1FK9A

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
536
structure length
519
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAITKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 146
structure length 519
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fk9A05
1BIZA 3NBPA 4CF1A 3SQ4A 5F8LA 1REVB 2G8HA 4HVJA 3HT3A 2IAJB 4IR1A 1HQUA 1JKHA 4DL3A 2KZMA 2R2TA 4BDZA 2ZD1A 2G8VA 4TY9A 3CJ5A 4HKQA 4DS4A 2YNHB 3RR7A 3PJXA 4TN2A 2YV0X 4HUEA 4DTUA 4KFBA 4LSNB 4O44B 1ZBFA 4ECZA 4ECUA 2HHSA 3IAYA 4Y3CA 2LSNA 3GYNA 2BGGA 4E7IA 4O4GB 4QWEA 1A5VA 1VSHA 4J9KA 2FVQA 1S1WA 1RT5B 3QZ7A 4FLYA 1HYSA 1QTMA 3NH0A 3OJUA 2D5RA 2PZSA 3BDPA 3KJVB 5K14B 1SL0A 4B9NA 1RT1B 4ZPBA 3JSMB 1Z4UA 4N41A 3G0ZA 5J2PA 4B9SA 4I9QA 2DFEA 4BE0A 3OYDA 1NK8A 4CF9A 4N47A 4WZMA 4CGFA 3MXJA 3D0PA 3CJ3A 4CHYA 3QGIA 3LP2B 3AVBA 1QQCA 4XPEA 4TSXA 1TK8A 3ULDA 1B92A 2ILYA 1SKWA 4CK1A 1JL2A 3K58A 5HBMB 4QAGA 2G8IA 4E7LA 3KHRA 3DLKA 4H4OA 1BI4B 1TAUA 3RB4A 3QEVA 2X78A 1N4LA 1NHVA 3H4BA 3V4IB 3VQDA 3DLRA 2FBTA 4HCCA 1RTJA 5KG2A 4FJ8A 4MIBA 3MEEB 4NLDA 1S1XB 3V6JA 2KQ2A 4FJ7A 1DTQB 5CYMB 5KFNA 3VQBA 1Z26A 3MXIA 2FLPA 3KHGA 1NJXA 4XPCA 1C0MA 4B3OB 2D3ZA 5KFWA 1S1XA 1HRHA 4HTUA 4NLPA 4R8UA 1NNDA 4KTQA 2F8TA 4ED0A 3T1AA 3RMBA 5KFKA 4JS4A 1TQLA 4J2AA 4RG8A 4NYFA 1TL3B 3AV9A 3DRSA 2F8EX 2UVRA 3S3MA 5KFOA 3SQ0A 3L3UA 5KFIA 3UR0A 4FM2A 1XC9A 2ZQBA 2YNIB 1J5OA 5F8HA 4W5RA 4EZ6A 3M8QA 4NLQA 2HNZA 3PW4A 1SH2A 3RAQA 5HROA 2VWKA 2QKKA 1KLMB 3ZSRA 1JLAB 2IAJA 3AA5X 4CERA 2BR0A 2JC0A 3HL8A 4C8OA 3DLGB 3P1GA 3IS9B 1D8YA 3FSIA 4WYLA 2C2EA 2AQ4A 3OL6A 1L5UA 1VRTA 4DTPA 4KPYA 1BQNA 3V81B 4F4YA 1A5XA 4G1QB 4M42A 5KFZA 1D1UA 2BE2A 4GMJB 3VQ9A 1UA1A 1Y97A 1RTJB 3AO1A 3PO5A 3KD5E 5HRSA 1JX4A 3ITHB 4O0IA 3TAMA 2D41A 1VRTB 1CZBA 1JLQB 1XI1A 2WRMA 4YQWA 1WAJA 4FLZA 4DTJA 4G1QA 4Z4EA 2I5JA 2V4QA 4GW6A 3PW5A 1N6QB 3ZT0A 5HBMA 4E3SA 1C0TA 4LH4A 3EY1A 4ZVEA 3QLHB 1T05A 1RT2A 5I42B 3OS0A 4C8NA 2C2DA 3MR5A 3H5XA 2E6MA 4OKEA 2RDJA 1JL1A 3V4IA 5F8MA 1VSDA 3NH2A 1SH3A 3HSTB 1QSYA 5D3GA 4M3RA 3QO9B 1G15A 3V9SA 1U09A 3N6LA 2B43A 3PW2A 4M41A 4N76A 4BE1A 2J6TA 3UPFA 5C42B 4MIAA 3KMSA 2KZZA 5C24B 3BQ1A 3MEDA 4DSJA 1GX6A 3EPGA 2YKNB 2AWZA 3ZSVA 2DPJA 4HUGA 1S0OA 3TARA 2HNDA 2B5JB 3AVMA 3M8SA 1D5AA 1NK6A 3OS2A 3DMJB 4DQSA 4O3RA 1QAJA 2ASJA 4DTSA 4H54A 3AVLA 2CKWA 1JLEB 1ASWA 5DGAA 4B9UA 3KMQA 2W7PA 3V9UA 2WOMA 4YP3A 3OSNA 3OYJA 3LPTA 1S9EB 3MR2A 1BIUA 4AH9A 1NJWA 2BE2B 2ASDA 2G8UA 4CHOA 2VG6B 4E7JA 2HNZB 4IR9A 1YVFA 5FRMA 4CJFA 3CYMA 4CK2A 1FKPB 4IOBA 4MK9A 5JUMA 3NMAA 4EEYA 2HVHA 2PY5A 3PV8A 5C24A 2AX1A 4B9LA 1XWLA 3ZSQA 3DLKB 5J2QA 3SFUA 5KFPA 1U04A 4YR3A 5EDWA 1QUVA 4PA1A 4TYAA 3PZPA 4FJ5A 3A2FA 4KO0A 4RNMA 3GIJA 4FM1A 3LAMA 1TP7A 1KLMA 4ZP8A 2FVCA 1UOCA 4CFDA 3V9WA 5KFVA 2R8JA 4RU9A 5CYQA 2E9RX 2RF2A 3TAFA 2R7YA 3NBPB 2OZSA 5KFSA 1TKXB 1TV6A 1S9GA 5HRNA 2OPSA 3OY9A 3KJVA 1LWEB 1DTTB 1GX5A 5KG5A 4ED6A 1C2PA 3KKSA 3KLFB 4CEQA 3DRRB 1F21A 1B9DA 1FKPA 3CO9A 2GUIA 3ZT4A 1S1VA 1XR6A 3KLHA 1WAFA 1LV5A 3QNOA 4CEOA 4C8LA 3K5OA 1FXXA 1UA0A 3DRPA 2HWIA 4JV0A 5KFUA 5KFTA 2AGPA 4FVMA 4BE2A 4M3TA 5L1JA 4Y1DA 4KB0A 4PY5A 4ZVFA 4KKOB 4OPKA 3G6VA 1C0UB 3CFOA 5KFHA 4U7CA 2B5JA 1TGOA 3BSAA 4KB1A 1NKCA 3U6FA 3KK2A 3WNFA 4OKKA 4J9PA 2QE5A 1WNEA 3QZ8A 5DQGA 5KG1A 2UUTA 4I7FA 4H4MA 2HHWA 3SI6A 4PUOA 3WNHA 3UQSA 1K1SA 2VG5A 1Q8IA 3OL9A 1Z25A 2W42A 4ZP7A 4YFUA 4NLSA 4ZPAA 4RNFA 4ECSA 1KSPA 4QOZB 1BHLA 3TQ1A 3SUPA 4CJRA 2KFNA 3K5NA 3D5MA 4CJ3A 1VSLA 1HQEA 1VRUB 4WZQA 4Q0BA 3NH1A 4ELUA 4YMEA 3GQCA 5EWGA 3JYTA 3FFIB 1W9HA 3LZJA 1KCFA 1NK7A 3SJJA 4ECXA 4CGDA 3ZT3A 5KGWA 4FZZA 3OYFA 3TI0A 4J9OA 3HPGA 1N6QA 5DLGA 4DSFA 2FVRA 1J9AA 4CJLA 1QSLA 4KV8A 4NCBA 3ITHA 1RDRA 3FDSA 3OHBA 1RBUA 3MEEA 4FK0A 2BQ3A 4RNHA 1NJYA 3D28A 1N5YA 4E19A 1J5OB 4O3NA 3CQ8A 4MK7A 4FLTA 2WONA 4AHRA 4CJEA 3MECB 2O5DA 4DQIA 4KFBB 4LSNA 2RDIA 2DPIA 2XY8A 1TKXA 1TV6B 4Y1CA 3AVFA 1QS4A 3RMAA 2OZMA 4FJGA 3KNAA 3EZUA 4KHQA 2FVPA 2X6SA 4ICLA 3M8QB 4RW8B 3L2RA 3V6HA 2IBKA 4NYNA 4KHYA 5HROB 1C1BB 1N56A 1S6QB 5KG3A 1S0MA 1WSFA 3BGRB 4CF2A 3DRSB 1HPZB 1J54A 1R0AB 4PWDA 4DTMA 4F4XA 4ZHRA 2P5OA 2JEGA 1WN7A 5J2MA 3C6UA 4Z4IA 1TK5A 1HNIA 3CJ2A 3V9XA 3KD1E 4HUFA 5KFDA 4HHTA 1BI4A 4NLXA 4ED3A 4EP5A 4TQSA 1S1WB 3NFAA 1FK9A 3H5YA 3DLEB 2ITGA 4CEDA 4K4UA 1QHTA 4KE5A 1YVUA 2W7OA 4CFAA 1RT7B 4EZ9A 3P5JA 4LY7A 2HHQA 4Z4HA 2OPPB 4F4ZA 2FBYA 3DM2B 2V4RA 3L8BA 1SUQB 2YNFA 3B6PA 4CF0A 2HNYA 1RDAA 1HQUB 2Z1IA 3AVHA 1LWFA 1LW0A 1J53A 4Q43A 1S6PA 3E01B 2BANB 5CZ1A 1JXLA 4DS5A 4DSKA 4JS5A 2AX0A 4RUAA 2IDOA 3AVJA 4Q8EA 4CHNA 3T5JA 4ZVHA 2X6NA 4K4VA 4IG0B 2F96A 2FC0A 3RB6A 4E1NA 3EYZA 3ZSYA 3CWJA 5KRSA 4DSLA 4M3XA 1S5JA 1XR7A 2IJFA 5KFRA 4FJ9A 3OYBA 2P51A 4F4KA 3M8PB 4W5QA 1C1BA 3OYEA 3IN5A 5KRTA 2Z1GA 3HPOA 1KTQA 4M3UA 2WK4A 2IM3A 4WE1A 3LP0A 3I0RA 4OJRA 4CEAA 1FK9B 1RTIA 5FRNA 4Z4CA 3AVGA 1ITGA 5JXSA 1BGXT 3KLEB 4Y2AA 3IRXA 2JC1A 4GVMA 1D0EA 2XI3A 2JEFA 2BQRA 1RNHA 3DRRA 3OYKA 4IBNA 2ALZA 2ZE2B 4E7KA 5F8NA 5KG7A 3WNGA 3LP1A 4H4OB 1WSHA 1RT5A 3KLEA 4B08A 1GOCA 1S9GB 2W9CA 4Q44A 2OPRB 3DI6A 1NK4A 1L3VA 2GV9A 5C5JA 3GILA 2G8WA 2V9WA 2YNGB 1IKYA 1IO2A 2D0CA 1JIHA 5KFGA 2AJQA 1TL1A 2HHVA 1S48A 3BQ2A 5CY4A 4E1MA 1C0TB 3PY8A 3G10A 4IH5A 1CLQA 3CM6A 4EBEA 3NDKA 5SZTA 1NJZA 4DL4A 2D0BA 3G86A 1EP4B 4KAIA 1L3SA 3CDWA 3TANA 2JLEA 3DYAA 1LWCA 2YHAA 3H5UA 3VQAA 4CECA 5KFQA 4F4WA 4DFMA 1VSKA 2P1JA 1TAQA 4NCGA 1BQNB 3SI8A 4G3IA 4JV2A 2W8KA 1VSFA 4MKBA 3HP6A 3NE6A 2VG7B 4K4ZA 3DLGA 3KK2B 5KFAA 1S1TA 3V1RA 3DOLA 3RR8A 3T5HA 3QGGA 3DOKA 1VRUA 1Q9YA 1RTHA 2P5GA 3OYAA 4UQGA 1RBTA 2R8IA 4XIUA 1RT3B 1IKVA 3C6TB 1S4FA 1WLJA 4FW2A 5DMRA 1RBVA 2RPIA 5DLFA 2HMIA 3O3GA 3V9ZA 3GIKA 1ZTWA 2AU0A 3OYHA 5C25B 5KT7A 5D3GB 1RTIB 4CHZA 4K8ZA 1LW2B 1ZBUA 4TYBA 2W9AA 3AO2A 4URQU 1WNSA 1IKXA 3M9OB 4ED7A 1IKXB 4KTZA 3QEWA 1BCMA 2ASLA 5DG7A 3BSCA 4U6PA 2ATLA 4F2RA 4W5TA 4IDKB 1EETB 1YTUA 4O5BA 4DL6A 2W9CB 4IFVA 3CFRA 4WXOA 1BCOA 1C6VA 3I5CA 4CEBA 2WCXA 4I9LA 4BACA 2HHTA 4RW9A 1TKTA 4QW8A 4WXWA 1RT6B 1LWEA 1S10A 3SUOA 4B9VA 2HAIA 5EUHA 3H5SA 4O4GA 1TKZB 4IRKA 1RBRA 2YHBA 5J2NA 1U47A 4IDKA 1MU2B 2XWYA 1JLCA 1ZBHA 1IKWA 5KI6A 2D3UA 4CIGA 5CZ2A 3VQ5A 3M9NB 3T5KA 3NCIA 4X2BA 1C1CA 2ZD1B 4J9MA 2DFHA 4EYHB 1LAVA 3O3FA 4RW4B 1VSIA 5HP1B 4FLVA 1S49A 4KRFA 1T3NA 5FDLB 5L1LA 3QEIA 1QE1B 1S1UB 4F8RA 4QPXA 4BDYA 4O3OA 3DYAB 4CJVA 4OVLA 5K14A 2ETJA 4YNQA 5KFMA 3QEPA 2OYQA 1JXBA 4M95A 3SPZA 1RT4B 3CDUA 4XO0A 3NGYA 4FW1A 4OGCA 1DLOA 1U49A 4O3QA 1WSIA 3Q8RB 3KLIB 1QSSA 3DLHA 4CJPA 1HNVA 3RAXA 2FBVA 1MMLA 2V0NA 4TLRA 2B4JA 4I2PA 4DL7A 1WSJA 4DFJA 3PR5B 4ECRA 4FK4A 4CFCA 3AVKA 1TKZA 4WFYA 4LH5A 4CIEA 1ASVA 2R8GA 3VQCA 4DF8A 1TVRA 4CJTA 1T94A 3VQEA 3MEGB 3TVKA 4GC6A 3MR6A 1YTAA 3MEGA 3V6DA 2IM0A 4ZTJA 3V1QA 3K5LA 2FLNA 2A1SA 3NAEA 3QNNA 3PJWA 1RDBA 4RW6A 1T03B 3HVRA 4IH6A 4AILC 2OPQA 1RILA 4IKFA 3CFPA 4CGGA 3PX4A 3JYTB 1C1AA 3ZT2A 3VQQA 4E0DA 4KHMA 3OYMA 4DSEA 3PR4A 1U45A 3ALYA 4AHSA 4NYZA 3DI6B 4FLUA 3RWUA 5EWEA 3PW7A 1RAJA 2G8KA 2HB5A 2ILZA 2AGQA 4ID5B 3LP1B 3NL0A 5T7BA 3SQ1A 4M3ZA 3I5AA 4CJKA 4B9MA 5KT4A 4FCYA 4O4RA 5JS2A 2JEIA 3ZSOA 3PO4A 4CFBA 2PYJA 4NLVA 3S9HA 1S97A 2UUWA 1ZETA 3MF5A 1C1CB 4N5SA 3RRGA 3CVKA 4R8UB 1HYZA 3C95A 4BWJA 4PQUB 4Y2CA 3KLVA 4FS1A 4K8XA 2HW3A 1UAXA 3MTKA 4Y34A 2IS3A 4KHUA 4MK8A 2FJXA 3IGNA 4NCGB 4J9SA 3I0SA 4O55A 4TY8A 3RRHA 3N6MA 2J6SA 3KLIA 3QYYA 4MKAA 5KG6A 1KRPA 2DFFA 1LAWA 1QAIA 4MFBA 2X74A 3SCXA 3AVIA 2OA8A 3KK1B 3O4QA 3BJYA 4NRTA 3MR3A 3U3GA 4O0JA 4O3SA 1L3TA 4PUOB 4EYIB 2EC0A 3GV8B 2KTQA 2WTFA 3ZSXA 3NAHA 3QEXA 3V6DB 1W0HA 3ICLA 4NLTA 1JLFB 4F3OA 1ZBLA 4QCLA 4YR2A 1K1QA 4NLWA 4Q45A 1A5WA 2HNYB 3VQ8A 2FJVA 2OPQB 4DL5A 3C94A 4RZRA 4J2DA 3HK2A 1NOZA 2E4LA 4FYDA 3TAPA 3Q8SB 4KKOA 2C2RA 3H2LA 4NLRA 3MFHA 3LANA 2BDPA 4KSEB 3CJ4A 3B6OA 5KFFA 5F8JA 4DTXA 5J1EB 4I2PB 4E7HA 2O4GA 4FJKA 3TAQA 5KFYA 4M45A 3I5BA 4KHNA 3WNEA 3PVXA 4LQ9A 4IRDA 4KI4A 3QINA 4PWDB 2YNFB 1RTDB 3DM2A 4Z0UA 2DTUA 5L9XA 3T5LA 3HPHA 3C6UB 1S9EA 2R2RA 5T14A 5DQIA 1X1PA 3PW0A 4ELTA 1RT7A 3NAIA 3GV5B 3AA2A 3KLGB 1HPZA 2BRKA 2RF2B 2W8LA 3H08A 3EPIA 5CYQB 1JLEA 4RW7B 3HHKA 1HNVB 3S3OA 4O44A 1EETA 2HWHA 4DU4A 1D9DA 2GC8A 3KOAA 4EBDA 4FBTA 3IG1A 3KIOA 2XGPA 1SL1A 1JLFA 4N56A 3THVA 4W5OA 3S3NA 4IFYA 5KT6A 4ID5A 1JLCB 3O4NA 4DWIA 1HARA 2BRLA 4DMNA 4DG1A 1TKDA 1EXQA 2B6AA 3LDSA 1ZYQA 4J2BA 4MH8A 4DEZA 3UDLA 4RW9B 1TL1B 2DY4A 1JLBB 4CJQA 3DOLB 1B9FA 4ICLB 3M8RA 4O3PA 4CE9A 2WB4A 4FJXA 3QLHA 4B3OA 2YNHA 3QESA 3GIMA 3QERA 4QWBA 3L3VA 3NKYA 4CF8A 4OPJA 3N6NA 3OL7A 2XCPA 4JRQA 3OL8A 5F9NA 5HLFB 1KVCA 1IM4A 4KI6A 1RT3A 2OH2A 1JLQA 4B8AB 3TAMB 2XY7A 4LD0A 3QGHA 1FKOB 3VQSA 2XY5A 5J1EA 4KREA 1HJRA 5DK5A 4I2QB 3KK1A 2WHOA 4AHCA 4JV1A 3OS1A 2YKMA 2HMIB 1RDCA 3TAEA 3E51A 3I0RB 3LP0B 1KVAA 2ZKUA 4IFYB 3QO9A 2R2SA 3TABA 4R5PB 4JLHA 1SKRA 3SYZA 1SV5B 4IQXA 4R5PA 4H4MB 3IG1B 3VA3A 4K4YA 3L2UA 2E9ZA 3UIQA 1RBSA 3VQ6A 4Q5VA 4FM0A 1YT3A 4ZMMA 4DU3A 4ZVGA 3SNNA 4RW7A 4OL8A 3DLBA 4DFKA 1HMVA 2FBXA 2AGOA 4I2QA 1VSJA 1IKWB 3LZIA 1KHVA 2YKMB 5KFBA 1QE1A 1S1UA 1EX4A 4QW9A 4CK3A 1RT1A 5DG9A 3DLEA 4H8KA 4FBUA 5DGBA 1X9SA 3BQ0A 1ZBIA 3HVAA 3K5MA 3LWMA 4CGJA 4CESA 5E41A 3V81A 4ZP9A 5KT5A 4CCHA 4KV8B 2Z1HA 4CGHA 4ECYA 1R0AA 4KAZA 4ZTFA 3OLBA 2OPSB 4B8CA 5DQHA 1T8EA 4CJSA 2XRIA 3FRZA 3Q8QB 4BDPA 3HO1A 5EWFA 1CXUA 1HYVA 3DDKA 2IC3A 3QIDA 3PHEA 1TKTB 1NHUA 2QV6A 3KHLA 1NK5A 4DTNA 3HKWA 3FQKA 3QIOA 3OYGA 3PUFA 4L8RB 2IOCA 4EP4A 1IH7A 4NLOA 5FDLA 3PX6A 2GIRA 3PX0A 5HP1A 2RKIA 3L2WA 2Y1IA 3CG7A 1FKOA 3SV4A 2XY6A 3C6TA 2IJNA 1S6QA 1Q9XA 1NKBA 3K2PA 1LW0B 5JS1A 3L2VA 2IC3B 4J9LA 3CDEA 5DG8A 2XI2A 5KFCA 3ISNC 3MXMA 4FK2A 4OGEA 3OJSA 1W25A 1GOAA 3HVWA 1X9WA 3MAQA 3SUNA 4KBIA 4URSA 4FJNA 5KT2A 3D45A 4LSLB 4CGIA 4C8KA 5J2NB 1I6JA 3H4DA 2VA2A 3F9KA 3QETA 2UVVA 4DTRA 3NF6A 3OVNA 1NK0A 2HHXA 4WFXA 4Q0BB 2QKBA 2YKNA 3BR9A 3V1OA 2B6AB 4DSIA 1HYSB 2IM1A 4FZXC 3DOKB 3Q8PB 1S0NA 4NZ0A 4DG1B 4ZP6A 1WSGA 4F50A 2EX3A 4EO8A 4W5NA 3OHAA 4FZYA 1GOBA 2VG5B 2Y1JA 1IG9A 4ECWA 5KT3A 3LAKA 3LP2A 4RNOA 1RTHB 3NGDA 2KFZA 2UVWA 4IRCA 3I8DA 2GBZA 3G6XA 2GIQA 4ED1A 1RT4A 4FLWA 4WYWA 1JXEA 5J2MB 4PQUA 4OLBA 5C25A 4F2SA 1RTDA 1EKEA 4MFBB 3BSOA 2I5JB 4I7FB 3I0SB 3NF9A 4TQRA 1ASUA 2VG6A 3HVTB 1TVRB 3G6YA 1IKYB 4ZHRB 4IH7A 3OYCA 3AO4A 4CJUA 4QWDA 1EP4A 5I42A 3KK3A 1HMVB 4KHRA 1RYRA 4K4XA 4KB7A 2OPRA 2XHBA 1KHWA 3RBEA 4WE1B 4TXSA 4ED2A 4KHWA 2QXFA 3KK3B 3RB0A 1SV5A 4C8MA 3KHHA 2HNDB 2R8KA 1N5YB 1JKHB 2JEJA 1UWBA 3IRXB 4DLGA 3SQ2A 4J2EA 1I39A 3CJ0A 4KO0B 3T19A 4HYKA 3VQPA 2W9BB 2XCAA 2CJQA 1RCHA 4AHVA 3ISND 1KFSA 1RA6A 1UWBB 2Q3SA 1N48A 3P83D 1VSMA 1BL3A 5KGXA 5HLFA 4OKJA 4IKAA 2R8HA 4ECQA 5EU7A 2VA3A 4M3YA 2Z1JA 1TK0A 2XC9A 3H59A 1RA7A 1BQMB 3QIPB 4Q8FA 4NLUA 3SFGA 2RN2A 3O3HA 3NHGA 4DQQA 4YR0A 3GIIA 1D9FA 5F8GA 5J2QB 4ED8A 3AO5A 4M94A 2FLLA 4RUCA 3MECA 1CXQA 3ZSWA 3M9MB 1NK9A 4ELVA 2BQUA 2ZE2A 3FFIA 1JLBA 4CHPA 2XGQA 1CSJA 3H40A 1LWFB 3DMJA 2G8FA 4EBCA 3RTVA 2XO7A 4HCBA 3OLAA 3KLHB 2OPPA 3V6KA 4DLEA 2EHGA 2IGIA 5KFLA 1S1TB 4ZPDA 1U48A 5KTQA 3LPUA 2WOMB 4J9QA 3ASMA 3RBDA 1NKEA 4MQ3A 1S6PB 3E01A 4QWAA 4EO6A 3BSNA 4WFZA 3TWHA 1ZTTA 1DTQA 5CYMA 1NOYA 1DLOB 3AA4A 4DF4A 3QIPA 4ID1A 1SUQA 4K4WA 3L2QA 1CZ9A 3FQLA 3K57A 3LP3A 5KFEA 4IG0A 1K6YA 4B9TA 1XHZA 3KTQA 2HHUA 2YNGA 3LALA 3HP9A 1MU2A 1REVA 3NF7A 3ZCMA 1C0UA 1RYSA 4CEZA 4AHUA 1KVBA 1KLNA 3LWLA 3CM5A 4DQRA 3DRPB 3AVNA 2WONB 3SV3A 4AHTA 1TL3A 4NLYA 3JSMA 4FJHA 2FJWA 4JRPA 4NCAA 4BWMA 2BANA 3OYIA 4KTWA 5KG0A 4IG3A 3RMDA 1KFDA 2NUBA 2I1RA 1S1VB 3NGIA 4RW4A 3VQ4A 5F8IA 4TY8B 3AO3A 1JLGB 5HRPA 4K4SA 1DTTA 4E89A 3F73A 1XHXA 3IGVA 2IMWP 3BGRA 4FJLA 5KFJA 1T7PA 1RT6A 1JLAA 1HNIB 2C28A 1RDDA 2F8SA 4J9RA 4R0EA 2RKIB 2PYLA 5I3UB 4FJJA 2O4IA 3HM9A 3OYNA 4KHSA 1LWCB 1S9FA 1O1WA 2YNIA 4DFPA 2J6UA 4IFVB 3IS9A 2R2UA 4OLAA 4DTOA 4LQ3A 2D7SA 4CEEA 3M8PA 4J9NA 5F9LA 4M3WA 1X9MA 2FVSA 3HYFA 1BQMA 3SZ2A 2IM2A 3T3FA 4Z4GA 2VWJA 3VN5A 5KFXA 5L1IA 3RB3A 3KLGA 4FS2A 3CIZA 1SKSA 3KKRA 1RT2B 4CHQA 1SL2A 2ATQA 4ECTA 5J2PB 4RW6B 4DU1A 1SH0A 5C42A 3NGZA 2KW4A 4FLXA 5L1KA 3BREA 1U4BA 1VSEA 2HVIA 5I3UA 1IKVB 3VA0A 4DQPA 4K50A 1VK0A 3U3YA 3AVAA 5FROA 4QWCA 3GV7B 5HRRA 3KLFA 1I3AA 3MEDB 2A1RA 4NRUA 3MFIA 4LSLA 2E6LA 2D0AA 3EZ5A 4K4TA 3TAGA 4F3TA 3H98A 4URGA 4FJIA 5SWMA 3OYLA 4CJ4A 1JLGA 2C22A 1HQEB 2VG7A 1OS5A 4RNNA 2JGUA 2QK9A 4RW8A 4CIFA 3ZSZA 3HVTA 3SPYA 4DL2A 1WSEA 2IA6A 3K59A 3HJFA 4IG3B 1LW2A 3NF8A 4CJ5A 5KG4A 3RMCA 1T05B 1T03A 3OSPA 3AVCA 4ECVA 3ZT1A 3SUQA 1BISA 4JUZA 2E9TA 3AA3A 3TR8A 4FJMA 2UVUA 4GC7A 3HXMA 1L3UA 1XR5A 3VQ7A 4ZPCA 4NLGA 2W9BA 4FXDA 4CEFA 4Z4FA 4CJWA
chains in the Genus database with same CATH superfamily
3NBPA 3F9MA 3SQ4A 4WJBA 2XMTA 2VQEF 4CO1A 1HQUA 1XNRF 2R2TA 2CXEA 4GVEA 3FKBA 1PCAA 1HW8A 2J7UA 3CC7S 4LF4F 3RR7A 4NL5A 4KPCA 2F9WA 4DTUA 4C48A 2HHSA 1FERA 1VQ8N 2VU5A 3IAYA 1VQKS 4Y3CA 2LSNA 2BGGA 2HRUA 4E7IA 4O4GB 4J9KA 1WTFA 1YGYA 3BP8A 3SSSA 3UR3C 1F2HA 3QZ7A 1CJTB 4RKUC 1HYSA 3H45C 4LR9A 4NB4A 5HL7L 3O8MA 3B4MA 4C8YA 3KJVB 1HBNA 2Q31A 2DR5A 3VEYA 4GKKK 3IA0A 4B9NA 4WCEL 4PAAA 2HSEB 3JSMB 1C4AA 4N41A 4M5LA 4DV4K 2EKYA 2XMMA 2DHAA 4LF4K 4BE0A 3QJPA 4CF9A 3UVJB 1FDAA 2Z2LA 4WZMA 1PJ7A 2J0QD 3LP2B 1FRMA 4HVZA 3AVBA 3GYXB 3D7EO 1YITN 4LRCA 4XPEA 4YHHK 1CULB 1TK8A 1OKJA 2R7VA 4QU7A 2ILYA 2P9NB 1GXUA 3K58A 2PO4A 2V63A 2YH0A 2G8IA 3VAFA 2HEKA 5DO2A 2Y1RI 3QFWA 4RR5A 1ZAVA 3W5ZA 2EXUA 2KN4A 2X78A 1NHVA 4OX6A 3DN9A 5CD4H 1ACMB 2AD9A 3AD9C 2K2PA 2NXUA 1H6KX 5D0HA 5KG2A 3S41A 4MIBA 3GJSB 2KH9A 4WTOB 1G6BA 1AUSL 4A57A 2L08A 4FJ7A 3HMJG 5CYMB 4HDGA 3O9QA 4WF9L 2M88A 5DETA 1RWMB 3PTWA 1NJXA 1G99A 5KFWA 3HSCA 4HTUA 4NLPA 3DC2A 4LR8A 3EGZA 2F8TA 2YX1A 4ED0A 2JNJA 3T1AA 1OQ3A 4V19X 3SDEA 5KFKA 2D74B 2DNNA 1N36J 1H0HB 3FZKA 3AV9A 3UCGA 2QL5B 2P9UB 2UVRA 1WG4A 2GFFA 1HNZJ 3GFHA 3SK3A 5BRHA 4KY3A 2DR6A 2IVFB 4ANEA 2A5XA 5SUHA 3F2KA 1XC9A 2YNIB 2YQ3A 3TA1A 4OV1A 1GT8A 4EZ6A 2E2QA 1U2FA 1IBLK 1LOTB 1LEOA 1SH2A 4DV6F 1HLWA 1ZZNA 5HROA 3R1LA 2QKKA 1TELA 3UFCX 4DR6J 4C1NI 1JLAB 1K8AT 4CD1A 5LJWA 2CPIA 2O67A 3E1YA 1UAWA 5HMZA 3CCVS 2AQ4A 1WHXA 1HBUB 1L5UA 4KPYA 4S0MA 1BQNA 3HHEA 3V81B 2E1ZA 4RX6A 4WBFA 4CLZA 1D1UA 1YJNN 5F0WA 3PO5A 1JQGA 3QMQA 1JX4A 1Y5NB 1CZBA 5K5MA 3KYLA 3D1HA 1WAJA 3KWMA 4G1QA 3THPA 2I5JA 2UXDF 4GW6A 3SQGA 1Q79A 1R31A 1NDCA 3V5RA 3EY1A 4ZVEA 1HD0A 1T05A 2YX7A 1RT2A 3FNNA 3OS0A 2DKOB 3MN7A 4Y00A 2RDJA 2DH9A 5F8MA 5LXRA 5AQLA 3LGNA 3HSTB 5E3AA 5D3GA 3TJAA 2P9LB 4USIA 3A5OC 3PW2A 1B64A 6FDRA 4PR6A 1N32J 4YN3B 1VIOA 3ENAA 4BE1A 3UPFA 3KMSA 2MEWA 5C24B 3BQ1A 3MEDA 4OZ3A 2R9LA 3TZXA 3EPGA 3E9OA 4ETXA 3TZWA 4W90B 2YXLA 2NUUG 3R7BB 1VMBA 4JKHA 3AA9A 3AVMA 1NK6A 3DMJB 3U9DA 4DX5A 3ID6A 4PEOA 5DGAA 4JI8J 4HTIA 1BWVA 3UI3A 4A48A 3OSNA 2DGXA 1BIUA 1YZ6A 3J80U 1GLFO 2KM8B 4CHOA 4P2FA 1V5VA 1TMJA 4NLBA 2LQ9A 2R42A 3R5CA 1QUPA 2M52A 4CJFA 2ZVIA 4IOBA 2V2QA 3UDCA 5JUMA 4EEYA 5C24A 3UNGC 2ZOMA 2CAJA 3ZSQA 1RQ0A 5J2QA 2Q3PA 1WACA 1U04A 1VJQA 1OSDA 3VEVA 3A2FA 4RNMA 1TP7A 2AJFE 2WVDA 1KLMA 4ZP8A 3OTOK 4OX8A 5E84A 3Q8VA 1QQOA 3M30B 4DV2F 4B3TJ 1HBMB 2VGMA 1ZA1B 3GPAA 1I1GA 3JTPA 2BABA 2R7YA 4H0VB 2RH3A 3NBPB 5E3PA 2NREA 1SKUB 5F2RA 1H72C 3OY9A 2X3DA 1WOSA 4KQZA 4PPZA 2XMAA 2J0WA 2M8HA 2V67A 4DR4K 1B9DA 4OFZA 2RJZA 3THXB 3KLHA 4PKHA 1LV5A 3QNOA 4CEOA 2J7KA 1LFPA 3M6XA 2OIHA 4AQYF 4TLQA 1WKKA 5ADXA 2AGPA 2RILA 4PY5A 3I33A 1YHQN 4ZVFA 4OPKA 5CCMA 5D0EA 5KFHA 2X7IA 3SSQA 3SBMA 5IT4A 3BSAA 4KB1A 1NKCA 2MYFA 3UWTA 4K43A 1GFWB 3U6FA 3KK2A 1S79A 4ZOSA 3WNFA 2QE5A 1WNEA 3Q86A 1IV0A 1UL3A 4FYXB 2M3DA 2DITA 1NB7A 5DQGA 2H9ZA 1KQKA 2NRTA 4I7FA 4H4MA 2OTJN 4PUOA 2VDIA 1K1SA 4TVAB 2AT1B 4G1PA 1Q8IA 1W2BM 2QLXA 3H20A 1EQ0A 9ATCB 5CCLA 2V8VA 1KSPA 4QOZB 3TQ1A 3SUPA 2KFNA 4CJRA 3K5NA 1GXTA 4X64K 1VSLA 1VQ5S 3A8EA 4DHVA 2JJ4D 2KL8A 1JCEA 3EN9A 3GQCA 4N77A 3FFIB 2IDEA 2XBPA 1KCFA 4CJ7A 4ECXA 1JJHA 5KGWA 4J9OA 2E1RA 3HPGA 5KOXA 3BEGB 3ITHA 2J0SD 5AQZA 3CIMA 3EZWA 2W6LA 4DPTA 3HRGA 4TNOA 1SJRA 1Y3KA 3FZHA 5BRDA 4A8XA 3D28A 1N5YA 1J5OB 3HF5A 4O3NA 3D1OA 2HQDA 3IDHA 1WEYA 4MK7A 1DEJA 4FLTA 3EKSA 1FJ7A 3TPQA 4DV4F 2DNZA 2RDIA 4A59A 2DGTA 2C2ZB 4Y1CA 2CZ9A 2Y0SD 2OZMA 4CT9A 4DV1K 3SDEB 3KNAA 2FVPA 1HR0K 2X6SA 2RHQB 5JLHA 2VFSA 4FL9A 3V6HA 4JBCA 4NYNA 1C1BB 3NGRA 1N56A 5KG3A 4JKEA 2BJDA 3J7ZT 3WQTA 4EGLA 1UVLA 3CUNA 2V2VA 2O8CB 2DY9A 3D6HB 4YOYA 1TK5A 4WU2A 2L3MA 5BR8F 2CGKA 4HACB 3A3OB 2EG2A 2R7RA 4HUFA 1G4CA 5KFDA 1X7VA 4HHTA 4ED3A 4TQSA 3NNHA 2ZBQA 5IT9U 1JJCB 1FK9A 3DLEB 4K4UA 3WEEB 4Y0WA 4ISFA 2FPHX 1YVUA 2W7OA 1RT7B 1F9FA 2D9OA 4EZ9A 2VIHA 2K3IA 1WC4A 1VC6A 3ILJA 3P4UB 4I6MB 4K0KK 2MZRA 4F4ZA 5B09A 5AXNA 2DVIA 3VGLA 4CF0A 3BB5A 2HNYA 1ULRA 3AVHA 2DNQA 1KS2A 1LW0A 4YDXA 1ZZFA 1SC6A 1U1KA 3J7YP 4X64J 3E01B 2BANB 3GCXP 4DSKA 5EX0A 1SI9A 2AX0A 4RUAA 1XERA 1NJIO 4CHNA 1CQNA 4PCQA 3RB6A 1Q7YO 3RW7A 4DSLA 3ENQA 1HIYA 1XR7A 4GVLA 3DXMB 4NEYA 1RE1B 4FJ9A 3M8PB 4P2SA 3HPOA 4DR1J 4WE1A 3MCAB 1RTIA 3TA0A 3NGSA 4QYZK 3H0PA 1BGXT 3IRXA 2XI3A 4FF4A 3HTVA 4JKGB 2E44A 2Y8YA 3HHLD 4RO0A 4AFFA 1GMVA 1LK5A 2XTJP 3DRRA 2ZE2B 4E7KA 3PRDA 5F8NA 5HMYA 4H4OB 3KLEA 1GOCA 5GADI 1NK4A 3JQMA 2I6WA 1EHWA 3GFZA 4LREA 1K9MT 1B0TA 5TKYA 1JIHA 5KFGA 3WUHA 2OHDA 1RAGB 1RKIA 1ILYA 2E7VA 4IH5A 2ZH4A 3CI5A 1NDLA 4DR3K 7AT1B 1ZS6A 5LMUJ 3CGIA 4DDFA 2D0BA 2GNKA 1EP4B 1IN0A 4KAIA 2QEXS 2HVEA 2EFVA 2IYGA 5LXYA 2VBWA 1MMDA 2P9IA 4DN9A 3MR7A 1I5OB 3OFFA 4G3IA 4A8SA 3OPKA 1VQLN 3M8YA 2QN6B 3CULA 2D1CA 3KG0A 5KFAA 2X1GA 1K73T 4PG4A 3VEXA 2XYGB 1N8RO 1S1TA 2GJ2A 4NPOA 1MMNA 2HBJA 1YJ9N 3QGGA 2ZHAA 3EICA 1VRUA 5CXTA 4H0OA 1Q9YA 4I67A 1ATNA 1PAUB 3LPEA 1RBTA 4WFNQ 3BBBA 2ZH2A 3DU6A 1DHMA 2H65B 3H1QA 3GIKA 1ZTWA 4NMXA 2HIYA 1GMWD 2VC1A 2J8SA 3VAJA 2CPXA 3C2PA 3CJRA 3OFHA 3J81j 1Z6RA 1FD2A 3FLCO 1E6YB 4KTZA 3S01A 3QEWA 3BSCA 1NMDA 4IDKB 4M5DB 3CD6S 1YTUA 4O5BA 1PJ5A 4K0KJ 1FESA 4M5GA 4YDDB 5AJ3F 4CEBA 2VBYA 3GFYA 3G6ES 4WYBA 1T9VA 4WXWA 4UTGA 1LK7A 2Q43A 3SUOA 3PSFA 1NB2A 1K8AO 3ENWA 1CG2A 5AZJB 4Y2KA 1KAZA 1RBRA 1U8SA 3T1YK 3OQ2A 1U47A 2V8HA 2O8FA 1A6LA 4FOIA 4B3SK 3R3LA 1JLCA 4M5KA 3FFKB 1YIJS 2HK2A 3A3PB 4Z7CA 3M9NB 1RHKB 3GR1A 3NCIA 1HNXK 2Z0GA 4X2BA 1WF2A 1S57A 4AXIA 4J9MA 1LAVA 3MM5B 5DDRC 5CZXA 5FDLB 5L1LA 3QEIA 1NGGA 3V4MA 4QPXA 4BDYA 4O3OA 3UNYA 3DYAB 4CJVA 4ILMA 1HLUA 3ZZOA 4OX9F 1JXBA 2QWPA 3HBTA 1NNEA 3CDUA 1K0VA 4FW1A 4OGCA 3JS9A 5AQSA 3W63A 3SMSA 1HBOB 3KLIB 4U7UD 2LA6A 3CMES 3H90A 3AXMA 2AHOB 4LC9B 3IKMA 3NS5A 4UY85 4NXMK 3BBCA 1T9YA 2NZ4A 3PR5B 3D54A 4FK4A 4DR1K 5D78A 3T1HF 4CFCA 5I4MA 3MM7A 3TX8A 3AY0A 5B0EA 3ATVA 1XQIA 5BPNA 3GOIA 1U26A 2R8GA 4CJTA 5B0CA 3TVKA 4WFBQ 2LLZA 5D4NA 3BBFA 5E33A 2PDAA 3MEGA 1UFWA 4I1TA 2K1RB 3IBCB 1C0GA 2GVDB 3BV8A 3VEWA 4HT7A 2Q0UA 2GZOA 4U67Q 2OELA 1RDBA 1T03B 4JKDA 2QWQA 4AILC 5E26A 1CC8A 3D6MB 2FJAB 2RD5C 2YWGA 4PRFA 3UKUB 1FXRA 1C1AA 2AMCB 2KG0A 4JB8B 2CNKB 3VQQA 2OGUA 3O5BA 2LKZA 4KHMA 2XNQA 4DSEA 2EEYA 1U45A 1HHSA 3DXBA 3ALYA 5LMNF 1O5JA 5EWEA 3PW7A 5IOLA 1RAJA 2HB5A 4QYZJ 2V50A 3AD8C 2WSEC 3LP1B 3NL0A 5T7BA 4CJKA 3D2WA 1EQYA 1AT1B 3F56A 3GB0A 3HSGA 4CO3A 2QTDA 4FCYA 4CFBA 2PYJA 5BYQA 4BRGA 2UUWA 2Y3YA 2RT3A 5AFUH 1C1CB 3RAMA 1R8HA 4FWNA 2DRAA 1VLYA 3RRGA 4A8OA 1HYZA 3KLVA 1K9MO 2HW3A 4ZITA 4PG7A 5AZJA 5K8OA 1PILA 2YPZA 4KHUA 4MK8A 2OTLN 2DHXA 2ASMA 2DNLA 3N6MA 4TY8A 4DPWA 3RRHA 5AXLA 4UUXA 3I96A 2CJAA 1S6OA 2J6SA 4GO5X 2ZVSA 3FE1A 5ETPA 3EO3A 4MKAA 5KG6A 1LAWA 4MFBA 3SCXA 2P9SA 5C7PA 1W26A 3KK1B 3FC9A 3O4QA 2RRAA 2JHEA 1W2BR 1FXLA 4O0JA 3D0HE 1RP5A 2M9KA 2QL7B 3GV8B 3MN9A 4B1ZA 3ZSXA 5LOQA 2JOQA 4YR2A 2MHEA 4BR2A 2HNYB 2UUCF 1S72S 2B0GA 2HOEA 4CZEA 1AZSB 4B3SJ 4FYDA 4B1XB 4FVCA 4OYZA 3LANA 4F26A 3B6OA 4DTXA 2JSXA 5KFYA 3M1FA 2NRZA 3PVXA 4LQ9A 3D1QA 5FLXY 2KRRA 5FPEA 4PWDB 3DM2A 4Z0UA 1YUWA 2XHCA 2JVOA 5GAEI 3K5PA 2J9CA 2QSFA 3PW0A 3KHYA 1RT7A 3NAIA 3AA2A 3KLGB 3ETMA 3H08A 1JLEA 2C3MA 1HNVB 2CUYA 2HWHA 3QBCA 3E9LA 3M6UA 2GC8A 3IR6B 4YY3K 2GJFA 3IAM9 4JI0J 4EBDA 3KIOA 1YHQS 2OEMA 5DJBA 2MKCA 2XGPA 2P9GA 2KHCA 4N56A 3THVA 4E8UA 3S3NA 4IFYA 1LXJA 4X65J 1S77D 3C7NA 3A1YG 3K2YA 2A2DA 2O8CA 1U8WA 5EOYA 2DNMA 2IRXA 4IWVA 2KT3A 2PFFB 4BC5A 2OJ3A 2FUG9 1U1PA 1T02A 2DY4A 2CYYA 3DOLB 1B9FA 4GRSA 1ZH5A 4ICLB 3J81Y 2QA2A 2KYXA 4RL1A 4F0KA 3VV2B 1Q81T 3L3VA 4AQYK 1HWUA 1NZ8A 1NGDA 2DGUA 3K9JA 4JI4F 3RJMB 1IM4A 1CS4A 1X3MA 2RUSA 3ZZUA 3FGVA 2XY7A 3WC0A 4KREA 1SC1B 4I2QB 5EX5A 2H5JB 3MM7B 2JVRA 2LQBA 4AHCA 5HO4A 2N4CA 1RDCA 3TAEA 3E51A 1IBMF 3LP0B 2P9LA 1PJ6A 3FBCA 2B9WA 1SKRA 3SYZA 2MZJA 1UTAA 3CTRA 2WVBA 3L2UA 3M05A 2E9ZA 3UIQA 2YPYA 4ZMMA 3CD5A 1GXLA 3GLJA 1URNA 3FZMA 2VF3A 3WZ0A 1MLAA 1DY3A 2MQOA 3QSYB 2FBXA 3JQJA 1CVJA 1IKWB 2KVIA 2HIQA 4OJGA 2DGWA 1WG5A 2Z30B 5KFBA 3R5GA 1QDUB 1AA1B 3PJ9A 1X9SA 5F1XA 2ZJPQ 4IO9Q 1X9JA 3FSXA 3K5MA 4HACA 5BJRA 4QS8A 4BRQA 5KT5A 1NEEA 3C0BA 4JI0K 2GQ2A 1R0AA 4DV5F 3OLBA 1SVDA 2PEHA 2FXUA 2YI1A 1T8EA 4ILRA 4CJSA 2VBZA 4WQ4A 4PL8A 3NLCA 1Q82T 3HO1A 3SBGA 1CXUA 3PHEA 3R5DA 1WOPA 5I3QA 4FDFA 1YJUA 2JFDA 4OIXA 3NGTA 3QIOA 4L8RB 4X66K 1IH7A 2AYGA 2OEJA 4NLOA 5FDLA 1VISA 2HLTA 3PX6A 1JJ2R 2Z57B 2RKIA 2FIUA 2Y1IA 2AV5A 1XEZA 2XY6A 3VR1A 4JHDB 2IJNA 2UXBJ 3TVZA 1K8KB 5AXKA 3CDEA 2E7WA 2WC9A 1PYSB 2OANA 3MXMA 1XNRJ 4FK2A 2YHXA 3PRBA 3L7UA 3HVWA 1X9WA 4BR0A 1Q5YA 2BBEA 4U7BA 3EDRB 1RWNB 3D45A 2HF4A 1G3OA 4C8KA 5AZIA 4CGIA 1I6JA 2VA2A 5K8MA 1X5TA 3QETA 5HMXA 2UVVA 2FHJD 7FDRA 1T9XA 4KT0C 3OVNA 5FD1A 2A40A 4USJC 2DB1A 4WFXA 2EK6A 2KJVA 2FC8A 2IM1A 3KJFB 3Q8PB 4NWBA 3M6WA 2B8PA 4ZP6A 5MLCV 1WSGA 1N8RT 4LF7K 2Y1JA 3ZTQA 1IG9A 5B0BA 4P72A 4ZCKA 2DO4A 4DR2J 3NGDA 2KFZA 1RT4A 2YX4A 1UJ5A 2ZH6A 1P8GA 2GMLA 2YKOA 3PFEA 5AT1B 3D6FB 4ISGA 1VK3A 3BN7A 4P75A 4DQ8A 4M7XA 1XNQF 1EKEA 5D6GA 2VPYB 2I5JB 1RCXB 2FHJA 4FF2A 4TQRA 1N36F 2W2OP 1ASUA 4LF1A 3CCES 4DI6A 1KD1T 4WIQA 2YQ0A 1HNZF 2JWNA 3UD3P 2XMJA 3HVTB 1TVRB 1O0PA 1IKYB 1NM2A 4IH7A 4IFEA 1U0SA 2GGPB 3AO4A 3KK3A 1N34J 3HFVA 4K4XA 4B1VA 4KB7A 3D3BJ 2XHBA 4CLLA 5K9FA 3RBEA 4TXSA 4LR7A 3VAMA 4ED4A 5BXIA 1D9AA 2H48B 1OO0B 3F5TA 1YRXA 3AAQA 2BTFA 1I94F 1Y00A 1NH7A 3BKTA 4J2EA 3IO1A 4UT4A 2JL9A 4HYKA 2J8AA 2CJQA 4O5FA 1YX2A 3HKZD 4WP9A 3CCZA 2Q3SA 2PC6A 3GONA 3CJKA 1HNWK 1OPZA 5HLFA 1QVFR 3UKUA 4OKJA 1X4BA 3WX8A 2R8HA 4ECQA 3VF6A 1RKJA 2K8GA 3QIPB 1X0FA 1N5TA 2RN2A 1WC3A 3NHGA 5GAGI 1I94J 1V3SA 2IIHA 1QZ5A 5F8GA 4C0BA 4GO7X 4USKA 3MECA 3ZSWA 2HK3A 4LFCJ 1JLBA 1WBDA 1CSJA 2IYIA 2G8FA 2H54B 4EBCA 2DNKA 2XO7A 4HCBA 4U67L 3OLAA 3SSRA 2IGIA 4LF6K 4J9UE 3V2UC 2ZWHA 4X4NA 1NKEA 3E01A 4FWRA 1ZTTA 1VQOS 2ZDPA 1NOYA 3QIPA 3CIPA 4ID1A 1FD8A 3LP3A 2RE1A 1HFEL 4JI4J 2F8HA 1XHZA 4QR0A 4N8NA 1M5KC 3I32A 3HFKA 2UUBK 4CQ1A 1C0UA 1X0PA 3MUTP 1IBMK 2VL1A 1RHJB 2WB1D 1XMOJ 1FJCA 4ZKAA 2HZVA 1KLNA 1MWKA 3LWLA 4DQRA 3AVNA 2FJWA 4JRPA 1S99A 5A0YA 3BF1A 2L41A 5E3QA 2I1RA 2CWKA 3C3LA 4RW4A 1FXDA 5F8IA 3CCQS 3BZCA 4LF7J 3HI9A 1JLGB 1HX1A 4DCHA 4E89A 2FHKA 1Q78A 3HFZB 3IGVA 4M63C 4FJLA 3SCIE 5KFJA 4JK9A 1IWAA 1EKRA 4OHYA 1R27B 4KHPF 1S22A 1EKSA 2V52B 4XTTA 2UU9F 1JLAA 3N4QA 1HNIB 4R0EA 3H2VE 2CQDA 1Q95G 2BZ2A 1SZ2A 2PYLA 3MD1A 5AQQA 3MUMP 4OO1J 4C3MA 1LWCB 4UOGA 4IFVB 2ZC3A 4OLAA 2FSJA 2YX6A 1NPRA 2D7SA 3PYEA 3VGMA 1X9MA 3HYFA 1GLCG 3D68A 4YY3F 4M5IA 2OTJS 3WXIA 5L1IA 3RB3A 5RUBA 2BUPA 2V8DA 1SKSA 4ZIVA 2DHHA 2ATQA 2R7WA 1Z05A 4FLXA 5D4OA 2CIMA 5L1KA 4IOXA 1U4BA 2NXNA 1VSEA 2VPZB 1WBBA 1B7FA 1VQKN 1A9NB 2HVIA 4BR7A 1VQ5N 4DUZK 4DQPA 3I31A 3SCJE 3NY0A 2ZITA 3DGPB 3CD0A 3AVAA 1RAIB 5FROA 1QJHA 3GTYX 2E1PA 1GLEG 2A1RA 3MEDB 1NXIA 2W25A 4K2XA 1NHKL 3QJLA 3CPEA 2D0AA 3EZ5A 1S7IA 1OVYA 3TAGA 1HNWJ 1N34K 4JKFA 3OYLA 4JAXA 2HHHF 5AQFA 4CJ4A 1JLGA 2ZJRL 1E4FT 1OS5A 1OSCA 1UETA 2ROPA 4CIFA 4LFBJ 4DL2A 2QJ3A 3QATA 4IG3B 3NF8A 1RK8A 2C2OB 3LUYA 1VC0A 4NXMJ 3ZT1A 3N28A 2VICA 1JCFA 1L3UA 2P8IA 2WW4A 4NLGA 2ZUAA 4CEFA 2GO9A 5A8KA 2G8HA 1X4EA 4DL3A 2KZMA 3D66A 3OTOF 2DIVA 2ZD1A 2FHOB 1CLFA 4TY9A 3W9IA 2NYHA 4HKQA 4HL9A 2UUAK 4DS4A 1J2VA 2YV0X 4OZ0A 3OBIA 2EI5A 3JXUA 4O44B 1ZBFA 3PG9A 5FLXU 4JKBA 3O8WA 4NZ7A 2X1AA 4QWEA 5FPDA 2DR7A 1S1WA 3NOCA 2EW9A 4FLYA 2HMPA 3OJUA 3BDPA 1E3MA 3HZGA 3KZBA 4ID8A 1RT1B 3BYRA 3IC1A 4ILHA 3G0ZA 3OV7A 3MMAA 2DFEA 1BC6A 4CM0A 2DNYA 3MMBB 3CCRN 3OYDA 3AH6A 4ZLJA 4CGFA 5F0UA 2XHWA 3D0PA 3OA9A 4CHYA 3QGIA 5GVQA 1VQ8S 4UW2A 3CDBA 1QQCA 2P9CA 1RCOB 2VV5A 3ULDA 2N3LA 2FJDB 1SKWA 3ILIA 1JL2A 3MPYA 3SQGB 4NASA 4QAGA 1U1LA 3FGUA 2ADBA 4H4OA 1P9YA 3RB4A 2KO1A 3WXKA 3DLRA 3P5TL 2BJ8A 4BQZA 5IV4A 3MEEB 4NLDA 1S1XB 4A8KA 1QQMA 9RUBA 1K73O 1DTQB 1VQMS 4LFBK 1YG0A 3MMBA 1VQ9S 3VETA 1Z26A 3MXIA 3NWGA 1UPMB 1RABB 3KUHA 2AEJA 2D3ZA 2O3DA 4QU6A 2WVCA 1HRHA 3T1YF 1RHMB 3CMEN 1P8ZA 4LIWA 2OLWA 4USHA 1WSRA 3Q24A 3EMTA 1RBLA 1YJVA 4UQTA 2F8EX 3WXLA 5KFOA 3FVYA 5KFIA 3HHLC 1RADB 3UR0A 1U24A 2ZQBA 3RRKA 5F8HA 2DBBA 3M8QA 4JI7F 3PW4A 3RAQA 3ENOA 4OLPA 2CRLA 3MN6A 3AA5X 1GLBG 2DGQA 1XK8A 1M5OC 3HL8A 4C8OA 3DLGB 5A2QU 2QWOA 4EFHA 3CD7A 3CJ7A 2C2EA 3KK7A 2OUGA 4X4OA 3NVMA 1VRTA 4DTPA 3IMQJ 2Q6BA 4YHHJ 1SPBP 3J80Y 4F4YA 3MWTA 2NSBA 2Q97A 1U1QA 2Z2ZA 1Y97A 1RTJB 2HHPA 3I9ZA 3M6GA 3FEYB 3AAPA 3TAMA 2RHSB 1RI7A 1XI1A 3EL2A 2WRMA 5M1NA 1B0PA 3MD3A 3C14B 1F3VA 2BA9A 3PW5A 5E0OA 4AL6A 3QNWB 5HBMA 1PBAA 1C0TA 2CJXB 4LH4A 3QLHB 3MX5A 3WDOA 4YDUA 1WC1A 4X84A 1KC8O 2C2DA 1H74A 2E6MA 3JB9k 2F63A 4G9ZA 2UUAJ 5LMNJ 4LVNP 1Q1KA 1YLXA 4DR2F 3BH6B 2A6OA 1DT9A 1QSYA 2A3ZA 3QO9B 3BO3A 4NEZA 1VK8A 4JI3F 4JD2B 3R6LB 1YJNS 4N76A 1Q86O 1WTBA 4BC3A 1WF1A 2J6TA 5C42B 5LT5A 3PYGA 1GX6A 2UXDK 3ZETA 3ZSVA 2DPJA 2F9DA 2HFNA 2VKRA 1TL5A 1S0OA 1D5AA 3OS2A 2KKHA 2CNOB 4O3RA 3CD6N 1WB9A 4DTSA 3MM9B 3AVLA 2CKWA 4L75A 1ASWA 5L39A 2W7PA 4GKKJ 2WOMA 5JMNA 3OYJA 3QRPA 3MR2A 4AH9A 3TTDA 2H5IB 2ASDA 2HNZB 1KEKA 1W7AA 3CCWA 5EN1A 2VOPA 4H5VA 5FRMA 3NMAA 5AE1A 2PY5A 3PV8A 2WTUA 3ZX2A 1XWLA 1TUYA 3DLKB 4YR3A 3KDOA 2LEAA 3VAHA 3LAMA 3W64A 3PEHA 2MXYA 4IEEA 2FVCA 1UOCA 2CGLA 4CFDA 3V9WA 2F7TA 2E5LJ 1K8KA 2R8JA 4RU9A 4OHXA 2YHYA 5CYQA 1RBOB 3ILLA 2E9RX 4OI4A 3KDNA 4M5HA 2O1PA 5HRNA 2OPSA 4DV7J 5GADU 1DTTB 5ITHA 2V6AA 3TP2A 1GX5A 4ED6A 5D4PA 3KLFB 4CEQA 3RGIA 3MAAB 4H5RA 3CJQA 3SQOP 4CP5A 1IVZA 1Y64A 2GUIA 3ZT4A 3ZYYX 2HAFA 3B6BA 1CC7A 3K5OA 1VC5A 1UA0A 2DGVA 2KT2A 5GAEP 3DRPA 2HWIA 4JV0A 2DHSA 5KFTA 2W4CA 1Q86T 5LMNK 4BE2A 4KB0A 1YBTA 4KKOB 3G6VA 3CFOA 3M6VA 1HNZK 2HZAA 1HHQA 2OTLS 4J9PA 3DXMA 4OKKA 1NGFA 4HLBA 3QZ8A 1HWIA 4DXLA 5KG1A 4BRKA 1OPIA 3TWZA 2UUTA 3SI6A 3MK6A 1R8CA 1Y4ZB 4ZK7M 3WX4A 1Z25A 2HKEA 3TOQA 5KPTA 4ZVQB 2Q79A 4ECSA 1RAHB 3OFGA 1IBKJ 3DXKA 4CJ3A 1YJTA 4B1WB 1VRUB 4Q0BA 1KWMA 3NH1A 4PYAA 1FX4A 3QMLA 5AQNA 3F41A 5EWGA 3LZJA 4CGDA 2AYMA 4LFCF 2MKIA 2KLAA 5K20B 4LF7F 3UN5A 3TTFA 1F60B 4BG8A 1ATSA 1RDRA 4FK0A 1KBRA 4DBQA 5GMEA 3ISZA 4RNHA 2XEXA 3MM6B 3R27A 3NG8A 3BS9A 3OUYA 1Y10A 2NXEA 2WONA 4CJEA 4ILJA 4NYPA 2O5DA 3TW0A 1TV6B 2V9KA 4HH0A 2A3JA 3T69A 2FZCB 2KXNB 3EZUA 3U1NA 3OR1A 3OTCA 4ICLA 3EDQB 2GVZA 4OZNA 1HQ2A 2IBKA 2QLWA 5HROB 4O8UA 2HQCA 4L3NA 4NXNJ 2IRUA 3R1HA 1TFWA 2V7ZA 5AQJA 1G7CB 1HPZB 2B9EA 4PWDA 2W40A 1QAXA 2ZH5A 4Z4IA 4ATNA 3DGPA 1U0HA 4QIWD 1R43A 3A8JA 4U8VA 3KD1E 1KD1O 3B8AX 4NLXA 2BX6A 4H0XB 1UVKA 3CF5Q 2F1FA 2MJNA 2QFJA 2D9PA 1RGIA 2ITGA 4CEDA 1QHTA 1MWQA 4KHPJ 4CIOA 3MPDA 3P5JA 4LY7A 2VBXA 2KB2A 4ZCIA 1LNQA 2OPPB 3H3NO 5DZ7A 4BRNA 4AE5A 4QPTA 1SUQB 2YNFA 4YDUC 3D2FB 4ETZA 5GINA 1HQUB 2Z1IA 4ZA1A 1LWFA 5CZ1A 1JXLA 4AM7A 2ACYA 1N88A 4DS5A 5AQIA 3FEZA 2GHWA 4K25A 1DKGD 2IDOA 2UXDJ 4CO0A 2G1HA 2X6NA 2F96A 3EYZA 3ZSYA 5KRSA 4OZ1A 2V2KA 3L4IA 5KFRA 1MWYA 3OYBA 1NMEB 1QVFM 3CF5L 4DV2K 5K8NA 2Z1GA 7FD1A 2OSQA 2IM3A 5HATA 1D4XA 4OJRA 2XB2D 3AVGA 4XH1A 3SAHA 1FA0A 2MZ1A 1KONA 2DTJA 3CEDA 4Y2AA 2JC1A 4GVMA 5LJ3Y 1D0EA 1HL6A 4IBNA 4QBUA 4RUBA 4AD6A 4JP8A 1EZZB 3LP1A 3UO0A 2B9YA 2XNRA 4ZIWA 1RT5A 2ASPA 1S9GB 4LF4J 1OJ4A 2OPRB 4R25A 2P9NA 3GILA 3M4XA 2MMYA 1N0VC 1U2VB 6FD1A 2FJBB 3NRBA 1TUVA 1QHAA 2F40A 5GAHP 2HHVA 2XZTB 1CQMA 3BQ2A 5FPMA 3FCVA 5CY4A 3QPIA 3R3TA 1CLQA 3VGTA 2V4JB 3CQYA 4DUYK 2NSCA 1NJZA 3C15A 4B3MF 4BROA 4J90A 3U1MA 1VI7A 4I0WA 3H5UA 5HN0A 4Q2MA 5KFQA 4BVPA 1CJVB 3QFUA 1BQNB 1WSVA 1RAAB 5IV3A 2K1RA 4JV2A 4NA3A 1VSFA 1SC4B 3G6EN 2VG7B 1U25A 1XJWB 3DLGA 4IJAA 3CPWR 5ETLA 1VBXA 1EWQA 1HI1A 2VPXB 5AQOA 3ATUA 4FP9A 5AXMA 2MY8A 3V1RA 3T5HA 5L46A 1KP6A 4QIVA 1JWWA 5ETOA 5ETTA 4UQGA 3GSIA 2CG8A 2R8IA 2X3GA 3QDKA 2CJBA 2MPUA 1IKVA 2VGNA 1XUPO 3J7ZO 3K7RA 1WJ9A 1H7XA 5JMVA 5CZVA 2KT5A 5D3GB 2C3PA 2E2PA 2CZVC 4DUZJ 4P7VA 1ZBUA 4TYBA 2R4FA 1IKXA 2GIFA 2IDLA 3OBYA 1M5HA 4ALZA 1BCMA 2ASLA 1CJKB 4LF9J 3M2RB 2ATLA 4CLYA 3CDAA 3KUEA 2WAQD 3VPZA 1HKBA 4WXOA 4K5SA 1AXQA 4NA2A 4BQLA 4I9LA 4L73A 4BACA 3HCXA 2DPNA 5D77A 3M2VB 4QW8A 3D2EB 2OI2A 2BXJA 3CJ8A 4B9VA 3M2UB 2FSKA 3P38A 5EUHA 3EWGA 3CT9A 2YHBA 3W3DA 4LF8K 2E1CA 4IDKA 4M5DA 1W97L 3M8WA 1VQ7N 1FX2A 1ZPWX 5LSOA 3ENHA 5KI6A 5HSPA 3HSJA 1S12A 1UW9A 4CIGA 1C1CA 1QVGM 5M1PA 4ZJLA 1S49A 4UY8T 3QBWA 4ZVPB 4F8RA 2LVWA 4OVLA 5KAKA 5K14A 2ERRA 4YNQA 1GK8A 5KFMA 3G9CA 5THWA 3SPZA 4CYUA 3NGYA 1DLOA 2VQFF 3EXCX 1OY9A 1WSIA 3Q8RB 2ZHBA 1QSSA 4QIGA 5H9EJ 4CJPA 3K0SA 2IVOA 2B4JA 5M2UA 1VJWA 1TFYA 1WC5A 4KHPK 1RU2A 1HKAA 4RBUA 2BVZA 4C0OC 2BJ7A 4WFYA 2W4PA 3HULA 4CIEA 3VQCA 1T94A 3VQEA 3ETOA 1ZM9A 5K8PA 4Q7AA 4A5BA 2MZQA 5LL6d 5B7WA 3V1QA 5A2QO 2FLNA 2A1SA 3NAEA 3ULEB 3CJ9A 1S3XA 3G4SN 2XLIA 2M70A 2QMWA 1H1VA 2OPQA 1VQON 5IC4B 3POTB 1J27A 2J5AA 1JNRB 1NSQA 4OYXA 3OYMA 4E2FB 4OX9K 4AHSA 4FLUA 3VGKA 1Y7PA 2G8KA 1RUSA 1YJRA 2ILZA 2C3YA 1X4AA 2MKKA 1WWHA 1F6TA 3O6WA 1FWKA 4JI3K 4LF8J 4JYAJ 5JS2A 1VRQC 2JEIA 3DCAA 4BCAA 3PO4A 1LOUA 1HNXF 2XYPB 3PACA 2W1BA 2O8DA 2NCKL 5A8WB 3PIPL 1IJEB 4P7TA 1N54B 5AE3A 4FS1A 2NRHA 3CNQP 2K3KA 4B02A 2R7SA 4OYBA 3R6MA 2FJXA 3IGNA 3I0SA 3R7SB 4A8MP 2Y8WA 4JI8K 2ZKTA 4B1UB 3QYYA 3MCPA 3TQEA 2DHGA 2H4WB 2X74A 1ZAXA 4QQBA 2OA8A 5MLCQ 4KC5A 3UD4P 2Q2RA 3BJYA 4NRTA 3U3GA 3WIUA 1L3TA 2HFOA 2KTQA 3QEXA 3IM8A 4NLTA 3ZZRA 4F3OA 1ZBLA 4V19J 1K1QA 5ETNA 3LTOA 3VQ8A 3C94A 2OPQB 3NCQA 1OYDA 4J2DA 1NOZA 2B4PA 2FY8A 4F67A 3H2LA 4NLRA 3MFHA 2GQCA 2CQCA 2QIFA 5KFFA 1F3FA 4DR1F 4E7HA 3QT8A 2O4GA 1B70B 3TAQA 3HX9A 4M45A 3DU5A 3I5BA 3AQOA 3UN2A 4KHNA 5B0AA 3WNEA 1YJ7A 4IEIA 5J1PA 3MMJA 2GS8A 2FF6A 4KI4A 2I38A 1NPKA 3CJBA 5AQTA 1VQ6S 3C6UB 3E66A 2ZBPA 4DV1J 2BRKA 2VD3A 2RF2B 3EPIA 3U1LA 3D3CJ 1EETA 2ZWOA 4DU4A 1WHVA 1F2GA 4WQ5C 4J7CA 5I9EB 1RZMA 2GW8A 1FRKA 3IG1A 3TZZA 3THWB 1FRXA 1VQ9N 1JLFA 4NYOA 4WU3A 5KT6A 2HURA 4ID5A 4PL7A 1HARA 1PC4A 4DMNA 1EXQA 3QAUA 2B6AA 2CPDA 2F65A 1ZYQA 4J2BA 2B4VA 4MH8A 4DEZA 1W2IA 3UDLA 2W7AA 1WUAA 1Q18A 3UN3A 4CJQA 1UMJA 3DOMB 2UV8G 2H5EA 3DDIA 4O3PA 1IJFB 2IY5B 4CE9A 4LIRA 5AJ3K 2DRBA 3BO2A 4B3OA 2YNHA 2DRDA 4TKTA 1T44A 4QWBA 4L3KA 3NKYA 2LP4A 1YI2N 3LDQA 3PNIA 4C6AA 4CF8A 4OPJA 4CZLA 4JRQA 3K89A 2MY7A 5F9NA 4DV0F 3BF3A 5HLFB 4KI6A 1RT3A 3BGLA 4B8AB 1FKOB 3VQSA 3IBWA 4C11A 1HJRA 1YQHA 2WHOA 4X62K 3Q22A 3OS1A 3AT1B 3NEKA 3I0RB 1V9OA 2ROGA 3QO9A 3C46A 4P52A 3TABA 3BUZB 4R5PB 5ETQA 2MKSA 4IQXA 1UJ4A 4K4YA 4Q5VA 3VQ6A 2QMXA 4F3QA 4DU3A 4MLEA 5JVGQ 5B0FA 2ZZNA 4ZVGA 1FDBA 4ZLPA 5KPRA 5IQQA 4I2QA 2K7JA 3AOAA 1YVNA 4FYYB 1KHVA 4M5NA 1QE1A 1S1UA 2W2PP 1EX4A 1RT1A 1KQGB 3DLEA 4H8KA 5DGBA 4K0KF 2CPZA 3HVAA 2O8BB 4J8FA 2GV1A 4KV8B 3IXQA 3W9JA 1RLCL 2D3O1 3OD2A 1U2VA 4KAZA 2E1YA 2G9OA 4OI1A 2O66A 3KJNB 2WVFA 3Q8QB 3CCTA 4BDPA 1O8BA 5BR8K 3Q23A 2MKYA 3M2VA 1EO1A 1JXVA 4PXBA 4DR3J 1RGVA 3AA8A 3EKUA 1NK5A 3FQKA 3HD1A 3PUFA 2IOCA 1BO5O 4EP4A 2EWHA 1YJ9S 3KKFA 4PG6A 1S76D 4NLCA 2MQLA 3G87A 2KHDA 4JI3J 2KM8C 4C11B 2PFDA 4GNIA 1FKOA 4B3MJ 3C6TA 1BHNA 1KQFB 5LMUK 3PIOQ 2MJUA 1NGAA 2MTLA 3GJTB 1NAQA 4WFAQ 4OYIA 3FRYA 1W25A 4E98A 1GOAA 1VQ4S 3Q7CA 4EHUA 4URSA 3GSDA 2H51B 1F5CA 4KGZB 1U1NA 1R0CB 3D6TB 1T11A 2VFRA 1VQSA 2YKNA 3BR9A 5T41A 3PKYA 4DSIA 1HYSB 3DOKB 3U4LA 1S0NA 2A1BA 4NZ0A 4DG1B 3LF0A 5H9FK 1ITPA 1EIYB 3BEXA 2A6AA 3C6HA 1NJIT 1BDGA 4W5NA 3OHAA 2BM1A 5BN9A 4CZGA 3O80A 1P6TA 1VR6A 1WDTA 1GOBA 1ZM2A 2E5LF 4JKCA 4X4PA 5DS7A 1TR0A 3J7YU 2VWBA 4NO7A 4RNOA 1RTHB 4IRCA 2GBZA 4ILGB 1GNKA 1SS6A 3RBZA 4B9QA 3T9NA 1JXEA 5GAHU 4PQUA 4DPUA 1DQ8A 2HFSA 4MDAA 5C25A 5F0XA 1RTDA 4X4VA 2DR9A 2PD1A 3ZTRA 4I7FB 1YBUA 4MMOA 3NF9A 1G2EA 4DV7F 3D2EA 4ES1A 2KFYA 1RB0A 4DU8A 1FJGJ 4PWWA 1FEHA 4FZVA 5HOOA 4LF2A 4QWDA 2EFGA 4LVOP 4KHRA 5DRKA 4PZVA 3P4IA 1RISA 2OPRA 4OHVA 1WKLA 3ZZPA 2IVMA 4ED2A 5D15A 4KHWA 5IQ6A 3RB0A 1SV5A 1X4DA 2E1AA 2R8KA 3T1YJ 5BYRA 2ZH9A 2Q1NA 2OSRA 2P9IB 2W9BB 3O2IA 4CVNE 2I0XA 3ISND 1KFSA 2DNPA 1UWBB 2EFNA 5KGXA 4ZLLA 2C1EB 4IKAA 3BM7A 3C65A 2ASYA 1NMNA 3VEOA 4WKYA 2VA3A 4M3YA 2Z1JA 4YOVA 3AJDA 4PABA 1TK0A 2QMUB 3MURP 1AROP 1D9FA 2VQEK 4X4RA 4ED8A 4MKVA 4RUCA 4WTYA 3M9MB 4ELVA 3G8QA 1YRTA 2JH3A 3RTVA 1J5EK 2F4VF 4DUYJ 2OPPA 3V6KA 4CO5A 3J7Z5 4DLEA 1T95A 5KFLA 5JICA 2P6TA 5KTQA 4J9QA 3ASMA 3M32B 3L7PA 2QL9B 4B3MK 2X1BA 3BSNA 4WFZA 1PGZA 5CYMA 2F3JA 4DF4A 3L2QA 4K4WA 1CZ9A 4BHQA 3FQLA 1TZ0A 1HI8A 4ERDA 4DV0J 2QT7A 1K6YA 1T6CA 3OT9A 3NF7A 3ZCMA 1RYSA 4AHUA 1KVBA 4X4TA 2LA4A 3CM5A 4X62F 1IR0A 2F4VK 3DRPB 3SV3A 3JSMA 3NVKA 3LPYA 3GE1A 4NCAA 5JLFA 2BANA 3R97A 3OYIA 4IG3A 1IR2A 2NUBA 3VQ4A 4XEIA 2HHHK 2LXUA 3RYLA 3FZLA 4JI7K 3DWLA 3UKRA 5HRPA 2P9EA 1IJJA 3MUVP 4JI2K 4OYPA 5G0RB 5KQ8A 3DDNA 2IMWP 3KWGA 1NLVA 1M0SA 1HR0J 2E5IA 5JVHL 3Q7BA 3QFHA 2F9JA 4HT5A 3FZFA 3B82A 2RQ4A 4FJJA 1IG8A 2O4IA 2JDJA 4CTAB 3OYNA 2A18A 2M8DB 2VPWB 3GZ7A 4DFPA 2GMHA 1U7LA 1GTEA 2PMHA 4DTOA 2L9WA 4IOAL 1Q16B 4FWKA 1GLDG 1V4SA 4CEEA 4MAKA 4J9NA 2G0JA 2NZCA 5F9LA 4M3WA 1EAYC 2E5JA 1E6YA 1BQMA 2QWNA 2EPIA 2IM2A 4DMZA 2VWJA 1NBEB 5KFXA 3VGVA 3TNVA 4BGAA 4FS2A 1KXPA 4U96A 1RT2B 4H4KA 4CHQA 1SL2A 1YRUA 4KH4A 4RW6B 3H6EA 3NGZA 4B3SF 4J5OA 2UP1A 1B0VA 3QWUA 1HWKA 1VK0A 3PHTA 4QWCA 1SJQA 3GV7B 4A8WA 1R0BG 2QG9B 3LGHA 2EFQA 3MCSA 4C98A 3AB2B 4URGA 2LCWA 1PBUA 4JV5F 1TUUA 4A47A 3TJ8A 3UKRB 1HQEB 3A8KA 5LM7E 3SAFA 2ZGYA 4RW8A 4MT1A 3ZSZA 3K59A 1VAZA 3M1VA 5KG4A 2HS3A 1T05B 3AVCA 4ECVA 3SUQA 1BISA 2G13A 1F9HA 2UVUA 3QWPA 4ZDNA 1BIZA 4YHHF 4CF1A 5F8LA 2PMWA 3MHYA 2YCHA 5HI7A 4BDZA 5C12A 1KN6A 2G8VA 1YI2S 3O08A 3LDLA 1GTHA 3CJ5A 1M1GA 4DU7A 3VF4A 2YNHB 3Q89A 2D0PA 2QC3A 3IWNC 4ECZA 3IUCA 1FDNA 4USWA 2KRBA 2E7XA 1TL7B 1A5VA 2DNRA 1XMOF 4L72B 1ESVA 2OCEA 2FVQA 1RT5B 2A6MA 2MB0B 4EHTA 1QTMA 2VOOA 4LF5J 2G2ZA 1VBYA 4USVA 3MEKA 4GVBA 4K2JA 1Z4UA 2PSZA 4PKIA 4B9SA 4I9QA 4M8LA 4Q2LA 3DAWA 4JI5J 3ZO7A 4FO0A 5GAEU 1NK8A 4B3RK 2D1KA 1IBMJ 3MXJA 4WK3A 3CJ3A 5C2GA 4CH1A 3W2VB 4MTPA 3CJCA 4NI2A 4AYBD 2FSNA 4CLFA 3DLLQ 4RBTA 3BKUA 1B92A 5L38A 5GADP 4CK1A 5HBMB 4E7LA 3BZKA 3KHRA 3DLKA 4A5AA 3MMAB 3LM9A 1BI4B 2KU7A 1Q53A 1TAUA 1DJ0A 5DDQC 1KAXA 3CXCM 2BUNA 3H4BA 2KXHA 3MCOA 3VQDA 4X64F 1BG3A 2FBTA 3BPDA 4FJ8A 1M90O 3T9ZA 4GKJF 5BRFA 3T41A 2V5HG 2KQ2A 1RWVB 4YY3J 3KHGA 2XSJA 3TUJC 4B3OB 4ZVTB 4LRDA 1T3VA 3L3CA 1NNDA 4BR5A 2UV8A 3RMBA 4JS4A 2YY3A 3MMCB 4RG8A 4NYFA 1TL3B 1FWLA 4BRCA 2GQQA 2UU9K 5IWAF 3SQ0A 3L3UA 3GP9A 3HSDA 1GLLO 5DDOC 1VBZA 1VCTA 1ZBSA 4MYUA 1J5OA 2E5GA 2M7SA 1F0XA 4UUWA 4P10A 5EVZA 1AYEA 4W5RA 4CO2A 2RS2A 1SXLA 2HNZA 4ED5A 3BZQA 5LY3A 4OX7A 2VWKA 1KLMB 4AQYJ 3ZSRA 2EKNA 3I82A 1JB0C 2JC0A 2O8FB 3P1GA 1SIWB 4OJ3A 3FSIA 2GGPA 4C1NK 4G1QB 4M42A 5KFZA 2BE2A 4GMJB 3VQ9A 3AO1A 4D3GA 3KD5E 5HRSA 1XBWA 2MQMA 1RAFB 4JKGA 3ITHB 2D41A 1RHRB 2YWWA 2EC2A 3CMAN 1S6UA 4DTJA 4BRPA 3N01A 4DR7K 2AJ4A 4Z4EA 2YJFA 3DGVA 1WC0A 4MO5A 4E3SA 3KVGA 4QIFA 3U27A 2BKPA 2F9TA 2ZH1A 2OFGX 4BR4A 5C2FA 4K8RA 4I69A 4OKEA 3G2XA 3V4IA 3CJKB 1VSDA 1S59A 1G15A 1U09A 2B43A 4M41A 3C14A 4JD2A 1X4GA 4LFAF 4WWSA 4CI0B 5HQMA 1F5AA 4MIAA 4UZCA 2KZZA 4DSJA 2AWZA 5EGYA 3AAWB 4HUGA 3GG1A 3RG6A 3GWCA 2HNDA 3MM5A 3F44A 3SXLA 2PI4A 1Z1ZA 1QAJA 2ASJA 3CC2N 4CI6A 5ELZA 3KUGA 2FYXA 1JLEB 3PLAA 3Q2SC 4YB5A 1SQEA 3V9UA 4HI1A 1XTZA 2XSFA 1UJ6A 3QT6A 3LPTA 3N79A 2MKJA 1YXQA 3OR2A 3VWSA 2G8UA 5A6PA 2VG6B 3O5TB 1SQGA 2VFTA 4K59A 1YVFA 4BRAA 1QVGR 2AYEA 3C6AA 3CYMA 3W60A 3GR0A 1BQXA 3J81U 3A5NC 3FCWA 3Q8YA 5AQHA 4DR7F 1BU6O 2A41A 2M2BA 3SFUA 5KFPA 4JK8A 1BLUA 2Y1LB 1QUVA 5EDWA 3PZPA 4JI6J 4FJ5A 5IT9O 3ZTPA 1RSCA 2A10A 5B0GA 1VQ6N 1RTZA 4Y6IA 3ADAC 2GWKA 2OZSA 3GJRB 2B4OA 1TV6A 1XNQK 4BREA 4LFCK 1S9GA 3H3OB 2UXCF 2GEMA 3KJVA 1LWEB 5KG5A 4DR7J 1I3OB 2J9EA 2RQMA 3KKSA 5ADZA 4OI6A 1VS3A 2EBGA 5E3CA 3UW1A 3RUBL 3W5YA 5A2QY 4C4WA 1XR6A 1WAFA 1DAXA 4C8LA 4F36A 4LF6J 4I6YA 1FXXA 1VHIA 2QW9A 2L9NA 1CEZA 3KXDA 1VQPS 5FJ4A 5L1JA 3CSKA 3CCMN 3VTIA 3KNGA 3P39A 2CWXA 1TGOA 4I6AA 1CULA 5J1NA 2VYPA 2BACA 1G1XA 3M8ZA 3CMQA 3DRYA 1KOOA 2WUSA 3NNAA 4CNYA 1MWMA 3WNHA 4H4KC 3UQSA 1RU1A 3OL9A 3CETA 3RZAA 4YFUA 2VH7A 1BHLA 3DNCA 3TR5A 1AUDA 4JK7A 1DQ9A 3D5MA 3JSYA 3F0NA 5H1SV 1VHXA 4FPAA 5M2PA 1HQEA 2X51A 4Y2MA 1P1LA 1VQMN 4ELUA 4YMEA 5HJYA 2V51B 3AFGA 2VODA 2P9KA 4CWBA 1NK7A 1QZ6A 4Y28C 4FZZA 3VAGA 3OYFA 3TI0A 1PC5A 1HJOA 1N6QA 3MM8B 2NPFA 5DLGA 4KV8A 3K0JA 3OHBA 3MEEA 4YB7A 1Y9OA 2BQ3A 2E66A 3HM8A 2D4WA 1NCLA 3I4HX 1NJYA 2UU9J 3ZETB 4X65K 1KVKA 3PIOL 3H8YA 1LXNA 1TKXA 4BRFA 3RMAA 1LKZA 2ZH8A 4FJGA 4KHQA 2RU3A 1A7GE 3M8QB 1FJGK 1R8AA 4RW8B 3L2RA 1U1RA 3OR1B 3L9ZA 2QSWA 4KHYA 2BE9B 3FZ2A 2FC9A 1S0MA 1WSFA 4HH1A 3BGRB 2N82B 2HF3A 4CF2A 3DRSB 1J54A 2P9PA 1R0AB 4EIAA 4F4XA 1VYAA 4BRDA 2P5OA 2GX8A 1WN7A 3THXA 3C6UA 2HBYB 3E3XA 3OXFA 1CS4B 2RVJA 3S8SA 3V9XA 3JSRA 2XM3A 1FNXH 3GDQA 2FQQB 4EP5A 1B4SA 1S1WB 3NFAA 4FWMA 2GELA 5G0RA 4WFAL 1T9TA 1ZAWA 3AOCA 4DCOB 3T6JA 4CFAA 1I51B 3BYPA 4Z4HA 3WEEA 3O1LA 2V4RA 5H1SQ 4JHDA 4K41A 4FN5A 2PAVA 4KH6A 3O44A 5HL7Q 3EVOA 4P9SA 1J53A 4Q43A 2YVSA 1S6PA 1ZXOA 1X4CA 4GVBB 2Z56B 5L9NA 1MROA 2E5LK 2AEMA 2QFIA 4JEPA 4JS5A 4Y2IA 3OTEA 2UXBF 2XWXA 4Q8EA 4ZVHA 4K4VA 4IG0B 4E1NA 4DV6J 3H2UB 3NMRA 4M3XA 4LRFA 1S5JA 3LA0A 2IJFA 3S1TA 5BPMA 1UZDA 2K7KA 4QIEA 4F4KA 2P51A 1C1BA 1X5SA 5AQVA 3OYEA 1OH8A 3VQTA 1RJJA 4M3UA 2WK4A 3G71N 3UCZP 2J9DA 2JWKA 3I6PA 4D3HA 2YKAA 3RSEB 5FRNA 1HPMA 2V34A 4O0NA 2MGZB 2EFOA 4L6V3 1VQYA 2NPIA 1ITGA 4XH5A 5JXSA 3KLEB 3ZEUB 3DHWC 4Z7YA 5M1OA 2BQRA 1H7WA 1RNHA 1UVJA 3OYKA 4W4MA 3FEXB 2P9PB 3WNGA 1WSHA 3U8XA 2DXEA 4B08A 4CLKA 5JVGL 2A2CA 1L3VA 2F4VJ 2GV9A 5C5JA 3MTJA 4OYAA 2G8WA 2Z2MA 2V9WA 1IKYA 1FDDA 2D0CA 4JI5F 2AJQA 1TL1A 3IMXA 2VFVA 4PHTX 4JI2J 1C0TB 3PY8A 3G10A 3MCMA 1XNQJ 4CT8A 4EBEA 3NDKA 4CM2A 5SZTA 2IHR1 3DXSX 3G86A 4WQ4C 3CDWA 2JLEA 3DYAA 4LRBA 3VQAA 3GIRA 5DDPC 1TL4A 3AODA 4F4WA 1VSKA 1UWAA 1TAQA 1YBAA 3EM1A 4MKBA 3THYA 3TUPA 3HP6A 3IWLA 1TYQB 3KK2B 1N33F 4AL7A 3O9RA 4YUDA 1QY7A 3ET6B 3OXLA 1CBKA 3DOKA 5IZHA 1FRLA 2NS1B 3FR0A 4PKGA 2ASOA 4XIUA 4DPYA 4GV6A 1RLDA 4U9RA 5T7LA 3G8TA 4NZ6A 3IR5B 3C6TB 1FO1A 3B4DA 4GV3A 1WLJA 4FW2A 2RPIA 5DLFA 3NNCA 2HMIA 3DLJA 4V19S 3OYHA 4YOEA 2AYBA 1DRZA 5FPNA 4K8ZA 4I4BA 3Q83A 1LW2B 1F9EB 2Z8QA 1WNSA 2A0FB 4X66J 5GIPA 3M9OB 2LQ5A 1IKXB 1NSAA 2V8GA 4W5TA 1EETB 2OKQA 1Y0HA 1E6VA 4DL6A 3MDFA 3R9PA 2AP1A 2W9CB 5IXUA 3WQUA 3CMAS 3VENA 3TU5A 4FYVB 1BCOA 2DISA 3R5JB 1UVNA 1UVIA 2YBVA 1SB6A 4RW9A 3VCDA 4ZCMA 1TKTA 5D4LA 2VQFJ 1C4CA 2HQFA 3ZZYA 3H5SA 1FRJA 1VQ4N 4I6MA 5J2NA 5M1KA 1N33K 2XWYA 1IKWA 1KVIA 2QTWA 2D3UA 2DD8S 2OD6A 4PYDA 3VQ5A 1UKUA 4ISEA 4TU8A 4F02A 4USMA 4QS9A 4BC2A 3LOUA 2YKQA 2HGMA 2ZD1B 1RWKB 2VJUA 4EYHB 4BY9C 4RW4B 2LYVA 1VSIA 5HP1B 4FLVA 4KRFA 1QE1B 1S1UB 3IAS9 4PKDB 1NGCA 5GAGP 4KBOA 2ZHOA 4DCPB 2ZM6F 3HZEA 3CJSA 3QEPA 4M95A 2KVQE 5A76A 4IZ9A 2AW0A 1FE4A 1D3WA 2F5GA 4WCEQ 1ZM3A 1U49A 3DLHA 3C16A 1HNVA 2FBVA 1SQKA 1TUWA 4TLRA 4ENOA 4YEAA 4DL7A 3CQXA 5EHHA 3FZBA 5GAHI 1BY9A 1JK9B 1TKZA 3D0IE 2QZ8A 2DCLA 1ASVA 2GUPA 2ZM6J 4JI4K 4GC6A 1YTAA 2W41A 3V6DA 2IM0A 3J80O 5CQGA 1CJUB 2GCFA 1CJVA 2VFUA 3K5LA 4H0PA 4NA1A 2HWTA 1AB8A 2XZDB 4P74A 2NXJA 2DCUB 3PJWA 1MNEA 2XULA 3MM8A 5E5NA 1MG7A 4ZJOA 3CFPA 1Z2ZA 4CGGA 3PX4A 4P73A 3JYTB 1S4EA 2FLOA 3ZT2A 2ZFHA 1NLKL 4E0DA 2ACMA 2V2ZA 5CE3A 3BH7B 2YWHA 1J6ZA 3DI6B 3RWUA 1UEUA 3C7NB 2W6KA 3EE3A 3BY5A 4B9MA 4CBUA 5C2CA 4O4RA 4WQ5A 3ZSOA 1CJUA 3THWA 2G2OA 4NLVA 5A8RA 1S97A 3A0IX 4A8QA 3MF5A 5A6WA 1NU4A 2HG4A 4R8UB 4FKXA 4BWJA 3E8OA 4G6VB 4Y2CA 2W24A 4MKYA 4QS7A 4EMDA 2UUBF 4PPDA 3QB0A 4PXDA 1ROFA 4J91A 2HVZA 4CNZA 3MTKA 2IS3A 2ATCB 1V6HA 4J9SA 4NCGB 5AE2A 4O55A 2LMIA 1AFJA 2E29A 1X5PA 4BC9A 1OY6A 4FWOA 4LBIA 4JI1F 1BMQB 1KDNA 5GMKa 2DFFA 3G82A 1RAEB 3X3UA 3AVIA 2B3TB 4ZJQA 2Q66A 1XQSC 2CQ0A 2G4BA 2BJ9A 4GV9A 2EC0A 4DPOA 3NAHA 2LQ8A 3V6DB 2DO0A 2Y0BB 3ICLA 2ZUGA 2LEBA 3CCRS 5G4DA 3ZTSA 1JLFB 5HVGA 4QCLA 4Q45A 1NG9A 3I4PA 2XLKA 1UVMA 1XMOK 2BV3A 1L3KA 2CQBA 1A5WA 4HHJA 3AJ1A 3NCPA 2R7TA 2ZBRA 4BVOA 3HK2A 3A12A 1SJ3P 2CZ4A 2BDPA 3CJ4A 5F8JA 3J7A1 5J1EB 1B7YB 1UW4A 3FSYA 3OXGA