1HYSA

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
total genus 119
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hysA05
1S0OA 2FBVA 5KFXA 1ZBFA 4RW9B 1I39A 1J5OB 3MEGB 4NLVA 3AO4A 3C6TA 2R8JA 3PZPA 5KG4A 1WSIA 2OH2A 4O4RA 3V1RA 3OYNA 4YQWA 4HUFA 4E7LA 1VSMA 3CDUA 2QK9A 3QNOA 2IC3A 4HCCA 3KLFB 4YR0A 4LSNA 1D9FA 3VQEA 4W5QA 1N5YA 1WLJA 1NOZA 2ZE2B 1HNIA 4JRPA 3NBPA 3OYHA 5KT4A 1RT1B 2FVSA 3V6KA 4XPCA 5KT7A 3CO9A 3UIQA 3OYCA 4IR9A 2OA8A 4NLOA 1RBRA 3PHEA 1WNEA 1K1SA 1A5XA 2E9ZA 4LY7A 4JV1A 3MR5A 5L1IA 4JRQA 4DSEA 1IKXA 4ZHRB 2ILZA 4CJ3A 1VSFA 2X6SA 2WK4A 3KD5E 5J1EB 4J9QA 4O3RA 3ISNC 5KG7A 1TVRA 4B8AB 4QCLA 4DL4A 3H2LA 5DQHA 3HVWA 4IOBA 1TKXB 3GV8B 1RT6B 1S9EA 3AVJA 2A1SA 1NNDA 1T8EA 4FJNA 3AO1A 1VSKA 3AO2A 5C25A 1WAFA 2XCPA 2PYLA 4JV2A 4FW2A 4B3OA 3PW2A 4FLWA 1KHVA 1S1XA 3K5MA 1S1WB 4F4ZA 1RYSA 2IM0A 4CIGA 4IFYB 2ALZA 3N6MA 2R8KA 5KTQA 3CJ0A 2F8EX 1TKZA 4F4XA 1I3AA 3OYFA 1TL3A 3HPOA 2E9TA 3OYKA 4RW7B 1SUQB 3N6LA 1DTTB 4OL8A 3DLBA 3QEVA 1BI4B 1GX5A 4KHUA 3Q8SB 1BQMA 3OL7A 1JL2A 4W5TA 3VQAA 3TR8A 3GIMA 1BQNA 4CEDA 2AX1A 4F4KA 3IS9B 1J54A 1J9AA 3OLBA 3G86A 4KI6A 3DMJA 5KFNA 2VG5B 4HKQA 1ZBLA 3VQ5A 1QAJA 4WZQA 3CM6A 4KHMA 5KT5A 1YVFA 4DL7A 3VQ4A 4I2QB 4FCYA 3RMCA 5HROB 2ASLA 4ID5A 5KFIA 3KD1E 4GVMA 1S1VB 4E7KA 4CE9A 4LH5A 3PVXA 5DGBA 2VG7A 1D0EA 2W9BB 3H59A 5I3UB 1C0TA 2FJXA 3ULDA 3B6OA 2WOMB 3V9UA 4ECWA 1X9WA 4CJLA 1A5WA 2YNHA 1JLFB 5KFOA 1D5AA 3BGRA 1NKCA 4IG0A 5C42A 4NLSA 4K8XA 1YT3A 1F21A 2RPIA 2R8GA 1N4LA 2V4RA 2HNDB 1XC9A 5KFQA 3BDPA 1RT5B 3O3HA 2F8SA 4HHTA 4EYHB 1Q8IA 4DL3A 1WSGA 4FVMA 4WE1B 1IKWA 3LALA 1JL1A 3KK2B 3TANA 3T1AA 2HMIB 1LWCA 1T3NA 3DM2A 1JLQA 4G1QA 4MKAA 3E01A 4URQU 4Y3CA 3NF7A 3RB4A 3SYZA 4B9NA 4CCHA 5L9XA 3NGYA 3SUOA 1GX6A 2G8UA 1TV6A 1CXQA 4M3WA 3P1GA 4TN2A 3M9MB 3KNAA 1ZTWA 4B9MA 4ED2A 3QIDA 4DLEA 5KFBA 3CJ2A 4M41A 3OS2A 1UWBB 5KFMA 5EU7A 1KTQA 4KO0B 2AJQA 3O4NA 3OYAA 1S0MA 1C0UA 2P5GA 3L2VA 5CZ2A 3C6UB 3ZSXA 2AU0A 2JEJA 4CHQA 2E6LA 3OHBA 4AHVA 5KFKA 5F8HA 3DLKB 3T5HA 1LW2A 2IDOA 4WFXA 3U3GA 4Q8FA 3ZSYA 4CJPA 4IG3B 4Y1CA 3WNEA 3NAIA 2HNYA 4NLRA 4MFBB 2R2RA 4GC6A 4ELUA 4J9SA 3UPFA 3TAMB 4J2BA 1DTQA 3IG1A 4LQ9A 4N76A 1A5VA 1XI1A 3QINA 5KFZA 3RMBA 4FJKA 1KFSA 1BCOA 1RBSA 3VN5A 4I7FA 3NGDA 3NMAA 3NH1A 3BSOA 3RBEA 3AA3A 3CFRA 3FDSA 3V9SA 3KHHA 2J6TA 4AHTA 4NLUA 4F3OA 3OL9A 4DTSA 3MXMA 1N5YB 2ILYA 4M95A 4LQ3A 5HRNA 1HNIB 3NBPB 4KSEB 5JS2A 4J9KA 3KIOA 1D8YA 3ZT4A 3PX4A 3LAMA 4BE0A 2ITGA 4QW8A 3DLEB 5F8JA 2X74A 1S9FA 3QLHA 1QAIA 1RTHA 1KVCA 4I9LA 4Q0BB 2JC0A 1MU2A 3GV5B 1BGXT 3OS1A 5JUMA 1TK5A 2XHBA 4DQRA 2HHXA 1IKXB 3KKRA 3HVTA 2G8WA 3LWMA 4DTJA 2P1JA 1N48A 3ZSOA 5F8GA 3RR7A 4Z4FA 3D45A 3SZ2A 5F8IA 1XHXA 1Z4UA 3G6XA 1RT4A 4TLRA 4FJLA 3OHAA 2FLPA 5SWMA 4DTMA 3VQCA 4OGEA 1JLGA 1RILA 3EPGA 3TI0A 4CEFA 5F9LA 4FJ7A 4F4YA 3PW5A 1S6PA 3NH2A 4DQPA 4TQRA 5C25B 3P83D 4NRTA 4GC7A 2C2RA 3UQSA 4KBIA 1NJWA 2XY7A 4PUOA 3QGGA 3BQ0A 4B3OB 3KLIA 5J2MA 2QE5A 1X9SA 1S1XB 1HQUB 3HP9A 1QSSA 4MK8A 3KMQA 2D41A 1S10A 1RDAA 2GIRA 1VSEA 1NK8A 3L3UA 1TKZB 4RW6A 1TL3B 4CFBA 3DRPA 5T14A 1SH3A 2P51A 5KFGA 3S9HA 1VSJA 3V4IA 5HRPA 3KTQA 1XWLA 3B6PA 3VA0A 3NF6A 4M3RA 1BQMB 4YMEA 3KKSA 3LP2A 2XWYA 1EXQA 4TY8B 2UVUA 4CHYA 4U6PA 1T05A 3LZJA 1LAWA 3VQQA 4WFYA 1RDDA 5KFVA 4CJWA 4NZ0A 3LPTA 4CEQA 4FM0A 3RRGA 4H4MB 1C1CA 3SPZA 4CFCA 3RMDA 4XO0A 3KK3A 4ID5B 1QSYA 3CFPA 1S1UA 3O3GA 3PUFA 4CJFA 2VG7B 4B9UA 2IMWP 3NAHA 1C0TB 3NAEA 3S3NA 4YR3A 3PO5A 1UAXA 1BISA 4EO6A 1ASVA 2DY4A 2BRKA 2W7OA 3I0SA 4IKAA 2YNHB 4WZMA 1RDCA 1TK8A 4BDYA 3AVCA 3O4QA 3MR2A 2HNZA 3BGRB 4I2QA 2DTUA 4IG0B 5C42B 3KLHA 2V0NA 1UOCA 4KREA 3VQBA 3CJ4A 1KLMA 3D0PA 4RNOA 3SQ2A 4M3TA 3EPIA 5EDWA 5SZTA 3HL8A 1NOYA 1IKWB 4KB7A 4M3YA 4N56A 1NK7A 4E7JA 4E1MA 1LWCB 3T5KA 2G8IA 3DM2B 1L3VA 1JLFA 1RT2A 2XGQA 4G1QB 4K4YA 3E01B 4NLTA 3TAEA 2C2DA 3QGIA 1HYZA 1JLEA 4ECUA 1TV6B 1B9FA 2E9RX 5I42A 4EP5A 2BANA 4Y2CA 4R0EA 1IKYA 1LAVA 4FLZA 2IJNA 1S6QA 3KK2A 3CVKA 2D3ZA 2XCAA 4CJTA 2D3UA 3RB6A 2Z1HA 2UVVA 1JLBA 1L3SA 2HHQA 5F9NA 3QESA 3L2UA 3G0ZA 4PQUA 3ZSQA 4Q5VA 2YNIB 2FJWA 1C0UB 3M8SA 4F50A 2KFNA 4RNHA 3EY1A 5C24B 3PX6A 3H5YA 1TKTB 2ASJA 4OKJA 2BQUA 1LW2B 4QWEA 4ZP6A 1U09A 4ED6A 3Q8PB 4K4TA 3DRSA 2HHVA 4FJ5A 4DSJA 4UQGA 2IBKA 4NRUA 2XC9A 5DMRA 1N6QA 4MK9A 1DTQB 3BQ1A 3OJUA 4J2EA 4IFVA 2O4IA 3ICLA 4RZRA 4DF4A 1VRTA 3OYGA 4CFDA 2FC0A 4DFJA 4I7FB 4MFBA 2XI2A 5KFEA 4NLGA 2W9CA 4KAIA 3D5MA 4JS4A 4DQIA 5KG2A 2IGIA 1NJXA 3TAMA 5DG9A 3SPYA 4CHZA 2RF2B 4NLPA 4OKKA 1TAQA 5KFPA 4WYWA 2OPPA 1VK0A 3LPUA 3H08A 3L2RA 5FDLA 2I1RA 3N6NA 5L1LA 4YR2A 3FSIA 3BR9A 2G8HA 3QLHB 1RTHB 1HMVA 4CGHA 1MU2B 1XR6A 4KHQA 3AVMA 3PX0A 1QE1A 4H54A 3NE6A 4CECA 3OY9A 1ZETA 4DFMA 3HVTB 2G8KA 3DLEA 5KFRA 1KSPA 5DG8A 5KI6A 2EX3A 2ASDA 3BSAA 4HUEA 4RNFA 4AILC 4Q0BA 1RT4B 4PWDA 3GIKA 5HLFA 4Z4EA 1JLGB 2P5OA 1NHUA 4Y1DA 5JXSA 5KT6A 3M8QA 4JUZA 3NGIA 1S6PB 3OYDA 4J9PA 2O5DA 1RA6A 3UDLA 5KGWA 4O0IA 4IH5A 1FK9A 2VA3A 4CK3A 1J53A 1B92A 4PUOB 4K8ZA 3KLIB 4FJ8A 5J2MB 3CDEA 4E0DA 3WNGA 3BJYA 4KV8A 3JSMA 4AHCA 4PY5A 4FJ9A 3SJJA 2W8LA 2CKWA 1NK9A 4RW6B 4IR1A 3NH0A 3DRPB 4ZP7A 4Q43A 3V4IB 3V6DA 1HQUA 2F96A 5FROA 4EYIB 3LP2B 4FYDA 1Z26A 5HRRA 5FRMA 4OVLA 1T05B 3HPHA 5DGAA 5CY4A 4DF8A 2X6NA 2Z1GA 5CZ1A 4ZTFA 2OPRA 2FBYA 3GIIA 4Y34A 4IRDA 1C1CB 4J9RA 4CK2A 1ITGA 4TY8A 3ZSVA 3KK3B 4BACA 4DU3A 4FM2A 1S1UB 4NYFA 3KLEA 3SNNA 4E1NA 3VQ8A 2ZD1A 3NKYA 4FM1A 1ASUA 3SUPA 3V9XA 3I0SB 4H4MA 3C94A 2HNZB 1LWEA 1JLAA 5F8LA 4FXDA 4CHPA 3KLHB 1CXUA 2HHWA 1T94A 3GILA 4CIEA 3AA2A 3KLGA 1KLMB 3SQ0A 4CGGA 5KGXA 4M3ZA 5CYMA 4NYZA 4B8CA 3CJ5A 4CIFA 3K58A 2IM2A 2AQ4A 3AVIA 1RT2B 2EHGA 4LD0A 1W25A 1KLNA 1T03B 4DMNA 3K57A 1S5JA 3CDWA 1SKWA 2BE2A 1JLEB 3NL0A 4QWAA 4HTUA 5I42B 2BANB 1C2PA 3LP0A 5KFTA 3MEDB 4B9LA 4H8KA 1IKYB 4E89A 2R7YA 4O3PA 4B08A 1S6QB 3KOAA 3F9KA 3RWUA 3G6YA 2HAIA 3NF9A 4FS1A 1JLBB 5C5JA 1BL3A 4B9VA 3HT3A 3VQDA 2YV0X 4PQUB 4K4UA 3H4DA 4K4VA 1FKOA 3QERA 1D1UA 3TQ1A 1L3UA 4IRCA 4BWJA 4MH8A 2WONA 3L8BA 3M9OB 4CJRA 4XPEA 4EBEA 4ECYA 3AVKA 3IAYA 2FVQA 4FS2A 5L1KA 2DFHA 4KAZA 3MFHA 3MFIA 2HHSA 2ATQA 2YNIA 3PW0A 3DRSB 3PV8A 3K59A 2PYJA 1LWFA 2HHTA 3ISND 5KFSA 5C24A 1RBTA 1QS4A 3AVNA 1N6QB 5KFJA 4Z4GA 3QZ7A 1TKTA 4EP4A 4F4WA 3QZ8A 4NCGA 3SFUA 3ZT0A 4Y2AA 4IFVB 1KHWA 4N5SA 4J9LA 1VRTB 4Z4CA 4O3NA 4W5NA 3HPGA 4E7HA 4ZMMA 2W9CB 2WHOA 1KVAA 2AGPA 4CJ4A 4RW4A 4ZVEA 5KRSA 2Z1JA 4MK7A 3P5JA 3LP3A 3IRXA 4CJUA 1U04A 4Z0UA 1RT7A 2OPPB 5KFDA 4KHYA 3K5OA 5FDLB 4ED1A 4CJKA 4ZPCA 3KHLA 4O0JA 3H40A 4WFZA 1RA7A 4RW8A 3VQ7A 4DS4A 4ECXA 3M8PA 3DOLA 1HMVB 2RF2A 2GBZA 2PY5A 2UUTA 2YNGB 3MR3A 1T7PA 4KFBA 2C28A 3VQSA 4AHSA 1QE1B 2OPSA 4ED0A 2FLNA 1S0NA 3DYAA 4ECTA 4XIUA 5DG7A 3CIZA 5EWEA 3TABA 1QTMA 2BR0A 4DFPA 1NHVA 3ZT1A 3ITHA 2KW4A 4PWDB 3RB0A 1JLCA 5HLFB 2B5JA 5KT3A 4FLTA 4J9MA 3NCIA 3E51A 2KZMA 3OSPA 2UUWA 4E19A 1VSDA 1SL1A 2OPQA 3RAQA 4TXSA 3LZIA 1OS5A 3EZ5A 4IH7A 3M8QB 3D28A 1ZBIA 1RDRA 2R2TA 4Z4IA 1VSHA 2FVRA 1FK9B 4FLXA 5HRSA 1Z25A 3K5NA 5CYQA 3G10A 1EP4A 5DK5A 4DTOA 4IH6A 4KV8B 3JSMB 3UR0A 3A2FA 2VG6A 3HM9A 2PZSA 4ED8A 4LSLB 1WSFA 3RTVA 4KB1A 2BGGA 5KG0A 4DSLA 4O5BA 5EWFA 1NK5A 3TAQA 1C0MA 1FKPA 1RT3B 3LP1A 1WN7A 1IH7A 3V6DB 1Q9XA 4J2DA 5HP1A 3CYMA 2ZKUA 1IKVA 3ZSWA 1JXBA 4OPJA 2OPRB 2CJQA 1S1TA 5KFCA 2D7SA 4ZVGA 4KHNA 4HCBA 4I2PB 4IDKB 1EX4A 5J2NA 4PA1A 4ELVA 3KLEB 1KCFA 3AVLA 4M3UA 2ZD1B 4CJVA 4TYAA 2XY5A 5T7BA 5E41A 2FVCA 1LWEB 4LH4A 1JLAB 4FJIA 3JYTA 1EKEA 1S9GA 2J6SA 3KLGB 3CQ8A 4K50A 4BDPA 5CYMB 4J9OA 4E7IA 3O3FA 3H5UA 1NKBA 4IRKA 3EZUA 5EWGA 2E4LA 4M42A 4QAGA 3ZT2A 1REVA 3OYIA 3HK2A 2FLLA 3CJ3A 1HNVA 4M3XA 4DU1A 4R5PA 3BREA 1CZ9A 2Z1IA 1QHTA 1TL1A 2BE2B 4ICLA 4WXOA 1LW0A 4EZ9A 3RB3A 3LP0B 3HXMA 2BQ3A 3OL8A 4KHSA 4NCAA 4Q45A 3DRRA 3AO5A 1NK6A 3SV4A 4NLYA 2KQ2A 3AVGA 1RBVA 2VWJA 1ZTTA 5KFAA 2FBXA 1T03A 3OL6A 4C8MA 2G8VA 1HARA 3TARA 2YKMA 1UA1A 3ALYA 3MECA 1C1BA 1WSHA 4FJJA 2YNFA 4QW9A 3MEDA 4DG1B 4ECSA 2AGOA 1FKOB 1XR5A 3I5BA 3LWLA 3OJSA 2WONB 4ED7A 4NCBA 4K4ZA 4CESA 2F8TA 4RUAA 1IO2A 1RTDA 2IM1A 3DOKA 2GC8A 2D0AA 3SQ1A 3KHRA 1O1WA 2VA2A 3Q8RB 4FLYA 3DLHA 4G3IA 1LWFB 1KVBA 2RKIB 4NCGB 5KG1A 1XHZA 1SV5A 4DTRA 3T5JA 4DS5A 4GW6A 2Y1IA 4MIBA 1W9HA 3TVKA 3FFIA 4QPXA 4ZVFA 4E3SA 1GOAA 1R0AA 4YP3A 4TQSA 3QYYA 3QO9A 4CJ5A 3GQCA 3I0RA 2XI3A 2UVWA 4YFUA 2HB5A 4RW4B 2R2SA 4TYBA 2JEGA 1U45A 3BSNA 2X78A 3IRXB 5KG5A 3AO3A 1QSLA 1RT7B 3LAKA 2DPIA 2W8KA 4AHUA 4N47A 3GV7B 4F2SA 4CK1A 4CGDA 4RW8B 2WTFA 1JKHA 4ECZA 2QV6A 4CEZA 3M8PB 1YTUA 3DOLB 2AX0A 4QWBA 1DLOA 2V9WA 3RR8A 3BSCA 4RNMA 3QIPA 3QIOA 3L3VA 3AVBA 4KFBB 2FJVA 4URSA 4O44A 2XY8A 4CFAA 2OPSB 3DYAB 3M8RA 3TAFA 2E6MA 3NHGA 4GMJB 2HW3A 3I8DA 4FBTA 3RAXA 4F2RA 2W9AA 3RRHA 2FVPA 3QGHA 5DQIA 2YNGA 3ITHB 1N56A 4KKOA 1BCMA 1TGOA 3IGNA 1JLCB 4EO8A 2B5JB 1KFDA 3AVHA 3ZSZA 3TAGA 4JS5A 4DLGA 1ZBHA 2OPQB 5HBMA 4NLWA 4CGIA 4CERA 4J9NA 4TY9A 3DI6A 1RTJA 3L2WA 2YHAA 5FRNA 3HKWA 4OKEA 1CZBA 4DSKA 3V9ZA 4BE1A 2YKNB 3NFAA 3SFGA 4JLHA 3HO1A 4R8UA 4CEBA 3WNHA 1TKDA 1HPZA 3QEWA 4CHOA 1WSJA 5CYQB 4QWCA 2JLEA 1W0HA 1EP4B 3V81A 3SI8A 2HHUA 2XY6A 4DQQA 1B9DA 2VG6B 4O3OA 1VRUA 1C6VA 1QQCA 2LSNA 4EZ6A 1S97A 5F8NA 4NLQA 5F8MA 4OGCA 3HJFA 2BQRA 1FKPB 4W5OA 4CEOA 3LP1B 2RDJA 3KK1A 5HP1B 4FZYA 1IKVB 2IS3A 3V1QA 3VQ6A 4ED3A 3PW7A 4LSLA 4U7CA 3LANA 1JIHA 1ASWA 3G6VA 4FK2A 2NUBA 4L8RB 3GYNA 1HRHA 3OYMA 4CJSA 1S1TB 1RT3A 1IG9A 3SQ4A 1TAUA 5J2NB 4C8LA 4Z4HA 3PW4A 4NLXA 1RNHA 4C8NA 5DLFA 1SL2A 2XRIA 3MTKA 1SH0A 4CHNA 4NLDA 1XR7A 3HSTB 4I2PA 4IDKA 2WCXA 1RBUA 4JV0A 4O3SA 3JYTB 1S9GB 2ATLA 1I6JA 3H5XA 1RTIA 3PY8A 1K6YA 4J2AA 3OLAA 4K4SA 3RBDA 3HYFA 1GOCA 1TK0A 4EBCA 4DU4A 4EEYA 3I5AA 4DL6A 1REVB 1WAJA 4FBUA 1HNVB 3KMSA 4R5PB 1TL1B 5JS1A 2JEFA 4KTWA 2B4JA 4ICLB 4O4GA 4FZZA 1LW0B 5K14A 2IA6A 4QOZB 3V6HA 1EETA 3I5CA 5KT2A 2AGQA 3SCXA 3DRRB 4RG8A 3ZT3A 5KFYA 2YKMB 4ZPAA 3HP6A 1GOBA 3MECB 1C1BB 1VSLA 4HYKA 2YNFB 1TQLA 2Q3SA 1HYSB 1BIZA 3CG7A 4X2BA 3MEEA 1RTDB 3NGZA 3DOKB 4DG1A 4DWIA 1MMLA 2YHBA 1YTAA 4F3TA 3CM5A 3S3OA 1HYVA 5D3GA 2IOCA 3ZSRA 1SV5B 2RN2A 1HQEA 5J2QA 2WB4A 4AH9A 2J6UA 1C1AA 3FFIB 1IM4A 4CEEA 4H4OA 1R0AB 3QO9B 4FK0A 3I0RB 2RKIA 2AWZA 3QNNA 2C22A 3NDKA 1CLQA 2HVHA 1LV5A 4ELTA 4DSFA 4CF0A 4ECQA 3T5LA 4FJHA 1JKHB 4ZP9A 3QETA 4OLAA 3IGVA 4ZPBA 1NKEA 2OZMA 1BHLA 2R8IA 4K4WA 1DLOB 4W5RA 2GUIA 3QIPB 2KZZA 4M94A 2IAJA 2DFFA 3AA4A 4O44B 4FJXA 3OYJA 4CEAA 1SH2A 4IBNA 4IKFA 2OYQA 1QUVA 4OJRA 4K4XA 4ZPDA 2C2EA 4MIAA 3NF8A 3EYZA 2RDIA 1JX4A 3DLGA 3KJVA 3THVA 1U49A 4C8KA 2B6AA 4YNQA 4DSIA 5J2PA 4I9QA 1VSIA 4FK4A 3TAPA 3IN5A 4KKOB 3C6TB 3PR5B 1D9DA 5HBMB 2GIQA 1S49A 1JXLA 3DI6B 2I5JA 1RTJB 1YVUA 1CSJA 2OZSA 4BDZA 4F8RA 3OVNA 2IC3B 4Q8EA 1NK0A 4LSNB 3WNFA 4RW9A 4R8UB 1J5OA 3MEGA 4FJGA 4DTNA 1HPZB 5EUHA 3U6FA 5KFLA 1UA0A 1WSEA 4DL5A 1G15A 3V81B 2W7PA 4DTPA 4BE2A 1U48A 2R2UA 4O3QA 1VRUB 2KFZA 4QWDA 3BQ2A 4TSXA 4FJMA 2YKNA 3KLFA 1NK4A 4CGJA 5DLGA 4WYLA 2ZE2A 3KK1B 1RT1A 2HWIA 3FQKA 2DPJA 4RNNA 4HVJA 4ECVA 5KG6A 3MXIA 3AVFA 3T19A 3SUNA 1FXXA 1TVRB 4OLBA 2WRMA 1SKRA 5DQGA 1RAJA 3PJXA 1S9EB 5KFUA 3V1OA 3ZCMA 1TP7A 2IJFA 4ZHRA 1L3TA 2BDPA 4O55A 4FLVA 5J1EA 2JC1A 5KFHA 4OPKA 4Q44A 1TKXA 1RT6A 4ZTJA 3FQLA 3OSNA 4KRFA 1S48A 3TWHA 4CF8A 4KE5A 2D0CA 4AHRA 5KFFA 2R8HA 1RCHA 2FBTA 1S4FA 3CWJA 4URGA 1SL0A 4DQSA 1RTIB 4CJEA 3VQPA 3L2QA 3PO4A 1BIUA 1NJYA 1Y97A 3MAQA 2QKBA 1K1QA 2JGUA 1S1WA 1U47A 3MF5A 3GIJA 5L1JA 4IFYA 3RMAA 3V6JA 4MKBA 1BQNB 4O4GB 5K14B 4KHRA 4FW1A 2D5RA 3KLVA 3DMJB 3M9NB 1EETB 4RW7A 1SUQA 1DTTA 1U4BA 1BI4A 4FLUA 2QKKA 2V4QA 3H4BA 1Q9YA 4IQXA 3K5LA 2O4GA 4KTQA 2VWKA 1KRPA 1L5UA 3DDKA 2QXFA 3QEXA 2XGPA 3T3FA 3IS9A 1SKSA 2VG5A 4HUGA 4CF1A 3SV3A 2HWHA 3AVAA 4B9TA 1RDBA 2Y1JA 4RU9A 2UVRA 2XO7A 4KI4A 3LDSA 2EC0A 5HROA 1S1VA 3QEIA 3MEEB 3HHKA 2W9BA 5I3UA 3OYBA 3VA3A 2WOMA 3CFOA 4ZVHA 3Q8QB 5D3GB 1JLQB 2G8FA 1WNSA 2B43A 4MQ3A 3C95A 1X1PA 4N41A 4RUCA 4KTZA 1HYSA 5KFWA 3S3MA 3FRZA 3SUQA 2HNDA 1X9MA 1HQEB 5J2QB 1RT5A 3H5SA 2DFEA 4WE1A 3K2PA 4H4OB 2HMIA 4DL2A 4EBDA 1HJRA 3MXJA 3KHGA 2W42A 2A1RA 1JXEA 4KPYA 3HVRA 1ZYQA 5KRTA 4CF9A 3AA5X 3SI6A 4ECRA 2KTQA 3OS0A 1NJZA 3OYLA 4BWMA 2ZQBA 4DTUA 3H98A 4CF2A 1ZBUA 2BRLA 1UWBA 2HVIA 4KO0A 4FZXC 2D0BA 2IAJB 3HVAA 3MR6A 3F73A 2HNYB 3ASMA 2JEIA 3C6UA 2IM3A 4DFKA 4C8OA 3PJWA 4CGFA 4KB0A 3PR4A 1RYRA 3DLRA 4ID1A 3VQ9A 3DLGB 3KJVB 3IG1B 3AV9A 3DLKA 3QEPA 2B6AB 5J2PB 5KG3A 3U3YA 4DEZA 4ZP8A 4DTXA 3OYEA 4M45A 4CJQA 4IG3A 4B9SA 4KHWA 4NYNA 2ETJA 2GV9A 3V9WA 4WXWA 2I5JB
chains in the Genus database with same CATH superfamily
1WDTA 1H7WA 1VIOA 2O8BB 1XEZA 5SUHA 3D67A 5FPMA 3I8BA 3BKUA 4NLVA 4CYUB 3M5RA 4M7YA 1RDWX 5KG4A 1WSIA 3BGOP 4AFFA 4H5RA 3V1RA 1QAYA 2D3OR 1LQ9A 3WXKA 5KPZA 2DYAA 2Z2MA 4NOHA 4CM0A 2VBYA 1WOQA 1YX2A 4OZNA 3GZ7A 3TVZA 1D9FA 3HD1A 2HFNA 1WLJA 3OUYB 2DHAA 3CCMN 1WF0A 3EKSA 5KT4A 2FVSA 1GMWD 1S6OA 1GLEG 4XPCA 3WIUA 4IR9A 1LWXA 2E1PA 4QIFA 2OA8A 4NLOA 1GT8A 2X1BA 4C8YA 1RBRA 3MM8A 3PIPQ 2VFVA 5L38A 1A5XA 2MQNA 3IP0A 2N7CA 4A8QA 4JRQA 1FVQA 2WSFC 3M8WA 4KBOA 1QTNB 3KJNB 2XQCA 1KC8O 3CMQA 1VSFA 1ROFA 3GJQB 5J1EB 1IM6A 4F25A 3O9TA 4J9QA 3ISNC 2RJZA 3BZKA 1CQNA 4QCLA 4DL4A 2ZZMA 2GW8A 2OTLS 2CNOB 5DQHA 4P2MA 1UFLA 1N8RO 1S9EA 3AVJA 3IAS9 1O8BA 4PYAA 1NNDA 3HHLA 4YS2A 1NXIA 4CO0A 4FJNA 3AO1A 1VSKA 1IBLJ 5C25A 4KHPK 4RUBA 1B4SA 5DRKA 5A8RB 4A8WA 2VH7A 4GO7X 2JHEA 3KNGA 3H20A 4OYXA 3K5MA 1S1WB 3CT9A 4F4ZA 3H46O 2IM0A 4X66K 1AUDA 2XSJA 5F0UA 5KTQA 4KH4A 2NRVA 3DXKB 1TKZA 3KWMA 4F4XA 1I3AA 5JVGL 3HPOA 2QA2A 2W24A 4RW7B 1SUQB 1F5AA 4OL8A 2EC2A 4HLBA 1X4CA 4KHUA 3Q8SB 3J7AN 3K9KA 2A18A 2MQOA 1XMBA 2A2DA 4V19J 5E3AA 2XS7A 1RQ0A 2HRUA 4W5TA 3SMPA 2W41A 3S6EA 4CEDA 3IS9B 1J9AA 3I55S 4HKQA 5E26A 3VQ5A 4WFNL 3VZHA 3CM6A 1V9OA 2COLA 3BN7A 4I2QB 3RMCA 1H6KX 1ZM4A 1S1VB 5IM0B 2QG9B 1NBEB 4ZDNA 3NGUA 3M8ZA 4OJ3A 2E1MC 3D6HB 5AR0A 3V9UA 2WOMB 1AB8A 1X9WA 4CJLA 4HDGA 1KN6A 4DDFA 2I2YA 1D5AA 1N88A 1N4LA 2W4DA 1XC9A 3GFZA 2B56A 4EU0A 1AT1B 1IKWA 3LALA 1JL1A 3KK2B 2XHCA 3CC2N 3MK6A 4ED5A 3CCLN 4G1QA 4Y3CA 2DCUB 3SYZA 1Y4ZB 5L9XA 3NGYA 3SUOA 1RWUA 2D1CA 2CJAA 4M3WA 4WU2A 5H1SQ 1ZM2A 4R79A 2W40A 3QIDA 5HJXA 4YOVA 2ZBIA 2RRAA 2VU5A 3HHLD 1KNZA 2H48B 3O4NA 3HFKA 5EX5A 2RAQA 3VAMA 2XEXA 5CZ2A 2AU0A 4I6MB 2E6LA 5A0YB 3UD5A 1WF1A 3CF5Q 5F8HA 1LW2A 4DUYJ 4ZIVA 1RBOB 3QBXA 4WFXA 4I6WA 2HQCA 4FWNA 4BRCA 2ASYA 1YRXA 1Y3JA 2IRXA 3LL3A 4NXMJ 4MIWA 4GC6A 2GHPA 3S1TA 4J9SA 3P49B 3UPFA 4WTOB 5B0EA 1WC4A 2J4RA 4PXCA 1R43A 3QINA 5KFZA 4FWKA 4FJKA 1TUGB 2XSFA 1BCOA 3RU0A 2V51B 4KYZA 3ZTPA 5L46A 4CZKA 3NH1A 2HEKA 3CFRA 3V9SA 9ATCB 3QAEA 3ZX2A 3R7BB 1G3OA 3MXMA 2ILYA 5JLHA 4M95A 4LQ3A 3CJ7A 4KSEB 2C2KB 3MEKA 4BE0A 2ITGA 2NRZA 4QW8A 1Z2ZA 4GVBA 1S9FA 3QLHA 1RTHA 2ZJRQ 4I9LA 2RHKA 2D69A 4Q0BB 3OTOJ 4EMDA 1HNWK 5JUMA 2EBGA 1RTZA 2G8WA 3ETMA 4DTJA 3NS5A 2JRSA 1PAEX 4FF1A 1S57A 3D45A 3Q23A 3NGTA 1Z4UA 2VGNA 4FJLA 2AKWB 3MMVA 2VBXA 2F7VA 1PYTA 1GLBG 4GMKA 3TI0A 5F9LA 3WXMB 2OKQA 3F2KA 4F4YA 1S6PA 3NH2A 4DQPA 3CJQA 4TQRA 1ZH5A 4LFBK 4V19S 3BPDA 1TZ0A 4B3OB 4P9SA 2QN6B 1HQUB 3HP9A 3R5GA 4MK8A 3R9LA 2D41A 2AD9A 4OX7A 4DN0A 3EZWA 2NRTA 2P9LB 1KAZA 1NEEA 3BGFA 2UYTA 1HX1A 1TL3B 4CFBA 4LF4J 2W6LA 4NX9A 3V4IA 3CCWA 3KTQA 5HRPA 4M3RA 3IWNC 1HNXJ 2XWYA 1EQYA 4CHYA 1HW9A 4K41A 2MLZA 1T05A 3LZJA 4KH6A 1LAWA 1VQSA 2SXLA 4MJKA 4FOEA 2LEAA 4XH5A 3N79A 4NZ0A 1M5OC 4H4MB 2A41A 1C1CA 4BQLA 4M5JA 4DV5J 4CFCA 3ZETA 4E98A 4K0KK 2KG0A 1PYSB 7FDRA 3G2XA 2XZDB 2HBZB 3C19A 1CJVB 3FGVA 4GNIA 1HD1A 1UAXA 1VYAA 3QJPA 2DY4A 2W7OA 4OMFG 4U9RA 3AVCA 3CPEA 3O4QA 3MR2A 5ADXA 4IG0B 5C42B 3CD7A 1UOCA 1WJ9A 4KREA 3VQBA 2DKOB 3CJ4A 1KLMA 3D0PA 3SQ2A 5HMYA 4M3TA 3EPIA 4U8YA 3FZMA 3HL8A 3OTEA 4KB7A 3CMAS 4E1MA 3LPYA 3K9JA 1L3VA 4NWBA 2XGQA 1XNQK 3PJ9A 4NLTA 3CXCM 2C2DA 2XBPA 1HYZA 1XQSC 5C2DA 2E9RX 4EP5A 2BANA 3AAPA 2CQHA 4DL0C 2ZBQA 2ZZTA 4MAKA 1S6QA 3CVKA 2D3ZA 3RB6A 3SCIE 1V5VA 4GY2B 3UCUP 2VQFJ 3FSYA 2MHEA 5D4NA 3BO4A 2GVDA 1X5SA 4Q5VA 1QQNA 1WWHA 4A8KA 2KFNA 2PIIA 4JI1J 3D6MB 2BJ1A 2RB7A 2WZ1A 2ASJA 4OYZA 3GIRA 3FZFA 3MCOA 2KT2A 4ED6A 1IBLF 1HW8A 4K4TA 4DV6K 3PM9A 3WT0A 4UQGA 1X7VA 2DNQA 4NRUA 5DZ6A 2DH8A 2NZ4A 3THWB 1DTQB 3U27A 2KRRA 3W61A 4IEEA 4J2EA 4IFVA 3ICLA 4DF4A 2KYZA 3Q7BA 1VRTA 3DNCA 3ILLA 4CFDA 2QYGA 1KXPA 4KAIA 3D5MA 3KZBA 4JS4A 4DQIA 2AJ2A 5DG9A 3GWCA 3SPYA 2H54B 2JJ4D 4NLPA 3L3CA 1ATSA 2OPPA 3MCAB 1ELOA 2UXDJ 1MN9A 2I1RA 1A6LA 2IVYA 2ZM6K 2N4DA 3EXYA 3KG4A 4FN5A 3TW0A 4CGHA 1MU2B 4KHQA 5RUBA 3AVMA 3NGKA 2C2OB 2RQMA 3DC2A 2Z2LA 3FLCO 1YJNS 4V19X 4K43A 2ACYA 1ZETA 1WOPA 2ZC4A 3HVTB 3DRYA 4LVNP 1KSPA 5KI6A 4IOCQ 4N77A 5AFUA 1X5OA 1PBUA 3GIKA 4PWDA 4P72A 2XMVA 5DO2A 1JLGB 1YLXA 1NHUA 4DBQA 5JXSA 5KT6A 2IHR1 1RHQB 2GNKA 1R3NA 5D0HA 2QIFA 3UDLA 2Q6CA 2MQLA 5KGWA 2WBRA 1LFWA 1FK9A 4OI0A 2EKYA 2DNKA 2VA3A 1EKSA 4GV6A 1YGYA 3CEDA 2HBMA 4PUOB 1VS3A 5U47A 3J7AP 4M5DB 5J2MB 1H1VA 3WNGA 3BJYA 2J0WA 3JSMA 4AHCA 4BC5A 1QDUB 4CP5A 1AA1B 3THTA 2CKWA 5IT0A 3MPYA 3ELHA 3DRPB 1UVLA 5FPNA 3R3TA 2F96A 5DDQC 3LP2B 2MQ8A 5FRMA 2CZVC 4M63A 1DT9A 3TSQA 1PGZA 5LMUK 4JKFA 2O8EA 2G4BA 4DUYF 2OPRA 3BEXA 4FXVA 2HQ3A 3A8EA 4PWWA 4CK2A 4TY8A 2OTJN 4DR6F 3UD4P 3ZSVA 1S1UB 2WBMA 4NYFA 1BHNA 2L08A 5M1OA 3NKYA 4OYPA 1UTAA 2OIHA 3FZKA 2HNZB 5A8WA 1MWKA 3NS7B 2VB6A 2LDIA 4DX5A 1T94A 2HPUA 4CIEA 5EN1A 1GMVA 2MKKA 4M3ZA 5D77A 4NYZA 3G6EN 4B8CA 3K58A 1NSKL 4Y2MA 3ZEUB 5AZJA 2IM2A 5HK4A 2YVSA 3PRDA 1YHQS 4YOYA 2EHGA 2HKEA 1T03B 3K57A 1JLEB 3TR5A 5E84A 2H5IB 4RUHA 3MR7A 3OTOF 4CO3A 4Y28C 1ZZNA 3F9KA 3HHEA 2RNEA 3FCHA 2ZHBA 3P3DA 1HHTP 2HAIA 1M1HA 1JLBB 1WKLA 5D0GA 2PT0A 1DKGD 3VQDA 2CPFA 2ZH3A 5A8KB 3M2VA 4NZ7A 3AA8A 4K4UA 3P5TL 5KQDA 1MWYA 2GTDA 3QERA 4HTLA 4BVOA 2E1AA 4CD1A 2VV5A 3AVKA 4GKKJ 3IAYA 3TTFA 2J8AA 3TP2A 5L1KA 2HHSA 2B0GA 2G0CA 5I3PA 3W66A 3A3PB 4LFAJ 2RVJA 1QS4A 3QZ7A 1TKTA 1X8DA 1VBZA 4NCGA 2MMYA 3OFFA 1SB6A 2BABA 1WC1A 4Y2AA 3UCGA 1KHWA 4N5SA 4FYXB 2XMAA 1OO0B 4HVZA 1B7FA 4EHUA 2W9CB 4BRGA 2QFIA 2B9EA 2UUAJ 1KVAA 1HNXF 3L7PA 2FF3B 4JD2A 4RW4A 4ZVEA 3KG1A 1C0FA 3LP3A 1TYQB 3QPIA 4CJUA 4XDDA 2CFXA 5AQHA 5KFDA 2KVIA 4ATNA 4XAKA 4LF5K 4ZPCA 3H40A 5BPNA 4F04B 2DHSA 2PY5A 2GBZA 4DB3A 2YKOA 4NL5A 3TTCA 4ZCMA 3ZTRA 2QLXA 3VQSA 4AHSA 1QE1B 2LLZA 3QGPA 2FLNA 3W5ZA 3Q8VA 1EO1A 2BJ8A 1FRHA 1N36K 3ID8A 3M6GA 2A40A 3BR8A 3ITHA 2EFOA 3NNCA 1Q7YO 4FLTA 3NCIA 2N3LA 4ANDA 5GADU 3RAQA 3C7NA 3LZIA 3M8QB 4LIWA 2R2TA 3HKZD 1G2EA 4K42A 2DXEA 3TO8A 1N33J 2KKZA 5HRSA 5E2QA 1Z25A 3G10A 3G71S 3OBYA 4CLFA 2QT7A 4WFAL 4IH6A 4KV8B 3UR0A 2BZ2A 3CCUS 3HM9A 4K5RA 3MUMP 2WVDA 3JSBA 4KB1A 2KLAA 2VQFF 1F1BB 3TAQA 1V3RA 1RT3B 1VQ4N 1FO1A 1YITN 4B3TK 4JI1F 3QJLA 2XMTA 1JXBA 2P9CA 3J81U 2XLKA 3D2EB 1CJKB 4DZ6A 1RZMA 1ATRA 3VAGA 5ETTA 1V5IB 2FZCB 2HHHK 2MSSA 2AIRB 3UVJB 4C48A 3HZGA 4PA1A 3KLEB 3W63A 3AVLA 2ZD1B 1K73T 4CJVA 2FVCA 1IBKJ 1MSWD 2LQBA 1JNZB 4USIA 1VLYA 2Z30B 3KLGB 4IQMA 4OLOA 4CBUA 2LVWA 4K50A 4BDPA 2NXNA 5CYMB 2OD6A 2X3DA 3EO3A 4CZGA 2AJ0A 3H5UA 4L72B 1RABB 2N7YA 2FY8A 5EWGA 2E4LA 3ZT2A 2UXDF 2FLLA 4DU1A 3BREA 1QHTA 3VGLA 2O66A 3OXLA 2OMLA 2CZ4A 3LP0B 3BYRA 1LOUA 4KHSA 4H0XB 2DT9A 4NCAA 1X4GA 3DRRA 1NK6A 4NLYA 2KQ2A 5AQXA 1RBVA 2J5AA 5KFAA 2FBXA 3CC4N 4C8MA 2G8VA 2CWXA 3RSEB 3MECA 1VQMS 4CTAB 4DG1B 5F3ZA 1XR5A 3UNYA 3B4MA 1CJTB 3W0LA 1WHYA 1RP5A 4AM6A 2WUSA 2BH1A 4LSZB 4WP8A 3CGIA 3DOKA 3CCQN 2DVIA 3SQ1A 1O1WA 2MZQA 2VA2A 2JH3A 4XEIA 3DLHA 1LWFB 1KVBA 4A5AA 1HR0K 2HS3A 4CLTA 2P9NA 1ZPVA 5KG1A 1SV5A 4DTRA 3SSQA 2QJ3A 1W9HA 3TVKA 4FYVB 3FFIA 4J90A 4C1NK 1EIYB 1XK8A 1GOAA 4E3SA 3QO9A 3L7OA 4CJ5A 1WKKA 1FTCA 2ZNYA 3IBCB 3I4HX 1Z1ZA 3I6PA 4A8SA 4P71A 4OJ1A 1UZHA 2W8KA 3M1VB 1VLOA 4CDIA 3UKRA 3RG6A 4AM7A 4CGDA 2WTFA 3QRRA 4ECZA 4DR7K 4CEZA 2BX6A 3DOLB 1IR2A 2YXLA 1DLOA 2F9JA 3THXB 4RNMA 4URSA 2B4OA 3G9CA 2QW9A 2IFXA 1NGDA 3WXIA 2WW4A 3DYAB 4K59A 2CQ3A 3H25A 1GTEA 4RL1A 2BBEA 4FBTA 4K2JA 4FPBA 2W9AA 3RRHA 3QGHA 4WKRA 3E9LA 4HHUA 4ES1A 2VFUA 2YNGA 3IGNA 1JLCB 1HD0A 1Q8LA 4BR0A 1TMMA 2OPQB 4O5FA 4J9NA 4ZVRB 4BC7A 1J5EK 2PA3A 5FRNA 1CZBA 4DSKA 3V9ZA 3OTBA 4BE1A 3E9OA 4JLHA 3HO1A 4R8UA 4CEBA 3WNHA 2UUBK 2CVEA 5B0AA 1W0HA 3SI8A 1XMQJ 1B9DA 3ZXWA 4E1JA 1NSQA 4O3OA 4AF1A 1NPKA 3C65A 4RBUA 5F8NA 4MO5A 5F8MA 4J9VA 3ZZZA 1NGHA 3HJFA 2VC0A 4CEOA 3LP1B 2RDJA 2FGCA 3KK1A 5K5MA 4HI1A 3D2FB 4FZYA 1R7IA 1IKVB 1HKAA 3LANA 1JIHA 3G6VA 3MM5A 4HH0A 3R7SB 2NUBA 1R27B 4GKKF 4BC3A 5CA5A 2R7XA 1N34J 3I31A 3PIOL 3S8SA 2GGPB 4LFAF 1NWKA 3MOJB 1FXRA 2VJVA 3AHPA 1HNZK 3EICA 2GJIA 2IBOA 3POTB 2XNRA 3O1LA 3FE1A 3MCNA 5DLFA 1VQNN 5AZIA 2UU9K 2V4JA 4I2PA 2DNLA 4O3SA 3EM1A 2VICA 3CUNA 2UUAF 1I6JA 1O5JA 4QQBA 3H5XA 2AW0A 2EG2A 1HWLA 1K6YA 4J2AA 2KHCA 2VL1A 4DU4A 3BF1A 5M1FA 4DL6A 1WAJA 3G96A 3KMSA 5GINA 4QS8A 4O4GA 4FZZA 1QAXA 2IA6A 4QOZB 5ADXH 2OANA 2DNRA 3V6HA 5KT2A 2AP6A 2HSTA 4DV7F 4C0OC 1CJUB 3ZT3A 3DU6A 5K8OA 4ZPAA 3HP6A 2V9KA 2BM1A 4X4QA 4ISGA 3BBCA 4FKYA 1HBUA 5D15A 1N5TA 1DFDA 3CCMS 1CLFA 2QA1A 3AFGA 3CD6N 3MEEA 1LNQA 4WK1A 3NGZA 1N33F 3FC9A 5GADP 1B99A 1YTAA 4NI2A 3CM5A 3S3OA 1RLDA 1HYVA 1FWLA 1RHKB 2QMUB 2ZH9A 2NYIA 1DHMA 4JI6J 4JI3J 3H42A 2J6UA 2KDOA 5ADZA 1WEXA 5AXNA 2UP1A 3ZX3A 4H4OA 1CS4A 1R0AB 4ZCKA 4FK0A 1KOOA 1HBOB 4DR1F 2Y1LB 1VC0A 2DITA 5E3PA 2DH9A 3MN5A 1EQ0A 4CF0A 2HQIA 4USJC 2V2VA 3UN2A 4KPCA 4ECQA 3NNAA 4FJHA 5LT5A 1H3DA 2CUYA 5K9FA 5JVGQ 3B8AX 3O6WA 4ZPVR 5F0XA 1BHLA 2F3JA 1M1KO 3FCVA 4M94A 3OYJA 3K8WA 2V69A 4IBNA 4IKFA 1OQ6A 1YK9A 3QT7A 2OYQA 4JI5J 4OJRA 3DXBA 1S72N 4K4XA 2C2EA 2F9TA 3KJVA 2E5IA 1U49A 1IBKF 2DRDA 4C8KA 2EI5A 5J2PA 2J0SD 1KC8T 4WFNQ 2A6AA 4PPZA 1SJFA 3FBFA 4PYDA 2F9WA 3T7ZA 2OCEA 1RWOB 2CQDA 3HSJA 1JXLA 4C6AA 5E3RA 3GPAA 1N8RT 2QEXN 4F8RA 3OVNA 2O8BA 1JMTA 1F2GA 2AZ3A 2E88A 2NRRA 4CYUA 2GUPA 4FJGA 3U6FA 2WC9A 2YHWA 2MLXA 3JTOA 3V81B 4DTPA 4BE2A 4CD3A 2VOPA 1VHFA 3C3LA 4M8LA 1HJOA 2GHVC 2DNOA 3MM8B 2A2CA 1QJHA 2WW8A 3Q8YA 4ZVTB 5DLGA 3OUYA 1RWWB 1E4FT 5D8HB 1XTZA 1PIEA 1FNXH 2BACA 2PE8A 2KU7A 1IBCB 3FQKA 4YN3B 4Z94A 4RNNA 3H3OB 3CC2S 2CAJA 5KPRA 3SUNA 3CCLS 2IYIA 1FXXA 2XLJA 5H9EK 4OLBA 3TOQA 3FEXB 2JOQA 3LGNA 4OQJA 1S9EB 2AEFA 2KJWA 5KFUA 3V1OA 1NG9A 3ZCMA 2IJFA 4O55A 3EN9A 4FLVA 5J1EA 1UVMA 2EPIA 4Q44A 3A3OB 6FD1A 3FQLA 2FD2A 4KRFA 1NSAA 3TUZC 3TWHA 1PC5A 1RCHA 2FBTA 2ZWOA 4URGA 3CJ9A 1AYEA 4DOZA 2GV1A 4BRFA 3CC7N 3L2QA 5A8RA 1NJYA 8ATCB 4NASA 1Y97A 2QKBA 1KBRA 1S1WA 1JB0C 2K8GA 3BS9A 1Y64A 3GIJA 5L1JA 4Z7YA 2DR6A 4I0WA 4QIWD 2J9CA 1JWWA 3DXKA 5L8RC 4DV0J 4FW1A 3WDOA 2ROEA 1X60A 4RW7A 1SUQA 3Q22A 2V4QA 4F3MA 4KGZB 3F44A 5GAEP 2Z2ZA 2DXFA 1AFIA 3G4SN 3FZLA 4JV5J 4L76A 2CZ9A 3CCJN 1VK3A 2Q31A 1T3OA 3IS9A 4QZVB 3B6BA 1SKSA 3LUYA 3PKYA 3RBXA 2XTJP 3MUVP 4CF1A 2HWHA 3R1XA 3PYFA 2XO7A 3LDSA 2EC0A 2GZOA 2XG8A 1S1VA 3H2UB 2CADA 1UEKA 2HFVA 3ZFVA 3OYBA 3UDCA 2WOMA 4Q2LA 2DRAA 2QLJB 5AE1A 3M6XA 2CQGA 3Q8QB 3C95A 2KXFA 4RUCA 1XMQF 3S3MA 3FRZA 1K0VA 5J2QB 3VVUA 3SXLA 3H5SA 5JICA 2GVZB 3K2PA 2XS5A 1HJRA 3MXJA 3I56N 2QL9B 2J8SA 3TEHB 4JKAA 2ALYB 4FL9A 3A5LC 4W92B 3QBWA 1ZYQA 5JMNA 5IWAJ 3A5MC 4ECRA 2OI2A 1WG4A 1N34F 2JVOA 2KG1A 2DY1A 3OTCA 5IT9O 3H98A 2ZHAA 2E20A 4RO0A 3E1YA 1Q4RA 2MZJA 1GLJO 2ZOGA 2GMHA 1XBWA 4KB0A 3SEOA 3MD3A 4E2FB 3ILOA 5BR8J 2B6AB 4OZ1A 3CIMA 4OZ3A 1VQPS 4ZP8A 2A3JA 3OYEA 2V63A 3C16B 2M8HA 3ZZOA 4KHWA 4NYNA 3TJ8A 2NS1B 4KGKA 4LBHA 4LF6J 3VGMA 2B4UA 1S0OA 2RILA 4IO8A 2R7QA 2GWJA 3OR2B 1I39A 1J5OB 4DX8H 3MEGB 3C6TA 2R8JA 5ETQA 2VFRA 3ATUA 4O4RA 5GAGI 3GJTB 2BE9B 3DFEA 1FRXA 2D9OA 3Q86A 4QS7A 4TNOA 4E7LA 2B8PA 3CDUA 3P4UB 4ZITA 1RGIA 4HCCA 1UJ4A 1UVIA 3VQEA 2ZH8A 2E7VA 2KT5A 1OY9A 1NOZA 3G8QA 2ZE2B 3VEOA 3OYHA 1R0BG 3V6KA 2MDAA 1MWMA 3UIQA 4UZBA 3O4WA 1RJJA 3PHEA 4NXNJ 3A5NC 2YKPA 5BRHA 2F1FA 2VPWB 4H03B 2VFTA 1VJWA 5CQGA 1U25A 1FXLA 3AGRA 4CJ3A 1CC7A 1B64A 2X6SA 2WK4A 3KD5E 4AL7A 5KG7A 2B7CB 2MZSA 4JI6F 2M7SA 4JI3F 1TKXB 2FJEB 1RT6B 1NHKL 2W2OP 2A1SA 4FF4A 3O3LA 1S12A 1T8EA 3J7ZT 4CNZA 2YKQA 1FRLA 1WAFA 1IR0A 2BOPA 2HMPA 4Y2KA 3GDQA 1Q8KA 4FW2A 4ES2A 4B3OA 4H4KA 3PW2A 4FLWA 2VJUA 3WUHA 3HCXA 1RYSA 4IO1A 4CIGA 2ALZA 4BC2A 2E5LK 4OYOA 2R8KA 2P9LA 4BS2A 1RB0A 3CJ0A 1NMDA 2F8EX 4OX9J 1TL3A 1RAGB 5D78A 1OY8A 1BI4B 1GX5A 1PJ6A 4P52A 2EW9A 4OIXA 4JI5F 1JL2A 2HWTA 2C3PA 5IQ6A 5AQFA 3GIMA 1FEEA 2AX1A 5LMNJ 2ERRA 4F4KA 1J54A 3DMJA 2J7WA 2NYHA 4FO0A 4M5NA 4KHMA 5KT5A 3VQ4A 5H9FJ 4FCYA 5AT1B 3AQOA 1IBLK 2QRRA 4QU6A 4LH5A 1UJ5A 4WIIA 1R8HA 1WC5A 1CJVA 1EB0A 2W9BB 2WSCC 1YI2S 1B7YB 2FJXA 1W2BM 2FJDB 3ZNJ1 5KFOA 4IG0A 5C42A 4NLSA 1F21A 2AA4A 5LXYA 1VRQC 3A8IA 2RPIA 1WF2A 2V4RA 2FXUA 3E66A 1RT5B 4HHTA 4EYHB 1Q8IA 4DL3A 3IXQA 4IOXA 2OEKA 3R5AA 1U1PA 1FD8A 3RRKA 5IT4A 3NOGA 4ZA1A 2ZWPA 5F41A 4KY3A 4JYAJ 1CXQA 3P1GA 3M9MB 3KNAA 4LMZA 3VGVA 3U4LA 3LDLA 2MYFA 1U1MA 3N4WA 4ED2A 4DR3J 1NCLA 5KFBA 3CJ2A 5AJ3J 3QT5A 1WC0A 3O9UA 3Q8UA 4JI8J 3OS2A 5JMVA 4M5GA 2LEBA 3EL2A 1EJ7L 2AEMA 3GG4A 4USWA 4PABA 5BXIA 1IQTA 3ZSXA 4RBVA 1U1LA 4CLPA 5AQWA 1OQ3A 5KFKA 5ETLA 3LQVA 1RUSA 2JFDA 2IDOA 4ER8A 2VF3A 3ZSYA 4CJPA 4IG3B 4KC5A 1WTFA 5DDPC 1NDCA 2HNYA 1WG1A 2R2RA 4UF4A 2N82B 1TFWA 4ELUA 3KK7A 1F3FA 1BQXA 3VETA 3THWA 4J2BA 1DTQA 4LQ9A 3LDPA 2MLYA 1PAUB 3BH7B 3I4PA 2GAHC 3RMBA 4DV0F 1RBSA 3VN5A 1KAYA 4OHXA 3BSOA 1DARA 3AA3A 4OJHA 3QFPA 3M2RB 2F4VJ 3KHHA 4AHTA 4NLUA 2I7PA 4A8XA 2PA8D 2M88A 4JV5F 5AQTA 1NGFA 2GEMA 1HNIB 3M6VA 1OWXA 5JS2A 4YOXA 3G6ES 3ZT4A 4CM2A 4BHQA 3JAMO 3W64A 2JC0A 1MU2A 2RU3A 3GV5B 1BGXT 3N4PA 1TK5A 1RHJB 4A47A 4DR6K 2HHXA 1IKXB 3HVTA 1LK5A 3BM7A 3LWMA 2P1JA 2V8VA 2G2OA 3RR7A 2JLFA 3SZ2A 5F8IA 3PDNA 4RBTA 5HMXA 4PKGA 3O9QA 2CH5A 4OGEA 1JLGA 1U8WA 4ES3A 1RILA 3W9IA 2GO9A 5FLXU 3PW5A 2VYPA 4BBYA 2WAQD 2IVFB 3MPWA 2C2RA 3UQSA 4PUOA 1KEKA 4M5DA 5J2MA 5C2FA 2QE5A 1U2VB 4NEYA 5IWAF 2A6OA 1K0TA 1SBRA 2HGLA 2JWKA 1GXTA 2GIRA 3OTOK 4DMZA 2PFUA 3DRPA 2DO4A 4G65A 1SH3A 3S9HA 5CCLA 1A0OB 3LPEA 5KAKA 2E5HA 2Y0SD 1BQMB 3WQPA 3KKSA 3LP2A 4TY8B 5LSOA 1KQFB 4NMXA 3BKTA 2YWGA 1URRA 2E2OA 3VQQA 2KYXA 5BR8F 4BGAA 2F8HA 4WPAA 2GQQA 3LPTA 4FM0A 2A10A 3SPZA 1Y00A 1QSYA 4LF6F 1S1UA 4MDAA 3PUFA 2QMWA 4B9UA 2DNPA 4OI6A 3NAEA 3S3NA 4A61A 3PSFA 4DR4J 1BISA 1ASVA 5GMKa 3AY9A 1RDCA 2HQGA 4NZ6A 2HNZA 3BGRB 2IA0A 4EIAA 4YOTA 2V0NA 2FHJA 3B8HA 1YBAA 5SZTA 2YWEA 2ZH7A 1HNXK 4E7JA 4C98A 1LWCB 3T5KA 5GIOA 1HFEL 1JLFA 3E01B 5EVZA 3MHYA 4H5TA 2XS2A 1JLEA 1JJ2M 1TV6B 1NAQA 3UNGC 4ZJOA 2JZ5A 4PPDA 4NXNF 3TSUA 4QYZK 1XMOJ 4BC9A 4LBIA 2CPZA 1KKHA 3PACA 2Z2YB 4CJTA 2UVVA 3PEJA 2W2QP 1ZAXA 1JLBA 1FCAA 2HHQA 1TUWA 3E3XA 3QESA 3J80O 2P6TA 4NLBA 2BA9A 3ENQA 5GADI 4IO9Q 5CABA 1FI4A 1VQ4S 1TKTB 2J9DE 1Q82T 3ZZRA 1GLAG 3MM9B 1YITS 2HLUA 4C2MA 1XUPO 2OO4A 4DR2J 2HF3A 2EXUA 2IBKA 2DXDA 1Q7YT 4JD2B 2M70A 3G8TA 3BQ1A 3MXHP 5AQKA 2O4IA 4F4AA 4OX9F 4C23A 2KRBA 1SS6A 2XI2A 3MWTA 5KFEA 2W9CA 4LJMA 3CQXA 1NJXA 3U02A 2VQFK 2NSCA 4CHZA 4CZCA 1TYQA 4AQYF 5KFPA 1VK0A 5LMNF 1VBKA 3VHQA 4JI1K 1VK8A 5L1LA 4K5SA 5B0CA 2H3EB 5M2UA 3MM7B 3RGIA 4ITSA 4LIRA 1VBYA 1Y7PA 4A8YA 4USKA 1HKBA 1XR6A 1RWKB 4KHPJ 3N5BA 1GNKA 1DBDA 3PX0A 2ACMA 2CA9A 2FHJD 1QE1A 3OT9A 2ZWHA 1X3NA 1FNOA 3GFXA 2K2PA 1Q0NA 4V1Ak 4RX6A 2OFHX 3DLEA 1H98A 3PFOA 2JVRA 1FERA 4HUEA 3BP8A 1YRTA 2NNWA 2IVOA 4AILC 2MZRA 3CC4S 1RT4B 1KAXA 2P5OA 4BCAA 2I7NA 4L3KA 3K5PA 3M8QA 4JUZA 1FA0A 2QWPA 3FVYA 4O0IA 3L4IA 1DJ0A 1QVFM 5AQQA 2VODA 2UXDK 4JYAF 3CCQS 5C7PA 4KV8A 1Q53A 4PY5A 4FVUA 4TU8A 3SQGB 4N8NA 5AJ3F 1S76D 4RW6B 3EE9A 5B08A 4JI8F 3TA2A 2RD5C 3BGUA 5FROA 5E33A 2LMIA 4X64J 5HRRA 4X4SA 2N4CA 3WHIA 4ZJQA 1I94F 2I9SA 4OVLA 3HPHA 2X6NA 2OSRA 3D2EA 1CJKA 5CZ1A 1K9MO 2FBYA 2IIHA 2VQEJ 3GIIA 4ILLA 4KJIA 4Y34A 1RXOB 3SMSA 2H1YA 2XZWA 2ZDOA 1IV0A 3FMWA 4IJAA 3A0IX 1PCAA 4FM2A 2GS8A 3KLEA 4E1NA 4CQ1A 3BF3A 2ZD1A 3RW6A 3BY5A 4FM1A 3BUZB 2IMOA 3SUPA 3C8YA 3C94A 2ZOMA 2M52A 4FXDA 4CHPA 2HHWA 5ETNA 3AA2A 2ZKTA 3KLGA 1FVSA 5HMZA 5CYMA 3OBIA 2D4WA 1H7XA 2O1PA 2MPUA 1RT2B 2B7BB 1IWGA 2X3GA 4CZJA 3U9ZA 3CO0P 1KLNA 2GMLA 3FRYA 4DMNA 5BYSA 1VOMA 1S5JA 1SKWA 1FJGF 4DPOA 3NL0A 3Q7CA 4DJBA 5I42B 4HTUA 2UUCK 4IWVA 3LP0A 5KFTA 4B9LA 4E89A 4O3PA 4B08A 2ZGYA 3VF0B 3A12A 2GO8A 3FZ2A 3NF9A 4FS1A 1R8CA 2RH3A 5C5JA 2ABYA 1VHXA 4LF9J 3RSEA 5CR4A 2FC9A 4PQUB 4CTAA 1KS2A 3H4DA 4K4VA 3H90A 3CJ1A 1L3UA 4MH8A 1L3KA 3L8BA 3PEHA 4XTTA 3MD1A 3PIOQ 4PKDB 1U1OA 4KAZA 2CH6A 1WHWA 3GB0A 2KM8C 3RZAA 4OI2A 4D3GA 1LWFA 2X7IA 4BRMA 5C24A 3AVNA 3BZQA 4F4WA 3SFUA 2VGMA 2ASMA 3TNVA 3HRGA 1HNWJ 4C9DA 1VQON 4B1XB 2VASA 1VQNS 3CJAA 4WWSA 1DZ5A 2AGPA 2CQ0A 5ETRA 3OQ2A 2Z1JA 4WQ5C 4MK7A 1H72C 3HLUA 3CCRN 3P5JA 5EOYA 2B4PA 4PL7A 3K5OA 4IXCA 5FDLB 3RVCA 4CJKA 4O0JA 4GRSA 3KHLA 1RA7A 1LFPA 4GKKK 4DS4A 3SCJE 1FJ7A 4C8ZA 4DU7A 3DOLA 2RF2A 3THXA 2YNGB 2C28A 5KOWA 1BG3A 4LFAK 4ED0A 3DYAA 4ECTA 4XIUA 3E2EA 3ILJA 4DR4F 1FHTA 2V67A 4GKJJ 3DOMB 1QTMA 4DFPA 5JJBA 1T6CA 4FWQA 2CPHA 2MHNA 2HOEA 4QU7A 1X4AA 5M1QA 2KW4A 1JLCA 3J7Z5 5HLFB 4U7BA 5M1PA 2OD4A 3CETA 3MWPA 1Q5YA 2UUWA 4DCJB 2OPQA 1OS5A 5T41A 3D28A 3E9PA 2UUAK 4KH5A 1VSHA 2FVRA 5AQNA 4FLXA 5TKWA 3FJ2A 1Q81O 2O8CB 1FESA 1NPRA 1G6BA 3CD6S 3EMTA 1E4GT 5DK5A 3FR0A 4DTOA 1XMOF 3MDFA 3HSGA 4ED8A 2BTFA 3BBBA 1WSFA 2BGGA 4DSLA 4O5BA 1NK5A 3MMBA 3R9PA 1KP6A 3R8YA 3NCRA 3NVMA 1UZDA 2XYHB 5G4DA 4DV7K 3LP1A 1WN7A 3V6DB 2V5HG 1BXNA 3X3UA 3CW2C 1VQ5S 1RKJA 1IKVA 1SIWB 3ZSWA 2K3KA 3K0SA 2CQPA 3EGVA 4LFCJ 2EG1A 3RAMA 4ZVGA 4DR2F 2EFVA 4I2PB 4AD6A 2GGPA 1ULRA 3THYB 5FIIA 3BDEA 4PG4A 4X65J 1UPMB 2HFSA 4WU3A 1KCFA 2HK3A 4WTYA 1R8PA 1WTBA 2QZ8A 4USUA 3WX8A 4TYAA 2XY5A 2WTUA 5T7BA 5E41A 4O23A 1MWQA 4LH4A 1JLAB 4FWLA 2CGJA 1IBMJ 2F5GA 1FT8A 1EKEA 2L9WA 2AV5A 4UUWA 4DX6A 3AY0A 4E7IA 2HG4A 4DR1K 3OFHA 2WFBA 3FBCA 3O1WA 3EZUA 5DDRC 1GLLO 3WEEB 4M42A 2JX2A 2E2PA 1S99A 5AQOA 4WIQA 2AJ4A 8RUCA 2Z1IA 3OV7A 4IFEA 5AQPA 2BE2B 4W90B 4B3MJ 2QEXS 1R8AA 3TYTA 2BQ3A 3K89A 4BRAA 3QWPA 3SV4A 2VWJA 1ZTTA 1I51B 1CJUA 3SQOP 3OL6A 1HARA 3TARA 1M5KC 2B51A 4OZ5A 3ALYA 1SC3B 3QBCA 3Q83A 2R7RA 3MEDA 1FKOB 2DEIA 1M1KT 2YWKA 4NB4A 1IBKK 2WONB 3PYGA 5B0BA 4NCBA 3LDNA 1H73A 1YQHA 2NREA 4K4ZA 4P10A 3Q0AA 3DWLA 1WOSA 1IO2A 3NS6A 2IM1A 4ILHA 3R97A 2D0AA 3T6BA 1GXUA 2QLWA 4DN9A 2MKYA 4UT4A 2ZM6J 3JXUA 2W6KA 4DS5A 3H6EA 4GW6A 4MIBA 2W01A 1TL4A 2MGZB 1FEHA 4I69A 2BV3A 3VVTA 4XH1A 1R0AA 1FDNA 3M4XA 3GQCA 1HBOA 2YTCA 2HQDA 2GMJA 4B3RJ 4X64F 3QMQA 1FD2A 2VC1A 3BB5A 1YIJN 2X78A 3IRXB 5KG5A 1QSLA 1RT7B 3CC7S 4PR6A 4F2SA 4U7UK 2VQEF 3EX7B 4CK1A 1UVKA 1V6HA 1S59A 4QWBA 1PILA 3RR8A 4TU9A 2E1CA 1N52B 2BKPA 3MI7X 2W2MP 4KFBB 4DU8A 3AVBA 3CCVS 4BR7A 2OPSB 2Y9HA 1HUXA 2OLWA 2E6MA 1S4EA 5AQRA 3C0BA 2HW3A 3I8DA 3JTNA 1P27B 2FVPA 3J7YU 5DQIA 1N56A 3G4SS 1BCMA 2KT3A 3U7JA 3AVHA 1M5HA 3CCJS 2ZH5A 1ZBHA 1O0PA 4TY9A 4OX8A 2VBZA 3JQJA 1NLKL 2QM1A 3HSZA 2ADCA 5LJVA 3W9HA 1RADB 3T69A 2V8PA 2V34A 5GAHU 2JLEA 1EP4B 3U1LA 3V81A 2W2PP 2HHUA 3A13A 4DQQA 2VG6B 4JI7J 1J2VA 2BKNA 5LY3A 5K8NA 2L9DA 4KGXB 5HAOA 5HQ8A 1A9NB 1VQYA 2LSNA 3M6WA 4LF9F 1S97A 3HHLC 1FKPB 1OY6A 4U8VA 4FPRA 3NP5A 1WG5A 2VKRA 1RAIB 1SIZA 4ED3A 3DU5A 4B1ZA 3I56S 3FCWA 2C3OA 3H0PA 4OX6A 4L8RB 2O8DA 1JNRB 3QRQA 3OYMA 4CJSA 1IG9A 2QSFA 4ZLPA 3M30B 3VQTA 2ZH1A 1F60B 4QOTA 3D0GE 2DY9A 5EXWA 3VAKA 4AXIA 1PKUA 4EUVA 1SJQA 4I68A 3M2UB 2L41A 1X3MA 2KB2A 3HSTB 1XMQK 4IDKA 2WCXA 5J1PA 3KUGA 4F26A 3NOCA 3JYTB 2ATLA 2EKNA 3MTJA 1HA1A 2M0GB 4EEYA 4TVAB 3I5AA 1REVB 2V94A 3UE5A 2R9LA 3OTDA 4FBUA 1HNVB 3EZOA 4YDDB 4ICLB 1LW0B 3W5YA 3KHYA 4X4NA 3H2VE 3T1HF 1N34K 2HQFA 3NWRA 4RWXA 3G25A 2FZKB 2GQCA 3SCXA 3ATVA 2UZAA 4RG8A 4BRDA 1HBMB 1M5VC 4GKJF 4WCEL 1C1BB 4LUBA 5AQZA 4HYKA 2YNFB 4PL8A 4YB1P 2VD3A 5HJYA 1SAZA 3ENOA 5HANA 4KT0C 3CERA 1AROP 2BVZA 5THWA 1FE4A 3KWGA 1NGIA 4X2BA 1RTDB 1V3ZA 4DWIA 1MMLA 3LDQA 2YHBA 2HVDA 3AH6A 3AARA 2ZUAA 1F5CA 1RDUA 4FKXA 5J2QA 4JI2F 5HI7A 3TTDA 2AMCB 2GVZA 1XN9A 3VAIA 5DJBA 1NM2A 1FTRA 4OZJA 1CLQA 2LKZA 1LV5A 1NBWA 1X31C 4DSFA 2UV8G 3IFRA 1G4CA 3A4TA 2V8DA 4LFCF 3CQYA 1JKHB 4ZP9A 1IJJA 1WB9A 4OLAA 2MZTA 2YBVA 4PXDA 4K4WA 3PRBA 2CNKB 4F3QA 3QIPB 2NPIA 2KZZA 4X65F 3D0IE 2LQJA 1RKIA 2NR0A 4O44B 3MMCB 4FJXA 2XYGB 1SH2A 3N5FA 4BQZA 3US5A 4DUZF 4ERDA 2IDLA 3EYZA 2RDIA 3IRWP 3ZC4A 3P5BP 4WFBL 4JI6K 2HBYB 4JI3K 3BBFA 2B6AA 4DSIA 1IBMF 2WVEA 2QA4G 3CCSS 3TAPA 4L6V3 3C6TB 1RU2A 2CG8A 4K8RA 3C16A 5BYRA 4OZ2A 3HMJG 2GIQA 1S49A 1PBAA 3SDEB 2CQ4A 2OZSA 4BDZA 1HPMA 2LCWA 3HZ6A 5MLCV 4Q8EA 4JK7A 3OR2A 3K0JA 2FUG9 1J5OA 3OD2A 3MEGA 5FJ4A 4B3MF 5EUHA 4BRPA 4DTNA 1ZPWX 1RCXB 3DGPB 1N5SA 2GIFA 3ADAC 4O3QA 2HHHJ 1YTYA 2KFZA 5T7LB 3P96A 1SJ1A 3BQ2A 4FJMA 2YKNA 4Y65A 1FWKA 2O67A 3EE3A 3MMAB 2ZE2A 4JI5K 2BXJA 1FXDA 4ECVA 2O3DA 1WSVA 1AUSL 2PN6A 3AVFA 3T19A 4GVEA 3UCZP 4B9QA 2GAGC 1FWPA 1RAJA 1R59O 2HHPA 3VEYA 1TL7B 4C3KA 1TKXA 4WF9L 1RT6A 4ZTJA 3HHDA 3DHWC 1YF5L 4CF8A 1PSDA 1MA9B 4AHRA 2O8FB 3LO3A 2R8HA 3VGKA 4PEOA 3CWJA 3MPVA 4DQSA 4B3RF 1I5OB 5GAGU 5CH7B 4QS9A 2GFFA 3MAHA 3MAQA 3LGMA 2NSBA 1FJCA 1ZOTA 3RMAA 5AQSA 3V6JA 2RHQB 4AUKA 2DGQA 2YHXA 1QHAA 1FFSB 2YJEA 3DMJB 3PSIA 4CLZA 1BI4A 4F9OA 3K5LA 2H3GX 2VWKA 2MY8A 1HR0J 3D9BA 3TWZA 1L5UA 2XMKA 3TSPA 3QEXA 2DISA 4RTFD 3T3FA 1YJTA 4HUGA 1Q79A 5CHCB 3AVAA 4B9TA 2KN4A 3J7ZO 4GV9A 2D74B 2Y1JA 3BV8A 3EEQA 5E3QA 1Q18A 4KI4A 2UXBJ 1U0HB 3QEIA 2KO1A 2W9BA 2FSNA 3VA3A 4JKHA 3W2VB 4BRQA 3Q24A 2AJ1A 3ETOA 1QUPA 2EWSA 2XO6A 2A42A 1SC6A 5D3GB 1WNSA 2B43A 4MQ3A 1FF2A 1HYSA 5IC4B 1EZZB 4JI7F 3SUQA 1RT5A 3AA9A 2RRNA 1UP1A 2E1YA 5A6PA 4EBDA 2BW7A 4YORA 4LF8J 4MLHA 1VBXA 3KHGA 4MMOA 3GFHA 2JWLA 3HFVA 5EY4A 1JXEA 3HVRA 5AXMA 1LCUA 4QJVA 5KRTA 3AA5X 1EARA 2FLOA 4USTA 2KTQA 1ZA2B 1NJZA 1B70B 2ZQBA 1KVJA 4DTUA 4CF2A 1IXKA 1RHUB 1SXLA 5D4PA 1ZBUA 1GAOA 2P9PB 1X4EA 3QSIA 2HVIA 1RLCL 1UAWA 1NH8A 2HNYB 3ASMA 2ZFHA 4DFKA 4C8OA 1SI9A 3PR4A 2CPDA 5KQ8A 2C42A 3DLGB 1M90T 4ED4A 3AAQA 3V2UC 3QEPA 2VZ9A 2NRHA 4DEZA 4M45A 4CJQA 4IG3A 4JI0J 3R5JB 1FFWB 3R6GB 2ETJA 2FSJA 2GV9A 2LU1A 2FGOA 2IVMA 1ZBFA 4RW9B 2P8IA 4UUXA 2NXJA 3PZPA 2AYMA 2W4PA 2PI4A 2RSQA 3GMGA 4A62A 2RUGA 3OYNA 4YQWA 4HUFA 4DV1J 3IM9A 4RU2A 3M2RA 2IC3A 3VEZA 2YWFA 4YR0A 4LSNA 4ZLLA 4TU7A 1HNIA 2YX1A 1GTHA 4X62J 1WC3A 2YX4A 3ZZ0A 3R5DA 5IQQA 5KT7A 4BGBA 5E5NA 3OYCA 5BR8K 5ETSA 2NUUG 1UJ6A 2XMJA 1WNEA 4LY7A 3MR5A 5L1IA 2KJVA 2I0XA 1IKXA 4LF6K 3CCTA 3T9NA 4B8AB 3A1YG 4LREA 3HVWA 3GV8B 4M63C 1NLVA 4PG7A 4ZLJA 2E5JA 3CNQP 5E0OA 1BA1A 5K20B 3R8EA 3C14B 2CPIA 2AYGA 3AO2A 4QIVA 3SAFA 1UVNA 4RKUC 4OYWA 3F5TA 2PYLA 1HKGA 4Q7AA 4CJ7A 3P8BB 1JJCB 4UW2A 1IJFB 3VMFB 1U2VA 1VQLN 1KHVA 3H3NO 1SJ3P 4CI0B 3Q2TC 3TVYA 2AT1B 4IFYB 3TZXA 4NXNK 4C4WA 4YDUA 2PEBA 1G7CB 1T95A 2B8QA 1EAYC 3AQPA 3DLBA 1NU0A 3JSRA 3WBZA 3GJRB 3B4DA 1LXJA 1BQMA 4U67L 4DV4J 3HJVA 4NXMF 3EVMA 4P74A 5GMDA 1OH7A 3TR8A 1BQNA 3SBMA 1RWPB 5KFNA 2VG5B 3GOIA 2QGFB 4L74A 1QAJA 5D0EA 3AODA 5HQLA 4P7VA 4S0MA 2HS0A 4Y00A 1YVFA 3TRGA 2YJFA 5HROB 4GVMA 1TUYA 4E7KA 2DD8S 4CE9A 2QYCA 4U95A 5DGBA 4YDXA 1PJ7A 1D0EA 4B1YB 5I3UB 3NY0A 1N0UA 1A5WA 1JLFB 2X51A 3BGRA 3OXGA 1NKCA 5HVFA 2P9SB 4K8XA 1YT3A 2FHOB 3D68A 2NLXA 2Y1RI 4DHVA 3TZZA 4OX9K 2HNDB 5LSLA 3BDPA 2D3O1 1CEZA 3O3HA 1WSGA 4WE1B 2U2FA 3HULA 3TANA 2HMIB 1LWCA 1H74A 1T3NA 4JK9A 4MDBA 1JLQA 3UWTA 3E01A 1WOOA 4URQU 4ISEA 3RB4A 4B9NA 2ZJPL 4AQYK 3GL1A 4LR9A 4PRFA 5LMNK 1TV6A 4MLEA 4TN2A 5H9FK 4B9MA 4C1NI 4M41A 2DGUA 2DBBA 3S01A 3F0NA 3CB4A 5EU7A 1KTQA 2EWHA 4KO0B 2AJQA 3P38A 1S0MA 2P5GA 3L2VA 5AQGA 4CT8A 2VFSA 1WHXA 2JEJA 3OHBA 1EWRA 4AHVA 4CZLA 1VQ9N 2FJAB 5HO4A 3T5HA 1DQ8A 2XM3A 3MM9A 4B3SJ 4Q8FA 3U3GA 4Y1CA 3WNEA 4LF4F 5GVQA 3K2YA 2CDQA 2AF6A 2Z56B 3IG1A 5A6WA 1QQOA 2OHDA 5AXKA 3L09A 4K7QA 1SC4B 5GAGP 3LH2S 4ZVSB 4JYAK 5FPDA 5H9EJ 2YWWA 1KFSA 1UETA 4B1VA 4G1PA 1Q7LB 3DDIA 3W2WB 1QVGR 2QC3A 2DNMA 5AJ3K 3RBEA 3SMZA 4BR4A 3QT6A 4X4UA 4DV5F 4JI8K 3R7NB 4DTSA 1N5YB 1F3VA 4CLYA 5HRNA 3D4JA 1I94K 3NBPB 1PYOB 1TR0A 1AZSB 2JNJA 1Q82O 4J9KA 4X4OA 3PX4A 1UMJA 1VFJA 1NJIT 3RYLA 3DLEB 5F8JA 2X74A 1QAIA 3MM7A 3J81O 5ETKA 1MROA 2UXBF 3SCLE 4RCHA 3OS1A 3GFYA 3ULEA 3UN5A 2XHBA 4I6YA 2P9KB 2V2ZA 4C3LA 4OV1A 1K9MT 1U7LA 3KKRA 1N48A 2ASOA 1XHXA 1M5SA 4YOUA 1RT4A 3OHAA 4CNYA 5SWMA 4DTMA 3VQCA 1TUVA 2DGVA 2CWKA 3QJJA 1B0PA 4HT5A 4FPAA 2OAUA 3EE8A 2NCKL 1GMUA 1GXLA 4LF8F 4KIAA 1RGVA 4Z37A 2P9EA 4GC7A 5F3TA 4ZLNA 1GLDG 2U1AA 1NJWA 2XY7A 1D09B 4L75A 4C11B 1BO5O 1X9SA 1S1XB 3R5CA 1QSSA 3KMQA 1YJVA 1FJGK 2CJBA 4NE9C 2G1HA 3PKMA 2DR7A 3SQGA 3L3UA 4RW6A 4IO9L 1FRMA 2P51A 5KFGA 1W97L 1VSJA 1XWLA 3B6PA 2AZ1A 4YMEA 1U24A 1E6VB 1EXQA 2E7XA 2UVUA 1JJ4A 1RHMB 1S79A 1VQOS 2WB1D 5B8HA 3DLLL 4JKCA 4CLLA 5L9NA 4WFYA 1RDDA 5KFVA 3ZX0A 3Q89A 4CJWA 4Q2MA 1K44A 3PCOB 3CCRS 3RRGA 4CI6A 1JK9B 4JI0F 4YB5A 4XO0A 1R31A 4P75A 4ID5B 4PWUA 3MN9A 4YY3J 3SK3A 3GCWP 3LOUA 2DNYA 4CJFA 2VG7B 2IMWP 3NAHA 1C0TB 4RWWA 4YR3A 3PO5A 2GJFA 3EGNA 3FK4A 2YNHB 1TK8A 2H51B 2VKZG 2DTUA 3FSXA 2HYIB 3IAM9 4ANCA 2BMBA 2Y0BB 4DV1F 1EKRA 2ZGZA 3HSCA 3J81Y 1NOYA 4M3YA 4N56A 2A6MA 2G8IA 3DM2B 2PO4A 2LYVA 1RT2A 1RFQA 3T1YK 4X62F 5H1SV 3QGIA 2FHKA 4ECUA 4QR0A 1B9FA 5I42A 4CO5A 4UOGA 4Y2CA 2R7SA 5ELZA 1Q8BA 4FLZA 3MN7A 3AGKA 3EWGA 2XCAA 1WEYA 2D3UA 1SJRA 2M3DA 2HFOA 4IOAQ 3UE2A 1RWXB 2LU2A 2IVPA 3G0ZA 3U8XA 5IOLA 1GEHA 4PQUA 1CG2A 4WBFA 5AE2A 4OLPA 1C0UB 4F50A 4QR1A 2MY7A 4RNHA 2R4FA 3EY1A 5C24B 2W7AA 3H5YA 3VCDA 2HLTA 2YHYA 4OKJA 2BQUA 4QWEA 5K8PA 2FHMA 2PGCA 4FWMA 1LKZA 5C2GA 4DSJA 3VF4A 2ZBRA 2XC9A 4P2SA 3KJQB 4WQ4A 4MK9A 3JTPA 3OJUA 3R2DJ 4RZRA 3EGZA 2Y8YA 2KI2A 1O13A 1XMOK 4MO4A 2FC0A 3OBWA 4I7FB 4MFBA 4FWRA 2HZVA 2OEJA 2JLGA 1Q81T 4NLGA 2QWRA 2KXNB 1ZAWA 2IGIA 3TAMA 1SQFA 3KYLA 1LXNA 2RQCA 4DV4F 1UKUA 1PG5B 2RF2B 4OKKA 2NLWA 1TAQA 1XIQA 1VQ6S 3LPUA 4H0OA 4LVOP 5FDLA 2J9DA 1ZM3A 2L48A 4YR2A 2QL7B 2G8HA 3CXCR 2ATCB 1S5ZA 3CJCA 2VCPA 5FPEA 1QD1A 4DR2K 5HSPA 3C2PA 4H54A 2K7JA 1OH5A 4CH1A 4CECA 1NGEA 4H5WA 2QXLA 3L9ZA 3DOMA 4Y0WA 5KFRA 3O80A 2ZZNA 4DKWA 2ASDA 3BSAA 2E5LJ 1JCEA 2OMOA 4RNFA 2GHWA 3IMXA 2YQ0A 4IDHA 3TX0A 1Q5VA 2CQBA 5HLFA 2Q1LA 2PDAA 1WI8A 4OI4A 4IUFA 2DIVA 4Y1DA 3IR7B 2QA4N 3NGIA 3MM6B 3OYDA 2IIRA 2O5DA 1X4BA 1IR1A 1BY9A 3MMBB 1ACMB 1N32J 3L0QA 3PFEA 4CK3A 1J53A 2O8CA 2IJRA 3KLIB 4FJ8A 1U2RA 2LDYA 3CDEA 4E0DA 4ZPTR 2W1BA 3VEWA 2MKSA 1DEJA 1S7IA 4ZP7A 2PD1A 5IXUA 4AL6A 5AXLA 3V6DA 2AYEA 3KJFB 2DK2A 2OP5A 3D6TB 1S77D 1VDHA 4FYDA 1Z26A 1FW6A 4B1WB 2GELA 2YCHA 5DDOC 3QFUA 4DF8A 5CY4A 1U2CA 1IVZA 2Z1GA 4R25A 4J7CA 4ZTFA 2W2NP 5JVHL 4JKDA 1YIJS 2I8EA 4B3SF 4M1KA 1K47A 5B0FA 4IRDA 4J9RA 4MKVA 3THYA 3N9UC 2XMMA 3KK3B 3CIPA 4BACA 4F7VA 7FD1A 4DU3A 3BO3A 1G1XA 1NGGA 2MKCA 4OJGA 3IWXA 3CI5A 3U1MA 1T9TA 3SNNA 2JDJA 4HL9A 1ASUA 2FY1A 2QWNA 3V9XA 3I0SB 1RSCA 1MMNA 3OHRA 3FNNA 3OA9A 3QICA 2ROGA 4DCPB 1JLAA 4N7TA 3KLHB 1R8BA 2VDIA 1CXUA 5KGXA 1QVGM 4OFZA 3CJ5A 1XJWB 1CULA 1DGKN 5F2RA 3WEEA 2K1RA 4X64K 2AQ4A 1YWXA 4NA3A 1H38A 1W25A 3I32A 1HI8A 2ZVSA 5BN8A 4ETXA 4CIOA 2F40A 2BE2A 1KD1O 2A0FB 2PEHA 1C2PA 2EEYA 3PHTA 4NEZA 3MEDB 3O5BA 2VQEK 1IKYB 3KOAA 3RWUA 4OHWA 1VR6A 4B9VA 3HT3A 4DCHA 2YV0X 4KQZA 4QYRA 3K7RA 2Y8WA 3J7YI 1DQAA 5M2PA 1FKOA 3TQ1A 2ZEJA 3NEKA 4MYUA 3DN9A 4IRCA 2WONA 3M9OB 1BWFO 4CJRA 4XPEA 3TQEA 3CCEN 4PHTX 4EBEA 4ECYA 2FVQA 4FS2A 2IRYA 3MFHA 1DY3A 2DR5A 3C46A 2ATQA 2YNIA 3DRSB 3TJAA 3MCSA 3PV8A 4QBUA 2HHTA 3D7SB 2UXCJ 2CDRB 3F9MA 3ISND 5KFSA 5GAHI 1OJ4A 1R6VA 3TJ9A 1N6QB 5KFJA 5LXRA 1WUAA 4EP4A 1YJRA 4LRCA 3ZT0A 3IM8A 3NNHA 2MGZA 4NLCA 4Z4CA 4W5NA 1OYEA 3D3BJ 2PFDA 4DR6J 2CQ1A 2WHOA 4JKGB 2V6AA 1V4TA 4LF9K 2HIQA 3OR1B 4M5MA 2DRBA 4JI4J 1OKJA 1YBUA 3IRXA 3VGUA 1U04A 3NMUA 1RT7A 1ZBTA 4KHYA 1XQIA 1BA0A 1KOHA 5HVGA 3A5OC 2EBEA 3NGRA 4ECXA 4CH0S 4X4VA 3D1HA 3GCXP 3QMLA 1HMVB 3OFGA 3O9SA 3QFWA 1CC8A 4YY3F 3MR3A 4KFBA 2WVCA 3MURP 4CRJA 2OPSA 1W7AA 1PO6A 1S0NA 5DG7A 3CIZA 4WCEQ 3NRBA 3TABA 3IR6B 2BR0A 2LEPA 2AYBA 1NHVA 1YZ7A 3ZT1A 3WQTA 4PKHA 4OPHA 4AYBD 1NNEA 4LT6A 2QFJA 2KZMA 4E19A 4NA2A 1VSDA 1SL1A 2FSKA 4L3QA 2JWNA 3EZ5A 4IH7A 1ZBIA 1RDRA 2Q6BA 4Z4IA 2GJ2A 3AXMA 1HWJA 2OJ3A 1T44A 2XMUA 3KDNA 3K5NA 3IUCA 2VBWA 2MSTA 3ULHA 1EP4A 4FXWA 1BWEA 3CJTA 4H5VA 4I64A 3A2FA 2VG6A 2YQ3A 4A48A 4R0JA 3RTVA 3T1HK 4A8MP 2Q79A 4F67A 3SIPB 1X0FA 4W4MA 2O8DB 1OPIA 5GIPA 1FKPA 5F0WA 4DR5J 4WYBA 1Q9XA 4J2DA 4A8OA 4GKJK 2ZKUA 1CPZA 2ROPA 4M5HA 1RAFB 5E3CA 2CJQA 4PAAA 5KFCA 2X1GA 2D7SA 4KHNA 4HCBA 4IDKB 3M30A 1EX4A 1VQPN 4DV3J 1EWQA 3BZCA 3M2UA 1VIXA 4QYZJ 4WFBQ 4H0YB 1X0PA 4OV6A 1LWEB 3LTOA 4JI2K 4FJIA 3JYTA 4HEA9 2J6SA 1YJ9N 3IBWA 2CNLB 3QNWB 3AB4B 2A3ZA 1BUXA 4P7TA 1FE0A 3O3FA 1NKBA