3NH1A

Crystal structure of rnase t in complex with a preferred ssdna (tagg) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 59
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh1A00
4CE9A 4DTPA 2PY5A 3ALYA 2XHBA 3AO5A 4CERA 4NCBA 5HLFA 3TANA 3HL8A 2A1RA 1YVUA 3NCIA 4CJQA 1QSLA 4DTSA 4K8XA 1ZBIA 1TVRA 2YNFA 3OYCA 3TI0A 4DTJA 4ELTA 4C8NA 1EX4A 4NCGA 3QIOA 4AHCA 4N5SA 5DMRA 4JRPA 1NK9A 1TL3A 1VSLA 2FBYA 3AVJA 1JL1A 1VSEA 3M8QA 3TAEA 1L3TA 2E6LA 4FJNA 1BISA 1ITGA 4FK2A 5I3UA 2VWJA 1IKVA 4FM1A 4M3UA 4CF0A 4FK4A 2WOMA 1DLOA 3ZSXA 1CZBA 4DWIA 4I2QA 4W5QA 4AHVA 1SKRA 4C8KA 2HHWA 2YKNA 4DQRA 1Z25A 4BE0A 1ZBLA 3MEGA 4IFYA 4DSLA 1BIZA 4CFDA 3K59A 1RTIA 1UOCA 4NYNA 2ZE2A 4HHTA 3V9SA 3SPYA 4F2SA 1CLQA 3G10A 3E01A 3PX6A 3EY1A 3AA3A 5T7BA 3KD1E 4CCHA 3I0SA 3RRHA 4DFPA 4DF4A 5JS1A 3WNGA 4CJPA 1L5UA 3F9KA 4ELUA 2YNGA 3O3FA 4KRFA 4CJSA 3CM6A 1WNSA 4E7LA 3LP0A 1VSIA 4LH4A 5K14A 2RKIA 3LZJA 4CEBA 4M3TA 3HYFA 3ZT2A 2O4IA 4OJRA 2D0AA 2Y1JA 4CJVA 1BQNA 3LAKA 2HHUA 3SPZA 1WSHA 4O4GA 4EZ6A 1TAQA 1J5OA 4QCLA 4H8KA 1D8YA 1UWBA 4B9SA 1S1TA 4EP5A 4DSFA 2ZQBA 3C6UA 4DFKA 3ASMA 4CGJA 3QO9A 4DG1A 3P5JA 3KLFA 1R0AA 4DFMA 1RBUA 1VRUA 4R5PA 2PYJA 4AHUA 4B9LA 4FZXC 1Y97A 1HYZA 1ZBUA 3M8RA 3I8DA 2E6MA 3KKRA 4CEQA 4FM0A 4FJGA 3JSMA 3VQDA 4PA1A 4FM2A 2KTQA 4FW1A 1S9EA 1RT5A 3OYAA 4DS5A 4IFVA 4DTRA 3RMDA 1JLCA 4FJIA 2D0BA 3FFIA 3NF8A 4FVMA 5CY4A 4KV8A 4CF1A 4XIUA 4DSJA 1SUQA 3S3OA 4E7KA 4DS4A 4KB0A 3VQCA 3HPHA 1IKWA 4IDKA 3QINA 3RMCA 1J53A 2HHQA 4FW2A 4E7JA 3S9HA 1XC9A 1VSHA 5HRRA 4AHSA 4CJKA 4KHSA 5J2NA 4J2AA 2D5RA 4CGFA 4FZYA 4KFBA 3QNNA 2G8WA 2KZZA 4OLBA 2DFFA 4KTWA 4M3RA 3KLEA 4ZTFA 3QIPA 3OS2A 3OVNA 1VSMA 3MECA 1FKPA 2Z1JA 4JS5A 1VSDA 3CG7A 1KCFA 3V81A 1LWCA 4CJRA 3KK3A 3D0PA 3VQ8A 3O3GA 4M3WA 1RDDA 3T1AA 4BE1A 2VWKA 4J2EA 4FZZA 4W5NA 1RBTA 1BGXT 3LAMA 3VQAA 4O44A 1W9HA 3IG1A 4BDZA 2GUIA 2HNZA 2R7YA 1IKXA 2YHBA 4KI6A 2G8FA 3M8PA 1U04A 1N6QA 3SCXA 1Q9YA 2DFEA 2IOCA 4GMJB 4GW6A 3OS1A 4Q5VA 3HSTB 3OS0A 3OYLA 3NHGA 4BE2A 4QAGA 1KFDA 1CXUA 1HPZA 1G15A 3ZSQA 1JXBA 4CECA 3L2QA 5C25A 1S6PA 4DU3A 2IDOA 3RRGA 4LSLA 4CEOA 4DQQA 1WSEA 3U3YA 1N5YA 4HUEA 3DLBA 4Y1DA 2LSNA 1ASVA 5KGWA 4J2DA 1S9GA 4CHOA 3CFPA 1S5JA 2B5JA 1CZ9A 1WN7A 3G0ZA 4IG3A 3ZSYA 3NH1A 3QESA 3I0RA 1QE1A 4RG8A 1NK7A 1I3AA 2FBVA 2B4JA 4RW7A 4LH5A 2JLEA 4RW6A 3PY8A 4CF2A 4M3XA 4C8LA 1TKTA 3AVKA 3NGZA 4F3OA 3KD5E 4I9LA 4OKEA 1NOZA 2QKBA 2FC0A 3DOKA 3LANA 4HUFA 4RW9A 4H4MA 3AO3A 3NH0A 3U3GA 1LV5A 2X74A 4CJFA 3P83D 1JLEA 4E19A 5EU7A 1JL2A 4PY5A 1EXQA 1EKEA 3OYHA 2G8VA 4NCAA 1RBVA 4FJKA 1I39A 2EX3A 1QQCA 1QS4A 1ZBFA 2OYQA 2NUBA 3AVLA 3HM9A 1L3VA 3SJJA 4BDYA 3C6TA 2BANA 3ISNC 2HHTA 4N76A 4W5OA 3CFRA 4E7IA 4B9NA 3DOLA 1C1CA 3TARA 3QETA 2YNIA 3PX4A 1L3UA 1B92A 2YKMA 3TWHA 3L3UA 4AILC 2WONA 4CK3A 2PYLA 4KTQA 4DTMA 4YNQA 3HVRA 3HJFA 2KW4A 4CJEA 3MAQA 2P1JA 3RTVA 4H4OA 5DK5A 2GV9A 3SUQA 4I2PA 1KRPA 2DY4A 1S1VA 3OYBA 3PO5A 4M3YA 3AVIA 4FLWA 2P5GA 3ZSOA 2HNDA 4AH9A 1RBRA 1QSSA 5C42A 5FDLA 1X9MA 3VQ7A 1D9DA 2HB5A 1X1PA 5HP1A 3OYJA 3M8SA 4CHPA 3HK2A 4B08A 3AVMA 4CHZA 5SZTA 2ITGA 2HNYA 3OYDA 4DLEA 3RMAA 4CGDA 1LAVA 4ZHRA 2Z1IA 2RPIA 2Z1HA 4DU1A 3SQ4A 1EETA 1UA1A 4QOZB 4Z4IA 4M3ZA 1NK8A 1NJWA 1KLNA 1LWEA 2XY8A 4CGGA 2O4GA 3AV9A 3T19A 4FJHA 4TSXA 1QHTA 2OPRA 5C24A 1JLBA 2XY6A 2F8SA 4FJ5A 1RT1A 4E3SA 4GVMA 5SWMA 4CEDA 5KGXA 4CHNA 3VQEA 2ETJA 2Y1IA 2G8UA 2BDPA 3U6FA 3SUOA 1BCOA 1EP4A 4FLYA 2ATQA 3ULDA 4JLHA 3RWUA 1RNHA 1YTAA 3OYFA 3K5MA 4CK1A 3AA4A 4CJWA 2F8TA 3KJVA 4M45A 1A5VA 4B9TA 3VQ4A 1T7PA 1KVAA 4CJLA 1VRTA 4DSIA 2KFZA 1Q9XA 4CEAA 4Z4CA 2AJQA 3SZ2A 1TV6A 3QNOA 3PV8A 4AHRA 2OPQA 3LDSA 3AA2A 3TAQA 3HVTA 4Y1CA 1S1WA 1KVBA 4DSKA 1JLQA 4FJMA 3OYMA 1C0TA 1SL0A 1RDBA 1NKCA 3L3VA 4KPYA 3DM2A 4O0JA 3KKSA 3NBPA 3VQPA 5E41A 3NGIA 4DF8A 4PWDA 1REVA 4CEEA 4FLXA 1HMVA 3KLHA 4FJLA 1RBSA 3TR8A 4DTXA 1RILA 3DRRA 1L3SA 3OYKA 4F8RA 1KLMA 4MQ3A 3KK2A 4HUGA 3K57A 3CQ8A 2FBXA 3O3HA 2Q3SA 1IH7A 3MXJA 4LD0A 2IAJA 2X6SA 3C95A 1KTQA 3A2FA 1C6VA 1J9AA 3NE6A 3L8BA 1IKYA 4CEZA 2B6AA 3OY9A 3HO1A 2VG6A 4BWJA 1C0UA 3K58A 1WLJA 2E4LA 1VK0A 5KTQA 4OPJA 4W5RA 2HHSA 3LP2A 3V1QA 3MXMA 1U49A 2G8HA 3OYIA 4F3TA 4AHTA 3L2VA 3DLKA 4CEFA 4Z4HA 1B9FA 4CHQA 3LZIA 4E7HA 3DI6A 3F73A 3AVHA 5I42A 1LW2A 3AVBA 4OGEA 4FJ8A 3WNFA 3AVNA 3V4IA 1ASUA 1XWLA 1GOAA 3HPOA 5CZ2A 1ZYQA 1TKDA 3BDPA 4E89A 1A5XA 1TK0A 1KFSA 1MU2A 4O5BA 3NF9A 1U45A 1TK8A 3QERA 4IBNA 2XY7A 3PUFA 1TAUA 4CFAA 3SUPA 2BGGA 4CJUA 1RDCA 1RT3A 2Z1GA 1W0HA 1X9SA 4I9QA 3EZ5A 3K5LA 3VN5A 3HT3A 1U4BA 5KRTA 5J2PA 2PZSA 3DRSA 1HQEA 2KFNA 3D45A 1BQMA 2FBTA 4DLGA 4Z4GA 4CGIA 3RR8A 1NK5A 2DTUA 4Z4FA 4RW8A 1D9FA 4OKJA 3DYAA 1VSFA 1T03A 5CYQA 1TL1A 3WNHA 4CFCA 3LPUA 2I5JA 3ZSVA 3V9XA 1A5WA 1HYVA 2YV0X 1TKZA 3SI6A 4KTZA 4FYDA 2BE2A 3DMJA 4WE1A 1HRHA 1JKHA 5CZ1A 4BDPA 1YTUA 3LALA 3P1GA 4C8OA 3AA5X 3IRXA 3KIOA 4ID1A 4W5TA 4FLZA 4CIEA 4KKOA 4OPKA 1SKWA 1BI4A 3PX0A 4IKFA 1RT4A 3S3MA 1NOYA 2G8KA 3KTQA 4HCBA 1HNIA 1LAWA 4MFBA 2P51A 1S1XA 1XHXA 2D0CA 4CF8A 4FXDA 1WSJA 3OYNA 3LP1A 4DTOA 4FJ7A 1RT2A 1D5AA 1JLFA 3LP3A 3ZSRA 3V9WA 3HP6A 2HMIA 4K8ZA 3L2RA 3VQQA 4CJ4A 2HW3A 1RDAA 2X6NA 1JLAA 2A1SA 3CFOA 4DMNA 1Z26A 3NGYA 4Z4EA 3VQ6A 1HYSA 4ZTJA 4KAZA 1FK9A 4J2BA 4DQIA 4DQPA 1FKOA 2XO7A 4FLUA 3NH2A 3ZT1A 4HVJA 2IGIA 4YFUA 3SUNA 2JGUA 4LY7A 3OJSA 1HNVA 1KSPA 3RMBA 1ZBHA 2RF2A 3THVA 4E1NA 1U47A 1WAFA 3OJUA 2YHAA 3CYMA 1NJYA 3L2UA 4KHQA 4KREA 3K2PA 4KO0A 4CK2A 4KB1A 3K5OA 4B8AB 3VQBA 3OYEA 3EYZA 3QEVA 3SQ0A 5D3GA 4IG0A 4BWMA 4JS4A 1DTQA 2OZMA 4CHYA 2OPPA 2G8IA 1BHLA 1LWFA 1BCMA 1VSKA 4M42A 3VQ9A 3SQ2A 3TAGA 4KHUA 1NJXA 1CXQA 1RTDA 4FK0A 1LW0A 5FROA 1UA0A 3KK1A 3AVCA 1NK6A 3LPTA 4DFJA 3IAYA 1SL1A 1VSJA 1C1AA 4DTUA 1RT6A 1BI4B 3ZT3A 2KZMA 4KHWA 2YNHA 5HBMA 1NKBA 1J54A 3BGRA 4EP4A 2HHVA 1XHZA 1SV5A 4LSNA 2IC3A 1JLGA 1HQUA 3TAPA 3AVAA 4NYFA 1IO2A 4CFBA 4F2RA 4CJ3A 3NF7A 1GOCA 4E1MA 3L2WA 3QEIA 3SNNA 2P5OA 4DTNA 4JRQA 3S3NA 1X9WA 4CIFA 5HRSA 3SYZA 3CM5A 1BL3A 3DLEA 3QLHA 1BIUA 3V9ZA 3AVFA 4Q0BA 3TAFA 3DLHA 4PUOA 4PQUA 3AVGA 2QXFA 4FLVA 1XI1A 4B9MA 5HRPA 1TK5A 1UAXA 3NAEA 1IG9A 4B9UA 1WSIA 1JXEA 3ZCMA 1FXXA 3WNEA 4B8CA 3KLIA 4HTUA 3PO4A 3V9UA 4KHYA 1KVCA 4FLTA 4F4KA 2OPSA 3B6PA 4HCCA 3AO2A 1YT3A 4OGCA 5HRNA 4Z0UA 4G1QA 2F96A 3MXIA 1HJRA 3ZSZA 1O1WA 3O4NA 2XY5A 3DRPA 1SL2A 2HHXA 3ITHA 4FJ9A 4B3OA 3DLGA 4OVLA 4N47A 3QEWA 4KI4A 3V6DA 3TABA 1RTJA 1S1UA 1NJZA 4ELVA 2GBZA 4B9VA 4L8RB 1WSGA 2OZSA 4FJXA 1ASWA 3B6OA 3T3FA 4CESA 5CYMA 3V1OA 3HPGA 3SV3A 1TKXA 4ICLA 1QSYA 4E0DA 4M41A 3VA0A 3ZT0A 4RW4A 2HVIA 4N56A 4CIGA 4DQSA 3MEDA 3NDKA 4I7FA 3NFAA 1NK0A 3VA3A 4UQGA 3QEPA 2RN2A 1NK4A 3ZSWA 2QK9A 5J2MA 1RTHA 1GOBA 2EHGA 2VG5A 3AO1A 3QEXA 2HVHA 1WSFA 5FRNA 3K5NA 4N41A 3VQ5A 3UIQA 4CF9A 1K6YA 5FRMA 3ZT4A 3IS9A 2X78A 1F21A 5KRSA 3OYGA 3KLGA 2QKKA 4CGHA 4EZ9A 2OA8A 4O0IA 4CJTA 1DTTA 2ZD1A 5JS2A 5HROA 3JYTA 4BACA 4KHNA 1S6QA 3LWMA 4C8MA 1RCHA 4FJJA 3SV4A 3LWLA 1T8EA 4ID5A 4O55A 3MEEA 1TGOA 3C94A 1NKEA 3O4QA 1C1BA 3HP9A 4DSEA 2XRIA 3SQ1A 1WAJA 4CJ5A 4FCYA 3RR7A 4OKKA 5J1EA 1C0MA 2VG7A 3TAMA 3H08A 3NF6A 5KI6A 4OLAA 2KQ2A 1U48A 2IS3A 3AO4A 1Q8IA 3V1RA 3HXMA 1SKSA 5J2QA 4DU4A 1RT7A 3DLRA 1B9DA 1T05A 2W42A 1QTMA 2DFHA
chains in the Genus database with same CATH superfamily
2PY5A 3O80A 2XHBA 3AO5A 4CERA 4MDBA 3HL8A 1QSLA 4K8XA 5JVHL 3T1YK 1TVRA 1I94K 4BR0A 4ELTA 4DTJA 3QIOA 4N5SA 2O8FA 1VSLA 2FBYA 3QICA 1L3TA 2V7ZA 1BISA 1ITGA 3U9DA 4EHUA 4AHVA 1ATNA 4BE0A 4DSLA 1RTIA 1UOCA 1CLQA 1EO1A 3ULEB 3AA3A 4CCHA 1NGDA 4BRHA 1L5UA 3F9KA 2YNGA 3VTIA 4LFAK 4KBOA 3ZT2A 2Y1JA 1BQNA 3L6QA 4DV3K 4O4GA 1HNZK 4QCLA 1J5OA 3I55N 4EP5A 2ZQBA 3C6UA 3ASMA 3QO9A 3KLFA 1R0AA 4DFMA 1VRUA 4R5PA 1MDUB 5C0YA 4IDHA 1Y97A 3CJBA 3I8DA 1QVGM 1ATSA 3KKRA 1KAYA 4FM2A 4FW1A 1E3MA 2HMPA 4IFVA 3RMDA 3CC2N 4FJIA 1JCGA 5CY4A 4FVMA 3J7ZO 3HPHA 4YOWA 4B1UB 1J53A 2HHQA 1VSHA 4AHSA 4CJKA 4KHSA 5J2NA 1HLUA 1BWFO 4MLEA 4KFBA 4A59A 2D0OA 3FFKB 3KLEA 4ZTFA 2O8BA 3A0IX 3OVNA 3MECA 1QQOA 1FKPA 1VSDA 3CG7A 4H5VA 3KK3A 3QBWA 2NRWA 3T1AA 2W40A 3CCSN 2UUCK 1RBTA 2QI2A 4BDZA 5AQTA 4GMJB 4BE2A 3NHGA 4KHWA 1HPZA 1G15A 3CPWM 2IDOA 3RRGA 4LSLA 4FWMA 1HKCA 1ASVA 1Q82O 5KGWA 3MN6A 1S5JA 1CZ9A 2VGMA 3G0ZA 4IG3A 3ZSYA 2YHWA 4H5RA 1HJOA 4RW7A 4JI8K 3SBTA 4CF2A 4WFBL 3P4IA 3AVKA 3KD5E 3DAWA 4I9LA 4DR3K 4LF5K 3LANA 3NH0A 3U3GA 2X74A 3A5NC 1SQKA 1VQLN 3VGMA 4GVEA 1EXQA 5EVZA 1YHQN 1NGJA 3ZX2A 1I39A 4LF7K 1QS4A 2NUBA 3AGRA 1L3VA 3SJJA 2GELA 2Q0RA 4LFCK 1RDUA 3EO3A 1XQSC 3DOLA 3QETA 2YNIA 3CCRN 1B92A 2OCEA 3TWHA 4BGBA 1XMQK 4H0TB 3O9TA 4MO4A 1N32K 3HVRA 2J4RA 3CIPA 2KW4A 4H4OA 3SUQA 3J80O 1S1VA 3ZSOA 1QSSA 4A5AA 1X9MA 5IT9O 3I8BA 2HF3A 1X1PA 3OYJA 3M8SA 4A57A 4B08A 4CHZA 3OYDA 1KD1O 3HOSA 4ZHRA 3MN7A 1EETA 3LDLA 4XH4A 4JV5K 1KLNA 1LWEA 3I33A 4GV3A 1QHTA 5AFUA 3CXCM 2F8SA 5C10A 1RT1A 4E3SA 4GVMA 4FJ5A 3G25A 4CEDA 1NMDA 3H1VX 3C7NB 2G8UA 4FLYA 2ATQA 3ULDA 4JLHA 3RWUA 1RNHA 4JK7A 1C0GA 3KJVA 4GKJK 1A5VA 1KVAA 2P9KA 1VRTA 4CJLA 4DSIA 3D6RA 3I56N 4Y1CA 3OYMA 3R1XA 1C0TA 1O13A 2YHXA 4R79A 4O0JA 3MN5A 3VQPA 4DF8A 4CEEA 3OW2M 3T69A 4KH4A 1RBSA 1YI2N 2NRRA 4BR9A 3CQ8A 4LD0A 2IAJA 4X64K 2X6SA 3C95A 4BRMA 4ISEA 3OHRA 4FWLA 4CEZA 3D7EO 1WLJA 2A6AA 1IBMK 1M1KO 5H1SQ 4AHTA 3L2VA 4CEFA 4JI1K 1B9FA 4CHQA 2PAVA 2P9LB 4E7HA 3AVHA 2WTUA 3GDQA 4JAXA 1ASUA 3HPOA 5KQDA 5CZ2A 5GADP 3KZBA 1KFSA 3TTCA 1WOQA 4H03B 3ZETA 4BGAA 2XY7A 1TAUA 4BQZA 2BGGA 4I9QA 1T6DA 3HT3A 5J2PA 2ASMA 2PZSA 2KFNA 2BH1A 4BRQA 3RR8A 4U67L 4RW8A 1D9FA 2NRTA 2A40A 1OH5A 3V9XA 3FR0A 2Q2RA 1SS6A 1TKZA 1JKHA 5CZ1A 3AA5X 3KIOA 4ID1A 4BQLA 4KKOA 1BI4A 5JICA 4PL7A 5AQOA 1LAWA 4OPAA 4CF8A 4XEIA 2UXDK 4X66K 4FXDA 3IDHA 4FJ7A 3LP3A 3HP6A 2HW3A 3L2RA 1RDAA 4DR4K 1JLAA 3GE1A 1Z26A 4KAZA 1FK9A 3ZT1A 2P9LA 4HVJA 3LDNA 3OJSA 2RF2A 3THVA 3OTOK 1HKGA 4FL9A 3OJUA 1IBKK 3CCQN 4KREA 2ZJPL 2E1YA 4CK2A 4LF4K 2Q31A 3K5OA 4BWMA 4JS4A 2OPPA 2G8IA 1LWFA 2GEMA 4KHUA 1CXQA 3GG4A 4FK0A 3KK1A 1VSJA 1U2VA 4RCHA 3U8XA 1NGBA 2KZMA 1NKBA 1XHZA 1SV5A 1HQUA 5F2RA 3AVAA 2W41A 4CJ3A 5KPRA 1GOCA 2D1KA 3L2WA 2NRHA 4JRQA 4CIFA 5HRSA 2CH5A 1BL3A 2VYPA 3DLEA 4YOVA 4YOUA 4LC9B 4WQ4C 4B9MA 1UAXA 4BRCA 4JEPA 3WNEA 2E5LK 3PO4A 3O9RA 4FLTA 4HCCA 3TSPA 3AO2A 2F96A 4NLCA 3O4NA 4AF1A 2P9NB 1SL2A 1P90A 2UUBK 3AY9A 5AQNA 1NJZA 1S1UA 4X65K 1YJ9N 2O8EB 3TPQA 5AQUA 3T3FA 2O8FB 3PIOL 1QSYA 1N33K 3E9OA 5AQVA 3ZT0A 2HVIA 4N56A 3AARA 3MEDA 2IVOA 5J2MA 2VG5A 2HVHA 1KC8O 1MWKA 2E2OA 5BRDA 4CZEA 1K6YA 5FRMA 3ZT4A 3OYGA 4BRFA 2OA8A 1JCEA 2CGLA 2ZD1A 5JS2A 4DV5K 2P9UA 3SMPA 1S6QA 4B9QA 3LWLA 5M1KA 3EEQA 1VQ5N 4DR7K 3C94A 2XRIA 4CJ5A 4FCYA 3Q7BA 3CCLN 4KH5A 1VQ6N 3M5RA 4OLAA 5BPMA 4K43A 1Q8IA 2AP1A 1T05A 3CCJN 4A62A 4CE9A 2AA4A 3ALYA 4NCBA 1BDGA 2A1RA 3NCIA 4WQ4A 1VQNN 2YNFA 3OYCA 3WXIA 3CPEA 5TKWA 1EX4A 4AHCA 1TL3A 3AVJA 4BRAA 3TAEA 2E6LA 5AQQA 3F2KA 2VWJA 3PSFA 1IKVA 4M3UA 1YJNN 4DWIA 4I2QA 4M7XA 4W5QA 3O1BA 3B8AX 4JKFA 1TYQB 4Y0WA 4M7YA 3VMFB 1GLFO 5F1XA 4F2SA 4BC5A 3D2FB 3U4LA 3G10A 5JMVA 3PX6A 4DKWA 3FZFA 3KD1E 3RRHA 4DF4A 4K25A 3WNGA 2YI1A 1HPMA 5M1OA 1WNSA 2QWRA 3LZJA 2RKIA 4FWNA 3HYFA 2D0AA 3LAKA 2W6LA 5BR9A 1D8YA 4B9SA 4DSFA 2NRVA 4CZGA 4DFKA 2KLAA 1DT9A 1RBUA 2PYJA 1S3XA 1Y64A 1K8KA 2E6MA 4FWKA 5ELZA 4FM0A 3VQDA 1NG9A 2QXLA 5FPDA 4DS5A 4DTRA 3VENA 3FFIA 4OX9K 2P9PB 5AQLA 3ZEUB 3VTHA 3S3OA 2ZF5O 3THYB 4WCEL 4KB0A 2NZTA 3QINA 1GLDG 4FW2A 3S9HA 3RVCA 2FLOA 4J2AA 4FZYA 3P39A 2KZZA 3QNNA 2G8WA 2UXCK 2DFFA 4KTWA 1QVFM 3HZ6A 1KCFA 1KAXA 1LWCA 4CJRA 4CJ7A 3CJ7A 4CD1A 4J2EA 5BPNA 3IKMA 4QS8A 1YF5L 4O44A 1W9HA 1OKJA 2R7YA 1LOTB 2YHBA 2BUPA 4KI6A 3M8PA 1U04A 1N8RO 1KFDA 3ZSQA 1S6PA 3U9ZA 4DU3A 2H3GX 4DQQA 3U3YA 1N5YA 5AQWA 5BR8K 2KHOA 4WQ5C 3CQYA 3S41A 3QESA 3I0RA 4RG8A 1I3AA 2B4JA 3OBYA 2P9IB 1NOZA 2QKBA 2FC0A 1K9MO 4RW9A 4H4MA 4GY2B 3M3ZA 1GLJO 2QWLA 3OBWA 3VEVA 5EU7A 4JI2K 4EIAA 4PY5A 4BRPA 2G8VA 4NCAA 4WYBA 3GBTA 1ZBFA 3H3NO 1CZAN 3UE5A 5EY4A 2GX9A 2HHTA 2RE2A 2GWKA 4CBWA 1L3UA 4AILC 3L3UA 3F9MA 4CK3A 4KTQA 4DTMA 4CJEA 3MAQA 2GV9A 4I2PA 2DY4A 2O8CA 4FLWA 4AH9A 1D9DA 5C42A 4FPBA 3VQ7A 4X62K 1VQMN 2F7TA 3WXKA 4CHPA 1SAZA 3HK2A 5M1QA 3RMAA 4JKHA 2PFUA 2Z1IA 4JHDB 1HNWK 2P9IA 4FWQA 4Z94A 4CGGA 5LJVA 3AV9A 3T19A 5AFUH 5C24A 1IJJA 5KGXA 1IV0A 2Y1IA 4J8FA 2BDPA 1BCOA 3CJ9A 3TU5A 1YTAA 4FWRA 3K5MA 4M45A 4B9TA 4OPHA 1Q9XA 4CEAA 5ADXA 2OPQA 1S1WA 4DSKA 5IWAK 2F4VK 1SL0A 1RDBA 1NKCA 4XH1A 3SMSA 4WFNL 4CBUA 1HMVA 3KLHA 4DTXA 1RILA 3DRRA 4F8RA 1U6ZA 4FWPA 3KK2A 4HUGA 3K57A 2FBXA 3MXJA 3MWPA 3K9JA 3A2FA 1IKYA 5FPNA 4BWJA 1C0UA 3PLAA 4JI5K 1TYQA 5KTQA 1VK0A 3LP2A 2ASOA 3BP8A 4CZFA 1K73O 1BO5O 1FJGK 3DI6A 3AVBA 4OGEA 3CD6N 3WNFA 3ATUA 3AVNA 1RDWX 4E89A 3NF9A 1TK8A 4JYAK 1VQ7N 3PUFA 3MX5A 4CFAA 3JAMO 4EFHA 4CJUA 1RDCA 1RT3A 4C1NI 1U4BA 3VN5A 3DRSA 3D45A 1BQMA 2QWOA 3DYAA 4CFCA 3VEZA 4JD2B 2I5JA 4WFAL 2PBDA 3DMJA 1ZXOA 1HRHA 5LL6Z 1YTUA 5BREA 3LALA 4C8OA 4OPKA 3FZHA 4IKFA 4IO9L 1HNIA 4AM7A 1S1XA 3UKRA 3BEXA 3LP1A 1RT2A 3ZX3A 4CJ4A 2VWBA 3WEEA 4IZ9A 3CFOA 3E9LA 3SAFA 3NGYA 1HX1A 1IBLK 1HYSA 3AAPA 5KPZA 3NH2A 3L4QA 1SZ2A 3FE1A 3SUNA 4JKDA 1KSPA 3RMBA 4JI0K 4JKAA 4A61A 3N4PA 1BG3A 5AQZA 4ILHA 4RWTA 3L2UA 4FOEA 3AGKA 2NRXA 4KO0A 3CI5A 5C2FA 4B8AB 3EYZA 3QEVA 4IG0A 5JLFA 1DTQA 5A2QO 3O5BA 3BY5A 3HTVA 1BCMA 4M42A 4H0OA 3VQ9A 3TAGA 1QQNA 1LW0A 5FROA 1UA0A 3IAYA 3LPTA 3VF6A 3EKUA 3THXB 1RT6A 3ZT3A 1YJWN 1J54A 3CCEN 4CD3A 2BTFA 4F2RA 3O9UA 2NRZA 3NF7A 2IVPA 2YJFA 3QEIA 3VF2A 1XNQK 2W6KA 3S3NA 1X9WA 4DR6K 3SYZA 3QLHA 1BIUA 3DLLL 3AVFA 4Q0BA 4C1NK 3TAFA 1EWQA 2QXFA 4FLVA 1XI1A 1N34K 4B9UA 1WBBA 2WFBA 3H1QA 5AQXA 4B8CA 3E9PA 3LL3A 2QW9A 5HRNA 1HJRA 1Q7YO 3ZSZA 1O1WA 1E4GT 3DRPA 3SLCA 2A42A 4OVLA 3QEWA 1W7AA 1RTJA 3A5LC 2GBZA 4B9VA 4IXCA 3CHWA 1ASWA 3EL2A 3QFUA 1S72N 1P8ZA 4E0DA 3HPGA 4FPAA 4JHDA 3VA0A 4RW4A 3KWIA 4DQSA 4BRGA 3UB5A 4I7FA 2HBMA 3VA3A 3WQTA 2RN2A 3IFRA 1GOBA 3QEXA 3AO1A 2GTDA 5FRNA 3K5NA 1R59O 3VQ5A 1QHAA 4K41A 4CF9A 2WC9A 3IS9A 1BUPA 5KRSA 2P9SA 3E66A 2QKKA 3IUCA 4CGHA 4EZ9A 3BF3A 4CJTA 3ZETB 3JYTA 2NNWA 1VAZA 5F0XA 1NGCA 4O55A 2D4WA 1TGOA 2QA4N 4FWSA 4BG9A 4DSEA 1S22A 1KQSM 2ZJRL 5TKYA 4OKKA 1C0MA 3H08A 5KI6A 4NLBA 1SKSA 4BC4A 1RT7A 1JJ2M 1YUWA 1B9DA 1QTMA 4DTPA 3M6GA 1W2BM 3LM9A 5HLFA 4B3SK 1ZBIA 4WF9L 1HKBA 1ESVA 3TI0A 3BUZB 4DV6K 3EZWA 4NCGA 5DMRA 1NK9A 4CW7B 1JL1A 3M8QA 5LJWA 5I3UA 4B3TK 3EE8A 2WOMA 1DLOA 1CZBA 2O8DB 3R3LA 5AQRA 1SKRA 4C8KA 4DQRA 1Z25A 1RGIA 3MEGA 4IFYA 3CETA 4HHTA 2HBKA 3EY1A 3G4SN 3WXJA 3SK3A 5T7BA 4DFPA 5JS1A 4CJPA 4ELUA 3D2FA 4CJSA 3CM6A 4IO8A 1YIJN 1VSIA 5K14A 4M3TA 2O4IA 4CEBA 3R8EA 1X9JA 4AQYK 1WSHA 1TAQA 3HSCA 4CGJA 3A5MC 3O6WA 4DG1A 4B9LA 4FZXC 1HYZA 4B1XB 3M8RA 4CEQA 4FJGA 4PKHA 1XMOK 4PA1A 2KTQA 1S9EA 1RT5A 4CZHA 3OYAA 2Q0UA 2D0BA 3NF8A 3VEXA 3RSEB 4E7KA 4DS4A 5EOYA 3VQCA 1V4TA 3RMCA 1GLAG 2HF4A 4E7JA 5HRRA 3VOVA 1EWRA 4OLBA 4M3RA 3H46O 3QIPA 5M1NA 3C65A 1VSMA 2Z1JA 2QWQA 3NVMA 1DEJA 3D0PA 3WT0A 4BE1A 2VWKA 3LDQA 2EWSA 4CBXA 1BGXT 3VQAA 4DV7K 2HNZA 2G8FA 4B1VA 1N6QA 1T3VA 2IOCA 3N4QA 4GW6A 3OYLA 3HSTB 2QWPA 4DR1K 4QAGA 3V9UA 1CXUA 4F4KA 2KFZA 4WQ5A 4BR2A 5C25A 5MLCQ 4CEOA 4K0KK 4BR5A 2LSNA 3D2EB 4B1WB 3WXLA 5E26A 4DQPA 3CFPA 2B5JA 4JKGB 4M63C 3NH1A 3O9QA 4DHYA 4LH5A 2JLEA 3PY8A 4M3XA 4C8LA 1TKTA 5AQIA 2WUSA 4OKEA 3AO3A 4I6MA 4KH6A 1LV5A 4CJFA 4DUZK 4MO5A 1JLEA 2F9WA 1JL2A 5BPLA 1JCFA 5E84A 1H1VA 1RBVA 1NM1A 1V4SA 2OYQA 1D4XA 4BDYA 2BANA 3ISNC 4N76A 4W5OA 3CFRA 2V7YA 3FLCO 3PX4A 4DQ8A 3C6AA 1BA1A 3CCVN 4DV4K 2PYLA 3KVGA 2O8EA 3ENHA 3L4IA 4PKGA 4YNQA 1VQ8N 3HJFA 4G9ZA 4CI6A 2P1JA 3F5TA 2YCHA 4V19S 4B1YB 3PO5A 4M3YA 3AVIA 2P5GA 2HNDA 4NXMK 5FDLA 3WQUA 1VQKN 5HP1A 3AVMA 4IEEA 2HNYA 4DLEA 4JI4K 4CGDA 1LAVA 2Z1HA 4DU1A 2F9TA 5M1FA 4M3ZA 4BRIA 1NK8A 2P9UB 2XY8A 2O4GA 4TSXA 4B1ZA 2OPRA 3K0SA 1JLBA 5SWMA 4CHNA 2ETJA 3ENBA 1EP4A 2OTLN 5AQFA 3OA9A 4CK1A 4DB3A 4RTFD 3VQ4A 1T7PA 3C7NA 3QFPA 4IOXA 4BREA 2AJQA 3SZ2A 4BRDA 5ADXH 3LDSA 3AA2A 4JD2A 1KVBA 1JLQA 1NGEA 3MMVA 3JS6A 5AQGA 4LF6K 5E41A 1HNXK 1REVA 4FSVA 4DR5K 1KLMA 3CMAN 2A41A 4EAHD 3O3HA 3VGLA 2QWNA 1J9AA 5M1PA 3NE6A 1OH6A 3ZX0A 4IJNA 4CZMA 3OY9A 3L8BA 2B6AA 3MN9A 4JNEA 3K58A 4HTLA 4A5BA 4W5RA 4OPJA 2HHSA 3MXMA 1U49A 3OYIA 1T44A 2ITMA 4JKBA 3LZIA 4FJ8A 3HBTA 3F73A 3E1YA 1ZYQA 5LY3A 1XWLA 1NU0A 1MU2A 1KAZA 2RHKA 4O5BA 5I9EB 2JWKA 3Q7CA 2HHHK 4IBNA 5FLXO 3SUPA 1X9SA 5BN9A 1K8AO 3EZ5A 3KK7A 5KRTA 1HQEA 3THWB 4Z4GA 4CGIA 2DTUA 1NK5A 4Z4FA 4OKJA 3BZCA 1VSFA 1T03A 1TL1A 3WNHA 3LPUA 3JXUA 2E88A 2ZJQL 3MCPA 3R9PA 2YV0X 4KTZA 2BE2A 4WE1A 4YORA 4BDPA 3P1GA 3IRXA 1SKWA 4W5TA 5JLHA 4BRNA 4DV2K 1RT4A 3S3MA 1NOYA 3KTQA 4MDAA 4MFBA 2ZM6K 2D0CA 1TUUA 3HOTA 2HMIA 4K8ZA 2QM1A 3VQQA 2X6NA 1QZ5A 3FZKA 2ZWHA 5AQJA 1NMNA 4DMNA 4Z4EA 4OO1J 2FSKA 4ZTJA 1M90O 3DJCA 3FZLA 4J2BA 4FLUA 3A5OC 4YFUA 2JGUA 4FO0A 4LY7A 1BU6O 4BRLA 1ZBHA 1U47A 4FOIA 3QDKA 1WAFA 3ULEA 3TTFA 4K42A 3P38A 3CYMA 4ISGA 3QBXA 5GAEP 3K2PA 4KB1A 3DXMA 3NVKA 5D3GA 3VQBA 3OYEA 3SQ0A 3J7AP 3THWA 4YHHK 4U7BA 2OZMA 4CHYA 1J5EK 3IMXA 1BHLA 3NMUA 4GV6A 5KPTA 1RTDA 3ZLJA 3VGKA 3AVCA 1C1AA 4DTUA 3BF1A 3O1WA 5HBMA 1VQ9N 1Z05A 2HHVA 3SAGA 4GNIA 4LSNA 2IC3A 1JLGA 2IVNA 3THXA 4LF9K 1U2VB 4NYFA 1IO2A 3DWLA 3P31A 1N36K 4E1MA 2P5OA 4DTNA 1T6CA 3CC7N 3R6MA 3DLHA 4PUOA 4FWOA 5HRPA 1IG9A 3ZYYX 3J7YP 1WSIA 1FXXA 3KLIA 4B3RK 4YY3K 1Q86O 4DCHA 4L3QA 2DPNA 4BROA 2HHXA 3O4WA 4PL8A 3DLGA 4N47A 2QWMA 3V6DA 3TABA 2UXBK 3MWTA 4IEIA 4H5TA 4ELVA 4CVNE 1ILYA 1WSGA 2OZSA 4FJXA 2FF3B 2P9NA 1G99A 2E2NA 3B6OA 3CF5L 4CESA 4JI7K 1TKXA 4ICLA 1NWKA 4M41A 4CIGA 4BVPA 1YAGA 2HBLA 2WBNA 4BRKA 1GLEG 1X3NA 3ZSWA 1RTHA 2I7NA 4N41A 3UIQA 2GUPA 4O0IA 5HOOA 4KHNA 4BACA 1NJIO 3UKUB 4GV9A 4C8MA 3SV4A 1T8EA 2CGKA 4EHTA 4ID5A 1WBDA 3M1FA 2ZGYA 3RR7A 4UY8O 3T1HK 3TAMA 3NF6A 2KQ2A 1U48A 2IS3A 2P9KB 2VGNA 3AO4A 3V1RA 4DR2K 4JKCA 5J2QA 3DLRA 5HROA 5JVGL 1MWMA 2DFHA 3TANA 1OH7A 1YVUA 4CJQA 4DTSA 4C8NA 4PKIA 5GIOA 4JRPA 3A8YA 1VSEA 4FJNA 4FK2A 3O8MA 4BR7A 5AQPA 4FM1A 3J81O 2YX6A 4CF0A 1YXQA 4FK4A 3ZSXA 5C12A 4H0XB 2HHWA 4CZLA 2YKNA 1ZBLA 1NNEA 1BIZA 4CFDA 3K59A 4NYNA 3V9SA 2ZE2A 3H45C 3SPYA 3E01A 3LDOA 3LDPA 3I0SA 3CERA 4KRFA 3O3FA 5AZIA 4E7LA 3LP0A 4AM6A 4LH4A 3VEYA 4OJRA 4CJVA 3O9SA 2HHUA 3SPZA 4EZ6A 4H8KA 1UWBA 2V52B 1S1TA 1XC3A 3P5JA 3UKRB 3T7ZA 4AHUA 4PHTX 1ZBUA 1X3MA 2P9PA 3EN9A 3JSMA 4YDUC 1YITN 3TTDA 1JLCA 2Q36A 4DSJA 4XIUA 4KV8A 4CF1A 3HRGA 1QQMA 4DUYK 1SUQA 3MDQA 5CR4A 5DM7L 1IKWA 4IDKA 3ZEUA 4C23A 1XC9A 3THYA 3RSEA 2D5RA 4CGFA 3OS2A 2QTDA 1WB9A 4MLHA 3PSIA 4JK8A 3DXMB 4JS5A 3V81A 3VQ8A 3O3GA 4M3WA 1RDDA 4JN4A 4IOCL 1GLLO 5C2DA 4FZZA 2VQFK 4W5NA 3LAMA 3IG1A 2GUIA 1IKXA 2KKZA 4NXNK 3K9KA 3SCXA 3AAQA 1Q9YA 2DFEA 3OS1A 1NBWA 4Q5VA 3OS0A 5C15A 1ZBSA 4B3OA 4CECA 3L2QA 1JXBA 2V51B 1IG8A 1WSEA 2UUAK 3DLBA 4HUEA 4Y1DA 1XNRK 1NGAA 4J2DA 1S9GA 4CHOA 1WN7A 1QE1A 1NK7A 2FBVA 5FPMA 4RW6A 5GAGP 3D2EA 3CQXA 5AJ3K 3NGZA 2FSNA 4F3OA 3DOKA 4HUFA 1OVQA 3P83D 5AQHA 4H0PA 4ILGB 2NLXA 3VPZA 4E19A 1EKEA 5CHIA 3OYHA 4FJKA 3MX2A 2EX3A 3VESA 1QQCA 2E1ZA 4O5FA 1NLVA 2CGJA 3AVLA 3EKSA 3HM9A 5AQSA 3C6TA 3VERA 1BOTO 4E7IA 3HM8A 2ASPA 1E4FT 4B9NA 1C1CA 3TARA 3O08A 5HL7L 1GLCG 3H3OB 5GIPA 2YKMA 4KHPK 2WONA 2E2PA 3EE9A 2O8CB 4ILJA 3CJCA 4H5NA 4JI6K 3RTVA 1HR0K 5DK5A 4YOYA 2I7PA 1KRPA 3OYBA 1VQPN 1XUPO 1RBRA 1GLBG 2HB5A 1WUAA 1DKGD 3VF4A 5SZTA 2ITGA 4IWVA 4CZKA 1VQ4N 4H0VB 2RPIA 4QS7A 3SQ4A 3CMEN 2O8DA 1UA1A 4QOZB 4Z4IA 2E2QA 1NJWA 1W97L 4FJHA 2E20A 1BA0A 2XY6A 3WXMB 3VQEA 1QZ6A 3HI0A 1Q81O 3U6FA 4H0YB 3SUOA 1ZC6A 3OYFA 3AA4A 4CJWA 2F8TA 3CJAA 2UU9K 4Z4CA 1TV6A 3QNOA 3PV8A 4AHRA 3TAQA 3HVTA 3W0LA 4FJMA 3H6EA 4KPYA 4FVUA 3L3VA 2A5XA 3DM2A 3NGIA 3KKSA 3NBPA 4PWDA 4FLXA 1MA9B 3TSUA 4FJLA 3TR8A 3DXKA 4A2AA 1L3SA 3OYKA 4MQ3A 2Q3SA 1IH7A 3C6HA 1KTQA 3C0BA 3CJ1A 1C6VA 3HO1A 2VG6A 2ZGZA 2E4LA 3V1QA 4CZIA 2G8HA 5EX5A 3QB0A 4F3TA 3DLKA 4Z4HA 1C0FA 2OTJN 5I42A 1LW2A 1DGKN 3BDPA 3V4IA 1GOAA 2VCPA 3BZKA 1TKDA 3CCMN 1A5XA 1TK0A 2P9SB 4IOAL 3SBGA 5B8HA 5AZIB 5KQ8A 4O8UA 1U45A 3QERA 3MK6A 4A2BA 4YOTA 2Z1GA 4PQUA 1W0HA 3K5LA 2JWLA 2FBTA 3ID6A 4QS9A 4DLGA 1LCUA 3GOIA 3J8AA 5CYQA 2GWJA 4IFEA 1KXPA 3ZSVA 1A5WA 1HYVA 2FF6A 3SI6A 1FW6A 4FYDA 2HBJA 4FLZA 4CIEA 1HUXA 3DXKB 3PX0A 1RFQA 2G8KA 4NB4A 4HCBA 2P51A 1XHXA 1WSJA 3LM2A 3OYNA 1K8KB 4DTOA 1D5AA 1JLFA 3ZSRA 5CE3A 4IJAA 3SJHA 4DV0K 3V9WA 3VEWA 2A1SA 1Q18A 3FZMA 2Q1NA 4HWIA 2VQEK 4BC3A 5BRFA 3VQ6A 4BY9C 5LMUK 4DQIA 4O8KA 1FKOA 3WEEB 2XO7A 4F9OA 2A3ZA 4JKEA 2IGIA 4H5WA 5AQYA 1HNVA 4E1NA 4BVOA 2FSJA 5GINA 1ATRA 2YHAA 4KHQA 1NJYA 4JI3K 2O8BB 4BG8A 3ID8A 2HOEA 4LFBK 2HSTA 1NGHA 1VSKA 3SQ2A 4JKGA 2YHYA 4ISFA 4CZJA 4BR4A 3G6EN 1NJXA 1NK6A 4DFJA 4DV1K 1SL1A 5GAHP 1BI4B 4XH5A 2YNHA 3BGRA 4I6MB 5EXWA 4EP4A 1OH8A 3TAPA 1OVYA 4CFBA 2QEXN 3SNNA 1NGGA 5AZJA 3UKUA 3CM5A 3V9ZA 2FXUA 4YDUA 3AVGA 1TK5A 3NAEA 3TSQA 3VETA 1JXEA 3ZCMA 4HTUA 3PIPL 4KHYA 1KVCA 2OPSA 3B6PA 5AR0A 5DM6L 1VHXA 1YT3A 4OGCA 4Z0UA 3L0QA 4G1QA 3MXIA 2XY5A 1Z6RA 3ITHA 4FJ9A 1J6ZA 4KI4A 3KHYA 1YVNA 4L8RB 5LMNK 2Q97A 4B3MK 5BN8A 3CC4N 1EQYA 5CYMA 3V1OA 5BRHA 3SV3A 2E8AA 3W3DA 3GL1A 1NGIA 3NDKA 1TUYA 3NFAA 1NK0A 2IIRA 4UQGA 3QEPA 1NK4A 2QK9A 4GKKK 2YJEA 2EHGA 1WSFA 4LF8K 4JK9A 4YOXA 5AQMA 3MCAB 2X78A 1F21A 3VEOA 4BC2A 3KLGA 3ENOA 3WUHA 1DTTA 2CH6A 5AZJB 3LWMA 2UYTA 3ATVA 1RCHA 4FJJA 1NGFA 1VQON 3MEEA 1NKEA 3O4QA 1C1BA 3HP9A 3QMLA 3CCUN 3SQ1A 1WAJA 2OANA 4E1JA 5J1EA 2VG7A 3KWGA 4NO7A 5FPEA 3G71N 3FGUA 3HXMA 4DU4A 2D0PA 5AQKA 3SAHA 2W42A
chains in the Genus database with same CATH topology
4CE9A 4DTPA 2PY5A 3ALYA 2XHBA 3AO5A 4CERA 4NCBA 5HLFA 3TANA 3HL8A 2A1RA 1YVUA 3NCIA 4CJQA 1QSLA 4DTSA 4K8XA 1ZBIA 1TVRA 2YNFA 3OYCA 3TI0A 4DTJA 4ELTA 4C8NA 1EX4A 4NCGA 3QIOA 4AHCA 4N5SA 5DMRA 4JRPA 1NK9A 1TL3A 1VSLA 2FBYA 3AVJA 1JL1A 1VSEA 3M8QA 3TAEA 1L3TA 2E6LA 4FJNA 1BISA 1ITGA 4FK2A 5I3UA 2VWJA 1IKVA 4FM1A 4M3UA 4CF0A 4FK4A 2WOMA 1DLOA 3ZSXA 1CZBA 4DWIA 4I2QA 4W5QA 4AHVA 1SKRA 4C8KA 2HHWA 2YKNA 4DQRA 1Z25A 4BE0A 1ZBLA 3MEGA 4IFYA 4DSLA 1BIZA 4CFDA 3K59A 1RTIA 1UOCA 4NYNA 2ZE2A 4HHTA 3V9SA 3SPYA 4F2SA 1CLQA 3G10A 3E01A 3PX6A 3EY1A 3AA3A 5T7BA 3KD1E 4CCHA 3I0SA 3RRHA 4DFPA 4DF4A 5JS1A 3WNGA 4CJPA 1L5UA 3F9KA 4ELUA 2YNGA 3O3FA 4KRFA 4CJSA 3CM6A 1WNSA 4E7LA 3LP0A 1VSIA 4LH4A 5K14A 2RKIA 3LZJA 4CEBA 4M3TA 3HYFA 3ZT2A 2O4IA 4OJRA 2D0AA 2Y1JA 4CJVA 1BQNA 3LAKA 2HHUA 3SPZA 1WSHA 4O4GA 4EZ6A 1TAQA 1J5OA 4QCLA 4H8KA 1D8YA 1UWBA 4B9SA 1S1TA 4EP5A 4DSFA 2ZQBA 3C6UA 4DFKA 3ASMA 4CGJA 3QO9A 4DG1A 3P5JA 3KLFA 1R0AA 4DFMA 1RBUA 1VRUA 4R5PA 2PYJA 4AHUA 4B9LA 4FZXC 1Y97A 1HYZA 1ZBUA 3M8RA 3I8DA 2E6MA 3KKRA 4CEQA 4FM0A 4FJGA 3JSMA 3VQDA 4PA1A 4FM2A 2KTQA 4FW1A 1S9EA 1RT5A 3OYAA 4DS5A 4IFVA 4DTRA 3RMDA 1JLCA 4FJIA 2D0BA 3FFIA 3NF8A 4FVMA 5CY4A 4KV8A 4CF1A 4XIUA 4DSJA 1SUQA 3S3OA 4E7KA 4DS4A 4KB0A 3VQCA 3HPHA 1IKWA 4IDKA 3QINA 3RMCA 1J53A 2HHQA 4FW2A 4E7JA 3S9HA 1XC9A 1VSHA 5HRRA 4AHSA 4CJKA 4KHSA 5J2NA 4J2AA 2D5RA 4CGFA 4FZYA 4KFBA 3QNNA 2G8WA 2KZZA 4OLBA 2DFFA 4KTWA 4M3RA 3KLEA 4ZTFA 3QIPA 3OS2A 3OVNA 1VSMA 3MECA 1FKPA 2Z1JA 4JS5A 1VSDA 3CG7A 1KCFA 3V81A 1LWCA 4CJRA 3KK3A 3D0PA 3VQ8A 3O3GA 4M3WA 1RDDA 3T1AA 4BE1A 2VWKA 4J2EA 4FZZA 4W5NA 1RBTA 1BGXT 3LAMA 3VQAA 4O44A 1W9HA 3IG1A 4BDZA 2GUIA 2HNZA 2R7YA 1IKXA 2YHBA 4KI6A 2G8FA 3M8PA 1U04A 1N6QA 3SCXA 1Q9YA 2DFEA 2IOCA 4GMJB 4GW6A 3OS1A 4Q5VA 3HSTB 3OS0A 3OYLA 3NHGA 4BE2A 4QAGA 1KFDA 1CXUA 1HPZA 1G15A 3ZSQA 1JXBA 4CECA 3L2QA 5C25A 1S6PA 4DU3A 2IDOA 3RRGA 4LSLA 4CEOA 4DQQA 1WSEA 3U3YA 1N5YA 4HUEA 3DLBA 4Y1DA 2LSNA 1ASVA 5KGWA 4J2DA 1S9GA 4CHOA 3CFPA 1S5JA 2B5JA 1CZ9A 1WN7A 3G0ZA 4IG3A 3ZSYA 3NH1A 3QESA 3I0RA 1QE1A 4RG8A 1NK7A 1I3AA 2FBVA 2B4JA 4RW7A 4LH5A 2JLEA 4RW6A 3PY8A 4CF2A 4M3XA 4C8LA 1TKTA 3AVKA 3NGZA 4F3OA 3KD5E 4I9LA 4OKEA 1NOZA 2QKBA 2FC0A 3DOKA 3LANA 4HUFA 4RW9A 4H4MA 3AO3A 3NH0A 3U3GA 1LV5A 2X74A 4CJFA 3P83D 1JLEA 4E19A 5EU7A 1JL2A 4PY5A 1EXQA 1EKEA 3OYHA 2G8VA 4NCAA 1RBVA 4FJKA 1I39A 2EX3A 1QQCA 1QS4A 1ZBFA 2OYQA 2NUBA 3AVLA 3HM9A 1L3VA 3SJJA 4BDYA 3C6TA 2BANA 3ISNC 2HHTA 4N76A 4W5OA 3CFRA 4E7IA 4B9NA 3DOLA 1C1CA 3TARA 3QETA 2YNIA 3PX4A 1L3UA 1B92A 2YKMA 3TWHA 3L3UA 4AILC 2WONA 4CK3A 2PYLA 4KTQA 4DTMA 4YNQA 3HVRA 3HJFA 2KW4A 4CJEA 3MAQA 2P1JA 3RTVA 4H4OA 5DK5A 2GV9A 3SUQA 4I2PA 1KRPA 2DY4A 1S1VA 3OYBA 3PO5A 4M3YA 3AVIA 4FLWA 2P5GA 3ZSOA 2HNDA 4AH9A 1RBRA 1QSSA 5C42A 5FDLA 1X9MA 3VQ7A 1D9DA 2HB5A 1X1PA 5HP1A 3OYJA 3M8SA 4CHPA 3HK2A 4B08A 3AVMA 4CHZA 5SZTA 2ITGA 2HNYA 3OYDA 4DLEA 3RMAA 4CGDA 1LAVA 4ZHRA 2Z1IA 2RPIA 2Z1HA 4DU1A 3SQ4A 1EETA 1UA1A 4QOZB 4Z4IA 4M3ZA 1NK8A 1NJWA 1KLNA 1LWEA 2XY8A 4CGGA 2O4GA 3AV9A 3T19A 4FJHA 4TSXA 1QHTA 2OPRA 5C24A 1JLBA 2XY6A 2F8SA 4FJ5A 1RT1A 4E3SA 4GVMA 5SWMA 4CEDA 5KGXA 4CHNA 3VQEA 2ETJA 2Y1IA 2G8UA 2BDPA 3U6FA 3SUOA 1BCOA 1EP4A 4FLYA 2ATQA 3ULDA 4JLHA 3RWUA 1RNHA 1YTAA 3OYFA 3K5MA 4CK1A 3AA4A 4CJWA 2F8TA 3KJVA 4M45A 1A5VA 4B9TA 3VQ4A 1T7PA 1KVAA 4CJLA 1VRTA 4DSIA 2KFZA 1Q9XA 4CEAA 4Z4CA 2AJQA 3SZ2A 1TV6A 3QNOA 3PV8A 4AHRA 2OPQA 3LDSA 3AA2A 3TAQA 3HVTA 4Y1CA 1S1WA 1KVBA 4DSKA 1JLQA 4FJMA 3OYMA 1C0TA 1SL0A 1RDBA 1NKCA 3L3VA 4KPYA 3DM2A 4O0JA 3KKSA 3NBPA 3VQPA 5E41A 3NGIA 4DF8A 4PWDA 1REVA 4CEEA 4FLXA 1HMVA 3KLHA 4FJLA 1RBSA 3TR8A 4DTXA 1RILA 3DRRA 1L3SA 3OYKA 4F8RA 1KLMA 4MQ3A 3KK2A 4HUGA 3K57A 3CQ8A 2FBXA 3O3HA 2Q3SA 1IH7A 3MXJA 4LD0A 2IAJA 2X6SA 3C95A 1KTQA 3A2FA 1C6VA 1J9AA 3NE6A 3L8BA 1IKYA 4CEZA 2B6AA 3OY9A 3HO1A 2VG6A 4BWJA 1C0UA 3K58A 1WLJA 2E4LA 1VK0A 5KTQA 4OPJA 4W5RA 2HHSA 3LP2A 3V1QA 3MXMA 1U49A 2G8HA 3OYIA 4F3TA 4AHTA 3L2VA 3DLKA 4CEFA 4Z4HA 1B9FA 4CHQA 3LZIA 4E7HA 3DI6A 3F73A 3AVHA 5I42A 1LW2A 3AVBA 4OGEA 4FJ8A 3WNFA 3AVNA 3V4IA 1ASUA 1XWLA 1GOAA 3HPOA 5CZ2A 1ZYQA 1TKDA 3BDPA 4E89A 1A5XA 1TK0A 1KFSA 1MU2A 4O5BA 3NF9A 1U45A 1TK8A 3QERA 4IBNA 2XY7A 3PUFA 1TAUA 4CFAA 3SUPA 2BGGA 4CJUA 1RDCA 1RT3A 2Z1GA 1W0HA 1X9SA 4I9QA 3EZ5A 3K5LA 3VN5A 3HT3A 1U4BA 5KRTA 5J2PA 2PZSA 3DRSA 1HQEA 2KFNA 3D45A 1BQMA 2FBTA 4DLGA 4Z4GA 4CGIA 3RR8A 1NK5A 2DTUA 4Z4FA 4RW8A 1D9FA 4OKJA 3DYAA 1VSFA 1T03A 5CYQA 1TL1A 3WNHA 4CFCA 3LPUA 2I5JA 3ZSVA 3V9XA 1A5WA 1HYVA 2YV0X 1TKZA 3SI6A 4KTZA 4FYDA 2BE2A 3DMJA 4WE1A 1HRHA 1JKHA 5CZ1A 4BDPA 1YTUA 3LALA 3P1GA 4C8OA 3AA5X 3IRXA 3KIOA 4ID1A 4W5TA 4FLZA 4CIEA 4KKOA 4OPKA 1SKWA 1BI4A 3PX0A 4IKFA 1RT4A 3S3MA 1NOYA 2G8KA 3KTQA 4HCBA 1HNIA 1LAWA 4MFBA 2P51A 1S1XA 1XHXA 2D0CA 4CF8A 4FXDA 1WSJA 3OYNA 3LP1A 4DTOA 4FJ7A 1RT2A 1D5AA 1JLFA 3LP3A 3ZSRA 3V9WA 3HP6A 2HMIA 4K8ZA 3L2RA 3VQQA 4CJ4A 2HW3A 1RDAA 2X6NA 1JLAA 2A1SA 3CFOA 4DMNA 1Z26A 3NGYA 4Z4EA 3VQ6A 1HYSA 4ZTJA 4KAZA 1FK9A 4J2BA 4DQIA 4DQPA 1FKOA 2XO7A 4FLUA 3NH2A 3ZT1A 4HVJA 2IGIA 4YFUA 3SUNA 2JGUA 4LY7A 3OJSA 1HNVA 1KSPA 3RMBA 1ZBHA 2RF2A 3THVA 4E1NA 1U47A 1WAFA 3OJUA 2YHAA 3CYMA 1NJYA 3L2UA 4KHQA 4KREA 3K2PA 4KO0A 4CK2A 4KB1A 3K5OA 4B8AB 3VQBA 3OYEA 3EYZA 3QEVA 3SQ0A 5D3GA 4IG0A 4BWMA 4JS4A 1DTQA 2OZMA 4CHYA 2OPPA 2G8IA 1BHLA 1LWFA 1BCMA 1VSKA 4M42A 3VQ9A 3SQ2A 3TAGA 4KHUA 1NJXA 1CXQA 1RTDA 4FK0A 1LW0A 5FROA 1UA0A 3KK1A 3AVCA 1NK6A 3LPTA 4DFJA 3IAYA 1SL1A 1VSJA 1C1AA 4DTUA 1RT6A 1BI4B 3ZT3A 2KZMA 4KHWA 2YNHA 5HBMA 1NKBA 1J54A 3BGRA 4EP4A 2HHVA 1XHZA 1SV5A 4LSNA 2IC3A 1JLGA 1HQUA 3TAPA 3AVAA 4NYFA 1IO2A 4CFBA 4F2RA 4CJ3A 3NF7A 1GOCA 4E1MA 3L2WA 3QEIA 3SNNA 2P5OA 4DTNA 4JRQA 3S3NA 1X9WA 4CIFA 5HRSA 3SYZA 3CM5A 1BL3A 3DLEA 3QLHA 1BIUA 3V9ZA 3AVFA 4Q0BA 3TAFA 3DLHA 4PUOA 4PQUA 3AVGA 2QXFA 4FLVA 1XI1A 4B9MA 5HRPA 1TK5A 1UAXA 3NAEA 1IG9A 4B9UA 1WSIA 1JXEA 3ZCMA 1FXXA 3WNEA 4B8CA 3KLIA 4HTUA 3PO4A 3V9UA 4KHYA 1KVCA 4FLTA 4F4KA 2OPSA 3B6PA 4HCCA 3AO2A 1YT3A 4OGCA 5HRNA 4Z0UA 4G1QA 2F96A 3MXIA 1HJRA 3ZSZA 1O1WA 3O4NA 2XY5A 3DRPA 1SL2A 2HHXA 3ITHA 4FJ9A 4B3OA 3DLGA 4OVLA 4N47A 3QEWA 4KI4A 3V6DA 3TABA 1RTJA 1S1UA 1NJZA 4ELVA 2GBZA 4B9VA 4L8RB 1WSGA 2OZSA 4FJXA 1ASWA 3B6OA 3T3FA 4CESA 5CYMA 3V1OA 3HPGA 3SV3A 1TKXA 4ICLA 1QSYA 4E0DA 4M41A 3VA0A 3ZT0A 4RW4A 2HVIA 4N56A 4CIGA 4DQSA 3MEDA 3NDKA 4I7FA 3NFAA 1NK0A 3VA3A 4UQGA 3QEPA 2RN2A 1NK4A 3ZSWA 2QK9A 5J2MA 1RTHA 1GOBA 2EHGA 2VG5A 3AO1A 3QEXA 2HVHA 1WSFA 5FRNA 3K5NA 4N41A 3VQ5A 3UIQA 4CF9A 1K6YA 5FRMA 3ZT4A 3IS9A 2X78A 1F21A 5KRSA 3OYGA 3KLGA 2QKKA 4CGHA 4EZ9A 2OA8A 4O0IA 4CJTA 1DTTA 2ZD1A 5JS2A 5HROA 3JYTA 4BACA 4KHNA 1S6QA 3LWMA 4C8MA 1RCHA 4FJJA 3SV4A 3LWLA 1T8EA 4ID5A 4O55A 3MEEA 1TGOA 3C94A 1NKEA 3O4QA 1C1BA 3HP9A 4DSEA 2XRIA 3SQ1A 1WAJA 4CJ5A 4FCYA 3RR7A 4OKKA 5J1EA 1C0MA 2VG7A 3TAMA 3H08A 3NF6A 5KI6A 4OLAA 2KQ2A 1U48A 2IS3A 3AO4A 1Q8IA 3V1RA 3HXMA 1SKSA 5J2QA 4DU4A 1RT7A 3DLRA 1B9DA 1T05A 2W42A 1QTMA 2DFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE9 A;  4DTP A;  2PY5 A;  3ALY A;  2XHB A;  3AO5 A;  4CER A;  4NCB A;  5HLF A;  3TAN A;  3HL8 A;  2A1R A;  1YVU A;  3NCI A;  4CJQ A;  1QSL A;  4DTS A;  4K8X A;  1ZBI A;  1TVR A;  2YNF A;  3OYC A;  3TI0 A;  4DTJ A;  4ELT A;  4C8N A;  1EX4 A;  4NCG A;  3QIO A;  4AHC A;  4N5S A;  5DMR A;  4JRP A;  1NK9 A;  1TL3 A;  1VSL A;  2FBY A;  3AVJ A;  1JL1 A;  1VSE A;  3M8Q A;  3TAE A;  1L3T A;  2E6L A;  4FJN A;  1BIS A;  1ITG A;  4FK2 A;  5I3U A;  2VWJ A;  1IKV A;  4FM1 A;  4M3U A;  4CF0 A;  4FK4 A;  2WOM A;  1DLO A;  3ZSX A;  1CZB A;  4DWI A;  4I2Q A;  4W5Q A;  4AHV A;  1SKR A;  4C8K A;  2HHW A;  2YKN A;  4DQR A;  1Z25 A;  4BE0 A;  1ZBL A;  3MEG A;  4IFY A;  4DSL A;  1BIZ A;  4CFD A;  3K59 A;  1RTI A;  1UOC A;  4NYN A;  2ZE2 A;  4HHT A;  3V9S A;  3SPY A;  4F2S A;  1CLQ A;  3G10 A;  3E01 A;  3PX6 A;  3EY1 A;  3AA3 A;  5T7B A;  3KD1 E;  4CCH A;  3I0S A;  3RRH A;  4DFP A;  4DF4 A;  5JS1 A;  3WNG A;  4CJP A;  1L5U A;  3F9K A;  4ELU A;  2YNG A;  3O3F A;  4KRF A;  4CJS A;  3CM6 A;  1WNS A;  4E7L A;  3LP0 A;  1VSI A;  4LH4 A;  5K14 A;  2RKI A;  3LZJ A;  4CEB A;  4M3T A;  3HYF A;  3ZT2 A;  2O4I A;  4OJR A;  2D0A A;  2Y1J A;  4CJV A;  1BQN A;  3LAK A;  2HHU A;  3SPZ A;  1WSH A;  4O4G A;  4EZ6 A;  1TAQ A;  1J5O A;  4QCL A;  4H8K A;  1D8Y A;  1UWB A;  4B9S A;  1S1T A;  4EP5 A;  4DSF A;  2ZQB A;  3C6U A;  4DFK A;  3ASM A;  4CGJ A;  3QO9 A;  4DG1 A;  3P5J A;  3KLF A;  1R0A A;  4DFM A;  1RBU A;  1VRU A;  4R5P A;  2PYJ A;  4AHU A;  4B9L A;  4FZX C;  1Y97 A;  1HYZ A;  1ZBU A;  3M8R A;  3I8D A;  2E6M A;  3KKR A;  4CEQ A;  4FM0 A;  4FJG A;  3JSM A;  3VQD A;  4PA1 A;  4FM2 A;  2KTQ A;  4FW1 A;  1S9E A;  1RT5 A;  3OYA A;  4DS5 A;  4IFV A;  4DTR A;  3RMD A;  1JLC A;  4FJI A;  2D0B A;  3FFI A;  3NF8 A;  4FVM A;  5CY4 A;  4KV8 A;  4CF1 A;  4XIU A;  4DSJ A;  1SUQ A;  3S3O A;  4E7K A;  4DS4 A;  4KB0 A;  3VQC A;  3HPH A;  1IKW A;  4IDK A;  3QIN A;  3RMC A;  1J53 A;  2HHQ A;  4FW2 A;  4E7J A;  3S9H A;  1XC9 A;  1VSH A;  5HRR A;  4AHS A;  4CJK A;  4KHS A;  5J2N A;  4J2A A;  2D5R A;  4CGF A;  4FZY A;  4KFB A;  3QNN A;  2G8W A;  2KZZ A;  4OLB A;  2DFF A;  4KTW A;  4M3R A;  3KLE A;  4ZTF A;  3QIP A;  3OS2 A;  3OVN A;  1VSM A;  3MEC A;  1FKP A;  2Z1J A;  4JS5 A;  1VSD A;  3CG7 A;  1KCF A;  3V81 A;  1LWC A;  4CJR A;  3KK3 A;  3D0P A;  3VQ8 A;  3O3G A;  4M3W A;  1RDD A;  3T1A A;  4BE1 A;  2VWK A;  4J2E A;  4FZZ A;  4W5N A;  1RBT A;  1BGX T;  3LAM A;  3VQA A;  4O44 A;  1W9H A;  3IG1 A;  4BDZ A;  2GUI A;  2HNZ A;  2R7Y A;  1IKX A;  2YHB A;  4KI6 A;  2G8F A;  3M8P A;  1U04 A;  1N6Q A;  3SCX A;  1Q9Y A;  2DFE A;  2IOC A;  4GMJ B;  4GW6 A;  3OS1 A;  4Q5V A;  3HST B;  3OS0 A;  3OYL A;  3NHG A;  4BE2 A;  4QAG A;  1KFD A;  1CXU A;  1HPZ A;  1G15 A;  3ZSQ A;  1JXB A;  4CEC A;  3L2Q A;  5C25 A;  1S6P A;  4DU3 A;  2IDO A;  3RRG A;  4LSL A;  4CEO A;  4DQQ A;  1WSE A;  3U3Y A;  1N5Y A;  4HUE A;  3DLB A;  4Y1D A;  2LSN A;  1ASV A;  5KGW A;  4J2D A;  1S9G A;  4CHO A;  3CFP A;  1S5J A;  2B5J A;  1CZ9 A;  1WN7 A;  3G0Z A;  4IG3 A;  3ZSY A;  3NH1 A;  3QES A;  3I0R A;  1QE1 A;  4RG8 A;  1NK7 A;  1I3A A;  2FBV A;  2B4J A;  4RW7 A;  4LH5 A;  2JLE A;  4RW6 A;  3PY8 A;  4CF2 A;  4M3X A;  4C8L A;  1TKT A;  3AVK A;  3NGZ A;  4F3O A;  3KD5 E;  4I9L A;  4OKE A;  1NOZ A;  2QKB A;  2FC0 A;  3DOK A;  3LAN A;  4HUF A;  4RW9 A;  4H4M A;  3AO3 A;  3NH0 A;  3U3G A;  1LV5 A;  2X74 A;  4CJF A;  3P83 D;  1JLE A;  4E19 A;  5EU7 A;  1JL2 A;  4PY5 A;  1EXQ A;  1EKE A;  3OYH A;  2G8V A;  4NCA A;  1RBV A;  4FJK A;  1I39 A;  2EX3 A;  1QQC A;  1QS4 A;  1ZBF A;  2OYQ A;  2NUB A;  3AVL A;  3HM9 A;  1L3V A;  3SJJ A;  4BDY A;  3C6T A;  2BAN A;  3ISN C;  2HHT A;  4N76 A;  4W5O A;  3CFR A;  4E7I A;  4B9N A;  3DOL A;  1C1C A;  3TAR A;  3QET A;  2YNI A;  3PX4 A;  1L3U A;  1B92 A;  2YKM A;  3TWH A;  3L3U A;  4AIL C;  2WON A;  4CK3 A;  2PYL A;  4KTQ A;  4DTM A;  4YNQ A;  3HVR A;  3HJF A;  2KW4 A;  4CJE A;  3MAQ A;  2P1J A;  3RTV A;  4H4O A;  5DK5 A;  2GV9 A;  3SUQ A;  4I2P A;  1KRP A;  2DY4 A;  1S1V A;  3OYB A;  3PO5 A;  4M3Y A;  3AVI A;  4FLW A;  2P5G A;  3ZSO A;  2HND A;  4AH9 A;  1RBR A;  1QSS A;  5C42 A;  5FDL A;  1X9M A;  3VQ7 A;  1D9D A;  2HB5 A;  1X1P A;  5HP1 A;  3OYJ A;  3M8S A;  4CHP A;  3HK2 A;  4B08 A;  3AVM A;  4CHZ A;  5SZT A;  2ITG A;  2HNY A;  3OYD A;  4DLE A;  3RMA A;  4CGD A;  1LAV A;  4ZHR A;  2Z1I A;  2RPI A;  2Z1H A;  4DU1 A;  3SQ4 A;  1EET A;  1UA1 A;  4QOZ B;  4Z4I A;  4M3Z A;  1NK8 A;  1NJW A;  1KLN A;  1LWE A;  2XY8 A;  4CGG A;  2O4G A;  3AV9 A;  3T19 A;  4FJH A;  4TSX A;  1QHT A;  2OPR A;  5C24 A;  1JLB A;  2XY6 A;  2F8S A;  4FJ5 A;  1RT1 A;  4E3S A;  4GVM A;  5SWM A;  4CED A;  5KGX A;  4CHN A;  3VQE A;  2ETJ A;  2Y1I A;  2G8U A;  2BDP A;  3U6F A;  3SUO A;  1BCO A;  1EP4 A;  4FLY A;  2ATQ A;  3ULD A;  4JLH A;  3RWU A;  1RNH A;  1YTA A;  3OYF A;  3K5M A;  4CK1 A;  3AA4 A;  4CJW A;  2F8T A;  3KJV A;  4M45 A;  1A5V A;  4B9T A;  3VQ4 A;  1T7P A;  1KVA A;  4CJL A;  1VRT A;  4DSI A;  2KFZ A;  1Q9X A;  4CEA A;  4Z4C A;  2AJQ A;  3SZ2 A;  1TV6 A;  3QNO A;  3PV8 A;  4AHR A;  2OPQ A;  3LDS A;  3AA2 A;  3TAQ A;  3HVT A;  4Y1C A;  1S1W A;  1KVB A;  4DSK A;  1JLQ A;  4FJM A;  3OYM A;  1C0T A;  1SL0 A;  1RDB A;  1NKC A;  3L3V A;  4KPY A;  3DM2 A;  4O0J A;  3KKS A;  3NBP A;  3VQP A;  5E41 A;  3NGI A;  4DF8 A;  4PWD A;  1REV A;  4CEE A;  4FLX A;  1HMV A;  3KLH A;  4FJL A;  1RBS A;  3TR8 A;  4DTX A;  1RIL A;  3DRR A;  1L3S A;  3OYK A;  4F8R A;  1KLM A;  4MQ3 A;  3KK2 A;  4HUG A;  3K57 A;  3CQ8 A;  2FBX A;  3O3H A;  2Q3S A;  1IH7 A;  3MXJ A;  4LD0 A;  2IAJ A;  2X6S A;  3C95 A;  1KTQ A;  3A2F A;  1C6V A;  1J9A A;  3NE6 A;  3L8B A;  1IKY A;  4CEZ A;  2B6A A;  3OY9 A;  3HO1 A;  2VG6 A;  4BWJ A;  1C0U A;  3K58 A;  1WLJ A;  2E4L A;  1VK0 A;  5KTQ A;  4OPJ A;  4W5R A;  2HHS A;  3LP2 A;  3V1Q A;  3MXM A;  1U49 A;  2G8H A;  3OYI A;  4F3T A;  4AHT A;  3L2V A;  3DLK A;  4CEF A;  4Z4H A;  1B9F A;  4CHQ A;  3LZI A;  4E7H A;  3DI6 A;  3F73 A;  3AVH A;  5I42 A;  1LW2 A;  3AVB A;  4OGE A;  4FJ8 A;  3WNF A;  3AVN A;  3V4I A;  1ASU A;  1XWL A;  1GOA A;  3HPO A;  5CZ2 A;  1ZYQ A;  1TKD A;  3BDP A;  4E89 A;  1A5X A;  1TK0 A;  1KFS A;  1MU2 A;  4O5B A;  3NF9 A;  1U45 A;  1TK8 A;  3QER A;  4IBN A;  2XY7 A;  3PUF A;  1TAU A;  4CFA A;  3SUP A;  2BGG A;  4CJU A;  1RDC A;  1RT3 A;  2Z1G A;  1W0H A;  1X9S A;  4I9Q A;  3EZ5 A;  3K5L A;  3VN5 A;  3HT3 A;  1U4B A;  5KRT A;  5J2P A;  2PZS A;  3DRS A;  1HQE A;  2KFN A;  3D45 A;  1BQM A;  2FBT A;  4DLG A;  4Z4G A;  4CGI A;  3RR8 A;  1NK5 A;  2DTU A;  4Z4F A;  4RW8 A;  1D9F A;  4OKJ A;  3DYA A;  1VSF A;  1T03 A;  5CYQ A;  1TL1 A;  3WNH A;  4CFC A;  3LPU A;  2I5J A;  3ZSV A;  3V9X A;  1A5W A;  1HYV A;  2YV0 X;  1TKZ A;  3SI6 A;  4KTZ A;  4FYD A;  2BE2 A;  3DMJ A;  4WE1 A;  1HRH A;  1JKH A;  5CZ1 A;  4BDP A;  1YTU A;  3LAL A;  3P1G A;  4C8O A;  3AA5 X;  3IRX A;  3KIO A;  4ID1 A;  4W5T A;  4FLZ A;  4CIE A;  4KKO A;  4OPK A;  1SKW A;  1BI4 A;  3PX0 A;  4IKF A;  1RT4 A;  3S3M A;  1NOY A;  2G8K A;  3KTQ A;  4HCB A;  1HNI A;  1LAW A;  4MFB A;  2P51 A;  1S1X A;  1XHX A;  2D0C A;  4CF8 A;  4FXD A;  1WSJ A;  3OYN A;  3LP1 A;  4DTO A;  4FJ7 A;  1RT2 A;  1D5A A;  1JLF A;  3LP3 A;  3ZSR A;  3V9W A;  3HP6 A;  2HMI A;  4K8Z A;  3L2R A;  3VQQ A;  4CJ4 A;  2HW3 A;  1RDA A;  2X6N A;  1JLA A;  2A1S A;  3CFO A;  4DMN A;  1Z26 A;  3NGY A;  4Z4E A;  3VQ6 A;  1HYS A;  4ZTJ A;  4KAZ A;  1FK9 A;  4J2B A;  4DQI A;  4DQP A;  1FKO A;  2XO7 A;  4FLU A;  3NH2 A;  3ZT1 A;  4HVJ A;  2IGI A;  4YFU A;  3SUN A;  2JGU A;  4LY7 A;  3OJS A;  1HNV A;  1KSP A;  3RMB A;  1ZBH A;  2RF2 A;  3THV A;  4E1N A;  1U47 A;  1WAF A;  3OJU A;  2YHA A;  3CYM A;  1NJY A;  3L2U A;  4KHQ A;  4KRE A;  3K2P A;  4KO0 A;  4CK2 A;  4KB1 A;  3K5O A;  4B8A B;  3VQB A;  3OYE A;  3EYZ A;  3QEV A;  3SQ0 A;  5D3G A;  4IG0 A;  4BWM A;  4JS4 A;  1DTQ A;  2OZM A;  4CHY A;  2OPP A;  2G8I A;  1BHL A;  1LWF A;  1BCM A;  1VSK A;  4M42 A;  3VQ9 A;  3SQ2 A;  3TAG A;  4KHU A;  1NJX A;  1CXQ A;  1RTD A;  4FK0 A;  1LW0 A;  5FRO A;  1UA0 A;  3KK1 A;  3AVC A;  1NK6 A;  3LPT A;  4DFJ A;  3IAY A;  1SL1 A;  1VSJ A;  1C1A A;  4DTU A;  1RT6 A;  1BI4 B;  3ZT3 A;  2KZM A;  4KHW A;  2YNH A;  5HBM A;  1NKB A;  1J54 A;  3BGR A;  4EP4 A;  2HHV A;  1XHZ A;  1SV5 A;  4LSN A;  2IC3 A;  1JLG A;  1HQU A;  3TAP A;  3AVA A;  4NYF A;  1IO2 A;  4CFB A;  4F2R A;  4CJ3 A;  3NF7 A;  1GOC A;  4E1M A;  3L2W A;  3QEI A;  3SNN A;  2P5O A;  4DTN A;  4JRQ A;  3S3N A;  1X9W A;  4CIF A;  5HRS A;  3SYZ A;  3CM5 A;  1BL3 A;  3DLE A;  3QLH A;  1BIU A;  3V9Z A;  3AVF A;  4Q0B A;  3TAF A;  3DLH A;  4PUO A;  4PQU A;  3AVG A;  2QXF A;  4FLV A;  1XI1 A;  4B9M A;  5HRP A;  1TK5 A;  1UAX A;  3NAE A;  1IG9 A;  4B9U A;  1WSI A;  1JXE A;  3ZCM A;  1FXX A;  3WNE A;  4B8C A;  3KLI A;  4HTU A;  3PO4 A;  3V9U A;  4KHY A;  1KVC A;  4FLT A;  4F4K A;  2OPS A;  3B6P A;  4HCC A;  3AO2 A;  1YT3 A;  4OGC A;  5HRN A;  4Z0U A;  4G1Q A;  2F96 A;  3MXI A;  1HJR A;  3ZSZ A;  1O1W A;  3O4N A;  2XY5 A;  3DRP A;  1SL2 A;  2HHX A;  3ITH A;  4FJ9 A;  4B3O A;  3DLG A;  4OVL A;  4N47 A;  3QEW A;  4KI4 A;  3V6D A;  3TAB A;  1RTJ A;  1S1U A;  1NJZ A;  4ELV A;  2GBZ A;  4B9V A;  4L8R B;  1WSG A;  2OZS A;  4FJX A;  1ASW A;  3B6O A;  3T3F A;  4CES A;  5CYM A;  3V1O A;  3HPG A;  3SV3 A;  1TKX A;  4ICL A;  1QSY A;  4E0D A;  4M41 A;  3VA0 A;  3ZT0 A;  4RW4 A;  2HVI A;  4N56 A;  4CIG A;  4DQS A;  3MED A;  3NDK A;  4I7F A;  3NFA A;  1NK0 A;  3VA3 A;  4UQG A;  3QEP A;  2RN2 A;  1NK4 A;  3ZSW A;  2QK9 A;  5J2M A;  1RTH A;  1GOB A;  2EHG A;  2VG5 A;  3AO1 A;  3QEX A;  2HVH A;  1WSF A;  5FRN A;  3K5N A;  4N41 A;  3VQ5 A;  3UIQ A;  4CF9 A;  1K6Y A;  5FRM A;  3ZT4 A;  3IS9 A;  2X78 A;  1F21 A;  5KRS A;  3OYG A;  3KLG A;  2QKK A;  4CGH A;  4EZ9 A;  2OA8 A;  4O0I A;  4CJT A;  1DTT A;  2ZD1 A;  5JS2 A;  5HRO A;  3JYT A;  4BAC A;  4KHN A;  1S6Q A;  3LWM A;  4C8M A;  1RCH A;  4FJJ A;  3SV4 A;  3LWL A;  1T8E A;  4ID5 A;  4O55 A;  3MEE A;  1TGO A;  3C94 A;  1NKE A;  3O4Q A;  1C1B A;  3HP9 A;  4DSE A;  2XRI A;  3SQ1 A;  1WAJ A;  4CJ5 A;  4FCY A;  3RR7 A;  4OKK A;  5J1E A;  1C0M A;  2VG7 A;  3TAM A;  3H08 A;  3NF6 A;  5KI6 A;  4OLA A;  2KQ2 A;  1U48 A;  2IS3 A;  3AO4 A;  1Q8I A;  3V1R A;  3HXM A;  1SKS A;  5J2Q A;  4DU4 A;  1RT7 A;  3DLR A;  1B9D A;  1T05 A;  2W42 A;  1QTM A;  2DFH A; 
#chains in the Genus database with same CATH topology
 2PY5 A;  3O80 A;  2XHB A;  3AO5 A;  4CER A;  4MDB A;  3HL8 A;  1QSL A;  4K8X A;  5JVH L;  3T1Y K;  1TVR A;  1I94 K;  4BR0 A;  4ELT A;  4DTJ A;  3QIO A;  4N5S A;  2O8F A;  1VSL A;  2FBY A;  3QIC A;  1L3T A;  2V7Z A;  1BIS A;  1ITG A;  3U9D A;  4EHU A;  4AHV A;  1ATN A;  4BE0 A;  4DSL A;  1RTI A;  1UOC A;  1CLQ A;  1EO1 A;  3ULE B;  3AA3 A;  4CCH A;  1NGD A;  4BRH A;  1L5U A;  3F9K A;  2YNG A;  3VTI A;  4LFA K;  4KBO A;  3ZT2 A;  2Y1J A;  1BQN A;  3L6Q A;  4DV3 K;  4O4G A;  1HNZ K;  4QCL A;  1J5O A;  3I55 N;  4EP5 A;  2ZQB A;  3C6U A;  3ASM A;  3QO9 A;  3KLF A;  1R0A A;  4DFM A;  1VRU A;  4R5P A;  1MDU B;  5C0Y A;  4IDH A;  1Y97 A;  3CJB A;  3I8D A;  1QVG M;  1ATS A;  3KKR A;  1KAY A;  4FM2 A;  4FW1 A;  1E3M A;  2HMP A;  4IFV A;  3RMD A;  3CC2 N;  4FJI A;  1JCG A;  5CY4 A;  4FVM A;  3J7Z O;  3HPH A;  4YOW A;  4B1U B;  1J53 A;  2HHQ A;  1VSH A;  4AHS A;  4CJK A;  4KHS A;  5J2N A;  1HLU A;  1BWF O;  4MLE A;  4KFB A;  4A59 A;  2D0O A;  3FFK B;  3KLE A;  4ZTF A;  2O8B A;  3A0I X;  3OVN A;  3MEC A;  1QQO A;  1FKP A;  1VSD A;  3CG7 A;  4H5V A;  3KK3 A;  3QBW A;  2NRW A;  3T1A A;  2W40 A;  3CCS N;  2UUC K;  1RBT A;  2QI2 A;  4BDZ A;  5AQT A;  4GMJ B;  4BE2 A;  3NHG A;  4KHW A;  1HPZ A;  1G15 A;  3CPW M;  2IDO A;  3RRG A;  4LSL A;  4FWM A;  1HKC A;  1ASV A;  1Q82 O;  5KGW A;  3MN6 A;  1S5J A;  1CZ9 A;  2VGM A;  3G0Z A;  4IG3 A;  3ZSY A;  2YHW A;  4H5R A;  1HJO A;  4RW7 A;  4JI8 K;  3SBT A;  4CF2 A;  4WFB L;  3P4I A;  3AVK A;  3KD5 E;  3DAW A;  4I9L A;  4DR3 K;  4LF5 K;  3LAN A;  3NH0 A;  3U3G A;  2X74 A;  3A5N C;  1SQK A;  1VQL N;  3VGM A;  4GVE A;  1EXQ A;  5EVZ A;  1YHQ N;  1NGJ A;  3ZX2 A;  1I39 A;  4LF7 K;  1QS4 A;  2NUB A;  3AGR A;  1L3V A;  3SJJ A;  2GEL A;  2Q0R A;  4LFC K;  1RDU A;  3EO3 A;  1XQS C;  3DOL A;  3QET A;  2YNI A;  3CCR N;  1B92 A;  2OCE A;  3TWH A;  4BGB A;  1XMQ K;  4H0T B;  3O9T A;  4MO4 A;  1N32 K;  3HVR A;  2J4R A;  3CIP A;  2KW4 A;  4H4O A;  3SUQ A;  3J80 O;  1S1V A;  3ZSO A;  1QSS A;  4A5A A;  1X9M A;  5IT9 O;  3I8B A;  2HF3 A;  1X1P A;  3OYJ A;  3M8S A;  4A57 A;  4B08 A;  4CHZ A;  3OYD A;  1KD1 O;  3HOS A;  4ZHR A;  3MN7 A;  1EET A;  3LDL A;  4XH4 A;  4JV5 K;  1KLN A;  1LWE A;  3I33 A;  4GV3 A;  1QHT A;  5AFU A;  3CXC M;  2F8S A;  5C10 A;  1RT1 A;  4E3S A;  4GVM A;  4FJ5 A;  3G25 A;  4CED A;  1NMD A;  3H1V X;  3C7N B;  2G8U A;  4FLY A;  2ATQ A;  3ULD A;  4JLH A;  3RWU A;  1RNH A;  4JK7 A;  1C0G A;  3KJV A;  4GKJ K;  1A5V A;  1KVA A;  2P9K A;  1VRT A;  4CJL A;  4DSI A;  3D6R A;  3I56 N;  4Y1C A;  3OYM A;  3R1X A;  1C0T A;  1O13 A;  2YHX A;  4R79 A;  4O0J A;  3MN5 A;  3VQP A;  4DF8 A;  4CEE A;  3OW2 M;  3T69 A;  4KH4 A;  1RBS A;  1YI2 N;  2NRR A;  4BR9 A;  3CQ8 A;  4LD0 A;  2IAJ A;  4X64 K;  2X6S A;  3C95 A;  4BRM A;  4ISE A;  3OHR A;  4FWL A;  4CEZ A;  3D7E O;  1WLJ A;  2A6A A;  1IBM K;  1M1K O;  5H1S Q;  4AHT A;  3L2V A;  4CEF A;  4JI1 K;  1B9F A;  4CHQ A;  2PAV A;  2P9L B;  4E7H A;  3AVH A;  2WTU A;  3GDQ A;  4JAX A;  1ASU A;  3HPO A;  5KQD A;  5CZ2 A;  5GAD P;  3KZB A;  1KFS A;  3TTC A;  1WOQ A;  4H03 B;  3ZET A;  4BGA A;  2XY7 A;  1TAU A;  4BQZ A;  2BGG A;  4I9Q A;  1T6D A;  3HT3 A;  5J2P A;  2ASM A;  2PZS A;  2KFN A;  2BH1 A;  4BRQ A;  3RR8 A;  4U67 L;  4RW8 A;  1D9F A;  2NRT A;  2A40 A;  1OH5 A;  3V9X A;  3FR0 A;  2Q2R A;  1SS6 A;  1TKZ A;  1JKH A;  5CZ1 A;  3AA5 X;  3KIO A;  4ID1 A;  4BQL A;  4KKO A;  1BI4 A;  5JIC A;  4PL7 A;  5AQO A;  1LAW A;  4OPA A;  4CF8 A;  4XEI A;  2UXD K;  4X66 K;  4FXD A;  3IDH A;  4FJ7 A;  3LP3 A;  3HP6 A;  2HW3 A;  3L2R A;  1RDA A;  4DR4 K;  1JLA A;  3GE1 A;  1Z26 A;  4KAZ A;  1FK9 A;  3ZT1 A;  2P9L A;  4HVJ A;  3LDN A;  3OJS A;  2RF2 A;  3THV A;  3OTO K;  1HKG A;  4FL9 A;  3OJU A;  1IBK K;  3CCQ N;  4KRE A;  2ZJP L;  2E1Y A;  4CK2 A;  4LF4 K;  2Q31 A;  3K5O A;  4BWM A;  4JS4 A;  2OPP A;  2G8I A;  1LWF A;  2GEM A;  4KHU A;  1CXQ A;  3GG4 A;  4FK0 A;  3KK1 A;  1VSJ A;  1U2V A;  4RCH A;  3U8X A;  1NGB A;  2KZM A;  1NKB A;  1XHZ A;  1SV5 A;  1HQU A;  5F2R A;  3AVA A;  2W41 A;  4CJ3 A;  5KPR A;  1GOC A;  2D1K A;  3L2W A;  2NRH A;  4JRQ A;  4CIF A;  5HRS A;  2CH5 A;  1BL3 A;  2VYP A;  3DLE A;  4YOV A;  4YOU A;  4LC9 B;  4WQ4 C;  4B9M A;  1UAX A;  4BRC A;  4JEP A;  3WNE A;  2E5L K;  3PO4 A;  3O9R A;  4FLT A;  4HCC A;  3TSP A;  3AO2 A;  2F96 A;  4NLC A;  3O4N A;  4AF1 A;  2P9N B;  1SL2 A;  1P90 A;  2UUB K;  3AY9 A;  5AQN A;  1NJZ A;  1S1U A;  4X65 K;  1YJ9 N;  2O8E B;  3TPQ A;  5AQU A;  3T3F A;  2O8F B;  3PIO L;  1QSY A;  1N33 K;  3E9O A;  5AQV A;  3ZT0 A;  2HVI A;  4N56 A;  3AAR A;  3MED A;  2IVO A;  5J2M A;  2VG5 A;  2HVH A;  1KC8 O;  1MWK A;  2E2O A;  5BRD A;  4CZE A;  1K6Y A;  5FRM A;  3ZT4 A;  3OYG A;  4BRF A;  2OA8 A;  1JCE A;  2CGL A;  2ZD1 A;  5JS2 A;  4DV5 K;  2P9U A;  3SMP A;  1S6Q A;  4B9Q A;  3LWL A;  5M1K A;  3EEQ A;  1VQ5 N;  4DR7 K;  3C94 A;  2XRI A;  4CJ5 A;  4FCY A;  3Q7B A;  3CCL N;  4KH5 A;  1VQ6 N;  3M5R A;  4OLA A;  5BPM A;  4K43 A;  1Q8I A;  2AP1 A;  1T05 A;  3CCJ N;  4A62 A;  4CE9 A;  2AA4 A;  3ALY A;  4NCB A;  1BDG A;  2A1R A;  3NCI A;  4WQ4 A;  1VQN N;  2YNF A;  3OYC A;  3WXI A;  3CPE A;  5TKW A;  1EX4 A;  4AHC A;  1TL3 A;  3AVJ A;  4BRA A;  3TAE A;  2E6L A;  5AQQ A;  3F2K A;  2VWJ A;  3PSF A;  1IKV A;  4M3U A;  1YJN N;  4DWI A;  4I2Q A;  4M7X A;  4W5Q A;  3O1B A;  3B8A X;  4JKF A;  1TYQ B;  4Y0W A;  4M7Y A;  3VMF B;  1GLF O;  5F1X A;  4F2S A;  4BC5 A;  3D2F B;  3U4L A;  3G10 A;  5JMV A;  3PX6 A;  4DKW A;  3FZF A;  3KD1 E;  3RRH A;  4DF4 A;  4K25 A;  3WNG A;  2YI1 A;  1HPM A;  5M1O A;  1WNS A;  2QWR A;  3LZJ A;  2RKI A;  4FWN A;  3HYF A;  2D0A A;  3LAK A;  2W6L A;  5BR9 A;  1D8Y A;  4B9S A;  4DSF A;  2NRV A;  4CZG A;  4DFK A;  2KLA A;  1DT9 A;  1RBU A;  2PYJ A;  1S3X A;  1Y64 A;  1K8K A;  2E6M A;  4FWK A;  5ELZ A;  4FM0 A;  3VQD A;  1NG9 A;  2QXL A;  5FPD A;  4DS5 A;  4DTR A;  3VEN A;  3FFI A;  4OX9 K;  2P9P B;  5AQL A;  3ZEU B;  3VTH A;  3S3O A;  2ZF5 O;  3THY B;  4WCE L;  4KB0 A;  2NZT A;  3QIN A;  1GLD G;  4FW2 A;  3S9H A;  3RVC A;  2FLO A;  4J2A A;  4FZY A;  3P39 A;  2KZZ A;  3QNN A;  2G8W A;  2UXC K;  2DFF A;  4KTW A;  1QVF M;  3HZ6 A;  1KCF A;  1KAX A;  1LWC A;  4CJR A;  4CJ7 A;  3CJ7 A;  4CD1 A;  4J2E A;  5BPN A;  3IKM A;  4QS8 A;  1YF5 L;  4O44 A;  1W9H A;  1OKJ A;  2R7Y A;  1LOT B;  2YHB A;  2BUP A;  4KI6 A;  3M8P A;  1U04 A;  1N8R O;  1KFD A;  3ZSQ A;  1S6P A;  3U9Z A;  4DU3 A;  2H3G X;  4DQQ A;  3U3Y A;  1N5Y A;  5AQW A;  5BR8 K;  2KHO A;  4WQ5 C;  3CQY A;  3S41 A;  3QES A;  3I0R A;  4RG8 A;  1I3A A;  2B4J A;  3OBY A;  2P9I B;  1NOZ A;  2QKB A;  2FC0 A;  1K9M O;  4RW9 A;  4H4M A;  4GY2 B;  3M3Z A;  1GLJ O;  2QWL A;  3OBW A;  3VEV A;  5EU7 A;  4JI2 K;  4EIA A;  4PY5 A;  4BRP A;  2G8V A;  4NCA A;  4WYB A;  3GBT A;  1ZBF A;  3H3N O;  1CZA N;  3UE5 A;  5EY4 A;  2GX9 A;  2HHT A;  2RE2 A;  2GWK A;  4CBW A;  1L3U A;  4AIL C;  3L3U A;  3F9M A;  4CK3 A;  4KTQ A;  4DTM A;  4CJE A;  3MAQ A;  2GV9 A;  4I2P A;  2DY4 A;  2O8C A;  4FLW A;  4AH9 A;  1D9D A;  5C42 A;  4FPB A;  3VQ7 A;  4X62 K;  1VQM N;  2F7T A;  3WXK A;  4CHP A;  1SAZ A;  3HK2 A;  5M1Q A;  3RMA A;  4JKH A;  2PFU A;  2Z1I A;  4JHD B;  1HNW K;  2P9I A;  4FWQ A;  4Z94 A;  4CGG A;  5LJV A;  3AV9 A;  3T19 A;  5AFU H;  5C24 A;  1IJJ A;  5KGX A;  1IV0 A;  2Y1I A;  4J8F A;  2BDP A;  1BCO A;  3CJ9 A;  3TU5 A;  1YTA A;  4FWR A;  3K5M A;  4M45 A;  4B9T A;  4OPH A;  1Q9X A;  4CEA A;  5ADX A;  2OPQ A;  1S1W A;  4DSK A;  5IWA K;  2F4V K;  1SL0 A;  1RDB A;  1NKC A;  4XH1 A;  3SMS A;  4WFN L;  4CBU A;  1HMV A;  3KLH A;  4DTX A;  1RIL A;  3DRR A;  4F8R A;  1U6Z A;  4FWP A;  3KK2 A;  4HUG A;  3K57 A;  2FBX A;  3MXJ A;  3MWP A;  3K9J A;  3A2F A;  1IKY A;  5FPN A;  4BWJ A;  1C0U A;  3PLA A;  4JI5 K;  1TYQ A;  5KTQ A;  1VK0 A;  3LP2 A;  2ASO A;  3BP8 A;  4CZF A;  1K73 O;  1BO5 O;  1FJG K;  3DI6 A;  3AVB A;  4OGE A;  3CD6 N;  3WNF A;  3ATU A;  3AVN A;  1RDW X;  4E89 A;  3NF9 A;  1TK8 A;  4JYA K;  1VQ7 N;  3PUF A;  3MX5 A;  4CFA A;  3JAM O;  4EFH A;  4CJU A;  1RDC A;  1RT3 A;  4C1N I;  1U4B A;  3VN5 A;  3DRS A;  3D45 A;  1BQM A;  2QWO A;  3DYA A;  4CFC A;  3VEZ A;  4JD2 B;  2I5J A;  4WFA L;  2PBD A;  3DMJ A;  1ZXO A;  1HRH A;  5LL6 Z;  1YTU A;  5BRE A;  3LAL A;  4C8O A;  4OPK A;  3FZH A;  4IKF A;  4IO9 L;  1HNI A;  4AM7 A;  1S1X A;  3UKR A;  3BEX A;  3LP1 A;  1RT2 A;  3ZX3 A;  4CJ4 A;  2VWB A;  3WEE A;  4IZ9 A;  3CFO A;  3E9L A;  3SAF A;  3NGY A;  1HX1 A;  1IBL K;  1HYS A;  3AAP A;  5KPZ A;  3NH2 A;  3L4Q A;  1SZ2 A;  3FE1 A;  3SUN A;  4JKD A;  1KSP A;  3RMB A;  4JI0 K;  4JKA A;  4A61 A;  3N4P A;  1BG3 A;  5AQZ A;  4ILH A;  4RWT A;  3L2U A;  4FOE A;  3AGK A;  2NRX A;  4KO0 A;  3CI5 A;  5C2F A;  4B8A B;  3EYZ A;  3QEV A;  4IG0 A;  5JLF A;  1DTQ A;  5A2Q O;  3O5B A;  3BY5 A;  3HTV A;  1BCM A;  4M42 A;  4H0O A;  3VQ9 A;  3TAG A;  1QQN A;  1LW0 A;  5FRO A;  1UA0 A;  3IAY A;  3LPT A;  3VF6 A;  3EKU A;  3THX B;  1RT6 A;  3ZT3 A;  1YJW N;  1J54 A;  3CCE N;  4CD3 A;  2BTF A;  4F2R A;  3O9U A;  2NRZ A;  3NF7 A;  2IVP A;  2YJF A;  3QEI A;  3VF2 A;  1XNQ K;  2W6K A;  3S3N A;  1X9W A;  4DR6 K;  3SYZ A;  3QLH A;  1BIU A;  3DLL L;  3AVF A;  4Q0B A;  4C1N K;  3TAF A;  1EWQ A;  2QXF A;  4FLV A;  1XI1 A;  1N34 K;  4B9U A;  1WBB A;  2WFB A;  3H1Q A;  5AQX A;  4B8C A;  3E9P A;  3LL3 A;  2QW9 A;  5HRN A;  1HJR A;  1Q7Y O;  3ZSZ A;  1O1W A;  1E4G T;  3DRP A;  3SLC A;  2A42 A;  4OVL A;  3QEW A;  1W7A A;  1RTJ A;  3A5L C;  2GBZ A;  4B9V A;  4IXC A;  3CHW A;  1ASW A;  3EL2 A;  3QFU A;  1S72 N;  1P8Z A;  4E0D A;  3HPG A;  4FPA A;  4JHD A;  3VA0 A;  4RW4 A;  3KWI A;  4DQS A;  4BRG A;  3UB5 A;  4I7F A;  2HBM A;  3VA3 A;  3WQT A;  2RN2 A;  3IFR A;  1GOB A;  3QEX A;  3AO1 A;  2GTD A;  5FRN A;  3K5N A;  1R59 O;  3VQ5 A;  1QHA A;  4K41 A;  4CF9 A;  2WC9 A;  3IS9 A;  1BUP A;  5KRS A;  2P9S A;  3E66 A;  2QKK A;  3IUC A;  4CGH A;  4EZ9 A;  3BF3 A;  4CJT A;  3ZET B;  3JYT A;  2NNW A;  1VAZ A;  5F0X A;  1NGC A;  4O55 A;  2D4W A;  1TGO A;  2QA4 N;  4FWS A;  4BG9 A;  4DSE A;  1S22 A;  1KQS M;  2ZJR L;  5TKY A;  4OKK A;  1C0M A;  3H08 A;  5KI6 A;  4NLB A;  1SKS A;  4BC4 A;  1RT7 A;  1JJ2 M;  1YUW A;  1B9D A;  1QTM A;  4DTP A;  3M6G A;  1W2B M;  3LM9 A;  5HLF A;  4B3S K;  1ZBI A;  4WF9 L;  1HKB A;  1ESV A;  3TI0 A;  3BUZ B;  4DV6 K;  3EZW A;  4NCG A;  5DMR A;  1NK9 A;  4CW7 B;  1JL1 A;  3M8Q A;  5LJW A;  5I3U A;  4B3T K;  3EE8 A;  2WOM A;  1DLO A;  1CZB A;  2O8D B;  3R3L A;  5AQR A;  1SKR A;  4C8K A;  4DQR A;  1Z25 A;  1RGI A;  3MEG A;  4IFY A;  3CET A;  4HHT A;  2HBK A;  3EY1 A;  3G4S N;  3WXJ A;  3SK3 A;  5T7B A;  4DFP A;  5JS1 A;  4CJP A;  4ELU A;  3D2F A;  4CJS A;  3CM6 A;  4IO8 A;  1YIJ N;  1VSI A;  5K14 A;  4M3T A;  2O4I A;  4CEB A;  3R8E A;  1X9J A;  4AQY K;  1WSH A;  1TAQ A;  3HSC A;  4CGJ A;  3A5M C;  3O6W A;  4DG1 A;  4B9L A;  4FZX C;  1HYZ A;  4B1X B;  3M8R A;  4CEQ A;  4FJG A;  4PKH A;  1XMO K;  4PA1 A;  2KTQ A;  1S9E A;  1RT5 A;  4CZH A;  3OYA A;  2Q0U A;  2D0B A;  3NF8 A;  3VEX A;  3RSE B;  4E7K A;  4DS4 A;  5EOY A;  3VQC A;  1V4T A;  3RMC A;  1GLA G;  2HF4 A;  4E7J A;  5HRR A;  3VOV A;  1EWR A;  4OLB A;  4M3R A;  3H46 O;  3QIP A;  5M1N A;  3C65 A;  1VSM A;  2Z1J A;  2QWQ A;  3NVM A;  1DEJ A;  3D0P A;  3WT0 A;  4BE1 A;  2VWK A;  3LDQ A;  2EWS A;  4CBX A;  1BGX T;  3VQA A;  4DV7 K;  2HNZ A;  2G8F A;  4B1V A;  1N6Q A;  1T3V A;  2IOC A;  3N4Q A;  4GW6 A;  3OYL A;  3HST B;  2QWP A;  4DR1 K;  4QAG A;  3V9U A;  1CXU A;  4F4K A;  2KFZ A;  4WQ5 A;  4BR2 A;  5C25 A;  5MLC Q;  4CEO A;  4K0K K;  4BR5 A;  2LSN A;  3D2E B;  4B1W B;  3WXL A;  5E26 A;  4DQP A;  3CFP A;  2B5J A;  4JKG B;  4M63 C;  3NH1 A;  3O9Q A;  4DHY A;  4LH5 A;  2JLE A;  3PY8 A;  4M3X A;  4C8L A;  1TKT A;  5AQI A;  2WUS A;  4OKE A;  3AO3 A;  4I6M A;  4KH6 A;  1LV5 A;  4CJF A;  4DUZ K;  4MO5 A;  1JLE A;  2F9W A;  1JL2 A;  5BPL A;  1JCF A;  5E84 A;  1H1V A;  1RBV A;  1NM1 A;  1V4S A;  2OYQ A;  1D4X A;  4BDY A;  2BAN A;  3ISN C;  4N76 A;  4W5O A;  3CFR A;  2V7Y A;  3FLC O;  3PX4 A;  4DQ8 A;  3C6A A;  1BA1 A;  3CCV N;  4DV4 K;  2PYL A;  3KVG A;  2O8E A;  3ENH A;  3L4I A;  4PKG A;  4YNQ A;  1VQ8 N;  3HJF A;  4G9Z A;  4CI6 A;  2P1J A;  3F5T A;  2YCH A;  4V19 S;  4B1Y B;  3PO5 A;  4M3Y A;  3AVI A;  2P5G A;  2HND A;  4NXM K;  5FDL A;  3WQU A;  1VQK N;  5HP1 A;  3AVM A;  4IEE A;  2HNY A;  4DLE A;  4JI4 K;  4CGD A;  1LAV A;  2Z1H A;  4DU1 A;  2F9T A;  5M1F A;  4M3Z A;  4BRI A;  1NK8 A;  2P9U B;  2XY8 A;  2O4G A;  4TSX A;  4B1Z A;  2OPR A;  3K0S A;  1JLB A;  5SWM A;  4CHN A;  2ETJ A;  3ENB A;  1EP4 A;  2OTL N;  5AQF A;  3OA9 A;  4CK1 A;  4DB3 A;  4RTF D;  3VQ4 A;  1T7P A;  3C7N A;  3QFP A;  4IOX A;  4BRE A;  2AJQ A;  3SZ2 A;  4BRD A;  5ADX H;  3LDS A;  3AA2 A;  4JD2 A;  1KVB A;  1JLQ A;  1NGE A;  3MMV A;  3JS6 A;  5AQG A;  4LF6 K;  5E41 A;  1HNX K;  1REV A;  4FSV A;  4DR5 K;  1KLM A;  3CMA N;  2A41 A;  4EAH D;  3O3H A;  3VGL A;  2QWN A;  1J9A A;  5M1P A;  3NE6 A;  1OH6 A;  3ZX0 A;  4IJN A;  4CZM A;  3OY9 A;  3L8B A;  2B6A A;  3MN9 A;  4JNE A;  3K58 A;  4HTL A;  4A5B A;  4W5R A;  4OPJ A;  2HHS A;  3MXM A;  1U49 A;  3OYI A;  1T44 A;  2ITM A;  4JKB A;  3LZI A;  4FJ8 A;  3HBT A;  3F73 A;  3E1Y A;  1ZYQ A;  5LY3 A;  1XWL A;  1NU0 A;  1MU2 A;  1KAZ A;  2RHK A;  4O5B A;  5I9E B;  2JWK A;  3Q7C A;  2HHH K;  4IBN A;  5FLX O;  3SUP A;  1X9S A;  5BN9 A;  1K8A O;  3EZ5 A;  3KK7 A;  5KRT A;  1HQE A;  3THW B;  4Z4G A;  4CGI A;  2DTU A;  1NK5 A;  4Z4F A;  4OKJ A;  3BZC A;  1VSF A;  1T03 A;  1TL1 A;  3WNH A;  3LPU A;  3JXU A;  2E88 A;  2ZJQ L;  3MCP A;  3R9P A;  2YV0 X;  4KTZ A;  2BE2 A;  4WE1 A;  4YOR A;  4BDP A;  3P1G A;  3IRX A;  1SKW A;  4W5T A;  5JLH A;  4BRN A;  4DV2 K;  1RT4 A;  3S3M A;  1NOY A;  3KTQ A;  4MDA A;  4MFB A;  2ZM6 K;  2D0C A;  1TUU A;  3HOT A;  2HMI A;  4K8Z A;  2QM1 A;  3VQQ A;  2X6N A;  1QZ5 A;  3FZK A;  2ZWH A;  5AQJ A;  1NMN A;  4DMN A;  4Z4E A;  4OO1 J;  2FSK A;  4ZTJ A;  1M90 O;  3DJC A;  3FZL A;  4J2B A;  4FLU A;  3A5O C;  4YFU A;  2JGU A;  4FO0 A;  4LY7 A;  1BU6 O;  4BRL A;  1ZBH A;  1U47 A;  4FOI A;  3QDK A;  1WAF A;  3ULE A;  3TTF A;  4K42 A;  3P38 A;  3CYM A;  4ISG A;  3QBX A;  5GAE P;  3K2P A;  4KB1 A;  3DXM A;  3NVK A;  5D3G A;  3VQB A;  3OYE A;  3SQ0 A;  3J7A P;  3THW A;  4YHH K;  4U7B A;  2OZM A;  4CHY A;  1J5E K;  3IMX A;  1BHL A;  3NMU A;  4GV6 A;  5KPT A;  1RTD A;  3ZLJ A;  3VGK A;  3AVC A;  1C1A A;  4DTU A;  3BF1 A;  3O1W A;  5HBM A;  1VQ9 N;  1Z05 A;  2HHV A;  3SAG A;  4GNI A;  4LSN A;  2IC3 A;  1JLG A;  2IVN A;  3THX A;  4LF9 K;  1U2V B;  4NYF A;  1IO2 A;  3DWL A;  3P31 A;  1N36 K;  4E1M A;  2P5O A;  4DTN A;  1T6C A;  3CC7 N;  3R6M A;  3DLH A;  4PUO A;  4FWO A;  5HRP A;  1IG9 A;  3ZYY X;  3J7Y P;  1WSI A;  1FXX A;  3KLI A;  4B3R K;  4YY3 K;  1Q86 O;  4DCH A;  4L3Q A;  2DPN A;  4BRO A;  2HHX A;  3O4W A;  4PL8 A;  3DLG A;  4N47 A;  2QWM A;  3V6D A;  3TAB A;  2UXB K;  3MWT A;  4IEI A;  4H5T A;  4ELV A;  4CVN E;  1ILY A;  1WSG A;  2OZS A;  4FJX A;  2FF3 B;  2P9N A;  1G99 A;  2E2N A;  3B6O A;  3CF5 L;  4CES A;  4JI7 K;  1TKX A;  4ICL A;  1NWK A;  4M41 A;  4CIG A;  4BVP A;  1YAG A;  2HBL A;  2WBN A;  4BRK A;  1GLE G;  1X3N A;  3ZSW A;  1RTH A;  2I7N A;  4N41 A;  3UIQ A;  2GUP A;  4O0I A;  5HOO A;  4KHN A;  4BAC A;  1NJI O;  3UKU B;  4GV9 A;  4C8M A;  3SV4 A;  1T8E A;  2CGK A;  4EHT A;  4ID5 A;  1WBD A;  3M1F A;  2ZGY A;  3RR7 A;  4UY8 O;  3T1H K;  3TAM A;  3NF6 A;  2KQ2 A;  1U48 A;  2IS3 A;  2P9K B;  2VGN A;  3AO4 A;  3V1R A;  4DR2 K;  4JKC A;  5J2Q A;  3DLR A;  5HRO A;  5JVG L;  1MWM A;  2DFH A;  3TAN A;  1OH7 A;  1YVU A;  4CJQ A;  4DTS A;  4C8N A;  4PKI A;  5GIO A;  4JRP A;  3A8Y A;  1VSE A;  4FJN A;  4FK2 A;  3O8M A;  4BR7 A;  5AQP A;  4FM1 A;  3J81 O;  2YX6 A;  4CF0 A;  1YXQ A;  4FK4 A;  3ZSX A;  5C12 A;  4H0X B;  2HHW A;  4CZL A;  2YKN A;  1ZBL A;  1NNE A;  1BIZ A;  4CFD A;  3K59 A;  4NYN A;  3V9S A;  2ZE2 A;  3H45 C;  3SPY A;  3E01 A;  3LDO A;  3LDP A;  3I0S A;  3CER A;  4KRF A;  3O3F A;  5AZI A;  4E7L A;  3LP0 A;  4AM6 A;  4LH4 A;  3VEY A;  4OJR A;  4CJV A;  3O9S A;  2HHU A;  3SPZ A;  4EZ6 A;  4H8K A;  1UWB A;  2V52 B;  1S1T A;  1XC3 A;  3P5J A;  3UKR B;  3T7Z A;  4AHU A;  4PHT X;  1ZBU A;  1X3M A;  2P9P A;  3EN9 A;  3JSM A;  4YDU C;  1YIT N;  3TTD A;  1JLC A;  2Q36 A;  4DSJ A;  4XIU A;  4KV8 A;  4CF1 A;  3HRG A;  1QQM A;  4DUY K;  1SUQ A;  3MDQ A;  5CR4 A;  5DM7 L;  1IKW A;  4IDK A;  3ZEU A;  4C23 A;  1XC9 A;  3THY A;  3RSE A;  2D5R A;  4CGF A;  3OS2 A;  2QTD A;  1WB9 A;  4MLH A;  3PSI A;  4JK8 A;  3DXM B;  4JS5 A;  3V81 A;  3VQ8 A;  3O3G A;  4M3W A;  1RDD A;  4JN4 A;  4IOC L;  1GLL O;  5C2D A;  4FZZ A;  2VQF K;  4W5N A;  3LAM A;  3IG1 A;  2GUI A;  1IKX A;  2KKZ A;  4NXN K;  3K9K A;  3SCX A;  3AAQ A;  1Q9Y A;  2DFE A;  3OS1 A;  1NBW A;  4Q5V A;  3OS0 A;  5C15 A;  1ZBS A;  4B3O A;  4CEC A;  3L2Q A;  1JXB A;  2V51 B;  1IG8 A;  1WSE A;  2UUA K;  3DLB A;  4HUE A;  4Y1D A;  1XNR K;  1NGA A;  4J2D A;  1S9G A;  4CHO A;  1WN7 A;  1QE1 A;  1NK7 A;  2FBV A;  5FPM A;  4RW6 A;  5GAG P;  3D2E A;  3CQX A;  5AJ3 K;  3NGZ A;  2FSN A;  4F3O A;  3DOK A;  4HUF A;  1OVQ A;  3P83 D;  5AQH A;  4H0P A;  4ILG B;  2NLX A;  3VPZ A;  4E19 A;  1EKE A;  5CHI A;  3OYH A;  4FJK A;  3MX2 A;  2EX3 A;  3VES A;  1QQC A;  2E1Z A;  4O5F A;  1NLV A;  2CGJ A;  3AVL A;  3EKS A;  3HM9 A;  5AQS A;  3C6T A;  3VER A;  1BOT O;  4E7I A;  3HM8 A;  2ASP A;  1E4F T;  4B9N A;  1C1C A;  3TAR A;  3O08 A;  5HL7 L;  1GLC G;  3H3O B;  5GIP A;  2YKM A;  4KHP K;  2WON A;  2E2P A;  3EE9 A;  2O8C B;  4ILJ A;  3CJC A;  4H5N A;  4JI6 K;  3RTV A;  1HR0 K;  5DK5 A;  4YOY A;  2I7P A;  1KRP A;  3OYB A;  1VQP N;  1XUP O;  1RBR A;  1GLB G;  2HB5 A;  1WUA A;  1DKG D;  3VF4 A;  5SZT A;  2ITG A;  4IWV A;  4CZK A;  1VQ4 N;  4H0V B;  2RPI A;  4QS7 A;  3SQ4 A;  3CME N;  2O8D A;  1UA1 A;  4QOZ B;  4Z4I A;  2E2Q A;  1NJW A;  1W97 L;  4FJH A;  2E20 A;  1BA0 A;  2XY6 A;  3WXM B;  3VQE A;  1QZ6 A;  3HI0 A;  1Q81 O;  3U6F A;  4H0Y B;  3SUO A;  1ZC6 A;  3OYF A;  3AA4 A;  4CJW A;  2F8T A;  3CJA A;  2UU9 K;  4Z4C A;  1TV6 A;  3QNO A;  3PV8 A;  4AHR A;  3TAQ A;  3HVT A;  3W0L A;  4FJM A;  3H6E A;  4KPY A;  4FVU A;  3L3V A;  2A5X A;  3DM2 A;  3NGI A;  3KKS A;  3NBP A;  4PWD A;  4FLX A;  1MA9 B;  3TSU A;  4FJL A;  3TR8 A;  3DXK A;  4A2A A;  1L3S A;  3OYK A;  4MQ3 A;  2Q3S A;  1IH7 A;  3C6H A;  1KTQ A;  3C0B A;  3CJ1 A;  1C6V A;  3HO1 A;  2VG6 A;  2ZGZ A;  2E4L A;  3V1Q A;  4CZI A;  2G8H A;  5EX5 A;  3QB0 A;  4F3T A;  3DLK A;  4Z4H A;  1C0F A;  2OTJ N;  5I42 A;  1LW2 A;  1DGK N;  3BDP A;  3V4I A;  1GOA A;  2VCP A;  3BZK A;  1TKD A;  3CCM N;  1A5X A;  1TK0 A;  2P9S B;  4IOA L;  3SBG A;  5B8H A;  5AZI B;  5KQ8 A;  4O8U A;  1U45 A;  3QER A;  3MK6 A;  4A2B A;  4YOT A;  2Z1G A;  4PQU A;  1W0H A;  3K5L A;  2JWL A;  2FBT A;  3ID6 A;  4QS9 A;  4DLG A;  1LCU A;  3GOI A;  3J8A A;  5CYQ A;  2GWJ A;  4IFE A;  1KXP A;  3ZSV A;  1A5W A;  1HYV A;  2FF6 A;  3SI6 A;  1FW6 A;  4FYD A;  2HBJ A;  4FLZ A;  4CIE A;  1HUX A;  3DXK B;  3PX0 A;  1RFQ A;  2G8K A;  4NB4 A;  4HCB A;  2P51 A;  1XHX A;  1WSJ A;  3LM2 A;  3OYN A;  1K8K B;  4DTO A;  1D5A A;  1JLF A;  3ZSR A;  5CE3 A;  4IJA A;  3SJH A;  4DV0 K;  3V9W A;  3VEW A;  2A1S A;  1Q18 A;  3FZM A;  2Q1N A;  4HWI A;  2VQE K;  4BC3 A;  5BRF A;  3VQ6 A;  4BY9 C;  5LMU K;  4DQI A;  4O8K A;  1FKO A;  3WEE B;  2XO7 A;  4F9O A;  2A3Z A;  4JKE A;  2IGI A;  4H5W A;  5AQY A;  1HNV A;  4E1N A;  4BVO A;  2FSJ A;  5GIN A;  1ATR A;  2YHA A;  4KHQ A;  1NJY A;  4JI3 K;  2O8B B;  4BG8 A;  3ID8 A;  2HOE A;  4LFB K;  2HST A;  1NGH A;  1VSK A;  3SQ2 A;  4JKG A;  2YHY A;  4ISF A;  4CZJ A;  4BR4 A;  3G6E N;  1NJX A;  1NK6 A;  4DFJ A;  4DV1 K;  1SL1 A;  5GAH P;  1BI4 B;  4XH5 A;  2YNH A;  3BGR A;  4I6M B;  5EXW A;  4EP4 A;  1OH8 A;  3TAP A;  1OVY A;  4CFB A;  2QEX N;  3SNN A;  1NGG A;  5AZJ A;  3UKU A;  3CM5 A;  3V9Z A;  2FXU A;  4YDU A;  3AVG A;  1TK5 A;  3NAE A;  3TSQ A;  3VET A;  1JXE A;  3ZCM A;  4HTU A;  3PIP L;  4KHY A;  1KVC A;  2OPS A;  3B6P A;  5AR0 A;  5DM6 L;  1VHX A;  1YT3 A;  4OGC A;  4Z0U A;  3L0Q A;  4G1Q A;  3MXI A;  2XY5 A;  1Z6R A;  3ITH A;  4FJ9 A;  1J6Z A;  4KI4 A;  3KHY A;  1YVN A;  4L8R B;  5LMN K;  2Q97 A;  4B3M K;  5BN8 A;  3CC4 N;  1EQY A;  5CYM A;  3V1O A;  5BRH A;  3SV3 A;  2E8A A;  3W3D A;  3GL1 A;  1NGI A;  3NDK A;  1TUY A;  3NFA A;  1NK0 A;  2IIR A;  4UQG A;  3QEP A;  1NK4 A;  2QK9 A;  4GKK K;  2YJE A;  2EHG A;  1WSF A;  4LF8 K;  4JK9 A;  4YOX A;  5AQM A;  3MCA B;  2X78 A;  1F21 A;  3VEO A;  4BC2 A;  3KLG A;  3ENO A;  3WUH A;  1DTT A;  2CH6 A;  5AZJ B;  3LWM A;  2UYT A;  3ATV A;  1RCH A;  4FJJ A;  1NGF A;  1VQO N;  3MEE A;  1NKE A;  3O4Q A;  1C1B A;  3HP9 A;  3QML A;  3CCU N;  3SQ1 A;  1WAJ A;  2OAN A;  4E1J A;  5J1E A;  2VG7 A;  3KWG A;  4NO7 A;  5FPE A;  3G71 N;  3FGU A;  3HXM A;  4DU4 A;  2D0P A;  5AQK A;  3SAH A;  2W42 A; 
#chains in the Genus database with same CATH homology
 4CE9 A;  4DTP A;  2PY5 A;  3ALY A;  2XHB A;  3AO5 A;  4CER A;  4NCB A;  5HLF A;  3TAN A;  3HL8 A;  2A1R A;  1YVU A;  3NCI A;  4CJQ A;  1QSL A;  4DTS A;  4K8X A;  1ZBI A;  1TVR A;  2YNF A;  3OYC A;  3TI0 A;  4DTJ A;  4ELT A;  4C8N A;  1EX4 A;  4NCG A;  3QIO A;  4AHC A;  4N5S A;  5DMR A;  4JRP A;  1NK9 A;  1TL3 A;  1VSL A;  2FBY A;  3AVJ A;  1JL1 A;  1VSE A;  3M8Q A;  3TAE A;  1L3T A;  2E6L A;  4FJN A;  1BIS A;  1ITG A;  4FK2 A;  5I3U A;  2VWJ A;  1IKV A;  4FM1 A;  4M3U A;  4CF0 A;  4FK4 A;  2WOM A;  1DLO A;  3ZSX A;  1CZB A;  4DWI A;  4I2Q A;  4W5Q A;  4AHV A;  1SKR A;  4C8K A;  2HHW A;  2YKN A;  4DQR A;  1Z25 A;  4BE0 A;  1ZBL A;  3MEG A;  4IFY A;  4DSL A;  1BIZ A;  4CFD A;  3K59 A;  1RTI A;  1UOC A;  4NYN A;  2ZE2 A;  4HHT A;  3V9S A;  3SPY A;  4F2S A;  1CLQ A;  3G10 A;  3E01 A;  3PX6 A;  3EY1 A;  3AA3 A;  5T7B A;  3KD1 E;  4CCH A;  3I0S A;  3RRH A;  4DFP A;  4DF4 A;  5JS1 A;  3WNG A;  4CJP A;  1L5U A;  3F9K A;  4ELU A;  2YNG A;  3O3F A;  4KRF A;  4CJS A;  3CM6 A;  1WNS A;  4E7L A;  3LP0 A;  1VSI A;  4LH4 A;  5K14 A;  2RKI A;  3LZJ A;  4CEB A;  4M3T A;  3HYF A;  3ZT2 A;  2O4I A;  4OJR A;  2D0A A;  2Y1J A;  4CJV A;  1BQN A;  3LAK A;  2HHU A;  3SPZ A;  1WSH A;  4O4G A;  4EZ6 A;  1TAQ A;  1J5O A;  4QCL A;  4H8K A;  1D8Y A;  1UWB A;  4B9S A;  1S1T A;  4EP5 A;  4DSF A;  2ZQB A;  3C6U A;  4DFK A;  3ASM A;  4CGJ A;  3QO9 A;  4DG1 A;  3P5J A;  3KLF A;  1R0A A;  4DFM A;  1RBU A;  1VRU A;  4R5P A;  2PYJ A;  4AHU A;  4B9L A;  4FZX C;  1Y97 A;  1HYZ A;  1ZBU A;  3M8R A;  3I8D A;  2E6M A;  3KKR A;  4CEQ A;  4FM0 A;  4FJG A;  3JSM A;  3VQD A;  4PA1 A;  4FM2 A;  2KTQ A;  4FW1 A;  1S9E A;  1RT5 A;  3OYA A;  4DS5 A;  4IFV A;  4DTR A;  3RMD A;  1JLC A;  4FJI A;  2D0B A;  3FFI A;  3NF8 A;  4FVM A;  5CY4 A;  4KV8 A;  4CF1 A;  4XIU A;  4DSJ A;  1SUQ A;  3S3O A;  4E7K A;  4DS4 A;  4KB0 A;  3VQC A;  3HPH A;  1IKW A;  4IDK A;  3QIN A;  3RMC A;  1J53 A;  2HHQ A;  4FW2 A;  4E7J A;  3S9H A;  1XC9 A;  1VSH A;  5HRR A;  4AHS A;  4CJK A;  4KHS A;  5J2N A;  4J2A A;  2D5R A;  4CGF A;  4FZY A;  4KFB A;  3QNN A;  2G8W A;  2KZZ A;  4OLB A;  2DFF A;  4KTW A;  4M3R A;  3KLE A;  4ZTF A;  3QIP A;  3OS2 A;  3OVN A;  1VSM A;  3MEC A;  1FKP A;  2Z1J A;  4JS5 A;  1VSD A;  3CG7 A;  1KCF A;  3V81 A;  1LWC A;  4CJR A;  3KK3 A;  3D0P A;  3VQ8 A;  3O3G A;  4M3W A;  1RDD A;  3T1A A;  4BE1 A;  2VWK A;  4J2E A;  4FZZ A;  4W5N A;  1RBT A;  1BGX T;  3LAM A;  3VQA A;  4O44 A;  1W9H A;  3IG1 A;  4BDZ A;  2GUI A;  2HNZ A;  2R7Y A;  1IKX A;  2YHB A;  4KI6 A;  2G8F A;  3M8P A;  1U04 A;  1N6Q A;  3SCX A;  1Q9Y A;  2DFE A;  2IOC A;  4GMJ B;  4GW6 A;  3OS1 A;  4Q5V A;  3HST B;  3OS0 A;  3OYL A;  3NHG A;  4BE2 A;  4QAG A;  1KFD A;  1CXU A;  1HPZ A;  1G15 A;  3ZSQ A;  1JXB A;  4CEC A;  3L2Q A;  5C25 A;  1S6P A;  4DU3 A;  2IDO A;  3RRG A;  4LSL A;  4CEO A;  4DQQ A;  1WSE A;  3U3Y A;  1N5Y A;  4HUE A;  3DLB A;  4Y1D A;  2LSN A;  1ASV A;  5KGW A;  4J2D A;  1S9G A;  4CHO A;  3CFP A;  1S5J A;  2B5J A;  1CZ9 A;  1WN7 A;  3G0Z A;  4IG3 A;  3ZSY A;  3NH1 A;  3QES A;  3I0R A;  1QE1 A;  4RG8 A;  1NK7 A;  1I3A A;  2FBV A;  2B4J A;  4RW7 A;  4LH5 A;  2JLE A;  4RW6 A;  3PY8 A;  4CF2 A;  4M3X A;  4C8L A;  1TKT A;  3AVK A;  3NGZ A;  4F3O A;  3KD5 E;  4I9L A;  4OKE A;  1NOZ A;  2QKB A;  2FC0 A;  3DOK A;  3LAN A;  4HUF A;  4RW9 A;  4H4M A;  3AO3 A;  3NH0 A;  3U3G A;  1LV5 A;  2X74 A;  4CJF A;  3P83 D;  1JLE A;  4E19 A;  5EU7 A;  1JL2 A;  4PY5 A;  1EXQ A;  1EKE A;  3OYH A;  2G8V A;  4NCA A;  1RBV A;  4FJK A;  1I39 A;  2EX3 A;  1QQC A;  1QS4 A;  1ZBF A;  2OYQ A;  2NUB A;  3AVL A;  3HM9 A;  1L3V A;  3SJJ A;  4BDY A;  3C6T A;  2BAN A;  3ISN C;  2HHT A;  4N76 A;  4W5O A;  3CFR A;  4E7I A;  4B9N A;  3DOL A;  1C1C A;  3TAR A;  3QET A;  2YNI A;  3PX4 A;  1L3U A;  1B92 A;  2YKM A;  3TWH A;  3L3U A;  4AIL C;  2WON A;  4CK3 A;  2PYL A;  4KTQ A;  4DTM A;  4YNQ A;  3HVR A;  3HJF A;  2KW4 A;  4CJE A;  3MAQ A;  2P1J A;  3RTV A;  4H4O A;  5DK5 A;  2GV9 A;  3SUQ A;  4I2P A;  1KRP A;  2DY4 A;  1S1V A;  3OYB A;  3PO5 A;  4M3Y A;  3AVI A;  4FLW A;  2P5G A;  3ZSO A;  2HND A;  4AH9 A;  1RBR A;  1QSS A;  5C42 A;  5FDL A;  1X9M A;  3VQ7 A;  1D9D A;  2HB5 A;  1X1P A;  5HP1 A;  3OYJ A;  3M8S A;  4CHP A;  3HK2 A;  4B08 A;  3AVM A;  4CHZ A;  5SZT A;  2ITG A;  2HNY A;  3OYD A;  4DLE A;  3RMA A;  4CGD A;  1LAV A;  4ZHR A;  2Z1I A;  2RPI A;  2Z1H A;  4DU1 A;  3SQ4 A;  1EET A;  1UA1 A;  4QOZ B;  4Z4I A;  4M3Z A;  1NK8 A;  1NJW A;  1KLN A;  1LWE A;  2XY8 A;  4CGG A;  2O4G A;  3AV9 A;  3T19 A;  4FJH A;  4TSX A;  1QHT A;  2OPR A;  5C24 A;  1JLB A;  2XY6 A;  2F8S A;  4FJ5 A;  1RT1 A;  4E3S A;  4GVM A;  5SWM A;  4CED A;  5KGX A;  4CHN A;  3VQE A;  2ETJ A;  2Y1I A;  2G8U A;  2BDP A;  3U6F A;  3SUO A;  1BCO A;  1EP4 A;  4FLY A;  2ATQ A;  3ULD A;  4JLH A;  3RWU A;  1RNH A;  1YTA A;  3OYF A;  3K5M A;  4CK1 A;  3AA4 A;  4CJW A;  2F8T A;  3KJV A;  4M45 A;  1A5V A;  4B9T A;  3VQ4 A;  1T7P A;  1KVA A;  4CJL A;  1VRT A;  4DSI A;  2KFZ A;  1Q9X A;  4CEA A;  4Z4C A;  2AJQ A;  3SZ2 A;  1TV6 A;  3QNO A;  3PV8 A;  4AHR A;  2OPQ A;  3LDS A;  3AA2 A;  3TAQ A;  3HVT A;  4Y1C A;  1S1W A;  1KVB A;  4DSK A;  1JLQ A;  4FJM A;  3OYM A;  1C0T A;  1SL0 A;  1RDB A;  1NKC A;  3L3V A;  4KPY A;  3DM2 A;  4O0J A;  3KKS A;  3NBP A;  3VQP A;  5E41 A;  3NGI A;  4DF8 A;  4PWD A;  1REV A;  4CEE A;  4FLX A;  1HMV A;  3KLH A;  4FJL A;  1RBS A;  3TR8 A;  4DTX A;  1RIL A;  3DRR A;  1L3S A;  3OYK A;  4F8R A;  1KLM A;  4MQ3 A;  3KK2 A;  4HUG A;  3K57 A;  3CQ8 A;  2FBX A;  3O3H A;  2Q3S A;  1IH7 A;  3MXJ A;  4LD0 A;  2IAJ A;  2X6S A;  3C95 A;  1KTQ A;  3A2F A;  1C6V A;  1J9A A;  3NE6 A;  3L8B A;  1IKY A;  4CEZ A;  2B6A A;  3OY9 A;  3HO1 A;  2VG6 A;  4BWJ A;  1C0U A;  3K58 A;  1WLJ A;  2E4L A;  1VK0 A;  5KTQ A;  4OPJ A;  4W5R A;  2HHS A;  3LP2 A;  3V1Q A;  3MXM A;  1U49 A;  2G8H A;  3OYI A;  4F3T A;  4AHT A;  3L2V A;  3DLK A;  4CEF A;  4Z4H A;  1B9F A;  4CHQ A;  3LZI A;  4E7H A;  3DI6 A;  3F73 A;  3AVH A;  5I42 A;  1LW2 A;  3AVB A;  4OGE A;  4FJ8 A;  3WNF A;  3AVN A;  3V4I A;  1ASU A;  1XWL A;  1GOA A;  3HPO A;  5CZ2 A;  1ZYQ A;  1TKD A;  3BDP A;  4E89 A;  1A5X A;  1TK0 A;  1KFS A;  1MU2 A;  4O5B A;  3NF9 A;  1U45 A;  1TK8 A;  3QER A;  4IBN A;  2XY7 A;  3PUF A;  1TAU A;  4CFA A;  3SUP A;  2BGG A;  4CJU A;  1RDC A;  1RT3 A;  2Z1G A;  1W0H A;  1X9S A;  4I9Q A;  3EZ5 A;  3K5L A;  3VN5 A;  3HT3 A;  1U4B A;  5KRT A;  5J2P A;  2PZS A;  3DRS A;  1HQE A;  2KFN A;  3D45 A;  1BQM A;  2FBT A;  4DLG A;  4Z4G A;  4CGI A;  3RR8 A;  1NK5 A;  2DTU A;  4Z4F A;  4RW8 A;  1D9F A;  4OKJ A;  3DYA A;  1VSF A;  1T03 A;  5CYQ A;  1TL1 A;  3WNH A;  4CFC A;  3LPU A;  2I5J A;  3ZSV A;  3V9X A;  1A5W A;  1HYV A;  2YV0 X;  1TKZ A;  3SI6 A;  4KTZ A;  4FYD A;  2BE2 A;  3DMJ A;  4WE1 A;  1HRH A;  1JKH A;  5CZ1 A;  4BDP A;  1YTU A;  3LAL A;  3P1G A;  4C8O A;  3AA5 X;  3IRX A;  3KIO A;  4ID1 A;  4W5T A;  4FLZ A;  4CIE A;  4KKO A;  4OPK A;  1SKW A;  1BI4 A;  3PX0 A;  4IKF A;  1RT4 A;  3S3M A;  1NOY A;  2G8K A;  3KTQ A;  4HCB A;  1HNI A;  1LAW A;  4MFB A;  2P51 A;  1S1X A;  1XHX A;  2D0C A;  4CF8 A;  4FXD A;  1WSJ A;  3OYN A;  3LP1 A;  4DTO A;  4FJ7 A;  1RT2 A;  1D5A A;  1JLF A;  3LP3 A;  3ZSR A;  3V9W A;  3HP6 A;  2HMI A;  4K8Z A;  3L2R A;  3VQQ A;  4CJ4 A;  2HW3 A;  1RDA A;  2X6N A;  1JLA A;  2A1S A;  3CFO A;  4DMN A;  1Z26 A;  3NGY A;  4Z4E A;  3VQ6 A;  1HYS A;  4ZTJ A;  4KAZ A;  1FK9 A;  4J2B A;  4DQI A;  4DQP A;  1FKO A;  2XO7 A;  4FLU A;  3NH2 A;  3ZT1 A;  4HVJ A;  2IGI A;  4YFU A;  3SUN A;  2JGU A;  4LY7 A;  3OJS A;  1HNV A;  1KSP A;  3RMB A;  1ZBH A;  2RF2 A;  3THV A;  4E1N A;  1U47 A;  1WAF A;  3OJU A;  2YHA A;  3CYM A;  1NJY A;  3L2U A;  4KHQ A;  4KRE A;  3K2P A;  4KO0 A;  4CK2 A;  4KB1 A;  3K5O A;  4B8A B;  3VQB A;  3OYE A;  3EYZ A;  3QEV A;  3SQ0 A;  5D3G A;  4IG0 A;  4BWM A;  4JS4 A;  1DTQ A;  2OZM A;  4CHY A;  2OPP A;  2G8I A;  1BHL A;  1LWF A;  1BCM A;  1VSK A;  4M42 A;  3VQ9 A;  3SQ2 A;  3TAG A;  4KHU A;  1NJX A;  1CXQ A;  1RTD A;  4FK0 A;  1LW0 A;  5FRO A;  1UA0 A;  3KK1 A;  3AVC A;  1NK6 A;  3LPT A;  4DFJ A;  3IAY A;  1SL1 A;  1VSJ A;  1C1A A;  4DTU A;  1RT6 A;  1BI4 B;  3ZT3 A;  2KZM A;  4KHW A;  2YNH A;  5HBM A;  1NKB A;  1J54 A;  3BGR A;  4EP4 A;  2HHV A;  1XHZ A;  1SV5 A;  4LSN A;  2IC3 A;  1JLG A;  1HQU A;  3TAP A;  3AVA A;  4NYF A;  1IO2 A;  4CFB A;  4F2R A;  4CJ3 A;  3NF7 A;  1GOC A;  4E1M A;  3L2W A;  3QEI A;  3SNN A;  2P5O A;  4DTN A;  4JRQ A;  3S3N A;  1X9W A;  4CIF A;  5HRS A;  3SYZ A;  3CM5 A;  1BL3 A;  3DLE A;  3QLH A;  1BIU A;  3V9Z A;  3AVF A;  4Q0B A;  3TAF A;  3DLH A;  4PUO A;  4PQU A;  3AVG A;  2QXF A;  4FLV A;  1XI1 A;  4B9M A;  5HRP A;  1TK5 A;  1UAX A;  3NAE A;  1IG9 A;  4B9U A;  1WSI A;  1JXE A;  3ZCM A;  1FXX A;  3WNE A;  4B8C A;  3KLI A;  4HTU A;  3PO4 A;  3V9U A;  4KHY A;  1KVC A;  4FLT A;  4F4K A;  2OPS A;  3B6P A;  4HCC A;  3AO2 A;  1YT3 A;  4OGC A;  5HRN A;  4Z0U A;  4G1Q A;  2F96 A;  3MXI A;  1HJR A;  3ZSZ A;  1O1W A;  3O4N A;  2XY5 A;  3DRP A;  1SL2 A;  2HHX A;  3ITH A;  4FJ9 A;  4B3O A;  3DLG A;  4OVL A;  4N47 A;  3QEW A;  4KI4 A;  3V6D A;  3TAB A;  1RTJ A;  1S1U A;  1NJZ A;  4ELV A;  2GBZ A;  4B9V A;  4L8R B;  1WSG A;  2OZS A;  4FJX A;  1ASW A;  3B6O A;  3T3F A;  4CES A;  5CYM A;  3V1O A;  3HPG A;  3SV3 A;  1TKX A;  4ICL A;  1QSY A;  4E0D A;  4M41 A;  3VA0 A;  3ZT0 A;  4RW4 A;  2HVI A;  4N56 A;  4CIG A;  4DQS A;  3MED A;  3NDK A;  4I7F A;  3NFA A;  1NK0 A;  3VA3 A;  4UQG A;  3QEP A;  2RN2 A;  1NK4 A;  3ZSW A;  2QK9 A;  5J2M A;  1RTH A;  1GOB A;  2EHG A;  2VG5 A;  3AO1 A;  3QEX A;  2HVH A;  1WSF A;  5FRN A;  3K5N A;  4N41 A;  3VQ5 A;  3UIQ A;  4CF9 A;  1K6Y A;  5FRM A;  3ZT4 A;  3IS9 A;  2X78 A;  1F21 A;  5KRS A;  3OYG A;  3KLG A;  2QKK A;  4CGH A;  4EZ9 A;  2OA8 A;  4O0I A;  4CJT A;  1DTT A;  2ZD1 A;  5JS2 A;  5HRO A;  3JYT A;  4BAC A;  4KHN A;  1S6Q A;  3LWM A;  4C8M A;  1RCH A;  4FJJ A;  3SV4 A;  3LWL A;  1T8E A;  4ID5 A;  4O55 A;  3MEE A;  1TGO A;  3C94 A;  1NKE A;  3O4Q A;  1C1B A;  3HP9 A;  4DSE A;  2XRI A;  3SQ1 A;  1WAJ A;  4CJ5 A;  4FCY A;  3RR7 A;  4OKK A;  5J1E A;  1C0M A;  2VG7 A;  3TAM A;  3H08 A;  3NF6 A;  5KI6 A;  4OLA A;  2KQ2 A;  1U48 A;  2IS3 A;  3AO4 A;  1Q8I A;  3V1R A;  3HXM A;  1SKS A;  5J2Q A;  4DU4 A;  1RT7 A;  3DLR A;  1B9D A;  1T05 A;  2W42 A;  1QTM A;  2DFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...