1FK9A

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
536
structure length
519
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAITKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 519
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fk9A05
4I2QA 4I7FA 1RT3B 2FBXA 3PX4A 4J9NA 4IQXA 3V1QA 1T8EA 5C24B 3DOKB 3GIKA 4AHUA 4URSA 4W5QA 3THVA 1KLNA 2GIRA 4I7FB 4DL4A 3PW2A 3LPTA 3E01B 4IG3A 1VSJA 4E7KA 4IFVB 2HWHA 3AO5A 3NL0A 4RUCA 1VSFA 4RZRA 4IG3B 5HBMB 2R2TA 4BDZA 4NLXA 1UA1A 3M8QA 3BSCA 1KHVA 3KK2B 3M8QB 1S48A 3SUQA 3G10A 4B9NA 1XHXA 2IDOA 2GV9A 1IKVB 2ASLA 2P5OA 1TGOA 2C2RA 4Z4HA 2AJQA 1KCFA 3V9SA 4FLWA 4WE1A 1RT4A 4ZTFA 3I5AA 4DEZA 4CEDA 1W0HA 3K5NA 2FVRA 4DFPA 2KZZA 4WE1B 4RNFA 4Y1CA 2HAIA 1GOCA 4CJSA 3BDPA 4C8MA 1C2PA 1X1PA 4NZ0A 1QE1A 5KFWA 4QW9A 5SZTA 4FLTA 1BI4B 2OPPA 4R5PA 2VG6B 1JLBB 2PY5A 4LY7A 3KMQA 1BIUA 4HYKA 3DRRA 3PR5B 4FZXC 3SQ0A 3H5SA 1A5WA 4DL5A 2W42A 4IFYB 2RDIA 3ULDA 4OJRA 4FJ5A 3Q8SB 4ECVA 2UUTA 5FDLB 3T1AA 3DRRB 2DPJA 2DFEA 3LP3A 1JLEA 2HVHA 3HO1A 3L2RA 3AVNA 3BJYA 3HSTB 1L5UA 2VA2A 1FXXA 4AHVA 5L9XA 3KIOA 3VQ7A 3KLEA 1RNHA 3D28A 3OLAA 2NUBA 4F8RA 4IKFA 3QERA 1RDCA 4K50A 1KSPA 4ZP6A 2R8GA 3RAQA 4PQUB 4FS2A 2QK9A 4OLBA 1N56A 1X9MA 4CF8A 1X9WA 5I3UB 5EWEA 4BWMA 1N5YA 1C1CB 4TQRA 2AQ4A 4TY8B 2YKMA 3VA3A 4RW7A 2FVCA 4CEOA 2YNHA 3FSIA 4BE1A 4N5SA 3NFAA 4B3OA 4CECA 4BACA 2YKMB 5KFLA 4F4ZA 1JLAA 4E89A 3EYZA 4ZVEA 3KLIA 2AGPA 4DFMA 4ED6A 4B8AB 3FFIB 4R8UA 2HWIA 3DLEB 3I5BA 4EBCA 4DU4A 3OL6A 3WNFA 3KLIB 4HUFA 4KHUA 1Z25A 2PZSA 4H4MA 4DS5A 5HRNA 2YNIA 1HPZB 3MF5A 4CJKA 2W8LA 3PJXA 3LP0A 4K4VA 5T7BA 1RT2A 3NGIA 1NHVA 3CM5A 4O3OA 3S3OA 4Y1DA 4F2SA 4CFAA 1RT2B 3FQKA 4FJ8A 4B8CA 1D9DA 3SFUA 2D5RA 2VG7B 3EZUA 3CDUA 1O1WA 3C6TB 4PY5A 2D3ZA 3V6DA 3LZJA 4IR1A 2Q3SA 5I42A 1N6QB 4DSIA 3L2WA 2UVRA 3HL8A 4H8KA 1N4LA 1WSIA 5I42B 1RYSA 1U45A 3DI6A 4MIAA 2FJXA 4J9KA 4CK2A 5KG1A 2V0NA 4KB1A 1T94A 3PW0A 2ASDA 4YR0A 4ZPCA 3ZSOA 2BANA 4IDKA 4L8RB 1LV5A 4O44A 4Z4CA 5J2NA 1RCHA 2YV0X 4NCAA 4J9MA 1TL3A 4LSLA 3ITHA 4IDKB 3SFGA 2AGQA 1UAXA 3OYHA 4FLYA 4CFDA 3RRGA 2HNYB 4KKOA 3SUPA 3DLGA 1RT6A 3ITHB 1D0EA 3RB4A 1KHWA 1S9FA 4FK0A 3Q8QB 3BSAA 5J2PB 3K57A 4CJFA 3QYYA 3GIMA 4JRPA 3I5CA 1T05A 3CJ5A 2W9CA 1RT6B 4IRKA 1BCOA 1JLCA 3AO1A 3IAYA 2G8IA 3D5MA 3VQ8A 4YFUA 2BE2A 4CEEA 4ZTJA 5K14B 5C5JA 3P83D 4DQQA 4Z4GA 3AVGA 4J9RA 2BE2B 3F9KA 3CJ4A 4DTJA 2G8KA 4DSLA 3IRXA 1CXUA 4F4KA 2PYJA 3K5MA 4CEFA 4DL2A 3CIZA 1CZBA 2RDJA 1VSMA 3IRXB 1RBVA 2ATQA 1TKXB 3AO4A 1J5OA 4CHQA 3KLGA 1SKSA 4IH6A 4M3ZA 1IH7A 1NHUA 1LWCA 2E6LA 3PY8A 1QSLA 4CJLA 4CJEA 4CEBA 3KD5E 3DLRA 4KI4A 3L2VA 2BQ3A 4CJPA 2O4IA 4X2BA 3MR3A 3KHRA 3OYEA 3QEXA 5C42B 3GV7B 4KRFA 1RTHB 3OS2A 5DLFA 4MKAA 1TKTB 4YMEA 1BHLA 1FKPB 3BQ2A 4J9OA 3PX0A 4H4OB 1RDRA 3Q8RB 3WNGA 4OL8A 3TI0A 1SKRA 3DLKB 3GYNA 5KRSA 4IH5A 4W5TA 2JGUA 3HK2A 1S1XA 2DFHA 4DSKA 5F8NA 3FRZA 3AVLA 3DRPA 1EP4A 1WAJA 4FM0A 1VSIA 1JKHA 1NKEA 4M95A 4YR3A 4DTRA 2A1RA 3DRPB 4IG0A 2ITGA 4OPJA 2PYLA 3VQEA 3RR8A 1NOYA 3M8RA 4FM2A 3HVWA 1S9GB 2C2DA 3V4IA 2Z1GA 3T5KA 3LANA 1NK0A 3QINA 3AV9A 3QETA 1RA7A 1BQNA 3VQPA 3ZSVA 3V4IB 2HHTA 3L2QA 2XO7A 3LP2A 3VA0A 2G8WA 4W5RA 1BQNB 3V9UA 3NH0A 4LD0A 5KFFA 4E3SA 4CK3A 1QUVA 1QHTA 1GX6A 1S6QB 2R2UA 2BR0A 2P1JA 2Z1IA 4MIBA 2EHGA 2XGPA 2YHBA 3OYJA 3CJ3A 4KAIA 3MXIA 4B9VA 1R0AB 4RUAA 3LWMA 4IRDA 4RW6A 1MMLA 4DG1A 4WYLA 1VSDA 2ILZA 1S6PB 3K58A 2WHOA 4CJUA 4E1MA 2IC3A 4RW6B 2BQRA 4FLUA 5FRNA 4CGFA 3IG1A 4O0JA 4FJKA 1ZBIA 4CHPA 1U04A 3IS9A 1TP7A 2IC3B 5KT3A 1B9DA 4KI6A 1JLQA 3PJWA 3OHAA 2Z1JA 3RRHA 1XR6A 4EO8A 4E1NA 4Y34A 3QNOA 5KFGA 1U49A 4EZ6A 3QIDA 4I9LA 3OYMA 3KK3A 1ZBFA 2IJNA 3CDWA 2JC0A 2ZE2B 1C0UA 1REVA 3KK3B 1W25A 3KK1A 3NKYA 4JV2A 1KVBA 3TAGA 3CM6A 5J2QA 3VN5A 4FCYA 4LQ3A 4WZMA 4KSEB 2P5GA 3ZSYA 2KFZA 3K59A 5J2QB 4NYFA 2E9RX 5CYMA 4TLRA 1D9FA 3SQ2A 4BWJA 3RMAA 3AO2A 4KHWA 3CFRA 4I2PB 4E0DA 5CYQA 1RBSA 5C25A 1NK8A 2G8HA 2I1RA 4HHTA 3HPOA 3OYIA 1HNVB 5JS2A 4W5NA 3H5XA 4AHCA 3AVIA 4FM1A 4OGCA 3I0RB 3IN5A 3NGDA 5HP1A 3CWJA 5KFEA 1RT7B 4F3TA 3ICLA 4CJ4A 3PR4A 4ED0A 4I9QA 4OVLA 3EY1A 3OL8A 4DTXA 3V81A 3QIPA 3QO9B 4NYZA 4WFZA 1D1UA 4DQIA 1S49A 1NNDA 4DF4A 2KZMA 4YR2A 1HNIB 3DM2A 3QIPB 3AVJA 3ASMA 4DTSA 4FK2A 3UR0A 3SUOA 3UQSA 4K4TA 3SV3A 4G1QA 1RBTA 2R2RA 2D0AA 2B6AB 1RTIA 2OA8A 3KLHA 4JUZA 4FVMA 2EC0A 1DTTA 4CGDA 4G1QB 5KG6A 2B5JB 4I2QB 3GV8B 1VRUA 3KLHB 3NAEA 3HYFA 1WNSA 1DTTB 4UQGA 4DMNA 4C8OA 1RDAA 3G6YA 1VRUB 3DRSA 5KFCA 4RW8A 2ZQBA 3LP1A 4PUOA 3T5LA 4PA1A 4HUEA 3TAMA 4Q8FA 2AX0A 3BSOA 2W9AA 2OPQA 4KHYA 4F3OA 1MU2A 3C94A 4FJMA 3G6VA 3HPGA 4JLHA 1RYRA 1T7PA 3CG7A 4JRQA 2R8IA 3NAIA 1RAJA 3H4BA 1RT4B 1S97A 3S3MA 2X6NA 4URGA 2HHWA 1TV6A 1SL1A 3H5UA 5DGAA 4J2BA 5KFZA 1TK5A 4H54A 1I3AA 1QE1B 4DFKA 4NLWA 2OPPB 4R5PB 2BRKA 3I0SA 3AA3A 3SUNA 1BCMA 5KT2A 2R7YA 5KFSA 4URQU 2JC1A 4ED3A 1CLQA 4O3RA 5KT4A 3MFIA 3QGHA 4CESA 4IKAA 3GV5B 4J9PA 2IM0A 3QNNA 3K5OA 1JLEB 1BIZA 1LWFA 5D3GA 2J6SA 3T3FA 1QSYA 4ZP7A 2G8FA 3V6JA 4DQSA 5D3GB 4OGEA 4DSFA 3CQ8A 5L1IA 3GILA 1Q9YA 4FJHA 3KLEB 5J2MA 1C6VA 1T03A 1ASVA 4U6PA 3O4QA 3LZIA 2IAJA 4KV8A 3P5JA 3NMAA 5KFNA 2QE5A 4O0IA 3OYGA 4CFBA 5FROA 3LAMA 4XPCA 2IAJB 4KV8B 3N6MA 4DL6A 2W7PA 1HYSA 3O3GA 1N5YB 3RMBA 4NLUA 4DS4A 4FJGA 4CIGA 4RW7B 1CSJA 1HYSB 3OHBA 1QAJA 1G15A 2YNHB 2QV6A 1XR7A 3M8SA 3MR5A 2R8HA 3SI8A 4B3OB 1XC9A 3O4NA 1JLAB 4XO0A 3C6UA 3QGGA 3QEIA 1DLOA 3QESA 1RT5A 4B9MA 4R8UB 1ZYQA 2ALZA 4CJ3A 4FJXA 4RNHA 1JL1A 3KKRA 3SV4A 2YKNA 2RN2A 3V9ZA 4H4MB 2VWKA 1NK7A 3ISNC 4ZHRA 3PW4A 4M3YA 5DG7A 1SL0A 3RMCA 2IM1A 2YNIB 4QOZB 4FYDA 1BQMA 2YKNB 3LP0B 4DTNA 4RW4A 4AHRA 4MH8A 1BQMB 4B08A 4K8ZA 4ED2A 1VSLA 4RW4B 4JS4A 3PW5A 1YT3A 4MQ3A 3RAXA 2BDPA 1RBRA 4M3RA 1U4BA 1JIHA 2D0BA 3KLFA 1N48A 1SKWA 4KFBA 2DFFA 4DTPA 4AH9A 3H40A 3OYDA 1HMVA 3WNHA 4K4YA 3L2UA 2QKBA 2ILYA 3V6DB 3KLFB 3H5YA 4M42A 2FLLA 3EPGA 2GC8A 3OL9A 1IO2A 3V1OA 1HMVB 1RDBA 1ZTTA 3ZT3A 5KFXA 3DI6B 3ZSQA 4OPKA 3ZSXA 4C8KA 3VQDA 3TARA 2G8UA 2UUWA 2ASJA 4NCBA 3ZT4A 5CY4A 2BANB 1RT1A 3Q8PB 4O44B 5J2NB 4DTOA 4CJVA 3CFOA 4FJIA 4CERA 1TL3B 4LSLB 3QZ8A 4B9SA 3ALYA 3NAHA 4FJNA 1WSEA 2FC0A 4KKOB 1NK9A 4JS5A 5L1KA 3DLGB 3PX6A 1TL1A 1HYZA 2VG5A 4RNMA 2C2EA 4CJQA 4HUGA 1T05B 3BQ1A 4K4SA 3HT3A 2W9CB 1HQEA 2B43A 4ECRA 3NHGA 4ZVGA 1JLCB 4J9LA 2CKWA 4KHSA 4EP4A 2XY7A 3QLHA 2WONA 1HQEB 4NLPA 1JLFA 4ZMMA 3RB0A 1Q9XA 2AWZA 2WONB 3TVKA 1RTJA 4Y2AA 4CIFA 5F8GA 2UVWA 2E9ZA 3F73A 4IBNA 4N76A 2X78A 2W9BA 1DTQA 3OSNA 4ECQA 3SZ2A 3HHKA 3V6HA 3V1RA 4E19A 4TYBA 3OYFA 1I39A 1LWEA 1S9EA 1J5OB 5KT7A 4WXWA 4Q45A 3KLGB 1DTQB 5KFHA 4NCGA 2XY5A 4ID5A 1LWCB 2OZMA 1IKWA 3TAEA 3ZT1A 3DYAA 3MEEA 2R2SA 2R8JA 4DQRA 1LWEB 4M3UA 3RMDA 4MFBA 3U6FA 4K4WA 2J6UA 4ID5B 3QGIA 1KFSA 3SPYA 4DU1A 4MK7A 1NJWA 4K4ZA 1EETA 3RB6A 3MR6A 3HXMA 1OS5A 1EETB 4B9UA 2OPSA 2GBZA 2HNDA 4FZZA 3N6LA 2VA3A 4EP5A 4WFYA 3MEGA 2R8KA 4FK4A 2FJWA 1S1XB 3L3VA 4RG8A 5KT5A 4HKQA 2HNDB 4O5BA 5KG5A 1ZETA 3PO4A 1XI1A 1X9SA 4EEYA 5HRPA 3MEGB 1EP4B 4DLEA 3MTKA 1S10A 3BR9A 1JKHB 4AHSA 1C0TA 2EX3A 4FZYA 4K4XA 4IG0B 5HLFA 1ZBUA 3TR8A 2IMWP 2E6MA 2Y1IA 2XWYA 3AA5X 5DG9A 1C0TB 5KFQA 2D0CA 1NK4A 4TN2A 4KHMA 2HNZA 1WSHA 5KFBA 4PWDA 2OPRA 1S1TA 4TY9A 4CK1A 1HARA 3HVTA 3LP2B 4DL3A 3EPIA 4QAGA 3U3YA 3SNNA 2W8KA 3OS0A 4K8XA 5KFIA 1S0MA 1A5XA 2YNFA 3VQQA 2JEJA 3SQ4A 4J2EA 2E4LA 1T3NA 4KB7A 1LW0A 3PV8A 2V9WA 5KFVA 4W5OA 4DG1B 1XWLA 3ZT2A 1C1BA 5F8JA 4WYWA 2FLNA 2BGGA 1LW2A 3JSMA 4DU3A 4ED8A 4Z4EA 4NLSA 4YNQA 3IG1B 4CFCA 2HMIA 3IS9B 2QKKA 4J9QA 3AVKA 3JYTA 5DQHA 3WNEA 1JLQB 5KFJA 4CF9A 2FBYA 5KG4A 1BGXT 3VQ5A 1VSHA 3KOAA 3JYTB 3IGVA 3M9OB 3H4DA 1CZ9A 1SH3A 3NBPA 1NJYA 1S1VA 2V4RA 2CJQA 3NDKA 3TAPA 3QEVA 2IM2A 5KFPA 2BQUA 1ZBHA 3NGZA 4NRUA 1SUQA 1C0UB 4ECSA 3MR2A 1REVB 3ZCMA 3KK1B 3T5HA 4TYAA 3UIQA 1ASUA 1SUQB 5EWGA 4CGGA 5FRMA 1WNEA 3V6KA 4CEQA 3SCXA 3HJFA 3T19A 4ZPAA 4QWBA 4DSEA 5CYMB 5EU7A 4IH7A 4KTZA 2F8EX 3ZSWA 5KG2A 1W9HA 3NF9A 3T5JA 5KFAA 5CYQB 5C25B 4FLXA 5F8IA 4EYHB 1S5JA 3KMSA 4O55A 3OSPA 1KLMA 5F8HA 4F2RA 1D8YA 4G3IA 1ASWA 5KT6A 5HP1B 3QZ7A 3RR7A 4BE0A 3LALA 3D0PA 1BL3A 1Z26A 4LQ9A 4BE2A 4FJJA 3V81B 3P1GA 1WN7A 1SH2A 4C8NA 4B9TA 4FW2A 2FVSA 1UWBA 4NLOA 3VQCA 3DM2B 3HVRA 4CHYA 1HQUA 3RTVA 2B4JA 2YNGA 3MFHA 2ATLA 3DLHA 4Q5VA 1C1AA 2VWJA 3QIOA 2WRMA 1RTIB 4DFJA 1JXBA 1HQUB 1RT3A 2V4QA 2YNGB 5C24A 3DOKA 5KFRA 4B9LA 2O5DA 4MK9A 1RDDA 3OY9A 4CF0A 5CZ1A 4DTMA 4FLZA 3E01A 3DRSB 4HTUA 3VQ4A 4RW8B 1QS4A 4IFVA 1NKBA 5KFKA 3MXMA 2HHXA 3LP1B 1C0MA 4PUOB 4GMJB 3TANA 3NH2A 1VSKA 4GC6A 1SH0A 3G0ZA 3TAMB 4GC7A 5HBMA 2D41A 4WZQA 1B92A 4DSJA 3TAFA 1JXEA 2OPQB 4WXOA 1HRHA 4TQSA 5EWFA 4ELTA 4JV1A 1QTMA 1BISA 4EYIB 3KK2A 3KD1E 2XY8A 1MU2B 1IKVA 3BREA 4R0EA 4NLQA 4RU9A 4IR9A 3NF7A 4TSXA 3AVFA 3LPUA 1S1WA 4NYNA 1B9FA 1LAWA 3DMJA 1D5AA 4BDPA 3N6NA 1WLJA 1S1WB 1Q8IA 5KFOA 4Q44A 1ZBLA 2W7OA 3DMJB 1TV6B 2AU0A 2ZD1A 4F50A 2IM3A 3OL7A 1FK9A 3VQAA 1BI4A 1QQCA 5KG7A 5SWMA 3PUFA 3SQ1A 2VG6A 1JLBA 3C95A 2ZD1B 4RNOA 1KVCA 5KFTA 3KHHA 1FK9B 4QCLA 4QWAA 3I0SB 2XY6A 3RBEA 1TAUA 4IFYA 2J6TA 3CDEA 3FQLA 3OYCA 5FDLA 4OKKA 2JLEA 2X74A 5HRSA 1HJRA 4M94A 4QWCA 4O3SA 1UOCA 1LWFB 2XCAA 4CIEA 3K2PA 2FJVA 3OYLA 3SI6A 4ZP8A 2IA6A 3PHEA 3M8PA 1NOZA 2FBVA 4EBDA 4FJLA 5KRTA 3M8PB 3AVHA 5J2MB 5DQIA 1T03B 4PQUA 4E7JA 4CJRA 2UVUA 3RBDA 4CGHA 5I3UA 3VQSA 4CJTA 1L3UA 4IOBA 4M3WA 3MXJA 1C1CA 1L3SA 4NLDA 4TY8A 4KHQA 3U3GA 1ZTWA 3VQBA 3SJJA 4CCHA 3OS1A 1NJXA 4M3TA 2JEIA 1GOAA 2WCXA 2AGOA 3OYBA 5KG3A 4F4WA 1TVRA 4Q0BA 1YVUA 3V9XA 4LSNA 3FFIA 3DLEA 4C8LA 2RKIA 4K4UA 3C6UB 5KFYA 4LH4A 1XHZA 4OKEA 1DLOB 4ZPBA 1S1UA 1TVRB 4Q0BB 1RT5B 1KTQA 3B6OA 4LSNB 2F8TA 2RKIB 2HHUA 3IGNA 3NF8A 1EKEA 2FLPA 4KHNA 3EZ5A 1S1UB 1HPZA 3LAKA 4ZHRB 5JXSA 1GX5A 3DDKA 2WB4A 2HHQA 3QEPA 5KFUA 1UA0A 1GOBA 5EDWA 3AVAA 4BDYA 3ZT0A 2GUIA 3FDSA 3NGYA 4Y2CA 5KTQA 3SPZA 4XPEA 4RNNA 3PZPA 4FBTA 1Z4UA 1K1SA 2IS3A 3DOLA 4XIUA 3MEDA 2VG7A 3H98A 2BRLA 2D7SA 2WK4A 1JX4A 3DOLB 4ICLA 3C6TA 3MEDB 4E7IA 4KFBB 2HB5A 3KNAA 1N6QA 3HVAA 1VK0A 3PO5A 3DLBA 5F9LA 4NLGA 4JV0A 3S3NA 2I5JA 4ICLB 3B6PA 4CEZA 3OYNA 1TK8A 2I5JB 4QW8A 4NLYA 2F8SA 1TKZA 4ELVA 1EX4A 2HHSA 4CEAA 4EBEA 3L3UA 1TK0A 5KFDA 1TKZB 3GIIA 1RT1B 4NLRA 3MECA 4EO6A 3D45A 2WTFA 1NKCA 3L8BA 3G6XA 1IM4A 2HNYA 1U09A 3GIJA 3BGRA 3OLBA 1KFDA 2E9TA 2OH2A 1LAVA 3MECB 3UDLA 5J2PA 1TQLA 3BGRB 2DY4A 4CE9A 3TAQA 1TL1B 2JEGA 2VG5B 3RWUA 1TAQA 4NLVA 4ECTA 3CJ2A 4O4RA 4U7CA 3QEWA 4YP3A 1K6YA 3K5LA 5K14A 3G86A 1SL2A 3QLHB 5F9NA 1WAFA 1J9AA 1YTUA 3A2FA 1J54A 5DQGA 3AA2A 3O3FA 4CHOA 3NE6A 2DTUA 1JLFB 4ELUA 4J9SA 4ECYA 1RTJB 2D3UA 4ED1A 2KW4A 3HPHA 3VQ9A 4OKJA 1TKXA 1SV5A 2W9BB 4NLTA 2WOMA 5E41A 5F8LA 1JL2A 5HRRA 2HW3A 2KQ2A 1XR5A 1S9EB 3ISND 4DTUA 1SV5B 5L1LA 5KFMA 2WOMB 4NCGB 4YQWA 2XGQA 4F4XA 1IKWB 4QWDA 3DYAB 3MEEB 4MFBB 4AHTA 5C42A 1RTHA 1JLGA 4TXSA 4KHRA 1TKTA 4FLVA 2LSNA 4F4YA 3LDSA 1IKYA 4FJ9A 3CVKA 3HP9A 3ZSRA 5JUMA 1FKPA 2XI3A 3NCIA 3NH1A 3OJSA 1JLGB 1A5VA 4H4OA 5F8MA 3TQ1A 1IKYB 2RF2A 5KG0A 3E51A 1KRPA 4KO0A 3VQ6A 3DLKA 3CYMA 3TABA 5DK5A 2OPSB 3GQCA 4CJ5A 1ITGA 4N41A 2RF2B 4KO0B 2G8VA 3CJ0A 4O3NA 3BSNA 1RA6A 3M9MB 4DF8A 4DWIA 4N56A 1WSJA 3UPFA 4ECXA 4O4GA 1HYVA 5J1EA 5KGWA 4J2DA 5HLFB 1S9GA 3PW7A 5DLGA 4WFXA 5DGBA 1NK5A 4Q8EA 4GW6A 4O4GB 1VSEA 5J1EB 2F96A 1YTAA 1KVAA 3H08A 4M45A 1U47A 2X6SA 2HNZB 4O3QA 2GIQA 4PWDB 2OPRB 1S1TB 1I6JA 4Q43A 3HVTB 1F21A 2P51A 2JEFA 3CO9A 3BQ0A 4DQPA 4CHNA 2FVPA 3AVMA 3RB3A 2HVIA 4HCBA 4CJWA 4DLGA 4EZ9A 2O4GA 1U48A 4DL7A 3AA4A 4KAZA 4AILC 2XCPA 4M3XA 4HCCA 1S6QA 3TWHA 3HP6A 1JXLA 4CF1A 3KKSA 4ID1A 1R0AA 2UVVA 3CFPA 2YNFB 4MK8A 1RBUA 5DMRA 5EUHA 4Z4FA 3PVXA 1LW0B 1S6PA 3I8DA 3S9HA 1C1BB 1NK6A 3KHLA 2IBKA 2KTQA 4CGJA 1Y97A 1J53A 2C28A 4Z0UA 1QAIA 4ED7A 1LW2B 3JSMB 1FKOA 4ZVHA 1L3TA 5L1JA 2A1SA 4QPXA 4ZVFA 2HMIB 4O3PA 3KTQA 4OLAA 3OYAA 3HKWA 3OJUA 1FKOB 5HROA 1K1QA 5KI6A 2Z1HA 3MAQA 4FJ7A 1QSSA 4N47A 3O3HA 3OYKA 4KTQA 4ECWA 4Z4IA 5DG8A 2FBTA 3AO3A 4RW9A 5JS1A 3V9WA 2KFNA 1L3VA 4ECZA 5HROB 2ZE2A 3NBPB 4J2AA 1S1VB 2RPIA 4FXDA 4RW9B 4QWEA 4LH5A 2XC9A 2C22A 2DPIA 3ZSZA 2XRIA 4CHZA 1IG9A 2YHAA 1S0NA 3AVCA 4KTWA 5T14A 1EXQA 4KB0A 2Y1JA 2QXFA 4KE5A 1WSGA 1S0OA 4FS1A 1YVFA 1VRTA 2XI2A 1RTDA 3SYZA 4I2PA 4FW1A 3KHGA 5KGXA 4NRTA 3KJVA 3M9NB 1VRTB 5CZ2A 1IKXA 4E7LA 1S4FA 2IJFA 1RTDB 2OZSA 1TKDA 3NF6A 4E7HA 1HNVA 3KJVB 4HVJA 3H59A 1IKXB 1CXQA 4FBUA 4IRCA 3I0RA 1KLMB 1RT7A 4ZPDA 4MKBA 3HM9A 1WSFA 2OYQA 4ECUA 2ETJA 2HHVA 3AVBA 3QO9A 2FVQA 2ZKUA 4KBIA 2IGIA 4M41A 2XHBA 4Y3CA 2AX1A 1RILA 2IOCA 1HNIA 4CGIA 1UWBB 4GVMA 3H2LA 4ZP9A 3OVNA 1NJZA 2B6AA 3KLVA 4CF2A 3LWLA 4KREA 4KPYA 2B5JA
chains in the Genus database with same CATH superfamily
4DPUA 4RU2A 4IQXA 3V1QA 8ATCB 5IWAF 3GIKA 3ATVA 4AHUA 4URSA 5AFUA 4W5QA 5CA5A 4OLOA 4I7FB 3PW2A 2DIVA 4CZLA 2DRBA 3VVUA 3THYB 2CZ4A 4BRMA 3NL0A 1ULRA 1R3NA 3J81O 4RZRA 1VHXA 4GO7X 1WC0A 1UA1A 3M8QA 1NBEB 1KQFB 2KKZA 3KXDA 2WUSA 1LK7A 3UVJB 9ATCB 2NQPA 1IKVB 4C4WA 2ZBCA 2FIUA 4LF8F 1YRTA 5G4DA 4CEDA 1W0HA 1VIXA 3MTJA 3O80A 3L7OA 4EAHD 3UD4P 2F8HA 2KZZA 4WE1B 2NRRA 4DR6F 2J7UA 1C2PA 1X1PA 4BG9A 4JKHA 4X65F 5E0OA 4CQ1A 4C2MA 2VG6B 2PA8D 4A8FA 4FOEA 1U0HA 4P72A 3DXKA 1N36J 4FZXC 3H25A 4DL5A 2UXCK 4IFYB 3CCES 4FJ5A 1LXNA 4X4VA 4ECVA 3T1AA 3IXQA 3SBGA 2NNWA 3TP2A 3L2RA 1FF2A 2EFGA 1V5VA 2CNOB 4YB1P 3HX9A 3LOUA 4Y65A 1KQSR 3PIPQ 1FXXA 1P6TA 3ET6A 3UD3P 3CD5A 2PE8A 4I56A 3OLAA 2X3DA 4F04B 4NYOA 1FDBA 3A0IX 4UOCA 3QERA 2DH7A 4K50A 1OY9A 2G13A 1WD6A 4FWQA 2Q66A 4PQUB 2IDEA 1REGX 2IPOB 2DGWA 5AE3A 4LFCK 4BC5A 1EZZB 2NCKL 5EWEA 4ZVRB 4JV5F 3D9BA 2GVDB 2GTDA 3VZHA 4UZBA 4DV7J 4J9VA 1WEXA 2EG1A 4TY8B 2YKMA 4CO0A 5M1OA 3VESA 3VA3A 4RW7A 2RAQA 1FA0A 1KQGB 2G1DA 2NZCA 3HCXA 4XH5A 1VQLS 4N5SA 4CECA 1R0BG 2QL7B 4F4ZA 4LT6A 4DX5A 3EYZA 2LXUA 2AGPA 4B8AB 3FFIB 4R8UA 1WACA 2EWHA 3KLIB 4KHUA 1LWXA 1Z25A 3R3LA 1HUXA 2A2DA 3IUCA 1HPZB 3CJ1A 2W8LA 4C0BA 1NHVA 2Z56B 5HK4A 1U1KA 2NRWA 2EK6A 2ZJQL 2VBZA 4B3RJ 4F2SA 4I68A 1IBMF 2ZJPL 1WC5A 3HZEA 1XC3A 2D5RA 4QPTA 1Q1KA 2VG7B 1VDHA 2ZHAA 2Z58B 4BRPA 2GX8A 4ZKAA 1O1WA 1VMBA 1QVFM 4B3SK 1N6QB 3G82A 1NLKL 4DR4K 1TL7B 4B3RF 3SXLA 1BA1A 3S8SA 2UVRA 4ZCLA 1N4LA 4K5RA 1NGDA 3DI6A 4MIAA 2FJXA 4N77A 5DO2A 4J9KA 4CK2A 2HURA 5KG1A 2RJZA 1DY3A 4JI2K 2CJYB 2IVYA 3EE9A 4GRSA 1NGJA 2VBXA 3ZSOA 2BANA 3IRWP 3P39A 4Z4CA 2A2CA 4GV3A 4KH0B 2YQ1A 4GVBB 3GJQB 3ITHA 5BYRA 4IDKB 2DB1A 3FJ2A 4YOEA 3RRGA 3H46O 2HNYB 4KKOA 3SUPA 3WC2A 1D0EA 3Q8QB 2O66A 3CJTA 5J2PB 3K57A 4CH1A 3GIMA 4JRPA 2W9CA 1RT6B 1BCOA 5A8RA 1HR0J 4C8ZA 3D6MB 4ZVTB 3MWTA 3B82A 3CJ8A 3D5MA 3I9V9 3O5TB 3THWB 2BE2A 1YBUA 5K14B 2E5LK 2HQDA 3LGNA 4DTJA 2DGTA 3IRXA 1CXUA 4DUZK 1AT1B 5B0BA 1VGYA 5BREA 1TKXB 1J5OA 1SKSA 4HVZA 4IH6A 3OVBA 1IH7A 1NNEA 3ENAA 1VYAA 2BM0A 3PY8A 2AYEA 1ITPA 4CJEA 1BUXA 4X4RA 1RAFB 3DLRA 1XJWB 2DXEA 3QB0A 4UZCA 3GG4A 3P31A 5M2RA 3GV7B 5DLFA 4GY2B 4EMDA 1NDPA 5IS2A 3HSZA 3N01A 4BVPA 1XNQK 2DY1A 3DC2A 3Q8RB 5LSRA 1RCXB 5DM6Q 3WNGA 1SKRA 3JAMU 3GYNA 5KRSA 4QS7A 3OXGA 3KUEA 2KN4A 4IWVA 2VQFJ 4OZLA 1GK8A 3FRZA 3DLLL 3TTCA 3AVLA 4ILJA 1EP4A 4NXNK 1H7WA 3LL3A 1WEZA 1KVKA 4FM0A 1JXVA 4OX9K 4M95A 2GZOA 4C11A 1QTNB 4HL9A 1GFWB 4OPAA 4OPJA 2MKHA 2WSEC 2BW7A 3MMAA 4DV3J 4AXIA 3VQEA 3RR8A 1NOYA 5K20B 3HVWA 1S9GB 3RAMA 2VQFF 1FXLA 2Z1GA 5D4OA 3K17A 1TZ0A 4J8FA 3QINA 1M5KC 1RA7A 2Q36A 3VQPA 3QQCD 3FGVA 2XO7A 3LP2A 4ZJOA 4BGAA 4A48A 3V9UA 3ETOA 3CJKB 2UZAA 2K1RA 1QUVA 1Q18A 1NMEB 2CA9A 3ZZRA 3OYJA 3MXIA 4JI8K 1T3VA 4DG1A 2J8AA 5DM7Q 1ZOTA 4NWBA 2VFSA 1S6PB 3FKBA 4DX7A 4EK2A 3R7SB 4M5IA 4FLUA 1OVYA 5FRNA 1T0TV 3THXB 4FJKA 1OO0B 4CHPA 2PD1A 2ZVSA 4JI1K 2E1YA 4E8UA 4KI6A 1HIYA 3PJWA 3OHAA 3FK4A 1ATNA 3OTEA 3SDEB 1U49A 1CLFA 1PSDA 4EZ6A 3H3OB 4YY3K 1KONA 3UDVA 1ZA2B 2ZWOA 1ZBFA 2GMLA 2ZE2B 4UW2A 1AFIA 4I6YA 4GVLA 3KK3B 1W25A 3KK1A 2U1AA 1I94F 2OAUA 3CM6A 3W3SA 2BW2A 1RE1B 2QI2A 4WZMA 4KSEB 4H0YB 2B56A 3Q7CA 3GG0A 2G9OA 3E8OA 1NAQA 2P9IA 4A62A 3ZZPA 1Y9OA 3PEHA 2HFNA 3WEEB 4RWWA 1MA9B 2D3O1 3DKDA 3CFRA 3Q22A 4I2PB 3C14A 3I31A 1HL6A 5I4MA 4FDFA 4KC5A 2I1RA 4HHTA 3BZKA 1HNVB 3NWRA 2PFUA 4FM1A 3U1LA 4OGCA 1PC4A 3NGDA 5HP1A 3AARA 5CE3A 3J7AN 3PR4A 3TW0A 4ED0A 3T1YF 1B7FA 5FLXU 3MUMP 3V81A 3QO9B 1CULA 2P5VA 4KGXB 4OMFG 3CC7S 3CULA 5AZJB 5K8OA 2QTWA 4JEPA 3SUOA 3UQSA 2R2RA 2FZGB 2D0AA 3TA2A 1GLCG 3DXMA 2B6AB 4FVMA 1LKZA 3VAIA 2EFOA 1TUUA 1N32J 2HQGA 1RWOB 2JH3A 5KG6A 4LC9B 4ANEA 6FDRA 3GG1A 4PCQA 2JWKA 3WDOA 4AL5A 5JLHA 3MX2A 1RLDA 3DRSA 5KFCA 4RW8A 1YKWA 1T6DA 1M5PC 2ZQBA 3PACA 5AFUH 4PA1A 2E1CA 4HUEA 3QAUA 3M6XA 5HANA 2YTCA 4Q8FA 3G2XA 4JKAA 4JKEA 2LLZA 2D4WA 3H8YA 3J80U 4KHYA 3VAHA 4QYRA 3FNNA 2RIJA 1VOMA 1BOTO 4DR1K 4BRGA 2CQBA 2HFOA 2EVZA 4A61A 4FJMA 1GLDG 2HHHF 2RDDA 2VC0A 4WP9A 1LQ9A 4DZDA 1OYDA 3QBWA 4JRQA 3MCMA 3W65A 4CYUA 3EZOA 4URGA 2HHWA 1TV6A 1FX4A 4YUDA 1NGIA 3T1HF 1JWWA 4QU6A 3DNCA 3P6YC 4DFKA 2ROPA 2ZNZA 3GB0A 2HPUA 3Q8VA 4OHXA 4LVOP 1YJNN 5HMYA 3O9QA 1U0HB 2UXDF 5KT2A 3O4WA 4URQU 3MM6A 1CLQA 3G8SA 1XMOJ 4NI2A 3HM8A 3G9CA 2MPUA 3QGHA 3SCIE 1M5SA 2HVEA 3HI0A 1HLUA 3CQYA 5LY3A 2BBEA 2AYMA 1QSYA 3O8MA 3V6JA 3F44A 4PKHA 3CJCA 2PFFB 3ET6B 1FT8A 4C3MA 4OI2A 1HBOA 4U6PA 3MOZA 3MPUB 4KV8A 4MLEA 3J81Y 2ZZMA 2QE5A 3G87A 3OYGA 2BJDA 1W7WA 1WC1A 5FROA 5LMUF 2PMZD 1R8CA 3VAMA 3S1TA 3RMBA 4NLUA 2MQLA 2EEYA 4B1XB 4CIGA 2E1ZA 4RW7B 1PIEA 1T6CA 1RP5A 2R8HA 3SI8A 4H0VB 2N4DA 4B3MJ 1KS2A 3ULHA 4AF1A 1X9JA 4XO0A 4ERDA 1DLOA 3R6MA 1RT5A 3AQPA 3MMVA 1OWXA 4R8UB 3CJQA 5GINA 4W98A 3GP9A 1SL0A 4CH0S 1KAZA 2HLUA 2O3DA 4FYDA 1BQMA 3VF2A 4QOZB 4LBPA 1G3OA 4DTNA 1PYOB 4B1UB 3R5DA 4K8ZA 4ED2A 4QR0A 1VSLA 1B7YB 4JS4A 3N0VA 3PW5A 2NXUA 2BDPA 5M1PA 1J2VA 1Q81T 1OSDA 5LSLA 2D0BA 3KLFA 2KXHA 3QBXA 4FWLA 3OYDA 2HAFA 1YITN 3BPDA 2AT1B 3C65A 4BVOA 2FLLA 3G82B 2MZTA 1IO2A 4LF6K 1X0FA 3H45C 5H9EJ 3DI6B 2G8UA 3QT6A 1NXIA 2M70A 7AT1B 3WXJA 1KQSM 3M1VB 2X1AA 3CCEN 5BRHA 5TKYA 4Y6IA 2BANB 4ZCKA 3CFOA 4FJIA 4CERA 1HWIA 4DV6J 5GMEA 5H9FJ 3ENBA 2ROEA 3ALYA 3NAHA 2GJIA 4KKOB 3FBCA 4GO5X 5EVZA 3PX6A 4RNMA 2G2OA 2K3KA 2Z2YB 4HUGA 4AL6A 2V8HA 3HT3A 2W9CB 3FZKA 4DUTA 4ISFA 4HH1A 3L7UA 4CDIA 2CG8A 2WONB 3EVWA 2FF6A 1WHYA 3BP8A 3CC4S 4N76A 3QRPA 2X78A 2W9BA 1JNRB 1VQLN 3SZ2A 2IMOA 5HATA 2N3OA 2RSQA 4UF4A 1J5OB 5KT7A 4V19S 2KHDA 3AOAA 5KFHA 2XY5A 3M6GA 3U9DA 1WJ9A 4JK8A 2RHQB 2DR5A 3DYAA 2R8JA 2A3ZA 4LIRA 4K4WA 4ID5B 2HFUA 4CIOA 2P9UA 3FC9A 1NDLA 3SMPA 1HWUA 4OI6A 3BGOP 2V50A 4A8OA 4BGBA 1VQ7N 2GCFA 3FCHA 4F36A 3HXMA 4ED5A 1OS5A 1RBLA 2GMJA 2EK1A 2WBRA 5L39A 5FIIA 2OPSA 2HNDA 1BE4A 4CLUA 3UCGA 1RWWB 1AXQA 5C10A 4WFYA 1CQMA 4FK4A 4RG8A 1OPZA 5KT5A 4O5BA 4JHDB 2BABA 3TJ8A 3PO4A 1XI1A 4EEYA 1EP4B 2RU9A 2HRUA 1RKIA 2KYZA 3I4HX 3BR9A 4C11B 1C0TA 3OVAA 4FZYA 1X7VA 5HLFA 2IMWP 4A59A 3LDQA 4UY8O 3MCNA 1NGBA 3MMAB 2AF6A 1WDTA 1BC6A 1NK4A 3IKMA 4X4SA 4KJIA 1S1TA 5D0GA 4CK1A 1ATRA 2NZTA 3G8TA 1UVNA 3GCWP 3LP2B 3OXLA 4DR7K 2BYCA 4IOAQ 3SNNA 3OS0A 4U9RA 1OH5A 1A5XA 2QLFB 2K1RB 3FBBA 2M8HA 2YNFA 4HWIA 3NP5A 2ACMA 2CUYA 2E4LA 5HOOA 1T3NA 4LREA 2QFJA 4DG1B 2ZBPA 4J7CA 4C3LA 2RILA 4WK1A 4WQ5A 3IMXA 1FKAF 1HNWK 4DU3A 3ELHA 4ED8A 4CFCA 3JXOA 2QKKA 1IR0A 4J9QA 2PEBA 4ZCIA 4QIFA 1HW9A 1QVGR 3JYTB 2VDHA 3M9OB 3CCLS 1CZ9A 2HBKA 2ZGZA 3HF5A 2CJQA 2A5XA 3CJRA 2JLGA 1OVQA 1SUQA 3J7YI 2HBRB 4M7YA 4ECSA 4NZ6A 2LU2A 3MR2A 1K44A 3KK1B 1BMQB 4A8WA 3T5HA 4TYAA 2AP6A 2ZITA 4USVA 2FSKA 1IBCB 1YJUA 1YJWN 2FC8A 1WTFA 3SCXA 4DSEA 4YS2A 4MDAA 3KUHA 5ETMA 3H0PA 1Q8LA 2IVPA 1N88A 2F8EX 3ZSWA 2DPNA 2YWHA 5KG2A 1W9HA 4V19X 4DV5K 3CDAA 1DT9A 4O8KA 3C14B 1HFEL 5JMVA 4LRBA 1CBKA 2H4YB 3ILOA 1S5JA 2FJEB 2V67A 1ASWA 2GX9A 5FLXO 5HP1B 3PIOQ 3LALA 3TA1A 1Z26A 4ES2A 4LQ9A 4BE2A 4FJJA 4KGZB 4V1Ak 3V81B 1VBXA 5GMDA 1CULB 1SH2A 2MEWA 2XMKA 2J5AA 2AEFA 3IP0A 4FF4A 1UWBA 1UVIA 4ED4A 2GQ2A 4CHYA 5J1PA 3I6PA 2G1HA 3LDLA 3QWUA 2ATLA 4F3MA 4Q5VA 1C1AA 4DFJA 1JXBA 1VQ6N 3DXBA 1PJ6A 1KVIA 2VHGA 2DCLA 4B9LA 2O5DA 3S41A 1SC4B 1PBUA 3MCSA 3MGJA 4DTMA 1Z1ZA 3E01A 3DRSB 5ITHA 3VQ4A 4RW8B 1NKBA 5KFKA 1XNRF 1NM2A 2D9PA 4GC6A 1SH0A 2PIIA 5D0HA 4P7VA 4FPRA 3J80O 3D6RA 4BC2A 2VGMA 4GC7A 1FJGK 5HBMA 1WHXA 4WZQA 2AMCB 2H9ZA 1FEHA 1HRHA 5EWFA 3GMGA 1H98A 1QTMA 4H4KC 4YDXA 3W9IA 3KK2A 4CZGA 3KD1E 1LK5A 3CMES 3HHEA 3BREA 4TSXA 4H0PA 3KZBA 3LPUA 5DS7A 1U2CA 2ABYA 3WUHA 3M2VA 2VOOA 4IYQA 1Q8IA 4CYUB 1OY6A 2BUNA 2W7OA 1TV6B 1FK9A 1BI4A 5M1NA 3M05A 3SQ1A 5I3QA 1JLBA 4M5KA 1H2TZ 2W24A 3KJNB 1Y5LB 4QR1A 3QFUA 2QWMA 5MAOA 3FQLA 1MROA 3OYCA 3WT0A 1YWXA 4MMOA 2JLEA 4NI2B 3P5TL 3U8XA 3CCWA 2H51B 4O3SA 3WQPA 4P2MA 1N34J 3K2PA 2FJVA 2C2KB 3GDQA 4GNIA 4ZN3A 5LL6d 3M8PA 1C0FA 4EBDA 3KUGA 4OV6A 1JCFA 5KRTA 3B8AX 2ZH1A 1RZMA 4GKJJ 1OPIA 1HBOB 4AXJA 1UJ4A 5DJBA 5C2CA 4CJRA 5HQLA 3RBDA 2QGFB 3VQSA 2CAJA 4IOBA 3NXZA 2ZOMA 4M3WA 1C1CA 1L3SA 3VOVA 1Q5YA 2ZF5O 3U3GA 2H5JB 2E1PA 1NJXA 5LL6Z 2H48B 2JEIA 4NA1A 4CLSA 5CABA 1TVRA 1N36K 2D0PA 1YVUA 2V8VA 2VFVA 4LSNA 4QIGA 5BN8A 4C8LA 1M5VC 4LH4A 3MM5A 1DLOB 3D7EO 1RT5B 1WWHA 2RKIB 4BG8A 2HKEA 4RR5A 1EKEA 2FLPA 4KHNA 1SJFA 2MQNA 1U0SA 4JV5K 5AXNA 4DX8H 1GX5A 3DDKA 2HHQA 1B70B 5LXRA 5EDWA 4DN9A 3AVAA 4DUYJ 3ZT0A 3MD3A 2VODA 4Y2CA 3TWZA 5L8RC 3SPZA 3FCVA 2V51B 1RHKB 3DOLA 4XIUA 2DNGA 4NASA 2C3UA 3UD5A 2ZM6F 1TU0B 4M8LA 1HD1A 4ES1A 2FHMA 3C6TA 3MEDB 2ERRA 2HB5A 1XERA 3X3UA 3T41A 1FRIA 4OI0A 3OYNA 1TK8A 1PKUA 1U02A 2I5JB 2J4RA 2E5GA 4ZN1A 2F8SA 2MJUA 4DU8A 3UE2A 2RD5C 3SK3A 3TSQA 4LFBJ 1HI0P 4EFHA 4CEAA 4EBEA 2Q97A 5LJ3Y 1W2IA 3L3UA 4U67L 1B64A 2FD2A 5AQKA 4EO6A 3BEXA 1YZ6A 4JP8A 2WTFA 1IM4A 3BGRA 2OH2A 5KQDA 3K5PA 2J0QD 1TQLA 1A7GE 4W4MA 4Y2MA 1U1LA 4B3RK 2IVFB 2DY4A 1UPMB 4CE9A 3CD7A 3MZIA 3RWUA 2DGUA 4ECTA 3ZTOA 3CJ2A 4ES3A 5E3CA 1K6YA 4C1NI 3K5LA 2MZQA 1SL2A 1WAFA 4ILMA 4PG4A 1Y00A 2P9NA 1XK8A 2BVZA 2KFYA 5EXWA 2FB0A 2IIRA 3MDFA 3TJ9A 5B0AA 4MO5A 3VQTA 3DXSX 5E2QA 3ZZOA 4NEYA 3SMSA 2J9DE 3F5TA 4DV1J 1SV5A 2FJBB 3UNYA 2W9BB 2F9WA 3NLCA 2ZH5A 5E41A 2QT7A 5F8LA 2KQ2A 1XR5A 1VQMS 5DDPC 3N79A 3RUBL 5KFMA 2WOMB 4YQWA 2XGQA 1RXOB 2ZBIA 4B1YB 3UFCX 4QWDA 3DYAB 1FTCA 4FYXB 1RDWX 2OTJN 5C42A 2JWLA 2P9UB 3Q2TC 3NCPA 1TKTA 2CADA 4F4YA 2BE9B 2LQ8A 3ZSRA 5JUMA 2FTRA 1JLGB 1A5VA 4H4OA 4ZVSB 1WBBA 4YHHJ 1HR0K 3FMBA 1IKYB 2RF2A 2DRDA 3E51A 3DLKA 3TABA 4OI4A 4DR2J 3CCZA 2OPSB 2QWRA 3W2VB 3QSYB 3CJ0A 2DJWA 4O3NA 4A46A 5GAGP 3FBEA 1KC8O 5AQMA 3MHYA 4YHHF 3J8AA 3W3DA 3UPFA 2GHWA 3CERA 2O8DB 2F7VA 3KG0A 3CPEA 5HLFB 1TYQA 3GU0A 1F6TA 4O23A 5DGBA 1NK5A 2V63A 4Q8EA 4GW6A 3IBFB 3W8GA 2N82B 1DFDA 3VGKA 1VSEA 4CLYA 1MWZA 5B0FA 3P38A 1ZH5A 1NDKA 2FZCB 2HSTA 3AAWB 1S1TB 1XBWA 1W2BR 4Q43A 2P51A 2JEFA 3CO9A 1PBAA 2FVPA 2B7BB 4CJWA 2O4GA 2QSFA 4DV2F 4CZJA 3CJBA 2O8FA 3ISZA 3ZYYX 1OH8A 1S0VA 4CF1A 2A6AA 2ZJQQ 2YNFB 5M2PA 5G0RB 2QEXS 3CB4A 4YORA 4YB6A 1ACMB 4FWRA 3TA0A 3EKSA 4X4NA 1NK6A 5LJVA 2VQFK 4JI3F 2MZSA 2XTJP 4DXLA 3MK6A 2C28A 1QAIA 4ZVHA 1L3TA 2Q0UA 3EN9A 3OR1A 1VQ5S 2N4CA 1M1KO 1FKOB 5KI6A 4M5JA 2PC6A 3MAQA 4DV3K 4KTQA 3CC4N 4Z4IA 3WQTA 2FBTA 3AO3A 4RW9A 2YH1A 2ZOGA 5HROB 1HLWA 3CTRA 2UUAF 4J37A 3O3LA 4LSZB 2XC9A 2XWXA 1UVKA 3KWMA 3S6EA 1IG9A 2YHAA 4CNYA 3U9ZA 4L3NA 1WC3A 4OYXA 4B02A 3Q8YA 4JKGB 2Y1JA 4OZ5A 1FNOA 3TX0A 1WSGA 3C16B 3ZZZA 1YVFA 3K89A 3A3OB 3O1WA 3V4MA 1RTDA 4KGVB 1ROFA 3KHGA 5KGXA 3KJVA 1FJ7A 5JVHL 1VRTB 1IKXA 3M3ZA 1NGFA 3TVYA 3NF6A 1GMVA 4X4TA 3VHQA 3W9JA 5HSPA 4W92B 4RBTA 1VQNS 1I94K 4JI6F 4JKDA 3Q89A 3I8BA 3HM9A 3R5CA 5I3PA 4G9ZA 2OYQA 2HHVA 2ETJA 3NGTA 2WTUA 2Y8YA 1Q53A 2XHBA 1ZAVA 1HNIA 1VK3A 2XMJA 1UWBB 3TUJC 4UOFA 4J90A 3O08A 3KLVA 1FE4A 1Q82T 2IRYA 4KREA 1NBWA 3EDQB 2QA4S 1NO8A 2OMLA 3PX4A 4FWSA 5AQJA 4J9NA 2HF4A 1FI4A 1T8EA 3L3CA 2OD6A 3M2UA 2V6AA 2RVJA 3HHLC 1HI8A 3LPTA 2R7SA 1Y64A 1B0VA 1QQMA 1UEUA 3E01B 4H5TA 1TL5A 5CXTA 1QVGM 2XZTB 1P9YA 4OX8A 2QYGA 3DLLQ 4IG3B 5GAHP 3O9TA 5HBMB 3LQVA 4MO4A 5F1XA 1N8RT 2WSFC 2M88A 3KK2B 3WXLA 3C2PA 5E5NA 2LMIA 4M63A 2GV9A 2EG2A 3PYDA 1TGOA 4ZJLA 4BR2A 3CCLN 4KHPJ 2JHEA 3I5AA 4OYBA 3M2VB 1VLOA 3FBFA 3K5NA 4MTPA 1JB0C 3D3BJ 2E7XA 1HWLA 3FMWA 4LF7J 1NM1A 4DFPA 4Y1CA 2HAIA 3KJQB 3BDPA 5FLXY 1JJ4A 3VETA 4QZVB 3D2WA 1TL4A 1BI4B 1N32K 1UEKA 2OPPA 4R5PA 4H0TB 4USTA 1JLBB 1S57A 2MSTA 1K9MT 4CO5A 3DRRA 4CO2A 3SQ0A 2VL1A 4LF7F 2W42A 2RDIA 3VF4A 1MROB 2AD9A 2RHSB 4LFCF 4WYBA 3VEZA 3CGIA 2P9LB 1EWQA 2VQEJ 3HOSA 2DPJA 1UW4A 3LP3A 1NPRA 3HO1A 3R1HA 3HSTB 5C2FA 1L5UA 3B8HA 3KYLA 1T11A 3CQXA 3KIOA 4EIAA 2B9XA 3KLEA 2OIHA 3D28A 4UUWA 4GV6A 4CZHA 2ASPA 2DR6A 1RACB 1VBYA 2VQEF 4OYPA 4F8RA 3ONQA 2NUBA 4IKFA 3UW1A 1RDCA 1KSPA 4ZP6A 1URNA 1T9WA 3H7HB 3J80Y 4PL7A 3QATA 4AL7A 4CF8A 1N5YA 2F5GA 1C1CB 2P9GA 3M6VA 1VFJA 2AQ4A 2LU1A 1AB8A 2VU5A 4P7TA 2YNHA 3FSIA 3NFAA 4B3OA 4BACA 4H5NA 2QL5B 2P9PA 2EPIA 3G6ES 4WIQA 3AGRA 3OR2A 3TX8A 5CR4A 4DFMA 4ED6A 1XMOK 3Q86A 2KG1A 4EBCA 3MM5B 1NCLA 1YI2N 4AYBD 4H4MA 5ELZA 3TZZA 2W01A 4A47A 3O6WA 3B4DA 2JRSA 3G8QA 5JVGL 1C4CA 4DR4F 1SQKA 3RG6A 4K4VA 2ZUAA 5HL7L 1IVZA 1F5AA 4PXCA 4O3OA 3S3OA 3BKFA 3MI7X 3W5YA 4O8UA 4JI2F 1RT2B 3FQKA 1ZBSA 4FJ8A 1JCEA 2W4DA 3EO3A 3CMEN 5AQGA 4OJHA 3A8KA 3EZUA 1SAZA 3CDUA 5BYQA 1VQ4S 3C6TB 2P9KA 4PY5A 2AJ0A 3BH7B 2Q3SA 5I42A 4YDUC 5BR9A 1WOSA 2RH3A 3WC0A 5RUBA 2AZ1A 2N7CA 1R59O 1KAYA 4DMZA 1WSIA 4ZLJA 2YWEA 2FGCA 4KB1A 3PW0A 2ASDA 2V2VA 1N54B 2ASYA 4BBYA 5AQPA 3OFHA 2FPHX 2GMHA 4WF9Q 3DU6A 4JI4J 5J2NA 1P8GA 2YV0X 3A4TA 2UP1A 2E5LF 4LSLA 3F9MA 4LJMA 2OFHX 3SFGA 1VR6A 4PXEA 1HHQA 4FYWB 4CFDA 2EXUA 3QRQA 1KHWA 2XMMA 1HKCA 1H73A 3BSAA 1W97L 3GR1A 3QYYA 1NMDA 1T05A 4JI4F 4NLCA 1JLCA 2G8IA 4YDDB 4YFUA 2DNYA 3MN9A 2QWOA 2HRTA 3VMFB 1GLFO 2P9NB 3AVGA 1FDNA 3BZQA 1AZSB 4F4KA 1ZXOA 2PYJA 1YJVA 4CEFA 3CIZA 1CZBA 2AZ3A 1RBVA 1Q86T 4OYIA 2CPFA 1X3MA 5D8HB 1R7IA 5HO4A 2E6LA 4BRQA 2FXUA 3KG1A 4AT1B 1QSLA 2IHR1 2VUGA 3KD5E 4DV6K 4NXNF 4C9DA 2A6OA 5H9FK 4YOTA 4OX9F 3KHRA 3OYEA 5C42B 5A2QO 2W4PA 1TKTB 4YMEA 2QZ8A 3PX0A 4H4OB 3D4JA 2NXJA 3DLKB 4IH5A 3PSFA 2HBMA 5IV3A 1FNMA 2APOA 4DSKA 2RRNA 3W60A 2DNZA 4CO4A 1WAJA 3FUYA 2F4VJ 1YTYA 4YR3A 5T7LA 3DRPB 4JI8F 4ZPVR 3M8RA 4FM2A 2R42A 2YVSA 2C2DA 3V4IA 3C7NA 3MMCB 3T5KA 3U4LA 3LANA 3QETA 2GAHC 3H6EA 1BQNA 3ZSVA 2F9TA 3FZHA 1VQKS 1G1XA 3IWXA 2G8WA 4W5RA 4JI1F 1UFWA 3HFVA 3NH0A 1R8PA 1UWAA 1QHTA 1GX6A 2BR0A 2P1JA 2PGCA 5K8MA 2DEIA 4MIBA 2BZ2A 3SAGA 2QRRA 4H4KA 4RW6A 4WP8A 2I38A 2ILZA 3K58A 4CJUA 2IC3A 2E29A 3IG1A 2V7YA 3NNHA 3LM9A 1V9OA 2Y0BB 3M8WA 3VEWA 1B9DA 2M4MA 2QW9A 1VJQA 2Z1JA 3OR1B 1XR6A 4E1NA 4Y34A 5KFGA 3L4BC 4PQAA 4I9LA 4LRAA 3JS9A 1RB0A 4ZPTR 1UL3A 1E6VB 4TNOA 1V3SA 4K5SA 3C46A 4BR0A 1VQMN 2ZUGA 2F9DA 4USJC 4JV2A 1KVBA 5J2QA 4FXWA 2DHGA 3CC2N 5B0GA 3EGZA 4LIWA 2P5GA 3WIUA 3BBBA 2KFZA 1F0XA 3K59A 4P75A 5M1KA 3HD2A 2E9RX 3I32A 1M90O 2JL9A 2J7WA 4Q2MA 4M5MA 3TUIC 3W2WA 3RMAA 1YRXA 3T7ZA 3OTOJ 1RAEB 4FKXA 2D9OA 4QIWD 2DGOA 4E0DA 2DNKA 4MYUA 2KVIA 4P73A 3VGTA 4DDFA 2G8HA 3HPOA 3OYIA 1KVJA 1LXJA 5JS2A 1RWXB 3AVIA 3VWSA 3PYEA 3CWJA 4PYDA 2UU9F 4CJ4A 4X66J 4TU8A 3PRVA 4OVLA 3EY1A 4LF1A 4DTXA 1W2BM 1CG2A 4LFAF 3J7ZT 4WFZA 4IOXA 1D1UA 4DQIA 1S49A 4DF4A 2P9CA 4YR2A 1HNIB 3QIPB 3P3DA 3OW2M 5B0EA 4FK2A 2A41A 4IO8A 1KD1T 3SV3A 4G1QA 3R7BB 1OYEA 2Q1NA 3Q2SC 2VH7A 3KLHA 4JUZA 1DTTA 2I6WA 3TOQA 4AD6A 2W2NP 3MPVA 4DR1F 3NAEA 3WX8A 2W41A 1WNSA 1K8AO 4DMNA 4C8OA 2VWBA 3M2UB 1VRUB 4JI5F 3FLCO 2QJ3A 4ZPWR 3NG8A 5LMNJ 3T5LA 3DOMA 4IO9L 2QEXN 4WIIA 4ANDA 3H1VX 4LBIA 4A2AA 2O8BA 2W9AA 1MNEA 2OPQA 4ZDNA 4CWBA 1PYTA 2Q1LA 3HLUA 1WC4A 1MU2A 7FD1A 1RAAB 3VTIA 5IQQA 1VQ5N 5LMNF 5HMZA 3HPGA 4FWMA 1YBTA 3P5BP 4A8XA 1RYRA 1XMBA 2CH6A 4K0KJ 2R8IA 1APSA 1HBNA 1S97A 2BE7D 1F60B 1SL1A 1XNRK 4H54A 1I3AA 1U25A 3AXMA 5AZIA 2CG4A 2R4FA 4NLWA 2VFRA 2OPPB 4R5PB 2QA4G 2BRKA 5D4LA 1HQ2A 1X4EA 2LEPA 1BCMA 2A18A 4QU7A 2JC1A 4ED3A 3GFZA 1MG7A 5KT4A 2GHVC 2XO6A 4CESA 4IKAA 3GV5B 4J9PA 5E26A 3K5OA 1QAXA 4DR5F 1LWFA 3JS6A 2J76E 4WPAA 3RU0A 4ZP7A 3HOTA 1GXLA 3I55S 2CPJA 5D3GB 1VQNN 1HNXF 3KLEB 5J2MA 3EVMA 1T03A 1ASVA 3O8WA 1GMWD 3CPWR 2IAJA 3NMAA 4OPHA 2W6KA 2CPYA 4CFBA 3CF5L 3LAMA 4XPCA 4AQYJ 2W7PA 3CETA 1U2RA 4OV1A 1N5YB 2MSSA 4GMKA 3NCRA 1MWYA 5M2UA 1HYSB 2V52B 3CD6N 4B9QA 2YNHB 2QV6A 4KH6A 2QA4N 3OT9A 4B3OB 4WQ4C 1EAYC 3KWGA 4BREA 4JKFA 1QLNA 2ALZA 4FJXA 4RNHA 1U1OA 2LDIA 3HHNB 2KB2A 3SV4A 5F0XA 2YKNA 3V9ZA 4H4MB 1NK7A 2VWKA 3EMTA 1N34K 2C2NA 4ZHRA 3ZETA 3J7AP 1GLEG 4ZVUB 5DG7A 2LFVA 3MUTP 3K2YA 4LF6F 4DU7A 3C66A 2MQMA 4AHRA 4B08A 2QG9B 2H3EB 1R27B 1QZ5A 2WW8A 5AXLA 4RW4B 3D0IE 1ZM3A 3RAXA 1N5SA 1IG8A 1RBRA 4M3RA 2ZHBA 2RT3A 1SKWA 3FZLA 3WIVA 3WNHA 1CJUA 4XDDA 2DR9A 2P9KB 4ZLPA 3H5YA 1R8AA 3RRKA 2QSWA 3EGWB 2WVCA 3EPGA 3OL9A 3V1OA 1HMVB 5D6GA 4BRKA 1RDBA 1ZTTA 2WB1D 4YB7A 1A6LA 4ZOSA 2ZBQA 4AUKA 3VQDA 1YGYA 2JFDA 3A8YA 4WFAL 5HN0A 2PI4A 3DN9A 5AQIA 3ZEUA 1TUYA 3A8EA 5CY4A 1RT1A 2OTLS 3X1LB 5J2NB 1WG1A 2ZM6K 4LSLB 1OQ6A 1MMDA 3G4SN 4DUYK 1WSEA 2FC0A 5IC4B 1HWKA 1Q8KA 3CE8A 4JI7J 1LCUA 1TL1A 1HYZA 2VG5A 2L48A 4CJQA 1MN7A 1T05B 3GONA 1JLCB 3QLHA 1MN9A 2MY8A 1RKJA 2A6MA 2RMLA 3MWBA 1HQEB 4NLPA 1JLFA 4ZMMA 2DHSA 2FSNA 4NA2A 1TELA 1Q9XA 2G2ZA 1NGEA 3UR3C 4CIFA 2UVWA 2E9ZA 1OMSA 2Z30B 4F26A 2X1FA 3D7SB 3D1HA 4K25A 1KOOA 2QWQA 4ECQA 1Q7YT 3HHKA 3PFOA 4E19A 1FWKA 3TZXA 3OYFA 3G6EN 4LFBK 1CVJA 1LWEA 1S9EA 4LBHA 3SCKE 4D3HA 4Q45A 4WXWA 5AQNA 4EHUA 1IBLJ 1DTQB 2MYFA 2GW8A 1MMNA 2IYGA 3MEEA 2R2SA 4CM0A 3RMDA 4MFBA 5LJ5Y 3U6FA 1T9YA 4OZ3A 4PABA 3MM9A 4K4ZA 3O5BA 3U1NA 2J9DA 4CZEA 2OLWA 1K73T 2V2KA 4QYZJ 3A5NC 1EETB 4ZCMA 4B9UA 1PILA 2GBZA 4I69A 3AQOA 1F9EB 4FZZA 2Q3PA 2VA3A 5CH7B 4BR5A 1N33J 2ZBRA 3MEGA 2R8KA 4CP5A 4HKQA 1X0PA 1ZETA 4DR7F 3EICA 1X9SA 2ZDOA 4DLEA 2YKAA 2VFTA 1VQ4N 1S10A 1S12A 4AHSA 5GAEI 4DV1K 3TR8A 2Y1IA 2E6MA 4ETXA 3ZZYA 2XWYA 1X5PA 5DG9A 5KFQA 2D0CA 4UOGA 3KHYA 4TN2A 2R7XA 3C7NB 2A0FB 3MWPA 1HNWF 3O9RA 3HVTA 4DL3A 4UT4A 4HHUA 3EPIA 3AODA 4ETZA 4M1KA 3M30A 3MR7A 5KFIA 4CI6A 4YHHK 3VQQA 4PG8A 4J2EA 1C1BA 5F8JA 5IT0A 4WYWA 2X7IA 4GKKJ 1HNZJ 2FLNA 3P4IA 2UXBJ 2HHPA 3JSMA 4CLFA 1CJKA 4Z4EA 5A2QY 4JKCA 3IG1B 3CO0P 4X4OA 5D0EA 2KH9A 1WDDA 3AVKA 2M0GB 2GUPA 1S72S 3CIPA 3QJLA 2HWTA 5KFJA 4CF9A 2XLIA 5KG4A 3VQ5A 3TPQA 3FR0A 2RNEA 2NRHA 4GKKF 2DR8A 3NBPA 1S1VA 3GFHA 4CTAA 5D15A 3DFEA 3QFHA 2XSFA 1SPBP 4U67Q 3R3TA 3ZCMA 4U96A 3UIQA 3HD1A 2B4PA 3TUZC 5H1SQ 4D3GA 2FLOA 3QGPA 4CEQA 4ZPAA 4I1TA 2VBYA 4X64J 3LH2S 5AQOA 4IH7A 3W2WB 2D74B 4X4PA 2D3OR 1Y0HA 2FGOA 3PRDA 5IQ6A 2KYXA 4O55A 3OSPA 3HSCA 1KLMA 4OJGA 3ZXWA 4G3IA 5AE1A 5AQHA 5KT6A 3RR7A 5FJ4A 4HHHA 3D0PA 2CPXA 5F0UA 1TR0A 1BL3A 5K8NA 3UKRA 5U47A 3RSEB 1YAGA 4ILRA 4FW2A 2FVSA 4DV4J 4NLOA 3VQCA 2LQ5A 3G71S 3I9ZA 4H5VA 2D1KA 4HHJA 1UJ6A 1HKBA 1JCGA 3DLHA 3QIOA 4HTLA 3KKFA 5A0YA 1HQUB 1RT3A 1VQKN 1UKUA 3PSIA 1X4AA 2YNGB 5C24A 1IWAA 5AJ3J 1QY7A 4MK9A 1QZ6A 1BA0A 2UXCJ 4DV4F 2LXFA 1GLBG 1D8ZA 1JJ2M 4HTUA 1QS4A 4IFVA 2YI1A 3MXMA 1T9XA 2IDLA 3QJPA 2RHKA 1RU2A 1N0UA 4K2XA 4L74A 3DOMB 3NH2A 4R79A 3R5BA 1QUPA 4DSJA 3M2RA 4RUHA 2O8BB 4X4UA 2DNOA 2OPQB 1O6XA 1NGAA 1GLLO 3SLCA 1MU2B 3R2CJ 2YXLA 4YDUA 3TU5A 3LA0A 2K8GA 3DHXA 3W66A 1S1WA 4DPTA 4UQTA 2M9KA 3MAAA 4FYVB 3PKYA 1LAWA 3DMJA 1FFWB 4U7UD 1HBNB 3HJVA 2C2OB 5KFOA 1IQZA 3D2FA 3O9SA 1QQCA 2Q43A 4DBQA 2ZD1B 4RNOA 3GYGA 1KVCA 2DCUB 5CCLA 2AP1A 2XY6A 2PMWA 1HBUA 3T9NA 1K8AT 2J6TA 1H2VZ 3FZFA 3CDEA 2KU7A 2DGXA 2X74A 1KN6A 4M94A 4QWCA 3VPZA 4P2SA 1WELA 1LWFB 2XCAA 4ISEA 4CIEA 3NCQA 2ZHOA 4ZP8A 1TTHB 2FBVA 3OBWA 3B4MA 4FJLA 2IYIA 1N36F 2LCWA 5J2MB 5DQIA 1T03B 3BS9A 4KHPK 5I3UA 4OJ3A 1S22A 2QM1A 4LF7K 4B3SJ 3MXJA 4E1JA 4USKA 4KHQA 4M5HA 1G2EA 3D0GE 4CCHA 3SAFA 1DGKN 4NXMJ 3VEXA 3AFGA 5K8PA 1PG5B 4KR0B 4KGMA 3QMLA 3GIRA 2AGOA 3TYTA 5E3RA 5KG3A 3VAKA 4F4WA 4LUBA 5BXIA 3AA9A 3LDNA 3DLEA 2CRLA 2HIQA 2L3MA 3GCXP 4OHZA 1XHZA 4Q0BB 2VQEK 5IZHA 1KTQA 3E66A 2B51A 4J5OA 4DV7F 4NXMF 1GT8A 3EZ5A 2XG8A 1S1UB 4CW7B 4WJBA 3LAKA 5E3QA 4ZHRB 4WTYA 1GOBA 4PWUA 2MQ8A 4BDYA 2A10A 1F1BB 2GUIA 3H2UB 1DZ5A 3NGYA 3WXIA 1Q5VA 2QMUB 2BOPA 4JD2A 4RNNA 1Z4UA 3ID8A 2IS3A 3H98A 5EY4A 4FVUA 3JSRA 1M1HA 3GFYA 1R0CB 2KXNB 1IBKJ 1VK0A 2KT3A 3TSUA 3PO5A 3K0JA 3DLBA 4DUZJ 5F9LA 5EN1A 1CJUB 4JV0A 4NLGA 4ICLB 1PO6A 1YIJS 4FF3A 2YKOA 4CEZA 3CSKA 3PJ9A 1EKRA 3GJTB 4NLYA 3D0HE 4BRCA 2B4VA 1TKZA 1L3KA 1VBZA 1WB9A 2HHSA 4MLHA 1TK0A 3GIIA 1RABB 2MQPA 1RT1B 4OZ0A 3MECA 1NMNA 3CPWM 3L8BA 1U7LA 3G6XA 1NDCA 4ZVPB 4PXBA 3OLBA 1FFSB 3LDPA 1SJ3P 5AQRA 2FSJA 3I55N 1VI7A 4WKRA 1TL1B 1VQ9S 2VG5B 4PKDB 1TAQA 3LGHA 1EJ7L 4LR8A 4K59A 4CH7A 5BRFA 3TNVA 2CPIA 3G86A 2XYPB 3QLHB 3ILIA 4HDHA 2JFKA 1RHJB 3A2FA 1J54A 3O3FA 2DNLA 3NE6A 1JLFB 4ELUA 4EUVA 1X31C 4J9SA 4ECYA 2D3UA 3FSYA 2KI2A 4FVCA 2KJVA 4YOVA 3HPHA 2FY8A 1RWVB 1HR0F 4NLTA 3HULA 1JL2A 2HW3A 5HRRA 2QWLA 1NU4A 1S9EB 6FD1A 4R0JA 4JI4K 3HFKA 1EB0A 2KDOA 3MEEB 4MFBB 2IVNA 2YX1A 2CPEA 1RTHA 1MDUB 4FLVA 3LDSA 2F9JA 2YBVA 2ZC3A 3MM9B 3AAQA 3VEVA 5F8MA 1RHQB 4KO0A 3CYMA 1GXUA 2JJ4D 4JN4A 2AYGA 3QPIA 5HQMA 1NSAA 1SQEA 4PRFA 5AQSA 4K43A 1YUWA 3BSNA 4K2JA 1X4HA 2KLAA 1ESVA 1WI8A 4N56A 1RWKB 4O4GA 1HYVA 1NZAA 5J1EA 4J2DA 2XLJA 2CQ4A 2M3DA 1ZM9A 4BS2A 2CZ9A 1Y3JA 4O3QA 2E2PA 3HVTB 3D6TB 1F21A 2NXNA 3AVMA 3RB3A 2OTLN 4DLGA 3AA4A 3QJJA 5HL7Q 2GIFA 4M3XA 4HCCA 3M30B 1S6QA 4UTGA 4DV3F 3TWHA 3M8YA 2ZJRL 4MIWA 3CFPA 1RBUA 3ENOA 1FE0A 2UUBJ 3PVXA 1Y4ZB 2BEFA 1JMTA 4JKBA 1T44A 1C1BB 3QRRA 2IBKA 2BMBA 2KTQA 1RSCA 4CGJA 2KRBA 4ED7A 3JSMB 1DQ9A 1H7XA 2F4VK 5L1JA 4OLAA 1YJ9S 3K8WA 2UUBF 1AA1B 2Z1HA 3N5BA 2CQ0A 2IRXA 3V9WA 1CJVA 2CQ1A 2KFNA 4RWTA 4CBWA 2M52A 3NBPB 1S1VB 3TO8A 3CIMA 2AJ1A 4FXDA 4CTAB 1HW8A 2FQQB 5GAGU 2DPIA 1HBMB 1GEHA 3ZSZA 1ZAXA 2P9SA 3R27A 4P2FA 1X4GA 5T14A 3GYXB 2DNMA 1V4SA 1OY8A 2DD8S 4KE5A 5M1FA 3ZTPA 1XQSC 2L9WA 3W8PA 4FS1A 2J0XA 3ULEA 3CMAS 1NEEA 4P52A 3C3LA 1RLCL 2OJ3A 3QAEA 1V5IB 2IJFA 1FHTA 3OVSA 3F56A 5KAKA 4E7HA 3KVGA 5L38A 1RHRB 2CH5A 1GTEA 3L95X 1CXQA 2VKRA 4IRCA 3I0RA 1CS4A 1KLMB 1RT7A 3AB4B 5EX3A 2UUCJ 3EKUA 1UVMA 2FJDB 2AJFE 4QOTA 2VKZG 3AVBA 2FVQA 2ZKUA 2IGIA 2RE1A 4M41A 2AX1A 4MKVA 2MQOA 3NGKA 1BWVA 4FKYA 4WQ4A 2H5IB 3F0NA 4AFFA 2I8EA 2HZVA 2UUCF 2OEJA 1F9FA 1BUPA 4KPYA 4YOXA 1T9VA 5A0YB 5C2GA 4I2QA 4I7FA 2B5JA 3BY5A 1RT3B 5C24B 2LECA 1UFKA 2UU9K 3N28A 4OX6A 2GIRA 1Q8BA 1KTVA 4OJ1A 3OTOK 2HFSA 1UAWA 2C3OA 4YOWA 4LFAK 4IFVB 3OQ2A 5F2RA 3OFEA 2NRXA 1VSFA 2Z0GA 2MTLA 4ALZA 2ZC4A 3EE8A 4BDZA 4NLXA 3CMQA 1N32F 2DISA 2N7YA 5C7PA 4X66K 2OP5A 4YB5A 3M8QB 1S72N 1S48A 2HS0A 4B9NA 3MM8A 3SUQA 2IDOA 2DNHA 2ASLA 2PT0A 2P5OA 1T02A 4FLWA 4WE1A 2QC3A 2BM1A 3MAAB 2V9KA 4ZTFA 1F3VA 4EFAC 1FERA 2GO8A 4JI5K 3IFEA 2KO1A 4RNFA 4CJSA 1VK8A 3H1QA 3D2FB 4QBUA 5KFWA 1K47A 4FLTA 1SC3B 3THPA 4USHA 2PY5A 3JQJA 4LY7A 2AJ4A 3CD0A 3VR1A 4HYKA 3H5SA 1A5WA 1HBUB 2CZVC 4DR3J 3O44A 3ULDA 5LMNK 2ZH7A 3DXKB 4HLBA 2E2NA 2C42A 1OH7A 1BLUA 3THTA 1X3NA 3CJSA 3ZX3A 5D77A 1B0PA 2HVHA 1U1PA 2I7NA 1E3MA 3AVNA 4IOCL 2Z8QA 4EHTA 2WBNA 1PC5A 4JYAJ 3IBCB 1Q16B 2VA2A 2CVEA 3ZZ0A 1E4GT 4AHVA 5L9XA 3NVKA 3VQ7A 1RNHA 3GWCA 1EQYA 5FPEA 2CNKB 3MPDA 2W2QP 3HRGA 1XMOF 1ZBTA 4K0KK 2YKPA 2R8GA 3RAQA 4FS2A 1CJTA 2XNQA 2QK9A 5GAHU 1X9WA 5I3UB 3RBZA 1LOTB 4DI6A 3ZLJA 4JAXA 1P1LA 3NS7B 2X1GA 3T69A 5BPMA 2OI2A 3JXUA 4TQRA 3G71N 3EGNA 4HDGA 4DR5K 2VD3A 4CEOA 4OIXA 3RZAA 2BUPA 2QMWA 2R7TA 2BJ7A 2YKMB 5LSOA 3N9UC 2R7RA 4DN0A 3VGLA 1JLAA 2W2OP 3CCRS 3KLIA 1S99A 2YCHA 4F3QA 1HNXK 3DLEB 1N0VC 3OL6A 3WNFA 3L9ZA 4HUFA 4DS5A 2X1BA 2NZ4A 1NPKA 1RFQA 3MF5A 4CJKA 5B7WA 3PJXA 3LP0A 2WC9A 4L73A 2L08A 3PXGa 4B3MF 3SBMA 4CFAA 2NXCA 2DNQA 1D9DA 4PG7A 2WVEA 3A13A 4DX6A 4KGKA 4K42A 2IVOA 3EJMA 3HT0A 1UZDA 2YX4A 3CCUS 2D3ZA 3VVTA 3V6DA 5F3ZA 4IR1A 3AJDA 2DXDA 2G0JA 3DJCA 4DSIA 4X62J 2RQ4A 1BQXA 4H8KA 2G0CA 5IM0A 3UDCA 3NWGA 2V0NA 1T94A 5KOWA 3W1YC 4YR0A 3AXKA 5C0YA 4IDKA 1LV5A 4O44A 4M5DA 5E33A 1RCHA 4NCAA 4J9MA 4X62F 1WOQA 3SBTA 1MWQA 2U2FA 3ILLA 3BUZB 2EC2A 3OYHA 2HSEB 4IQMA 3DLGA 1RT6A 4CBXA 1M0SA 3ITHB 4FK0A 4F0MA 1IXKA 4CJFA 3THWA 1X4DA 3I5CA 3NNCA 3CJ5A 1EHWA 4LF5J 4ZLNA 4DHYA 1S59A 3VQ8A 3OTDA 4HTIA 3FZBA 3B54A 2XS2A 5A8RB 3M4XA 2COLA 4DQQA 4DV6F 4J9RA 2BE2B 3EZWA 3F9KA 5ADXH 2G8KA 3KNGA 2HGLA 3ZC4A 4HH0A 3K5MA 5IOLA 4LF5F 3IRXB 1SCJB 2ATQA 3PEJA 3A12A 5DETA 4JI0J 4CHQA 2V8GA 1NGCA 2MXYA 1UP1A 3JTNA 5E3AA 3HZ6A 2NRTA 2H54B 5B8HA 3M8ZA 5A76A 4CJLA 1WUUA 2JLFA 2VGNA 3SQOP 4CEBA 4B3TJ 2BQ3A 1DJ0A 3FVYA 5DDRC 1RQ0A 4S0MA 4CJPA 3IO1A 4L76A 1IN0A 4X2BA 1U6BA 1YRUA 3CI5A 3QEXA 4KRFA 2VPWB 1RTHB 4JI0F 3HFZB 5EHHA 4MKAA 3D3CJ 3J7YP 3BQ2A 1RDRA 2GA7A 1Q7LB 2B8PA 5DDQC 3L4QA 4OL8A 3TI0A 4OLPA 3CF5Q 1HJOA 1RTZA 2D69A 5F8NA 3FZMA 4GV9A 2MQQA 2QWPA 1NKEA 4DTRA 3T9ZA 2ITGA 1GMWA 2PYLA 4Z94A 1PGZA 1ZC6A 2ZWPA 1IBLK 3D6HB 4CLKA 1BO5O 2HHTA 3L2QA 4F02A 2YY3A 1RADB 2HRYA 4PKGA 2KJWA 3AAPA 2ADBA 2Z2LA 1H2UX 1IR1A 1S6QB 2R2UA 4QYZK 2EHGA 2XGPA 4B9VA 2YHBA 1SS6A 1IWGA 3LWMA 3MOJB 4XDCA 5HI7A 3E2EA 2KXFA 1VSDA 3QT8A 3IM9A 1N33K 1VQ9N 1NU0A 4WFBL 2WHOA 4E1MA 2G0IA 2BQRA 4O0JA 1ZBIA 3IS9A 1TP7A 1DARA 2W25A 2KM8B 1SC6A 1JLQA 3RRHA 2MKJA 4CO3A 3QNOA 1WKKA 2QN6B 4OYOA 4WCEQ 2HYIB 2BKOA 3KK3A 1XMQJ 2VOPA 1CJVB 2W40A 3EX7B 2E66A 4MDBA 1O0PA 2HGMA 4BROA 1C0UA 1URRA 3VAJA 1KBRA 2DKOB 1FVSA 4LF9J 2XB2D 4A8KA 2P9SB 1KDNA 3EM1A 3K7RA 4UUXA 4LQ3A 2W2PP 2F1FA 4EU0A 4NYFA 1XMQF 1Z2LA 1N5QA 1VC6A 2KHOA 3SQ2A 3LTOA 5FPMA 2P9IB 3AO2A 3ULEB 4KHWA 5I9EB 1UMJA 3BGUA 5CYQA 1RBSA 4GKKK 4OHWA 1FJGJ 3CCMS 2V5HG 3ILJA 5K5MA 2XMAA 1VCTA 4W5NA 1Q78A 3H5XA 1UETA 4CRJA 3I0RB 5D4PA 3IN5A 1CS4B 3L6QA 1RT7B 2AKWB 4F3TA 2LP4A 4I9QA 5AZJA 1QHAA 4DOZA 4BR9A 3QT7A 3R1LA 5IWAJ 4NYZA 1P27B 8AT1B 5GMKa 3OHRA 4F0HA 2M5YA 2BXJA 3BKTA 4WU2A 2W7AA 3EVOA 3AVJA 3ASMA 5ETNA 4K4TA 4ZS6A 3LDOA 3LM2A 1RTIA 2OA8A 3LO3A 1Q0NA 4JOUA 1WG4A 1LFWA 3DXMB 2B5JB 4I2QB 3HYFA 4BRDA 4X64K 4UQGA 5H1SV 4OX7A 2FJAB 2CQPA 3K8VA 1ZA1B 5IV4A 3MCOA 4LF8J 3L4IA 2AX0A 2YHWA 3BEGB 4PXDA 2C3PA 3BSOA 2WVFA 5AE2A 4DR6J 4X65J 1PJ5A 2CXEA 4WQ5C 3T6JA 2NRVA 3C94A 3EXCX 5DDOC 1WG5A 2KT2A 1YJ9N 3KJFB 3MM8B 1T7PA 1S77D 2K7KA 3CG7A 1YITS 4DV4K 3NAIA 1RAJA 1S7IA 1IV0A 5E7OB 4FSVA 4J2BA 1TK5A 2HQ3A 4IO1A 2XZDB 3ZTRA 3FFKB 3TEGA 5AJ3K 1F5BA 3I0SA 3BGFA 5BRDA 2R7YA 4ZJQA 2RE2A 3W64A 4O3RA 2ZEJA 3CMAN 2ZOFA 3MM6B 3QNWB 3QNNA 3IWNC 4JV5J 4A8QA 1BIZA 3CCJS 2NLXA 5B08A 4XH4A 2HLTA 3F2KA 2MKCA 2J6SA 3T3FA 2E5JA 2CQHA 4DQSA 4ATNA 4OHYA 1AFJA 1RWMB 2BTFA 4OGEA 5AXKA 2YQ3A 1Q81O 5L1IA 3BYRA 1C6VA 4Q7AA 2XMWA 1YDLA 3O4QA 5KFNA 2DGSA 4G6VB 2QA1A 2W2MP 4LR9A 1CJTB 3VENA 3I96A 4KV8B 3N6MA 5BYSA 1SXLA 4DL6A 2C2MB 1N34F 4PG6A 2RB7A 3BN7A 3GBTA 3O3GA 3CC7N 3R6LB 5K9FA 2DH9A 1GMUA 4LRFA 3VGSA 1QAJA 4NE9C 3HHLD 3MR5A 4GKJF 5IT9O 5B09A 2Q0RA 4KH1B 1QJHA 1JLAB 1RWNB 1OJ4A 1IBMJ 4B9MA 1U1RA 4CJ3A 3EDRB 5SUHA 1JL1A 1RU1A 3OA9A 3MD1A 2RN2A 2PA3A 4BC7A 3ISNC 3VF0B 1VQ7S 4M3YA 2IM1A 1D9AA 2X3GA 3M6UA 4OI1A 2MLXA 3LP0B 3F41A 1G7CB 4MH8A 2NPFA 1BQMB 1KP6A 2UV8G 1R8HA 1YT3A 3GJRB 1NB7A 4LMZA 4WFNQ 1U4BA 3VALA 3JQMA 3MCPA 1AYEA 4FPBA 4DTPA 4AH9A 3VF6A 3L2UA 2QKBA 4CI0B 4FNIA 2ZH3A 4DV7K 2WAQD 3V6DB 3KLFB 4NXMK 2GQQA 4CZFA 4M42A 4DUYF 3FGUA 2GC8A 1EX8A 2XBPA 2IFXA 2YWFA 3A5LC 4ISGA 3ZT3A 2XHWA 5ETSA 3M1VA 5IM0B 3ZSQA 4C8KA 4OPKA 3AD8C 4QQBA 3TARA 4U95A 4NCBA 4KT0C 1F3FA 2MB0B 3E9OA 3Q8PB 4O44B 5E3PA 4M5DB 2OKQA 3SCJE 4CJVA 4DTOA 4Z7YA 2O8CA 1S6UA 3PKMA 2F7TA 2NS1B 2BH1A 4BQZA 3W7BA 3QZ8A 3POTA 1R31A 4FJNA 2JVRA 1BWFO 1NK9A 2GQCA 3DLGB 4K7QA 1KQKA 4PG5A 4LFBF 2ZKTA 1K0VA 2E8AA 2XS5A 2B43A 1RBAA 3NHGA 5BPLA 2CKWA 4EP4A 3D66A 1FESA 4WTOB 2WONA 1HI1A 3CCQS 5J1NA 3C8YA 5JMNA 1IBKK 4JNEA 2DEJA 4U8VA 1H72C 4Y2AA 2HQIA 2RRBA 1B4SA 3NOCA 4IBNA 4BLGA 2XS7A 4LVNP 3OSNA 2X51A 3D6FB 3V1RA 3CCRN 1FCAA 4ID5A 1YJWS 2OZMA 1H1VA 1IKWA 3TAEA 3GLJA 4M3UA 3U02A 2GELA 2ZH8A 3DGVA 2J6UA 1X8DA 1QAYA 3SPYA 4DU1A 4MK7A 1NJWA 2CPDA 4RJVA 3RB6A 2OMOA 4DV1F 3K9KA 3A8IA 5ADZA 4B17A 5F41A 3HMJG 3UI3A 5A2QU 2QFIA 4OYMA 5GAEU 4A8MP 4NLBA 3VAFA 1VQYA 4JHDA 3N6LA 2BOAA 2R7UA 3ZZUA 4EP5A 1ILYA 3BO3A 2HNDB 4NMXA 5KG5A 2CQ2A 2NRZA 5KPRA 2B4OA 2DR7A 2XZWA 3W5XA 3MTKA 3CCUN 1FX2A 2GWJA 2HBYB 2EX3A 3CCSS 1ZBUA 2YJFA 3DCAA 1C0TB 4DR2F 4CZKA 4RPFA 4KHMA 1T9TA 4A8SA 4H5WA 5MLCQ 2HNZA 1S6OA 1VQ6S 4PWDA 1X60A 2GFFA 3EUNA 1HARA 2AYBA 4BHQA 1GLAG 1LNQA 4USIA 2RS8A 1BD6A 3UB5A 4ZK7M 3U3YA 2H65B 4K8XA 2XMTA 1EQMA 4W90B 3TTFA 4ENOA 2Z4PA 3OW2R 3SQ4A 4YEAA 1B0TA 1LW0A 1YJTA 5KFVA 4W5OA 2H4WB 4I0WA 3ZT2A 1WTBA 2VV5A 2ZJPQ 1HHSA 3NY0A 2AW0A 1I94J 1RHMB 4YNQA 4P74A 1T9UA 2HMIA 3IS9B 3IWLA 3JYTA 5AT1B 3IFRA 2EFVA 1ZZFA 3ZX0A 4ID8A 3WNEA 1JLQB 3E1YA 2AEJA 1ZS6A 2LYVA 1HPMA 1BGXT 2OEMA 1VSHA 3KOAA 3IGVA 1FNXH 1SH3A 4ZA1A 5CD4A 1NJYA 4HI2A 5KFPA 1RBOB 3SJHA 1C0UB 4UY8T 3ZFVA 4KPCA 4ILLA 1ASUA 1SUQB 3BKUA 5EWGA 4CGGA