1FK9A

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
536
structure length
519
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAITKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 146
structure length 519
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fk9A05
3DI6B 1BQNB 2E9TA 2IJNA 1TKXA 2XI3A 3N6MA 1ASVA 1RBTA 4B9NA 4ECVA 1OS5A 4KB1A 5HP1B 2GV9A 4I9LA 1JLQB 3KLEA 3DLBA 1IM4A 2B5JB 1TKDA 2GUIA 3CG7A 1BISA 3QNNA 1D5AA 1GOBA 3KK2A 3P5JA 3AO1A 5C24A 5D3GB 3WNEA 4CJRA 4CGGA 4DTMA 4MFBB 4DSKA 3BREA 2GIQA 1FK9A 3NCIA 4G1QB 4F2RA 4ID5B 3SQ0A 5KFCA 2YV0X 3C6TB 3PZPA 2VG5A 4NRTA 4RW9A 3V9UA 3AA2A 3VQBA 2Y1JA 3B6PA 5F8JA 4KBIA 1J5OA 4EP4A 4ZPCA 4ECYA 4LSLA 1L5UA 3K5NA 3NF6A 1CLQA 1S9GB 4Y2CA 3PHEA 1A5WA 4W5TA 4KHYA 3KLFA 4QOZB 2HMIB 4Q44A 3KOAA 5J2QA 2F8SA 4DTRA 1WSGA 4ZPDA 1T05A 4XIUA 1Q8IA 1LWCA 2ZQBA 1MMLA 3PW5A 1N6QB 3NF8A 5E41A 5KFXA 1LWEB 3SPYA 3IRXB 2HHVA 4I9QA 3KKRA 3Q8SB 4DG1A 1XHZA 1RBVA 1XI1A 1RTIB 4O55A 4ED0A 4NLPA 4DFJA 1I3AA 3VQ5A 4K8XA 3THVA 1NKEA 4N56A 3P1GA 3PW2A 4IRKA 3CJ5A 4NLGA 4K8ZA 2AU0A 4XPEA 4NLQA 1C1BA 3OSPA 3WNFA 3TABA 3AA3A 4EBDA 3V1OA 1T8EA 2G8KA 5L1IA 4TXSA 4FK4A 3LWLA 1WLJA 4B9LA 1KVCA 1XR5A 4M94A 3V81A 3QLHB 4RNFA 4URGA 1IKVA 1SV5B 4HHTA 3QO9A 4E3SA 2IS3A 3DRPB 5KI6A 1N5YB 4NYNA 4Q8FA 2W7OA 2Q3SA 4KHWA 2XCAA 3OYMA 3ITHA 3MEGA 3DLKB 3OSNA 4KV8B 3D0PA 4FJLA 2ASDA 4ECSA 3GV7B 3FRZA 3QEPA 2IM1A 3LP1A 3ISNC 3H4BA 1JKHA 1HNIA 3CFRA 4WFXA 3SI8A 4ZMMA 5T7BA 1TL1B 5KG3A 4DL2A 4WFYA 4MK9A 2BR0A 3CJ3A 4HYKA 4DQQA 3SUNA 2WRMA 2C2RA 1JXBA 3V4IA 4TYAA 4C8LA 1RDAA 4M3UA 1XC9A 3AVMA 3PO4A 5KG2A 3GIKA 4IQXA 4YR3A 3BGRB 1S6QB 3AVJA 1GOAA 4CK1A 1QUVA 2D3UA 4U6PA 4ZTFA 4HTUA 1Z25A 4C8OA 4K4XA 3DYAB 4KI4A 4C8NA 2R8KA 4F8RA 5C42A 3NDKA 4K4TA 2UVRA 2DFEA 1DTTA 1TK5A 1J54A 1WSIA 4DSFA 4I2PB 4QWEA 3OYBA 1IKYA 4TYBA 5KT5A 5CYQA 4NLUA 2IJFA 4DTXA 3Q8RB 3T5JA 3CM6A 4AHSA 4CJWA 3C6TA 2R2UA 4CHYA 1U48A 3SQ1A 3V6KA 3CFOA 3KKSA 1HNVA 3ZT1A 3FSIA 2FJWA 3OYAA 3AVAA 4RUAA 4W5NA 4DQIA 5KT7A 1RT6B 3MAQA 1J9AA 4DL4A 4C8MA 1NOYA 1VSFA 4PA1A 3KLFB 2YNHB 4YR0A 4X2BA 4B9UA 1RT4B 1O1WA 2AX1A 2IM0A 3CWJA 2UUWA 4DTNA 1T05B 4IRCA 3HPOA 3KD5E 1S0NA 4FJIA 3L2UA 1T03A 4RNMA 5KGWA 4DEZA 1S1WB 1ZTWA 5KFZA 4CJ5A 4FJGA 3VQPA 1S1TA 4Z4HA 4DU1A 4FJ7A 3N6NA 3V9XA 1I39A 5KG5A 3ISND 2E4LA 3DMJA 4AHCA 3K57A 3I5AA 3QEXA 3RRGA 4IR1A 3BQ2A 3RR8A 1SKRA 4TQRA 3OYJA 2HWHA 4DFKA 1QAIA 4RW7A 3SQ2A 4KHQA 3LP2B 5DGBA 3AO3A 4KAIA 4J9LA 2IA6A 2XWYA 3QO9B 1FKPA 3C95A 4CJUA 1C0TB 1S1UB 4OPKA 5KFMA 3OYNA 1IKXB 3VQCA 1RT7B 2IC3B 4IG0B 4CE9A 3QYYA 3QZ8A 2F96A 1ZBHA 4DLGA 4KV8A 1TKXB 1W9HA 4E7KA 2JEJA 1ZBUA 4CERA 4CJVA 3MXIA 2IM3A 4CJ3A 1RBRA 1RCHA 2XY5A 3K59A 3KNAA 1XR6A 3I5CA 3HVTA 1VSEA 2RN2A 1S6PA 5C5JA 2KZZA 3QIOA 3RAQA 1A5XA 4CFCA 4M3WA 3H98A 1WNSA 4B3OB 1KFSA 4RU9A 4TN2A 2XGPA 1CXQA 1HYSA 3QESA 4G1QA 2QE5A 3KLGB 4ID5A 3DLRA 2G8WA 3RMCA 1S4FA 5KG4A 1T7PA 2ITGA 4BE1A 2WB4A 3GIMA 1QE1A 2RDIA 2ZD1A 4KHMA 4R8UB 5KFUA 5K14B 2IOCA 1U49A 2ATQA 3S3OA 2JEFA 3SYZA 4M3ZA 3KLVA 3CJ4A 3ZCMA 4IFYB 2B43A 4EP5A 4PWDA 4Z4CA 1JLCA 2FLPA 1DTTB 5EU7A 4CJFA 1IG9A 2UVUA 2EC0A 5HROB 3OL7A 2R2SA 1TKZB 3GILA 4RG8A 1LAVA 4ZPBA 1JLEA 4HVJA 1BL3A 2W8LA 1L3VA 1RTIA 2X6SA 2E9RX 3O3FA 3BQ1A 1RT3A 1NK8A 1C2PA 1EX4A 4FLTA 4WYLA 2DPIA 2P5GA 4JS4A 4Q0BB 2BQ3A 1C1BB 2BRLA 3RB3A 4F4XA 4CEDA 5KTQA 1JLBB 4CEZA 1L3UA 4O44B 1IKVB 4JS5A 1N4LA 3PUFA 3KLHB 1T3NA 4IH5A 4DF4A 3MR5A 2YKMB 3I8DA 3CQ8A 1N5YA 3QEIA 3HPGA 1DTQA 5KG6A 3HL8A 3C6UB 4ICLA 4OKJA 4I7FA 3DLKA 4AHVA 3LANA 1UA0A 5KFEA 1XHXA 2BGGA 3E51A 3BQ0A 4E0DA 4XPCA 3EPGA 3NAEA 3G6XA 1WNEA 2KFZA 4Q45A 3BSNA 4NLTA 4K4SA 1Q9YA 1F21A 3VQQA 1RTHB 1S1VB 5DLGA 4FVMA 4KTQA 4OL8A 4RW6A 5KRTA 3GIIA 1RDRA 1LAWA 3SUPA 3RBDA 1RTDA 2KW4A 1VSHA 3OL6A 4ECXA 4GC6A 3LZIA 3MEEB 4M42A 4MFBA 4DS4A 1REVA 1RTJB 3V6DA 2HVHA 2FC0A 1RDDA 4Q43A 3HP6A 1HQEB 1S6QA 3TARA 4ZP6A 1EKEA 3AVKA 4F3OA 3HVAA 4FLWA 3E01B 1QAJA 1S6PB 2I5JA 4N47A 4IR9A 3RR7A 4I2PA 3QEWA 5EWGA 4NYFA 1D9DA 3MEDA 4YMEA 5KG7A 4IDKB 2YNGB 4LH4A 5JS2A 5DG7A 1RYSA 3KLGA 5J2QB 3NL0A 2X78A 1CXUA 4FM1A 2JEIA 3ZSWA 4CF8A 2OPSB 2UUTA 3OHBA 1LWEA 3DM2A 3SFGA 1KLMB 3NGIA 1ZETA 5J1EA 2BANA 3ZSZA 4QWAA 3LDSA 4MQ3A 4ZTJA 4K4UA 2LSNA 4IFYA 2XCPA 4ZVEA 3DDKA 1UWBB 1NJYA 4DU3A 3MF5A 3KJVB 1HMVA 4U7CA 4N76A 3EY1A 5KFGA 2C2DA 5JUMA 3QETA 2OPPA 4KO0A 4GVMA 1EP4A 3SUOA 5F9LA 4W5RA 1S9EA 3Q8PB 3M9OB 1JLEB 4NLRA 3HVRA 1TK0A 4DQPA 4Y2AA 2G8IA 4JV0A 4N5SA 2P51A 2VWKA 5HBMA 5L9XA 1TQLA 2JGUA 5KFNA 3SQ4A 3QGGA 3F9KA 2R7YA 3N6LA 4B8CA 3L3VA 4TSXA 3NH1A 2I1RA 3GQCA 3F73A 4OJRA 5J2NA 4RW8A 2JEGA 2HNZB 3KHRA 1S97A 4F4KA 2IBKA 3ZSRA 4ZP9A 1XR7A 1S1XA 3NGDA 3AVCA 3EZUA 3HKWA 1TL1A 3VQ4A 2W9BA 4LY7A 3MFIA 5CYMA 2AJQA 5KRSA 5I3UB 1LW0B 3EYZA 3TAEA 4KHSA 2BE2B 2IM2A 3NAHA 4PUOA 2RKIA 2GC8A 2FBVA 3QGHA 3DRSB 1B9FA 4O4RA 5KFIA 1IKWB 3HVTB 1NK5A 1LWFB 3AVLA 4CCHA 1VRTB 3LP0B 4B3OA 4EEYA 4CF2A 3SCXA 3D45A 2HNYA 1VK0A 4KAZA 4ED2A 3M9NB 4DSJA 1YT3A 4TQSA 4GW6A 4QWBA 2O4GA 4FLXA 1REVB 1RTJA 4FK0A 4JUZA 5CYQB 2OPQB 1S0MA 2B4JA 3PX4A 4EO6A 2V9WA 1WSHA 2DY4A 1U4BA 3ZSYA 4BWJA 3KK3B 4ZPAA 3PJWA 3L2WA 4ECUA 3AO4A 3L3UA 3ZT4A 4FJHA 2W9AA 2HAIA 3WNHA 1BCMA 4F4YA 1L3SA 4FJ8A 4DTJA 4R5PB 4MKBA 4KTWA 4O3OA 5KFVA 4WZMA 4J2DA 3H4DA 1TK8A 4LSNB 4K4VA 4BDPA 1MU2A 2HHQA 2EHGA 1JLFB 5KFKA 2OPRA 3AVGA 4Y3CA 1DLOA 4I2QB 1WN7A 2D0AA 4FK2A 3VA3A 5C25B 2Y1IA 3LZJA 1RA7A 3BR9A 4KKOA 2ILYA 2FBXA 2QK9A 4FCYA 3UIQA 3LWMA 1S49A 5HRSA 4FM0A 3HK2A 2ASJA 1TVRB 2D0CA 4DTSA 3HSTB 3PW4A 1QS4A 3G10A 1SUQA 5FROA 3UPFA 3U6FA 2VG7B 4ECTA 3OYKA 3KJVA 1TL3B 4Z4GA 1N48A 2OPPB 4CF0A 4CJPA 3T19A 5F8GA 4CEFA 3GIJA 2YNFB 4J2EA 4YR2A 4B9SA 1D0EA 2AGQA 4ED7A 4KREA 3LP2A 3HYFA 3T5LA 3DI6A 4E1MA 1VSJA 4CJQA 3KLIA 1RT2B 3LAMA 5KT6A 5KFFA 3OYLA 5JXSA 4W5OA 5HLFA 3SV4A 3AO2A 2DFFA 1YTAA 4J2AA 1JLQA 3KLEB 3PR5B 2FLNA 1RT7A 2R8JA 4OGEA 2D3ZA 4Y1DA 4J9OA 4ZHRA 1Q9XA 4TLRA 4CF1A 4ZVFA 2IGIA 1W25A 4QW8A 1D9FA 1JXLA 3G6YA 2HVIA 2ZE2A 2F8EX 4CHPA 2P5OA 2Z1JA 4RW6B 1BHLA 4MK8A 4OKKA 3ZSOA 1RTDB 1C0MA 1UA1A 4MKAA 3BSOA 3OYEA 2IDOA 2YHBA 3VQ8A 4CHQA 4J9NA 3M8PB 5CYMB 2DFHA 3DOKA 3UQSA 1HQEA 3RB6A 2ALZA 4DL5A 2WTFA 3PW7A 2HHXA 1S9FA 3WNGA 1I6JA 4CF9A 1HYZA 1SL0A 5FDLB 3E01A 4RNNA 3DRSA 5KFHA 3D5MA 4QWCA 2JC0A 3TAMA 1LWFA 2I5JB 4ELUA 4KFBA 4PY5A 2DTUA 1KHWA 3ZT3A 4N41A 3KTQA 3OS0A 4YFUA 4E89A 3H5XA 3FFIB 1HQUA 3NE6A 1Z26A 3TI0A 4FS1A 5JS1A 4W5QA 3ICLA 4E7LA 2HHTA 1BIZA 4IFVB 4OGCA 5HROA 2EX3A 4E7JA 4NCGA 2UVVA 2ILZA 1KFDA 2PYJA 1VSIA 2BANB 2F8TA 1RNHA 3KK3A 4KE5A 4ELVA 4H4OB 3QLHA 4EZ6A 5KFWA 3ZSVA 2FBTA 3HP9A 1UOCA 3GV8B 1C6VA 2WOMB 2YNIB 1U04A 4QAGA 2J6TA 4KO0B 3NF9A 5DMRA 1RBUA 3NGZA 5DK5A 4CJSA 1JLBA 4OLAA 3ITHB 4RZRA 5KFOA 1MU2B 4Y34A 3ALYA 4NLDA 4E19A 4K4YA 2XRIA 4M45A 4I2QA 1KRPA 2YKMA 4IG3A 5KFTA 4CJKA 4NLOA 3U3GA 4HUFA 4FXDA 5KFLA 4QCLA 3O3HA 3C6UA 3O4NA 3OJSA 4I7FB 1NK0A 3HVWA 4DSLA 3S3NA 3AO5A 4ED8A 4URSA 4WXOA 3U3YA 3V1QA 3IS9A 1FXXA 2E9ZA 1YTUA 3PY8A 3AVIA 2W7PA 3DOLB 4F2SA 4DLEA 1S1XB 1YVFA 3L8BA 4WXWA 3IAYA 1S1VA 3AVNA 3ASMA 2C22A 3JYTA 5I42A 3VN5A 5SZTA 1U45A 3KLIB 1RT2A 4PQUB 1FKOB 1NHUA 3UR0A 3JSMA 3OY9A 4JRQA 2FJVA 3V6DB 4Q5VA 2C28A 3S9HA 4TY8A 1C1CA 1UAXA 4H4MA 1IKWA 1RILA 1IKYB 2W8KA 4GC7A 4KSEB 4JV1A 4CFAA 3V6JA 5HP1A 4RW4B 1X9SA 2VA3A 3VQEA 1NK6A 1IH7A 3T5KA 2VWJA 1QSLA 4CGFA 1LV5A 2KZMA 5D3GA 5EWEA 1HNVB 1HARA 3MEDB 1FK9B 1ZBFA 2FVQA 4JLHA 3MR2A 4CEEA 3DOKB 3BSAA 1RBSA 2O4IA 4FW2A 4EZ9A 5KFSA 2UVWA 3OVNA 4B8AB 5HRPA 3SPZA 1RYRA 3TVKA 1L3TA 4M41A 3DM2B 5HRNA 2NUBA 5J1EB 1RT1B 4NYZA 3TAMB 2VG6A 4J9MA 3H08A 1QSYA 3NBPB 5DLFA 4HCBA 3TQ1A 1JL1A 4CJ4A 3V1RA 4ID1A 2HMIA 4KHNA 2R8IA 1NK4A 4ED6A 1NJXA 3KIOA 1X9WA 3CVKA 1HMVB 1JLFA 2OPRB 4WFZA 3NHGA 3IGVA 4CEAA 2D7SA 4HCCA 2AX0A 4O4GB 4O0JA 4O3RA 4AHTA 3DMJB 1XWLA 3IRXA 3M8SA 3RB4A 1S9EB 2XO7A 4BE0A 5DG8A 3OS2A 4CJLA 2W9CA 1JLGB 4H4OA 1NKCA 3QGIA 4M3YA 3TR8A 4RW7B 3NF7A 1HJRA 1ZBIA 2YNIA 3FQLA 3IG1A 3PVXA 2XC9A 2OZMA 3S3MA 4IG0A 2HHWA 3CM5A 5J2NB 2D5RA 4RW8B 1SV5A 4ZP7A 4NLVA 3OYDA 1X9MA 2YKNB 1TKTA 4O3PA 1KVAA 2GIRA 2D0BA 3LAKA 4CGJA 5T14A 4KHRA 3I0RA 4J9QA 4EBCA 4J9SA 3VQ6A 3H40A 4BWMA 1BQMB 4ZHRB 4IOBA 1RT5B 3CO9A 3D28A 4NLSA 1LW0A 2Z1HA 2RF2A 3L2VA 1KTQA 3ZSXA 3TAFA 2XY7A 4LH5A 4O3SA 4EYIB 4ZP8A 1VRUB 4CIEA 4FJKA 4K4WA 1RDBA 1JKHB 1Y97A 1VRTA 3NAIA 2ZD1B 4R8UA 2J6UA 4CHNA 4CESA 3M8PA 4Z4FA 3KMQA 2HB5A 2HWIA 4KHUA 5KFPA 2HNDB 2V0NA 3ULDA 4OLBA 4CGHA 4AHUA 1NJWA 4E7HA 2HW3A 1JXEA 1S0OA 4BDYA 1TKZA 3T1AA 3QINA 4BACA 3OJUA 5C42B 1N56A 3NMAA 3NFAA 2R2RA 3FFIA 1HQUB 2XY6A 4CEOA 4R0EA 3CDUA 3QERA 5DG9A 2C2EA 4NZ0A 1B92A 4IFVA 4NLXA 5CZ1A 3DLEB 3AV9A 3OYIA 4IKFA 2E6LA 3HJFA 1HRHA 1ZTTA 3SFUA 3QNOA 1BGXT 1DLOB 4WYWA 3MR3A 1IO2A 3AVBA 4FLVA 4DQSA 5C25A 1VSLA 3QIDA 5HRRA 4KKOB 3H5UA 4B08A 3KLHA 2VG6B 2WOMA 4FLYA 5DQGA 5KFAA 3NBPA 4CK2A 3T5HA 3CFPA 5J2PB 1TVRA 4IH6A 1WSFA 2YNHA 4DU4A 1RT4A 3AA4A 5KG1A 2B6AA 4Y1CA 2AQ4A 4ICLB 4MIBA 4RUCA 3CDEA 1HPZB 2R8GA 3OYHA 4LQ9A 4CEQA 3RWUA 3M8RA 2ZKUA 3I0SA 3TAPA 1S1WA 4DTOA 4QWDA 4H8KA 3LPTA 4CJTA 2W9CB 1LW2A 3LALA 4URQU 1W0HA 4FJXA 1B9DA 2V4RA 4FLZA 2BRKA 1RTHA 4DS5A 4DFPA 4LQ3A 4FZXC 3IS9B 2XGQA 3KD1E 3SV3A 5F9NA 1ZYQA 3M8QB 5KFJA 2PY5A 5EDWA 4FJJA 4DMNA 3MEEA 3DOLA 3QIPB 3SI6A 5J2MB 4Z4EA 3K2PA 2ZE2B 4M3RA 1BCOA 4Z4IA 3DLGA 3PR4A 1BIUA 3TANA 1RAJA 3JYTB 5F8HA 5I42B 1KCFA 3GV5B 4PQUA 2BQUA 2AGPA 2G8FA 1C0TA 1BI4A 4CECA 2X6NA 3BSCA 1QQCA 4FBUA 4O5BA 3ZT2A 3I0RB 3OLBA 2IC3A 1EXQA 1SL1A 4DTPA 1RT5A 3QZ7A 4H4MB 1WAFA 1KHVA 4H54A 4XO0A 2JLEA 4IDKA 2YNGA 3C94A 1ASUA 4DSEA 3I5BA 1RA6A 4FJ5A 5FDLA 2HHSA 3HT3A 4FW1A 3PX0A 4KFBB 4CHZA 1TV6B 3A2FA 4WZQA 1J5OB 2DPJA 3QEVA 3HO1A 5KT3A 1HYSB 4CEBA 2KQ2A 1SKWA 3KK1A 1TAQA 3SNNA 2E6MA 2ASLA 4O3QA 3IGNA 3VQSA 3NH0A 3NGYA 4NCBA 1ITGA 5F8IA 1QE1B 1UWBA 4NCAA 1Z4UA 3ZSQA 1QTMA 1T94A 4NCGB 1QSSA 4M95A 1EETA 4FJ9A 4J9RA 2XI2A 1RT1A 1TAUA 4KRFA 1R0AA 1EP4B 4C8KA 1JIHA 4HUGA 3H5YA 4PWDB 2YHAA 3TWHA 4M3XA 5FRNA 2O5DA 1CZBA 3LPUA 4EBEA 3P83D 4ECQA 3K5MA 4IRDA 2W42A 1C1AA 4JV2A 5FRMA 5HBMB 2G8VA 3DLEA 3OS1A 3O3GA 4FS2A 3OL9A 4LD0A 3CJ2A 3G6VA 1JLGA 4IG3B 3V81B 3UDLA 5F8MA 3KHHA 2HNZA 2R8HA 5CY4A 3M9MB 2QV6A 2WONB 2GBZA 1VSDA 4DFMA 1NOZA 3RBEA 3IG1B 5SWMA 3EZ5A 2IAJB 4J9PA 4OPJA 4F50A 1G15A 4KPYA 2WK4A 2W9BB 3K5LA 1JLAB 1HPZA 3RMBA 3DRRB 4GMJB 4QPXA 3PO5A 4FYDA 1SH0A 3I0SB 1U47A 2BE2A 4PUOB 5EWFA 1X1PA 1C0UB 3SZ2A 4B9VA 3RB0A 3B6OA 1BQMA 4FBTA 4DL7A 1FKOA 3LP0A 2QXFA 4BE2A 4G3IA 1QHTA 1KSPA 5KFQA 2B5JA 1S5JA 3L2RA 5KT2A 3KK2B 1VRUA 5DQHA 3V9WA 2CKWA 5J2MA 1WAJA 4DTUA 3EPIA 3V4IB 1NHVA 2A1SA 3ZT0A 4FZYA 3HXMA 4RW4A 1CZ9A 2OA8A 2BQRA 4BDZA 2VG5B 4RW9B 4IBNA 3PW0A 4KB7A 4ZVHA 3DYAA 4IKAA 2ATLA 3RMDA 4DL3A 4KB0A 1TGOA 4OKEA 4YNQA 3K58A 4L8RB 4K4ZA 4FLUA 1S9GA 3NKYA 5F8LA 1D1UA 2P1JA 3IN5A 4FZZA 1K6YA 1TV6A 2QKKA 1N6QA 2FJXA 3L2QA 4O3NA 2OZSA 4FJMA 5L1JA 2AWZA 5EUHA 1HYVA 4F3TA 1A5VA 1VSKA 2XHBA 1TP7A 4HUEA 4J2BA 4K50A 2Z1IA 2OPSA 1SUQB 4O4GA 4CFDA 1KLMA 1TL3A 2BDPA 3V6HA 1D8YA 2QKBA 1SH3A 1ZBLA 3RAXA 2IMWP 4Z0UA 1R0AB 4HKQA 3G86A 4RNOA 2OH2A 5J2PA 3KMSA 3AVFA 1WSJA 4ZVGA 3VQAA 3KHLA 3PX6A 4JRPA 4DWIA 1S1TB 4AHRA 3PV8A 1NJZA 4WE1A 3DRPA 1JL2A 3FDSA 1NKBA 5HLFB 1GX6A 2KFNA 3MXJA 4QW9A 2FVRA 3OHAA 2PYLA 5L1KA 2CJQA 4KI6A 3MEGB 3MECA 1K1QA 4OVLA 3Q8QB 4CJEA 1BQNA 2WCXA 1LW2B 2RDJA 2YKNA 1TKTB 3CYMA 4ECRA 2WONA 4CIFA 3LP1B 1S10A 5KFDA 3OYFA 1NK9A 3M8QA 1HNIB 4NLWA 5C24B 1U09A 4KTZA 2FVCA 1YVUA 3OLAA 4F4WA 2RF2B 5DQIA 3O4QA 4DF8A 2FLLA 1S48A 4CGIA 3RRHA 3LP3A 2OYQA 3OYCA 3MR6A 3T3FA 4AILC 5KFYA 1BI4B 3HM9A 4NRUA 4ECZA 1CSJA 4MK7A 2A1RA 3OL8A 1C0UA 4ED3A 1KLNA 3DLHA 4LSLB 4ED1A 1ASWA 3BGRA 5KG0A 5I3UA 2VA2A 2HNDA 1RDCA 4EO8A 4DQRA 3CDWA 3VQDA 2RKIB 3RTVA 4B9TA 1J53A 3BJYA 1LWCB 5KFBA 1GOCA 2G8UA 2HHUA 4B9MA 5CZ2A 2HNYB 5KGXA 5K14A 4AH9A 3SUQA 4MIAA 3KK1B 4DG1B 3AVHA 3KHGA 1KVBA 3V9SA 2V4QA 2FBYA 4O0IA 4M3TA 1GX5A 2OPQA 3MFHA 2J6SA 3H5SA 1JLCB 2JC1A 3FQKA 2KTQA 1RT6A 1EETB 2RPIA 3TAGA 1NNDA 5F8NA 3H59A 3SJJA 4FJNA 3CIZA 4TY9A 3MXMA 4FM2A 2FVSA 1JX4A 1VSMA 1T03B 4J9KA 2ETJA 4YP3A 3PJXA 3VA0A 3MTKA 3BDPA 1RT3B 4R5PA 5DGAA 4IH7A 1WSEA 3OYGA 2D41A 2R2TA 4UQGA 4ECWA 3AA5X 2B6AB 4Q0BA 4LSNA 3RMAA 2G8HA 3VQ9A 2PZSA 3CJ0A 4CK3A 4NLYA 4E1NA 1K1SA 2X74A 4DSIA 5L1LA 2WHOA 3K5OA 3V9ZA 4YQWA 4CFBA 4O44A 5KFRA 2AGOA 4EYHB 1SL2A 1NK7A 5KT4A 4ELTA 3TAQA 3H2LA 3GYNA 2XY8A 1SH2A 4DL6A 2IAJA 4E7IA 4CHOA 4F4ZA 2FVPA 1DTQB 4Q8EA 2Z1GA 2VG7A 3G0ZA 1JLAA 4CIGA 1SKSA 4WE1B 3DRRA 1FKPB 4CGDA 1S1UA 3HPHA 2YNFA 3JSMB 1IKXA 3QIPA 4MH8A 3NH2A 4RNHA 3HHKA 4TY8B 3DLGB 1C1CB 3VQ7A 3MECB
chains in the Genus database with same CATH superfamily
5L39A 3DI6B 2E9TA 2PAVA 4ECVA 4HDHA 1OS5A 2BOAA 3MWPA 1U6FA 4AUKA 5GAHP 2FGOA 4EU0A 4A8MP 4NLCA 3KLEA 1TKDA 1BISA 1HKBA 5M2RA 4NPOA 5LMNK 4KHPF 4BC5A 4B3TJ 1XNQJ 2GIQA 1FK9A 2HOEA 3JB9k 3CPWR 4ID5B 3PZPA 4NRTA 3J7YI 2EFVA 2CIMA 3CB4A 3V9UA 3AA2A 1Q0NA 1S77D 2Y1JA 4ILLA 3B6PA 2PD1A 4GRSA 4DR4F 5IT9U 2VGMA 5AT1B 4F3QA 4CTAB 3WC2A 2OGUA 2YWFA 2DT9A 4Y2CA 2HFNA 3R2DJ 4L6V3 1KNZA 5GAHU 1NXIA 2A3JA 4CM0A 4Q44A 5J2QA 1WSGA 4HTJA 2ZUGA 1ZAVA 4XIUA 3B54A 2E5LJ 1Q8IA 4CYUA 3K5PA 1N6QB 4PL7A 2AYBA 5KFXA 4I9QA 3Q8SB 1IQZA 1RBVA 1ILYA 4KQZA 3VQ5A 1NKEA 2HK2A 1P6TA 4N56A 2XLJA 3PW2A 4DCPB 3VAHA 5GIOA 1NGCA 4XPEA 2ZM6F 1O6XA 2UXCJ 3AA3A 4EBDA 1NGDA 4TXSA 4B9LA 1U1LA 4HR2A 4URGA 1R3NA 1YXQA 3TW0A 2QYGA 3GCWP 1OO0B 1N5YB 4MO4A 3P45B 3N28A 4NYNA 2W7OA 5LSOA 2DR8A 2Q3SA 5GINA 4LF4F 2I2YA 3PYEA 3IMQJ 3DLKB 5D0EA 1RWWB 2KI2A 3BR8A 3D0PA 3UD4P 3PACA 2ZH5A 1HKCA 5JVGQ 3N9UC 5EX5A 1I5OB 4F0KA 2BJEA 4OMFG 3CFRA 2RRBA 2YWEA 4OJ3A 2PI5A 4HYKA 1FI4A 4CLPA 3KJNB 1WB9A 5DDQC 2C2RA 5F3TA 3V4IA 1RDAA 1HR0J 1XC9A 1WSRA 3O9SA 4IQXA 4CLZA 3BGRB 5GAEU 4U6PA 3VGMA 4ZTFA 2DY1A 5LMNF 4KI4A 4DPTA 4C8NA 2QT7A 3MDQA 2UVRA 1YHQS 2LQBA 2E1CA 4I2PB 2HS3A 1IKYA 1PKUA 3W63A 4TYBA 3H90A 2R7QA 3FVYA 5HJXA 1FDNA 2Q1NA 2YQ3A 1SKUB 3Q8RB 1KVKA 4RR5A 2MLXA 3C6TA 2R2UA 1M1GA 1U48A 4O8KA 3RW7A 2NZTA 4BRAA 4B3SF 3ZT1A 3FSIA 3LH2S 4DQIA 2C2ZB 3OBWA 2Z56B 4B1ZA 4IZ9A 4WIIA 1RUSA 2QEXS 4DUTA 3CCSS 4X2BA 2AX1A 3CJRA 2GTDA 2UUWA 1QVFM 5J1NA 4OJ1A 4FJIA 2K3KA 4RNMA 5KGWA 4DEZA 3MN5A 3TVYA 2PMHA 4OZNA 1ATSA 4O5FA 3U02A 3JTNA 2M4MA 2A3ZA 4Z4HA 4K5SA 4DU1A 3CUNA 4FJ7A 2IFXA 3CCTA 3N6NA 5KG5A 4PKIA 2E4LA 3DMJA 3K57A 4AHCA 3G25A 3I5AA 4C8ZA 4CWBA 2AEMA 2CUYA 3BQ2A 4A47A 2V68A 1KP6A 3OYJA 1QAIA 5E3RA 2QWQA 4RPFA 1DQAA 1VC0A 3LP2B 4M63A 4KAIA 3I9ZA 2D1KA 1O8BA 1C0TB 1VJWA 5KFMA 3OYNA 3VQCA 1X60A 2E1PA 2BJ8A 3FZ2A 4ILHA 2KFYA 1W9HA 4HLBA 2J76E 4BRLA 2VPWB 2D3O1 4DV6F 1P27B 4FKXA 2XSFA 2B9EA 2R7OA 1RBRA 4USKA 1RCHA 1E6VB 3HVTA 3CJSA 1M90T 5C5JA 4LF6J 1RDWX 2KZZA 3JXUA 3QIOA 4FVUA 3HZ6A 3LDLA 3H98A 4M3WA 4GVBA 1RHRB 2XM3A 3IAS9 3E8OA 2KYXA 3QESA 4G1QA 3RMCA 1UVLA 1SJQA 5EVZA 2ITGA 1RAIB 2RDIA 3GTYX 1M90O 5K14B 5LMUK 1S4EA 3CETA 2ATQA 1CJKB 2JEFA 2XWXA 1N32F 4M3ZA 4EMDA 3HF5A 2YWWA 3CCLN 2B43A 5GAEP 1JLCA 3OTOK 3MM8A 5EU7A 1AYEA 2MKSA 1EQMA 3W64A 4R0JA 3I56N 3AA9A 1J5EF 5D4PA 4QU6A 2ZH4A 1TKZB 2C1EB 2AJ4A 3M6XA 3AAWB 3HOSA 2ROPA 3O3FA 5A8RB 3U9DA 2MKJA 4WYLA 4B1YB 2DPIA 3OW2M 1YJ9N 4X4UA 1C1BB 3M7VA 2WW4A 3OVSA 4DR5K 2NRWA 2G1DA 4CEZA 2RHKA 4D3HA 2D74B 4O44B 1N4LA 3PUFA 2O8FB 1T3NA 3W5XA 4DF4A 1FKAF 4NA2A 5IT9Y 1TUWA 1NPKA 3HPGA 5KG6A 3HL8A 4NL5A 4ICLA 4I7FA 4PKDB 2UXBJ 1DY3A 1UA0A 1XHXA 1AW0A 2W24A 1UEUA 2RQKA 2HF4A 4XPCA 1OY9A 4NZ7A 2DR7A 1HFEL 4Q45A 4KGZB 2Z4PA 4JB8B 3HLUA 3JAMY 1Q9YA 1F21A 3MMCA 2HVZA 2QA4N 2DBBA 4MTPA 1U8WA 3SEOA 3GE9A 3OW2R 1RTHB 4OL8A 2RHSB 3SUPA 3JSYA 4ECXA 3C16A 3HSGA 1A6LA 1EIYB 3MUMP 1RDDA 2OEMA 2POKA 2UXCK 3HHLA 1IWAA 1GLEG 1HQEB 3PJ9A 3MCPA 5B09A 1EKEA 5BRFA 4BQLA 3HVAA 1B70B 4KHPJ 3HT0A 2ZH3A 1S6PB 4ZCKA 3MM9B 4DCHA 3MX2A 1XUPO 1FVQA 3PFEA 4NYFA 5KPTA 2ZM6K 3MEDA 2IDLA 4YMEA 3M2RA 1RYSA 2MJUA 3KLGA 4PG5A 4FYYB 4FM1A 2A2CA 1TELA 4K59A 2V8VA 2VICA 4CZKA 3OHBA 1NDKA 1V5IB 1WC4A 1KLMB 1E6YB 5J1EA 2VPXB 2BANA 1NM2A 3N5FA 2F4VJ 1ATRA 5FPDA 4JD2B 3UDVA 3CCJN 1UWBB 1FWKA 5E3AA 2CZ4A 2F5GA 1DJ0A 4LRDA 2IVPA 3A0IX 4DU3A 4B3RK 1HMVA 4N76A 5KFGA 3KUGA 5JUMA 2OPPA 4PZVA 3D1QA 3MPDA 5IZHA 2CH5A 3Q8PB 1JLEB 2CQ2A 3M1VA 3W60A 1M5PC 4Y2AA 4DQPA 4F0HA 1VQ7S 4N5SA 2UYTA 5AQMA 1FHTA 1NMNA 5HBMA 2JGUA 5KFNA 2KXFA 4UY8O 2MB0B 2DNYA 4WQ5A 1W7WA 1WACA 4B8CA 4KBOA 4LR7A 1V6HA 1RADB 2DH8A 3GQCA 4RW8A 2JEGA 1S97A 2DXEA 3SLCA 1AXQA 2CZVC 3EZUA 1MN7A 4ZJQA 1JNRB 4FOIA 2QWPA 4DV7F 4Z7CA 1PIEA 2F8MA 2JDJA 3TAEA 4KHSA 4PUOA 2BE7D 2OFGX 2RUGA 2MQQA 4H5TA 5GADU 3DRSB 3D6RA 1VQNS 2ZH8A 1LWFB 1AFJA 3QDKA 3SCXA 1VK0A 1TZ0A 1WWHA 4W4MA 2LXIA 1YT3A 2F7VA 4EWTA 8ATCB 4QWBA 1OSDA 2OD4A 3G87A 4HEA9 4CLWA 4CLTA 4FLXA 3PIOL 1JWWA 2OPQB 1NGJA 4GO7X 3JQMA 1Z05A 2KH9A 3CC7S 2W7AA 2P9KB 2V9WA 2WSCC 1WSHA 3M2UB 4FNHA 3UR3C 3AO4A 1CC8A 1CLFA 3QGPA 4JI8J 2V52B 5D8HB 4BRNA 4F4YA 4ZKAA 2DNQA 2CWXA 2OSQA 3NNHA 1XNRF 4MKBA 2HHHJ 4JI3J 1ZA1B 2VV5A 4WZMA 1S5ZA 4NZ6A 4J2DA 3H4DA 4LSNB 3TR5A 4BDPA 4OX6A 3AVGA 3UDEA 1RAFB 3IAM9 2CAJA 1KD1O 3DLLL 2VIHA 4M7XA 3NOCA 2ILYA 2FBXA 2QK9A 4A2BA 1SJ3P 3DXKA 4FM0A 4DX6A 2D0CA 4DTSA 1N0UA 5T7LA 4DR6K 3HSTB 1SUQA 1YIJN 2ACMA 3OYKA 4ECTA 4Z4GA 4WCEQ 1VI7A 3PRDA 4CF0A 3D1HA 4LFCJ 4CEFA 4J90A 4LVNP 2YNFB 1K8AT 1A0OB 4ED7A 2H3GX 4OZ2A 3TTCA 3T5LA 3DI6A 2D4WA 3KLIA 2GCFA 2BA9A 5KFFA 4UW2A 2DFFA 3KLEB 1WHWA 3PR5B 1YBAA 1E4FT 4OGEA 1ELOA 4LF8F 3AGKA 3FBBA 1W25A 3WEEA 3G6YA 2ZE2A 2Q43A 2KG1A 4DHVA 5HATA 1XBWA 1BHLA 2VUGA 3QBCA 1RTDB 2IPOB 1TL7B 2DO0A 4MKAA 4CT9A 3C3LA 4BR2A 2GQCA 2O8DB 2GWJA 1WDDA 3DXSX 2OKQA 1BWEA 3EUNA 1P1TA 1MMNA 1F0XA 2HFSA 2DD8S 2DFHA 4TKTA 3VZIA 4WK1A 3B78A 1S9FA 3CJKB 3KG1A 4A2AA 3R8EA 1HYZA 2PGCA 3TSPA 2A18A 3E01A 5JLFA 3TAMA 2Y8WA 3OFHA 4AXJA 4ELUA 2YY3A 3ZNJ1 3LDQA 1KHWA 1T3OA 2F65A 3KTQA 2HS4A 1RU2A 4YFUA 4JI8F 4IO8A 1QJHA 1VQOS 4GKJK 1HQUA 1BO5O 4OZ3A 3TI0A 1Z26A 2VBWA 4W5QA 3AXKA 2HHTA 5EX0A 4ISGA 1BIZA 4IFVB 1LK5A 4OGCA 5HROA 1N33J 3HOTA 2ILZA 4AQYF 1RFQA 1VSIA 3LDNA 2F8TA 5AZJA 3KK3A 1NDCA 1NBEB 3AY9A 5A8WA 3MXHP 2BKPA 4ETZA 5B0BA 2WOMB 2YNIB 1X4EA 3THYA 4H5NA 5D77A 3NF9A 2A2DA 1RBUA 1L3KA 3QT8A 3AQOA 4WJBA 4CD3A 1XC3A 3ZLJA 2G0JA 5KFOA 4WPAA 4Y34A 5K9FA 1YQHA 2YKMA 4IG3A 1X7VA 2EKYA 5KFTA 4UOHA 3IUCA 3ZX2A 3MI7X 4TNOA 4X66F 4OI3A 4ED8A 3WDOA 4WXOA 1XQSC 4CZIA 2OI2A 1GNKA 3V1QA 2OTJN 3IS9A 3VAGA 4HHJA 3DRYA 3T6BA 3PY8A 2QI2A 3UVJA 1S1XB 3ATVA 5BYQA 3KXDA 4DV7J 1PC5A 2MQMA 2X7IA 4PWUA 3CCUN 1WF0A 3OXFA 4DUZK 1T9UA 5SZTA 3NNAA 1RT2A 3Q83A 3AA8A 5M1QA 3A5NC 4Q5VA 4TY8A 4MYUA 4LFBF 1WI6A 4H4MA 2RSQA 3L7UA 1O0PA 1QAYA 2MPUA 1IKYB 2W8KA 2J8SA 1NJIO 2XMKA 4RW4B 2NREA 4LF2A 3VQEA 2HRUA 1IH7A 7FDRA 2BKOA 3VEXA 2WTUA 4JV5F 3DXMB 5D3GA 3CCSN 2Z57B 3MR2A 3DOKB 3BSAA 5G0RB 1IBLK 2BH1A 4EZ9A 1WDTA 5KFSA 3OVNA 3D6FB 1RYRA 3TVKA 5IOLA 5M1OA 5JVHQ 1IJFB 2IMOA 4J9MA 3QB0A 3NBPB 4DDFA 3CF5Q 1RWNB 2EPIA 4C7QA 1UVNA 1UL3A 2NLXA 1X5SA 4JAXA 4JOUA 1RHMB 2DR6A 3IGVA 4CEAA 2D7SA 1DURA 1OVYA 4HCCA 3I55S 4H0OA 4O0JA 1ESVA 3DMJB 1T9XA 3WQUA 4L72B 1R8BA 2XO7A 3N4QA 3W9HA 3OS2A 1U1KA 2E66A 1BDGA 3QGIA 4IOAL 3NCRA 3AD9C 5IT4A 4DR7K 1ITPA 4USVA 3IG1A 4PG8A 3MHYA 1UFWA 1HI0P 2KHCA 4ZA1A 3S3MA 3CM5A 2D5RA 2F9WA 2OJ3A 3HFZB 4FDFA 2YKNB 1KVAA 2MZTA 4B1UB 2XS7A 3HSCA 3T41A 2B8PA 3ZC4A 1RZMA 4EBCA 3H40A 4JNEA 4ZHRB 3CO9A 2R7RA 4NLSA 2BZ2A 2IRYA 2QA2A 3LDPA 4FWMA 2HURA 3TAFA 4O3SA 1OYEA 4HHHA 2CQDA 3DGVA 4EAHD 3C7NA 2VODA 1T02A 1ROFA 1RDBA 1JKHB 4QS7A 1Y97A 1VRTA 1R0CB 1H73A 1T0TV 2LMIA 1RLDA 4CESA 4CHNA 5D78A 4G1PA 2CGJA 1K8KA 1CJKA 2BJ9A 4CM2A 4JK9A 3AT1B 3DFEA 4UTGA 2YWGA 4UZBA 2OEJA 1GLFO 3MN6A 2V0NA 1Q18A 7FD1A 5AQYA 2B4PA 1ZM3A 1X0FA 2PE8A 4CGHA 2HW3A 1OH8A 3G6ES 3EN9A 5BR8K 4BDYA 3BS9A 1TKZA 3CC2N 4I6MB 4BACA 1Y4ZB 2PDAA 5C42B 3AJ2A 1BE4A 3MN7A 3PIOQ 3NMAA 1U02A 3B6BA 4C3MA 1B92A 3R9LA 3BGFA 3CCMN 1KTVA 3AV9A 4IKFA 3LL3A 4B3MK 1GT8A 2V7ZA 2ROEA 1FRLA 2E6LA 2GVZA 3SFUA 1HRHA 3QNOA 2DNLA 4FF2A 2Q79A 1DLOB 2DVIA 5HQMA 3AVBA 1RAHB 4FLVA 4L74A 3QIDA 4B08A 2VG6B 3SMZA 2KT2A 2GS8A 4FLYA 5KFAA 3H46O 2HRYA 2YKOA 4OYAA 3IFEA 1UP1A 4CK2A 3T5HA 5HK4A 3CFPA 1Q53A 5J2PB 4G1IA 4DU4A 1RT4A 3AA4A 1BA1A 3MCAB 4Y1CA 4ICLB 2E1ZA 2UZAA 1HPZB 2BX6A 3OYHA 5KPZA 3MMAB 3MPWA 3J81U 2LQ8A 4BRHA 3I0SA 3TAPA 1S1WA 5HQLA 1MW7A 3QMQA 3LPTA 4JBCA 1OQ3A 3I87A 4WFNQ 4OYPA 2W9CB 3GYGA 3LALA 3MAHA 2WUSA 5LMUF 2NXCA 3AHPA 1W0HA 1B9DA 1UJ4A 1RTHA 4P72A 1RHKB 5AXMA 5LJWA 4LF1A 3OXGA 3P8BB 3J81j 3C14A 1ZYQA 3C6AA 5JVHL 2AJ0A 4F4AA 2CDRB 5J2MB 3DHXA 3CJ8A 2OHDA 3DLGA 2E44A 3PR4A 2GELA 3TANA 1V9OA 4OPAA 3JYTB 4ENOA 2BQUA 2G8FA 1BI4A 2X3DA 2XQCA 2X6NA 3BSCA 4FBUA 2Z2MA 4PG4A 2V69A 1SL1A 1EXQA 4DV6J 2HVDA 3SBTA 4JKEA 2W25A 1KHVA 5IM0B 3LPEA 4JI5F 2JLEA 3TUJC 1FD2A 1ASUA 5FDLA 3HT3A 4W92B 2W2MP 1NMDA 3VF2A 1TV6B 4CHZA 3G8QA 4DV2K 2DPJA 1H2UX 1HYSB 1YWXA 1ZZNA 3N79A 4I1TA 5FPEA 5C12A 3VHQA 3POTB 2MQPA 2EKNA 3VQSA 4NCBA 5F8IA 4M5MA 1QE1B 1UWBA 2HHPA 3UN3A 3WXKA 4NCAA 1Z4UA 3DGPA 2CNOB 4CZLA 1QSSA 4HT7A 2K8GA 1R0AA 2BABA 4BREA 2QYCA 2HKEA 3M1FA 1LEOA 4OX8A 4PWDB 1I1GA 3TWHA 5EX3A 4LF4J 4C1NK 4JKGB 2W42A 5AQGA 1C1AA 3R5JB 5HBMB 1IQTA 3HJVA 3BZKA 3BPSP 3DLEA 3O3GA 2U1AA 4FS2A 5CHIA 1CJVA 2E5GA 3D6TB 5ETVA 1S6UA 2NRVA 5MLCQ 1HR0K 2DRAA 3OR2B 4C97A 2C2MB 3VEOA 1X4AA 2HBQB 5CY4A 1VSDA 4DFMA 1RABB 2W40A 1NOZA 2ZFHA 3MTJA 2W6LA 4M8LA 2LDYA 4CZFA 3EZ5A 4Z37A 5M2PA 4DR3J 4FXVA 3MPVA 3K5LA 4LR9A 3I55N 4ZOSA 3PTWA 3PO5A 4FF3A 1SH0A 4PUOB 5EWFA 4OPHA 1X1PA 2B4VA 3D67A 4B9VA 4E8UA 4K41A 1BQMA 3G82B 4FBTA 4C11B 3J8AA 3J7AP 1NUEA 1F5BA 3AB2B 1XJWB 1ZAWA 2APOA 2R7VA 1D4XA 1ZA2B 5K5MA 4G6VB 2AT1B 1VRUA 5DQHA 4DTUA 2C2OB 2J0QD 3NWGA 3V4IB 4B3SJ 5DJBA 4LBPA 3T1YJ 5DDOC 1KQFB 1CJUB 5AE1A 5HI7A 1FDDA 5K8PA 5B08A 3GFHA 4ZVHA 4L73A 4BR9A 1TGOA 2ZZMA 2HHHF 1D3WA 2C3UA 4K4ZA 1T9TA 4QIVA 4FLUA 2EWHA 3C66A 5F0XA 1HHTP 2CQ0A 2ZC3A 4UOCA 4CYUB 3HFVA 3NWRA 1N6QA 3OR1B 1G1XA 5ADXA 1B4SA 4YS2A 1M5HA 5TKYA 2HS0A 1TP7A 4NEYA 1QVFR 1KQKA 5T7LB 2CPFA 2OPSA 1SUQB 1MMDA 1DARA 4J37A 3V6HA 1HNWF 2IMWP 4PWWA 4YB5A 2M0GB 2M7SA 3SQGA 3KMSA 1GTHA 4DV1K 2AA4A 3I4HX 4QIEA 1XK8A 1WSJA 4DR2J 4YEAA 3QSIA 4YB6A 4DWIA 1EJ7L 4WE1A 4YOVA 2FIUA 1JL2A 3RG6A 4BHQA 1RU1A 3MXJA 3I6PA 2PYLA 3CJ9A 5BN9A 2M70A 4OZJA 4A61A 4OYOA 5HVGA 3MECA 2ZBRA 1DHMA 4K0KF 8AT1B 3AOCA 2AW0A 1U6ZA 4QOTA 5ETTA 3C15B 1QHAA 3TU5A 3CYMA 4PEOA 3JS6A 1G6BA 1XNRK 2OAUA 4CDIA 3GWCA 1S10A 5KFDA 3RU0A 2UXDJ 5C24B 2IBOA 4FPIA 3KUEA 2WAQD 3O4QA 5CABA 1WI8A 5A2QU 4BR5A 4DF8A 3CC4N 4CGIA 1YJWS 2ASMA 1TFWA 3LP3A 2OYQA 3UKUA 3MR6A 5L9NA 4I64A 5KFYA 1UJ5A 3HM9A 3CJ7A 4NRUA 3FBFA 1C0UA 3F5TA 4LSLB 2X1FA 1TYQB 3BGRA 2O67A 4ZVTB 2CRLA 2CYYA 4GVBB 5KG0A 3J81Y 1OY8A 3UCUP 4KGKA 1RDCA 3SMSA 2RKIB 3VQDA 2HQ3A 1J53A 1NB2A 2E1MC 2EWSA 1VR6A 1XMQF 2G8UA 3KUHA 2HHUA 3VOVA 3OBIA 5HAOA 5K14A 4MIAA 2P9SA 1X3MA 4A62A 2BTFA 1VQ9N 4UY8T 1ZXOA 4O0IA 1J5EJ 5A8WB 3L3CA 1GX5A 2J6SA 1JLCB 2ZF5O 4LF7K 1EETB 2HBRB 3U1NA 3EDQB 3CIZA 5BPLA 3MXMA 5AFUH 4NA3A 1RWMB 4FM2A 4JI1F 3PDNA 1VSMA 9ATCB 2ETJA 3S7RA 4R5PA 5BRHA 1B0TA 3OYGA 4CJ7A 3FNNA 1R6YA 2R2TA 1G4CA 2QLXA 4ZLJA 2NRTA 4QR1A 2LFVA 3AA5X 2B6AB 3D2EA 3UN2A 3VQ9A 4E2FB 2E1YA 2VOOA 3O9TA 1N33K 4NLYA 1K1SA 4LFAF 4USTA 2RE2A 2WHOA 3GG0A 2CGLA 4ES2A 4O44A 3Q2SC 1SL2A 4CVNE 4BR0A 5KT4A 1AZSB 1HBUA 1B7FA 2XY8A 1SH2A 2MKCA 2IAJA 4E7IA 2FVPA 4JI6J 5ETSA 3Q8UA 4IOAQ 2IYIA 4P73A 4YY3F 2Z1GA 4GV3A 4DV3J 3I32A 4DV4J 3ADAC 3C65A 1JLAA 4JI5K 2BJ1A 4DR2F 4JKBA 4I4BA 3HPHA 1SI9A 2C3PA 4XH4A 4MH8A 2C3OA 3FJ2A 4J7CA 4TY8B 4AFFA 4ATNA 3MOJB 3FR0A 1EX8A 4AL7A 3BH6B 1BQNB 2IJNA 3CDBA 4AQYK 4KB1A 4LFBK 1MROA 4KH6A 1IM4A 2GUIA 3ONQA 4DPXA 3UD3P 1E6VA 2EXUA 2F9JA 2F8HA 3KK2A 1Y5IB 3W2VA 4PQAA 5D3GB 3WNEA 2C2KB 4K43A 3BREA 3AJDA 4G1QB 1GMVA 3VEWA 1KC8O 4XTTA 2A0FB 4DX8H 4RW9A 2O8BA 4A8OA 2E1RA 3VQBA 5F8JA 3E66A 4ZPCA 2MDAA 1L5UA 4FL9A 3K5NA 1CLQA 1KAYA 2QSWA 5I4MA 1A5WA 2U2FA 3M2RB 3KOAA 1WTFA 1SC1B 2BE9B 2Z30B 3CPEA 1X5PA 2ZQBA 3OPKA 3R6MA 4DN9A 1RAEB 3DOMA 3PW5A 5E41A 1ZPVA 3SPYA 3KKRA 4JP8A 1VJQA 4NLPA 5A8RA 1Y5LB 2GJIA 1IBLJ 4IRKA 3CD5A 2E8AA 1C1BA 1R6VA 3OSPA 3J80Y 3V1OA 3OFEA 2G8KA 5L1IA 2FPHX 4FK4A 1WLJA 1XR5A 3QLHB 4RNFA 5GMEA 1K8AO 5AE2A 3WBZA 2QWOA 4IJNA 3HI0A 3DRPB 4MDAA 5D6GA 4Q8FA 4JV5K 4IUFA 2XCAA 3CJTA 3VGUA 3MM6A 4ITSA 4C0HA 1N5SA 4CZHA 2XMAA 4CIOA 1GQEA 4ZJLA 3C46A 5BXIA 2AF6A 4AF1A 1SIZA 3W2WB 4ECSA 3QRPA 3FMWA 3HTVA 2Z58B 3GV7B 3IWNC 4XDDA 1KEKA 2J7WA 3PHTA 1JKHA 1HNIA 1S12A 3SCKE 3SI8A 4ZMMA 1N0VC 4DL2A 2GEMA 3R3LA 4KRWA 2XTJP 3C16B 4JHDB 3W8GA 4OV1A 4DQQA 4AXIA 4DR1K 1RLCL 4CP5A 5KG2A 3GIKA 2H1YA 3J81O 5C15A 2FHOB 3CW2C 4C8OA 1Z25A 4K4XA 2R8KA 2FZKB 3BYPA 4F8RA 5C42A 5E3PA 2JSXA 2DFEA 1DTTA 2E2OA 2JLGA 1QZ6A 4CO3A 1WSIA 2IRUA 1Q82O 3C2PA 3OYBA 2ZVIA 1G3OA 4NLUA 1TL4A 3BBCA 1RCOB 2IJFA 1NM1A 2KDOA 3T5JA 3CM6A 3ETOA 4CJWA 3ZNUA 2NYHA 2GAHC 1B99A 2RH3A 4M7YA 3ZTSA 2QFIA 2RS8A 3F0NA 5HANA 3AVAA 2VKZG 1NPRA 1FERA 1J9AA 2QA4S 4DL4A 4JD2A 4NA1A 5KOWA 2KRBA 4LIWA 4PA1A 3Q0AA 5AQOA 3EZOA 4B9UA 1RT4B 3T69A 5HN0A 3CWJA 4GKJF 3KD5E 2HFOA 3I31A 1S1WB 4DOZA 1ZTWA 3NS5A 1H6KX 1VYAA 2BACA 4CJ5A 2OP5A 2FY8A 3ENQA 3BH7B 2GHPA 2D0OA 2DNNA 2P9PA 1FJGK 4JI7J 3V9XA 4USHA 3O5BA 1I39A 3ISND 1FXDA 2DTJA 3QEXA 3RRGA 2KB2A 5CYJA 2O8CA 2XNQA 1N5VA 1U2FA 1WF1A 1W2BM 3EGZA 1A7GE 4DFKA 2WVFA 3R3TA 3SQ2A 3PKYA 3AO3A 1S6OA 2ZC4A 3C95A 4CJUA 5G4DA 2QC3A 1HL6A 2BEFA 5CAAA 4IG0B 3LO3A 3QYYA 4CE9A 5L46A 2F96A 2P9LA 2OTLN 1TKXB 1HPMA 4JI2J 4E7KA 1SAZA 2JHEA 1O13A 4WWSA 2WVDA 4CJVA 3MXIA 2IM3A 4CJ3A 2OUGA 2XY5A 1VSEA 2RN2A 3RAQA 1V3SA 1UWAA 5BR8J 4RU9A 2XGPA 1HYSA 1MDUB 2KM8C 4IO1A 4OZ1A 3EL2A 1QD1A 1URRA 1KONA 2G8WA 1S4FA 1BD6A 4BRGA 4BE1A 3GIMA 1QE1A 4GKJJ 2QM1A 2ZD1A 3DNCA 3VMFB 4UOGA 5KFUA 2P9KA 1B0PA 4B3MJ 3SYZA 4MJKA 4DXLA 1FNOA 4IFYB 1VQ6N 5GIPA 2HBZB 4PWDA 1IBKJ 1X5TA 2FLPA 3CJQA 1TUVA 4ANDA 5JVGL 1YLXA 5HROB 3MAAB 2W2OP 3UO0A 3SK3A 1LK7A 4RG8A 3GPAA 4FWPA 1AT1B 4OYBA 1TU0B 1UVKA 2W8LA 1L3VA 2E9RX 1EX4A 3W8PA 2PIIA 1JJ4A 2HLTA 3GB0A 4RLEA 3TO8A 4JKDA 4JS4A 2BQ3A 4DB3A 2BRLA 3RB3A 2CFXA 4F4XA 3UNGC 1YJVA 5KTQA 1GLAG 3QRRA 2P9UB 5EY4A 1IKVB 4JS5A 2ERRA 3GOIA 4IH5A 1R89A 2YKMB 3MUVP 3K9KA 3VGKA 6FDRA 5LOQA 4ZN3A 1UZDA 1ACMB 4OKJA 4AHVA 5LXYA 2MZSA 3E51A 3BQ0A 4G65A 4E0DA 1Y9OA 3EPGA 2NR0A 1M0SA 4LRAA 1F9FA 1R8PA 3BSNA 5IV4A 1HNXK 3WEEB 5AR0A 2QLFB 4BRCA 4TU7A 5A2QO 2IYGA 3E3XA 3VAFA 4FVMA 4FWQA 3R1XA 3RBDA 1D9AA 1RTDA 1X5OA 4YB1P 2CQCA 4M42A 3OQ2A 4MFBA 4ILJA 1RTJB 4O23A 2FC0A 5IV3A 3HP6A 5SUHA 3TARA 5CE3A 1WG5A 5E7OB 2DCLA 4CH7A 4U9RA 2DGUA 1S7HA 3E01B 1QAJA 1UPPA 2H54B 3KNGA 1GXTA 5ETOA 4N47A 1YBUA 3RR7A 3F2KA 1HLWA 1V5VA 3OR1A 5KG7A 1SZ2A 4H0XB 5JS2A 1JJCB 5LSRA 3M8YA 1Y11A 3SAHA 4UF4A 2D0PA 2P9EA 1CXUA 1NSQA 3ZSWA 4CF8A 2OPSB 2UUTA 3PEHA 2PT0A 1BC6A 3NGIA 1ZETA 3BN4A 2YPZA 4PPDA 5B0EA 3AOAA 3U1LA 2R9LA 3CXCR 4E1JA 2MKIA 4K4UA 3FRYA 2LSNA 3CGIA 5TKWA 3W3SA 4ZPTR 2BW2A 2FUG9 1Q78A 2HQIA 3EXYA 2C2DA 4GVMA 3GCXP 2ZZTA 3SUOA 3GR1A 2VYPA 4BR7A 5F9LA 2RB7A 2GMJA 2QTDA 3Q8VA 1SB6A 4N77A 3MX5A 2C2NA 2RJZA 3BPDA 2P51A 2VWKA 1UCNA 2X1GA 3DAWA 3ZTRA 3S1TA 5H1SV 2OO4A 1UVJA 2B9XA 3N6LA 4TSXA 4V19J 2I1RA 3MCNA 4OJRA 5ETRA 1EARA 3KHRA 2N4CA 4OZ0A 3BKFA 2GAGC 4ZP9A 5K8NA 1S1XA 5AJ3K 1AROP 3MCSA 3X1LB 2B8QA 3RAMA 1MSWD 4AT1B 2W9BA 4BG8A 3IBCB 2LU1A 2AJQA 4H0TB 4OX9J 1Y64A 5KRSA 2OCEA 4H4KA 1NO8A 5MLCV 2BE2B 3BO2A 4BR4A 3KG4A 2PA3A 2RKIA 2FBVA 5J1PA 3L4IA 1YGYA 2EK1A 3QGHA 5KFIA 4O4RA 5H1SQ 3MPUB 4CO2A 3D0GE 3MMCB 4JK8A 4ZVPB 4M5KA 1VRTB 3K2YA 4YDUA 3D45A 4KAZA 1O51A 3M9NB 4LC9B 1SBRA 4DSJA 2BJ7A 4AYBD 3DXMA 2P9GA 1VFJA 2FHKA 4IOXA 4FK0A 2ABYA 4JUZA 5CYQB 2YH0A 2VOPA 3ZSYA 3ZZPA 2K7JA 2RT3A 2F1FA 4CH1A 4I6MA 4USMA 4I6AA 3IDHA 1RWKB 1RBAA 2HAIA 5M1NA 2DGVA 2P2CB 3P38A 3LQVA 4TU8A 2UP1A 4FJ8A 1XIQA 5HJYA 3JTPA 1KVJA 4DTJA 5HSPA 4R5PB 4KTWA 5KFVA 4FN5A 4OQJA 2DH7A 1F2GA 4XAKA 2J9DA 1WC0A 2HHQA 2CPDA 4Y3CA 1DLOA 4I2QB 2D0AA 2QO3A 4EI2A 3FCVA 3VA3A 3BUZB 1GLBG 3BR9A 1E6YA 2LEAA 4QU7A 5JICA 1GAOA 1VAZA 4IYQA 2ASJA 1HNXJ 3HK2A 1IR2A 2F40A 3PW4A 3G10A 1LWXA 4P2XA 1N88A 3V4MA 1N48A 2DY9A 2OPPB 5F8GA 2C3MA 2LKZA 4OX7A 4B9SA 4ZVRB 4MIWA 2BW7A 2A40A 3MUTP 1VSJA 4CJQA 1F6TA 1BXNA 3D3BJ 5KAKA 5JXSA 3M6GA 3A13A 3SV4A 4WFAQ 4JI5J 4YORA 1YTAA 4J2AA 4WF9L 1RT7A 4J9OA 4ZHRA 3R5GA 3A8JA 4TLRA 4ZVFA 3RUBL 2QL9B 1D9FA 2DNZA 1RWXB 2DNHA 2F8EX 4JKHA 1JJ2R 4ED4A 4CHPA 2Z1JA 2GX8A 4KHPK 4RW6B 4O0NA 1SC4B 1RAAB 2J0SD 3BSOA 2YHBA 4CHQA 4CBUA 2ALZA 3PW7A 2HHXA 1DGKN 2FB0A 1FJGJ 1SC3B 1WHXA 2RQMA 2V2KA 1SL0A 5FDLB 3FZMA 3DRSA 5KFHA 1BWFO 2JC0A 4OYIA 1LWFA 3HBTA 3DOMB 5E26A 2E5HA 4CZMA 4DR5F 3I82A 1VHIA 3DXBA 3NE6A 2QMXA 2VBXA 1AA1B 2RQ4A 3DGPB 2UVVA 3LM2A 3MGJA 5CD4H 2VU5A 2LA6A 2GVZB 2LU2A 4KE5A 3M2UA 4JYAK 4ELVA 2KXHA 3D1OA 2ZJRL 2NXNA 3QLHA 5KFWA 4A8KA 3E2EA 4C0OC 1U04A 5KQDA 2QL5B 2J6TA 4KO0B 3GG1A 5DMRA 3NGZA 4EIAA 2FTRA 2GMHA 3PRVA 5C2CA 1HNXF 4OLAA 4J5OA 4B02A 2VQFJ 2XMWA 4NLDA 3CCVS 3DWLA 3PCOB 1KRPA 4CJKA 2L48A 2RS2A 4OJHA 3C6UA 4MMOA 5GMKa 4OV6A 3HVWA 2IVNA 1M5OC 1UTAA 4X4VA 5LXRA 3VVTA 3HHDA 1VHFA 4JI6F 1P8ZA 1ZZFA 2E9ZA 2KN4A 4P2MA 4F2SA 1YX2A 1Q5VA 4FYXB 2Z0GA 2UXCF 3Q23A 2CG4A 3AVNA 2C22A 3G6EN 3JYTA 3VN5A 3VF4A 3KLIB 1YDLA 3AODA 2E2NA 2E7XA 4FP9A 4P9SA 1C0FA 3JSMA 2UUBF 4JKAA 2FJVA 1RHUB 1C1CA 1VBZA 1FWPA 2CZ9A 5GADI 1IKWA 3CCWA 2NXUA 4CQ1A 3O08A 1TR0A 5IM0A 1K73T 4KSEB 1YRTA 2BVZA 3V6JA 5HP1A 4OI6A 3H3OB 1P90A 1F60B 2VWJA 3TZWA 1GXLA 1TL7A 1IR1A 3TA1A 2JFKA 2J8AA 2V8DA 3FZHA 4JI4F 4X64F 4C0BA 2UUCJ 3THPA 4PCQA 5ITHA 2VFRA 1ZBSA 1SQEA 2LXUA 2UVWA 2EFOA 1YSJA 4DV5F 3M05A 4ANCA 2NUBA 3MD3A 3QT5A 4ERDA 4NYZA 3TAMB 2QIFA 1RHQB 1U26A 2ZJQQ 2CPYA 3IC1A 2HMIA 2WVBA 2RU3A 1Y3JA 4ALZA 4ED6A 2XYPB 4JKGA 2HZAA 2YX4A 2ZWPA 3EE8A 4X4OA 4AHTA 1UVMA 2MQLA 1XWLA 1P9QC 2HIYA 1S9EB 4WKRA 2FC9A 5AXLA 2HGMA 1OWXA 1WC5A 1HJRA 3D54A 3VAIA 2YNIA 2RNEA 9RUBA 1YI2N 3NRBA 1FESA 1DAXA 2KYZA 2XEXA 3VV2B 4BVOA 3G71S 4DX7A 4IG0A 2OANA 5J2NB 1NGHA 2H5JB 1SJ1A 5CA5A 2CPJA 4NASA 5GAHI 5FPMA 1PYTA 1Q7LB 2GIRA 2VDHA 2XMVA 3ZEUA 3A5OC 5KOXA 3Q8YA 5EGYA 3I0RA 4J9SA 3VQ6A 1RBOB 1BQMB 1RT5B 4C11A 1XMOK 2MYFA 3HSJA 4YDUC 1LW0A 3ULEA 3ZSXA 2XY7A 3RVCA 4M63C 2VZ9A 5D4NA 1VRUB 3UVJB 4RBUA 2KHDA 1U0HB 2ZD1B 3ZZTA 1DZ5A 2J6UA 3SCIE 4QYRA 6FD1A 1ICEB 2DH9A 2PMZD 5AFUA 2PI4A 2B7CB 2ZOGA 3ULDA 1VQ8S 4HDGA 3FCWA 4CLSA 3HM8A 4DR7F 4E7HA 4RL1A 1VQNN 3R6LB 4FF1A 3MAAA 1NGAA 1PG5B 4DV7K 2G0CA 3T1AA 2NQPA 4MO5A 2EVZA 4NXNK 2NUHA 2XYGB 2XY6A 4CEOA 5DG9A 2ZZNA 4H5VA 4LF6F 4NLXA 2QN6B 1UEKA 3OYIA 3R5AA 4DR6F 4QS8A 4OYZA 4C8YA 2GHVC 5CZVA 2Z2LA 1BGXT 3CCRN 1IO2A 2P9UA 3IRWP 2G0IA 4DQSA 5C25A 1VSLA 4KKOB 3ID6A 3NGSA 1BA0A 4BRIA 4LF9K 2CWKA 3A3PB 4OLPA 3M6UA 2JL9A 2YJFA 3NBPA 3ZX3A 5E2QA 3M8WA 3P6YC 1YJRA 1TVRA 4IH6A 1WSFA 4GKKF 2I7PA 1OPIA 2B6AA 3D2EB 2AQ4A 4RUCA 4CLKA 3CQYA 4LQ9A 4CEQA 4IO9Q 3VAKA 1Y00A 3QFPA 3M8RA 4LRBA 4H8KA 3ILJA 3PIPQ 4YY3J 3BBBA 3SDEA 2BOPA 3ENBA 3J7ZO 4FJXA 1Q7YT 3O8MA 4RO0A 4DS5A 4DFPA 1I94K 2UV8A 1VMBA 3A3NB 4BCAA 2JWKA 5AQTA 3SV3A 5F9NA 3H8YA 1RWUA 2BYCA 5EDWA 4MLEA 3DOLA 4U67L 4Z4EA 5AQWA 1BCOA 1TL5A 1K47A 1BIUA 2OELA 5F8HA 5I42B 1KCFA 2QMWA 1PJ6A 1P9YA 5HMWA 3GFZA 4CECA 5K20B 3UKRA 3Q2TC 4NMXA 1MROB 3ZT2A 2NNWA 3OLBA 2IC3A 3IBFB 1G99A 3LPYA 1TYQA 4XH5A 1WAFA 1MWKA 1XNQK 4X4TA 3CNQP 2J7UA 3IWXA 3A2FA 4WZQA 3G9CA 2DNRA 5IT0A 3A8YA 1TAQA 1J27A 4ED5A 3IGNA 5AJ3J 2YWHA 3UFCX 3AGRA 1HKGA 2IJRA 1QTMA 3ZSQA 1T94A 3DRXA 4ILMA 4M95A 1KQSM 1EETA 2Q6BA 2PMWA 1RJJA 5AQIA 1BG3A 1CQNA 2ZJQL 4JI3K 2CJ9A 3FFKB 2YHAA 3M30A 3QJPA 1IBLF 4UZCA 5FRNA 3HX9A 3HRGA 3TUIC 4OYXA 2O66A 3LPUA 4EBEA 3Q24A 1FJEB 1FX2A 3CXCM 4JV2A 1EB0A 2GV1A 3FZLA 4J8FA 3MM7B 2LQJA 3R9PA 3QWPA 4LD0A 3S8SA 4LF9F 1JLGA 3O9QA 5IWAF 4DCOB 4LF5F 3EE9A 3KHHA 2A42A 2J9EA 2GBZA 4WP3A 3ZZZA 2E20A 4C2MA 5SWMA 2IAJB 4DQ8A 3L95X 4YOEA 3P39A 4F50A 5EOYA 2WK4A 2W9BB 1JLAB 4FSVA 4GV6A 1HPZA 2HBYB 4ZK7M 2GIFA 4QPXA 1PCAA 3NG8A 4K8RA 2GUPA 1YF5L 3TUPA 3I0SB 1U47A 2BE2A 1CULA 2F7TA 1NSPA 3W2WA 2FSNA 3JTOA 4BGBA 3SZ2A 2LQ5A 3EGVA 4DPYA 3RB0A 1U1OA 2D9PA 3SSSA 2DNPA 1FDAA 4DL7A 3W65A 4DR4K 2QXFA 2LEBA 1QHTA 4DHYA 1KSPA 5KFQA 1KWMA 1S5JA 1U6BA 5K8MA 5I9EB 3L2RA 5KT2A 3KK2B 2UUAK 3A8IA 1B0VA 2J0WA 3V9WA 5J2MA 1FF2A 1T11A 2YTCA 4FZYA 2WBMA 2ZEJA 1CZ9A 1WF2A 3J80U 2OA8A 4BDZA 4RW9B 2O8BB 4U7UK 3WQPA 1NRKA 1HR0F 3ENVA 3RMDA 1FW6A 1ZM9A 2K1RB 4YNQA 4X65F 4L8RB 1U1MA 3IMXA 5F8LA 4HH0A 2MLYA 3NCPA 3WX8A 1T6CA 2CJYB 3QPIA 2ZGYA 3HDSA 1TV6A 4ZVUB 3H0PA 2AWZA 1HYVA 4NMLA 4F3TA 1VSKA 4D3GA 1KC8T 4HUEA 3KK7A 4J2BA 1PBUA 2Z1IA 3TJAA 4O4GA 1RBLA 4CFDA 4LIRA 3TWZA 5HL7L 2K2PA 1KAXA 1ZBLA 3W0LA 3RAXA 1GTEA 4Y2MA 4Z0UA 1R0AB 3BZCA 3J7Z5 2OH2A 2QL7B 4NEZA 4ZVGA 3PX6A 3KWGA 3A5LC 4AHRA 1NJZA 5C0YA 2OLWA 3DRPA 2P9PB 3FDSA 2ZHBA 2EI5A 2MEWA 1UMJA 1NKBA 1GX6A 2KFNA 3N4PA 3GP9A 3AB4B 5L1KA 2BJ3A 2DNMA 4DR3F 3DLJA 3R5DA 1MA9B 4WU2A 3OFGA 3CC4S 4K0KK 4ECRA 3P49B 5ELZA 3MURP 3M8QA 1HNIB 4NLWA 3P4UB 4KTZA 2WBRA 4I56A 2PO4A 3OLAA 2F9TA 2FLLA 1S48A 4OI4A 1WOSA 3T3FA 2CPHA 4NXNF 2MTLA 4ECZA 1U1NA 1IXKA 1CSJA 2R3VA 2A1RA 2MKKA 4DX5A 4ED3A 2BMBA 1Q95G 1S3XA 2AV5A 5FPNA 4B3MF 5I3UA 4HTIA 4JKFA 4KH0B 2P6TA 4USIA 1PGZA 2HQDA 2M9KA 3J7YP 4X4QA 3H2UB 2DKOB 1WJ9A 3ULHA 1IBKF 3BJYA 1LWCB 4Y6IA 5KFBA 3TSUA 2NRHA 3P5BP 2VH7A 1GOCA 4C9DA 5AQLA 2YHXA 2JWLA 2HNYB 2ZKTA 1W2BR 3KK1B 3GBTA 4DG1B 3GZ7A 3OUYA 1WEYA 2XG8A 2MSSA 3VESA 4WFNL 4I69A 1Q7YO 2IVMA 1JCFA 4PKHA 5AQRA 4YDXA 2CJKA 5F8NA 3H59A 4BRPA 1SPBP 3QJJA 4FWNA 3BF1A 2O01C 2XB2D 3N0VA 3R5CA 3VA0A 3MTKA 3EZWA 1UETA 5DGAA 3FLCO 3AXMA 2CADA 2VONA 4RJVA 3RMAA 4BS2A 2PZSA 1GXUA 1K0TA 2SXLA 3QFWA 4E1NA 3W5ZA 3NLCA 1D09B 5AXKA 4CFBA 3NY0A 5H9EJ 1VCTA 1NK7A 2O8CB 3D4JA 4RWTA 1VQPN 1LQ9A 3TAQA 4AQYJ 1DT9A 2BKNA 1N54B 1NMEB 3SQGB 4CHOA 3CEDA 1Q81O 3W7BA 3CO0P 2VG7A 2ZJPQ 2BUPA 4WE1B 3DRRA 4L3NA 3C0BA 4AM7A 2N82B 4K0KJ 2M5YA 3JSMB 2LQ9A 3QIPA 3JQKA 3GYXB 3GJTB 2CJXB 2L9WA 1C1CB 2EBEA 3HD1A 3MECB 2F63A 5A2QY 1TKXA 1N8RT 3C15A 4BRDA 4I6YA 5HP1B 2GV9A 3OA9A 1M1KT 4JI0K 1JLQB 2K7KA 4U67Q 3QNNA 4JI2F 1D5AA 4CO1A 4DR6J 3P5JA 3AO1A 5H9FK 5C24A 4TLQA 4DSKA 3S41A 4CGGA 4CJRA 4MFBB 4Y28C 3NCIA 4F2RA 2HAFA 4OIXA 3WQTA 3SQ0A 4BGAA 3CCEN 3IR6B 3CCLS 4FWRA 2DYAA 2VG5A 2QLJB 2QA1A 3D2FB 4NB4A 1J5OA 4EP4A 4ECYA 2E88A 4LSLA 5A8KA 2VPYB 3ZX0A 1S9GB 4KHYA 3LW5C 3FK4A 5GVQA 3R1LA 3KLFA 4QOZB 1WOQA 2HMIB 5B8HA 2MHEA 4LFCK 2JX2A 2RMLA 4OFZA 4F04B 3K7RA 3BY5A 1H2VZ 1T05A 4P75A 3WXJA 4P71A 4AE5A 3BEXA 4B17A 5DRKA 2BXJA 3BDEA 1HD1A 4M5HA 4DV1J 2Y1RI 1MWYA 1T9WA 3PYGA 4ED0A 1I3AA 2CJAA 1KXPA 3THVA 2RIJA 3SCLE 2DISA 4JI7K 1ZM2A 5K8OA 2H4WB 2V4JA 5JJBA 4K8ZA 4NLQA 3TABA 2F3JA 1T8EA 3LWLA 3L6QA 2H65B 4ISEA 4M94A 3V81A 2R7SA 1FJCA 1IKVA 3UI3A 3NEKA 5GMDA 4HHTA 3QBWA 1E4GT 3QO9A 3TEGA 1LNQA 3U27A 3OFFA 3US5A 5KI6A 5EN1A 5IQ6A 1U1PA 3ZEUB 4KHWA 1WOOA 2ZJRQ 4GVEA 3VTHA 2DIVA 3OYMA 3ITHA 1S72N 2HK3A 1WKLA 1GK8A 4KV8B 2RILA 5HMXA 4FJLA 2A6OA 3ULEB 2JVRA 3HD2A 2NXJA 3FRZA 3QEPA 2IM1A 1AZSA 3U1MA 1K9MO 1R31A 4B3SK 1U0HA 5D4LA 5FLXU 3ZO7A 1OIAA 5C2FA 4WFXA 4C6AA 3J7ZT 5CCMA 1N36K 1RXOB 4WFYA 3CMQA 4FKYA 2MZ1A 2DITA 1DBDA 2BR0A 3R1HA 1NH7A 2EG1A 5L8RC 4L3KA 1YBTA 3SUNA 1XTZA 3RSEA 1JXBA 5FD1A 4TYAA 1V4TA 3I33A 1YJNN 4ANEA 4M3UA 1YJWN 3PO4A 2AYGA 3KYLA 3DDIA 4YR3A 1DQ8A 3CCMS 1UW9A 1QUVA 2D3UA 4CNYA 2WZ1A 4HTUA 1NPPA 4QIFA 3DYAB 3Q7BA 4HH1A 1FX4A 2B9WA 3W2VB 2CPEA 1HNZF 1LOUA 5CYQA 1VGYA 1FNXH 1LXJA 2XS5A 2HF3A 4NLBA 1KOOA 4DTXA 2Q1LA 4JK7A 5CR4A 1HIYA 3TPQA 4CHYA 4ZDNA 5GAEI 1QLNA 3K8WA 3KKSA 1Q8BA 1OSCA 1HNVA 2NRZA 4RUAA 5KT7A 4LBHA 3WZ0A 1RT6B 5E0OA 3MAQA 2YPYA 2IY5B 3NVKA 4PG6A 4C8MA 4Y0WA 1NOYA 2ATCB 2H9ZA 1VSFA 4YR0A 1H2TZ 3LOUA 2WSEC 1O1WA 2IM0A 1KN6A 4ZLNA 3HPOA 3TJ9A 1T9VA 3U7JA 3QATA 2E5IA 3SDEB 4FJGA 3VQPA 1UW4A 4QR2A 3H3NO 2IDEA 3WXMB 2X1BA 2FHJA 2FD2A 2HFUA 3D7SB 3RR8A 3CQXA 4RWXA 1NB7A 1SKRA 4TQRA 4JN4A 3QAEA 2QX0A 1VQ4S 4RW7A 1FTRA 1G7CB 4J9LA 2IA6A 1P8GA 2DR9A 2XWYA 1J5EK 1FKPA 1LCUA 5LJ5Y 1S1UB 5F0WA 2VWBA 4OPKA 3UKRB 1IKXB 3OTOF 4ZCLA 1RT7B 2IC3B 1QDUB 1DKGD 3MM6B 1ZBHA 2HEKA 3CCUS 4YY3K 2HFZA 3W5YA 5A76A 1RAOA 3G4SS 2P8IA 1IBKK 1ZBUA 4BRQA 1FO1A 2Y3YA 4L76A 3OTCA 4OX9F 3MMBB 2LCWA 1Y7PA 4YHHF 2WFBA 1A5XA 4CFCA 2BBEA 1WNSA 4FYVB 1KFSA 1C0GA 3HHNB 4TN2A 1DFDA 4M5DA 4F0MA 5HVFA 4V19X 4K2XA 1ZPWX 3DLRA 3WIVA 1T7PA 4JHDA 3VERA 3BGOP 5ETQA 2AIRB 2YX1A 4R8UB 3ZZOA 1YJNS 1U49A 3M4XA 3CJ1A 4LR8A 3ZCMA 2HG4A 2XLIA 4EP5A 1KS2A 4Z4CA 3M30B 1DTTB 5LL6d 4KH1B 4CJFA 2DHHA 4P7VA 3CERA 5AQSA 1J2VA 3WIUA 4ZPBA 3EMTA 4HVJA 1U8SA 1EHWA 1BL3A 1RTIA 2X6SA 3BQ1A 5DZ6A 4F3MA 1NK8A 1VHXA 5B0DA 1BHNA 4KC5A 1NGGA 4KJIA 3OTBA 2JFDA 2WW8A 2AHOB 4OHVA 1UKUA 2RAQA 4WF9Q 4WP9A 4PXEA 3UW1A 3UD5A 4OHWA 2HWTA 4LUBA 1VQPS 4GV9A 3KLHB 2CQGA 1SC6A 1ATNA 2FQQB 5F41A 3DCAA 4J91A 2DGWA 3I8DA 3CQ8A 2EG2A 3QEIA 3WHIA 1NU0A 1CQMA 3C6UB 2V9KA 3LANA 3GJSB 5KFEA 4WQ5C 2AP6A 5KPRA 2IVFB 3THXA 3NAEA 3G6XA 1T3VA 2QLBB 2KFZA 2KXNB 5M1KA 2ZH7A 5AQQA 1X4FA 4NLTA 1AB8A 5JLHA 3G8SA 1H74A 3KZBA 5LSLA 2KRRA 4UY85 5DLGA 3A5MC 1RWVB 4KTQA 4RW6A 1PYSB 2KW4A 1FFGB 3LZIA 2FSKA 3MEEB 1REVA 3FBEA 4DZ6A 2C42A 2HVHA 2QJ3A 4Q43A 2P9LB 4L3QA 4BQZA 1S6QA 2EK6A 1YRXA 2GW8A 4F3OA 3AVKA 3M2VA 2JZ5A 2L08A 2XSJA 3P3DA 4IR9A 1NDPA 1YIJS 3ZZRA 3QEWA 5EWGA 5E3QA 4YHHJ 4IDKB 4LH4A 5DG7A 3NL0A 4FWKA 2G4BA 4BC9A 3CMAS 4DR1F 3U8XA 1EQYA 1LWEA 3ZSZA 1WC6A 3TOQA 2IIRA 4MQ3A 2YKQA 4B3RF 4IFYA 2XCPA 1R8AA 1JJHA 2B7BB 2ROGA 1M5SA 2RVJA 3K0SA 2Z2YB 3MF5A 3KJVB 4QBUA 3ENOA 4EHTA 2UUCF 3EY1A 2B4OA 1U1QA 4DV1F 2VKRA 4KO0A 1SIWB 1RACB 1B3TA 1EP4A 2YH1A 4MDBA 4Z7YA 1GLJO 1S9EA 3M9OB 3E9LA 4NLRA 2NSBA 1TK0A 1YZ7A 4H4KC 3OV7A 3M8ZA 3CD6S 1S79A 3CCRS 4ES3A 3CF5L 4DUZF 3NS6A 4LF5J 5L9XA 5B0GA 4EGLA 2WVCA 2R7YA 5ADZA 4FZVA 1VQ4N 3L3VA 3H42A 3ZXWA 2LXFA 3F73A 5J2NA 2HNZB 1R7IA 4F4KA 2DPNA 2RD5C 5ETMA 3ZSRA 3ILOA 1EKSA 3GJRB 3NGDA 3AVCA 2ZH6A 3CCQS 1HI8A 3ATUA 1Q86T 1TL1A 3MFIA 3VGSA 5CYMA 4HVZA 5I3UB 1LW0B 1EAYC 3U9ZA 2IM2A 3NAHA 2H51B 5LT5A 5EHHA 5JMNA 3RBZA 3FE1A 1B9FA 1IKWB 3AVLA 4WQ4C 1RTZA 3VCDA 1WC3A 4CCHA 1M1KO 4B3OA 3BB5A 2HNYA 1HWKA 4ED2A 2FGCA 3SAGA 4AD6A 2NRRA 4TQSA 4GW6A 3PG9A 2O4GA 4C1NI 1KR4A 4DU8A 3BN7A 3EKUA 2B4UA 1RTJA 1WUUA 4X4NA 1S0MA 2QSFA 4EO6A 2Q97A 3TX0A 2I7NA 3IM8A 4BWJA 4ZPAA 4LT6A 5U47A 3IWLA 2GWKA 3FGVA 4LRFA 1L3SA 1H3DA 4HHUA 4N8OA 4O3OA 1RCXB 4AM6A 3D3CJ 1P1LA 3SIPB 5F1XA 1MU2A 2EHGA 5KFKA 3MN9A 3MOZA 1T95A 4F67A 4FK2A 2ASOA 1Z1ZA 5C25B 3THTA 1RA7A 2M8HA 4KKOA 3CHWA 3JSBA 3UIQA 2GZOA 3QFHA 1S49A 5HRSA 3K0JA 2M88A 1X0PA 1TVRB 2WB1D 4YB7A 1VQMS 2KJWA 1RP5A 3MMVA 4N8NA 1YZ6A 3UPFA 1NLKL 4ISFA 3H25A 2VG7B 2W2QP 1TL3B 1I94J 4CJPA 4R25A 1FTCA 1Z2ZA 2AGQA 2MKYA 2GVDA 1SQGA 2W41A 4KREA 2DO4A 4ZN1A 5IFMA 1CEZA 1RISA 5KT6A 4GMKA 3OYLA 4QIWD 4W5OA 5HLFA 1HWLA 2OFHX 3FC9A 1JLQA 4FOEA 2A6AA 4FXWA 2FLNA 4DI6A 1NLVA 1N52B 1S59A 3TA0A 2FJDB 4QW8A 1JXLA 3J7A1 1Q4RA 4CZJA 2HVIA 2I6WA 4NXMF 1IBMK 2P5OA 2QFJA 4OKKA 2MY8A 2HGLA 2ZITA 5MAOA 3ZSOA 1N32J 3ZETA 1FT8A 2I9SA 2XULA 3VQ8A 3O3LA 2PA8D 3ID8A 4DV3F 3RB6A 4DL5A 2WTFA 5A6PA 3WNGA 3F56A 4CF9A 1N36J 1K73O 4QWCA 4DV4K 1W26A 2QEXN 2OTJS 2I5JB 2DTUA 2OIHA 1ZC6A 4PRFA 3ZT3A 4FWOA 4WU3A 3H5XA 2DGSA 3PEJA 3CCJS 5JS1A 4E7LA 3D0HE 3HI9A 4OX9K 4JI8K 2V8HA 2CQBA 2EX3A 2BM1A 1KFDA 5DM6Q 4C3KA 1YUWA 3CMAN 3SCJE 3VWSA 1RNHA 4P6QA 1WOPA 2Y9HA 1OMSA 4H4OB 4DV0J 5FIIA 1WBBA 4MKYA 4CT8A 3ZSVA 2FBTA 3HP9A 1IJJA 1UOCA 3GV8B 1AUSL 3T9ZA 5CHCB 4QAGA 2XMJA 2RHQB 4A5AA 2UU9J 4U96A 3MM7A 1JLBA 1TUUA 1BQXA 1PAEX 3ITHB 4RZRA 3EVMA 3ALYA 2FY1A 4E19A 3P4IA 1URNA 2MQ8A 2XRIA 4M45A 4I2QA 2V63A 2FYXA 2PFUA 1RHJB 3N01A 1RAGB 2XZDB 2L9NA 1GEHA 4M5NA 4NLOA 4X66K 3A12A 1EWRA 3OJSA 2DEJA 4DSLA 2FC8A 2VASA 2JJ4D 3AO5A 1LKZA 5F2RA 3SBMA 1HJOA 1FXXA 3AJ1A 1FXLA 1IJEB 3AVIA 1WG1A 4LREA 2I8EA 3RRKA 2W7PA 3DOLB 3T6JA 1N36F 1T6DA 3CJAA 1CULB 1YVFA 3L8BA 3LDOA 3B8HA 3GU0A 4ZVQB 1S1VA 5M2UA 3ASMA 2NZ4A 5I42A 4B1VA 3H6EA 1QVGR 1SJFA 3UN5A 4M1KA 3OY9A 2MLZA 3V6DB 3S9HA 2VFTA 2E1AA 4ZJOA 5CQGA 3L4QA 4CH0S 2GFFA 2D9OA 3HZGA 3L7PA 4JV1A 4CFAA 1T9YA 3T5KA 4U8YA 1QSLA 4CGFA 2AZ1A 4H03B 1LV5A 1XN9A 2KZMA 2E7VA 4WTYA 1HNVB 1HARA 2DGTA 3T7ZA 1ZBFA 3T1YF 4A59A 3JS9A 4K25A 4CEEA 5BRDA 4Q2MA 2MZRA 5M1PA 5HRPA 3SPZA 3HFKA 1AUDA 4M41A 3VETA 3PLAA 3DM2B 1Q81T 1W2IA 5AQVA 2KU7A 4HWIA 3GMGA 1QSYA 2ZBIA 5DLFA 4HCBA 3I56S 3GG4A 3TQ1A 1JL1A 3V1RA 4FYWB 4ID1A 1UEVA 2R8IA 3KIOA 3MD1A 4JI7F 4X65J 1JLFA 2OPRB 3NHGA 4JI1J 2AX0A 2EEYA 2HSEB 2E5LF 4O4GB 2LYVA 2BV3A 3IRXA 3M32A 4NI2A 4K7QA 1HWUA 4RU2A 4BE0A 3OTDA 5DG8A 1HKAA 3JXOA 1U0SA