3NH1A

Crystal structure of rnase t in complex with a preferred ssdna (tagg) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
b'NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 59
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh1A00
3L2VA 3VQ5A 1RT7A 4QAGA 4ZHRA 2P5OA 2EHGA 4DTMA 3V4IA 4DLEA 3V6DA 3VQDA 3ZSRA 2JGUA 1A5VA 1RT5A 2Z1JA 3ZSWA 3ZT4A 4CHNA 4DQIA 3NF8A 4KO0A 3NGYA 2DFFA 3LWLA 4E1MA 4MFBA 3RR7A 4EZ9A 1Z25A 3VQ4A 1KVAA 2VG7A 3ULDA 4OGCA 4E7KA 3O3HA 4DSFA 4DTXA 3IAYA 1S9EA 3C94A 4AHRA 5HRSA 3OYIA 3V9SA 3V9WA 3OYBA 4CERA 3QEPA 1WAFA 2D5RA 3AVMA 3VQCA 3V81A 2RN2A 4FLTA 3CM6A 4OKEA 4JRQA 4J2AA 4CESA 4HTUA 4L8RB 2X78A 4K8ZA 2ETJA 1ZBLA 1HYSA 1L3UA 2A1SA 3DMJA 1JL2A 1C1AA 3KJVA 2IAJA 3THVA 3O3FA 1CXQA 4H4OA 1NJZA 4CHZA 1N5YA 3WNHA 3DI6A 1U45A 4DSLA 2HHQA 2KZMA 1TKTA 4AH9A 2RF2A 1W9HA 3KLEA 1XC9A 1S6PA 4DTJA 3QNNA 4IFYA 4CECA 4CJWA 3QEIA 4F4KA 3SQ1A 3DYAA 1S6QA 2FC0A 4CJQA 2PY5A 3AVFA 3L3UA 5SWMA 3QLHA 1L3SA 4C8MA 3SUQA 1KCFA 4M3YA 2VWKA 4O0JA 4AHUA 3RRHA 4M42A 3OYGA 3LPUA 4HUGA 5D3GA 1RT1A 4IG0A 3V1QA 4LD0A 3KTQA 1BCMA 1D5AA 3SUPA 4KHYA 2HVIA 1SKWA 1C0MA 1DLOA 4LH5A 4DTPA 3DOLA 4DF4A 1RCHA 2ZD1A 1D8YA 1KSPA 4OJRA 3H08A 4KV8A 4ZTFA 1VSMA 3O4QA 2F96A 4CJRA 4I9QA 3KK2A 1KFSA 4CF8A 3WNGA 3MXJA 4CEDA 4KREA 5HRPA 3OYHA 5KGWA 3PX0A 3ZCMA 2KZZA 4DLGA 3TAQA 4CJ4A 3IG1A 3EZ5A 3P5JA 4C8OA 2HNDA 4CFCA 4M45A 3DLHA 1J53A 4KHWA 4DG1A 3L3VA 4PA1A 3QEVA 3LP0A 4BACA 2FBTA 4DQSA 3OYCA 1NJYA 3M8RA 4CF9A 5EU7A 2I5JA 4CF0A 5HRRA 1TKDA 1NOYA 3KKRA 3LALA 3KKSA 4I2PA 4CIEA 4CK2A 1N6QA 2G8UA 2PYJA 4O4GA 1QTMA 1WNSA 2RKIA 4K8XA 3TANA 4CEZA 2FBVA 1HRHA 1RT4A 1VSKA 3AVCA 4DU4A 1T03A 2G8HA 4OPKA 4FJ8A 1FK9A 4F3TA 1FXXA 4H8KA 4FLYA 4FLZA 3CM5A 1C1BA 1SKSA 4DQPA 3S3MA 3O4NA 3ZT0A 1QHTA 1UOCA 4CJVA 1KRPA 4IKFA 2QKBA 1XHXA 3NFAA 4CGHA 2ZE2A 1JLQA 1IO2A 4UQGA 1KVCA 3OYJA 3KLFA 3K2PA 2ZQBA 3NDKA 1HPZA 4B9SA 4E0DA 3G10A 4OGEA 2BANA 5J2QA 2HHXA 1RBSA 3T3FA 1NK6A 3E01A 3CFPA 4GW6A 1J5OA 4DTRA 4Z0UA 4KB0A 3LP2A 4H4MA 3U3GA 3EY1A 4KHSA 2G8FA 1CZ9A 1SL1A 3L2RA 4OVLA 2DFHA 4LY7A 1LAWA 4FK0A 1FKOA 3TAGA 3AVHA 1HQEA 4FM2A 5CYQA 3TWHA 4BDPA 3PY8A 1FKPA 4OLAA 4LSLA 2XRIA 2YKNA 4CHOA 4CFDA 4Y1DA 3WNFA 4CGDA 3NH1A 3DM2A 1U4BA 4FJGA 4FYDA 3RMAA 1SL2A 2HW3A 2KFZA 4KKOA 3DLRA 1ZBIA 2Z1HA 3DLGA 5K14A 5J2NA 2GUIA 3OVNA 3HO1A 4B9TA 1RILA 3C6UA 3LP3A 4CJUA 4HVJA 3KK3A 3HM9A 2E6MA 4FLUA 4PQUA 1QE1A 3SQ2A 3ZSYA 4NCGA 2PYLA 4M41A 4Z4CA 4FJ7A 3PV8A 4IG3A 1L3TA 1Y97A 4J2EA 1HMVA 2QKKA 1JLGA 3NH0A 1WN7A 4GMJB 3S3OA 1TK5A 4ELVA 1BQMA 1HQUA 1VRTA 4PUOA 2QXFA 3AO2A 1NKEA 3L2UA 1TL3A 1YTUA 1NOZA 1F21A 4HUEA 4FM1A 1RBUA 3TI0A 3K5NA 2XY5A 2XO7A 1I3AA 3V1OA 4NCAA 4AHSA 1QS4A 1T05A 3DLEA 4LH4A 1JKHA 2WONA 2B6AA 3I0SA 4CF1A 3I8DA 1T8EA 3TAPA 4DTUA 3DRSA 3SYZA 5E41A 3MXMA 3EYZA 4KHQA 1RDBA 4FLVA 3NF6A 4CEOA 4HCBA 1VSEA 1KTQA 3D0PA 1D9FA 4DS5A 1GOAA 4CCHA 3KK1A 3HVRA 3M8SA 1VSJA 1ASVA 4JRPA 3K5LA 4N41A 4E19A 1VSFA 4CEQA 1NJXA 4CJKA 4CIFA 2Y1IA 3PX4A 1TAQA 3PX6A 4C8NA 1JLEA 3KIOA 4Q5VA 1X1PA 1JLFA 3ZSOA 4NCBA 1U49A 3DLBA 4OKJA 1VSLA 2YNGA 3OYDA 3LDSA 1TKZA 3KLGA 3NAEA 1LV5A 3F73A 3RR8A 3AO5A 1IH7A 3AO3A 3LP1A 1TVRA 3PUFA 4FJ9A 4W5NA 3ZT2A 5FRMA 1BI4B 1XWLA 2LSNA 1Q9YA 2O4IA 3VQEA 3JYTA 4J2BA 2KTQA 3M8PA 3HPGA 2OYQA 4J2DA 3CFOA 3VQAA 3HP9A 3ZT3A 3U3YA 4QOZB 2HNYA 2IS3A 3QEWA 1WSGA 3T19A 4FW1A 1TK8A 1LW0A 1B9DA 4M3TA 1CXUA 5DK5A 3BGRA 4OKKA 1LWEA 3K5OA 4ELTA 2O4GA 3SUNA 5KRTA 4B8CA 4RG8A 2P5GA 3BDPA 4CFBA 1S9GA 1O1WA 2G8KA 1BGXT 3ZSVA 1BIUA 2YKMA 3MEEA 4NYFA 3RWUA 1ASUA 2YHBA 2Q3SA 4F8RA 3VQPA 3VN5A 4DFKA 1WSHA 1RBVA 4B9UA 4ID1A 5JS2A 3OYKA 3NE6A 3SCXA 1JXBA 2D0BA 4RW4A 4FZYA 3ZSQA 3SPZA 4FXDA 3AVBA 1JL1A 2E6LA 3C95A 2HHTA 1VSHA 2DY4A 4Q0BA 3LAMA 4KAZA 2QK9A 2F8TA 4N56A 3AV9A 3SV4A 3C6TA 4CHPA 4RW8A 4CJTA 2X6NA 1HJRA 3TAMA 4BE0A 3ISNC 4CF2A 4C8KA 4Z4EA 1B9FA 3KD1E 1VK0A 3OYMA 2IOCA 1LW2A 2Z1GA 3OYNA 3V9UA 1SUQA 2OPQA 4HUFA 3NF7A 4AHTA 1JLBA 5CYMA 4NYNA 5HP1A 4ZTJA 2F8SA 4KRFA 4E7JA 4HHTA 1ITGA 1JLAA 4YFUA 3SJJA 3MXIA 1KLNA 2OA8A 1BHLA 1XI1A 1JXEA 3DRRA 3HPHA 4CJEA 4DF8A 1YVUA 4OPJA 3V9XA 1EP4A 4CJ3A 1UA1A 2VG6A 3ALYA 2IC3A 1XHZA 1YT3A 1A5XA 1RTIA 1S1XA 1EETA 4ICLA 1WSJA 4PY5A 4LSNA 4CGIA 3L2WA 4BWJA 2RPIA 1U47A 2XHBA 3SZ2A 4I2QA 3OYEA 4Z4FA 1CLQA 3NH2A 1SV5A 4RW6A 4M3RA 3SI6A 2WOMA 4EP5A 3O3GA 1WSIA 3NGIA 4DS4A 2KQ2A 1K6YA 5C25A 4HCCA 1LWFA 4W5RA 1NK7A 3VA0A 5HLFA 4E1NA 1SKRA 3I0RA 2IGIA 4FK2A 4Z4IA 1S5JA 3B6PA 2YNIA 3AA2A 3CFRA 4KB1A 4Y1CA 4E3SA 1RDCA 4MQ3A 4FJMA 4CJFA 5FRNA 3PO4A 3AVNA 2KW4A 1NK9A 5CZ2A 4DSEA 4ELUA 1C0TA 2YNFA 3AVGA 4F2SA 2HVHA 3K59A 4IFVA 1TAUA 2NUBA 2D0CA 3VQ6A 2YNHA 1W0HA 3QINA 3OYFA 4DFJA 3TAFA 2HMIA 4FZZA 1U04A 4W5TA 4E7IA 1NK4A 4W5QA 1IKVA 4FJ5A 1R0AA 4CK3A 1TV6A 3VQ7A 4CGFA 4B9VA 3K58A 4B9NA 5HRNA 3IS9A 4KI4A 1RT2A 2FBYA 3V1RA 3ASMA 2YHAA 3TAEA 3HSTB 1S1VA 3M8QA 4DTNA 3ZSXA 1EKEA 3K5MA 2HHVA 3K57A 3AA3A 3PO5A 1RBRA 3G0ZA 4FJIA 3HK2A 5KRSA 3QERA 4DTOA 1C6VA 2A1RA 1YTAA 3QESA 3OJUA 2IDOA 2PZSA 1C0UA 1C1CA 1EX4A 1TL1A 4IDKA 4CEAA 4BE1A 3TABA 4FJKA 1ASWA 1UA0A 3MAQA 1NKBA 3SQ4A 1RTJA 3SQ0A 4KI6A 4CGGA 1LAVA 3AA4A 3CYMA 4O44A 4ID5A 1L3VA 2X74A 3VQ9A 3WNEA 2BDPA 3OY9A 5I3UA 1KVBA 4JLHA 3VQQA 4DFPA 1Z26A 1L5UA 4B9LA 2BGGA 4OLBA 5C24A 1LWCA 4DSJA 5CY4A 3RRGA 2ITGA 1S1UA 4AHCA 2OPRA 1IKWA 4E7HA 1GOCA 1Q8IA 3T1AA 2DFEA 3U6FA 3TARA 4EZ6A 2BE2A 2HHUA 2FBXA 2HB5A 4DU1A 4FLXA 2OPPA 3AVIA 3HJFA 1X9WA 4M3ZA 3LZIA 3AVKA 4JS4A 3RMBA 2HNZA 4I9LA 3OJSA 3D45A 3JSMA 4TSXA 2ATQA 3QETA 3MECA 1J54A 1RTHA 1QSYA 4B9MA 3SUOA 3OYLA 1TKXA 4B8AB 2OPSA 2R7YA 1MU2A 3V9ZA 4EP4A 1X9SA 3MEDA 4FZXC 3DRPA 4BE2A 2EX3A 2D0AA 1RNHA 4RW9A 4DMNA 3SPYA 1RT3A 3S9HA 4DSIA 1HYZA 4M3XA 3QIPA 1BL3A 5J1EA 3FFIA 2X6SA 3CG7A 5DMRA 3OS1A 3B6OA 3QIOA 1BQNA 4WE1A 3QO9A 1EXQA 4Z4HA 3L8BA 5SZTA 4DU3A 3LPTA 4W5OA 3SV3A 1J9AA 3HVTA 1VSDA 3RMCA 2Y1JA 4FJHA 3ITHA 1ZBFA 1S1WA 4DSKA 4CJSA 4FJJA 2B5JA 3P1GA 4O55A 3HP6A 2B4JA 4FJLA 1D9DA 1WLJA 3KD5E 2Z1IA 3QEXA 3L2QA 2XY7A 4QCLA 1DTTA 4G1QA 2GV9A 5KI6A 4CJLA 2AJQA 1IKXA 5HROA 3MEGA 1RT6A 4E7LA 4CK1A 3S3NA 4CJ5A 4JS5A 1NJWA 2GBZA 1RTDA 2OZSA 3DLKA 4O5BA 3VQ8A 4N5SA 2XY6A 2G8WA 1BCOA 4FK4A 3HYFA 3OYAA 4N76A 1UWBA 5HBMA 1KLMA 4CEEA 3NBPA 4IBNA 1ZYQA 3HXMA 2W42A 4FCYA 1GOBA 4DFMA 1VSIA 2JLEA 4BDZA 3AVLA 3SNNA 1TK0A 3ZSZA 4I7FA 1A5WA 3LZJA 3A2FA 1REVA 4F2RA 1TGOA 3QNOA 5I42A 2KFNA 4FLWA 3HT3A 4AILC 4Z4GA 4M3WA 3HL8A 4CHYA 1Q9XA 4KHUA 1S1TA 1ZBUA 4FJXA 4FW2A 3NCIA 4KTQA 1U48A 1NK5A 1BIZA 4FVMA 4N47A 3DOKA 3OS2A 1CZBA 4BDYA 4CEFA 2VWJA 3UIQA 2XY8A 5JS1A 3AA5X 1HNVA 1QSLA 2DTUA 5FROA 1BISA 1QSSA 1NK8A 4M3UA 4DQQA 4XIUA 5J2MA 3RTVA 4KFBA 4CGJA 4B08A 2G8VA 1WSEA 3P83D 1T7PA 4KPYA 2HHSA 4C8LA 1HYVA 1DTQA 1I39A 4CHQA 4CFAA 1QQCA 4AHVA 1NKCA 1ZBHA 3NHGA 5FDLA 4O0IA 5J2PA 1RBTA 4CE9A 3F9KA 3LANA 4FM0A 1SL0A 3LAKA 3NGZA 1WAJA 3OS0A 4R5PA 1WSFA 5C42A 3RMDA 4RW7A 3AVAA 4BWMA 3IRXA 2HHWA 3VQBA 1NK0A 3NF9A 1X9MA 3ZT1A 2YV0X 1HNIA 5CZ1A 2G8IA 1G15A 4KTWA 4E89A 3KLHA 3LWMA 4KHNA 4PWDA 1IKYA 4GVMA 1BI4A 2VG5A 3VA3A 1RDAA 4DQRA 4F3OA 4YNQA 2P1JA 4CEBA 1VRUA 3AVJA 4CJPA 2P51A 2OZMA 3AO4A 3TR8A 1B92A 3AO1A 4FJNA 3CQ8A 4KTZA 5KGXA 4CIGA 4DTSA 2E4LA 1JLCA 1IG9A 4DWIA 1KFDA 5T7BA 4B3OA 1UAXA 3KLIA 5KTQA 1RDDA 3HPOA
chains in the Genus database with same CATH superfamily
1RT7A 2P5OA 4DTMA 3V4IA 3VQDA 3ZSRA 3R1XA 1A5VA 1RT5A 5H1SQ 3J81O 4HTLA 5EY4A 1K8AO 4YOUA 4M7XA 4BR5A 4JV5K 3VQ4A 2GWKA 3O3HA 3LM9A 3V9SA 2QXLA 2D5RA 2QWLA 1QQOA 4CESA 4L8RB 2X78A 3G71N 2A1SA 3UKUB 4JEPA 1MWKA 4FSVA 1N5YA 3WNHA 4DSLA 4AH9A 5FPDA 4BVPA 1ATRA 4CECA 4CJQA 1S6QA 1WBBA 4BRCA 4DR6K 1P90A 3N4PA 5SWMA 3TTFA 5B8HA 3CJCA 3SUQA 1HR0K 4M3YA 2Q1NA 4M42A 1YITN 1XC3A 1D5AA 1TYQA 3C6AA 3O08A 3SUPA 1SKWA 4KHYA 4FL9A 4DTPA 1QQMA 1MWMA 3O4QA 2F96A 4CJRA 1KFSA 2YHXA 3WNGA 3T69A 4JHDA 3TAQA 4CJ4A 3EZ5A 1J53A 1NGJA 2BUPA 4DG1A 3CI5A 3L3VA 4DQSA 5KPZA 1NJYA 3M8RA 4CF9A 4CF0A 1NOYA 3KKSA 4I2PA 4EAHD 1YJWN 2PYJA 5AQHA 3ZX3A 2D0PA 4CEZA 4DU4A 1HRHA 2G8HA 3H3NO 1WUAA 3TU5A 2QWNA 3CM5A 3ENBA 3R6MA 2BH1A 3TSUA 2P9KA 5ADXA 3S3MA 1QHTA 1ILYA 1XHXA 2ZE2A 1JLQA 1HKGA 3MX2A 3KLFA 3EEQA 3G10A 2BANA 1RBSA 5BPNA 1TYQB 3F2KA 4GW6A 3SAHA 4Z0UA 5BPLA 4H4MA 4BRAA 1VHXA 4BRFA 4UY8O 4BGBA 3C0BA 4JHDB 3TWHA 5M1KA 3PY8A 5HL7L 1T6DA 2XRIA 2YKNA 1DT9A 4CFDA 4CGDA 1X3MA 3A5LC 1VQKN 4C1NK 4BRDA 1ATNA 1GLJO 3VEYA 4A5BA 2GUIA 5C2FA 4B1ZA 4B9TA 4FLUA 5BR8K 4FJ7A 3PV8A 1KD1O 4J2EA 1JLGA 4ELVA 1BQMA 3CQYA 4PUOA 3AO2A 1NKEA 2ZJPL 4IOXA 2E20A 2P9KB 2XY5A 4BY9C 2FSJA 1JKHA 2B6AA 3I8DA 3MWTA 4KHQA 2WTUA 3BZKA 1HX1A 5AZIA 4HCBA 1KTQA 4DS5A 4XH5A 2RHKA 3HVRA 1VSJA 2UUCK 3VERA 4JRPA 3K5LA 4E19A 5AQJA 1EWRA 4R79A 4CEQA 2UU9K 4CIFA 2Y1IA 3PX6A 1JLFA 3DLBA 3LP1A 2V51B 3CCEN 1E4FT 1YVNA 2LSNA 2O4IA 2VCPA 3HPGA 1U6ZA 1ZXOA 3CFOA 5FPNA 3L6QA 3U3YA 1HLUA 4BR9A 3T19A 2VGMA 1B9DA 2HHHK 1LWEA 1Y64A 5KRTA 4RG8A 3CQXA 4CZLA 3MEEA 2FLOA 5AJ3K 3AGRA 4F8RA 4B9UA 4ID1A 5JS2A 5AQSA 3NE6A 1JXBA 2D0BA 4JD2A 3ZSQA 2NRRA 5AZIB 3AVBA 4GY2B 1DGKN 3VF2A 3AV9A 5KPTA 3C6TA 1JJ2M 5EOYA 1BA1A 4NXMK 5HOOA 1QVFM 4CJTA 1EO1A 2X6NA 3ATVA 3TPQA 3TAMA 4C8KA 1VK0A 3OYNA 2ZJQL 2OPQA 3CHWA 4HUFA 4AHTA 4NYNA 4ZTJA 3CERA 1ITGA 1JLAA 3SJJA 1XI1A 5C10A 1YVUA 4BRHA 1EP4A 3JXUA 3KZBA 1A5XA 1RTIA 1S1XA 4ICLA 3S41A 4BWJA 4I2QA 1CLQA 4X66K 3UB5A 5GAHP 2QWMA 3F5TA 4EP5A 3O3GA 3NGIA 2KQ2A 5C25A 4B1VA 1LWFA 3HRGA 5HLFA 4FK2A 3EE8A 1YIJN 4JD2B 2VGNA 3O1WA 1RDCA 3PO4A 3AVNA 1NK9A 4DSEA 2FSNA 1C0TA 3AVGA 4IO8A 4F2SA 3K59A 2D0CA 3P31A 1W0HA 1NK4A 1V4SA 4W5QA 1TV6A 3VQ7A 4B9VA 3VF6A 4JKGA 4K43A 1Z6RA 3CCUN 2P9SA 4ILGB 1OH7A 3CC7N 1EKEA 1BUPA 5FLXO 3U9DA 1RBRA 3G0ZA 3DAWA 4K42A 2YI1A 4DTOA 3O9QA 4JYAK 3WXIA 4BRGA 2IDOA 2PZSA 1C0UA 1NJIO 4CEAA 4OPHA 3BP8A 4WQ4C 2CH5A 3TABA 3MAQA 3SQ4A 2F4VK 1M1KO 4KI6A 3WQUA 4CGGA 4O44A 4ID5A 3ID6A 3JAMO 3QMLA 5I3UA 3VQQA 3L0QA 1Z26A 2D0OA 5C24A 2ASPA 3RRGA 4AM6A 4IXCA 3IUCA 4AHCA 1IKWA 4E7HA 2DFEA 3TARA 2BE2A 5M1FA 4DV5K 2OPPA 3LZIA 3O9SA 3AVKA 4J8FA 4TSXA 5GIPA 1VQ7N 1J54A 4JKGB 3A5MC 4F9OA 1GLBG 4B8AB 2OPSA 3U9ZA 2R7YA 1MU2A 2P9SB 4FZXC 3DRPA 1RNHA 4DSIA 3S9HA 4M3XA 3FFIA 5DMRA 3OS1A 1FW6A 3QO9A 4LF6K 3LPTA 4W5OA 4BR7A 4H5NA 2Y1JA 4X62K 4BRLA 2B5JA 3P1GA 2O8DA 4FJLA 1D9DA 3HI0A 4IEIA 3QEXA 1HNXK 2XY7A 3DXMB 4LF8K 4NO7A 5KI6A 3WUHA 3M1FA 4CK1A 4JS5A 1KXPA 3DLKA 2XY6A 4DR7K 4JNEA 1KLMA 3VGLA 2ZJRL 1NG9A 5GAEP 1A5WA 4CD1A 4F2RA 3QNOA 2NRXA 3CCVN 4M3WA 1Q9XA 1S1TA 4FW2A 5EVZA 3BZCA 2WFBA 1BIZA 3F9MA 3T7ZA 3RVCA 3UIQA 5BRDA 3AA5X 2DTUA 4RCHA 5FROA 1NK8A 1VQON 5J2MA 4YHHK 4CGJA 3J8AA 4CBUA 2QWOA 2O8DB 1HYVA 2HSTA 4KH4A 4AHVA 4H0XB 1H1VA 1GLEG 1SL0A 3VEZA 3NGZA 4FWMA 1WSFA 4BRKA 2EWSA 4LF7K 3VQBA 1NK0A 1IG8A 3ZT1A 1Q86O 2W6LA 4CI6A 4PWDA 1BI4A 1RDAA 4LF9K 4JI3K 4F3OA 2QWRA 4FWLA 3QB0A 2OZMA 2YHWA 3VGKA 4KTZA 4CZGA 1KFDA 3KLIA 4DHYA 3VETA 3L2VA 5AQYA 2NNWA 4DLEA 3V6DA 1RFQA 2JGUA 2Q0UA 3ZSWA 4CHNA 4BC3A 4DQIA 3NF8A 1DEJA 4JI6K 3RR7A 1Z25A 4Z94A 4YORA 4OGCA 3IAYA 3C94A 2OTLN 2I7PA 1L3UA 4C1NI 3O8MA 1JL2A 3E66A 1SAZA 4H0PA 4DV3K 4CHZA 4IFEA 3D2FA 1RGIA 1XC9A 1S6PA 4WQ4A 4CJWA 2PY5A 5MLCQ 4C8MA 2VWKA 4O0JA 5AQNA 2WBNA 4JKAA 3LPUA 3QBWA 4C23A 3KTQA 2HVIA 2P9IB 1C0MA 1DLOA 3DOLA 3WXJA 1RCHA 1D8YA 3H08A 4EFHA 4I9QA 4B9QA 3KK2A 4CF8A 4KREA 5HRPA 4WYBA 5JLFA 2KZZA 3ZLJA 2KHOA 4C8OA 2HNDA 4M45A 3H45C 2IVPA 4MDAA 5AQPA 1VQ4N 4JKBA 4PA1A 4BVOA 3OYCA 5BRHA 5EU7A 2I5JA 3OTOK 1TKDA 4CD3A 1HKCA 4CK2A 1VAZA 4CIEA 1GLDG 1N6QA 4O4GA 1NGGA 3U4LA 1HYSA 2A40A 1VSKA 5ADXH 4F3TA 4OPKA 1FXXA 4JI0K 3CC4N 4IJAA 3D2FB 3QBXA 1C1BA 3O4NA 5LL6Z 4B1YB 4M63C 4UQGA 2ZQBA 3NDKA 2DPNA 2O8FA 4OGEA 5AQLA 3CFPA 3LP2A 3U3GA 1IBMK 4JI5K 2G8FA 2HBJA 5AFUA 4DV6K 5LMUK 4OVLA 2DFHA 2ASOA 3MDQA 3GOIA 3LL3A 4FWSA 4BDPA 1FKPA 3W0LA 4Y1DA 1U4BA 5GIOA 3SBGA 3DLRA 5C15A 4JI1K 3HO1A 1C0FA 1RILA 3C6UA 3LP3A 3HM9A 4PQUA 3CCLN 3OBYA 1QE1A 5F1XA 3ZSYA 2PYLA 4Z4CA 5BRFA 2YJFA 1Y97A 1RDUA 1HMVA 3SMSA 3R3LA 3QICA 4O8UA 4WFNL 3VTIA 1VRTA 1K8KA 3H1VX 4GNIA 1F21A 1GLLO 4HUEA 3TI0A 2XO7A 1I3AA 2P9LB 1QQNA 4CF1A 2WONA 1T3VA 3I0SA 3TTDA 2GELA 3TAPA 4DTUA 3SYZA 4CVNE 4JKCA 3EYZA 2O8FB 5IWAK 1OVYA 4FLVA 4B3MK 1P8ZA 3PSIA 1D9FA 4CCHA 1NGFA 3LDOA 3PIPL 1NJXA 1TAQA 3RSEA 2NZTA 3CCJN 1OKJA 1JLEA 2QW9A 3KIOA 3ZSOA 4OKJA 5FPEA 2YNGA 3BEXA 5AQZA 1VQLN 3KLGA 3F73A 1GLFO 3C65A 3RR8A 3PUFA 4J2BA 3M8PA 2OYQA 5M1QA 3HP9A 3SMPA 2HNYA 1NM1A 3QEWA 4BR0A 2IVOA 1CXUA 5DK5A 5AQKA 3K5OA 3FZLA 2UXBK 3TSQA 4DR2K 4B8CA 4HWIA 4QS7A 1S9GA 4B3TK 2ITMA 3ZSVA 1BOTO 3RWUA 1ASUA 3FZMA 2YHBA 2Q3SA 3O1BA 2GUPA 2A41A 4DFKA 2ZWHA 3P38A 1RBVA 4OX9K 4FZYA 3HOTA 3SPZA 1JL1A 1VSHA 4KAZA 2QK9A 4N56A 1TUYA 3RSEB 1NLVA 3ISNC 4Z4EA 1B9FA 4M7YA 3CMEN 1JLBA 3SK3A 4KBOA 3PIOL 4KRFA 4YFUA 1KLNA 2OA8A 1NGIA 3DRRA 4H5VA 1UA1A 1YHQN 1C0GA 3ALYA 4WQ5C 1EWQA 1EETA 4LSNA 3L2WA 2HF4A 2XHBA 3SZ2A 1QVGM 4BQLA 4A62A 3BUZB 1J5EK 1K6YA 2OANA 3G6EN 1NK7A 3VA0A 1SKRA 3WT0A 3B6PA 3CFRA 4CZMA 4Y1CA 4MQ3A 5FRNA 2KW4A 5TKWA 2HVHA 1DKGD 3D6RA 1S3XA 3R8EA 4EHUA 2NRZA 4DFJA 3TAFA 1YF5L 2NRHA 4FJ5A 4ISFA 3EN9A 2UUBK 5E26A 3K58A 4FOEA 1BDGA 3A5OC 5HRNA 1FJGK 2KLAA 3LDNA 1RT2A 3ZX0A 2YHAA 3TAEA 2ASMA 1S1VA 3M8QA 3ZSXA 3K5MA 1NMDA 3SBTA 3K57A 3AA3A 3WXLA 3QERA 2A1RA 1YTAA 5TKYA 1C1CA 4IDKA 4KH5A 3CMAN 1UA0A 3FZKA 3HTVA 3SQ0A 1IBLK 3KVGA 3CYMA 4DV4K 2BDPA 4K0KK 4JLHA 1SQKA 3CPWM 3FE1A 2VQEK 2OPRA 3GBTA 2HHUA 1MDUB 2HB5A 1KAXA 4DKWA 4FLXA 3AVIA 3HJFA 4M3ZA 1XNQK 4JKDA 4A5AA 1EQYA 2ATQA 4B9MA 4FWOA 4YOWA 3V9ZA 2F8SA 5JS1A 3SPYA 1Q81O 1RT3A 1HYZA 2NRWA 2X6SA 3CG7A 4FOIA 3B6OA 3QIOA 1EXQA 4Z4HA 3L8BA 4DU3A 3RMCA 1S1WA 1ZBFA 1WBDA 4CJSA 3U8XA 4FJJA 4O55A 3HP6A 4CW7B 2Z1IA 3TTCA 5CHIA 4JKHA 2W6KA 3KK7A 2NRTA 1I94K 4YDUC 3MEGA 3Q7BA 4EIAA 4E7LA 4CJ5A 1VQ8N 4O5BA 2G8WA 5HBMA 5GADP 1ZYQA 3HXMA 4DFMA 3AVLA 1TK0A 4LFCK 3ZSZA 3A2FA 3HT3A 3HL8A 4KHUA 1ZBUA 1N32K 3E9LA 3QFPA 3JS6A 1NK5A 1S72N 4FVMA 4LF5K 2VWJA 1QSLA 4A57A 3CIPA 1QSSA 2GWJA 4DQQA 4MDBA 4B08A 2G8VA 1T7PA 4KPYA 3THXA 4CHQA 1IV0A 1QQCA 3C7NA 4O0IA 4WQ5A 3LAKA 1WAJA 3MX5A 3AVAA 3VTHA 2YHYA 4I6MA 4BRQA 1G15A 4E89A 3LWMA 3KLHA 3VA3A 4CEBA 1VRUA 3AVJA 3MMVA 2FF3B 1XMOK 3CQ8A 3T1YK 1IG9A 1JLCA 4BR2A 4RTFD 3J7AP 3KWGA 1RDDA 3HPOA 1QZ6A 4ZHRA 4A2AA 4JI2K 1LOTB 3ZX2A 3ENHA 3VENA 4KO0A 4LFAK 3NGYA 1VQ9N 4B3SK 2DFFA 4WFAL 1KVAA 4DTXA 4DSFA 1S9EA 1CZAN 3OYBA 4CERA 3VQCA 3V81A 2RN2A 3CM6A 4OKEA 4JRQA 4IDHA 4B3RK 4HTUA 3THXB 3SAFA 3FFKB 1ZBLA 3HBTA 3DMJA 4WCEL 1C1AA 4GV3A 2IAJA 2QWPA 1JCGA 3C7NB 3O3FA 1CXQA 3G25A 4Y0WA 3DI6A 1W9HA 3J7YP 3KLEA 4DTJA 3QNNA 1D4XA 4H0YB 1SS6A 4IFYA 3QEIA 4F4KA 4I6MB 3SQ1A 1TUUA 3DYAA 2FC0A 4DR4K 3L3UA 1L3SA 4AQYK 1KCFA 2A42A 2ZGYA 3KHYA 5EX5A 4HUGA 5D3GA 3V1QA 4IG0A 5AQVA 1M90O 1QZ5A 1BCMA 4GVEA 4LH5A 4DF4A 2ZD1A 3I8BA 3TSPA 4OJRA 1E4GT 4KV8A 4ZTFA 5AQGA 1ATSA 3MXJA 2YX6A 4CEDA 4BRIA 3PX0A 5KGWA 1Q82O 3ZCMA 2HBLA 4DLGA 3W3DA 4KHWA 5LJVA 3QEVA 3LP0A 4BACA 2FBTA 3H3OB 1HKBA 1XQSC 1BG3A 2W40A 3LDPA 1WNSA 2D4WA 2FBVA 3AVCA 4CZHA 4CZJA 1FK9A 5M1NA 2UXDK 1YJNN 2F9TA 4DQPA 4QS8A 4CJVA 1UOCA 3NFAA 4CGHA 4BREA 4FPBA 1IO2A 3OYJA 3K2PA 1HPZA 4H5RA 4CZIA 2AP1A 4E0DA 4YDUA 5AFUH 3T3FA 1NK6A 2PAVA 2Q0RA 4KB0A 5AQRA 3CCQN 3EY1A 4KHSA 3MN7A 5KPRA 1SL1A 4DR3K 4LY7A 3T1HK 1LAWA 1FKOA 5DM6L 2CGLA 4FM2A 5JVHL 4OLAA 3NH1A 1S22A 5F0XA 3ZYYX 3DM2A 4FJGA 2KFZA 3RMAA 1SL2A 1NWKA 4KKOA 1ZBIA 4QS9A 3WEEA 3C6HA 2YJEA 4DQ8A 3VEOA 4HVJA 4CJUA 2E6MA 3SQ2A 2CGJA 4NCGA 4IG3A 3GL1A 2QKKA 3A8YA 1WN7A 4GMJB 1TK5A 5AQFA 4B1WB 2QXFA 3ZEUA 1TL3A 1NOZA 1KQSM 2BTFA 4KH6A 3K5NA 3V1OA 5BREA 4NCAA 1T05A 5AQQA 3J80O 5E41A 3CCRN 1OVQA 4MLEA 1HPMA 1ESVA 1VSEA 1GOAA 5AQUA 1VQ5N 1VSFA 4CJKA 2GTDA 4DUZK 5JMVA 4Q5VA 4NCBA 3OYDA 3CETA 3LDSA 1TKZA 3NAEA 3WEEB 3AO3A 4GV6A 3UE5A 1TVRA 5FRMA 1BI4B 1XWLA 4X64K 4ILHA 3VQEA 3FZFA 2KTQA 1K73O 3ZT3A 2IS3A 4E1JA 5EXWA 1HNZK 4M3TA 4NB4A 1YUWA 2O4GA 5C0YA 3SUNA 2P5GA 3BDPA 2V52B 3OA9A 1O1WA 2G8KA 4CJ7A 4GKKK 1BGXT 1BIUA 2YKMA 2E2QA 5JLHA 1N8RO 4OO1J 1WSHA 3FLCO 2QWQA 4BC2A 3SCXA 3OYKA 4FXDA 4H0OA 1MA9B 3C95A 3Q7CA 2HHTA 2DY4A 3E9PA 2WUSA 2F8TA 3SV4A 4FWKA 4CHPA 4H0VB 3VMFB 4CF2A 4YOXA 3OYMA 3NVKA 2IOCA 1LW2A 3M5RA 3PSFA 1SUQA 3NF7A 5LJWA 4H0TB 5HP1A 4E7JA 4HHTA 2OTJN 4GKJK 1BHLA 3D2EA 4CJEA 3HPHA 4OPJA 3B8AX 4YOVA 3V9XA 4CJ3A 5IT9O 2ZM6K 2VG6A 2IC3A 1YT3A 3MWPA 1JCFA 1HJOA 4PY5A 1IJJA 4CGIA 4PL8A 4DUYK 3IKMA 3PLAA 5AZJA 3OYEA 4Z4FA 4XH4A 1SV5A 4RW6A 3SI6A 4WFBL 2WOMA 4DS4A 4BRMA 2E1ZA 4E1NA 3I0RA 3K0SA 3AA2A 4KB1A 1VQPN 1IBKK 3O9TA 4FJMA 4CJFA 4ELUA 3SAGA 1TAUA 2NUBA 1LCUA 3VQ6A 4CBWA 4FZZA 1NBWA 1NGCA 2HMIA 4W5TA 3O4WA 1IKVA 3QFUA 1XNRK 4CK3A 4LFBK 4CGFA 2V7ZA 3BF3A 4U67L 4B9NA 1VQNN 3MK6A 3IS9A 4KI4A 3V1RA 3ASMA 3HSTB 3D2EB 1BO5O 2HHVA 2O8EA 3PO5A 1HUXA 3HK2A 1RDWX 4MO4A 1C6VA 3QESA 3AARA 1EX4A 4FJKA 4IO9L 5AZJB 1YAGA 3CJ7A 1RTJA 4IZ9A 1U2VA 3AA4A 2X74A 3WNEA 4B9LA 3OY9A 3OHRA 4DFPA 5CE3A 2BGGA 5CY4A 3DXKA 3CJ1A 3K9KA 1Q8IA 3T1AA 2FBXA 3CF5L 4IOCL 2VQFK 4FWNA 3RMBA 2HNZA 4I9LA 1K8KB 3OJSA 3MECA 1RTHA 1QSYA 3OYLA 4JI4K 4EP4A 4YOYA 2OCEA 4BE2A 2D0AA 3QIPA 5GAGP 1BL3A 2O8EB 3HVTA 4FJHA 3FR0A 2NLXA 1YI2N 1WLJA 4JKEA 4FWQA 3L2QA 3EO3A 1U2VB 5I9EB 4QCLA 1DTTA 4XEIA 1XMQK 4CJLA 3CD6N 1IKXA 5C2DA 5HROA 3S3NA 2OZSA 2GBZA 2ZGZA 3DXKB 4N5SA 3VQ8A 1BCOA 3CJ9A 3OYAA 3ID8A 1UWBA 2W41A 3NBPA 4BG9A 4IBNA 1GOBA 2AA4A 2JLEA 4U7BA 3LZJA 1W2BM 1X9JA 5I42A 4Z4GA 4CHYA 2H3GX 4KTQA 3OS2A 3DOKA 3VEWA 2XY8A 1BISA 3L4IA 3N4QA 4XIUA 3RTVA 3M3ZA 1Q18A 4BC5A 4NXNK 1WOQA 4IWVA 2HHSA 4C8LA 4Q0BA 1I39A 4CFAA 1NKCA 1ZBHA 5J2PA 2IVNA 3VEVA 3OS0A 4R5PA 1K9MO 3HM8A 4RW7A 4BWMA 2QM1A 5CR4A 4KTWA 1IKYA 4GVMA 4FWPA 2VG5A 2VWBA 4DQRA 4YNQA 1XUPO 2P1JA 4CJPA 3AO4A 3AO1A 4V19S 3DLLL 2IIRA 5KGXA 4CIGA 4DTSA 2E4LA 4PKHA 4B3OA 5KTQA 4RWTA 3CPEA 3VQ5A 4QAGA 2EHGA 3MCAB 4IJNA 1OH6A 2Z1JA 3VEXA 3ZT4A 3HZ6A 1Z05A 3NVMA 4E1MA 4MFBA 3LWLA 4EZ9A 5BN9A 2VG7A 3ULDA 4FPAA 3GG4A 4E7KA 3OYIA 4AHRA 5HRSA 3V9WA 3A0IX 3QEPA 2HBKA 1WAFA 3AVMA 3AAPA 3THWA 4J2AA 4FLTA 3O9UA 4K8ZA 2ETJA 3KJVA 3ZETA 3THVA 3DJCA 4H4OA 1NJZA 1J6ZA 2HHQA 2KZMA 1U45A 2KFNA 1TKTA 4BRPA 2RF2A 3GDQA 3O5BA 1NGAA 1NU0A 5KQ8A 3ATUA 3AVFA 3DWLA 3QLHA 2FSKA 4DR5K 4AHUA 5M1PA 3RRHA 3OYGA 3H1QA 1RT1A 2FF6A 4LD0A 5AQMA 1QHAA 3O9RA 5A2QO 1KSPA 1VSMA 4A59A 4O5FA 1OH5A 3OYHA 2QEXN 3HSCA 2Q2RA 5LY3A 1N33K 3IG1A 3P5JA 4CFCA 3DLHA 2QI2A 2VYPA 5AQXA 4WF9L 3MN9A 2WC9A 5C12A 5HRRA 3EZWA 2Q97A 3THWB 3KKRA 3LALA 2G8UA 4LF4K 4DV1K 1KC8O 1QTMA 2RKIA 2A6AA 3TANA 4K8XA 1T03A 3ZETB 1RT4A 4FJ8A 4H8KA 3R9PA 4FLYA 4FLZA 3O80A 4MO5A 2P9UA 1SKSA 3ZT0A 1KRPA 4IKFA 2QKBA 2JWLA 1KVCA 1NGBA 3MCPA 3EL2A 4FO0A 3WXMB 4B9SA 4ILJA 2HOEA 5J2QA 4FWRA 2HHXA 3VGMA 3E01A 1J5OA 4DTRA 3E9OA 5AQWA 3SJHA 4H03B 4H5TA 4CBXA 1CZ9A 1VQMN 3L2RA 1YXQA 2Q31A 4FK0A 5AR0A 3TAGA 3AVHA 1HQEA 5CYQA 1T6CA 5LMNK 4G9ZA 4LSLA 4CHOA 3WNFA 4FYDA 3AAQA 2HW3A 3I55N 2Z1HA 3DLGA 3KWIA 5K14A 1BWFO 5J2NA 3OVNA 3KK3A 4M41A 2PBDA 1W7AA 1Q7YO 1L3TA 5GINA 3NH0A 4PHTX 3S3OA 1WB9A 1HQUA 1YTUA 4A61A 1KAYA 3L2UA 2P9UB 4FM1A 1RBUA 2P9PA 4BC4A 3QDKA 1QS4A 4AHSA 3DLEA 4LH4A 1BU6O 1T8EA 3D7EO 3DRSA 3O6WA 1R59O 2E1YA 3MXMA 3M6GA 1RDBA 3NF6A 4CEOA 3LDLA 3IMXA 1G99A 3D0PA 1GLAG 3KK1A 3BY5A 3M8SA 3AY9A 1ASVA 2CGKA 4H5WA 4N41A 4BGAA 3FZHA 3PX4A 4C8NA 3DXMA 4BR4A 1X1PA 5F2RA 1U49A 1VSLA 5BN8A 4JKFA 2GEMA 1LV5A 3AO5A 1IH7A 4FJ9A 4W5NA 3ZT2A 1Q9YA 3JYTA 4J2DA 3VQAA 3CJBA 4XH1A 4QOZB 2ZF5O 1WSGA 4FW1A 1TK8A 1LW0A 3H6EA 3BGRA 1BA0A 1X3NA 4OKKA 4ELTA 5E84A 2P9PB 3SLCA 3WQTA 2Q36A 4BROA 3I33A 4CFBA 4JAXA 4IEEA 4NYFA 2E8AA 3VQPA 3VN5A 2J4RA 5ELZA 4RW4A 2E6LA 2E5LK 1V4TA 1YJ9N 1HNWK 4A2BA 3LAMA 4DV7K 2JWKA 3CXCM 4DR1K 4RW8A 1HJRA 2HBMA 4BE0A 3KD1E 2Z1GA 3V9UA 4JI8K 4NLBA 3EE9A 5CYMA 4YY3K 1OH8A 2E88A 1N36K 4X65K 4MLHA 3MXIA 1E3MA 1JXEA 1O13A 1T44A 4DF8A 4FVUA 1ZC6A 3IFRA 3I56N 2PFUA 1XHZA 2HF3A 3BF1A 1WSJA 2E2OA 2E2PA 4JK7A 2RPIA 1U47A 3CCMN 1ZBSA 2V7YA 3NH2A 4M3RA 3EKSA 3MN6A 3A5NC 4GV9A 2P9NA 3VOVA 3K9JA 4JK9A 4CZKA 1WSIA 1VQ6N 4HCCA 2O8CA 4W5RA 5JVGL 2QA4N 2A3ZA 5M1OA 2IGIA 4Z4IA 2UXCK 1S5JA 2YNIA 2CH6A 3OBWA 3OW2M 4JI7K 4PKIA 4E3SA 5BPMA 5CZ2A 2YNFA 3EKUA 4IFVA 4KHPK 4ISEA 2YNHA 3QINA 3OYFA 5AQOA 1U04A 2F9WA 4E7IA 2D1KA 2KKZA 1R0AA 2NRVA 3ULEA 4AF1A 2FBYA 4O8KA 3G4SN 4PKGA 4IOAL 4JN4A 4DTNA 3VF4A 4EHTA 4YOTA 4FJIA 5KRSA 2I7NA 1KAZA 2P9IA 3UKRA 3OJUA 2UUAK 4B1UB 4DB3A 1TL1A 4BE1A 1ASWA 3P39A 2P9NB 1NKBA 3E1YA 1LAVA 3MN5A 1L3VA 1NGDA 3VQ9A 2O8CB 4BQZA 1L5UA 1KVBA 4OLBA 3GE1A 1LWCA 4DSJA 2F7TA 2ITGA 1S1UA 1GOCA 3U6FA 4EZ6A 4BG8A 4DU1A 2O8BA 4CZFA 3L4QA 1X9WA 4JS4A 1N34K 3JSMA 4JK8A 3D45A 3ENOA 3QETA 3ZEUB 3P4IA 5AQTA 3ULEB 3SUOA 1TKXA 5DM7L 1X9SA 3MEDA 4K25A 2EX3A 4RW9A 4DMNA 5J1EA 4BRNA 4ISGA 4WE1A 1BQNA 1NGHA 4PL7A 5BR9A 1JCEA 5SZTA 3SV3A 1J9AA 1VSDA 4OPAA 1NGEA 3UKRB 3ITHA 4DSKA 1NNEA 2B4JA 4L3QA 3KD5E 4NLCA 5AQIA 4CZEA 1SZ2A 3FGUA 4G1QA 2GV9A 3LM2A 4DCHA 2AJQA 4K41A 1RT6A 1NJWA 1RTDA 4FK4A 3HYFA 4N76A 5JICA 4CEEA 2W42A 4FCYA 1VSIA 4BDZA 2O8BB 3J7ZO 3SNNA 3AGKA 4I7FA 1REVA 1TGOA 3VESA 4FLWA 4AILC 3THYA 4FJXA 2FXUA 3NCIA 1U48A 2P9LA 4N47A 2YCHA 1CZBA 4BDYA 4B1XB 4CEFA 3CJAA 1W97L 1HNVA 2A5XA 4M3UA 3HOSA 3WXKA 1NMNA 4KFBA 3NMUA 1WSEA 3P83D 3IDHA 1DTQA 3LDQA 3NHGA 5FDLA 3UKUA 4DV2K 5FPMA 1RBTA 4CE9A 3F9KA 3LANA 4FM0A 3VPZA 2HMPA 5C42A 2GX9A 3RMDA 3IRXA 4AM7A 2UYTA 2HHWA 3NF9A 1X9MA 2YV0X 1HNIA 1GLCG 5CZ1A 2G8IA 4KHNA 2RE2A 5KQDA 2QTDA 3CCSN 2P51A 3TR8A 1B92A 4FJNA 4LC9B 2E2NA 4DV0K 4DWIA 5T7BA 1UAXA 3CC2N 3THYB 3H46O
chains in the Genus database with same CATH topology
3L2VA 3VQ5A 1RT7A 4QAGA 4ZHRA 2P5OA 2EHGA 4DTMA 3V4IA 4DLEA 3V6DA 3VQDA 3ZSRA 2JGUA 1A5VA 1RT5A 2Z1JA 3ZSWA 3ZT4A 4CHNA 4DQIA 3NF8A 4KO0A 3NGYA 2DFFA 3LWLA 4E1MA 4MFBA 3RR7A 4EZ9A 1Z25A 3VQ4A 1KVAA 2VG7A 3ULDA 4OGCA 4E7KA 3O3HA 4DSFA 4DTXA 3IAYA 1S9EA 3C94A 4AHRA 5HRSA 3OYIA 3V9SA 3V9WA 3OYBA 4CERA 3QEPA 1WAFA 2D5RA 3AVMA 3VQCA 3V81A 2RN2A 4FLTA 3CM6A 4OKEA 4JRQA 4J2AA 4CESA 4HTUA 4L8RB 2X78A 4K8ZA 2ETJA 1ZBLA 1HYSA 1L3UA 2A1SA 3DMJA 1JL2A 1C1AA 3KJVA 2IAJA 3THVA 3O3FA 1CXQA 4H4OA 1NJZA 4CHZA 1N5YA 3WNHA 3DI6A 1U45A 4DSLA 2HHQA 2KZMA 1TKTA 4AH9A 2RF2A 1W9HA 3KLEA 1XC9A 1S6PA 4DTJA 3QNNA 4IFYA 4CECA 4CJWA 3QEIA 4F4KA 3SQ1A 3DYAA 1S6QA 2FC0A 4CJQA 2PY5A 3AVFA 3L3UA 5SWMA 3QLHA 1L3SA 4C8MA 3SUQA 1KCFA 4M3YA 2VWKA 4O0JA 4AHUA 3RRHA 4M42A 3OYGA 3LPUA 4HUGA 5D3GA 1RT1A 4IG0A 3V1QA 4LD0A 3KTQA 1BCMA 1D5AA 3SUPA 4KHYA 2HVIA 1SKWA 1C0MA 1DLOA 4LH5A 4DTPA 3DOLA 4DF4A 1RCHA 2ZD1A 1D8YA 1KSPA 4OJRA 3H08A 4KV8A 4ZTFA 1VSMA 3O4QA 2F96A 4CJRA 4I9QA 3KK2A 1KFSA 4CF8A 3WNGA 3MXJA 4CEDA 4KREA 5HRPA 3OYHA 5KGWA 3PX0A 3ZCMA 2KZZA 4DLGA 3TAQA 4CJ4A 3IG1A 3EZ5A 3P5JA 4C8OA 2HNDA 4CFCA 4M45A 3DLHA 1J53A 4KHWA 4DG1A 3L3VA 4PA1A 3QEVA 3LP0A 4BACA 2FBTA 4DQSA 3OYCA 1NJYA 3M8RA 4CF9A 5EU7A 2I5JA 4CF0A 5HRRA 1TKDA 1NOYA 3KKRA 3LALA 3KKSA 4I2PA 4CIEA 4CK2A 1N6QA 2G8UA 2PYJA 4O4GA 1QTMA 1WNSA 2RKIA 4K8XA 3TANA 4CEZA 2FBVA 1HRHA 1RT4A 1VSKA 3AVCA 4DU4A 1T03A 2G8HA 4OPKA 4FJ8A 1FK9A 4F3TA 1FXXA 4H8KA 4FLYA 4FLZA 3CM5A 1C1BA 1SKSA 4DQPA 3S3MA 3O4NA 3ZT0A 1QHTA 1UOCA 4CJVA 1KRPA 4IKFA 2QKBA 1XHXA 3NFAA 4CGHA 2ZE2A 1JLQA 1IO2A 4UQGA 1KVCA 3OYJA 3KLFA 3K2PA 2ZQBA 3NDKA 1HPZA 4B9SA 4E0DA 3G10A 4OGEA 2BANA 5J2QA 2HHXA 1RBSA 3T3FA 1NK6A 3E01A 3CFPA 4GW6A 1J5OA 4DTRA 4Z0UA 4KB0A 3LP2A 4H4MA 3U3GA 3EY1A 4KHSA 2G8FA 1CZ9A 1SL1A 3L2RA 4OVLA 2DFHA 4LY7A 1LAWA 4FK0A 1FKOA 3TAGA 3AVHA 1HQEA 4FM2A 5CYQA 3TWHA 4BDPA 3PY8A 1FKPA 4OLAA 4LSLA 2XRIA 2YKNA 4CHOA 4CFDA 4Y1DA 3WNFA 4CGDA 3NH1A 3DM2A 1U4BA 4FJGA 4FYDA 3RMAA 1SL2A 2HW3A 2KFZA 4KKOA 3DLRA 1ZBIA 2Z1HA 3DLGA 5K14A 5J2NA 2GUIA 3OVNA 3HO1A 4B9TA 1RILA 3C6UA 3LP3A 4CJUA 4HVJA 3KK3A 3HM9A 2E6MA 4FLUA 4PQUA 1QE1A 3SQ2A 3ZSYA 4NCGA 2PYLA 4M41A 4Z4CA 4FJ7A 3PV8A 4IG3A 1L3TA 1Y97A 4J2EA 1HMVA 2QKKA 1JLGA 3NH0A 1WN7A 4GMJB 3S3OA 1TK5A 4ELVA 1BQMA 1HQUA 1VRTA 4PUOA 2QXFA 3AO2A 1NKEA 3L2UA 1TL3A 1YTUA 1NOZA 1F21A 4HUEA 4FM1A 1RBUA 3TI0A 3K5NA 2XY5A 2XO7A 1I3AA 3V1OA 4NCAA 4AHSA 1QS4A 1T05A 3DLEA 4LH4A 1JKHA 2WONA 2B6AA 3I0SA 4CF1A 3I8DA 1T8EA 3TAPA 4DTUA 3DRSA 3SYZA 5E41A 3MXMA 3EYZA 4KHQA 1RDBA 4FLVA 3NF6A 4CEOA 4HCBA 1VSEA 1KTQA 3D0PA 1D9FA 4DS5A 1GOAA 4CCHA 3KK1A 3HVRA 3M8SA 1VSJA 1ASVA 4JRPA 3K5LA 4N41A 4E19A 1VSFA 4CEQA 1NJXA 4CJKA 4CIFA 2Y1IA 3PX4A 1TAQA 3PX6A 4C8NA 1JLEA 3KIOA 4Q5VA 1X1PA 1JLFA 3ZSOA 4NCBA 1U49A 3DLBA 4OKJA 1VSLA 2YNGA 3OYDA 3LDSA 1TKZA 3KLGA 3NAEA 1LV5A 3F73A 3RR8A 3AO5A 1IH7A 3AO3A 3LP1A 1TVRA 3PUFA 4FJ9A 4W5NA 3ZT2A 5FRMA 1BI4B 1XWLA 2LSNA 1Q9YA 2O4IA 3VQEA 3JYTA 4J2BA 2KTQA 3M8PA 3HPGA 2OYQA 4J2DA 3CFOA 3VQAA 3HP9A 3ZT3A 3U3YA 4QOZB 2HNYA 2IS3A 3QEWA 1WSGA 3T19A 4FW1A 1TK8A 1LW0A 1B9DA 4M3TA 1CXUA 5DK5A 3BGRA 4OKKA 1LWEA 3K5OA 4ELTA 2O4GA 3SUNA 5KRTA 4B8CA 4RG8A 2P5GA 3BDPA 4CFBA 1S9GA 1O1WA 2G8KA 1BGXT 3ZSVA 1BIUA 2YKMA 3MEEA 4NYFA 3RWUA 1ASUA 2YHBA 2Q3SA 4F8RA 3VQPA 3VN5A 4DFKA 1WSHA 1RBVA 4B9UA 4ID1A 5JS2A 3OYKA 3NE6A 3SCXA 1JXBA 2D0BA 4RW4A 4FZYA 3ZSQA 3SPZA 4FXDA 3AVBA 1JL1A 2E6LA 3C95A 2HHTA 1VSHA 2DY4A 4Q0BA 3LAMA 4KAZA 2QK9A 2F8TA 4N56A 3AV9A 3SV4A 3C6TA 4CHPA 4RW8A 4CJTA 2X6NA 1HJRA 3TAMA 4BE0A 3ISNC 4CF2A 4C8KA 4Z4EA 1B9FA 3KD1E 1VK0A 3OYMA 2IOCA 1LW2A 2Z1GA 3OYNA 3V9UA 1SUQA 2OPQA 4HUFA 3NF7A 4AHTA 1JLBA 5CYMA 4NYNA 5HP1A 4ZTJA 2F8SA 4KRFA 4E7JA 4HHTA 1ITGA 1JLAA 4YFUA 3SJJA 3MXIA 1KLNA 2OA8A 1BHLA 1XI1A 1JXEA 3DRRA 3HPHA 4CJEA 4DF8A 1YVUA 4OPJA 3V9XA 1EP4A 4CJ3A 1UA1A 2VG6A 3ALYA 2IC3A 1XHZA 1YT3A 1A5XA 1RTIA 1S1XA 1EETA 4ICLA 1WSJA 4PY5A 4LSNA 4CGIA 3L2WA 4BWJA 2RPIA 1U47A 2XHBA 3SZ2A 4I2QA 3OYEA 4Z4FA 1CLQA 3NH2A 1SV5A 4RW6A 4M3RA 3SI6A 2WOMA 4EP5A 3O3GA 1WSIA 3NGIA 4DS4A 2KQ2A 1K6YA 5C25A 4HCCA 1LWFA 4W5RA 1NK7A 3VA0A 5HLFA 4E1NA 1SKRA 3I0RA 2IGIA 4FK2A 4Z4IA 1S5JA 3B6PA 2YNIA 3AA2A 3CFRA 4KB1A 4Y1CA 4E3SA 1RDCA 4MQ3A 4FJMA 4CJFA 5FRNA 3PO4A 3AVNA 2KW4A 1NK9A 5CZ2A 4DSEA 4ELUA 1C0TA 2YNFA 3AVGA 4F2SA 2HVHA 3K59A 4IFVA 1TAUA 2NUBA 2D0CA 3VQ6A 2YNHA 1W0HA 3QINA 3OYFA 4DFJA 3TAFA 2HMIA 4FZZA 1U04A 4W5TA 4E7IA 1NK4A 4W5QA 1IKVA 4FJ5A 1R0AA 4CK3A 1TV6A 3VQ7A 4CGFA 4B9VA 3K58A 4B9NA 5HRNA 3IS9A 4KI4A 1RT2A 2FBYA 3V1RA 3ASMA 2YHAA 3TAEA 3HSTB 1S1VA 3M8QA 4DTNA 3ZSXA 1EKEA 3K5MA 2HHVA 3K57A 3AA3A 3PO5A 1RBRA 3G0ZA 4FJIA 3HK2A 5KRSA 3QERA 4DTOA 1C6VA 2A1RA 1YTAA 3QESA 3OJUA 2IDOA 2PZSA 1C0UA 1C1CA 1EX4A 1TL1A 4IDKA 4CEAA 4BE1A 3TABA 4FJKA 1ASWA 1UA0A 3MAQA 1NKBA 3SQ4A 1RTJA 3SQ0A 4KI6A 4CGGA 1LAVA 3AA4A 3CYMA 4O44A 4ID5A 1L3VA 2X74A 3VQ9A 3WNEA 2BDPA 3OY9A 5I3UA 1KVBA 4JLHA 3VQQA 4DFPA 1Z26A 1L5UA 4B9LA 2BGGA 4OLBA 5C24A 1LWCA 4DSJA 5CY4A 3RRGA 2ITGA 1S1UA 4AHCA 2OPRA 1IKWA 4E7HA 1GOCA 1Q8IA 3T1AA 2DFEA 3U6FA 3TARA 4EZ6A 2BE2A 2HHUA 2FBXA 2HB5A 4DU1A 4FLXA 2OPPA 3AVIA 3HJFA 1X9WA 4M3ZA 3LZIA 3AVKA 4JS4A 3RMBA 2HNZA 4I9LA 3OJSA 3D45A 3JSMA 4TSXA 2ATQA 3QETA 3MECA 1J54A 1RTHA 1QSYA 4B9MA 3SUOA 3OYLA 1TKXA 4B8AB 2OPSA 2R7YA 1MU2A 3V9ZA 4EP4A 1X9SA 3MEDA 4FZXC 3DRPA 4BE2A 2EX3A 2D0AA 1RNHA 4RW9A 4DMNA 3SPYA 1RT3A 3S9HA 4DSIA 1HYZA 4M3XA 3QIPA 1BL3A 5J1EA 3FFIA 2X6SA 3CG7A 5DMRA 3OS1A 3B6OA 3QIOA 1BQNA 4WE1A 3QO9A 1EXQA 4Z4HA 3L8BA 5SZTA 4DU3A 3LPTA 4W5OA 3SV3A 1J9AA 3HVTA 1VSDA 3RMCA 2Y1JA 4FJHA 3ITHA 1ZBFA 1S1WA 4DSKA 4CJSA 4FJJA 2B5JA 3P1GA 4O55A 3HP6A 2B4JA 4FJLA 1D9DA 1WLJA 3KD5E 2Z1IA 3QEXA 3L2QA 2XY7A 4QCLA 1DTTA 4G1QA 2GV9A 5KI6A 4CJLA 2AJQA 1IKXA 5HROA 3MEGA 1RT6A 4E7LA 4CK1A 3S3NA 4CJ5A 4JS5A 1NJWA 2GBZA 1RTDA 2OZSA 3DLKA 4O5BA 3VQ8A 4N5SA 2XY6A 2G8WA 1BCOA 4FK4A 3HYFA 3OYAA 4N76A 1UWBA 5HBMA 1KLMA 4CEEA 3NBPA 4IBNA 1ZYQA 3HXMA 2W42A 4FCYA 1GOBA 4DFMA 1VSIA 2JLEA 4BDZA 3AVLA 3SNNA 1TK0A 3ZSZA 4I7FA 1A5WA 3LZJA 3A2FA 1REVA 4F2RA 1TGOA 3QNOA 5I42A 2KFNA 4FLWA 3HT3A 4AILC 4Z4GA 4M3WA 3HL8A 4CHYA 1Q9XA 4KHUA 1S1TA 1ZBUA 4FJXA 4FW2A 3NCIA 4KTQA 1U48A 1NK5A 1BIZA 4FVMA 4N47A 3DOKA 3OS2A 1CZBA 4BDYA 4CEFA 2VWJA 3UIQA 2XY8A 5JS1A 3AA5X 1HNVA 1QSLA 2DTUA 5FROA 1BISA 1QSSA 1NK8A 4M3UA 4DQQA 4XIUA 5J2MA 3RTVA 4KFBA 4CGJA 4B08A 2G8VA 1WSEA 3P83D 1T7PA 4KPYA 2HHSA 4C8LA 1HYVA 1DTQA 1I39A 4CHQA 4CFAA 1QQCA 4AHVA 1NKCA 1ZBHA 3NHGA 5FDLA 4O0IA 5J2PA 1RBTA 4CE9A 3F9KA 3LANA 4FM0A 1SL0A 3LAKA 3NGZA 1WAJA 3OS0A 4R5PA 1WSFA 5C42A 3RMDA 4RW7A 3AVAA 4BWMA 3IRXA 2HHWA 3VQBA 1NK0A 3NF9A 1X9MA 3ZT1A 2YV0X 1HNIA 5CZ1A 2G8IA 1G15A 4KTWA 4E89A 3KLHA 3LWMA 4KHNA 4PWDA 1IKYA 4GVMA 1BI4A 2VG5A 3VA3A 1RDAA 4DQRA 4F3OA 4YNQA 2P1JA 4CEBA 1VRUA 3AVJA 4CJPA 2P51A 2OZMA 3AO4A 3TR8A 1B92A 3AO1A 4FJNA 3CQ8A 4KTZA 5KGXA 4CIGA 4DTSA 2E4LA 1JLCA 1IG9A 4DWIA 1KFDA 5T7BA 4B3OA 1UAXA 3KLIA 5KTQA 1RDDA 3HPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  3VQ5 A;  1RT7 A;  4QAG A;  4ZHR A;  2P5O A;  2EHG A;  4DTM A;  3V4I A;  4DLE A;  3V6D A;  3VQD A;  3ZSR A;  2JGU A;  1A5V A;  1RT5 A;  2Z1J A;  3ZSW A;  3ZT4 A;  4CHN A;  4DQI A;  3NF8 A;  4KO0 A;  3NGY A;  2DFF A;  3LWL A;  4E1M A;  4MFB A;  3RR7 A;  4EZ9 A;  1Z25 A;  3VQ4 A;  1KVA A;  2VG7 A;  3ULD A;  4OGC A;  4E7K A;  3O3H A;  4DSF A;  4DTX A;  3IAY A;  1S9E A;  3C94 A;  4AHR A;  5HRS A;  3OYI A;  3V9S A;  3V9W A;  3OYB A;  4CER A;  3QEP A;  1WAF A;  2D5R A;  3AVM A;  3VQC A;  3V81 A;  2RN2 A;  4FLT A;  3CM6 A;  4OKE A;  4JRQ A;  4J2A A;  4CES A;  4HTU A;  4L8R B;  2X78 A;  4K8Z A;  2ETJ A;  1ZBL A;  1HYS A;  1L3U A;  2A1S A;  3DMJ A;  1JL2 A;  1C1A A;  3KJV A;  2IAJ A;  3THV A;  3O3F A;  1CXQ A;  4H4O A;  1NJZ A;  4CHZ A;  1N5Y A;  3WNH A;  3DI6 A;  1U45 A;  4DSL A;  2HHQ A;  2KZM A;  1TKT A;  4AH9 A;  2RF2 A;  1W9H A;  3KLE A;  1XC9 A;  1S6P A;  4DTJ A;  3QNN A;  4IFY A;  4CEC A;  4CJW A;  3QEI A;  4F4K A;  3SQ1 A;  3DYA A;  1S6Q A;  2FC0 A;  4CJQ A;  2PY5 A;  3AVF A;  3L3U A;  5SWM A;  3QLH A;  1L3S A;  4C8M A;  3SUQ A;  1KCF A;  4M3Y A;  2VWK A;  4O0J A;  4AHU A;  3RRH A;  4M42 A;  3OYG A;  3LPU A;  4HUG A;  5D3G A;  1RT1 A;  4IG0 A;  3V1Q A;  4LD0 A;  3KTQ A;  1BCM A;  1D5A A;  3SUP A;  4KHY A;  2HVI A;  1SKW A;  1C0M A;  1DLO A;  4LH5 A;  4DTP A;  3DOL A;  4DF4 A;  1RCH A;  2ZD1 A;  1D8Y A;  1KSP A;  4OJR A;  3H08 A;  4KV8 A;  4ZTF A;  1VSM A;  3O4Q A;  2F96 A;  4CJR A;  4I9Q A;  3KK2 A;  1KFS A;  4CF8 A;  3WNG A;  3MXJ A;  4CED A;  4KRE A;  5HRP A;  3OYH A;  5KGW A;  3PX0 A;  3ZCM A;  2KZZ A;  4DLG A;  3TAQ A;  4CJ4 A;  3IG1 A;  3EZ5 A;  3P5J A;  4C8O A;  2HND A;  4CFC A;  4M45 A;  3DLH A;  1J53 A;  4KHW A;  4DG1 A;  3L3V A;  4PA1 A;  3QEV A;  3LP0 A;  4BAC A;  2FBT A;  4DQS A;  3OYC A;  1NJY A;  3M8R A;  4CF9 A;  5EU7 A;  2I5J A;  4CF0 A;  5HRR A;  1TKD A;  1NOY A;  3KKR A;  3LAL A;  3KKS A;  4I2P A;  4CIE A;  4CK2 A;  1N6Q A;  2G8U A;  2PYJ A;  4O4G A;  1QTM A;  1WNS A;  2RKI A;  4K8X A;  3TAN A;  4CEZ A;  2FBV A;  1HRH A;  1RT4 A;  1VSK A;  3AVC A;  4DU4 A;  1T03 A;  2G8H A;  4OPK A;  4FJ8 A;  1FK9 A;  4F3T A;  1FXX A;  4H8K A;  4FLY A;  4FLZ A;  3CM5 A;  1C1B A;  1SKS A;  4DQP A;  3S3M A;  3O4N A;  3ZT0 A;  1QHT A;  1UOC A;  4CJV A;  1KRP A;  4IKF A;  2QKB A;  1XHX A;  3NFA A;  4CGH A;  2ZE2 A;  1JLQ A;  1IO2 A;  4UQG A;  1KVC A;  3OYJ A;  3KLF A;  3K2P A;  2ZQB A;  3NDK A;  1HPZ A;  4B9S A;  4E0D A;  3G10 A;  4OGE A;  2BAN A;  5J2Q A;  2HHX A;  1RBS A;  3T3F A;  1NK6 A;  3E01 A;  3CFP A;  4GW6 A;  1J5O A;  4DTR A;  4Z0U A;  4KB0 A;  3LP2 A;  4H4M A;  3U3G A;  3EY1 A;  4KHS A;  2G8F A;  1CZ9 A;  1SL1 A;  3L2R A;  4OVL A;  2DFH A;  4LY7 A;  1LAW A;  4FK0 A;  1FKO A;  3TAG A;  3AVH A;  1HQE A;  4FM2 A;  5CYQ A;  3TWH A;  4BDP A;  3PY8 A;  1FKP A;  4OLA A;  4LSL A;  2XRI A;  2YKN A;  4CHO A;  4CFD A;  4Y1D A;  3WNF A;  4CGD A;  3NH1 A;  3DM2 A;  1U4B A;  4FJG A;  4FYD A;  3RMA A;  1SL2 A;  2HW3 A;  2KFZ A;  4KKO A;  3DLR A;  1ZBI A;  2Z1H A;  3DLG A;  5K14 A;  5J2N A;  2GUI A;  3OVN A;  3HO1 A;  4B9T A;  1RIL A;  3C6U A;  3LP3 A;  4CJU A;  4HVJ A;  3KK3 A;  3HM9 A;  2E6M A;  4FLU A;  4PQU A;  1QE1 A;  3SQ2 A;  3ZSY A;  4NCG A;  2PYL A;  4M41 A;  4Z4C A;  4FJ7 A;  3PV8 A;  4IG3 A;  1L3T A;  1Y97 A;  4J2E A;  1HMV A;  2QKK A;  1JLG A;  3NH0 A;  1WN7 A;  4GMJ B;  3S3O A;  1TK5 A;  4ELV A;  1BQM A;  1HQU A;  1VRT A;  4PUO A;  2QXF A;  3AO2 A;  1NKE A;  3L2U A;  1TL3 A;  1YTU A;  1NOZ A;  1F21 A;  4HUE A;  4FM1 A;  1RBU A;  3TI0 A;  3K5N A;  2XY5 A;  2XO7 A;  1I3A A;  3V1O A;  4NCA A;  4AHS A;  1QS4 A;  1T05 A;  3DLE A;  4LH4 A;  1JKH A;  2WON A;  2B6A A;  3I0S A;  4CF1 A;  3I8D A;  1T8E A;  3TAP A;  4DTU A;  3DRS A;  3SYZ A;  5E41 A;  3MXM A;  3EYZ A;  4KHQ A;  1RDB A;  4FLV A;  3NF6 A;  4CEO A;  4HCB A;  1VSE A;  1KTQ A;  3D0P A;  1D9F A;  4DS5 A;  1GOA A;  4CCH A;  3KK1 A;  3HVR A;  3M8S A;  1VSJ A;  1ASV A;  4JRP A;  3K5L A;  4N41 A;  4E19 A;  1VSF A;  4CEQ A;  1NJX A;  4CJK A;  4CIF A;  2Y1I A;  3PX4 A;  1TAQ A;  3PX6 A;  4C8N A;  1JLE A;  3KIO A;  4Q5V A;  1X1P A;  1JLF A;  3ZSO A;  4NCB A;  1U49 A;  3DLB A;  4OKJ A;  1VSL A;  2YNG A;  3OYD A;  3LDS A;  1TKZ A;  3KLG A;  3NAE A;  1LV5 A;  3F73 A;  3RR8 A;  3AO5 A;  1IH7 A;  3AO3 A;  3LP1 A;  1TVR A;  3PUF A;  4FJ9 A;  4W5N A;  3ZT2 A;  5FRM A;  1BI4 B;  1XWL A;  2LSN A;  1Q9Y A;  2O4I A;  3VQE A;  3JYT A;  4J2B A;  2KTQ A;  3M8P A;  3HPG A;  2OYQ A;  4J2D A;  3CFO A;  3VQA A;  3HP9 A;  3ZT3 A;  3U3Y A;  4QOZ B;  2HNY A;  2IS3 A;  3QEW A;  1WSG A;  3T19 A;  4FW1 A;  1TK8 A;  1LW0 A;  1B9D A;  4M3T A;  1CXU A;  5DK5 A;  3BGR A;  4OKK A;  1LWE A;  3K5O A;  4ELT A;  2O4G A;  3SUN A;  5KRT A;  4B8C A;  4RG8 A;  2P5G A;  3BDP A;  4CFB A;  1S9G A;  1O1W A;  2G8K A;  1BGX T;  3ZSV A;  1BIU A;  2YKM A;  3MEE A;  4NYF A;  3RWU A;  1ASU A;  2YHB A;  2Q3S A;  4F8R A;  3VQP A;  3VN5 A;  4DFK A;  1WSH A;  1RBV A;  4B9U A;  4ID1 A;  5JS2 A;  3OYK A;  3NE6 A;  3SCX A;  1JXB A;  2D0B A;  4RW4 A;  4FZY A;  3ZSQ A;  3SPZ A;  4FXD A;  3AVB A;  1JL1 A;  2E6L A;  3C95 A;  2HHT A;  1VSH A;  2DY4 A;  4Q0B A;  3LAM A;  4KAZ A;  2QK9 A;  2F8T A;  4N56 A;  3AV9 A;  3SV4 A;  3C6T A;  4CHP A;  4RW8 A;  4CJT A;  2X6N A;  1HJR A;  3TAM A;  4BE0 A;  3ISN C;  4CF2 A;  4C8K A;  4Z4E A;  1B9F A;  3KD1 E;  1VK0 A;  3OYM A;  2IOC A;  1LW2 A;  2Z1G A;  3OYN A;  3V9U A;  1SUQ A;  2OPQ A;  4HUF A;  3NF7 A;  4AHT A;  1JLB A;  5CYM A;  4NYN A;  5HP1 A;  4ZTJ A;  2F8S A;  4KRF A;  4E7J A;  4HHT A;  1ITG A;  1JLA A;  4YFU A;  3SJJ A;  3MXI A;  1KLN A;  2OA8 A;  1BHL A;  1XI1 A;  1JXE A;  3DRR A;  3HPH A;  4CJE A;  4DF8 A;  1YVU A;  4OPJ A;  3V9X A;  1EP4 A;  4CJ3 A;  1UA1 A;  2VG6 A;  3ALY A;  2IC3 A;  1XHZ A;  1YT3 A;  1A5X A;  1RTI A;  1S1X A;  1EET A;  4ICL A;  1WSJ A;  4PY5 A;  4LSN A;  4CGI A;  3L2W A;  4BWJ A;  2RPI A;  1U47 A;  2XHB A;  3SZ2 A;  4I2Q A;  3OYE A;  4Z4F A;  1CLQ A;  3NH2 A;  1SV5 A;  4RW6 A;  4M3R A;  3SI6 A;  2WOM A;  4EP5 A;  3O3G A;  1WSI A;  3NGI A;  4DS4 A;  2KQ2 A;  1K6Y A;  5C25 A;  4HCC A;  1LWF A;  4W5R A;  1NK7 A;  3VA0 A;  5HLF A;  4E1N A;  1SKR A;  3I0R A;  2IGI A;  4FK2 A;  4Z4I A;  1S5J A;  3B6P A;  2YNI A;  3AA2 A;  3CFR A;  4KB1 A;  4Y1C A;  4E3S A;  1RDC A;  4MQ3 A;  4FJM A;  4CJF A;  5FRN A;  3PO4 A;  3AVN A;  2KW4 A;  1NK9 A;  5CZ2 A;  4DSE A;  4ELU A;  1C0T A;  2YNF A;  3AVG A;  4F2S A;  2HVH A;  3K59 A;  4IFV A;  1TAU A;  2NUB A;  2D0C A;  3VQ6 A;  2YNH A;  1W0H A;  3QIN A;  3OYF A;  4DFJ A;  3TAF A;  2HMI A;  4FZZ A;  1U04 A;  4W5T A;  4E7I A;  1NK4 A;  4W5Q A;  1IKV A;  4FJ5 A;  1R0A A;  4CK3 A;  1TV6 A;  3VQ7 A;  4CGF A;  4B9V A;  3K58 A;  4B9N A;  5HRN A;  3IS9 A;  4KI4 A;  1RT2 A;  2FBY A;  3V1R A;  3ASM A;  2YHA A;  3TAE A;  3HST B;  1S1V A;  3M8Q A;  4DTN A;  3ZSX A;  1EKE A;  3K5M A;  2HHV A;  3K57 A;  3AA3 A;  3PO5 A;  1RBR A;  3G0Z A;  4FJI A;  3HK2 A;  5KRS A;  3QER A;  4DTO A;  1C6V A;  2A1R A;  1YTA A;  3QES A;  3OJU A;  2IDO A;  2PZS A;  1C0U A;  1C1C A;  1EX4 A;  1TL1 A;  4IDK A;  4CEA A;  4BE1 A;  3TAB A;  4FJK A;  1ASW A;  1UA0 A;  3MAQ A;  1NKB A;  3SQ4 A;  1RTJ A;  3SQ0 A;  4KI6 A;  4CGG A;  1LAV A;  3AA4 A;  3CYM A;  4O44 A;  4ID5 A;  1L3V A;  2X74 A;  3VQ9 A;  3WNE A;  2BDP A;  3OY9 A;  5I3U A;  1KVB A;  4JLH A;  3VQQ A;  4DFP A;  1Z26 A;  1L5U A;  4B9L A;  2BGG A;  4OLB A;  5C24 A;  1LWC A;  4DSJ A;  5CY4 A;  3RRG A;  2ITG A;  1S1U A;  4AHC A;  2OPR A;  1IKW A;  4E7H A;  1GOC A;  1Q8I A;  3T1A A;  2DFE A;  3U6F A;  3TAR A;  4EZ6 A;  2BE2 A;  2HHU A;  2FBX A;  2HB5 A;  4DU1 A;  4FLX A;  2OPP A;  3AVI A;  3HJF A;  1X9W A;  4M3Z A;  3LZI A;  3AVK A;  4JS4 A;  3RMB A;  2HNZ A;  4I9L A;  3OJS A;  3D45 A;  3JSM A;  4TSX A;  2ATQ A;  3QET A;  3MEC A;  1J54 A;  1RTH A;  1QSY A;  4B9M A;  3SUO A;  3OYL A;  1TKX A;  4B8A B;  2OPS A;  2R7Y A;  1MU2 A;  3V9Z A;  4EP4 A;  1X9S A;  3MED A;  4FZX C;  3DRP A;  4BE2 A;  2EX3 A;  2D0A A;  1RNH A;  4RW9 A;  4DMN A;  3SPY A;  1RT3 A;  3S9H A;  4DSI A;  1HYZ A;  4M3X A;  3QIP A;  1BL3 A;  5J1E A;  3FFI A;  2X6S A;  3CG7 A;  5DMR A;  3OS1 A;  3B6O A;  3QIO A;  1BQN A;  4WE1 A;  3QO9 A;  1EXQ A;  4Z4H A;  3L8B A;  5SZT A;  4DU3 A;  3LPT A;  4W5O A;  3SV3 A;  1J9A A;  3HVT A;  1VSD A;  3RMC A;  2Y1J A;  4FJH A;  3ITH A;  1ZBF A;  1S1W A;  4DSK A;  4CJS A;  4FJJ A;  2B5J A;  3P1G A;  4O55 A;  3HP6 A;  2B4J A;  4FJL A;  1D9D A;  1WLJ A;  3KD5 E;  2Z1I A;  3QEX A;  3L2Q A;  2XY7 A;  4QCL A;  1DTT A;  4G1Q A;  2GV9 A;  5KI6 A;  4CJL A;  2AJQ A;  1IKX A;  5HRO A;  3MEG A;  1RT6 A;  4E7L A;  4CK1 A;  3S3N A;  4CJ5 A;  4JS5 A;  1NJW A;  2GBZ A;  1RTD A;  2OZS A;  3DLK A;  4O5B A;  3VQ8 A;  4N5S A;  2XY6 A;  2G8W A;  1BCO A;  4FK4 A;  3HYF A;  3OYA A;  4N76 A;  1UWB A;  5HBM A;  1KLM A;  4CEE A;  3NBP A;  4IBN A;  1ZYQ A;  3HXM A;  2W42 A;  4FCY A;  1GOB A;  4DFM A;  1VSI A;  2JLE A;  4BDZ A;  3AVL A;  3SNN A;  1TK0 A;  3ZSZ A;  4I7F A;  1A5W A;  3LZJ A;  3A2F A;  1REV A;  4F2R A;  1TGO A;  3QNO A;  5I42 A;  2KFN A;  4FLW A;  3HT3 A;  4AIL C;  4Z4G A;  4M3W A;  3HL8 A;  4CHY A;  1Q9X A;  4KHU A;  1S1T A;  1ZBU A;  4FJX A;  4FW2 A;  3NCI A;  4KTQ A;  1U48 A;  1NK5 A;  1BIZ A;  4FVM A;  4N47 A;  3DOK A;  3OS2 A;  1CZB A;  4BDY A;  4CEF A;  2VWJ A;  3UIQ A;  2XY8 A;  5JS1 A;  3AA5 X;  1HNV A;  1QSL A;  2DTU A;  5FRO A;  1BIS A;  1QSS A;  1NK8 A;  4M3U A;  4DQQ A;  4XIU A;  5J2M A;  3RTV A;  4KFB A;  4CGJ A;  4B08 A;  2G8V A;  1WSE A;  3P83 D;  1T7P A;  4KPY A;  2HHS A;  4C8L A;  1HYV A;  1DTQ A;  1I39 A;  4CHQ A;  4CFA A;  1QQC A;  4AHV A;  1NKC A;  1ZBH A;  3NHG A;  5FDL A;  4O0I A;  5J2P A;  1RBT A;  4CE9 A;  3F9K A;  3LAN A;  4FM0 A;  1SL0 A;  3LAK A;  3NGZ A;  1WAJ A;  3OS0 A;  4R5P A;  1WSF A;  5C42 A;  3RMD A;  4RW7 A;  3AVA A;  4BWM A;  3IRX A;  2HHW A;  3VQB A;  1NK0 A;  3NF9 A;  1X9M A;  3ZT1 A;  2YV0 X;  1HNI A;  5CZ1 A;  2G8I A;  1G15 A;  4KTW A;  4E89 A;  3KLH A;  3LWM A;  4KHN A;  4PWD A;  1IKY A;  4GVM A;  1BI4 A;  2VG5 A;  3VA3 A;  1RDA A;  4DQR A;  4F3O A;  4YNQ A;  2P1J A;  4CEB A;  1VRU A;  3AVJ A;  4CJP A;  2P51 A;  2OZM A;  3AO4 A;  3TR8 A;  1B92 A;  3AO1 A;  4FJN A;  3CQ8 A;  4KTZ A;  5KGX A;  4CIG A;  4DTS A;  2E4L A;  1JLC A;  1IG9 A;  4DWI A;  1KFD A;  5T7B A;  4B3O A;  1UAX A;  3KLI A;  5KTQ A;  1RDD A;  3HPO A; 
#chains in the Genus database with same CATH topology
 1RT7 A;  2P5O A;  4DTM A;  3V4I A;  3VQD A;  3ZSR A;  3R1X A;  1A5V A;  1RT5 A;  5H1S Q;  3J81 O;  4HTL A;  5EY4 A;  1K8A O;  4YOU A;  4M7X A;  4BR5 A;  4JV5 K;  3VQ4 A;  2GWK A;  3O3H A;  3LM9 A;  3V9S A;  2QXL A;  2D5R A;  2QWL A;  1QQO A;  4CES A;  4L8R B;  2X78 A;  3G71 N;  2A1S A;  3UKU B;  4JEP A;  1MWK A;  4FSV A;  1N5Y A;  3WNH A;  4DSL A;  4AH9 A;  5FPD A;  4BVP A;  1ATR A;  4CEC A;  4CJQ A;  1S6Q A;  1WBB A;  4BRC A;  4DR6 K;  1P90 A;  3N4P A;  5SWM A;  3TTF A;  5B8H A;  3CJC A;  3SUQ A;  1HR0 K;  4M3Y A;  2Q1N A;  4M42 A;  1YIT N;  1XC3 A;  1D5A A;  1TYQ A;  3C6A A;  3O08 A;  3SUP A;  1SKW A;  4KHY A;  4FL9 A;  4DTP A;  1QQM A;  1MWM A;  3O4Q A;  2F96 A;  4CJR A;  1KFS A;  2YHX A;  3WNG A;  3T69 A;  4JHD A;  3TAQ A;  4CJ4 A;  3EZ5 A;  1J53 A;  1NGJ A;  2BUP A;  4DG1 A;  3CI5 A;  3L3V A;  4DQS A;  5KPZ A;  1NJY A;  3M8R A;  4CF9 A;  4CF0 A;  1NOY A;  3KKS A;  4I2P A;  4EAH D;  1YJW N;  2PYJ A;  5AQH A;  3ZX3 A;  2D0P A;  4CEZ A;  4DU4 A;  1HRH A;  2G8H A;  3H3N O;  1WUA A;  3TU5 A;  2QWN A;  3CM5 A;  3ENB A;  3R6M A;  2BH1 A;  3TSU A;  2P9K A;  5ADX A;  3S3M A;  1QHT A;  1ILY A;  1XHX A;  2ZE2 A;  1JLQ A;  1HKG A;  3MX2 A;  3KLF A;  3EEQ A;  3G10 A;  2BAN A;  1RBS A;  5BPN A;  1TYQ B;  3F2K A;  4GW6 A;  3SAH A;  4Z0U A;  5BPL A;  4H4M A;  4BRA A;  1VHX A;  4BRF A;  4UY8 O;  4BGB A;  3C0B A;  4JHD B;  3TWH A;  5M1K A;  3PY8 A;  5HL7 L;  1T6D A;  2XRI A;  2YKN A;  1DT9 A;  4CFD A;  4CGD A;  1X3M A;  3A5L C;  1VQK N;  4C1N K;  4BRD A;  1ATN A;  1GLJ O;  3VEY A;  4A5B A;  2GUI A;  5C2F A;  4B1Z A;  4B9T A;  4FLU A;  5BR8 K;  4FJ7 A;  3PV8 A;  1KD1 O;  4J2E A;  1JLG A;  4ELV A;  1BQM A;  3CQY A;  4PUO A;  3AO2 A;  1NKE A;  2ZJP L;  4IOX A;  2E20 A;  2P9K B;  2XY5 A;  4BY9 C;  2FSJ A;  1JKH A;  2B6A A;  3I8D A;  3MWT A;  4KHQ A;  2WTU A;  3BZK A;  1HX1 A;  5AZI A;  4HCB A;  1KTQ A;  4DS5 A;  4XH5 A;  2RHK A;  3HVR A;  1VSJ A;  2UUC K;  3VER A;  4JRP A;  3K5L A;  4E19 A;  5AQJ A;  1EWR A;  4R79 A;  4CEQ A;  2UU9 K;  4CIF A;  2Y1I A;  3PX6 A;  1JLF A;  3DLB A;  3LP1 A;  2V51 B;  3CCE N;  1E4F T;  1YVN A;  2LSN A;  2O4I A;  2VCP A;  3HPG A;  1U6Z A;  1ZXO A;  3CFO A;  5FPN A;  3L6Q A;  3U3Y A;  1HLU A;  4BR9 A;  3T19 A;  2VGM A;  1B9D A;  2HHH K;  1LWE A;  1Y64 A;  5KRT A;  4RG8 A;  3CQX A;  4CZL A;  3MEE A;  2FLO A;  5AJ3 K;  3AGR A;  4F8R A;  4B9U A;  4ID1 A;  5JS2 A;  5AQS A;  3NE6 A;  1JXB A;  2D0B A;  4JD2 A;  3ZSQ A;  2NRR A;  5AZI B;  3AVB A;  4GY2 B;  1DGK N;  3VF2 A;  3AV9 A;  5KPT A;  3C6T A;  1JJ2 M;  5EOY A;  1BA1 A;  4NXM K;  5HOO A;  1QVF M;  4CJT A;  1EO1 A;  2X6N A;  3ATV A;  3TPQ A;  3TAM A;  4C8K A;  1VK0 A;  3OYN A;  2ZJQ L;  2OPQ A;  3CHW A;  4HUF A;  4AHT A;  4NYN A;  4ZTJ A;  3CER A;  1ITG A;  1JLA A;  3SJJ A;  1XI1 A;  5C10 A;  1YVU A;  4BRH A;  1EP4 A;  3JXU A;  3KZB A;  1A5X A;  1RTI A;  1S1X A;  4ICL A;  3S41 A;  4BWJ A;  4I2Q A;  1CLQ A;  4X66 K;  3UB5 A;  5GAH P;  2QWM A;  3F5T A;  4EP5 A;  3O3G A;  3NGI A;  2KQ2 A;  5C25 A;  4B1V A;  1LWF A;  3HRG A;  5HLF A;  4FK2 A;  3EE8 A;  1YIJ N;  4JD2 B;  2VGN A;  3O1W A;  1RDC A;  3PO4 A;  3AVN A;  1NK9 A;  4DSE A;  2FSN A;  1C0T A;  3AVG A;  4IO8 A;  4F2S A;  3K59 A;  2D0C A;  3P31 A;  1W0H A;  1NK4 A;  1V4S A;  4W5Q A;  1TV6 A;  3VQ7 A;  4B9V A;  3VF6 A;  4JKG A;  4K43 A;  1Z6R A;  3CCU N;  2P9S A;  4ILG B;  1OH7 A;  3CC7 N;  1EKE A;  1BUP A;  5FLX O;  3U9D A;  1RBR A;  3G0Z A;  3DAW A;  4K42 A;  2YI1 A;  4DTO A;  3O9Q A;  4JYA K;  3WXI A;  4BRG A;  2IDO A;  2PZS A;  1C0U A;  1NJI O;  4CEA A;  4OPH A;  3BP8 A;  4WQ4 C;  2CH5 A;  3TAB A;  3MAQ A;  3SQ4 A;  2F4V K;  1M1K O;  4KI6 A;  3WQU A;  4CGG A;  4O44 A;  4ID5 A;  3ID6 A;  3JAM O;  3QML A;  5I3U A;  3VQQ A;  3L0Q A;  1Z26 A;  2D0O A;  5C24 A;  2ASP A;  3RRG A;  4AM6 A;  4IXC A;  3IUC A;  4AHC A;  1IKW A;  4E7H A;  2DFE A;  3TAR A;  2BE2 A;  5M1F A;  4DV5 K;  2OPP A;  3LZI A;  3O9S A;  3AVK A;  4J8F A;  4TSX A;  5GIP A;  1VQ7 N;  1J54 A;  4JKG B;  3A5M C;  4F9O A;  1GLB G;  4B8A B;  2OPS A;  3U9Z A;  2R7Y A;  1MU2 A;  2P9S B;  4FZX C;  3DRP A;  1RNH A;  4DSI A;  3S9H A;  4M3X A;  3FFI A;  5DMR A;  3OS1 A;  1FW6 A;  3QO9 A;  4LF6 K;  3LPT A;  4W5O A;  4BR7 A;  4H5N A;  2Y1J A;  4X62 K;  4BRL A;  2B5J A;  3P1G A;  2O8D A;  4FJL A;  1D9D A;  3HI0 A;  4IEI A;  3QEX A;  1HNX K;  2XY7 A;  3DXM B;  4LF8 K;  4NO7 A;  5KI6 A;  3WUH A;  3M1F A;  4CK1 A;  4JS5 A;  1KXP A;  3DLK A;  2XY6 A;  4DR7 K;  4JNE A;  1KLM A;  3VGL A;  2ZJR L;  1NG9 A;  5GAE P;  1A5W A;  4CD1 A;  4F2R A;  3QNO A;  2NRX A;  3CCV N;  4M3W A;  1Q9X A;  1S1T A;  4FW2 A;  5EVZ A;  3BZC A;  2WFB A;  1BIZ A;  3F9M A;  3T7Z A;  3RVC A;  3UIQ A;  5BRD A;  3AA5 X;  2DTU A;  4RCH A;  5FRO A;  1NK8 A;  1VQO N;  5J2M A;  4YHH K;  4CGJ A;  3J8A A;  4CBU A;  2QWO A;  2O8D B;  1HYV A;  2HST A;  4KH4 A;  4AHV A;  4H0X B;  1H1V A;  1GLE G;  1SL0 A;  3VEZ A;  3NGZ A;  4FWM A;  1WSF A;  4BRK A;  2EWS A;  4LF7 K;  3VQB A;  1NK0 A;  1IG8 A;  3ZT1 A;  1Q86 O;  2W6L A;  4CI6 A;  4PWD A;  1BI4 A;  1RDA A;  4LF9 K;  4JI3 K;  4F3O A;  2QWR A;  4FWL A;  3QB0 A;  2OZM A;  2YHW A;  3VGK A;  4KTZ A;  4CZG A;  1KFD A;  3KLI A;  4DHY A;  3VET A;  3L2V A;  5AQY A;  2NNW A;  4DLE A;  3V6D A;  1RFQ A;  2JGU A;  2Q0U A;  3ZSW A;  4CHN A;  4BC3 A;  4DQI A;  3NF8 A;  1DEJ A;  4JI6 K;  3RR7 A;  1Z25 A;  4Z94 A;  4YOR A;  4OGC A;  3IAY A;  3C94 A;  2OTL N;  2I7P A;  1L3U A;  4C1N I;  3O8M A;  1JL2 A;  3E66 A;  1SAZ A;  4H0P A;  4DV3 K;  4CHZ A;  4IFE A;  3D2F A;  1RGI A;  1XC9 A;  1S6P A;  4WQ4 A;  4CJW A;  2PY5 A;  5MLC Q;  4C8M A;  2VWK A;  4O0J A;  5AQN A;  2WBN A;  4JKA A;  3LPU A;  3QBW A;  4C23 A;  3KTQ A;  2HVI A;  2P9I B;  1C0M A;  1DLO A;  3DOL A;  3WXJ A;  1RCH A;  1D8Y A;  3H08 A;  4EFH A;  4I9Q A;  4B9Q A;  3KK2 A;  4CF8 A;  4KRE A;  5HRP A;  4WYB A;  5JLF A;  2KZZ A;  3ZLJ A;  2KHO A;  4C8O A;  2HND A;  4M45 A;  3H45 C;  2IVP A;  4MDA A;  5AQP A;  1VQ4 N;  4JKB A;  4PA1 A;  4BVO A;  3OYC A;  5BRH A;  5EU7 A;  2I5J A;  3OTO K;  1TKD A;  4CD3 A;  1HKC A;  4CK2 A;  1VAZ A;  4CIE A;  1GLD G;  1N6Q A;  4O4G A;  1NGG A;  3U4L A;  1HYS A;  2A40 A;  1VSK A;  5ADX H;  4F3T A;  4OPK A;  1FXX A;  4JI0 K;  3CC4 N;  4IJA A;  3D2F B;  3QBX A;  1C1B A;  3O4N A;  5LL6 Z;  4B1Y B;  4M63 C;  4UQG A;  2ZQB A;  3NDK A;  2DPN A;  2O8F A;  4OGE A;  5AQL A;  3CFP A;  3LP2 A;  3U3G A;  1IBM K;  4JI5 K;  2G8F A;  2HBJ A;  5AFU A;  4DV6 K;  5LMU K;  4OVL A;  2DFH A;  2ASO A;  3MDQ A;  3GOI A;  3LL3 A;  4FWS A;  4BDP A;  1FKP A;  3W0L A;  4Y1D A;  1U4B A;  5GIO A;  3SBG A;  3DLR A;  5C15 A;  4JI1 K;  3HO1 A;  1C0F A;  1RIL A;  3C6U A;  3LP3 A;  3HM9 A;  4PQU A;  3CCL N;  3OBY A;  1QE1 A;  5F1X A;  3ZSY A;  2PYL A;  4Z4C A;  5BRF A;  2YJF A;  1Y97 A;  1RDU A;  1HMV A;  3SMS A;  3R3L A;  3QIC A;  4O8U A;  4WFN L;  3VTI A;  1VRT A;  1K8K A;  3H1V X;  4GNI A;  1F21 A;  1GLL O;  4HUE A;  3TI0 A;  2XO7 A;  1I3A A;  2P9L B;  1QQN A;  4CF1 A;  2WON A;  1T3V A;  3I0S A;  3TTD A;  2GEL A;  3TAP A;  4DTU A;  3SYZ A;  4CVN E;  4JKC A;  3EYZ A;  2O8F B;  5IWA K;  1OVY A;  4FLV A;  4B3M K;  1P8Z A;  3PSI A;  1D9F A;  4CCH A;  1NGF A;  3LDO A;  3PIP L;  1NJX A;  1TAQ A;  3RSE A;  2NZT A;  3CCJ N;  1OKJ A;  1JLE A;  2QW9 A;  3KIO A;  3ZSO A;  4OKJ A;  5FPE A;  2YNG A;  3BEX A;  5AQZ A;  1VQL N;  3KLG A;  3F73 A;  1GLF O;  3C65 A;  3RR8 A;  3PUF A;  4J2B A;  3M8P A;  2OYQ A;  5M1Q A;  3HP9 A;  3SMP A;  2HNY A;  1NM1 A;  3QEW A;  4BR0 A;  2IVO A;  1CXU A;  5DK5 A;  5AQK A;  3K5O A;  3FZL A;  2UXB K;  3TSQ A;  4DR2 K;  4B8C A;  4HWI A;  4QS7 A;  1S9G A;  4B3T K;  2ITM A;  3ZSV A;  1BOT O;  3RWU A;  1ASU A;  3FZM A;  2YHB A;  2Q3S A;  3O1B A;  2GUP A;  2A41 A;  4DFK A;  2ZWH A;  3P38 A;  1RBV A;  4OX9 K;  4FZY A;  3HOT A;  3SPZ A;  1JL1 A;  1VSH A;  4KAZ A;  2QK9 A;  4N56 A;  1TUY A;  3RSE B;  1NLV A;  3ISN C;  4Z4E A;  1B9F A;  4M7Y A;  3CME N;  1JLB A;  3SK3 A;  4KBO A;  3PIO L;  4KRF A;  4YFU A;  1KLN A;  2OA8 A;  1NGI A;  3DRR A;  4H5V A;  1UA1 A;  1YHQ N;  1C0G A;  3ALY A;  4WQ5 C;  1EWQ A;  1EET A;  4LSN A;  3L2W A;  2HF4 A;  2XHB A;  3SZ2 A;  1QVG M;  4BQL A;  4A62 A;  3BUZ B;  1J5E K;  1K6Y A;  2OAN A;  3G6E N;  1NK7 A;  3VA0 A;  1SKR A;  3WT0 A;  3B6P A;  3CFR A;  4CZM A;  4Y1C A;  4MQ3 A;  5FRN A;  2KW4 A;  5TKW A;  2HVH A;  1DKG D;  3D6R A;  1S3X A;  3R8E A;  4EHU A;  2NRZ A;  4DFJ A;  3TAF A;  1YF5 L;  2NRH A;  4FJ5 A;  4ISF A;  3EN9 A;  2UUB K;  5E26 A;  3K58 A;  4FOE A;  1BDG A;  3A5O C;  5HRN A;  1FJG K;  2KLA A;  3LDN A;  1RT2 A;  3ZX0 A;  2YHA A;  3TAE A;  2ASM A;  1S1V A;  3M8Q A;  3ZSX A;  3K5M A;  1NMD A;  3SBT A;  3K57 A;  3AA3 A;  3WXL A;  3QER A;  2A1R A;  1YTA A;  5TKY A;  1C1C A;  4IDK A;  4KH5 A;  3CMA N;  1UA0 A;  3FZK A;  3HTV A;  3SQ0 A;  1IBL K;  3KVG A;  3CYM A;  4DV4 K;  2BDP A;  4K0K K;  4JLH A;  1SQK A;  3CPW M;  3FE1 A;  2VQE K;  2OPR A;  3GBT A;  2HHU A;  1MDU B;  2HB5 A;  1KAX A;  4DKW A;  4FLX A;  3AVI A;  3HJF A;  4M3Z A;  1XNQ K;  4JKD A;  4A5A A;  1EQY A;  2ATQ A;  4B9M A;  4FWO A;  4YOW A;  3V9Z A;  2F8S A;  5JS1 A;  3SPY A;  1Q81 O;  1RT3 A;  1HYZ A;  2NRW A;  2X6S A;  3CG7 A;  4FOI A;  3B6O A;  3QIO A;  1EXQ A;  4Z4H A;  3L8B A;  4DU3 A;  3RMC A;  1S1W A;  1ZBF A;  1WBD A;  4CJS A;  3U8X A;  4FJJ A;  4O55 A;  3HP6 A;  4CW7 B;  2Z1I A;  3TTC A;  5CHI A;  4JKH A;  2W6K A;  3KK7 A;  2NRT A;  1I94 K;  4YDU C;  3MEG A;  3Q7B A;  4EIA A;  4E7L A;  4CJ5 A;  1VQ8 N;  4O5B A;  2G8W A;  5HBM A;  5GAD P;  1ZYQ A;  3HXM A;  4DFM A;  3AVL A;  1TK0 A;  4LFC K;  3ZSZ A;  3A2F A;  3HT3 A;  3HL8 A;  4KHU A;  1ZBU A;  1N32 K;  3E9L A;  3QFP A;  3JS6 A;  1NK5 A;  1S72 N;  4FVM A;  4LF5 K;  2VWJ A;  1QSL A;  4A57 A;  3CIP A;  1QSS A;  2GWJ A;  4DQQ A;  4MDB A;  4B08 A;  2G8V A;  1T7P A;  4KPY A;  3THX A;  4CHQ A;  1IV0 A;  1QQC A;  3C7N A;  4O0I A;  4WQ5 A;  3LAK A;  1WAJ A;  3MX5 A;  3AVA A;  3VTH A;  2YHY A;  4I6M A;  4BRQ A;  1G15 A;  4E89 A;  3LWM A;  3KLH A;  3VA3 A;  4CEB A;  1VRU A;  3AVJ A;  3MMV A;  2FF3 B;  1XMO K;  3CQ8 A;  3T1Y K;  1IG9 A;  1JLC A;  4BR2 A;  4RTF D;  3J7A P;  3KWG A;  1RDD A;  3HPO A;  1QZ6 A;  4ZHR A;  4A2A A;  4JI2 K;  1LOT B;  3ZX2 A;  3ENH A;  3VEN A;  4KO0 A;  4LFA K;  3NGY A;  1VQ9 N;  4B3S K;  2DFF A;  4WFA L;  1KVA A;  4DTX A;  4DSF A;  1S9E A;  1CZA N;  3OYB A;  4CER A;  3VQC A;  3V81 A;  2RN2 A;  3CM6 A;  4OKE A;  4JRQ A;  4IDH A;  4B3R K;  4HTU A;  3THX B;  3SAF A;  3FFK B;  1ZBL A;  3HBT A;  3DMJ A;  4WCE L;  1C1A A;  4GV3 A;  2IAJ A;  2QWP A;  1JCG A;  3C7N B;  3O3F A;  1CXQ A;  3G25 A;  4Y0W A;  3DI6 A;  1W9H A;  3J7Y P;  3KLE A;  4DTJ A;  3QNN A;  1D4X A;  4H0Y B;  1SS6 A;  4IFY A;  3QEI A;  4F4K A;  4I6M B;  3SQ1 A;  1TUU A;  3DYA A;  2FC0 A;  4DR4 K;  3L3U A;  1L3S A;  4AQY K;  1KCF A;  2A42 A;  2ZGY A;  3KHY A;  5EX5 A;  4HUG A;  5D3G A;  3V1Q A;  4IG0 A;  5AQV A;  1M90 O;  1QZ5 A;  1BCM A;  4GVE A;  4LH5 A;  4DF4 A;  2ZD1 A;  3I8B A;  3TSP A;  4OJR A;  1E4G T;  4KV8 A;  4ZTF A;  5AQG A;  1ATS A;  3MXJ A;  2YX6 A;  4CED A;  4BRI A;  3PX0 A;  5KGW A;  1Q82 O;  3ZCM A;  2HBL A;  4DLG A;  3W3D A;  4KHW A;  5LJV A;  3QEV A;  3LP0 A;  4BAC A;  2FBT A;  3H3O B;  1HKB A;  1XQS C;  1BG3 A;  2W40 A;  3LDP A;  1WNS A;  2D4W A;  2FBV A;  3AVC A;  4CZH A;  4CZJ A;  1FK9 A;  5M1N A;  2UXD K;  1YJN N;  2F9T A;  4DQP A;  4QS8 A;  4CJV A;  1UOC A;  3NFA A;  4CGH A;  4BRE A;  4FPB A;  1IO2 A;  3OYJ A;  3K2P A;  1HPZ A;  4H5R A;  4CZI A;  2AP1 A;  4E0D A;  4YDU A;  5AFU H;  3T3F A;  1NK6 A;  2PAV A;  2Q0R A;  4KB0 A;  5AQR A;  3CCQ N;  3EY1 A;  4KHS A;  3MN7 A;  5KPR A;  1SL1 A;  4DR3 K;  4LY7 A;  3T1H K;  1LAW A;  1FKO A;  5DM6 L;  2CGL A;  4FM2 A;  5JVH L;  4OLA A;  3NH1 A;  1S22 A;  5F0X A;  3ZYY X;  3DM2 A;  4FJG A;  2KFZ A;  3RMA A;  1SL2 A;  1NWK A;  4KKO A;  1ZBI A;  4QS9 A;  3WEE A;  3C6H A;  2YJE A;  4DQ8 A;  3VEO A;  4HVJ A;  4CJU A;  2E6M A;  3SQ2 A;  2CGJ A;  4NCG A;  4IG3 A;  3GL1 A;  2QKK A;  3A8Y A;  1WN7 A;  4GMJ B;  1TK5 A;  5AQF A;  4B1W B;  2QXF A;  3ZEU A;  1TL3 A;  1NOZ A;  1KQS M;  2BTF A;  4KH6 A;  3K5N A;  3V1O A;  5BRE A;  4NCA A;  1T05 A;  5AQQ A;  3J80 O;  5E41 A;  3CCR N;  1OVQ A;  4MLE A;  1HPM A;  1ESV A;  1VSE A;  1GOA A;  5AQU A;  1VQ5 N;  1VSF A;  4CJK A;  2GTD A;  4DUZ K;  5JMV A;  4Q5V A;  4NCB A;  3OYD A;  3CET A;  3LDS A;  1TKZ A;  3NAE A;  3WEE B;  3AO3 A;  4GV6 A;  3UE5 A;  1TVR A;  5FRM A;  1BI4 B;  1XWL A;  4X64 K;  4ILH A;  3VQE A;  3FZF A;  2KTQ A;  1K73 O;  3ZT3 A;  2IS3 A;  4E1J A;  5EXW A;  1HNZ K;  4M3T A;  4NB4 A;  1YUW A;  2O4G A;  5C0Y A;  3SUN A;  2P5G A;  3BDP A;  2V52 B;  3OA9 A;  1O1W A;  2G8K A;  4CJ7 A;  4GKK K;  1BGX T;  1BIU A;  2YKM A;  2E2Q A;  5JLH A;  1N8R O;  4OO1 J;  1WSH A;  3FLC O;  2QWQ A;  4BC2 A;  3SCX A;  3OYK A;  4FXD A;  4H0O A;  1MA9 B;  3C95 A;  3Q7C A;  2HHT A;  2DY4 A;  3E9P A;  2WUS A;  2F8T A;  3SV4 A;  4FWK A;  4CHP A;  4H0V B;  3VMF B;  4CF2 A;  4YOX A;  3OYM A;  3NVK A;  2IOC A;  1LW2 A;  3M5R A;  3PSF A;  1SUQ A;  3NF7 A;  5LJW A;  4H0T B;  5HP1 A;  4E7J A;  4HHT A;  2OTJ N;  4GKJ K;  1BHL A;  3D2E A;  4CJE A;  3HPH A;  4OPJ A;  3B8A X;  4YOV A;  3V9X A;  4CJ3 A;  5IT9 O;  2ZM6 K;  2VG6 A;  2IC3 A;  1YT3 A;  3MWP A;  1JCF A;  1HJO A;  4PY5 A;  1IJJ A;  4CGI A;  4PL8 A;  4DUY K;  3IKM A;  3PLA A;  5AZJ A;  3OYE A;  4Z4F A;  4XH4 A;  1SV5 A;  4RW6 A;  3SI6 A;  4WFB L;  2WOM A;  4DS4 A;  4BRM A;  2E1Z A;  4E1N A;  3I0R A;  3K0S A;  3AA2 A;  4KB1 A;  1VQP N;  1IBK K;  3O9T A;  4FJM A;  4CJF A;  4ELU A;  3SAG A;  1TAU A;  2NUB A;  1LCU A;  3VQ6 A;  4CBW A;  4FZZ A;  1NBW A;  1NGC A;  2HMI A;  4W5T A;  3O4W A;  1IKV A;  3QFU A;  1XNR K;  4CK3 A;  4LFB K;  4CGF A;  2V7Z A;  3BF3 A;  4U67 L;  4B9N A;  1VQN N;  3MK6 A;  3IS9 A;  4KI4 A;  3V1R A;  3ASM A;  3HST B;  3D2E B;  1BO5 O;  2HHV A;  2O8E A;  3PO5 A;  1HUX A;  3HK2 A;  1RDW X;  4MO4 A;  1C6V A;  3QES A;  3AAR A;  1EX4 A;  4FJK A;  4IO9 L;  5AZJ B;  1YAG A;  3CJ7 A;  1RTJ A;  4IZ9 A;  1U2V A;  3AA4 A;  2X74 A;  3WNE A;  4B9L A;  3OY9 A;  3OHR A;  4DFP A;  5CE3 A;  2BGG A;  5CY4 A;  3DXK A;  3CJ1 A;  3K9K A;  1Q8I A;  3T1A A;  2FBX A;  3CF5 L;  4IOC L;  2VQF K;  4FWN A;  3RMB A;  2HNZ A;  4I9L A;  1K8K B;  3OJS A;  3MEC A;  1RTH A;  1QSY A;  3OYL A;  4JI4 K;  4EP4 A;  4YOY A;  2OCE A;  4BE2 A;  2D0A A;  3QIP A;  5GAG P;  1BL3 A;  2O8E B;  3HVT A;  4FJH A;  3FR0 A;  2NLX A;  1YI2 N;  1WLJ A;  4JKE A;  4FWQ A;  3L2Q A;  3EO3 A;  1U2V B;  5I9E B;  4QCL A;  1DTT A;  4XEI A;  1XMQ K;  4CJL A;  3CD6 N;  1IKX A;  5C2D A;  5HRO A;  3S3N A;  2OZS A;  2GBZ A;  2ZGZ A;  3DXK B;  4N5S A;  3VQ8 A;  1BCO A;  3CJ9 A;  3OYA A;  3ID8 A;  1UWB A;  2W41 A;  3NBP A;  4BG9 A;  4IBN A;  1GOB A;  2AA4 A;  2JLE A;  4U7B A;  3LZJ A;  1W2B M;  1X9J A;  5I42 A;  4Z4G A;  4CHY A;  2H3G X;  4KTQ A;  3OS2 A;  3DOK A;  3VEW A;  2XY8 A;  1BIS A;  3L4I A;  3N4Q A;  4XIU A;  3RTV A;  3M3Z A;  1Q18 A;  4BC5 A;  4NXN K;  1WOQ A;  4IWV A;  2HHS A;  4C8L A;  4Q0B A;  1I39 A;  4CFA A;  1NKC A;  1ZBH A;  5J2P A;  2IVN A;  3VEV A;  3OS0 A;  4R5P A;  1K9M O;  3HM8 A;  4RW7 A;  4BWM A;  2QM1 A;  5CR4 A;  4KTW A;  1IKY A;  4GVM A;  4FWP A;  2VG5 A;  2VWB A;  4DQR A;  4YNQ A;  1XUP O;  2P1J A;  4CJP A;  3AO4 A;  3AO1 A;  4V19 S;  3DLL L;  2IIR A;  5KGX A;  4CIG A;  4DTS A;  2E4L A;  4PKH A;  4B3O A;  5KTQ A;  4RWT A;  3CPE A;  3VQ5 A;  4QAG A;  2EHG A;  3MCA B;  4IJN A;  1OH6 A;  2Z1J A;  3VEX A;  3ZT4 A;  3HZ6 A;  1Z05 A;  3NVM A;  4E1M A;  4MFB A;  3LWL A;  4EZ9 A;  5BN9 A;  2VG7 A;  3ULD A;  4FPA A;  3GG4 A;  4E7K A;  3OYI A;  4AHR A;  5HRS A;  3V9W A;  3A0I X;  3QEP A;  2HBK A;  1WAF A;  3AVM A;  3AAP A;  3THW A;  4J2A A;  4FLT A;  3O9U A;  4K8Z A;  2ETJ A;  3KJV A;  3ZET A;  3THV A;  3DJC A;  4H4O A;  1NJZ A;  1J6Z A;  2HHQ A;  2KZM A;  1U45 A;  2KFN A;  1TKT A;  4BRP A;  2RF2 A;  3GDQ A;  3O5B A;  1NGA A;  1NU0 A;  5KQ8 A;  3ATU A;  3AVF A;  3DWL A;  3QLH A;  2FSK A;  4DR5 K;  4AHU A;  5M1P A;  3RRH A;  3OYG A;  3H1Q A;  1RT1 A;  2FF6 A;  4LD0 A;  5AQM A;  1QHA A;  3O9R A;  5A2Q O;  1KSP A;  1VSM A;  4A59 A;  4O5F A;  1OH5 A;  3OYH A;  2QEX N;  3HSC A;  2Q2R A;  5LY3 A;  1N33 K;  3IG1 A;  3P5J A;  4CFC A;  3DLH A;  2QI2 A;  2VYP A;  5AQX A;  4WF9 L;  3MN9 A;  2WC9 A;  5C12 A;  5HRR A;  3EZW A;  2Q97 A;  3THW B;  3KKR A;  3LAL A;  2G8U A;  4LF4 K;  4DV1 K;  1KC8 O;  1QTM A;  2RKI A;  2A6A A;  3TAN A;  4K8X A;  1T03 A;  3ZET B;  1RT4 A;  4FJ8 A;  4H8K A;  3R9P A;  4FLY A;  4FLZ A;  3O80 A;  4MO5 A;  2P9U A;  1SKS A;  3ZT0 A;  1KRP A;  4IKF A;  2QKB A;  2JWL A;  1KVC A;  1NGB A;  3MCP A;  3EL2 A;  4FO0 A;  3WXM B;  4B9S A;  4ILJ A;  2HOE A;  5J2Q A;  4FWR A;  2HHX A;  3VGM A;  3E01 A;  1J5O A;  4DTR A;  3E9O A;  5AQW A;  3SJH A;  4H03 B;  4H5T A;  4CBX A;  1CZ9 A;  1VQM N;  3L2R A;  1YXQ A;  2Q31 A;  4FK0 A;  5AR0 A;  3TAG A;  3AVH A;  1HQE A;  5CYQ A;  1T6C A;  5LMN K;  4G9Z A;  4LSL A;  4CHO A;  3WNF A;  4FYD A;  3AAQ A;  2HW3 A;  3I55 N;  2Z1H A;  3DLG A;  3KWI A;  5K14 A;  1BWF O;  5J2N A;  3OVN A;  3KK3 A;  4M41 A;  2PBD A;  1W7A A;  1Q7Y O;  1L3T A;  5GIN A;  3NH0 A;  4PHT X;  3S3O A;  1WB9 A;  1HQU A;  1YTU A;  4A61 A;  1KAY A;  3L2U A;  2P9U B;  4FM1 A;  1RBU A;  2P9P A;  4BC4 A;  3QDK A;  1QS4 A;  4AHS A;  3DLE A;  4LH4 A;  1BU6 O;  1T8E A;  3D7E O;  3DRS A;  3O6W A;  1R59 O;  2E1Y A;  3MXM A;  3M6G A;  1RDB A;  3NF6 A;  4CEO A;  3LDL A;  3IMX A;  1G99 A;  3D0P A;  1GLA G;  3KK1 A;  3BY5 A;  3M8S A;  3AY9 A;  1ASV A;  2CGK A;  4H5W A;  4N41 A;  4BGA A;  3FZH A;  3PX4 A;  4C8N A;  3DXM A;  4BR4 A;  1X1P A;  5F2R A;  1U49 A;  1VSL A;  5BN8 A;  4JKF A;  2GEM A;  1LV5 A;  3AO5 A;  1IH7 A;  4FJ9 A;  4W5N A;  3ZT2 A;  1Q9Y A;  3JYT A;  4J2D A;  3VQA A;  3CJB A;  4XH1 A;  4QOZ B;  2ZF5 O;  1WSG A;  4FW1 A;  1TK8 A;  1LW0 A;  3H6E A;  3BGR A;  1BA0 A;  1X3N A;  4OKK A;  4ELT A;  5E84 A;  2P9P B;  3SLC A;  3WQT A;  2Q36 A;  4BRO A;  3I33 A;  4CFB A;  4JAX A;  4IEE A;  4NYF A;  2E8A A;  3VQP A;  3VN5 A;  2J4R A;  5ELZ A;  4RW4 A;  2E6L A;  2E5L K;  1V4T A;  1YJ9 N;  1HNW K;  4A2B A;  3LAM A;  4DV7 K;  2JWK A;  3CXC M;  4DR1 K;  4RW8 A;  1HJR A;  2HBM A;  4BE0 A;  3KD1 E;  2Z1G A;  3V9U A;  4JI8 K;  4NLB A;  3EE9 A;  5CYM A;  4YY3 K;  1OH8 A;  2E88 A;  1N36 K;  4X65 K;  4MLH A;  3MXI A;  1E3M A;  1JXE A;  1O13 A;  1T44 A;  4DF8 A;  4FVU A;  1ZC6 A;  3IFR A;  3I56 N;  2PFU A;  1XHZ A;  2HF3 A;  3BF1 A;  1WSJ A;  2E2O A;  2E2P A;  4JK7 A;  2RPI A;  1U47 A;  3CCM N;  1ZBS A;  2V7Y A;  3NH2 A;  4M3R A;  3EKS A;  3MN6 A;  3A5N C;  4GV9 A;  2P9N A;  3VOV A;  3K9J A;  4JK9 A;  4CZK A;  1WSI A;  1VQ6 N;  4HCC A;  2O8C A;  4W5R A;  5JVG L;  2QA4 N;  2A3Z A;  5M1O A;  2IGI A;  4Z4I A;  2UXC K;  1S5J A;  2YNI A;  2CH6 A;  3OBW A;  3OW2 M;  4JI7 K;  4PKI A;  4E3S A;  5BPM A;  5CZ2 A;  2YNF A;  3EKU A;  4IFV A;  4KHP K;  4ISE A;  2YNH A;  3QIN A;  3OYF A;  5AQO A;  1U04 A;  2F9W A;  4E7I A;  2D1K A;  2KKZ A;  1R0A A;  2NRV A;  3ULE A;  4AF1 A;  2FBY A;  4O8K A;  3G4S N;  4PKG A;  4IOA L;  4JN4 A;  4DTN A;  3VF4 A;  4EHT A;  4YOT A;  4FJI A;  5KRS A;  2I7N A;  1KAZ A;  2P9I A;  3UKR A;  3OJU A;  2UUA K;  4B1U B;  4DB3 A;  1TL1 A;  4BE1 A;  1ASW A;  3P39 A;  2P9N B;  1NKB A;  3E1Y A;  1LAV A;  3MN5 A;  1L3V A;  1NGD A;  3VQ9 A;  2O8C B;  4BQZ A;  1L5U A;  1KVB A;  4OLB A;  3GE1 A;  1LWC A;  4DSJ A;  2F7T A;  2ITG A;  1S1U A;  1GOC A;  3U6F A;  4EZ6 A;  4BG8 A;  4DU1 A;  2O8B A;  4CZF A;  3L4Q A;  1X9W A;  4JS4 A;  1N34 K;  3JSM A;  4JK8 A;  3D45 A;  3ENO A;  3QET A;  3ZEU B;  3P4I A;  5AQT A;  3ULE B;  3SUO A;  1TKX A;  5DM7 L;  1X9S A;  3MED A;  4K25 A;  2EX3 A;  4RW9 A;  4DMN A;  5J1E A;  4BRN A;  4ISG A;  4WE1 A;  1BQN A;  1NGH A;  4PL7 A;  5BR9 A;  1JCE A;  5SZT A;  3SV3 A;  1J9A A;  1VSD A;  4OPA A;  1NGE A;  3UKR B;  3ITH A;  4DSK A;  1NNE A;  2B4J A;  4L3Q A;  3KD5 E;  4NLC A;  5AQI A;  4CZE A;  1SZ2 A;  3FGU A;  4G1Q A;  2GV9 A;  3LM2 A;  4DCH A;  2AJQ A;  4K41 A;  1RT6 A;  1NJW A;  1RTD A;  4FK4 A;  3HYF A;  4N76 A;  5JIC A;  4CEE A;  2W42 A;  4FCY A;  1VSI A;  4BDZ A;  2O8B B;  3J7Z O;  3SNN A;  3AGK A;  4I7F A;  1REV A;  1TGO A;  3VES A;  4FLW A;  4AIL C;  3THY A;  4FJX A;  2FXU A;  3NCI A;  1U48 A;  2P9L A;  4N47 A;  2YCH A;  1CZB A;  4BDY A;  4B1X B;  4CEF A;  3CJA A;  1W97 L;  1HNV A;  2A5X A;  4M3U A;  3HOS A;  3WXK A;  1NMN A;  4KFB A;  3NMU A;  1WSE A;  3P83 D;  3IDH A;  1DTQ A;  3LDQ A;  3NHG A;  5FDL A;  3UKU A;  4DV2 K;  5FPM A;  1RBT A;  4CE9 A;  3F9K A;  3LAN A;  4FM0 A;  3VPZ A;  2HMP A;  5C42 A;  2GX9 A;  3RMD A;  3IRX A;  4AM7 A;  2UYT A;  2HHW A;  3NF9 A;  1X9M A;  2YV0 X;  1HNI A;  1GLC G;  5CZ1 A;  2G8I A;  4KHN A;  2RE2 A;  5KQD A;  2QTD A;  3CCS N;  2P51 A;  3TR8 A;  1B92 A;  4FJN A;  4LC9 B;  2E2N A;  4DV0 K;  4DWI A;  5T7B A;  1UAX A;  3CC2 N;  3THY B;  3H46 O; 
#chains in the Genus database with same CATH homology
 3L2V A;  3VQ5 A;  1RT7 A;  4QAG A;  4ZHR A;  2P5O A;  2EHG A;  4DTM A;  3V4I A;  4DLE A;  3V6D A;  3VQD A;  3ZSR A;  2JGU A;  1A5V A;  1RT5 A;  2Z1J A;  3ZSW A;  3ZT4 A;  4CHN A;  4DQI A;  3NF8 A;  4KO0 A;  3NGY A;  2DFF A;  3LWL A;  4E1M A;  4MFB A;  3RR7 A;  4EZ9 A;  1Z25 A;  3VQ4 A;  1KVA A;  2VG7 A;  3ULD A;  4OGC A;  4E7K A;  3O3H A;  4DSF A;  4DTX A;  3IAY A;  1S9E A;  3C94 A;  4AHR A;  5HRS A;  3OYI A;  3V9S A;  3V9W A;  3OYB A;  4CER A;  3QEP A;  1WAF A;  2D5R A;  3AVM A;  3VQC A;  3V81 A;  2RN2 A;  4FLT A;  3CM6 A;  4OKE A;  4JRQ A;  4J2A A;  4CES A;  4HTU A;  4L8R B;  2X78 A;  4K8Z A;  2ETJ A;  1ZBL A;  1HYS A;  1L3U A;  2A1S A;  3DMJ A;  1JL2 A;  1C1A A;  3KJV A;  2IAJ A;  3THV A;  3O3F A;  1CXQ A;  4H4O A;  1NJZ A;  4CHZ A;  1N5Y A;  3WNH A;  3DI6 A;  1U45 A;  4DSL A;  2HHQ A;  2KZM A;  1TKT A;  4AH9 A;  2RF2 A;  1W9H A;  3KLE A;  1XC9 A;  1S6P A;  4DTJ A;  3QNN A;  4IFY A;  4CEC A;  4CJW A;  3QEI A;  4F4K A;  3SQ1 A;  3DYA A;  1S6Q A;  2FC0 A;  4CJQ A;  2PY5 A;  3AVF A;  3L3U A;  5SWM A;  3QLH A;  1L3S A;  4C8M A;  3SUQ A;  1KCF A;  4M3Y A;  2VWK A;  4O0J A;  4AHU A;  3RRH A;  4M42 A;  3OYG A;  3LPU A;  4HUG A;  5D3G A;  1RT1 A;  4IG0 A;  3V1Q A;  4LD0 A;  3KTQ A;  1BCM A;  1D5A A;  3SUP A;  4KHY A;  2HVI A;  1SKW A;  1C0M A;  1DLO A;  4LH5 A;  4DTP A;  3DOL A;  4DF4 A;  1RCH A;  2ZD1 A;  1D8Y A;  1KSP A;  4OJR A;  3H08 A;  4KV8 A;  4ZTF A;  1VSM A;  3O4Q A;  2F96 A;  4CJR A;  4I9Q A;  3KK2 A;  1KFS A;  4CF8 A;  3WNG A;  3MXJ A;  4CED A;  4KRE A;  5HRP A;  3OYH A;  5KGW A;  3PX0 A;  3ZCM A;  2KZZ A;  4DLG A;  3TAQ A;  4CJ4 A;  3IG1 A;  3EZ5 A;  3P5J A;  4C8O A;  2HND A;  4CFC A;  4M45 A;  3DLH A;  1J53 A;  4KHW A;  4DG1 A;  3L3V A;  4PA1 A;  3QEV A;  3LP0 A;  4BAC A;  2FBT A;  4DQS A;  3OYC A;  1NJY A;  3M8R A;  4CF9 A;  5EU7 A;  2I5J A;  4CF0 A;  5HRR A;  1TKD A;  1NOY A;  3KKR A;  3LAL A;  3KKS A;  4I2P A;  4CIE A;  4CK2 A;  1N6Q A;  2G8U A;  2PYJ A;  4O4G A;  1QTM A;  1WNS A;  2RKI A;  4K8X A;  3TAN A;  4CEZ A;  2FBV A;  1HRH A;  1RT4 A;  1VSK A;  3AVC A;  4DU4 A;  1T03 A;  2G8H A;  4OPK A;  4FJ8 A;  1FK9 A;  4F3T A;  1FXX A;  4H8K A;  4FLY A;  4FLZ A;  3CM5 A;  1C1B A;  1SKS A;  4DQP A;  3S3M A;  3O4N A;  3ZT0 A;  1QHT A;  1UOC A;  4CJV A;  1KRP A;  4IKF A;  2QKB A;  1XHX A;  3NFA A;  4CGH A;  2ZE2 A;  1JLQ A;  1IO2 A;  4UQG A;  1KVC A;  3OYJ A;  3KLF A;  3K2P A;  2ZQB A;  3NDK A;  1HPZ A;  4B9S A;  4E0D A;  3G10 A;  4OGE A;  2BAN A;  5J2Q A;  2HHX A;  1RBS A;  3T3F A;  1NK6 A;  3E01 A;  3CFP A;  4GW6 A;  1J5O A;  4DTR A;  4Z0U A;  4KB0 A;  3LP2 A;  4H4M A;  3U3G A;  3EY1 A;  4KHS A;  2G8F A;  1CZ9 A;  1SL1 A;  3L2R A;  4OVL A;  2DFH A;  4LY7 A;  1LAW A;  4FK0 A;  1FKO A;  3TAG A;  3AVH A;  1HQE A;  4FM2 A;  5CYQ A;  3TWH A;  4BDP A;  3PY8 A;  1FKP A;  4OLA A;  4LSL A;  2XRI A;  2YKN A;  4CHO A;  4CFD A;  4Y1D A;  3WNF A;  4CGD A;  3NH1 A;  3DM2 A;  1U4B A;  4FJG A;  4FYD A;  3RMA A;  1SL2 A;  2HW3 A;  2KFZ A;  4KKO A;  3DLR A;  1ZBI A;  2Z1H A;  3DLG A;  5K14 A;  5J2N A;  2GUI A;  3OVN A;  3HO1 A;  4B9T A;  1RIL A;  3C6U A;  3LP3 A;  4CJU A;  4HVJ A;  3KK3 A;  3HM9 A;  2E6M A;  4FLU A;  4PQU A;  1QE1 A;  3SQ2 A;  3ZSY A;  4NCG A;  2PYL A;  4M41 A;  4Z4C A;  4FJ7 A;  3PV8 A;  4IG3 A;  1L3T A;  1Y97 A;  4J2E A;  1HMV A;  2QKK A;  1JLG A;  3NH0 A;  1WN7 A;  4GMJ B;  3S3O A;  1TK5 A;  4ELV A;  1BQM A;  1HQU A;  1VRT A;  4PUO A;  2QXF A;  3AO2 A;  1NKE A;  3L2U A;  1TL3 A;  1YTU A;  1NOZ A;  1F21 A;  4HUE A;  4FM1 A;  1RBU A;  3TI0 A;  3K5N A;  2XY5 A;  2XO7 A;  1I3A A;  3V1O A;  4NCA A;  4AHS A;  1QS4 A;  1T05 A;  3DLE A;  4LH4 A;  1JKH A;  2WON A;  2B6A A;  3I0S A;  4CF1 A;  3I8D A;  1T8E A;  3TAP A;  4DTU A;  3DRS A;  3SYZ A;  5E41 A;  3MXM A;  3EYZ A;  4KHQ A;  1RDB A;  4FLV A;  3NF6 A;  4CEO A;  4HCB A;  1VSE A;  1KTQ A;  3D0P A;  1D9F A;  4DS5 A;  1GOA A;  4CCH A;  3KK1 A;  3HVR A;  3M8S A;  1VSJ A;  1ASV A;  4JRP A;  3K5L A;  4N41 A;  4E19 A;  1VSF A;  4CEQ A;  1NJX A;  4CJK A;  4CIF A;  2Y1I A;  3PX4 A;  1TAQ A;  3PX6 A;  4C8N A;  1JLE A;  3KIO A;  4Q5V A;  1X1P A;  1JLF A;  3ZSO A;  4NCB A;  1U49 A;  3DLB A;  4OKJ A;  1VSL A;  2YNG A;  3OYD A;  3LDS A;  1TKZ A;  3KLG A;  3NAE A;  1LV5 A;  3F73 A;  3RR8 A;  3AO5 A;  1IH7 A;  3AO3 A;  3LP1 A;  1TVR A;  3PUF A;  4FJ9 A;  4W5N A;  3ZT2 A;  5FRM A;  1BI4 B;  1XWL A;  2LSN A;  1Q9Y A;  2O4I A;  3VQE A;  3JYT A;  4J2B A;  2KTQ A;  3M8P A;  3HPG A;  2OYQ A;  4J2D A;  3CFO A;  3VQA A;  3HP9 A;  3ZT3 A;  3U3Y A;  4QOZ B;  2HNY A;  2IS3 A;  3QEW A;  1WSG A;  3T19 A;  4FW1 A;  1TK8 A;  1LW0 A;  1B9D A;  4M3T A;  1CXU A;  5DK5 A;  3BGR A;  4OKK A;  1LWE A;  3K5O A;  4ELT A;  2O4G A;  3SUN A;  5KRT A;  4B8C A;  4RG8 A;  2P5G A;  3BDP A;  4CFB A;  1S9G A;  1O1W A;  2G8K A;  1BGX T;  3ZSV A;  1BIU A;  2YKM A;  3MEE A;  4NYF A;  3RWU A;  1ASU A;  2YHB A;  2Q3S A;  4F8R A;  3VQP A;  3VN5 A;  4DFK A;  1WSH A;  1RBV A;  4B9U A;  4ID1 A;  5JS2 A;  3OYK A;  3NE6 A;  3SCX A;  1JXB A;  2D0B A;  4RW4 A;  4FZY A;  3ZSQ A;  3SPZ A;  4FXD A;  3AVB A;  1JL1 A;  2E6L A;  3C95 A;  2HHT A;  1VSH A;  2DY4 A;  4Q0B A;  3LAM A;  4KAZ A;  2QK9 A;  2F8T A;  4N56 A;  3AV9 A;  3SV4 A;  3C6T A;  4CHP A;  4RW8 A;  4CJT A;  2X6N A;  1HJR A;  3TAM A;  4BE0 A;  3ISN C;  4CF2 A;  4C8K A;  4Z4E A;  1B9F A;  3KD1 E;  1VK0 A;  3OYM A;  2IOC A;  1LW2 A;  2Z1G A;  3OYN A;  3V9U A;  1SUQ A;  2OPQ A;  4HUF A;  3NF7 A;  4AHT A;  1JLB A;  5CYM A;  4NYN A;  5HP1 A;  4ZTJ A;  2F8S A;  4KRF A;  4E7J A;  4HHT A;  1ITG A;  1JLA A;  4YFU A;  3SJJ A;  3MXI A;  1KLN A;  2OA8 A;  1BHL A;  1XI1 A;  1JXE A;  3DRR A;  3HPH A;  4CJE A;  4DF8 A;  1YVU A;  4OPJ A;  3V9X A;  1EP4 A;  4CJ3 A;  1UA1 A;  2VG6 A;  3ALY A;  2IC3 A;  1XHZ A;  1YT3 A;  1A5X A;  1RTI A;  1S1X A;  1EET A;  4ICL A;  1WSJ A;  4PY5 A;  4LSN A;  4CGI A;  3L2W A;  4BWJ A;  2RPI A;  1U47 A;  2XHB A;  3SZ2 A;  4I2Q A;  3OYE A;  4Z4F A;  1CLQ A;  3NH2 A;  1SV5 A;  4RW6 A;  4M3R A;  3SI6 A;  2WOM A;  4EP5 A;  3O3G A;  1WSI A;  3NGI A;  4DS4 A;  2KQ2 A;  1K6Y A;  5C25 A;  4HCC A;  1LWF A;  4W5R A;  1NK7 A;  3VA0 A;  5HLF A;  4E1N A;  1SKR A;  3I0R A;  2IGI A;  4FK2 A;  4Z4I A;  1S5J A;  3B6P A;  2YNI A;  3AA2 A;  3CFR A;  4KB1 A;  4Y1C A;  4E3S A;  1RDC A;  4MQ3 A;  4FJM A;  4CJF A;  5FRN A;  3PO4 A;  3AVN A;  2KW4 A;  1NK9 A;  5CZ2 A;  4DSE A;  4ELU A;  1C0T A;  2YNF A;  3AVG A;  4F2S A;  2HVH A;  3K59 A;  4IFV A;  1TAU A;  2NUB A;  2D0C A;  3VQ6 A;  2YNH A;  1W0H A;  3QIN A;  3OYF A;  4DFJ A;  3TAF A;  2HMI A;  4FZZ A;  1U04 A;  4W5T A;  4E7I A;  1NK4 A;  4W5Q A;  1IKV A;  4FJ5 A;  1R0A A;  4CK3 A;  1TV6 A;  3VQ7 A;  4CGF A;  4B9V A;  3K58 A;  4B9N A;  5HRN A;  3IS9 A;  4KI4 A;  1RT2 A;  2FBY A;  3V1R A;  3ASM A;  2YHA A;  3TAE A;  3HST B;  1S1V A;  3M8Q A;  4DTN A;  3ZSX A;  1EKE A;  3K5M A;  2HHV A;  3K57 A;  3AA3 A;  3PO5 A;  1RBR A;  3G0Z A;  4FJI A;  3HK2 A;  5KRS A;  3QER A;  4DTO A;  1C6V A;  2A1R A;  1YTA A;  3QES A;  3OJU A;  2IDO A;  2PZS A;  1C0U A;  1C1C A;  1EX4 A;  1TL1 A;  4IDK A;  4CEA A;  4BE1 A;  3TAB A;  4FJK A;  1ASW A;  1UA0 A;  3MAQ A;  1NKB A;  3SQ4 A;  1RTJ A;  3SQ0 A;  4KI6 A;  4CGG A;  1LAV A;  3AA4 A;  3CYM A;  4O44 A;  4ID5 A;  1L3V A;  2X74 A;  3VQ9 A;  3WNE A;  2BDP A;  3OY9 A;  5I3U A;  1KVB A;  4JLH A;  3VQQ A;  4DFP A;  1Z26 A;  1L5U A;  4B9L A;  2BGG A;  4OLB A;  5C24 A;  1LWC A;  4DSJ A;  5CY4 A;  3RRG A;  2ITG A;  1S1U A;  4AHC A;  2OPR A;  1IKW A;  4E7H A;  1GOC A;  1Q8I A;  3T1A A;  2DFE A;  3U6F A;  3TAR A;  4EZ6 A;  2BE2 A;  2HHU A;  2FBX A;  2HB5 A;  4DU1 A;  4FLX A;  2OPP A;  3AVI A;  3HJF A;  1X9W A;  4M3Z A;  3LZI A;  3AVK A;  4JS4 A;  3RMB A;  2HNZ A;  4I9L A;  3OJS A;  3D45 A;  3JSM A;  4TSX A;  2ATQ A;  3QET A;  3MEC A;  1J54 A;  1RTH A;  1QSY A;  4B9M A;  3SUO A;  3OYL A;  1TKX A;  4B8A B;  2OPS A;  2R7Y A;  1MU2 A;  3V9Z A;  4EP4 A;  1X9S A;  3MED A;  4FZX C;  3DRP A;  4BE2 A;  2EX3 A;  2D0A A;  1RNH A;  4RW9 A;  4DMN A;  3SPY A;  1RT3 A;  3S9H A;  4DSI A;  1HYZ A;  4M3X A;  3QIP A;  1BL3 A;  5J1E A;  3FFI A;  2X6S A;  3CG7 A;  5DMR A;  3OS1 A;  3B6O A;  3QIO A;  1BQN A;  4WE1 A;  3QO9 A;  1EXQ A;  4Z4H A;  3L8B A;  5SZT A;  4DU3 A;  3LPT A;  4W5O A;  3SV3 A;  1J9A A;  3HVT A;  1VSD A;  3RMC A;  2Y1J A;  4FJH A;  3ITH A;  1ZBF A;  1S1W A;  4DSK A;  4CJS A;  4FJJ A;  2B5J A;  3P1G A;  4O55 A;  3HP6 A;  2B4J A;  4FJL A;  1D9D A;  1WLJ A;  3KD5 E;  2Z1I A;  3QEX A;  3L2Q A;  2XY7 A;  4QCL A;  1DTT A;  4G1Q A;  2GV9 A;  5KI6 A;  4CJL A;  2AJQ A;  1IKX A;  5HRO A;  3MEG A;  1RT6 A;  4E7L A;  4CK1 A;  3S3N A;  4CJ5 A;  4JS5 A;  1NJW A;  2GBZ A;  1RTD A;  2OZS A;  3DLK A;  4O5B A;  3VQ8 A;  4N5S A;  2XY6 A;  2G8W A;  1BCO A;  4FK4 A;  3HYF A;  3OYA A;  4N76 A;  1UWB A;  5HBM A;  1KLM A;  4CEE A;  3NBP A;  4IBN A;  1ZYQ A;  3HXM A;  2W42 A;  4FCY A;  1GOB A;  4DFM A;  1VSI A;  2JLE A;  4BDZ A;  3AVL A;  3SNN A;  1TK0 A;  3ZSZ A;  4I7F A;  1A5W A;  3LZJ A;  3A2F A;  1REV A;  4F2R A;  1TGO A;  3QNO A;  5I42 A;  2KFN A;  4FLW A;  3HT3 A;  4AIL C;  4Z4G A;  4M3W A;  3HL8 A;  4CHY A;  1Q9X A;  4KHU A;  1S1T A;  1ZBU A;  4FJX A;  4FW2 A;  3NCI A;  4KTQ A;  1U48 A;  1NK5 A;  1BIZ A;  4FVM A;  4N47 A;  3DOK A;  3OS2 A;  1CZB A;  4BDY A;  4CEF A;  2VWJ A;  3UIQ A;  2XY8 A;  5JS1 A;  3AA5 X;  1HNV A;  1QSL A;  2DTU A;  5FRO A;  1BIS A;  1QSS A;  1NK8 A;  4M3U A;  4DQQ A;  4XIU A;  5J2M A;  3RTV A;  4KFB A;  4CGJ A;  4B08 A;  2G8V A;  1WSE A;  3P83 D;  1T7P A;  4KPY A;  2HHS A;  4C8L A;  1HYV A;  1DTQ A;  1I39 A;  4CHQ A;  4CFA A;  1QQC A;  4AHV A;  1NKC A;  1ZBH A;  3NHG A;  5FDL A;  4O0I A;  5J2P A;  1RBT A;  4CE9 A;  3F9K A;  3LAN A;  4FM0 A;  1SL0 A;  3LAK A;  3NGZ A;  1WAJ A;  3OS0 A;  4R5P A;  1WSF A;  5C42 A;  3RMD A;  4RW7 A;  3AVA A;  4BWM A;  3IRX A;  2HHW A;  3VQB A;  1NK0 A;  3NF9 A;  1X9M A;  3ZT1 A;  2YV0 X;  1HNI A;  5CZ1 A;  2G8I A;  1G15 A;  4KTW A;  4E89 A;  3KLH A;  3LWM A;  4KHN A;  4PWD A;  1IKY A;  4GVM A;  1BI4 A;  2VG5 A;  3VA3 A;  1RDA A;  4DQR A;  4F3O A;  4YNQ A;  2P1J A;  4CEB A;  1VRU A;  3AVJ A;  4CJP A;  2P51 A;  2OZM A;  3AO4 A;  3TR8 A;  1B92 A;  3AO1 A;  4FJN A;  3CQ8 A;  4KTZ A;  5KGX A;  4CIG A;  4DTS A;  2E4L A;  1JLC A;  1IG9 A;  4DWI A;  1KFD A;  5T7B A;  4B3O A;  1UAX A;  3KLI A;  5KTQ A;  1RDD A;  3HPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...