1FK9A

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
536
structure length
519
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAITKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 519
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fk9A05
1CZ9A 4CJFA 4JRQA 4IKFA 1HJRA 4GC7A 2ATQA 1C0TA 1ZBHA 4C8KA 4Y2CA 2I5JB 1N48A 4IG3B 4H4OA 4Z4CA 3AVJA 1HRHA 4ZHRB 4Y34A 2BR0A 4IRDA 1NNDA 2XC9A 1LAWA 1CSJA 3V6HA 5KT3A 3KNAA 3HT3A 3DRRB 4NLOA 1QE1A 3LP1B 3H2LA 3K59A 3M8RA 1S6QB 1RA6A 3IG1B 1JLGA 4Z0UA 1W0HA 1KFSA 4H4MA 3KK2B 4IOBA 1DTTB 4RW7A 1T03A 4J9QA 4ED1A 2WHOA 4JS4A 3L2VA 2V0NA 3H59A 2B4JA 2FVCA 3OYKA 4NLWA 3C6TA 3HL8A 1G15A 3G86A 1VK0A 2WRMA 1S4FA 4M3YA 1N5YA 3O3FA 5T14A 2XHBA 5KTQA 2ASJA 1S0OA 5F8JA 5KRSA 1JLEB 2DFHA 1S1VA 1X9MA 1LWCB 3KLIA 4MQ3A 3TR8A 2HHUA 3TI0A 4FYDA 4RW9B 4KREA 1IG9A 3PX4A 1QSLA 2IGIA 1BQNA 4WFZA 1S97A 3OYEA 5KFYA 4E19A 4RW8A 3SFUA 3KLFA 1HPZA 2G8IA 4DFKA 4FZYA 3NMAA 1L3TA 1IKYA 3RBEA 4K4UA 3O3HA 1D0EA 3QESA 3TABA 1EETB 1RDDA 2F8EX 3AVCA 3LWMA 1I3AA 5J2NB 3DLHA 1HNIA 1LAVA 2KW4A 2UVVA 2FBVA 3OYBA 4CEBA 2YKMB 2F96A 1JLFB 4CJUA 3OYLA 4CJ5A 4OKJA 4K4YA 3SQ1A 5KFMA 3O3GA 2XGPA 1S9FA 3OHAA 4TQRA 1WAJA 1NJZA 4H4OB 1S1TB 2HWIA 2EX3A 2GIRA 3DLRA 3FFIA 3VA3A 1ZBIA 1BIUA 3FQLA 1Z26A 4E7KA 3AO2A 3ITHA 1ZBFA 3T3FA 2VG5B 4HCBA 4Q43A 2B43A 1QE1B 3V9SA 3H08A 4KFBA 2G8UA 1UA1A 5F8GA 3RAXA 4DEZA 3NAHA 1EP4A 4JV0A 1SL2A 3MEEA 4CJTA 4RW7B 1T03B 3Q8QB 4O4GA 3SUPA 1NK6A 2R7YA 5KFXA 3LP2A 4O0JA 4KB7A 4N56A 3CJ0A 1WNSA 4HYKA 3HP6A 4KV8A 5JS1A 4LSNA 1VSKA 1TKDA 4MK8A 3HM9A 4B3OB 4ID5A 1NK8A 5EDWA 3RMCA 4J2DA 3G10A 2YNGB 5KFSA 1S1VB 3PX6A 1RBVA 3CG7A 5KI6A 2FLLA 4CESA 3I5AA 2V4RA 1C1CB 3CDEA 4CJ4A 3RR8A 2KTQA 4DTSA 3KTQA 1VRUA 4DMNA 3HKWA 1RDBA 3IGNA 1NK7A 1BQNB 2HHTA 1RT2A 4IRKA 4ECUA 4RW8B 5L9XA 4EP4A 4AHSA 4B9MA 4ZP9A 4ICLA 2OPRA 4RG8A 4CEFA 3KJVA 4JRPA 3SV4A 3V6JA 5F9NA 1Y97A 3ULDA 1NK0A 4JV2A 2HB5A 3NBPA 5KT6A 1RAJA 4FLWA 1QSSA 1S9GA 4MKBA 3EZ5A 5HROA 4LQ3A 2RN2A 3TAEA 1S1XB 2ETJA 4ZPDA 2E9ZA 3OL6A 3BSNA 3MEGA 4DL7A 4ZPBA 5DLGA 2VA2A 4FS2A 2XI2A 1ZBLA 4IH7A 5DGAA 1EXQA 1U49A 4W5RA 3V6KA 3FFIB 1J5OA 4DQSA 2XRIA 2ALZA 3ITHB 3C94A 5KG3A 1WNEA 4CJPA 4JS5A 5F8NA 2ZD1A 4RNHA 4WXWA 1TGOA 1F21A 4KFBB 3CWJA 1QS4A 4HVJA 4JLHA 1MU2B 3M8PA 1NKCA 3ZSQA 4FJKA 1EP4B 5HBMA 2YHBA 3SPZA 3MEEB 1BCMA 3BGRB 5J2PB 3RB4A 3HK2A 4O4GB 3MR2A 2KFNA 4F4ZA 4DTMA 1D9DA 4CEDA 1X9SA 4TSXA 2KQ2A 1TK8A 4HUEA 3GIIA 1VSIA 3V9WA 1FKPA 3M9OB 2PYJA 3L2RA 1TV6A 2JGUA 3DLEA 4CJWA 2B6AB 2BANB 1U45A 4ID5B 5L1LA 1KVCA 1RA7A 2IM3A 4DL3A 5F8IA 5HP1B 1TL1A 4FJMA 2B5JA 5EWGA 3D5MA 3OYDA 3LPTA 4ECWA 5KFWA 3PV8A 4DFMA 1WSFA 4E7JA 3KK3B 1SV5A 1RTDB 2RKIB 3QIOA 2GC8A 4R5PA 4DTJA 3WNGA 2W9CA 4FJLA 1TKZA 4CF9A 5C24A 4M3UA 3DI6A 2OPRB 4NLGA 1NHVA 4Y1CA 1QSYA 2IOCA 3K57A 4TXSA 2FVRA 4O3NA 2C2RA 5DGBA 4K4XA 3FDSA 3PR4A 5I3UA 3H4DA 3NL0A 1HMVA 4NLQA 2XY7A 3NBPB 4PY5A 3TAPA 2HHWA 3RB3A 2HVHA 5HROB 3ZSXA 2A1SA 3U6FA 3NGZA 5DLFA 1Z4UA 4PA1A 2P5GA 4O3SA 3MEGB 4Y1DA 4C8NA 4LQ9A 3RAQA 2WCXA 4E1NA 2O4GA 5JUMA 1RT1A 3UQSA 4I2PA 1J5OB 1NHUA 4CGIA 2KFZA 1XWLA 1C1AA 4B9VA 1FK9B 3PW0A 5KFPA 1VSDA 3KK1A 3OSNA 1RT3B 1XR7A 3QO9A 3VQQA 3JYTB 4F3OA 2GIQA 2Z1JA 4M42A 5KT2A 4BE1A 2D0AA 2JEGA 2X74A 3VQ7A 2O5DA 5E41A 4TY9A 4H54A 3M8PB 5KG7A 2W7PA 2HNZB 3QEXA 4ELUA 1FKOB 4IH6A 2HNDA 2YKNA 3KIOA 3NF6A 4HHTA 3V9UA 3ZT3A 2DPJA 1RBTA 2HW3A 1FKPB 4DG1A 1SL0A 4LY7A 4DSFA 2XY8A 3DLEB 3KLHB 3OL8A 4KHMA 2W7OA 1ITGA 1UWBB 2JC1A 3AO1A 3KKRA 1XHXA 5C42A 2IC3A 4O3QA 3EPGA 3WNHA 5KFGA 5DG8A 1TL1B 3PUFA 5DG7A 4WFYA 4CHNA 4DTUA 3QYYA 1U04A 4MFBB 1KHVA 3KMSA 5D3GB 3PO4A 5CZ2A 4TN2A 4K4VA 5C24B 4O3RA 3DI6B 4IFVA 3QIPA 1IKWA 5J2QA 1NK5A 2D5RA 4MK7A 4DF4A 3TARA 1S1WB 1RBUA 4NLXA 4W5TA 4WYLA 5I3UB 5KFLA 4M3TA 1C0MA 1SUQB 4FS1A 3RMDA 4IRCA 1VSEA 3LANA 4O3PA 3BQ0A 1S6PB 1WAFA 3H4BA 2UVUA 2CKWA 2PYLA 3QEIA 1JXEA 2R8KA 3NGDA 3GV5B 4ZP6A 2AQ4A 4FLUA 4CEQA 4CGGA 4FLZA 4CIEA 3MAQA 1RT1B 5K14A 1LWFA 4I2PB 2Z1GA 2R8IA 4NLPA 4DL4A 3QERA 1TKXA 2HNYA 4NYFA 2XI3A 3QO9B 3KHLA 5KFHA 4IG0A 3OL9A 2EHGA 3KLVA 3F9KA 2PY5A 3MEDB 2OPSB 3SI6A 3DLGB 5KFBA 3IRXA 4Z4GA 4N76A 3VQ8A 4ED3A 3BSCA 4I7FB 4YP3A 5J1EA 4O55A 3AVGA 1RT7A 2UUWA 3AV9A 1D8YA 2QKBA 1ZBUA 3SUOA 1WSIA 2E9RX 1J9AA 3DOKB 2ZQBA 2R8JA 3HPHA 1C2PA 4NYNA 3HO1A 1I6JA 3HJFA 4DL5A 3V1OA 4O4RA 3V6DB 1C1BB 4ZPCA 3S9HA 1U48A 1CXQA 2ASDA 5DK5A 4NLSA 3E51A 2IC3B 3QLHA 1HYSA 1WSJA 3TQ1A 2VG7A 2P51A 1HQUA 1K6YA 1Z25A 4J9MA 2XO7A 2LSNA 3HSTB 3I8DA 2FVSA 4YR3A 1CLQA 1T3NA 2BQRA 3KLGA 3JSMA 4FLXA 4CJLA 1ZETA 1ZTTA 2WB4A 3VQEA 4Z4EA 3BSOA 1QHTA 4K4SA 1LW2B 1IKVA 3OYNA 4Q44A 3HVRA 3QIPB 2JEIA 3AVIA 5I42A 4LH5A 2D0CA 2IJNA 4TYAA 4ZVFA 4BDYA 3ASMA 3HVWA 5FROA 3OJUA 4IH5A 5KFUA 1REVA 1LW0B 3TWHA 4K4TA 1S48A 4WZQA 3Q8PB 3RB0A 4H8KA 3VQ5A 4N47A 1RILA 3NHGA 1BQMA 3V81B 2FBTA 4FJ5A 3SUQA 4OJRA 3ICLA 2IM0A 3L8BA 1W25A 4Y2AA 3PO5A 4AHUA 4KHQA 5K14B 3GQCA 4FJ7A 3QZ7A 5EU7A 3SJJA 2YNIB 2BQ3A 3Q8RB 2HNYB 4YNQA 4AHRA 2AX0A 1VSHA 4RNNA 3ZSWA 2ZE2A 1VSMA 5J2MA 3AO3A 1YT3A 3TAMA 4KSEB 2ZKUA 4WE1A 3MR6A 2V4QA 4CECA 3CO9A 4ZVHA 4PQUB 3L3VA 4DTNA 1KVAA 4QWCA 4KKOB 4O0IA 2Y1JA 4I9QA 1TK5A 3DRPB 3GV8B 3SFGA 1RT7B 3QGGA 4O44B 4ECRA 4CEZA 2BE2B 2WOMB 4CGFA 2W9AA 3M8QB 3RMBA 4RW6B 4U6PA 4F50A 4LSLA 3CJ4A 4B8CA 1A5VA 4KHWA 3MF5A 2AU0A 4ZP7A 4KI6A 3DMJA 4KO0A 3CVKA 3D28A 3MTKA 4MKAA 4ZP8A 4DSIA 4B9UA 1C0UA 1TVRA 4I2QB 4DQQA 3I5CA 1HNVA 2J6UA 3NFAA 1QAJA 4CE9A 1RTIB 1L5UA 3QLHB 4KHNA 3OYIA 1KTQA 4DSEA 1VSJA 4ZPAA 1S0MA 1L3SA 1C0TB 3K5LA 5KFFA 4DS4A 4CF8A 4M3XA 4KAZA 3KLEA 3JSMB 2EC0A 4TY8A 3HPOA 4HKQA 3QEPA 4CFAA 4KHYA 3LALA 1SKSA 3SYZA 4RUCA 5I42B 1NKEA 4M94A 2R2TA 4F8RA 2C28A 1JLGB 2GUIA 3KKSA 4H4MB 3VQ6A 4FM0A 1OS5A 4CEOA 4CERA 4FLYA 2AJQA 1RYRA 3UPFA 1ASVA 4CK2A 2OZMA 3OYMA 3C6TB 3H5UA 2NUBA 4OL8A 4K50A 1KLMA 3T1AA 4YQWA 2FVQA 3I0SA 4K8ZA 1N5YB 3DRSA 4J9PA 1LWEA 3LAMA 2ITGA 4CIFA 2IM2A 1B9FA 1SKWA 4EBEA 4CEEA 2ASLA 4EBCA 3UDLA 3MXIA 2W42A 2BGGA 4O5BA 2ZE2B 2IAJA 3F73A 1SKRA 3KLIB 4ECYA 4WE1B 4RW4A 3L3UA 4ED6A 1XR6A 4FVMA 1NOYA 4O3OA 3RMAA 3PVXA 3LWLA 2YNFA 4J9LA 3MECA 3KLFB 3VQDA 4KBIA 1HPZB 3TAFA 3OYFA 5KFCA 3OYCA 1BGXT 2W8KA 4FCYA 1IKYB 2Q3SA 4KB0A 1RT6A 5DQGA 2HAIA 3H98A 4RNFA 1RTJA 4NCAA 3A2FA 1HNIB 3NF9A 1C0UB 1TVRB 1JLCA 2OPQA 5KFOA 1HNVB 4ZVEA 4J9OA 4PUOA 1GOCA 3AA3A 2QV6A 2UUTA 1VSFA 4KPYA 1S1UA 2IA6A 3MXJA 2O4IA 3S3OA 1X1PA 5EUHA 4MIAA 3KHGA 4Q0BA 1RT4A 2G8WA 4OPKA 1HQEA 4E7HA 3SV3A 3NH0A 2G8FA 3IAYA 4KE5A 5JXSA 3LPUA 3I0RA 4NZ0A 3VQ9A 4NRTA 3BR9A 1T8EA 4FBTA 4IBNA 4NLDA 4C8MA 1WSGA 2VA3A 4B8AB 4CIGA 1DLOA 4FK0A 3TVKA 4FW2A 3M9MB 3LP2B 4K4ZA 4DSJA 3RRHA 3BSAA 4CFBA 3AA5X 4FLVA 3S3MA 2BDPA 4Z4IA 4KAIA 4KV8B 3DM2A 1T05A 2X6SA 3QNOA 1N6QA 4DL2A 4LSNB 3I0SB 5KT5A 4EO6A 4AILC 4Z4HA 2ATLA 3BREA 1R0AA 4ZVGA 2XY6A 3MFIA 4CHQA 4BE0A 1Q8IA 1NK9A 1S9EA 4IR1A 3KHHA 3MR5A 3B6OA 4I9LA 3BDPA 1S49A 1BL3A 4M95A 4RW4B 3C6UA 1L3UA 5DMRA 5KGWA 1VRUB 3D45A 4L8RB 3AVMA 4GW6A 4M3RA 3ZSOA 4RNMA 1RT2B 2YNFB 2IM1A 1JLQA 3OYGA 4ICLB 4DU4A 3SPYA 3KJVB 1RTHA 3CJ3A 1JLAA 4ID1A 3QEVA 5CYMA 3AA4A 4E89A 2OPQB 1S9GB 2FC0A 2GBZA 5KRTA 2OYQA 4M3ZA 3CM5A 4AHCA 4CJVA 3V1RA 2G8KA 2QE5A 4NRUA 3SCXA 4WXOA 1SH2A 3DOLA 1KSPA 3AO4A 3CM6A 4DF8A 3FRZA 4CF0A 4C8OA 5KG5A 3TAGA 4EO8A 4J9KA 2DFFA 3V4IA 4FK2A 1TKTA 2YNHA 3HP9A 5F8MA 1RT5A 5DQHA 3ZSRA 1NOZA 4KTWA 1WLJA 4YR2A 2XCAA 4FJHA 2ZD1B 3DYAA 3FQKA 4F4YA 1U09A 3LAKA 4QW9A 5EWFA 2R8HA 4R8UA 5HBMB 3KOAA 1B92A 4F4KA 3PW7A 3RR7A 4MIBA 3CYMA 4CK3A 1RDAA 5L1KA 1TL3A 4WYWA 1T7PA 3CJ5A 3CFRA 1VRTA 3KHRA 4IQXA 4TLRA 3ZSVA 3DM2B 1T05B 4DTOA 1YVUA 1N6QB 1GX5A 2DY4A 1TV6B 1SH3A 1JKHA 1R0AB 1JLBA 2RDJA 2R2SA 4ELTA 3SQ0A 3QGIA 3UR0A 2B5JB 4FM1A 3K5MA 4U7CA 5L1IA 3THVA 2VG6A 3S3NA 5HLFA 2I1RA 5C25A 1SV5B 4R5PB 4M41A 4KHRA 1JLQB 2W9CB 4AHVA 1TKZB 3RBDA 3VQSA 4M3WA 2HHVA 1RTHB 4Q8FA 4URSA 2I5JA 4TQSA 1GOAA 3MFHA 2G8VA 3AVFA 5CYMB 1KHWA 1HMVB 4CHYA 4ZHRA 1K1QA 3NDKA 1JX4A 3HVAA 2FJWA 4FLTA 2HMIA 1RCHA 2X6NA 4QWEA 1QTMA 3AVNA 3VQ4A 3DRRA 4WFXA 3OSPA 3LP1A 3U3GA 3WNEA 3NCIA 3DOLB 3IG1A 5KFZA 2WTFA 5FDLA 1TQLA 1B9DA 4DLEA 3KK2A 2BRKA 3QGHA 3V4IB 2JLEA 4M45A 1TKTB 2YNHB 1D1UA 3KK1B 4QWBA 5KFTA 4QAGA 3T5KA 3HYFA 4B9TA 2F8SA 5L1JA 2AGQA 2FBXA 3ALYA 1ZYQA 1S10A 3T19A 3GYNA 4QWDA 4EBDA 3OJSA 4ED0A 3LP3A 2HNDB 2YKNB 1EX4A 2D0BA 1MMLA 1TL3B 3OYAA 1GX6A 4FZZA 4LH4A 4XO0A 2QK9A 2ILYA 4EYHB 4G1QA 1UA0A 1D5AA 4DG1B 4RW9A 2KZZA 1TAQA 4F2SA 4IFYA 1JKHB 3H5YA 2DTUA 2W9BA 3PW2A 2VWKA 5KFJA 3PR5B 3NKYA 5C42B 3QZ8A 4ZTFA 3DLKA 3OYJA 3ZSYA 1XI1A 4J2EA 4HTUA 3I5BA 5EWEA 3M9NB 3CDUA 3QNNA 3AO5A 4JUZA 3RWUA 3OY9A 1QUVA 3OL7A 4DWIA 1XR5A 3OLAA 4ECXA 3RRGA 2YKMA 1JLFA 2AGOA 4DS5A 3NAIA 1NJXA 1TAUA 4KTZA 4XIUA 4IDKA 4IFVB 1IKWB 5J2QB 5HRSA 1KVBA 4NCBA 3HXMA 4OLAA 4MK9A 2VWJA 2JC0A 1S1TA 3EZUA 1ASWA 1WSEA 3VQPA 3GIKA 3WNFA 5KFKA 3AVAA 4OGCA 4Q8EA 2J6SA 4KTQA 4OVLA 3HVTA 4Z4FA 2HMIB 3ZSZA 4Q45A 4FJNA 2VG5A 3VQBA 3GV7B 4FJGA 4ZMMA 3AVHA 5FDLB 3SZ2A 3OS2A 4OGEA 2JEJA 4CF1A 1LWFB 1T94A 4J9NA 3SI8A 1TKXB 4NYZA 5KG6A 3LDSA 1KFDA 4J2AA 1YVFA 1YTAA 3CFOA 3NE6A 1QQCA 2FLNA 1K1SA 4NCGA 4IG0B 1DTQA 3T5JA 3TAQA 4W5NA 4N5SA 3IN5A 3DLBA 3IRXB 3OLBA 1IO2A 2BRLA 4JV1A 4IKAA 5J1EB 4B3OA 2IMWP 2UVWA 1JIHA 1RNHA 3LZJA 4XPEA 1UOCA 2WONA 2YNGA 1U4BA 3QINA 3RB6A 4G1QB 4NLRA 1C1CA 4B08A 2AX1A 3NH1A 3L2QA 5FRMA 5KFRA 3DDKA 1U47A 4IFYB 3H5SA 4GC6A 4TYBA 3O4QA 4GMJB 2W9BB 4DTRA 1LV5A 4PWDA 2Y1IA 4DL6A 4CCHA 2R8GA 3DLKB 4F4XA 1HYSB 2IDOA 3K2PA 2VG7B 3VQCA 4F2RA 1I39A 1HQUB 5F8LA 3CJ2A 4E7LA 3PZPA 5SZTA 3MR3A 4FM2A 4YR0A 4CGDA 3KLGB 3GIMA 1XC9A 3ZT1A 4CGHA 3UIQA 3G6XA 2E6MA 1HYVA 1S1XA 3QIDA 2WK4A 1IKVB 5SWMA 3B6PA 4E7IA 4ECTA 4IDKB 3H40A 1IKXA 4C8LA 2XGQA 2FBYA 4QCLA 3CFPA 1BHLA 4R0EA 5KFIA 3GIJA 3LZIA 1REVB 1N56A 2GV9A 4CJQA 3HVTB 3RTVA 1TP7A 1BQMB 1ZTWA 3G6VA 1MU2A 1Q9YA 4Q5VA 4BWMA 3T5LA 3BGRA 3G0ZA 4BDPA 4KB1A 2OZSA 5J2PA 3CDWA 1WN7A 4BDZA 2OA8A 4KHSA 1BISA 3OHBA 4HCCA 1NK4A 4NCGB 1DTQB 5J2MB 2ILZA 4J9RA 1JXBA 4W5OA 3TAMB 4K4WA 5KFQA 4EZ9A 2XCPA 3ISNC 2IBKA 2B6AA 2BANA 4CJRA 2FJVA 4E1MA 5HP1A 2CJQA 2WONB 4ELVA 4F3TA 3SQ2A 4DLGA 4LSLB 3NGIA 2D7SA 3PY8A 3CIZA 4FZXC 4CJSA 1SL1A 3VQAA 3DMJB 4KO0B 1SH0A 3PX0A 4FJIA 3KK3A 1RTDA 1W9HA 5CY4A 5KG0A 4DFJA 2RKIA 4CFCA 5C5JA 2Z1HA 1A5XA 4PWDB 3EY1A 4CHZA 4DQRA 1BIZA 1FXXA 2RF2A 1XHZA 1YTUA 2F8TA 1WSHA 4AHTA 4XPCA 3P83D 5FRNA 2HHQA 4URQU 3PW4A 5KG4A 3KLEB 3C95A 2V9WA 2C2EA 4CHPA 4TY8B 2HHSA 4CJEA 1ASUA 4FJXA 4LD0A 1RYSA 1BI4A 1C6VA 4QPXA 4FBUA 1IKXB 3N6MA 4RZRA 3EYZA 4B9LA 4CHOA 3ZT4A 4UQGA 4QWAA 1HARA 4NLTA 2P1JA 3IS9A 4EP5A 1FK9A 4F4WA 4OPJA 4MH8A 5DQIA 4X2BA 4OLBA 1RT3A 4Y3CA 3L2WA 3JYTA 1IM4A 2RPIA 3G6YA 1A5WA 2QKKA 3ZT2A 4G3IA 4W5QA 4ECQA 1GOBA 3K5NA 4HUFA 1BCOA 1KLMB 4AH9A 1RBSA 5KFAA 3BQ2A 3NAEA 2HNZA 1FKOA 2C22A 4E0DA 3DRSB 1VSLA 1RDCA 1LWEB 2XWYA 4E3SA 2AGPA 2RDIA 3IGVA 1N4LA 2X78A 2IAJB 3M8SA 1IH7A 4DTXA 1X9WA 4FW1A 3EPIA 5KG1A 4KRFA 5KFNA 1KCFA 5HRRA 3KLHA 1S5JA 3E01A 1UWBA 4HUGA 1CZBA 3MECB 2OPPA 3PW5A 4EZ6A 5KFEA 4ED2A 5KT7A 3AVLA 2BQUA 1RT6B 3FSIA 1NKBA 1KRPA 2YHAA 4MFBA 3AVBA 1RTJB 2J6TA 5D3GA 1JLCB 4QW8A 2KZMA 4PUOB 4CJKA 2RF2B 3SUNA 4NLUA 4DQIA 2E9TA 1S1UB 2JEFA 2IJFA 5CYQA 4OKKA 1S1WA 4DU3A 4B9NA 1J53A 4Q0BB 3KD5E 3AA2A 1RT4B 1SUQA 3HPGA 1HQEB 3NF7A 5KGXA 4DQPA 5F8HA 4CGJA 3ISND 3V1QA 1O1WA 3I0RB 1S6PA 4ED8A 3NGYA 1BI4B 3NF8A 4J9SA 3PJXA 3VN5A 4FJ8A 2D3ZA 4K8XA 2UVRA 1KLNA 4RUAA 1Q9XA 2OH2A 3IS9B 2IS3A 3OYHA 1NJYA 3LP0A 3U3YA 3GILA 3MXMA 4B9SA 1RBRA 3L2UA 1DLOB 4CK1A 3NH2A 4NLVA 5CZ1A 1JL1A 3QEWA 3MEDA 2OPSA 3DLGA 2E6LA 2R2UA 2C2DA 4I7FA 2DPIA 1RDRA 5KFVA 5KFDA 1HYZA 2HVIA 1TK0A 2A1RA 1L3VA 4YMEA 1J54A 3SNNA 4YFUA 1S9EB 3DOKA 1UAXA 3HHKA 4DFPA 3C6UB 3N6LA 4GVMA 3K58A 3QETA 3V6DA 1C1BA 3K5OA 3E01B 4EEYA 4DSKA 2XY5A 2OPPB 5DG9A 5KG2A 4URGA 4OKEA 2D41A 3BJYA 1JXLA 5JS2A 3T5HA 4DU1A 1NJWA 3AVKA 1JLAB 2E4LA 3OS0A 5T7BA 3V9XA 3V9ZA 4IG3A 3OS1A 4FJ9A 4ED7A 4CFDA 4NLYA 4EYIB 1LW2A 4WZMA 3N6NA 1S0NA 4CEAA 2Z1IA 5CYQB 2W8LA 4BACA 5KT4A 1S6QA 2QXFA 3D0PA 1LW0A 3P5JA 2P5OA 3KMQA 4CF2A 1DTTA 2HHXA 4KI4A 4RNOA 2FLPA 1D9FA 4IR9A 1RT5B 4QOZB 3PHEA 2FJXA 3V81A 5HRPA 4BWJA 4KHUA 2FVPA 4FXDA 3ZCMA 4ZTJA 3DYAB 4RU9A 1JL2A 2YV0X 4R8UB 3LP0B 1QAIA 4J2BA 2YNIA 3BQ1A 2G8HA 1JLEA 1LWCA 1VRTB 2R2RA 3ZT0A 4PQUA 4FJJA 2DFEA 2PZSA 4FK4A 4KKOA 3H5XA 4ECZA 3DRPA 4ECVA 2D3UA 3OVNA 2HWHA 1JLBB 4O44A 2BE2A 2WOMA 5F9LA 3Q8SB 3M8QA 4DSLA 4N41A 3VA0A 3TANA 4RW6A 5HRNA 3CQ8A 4DTPA 2VG6B 1EETA 4CJ3A 3P1GA 4BE2A 5HLFB 3O4NA 1EKEA 5J2NA 1CXUA 5C25B 4ECSA 4I2QA 2AWZA 3SQ4A 3KD1E 1RTIA 3PJWA
chains in the Genus database with same CATH superfamily
4C3MA 5KOXA 1C0TA 3HHLB 4Y2CA 1WELA 1XMQJ 2Q6CA 1MWKA 4Z4CA 2HBQB 1I3OB 3CJ1A 3AVJA 1HRHA 1WHYA 2BR0A 4UOHA 1IBLK 4WK3A 3BF3A 2ZJRL 3E2EA 1S4EA 5GAHI 2FF3B 1NPPA 1LAWA 1CSJA 1FW6A 3VOVA 3V6HA 2IDLA 1UZDA 1QE1A 2UUCF 3K59A 5K8NA 3M8RA 1NLVA 3EUNA 1RA6A 5CE3A 3R1LA 4JI8K 1W0HA 4H4MA 3KK2B 4AFFA 2W6KA 4IOBA 4GV9A 3BM7A 2ZNYA 1T03A 5C2CA 4J9QA 4DR4J 2V0NA 3H59A 2FVCA 3O3LA 4ES3A 1UJ4A 3LOUA 4Y65A 4NLWA 2O66A 2EG1A 3UR3C 2G0CA 1VK0A 1S4FA 2D4WA 3PYGA 4FVUA 1N5YA 5T14A 1F2GA 3DC2A 2EKNA 3Q8YA 1TTHB 1FXDA 3GPAA 5F8JA 2W6LA 1JLEB 2ZM6K 1B0PA 4YOXA 1X9MA 4BR0A 1QVFR 2I8EA 1LWCB 3G2XA 2YI1A 2HHUA 3OR1B 1FTCA 4HTJA 2VQEK 3FCHA 2YH0A 3PX4A 2OTLN 3FCWA 4MJKA 3EEQA 3FEZA 1QSLA 2IGIA 2AYMA 3KK7A 3IMQJ 3KLFA 2CWKA 1RWVB 3AD7C 1NZ8A 3G8QA 3J80O 1RDDA 3AVCA 1LAVA 2UVVA 2FBVA 3OYBA 1RWXB 1FJEB 1YJVA 3T7ZA 4NI2B 2F96A 1NRKA 3ENWA 1VQ7N 1UVJA 2GTDA 4K4YA 1U1RA 2AIRB 3FCVA 3QBCA 1KQFB 2XGPA 3TSQA 3QJJA 1HBNB 2GJIA 2EX3A 5ETQA 2ASMA 2EC2A 2VASA 4E7KA 1ZBFA 4C1NI 5B09A 3FEYB 2HQGA 1DRZA 5EXWA 3THXA 3V9SA 2QIFA 3AAQA 4KFBA 4DEZA 1ZM9A 1FJCA 5LJWA 1UW9A 4JV0A 3HSJA 3MEEA 1KD1T 3Q8QB 4NXNJ 2B3TB 3SUPA 5E3QA 1NK6A 2O8DA 2R7YA 1T6DA 3BF1A 2J9DE 2MGZB 1WNSA 1SI9A 4ZITA 3DJCA 1GEHA 1MROA 3T1YF 2AEJA 1T0TV 2L9DA 2LXFA 2ZDOA 2VYPA 2PO4A 1P8GA 1VHXA 1VGYA 3I56S 3C2PA 4LF4J 3UO0A 1VC5A 5EDWA 3RMCA 4A59A 2YNGB 1VHFA 2ZH2A 2QLWA 1ZS6A 5KFSA 5IWAK 2KG1A 5AE2A 2FLLA 5GAGI 4CESA 3CDEA 3RR8A 3CC4S 1XMBA 4DTSA 2QC3A 2CDQA 3X3UA 3GG4A 1V5IB 2VD3A 2L9WA 3NEKA 2DVIA 3PIOL 4ICLA 4DV2K 3KJVA 4JRPA 3V6JA 4JI4J 2AA4A 2P9SB 1UFLA 1MMDA 4AQYK 1NK0A 3H46O 3NG8A 5KT6A 2H5JB 4DZDA 3M8YA 4MKBA 4GVBB 2RN2A 5ADXH 2E1YA 4LF5K 2P9UB 2GW8A 4ZPBA 3OUYA 2VA2A 2I0XA 1XMOK 4FS2A 3TUPA 4IH7A 3LGHA 1U49A 4W5RA 3W62A 3OXFA 4LT6A 4ISGA 3WT0A 5JLHA 3BPDA 3ITHB 4JI3J 1N33F 4JS5A 5A8RA 2MQQA 1F21A 4HR2A 3CCVS 2AF6A 2UXDF 3M8PA 1NKCA 2CNKB 1E6VB 1EP4B 3W1YC 1BCMA 4WIQA 5J2PB 3HK2A 4O4GB 4F4ZA 1D9DA 4WFAQ 4CEDA 1GLDG 2H9ZA 2KQ2A 1TK8A 1Q79A 3IRWP 4HUEA 4WP9A 5K5MA 1H6KX 3L2RA 3EX7B 4OX8A 1PAEX 3PYDA 1OIAA 4K41A 2Q66A 5L1LA 3MM6B 1BO5O 2BBEA 5HP1B 1Q18A 4CI6A 1TL1A 4FJMA 4QIWD 3D5MA 3LPTA 4ECWA 2F8HA 2DD8S 1M5OC 3ZO7A 2JWNA 2VQFF 1NDLA 1SV5A 1RTDB 2RKIB 2G9OA 4CZIA 4FJLA 4BVOA 4ZVSB 4FPAA 4M3UA 3DI6A 4XTTA 3LO3A 1EQYA 2FVRA 3PIPQ 3U9DA 3KWGA 3CMAN 1VI7A 1OY8A 3RB3A 5HROB 2NSBA 3NGZA 4Q2LA 2K2PA 1HNWK 2V5HG 3H20A 4C8NA 2YJFA 2UP1A 2DNLA 1W97L 1T9UA 2FHJA 3FZKA 5JUMA 3KWMA 1RT1A 3UQSA 3JSBA 1J5OB 5I4MA 2KFZA 1XWLA 1YI2S 2XHCA 2VPYB 4CTAB 2G0JA 1XR7A 3QO9A 3JYTB 2KYZA 1HBMA 1BA0A 3DGPA 3ZZRA 3W2VB 2O3DA 5KG7A 4X66K 2HNZB 1UJ6A 4A8OA 2HNDA 2DY9A 3KIOA 2F5GA 3NF6A 4HHTA 2OUGA 3CT9A 4WU2A 2DPJA 4JI5K 4CT8A 1FKPB 3HSZA 3BYRA 3QFPA 4L3KA 3UDEA 2EFPA 4WTOB 4JAXA 3OL8A 4KHMA 1XN9A 1R31A 3TA2A 2W7OA 1ITGA 2JC1A 2DHHA 1XNRF 5KFGA 1EARA 2HBKA 3OR2B 4WFYA 4CHNA 4MO5A 2LEBA 1P6TA 1U04A 1XC3A 3Q8VA 2FSNA 4MFBB 2G13A 1KHVA 4C6AA 4CZMA 3W2WB 1VIXA 4I6YA 1SJ1A 5IT4A 4GV6A 2P9GA 4OHZA 1QQOA 5C24B 3C6HA 4IFVA 1X3MA 3G6EN 2GUPA 2W2MP 3R9PA 1BXNA 4R79A 2E2PA 1UJ5A 4IYQA 3QQCD 5I3UB 3A8JA 4JKGA 2KYXA 1R59O 3BQ0A 2IHR1 2QMUB 4YY3K 1WAFA 1ZM2A 4YORA 3GV5B 3WXMB 2ZJRQ 2AQ4A 4FLUA 4H0TB 4CIEA 4YOUA 1EZZB 1WC6A 2RH3A 4NLPA 4DL4A 2F9JA 3EVWA 1TKXA 3P38A 1C4AA 1HR0J 5J1PA 4IG0A 3DLJA 2EHGA 3AOAA 3SI6A 4X4OA 2RRBA 2GQCA 3DXMA 3EGNA 1JQGA 2XS5A 2V69A 1L3KA 3DN9A 3HSCA 3SUOA 5DS7A 2RQMA 2KM8C 3HPHA 5ETTA 4CBUA 2UUBK 1I51B 4HWIA 4DL5A 3NGRA 1CG2A 2DNPA 3S9HA 1UEUA 2ASDA 3UN2A 4EGLA 2VGNA 3QLHA 2BACA 5MAOA 2K8GA 4ES2A 1DKGD 2XO7A 2E5LJ 2FVSA 4LIWA 2BQRA 4M7XA 2X3DA 5HVFA 3BSOA 3H42A 1QHTA 2LU2A 1X4FA 2HGLA 3AT1B 1IKVA 4DX8H 3FSYA 1FX4A 3QIPB 4Q44A 3HVRA 5I42A 2D0CA 4TYAA 4ZVFA 2LQ8A 3ASMA 1LNQA 1UETA 5FROA 1YRUA 2G1HA 4IH5A 3A1YG 3P45B 2FHMA 4QU6A 3LM9A 4I6WA 5AZJB 4FNHA 3J81U 3H7HB 3NHGA 1BQMA 1Y3JA 1EX8A 4QIGA 3MN6A 3ICLA 2IM0A 2D3O1 2C3UA 1U0HB 4AHUA 4KHQA 3NVKA 5K14B 2CJXB 2EWHA 3QZ7A 5EU7A 3QFUA 3Q8RB 4YNQA 1IBCB 2EVZA 3AAWB 2L41A 2ZE2A 5J2MA 3AO3A 2OTLS 1QTNB 2WC9A 1LXNA 3L3VA 5BRHA 1TK5A 1HHTP 4QZVB 3J7AN 3QGGA 4XDCA 5AQOA 3M8QB 2YWWA 5LMNF 4U6PA 4LSLA 3T41A 1Y5LB 4KHWA 3MF5A 2AU0A 5DDRC 1GLCG 2DNYA 1XERA 4O5FA 4KO0A 3K17A 4ZP8A 3W3SA 4DSIA 3MMBB 1WSVA 4UF4A 1E6YB 1QAJA 3UCGA 1RTIB 1TFWA 4P2SA 5GADU 1WSRA 1CJUA 3OTOJ 4G65A 2QT7A 2QTWA 3K5LA 2DNMA 3CE8A 4LVNP 5KFFA 4DS4A 3PIOQ 1MSWD 5H9EJ 3PFOA 4M3XA 2CNOB 2BZ2A 3JSMB 1ZAVA 4TY8A 1ESVA 4CFAA 4RUCA 4DR5J 4M94A 3NNCA 4FVCA 4EK2A 2X1AA 2CQ0A 3ENBA 2UU9J 1JLGB 1Q16B 2KO1A 2MDAA 3VQ6A 3HZGA 2V68A 3AD9C 2AJQA 1RYRA 4RX6A 2UXBF 2OZMA 4PL7A 3H5UA 4LF1A 2ZWPA 1KLMA 1WWHA 2WVCA 4YQWA 2XNQA 4J9PA 4KHPK 4DR2K 2IM2A 4DMZA 1U6ZA 1SKWA 2P9IB 4F25A 5B0AA 4EBCA 4DQ8A 3UDLA 3IA0A 2BGGA 3DXSX 5HVHA 2MZ1A 3Q89A 1GLJO 1YWXA 4RW4A 4ED6A 3FBBA 4YUDA 2ZF5O 4FVMA 2E44A 4IJAA 4O3OA 1R8BA 3Q83A 2YNFA 3TAFA 3RGIA 1HPZB 5KFCA 2LA4A 2EG2A 2HRYA 2W8KA 1Q0NA 1G3OA 1K0TA 2QWMA 4FWRA 1OPIA 3H98A 4RNFA 2W2PP 1HNIB 3AHPA 3NF9A 5AQQA 1HNVB 4L72B 3GFHA 4PUOA 4OLOA 3TZZA 1RABB 4LFBF 2CGJA 5LMUF 2IA6A 2CIMA 1LQ9A 2O8CB 5HJYA 1KBRA 1RHKB 5EUHA 3QNWB 3M32B 4MIAA 4DV3F 3TQEA 4X4RA 4CIOA 4I68A 1HQEA 4E7HA 4A62A 3AD8C 1PJ7A 3JQKA 1NSQA 5AQIA 3DDIA 3LDNA 3BR9A 2M8HA 1HI1A 4G1PA 2PI4A 2J76E 1DLOA 2PA3A 5LJ5Y 2E2OA 3BSAA 4V19J 1S59A 2K3KA 1V9OA 4KV8B 1T05A 4B3SF 1N6QA 4L6V3 1Y4ZB 2X1BA 4YN3B 4NE9C 2OHDA 2ZVSA 5IT0A 3TYTA 3BREA 3KXDA 5HQLA 1HD1A 4LIRA 3THTA 3B6OA 3K8WA 1BL3A 4M95A 3C6UA 1L3UA 3ENVA 1VRQC 4GW6A 5IC6B 2RUGA 3ZSOA 4RNMA 1YJ9N 2RT3A 1RT2B 1JLQA 3A13A 3EJMA 1DQ8A 2BKNA 5L39A 3CQYA 4WYBA 2QWPA 4DU4A 1Z6RA 3QJLA 1RTHA 1FKAF 2R7WA 1U25A 1ZA1B 2GMLA 4E89A 1CEZA 2FC0A 2GBZA 5KRTA 2HQ3A 1WG4A 4M5GA 2JRSA 2QWRA 1TFYA 5EX5A 4IEEA 3RU0A 3H2VE 3SCXA 2JWLA 4C8OA 4DHYA 3TAGA 4PPZA 5AQZA 4FK2A 4TU8A 4B1VA 5BN9A 3BO3A 2LEPA 5EVZA 3RAMA 3BGOP 1S0VA 2KT3A 4YR2A 4DI6A 4F4YA 4ISEA 2MSSA 2R8HA 1WC3A 3UW1A 2P9KA 3KOAA 2QA2A 4RBTA 4MIBA 3CYMA 4CK3A 2NNWA 4WYWA 3CDBA 1HPMA 1N8RO 3F44A 4IQXA 3ZSVA 3DM2B 1X4DA 4B02A 5MLCQ 4PL8A 5BYQA 1YVUA 3SQGB 1GX5A 2OD4A 4DV1F 3T1YK 4ENOA 2GHPA 2V8VA 1R0AB 2RDJA 3JAMY 2FHKA 1H2VZ 2MKSA 4FM1A 4U7CA 3THVA 1U02A 5GAGU 2EK1A 1TYQA 3PYFA 2CQ4A 3G6ES 1OPZA 3MD1A 4M41A 3HZEA 4KHRA 2W9CB 1TKZB 1FFGB 3MAAB 4DR1F 3VQSA 5M2UA 4M3WA 4J7CA 3U27A 3SBMA 3JAMU 4OHXA 4Q8FA 1W7WA 1KP6A 2I5JA 4PPDA 4JI2F 1MMNA 1GOAA 1HUXA 5DETA 2IRUA 4CRJA 4CHYA 4A47A 1RDWX 3J80U 1S5ZA 4LBIA 4JI6J 4CDIA 3SAFA 2X6NA 3MMAB 1IBKF 1KAZA 3MM7A 4WFXA 3HULA 3OSPA 4N77A 5I9EB 5FDLA 4KY3A 3PHTA 4DLEA 3THYB 2DH8A 3BGUA 4U7BA 2AHOB 2WBMA 2YPZA 4C0OC 2YNHB 1B0TA 3GLJA 1LXJA 3CCEN 2HAFA 3SDEA 4AUKA 3T5KA 1N33K 3D6RA 4IEIA 2YH1A 4LF9F 1H2TZ 2VBZA 5L1JA 3ALYA 1VS3A 3GYNA 3OJSA 3M3ZA 4MLEA 2GVZA 3LP3A 3L7PA 5LM7E 1YG0A 5BXIA 4DUYF 3ULEA 1Y3KA 1MMLA 3OYAA 3UKRB 3D3CJ 3A0IX 4LH4A 1VQMN 2QK9A 2ILYA 5J1NA 1XTZA 5CD4A 1AZSB 1CJKB 4RW9A 2UV8A 4F2SA 2DTUA 5GIPA 3F56A 3PW2A 2VWKA 3ULHA 3PR5B 3NKYA 5C42B 4XK8C 4ZTFA 2O8BB 2DXFA 3ZSYA 3D6TB 3CJCA 3VF0B 4FWOA 3OY9A 3OL7A 4DPTA 2VQFK 1FCAA 3RRGA 1JLFA 3EWGA 1T44A 3NAIA 5BR8F 3R6GB 2V67A 5J2QB 2RAQA 1EJ7L 4V1Ak 4OLAA 2IA0A 1SC3B 4K59A 3EL2A 2JC0A 1ASWA 3ZZYA 2M3DA 1WSEA 3VQPA 3T9ZA 1WHXA 2RU9A 5C12A 1H0HB 4OVLA 1K8AO 3AY9A 3OBWA 2V50A 4JKCA 4FJNA 2YX7A 1Y0HA 1K73O 2EEYA 4ZMMA 4X4VA 2YJEA 3O9SA 1R6YA 4OGEA 5AQNA 1KC8O 4CF1A 1LWFB 5JMNA 1B7YB 4J9NA 4NYZA 3LGMA 5KG6A 2AD9A 3LDSA 1J5EK 2XWXA 3CFOA 5K20B 1QQCA 3QPIA 4ZJQA 4K5RA 3MM8B 3L4QA 1DTQA 3T5JA 2HVZA 2QA1A 3IN5A 3MWBA 1IO2A 3QAUA 3G87A 2R7SA 3THPA 5J1EB 3DU6A 3VTHA 2UVWA 2IMWP 3TEGA 4Z2XA 3LZJA 1NSKL 4XPEA 1BC6A 1D9AA 5LOQA 4A5AA 4G1QB 1V4SA 4B08A 4B3RF 2ZBPA 3TX0A 3NNHA 3H5SA 4GC6A 3O9RA 3O4QA 3OFFA 4GV3A 4CCHA 2I6WA 4YB6A 4F4AA 1KVKA 3DLKB 2IDOA 2VG7B 4F2RA 2CNLB 3EVMA 3PKMA 2RHQB 2RQCA 4E7LA 5SZTA 4FM2A 3UDVA 4H5VA 5AJ3K 4OX9J 1R8CA 1QZ5A 3M30B 3UIQA 2NZTA 3G6XA 1N5VA 3QIDA 3FFKB 4IDKB 1X8DA 4C8LA 2XGQA 4MLHA 2FBYA 3G9CA 2R9LA 1F2HA 2E1MC 4ZS6A 4ATNA 1REVB 1QHAA 3S1TA 2DNKA 5D4PA 1XUPO 3HVTB 1TP7A 3EKUA 3G6VA 3CD6S 1MU2A 4KGXB 1JXVA 4DR6F 1HL6A 1JWWA 2OZSA 2OA8A 5CHCB 1BISA 3C7NB 3DXKB 2M52A 4HCCA 1N8RT 2Z2ZA 3OFGA 4DR4F 2DR7A 4NCGB 1OKJA 3UNGC 2DO4A 2ILZA 1JXBA 3TAMB 4K4WA 2MQMA 4EZ9A 2FY1A 4I1TA 1R43A 3BH6B 1SQKA 4Y6IA 2WONB 3AQOA 2VBXA 3J7A1 4DLGA 3NGIA 3PY8A 4HTLA 3CIZA 1NGEA 3B8AX 2HSTA 2AJ2A 1JMTA 1OO0B 5FLXY 3DMJB 1SH0A 3KK3A 5CY4A 1KQGB 1MA9B 4FP9A 2Y8WA 2DNNA 4PWDB 1GMWD 4CHZA 4DQRA 3JXUA 1FXXA 1YTUA 2YTCA 1P9QC 2X1GA 2F8TA 1WSHA 1YBUA 4QIVA 5B0EA 1CQNA 3A5LC 3C95A 1OY6A 2V9WA 4IOCL 1U26A 1RAFB 4DCPB 5FLXU 4JN4A 1ASUA 2KHOA 2KT2A 1NZAA 1YUWA 1E3MA 3D0GE 1IBMJ 3FNNA 4RZRA 4AM6A 4CHOA 2ZGZA 3ZT4A 4UQGA 4H4KC 4NLTA 5E2QA 4EP5A 2LKZA 1FK9A 4UQTA 2CUYA 4X2BA 4YHHJ 1BWFO 1BMQB 3G6YA 1YZ6A 4G3IA 2F9DA 1GOBA 2J9CA 4QYZJ 2QTDA 2JSXA 3HD1A 4AH9A 3TZYA 5BJRA 1Z2LA 1RDCA 1Q8BA 4E3SA 4YB7A 5BYSA 1HWJA 3O8WA 2NXNA 3M8SA 4Y00A 2HG4A 1X9WA 1IH7A 4DTXA 1YJ9S 1YRXA 1FFWB 2G4BA 3KLHA 1S5JA 3HF5A 1C0FA 2N3LA 1UWBA 4F0MA 1CZBA 4Y2IA 4IO8A 1M5KC 1KWMA 1N0VC 4LF4F 5KT7A 2M9KA 5LMNK 3IM9A 4DUZJ 4PQAA 1UPMB 1RTJB 4I64A 1G99A 1EKSA 2VWBA 1ZA2B 4Y0FA 5HMWA 2I7NA 2HGNA 2E9TA 1S1UB 2JEFA 2LP4A 4EAHD 2F4FA 5CYQA 4OKKA 1S1WA 4DU3A 5DM7L 4Q0BB 2AEMA 1K8AT 4DQPA 2V8HA 1WKKA 1VAZA 2DRBA 4CGJA 3V1QA 3E3XA 1HBUB 2RRAA 1RE1B 1QAXA 2YX6A 1O1WA 4ED8A 2DH9A 3NGYA 3F5TA 3PJXA 4WP3A 2NRRA 3EE3A 2W01A 2YCHA 5HMXA 3N4QA 1KC8T 4K8XA 2UVRA 4RUAA 4QYRA 3IR6B 4AT1B 2J8AA 2OH2A 4NWBA 1JJ2M 3OYHA 4WTYA 1R8PA 2CPXA 3MXMA 3MN7A 4CK1A 3CCZA 2UXBK 3ZC4A 3D2EA 2OMOA 2IJRA 4JI3F 4OZ2A 3ENOA 2DPIA 3T1HK 5KFDA 3J7ZO 2DNRA 1WF2A 4PEOA 1L3VA 5EN1A 2KDOA 1FJGK 4YFUA 1Q78A 3QETA 2YBVA 1YRTA 1C1BA 2ACMA 3E01B 5U47A 4DSKA 4DR3J 4RL1A 3BJYA 3CJKA 3T5HA 1U0SA 1NJWA 3WQUA 3HHLA 4BC2A 2M8DB 4V19S 3V9ZA 4TKTA 4FJ9A 2ADBA 1K47A 4ED7A 4C3LA 2DBBA 3VEWA 1LW2A 4CLSA 4I56A 3GMGA 2QYCA 3OD2A 5LMUK 1Q5VA 3CF5L 3P5JA 2P5OA 3KMQA 4DV3K 4RBVA 3CCES 4CNYA 4CF2A 2ZWHA 3CC2N 2FIUA 4KI4A 1O13A 2DHAA 3B8HA 2UUAF 4HHHA 1Q95G 3ZX0A 3MPDA 5BPMA 3HT0A 3D0HE 1B0VA 2DISA 3D1QA 3O5TB 1QAIA 3M6UA 1MDUB 2YNIA 4F26A 4OPHA 1QLNA 1JLEA 2P9NA 1MN9A 1LWCA 2F4VF 2R2RA 3ZXWA 1RUSA 3OR1A 4P52A 1PIEA 3BN4A 4BR9A 3BF4A 3I82A 2B8PA 4OZ0A 2QM1A 1TMMA 2IYGA 5BPNA 4ZVRB 3AH6A 3H5XA 4B3SK 1RWKB 2MSTA 3BV8A 2PBDA 5GIOA 5F9LA 3HFZB 2V94A 3VA0A 1ATSA 3VAJA 4YDDB 2BKOA 3R5BA 2VG6B 1VQ5N 2ASPA 5LJVA 3P1GA 2HLTA 3O44A 2ZZNA 4NI2A 2GIFA 4W4MA 1CZ9A 3ILJA 3CPWR 2V4JA 2WB1D 2MTLA 1HJRA 1FI4A 5CD4H 4LR8A 1YBAA 4C8KA 2GCFA 1HBNA 1OYEA 5HK4A 4BQLA 2MKHA 3MCSA 4ZHRB 4Y34A 4IRDA 3S8SA 2CZVC 1NNDA 1SXLA 3N0VA 3CCLN 1VBXA 1YF5L 3KNAA 5KT3A 5EX0A 3HT3A 3AODA 1U1MA 1B4SA 4NLOA 1NU4A 4QIFA 3IG1B 1IR0A 4LF2A 3SIPB 2PFDA 1P27B 3IBFB 3L2VA 5HQ8A 3R8EA 2MGZA 4QR2A 4ER8A 4B3TJ 1GAOA 4H0OA 5KAKA 3HL8A 2XZTB 4RPFA 4M5JA 3O3FA 5KTQA 2BOPA 3G25A 3L9ZA 2XMJA 2DFHA 1Y10A 2QZ8A 4HL9A 2NCKL 3CD7A 3A8YA 4MQ3A 2DR6A 3O5BA 4FYDA 2EWSA 7AT1B 2Z58B 2N4CA 4KREA 4ZLPA 3BEXA 4DV1K 4QOTA 4IWVA 5AQLA 4E19A 4DFKA 5HANA 1L3TA 3NMAA 3G8TA 4K4UA 3O3HA 3QESA 4B17A 1T3VA 1EETB 3WC0A 3LWMA 5J2NB 4JKEA 4PXCA 4K5SA 2FXUA 2HS4A 3W8PA 1YAGA 1TUYA 2HEKA 3TEHB 3OVBA 2VOOA 3OYLA 4CJ5A 4OKJA 4NASA 4TLQA 4C1NK 3SQ1A 1HQ2A 4DR1K 3ET6B 1B70B 2MQLA 5T7LB 1O5JA 1RISA 2PSZA 1WAJA 1NJZA 1S1TB 4JI2K 3DLRA 1SBRA 3BP8A 1BIUA 3O1LA 3FQLA 3ITHA 3G82A 3CIPA 4IOCQ 5JVHL 1WD6A 4Q43A 2B43A 1IBKK 4DU7A 3H08A 4K2JA 3RAXA 4ALZA 1EP4A 3BH7B 4CJTA 3DXBA 5TKYA 4ANDA 4O4GA 2RQ4A 1HKCA 3LP2A 4O0JA 2FY8A 2DHSA 4Q7AA 3U7JA 4LF9K 2RRNA 3J7ZT 3I8BA 2NQPA 1QVGR 3GJQB 3HZ6A 1Q53A 3A3PB 4DCJB 1G6BA 3O80A 1BU6O 4B3OB 3AOCA 2CQ1A 1NK8A 3MM6A 3M1VA 2E8AA 4DUYK 3G10A 4X65F 1URNA 1F3FA 3O6WA 2XMAA 2K7KA 3I5AA 1C1CB 4BC9A 3QMQA 5AQWA 1VRUA 3P49B 3IGNA 2PIIA 1BQNB 3S7RA 2GQ2A 2QX0A 4ECUA 4RW8B 3QT8A 2ZBQA 4B9MA 4NEZA 4U96A 2MLXA 1CJTB 4RG8A 2NR0A 4CEFA 2HFUA 2MZJA 3SV4A 3VEXA 5HMYA 1XQIA 4YOYA 4JV2A 2HB5A 1RAJA 1S9GA 3EZ5A 5HROA 4LQ3A 1WOQA 1S1XB 2ETJA 1O0PA 2NUHA 4CW7B 2XBPA 2GFFA 5BR8K 4P10A 3JSRA 2GAGC 4ZVOB 2MY7A 3GOIA 3OTOF 3GG1A 3VCDA 1EXQA 3IR7B 1J5OA 4MAKA 5TKWA 2ALZA 5DM7Q 2D0OA 2YKOA 2VQEJ 3FBFA 1LFPA 3C94A 4WU3A 5KG3A 3HCXA 5JLFA 4MO4A 1WKJA 4CJPA 3ATUA 2HLUA 1V3ZA 4BREA 2ZD1A 4RNHA 4C8YA 3GJSB 4LF6J 4I6MA 4DR5F 3US5A 3QBXA 2LLZA 5HBMA 2AJ4A 2QLXA 2NYIA 3POTA 2YHBA 3BGRB 3R1HA 4YOTA 1PYOB 2UU9F 1DEJA 2X1FA 2D3OR 1P9YA 5E3CA 1X9SA 4TSXA 5ITHA 9RUBA 1FKPA 3M9OB 2YKPA 5B08A 1WOPA 4CJWA 3ZLJA 2B9XA 1S22A 2V63A 4BR5A 4ID5B 1KVCA 3VEYA 4IUFA 4ISFA 2B5JA 5EWGA 3OR2A 4JV5F 2BJ8A 4Y2MA 5ADZA 2HQCA 5KFWA 2QO3A 4E7JA 1LK5A 4HT5A 3ELHA 2GC8A 2F65A 4DTJA 3A5MC 2Y8YA 4CF9A 5C24A 1VQSA 3I9V9 4AE5A 2OPRB 2BV3A 4NLGA 4EU0A 2Q1NA 5C10A 3K57A 5DGBA 2XQCA 2E1ZA 3PR4A 5I3UA 1HMVA 2DJWA 4NLQA 3WC2A 2XY7A 2GEMA 5C0YA 2HVHA 5FPDA 3KUEA 1NH8A 2P5GA 1T9VA 4O3SA 3MEGB 3R97A 8RUCA 4J90A 4E1NA 2QLFB 5FPEA 3ZEUA 3D0IE 3GWCA 1NHUA 4CGIA 5KFPA 3CJTA 3CF5Q 2VPZB 2G2YA 3VQ7A 2O5DA 4TY9A 4H54A 3TUJC 3QEXA 4ELUA 1UCNA 4C97A 2YKNA 2CQPA 2FZGB 4GY2B 3R6LB 2VHGA 4AQYJ 1D3WA 3RG6A 1RBTA 4MYTA 1GLAG 3RUBL 4DR4K 3ONQA 1WEYA 2B7CB 4DG1A 1WUAA 1RKIA 4HH1A 4LY7A 3SSQA 1IM6A 4DSFA 4LF5J 3C19A 3DLEB 2DK2A 4A8QA 3MMVA 2ZITA 3WUHA 3WNHA 1CJVB 3ID6A 3SK3A 3PUFA 1I5OB 2AT1B 3CNQP 3PFEA 5DG7A 1M5PC 3QYYA 1AUSL 2POKA 4KGMA 5FIIA 5D3GB 3PO4A 4BRFA 3G71N 2F40A 3GU0A 2Q2RA 2KRRA 3QIPA 1IKWA 4OI0A 5GAEI 2OP5A 4W5TA 3CC2S 4M3TA 4LMZA 4NB4A 1C0MA 3ZNJ1 5CZXA 3R7NB 1R3NA 4BVPA 5AZJA 1MNEA 5DRKA 3TA1A 2KFYA 1S6PB 3TUIC 3NOCA 2PYLA 3PSFA 3T69A 4CGGA 4FLZA 2Z30B 1ZAWA 5K14A 4I2PB 1WORA 2Z1GA 2IFXA 2KLAA 5IOLA 4QS9A 4RUBA 3KHLA 5KFHA 5FPNA 2Y9HA 3OL9A 4P2XA 1IR2A 3NLCA 1FHTA 2XO6A 2ZHBA 3DLGB 5KFBA 4Z4GA 4A8MP 2IIRA 2KRBA 4CO3A 4JD2B 2PMHA 4UY85 3AVGA 3OFEA 1D8YA 2QKBA 3MPUB 4ANCA 4CZEA 1VQ5S 2WUSA 1OY9A 4NXNK 3G4SN 1FD8A 3ZETA 4NYNA 2Q6BA 2BEFA 5D0RA 1P8ZA 3R27A 3Q23A 3NVMA 3MMBA 3V1OA 4O4RA 1FDNA 3V6DB 1P1LA 1U48A 1E6YA 1ROFA 2FYXA 5DK5A 2IC3B 4USUA 3S6EA 1K6YA 4LF4K 4M5HA 4J9MA 1BUXA 1M1HA 1BLUA 2PMZD 3I8DA 2BJ9A 4PXEA 3A4TA 3HM8A 4BRIA 1T3NA 1CLQA 3U02A 3CO0P 2A5XA 3MWTA 3JSMA 3CCLS 2NYHA 4FLXA 4CJLA 3A3OB 4K4SA 4ILHA 1HWKA 3C6AA 3IUCA 3HDSA 2O8FB 3AVIA 2IJNA 2OI2A 4BDYA 1OVYA 3HVWA 5B0BA 5KFUA 2BYCA 5HVGA 3R2CJ 5BPLA 2H5IB 3PLAA 3Q8PB 3RB0A 2FHJD 3VQ5A 4PKDB 4FJ5A 1KNZA 3BY5A 3LW5C 5A2QY 4GO5X 2E29A 4Y2AA 4CO4A 3JSYA 5JVHQ 2EFVA 4FJ7A 5G0RA 2BQ3A 2P9IA 2YWGA 2HNYB 4BR7A 5HO4A 5M2RA 3KG0A 4O23A 4RNNA 3ZSWA 3I32A 3GONA 1UEKA 4CECA 4H5WA 3CO9A 4JI3K 4PQUB 4QWCA 5A2QU 5AQJA 1RT7B 3TSPA 4O44B 4CEZA 2BE2B 1R6VA 1S76D 4RW6B 4E8UA 5AQGA 1GLEG 4F50A 3CJ4A 3LGNA 5AFUA 3BDEA 3PCOB 4KI6A 1YK9A 3D28A 3B4DA 1VQKN 3C16B 4B9UA 1TL7B 3I5CA 4DR7J 1HNVA 2CGKA 3B4MA 1L5UA 3ISZA 4LF7F 1C0TB 4BRDA 1N34J 4KAZA 3KLEA 5MLCV 3EZOA 2EC0A 1BQXA 3W63A 3QJPA 4HKQA 2H48B 2CQ3A 2FPHX 3IDHA 2RE2A 3SYZA 3E8OA 1F9EB 5CYJA 1NKEA 4RTFD 1JJ2R 5H1SV 2R2TA 2C28A 3X1LB 5IFMA 4H4MB 3TTFA 2BKPA 4FM0A 4O8KA 4OFZA 4CEOA 3AJ2A 3QRPA 1UTAA 1TUUA 2C3YA 4CK2A 1WTFA 2AZ3A 2UUAK 3RBXA 2NUBA 4OL8A 4X4NA 4X66F 3V2UC 4AM7A 5KPZA 3GE1A 3GL1A 2QFIA 1Y5IB 1N5YB 3DRSA 1LWEA 4HDHA 3SSSA 5DO2A 4CEEA 2BJDA 3NY0A 3MXIA 3J7YI 2IAJA 2E2QA 3CTRA 4ZLLA 4PWUA 5DDPC 4WE1B 3JTOA 2F4VK 4A61A 2R7XA 2X7IA 2AW0A 2VPWB 4FF1A 1TUVA 5CHIA 1SAZA 5LT5A 3MCAB 3LWLA 4J9LA 2Q97A 3KLFB 2DR8A 4KBIA 2OIHA 4UZBA 3OYCA 2QWLA 1E4GT 3LDLA 1RWMB 4KB0A 1RT6A 5DQGA 9ATCB 1DY3A 3TJ9A 3W5YA 3A2FA 4ILGB 1JJHA 1JLCA 5KFOA 4BRPA 4ZVEA 3MGJA 1Y7PA 1GOCA 3AA3A 3ILIA 1ELOA 2X51A 1UL3A 1VSFA 4KPYA 2FSJA 2NRZA 2WTUA 3S3OA 3ZTOA 5IC4B 3UD4P 4HHUA 3KHGA 1RT4A 2O8EB 1NDCA 4BRLA 2G8WA 4KC5A 4OZJA 3NH0A 4KE5A 1NBEB 4ANEA 1BOTO 3I0RA 4C11A 1M1KO 4HT7A 1NCLA 4W92B 2FTRA 4NZ0A 3QB0A 3VQ9A 4KH5A 4ZIVA 3GSDA 4NRTA 3THXB 4FPBA 1T8EA 4MKYA 1YJNN 7FDRA 2VUGA 4CI0B 3ZZOA 3N4PA 2DIVA 5HAOA 3TVKA 2OEMA 3PM9A 4ZCKA 3DDNA 2UV8G 3M9MB 4NZ6A 4CFBA 2CG4A 3S3MA 3OPKA 2BDPA 1MROB 2UXCF 3CCMN 4MTPA 5CH7B 4FO0A 3DM2A 3QNOA 4DL2A 3FZBA 2KJWA 4ZPTR 3I0SB 3F41A 4AILC 3K89A 2ATLA 1R0AA 4ZVGA 4DV7F 3MN9A 1Q8IA 1ZZFA 2JHEA 1KXPA 1NK9A 3IXQA 1S9EA 4TU9A 2GO9A 2UUBF 4W90B 2HFVA 2J0WA 3UD3P 4BC3A 5EHHA 1CC7A 4BS2A 4M3RA 5KPRA 2EFNA 5AQRA 4ICLB 3KJVB 3D1HA 2HZAA 4LFCF 3QEVA 3EM1A 2A3JA 2OPQB 1AA1B 3SJHA 4JYAJ 2OYQA 2G1DA 1IWGA 2RD5C 3CM5A 2XSJB 3MMAA 3FZ2A 4AHCA 4IOXA 1EWRA 2G8KA 5EGYA 3OUYB 4KHPJ 2QE5A 3WHIA 4WXOA 4P74A 3CM6A 4DF8A 4IFEA 3FRZA 4DX5A 1AT1B 4J9KA 5C2DA 2ZJQL 4CD3A 2YNHA 2B9YA 5HN0A 2E5LK 1RT5A 1Y00A 5DQHA 3NS5A 5T41A 1NOZA 4KTWA 1XEZA 3CJ8A 2ZH8A 1WLJA 5A8RB 3DYAA 4OZ5A 4XH5A 3NWRA 3VAGA 2VFSA 1U09A 4QW9A 5EWFA 1AFIA 1EWQA 1B92A 4F4KA 3PW7A 3VTIA 3RR7A 4C0BA 1EO1A 3UKRA 4FYYB 5IM0A 4CYUA 2GVDB 2GJFA 4YHHF 3KHRA 4EFAC 3MI7X 2DY4A 3O6QA 1WC4A 1R89A 4UTGA 5ETNA 1JLBA 4JK7A 4BROA 3OBIA 2AJFE 4ELTA 3QGIA 1S12A 4X65K 4CM0A 5AQHA 3S3NA 3G71S 4JI1J 2B9WA 3QFHA 5C25A 1SV5B 4ZJOA 3OBYA 2J7UA 4OZ3A 2ZOGA 3AOBA 2UUCJ 1VK3A 3BN7A 2BOAA 1XJWB 2HHVA 4FWQA 1X4CA 3OTCA 3AVFA 3VGSA 4DUZF 4OO1J 3NDKA 2FJWA 3DFEA 1NM1A 4QWEA 4WKYA 1QTMA 4KJIA 3VQ4A 3DRRA 3LP1A 3NCIA 2WTFA 1B9DA 1X7VA 3BKUA 2BRKA 3QGHA 3V4IB 2R7TA 3OTOK 4M45A 3TA0A 2IYIA 4ZIWA 4O0NA 2MZRA 5H9EK 5KFTA 2IVFB 2XS2A 3EXYA 3MM8A 1HBMB 1IXKA 1VBKA 3DGPB 1LOUA 2AGQA 1ZYQA 3T19A 4MMOA 4F67A 3GJRB 4QWDA 4U7UD 4DR5K 4KH4A 5GADP 1RGIA 1HNXF 1G1XA 2HNDB 1FXRA 2VFVA 2D69A 2D0BA 1TL3B 1S57A 4X62J 1GX6A 2UU9K 3G4SS 4FWSA 4G1QA 3FKBA 3CXCM 1D5AA 1ZZNA 1RAIB 3MMJA 1TAQA 2MPUA 1UWAA 1WKLA 2ASYA 2IIHA 3OTEA 3H5YA 1SIWB 2FDNA 2R3VA 1BD6A 5KFJA 2CAJA 3DLKA 1UVMA 6AT1B 3W64A 2N7YA 1QDUB 4HTUA 5EWEA 2NRWA 3M9NB 5I3PA 1QJHA 4IXCA 3RWUA 4DWIA 4U67L 4IO9L 4ECXA 2YKMA 4OYOA 1T95A 5HMZA 1TAUA 1VQ8N 3GFYA 4IDKA 4IFVB 3IAM9 4NCBA 4DR3F 4U9RA 4JKGB 4CLWA 4AXJA 3GIKA 2FQQB 3WNFA 1LOTB 1M1KT 4OGCA 2I2YA 1AB8A 2HBRB 2Z2YB 3HVTA 4M5DA 2KM8B 1K8KB 3T1YJ 2VG5A 2YHXA 2KKZA 4FJGA 4DB3A 3WXIA 3PRBA 4JK9A 3OS2A 3R5CA 3GB0A 4OI6A 4DX7A 3SI8A 3C7NA 1TKXB 2LA6A 4LF8F 4J2AA 3H2UB 4LFAJ 4PKHA 3R9LA 2FLNA 4NCGA 4IG0B 3VV2B 1NGGA 3OLBA 2QSFA 2J7WA 2VDHA 4IKAA 4BG8A 2A10A 3BEGB 3DXMB 4LSZB 1RNHA 2V51B 2WONA 3WZ0A 3FGVA 1ICEB 1VQKS 3RB6A 3NH1A 1RTZA 3KG1A 3QRQA 2CVIA 2ROEA 4IFYB 5GAHP 2W9BB 4DTRA 1LV5A 4PWDA 2O67A 5HOOA 3RYLA 2HHHF 1RDUA 3VQCA 1I39A 2CJKA 1RBLA 4ZN1A 1AUDA 3VAIA 3MR3A 3GIMA 1XC9A 1U2FA 4G9ZA 4CGHA 4NLCA 3UN3A 2E1AA 2WSEC 2WK4A 1IKVB 2XSFA 3B6PA 4A48A 3GR1A 2UXDJ 4LRBA 2DH7A 1ILYA 4QCLA 5AFUH 3VGTA 2AYBA 4R0EA 5GAEU 3MZIA 1RAHB 1T9WA 4Q2MA 2H3EB 3RRKA 4FOEA 2ZZMA 4CJQA 1T3OA 3RBZA 2JFKA 1BQMB 3M2RB 4HACB 5FD1A 2OELA 4ED4A 2MHEA 4CO5A 1TELA 2W1BA 4KB1A 2J8SA 3CDWA 1KONA 4BDZA 2XMTA 3IWNC 4BRCA 4YOEA 2VQFJ 5IZHA 2CFXA 5J2MB 4WFNL 2NPIA 4B3TF 1WACA 4W5OA 4OJGA 2QEXN 3UE2A 4M5MA 4H03B 4ILJA 1TUWA 3HX9A 2B6AA 2BANA 4ZPVR 1SC4B 4BY9C 2CJQA 2Z57B 2W4DA 2Y1RI 8AT1B 3SQ2A 4LSLB 3TX8A 4BRAA 4KO0B 1R0BG 2CH6A 4FJIA 2V7ZA 2Z2MA 5C5JA 2CZ9A 2VB6A 5CXTA 1A5XA 2DCUB 3CGIA 1BIZA 1VLYA 2Z8QA 2C2MB 3I55N 1VJQA 2CA9A 2V9KA 1CJUB 4QR0A 2HHQA 1FWLA 2VFTA 1A9NB 4XDDA 4LBHA 5ETKA 2NPFA 2C2EA 4CHPA 4TY8B 3LPYA 5DZ7A 2BA9A 2WW8A 1Z05A 2CG8A 4BC4A 4FDFA 5AXNA 1RYSA 4FBUA 1IKXB 2GGPA 1YJNS 3IWXA 4CH0S 6FD1A 3JS9A 1UEVA 4DV4F 3K9KA 5M1FA 2B4OA 1VOMA 1IR1A 1XBWA 4FWLA 2JH3A 4F4WA 4OPJA 4OLBA 4FPRA 1RT3A 4Y3CA 3L2WA 1IM4A 3H90A 4R25A 3CCMS 2RPIA 5GAGP 2ZJQQ 1QM9A 3BGLA 3O08A 3VF2A 4JI6K 1Y5NB 2MJNA 1KLMB 3M6WA 5KFAA 3SEOA 1FKOA 2KU7A 1I94F 2V8PA 1XNRJ 2W41A 1FEHA 1CULB 1PC5A 2XWYA 3MR7A 2AGPA 2RDIA 3K7RA 2X78A 3OTDA 4LJMA 3DLLL 5KG1A 1IWAA 4KRFA 5KFNA 3LL3A 3K0SA 3A8EA 1KCFA 1T9YA 2CGLA 5HRRA 3VGMA 3CC7N 3E01A 2MZSA 1MG7A 2VKZG 4WCEL 3ILOA 3PW5A 2N4DA 1SS6A 3SMSA 3NGUA 4EZ6A 3DHWC 5KFEA 3R8YA 4B9QA 3FSIA 2JNJA 2WVFA 3AVBA 1NB2A 2ROPA 3TUZC 1ZPWX 3HRGA 2GMJA 3A12A 2GX9A 2KZMA 2HS3A 4PUOB 1W2BR 2RF2B 3HTVA 2HRUA 1VQLS 4LF7K 4JI7J 5CA5A 4O8UA 4B9NA 2PDAA 1J53A 4LRFA 1SUQA 1HQEB 3QFWA 4ZVPB 5KGXA 2KH9A 3NMUA 4NYPA 1DBDA 2I7PA 3KKFA 1BG3A 3MCOA 2GO8A 4F0KA 4JKAA 2YWEA 4J9SA 1RJJA 2W2NP 1M1GA 2NRTA 3MM5A 5CZVA 1KLNA 3C15A 1Q9XA 2IS3A 3N4WA 2HZVA 3GILA 4B9SA 1J5EF 1RBRA 1DLOB 4NEYA 2L9NA 2Q31A 2HBJA 2PD1A 5E26A 1JL1A 1A6LA 1IUJA 3MEDA 2OPSA 1P1TA 2E6LA 1RKJA 2R2UA 5GMEA 2RS8A 3GE9A 4CO1A 3DCAA 4I7FA 3R2DJ 3OVSA 5CABA 4LF6F 2QMWA 1HYZA 2HVIA 2J4RA 1R0CB 3I6PA 1JCEA 1NH7A 3DOKA 3J7YU 4K0KF 2OFHX 5ETVA 4DOZA 3RSEB 3C6UB 3N6LA 2XY5A 3E66A 1U2RA 2HMPA 2OPPB 2D41A 1JXLA 2CPEA 3I9ZA 1VDHA 4DV0J 2ALYB 5AJ3F 3FK4A 3Q86A 2E4LA 2LECA 1UVIA 2WSFC 4R0JA 3D2FA 3FLCO 3RJMB 1BE4A 4P7TA 1U1NA 5JJBA 1MN7A 4UZCA 2QRRA 4EYIB 2HURA 3FUYA 4WZMA 4A8XA 1WBBA 4U67Q 4IO9Q 1Q86O 1OMSA 4P9SA 2W8LA 1H98A 4BACA 3CJAA 5E3PA 2QXFA 2PI5A 1HI0P 2DGWA 2MQPA 5BREA 1LW0A 2DNQA 1GLLO 2E7WA 1HBOA 2ROGA 3W66A 3MOJB 4RNOA 1D9FA 2FLPA 2MB0B 3H6EA 5AR0A 3V81A 4OX9K 1PYSB 4OX6A 1DJ0A 2I38A 4FXDA 3ZCMA 4RU9A 2NRHA 2AZ1A 2V6AA 4YS2A 5HI7A 2YV0X 2P9KB 3LP0B 1J2VA 4C48A 2C1EB 3P31A 2MZTA 1HHSA 2H3GX 2V34A 1U1QA 3MUVP 4AF1A 2VKRA 1HNZJ 4NA3A 4EIAA 3ZT0A 2QJ3A 2UXCK 4WKRA 2PZSA 4KKOA 3AA8A 3CPEA 3DRPA 1VQYA 2D3UA 2HWHA 2WOMA 2JLFA 3TANA 5HRNA 4DV7K 3CIMA 2VH7A 1ZM4A 3CQ8A 1EETA 1N52B 5J2NA 1CXUA 4I2QA 2AWZA 2KT5A 2KXNB 4GMKA 1VQ8S 3OA9A 4OI1A 2CJ9A 2LQJA 3TPQA 1KAYA 2PFFB 3ET6A 4J9UE 1R8AA 2BTFA 2I5JB 3J81Y 1N48A 4X4PA 4LFCK 2VFUA 3ADAC 5A0YA 3HHEA 3T6JA 1GQEA 3MM7B 5AZIA 3KVGA 1S6QB 4OJ3A 2GV1A 4FYXB 1VC0A 4HTIA 4I0WA 1H73A 5IT9O 4WQ5A 2FUG9 1DTTB 2DGQA 4JS4A 4GO7X 3H8YA 4PG7A 1B99A 3NXZA 3D66A 4NXMF 3OYKA 1PJ6A 5A6WA 3DOMA 3C6TA 1G15A 3VESA 3KG4A 1X31C 4OQJA 2WRMA 5JVGL 4M3YA 3CJBA 3JTNA 2GVZB 2J9DA 2ASJA 3ULEB 1X5TA 1HI8A 3WEEA 5KRSA 2K1RB 3EKSA 3CEDA 2PGCA 1U1KA 3KLIA 3TR8A 3TI0A 4KH6A 2W2OP 4YHHK 3P4IA 4RW9B 2DITA 1X5OA 1NSPA 4J8FA 4FF3A 4WFNQ 4JI0F 5AXKA 2VIHA 1BQNA 1S97A 4LFBJ 5KFYA 3C14B 3CB4A 5LMUJ 3OYEA 4QYZK 4IOAL 4RW8A 4RO0A 4WQ5C 1VQON 4CLZA 2E5IA 2G8IA 5D4LA 4FZYA 2XS7A 2NZCA 1CJTA 1IKYA 3N79A 4DV3J 3RBEA 2WVEA 3BKTA 2EI5A 2ZBRA 3AAPA 2F8EX 1S6UA 2ZBCA 3DLHA 1VISA 3SCJE 3HHLD 3GDQA 1FFSB 2FJBB 2ACYA 3W9JA 1JLFB 1U2VA 5EX3A 2Q43A 3O3GA 1FRHA 3AQPA 4JP8A 2IPOB 4TQRA 3QATA 4H4OB 2HWIA 2GIRA 4DXLA 4DUZK 1ZBIA 1Z26A 3T3FA 4PR6A 3NMRA 2K06A 2Z4PA 4P7VA 1W7AA 3MK6A 1NGAA 1UA1A 1FWPA 4OHYA 4RW7B 1K44A 3AB2B 2APOA 1FJ7A 1RHUB 4KB7A 2WAQD 2QEXS 3I87A 3D6FB 1UP1A 2OAUA 3T1HF 2P9LA 4B1YB 4LSNA 4L3QA 1EB0A 1VSKA 1TKDA 3CD6N 4MK8A 2KB2A 4ID5A 1FJGF 1HNXK 2VGMA 1CBKA 3TTDA 3MDFA 1VHIA 1S1VB 3PX6A 1VQ4N 3CETA 1PBUA 2V4RA 1V3RA 3R5GA 3HKWA 1RDBA 3I55S 3DLLQ 4IRKA 3IAS9 3U1NA 3U1LA 4EP4A 3TU5A 4AHSA 4X84A 4AL7A 2OPRA 1N36J 2YX1A 3VMFB 4WCEQ 2JOQA 5F9NA 3F0NA 2YQ0A 4KGVB 1N5TA 2BVZA 4NMLA 4FLWA 1QSSA 2QWQA 4QS7A 3ENAA 4DR7F 3OL6A 3MEGA 1TU0B 4PYAA 5DLGA 3CPWM 1KKHA 1J6ZA 4N7TA 1FRLA 4DR3K 5DGAA 3V6KA 3FFIB 2XRIA 2HK2A 1N34F 5B8HA 1AXQA 1D4XA 5GAHU 4F02A 3CDAA 6FDRA 1WNEA 4JNEA 5F8NA 1RB0A 4DV1J 2P9EA 2LU1A 1AYEA 4WXWA 2ZZTA 3CWJA 1QS4A 4JLHA 1MU2B 3ZZTA 3SPZA 2V8GA 3M7VA 3RB4A 3LPEA 3MR2A 4DTMA 1UW4A 2ABYA 3IM8A 3CXCR 4PG5A 1UAWA 4LF8K 3UNYA 4JB8B 4B3MJ 3V9WA 3DRXA 4FWNA 3VERA 3CC7S 4H0XB 1TV6A 3DLEA 4CO0A 5ELZA 2HZCA 1U45A 2FC8A 4ZLNA 1RA7A 2IM3A 5F8IA 4K42A 4NO7A 3MCMA 3BUZB 1X9JA 2WBRA 4DFMA 3VEZA 5D0EA 3FBEA 3KK3B 2KG0A 2W40A 3QIOA 2RE1A 3BZKA 5M1QA 2NUUG 4R5PA 3FMWA 3SMPA 3WNGA 7FD1A 4CO2A 2R7UA 2MEWA 1ZBTA 1M5VC 2BX6A 1NHVA 1QSYA 1UZHA 2HHHK 4O3NA 2C2RA 3FDSA 3H4DA 3NL0A 3LH2S 2Q36A 1H74A 3NBPB 3WIVA 4PY5A 3TAPA 2HHWA 1F5BA 4MYUA 2A1SA 3U6FA 4UW2A 4X4SA 3VAKA 1TL4A 2PFUA 1Z4UA 2GWJA 4PA1A 3UKUB 5ETRA 4LQ9A 3RAQA 3PXGa 3QT6A 4DUYJ 2YWHA 4CZJA 3LQVA 4I2PA 2A42A 3D7EO 2Z0GA 1C1AA 1FK9B 3PW0A 2VBWA 1VSDA 3KK1A 3OSNA 1WC1A 3AXKA 3KYLA 2GIQA 2Z1JA 2RHKA 2D0AA 1XNQF 3L7UA 3M2VA 3NGKA 1GXTA 1KN6A 2ASOA 5M1PA 2W7PA 2G2OA 3N5BA 3VEOA 1PAUB 3V9UA 3PRDA 3GTYX 1ZAXA 2HW3A 2BE7D 3TOQA 5DDQC 4B3TK 3EZWA 3KLHB 4U8YA 1UWBB 1QVGM 1XHXA 4O3QA 2IC3A 1IN0A 5H1SQ 2WFBA 2MQOA 4DTUA 4M5IA 3CHWA 1FX2A 3J80Y 1RCXB 2XMMA 5CZ2A 4K4VA 2QXLA 2O8FA 2NLXA 2D5RA 4E2FB 4FNIA 1RLDA 3TARA 1S1WB 2VL1A 2DXEA 3A8KA 4WYLA 1F60B 2C2NA 5KFLA 3ZTQA 1EHWA 3VAHA 3W9HA 4BC5A 1IJEB 3RMDA 4BRMA 4IRCA 2BUPA 1VSEA 3BKFA 2J0XA 2UVUA 2CKWA 3B54A 4JYAF 3QEIA 2R8KA 3NGDA 3MOZA 3P6YC 2CADA 4ZOSA 4ZP6A 4CVNE 2RJZA 4CEQA 3MAQA 3BS9A 1O6XA 2VJVA 4DV4K 5AQUA 2G0IA 2HNYA 4FKYA 5BRDA 1EQMA 1FF2A 2XI3A 4B3RJ 3NGTA 1HWIA 1CS4A 3O2IA 3D2EB 3KLVA 3F9KA 2PY5A 1PBAA 4K7QA 4XAKA 4FPIA 1YIJN 3IRXA 4N76A 2OMLA 4ED3A 3BSCA 1U1LA 4YP3A 1V6HA 4O55A 3ZX2A 3M2UA 1RT7A 2JLGA 3AV9A 1I94K 2HVEA 2QWOA 5JVGQ 4ZVUB 1WSIA 1WDDA 2E9RX 2U1AA 1J9AA 2R8JA 1C2PA 5HSPA 3HO1A 4XEIA 4P6QA 1HLWA 3C16A 2VU5A 1C1BB 4CLUA 4NLSA 2H51B 1YSJA 3VZIA 1HYSA 5LXYA 2HHPA 3CJKB 2P51A 1HQUA 4DV6J 3NP5A 2BE9B 4IOAQ 5I3QA 2B51A 2LSNA 4A8SA 4BG9A 3HSTB 3VETA 3FJ2A 3KLGA 2L48A 1NWKA 1FRMA 5H9FK 4JI1F 1V5VA 1ZETA 3VQEA 4DPUA 4Z4EA 4HH0A 1LW2B 1KVIA 1WHVA 4S0MA 2JEIA 4DR6J 5D0HA 2EW9A 2RVJA 2AYEA 3OJUA 3AJDA 4OI2A 3TWHA 1WC5A 2JFDA 3IBCB 4K4TA 4JHDB 4DCHA 4FYVB 1TZ0A 1R27B 1VC6A 4H8KA 3GYXB 2VC0A 1AFJA 2D1CA 4DU8A 3OHRA 4OJRA 3KDNA 4WJBA 3L8BA 1RAOA 2NXEA 3QICA 2RUSA 3OXLA 4MKVA 3SJJA 2YNIB 2OCEA 3SCKE 4USWA 2AX0A 2P9NB 2EKYA 4M5KA 2CQHA 1VSMA 1FXLA 1YT3A 2XZWA 4KSEB 2ZKUA 4WE1A 5HL7L 3AXMA 4ZVHA 3HJVA 4DTNA 1KVAA 1VQOS 4O0IA 4I9QA 4GKKF 3JAMO 4M5NA 4LF6K 4CGFA 3RMBA 1C0GA 3W8GA 5FJ4A 1A5VA 1BUPA 2CQCA 4X62F 3U1MA 2HKEA 4M7YA 3EXCX 2W2QP 3CERA 3CVKA 3MTKA 1F5AA 4K0KK 2CYYA 3HI9A 4C3KA 4DQQA 3HHDA 4CH7A 2J6UA 3NFAA 3ZX3A 4CE9A 4KHNA 3OYIA 2V4JB 4DSEA 1VK8A 2G2ZA 3QWPA 4CF8A 2O8EA 2RB7A 5F1XA 2XTJP 3VAMA 3H0PA 3P3DA 3HPOA 3OFHA 5GMKa 3QEPA 4KHYA 4L76A 1WHWA 2CZ4A 3Q2SC 1KQSR 3LALA 5ETSA 3I31A 3SXLA 3D6MB 2B4VA 5L38A 3IMXA 5D4OA 2RNEA 1NB7A 4G1IA 4NX9A 1XMQF 1OS5A 4CERA 4FLYA 3B6BA 2VONA 1ASVA 1OSCA 2O1PA 1ITPA 3OYMA 4BC7A 4IO1A 1KDNA 1GH8A 1HKBA 3T1AA 1F5CA 5EY4A 2GHVC 2QI2A 2FVQA 3I0SA 4K8ZA 2BABA 3LAMA 3GSIA 1VQ4S 2ASLA 1A0OB 3RW6A 3F2KA 3DRYA 5AXLA 3JB9k 2W42A 2FF6A 1OH8A 4O5BA 1PILA 3F73A 1SKRA 4ZJLA 3Q22A 2E1RA 4ECYA 1Q7LB 4LFAF 5KPTA 1WB9A 3WIUA 1RHJB 2VF3A 1XR6A 1NOYA 2B0GA 5A8WB 2DNZA 2RQKA 3PVXA 3SBTA 3R7BB 5HQMA 3MECA 1NGBA 1W2IA 1BGXT 2LYVA 4JK8A 1M5SA 1YHQS 1N0UA 2Q3SA 2A41A 3ZNUA 1WEZA 2HAIA 4NCAA 3H3OB 1WG1A 1C0UB 1DARA 1TVRB 2OPQA 5IQ6A 4K2XA 4J9OA 2QLJB 5LSLA 2XSJA 2UUTA 3ZTPA 3MXJA 1O51A 2O4IA 1X1PA 2W4PA 3EE8A 4JEPA 2G8FA 3IAYA 2IVOA 5JXSA 3C3LA 3LPUA 2U2FA 1G7CB 3QAEA 4LVOP 1GXUA 3G82B 3JXOA 5KOWA 2XB2D 3OVAA 1QD1A 1MWZA 3K0JA 4FBTA 4IBNA 2W4CA 1T9XA 4LREA 1N88A 2VA3A 1HWUA 4B8AB 4CIGA 1ZXOA 4FK0A 3EGVA 2KHDA 4FWPA 4FW2A 3LP2B 4K4ZA 1AW0A 3RRHA 2GVDA 4NXMK 2DTJA 2LCWA 1RAGB 4Z4IA 4KAIA 4C8ZA 2X6SA 1KOHA 2HS0A 3PKYA 1M0SA 2YVSA 4UOCA 4EO6A 4Z4HA 2AYGA 3O8MA 2XY6A 3MFIA 2QA4S 3M1VB 1NMEB 4FF4A 4NXNF 4D3HA 1VQ9N 2R7RA 4MT1A 3BDPA 3O9QA 5DMRA 1GLFO 1VRUB 3P8BB 3AVMA 3O1BA 2NSCA 1RSCA 1SJ4P 2CPYA 2IM1A 4JI0K 2CPDA 2HQDA 3W65A 4QIEA 2CQGA 1MW7A 3ZZ0A 3TJ8A 3CJ3A 4CH1A 1JLAA 2Q0RA 5C7PA 1VQ6N 1FESA 2QN6B 1XIQA 3UDCA 2MMYA 2YX4A 2UUAJ 2XMVA 3FMBA 1H7XA 1S9GB 4C7QA 2C2KB 2JX2A 3CD0A 3CJ7A 1P90A 4OYBA 3NOGA 4CJVA 3V1RA 2JL9A 4NRUA 2O01C 1SH2A 1KSPA 3AO4A 3MWPA 4NZ7A 4K8RA 5LL6Z 4RUHA 4JI4F 3V4IA 1U6BA 5IT9Y 5L46A 3CMQA 3OW2R 1K73T 1WI6A 5F8MA 2QW9A 3ZSRA 2F4VJ 2ATCB 3MMCA 2HIQA 2XLJA 4FJHA 2ZD1B 2OANA 2IRYA 4I6MB 2AJ0A 2OGUA 4R8UA 3RW7A 5HBMB 3POTB 5AQFA 4H0VB 4WWSA 4OYMA 2B9EA 3MM9A 3ID8A 5L1KA 1TL3A 2B56A 2HVDA 1RU2A 1OH7A 5IT9U 1RBAA 3CJ5A 3CFRA 1VRTA 2EK6A 2LVWA 3MPVA 1RXOB 2HK3A 1E4FT 1U7LA 4DPWA 2UZAA 5K9FA 2J7KA 2R2SA 4NL5A 1G4CA 2A40A 3UR0A 4A2AA 2B5JB 5LY3A 4ED5A 2FB0A 3LDPA 4QJVA 1G2EA 5FLXO 3E9LA 5HLFA 3F9MA 2J0SD 1FWKA 1FE0A 2I1RA 4HLBA 3VR1A 2CPIA 4CLKA 1WJ9A 2YXLA 3M1FA 1VQNN 4AHVA 3RBDA 3KUGA 5A8KB 3HD2A