1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
3CJ2A 4PWDA 4CEOA 4NYFA 3MXMA 1S9EB 3OSNA 4IRCA 4QPXA 3HP9A 4TY8B 3C6TA 4OL8A 4NCGB 1A5XA 5KG0A 4M94A 4Y3CA 2ASLA 3DOKA 2E6MA 3ZT0A 3VQDA 1NKCA 1LWCA 2UVWA 1Q9XA 2VA2A 1BQMB 2ATQA 1RT5A 4F4YA 2W9CA 4ICLB 1LWEA 2XC9A 1JLBB 4Q43A 4K4VA 4DU4A 3KKSA 2KTQA 5J2QB 1T94A 3DYAB 2C2DA 4QWAA 1T8EA 2IAJB 3C94A 3NH1A 4IR9A 4N41A 1Z26A 4WXWA 5C5JA 4WYLA 1HNVA 1VSHA 3OSPA 4CEZA 2DTUA 1S1VB 1HQEB 1TP7A 1S49A 2W9AA 2A1SA 2WB4A 3QYYA 2FBXA 3ZSRA 1SV5A 4IOBA 3ZSXA 3DI6A 5KFCA 1VRTB 4ID5B 2O5DA 1I6JA 3DOLB 4OPKA 2W7PA 3HSTB 2B43A 3O3FA 3U3GA 1JLQA 1ZBIA 4O44A 2Z1HA 5F8JA 4EEYA 4O0JA 3OYEA 5FDLB 4ZHRB 4ECQA 2HHTA 1TKXA 4EBDA 4ZTJA 1B92A 3GQCA 3QIPA 4MIBA 3T1AA 2JEJA 3AA4A 4CGIA 2WRMA 4JS4A 3H40A 4K4SA 4F4WA 4OVLA 2OPRB 1S6QB 3N6NA 2DY4A 4M3RA 3ITHB 5KFXA 4DL6A 1TV6A 1N5YB 3GIMA 4Q8FA 2XY7A 1YTAA 3L3UA 3V9ZA 1NHVA 4M3WA 4IH7A 4O3PA 4ED7A 4FM2A 4NRTA 2RKIB 3RMAA 4KSEB 1HYSB 4M95A 4DLEA 4R5PA 2GBZA 4BDZA 2D41A 4KI6A 5FROA 1ZTTA 1QSLA 2B6AA 1S6PA 3A2FA 5J2NA 3BGRB 1FK9A 1RYSA 1KLNA 4K4XA 1KCFA 4M3TA 2AQ4A 4WZMA 3AVBA 2IM0A 3I0RA 2PYJA 4RNMA 1CXQA 4IG3B 2WHOA 3S3OA 3V9UA 3DLGA 2HHVA 5E41A 1HQUB 3QEVA 4CGDA 3CDEA 1HYVA 4OPJA 1Z4UA 4FJJA 1HMVA 3VQPA 1EKEA 5HRRA 4FCYA 4B9UA 2YNGB 3LZJA 4CESA 4ZP6A 4QWBA 2BDPA 4CJ4A 3D28A 3QNOA 4RW8B 1XI1A 4HUGA 4U6PA 3SYZA 1TVRB 3L8BA 3LAMA 2D7SA 1TKDA 3SQ1A 1WLJA 5KG5A 2QKBA 4J9NA 4IFYB 1RT1A 4CEAA 4DTMA 4J9MA 4TYAA 5T7BA 4CK2A 4JUZA 3BSOA 3PHEA 5JUMA 4CEEA 3CG7A 2E4LA 3T3FA 2BQ3A 2J6SA 1KSPA 4N47A 3QNNA 3CJ4A 2OPPA 4ED6A 3ZSZA 4IR1A 1Q9YA 2V9WA 3MEDA 4RW9A 1HYZA 2QK9A 3KLHA 2G8KA 1KFSA 4FLXA 4NLVA 2R2TA 5SWMA 4NLDA 4FS2A 3OL7A 4O55A 4XIUA 4FJNA 2XY8A 4ECSA 4KTWA 3DI6B 4TLRA 2BQUA 2C28A 3SI8A 4DS4A 3RRHA 3KK2A 3QINA 4I2QA 3UIQA 5HRNA 1ASUA 2GIQA 3KLFA 4Y1DA 1JLQB 4ECYA 3OYBA 4OGEA 4O44B 3NF7A 4I7FA 2V4RA 2KFZA 1J54A 1RDRA 3F73A 2OPQB 1TKXB 4IKAA 3AVGA 4F2SA 3PJWA 1JKHA 4ECUA 4HKQA 2JEIA 4KRFA 5JS2A 4HVJA 5CYMA 4IDKB 4AHSA 3CQ8A 1MU2A 4E1NA 1U49A 3C6UA 2PYLA 4CJ5A 2ASJA 5EDWA 2YNFB 3ULDA 4E89A 4FLUA 5F9LA 1KTQA 3DRPA 3TAMA 3KOAA 1Q8IA 2BRKA 1J9AA 3TARA 5HROA 3I5AA 1T05B 1F21A 1NOYA 1S1TB 1RT2A 3NF9A 4HUFA 1VSEA 2KFNA 2B6AB 3RRGA 4RW4A 3LP1A 1FK9B 3VA0A 2HWHA 3Q8RB 1NKEA 2FC0A 5KFBA 2HVIA 2QE5A 3KMSA 5CZ2A 1RDBA 3RMCA 3FFIA 3AA5X 1T03A 3HXMA 5K14A 3ZSWA 5CYQB 3MEEA 3OY9A 4F4XA 1IKXA 2GUIA 3EY1A 1WNEA 3CIZA 4NLPA 1X9SA 2ILZA 1S97A 3OS0A 1EP4B 3NAEA 3L2VA 1HMVB 3SV4A 3QEWA 3B6PA 4ZTFA 3T5LA 4FBTA 1X9MA 3H2LA 3OL9A 4K8ZA 5KFNA 1IO2A 4TYBA 4PY5A 3LPTA 4O4GB 3G6XA 3O3HA 1QS4A 4LH4A 4M3UA 3LP0A 3MXIA 2P51A 3HVAA 3Q8SB 1L3UA 4EO6A 3AVFA 1JLEB 1LWFA 1S9EA 3GV5B 4KAZA 4TY8A 1BI4B 2OZMA 3OYMA 3ZSVA 1XR5A 2IA6A 4RG8A 4FBUA 1HPZB 2WOMA 3O3GA 4H4MB 3H08A 3VQCA 4NCGA 4DG1B 4WFYA 3AV9A 3RR8A 1WN7A 1C2PA 2DPIA 2FLLA 1IH7A 1VSDA 4QCLA 4GW6A 1NK8A 1BQMA 2GIRA 3NAIA 1T3NA 4KAIA 2OPSB 3L3VA 2IBKA 3PW0A 1RCHA 4DWIA 4ICLA 4QOZB 1HNIA 3ZSOA 4KHUA 3IRXB 1UA1A 5J2QA 4BWMA 4CEDA 2R8HA 3FDSA 1TK8A 3CVKA 3ISNC 2OH2A 4KO0B 4CGJA 1UAXA 4J2DA 3QGIA 4EO8A 3HJFA 3GIIA 2NUBA 1O1WA 1HQEA 3TAGA 4U7CA 3LWMA 4ZVGA 4FLYA 1EETB 3OJUA 4EP4A 4G1QA 1VRTA 4ID5A 2D0CA 4O5BA 2YNHB 4CHOA 4KB1A 3NAHA 3T5HA 1SKSA 2X6SA 3V6JA 4FJ5A 4FK0A 4LSNB 1L3SA 3PVXA 1QAIA 2IJFA 2YV0X 1S9GB 1KFDA 2X6NA 4MQ3A 5FDLA 1VRUA 5CYMB 4ZHRA 5D3GB 1MU2B 1XHXA 3TAEA 5KT7A 4MK9A 4M41A 3OL8A 3SQ4A 5L1LA 4CJKA 4B9NA 4J9PA 1LW2B 5KG4A 4DSFA 3AVJA 2OPRA 1S6QA 2VG5B 1NJXA 1DLOA 4AH9A 4CK3A 2QKKA 1S1WB 4KTQA 4HCCA 3I5CA 5C24B 5HROB 3SFGA 3ITHA 2UVVA 3IAYA 3PW5A 4DL5A 3CYMA 3KLGA 4B9VA 3H5UA 2PZSA 1RT2B 1J5OB 5KFIA 1S4FA 3L2WA 3NGZA 2YNIB 3OYGA 5KFRA 5KFZA 5EUHA 4M3XA 3OYLA 4DFKA 2O4IA 3RTVA 1R0AA 3AA2A 4G3IA 5KG3A 3TABA 2FLPA 4N5SA 3HT3A 2J6TA 3GYNA 3KIOA 3BGRA 3FFIB 3KLIB 4NZ0A 2R8JA 3V81B 1RTDA 4OKKA 1IM4A 3MEEB 1IKXB 4MKAA 3AVKA 3SFUA 5KG7A 4H4OB 4BE0A 3V1OA 4ELTA 3OL6A 1X9WA 5KT3A 4JV2A 2XY5A 1SKRA 1I3AA 1RA7A 2OA8A 2DFHA 3CFOA 4IRKA 3PW2A 3H5YA 2W42A 1N56A 5KFTA 1HQUA 4BACA 3MFHA 1BQNB 1VSFA 3KK1A 4AHCA 4QW9A 3KHLA 1KRPA 3CWJA 1TKZB 1HRHA 1RTIB 2YHAA 3QZ7A 4F8RA 3BSAA 4E3SA 2WK4A 4DF8A 2UVRA 3BSNA 3C95A 2DFFA 4RW8A 1LWFB 3H4DA 1TVRA 1TAUA 4B9MA 4DSEA 2ZD1A 4IFYA 2WOMB 3ZCMA 4E7IA 3TI0A 3I0SA 1U09A 3P5JA 4RW6B 4KHNA 5KT4A 4H8KA 2XCPA 2FVSA 2UUWA 3LDSA 2W9BA 3QGGA 4KBIA 1HNIB 2R8IA 1SH0A 5KFEA 5J1EB 3VQQA 4I9LA 4XO0A 4F4ZA 4DU3A 1K1QA 3HVTA 3DDKA 1VK0A 1EX4A 2HNDB 3CFPA 4NLGA 4ZVEA 1REVB 1LAWA 1NK6A 4RUCA 2G8UA 4HTUA 4C8NA 2FVPA 4N76A 2D3ZA 2BQRA 1RNHA 1DTTB 3V4IB 4DSKA 2EX3A 4G1QB 3AVHA 3QZ8A 5C42A 2R8GA 2FBTA 4E0DA 4CGFA 4YMEA 4KPYA 1GOCA 2AGPA 4IQXA 2IDOA 4Z4EA 2B5JA 4XPCA 1CZBA 2Y1IA 1VRUB 3LP2B 3DLRA 2OPQA 1RDCA 2E6LA 4KHWA 3G6YA 4RNNA 3KJVB 2B4JA 1TAQA 3HK2A 3AO3A 4E7JA 3CFRA 1ZYQA 4IDKA 2R7YA 4QW8A 4KHSA 1TKTB 4CFCA 2VG6B 1DLOB 5L1JA 5KFQA 2W7OA 1TL3A 2J6UA 4KKOA 5F8MA 4CHZA 4B3OA 2V0NA 5KFPA 1WSIA 3NGIA 3S3MA 2YNFA 3M9NB 2AU0A 3CJ5A 3KLGB 4RUAA 3CM5A 2ATLA 3K57A 4ED0A 1XWLA 3TWHA 4ECVA 2IC3A 1YT3A 4B9TA 4HCBA 2HNZA 1T05A 1ZBUA 2Z1IA 1S1TA 2ILYA 4ED8A 1RYRA 1R0AB 1WSGA 3QETA 1LAVA 5JXSA 4PQUB 4FK2A 3EPIA 1K1SA 2CJQA 2IM2A 5DLGA 3HVWA 4MIAA 1ITGA 1KVBA 4O3RA 4DSJA 4ED3A 1RTDB 5KTQA 4OJRA 4YP3A 1RA6A 1I39A 4J2AA 4X2BA 2D5RA 4KE5A 2P5OA 5KG2A 4CERA 2BRLA 5CYQA 4IFVB 3UQSA 2EC0A 3H5XA 2X74A 3KTQA 4JV1A 4DL4A 3FQKA 4DL3A 2O4GA 1EP4A 4DMNA 3KK1B 2V4QA 1CSJA 2ZE2B 4WYWA 1QAJA 4CFBA 3DM2A 4KHMA 4FJXA 4DFJA 3SUPA 4FLZA 4PA1A 3NGDA 1U04A 1QE1B 3AA3A 4O4GA 4M45A 4IH5A 1U4BA 4Y34A 4NCBA 4DU1A 5SZTA 5L1IA 3KMQA 4RNOA 4QWEA 3M9OB 4JLHA 3DRRB 1S1UA 2XGQA 2KW4A 2ZD1B 1U48A 3ZSYA 4MK7A 4CIGA 3OYHA 3ISND 3I0SB 4CGGA 3OYCA 1JLEA 4NCAA 1NJZA 1K6YA 4QAGA 3PO5A 2FJXA 2YHBA 3VA3A 2D0BA 1BI4A 2AX1A 2JC0A 4URQU 3HP6A 2XI3A 1HPZA 2W9BB 4H4MA 5KRTA 4DG1A 1NKBA 4F3OA 3KHRA 3K5OA 2QV6A 4KV8B 1VSIA 5T14A 4Q8EA 4MH8A 2OPSA 3KKRA 3HVTB 2C22A 1JLAA 3IRXA 1JIHA 4ZP7A 1Y97A 4Q5VA 5DQHA 4KO0A 2RDJA 3OHAA 1W9HA 3QLHB 1WSHA 3T19A 4DL7A 4GC7A 1JLFB 3M8SA 1JLCA 5C42B 4QWCA 3KHHA 1D5AA 3AVAA 1LW0B 3GIKA 1EETA 2FVQA 2Z1JA 2E9ZA 4K4UA 2B5JB 4FJIA 2ITGA 2YNHA 2C2RA 3PR5B 4Z4CA 4ED2A 3VQSA 3S3NA 4FM1A 3PZPA 1SH2A 4AHUA 4LSNA 1RT3A 4RU9A 4ZVHA 1S9GA 4M3YA 4JS5A 1DTQB 3CO9A 5D3GA 5KRSA 4O3OA 2HHUA 1KHVA 1RTJB 1TL3B 4KKOB 4MK8A 3OS2A 3RAXA 4E19A 2DFEA 1GOAA 4B3OB 4B9LA 2HHQA 5KGXA 4DTUA 3KLVA 1LW2A 2VG5A 4DTOA 1S1WA 3QERA 3AO2A 2IC3B 5C24A 1NOZA 2HNZB 5C25B 3HL8A 3RMBA 4XPEA 1J5OA 1QSYA 3PY8A 3O4QA 2VWJA 3JSMA 2YNIA 3U6FA 1TL1B 4CEFA 3ALYA 3BREA 5EWGA 3NBPB 3MEGB 2GV9A 3HKWA 1N6QB 1GX6A 2Z1GA 4KTZA 4CE9A 3OYJA 3RR7A 3OJSA 4CF9A 3UR0A 3UDLA 1QSSA 4CJVA 4FJ8A 1J53A 3KLIA 4OGCA 3V81A 1KLMB 1RILA 3V1QA 1SUQB 3TQ1A 4CF2A 4ECZA 5KT2A 4C8KA 1SL0A 4ZPCA 4H4OA 3M8RA 3G6VA 3CM6A 2C2EA 5F8IA 1WSFA 3LWLA 4EZ9A 3LPUA 3NH2A 1XC9A 3NE6A 3DM2B 1ZBLA 3K5LA 2FVRA 3RWUA 1BQNA 4EP5A 4NLOA 2W8LA 1TKZA 3IG1B 2KZMA 2ETJA 1RTIA 5EWFA 3BQ2A 2BANB 4YFUA 4J9LA 4PUOB 3DMJB 3V6DB 4ED1A 1S1UB 4DFPA 5KFSA 3FRZA 4IH6A 3HPHA 4GVMA 3Q8QB 3NDKA 1TQLA 4EYHB 2WCXA 3ZT3A 3VQ5A 4O0IA 4NLUA 1QHTA 4RZRA 4BE2A 2R2SA 3TR8A 2IS3A 3SUQA 4C8MA 5F9NA 4F4KA 1S0MA 4FJMA 4RW6A 4DQPA 4NLYA 4IBNA 4CIFA 5F8GA 3DRSB 4E7HA 4KFBB 2HMIB 4W5OA 1JLAB 4FJGA 3L2QA 3E51A 2RN2A 3VQ6A 1TK5A 2HWIA 5J1EA 3AO1A 4F3TA 2I5JB 1RBTA 4UQGA 3N6MA 3D5MA 3V6KA 4Y2CA 1NJYA 2HNDA 3HPGA 2R2UA 4ZP8A 3ZT4A 1SL2A 3OYIA 4Z0UA 4FJLA 1REVA 3TAQA 1B9FA 1JLCB 4OLAA 3WNHA 2D0AA 5KFJA 3VQ8A 4JV0A 1D9FA 3M8QB 4KHYA 5HP1A 4LD0A 1DTTA 3V4IA 4WE1A 1T7PA 3SI6A 3OHBA 1RBRA 4DSLA 4Z4GA 1S1XB 1N4LA 2XY6A 1BIZA 3MECA 2YKMB 3LAKA 5I3UB 1ZBFA 2AWZA 4RW7A 4NLXA 1W25A 4KREA 4YQWA 4O3NA 1RT3B 3OYKA 4RNHA 3AVLA 3LP2A 1EXQA 1TGOA 2JEFA 3KJVA 3EYZA 2UVUA 2QXFA 1LV5A 1L3TA 4FZYA 1TKTA 5KFUA 2VG6A 4LSLB 2IOCA 4FXDA 4GMJB 4CJSA 2F8EX 4CHNA 4C8LA 2BR0A 2FBYA 4CFAA 3HPOA 4K8XA 3JSMB 5DGBA 3LZIA 1KVCA 3I5BA 4CJQA 3EZUA 3HYFA 2D3UA 1RT7A 3PR4A 1U47A 4PQUA 2W8KA 2LSNA 4ECWA 3E01B 4ZP9A 3SNNA 3SCXA 3G86A 4Q44A 5J2PB 4N56A 1WAFA 4ZVFA 1CZ9A 1CLQA 1VSMA 1NJWA 3DLEB 1JLGB 4B08A 4M42A 3VQBA 5HLFB 2YKNB 3MTKA 4FK4A 4IFVA 3AO4A 3HM9A 1HJRA 4DTPA 1C1CB 3MF5A 3PO4A 1D0EA 2I1RA 2ZE2A 4CJPA 3K59A 4WXOA 3V1RA 5KFKA 3LALA 3H98A 3AVCA 5KFHA 3OYNA 3QO9B 4MKBA 1QE1A 4TQRA 3ASMA 3JYTB 1GX5A 3F9KA 4HYKA 4W5NA 4I2PB 4Q0BB 3V9SA 3DRRA 3PX0A 4R8UA 4NRUA 3NGYA 3BDPA 4IRDA 2R2RA 4LY7A 3CDUA 1RT4A 4CGHA 5KG6A 3RBDA 5DG7A 3WNGA 4URSA 4DL2A 1UOCA 3RMDA 1IKYB 1RTHB 1UWBA 2BE2A 2HNYB 2PY5A 3PX6A 2A1RA 1NNDA 4KV8A 2AGQA 3OLAA 4CHYA 3VQ4A 1TK0A 3QGHA 2HHXA 3VQEA 3PJXA 3QESA 4KHRA 3KK3B 3DLHA 3NHGA 3BJYA 5HP1B 2XCAA 4WE1B 2JLEA 3QLHA 3MR2A 3H5SA 3QIOA 2XI2A 3GV7B 4AHTA 3KD5E 1JLFA 5KI6A 3MECB 4RNFA 3D45A 1LW0A 4RW7B 3KLEB 4FJ9A 4CJ3A 4DQIA 5DLFA 3HVRA 4M3ZA 4E7LA 3GILA 4KB0A 1C1BB 1C0UB 4EBCA 4YR3A 3OYAA 1DTQA 1G15A 5HBMA 1YVFA 3NKYA 1RBSA 2HB5A 4CIEA 4B8CA 1RTJA 5DGAA 3SZ2A 3OVNA 4FJKA 5KGWA 1VSKA 5J2MA 4K50A 4DF4A 3AVIA 2G8VA 3H4BA 5C25A 1BGXT 1QTMA 3PV8A 1RT7B 1IG9A 4BDPA 4FZZA 4DTRA 4CJEA 3TAPA 4W5TA 2FVCA 5HRSA 1TL1A 4DLGA 3NBPA 3MEGA 1BIUA 1N6QA 4ZPAA 3RBEA 1RDDA 4F50A 4B8AB 4EBEA 3NL0A 5KFLA 3IGNA 2VG7A 4ELUA 1FKPB 4AILC 4FS1A 1D8YA 1IKWB 2OYQA 1KLMA 4JRQA 1SUQA 1JX4A 2F8TA 1RDAA 4CHPA 3LANA 4CF1A 1WNSA 2FJWA 1JXBA 1S0NA 4ID1A 4BDYA 4K4ZA 4CJLA 1C0MA 4FZXC 1YVUA 3SV3A 2P5GA 5EU7A 3AVNA 4LH5A 2F96A 3Q8PB 4OKJA 4URGA 4TN2A 3IG1A 2HHWA 4KHQA 2BANA 4EZ6A 4PUOA 5JS1A 3RB6A 4WFXA 3DMJA 3V6DA 4R8UB 1JL2A 1ASWA 4B9SA 2KQ2A 1N48A 4NYNA 1NK4A 1RT4B 1RT6B 4I9QA 5I42B 1WSEA 1YTUA 3OS1A 4PWDB 3IS9A 4J9QA 3DLKA 1W0HA 1X1PA 2XHBA 1UWBB 2BE2B 1ASVA 1S5JA 2RF2A 3MR3A 3P83D 4HUEA 3SUOA 3C6TB 3DRSA 4KFBA 2AGOA 2HMIA 4AHVA 3OYFA 2WTFA 1JXLA 3DOKB 3CJ0A 4KB7A 1LWCB 2IGIA 1CXUA 4OKEA 1XR6A 1RT5B 2Q3SA 2W9CB 1LWEB 1C0TA 4O4RA 5F8NA 1OS5A 2I5JA 3VQ9A 1WSJA 1ZETA 2VA3A 4OLBA 1S48A 1S9FA 4H54A 3K5MA 4CF0A 4ECRA 2E9TA 3VQAA 3K2PA 1HNVB 3ZSQA 3M8QA 4Y1CA 2ZKUA 4LQ3A 1S1XA 4C8OA 1SV5B 3KNAA 2YKMA 5I3UA 2UUTA 3NFAA 1BHLA 3GV8B 4CECA 4CJUA 2G8FA 5L1KA 4FLWA 5HBMB 5F8HA 2Y1JA 2VWKA 5KFMA 4Z4HA 4IG0A 4ELVA 3MAQA 2HAIA 3FQLA 4KI4A 3QIPB 3MXJA 5J2MB 1FKOA 5CZ1A 4BE1A 4LSLA 3PW7A 4ZPBA 4ECXA 4JRPA 4J2EA 4IKFA 3THVA 3O4NA 3AVMA 4CEBA 3QEPA 3OYDA 3IN5A 5KFFA 3FSIA 4CCHA 1TV6B 3ZT2A 3KHGA 3PW4A 2IMWP 3CJ3A 1KHWA 4FW2A 4E7KA 3SUNA 1U45A 4DTSA 2G8IA 2VG7B 3PX4A 1NK0A 3E01A 4R5PB 3IGVA 1IKVA 4FM0A 4K4YA 3EZ5A 1S6PB 1RAJA 4J9RA 4FJ7A 4NLWA 5J2NB 3M8PA 4CJTA 5KT5A 1BCMA 5J2PA 2XRIA 3QEXA 3DLBA 1NK5A 3DLEA 1JLGA 1C6VA 2XWYA 5DG8A 4CHQA 3MR6A 3L2RA 5HLFA 3WNFA 2YKNA 3I0RB 1VSJA 4DTXA 2IJNA 1L3VA 4QWDA 3NF8A 1C1CA 2G8HA 2AX0A 2E9RX 3DLGB 4DS5A 4DQRA 2ASDA 5KT6A 2HW3A 4FVMA 4EYIB 2G8WA 1FXXA 4MFBA 2XGPA 1BL3A 5L9XA 5DK5A 2X78A 4Z4IA 2RPIA 3PUFA 5KFVA 4WFZA 2CKWA 3QIDA 3GIJA 5CY4A 3T5JA 3QO9A 4CJWA 3EPGA 2WONA 3JYTA 1ZTWA 4WZQA 1RBUA 1XR7A 4NLQA 4I2PA 2IM1A 4Q0BA 3IS9B 2HVHA 4CJFA 3T5KA 3DLKB 3AO5A 1JL1A 1C1AA 2RF2B 4J9SA 3NCIA 1RT1B 4E1MA 3HHKA 4HHTA 1IKYA 1RTHA 3MFIA 2HNYA 2R8KA 1QQCA 3BQ0A 5DMRA 2KZZA 1D1UA 4DEZA 5FRMA 1C0TB 4CJRA 1NK7A 2OPPB 5KFDA 3RAQA 4TY9A 3NH0A 3ICLA 3D0PA 1XHZA 3ZT1A 3K5NA 5KFAA 3MEDB 4RW9B 3KD1E 1ZBHA 1JLBA 3KLHB 3KK3A 5DG9A 3NMAA 3DYAA 2F8SA 1NK9A 2IAJA 3P1GA 3L2UA 3V6HA 5KFGA 2BGGA 3BQ1A 5HRPA 4J9OA 3RB4A 1S1VA 1HARA 3KK2B 5DQGA 4I2QB 3SPYA 1D9DA 4NLRA 4K4TA 3KLEA 2HHSA 3KLFB 3RB0A 2RDIA 4J2BA 1B9DA 4L8RB 4I7FB 2ALZA 4DQSA 3G10A 1C1BA 4YR2A 1C0UA 5DQIA 4IG0B 4CFDA 3SPZA 4Z4FA 4LQ9A 3DOLA 4FJHA 3B6OA 4W5RA 2GC8A 4DSIA 1JKHB 3K58A 1WAJA 3TANA 5KFYA 1FKOB 2FJVA 3N6LA 5KG1A 2JC1A 4AHRA 1L5UA 2JEGA 5F8LA 2IM3A 5KFWA 4TSXA 4DFMA 3C6UB 4O3QA 3CDWA 3H59A 3M9MB 4DTNA 3BSCA 3I8DA 1UA0A 4NLTA 3WNEA 1GOBA 3HO1A 3DRPB 3TAMB 4F2RA 3UPFA 3NF6A 4ZMMA 3BR9A 3VN5A 3V9XA 3TVKA 3G0ZA 2JGUA 4BWJA 1SKWA 1N5YA 3U3YA 1RBVA 4YR0A 1IKVB 4Q45A 1S10A 3SQ0A 2RKIA 5FRNA 4RW4B 4GC6A 4FLTA 1Z25A 3LP1B 2AJQA 3M8PB 1HYSA 4DTJA 1FKPA 1QUVA 1VSLA 2FBVA 3QEIA 1SL1A 3MR5A 1A5WA 1A5VA 2DPJA 1IKWA 4FW1A 2EHGA 3S9HA 4W5QA 1NHUA 2XO7A 1SH3A 4R0EA 5KFOA 1T03B 5K14B 4CK1A 4YNQA 4TXSA 4ZPDA 1JXEA 4FLVA 4MFBB 4FYDA 4IG3A 4K4WA 3TAFA 4CEQA 4DQQA 1S0OA 3RB3A 3SQ2A 3SJJA 4NYZA 1MMLA 2P1JA 5EWEA 1KVAA 2WONB 3LP3A 4TQSA 4NLSA 1BCOA 2FLNA 4CF8A 1BISA 2ZQBA 3VQ7A 4Y2AA 4J9KA 3V9WA 4ECTA 3LP0B 2YNGA 1RT6A 5I42A 4O3SA 2OZSA 3OLBA
chains in the Genus database with same CATH superfamily
3CJ2A 4CO3A 2EFQA 2CQ3A 4NYFA 3A8JA 1ZZFA 3OSNA 4QPXA 2DRDA 5C2CA 2U1AA 3F9MA 3C6TA 2N4CA 2DHHA 3DOMA 5KG0A 4KHPK 4Y3CA 3EEQA 4IO1A 2QTWA 1S77D 1NGHA 2W9CA 1M5HA 3TSQA 4DR7J 1RACB 1FI4A 4K4VA 4BRLA 3EICA 1T94A 2HBYB 4QWAA 4N41A 3C15B 8RUCA 4KGKA 5C5JA 2BXJA 4WYLA 1HNVA 3OTDA 4G1PA 4CEZA 2CA9A 1S1VB 4DPTA 2GJIA 2V9KA 2A1SA 2FBXA 1VS3A 3DI6A 1VHIA 4ID5B 4B3RK 5CZVA 2CIMA 2HLTA 2HQFA 3T1HF 2VOPA 3SAHA 2OGUA 1AROP 1M90T 2B43A 2IPOB 2NUUG 1TUGB 2Z1HA 3ZXWA 5F8JA 2HHTA 1NNEA 2WW8A 3M3ZA 1G3OA 4ZTJA 5F41A 2DT9A 5LMNJ 4DUZF 2CDRB 1R59O 3RAMA 3T1AA 1M1GA 2ZNZA 2WRMA 2WW4A 4CZFA 3K5PA 4K4SA 4OVLA 2AJFE 1GH8A 1UZHA 3KDOA 1VOMA 3C0BA 5KFXA 1YX2A 1N5YB 2VBWA 3GIMA 1X3NA 4PPZA 4OIXA 2XMAA 4O3PA 4B02A 3D0HE 4I69A 4DR1F 2Z56B 5HANA 3LPEA 3NMUA 3C16A 4M95A 1AXQA 2SXLA 3L4BC 2D41A 1SXLA 4LRDA 2B6AA 3A2FA 4I6MA 1BWFO 5FPDA 2YPZA 3CJRA 2H4WB 1RYSA 4DV6F 1KLNA 1WOSA 2IM0A 4RNMA 1D3WA 5H9FJ 2JL9A 3PYGA 1IUJA 4W4MA 1IBKK 2YHYA 3V9UA 3DLGA 3D54A 1X8DA 2DXDA 2IVFB 5K8NA 3CCSS 4E1JA 4CGDA 4FYVB 3CDEA 1HYVA 4FJJA 2GX8A 3VQPA 2MSTA 4FCYA 1NDLA 4B9UA 4AM6A 4QWBA 4BQZA 1KONA 1HLWA 2KHCA 2UXBK 2VL1A 4HUGA 2QO3A 5LJWA 3L8BA 1TKDA 3D2FB 5KG5A 4JI7K 2AYBA 4IFYB 5HVHA 1N33K 1ZAXA 3MM6A 4CEAA 2KT5A 2D1KA 3P6YC 3R5GA 5B09A 2EWSA 4DTMA 2F8MA 4JUZA 1S99A 3PHEA 4E2FB 3BEXA 1NCLA 2Q3PA 2G13A 2E4LA 2BQ3A 1KSPA 3M8YA 3N9UC 2OPPA 3C6HA 2XYGB 2DGVA 4IR1A 4CZHA 3TSPA 2KN4A 2BJ3A 4RW9A 3VALA 4QS8A 1F6TA 4JAXA 1KFSA 4CNYA 3MMAA 2R2TA 4B1VA 1WF2A 4WPAA 4L3NA 3CCRS 4FSVA 4KTWA 3NGRA 2GA7A 3WT0A 4DS4A 3BGLA 1ZOTA 4I2QA 2HFNA 1RAGB 3ENVA 2IBOA 4NXMK 4ECYA 4O44B 5DZ7A 3IUCA 2QA2A 1HQ2A 4A62A 2YQ0A 4HACB 3NEKA 1A6LA 2ATCB 2FIUA 4CT8A 1WI6A 5JS2A 3ZZRA 5CYMA 2BBEA 5CHIA 1WTFA 5FPNA 4OX9F 5EDWA 4ZCIA 1MSWD 4NB4A 3QICA 2VFVA 2FD2A 5F9LA 3W5ZA 3KOAA 1Q8IA 3WX4A 4PCQA 3RSEA 5JVHQ 5HQMA 2JLFA 3CC7S 2JWKA 5HATA 1F21A 3EXYA 2PT0A 1RT2A 3NF9A 2PI5A 4HUFA 5IV3A 1VSEA 3D2WA 3B6BA 3TR5A 3ULHA 1NM1A 4BGAA 5AQOA 5DO2A 4WU3A 2FC0A 3CMAS 5KFBA 5ADZA 2QTDA 1FXDA 2UXCK 3KMSA 5EX3A 3RMCA 3FFIA 4PKHA 1YJTA 4P52A 3AA5X 2HIYA 3HXMA 3S01A 3SCLE 1IKXA 1CS4B 5G4DA 3CIZA 5A8WA 4NLPA 2MZQA 1Q81O 1XN9A 2YCHA 1OH7A 3QEWA 3B6PA 4ZTFA 1X9MA 2DK2A 2APOA 3H90A 3GFXA 4K8ZA 2ZC4A 5KFNA 4TYBA 3RU0A 3LP0A 2LP4A 1P27B 2HZCA 1OPZA 7FD1A 3HVAA 3Q8SB 2GW8A 2VPYB 3HI9A 5EXWA 3M2VB 3WIUA 3GV5B 4A48A 5CHCB 2HRTA 2OZMA 1F9FA 3W3SA 1KD1O 4PAAA 1WACA 3O1LA 2EFPA 1SB6A 3H08A 3VQCA 4NCGA 3AV9A 3EGZA 1SC6A 3CJTA 3C65A 5KAKA 1IH7A 3QBWA 1NPRA 1NK8A 1HBMA 2OPSB 3OA9A 3I9V9 1NLKL 1QVFR 1QM9A 2HRUA 3IRXB 5J2QA 3QPIA 4CEDA 3IDHA 4OLPA 3FDSA 4JKFA 4B1WB 3BF4A 4Y65A 2OH2A 4IZ9A 1KC8O 3HJFA 3GIIA 4DPWA 3ZTOA 1JJ4A 1HQEA 3TAGA 1ITPA 1OQ6A 5BRDA 4PG7A 4O0NA 3OJUA 4G1QA 4CLSA 3TJAA 2YNHB 3CXCR 3U27A 4NI2A 2VQFF 3CCUS 2DGTA 2LXFA 5AQWA 4LSNB 3S7RA 2IJFA 3PVXA 3K8WA 5AQTA 3ZZYA 5AJ3F 3PIPL 4ZHRA 2NRTA 3ZETA 3D66A 2VUGA 4AL6A 4M41A 4DV3K 3SQ4A 4FWMA 4A5AA 2CWKA 5L1LA 1SQGA 3A8EA 3G71N 1LW2B 2HHHK 4F04B 2OPRA 1NJXA 4CK3A 3V4MA 1NSPA 4EFAC 2UU9F 5CD4H 3QJLA 3IWNC 3DN9A 4YB7A 3CYMA 4EAHD 1HWUA 1FDAA 3H5UA 3ENBA 1J5OB 5KFIA 2QXLA 2Z4PA 4M5DA 1S4FA 3L2WA 4ISEA 4B3TK 3O8WA 5KFRA 4A8FA 1QLNA 2V68A 1SAZA 1BA1A 5L9NA 5KG3A 3TABA 2V8HA 2J6TA 3KIOA 4F36A 3P39A 2QL7B 3R9PA 4NZ0A 4X4OA 1T95A 2GEMA 1HW8A 3MEEB 1M5PC 4JI6K 2M8DB 3SFUA 3T1YJ 4DV1J 4BE0A 2YH1A 4CO5A 5KT3A 2P9SA 3BB5A 4OZJA 2OA8A 1NH8A 3H5YA 3DLLL 3NMRA 3MFHA 4IEEA 1VSFA 2E2PA 4NEZA 1K9MO 4WQ4A 3PYDA 1HNZF 3BSAA 4PABA 4XAKA 2ZH8A 3C14B 4DF8A 2HMPA 5ETQA 3BSNA 4RW8A 3CB4A 4BROA 3P45B 1LWFB 3ULEA 3H4DA 3CDBA 4OX6A 4HL9A 2M0GB 1TAUA 2V50A 1I94J 1UVKA 4B1ZA 4QR1A 3N4WA 5AQVA 3O9TA 1V6HA 3M05A 4OHVA 1Q86T 4H8KA 4CO0A 4P74A 2FVSA 4UW2A 3LDSA 2W9BA 1HI8A 3CD6S 1R8BA 3J80U 4C4WA 3ETOA 1URNA 4LF8J 5I3QA 2V6AA 2IY5B 2DH8A 3VQQA 5BR8J 4XO0A 4JI0F 1FTRA 4RL1A 3HVTA 2FSNA 1T9VA 4RLEA 4LF9J 1NK6A 3RUBL 1PJ7A 5IC6B 3AY9A 3HZ6A 2G8UA 1YUWA 3MCMA 4HTUA 1WOPA 4YY3K 4N76A 3LW5C 2KG1A 1DTTB 4EWTA 3M2UB 3G82B 1N8RO 3DGVA 2NR0A 3P31A 5K5MA 5M1PA 1ELOA 1Q82T 2PFFB 1F1BB 4YMEA 2AGPA 4IQXA 4XPCA 1QZ5A 1VRUB 1VGYA 3DLRA 2OPQA 3H3OB 3CC2S 1NJIT 1RDCA 1WC1A 2E6LA 3KJVB 1U0HB 4ZCLA 1TAQA 1RQ0A 2PI4A 5C12A 2CPHA 1ZYQA 2R7YA 4KHSA 3RVCA 1IWAA 1DLOB 2MZJA 2J6UA 5T7LB 5F8MA 2V0NA 1F5CA 3S3MA 2YNFA 1FD8A 4HLBA 4B3MF 3KLGB 2ATLA 2N7YA 4OJ3A 2KFYA 2J9EA 4ECVA 1JCEA 1YT3A 1YJ7A 3UNGC 3M6UA 4ZPWR 1ZBUA 2Z1IA 2Z0GA 2ZH1A 2V2KA 5C0YA 5AZJA 4YOVA 4YOXA 1LAVA 3IWXA 1WC0A 3EPIA 1B7FA 4WBFA 2GQ2A 1QJHA 5DLGA 4OYOA 4ED3A 1RTDB 4YP3A 1YI2S 3DLLQ 4AD6A 4J2AA 1R0CB 2CQIA 5LOQA 5AE2A 6AT1B 4X2BA 2XZDB 5KG2A 4CERA 5CYQA 3H5XA 3UQSA 4X64K 4LF5F 4QIWD 3FQKA 2LFVA 4PKIA 4PWWA 1U8WA 1RABB 4DHVA 2P8IA 1U1LA 2CDQA 4CFBA 4DV5J 4KHMA 3B4DA 2A0FB 2VD3A 2CAJA 1RP5A 4DR2F 2BUPA 1C0FA 5H1SQ 1Z6RA 3QMQA 3DRRB 4JLHA 4FPIA 2XGQA 4CIGA 4MK7A 3OYHA 3ISND 5LM7E 3AJ1A 3FGVA 4HH0A 4PXBA 2YBVA 2P2CB 1CJTA 3PO5A 2PEBA 3VF2A 2YHBA 2D0BA 1BI4A 2AX1A 1N52B 2NXEA 4XEIA 4B1XB 1HPZA 4H4MA 2F3JA 4F3OA 1NGAA 5IWAK 4DUYK 3LM9A 2W01A 1T3OA 2QV6A 1VSIA 5T14A 3VGMA 3CTRA 2C22A 2FC9A 2LDYA 4K5RA 2PO4A 2QIFA 2J7UA 1K0VA 1Y97A 4Q5VA 3MPWA 4DR6K 4PYAA 1YG0A 4A8WA 1VQ8S 3TVZA 5DQHA 2BVZA 1VYAA 2ZOMA 1WSHA 3T19A 2JVRA 4DL7A 2OTJN 1RBLA 1JLFB 3M8SA 2QX0A 4IJNA 1KVKA 2C3UA 1HLUA 2P9UA 2B5JB 1MG7A 3QAEA 4FJIA 2ITGA 2KT2A 3PR5B 4Z4CA 3BGOP 4ED2A 4FPAA 3D6RA 3GL1A 3VOVA 2CQDA 2IVYA 1RT3A 2FGOA 1TTHB 4M3YA 5B0FA 1DTQB 4OJHA 2HHUA 4XDCA 5K9FA 1TL3B 5CQGA 4KKOB 4MK8A 3RAXA 4B3OB 2PSZA 2HHQA 5LJVA 2RE1A 1VK3A 3E9PA 3HHEA 5HQLA 1S1WA 5AQFA 5BREA 3IBWA 2V2ZA 2BJDA 3IM8A 3PY8A 1KVJA 4Y0WA 1O51A 3JSMA 2YNIA 1UWAA 5LMUJ 3HHLC 5H9EJ 2D0PA 3ALYA 4CEFA 2BUNA 4ILHA 4RUBA 3HKWA 4PKDB 1YJUA 5D77A 1EQ0A 1KP6A 3RR7A 3A1YG 1QDUB 3MUTP 3D1OA 4OGCA 1FX2A 4LR9A 3ILIA 2E5LF 4I64A 3SDEA 2EWHA 2DJWA 4H4OA 2K7KA 1HW9A 3G6VA 2M52A 2MB0B 1GAOA 2KT3A 4TKTA 4UY8O 3NH2A 3MCNA 1RHUB 2CQHA 4EP5A 4A2AA 2F9JA 2W8LA 1TKZA 1RGVA 2BANB 4YFUA 3QWUA 4PUOB 2CPFA 3VVTA 3SEOA 1UVJA 5KFSA 4OI2A 3FRZA 3HPHA 2NRXA 1QQMA 3ENAA 2KKHA 1BA0A 3VAIA 1UJ5A 4C3KA 1Y00A 4BRNA 3BPDA 1BC6A 1Z1ZA 3KG4A 5F9NA 3MXHP 4FJMA 5H1SV 5D4NA 2VFTA 2UUAF 2BYCA 3OR2B 1EWQA 4XH4A 1SIWB 2QRRA 4LBHA 1WEYA 1VJQA 2E2QA 1EX8A 2CNKB 2MQ8A 3OTOJ 4PG8A 3E51A 4GVBB 1HWJA 3DXMA 2HWIA 4CBXA 1RBTA 3HHNB 4RBUA 2DGXA 2EEYA 2NRVA 1OH6A 2Q0UA 4FJLA 2C3OA 4U96A 3FZMA 3TAQA 2NRHA 4B1YB 3WNHA 5CA5A 4IDHA 2HBZB 5KFJA 4JV0A 5HP1A 3V4IA 3NRBA 4MDAA 2OP5A 3MD1A 5EOYA 1BIZA 3MECA 3LAKA 3I8BA 4FWPA 2HQ3A 3QRPA 1ZBFA 2AWZA 1RISA 4RW7A 1S59A 2QA4N 1ZAWA 2UUBJ 4O3NA 3ENWA 4OZ3A 3UN2A 3PFOA 2V51B 3MMBB 1SVDA 2VPZB 3JXUA 5LY3A 3LP2A 1O8BA 2XMVA 1PIEA 2F1FA 1EXQA 2JEFA 2CNNB 2I2YA 4V1Ak 1YRXA 3LDOA 3LPYA 4X4NA 3TTCA 5KFUA 2YQ1A 2IDLA 3R6GB 2YX7A 4K0KJ 4GMJB 1UPPA 4CFAA 2HFZA 1MROA 2OD4A 4LF7K 4ZJLA 1KVCA 5HVFA 3EZUA 3OV7A 4DV7K 3PR4A 4PQUA 3C7NA 3E01B 4FDFA 1HNXK 4AL5A 4H4KC 4BVPA 2B3TB 4X62J 3OW2R 4N56A 2AP6A 5IM0B 3R6LB 3CJAA 2G2YA 1NJWA 1SJRA 1JLGB 5HQ8A 1NGJA 1T9YA 4FK4A 2XZWA 4KH6A 3QGPA 2OAUA 3HM9A 3AO4A 1HJRA 3DRXA 1C1CB 1K8KA 4G1IA 3PO4A 3BBBA 3ZYYX 1KBRA 1RLDA 2OHDA 1M5VC 2Z2YB 3OXGA 2XTJP 3TZZA 4NPOA 3HSGA 2I1RA 2ZE2A 1DT9A 1NGIA 3K59A 2DH9A 2E5IA 4B3RF 1QE1A 3JYTB 2HFUA 2W24A 4QR0A 1C4AA 2MKSA 4JI2F 3PX0A 4R8UA 3CJ8A 4DV4F 4LY7A 1RT4A 4CGHA 1U8SA 3K17A 1DQAA 5KG6A 4I56A 2DRBA 1VLOA 2I8EA 2QWPA 4URSA 1VAZA 2N3LA 1YQHA 2MQLA 1HWKA 3MR7A 1UWBA 2HEKA 2N4DA 3HRGA 1FFWB 2C42A 4DOZA 1FJEB 1WEZA 3GWCA 4MT1A 1TK0A 2B9WA 5AXMA 3QGHA 2BKNA 3ZZ0A 1EQYA 4LFAK 1HX1A 2HHXA 1RHRB 5CAAA 4F67A 1EIYB 3KG0A 3CJKB 3KK3B 4YN3B 2V7ZA 2HBLA 2B4VA 3NHGA 2XCAA 4JI1J 3O5BA 4JI3F 4LF6J 3M6XA 3TP2A 4HH1A 5ETLA 1U1RA 3KD5E 3CCJN 2X1BA 2F4VF 4U8YA 4FOIA 4I67A 2OSRA 1ZM3A 4DR3J 4JEPA 3CPWM 4WK1A 4FJ9A 5B0GA 2DNQA 1WTBA 3FMBA 2Y1LB 3GIRA 1R8PA 3FCVA 1C0UB 4YB5A 3G2XA 2UXDK 3W9IA 1IBKF 4IEIA 3W65A 1BU6O 5HBMA 3E1YA 3NKYA 1SJ1A 4CIEA 3UR3C 4B8CA 1RTJA 4J9VA 3OVNA 3TO8A 3WIVA 4LVOP 4DPXA 2AW0A 5CCLA 5J2MA 1O6XA 2W41A 4NZ7A 1FRJA 4Y6IA 2UXBF 4DF4A 3AVIA 1S0VA 4P2MA 3H4BA 1QTMA 3EX7B 1IG9A 4JI7F 4C23A 4CJEA 1IR0A 4W5TA 4YS2A 1R7IA 3MEGA 3I87A 1RDDA 4EBEA 1A7GE 3JQMA 2PGCA 4MO4A 4TU8A 3R5DA 1FKPB 4C0HA 4AILC 1N32F 4ANEA 1D8YA 4P72A 3QDKA 2F8TA 2ZOGA 3A5LC 4JI4K 4PR6A 4FZXC 2MKKA 4OO1J 1W2IA 2XBPA 5F2RA 3TJ9A 1WUUA 4DR5F 3MDQA 4OX7A 5KPZA 4KHQA 1E6VB 4WFXA 3DMJA 2XS5A 2P9GA 3LGHA 2FXUA 1RAIB 4B9SA 3D6FB 5DRKA 1NK4A 1N48A 2ITMA 4JI8K 1Y3KA 3L7OA 3NGUA 2XSJA 3H7HB 3OXFA 4LRCA 3IS9A 2B4PA 2GS8A 2HF3A 2X1AA 2BE2B 4GKKF 3MR3A 3ATVA 4NA1A 4HUEA 3SUOA 5DDQC 2KYZA 2OSQA 3UD4P 3MDFA 4GVLA 4DV2J 1FXRA 2HMIA 1KQKA 1UVLA 4AHVA 3IO1A 2WTFA 2LQ9A 1PGZA 4KB7A 3ET6A 1LWCB 1XNRK 2YWFA 3GG4A 4YOWA 2Q3SA 2V8GA 1LWEB 4O4RA 3VQ9A 1WSJA 1X4EA 4R25A 2E1AA 3THTA 4H54A 3BBFA 4CF0A 4ECRA 5LXYA 2ZOFA 2E66A 3NXZA 4DJBA 2N3OA 1XK8A 3W7BA 2HQCA 3AJDA 3PHTA 4JOUA 4PRFA 1XNQK 3GYGA 1SV5B 4OZ5A 2UXCF 3D7SB 3LL3A 2YKMA 5I3UA 4AYBD 2UUTA 2FHKA 2AZ1A 1OWXA 2ZC3A 4DV0K 1NBWA 2HURA 2ZM6K 3N79A 2Y1JA 2YKOA 2VASA 2GELA 2VWKA 1VBKA 1H98A 3MCOA 2KG0A 2HAIA 3FCHA 3JXOA 2YI1A 4RWTA 4BE1A 5C10A 1VQYA 4J2EA 2CPIA 2HBKA 2BJ1A 1XMOF 2A6AA 4CEBA 2ZVIA 1J27A 2AP1A 4QQBA 1Y5NB 2GO8A 5KFFA 4CCHA 1TV6B 4B3SF 4BC9A 3KHGA 1WI8A 3HULA 2DXEA 1OY9A 3O6WA 2J8AA 4FW2A 3SUNA 1WB9A 4LF4K 2BV3A 2G8IA 1RXOB 2VG7B 2CQPA 6FD1A 5GADU 3G25A 4PL8A 4FM0A 3FBEA 2DNLA 1S6PB 1RWVB 1RAJA 4C6AA 2DO4A 1BCMA 4AQYJ 1HIYA 3DLBA 1OQ3A 1YJNN 3DLEA 2XWYA 1VSJA 2IJNA 1RAHB 4BR2A 4X65J 4B17A 1RHQB 3ZTQA 3QSIA 4ED4A 2V4JA 5HMWA 4DS5A 2ASDA 4WYBA 2M88A 2E7VA 4HVZA 1VQ4N 2CZ4A 2RPIA 3QIDA 2YX6A 1S4EA 3GIJA 1FNMA 5CY4A 2KM8B 4CJWA 3EPGA 4DZ6A 4DDFA 5GMDA 4DR7F 1XBWA 2YTCA 1EKSA 1ZA1B 3M32A 4I2PA 2IM1A 3T5KA 3DLKB 1T6DA 5GAEP 4LT6A 4L3KA 1HBOA 3J7YU 1SCJB 3CULA 5CCMA 4A8OA 2F7TA 4DQ8A 3NCIA 4J90A 3HHKA 3CCEN 3M6VA 1IKYA 2ZH4A 2H65B 3UCGA 4OFZA 5GIPA 4DPOA 4QS9A 4USWA 5FRMA 1C0TB 4KGVB 4EU0A 4RTFD 3MM7B 4PG6A 3HBTA 4TY9A 4X4VA 3PKYA 3J7YP 3NGKA 4LFCK 2PMHA 5BJRA 2PEHA 1ZBHA 4B3TF 3K9KA 5THWA 3PG9A 4YDDB 2F8SA 1NK9A 4JV5J 3PDNA 4H5RA 3P1GA 3L2UA 3V6HA 3THYA 1UFLA 1ZH5A 4ZVOB 2W4PA 5HRPA 1H72C 3SPYA 1W7WA 4JI6F 1LOTB 4J2BA 1RI7A 2G2OA 2ZBQA 2XZTB 3G10A 1C1BA 1BWVA 3SPZA 3DOLA 4WP8A 4FJHA 1BE4A 2GC8A 2CJYB 5KQ8A 4UY85 1JKHB 5KFYA 1FKOB 3N6LA 1SC3B 5F8LA 2IM3A 4IUFA 1MWQA 5KFWA 1HR0J 3CERA 3KUGA 3OD2A 2NRWA 4O3QA 2QWLA 3M9MB 4PYDA 4DTNA 3K7RA 1UA0A 2P9EA 2L3MA 4FP9A 2BTFA 3R6MA 3NOCA 1UETA 3WNEA 3PIOQ 1GOBA 3X3UA 3HO1A 3DRPB 3TAMB 4CW7B 4KRWA 1S76D 1F9EB 1UFKA 3V9XA 3G0ZA 7AT1B 2H54B 1FRMA 1RBVA 3HOTA 2K06A 3NP5A 4RW4B 4FLTA 2AJQA 3M8PB 4JKAA 1VSLA 4DR4K 1T44A 5IT9U 1NGFA 3PRDA 2KXNB 4FW1A 2ZUAA 4RPFA 4W5QA 3ZX3A 2BJ8A 3D2EB 4MAKA 5LL6Z 1NHUA 1SH3A 3DGPB 1T03B 3JB9k 3J81Y 3JAMU 2Q79A 4ZPDA 2FGCA 3G9CA 4BS2A 4IG3A 4CEQA 4OHZA 3RB3A 2O8BB 4YY3F 2LXIA 4OJGA 3SJJA 1GXUA 2ZBCA 2JNJA 4QYZJ 2WONB 4TQSA 2V8DA 3MM9B 1CJVB 4CF8A 2ZJPQ 2NSCA 1RWXB 4J9KA 1APSA 2MLZA 5A8KA 2YNGA 2E1CA 4CNZA 1RT6A 5CXTA 2DYAA 1S9EB 4IRCA 2QWQA 3M1VB 1F2HA 1A5XA 2EKYA 3IXQA 4UT4A 4Z7YA 3DOKA 3VQDA 2KO1A 1NBEB 4H0YB 2VA2A 5I3PA 1OYEA 2KXHA 4P73A 1PJ6A 5ETNA 1UW4A 3EGWB 1JLBB 1KAXA 2DEIA 3P49B 3NCQA 3DYAB 1T8EA 2IAJB 3C94A 3NH1A 4IR9A 2YX4A 5A2QU 1WEXA 4FL9A 4OI6A 2NXCA 3OSPA 2NNWA 3KK7A 1S49A 3RW7A 3BV8A 4BLGA 5DZ6A 3ZSXA 5KFCA 4G9ZA 2XG8A 5MLCQ 1VRTB 2P5VA 5IT0A 2ASPA 2O5DA 1I6JA 1H0HB 4X64F 2W7PA 2D3O1 3QT5A 3HSTB 3O3FA 1JLQA 1ZBIA 4JYAJ 5A0YB 3TEGA 2HSTA 4EEYA 3OYEA 5FDLB 3OR1A 4ECQA 1Y5IB 2FJAB 1TKXA 4EBDA 3MPUB 3IR7B 5BYQA 5FPEA 3QIPA 2JEJA 1GMWA 4JS4A 4YHHJ 3H40A 3IR5B 3I56S 1ZZNA 4L3QA 1S6QB 2QJ3A 1GMUA 2DY4A 2O8FB 4M3RA 1H6KX 5HMYA 3UDCA 3VVUA 4DL6A 1RLCL 3HX9A 2XY7A 1YTAA 3L3UA 1U2RA 4ED7A 3VGKA 2YKQA 3VEZA 1T3VA 2R42A 1HHSA 3MN6A 5DJBA 2GVZA 1HYSB 4ZN1A 5FLXU 3EGVA 4CZGA 4R5PA 4DUYF 5IWAF 2GBZA 3NVMA 2P9PA 2KU7A 3QBCA 1QSLA 1MW7A 3R27A 3BGRB 3GFHA 4NZ6A 1KCFA 5AZIA 3SBGA 4WZMA 3AVBA 3ZZPA 1FE4A 5G0RB 1OKJA 3I0RA 3R5AA 1CXQA 2V7YA 1KQFB 4X4SA 2WVEA 3HD2A 3VEVA 1N5VA 1VHFA 4TU7A 2Y8YA 5E41A 4RX6A 5E3QA 2VQEF 3UD3P 1Z4UA 2DR7A 1HMVA 3P5BP 3AJ2A 4DUZK 3D1HA 4ZP6A 2GWJA 2BDPA 4WP3A 3D28A 3QNOA 3JQKA 5M1FA 1WKKA 4U6PA 1TVRB 3SQ1A 3SAFA 4FF3A 5GIOA 4J9NA 3SQOP 2QKBA 3THPA 2E5JA 3N4QA 4F0KA 4OZ2A 1DRZA 2K1RA 1VMBA 2GO9A 4CK2A 3BSOA 4DR1K 1M5OC 4FF1A 1EHWA 1VQMN 3GDQA 2NXNA 1BD6A 3QNNA 4ED6A 3IFRA 2VIHA 3ZSZA 1Q9YA 4DV6K 3MEDA 9ATCB 4MKYA 2QK9A 4H0XB 2HQIA 1KWMA 2ZWOA 3JQJA 5SWMA 3Q2TC 2GUPA 4O55A 3OL7A 3QAUA 3DI6B 2DCUB 4TLRA 2BQUA 2C28A 5JICA 4OV1A 3D3CJ 3H20A 3UIQA 4OZ0A 2XWXA 3KLFA 3OYBA 1XQSC 4OGEA 3NF7A 4I7FA 2KFZA 1J54A 3L9ZA 4P7TA 3F73A 4NXNJ 5CH7B 5K8PA 3EVOA 1AT1B 1GXLA 4IKAA 5MLCV 2OEKA 1FFSB 1B70B 1JJ2R 3NLCA 1CZAN 5AQMA 4ECUA 1G1XA 4FWRA 4HVJA 4IDKB 3CQ8A 1MU2A 3NCRA 2HWTA 2R7VA 4CJ5A 1FRKA 2ASJA 3CJ7A 1HUXA 2OD6A 3T1YF 4DV1F 4FLUA 1VQNN 1J9AA 2EVZA 2JLGA 5BN8A 3TARA 5D4OA 1T05B 1D09B 1NOYA 3C16B 2VYPA 2VDIA 1OY8A 2BZ2A 2WVFA 2B6AB 4BRHA 3IAS9 2L9WA 4YEAA 1W26A 2HWHA 3Q8RB 2HF4A 2V2VA 2IRXA 2HVIA 3W8GA 5B0BA 3W3DA 2VDHA 1M5SA 5CZ2A 1RDBA 5AFUA 2A41A 3AD9C 1B64A 5K14A 2R9LA 4AT1B 1X9SA 1S97A 4CLWA 2ZFHA 1NPPA 3PFEA 4CTAA 4FWSA 5HOOA 3H2LA 2Y3YA 1UVMA 4OI0A 1NU4A 2D9PA 1IO2A 2O8DB 1TL7B 1CQMA 1FDNA 5BR8F 3LPTA 3UVJA 3G6XA 4V19X 3O3HA 3D6TB 1FDDA 1FEHA 2QMXA 2P51A 4OX9K 3POTA 4LF9F 2QC3A 3AVFA 1IJFB 1X4FA 4CLTA 1KQSM 2XLKA 1IN0A 2VODA 2CGLA 3KJNB 3PSFA 4RG8A 1RE1B 5IQ6A 4FBUA 4DG1B 3RR8A 1WN7A 3SSQA 2DNYA 3MX5A 4GW6A 2P9CA 4KAIA 3FRYA 2EG2A 1RCHA 4BR5A 4QOZB 2IMOA 3VCDA 1ZC6A 1TYQB 1HJOA 4JKGA 3CVKA 1M1KO 3L6QA 4TU9A 4C98A 4MJKA 4WQ4C 1HNXF 3QGIA 2PFDA 3EL2A 2IRUA 4GKJJ 3KWGA 4USUA 2DXFA 1EETB 4PXDA 1TFYA 4O5BA 4ID5A 1QTNB 3AT1B 1R8HA 2O1PA 2DIUA 3MWBA 4CHOA 1X0FA 3SQGB 3T5HA 2WAQD 2X6SA 4LF4J 2KHOA 3H1QA 4FK0A 4LRAA 1L3SA 2YV0X 1QAIA 3NCPA 4MQ3A 3AOCA 5CYMB 5D3GB 1Y11A 1YJRA 3VAKA 3BF1A 2Q43A 3OL8A 3ID6A 2RHQB 3N01A 1A0OB 4J9PA 1Q8BA 5KG4A 2ZHAA 3AVJA 3M6WA 2QKKA 2YWGA 4HCCA 3I5CA 4MKVA 3SFGA 2FY8A 2DHXA 2PZSA 1RT2B 5AXNA 3PCOB 1P6TA 3OYGA 1WD6A 5LJ5Y 5KFZA 4DV5F 3OYLA 3W2WB 3LOUA 3N0VA 3GYNA 3FFIB 4IO8A 3N5FA 3HDSA 3TA2A 2LEPA 4OKKA 5BYRA 1IKXB 3AVKA 5KG7A 1UZDA 1LKZA 3V1OA 4ELTA 3AFGA 1GLJO 4U7BA 2AYMA 4J5OA 3DDIA 2DFHA 4IRKA 2W42A 5KFTA 4BACA 3MGJA 5AJ3K 1BQNB 4JBCA 4QW9A 2A3ZA 3MPVA 1HRHA 2YHAA 3BBCA 3FLCO 4BRGA 2D74B 1OO0B 2UVRA 4UUXA 3WXLA 2CQ0A 1K44A 1H38A 1RHKB 1X4DA 5IFMA 2UXDF 2RE2A 2QWOA 1M1HA 4OLOA 2ZD1A 4IFYA 5B8HA 3ZCMA 4E7IA 4ILJA 1U09A 3P5JA 4KHNA 1SJ4P 1UMJA 2C2ZB 1VQ5S 5KT4A 1HBMB 3G87A 2UUWA 3J80O 1QVGM 2R8IA 4BRIA 1DQ9A 5ETOA 4CQ1A 3Q8VA 3F56A 2B51A 4WFAL 1UAWA 3W62A 5J1EB 4ANDA 4DU3A 4ZVRB 3DDKA 1N36J 3TX0A 2ZBIA 1LAWA 2W4DA 4RUCA 2FC8A 4EHUA 3UB5A 2D3ZA 1RNHA 1RAOA 5J1NA 4G1QB 3L3CA 2E2NA 3FGUA 2E7WA 2MEWA 5GMEA 2D3OR 3CMQA 4CI6A 5IV4A 5C42A 2R8GA 3LF0A 2NCKL 3CD0A 5GAHU 2BEFA 1GOCA 2JHEA 1CZBA 4PHTX 4JI4F 3HFZB 4EK2A 5LMUF 2AEMA 3MPDA 3M5RA 3THWA 4USJC 2B4JA 1SQEA 1UEVA 2CQBA 3AO3A 4E7JA 3VF0B 4I68A 1Z05A 1YBTA 1TKTB 3T41A 1P1TA 1GLEG 3SXLA 4CHZA 2H4YB 2W1BA 5BN9A 4QZVB 5GAHP 2AU0A 3DAWA 3CM5A 3K57A 3O2IA 4JI8F 1UTAA 2E5HA 4M5DB 5L46A 4H0OA 4HCBA 2HNZA 1VDHA 1YDLA 3QETA 3KJFB 4JI0K 3OQ2A 1K1SA 1VC5A 3JS9A 4WFNL 4MIAA 1ITGA 4O3RA 3ZTRA 1H3DA 1S72N 5KTQA 4OJRA 3GJQB 4JN4A 2ASMA 1I39A 1VQSA 3HFKA 4ZDNA 4X4RA 1VQ4S 3ATUA 2Q66A 4A2BA 2KRBA 1OSCA 2VGNA 1SC4B 2R7QA 1IG8A 2P5OA 2P9SB 4IFVB 2EC0A 3M2RB 1VQOS 5C2DA 4DL4A 3VGVA 4K41A 1GNKA 4DX7A 2MSSA 4A8SA 4CBUA 2RMLA 1KS2A 1CSJA 1NUEA 4WYWA 4OI1A 3MN7A 3E3XA 4DFJA 3OTOF 1M1KT 4FLZA 2FZCB 4FWLA 3CCES 3NGDA 2LQ5A 4DV0F 2D69A 1U4BA 2LU1A 4DU1A 5SZTA 3KMQA 4RNOA 4QWEA 2J0QD 1S1UA 2KW4A 3BR8A 3ZSYA 4B3MK 1FKAF 3OYCA 4MYUA 5BPMA 1N88A 3U1LA 3M2VA 1K6YA 1NGCA 1DURA 2YKPA 3UWTA 5IXUA 2JC0A 3AHPA 4URQU 3HP6A 2W9BB 4F26A 5KRTA 2RQMA 1T9TA 3EWGA 1NKBA 3U9ZA 3KHRA 3OTBA 4WK3A 2UUBF 4Q8EA 2OPSA 1E6YB 3SAGA 2J0SD 3HVTB 1X5OA 1HWIA 5IT9Y 2QA4G 3IRXA 1YTYA 1TUUA 2F40A 3GPAA 2ZEJA 2ZZMA 5B7WA 2RDJA 3QLHB 4ETXA 2LXUA 2DGSA 1JLCA 4K0KF 1Y9OA 1RDWX 4QWCA 3UI3A 3J81O 1D5AA 1LW0B 3CCWA 1TFWA 1J6ZA 2Z1JA 1U25A 2PFUA 2YNHA 4BY9C 4BR9A 3VQSA 2A10A 3S1TA 1PYTA 5D15A 3NOGA 4WFBQ 4LSNA 2QA1A 1IBCB 3D4JA 5EY4A 4JI5K 3QFPA 2EW9A 4JS5A 4O3OA 5DM7Q 2ACYA 1NMEB 2VF3A 4E19A 1GOAA 3BEGB 3IM9A 2GVDB 1LW2A 4NE9C 3N5BA 3CT9A 4DTOA 3S8SA 3AO2A 3T1HJ 1NOZA 1GMWD 4NLBA 5C25B 3HL8A 3TZXA 4XPEA 1J5OA 1YAGA 2VWJA 2AZ3A 3HSJA 4JKBA 4M63A 3NBPB 1K47A 1N6QB 2Z1GA 1KR4A 1WHVA 1V3RA 1YJWN 1CQNA 4QIGA 5HMZA 4M5MA 3AA8A 3UDLA 1JJHA 1KLMB 1SUQB 2W2NP 4V19S 4ECZA 5KT2A 2DNPA 1M90O 4X4TA 3R2CJ 4LFCF 1FVQA 3G96A 2B4OA 3CM6A 3OT9A 1WSFA 3LWLA 4EZ9A 4K5SA 3LPUA 4CLPA 2FVRA 1SPBP 3UFCX 2NLWA 4NLOA 4LREA 3IG1B 2KZMA 4C48A 1VQ7N 1FJGJ 4J8FA 5EWFA 2GFFA 3CJSA 4DV6J 2DR5A 3VEXA 3C14A 4WCEL 2Q0RA 3ZNJ1 2EKNA 4GVMA 2QSWA 1CLFA 4NLUA 2PD1A 4RZRA 4BE2A 2R2SA 4LF6F 4GY2B 3SUQA 4EGLA 2E1YA 5JLFA 2HYIB 4IBNA 4CIFA 4FOEA 2OJ3A 3DRSB 3UE2A 1VRQC 1XC3A 4P2XA 4CZLA 3FBBA 1MWZA 3L2QA 1KTVA 1ATRA 2I5JB 2OMOA 2VPXB 3N6MA 2AJ2A 2E5LK 1YITS 4ZP8A 4KGMA 5AE1A 3OYIA 2HIQA 4OLAA 2I0XA 2YY3A 2D0AA 1VISA 3VQ8A 2FHOB 3M8QB 4PWUA 1DTTA 3BH7B 3M2UA 3G82A 3W8PA 4WE1A 2P9UB 4ILRA 3OHBA 4Z4GA 4DSLA 2FTRA 2XY6A 2QFIA 3JTNA 4Z94A 2DVIA 4NLXA 3RBXA 3O44A 3CCQN 1RT3B 1VBXA 3T69A 4BREA 4WKYA 5HK4A 5M2UA 3EE9A 1TGOA 3KJVA 1VQ6N 1FESA 3EYZA 1N34K 3I32A 1L3TA 4FZYA 1U7LA 1J5EJ 4LSLB 2OEMA 3K2YA 3FZKA 5LSOA 2UUAK 2AA4A 4CHNA 4C8LA 2KVQE 3GR0A 4USMA 4K8XA 2AEFA 5KOXA 3JSMB 3LZIA 2WVDA 3NS6A 3I5BA 3BYRA 2F8HA 1Q8LA 2I9SA 1RT7A 3U9DA 2OFHX 4ECWA 4OV6A 4ZP9A 3CD5A 3MX2A 3SCXA 1KXPA 4RCHA 4Q44A 5J2PB 1U2CA 2MZSA 1RHJB 4ZVFA 2HG4A 1V5VA 3CSKA 4LBPA 4B08A 5HL7L 3VQBA 2YKNB 3MTKA 3ZNUA 3PYFA 2XYPB 4F4AA 3MF5A 4DV2F 4XDDA 2A1BA 3HZGA 1DFDA 3C66A 4OX8A 2PA3A 2L48A 4WXOA 5LSLA 1NWKA 3LALA 3H98A 3AVCA 5KFHA 1X4AA 3OYNA 4PXEA 3CC4S 3QO9B 4HT7A 4TQRA 2CPYA 4HYKA 1NXIA 4W5NA 4DN9A 1VQMS 1RWOB 3DRRA 2XLJA 1D4XA 2R2RA 1YBAA 1X5PA 3W64A 5GAGP 1UOCA 1YHQN 3RMDA 1RTHB 2HNYB 5AQYA 2PY5A 3TSUA 1SI9A 2A1RA 4QIFA 4CHYA 1BWEA 3VQ4A 5AXKA 1FRXA 3VMFB 3VQEA 2HSEB 1YBUA 1KAZA 4ZITA 4OQJA 1E4GT 2CQ1A 1PYSB 5HP1B 2IHR1 2XI2A 1NGEA 3GV7B 2VFUA 5EX5A 1JLFA 2QGFB 5KI6A 1ZM2A 3C19A 3MECB 4RNFA 4PXCA 2RD5C 3NS5A 3QATA 1R6YA 1WC6A 4RW7B 3J7AN 2ZJRL 4EFHA 1FDBA 3GOIA 3KLEB 2O8EB 4DHYA 3WXIA 2B8PA 2MY8A 3HVRA 4M3ZA 2G2ZA 3GILA 4BC5A 3HHLD 1YKWA 2D0OA 3OUYB 3L7UA 4JI2K 1DTQA 1G15A 1YVFA 1GLFO 1TMJA 2CGKA 1YZ7A 2MQOA 4DV4K 3OPKA 4DN0A 3MOZA 1VSKA 2YHXA 1LWXA 2HFSA 3J7A1 2N82B 1EARA 2W40A 4K50A 4N8NA 2X1FA 2UZAA 4X65F 2G8VA 1BGXT 2VQFJ 1MNEA 3PV8A 1HBUB 3C7NB 3TAPA 3NGTA 1BIUA 4ZPAA 2R7RA 3NL0A 1DQ8A 3US5A 3FJ2A 1WC3A 4JI3K 4FS1A 4XK8C 3M6GA 4ZK7M 4KH0B 1IKWB 1HI1A 2MMYA 2UU9J 3K8VA 2F4VK 2M8HA 4KH1B 1K8KB 3AH6A 3ELHA 1WNSA 4U8VA 2FJWA 4BBYA 4CJLA 1CULB 2CQ2A 4ILLA 3VGSA 3H45C 2HBRB 1LFPA 2GIFA 3Q22A 5EU7A 2P9KB 3VQTA 4LH5A 3Q8PB 4OKJA 2HHWA 1TUYA 2BANA 4PUOA 4BRKA 4R8UB 1FCAA 1JL2A 3FE1A 2QG9B 4NYNA 1RT4B 4I9QA 5I42B 3GFYA 3OS1A 4PWDB 1FWLA 3MCPA 4JV5F 1X1PA 2VICA 2V94A 1UWBB 2P9NB 1ASVA 2RF2A 3P83D 3OR2A 2A42A 3W5YA 2AGOA 3VZHA 3MN9A 3CJ0A 4NMLA 1HNZJ 1CXUA 3H2UB 1XR6A 4Z7CA 1RT5B 4GVBA 1C0GA 3CNQP 1XMQF 1N32K 2Q2RA 2HK2A 3HM8A 2O01C 3H3NO 2VA3A 3T6JA 1XJWB 2E9TA 3VQAA 2ZITA 1GXTA 4CM2A 5J1PA 1HR0F 3IBFB 4Y1CA 1RWWB 2ZH6A 2ZH7A 1SIZA 4LQ3A 5HAOA 1REGX 3GV8B 4DR5K 4GV3A 4CJUA 3F41A 1IBMJ 3MMBA 4OHYA 5HBMB 4LF2A 3TZYA 4ES3A 5DETA 2DNNA 5KFMA 1IJJA 4IG0A 1Q86O 4ELVA 1I1GA 2GV1A 3MXJA 5J2MB 4O8UA 4FF4A 4JK7A 4GKKK 4JRPA 4ECXA 2NPIA 4IKFA 3FSIA 1LK7A 1T9XA 3ZT2A 2W2QP 2P9IB 3PW4A 3CJ3A 5F0UA 1KHWA 1JCGA 2DGOA 1U45A 1QUPA 3A5MC 5DM6L 3AGRA 1VI7A 3E01A 3NS7B 2PAVA 4K8RA 3HOSA 1Q82O 5DDRC 4B9QA 4FJ7A 5J2NB 4UOCA 5D4PA 4CJTA 5KT5A 2X1GA 5IM0A 2KI2A 1B3TA 2K3IA 5I4MA 1NK5A 1JLGA 4ES2A 1DARA 2NQPA 2MQQA 3BUZB 1NJIO 3U8XA 4QWDA 4Y2IA 2PC6A 1Q79A 2BE9B 1C1CA 3K0JA 4QYRA 3IKMA 2CJ9A 4CIOA 4DQRA 5KT6A 2G8WA 1FXXA 2V69A 3CEDA 5DK5A 2X78A 4WFZA 2CKWA 3ILJA 3VGLA 1X9JA 1S79A 2W6LA 3JYTA 1WBDA 3CCSN 1XR7A 2XSJB 2HVHA 3IS9B 3SJHA 1XMOK 4LF5J 1ZXOA 1QAXA 1C1AA 3GSIA 4J9SA 1X7VA 4B3SK 1RT1B 3BKFA 3V5RA 5TKWA 2P6SA 5D0RA 3CMES 3ET6B 3FZBA 3UKRB 2MQNA 1QQCA 5DMRA 3WHIA 3J8AA 4DEZA 1ESVA 2MQMA 4DR2J 2BM1A 1PC5A 2ZKTA 1NK7A 4OPAA 1HNWK 1VIXA 5KFDA 2VCPA 3ICLA 3D0PA 4JYAF 1XHZA 3KLHB 3KK3A 3DHXA 4C0BA 4H0TB 2JSXA 3IA0A 1FT8A 2BGGA 3IC1A 3BKUA 3C8YA 3BQ1A 4ZKAA 3KK2B 2ROEA 1JB0C 1D9DA 5D8HB 4NLRA 4K4TA 4F3QA 1MLAA 3CCRN 2RDIA 3A13A 3SBTA 4L8RB 1U6ZA 1F3VA 4ZPTR 4DR7K 3UKUB 4YR2A 3O80A 1C0UA 1RUSA 5DQIA 4LQ9A 2J4RA 4DSIA 3K58A 1WAJA 5KG1A 2JC1A 3Q86A 1ATSA 4AHRA 3ISZA 1DJ0A 2A40A 3C6UB 3H59A 2AIRB 4UZBA 4NLTA 5BXIA 2FJBB 4QBUA 4KGZB 1FE0A 4ZMMA 2HGNA 1NHKL 3TVKA 4RWXA 1JXVA 3U3YA 4PG5A 1RAFB 2RKIA 4U9RA 3LP1B 5IT9O 3CC7N 4DTJA 1AB8A 5LMNK 1FKPA 1QUVA 1M0SA 2FBVA 1SL1A 3MR5A 2QMWA 4ZLNA 2EHGA 2DNRA 1YJ9S 3JAMO 5BPLA 2XO7A 3ADAC 2H1YA 4USIA 2V4JB 4BC4A 2GZOA 2UUCJ 3K9JA 3O5TB 4DQQA 1S0OA 2DHGA 2QMUB 4KIAA 2X3DA 3LP3A 2FLNA 5JLHA 2IRYA 1EKRA 4IOXA 1E6VA 1HBOB 2HBQB 1RBOB 4O3SA 4A8XA 3OLBA 4CEOA 5H9FK 3MXMA 2CADA 3HP9A 4Y28C 4TY8B 3A8IA 2AJ1A 3LH2S 4OL8A 4L76A 2VJVA 4M94A 2JVOA 2ASLA 4U7UK 1NKCA 1LWCA 2GQCA 1NZ8A 2KDOA 3P96A 1BQMB 1DBDA 2ATQA 1VLYA 1GT8A 2WSFC 4ICLB 1LWEA 4NXNF 2XC9A 4Q43A 2Z2ZA 4DU4A 2KTQA 5A2QO 5GADI 2C2DA 2ZHOA 4HI1A 4GVEA 2HKEA 4WXWA 3DU6A 2QWNA 1EWRA 2JDJA 1VSHA 2DTUA 4L74A 3R2DJ 3BM7A 2A3JA 1VK8A 2W9AA 4KGXB 4USKA 5GAEI 3ZSRA 1SV5A 3PIPQ 4ILMA 2GMJA 3UN3A 4FYYB 1VQLS 3DOLB 2LKZA 3VTIA 4X66J 2V8PA 3U3GA 3R3TA 1BXNA 3FFKB 4O0JA 2RT3A 1FEEA 2LYVA 1NGDA 2B9YA 1B92A 4MIBA 3G8SA 3J7YI 2JX2A 3PLAA 4F4WA 3N6NA 4RUHA 4RWWA 3ITHB 2NSBA 3T6BA 2NREA 1TV6A 4Q8FA 4M3WA 2DNZA 4K2JA 5FLXO 3Q8UA 3TW0A 1YWXA 1IBLJ 1LQ9A 2B9EA 4BQLA 2OELA 4DLEA 5JMVA 3S6EA 4CD3A 2VOOA 4KI6A 5FROA 4DUTA 1S6PA 2HGMA 4N77A 1FK9A 2WBNA 2J9DE 1S5ZA 4PPDA 1WC4A 4F0HA 1F0XA 3W9HA 2DR8A 4IO9L 4IG3B 2WHOA 3MZIA 1AZSB 4JHDA 4O23A 2R7OA 3ZFVA 5AQZA 1MA9B 3R8EA 3S3OA 2XS2A 2HHVA 1HQUB 3Q0AA 3GP9A 3QEVA 4KHPJ 2DISA 2DPNA 3OTCA 4OPJA 1PAEX 2ZH2A 2ZGZA 1RCXB 5GINA 3GJSB 4WIIA 1YIJS 2LQBA 2YNGB 3LZJA 3ZEUA 2RQ4A 2XSFA 1XI1A 4P2SA 3G4SS 3SYZA 4CO4A 4JI5F 2E1RA 3HMJG 5GVQA 2L9DA 4C8YA 2FYXA 1UVIA 1WOOA 3CDAA 4S0MA 4YDUC 3DKDA 3Q83A 3ENQA 4TYAA 1SJFA 3R97A 1JK9B 4CO1A 4B3RJ 3T3FA 2XB2D 3D7EO 3MM7A 3EO3A 1VC0A 4A47A 3CJ4A 1Q95G 4LFBF 4ISFA 2CPEA 1X4HA 4ZCMA 5JMNA 2ZH3A 5AQQA 4NYPA 4DV4J 2C3YA 2FHJA 3N4PA 4CZCA 1VQPS 3H42A 2C2KB 3CD6N 2RRAA 3VF4A 4FS2A 4UQTA 1N5SA 4ECSA 4M5KA 3RJMB 1VQ6S 2VQEK 3RRHA 3QINA 2AF6A 4CM0A 3WQUA 2AHOB 2GIQA 3WBZA 3Q24A 1MWMA 1JLQB 1HHTP 1RDRA 3OR1B 4KT0C 1TKXB 2XO6A 4F2SA 2HBJA 3PJWA 1JKHA 1TELA 3I96A 2JEIA 4KRFA 1WKLA 1ZAVA 3MM5A 3R1HA 4AHSA 1U49A 1YSJA 3CC2N 1AUSL 3EZOA 3ULDA 2G9OA 1LXNA 2BMBA 1ZM4A 3H2VE 3DRPA 3TAMA 3TQEA 4NX9A 5HROA 2ALYB 1IBKJ 1S1TB 2BKOA 4IO9Q 2KFNA 2P9PB 5SUHA 4RW4A 5E7OB 5HMXA 2P9LB 5AZIB 4NEYA 3LGMA 3CF5L 2E7XA 2X51A 4DMZA 2UXBJ 3VHQA 3VV2B 2RQCA 3D2EA 3DGPA 1T03A 3ZSWA 3OY9A 4JI7J 1YI2N 1TR0A 1NLVA 1N33J 3EY1A 1P90A 2DHSA 2ILZA 1UEKA 3OS0A 3FBFA 1EP4B 3L2VA 1HMVB 4CLLA 2O8BA 5CYJA 3DNCA 3UN5A 4GMKA 2EFGA 3P4IA 3T5LA 3JSYA 3RYLA 2VB6A 4Q7AA 5C2GA 2MHNA 1FWKA 4YOYA 3MM9A 3GJRB 1S7IA 1CJVA 4PY5A 4QOTA 5HI7A 1JNZB 4O4GB 1FO1A 4CT9A 1QS4A 4LH4A 3CJ1A 1N36F 2EFNA 1OIAA 3T1YK 2NS1B 4DV1K 1T0TV 1JLEB 2MLXA 3UO0A 1S9EA 3Q7CA 4OHWA 4DCHA 2K1RB 4BVOA 1N34F 2VZ9A 3M1VA 1Y64A 3ZSVA 1XR5A 3GCWP 2WOMA 1FJCA 3U4LA 4DR5J 3MAHA 4WFYA 4A5BA 3DC2A 1SZ2A 3LM2A 5EX0A 2UP1A 4DU7A 4QCLA 1VSDA 2NZ4A 3UE5A 2YWWA 3QQCD 3NAIA 1K73T 1UVNA 3L3VA 2IBKA 4NXMJ 4DWIA 2CJAA 1HNIA 1B0TA 2XHWA 4DZDA 4LUBA 4L73A 2VFSA 1UA1A 4PEOA 4BWMA 2J7WA 3LTOA 3EKSA 4GV6A 3Q7BA 2OKQA 4JKDA 3CCLN 2XMJA 3D6MB 2RHKA 4KO0B 4CGJA 4J2DA 1I94K 1FXLA 3BO4A 2XNRA 1O1WA 2DNMA 5LJ3Y 4M7YA 3GBTA 1VQKN 4U7CA 3LWMA 4ZVGA 2QLFB 4RJVA 2DD8S 4EP4A 1VQ8N 1VRTA 3AAPA 2DNOA 4Z2XA 3GG0A 4KB1A 4CZIA 3O1WA 4LF8K 5I9EB 4FJ5A 5BR8K 2MJUA 2RH3A 1S9GB 1KFDA 4AFFA 5FDLA 2QW9A 1MU2B 3IWLA 1XHXA 4LF9K 5KT7A 2OLWA 3TOQA 4WP9A 2V34A 2XYHB 2CPZA 2DHAA 1KEKA 2UXCJ 1TUWA 3UD5A 1BDGA 1S6QA 2VG5B 4YB6A 2O8FA 4KTQA 2LECA 3CJBA 5C24B 3ENHA 3I33A 3AD7C 2AJ0A 4B9VA 4R79A 4HHJA 1RU2A 1D9AA 2RS8A 4RBVA 3H1VX 4LVNP 5EUHA 4C11B 4M3XA 3RTVA 2WVBA 2AYEA 3QFHA 1O5JA 1R0AA 2N7CA 3NNHA 3AA2A 2RVJA 4KR0B 4JNEA 4G3IA 2FSJA 2JFKA 4N5SA 3HT3A 3WQPA 2LDIA 2FLPA 3BGRA 4QU6A 3KLIB 2R8JA 3V81B 1NZAA 4RBTA 5D6GA 1OSDA 5JJBA 1NU0A 2CNLB 5G0RA 3AA9A 4B3SJ 1Z2LA 2ZNYA 3I82A 3OL6A 2XY5A 1RA7A 2RJZA 4OZNA 2BE7D 4AF1A 1N56A 4CJ7A 3KK1A 1T02A 2EC2A 3KHLA 1KRPA 3CWJA 3UVJB 2IIRA 1RTIB 3QZ7A 2CPXA 3OVSA 3DXKA 3POTB 2DGQA 2DFFA 3NNAA 4LSZB 4USVA 5KOWA 1KAYA 2RNEA 1TVRA 1H7XA 4B9MA 5M1QA 4DSEA 1LEOA 3TI0A 2MXYA 3I0SA 2WB1D 2R7WA 2FUG9 3AXKA 1B4SA 4RW6B 1N0VC 2B8QA 2EBEA 4C8ZA 2XCPA 3K0SA 4DV5K 3NGSA 2OCEA 1IM6A 3QFUA 4KBIA 3FEYB 1RKJA 1IQTA 1SH0A 2Z8QA 4U67L 4JKGB 1ZBTA 5F0XA 1QVFM 3KFWX 2VHGA 2PIIA 4I9LA 3LGNA 4F4ZA 2XMKA 1K1QA 1HBNB 1R89A 4FNIA 1VK0A 2HNDB 3CFPA 3A5NC 4ZVEA 4IXCA 1REVB 3IRWP 2F5GA 2F9DA 1YZ6A 4DV3J 4C8NA 2FVPA 3AAQA 2EX3A 3MAAA 1X5TA 1VCTA 3HHLB 3QZ8A 2HHHJ 4ILGB 1AW0A 2FBTA 4CGFA 3CXCM 1BQXA 1MN7A 2AEJA 2XEXA 3HFVA 3VAGA 2Y1IA 2DKOB 4B3TJ 4EUVA 3BZQA 1W7AA 4KHWA 3G6YA 4RNNA 4YORA 3X1LB 3I6PA 2B7CB 3CFRA 3NNCA 4IDKA 3IP0A 4J7CA 2F9TA 4CFCA 2VG6B 5L1JA 3F0NA 2W7OA 3HT0A 4WIQA 2VV5A 5KFPA 1WSIA 3NGIA 4FWQA 3M9NB 4JI6J 2HVDA 4CZJA 3CJ5A 1JCFA 2JRSA 1SS6A 2KLAA 3TWHA 3UDVA 4UZCA 2IC3A 2GHVC 3EGNA 5HO4A 1T05A 2LA6A 2ILYA 3NG8A 4ED8A 1RYRA 3UCZP 5EGYA 1WSGA 3EE3A 5JXSA 2CJQA 1FJGF 5JVHL 3HVWA 1KVBA 4DSJA 2ACMA 4FYXB 2Y8WA 2OANA 2QL9B 2ZVSA 2GTDA 1PC4A 4YOEA 5AQXA 2D5RA 3M30B 1U1PA 1XUPO 2GQQA 3MI7X 1S3XA 3PEJA 1KNZA 1CJKB 3KTQA 3MHYA 2M4MA 3CIMA 5LL6d 3QWPA 4J91A 2V4QA 5H9EK 5LMUK 2VC0A 2DY1A 5IC4B 1QAJA 3DM2A 1V4SA 3GLJA 2WFBA 3H0PA 3EKUA 4CLKA 2O8DA 1TL7A 1U04A 3AA3A 4L72B 2CUYA 4IH5A 4NCBA 1OPIA 4L6V3 5L1IA 3RBZA 4M63C 2ZD1B 1U48A 3OBWA 4U67Q 2R7UA 8ATCB 2UYTA 4NCAA 4P9SA 3GE9A 4YY3J 4FVCA 1FD2A 4ZLLA 2Q6CA 4DG1A 4BRFA 2ADBA 3K5OA 2HAFA 4FWOA 4KV8B 1YRTA 5HJYA 2E44A 3RRKA 4MH8A 3KKRA 4ZJOA 2RUSA 1RWMB 4RKUC 1JLAA 1Q7YO 1TYQA 1KQGB 2Z57B 4LR8A 1JIHA 3IMXA 2JFDA 1U2VB 4ER8A 2E2OA 3EJMA 2B7BB 1G7CB 3OHAA 5L39A 3MEKA 1J5EF 1R6VA 4GC7A 4OI4A 3DWLA 3OTEA 2YPYA 5C42B 3KHHA 3TTDA 2GJFA 4IYQA 3AVAA 2IVPA 2RILA 2V67A 1EETA 3A4TA 3OTOK 3SQGA 1K8AO 3FVYA 3S3NA 3THWB 3K89A 4FM1A 4UUWA 4AHUA 2L08A 2JWNA 4QJVA 1Y7PA 3G71S 1BLUA 3CO9A 3NVKA 5D3GA 5KRSA 2M3DA 4OYPA 2ZWPA 3OS2A 3ZZZA 4DPYA 2DFEA 3SCJE 4B9LA 4Q2MA 4C97A 5ADXH 4C2MA 5KGXA 1ZPWX 4AE5A 1F2GA 2YWKA 2YVSA 2EK1A 4GRSA 2HNZB 2UUBK 3BZKA 4X64J 3RMBA 1QSYA 3D0IE 3O4QA 1R43A 3L4IA 2GGPB 1JQGA 1P8GA 4EIAA 1ZM9A 1TL1B 5BYSA 3J80Y 3BREA 5EWGA 3W2WA 2GV9A 3EVWA 1GX6A 4KTZA 3DLJA 2PA8D 3OYJA 4R0JA 2P6TA 4P2FA 3KWIA 3OJSA 4CF9A 4CD1A 3UR0A 3G8QA 1QSSA 3EZWA 2RRNA 1HNWF 4JD2A 5BR9A 4K0KK 3V1QA 4C8KA 4CH0S 2DIVA 3M8RA 3TNVA 2IYGA 2C2EA 1V3ZA 3MM8A 4F0MA 2MKIA 5HN0A 3CI5A 5GAEU 4OYZA 5AQGA 1ZBLA 2NRZA 5GAHI 4DUYJ 5IWAJ 2QZ8A 3RWUA 1BQNA 1PG5B 5ETRA 2ETJA 3R7BB 3BQ2A 4X62K 5AE3A 3V6DB 1S1UB 2EBGA 2HS3A 4IH6A 3Q8QB 1T9UA 2A2DA 1TQLA 2OMLA 2WCXA 3ZT3A 4DR6J 2AD9A 2HPUA 2CJBA 2E20A 2IS3A 2NXUA 1DY3A 2GAGC 1S0MA 2AJ4A 4DQPA 2VQEJ 2WVCA 4E7HA 4KFBB 2F4FA 4A46A 3CPEA 4ZLJA 4W5OA 2G1DA 2K2PA 4FJGA 3I31A 1DEJA 3GE1A 1FNXH 4X4PA 3VQ6A 4K25A 5J1EA 2MLYA 4F3TA 4O5FA 3D5MA 3V6KA 2RSQA 3IMQJ 1NJYA 3ZT4A 4Z0UA 2FHMA 1JLCB 1D9FA 3CCMN 1S12A 2JWLA 4LD0A 2FHJD 5LMNF 3A5OC 1W2BM 1T7PA 1RBRA 1S1XB 1N4LA 3M1FA 3WEEA 2HLUA 3CPWR 5E5NA 1W25A 2Q36A 4RNHA