1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
4NLDA 3OL6A 2IGIA 5L1LA 1BIZA 3ISNC 2IM0A 4LSLB 3D28A 4BACA 1REVA 4FM0A 4M95A 3CYMA 4E7HA 1ITGA 4Z0UA 2HNYB 1X9WA 2O5DA 3HPHA 3S3OA 1U4BA 3ZSQA 5DMRA 4FK2A 2XO7A 1SL1A 2KZMA 2OA8A 3DOKA 3MR3A 4AHRA 1QHTA 1U04A 1WNSA 1XR7A 1HYVA 4CJUA 1RILA 3MAQA 4IRKA 1VSFA 3G6XA 3L3VA 4KBIA 4CGIA 3QZ7A 4M94A 1S9EB 1B9DA 3ZT4A 3H2LA 3NMAA 5JXSA 2YHBA 2WONA 4QPXA 1EX4A 1VSIA 4FLZA 3K2PA 3MEEA 1L5UA 2IJFA 4E7KA 3CG7A 1KRPA 4CGJA 3HK2A 1NJYA 4FJKA 3V9SA 4KHYA 4YMEA 2B4JA 1JKHB 5KFQA 4RW6B 3S9HA 1J5OA 4RW4B 3VQ4A 1FK9B 3G6VA 1NHUA 3DMJB 3AO3A 2VG5B 3M9NB 4EP5A 4QOZB 4RNFA 3CO9A 4IG3B 1VSLA 2IMWP 3SYZA 1ZTWA 4OPKA 4FJNA 3PW2A 3GQCA 4G1QB 3AVCA 4FBUA 3HVRA 3TAMB 4DU3A 4CHPA 3TARA 3KK1A 2FJWA 3S3MA 5FRNA 3NCIA 4DS4A 1X9SA 3KTQA 3VQEA 1JLAB 2FVQA 5KT2A 3KKSA 4AHSA 4ZP6A 3CQ8A 3ISND 4IH5A 4CJLA 1DLOA 3M8QA 4CEZA 1QAJA 1BQNB 3CFPA 2IM2A 5HLFA 1ASVA 1HYZA 4FVMA 1EETB 5SZTA 2V9WA 2IM1A 3QETA 1IKYB 1T3NA 4DWIA 3TQ1A 4F2RA 1KSPA 4ELUA 3S3NA 1S0MA 4B8CA 5JUMA 2JEFA 2BE2A 3KLEA 4DMNA 3NF6A 5KFBA 3IG1A 4O44A 3NF7A 1TGOA 4J9RA 1IKVA 3DLKB 3LZIA 1TL3A 1RT7A 5DG7A 2DTUA 3FRZA 4LSNA 5DG9A 3AVFA 5CY4A 3SNNA 1RBRA 3QNNA 4O4RA 3O4QA 1RT6A 2HHQA 5KGXA 3I8DA 3KLGB 2ZD1B 5FROA 1IKWA 1S1VB 4G3IA 1RNHA 4W5NA 2HWIA 4PWDA 1N56A 2RF2B 3GIJA 3G86A 4DFPA 3OL9A 4WE1B 5CYQB 3HXMA 3OYEA 4QW9A 3KK3A 1HQUA 4H54A 4Z4EA 3PW5A 1RTDB 3I0RB 4WFZA 1CLQA 3SQ2A 3IS9B 3DRSA 1C2PA 2BQRA 4J9NA 3N6LA 2XCAA 4CJFA 4N76A 3L2WA 5KFKA 1KCFA 5I3UA 3NF9A 3KHLA 1NK4A 4IG0B 2IC3B 2OPPA 1A5WA 3UIQA 3AA4A 4IRDA 4LD0A 2DPIA 4M3YA 4Z4CA 2C2DA 1Q9XA 1VSDA 4MFBB 3V1QA 3RBEA 5FRMA 4CK3A 1B9FA 5L1KA 5DG8A 1JIHA 2W9BB 2HVIA 1GX6A 4YP3A 4WFXA 4XPCA 1REVB 4DF8A 3OYKA 3BGRB 1J9AA 2PZSA 2P1JA 3RMBA 1S49A 4RW7B 3ZSWA 1ZBLA 4FJ8A 3VQ9A 4YR3A 3NH2A 3QO9B 2F8EX 2OPRB 3G6YA 3DYAB 1BIUA 4DTPA 4IFVB 2YNIB 3AA5X 3QZ8A 5KFPA 3DLHA 3LP0A 1HNIA 1TK8A 1C0TB 1UA0A 2E6MA 3KLFA 1RTIA 2HHXA 3NGYA 3TR8A 5F8HA 1MU2A 3LP2A 4CF9A 3LAKA 1FKOA 4KTZA 2C2RA 3PJWA 2PY5A 3HHKA 4CJ3A 1LWCB 4CIFA 2IAJB 4EBEA 3L2QA 4X2BA 2FVPA 2ASJA 2ASLA 2ILZA 1LAWA 4JUZA 1WSEA 2B6AA 2OPQA 1UOCA 3NH1A 1S5JA 2C28A 3V81A 4DL2A 3CM6A 1KHWA 1NHVA 4H8KA 3OS1A 4IDKB 2Z1IA 2HHWA 4O3PA 4K4YA 4CJVA 1XR5A 2HNZA 4AHCA 1HPZA 3UPFA 2I5JB 3SV4A 3BQ1A 4F4WA 4HCCA 3M9MB 3HO1A 4B3OA 4FLVA 2YV0X 5EU7A 3KOAA 3QINA 3AVIA 3NL0A 3OLBA 1N5YB 1RT5A 1C1CA 3AVAA 5KTQA 4B9UA 4KHMA 3B6PA 4JV1A 4DFKA 3WNGA 4M3WA 4MH8A 2AJQA 4ECTA 1L3SA 3M8RA 1IKXA 4FYDA 2ATQA 2XY6A 4DTOA 4DSJA 4J2EA 4NYNA 5J2MA 4ICLA 5KFWA 4NLXA 2XRIA 3V4IA 3SJJA 2YKMA 1SKRA 3T5KA 2YNFB 4DSIA 5J1EA 3V6JA 4H4OA 1TL3B 5F8IA 5F8NA 3GIKA 4GVMA 3TVKA 5KFZA 5DLFA 1IH7A 2BANB 3OYNA 1SKWA 2WK4A 3IRXA 4DQIA 4I2QA 1WSIA 2JGUA 4QWEA 4K50A 2RDJA 4O0IA 1VK0A 2BRLA 4NCGA 5K14B 1UWBA 3AVKA 3RTVA 4ED2A 3CIZA 3K5NA 4KHUA 2XC9A 3DLGA 1KHVA 4DLEA 4DTXA 3LWLA 4KAZA 1RDBA 3JYTA 3DLEA 4EBDA 4CF8A 4O4GA 2XWYA 2RKIA 5HRSA 4MK9A 3CM5A 1IO2A 2R8GA 1IG9A 4KB1A 2HWHA 1TKTB 3DRSB 2XGPA 3EPIA 5DQGA 1VSKA 3RMDA 4CF1A 1RT1B 2ITGA 2BR0A 4DTSA 3RMAA 3MR2A 1QQCA 3KNAA 3HP6A 5J2QB 3AVJA 4HHTA 3LPTA 2ZE2A 5KG7A 3AVBA 2J6TA 5KI6A 2UVWA 3KLHA 4DTNA 2HNDA 3NAIA 3LALA 4KFBB 2BQUA 2R2SA 3QIPB 2OZSA 3SV3A 5J2NA 1WSFA 3HJFA 4WZMA 2HVHA 3KIOA 1ASUA 4BWMA 1S9GB 4H4MB 4FJ9A 4GC6A 2FBTA 4JLHA 3NE6A 1TKXB 2D0BA 1S97A 1NKBA 5HP1A 3LANA 4ECSA 2F8TA 1HMVA 2QE5A 4DFJA 3DI6A 2JEIA 3QGGA 4KKOB 1S1TA 2FLLA 4IFVA 4B9LA 2KZZA 3KK2A 4KHRA 3H5SA 4UQGA 2VG7A 1RTIB 4W5RA 1SUQB 1KLMA 3CJ0A 2PYLA 3QGIA 3VQ8A 4OVLA 4M3ZA 1LAVA 2FVRA 2PYJA 4F4ZA 3CVKA 3MR6A 4ZTFA 3AVNA 3OHAA 1S6QA 1RT2B 5KFXA 4WYLA 3ZCMA 1RBUA 3L8BA 4FBTA 3VQCA 1TQLA 5FDLA 3FSIA 2KQ2A 3V6KA 5KT3A 4CFDA 2AWZA 4FK0A 3AO4A 1G15A 4U6PA 2UVRA 4CJTA 4Q44A 4NLTA 3SFGA 3KJVB 1HQEA 3E01B 3GV8B 4OL8A 4F4KA 3VA3A 4DL7A 2WCXA 4Q0BA 1YVFA 3MFIA 1S9FA 5F8GA 4ELTA 3AVMA 2HNZB 3HM9A 5C24A 1HPZB 4DG1A 2QK9A 1JLFA 3DMJA 1JXBA 2E9TA 3HSTB 4J9MA 4RNOA 3WNFA 4FM1A 1ZBUA 1C1BB 3MXMA 4CERA 1HJRA 4W5QA 3V9WA 1LWEA 4K4VA 3KHRA 1JLGB 2D3UA 5KFLA 1LW0A 4DL5A 4KREA 4CHOA 1BGXT 3OYGA 3PZPA 5KG0A 4TYAA 2IS3A 1I6JA 3PO4A 1RTHB 3NGIA 3PVXA 3I0SA 3QEVA 2OYQA 3DRPB 3VQ7A 4M42A 4Q8FA 5EUHA 1NJXA 5KFYA 3MXIA 5L1JA 4KO0A 2Z1JA 1JL2A 3H08A 1L3UA 4K4WA 4HVJA 3FFIB 2BDPA 3BR9A 5CZ1A 1TL1A 1VRUB 3DOLB 2XI3A 4WYWA 1EETA 5EDWA 5J2PA 3MEGB 1J53A 1JLBB 1RDCA 1C1AA 4ZVEA 3AA3A 2YHAA 3BREA 5CYMA 4FLUA 1DTQA 3OL8A 1D1UA 4ED8A 4DTRA 4E7JA 4DF4A 4CIGA 2YKMB 3Q8PB 3PX0A 2FVSA 3O3FA 3CFOA 1RDDA 4H4OB 4NYFA 1RTJB 4J9SA 2EX3A 1QUVA 3C6UB 4DL6A 2D3ZA 3VQQA 4LQ3A 3IRXB 3U6FA 2X78A 5HBMA 4CK2A 1KFSA 4MK7A 1Z26A 1UA1A 3HPGA 3P83D 3SQ0A 4R5PB 1S10A 3K58A 1S1WA 3MF5A 4J9QA 3IAYA 4KB0A 3FQKA 3NF8A 4CF0A 1L3TA 4DQSA 4DQRA 1HYSB 4RNHA 4PQUB 3PV8A 1RT3B 1GOBA 2RDIA 3HVWA 4K4SA 1DTTB 3DOKB 4KB7A 3MXJA 5KRSA 1IKWB 1S1VA 4TSXA 3VQ5A 2Q3SA 5KG6A 2ILYA 4I7FB 4ELVA 1EP4A 4QW8A 1NK8A 3I5AA 1A5XA 4DTMA 4URQU 4ZP8A 1HQUB 4IKFA 4ZP9A 3CFRA 5KT5A 4ZPDA 3V9UA 3ITHB 4IR1A 2FBYA 4URGA 3A2FA 4TY8A 5DGBA 4ZVGA 2WONB 3LP1A 1CZBA 4FM2A 3K5OA 1JLCA 2OPPB 2OPSB 4AHUA 4F2SA 4F3OA 1XI1A 3VQDA 1I3AA 3VQ6A 5DLGA 4RNNA 3T5HA 4J2BA 2P5GA 1UAXA 3DLBA 2DFFA 1N4LA 2I1RA 3RAXA 2IM3A 5HRRA 4RUAA 1B92A 3ALYA 2A1SA 5KT7A 1TKXA 4ZHRB 2W9CA 2JEGA 4EO8A 1BI4B 4FJLA 5HP1B 1C0UA 3GV5B 1HMVB 4M41A 5T7BA 1TK5A 1RA6A 4BDZA 4W5OA 2G8KA 5F9LA 4NLYA 3F73A 3TI0A 1YTUA 4E7IA 3BQ0A 2ASDA 1TVRB 2G8WA 2VG6B 3C6TB 4FZZA 2XGQA 5C25B 4M3XA 4HTUA 2AGQA 4OGCA 1TKZB 5E41A 1S6QB 1DLOB 4BE0A 4IRCA 3LWMA 4IFYA 3SUNA 5HLFB 1Z25A 3OYCA 4FW1A 2KFZA 3K59A 1S6PA 4KV8A 3OJSA 4B9VA 5F9NA 4ECUA 4J9PA 2IAJA 3HYFA 3NH0A 4CGDA 3AA2A 4N47A 5KFOA 1IKYA 1KLNA 1D0EA 2R2UA 2IJNA 2JEJA 3NKYA 5KRTA 3L2VA 1YVUA 3AVLA 5C42A 4QWCA 3KLEB 4C8NA 2GC8A 4O3NA 1XHZA 4EYIB 3KD1E 3I5CA 3H5YA 1QSSA 4KTQA 1K6YA 2AX1A 3V1OA 2QV6A 2YKNA 1T03A 4EZ6A 4F4YA 4OKEA 1KVAA 1J5OB 3ZT0A 2A1RA 4FCYA 4QWBA 1VRTA 1WSJA 3ZSRA 2VG5A 1LW0B 4DTJA 4CECA 5JS1A 3L2UA 4CK1A 1ZBFA 1EKEA 2FLPA 3KKRA 2KFNA 4ECZA 3V6DA 3UQSA 4IH7A 4NLQA 1ZYQA 4DQPA 2XY5A 3DRPA 1JLQB 5I42A 1SH2A 1I39A 4DU1A 2Y1JA 3SUQA 2FC0A 4RW8A 5D3GB 1X9MA 4NLRA 4IH6A 2R8IA 2IOCA 4CEFA 2GV9A 3AO1A 3F9KA 4FJ5A 1RDRA 1RTDA 1ZBIA 1CXUA 3HVTB 2X6NA 3U3GA 4CEQA 5KT4A 1FKPB 3OL7A 4C8LA 3N6MA 4TQRA 1GOCA 1NNDA 3OYLA 1IKXB 2W8LA 2HMIB 4PUOA 4J2DA 1T05A 3H59A 1S4FA 3TWHA 1D5AA 3CDWA 1LV5A 2YNGB 3T1AA 2R7YA 1SL2A 4CEAA 2GUIA 2V0NA 3Q8RB 5J2MB 1WN7A 1HNVB 4OKJA 3Q8SB 2BE2B 3MEDA 3QNOA 1N6QA 4O5BA 3UR0A 2BQ3A 4Q45A 2WHOA 3NGZA 2HB5A 3HPOA 4ECWA 2BANA 3RAQA 1U49A 1JXEA 2CKWA 4I2QB 2E9RX 4E1MA 3RB4A 3RBDA 4FK4A 1S1UB 4FS1A 1HYSA 1O1WA 4RG8A 4NCGB 4FS2A 4OLBA 5EWGA 2ATLA 1DTTA 4CHZA 4MIAA 1W0HA 1RT6B 3IN5A 3CJ2A 3PW0A 1ASWA 4KHQA 3KLGA 3PY8A 3OYIA 4DL4A 4OLAA 4CFCA 4O4GB 1S0OA 5KG5A 2E6LA 3SPZA 4FJ7A 2RF2A 1KTQA 3KHGA 4M3RA 4JV0A 4KHSA 1BL3A 1TV6B 4O0JA 1XC9A 4B9NA 4E0DA 1JXLA 1KVCA 3K57A 1S9EA 2FJXA 1JLCB 5HRNA 2DY4A 2OPSA 3GYNA 1U45A 3M8PB 4BDYA 4BE2A 4RNMA 2O4IA 4WXWA 3T3FA 5I3UB 3QIDA 1RYSA 3DM2B 4HUGA 3VQPA 3L2RA 4CEDA 3BJYA 4J9OA 4F3TA 3PW4A 1BI4A 1JKHA 1N48A 4RW6A 2GIQA 4E3SA 4C8KA 4RW4A 4CIEA 2FBXA 4FLTA 2P5OA 4MIBA 4MFBA 2HHSA 2AQ4A 3CDEA 3PHEA 3SI6A 3VA0A 1RYRA 3T5LA 2VA2A 1CXQA 1TKDA 4PY5A 2HHUA 2ALZA 4HCBA 2W9AA 4DEZA 4I2PB 1TVRA 4ECXA 4B3OB 1K1QA 4KKOA 4ID1A 1S1TB 1ZTTA 4U7CA 4LSLA 1F21A 3QO9A 5C5JA 1TKZA 1U48A 3EY1A 1RT5B 3TAEA 1KLMB 3EYZA 5DGAA 1WNEA 4AHVA 4AILC 3I5BA 5F8LA 3VQAA 3MR5A 4W5TA 4N41A 2DFEA 2R8JA 3QESA 3THVA 3RWUA 1SH0A 4KI6A 3QGHA 2EC0A 3ZT3A 3CJ5A 1TP7A 2OH2A 3GIIA 1MMLA 5FDLB 4O3SA 1ZBHA 4F8RA 3HL8A 4M3UA 2B5JB 5L9XA 3K5LA 4IOBA 1IM4A 1LWFB 4RUCA 4NLVA 3MECB 2OPQB 3V4IB 4B9SA 2G8UA 1Z4UA 3PJXA 3H5UA 3RRGA 1T8EA 3IGNA 2EHGA 3CWJA 1GOAA 4DTUA 4C8MA 1S1XA 4FJGA 1RDAA 4IDKA 3ULDA 1JL1A 3DLKA 2AGOA 1C1BA 2X74A 4YFUA 3OS0A 3U3YA 4LSNB 4Z4HA 3NAHA 4MKBA 3ZT2A 4QCLA 3TANA 4R0EA 4ID5A 3OS2A 1JLQA 3SPYA 1XHXA 1W9HA 4CGFA 4QAGA 3JYTB 1EXQA 4RW8B 4G1QA 2J6SA 2VA3A 4K8XA 1NK5A 2JC1A 4CEEA 1TKTA 1U09A 3DRRB 2QXFA 3JSMA 3MFHA 4KE5A 3EZ5A 3KK3B 2W7PA 1JLAA 4WFYA 2D0AA 4URSA 1NK6A 3LDSA 1JLBA 2XCPA 4ED0A 3E51A 4JS4A 3T5JA 3SQ4A 3TAGA 2IC3A 1NKCA 2RPIA 5J2NB 1KFDA 2XHBA 2VWJA 1BCOA 4FZYA 1WAFA 2B43A 3MEDB 5KFAA 3QEXA 4Z4IA 4BWJA 3OVNA 3SUOA 4Y1DA 4FJXA 3HKWA 1RCHA 4ED1A 2YNFA 5KT6A 3NFAA 2QKBA 4TQSA 4DS5A 3SI8A 3LP3A 2UVUA 2FJVA 2YNHA 1S1UA 5KG4A 3RMCA 4Z4FA 4NLGA 4CEOA 3BGRA 2W8KA 2Z1HA 3DI6B 4HKQA 3EPGA 4R5PA 3QYYA 5KFJA 4CJPA 4RW7A 1S0NA 4YQWA 4CFBA 2VG7B 5K14A 2HNYA 2ZKUA 4FJIA 1NOZA 3V9ZA 3DYAA 4RW9B 4ZP7A 3LP0B 4QWAA 4FXDA 3KHHA 1HNIB 2WTFA 1C0TA 4ZVHA 4K4TA 2UUTA 4GMJB 3O3GA 2RKIB 3ZT1A 3PX6A 5KG1A 2G8VA 1VSHA 3K5MA 1Q8IA 4I9QA 4MQ3A 4CESA 2G8IA 3ITHA 4WE1A 2AGPA 3M8PA 2IBKA 3PR4A 4KAIA 3LP1B 3SQ1A 5KFTA 4IR9A 1HQEB 3KMQA 2DPJA 3D45A 2B6AB 4CJ4A 1XWLA 3SZ2A 3OYMA 4CGGA 2KW4A 4CJQA 2HNDB 4IBNA 5C24B 1RBSA 4DG1B 2LSNA 5HROB 4AHTA 4R8UA 4E7LA 4B9MA 3VQSA 4M45A 5KFSA 1VSEA 2HW3A 1SH3A 1FK9A 4NRTA 1BQMB 2I5JA 1BISA 4O3QA 3M8SA 3H5XA 4MKAA 1T94A 2R2TA 4M3TA 1R0AA 4KHWA 3OY9A 1VSMA 3I0SB 3MTKA 2WOMA 4N5SA 5C25A 3KK2B 4WXOA 3TABA 2OZMA 4KO0B 1N5YA 3OHBA 4GW6A 4B8AB 4JRQA 5JS2A 4KI4A 2OPRA 2FLNA 2YNIA 3DOLA 1QS4A 3TAPA 1LW2B 4KSEB 3OYHA 3MEGA 1S6PB 2IA6A 1TAUA 4FJHA 3PUFA 5F8MA 4CJ5A 4AH9A 4PA1A 4FJMA 5EWFA 3L3UA 3D5MA 2D41A 3BQ2A 4TXSA 1OS5A 5EWEA 1YTAA 1BQNA 3LP2B 2B5JA 1WSHA 1LWFA 1RBVA 2Z1GA 3HT3A 5KFVA 2ZQBA 1J54A 4J9KA 3RR8A 3BDPA 3RR7A 3H40A 3QEPA 4CHYA 4L8RB 3SFUA 3RB3A 5KFIA 3OYJA 1S1XB 4QWDA 4XIUA 1BCMA 3CJ4A 4HYKA 2E4LA 4XPEA 4Q0BB 2YKNB 4CJKA 3V81B 4DSKA 3C95A 4DSFA 4O44B 3IG1B 3NBPB 3VN5A 4CJWA 1C6VA 4DSLA 2RN2A 2JLEA 1JLFB 1JX4A 3UDLA 4DFMA 3PX4A 1IKVB 3OLAA 1QSYA 4BDPA 2HAIA 3AO5A 4Z4GA 1LWEB 1S48A 1UWBB 4ECYA 3V6DB 1X1PA 1JLGA 4NLPA 4DQQA 4NLOA 4OJRA 3KLVA 5KG2A 5DK5A 5KGWA 4E89A 1RA7A 4Y2CA 4LH4A 1NJZA 3BSCA 1QE1A 1RTHA 4GC7A 2R2RA 3WNHA 4EP4A 2E9ZA 4ZPAA 4HUFA 1SV5B 3O3HA 3V6HA 3FQLA 1C1CB 5DQIA 3OYAA 1YT3A 3HVTA 5L1IA 4C8OA 4NLUA 5CYQA 4EZ9A 1ZETA 4TY8B 4O3OA 4NRUA 1TL1B 1RT4A 1VRUA 1RT1A 4YR2A 3I0RA 2XI2A 2WB4A 2AX0A 2UUWA 4O3RA 1T05B 2QKKA 1WLJA 4KPYA 4Y2AA 1K1SA 3TAQA 2YNGA 1CZ9A 2JC0A 4KFBA 1FXXA 2FVCA 1JLEB 2C22A 1DTQB 4IG0A 2GIRA 1QAIA 4OPJA 5F8JA 4J2AA 3D0PA 1HNVA 4NLWA 4ED6A 3H4DA 3QEIA 3DLRA 4FLYA 2YNHB 4TY9A 4EBCA 3G10A 1RTJA 3QEWA 4B9TA 3QIOA 4NLSA 3CJ3A 4DU4A 4FW2A 4IQXA 3QLHB 2W9BA 3KLIB 4DL3A 5HBMB 2P51A 4E1NA 5KFDA 1KVBA 3H98A 2O4GA 1NOYA 3G0ZA 4Q43A 4ED3A 4N56A 2VG6A 3C6TA 1Y97A 3NGDA 3DDKA 4RW9A 4K4XA 4K4ZA 4CFAA 4PQUA 1RT3A 4ECRA 1SUQA 4YR0A 1C0MA 5KFCA 1A5VA 4CJEA 4IFYB 3ZSXA 3ZSZA 4NCBA 3B6OA 3DLGB 4I7FA 3GV7B 2NUBA 2X6SA 4DLGA 3KLFB 3DLEB 1TV6A 4KHNA 4OKKA 4CHNA 1MU2B 4FLWA 3OSNA 3LPUA 1FKOB 4TLRA 3NDKA 4DSEA 4CEBA 5KFMA 1LWCA 3IGVA 3O4NA 5C42B 1BHLA 4O55A 3H4BA 2V4QA 3KJVA 4NYZA 3AO2A 5J2QA 5HROA 2ZE2B 2VWKA 4R8UB 3P5JA 4OGEA 1T03B 5KFFA 4JV2A 3QIPA 3ICLA 4B08A 4CJSA 1VRTB 4CGHA 1BQMA 3MEEB 4YNQA 3AVHA 1NKEA 4JRPA 4ZHRA 2ETJA 4K8ZA 1C0UB 3OYFA 3FDSA 1R0AB 1W25A 2R8HA 4FJJA 4LH5A 2FBVA 1Q9YA 4CJRA 2DFHA 4JS5A 1HARA 4E19A 2WOMB 4IG3A 1CSJA 5SWMA 4FLXA 3ZSVA 4EO6A 4ZTJA 3P1GA 5D3GA 5CZ2A 4CHQA 3QERA 5KFUA 4NCAA 3V9XA 4ZMMA 1LW2A 3TAMA 3AV9A 3PW7A 2F8SA 5KFRA 5KG3A 3KK1B 4EEYA 4TYBA 3FFIA 3ASMA 3OSPA 1WAJA 3HP9A 1FKPA 3BSOA 3T19A 2CJQA 1NK9A 1TK0A 4Y3CA 4Q5VA 5J2PB 4KV8B 2HMIA 4PUOB 1RT2A 3NAEA 4IKAA 3M8QB 3TAFA 1D9FA 5CYMB 4ZPBA 3M9OB 2G8HA 1GX5A 2IDOA 4F4XA 3MECA 3SCXA 4CF2A 2V4RA 2GBZA 1RBTA 3AVGA 4Y1CA 3NBPA 3RRHA 1WSGA 4ICLB 3BSNA 2AU0A 3E01A 3RB0A 2WRMA 2UVVA 3C6UA 3PO5A 3HVAA 5J1EB 4FZXC 3N6NA 4KTWA 5DQHA 3PR5B 1TAQA 2BRKA 4Y34A 1S1WB 2Y1IA 4ZVFA 3C94A 4ID5B 1RAJA 1XR6A 4ECQA 1QSLA 4J9LA 2D0CA 1RT7B 1L3VA 1U47A 1D9DA 1QE1B 2HHTA 2D5RA 3GIMA 4ED7A 2XY8A 2G8FA 5HRPA 4EYHB 4I9LA 3KMSA 3VQBA 3NHGA 4K4UA 5I42B 3LZJA 5T14A 1T7PA 2XY7A 3KD5E 3ZSYA 1SV5A 1D8YA 1EP4B 2ZD1A 2HHVA 3DRRA 3JSMB 3CDUA 1RT4B 2D7SA 4CCHA 4PWDB 3OJUA 3EZUA 4LY7A 5KFGA 4TN2A 3V1RA 3WNEA 2C2EA 1VSJA 4XO0A 1JLEA 4BE1A 5KFNA 4HUEA 3IS9A 3DM2A 1HRHA 2KTQA 4NZ0A 3LAMA 4RZRA 4RU9A 2W7OA 4Q8EA 4WZQA 3OYDA 3Q8QB 4ZPCA 2J6UA 3KLHB 3OYBA 4F50A 4CE9A 1NJWA 1SL0A 2W42A 5KFEA 4KRFA 4MK8A 1NK7A 2R8KA 3QLHA 3ZSOA 3SUPA 3KLIA 1NK0A 2W9CB 4LQ9A 1SKSA 1N6QB 3RB6A 2F96A 2BGGA 1S9GA 4H4MA 3BSAA 1QTMA 3GILA 4I2PA 5KFHA 4ECVA
chains in the Genus database with same CATH superfamily
5CD4A 2FJEB 2IGIA 5L1LA 3RSEA 1BIZA 4WKRA 2QL7B 3D28A 4CO2A 4BACA 1IJJA 1HD1A 3CYMA 3N28A 1X9WA 3S3OA 4O23A 4C8ZA 2VYPA 4P71A 3TOQA 2HRYA 4M5NA 1SL1A 4HHHA 1WG4A 3DXSX 2KHDA 2ZH8A 3R7SB 3D2EB 3DOKA 4WWSA 3CI5A 2NXCA 1N32J 4C23A 2BOPA 3CCUS 1UAWA 3MPVA 2QLWA 4I6YA 4AQYJ 4NMLA 4UQTA 2RT3A 2E1AA 3L3VA 2IY5B 1HBNA 5A8WA 2QA4N 5EX5A 3B8AX 3MPDA 3LDLA 2YHBA 3CEDA 2IYGA 2KJVA 4JV5J 2YCHA 4I0WA 1NJYA 3V9SA 2B4JA 5KFQA 3TW0A 1J5OA 4RW4B 3HOTA 4XH4A 3VQ4A 3SLCA 1FK9B 3LDOA 2YKQA 1S22A 3AO3A 2VG5B 2YWHA 4QOZB 1U2VB 2GS8A 2YKPA 2HQCA 3VALA 2BJ7A 3SYZA 4RU2A 4FJNA 2LLZA 5FLXU 4FBUA 3RU0A 3HVRA 4DU3A 1N34K 3G82A 4LIWA 3KK1A 1FXLA 2A3JA 1HBOA 4MT1A 3OA9A 2BKPA 3KTQA 1JLAB 2J7UA 2FVQA 4LF5F 2JNJA 4B9QA 3JQMA 3KKSA 3CQ8A 1FVSA 3CFPA 4WQ4C 1ASVA 1HYZA 3GU0A 4KRWA 1EETB 2UU9K 3DFEA 5SZTA 4YHHJ 4WCEL 1NDCA 2IM1A 3DU6A 1AROP 3M5RA 3TX0A 1KKHA 2KKZA 3PYGA 1UJ4A 1T3NA 4FYWB 2JJ4D 2NRWA 1KSPA 1S0MA 5JUMA 2KHOA 2BE2A 2R9LA 2FF3B 1VQ7N 2E1ZA 2L3MA 3IG1A 4O44A 1RGIA 1URNA 1VOMA 4P73A 2ZH4A 3J80O 4O0NA 1P8GA 3N5BA 2FC8A 3P49B 1IKVA 3DLKB 2HQDA 2DJWA 4LSNA 5CY4A 3AY0A 4O4RA 2HHQA 2ZGYA 2HQ3A 2VFRA 3J7A1 2JH3A 1K73T 5FROA 3SSRA 3TUPA 1IVZA 3SQOP 2R7UA 1N56A 3MEKA 2LFVA 4JI7K 2CJKA 4DFPA 2IDLA 4WE1B 5CYQB 1Q7YT 3KKFA 1KBRA 3HHLD 2E1CA 1N33F 3SQ2A 2OGUA 4ETZA 4NZ7A 4JI1F 4N76A 1FF2A 3L2WA 4JYAF 1QQOA 4WU3A 2C1EB 4Y0FA 4G1IA 1A5WA 1MW7A 2V50A 1M90O 3AA4A 4IRDA 4LD0A 2DPIA 4M3YA 3MMBB 3V5RA 2F63A 4EU0A 2HF4A 4DR1F 1VSDA 3SMSA 1FTCA 4IDHA 4CK3A 1B9FA 5L1KA 2Q31A 2UUBF 2W9BB 2JWNA 1B7FA 3W8PA 3ET6A 1LKZA 2CQ1A 4C7QA 3ID8A 3VENA 4L3KA 2Q3PA 2VIHA 2NR0A 2R4FA 1Q1KA 4KGZB 2XQCA 1JCFA 4FL9A 5JMNA 3PEJA 2OPRB 2AYGA 3G6YA 4DV4K 1UFKA 4RBUA 5KFPA 2VFTA 3SAHA 2MJNA 3LP0A 3OBWA 2B4UA 4CI0B 1HNIA 1TK8A 4E1JA 1JMTA 2MTLA 5AQVA 3J80Y 4JOUA 3NGYA 3TR8A 3HHEA 2ZBCA 4ENOA 4OX9J 2CQ0A 3ILIA 3DWLA 1RGVA 1S76D 1FKOA 2C2RA 1OY9A 4OX9F 5C2DA 3BS9A 4CJ3A 2H1YA 2O67A 3AJDA 4EBEA 4JAXA 1CS4B 2E7WA 3L2QA 3GSIA 3NLCA 3MCNA 1QVGM 1IJFB 2ILZA 2W7AA 3KXDA 2MKKA 5KPZA 6FDRA 1S5JA 3EVOA 3V81A 3ZLJA 1VAZA 2AKWB 1RDUA 4H0VB 1BC6A 1NH7A 2KM8C 4ID8A 3NCPA 2YPYA 1K8KA 4EHUA 4K4YA 2VFSA 5IZHA 3W3SA 2CJAA 4ZJLA 2HMPA 5L39A 2DB1A 4G9ZA 1VQON 4QIFA 4TU7A 4F4WA 4HCCA 3T1YK 3SDEB 4WFAQ 3HO1A 3BGLA 2BJ1A 4CNYA 1WB9A 3CJ1A 2XBPA 3THPA 3QINA 1RAOA 4Z94A 4DR2K 1RT5A 2FYXA 3N0VA 5FLXY 3F0NA 1KVJA 3CJ7A 3W9HA 1Q5VA 5AQMA 2NXJA 3D2FB 3WNGA 3EMTA 4QS8A 4WP9A 5HVGA 1K73O 5A0YA 1W7AA 1AUDA 2J9DE 1KQSM 1SB6A 4DSJA 4J2EA 1KXPA 4ICLA 3VAMA 2YNFB 3V6JA 4USWA 3K9KA 4H4OA 4X62J 1IXKA 3M6UA 3HLUA 2WK4A 4LF9F 4JI4J 4U67L 4O0IA 3B82A 3SMPA 4ISFA 3AVKA 5CABA 1U0HB 3RTVA 2X7IA 4GKKF 2COLA 3K5NA 3T9NA 3LWLA 4X62F 1RDBA 3JYTA 4EBDA 4OZ5A 2HRTA 4O4GA 3RBZA 3PIPL 1WF1A 4MK9A 1IG9A 3WX4A 3DRSB 3EPIA 1QD1A 1Q82T 3RMDA 3UW1A 1RT1B 2O3DA 4DV1J 1MMDA 2C3YA 1QQCA 3MCMA 4IYQA 3RRKA 2ZE2A 2DIUA 1PO6A 1PCAA 3KLHA 4DTNA 3ZNUA 4HL9A 3CJBA 2OZSA 2YJEA 4ZPVR 1UZHA 1KC8T 3OVSA 2CQ3A 3HJFA 2AT1B 3QFWA 4BWMA 5C0YA 4C98A 2OMLA 1FKAF 4FSVA 2DGTA 4GC6A 2ASPA 5KOXA 3HKZD 4ZS6A 3JS6A 3D7SB 3GFYA 1OWXA 4ZDNA 2KL8A 5HP1A 1RBOB 4DV2J 4RKUC 2NCKL 2CH6A 3HF5A 4FPAA 4YDUC 2KZZA 3KK2A 4KHRA 2DGVA 3J7YP 5DDOC 3ZO7A 4W5RA 1KVKA 1XC3A 3CC2N 2W4PA 4M3ZA 3CB4A 2XMUA 3MR6A 5KQDA 2EFPA 1TMMA 4ZTFA 2J8AA 4LT6A 2IJRA 3OHAA 1S6QA 4DPTA 5GAGU 2OJ3A 3ZCMA 3L8BA 4ALZA 3VQCA 1FRHA 2DRBA 4FF2A 5FDLA 4JN4A 3QFHA 2KQ2A 1FT8A 2KYXA 1G15A 2MMYA 1WSVA 4AM6A 3D9BA 2PEBA 4USJC 2YXLA 3B6BA 3PM9A 4Q44A 4NLTA 1UZDA 1NB2A 1HQEA 3N4WA 1KNZA 4CZKA 3QSIA 5CHIA 1S9FA 4PXBA 1GNKA 2J9DA 4PG6A 1F0XA 4DPUA 3DMJA 1JXBA 2E9TA 4F7VA 4RNOA 2HIQA 1NPPA 1RAEB 2V94A 4L3NA 2QWMA 1RI7A 2H5EA 5D4PA 4K4VA 3KHRA 1R8AA 4KREA 2Z58B 3VEWA 1X31C 3OYGA 8RUCA 5GIPA 5KG0A 3THXA 2A5XA 2IS3A 1I6JA 2YI1A 3P38A 2V67A 4PQAA 4M42A 1RBAA 2FZKB 3HSDA 4Q8FA 1NJXA 4NYOA 2M88A 4HVJA 2Z4PA 2BDPA 1K44A 2LCWA 1P90A 4YEAA 1VRUB 2XI3A 2CG8A 5THWA 4WYWA 2GUPA 4B3TF 4PL7A 1J53A 4USTA 1JLBB 4TNOA 1C1AA 4ZVEA 4BRCA 5CYMA 2NPIA 4HI1A 2QTWA 1DTQA 3FNNA 2KI2A 1TFWA 1J6ZA 3M1FA 1F2HA 4H4OB 1FO1A 3G96A 1NPKA 4J9SA 2ZH6A 4JKFA 1OY6A 1QUVA 3C6UB 4DL6A 1X0PA 4LQ3A 3U6FA 2X78A 2WZ1A 3W5YA 4CK2A 1GLJO 5JJBA 1QHAA 1U7LA 3C14A 1Z26A 1ATNA 2VASA 3K58A 4KB0A 4J9QA 1BMQB 4BR9A 4PXCA 3M05A 1VQ8N 3LQVA 5HMYA 5AFUA 4RX6A 2HBQB 2D9PA 4BRDA 5KRSA 5AZJA 3W9IA 4TSXA 4DV7J 3VQ5A 3LGMA 2HGNA 1JNZB 4DTMA 4URQU 2MKSA 2K2PA 1HQUB 3T7ZA 1HKAA 2DRDA 3ENAA 1NLVA 3EKUA 4IR1A 4URGA 5H1SV 2WONB 5LT5A 1D09B 2ALYB 2CVIA 4F2SA 1VLYA 3VQDA 3VQ6A 1I94K 3KG1A 3CO0P 4PCQA 3RJMB 1EHWA 1GMWD 1CJTB 2L9DA 3C66A 1BI4B 2GHPA 4UY8T 3GR0A 3ET6B 5B8HA 1HMVB 3MAHA 3VQTA 5T7BA 3G6ES 1HNWK 4Y65A 4CIOA 3JQKA 2VC0A 3UDEA 1T9WA 3BQ0A 3FZKA 5LXRA 1UJ5A 2ASDA 1TVRB 2G8WA 3C6TB 4CH7A 1UMJA 5M1NA 2V51B 5C25B 7AT1B 3UN3A 3SUNA 1Z25A 4GY2B 3OYCA 4FW1A 3CJCA 4KV8A 4B9VA 3DXKB 5F9NA 2OTLN 4P2MA 3HSGA 2M8DB 5H9EK 3AA2A 5KFOA 1IKYA 1S77D 1KLNA 3MOJB 2H65B 3FEXB 2K3KA 2PMHA 3NKYA 2WVFA 5KRTA 3L2VA 3N4PA 2XB2D 1XQSC 3AVLA 1YUWA 5C42A 3KLEB 5HSPA 3X1LB 4O3NA 1XHZA 5D8HB 3KD1E 2N3OA 4QS7A 4WFBL 3H5YA 3BGUA 1TELA 4LF2A 3FSYA 1J5OB 2Q66A 4ES2A 3ZT0A 2VPZB 3G6EN 3MCOA 1FJGJ 2VG5A 4DTJA 3UE5A 1ZBFA 4DHVA 2FLPA 2KFNA 4CZEA 3EVMA 3V6DA 3UQSA 4ILHA 2H9ZA 4NLQA 5AJ3J 3A5OC 4WU2A 1JLQB 3C7NB 3ZTOA 4X66F 2P9LA 1I39A 3MK6A 3WEEB 4DU1A 1UTAA 3E9PA 3OR1A 4HEA9 2NXEA 5D3GB 3P3DA 4GRSA 3D4JA 4EWTA 3CJKB 3F9KA 1HFEL 3J81j 1U1MA 5J1NA 3KUGA 1HWKA 4ZCLA 1NMEB 1WUAA 4JI5F 5HJYA 3H90A 1BWEA 4FWNA 1GOCA 1NNDA 3OYLA 1IKXB 2W8LA 4PUOA 1U1PA 3BYRA 2Q79A 3H59A 4CH1A 2BUNA 4DDFA 5IV3A 1LV5A 3R5BA 5J1PA 2GUIA 1BDGA 3VAHA 4E98A 1ZS6A 1WN7A 5IS2A 2JVOA 2LP4A 1UKUA 4CYUA 1N6QA 1QTNB 2ROPA 1X5OA 3C14B 4H03B 2RSQA 4ECWA 1VMBA 2D4WA 2CKWA 4LMZA 2B7BB 1RU2A 1RDWX 4CM2A 4NCGB 4U7UK 4OZ0A 4CHZA 4M5HA 4Z2XA 4IEIA 1R59O 4KHQA 2DRAA 3CSKA 1U1QA 1S0OA 2E6LA 4LJMA 3A3OB 1FXRA 2LQ5A 3R3TA 1BWFO 3SPZA 2RF2A 1KTQA 4V1Ak 2H5JB 2DH8A 2WVEA 4JV0A 4JI6J 1BL3A 4PAAA 3OD2A 1MWMA 4E0DA 2JSXA 3BUZB 3FGUA 4OI1A 1JXLA 5BPMA 1E3MA 2JZ5A 3S7RA 1JLCB 5E5NA 1VQMS 2DY4A 4JYAJ 3PKMA 4CLFA 4DR4F 3M8PB 1YJNN 4BE2A 4WXWA 2RDDA 3I82A 2F40A 2FXUA 2NREA 1RYSA 3Q89A 4A8MP 4CEDA 1Z1ZA 3BJYA 4F3TA 4ZCKA 1WUUA 1JKHA 2IVFB 3NS6A 4C0BA 4E3SA 2J5AA 3NGTA 4NOHA 4CIEA 4MFBA 2LQ9A 1WOQA 2AQ4A 3CDEA 4OHYA 3JTNA 1NZAA 2CQ2A 4QR0A 3SBMA 1VBYA 4CZHA 1U2VA 4EI2A 2EC2A 3QMLA 4PR6A 4DEZA 9ATCB 4ECXA 1K1QA 1S72N 4KKOA 2VFUA 2JL9A 4DR1J 3MN6A 3FC9A 1J27A 1FERA 4PG8A 4CT9A 4IOAQ 1TKZA 4DV5J 3EYZA 4EIAA 1L3KA 3CCWA 1SJ3P 3AJ2A 2RU9A 3QMQA 4W5TA 2EFGA 3KUHA 2CYYA 4KI6A 2UU9F 1P8ZA 3CJ5A 2RRNA 1M5OC 4M5IA 5FDLB 4JP8A 2HGLA 2C2KB 1VQ4N 4WK1A 1S7IA 2B5JB 4LF8F 1KOOA 3V4IB 4CZCA 1NLKL 2G8UA 1Z4UA 3BEXA 3UR3C 1IR2A 2QMWA 5AQPA 1GXLA 1PGZA 1RDAA 3BH7B 4A46A 2UUBK 1HWIA 3IA0A 2X74A 3OS0A 1MWKA 2MLXA 1PIEA 3NAHA 4HTLA 2BJ8A 4MKBA 5AQKA 1T9UA 2GIFA 5GADI 4R0EA 2DKOB 3CDBA 3OS2A 1JLQA 3C7NA 1XHXA 1W9HA 1AYEA 4CGFA 3JYTB 4K42A 2EVZA 1E6YB 1GMVA 2VA3A 4K8XA 2QL9B 3JAMO 1NK5A 1WELA 4IO8A 1YVNA 4CEEA 2QA2A 3CJKA 4DHYA 4IUFA 2QXFA 4GO7X 4IOXA 1IJEB 4JKBA 3H0PA 2W6KA 2D0AA 1VYAA 3WHIA 4URSA 4A8QA 2M0GB 5ELZA 2CPJA 2CGJA 3TAGA 2IC3A 2JWLA 2DO4A 5J2NB 4B3SJ 2XHBA 2VWJA 4FZYA 2RU3A 2B43A 4FJXA 1RCHA 4DV7F 1YIJS 4H5TA 1H73A 5AR0A 5KT6A 1HBMB 1X60A 4BG8A 5M2PA 3BGRA 2MDAA 2GWJA 4B17A 2CZ4A 2Y3YA 1S57A 3FZBA 2OSRA 2JX2A 4YQWA 1R3NA 2NRZA 2HNYA 4Q2MA 2V7ZA 2B9EA 4KR0B 3A3PB 2Y9HA 1SCJB 3LP0B 2RUSA 3B54A 4FXDA 3IFRA 3BM7A 1UCNA 2WTFA 1C0TA 1F1BB 3MX5A 2DGUA 4K4TA 4GMJB 4JI8J 2VQFJ 1VSHA 1U2CA 2G8VA 3PFEA 2ITMA 4LC9B 4MQ3A 4CQ1A 3U1LA 4WE1A 1YRXA 4KAIA 3K2YA 5KFTA 2E2QA 1Y3JA 2DPJA 2VZ9A 4QYZK 1XWLA 2BOAA 2AV5A 2KXNB 2EEYA 4JI1K 1DY3A 5CA5A 2PFUA 5HQMA 2ZJQQ 2HNDB 2XWXA 4C1NI 3T1HK 2CQPA 2HVEA 1FJCA 1S4EA 3WC0A 1RBSA 3BP8A 4Y2KA 4AHTA 3UKRA 5JVGL 2QC3A 4CZGA 4R8UA 5BYQA 3VMFB 4PWUA 2HHPA 5KFSA 1VSEA 2CPEA 1KN6A 1F9EB 1R8CA 2I5JA 3QBCA 1F6TA 5K5MA 4O3QA 2WW4A 3MURP 4MKAA 1EKSA 1RWPB 2R2TA 5DJBA 3AHPA 3O80A 3NS7B 4DCJB 1R43A 4UOFA 1SJ1A 4LF7F 1HWUA 4WXOA 2OZMA 3M2UB 3QFPA 1VR6A 2ZOMA 3VOVA 1R8BA 4KI4A 2HVZA 4F36A 4ZPTR 1FRKA 1LW2B 4KSEB 2Z56B 1E6VA 3OYHA 3MEGA 2DIVA 2IA6A 4LRCA 4FJHA 4AH9A 3THTA 4AF1A 3L3UA 3D5MA 3MCPA 1X5PA 3W60A 2PAVA 1Y5NB 3WQUA 1TUWA 4C8YA 3GP9A 1MN9A 2ZFHA 4CZIA 2YKAA 4F26A 3RR8A 2NXUA 3IWLA 2BTFA 4L8RB 1X9JA 4FXVA 4W98A 4N77A 3RB3A 3OYJA 4BQLA 4QWDA 4XIUA 1XNRK 1U02A 3OPKA 4BC2A 1PC5A 2XYHB 3AH6A 3MD1A 2YKNB 2G4BA 3V81B 2IRYA 4DSFA 1U2RA 1W2IA 2RN2A 2UUAK 2B7CB 2JLEA 5JVGQ 1M1HA 4QU7A 1V5VA 3PX4A 4FO0A 2NRRA 1IKVB 4KH6A 2CDQA 3AO5A 2GX9A 3DNCA 4NLOA 1UW4A 1FJGK 5KG2A 1ZH5A 1E6YA 2XNRA 5DDPC 1LQ9A 1NSPA 2O8EB 1XMBA 4Y2CA 2L41A 4I1TA 2ZWPA 3N4QA 3BSCA 4M63C 5G0RA 2AJ2A 4CLZA 4ZPAA 4HUFA 3OVAA 2B9YA 4OYOA 3I55S 3O3HA 3FQLA 1D8ZA 5L1IA 4C8OA 4NLUA 5CYQA 5LMUJ 4TY8B 4O3OA 4NRUA 1VRUA 1Y3KA 3GE1A 2XI2A 4X4NA 1AW0A 2XZWA 2ZWHA 4KPYA 1WLJA 2KDOA 3P8BB 1CZ9A 2JC0A 2OHDA 3IP0A 1DQ8A 1DTQB 1QAIA 3EGWB 1HNVA 1YBAA 4NLWA 4WBFA 1Q18A 3G9CA 2JWKA 2BJ3A 2H54B 2DNMA 1HHSA 3QEWA 3QIOA 1YJ7A 4IQXA 3R9LA 4Y28C 1X4FA 2P9SA 2E2NA 4Q43A 3FEYB 2VG6A 2V52B 2X1FA 2YH1A 3NNHA 3WX8A 2DXFA 4PQUA 2A1BA 5LJWA 3KG0A 4ECRA 1WD6A 3J7Z5 4JI3K 2QG9B 3GJQB 3DLGB 3UVJB 2BMBA 2WVDA 3S01A 5E3RA 4I67A 1TV6A 1UVIA 1GLAG 4B1YB 1F3FA 2PT0A 4WP8A 3NDKA 4TLRA 4DSEA 4FYXB 4DR1K 4A47A 2W2PP 5KFMA 3EJMA 5LY3A 1BHLA 1B64A 3VEYA 1M5HA 3CD0A 3UD5A 3FZFA 4NYZA 2I2YA 1I3OB 2RUGA 3BDEA 2IDEA 5E0OA 1T03B 4JI4K 5AE2A 4OX6A 3QIPA 3ICLA 2AZ1A 3SCLE 4YNQA 3CCVN 3ZXWA 1V3RA 1TFYA 2VQEK 3SBTA 3TTDA 3H3OB 2DFHA 1WEZA 5B09A 1GTHA 2Z2YB 3C8YA 5SWMA 4XDCA 2B56A 4ZTJA 5F0WA 2CJ9A 5D3GA 2XMJA 5CZ2A 3I96A 3CCUN 2YWWA 3O6QA 4ZMMA 4DV1K 2F8SA 4NXNJ 2Z8QA 5ETTA 5HOOA 3KK1B 3T41A 3OSPA 4JV5K 1FKPA 4OYPA 1C4AA 4Y3CA 2ZC4A 3CC7S 4Q5VA 3Q8VA 4PUOB 4ZVQB 4FOIA 3UB5A 3H2UB 2V8VA 4I6MB 4ZPBA 3M9OB 2YTCA 1GX5A 5AQOA 4J91A 1HHQA 2IDOA 1RCOB 1RAAB 4HT5A 3SCXA 2QTDA 2V4RA 2GBZA 4AM7A 3A1YG 4K8RA 1VQKS 5IV4A 3RRHA 2RVJA 3BSNA 2MY7A 5DRKA 2UVVA 1VQ9S 4BLGA 2NYIA 2AEJA 1KP6A 2RHKA 1GLCG 4KHPJ 1N52B 3VGUA 4Y34A 4ZVFA 4OI4A 3C94A 1WBDA 1W2BM 3QFUA 1KQGB 4DV0K 1XR6A 4ECQA 3D7EO 4DV5K 2FJDB 1YHQN 1N34F 4H5RA 3QNWB 2UV8G 1HKCA 3IXQA 1KQKA 1XMOJ 5DM6Q 2XY8A 3U7JA 2NSBA 3W61A 3KMSA 3F41A 2X51A 2ZH9A 3NHGA 1RISA 2XY7A 1GLEG 1Q82O 3C0BA 3NCRA 2HHVA 1X5TA 3DRRA 4MIWA 3CDAA 3JSMB 3NGSA 2U2FA 4DN9A 2D0OA 2D7SA 2O8BB 2YWFA 4PWDB 3OJUA 2APOA 1NGBA 2G1DA 5KFGA 3VAIA 4OIXA 1SS6A 4JD2B 1YRUA 2BACA 1VSJA 5IFMA 2RHQB 1JLEA 4BE1A 3IS9A 5AFUH 4RZRA 2GZOA 5ADXH 1U1NA 1P1TA 3D0HE 2F9WA 1HJOA 2ABYA 3OYBA 1FNOA 2J8SA 3ZSOA 5ETMA 5EVZA 3PSFA 1V3ZA 3BKTA 2KN4A 2RQMA 2Q0UA 2HQFA 4H4MA 1QTMA 4KIAA 4DUYK 2QYGA 4ECVA 1H6KX 4NLDA 1CBKA 1RU1A 2F9DA 2XM3A 3D1QA 4LSLB 2VKRA 1FWLA 2E44A 1HPMA 4E7HA 2HNYB 3PEHA 4LF9J 4FK2A 5KQ8A 2DD8S 2XULA 2AP1A 2KZMA 2OFHX 1FRXA 5GAHI 6FD1A 3MR3A 3HULA 1IBMK 2OEKA 5LL6d 5GMEA 1U04A 4DR6J 1WEYA 3AB4B 3OHRA 4CJUA 1VK8A 1VCTA 3UCZP 3MAQA 3OTOK 2CNKB 3G6XA 1U25A 3QZ7A 2GAHC 3H45C 1N36J 5ETLA 1TU0B 3VEXA 3D2WA 4QIGA 3NEKA 4IOCL 2HBRB 5ETOA 2GMLA 3NMAA 4ANCA 4LF4K 3VR1A 2C2ZB 2WONA 2EG2A 3QAEA 4BRKA 3MMCA 1S0VA 4FLZA 1OJ4A 2Z57B 2XS2A 3RW7A 3MEEA 1L5UA 1S99A 4QYZJ 2FQQB 2ZZTA 4KHYA 3O9RA 3R1XA 4YMEA 1FRJA 4NXMJ 1LEOA 1HR0F 1YBTA 1RWMB 4YHHF 4PABA 1B3TA 1FXDA 1NHUA 1QVFR 5F2RA 2ATCB 4I4BA 2RB7A 3CO9A 1FEHA 3MPUB 1ZTWA 3H2VE 4JI4F 4AQYF 3SK3A 3PW2A 1XNRJ 1EWRA 3TAMB 4CHPA 2QJ3A 4KHPF 3ILJA 3S3MA 5FRNA 9RUBA 3ZZZA 2CQDA 2IYIA 4WQ4A 3VQEA 1VQPS 3KJQB 3OW2M 2WB1D 4CEZA 5ETRA 4BC3A 2QWRA 4V19S 1BQNB 4NXNF 3HZ6A 3FBEA 3MD3A 1IBKF 4JKHA 4EAHD 3WXMB 1IKYB 3AD7C 1U2FA 1XNQF 5BPNA 5GAGP 2JEFA 2PE8A 4M1KA 3KLEA 3NF6A 5KFBA 3JXUA 2BKNA 1YJWN 4D3HA 1QJHA 1TUGB 3ETOA 2N82B 4W92B 3LL3A 5HO4A 1O5JA 2AJFE 1TL3A 3FRZA 3AVFA 5DG9A 3W2VB 4MDBA 4M7XA 1RBRA 3WBZA 3O4QA 1ILYA 3I8DA 4LR8A 3LGNA 3KLGB 1IV0A 1EJ7L 3VTIA 3CJ9A 3GWCA 4C1NK 2AP6A 2A2CA 1IKWA 1RNHA 4W5NA 2HWIA 1VQPN 4PWDA 5BRHA 2HSEB 3AGKA 3G86A 1VHIA 1VQ6S 5IC6B 3UI3A 2WW8A 3WQPA 1HQUA 2Y0SD 4Z4EA 3OXGA 3PW5A 2BJDA 2GJ2A 3CQXA 2EK1A 2BQRA 5DDRC 4J9NA 3N6LA 3NOCA 1DEJA 4DU7A 3NF9A 2KVQE 3M8ZA 3MM8B 2IC3B 4A8KA 1FESA 1S59A 5F3ZA 1FX4A 5CXTA 2C2DA 1H2UX 3WDOA 4JK7A 2OI2A 3OQ2A 3CNQP 1JIHA 3BN4A 1GX6A 4YP3A 2FDNA 4WFXA 4XPCA 4A8FA 3RSEB 4KGVB 3BZCA 1PILA 4KJIA 1M0SA 2GVZB 3BGRB 3O4WA 4U8YA 3RMBA 1DRZA 3ZZOA 1AT1B 5JVHQ 5F41A 4K25A 3FE1A 1RE1B 5C2CA 5H1SQ 1Q16B 1HR0J 3QO9B 1NH8A 1V4SA 4CTAB 1WDTA 1BIUA 1LK5A 4WFNL 3O9UA 1TUVA 1Y10A 1T9TA 3AA5X 3PIOL 3DLHA 1MNEA 1C0TB 4DR5K 1UA0A 2E6MA 5B0BA 3TX8A 4ZVUB 2EWSA 4K5RA 2PSZA 1MU2A 3MCSA 4ZLNA 2HGMA 1YQHA 4PL8A 1LWCB 4CIFA 3V2UC 1GEHA 3ISZA 3GG4A 3D0GE 2HFVA 2ASJA 2BE9B 2VFVA 3I32A 5C7PA 3BPDA 1LAWA 1P9YA 1GXTA 2OPQA 2D1KA 1FD2A 1N36F 4DL2A 2UXDK 1NHVA 4A8XA 2JLFA 4H8KA 3OS1A 2HHWA 2B4OA 3QQCD 1UFLA 4X4PA 3AQOA 4O3PA 4H0YB 4CJVA 1VC0A 3I9ZA 2HNZA 2XEXA 2VGMA 1S5ZA 1HPZA 2G2OA 3GCXP 2M70A 3BQ1A 4DKWA 2EFVA 4GKKJ 2HZCA 5HQ8A 1UL3A 2MY8A 5JVHL 1K0VA 4JI2K 3C6AA 5EU7A 4OHXA 3CMAS 4DX6A 2R7WA 4NO7A 4RTFD 3D3CJ 2B8PA 1C1CA 3CCJS 3AVAA 3A5NC 3FMBA 2MEWA 4P7VA 3B6PA 4I6AA 1HBUA 2PMWA 3H1VX 1NAQA 2XHCA 3THWB 4ZJOA 5LJVA 2DXEA 3TJ9A 1J2VA 4LRFA 1QLNA 1L3SA 5E26A 1NPRA 5T7LB 4FYDA 3R1HA 3QRQA 1CVJA 3L7PA 1X4HA 4EK2A 4NYNA 2HURA 3BBCA 3BBBA 5ETNA 3V4IA 3SJJA 3MM7A 1SKRA 3T5KA 5E2QA 4DSIA 1VBKA 5J1EA 2QM1A 5I3QA 3TVKA 1RB0A 5KFZA 2FF6A 1IH7A 4GV3A 2BANB 3OYNA 1WKJA 3IRXA 4A5BA 1RWWB 3OV7A 5IXUA 5GMDA 1IM6A 4K50A 5FD1A 4DX5A 1VK0A 4FPBA 4ISEA 3UKUB 4KHPK 5K14B 1UWBA 2WVCA 4UY8O 4ED2A 2GX8A 3CIZA 1K47A 1Y9OA 4KHUA 2ZJRL 4XK8C 4DV2K 4DPOA 3DLGA 4DTXA 4ZK7M 4KAZA 1WKLA 1KWMA 4CF8A 3MI7X 5HRSA 5ETPA 1KAZA 1IBLK 4FKXA 1TKTB 3AARA 2W4CA 5DQGA 1VSKA 3IFEA 1G2EA 3AXMA 2BX6A 4CF1A 1H72C 2IPOB 3KNAA 3HP6A 3OUYB 1S3XA 2XZTB 3LPTA 1BOTO 5RUBA 5KG7A 4J37A 1N8RT 1NGDA 5C12A 2AYMA 2R2SA 1WTBA 3QIPB 4CLWA 3SV3A 1WSFA 1WC3A 3KIOA 5AQYA 3RVCA 1S9GB 4FJ9A 2FBTA 2ZH7A 1CJTA 1S97A 3THYB 4P7TA 3LANA 4ECSA 4C0HA 2ASOA 2F8TA 2CPHA 3DI6A 1FWPA 3QGGA 1WOSA 3AFGA 4B9LA 2L9NA 3DGVA 4JK9A 2P9PB 2C3PA 2VG7A 2Z2LA 3CJ0A 3QGIA 1M1KO 2K1RB 4OVLA 3OTBA 5JICA 4WF9L 5EN1A 3IR7B 3UCUP 3BN7A 2HYIB 3CVKA 2NS1B 2E5HA 3ATUA 1Q7YO 1HKBA 2HFZA 1MA9B 3AVNA 1RKIA 1RT2B 4WYLA 4LF5K 4B3TJ 3JTOA 1NJIT 3K5PA 3U9DA 2AEFA 2DXDA 2NLXA 1VQNN 2H3GX 2B4PA 3V6KA 4CFDA 2AWZA 3IDHA 2ZITA 4CJTA 3W62A 5D4LA 3SFGA 1H98A 3E01B 4OL8A 2LDYA 4OX8A 1GMWA 3MFIA 3H7HB 2CZ9A 1NXIA 4CLTA 4DG1A 2QK9A 2VBZA 3HSTB 3NVMA 3WNFA 5KPTA 3Q7BA 3AAWB 1A7GE 4CRJA 4ER8A 1ZBUA 2EBEA 1C1BB 5AE1A 3V9WA 3MN5A 4DL5A 4HHUA 3VGLA 3BO4A 4FPIA 1BGXT 3PZPA 3DHWC 2DY1A 4TYAA 3PO4A 3NGIA 5G0RB 3SAGA 1RWKB 3DRPB 5EUHA 4PWWA 1Y0HA 1L3UA 1FVQA 1FTRA 3TSQA 2VH7A 2H4WB 5M2UA 3FFIB 3BR9A 1N33J 1TL1A 1HIYA 2MLZA 3IM9A 1GLLO 5EDWA 3MEGB 3LGHA 3A0IX 3SQGB 4PKDB 2OEMA 4H5WA 3QATA 3BREA 4FLUA 1RP5A 2IRUA 3HM8A 2JLGA 4ED8A 2FVSA 3O3FA 4AE5A 4JI0J 4IWVA 3FBCA 2XS7A 2OCEA 4USMA 5HBMA 2DVIA 2V7YA 3IR5B 3A5LC 3PDNA 4AFFA 4YY3K 2XS5A 2ZNZA 1ZPVA 3VAGA 2KJWA 1NWKA 3MF5A 2YX6A 3IAYA 4MJKA 4CF0A 4DQSA 1HYSB 1WHVA 5K8NA 3PV8A 1GOBA 3K8WA 3DOKB 4KB7A 2GGPB 5AQTA 3MXJA 5HMXA 3OW2R 2AJ4A 1IKWB 4BREA 4LFBJ 4LF6F 4YDXA 2G1HA 1YJ9N 3UN5A 2DO0A 4I7FB 2FTRA 3S41A 4BRFA 5LSRA 2NXNA 5HAOA 1NK8A 3IWNC 1A5XA 1AXQA 4AT1B 2GA7A 5A2QO 3DJCA 2O8BA 1WJ9A 3B8HA 3CFRA 2DH9A 5KT5A 1ULRA 3V9UA 4A57A 2DNHA 5GAEU 4YHHK 1HNZK 4F04B 3A2FA 5DGBA 1CLFA 4ZVGA 3F9MA 3DU5A 4X4UA 1NU0A 3DXBA 3GIRA 3HHLB 4F3OA 3PRDA 1XI1A 3LH2S 5DLGA 3W3DA 3T5HA 5BR8F 4JEPA 4A59A 2P5GA 4I64A 1V3SA 3L4BC 1N32K 5CCLA 5KT7A 2JEGA 1N88A 1TL4A 4TLQA 4CBXA 1SC3B 1C0UA 3SMZA 4DR3K 2PC6A 3Q8UA 3F44A 3NMRA 4BDZA 2D69A 4W5OA 2G8KA 5F9LA 3SXLA 4O8UA 4E7IA 1IBMF 5A8RB 4B3SK 2MQNA 2O8CB 3E2EA 2P9NB 2RHSB 1GK8A 4FZZA 2CADA 3Q2TC 4H0OA 4HTUA 5B0CA 3LOUA 1NGEA 2PIIA 4OGCA 3M4XA 1W7WA 1Y4ZB 5C2FA 1DLOB 1SIWB 4M8LA 2RH3A 3I4HX 2MZ1A 4JV5F 2ZBQA 5A2QU 3K59A 4FVCA 3OJSA 3KVGA 4J9PA 2IAJA 4GVBA 2LQBA 5ADZA 2PMZD 1NGIA 2JEJA 3C65A 2K3IA 3U8XA 4AXIA 3CCLN 2CQBA 2F1FA 2IBOA 3MDQA 1RADB 3CD5A 4NXMK 1VIOA 1CJUA 3I5CA 3AA9A 1QSSA 1HUXA 5DO2A 2WAQD 1T03A 4CW7B 4EZ6A 4OKEA 2XLKA 2BYCA 3BV8A 4FCYA 4QWBA 4NA3A 4BVPA 1VRTA 3W2WB 1WSJA 2VWBA 4LFAF 1CJVA 1LW0B 4CECA 3H3NO 3VESA 1WHXA 3KKRA 3G71N 2OEJA 1ZYQA 1SVDA 4A2AA 4MO5A 3LUYA 4KBOA 2XMMA 5F3TA 1SH2A 2P9EA 3IR6B 3SUQA 4RW8A 1X9MA 2W40A 5D15A 1O0PA 1T44A 1SAZA 4CEFA 2GV9A 3AO1A 1RDRA 1ZBIA 3D2FA 3AODA 3JQJA 1CXUA 5GINA 3HVTB 2UUAF 2X6NA 3U3GA 4CEQA 3IMXA 5KT4A 3O6WA 3QJLA 1FKPB 4LFAJ 3CCSN 3BH6B 5T7LA 2VF3A 4HACA 4C6AA 2FY1A 3TWHA 4G65A 1YZ7A 3A12A 1UJ6A 3PRBA 1RAGB 4UZCA 1X4GA 4CEAA 3ZTPA 2MKYA 1ZBTA 4KGMA 3AA8A 3R5CA 1HNVB 3Q8SB 4C3LA 3QNOA 3G87A 2BQ3A 2CPFA 4CH0S 1PSDA 4NWBA 2WHOA 3HPOA 2BANA 4M5DB 1JXEA 2UXBJ 1R7IA 4Z7YA 1YXQA 2E9RX 1RLCL 2P9SB 3RBDA 3OFEA 5DDQC 2HBMA 1O1WA 4M5GA 4FS2A 1CPZA 2F8HA 2ATLA 1DTTA 1W0HA 3IO1A 1RT6B 4CTAA 1VIXA 2M5YA 2AZ3A 4LRDA 3QICA 3M2RA 4A8WA 4CFCA 2MXYA 4O4GB 4RWXA 5IWAF 4B3MK 3FVYA 4AYBD 1VI7A 1R27B 3UN2A 3KHGA 1M5SA 4KHSA 2FSKA 1TV6B 2VC1A 1VHXA 2M52A 5BR8K 2LU1A 1S9EA 3FK4A 1YLXA 4FF1A 5CZVA 1YDLA 5HRNA 2OPSA 4FOEA 3MM9A 3GYNA 4BDYA 1QVFM 4RNMA 5B0FA 3T3FA 3C6HA 5I3UB 1T9XA 3QIDA 3DM2B 1R6YA 4FVUA 2HG4A 3VQPA 4CZMA 3L2RA 3W1YC 3IBWA 3AJ1A 1XQIA 4RW6A 2GIQA 5HQLA 2NNWA 4MIBA 2HHSA 1WOOA 2P9KB 4NA2A 4DZDA 3SI6A 2DNGA 3M30A 3DGPB 1RYRA 3HHNB 3UE2A 1CXQA 1S6OA 3R5AA 2HHUA 2JFDA 2HPUA 4X4RA 2ALZA 2W9AA 2CGKA 2EW9A 3OR2A 1TVRA 3ENWA 2PGCA 3ZETA 4ID1A 5BN9A 1N5TA 2Q36A 4U7CA 1F21A 3QO9A 2IIHA 4NXMF 3EY1A 1RT5B 1KLMB 3LM9A 5DGAA 4CI6A 4BR0A 3M7VA 2M2BA 1RKJA 3I5BA 5F8LA 4E2FB 2O01C 3HMJG 3T1HJ 3QGHA 1YJ9S 2E1YA 4NA1A 2CGLA 4Y00A 4DV7K 2CNLB 4F8RA 3D6RA 2A0FB 3C15A 4OZJA 1Q0NA 1Q86T 4M3UA 4RUBA 2DHXA 5L9XA 3IAM9 4IOBA 1IM4A 4DR4J 5C15A 5L46A 4RUCA 5IQQA 3AD9C 5DS7A 2OPQB 2KB2A 5M1KA 1FFSB 2EHGA 4CLPA 4B1VA 3H20A 1S1XA 4X4QA 4JNEA 1EAYC 2BVZA 3PYFA 1I1GA 4YOWA 4ZITA 2KH9A 3GOIA 3DLKA 2QEXS 4LSNB 4OZLA 4A62A 1U0HA 2MJUA 1TR0A 2C2NA 3TANA 4ID5A 3MPYA 4DOZA 1HNXF 4DCPB 4QAGA 2XMVA 4CM0A 4BGAA 4DUTA 4DPXA 1DQAA 2O8EA 3FCVA 2J4RA 4KE5A 4OYMA 3EZ5A 5ITHA 1JLAA 3K8VA 5AXMA 4NMXA 3ILOA 1IG8A 1H38A 2MPUA 2XCPA 1VQ6N 1EO1A 4C11A 2BV3A 1G1XA 1QZ6A 3EXYA 5TKWA 4MYUA 5CR4A 1VGYA 1RHMB 4DV0F 1BCOA 3BKFA 1YJWS 3MEDB 3MMBA 5KFAA 4P72A 4ZLJA 4BWJA 3LW5C 3SUOA 2YJFA 4Y1DA 3OTCA 1KS2A 1R0CB 3NGRA 4BRGA 3NFAA 4DS5A 4PEOA 2FJVA 3GG1A 3O8MA 4Z4FA 2ASMA 1AB8A 4IO9Q 4NLGA 5B0DA 2Z1HA 3ULHA 3R7BB 4HKQA 3EPGA 2BJ9A 4JK8A 2EWHA 4CJPA 2GWKA 4RW7A 2DT9A 4U96A 3I56N 5LSOA 2C2OB 3VEZA 4YOTA 5F0UA 4DV6F 4CFBA 1APSA 2P6SA 3Q86A 4K0KK 3ZTSA 4FYYB 4FJIA 1NOZA 5BR9A 1JCEA 2PBDA 2BA9A 4RW9B 2FHJD 4ZP7A 1ZOTA 2ZJPQ 3S6EA 5M1FA 2UUTA 1M5VC 1WC1A 2RKIB 3PX6A 5KG1A 3K5MA 3P4IA 1VISA 1H1VA 2DR5A 4DR3F 1UVNA 2G8IA 2ZOFA 1F9FA 1DQ9A 3IM8A 2WBMA 3R5GA 2ROEA 4DR2F 3ZZUA 1HQEB 3D45A 4CJ4A 3HHLA 3CE8A 3OYMA 2KFYA 1M5KC 3T1HF 4CGGA 4FWQA 3PYDA 4CJQA 2RQCA 3U27A 5ETQA 1SJFA 2CWKA 1Q5YA 3M32B 4DG1B 3O9QA 5HROB 4U9RA 4EFHA 4TKTA 1UVMA 4S0MA 3DGPA 5AQXA 3ELHA 3VQSA 3B4MA 2PFDA 1SH3A 1FK9A 4NRTA 2G9OA 4OYZA 3QBXA 5CE3A 4K59A 3H5XA 1IUJA 1NGGA 1T94A 4M3TA 1R0AA 3VEOA 4CT8A 2I38A 5IM0A 3OY9A 1VSMA 3MUVP 5FPMA 4N5SA 4MTPA 2R7OA 3KFWX 2ZGZA 3TABA 4F0MA 4KO0B 3MAAB 1N5YA 3OHBA 4B8AB 3TUIC 5JS2A 1F5AA 1SJQA 2HF3A 1HBOB 2FLNA 1XERA 1YITS 2YNIA 2O1PA 1VC5A 3R1LA 1DARA 4K43A 3PUFA 2NUHA 3BQ2A 4JI3F 2I9SA 3HBTA 3C15B 1YTAA 3R3LA 2UZAA 3ZX2A 1VQ8S 1X4BA 2GELA 4CO0A 3TZZA 1HI1A 3D0IE 2ZQBA 1J54A 4J9KA 3MM6A 1P27B 2N4CA 3H40A 3QEPA 4I6MA 2JFKA 3CJ8A 1KEKA 5KFIA 1S1XB 2MQQA 2HBLA 4J9UE 1BCMA 2KT5A 4NEYA 2E4LA 3KNGA 4XPEA 2YH0A 3CGIA 4CZJA 1WHWA 4CJKA 3R8YA 4DSKA 4O44B 3IG1B 1PAEX 4IJAA 1RHRB 4ZLLA 3KJNB 1DGKN 1JX4A 2DBBA 3OLAA 3VPZA 1QSYA 4BDPA 3CJRA 2DPNA 1LWEB 1UWBB 4ECYA 4M63A 4C2MA 1VQOS 5KGWA 4E89A 1SQKA 2GMHA 1HX1A 3CCQS 1NJZA 3K9JA 3QSYB 1H7WA 3EX7B 1WG1A 1RHJB 1BLUA 4X65K 3V6HA 5L9NA 5DQIA 3HVTA 1YJNS 1W2BR 4PG5A 2MQ8A 3HFZB 5LJ3Y 3BKUA 1Y5IB 3Q24A 2WB4A 4O3RA 4F02A 5L38A 2QKKA 4DV4J 1K1SA 5E33A 2YNGA 5ADXA 3F56A 4LVNP 2FVCA 4YN3B 1J5EF 2GIRA 4J2AA 2NRTA 5CCMA 3D0PA 2AJ1A 4CYUB 2LKZA 5AQWA 3DKDA 3QEIA 2PFFB 2ZNYA 2CXEA 2V68A 4EBCA 4B9TA 1V4TA 4BRLA 3SBGA 3CJ3A 4FW2A 5BRDA 1CJKB 4DL3A 3KLIB 2GVDA 2P51A 5HANA 4FWRA 2C42A 5CD4H 3H98A 1CQMA 1WTFA 2VQEJ 1O6XA 2WBNA 1YG0A 3NGDA 4K4XA 2QA1A 3TEGA 1I94J 4ILGB 4LSZB 2VODA 3D54A 1C0MA 2WC9A 4WQ5A 4DI6A 4CJEA 4QR1A 4IFYB 2VPXB 2NUBA 4OMFG 3L9ZA 3D2EA 2EKYA 4KHNA 1MU2B 4FLWA 3P31A 2R3VA 1MSWD 3AXKA 3LPUA 5LMUF 3TUZC 2OANA 3HD2A 1OO0B 1LWCA 3IGVA 4AD6A 3QJJA 1HBNB 4DX7A 3UO0A 3U9ZA 3KJVA 1NB7A 3DXMB 3M32A 1VJWA 4USHA 3AO2A 2ZE2B 1V6HA 4CO1A 4OZNA 5KFFA 4JV2A 1WI6A 4U8VA 4LFBK 1VRTB 1Z6RA 1NKEA 5D0RA 2VJUA 1CJVB 3BGOP 2MQPA 4F3QA 1IN0A 5AJ3K 4HTJA 5C2GA 4K8ZA 1C0UB 1W25A 3NY0A 4CP5A 4ES1A 3TR5A 5IT9Y 4GO5X 2HOEA 2AJ0A 4JS5A 4E19A 4FWLA 1U8SA 4XH5A 2C3OA 2P9LB 5A8RA 4N8NA 3SDEA 2ZDPA 4EO6A 3OR1B 1RCXB 3NNCA 3P1GA 4NCAA 2QWLA 4LR9A 3A4TA 4KGKA 2J0XA 5KFRA 3O1LA 4EEYA 5BR8J 3L0QA 3FFIA 3ASMA 4PKGA 1NK9A 1B4SA 4HH0A 4UTGA 2BM1A 1ZM4A 4KV8B 2HMIA 2P9GA 3SQGA 2EXUA 3NAEA 2ERRA 4ATNA 2GEMA 1Y00A 1D9FA 1Q79A 5A0YB 1PAUB 1RSCA 5LM7E 1T0TV 2F4VJ 1QY7A 4EFAC 4DR6K 1WSGA 3GR1A 4ICLB 1JWWA 2AU0A 2F9TA 4CNZA 3A8YA 3ZX0A 4F4AA 3RB0A 2HQIA 2AF6A 2NPFA 4BS2A 1KD1T 1ZC6A 4FZXC 3N6NA 5DQHA 5AQGA 2Y1IA 3R8EA 4GVLA 2YY3A 2MZJA 3VHQA 5D0EA 1L3VA 1D9DA 4W4MA 4GVEA 4DCOB 3R6LB 4RL1A 4JI6K 4ED7A 2G8FA 5HRPA 1Q8KA 1Y7PA 4EYHB 3VQBA 1REGX 4ILMA 2XLIA 4K4UA 3RW6A 5T14A 1SV5A 1EX8A 1D8YA 3WEEA 2EK6A 1IBCB 5D4NA 1N33K 2UXCK 3CF5Q 3EZUA 1G6BA 5FPDA 3CCLS 3MM9B 1ESVA 3V1RA 2DNLA 1B0PA 2ZBRA 1KC8O 1HWLA 2DNQA 5KFNA 3POTB 4LR7A 3LAMA 4RU9A 2W7OA 1BXNA 4Q8EA 4WZQA 3OYDA 3Q8QB 3QRPA 4F50A 2VU5A 4CE9A 1NJWA 1SL0A 2FHKA 2ZUGA 2NUUG 5U47A 3QLHA 3QT5A 5BYRA 2GW8A 2BGGA 1S9GA 4OX9K 3HFKA 3G71S 5GIOA 5KFHA 3OL6A 2FPHX 2YQ3A 4ZKAA 1N5QA 5SUHA 3ISNC 1NEEA 2Y8YA 4FM0A 3OFGA 4LF8K 3SAFA 1ITGA 2H48B 2O5DA 3F2KA 3HPHA 3D3BJ 3ZSQA 1N54B 2XO7A 4C3MA 2QO3A 3CMES 5AZIB 5F1XA 2C2MB 2W41A 4IRKA 2BKOA 1VSFA 2CA9A 1N34J 3VGMA 2BBEA 2JDJA 3W5XA 1LOUA 2DNRA 4CGIA 2P6TA 3J8AA 3ZT4A 2X1GA 3H2LA 3PHTA 5A8KB 2I0XA 3NG8A 2RJZA 3VF6A 5JXSA 2ZH3A 1JJ4A 2FSNA 1EX4A 1VSIA 3ENBA 1HLUA 2J7KA 3PSIA 2PA8D 3TEHB 3K2PA 2IJFA 2OD6A 3ZEUB 1KTVA 3HK2A 2HBZB 4FJKA 2UXCF 3S9HA 3G6VA 1FFGB 2P9KA 3DMJB 2H51B 5AT1B 3M9NB 4RNFA 4AL7A 4IG3B 1OVQA 4OPKA 3ZETB 4DN0A 1QAXA 2E2OA 2ADBA 2E29A 1T9YA 4OZ3A 3TARA 1YWXA 2D3OR 3E9LA 2R7RA 3NCIA 2MHNA 2CPYA 4AHSA 4ZP6A 4A4JA 3ISND 2N4DA 4W90B 3CC4S 1HBUB 2IM2A 4RJVA 4F67A 5I4MA 1NSAA 2VPYB 5IT0A 4DWIA 4X84A 1P1LA 3TQ1A 4ELUA 3S3NA 1YIJN 4DPYA 2LMIA 1YJUA 2LXIA 4DMNA 1OKJA 2DGWA 4B1ZA 1F9HA 5I9EB 1KOHA 3JB9k 3PIPQ 3TA0A 3NF7A 3NWRA 1RAHB 1TGOA 2VOOA 4J9RA 5E7OB 1DBDA 4HH1A 2R7TA 3LZIA 5DG7A 2DTUA 3PG9A 3SNNA 3IBCB 3QNNA 3QT7A 2GQCA 1RT6A 1O8BA 4MLEA 5KGXA 3HTVA 2F7VA 2W2QP 2R7SA 1EWQA 3DDNA 2ZD1B 4USUA 5HJXA 3WXLA 4M5JA 2VQEF 1SXLA 4OHVA 1DURA 2RF2B 3GIJA 1VQSA 4D3GA 3OL9A 3HXMA 3F5TA 2CJBA 1RTDB 3I0RB 1CLQA 3IS9B 3PJ9A 1LCUA 1JXVA 1C2PA 3VGVA 1NHKL 4FF3A 1WC4A 2XCAA 4CJFA 1RXOB 4OI0A 1KCFA 5I3UA 2B4VA 3KHLA 4RUHA 1NK4A 2UXDF 4PXDA 4EHTA 4IG0B 4DUZK 3EWGA 1RWVB 2FZCB 2QLBB 3FEZA 3LDQA 3ZX3A 4Z4CA 2E5LJ 1H2TZ 1Q9XA 2M8HA 4MFBB 4OHZA 2HVIA 3M30B 3VF0B 2G2ZA 1FNXH 1AA1B 4UF4A 1REVB 3OYKA 4HHJA 5TKYA 2PI4A 3ZSWA 1ZBLA 3VQ9A 5MAOA 4YR3A 2E7VA 2IHR1 1OH5A 1JJ2R 5IQ6A 4UUXA 2F8EX 2YNIB 2NRXA 1U24A 1VBZA 3JSYA 4FYVB 1RTZA 4AUKA 1UVLA 5F8HA 3LP2A 2U1AA 1XMOK 3HRGA 4RWWA 3PJWA 3R5DA 3K0SA 3TRGA 1GLBG 2IAJB 3HHLC 3MWBA 4X2BA 2FVPA 2HHHJ 1TUUA 2UYTA 2VDHA 2EG1A 4JUZA 1WSEA 5E3QA 2B6AA 2PN6A 3NH1A 1VQ9N 4R79A 4PHTX 3G8SA 4X66J 1LXJA 1SI9A 1KHWA 2DNZA 2G2YA 4UW2A 5H9EJ 1FEEA 1HLWA 3AAPA 2F8MA 1FJ7A 1F3VA 3UPFA 3W2WA 2G0JA 3SV4A 5C10A 2E66A 2HIYA 1FDBA 4WPAA 4Z37A 3NXZA 2HFSA 2V2QA 1TUYA 3TVYA 3ENVA 3D1OA 2IMOA 1SZ2A 1NJIO 4B3OA 1NM1A 4FLVA 2YV0X 3OT9A 3NCQA 1OPZA 4IO1A 4PPDA 2XSFA 3AVIA 3NL0A 1N5YB 3NNAA 3HI0A 2QYCA 2BZ2A 5AQQA 4WFNQ 4B9UA 4A5AA 5HMWA 4JV1A 1MWYA 3ID6A 1NBWA 2HK2A 4M3WA 1RFQA 1ICEB 2QFIA 4HR2A 4ECTA 2H5IB 3M8RA 1IKXA 3RZAA 2AIRB 2ATQA 3CERA 2XY6A 4U7UD 3CQYA 1VDHA 4X4TA 3M6XA 4JKEA 1SBRA 5J2MA 3AT1B 5GAEP 3HT0A 4NLXA 2XRIA 4BHQA 3E66A 2YKMA 3ENQA 5GAGI 5B7WA 1T11A 2VONA 2GHWA 1TL3B 2CWXA 5F8NA 4GVMA 4FWOA 1SQEA 2F9JA 4TU8A 1SKWA 4DQIA 4I2QA 2Q1NA 3CCMN 4B1WB 4P2FA 1WSIA 2JGUA 2B9XA 4NCGA 2Q43A 3C46A 2XMWA 1KHVA 4DLEA 1YX2A 4G6VB 1EQMA 2RMLA 4JI2J 2RKIA 3PFOA 2HEKA 4FZVA 3RG6A 3CM5A 4G1PA 4DV3K 1IO2A 4OYXA 1B99A 2R8GA 5K20B 4KB1A 5D78A 1UVJA 2VQFF 5F0XA 3OTOJ 4USIA 2XGPA 4CVNE 4DV6J 3L7OA 3QRRA 3JXOA 2ITGA 2BR0A 2GFFA 3RMAA 3POTA 1OIAA 5AXKA 3GTYX 3AVJA 3CC4N 2HS0A 5KI6A 1CEZA 2HNDA 4DV2F 4KFBB 3CIPA 5CYJA 4NLBA 2DY9A 2R7VA 5J2NA 4HLBA 1AZSB 2CPDA 5D6GA 4WZMA 4OV6A 3CMAN 2O8FB 1ASUA 4H4MB 4CLSA 2QSWA 1VQ7S 4BC9A 5IWAK 1LWXA 3I9V9 4XDDA 3NE6A 1PYOB 1O13A 4H5VA 4CZLA 4NX9A 4E8UA 2QE5A 4DFJA 3OR2B 3CW2C 4K0KJ 3VGTA 3H5SA 2A6AA 1XNRF 1RAFB 1SUQB 2HHHK 4YUDA 3VQ8A 2FVRA 1NU4A 2YBVA 1NM2A 4F4ZA 1SIZA 1M1KT 1F60B 5KAKA 2NZCA 4YY3J 5IWAJ 1BA1A 2KHCA 3HDSA 5HK4A 2OP5A 1RBUA 3IMQJ 5BJRA 3CTRA 2NZ4A 1TQLA 4GKJF 4H0XB 5M1PA 1U1LA 3ZTRA 3FSIA 2X3DA 3HHDA 5A8KA 5KT3A 2KRRA 3M6GA 3CCMS 3AO4A 4C4WA 4U6PA 2UVRA 1R8HA 3L95X 5A76A 2MQOA 4Q0BA 1YVFA 1UPMB 1PC4A 4RBVA 5F8GA 3GZ7A 3EXCX 1VK3A 5M1QA 1JLFA 4NB4A 3WQTA 1T6CA 1D4XA 4FM1A 4CERA 4RLEA 3TZWA 5BN8A 2D1CA 3TSPA 2A3ZA 2D3UA 5KFLA 2ZM6J 1MN7A 1WC5A 1GQEA 1CULB 4CHOA 3EL2A 2EI5A 3WC2A 3FKBA 3CD6S 1PKUA 4PRFA 1RTHB 1HNZF 4WIQA 4Z7CA 3OFFA 3C2PA 2LQ8A 3I0SA 3QEVA 2QLXA 1HKGA 3FCHA 4FNHA 3MXIA 5L1JA 4HVZA 2Z1JA 1JL2A 3H08A 2IVYA 4K4WA 3TVZA 4PKIA 3DLLL 5CZ1A 4JD2A 2KXHA 3HX9A 5IT9U 3DOLB 1EETA 2HWTA 5J2PA 1TL7A 1VQNS 1MROB 3LPEA 1RDCA 3WXJA 2YHAA 2IRXA 3TTFA 1D1UA 4XAKA 4H4KC 4DF4A 4E7JA 4DTRA 2YKMB 4C0OC 3Q8PB 3EGZA 1S79A 1Z05A 2O8DB 5A6WA 4NYFA 3OXFA 1RTJB 1HHTP 2EX3A 4OHWA 2I7PA 1VRQC 3GJTB 5IT9O 2B9WA 5AQUA 3J81U 3GFHA 1X3MA 3C19A 1XMQK 3SQ0A 4R5PB 1S10A 4M5DA 3BBFA 4UZBA 3AGRA 3CPWR 1X5SA 3FQKA 3TYTA 1L3TA 1OPIA 3K17A 4PQUB 4RNHA 1RT3B 2GJIA 2W25A 2I6WA 1DTTB 2CRLA 8ATCB 2KLAA 3CXCR 2ILYA 3CJSA 4L75A 2F4FA 3BO2A 4RBTA 3J7AP 5DM6L 4OJ1A 2RIJA 4ZP8A 4IKFA 2AD9A 4ZP9A 1WG5A 3U02A 4ZPDA 4M5MA 2DGXA 4HI2A 4JI7F 3ITHB 2VQFK 5A2QY 2HAFA 3LP1A 4ZIWA 1CZBA 3K5OA 1JLCA 3WXKA 2OPPB 2OPSB 3MM5B 4AHUA 1I3AA 4CDIA 3DN9A 1UAXA 1DZ5A 2I1RA 5HRRA 4NASA 1B92A 5LSLA 3ALYA 3MXHP 1TKXA 2W9CA 4FJLA 3GV5B 2CUYA 4RPFA 3EO3A 3GL1A 1N36K 3NGUA 3TI0A 1YTUA 4FWKA 2X1BA 2IIRA 5IM0B 4GV6A 2VG6B 5DETA 2XGQA 3EKSA 4M3XA 4PPZA 1TKZB 2AW0A 1Y5LB 1S6QB 3TA2A 4GV9A 1BQXA 3LWMA 4IFYA 2J9EA 2CPXA 2D9OA 5HLFB 3VGKA 4BR2A 2KFZA 1HQ2A 1S6PA 1U1KA 2G0IA 2XSJA 3M8YA 1TL5A 3HZEA 1U26A 3FFKB 3HYFA 1RWNB 4CGDA 4N47A 2D0PA 2MKCA 2R2UA 5A8WB 3PKYA 2ZVIA 3E3XA 1H7XA 1K0TA 3GFXA 3O2IA 1YVUA 3I8BA 4QWCA 2GQ2A 4C8NA 2AHOB 1XBWA 3UDCA 3AOCA 4DX8H 2QLJB 4KTQA 1K6YA 2AX1A 1K8KB 1UW9A 5ETKA 5AXNA 4NLCA 5LXYA 1KVAA 1YKWA 3G8TA 3ZSRA 1FA0A 1Y11A 3CETA 2Y0BB 3L2UA 3VVTA 1EKEA 2B3TB 4FN5A 4ECZA 1UP1A 1NGCA 1F2GA 4DQPA 3DRPA 5I42A 2KYZA 2X1AA 1RQ0A 1IBKJ 2GMJA 2W01A 2LYVA 3P96A 4IH6A 2IOCA 2YVSA 1XTZA 5LL6Z 2GJFA 1RTDA 1NGAA 2QRRA 3TP2A 3FLCO 3VGSA 2MZRA 4C8LA 2VBXA 2QX0A 1T05A 1KONA 2E1RA 1D5AA 4K7QA 2YNGB 3T1AA 2K8GA 6AT1B 5M1OA 2R7YA 4LFCJ 2O8DA 4C11B 4LF5J 2KO1A 3Q22A 4OKJA 1KR4A 3MPWA 2GAGC 3MEDA 5GAHP 2UUCK 3UR0A 1RHKB 3C16A 3J7YU 2HB5A 3FBFA 1NDKA 3RAQA 1U49A 3CC2S 4WF9Q 4E1MA 3RB4A 5H9FK 1S1UB 4FS1A 1KAYA 4RG8A 4OLBA 5EWGA 2FHMA 3VTHA 4B02A 1D3WA 4DV1F 2HBKA