1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
4QWCA 1WAJA 1MU2A 3KK1A 2XWYA 1S9GB 4Z4GA 1RBRA 4CGGA 5K14B 4QWEA 5HRSA 3ZSZA 4ED1A 1S0MA 5KFSA 4O3RA 4KHQA 4CHYA 2YKNB 2YV0X 4OGEA 4B9LA 5KFFA 3RR8A 3H5XA 4CJUA 1IM4A 4J9MA 4Q8FA 3HM9A 1NK8A 1QHTA 4MK7A 4DQSA 1I3AA 3EZUA 3SFUA 2C22A 4FM0A 1I6JA 4NCBA 3C95A 2DY4A 4TQRA 3KLGB 2HHSA 2R2SA 2UUWA 1RT6B 4DTRA 1CLQA 4FLYA 4NLUA 4AHSA 1S6QA 3T1AA 3CDEA 4ED6A 4E0DA 1NK4A 3KD1E 2DPIA 2LSNA 1IKXA 1N48A 1EETA 3A2FA 4ZPAA 3TAQA 5J2MA 4ID1A 3M8QA 1JX4A 4LSNB 4TYAA 3BQ1A 3L2RA 1VRTA 4NLPA 4EBEA 5DLGA 4CK1A 1HMVA 5KRSA 5KFZA 1S1VB 3KOAA 3ZT1A 1NKCA 3VQQA 2RF2A 2OYQA 2UVWA 1WSGA 1RT5A 4DSLA 2AQ4A 4IR1A 4E89A 3K2PA 4FJHA 4YR2A 1MU2B 4CF1A 2XO7A 4AH9A 4F4KA 4FLUA 3V81A 1EP4A 1I39A 1L3SA 4W5TA 3QINA 3GIJA 2VG6A 1NK0A 3TANA 4UQGA 3NF9A 4B08A 3SV4A 1D0EA 2D5RA 1A5VA 3KLFA 1L3TA 4IRKA 3QGHA 3CYMA 3AA5X 3HYFA 2AGQA 3DLEB 2FBYA 5HRNA 3CFPA 4OGCA 4KAZA 4O3NA 3HXMA 2R8GA 1LAVA 4CGHA 2W7OA 1HYZA 4FM2A 3ZT0A 1S6QB 4ZHRA 3HVTA 2OPRA 3SJJA 2ALZA 1IKXB 4NLQA 1EETB 1ZBIA 1EKEA 5J2MB 3M8QB 4DSIA 4AHTA 4KTZA 4Q45A 1VRTB 1TQLA 4TY9A 1HMVB 4W5NA 1TKDA 1X1PA 4Y2AA 2RF2B 3QYYA 4M3UA 1RT5B 4I2PA 3IGVA 3RRHA 2ASDA 4CHQA 1RT7A 1TKXA 4ICLA 4PUOA 3H98A 3V81B 5DG7A 1EP4B 5EWEA 3NH2A 4QAGA 4Q43A 1UOCA 4NLTA 3NF8A 4YR0A 3DLBA 2BE2A 2VG6B 4KRFA 1J5OA 4K4WA 4FXDA 3DM2A 1UWBA 3KLFB 4XIUA 4WZMA 4ELTA 4W5RA 4C8MA 4M3ZA 2HVHA 3I5AA 3NAEA 4ED3A 2KZMA 4J2BA 4RUAA 4ZHRB 1ASUA 3HVTB 3T19A 3L8BA 2OPRB 4ZP8A 4M3XA 4DL3A 3QZ7A 3ZSQA 4TLRA 3H5UA 4RNHA 2WTFA 1WLJA 3IG1B 1LW2A 3OY9A 1SH0A 3SNNA 3MR3A 1TK8A 4I2PB 4KV8A 4DLEA 4C8OA 3CVKA 1RT7B 4OVLA 1TKXB 1D9DA 1DLOA 1RDRA 1U4BA 3VQBA 4ICLB 4PUOB 4XPCA 5DLFA 2RN2A 3N6LA 5L9XA 2KW4A 3OS1A 2YNFA 3F73A 1L5UA 2BE2B 3H4BA 4E3SA 4RNOA 3V9WA 4O55A 1QUVA 2R8HA 3GIMA 2WRMA 3GYNA 3AO3A 4JV2A 4RW7A 3WNGA 1UWBB 4IH6A 3PHEA 3SZ2A 1N6QA 1RTIA 4E7KA 5HRRA 4CJKA 1QTMA 2V4RA 5KFJA 2HHWA 3GILA 3Q8PB 5KFVA 2D0CA 2UVUA 2ATQA 4KHMA 3DOLA 3NDKA 4Y1DA 1NJZA 3LWMA 4R5PA 5C5JA 4RU9A 4OPKA 1C0UB 3RBEA 3AO1A 4CFDA 2OA8A 3MXMA 5I42A 3SQ2A 3DRPA 5F8IA 2P5GA 2W7PA 4WXWA 2FVCA 1RNHA 3Q8RB 3V1OA 4DU4A 2VWJA 4DFMA 4DTNA 2IM3A 2NUBA 4KV8B 3AA4A 4CJWA 4EP4A 2E6LA 1DLOB 1S1XA 2W42A 1JLAA 1BISA 5KT6A 3ZT3A 3BQ2A 4DTPA 4HHTA 3HJFA 1RT1A 5T14A 2YNFB 1ZBHA 1SKSA 4OLBA 1KVCA 4DL7A 5JS2A 3KKRA 3H08A 4X2BA 3PY8A 2IGIA 5F8GA 4FJ9A 4RW7B 2RDIA 1N6QB 3KLHB 3PO5A 5KT5A 3OS0A 1RTIB 4I9LA 3SUNA 3RBDA 1SL2A 3ICLA 1RTDA 1TKTB 1S9EA 3HK2A 4RW9A 4O0JA 3DOLB 1BIZA 4CCHA 4R8UA 4R5PB 3RB6A 2IC3A 4M3YA 3ZSOA 1MMLA 3D28A 3OL8A 4DF8A 5EWGA 2WK4A 4B9MA 4OPJA 2QV6A 5I42B 1SH2A 3DRPB 5KFHA 4WYLA 4FLZA 4LH5A 3WNFA 4DWIA 3M9NB 2OPPA 4RW4A 4L8RB 2WB4A 3T5LA 2R8KA 3CM5A 4M3WA 4PA1A 1N4LA 4JRPA 4ED8A 1JLQA 5JS1A 3N6MA 1S1XB 1ZBFA 1K1QA 1JLAB 1J53A 4B9TA 4EBCA 3LZJA 4KBIA 2P1JA 1Q9YA 2JEIA 4CEZA 1BCOA 1RT1B 5D3GA 5KFLA 2D41A 3KMQA 1VSFA 3QIOA 4F4WA 1VSLA 2DPJA 1LWEA 1CSJA 4IFVA 1TAUA 5KFXA 5DG9A 1BL3A 2R2TA 4K50A 3S3NA 4E7LA 2P51A 1N5YA 2E9RX 2PZSA 1RTDB 1S9EB 3CDWA 2Z1GA 4RW9B 4EEYA 3EZ5A 4DF4A 4IDKA 2FLPA 1RA7A 3RMAA 4R8UB 4FJ5A 1CZ9A 2IC3B 1S9FA 2G8IA 4ZVHA 3G10A 1T03A 3THVA 1JL2A 3DRSA 4O0IA 4DTSA 3M8PA 2QE5A 3IRXB 1RA6A 2DTUA 4E7IA 1C0TA 1YVFA 3AVAA 3T5KA 2BRLA 2ATLA 1ZBUA 3FFIA 3KTQA 3KHRA 4RW6A 2IAJA 1NHVA 2FLLA 1JLQB 2ILYA 2OPSA 5KT2A 4ZVEA 4Q0BA 2C28A 3PUFA 1XHXA 4KHSA 1O1WA 3VN5A 4OKJA 1RT3A 4DSFA 4E7HA 2A1RA 3BSOA 5KFEA 1LWEB 4IFVB 3AVCA 3NGYA 3GQCA 3KLIA 3VQDA 3V9XA 2X6NA 2A1SA 3H5SA 3SV3A 2HHXA 1N5YB 1EXQA 4MK8A 1ZTTA 3G6XA 1TAQA 4FJKA 4CHNA 3CJ2A 5KFKA 4Y2CA 3M8RA 2E6MA 4DFJA 3HVWA 3SFGA 5KG0A 5J2PA 2HHQA 4NYFA 1T03B 2WHOA 4FCYA 3DRSB 2FBTA 4DTMA 3TAMA 4FW2A 1C6VA 4TY8A 1QQCA 3M8PB 2AX0A 2BDPA 4CGFA 3RB0A 3O3HA 1C0TB 3IS9A 3VQCA 2ZQBA 2O5DA 4EZ9A 3FFIB 4CHZA 2VWKA 2IAJB 1X9SA 4PY5A 2OPSB 4Q0BB 2PYJA 1RT4A 4KHUA 4DG1A 3AVLA 4W5OA 1VSMA 1S9GA 1S4FA 2XI3A 4ED7A 2HW3A 2W9CA 4CJTA 4NRTA 4E1MA 4F8RA 3PW4A 2WCXA 3KLIB 3H5YA 3HP9A 4Z4HA 2OZMA 3LANA 3OYHA 2YHAA 3OS2A 4ZPCA 4FBTA 1U47A 2FC0A 2DFHA 1WSIA 4TN2A 4I2QA 4K4VA 4DTXA 1FK9A 3G0ZA 5J2PB 3MFHA 4NLDA 4ECXA 3OLAA 3EPIA 3L3UA 3OJSA 3O3GA 3TAMB 4TY8B 2RKIA 1IKYA 2VA2A 2ASLA 4FJ8A 4WXOA 3G6YA 1RTJA 5C25A 3IS9B 4ECRA 3P1GA 4ECQA 3QEPA 1VSHA 4CF2A 4HCBA 2XCAA 4EYHB 5F8JA 1RT4B 1U49A 1U48A 3L2UA 3QESA 1ZETA 4DG1B 4F4YA 1U09A 1SKRA 5L1IA 2RDJA 4DLGA 4B8CA 4H4OA 2W9CB 5KG1A 2I1RA 4ECWA 1REVA 3LAKA 4URGA 4YQWA 3PJWA 2UVRA 2ZKUA 3VA0A 3I0RA 3VQ7A 4LH4A 2FVRA 4E1NA 4DL2A 3QEWA 1Q9XA 3DLEA 1NK7A 4FLXA 4I2QB 3OVNA 1FK9B 1FKPA 3M9MB 4MK9A 3QLHA 4FVMA 4CHOA 2IDOA 5KG2A 3PW2A 5F9LA 4M3TA 4MKAA 2RKIB 2F96A 3OYCA 3QEXA 1IKYB 5CZ2A 2I5JA 4GVMA 4DS4A 1RTJB 5C25B 2HNYA 3ISNC 2IOCA 3VQ4A 4J9PA 4CFBA 3PO4A 4RNFA 4BDZA 1XI1A 4K8ZA 3HHKA 1T94A 3QGGA 3V9SA 4IH5A 3SUQA 4B9UA 4ECYA 3CQ8A 2ASJA 1XR6A 4CEAA 3V9ZA 5KFIA 4WFXA 1UAXA 1WSHA 2Z1JA 4H4OB 3U3YA 1S10A 1TVRB 4ZMMA 4CJEA 4KREA 3S3OA 1RTHA 1REVB 4K4UA 2GBZA 4J2AA 3RMBA 3RB3A 1N56A 3C6TA 1R0AA 4JV0A 2J6SA 2EX3A 4NCGA 3I0RB 3B6OA 3U6FA 1L3VA 1WSJA 5HROA 3KK3A 3HPOA 3H4DA 3D5MA 1HNIA 2YNIA 2ETJA 3OYGA 1FKPB 3CJ4A 4K4TA 3QLHB 4ELUA 3AV9A 3ZSXA 4AHVA 4DSJA 4QPXA 4ELVA 2JEFA 3SQ1A 2I5JB 4IBNA 4AHCA 1NKEA 4LY7A 2HNYB 3IG1A 4ECTA 4OKEA 1U04A 4O4GA 2E9ZA 3RB4A 1QSSA 4EO6A 3NGDA 4O3PA 4CJFA 3M8SA 4LQ3A 1B92A 3MF5A 3AA2A 4M42A 4O44A 2HWIA 2C2DA 4CJVA 4KFBA 3K58A 1RTHB 4O3SA 1SL0A 3PR4A 3OJUA 1FKOA 4QW8A 3DDKA 2HNZA 4EO8A 3C6TB 5J2NA 1R0AB 4J9OA 4E19A 3S3MA 4NCGB 2CJQA 3OL6A 3PZPA 4ZTFA 1S1UA 4DEZA 4KI6A 4H54A 1SL1A 5HROB 3KK3B 3KLEB 1JXLA 1HNIB 2YNIB 4QW9A 1VK0A 2Z1HA 4GW6A 3NH1A 1C0UA 1DTQB 3BREA 1RILA 2BGGA 3QO9A 4DS5A 3AO5A 3LPUA 2AGPA 3IGNA 3OL7A 1RDCA 2VG7A 3GV5B 4I7FA 2FJWA 5F8HA 5KFTA 4O4GB 4J9LA 1KVBA 3BGRA 5KG3A 1NKBA 4Z4IA 3FDSA 3ZCMA 3OL9A 1RBUA 4J9NA 4GC7A 1KVAA 3GV8B 2FLNA 2D3UA 2IBKA 4BWJA 4O44B 5HBMA 3ALYA 4JRQA 4FK2A 3MECA 4HUFA 4KFBB 5L1JA 1VSJA 1IH7A 4DU3A 2QKBA 4K8XA 1FKOB 3KD5E 3NCIA 2HNZB 3VQEA 5J2NB 5CYQA 2FVQA 2IA6A 4Q5VA 4FLWA 4FK4A 3KLHA 2YNGA 1C1CA 1S1UB 4KO0A 4FS2A 1TK5A 2X6SA 4JLHA 3V6KA 4CFAA 1JKHA 3L3VA 1TKTA 2JGUA 3NKYA 5KFWA 3DMJA 2ILZA 3NGZA 1TL1A 1JLFA 4R0EA 4ECVA 1B9DA 4FZYA 1YTAA 3QO9B 5KFOA 1GOBA 4YNQA 3T3FA 4BDYA 1LWFA 4F2SA 3BJYA 2VG7B 2KFZA 4I7FB 4ZVFA 3KJVA 3K59A 3U3GA 2HHTA 1HARA 1S6PA 4FJJA 3BGRB 3ITHA 4KE5A 2QKKA 1UA1A 1WSEA 5KRTA 1HYSA 3EPGA 3VQ5A 2XGPA 3OYFA 3MXIA 1QSYA 4NYZA 5DQGA 4M45A 5HBMB 3MECB 1NJXA 5EU7A 4GMJB 1RDAA 3DLKA 5CYQB 4CECA 1FXXA 4DQRA 2YNGB 4HKQA 1C1CB 2FVSA 4KO0B 4NLXA 2GC8A 3QGIA 3PX6A 4Y34A 1JKHB 3ZSWA 4RNNA 4FW1A 3K5NA 3RRGA 3DMJB 1TL1B 1JLFB 4N56A 5F8LA 4NLVA 4CFCA 1BHLA 1U45A 2FJVA 1SH3A 3OYDA 2UVVA 4ID5A 1LWFB 4O5BA 4H4MB 2G8KA 4IRCA 1KLMA 3KJVB 4ZP6A 4U6PA 3SI6A 1NK9A 1C1AA 3IRXA 4FYDA 1S6PB 1B9FA 4CF9A 3ITHB 2EC0A 2R2RA 3O3FA 1WSFA 1HYSB 1IKWB 1ASVA 3KKSA 3SI8A 4W5QA 2O4IA 4RNMA 3OYMA 3CFOA 4KSEB 1VRUA 2P5OA 3SQ4A 3CO9A 3HSTB 4DU1A 3K5OA 1S48A 2R8IA 3DLKB 1S1TB 4ECSA 4OL8A 3NL0A 1C0MA 1S49A 5CY4A 2JEGA 4CJ4A 4OJRA 4MH8A 5FROA 4J9KA 4KHRA 1JIHA 3G6VA 3HL8A 4FZXC 3PW0A 3OYJA 2XY6A 4OKKA 3V6JA 4DTOA 4CJQA 4TQSA 3VQPA 4ID5B 5KT3A 4CJLA 2AU0A 4HUGA 1KHWA 1KLMB 3CDUA 3CJ0A 5EWFA 4FLTA 3VA3A 1W25A 4Z4FA 3NF6A 4G3IA 2FBVA 4Y1CA 5KGXA 3C6UA 4JS5A 3KHGA 1KLNA 4YFUA 5KTQA 5J2QB 4QOZB 3AVKA 4DQQA 2D7SA 5EDWA 4NLYA 1Q8IA 3HVAA 2J6UA 3PX4A 5CYMA 1VRUB 3G86A 2AWZA 3DYAA 3NH0A 3MR6A 1NNDA 4ZPBA 4RUCA 5KGWA 4MFBA 3CJ3A 2HNDB 1KCFA 3OYLA 2IS3A 5HP1B 4JUZA 1ZYQA 4FJIA 3HKWA 1SUQA 4H8KA 1LAWA 5C42B 4IRDA 3QETA 3SUPA 1LV5A 3F9KA 4I9QA 4YR3A 1VSEA 4NLOA 4MIBA 3SCXA 2BQUA 2Z1IA 3CJ5A 4CJ3A 1NK5A 3AVNA 1LWCA 3C6UB 2BR0A 4C8LA 5KFMA 4AHUA 1RCHA 4Y3CA 2KZZA 1RDBA 2JEJA 1WN7A 1IG9A 3UIQA 1HQEA 4IFYA 2F8EX 4J2EA 4WE1A 5CYMB 1HPZA 1Z26A 3CM6A 3TQ1A 3DYAB 3V1RA 3FQLA 1NHUA 1D5AA 3BQ0A 3TAEA 4RZRA 1WNSA 4MFBB 1QSLA 1TKZA 1T3NA 3I8DA 3HO1A 1J9AA 1VSIA 4NLGA 3VQSA 3VQ9A 4IOBA 1XR5A 3FQKA 1BIUA 3V9UA 3DI6A 4CEDA 2E9TA 1NJWA 1SUQB 3OYIA 1S97A 4Z4CA 1A5WA 3M9OB 3V4IA 4K4SA 5KG4A 4GC6A 3Q8QB 3SPZA 4ECZA 2BQRA 3V6DB 3C94A 2X78A 1IO2A 4URSA 2RPIA 4PWDA 2Y1IA 2ZD1A 2X74A 5KFRA 3WNEA 2XCPA 4JV1A 3P5JA 2JLEA 5KT4A 4FS1A 1LWCB 4N47A 1NK6A 4ECUA 1BQNA 4CEBA 3OYEA 4ZPDA 4F50A 3OLBA 2HMIA 4MQ3A 2WOMA 1HQEB 3AVIA 4IFYB 4NZ0A 3QERA 4WE1B 1HPZB 2W8KA 1L3UA 3PW5A 3MEGB 2BANA 1TVRA 3SUOA 5DGBA 4M94A 2PY5A 1TKZB 5KFQA 1RBSA 2XRIA 4MKBA 2AGOA 3BDPA 2B43A 4FZZA 3DI6B 2R8JA 2JC0A 1HRHA 3PJXA 4KI4A 3I0SA 3LPTA 3RTVA 3NAHA 3V4IB 3MEDA 2AJQA 1CXUA 4K4ZA 4EBDA 1CXQA 4CEEA 3KHHA 1YT3A 3QEVA 3EYZA 4PWDB 3BSNA 2ZD1B 1JL1A 3QNOA 4FBUA 4IR9A 1WAFA 4Q44A 4F4ZA 4LSLA 4NLWA 5DQHA 2W9AA 3MFIA 4WYWA 1W9HA 4O3OA 5FDLB 1JLEA 4N41A 1BQNB 3OHAA 1S1WB 3ISND 1ITGA 2F8SA 5FRMA 2HMIB 4DL5A 3JYTA 1JLCA 3KK2A 2WOMB 4CESA 2VA3A 1EX4A 2CKWA 5KFPA 1QAJA 1GX5A 5KFDA 4U7CA 4HYKA 3HPGA 4FJ7A 2BANB 5DK5A 3E01A 4DQPA 3TVKA 1LW0A 2C2RA 4FJNA 1OS5A 3JSMA 5KG7A 5DG8A 2HHUA 5CZ1A 4Z0UA 5DQIA 4LQ9A 4KHWA 1SKWA 2D3ZA 2QK9A 1NJYA 1JLGA 4ED2A 3ZSVA 4Z4EA 3LZIA 4DSKA 3KK1B 3I0SB 2IMWP 5F8MA 5KFNA 3AVFA 3MEDB 5HLFA 1IKVA 4DSEA 3KLEA 4HUEA 5KG6A 2ZE2A 2W9BA 2AX1A 2V0NA 5KFAA 5EUHA 1RDDA 1DTQA 4G1QA 3AVJA 4O3QA 4LSLB 4CIFA 4ED0A 2EHGA 1T7PA 4NRUA 3UPFA 1QS4A 4CIGA 2V4QA 1BGXT 1K6YA 1JLEB 3MAQA 3L2WA 4F4XA 1Z4UA 4NLSA 4BE2A 3JYTB 5KFGA 1JLCB 3KK2B 2IM2A 4FJGA 2IM0A 1SV5A 1RT2A 4EYIB 3HT3A 4WFZA 3LP3A 4FJLA 3E01B 1C2PA 1LW0B 3MR2A 1HYVA 3HPHA 3ZT4A 3JSMB 3ZT2A 3PVXA 4DFPA 5T7BA 3DOKA 1KRPA 1QAIA 4CGJA 5HRPA 4FM1A 1JLGB 2YNHA 1F21A 3CFRA 5HLFB 1IKVB 1KSPA 4IKFA 1Y97A 3NF7A 4DL6A 2ZE2B 2W9BB 4KB1A 5JXSA 1JLBA 1BI4A 1NOYA 3MTKA 5C24A 4O4RA 2QXFA 4G1QB 4Q8EA 2F8TA 5SZTA 3NHGA 4CF8A 4FLVA 4DMNA 3NBPA 4TSXA 1C1BA 2HWHA 5E41A 2VG5A 3O4NA 4CERA 4CF0A 3ULDA 4E7JA 3RAXA 4AHRA 1TL3A 4CE9A 4IH7A 2G8HA 3MXJA 3AVHA 4M3RA 2O4GA 4EP5A 3OYAA 1SV5B 1RT2B 4B9NA 2JC1A 4CEFA 3KHLA 4J9QA 4F3TA 3BSCA 3I5CA 3K5MA 1VSDA 4LD0A 3ZSRA 2B5JA 1S0NA 3UDLA 1BCMA 2D0AA 4BDPA 3DOKB 3B6PA 4ZP9A 1TV6A 3NMAA 2YNHB 3AO4A 4KAIA 4J9SA 3QEIA 3HVRA 1DTTA 1GOAA 2ITGA 1JLBB 4CK3A 1BI4B 2HB5A 4B8AB 2KFNA 5C24B 1J5OB 4K4YA 4B9VA 3DM2B 2XY7A 4N76A 1WNEA 3TARA 1RAJA 4WZQA 3MR5A 3PR5B 4CEQA 3NBPB 4H4MA 3GV7B 1C1BB 1HJRA 2VG5B 3K5LA 4TXSA 2GV9A 5FRNA 3PW7A 3OHBA 3DLRA 5SWMA 1TL3B 3P83D 4CJPA 1KFDA 2OPQA 2GIQA 4HCCA 3RMCA 1T05A 3T5HA 3NAIA 2G8WA 1IKWA 4J9RA 3H2LA 1XHZA 1HNVA 1LW2B 4KB7A 1TGOA 4KTWA 2B5JB 4BE1A 2B6AA 3LP2A 5DGAA 1TV6B 1S1TA 4YMEA 3BSAA 4NCAA 4FJXA 2DFFA 4BWMA 4OLAA 2XY5A 3AA3A 3L2VA 4KKOA 3SQ0A 1KFSA 3V1QA 1DTTB 4B9SA 3AVBA 2G8UA 1D9FA 3VQAA 2XC9A 4FK0A 1JXEA 3VQ6A 4M95A 3DLHA 4PQUA 3OSPA 1BQMA 1XR7A 3LP0A 4KHNA 3RAQA 1RYSA 4F3OA 1QE1A 3QIPA 2OPQB 3QIDA 1T05B 4CJSA 5J2QA 3KIOA 4IG3A 3O4QA 1X9MA 3LAMA 1HNVB 2B4JA 5KFUA 2OH2A 4BACA 1UA0A 5L1LA 3AO2A 3BR9A 4QWBA 2B6AB 3LP2B 3LP1A 3NFAA 3UQSA 1RBTA 2HNDA 3H40A 1CZBA 4DQIA 2KTQA 2V9WA 1S5JA 4NLRA 3HP6A 5HP1A 4M41A 5KT7A 4KKOB 3CIZA 2G8FA 3SPYA 5C42A 4IQXA 1A5XA 4DL4A 2Q3SA 3T5JA 3OYBA 2XY8A 4HVJA 4CJ5A 4IKAA 4PQUB 3RMDA 1YTUA 4B3OA 4KB0A 3FRZA 4RW8A 1BQMB 2FJXA 3PX0A 3NGIA 3S9HA 2G8VA 4XPEA 1HQUA 1D1UA 3RR7A 3LP0B 2D0BA 3ASMA 2J6TA 1GX6A 1QE1B 3QIPB 3UR0A 4K4XA 3SYZA 3QNNA 4WFYA 4KHYA 2GUIA 2YHBA 4IG3B 5KFYA 3N6NA 3OSNA 4CJRA 4KPYA 4NYNA 3PV8A 2OPPB 4RW4B 1GOCA 3QZ8A 4XO0A 3LP1B 4BE0A 1XC9A 3VQ8A 4CIEA 3OYNA 4IG0A 4ZTJA 4DFKA 5JUMA 2IJNA 3LDSA 4FJMA 1NOZA 5I3UA 5D3GB 3TAPA 3E51A 1KTQA 3L2QA 5KG5A 3CG7A 3MEEA 4TYBA 5DMRA 3V6DA 4N5SA 5F8NA 2IM1A 4HTUA 4B3OB 3LALA 3IN5A 4J2DA 4RW8B 3TR8A 3Q8SB 4C8KA 3H59A 1X9WA 1HQUB 1JXBA 1ZTWA 2HHVA 1W0HA 4QWDA 4IDKB 2W8LA 5L1KA 3DLGA 2HVIA 3I5BA 3NE6A 3D45A 2R2UA 4RG8A 2XHBA 2FBXA 1T8EA 4DTUA 2C2EA 5KI6A 4KTQA 4YP3A 1RYRA 3KNAA 5F9NA 3GIIA 4ZP7A 3GIKA 3D0PA 1J54A 4C8NA 1TK0A 1XWLA 2IJFA 2Y1JA 3TI0A 3MEGA 5KFBA 4AILC 2YKMA 5J1EA 1ZBLA 4RW6B 2WONA 3DRRA 4IG0B 1K1SA 1VSKA 2XI2A 4JS4A 3TAFA 2XGQA 5I3UB 1RT3B 4CEOA 2OZSA 5K14A 3MEEB 2GIRA 3KLVA 3TABA 3IAYA 1KHVA 3ZSYA 3LWLA 2DFEA 2YKNA 2R7YA 2KQ2A 3KMSA 1D8YA 2E4LA 4F2RA 1ASWA 1RBVA 4EZ6A 4MIAA 3RWUA 2PYLA 4URQU 4QWAA 3DLGB 1Z25A 4QCLA 2UUTA 5FDLA 3KLGA 3V6HA 1S1WA 3EY1A 3TAGA 1RT6A 4CK2A 3AVGA 1S0OA 3K57A 1G15A 4DTJA 2HAIA 2BRKA 4CHPA 2BQ3A 4CGIA 2FVPA 3OYKA 1YVUA 4LSNA 4ZVGA 2YKMB 5J1EB 3TWHA 3FSIA 1TP7A 3AVMA 1S1VA 2WONB 3WNHA 4CGDA 3DRRB 5KFCA 3CWJA
chains in the Genus database with same CATH superfamily
2HFOA 2XWYA 1S9GB 4Z4GA 2WVFA 4CGGA 1R8HA 2OEKA 3ZSZA 5IT9O 4K25A 1S0MA 1PILA 2OCEA 3AQPA 3B54A 1Z2ZA 3VAIA 4DUTA 2YV0X 4YB7A 1EAYC 3GTYX 2ZGYA 4MK7A 5A0YB 3EZUA 4TU9A 3SFUA 3CMES 2HS3A 2W4CA 2C22A 3UVJB 3W64A 1VQSA 4TQRA 4V19S 3KLGB 2HHSA 2R2SA 1ATSA 2KT5A 2UUWA 1B0TA 2DY1A 4NPOA 2MKJA 4DTRA 2FGOA 4E0DA 2DPIA 2LSNA 2OGUA 2VFSA 2XS7A 3FE1A 3HHLD 3ENBA 2DGOA 5J2MA 4WP3A 4A4JA 3PRVA 1DHMA 4TYAA 1YJNS 3E3XA 4WIIA 3W60A 5DLGA 5KFZA 1SB6A 3ZT1A 2RF2A 1M0SA 3M30B 2UVWA 1RT5A 4DSLA 3AOAA 2EK1A 3BO4A 2FTRA 2P9IB 4YR2A 1MU2B 2XO7A 4FJHA 4AH9A 3HHDA 4FLUA 5IV4A 2RSQA 4WU3A 4W5TA 3TOQA 3QINA 1HNZJ 5IWAF 4CYUA 4QR0A 3EVWA 1KAZA 3C14B 3Q0AA 4CBXA 2B4UA 1G6BA 2K3KA 2R8GA 1LAVA 2DNRA 4CGHA 2W7OA 2YPZA 1UPMB 2EPIA 4OIXA 4YOTA 2CQPA 1W2IA 3M8QB 1R27B 2K7KA 4KTZA 3PEJA 4TY9A 1HMVB 4W5NA 5LMUJ 4Y2AA 1SAZA 3RRHA 2ASDA 1TKXA 3L9ZA 1D3WA 1SQKA 2UXCJ 2YX6A 2BMBA 1RAIB 1VQPS 4YR0A 2A6MA 2VG6B 4FSVA 5A8RB 2Y0SD 4KRFA 4W4MA 3G25A 3RZAA 1ITPA 3W2WA 3L7PA 3KLFB 4ELTA 2BW7A 1U1KA 2XSFA 3DOMA 4QIVA 2FF6A 1KC8O 4LBHA 2M4MA 4M3ZA 2HVHA 2KZMA 3OTDA 4LF5F 3MM8A 4J2BA 3PKYA 4CO4A 3U1LA 4CDIA 2OP5A 3ZSQA 3AOBA 3H5UA 1WLJA 2P2CB 3KHYA 2XEXA 3FK4A 3MR3A 1TK8A 4DV3F 1OWXA 1D9DA 4OVLA 1RDRA 4X62K 4P74A 4IOAQ 4ICLB 4PUOB 4QIEA 2EKYA 4B3MF 2C3OA 2WVBA 3GP9A 1L5UA 2BE2B 3V2UC 5BPMA 4E3SA 3V9WA 4C0HA 3GYNA 3AO3A 2KYXA 1HWLA 3PHEA 4FZVA 4YS2A 4YORA 5IV3A 1MMDA 3T1YF 4CJKA 1QTMA 2A0FB 2V4RA 5KFJA 5E84A 2HHWA 1GLCG 3GILA 3Q8PB 1HNXJ 3NDKA 5FPNA 4R5PA 3GFYA 1UP1A 2L41A 5C5JA 1RWNB 1KAYA 2DO0A 3AO1A 2EFVA 2E1PA 5J1PA 2NZCA 3SQ2A 2BJ7A 5F8IA 4NEZA 2W7PA 4QR1A 3V1OA 2ZH8A 4YHHK 2GA7A 4GKKJ 2MLZA 2NUBA 1RI7A 4LIRA 4DV5F 2R7OA 3ILOA 4CLLA 3D1OA 1S1XA 3VAHA 8AT1B 3QNWB 1BISA 3VTHA 2K1RB 4J5OA 3B8AX 5LSOA 1VCTA 2VPZB 2QA4N 4CLWA 3UW1A 1RT1A 1RHRB 3HJFA 1KVCA 4DL7A 5JS2A 3MMCA 3H08A 3OD2A 3ZZUA 3PY8A 3CCES 4PRFA 4FJ9A 4P2SA 1WG1A 2RDIA 3POTB 4ZPTR 1M5VC 5KT5A 5AQZA 3OS0A 2R7WA 4I9LA 1SL2A 4ZOSA 1RTDA 2ATCB 4DR4J 3HK2A 4O0JA 1ZPWX 1VBZA 4A62A 1NSPA 2OMOA 4R8UA 4Y6IA 4Y2MA 2IC3A 2AYMA 2A42A 3BEGB 4KHPF 3W9IA 1H2VZ 1PBAA 2CQ0A 1KOOA 2X3GA 3TW0A 1TFWA 5I42B 3OW2R 3C66A 2QWNA 4DWIA 2PBDA 3M9NB 3SLCA 2VCPA 5HJYA 4F0KA 1XNRK 4GVLA 3GDQA 3BN7A 2VICA 4CWBA 1JLQA 4QIGA 1JLAB 1SKUB 4B9TA 4EBCA 4LF1A 1IBLF 4X4QA 1BCOA 2IFXA 2DRAA 2AHOB 5D3GA 2DR9A 3KJQB 1WKLA 3KMQA 5H1SV 2KT2A 5GADP 1VSLA 2DPJA 2ZBRA 2HRUA 1R31A 4YY3K 4K50A 1N5YA 2LEPA 1S9EB 4RW9B 2CJYB 3EZ5A 4DF4A 1NDKA 2HKEA 2N7CA 1S9FA 5ETOA 4DBQA 3WUHA 3IC1A 3RSEA 1SBRA 2DNMA 3MTJA 3THVA 3CC4S 3DRSA 1JNZB 3RBZA 4NXNJ 3DDIA 4I6YA 2QE5A 5T41A 3IRXB 3AJ1A 2E2QA 2KG1A 3ZZZA 4OX9J 4JI6K 3AVAA 2QZ8A 1HBNB 4KY3A 2CPIA 1NHVA 1K73O 2OPSA 1I5OB 2LQ5A 1YHQS 1E6YB 1O1WA 1RT3A 4LFCK 3EGNA 2DXDA 3BSOA 1U1NA 4UY8T 3AVCA 4FPAA 2CGJA 1R8CA 4Z94A 2ZDOA 3EEQA 3CMAS 5C2DA 4MK8A 1ZTTA 4EIAA 3G4SN 1TAQA 2OLWA 3NMUA 4TNOA 5BYRA 3ULEA 1KVJA 1NPPA 4OO1J 4NYFA 1T03B 4MO5A 2CG8A 4DTMA 2E2PA 2HS0A 2RAQA 3FCVA 2BDPA 4CGFA 1HLUA 1C0TB 1SPBP 3FFIB 3TU5A 2IAJB 4PY5A 1N88A 5K8NA 4IYQA 1WEZA 4I4BA 1CJTA 4L73A 3RU0A 1S9GA 1S4FA 3CF5L 4ED7A 3M1VB 2AZ1A 4BGBA 4ILJA 2FC9A 1VC0A 2MKIA 4F8RA 4X4NA 4FYXB 4F3QA 3ZEUB 3PW4A 3KLIB 4LRAA 3H5YA 4JK7A 3LANA 4LRCA 2EG2A 3VALA 3ZC4A 3CT9A 3M6XA 1W26A 4FBTA 1IG8A 1OH7A 4J7CA 1WSIA 5JMVA 3DXKB 4UOCA 2C3YA 3G0ZA 2O8CB 1MA9B 3BP8A 5GMKa 2X1BA 4DL0C 3VHQA 4ECXA 3OJSA 3TAMB 4L74A 1IKYA 2DHSA 4AFFA 3CJ9A 3PRDA 1NXIA 4FJ8A 3IS9B 2EXUA 5AZIA 1UKUA 3QPIA 4CF2A 4HCBA 2XCAA 1Y10A 5GAEU 1U48A 4DG1B 2XS5A 1FEEA 1YJVA 4R0JA 1SKRA 3O3LA 2RDJA 4K0KF 1NHKL 2JWNA 2W9CB 4AL5A 2KYZA 4DI6A 4WK1A 1PG5B 1REVA 2JFDA 2YI1A 3LAKA 4URGA 2GVDB 4YQWA 4A57A 2PC6A 1GH8A 4CO1A 3JTPA 3I0RA 3VQ7A 4LH4A 5BRFA 5M1OA 4E1NA 1FWKA 4CT9A 3QEWA 1Q9XA 3C14A 2BH1A 4GNIA 1WD6A 5HVFA 1V3RA 3PG9A 2IY5B 3QGPA 3R3LA 1UFKA 1NGHA 3HMJG 2HSTA 4C8ZA 4OJ3A 4FVMA 1CJKB 2CVEA 2WSCC 2B56A 4CP5A 2O8FB 2UXBK 4B1XB 1RTJB 2IOCA 2HNYA 1T9YA 3VQ4A 1GNKA 4CFBA 1I51B 1XI1A 2NRTA 1T94A 5E3PA 1TL5A 2L08A 1XR6A 5LMUF 3G87A 3V9ZA 4WFXA 2DITA 4H4OB 1S10A 2D3O1 5GAHU 2DRBA 4CJEA 3AODA 1BO5O 2UXCF 2J8AA 3RB3A 1HBMA 2IRYA 5KAKA 5HVHA 4JV0A 2J6SA 2AA4A 1U1OA 4WFAL 1K0VA 2VF3A 2YNIA 3CJ4A 3QLHB 4WFBL 2JLGA 2MZJA 1HD0A 4QPXA 1B99A 4IBNA 4RCHA 3PACA 3VAFA 4AHCA 2LDYA 3VGMA 5E7OB 4KH4A 1OPIA 2E9ZA 3RB4A 4BG9A 3PDNA 2DRDA 3MCMA 2ACYA 2KHOA 3KVGA 1MLAA 2ZNYA 3VEXA 1KBRA 1BWVA 3AA2A 4M42A 4Z7CA 1YITS 3NCQA 1HI8A 2ZNZA 3K58A 4USUA 2HAFA 1U6BA 1VHXA 3PR4A 1Q7YT 2HNZA 3C6TB 5J2NA 4J9OA 1WHVA 3OL6A 2WVDA 1UZHA 2BJDA 1S1UA 3FZFA 2NNWA 3HTVA 2R7SA 1U8SA 4FVUA 1UW4A 4QW9A 3T1HF 3QJLA 1GMWA 4BC9A 3MWBA 3SBMA 4WQ5C 4ZA1A 3AO5A 3UN3A 3JXUA 1PJ5A 2FHMA 3Q22A 3IR5B 2OEJA 1ACMB 3H8YA 5CD4H 5M2PA 4O4GB 4LVOP 4RWXA 1CQMA 5AQHA 4GKKF 4C0BA 4WP8A 1VQMN 3CCJS 3UNGC 2K1RA 5EX5A 3AXKA 3MECA 4HUFA 2PDAA 4KFBB 1VSJA 4DHYA 2HBRB 1DQ9A 4NE9C 1FKOB 1Q86O 2J9DA 3ETOA 2LQBA 4AD6A 3VQEA 3NCIA 2B8QA 4BCAA 5HQ8A 4H5VA 1Q5VA 2E8AA 3R7SB 3CPEA 2YBVA 4BR5A 1EARA 4CFAA 3CJKB 3Q2TC 5D0RA 3MDQA 3PTWA 3P4UB 4DR4F 2A41A 4ECVA 1YTAA 5E3RA 5KFOA 3ENOA 4UZBA 4LBIA 4AYBD 4F2SA 2KFZA 2VG7B 4I7FB 4FOEA 4A8YA 3HOSA 1P9QC 1FJCA 2ACMA 2HHTA 4CZIA 4X66F 4FJJA 4C7QA 4ED5A 1UA1A 1WSEA 4L76A 3VQ5A 4WIQA 1L3KA 1X5OA 3OYFA 2A1BA 4FNHA 5ETTA 3QRQA 2Q36A 1ZA1B 2GZOA 1H3DA 1NJXA 2J5AA 2UXDJ 2PMHA 3FLCO 1WOOA 5CYQB 1Y3JA 3EE3A 4X64J 4CLPA 1C1CB 4KO0B 5F2RA 3PX6A 1URRA 1JKHB 3K5NA 1SC4B 3QFPA 1S79A 4ES3A 5DDOC 2F9JA 1V6HA 4HTJA 3WQTA 4O23A 1FWPA 3TJAA 3B4MA 4JAXA 3LDQA 1LWFB 4HVZA 4O5BA 2VIHA 2XO6A 5LJVA 3KJVB 2HFVA 4U6PA 1Y0HA 3ZNJ1 3IRXA 4NXNF 4CF9A 1VQMS 3A1YG 1HBNA 5IWAK 2DNZA 5M2UA 1N5VA 1ASVA 3OUYB 4MIWA 3VVUA 4W5QA 3I4HX 3HHLB 5HO4A 2OJ3A 3CCVN 3CO9A 3GJRB 4M5JA 3K5OA 1QQNA 1NGAA 5F0UA 3DLKB 2FHOB 1RGVA 5JVHQ 2PA8D 2VONA 2QXLA 4ECSA 1C0MA 2WSFC 2MPUA 4EFAC 3ZNUA 2LKZA 4OJRA 4MH8A 5FROA 4J9KA 4DMZA 4XDDA 4NZ7A 2KVIA 2YWKA 2CNLB 4FZXC 1BWFO 3OYJA 2XY6A 2HMPA 1K44A 4LR9A 3P96A 4A5BA 1RE1B 3VQPA 4ID5B 3OBYA 4CJLA 2YY3A 2AU0A 1BD6A 1VGYA 3MUMP 3VA3A 3NF6A 5HQMA 4Y1CA 3C6UA 3KHGA 1X5SA 4PCQA 4YFUA 3A8YA 3QAUA 1ULRA 5EDWA 2CADA 1OSCA 2IVNA 3M8YA 5AQOA 2ZH9A 3OPKA 4NWBA 1C0FA 1YUWA 3TRGA 4M5MA 5EGYA 2PFDA 4B1UB 4RUCA 5KGWA 4MFBA 1KCFA 4LF5K 1OH6A 3VERA 1KQSR 2IS3A 4BQLA 4JUZA 4FP9A 1SUQA 3AY9A 3I55S 4H8KA 5FPMA 1H1VA 2ZH3A 1NGFA 1IBMJ 4PKDB 4OYXA 3MGJA 2V51B 1V5VA 4A2AA 4DV3K 2NRXA 2VFVA 5G0RA 1UEUA 5D0GA 3F9KA 3RBXA 4YR3A 5IM0B 4KR0B 1DQ8A 4MIBA 4B3MK 1GT8A 2BQUA 4OMFG 1NK5A 2R7TA 2G2YA 3R5AA 4FWNA 1LWCA 1ZM3A 2MSSA 4C8LA 1ZAXA 3HHNB 4Y3CA 2KZZA 1RDBA 3MZIA 2D74B 4IFYA 3T1YK 3J80U 1PYTA 3CC7S 1HPZA 1N32F 1Z26A 3DCAA 2IVPA 3BQ0A 3W9HA 1UEVA 4NLGA 3VQSA 3VQ9A 1BXNA 1XR5A 3OTOF 1BIUA 2CQ4A 1NJWA 4Z4CA 1UW9A 4ZJOA 3QFWA 4K4SA 3ZZPA 1RAEB 4DCOB 4FNIA 3WC0A 4M7XA 4P75A 4URSA 4DV5K 4ER8A 2AT1B 4UF4A 2L9WA 1QTNB 2O8FA 4B1YB 1HNWJ 2F5GA 1FDDA 1NK6A 3WEEA 4ECUA 1BQNA 3G8SA 3GG1A 3Q86A 3TUIC 1EO1A 1YBUA 2HMIA 4K59A 2DBBA 4RR5A 2MY7A 5HJXA 2VGNA 4MQ3A 1HQEB 4NZ0A 3QERA 3L4BC 1GLEG 3QBWA 4OZJA 3PW5A 2BANA 4C2MA 8ATCB 2PY5A 1TKZB 2AGOA 4BRAA 2V2ZA 4KHPK 3D3CJ 3D6TB 4OPAA 5D0HA 4GRSA 3DI6B 1HRHA 2W2MP 2ZZTA 2RHQB 2GV1A 3GB0A 2CQDA 4H0TB 4FWOA 3RTVA 4OYZA 3UE5A 1GXLA 2WSEC 4OZLA 3JAMY 4HACA 4IO8A 1CXQA 4EI2A 1DBDA 1R7IA 1YF5L 4PWDB 4DR5J 3VAKA 2ZD1B 5M1FA 2V68A 3LA0A 4MKYA 1JL1A 1WAFA 3BO3A 4U7UK 5FLXY 4F4ZA 1IBLK 2EFNA 5DZ6A 4ZS6A 2G1HA 2W9AA 2DTJA 3MFIA 1ELOA 4UY85 4WYWA 2BJ9A 1W9HA 4PAAA 4O3OA 4BRHA 5FDLB 2AEJA 2KJWA 3KG0A 5H9FK 4DCHA 5E3CA 4ZJLA 2E20A 2WOMB 1E6VA 2YHWA 2J9DE 2R4FA 1FRXA 2F7TA 4U7CA 3EKUA 5DK5A 1LW0A 4RUBA 3CCQN 5C2FA 2HQFA 5KG7A 3IR6B 4ISFA 1KD1T 5CZ1A 1HKAA 4B9QA 2W6KA 4Z0UA 1NJYA 4ED2A 5M1NA 1O8BA 2H9ZA 1EQMA 3GOIA 3NCRA 3J81O 1EWRA 3JAMU 3CD6N 2W9BA 1VQYA 1HI1A 3M2RA 2AX1A 3SAGA 1HWKA 1XERA 5EUHA 2GX8A 2GCFA 2QWMA 2FSKA 3AVJA 1SJRA 2FPHX 1TELA 3OTCA 1KVIA 1F9EB 1UVIA 4O3QA 1RDUA 4M5HA 4H0XB 5G4DA 2HBJA 4BRQA 3QT8A 3UPFA 1QS4A 1K6YA 4D3GA 2GELA 3L2WA 4P72A 5LXYA 4F4XA 3IAM9 3CCSN 3JYTB 4FJGA 3E01B 2AYEA 1C2PA 3MR2A 3HPHA 3ZT2A 4DX8H 2RE1A 1HWJA 2AEMA 4V19X 2Z2MA 1YRXA 4CGJA 5HRPA 1RAOA 1JLGB 3A5OC 2OFGX 4LF7J 1WEXA 1WOPA 5CHCB 2VC1A 2AYBA 1Y97A 3NF7A 4DL6A 2ZE2B 3DXSX 1AA1B 2RILA 1NOYA 1RWXB 1NGCA 2VJVA 2QXFA 3MOJB 3DNCA 3NHGA 2QSFA 2MSTA 4CI0B 4CF8A 6AT1B 1I1GA 3UKUA 1DT9A 3NBPA 2ITMA 2HWHA 4LF9F 2W1BA 3O4NA 1X9JA 2QL5B 4CERA 3CPWR 3ULDA 1SQGA 4AHRA 1TL3A 1HBOB 3MXJA 3OYAA 3RGIA 3KUGA 4B9NA 1N0VC 2NS1B 4C3KA 4CEFA 3KHLA 2V8GA 4EWTA 3BSCA 3K5MA 3RUBL 3FZHA 3U1NA 4LD0A 1BCMA 2D0AA 3UN2A 4BDPA 2DYAA 5CD4A 3NMAA 2YJEA 1WF0A 2SXLA 2UXDF 1H7XA 2YNHB 2HZVA 4OHYA 2DR6A 4J9SA 3QEIA 4X64F 3BBBA 2NQPA 2ITGA 1JLBB 4CK3A 4JB8B 2KFNA 2HB5A 1T0TV 4P52A 4CT8A 4K4YA 3UKRA 2J7WA 2AIRB 1RAJA 4WFNL 1GFWB 4WZQA 2LQ9A 2KRBA 2QFIA 1C1BB 2HQGA 4K0KK 3OHBA 3F41A 2CQCA 4DOZA 3ZZOA 3VF6A 4HCCA 4LR8A 1NMNA 1YTYA 1M90T 3LTOA 1JWWA 3A4TA 1HD1A 5B0EA 4CNZA 3J7YU 2OD6A 3OUYA 3H2LA 2O3DA 2BBEA 1F5CA 2YJFA 3E2EA 2A18A 1TGOA 1FEHA 1S3XA 5E0OA 2KJVA 2B6AA 5DGAA 4PYDA 3WHIA 2YQ0A 4CQ1A 2ASOA 1DTTB 4XEIA 1RAHB 4F0MA 1CVJA 3VZIA 4OI3A 1D9FA 1V3ZA 4ILMA 2JOQA 4M95A 1H0HB 1X4FA 1S22A 1NB7A 1UVLA 2XMUA 2RE2A 4M7YA 2ZH5A 3QIPA 1HX1A 2OPQB 1DKGD 1RLDA 3GYXB 2LA6A 2M7SA 1O51A 1OO0B 3BYPA 3UDVA 3C15B 3NGSA 3UNYA 3QFHA 2OH2A 4BACA 2C3PA 4JKGA 4PG4A 5L1LA 4Y00A 1NZAA 3LP1A 3LP2B 1LNQA 3CCMN 3MM5B 3QMQA 2PD1A 2DXEA 4PPDA 1F9FA 2OD4A 3AGKA 2UUCF 2G8FA 1GQEA 3VF2A 3CERA 1VYAA 2CJAA 3SPYA 4AQYJ 1WOQA 1A5XA 1F2GA 4D3HA 5JMNA 4I67A 2XY8A 4UTGA 5KQDA 3T9NA 3CMQA 2NXEA 3IWLA 4AUKA 4KB0A 3BF4A 1EKRA 3PX0A 4JD2B 3NGIA 2CQ3A 3C16B 1HQUA 3LP0B 3AT1B 3OVAA 2P9NA 2CDQA 5AXLA 1QE1B 3UR0A 3FZKA 3N0VA 3AD8C 2OTJN 3MCSA 2QFJA 1TUVA 4KHYA 2NSBA 1SJQA 2DH7A 1CULB 4L75A 1TUYA 4DPWA 5AQKA 3E9OA 3PXGa 4CJRA 2F7VA 4KPYA 1S7HA 2OPPB 1GOCA 4XO0A 4PKHA 1DARA 4HI1A 4USKA 3T1HK 2B9YA 3OW2M 2DGTA 1XC9A 2V4JA 4MJKA 3GZ7A 2LXFA 2DGQA 1VI7A 1M1KT 3HLUA 5LXRA 4FJMA 2ZJPQ 5B0FA 1PC5A 4GVEA 3R1HA 3C3LA 1PKUA 3ZETB 2AJ0A 5KG5A 4BGAA 3MEEA 4TYBA 1XTZA 4N5SA 2VKZG 2FQQB 5F8NA 3E9PA 1RABB 1HW9A 1WG4A 4RW8B 4GKKK 5JLFA 4C8KA 5IOLA 2VL1A 3H59A 4JHDB 2DB1A 2Y1RI 1B7YB 2HVIA 4FOIA 3DLGA 2YX1A 3NE6A 3W2VB 2FBXA 2VYPA 3ZZTA 2WC9A 4KTQA 3AHPA 1HNWF 3H1VX 1V9OA 4Y65A 3GIKA 1Q1KA 4C8NA 4KC5A 3L7UA 3A5MC 1XWLA 2IJFA 4C98A 5L46A 2Y1JA 2W6LA 4LF6F 1OSDA 4XH1A 3W65A 5HL7Q 1R8PA 4DR4K 1HPMA 1B0PA 3N01A 3VGLA 3ID6A 3IP0A 4F67A 4IG0B 1ICEB 3CULA 3I96A 1K1SA 4FWPA 5DM6L 2YQ3A 4JS4A 2FLOA 4J8FA 4M5NA 1QUPA 2O1PA 1YIJN 2GIRA 4X66K 3U7JA 3KLVA 3TABA 2RH3A 3IAYA 3CIMA 1KHVA 1ZM4A 3ZSYA 2VFRA 2KQ2A 4GKJJ 3KMSA 1KQKA 4F2RA 4EZ6A 1RBVA 1S72S 4MIAA 3ET6B 4QWAA 5FDLA 2MKSA 4YOXA 2QL7B 1RT6A 4A5AA 4BVOA 1S0OA 3K57A 2E7WA 5A6WA 3UDCA 4DTJA 5B0CA 4KBOA 4K41A 4CHPA 2BQ3A 4CGIA 3OYKA 1YVUA 4PABA 4ZVGA 5A2QY 2YKMB 1VBXA 1TP7A 2WONB 3FZMA 3WNHA 4PZVA 3S8SA 3QSYB 3MAAB 3EZWA 3CQYA 2MYFA 3O5TB 3JS6A 2OANA 1OY6A 4NXNK 2N4DA 3M32B 3ZZ0A 1F1BB 2YKNB 5KFFA 3H5XA 4CJUA 2CQ2A 2R7VA 1IJEB 1VQ8S 3OXLA 1NK8A 2ROGA 1BMQB 3KUHA 3WXJA 4X62J 3C95A 1X4CA 4B3RJ 4H4KA 4YOYA 3VZHA 3MN7A 4FLYA 4NLUA 1S6QA 3HZGA 1PSDA 4CM0A 2ASYA 1NK4A 3KD1E 4A59A 3N28A 2Q0RA 4CO3A 4CZJA 2XHCA 1JX4A 1ZH5A 1VRTA 4EBEA 2VQFJ 4UY8O 3UE2A 3NMRA 2Y0BB 3DHWC 3VQQA 4CBWA 1WSGA 3K2PA 4NA3A 4RUHA 5AE1A 5GAHI 1EP4A 3P4IA 2CJXB 1L3SA 4LF7F 2QM1A 2A5XA 5AE2A 1NK0A 1I94F 4UQGA 1VQ9N 3NG8A 2XMJA 5IT4A 2HZCA 3ONQA 3QGHA 3CYMA 3LF0A 3HYFA 2HHPA 2AGQA 2FBYA 5HRNA 1VQOS 4O3NA 3HXMA 2COLA 4KGMA 5AQUA 1SC1B 4K5RA 1AROP 4BBYA 2UUAF 4CIOA 1HYZA 2HF4A 5C2CA 1B4SA 2QA1A 2OPRA 1GK8A 1NMEB 1IKXB 1EETB 1ZBIA 4FWRA 1EKEA 2K2PA 1YG0A 1FRJA 1TQLA 1XBWA 3SAHA 1QVFR 1X1PA 3OBIA 3J7A1 4M3UA 4I2PA 3IGVA 1RT7A 5E2QA 2CPFA 4WTOB 4I56A 3V81B 3OHRA 3SDEB 3NH2A 1T9TA 4NLTA 4LF4F 3C6AA 4CLZA 1Y64A 3D66A 3SIPB 1U1LA 2NZTA 4FXDA 3CJBA 1UWBA 1KQGB 4XIUA 4FL9A 1NG9A 5IT9Y 1OH5A 4OFZA 2ZUGA 4C8MA 1NGDA 1N32K 1AYEA 1VK8A 4Y2IA 3I5AA 3PM9A 4WBFA 1QHAA 2XM3A 1NM1A 3CC2N 4G1PA 3W5ZA 4DJBA 4ZHRB 4DCPB 3HVTB 3OTOK 2O8BB 1PO6A 4ZP8A 2K7JA 4P6QA 5AQYA 4TLRA 2WTFA 4YY3J 2C1EB 1KN6A 3MMVA 4BRLA 1UZDA 4DLEA 5HATA 3CVKA 1DLOA 1REGX 3W9JA 1U4BA 4XPCA 1Q8LA 3N6LA 1WG5A 2ZWHA 1Q82O 2B7BB 2J76E 3F73A 1J5EJ 2VHGA 4BC2A 2CPDA 4HDGA 2HK2A 5BRHA 3VV2B 4O55A 1RBAA 2KXHA 2WRMA 5BR8F 1N6QA 3S41A 5IT9U 1O0PA 5HRRA 4JI6J 3VGUA 5I3PA 5KFVA 2PFFB 3HZEA 2ATQA 3DOLA 1VQ5S 4Y1DA 3LWMA 4USWA 1MROB 1X4DA 3WX8A 1FNOA 1YJWS 2ZOGA 3CEDA 2CPHA 4ZITA 1HBUB 3WXKA 1SC3B 4LFCJ 4JKFA 2HOEA 3DRPA 5BR9A 4RBUA 5D4LA 4ANEA 3TNVA 3N4PA 4RJVA 4WXWA 3Q8RB 5ETQA 4DU4A 4DTNA 4KV8B 1Q5YA 3AA4A 4NA2A 4CJWA 2XB2D 1YJTA 1VJWA 5KT6A 3ZT3A 3CXCM 5T7LB 4HHTA 4MDBA 5T14A 4X4UA 2YNFB 1ZBHA 4N8OA 4OLOA 4RW7B 4C48A 1RTIB 3SEOA 4JI2F 1Q18A 4TVAB 4KH5A 1V3SA 2YKPA 3M5RA 4CCHA 3TEGA 4I69A 3EX7B 4M3YA 3ZSOA 3MX2A 3OR1B 2XG8A 1MMLA 3EGZA 3D28A 4NI2B 1BA1A 1CULA 5EWGA 2QEXN 2WK4A 4B9MA 4OPJA 1WC0A 3Q8UA 5CAAA 1HQ2A 4LH5A 2RUSA 3CIPA 2OPPA 2V69A 1MSWD 3T5LA 1C0GA 2HSEB 3CM5A 1K8KA 3QQCD 1YI2S 1N4LA 4JRPA 2G0CA 2MQNA 1K1QA 1J53A 1RBLA 4KBIA 2P1JA 1Q9YA 3PYFA 4DV4J 2JVRA 5KFLA 2BEFA 3GPAA 1M5PC 3A0IX 1VSFA 1CSJA 4IFVA 5KFXA 5DG9A 4DZ6A 1NWKA 2JNJA 4E7LA 2H48B 4NYOA 2QYCA 2Z1GA 4EEYA 2IPOB 2FLPA 1RA7A 3DGPB 5HMWA 3OFEA 3W2VA 2F9DA 4K5SA 2VDIA 1VBYA 3FBBA 4ZVHA 3BF3A 1JCEA 4M1KA 1U2CA 3N4QA 2UUBK 4O0IA 1HKCA 4DTSA 5IT0A 1RA6A 4PPZA 4E7IA 1FHTA 3T5KA 1ZBUA 3VAMA 3D0HE 3M6UA 2FLLA 4K42A 1X7VA 1VQNN 2ILYA 2HQCA 4Q0BA 3JTNA 2C28A 3GSDA 3CUNA 1GXTA 1XHXA 1YRTA 3TP2A 3A5NC 4LF9K 5BREA 1SJ3P 2OTLN 4A8QA 4KT0C 1LWEB 1NNEA 4BRDA 1U0SA 3GQCA 3VQDA 2GVZB 3U9DA 3ZO7A 3H5SA 3JSRA 1URNA 1EXQA 2LCWA 4QYRA 3NOCA 3AB4B 2JVOA 4QIWD 4GKJF 3GL1A 4CHNA 2MTLA 5I4MA 5KFKA 3IMXA 1KXPA 3HVWA 3SFGA 2XNRA 4JI0F 1RCOB 2HHQA 2OELA 4OJ1A 1IV0A 4ZN1A 1XJWB 2ZJRL 2UXDK 3THWB 1MN7A 1SJFA 4FW2A 3NOGA 1X0PA 3NLCA 1NJIT 1MN9A 4FWQA 3M8PB 4X64K 4NB4A 2M9KA 3TTCA 1IM6A 4EZ9A 2VZ9A 1XMBA 2V9KA 2BM0A 2V2QA 4ZIVA 2CJ9A 3GE1A 2G2OA 1GMVA 2RDDA 2XMWA 3FNNA 1WHWA 3O8WA 1TL7B 2IBOA 3U8XA 5DDQC 2HIYA 1NRKA 3CDAA 3P5TL 4NRTA 4CJTA 2VV5A 1JJ4A 3BS9A 1KVKA 4R25A 1ILYA 5IFMA 3OYHA 5LT5A 4JN4A 2YHAA 4NASA 2FYXA 1KQSM 2Q66A 4K4VA 4BRFA 2QMUB 1FK9A 2GMHA 5J2PB 1Z2LA 3R6MA 3MFHA 4CH1A 3OLAA 3L3UA 1CPZA 4O8UA 2E1MC 3O3GA 2FZGB 4B3RF 2MQLA 4TY8B 1UAWA 5K8MA 4OLPA 2ASLA 3G6YA 5C25A 5H9EJ 4TU7A 2G13A 3QEPA 3RVCA 4JKEA 2VPYB 3CCRS 1RT4B 1APSA 2VQFF 3A5LC 1ZETA 5K8OA 3C6HA 4F4YA 4F9OA 3AA8A 5AZJA 4B8CA 4QJVA 3Q7CA 1S57A 3MEKA 3H20A 3GLJA 2NCKL 1ZM9A 2I1RA 2YWWA 4DPYA 1VOMA 1RJJA 1JJ2R 3P38A 3O5BA 2ZITA 1D8ZA 2HBLA 3PJWA 2UVRA 2ZKUA 3UD3P 3CF5Q 3EWGA 2IIHA 4I2QB 2DNHA 3OVNA 2DHHA 3MMBB 4MK9A 2IDOA 5KG2A 1T9WA 3VESA 4DV7F 4MKAA 4Q2LA 5B8HA 2RKIB 2F96A 3OYCA 2L9NA 2UUCK 1RAGB 1NGIA 4GVMA 4IOXA 1UWAA 5EOYA 4J9PA 3B82A 2R7UA 2HK3A 3V9SA 1UL3A 4AXIA 4HR2A 5KQ8A 4B9UA 1F5BA 1IBKF 5AQGA 2ASJA 4CEAA 4N8NA 4JI1J 3W62A 1NSQA 1UAXA 3SDEA 1ATRA 4WF9Q 1U2VA 3U3YA 4KREA 2GBZA 3L3CA 2X1FA 3RMBA 1OYDA 2L3MA 1N56A 2YHXA 2F8MA 5KPTA 3U6FA 2E66A 2XZTB 2FF3B 1HNIA 1SXLA 1I3OB 3CD7A 3OYGA 1FKPB 1TTHB 3UDEA 3B8HA 5ETLA 4WYBA 3AV9A 3ZSXA 4A2BA 1XUPO 1NH7A 2C2ZB 2I5JB 3BM7A 1NEEA 3P31A 4IOAL 4FXWA 4LY7A 5GADI 4ECTA 1QY7A 1QSSA 4EO6A 2VBZA 4DPXA 3MAHA 1TMMA 4DCJB 3MF5A 2GUPA 4DPTA 3K9KA 4O44A 2HWIA 5AXKA 4PXCA 2C2DA 3CQXA 1RTHB 2XMVA 3AARA 4O3SA 4HHJA 1WORA 4PXDA 1R0AB 1EHWA 1FO1A 1HNWK 1J5EF 2V67A 4NCGB 2CJQA 5AQRA 2VQEF 3PZPA 4ZTFA 4DEZA 1X0FA 3QRPA 4NXMJ 3F0NA 4BC3A 4H5WA 5HROB 3KK3B 5IWAJ 1JXLA 4M63A 1P1TA 4WTYA 2ZBPA 4LF6K 3CD0A 5DO2A 1VS3A 1AW0A 1YAGA 2HURA 3NH1A 1X5PA 3BREA 1RILA 4WFAQ 4OHZA 2QG9B 5HMZA 3DXMB 5BPLA 4GV6A 2IDEA 4WFBQ 1KVBA 1SZ2A 4F4AA 5K5MA 1E3MA 3MM6B 3BGRA 2NXUA 5KG3A 4Z4IA 1F60B 4BHQA 2Y3YA 3BN4A 2FLNA 2D3UA 2A3ZA 2YTCA 4BWJA 5HBMA 4YDUA 4MDAA 3IFEA 5L1JA 1O13A 1IH7A 2QKBA 3TEHB 5F3TA 1FX4A 3UO0A 4FYWB 1GLDG 3THYB 2V8VA 3GR0A 2IA6A 1VBKA 2YNGA 2W2OP 2FD2A 5HVGA 3V6KA 3MM7B 3N79A 1U7LA 5KFWA 3SSSA 2LMIA 1TL1A 1CBKA 3NGZA 1LXNA 3V5RA 3ADAC 1HWIA 3QO9B 1N5SA 1GOBA 2FHJD 1Q16B 3LUYA 3C46A 1X8DA 2NRVA 3K17A 4LF5J 2VPXB 2ALYB 2E2NA 2YHYA 3VGKA 4KE5A 3MM9B 3CPWM 4JI3F 1HYSA 3O1WA 2HIQA 2CZVC 1VQLN 2DHGA 4NYZA 2ZZNA 1OVYA 4CNYA 2H65B 5HN0A 2OSQA 4GMJB 4W90B 3UCZP 1RDAA 3JTOA 3HZ6A 4DV4F 4B3MJ 4CECA 1YJ9S 1G4CA 4DQRA 2FVSA 4PL7A 2RNEA 4RKUC 2AJFE 4UOHA 1F3VA 4RNNA 1HUXA 2O8DA 3RRGA 3PKMA 3DMJB 1FWLA 5HAOA 1JLFB 2YWGA 5F8LA 4NLVA 4CFCA 3LW5C 3T1YJ 2CQHA 4BREA 4CZLA 2NRZA 5LSRA 4H4MB 3OBWA 2LQJA 1U1RA 1EIYB 1NK9A 1VISA 3MCAB 4LF7K 1S6PB 3MMAA 3ITHB 4I6WA 3D2EB 2X1AA 3HSGA 1I94K 3WDOA 1WSFA 3O4WA 4J9VA 1IKWB 5I3QA 2O4IA 4I0WA 2KHCA 5ETNA 4KSEB 4DV5J 2WFBA 4CVNE 3HSTB 3P45B 2R8IA 2GS8A 1S1TB 4J90A 2E5LF 1D9AA 1FE4A 3NL0A 2UUAK 2OIHA 2E1RA 2ZWOA 2FSJA 4DPUA 1JIHA 3G6VA 2DCLA 2D0PA 3MDFA 4OKKA 3C65A 1SVDA 2CDRB 2P9UB 4TQSA 1TYQB 2B3TB 5KT3A 2KKZA 2XLIA 1M5HA 1JCGA 1KHWA 1KLMB 3P49B 1U25A 1JMTA 4LF4K 3WXLA 5KTQA 5J2QB 4H0PA 4DQQA 1WKJA 2RRAA 1Q8IA 4DZDA 2MGZB 1VRUB 2AWZA 3DYAA 3LDOA 4ZPBA 4OHVA 4P2MA 4RO0A 3OYLA 4ZVUB 1ZYQA 2NXCA 1TMJA 3O9RA 4BVPA 1OQ3A 2HPUA 5H9FJ 1U8WA 5C42B 1LAWA 3C7NA 3D6HB 3LQVA 3GJSB 5A76A 1M90O 1HW8A 4YN3B 4ZLNA 1U1QA 3KWMA 1MWZA 1VSEA 2Z1IA 2L9DA 1Z1ZA 4LC9B 1QM9A 3M6WA 1HHQA 1VQKS 1SIZA 5KFMA 3MX5A 3CMEN 4RLEA 1B64A 2D4WA 3UR3C 5BR8K 2JEJA 1WN7A 2F8EX 4J2EA 5CYMB 4A8OA 3CM6A 3GYGA 2E1ZA 3FQLA 1D5AA 1YZ7A 4RZRA 5U47A 3OTEA 1T3NA 3HO1A 1BWEA 3FQKA 3PEHA 2ZH4A 1YJNN 2XSJB 5D15A 3OYIA 3TX8A 3D6FB 3M9OB 3D2FB 4RWWA 1H74A 2GO8A 2BJEA 2BQRA 2V2KA 2X78A 1IO2A 2RPIA 4ZLLA 2RB7A 1U26A 2Y1IA 1WTBA 3FBFA 3QWUA 3WNEA 2XCPA 1OVQA 1ESVA 5B0DA 2KXFA 5KT4A 3NEKA 1KC8T 1S99A 4DR6F 3TSUA 3NXZA 4F50A 4IOCL 2H5IB 4X4RA 4B3TJ 3BBCA 1GLJO 4W98A 4JI2K 4WE1B 4F26A 3TSPA 3PIOL 4BC4A 2BTFA 3FUYA 4JI1F 1QAYA 1U2RA 3BDPA 4OI0A 1FXLA 2R8JA 3E9LA 3RYLA 1KKHA 2EVZA 3V4IB 3MEDA 3J7Z5 3TZZA 1CXUA 4EBDA 4ILRA 4QS7A 3BSNA 3O9TA 1VQPN 4BR2A 1Q81T 5AJ3F 5E33A 2GFFA 3PNIA 1JB0C 1JLEA 1CJVB 3V4MA 3OHAA 1R89A 3ISND 2O01C 2CNOB 2GGPA 1HJOA 3KG4A 3NS5A 3KK2A 4CESA 2VA3A 5KFPA 2ABYA 1HA1A 5KFDA 4HYKA 2C2RA 1QLNA 3JSMA 5DG8A 2HHUA 3LGNA 5HMYA 4KHWA 1SKWA 4K0KJ 5AQQA 2QK9A 4DSKA 3KK1B 3I0SB 2IMWP 3MN5A 5KFNA 3HSCA 4DSEA 1RAAB 4C11A 4DR3F 3AAPA 2BE7D 1IN0A 4NXMF 1TZ0A 5KFAA 3IBCB 1FTRA 2D69A 1RDDA 1VIXA 3SQOP 4CD3A 2QYGA 4LSLB 2EFPA 2EHGA 3IM8A 4A8FA 4NRUA 2FJAB 4CIGA 3BKUA 1X4GA 4U7BA 4J37A 2P9LB 5D8HB 3JXOA 1RISA 3WXIA 1Z4UA 3PLAA 4X4VA 5KFGA 1JLCB 1UPPA 2IM2A 4OI6A 2IM0A 1SV5A 3Q23A 4EYIB 4WFZA 3DLJA 1T9UA 4GKJK 5AQNA 5GINA 4IO9L 3ZT4A 1NLKL 2YXLA 5FPDA 4DFPA 3PVXA 4JI0K 1KRPA 3NNHA 4C9DA 5ITHA 4JI8F 3KWGA 1RKJA 5BJRA 1UCNA 5HLFB 1IKVB 4S0MA 2P9KB 4WU2A 1WJ9A 5JXSA 3MTKA 3TR5A 5C24A 4O4RA 4DKWA 4G1QB 2F8TA 3B6BA 4ALZA 2GQQA 1FFGB 3ATVA 4DMNA 4FLVA 3CCEN 1LCUA 3ZX3A 5E41A 2VG5A 3NGRA 3DRYA 4TLQA 3RAXA 2ZHOA 1BUPA 2EFGA 4USJC 2A2DA 2B9XA 3HT0A 4M3RA 2UP1A 3LM9A 1RT2B 1NSKL 4MT1A 4UUWA 1ZXOA 4CTAB 2HZAA 3IWXA 4OPHA 3ZSRA 2B5JA 2RQMA 1S0NA 3DOKB 2A6AA 2C2KB 2WBNA 1TV6A 4FWSA 4CZEA 4MLEA 4KAIA 2EC2A 1QVFM 4ZJQA 4B3RK 4G6VB 3T7ZA 2GWKA 9ATCB 1BI4B 1W7WA 1J5OB 5EVZA 2VQFK 3T1HJ 4CLKA 3MR5A 4H4MA 2GV9A 1SJ1A 5FRNA 3PW7A 1BA0A 3A8EA 3DLRA 5SWMA 1KFDA 1NZ8A 4FPBA 2G8WA 3PIPQ 1RZMA 1CS4A 1IKWA 3LM2A 5MLCQ 4NA1A 4Z37A 2PAVA 3HF5A 5JVHL 3EGVA 3M2VB 5LY3A 3BZQA 2XMKA 3ZZRA 1XMQJ 1VQ7S 4PKIA 1LW2B 2C2NA 3CC4N 4BE1A 4PWUA 2HBQB 1KR4A 2ROEA 2MKCA 4O0NA 1S1TA 3SCLE 2CIMA 2WVCA 2DFFA 2QWQA 2XY5A 4CLSA 3H2UB 4DV7K 4KKOA 2VOPA 1QVGR 3SQ0A 3TUPA 1KFSA 4ZCKA 3AVBA 2G8UA 3NVMA 3VQAA 3J81U 1YHQN 1BQXA 1JXEA 3S01A 2RMLA 3FMBA 2P9UA 2FGCA 2WZ1A 2ASPA 1IBKK 1AZSB 1BQMA 5D78A 3NGKA 4ZK7M 2EBEA 2F63A 2GHWA 3G2XA 3RAQA 3FJ2A 3CMAN 1RYSA 3PYEA 5CQGA 2KI2A 3QIDA 2GQCA 4JV5F 1T05B 4WFNQ 5J2QA 3FRYA 5DM7L 1KNZA 4X66J 2K8GA 1IR2A 1X9MA 3IXQA 3LAMA 3BB5A 1HNVB 5KFUA 3EDRB 1NUEA 2EI5A 3I9ZA 3KK7A 5DRKA 4FKYA 3ETMA 1RBTA 2FHKA 2Z0GA 4ZKAA 4JBCA 4NLRA 3HP6A 3FZLA 5AQTA 4LVNP 4M41A 5KT7A 3CIZA 3O2IA 4M5IA 5C42A 4ITSA 3BGUA 4DL4A 4B3SF 3W7BA 3HDSA 4PQUB 3R1LA 4DX5A 1YTUA 4N7TA 1H2UX 2KLAA 3NNAA 3FRZA 1NDLA 4TU8A 3PCOB 1XMOF 4XPEA 2QRRA 3RR7A 3VF4A 2D0BA 3SBTA 1GX6A 2DHXA 1LK7A 2HFNA 4H4KC 3LPEA 4HH1A 5A8WB 2RQ4A 2Z2LA 1WHYA 2V8HA 4IG3B 2FJBB 4JKAA 1CEZA 1J5EK 2O8EB 2VQEK 4GO5X 1TUWA 2ZH2A 1O6XA 3LL3A 3S1TA 4BE0A 4OZ1A 4OYOA 2DNLA 4LRBA 2AEFA 1Y4ZB 3TAPA 4ZVRB 3PSIA 1KAXA 4M8LA 4IJNA 4LF8F 1OQ6A 1PBUA 4B3OB 4JKDA 4J2DA 4HL9A 1X9WA 1JXBA 4IDKB 5LOQA 2MKHA 2R2UA 4RG8A 3NY0A 3D54A 2C2EA 5KI6A 4YP3A 4GVBB 3KYLA 4ZP7A 1Y9OA 4I6MA 4LR7A 4B3TF 1DRZA 3GU0A 3O9SA 5J1EA 3I56S 4CLYA 4RW6B 4ZIWA 2X7IA 2A6OA 2P9PB 1FNXH 2E1CA 1VSKA 1U0HA 2XI2A 3TAFA 3ATUA 5I3UB 2E44A 4LMZA 2OZSA 1GMWD 2MLYA 1C4CA 3LWLA 4JI3K 3W61A 5AR0A 1BOTO 4C23A 3A13A 1NO8A 1UVNA 4MTPA 2NUUG 1Y7PA 1Q4RA 2HVDA 5A0YA 4MLHA 2RU9A 5E26A 5GIOA 3CB4A 3UVJA 4QCLA 1S4EA 3AXMA 3KLGA 4HT7A 4DV4K 1BUXA 1B70B 4NL5A 3AVGA 4JOUA 4GMKA 2DIUA 4DN9A 3CCUS 2RRBA 2FDNA 5FD1A 3TYTA 4UOFA 2VFUA 2C2MB 4Z7YA 2KRRA 3FSIA 4OYAA 3AVMA 4CGDA 3OVSA 3DRRB 3M30A 5KFCA 5IXUA 1N32J 4OHXA 3L7OA 4QWCA 1TFYA 2P9IA 1MU2A 3DHXA 3KK1A 5K14B 2A3JA 4QWEA 3CO0P 3OTOJ 5HRSA 2NREA 3L6QA 5KFSA 1PJ6A 3OR2B 5DM6Q 1Q86T 4CLUA 1YITN 4KHQA 3ZX2A 2EFQA 2KXNB 4B9LA 2VC0A 3K8WA 4PWWA 1IM4A 2YX7A 3MWPA 4Q8FA 2YKQA 5CCLA 1UFWA 3IFRA 4EK2A 4NCBA 3J7ZO 2J7UA 2DY4A 1M1GA 2BW2A 3L4QA 1R8BA 1SCJB 2E5LK 1WEYA 4OZNA 1CLQA 1SJ4P 4P7TA 3T1AA 2B0GA 3CDEA 2XMTA 3E1YA 1IQTA 3IBFB 4NO7A 2IVMA 2YH0A 4ZPAA 3TAQA 1LEOA 3M8QA 4ID1A 4LSNB 3BQ1A 2DNNA 4NLPA 4CK1A 1HMVA 5KRSA 1S1VB 3KOAA 4NMXA 2OYQA 2AQ4A 4IR1A 3I32A 2Z56B 4E89A 2VUGA 3BPSP 4YOUA 4CF1A 1I39A 3D2WA 3MN6A 2QWLA 1OH8A 4GY2B 3HSJA 3JS9A 1UMJA 5IQ6A 2CWKA 3NRBA 3CCJN 2VG6A 3JQKA 2VGMA 5A8RA 3VTIA 3TANA 1HHSA 4MO4A 3NF9A 3SV4A 2D5RA 4USHA 3IDHA 3KLFA 4IRKA 1JJ2M 2VFTA 5D0EA 3AA5X 4RX6A 3X3UA 5EHHA 1OIAA 3DN9A 4KAZA 3O80A 1FD2A 2AZ3A 3D9BA 3M6VA 2V50A 1K47A 2E7XA 3C2PA 4FM2A 3B78A 4AT1B 3NP5A 3J7AP 3H3NO 3SJJA 3AJ2A 2ALZA 1NAQA 2I8EA 2CPEA 2IDLA 5J2MB 4DSIA 4AHTA 1ZS6A 4Q45A 3WQPA 3THXB 1UEKA 1FKAF 1VQ4S 1TKDA 2RF2B 3U1MA 1RT5B 2MKKA 1X5TA 1CJUB 4ICLA 4PUOA 2XMAA 4BR7A 4L3KA 1N36J 1BE4A 4ZVPB 3DDNA 4QAGA 3GFHA 1UOCA 3DLBA 2PMZD 4FF4A 2BE2A 3R5CA 4CYUB 3CI5A 1J5OA 4K4WA 3M4XA 4GV3A 2MB0B 5H9EK 1FJGJ 4WZMA 2ZM6F 2QX0A 1TL4A 1FRLA 3NAEA 3ULHA 3R5BA 1AFIA 2M70A 2ZUAA 2DEIA 3EGWB 2QLWA 3IMQJ 3H1QA 3G6ES 4M3XA 2XYPB 4WPAA 3IG1B 3QB0A 1LW2A 3E66A 5CYJA 3PFEA 5DDPC 3OY9A 4USIA 2V2VA 4JK8A 1XMQF 4AL6A 4QBUA 3CXCR 4FF2A 1TKXB 3A8KA 2WVEA 4KH1B 3VQBA 1FJEB 2QI2A 1HIYA 2RN2A 4KGXB 3CHWA 4A8KA 4L3QA 3OS1A 1JJCB 5GAGP 1KP6A 3H4BA 4RNOA 3OVBA 2UUBJ 4DR6K 3GIMA 3W2WB 2W2PP 3POTA 3SZ2A 2JH3A 2HFSA 3DOMB 3G8QA 5GAEP 2OAUA 1WSRA 1X3MA 2F8HA 4DR7J 2UVUA 4CH7A 1B0VA 1Q78A 4JI1K 3RRKA 2PEHA 4RU9A 3HKZD 3MM8B 1RU2A 2YPYA 2RS8A 2CH5A 1D4XA 4LF9J 1HFEL 2IVOA 4CFDA 2OA8A 2Z4PA 3MXMA 5I42A 3N5BA 4PG8A 2ZH7A 3AAQA 1G99A 4H5NA 2VWJA 4M5GA 2N7YA 3D4JA 4JKHA 5L8RC 2E6LA 4RBVA 3CJRA 3VMFB 2W42A 1JLAA 5AQXA 3GCXP 5AQWA 1HHTP 1AUSL 5AJ3K 1NPRA 5C10A 1WB9A 2DK2A 4ETZA 4CLFA 1SKSA 1HL6A 1S77D 3KKRA 4X2BA 2G1DA 3DKDA 4Q7AA 2W01A 3ZTRA 4U7UD 3KLHB 3RJMB 4V1Ak 1NGBA 3SUNA 3ICLA 1XQSC 1EWQA 4ZLJA 1S9EA 4RW9A 1HR0F 1BIZA 4USMA 4CZFA 3MHYA 4QYZK 1T3VA 5GAHP 2JWKA 4R5PB 1GLLO 3I55N 4P7VA 1F9HA 4DF8A 2R9LA 1R3NA 2V5HG 4KGVB 2O8EA 1CC7A 5B0BA 1SH2A 3GBTA 3GFXA 2H3GX 4WCEL 3WNFA 3L4IA 3CCLS 4DR3K 4W92B 2WB4A 3EE9A 4NXMK 3SSQA 4M3WA 4QIFA 4X4SA 5JS1A 3N6MA 2MHEA 2DR8A 1S1XB 1E6YA 2JEIA 4F36A 3Q8YA 3Q8VA 1RT1B 2FZCB 2HFUA 1ZOTA 2OKQA 5IQQA 2YX4A 3MMCB 3MPYA 2D41A 3R6LB 3CC7N 4NYPA 3R6GB 4Y28C 4AL7A 2P51A 4LFAF 2PZSA 1RTDB 1GLFO 3QMLA 3CDWA 4TKTA 4IDKA 5JVGQ 2FZKB 3RMAA 4R8UB 1NMDA 1CZ9A 2IC3B 3T41A 3HX9A 3W63A 2Z8QA 2G8IA 3G10A 1T03A 4JI8K 4CLTA 5A2QO 1VHIA 2V6AA 1YSJA 2DTUA 2CWXA 1C0TA 1YVFA 1DAXA 2ATLA 2BRLA 3GJQB 3FFIA 3KTQA 4RW6A 2IAJA 2DVIA 1JLQB 3OXFA 4ZVEA 2KFYA 5C12A 1X4AA 3PUFA 1FXRA 3CCTA 4KHSA 1RDWX 4HHUA 3J80Y 4DSFA 2ZBQA 3M1VA 3ZYYX 4IFEA 3G71S 4E7HA 2A1RA 3ZEUA 1VDHA 2UUCJ 3NGYA 3KLIA 2A1SA 2XHWA 5AQPA 2NXNA 2HHXA 1N5YB 2MZRA 5D4NA 4MAKA 1ZZNA 4E1JA 3M05A 4A61A 1IJJA 2G0IA 3DXKA 3M8RA 2ZDPA 5HSPA 4DFJA 1R0BG 2XTJP 5KG0A 2CZ4A 2O8CA 3RSEB 1EQYA 7FDRA 1RXOB 2CXEA 4B1ZA 2WHOA 1LXJA 2FHJA 2B4VA 3DRSB 2FBTA 3MCNA 3TAMA 3W66A 2VPWB 1NBWA 2AX0A 3LH2S 5LL6d 2H4YB 3O3HA 2C42A 1NSAA 3CNQP 1H73A 3IS9A 3VQCA 2ZQBA 3THPA 4CHZA 1M5OC 3RAMA 2VWKA 2WAQD 4JI5F 2OPSB 2PYJA 4FPRA 4DG1A 3EJMA 3QFUA 2XI3A 4JKBA 2W9CA 5TKWA 4X4TA 3P6YC 3GMGA 5FJ4A 3HP9A 2GVDA 4Z4HA 2OZMA 1IUJA 5ETVA 4ZPCA 3QSIA 2LQ8A 4M63C 4DTXA 1R43A 3ULEB 3BKFA 2DHAA 4U8YA 4FYYB 1VFJA 4QOTA 3N5FA 2HHHJ 2ZHAA 2QMWA 1CJKA 2HRTA 2F1FA 1YZ6A 2VA2A 2BM1A 4WXOA 4ECRA 1RTJA 3ZXWA 2ZJRQ 2KL8A 1Q8KA 3P1GA 4ECQA 2DCUB 1K9MO 5F8JA 4JI4J 1CJTB 2MEWA 2RUGA 1U49A 4LF6J 3QESA 3QJPA 4YDUC 3I6PA 2CFXA 4DLGA 2Y8WA 2V8DA 2NPIA 3SBGA 4H4OA 1VHFA 2PN6A 2QLBB 5THWA 4ECWA 1EJ7L 1LQ9A 4JV5K 3D6MB 3VA0A 4J9UE 2N82B 2FVRA 2ERRA 3VEWA 4DL2A 1WACA 2F4FA 1NK7A 3VEVA 1X31C 1TR0A 3M9MB 4H5RA 4DV2F 3QLHA 4CHOA 4QU6A 2NXJA 3LDNA 1PCAA 4HH0A 3PW2A 5F9LA 4M3TA 1VQ6S 1IKYB 1T95A 5AZIB 1S6UA 1WDDA 3THXA 4BDZA 4B3SK 3N4WA 4IH5A 2YQ1A 4ZVSB 4X65F 3SUQA 4YOWA 4ECYA 1K8AT 2D0OA 3CQ8A 3QATA 1CJUA 2QA2A 3O6QA 2DIVA 5KFIA 2CGKA 2Z1JA 1XMOK 4OX6A 3MURP 2QTDA 1REVB 2RD5C 4K4UA 4QS9A 1N36F 3AD9C 4J2AA 3C6TA 2EX3A 3WBZA 3I0RB 5EY4A 3ILJA 3F56A 1AB8A 2Y8YA 1WSJA 1BLUA 1FJGF 3CJSA 4FKXA 3HPOA 3D5MA 5AE3A 4ANCA 1RP5A 2ETJA 4DUZF 4K4TA 4C1NK 4ELUA 4AHVA 4DSJA 2V94A 3O9QA 2IRXA 3FC9A 2GAHC 2JEFA 1FESA 3SQ1A 3IO1A 2MHNA 2K06A 1ZC6A 1NKEA 2HNYB 3IG1A 3OQ2A 4OKEA 4O4GA 5GADU 4LSZB 4LF8K 3BYRA 4ISGA 2R42A 1SIWB 3HFKA 1X4BA 4O3PA 4CJFA 1QDUB 4LQ3A 2BZ2A 3QT5A 2IVFB 3NGUA 2F4VJ 3KJFB 4O5FA 4KFBA 4BRNA 3F5TA 4N77A 1FKOA 3UWTA 4PYAA 1HBMB 4CD1A 2HLUA 4O8KA 3W5YA 3H25A 2CAJA 1FRHA 2LXIA 1IJFB 2RQKA 3CJ7A 4HLBA 2UUBF 3OFGA 4XK8C 3WZ0A 1UJ4A 2MQMA 4KI6A 1SL1A 2CUYA 1I94J 3CJKA 2EBGA 5LMNJ 3AY0A 4B3TK 2YNIB 1VK0A 2M88A 1Y5NB 3CETA 4G9ZA 4LF2A 4DR7F 1VJQA 2BGGA 4WQ4A 3FZBA 2HYIB 2AGPA 2V7YA 3BH7B 4K43A 4ZCLA 4H0OA 2VG7A 3GV5B 4I7FA 4C3MA 4JI7F 2FJWA 3GFZA 2V7ZA 5F8HA 2UUAJ 5KFTA 2L48A 4J9LA 2E1YA 2V63A 2ZC4A 1NKBA 3FDSA 3OL9A 1MWKA 1RBUA 5MAOA 3AOCA 3LGMA 1Y00A 4GC7A 1KVAA 3GV8B 4DV0J 1WUUA 2P9CA 3CTRA 3I8BA 2IBKA 5RUBA 4JYAF 5BPNA 2JX2A 1NU0A 2OI2A 2N4CA 2H3EB 4OZ5A 4FO0A 1R0CB 2JWLA 2HNZB 5J2NB 5CYQA 2XBPA 4BQZA 4Q5VA 4FK4A 5E3QA 3KLHA 1C1CA 1S1UB 4KO0A 2XYHB 4FS2A 3HBTA 1WTFA 4LF4J 1TK5A 1Q81O 1JKHA 1U6FA 2JGUA 2M2BA 2ILZA 3GE9A 1B9DA 3AQOA 2W2NP 1RWMB 2DH8A 1DGKN 4BDYA 4MYUA 1LWFA 2HVZA 3BJYA 4DV6J 4ZVFA 3KJVA 2QW9A 2M5YA 3U3GA 1ZBTA 2BYCA 2IHR1 2RJZA 1HARA 2ZJQL 3HSZA 2Z2ZA 3H7HB 3MXHP 5KRTA 2XGPA 3K89A 5IC6B 5DQGA 4M45A 3I82A 3MECB 3HHLA 4I1TA 3A3OB 3R97A 3G96A 1E4GT 4F7VA 5A8KB 3DLKA 5KOXA 2BKOA 5MLCV 4GO7X 4HKQA 4NLXA 2GC8A 3QGIA 4YB1P 4Y34A 2CZ9A 4BRGA 5BR8J 3JQJA 3T69A 2D1KA 2HVEA 1HKGA 4N56A 1R6VA 3EICA 1BHLA 1JK9B 1U45A 3I33A 2FJVA 2I7PA 3OYDA 2UVVA 4ID5A 3MPUB 2QA4G 4USTA 2DISA 4ZPWR 1BG3A 3QAEA 3DJCA 2EC0A 2M8DB 2IA0A 2B9WA 2JJ4D 4LJMA 3K7RA 4DUYF 4FVCA 3LO3A 2E29A 3VENA 3PYGA 3KKSA 2ROPA 4OX7A 1N33F 4DV1J 3VGTA 1GTEA 5F1XA 5M2RA 4DU1A 1RQ0A 4NX9A 4MYTA 2K3IA 2ZBIA 1BDGA 2NUHA 4I6AA 3HL8A 3NVKA 1FNMA 1QVGM 2ZOFA 2DXFA 3V6JA 4JI2J 2RRNA 4PQAA 4CJQA 2W2QP 1LFPA 3TTFA 4UQTA 4OZ0A 2RIJA 4HUGA 5EWFA 5IM0A 3VEYA 1W25A 2M52A 4H03B 1NGJA 4Z4FA 3F9MA 5CCMA 5KGXA 1MWMA 4OZ3A 1S72N 2QA4S 2D7SA 1QJHA 4NLYA 2VKRA 3HVAA 3O1BA 2DT9A 2ZM6K 2EG1A 3TVYA 3VWSA 3PX4A 4BR4A 3IRWP 3NH0A 5HQLA 3D67A 2MZQA 1WUAA 1NNDA 1XQIA 3QWPA 3TX0A 3