1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
4BACA 4K8ZA 2VG6A 4F2SA 4RZRA 3GILA 4MIBA 5J1EB 5KFTA 4HUGA 4RNHA 1S0NA 3GIKA 1KSPA 4O44B 3HPOA 1T05B 4R0EA 1Q9YA 4KHSA 3AVMA 3OYCA 2WB4A 3LAKA 4KHQA 3CJ0A 4R5PA 2YKMB 1S0OA 2YNGA 5KFKA 3H2LA 1C0TA 4OPJA 4M42A 1GOAA 2JEJA 3FSIA 5HRNA 3O4NA 4URSA 4YMEA 3DMJA 4YR0A 2IAJA 3PV8A 1IKXA 1RT5A 2HHUA 4TY9A 2XC9A 3MR3A 4O3OA 4E19A 4CGHA 3RR7A 3MEDA 4ED7A 3DI6B 4AHCA 1RBSA 2WCXA 3QZ8A 1RBTA 4DLGA 1NK8A 3NH2A 2XHBA 3NH1A 2OPRB 1HARA 4FLYA 4EP4A 3QEPA 3MECB 4DL7A 5KRTA 3IG1A 3V9SA 2Z1GA 5KGXA 3H5XA 4DF8A 4FLTA 5KT3A 3L2VA 2GUIA 3KHRA 1WSHA 1CSJA 4OJRA 4K50A 4CIGA 3BGRB 4KHRA 3KNAA 3OLAA 4ECUA 3IS9A 3PW4A 4DQQA 3MFHA 4NCGA 3UQSA 2KZMA 3V6KA 3GIMA 5KT5A 4E7JA 1JLBA 3SV4A 3U3YA 1D8YA 4OKJA 5KFXA 4IFYA 1BHLA 3QZ7A 2G8FA 4DFJA 4UQGA 1WLJA 1JLQA 3QIOA 2IC3A 4MIAA 3BSOA 1VSDA 5KT6A 5F9NA 4KRFA 3KK1A 2HHWA 3KOAA 4PA1A 1IKVB 3O3GA 4FZYA 4DTSA 4ID5A 3KTQA 1DTTA 2OPQB 4ZP7A 3DLHA 2QXFA 3HVRA 4HHTA 4CFCA 3AVGA 3RR8A 4CGDA 4B08A 4C8NA 1VSMA 2R8JA 5KFYA 4K4VA 5FDLB 1SKSA 5HP1B 3LP1B 3MF5A 4IG3A 4QW8A 4IKAA 4F4XA 1XI1A 3PW0A 5HROA 4JLHA 1T03B 4QW9A 3TANA 4O4GA 1NJYA 5KFQA 3V81A 4U7CA 2BRLA 3AA2A 3DLKA 3ZT1A 3SI6A 4KO0A 2V4QA 4RNOA 2ALZA 4O3NA 1S4FA 3L2QA 3PJWA 1VSHA 3SNNA 2AGOA 4FS1A 1CXUA 5L1JA 3QGIA 1HNVA 4ECVA 4K4ZA 4E1MA 4FW2A 4W5TA 4B9VA 3QERA 4DLEA 3DOLA 4Z4HA 4EP5A 3ZT2A 2OPPB 4BE0A 3SI8A 1SUQB 4ZHRB 1RT3B 5I3UA 3QEIA 1S1XA 1NK6A 1HRHA 3H4BA 4FJ7A 4ZP8A 3DRPA 3BSAA 5FRMA 2HHVA 4Y1DA 2W7PA 1CXQA 3DYAA 1JLAB 1S1UA 1KFSA 3NF9A 3AA5X 5CYQA 4FJMA 1RT6A 1S9EA 1SV5A 3OHAA 4Y3CA 2HWHA 3KLVA 3QYYA 1RDAA 3BREA 3OJSA 4CF8A 3KLEA 1NK0A 3H98A 4RW8B 3JSMA 4O3RA 4FYDA 4J9SA 1TGOA 2FVSA 3KJVA 3OS0A 4EO8A 4F4WA 3QEVA 1LWFB 4B9SA 4F2RA 1KFDA 4DU3A 1XR5A 1IH7A 1NJWA 2VA2A 2JGUA 1TKTB 3TAMA 3AVKA 4KREA 4KHUA 4K4YA 2R8HA 1RT7A 1SH2A 2FLPA 5EWEA 4GC6A 3C95A 1JLGB 5C42A 2IOCA 5J2QA 1BGXT 2O5DA 4CHQA 2R2RA 3OY9A 4RNFA 4W5NA 5JS1A 3SPYA 3QGGA 5HLFA 1S9GA 1JLFB 4CGFA 3G6YA 3QEWA 2C2RA 3S3NA 1TL3B 3V1OA 3G10A 5D3GA 5F8JA 4FCYA 3KHHA 1RILA 3RMAA 1IG9A 4WFXA 1S97A 4YQWA 2FLNA 1EETA 1YVUA 4AHSA 3CWJA 4IFVA 1HQUA 5L1KA 1RBRA 2C28A 2EC0A 3QINA 2Z1HA 2JLEA 4FM1A 5L1LA 1KVCA 2D0BA 3K5MA 1RYSA 3NGIA 2IGIA 2A1RA 1S1VB 3RWUA 1WSJA 2GC8A 2FC0A 3QLHA 3AO5A 4KSEB 2QK9A 2D41A 4Z4GA 2AGQA 4EBCA 4AILC 4DEZA 2B5JA 2C2DA 2VG5A 2HMIA 5KTQA 1IKYB 3AVFA 3V9WA 1EP4A 5EDWA 4M45A 4J2AA 2X78A 4N56A 3HT3A 3HKWA 3AVAA 1DTQA 1LV5A 2VA3A 4CF9A 3H5UA 3MXMA 2HNDA 3VQQA 3OYAA 3TAPA 1N6QB 2YKNB 3NAEA 3T1AA 1U4BA 2XGPA 3LWLA 2B6AA 5HRPA 1BIUA 2ILYA 4RW4A 3RRHA 4NLUA 5J2NA 1UA1A 1REVA 4I2QA 3EPIA 4QWCA 2KTQA 4FS2A 3GYNA 4F3OA 3FRZA 3PY8A 3AVLA 4H4OB 1R0AA 1NJXA 3V4IB 3CFRA 4FJ9A 2IM0A 2QKKA 4ECWA 4OGEA 3UR0A 4XPCA 3M9OB 3FFIB 5FROA 4E7LA 1K1SA 4BWJA 1RT2B 4NLQA 1QE1A 3V6DB 3HHKA 3SJJA 1S48A 1IKWB 2RKIA 2G8VA 3AVNA 2D5RA 3OSPA 4O0JA 2W7OA 1N5YB 3RBEA 4B9UA 4H4MB 4RG8A 1ASWA 3PZPA 3KK2B 4FJ8A 2UUTA 1TVRB 4MFBB 4ZVHA 4ECTA 4BDYA 3PW5A 1HJRA 3ZSWA 5KG1A 4N76A 4ZPCA 4ECZA 4DSLA 4EZ6A 1RT1A 3KHGA 2OH2A 3GV8B 4Q8FA 2J6SA 1S9FA 4JRPA 4ZTFA 5KT2A 1BL3A 2DFEA 5EUHA 2XI2A 3ZT4A 4DF4A 1SL1A 3JYTA 1MU2A 1NNDA 1NHVA 4ECXA 3FQKA 2D3ZA 1XR7A 3RMBA 1TV6A 3P1GA 4N5SA 5F9LA 3VQPA 2VWJA 4B9MA 2HB5A 3CVKA 3RAQA 3TQ1A 1A5WA 2O4IA 2BRKA 2IDOA 4QWEA 3KD1E 1HPZA 5KFJA 2G8UA 1C0MA 1CZBA 1Z4UA 3SQ0A 4IRCA 4YR3A 4M3RA 2J6TA 3DRRA 2IAJB 3OL7A 1IKXB 1LWCA 4IDKA 1BQMB 4FK4A 3I8DA 2Z1JA 3V1QA 1RTDA 3SQ1A 1KVAA 4DSJA 5DG9A 2RF2A 5T7BA 1UWBB 4KI4A 4Q0BA 4PQUB 4O3SA 3KLFB 3HVTA 4RW6A 2WHOA 1KLNA 5I42A 4B9NA 1W0HA 2RDIA 4CJKA 1QTMA 3LDSA 3SPZA 2XY5A 5KFRA 2YV0X 2JEIA 2O4GA 4FJLA 3DLGB 4KHYA 3NAHA 4TQSA 3AVCA 1SL0A 3GQCA 3H5SA 3I5BA 5DQHA 1VSJA 3VQ6A 4KTWA 4O5BA 1S6QA 2C22A 2RN2A 1C6VA 4DTUA 4F50A 2FJXA 4ZVEA 3NMAA 1NKCA 4KKOB 1B92A 1KVBA 3D5MA 4QWDA 1Q9XA 4NLGA 4G1QA 1K6YA 2Y1IA 4J9RA 2WONA 4IFYB 4OL8A 2W9BA 4CK3A 2G8KA 4EBEA 2ZE2B 2V0NA 3ZSQA 3TR8A 4PUOA 1I3AA 3VQEA 5F8IA 3NGDA 3ASMA 1JLQB 3T5KA 2EHGA 4CEFA 2IC3B 4DSEA 3G0ZA 4WYWA 4KAZA 4Y1CA 4LH4A 1NKBA 2AX1A 2PY5A 3M8PB 4CEZA 3RMCA 1NOZA 5KFPA 3OYFA 3SYZA 2D3UA 1I6JA 1U04A 2OZSA 3K58A 1X1PA 4KV8B 1RTIB 3E01B 2JEGA 3TARA 3CM6A 1HYSA 4MH8A 4TY8B 1K1QA 3CJ3A 1HQEA 5CY4A 3EYZA 4DFPA 1I39A 1FXXA 2BQ3A 1RTJB 2XCAA 1JLCB 4JS4A 2AWZA 1XC9A 3Q8QB 3LP0A 4PY5A 4DG1A 4RW9A 4KB1A 4KTQA 2AQ4A 4ELUA 4NLRA 4WXWA 3LANA 5KFVA 4B3OA 5F8GA 4CFDA 1RDRA 4ED3A 3PVXA 2E9RX 4O4GB 3ZSZA 2OPSA 4Q43A 5K14A 4DL2A 4Q5VA 4CJTA 2HVHA 4I9QA 4KO0B 1S1WB 3KK3B 3WNGA 2R2SA 3HXMA 3DLEB 3RB0A 2B43A 2I1RA 3RB3A 5DK5A 3ITHA 3WNFA 3I0RA 3OYHA 4DTMA 1FKOA 2HVIA 1RTHA 1C0UA 2IM1A 2UVUA 4IG0B 1QSLA 1HNIB 3RTVA 1IM4A 3DOLB 1BI4A 3ZSVA 4BE2A 3I0SA 4E7KA 1RT4B 5F8HA 4OGCA 3DOKB 3PO4A 4KFBB 1N4LA 5J1EA 4J2BA 3KHLA 5HRRA 5J2MB 2HAIA 3E51A 2E6LA 2R8IA 3NL0A 2YNHA 1L3VA 3F9KA 5HRSA 1VSEA 2YKMA 3NF8A 3OSNA 3DYAB 1NKEA 1B9DA 4ICLB 2Q3SA 4Q8EA 3GV7B 4NLVA 2IJNA 1NK7A 2BE2B 4E1NA 5KG6A 1KLMA 2IMWP 4OPKA 4Z0UA 1RT6B 1SKWA 1BCOA 1KHWA 2ATLA 3LZJA 5KT4A 1SV5B 3H59A 4FLWA 1DLOA 2X6NA 3VQSA 3SUPA 1NHUA 1TL1A 1QHTA 4CJRA 3SQ2A 4HVJA 4NLDA 4CGIA 5KT7A 5C25B 4XIUA 2OPRA 3RAXA 3TABA 4DWIA 4NYNA 3MEEB 5F8NA 3KJVB 2WOMA 2XY6A 3OL6A 2IBKA 4DU1A 1S1TA 4EO6A 2QE5A 3HVAA 3NBPA 3D45A 1HYZA 4QPXA 4BWMA 1RT7B 4CJPA 4OKEA 4JUZA 1EX4A 2I5JB 4YR2A 1NK4A 3KLIB 4IR1A 4NRUA 4NLSA 3BGRA 5C42B 4J9LA 5CYMA 2Y1JA 3PX0A 1UA0A 3RRGA 2P51A 2F96A 3DM2A 3KLHA 1YT3A 5HBMA 5KRSA 1S9GB 3I5AA 1JKHA 4NRTA 5D3GB 4GMJB 2DFHA 3T5LA 4X2BA 3TAFA 1C1BA 4M3UA 4J9QA 4CEBA 4IFVB 3ZSOA 5KG4A 3QIPA 3LP2A 4RNMA 1IKVA 4JV2A 4IBNA 2W8KA 5EWFA 1TKZB 3PJXA 1JL1A 4DQSA 3H4DA 2WRMA 1W9HA 2OPQA 1VRTA 2FVPA 2C2EA 4LH5A 2W8LA 2YNIB 3QLHB 2OA8A 5C24B 1RBUA 1U45A 3BQ0A 2ITGA 5KGWA 3BSNA 4KB7A 4I2PA 3PW2A 2VG5B 1RDDA 3V9XA 4FM0A 5HP1A 3LP1A 2CKWA 2W42A 1EP4B 3C6UB 5KFWA 4HKQA 1TK8A 3PUFA 1CZ9A 1T03A 3BJYA 4IKFA 1DTQB 2JEFA 4CFAA 4LSLA 1WNEA 1TKXA 4CHYA 1KRPA 1T94A 4TXSA 2LSNA 2XI3A 4O55A 4DTPA 2XY7A 3QO9A 4EYHB 4ZPBA 4CK2A 4RW4B 2JC0A 2AGPA 5J2NB 3TVKA 2VWKA 3CG7A 4N41A 2P5GA 3ZSYA 4I2QB 4DSFA 3OYKA 3KD5E 4IOBA 4CF2A 3THVA 5KFHA 3S3OA 4BE1A 3CYMA 4FJIA 1SUQA 4ZHRA 4CEOA 1RT3A 3K5NA 1KCFA 4I7FA 1VSKA 2YNFA 4CESA 4CERA 3L2UA 3S3MA 1LW0A 1FK9B 3NE6A 3Q8SB 1D1UA 1L3SA 4ZMMA 5KFMA 1RNHA 2DY4A 4XPEA 2VG7A 5KFIA 3CM5A 2X74A 1QE1B 4CIEA 4M41A 4CFBA 3SUOA 2KFZA 3OS1A 2ILZA 4CHPA 1XHXA 5JUMA 4KBIA 2BGGA 1L3UA 3AA4A 1C1CA 4CJ5A 2PYJA 3V9ZA 1WN7A 4F8RA 3K57A 3EY1A 4RW7A 3KLGA 3ZSXA 3NF7A 1S6PB 3EPGA 2IJFA 3KKRA 4CEEA 4J9OA 1GOBA 4J9NA 3KKSA 3ZCMA 1QSYA 5KI6A 1HMVB 1RT1B 1TKTA 1YVFA 4O4RA 5KFEA 1ZBFA 3CJ4A 4YNQA 3GIJA 3MEGA 5J2PA 3IAYA 3A2FA 3V9UA 2XRIA 4IRKA 1JLGA 1VRUB 4H8KA 4EZ9A 4NCAA 4MK8A 1XHZA 1NK5A 2GIQA 4NLPA 3JYTB 2GIRA 3ZT3A 3PW7A 2R8KA 1TKDA 1MU2B 4LQ3A 4FJNA 2QV6A 5KG0A 1X9WA 1GX6A 4FZXC 3VQ7A 3TI0A 1TL3A 3VQBA 3T5JA 4R8UA 1NOYA 2HNYB 3T19A 4GW6A 1TP7A 2G8IA 4I9LA 4KTZA 4E7IA 3H40A 4H54A 3K5LA 2FJWA 3V6HA 4CEDA 1OS5A 3BQ2A 3WNHA 2R7YA 1D5AA 3UDLA 1JLEB 1RA7A 4NLYA 3NGYA 4QAGA 2HW3A 3OHBA 4FBUA 4JV1A 4CJWA 1BQNB 3TAGA 2F8EX 4IDKB 3QESA 4TLRA 2JC1A 3SUQA 4MKBA 4AHRA 4F4YA 3H5YA 2RF2B 4DTNA 3ISND 4CEQA 4Q0BB 3VA3A 2ZD1A 3RBDA 1J5OB 3HVTB 4RW6B 5DLFA 4O3QA 3NDKA 1BIZA 1LWEA 4B9LA 2EX3A 2KW4A 4GVMA 4CEAA 3O3FA 3QNNA 1YTUA 5KFDA 5KFGA 2OZMA 4U6PA 3LPUA 1JXLA 3M8QA 1RCHA 3C94A 4M3ZA 2P5OA 1QS4A 2XY8A 3B6PA 3MTKA 1TAUA 2VG6B 1EXQA 1FKPA 4MK7A 3DRSA 2E9TA 4J9KA 3NF6A 2XWYA 4IH6A 2UUWA 5EU7A 4CCHA 1T8EA 3HO1A 4CGJA 4FJJA 4R5PB 2YNGB 4Z4CA 1C0TB 4K8XA 2FLLA 2HNZA 4FJHA 1SH3A 5SWMA 3BSCA 4DMNA 4C8LA 3V4IA 4EBDA 3OYLA 3FQLA 3DMJB 4AHTA 1N56A 3OL9A 2KQ2A 4FZZA 3FFIA 1RT5B 4FLUA 5KFAA 2B4JA 4WE1A 1TK5A 3MEDB 3I5CA 4B8CA 3NFAA 1HYSB 4MQ3A 3V6DA 4HCBA 1HQEB 3C6TA 3HSTB 1RDCA 1LW2A 3DDKA 4J2EA 4ELVA 3PO5A 3LP0B 3QEXA 4DG1B 1N5YA 1L3TA 2ASDA 4DTJA 3IG1B 1ZTWA 3HM9A 3KK2A 1JX4A 4RNNA 5JS2A 2OPSB 2W9CA 3T5HA 5K14B 4DTXA 2DTUA 3IS9B 3IRXA 4KE5A 4NCGB 1A5VA 2BANA 4IH5A 2A1SA 4FXDA 3I0RB 3NKYA 4F3TA 1JLBB 1C0UB 1S5JA 2HHTA 4HUEA 3U6FA 4YP3A 4DTRA 3SFGA 4CJEA 2R2TA 1EKEA 2FBVA 4CJFA 3I0SB 4K4XA 3QGHA 1J54A 4RUCA 2ZQBA 2ASLA 1WSFA 1GOCA 1ASUA 3L2WA 4ZP6A 3TWHA 3SV3A 3KK1B 3MFIA 3LWMA 1RBVA 4DS4A 2YNHB 2BDPA 2R8GA 4ID5B 3CDUA 1DTTB 3N6NA 3O3HA 4AHUA 3SUNA 1W25A 1HYVA 4HYKA 3QIDA 2KZZA 3N6LA 3P83D 1KLMB 4PWDA 2ZKUA 2WK4A 3VN5A 2PZSA 1Z25A 1KHVA 1U47A 4B8AB 3SZ2A 1BQMA 1DLOB 4IG3B 4M3WA 4EEYA 5HROB 4N47A 4ED2A 1TL1B 1TAQA 1UWBA 3GIIA 4PQUA 1WNSA 4WFYA 3K2PA 3KLFA 3V81B 4G3IA 3D0PA 5KFZA 3LALA 4DL4A 2XO7A 3PX4A 3DLKB 2WOMB 3L3VA 2UVVA 2W9AA 3M8RA 4TYAA 2YHAA 1S1TB 3NHGA 4DFKA 4W5OA 2FVCA 3NBPB 2D0AA 3IN5A 4M95A 3K5OA 3DLGA 4OVLA 4RU9A 1HNVB 4LSNA 2AX0A 4CIFA 3SCXA 1T3NA 4FK2A 1SH0A 5CYMB 3ZT0A 3LAMA 3VQDA 5CZ1A 4KKOA 4E0DA 3KIOA 3DM2B 3KLHB 5HBMB 4ZPDA 4K4TA 5I3UB 3EZUA 3VQ9A 2IM2A 4M3YA 1S1XB 4O44A 4ECYA 3L3UA 4DQIA 3NH0A 2BR0A 2IA6A 1JKHB 1T05A 1N48A 4F4ZA 3DRPB 1C1AA 4WFZA 3OYBA 1VK0A 4ZTJA 1X9SA 3OYMA 3AVJA 5DG7A 3OYDA 2ZE2A 1U09A 1S1UB 5DGAA 1C1BB 1MMLA 4O3PA 2G8WA 3OJUA 5DG8A 2ASJA 4DS5A 4HCCA 4LQ9A 3QIPB 4WXOA 5KFCA 4CE9A 3LP2B 3OYJA 3M8PA 5KFBA 1XR6A 5CYQB 2DPIA 3G6XA 5DMRA 1S9EB 3HK2A 4AHVA 4E3SA 1VRTB 5DGBA 4EYIB 4KV8A 1NK9A 1RTIA 3DI6A 3E01A 2OYQA 3KLEB 3ICLA 3EZ5A 4TY8A 2BQRA 3JSMB 4HUFA 1RTJA 1JLCA 4HTUA 1RA6A 4C8KA 4I2PB 3SFUA 3MECA 4ZPAA 2D0CA 2HHSA 4ZVFA 4AH9A 5SZTA 3VA0A 1A5XA 3TAMB 4Z4EA 1QAJA 1D9DA 1ZETA 4CJSA 1RYRA 4KHWA 4QCLA 5JXSA 1O1WA 1BCMA 3KMQA 3OVNA 4LSLB 3MR5A 4DFMA 1TKXB 1S1WA 3KK3A 5J2QB 2DPJA 3DLEA 4QWBA 4NYZA 4WZQA 3QO9B 5HLFB 4Y2CA 3L2RA 4IG0A 4OKKA 2FJVA 4O0IA 4IRDA 1HNIA 1S49A 3SQ4A 4NLTA 2RPIA 3CO9A 3CFOA 2KFNA 1RT4A 3DOKA 1EETB 4KFBA 4K4UA 3TAQA 4CHNA 5KG2A 3CIZA 4FJXA 1ZBLA 5L9XA 1HQUB 5KFFA 4URQU 5KFSA 5J2MA 1UAXA 3HP6A 2GV9A 2IS3A 4I7FB 4J9MA 1J9AA 3M9NB 3F73A 2YNFB 3HPGA 3V1RA 1LW0B 1G15A 3HP9A 4ICLA 3CQ8A 1U49A 1ZBUA 4Q44A 2J6UA 4LY7A 2FBYA 3V6JA 2VG7B 2BE2A 5KG3A 1QQCA 2FVRA 2B5JB 2PYLA 5EWGA 4JS5A 5FDLA 2HMIB 2FBXA 3MR2A 5KFNA 1GX5A 1LAVA 3MR6A 2R2UA 3RB6A 1C1CB 1KTQA 4QOZB 4IQXA 5C25A 1F21A 3LP3A 3OS2A 4RW7B 3MEEA 1QUVA 3KLGB 4MK9A 4QWAA 1RAJA 4ED0A 3AO2A 4KI6A 3ALYA 2HNDB 1C2PA 4ED8A 1TK0A 4M3XA 1JXBA 4NYFA 4FLZA 3PR5B 1X9MA 1L5UA 3UIQA 2B6AB 3WNEA 4BDPA 3MEGB 5J2PB 3G86A 4ECSA 3AO3A 2I5JA 4DL3A 3IGNA 4FJ5A 3P5JA 3KLIA 1ZYQA 1REVB 3CJ2A 3AV9A 4LD0A 3VQCA 2OPPA 3H08A 1S10A 4NZ0A 3HL8A 3NAIA 4F4KA 2E6MA 4JV0A 1R0AB 4ELTA 3S9HA 1RDBA 4DL5A 4Y34A 4R8UB 1J53A 4IH7A 1WAFA 3M9MB 3BR9A 1XWLA 1JLAA 4DL6A 1T7PA 4GC7A 3VQ4A 5C5JA 3NGZA 2HHXA 3LZIA 1Q8IA 4B9TA 4TYBA 4C8MA 4TQRA 1S0MA 3M8SA 4NLXA 2RKIB 1JXEA 4M94A 2HHQA 1TKZA 3D28A 4KHNA 1WAJA 4CGGA 2YNIA 2DFFA 3AO1A 1JIHA 4CF1A 4RW8A 2P1JA 5C24A 5F8MA 4FK0A 4FLVA 5KG7A 3B6OA 4Z4FA 2X6SA 2ZD1B 4FJGA 3CDWA 3Q8RB 3N6MA 1LWEB 1LWFA 3DLRA 3C6UA 3QNOA 2V9WA 2HWIA 4TN2A 4MKAA 4NCBA 4XO0A 1D9FA 3M8QB 3U3GA 5DLGA 3VQAA 4FVMA 3HVWA 4YFUA 3BDPA 4OLAA 3AVIA 2AJQA 4RUAA 4FJKA 1JLFA 1FKPB 4ECRA 5T14A 3HPHA 2FVQA 3DRSB 3L8BA 1TV6B 4CJ3A 3OYGA 4ECQA 3OL8A 1CLQA 2UVRA 2ETJA 1SL2A 3HYFA 4CJQA 1YTAA 1HPZB 2F8TA 2HNZB 1UOCA 4DU4A 1WSIA 1ZTTA 3ULDA 2XGQA 1Z26A 3UPFA 2NUBA 4CF0A 4FM2A 1QAIA 4W5QA 4J2DA 3LPTA 1FK9A 2GBZA 3DLBA 1LAWA 3DRRB 1LWCB 1S1VA 3MAQA 4DQRA 4WE1B 4WZMA 1RTDB 3T3FA 3HJFA 2UVWA 5FRNA 3C6TB 2CJQA 1LW2B 3Q8PB 4W5RA 4ID1A 5I42B 2E4LA 1SKRA 4DQPA 3MXJA 1IKYA 3FDSA 4CHOA 4J9PA 2XCPA 3G6VA 4Y2AA 3GV5B 2AU0A 4NLWA 4CK1A 1ZBIA 4WYLA 4TSXA 4ZVGA 4E7HA 5E41A 4M3TA 4CECA 1QSSA 3TAEA 1S6QB 2W9CB 1S6PA 3RMDA 3ISNC 4L8RB 1VSIA 3KMSA 1Y97A 1N6QA 1HMVA 2YKNA 3IRXB 5KFOA 4OLBA 5F8LA 3QETA 1WSEA 2BANB 2D7SA 4CJVA 1ASVA 5L1IA 2ATQA 4JRQA 3VQ5A 4G1QB 1VRUA 3O4QA 4DTOA 3IGVA 3OYIA 2WONB 4KAIA 2W9BB 5DQGA 3RB4A 3AVHA 3PR4A 4PUOB 5KG5A 2WTFA 4KPYA 2E9ZA 4FLXA 4H4OA 5DQIA 1VSLA 4URGA 4NLOA 4ZP9A 2YHBA 2V4RA 4E89A 5KFLA 2HNYA 2IM3A 3PHEA 1WSGA 5CZ2A 5KFUA 4IR9A 3PX6A 4K4SA 4CJLA 2FBTA 3OLBA 1RT2A 3AA3A 3AVBA 3OYEA 1JL2A 4BDZA 1JLEA 1TQLA 3CFPA 3OYNA 4FBTA 1IKWA 4PWDB 4ED1A 2F8SA 3VQ8A 1BISA 1BQNA 4RW9B 1VSFA 4H4MA 3CJ5A 3AO4A 4B3OB 2Z1IA 3NCIA 1NJZA 4KB0A 1TVRA 4MFBA 4CHZA 1J5OA 4C8OA 1ITGA 4CJ4A 2G8HA 1U48A 3K59A 1B9FA 1ZBHA 3CDEA 4Z4IA 3BQ1A 3ITHB 2RDJA 1FKOB 1RTHB 4DSIA 2QKBA 3MXIA 4LSNB 4DSKA 4KHMA 4K4WA 1IO2A 4CJUA 4Q45A 2BQUA 3ZSRA 1BI4B 1D0EA 4FW1A 4ED6A
chains in the Genus database with same CATH superfamily
4RX6A 4BACA 4K8ZA 4MIBA 3MXHP 1FE4A 1S0NA 1S79A 2NZCA 2J0XA 1QM9A 3NLCA 1T05B 4R0EA 4CLSA 1Q9YA 3EE9A 4LF7J 4FPAA 3SQOP 4KHQA 4R5PA 2YKMB 1S0OA 3HCXA 1WI6A 3KK7A 1XMQF 4OPJA 4M42A 3OTBA 5HRNA 1IWAA 4YMEA 3DMJA 4RKUC 1ZAVA 4C3LA 2B7BB 3R27A 4M5GA 1IKXA 4RPFA 4TY9A 4QYRA 4PABA 1H2VZ 1RBTA 3RSEA 3QJPA 1WC6A 2YWFA 1HLUA 2W01A 3NH2A 2XHBA 4BC4A 3DXSX 2UUAF 1HARA 2Z0GA 2E5GA 1NXIA 3V9SA 2YI1A 2Z1GA 2CGJA 4DR5K 1ZS6A 3L2VA 3MPVA 3UD5A 1WSHA 1FDAA 4K50A 4X84A 3OLAA 3ILJA 3CCQS 3MFHA 2HBMA 4NCGA 1A0OB 3AXKA 1Y11A 2AJ0A 3THPA 3MWTA 2DO4A 4E7JA 1JLBA 1O0PA 3M30A 5MLCV 1YBTA 3FBEA 1T6CA 4IFYA 3W5YA 3QZ7A 2G8FA 4EUVA 2NQPA 4DFJA 4DR1F 3NRBA 3G71S 2DHGA 2IFXA 4JI8J 1SC6A 2OSRA 3QIOA 4MIAA 3BSOA 1ZXOA 5F9NA 2EG1A 5HJYA 4KRFA 3VEVA 3KOAA 4PA1A 1AT1B 4H5WA 2DGOA 5IZHA 3EZWA 2CJAA 5CYJA 3KTQA 3RVCA 4X65F 1URRA 4HHTA 4CFCA 3ENQA 1H0HB 3AVGA 1FWPA 4C8NA 5M1QA 1XIQA 4K4VA 1KQGB 1R43A 4ILLA 5DDRC 1FX4A 3UW1A 3O3LA 1YITN 1T03B 1LFPA 4QW9A 1CQNA 2BRLA 4YHHK 1U2VB 3WXJA 3DLKA 3CJCA 4E2FB 4A8WA 2V4QA 1KD1T 5AQOA 2ZH1A 2ALZA 1X4BA 2V7ZA 1EWRA 1E6VA 1HNVA 4DUZJ 1YJWS 3GJTB 3QERA 4DLEA 2XZTB 3OR1B 5AQJA 2WVCA 3WXKA 3QEIA 3K8WA 3IP0A 2J76E 4FJ7A 4ZP8A 3UDCA 4CLYA 4Y1DA 3H8YA 3D3BJ 2DR9A 1JLAB 1S1UA 2EBEA 2HVZA 5IWAF 8ATCB 2BJ1A 1CS4B 3J7AN 2XSJB 3FZKA 7AT1B 1S9EA 1SQFA 1YJNS 5AQFA 2HWHA 3KLVA 3EVMA 3QYYA 1BXNA 3MUTP 3OJSA 2CPEA 4AXJA 2QTWA 3H98A 4GKKJ 2ZITA 3CHWA 2CPXA 3IFRA 4JBCA 3U02A 3FR0A 2O01C 4HHHA 4K0KK 2YJFA 1VC5A 2JGUA 2MSSA 1BUXA 3OT9A 1T11A 2R8HA 3MM6A 3MD1A 1KOHA 2EFVA 4BCAA 2DGXA 1MMDA 2EWSA 1PJ7A 1IUJA 2XHWA 4ZPTR 4OLPA 4RNFA 4CH1A 3R3LA 3W61A 1PGZA 5JS1A 1RU1A 5HLFA 4CGFA 4FWKA 1WUAA 1TL3B 3V1OA 3G10A 4OYIA 5F8JA 4FCYA 1QHAA 3CD7A 2C3UA 2BJ7A 4WFXA 1Q82O 1RWWB 4S0MA 2DXFA 1RBRA 2JLEA 2CYYA 3CUNA 1U1KA 2COLA 1SI9A 3M8WA 1KVCA 2D0BA 3K5MA 4I6MA 3SIPB 1S1VB 1WSJA 4IEIA 2JFDA 2VU5A 5ETPA 3BZKA 2ZUGA 1XMOK 2D41A 3ZZRA 3EUNA 2FQQB 1HNZK 4AILC 4DEZA 2B5JA 2H5EA 2ZGYA 2HMIA 2KHCA 3CE8A 3AVFA 2LU2A 2YWKA 5HMXA 4F0MA 3V9WA 1CJKA 2UXDK 5EDWA 4M45A 2KL8A 3GJRB 2E5LF 4RU2A 2X78A 4N56A 3HKWA 5LMUF 2VGNA 3AVAA 1U0HB 2YX7A 2F7VA 3TAPA 5E3CA 3T1AA 2DR8A 1EKSA 4CLWA 1P1TA 5FLXU 1YQHA 2HK3A 3LDQA 2B6AA 2CJBA 3RRHA 5B0CA 1Y00A 5AR0A 5J2NA 3D1HA 2OTLS 1WF2A 3QT6A 3OTOF 1NMEB 3FLCO 3O1WA 1IBLJ 1ZPWX 1CJVA 3AVLA 4H4OB 5B08A 3UKUB 3GU0A 4A8YA 3H0PA 2A2CA 3JAMU 3BO2A 3VAJA 1GAOA 2FTRA 2IM0A 1PC4A 2QKKA 4ECWA 5AQYA 1HIYA 3TVYA 4ANDA 3FMBA 3GTYX 5ETLA 3UR0A 1M90T 5FROA 4LF7F 3G4SN 3PG9A 1TYQB 4BWJA 2GHPA 4NLQA 5AQNA 3V6DB 2KM8B 1QVFR 5EHHA 3PACA 4LVOP 4Y6IA 2W7OA 1ZOTA 2ZJPL 3D6FB 3CCJS 2QA4N 3PZPA 3MCPA 2RSQA 2OP5A 3R7BB 2VBZA 4MFBB 3IUCA 4ECTA 4BDYA 2V68A 1HJRA 1ELOA 1HHTP 4ZPCA 3DGPB 4ECZA 2HEKA 3B78A 4DSLA 3VTIA 3BZQA 1RT1A 4PXBA 3IBFB 1TUGB 2J6SA 3K7RA 4OZ1A 4A5AA 1H38A 2GAGC 3KJNB 3AD8C 4QIVA 3C2PA 2XI2A 3J81Y 3JYTA 4BR4A 4WF9L 1MU2A 1P6TA 3ELHA 2D3ZA 1GLBG 3B4MA 5M2PA 1TV6A 5I9EB 2QA2A 5F9LA 3TJAA 4B9MA 1HX1A 2VWJA 2HB5A 3F44A 2J0WA 2ALYB 2O4IA 2BRKA 2IDOA 4K25A 3KD1E 2QFJA 3KWMA 2G8UA 4H5TA 4FNIA 4FN5A 3P5BP 1NM1A 3NEKA 4JI8F 4IRCA 4B1ZA 4M3RA 2WW4A 1U8SA 1FDDA 2GV1A 5H9FK 4YY3K 3J80Y 1IKXB 1LWCA 2AKWB 6FDRA 3B6BA 3N4PA 1DQ9A 3W3DA 5L46A 2RF2A 1UWBB 2DD8S 4Q0BA 1GQEA 1VISA 2CQ3A 2WHOA 2VQFJ 2WVFA 3QT7A 3KXDA 1MSWD 1AXQA 3BGOP 3G6EN 4L3NA 3LDSA 4QIEA 2U2FA 2VCPA 2JEIA 4JKHA 5LT5A 4FJLA 2VOPA 4KHYA 4TQSA 3W2VB 5GAEP 5K8MA 4EU0A 5HK4A 4DTUA 4F50A 2GUPA 1NKCA 2YHXA 1N36K 4QWDA 2CPIA 2PMWA 1MWZA 4FNHA 3M30B 3CJTA 4G1QA 3H7HB 1K6YA 1NBEB 4IFYB 2HFNA 2W9BA 4DUZF 4EBEA 2ZE2B 2V0NA 2DK2A 1OSCA 1Q8LA 3IKMA 3T5KA 3CCLS 2E44A 2EHGA 1NB2A 3G0ZA 4KAZA 4RUHA 4DV3J 1RAFB 1NKBA 2VL1A 3J7AP 2P2CB 2ZM6K 2PO4A 1VLYA 2D3UA 1U04A 3OW2M 4KV8B 2GJ2A 2V9KA 3CM6A 3S01A 2HFVA 3M6VA 1NMNA 1NGIA 3D3CJ 2XCAA 4JS4A 4R25A 2AWZA 3OTDA 4C3MA 3SMPA 2AD9A 4A59A 2D3O1 4FF3A 2KRBA 4YUDA 1RDRA 4ED3A 5A6PA 2E9RX 3G82A 4Q43A 1NZ8A 2HIYA 4GKKF 5K14A 4Q5VA 4CO4A 4QU6A 2HF4A 4I9QA 1FXDA 1S1WB 2B43A 3D1OA 2BBEA 3RU0A 1WKJA 4WQ5A 4DTMA 1T3VA 1FKOA 2DPNA 1C0UA 2IM1A 1WSVA 4IG0B 2HWTA 2FF3B 1WBDA 2V4JA 1V5VA 2WB1D 1VQOS 4BE2A 3I0SA 4B9QA 2I9SA 3C19A 1N4LA 3KHLA 4HDGA 5A0YA 5J2MB 1GTEA 2ZOMA 3C7NA 3AODA 2RS8A 2RILA 1UETA 2OEKA 3NF8A 1AA1B 1NKEA 2DKOB 3M5RA 4NEYA 2EK1A 4BRFA 2F8HA 1SC3B 4Q8EA 3AA9A 4NLVA 2BE2B 1KXPA 3EM1A 1SKWA 3I96A 2OD4A 3LZJA 2HLTA 2DR7A 1DLOA 2AJ4A 3DRXA 2X6NA 3OBIA 3P96A 4GRSA 4U7UD 3SUPA 3GFYA 1NHUA 5BN8A 1UWAA 2G0CA 4NLDA 4XIUA 2OPRA 1PKUA 4NYNA 2WOMA 2XY6A 1N32K 4V19J 3A1YG 3WX8A 3HVAA 3BZCA 3D45A 1HYZA 3J81j 2RU3A 5AJ3J 3ZYYX 5AFUH 4C2MA 1EX4A 1NK4A 1XNQK 4NRUA 1YUWA 3BGRA 1DARA 5CYMA 1HWUA 5DM6L 4GV6A 1RSCA 4LF2A 3TTDA 2M3DA 3VERA 4NRTA 3UN5A 2EFGA 3R9PA 5GINA 3UFCX 4TLQA 1C1BA 1KAYA 4CEBA 2N3LA 1VQ5N 3RG6A 1CJTA 1Q4RA 1IBLF 3LP2A 3CJQA 2YTCA 4I6MB 5A2QY 1VRTA 4Q2MA 2YNIB 1HKCA 1ZM2A 3B4DA 3NY0A 4LFAJ 3ZETA 2RRAA 3KKFA 1U45A 3BSNA 3A8JA 1T95A 3MN9A 4KB7A 4I2PA 2A2DA 4HR2A 5HP1A 3V9XA 4GV3A 1QVGR 3Q7BA 1CJKB 4UOGA 5KFWA 4DPOA 4BRLA 4CD3A 2V8PA 4PYAA 2E1RA 2FJDB 1WNEA 4FSVA 1EHWA 2ZHBA 1KRPA 2RVJA 3OVAA 4TXSA 4O55A 4DX7A 4DTPA 2IVPA 5KQ8A 4BRDA 5E33A 2GGPB 2WSCC 1EQMA 5J2NB 1Q0NA 3CG7A 1NB7A 4N41A 4WFAQ 2QJ3A 1WEZA 2BJDA 2HFUA 1WOPA 3C15A 4ZHRA 1CJVB 1KEKA 1FJGJ 4E1JA 1ZM3A 1KCFA 4JI0J 1NM2A 3VQTA 4I7FA 1Q5YA 2NSBA 4ZVQB 5D0HA 1BA1A 1XMBA 1LW0A 3Q8SB 3QB0A 5B0BA 3RW7A 4ZMMA 5KFMA 4M5DA 3LDLA 2VG7A 1V3SA 2X74A 3SMZA 3T6BA 4CFBA 5BRDA 3SUOA 2BH1A 2YWGA 2QZ8A 2QLJB 1YK9A 5I4MA 3DXBA 5ITHA 2BJ8A 2UUCJ 4CO0A 2B51A 4PKGA 3V9ZA 1FJ7A 1WN7A 2CJXB 4JI2K 3K57A 3M1FA 4BR7A 1GOBA 4J9NA 1QSYA 3GR1A 2R7WA 2VQFF 3PIOL 1RT1B 1TKTA 4JI5J 4O4RA 3CJ4A 1NDKA 3GPAA 3GIJA 3GYGA 3IAYA 2AEMA 3P8BB 2O8EA 4B3SK 1JLGA 2IPOB 4FWRA 2D69A 2HRUA 1F2GA 2GIQA 4NLPA 3R97A 3JYTB 1Q5VA 3ZT3A 1TKDA 1MU2B 2QV6A 5KG0A 1VQLN 1GH8A 4QR2A 3CD5A 2KDOA 4BRNA 4WBFA 3TSUA 2HFZA 4KTZA 1VHFA 4LR9A 2FJWA 2ZWHA 1OS5A 3UDLA 1JLEB 1RA7A 4NLYA 2VC1A 2HW3A 3IO1A 3R5DA 3HHLD 4DV3F 5IT9U 3CI5A 3QESA 4YOUA 2RF2B 2A6MA 3QRRA 4Q0BB 3RBDA 5DLFA 2I7NA 1BIZA 4B3RK 1KVIA 4B9LA 3QNNA 4AM6A 2P9SA 1G2EA 1RABB 5KFDA 4NLBA 2BYCA 3L4QA 3J81O 3M8QA 2CQDA 3L7OA 1NDLA 2GZOA 1LFWA 4GKJJ 2FB0A 2P5OA 1BMQB 1PIEA 2K8GA 1HR0J 1HFEL 3THYA 2VG6B 3AFGA 3BBBA 3RUBL 3RAMA 3O9TA 4UT4A 4IH6A 2LECA 4CCHA 1BG3A 1HHSA 4V19X 4CGJA 4LREA 1KAXA 5HMYA 1LK7A 4TVAB 3GDQA 2HNZA 4CVNE 2AYBA 1SH3A 3BSCA 3CCUS 3VZIA 3DGVA 2D3OR 2HFSA 3T9NA 3TP2A 3MURP 3L0QA 3HT0A 1F5CA 1P1LA 2KM8C 1RT5B 5G0RA 1FRMA 5IXUA 2YH1A 3MEDB 3CMQA 1FE0A 1RK8A 4TU9A 2Z2MA 3HSTB 2Z56B 3FMWA 2XS5A 4N8OA 4ITSA 1IBMJ 1L3TA 1U1LA 2ASDA 2J5AA 2NR0A 2E20A 1BUPA 2CGLA 1ZTWA 3HM9A 2GAHC 5CXTA 5JS2A 3O44A 3G82B 4PRFA 5K14B 5HQMA 4PCQA 2X7IA 3MPWA 3B82A 3D0GE 4CLUA 1A5VA 3ATVA 2BANA 2K3KA 4CYUA 4F3TA 4M5JA 1XJWB 1C0UB 1S5JA 1R8AA 4DTRA 3W65A 3SFGA 3OXGA 5AJ3F 2V4JB 2DHXA 3I0SB 4HACA 4K4XA 1J54A 2C2OB 2AZ3A 2BUPA 2JLFA 1WSFA 2DH7A 5A0YB 4QS7A 1N5VA 1ASUA 1GLCG 3MFIA 1T0TV 5IC4B 4UUXA 4A47A 1RBVA 5AQIA 3C7NB 3CDUA 1DTTB 2CPJA 2VPXB 3D54A 1W25A 1RI7A 4HYKA 2CPDA 1R59O 1WG1A 3AGRA 3WEEA 2Q6BA 3SAHA 4PWDA 2QYGA 3D67A 3VN5A 2ROGA 4UZCA 5F0XA 4DPUA 1Z25A 2ASOA 1VQKN 1BQMA 1DLOB 4PL8A 4WP8A 3PM9A 2WVBA 3HKZD 4M3WA 1NH8A 2F8MA 1TAQA 4LFAF 5KFZA 3I6PA 3VGLA 3BB5A 3SXLA 3PX4A 2WOMB 4ZVUB 4WPAA 4Y0WA 4TYAA 2YHAA 3NHGA 2DR5A 4W5OA 1PC5A 4CH7A 1Q95G 3LQVA 1S12A 4AT1B 1S5ZA 4X4RA 1CC8A 2H9ZA 4CIFA 1RHRB 1T3NA 1HNWK 4FP9A 5K8OA 2XZDB 5CYMB 3D7SB 1UAWA 5CZ1A 4KKOA 3KIOA 5FPEA 3THXA 3N79A 5I3UB 4J8FA 2IM2A 3NGUA 4ZN3A 4ECYA 1JCEA 1Y3KA 2BR0A 4CLPA 1U6FA 5E84A 1N48A 3GLJA 4LJMA 2EKNA 3OYMA 5BREA 2GCFA 1JXVA 5DGAA 1C1BB 4O3PA 3IR7B 1M0SA 1CJTB 1WKLA 4CE9A 3LP2B 5CYQB 1FJGF 4B3TK 4H5VA 3JSBA 4AHVA 3ZZ0A 2MKHA 4B3MK 1GMUA 1VRTB 1NAQA 5DGBA 4RWTA 1RTIA 3E01A 4X62K 3S1TA 3EZ5A 4TY8A 3ZETB 2OELA 2WW8A 4DV7J 4GO5X 3ZTOA 4I2PB 3SFUA 3E66A 4BC7A 2A6OA 3R5CA 1F5AA 1A5XA 2L41A 5ETTA 3TAMB 2UUCF 3Q23A 2AJFE 1HD0A 3OXFA 4CJSA 2ZH4A 1XK8A 4KHWA 4QCLA 4BRPA 1O1WA 1YJRA 2FZGB 2N82B 4FVCA 2DPJA 4DV2J 3DLEA 5HN0A 4NYZA 4XDDA 2KT3A 2O8DB 4NL5A 4JI5F 2FJVA 1HNIA 3SQ4A 4YOYA 1ULRA 4B02A 2RPIA 3CO9A 4YS2A 2E2OA 3CFOA 1RT4A 2QA4G 4QU7A 4ZJOA 1EETB 2K1RA 3C15B 1SC1B 1ZBLA 2DXEA 5KFFA 1HQUB 3TSPA 3HI9A 2WC9A 4LFCK 2IS3A 4I7FB 2P9EA 3F73A 2VBYA 3V1RA 3KHYA 5KPZA 3BF4A 1LW0B 3VGKA 2RRBA 2QM1A 3DKDA 3LL3A 5DM7Q 3PIPL 4NX9A 4Q44A 1GFWB 2FBYA 4C23A 2VG7B 1S22A 1T9TA 2YKQA 4F0HA 2MYFA 5EWGA 2ZHAA 2ZDOA 5FDLA 2XHCA 3MR2A 3KWGA 4M7XA 1LAVA 4M5MA 3SLCA 2VJUA 1KTQA 4IEEA 2BE9B 3LO3A 2ZH8A 2ZEJA 3MEEA 4MK9A 1SJ4P 3AO2A 3L9ZA 4KI6A 1Q16B 2B9XA 1C2PA 5FPNA 2D1CA 4K43A 2BZ2A 3I8BA 3PR5B 2CH5A 1DQ8A 2C2ZB 3WNEA 3R6LB 3JXOA 4ECSA 4K5SA 2I5JA 2O8EB 2J7UA 3KLIA 3MCOA 2LKZA 4LD0A 1FRKA 5JVHL 4GKJF 5ADZA 4FVUA 3LUYA 3NAIA 2YWHA 1FKAF 1HR0F 1R0AB 3S9HA 1S72S 1RDBA 4Y65A 1J53A 2P9KB 2UXBK 3VVUA 3M9MB 4FWPA 1U1NA 3RBZA 3L09A 2FLOA 1T7PA 5C5JA 2W2MP 4BR9A 2IBOA 3Q0AA 5FIIA 2YHWA 4C8MA 2XQCA 2CZ4A 3M8SA 2E7VA 1HD1A 4WQ4C 5KOXA 4L3KA 5C7PA 3ZTQA 1O8BA 1PBAA 3AO1A 2XYGB 2P1JA 5J1NA 4JYAJ 3O5BA 3A12A 3VGUA 5CH7B 1D3WA 3TOQA 2KYZA 5LSOA 3LH2S 4NYOA 2ZOGA 2P9SB 4JI6F 2HWIA 4TN2A 4NCBA 1IBMF 4L3QA 2VASA 1WUUA 5MLCQ 3M8QB 4CZLA 3BBCA 4XK8C 4WYBA 3C66A 3A5NC 4RTFD 3Q89A 5JMNA 1Y9OA 3HVWA 3THYB 2O8FA 4YB7A 3AVIA 4RUAA 2QWRA 1XC3A 4FJKA 2YBVA 5T14A 5AZIA 3IBCB 3E2EA 1QQOA 3EO3A 2P9CA 1AB8A 5A8KA 3O1BA 4ECQA 3OL8A 1CLQA 5HAOA 2PC6A 2ETJA 4DV1K 1S7HA 3HYFA 3DHXA 4CJQA 1YTAA 1HPZB 2HNZB 2RS2A 3PCOB 1OQ3A 4AYBD 2Y1LB 2XGQA 4O8KA 1Z26A 4CF0A 4J2DA 5K9FA 2EWHA 3CJAA 3GMGA 2A42A 2HF3A 2EBGA 2UYTA 2HRTA 4JK9A 2MZQA 2ZZTA 4NI2A 4WZMA 3HJFA 1Y5LB 2PEHA 4ZCIA 2HBQB 2ZVIA 3VETA 4LR7A 1SKRA 4ID1A 1S6OA 1IKYA 3FDSA 4CHOA 5KQDA 4J9PA 1J2VA 2X51A 3G6VA 4YB5A 3OFHA 3GV5B 2WAQD 1HWJA 4CK1A 1ZBIA 3VGMA 4E7HA 2PA3A 4CECA 2MMYA 3OD2A 1VIXA 4LUBA 2CNKB 2HAFA 4CO3A 4P52A 2ZH5A 3RMDA 2B9EA 1PG5B 3KMSA 1N6QA 4OLBA 3WC2A 2BANB 4PQAA 3Q22A 4X4VA 2V51B 4CJVA 1GXTA 4CYUB 2IRUA 2BW7A 3WZ0A 4JRQA 3VQ5A 4DUYK 4K7QA 4UY8T 3IGVA 2WONB 1OSDA 4KAIA 4KPYA 2WTFA 2L9WA 3NGSA 3M1VB 8AT1B 3OUYB 2W4DA 3R8EA 4CZIA 1VSLA 2OEJA 2V4RA 4LR8A 4FF2A 4JI1K 1UFWA 4USKA 1WSGA 3BF3A 2ZH7A 2NSCA 3ZTSA 4JI4J 2ZVSA 4LMZA 3BYPA 2IHR1 2ZC3A 1SS6A 4F26A 4IOCQ 3W9JA 1JL2A 1GK8A 1B7FA 4Z7CA 4GY2B 4PWDB 1J6ZA 3FE1A 1BQNA 2OFHX 4Y2KA 2FGOA 2NXEA 4ER8A 5F3ZA 4BR2A 1X9JA 2CUYA 4XH5A 2J8AA 3GE1A 4OYAA 2H3EB 4ZJLA 2LQ8A 3NCIA 1TVRA 3W62A 1E6YA 1WEYA 3SAGA 2G2ZA 2GWJA 3IAM9 1QJHA 5T41A 2W7AA 4CJ4A 3I55S 2EI5A 3CMES 2WBMA 4OMFG 3VEXA 2NUUG 2RDJA 1RTHB 1ZZNA 2KLAA 1T3OA 4DR4J 3UVJA 3HFZB 4CJUA 1FCAA 1BI4B 1H2UX 4RZRA 2NRHA 4P6QA 1DKGD 5J1EB 4HUGA 3THXB 2M2BA 4DV2F 3GIKA 3KYLA 4JI7J 1G7CB 3HPOA 2F9DA 1AFIA 4NA3A 2WB4A 4KHPJ 4I69A 5M1FA 1TMMA 3D66A 1C0TA 4EAHD 1Q53A 2VFTA 2BE7D 3O4NA 4URSA 3TW0A 1SB6A 4LRDA 2NXNA 4FOIA 5JJBA 2HHUA 2ZBRA 3MR3A 2F9JA 4O3OA 3RR7A 4ED7A 3A13A 1RBSA 2L48A 2P8IA 4KGXB 3R6MA 3VAIA 4YN3B 4DLGA 3NH1A 3B8AX 3QICA 3GFZA 4EP4A 1N5QA 5ETNA 1BD6A 2G13A 4F67A 2XO6A 1VLOA 3FJ2A 1PAUB 4DF8A 2VJVA 2GUIA 2MZRA 4OJRA 1UPPA 3JSYA 2C3YA 4CIGA 2J9DA 2ZH3A 4ECUA 4H0VB 3IS9A 3PW4A 4LF4K 2GVDB 4DQQA 3W8GA 1YZ7A 1D09B 3GIMA 5KT5A 1HI1A 2NRVA 3OW2R 3P4UB 2UV8G 3AD9C 1D8YA 4DKWA 2KT5A 1BHLA 3MCAB 1T02A 2EFPA 4ZPWR 5LXYA 3E8OA 2FIUA 1S0VA 1X4GA 1WLJA 2CZ9A 3MCMA 1NUEA 5D4OA 1ICEB 1VBYA 3CJKB 2CGKA 2J4RA 4FZYA 4DTSA 1Z6RA 2OPQB 2H3GX 4JD2B 2GW8A 2GVZB 1PYOB 4PKHA 3RR8A 4G6VB 2WVEA 1VSMA 5DO2A 5FPMA 5FDLB 2OD6A 3MF5A 1Q81T 3THTA 1ESVA 4F4XA 2CJ9A 1H98A 2HHHJ 2XLKA 3TANA 4O4GA 3FUYA 1OO0B 1NJYA 4F36A 3V81A 5HL7Q 1LEOA 1GLJO 4JYAF 4KO0A 5HO4A 5TKWA 4RNOA 1VFJA 2B9WA 4O3NA 1P9YA 1S4FA 3L2QA 2ADCA 4RO0A 3FK4A 1VSHA 2IYGA 2AGOA 5L1JA 4K4ZA 4E1MA 4OI3A 1W7WA 1VOMA 4W5TA 4B9VA 3ZT2A 2YWWA 2UXCK 4NE9C 3I82A 5F1XA 2BVZA 2EKYA 1YI2S 4C8ZA 2F5GA 4DV5J 2HHVA 2W7PA 1CXQA 2BMBA 4CLTA 2E2QA 3CJ9A 2DISA 1G4CA 5D0GA 2LXUA 3SJHA 2G9OA 1WOQA 3C65A 3PYFA 3TUJC 4FJMA 1RT6A 1E4FT 4IOCL 4IO1A 4Y3CA 2MGZA 5ETOA 1SQKA 2QI2A 1RDAA 4WK3A 3BREA 4IO8A 4CF8A 4M63C 3KLEA 3TTFA 3JSMA 4O3RA 1HL6A 4FYDA 5C15A 4GV9A 1UZDA 2FVSA 3MPDA 3KJVA 2XMUA 4A5BA 1YWXA 4IYQA 5C2DA 3SK3A 4B9SA 4F2RA 1KFDA 4DU3A 1XR5A 5DZ7A 3AVKA 2VV5A 1RUSA 4K4YA 1RT7A 1SH2A 5EWEA 3A0IX 1REGX 3C95A 1S99A 4NEZA 5HATA 1EWQA 5C42A 2Y0BB 3IR5B 5J2QA 1BGXT 2O5DA 2RMLA 4CHQA 2DB1A 4JKEA 2NCKL 4LF1A 2O8FB 1LK5A 2GO8A 3QGGA 1NSKL 3QEWA 3G6YA 3Q24A 1VQ8S 3MM8A 5D3GA 1N8RT 1FXRA 1IG9A 1S97A 3H25A 1N33K 2YQ0A 1YJ9S 2HYIB 2AJ1A 2H51B 3CWJA 4IFVA 1PYTA 3QINA 3U1NA 2Z1HA 2D1KA 1VQ4N 5L1LA 1HBMA 3F56A 5A8RA 3NGIA 2BW2A 1UTAA 3CCMN 1KQSM 3BH6B 2BTFA 2M5YA 2MY8A 5J1PA 3AO5A 1IV0A 4JI4F 4NI2B 2YH0A 2AGQA 4EBCA 4KR0B 2Y1RI 1X4FA 2AV5A 5KTQA 1IKYB 1HLWA 5H1SV 2O1PA 3K17A 1TL5A 3BN7A 2XLJA 2VA3A 4WFBQ 3MXMA 1PYSB 2HNDA 1NNEA 3OYAA 1N6QB 3T69A 4OFZA 3VALA 3NAEA 1U4BA 4OHXA 5GADP 2XGPA 3LWLA 1UEKA 1BIUA 1WB9A 4NLUA 3BKUA 1OH7A 4LC9B 4X64K 4I2QA 1X4DA 1PAEX 4CT9A 4DR4F 1S7IA 4FF4A 3NP5A 4F3OA 3PY8A 1B4SA 3EZOA 2VQEK 3V4IB 2ZFHA 5LJWA 2Z30B 4WKRA 2ZH2A 4OGEA 2H4YB 2V52B 4JI7F 1FW6A 4PXEA 4XPCA 4USVA 3FFIB 2P9IA 2LLZA 4KHPF 4E7LA 5CHCB 3GP9A 1HBUB 3WIUA 3VHQA 2M9KA 5AQWA 2G8VA 1NWKA 3IWNC 3IA0A 1NDPA 2D5RA 1U26A 4KGZB 2BJEA 3DLLQ 3RBEA 3ZC4A 3CJ7A 4HTLA 1DURA 4RG8A 1RAEB 2B4VA 1M1KT 3KK2B 2IRXA 1TVRB 2I2YA 3NS5A 1WD6A 4WCEQ 3HHLA 3BF1A 4K2XA 4WP3A 3ZSWA 4CZFA 5KG1A 1RWPB 1IXKA 4KYZA 2RQ4A 3KHGA 5CE3A 2OH2A 4Q8FA 5K5MA 2FJBB 4EHUA 3K9KA 4ZTFA 2OKQA 5KT2A 3A8IA 1CQMA 2HGMA 3UVJB 1M1HA 2A40A 2DFEA 5EUHA 3ZT4A 5EGYA 4DF4A 2DJWA 2GA7A 3VAFA 1NGBA 4DR5J 1C4CA 1NHVA 4X66K 4L76A 4ECXA 3FQKA 1KOOA 2V2VA 4TKTA 2KT2A 4JKDA 1R6YA 4OI1A 1WDDA 2HGNA 3TQ1A 4ETZA 3LDOA 1LWXA 5KFJA 5JMVA 4CLFA 4ANCA 1QAXA 3SQ0A 3M6XA 4OYBA 1GLLO 5LM7E 2V8HA 2XEXA 3S6EA 3CMAN 1NEEA 2Q43A 3R1LA 2MDAA 4IDKA 3DAWA 2C3MA 3I8DA 2F4VK 2ROEA 1RTDA 4X4OA 3JB9k 3SQ1A 1KVAA 5DG9A 2QFIA 4O3SA 4ZS6A 5I42A 2RHKA 4RWWA 4BR0A 3JQKA 2RDIA 2XY5A 5KFRA 2O4GA 2XS7A 4U8VA 1GMWD 2MXYA 1YGYA 3NAHA 2JLGA 3AVCA 1SL0A 2HHHF 1VQMN 1YF5L 4O5BA 1S6QA 2X1FA 2V5HG 2RN2A 1C6VA 4OHYA 1U1OA 1HKBA 3P31A 3A8KA 2QWOA 5GAEU 4HWIA 1J5EK 4H0YB 1KVBA 3KUGA 3D5MA 3FZHA 4YHHJ 4NLGA 5CZVA 1RAHB 1DY3A 1UPMB 2Y1IA 2FGCA 3NXZA 2G8KA 1VC6A 2M70A 2PEBA 1OWXA 4YOTA 4LRAA 4DSEA 4Y0FA 4WYWA 3D4JA 5LJ3Y 1VJQA 2AX1A 3DU5A 1XEZA 3PRDA 5BYSA 2PY5A 4CEZA 4ETXA 2GX9A 4PG5A 4DV5F 1NOZA 3D7EO 3OYFA 3BUZB 3SYZA 1I6JA 2AT1B 2OZSA 3K58A 3MCNA 3P38A 3HHNB 1FDBA 3CJ3A 2MQPA 1WC5A 3DXKA 3GWCA 4DFPA 1JLCB 4JKBA 2UU9K 1FI4A 1F1BB 3Q8QB 4RW9A 1V9OA 4NLRA 4WXWA 2QWLA 3LANA 4CFDA 3D0IE 3TYTA 5HVHA 5U47A 4OJHA 1I51B 3PVXA 4O4GB 1UW9A 4LIRA 1NGHA 3J7A1 2HVHA 4KO0B 3QQCD 4X4PA 3HXMA 3BPDA 3RB0A 1UP1A 2BM0A 4EWTA 2CDRB 1KNZA 2ZJRL 2B9YA 4HLBA 2ATCB 3CCVN 4BRMA 1GLEG 4ILGB 1QSLA 1FEEA 2G2OA 4OZJA 4K0KJ 4MMOA 3I4PA 2QL9B 3QFWA 3ZSVA 4A57A 2MQNA 5F8HA 3MD3A 2DNQA 4DPXA 1X0FA 3E51A 3DXMA 1YITS 1VYAA 1H2TZ 4U67Q 1VC0A 4G9ZA 4H0XB 2RUGA 1XN9A 2R8IA 2Q1LA 3W8PA 2YNHA 2DIUA 2YKMA 2W6KA 5CQGA 2Q3SA 1BWVA 4NMLA 3AAQA 2IJNA 4YDXA 1NK7A 4E1NA 5KG6A 2GMJA 1HNXK 3KG4A 2IMWP 4OPKA 4IO9L 4XTTA 1RT6B 1XQSC 4ILHA 4DCJB 1KHWA 1TR0A 1XQIA 4MKYA 4DX6A 5KT4A 2ATLA 3M4XA 4CRJA 1ATSA 3H59A 4FLWA 5AXNA 3WX4A 4DR2K 3HRGA 2DGVA 2BV3A 2DRBA 4DV0K 4ILRA 3SQ2A 2DHSA 4HVJA 3EDRB 4CGIA 3TABA 3BH7B 3RAXA 4LF5K 3HZGA 3IAS9 4I4BA 3KJVB 2HIQA 4E8UA 3OL6A 2QE5A 4P2MA 3GE9A 1WF0A 2YKPA 1XMOJ 2IY5B 3TWZA 4BWMA 1RT7B 4OKEA 4AFFA 1Q7YT 4YR2A 4H4KC 1U1MA 3D6TB 4IR1A 2HK2A 3FZMA 2A3ZA 5C42B 1G3OA 4J9LA 2UXDJ 3RRGA 3W1YC 3TU5A 3Q8UA 5HBMA 3O5TB 4QQBA 2CWXA 3J81U 3KUEA 1DQAA 2DGUA 3I5AA 4DR3K 4KH6A 1VQPS 2OO4A 5D3GB 1YJVA 2ROPA 1KP6A 2FDNA 2Y9HA 2NS1B 3L7PA 4IFVB 4QIFA 1P8ZA 3QWPA 3ZSOA 2OSQA 5KG4A 5AXKA 4H0OA 2DITA 4QIGA 4TNOA 2Z57B 4RNMA 2W8KA 4M5LA 3FEZA 2R7UA 5EWFA 2ZWPA 2QMXA 1TKZB 1JL1A 3CC4N 3H4DA 1W9HA 1W2BM 4LH5A 2IYIA 2W8LA 3J80U 5C24B 1RBUA 4ZVSB 4DI6A 3ZEUA 2QL7B 5DZ6A 2CWKA 3SBMA 3R9LA 1RDDA 4QYZK 4CTAA 3AAPA 1WEXA 2CKWA 2R7VA 3AOCA 3DFEA 4LBPA 1T03A 4IKFA 1NGAA 5DDPC 3DNCA 4WJBA 5AZJB 4YDUA 4CHYA 2XMAA 1T94A 3UB5A 1GMVA 5JVGQ 2JC0A 4C6AA 2AGPA 2VWKA 4C9DA 2P5GA 3ZSYA 4I2QB 1U02A 4DSFA 3EXCX 3ZNJ1 3QRQA 4BE1A 3CYMA 3PRBA 4P7VA 2CVIA 4CEOA 2IVMA 4KQZA 4A48A 3TNVA 4DR5F 3D2FA 1VSKA 2W2QP 3U27A 3IRWP 4QIWD 3KZBA 2YNFA 4CERA 2LEAA 3L2UA 2KKHA 2X3DA 1FVSA 3NE6A 3EDQB 4WFNQ 1ZA2B 4A2BA 2XYHB 4NB4A 4P2SA 2MKKA 4KBOA 4XPEA 1RAAB 2PSZA 2XG8A 5KFIA 5HANA 3KUHA 4MYUA 4CHPA 1XHXA 4AE5A 4KBIA 2F9TA 3HSCA 4V1Ak 1L3UA 2P9UA 3FEXB 1C1CA 2Y0SD 3V2UC 3CERA 1VQ8N 4F8RA 4DV6K 2J9EA 3UE2A 5H9FJ 3JXUA 3HHLB 4YY3J 3ZSXA 2CG4A 4CT8A 3EPGA 4B1YB 4NXMK 3KKSA 2JVRA 5KI6A 1PCAA 1YJ9N 1BWFO 1HMVB 1M5HA 1JB0C 4DXLA 3G4SS 3HSJA 3R2DJ 4C7QA 2QMWA 3W63A 4YNQA 3DC2A 2FPHX 4M1KA 3FSXA 3MEGA 3V9UA 1A9NB 1OH8A 1RTZA 1VRUB 2APOA 3A8YA 3FEYB 4KH0B 3PW7A 1QDUB 3MM9A 1UJ4A 5F2RA 3VGTA 2RJZA 2QA4S 3AXMA 2KXNB 1M5OC 3TI0A 3H46O 1TL3A 3VQBA 1NOYA 2RH3A 4GW6A 4YHHF 4E7IA 2CRLA 1N36J 1NGJA 2EG2A 3K5LA 3V6HA 3WNHA 2JSXA 2DGTA 3FSYA 2ZNZA 5JICA 5EX3A 1R7IA 2PFDA 2W4PA 1C0FA 2KVIA 2GX8A 4IDKB 3HD1A 4AHRA 3H5YA 3ISND 4CEQA 1V3ZA 4NOHA 2ZM6J 1HBOA 4O3QA 3SBGA 1LWEA 1VHIA 3H20A 2FHKA 4DR7K 2A3JA 3HOTA 2CNOB 4DOZA 1F9EB 4MO4A 1U0HA 4LSZB 3C94A 4CO1A 3TZXA 3J7YI 1CEZA 1NU4A 4JI0K 2KG0A 5K20B 3EGWB 3CF5L 3B6PA 1F9FA 2ZBCA 3D6RA 2DY1A 4ISGA 4MK7A 4J9KA 2XWYA 5AE2A 5EU7A 5B09A 4XAKA 3AJ2A 4L6V3 3HO1A 4FJJA 2AP1A 3A5OC 3IDHA 4J5OA 2YNGB 1BQXA 3G6ES 4K0KF 2FLLA 3UKUA 2CIMA 3CNQP 1F60B 3VAMA 2NRRA 2ZZMA 4LBHA 4AHTA 3M05A 3OL9A 4BGAA 3CT9A 4DBQA 3ZNUA 5KFAA 5AQHA 5AXLA 1WSRA 5A2QU 3EVWA 4MQ3A 3V6DA 3DXKB 3BYRA 1JCGA 3PO5A 3PHTA 4I6YA 3IG1B 2GQ2A 3SSRA 4E98A 2Q0RA 2FZCB 4OPHA 1YBUA 1WG4A 2ZF5O 1JX4A 3N28A 3W2WB 4PXCA 3DGPA 1RHUB 5GIPA 2IMOA 3IRXA 2VUGA 1KC8O 2HBZB 4IH5A 4C8YA 3AARA 3W9IA 2A1SA 4CJ7A 3NKYA 2HHTA 4TU7A 1XMOF 1N5SA 1N32J 3L4BC 4AM7A 2R2TA 2FBVA 2XWXA 5K8NA 3VZHA 5KOWA 1HNZF 1FVQA 4ZITA 2JZ5A 4I0WA 2JH3A 4PXDA 2UXDF 1Z2ZA 5GAGI 3T1HK 3DXMB 3L2WA 4ZP6A 4G1IA 4AQYK 3KK1B 1XNQJ 3LWMA 3UKRB 4R0JA 2PI5A 4DS4A 2YNHB 4IJAA 4ID5B 3LGHA 3HBTA 1GTHA 3AOBA 2NRWA 3O3HA 2UUBK 1T9UA 3HF5A 3N5FA 3RRKA 4IUFA 1I5OB 1EX8A 3P83D 4HI2A 3Q8YA 4B8AB 1R8PA 4IG3B 3OVSA 2VPYB 1Y3JA 4EEYA 5HROB 5FLXO 1UWBA 3GIIA 3VF0B 1NBWA 3K2PA 4WFYA 4G3IA 5A6WA 2XO7A 2AEFA 3L3VA 3QT5A 4CZKA 2FVCA 2D0AA 4B1XB 1QLNA 3CC2N 5ETQA 4OVLA 1GNKA 3JAMO 5E3PA 3W2VA 2AX0A 2LU1A 5C0YA 1VQSA 5L39A 2EK6A 3N4WA 4QS9A 3GG1A 1XERA 9RUBA 3QT8A 5HBMB 1NSPA 1NLVA 3QSYB 1S1XB 2FHMA 3L3UA 4HHJA 4DQIA 3NH0A 3DRPB 1C1AA 3MUVP 1X9SA 3QRPA 2Q31A 3AVJA 2ZE2A 1QUPA 3TUPA 1BY9A 3OTCA 4DV4K 2G8WA 3NOCA 3OJUA 2ZOFA 4DS5A 2ASJA 3MTJA 4HCCA 4LF9K 5D4NA 2B56A 4I56A 4LQ9A 4WXOA 2N3OA 5KFCA 2YPZA 3VEOA 1XR6A 4RR5A 1UVIA 3MM5A 4O5FA 1T9YA 5D6GA 2CFXA 2DO0A 3VENA 4KV8A 3DI6A 2OYQA 3A8EA 4FWMA 4CQ1A 2BQRA 1RGVA 3ZEUB 5BXIA 5LSRA 2WFBA 3MECA 4ZPAA 2D0CA 4ZVFA 4N77A 5SZTA 4CTAB 2ZBQA 3W3SA 1RBLA 2VOOA 1VQ5S 1QAJA 1ZETA 1RYRA 2B4UA 1IR0A 3OVNA 2RHQB 5GMKa 1S1WA 5AE3A 4CBWA 4YY3F 3MMVA 1YDLA 1R3NA 3B8HA 4JI2J 4DPWA 3J7YU 4Y2CA 3L2RA 4IG0A 4JKCA 3CQXA 3FBBA 4NLTA 3PDNA 2XM3A 1ZH5A 2VODA 1I94K 2NRTA 1WC1A 1YJTA 5KG2A 2VGMA 3ZX3A 5J2MA 3I9V9 4F02A 4ATNA 4D3HA 4B3SJ 5D8HB 3D2FB 3Q7CA 4J9MA 1G6BA 1NRKA 3FZ2A 1J9AA 3M9NB 2YNFB 3HPGA 2V2QA 2NRZA 5B0GA 3HP9A 5IQQA 1P9QC 4DR6K 3I56N 1YLXA 5LSLA 1Q8BA 3V6JA 1MLAA 3SSSA 2BE2A 1N36F 5KG3A 5KAKA 3P5TL 2R42A 4JS5A 2G0IA 4U8YA 3NS7B 1U6BA 2O8BB 1GX5A 2P9UB 3RB6A 1BOTO 1C1CB 2ZWOA 3AA8A 4I64A 1VQPN 4IQXA 5BPNA 1WHYA 4A4JA 3W7BA 4IZ9A 2XMMA 4BC5A 4BS2A 1AUDA 3HSDA 1JXBA 3ZZPA 3HJVA 3ID6A 3AGKA 2ZM6F 1FD2A 3FCWA 1L5UA 2VONA 1EAYC 3A3NB 3MEGB 3G86A 3AO3A 5LMNK 1NSAA 3P5JA 1ZYQA 1BA0A 1REVB 2BUNA 3UN2A 3MK6A 2OPPA 4J90A 3E3XA 3O6QA 2NXJA 3MM9B 4AXIA 4JV0A 4ELTA 4WP9A 4DL5A 2KVQE 3FGUA 1NO8A 2V8VA 4J91A 4DV7K 2LXFA 2IVFB 3CCTA 3BR9A 4GC7A 3GZ7A 2PD1A 1Q86T 1EIYB 2HHXA 5GAGU 2XMTA 4B9TA 2HHPA 3M8YA 3ULHA 1VQ9N 4JK8A 3C6AA 2A10A 3FCVA 2AYEA 3FRYA 1PJ5A 4NLXA 2RKIB 2FHJD 1JXEA 2HHQA 1IQTA 3IMQJ 1SQEA 2X1BA 1YSJA 3BDEA 1WAJA 1TTHB 2GEMA 4JI3K 2CQBA 1OKJA 2YNIA 4CW7B 1VQLS 5K8PA 4WQ4A 5F8MA 2F65A 4FLVA 1HBOB 3Q8RB 3BEXA 2JWKA 5F0UA 3N6MA 1LWEB 2YY3A 2H5JB 5DDOC 1CG2A 3DLRA 2Q1NA 4P75A 4MKAA 2C3OA 4A8QA 4XO0A 1ZA1B 3US5A 3H2VE 3NWGA 3EJMA 4KGKA 1MWKA 1FFWB 2ADBA 1AZSB 4USIA 3ZFVA 2GNKA 3H45C 3DOMA 3T1YK 3CO0P 4OYWA 4G65A 1VS3A 2AJQA 5ETSA 3M3ZA 4QOTA 1JLFA 4FWQA 4ECRA 2GGPA 1KQSR 3HPHA 3U1MA 1OYEA 2F7TA 4M5KA 2LQBA 2HBJA 1GXLA 3WHIA 1N32F 3BV8A 2DEIA 5AQUA 1NGCA 2W1BA 5AQTA 2GHVC 3ULDA 3MCSA 3UPFA 4FM2A 1QAIA 4W5QA 2BEFA 3DLBA 3DRRB 1FNXH 1XNQF 2PMZD 3MAQA 4DQRA 2E2PA 4CZEA 4AL6A 3TX0A 4MAKA 2UVWA 3BP8A 2RAQA 4JKAA 3BGUA 4W5RA 3LGNA 3MXJA 2QC3A 2XCPA 4A8OA 2AU0A 3HHLC 3HTVA 2LA6A 4WYLA 2KI2A 4ZVGA 5BR8K 2P9NA 2UZAA 1VQ7N 2OGUA 1VSIA 2CNNB 2R3VA 3IRXB 4ZIWA 1SJ1A 5F8LA 3QETA 1WSEA 2MZJA 3NMUA 2QWQA 2K3IA 3ILOA 1ASVA 5A8WB 5L1IA 2P6TA 3MX2A 2PGCA 2JHEA 2JRSA 4JN4A 2V2KA 5DQGA 3QBCA 4RBUA 1K44A 3F2KA 3PR4A 2N4DA 4PUOB 2UV8A 4RBVA 2E9ZA 5ADXH 5CHIA 4ZLLA 1K9MT 4URGA 4ZP9A 1WBBA 2VC0A 5KFUA 1HNWJ 2L08A 4I1TA 2V7YA 2ERRA 2XYPB 5C12A 4DPTA 2FBTA 1HW9A 3LM9A 3VEWA 1OQ6A 5IM0B 1RT2A 3O9UA 1AW0A 3OYEA 4BDZA 1JLEA 5IS2A 3OYNA 2MQLA 1U2CA 2DNMA 4ED1A 2F8SA 3VQ8A 3FFKB 4DQ8A 2NYHA 2E5JA 1BISA 1VSFA 3CETA 4C4WA 3A5LC 4B3OB 3CCZA 3LA0A 1UW4A 4USTA 2QWPA 1VBKA 4B3TJ 2HVEA 4OQJA 4C8OA 4B3MJ 1U48A 4X62J 1ZBHA 3ITHB 4K41A 2ZUAA 2QKBA 4DSKA 1IQZA 4KHMA 1FRIA 4Q45A 3MMJA 1D0EA 4Z37A 3WUHA 4V19S 2W24A 4ED6A 1VQKS 4F3QA 4PAAA 2VG6A 4OZ5A 1GMWA 1NH7A 2DGQA 4RLEA 3TQEA 2ZJQQ 4RNHA 4WIIA 1K8AT 2FJAB 2VZ9A 1YJUA 2RQCA 2DNYA 4JI2F 3OYCA 4BRQA 3LAKA 4ERDA 4ZCKA 3OFFA 2OFGX 1IBKK 1WACA 2HZCA 1RHMB 3ZZYA 3L3CA 1FNOA 3PSIA 1RQ0A 1HW8A 2IAJA 4B3SF 2D4WA 3NGRA 3MM5B 5H1SQ 1RT5A 5IT0A 4E19A 4CGHA 3MEDA 3DI6B 4AHCA 4X4TA 3O2IA 2FSJA 4DX5A 1GLDG 2PE8A 1NK8A 1FFSB 4YORA 3QEPA 3MECB 2I6WA 4DL7A 3D2WA 5KRTA 4H0PA 3FZLA 4NZ7A 3H5XA 3AAWB 4FLTA 4CZMA 3M6UA 3ILIA 3QATA 5HQLA 5D15A 3KNAA 3CCEN 2VIHA 3MN6A 3GJQB 2RQMA 3UQSA 3AY0A 1UKUA 1WC0A 3SV4A 3U3YA 1RWKB 2RD5C 4DCHA 4OKJA 4EFAC 3KNGA 3ETMA 1VBXA 2QG9B 2DTJA 3U8XA 2OTJN 3WXIA 2K7KA 3PTWA 2RE2A 1JLQA 1Q82T 2IC3A 1VSDA 5KT6A 1IKVB 3ULEB 4USWA 1ZZFA 5H9EK 3H6EA 1RLDA 2H48B 4BC3A 1DTTA 1I3OB 1GXUA 2OAUA 3VR1A 4ZP7A 3UDVA 3DLHA 5CZXA 3PFEA 4QBUA 3MAHA 4CGDA 1UFLA 2OCEA 2VBWA 4ZCMA 2UXBJ 5KFYA 5E3AA 3SDEA 2ITMA 1KS2A 4RJVA 3LP1B 4QW8A 1AFJA 4IKAA 1XI1A 3FBFA 2D0PA 1RWVB 2MKYA 3L6QA 5KFQA 1NLKL 2I0XA 4U7CA 3AA2A 1S4EA 3ZT1A 3NGTA 3SI6A 1UEUA 4W4MA 3G8QA 3Q2SC 4P72A 3V5RA 2DNLA 2CAJA 3PJWA 3SNNA 4OI2A 4FS1A 3QGIA 3MN5A 3W5XA 1RLCL 3DOLA 4EP5A 1TUUA 5C2GA 2OPPB 1YTYA 3SI8A 1SUQB 2LFVA 1RT3B 5I3UA 3MR7A 3M32A 4HVZA 1HRHA 1IBCB 3H4BA 2OHDA 4KC5A 2YHYA 4PL7A 3DYAA 2LA4A 4IFEA 4Y00A 2V94A 3O8MA 2F4FA 3BO3A 3NF9A 1LKZA 2GQCA 5CD4H 5CYQA 2BX6A 1F3VA 3VGVA 2CG8A 3OHAA 1FA0A 3KDOA 4DV1J 3TUIC 4P9SA 1WELA 4J9SA 1YJ7A 2D9PA 3MWBA 3SCIE 1TGOA 3UR3C 4M63A 3OS0A 3C14A 4F4WA 3DDIA 3QEVA 4CO5A 2FYXA 1IH7A 5AQQA 2VA2A 4PG4A 3TAMA 4KREA 4YDUC 2BKPA 5RUBA 4GVEA 3I31A 2FLPA 2KKZA 3GG4A 1FNMA 1SZ2A 4DN9A 2ZZNA 3IC1A 1WI8A 4LFBK 2PBDA 3DOMB 2CA9A 1NJIT 3IXQA 5GMDA 4W5NA 2MKSA 3LPEA 3SPYA 1CBKA 2O8DA 3G87A 1JLFB 1W2BR 4LF8K 4ZN1A 1SIWB 2C2RA 3S3NA 3PKMA 1U2RA 4ISFA 1X60A 4DHVA 1IJJA 4U7UK 4X4NA 4ZOSA 3BY5A 3M2VA 4BRAA 3I87A 4PR6A 1EETA 4C3KA 4AHSA 2IVOA 4EI2A 1HQUA 5L1KA 3MOZA 4DUYJ 4JEPA 1OH5A 5LOQA 4DCPB 1RYSA 3WXLA 1K0VA 1VGYA 4KH4A 1IR1A 4IQMA 4C11B 3RWUA 1HNWF 4F04B 3QLHA 1PILA 4KSEB 5HVGA 1H6KX 2YKAA 1T9WA 3SBTA 3AB4B 1ZM4A 4JI1J 2DNOA 3WQTA 2C2DA 1SAZA 2VG5A 3HM8A 4USMA 3MPYA 2H54B 3MMCB 3HT3A 3GSDA 2W25A 3TA1A 4CDIA 1U1PA 1LV5A 1G99A 4ZLNA 3BGFA 2P9NB 4ILJA 3ENVA 1KD1O 3WIVA 2E8AA 4GNIA 2LQJA 5ETVA 2PN6A 3M2RA 4GVBB 4B3TF 3UI3A 4BRKA 2M4MA 3BS9A 2B0GA 4B3MF 4BG8A 1VQYA 5AQVA 5HRPA 2ILYA 4RW4A 4X62F 1SIZA 3EGNA 2OMOA 3VAKA 3TX8A 4DHYA 1UA1A 3RBXA 4FWLA 2R4FA 4QWCA 4OV6A 1VCTA 3GYNA 1E3MA 1R0AA 1NJXA 2GO9A 4GMKA 4FJ9A 2Q0UA 2HSEB 3BGLA 2P9KA 4CLKA 1MN9A 2NLXA 3SQGB 3JTOA 2JFKA 1K1SA 1RT2B 5AXMA 3HHKA 3SJJA 1WTBA 4YOEA 1ZM9A 3W0LA 3GONA 4GVLA 4O0JA 1N34K 1YHQN 1N5YB 4HH1A 5BPMA 1K0TA 1RDUA 1DGKN 4YB6A 1RXOB 4FJ8A 2UUTA 3PJ9A 3QJJA 1GLAG 3PW5A 1R27B 5L8RC 4LFCF 4N76A 2L9NA 5KPRA 4EZ6A 1KKHA 2DH8A 2GTDA 2BOPA 1S9FA 1YKWA 4KGMA 2VFVA 2OANA 2UP1A 2A6AA 2E66A 3KWIA 1X4EA 1KVKA 3JQJA 3JTNA 4LF6K 1RJJA 2MHNA 4RWXA 3W9HA 3J7Z5 2WSEC 1N5TA 1RWUA 2G1DA 4N5SA 1FX2A 1RAIB 3EGVA 3VQPA 4NA1A 5CCMA 3RAQA 4LF4J 1NCLA 4QWEA 4U96A 3J7ZT 1HPZA 3SEOA 5IC6B 2NYIA 3QWUA 1CZBA 2EC2A 2Q2RA 2LDYA 4YR3A 2JWNA 2Y3YA 3EKUA 2IAJB 3TVZA 4BC2A 1Y64A 2LEBA 2E29A 1DRZA 4JV5K 2HFOA 2Z1JA 4PKIA 4OYZA 3IBWA 4DSJA 5T7BA 2X1AA 4KI4A 4PQUB 3KLFB 1X0PA 4RW6A 3H3NO 2A0FB 1S59A 4B9NA 2XSFA 3U1LA 4JI6J 3DJCA 2UXBF 2CH6A 2YV0X 4UOFA 3ONQA 3DLGB 4OJ1A 2LQ9A 2KG1A 3GQCA 3I5BA 1VSJA 2DH9A 2C22A 4A8SA 1R6VA 4KRWA 3NMAA 1B92A 3D2EB 2ASMA 2NXUA 2CDQA 1Q9XA 2W2PP 5C2CA 1X4AA 3VV2B 1CZAN 2WONA 1X4CA 4OL8A 1TZ0A 2CQGA 1NDCA 2DCLA 3GYXB 3L95X 3TR8A 3M1VA 5F8IA 3NGDA 3ASMA 1JLQB 1NPKA 3OUYA 4CEFA 2IC3B 4BVPA 4WFAL 2YQ1A 4Y1CA 4LH4A 2PIIA 2I8EA 3M8PB 1UVNA 1M90O 2GJFA 2UXCJ 2MQQA 3PNIA 5KFPA 1X1PA 1JMTA 2H5IB 3NNAA 2KRRA 1HYSA 4MH8A 1R89A 2HKEA 1K1QA 2R9LA 1HQEA 3EYZA 5CY4A 1I39A 1FXXA 2BQ3A 1RTJB 3G25A 3SDEB 4PY5A 3HOSA 5F8GA 5EN1A 3I9ZA 4DV1F 1VBZA 2VICA 3ZSZA 2OPSA 2DNNA 1SVDA 3OFGA 3TA2A 4AF1A 3VESA 4DL2A 2EXUA 1XNRK 3KK3B 3WNGA 2R2SA 2I1RA 3T6JA 1T9VA 3WNFA 2XTJP 3I0RA 4B17A 2FC9A 5I3QA 1RTHA 2YX4A 3F9MA 2W2NP 2N4CA 3DOLB 1BI4A 4RCHA 2OI2A 4OGCA 3DOKB 1K9MO 4KFBB 5J1EA 4J2BA 3M32B 2DEJA 1L3VA 3F9KA 5HRSA 2RIJA 3DYAB 3IM9A 1TL7B 4ICLB 1B9DA 3L7UA 4HT5A 1SJQA 2XZWA 2ZJPQ 2O8CB 4Z0UA 1BCOA 1N33J 4DUYF 4XH1A 2R7RA 4OV1A 1QQMA 5F3TA 5L38A 1QHTA 3C8YA 4MT1A 2KFYA 5C25B 4DWIA 2QEXN 5F8NA 4JI1F 3OA9A 3PYEA 3C14B 1FRJA 4EO6A 1CPZA 4HHUA 2DNRA 3C16B 4QPXA 1RWXB 4WF9Q 3CPWM 3UWTA 5AQXA 3NVKA 3CPEA 3PX0A 2Y1JA 1UA0A 4RL1A 2P51A 2BOAA 2GVDA 1K8AO 3KLHA 1YT3A 4H4KA 1WORA 4GMJB 3O08A 1APSA 4X2BA 3X1LB 4L75A 3M2VB 3NOGA 4CNZA 1Y5NB 4J9QA 3GIRA 3KG1A 3HMJG 3CD0A 5F41A 3V4MA 1OVYA 3QIPA 2RDDA 3CJKA 3UCUP 4X64J 2XB2D 3IFEA 2OMLA 1Q1KA 3PJXA 3TEGA 1VQNS 4FPBA 1LOTB 2OPQA 2FVPA 4JD2A 4GO7X 3QLHB 2GVZA 2OA8A 2VQEJ 2HS0A 4LRCA 1NGEA 5KGWA 1TFYA 5T7LA 4O8UA 4L74A 3PW2A 2VG5B 4P7TA 1HI0P 2MKCA 4FKXA 3C6UB 4D3GA 4EMDA 3BJYA 2NNWA 1PSDA 2ZHOA 1VQ4S 3UDEA 2JEFA 4CFAA 3PXGa 2G0JA 1TKXA 3M2RB 2DCUB 2SXLA 2QMUB 3CCMS 4ZKAA 3TO8A 2ACYA 3A3OB 5GAHI 1D4XA 3QO9A 1WDTA 4EYHB 4ZPBA 4CK2A 4RW4B 1ROFA 2K2PA 4KH1B 5IOLA 3WQUA 4IOBA 4CF2A 3S3OA 4R79A 4Y2IA 4FJIA 4CD1A 2W41A 4DU8A 5GIOA 3VGSA 4H0TB 1XUPO 4XH4A 4NXNK 2QLFB 2MHEA 4IOXA 4W98A 3S3MA 1FK9B 2U1AA 1D1UA 4X66J 2HZVA 3CQYA 4ENOA 2Z2LA 1VQ6N 4LF4F 4A46A 5BR9A 2PI4A 3CM5A 4CIEA 3DRYA 1H7XA 2KFZA 3OS1A 2B3TB 4FWOA 4OX9K 2DT9A 2ILZA 2WZ1A 3DCAA 4PG6A 2CVEA 4CBUA 5JUMA 1UVMA 3AA4A 2FUG9 2MKJA 4CJ5A 2PYJA 3OHRA 4ES3A 1YXQA 3QFUA 2ZKTA 5IV3A 2FHJA 2DNGA 5EX0A 2E1AA 5EY4A 2H65B 1M1GA 1S6PB 2IJFA 5B0EA 4CEEA 2JVOA 3ZCMA 1XMQK 3NG8A 5AQPA 2F4VJ 5KFEA 1ZBFA 3ENOA 1R0BG 5J2PA 3ENWA 4H8KA 4NCAA 5G4DA 3AY9A 4DN0A 1XHZA 1NK5A 3VF6A 1BU6O 2QIFA 4FJNA 2R8KA 1BC6A 2XMWA 1FDNA 3CCRN 5A76A 3F0NA 4FZXC 3VQ7A 2UUAK 1LXNA 4A8KA 2HNYB 1ATRA 3ZZZA 1TP7A 1X5PA 2Q36A 4I9LA 2M88A 4UQTA 4BY9C 1UJ5A 4OI4A 4BLGA 1J5EJ 4CEDA 3BQ2A 1OH6A 1GEHA 2R7YA 1RBOB 1RBAA 1D5AA 5MAOA 5CR4A 1C0GA 1DT9A 4UZBA 4JV1A 4CJWA 3TAGA 2HPUA 4TLRA 1U8WA 2UXCF 3TRGA 4JHDB 4U9RA 3EMTA 4MKBA 4JP8A 5CAAA 1YIJS 2ZD1A 1J5OB 4RW6B 4DR1K 1DAXA 2NREA 4GVMA 2ASPA