1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
4IFVB 4ICLA 1RT2A 2E6LA 4FJLA 4TQSA 3H08A 3M8RA 3TAMB 4BWMA 2DPJA 5DGAA 4Q44A 4ECVA 2G8HA 3KIOA 1TP7A 3T1AA 4ECRA 2X6NA 4FM2A 1QSYA 2BDPA 1J5OA 3IGVA 4FJXA 3GIMA 1NJYA 1WSJA 2IMWP 4WZQA 2XO7A 4O0JA 3LPUA 4CHPA 4OLBA 2O5DA 1XI1A 4ZP6A 3OHAA 2R2SA 2W8LA 3SZ2A 4M3UA 4PY5A 1S97A 4HUFA 4J2DA 4MK7A 1N4LA 3QEWA 4KV8A 3KK2A 2IM0A 5EWEA 4N56A 4DMNA 3ZT1A 4KHWA 1IKVB 5F8MA 4BWJA 3NH1A 2G8VA 3KTQA 1HPZB 2YNFB 3OLAA 4J2BA 3VQ4A 4FJIA 3EZUA 5C5JA 1VRTA 4QPXA 4DU1A 3V6DA 1KLNA 1XC9A 3DRSB 1UOCA 4F2SA 3NKYA 4J9OA 1DTTA 3C94A 3CQ8A 3KNAA 4E7HA 1YT3A 4CF8A 4CJFA 3LZIA 1SKRA 4GC7A 4K8XA 4IR1A 4U7CA 4F2RA 3V9WA 1VRTB 1D5AA 1WLJA 3OVNA 4NLQA 2HNYA 4KB0A 1N48A 1VSEA 3L2RA 5KFZA 1KFDA 3QO9B 2E9TA 5KFFA 1RBRA 4IKFA 2F8TA 4EZ9A 2W9BA 4DTXA 3HJFA 1U4BA 4KHMA 4YR0A 4DSKA 2W8KA 1RAJA 5HRRA 3THVA 3NF8A 2AQ4A 5DG9A 1ZBLA 2DPIA 4B3OB 3AVBA 3S9HA 4BDZA 3IG1B 4KFBA 4NLXA 1S1XB 3C6TA 4AHTA 2GIRA 2Z1GA 4ZVEA 1KFSA 4F50A 1JLBA 4NCGB 1J9AA 2ILYA 2Z1JA 2A1RA 1RDDA 3CYMA 3LANA 3ZSRA 4E89A 1U45A 4E7JA 3RMAA 2DFHA 4PQUB 3L3UA 4E7KA 3EZ5A 2YNHA 1EX4A 2AX1A 3IAYA 5KI6A 3OYCA 3U6FA 5KFVA 1LWFA 4IH7A 3HP9A 3GV8B 4ZP9A 1VSIA 1RTIA 1IG9A 3VN5A 1VSJA 5CYMB 4CJTA 4DU4A 4WE1A 3CM5A 1T7PA 4MK9A 2YNHB 2FJXA 4TN2A 5T14A 2JEJA 3AVAA 3KLFA 4AHCA 2C22A 3MEGB 4RNOA 4Z4CA 4EBEA 3MR6A 1RTJA 3AVMA 2WONB 1SV5A 2BANB 1HMVB 4MFBB 4I2QA 3HP6A 4KI6A 1FKPA 3ITHA 5KFDA 4DG1B 3RR7A 4CJSA 4M41A 3CJ0A 3ZSVA 3WNFA 3N6LA 2HVIA 1ZBFA 1W9HA 4ZVHA 3K2PA 2FJWA 3MAQA 4IR9A 2E4LA 1HNVA 2QK9A 4B9NA 4HVJA 2JGUA 1BL3A 4HTUA 4NLTA 2BANA 4QWCA 2PZSA 3DOKB 1UA0A 3KLHB 1EP4A 4FZZA 4DL5A 2KFZA 4J9LA 2ITGA 3PO4A 2RDJA 4J9MA 3VQ7A 4CEAA 1ASUA 1JLEB 1KLMA 3OL8A 3TAPA 1NOZA 2W7PA 4QWAA 3HPOA 2ASDA 2AU0A 3OS1A 5KT4A 1QAIA 1JL2A 4RW8A 4KO0A 1L5UA 4KBIA 1B9FA 4DTRA 1LWCA 3BSCA 2D0AA 4E1NA 4FJNA 4CFBA 1L3UA 3TARA 4CGHA 4K8ZA 3PV8A 5C24B 2D5RA 5JXSA 5SWMA 2B4JA 3A2FA 1JXLA 1KCFA 4K4XA 2XC9A 1UWBA 1FXXA 4KHSA 3AO4A 1SH3A 4RNFA 1VK0A 2VG7B 4K4SA 3CVKA 5KG0A 4EP5A 4CEQA 4CK3A 3M8QA 3H5SA 4H4OA 3OYAA 2IA6A 3BR9A 4RW4B 3D0PA 4WYLA 1S1TA 3T19A 4I7FA 4RNMA 2KFNA 1BIZA 3C6UA 2XY5A 3OLBA 2DY4A 2VWJA 1W0HA 4OVLA 3E01A 4EO6A 3V9ZA 4IRDA 4O55A 4DLGA 5F8JA 2FJVA 1S1VA 4KB1A 5KG3A 5I3UA 1WNEA 3AV9A 1QAJA 4Q8EA 3P83D 2HHSA 3CDEA 3KK1A 3TWHA 3RMCA 4KTQA 4DTPA 4DL4A 5KT7A 5HBMB 4NLUA 4YMEA 3DLKA 1ZBUA 3V4IA 4ZPDA 1BCOA 3AVJA 3SV3A 3WNGA 3DLGA 3ZT0A 1YTUA 4C8MA 3H2LA 2OPRA 5T7BA 1EETB 4KTWA 5J2PA 4R0EA 3Q8SB 2VA2A 1L3SA 1W25A 3TAFA 2X6SA 2HHXA 4NCAA 4IG0A 3H98A 5KG5A 2R8GA 1BISA 2HMIA 3M9MB 3RBDA 3V6KA 3V4IB 2GV9A 3K59A 3PX0A 1HYSA 2UVVA 4XO0A 2HHWA 4DTNA 2ETJA 4J9KA 5J2PB 2XCPA 4IOBA 3JYTB 4K4TA 3EPIA 1BHLA 4DTOA 4MH8A 2W9AA 1HRHA 4DFJA 4J2AA 3DYAA 3H5UA 4K4UA 1JLFA 5KFUA 3RWUA 4ED2A 1TQLA 4ECTA 4B8AB 3MECB 3AA5X 5J2NB 4LH4A 2XI2A 4FJ9A 2DFEA 1CSJA 4O3PA 3MEEA 4KKOB 1S48A 1QUVA 5KT3A 1C0UA 2IC3B 4M3XA 3OL6A 5CZ2A 2JC0A 3QINA 4B8CA 3PY8A 4ZTFA 3BDPA 4E1MA 1S6QB 1RTDA 4DQSA 2IJFA 3VQAA 1BQNA 4ZPBA 1NKBA 3VQPA 1JKHA 1J54A 3L2QA 4KO0B 3SQ4A 1T3NA 1RT1B 2C28A 4FJ7A 3UDLA 5C24A 2IM3A 3KLGB 1TL1A 4HUGA 3LAMA 4CECA 4CIEA 3OY9A 5DQGA 4FLXA 5HROA 1I39A 4I2PA 2XY6A 2OA8A 1JLCB 2HNDB 4L8RB 3QESA 4DF4A 2R8JA 1LWFB 3BSAA 4PA1A 2LSNA 2G8FA 3AO3A 4I7FB 3ZT2A 4HCBA 4LSNA 4HYKA 3CJ2A 2KZZA 4J9NA 4J9RA 1K1QA 1NK5A 4F3TA 3C6UB 4R5PB 2FVCA 3PJXA 3LPTA 2OPQB 3MXJA 2HHTA 2X78A 3P1GA 3RTVA 3DMJA 3V6HA 1IH7A 1RTHB 2BE2A 2ZE2B 4GMJB 2R7YA 4ID5B 3LP0A 4CK1A 5F8IA 3V81A 4FM1A 1TKZA 1C2PA 3GIIA 2I1RA 1VSDA 1OS5A 2YKNB 1KSPA 1FK9B 4F4XA 4IQXA 3V9SA 5I42A 3PZPA 2J6UA 3KD1E 4CIGA 1IKYA 2YV0X 1TK0A 5KFYA 2RF2B 5HRSA 4O4GB 1EETA 2IM2A 3V81B 3PR5B 3AVHA 2E6MA 1S1UB 3FQKA 4PWDA 4KB7A 1D8YA 4M45A 1QSSA 3RR8A 5L1JA 2QKBA 4FLTA 4H4MA 1RA6A 1S9GB 5F8HA 4DF8A 4LD0A 1XR6A 4WFYA 2V9WA 5I42B 3WNHA 3U3GA 4IBNA 2V0NA 1U09A 3OYJA 4M94A 1VSMA 3L2VA 1VSHA 2YHBA 3UQSA 3ISND 4IH5A 1S1UA 3NFAA 3QERA 4NRUA 1UA1A 2ILZA 4WFXA 2C2EA 4NLPA 3CDWA 3M8QB 5CYQA 4Z4GA 3CJ5A 2FBTA 1LW0B 1JLFB 3LZJA 2FC0A 4YP3A 5J2NA 4K4YA 2QV6A 4BACA 5KFSA 3OSNA 4EYIB 1XR5A 1C1CA 3ZSWA 2C2DA 3AVLA 3VQ5A 3EYZA 3DRRA 3H59A 2HW3A 4DL7A 1NK6A 4ZHRB 3VQSA 1JLBB 4W5TA 4BDYA 4Q45A 5CYQB 3OYKA 2BQ3A 3Q8PB 3KHLA 3NGZA 1Q9YA 3QYYA 1RTDB 1KRPA 3MFIA 4RUCA 4WZMA 1L3VA 1N5YB 3V9UA 3NHGA 2P1JA 1JKHB 1CZ9A 1RT6B 5KFIA 5KFRA 4RW6B 4IRKA 3L3VA 1WN7A 4FVMA 4ECWA 4Q43A 1RT1A 5DG7A 4BDPA 1I3AA 4YFUA 3WNEA 3DDKA 4I2PB 4B9MA 1ITGA 4CJRA 4CE9A 4FLYA 4IG0B 4Q5VA 4ED8A 3NDKA 1RTJB 1LWEB 3PW5A 4TQRA 5K14A 3O3GA 2BQUA 1ZETA 5DQIA 4JLHA 4C8OA 1HYZA 4JUZA 3HL8A 1DTQA 1FKPB 4DG1A 3KLIB 3AA2A 4O3NA 3G6XA 4W5NA 2KQ2A 2DFFA 2BGGA 2DTUA 4CF1A 2GUIA 3HK2A 3KK1B 1RBTA 2P5GA 4NLGA 4CJPA 3FQLA 3H40A 3HKWA 3H5YA 4IFYA 4EZ6A 5DGBA 4CGJA 2JLEA 2BRKA 2BE2B 3SJJA 4CF2A 5KG1A 5D3GB 1A5WA 4LQ3A 2W9CB 2R8IA 4O44B 2HWIA 3OYHA 4MKAA 3OYDA 4CHOA 1ZBHA 3T3FA 4CJ3A 2Q3SA 4ICLB 1JLEA 3NF9A 2RDIA 2VWKA 2XRIA 3M9NB 4QOZB 4FS2A 4K4ZA 3DLRA 4DSIA 5C25B 1S9FA 2JC1A 1BI4A 1C0TB 1RBSA 1HYVA 4KHYA 4Z4IA 3NGIA 5FRNA 4DTSA 2W9CA 1DLOB 3S3NA 4CGDA 1Q9XA 4ELUA 3OYLA 3NL0A 5KG6A 4YR2A 1WSEA 4PWDB 3QNNA 1ZYQA 2B6AB 3M8PA 4DEZA 4WFZA 3VQQA 3NE6A 1TV6B 3B6OA 4KI4A 1MMLA 4CJEA 4Q0BA 4ECXA 4RW4A 2AWZA 2CJQA 3VQCA 4IG3B 2WOMA 4E7IA 2JEGA 2RPIA 4DQPA 3OYEA 3NCIA 1KHWA 5C42B 2UUTA 2EC0A 3H5XA 4WXWA 3KKRA 4LY7A 1HARA 1XHZA 3F73A 2OZMA 3QIPA 2BRLA 3GV5B 5EU7A 2FLLA 1GOCA 4KE5A 3TAGA 4CJUA 5J2QA 1KVBA 3RRGA 3UR0A 1YTAA 2E9RX 2IDOA 2D7SA 2HB5A 3G6YA 2F96A 5CZ1A 3KJVA 1VSFA 5DLFA 5KFPA 3MR2A 3O4NA 2FVQA 1C1CB 4O4RA 1C0MA 4U6PA 1S5JA 3IN5A 3KK3B 3O3FA 4TYAA 1S10A 5EWFA 3NF6A 4DTJA 1QE1B 4M3TA 3PW4A 3RAQA 3CJ3A 3LP1B 1C1BA 4URSA 5KFBA 2ATLA 2HMIB 1N5YA 4FJGA 1S6PA 5JS1A 1TKDA 3C6TB 3KK3A 4QWDA 2ZD1A 3TQ1A 5HRNA 1QE1A 4B08A 3BQ0A 2D0CA 4MQ3A 4LSNB 4B9TA 1TKXA 2GBZA 4C8LA 1G15A 3NH0A 4G1QB 4DQRA 1S9GA 3S3MA 1RYSA 3PW0A 4CJQA 3BSNA 4CERA 4O3RA 2KTQA 3KHHA 5KGXA 1CZBA 1ASVA 4FJKA 1R0AA 4NYZA 5DQHA 3KHRA 4DS4A 3E51A 5HP1A 5CYMA 2YKNA 3DRPA 4WE1B 1FKOA 3D45A 4HKQA 3VQEA 4CFAA 4HUEA 3QEVA 4Y2CA 4JRPA 3RMDA 2AX0A 1BGXT 4I2QB 3F9KA 3O4QA 1BQMB 2WHOA 3PW7A 2NUBA 1X9SA 3SV4A 2ASLA 1B92A 4ZHRA 3AVIA 5HRPA 4CK2A 1RDBA 5KFHA 3U3YA 1C6VA 3DI6A 1TK5A 4Z4HA 1WAFA 1EXQA 2OH2A 1HPZA 3KK2B 4ZMMA 2YNFA 4LSLB 2JEFA 4M42A 4DQQA 3RB4A 3AO1A 3PX6A 2AJQA 4ED0A 3T5HA 5KRTA 4EEYA 4FZYA 3IRXA 3OS2A 2OPPA 1K1SA 1N6QB 4CEDA 4Q0BB 2FVRA 1VSKA 3QGHA 4RW8B 3L8BA 2B5JA 4DFPA 2OYQA 3VQ6A 1TK8A 4JV2A 4IG3A 3KMQA 2IOCA 3D28A 4CEFA 5KFEA 4GVMA 4CJ5A 4CEZA 1GX5A 1LWEA 1JLGA 4ID5A 2VA3A 4RNHA 3QO9A 1T05B 3TVKA 2HNZA 3V6JA 4RW9B 1Y97A 1RBUA 2R2UA 4KREA 2GIQA 3I0RA 4CF9A 3IG1A 2RN2A 2YNIA 3KMSA 4EBCA 3PX4A 1IKWA 1JLQB 3ZSYA 3QEXA 1IKYB 2UVUA 3SCXA 1JLGB 2RKIB 5KRSA 3V1QA 3GYNA 1T05A 4EBDA 1YVUA 4NCGA 5D3GA 1CLQA 4RW9A 4DU3A 3AO2A 1RT7A 2W7OA 3KLEA 4JV1A 4YR3A 1C1BB 1S9EA 4FZXC 3SQ0A 4CJLA 4FJ8A 1IKWB 1F21A 3PR4A 3FRZA 4F3OA 3HVTB 2X74A 1U47A 1NKCA 5J2MB 2ZD1B 1I6JA 5KFNA 3P5JA 3MR5A 4RNNA 1BI4B 3DLGB 5KT6A 5EDWA 1JL1A 3VQDA 1JX4A 4RG8A 4DSJA 4O0IA 4E7LA 4OPJA 1LW2A 2OPRB 3EY1A 5FROA 4Y3CA 4NZ0A 4IDKB 4QWBA 3RAXA 4Y2AA 4NLDA 2UUWA 2G8UA 2PYLA 4AHRA 4G1QA 3MXIA 1TV6A 4HCCA 1SV5B 1MU2A 1J5OB 1TKTA 2WONA 3NGYA 4O44A 2IJNA 3QNOA 4Z4EA 5KG7A 4OLAA 1SL1A 3MTKA 3HVWA 1EKEA 4OKJA 1WNSA 3DRPB 1HJRA 3OSPA 1HNVB 4NYNA 3CO9A 1IKVA 1C0TA 3Q8RB 3OJSA 1ZTTA 3DOKA 2WRMA 5L9XA 4F4KA 3VQBA 1S1WB 1RT6A 4XPCA 4BE0A 4O3SA 5HLFA 3T5JA 4NLRA 3M8PB 4KAIA 2I5JB 2GC8A 3HYFA 1LWCB 3KLVA 1C0UB 2IC3A 1REVA 1SH2A 4ZP8A 4ED6A 4NLSA 3OHBA 1L3TA 5JUMA 2P51A 1D0EA 5FDLB 3I8DA 3IS9B 1CXQA 4GC6A 1NK0A 3UIQA 2FLPA 3V1OA 3IRXB 1CXUA 3L2UA 3DOLB 3ZSQA 3ZT4A 2IAJA 1NJXA 1N6QA 4C8NA 4N5SA 1S6PB 4EP4A 4LH5A 2B5JB 1RBVA 4YNQA 4H8KA 3CIZA 4ECSA 2FVSA 4FLVA 5J2QB 3BQ2A 3KLIA 1GX6A 1A5XA 1SKWA 3NGDA 3K58A 4NCBA 5F8LA 3K5LA 3LP2A 1ZTWA 4DL3A 3BGRB 1S1TB 3DOLA 3KJVB 3VA0A 3I5AA 4FM0A 5KFKA 1LV5A 3QLHA 3QEPA 4CHYA 2XY7A 3AO5A 4FCYA 3SYZA 1QTMA 4AHSA 2YHAA 3HPHA 3OL9A 4DQIA 5I3UB 3AA3A 4AH9A 5L1LA 3QETA 4QWEA 2YNIB 3NAHA 5KT5A 2O4IA 4Y1CA 2XY8A 3T5LA 2AGPA 5C25A 4DLEA 2IS3A 5J1EB 3OL7A 4R5PA 4RW7B 2FLNA 4J9SA 4B9LA 4B9SA 5L1IA 4K50A 1DLOA 1JLAA 3LDSA 3LP0B 5EWGA 3GQCA 4FS1A 2OZSA 3SI8A 1RTIB 3O3HA 5KFOA 2QKKA 1SUQA 4CGIA 4FK4A 3FSIA 1S9EB 3NF7A 2QXFA 3HT3A 4QW9A 2KZMA 4YQWA 3NMAA 3HPGA 4KHQA 2R2RA 3G6VA 2AGQA 3RB6A 4OPKA 1HNIA 1RT4A 3LP3A 5J2MA 4DL2A 2D3UA 3VA3A 3G86A 3I5BA 3MR3A 4O4GA 4CESA 2D0BA 3HVAA 2J6SA 5HP1B 3HO1A 1SUQB 3OYBA 2V4RA 1FKOB 1S0OA 4URGA 3ALYA 4H4MB 3JYTA 4ZPAA 4BE1A 2V4QA 2Z1IA 3PHEA 5F8GA 4I9QA 1WSIA 5F8NA 3QIOA 3QZ7A 3MXMA 2CKWA 4TY8A 4GW6A 3KLHA 1BQMA 4ECZA 3MECA 4O3QA 4B9UA 3ZSOA 1NK4A 4DS5A 4FBUA 4E19A 4KHUA 3RB0A 1LAWA 5DG8A 4FK0A 3MEEB 4KKOA 3G10A 3OYIA 1D1UA 5KFCA 1ZBIA 2FBVA 3TI0A 4FJMA 4CF0A 1NNDA 2IM1A 4NLYA 2F8SA 3MEDA 4ID1A 1S1WA 3NAEA 4ZTJA 3I0RB 1T94A 1X1PA 1U04A 2OPPB 2ATQA 3DRRB 3QGIA 5KT2A 1HQEB 4KHNA 3JSMB 4ED3A 4OL8A 3DLBA 1TAQA 1WAJA 4H4OB 4TXSA 4ZP7A 2ALZA 1REVB 4MIAA 1TL1B 5KFQA 1D9FA 3SQ1A 4B9VA 1B9DA 4DTMA 3MEDB 1RT7B 2D41A 2IAJB 2UVWA 4JRQA 4RUAA 4CHZA 5JS2A 4FJJA 3OJUA 1HQUB 4CFDA 3ZSZA 1RILA 2HNDA 3E01B 1HQEA 2E9ZA 5F9LA 2OPSA 3CM6A 1TVRA 4MK8A 1LAVA 1RDAA 4M3YA 3SFUA 1KHVA 3TANA 4KHRA 3BGRA 5DK5A 1NJZA 3TABA 1LW2B 2ASJA 2AGOA 4FJ5A 3QLHB 5EUHA 1RT5A 2OPQA 4CIFA 3DLKB 3CWJA 1BCMA 3TR8A 4UQGA 4CGFA 3ICLA 4LQ9A 4FXDA 3DMJB 4W5OA 1O1WA 3B6PA 2C2RA 1DTQB 4OGCA 3V9XA 2KW4A 4QAGA 3RB3A 2FBXA 1TKZB 3H4BA 2VG5B 1S0NA 5F9NA 2QE5A 4E3SA 4N76A 4FLZA 1YVFA 1RT2B 4Y1DA 1A5VA 3HVRA 3SQ2A 1NK8A 1RT5B 4URQU 3DI6B 4NLWA 1ASWA 4ZVFA 3SPZA 5J1EA 3SUNA 4QW8A 4TLRA 4CCHA 1RYRA 4M95A 3PVXA 3CJ4A 4O3OA 5SZTA 3DLEB 3BSOA 4QCLA 4RZRA 1WSHA 3L2WA 4ZVGA 4XPEA 2A1SA 4DTUA 4BE2A 3ASMA 3ULDA 4PQUA 3T5KA 3SNNA 2I5JA 3UPFA 2XGQA 2Y1IA 1NKEA 4J2EA 1QSLA 4WYWA 1MU2B 2YKMA 3AVKA 3FDSA 1SH0A 5KFGA 1TKTB 3GIKA 3ZT3A 3IS9A 3QZ8A 4CEEA 4EO8A 3K57A 4IFVA 4NRTA 3CG7A 4J9QA 2ZKUA 5KG2A 1IKXB 1S0MA 1RT3B 5KFMA 1QQCA 4CJKA 3D5MA 2R8HA 5DMRA 4RU9A 2WB4A 3DRSA 3LALA 1KVAA 1LW0A 4CJVA 1DTTB 3NBPA 2BR0A 4O5BA 1UAXA 4M3RA 5KFXA 3BQ1A 4DSFA 4ELTA 1VSLA 4FW1A 2WOMB 4F8RA 1U48A 3DLHA 1S6QA 2F8EX 4Q8FA 3ZCMA 4TY8B 3TAQA 3Q8QB 3K5NA 5C42A 5FRMA 3DM2B 2WTFA 3KHGA 3OS0A 3AVGA 4CJWA 4TYBA 3QIPB 2HAIA 1RNHA 5HLFB 3SUOA 4K4VA 1RT3A 3AVCA 2RKIA 4KSEB 2PY5A 4ECUA 4KV8B 5DLGA 3OYMA 4ED7A 1D9DA 4KPYA 1WSFA 3NH2A 3KLEB 1T03A 3BJYA 1S49A 5HROB 1Z4UA 3AA4A 4XIUA 3MF5A 2IGIA 2G8WA 4B3OA 1JLCA 3HVTA 1RDRA 3CFRA 4AHVA 3V6DB 4PUOA 4K4WA 4RW7A 4J9PA 4FYDA 4RW6A 3FFIA 5E41A 3SPYA 2W42A 5KGWA 4W5QA 4FBTA 2BQRA 3SFGA 4AHUA 1C1AA 1KTQA 1RA7A 4IDKA 2XI3A 3LP1A 1HQUA 1T03B 4Z0UA 4W5RA 3SUQA 4F4YA 2UVRA 3OYFA 1QHTA 3KOAA 2HNYB 1RDCA 5K14B 4DFKA 3AVFA 2VG6A 1NK9A 2G8KA 2VG7A 1RTHA 1TGOA 3HXMA 2ZE2A 4OKEA 5KFAA 1XHXA 4OJRA 4JV0A 4R8UA 3TAEA 4N41A 4JS5A 2OPSB 4N47A 1U49A 1TVRB 3C95A 1KVCA 2Z1HA 2W9BB 3OYGA 3LWMA 4FLUA 2XCAA 4CJ4A 4F4ZA 1JXEA 3PW2A 1J53A 1TKXB 1NK7A 3VQ9A 2IBKA 1FK9A 2P5OA 4NYFA 3BREA 2XWYA 1IO2A 2HHUA 4KFBB 1BIUA 4FW2A 3PO5A 3HSTB 3MEGA 3TAMA 4M3ZA 1TL3A 3V1RA 1S4FA 3GILA 2RF2A 3K5MA 4R8UB 4FLWA 3NAIA 4G3IA 1S1VB 3S3OA 2D3ZA 1SKSA 3N6NA 3IGNA 3ITHB 2YNGB 2JEIA 4NLOA 1NHVA 2J6TA 2VG5A 5KFTA 2EHGA 4FK2A 4CFCA 4TSXA 1Z26A 3QGGA 5HBMA 4DL6A 4EYHB 4IRCA 5FDLA 3VQ8A 4OGEA 4TY9A 3CFPA 1TAUA 1TL3B 3ISNC 1GOBA 3HM9A 2G8IA 1JIHA 4KAZA 4WXOA 1EP4B 4DSLA 4ECYA 4I9LA 2Y1JA 1N56A 3I5CA 4CGGA 4ZPCA 3PJWA 3HHKA 4Y34A 4OKKA 1KLMB 5KFWA 2B6AA 4DFMA 4KRFA 3EPGA 1XR7A 1GOAA 3CFOA 5KFLA 3GIJA 3CDUA 4CHQA 3LP2B 4F4WA 1T8EA 4DWIA 4LSLA 3K5OA 2ZQBA 4IH6A 3GV7B 4E0DA 3QIDA 2WCXA 2XGPA 1IKXA 1NJWA 1IM4A 3PUFA 1UWBB 4FJHA 3OYNA 3QEIA 3M9OB 4CHNA 5KTQA 3NBPB 2FVPA 1WSGA 2R2TA 3DYAB 2O4GA 4DSEA 3G0ZA 3I0SA 4CEBA 4JS4A 1NOYA 5CY4A 1K6YA 1S1XA 3DM2A 1X9MA 1QS4A 2R8KA 1JXBA 1VRUB 2HHQA 3JSMA 2WK4A 3ZSXA 1JLAB 4ED1A 3RBEA 1Q8IA 2HNZB 3SI6A 5L1KA 4ECQA 3I0SB 4KTZA 1XWLA 2B43A 3KKSA 2HWHA 2FBYA 3LWLA 3RMBA 3LAKA 1VRUA 1SL0A 1BQNB 1JLQA 3KD5E 1HNIB 1RT4B 4NLVA 4PUOB 4Z4FA 3SUPA 5KG4A 4HHTA 1SL2A 2PYJA 3FFIB 4C8KA 4M3WA 2YNGA 3DLEA 2HVHA 3AVNA 3KLGA 3M8SA 4IKAA 2XHBA 3KLFB 4ELVA 4CEOA 4IFYB 2EX3A 3RRHA 1Z25A 4AILC 1NHUA 4H54A 3MFHA 1RCHA 5KFJA 2YKMB 2VG6B 1HYSB 4MKBA 4MIBA 3H4DA 2HHVA 1X9WA 1HMVA 4MFBA 4X2BA 3N6MA 1R0AB
chains in the Genus database with same CATH superfamily
5K8MA 4YY3F 1MA9B 4PKIA 4FKYA 1DRZA 2AP1A 2MJUA 4TQSA 3H08A 1BUPA 3BZQA 4Q44A 3R97A 3MWBA 3M3ZA 2BJ7A 2KG0A 1OPZA 4X4UA 4WFAL 4FM2A 3IGVA 3PHTA 3CB4A 5EN1A 4FJXA 1NJYA 4W98A 3HHLB 4WZQA 1HBOA 4LRCA 1K8KA 3OHAA 2R2SA 1X3MA 4PY5A 3W9JA 3VQTA 5CHCB 3IAM9 4L72B 4KV8A 1N36K 4N56A 5ETLA 3E2EA 5F8MA 4OYBA 1IUJA 1HPZB 1GTEA 4YB5A 1OQ3A 2ZM6F 4FJIA 4PYDA 1KVKA 1CG2A 4DU1A 4FWNA 2SXLA 1KC8O 3NKYA 3LL3A 4LR8A 4DB3A 5F0XA 1SKRA 4GC7A 4OIXA 1UEVA 2OTJN 4K8XA 4IR1A 3CCES 4JK7A 3R2CJ 3KYLA 4KPCA 4NLQA 5LL6d 2Q97A 2ZVSA 1WEZA 2EXUA 1VSEA 1SJFA 3QO9B 4AFFA 1UVLA 2E9TA 4GKJF 2AP6A 1N36F 2CQIA 1FRIA 5KFFA 4IKFA 4CQ1A 1WBBA 3KG1A 4RTFD 3THVA 3US5A 2IVNA 5DG9A 1NLKL 3THWA 1S1XB 2DB1A 1RLDA 4AHTA 4CZMA 3G82A 2V8VA 4ZA1A 2A1RA 2J0SD 3CYMA 1P9QC 3LANA 4IJNA 2V2VA 1N36J 1NGGA 3L3UA 4E7KA 3EZ5A 3K9KA 2AX1A 1Q95G 2Q3PA 1FJCA 1LOTB 3H7HB 3ZETB 2N7YA 1WKLA 2CPEA 3CQYA 4IH7A 5D4LA 3WQPA 4F02A 3OTOK 3GV8B 1PJ6A 4ZP9A 4Y2KA 4DR7J 3HD1A 4J9VA 2JWLA 2NZTA 2XO6A 3QAUA 2PO4A 4DU4A 1EWQA 3GSDA 4GKKJ 3LO3A 2JEJA 3KLFA 1R0BG 2WVDA 2C22A 2CJKA 4RNOA 4EBEA 2VB6A 3GZ7A 3LDOA 1SV5A 2BANB 3QB0A 4B1VA 2E1PA 2Z30B 4RWTA 3CC2S 2B4UA 1YJVA 5E0OA 1RCXB 1VJWA 3ITHA 5KFDA 2B4PA 3WBZA 2HOEA 2BJ1A 3CJ0A 1NGCA 1NPPA 1ZBFA 1F5CA 3K2PA 3ZZRA 1VQ7N 1KP6A 5ETNA 2I38A 2Z0GA 4HVJA 2JGUA 1OVYA 3OFFA 5LMNF 3ZEUB 3DOKB 1UA0A 4JK9A 4FZZA 2ITGA 4Y6IA 2N4DA 2ZOFA 4OJ3A 4CEAA 1HBUB 5KT4A 2R7UA 1JL2A 3DGPA 4KO0A 4DUYF 1LWCA 2D0AA 4E1NA 2GVZA 4FJNA 1YITN 1GLBG 5AQFA 4K8ZA 1ATSA 5C24B 2D5RA 5HOOA 4ED4A 1KCFA 2GMJA 1FXXA 4KHSA 1T11A 4CO2A 5LMUF 3CVKA 4P6QA 1HWUA 1RP5A 5IZHA 3H5SA 2CFXA 4HT5A 2IA6A 4JI6K 4Y00A 4PHTX 3FEZA 2NRTA 4WYLA 3LDPA 3RG6A 3WX4A 2UU9F 1A7GE 4QYZJ 4FDFA 1U1KA 1BIZA 4OX8A 3OLBA 2XY5A 2VWJA 4OVLA 1IBMJ 3I4PA 4EO6A 1YF5L 3V9ZA 4IRDA 2ZZNA 5F8JA 3OV7A 1K8AT 4YOWA 3OFHA 3QRQA 2AEJA 2UXCK 1S4EA 3ZX2A 2FJVA 2JSXA 5AQRA 3HOTA 1BXNA 1R3NA 1VYAA 3AXMA 1WNEA 4PL8A 4LF4J 3EJMA 4ZITA 3MX2A 3HSGA 2ZUGA 1Y3KA 3CCSS 4DI6A 2AJFE 3DLKA 1O13A 1ZBUA 1FDDA 2I6WA 5CAAA 2KN4A 1O51A 1VR6A 4A62A 3SV3A 1UPPA 3M7VA 5G0RB 1YZ6A 2HLTA 3CCQS 2OPRA 3C16B 1M1GA 4R0EA 1L3SA 2X6SA 4B3MJ 1BISA 3ETOA 3F2KA 2CUYA 1MROB 1RHKB 3J7Z5 2UVVA 2AF6A 1RAHB 3OVSA 3GP9A 3CJ7A 4CLKA 3UDVA 4M5HA 3FR0A 2QWPA 2XS7A 1VI7A 2XCPA 1SQEA 2V7YA 3MD1A 1N5TA 2DTJA 4DTOA 1HRHA 2QWMA 3H5UA 2RILA 2BM1A 5KFUA 5DDOC 4C9DA 1X5OA 2W2NP 3OR2A 3AGKA 4B8AB 3FZFA 4WFNL 3M30A 2PEHA 4QIFA 4BR2A 2HBMA 1CSJA 3MEEA 1IQTA 1C0UA 2IC3B 4ZPVR 1Y4ZB 3LF0A 4LR7A 2B3TB 1RTDA 1WUUA 3VGMA 3TUZC 1Q7YT 1Q18A 3VQPA 4NXMF 5A0YB 4KO0B 3A8EA 3TSQA 1ZM2A 5C2DA 2GAHC 1MNEA 4TU7A 4ZKAA 3TEHB 2BOAA 2IM3A 1IN0A 1IG8A 1TL1A 5M1KA 3LAMA 4YORA 3ENHA 4B3TF 5IWAJ 1HUXA 2CQDA 4I2PA 1XNRF 9RUBA 4P73A 4KY3A 3P31A 2CADA 2E2OA 3BSAA 4DV7J 2G8FA 3ZT2A 4HCBA 1VQNS 1ZAWA 3CJ2A 1W7WA 2GQCA 1Q8LA 3AD9C 2MKCA 4F3TA 1FRMA 3C6UB 4R5PB 2OPQB 2HHTA 3FZHA 3P1GA 3RTVA 3A5LC 3DMJA 1WC3A 4O5FA 1U1LA 3AB2B 4WQ5C 2WB1D 4AM6A 4AQYJ 1VQON 5AQTA 4GV6A 2HGMA 2WBRA 3EZOA 3CCJN 2WVBA 2XLKA 3C0BA 3KD1E 1IKYA 1SS6A 4HEA9 4JYAJ 2V2KA 1EETA 3V81B 1FFWB 5L38A 1S1UB 1NZ8A 4PWDA 1D8YA 2E5LK 1S9GB 1FRXA 1RU1A 4WFYA 4LC9B 3VEWA 2GEMA 4OHXA 1X4EA 3OYJA 3L2VA 1MLAA 1VSHA 4ISGA 4OPHA 1XMOF 2L08A 2CQPA 4IH5A 4CLTA 3NFAA 2JZ5A 4BRDA 1XEZA 2DR6A 1NGBA 3W2WB 5BN8A 2V67A 3VF4A 2F9TA 4NLPA 3R6LB 1N32F 3M8QB 4IJAA 5CYQA 2VPXB 1RHMB 5C2CA 2FBTA 3M6GA 1LW0B 2GWJA 1JLFB 3TTCA 2FC0A 4F04B 2JFKA 3D0GE 3PM9A 2LP4A 4R0JA 1N5SA 2F4VK 3VEXA 1XR5A 4UT4A 1C1CA 3ZSWA 2CQ1A 2W2MP 3DRRA 2PIIA 3T69A 1HBUA 1OH5A 4DL7A 4ZHRB 3VQSA 3K17A 1JLBB 3PIOQ 4BDYA 1GQEA 3VPZA 5CYQB 4FOEA 2V6AA 3I8BA 2C2KB 3KHLA 1RJJA 3ENAA 4WZMA 5D0HA 3SAGA 4QZVB 1JKHB 3J81Y 1HNZK 2MLXA 2Y0BB 4IRKA 4FVMA 1WN7A 1KVJA 3BP8A 3H25A 1HBNB 1JCFA 3R9PA 3R7SB 1RT1A 5KPTA 2E44A 2AYGA 2POKA 1I3AA 3ZX3A 2VFUA 3DDKA 4B9MA 4HWIA 5IQQA 2BKPA 4CJRA 1S72S 4JI5J 1XQSC 4YDXA 3MUMP 4ED8A 4CDIA 3W61A 1RTJB 2XMMA 1URRA 4ID8A 1GMWD 4IO9Q 5K14A 2G9OA 3CCWA 2A0FB 4O3NA 3G6XA 1Y00A 2DFFA 3MCOA 2BJ3A 2BGGA 2QA2A 4CF1A 2GUIA 2F7TA 4NXNF 1VHXA 3HKWA 4Z7YA 1N33J 4EZ6A 4Y28C 3FKBA 3SJJA 4X66K 4XK8C 2P9UA 3PIOL 5AQLA 1NB7A 4P2FA 5D3GB 1ZC6A 4LQ3A 2V34A 2XMTA 4LF8J 4DV7F 1KQFB 3FK4A 2ZH5A 4OZ2A 1FX4A 3T3FA 2GVDA 2MKHA 1AFIA 4ICLB 3S6EA 3NF9A 2OFHX 1ELOA 4CVNE 3J7YP 1RHJB 2KO1A 1R59O 4A4JA 3LA0A 2PN6A 4Z4IA 3NGIA 4DCOB 3S3NA 1NDPA 4ELUA 4DDFA 4A8OA 2EWHA 3ET6A 3NL0A 3K0SA 2XMUA 3QNNA 1ZYQA 5GAEU 2B6AB 1FRJA 3L95X 3VQQA 3B6OA 4KI4A 1XNRK 4Q0BA 1TTHB 2IYIA 4TLQA 4AF1A 2AHOB 4E7IA 5C42B 1XHZA 3UD4P 4DV6K 3R5AA 3GV5B 4IZ9A 3MCMA 4KE5A 3H3OB 4IOAL 5DO2A 3TW0A 4YHHF 2Q1LA 1RBOB 3MN9A 2D7SA 3C66A 2F96A 3CD5A 4YB6A 3KJVA 1WDDA 4F67A 3Q8VA 4WJBA 3ILLA 3O4NA 2FVQA 3Q0AA 4O4RA 1YTYA 4U6PA 4C0OC 2RRNA 2ZH9A 3HZ6A 3P5TL 3KK3B 4EFHA 1S10A 3EN9A 3UVJA 2G2ZA 3NF6A 4DV7K 5D0EA 3RAQA 4DUYK 4AL5A 4YY3J 4IEEA 2HFNA 3L7UA 4JI4K 1VJQA 3UCZP 2ZBIA 2EVZA 2VFRA 1GTHA 5B08A 1N5YA 4FJGA 1S7IA 3H42A 5JS1A 4LF6K 2P9SA 3C6TB 3OBWA 3KK3A 2IVPA 3D1QA 4QWDA 1HWIA 3D1HA 2UXBF 2K8GA 4BREA 3TQ1A 5HRNA 4BR4A 4LSNB 3EMTA 4A8KA 4JI7J 4C8LA 2BMBA 1G15A 3MK6A 2MKJA 3MMAB 1FJGJ 1M1HA 4CJQA 3E3XA 3B78A 2KTQA 1EZZB 4CI0B 2OEJA 4NI2B 3A8IA 5AQVA 3NVMA 5L8RC 1CULB 4Z7CA 3NGRA 3KHRA 5HP1A 3DRXA 1CC8A 5CYMA 4WE1B 3BZKA 2LA4A 4DCJB 4HUEA 3QEVA 4QIEA 4PEOA 1UW9A 2NXCA 2DGSA 2AX0A 1YRXA 1QHAA 4JHDB 2BUPA 1UPMB 5B0EA 3G87A 4FYYB 2WHOA 3GR0A 4B3TK 1YITS 5E3AA 1B92A 4ZLPA 4DV0K 5HRPA 5LL6Z 3P49B 4QIGA 2XYPB 5KFHA 3DI6A 2Q6BA 2OH2A 1HPZA 5BR8J 4LSLB 4NO7A 4LF7F 2AJQA 4ED0A 4ILMA 1W97L 4BRQA 1AW0A 2D3OR 2OPPA 4ANCA 1M0SA 4B3TJ 1K1SA 4CEDA 4X65J 4B17A 2FVRA 1VSKA 2B5JA 2IDEA 3T7ZA 2OYQA 2MQ8A 1SJ4P 1BWFO 3KMQA 2VODA 2IOCA 3OPKA 4NE9C 4CH1A 2ZBRA 3D28A 4DHYA 2NSBA 3S01A 2MY7A 4ZDNA 1JLGA 4PZVA 2YQ3A 4KHPK 5HMWA 3A3NB 3QO9A 1K73O 2ZJQQ 2GX8A 2O1PA 3BR8A 2R2UA 1M5SA 1VGYA 3FBEA 3EGZA 3T1YK 2KB2A 4YUDA 5K9FA 4CF9A 3IG1A 2RN2A 3QEXA 4GKKF 3LW5C 1T9UA 3DXSX 2EPIA 1RLCL 4RW9A 2YX1A 1RT7A 4L3NA 2W7OA 3KLEA 2GO9A 2IVOA 1S9EA 4M5MA 4FZXC 3UO0A 3KG0A 3NEKA 1IKWB 3PR4A 1U47A 5J2MB 2HVZA 2WSCC 3GOIA 5K8NA 4FWRA 3LDQA 5KFNA 4RUBA 3NP5A 3R1LA 4F9OA 3EY1A 1S3XA 2FXUA 1M1KT 4ISEA 2E5IA 4OZ5A 5GADI 2UUWA 4G9ZA 2PYLA 4Z2XA 3DN9A 3MXIA 1MU2A 4M63A 1A9NB 4H5VA 1NGJA 1ATNA 3A5MC 2C3OA 2DIVA 2W2OP 2ZBPA 3A12A 3R6GB 3HVWA 3KKFA 1GLJO 3FUYA 4I6YA 1WNSA 1HNWK 3OSPA 4NYNA 4OI1A 2LXUA 2U1AA 4JKGA 2M2BA 2HFUA 3W63A 3BY5A 3Q8RB 1K73T 4UY8O 2FPHX 1YRUA 3EE3A 4U7BA 5IFMA 1NXIA 4OZ3A 7AT1B 3RBZA 4B1ZA 2A6OA 1Q53A 1YJUA 1KQGB 2KI2A 3VZHA 4BE0A 5HLFA 3IBWA 3EX7B 1QJHA 3HYFA 2RT3A 1C0UB 2IC3A 1PYTA 5ETKA 3ENBA 4RJVA 2LEPA 3I8DA 3M6XA 1CXQA 4GC6A 3R5JB 2CQ4A 2IAJA 1NJXA 1N6QA 3ZZZA 4N5SA 1HR0K 4HHUA 4EP4A 2R7OA 1RBVA 4CLLA 3CIZA 5J2QB 1IBLK 3MR7A 2KM8B 1M5PC 1A5XA 1X4FA 3NGDA 4B3RF 3OW2M 3BGRB 2NRVA 1FWPA 2MEWA 4BQLA 3M1VA 3QLHA 3U02A 4A57A 3QEPA 2OI2A 2FC8A 3CCUS 1HLWA 4CZEA 1UVNA 5D8HB 4LFBJ 2YHAA 3B8HA 3OL9A 1IR0A 4DV1F 3SAFA 2ROPA 2ZJRQ 1EKRA 2PMHA 4MLEA 4QWEA 4Y1CA 3OL7A 4R5PA 4RW7B 2UXCF 5JLFA 4P7VA 4J9SA 3KUGA 3EE8A 3LP0B 4DV4K 2DD8S 1BHNA 1UVJA 3HT0A 3IDHA 2JJ4D 3QBCA 3O3HA 4ENOA 5KFOA 2EFGA 1WC4A 1XMQF 1SUQA 5E3RA 1NCLA 2DITA 3NMAA 3P8BB 3SK3A 2R2RA 3G6VA 1I1GA 2CAJA 4OPKA 4ZPTR 2D3UA 5HSPA 2UV8G 3MR3A 4O4GA 4I6MB 1PAUB 5TKYA 1IBLJ 4OFZA 4FWQA 3WHIA 1MMDA 4DV3F 5FD1A 5LOQA 4ILGB 4LFAJ 1XMOK 4AL7A 3JYTA 1VCTA 2QLWA 4EUVA 3THXA 2G13A 3PHEA 3TUIC 3IWLA 5F8NA 3QIOA 4TY8A 3MZIA 1H0HB 3DDNA 5JMNA 1BQMA 1HFEL 1SJ3P 4EFAC 4DS5A 4E19A 3RB0A 4BRIA 1RKIA 4ZVRB 2ZUAA 5DG8A 3MEEB 5E3QA 3OYIA 1D1UA 2FBVA 2BZ2A 3MEKA 2IM1A 2JNJA 1T44A 4UUXA 2DNRA 3O08A 2F8SA 3FSYA 2WSFC 1PCAA 3MEDA 2DHGA 2F9DA 2ZH3A 2FF3B 1IJFB 4JI2F 3NAEA 4ZTJA 1U04A 4KHNA 4CLPA 1XC3A 4OL8A 4J37A 3DLBA 2MGZA 1TAQA 2ZHOA 1HPMA 4DV4F 4M7XA 2HQIA 3C6HA 2QLBB 1J6ZA 2E5LF 4B9VA 3CCEN 1RT7B 2NQPA 3IBCB 3OJUA 1HKBA 2HNDA 3AQPA 4USTA 3ZZOA 1FDAA 2VBWA 2IPOB 1TELA 2CGJA 1P1LA 4ZLNA 3CIPA 5KQDA 2HQCA 1RZMA 1VQ9N 1TL4A 4JKDA 2V4JA 2GIFA 1VIOA 2G0IA 5IM0A 3W0LA 4FJ5A 2O01C 4LVNP 3DLKB 2AD9A 3TR8A 2E1CA 4CGFA 5AXLA 4LQ9A 2YH0A 1U2RA 2R7RA 1U02A 2AJ4A 2FZCB 3DXMA 1AFJA 3B6PA 4KJIA 3H45C 3VR1A 4P10A 2IA0A 1YJWS 5DRKA 4E3SA 4NZ7A 1FTCA 3UR3C 1RT2B 1FERA 2CGLA 1S76D 4URQU 2IDLA 2YY3A 2PD1A 1RTZA 4P2MA 1HBMB 3N01A 4MTPA 4DV5F 1TMMA 1YWXA 3CJ4A 3ZTQA 2PI5A 2WC9A 2Q36A 3BSOA 3L2WA 3VGSA 2W7AA 3VHQA 2JVOA 3T5KA 1FX2A 1U2CA 3SNNA 2I5JA 1NKEA 3BS9A 4J2EA 1MU2B 3O9TA 3B4DA 1SVDA 4LF7K 3FDSA 1N88A 1DT9A 5E7OB 1VQYA 3VAGA 4BROA 1MN9A 2D0OA 3CXCR 3NGUA 2NYHA 3NRBA 3C15B 1KR4A 3CULA 5KFMA 1S59A 3Q22A 3D5MA 3CJQA 3EDQB 3G6ES 2WB4A 1N34J 2QIFA 1UAXA 1NM1A 1FXLA 1S6QA 1RAFB 4Q8FA 3ZCMA 3Q8QB 5C42A 2WTFA 3QIPB 5HLFB 5EHHA 1N34F 3OBIA 5CH7B 3W1YC 3BBBA 4WK1A 1UMJA 4ED7A 2NSCA 1N34K 4JOUA 2Q79A 5HN0A 1T03A 4Y2MA 5GAGP 3BJYA 4USMA 3A8KA 5HROB 4LUBA 3ID8A 4B3OA 1JLCA 1RDRA 1WC1A 4AHVA 2RNEA 1Y9OA 4FYDA 4PCQA 3TRGA 4RW6A 3SPYA 5AQHA 3CT9A 2VQFK 4U67L 1C4AA 2GV1A 3UE5A 1WF1A 4WP9A 3CCJS 1KTQA 3CJKB 4IDKA 3WQTA 4F4YA 3N5FA 3R3LA 1U0HA 5CYJA 1QHTA 4JKHA 3QMLA 1YAGA 2GQQA 1RDCA 5K14B 3BEGB 3FNNA 3MM8A 4JKEA 2WZ1A 2YWWA 4FNIA 1TGOA 3HXMA 5KFAA 3M2RA 4OJRA 4A2BA 3SSRA 2BM0A 3WC2A 4N41A 1U49A 1NMDA 1TVRB 2QWOA 4YN3B 2GWKA 4CH0S 1R43A 4DHVA 3HZEA 4C11B 3CCSN 1VQ4S 2XMKA 4QU6A 4GKJK 3MEGA 4YOYA 1U1NA 1TL3A 5CZXA 1S4FA 2QG9B 4OX9J 4H5WA 3K5MA 4W4MA 1ROFA 3A3OB 1DJ0A 5GADP 2D3ZA 1SKSA 3N6NA 4BC7A 2J6TA 2LDYA 3SBMA 3H46O 5M1OA 1N0VC 2YJEA 1CEZA 1CJUB 2EHGA 4CFCA 1FA0A 2DGVA 2YHYA 1LEOA 4FK2A 3HI0A 5JVGL 5HBMA 5LSRA 4DL6A 1TR0A 4XH1A 1HKCA 3VQ8A 4L76A 1OYDA 1GOBA 4BVPA 3ET6B 3NS6A 3R3TA 3BYPA 4DSLA 3TPQA 2JL9A 4ECYA 3TWZA 3W2VB 3CCVS 2Y1JA 3I5CA 2H5JB 1MSWD 1KLMB 1WWHA 1RWMB 4WWSA 2F63A 2CPYA 3FGUA 1XR7A 1J5EK 4CHQA 4F4WA 2ZQBA 2WCXA 2IFXA 2HS4A 2XGPA 1IKXA 2ATCB 2PA3A 3MAHA 1IM4A 3VAFA 3PUFA 2ZOMA 1YQHA 2E1ZA 3M9OB 1X0FA 4HH1A 2XM3A 2R2TA 4DSEA 1R8AA 4PRFA 4CEBA 1PC5A 4ITSA 1N33K 2FUG9 1NOYA 5CY4A 1K6YA 4ZLJA 4X4PA 3VEZA 1QS4A 1F5BA 2C2MB 4C3MA 1WD6A 4Z37A 1VFJA 2OSRA 3ZSXA 4A8MP 4L3KA 4BBYA 3U7JA 3LGHA 1GLAG 1Q8IA 2ZM6J 4JI3K 1CVJA 4ECQA 4KTZA 2V52B 2HHHK 2B43A 4KGVB 4BGBA 4ZVPB 3ULEA 2KJWA 3LWLA 2UYTA 3RMBA 3LAKA 3L09A 3PG9A 1VRUA 1NSAA 1HNIB 2ZFHA 1UFLA 4X4TA 2E20A 1YK9A 3O3LA 4FKXA 4M3WA 4YDUC 3C19A 4MIWA 3DLEA 4JYAF 3GFXA 4ILHA 3KLGA 3MGJA 4CBXA 4CEOA 3RRHA 1Z25A 1NHUA 3CCZA 5DETA 3MFHA 1RCHA 4Q2LA 2RRBA 4O8UA 2VG6B 3MM7A 2DEIA 2GX9A 1UETA 2QWRA 4BRGA 2EKYA 2YNGB 4WPAA 3BPDA 4IFVB 1KOOA 1Y7PA 1RT2A 4IFEA 1IBKJ 3HTVA 2CGKA 1JXVA 3M8RA 1K0VA 2Z2ZA 5DGAA 3KWIA 4UOGA 4KH0B 1TP7A 4ECRA 2PC6A 2X6NA 3MM7B 2B9XA 3THPA 5LJVA 3VEOA 2DVIA 3NNHA 1X5PA 4UUWA 1MG7A 1FXDA 2VQFJ 4DR3F 4HUFA 1N4LA 1CJUA 2IY5B 3M6WA 3KK2A 2BJ9A 4Y2IA 5EWEA 2ZDPA 1XBWA 3NH1A 3KTQA 2GHWA 1M5HA 5I9EB 3EDRB 3D2EB 3VQ4A 2YHWA 3UDEA 2ROEA 3CMEN 2V63A 2YX7A 3HRGA 2YQ1A 2LU2A 4QPXA 1H74A 5D0RA 3FMBA 1XC9A 4J9OA 1DTTA 3MWPA 3C94A 3CQ8A 2EG2A 3QRRA 4W92B 2H54B 4CF8A 2VIHA 3LZIA 1PKUA 3M30B 1E4FT 3LUYA 4F2RA 3QQCD 3MPWA 4FVCA 3V9WA 1VRTB 3OVNA 2HNYA 3ZXWA 4KB0A 1N48A 4AQYK 2ZJQL 3I9ZA 4ZVQB 1RBRA 4RPFA 1Q82T 3D54A 2W9BA 1U4BA 4KHMA 4DSKA 4DZDA 5HRRA 2M4MA 2AQ4A 4Q2MA 4P74A 4J8FA 3FZBA 3AVBA 3UKRB 3S9HA 4JI5K 1NBWA 3CPWR 1VQPN 4UW2A 2UUAJ 3O5BA 1Y64A 1HNZF 5A8RB 5HQMA 4ZVEA 2QFJA 2GTDA 1JLBA 3T1HF 2Z1JA 1KONA 3HM8A 2JRSA 4PQUB 3SCJE 2LECA 1EX4A 3IAYA 3A8YA 2E88A 3MM9B 4OZJA 2OO4A 3OYCA 5KFVA 1HJOA 3HP9A 2QL5B 4PPZA 2FY1A 3M2UA 2X1GA 3IC1A 1RTIA 4QPTA 5D77A 3SBTA 4WE1A 3CM5A 3MD3A 4P72A 2YNHB 2MPUA 5A8KA 5T14A 5AQWA 2O8FA 4AHCA 4M7YA 3MEGB 2G2YA 4Z4CA 3H6EA 1H7XA 1RTJA 3KJNB 4DV6J 2Z2LA 2VBYA 2WONB 1FRKA 3HP6A 2CG8A 5DM7L 1LQ9A 1WOSA 1FKPA 5JMVA 4DG1B 1XMQK 2CJYB 4M41A 3ZSVA 3N6LA 2HVIA 1RKJA 3UWTA 4FPBA 3IM9A 3F41A 5DM6L 4B9NA 2KYZA 2HHPA 1BL3A 4HTUA 2PZSA 3W60A 2CJXB 5DZ6A 1V4SA 3E66A 1Y11A 1EP4A 2J7WA 2GA7A 3KWGA 2X3DA 4H4KA 4J9MA 3BUZB 2VQEF 2MQOA 4DR1J 1ASUA 1KLMA 5C0YA 3TAPA 2YWKA 1NOZA 4XDCA 2EBGA 2W7PA 1WSRA 4J5OA 4KBIA 2OCEA 2RQCA 3FE1A 1YBUA 1VBZA 3CDBA 4CGHA 1QLNA 1PGZA 1HQ2A 1FD2A 2LA6A 2B7CB 5JXSA 2J9CA 5SWMA 1JXLA 4OJHA 1QM9A 1UWBA 2MMYA 3AO4A 4CBWA 3JAMO 2KKHA 4K4SA 1C0FA 1MWQA 1ZA1B 2CWXA 3AJDA 4CK3A 3M8QA 3R1XA 4N8NA 4FWLA 1NGAA 2HBQB 3OYAA 2DO0A 2ASOA 5HK4A 5DDRC 2OANA 5AFUH 3T19A 3PYFA 4LFCK 4DR7K 1A6LA 3OUYB 1W0HA 2YBVA 1BMQB 4O55A 4DLGA 5BXIA 4YS2A 2ZH6A 2E1MC 1NNEA 5FLXY 3TOQA 3O80A 4AM7A 1B64A 1Z2LA 2DR5A 2HSEB 1QAJA 4Q8EA 3NVKA 2DXFA 3KG4A 3JS9A 1OY9A 4X64J 3R8YA 4NLUA 3CCRN 3ZZUA 4USVA 1BCOA 4JI0K 4YHHK 2N3LA 4OI4A 3WNGA 3DLGA 3HBTA 4JI6F 1SQFA 2AYEA 4R79A 5JLHA 3H2LA 5D15A 5T7BA 5J2PA 1OKJA 4KH5A 1NJIO 3TAFA 4P52A 2E2PA 3H98A 1TUVA 1P6TA 1JJ2R 3V4IB 2GV9A 3K59A 4DTNA 1T9WA 1HWLA 4F7VA 1CLFA 2ETJA 2XG8A 5RUBA 4LBHA 3W2WA 4IOBA 3J81j 3H3NO 1UVIA 4K4TA 2OGUA 2HRTA 3EPIA 4CZKA 1GXUA 4MH8A 1UEUA 1BOTO 4J2AA 3DYAA 2NLXA 1WELA 3P96A 3TUPA 3AA5X 2CVIA 1PSDA 1NB2A 5J2NB 5AQJA 2BJ8A 2XI2A 4MO4A 4KC5A 2HAFA 4FJ9A 3G96A 3KFWX 4O3PA 4DJBA 4KKOB 1YJNN 2O8CA 4A46A 1H3DA 3IUCA 3QAEA 3DLLL 3W62A 1WOPA 3QT5A 3EL2A 3QT7A 5A2QY 5C12A 3UCGA 5FIIA 3QINA 2HGLA 2VUGA 4NMLA 4B8CA 2FGOA 3SQOP 4E1MA 3KVGA 2CQCA 1S6QB 4DQSA 1RBLA 2EFOA 5B8HA 1BQNA 2LLZA 4BRPA 1J54A 3L2QA 2QL7B 4CLSA 2C28A 5AE3A 3P38A 3LTOA 2GGPB 2JDJA 1U6BA 4CECA 5DQGA 2G0JA 4FLXA 5HROA 4TU9A 2HZCA 2XEXA 4X64K 2HNDB 2ZGZA 1H2VZ 4L8RB 4CO5A 4DF4A 2YI1A 2DEJA 1NWKA 5GMDA 1ULRA 1KTVA 2XBPA 1VQNN 2LSNA 3AO3A 4I7FB 4ES2A 1G99A 1K1QA 3LM2A 1S72N 1OH7A 4DPWA 2X78A 3A5OC 4DX5A 1IH7A 2V51B 2BE2A 2HRYA 3CE8A 4FPRA 3ULHA 2LQ5A 4ID5B 5ADXH 4FM1A 3D6FB 1SJRA 5AJ3J 2PFDA 5AT1B 2ZM6K 1FK9B 4WF9Q 3F5TA 4F4XA 3IA0A 3BKTA 3X3UA 3IM8A 4MT1A 5I42A 4FYVB 4CP5A 4CIGA 1TK0A 4ZVOB 2ZC4A 3VMFB 3IBFB 1JJ2M 5GMKa 4IO9L 2E6MA 1Q8KA 1N8RT 4HHHA 4KB7A 2HBLA 1F60B 3SAHA 4M45A 5L1JA 3QFUA 4CZIA 1RA6A 4PG7A 4DF8A 1FWKA 1FJGK 4LD0A 2V9WA 3WNHA 3JQJA 3J7ZT 1HR0J 5HANA 3O5TB 4OHVA 3SEOA 3UQSA 1ESVA 2F3JA 3Q86A 1PYOB 1S1UA 3KDNA 4DR2K 3RRKA 4WFXA 2W2QP 2QWQA 4BLGA 1DAXA 2DGXA 2QV6A 4BACA 5KFSA 4EYIB 2BTFA 3AVLA 3VQ5A 2D3O1 2F40A 3H59A 1NK6A 3O2IA 4DV0J 1SBRA 1HBNA 3KJQB 1VS3A 5F0UA 4FWPA 3OYKA 2H51B 2BQ3A 1X5TA 1QQMA 1ZS6A 1RTDB 2P8IA 4YY3K 1NAQA 3MFIA 4HI2A 1X9JA 3MURP 3V9UA 1CZ9A 5KFRA 1XNQJ 4RW6B 3OXGA 1BU6O 3L3VA 3CPWM 1NU4A 1N32K 4Q43A 3P5BP 5DG7A 4X4OA 2I2YA 3CMES 4MLHA 4K0KF 5FJ4A 4BS2A 5LMUK 4FWMA 3CUNA 3EVMA 4B9QA 3PW5A 1ZM4A 3FGVA 4PL7A 3O3GA 2BQUA 3TTFA 3RW7A 1ZETA 1NRKA 2A41A 2B56A 4JUZA 3KLIB 3SQGA 3M8YA 4JI1F 2EFPA 4XDDA 3W3SA 3HK2A 2GO8A 1U0SA 3KK1B 2F1FA 2ZHAA 4ERDA 4NLGA 2W2PP 1ACMB 3CTRA 3FQLA 1VK8A 3H40A 5EX5A 5CCLA 4JI8K 2JLEA 2BRKA 3BO4A 3C65A 4JHDA 2ACMA 2R8IA 4O44B 3OYDA 1VQ7S 1KVIA 1ZBHA 4CJ3A 2MB0B 2Q3SA 2DNMA 4OQJA 5E84A 2HBJA 2XRIA 3M9NB 4GRSA 4FS2A 4EHTA 2M8HA 3DLRA 1RWWB 5CE3A 3KWMA 1S5ZA 3RSEA 2JC1A 1C0TB 5K5MA 2YKOA 2P6SA 2W9CA 3DXBA 4PWUA 2EFQA 5KOXA 2GW8A 1X5SA 2HSTA 3ZNJ1 3MN7A 1R8PA 2P9GA 3W2VA 4PWDB 5H9FJ 4DEZA 4WFZA 1TYQB 1TV6B 4YB1P 3BZCA 3SDEA 4Z94A 3G8SA 3Q89A 4IG3B 1VC0A 2WOMA 3TQEA 3NCIA 4WXWA 3W8PA 4LY7A 3P6YC 2NLWA 3FBCA 3OT9A 3QIPA 3MHYA 3EVOA 4EI2A 4OI0A 4GKKK 3LGNA 1R6YA 4B02A 3VAJA 3UR0A 2R7WA 1WG5A 1YTAA 1YHQS 1BD6A 1EX8A 2IDOA 1D09B 3K5PA 5KFPA 3MR2A 1C1CB 1C0MA 2VKZG 3W5XA 3IN5A 4BGAA 4LF5J 2P9KB 1R0CB 5ETPA 3F9MA 2DGOA 1RWUA 1G3OA 3FZKA 2IRUA 1Q7YO 5DDPC 5E2QA 3HHLC 4C6AA 3CJAA 3LP1B 3BBCA 4URSA 1FXRA 3OTCA 2V7ZA 2ATLA 2HMIB 2QYCA 3J80U 3MPDA 4DPYA 1TKDA 1VISA 2CPDA 2PE8A 1VBKA 1U1MA 2E2QA 4IXCA 4B08A 2QFIA 1NEEA 4MQ3A 1HNXK 3TJ9A 2DH8A 4B9TA 2DRBA 2E7WA 1ZZFA 4JI1K 5IQ6A 1U2VB 3AY9A 4U67Q 2B8QA 1RYSA 3BSNA 2PMZD 4NA2A 2XHWA 4P2XA 1AROP 2FJEB 3QBXA 4FJKA 1R0AA 4QIWD 3VEYA 2GCFA 4RKUC 2QMXA 3UW1A 3E51A 3DRPA 3DLJA 2UZAA 1VLYA 4HKQA 3VQEA 4PABA 4FWSA 3THXB 3SXLA 2VFTA 4X62F 5EY4A 3D6TB 2W4PA 4ZN3A 1RDWX 1BGXT 2HFZA 4YHHJ 2R7SA 5ETOA 4OHYA 3X1LB 3PW7A 2MHEA 2R7QA 2LQ9A 4OYXA 3JSYA 1RDBA 2IHR1 2KLAA 2PBDA 3U3YA 3FRYA 1C6VA 1I94K 1TK5A 2E1YA 5AQYA 3KK2B 4KT0C 2JEFA 4DV2J 4DQQA 3AO1A 4WIQA 3T5HA 5KRTA 1NPRA 3IRXA 2E2NA 5C15A 2OD6A 1Q1KA 1AZSA 4PXCA 3M5RA 2VPYB 4DR5F 3TEGA 5E3CA 1HA1A 4RW8B 3VQ6A 3EWGA 5D4PA 2MQNA 3I56S 1NM2A 4DR4J 4E2FB 3O1WA 4IG3A 5HMXA 4G1PA 3CJCA 4DR2F 4RBVA 4EAHD 2QL9B 4O23A 4UZBA 4Y0FA 1TFYA 5E33A 5KFEA 3EXCX 4CJ5A 4CEZA 3C15A 2DCUB 1T05B 3L6QA 3TVKA 3UFCX 2HNZA 3D6MB 3V6JA 3MWTA 3DAWA 3PIPQ 5THWA 1X0PA 2CPZA 2GIQA 4NEZA 5A8WB 4JI1J 4OPAA 2HMPA 3M32A 3EUNA 4F3MA 1GXLA 2UVUA 4BC4A 3SCXA 1FW6A 1B70B 4QYRA 2RKIB 5KRSA 3V1QA 1RWKB 1TFWA 1YVUA 4EU0A 3GLJA 2QA4G 1HD1A 2HK3A 4MYTA 3WC0A 4LF9K 3AO2A 3MM5B 2E5LJ 4DX6A 2L9DA 1X3NA 5HQLA 3ID6A 3SQ0A 2XS5A 5EXWA 4F3OA 3HVTB 4FYXB 1JK9B 3P5JA 1IV0A 1VQLS 3J7YI 3ZO7A 5KT6A 2BVZA 4DSJA 4O0IA 4ZVSB 4OPJA 4WK3A 3MM5A 5FROA 4Y3CA 4I6MA 2MZTA 4A5AA 4TKTA 4AHRA 4G1QA 3FCWA 1TV6A 3O9SA 1SV5B 1Q79A 4LBPA 1VK3A 3M2RB 2MHNA 4O44A 2HVEA 4FPAA 3TA2A 3J80Y 3QNOA 3HHLA 2BKOA 3FMWA 2P9IA 5KG7A 3P39A 4WF9L 3UN5A 3THYA 2DH9A 2FJBB 4CZFA 4KGZB 2A18A 1JJCB 3OTEA 3DU5A 2I0XA 1IKVA 3IRWP 4U9RA 5BR8K 2ADCA 1ZTTA 1DKGD 5L9XA 1RT6A 4XPCA 2A2CA 3F44A 2YXLA 4O3SA 2M8DB 2O8CB 3EGWB 1E6YB 3OHBA 2NYIA 5JUMA 4H03B 3R27A 5K8PA 2QWLA 3DXKA 1D0EA 5H1SQ 4ALZA 3KNGA 3EGNA 3IRXB 3L2UA 3ZSQA 3OBYA 3W5ZA 2F8HA 3N0VA 3AAWB 2KXNB 4PG4A 4CNYA 4V1Ak 5GADU 2FVSA 3R7NB 2DH7A 3KLIA 2DIUA 2QZ8A 3SQGB 3HHNB 3K58A 5AJ3F 5F8LA 2C3YA 2MZRA 1IR1A 2DNLA 3KJVB 3OUYA 3T41A 2XLJA 5B09A 3BF4A 3IR5B 2IIRA 1IWAA 1UWAA 2RAQA 2MZSA 3AO5A 3SYZA 4C8YA 2H65B 3LGMA 4AHSA 4FNHA 4WKYA 3HPHA 3AA3A 2YNIB 4H0XB 3NAHA 2ALYB 4JI8F 3T5LA 2AGPA 5C25A 1S57A 1WG1A 5ITHA 5AQSA 1KBRA 1YG0A 3D2WA 4B9LA 3TA1A 5L1IA 3H90A 1JLAA 3LDSA 1ATRA 3GQCA 5EWGA 3Q8UA 2ZOGA 4FS1A 3CD0A 3SI8A 2CDQA 4GMKA 1D4XA 3TSUA 5J1PA 5I3QA 3FSIA 1S9EB 3GJRB 5GIOA 2VDIA 3U8XA 2KZMA 2QTDA 2RHKA 4ZCIA 3RB6A 2Y8WA 3M2VA 4DR5J 4OLOA 4DOZA 4DL2A 2FIUA 4OYIA 3EE9A 4GVBA 2J6SA 4JI6J 4PAAA 3TZXA 1FKOB 1XTZA 4URGA 1S0OA 2VBXA 4H4MB 4ZPAA 4BE1A 2V4QA 3A5NC 4A8QA 5F8GA 1WSIA 4NEYA 2CKWA 1R7IA 2RHQB 1FEHA 3G9CA 3K0JA 4ECZA 2XWXA 1NK4A 4DR2J 3OTOJ 4IDHA 1U1OA 4CW7B 2F4VF 1RADB 4BC5A 2DGWA 5ETMA 3G10A 1FJ7A 5KFCA 2VF3A 3QGPA 5AXKA 2KYXA 4MKVA 4N77A 2VOPA 2JFDA 1GFWB 1VQSA 1M5OC 1X8DA 1T94A 2OPPB 1UFKA 3DRRB 4L74A 1TUUA 5KT2A 4ATNA 4C23A 2DY9A 4ZP7A 1NLVA 4BHQA 3OA9A 1HW8A 4YDUA 2CQ2A 4MIAA 1X4BA 2UVWA 3POTB 4DUZJ 4RUAA 5JS2A 4FJJA 1HQUB 3ZSZA 1FJGF 3E01B 1S7HA 3AA9A 2E9ZA 4BR9A 4BQZA 3HLUA 2B7BB 3HSCA 2OPSA 3CM6A 1KDNA 1LAVA 1NPKA 1CS4B 1RDAA 3SFUA 5EGYA 3HHLD 4LRFA 9ATCB 3IFRA 1RGIA 4HDGA 1VQ8N 1XIQA 3AB4B 4JI4J 3D6HB 1UJ4A 1I3OB 5EUHA 2P9PA 3VGUA 2M0GB 4C98A 2OPQA 2A6MA 4DV5J 3FC9A 3CWJA 2Q2RA 2V8PA 3NCPA 4I1TA 4X4VA 4I6AA 2C2RA 4QBUA 4CD3A 2HG4A 2KW4A 4QAGA 2VG5B 1S0NA 5F9NA 3WXLA 4CT9A 4FLZA 2UUAF 1A5VA 1JNZB 3HVRA 1NK8A 2ZWPA 4FVUA 2O8BB 1ASWA 3DJCA 5LMNK 1GLFO 3CCRS 1WHXA 3SUNA 3O8MA 1RYRA 2J76E 2VFSA 2IYGA 3BO3A 3OTOF 5SZTA 3DHWC 5I3PA 4QCLA 1WSHA 3CCQN 4ZVGA 3LDLA 1XUPO 2NR0A 2L3MA 3UI3A 2Y1IA 1TUYA 3EICA 1FT8A 1QSLA 4WYWA 1SH0A 4WKRA 4QOTA 3GIKA 1TUGB 2PFUA 3QZ8A 3MUVP 2AIRB 5AQPA 4NRTA 4J9QA 2ZKUA 1DY3A 1GEHA 3RUBL 4DV4J 1S0MA 2RDDA 1QQCA 4CJKA 4WIIA 2YWFA 5DMRA 1U2FA 2HRUA 2P9NA 1KVAA 3LALA 3GG1A 4X4NA 3K8VA 2QWNA 4CJVA 3SDEB 4O5BA 2QEXS 2FTRA 3BQ1A 4DSFA 4ELTA 3B6BA 4F8RA 2QEXN 3NS7B 2B8PA 1V5VA 3TAQA 1WC0A 4TYBA 2HAIA 3SUOA 2KT3A 4Y0WA 4RCHA 3I33A 5E3PA 4U7UD 5DM6Q 3CC7S 3AAQA 1PBUA 2K3IA 4KPYA 2QI2A 3GYGA 1NHKL 2RUGA 4RX6A 3L3CA 3D2EA 3BV8A 4NASA 1S6UA 1JB0C 3AA4A 4C2MA 4XIUA 2UXBJ 1O0PA 2D69A 4RW7A 1FVSA 3OQ2A 3FFIA 5T7LA 1REGX 1HHSA 1E3MA 5KGWA 2C1EB 2FQQB 4LIWA 4FBTA 2BQRA 4BRFA 3SFGA 4AHUA 2XI3A 3K7RA 5CCMA 4W5RA 3KJFB 3OYFA 5IT4A 2ZJRL 4DFKA 2Q43A 1RFQA 2ZE2A 4OKEA 4LMZA 4XH4A 3DGVA 4N47A 4JS5A 3L9ZA 2YX6A 2V4JB 2W9BB 3LWMA 1GLDG 1K9MO 1YGYA 4CJ4A 4M5DA 4F4ZA 3PW2A 1NK7A 1J53A 1HL6A 3VQ9A 4NYFA 1YI2S 1BIUA 3ZFVA 2P9PB 3HSTB 1FFSB 4M3ZA 3G82B 5A6PA 3CEDA 3DXMB 1QVFR 3LDNA 4R8UB 4FLWA 3JAMY 2I7NA 3D7EO 3ZLJA 3ITHB 4RUHA 4DV1J 4GO7X 2BW7A 3KK7A 3J7AN 4A5BA 5JVGQ 2HHHF 3QICA 3KZBA 2ZEJA 4CZLA 2PI4A 4FF3A 1WSVA 3QGGA 2N4CA 5SUHA 4H0TB 3Q23A 2MQMA 4EYHB 1TAUA 4TY9A 3CFPA 4DN0A 2ZZTA 1JWWA 4DL0C 4LFCJ 3L4BC 4K2JA 2G8IA 2MKSA 1JIHA 1B4SA 5CZVA 1DFDA 2QX0A 4CGGA 2M9KA 3BEXA 4K43A 2DBBA 4OKKA 1D8ZA 4IWVA 3BO2A 4JI3J 1HNWJ 5KFWA 4DFMA 1VQ6N 5KFLA 3MPVA 4FP9A 3K5OA 4YOEA 4GO5X 3QIDA 4CO0A 4B3SF 2G0CA 4LF8F 2NCKL 3NXZA 3VOVA 4USKA 1UWBB 3OYNA 3QEIA 3G8TA 1FWLA 1JQGA 4CHNA 5KTQA 1GH8A 4LFCF 1L3KA 2VC1A 2RH3A 1F2GA 4R25A 2W40A 4JP8A 4LRAA 2MQLA 5BN9A 2KVIA 1S1XA 3DM2A 1QUPA 3OR1B 2R8KA 1JXBA 3RU0A 5FPMA 5A8RA 2HQDA 1KOHA 1VQ5N 1VQ9S 3IFEA 2VGMA 3RBEA 2ZVIA 3N79A 2HNZB 1RU2A 3CCLS 3POTA 1CBKA 4X66J 2FBYA 3G4SN 4OX9F 5HVFA 3AH6A 1RXOB 3KD5E 1RT4B 2WBNA 1SC4B 4QS9A 3GE1A 1URNA 4S0MA 2G1DA 2VWBA 5MLCV 5A0YA 4JYAK 2MKIA 4NX9A 4Z4FA 3SUPA 2DPNA 3LH2S 1QVFM 2MSSA 4JNEA 3AVNA 3J81O 2HURA 2D74B 4HTJA 2XHBA 3KLFB 4ELVA 3TYTA 1HX1A 1YJRA 3AXKA 2A6AA 2EX3A 3CPEA 4AILC 1MWYA 4H54A 3U27A 4CLYA 5E5NA 1V4TA 1GAOA 1WKKA 2EG1A 2HHVA 1X9WA 4EZ9A 1R0AB 2JVRA 1HKAA 2F9JA 3I4HX 2E6LA 4FJLA 3TAMB 2CIMA 2DPJA 4ECVA 2DNZA 1UP1A 3T1AA 2AEMA 1JJHA 2EWSA 2NRRA 1QSYA 1J5OA 2PMWA 3T6JA 2XNRA 3QNWB 3QJJA 2KM8C 1VQ8S 1ILYA 4NA3A 1XN9A 2BACA 2IMWP 2XO7A 3LPUA 4OLBA 2O5DA 5D78A 1XI1A 2XSJA 2NXEA 4OYWA 1EJ7L 4DR4F 4MK7A 2DNQA 2IM0A 3ZT1A 1S77D 3SBGA 4A8XA 5FPEA 1U7LA 2YNFB 3OLAA 3EVWA 3ONQA 4J2BA 1DARA 3EZUA 5C5JA 5F2RA 1VRTA 4RR5A 1RE1B 4FXVA 1AUSL 3V6DA 1KLNA 3JXOA 3ZYYX 3DRSB 5IC6B 4F2SA 2OKQA 3KNAA 3VF6A 4X4QA 4C8ZA 2GQ2A 3ATVA 4DUZF 3CJ8A 4E7HA 4CJFA 3BPSP 1VC6A 4U7CA 4AQYF 3PKMA 5IV4A 2O3DA 3I9V9 4LF7J 1R31A 1WLJA 4UOHA 1IBCB 2KRRA 3L2RA 2P9KA 1KFDA 4HTLA 2V8HA 3SCKE 2JX2A 3GSIA 1N0UA 5IT9U 4DR1F 1ZA2B 1WI8A 4EIAA 3OTBA 2F8TA 2G2OA 3HJFA 4YR0A 1RAJA 2GMLA 4J90A 4WP8A 3G71S 3V5RA 2HBYB 1ZBLA 1ZXOA 3IG1B 4KFBA 5M1FA 3C6TA 1FDNA 2F7VA 3MMBA 4F50A 4NCGB 3UNGC 2OTLS 2ILYA 3TX8A 4BRHA 1GLEG 3N28A 2XHCA 3UB5A 5I4MA 3CJKA 4E89A 1LKZA 4E7JA 3JQKA 4OZ0A 3OXFA 4MDBA 5A6WA 4DR3K 1XNQF 1KAXA 4F4AA 1SJQA 2RJZA 1Q82O 5KI6A 2B0GA 3GB0A 1LWFA 1PO6A 4OYZA 3FCHA 1CULA 2RRAA 4PKGA 1VSIA 4M5DB 4KH1B 3VN5A 5CYMB 2XYHB 4CJTA 1J27A 4MK9A 4JBCA 3TA0A 2FJXA 4LF9J 3E9PA 4FF2A 2YPZA 3P4UB 3MR6A 5IT9O 1EKSA 1RWVB 3BDEA 4H5NA 3NMUA 3M2VB 1WC5A 1FF2A 5DS7A 4MFBB 1BQXA 4I2QA 1BWEA 3AY0A 2FSNA 4PG6A 2VPZB 3RR7A 4CJSA 3DC2A 3NOCA 4C3KA 3TR5A 4NOHA 2IRXA 4FO0A 1BUXA 1OIAA 4EMDA 3H0PA 3HD2A 1WDTA 3UE2A 2ACYA 4IR9A 3ENOA 2HBKA 3F56A 1HNVA 1MDUB 3RVCA 3I55N 2FHMA 2XULA 4JKGB 4QWCA 2J0WA 1QDUB 3NNCA 3KLHB 1RCOB 4F26A 2KFZA 3QATA 2RDJA 3CJ9A 1SIZA 2NZCA 1Q5VA 2V69A 5K8OA 4PXBA 2W4DA 1JLEB 4C48A 3CMAN 3HPOA 2ASDA 3OS1A 3JSBA 2PA8D 1QAIA 2J0XA 1TL5A 1QD1A 4CZGA 4WQ5A 3BSCA 4CFBA 3CC7N 1L3UA 2PDAA 4WU3A 3TARA 4DPUA 3M1FA 2LQJA 4C4WA 4RWXA 1Z6RA 2R7XA 4LBIA 3NCRA 3A2FA 3BYRA 3BN4A 3IXQA 2CH6A 2XC9A 3GFYA 5F3ZA 4RNFA 5CA5A 1VK0A 1B7FA 2OLWA 1WEXA 4EP5A 2AYBA 4CEQA 3CGIA 3FSXA 4QQBA 4H4OA 3VF2A 4RW4B 4JI2J 1T9XA 3O9UA 4FF4A 3D0PA 4MO5A 1S1TA 3QMQA 4I7FA 5GAGU 1FFGB 4RNMA 4U8VA 4ZLLA 1V3SA 4I0WA 2DY4A 4P2SA 3E01A 1PILA 2HQFA 4FOIA 2VYPA 2YCHA 4NZ6A 5AQGA 1NSPA 1S1VA 1ZM9A 2MTLA 5I3UA 2MJNA 2PAVA 5GAHU 3AV9A 2NUHA 4Y65A 2HHSA 1YVNA 3CDEA 1RGVA 3TWHA 3RMCA 1R6VA 3KHYA 3ULEB 1VIXA 2IBOA 1FNMA 3PTWA 5KT7A 4DL4A 4U95A 4XAKA 4WBFA 3FCVA 2HPUA 3ZZYA 4ZPDA 1AUDA 2XZWA 2ASMA 3O4WA 3I31A 4N7TA 1UVMA 3GCWP 1BG3A 2B9EA 3ZT0A 2DKOB 1YTUA 4C8MA 4KTWA 4LFBF 2R8GA 3L4IA 2HMIA 3RBDA 3V6KA 3ZETA 1OVQA 3RSEB 2A10A 2HHWA 1WTBA 2B51A 3CW2C 2HIQA 3WUHA 4LJMA 4ER8A 5B0DA 4J9KA 5J2PB 1HWJA 3UCUP 4K4UA 3TP2A 2K2PA 2NXNA 4B1XB 3RWUA 4ED2A 2XQCA 1TQLA 2KH9A 4ECTA 1I51B 3FLCO 4LH4A 2VGNA 1IQZA 2H4WB 2DFEA 2FHJA 3O6WA 1DHMA 1F0XA 2ROGA 3DLLQ 3NNAA 1GLCG 1S48A 2D4WA 5KT3A 4H0VB 1JMTA 4KIAA 3UKUA 5CZ2A 1X60A 3GIRA 3PY8A 3C46A 1LFPA 1Y5LB 1Z05A 3O9RA 4WYBA 3MM6A 3VQAA 4ZPBA 2VICA 2VD3A 1H2TZ 1NKBA 5CR4A 4OZNA 4I6WA 1T3NA 3BGOP 1HNXJ 3M8WA 1WUAA 1XMOJ 4LFAK 4FJ7A 3UDLA 5C24A 2NS1B 3KLGB 3AOAA 3ZTPA 4DXLA 4HUGA 4CIEA 1EQ0A 1DEJA 3OY9A 5AQUA 3LM9A 1I39A 2XY6A 1HD0A 2OA8A 1JLCB 1RAGB 3CD7A 3QESA 2Y1RI 1YHQN 4I68A 3MOZA 1GLLO 2GGPA 2AT1B 4PA1A 2YWHA 2LXFA 4LSNA 3C7NB 3W66A 2WVFA 4HYKA 3B82A 2HHHJ 4J9NA 4J9RA 3CQXA 3H2VE 3EXYA 3CI5A 4H4KC 1NK5A 3D3BJ 2HEKA 3PJXA 3LPTA 1E6VB 4U96A 1RTHB 2ZE2B 2C3UA 2R7YA 3LP0A 4CK1A 3V81A 1TKZA 1YX2A 1C2PA 2I1RA 2HZVA 4C0BA 1I5OB 1VSDA 4B3RJ 3TZZA 3DWLA 2YKNB 1KSPA 1I94J 1PJ5A 1YIJS 1U6FA 3EM1A 2ASYA 3PCOB 3V9SA 2WBMA 4OMFG 3GJTB 1TZ0A 4KGXB 2NRXA 2YV0X 2RF2B 3M6VA 5HRSA 2VOOA 3CD6S 4O4GB 1FEEA 1TMJA 2DXEA 3PR5B 1UJ5A 4OYMA 5GVQA 3BGFA 3CNQP 1QSSA 3RR8A 2ZC3A 2QKBA 5CABA 5F8HA 2QSFA 1RHQB 4UOCA 3DCAA 1YJTA 5LJ3Y 1CZAN 3U3GA 2V0NA 4HT7A 5DZ7A 3WIVA 1OO0B 5M2PA 3AGRA 1H72C 3I55S 3NG8A 3I82A 3IWNC 4NRUA 3VCDA 1UA1A 1RAIB 2ILZA 3KUEA 5BYSA 3BKFA 5C2GA 3CJ5A 3DRYA 3LZJA 4USWA 4YP3A 5CD4A 4DUTA 1ZH5A 1YJ9S 3OSNA 2C2DA 2ZZMA 3W65A 2VASA 3P4IA 4TVAB 4AE5A 4JV5J 4D3GA 3QSIA 3Q8PB 1G6BA 1BLUA 1Q9YA 3QYYA 1KRPA 3R7BB 4K41A 4RUCA 1L3VA 2CWKA 2QO3A 1N5YB 3PRBA 5AQZA 2Q0RA 3G71N 4C97A 1RT6B 5KFIA 2W01A 3N4QA 1F9EB 3E9LA 4ECWA 4P75A 2V5HG 4D3HA 4QR1A 5G0RA 1UEKA 1LCUA 1WACA 4BDPA 2Q66A 4V19X 4YFUA 1Q7LB 2ZH1A 1S6OA 1E4GT 4DR5K 3C14B 2W4CA 4CE9A 2OEKA 1ZAXA 4X62J 5KQ8A 4QIVA 4F36A 4P7TA 4IUFA 4C8OA 3JXUA 1Q16B 5C2FA 5BR9A 1DTQA 2HQ3A 4DG1A 1CC7A 1B0PA 3AA2A 2KQ2A 5ADZA 2DTUA 5BPMA 1A0OB 1U1QA 4CJPA 3H5YA 4IFYA 5DGBA 4CGJA 2H5EA 2YX4A 1UZDA 1E6VA 4CF2A 3CJBA 3P45B 4LF4F 1RBAA 2PSZA 1A5WA 4IOAQ 2W9CB 3VVTA 2CQHA 5BRDA 4MKAA 1UZHA 4UZCA 4CHOA 1GNKA 1RWOB 2HIYA 4JI4F 3DGPB 1S79A 4QOZB 4JI8J 2QT7A 4K4ZA 1QQNA 5C25B 1S9FA 1BA0A 1J5EJ 1P90A 2K3KA 2VDHA 5GINA 2FHJD 2HBZB 5GAEP 4RBUA 4CGDA 3N4WA 1Q9XA 3OYLA 5FPDA 4LT6A 2MSTA 2OMLA 1N5VA 5KG6A 4ZN1A 1OMSA 4B1YB 3M8PA 1F5AA 3VESA 4QS7A 2DT9A 3PSIA 5F41A 1MMLA 1BY9A 4ECXA 4RW4A 4K0KK 2AWZA 2CJQA 2IMOA 3MMJA 4KBOA 1NGIA 4CLFA 2XMJA 1KHWA 2UXDK 2UUTA 2EC0A 3KKRA 1HARA 4PWWA 3R5GA 4IO1A 1VBXA 2BRLA 5EU7A 4ZJLA 2DYAA 2RE1A 1GOCA 2QA4S 2BXJA 3UKUB 1Y10A 4CJUA 3RRGA 5BREA 4DV5K 4YEAA 2E9RX 2DR8A 5CHIA 3G6YA 2F4VJ 5CZ1A 1VSFA 4ZVUB 2XZTB 4BRMA 1V9OA 4DTJA 4LVOP 1QE1B 4M3TA 5C10A 3PW4A 3CJ3A 2CNNB 1KS2A 1C1BA 5KFBA 5T41A 2LQBA 4K7QA 2GJFA 3MM8B 1KC8T 2MLZA 4ZJQA 2VONA 1FVQA 1QZ5A 4FF1A 1QE1A 3W5YA 1ITPA 3W3DA 1HR0F 1TKXA 2V8DA 5B0FA 2QLJB 4G1QB 1OJ4A 4DQRA 2QLFB 3T1HJ 1S9GA 3JQMA 3TSPA 3ZZ0A 3D2FA 2GJIA 4DCPB 1OPIA 1SIWB 1RACB 3KHHA 1VQLN 3GL1A 5FPNA 5KGXA 4USUA 5ETVA 2MKYA 2DJWA 2NZ4A 4DS4A 3AOBA 5BPLA 2NXUA 2KHOA 3PXGa 3D45A 2O8FB 1CPZA 3J7A1 1NGDA 5FLXO 2YKQA 1BC6A 4CM0A 1EARA 3F9KA 4BVOA 2YWGA 4QR0A 2E1AA 3ZTOA 2NUBA 1X9SA 3SV4A 2ASLA 4H0PA 3U9DA 5F0WA 4ZHRA 1X4AA 3DXKB 4MJKA 2HLUA 3UNYA 4Z4HA 1VAZA 3QRPA 3PEJA 2OD4A 4IYQA 5D6GA 4ZMMA 2YNFA 5LXRA 4M42A 3RB4A 5L9NA 2LYVA 3JS6A 3WXIA 5F3TA 4FZYA 1P8GA 3E8OA 2WTUA 2FZGB 1ZZNA 4Q0BB 1WF0A 1JNRB 1K8AO 3L8BA 4DFPA 2DNKA 1IBKK 5D4NA 5B0AA 1VDHA 1O6XA 5LJWA 4JI3F 3WEEA 5GAHI 4AYBD 3NGSA 1YZ7A 3D0IE 4GVMA 2W25A 2ASPA 3WIUA 1GX5A 1LWEA 3FEXB 4L6V3 1N33F 4RNHA 5JJBA 1QZ6A 3T9ZA 4RW9B 4I69A 1RBUA 3I0RA 3ZTRA 2YNIA 3KMSA 2PT0A 3PX4A 2BV3A 3O6QA 3CJ1A 3WZ0A 4IEIA 1JLGB 4FL9A 3SSQA 1QY7A 2AKWB 4NCGA 5D3GA 1CLQA 1QVGR 4HLBA 1TL7A 4DU3A 4JV1A 1FRLA 2FHKA 2Q31A 4NL5A 2RD5C 2P9SB 1C4CA 4FJ8A 3M32B 2ZBQA 1F21A 1B99A 2X74A 3CD6N 3VV2B 1NKCA 4JKFA 4LREA 3N9UC 1I6JA 2DNOA 4HACA 3VTHA 4RNNA 1BI4B 3DLGB 1JL1A 4GVBB 2Y9HA 4LF5K 2DR9A 2E7XA 4E7LA 1LK5A 1WORA 2CG4A 4NZ0A 3MMAA 5AJ3K 2Y8YA 4Y2AA 2A42A 2W6KA 2F4FA 4ZCMA 1LWXA 4HCCA 4YOUA 2J9EA 1HWKA 1TKTA 2WONA 3NGYA 2X1BA 3NMRA 3QWUA 4ANEA