1FK9A

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
536
structure length
519
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAITKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 146
structure length 519
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fk9A05
2GIRA 4DL5A 4ECSA 4ZP6A 3AO3A 1DTTA 4PWDA 4I2QB 4N5SA 3B6PA 2XCAA 1D8YA 1N5YB 3OYKA 2P5OA 3AA5X 1S9EA 4XIUA 4OPKA 3IG1A 2LSNA 4U6PA 4Y34A 5HP1A 1U4BA 5KFDA 1NJWA 3C6UB 2HB5A 2BANA 1RTDA 3RR8A 4DS4A 4URSA 3CJ4A 4CFBA 2YNGA 4AHSA 3QGHA 3IAYA 2IMWP 2X6SA 4CEFA 1IH7A 4CK3A 4IG3A 3KK3A 3PX4A 5F9LA 3BSNA 4OJRA 2C28A 1S6QB 5C42A 1SUQA 4R8UA 1T8EA 1ZBUA 3SQ1A 1SH2A 4DQRA 1JLCB 3HHKA 2YNFA 1W9HA 1RNHA 2GUIA 1S1VB 4JV2A 1LW0A 2HHQA 1S0NA 1TL1B 4IG0B 2D3UA 4O4GA 4IOBA 4CE9A 5F8HA 4KB0A 4HTUA 4FZZA 2HNZB 1U04A 4DFJA 4HCBA 4QPXA 1KTQA 3AVCA 3ZSQA 5KG3A 2IC3B 4E1NA 3OYMA 2HWHA 2OPQA 2XI2A 3H5UA 2HNYB 4DL2A 2YV0X 1ZETA 2X6NA 1RT7B 5L1KA 1J5OA 3QZ8A 1VSLA 3N6MA 4Z4GA 4R0EA 3HL8A 4FJJA 5T7BA 3OS2A 4DU4A 3CDUA 1S4FA 1HPZA 2GV9A 4PUOA 2YKMB 1Q9YA 2ASJA 5DK5A 4DWIA 1TV6A 4DTOA 2XY8A 5DLFA 1X9MA 4WXWA 4KHQA 1Z25A 2XRIA 3PUFA 5EWEA 3ZSZA 3PVXA 1KVCA 2R2TA 2ZD1B 3TAMA 3H98A 3DOLA 4CGHA 3NH1A 3ZT2A 3WNHA 5T14A 4WFXA 3G0ZA 3SYZA 3MFIA 3TR8A 3Q8RB 5J2MA 1C1AA 3OS1A 4FS2A 5F8LA 4ECRA 1K6YA 2C2DA 3ISND 1JIHA 3TVKA 3KHHA 3I0SA 2ZKUA 3C6TB 3HT3A 1JLAB 1XC9A 3LWLA 3K59A 2IGIA 4Z4HA 2XGQA 1B9DA 3TI0A 4FJNA 4ZP8A 4ZVGA 2ILYA 2FLPA 2CKWA 3VQDA 2HHWA 1KSPA 1J54A 2IAJA 4CJVA 2EC0A 4FZXC 5K14B 4BWJA 4BE0A 3QIPA 3E01B 2A1SA 4FJHA 1VRTB 4H4OB 2HNDA 4FLXA 3VQAA 4ZHRA 4JV0A 3TAEA 4CIFA 3ZCMA 4O3QA 5FRNA 5SWMA 3DI6B 2IM1A 1N48A 4TY9A 1JLQB 2UVUA 1RT6A 2QKKA 2YHBA 5KT4A 2O4GA 3NMAA 3ITHA 1XR6A 2E9TA 2IS3A 3OVNA 3NAEA 2OYQA 4FM1A 5KFZA 3BSCA 1TL3B 2XGPA 2PY5A 4WYLA 3T5LA 3FQKA 1NK6A 4IH6A 4CHQA 4KI4A 4RUCA 1TP7A 1RBSA 1YVFA 3GYNA 1HQEB 2HWIA 4DL4A 3HSTB 4JS4A 1LWFB 1HNVB 3KLIA 5DQHA 2FLLA 1L3SA 3JYTA 2FJVA 4ED0A 4FLUA 4RW9B 2ZE2B 4FBUA 1VRUB 3ZSRA 5KFVA 4IH7A 4CJPA 4QW8A 5KG6A 1JLEA 2J6SA 3HPGA 2X78A 2FVCA 5CZ1A 2UUTA 1ITGA 4X2BA 1NKCA 4KHSA 1C1BB 3Q8QB 2Z1JA 1RDRA 3AVIA 4E7HA 3MEEB 1K1SA 3SUNA 4Y1CA 1IKYB 2ASLA 3LANA 5KFNA 1JLGA 4ECTA 2IDOA 2YNIB 3K58A 1SV5B 3IS9A 3T5JA 3SCXA 4KFBA 4EYIB 1T03A 4N47A 3M8QB 3I0RB 1RT5B 3QO9A 4LH4A 5KFSA 4MK7A 1TVRB 3BR9A 1SH0A 3S3MA 1N4LA 3BREA 3O4QA 3PV8A 3I5CA 5I42B 3IGVA 3L2VA 2PYJA 1N56A 2A1RA 4B08A 4ECVA 4OGCA 4FK4A 4OKKA 2W9CA 4B9SA 4EEYA 4Z4IA 1CSJA 2BR0A 3DLEB 4B9MA 3U3GA 3MECA 4UQGA 2RKIB 4FW2A 2W9AA 1VSIA 3V6DA 3RB3A 5HBMB 3UQSA 1WLJA 1S1WB 4EBCA 4XPEA 4FJKA 1S9GA 4O3SA 1NKBA 3NHGA 4NLOA 3QNOA 4KB7A 4RU9A 2QV6A 1TKXA 4Y3CA 3C6UA 1RTHB 5KGXA 1ASWA 5KT5A 3MR3A 3AA3A 4DL3A 3V6HA 3KD5E 3F73A 1HMVB 2WHOA 1BISA 1FKPA 3Q8PB 3GIKA 3TAPA 4Z4CA 2ATQA 5SZTA 4OLBA 2G8IA 1BQNB 3KD1E 5KFGA 2R8KA 1HYSA 3MFHA 1CZBA 3CJ5A 4MFBB 5HLFA 3PW5A 4PA1A 5L1JA 4CIGA 3V9ZA 1C2PA 4Q0BB 4YR3A 4J2BA 3QIDA 4OVLA 4LSNB 4K4VA 3VA0A 3V81B 4CHOA 3T5HA 3V9WA 4FLZA 3U3YA 1C0UB 1TL1A 4IG0A 5KFIA 2WTFA 4H8KA 4W5QA 1SL1A 4Y1DA 1RBVA 3DRRB 5FROA 2FJWA 1WNSA 1S1UB 3VQSA 1BIZA 4W5NA 3L2WA 4WFYA 4CGGA 3P83D 1DTQA 2IC3A 3SQ4A 2AX0A 4NLDA 2RDJA 3SUPA 3QEWA 4LH5A 4NLTA 4OGEA 2BQRA 4O5BA 3QYYA 2B6AB 2B4JA 1R0AA 3HVTB 5CYMB 3KKSA 1D0EA 4KI6A 1VSEA 2BRLA 4F50A 5J2PB 2ILZA 3D28A 4ZTFA 1RYRA 4G3IA 4KKOB 5HRPA 1S1TB 4J2DA 3GV8B 2AGOA 3QETA 1KFDA 2ZD1A 1KHVA 2RDIA 3CG7A 4Z4FA 3NH2A 4E7LA 1ZBIA 4L8RB 3OYCA 4OPJA 1QHTA 3PJXA 4ED2A 1UAXA 2G8VA 3LP0A 4J9SA 1ASUA 3HXMA 3LZJA 3VQ6A 5DQIA 1S1XA 2YKNB 3NGYA 1KVBA 5C25B 3KTQA 3RAXA 2W8LA 4IQXA 3OYGA 4AHUA 4DLEA 4LD0A 3PZPA 2UVWA 2B5JB 3KHGA 1HQUB 5DGBA 1RBTA 4CF9A 3KK1B 4DG1B 5K14A 3V1RA 4CF2A 3SPYA 5KFRA 1ZBHA 3AVBA 4F3TA 4H4OA 1VSHA 4WE1A 3H4DA 1SKWA 3M8PB 4IFVB 3HVWA 2ZQBA 1S48A 3MR6A 1JL1A 3KLEB 5F8JA 2KW4A 1U48A 4QWDA 3T5KA 1NJXA 4AH9A 4RNMA 4F4ZA 3OYAA 4FJLA 1GX5A 2HHSA 1WAFA 4EZ6A 4R5PA 4FBTA 3K57A 1S97A 3NE6A 4KTQA 5KFMA 4KTWA 4DTXA 1RYSA 4KV8B 5KG2A 1LAVA 4E3SA 1CLQA 4GVMA 2OPSB 4PQUB 3KLVA 2EHGA 4QCLA 3MEDB 3KLFB 3K5OA 1YTUA 4CEZA 1G15A 3UR0A 4IFYB 4BE1A 3RTVA 3QGIA 4CF8A 3NBPB 3KHLA 3DLGB 4RW9A 1W0HA 2ZE2A 3NGDA 4FVMA 3Q8SB 4Y2CA 2VG6A 1T3NA 4CF1A 5C24B 5J2NB 2WB4A 2I5JA 1VSFA 3OYBA 3AO5A 3OHBA 4FS1A 3GILA 3K2PA 5KG4A 3IN5A 1MU2B 3H59A 2KTQA 2R2SA 1IKYA 4RW4A 3M8SA 3CFPA 3DMJB 3UIQA 3S3OA 1TKZA 4NLGA 1XR7A 2JEGA 4DF4A 3AVJA 4C8KA 3LDSA 1EP4A 1KLMB 3IRXA 1S6PA 3SQ0A 1RT5A 3CM5A 5FDLB 5EWFA 1UA1A 2VG7A 3CDWA 3CFOA 4CJLA 4CGJA 4RW8B 1IKVB 3OYDA 1JLBB 1C0TA 2OPRB 3MTKA 3NAHA 1QE1B 3CIZA 4NLRA 3SV3A 3DRPB 3DM2B 4NYZA 1C1CB 3OYJA 2OPPB 3KLGA 5HROB 2E6LA 1RBRA 4TY8B 1JLFB 2I1RA 2VA3A 4RNNA 4J2EA 4M3YA 5L1LA 2VG5B 3AVHA 3MR5A 3PR5B 3JSMB 5EU7A 1SL2A 4E7IA 3DOKB 5KFQA 4FCYA 1UOCA 3EPIA 3VQ7A 3NF8A 3ISNC 1RT1B 3NCIA 3KHRA 1BQMB 5FRMA 2WCXA 1VSKA 3MXIA 3M9MB 1HMVA 4OL8A 4ELTA 3I8DA 4Z0UA 3KK2B 4DQQA 2XO7A 2UVVA 3UPFA 4DTMA 3LP1B 1SL0A 3SFUA 4LSNA 1FKOA 3DRSA 3V81A 4BDPA 4FYDA 2HVHA 3V4IA 4O3RA 3QNNA 5KFKA 4NCGB 2W9BB 1ZBFA 5L9XA 3KJVB 3PX0A 5F8MA 3PO5A 3FFIB 3MEGA 4QWCA 2YNHB 3ZT3A 4BDZA 4ZP7A 1RTIA 3OYHA 4J9NA 1D1UA 1OS5A 4ZPBA 1JXEA 4CCHA 2JGUA 1RAJA 3DLKA 4KAIA 3BGRB 4DQIA 2G8FA 4I9QA 2XC9A 5EWGA 4M3RA 4MK9A 2BQUA 1LAWA 5CYMA 3LAMA 4KPYA 3OSNA 1TGOA 5KI6A 4ECQA 4NLSA 4B8CA 4IRDA 4URGA 4DL7A 4KKOA 1NJZA 4CJQA 3NF6A 3MR2A 4WFZA 4RNFA 1BL3A 4EYHB 4OLAA 3NFAA 1IKWB 3AVMA 1LWCA 3LP2B 1RDAA 2V9WA 3LPUA 3SNNA 4J2AA 3SUOA 2DTUA 1U09A 3LALA 1RILA 4ID5A 4FJ5A 1XI1A 2YKNA 4RW7B 1TAUA 3QEVA 4NLPA 4RZRA 4GC7A 5KRSA 2D0BA 3IGNA 3NKYA 4GMJB 4Q8FA 4ELUA 4M3XA 1JKHB 2F8TA 3HKWA 3TWHA 2UUWA 2DY4A 4O3NA 3TAFA 4EP5A 4W5TA 3FDSA 4CJSA 1FK9A 1NK4A 4K50A 1T05A 1GX6A 1VSJA 1BCOA 2KZZA 3ICLA 1REVA 1HNIA 3M8PA 4IFVA 4M94A 2HMIA 3KLEA 2XY7A 5J2QB 1HARA 4Q44A 1TKDA 4ZVFA 3KIOA 1NHVA 4JV1A 1L3TA 3QINA 1BI4B 1UWBB 4TN2A 3P5JA 3SZ2A 4O44A 3QLHB 3QERA 4NLYA 3OL8A 2E6MA 4O4RA 3KKRA 4U7CA 1RTJB 3QZ7A 4M45A 4K4SA 1LV5A 4MIBA 3LWMA 1RCHA 1CZ9A 1JXBA 4G1QB 2GIQA 2HHVA 3B6OA 2BRKA 5E41A 1LWEB 3KMQA 3CFRA 4IFYA 4CEOA 4IKFA 3V6JA 1X1PA 3S9HA 2FJXA 4LSLB 1J53A 1DLOB 5KT7A 4M42A 4B3OA 3CJ0A 2HHUA 5KFJA 1RT3B 4I7FB 3C94A 5J2NA 2RF2B 4CHZA 3M9OB 3PW7A 4K8ZA 1KVAA 2D7SA 2D41A 4W5OA 5KFEA 1VK0A 5DG7A 2G8HA 4ICLA 3NGIA 4J9PA 3EPGA 4F4YA 4TQSA 4H4MB 3WNGA 4CJUA 4DQSA 5CYQB 1EETB 5DLGA 1B9FA 4QW9A 4WZMA 2WOMA 4FJ7A 1WAJA 1KLMA 3VQ9A 5FDLA 1RT4A 2DPIA 4YMEA 1I3AA 5HRNA 1IKVA 2BE2B 4KO0B 4FW1A 3DLRA 3RAQA 3CM6A 4DSIA 3GIIA 2WONB 4CHNA 1QE1A 1NK9A 1S5JA 3RWUA 4NRTA 3EZ5A 1I39A 4KBIA 4I2QA 2CJQA 3RB4A 5F8IA 2JC1A 4DEZA 1N5YA 1DTTB 4AILC 3H5XA 4JUZA 3O3FA 1BHLA 1F21A 4AHCA 5KFAA 2PZSA 5KFPA 4FJXA 1S9EB 4HKQA 4MIAA 3IG1B 3OLAA 1Z26A 3LZIA 4DL6A 4I9LA 4MH8A 2G8WA 2BANB 1RTDB 3AV9A 2XI3A 3G6XA 2FLNA 2G8KA 4EO8A 2B43A 4JRQA 4DSLA 4IG3B 1QAJA 1S6QA 3KK3B 1IM4A 5JS1A 4YQWA 1JLCA 2QKBA 5C42B 1HYZA 1S1VA 2O4IA 3OYIA 2YNFB 4CJRA 2BGGA 5DG9A 2FVPA 4C8NA 5CY4A 1LW0B 3BQ1A 1SKSA 4E19A 4K8XA 2IJFA 3V9SA 3EY1A 5C5JA 5KG5A 3DYAB 2HNZA 4DSEA 4O4GB 2P1JA 1LW2B 3NAIA 4EO6A 1RBUA 3G6YA 3CJ3A 4Z4EA 4NRUA 2W9BA 2NUBA 2HNYA 1XWLA 3K5LA 1QAIA 2OPQB 1RT7A 1NHUA 4ZPDA 3V9XA 4ZMMA 4CF0A 4J9LA 2IJNA 4URQU 1TK0A 4RNOA 2YKMA 2R2RA 1C6VA 3QGGA 2Y1IA 4PUOB 2AU0A 2P5GA 1TV6B 4CEBA 3LPTA 1A5WA 3CJ2A 4FJIA 1N6QB 4ZVEA 3TAMB 2XHBA 3AO2A 5JS2A 4O55A 2AGQA 1EXQA 1A5VA 1Y97A 4ECYA 5KRTA 4TYAA 4HHTA 1A5XA 4IR1A 2FBVA 5J2MB 3HJFA 4CIEA 3WNFA 3G10A 3C6TA 1JLAA 2W7PA 3VQ5A 3I0SB 4TYBA 3EYZA 3OS0A 2PYLA 2HAIA 4FLYA 2KZMA 1QS4A 4B9TA 3HVAA 4CESA 2UVRA 1IO2A 3E01A 3AVNA 3ZSYA 3SI6A 4ED8A 2IAJB 4CK1A 1VRTA 5KG7A 4IDKB 2HVIA 4QWBA 1RDBA 3QIPB 4DSFA 2AGPA 2HNDB 4B8AB 2D5RA 3VQCA 3DI6A 1YT3A 3CWJA 4FJMA 1JLQA 2IA6A 4CEEA 4ECUA 3LAKA 1RT6B 3N6NA 3PW2A 1TL3A 5EUHA 1SH3A 3ITHB 2GC8A 3I5BA 5EDWA 5KFCA 3RBDA 1SKRA 1NJYA 3VN5A 3RRGA 4K4XA 3HPOA 1BGXT 1HQEA 4B9UA 1LWFA 1W25A 1HNVA 3A2FA 4DTNA 4Q8EA 4CJWA 1WSGA 3MF5A 1KHWA 3HP6A 3H40A 5DQGA 2D3ZA 3GIMA 3KLIB 3DLHA 1VRUA 3HYFA 4CJ3A 3SI8A 5KGWA 4LY7A 3QEPA 1NOZA 1C1BA 2DFEA 1JLEB 2QK9A 2W7OA 1L3VA 1KLNA 1X9SA 2DFHA 2RN2A 4YFUA 4CHYA 4KHUA 3MEEA 4KHMA 4FLVA 4CFAA 3F9KA 4ELVA 3ZSOA 4PY5A 3AA4A 4YNQA 3FRZA 4ZPCA 2YNIA 1WN7A 2RF2A 4HCCA 1SV5A 1QUVA 1S10A 3NF9A 2W42A 1JLGB 4DTJA 5DMRA 3PW0A 3BQ0A 4DTPA 3TQ1A 3M8QA 3I0RA 3IS9B 2J6UA 3ASMA 4EZ9A 4JS5A 4H4MA 4O0IA 1T03B 1TVRA 2XCPA 1QSSA 1WSJA 3QO9B 1QSLA 3AO1A 2HHXA 3ALYA 4ZP9A 4NLQA 4CFDA 5I42A 3OYLA 3QESA 1ZTWA 1S9FA 3SPZA 1RDCA 3UDLA 5KFYA 3L2QA 2VWKA 4F4KA 4B9NA 3DLEA 2W9CB 4YR0A 3H2LA 2R8IA 4KO0A 4WYWA 4KHWA 4I2PB 3GV5B 2OH2A 4QAGA 2F96A 4CJEA 2RKIA 3OL9A 3AVLA 5HBMA 4CJKA 4M3TA 4FJGA 1S1WA 3V6DB 1JX4A 4DTRA 3PO4A 2R8JA 4N76A 4DS5A 5KG1A 1T94A 5L1IA 4GC6A 4ED1A 3OHAA 2IM0A 3H5YA 2WK4A 3E51A 1S9GB 4MK8A 1RTHA 1TKXB 1HYVA 4F4WA 3VQBA 4QOZB 3ZT4A 4F8RA 2DFFA 4B9LA 3S3NA 4DFMA 1FKPB 4FLWA 1BQNA 4KREA 4BE2A 3N6LA 4IKAA 1XHXA 3LP3A 4K4YA 4MFBA 1NNDA 4K4ZA 1TQLA 3OLBA 1HYSB 2J6TA 4Q0BA 1GOBA 5HLFB 3PR4A 3L8BA 3V1QA 3QEIA 2R2UA 1NK0A 3PJWA 1C0UA 3TAGA 2KFZA 3M9NB 2AJQA 5I3UB 2AQ4A 3DRRA 3DYAA 4ED3A 1S1UA 1EKEA 1IKXB 3V1OA 1LW2A 3ZSXA 1D9FA 5DGAA 4NYFA 1O1WA 5F9NA 3BJYA 1WSHA 3CDEA 1DTQB 4ED6A 4GW6A 5D3GB 3M8RA 1GOCA 4FXDA 4W5RA 4DU3A 1B92A 2VWJA 2FBTA 2B6AA 3AA2A 4E1MA 3ZT1A 3HVTA 4EBEA 1YVUA 4ED7A 3MXJA 3BDPA 2YHAA 1R0AB 3CO9A 5J2PA 4FK0A 3GIJA 2ETJA 1S1TA 3MXMA 3PX6A 5KFUA 4FJ8A 1KFSA 1JL2A 4F2RA 4XPCA 1BCMA 4ECXA 2Q3SA 4DTSA 5KFLA 1NOYA 3BSAA 4CFCA 1N6QA 4QWEA 5KG0A 5KFFA 4C8LA 2E9RX 1TAQA 1ZBLA 1KRPA 1YTAA 4KHNA 1RA6A 2JLEA 3C95A 3G86A 1L5UA 5KFOA 3LP0B 4CEQA 2VA2A 1UA0A 5C25A 4HVJA 3KMSA 3OL7A 1S0MA 1S1XB 5KFTA 5JUMA 1VSMA 4N56A 2BDPA 2B5JA 2XY6A 4YP3A 3VQ4A 4M3WA 4CJ4A 1HQUA 3KK1A 2JEIA 4H54A 4NLVA 4DG1A 1CXUA 1Q9XA 3T19A 3PHEA 3VA3A 4DLGA 2ASDA 2D0AA 1RT2B 3U6FA 4IDKA 3ZT0A 3SUQA 3O3HA 4MQ3A 3SFGA 5KFXA 4WE1B 2X74A 3D5MA 2Z1GA 4F2SA 3T1AA 1X9WA 2Y1JA 2BQ3A 2FBXA 4CGIA 4ZPAA 5HRSA 3CYMA 1ASVA 4NYNA 4R5PB 5JXSA 2E4LA 3OY9A 3RMBA 3SV4A 4KV8A 1QTMA 3AVGA 3SJJA 2HHTA 2D0CA 4M41A 4LQ3A 4RW6B 2OPSA 4CGDA 1VSDA 5KT6A 4DTUA 3G6VA 2GBZA 4PQUA 3MEDA 3KLFA 1J9AA 2F8EX 1TKTB 2IBKA 3KLHB 5J1EB 3OSPA 3NBPA 3DLGA 4TQRA 4N41A 3OJUA 2EX3A 5C24A 2OZSA 1NKEA 4ZTJA 2VG6B 5F8GA 3BQ2A 2OA8A 2DPJA 4NCAA 2KQ2A 4NCBA 2Z1IA 4QWAA 3NH0A 1HRHA 4DSKA 2I5JB 1WSIA 4CK2A 2Z1HA 2XWYA 3H08A 1MU2A 5KFBA 4BACA 3DMJA 4DSJA 2IM2A 1S0OA 1U47A 2JC0A 1QSYA 4E7KA 4RW4B 1TKZB 3RMCA 5F8NA 4M3ZA 3FQLA 5KT2A 1EP4B 4NLXA 4CGFA 3MAQA 3RRHA 3IRXB 1S6PB 1XHZA 1RDDA 2IOCA 4RW8A 1JLBA 3HM9A 2VG7B 1K1QA 2OPRA 2E9ZA 3L2RA 4EP4A 1C0TB 3NGZA 3DRPA 3DM2A 4KAZA 2FC0A 3L3UA 1C1CA 4KSEB 2OPPA 5HROA 4I2PA 4PWDB 4TY8A 1JLFA 3L3VA 5KFWA 4BWMA 4F3OA 3KLGB 4CECA 4DQPA 4EBDA 3PW4A 2VG5A 1C0MA 3ULDA 3KNAA 3AVAA 3SQ2A 4ECZA 3JSMA 4FZYA 4XO0A 4CJ5A 5HP1B 3DOKA 1WSEA 1Z4UA 4J9OA 2V0NA 3TARA 4IBNA 3DLBA 1Q8IA 4KHRA 2YNGB 4LQ9A 1RT1A 1BQMA 2R8HA 2C2EA 1D5AA 5KTQA 3O3GA 4IH5A 3H5SA 3HPHA 4KB1A 2XY5A 3P1GA 1SUQB 2FVSA 3OYFA 4R8UB 4Y2AA 3KK2A 4DMNA 4J9KA 4F4XA 2ITGA 4DFKA 3LP1A 2V4QA 2G8UA 1WNEA 4MKBA 1U49A 2P51A 3NF7A 1FKOB 4BDYA 3DRSB 4C8MA 1WSFA 4NCGA 1ZTTA 5I3UA 3V4IB 3KJVA 3D45A 4C8OA 3V6KA 2AX1A 4Q45A 1JXLA 3FFIA 1IKXA 2HW3A 1QQCA 2YNHA 4E89A 1J5OB 3AO4A 5CZ2A 3MEGB 3HVRA 4YR2A 4NLWA 3RR7A 1RTIB 1HPZB 5D3GA 3BGRA 3DLKB 4E0DA 2R8GA 3VQEA 3K5MA 1NK5A 4FJ9A 3H4BA 2ALZA 4AHVA 3TABA 4CHPA 3PY8A 1BIUA 4IRKA 3GQCA 4KE5A 2FVRA 3K5NA 3DOLB 4TLRA 5KT3A 1NK7A 3O4NA 1RA7A 1IKWA 4KHYA 3CQ8A 3VQQA 3LP2A 2AWZA 4B9VA 4OKJA 2JEJA 1LWCB 1TK5A 1KCFA 1D9DA 2OZMA 4RW7A 4NZ0A 4Q5VA 2F8SA 3V9UA 4ID5B 4Q43A 4K4TA 3DDKA 4DFPA 1MMLA 1JKHA 4MKAA 3RB0A 4CJFA 4WZQA 3VQPA 4K4UA 3NL0A 3QEXA 3BSOA 4TXSA 1ZYQA 4ZHRB 3NDKA 1RT2A 4CEDA 4O3OA 2FVQA 2QXFA 1FK9B 4O0JA 4M3UA 4CEAA 3I5AA 2FBYA 3T3FA 1T05B 3GV7B 4ID1A 3ZSWA 4WXOA 5J2QA 2JEFA 1REVB 1HNIB 2HMIB 4ZVHA 4JRPA 4HUEA 4KRFA 1BI4A 1UWBA 1GOAA 4NLUA 3L2UA 3QLHA 4HYKA 2IM3A 5HRRA 4DU1A 4O3PA 4O44B 3OYEA 3AVFA 4TSXA 3RMAA 1I6JA 2O5DA 1RTJA 3AVKA 4AHTA 4RW6A 3ZSVA 4G1QA 3HP9A 4HUGA 4FLTA 3JYTB 4RNHA 1FXXA 1TKTA 5KFHA 1LWEA 2ATLA 4IRCA 4RUAA 3KLHA 4HUFA 4ECWA 5J1EA 1T7PA 1IG9A 2W8KA 2WRMA 4LSLA 4CERA 1DLOA 4M95A 2C22A 1U45A 2QE5A 3QIOA 1TK8A 2C2RA 3RBEA 1RT3A 4J9MA 4I7FA 4B3OB 3WNEA 4FK2A 4E7JA 4K4WA 4JLHA 4J9RA 3OYNA 4KTZA 3OL6A 4KFBB 1EX4A 3THVA 1HJRA 4FM0A 4ICLB 4AHRA 3OJSA 4IR9A 5CYQA 1EETA 4OKEA 5DG8A 4CJTA 3RMDA 4DF8A 3D0PA 3TANA 4RG8A 4J9QA 2WOMB 1L3UA 1CXQA 3FSIA 3EZUA 4FM2A 2RPIA 1RT4B 2BE2A 2V4RA 3HK2A 3HO1A 3KOAA 3VQ8A 3CVKA 2WONA 1S49A 3RB6A 3MECB 2R7YA 3TAQA 1NK8A 2KFNA 1XR5A
chains in the Genus database with same CATH superfamily
4DL5A 4ZP6A 3OHRA 4I2QB 1N36F 4PXDA 3B6PA 3BBBA 3PACA 3UR3C 1BA0A 2EPIA 2XCAA 1N5YB 1XERA 4FKYA 3AA5X 1S9EA 4XIUA 4OPKA 1O6XA 4F0MA 4U6PA 1R27B 3GIRA 2CQHA 3KFWX 3HFZB 1SIWB 5AQVA 2YQ1A 2HB5A 1EWQA 2BANA 3F44A 4URSA 2VFTA 2P9GA 4ZITA 2E2PA 2Z4PA 2HGNA 1HD1A 2NXEA 3IAYA 3EUNA 3A8IA 3MURP 5FPMA 4IG3A 2E5HA 1TL7B 3CULA 4OJRA 2C28A 4KIAA 1K8KA 1H72C 3UNYA 1ZBUA 3SQ1A 1SH2A 7AT1B 2XULA 1FKAF 2GUIA 2HHQA 1S0NA 1WF1A 2D3UA 1BE4A 4HCBA 1FRJA 1DKGD 3CCUS 2B9WA 4FNHA 3IRWP 3T7ZA 2MJUA 2W7AA 3R2DJ 2OPQA 3H5UA 1SJ4P 4H5NA 2HNYB 2HZCA 4DL2A 3FZBA 1ZETA 5L1KA 3P5BP 5LL6d 4Y2IA 3QZ8A 1FXLA 4PG8A 3NNCA 3HL8A 5T7BA 4DU4A 3HHDA 2H5JB 3NGSA 2LKZA 3O08A 3C15A 3WZ0A 2ZC3A 5EWEA 3CPWR 1KVCA 2DGOA 4CZJA 4F36A 3C7NA 1CBKA 4CGHA 4U95A 5T14A 3G0ZA 2HS4A 3RYLA 4JHDA 1HLWA 3MFIA 3TR8A 4C11B 1YF5L 4GKJF 2XTJP 3M2RB 2A5XA 5LT5A 3VERA 4KH5A 5TKWA 4C9DA 2ZKUA 2A10A 3C6TB 1D9AA 2E1ZA 1XC9A 3H20A 4CIOA 1CULA 3O1LA 3TI0A 4ZVGA 2ILYA 2VICA 3E9LA 2CKWA 2HHWA 4CJVA 1HJOA 2A1SA 2B4PA 3AAPA 2ZH2A 4H4OB 4FLXA 3OTBA 1TFWA 3VQAA 4ZHRA 1RB0A 4O3QA 2DR5A 1N32F 1NBEB 1WC4A 3DI6B 3PRBA 2QA4G 2IM1A 1XK8A 4TY9A 1VQ5S 2UVUA 2CQPA 1WEZA 3VAKA 5KT4A 1TMJA 2QL7B 3P6YC 1MROB 3OVNA 4LF8J 2OYQA 1HWJA 1KDNA 4OYOA 2PY5A 1RK8A 2LYVA 4J91A 3MCNA 1NK6A 4IH6A 4NX9A 3SBGA 2N3LA 4U7UD 1HQEB 2FJAB 4DL4A 3HSTB 4DB3A 4OJ1A 2MJNA 5ITHA 1IQTA 2FJVA 4FLUA 1LCUA 2IYGA 2ZE2B 4JI1F 1WUUA 1VRUB 3ZSRA 1NM2A 3FKBA 4IH7A 1NXIA 4QW8A 1JLEA 5BN9A 3ENHA 4I0WA 4JV5F 1ITGA 1NKCA 3M6GA 4KHSA 1C1BB 2W6LA 4PAAA 3AVIA 2BKOA 4PKHA 5GAEP 3OR2B 2RMLA 2QA1A 4NMXA 4Y1CA 1NAQA 1IKYB 4FWLA 5KFNA 4ECTA 2LMIA 2YNIB 5BRHA 2KM8C 1SQFA 3CCRS 3O9TA 5F41A 3SCXA 4KFBA 4BVPA 5M2UA 3I0RB 4LH4A 4DV6K 4M5MA 4K8RA 3DAWA 1UMJA 4IEEA 2OKQA 3I5CA 3IGVA 3L2VA 2A1RA 2F40A 4ECVA 4QS8A 2UUBK 4OKKA 4OHZA 3FMBA 1HWUA 3W62A 4BCAA 4B3SK 1NH8A 2W9AA 4FW2A 1FFWB 3KJQB 5AZIA 5HBMB 3T69A 1ROFA 1S1WB 2NR0A 3IM8A 3NCRA 1KOOA 1XBWA 4P52A 4M63C 4RU9A 2QV6A 4I6MA 2G4BA 3C6UA 3AGKA 2ZNYA 4DL3A 1BISA 1TUGB 3Q8PB 3PRVA 3TAPA 4HR2A 4OLBA 5GMKa 4XH1A 5KFGA 1HYSA 5LOQA 2VPZB 2YX7A 1Q53A 4X4UA 3V9ZA 4DR1K 2DNZA 1KOHA 3V81B 2NRXA 4B3SJ 4CHOA 3KVGA 3EXYA 2WTFA 2YWGA 3TSPA 3OD2A 5FROA 4TVAB 3FBCA 4RWXA 1S1UB 5AE3A 4W5NA 4CGGA 2R7UA 2IC3A 3OTCA 3QEWA 1YI2S 4NLTA 3BZCA 1QTNB 4O5BA 1YDLA 2CGLA 5A6WA 4OYMA 2B6AB 1DAXA 4DV4F 3KKSA 1D0EA 5BPLA 4C23A 4FNIA 4V1Ak 4JI2J 3EZOA 4BR4A 4ZTFA 2WSFC 1OSDA 5KAKA 1V4TA 1NGDA 3C16A 3I56S 3PJXA 1UAXA 4JKAA 4PEOA 3ILIA 3VQ6A 3WQUA 5M1NA 1S1XA 2YKNB 3BEGB 1KVBA 4CLFA 3RAXA 2QXLA 2J7UA 2AA4A 1YRXA 2L3MA 3CJTA 1BO5O 1H38A 1ZAWA 2UVWA 3PSFA 2OAUA 3KHGA 2VZ9A 4PL7A 1VQ5N 3CMES 1RBTA 4CF9A 3LGNA 4DG1B 2ZZTA 3IMQJ 5A8WB 3V1RA 5JLFA 4YORA 4DV2F 1FWLA 3CJKA 4F3TA 2QI2A 1VSHA 3H4DA 3ATUA 4GVBB 4YN3B 3MR6A 4A2AA 2MKHA 2H4WB 4AH9A 1GX5A 1WAFA 2C2OB 2LCWA 1NMDA 4U96A 3K57A 2MZQA 4KTQA 2Y0SD 5KFMA 4KV8B 3BS9A 2PFFB 3M2VB 1PAEX 3VHQA 5KG2A 5MLCQ 2NUHA 1JCGA 2OTJS 3HRGA 4GVMA 2OPSB 5THWA 4XDCA 3KLVA 2GGPA 1G15A 3UR0A 4HTLA 2P9IA 2KG0A 4ZVQB 3QGIA 3ZETB 1ZXOA 2BTFA 4RW9A 2GHWA 1HKAA 2UU9F 4DPOA 2FDNA 1MWZA 3POTA 2BEFA 5C24B 1VSFA 4JD2B 3OYBA 3AO5A 5CA5A 4R0JA 1MU2B 4RW4A 3ZZRA 1MWKA 4NLGA 1XR7A 1EP4A 1S6PA 5BXIA 2KYXA 4NXMF 3BO2A 1S6UA 3HFVA 4CJLA 2XYGB 1NSQA 1MMDA 1IKVB 3G82A 1JLBB 1U0HB 1C0TA 2OPRB 3NAHA 3JSYA 2QFJA 4L75A 4RWWA 2JVOA 1TYQB 2MLYA 2ZZMA 2LEAA 1FDBA 3OYJA 5DM6L 2OPPB 5HOOA 2E6LA 2C3OA 3I55S 1JLFB 2VA3A 4RNNA 2RIJA 1VLYA 4DV5K 3AVHA 2BZ2A 3J81O 4KBOA 3C19A 4A8SA 3P4IA 3VMFB 2DBBA 5AT1B 1SJFA 1WJ9A 3O2IA 2MGZB 1V3RA 3VQ7A 1HNZF 4IYQA 3KHRA 3NOGA 1BQMB 4B1YB 4C97A 4CT8A 4WP3A 1IR1A 3DC2A 3I8DA 4LF2A 2QLBB 4NLBA 4MIWA 4AL7A 5J1PA 4DQQA 2VHGA 5C0YA 3MWPA 1RBAA 2W4PA 3SFUA 2ZH6A 3NVKA 4DV5J 3UW1A 4GV6A 1Q16B 2IYIA 1KWMA 1V3ZA 1YI2N 3Q8UA 1U1PA 5KFKA 1R43A 3R2CJ 1VAZA 1X5SA 2AEFA 3KJVB 3LGMA 1OSCA 2GHVC 4DR7F 1RKIA 3PO5A 3MEGA 4QWCA 4KGXB 2P8IA 4ZP7A 4OPAA 4PL8A 2HMPA 3W3DA 1CPZA 1JXEA 4UY85 2I7PA 4KAIA 4M63A 4OX9J 2CH5A 2XC9A 4WQ4C 4EIAA 3VALA 4MK9A 5ETNA 1LAWA 3HHLB 2XLJA 5MLCV 4KPYA 1T9YA 2QLJB 5F0UA 3PDNA 4F67A 3I56N 2Q1LA 4NLSA 3DU5A 3SEOA 5AQKA 4KKOA 1NJZA 3QPIA 4CJQA 2FJDB 3BF3A 2Z2YB 1PBAA 4PYDA 1V3SA 3NEKA 3PIPL 2A40A 1HLUA 4I56A 3MPYA 5IT9O 1AFIA 3RW7A 2HF3A 3LP2B 4FPAA 3SUOA 1U09A 3LALA 1PGZA 1RHUB 3CMAS 4RW7B 3QEVA 4NLPA 4GC7A 5AZJB 3NKYA 3VVUA 4Q8FA 2OI2A 4JBCA 1WWHA 2WUSA 1NK4A 1FK9A 2UXBK 2ZNZA 4Y28C 1KP6A 1GX6A 2K8GA 2GMJA 2LXIA 1FDDA 5LXRA 1BCOA 5E3RA 3ICLA 3M8PA 2GJFA 1P27B 3KLEA 3LW5C 1HARA 4Q44A 2OTJN 3OXFA 3GJTB 4ZVFA 4JV1A 1VQSA 1L3TA 1HBMB 1BI4B 3THXA 4C3MA 1U2CA 3P5JA 2Y3YA 3CJRA 3TP2A 2H65B 3ID8A 3BP8A 4NLYA 4F26A 1X5TA 1YRUA 5ETLA 4KH1B 1VBYA 1N34J 2HPUA 3N28A 1RBOB 5DZ6A 3LH2S 1LV5A 1J27A 2R7WA 1CZ9A 4G1QB 1FRLA 3HD1A 5E41A 4Y65A 4IFYA 1ZBTA 1HNWK 2UXBJ 3B4DA 2ZBCA 4M42A 3HI0A 3THYA 2MY8A 1RT3B 4I7FB 3C94A 3UO0A 3T6JA 1GMVA 2RF2B 3D2EA 3PW7A 1JB0C 4NI2A 4ICLA 1FNOA 1K9MO 4HDHA 2E5IA 3EPGA 1EX8A 1OIAA 1IJJA 2EG2A 1LWXA 1FRHA 1B9FA 3WXMB 4WZMA 1CJTA 2E2QA 1RAFB 4LVOP 3VQ9A 3BO4A 5E2QA 2ZOFA 2MQPA 1U1NA 4WYBA 4X4RA 2DPIA 4M7YA 1Y64A 3HM8A 3I55N 2DH7A 2M9KA 4F3MA 4DSIA 3DLRA 2CQ4A 2ROEA 3CM6A 4CO5A 3HSJA 5DZ7A 2RT3A 1Q5YA 2CVEA 3TZXA 3HHNB 4NRTA 2D4WA 2C2NA 2EFOA 2CJQA 2R7QA 1ZOTA 2LVWA 2GAGC 1DTTB 2PMZD 2DNNA 4C8YA 1CEZA 5EGYA 3FZLA 2HBMA 2K3KA 1T0TV 1F21A 1OO0B 4HKQA 1YJRA 3M32A 3G96A 1Z26A 3VAHA 4OYIA 1VQ7N 4BC7A 2HSEB 4I9LA 4MH8A 4WQ5C 1RTDB 1CS4B 1GLEG 3AV9A 4DDFA 5CE3A 3R97A 2M8HA 3G6XA 3MM6A 4M5DB 4YEAA 3WX4A 2B43A 2FIUA 3VGKA 4OZ5A 4A57A 1U1OA 1FTRA 1JLCA 3U8XA 3R5AA 2FSJA 4MKYA 1S1VA 1NU0A 4WFNL 2Y8WA 1PCAA 3OYIA 3U1MA 2BGGA 3SBMA 4DV6F 1D09B 4C8NA 2VPYB 3BQ1A 1SKSA 4K8XA 2IJFA 4LR8A 2VQFJ 1T3VA 4DSEA 5KG5A 3DYAB 4HHUA 4CP5A 2G2OA 2KJWA 3DU6A 4LUBA 3N01A 1LW2B 3NAIA 4EO6A 1RAAB 2UUBF 2MQMA 2W9BA 5HQLA 2W2QP 4OV6A 1RT7A 2ITMA 3BGOP 3ET6B 4M5LA 1VI7A 4ZIWA 2B8PA 2H9ZA 1GXLA 5B08A 1IBKK 1HNXK 4JKGB 4WFBL 2CPXA 1CJVA 2AU0A 3ZZZA 3DDIA 3LF0A 3U9ZA 1TV6B 3FCHA 4F0HA 4RTFD 3LPTA 2CAJA 1A5WA 1N6QB 3TAMB 2OEJA 1EQMA 1BDGA 4ZPVR 2XHBA 2KI2A 3I8BA 1WI8A 4ZLLA 1U6BA 3MCAB 4BRFA 1A5VA 5KRTA 4TYAA 1A5XA 3CMAN 4V19J 4OZLA 5J2MB 3HJFA 4K0KK 4BR7A 2UUCK 2W7PA 2OUGA 3VQ5A 1NEEA 4TYBA 3HX9A 1MWYA 3J80O 4H0YB 4AXIA 2OD4A 2YBVA 4PQAA 5GMEA 4DR1F 1VQLS 3OS0A 3ENOA 2B7BB 1S5ZA 4I1TA 4CESA 1R0CB 1IBKJ 2UVRA 3E01A 1GLFO 4GRSA 3SI6A 2IAJB 1RDBA 3QIPB 1WHYA 3C14A 3CO0P 4DSFA 2UP1A 4HHJA 1QVGM 1GMWD 2EI5A 3IR7B 2HKEA 3SCKE 3IDHA 3CE8A 1BOTO 3KG4A 3VF0B 2MXYA 2P9KA 2R4FA 4K0KJ 1SKRA 3OT9A 4YOEA 2VFVA 3N4PA 1BGXT 5HL7Q 2X3DA 2KU7A 4CJWA 2QN6B 1KHWA 3MUTP 4TU9A 3HP6A 2VB6A 3H40A 3W9HA 5DQGA 2ZWHA 3SI8A 1J5EJ 2FF6A 5KGWA 4LY7A 4CYUA 1MG7A 3M05A 1KVJA 3CCLS 1L3VA 5AQXA 3GL1A 1S0VA 4BC4A 3MEEA 4KHMA 4DZDA 2BJEA 3FRZA 2OSRA 5LJVA 2A41A 1QUVA 4LVNP 5AXKA 4DTPA 5BR8K 3ASMA 4EZ9A 3I6PA 3I31A 4O0IA 2E1YA 1WSJA 3QO9B 2IIRA 3CPWM 3NS5A 2DHSA 2AJ4A 1WDTA 2L41A 4UOHA 3OYLA 3QESA 5M2RA 5BN8A 4A8OA 1RDCA 2EKNA 2BM1A 3MM8A 4C1NK 4CLWA 5HMZA 2W9CB 4YR0A 4WYWA 1S59A 4KHWA 2DEIA 3QFHA 4QAGA 1ZM2A 6FDRA 3D1HA 1N5TA 3CGIA 4WTYA 3TA2A 1F2GA 4FJGA 4DR4K 4G65A 1JX4A 1N5VA 2F9WA 3RUBL 3SMPA 3DXKA 4JI3K 5L1IA 1TR0A 5IM0A 4GC6A 1R8AA 3H5YA 2WK4A 5DJBA 5BR8J 2WBRA 1HI1A 4AFFA 3A5MC 3BB5A 3VQBA 4QOZB 4F8RA 2HEKA 4CZGA 3OA9A 4MLHA 5AQMA 3NGKA 3RW6A 1VR6A 4FLWA 4IKAA 1DEJA 3LP3A 2NSBA 4K4YA 4MFBA 4K4ZA 1TQLA 3OTOK 1C4AA 5DO2A 4Q0BA 5GAEI 3HJVA 1GOBA 1OQ3A 5DM7Q 3L8BA 3QAEA 1PKUA 3V1QA 2R2UA 1C0UA 4DR4J 3M9NB 2AJQA 4PWUA 1QHAA 3DRRA 5ETQA 3CJ7A 2NLXA 1FE4A 1GFWB 1KKHA 1EKEA 2ZH1A 3U4LA 3ZSXA 5DGAA 2J0XA 4ZN1A 5F9NA 2V94A 1GH8A 1WSHA 1E6VB 1Y3KA 3CCWA 5D3GB 1GOCA 1WC5A 2DT9A 2VWJA 4NLCA 3MN9A 3CJSA 4YB7A 2YHAA 4WQ5A 4FK0A 4RPFA 3MAHA 1HKCA 2R7SA 3OTOJ 3GIJA 3UDVA 1S1TA 1Q79A 3CNQP 1KFSA 1V5IB 1U1MA 1O5JA 1NOYA 2DGSA 2BX6A 4U67Q 4OHWA 5KG0A 3AB4B 4C8LA 3OBIA 4IEIA 4QIGA 5AQFA 1EKSA 3CI5A 1S77D 2QG9B 1URNA 3C95A 2W40A 2W2MP 1VDHA 3M1VA 1FD2A 1W97L 1XMOF 3Q8YA 4HVJA 4IJNA 3CQXA 2A2CA 3TQEA 2HZAA 2NQPA 3T9ZA 2XY6A 2NCKL 3VQ4A 5IWAK 5AR0A 2GS8A 4P71A 1IVZA 2K7JA 3N9UC 3GCWP 4IDKA 3U02A 4WP9A 4MQ3A 2ZHOA 5KFXA 4DUZK 1P6TA 3CCMS 3D5MA 2GMLA 2WW4A 2NRTA 1REGX 4F2SA 3RJMB 3TZYA 3MAAB 4ZPAA 4NEYA 5DDRC 3PM9A 1NDLA 2YI1A 1FEHA 3G25A 5HVHA 3AVGA 3VTHA 4IO9L 3J8AA 4LQ3A 2XS7A 3G6VA 2AV5A 5L38A 3GFHA 5AQLA 2DGQA 5D4OA 5IXUA 1R31A 2CPJA 3RU0A 1H2TZ 5J1EB 3JXOA 3NBPA 3MN7A 2VOOA 2ZVIA 2N4DA 3IAM9 2B9XA 4DZ6A 4GO7X 3MI7X 3UDEA 4DUZJ 2VG6B 5A2QU 4NCAA 5EOYA 3R8YA 2KQ2A 2Z1IA 1JMTA 4CK2A 1EJ7L 3DMJA 3MM9A 4DSJA 1U47A 2HLTA 3FZKA 4ZK7M 5F8NA 2A42A 4M3ZA 3BKFA 3JS9A 3IRXB 1RBLA 4YOUA 1KQFB 4JN4A 2QWMA 3DGPA 1HHSA 4RW8A 2VG7B 1C0GA 4AQYK 5K8PA 3MGJA 4DPYA 4EP4A 3NGZA 3T1HJ 3O1BA 2AJFE 2LECA 2IDLA 1OPZA 2JLFA 2CQ1A 4KSEB 4I2PA 2BKNA 1CZAN 1HIYA 4C7QA 2BJ8A 1T6DA 3L3VA 2RS2A 1NJIO 5EX3A 4UOGA 1C0MA 3KNAA 1RWVB 1WKJA 4OI0A 3CCJS 4ECZA 2YH1A 2P9EA 4CJ5A 2B9YA 2HURA 1EZZB 3FRYA 1SS6A 2V0NA 1Q8IA 1HNWF 3D3BJ 1RT1A 1HFEL 4HACB 2VASA 3O9UA 4IH5A 3R1HA 4IQMA 3H5SA 2Z2MA 3WXKA 4AQYJ 1WTFA 3KK2A 2NZ4A 2LA4A 3H25A 3ADAC 2R7VA 5A76A 4J9KA 4F4XA 2CG8A 3RG6A 3LP1A 2V4QA 3EVMA 1JWWA 5B0BA 3OTEA 4PXBA 4MKBA 3T9NA 3GDQA 5I3UA 3D45A 4C8OA 4ZCKA 4DR2K 1JXLA 1UCNA 5D78A 4I6AA 1H7WA 1G6BA 4K59A 4KT0C 3HVRA 4P6QA 3RR7A 3LOUA 1U0SA 3AQPA 4JI0J 3DLKB 4F04B 4DV0K 2F9TA 2E5GA 3CCVS 2WBNA 4ZCLA 1BIUA 4KE5A 5E3PA 2FVRA 5KT3A 4M5KA 3O4NA 4TLQA 3A8JA 3J7ZT 4PPDA 2IDEA 5EHHA 3OVAA 2N7YA 4D3GA 3VQQA 2AWZA 1VFJA 2HG4A 3DXSX 3FGVA 2DGUA 1KN6A 4DR2J 1XNRJ 3D0GE 5G0RB 2E29A 1KCFA 4DR6F 3P45B 3OW2R 5E26A 4ZIVA 3W5YA 1M1GA 4ID5B 4CLSA 2V6AA 3OV7A 3HZ6A 3ENVA 4USUA 1SC6A 4F4AA 4L72B 3VQPA 4WCEQ 3ID6A 2DGWA 4BVOA 3QEXA 3W1YC 1ZYQA 4ZHRB 5CZXA 1KBRA 4O3OA 4C2MA 2KKZA 3HLUA 4CEAA 3I5AA 1GMUA 3P8BB 3GV7B 4WXOA 1SPBP 2WTUA 3WC0A 2MY7A 1HNIB 4DV1K 3S7RA 3LUYA 2C3YA 4DOZA 3M8WA 4X64J 4JKDA 2CNLB 4NLUA 4OQJA 1HNXF 1W2BM 2PC6A 4DU1A 3VR1A 2ASYA 1M5PC 1OQ6A 5CHCB 3VGUA 3AVFA 1NGEA 3B54A 1I6JA 4HVZA 1HBOA 4U7BA 3FMWA 1Q95G 1AW0A 5LMNK 1V5VA 1QQMA 3CJCA 4HUGA 1RKJA 3QBXA 2XLKA 1RQ0A 2R7XA 2KKHA 2ATLA 4IRCA 3KLHA 4HUFA 4ECWA 1T7PA 2A3ZA 2W8KA 2UUCF 4M95A 2QE5A 3PRDA 2O66A 1VIOA 2E5LK 5I3PA 2ASPA 3PEJA 2FGOA 4N8OA 4K4WA 5AQGA 1IJFB 4LF7F 1RHRB 3K0SA 4KFBB 3THVA 1B7YB 4IR9A 5A2QY 5CYQA 1UVJA 3UKUA 4KGMA 3RMDA 4ZVOB 4J9QA 2WOMB 1L3UA 1YJ7A 1CXQA 3W0LA 3EZUA 2AJ0A 2V4RA 4E1JA 3KOAA 2DPNA 1GLLO 3CVKA 1RABB 2WONA 3MPDA 2O8EA 3CCJN 1BMQB 4UQTA 3BN4A 3TSQA 2XMTA 2NXUA 1RADB 1U6FA 3AO3A 3OYKA 2D9OA 3QMLA 3PYFA 3D66A 1N0VC 3IP0A 2LSNA 2EC2A 4Y34A 2D3O1 3ZTSA 3MMCB 1Y5NB 2W6KA 2ZJRL 3C6UB 4NO7A 3RR8A 4DS4A 5L39A 4JK9A 2XM3A 2MYFA 3R7SB 4PKDB 3QGHA 2BW7A 2IMWP 4CEFA 3KK3A 5D4NA 3BSNA 3OR1B 5CD4H 4W98A 5C42A 3QRPA 4DCJB 2R7OA 2YNFA 2HHHF 3J81U 2QEXN 1A6LA 1GLAG 1MA9B 2V8DA 2PDAA 3VGMA 1ZAVA 4O4GA 2WB1D 1FJEB 5F8HA 5D15A 4HTUA 2OEKA 4FZZA 1U04A 4DFJA 1VQ4S 1VJWA 3U9DA 4ATNA 2CQIA 2MZ1A 1J2VA 4B3MF 2IC3B 2J9EA 2GNKA 2DNHA 3G8SA 2ZM6K 3CCVN 2CZVC 4USWA 2VBZA 3DXMA 1FNMA 4B3TJ 1VSLA 3N6MA 1GEHA 5ETVA 1HPZA 1UPPA 4C98A 1B3TA 2LFVA 5ETSA 4JI3F 1N33J 4DTOA 3NWRA 5DLFA 2BV3A 3CF5Q 4KHQA 1PILA 5JVGQ 3PVXA 3MM7A 4X66K 1JJHA 3QRQA 1OWXA 3DOLA 4GKKF 4WFXA 3C16B 5HANA 2NREA 1HWIA 1SQEA 5C2CA 2MZTA 4FS2A 3UFCX 2PD1A 1G99A 1JIHA 3I0SA 1FO1A 3H45C 3HT3A 1JLAB 3BEXA 1N54B 4ZA1A 1BLUA 2F9JA 3UNGC 2IGIA 2R7RA 4Z4HA 3ULEA 5IOLA 1B9DA 3CD5A 2IRUA 2FLPA 1KSPA 4QIWD 4FXVA 4NL5A 1QVFR 4FJHA 1VRTB 4F0KA 1OY8A 4YHHK 4X66J 5FRNA 3A3PB 2CVIA 2AYGA 5IT9U 2BKPA 2DRBA 1RT6A 2F65A 2YHBA 2XMMA 4A2BA 3NMAA 2GEMA 3E66A 1BU6O 5JJBA 3NAEA 4CLKA 4FM1A 1TL3B 4WYLA 3FQKA 3BO3A 4OYZA 4CW7B 4RUCA 1TP7A 4RO0A 3ZTOA 3G87A 3GYNA 2HOEA 2GQ2A 3GG0A 2DR8A 3BZQA 4C0HA 1RACB 1HI8A 3HF5A 2FYXA 5DQHA 1L3SA 2FLLA 2UUAK 3JYTA 4ED0A 4RW9B 4H0PA 3OVBA 4YB1P 4CJPA 3HPGA 1YAGA 4DN0A 2AYBA 2Z1JA 1DURA 4NE9C 1K1SA 4JI6K 5KOWA 2ASLA 4NWBA 1JLGA 2IDOA 1UL3A 4ES3A 5IWAF 4JYAK 1SV5B 3IS9A 4CH0S 1B99A 4X62F 3DKDA 4DCHA 3MOJB 2I0XA 1ZPVA 2MQNA 3BM7A 1LXJA 4UUWA 1IBMF 5I42B 1SC3B 5ADXH 4QS9A 5E33A 2ZHBA 2VQEK 4OGCA 4FK4A 2G2ZA 4B9SA 5HN0A 4LF9K 2GHPA 1IV0A 5AQRA 2ZJQL 1CSJA 3R1XA 4B9MA 4BR0A 3IWNC 3WEEB 1N5QA 3V6DA 3RB3A 2YPZA 5LL6Z 2XHWA 2NUUG 3FK4A 4EBCA 4JI6J 4G1IA 4FJKA 1N52B 2H4YB 1S9GA 3CMQA 3AJ2A 4O3SA 4QS7A 3NHGA 4ZVPB 3CC7S 5GIPA 1R8BA 2Y0BB 1RTHB 1M5HA 3AA3A 3JXUA 4BC3A 3KD5E 3F73A 2WHOA 1FKPA 4HTIA 1E4FT 3J7A1 1UZDA 2M3DA 1Y9OA 1YITN 2NS1B 1HBUB 2VQEJ 5DDOC 5K20B 2R8KA 3QT8A 1NGJA 4FWNA 2HVEA 1CZBA 4LF5J 3PW5A 2H5IB 2FY8A 4IFEA 4OJGA 3D6TB 2LQ9A 4K4VA 3VA0A 1GAOA 1YTYA 2HFOA 3U3YA 2R7TA 1BUXA 2EK6A 1RBVA 4C0BA 1U7LA 3J81Y 3SAHA 4KC5A 3FGUA 2RDJA 3ULHA 4OI6A 3ATVA 4HH0A 3SIPB 3FEYB 4WIIA 2XZTB 2B4JA 3HVTB 2B0GA 2PIIA 5LSOA 4QU7A 2BRLA 1KD1O 3ZXWA 3D28A 3VGVA 2GUPA 4KKOB 5HRPA 4AM6A 3KWGA 4FVUA 4KRWA 2ZD1A 3NLCA 2F1FA 3CG7A 4Z4FA 3NH2A 1ZBIA 3H1VX 3OYCA 3NY0A 1NZAA 4CZCA 2J0QD 3MDFA 1BUPA 3EJMA 2MPUA 3HOTA 4IJAA 3NS6A 4W90B 4BQLA 4IQXA 3OYGA 1FRMA 4AHUA 1FNXH 3PZPA 2YPYA 5C2FA 2B5JB 2F4VJ 4DX7A 5K14A 1HR0K 1A7GE 4A62A 1H98A 1RCOB 1T95A 4WE1A 4P10A 1SKWA 3M8PB 3HVWA 4AL5A 2ZQBA 2P9LB 3I96A 3KLEB 1DT9A 3MX2A 4RNMA 2HHSA 2JFKA 4R5PA 4FBTA 3MMAB 3J80U 1HKGA 1S97A 3KNGA 2HGLA 3EX7B 1S3XA 4KTWA 3O8WA 4DV0F 3SSSA 1G3OA 5IT9Y 3F41A 2ZBPA 3NNHA 1ZM9A 1BWVA 1K8AO 1CLQA 3EMTA 2L9NA 4DPXA 3ZX2A 4PQUB 2GVDA 1W2IA 1YSJA 3K5OA 1YTUA 4LFCJ 1G2EA 2YJEA 1ESVA 4P72A 4IFYB 4BE1A 4A5BA 4CF8A 3P3DA 5ELZA 1HR0J 2XSJB 1WC1A 4A8KA 3QJPA 3THYB 2OMLA 1MMNA 3BDEA 2I5JA 3QSYB 4FS1A 3GILA 2MHEA 3K2PA 1N88A 2PGCA 2XMVA 3H59A 3PKYA 2MKJA 3M8SA 3S3OA 2Y1LB 1M1HA 3GR1A 3QJJA 4LF4F 1NGAA 1F1BB 2SXLA 4DF4A 4C8KA 3LDSA 1VC6A 4JI4K 4FYXB 4NASA 3CXCR 4HLBA 2WVDA 3L3CA 3CM5A 4BRKA 5EWFA 1UA1A 2DB1A 1PJ6A 3CDWA 4NB4A 3CFOA 4LFAJ 2QWOA 4CGJA 2ZITA 5CAAA 4DV1F 1B0VA 4LFBK 5HMXA 3FJ2A 2DCLA 4OV1A 3MMBB 3DRPB 4H03B 4NYZA 1U6ZA 1C1CB 4XH4A 4OZ2A 5HROB 4JI5F 4LF6K 4TY8B 5B09A 4J2EA 3LGHA 4M3YA 3CC7N 2UV8A 2RH3A 5LMNF 2VG5B 1FFSB 2DNMA 4JB8B 3B78A 3JSMB 3E8OA 4E7IA 1QZ6A 2FTRA 5KFQA 4OX8A 3HDSA 2CPZA 3NF8A 4PR6A 3ISNC 3NCIA 1WUAA 2WCXA 5FRMA 2E5LF 4OX6A 4DR5K 1UKUA 3Q22A 4OL8A 3G8QA 3EKSA 4LFBJ 5CCLA 4ZOSA 1FHTA 1M5KC 1KXPA 2MQOA 1MLAA 1VQPS 2XO7A 4A8XA 4WTOB 3CW2C 4HI1A 3MOZA 1SL0A 4HTJA 4LSNA 1DFDA 1FKOA 3AJDA 2HVHA 1M5SA 4AL6A 4NCGB 3I82A 2W9BB 1VQMS 2W01A 5L9XA 4AT1B 3PX0A 1SCJB 4RCHA 4BDZA 1WI6A 3K8WA 1RTIA 1YK9A 2GVZB 3BUZB 3OYHA 2O8DA 1OS5A 3TUIC 1TZ0A 1H74A 4EMDA 3BGRB 1NGHA 1RZMA 1CJVB 1RUSA 4M3RA 4J9VA 3M4XA 4M5IA 3LAMA 3OSNA 5KI6A 4B8CA 1AZSB 3C66A 2R42A 1QUPA 4URGA 4DL7A 2F7VA 1VC5A 4DR3F 1NHKL 1GK8A 1IG8A 3NF6A 3AA8A 4OLAA 3PHTA 3TJ9A 1RAHB 4KGZB 3AVMA 2B8QA 3OPKA 3TU5A 4RBVA 1E6YA 2RE2A 1RILA 3LL3A 4FJ5A 4OMFG 4FF3A 2OLWA 2QX0A 3QT7A 1RI7A 3Q7BA 4M7XA 4OYBA 1RLDA 1JKHB 2QGFB 2AD9A 3HKWA 2YWHA 2UUWA 2DY4A 2CQBA 3FDSA 4DKWA 3J7YP 4OFZA 3LA0A 1VSJA 2XEXA 2O8FB 2P9CA 3GU0A 2KZZA 2ZM6F 1REVA 1CJKA 3FBBA 2FJEB 5J2QB 4F25A 3EL2A 2XMJA 3SLCA 3UKRA 3G9CA 1FESA 1CJUA 2DNLA 3P5TL 2GX8A 5SUHA 5U47A 3SK3A 2E6MA 4O4RA 3KKRA 2L9DA 4LT6A 1KONA 1RTJB 2L48A 4M45A 3J80Y 2W41A 1LK7A 2DY9A 4MIBA 3LWMA 1RCHA 2JSXA 1JXBA 1XIQA 2A1BA 2BRKA 3SQOP 2AEJA 4KHPK 3LPYA 4CYUB 3V6JA 3PIOL 3S9HA 4O0NA 1YXQA 4PKGA 4U9RA 5BYSA 2YWEA 2NRHA 3TPQA 4B3OA 2QJ3A 2ZF5O 5LY3A 1ZPWX 3CC2N 2VONA 1MNEA 3MM5B 3M9OB 4K8ZA 3JTOA 3PTWA 2D41A 4W5OA 3BYPA 3CTRA 5DG7A 2G8HA 1WF2A 1QAXA 4J9PA 4CNZA 4DV7K 4CJUA 3IAS9 4DQSA 2NSCA 1S4EA 4YHHF 5D4PA 6AT1B 2V52B 3CCES 1WORA 4B1XB 2XMWA 1RT4A 5JVGL 1I3AA 2V63A 3S41A 2BE2B 1FXDA 3GIIA 3K9JA 1QE1A 2HFNA 4IOCL 1PG5B 4M5GA 3RWUA 1FVSA 3OW2M 4I2QA 1K47A 1NU4A 2ACMA 5F8IA 4DEZA 1N5YA 3DXKB 1H3DA 4F02A 4EFHA 4CLLA 3EKUA 2Q66A 5L8RC 3W9IA 2J0SD 5JVHQ 2VD3A 1BHLA 4AHCA 2XNQA 2UUAF 1NB2A 1UVKA 4MIAA 3IG1B 4QR2A 1LEOA 1FT8A 4DV7J 3LZIA 2FSNA 2OD6A 1YQHA 2GX9A 4GV9A 2RU3A 3DLLL 1VQPN 3BGLA 2XI3A 2V7YA 1XMQF 2QTWA 2G8KA 2VDHA 1GTHA 1TL7A 4YY3J 4DSLA 1IM4A 4J9UE 2FD2A 4JYAF 1PJ5A 2E1AA 3QWPA 2PI4A 4BRAA 2QKBA 5GADP 1RHMB 3DN9A 2O4IA 4KQZA 4NOHA 5DG9A 4FOIA 1JK9B 4NEZA 2FVPA 1H0HB 3K9KA 1LW0B 3V9SA 2FY1A 2ZH3A 3CCQN 1N8RT 1K0VA 2P1JA 1Q82O 1BD6A 3HCXA 2APOA 2NUBA 4LF9F 1UJ6A 2HNYA 1QAIA 1UJ4A 4BS2A 5H1SV 1NHUA 4ES1A 4ZPDA 1YBUA 1IJEB 1VMBA 5KPTA 4CF0A 2J9CA 2AF6A 4URQU 5I4MA 1BG3A 3W2VA 1C6VA 1FJGK 4PUOB 2YKOA 5DETA 4OLOA 4CEBA 1QY7A 4JI7J 2VU5A 4Y6IA 4ZVEA 1HI0P 2C2ZB 1GXTA 2H1YA 2RHSB 4KH0B 3AO2A 2D0PA 5JS2A 4O55A 4Y2KA 1YZ7A 3DXBA 4BRCA 2Q43A 3M2RA 2GJ2A 3QBCA 4TKTA 4L74A 3WNFA 2DO4A 1LQ9A 3G10A 3C6TA 3OFFA 1IQZA 3FE1A 4LRCA 4PZVA 5B0DA 2YQ3A 2PYLA 4FLYA 2KZMA 3W5ZA 1YJNN 1QS4A 3HVAA 1IXKA 3A1YG 4DCPB 3AVNA 4ED8A 4CK1A 5KG7A 2E2OA 4IDKB 3J81j 4QWBA 4CO0A 5A8KB 3GFZA 2KT5A 2HNDB 4B8AB 2D5RA 2RQ4A 3DI6A 2KN4A 4QJVA 1JNRB 5E7OB 2F8MA 2DR6A 3W64A 2IA6A 4CZHA 1YG0A 3OQ2A 3EVOA 3N4WA 4LRAA 3VENA 3E9OA 2NXCA 1VISA 4O8KA 3ITHB 5EDWA 3C6HA 3RBDA 4CZIA 3AQOA 2ADBA 1NJYA 5GAEU 2G1DA 2Q0RA 3GB0A 4K4XA 1HQEA 3OUYA 1WBBA 1VQ8S 3A0IX 3GIMA 3KLIB 3DLHA 1VRUA 2BBEA 1RWMB 9RUBA 1OVYA 2GTDA 3THWB 3W66A 5T7LB 4OHVA 1U26A 1C1BA 2DFEA 1Y7PA 1VGYA 1ZAXA 1KC8O 3HT0A 1WEYA 3EGNA 3OR2A 4FLVA 2DH8A 3MTJA 4ELVA 3ZSOA 3OFEA 4PY5A 3AA4A 4YNQA 4ILHA 1UPMB 2YNIA 5LMUF 3CCEN 4JI8J 2W42A 4N8NA 3CCZA 3JQJA 3PW0A 3BQ0A 3MEKA 2EFPA 2J6UA 3I0RA 3TNVA 3IR5B 1HR0F 1T03B 5CZVA 1VC0A 3MCOA 1U8WA 4NLQA 4BRDA 4CFDA 3Q0AA 2NPIA 1S9FA 4PPZA 2D9PA 4UY8O 3O8MA 3HFKA 4ITSA 4H0OA 3H2LA 4KO0A 4I2PB 1NM1A 4CJEA 1KTVA 2IVYA 4CLTA 3AVLA 4WF9L 5HBMA 3WIVA 2CADA 4M3TA 4OX7A 2MKSA 2DXEA 1S1WA 4ED4A 3O9SA 1VQ6S 1VBKA 1T94A 3FNNA 2D3OR 3OHAA 1QVFM 2ACYA 4FDFA 5H9FK 4QYZK 3HHLC 1TKXB 3F2KA 1HYVA 4F4WA 1IBCB 3JTPA 2DFFA 2Q6BA 4B9LA 4FYWB 5AQWA 1SVDA 3S3NA 4M5JA 3LM2A 4CZEA 3H2VE 1FFGB 4M8LA 1CLFA 3NWGA 1MWMA 3OLBA 5MAOA 3E1YA 5HLFB 2CPYA 1RWNB 1VQNN 5HVGA 4JI4F 3A8EA 1I3OB 3QEIA 4L76A 5B8HA 3PJWA 3VQTA 2KFZA 4ED5A 5C10A 5I3UB 5A8RB 1LFWA 2XZWA 1S1UA 1D9FA 1OY6A 3JQKA 5H9FJ 2G0IA 4QYZJ 4JKEA 4X4VA 3CDEA 1DTQB 1FRKA 4GW6A 3LDLA 1D3WA 2QWQA 3U7JA 5GAGP 4LF6F 2B6AA 3AD7C 4EBEA 3A13A 4ED7A 2VFUA 1R0AB 3R9LA 3Q7CA 3W8PA 2BVZA 1ITPA 3SDEA 2XMKA 3MR7A 4XPCA 2B4OA 4CFCA 3IWXA 2ZWPA 3NGUA 1TAQA 4DUTA 1SAZA 3AAWB 1RA6A 1HKBA 2JLEA 4DR5F 3G86A 4LF8K 1L5UA 4KJIA 5KFOA 1GNKA 3LP0B 4CEQA 2N3OA 1YHQN 5AFUA 3KMSA 2OCEA 3RAMA 2VBWA 2MKIA 5KFTA 5JUMA 2DIUA 3AOCA 4YP3A 4P73A 1SXLA 2ABYA 2HYIB 3BYRA 3MPWA 2JEIA 4H54A 4FL9A 5HI7A 4DG1A 1IN0A 3DFEA 1CXUA 4UZBA 2HBZB 4FKXA 5IT0A 3ZT0A 2RJZA 4ILRA 2BJDA 3THPA 4BRPA 2DIVA 3D0IE 3D1QA 4USTA 2CPFA 4X65J 1I51B 3J7AN 2BQ3A 4CGIA 4ETZA 5HRSA 4WIQA 1ASVA 4J7CA 5JXSA 1LKZA 3SV4A 4KV8A 1VQ8N 1TELA 1U2RA 3M2VA 5A2QO 1P9YA 3SJJA 2HHTA 2D0CA 4M41A 4P2MA 1WD6A 2OPSA 1VSDA 3VZIA 4DTUA 3QT5A 1M90O 1H73A 3CQYA 3NXZA 2C3MA 2F8EX 3WC2A 3KLHB 1WOOA 3ZETA 3WQPA 4TQRA 2EX3A 4IOAQ 5C24A 1RAIB 3IC1A 3SBTA 4JD2A 2OA8A 5F8GA 4H5VA 3NH0A 1HRHA 2IIHA 1YUWA 1MU2A 5KFBA 4DV3F 2LDYA 1N8RO 1URRA 4PYAA 2AZ1A 3UKUB 2WC9A 5A0YA 1TKZB 5K8MA 3RMCA 3FQLA 3Q2TC 2RS8A 1WHVA 1Y0HA 2YWKA 1NSKL 2VPWB 2ZH7A 2IOCA 1JLBA 3BR8A 3Q2SC 2OPRA 2E9ZA 2Z2LA 1TYQA 1EARA 2FHJA 2F5GA 1VQ6N 3I9ZA 3VEXA 4KAZA 3QMQA 2FC0A 2DXDA 2OPPA 2OANA 1ZC6A 2GQCA 1JLFA 4F3OA 4BWMA 3KLGB 5AJ3J 4CECA 4EBDA 1D4XA 3T1YJ 3SQ2A 4FZYA 4ALZA 3NS7B 1SC1B 4KHPF 4EUVA 2HQIA 1EO1A 1Z4UA 3DLBA 2MGZA 2X1AA 2Z56B 2KYZA 2VL1A 4LQ9A 4A48A 2HBJA 5AE2A 2P9PB 1WHXA 1BQMA 4RBUA 1E4GT 5KTQA 2KT3A 1TUVA 1HWLA 4UTGA 1OH7A 2UXCK 3X1LB 1B4SA 4YOVA 4H5RA 1YX2A 1P1TA 4NZ6A 2X51A 2VIHA 2YHYA 4GVLA 2ITGA 4JI2K 4L3KA 3CCUN 5GAHU 3TSUA 2P51A 2CG4A 3SCLE 4BDYA 3DRSB 4RR5A 1ZTTA 1N0UA 3V4IB 3KJVA 4I69A 3K2YA 2E5JA 4DUYF 1K9MT 1FVQA 3UI3A 2P9NB 2M0GB 2V9KA 3DXMB 5CZ2A 2JX2A 4ILJA 4YOXA 4ILLA 2HQDA 1HPZB 2EW9A 2WVFA 2DGVA 3UVJB 4E0DA 2R8GA 3VQEA 2UXCJ 4OPHA 1NK5A 3HHLA 2ZGYA 2BE7D 2RE1A 3FEXB 3M6VA 3H4BA 1Q8KA 2QMWA 2QSWA 4J90A 3PY8A 2FXUA 1DZ5A 3DOLB 1QQOA 3OVSA 2KHCA 1O0PA 1X0FA 1RA7A 3AD8C 5ETPA 3M2UA 2V7ZA 4ZVUB 2Q36A 4B1UB 3LP2A 1FA0A 4ERDA 2LLZA 4R25A 1LWCB 5F3TA 3NP5A 4RW7A 5AZJA 3V9UA 4Q43A 2LQBA 4CJ7A 3DDKA 3ZFVA 1IBLF 2IHR1 3D6RA 3UB5A 4NYPA 3GYXB 4CEDA 4PHTX 2QXFA 1X4CA 4NXNJ 3TR5A 5HQMA 1T05B 2ZDOA 4ID1A 2DK2A 3ZSWA 1SJ1A 1LXNA 4FWKA 3CJ9A 2QSFA 2VPXB 1A9NB 1CC7A 2HMIB 4JRPA 1HBMA 3GFXA 1BI4A 4XK8C 3L2UA 1FJGF 4RWTA 1N36K 3D7EO 4O44B 3D7SB 5B7WA 2ZVSA 3TUJC 2O5DA 3AVKA 2I7NA 4RW6A 4G1QA 3HP9A 2YVSA 4DN9A 3JYTB 3DDNA 1WC0A 1FXXA 1TKTA 1XQSC 4RUAA 3D6HB 2BH1A 1WOPA 5IS2A 4ANEA 3L7OA 2IA0A 4MAKA 2C2RA 3RBEA 1RT3A 4I7FA 3M8YA 4USIA 3CCRN 1J6ZA 4E7JA 1FX2A 3US5A 4OZJA 2O8CB 4JLHA 3OYNA 2ALYB 3OL6A 3QT6A 3KWMA 2KXHA 5B0EA 2V2VA 4FM0A 2K3IA 3R7NB 3OJSA 2OTLS 4EK2A 4H4KC 4EFAC 1N36J 5DG8A 2CRLA 3SMSA 4DF8A 3D0PA 1KAXA 1MWQA 2CIMA 4CH7A 4RG8A 2ZOGA 4OYXA 1WC3A 4IO8A 4BRQA 1SQGA 4FM2A 3J7YI 1EB0A 3HK2A 4NA2A 4NYOA 3K7RA 4CI6A 2UXDF 1QD1A 3RB6A 1UWAA 1HUXA 2JJ4D 2DITA 3TAQA 4OZ0A 4A47A 4AD6A 5GMDA 4BC5A 2ROPA 2D1KA 2GIRA 2VUGA 1DTTA 4PWDA 4N5SA 1JJCB 1D8YA 3D4JA 3JSBA 2J9DE 5HP1A 1OH5A 2DY1A 3F0NA 2EKYA 3ILOA 5CCMA 1GLDG 1NJWA 4RKUC 1RTDA 2EFVA 1CS4A 1FX4A 1K73O 2RHQB 3MCSA 4GKJK 4M5DA 2GFFA 1XC3A 3ZZOA 1IH7A 4CK3A 5LXYA 1V4SA 3MPVA 4OX9K 1S6QB 3VPZA 4DQRA 3HHKA 4JK7A 1W9HA 2PBDA 5ETRA 5GVQA 1NCLA 5IV3A 1CC8A 2QFIA 1QQNA 4IOBA 3QFUA 4CE9A 4KB0A 5AQTA 2HNZB 1UJ5A 1KTQA 3AVCA 1BQXA 1T02A 3OYMA 2HWHA 2Z30B 3CDAA 1YIJS 3GSIA 3ET6A 2YV0X 2X6NA 4K42A 1J5OA 2CNKB 5M2PA 1NH7A 4GKJJ 4Z4GA 5C2DA 3GR0A 2B4UA 4FJJA 3OS2A 4HEA9 2ZEJA 1S4FA 4JKGA 3TVYA 2YKMB 2AT1B 1Q9YA 2ASJA 5DK5A 1DGKN 1TV6A 1X9MA 4B17A 5GAHP 1Z25A 3CJ8A 3PUFA 2ZD1B 3TAMA 3H98A 3MUMP 1Q86T 3NH1A 3WNHA 4JI1K 2PT0A 4O5FA 2AIRB 3SQGA 3Q8RB 4QYRA 5J2MA 4P2XA 1C1AA 3W2WA 3DHWC 2EK1A 4CQ1A 4ECRA 1K6YA 1N32J 2C2DA 1FCAA 1S22A 5B0FA 3KHHA 5LJ3Y 4YDUC 2DR9A 2KDOA 4P7VA 4N77A 3TW0A 4BGBA 3LWLA 2CJBA 5AQYA 3K59A 2V4JB 3DHXA 3WT0A 3CMEN 2XGQA 4JEPA 2XB2D 1N34K 4FJNA 2XYHB 3VQDA 1B0PA 1J54A 2IAJA 2B51A 5GADI 4FZXC 5K14B 3H90A 4BE0A 3QIPA 3GP9A 3IA0A 1FD8A 4FO0A 4JV0A 1WSVA 2VJUA 4I67A 3ZCMA 5SWMA 3BGUA 1N48A 1JLQB 2DGXA 5ETMA 1F6TA 4JI1J 3P4UB 2QKKA 2DHXA 2O4GA 4DPWA 3VZHA 2GO8A 3ZZYA 3IKMA 1HW8A 2CGJA 2E2NA 2IS3A 4A8QA 5KFZA 3BSCA 4JV5J 2VFRA 5HJYA 4B02A 2CYYA 4CHQA 3L9ZA 3E3XA 1RBSA 3KDOA 1CVJA 2CH6A 2GVDB 1FERA 2QLXA 3D2WA 4CBXA 4EU0A 4JS4A 1LWFB 3HKZD 1HNVB 4A8MP 4WFAQ 1ICEB 2MEWA 3KYLA 2JFDA 4FBUA 1RDWX 5KFVA 1HBNB 3VAGA 5KG6A 4LF8F 3SSQA 3H0PA 3NCQA 2FVCA 1VQ9S 2X78A 2UUTA 3Q8QB 2OTLN 4E7HA 2K06A 1S57A 2Q0UA 1YKWA 3CB4A 3ZTRA 2XS2A 3H46O 4B3RK 1TL5A 3K0JA 2CNOB 5K8OA 3LDPA 3M8QB 3QO9A 2WFBA 3AY9A 1OPIA 5KFSA 3LDNA 3BH7B 4MK7A 1TVRB 2FZKB 1N4LA 5IZHA 2RVJA 1ZA1B 3BGFA 2PYJA 1N56A 3PJ9A 4B08A 1BA1A 3ZEUA 5ADXA 3K8VA 2CQDA 4AXJA 2W9CA 4LBIA 2BR0A 3DLEB 3U3GA 1WB9A 3GCXP 1YVNA 1F2HA 3MECA 4UQGA 4DU7A 1NGBA 2ZDPA 3BF1A 2PAVA 2RKIB 4DV4K 3A5NC 1OY9A 5D0RA 3CD7A 2QWNA 2V8GA 3RBXA 4XPEA 2VQFK 3TX8A 4B3RJ 3QNOA 3EDQB 4QR0A 4Y3CA 3U1NA 1NG9A 3D2FB 1ASWA 4JKCA 5KT5A 3MR3A 2C3PA 1UW9A 4JAXA 3LPEA 7FD1A 3IFEA 1MSWD 5SZTA 1BQNB 3KD1E 2RRAA 2HVDA 3MFHA 4OJ3A 5D0GA 3CJ5A 5BPMA 3S1TA 1X9JA 4PA1A 3VF6A 5L1JA 4C0OC 2XG8A 4CIGA 2DR7A 1C2PA 4J2BA 3QIDA 4OVLA 4LSNB 3SMZA 4JKFA 4DV4J 1C4CA 2RRNA 1KAZA 3NCPA 4J8FA 3T5HA 4MTPA 4FLZA 1IM6A 1RFQA 1TL1A 4W5QA 4IG0A 1SL1A 4Y1DA 4V19X 3HD2A 1R6YA 2LU1A 4O8UA 1M1KT 1BIZA 2VGMA 3L2WA 4WFYA 3UD3P 1E6VA 2HBRB 4DPUA 1YLXA 3R9PA 4CBUA 4W92B 8ATCB 4OGEA 3VF4A 1UEUA 3QYYA 4AUKA 1U1KA 4B3SF 3MWTA 2AHOB 3FCWA 4F50A 1UTAA 2B7CB 5J2PB 2QMUB 4FOEA 3J7Z5 2AYEA 3GV8B 2MKYA 1HL6A 5DM6Q 1TFYA 2RDIA 3UDCA 1NJIT 2DCUB 4DV2J 4OPJA 1QHTA 2XS5A 3RSEB 4ED2A 2VFSA 1RWPB 1IR2A 3D0HE 4J9SA 1ASUA 4PXEA 3HXMA 3LZJA 2HQFA 2YJFA 4FF4A 5DQIA 3NGYA 3J7AP 5C25B 3M8ZA 4QIVA 3DJCA 2VBYA 2W8LA 2MB0B 3U27A 4JI2F 4DLEA 3GWCA 1R7IA 1NB7A 1HQUB 1HQ2A 3KK1B 5KPZA 3BY5A 2HS0A 1TUYA 1X4EA 4X4PA 5KFRA 3AVBA 5AQJA 1J5EK 2X1GA 1CJKB 2KRRA 3O44A 4JKHA 3KG1A 5F8JA 2KW4A 1U48A 4QWDA 3MAAA 2BXJA 1E3MA 3RZAA 3OYAA 4FJLA 2YKPA 1S6OA 4LIRA 4EZ6A 5AQPA 2IRXA 2D69A 2UU9J 4WQ4A 2F63A 1RISA 1YRTA 3P38A 1RYSA 1M5VC 3H7HB 5GAGI 4IWVA 2XQCA 1ILYA 2HQGA 1VQ9N 4KGKA 1X0PA 2EHGA 3MEDB 3KLFB 3FUYA 5LSLA 2HLUA 3O1WA 4YDUA 2AW0A 4QOTA 3CJAA 4NXMJ 3DLGB 4W4MA 3NGDA 4FVMA 3Q8SB 2MDAA 4Y2CA 3NNAA 4I6YA 2GCFA 3FZHA 2VG6A 5AQUA 4CTAB 2WB4A 3Q24A 1PBUA 4H0VB 3OHBA 5KG4A 3ZTPA 2KTQA 2R2SA 1TUUA 2CGKA 2GMHA 3CFPA 3VEVA 3UIQA 1VYAA 2YH0A 4DHYA 1SB6A 2LXUA 2JEGA 3WUHA 2V2KA 4WKYA 3FLCO 1MN7A 3IRXA 1X8DA 3SQ0A 1RT5A 2RU9A 1FE0A 4B1WB 2A3JA 4AM7A 4TNOA 2VG7A 3WXJA 3OYDA 4DR7K 5E3QA 3M6UA 3DNCA 1CG2A 3MTKA 3K5PA 1QE1B 3CIZA 3SV3A 1FI4A 1HNZJ 3DM2B 1T9TA 5AQSA 3PFEA 1VIXA 3PSIA 2I1RA 5HAOA 3CCSS 1Q86O 4HI2A 2BYCA 1P90A 5L1LA 4LF1A 3MR5A 5IT4A 2FF3B 3ZZUA 2WZ1A 5EU7A 2ZBQA 1QVGR 2LA6A 2F7TA 5EX5A 3DOKB 4FCYA 1UOCA 2E1PA 2M8DB 4HACA 3EPIA 4UZCA 2E7VA 4RBTA 2GWJA 2DH9A 1HMVA 4OI2A 2OHDA 3UCZP 3PCOB 1GXUA 4DR7J 4ELTA 3RVCA 3H42A 5EXWA 2YHWA 3TOQA 2IRYA 2UVVA 1Z05A 2GA7A 1Z2LA 1NDPA 4USVA 2FHMA 1RHQB 1FJCA 3LTOA 1NPRA 3N79A 4BDPA 4FYDA 2ZFHA 1W7WA 2JVRA 2VH7A 3QNNA 4CZKA 5KQ8A 4X4NA 5F8MA 1PC5A 2IBOA 3GJSB 3AXKA 4MJKA 3FFIB 1OH6A 2VC1A 2YNHB 3ZT3A 4J9NA 4ZPBA 4CCHA 1F3VA 2E66A 2JGUA 1RAJA 3DLKA 2DHHA 2X7IA 3W2VB 3X3UA 2MSTA 3ZTQA 4DQIA 4I9QA 2A6OA 5EWGA 1O8BA 4MDAA 4DV5F 4WPAA 5I9EB 5CYMA 4BLGA 4AF1A 4ECQA 2C2KB 2HIQA 1U2FA 2YWFA 2AP1A 4UW2A 4A4JA 1BL3A 4EYHB 2Q79A 3NFAA 1XNQK 1IKWB 3M30B 3EO3A 3NMUA 2DNPA 3IBFB 1NRKA 5HVFA 1VQLN 3MN5A 5G0RA 4OX9F 3LPUA 4Q2LA 4J2AA 1WC6A 4ID5A 1HD0A 1K0TA 1NPPA 2D0BA 2GWKA 4GMJB 4M3XA 4OZ1A 3HTVA 2F8TA 3TWHA 4BR9A 5C7PA 1WTBA 2EFQA 4O3NA 2BE9B 3TAFA 4EP5A 4W5TA 2O8BB 4CJSA 1Q8LA 2J7WA 4UOCA 3LO3A 3C65A 2CQ0A 2GJIA 3T41A 2MQ8A 1T11A 4WFNQ 5M1OA 3PXGa 3QFWA 1HNIA 2XMAA 4IFVA 3QB0A 1F0XA 1TKDA 4Z94A 3KIOA 2GO9A 2ZOMA 1T3OA 3QINA 2H51B 1XNQJ 1UWBB 2QL5B 4TN2A 3SZ2A 3QLHB 2K2PA 2AJ2A 2C2MB 1UVMA 3OUYB 2CJXB 2CDRB 4U7CA 1KEKA 3ZNUA 2K1RA 5C15A 4CNYA 3WXIA 2GIQA 3CCLN 3ENAA 2FSKA 4A59A 1LWEB 8AT1B 3KMQA 2BABA 3CFRA 4WFBQ 4CEOA 4FVCA 4FPRA 3IBWA 3EZWA 3GG4A 3GMGA 3T1HK 4IXCA 4LSLB 1S7HA 1SJRA 1DLOB 4ZKAA 2CJ9A 5KT7A 2G0JA 1EHWA 2HHUA 3WBZA 1U2VB 5J2NA 4CHZA 3MZIA 1N34F 2D7SA 4WWSA 4DPTA 4CM2A 2V8PA 4F4YA 4TQSA 1M1KO 3UN2A 3O80A 3AD9C 1EETB 5DLGA 4MLEA 4QW9A 1XMBA 2WOMA 4FJ7A 5F0XA 1KLMA 1X5OA 2UXBF 5FDLA 1Q7YO 2HGMA 1TL4A 4YMEA 1XEZA 3VEYA 3CCSN 4P9SA 5HRNA 3NVMA 3TTDA 3CEDA 4KO0B 2P6TA 3NG8A 2EVZA 5DDPC 5E84A 2P9UB 3FVYA 3FR0A 3EZ5A 3ENBA 3RB4A 3RGIA 2JC1A 1QLNA 3W63A 3H5XA 4JUZA 1GLCG 3O3FA 5KFAA 2PZSA 3RBZA 3TO8A 4FJXA 1S9EB 3MMCA 1YWXA 4DV6J 1QAYA 3OLAA 1YZ6A 3TJAA 4EHUA 3W5XA 2BANB 2FLOA 1WKLA 2DXFA 2P9SA 2UUBJ 2WAQD 3PFOA 3QSIA 2NRZA 3LQVA 3HSCA 4EO8A 2JL9A 3D3CJ 3OR1A 3CETA 4IG3B 2VYPA 4JI0K 2AEMA 4B3RF 2OJ3A 5JS1A 4YQWA 1K8KB 1LOUA 2CJYB 1JCFA 1X7VA 2BA9A 4CJRA 4E8UA 3TEHB 3UD5A 4U7UK 2MKCA 1ZS6A 2DRAA 5EVZA 4C4WA 3I4HX 3NGTA 1RBUA 2DNYA 3CJ3A 1AA1B 4LBHA 2NRVA 2OPQB 4ID8A 1T44A 1RU2A 2VC0A 4WFAL 1XNRK 2G0CA 5EX0A 2EG1A 3A5OC 2KJVA 4ZMMA 1TK0A 1ZBSA 3S8SA 3TTCA 2Y1IA 3C8YA 2P5GA 2VQFF 1ZZFA 3C15B 3SDEB 3QRRA 3F5TA 3PG9A 2LQ8A 4DR1J 3P39A 2KXFA 4A5AA 1WACA 4F9OA 5KPRA 4FJIA 2HF4A 3C7NB 1H7XA 1VHFA 2EBGA 2AGQA 1Y97A 4I64A 4JHDB 3AARA 4HHTA 2FBVA 3H6EA 4QBUA 2WBMA 3S01A 3VGTA 1ELOA 4X64K 4FF1A 2V68A 1JLAA 3CHWA 2HAFA 1HHTP 2P5VA 1MW7A 2NYIA 4G1PA 3EYZA 1S7IA 1NNEA 1YJVA 2HAIA 3O5TB 1DQAA 1CULB 4B9TA 3WXLA 1F5CA 2DD8S 3TEGA 4USJC 1NGCA 3ZSYA 1VRTA 3CCMN 2W25A 3VEWA 2HHPA 2J4RA 2AGPA 2E7XA 3CWJA 4FJMA 4CEEA 1VQYA 2GELA 3ZZPA 3N6NA 3PW2A 1TL3A 5EUHA 3JAMU 5BRDA 2GC8A 2EEYA 5KFCA 3I32A 1IBKF 3VN5A 3OFGA 2OO4A 3D67A 5T41A 1LK5A 3HPOA 2J5AA 1FTCA 1FDAA 2QA2A 1W25A 2N7CA 1GLBG 3A2FA 3MHYA 2RSQA 4Q8EA 3MF5A 3P31A 2D3ZA 5GAHI