1FK9A

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
536
structure length
519
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAITKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 146
structure length 519
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fk9A05
2F8SA 1C1AA 3Q8PB 4C8NA 5C24B 4RUAA 4DTPA 3NGYA 1NJYA 1S1TA 1DTTB 3NH0A 1LAWA 1YVUA 3CIZA 4R8UA 2WB4A 4J9SA 5J2PA 3IRXB 4DWIA 4I9QA 3IGVA 1L3TA 4FZXC 3ZSXA 4KE5A 4K4YA 1U48A 4K4ZA 4M3UA 3SPZA 3NAEA 3KD1E 1NOYA 3QNNA 5KG7A 1X9MA 3HPHA 3KLGA 3QETA 3HXMA 4F4KA 4I7FB 4FJXA 4EBEA 4DLGA 3GV5B 1GX5A 2ZE2A 1B9FA 4MIBA 3CDUA 3K5OA 3LALA 4QWDA 5KTQA 1GOAA 4C8LA 4CFCA 1I3AA 1SL2A 4OKEA 1WNSA 4KHQA 3H5YA 1S1TB 3MECA 1D9FA 4NCAA 4MK9A 1LW0A 1RT3A 5KG5A 3DRSB 3V6JA 3AO5A 4CIGA 2JLEA 1KFDA 2J6SA 4CCHA 2FBYA 4HKQA 5HRNA 2HHVA 4K8ZA 1U04A 5D3GA 4M45A 5KFUA 3RMAA 2XHBA 1JLFA 1EP4B 4DLEA 3DRSA 4K4VA 2B5JB 4O44A 5CZ2A 1TKTA 2BQRA 2W8LA 4NYNA 4ICLB 1VSMA 1U47A 4CJVA 2AU0A 4FXDA 3MEGB 3ZSOA 3PZPA 3T1AA 1DLOB 4OPJA 4YP3A 3LAKA 2D7SA 1REVA 4K8XA 4FVMA 2V4RA 3SZ2A 3IG1A 4DSIA 4KHUA 4QOZB 3ITHA 3MEDA 4N76A 4DU1A 3SQ4A 5EWFA 1A5XA 4CHNA 4YMEA 3CJ5A 1ZBFA 1XR7A 2EHGA 2VG5B 3SQ0A 2UVWA 2HNZA 1Q9YA 3VQ7A 3H2LA 4MIAA 1Z26A 3BGRB 3QEVA 2HHTA 1IO2A 5KFWA 4DL5A 3OVNA 4Q0BA 3AO2A 3DI6B 4TY8A 1C0TB 2HWIA 2IM1A 3C95A 5SZTA 3QNOA 3AA2A 1NKCA 4PQUA 1SL1A 5L1JA 2ETJA 2OPSB 4JUZA 1NJWA 4F4XA 5DQHA 4LQ3A 4ECXA 3SI8A 3N6LA 4CJFA 5C25B 3RAQA 2P51A 1TKZA 1S6PB 2KFNA 2ALZA 2HB5A 1TKDA 1RDRA 4HTUA 1EETA 4FM0A 3DM2B 1L5UA 2YNGB 5DG8A 3OYKA 5T14A 5KFLA 4CHPA 3KLIB 4BE0A 3PX0A 3K58A 5EWEA 4JV2A 1IKXB 1TAQA 1F21A 4CGJA 1SUQA 4URSA 3QEPA 1W0HA 2QE5A 4KHNA 4F4WA 4F2SA 4DSLA 1XI1A 1RT7B 4RG8A 1SKSA 2IBKA 5KGXA 4CEOA 1RBSA 3SUOA 4N56A 1S1UB 3QEWA 3CG7A 3SJJA 5KT2A 2X74A 4E1MA 4DSFA 3IGNA 3UQSA 3CJ3A 2OA8A 4LSLA 4EBDA 3QGGA 2EX3A 2OPPA 5KFZA 3LWMA 4CJ3A 3AVJA 2I5JB 3QERA 4DU4A 4G1QB 4CJWA 2IC3B 2IJNA 3BDPA 4R0EA 3O4NA 3PVXA 4OKJA 1Z4UA 2BE2A 2D5RA 4CJRA 4BDPA 3EZ5A 1S97A 1BQMB 1NK9A 4RNNA 3GILA 4DFPA 3VA0A 3VQQA 4KO0B 2IC3A 5I42A 3LZIA 3NGIA 3KLEB 2R7YA 3B6PA 4TN2A 2I1RA 3NBPA 3KHLA 1RDCA 3NE6A 1S49A 1HYZA 1RTDB 4DG1B 3JSMB 4CF1A 2BRKA 4QCLA 4NLYA 4WXWA 1VSKA 2KQ2A 4OGCA 3G10A 1S1VB 2RDIA 4I2PB 4OGEA 3WNHA 4KBIA 3DLEB 3DMJB 1IM4A 1KVAA 3ALYA 4Z4EA 4MFBB 5KFRA 4OLBA 5HBMB 1LW2A 4FJKA 4ED2A 3IS9A 5K14B 4I2PA 3OYFA 4CJKA 2B43A 3K5NA 3M9NB 3OSPA 5C5JA 3Q8RB 5KG6A 5L9XA 1T05A 3KLIA 3GV7B 1S1XA 3U3YA 2F96A 2HHUA 1BIUA 3NHGA 5DLFA 1HMVB 3HM9A 4ECUA 1ITGA 3MFHA 4NRTA 3OSNA 2PY5A 4DTUA 4ECSA 1D8YA 1TK8A 3T5JA 3FSIA 2QV6A 1RT4A 4BE2A 2C2RA 1RBUA 3SUPA 1LWFA 4YQWA 3LDSA 2G8WA 2VA2A 4FJNA 2G8FA 4LSNA 4IG3B 4YNQA 3NF9A 4FZYA 1WAFA 3C6UB 4FJHA 4LSLB 4RZRA 2HMIA 1K1SA 3AVGA 4GVMA 5KRTA 4WZMA 3KLHB 3TAEA 4KHSA 4TXSA 3SUQA 1QAJA 3JYTA 2ATLA 2E4LA 3AA5X 4O4GA 3LAMA 1T03B 3LP1B 3SFUA 4M41A 2W42A 4Y3CA 2QKKA 1XR5A 4DTXA 1ZBIA 2R2RA 3NMAA 1ZETA 3QZ7A 1JLBB 3DRPB 2PYLA 4PUOB 4B9NA 4HUGA 5J2QB 5JXSA 1EX4A 3OJUA 4FK2A 1KLNA 2XCPA 3RMBA 4DTRA 3KNAA 4W5RA 2VA3A 1TQLA 4ZVHA 3QYYA 2ILYA 1TL3B 2PZSA 4JRQA 1IH7A 5KFKA 1U4BA 3L2VA 1JXEA 1LAVA 1TV6A 1RAJA 4IH5A 3AVFA 4HCBA 3OYIA 1KVCA 4HUFA 1NK4A 1RCHA 2W7OA 2J6TA 2AGOA 3BSCA 2HMIB 4CGFA 4W5OA 2EC0A 1BCMA 1C0UA 4Z4CA 1QTMA 4FJ7A 4LSNB 2JEJA 2YKMA 4DL2A 4O5BA 3NL0A 3V1QA 4KB0A 4IFVA 1HARA 1S1XB 1JKHB 4FLVA 1O1WA 3NH1A 2HNDB 5J2NB 2FLPA 1BQMA 4K50A 5KFVA 3V1RA 4WFYA 4ZPBA 1XWLA 3CWJA 4B8AB 1C0MA 5J1EA 3NH2A 2O4GA 2KFZA 5JS1A 1J9AA 4AHTA 1RDBA 4CEBA 1X9SA 3QINA 4OJRA 3O3HA 3S3OA 2D41A 3NDKA 1JLGA 5KFXA 2R2SA 3I0RB 4DFMA 1VSHA 1TK0A 3EPGA 4CFBA 1T05B 4RNMA 1Z25A 3HVTB 1NKEA 4IG0B 4FLXA 1YVFA 4ECWA 5FROA 4IQXA 4ED1A 3PV8A 1S1UA 1VSIA 1RT6A 5KFFA 3MECB 2IM3A 4ED7A 3V9XA 5KFPA 4DQIA 1LW2B 3LP0A 3NFAA 3L3UA 1RTJA 3CQ8A 2GIRA 4CFDA 2VWKA 2P1JA 4FJLA 3PR4A 4Z4IA 4WE1A 3FRZA 3TAQA 5KFQA 3S3NA 3VQDA 4LY7A 4RW4A 3GV8B 3RB0A 3KMQA 3U6FA 4JLHA 3SV3A 4AHVA 4RNOA 2BR0A 4B9TA 5KRSA 2YV0X 4CECA 4XPEA 5KFOA 4BDYA 2YKMB 4E3SA 5I42B 4LD0A 3TAPA 4RW8A 3V81A 1DTTA 5F8LA 4IBNA 2OYQA 4M3YA 2FC0A 3RRGA 3DLHA 2AGPA 1S0MA 4BWJA 4WE1B 4Z4FA 5HLFA 4O3RA 2Z1JA 1JLQA 3VQ6A 4ZMMA 5DGBA 4ZPAA 1S9EA 4QWCA 4E7KA 4TQSA 3P83D 1HQEA 4FCYA 3KTQA 4KHMA 4YR2A 4IH7A 1RT2B 4QW9A 4HUEA 4KV8B 1BCOA 3DM2A 4CJQA 4KO0A 2UUTA 2YNFB 1S6PA 3MR3A 4DL6A 2IAJB 5C25A 3HP6A 4DSKA 3DRPA 4CESA 1JLBA 5KFBA 2E9ZA 2B5JA 4O44B 4IOBA 2XI2A 2C22A 3UR0A 4CEDA 4R5PA 3SI6A 4RNFA 4MH8A 4O3OA 1JLEA 3MEEB 1SH2A 3ZT1A 1NHVA 1JLAB 4Y34A 4ECQA 2HNYA 2CKWA 2YNIA 2WOMA 3QIDA 1WSJA 3DOKB 2OZMA 3CM6A 3V9WA 1LW0B 4N41A 3OYCA 4EO6A 3HHKA 3DI6A 4TY8B 4CHYA 1R0AB 1HNIA 1MMLA 4Y2AA 4DL4A 1OS5A 1XC9A 3MFIA 2E6MA 3FFIB 3IAYA 4ELUA 3GIMA 1L3VA 4FJ9A 1J54A 2G8UA 3DOLB 1FK9B 2WCXA 4RW7A 3AVCA 3L2RA 5D3GB 4HHTA 2YNGA 4FJ8A 1C1BB 3QO9A 5L1KA 4TSXA 3VQ9A 4FJ5A 1RTIB 5J2QA 3CJ2A 4OVLA 3SV4A 1I39A 2HHXA 1VSEA 3RR8A 3V9SA 4CEQA 4ZP9A 4EZ6A 3Q8QB 4KFBA 3TABA 4AHRA 5C24A 1CZBA 1ZTTA 3IS9B 4TYBA 4RU9A 4DQRA 3H5UA 1EP4A 1JLFB 1C6VA 4I9LA 2OPQB 4ZTFA 3VN5A 5EWGA 4FW2A 4E19A 1KLMB 4CF2A 3DLEA 3ISNC 2G8KA 1TK5A 4BDZA 2VG5A 5KG4A 5HRRA 3M8RA 1UOCA 1X9WA 3QLHA 5C42A 3EZUA 2E9TA 1JLCA 3TWHA 4RW7B 1RTHB 2FBVA 3C6UA 4Q45A 3V6HA 3M9OB 4UQGA 3MXMA 3HL8A 3IG1B 3K2PA 4KB7A 4QWAA 4NLRA 1FXXA 5FDLA 4GC6A 2XY6A 2FVRA 2RF2B 1HNIB 1R0AA 4Q44A 1NOZA 5KFEA 5F9LA 3N6MA 2ZQBA 2FLLA 2HVHA 1TAUA 3ZSYA 4EO8A 4CERA 4G3IA 3ASMA 2OZSA 4DEZA 4IRCA 2P5GA 4DTJA 1ASVA 2AX0A 4CGHA 2I5JA 3G6YA 4Y2CA 2HWHA 4HYKA 2ATQA 4DU3A 2RKIA 1CZ9A 2OPPB 3RMDA 4ZVEA 4F4YA 1YTUA 4NLVA 3MEEA 1UWBB 4N5SA 5J2PB 1RNHA 3ZT4A 3PO5A 4RW6B 1N6QB 4YFUA 3TAMB 4F2RA 4CE9A 3DYAB 1LWCB 2AJQA 2IOCA 1NK6A 4J2EA 4MFBA 4CJTA 1FKPB 4ED3A 1RTIA 4FK0A 4X2BA 3HT3A 5HRPA 3V4IB 3QIPB 1YTAA 1DTQB 4Z0UA 4FBTA 4AHCA 3NF6A 2XCAA 3OYNA 4Q5VA 3DLGA 5SWMA 5KFGA 3GIJA 1JL2A 4ZP8A 4FJMA 3SFGA 4CEEA 1UA1A 4O3QA 4GW6A 2OPRB 3QEXA 3QIPA 4IFYB 4DSEA 1IKVB 3FDSA 3UPFA 2FJWA 5J2MA 4BWMA 3SCXA 4FM1A 2VG6B 2W9BA 2LSNA 1LWCA 3CJ4A 5F8GA 3KHHA 2DPJA 1WN7A 2D0BA 2JC0A 3LP2A 4WYWA 3RR7A 1S9FA 2DY4A 2WOMB 4J9NA 4PY5A 2HNYB 2Z1HA 3AO4A 1VRTA 4ZPCA 4FLUA 4CJ5A 5HROB 1J5OA 1RYSA 4F3OA 1RDAA 4NYFA 3OYBA 2FVPA 3SQ2A 3LP2B 1BQNB 2C2DA 4B9UA 3V9ZA 5DQIA 3OYMA 4K4TA 1IG9A 4KAIA 2ZD1B 3LWLA 1VSFA 4HCCA 3ULDA 2RN2A 3PW2A 3PX4A 2AX1A 1TL1B 1FKPA 3SPYA 2XGPA 4KHRA 3RBEA 3TAGA 2B4JA 2G8VA 4DTOA 4IRKA 1W9HA 4FJJA 4EZ9A 2XRIA 2HHQA 1WSEA 3QGHA 5KG2A 1VRTB 1HYSB 3LANA 3PO4A 4NLPA 4K4WA 1NKBA 5EDWA 1K6YA 5KT3A 2ASLA 5HLFB 1TP7A 5KI6A 1VK0A 3TI0A 1T7PA 4M3RA 1U49A 5EU7A 2ITGA 4CK2A 2W9BB 4H4MA 3KHGA 1C0TA 5HRSA 4CHZA 1VSLA 3P1GA 2UVUA 2RF2A 4RW6A 4FLTA 2P5OA 4YR3A 3BGRA 3PW4A 3RAXA 2X6NA 4FJGA 4J2AA 2BRLA 4TYAA 2V9WA 2IS3A 2ASDA 2HHSA 2Z1IA 2FBXA 4CF9A 5KFDA 4M3ZA 4U7CA 1DTQA 4FBUA 1T3NA 3VQPA 4E7LA 3V4IA 2XY7A 5KGWA 5T7BA 3GIKA 4DL7A 1KHWA 4WZQA 3AV9A 3L2UA 1N4LA 4KPYA 3OHBA 2ASJA 4NLDA 4ICLA 4L8RB 2WONA 4IR9A 3PUFA 4E0DA 3CDWA 3LZJA 5KT5A 1JX4A 1JLCB 4JS4A 4DSJA 2GUIA 4RW9A 4M42A 1IKYA 2FVQA 1BISA 4CJ4A 2W8KA 3F73A 4DTSA 3OYLA 1S6QA 3KK2A 1BHLA 4DTNA 1ZYQA 4RW9B 4C8OA 5DG7A 4ID5A 2AGQA 4ZHRB 2VG7A 1KRPA 1QSYA 3MR2A 4E7HA 4TLRA 3DOLA 1LWEA 3M9MB 1RT3B 1N56A 3OL9A 3O3GA 4KHWA 4NLTA 1KCFA 4CIEA 4CEFA 4JRPA 4FS1A 4J9PA 2X6SA 5CYQA 2YKNA 4IFVB 5CYMA 1A5WA 3ZT3A 3KHRA 4KTZA 4ID1A 1SV5B 1NJZA 1RT2A 4CJPA 2DFEA 1Q8IA 4O4RA 4Z4HA 4I7FA 2KTQA 3KLHA 4KHYA 3THVA 5KFIA 3VQCA 1QE1A 3WNFA 1KLMA 3L3VA 2XY5A 2W9CB 4H8KA 2BDPA 5KT4A 4O55A 3TARA 3E01A 1HPZA 4C8MA 3S9HA 2W9AA 4F8RA 4GMJB 3G86A 1TV6B 5DLGA 4IDKB 5KG0A 4KFBB 2GC8A 2VG6A 4W5QA 3QESA 1ZBLA 2KW4A 3QIOA 2G8IA 2OH2A 3NKYA 3VQ8A 5CY4A 5F9NA 3CDEA 4RW8B 4ELTA 2OPRA 4FLZA 2DFFA 5KFMA 1TKXA 4O0IA 1UA0A 4I2QA 1HQEB 2D3UA 1FK9A 3RB3A 4IRDA 3NF7A 2D3ZA 3MXJA 1U09A 3HKWA 1S5JA 1VSDA 3V6DA 2IAJA 2B6AB 1C1CA 2R2UA 4K4SA 5KT6A 3UDLA 2D0CA 1S0NA 2IM2A 1CSJA 4O4GB 3PHEA 1RT6B 4M3XA 1RYRA 3DYAA 1SL0A 4GC7A 3A2FA 3HPGA 1N5YB 3HYFA 4BACA 1RT5A 1JL1A 3DLKB 1EKEA 3H4BA 3L2WA 2YNIB 3GQCA 4EEYA 4H4OA 1LV5A 3OYDA 3ISND 3UIQA 4EYIB 1SKRA 3LPTA 3NGZA 1W25A 4FS2A 5KFTA 3CO9A 4ZP7A 2QKBA 4W5TA 1S9GB 1IKWA 1FKOB 1N48A 4C8KA 3BJYA 1IKWB 1S9GA 2FJVA 3VQSA 3V81B 2QXFA 4M95A 3M8PB 3KK1A 3KLVA 3I8DA 1HRHA 4F50A 2IMWP 3KK3A 3AA4A 5CZ1A 2DFHA 2W7PA 1S9EB 3I0SB 3T5LA 3EPIA 3CVKA 3HVWA 2WK4A 4CGDA 2BGGA 4ED6A 1D1UA 1RTJB 1TVRB 3G6XA 4ECZA 2B6AA 1S10A 5I3UA 3WNEA 3K5LA 4AH9A 3G0ZA 3KIOA 1S1VA 1GX6A 1XHZA 4B8CA 4BE1A 3OL7A 4QWEA 1UWBA 4B9VA 3KKRA 4RUCA 1JKHA 1JLGB 4FZZA 1TKXB 3KK3B 5F8HA 1C1BA 3O4QA 1SH0A 3H5SA 4MK8A 1JXLA 3CFOA 3EY1A 3QZ8A 4DQQA 1D5AA 2RPIA 3AVHA 2IGIA 3D45A 2BE2B 3ZSZA 3FFIA 3MXIA 3NF8A 4NLWA 4F3TA 3BQ1A 2HNDA 1D9DA 5KT7A 1HNVB 4CF0A 1GOBA 1XHXA 4QW8A 2GBZA 3BQ0A 1HJRA 4NRUA 4NLXA 1QSLA 3EYZA 4IG0A 3GIIA 4KKOB 1RT1A 3S3MA 4KSEB 4O3NA 2JEIA 3RB6A 1QSSA 3I0RA 3DOKA 1NK0A 4QPXA 1NK7A 1SH3A 4ELVA 3ZSWA 4NYZA 3HJFA 1JLEB 1YT3A 5CYQB 4WXOA 4J9MA 3IN5A 1Q9XA 1WSGA 4QAGA 3HPOA 4M3TA 4RNHA 5KFHA 1NNDA 4ZVFA 3TR8A 3D5MA 3KLFB 1TL3A 4ZHRA 4CGIA 1RA7A 3KJVB 1NJXA 1T03A 4KV8A 3SQ1A 3NCIA 3ZSVA 4JV1A 4E7JA 5KFCA 3LP3A 3P5JA 3RMCA 3DLRA 3QEIA 1IKYB 3KLFA 1BIZA 3AVLA 4CF8A 3DRRA 2ZKUA 1U45A 2OPSA 1JIHA 2F8EX 3TAFA 1JLQB 3K57A 3H08A 1RT4B 2IM0A 4ZP6A 2D0AA 3OYHA 1BGXT 3DMJA 1WSFA 4DQSA 1QE1B 3VQBA 3KOAA 1QUVA 1MU2A 2R8JA 3DRRB 3T3FA 3TANA 4M3WA 4XPCA 3HO1A 2IDOA 1RT1B 5KFNA 5DK5A 1RBTA 1HMVA 4H54A 1K1QA 3JSMA 2HHWA 4DQPA 5E41A 2FJXA 2A1RA 4OLAA 2G8HA 4KTQA 1LWFB 1ZTWA 1S1WB 4R5PB 1HNVA 3MF5A 2Q3SA 2FVCA 3M8SA 4RW4B 4WYLA 3OS0A 2E9RX 1FKOA 3VQAA 1RBVA 3RWUA 1LWEB 4NLGA 2F8TA 5I3UB 3VA3A 2IJFA 2QK9A 4OPKA 3C6TB 1UAXA 1T8EA 1TVRA 4B9MA 3OY9A 5DMRA 4PWDA 3RB4A 3LP1A 4CHQA 3HK2A 4EP4A 3SUNA 3JYTB 4DMNA 5KFJA 2UVRA 4NLQA 1D0EA 3NAHA 1CXUA 4H4OB 3ZSRA 3KD5E 1TGOA 4ZVGA 1WAJA 3K5MA 3PW5A 3I5AA 3KLEA 4IKAA 3OL8A 2WRMA 2E6LA 3O3FA 1TL1A 3HSTB 3V6DB 4FW1A 4E1NA 3PW7A 3ICLA 3OYAA 1KVBA 1NHUA 1B9DA 4I2QB 5F8MA 1S1WA 4G1QA 4DG1A 2V0NA 1BI4B 3OLAA 3AVAA 2XO7A 4FK4A 1C2PA 1CXQA 3V9UA 3M8PA 3KK1B 4NLOA 5FRMA 4J2BA 3BREA 3OL6A 2IA6A 2YHAA 4H4MB 3H4DA 2HAIA 5K14A 4HVJA 3MR5A 4IH6A 1RBRA 1B92A 5F8JA 3AVMA 2BANA 5KG3A 2YNHB 5DG9A 1WSHA 1IKVA 2O5DA 1J53A 4URQU 3T5HA 1RA6A 3MTKA 3VQ5A 3DLKA 3CM5A 3DLGB 4OKKA 2R2TA 5KG1A 1N5YA 4EYHB 2ILZA 4XO0A 3NBPB 5KFAA 4J2DA 4IR1A 3CYMA 2JEFA 2RDJA 3ITHB 3MEDB 3BSNA 4KREA 5CYMB 3I5BA 3RTVA 1L3UA 4EBCA 1RT7A 1TKZB 4N47A 3C6TA 3PX6A 4YR0A 4KI4A 2DTUA 1RDDA 3T5KA 4DFJA 1CLQA 3B6OA 5J2NA 4LH4A 4CJLA 4ECVA 3E01B 4DL3A 4Q0BB 3H59A 1N6QA 3AO3A 4CK3A 3T19A 4MK7A 1SKWA 4KAZA 3LPUA 4J9OA 2A1SA 5DGAA 1KHVA 4WFXA 2Z1GA 3ZSQA 1C0UB 3I5CA 1KSPA 3HVRA 1RILA 3NGDA 3L8BA 1RT5B 1QAIA 4FLWA 1MU2B 3OYGA 4F4ZA 4IG3A 2WTFA 4J9QA 3AA3A 4PQUB 1I6JA 2XY8A 3ZT0A 1HPZB 2R8IA 1GOCA 3RRHA 2W9CA 4O3SA 2O4IA 5FDLB 1S4FA 2KZMA 3AVKA 1SUQB 1G15A 4CK1A 5JUMA 3C94A 4K4UA 1A5VA 3AVNA 4ID5B 4ED0A 1S48A 5C42B 4DS4A 3DLBA 3KLGB 3Q8SB 1HQUB 4MKBA 4NLUA 3HVAA 3KJVA 2X78A 1DLOA 4FM2A 5JS2A 4JS5A 3AO1A 3D28A 5EUHA 4DS5A 4PUOA 2OPQA 1S0OA 4OL8A 2FVSA 2VWJA 2DPIA 3N6NA 3OHAA 2NUBA 3VQ4A 3TQ1A 4CFAA 1ASWA 2VG7B 4ZTJA 4Q8EA 1EXQA 4PA1A 4DFKA 2GV9A 4LH5A 3BSAA 2HW3A 4EP5A 3CFRA 3RBDA 1X1PA 2RKIB 3ZCMA 4B9SA 2R8KA 2UVVA 4KKOA 3TVKA 2FLNA 4Z4GA 4Q43A 3FQKA 1RTDA 4Y1CA 1REVB 4AHUA 3M8QB 4FYDA 1QS4A 3PR5B 3IRXA 4CGGA 2XC9A 4R8UB 3AVBA 2CJQA 4TY9A 5KFSA 3OS2A 3M8QA 4NZ0A 4KB1A 4E89A 1T94A 1TKTB 2XWYA 4ECTA 2ZD1A 4MKAA 2XGQA 2ZE2B 3OLBA 2V4QA 1RTHA 1NK8A 3QLHB 4CJUA 4KRFA 3V1OA 3E51A 4NCGA 4ECRA 5HROA 1J5OB 3BR9A 2KZZA 1KFSA 1VRUA 2JC1A 2PYJA 4FLYA 4B9LA 5FRNA 2JGUA 1Y97A 4E7IA 2WONB 4J9RA 2C28A 1ZBHA 3OS1A 5HBMA 4XIUA 4FJIA 4IKFA 4ECYA 4ED8A 1HYVA 4KTWA 4JV0A 3PJWA 4NLSA 2Y1JA 3QO9B 2J6UA 1HQUA 3NAIA 3FQLA 5DQGA 3I0SA 3AVIA 2UUWA 2Y1IA 3OYJA 4CIFA 2JEGA 4AILC 3KKSA 3ZT2A 4J9KA 3PJXA 1XR6A 3F9KA 3BQ2A 4WFZA 4LQ9A 3G6VA 3V6KA 2R8HA 5L1IA 1NK5A 2XI3A 1WSIA 3WNGA 4CHOA 4U6PA 2YNHA 5L1LA 4CJEA 2BQUA 3QGIA 2BANB 4Q8FA 1QHTA 4KI6A 4IDKA 4DF4A 3D0PA 4Y1DA 4J9LA 2FBTA 3TAMA 4NCBA 3MAQA 5J2MB 3GYNA 4CEAA 1VRUB 3DDKA 3BSOA 1HYSA 5HP1B 1JLAA 3L2QA 2HNZB 4O0JA 4NCGB 3H5XA 1BI4A 2BQ3A 4DF8A 5F8NA 1KTQA 3SYZA 2HVIA 3CJ0A 4B3OA 1SV5A 2R8GA 1BL3A 4CEZA 4B08A 2YKNB 5F8IA 4M94A 3CFPA 1C1CB 3HP9A 2YNFA 3OYEA 3MEGA 2GIQA 3LP0B 4IFYA 4MQ3A 3H40A 2AWZA 1WLJA 3K59A 4B3OB 4DTMA 1IKXA 2C2EA 3KMSA 1L3SA 1ASUA 3H98A 1BQNA 4AHSA 3MR6A 2WHOA 1VSJA 3HVTA 4W5NA 3PY8A 4QWBA 2YHBA 3SNNA 2AQ4A 4CJSA 1S6QB 3KK2B 1WNEA 5HP1A 1QQCA 1EETB 5KFYA 4URGA 4K4XA 3PW0A 1ZBUA 4PWDB 3VQEA 3OJSA 4TQRA 1JXBA 3U3GA 4O3PA 4ZPDA 5J1EB
chains in the Genus database with same CATH superfamily
3Q8PB 4C8NA 3ZZOA 1NJYA 1S4EA 1YVUA 1HNWK 3BO2A 4YOUA 3Q2TC 3H3NO 4B1WB 2J0SD 3SQGB 5DDQC 4AQYK 2XZDB 1GMWD 2QEXS 4BG9A 1NOYA 3QNNA 1X9MA 3QETA 4F4KA 2R7QA 2BX6A 3VEOA 1Q16B 3MMBB 2OTJN 1J5EK 2ZOMA 2C2OB 1B9FA 4NXMJ 1VQKS 4G65A 4BR7A 3LALA 4DXLA 1T9WA 4C8LA 2XHCA 1WNSA 4KHQA 4NCAA 2LA4A 2ZWHA 4X4TA 1MMDA 3OTOK 5KG5A 3V6JA 4A8SA 2BYCA 4CIGA 1CPZA 4CCHA 4HKQA 2B4PA 4JBCA 4DR5K 2HVEA 2QXLA 2XEXA 2B51A 2DGXA 5D3GA 3RMAA 1JLFA 2ZH1A 4DLEA 1Y3KA 4DR1K 2MZJA 1GAOA 1S6UA 3HTVA 2B5JB 4O44A 2I7NA 2W8LA 4NYNA 5LMUF 2CG4A 1SC6A 3J80Y 2AU0A 4FXDA 3MEGB 3EDQB 4P73A 3QMQA 4JN4A 3TA1A 2Z2ZA 3LAKA 1CQMA 1REVA 4FNIA 4YS2A 3SZ2A 1Q79A 3ITHA 4DU1A 3SQ4A 3VEXA 4YEAA 5EWFA 1A5XA 1HR0F 1O6XA 1AFIA 3W5YA 2EHGA 2H3EB 2VG5B 5JVHL 4DI6A 2OO4A 3OVNA 2MJNA 5BR8J 4LF9K 4OI4A 3BZCA 3C95A 2QLWA 2ETJA 2XMAA 2DGUA 5HN0A 5BRFA 5DQHA 1NGCA 1R8PA 3SI8A 3N6LA 3CQXA 3RAQA 1K8KA 1TKZA 2HZVA 1FJEB 2P9KB 3SLCA 4L75A 2HB5A 4HTUA 1G7CB 4CZIA 4BC5A 1HHQA 1H2UX 1VC0A 2FLOA 4QJVA 1K0TA 2HGMA 4BE0A 4OFZA 2AP1A 1TL4A 1RAAB 2MGZB 1F21A 4CGJA 3V5RA 4WCEQ 1JJ2R 4F2SA 4J5OA 4JI7J 5A8RB 4ES2A 3HHEA 1Q7YT 3PEHA 5KOWA 2Z8QA 3SUOA 3CW2C 2WSFC 5GAGP 3H0PA 3BPSP 2ATCB 2OUGA 3SJJA 4DSFA 4KJIA 1P6TA 2XBPA 4A59A 3QGGA 2EX3A 2OPPA 2YX6A 2XQCA 3CXCM 4USJC 3T1HJ 4V19X 3CT9A 3CCRS 1X8DA 1U24A 1VK8A 4FPIA 2WVBA 1Q82O 3HOSA 3UE2A 4NA2A 3S01A 4DFPA 3VA0A 4WF9L 3VQQA 5E2QA 5I42A 3LZIA 3KLEB 2DTJA 4TN2A 3NBPA 3NE6A 4U8YA 1HYZA 3MMAB 2GO9A 4KY3A 4USMA 5T7LA 2PT0A 4NLYA 1I94F 1YQHA 2B4VA 2KQ2A 4F7VA 3G10A 3QSIA 4B17A 1YI2S 2RDIA 3CCTA 3SIPB 5EOYA 4AM6A 4MFBB 1NNEA 5KFRA 2P9IA 4YHHJ 4L3KA 5H9FK 4JI8K 1PC5A 4P2MA 3K5NA 3ET6A 3T1YF 3MM6B 5C5JA 1NMEB 2P9SA 1HBNA 3JXUA 3TW0A 5BYSA 2OHDA 3U3YA 2WFBA 3M32B 4NASA 1X4CA 4IOXA 2HHUA 1QVFM 5DLFA 3HM9A 2GA7A 2RRAA 3MFHA 4NRTA 4DTUA 4DU8A 4FPBA 1T44A 2O8DB 1TK8A 5ETKA 5K9FA 4OYBA 1HQ2A 2DGQA 3NS6A 2X51A 1RT4A 5GAEP 2OTLS 2BABA 1JJCB 2BXJA 1RBUA 1QVGM 4YQWA 9ATCB 3UVJB 1X0PA 2BJ1A 3AD9C 1AFJA 1RK8A 4FJNA 4LSNA 4FZYA 2ADBA 4NYOA 2GV1A 4LSLB 1K1SA 3AXMA 5KRTA 1SXLA 4L6V3 4TXSA 1EZZB 3SUQA 1EARA 1QAJA 4OI0A 3DN9A 4A2AA 3JYTA 4XH5A 3UN3A 3LAMA 1HI1A 3C8YA 4DCPB 1CJVA 1VQ6N 4Y3CA 4GV9A 3WXIA 2R2RA 2YKQA 2HLUA 2QWMA 1ZETA 4M5HA 4YDDB 4I68A 1YJWS 2PYLA 1RI7A 1HKBA 1X4HA 4HUGA 4H5WA 4FK2A 1OIAA 3LW5C 2JLFA 3TA2A 3FGVA 4Q2LA 3KNAA 2N4CA 4U7UD 8ATCB 4JRQA 4USKA 4LVOP 5KFKA 4GRSA 3L2VA 3CQYA 1TV6A 1PKUA 4IH5A 3TQEA 3AVFA 2MQLA 2YPZA 4G1IA 1Q86T 2Q43A 1VQ7S 2I38A 2FPHX 4A57A 3BP8A 3TYTA 5BR8F 3GDQA 2C2ZB 3CERA 1XTZA 1DBDA 2H5JB 2I2YA 4O5BA 3R3LA 1HARA 1S1XB 3LPEA 6FD1A 4DX7A 4DHYA 1F9FA 2FLPA 2IVNA 3Q0AA 1HIYA 1XWLA 4B8AB 4JKAA 2JSXA 1C0MA 5J1EA 1FJGK 1WG5A 4CD1A 1J9AA 4AHTA 1RDBA 1CEZA 1X9SA 1ZZFA 3QINA 1TYQB 3O3HA 3ZTQA 1JLGA 2MZQA 5KFXA 4DFMA 1TK0A 2HURA 1BDGA 4L72B 4CFBA 2VPWB 3BR8A 5T7LB 4CLPA 1NKEA 4FLXA 1YVFA 1NSQA 1VSIA 2IM3A 3LP0A 4EIAA 3C0BA 2P1JA 4FJLA 3PR4A 3EXCX 3VZHA 3GV8B 3MK6A 4XTTA 2XULA 2XSJA 4LR8A 1GMUA 3MM7A 3EM1A 3NEKA 4AE5A 2PI5A 4B9TA 5KRSA 4IZ9A 5KFOA 2YKMB 5I42B 1WEZA 3TAPA 4RW8A 2E5GA 3JTNA 2OEKA 3TUZC 4F0KA 2WZ1A 3ZXWA 1URRA 5F8LA 4IBNA 2OYQA 3GP9A 3RRGA 5B0GA 4I6MB 5LXRA 3NMRA 5IT0A 2Q31A 1U1PA 3DNCA 2RQCA 2Z1JA 2CPHA 1HNXF 1JLQA 2Q3PA 3GCXP 1T9VA 5AXLA 3VGVA 3MCMA 3EEQA 2UP1A 3M05A 3QBCA 4G1PA 2VHGA 1DQ8A 4TQSA 3P83D 2Q0UA 1T0TV 2AA4A 2WBRA 3MD1A 1F5AA 4IH7A 1RT2B 5KQDA 3MMVA 4H4KA 3DRYA 1U2VA 3FUYA 1S6PA 3MR3A 5AE3A 4WFAQ 4U67L 5C25A 1U1QA 3HP6A 1N34K 2DJWA 4PCQA 4JI4F 4YOVA 2VUGA 4CEDA 2CUYA 4JI8J 4RNFA 2O8FA 4O3OA 3MEEB 1JLAB 4Y34A 5AT1B 4ANEA 4BRCA 2YKAA 4JKCA 1F1BB 4YOYA 4RTFD 3M2RB 1DY3A 5GMEA 4A47A 1WOPA 2QWOA 3LGHA 3OYCA 4UOFA 1H1VA 2LMIA 3A8KA 1R0AB 1U8WA 1YJRA 4UUXA 2N82B 4F9OA 2M70A 2RS2A 4A46A 7FD1A 4FJ9A 3Q8UA 4L3NA 4CLFA 2VKZG 3G82A 1FK9B 1HKAA 3CCZA 3G96A 2V67A 3MM8A 3L2RA 4FJ8A 5L1KA 3CJCA 4QPTA 5E33A 2KLAA 5F0WA 4OVLA 3SV4A 2HHXA 1VSEA 2C1EB 4EZ6A 4KGVB 2RQKA 4FNHA 4UUWA 4BRMA 3GB0A 4TU9A 2UUBK 1KVIA 1FRJA 1EP4A 3SMPA 2V68A 1C6VA 3H25A 1G99A 3H45C 4ZTFA 5EWGA 2QL9B 2B7BB 2R7SA 5ELZA 1PAUB 2G8KA 4IWVA 2DNRA 5KG4A 1HI0P 3M8RA 1RU2A 1UOCA 3FC9A 4ZLNA 3EZUA 1ZS6A 1RTHB 4JI5F 3CD5A 2RJZA 3W8GA 4UOHA 1OH6A 3HL8A 2VV5A 4KB7A 2QJ3A 3HFKA 4NLRA 1RAIB 1NM2A 2VOOA 2VFRA 2FVRA 1WDDA 1N32F 1HNIB 4Q44A 2MHNA 2UUBF 3N6MA 2JFDA 4A61A 3E3XA 4DEZA 4IRCA 2QMXA 4DTJA 3GFXA 2QLXA 2AX0A 2PC6A 2HRTA 3WQPA 4P75A 4DU3A 2HSEB 3RMDA 4F4YA 4NLVA 1RP5A 1UWBB 4N5SA 5J2PB 1RNHA 4JKGB 2HQCA 3LM9A 2B4OA 2A3JA 3M30A 2ROEA 1EQYA 3J7AN 4GKJK 1KC8O 1NK6A 3CCSS 8RUCA 2BE7D 4JAXA 3UD4P 2W41A 3K5PA 4OLOA 2Q1LA 4DV0F 3MM9A 1DTQB 4DUTA 3NF6A 4A5BA 2AJ4A 3I87A 4Q5VA 3T1YK 4WK1A 2AEJA 3GIJA 4CEEA 5CZVA 1XMOF 3QEXA 2FHJA 4BRPA 2Y0SD 3BN4A 4BWMA 3SCXA 1TUYA 2QFIA 3V4MA 2NRHA 3W2VB 2W9BA 4ZVOB 4QS8A 1LWCA 4WKRA 3CJ4A 4KH5A 2DPJA 2JC0A 3RR7A 1VQMS 5AXMA 2DY4A 1S22A 4J9NA 5MLCQ 3ETOA 4I1TA 1VRTA 2ZWPA 1NGAA 4B1YB 4CJ5A 5GAGI 1RYSA 1J5OA 4F3OA 3TZZA 5TKYA 1V3RA 4X4OA 3W64A 4CO0A 1HWUA 3M6VA 5DQIA 2XG8A 3OYMA 2DNKA 1KVJA 3LWLA 3PFOA 2RDDA 4EUVA 5J1PA 4KHRA 1YITN 4DTOA 2VBZA 2GQCA 3K0SA 4FJJA 4DX6A 2IDEA 2JLGA 1T3VA 2DRAA 1SC3B 3OR1A 4W98A 3M8YA 1R8CA 5HQLA 2GX9A 4LRAA 1PILA 3GYXB 4RKUC 2I0XA 3W2VA 2W9BB 1JXVA 3MUTP 1C0TA 4UY85 3BS9A 4CHZA 3GL1A 4RW6A 3PW4A 1DHMA 4YOXA 2IS3A 2ASDA 3QJLA 5IQ6A 2EBEA 3M2VA 4CF9A 1SAZA 4DCHA 1K8AO 1HNZJ 2Z30B 2ZC4A 1Y64A 2CVEA 3VQPA 4PR6A 3WEEA 2G1DA 3CD7A 3QQCD 4XH1A 3L4QA 2KHCA 3VEZA 1AXQA 1UVKA 2YXLA 4BR0A 5B08A 5HMZA 1M90T 4ICLA 1OH7A 4IR9A 5KT5A 2BVZA 3G9CA 4PQAA 3AAPA 2RQMA 1BISA 1XMOJ 2ZH2A 3DAWA 3RSEA 4JV5J 4RW9B 2J0XA 3G87A 2CNNB 3HD1A 5DG7A 3MCAB 1QSYA 3MR2A 2DO4A 3DOLA 4RO0A 2KG1A 2YPYA 4IDHA 3OW2M 1N56A 2D3O1 3O3GA 1WHWA 1M5SA 3I56N 3OR2B 2EFPA 5GMDA 3P39A 1NEEA 4CO1A 4YY3F 4J9PA 2J7UA 3CD6N 4C4WA 1FI4A 3Q7BA 4FDFA 3BF1A 1YX2A 2K7KA 4IFVB 4HH0A 5CYMA 1U6ZA 3VF6A 5K8PA 3ZT3A 3TOQA 1O51A 1NJZA 4WCEL 4CJPA 1IG8A 4USHA 4DN9A 4I7FA 1B3TA 4DV1F 5GAHI 4MIWA 3VQCA 1QE1A 4OYZA 1BG3A 2XY5A 5LSLA 4H8KA 1S76D 3TARA 3E01A 4LRCA 3TP2A 2FB0A 2HGNA 1Y5LB 4CJ7A 3SBMA 1AUSL 2A2DA 3IMQJ 1ZBTA 1XNRK 4F3QA 3QESA 2FC8A 1ZBLA 2HRYA 3QIOA 3VQ8A 5F9NA 1SJ3P 3CDEA 1BE4A 3R1LA 3ZFVA 2MTLA 2POKA 4ELTA 4F3MA 2KH9A 1TZ0A 3R2CJ 1Z2LA 1TKXA 2DFFA 4HTJA 2NRVA 1VBKA 3RB3A 3PSIA 3NF7A 1RGVA 2GW8A 2FYXA 3MM9B 4LF7J 2EK6A 4CO5A 3MXJA 2GX8A 1VSDA 3OTOF 2R2UA 3GOIA 2D0CA 1EIYB 3WT0A 2J8SA 3DYAA 2MY7A 3A2FA 4DPOA 4I6AA 3O3LA 3H4BA 4UQTA 4EAHD 2RHQB 1IWGA 4DZ6A 1SKRA 3WC0A 1GLFO 2J9CA 4NXMF 5KFTA 4AT1B 3W61A 2AP6A 1S9GB 2E5LK 2AEMA 1CG2A 1FKOB 5AQOA 1FFWB 1S9GA 3MURP 2VKRA 2P2CB 3VEYA 3KK1A 2UUCK 1HX1A 3M1VB 2HIQA 1IBMJ 1HRHA 1WSRA 3CMES 3W3DA 2C2KB 2AJFE 1BLUA 4IQMA 3FRYA 1FEHA 1NBEB 2DFHA 3CMAS 4OZJA 5GIPA 1URNA 3ET6B 3CVKA 1LEOA 2V50A 1MN9A 3JXOA 2LQ9A 2OSQA 3DKDA 1TVRB 4ECZA 1RAEB 4NB4A 4F36A 4BRHA 1S10A 3K5LA 5KQ8A 3G0ZA 3KIOA 1S1VA 1U8SA 2ZNYA 2R7UA 3OL7A 4QWEA 3NP5A 4R25A 2PFDA 2HHPA 1WELA 2DHGA 1RCOB 1Q1KA 1FDDA 4MK8A 4FL9A 3EO3A 3QZ8A 2BH1A 3ZSZA 3FFIA 1OKJA 4NLWA 2HNDA 1HNZF 2NRRA 1HNVB 5GAHU 4RWXA 2GBZA 2LYVA 2JX2A 3VWSA 3VGUA 4C8ZA 3GIIA 4KSEB 3RB6A 2VGMA 1DKGD 4ZVTB 3QFHA 4OYAA 2QWQA 1WACA 2QA1A 4A48A 1OSDA 2YH0A 3CB4A 4M5KA 2PN6A 1BWVA 4J9MA 2XZTB 2FJDB 3IN5A 5BN8A 1ZA2B 3CCWA 4ZVFA 3IAS9 1KDNA 3ZLJA 3ULHA 1TL3A 1SQGA 2WSEC 3GPAA 3KUEA 1IV0A 2DISA 3D7SB 1X5SA 4KV8A 3SQ1A 1PJ5A 2UXBF 2YY3A 3ZSVA 3LP3A 1RBOB 3DLRA 1IKYB 4ZVUB 1BIZA 3EVWA 3TSPA 1KQSR 2AKWB 2O01C 5AXNA 4M5IA 4CM2A 1U45A 4MYTA 2PMWA 3PTWA 4DR2J 1JLQB 2IM0A 3OYHA 1BGXT 4CH1A 3IO1A 5ETRA 4DQSA 1QE1B 1VQ8S 2QL5B 3HHLD 1U6FA 3TANA 4DHVA 1N33F 4PG8A 3CC4N 1YI2N 4A8QA 4OZ1A 5ETMA 2OANA 1RBTA 2QN6B 1HMVA 5E41A 5CD4H 1JCFA 2WBMA 4LF4F 5ADXA 2XMJA 4PG6A 1S1WB 3RW6A 1EWRA 2GJ2A 1M90O 3WQTA 2Q3SA 2FVCA 2ZFHA 1OVQA 1FKOA 3C6HA 4NLGA 2IJFA 4OPKA 5AQHA 2HFOA 1UAXA 1VQSA 1WG4A 4PWDA 3CETA 2DITA 3M1FA 4Y2IA 4EP4A 5AZJA 2E66A 4B1UB 1D0EA 1CXUA 4H4OB 3HHDA 5SUHA 4C98A 3ZSRA 2F63A 1TGOA 1U25A 1WAJA 2HMPA 1TYQA 5IZHA 3AA9A 2WRMA 2P9IB 4DR3J 3JAMY 1A0OB 4E1NA 2GELA 1X5OA 5ETLA 3LA0A 4CLSA 3NNHA 2NYHA 4CI6A 2E5JA 1VOMA 3WXKA 3CCJS 3R7SB 1S1WA 4G1QA 4DG1A 1LK7A 2C2MB 2O3DA 2JWLA 2XO7A 2XTJP 3KK1B 2QLBB 3SQOP 5FRMA 2JL9A 1QM9A 4J2BA 1YBAA 3J81j 4NXNJ 2YHAA 4PPZA 3MR5A 4IYQA 4IH6A 3FNNA 2PMHA 5F8JA 4X4SA 2BANA 3G6ES 4TLQA 5KG3A 1VK3A 2YNHB 2F4VJ 3C7NA 4W92B 1O13A 4ZPVR 1LKZA 2B8PA 5LY3A 4OJGA 3P3DA 1P8GA 2BJEA 5D6GA 4URQU 3VAGA 3MUMP 3DLGB 2R2TA 2Y0BB 5KG1A 5D4OA 4RPFA 4IR1A 4LF8F 2LQ8A 4KREA 2ACMA 3OT9A 2FHOB 1L3UA 3RTVA 1LOTB 1Y11A 1RT7A 5HMYA 1TKZB 4LJMA 3LDLA 2EFVA 1RDDA 5E26A 4XEIA 2PD1A 4DR4K 4DFJA 1CLQA 3B6OA 1IM6A 2G1HA 4OI6A 3U02A 9RUBA 3FEYB 2JJ4D 3FEZA 1FDAA 4CK3A 3T19A 1N54B 2QA4N 4KAZA 3LPUA 2WAQD 4J9OA 4RLEA 4WIIA 1KHVA 3VGKA 1KSPA 3HVRA 3BGOP 2VJVA 3OYGA 4F4ZA 3HDSA 3FCHA 3WDOA 4X66F 1I6JA 1N5VA 3SXLA 3DXKB 4OX7A 1N32J 4PXDA 2O4IA 3JAMU 3AVKA 1KXPA 1RLDA 3WEEB 1W2BR 3C94A 1C4AA 1A5VA 4OX9K 1HD1A 4ERDA 1HW8A 3KLGB 4MKBA 4NLUA 2B8QA 1DLOA 4FM2A 4JS5A 4K5SA 3AO1A 5EUHA 4KT0C 1V4TA 3QAUA 4OL8A 4MDBA 3M7VA 2DPIA 4X4UA 3VQ4A 3TQ1A 1U2RA 2XNQA 2VG7B 1H0HB 1O0PA 2EW9A 4PA1A 3R7BB 3KJNB 5ETTA 1UVMA 4B9SA 2DRDA 4J9VA 4JI2F 3VAMA 3PIPQ 2R8KA 1WTBA 4OJHA 1NU0A 4IO1A 4WWSA 2W7AA 3DWLA 1S5ZA 5BR9A 4KKOA 2FLNA 4Q43A 2APOA 4USVA 3BYPA 4Y1CA 1NJIT 4AHUA 3M8QB 3R1HA 4CP5A 2J7KA 5HMWA 4FYDA 3BZQA 3IRXA 3C66A 4B1ZA 3HSDA 4JI0J 1ACMB 2P6SA 2CJQA 3O5BA 4TY9A 1HWJA 4J91A 3OS2A 3M8QA 2VQFF 3R27A 3O08A 1TKTB 4WF9Q 2ZD1A 5F41A 2XGQA 2ZE2B 1RU1A 3OLBA 2UV8G 1NK8A 6AT1B 3QLHB 3WXMB 4KRFA 2NSBA 2PA8D 3ZTPA 1J5OB 3BF4A 2K06A 1KFSA 1JCEA 1VRUA 1MWKA 5IOLA 1SIZA 2JC1A 4RX6A 2VWBA 4DR7K 1Q95G 4OJ1A 4B9LA 5HK4A 4C6AA 4KH6A 3A3PB 1QY7A 2ASOA 3J7Z5 3OS1A 4E8UA 4XIUA 4JI3K 4ECYA 5BJRA 2KT5A 1K9MT 5DS7A 3QBWA 2G2YA 2Y1JA 3QO9B 4FF1A 5DQGA 2XWXA 3NS7B 3P49B 2OI2A 1XUPO 2OGUA 1FESA 3QT6A 4D3HA 3UWTA 2MKHA 2KO1A 2GJIA 2DXFA 7FDRA 4WFZA 2R8HA 5AJ3K 1NK5A 1YG0A 2BJ7A 2JZ5A 2G0JA 4CJEA 3HSZA 2CH6A 4PL8A 4Q8FA 1QHTA 3QPIA 3D6HB 2A6MA 4I6MA 3HF5A 3E2EA 3JQJA 3J7YP 2DHSA 4NCBA 1RADB 3MAQA 1VRUB 4LFCF 5HP1B 1JLAA 1QD1A 1PYOB 2DNMA 4NCGB 2BQ3A 2FUG9 2BUPA 2E1CA 3GTYX 1KTQA 1R6VA 3SYZA 2HVIA 2YBVA 4GMKA 1WC3A 4B3OA 3R9LA 2YQ1A 5I4MA 1BL3A 4B08A 2V69A 2I8EA 5F8IA 3MAAA 2LP4A 3BKUA 4M94A 1C1CB 3MN7A 2QMUB 4ZJLA 3LP0B 4IFYA 1NU4A 3K59A 3CJAA 3T1YJ 4OHVA 5KOXA 2W1BA 1L3SA 1M1GA 4AHSA 3HVTA 2K2PA 2YHXA 4JKGA 3DOMA 3A13A 2J0WA 3OBIA 1J5EF 4CJSA 3PNIA 4LF5K 4NA1A 1FRMA 3FR0A 2V52B 4M5MA 4URGA 4K4XA 3PW0A 1ZBUA 2HHHJ 4O3PA 5J1EB 3KWGA 4RUAA 4DPWA 4JI6K 1FJCA 1S1TA 5IV3A 5IC4B 3NH0A 4YY3J 3JQMA 4R8UA 2LDYA 2WB4A 2RQ4A 4DWIA 2Y8YA 1L3TA 3CC2N 4OX9J 4KE5A 3AARA 3DXBA 3KD1E 4QR0A 2BV3A 2PEBA 4I7FB 1TELA 4IUFA 5FPEA 2NZ4A 4FJXA 3FCVA 3HJVA 2Y1RI 3T69A 3MHYA 1AZSB 1LWXA 4CBXA 3AODA 3I9ZA 3N4PA 3WUHA 3CCUN 1SL2A 3H5YA 1KOHA 4ILJA 1D9FA 3QRQA 1LW0A 3WIUA 3QB0A 3OTDA 3QICA 1RWWB 3AGKA 2HK3A 1R8AA 2IMOA 4AXJA 3QJPA 4M5JA 2FBYA 1CC7A 2HHVA 2G0CA 4K8ZA 4BREA 1U04A 2GO8A 1VI7A 3G2XA 5AE2A 2XHBA 1EP4B 3DRSA 2V4JB 3H90A 4IEIA 1N33K 4K4VA 3W7BA 3AOAA 2KRBA 3C15B 1Y9OA 1WF0A 1VSMA 2A41A 4CJVA 4H0PA 4CZGA 2JWKA 1CVJA 3ZSOA 3PZPA 3A8YA 2RD5C 4QS9A 4YP3A 3K2YA 4NYPA 3VTHA 1P9YA 2VZ9A 4FVMA 3IG1A 1G6BA 2BJ8A 3THXB 3ZC4A 3H2UB 3PLAA 1LXJA 3MGJA 3J81U 4LF6F 2X1BA 3EKUA 2ADCA 2VONA 1N88A 2R7WA 3K8WA 1Q9YA 5HQ8A 3BGRB 4N8NA 2HS3A 4HTIA 2DNNA 5KFWA 1HBMA 4DZDA 3KFWX 4TY8A 3IC1A 2XS2A 4JK8A 1T02A 3QFWA 4PQUA 1SJ4P 2OPSB 4KC5A 3SCKE 1PJ7A 4F4XA 4LQ3A 4QIWD 4CH0S 1S79A 4NL5A 2XHWA 2ALZA 1TKDA 1JQGA 4FM0A 1L5UA 2ZH8A 2CJXB 2J4RA 2HRUA 3FSXA 5T14A 5KFLA 2HBMA 1WUAA 2DXEA 5EWEA 2CJBA 1B0PA 2Y9HA 1SUQA 4TU7A 3QNWB 3MMCA 3QEPA 4MMOA 2MMYA 4F4WA 4DSLA 1RAFB 2I7PA 2H1YA 4J37A 3R9PA 1CJVB 4P6QA 1SKSA 2B9YA 1RBSA 4EFAC 2QA2A 5H9FJ 4D3GA 4OZNA 2Q6BA 5AFUA 4E1MA 2FQQB 3IGNA 2FSNA 3EE8A 1VHXA 4EBDA 5KFZA 3CE8A 4FWPA 3AVJA 2I5JB 3QERA 4G1QB 1YBTA 1OY8A 3UR3C 3BDPA 5LJ3Y 3LTOA 4C0BA 3LOUA 4OKJA 3OBWA 4LVNP 2PE8A 2D5RA 4CJRA 4RNNA 2H48B 3GILA 1RHRB 3Q23A 5AQRA 4KHPK 1W2BM 1BUXA 3NGIA 2R7YA 2Q66A 5ETPA 5G0RB 1S49A 3L9ZA 1FF2A 4CF1A 2Q2RA 2COLA 4QCLA 2F7TA 4DV5J 3KHYA 1VSKA 3UNYA 2XMWA 2CH5A 4OGCA 1S1VB 4I2PB 4LR7A 2DBBA 3WNHA 3W9IA 3DLEB 1IM4A 2VICA 4Z4EA 1VISA 4OLBA 2J0QD 2RB7A 4JKHA 4I2PA 4B3RJ 4CJKA 3THWB 4GVBA 4ILLA 1EQ0A 1VQ7N 1FO1A 4WQ4A 3R5GA 2RU9A 5KG6A 4JI1J 3KLIA 2Z58B 3VGSA 5AQMA 1VQNS 1TUVA 1S1XA 1T95A 2OAUA 2GAGC 4KQZA 1ICEB 3EICA 1BIUA 3NHGA 4F67A 2YI1A 1VIXA 1IUJA 2CZ9A 1D8YA 3MPWA 4JYAF 1I94K 1OPZA 3Q22A 1W97L 3O9TA 4ISFA 3T5JA 5BRHA 3VETA 1YJNN 5FLXO 3SUPA 1LWFA 3LDSA 2G8WA 4ZVRB 2VA2A 2VQFK 3IWLA 3DU6A 1FTRA 4IG3B 4YNQA 3C6UB 4JI4J 4FJHA 4RZRA 4GVMA 4AM7A 1RAGB 4KHSA 3CD6S 1P1LA 1CJUA 3LP1B 3SFUA 3UCGA 3QBXA 1Q18A 2KHDA 2E2OA 1RWVB 3OBYA 1JJHA 2HS4A 4PKGA 4O5FA 1JLBB 3DRPB 3P5TL 4PUOB 2Z57B 4PKHA 3M3ZA 3OXFA 2ZH6A 1EX4A 4DMZA 1WJ9A 4NEZA 4DTRA 3QRRA 2ZJQQ 1RHMB 4Y2KA 4M5DA 4BY9C 4OYWA 1PAEX 2KXHA 3QYYA 1TL3B 3P96A 5I3QA 4TU8A 2F9DA 1IH7A 5GINA 1LAVA 1RAJA 3O1WA 4OX9F 3UDVA 3H1VX 4HCBA 4DV3J 3I96A 1IQZA 2AJ0A 3OYIA 5LT5A 1KVCA 5C15A 2ZUGA 4HUFA 2OCEA 4OHYA 1RCHA 2WVCA 4CI0B 2W7OA 3MD3A 1Q78A 4ZLLA 2D9OA 4CGFA 4X62K 4DQ8A 5B0EA 1FEEA 2YKMA 2NR0A 2CJYB 2M8HA 4EU0A 2DEIA 1YIJS 3SQGA 3NL0A 4WFAL 5A0YB 1JKHB 1NH8A 3PXGa 1O1WA 5A2QY 2MEWA 2HNDB 5D15A 4BR9A 4XK8C 4K50A 2ZDPA 1QVGR 4ZVSB 2PA3A 2KFZA 2O4GA 1SQKA 4ALZA 1RWMB 1OY9A 4CEBA 4OJRA 2D41A 1YVNA 4X62F 1WKKA 4QQBA 2CQHA 2B7CB 3EPGA 2U2FA 1Z25A 2BZ2A 3FZLA 3JSBA 5HO4A 2UV8A 4IQXA 3PV8A 2IJRA 1HNWF 5KFPA 4DQIA 2YHWA 3L3UA 4PHTX 2GIRA 1KQKA 4WE1A 1G3OA 2E2NA 3TAQA 1E4GT 1ZM3A 2KFYA 3S3NA 3VQDA 4RW4A 3RB0A 1ZXOA 3W1YC 3U6FA 1F0XA 4DR6F 3DGPB 4JLHA 4QIVA 3S1TA 3W8PA 5A0YA 3HHLB 4AHVA 4RNOA 2BR0A 4A2BA 1IJEB 4BDYA 4XPEA 4E3SA 3IRWP 3GFZA 3QDKA 4OYXA 4DR3K 2NXUA 1HPMA 3EVMA 3LPYA 3ZEUB 5L46A 1H72C 2ZZTA 3MWTA 1F5CA 2ABYA 3G25A 3DLHA 3X1LB 2GVZB 3CPEA 2AGPA 4FWSA 4BWJA 1S0MA 1NMDA 3M8ZA 4LFBJ 4RJVA 3H46O 5AQSA 3U4LA 3HFVA 1PCAA 1I5OB 3CGIA 3ENAA 4A8MP 3J80O 5CAAA 5D8HB 3TTFA 1S9EA 4CQ1A 1FCAA 2AEFA 3NXZA 3P38A 3BBFA 2MYFA 3PEJA 4WK3A 3AD8C 1V5VA 3D0GE 4LIRA 1R89A 4KO0A 1VQPN 2MDAA 1NPKA 4M1KA 3KDNA 2IAJB 4DSKA 3DRPA 1CZAN 4AL7A 2E9ZA 3PHTA 2W40A 3BGUA 3CDAA 4FYYB 1RDUA 3UR0A 4CZLA 4MH8A 4ECQA 2P9EA 2CKWA 5B0DA 2YNIA 1WSJA 3CJ9A 1VQLS 2OZMA 3CM6A 1FXDA 3T7ZA 4DV5K 4KR0B 4F4AA 3HHKA 2D4WA 3PKYA 2BE9B 3CSKA 1HNIA 1MMLA 4Y2AA 4DL4A 1SC1B 2IYGA 2CVIA 1OS5A 4QIFA 1ATSA 3MFIA 3ENHA 2A2CA 4X4QA 2G8UA 3NGSA 3DOLB 3M2UB 2E5HA 4RW7A 3R7NB 2F9WA 2EC2A 3CJ2A 1I39A 2X1GA 3RR8A 3V9SA 4CEQA 4KFBA 2MLXA 4AHRA 2CRLA 4ISEA 1GXTA 1QLNA 1CZBA 4TYBA 4RU9A 3H5UA 2OPQB 3J7YU 2XMMA 4CF2A 5C2CA 2E1ZA 3A5MC 2VG5A 1WSVA 3BBBA 4ZCKA 5L39A 1VBXA 4NWBA 5C42A 4CZEA 4HHUA 4Q45A 1NDLA 3V6HA 3MXMA 3IG1B 2EFOA 1FXXA 4QOTA 2QEXN 2VQEF 5KFEA 2ZQBA 2FLLA 1TAUA 4EO8A 2C3UA 3R6MA 4CERA 4G3IA 2O8DA 4CDIA 1XC3A 3ASMA 2F9TA 3Q8VA 3CCMS 1ASVA 4BRLA 2I5JA 3OTCA 4HYKA 3CCVS 2RKIA 2HFZA 1YTUA 3A8EA 4RW6B 2QTWA 5IC6B 1N6QB 1HR0J 4F2RA 1O8BA 4K0KJ 2AJQA 1Q7LB 3H1QA 1HBUA 4CW7B 5DZ7A 4J2EA 4NZ6A 4MFBA 2CG8A 4WTYA 3IKMA 4FK0A 3HT3A 1UPPA 2NCKL 2E1MC 3OYNA 4QR1A 5IS2A 1RTZA 1JL2A 4ZP8A 3SFGA 1UA1A 4O3QA 4Y65A 2OPRB 1VBZA 4Y6IA 2VOPA 5LMNJ 4MT1A 1G1XA 2VG6B 2F4FA 2YX1A 1MNEA 1S6OA 1KTVA 4C0OC 2X7IA 2XM3A 4RWWA 4ATNA 3O6WA 3KHHA 2D0BA 1YF5L 4WYWA 1WKJA 2XLKA 3FJ2A 2HZAA 2ZM6F 4R0JA 4PY5A 1IBMF 3AO4A 5HROB 2FJEB 2ZOGA 1L3KA 2V8VA 1ROFA 5AQPA 2Y3YA 1WF1A 1OYEA 4KAIA 4A8YA 2P9NA 1I94J 4HCCA 1SKUB 3AY9A 1JK9B 3VEVA 3OQ2A 3K89A 3GJRB 1TU0B 3UD5A 2K3KA 3MX2A 3DHXA 3D2WA 4EZ9A 3QGHA 4B3RK 5DM7L 3PO4A 5BYRA 4F02A 2L9DA 2EI5A 5JVHQ 4BRKA 1NKBA 2HVZA 4KPCA 5B0BA 1T7PA 5IQQA 3NGUA 2ROPA 4CK2A 2ITGA 4IXCA 1VSLA 4FPAA 3MZIA 4Z2XA 1DURA 4FLTA 3HZ6A 2IVFB 3Q8YA 3THPA 4YR3A 3EVOA 3R8EA 2X6NA 4J2AA 4TYAA 2V9WA 2ZBPA 2HFSA 2CQGA 2Z1IA 2OEJA 3AT1B 2PDAA 1LFPA 5KFDA 4B3RF 4U7CA 1CS4B 1MWYA 3K9JA 4E7LA 3VV2B 3V4IA 1MSWD 5KGWA 2F3JA 3GIKA 3W0LA 4DL7A 2KRRA 1VQKN 3CJ1A 1KHWA 4WZQA 2QYCA 2ZHOA 4KPYA 1T3OA 3U27A 4NLDA 5AQWA 4L8RB 1YK9A 1YZ7A 3PUFA 3P8BB 3LZJA 1JLCB 4JS4A 3JS6A 2NSCA 1FFGB 2CAJA 1UEVA 1VQYA 3PDNA 3OYLA 4ZKAA 1IBLK 3KK2A 4DTNA 4DV7F 1ZYQA 4C8OA 2IFXA 1EAYC 1YJTA 2HQIA 2VG7A 3HI0A 3C19A 4I69A 3VERA 2P9LB 4C3MA 1UW4A 3OL9A 2VYPA 1KCFA 2W2MP 4P10A 5C2DA 4DV1J 5CZXA 3JS9A 1FXLA 2YKNA 3KKFA 2B9WA 2W4PA 1RT2A 3EE3A 1V3ZA 2MKSA 1Q8IA 4O4RA 2KTQA 4OI2A 1N5SA 3KLHA 2DCLA 1SJFA 4KHYA 2OTLN 1KLMA 5IT9Y 3NY0A 2O8FB 4ZCMA 4DR1F 3PYEA 4RU2A 5KT4A 4OV1A 2BDPA 1WB9A 4O55A 1FJGF 4C8MA 3VAFA 1VYAA 4GMJB 3J7YI 2UXCJ 4RBTA 5DLGA 2R7TA 5KG0A 2CJ9A 1UWAA 2VG6A 5LMUJ 3ZX2A 1U6BA 1WOOA 4MKYA 1RJJA 4DV7K 2NUUG 2R7XA 1H98A 3AGRA 4ID8A 2GTDA 4I2QA 3O9UA 1FK9A 1YJWN 2ZNZA 4J8FA 1U09A 3HKWA 2KN4A 2FJBB 2LFVA 1S5JA 1XERA 2IAJA 1C1CA 1IJJA 4K4SA 5KT6A 4MLHA 2P9NB 2IM2A 1CSJA 3MPVA 4O4GB 4DV4J 4M3XA 3SCJE 4GC7A 1N5YB 2JH3A 2CPZA 4X65K 1S7HA 3IDHA 4WFNQ 3L2WA 4LF8K 1N8RO 1VDHA 4EEYA 3THYB 4IJAA 3UIQA 1WC0A 3LPTA 3NGZA 1W25A 3HHLA 2YQ3A 3CO9A 2QSWA 2QKBA 4IOCL 4JD2B 3DGPA 3TX0A 4AQYF 4LRDA 3KUGA 4OO1J 3T6BA 4DUZJ 3W2WB 2AMCB 3CJSA 3BJYA 4DV6F 1V3SA 2FJVA 2FF3B 2QXFA 3M8PB 1P9QC 4JD2A 4PZVA 3KLVA 2AJ1A 3PYDA 3I8DA 2D3OR 4F50A 1TR0A 3CMAN 2XLJA 2ZVSA 2WW4A 1NGJA 3ZETA 1VMBA 3D3CJ 3MM7B 1S9EB 3T5LA 3THWA 4J90A 5KAKA 3OXGA 3A5LC 2BGGA 3IM8A 1IBCB 4PEOA 5F2RA 1RTJB 4C7QA 3SSQA 1VQPS 3AQOA 4AH9A 4PXEA 2F9JA 3IR6B 4OI1A 4B8CA 4BRNA 1Q53A 2OMOA 1UWBA 3KKRA 4RUCA 3H42A 2DGOA 3VESA 2GMHA 1TKXB 5F8HA 6FDRA 1YJUA 2HAFA 2JWNA 1RHQB 2RAQA 3R8YA 3H5SA 4CD3A 5HANA 2MKYA 4H0YB 2DGSA 1NZAA 1XN9A 3ENVA 2BE2B 3J80U 4OZLA 3KNGA 3BQ1A 1LK5A 4CF0A 1XHXA 1TMMA 4QW8A 2AIRB 5LSOA 5M1QA 1HJRA 4NRUA 4NLXA 2J9EA 1QSLA 2ITMA 3TR5A 3ZTOA 3QJJA 1KR4A 3WZ0A 4KYZA 4O3NA 3MAHA 2JEIA 4H5NA 1QSSA 3I0RA 3DOKA 1SH3A 2XZWA 3ZSWA 1UMJA 3AY0A 4B3SJ 4DV6K 3C2PA 2BTFA 4ED4A 5CYQB 5D77A 2W01A 3FZKA 4ZIVA 2RMLA 1Q9XA 3AH6A 3HPOA 2VU5A 4RNHA 5KFHA 4IOAL 1UETA 1RA7A 5HL7Q 4H5RA 1NBWA 2ZBCA 4F0MA 5KFCA 3P5JA 2WUSA 3RGIA 2CNOB 3B82A 3AVLA 5BPNA 4UY8O 1X7VA 3HSJA 2CA9A 5LMNF 3H08A 1WWHA 3DMJA 1WSFA 3VQBA 3CCUS 2R8JA 3DRRB 2GHWA 2EWSA 1T11A 3ZZZA 3HO1A 2FGOA 4I56A 2KYXA 5E5NA 2QC3A 4H54A 3JSMA 2FJXA 2A1RA 4OLAA 4I6WA 5I9EB 1ZTWA 5ETVA 1N34J 1Q4RA 1Q81T 3PACA 1BWEA 3FVYA 2XYGB 3M8SA 2A6OA 4WYLA 3OS0A 2BBEA 1RBVA 1H38A 2F8TA 1IBKF 3C6TB 1T8EA 3ULEA 3OY9A 5DMRA 3RB4A 1HNXJ 2RIJA 4DV2K 3HK2A 4CHQA 2BJ3A 3JYTB 2UVRA 2Q6CA 4AXIA 4CLUA 2D0PA 3KD5E 2ZUAA 4BC4A 3D1HA 2HF3A 4ANCA 2L3MA 3PW5A 1WC5A 3U1LA 2HG4A 3PG9A 4TKTA 2VBXA 4HACA 5D0GA 4WP3A 3V6DB 2LQJA 3KZBA 2J9DA 3PW7A 3ICLA 4NXNF 3OYAA 1XIQA 1E3MA 5IV4A 1KC8T 1KVBA 1B9DA 4LREA 4OYPA 4I2QB 2E2QA 3GJQB 3W66A 1IXKA 2V0NA 1BI4B 3DU5A 1FD8A 4FK4A 2AYMA 1C2PA 3OW2R 4ZITA 3OFFA 1CXQA 3M8PA 4R79A 4DUZK 1VIOA 3K9KA 1OY6A 3OL6A 1IBKK 4H4MB 3H4DA 2HAIA 5K14A 1DZ5A 5GMKa 2CJKA 4NLBA 4L76A 2GJFA 4H0OA 5DG9A 1YHQN 2E1YA 4JI7K 1XJWB 4KGXB 3IR7B 3THYA 4LRBA 4ZCLA 5IT9O 1VAZA 4CBWA 3VQ5A 3DLKA 3CM5A 2P6TA 2HBRB 3AB2B 3R6LB 3HSCA 1XMBA 3MEDB 3BSNA 4USIA 1FTCA 4YUDA 4C48A 1U1LA 2P9KA 4EBCA 3OHRA 2M4MA 2DTUA 4HDHA 2I9SA 3D3BJ 1FX4A 3T9ZA 4B02A 2QFJA 5J2NA 2LKZA 2VPXB 4CJLA 4ECVA 4DL3A 4Q0BB 2LEAA 1Y10A 2M8DB 1BA0A 3HI9A 3R3TA 4MK7A 2EEYA 3I8BA 2A1SA 4LF9J 5DGAA 4WFXA 1C0UB 1SQEA 3MOZA 1RILA 4DX5A 2RUSA 3L8BA 1QAIA 1FT8A 2A42A 2DGTA 1MU2B 3THXA 3I4PA 4IG3A 4J9QA 4PQUB 2XY8A 3DGVA 1MWZA 4L3QA 3U7JA 3F0NA 2L41A 1GOCA 2BUNA 2H9ZA 3RRHA 3N5FA 2F65A 3AD7C 2LA6A 5CR4A 4JI3F 1S4FA 2KZMA 4OYIA 1RDWX 1G15A 4CK1A 4JI5J 3AVNA 3MR7A 3M6UA 1JCGA 1YIJN 1WI6A 5AJ3J 5ETOA 3T6JA 2KXFA 3EL2A 2GHVC 3EZWA 2X78A 2QIFA 1HNWJ 1Q5VA 1HUXA 1FHTA 4PUOA 2P9PA 2OPQA 1S0OA 3FMWA 5LJVA 2VWJA 3CXCR 1MROB 4M63A 2NUBA 1RISA 2M3DA 1KAZA 4ZTJA 1H7WA 3BGFA 2UUAJ 1N0UA 4U7BA 3AJ1A 2GV9A 4LH5A 4PABA 2PI4A 1GH8A 3RBDA 2U1AA 1X1PA 2HBJA 3N4WA 2DRBA 2IPOB 4C9DA 3TEGA 4LT6A 2UVVA 4X65F 3FQKA 1RTDA 1YWXA 2CPEA 3O80A 2M0GB 4LFAJ 2MQMA 2OJ3A 4R8UB 3AVBA 3BUZB 1RBLA 2NRZA 4NZ0A 3N0VA 2IYIA 4KB1A 1T94A 2FHJD 1UZHA 3CPWR 5A6PA 2UXCF 3MDQA 1HHTP 2V8HA 4CJUA 2NNWA 1H2VZ 4CTAB 2BKNA 2CDQA 4NCGA 4TVAB 4DV0J 4ECRA 5HROA 2LLZA 2D1CA 3BR9A 1NGEA 2JRSA 3C65A 1KD1O 4K41A 3WHIA 3W3SA 4FLYA 2HBKA 1E6YA 2HYIB 1W2IA 1B0TA 1Y97A 2DGVA 2WONB 4J9RA 1TTHB 1RWOB 2VIHA 4GVLA 3GWCA 4X4PA 5GADP 1HYVA 4KTWA 3ENWA 4BS2A 4FYVB 4LC9B 1WF2A 2NRWA 4JV0A 3GSIA 4OHXA 1ZM9A 1KNZA 1KAYA 2J6UA 1OQ3A 1UFKA 3LUYA 3NAIA 2KXNB 3I0SA 3AVIA 4X84A 2IRUA 3OYJA 4LFCK 2ALYB 2GAHC 4J9KA 2E29A 1XR6A 3F9KA 3BQ2A 3G6VA 3V6KA 2NRTA 3UKUB 5L1IA 2CQCA 3HHNB 2CGKA 2MZRA 1BOTO 2XI3A 1E6VB 4ZPWR 4CHOA 5L1LA 2DD8S 3QGIA 2CPFA 3D6MB 4KI6A 3UN5A 2B0GA 3TZWA 3D0PA 1R6YA 4J9LA 1M5KC 2M52A 3FKBA 3VMFB 3GYNA 3ZZUA 1HYSA 3D0IE 3D1QA 5BR8K 2UZAA 2HNZB 4M5NA 2QSFA 4P52A 1WHYA 2RNEA 5F8NA 3HZEA 4FO0A 5AQIA 3IBFB 2CQ2A 3VOVA 3OUYB 1SV5A 2R8GA 4P72A 3PRVA 2YKNB 4FWRA 1QVFR 3AAWB 2GIQA 3H40A 4JI2J 2AWZA 2RHSB 4RCHA 3GG0A 2MKKA 2E44A 2VPZB 3HHLC 4I0WA 3KMSA 1K0VA 1ASUA 3H98A 3D2FA 5AQFA 4W5NA 3FZ2A 4QWBA 2YHBA 4ILGB 2AQ4A 3KK2B 1WNEA 3CC7N 1N32K 1EETB 4ETZA 1PGZA 3C3LA 1XMQK 1ELOA 2CQDA 4EFHA 4PWDB 4DR5J 3VQEA 1IJFB 4ZPDA 4CO3A 1NPPA 2F8SA 1C1AA 4OV6A 3IAM9 5C24B 4UW2A 4DTPA 4GNIA 4MJKA 3NGYA 3AAQA 1QHAA 4M7XA 3CIZA 3LGNA 4I9QA 4AL6A 4HH1A 3OVSA 3L4IA 3S6EA 4FWLA 2AW0A 4ZVPB 3CCQN 4FZXC 1VFJA 1X5TA 3ZSXA 4K4YA 4M3UA 2EFQA 1FRXA 2BOAA 3A4TA 3FEXB 2VCPA 2ZKTA 3O4WA 4BC9A 1MG7A 2ZITA 3M2UA 4DLGA 3GV5B 5F1XA 2GMLA 4MIBA 3CDUA 4F26A 1GOAA 4DR1J 2ROGA 4QYRA 5EX0A 1APSA 4OKEA 3MECA 3UB5A 3J7ZO 4QR2A 3L3CA 3DRSB 3IBWA 3AO5A 2JLEA 3OFEA 3FE1A 2OMLA 3CCEN 3ADAC 3W65A 2RUGA 1C4CA 2NZTA 4LF1A 2UUAF 4M45A 1LOUA 2Z2MA 3UDEA 5KFUA 3B8AX 2QT7A 1R43A 3BEGB 3G82B 4WU3A 4X64K 4UTGA 4KIAA 2UXDK 3L6QA 2BQRA 3KVGA 4ICLB 3CJQA 5AQZA 1U47A 4CLYA 2UUCJ 4HT5A 1KAXA 3T1AA 2DH7A 1GMVA 4USUA 3H2VE 4QU6A 4U67Q 4QOZB 4K5RA 4KHUA 3MEDA 1LFWA 5M1OA 4ANDA 1CJKB 3HZGA 3I31A 3CJ5A 2DNGA 1NRKA 1VC5A 3OTEA 1XR7A 1A7GE 2UUCF 2QX0A 3JQKA 4C1NI 3GE9A 3VQ7A 3O1BA 2QO3A 1GTEA 3UVJA 3CIMA 2HHTA 3QEVA 4DPXA 2VC0A 1IO2A 3G71S 3PIOL 3AO2A 2LXFA 3DI6B 1C0TB 2HWIA 2IM1A 3QNOA 1NKCA 1SL1A 4EHTA 2E7VA 5L1JA 3LQVA 4JUZA 1NJWA 5L38A 4YHHK 4CJFA 1U0HB 4Z94A 3QT8A 2J5AA 2W2QP 2KFNA 1VQ5S 4NLCA 1EETA 3DM2B 4LF7K 1IR0A 1MN7A 3VGLA 2YNGB 5FLXU 2XMVA 2E20A 5DG8A 3OYKA 2GVDA 1JNRB 1UPMB 2KJVA 3QWUA 1IQTA 4JV2A 1IKXB 3Q86A 2CQ1A 1VRQC 5B0CA 4GKJJ 1F6TA 2HQ3A 4M5GA 3U1MA 1W0HA 4KHNA 1K73O 1XI1A 4KGMA 3ZZRA 5KGXA 4CEOA 4DUZF 2C3MA 4C0HA 4N56A 1S1UB 3QEWA 3CG7A 3NLCA 1WC6A 1M5HA 2X74A 2HWTA 4UY8T 2HBYB 3MMAA 1PO6A 2IDLA 2HBZB 3LWMA 4CJ3A 5AZJB 2EXUA 3GFYA 3LL3A 3NVKA 4OIXA 4DU4A 1IN0A 3MPUB 3CF5Q 3Q89A 1T6DA 2IJNA 2YWHA 2V2QA 4R0EA 3O4NA 1SI9A 4DPYA 4YHHF 2BE2A 1Q5YA 3CHWA 4BDPA 1NK9A 5JICA 2H4YB 4KO0B 3NS5A 2IC3A 4UOGA 2A6AA 2I1RA 5ETNA 4A8XA 4Q2MA 2BRKA 1SB6A 4WXWA 1R8BA 1RHKB 2XSFA 2V8PA 4OGEA 2F8MA 3HBTA 3GR1A 3RZAA 1FKAF 2QI2A 4CO2A 5HBMB 1UJ4A 1LW2A 4FJKA 3DHWC 2M7SA 1S0VA 2UUAK 4BR2A 1UZDA 4ZN1A 3M9NB 3M30B 2CQBA 4K7QA 2E1RA 1T05A 3GV7B 4DU7A 3LGMA 4A8OA 5F3TA 3PYGA 3IP0A 3Q2SC 4FF2A 2VBYA 4ECUA 1X9JA 1ITGA 2CNLB 3K8VA 2PY5A 4HT7A 2QWNA 1BMQB 3FSIA 2DYAA 4BE2A 4QBUA 1JJ2M 2Z2YB 2JNJA 2C2RA 1SJRA 1P90A 3BKTA 2FTRA 2IIRA 3NF9A 2ZBRA 1WAFA 3U8XA 2HPUA 3KLHB 1VQ8N 1RKIA 3TAEA 3IUCA 1CJKA 2ATLA 3AA5X 4O4GA 4M41A 2QKKA 1ZBIA 2AYEA 4ZCIA 4JI0K 3R6GB 1KD1T 1CLFA 3NMAA 2M5YA 4DV4F 1T9UA 5JXSA 3OJUA 4M8LA 1NM1A 2XCPA 3CIPA 1S99A 3P31A 4FKYA 1N33J 4W5RA 1TQLA 3UKRA 2ILYA 4S0MA 4C1NK 2B9XA 3VAHA 1JXEA 2LXIA 3RBXA 4L73A 2QWPA 2NXEA 1NK4A 1HJOA 3C6AA 4EMDA 3L0QA 1P8ZA 2J6TA 4XDDA 2R7OA 1YKWA 3MUVP 4ZLJA 4WBFA 2VQFJ 3BSCA 1PBUA 2XMKA 4FP9A 1NB7A 2HMIB 3TO8A 4W5OA 2EC0A 1QTMA 4CIOA 2JEJA 3QT5A 1FDNA 4YOTA 1Q8LA 4IFVA 2DB1A 2PO4A 4FVCA 4RR5A 1GLJO 4C11B 1G2EA 2J9DE 2BACA 5J2NB 4ILRA 4DN0A 5KFVA 3NWRA 4LF6K 3V1RA 4WFYA 4BVPA 1MWMA 1ZAWA 2E1AA 4DX8H 3NH2A 2FHMA 2A5XA 4UZBA 5THWA 1A6LA 3IBCB 3TJAA 4JB8B 3ID8A 3B54A 2R2SA 3J7A1 1VSHA 4LF4K 3W63A 3HVTB 5M1FA 1XNQK 5C10A 5RUBA 4ECWA 4ED1A 3QSYB 3UNGC 1S1UA 1RT6A 2VDIA 4ED7A 1N36J 1LW2B 2KHOA 1RTJA 4BC2A 2K1RA 2NPFA 4CFDA 2VWKA 3VHQA 4Z4IA 1IR2A 3FRZA 4H0XB 4C23A 5C12A 2KDOA 4A4JA 1RGIA 3ZEUA 4H5TA 3KMQA 3GMGA 3KWMA 5CCLA 1DFDA 3B4DA 2BOPA 2O67A 3SMSA 2MJUA 3T1HF 3R97A 4WU2A 3QT7A 1HNZK 3KUHA 1ZH5A 3PSFA 1HL6A 2QL7B 1NDCA 1JWWA 2O8BB 3V81A 5AXKA 1S77D 3PRBA 5LJ5Y 1DTTA 2FC0A 3MCOA 1Y5IB 3JSYA 1PIEA 2ASYA 4Z4FA 2JOQA 1GQEA 3A3OB 2X3GA 3LDQA 3N4QA 3E8OA 3TVYA 1RAHB 5CCMA 2MKCA 4JHDB 3TX8A 4QWCA 5DZ6A 1HQEA 4FCYA 2FDNA 2ZC3A 3VF2A 4KHMA 4BRFA 1NJIO 3VAJA 2H4WB 4DV3F 5E3PA 4HUEA 2DHAA 1BCOA 2NQPA 2UUTA 2YNFB 4DL6A 1M5OC 1PBAA 1VQ9N 2ZHAA 4CESA 1JLBA 2B5JA 4O44B 1Y4ZB 4IOBA 2C22A 4O8UA 3TWZA 4GO5X 2XO6A 2OP5A 1JLEA 1BWFO 5E84A 1EB0A 1SH2A 1R7IA 1ZOTA 1NHVA 2ZGYA 2HNYA 3IM9A 1MA9B 1T9XA 2WOMA 2V63A 3QIDA 1ZPWX 4ES1A 2YHYA 3UDCA 2B4UA 3DLLL 3KXDA 1K47A 4M63C 3VZIA 4CT8A 3KJFB 4EO6A 1NZ8A 3UE5A 2MSTA 4TY8B 4CHYA 1HWIA 5KPZA 1XC9A 4WYBA 4C2MA 3IAYA 2ZJPL 3GIMA 1YLXA 1L3VA 4PG4A 2AZ1A 5K8OA 7AT1B 2WCXA 3SAHA 3AVCA 1REGX 5D3GB 1GT8A 2YNGA 5H1SQ 1C1BB 4FJ5A 2QM1A 1RTIB 2E7WA 4ZP9A 2PGCA 5D4NA 2HZCA 2NUHA 1VCTA 2YWKA 3OR2A 1Q82T 2KI2A 3ILJA 4LFAF 4N77A 3IS9B 4DV2F 1M0SA 3I9V9 2DH8A 4FW2A 3VN5A 2CADA 1KLMB 3DLEA 3E66A 4BDZA 2VQEJ 5HRRA 4ZK7M 2E9TA 5CE3A 5K20B 3C6UA 3UCZP 1GTHA 1BY9A 1WOSA 2XMTA 4QWAA 4LFBF 4LF6J 1OJ4A 2DCUB 2L08A 5FDLA 4GC6A 2XY6A 2RF2B 3IMXA 2FGCA 4A5AA 5HVFA 5F9LA 1BO5O 3CTRA 3W9JA 3A3NB 3W2WA 3ZSYA 3FLCO 4NOHA 2OZSA 2P5GA 1RHJB 3W5ZA 1UCNA 1ZPVA 1F9HA 1NLKL 4CGHA 2HWHA 2ATQA 1TUWA 1CZ9A 2OPPB 4ZVEA 1SCJB 2V2VA 1DAXA 5DM7Q 3TAMB 2L9WA 4CE9A 3DYAB 4KBOA 1LWCB 1GLCG 2IOCA 4KRWA 1FJGJ 3I82A 5DRKA 1E6VA 3RU0A 1R3NA 4ED3A 4DR2F 1U2VB 3DDIA 3V4IB 1YTAA 2OSRA 4Z0UA 4AHCA 2MY8A 3Q7CA 1R59O 2UXDJ 2D1KA 5SWMA 5KFGA 2MZSA 4U95A 4DR7F 3A1YG 2PEHA 4BVOA 3BO3A 1MMNA 1VQ4N 3UI3A 4ES3A 5LJWA 1IKVB 3S7RA 3KG4A 1WKLA 3TJ9A 2E2PA 1VHFA 5J2MA 1JJ4A 1X4FA 5BPLA 3IFRA 4FSVA 1CC8A 2O8CA 2LSNA 5AQVA 3CCES 1WN7A 3OTOJ 5CD4A 3LP2A 4HL9A 2DKOB 1NGIA 1S9FA 4BC3A 3GYGA 2WOMB 4FXVA 2Z1HA 4FLUA 4OX8A 1NSAA 4ZPCA 1ILYA 4KH1B 1ITPA 4IEEA 2NXNA 1TUUA 4NYFA 3EN9A 2FVPA 3LP2B 5HJYA 3V9ZA 1J5EJ 4A8FA 4K4TA 1IG9A 3RRKA 5G4DA 2ZD1B 5DM6L 4DV5F 3BYRA 3ULDA 2RN2A 4IO9Q 1VJWA 2AX1A 1TL1B 3GIRA 3D6FB 4BG8A 4DPTA 2HKEA 2B4JA 2JHEA 2YX7A 2M9KA 4IRKA 1W9HA 2XRIA 2HHQA 3TRGA 2LEBA 5KG2A 1VRTB 2RHKA 2BJDA 4NLPA 1KEKA 3C7NB 4K4WA 2IHR1 1Y0HA 5EDWA 2VFUA 1BUPA 5KT3A 2ASLA 3TI0A 2HGLA 3QGPA 1RLCL 1HBUB 1O5JA 1Q7YO 3TPQA 1WEYA 3KHGA 5D4PA 5HRSA 3P1GA 2W2PP 4PYDA 2UVUA 4Z7YA 2P5OA 5ADZA 4BRAA 2LVWA 3RAXA 2BRLA 2OLWA 2HHSA 1HWKA 3HX9A 1S72S 1WTFA 2GUPA 3L7OA 1T3NA 1BD6A 2AYBA 3QATA 2XY7A 4B3SF 5T7BA 1YJVA 5CABA 2V7YA 4ZJOA 2Z4PA 2GWKA 1F5BA 1T9YA 3L2UA 1N4LA 3OHBA 2ZWOA 2UXBK 2WONA 3G4SS 1MROA 4E0DA 3CDWA 4OYMA 4NE9C 2HFVA 2EFGA 3TUJC 2P9PB 4Z7CA 4M42A 4RW9A 4ILHA 1IKYA 2FVQA 1FA0A 4CJ4A 2W8KA 2CPJA 4DR7J 5DDPC 2W25A 4WP9A 3F73A 4OPHA 4DTSA 3TTDA 4FWKA 3GU0A 1S6QA 1BHLA 2Q0RA 4DCOB 1V4SA 1GMWA 2ZJPQ 3MM8B 4ID5A 2AGQA 1KRPA 4ZHRB 1V5IB 3RBZA 4CNZA 4LF9F 3HFZB 4TLRA 2QWLA 1SIWB 1LWEA 3M9MB 1RT3B 5AFUH 4CIEA 3AXKA 4JRPA 2AD9A 4FS1A 1V6HA 2RS8A 2X6SA 2NS1B 1M1KT 2G13A 4P7VA 4YB5A 3M5RA 1SV5B 3BH7B 1A9NB 3K17A 4FWQA 1P27B 2DFEA 4V19J 5C2GA 4BQZA 4KHPF 2DNHA 4ZDNA 4ILMA 4PG5A 5A2QO 3ZNJ1 3DCAA 3HSGA 1N36K 4LFBK 1FWPA 2W9CB 3G4SN 1YXQA 4PG7A 1HPZA 3VAKA 4GY2B 1TV6B 4IDKB 1NHKL 4KFBB 4H0VB 2GCFA 1X60A 4CRJA 2GC8A 2KW4A 2OKQA 2OH2A 3D7EO 3NKYA 1HW9A 1GXLA 4HHJA 2HBLA 3NCPA 4CZFA 5LMNK 4FLZA 5KFMA 1TFYA 3CDBA 4O0IA 1HQEB 2D3UA 4FWMA 4IRDA 5AQTA 4CLZA 2D3ZA 3EX7B 4Y00A 3BGLA 3CJBA 5E3AA 4LF5F 4JOUA 1Z2ZA 1S0NA 1FWLA