3NH1A

Crystal structure of rnase t in complex with a preferred ssdna (tagg) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh1A00
3JSMA 4Z4HA 2Y1IA 3AVAA 3ZT4A 1VSEA 2E4LA 2ZE2A 4CF1A 4HUFA 1NJXA 4Z4GA 3MECA 5KRSA 3CFRA 3BGRA 1UAXA 5EU7A 4LH5A 3TAEA 3L2QA 3QEWA 2YKMA 1ZBUA 3DLEA 1D5AA 4W5RA 2X6SA 3HM9A 1NK8A 2HNYA 4FJ8A 4F2SA 3EYZA 5KTQA 3TR8A 1ZYQA 3NGIA 2GV9A 1VSKA 4C8NA 4AH9A 4TSXA 3OS2A 4CJFA 4FLYA 1JKHA 4GMJB 4OPJA 1L3SA 4CCHA 4CEZA 4M3TA 4CFDA 2FBXA 1C6VA 3AVGA 3KJVA 1RT4A 5C24A 1BQMA 4ID5A 3K59A 1HYZA 4BE1A 3SJJA 2XY6A 5CYQA 4CJUA 4HHTA 1C0UA 3HK2A 4GW6A 2FC0A 4XIUA 3LP1A 1CLQA 1X1PA 4C8MA 4B8AB 3L2RA 3SQ0A 4B9UA 3DRPA 3V9WA 2ATQA 4KHQA 1LWCA 4DSLA 1UOCA 3AA3A 3I8DA 3K5MA 3P1GA 3MEDA 4J2AA 4IG0A 1TV6A 1S9GA 2D0CA 2I5JA 3DYAA 3U3GA 4CFBA 3OYJA 4JRPA 3QETA 3S3NA 5HLFA 1RDCA 3KIOA 1QTMA 1B92A 4LD0A 2IDOA 3AV9A 5CZ2A 1BI4A 4MFBA 3JYTA 1TK0A 4CK2A 2A1SA 4W5OA 3OYIA 3VQAA 2D0AA 1R0AA 1RDBA 4BWJA 3ZSWA 1CXQA 4CEAA 3IG1A 4CJLA 4CF9A 4CK3A 4FCYA 4B9LA 3WNHA 1FKOA 4K8XA 3V9UA 1TAUA 3OYCA 1RTJA 4DFMA 4KHUA 3M8SA 1HPZA 1JLGA 4DF4A 1LW2A 2QXFA 2F8TA 3CFOA 3OYMA 1VSMA 4DS5A 3PO5A 5FRMA 1S1TA 2OZSA 1U49A 1VSIA 4CJTA 4BDYA 5CZ1A 4KPYA 2VG7A 4AILC 1CZBA 1TGOA 3AA2A 3K2PA 5HP1A 1NJWA 4CGJA 1T7PA 4BDPA 4FJMA 1TKXA 4KTWA 5KGXA 4CJEA 2FBTA 3OYBA 4ELVA 1SV5A 2G8WA 3NH0A 3K5NA 3HP6A 1IKVA 4HCCA 4CEBA 2JGUA 3HPGA 4ID1A 4B08A 4KB0A 4FLZA 1NK6A 3ZCMA 1EETA 4IBNA 1WSFA 2XO7A 2VWKA 4EP4A 2P5GA 1DLOA 5CY4A 1SKSA 4CE9A 1O1WA 2P5OA 4CHPA 2Y1JA 1HJRA 1FKPA 3TAMA 1YTUA 3QEXA 1RBTA 1UA0A 3AVCA 1XHXA 4CJSA 3T1AA 1S5JA 2KZZA 1GOCA 3S3MA 4OGEA 4DU3A 1YT3A 2HHXA 4KHNA 1HMVA 3AA5X 4N5SA 3NF6A 1JLFA 4DTNA 3L2UA 5HROA 3SNNA 4CHOA 1S1XA 3B6OA 4E19A 3OYLA 4O0IA 3F9KA 3M8RA 1I3AA 3M8QA 4IFVA 3U3YA 1VSHA 1C1CA 1A5XA 1TKTA 3KLIA 4JS5A 5CYMA 3LP3A 3PX0A 4CK1A 1LV5A 2RN2A 4BWMA 4AHSA 4DU1A 1N5YA 4E7LA 3QIPA 5FROA 1BIUA 1D8YA 1WNSA 3I0SA 4CFCA 3KD5E 1RBSA 1VSFA 1ITGA 4WE1A 3LWMA 3AVHA 3AVLA 2E6LA 4CESA 4EP5A 3OYKA 4DS4A 4FM0A 1SUQA 4DTRA 1L3TA 3OS1A 3DLBA 2G8IA 2R7YA 4DTJA 2HHWA 1RDDA 2P1JA 3OYEA 2VWJA 3RMCA 3PUFA 1QSLA 2DTUA 1HYSA 1EXQA 4Z4IA 4CJPA 3KD1E 3SQ4A 1SL2A 2DFFA 4I7FA 3SQ1A 4FW1A 3OYGA 4BACA 4IG3A 1KVAA 3U6FA 3MXMA 1VSLA 3HT3A 1DTTA 3QEVA 2XRIA 1NK4A 4W5QA 3LZJA 2OYQA 1EP4A 3LANA 2ETJA 3AVJA 4CJVA 3DOLA 3ZSRA 1T8EA 3NDKA 2HHVA 4E1MA 1L5UA 1VRTA 2DFHA 3MXJA 4O5BA 3LPTA 4IDKA 3TAFA 1WAFA 4ICLA 2IGIA 4AHVA 2IOCA 3QNOA 3L2VA 4CGIA 4RG8A 1VK0A 3AO1A 4KI6A 1U04A 3HJFA 3PO4A 1IKYA 2B5JA 1S9EA 1ZBFA 2PYJA 1T05A 4M3RA 4DSKA 1ZBHA 3ZSXA 3NGYA 5DMRA 4HCBA 4RW9A 5HRSA 1QHTA 3F73A 4FXDA 4O44A 4CIEA 3AO2A 5C25A 4CJ3A 3SCXA 1VSJA 4KHWA 4O0JA 4F3OA 3VQEA 1RDAA 3TAGA 4KRFA 1YVUA 3NGZA 3NCIA 2PYLA 2G8FA 4DSFA 1S1UA 1WSEA 3DOKA 3OYDA 1ZBIA 4GVMA 1NKCA 4LH4A 2HW3A 1RT7A 4AHCA 3V1OA 1EX4A 4CHZA 1Q9XA 3AVKA 4PQUA 3OYHA 5SWMA 2BGGA 1J54A 3VQCA 3OYAA 4H4OA 1L3UA 1LWFA 2XHBA 4K8ZA 4OJRA 1K6YA 1TL1A 1XC9A 1WN7A 1IG9A 2GBZA 1KFSA 2YV0X 3SUQA 1NKEA 1JLAA 3C6TA 1RBVA 2ITGA 2YHAA 1B9DA 2IS3A 3QO9A 4QAGA 1KRPA 4FJNA 2HVHA 1W9HA 2KQ2A 2D5RA 3OJUA 3RRHA 2D0BA 2VG6A 4LSNA 4F4KA 2FBVA 3PV8A 2BE2A 3VQ8A 1HRHA 2VG5A 2KTQA 3O3HA 3HP9A 4CF0A 3C95A 4RW7A 2X78A 3AO4A 3ZSQA 4F3TA 4EZ9A 2RPIA 1QE1A 3AVNA 1WSHA 3DLGA 3P5JA 4CERA 3O4NA 3EY1A 4DQPA 1LAWA 1U45A 4DQIA 4CJQA 4M3ZA 3AO5A 3HO1A 4DFKA 4C8OA 2KFZA 4CEEA 4RW6A 3V1QA 2B6AA 3P83D 3I0RA 3LALA 4Z4CA 5HRNA 3K58A 4KHYA 4Z4EA 4PY5A 1KFDA 4IKFA 2JLEA 3NFAA 3L8BA 1ASWA 3QIOA 3B6PA 1XI1A 3V1RA 3KK2A 1N6QA 1TKZA 4BDZA 4B9NA 4NYFA 3NBPA 4FK0A 3T3FA 4PWDA 3NF7A 1A5WA 3D0PA 5JS1A 3ALYA 4O4GA 1VRUA 4DSIA 4FJXA 1Q9YA 3VN5A 2G8HA 4N56A 2HVIA 3DMJA 3O4QA 3WNGA 5J2MA 3PX6A 3VA0A 2YNFA 2HB5A 2HHQA 3IRXA 2EHGA 3C94A 4F8RA 2OPPA 1C0MA 1TL3A 3ZT1A 4FVMA 4CJ4A 2EX3A 3CYMA 1KTQA 4I9LA 3KLHA 4E89A 3V4IA 3VQPA 4BE2A 1RBUA 4B9SA 4YFUA 4C8KA 4ZHRA 3V81A 5SZTA 3OYNA 1D9FA 2OZMA 2PY5A 1CZ9A 4ZTFA 4B9TA 3KTQA 1NJZA 4FJLA 4QCLA 1RT3A 4YNQA 1C0TA 4E0DA 4FJKA 2Q3SA 4Q0BA 3ZSOA 4KKOA 1KCFA 4UQGA 3OYFA 1B9FA 4CEOA 2Z1JA 1KVBA 3KKRA 3VQBA 4DU4A 1TVRA 3VQQA 3LPUA 3SYZA 1RILA 2YNIA 3SV4A 4DF8A 1J5OA 4G1QA 5T7BA 3RMAA 3NHGA 3L3VA 3LP2A 1BISA 3RMBA 4FM1A 4FJ5A 3SUNA 3K5LA 1S6QA 1RNHA 3E01A 4E7JA 2IC3A 3RRGA 4FW2A 4DTXA 4DTMA 3VQDA 4FM2A 4I2PA 3ZT2A 1RBRA 4LSLA 3EZ5A 4FYDA 2O4IA 4CEDA 4NCBA 2Z1GA 5I42A 1RT1A 3NH1A 4E3SA 4AHTA 3WNEA 4FLXA 1XWLA 3SUOA 4DFJA 1JLBA 3QEPA 3WNFA 4FZYA 1XHZA 4M3XA 2RKIA 3NE6A 1RT6A 1C1AA 1QS4A 1U47A 1QSSA 3VA3A 2QK9A 5KRTA 2HHTA 3CM5A 5K14A 2YHBA 3MAQA 4CGDA 4FJGA 3CQ8A 5I3UA 4OLBA 1Y97A 4CF2A 4FZXC 4ELTA 4CIFA 3QESA 1MU2A 1LWEA 1RTDA 4FJIA 4Y1DA 2PZSA 4KHSA 1S6PA 4CGFA 3VQ5A 3MEGA 4N47A 4CGHA 1JLQA 3HPOA 4E7HA 2DY4A 4JLHA 1YTAA 3CG7A 4JS4A 3SI6A 2KFNA 1WSGA 3DLKA 3HL8A 4I2QA 4EZ6A 3L2WA 5C42A 5J2PA 1T03A 1KLMA 1RCHA 4H8KA 2G8UA 1IH7A 5DK5A 3M8PA 3SUPA 4E7IA 2E6MA 1Z25A 4DTSA 4FJHA 1C1BA 4Z0UA 1I39A 2WOMA 4PUOA 3DRSA 5KGWA 3KK1A 1JL1A 3QNNA 4DSJA 3K57A 1GOAA 2KZMA 2Z1IA 3V9ZA 2B4JA 2OPRA 2YNGA 3V9SA 1UA1A 4ELUA 4PA1A 3ITHA 1JXBA 2F96A 3H08A 1BQNA 1BHLA 3AO3A 4DSEA 4KAZA 2IAJA 4DTUA 1BGXT 4FK2A 4DLEA 3HXMA 3TAQA 3ISNC 1SKRA 3MEEA 3C6UA 1X9WA 3NH2A 4B8CA 4LY7A 3SQ2A 4J2DA 1LAVA 3T19A 3HVTA 1Z26A 4OPKA 2XY5A 1TK8A 1QSYA 4C8LA 1ASVA 3AVFA 3ZT0A 3S3OA 2HHUA 4CJRA 3TAPA 4O55A 2WONA 2Z1HA 4DMNA 4DTOA 3AVMA 4FLWA 4ZTJA 4FJ9A 4IFYA 3VQ7A 3TANA 2RF2A 3RR8A 4DQSA 1SKWA 3RR7A 3NF9A 3VQ6A 3QINA 2NUBA 3ZT3A 4OKEA 4OKJA 5FRNA 4J2EA 2ZQBA 4FK4A 3DLRA 3RTVA 4Q5VA 1HQUA 1NK0A 4RW4A 1EKEA 5KI6A 4CEQA 4HUGA 3HPHA 1KLNA 2P51A 3TI0A 1NOYA 1J9AA 3OS0A 4M3WA 2OPQA 1CXUA 1UWBA 1NK7A 1WSJA 1J53A 1RTIA 4Z4FA 3SPYA 1JL2A 5HBMA 4CHYA 3KLFA 2BANA 4DWIA 3UIQA 4FLUA 3AVIA 2XY7A 3KKSA 3V9XA 2GUIA 1X9MA 2HHSA 1BCMA 1IKWA 2ZD1A 3PX4A 3HVRA 3SPZA 4E7KA 1TKDA 3TWHA 1DTQA 3VQ9A 4KREA 4FLVA 1G15A 5J2QA 4KV8A 1REVA 4KFBA 4DQRA 4CECA 1X9SA 3IAYA 3LP0A 1VSDA 3O3GA 3OY9A 3RWUA 3MXIA 1IKXA 1BCOA 4F2RA 2QKKA 4B3OA 4M45A 3DRRA 3V6DA 3LDSA 5HRRA 3SV3A 4BE0A 4CIGA 3THVA 3NAEA 1D9DA 3ULDA 4J2BA 5J1EA 1S1WA 2FBYA 1BL3A 3IS9A 3VQ4A 1SL0A 1BIZA 3DM2A 4AHUA 4QOZB 4CF8A 1WLJA 3ZSZA 1FK9A 3FFIA 2AJQA 1FXXA 1F21A 3HYFA 1BI4B 1HNIA 2O4GA 4H4MA 3O3FA 4M41A 4CHQA 4DQQA 1ASUA 1HQEA 4DLGA 4M3UA 2G8VA 1QQCA 5HRPA 2W42A 4OVLA 3CFPA 4AHRA 3LWLA 1NKBA 4KO0A 1JLEA 4KTZA 4CJKA 4B9VA 1HNVA 4M3YA 2HNZA 2XY8A 2X6NA 3KLGA 1WAJA 3D45A 1KVCA 3DI6A 3OVNA 3K5OA 4FJ7A 2F8SA 4OLAA 4DFPA 4L8RB 4N76A 3G10A 3BDPA 4DG1A 3DLHA 3KLEA 4FLTA 3RMDA 4M42A 1HYVA 4R5PA 5JS2A 1ZBLA 4CGGA 4JRQA 2BDPA 3QLHA 3G0ZA 3CM6A 3KK3A 4B9MA 1TAQA 4HTUA 1A5VA 2QKBA 5J2NA 1S1VA 2HMIA 3QERA 4OKKA 3OJSA 3PY8A 1JXEA 1NK5A 4W5TA 1NJYA 3AA4A 1GOBA 4DTPA 1U48A 5E41A 3A2FA 4NCGA 4KTQA 4N41A 4CEFA 1IO2A 1RTHA 1L3VA 3LAMA 3TABA 1NK9A 1Q8IA 3HSTB 1WSIA 2X74A 2YKNA 1LW0A 1NOZA 4MQ3A 4CFAA 4HVJA 4CHNA 1TK5A 5D3GA 1RT5A 1SL1A 3SZ2A 4KB1A 3ZSVA 2KW4A 4CJ5A 4NCAA 2A1RA 3NF8A 2OA8A 4W5NA 2OPSA 2LSNA 4NYNA 3QEIA 2G8KA 3LZIA 4FZZA 2DFEA 2YNHA 3L3UA 1RT2A 4HUEA 4OGCA 3AVBA 1W0HA 3TARA 4KI4A 1U4BA 2HNDA 3S9HA 4I9QA 3ZSYA 3ASMA 4CJWA 4E1NA 5FDLA 1KSPA 4FJJA 1JLCA 3LAKA 4RW8A 4Y1CA
chains in the Genus database with same CATH superfamily
4PL8A 3OHRA 4C1NK 1JJ2M 4CF1A 3MECA 1UAXA 5EU7A 1KAYA 3CCJN 2YKMA 3DLEA 1D5AA 4UY8O 3HM9A 4F2SA 2GV9A 3UKRA 4AH9A 1U2VA 4CCHA 4JKAA 4M3TA 3UKUB 1GLEG 4ID5A 1HYZA 4HHTA 1C0UA 3E66A 3SQ0A 3DXKB 3CCVN 1VQ4N 2NRRA 3W3DA 4QS7A 3I8DA 3I56N 3P1GA 4FOEA 1E4GT 5HLFA 3OYIA 2A1SA 1RDBA 3ZSWA 4X66K 3IG1A 4K8XA 2FLOA 2HOEA 4YOTA 5M1OA 4DFMA 4KHUA 3M8SA 1JLGA 4DF4A 2F8TA 3CFOA 4NO7A 1U49A 4CJTA 4BDYA 2O8BB 1LCUA 4AILC 3K2PA 1TGOA 1N8RO 4FJMA 4GV9A 2FBTA 5AQOA 3JS6A 3K5NA 3MN7A 1XMOK 4CEBA 2JGUA 1NGDA 4ILJA 4B08A 1DLOA 1RBTA 3O9SA 4CBWA 1S5JA 5GIOA 3C65A 1Q7YO 1HMVA 3AA5X 1JLFA 5AR0A 1S1XA 3GL1A 3O5BA 4JHDB 5EXWA 3M8QA 1T6CA 4C23A 2A6AA 3E9PA 1C1CA 4BC3A 3PX0A 4CK1A 4DU1A 4E7LA 2ZJRL 5FROA 4BRHA 4WFBL 3KD5E 2QM1A 4ISGA 4DTRA 3DLBA 3OS1A 4IEEA 2VWJA 3DAWA 3PUFA 3WQUA 3HBTA 4A61A 2V7YA 2ZF5O 1EXQA 2O8EB 3VEYA 4DB3A 5IT9O 1C0GA 1KVAA 3EE8A 1M1KO 1DTTA 3C7NB 2P9KA 3QEVA 3EN9A 1P90A 4W5QA 3LZJA 3T1YK 3DOLA 4KH4A 4LF4K 3CJAA 5AQNA 3LPTA 3U9ZA 5BN9A 1E3MA 2IGIA 1GLLO 4AHVA 4CZKA 2QWMA 3L2VA 4H0XB 3CD6N 4KI6A 4JKCA 3M1FA 4PHTX 4DSKA 4NB4A 5HRSA 3THYB 3IKMA 2A40A 4BREA 4FXDA 4O44A 5C25A 4CJ3A 3VQEA 3CQXA 3WXMB 3NGZA 1S1UA 1WSEA 3P38A 3OYDA 4JI6K 1RT7A 3FZMA 3TSQA 4BRPA 3AVKA 1NNEA 5FPDA 3DLLL 3NVKA 3VQCA 4BRFA 3Q7BA 3AGRA 4H4OA 4JI0K 5AZJB 1X3NA 2NNWA 1XMQK 4K8ZA 1TL1A 1WN7A 2E2QA 2GBZA 3SUQA 3WXJA 2F9WA 3C6TA 3K9JA 4IEIA 4XH5A 2WTUA 3CMAN 4DKWA 3QO9A 1KRPA 2ZGZA 3VPZA 2KQ2A 1WBDA 3ID8A 3OJUA 4DV4K 3NMUA 1HRHA 1OH7A 1NLVA 3HP9A 4WCEL 4EZ9A 4HCBA 1QE1A 2ZGYA 3E1YA 4GY2B 1LAWA 4M3ZA 2D1KA 2KFZA 3K58A 5ELZA 3I0RA 3WXLA 3H3NO 4FPAA 3NFAA 3UKRB 3H46O 1N6QA 4BR5A 5AQYA 1GLCG 3HOSA 3ALYA 1V4TA 3D2FB 4N56A 5J2MA 2YNFA 3OBWA 2HHQA 2AA4A 4F8RA 3BEXA 1TL3A 3CXCM 4CJ4A 2EX3A 3CYMA 3ZEUA 4E89A 2YCHA 4C8KA 5SZTA 1Q82O 4FWNA 1NJZA 4FJLA 4QCLA 4DQ8A 2Q3SA 2W41A 1KCFA 3BP8A 1KVBA 3KKRA 1OH8A 3LPUA 4DR7K 2Q2RA 3O8MA 1J5OA 2YJFA 1Q86O 3L3VA 3MN6A 1ATSA 2EWSA 3SUNA 3E01A 1S22A 4F9OA 3U9DA 4JK9A 3ZT2A 4LSLA 4JD2A 5KPRA 4FYDA 3AY9A 2Z1GA 1K8KA 4C1NI 4E3SA 2E2OA 2VGNA 1XWLA 4DFJA 1YJNN 2RKIA 1C1AA 1QS4A 4FSVA 3D7EO 3GG4A 1NGAA 5M1FA 4WQ4C 4FJGA 4IO8A 3CCQN 3QESA 5AQRA 4B3TK 2DY4A 4CGHA 3HPOA 1JLQA 3IFRA 3KVGA 3SBGA 3DLKA 3TPQA 5J2PA 5DK5A 3FZKA 1Y64A 4DTSA 1HUXA 5AQHA 1C1BA 3QNNA 5GAGP 4H0TB 1DT9A 1IJJA 2B4JA 3BUZB 4PA1A 3ITHA 1HKBA 1QQOA 4DTUA 4FK2A 4DCHA 3KHYA 1LAVA 1Z26A 4C8LA 1O13A 2HBMA 1TK8A 3AVFA 4CJRA 4L3QA 4DMNA 2Z1HA 3AVMA 2IVPA 1DEJA 3MDQA 2HF4A 4BRAA 2QWRA 3AAPA 4OKEA 4OKJA 5FRNA 5M1NA 4FK4A 2ZQBA 4JKEA 4Q5VA 3O9RA 5M1PA 4BGAA 2E1ZA 1EKEA 4CEQA 4HUGA 4M3WA 4EFHA 1CXUA 1NK7A 1J53A 4Z4FA 1VHXA 4CZLA 3KLFA 3L0QA 4DWIA 3UIQA 3T7ZA 1X9MA 2HHSA 3QB0A 2ZD1A 3SPZA 1YI2N 3D6RA 4E7KA 3VQ9A 4BG9A 3VMFB 5BRHA 2ZM6K 3O3GA 1FW6A 2QKKA 3A5LC 3ULEB 4M45A 1J5EK 3TSUA 1SL0A 3H3OB 3DM2A 4YORA 5FLXO 3FFIA 3RR7A 4H4MA 4CVNE 1QQCA 2W42A 3R6MA 5M1KA 4KTZA 2X6NA 2HBKA 2VGMA 1YJWN 4JKGA 3K5OA 2F8SA 1OVQA 4AM7A 4QS8A 4FOIA 3LL3A 4A57A 4DG1A 4FLTA 5JS2A 2P9UA 4CGGA 5BPMA 5GIPA 4B9MA 4BC2A 4HTUA 1HNXK 4BRCA 2HMIA 3SK3A 3QERA 4OKKA 3PY8A 3L4IA 4W5TA 1NJYA 3AA4A 1GOBA 3AAQA 4OX9K 2QI2A 5E41A 1XNQK 3A2FA 4KTQA 4N41A 1IO2A 1RTHA 2QXLA 1WSIA 4CFAA 2OANA 4MQ3A 4IDHA 4HVJA 1TK5A 1SL1A 4H03B 3FZHA 1SAZA 1N33K 3ZSVA 2D4WA 2KW4A 2OA8A 2OPSA 4FZZA 1QHAA 3HSCA 2YNHA 4ILHA 4OGCA 3DWLA 2HNDA 1BO5O 4CJWA 4E1NA 3MCAB 4FJJA 1WBBA 3ZT4A 1KC8O 5KRSA 3CFRA 4JD2B 3NVMA 4K42A 3QEWA 1NM1A 3LDNA 3UE5A 4K25A 4FLYA 4CJFA 3CJ9A 4CZHA 2Q0RA 4GMJB 4OPJA 4DR6K 1C6VA 3KJVA 5C24A 1BQMA 4FWOA 3PIOL 4BE1A 4BRIA 2XY6A 3SJJA 1Q18A 3HK2A 2FC0A 4H0OA 4XIUA 1X1PA 5AQJA 4B8AB 3L2RA 1LWCA 5FPNA 5BR8K 1HLUA 1UOCA 3AA3A 3K5MA 4J2AA 4IG0A 3CJ7A 2D0CA 1S9GA 2I5JA 3QETA 1RDCA 2OZSA 4LD0A 3AV9A 4M7XA 4I6MA 2D0AA 1R0AA 1QZ5A 2P9IB 4JI5K 4HWIA 3OYCA 1LW2A 2A5XA 2QXFA 2WUSA 3E9OA 4DS5A 3PO5A 2H3GX 4WFNL 2NRXA 4BDPA 4Y0WA 5GADP 4CJEA 4ELVA 1SV5A 3HP6A 3HPGA 3MN5A 1WB9A 4DV1K 3ZCMA 1WSFA 2XO7A 2VWKA 3CPWM 1SKSA 4A2AA 2Y1JA 5AQIA 5CHIA 1HJOA 1YTUA 4DUYK 4LF7K 2I7PA 1GOCA 1P8ZA 3VERA 3A5MC 3S3MA 4OGEA 2HHXA 4KHNA 1NGFA 3CCSN 4JN4A 4N5SA 4DTNA 3L2UA 3SNNA 5AZIA 4E19A 4O0IA 3U3YA 4IFVA 1VSHA 1TKTA 2A42A 3W0LA 5EY4A 2RN2A 4AHSA 5FPMA 1WNSA 5DM6L 4BRLA 5AJ3K 4WE1A 3LWMA 4DS4A 2UUCK 2E6LA 3OYKA 1SUQA 3C6HA 2HHWA 2G8IA 2R7YA 2P1JA 4B9QA 3RMCA 3TTDA 1QSLA 1BA0A 4H0VB 3SAFA 4BQZA 4BR4A 4LFAK 4I7FA 3CIPA 3SQ1A 3VTIA 4XH4A 3MN9A 3U6FA 5LMNK 2J4RA 4MDAA 1EP4A 3AVJA 4CJVA 2HHVA 2YHYA 3ZSRA 1T8EA 2IIRA 3TTCA 3MXJA 4M63C 4JK8A 4K0KK 4IDKA 3TAFA 1WAFA 2IOCA 1WOQA 4JI3K 1ZBHA 1ZXOA 3ZSXA 3NGYA 3CCLN 3RSEB 3F73A 2HBLA 3SCXA 4F3OA 3TAGA 4BR7A 4KRFA 1HKGA 4IOXA 3R9PA 3NCIA 3IDHA 3TTFA 4LH4A 2HW3A 5BPNA 3FZFA 4CHZA 1EX4A 1R59O 3OYHA 5SWMA 2BGGA 3R8EA 2P9LB 1JCEA 1IV0A 1L3UA 4DV3K 4JKFA 4OJRA 2UU9K 5AFUH 4A5BA 4QAGA 5AQTA 2IS3A 3G4SN 3VTHA 3CC4N 3ZETA 2YHXA 1H1VA 3RRHA 4F4KA 2FBVA 4FWKA 2ASMA 3O3HA 1DGKN 3LDOA 4CF0A 5BR9A 2X78A 4KHPK 2KKZA 3THWA 1N36K 3AVNA 3DLGA 4ISEA 3EY1A 4DQIA 4CJQA 3AO5A 4CD3A 4CEEA 4KBOA 3OW2M 4PY5A 4DV5K 3L8BA 3I8BA 3B6PA 3CQYA 4FWRA 2QWQA 4NYFA 2QTDA 3D0PA 1A5WA 5JS1A 4PKHA 4K41A 1VRUA 3VN5A 3DJCA 5EOYA 2HSTA 1QVFM 4IOAL 5KQDA 4XH1A 3C94A 3SAHA 4DHYA 2OCEA 1KTQA 3KLHA 5BRDA 3ZX0A 5HOOA 2HHHK 3VQPA 3VGKA 3WT0A 3OYNA 2A41A 4I6MB 1CZ9A 4ZTFA 4B9TA 4YOUA 3KTQA 3VGLA 5ADXA 4NLBA 4KKOA 4UQGA 3OYFA 4IFEA 4WQ4A 2QWLA 3VQQA 3SYZA 4B1UB 3RMAA 2GUPA 3D2EA 4DR3K 1BG3A 4LF9K 1VQ9N 4DTMA 4FM2A 4I2PA 1RBRA 3EZ5A 4CEDA 1BWFO 5I42A 3NH1A 3J80O 3H45C 4AHTA 3SUOA 1JLBA 1XHZA 1QSSA 4BRNA 3J7ZO 4MO5A 2QK9A 3A5NC 2PBDA 2HHTA 5K14A 3MAQA 3VOVA 4YOXA 5I3UA 1Y97A 1K9MO 4CF2A 4DR4K 1MU2A 1LWEA 5AZIB 1S6PA 4CGFA 3VQ5A 4E7HA 4BR0A 5BREA 2KFNA 5LY3A 4EZ6A 3EKSA 3L2WA 5C42A 1XNRK 1IH7A 3C6AA 3SUPA 2CH6A 1K73O 4FJHA 1I39A 3CHWA 3OA9A 3DRSA 3KK1A 4DSJA 3GDQA 1GOAA 3QDKA 3U4LA 4CZMA 2Z1IA 1JXBA 2F96A 4DSEA 2JWLA 4BGBA 3FFKB 4LY7A 4IOCL 4OPKA 1ASVA 4JV5K 2HHUA 3TAPA 3P31A 4IZ9A 3MK6A 4FLWA 1V4SA 4FJ9A 3THXB 3TANA 1S3XA 3J81O 3RR8A 4DQSA 2YI1A 3NF9A 5BN8A 4YOYA 2W6LA 3QINA 3G6EN 4LFBK 3T1HK 2NRWA 5LMUK 2P51A 3TI0A 2WFBA 2ZWHA 2OPQA 1UWBA 1WSJA 4BVOA 2QA4N 4CJ7A 4O5FA 3AVIA 5AQMA 2GUIA 3HVRA 1U2VB 1HNWK 3TWHA 1DTQA 3PSIA 1X9JA 4JI2K 3F5TA 1G15A 5J2QA 4KV8A 4DQRA 4CECA 1X9SA 4B3RK 3GE1A 3LP0A 3OY9A 2E5LK 3MXIA 1IKXA 4H5VA 4HTLA 3DRRA 3LDSA 3DXMA 3NAEA 4J2BA 1S1WA 2ASOA 1BL3A 3VETA 2FBYA 3CJ1A 4AHUA 1WLJA 3ZETB 1FK9A 1FXXA 1F21A 3O3FA 3CJCA 2E20A 3HM8A 4M41A 4DQQA 2V52B 3IMXA 5HRPA 4A62A 4QS9A 3M3ZA 3LWLA 1NKBA 1JLEA 4CJKA 4B9VA 1HNVA 3VEXA 4ISFA 1SQKA 3D45A 3O1WA 1KVCA 4OLAA 3HTVA 4N76A 5E84A 5JMVA 3BDPA 3DLHA 3KLEA 3RMDA 1HYVA 3FZLA 4EHUA 1NBWA 3QLHA 5EX5A 3G0ZA 1NGCA 4WQ5A 2QKBA 4DV0K 2VCPA 4MLHA 3KK7A 3MX5A 1NK5A 3CERA 4LF8K 4GKKK 4NCGA 1YF5L 2QWPA 2ZJPL 2UUBK 3LAMA 3VEVA 1KAZA 1LW0A 4CHNA 1ESVA 1NGBA 1RT5A 2BH1A 4PKIA 2A1RA 5AQGA 2LSNA 3WUHA 1YITN 4BRMA 3LZIA 1Z05A 4HUEA 4B1VA 1IBLK 3AVBA 2P9PA 4I9QA 1EO1A 3ASMA 1RFQA 3MWTA 3LAKA 4Y1CA 3JSMA 2Y1IA 3AVAA 4Z4GA 1VSEA 4HUFA 4LH5A 1NMNA 3L2QA 2P9KB 4U67L 4W5RA 4YDUC 2P9SA 5JICA 1NK8A 2HNYA 3EYZA 3CCUN 5KTQA 1QVGM 2HF3A 4GVEA 3TR8A 3NGIA 3O08A 1EQYA 3OS2A 3MMVA 1L3SA 4CEZA 4CFDA 2FBXA 2ASPA 4JAXA 3GOIA 3K59A 4LFCK 5CYQA 5C12A 4CJUA 2QWNA 3LP1A 3L6QA 4LC9B 4C8MA 3I55N 4KHQA 1CLQA 4BRGA 3V9WA 4B1XB 1HPMA 1SS6A 4DSLA 1DKGD 4FO0A 3MEDA 4MDBA 1TV6A 3DYAA 4CFBA 1B92A 2IDOA 1BI4A 2IVNA 4JI4K 1VQ8N 3ZX2A 3CETA 3VQAA 4AF1A 4CEAA 4BWJA 4CJLA 4CF9A 4CK3A 3FLCO 3HI0A 4MO4A 4B9LA 1FKOA 3V9UA 3BF3A 4BC4A 1HPZA 1HR0K 5AQUA 3OYMA 1VSMA 3BZKA 1VSIA 5CZ1A 4KPYA 1T6DA 2VG7A 1CZBA 1TKXA 4KTWA 2O8DA 3NH0A 4HCCA 2CGKA 4ID1A 1CZAN 1YJ9N 4FLZA 5AQPA 4KB0A 1EETA 4IBNA 3WEEA 4CE9A 1HJRA 3QEXA 4FVUA 3HRGA 3AVCA 1XHXA 4DR1K 3T1AA 5DM7L 4FL9A 2KZZA 1YT3A 5HROA 3NF6A 5LJVA 3A8YA 3M8RA 4FWLA 1I3AA 3KWGA 5GAEP 2OTLN 1A5XA 4LF6K 1LV5A 3VGMA 4B1ZA 2CH5A 3QIPA 1BIUA 1D8YA 4OPHA 1W97L 3EL2A 1YUWA 5KPTA 1VSFA 1ITGA 3VEOA 3AVLA 4FPBA 3DXMB 5MLCQ 4FM0A 3ZEUB 1L3TA 4CZEA 1RDDA 5HL7L 3ATVA 3OYEA 2ZJQL 2DTUA 4Z4IA 3WQTA 4CJPA 4IO9L 1SL2A 1N34K 4FW1A 4BACA 4IG3A 4BRKA 1NGEA 3MXMA 1VSLA 2BTFA 3WXIA 1YVNA 2XRIA 1NK4A 2OYQA 3LANA 2ETJA 1X3MA 1MWMA 4BRDA 2AP1A 1NU0A 4U7BA 3QNOA 4H0YB 4RG8A 1VK0A 4CGIA 3HJFA 5C2FA 3PO4A 1IKYA 2B5JA 3EE9A 1T05A 4M3RA 4CI6A 2D0OA 1K8KB 1E4FT 1QHTA 5GINA 4KHWA 4CIEA 3AO2A 1T44A 1VSJA 4M7YA 1RDAA 1YVUA 2RHKA 2PYLA 4DSFA 3DOKA 4GVMA 1NKCA 1NGJA 5JLFA 3CCMN 3UB5A 1Q9XA 2E88A 1IG8A 1J54A 4BR9A 3OYAA 2V51B 2CGLA 2XHBA 1K6YA 4PKGA 2YV0X 1JLAA 1RBVA 4B1WB 2ITGA 2WBNA 4FJNA 3SMSA 2HVHA 2P9PB 2O8CA 4BC5A 1EWQA 3A0IX 2E2NA 3VQ8A 4H0PA 2VG5A 4V19S 4GKJK 2KTQA 3AO4A 2WC9A 4F3TA 2RPIA 1WSHA 4CERA 3P5JA 5IWAK 3O4NA 1U45A 1XUPO 3HO1A 4C8OA 3V1QA 2B6AA 3P83D 3LALA 5C15A 5B8HA 4IKFA 2GWKA 2JLEA 3V1RA 1GLAG 3KK2A 1TKZA 4BDZA 4PWDA 3NBPA 3LDQA 3NF7A 4O4GA 4DSIA 1Q9YA 3DMJA 3O4QA 4LF5K 3VA0A 4EIAA 2HB5A 2Q0UA 2OPPA 1C0MA 4FVMA 4I9LA 4H5NA 4CZJA 3V4IA 3SJHA 1RBUA 4YFUA 4YHHK 4ZHRA 2OZMA 1D9FA 4CZIA 3EKUA 4WYBA 2NLXA 1RT3A 4YNQA 4E0DA 4FJKA 4NXMK 1U6ZA 1Z6RA 4Q0BA 1KQSM 3CJBA 2Z1JA 1TVRA 1RILA 3CC7N 2YNIA 3SV4A 4DF8A 4G1QA 5T7BA 1HKCA 2UUAK 4IJAA 5JVGL 5A2QO 3LP2A 1ZC6A 1BISA 3RMBA 1TYQA 4FM1A 3K5LA 2O8DB 2VWBA 4FW2A 3VQDA 3SBTA 1RT1A 3THYA 3WEEB 3WNEA 4M3XA 4EAHD 3NE6A 2A3ZA 3VA3A 2F7TA 4BRQA 4X65K 2HBJA 3CM5A 2YHWA 2YHBA 4OLBA 4JKGB 3CQ8A 4FZXC 4ELTA 2W6KA 3QFUA 1RTDA 4Y1DA 4KHSA 3MEGA 4N47A 4JLHA 2P9UB 3SI6A 5CR4A 1WSGA 3HL8A 4I2QA 5GAHP 4IXCA 1GLJO 2OTJN 1KLMA 2G8UA 1NGGA 3U8XA 3M8PA 4E7IA 2E6MA 1Z25A 4Z0UA 4RWTA 5KGWA 3BZCA 2OPRA 2YNGA 1UA1A 1XC3A 4KAZA 3H08A 1BQNA 1BHLA 1RGIA 2D0PA 2IAJA 4DLEA 1SKRA 3C6UA 1T3VA 4B8CA 3VF2A 4J2DA 3T19A 5AQVA 2FXUA 3HVTA 2XY5A 4JI1K 4AM6A 1QSYA 3ZT0A 2QWOA 1TUUA 4O55A 4CBXA 1N32K 4DTOA 4CZFA 3H1VX 4A59A 3ZT3A 4ILGB 3RTVA 3D2FA 1HQUA 5AQSA 4RW4A 4YY3K 1KLNA 4A5AA 3OS0A 2RE2A 5JVHL 1JL2A 4CHYA 2BANA 1YHQN 4FLUA 3H6EA 3V9XA 4BROA 1VQON 4DV6K 1BCMA 3PX4A 4B3SK 3O6WA 4NXNK 2Q36A 3R1XA 4BY9C 2PFUA 1VSDA 4B3OA 1BCOA 4F2RA 4FWMA 5HRRA 4BVPA 4BE0A 3THVA 3ULDA 1QQMA 3VQ4A 3IS9A 1IBMK 1KD1O 1BIZA 5JLHA 4QOZB 3ZSZA 4NLCA 4RCHA 2O8CB 1ILYA 4CHQA 3CF5L 4M3UA 4JEPA 2P9NA 5C2DA 2VYPA 3CFPA 3F2KA 4AHRA 4X64K 3P39A 2HNZA 1EWRA 2XY8A 3KLGA 1WAJA 1G99A 1QQNA 3DI6A 3OVNA 4FJ7A 4DV7K 4DFPA 4L8RB 4K43A 1LOTB 2Q1NA 1ZBLA 4JKBA 3CM6A 3KK3A 1TAQA 4B1YB 5J2NA 1SZ2A 1S1VA 3OJSA 1JXEA 4IJNA 1I94K 1YAGA 4DTPA 4BQLA 1U48A 4JKDA 4CEFA 1XQSC 3HZ6A 4KH6A 4YDUA 1NOZA 3H1QA 5D3GA 3SZ2A 4KB1A 5FPEA 1KAXA 3LM2A 4NCAA 3NF8A 4NYNA 3G71N 2DFEA 1J6ZA 4AQYK 4FWQA 4KI4A 3S9HA 4BG8A 3ZSYA 1TYQB 2F9TA 1KSPA 4RW8A 4JS5A 2O4IA 4Z4HA 3QICA 2E4LA 2ZE2A 1GLBG 1NJXA 3FE1A 3BGRA 3VEZA 1W2BM 3TAEA 2NRZA 2FSJA 1ZBUA 2X6SA 4FJ8A 3ID6A 3EZWA 2FF6A 3I33A 1ZYQA 1VSKA 4C8NA 2I7NA 1QZ6A 4TSXA 1JKHA 2DPNA 3AVGA 1RT4A 1VQKN 3CI5A 3QBWA 4GW6A 3ULEA 2KLAA 4B9UA 3DRPA 2ATQA 3M5RA 3FGUA 3O9UA 3U3GA 4JRPA 3OYJA 3S3NA 3KIOA 1QTMA 3JYTA 5AQKA 5CZ2A 4MFBA 1TK0A 4CK2A 4W5OA 4FCYA 1CXQA 1NGIA 1S72N 1TAUA 3WNHA 2PAVA 3M6GA 1RDWX 1RTJA 1NG9A 2E1YA 3BF1A 4CW7B 4CZGA 4GV3A 4OPAA 5FRMA 1S1TA 2Q31A 3JXUA 4DR2K 3OTOK 4FJ5A 3AA2A 5HP1A 1NJWA 2FF3B 4CGJA 1T7PA 2O8FA 5KGXA 3OYBA 1K8AO 3C0BA 2G8WA 4H5RA 2IVOA 1IKVA 5AQQA 1ZBSA 5BRFA 1NK6A 2P5GA 4EP4A 5CY4A 5F1XA 2P5OA 1O1WA 2E2PA 1YXQA 4CHPA 5CE3A 3THWB 3TAMA 1FKPA 1UA0A 4CJSA 4DU3A 1FJGK 2Q97A 4CHOA 3B6OA 3OYLA 3F9KA 3KLIA 5CYMA 3LP3A 1W7AA 3O80A 4BWMA 1N5YA 1WUAA 4JKHA 3I0SA 3WXKA 4CFCA 1RBSA 1YIJN 2W40A 3AVHA 4CESA 4EP5A 4DTJA 3CCRN 1HYSA 3KD1E 3SQ4A 1Q81O 2DFFA 3OYGA 2P9NB 3K0SA 4JI8K 3HT3A 4BR2A 3QMLA 2HMPA 1NGHA 3VEWA 3NDKA 4E1MA 1L5UA 1VRTA 2DFHA 4O5BA 3PIPL 4ICLA 3KWIA 3D2EB 2NZTA 3AO1A 1U04A 5AQWA 3O4WA 3RVCA 1BUPA 1S9EA 1ZBFA 2PYJA 5C10A 5DMRA 4RW9A 3GBTA 5F2RA 1MWKA 4O0JA 1ZBIA 3SLCA 2G8FA 2GX9A 1OH5A 4AHCA 3V1OA 4GNIA 4PQUA 1M90O 2P9IA 3AARA 1VQMN 1LWFA 2NRHA 3E9LA 3QBXA 1XC9A 1OVYA 3P4IA 5ADXH 4PL7A 1IG9A 1KFSA 1NKEA 1TUYA 1VAZA 2UXCK 2YHAA 1B9DA 2GELA 1W9HA 1OKJA 1JCFA 2D5RA 4CBUA 2D0BA 2VG6A 4LSNA 3PV8A 2BE2A 3LM9A 3ZYYX 4DV2K 3C95A 3EO3A 3QFPA 4RW7A 2GWJA 3ZSQA 4DQPA 5AQXA 4DFKA 4RW6A 2UXDK 5HRNA 4Z4CA 4KHYA 1GLDG 2FSKA 4Z4EA 1KFDA 3CMEN 3EEQA 1ASWA 3QIOA 1XI1A 4B9NA 4FK0A 3T3FA 3VF6A 2KHOA 4FJXA 3KZBA 2G8HA 2HVIA 3WNGA 3PX6A 3IRXA 2EHGA 3O1BA 3ZT1A 3J7YP 3VENA 1OH6A 2F4VK 4BE2A 4B9SA 4CD1A 3V81A 2PY5A 2NRTA 3ENHA 1C0TA 5AFUA 3ZSOA 1B9FA 4CEOA 4O8KA 1BA1A 3VQBA 4DU4A 1HX1A 3JAMO 1VQLN 4JYAK 3NHGA 1S6QA 1RNHA 2O8FB 4E7JA 2IC3A 3RRGA 4DTXA 3VESA 4NCBA 4E1JA 1GLFO 1JCGA 3RSEA 3CCEN 4A2BA 4FLXA 3QEPA 3WNFA 4FZYA 1RT6A 2VQFK 1U47A 5KRTA 3A5OC 3BY5A 4CGDA 4DUZK 2VQEK 4CIFA 3UKUA 2P9LA 4FJIA 5F0XA 4YOWA 3MX2A 2QW9A 1BU6O 4R79A 2PZSA 4Z94A 4H5WA 3K9KA 3PSFA 1YTAA 3CG7A 4JS4A 3CC2N 3DXKA 3ENBA 1D4XA 1T03A 4IWVA 1VQ6N 1RCHA 4H8KA 2WOMA 1BDGA 4WF9L 4PUOA 4WQ5C 1JL1A 3O9TA 2GEMA 3K57A 2KZMA 3T69A 4OO1J 3V9ZA 3V9SA 4ELUA 5BPLA 3AO3A 3FR0A 1BGXT 2E8AA 3HXMA 3TAQA 3ISNC 5LJWA 3MEEA 1X9WA 4JK7A 3NH2A 3LDLA 5LL6Z 3SQ2A 1MA9B 4FWSA 2O8BA 3S3OA 4JI7K 5E26A 3G25A 3IUCA 2WONA 4ZTJA 4IFYA 3VQ7A 5KPZA 2RF2A 1SKWA 5TKYA 3VQ6A 4WFAL 2NUBA 3ZX3A 4J2EA 3DLRA 1BOTO 4O8UA 4GV6A 1NMDA 1NK0A 5KI6A 3HPHA 3J8AA 4MLEA 5KQ8A 1NOYA 1J9AA 5TKWA 1ATNA 2P9SB 1RTIA 3SPYA 5HBMA 3SMPA 3F9MA 2XY7A 3S41A 3KKSA 4J8FA 2YX6A 2ITMA 4JHDA 5AQLA 1IKWA 4XEIA 3N4PA 1TKDA 2V7ZA 4KREA 4FLVA 5I9EB 2UYTA 2BUPA 1REVA 3ATUA 4KFBA 3IAYA 3RWUA 3N4QA 3J7AP 3V6DA 1ATRA 4H5TA 3SV3A 1D9DA 4CIGA 2UXBK 5J1EA 3R3LA 3SAGA 1MDUB 4CF8A 2AJQA 4YOVA 2O8EA 3HYFA 1BI4B 1HNIA 2O4GA 1ASUA 1HQEA 4DLGA 2G8VA 1NWKA 4JNEA 3CPEA 2FSNA 3C7NA 4G9ZA 4OVLA 4RTFD 4B3MK 2NRVA 4KO0A 5EVZA 3LDPA 4M3YA 3MWPA 3O9QA 3HOTA 3G10A 2QEXN 4M42A 4R5PA 2CGJA 4JRQA 3L4QA 5AQFA 4EHTA 2BDPA 3MCPA 4DR5K 3ENOA 1A5VA 3AGKA 4KH5A 3B8AX 2JWKA 1RDUA 1VQPN 3PLAA 1KXPA 3VF4A 3OBYA 1L3VA 3TABA 5M1QA 1NK9A 1Q8IA 3HSTB 4FWPA 3TU5A 2X74A 2YKNA 5AQZA 5AZJA 4X62K 4CJ5A 4W5NA 1VQNN 3TSPA 2GTDA 1VQ7N 3Q7CA 1IBKK 5C0YA 1C0FA 3QEIA 2G8KA 1NJIO 3L3UA 2YJEA 1RT2A 1HNZK 1VQ5N 3TARA 1W0HA 3THXA 1U4BA 3ZLJA 5H1SQ 5FDLA 1JLCA
chains in the Genus database with same CATH topology
3JSMA 4Z4HA 2Y1IA 3AVAA 3ZT4A 1VSEA 2E4LA 2ZE2A 4CF1A 4HUFA 1NJXA 4Z4GA 3MECA 5KRSA 3CFRA 3BGRA 1UAXA 5EU7A 4LH5A 3TAEA 3L2QA 3QEWA 2YKMA 1ZBUA 3DLEA 1D5AA 4W5RA 2X6SA 3HM9A 1NK8A 2HNYA 4FJ8A 4F2SA 3EYZA 5KTQA 3TR8A 1ZYQA 3NGIA 2GV9A 1VSKA 4C8NA 4AH9A 4TSXA 3OS2A 4CJFA 4FLYA 1JKHA 4GMJB 4OPJA 1L3SA 4CCHA 4CEZA 4M3TA 4CFDA 2FBXA 1C6VA 3AVGA 3KJVA 1RT4A 5C24A 1BQMA 4ID5A 3K59A 1HYZA 4BE1A 3SJJA 2XY6A 5CYQA 4CJUA 4HHTA 1C0UA 3HK2A 4GW6A 2FC0A 4XIUA 3LP1A 1CLQA 1X1PA 4C8MA 4B8AB 3L2RA 3SQ0A 4B9UA 3DRPA 3V9WA 2ATQA 4KHQA 1LWCA 4DSLA 1UOCA 3AA3A 3I8DA 3K5MA 3P1GA 3MEDA 4J2AA 4IG0A 1TV6A 1S9GA 2D0CA 2I5JA 3DYAA 3U3GA 4CFBA 3OYJA 4JRPA 3QETA 3S3NA 5HLFA 1RDCA 3KIOA 1QTMA 1B92A 4LD0A 2IDOA 3AV9A 5CZ2A 1BI4A 4MFBA 3JYTA 1TK0A 4CK2A 2A1SA 4W5OA 3OYIA 3VQAA 2D0AA 1R0AA 1RDBA 4BWJA 3ZSWA 1CXQA 4CEAA 3IG1A 4CJLA 4CF9A 4CK3A 4FCYA 4B9LA 3WNHA 1FKOA 4K8XA 3V9UA 1TAUA 3OYCA 1RTJA 4DFMA 4KHUA 3M8SA 1HPZA 1JLGA 4DF4A 1LW2A 2QXFA 2F8TA 3CFOA 3OYMA 1VSMA 4DS5A 3PO5A 5FRMA 1S1TA 2OZSA 1U49A 1VSIA 4CJTA 4BDYA 5CZ1A 4KPYA 2VG7A 4AILC 1CZBA 1TGOA 3AA2A 3K2PA 5HP1A 1NJWA 4CGJA 1T7PA 4BDPA 4FJMA 1TKXA 4KTWA 5KGXA 4CJEA 2FBTA 3OYBA 4ELVA 1SV5A 2G8WA 3NH0A 3K5NA 3HP6A 1IKVA 4HCCA 4CEBA 2JGUA 3HPGA 4ID1A 4B08A 4KB0A 4FLZA 1NK6A 3ZCMA 1EETA 4IBNA 1WSFA 2XO7A 2VWKA 4EP4A 2P5GA 1DLOA 5CY4A 1SKSA 4CE9A 1O1WA 2P5OA 4CHPA 2Y1JA 1HJRA 1FKPA 3TAMA 1YTUA 3QEXA 1RBTA 1UA0A 3AVCA 1XHXA 4CJSA 3T1AA 1S5JA 2KZZA 1GOCA 3S3MA 4OGEA 4DU3A 1YT3A 2HHXA 4KHNA 1HMVA 3AA5X 4N5SA 3NF6A 1JLFA 4DTNA 3L2UA 5HROA 3SNNA 4CHOA 1S1XA 3B6OA 4E19A 3OYLA 4O0IA 3F9KA 3M8RA 1I3AA 3M8QA 4IFVA 3U3YA 1VSHA 1C1CA 1A5XA 1TKTA 3KLIA 4JS5A 5CYMA 3LP3A 3PX0A 4CK1A 1LV5A 2RN2A 4BWMA 4AHSA 4DU1A 1N5YA 4E7LA 3QIPA 5FROA 1BIUA 1D8YA 1WNSA 3I0SA 4CFCA 3KD5E 1RBSA 1VSFA 1ITGA 4WE1A 3LWMA 3AVHA 3AVLA 2E6LA 4CESA 4EP5A 3OYKA 4DS4A 4FM0A 1SUQA 4DTRA 1L3TA 3OS1A 3DLBA 2G8IA 2R7YA 4DTJA 2HHWA 1RDDA 2P1JA 3OYEA 2VWJA 3RMCA 3PUFA 1QSLA 2DTUA 1HYSA 1EXQA 4Z4IA 4CJPA 3KD1E 3SQ4A 1SL2A 2DFFA 4I7FA 3SQ1A 4FW1A 3OYGA 4BACA 4IG3A 1KVAA 3U6FA 3MXMA 1VSLA 3HT3A 1DTTA 3QEVA 2XRIA 1NK4A 4W5QA 3LZJA 2OYQA 1EP4A 3LANA 2ETJA 3AVJA 4CJVA 3DOLA 3ZSRA 1T8EA 3NDKA 2HHVA 4E1MA 1L5UA 1VRTA 2DFHA 3MXJA 4O5BA 3LPTA 4IDKA 3TAFA 1WAFA 4ICLA 2IGIA 4AHVA 2IOCA 3QNOA 3L2VA 4CGIA 4RG8A 1VK0A 3AO1A 4KI6A 1U04A 3HJFA 3PO4A 1IKYA 2B5JA 1S9EA 1ZBFA 2PYJA 1T05A 4M3RA 4DSKA 1ZBHA 3ZSXA 3NGYA 5DMRA 4HCBA 4RW9A 5HRSA 1QHTA 3F73A 4FXDA 4O44A 4CIEA 3AO2A 5C25A 4CJ3A 3SCXA 1VSJA 4KHWA 4O0JA 4F3OA 3VQEA 1RDAA 3TAGA 4KRFA 1YVUA 3NGZA 3NCIA 2PYLA 2G8FA 4DSFA 1S1UA 1WSEA 3DOKA 3OYDA 1ZBIA 4GVMA 1NKCA 4LH4A 2HW3A 1RT7A 4AHCA 3V1OA 1EX4A 4CHZA 1Q9XA 3AVKA 4PQUA 3OYHA 5SWMA 2BGGA 1J54A 3VQCA 3OYAA 4H4OA 1L3UA 1LWFA 2XHBA 4K8ZA 4OJRA 1K6YA 1TL1A 1XC9A 1WN7A 1IG9A 2GBZA 1KFSA 2YV0X 3SUQA 1NKEA 1JLAA 3C6TA 1RBVA 2ITGA 2YHAA 1B9DA 2IS3A 3QO9A 4QAGA 1KRPA 4FJNA 2HVHA 1W9HA 2KQ2A 2D5RA 3OJUA 3RRHA 2D0BA 2VG6A 4LSNA 4F4KA 2FBVA 3PV8A 2BE2A 3VQ8A 1HRHA 2VG5A 2KTQA 3O3HA 3HP9A 4CF0A 3C95A 4RW7A 2X78A 3AO4A 3ZSQA 4F3TA 4EZ9A 2RPIA 1QE1A 3AVNA 1WSHA 3DLGA 3P5JA 4CERA 3O4NA 3EY1A 4DQPA 1LAWA 1U45A 4DQIA 4CJQA 4M3ZA 3AO5A 3HO1A 4DFKA 4C8OA 2KFZA 4CEEA 4RW6A 3V1QA 2B6AA 3P83D 3I0RA 3LALA 4Z4CA 5HRNA 3K58A 4KHYA 4Z4EA 4PY5A 1KFDA 4IKFA 2JLEA 3NFAA 3L8BA 1ASWA 3QIOA 3B6PA 1XI1A 3V1RA 3KK2A 1N6QA 1TKZA 4BDZA 4B9NA 4NYFA 3NBPA 4FK0A 3T3FA 4PWDA 3NF7A 1A5WA 3D0PA 5JS1A 3ALYA 4O4GA 1VRUA 4DSIA 4FJXA 1Q9YA 3VN5A 2G8HA 4N56A 2HVIA 3DMJA 3O4QA 3WNGA 5J2MA 3PX6A 3VA0A 2YNFA 2HB5A 2HHQA 3IRXA 2EHGA 3C94A 4F8RA 2OPPA 1C0MA 1TL3A 3ZT1A 4FVMA 4CJ4A 2EX3A 3CYMA 1KTQA 4I9LA 3KLHA 4E89A 3V4IA 3VQPA 4BE2A 1RBUA 4B9SA 4YFUA 4C8KA 4ZHRA 3V81A 5SZTA 3OYNA 1D9FA 2OZMA 2PY5A 1CZ9A 4ZTFA 4B9TA 3KTQA 1NJZA 4FJLA 4QCLA 1RT3A 4YNQA 1C0TA 4E0DA 4FJKA 2Q3SA 4Q0BA 3ZSOA 4KKOA 1KCFA 4UQGA 3OYFA 1B9FA 4CEOA 2Z1JA 1KVBA 3KKRA 3VQBA 4DU4A 1TVRA 3VQQA 3LPUA 3SYZA 1RILA 2YNIA 3SV4A 4DF8A 1J5OA 4G1QA 5T7BA 3RMAA 3NHGA 3L3VA 3LP2A 1BISA 3RMBA 4FM1A 4FJ5A 3SUNA 3K5LA 1S6QA 1RNHA 3E01A 4E7JA 2IC3A 3RRGA 4FW2A 4DTXA 4DTMA 3VQDA 4FM2A 4I2PA 3ZT2A 1RBRA 4LSLA 3EZ5A 4FYDA 2O4IA 4CEDA 4NCBA 2Z1GA 5I42A 1RT1A 3NH1A 4E3SA 4AHTA 3WNEA 4FLXA 1XWLA 3SUOA 4DFJA 1JLBA 3QEPA 3WNFA 4FZYA 1XHZA 4M3XA 2RKIA 3NE6A 1RT6A 1C1AA 1QS4A 1U47A 1QSSA 3VA3A 2QK9A 5KRTA 2HHTA 3CM5A 5K14A 2YHBA 3MAQA 4CGDA 4FJGA 3CQ8A 5I3UA 4OLBA 1Y97A 4CF2A 4FZXC 4ELTA 4CIFA 3QESA 1MU2A 1LWEA 1RTDA 4FJIA 4Y1DA 2PZSA 4KHSA 1S6PA 4CGFA 3VQ5A 3MEGA 4N47A 4CGHA 1JLQA 3HPOA 4E7HA 2DY4A 4JLHA 1YTAA 3CG7A 4JS4A 3SI6A 2KFNA 1WSGA 3DLKA 3HL8A 4I2QA 4EZ6A 3L2WA 5C42A 5J2PA 1T03A 1KLMA 1RCHA 4H8KA 2G8UA 1IH7A 5DK5A 3M8PA 3SUPA 4E7IA 2E6MA 1Z25A 4DTSA 4FJHA 1C1BA 4Z0UA 1I39A 2WOMA 4PUOA 3DRSA 5KGWA 3KK1A 1JL1A 3QNNA 4DSJA 3K57A 1GOAA 2KZMA 2Z1IA 3V9ZA 2B4JA 2OPRA 2YNGA 3V9SA 1UA1A 4ELUA 4PA1A 3ITHA 1JXBA 2F96A 3H08A 1BQNA 1BHLA 3AO3A 4DSEA 4KAZA 2IAJA 4DTUA 1BGXT 4FK2A 4DLEA 3HXMA 3TAQA 3ISNC 1SKRA 3MEEA 3C6UA 1X9WA 3NH2A 4B8CA 4LY7A 3SQ2A 4J2DA 1LAVA 3T19A 3HVTA 1Z26A 4OPKA 2XY5A 1TK8A 1QSYA 4C8LA 1ASVA 3AVFA 3ZT0A 3S3OA 2HHUA 4CJRA 3TAPA 4O55A 2WONA 2Z1HA 4DMNA 4DTOA 3AVMA 4FLWA 4ZTJA 4FJ9A 4IFYA 3VQ7A 3TANA 2RF2A 3RR8A 4DQSA 1SKWA 3RR7A 3NF9A 3VQ6A 3QINA 2NUBA 3ZT3A 4OKEA 4OKJA 5FRNA 4J2EA 2ZQBA 4FK4A 3DLRA 3RTVA 4Q5VA 1HQUA 1NK0A 4RW4A 1EKEA 5KI6A 4CEQA 4HUGA 3HPHA 1KLNA 2P51A 3TI0A 1NOYA 1J9AA 3OS0A 4M3WA 2OPQA 1CXUA 1UWBA 1NK7A 1WSJA 1J53A 1RTIA 4Z4FA 3SPYA 1JL2A 5HBMA 4CHYA 3KLFA 2BANA 4DWIA 3UIQA 4FLUA 3AVIA 2XY7A 3KKSA 3V9XA 2GUIA 1X9MA 2HHSA 1BCMA 1IKWA 2ZD1A 3PX4A 3HVRA 3SPZA 4E7KA 1TKDA 3TWHA 1DTQA 3VQ9A 4KREA 4FLVA 1G15A 5J2QA 4KV8A 1REVA 4KFBA 4DQRA 4CECA 1X9SA 3IAYA 3LP0A 1VSDA 3O3GA 3OY9A 3RWUA 3MXIA 1IKXA 1BCOA 4F2RA 2QKKA 4B3OA 4M45A 3DRRA 3V6DA 3LDSA 5HRRA 3SV3A 4BE0A 4CIGA 3THVA 3NAEA 1D9DA 3ULDA 4J2BA 5J1EA 1S1WA 2FBYA 1BL3A 3IS9A 3VQ4A 1SL0A 1BIZA 3DM2A 4AHUA 4QOZB 4CF8A 1WLJA 3ZSZA 1FK9A 3FFIA 2AJQA 1FXXA 1F21A 3HYFA 1BI4B 1HNIA 2O4GA 4H4MA 3O3FA 4M41A 4CHQA 4DQQA 1ASUA 1HQEA 4DLGA 4M3UA 2G8VA 1QQCA 5HRPA 2W42A 4OVLA 3CFPA 4AHRA 3LWLA 1NKBA 4KO0A 1JLEA 4KTZA 4CJKA 4B9VA 1HNVA 4M3YA 2HNZA 2XY8A 2X6NA 3KLGA 1WAJA 3D45A 1KVCA 3DI6A 3OVNA 3K5OA 4FJ7A 2F8SA 4OLAA 4DFPA 4L8RB 4N76A 3G10A 3BDPA 4DG1A 3DLHA 3KLEA 4FLTA 3RMDA 4M42A 1HYVA 4R5PA 5JS2A 1ZBLA 4CGGA 4JRQA 2BDPA 3QLHA 3G0ZA 3CM6A 3KK3A 4B9MA 1TAQA 4HTUA 1A5VA 2QKBA 5J2NA 1S1VA 2HMIA 3QERA 4OKKA 3OJSA 3PY8A 1JXEA 1NK5A 4W5TA 1NJYA 3AA4A 1GOBA 4DTPA 1U48A 5E41A 3A2FA 4NCGA 4KTQA 4N41A 4CEFA 1IO2A 1RTHA 1L3VA 3LAMA 3TABA 1NK9A 1Q8IA 3HSTB 1WSIA 2X74A 2YKNA 1LW0A 1NOZA 4MQ3A 4CFAA 4HVJA 4CHNA 1TK5A 5D3GA 1RT5A 1SL1A 3SZ2A 4KB1A 3ZSVA 2KW4A 4CJ5A 4NCAA 2A1RA 3NF8A 2OA8A 4W5NA 2OPSA 2LSNA 4NYNA 3QEIA 2G8KA 3LZIA 4FZZA 2DFEA 2YNHA 3L3UA 1RT2A 4HUEA 4OGCA 3AVBA 1W0HA 3TARA 4KI4A 1U4BA 2HNDA 3S9HA 4I9QA 3ZSYA 3ASMA 4CJWA 4E1NA 5FDLA 1KSPA 4FJJA 1JLCA 3LAKA 4RW8A 4Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSM A;  4Z4H A;  2Y1I A;  3AVA A;  3ZT4 A;  1VSE A;  2E4L A;  2ZE2 A;  4CF1 A;  4HUF A;  1NJX A;  4Z4G A;  3MEC A;  5KRS A;  3CFR A;  3BGR A;  1UAX A;  5EU7 A;  4LH5 A;  3TAE A;  3L2Q A;  3QEW A;  2YKM A;  1ZBU A;  3DLE A;  1D5A A;  4W5R A;  2X6S A;  3HM9 A;  1NK8 A;  2HNY A;  4FJ8 A;  4F2S A;  3EYZ A;  5KTQ A;  3TR8 A;  1ZYQ A;  3NGI A;  2GV9 A;  1VSK A;  4C8N A;  4AH9 A;  4TSX A;  3OS2 A;  4CJF A;  4FLY A;  1JKH A;  4GMJ B;  4OPJ A;  1L3S A;  4CCH A;  4CEZ A;  4M3T A;  4CFD A;  2FBX A;  1C6V A;  3AVG A;  3KJV A;  1RT4 A;  5C24 A;  1BQM A;  4ID5 A;  3K59 A;  1HYZ A;  4BE1 A;  3SJJ A;  2XY6 A;  5CYQ A;  4CJU A;  4HHT A;  1C0U A;  3HK2 A;  4GW6 A;  2FC0 A;  4XIU A;  3LP1 A;  1CLQ A;  1X1P A;  4C8M A;  4B8A B;  3L2R A;  3SQ0 A;  4B9U A;  3DRP A;  3V9W A;  2ATQ A;  4KHQ A;  1LWC A;  4DSL A;  1UOC A;  3AA3 A;  3I8D A;  3K5M A;  3P1G A;  3MED A;  4J2A A;  4IG0 A;  1TV6 A;  1S9G A;  2D0C A;  2I5J A;  3DYA A;  3U3G A;  4CFB A;  3OYJ A;  4JRP A;  3QET A;  3S3N A;  5HLF A;  1RDC A;  3KIO A;  1QTM A;  1B92 A;  4LD0 A;  2IDO A;  3AV9 A;  5CZ2 A;  1BI4 A;  4MFB A;  3JYT A;  1TK0 A;  4CK2 A;  2A1S A;  4W5O A;  3OYI A;  3VQA A;  2D0A A;  1R0A A;  1RDB A;  4BWJ A;  3ZSW A;  1CXQ A;  4CEA A;  3IG1 A;  4CJL A;  4CF9 A;  4CK3 A;  4FCY A;  4B9L A;  3WNH A;  1FKO A;  4K8X A;  3V9U A;  1TAU A;  3OYC A;  1RTJ A;  4DFM A;  4KHU A;  3M8S A;  1HPZ A;  1JLG A;  4DF4 A;  1LW2 A;  2QXF A;  2F8T A;  3CFO A;  3OYM A;  1VSM A;  4DS5 A;  3PO5 A;  5FRM A;  1S1T A;  2OZS A;  1U49 A;  1VSI A;  4CJT A;  4BDY A;  5CZ1 A;  4KPY A;  2VG7 A;  4AIL C;  1CZB A;  1TGO A;  3AA2 A;  3K2P A;  5HP1 A;  1NJW A;  4CGJ A;  1T7P A;  4BDP A;  4FJM A;  1TKX A;  4KTW A;  5KGX A;  4CJE A;  2FBT A;  3OYB A;  4ELV A;  1SV5 A;  2G8W A;  3NH0 A;  3K5N A;  3HP6 A;  1IKV A;  4HCC A;  4CEB A;  2JGU A;  3HPG A;  4ID1 A;  4B08 A;  4KB0 A;  4FLZ A;  1NK6 A;  3ZCM A;  1EET A;  4IBN A;  1WSF A;  2XO7 A;  2VWK A;  4EP4 A;  2P5G A;  1DLO A;  5CY4 A;  1SKS A;  4CE9 A;  1O1W A;  2P5O A;  4CHP A;  2Y1J A;  1HJR A;  1FKP A;  3TAM A;  1YTU A;  3QEX A;  1RBT A;  1UA0 A;  3AVC A;  1XHX A;  4CJS A;  3T1A A;  1S5J A;  2KZZ A;  1GOC A;  3S3M A;  4OGE A;  4DU3 A;  1YT3 A;  2HHX A;  4KHN A;  1HMV A;  3AA5 X;  4N5S A;  3NF6 A;  1JLF A;  4DTN A;  3L2U A;  5HRO A;  3SNN A;  4CHO A;  1S1X A;  3B6O A;  4E19 A;  3OYL A;  4O0I A;  3F9K A;  3M8R A;  1I3A A;  3M8Q A;  4IFV A;  3U3Y A;  1VSH A;  1C1C A;  1A5X A;  1TKT A;  3KLI A;  4JS5 A;  5CYM A;  3LP3 A;  3PX0 A;  4CK1 A;  1LV5 A;  2RN2 A;  4BWM A;  4AHS A;  4DU1 A;  1N5Y A;  4E7L A;  3QIP A;  5FRO A;  1BIU A;  1D8Y A;  1WNS A;  3I0S A;  4CFC A;  3KD5 E;  1RBS A;  1VSF A;  1ITG A;  4WE1 A;  3LWM A;  3AVH A;  3AVL A;  2E6L A;  4CES A;  4EP5 A;  3OYK A;  4DS4 A;  4FM0 A;  1SUQ A;  4DTR A;  1L3T A;  3OS1 A;  3DLB A;  2G8I A;  2R7Y A;  4DTJ A;  2HHW A;  1RDD A;  2P1J A;  3OYE A;  2VWJ A;  3RMC A;  3PUF A;  1QSL A;  2DTU A;  1HYS A;  1EXQ A;  4Z4I A;  4CJP A;  3KD1 E;  3SQ4 A;  1SL2 A;  2DFF A;  4I7F A;  3SQ1 A;  4FW1 A;  3OYG A;  4BAC A;  4IG3 A;  1KVA A;  3U6F A;  3MXM A;  1VSL A;  3HT3 A;  1DTT A;  3QEV A;  2XRI A;  1NK4 A;  4W5Q A;  3LZJ A;  2OYQ A;  1EP4 A;  3LAN A;  2ETJ A;  3AVJ A;  4CJV A;  3DOL A;  3ZSR A;  1T8E A;  3NDK A;  2HHV A;  4E1M A;  1L5U A;  1VRT A;  2DFH A;  3MXJ A;  4O5B A;  3LPT A;  4IDK A;  3TAF A;  1WAF A;  4ICL A;  2IGI A;  4AHV A;  2IOC A;  3QNO A;  3L2V A;  4CGI A;  4RG8 A;  1VK0 A;  3AO1 A;  4KI6 A;  1U04 A;  3HJF A;  3PO4 A;  1IKY A;  2B5J A;  1S9E A;  1ZBF A;  2PYJ A;  1T05 A;  4M3R A;  4DSK A;  1ZBH A;  3ZSX A;  3NGY A;  5DMR A;  4HCB A;  4RW9 A;  5HRS A;  1QHT A;  3F73 A;  4FXD A;  4O44 A;  4CIE A;  3AO2 A;  5C25 A;  4CJ3 A;  3SCX A;  1VSJ A;  4KHW A;  4O0J A;  4F3O A;  3VQE A;  1RDA A;  3TAG A;  4KRF A;  1YVU A;  3NGZ A;  3NCI A;  2PYL A;  2G8F A;  4DSF A;  1S1U A;  1WSE A;  3DOK A;  3OYD A;  1ZBI A;  4GVM A;  1NKC A;  4LH4 A;  2HW3 A;  1RT7 A;  4AHC A;  3V1O A;  1EX4 A;  4CHZ A;  1Q9X A;  3AVK A;  4PQU A;  3OYH A;  5SWM A;  2BGG A;  1J54 A;  3VQC A;  3OYA A;  4H4O A;  1L3U A;  1LWF A;  2XHB A;  4K8Z A;  4OJR A;  1K6Y A;  1TL1 A;  1XC9 A;  1WN7 A;  1IG9 A;  2GBZ A;  1KFS A;  2YV0 X;  3SUQ A;  1NKE A;  1JLA A;  3C6T A;  1RBV A;  2ITG A;  2YHA A;  1B9D A;  2IS3 A;  3QO9 A;  4QAG A;  1KRP A;  4FJN A;  2HVH A;  1W9H A;  2KQ2 A;  2D5R A;  3OJU A;  3RRH A;  2D0B A;  2VG6 A;  4LSN A;  4F4K A;  2FBV A;  3PV8 A;  2BE2 A;  3VQ8 A;  1HRH A;  2VG5 A;  2KTQ A;  3O3H A;  3HP9 A;  4CF0 A;  3C95 A;  4RW7 A;  2X78 A;  3AO4 A;  3ZSQ A;  4F3T A;  4EZ9 A;  2RPI A;  1QE1 A;  3AVN A;  1WSH A;  3DLG A;  3P5J A;  4CER A;  3O4N A;  3EY1 A;  4DQP A;  1LAW A;  1U45 A;  4DQI A;  4CJQ A;  4M3Z A;  3AO5 A;  3HO1 A;  4DFK A;  4C8O A;  2KFZ A;  4CEE A;  4RW6 A;  3V1Q A;  2B6A A;  3P83 D;  3I0R A;  3LAL A;  4Z4C A;  5HRN A;  3K58 A;  4KHY A;  4Z4E A;  4PY5 A;  1KFD A;  4IKF A;  2JLE A;  3NFA A;  3L8B A;  1ASW A;  3QIO A;  3B6P A;  1XI1 A;  3V1R A;  3KK2 A;  1N6Q A;  1TKZ A;  4BDZ A;  4B9N A;  4NYF A;  3NBP A;  4FK0 A;  3T3F A;  4PWD A;  3NF7 A;  1A5W A;  3D0P A;  5JS1 A;  3ALY A;  4O4G A;  1VRU A;  4DSI A;  4FJX A;  1Q9Y A;  3VN5 A;  2G8H A;  4N56 A;  2HVI A;  3DMJ A;  3O4Q A;  3WNG A;  5J2M A;  3PX6 A;  3VA0 A;  2YNF A;  2HB5 A;  2HHQ A;  3IRX A;  2EHG A;  3C94 A;  4F8R A;  2OPP A;  1C0M A;  1TL3 A;  3ZT1 A;  4FVM A;  4CJ4 A;  2EX3 A;  3CYM A;  1KTQ A;  4I9L A;  3KLH A;  4E89 A;  3V4I A;  3VQP A;  4BE2 A;  1RBU A;  4B9S A;  4YFU A;  4C8K A;  4ZHR A;  3V81 A;  5SZT A;  3OYN A;  1D9F A;  2OZM A;  2PY5 A;  1CZ9 A;  4ZTF A;  4B9T A;  3KTQ A;  1NJZ A;  4FJL A;  4QCL A;  1RT3 A;  4YNQ A;  1C0T A;  4E0D A;  4FJK A;  2Q3S A;  4Q0B A;  3ZSO A;  4KKO A;  1KCF A;  4UQG A;  3OYF A;  1B9F A;  4CEO A;  2Z1J A;  1KVB A;  3KKR A;  3VQB A;  4DU4 A;  1TVR A;  3VQQ A;  3LPU A;  3SYZ A;  1RIL A;  2YNI A;  3SV4 A;  4DF8 A;  1J5O A;  4G1Q A;  5T7B A;  3RMA A;  3NHG A;  3L3V A;  3LP2 A;  1BIS A;  3RMB A;  4FM1 A;  4FJ5 A;  3SUN A;  3K5L A;  1S6Q A;  1RNH A;  3E01 A;  4E7J A;  2IC3 A;  3RRG A;  4FW2 A;  4DTX A;  4DTM A;  3VQD A;  4FM2 A;  4I2P A;  3ZT2 A;  1RBR A;  4LSL A;  3EZ5 A;  4FYD A;  2O4I A;  4CED A;  4NCB A;  2Z1G A;  5I42 A;  1RT1 A;  3NH1 A;  4E3S A;  4AHT A;  3WNE A;  4FLX A;  1XWL A;  3SUO A;  4DFJ A;  1JLB A;  3QEP A;  3WNF A;  4FZY A;  1XHZ A;  4M3X A;  2RKI A;  3NE6 A;  1RT6 A;  1C1A A;  1QS4 A;  1U47 A;  1QSS A;  3VA3 A;  2QK9 A;  5KRT A;  2HHT A;  3CM5 A;  5K14 A;  2YHB A;  3MAQ A;  4CGD A;  4FJG A;  3CQ8 A;  5I3U A;  4OLB A;  1Y97 A;  4CF2 A;  4FZX C;  4ELT A;  4CIF A;  3QES A;  1MU2 A;  1LWE A;  1RTD A;  4FJI A;  4Y1D A;  2PZS A;  4KHS A;  1S6P A;  4CGF A;  3VQ5 A;  3MEG A;  4N47 A;  4CGH A;  1JLQ A;  3HPO A;  4E7H A;  2DY4 A;  4JLH A;  1YTA A;  3CG7 A;  4JS4 A;  3SI6 A;  2KFN A;  1WSG A;  3DLK A;  3HL8 A;  4I2Q A;  4EZ6 A;  3L2W A;  5C42 A;  5J2P A;  1T03 A;  1KLM A;  1RCH A;  4H8K A;  2G8U A;  1IH7 A;  5DK5 A;  3M8P A;  3SUP A;  4E7I A;  2E6M A;  1Z25 A;  4DTS A;  4FJH A;  1C1B A;  4Z0U A;  1I39 A;  2WOM A;  4PUO A;  3DRS A;  5KGW A;  3KK1 A;  1JL1 A;  3QNN A;  4DSJ A;  3K57 A;  1GOA A;  2KZM A;  2Z1I A;  3V9Z A;  2B4J A;  2OPR A;  2YNG A;  3V9S A;  1UA1 A;  4ELU A;  4PA1 A;  3ITH A;  1JXB A;  2F96 A;  3H08 A;  1BQN A;  1BHL A;  3AO3 A;  4DSE A;  4KAZ A;  2IAJ A;  4DTU A;  1BGX T;  4FK2 A;  4DLE A;  3HXM A;  3TAQ A;  3ISN C;  1SKR A;  3MEE A;  3C6U A;  1X9W A;  3NH2 A;  4B8C A;  4LY7 A;  3SQ2 A;  4J2D A;  1LAV A;  3T19 A;  3HVT A;  1Z26 A;  4OPK A;  2XY5 A;  1TK8 A;  1QSY A;  4C8L A;  1ASV A;  3AVF A;  3ZT0 A;  3S3O A;  2HHU A;  4CJR A;  3TAP A;  4O55 A;  2WON A;  2Z1H A;  4DMN A;  4DTO A;  3AVM A;  4FLW A;  4ZTJ A;  4FJ9 A;  4IFY A;  3VQ7 A;  3TAN A;  2RF2 A;  3RR8 A;  4DQS A;  1SKW A;  3RR7 A;  3NF9 A;  3VQ6 A;  3QIN A;  2NUB A;  3ZT3 A;  4OKE A;  4OKJ A;  5FRN A;  4J2E A;  2ZQB A;  4FK4 A;  3DLR A;  3RTV A;  4Q5V A;  1HQU A;  1NK0 A;  4RW4 A;  1EKE A;  5KI6 A;  4CEQ A;  4HUG A;  3HPH A;  1KLN A;  2P51 A;  3TI0 A;  1NOY A;  1J9A A;  3OS0 A;  4M3W A;  2OPQ A;  1CXU A;  1UWB A;  1NK7 A;  1WSJ A;  1J53 A;  1RTI A;  4Z4F A;  3SPY A;  1JL2 A;  5HBM A;  4CHY A;  3KLF A;  2BAN A;  4DWI A;  3UIQ A;  4FLU A;  3AVI A;  2XY7 A;  3KKS A;  3V9X A;  2GUI A;  1X9M A;  2HHS A;  1BCM A;  1IKW A;  2ZD1 A;  3PX4 A;  3HVR A;  3SPZ A;  4E7K A;  1TKD A;  3TWH A;  1DTQ A;  3VQ9 A;  4KRE A;  4FLV A;  1G15 A;  5J2Q A;  4KV8 A;  1REV A;  4KFB A;  4DQR A;  4CEC A;  1X9S A;  3IAY A;  3LP0 A;  1VSD A;  3O3G A;  3OY9 A;  3RWU A;  3MXI A;  1IKX A;  1BCO A;  4F2R A;  2QKK A;  4B3O A;  4M45 A;  3DRR A;  3V6D A;  3LDS A;  5HRR A;  3SV3 A;  4BE0 A;  4CIG A;  3THV A;  3NAE A;  1D9D A;  3ULD A;  4J2B A;  5J1E A;  1S1W A;  2FBY A;  1BL3 A;  3IS9 A;  3VQ4 A;  1SL0 A;  1BIZ A;  3DM2 A;  4AHU A;  4QOZ B;  4CF8 A;  1WLJ A;  3ZSZ A;  1FK9 A;  3FFI A;  2AJQ A;  1FXX A;  1F21 A;  3HYF A;  1BI4 B;  1HNI A;  2O4G A;  4H4M A;  3O3F A;  4M41 A;  4CHQ A;  4DQQ A;  1ASU A;  1HQE A;  4DLG A;  4M3U A;  2G8V A;  1QQC A;  5HRP A;  2W42 A;  4OVL A;  3CFP A;  4AHR A;  3LWL A;  1NKB A;  4KO0 A;  1JLE A;  4KTZ A;  4CJK A;  4B9V A;  1HNV A;  4M3Y A;  2HNZ A;  2XY8 A;  2X6N A;  3KLG A;  1WAJ A;  3D45 A;  1KVC A;  3DI6 A;  3OVN A;  3K5O A;  4FJ7 A;  2F8S A;  4OLA A;  4DFP A;  4L8R B;  4N76 A;  3G10 A;  3BDP A;  4DG1 A;  3DLH A;  3KLE A;  4FLT A;  3RMD A;  4M42 A;  1HYV A;  4R5P A;  5JS2 A;  1ZBL A;  4CGG A;  4JRQ A;  2BDP A;  3QLH A;  3G0Z A;  3CM6 A;  3KK3 A;  4B9M A;  1TAQ A;  4HTU A;  1A5V A;  2QKB A;  5J2N A;  1S1V A;  2HMI A;  3QER A;  4OKK A;  3OJS A;  3PY8 A;  1JXE A;  1NK5 A;  4W5T A;  1NJY A;  3AA4 A;  1GOB A;  4DTP A;  1U48 A;  5E41 A;  3A2F A;  4NCG A;  4KTQ A;  4N41 A;  4CEF A;  1IO2 A;  1RTH A;  1L3V A;  3LAM A;  3TAB A;  1NK9 A;  1Q8I A;  3HST B;  1WSI A;  2X74 A;  2YKN A;  1LW0 A;  1NOZ A;  4MQ3 A;  4CFA A;  4HVJ A;  4CHN A;  1TK5 A;  5D3G A;  1RT5 A;  1SL1 A;  3SZ2 A;  4KB1 A;  3ZSV A;  2KW4 A;  4CJ5 A;  4NCA A;  2A1R A;  3NF8 A;  2OA8 A;  4W5N A;  2OPS A;  2LSN A;  4NYN A;  3QEI A;  2G8K A;  3LZI A;  4FZZ A;  2DFE A;  2YNH A;  3L3U A;  1RT2 A;  4HUE A;  4OGC A;  3AVB A;  1W0H A;  3TAR A;  4KI4 A;  1U4B A;  2HND A;  3S9H A;  4I9Q A;  3ZSY A;  3ASM A;  4CJW A;  4E1N A;  5FDL A;  1KSP A;  4FJJ A;  1JLC A;  3LAK A;  4RW8 A;  4Y1C A; 
#chains in the Genus database with same CATH topology
 4PL8 A;  3OHR A;  4C1N K;  1JJ2 M;  4CF1 A;  3MEC A;  1UAX A;  5EU7 A;  1KAY A;  3CCJ N;  2YKM A;  3DLE A;  1D5A A;  4UY8 O;  3HM9 A;  4F2S A;  2GV9 A;  3UKR A;  4AH9 A;  1U2V A;  4CCH A;  4JKA A;  4M3T A;  3UKU B;  1GLE G;  4ID5 A;  1HYZ A;  4HHT A;  1C0U A;  3E66 A;  3SQ0 A;  3DXK B;  3CCV N;  1VQ4 N;  2NRR A;  3W3D A;  4QS7 A;  3I8D A;  3I56 N;  3P1G A;  4FOE A;  1E4G T;  5HLF A;  3OYI A;  2A1S A;  1RDB A;  3ZSW A;  4X66 K;  3IG1 A;  4K8X A;  2FLO A;  2HOE A;  4YOT A;  5M1O A;  4DFM A;  4KHU A;  3M8S A;  1JLG A;  4DF4 A;  2F8T A;  3CFO A;  4NO7 A;  1U49 A;  4CJT A;  4BDY A;  2O8B B;  1LCU A;  4AIL C;  3K2P A;  1TGO A;  1N8R O;  4FJM A;  4GV9 A;  2FBT A;  5AQO A;  3JS6 A;  3K5N A;  3MN7 A;  1XMO K;  4CEB A;  2JGU A;  1NGD A;  4ILJ A;  4B08 A;  1DLO A;  1RBT A;  3O9S A;  4CBW A;  1S5J A;  5GIO A;  3C65 A;  1Q7Y O;  1HMV A;  3AA5 X;  1JLF A;  5AR0 A;  1S1X A;  3GL1 A;  3O5B A;  4JHD B;  5EXW A;  3M8Q A;  1T6C A;  4C23 A;  2A6A A;  3E9P A;  1C1C A;  4BC3 A;  3PX0 A;  4CK1 A;  4DU1 A;  4E7L A;  2ZJR L;  5FRO A;  4BRH A;  4WFB L;  3KD5 E;  2QM1 A;  4ISG A;  4DTR A;  3DLB A;  3OS1 A;  4IEE A;  2VWJ A;  3DAW A;  3PUF A;  3WQU A;  3HBT A;  4A61 A;  2V7Y A;  2ZF5 O;  1EXQ A;  2O8E B;  3VEY A;  4DB3 A;  5IT9 O;  1C0G A;  1KVA A;  3EE8 A;  1M1K O;  1DTT A;  3C7N B;  2P9K A;  3QEV A;  3EN9 A;  1P90 A;  4W5Q A;  3LZJ A;  3T1Y K;  3DOL A;  4KH4 A;  4LF4 K;  3CJA A;  5AQN A;  3LPT A;  3U9Z A;  5BN9 A;  1E3M A;  2IGI A;  1GLL O;  4AHV A;  4CZK A;  2QWM A;  3L2V A;  4H0X B;  3CD6 N;  4KI6 A;  4JKC A;  3M1F A;  4PHT X;  4DSK A;  4NB4 A;  5HRS A;  3THY B;  3IKM A;  2A40 A;  4BRE A;  4FXD A;  4O44 A;  5C25 A;  4CJ3 A;  3VQE A;  3CQX A;  3WXM B;  3NGZ A;  1S1U A;  1WSE A;  3P38 A;  3OYD A;  4JI6 K;  1RT7 A;  3FZM A;  3TSQ A;  4BRP A;  3AVK A;  1NNE A;  5FPD A;  3DLL L;  3NVK A;  3VQC A;  4BRF A;  3Q7B A;  3AGR A;  4H4O A;  4JI0 K;  5AZJ B;  1X3N A;  2NNW A;  1XMQ K;  4K8Z A;  1TL1 A;  1WN7 A;  2E2Q A;  2GBZ A;  3SUQ A;  3WXJ A;  2F9W A;  3C6T A;  3K9J A;  4IEI A;  4XH5 A;  2WTU A;  3CMA N;  4DKW A;  3QO9 A;  1KRP A;  2ZGZ A;  3VPZ A;  2KQ2 A;  1WBD A;  3ID8 A;  3OJU A;  4DV4 K;  3NMU A;  1HRH A;  1OH7 A;  1NLV A;  3HP9 A;  4WCE L;  4EZ9 A;  4HCB A;  1QE1 A;  2ZGY A;  3E1Y A;  4GY2 B;  1LAW A;  4M3Z A;  2D1K A;  2KFZ A;  3K58 A;  5ELZ A;  3I0R A;  3WXL A;  3H3N O;  4FPA A;  3NFA A;  3UKR B;  3H46 O;  1N6Q A;  4BR5 A;  5AQY A;  1GLC G;  3HOS A;  3ALY A;  1V4T A;  3D2F B;  4N56 A;  5J2M A;  2YNF A;  3OBW A;  2HHQ A;  2AA4 A;  4F8R A;  3BEX A;  1TL3 A;  3CXC M;  4CJ4 A;  2EX3 A;  3CYM A;  3ZEU A;  4E89 A;  2YCH A;  4C8K A;  5SZT A;  1Q82 O;  4FWN A;  1NJZ A;  4FJL A;  4QCL A;  4DQ8 A;  2Q3S A;  2W41 A;  1KCF A;  3BP8 A;  1KVB A;  3KKR A;  1OH8 A;  3LPU A;  4DR7 K;  2Q2R A;  3O8M A;  1J5O A;  2YJF A;  1Q86 O;  3L3V A;  3MN6 A;  1ATS A;  2EWS A;  3SUN A;  3E01 A;  1S22 A;  4F9O A;  3U9D A;  4JK9 A;  3ZT2 A;  4LSL A;  4JD2 A;  5KPR A;  4FYD A;  3AY9 A;  2Z1G A;  1K8K A;  4C1N I;  4E3S A;  2E2O A;  2VGN A;  1XWL A;  4DFJ A;  1YJN N;  2RKI A;  1C1A A;  1QS4 A;  4FSV A;  3D7E O;  3GG4 A;  1NGA A;  5M1F A;  4WQ4 C;  4FJG A;  4IO8 A;  3CCQ N;  3QES A;  5AQR A;  4B3T K;  2DY4 A;  4CGH A;  3HPO A;  1JLQ A;  3IFR A;  3KVG A;  3SBG A;  3DLK A;  3TPQ A;  5J2P A;  5DK5 A;  3FZK A;  1Y64 A;  4DTS A;  1HUX A;  5AQH A;  1C1B A;  3QNN A;  5GAG P;  4H0T B;  1DT9 A;  1IJJ A;  2B4J A;  3BUZ B;  4PA1 A;  3ITH A;  1HKB A;  1QQO A;  4DTU A;  4FK2 A;  4DCH A;  3KHY A;  1LAV A;  1Z26 A;  4C8L A;  1O13 A;  2HBM A;  1TK8 A;  3AVF A;  4CJR A;  4L3Q A;  4DMN A;  2Z1H A;  3AVM A;  2IVP A;  1DEJ A;  3MDQ A;  2HF4 A;  4BRA A;  2QWR A;  3AAP A;  4OKE A;  4OKJ A;  5FRN A;  5M1N A;  4FK4 A;  2ZQB A;  4JKE A;  4Q5V A;  3O9R A;  5M1P A;  4BGA A;  2E1Z A;  1EKE A;  4CEQ A;  4HUG A;  4M3W A;  4EFH A;  1CXU A;  1NK7 A;  1J53 A;  4Z4F A;  1VHX A;  4CZL A;  3KLF A;  3L0Q A;  4DWI A;  3UIQ A;  3T7Z A;  1X9M A;  2HHS A;  3QB0 A;  2ZD1 A;  3SPZ A;  1YI2 N;  3D6R A;  4E7K A;  3VQ9 A;  4BG9 A;  3VMF B;  5BRH A;  2ZM6 K;  3O3G A;  1FW6 A;  2QKK A;  3A5L C;  3ULE B;  4M45 A;  1J5E K;  3TSU A;  1SL0 A;  3H3O B;  3DM2 A;  4YOR A;  5FLX O;  3FFI A;  3RR7 A;  4H4M A;  4CVN E;  1QQC A;  2W42 A;  3R6M A;  5M1K A;  4KTZ A;  2X6N A;  2HBK A;  2VGM A;  1YJW N;  4JKG A;  3K5O A;  2F8S A;  1OVQ A;  4AM7 A;  4QS8 A;  4FOI A;  3LL3 A;  4A57 A;  4DG1 A;  4FLT A;  5JS2 A;  2P9U A;  4CGG A;  5BPM A;  5GIP A;  4B9M A;  4BC2 A;  4HTU A;  1HNX K;  4BRC A;  2HMI A;  3SK3 A;  3QER A;  4OKK A;  3PY8 A;  3L4I A;  4W5T A;  1NJY A;  3AA4 A;  1GOB A;  3AAQ A;  4OX9 K;  2QI2 A;  5E41 A;  1XNQ K;  3A2F A;  4KTQ A;  4N41 A;  1IO2 A;  1RTH A;  2QXL A;  1WSI A;  4CFA A;  2OAN A;  4MQ3 A;  4IDH A;  4HVJ A;  1TK5 A;  1SL1 A;  4H03 B;  3FZH A;  1SAZ A;  1N33 K;  3ZSV A;  2D4W A;  2KW4 A;  2OA8 A;  2OPS A;  4FZZ A;  1QHA A;  3HSC A;  2YNH A;  4ILH A;  4OGC A;  3DWL A;  2HND A;  1BO5 O;  4CJW A;  4E1N A;  3MCA B;  4FJJ A;  1WBB A;  3ZT4 A;  1KC8 O;  5KRS A;  3CFR A;  4JD2 B;  3NVM A;  4K42 A;  3QEW A;  1NM1 A;  3LDN A;  3UE5 A;  4K25 A;  4FLY A;  4CJF A;  3CJ9 A;  4CZH A;  2Q0R A;  4GMJ B;  4OPJ A;  4DR6 K;  1C6V A;  3KJV A;  5C24 A;  1BQM A;  4FWO A;  3PIO L;  4BE1 A;  4BRI A;  2XY6 A;  3SJJ A;  1Q18 A;  3HK2 A;  2FC0 A;  4H0O A;  4XIU A;  1X1P A;  5AQJ A;  4B8A B;  3L2R A;  1LWC A;  5FPN A;  5BR8 K;  1HLU A;  1UOC A;  3AA3 A;  3K5M A;  4J2A A;  4IG0 A;  3CJ7 A;  2D0C A;  1S9G A;  2I5J A;  3QET A;  1RDC A;  2OZS A;  4LD0 A;  3AV9 A;  4M7X A;  4I6M A;  2D0A A;  1R0A A;  1QZ5 A;  2P9I B;  4JI5 K;  4HWI A;  3OYC A;  1LW2 A;  2A5X A;  2QXF A;  2WUS A;  3E9O A;  4DS5 A;  3PO5 A;  2H3G X;  4WFN L;  2NRX A;  4BDP A;  4Y0W A;  5GAD P;  4CJE A;  4ELV A;  1SV5 A;  3HP6 A;  3HPG A;  3MN5 A;  1WB9 A;  4DV1 K;  3ZCM A;  1WSF A;  2XO7 A;  2VWK A;  3CPW M;  1SKS A;  4A2A A;  2Y1J A;  5AQI A;  5CHI A;  1HJO A;  1YTU A;  4DUY K;  4LF7 K;  2I7P A;  1GOC A;  1P8Z A;  3VER A;  3A5M C;  3S3M A;  4OGE A;  2HHX A;  4KHN A;  1NGF A;  3CCS N;  4JN4 A;  4N5S A;  4DTN A;  3L2U A;  3SNN A;  5AZI A;  4E19 A;  4O0I A;  3U3Y A;  4IFV A;  1VSH A;  1TKT A;  2A42 A;  3W0L A;  5EY4 A;  2RN2 A;  4AHS A;  5FPM A;  1WNS A;  5DM6 L;  4BRL A;  5AJ3 K;  4WE1 A;  3LWM A;  4DS4 A;  2UUC K;  2E6L A;  3OYK A;  1SUQ A;  3C6H A;  2HHW A;  2G8I A;  2R7Y A;  2P1J A;  4B9Q A;  3RMC A;  3TTD A;  1QSL A;  1BA0 A;  4H0V B;  3SAF A;  4BQZ A;  4BR4 A;  4LFA K;  4I7F A;  3CIP A;  3SQ1 A;  3VTI A;  4XH4 A;  3MN9 A;  3U6F A;  5LMN K;  2J4R A;  4MDA A;  1EP4 A;  3AVJ A;  4CJV A;  2HHV A;  2YHY A;  3ZSR A;  1T8E A;  2IIR A;  3TTC A;  3MXJ A;  4M63 C;  4JK8 A;  4K0K K;  4IDK A;  3TAF A;  1WAF A;  2IOC A;  1WOQ A;  4JI3 K;  1ZBH A;  1ZXO A;  3ZSX A;  3NGY A;  3CCL N;  3RSE B;  3F73 A;  2HBL A;  3SCX A;  4F3O A;  3TAG A;  4BR7 A;  4KRF A;  1HKG A;  4IOX A;  3R9P A;  3NCI A;  3IDH A;  3TTF A;  4LH4 A;  2HW3 A;  5BPN A;  3FZF A;  4CHZ A;  1EX4 A;  1R59 O;  3OYH A;  5SWM A;  2BGG A;  3R8E A;  2P9L B;  1JCE A;  1IV0 A;  1L3U A;  4DV3 K;  4JKF A;  4OJR A;  2UU9 K;  5AFU H;  4A5B A;  4QAG A;  5AQT A;  2IS3 A;  3G4S N;  3VTH A;  3CC4 N;  3ZET A;  2YHX A;  1H1V A;  3RRH A;  4F4K A;  2FBV A;  4FWK A;  2ASM A;  3O3H A;  1DGK N;  3LDO A;  4CF0 A;  5BR9 A;  2X78 A;  4KHP K;  2KKZ A;  3THW A;  1N36 K;  3AVN A;  3DLG A;  4ISE A;  3EY1 A;  4DQI A;  4CJQ A;  3AO5 A;  4CD3 A;  4CEE A;  4KBO A;  3OW2 M;  4PY5 A;  4DV5 K;  3L8B A;  3I8B A;  3B6P A;  3CQY A;  4FWR A;  2QWQ A;  4NYF A;  2QTD A;  3D0P A;  1A5W A;  5JS1 A;  4PKH A;  4K41 A;  1VRU A;  3VN5 A;  3DJC A;  5EOY A;  2HST A;  1QVF M;  4IOA L;  5KQD A;  4XH1 A;  3C94 A;  3SAH A;  4DHY A;  2OCE A;  1KTQ A;  3KLH A;  5BRD A;  3ZX0 A;  5HOO A;  2HHH K;  3VQP A;  3VGK A;  3WT0 A;  3OYN A;  2A41 A;  4I6M B;  1CZ9 A;  4ZTF A;  4B9T A;  4YOU A;  3KTQ A;  3VGL A;  5ADX A;  4NLB A;  4KKO A;  4UQG A;  3OYF A;  4IFE A;  4WQ4 A;  2QWL A;  3VQQ A;  3SYZ A;  4B1U B;  3RMA A;  2GUP A;  3D2E A;  4DR3 K;  1BG3 A;  4LF9 K;  1VQ9 N;  4DTM A;  4FM2 A;  4I2P A;  1RBR A;  3EZ5 A;  4CED A;  1BWF O;  5I42 A;  3NH1 A;  3J80 O;  3H45 C;  4AHT A;  3SUO A;  1JLB A;  1XHZ A;  1QSS A;  4BRN A;  3J7Z O;  4MO5 A;  2QK9 A;  3A5N C;  2PBD A;  2HHT A;  5K14 A;  3MAQ A;  3VOV A;  4YOX A;  5I3U A;  1Y97 A;  1K9M O;  4CF2 A;  4DR4 K;  1MU2 A;  1LWE A;  5AZI B;  1S6P A;  4CGF A;  3VQ5 A;  4E7H A;  4BR0 A;  5BRE A;  2KFN A;  5LY3 A;  4EZ6 A;  3EKS A;  3L2W A;  5C42 A;  1XNR K;  1IH7 A;  3C6A A;  3SUP A;  2CH6 A;  1K73 O;  4FJH A;  1I39 A;  3CHW A;  3OA9 A;  3DRS A;  3KK1 A;  4DSJ A;  3GDQ A;  1GOA A;  3QDK A;  3U4L A;  4CZM A;  2Z1I A;  1JXB A;  2F96 A;  4DSE A;  2JWL A;  4BGB A;  3FFK B;  4LY7 A;  4IOC L;  4OPK A;  1ASV A;  4JV5 K;  2HHU A;  3TAP A;  3P31 A;  4IZ9 A;  3MK6 A;  4FLW A;  1V4S A;  4FJ9 A;  3THX B;  3TAN A;  1S3X A;  3J81 O;  3RR8 A;  4DQS A;  2YI1 A;  3NF9 A;  5BN8 A;  4YOY A;  2W6L A;  3QIN A;  3G6E N;  4LFB K;  3T1H K;  2NRW A;  5LMU K;  2P51 A;  3TI0 A;  2WFB A;  2ZWH A;  2OPQ A;  1UWB A;  1WSJ A;  4BVO A;  2QA4 N;  4CJ7 A;  4O5F A;  3AVI A;  5AQM A;  2GUI A;  3HVR A;  1U2V B;  1HNW K;  3TWH A;  1DTQ A;  3PSI A;  1X9J A;  4JI2 K;  3F5T A;  1G15 A;  5J2Q A;  4KV8 A;  4DQR A;  4CEC A;  1X9S A;  4B3R K;  3GE1 A;  3LP0 A;  3OY9 A;  2E5L K;  3MXI A;  1IKX A;  4H5V A;  4HTL A;  3DRR A;  3LDS A;  3DXM A;  3NAE A;  4J2B A;  1S1W A;  2ASO A;  1BL3 A;  3VET A;  2FBY A;  3CJ1 A;  4AHU A;  1WLJ A;  3ZET B;  1FK9 A;  1FXX A;  1F21 A;  3O3F A;  3CJC A;  2E20 A;  3HM8 A;  4M41 A;  4DQQ A;  2V52 B;  3IMX A;  5HRP A;  4A62 A;  4QS9 A;  3M3Z A;  3LWL A;  1NKB A;  1JLE A;  4CJK A;  4B9V A;  1HNV A;  3VEX A;  4ISF A;  1SQK A;  3D45 A;  3O1W A;  1KVC A;  4OLA A;  3HTV A;  4N76 A;  5E84 A;  5JMV A;  3BDP A;  3DLH A;  3KLE A;  3RMD A;  1HYV A;  3FZL A;  4EHU A;  1NBW A;  3QLH A;  5EX5 A;  3G0Z A;  1NGC A;  4WQ5 A;  2QKB A;  4DV0 K;  2VCP A;  4MLH A;  3KK7 A;  3MX5 A;  1NK5 A;  3CER A;  4LF8 K;  4GKK K;  4NCG A;  1YF5 L;  2QWP A;  2ZJP L;  2UUB K;  3LAM A;  3VEV A;  1KAZ A;  1LW0 A;  4CHN A;  1ESV A;  1NGB A;  1RT5 A;  2BH1 A;  4PKI A;  2A1R A;  5AQG A;  2LSN A;  3WUH A;  1YIT N;  4BRM A;  3LZI A;  1Z05 A;  4HUE A;  4B1V A;  1IBL K;  3AVB A;  2P9P A;  4I9Q A;  1EO1 A;  3ASM A;  1RFQ A;  3MWT A;  3LAK A;  4Y1C A;  3JSM A;  2Y1I A;  3AVA A;  4Z4G A;  1VSE A;  4HUF A;  4LH5 A;  1NMN A;  3L2Q A;  2P9K B;  4U67 L;  4W5R A;  4YDU C;  2P9S A;  5JIC A;  1NK8 A;  2HNY A;  3EYZ A;  3CCU N;  5KTQ A;  1QVG M;  2HF3 A;  4GVE A;  3TR8 A;  3NGI A;  3O08 A;  1EQY A;  3OS2 A;  3MMV A;  1L3S A;  4CEZ A;  4CFD A;  2FBX A;  2ASP A;  4JAX A;  3GOI A;  3K59 A;  4LFC K;  5CYQ A;  5C12 A;  4CJU A;  2QWN A;  3LP1 A;  3L6Q A;  4LC9 B;  4C8M A;  3I55 N;  4KHQ A;  1CLQ A;  4BRG A;  3V9W A;  4B1X B;  1HPM A;  1SS6 A;  4DSL A;  1DKG D;  4FO0 A;  3MED A;  4MDB A;  1TV6 A;  3DYA A;  4CFB A;  1B92 A;  2IDO A;  1BI4 A;  2IVN A;  4JI4 K;  1VQ8 N;  3ZX2 A;  3CET A;  3VQA A;  4AF1 A;  4CEA A;  4BWJ A;  4CJL A;  4CF9 A;  4CK3 A;  3FLC O;  3HI0 A;  4MO4 A;  4B9L A;  1FKO A;  3V9U A;  3BF3 A;  4BC4 A;  1HPZ A;  1HR0 K;  5AQU A;  3OYM A;  1VSM A;  3BZK A;  1VSI A;  5CZ1 A;  4KPY A;  1T6D A;  2VG7 A;  1CZB A;  1TKX A;  4KTW A;  2O8D A;  3NH0 A;  4HCC A;  2CGK A;  4ID1 A;  1CZA N;  1YJ9 N;  4FLZ A;  5AQP A;  4KB0 A;  1EET A;  4IBN A;  3WEE A;  4CE9 A;  1HJR A;  3QEX A;  4FVU A;  3HRG A;  3AVC A;  1XHX A;  4DR1 K;  3T1A A;  5DM7 L;  4FL9 A;  2KZZ A;  1YT3 A;  5HRO A;  3NF6 A;  5LJV A;  3A8Y A;  3M8R A;  4FWL A;  1I3A A;  3KWG A;  5GAE P;  2OTL N;  1A5X A;  4LF6 K;  1LV5 A;  3VGM A;  4B1Z A;  2CH5 A;  3QIP A;  1BIU A;  1D8Y A;  4OPH A;  1W97 L;  3EL2 A;  1YUW A;  5KPT A;  1VSF A;  1ITG A;  3VEO A;  3AVL A;  4FPB A;  3DXM B;  5MLC Q;  4FM0 A;  3ZEU B;  1L3T A;  4CZE A;  1RDD A;  5HL7 L;  3ATV A;  3OYE A;  2ZJQ L;  2DTU A;  4Z4I A;  3WQT A;  4CJP A;  4IO9 L;  1SL2 A;  1N34 K;  4FW1 A;  4BAC A;  4IG3 A;  4BRK A;  1NGE A;  3MXM A;  1VSL A;  2BTF A;  3WXI A;  1YVN A;  2XRI A;  1NK4 A;  2OYQ A;  3LAN A;  2ETJ A;  1X3M A;  1MWM A;  4BRD A;  2AP1 A;  1NU0 A;  4U7B A;  3QNO A;  4H0Y B;  4RG8 A;  1VK0 A;  4CGI A;  3HJF A;  5C2F A;  3PO4 A;  1IKY A;  2B5J A;  3EE9 A;  1T05 A;  4M3R A;  4CI6 A;  2D0O A;  1K8K B;  1E4F T;  1QHT A;  5GIN A;  4KHW A;  4CIE A;  3AO2 A;  1T44 A;  1VSJ A;  4M7Y A;  1RDA A;  1YVU A;  2RHK A;  2PYL A;  4DSF A;  3DOK A;  4GVM A;  1NKC A;  1NGJ A;  5JLF A;  3CCM N;  3UB5 A;  1Q9X A;  2E88 A;  1IG8 A;  1J54 A;  4BR9 A;  3OYA A;  2V51 B;  2CGL A;  2XHB A;  1K6Y A;  4PKG A;  2YV0 X;  1JLA A;  1RBV A;  4B1W B;  2ITG A;  2WBN A;  4FJN A;  3SMS A;  2HVH A;  2P9P B;  2O8C A;  4BC5 A;  1EWQ A;  3A0I X;  2E2N A;  3VQ8 A;  4H0P A;  2VG5 A;  4V19 S;  4GKJ K;  2KTQ A;  3AO4 A;  2WC9 A;  4F3T A;  2RPI A;  1WSH A;  4CER A;  3P5J A;  5IWA K;  3O4N A;  1U45 A;  1XUP O;  3HO1 A;  4C8O A;  3V1Q A;  2B6A A;  3P83 D;  3LAL A;  5C15 A;  5B8H A;  4IKF A;  2GWK A;  2JLE A;  3V1R A;  1GLA G;  3KK2 A;  1TKZ A;  4BDZ A;  4PWD A;  3NBP A;  3LDQ A;  3NF7 A;  4O4G A;  4DSI A;  1Q9Y A;  3DMJ A;  3O4Q A;  4LF5 K;  3VA0 A;  4EIA A;  2HB5 A;  2Q0U A;  2OPP A;  1C0M A;  4FVM A;  4I9L A;  4H5N A;  4CZJ A;  3V4I A;  3SJH A;  1RBU A;  4YFU A;  4YHH K;  4ZHR A;  2OZM A;  1D9F A;  4CZI A;  3EKU A;  4WYB A;  2NLX A;  1RT3 A;  4YNQ A;  4E0D A;  4FJK A;  4NXM K;  1U6Z A;  1Z6R A;  4Q0B A;  1KQS M;  3CJB A;  2Z1J A;  1TVR A;  1RIL A;  3CC7 N;  2YNI A;  3SV4 A;  4DF8 A;  4G1Q A;  5T7B A;  1HKC A;  2UUA K;  4IJA A;  5JVG L;  5A2Q O;  3LP2 A;  1ZC6 A;  1BIS A;  3RMB A;  1TYQ A;  4FM1 A;  3K5L A;  2O8D B;  2VWB A;  4FW2 A;  3VQD A;  3SBT A;  1RT1 A;  3THY A;  3WEE B;  3WNE A;  4M3X A;  4EAH D;  3NE6 A;  2A3Z A;  3VA3 A;  2F7T A;  4BRQ A;  4X65 K;  2HBJ A;  3CM5 A;  2YHW A;  2YHB A;  4OLB A;  4JKG B;  3CQ8 A;  4FZX C;  4ELT A;  2W6K A;  3QFU A;  1RTD A;  4Y1D A;  4KHS A;  3MEG A;  4N47 A;  4JLH A;  2P9U B;  3SI6 A;  5CR4 A;  1WSG A;  3HL8 A;  4I2Q A;  5GAH P;  4IXC A;  1GLJ O;  2OTJ N;  1KLM A;  2G8U A;  1NGG A;  3U8X A;  3M8P A;  4E7I A;  2E6M A;  1Z25 A;  4Z0U A;  4RWT A;  5KGW A;  3BZC A;  2OPR A;  2YNG A;  1UA1 A;  1XC3 A;  4KAZ A;  3H08 A;  1BQN A;  1BHL A;  1RGI A;  2D0P A;  2IAJ A;  4DLE A;  1SKR A;  3C6U A;  1T3V A;  4B8C A;  3VF2 A;  4J2D A;  3T19 A;  5AQV A;  2FXU A;  3HVT A;  2XY5 A;  4JI1 K;  4AM6 A;  1QSY A;  3ZT0 A;  2QWO A;  1TUU A;  4O55 A;  4CBX A;  1N32 K;  4DTO A;  4CZF A;  3H1V X;  4A59 A;  3ZT3 A;  4ILG B;  3RTV A;  3D2F A;  1HQU A;  5AQS A;  4RW4 A;  4YY3 K;  1KLN A;  4A5A A;  3OS0 A;  2RE2 A;  5JVH L;  1JL2 A;  4CHY A;  2BAN A;  1YHQ N;  4FLU A;  3H6E A;  3V9X A;  4BRO A;  1VQO N;  4DV6 K;  1BCM A;  3PX4 A;  4B3S K;  3O6W A;  4NXN K;  2Q36 A;  3R1X A;  4BY9 C;  2PFU A;  1VSD A;  4B3O A;  1BCO A;  4F2R A;  4FWM A;  5HRR A;  4BVP A;  4BE0 A;  3THV A;  3ULD A;  1QQM A;  3VQ4 A;  3IS9 A;  1IBM K;  1KD1 O;  1BIZ A;  5JLH A;  4QOZ B;  3ZSZ A;  4NLC A;  4RCH A;  2O8C B;  1ILY A;  4CHQ A;  3CF5 L;  4M3U A;  4JEP A;  2P9N A;  5C2D A;  2VYP A;  3CFP A;  3F2K A;  4AHR A;  4X64 K;  3P39 A;  2HNZ A;  1EWR A;  2XY8 A;  3KLG A;  1WAJ A;  1G99 A;  1QQN A;  3DI6 A;  3OVN A;  4FJ7 A;  4DV7 K;  4DFP A;  4L8R B;  4K43 A;  1LOT B;  2Q1N A;  1ZBL A;  4JKB A;  3CM6 A;  3KK3 A;  1TAQ A;  4B1Y B;  5J2N A;  1SZ2 A;  1S1V A;  3OJS A;  1JXE A;  4IJN A;  1I94 K;  1YAG A;  4DTP A;  4BQL A;  1U48 A;  4JKD A;  4CEF A;  1XQS C;  3HZ6 A;  4KH6 A;  4YDU A;  1NOZ A;  3H1Q A;  5D3G A;  3SZ2 A;  4KB1 A;  5FPE A;  1KAX A;  3LM2 A;  4NCA A;  3NF8 A;  4NYN A;  3G71 N;  2DFE A;  1J6Z A;  4AQY K;  4FWQ A;  4KI4 A;  3S9H A;  4BG8 A;  3ZSY A;  1TYQ B;  2F9T A;  1KSP A;  4RW8 A;  4JS5 A;  2O4I A;  4Z4H A;  3QIC A;  2E4L A;  2ZE2 A;  1GLB G;  1NJX A;  3FE1 A;  3BGR A;  3VEZ A;  1W2B M;  3TAE A;  2NRZ A;  2FSJ A;  1ZBU A;  2X6S A;  4FJ8 A;  3ID6 A;  3EZW A;  2FF6 A;  3I33 A;  1ZYQ A;  1VSK A;  4C8N A;  2I7N A;  1QZ6 A;  4TSX A;  1JKH A;  2DPN A;  3AVG A;  1RT4 A;  1VQK N;  3CI5 A;  3QBW A;  4GW6 A;  3ULE A;  2KLA A;  4B9U A;  3DRP A;  2ATQ A;  3M5R A;  3FGU A;  3O9U A;  3U3G A;  4JRP A;  3OYJ A;  3S3N A;  3KIO A;  1QTM A;  3JYT A;  5AQK A;  5CZ2 A;  4MFB A;  1TK0 A;  4CK2 A;  4W5O A;  4FCY A;  1CXQ A;  1NGI A;  1S72 N;  1TAU A;  3WNH A;  2PAV A;  3M6G A;  1RDW X;  1RTJ A;  1NG9 A;  2E1Y A;  3BF1 A;  4CW7 B;  4CZG A;  4GV3 A;  4OPA A;  5FRM A;  1S1T A;  2Q31 A;  3JXU A;  4DR2 K;  3OTO K;  4FJ5 A;  3AA2 A;  5HP1 A;  1NJW A;  2FF3 B;  4CGJ A;  1T7P A;  2O8F A;  5KGX A;  3OYB A;  1K8A O;  3C0B A;  2G8W A;  4H5R A;  2IVO A;  1IKV A;  5AQQ A;  1ZBS A;  5BRF A;  1NK6 A;  2P5G A;  4EP4 A;  5CY4 A;  5F1X A;  2P5O A;  1O1W A;  2E2P A;  1YXQ A;  4CHP A;  5CE3 A;  3THW B;  3TAM A;  1FKP A;  1UA0 A;  4CJS A;  4DU3 A;  1FJG K;  2Q97 A;  4CHO A;  3B6O A;  3OYL A;  3F9K A;  3KLI A;  5CYM A;  3LP3 A;  1W7A A;  3O80 A;  4BWM A;  1N5Y A;  1WUA A;  4JKH A;  3I0S A;  3WXK A;  4CFC A;  1RBS A;  1YIJ N;  2W40 A;  3AVH A;  4CES A;  4EP5 A;  4DTJ A;  3CCR N;  1HYS A;  3KD1 E;  3SQ4 A;  1Q81 O;  2DFF A;  3OYG A;  2P9N B;  3K0S A;  4JI8 K;  3HT3 A;  4BR2 A;  3QML A;  2HMP A;  1NGH A;  3VEW A;  3NDK A;  4E1M A;  1L5U A;  1VRT A;  2DFH A;  4O5B A;  3PIP L;  4ICL A;  3KWI A;  3D2E B;  2NZT A;  3AO1 A;  1U04 A;  5AQW A;  3O4W A;  3RVC A;  1BUP A;  1S9E A;  1ZBF A;  2PYJ A;  5C10 A;  5DMR A;  4RW9 A;  3GBT A;  5F2R A;  1MWK A;  4O0J A;  1ZBI A;  3SLC A;  2G8F A;  2GX9 A;  1OH5 A;  4AHC A;  3V1O A;  4GNI A;  4PQU A;  1M90 O;  2P9I A;  3AAR A;  1VQM N;  1LWF A;  2NRH A;  3E9L A;  3QBX A;  1XC9 A;  1OVY A;  3P4I A;  5ADX H;  4PL7 A;  1IG9 A;  1KFS A;  1NKE A;  1TUY A;  1VAZ A;  2UXC K;  2YHA A;  1B9D A;  2GEL A;  1W9H A;  1OKJ A;  1JCF A;  2D5R A;  4CBU A;  2D0B A;  2VG6 A;  4LSN A;  3PV8 A;  2BE2 A;  3LM9 A;  3ZYY X;  4DV2 K;  3C95 A;  3EO3 A;  3QFP A;  4RW7 A;  2GWJ A;  3ZSQ A;  4DQP A;  5AQX A;  4DFK A;  4RW6 A;  2UXD K;  5HRN A;  4Z4C A;  4KHY A;  1GLD G;  2FSK A;  4Z4E A;  1KFD A;  3CME N;  3EEQ A;  1ASW A;  3QIO A;  1XI1 A;  4B9N A;  4FK0 A;  3T3F A;  3VF6 A;  2KHO A;  4FJX A;  3KZB A;  2G8H A;  2HVI A;  3WNG A;  3PX6 A;  3IRX A;  2EHG A;  3O1B A;  3ZT1 A;  3J7Y P;  3VEN A;  1OH6 A;  2F4V K;  4BE2 A;  4B9S A;  4CD1 A;  3V81 A;  2PY5 A;  2NRT A;  3ENH A;  1C0T A;  5AFU A;  3ZSO A;  1B9F A;  4CEO A;  4O8K A;  1BA1 A;  3VQB A;  4DU4 A;  1HX1 A;  3JAM O;  1VQL N;  4JYA K;  3NHG A;  1S6Q A;  1RNH A;  2O8F B;  4E7J A;  2IC3 A;  3RRG A;  4DTX A;  3VES A;  4NCB A;  4E1J A;  1GLF O;  1JCG A;  3RSE A;  3CCE N;  4A2B A;  4FLX A;  3QEP A;  3WNF A;  4FZY A;  1RT6 A;  2VQF K;  1U47 A;  5KRT A;  3A5O C;  3BY5 A;  4CGD A;  4DUZ K;  2VQE K;  4CIF A;  3UKU A;  2P9L A;  4FJI A;  5F0X A;  4YOW A;  3MX2 A;  2QW9 A;  1BU6 O;  4R79 A;  2PZS A;  4Z94 A;  4H5W A;  3K9K A;  3PSF A;  1YTA A;  3CG7 A;  4JS4 A;  3CC2 N;  3DXK A;  3ENB A;  1D4X A;  1T03 A;  4IWV A;  1VQ6 N;  1RCH A;  4H8K A;  2WOM A;  1BDG A;  4WF9 L;  4PUO A;  4WQ5 C;  1JL1 A;  3O9T A;  2GEM A;  3K57 A;  2KZM A;  3T69 A;  4OO1 J;  3V9Z A;  3V9S A;  4ELU A;  5BPL A;  3AO3 A;  3FR0 A;  1BGX T;  2E8A A;  3HXM A;  3TAQ A;  3ISN C;  5LJW A;  3MEE A;  1X9W A;  4JK7 A;  3NH2 A;  3LDL A;  5LL6 Z;  3SQ2 A;  1MA9 B;  4FWS A;  2O8B A;  3S3O A;  4JI7 K;  5E26 A;  3G25 A;  3IUC A;  2WON A;  4ZTJ A;  4IFY A;  3VQ7 A;  5KPZ A;  2RF2 A;  1SKW A;  5TKY A;  3VQ6 A;  4WFA L;  2NUB A;  3ZX3 A;  4J2E A;  3DLR A;  1BOT O;  4O8U A;  4GV6 A;  1NMD A;  1NK0 A;  5KI6 A;  3HPH A;  3J8A A;  4MLE A;  5KQ8 A;  1NOY A;  1J9A A;  5TKW A;  1ATN A;  2P9S B;  1RTI A;  3SPY A;  5HBM A;  3SMP A;  3F9M A;  2XY7 A;  3S41 A;  3KKS A;  4J8F A;  2YX6 A;  2ITM A;  4JHD A;  5AQL A;  1IKW A;  4XEI A;  3N4P A;  1TKD A;  2V7Z A;  4KRE A;  4FLV A;  5I9E B;  2UYT A;  2BUP A;  1REV A;  3ATU A;  4KFB A;  3IAY A;  3RWU A;  3N4Q A;  3J7A P;  3V6D A;  1ATR A;  4H5T A;  3SV3 A;  1D9D A;  4CIG A;  2UXB K;  5J1E A;  3R3L A;  3SAG A;  1MDU B;  4CF8 A;  2AJQ A;  4YOV A;  2O8E A;  3HYF A;  1BI4 B;  1HNI A;  2O4G A;  1ASU A;  1HQE A;  4DLG A;  2G8V A;  1NWK A;  4JNE A;  3CPE A;  2FSN A;  3C7N A;  4G9Z A;  4OVL A;  4RTF D;  4B3M K;  2NRV A;  4KO0 A;  5EVZ A;  3LDP A;  4M3Y A;  3MWP A;  3O9Q A;  3HOT A;  3G10 A;  2QEX N;  4M42 A;  4R5P A;  2CGJ A;  4JRQ A;  3L4Q A;  5AQF A;  4EHT A;  2BDP A;  3MCP A;  4DR5 K;  3ENO A;  1A5V A;  3AGK A;  4KH5 A;  3B8A X;  2JWK A;  1RDU A;  1VQP N;  3PLA A;  1KXP A;  3VF4 A;  3OBY A;  1L3V A;  3TAB A;  5M1Q A;  1NK9 A;  1Q8I A;  3HST B;  4FWP A;  3TU5 A;  2X74 A;  2YKN A;  5AQZ A;  5AZJ A;  4X62 K;  4CJ5 A;  4W5N A;  1VQN N;  3TSP A;  2GTD A;  1VQ7 N;  3Q7C A;  1IBK K;  5C0Y A;  1C0F A;  3QEI A;  2G8K A;  1NJI O;  3L3U A;  2YJE A;  1RT2 A;  1HNZ K;  1VQ5 N;  3TAR A;  1W0H A;  3THX A;  1U4B A;  3ZLJ A;  5H1S Q;  5FDL A;  1JLC A; 
#chains in the Genus database with same CATH homology
 3JSM A;  4Z4H A;  2Y1I A;  3AVA A;  3ZT4 A;  1VSE A;  2E4L A;  2ZE2 A;  4CF1 A;  4HUF A;  1NJX A;  4Z4G A;  3MEC A;  5KRS A;  3CFR A;  3BGR A;  1UAX A;  5EU7 A;  4LH5 A;  3TAE A;  3L2Q A;  3QEW A;  2YKM A;  1ZBU A;  3DLE A;  1D5A A;  4W5R A;  2X6S A;  3HM9 A;  1NK8 A;  2HNY A;  4FJ8 A;  4F2S A;  3EYZ A;  5KTQ A;  3TR8 A;  1ZYQ A;  3NGI A;  2GV9 A;  1VSK A;  4C8N A;  4AH9 A;  4TSX A;  3OS2 A;  4CJF A;  4FLY A;  1JKH A;  4GMJ B;  4OPJ A;  1L3S A;  4CCH A;  4CEZ A;  4M3T A;  4CFD A;  2FBX A;  1C6V A;  3AVG A;  3KJV A;  1RT4 A;  5C24 A;  1BQM A;  4ID5 A;  3K59 A;  1HYZ A;  4BE1 A;  3SJJ A;  2XY6 A;  5CYQ A;  4CJU A;  4HHT A;  1C0U A;  3HK2 A;  4GW6 A;  2FC0 A;  4XIU A;  3LP1 A;  1CLQ A;  1X1P A;  4C8M A;  4B8A B;  3L2R A;  3SQ0 A;  4B9U A;  3DRP A;  3V9W A;  2ATQ A;  4KHQ A;  1LWC A;  4DSL A;  1UOC A;  3AA3 A;  3I8D A;  3K5M A;  3P1G A;  3MED A;  4J2A A;  4IG0 A;  1TV6 A;  1S9G A;  2D0C A;  2I5J A;  3DYA A;  3U3G A;  4CFB A;  3OYJ A;  4JRP A;  3QET A;  3S3N A;  5HLF A;  1RDC A;  3KIO A;  1QTM A;  1B92 A;  4LD0 A;  2IDO A;  3AV9 A;  5CZ2 A;  1BI4 A;  4MFB A;  3JYT A;  1TK0 A;  4CK2 A;  2A1S A;  4W5O A;  3OYI A;  3VQA A;  2D0A A;  1R0A A;  1RDB A;  4BWJ A;  3ZSW A;  1CXQ A;  4CEA A;  3IG1 A;  4CJL A;  4CF9 A;  4CK3 A;  4FCY A;  4B9L A;  3WNH A;  1FKO A;  4K8X A;  3V9U A;  1TAU A;  3OYC A;  1RTJ A;  4DFM A;  4KHU A;  3M8S A;  1HPZ A;  1JLG A;  4DF4 A;  1LW2 A;  2QXF A;  2F8T A;  3CFO A;  3OYM A;  1VSM A;  4DS5 A;  3PO5 A;  5FRM A;  1S1T A;  2OZS A;  1U49 A;  1VSI A;  4CJT A;  4BDY A;  5CZ1 A;  4KPY A;  2VG7 A;  4AIL C;  1CZB A;  1TGO A;  3AA2 A;  3K2P A;  5HP1 A;  1NJW A;  4CGJ A;  1T7P A;  4BDP A;  4FJM A;  1TKX A;  4KTW A;  5KGX A;  4CJE A;  2FBT A;  3OYB A;  4ELV A;  1SV5 A;  2G8W A;  3NH0 A;  3K5N A;  3HP6 A;  1IKV A;  4HCC A;  4CEB A;  2JGU A;  3HPG A;  4ID1 A;  4B08 A;  4KB0 A;  4FLZ A;  1NK6 A;  3ZCM A;  1EET A;  4IBN A;  1WSF A;  2XO7 A;  2VWK A;  4EP4 A;  2P5G A;  1DLO A;  5CY4 A;  1SKS A;  4CE9 A;  1O1W A;  2P5O A;  4CHP A;  2Y1J A;  1HJR A;  1FKP A;  3TAM A;  1YTU A;  3QEX A;  1RBT A;  1UA0 A;  3AVC A;  1XHX A;  4CJS A;  3T1A A;  1S5J A;  2KZZ A;  1GOC A;  3S3M A;  4OGE A;  4DU3 A;  1YT3 A;  2HHX A;  4KHN A;  1HMV A;  3AA5 X;  4N5S A;  3NF6 A;  1JLF A;  4DTN A;  3L2U A;  5HRO A;  3SNN A;  4CHO A;  1S1X A;  3B6O A;  4E19 A;  3OYL A;  4O0I A;  3F9K A;  3M8R A;  1I3A A;  3M8Q A;  4IFV A;  3U3Y A;  1VSH A;  1C1C A;  1A5X A;  1TKT A;  3KLI A;  4JS5 A;  5CYM A;  3LP3 A;  3PX0 A;  4CK1 A;  1LV5 A;  2RN2 A;  4BWM A;  4AHS A;  4DU1 A;  1N5Y A;  4E7L A;  3QIP A;  5FRO A;  1BIU A;  1D8Y A;  1WNS A;  3I0S A;  4CFC A;  3KD5 E;  1RBS A;  1VSF A;  1ITG A;  4WE1 A;  3LWM A;  3AVH A;  3AVL A;  2E6L A;  4CES A;  4EP5 A;  3OYK A;  4DS4 A;  4FM0 A;  1SUQ A;  4DTR A;  1L3T A;  3OS1 A;  3DLB A;  2G8I A;  2R7Y A;  4DTJ A;  2HHW A;  1RDD A;  2P1J A;  3OYE A;  2VWJ A;  3RMC A;  3PUF A;  1QSL A;  2DTU A;  1HYS A;  1EXQ A;  4Z4I A;  4CJP A;  3KD1 E;  3SQ4 A;  1SL2 A;  2DFF A;  4I7F A;  3SQ1 A;  4FW1 A;  3OYG A;  4BAC A;  4IG3 A;  1KVA A;  3U6F A;  3MXM A;  1VSL A;  3HT3 A;  1DTT A;  3QEV A;  2XRI A;  1NK4 A;  4W5Q A;  3LZJ A;  2OYQ A;  1EP4 A;  3LAN A;  2ETJ A;  3AVJ A;  4CJV A;  3DOL A;  3ZSR A;  1T8E A;  3NDK A;  2HHV A;  4E1M A;  1L5U A;  1VRT A;  2DFH A;  3MXJ A;  4O5B A;  3LPT A;  4IDK A;  3TAF A;  1WAF A;  4ICL A;  2IGI A;  4AHV A;  2IOC A;  3QNO A;  3L2V A;  4CGI A;  4RG8 A;  1VK0 A;  3AO1 A;  4KI6 A;  1U04 A;  3HJF A;  3PO4 A;  1IKY A;  2B5J A;  1S9E A;  1ZBF A;  2PYJ A;  1T05 A;  4M3R A;  4DSK A;  1ZBH A;  3ZSX A;  3NGY A;  5DMR A;  4HCB A;  4RW9 A;  5HRS A;  1QHT A;  3F73 A;  4FXD A;  4O44 A;  4CIE A;  3AO2 A;  5C25 A;  4CJ3 A;  3SCX A;  1VSJ A;  4KHW A;  4O0J A;  4F3O A;  3VQE A;  1RDA A;  3TAG A;  4KRF A;  1YVU A;  3NGZ A;  3NCI A;  2PYL A;  2G8F A;  4DSF A;  1S1U A;  1WSE A;  3DOK A;  3OYD A;  1ZBI A;  4GVM A;  1NKC A;  4LH4 A;  2HW3 A;  1RT7 A;  4AHC A;  3V1O A;  1EX4 A;  4CHZ A;  1Q9X A;  3AVK A;  4PQU A;  3OYH A;  5SWM A;  2BGG A;  1J54 A;  3VQC A;  3OYA A;  4H4O A;  1L3U A;  1LWF A;  2XHB A;  4K8Z A;  4OJR A;  1K6Y A;  1TL1 A;  1XC9 A;  1WN7 A;  1IG9 A;  2GBZ A;  1KFS A;  2YV0 X;  3SUQ A;  1NKE A;  1JLA A;  3C6T A;  1RBV A;  2ITG A;  2YHA A;  1B9D A;  2IS3 A;  3QO9 A;  4QAG A;  1KRP A;  4FJN A;  2HVH A;  1W9H A;  2KQ2 A;  2D5R A;  3OJU A;  3RRH A;  2D0B A;  2VG6 A;  4LSN A;  4F4K A;  2FBV A;  3PV8 A;  2BE2 A;  3VQ8 A;  1HRH A;  2VG5 A;  2KTQ A;  3O3H A;  3HP9 A;  4CF0 A;  3C95 A;  4RW7 A;  2X78 A;  3AO4 A;  3ZSQ A;  4F3T A;  4EZ9 A;  2RPI A;  1QE1 A;  3AVN A;  1WSH A;  3DLG A;  3P5J A;  4CER A;  3O4N A;  3EY1 A;  4DQP A;  1LAW A;  1U45 A;  4DQI A;  4CJQ A;  4M3Z A;  3AO5 A;  3HO1 A;  4DFK A;  4C8O A;  2KFZ A;  4CEE A;  4RW6 A;  3V1Q A;  2B6A A;  3P83 D;  3I0R A;  3LAL A;  4Z4C A;  5HRN A;  3K58 A;  4KHY A;  4Z4E A;  4PY5 A;  1KFD A;  4IKF A;  2JLE A;  3NFA A;  3L8B A;  1ASW A;  3QIO A;  3B6P A;  1XI1 A;  3V1R A;  3KK2 A;  1N6Q A;  1TKZ A;  4BDZ A;  4B9N A;  4NYF A;  3NBP A;  4FK0 A;  3T3F A;  4PWD A;  3NF7 A;  1A5W A;  3D0P A;  5JS1 A;  3ALY A;  4O4G A;  1VRU A;  4DSI A;  4FJX A;  1Q9Y A;  3VN5 A;  2G8H A;  4N56 A;  2HVI A;  3DMJ A;  3O4Q A;  3WNG A;  5J2M A;  3PX6 A;  3VA0 A;  2YNF A;  2HB5 A;  2HHQ A;  3IRX A;  2EHG A;  3C94 A;  4F8R A;  2OPP A;  1C0M A;  1TL3 A;  3ZT1 A;  4FVM A;  4CJ4 A;  2EX3 A;  3CYM A;  1KTQ A;  4I9L A;  3KLH A;  4E89 A;  3V4I A;  3VQP A;  4BE2 A;  1RBU A;  4B9S A;  4YFU A;  4C8K A;  4ZHR A;  3V81 A;  5SZT A;  3OYN A;  1D9F A;  2OZM A;  2PY5 A;  1CZ9 A;  4ZTF A;  4B9T A;  3KTQ A;  1NJZ A;  4FJL A;  4QCL A;  1RT3 A;  4YNQ A;  1C0T A;  4E0D A;  4FJK A;  2Q3S A;  4Q0B A;  3ZSO A;  4KKO A;  1KCF A;  4UQG A;  3OYF A;  1B9F A;  4CEO A;  2Z1J A;  1KVB A;  3KKR A;  3VQB A;  4DU4 A;  1TVR A;  3VQQ A;  3LPU A;  3SYZ A;  1RIL A;  2YNI A;  3SV4 A;  4DF8 A;  1J5O A;  4G1Q A;  5T7B A;  3RMA A;  3NHG A;  3L3V A;  3LP2 A;  1BIS A;  3RMB A;  4FM1 A;  4FJ5 A;  3SUN A;  3K5L A;  1S6Q A;  1RNH A;  3E01 A;  4E7J A;  2IC3 A;  3RRG A;  4FW2 A;  4DTX A;  4DTM A;  3VQD A;  4FM2 A;  4I2P A;  3ZT2 A;  1RBR A;  4LSL A;  3EZ5 A;  4FYD A;  2O4I A;  4CED A;  4NCB A;  2Z1G A;  5I42 A;  1RT1 A;  3NH1 A;  4E3S A;  4AHT A;  3WNE A;  4FLX A;  1XWL A;  3SUO A;  4DFJ A;  1JLB A;  3QEP A;  3WNF A;  4FZY A;  1XHZ A;  4M3X A;  2RKI A;  3NE6 A;  1RT6 A;  1C1A A;  1QS4 A;  1U47 A;  1QSS A;  3VA3 A;  2QK9 A;  5KRT A;  2HHT A;  3CM5 A;  5K14 A;  2YHB A;  3MAQ A;  4CGD A;  4FJG A;  3CQ8 A;  5I3U A;  4OLB A;  1Y97 A;  4CF2 A;  4FZX C;  4ELT A;  4CIF A;  3QES A;  1MU2 A;  1LWE A;  1RTD A;  4FJI A;  4Y1D A;  2PZS A;  4KHS A;  1S6P A;  4CGF A;  3VQ5 A;  3MEG A;  4N47 A;  4CGH A;  1JLQ A;  3HPO A;  4E7H A;  2DY4 A;  4JLH A;  1YTA A;  3CG7 A;  4JS4 A;  3SI6 A;  2KFN A;  1WSG A;  3DLK A;  3HL8 A;  4I2Q A;  4EZ6 A;  3L2W A;  5C42 A;  5J2P A;  1T03 A;  1KLM A;  1RCH A;  4H8K A;  2G8U A;  1IH7 A;  5DK5 A;  3M8P A;  3SUP A;  4E7I A;  2E6M A;  1Z25 A;  4DTS A;  4FJH A;  1C1B A;  4Z0U A;  1I39 A;  2WOM A;  4PUO A;  3DRS A;  5KGW A;  3KK1 A;  1JL1 A;  3QNN A;  4DSJ A;  3K57 A;  1GOA A;  2KZM A;  2Z1I A;  3V9Z A;  2B4J A;  2OPR A;  2YNG A;  3V9S A;  1UA1 A;  4ELU A;  4PA1 A;  3ITH A;  1JXB A;  2F96 A;  3H08 A;  1BQN A;  1BHL A;  3AO3 A;  4DSE A;  4KAZ A;  2IAJ A;  4DTU A;  1BGX T;  4FK2 A;  4DLE A;  3HXM A;  3TAQ A;  3ISN C;  1SKR A;  3MEE A;  3C6U A;  1X9W A;  3NH2 A;  4B8C A;  4LY7 A;  3SQ2 A;  4J2D A;  1LAV A;  3T19 A;  3HVT A;  1Z26 A;  4OPK A;  2XY5 A;  1TK8 A;  1QSY A;  4C8L A;  1ASV A;  3AVF A;  3ZT0 A;  3S3O A;  2HHU A;  4CJR A;  3TAP A;  4O55 A;  2WON A;  2Z1H A;  4DMN A;  4DTO A;  3AVM A;  4FLW A;  4ZTJ A;  4FJ9 A;  4IFY A;  3VQ7 A;  3TAN A;  2RF2 A;  3RR8 A;  4DQS A;  1SKW A;  3RR7 A;  3NF9 A;  3VQ6 A;  3QIN A;  2NUB A;  3ZT3 A;  4OKE A;  4OKJ A;  5FRN A;  4J2E A;  2ZQB A;  4FK4 A;  3DLR A;  3RTV A;  4Q5V A;  1HQU A;  1NK0 A;  4RW4 A;  1EKE A;  5KI6 A;  4CEQ A;  4HUG A;  3HPH A;  1KLN A;  2P51 A;  3TI0 A;  1NOY A;  1J9A A;  3OS0 A;  4M3W A;  2OPQ A;  1CXU A;  1UWB A;  1NK7 A;  1WSJ A;  1J53 A;  1RTI A;  4Z4F A;  3SPY A;  1JL2 A;  5HBM A;  4CHY A;  3KLF A;  2BAN A;  4DWI A;  3UIQ A;  4FLU A;  3AVI A;  2XY7 A;  3KKS A;  3V9X A;  2GUI A;  1X9M A;  2HHS A;  1BCM A;  1IKW A;  2ZD1 A;  3PX4 A;  3HVR A;  3SPZ A;  4E7K A;  1TKD A;  3TWH A;  1DTQ A;  3VQ9 A;  4KRE A;  4FLV A;  1G15 A;  5J2Q A;  4KV8 A;  1REV A;  4KFB A;  4DQR A;  4CEC A;  1X9S A;  3IAY A;  3LP0 A;  1VSD A;  3O3G A;  3OY9 A;  3RWU A;  3MXI A;  1IKX A;  1BCO A;  4F2R A;  2QKK A;  4B3O A;  4M45 A;  3DRR A;  3V6D A;  3LDS A;  5HRR A;  3SV3 A;  4BE0 A;  4CIG A;  3THV A;  3NAE A;  1D9D A;  3ULD A;  4J2B A;  5J1E A;  1S1W A;  2FBY A;  1BL3 A;  3IS9 A;  3VQ4 A;  1SL0 A;  1BIZ A;  3DM2 A;  4AHU A;  4QOZ B;  4CF8 A;  1WLJ A;  3ZSZ A;  1FK9 A;  3FFI A;  2AJQ A;  1FXX A;  1F21 A;  3HYF A;  1BI4 B;  1HNI A;  2O4G A;  4H4M A;  3O3F A;  4M41 A;  4CHQ A;  4DQQ A;  1ASU A;  1HQE A;  4DLG A;  4M3U A;  2G8V A;  1QQC A;  5HRP A;  2W42 A;  4OVL A;  3CFP A;  4AHR A;  3LWL A;  1NKB A;  4KO0 A;  1JLE A;  4KTZ A;  4CJK A;  4B9V A;  1HNV A;  4M3Y A;  2HNZ A;  2XY8 A;  2X6N A;  3KLG A;  1WAJ A;  3D45 A;  1KVC A;  3DI6 A;  3OVN A;  3K5O A;  4FJ7 A;  2F8S A;  4OLA A;  4DFP A;  4L8R B;  4N76 A;  3G10 A;  3BDP A;  4DG1 A;  3DLH A;  3KLE A;  4FLT A;  3RMD A;  4M42 A;  1HYV A;  4R5P A;  5JS2 A;  1ZBL A;  4CGG A;  4JRQ A;  2BDP A;  3QLH A;  3G0Z A;  3CM6 A;  3KK3 A;  4B9M A;  1TAQ A;  4HTU A;  1A5V A;  2QKB A;  5J2N A;  1S1V A;  2HMI A;  3QER A;  4OKK A;  3OJS A;  3PY8 A;  1JXE A;  1NK5 A;  4W5T A;  1NJY A;  3AA4 A;  1GOB A;  4DTP A;  1U48 A;  5E41 A;  3A2F A;  4NCG A;  4KTQ A;  4N41 A;  4CEF A;  1IO2 A;  1RTH A;  1L3V A;  3LAM A;  3TAB A;  1NK9 A;  1Q8I A;  3HST B;  1WSI A;  2X74 A;  2YKN A;  1LW0 A;  1NOZ A;  4MQ3 A;  4CFA A;  4HVJ A;  4CHN A;  1TK5 A;  5D3G A;  1RT5 A;  1SL1 A;  3SZ2 A;  4KB1 A;  3ZSV A;  2KW4 A;  4CJ5 A;  4NCA A;  2A1R A;  3NF8 A;  2OA8 A;  4W5N A;  2OPS A;  2LSN A;  4NYN A;  3QEI A;  2G8K A;  3LZI A;  4FZZ A;  2DFE A;  2YNH A;  3L3U A;  1RT2 A;  4HUE A;  4OGC A;  3AVB A;  1W0H A;  3TAR A;  4KI4 A;  1U4B A;  2HND A;  3S9H A;  4I9Q A;  3ZSY A;  3ASM A;  4CJW A;  4E1N A;  5FDL A;  1KSP A;  4FJJ A;  1JLC A;  3LAK A;  4RW8 A;  4Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...