3NH1A

Crystal structure of rnase t in complex with a preferred ssdna (tagg) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
209
structure length
209
Chain Sequence
NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 59
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh1A00
5EU7A 3AO3A 2DFFA 3AVLA 4CJKA 4K8XA 3QEVA 2HB5A 4CFAA 5HRNA 3M8SA 1TK0A 1DTTA 5D3GA 2HHXA 4M45A 2DFEA 1BIZA 3CFOA 3AO2A 3AVJA 3HT3A 3OJUA 2E6LA 3OYFA 2BE2A 3KLIA 3EZ5A 2YNHA 3MAQA 4ID1A 1R0AA 5FRNA 1Z25A 1ASVA 4CGJA 3G10A 4EP5A 3SI6A 3PY8A 5K14A 4CERA 4YFUA 3KLHA 4E3SA 4B9VA 4KRFA 1WNSA 3VQAA 2I5JA 3RRGA 4EZ9A 4DQIA 1I39A 4OGCA 1RT6A 3QLHA 2ZQBA 3VQ8A 1X9MA 3HVRA 4DQSA 4ELUA 2FC0A 3LWLA 4I9LA 3U6FA 1SKRA 1RDDA 3K5NA 4DF4A 4B9TA 1TKZA 4O44A 5J2PA 4GVMA 1EX4A 1TAQA 4OKJA 1BCMA 3OYEA 4CIEA 1L5UA 3SQ0A 4JLHA 4CGHA 3U3GA 4LH5A 3ZSZA 4CJFA 5J1EA 3SJJA 4H4OA 4IFVA 1SV5A 4J2AA 3VQEA 1NK0A 3K59A 3TABA 3IG1A 3OS1A 4DWIA 3CYMA 1RTDA 4CJ5A 2ZD1A 3AV9A 1NJWA 4KKOA 3OYAA 3OYNA 4CJLA 4RW6A 1HPZA 3MEGA 2G8KA 5KRTA 3HP6A 3SV3A 1C6VA 4AHVA 4BDPA 1FKOA 1S6QA 2OPRA 3QO9A 4IBNA 4EP4A 3OYHA 3EYZA 1XHZA 1XC9A 4PUOA 2KFZA 4DTXA 4OKEA 4LH4A 2KTQA 3O3FA 3C95A 4OLAA 3S3NA 4KPYA 3QEIA 2QKKA 1BQNA 2ITGA 3H08A 4G1QA 3OJSA 4FYDA 4B9SA 2D0CA 4FZXC 2Z1GA 4AHTA 3E01A 5C24A 3CFRA 3O3GA 1HQUA 4FM2A 1TV6A 2YNGA 4OKKA 5T7BA 3NHGA 4CEEA 2HVIA 2DTUA 5DK5A 4M3RA 2YV0X 3ZSQA 1G15A 1RBUA 1LW0A 2JLEA 1VSDA 2O4IA 3I0SA 3TAFA 2W42A 1HQEA 4CJPA 4Q0BA 1WSFA 3L2QA 3TARA 1FK9A 2QKBA 4FLXA 3ASMA 1NKCA 4FM0A 4FLVA 1TK8A 3OYIA 1RBRA 2HHTA 3TAPA 4CHYA 3KK2A 4FM1A 5DMRA 3JYTA 3HVTA 3C94A 4HUFA 1SL2A 1J9AA 1YVUA 3V9WA 2A1RA 3ZSOA 3KLEA 1EP4A 2PYLA 1RNHA 1LWEA 1YT3A 4IG3A 5HP1A 1KVAA 3HPGA 3OS2A 1QQCA 2HNYA 3L2VA 3LDSA 2HMIA 2Z1HA 4PA1A 3VQCA 3TAMA 1WAFA 3MECA 4DFMA 3PV8A 3AVBA 4M3TA 3AO1A 4FJGA 4QAGA 4E7LA 2XY6A 1HNIA 1LWFA 1U47A 4FJJA 4QCLA 4DQQA 1RTJA 3TAQA 3L8BA 3WNHA 2IDOA 3DLRA 1JL1A 4HUEA 4RW8A 1TKTA 3ITHA 5E41A 4DG1A 1T7PA 3QINA 1IKXA 4KREA 3AVCA 3ISNC 1VSEA 4RW7A 1RTIA 3ZT3A 4CF1A 4KI6A 4IFYA 4FK2A 2IAJA 3KTQA 3SQ1A 5CYMA 3KK3A 1RT4A 3LZJA 4FZYA 2KZMA 3V9XA 4DSFA 4K8ZA 1VRTA 4CJTA 2QXFA 3SUPA 3QEPA 1TVRA 1SL0A 3BGRA 4HHTA 1VSMA 2EX3A 3OVNA 4C8NA 4CJWA 1JLAA 4QOZB 1RT2A 3M8QA 1KFSA 3BDPA 1LAVA 2BGGA 5KTQA 4KV8A 4CEQA 1YTAA 4BWJA 4BE0A 3NE6A 4DS5A 4KB1A 4YNQA 2OYQA 4MQ3A 4NCAA 4IG0A 3WNFA 1U4BA 2RKIA 4B9NA 5HBMA 1HYVA 1ZBHA 4BDZA 4CHOA 3M8RA 5HRPA 4E7HA 4H4MA 2PY5A 5C25A 3RRHA 3DMJA 1L3SA 3QESA 3V1QA 2P1JA 1C0UA 3F9KA 4H8KA 4FLWA 1BI4B 2EHGA 3QEWA 4FVMA 2GUIA 1QTMA 1KTQA 4DU1A 1WAJA 5JS2A 3VA3A 1RT7A 4CGGA 3SYZA 1UWBA 3PO5A 1ZBUA 1WN7A 3AA4A 4CFCA 1LW2A 5CZ2A 4CJUA 4KTWA 3F73A 2OA8A 4M3XA 2F8SA 1X9WA 3KD1E 1UA0A 3ZT2A 1CZBA 2G8HA 4DFKA 1VRUA 3M8PA 4LSNA 3V6DA 3SUOA 3NH1A 1NK6A 5HRSA 1T05A 4DTNA 4FW2A 1ZBLA 1DTQA 3IS9A 3S3OA 4DS4A 4OGEA 4W5TA 4B3OA 3ALYA 4GMJB 3NGZA 1SUQA 4R5PA 1J53A 5KGWA 3L3UA 4CJ3A 4FJXA 2NUBA 1HYSA 2HNZA 5KI6A 4DTRA 3FFIA 1ASUA 1IKYA 3ZT0A 1TL1A 4CJQA 4CGFA 2X6SA 3SQ2A 4DTMA 4FJHA 1RDCA 3KIOA 3RMDA 2RN2A 3PO4A 4CFBA 3L2RA 2ETJA 3P1GA 4DTUA 1VSJA 4BE2A 3PX4A 1S9GA 2F8TA 3P5JA 3QNOA 1N5YA 4FJIA 3HPHA 4KHNA 3NH2A 2YKMA 5HLFA 2G8WA 2LSNA 3LWMA 2PZSA 3OYMA 2A1SA 1RBSA 4CGDA 1FKPA 1XI1A 4C8MA 1NK7A 2DY4A 3AVIA 4Y1CA 4Z4GA 4CESA 1BIUA 2HHUA 3AA3A 2HHQA 4CHZA 4Z4EA 4Z4HA 4FJNA 1X9SA 4W5OA 2OPPA 4E1MA 3B6PA 2P51A 4N56A 1QE1A 3PX6A 1Q9YA 4DSEA 3OYGA 3LP2A 4AHSA 3DRRA 1CZ9A 3VQ4A 4OLBA 4LY7A 1WSJA 2Q3SA 4BACA 1JLBA 3P83D 4CEBA 3VA0A 1SL1A 1CXUA 4M3ZA 5FRMA 1HNVA 1JLFA 4OPJA 1Q9XA 1JLGA 1Z26A 3K5LA 3QERA 3TI0A 1Q8IA 3ZSRA 2X74A 1T03A 1LWCA 5C42A 3S3MA 4LD0A 4UQGA 1T8EA 4B9MA 3ZSYA 1HYZA 1EXQA 1XWLA 3IRXA 1SKWA 2IC3A 3DRSA 4DTOA 4E0DA 2KW4A 3MEEA 4KFBA 4I7FA 3V9UA 4N5SA 1S1WA 4CEOA 2XHBA 4DTPA 5I42A 3TANA 1DLOA 1JXBA 4DTSA 1D8YA 3KD5E 4F8RA 1WSGA 4J2BA 3L2UA 4CHQA 3VQ7A 3V9SA 3U3YA 3MXJA 4Z0UA 5SZTA 3ZSVA 2P5GA 3AVKA 2GBZA 3AVGA 1C0TA 4O0IA 1NK5A 1BGXT 2YHAA 3VQQA 1L3VA 2GV9A 3OYLA 3CM6A 1KLMA 3K57A 2YNFA 3SQ4A 2F96A 2OZSA 4BE1A 4B8AB 2XY7A 1ASWA 4AHUA 3HJFA 4PY5A 2KFNA 1RDAA 1RT5A 3QEXA 4KTQA 3O4QA 1HMVA 4Z4FA 3DYAA 4JRPA 3IAYA 3LANA 3EY1A 2G8IA 1UOCA 1X1PA 3PX0A 5J2MA 3VQPA 1C1AA 2VG6A 2IS3A 3NCIA 4DTJA 3CG7A 4GW6A 3HYFA 3CFPA 2G8FA 2XO7A 1B92A 2YKNA 1TGOA 4Q5VA 3LPUA 3ZCMA 4W5RA 4E7JA 4CGIA 4DSJA 2IGIA 4O0JA 1JLQA 4N47A 4BDYA 1NKEA 4N41A 1ZYQA 4FXDA 1C0MA 1IG9A 2KZZA 1TL3A 3LP1A 4F3TA 4M3YA 1GOAA 3V1RA 4HTUA 3T3FA 4XIUA 3SPZA 3LPTA 3OYKA 3RMBA 4HCCA 4OPKA 3LP0A 1NJYA 4B08A 1EKEA 3V1OA 1RDBA 2P5OA 4DSLA 3RMCA 5HROA 1GOCA 2E4LA 2FBYA 2VG7A 2YHBA 3I0RA 3QIOA 3ZT4A 4OJRA 4C8KA 1JXEA 4RW9A 4FK4A 1QS4A 3AO4A 3T19A 3SPYA 4NYNA 1W9HA 4ELVA 1RTHA 3C6TA 3NF9A 4DF8A 4KHUA 4I2QA 4FZZA 3AO5A 4C8LA 2YNIA 4F3OA 3DI6A 1A5XA 5HRRA 5CZ1A 3NF8A 3CQ8A 3A2FA 1RT1A 4CFDA 1NK9A 3DLHA 3MXMA 1BISA 1TKXA 2ATQA 5KGXA 3TAEA 2O4GA 1D9FA 3DLBA 4HCBA 4LSLA 3KKSA 3LAKA 5J2NA 4F2SA 4AHCA 3V81A 4L8RB 1C1BA 2D0BA 2FBVA 3KLGA 3UIQA 3SV4A 1UAXA 4EZ6A 4O5BA 3WNEA 1MU2A 1VSIA 3HO1A 4C8OA 4O4GA 3AVMA 2JGUA 1IO2A 1WLJA 2HW3A 1NOYA 4TSXA 1LV5A 1BL3A 3LAMA 2WONA 3HPOA 1JL2A 1HJRA 3SCXA 2IOCA 4JS5A 3HP9A 4M42A 1KCFA 2BANA 3VQ5A 2OPQA 1L3UA 3OYBA 4KO0A 4M41A 2Y1IA 1J5OA 4FW1A 4DLGA 1ITGA 1RT3A 3RR8A 4F4KA 4NCBA 1KVCA 1U48A 4CK3A 3AVNA 1WSIA 1IH7A 3KLFA 2E6MA 4FJLA 4MFBA 5SWMA 4CECA 1VSLA 2DFHA 2Z1JA 1UA1A 1D5AA 3O3HA 3HM9A 3NDKA 2Z1IA 3DOKA 3K2PA 3AVHA 3L2WA 4DU4A 1U45A 4FJ5A 1S1XA 3DOLA 4CJSA 4KB0A 2AJQA 2OZMA 1WSEA 1TKDA 3T1AA 3L3VA 1CXQA 1RBTA 1S6PA 4CF0A 2Y1JA 3LP3A 1KLNA 3OYCA 3K5OA 4ZHRA 4KHQA 4W5NA 3C6UA 1KFDA 3NBPA 4Y1DA 3QETA 1IKWA 2X78A 4DU3A 5I3UA 3O4NA 4E19A 1N6QA 2FBTA 3V4IA 3VN5A 4E89A 3NGIA 3NFAA 1NK8A 3NF7A 1TAUA 1U49A 3AVAA 3SUQA 3QNNA 1JLEA 4IDKA 3VQDA 1QSYA 1VSKA 3OYDA 4DSKA 4CJVA 3KJVA 4DFJA 2XY5A 4FJMA 2QK9A 2WOMA 3TR8A 4ID5A 1U04A 3LALA 4ICLA 4AHRA 4CEFA 4CE9A 4CF9A 4DQRA 3S9HA 3VQBA 1I3AA 3VQ9A 4JS4A 4AILC 2HNDA 3SUNA 4E7IA 1TK5A 2G8UA 4FJ8A 4E7KA 5CY4A 4J2DA 1QHTA 1VK0A 2FBXA 2OPSA 1HRHA 2XY8A 3OS0A 3G0ZA 3AVFA 4DLEA 1LAWA 3AA5X 3NF6A 1QSLA 3PUFA 1NKBA 1XHXA 4M3UA 3AA2A 4M3WA 1REVA 2VG5A 3V9ZA 1ZBIA 4KHYA 3JSMA 1O1WA 2D0AA 3HL8A 3RMAA 1ZBFA 3D45A 3OYJA 3DLEA 3MXIA 2HHWA 1K6YA 4E1NA 3NH0A 4Z4IA 1S5JA 3D0PA 2B4JA 4CEZA 4ZTFA 2VWJA 1VSHA 2ZE2A 1IKVA 4CEAA 3LZIA 1NJZA 4B9UA 4CIFA 4O55A 5CYQA 4ZTJA 5FROA 4AH9A 1CLQA 4Z4CA 3TWHA 4FLUA 4CEDA 3HSTB 4FLTA 4BWMA 4CF2A 4DFPA 1A5VA 1S1TA 3HK2A 1S9EA 4PWDA 4CJEA 4HUGA 3RWUA 1NOZA 3RTVA 1BQMA 4J2EA 4FLYA 1EETA 3THVA 4RG8A 4FCYA 4NCGA 3TAGA 4CF8A 4FJKA 4CHPA 1W0HA 2BDPA 1S1UA 3SZ2A 1BHLA 2X6NA 4CK2A 3ZSWA 1BCOA 3ZSXA 3K5MA 4FK0A 5J2QA 3CM5A 3SNNA 3VQ6A 1GOBA 1F21A 4I9QA 4N76A 3OY9A 2R7YA 1SKSA 4KHWA 4IKFA 4KHSA 4PQUA 1D9DA 3KK1A 4B9LA 4W5QA 5FDLA 4FJ9A 3B6OA 4CHNA 1VSFA 1Y97A 2KQ2A 2VWKA 1QSSA 4CCHA 4NYFA 4F2RA 1RCHA 3DM2A 4FJ7A 4ELTA 4RW4A 3NGYA 1KVBA 4CJ4A 4DSIA 1JLCA 3DLGA 1A5WA 1YTUA 1RBVA 2RPIA 2HHSA 1KSPA 2XRIA 4JRQA 2G8VA 3NAEA 2RF2A 3KKRA 4CIGA 3DLKA 4KAZA 5KRSA 1JKHA 1L3TA 3ZT1A 2D5RA 4DMNA 3I8DA 2B6AA 4WE1A 4CJRA 2B5JA 1KRPA 1J54A 4CK1A 2PYJA 4KTZA 1S1VA 4FLZA 4DQPA 1FXXA 4I2PA 3RR7A 4KI4A 2HHVA 3ULDA 3DRPA 1BI4A 3HXMA 2HVHA 3WNGA 4HVJA 3K58A 5JS1A 1B9FA 1B9DA 1C1CA 4B8CA 1WSHA 1NK4A 1NJXA 3QIPA 4OVLA 3MEDA 1RILA
chains in the Genus database with same CATH superfamily
5BRDA 4K8XA 4C1NK 2HHXA 2DFEA 3CI5A 4IOCL 2BE2A 3O08A 3CJ7A 4CGJA 3KLHA 4O5FA 1RT6A 1T3VA 1NMDA 3HVRA 4BR7A 4WQ4A 4ELUA 3Q7CA 1SKRA 4B9TA 5KQDA 2NRXA 1L5UA 1NWKA 2FSNA 3U3GA 3ZSZA 5J1EA 4PKGA 1SV5A 3F5TA 5AQJA 3PSFA 4DWIA 3CC4N 2ZD1A 1IV0A 1TUYA 3EZWA 1NJWA 4KKOA 3MCPA 4DR6K 4RW6A 2G8KA 4QS9A 1C6VA 1FKOA 1S6QA 3OYHA 2HF3A 4JV5K 1T6DA 2UU9K 4O8UA 4OKEA 5EXWA 3H08A 4NXNK 4AHTA 5C24A 4CJ7A 3CFRA 1HQUA 3CCEN 1XUPO 3NHGA 4CEEA 4FL9A 2ZGYA 2HVIA 1RBUA 4AQYK 3UB5A 2O4IA 1HQEA 3THXA 1WSFA 3THWA 1NKCA 5LJVA 5BR8K 1RBRA 3TAPA 2CGLA 4CHYA 5FPMA 3HVTA 1SL2A 1DEJA 3OS2A 3L2VA 4PA1A 3TAMA 3MECA 3AO1A 4JKGB 2FSJA 4FJGA 4B9QA 5E84A 4DUZK 3LM9A 2ASMA 1YXQA 4DG1A 1BOTO 5AQXA 4B3TK 1VSEA 5E26A 2CH6A 5BPNA 5CYMA 4FZYA 3V9XA 4PHTX 4M63C 4BGBA 1ZBSA 2QXFA 3QEPA 1TVRA 3OVNA 4M7XA 4CJWA 1RT2A 3M8QA 1LAVA 3VEWA 4KV8A 3G4SN 3AAPA 4DS5A 1K8KB 2OYQA 1HKCA 5HL7L 3F9MA 4GV3A 2E88A 5HBMA 4B9NA 4C1NI 1HYVA 4F9OA 1ZBHA 2D0OA 1XMOK 2PY5A 4G9ZA 2VQFK 3SJHA 3DMJA 1L3SA 3QESA 1C0UA 3LM2A 3QEWA 3ZYYX 2GUIA 1QTMA 1WAJA 3VA3A 1E3MA 1RT7A 3BZCA 1WN7A 4LF7K 1NLVA 2G8HA 4PL7A 1KQSM 1ESVA 1VQ8N 3LDOA 1HLUA 4LSNA 3RSEB 4H0VB 4DV5K 2AA4A 2QWPA 4Z94A 1T05A 4A2BA 4FW2A 3KHYA 1DTQA 4LFBK 3VEVA 3BP8A 1J53A 2NUBA 5AQIA 4DTRA 4MLEA 3ZT0A 3EKSA 4DTMA 4FJHA 5AQQA 5H1SQ 4CFBA 2NRHA 4BR9A 3U9ZA 1OKJA 3A5OC 3NH2A 2LSNA 1N8RO 1EO1A 3LWMA 5B8HA 2PZSA 1NK7A 3VEXA 1FKPA 3AVIA 4Y1CA 4DV1K 1BIUA 3HOTA 2HBKA 4Z4HA 5JLHA 3B6PA 2YCHA 4FVUA 3CCSN 3BEXA 1M90O 1EWRA 3DRRA 1CZ9A 5AQVA 2D4WA 5MLCQ 2HSTA 3JS6A 4OPJA 1Z26A 4JKHA 1MWKA 1Q8IA 4JI3K 4JI8K 3S3MA 4WQ5C 4UQGA 1KAXA 3ZSYA 3IRXA 1SKWA 4C23A 1WBBA 4BVOA 4DTOA 4E0DA 1X3NA 3MEEA 4KFBA 4DTPA 4NXMK 5I42A 4JI6K 1JXBA 4GY2B 5GINA 2IVOA 4J2BA 4CHQA 3P39A 3V9SA 3U3YA 3THXB 3THWB 3ZSVA 1O13A 4CZIA 4O0IA 3MN6A 1KLMA 4IO9L 2YNFA 3KVGA 2F96A 3SQ4A 4BE1A 1SZ2A 5EOYA 2A6AA 3DYAA 4BGAA 1UOCA 1C1AA 4WF9L 2VG6A 2IS3A 3O9UA 3CG7A 2XO7A 5M1FA 3LPUA 4W5RA 4CGIA 2QA4N 3CJBA 2IGIA 4O0JA 1NKEA 4N41A 1ZYQA 1IG9A 1TL3A 5IWAK 4JN4A 4F3TA 3ZLJA 3SPZA 4HTUA 3OYKA 4FPBA 3ZX2A 1QHAA 3EE8A 4B3RK 4BROA 1GOCA 1WUAA 2Q0RA 3ZT4A 3FLCO 1KAYA 1JXEA 1QS4A 4B1VA 3SPYA 1RTHA 4KHUA 5LJWA 2YNIA 2E2NA 5AJ3K 3CQ8A 3ENHA 5TKYA 1RT1A 5GAHP 2O8FA 1BISA 3TAEA 5KPRA 4LSLA 3KKSA 3LAKA 3V81A 2E5LK 1C1BA 4L8RB 1BG3A 1UAXA 3WNEA 5AQNA 1VSIA 1IO2A 2HW3A 4BY9C 4TSXA 1BL3A 4GVEA 4MLHA 1IBMK 1JL2A 2IOCA 4DKWA 1W7AA 4JD2A 3L4QA 1J5OA 4DLGA 1ITGA 3TTDA 4CK3A 1WOQA 3AVNA 3KLFA 1IH7A 3R8EA 2F7TA 2P9PA 4MFBA 4CVNE 4CECA 5TKWA 2DFHA 2FF3B 2Z1JA 1UA1A 3O3HA 2QM1A 3HM9A 3DOKA 3AVHA 1U45A 2ZF5O 4X64K 1TKDA 2ZJPL 1RBTA 4CF0A 1NM1A 3OYCA 5AZJB 1KFDA 1Q7YO 1ZC6A 3V4IA 2QI2A 4HWIA 3E9OA 1NK8A 1NGGA 1OH5A 3VQDA 1Y64A 3OA9A 4BG9A 4JI7K 3KJVA 2WOMA 3C7NB 4ID5A 4ICLA 4CEFA 3G25A 3EL2A 4K0KK 4DR5K 3THYA 1I3AA 3VQ9A 4AILC 2G8UA 4E7KA 5CY4A 4J2DA 2D1KA 5GAEP 3IFRA 4FWOA 3ZX0A 4H5VA 1NKBA 1GLFO 3AA2A 4IOXA 1EQYA 4KHYA 5C0YA 1ZBFA 4CBXA 3MXIA 1R59O 3D6RA 2A5XA 2HBJA 3SLCA 3HTVA 4E1NA 2ZWHA 1VSHA 3MWPA 2ZE2A 5M1OA 1IKVA 4B1UB 4EHUA 4CEAA 4FWQA 4L3QA 4B9UA 4CIFA 5CYQA 5EX5A 3AAQA 2O8CB 4CI6A 4CF2A 1A5VA 3H46O 4CJEA 4HUGA 4RWTA 5C2FA 3ID6A 4K41A 4NCGA 4CF8A 4BREA 3OW2M 4CHPA 5LMUK 5AFUA 3VGMA 2X6NA 3ZSWA 4YDUA 3CM5A 3FE1A 4YOUA 1F21A 4N76A 4KHSA 5AQPA 1D9DA 1KC8O 3S41A 4LF9K 4CCHA 3Q7BA 3NMUA 4F2RA 1KVBA 1YTUA 2ITMA 1A5WA 1ATRA 4WFBL 1RGIA 2XRIA 4JRQA 2G8VA 2RF2A 4KAZA 2Q1NA 5KRSA 4KH6A 2D5RA 2B6AA 4WE1A 1KRPA 4KTZA 2NRTA 4FLZA 2HHVA 3G71N 3ULDA 1BI4A 4DR4K 4BRFA 3VEZA 1WSHA 1NK4A 1Q86O 4OVLA 3NF7A 1RILA 3AVLA 3HSCA 3QEVA 5D3GA 4M45A 2VCPA 4YOXA 2O8FB 3HT3A 1R0AA 3MAQA 3DWLA 4LF4K 3IMXA 1ASVA 2WTUA 4E3SA 3VQAA 3DJCA 2ZJQL 2VGMA 1X9MA 3HBTA 3CETA 4I9LA 1ATSA 1RDDA 3I33A 4GVMA 4FOEA 1TAQA 1Q82O 2OCEA 2NRRA 3TTCA 3SQ0A 4JD2B 4JLHA 2Q2RA 4E1JA 4J2AA 1NK0A 3TABA 3CYMA 4IO8A 2P9PB 3AV9A 2O8EA 2Q97A 3OYAA 5M1QA 3A5MC 4BDPA 1XHZA 4IBNA 2OPRA 2KFZA 3EYZA 5EVZA 2NRZA 4OLAA 3S3NA 2HBMA 2PAVA 2ITGA 4G1QA 3OJSA 3DXKA 1QZ5A 4B9SA 4YY3K 4BR5A 3OTOK 1NGJA 3TSUA 3O3GA 4FM2A 2YNGA 2DTUA 3THYB 1IBLK 1G15A 1LW0A 3QB0A 1VSDA 4A59A 3I0SA 4CJPA 3TARA 3ASMA 1TK8A 4JKGA 2HHTA 4FM1A 3JYTA 4HUFA 3KLEA 2PYLA 3EEQA 2E1ZA 1KVAA 3FGUA 3VQCA 4DFMA 3PV8A 3AVBA 4QAGA 4E7LA 3DXMA 1U47A 4QCLA 3L8BA 3WNHA 1JL1A 3FFKB 1EWQA 4RW8A 3H1VX 1TKTA 1T7PA 3QINA 1IKXA 1NGIA 4BQLA 4RW7A 3ZT3A 4V19S 4IFYA 4DR7K 4FK2A 2IAJA 3SQ1A 1Z6RA 3KK3A 1RT4A 3LZJA 1K8KA 4PL8A 4K8ZA 4CJTA 3SUPA 1SL0A 3H1QA 4HHTA 3T7ZA 4QOZB 4BRKA 1KFSA 3BDPA 5BR9A 2RHKA 2BGGA 5KTQA 4CEQA 4BWJA 2A40A 4JK9A 3CCMN 3ZEUA 4JI0K 4NCAA 3WNFA 3R1XA 2RKIA 3SAFA 3ATVA 5DM7L 3VETA 5C25A 4DR1K 3RRHA 2QXLA 2P1JA 3RSEA 3M5RA 1VQ4N 1BI4B 2EHGA 4DU1A 5JS2A 2V7ZA 3H3OB 4CGGA 3VTHA 2OA8A 3F73A 2GUPA 1UA0A 1BUPA 4JI5K 1VRUA 3QMLA 3SUOA 4FWRA 3NH1A 3VF4A 1ZBLA 4IJNA 3S3OA 4W5TA 4BQZA 1SUQA 2CH5A 4CJ3A 1HYSA 2HNZA 1VQ5N 1IBKK 1NGDA 4CJQA 1NGCA 1RDUA 3A0IX 2UUBK 2PFUA 1RDCA 3ENBA 2RN2A 1U2VA 5LL6Z 2ETJA 1GLEG 2V51B 1S9GA 1X3MA 3QNOA 1N5YA 3HPHA 2YKMA 2G8WA 1OVYA 3OYMA 1RBSA 3CCLN 2O8EB 4LF5K 3GDQA 1NJIO 2HHQA 1HJOA 2W40A 3IUCA 4OO1J 3PX6A 4MO5A 5GIOA 3ID8A 3D7EO 3LP2A 2BTFA 1YUWA 3VA0A 1CXUA 5FRMA 5BRFA 3ZSRA 3DXKB 3QFPA 1EXQA 4M7YA 3SMSA 3OBYA 3DRSA 5AQRA 1K9MO 3JXUA 1LCUA 1CZAN 2KW4A 4I7FA 3CCQN 4N5SA 1S1WA 3N4PA 1DLOA 1P90A 1WSGA 2P5GA 3AVKA 1C0TA 1NK5A 2YHAA 3VQQA 1L3VA 4GV6A 2KKZA 4B8AB 4AHUA 4GV9A 3R3LA 1RDAA 2IIRA 3T1YK 4KTQA 3IAYA 3LANA 1JCGA 3DXMB 3C65A 4Q5VA 3J8AA 4DSJA 1JLQA 1OVQA 1YITN 1C0MA 2QWMA 3F2KA 3LP1A 3TTFA 3CPEA 4M3YA 4WQ4C 3CC7N 3QFUA 4NLBA 4OPKA 1Q81O 3AARA 1RDBA 5HOOA 3QICA 4O8KA 3RMCA 5HROA 2FBYA 2E4LA 2VG7A 2YHBA 4H5RA 4OJRA 2ZGZA 3T19A 4NYNA 3NVMA 4ELVA 2GEMA 4C8LA 4F3OA 3DI6A 1A5XA 5HRRA 4JKFA 5CZ1A 3ZEUB 4CFDA 1E4FT 3MXMA 5KGXA 4HCBA 3ULEA 3GG4A 3SV4A 4EZ6A 4O5BA 3HO1A 4C8OA 4O4GA 3AVMA 1YF5L 1NOYA 1K73O 3CERA 4QS7A 2YHXA 1YI2N 3SCXA 1KCFA 3VQ5A 1NG9A 3A8YA 3OYBA 4A5BA 4M41A 1RT3A 3C0BA 3RR8A 5AQLA 4YOVA 1KVCA 1U48A 5AZJA 1QQNA 4DV6K 2E6MA 4AF1A 1D5AA 2QW9A 5BREA 3NDKA 4DU4A 4KB0A 1WSEA 3T1AA 4CZJA 4KHQA 3C7NA 3QBXA 4Y1DA 3C6UA 2W6KA 3NBPA 3QETA 1IKWA 1S72N 5I3UA 1U2VB 4E19A 4H0TB 4B1YB 4BC3A 1TAUA 3SUQA 4IDKA 3VGLA 1JLEA 2GWJA 4KH4A 1QSYA 4EAHD 3OBWA 4R79A 1DKGD 3H45C 3LALA 3I8BA 4AHRA 4CE9A 4FWPA 2V7YA 4E7IA 4OX9K 3P4IA 3LDQA 3AVFA 4JKDA 1LAWA 3AA5X 3NF6A 1QSLA 3PUFA 2VWBA 1XNQK 4M3UA 1VQLN 4M3WA 2O8CA 1ZBIA 3D45A 4JKBA 1BWFO 4FWKA 3OYJA 3DLEA 1YJ9N 2HHWA 4CZMA 1K6YA 4Z4IA 3ENOA 2B4JA 2VWJA 1T6CA 4IJAA 5AQUA 4IEEA 4AH9A 5KQ8A 4Z4CA 3TWHA 4FLUA 4BWMA 3HK2A 1S9EA 1XC3A 1BQMA 4J2EA 1EETA 1NGEA 4FJKA 1WBDA 1S1UA 1BCOA 4FK0A 3K5MA 2FXUA 3K9JA 4X66K 4DV2K 3OY9A 2R7YA 4KHWA 4IKFA 2NLXA 2Q0UA 1HUXA 4FJ9A 1HNZK 3B6OA 4CHNA 3CCJN 4NYFA 4ELTA 3CJ1A 4RW4A 4XH4A 4CJ4A 3DLGA 4LC9B 4BVPA 5M1PA 2A42A 4ISFA 4CIGA 4A5AA 4IOAL 4ILHA 2PBDA 1DGKN 4CJRA 1NNEA 4KI4A 3AY9A 4DQPA 4I2PA 3WXLA 4DV4K 4JKCA 4HVJA 1GLDG 4YORA 1B9FA 1B9DA 1C1CA 1NJXA 3KWIA 3HM8A 2WBNA 3AO3A 2HB5A 1TK0A 1BIZA 3CFOA 3AO2A 3AVJA 3WT0A 3D2EA 2E6LA 1RFQA 3T69A 3KLIA 3ULEB 1Z05A 3OJUA 3EZ5A 3CMEN 5FRNA 1XNRK 1QQMA 1Z25A 4EP5A 3G10A 2GWKA 4A2AA 3PY8A 5K14A 4BRAA 4CERA 4YFUA 4B9VA 1WNSA 4EZ9A 3RRGA 1I39A 4OGCA 3QLHA 2ZQBA 2YHWA 3CPWM 3GE1A 3CJ9A 2FC0A 3LWLA 4DB3A 1VQ7N 5J2PA 4O44A 3OYEA 1EX4A 4OKJA 4CIEA 4LH5A 3G6EN 2J4RA 4BC2A 3SJJA 4CJFA 3VQEA 3K59A 3CCVN 3IG1A 1U6ZA 1RTDA 3OYNA 4CJLA 1GLBG 3J7YP 1HPZA 1N32K 3SK3A 3SV3A 4AHVA 3J7ZO 4PUOA 3QO9A 3WUHA 2WUSA 3VOVA 3GBTA 4DQ8A 3O3FA 4JI2K 3K9KA 4BR2A 4KPYA 3QEIA 4CD1A 5AQYA 1KXPA 4FYDA 4FZXC 2D0CA 3U8XA 3M1FA 5JVHL 5T7BA 1XMQK 4JI1K 1VQMN 5DK5A 4M3RA 3ZSQA 2YX6A 2CGKA 3W0LA 2JLEA 4CZGA 3MN9A 3TAFA 1DT9A 2W42A 3U4LA 1YIJN 1NGAA 2QKBA 4FLXA 3CCRN 2V52B 4FOIA 1YJNN 3RVCA 4B1WB 5GAGP 3MWTA 4IXCA 1C0GA 1J9AA 1EP4A 1LWEA 1YT3A 4NLCA 5HP1A 3MX2A 3HPGA 2HMIA 2HNYA 5AQTA 1BO5O 1WAFA 4M3TA 3MN7A 1HNIA 1LWFA 2ASOA 2VYPA 3TAQA 2IDOA 3DLRA 4HUEA 5E41A 4LF6K 3ISNC 1RTIA 1YAGA 4CF1A 2QWLA 2KZMA 4H5NA 1BA1A 3P31A 3FR0A 1VSMA 1NMNA 4C8NA 4CZKA 3C6HA 5EY4A 5AQKA 1YTAA 5AR0A 3NE6A 3O9QA 1M1KO 4KB1A 4NB4A 3O9SA 4MQ3A 3PSIA 3CF5L 4B3MK 4BDZA 3W3DA 4CHOA 1VAZA 5HRPA 3J81O 3M8RA 1HKBA 4E7HA 1S3XA 3CJCA 3F9KA 4H8KA 4FLWA 1V4SA 3C6AA 3FZMA 4K42A 2P9UA 5JLFA 3PO5A 5M1KA 3SYZA 1ZBUA 4CFCA 3AA4A 4CJUA 1LW2A 5CZ2A 4KTWA 1MWMA 1QZ6A 3CC2N 3KD1E 2F8SA 2JWKA 3ZT2A 2QWRA 3O4WA 3D2EB 3VPZA 3E9PA 1NK6A 1P8ZA 4DTNA 3EE9A 3SBTA 3IS9A 5AZIA 4DS4A 4OGEA 3NGZA 2YJFA 2BH1A 3L3UA 3ZETA 4FJXA 5JICA 1TL1A 2OTJN 4CGFA 2X6SA 3SQ2A 2P9IB 4X65K 3BZKA 5BN8A 5AQFA 4LFAK 4A57A 1YHQN 1VSJA 2BUPA 4BE2A 3P5JA 4BRGA 4JK8A 4FJIA 4UY8O 5HLFA 3WXMB 2A1SA 1XI1A 2DY4A 4Z4GA 4CESA 3TSPA 5BRHA 2UXDK 2HHUA 4CHZA 4FJNA 4GKKK 1J5EK 4W5OA 5AQMA 1Q9YA 3I55N 5IT9O 4FWMA 4DSEA 3BF3A 3VQ4A 3B8AX 4CD3A 1WSJA 2Q3SA 4M3ZA 1OH6A 1SS6A 3ZX3A 4YDUC 1Q9XA 3QERA 1NGBA 2I7NA 2X74A 5C42A 4LD0A 4CZFA 1XWLA 2IC3A 2QWOA 1N33K 3KWGA 3V9UA 3CXCM 4BRLA 4CEOA 4DTSA 1D8YA 2ZM6K 3KD5E 3L2UA 4JHDA 3MXJA 4H5TA 5AQZA 2GBZA 1BGXT 1KAZA 3QBWA 2GV9A 3OYLA 2E1YA 2KFNA 3WEEA 3HJFA 4PY5A 1RT5A 4H0YB 3QEXA 3O4QA 1HMVA 4WYBA 4Z4FA 2G8IA 3EY1A 5JVGL 4IEIA 3VENA 2GX9A 4DTJA 4GW6A 3UKUB 3HYFA 3O8MA 3VEYA 5F1XA 1B92A 1TGOA 4FWSA 4E7JA 4DV7K 3GOIA 4N47A 4BDYA 4FXDA 1GOAA 3HZ6A 5FLXO 3T3FA 3LPTA 4HCCA 4BRHA 3KK7A 1HR0K 1NJYA 3BF1A 3V1OA 4DSLA 3PIPL 4C8KA 3QIOA 2D0PA 1ATNA 4FK4A 3AO5A 3AGKA 3WXJA 3NF8A 2P9LA 4ILJA 1TKXA 3DLBA 5LMNK 5J2NA 4AHCA 2D0BA 1K8AO 3UIQA 1MU2A 2E8AA 5BPLA 3KZBA 3FZLA 1WLJA 2VGNA 4Y0WA 2P9UB 5ELZA 2P9KA 1HJRA 4JS5A 3HP9A 4IDHA 4XH1A 1L3UA 1OH7A 2GELA 4F4KA 1VQON 5CR4A 5FPEA 4KBOA 3A5LC 3GL1A 3O1BA 5SWMA 5AZIB 2NZTA 2DPNA 1S1XA 3DOLA 3ZETB 3L3VA 1CXQA 2Y1JA 1BA0A 3P38A 3LL3A 4W5NA 4XH5A 4DHYA 1NBWA 5C10A 4E89A 3VF6A 2HHHK 1BU6O 1U49A 3AVAA 4DSKA 1VSKA 2A41A 3OYDA 4FPAA 3E66A 2GTDA 2QK9A 1U04A 1XQSC 4DQRA 2P9NA 1D4XA 2RE2A 3O80A 4DR3K 4JS4A 3S9HA 1ZXOA 4FJ8A 1QHTA 4NO7A 2FBXA 5DM6L 1W97L 2XY8A 1V4TA 1IJJA 3G0ZA 4DLEA 4CBWA 3VTIA 4FWLA 4KH5A 1REVA 3J80O 3V9ZA 4JKAA 3JSMA 1O1WA 2D0AA 3HL8A 1VQ9N 1MA9B 3VMFB 2IVNA 3UE5A 3NH0A 3EKUA 4CEZA 3VEOA 1NU0A 3CJAA 4ZTJA 2HMPA 5I9EB 2YI1A 5FROA 4JHDB 1CLQA 4DUYK 4CEDA 3HSTB 4IWVA 4FLTA 5JMVA 1QQOA 1S1TA 1NOZA 3RTVA 3THVA 3MX5A 3EO3A 4RG8A 4FCYA 3TAGA 2H3GX 1W0HA 4FSVA 2BDPA 3WEEB 3WXKA 5GIPA 4CK2A 2FF6A 4RTFD 3ZSXA 3SNNA 1X9JA 3SAHA 1RDWX 1SKSA 4WQ5A 1GLAG 4W5QA 5FDLA 1FJGK 4B3SK 1QSSA 1RCHA 3DM2A 1JLCA 2NRWA 3PIOL 4BRIA 2A3ZA 3NAEA 3MDQA 3KKRA 2EWSA 3DLKA 2E2QA 4U7BA 3L4IA 1L3TA 3VESA 4MDAA 3I8DA 2PYJA 3EN9A 3H6EA 4BRMA 4JNEA 2HVHA 3HXMA 3WNGA 3K58A 4H0PA 1ILYA 5EU7A 2DFFA 4CJKA 4CFAA 5HRNA 3M8SA 2P9LB 1DTTA 3OYFA 2YNHA 2NRVA 4ID1A 5AQOA 3SI6A 4KRFA 2I5JA 4DQIA 4WFAL 3M3ZA 3VQ8A 4YOYA 4DQSA 3U6FA 3K5NA 4DF4A 3WXIA 2P9KB 1TKZA 1BCMA 4CGHA 2O8DA 1NGHA 2UXBK 2CGJA 4H4OA 4IFVA 1TYQA 1OH8A 5M1NA 4DV0K 2I7PA 3OS1A 4A61A 4CJ5A 1SQKA 3MEGA 5KRTA 4J8FA 3HP6A 3PLAA 4ISGA 2W41A 4EP4A 1XC9A 3T1HK 4DTXA 4JI4K 2YHYA 4LH4A 2KTQA 3C95A 4LFCK 4IZ9A 1VQPN 2QKKA 1BQNA 4B1XB 4BC4A 1VQ6N 1T44A 3ATUA 2Z1GA 3E01A 4BRPA 1J6ZA 3CIPA 1H1VA 5AQGA 2OANA 4MDBA 1TV6A 4OKKA 2P9NB 2YV0X 4HTLA 1GLCG 4Q0BA 3L2QA 1FK9A 4MO4A 4FM0A 4FLVA 3OYIA 1NGFA 1MDUB 4K25A 4FO0A 3KK2A 5DMRA 4PKHA 3C94A 1YVUA 3V9WA 2A1RA 3ZSOA 1RNHA 1HNXK 2KHOA 4IG3A 2FSKA 3LDSA 1QQCA 2Z1HA 3CQXA 3LDPA 3CHWA 5BPMA 4WFNL 2XY6A 2P9SA 4IFEA 4BG8A 4FJJA 4DQQA 3UKRA 1RTJA 3ITHA 4KREA 3AVCA 5KPTA 2NNWA 3O1WA 3KTQA 4BRDA 4DSFA 4BR0A 5KPZA 1VRTA 2FLOA 3BGRA 2EX3A 3LDNA 1JLAA 4BR4A 4EHTA 3BY5A 1GLJO 4BE0A 4CW7B 2KLAA 4ILGB 4YNQA 4IG0A 4AM6A 2HBLA 1U4BA 1VHXA 4JEPA 3R9PA 4H4MA 3L6QA 3V1QA 1FW6A 3LDLA 4DCHA 4FVMA 1KTQA 1YVNA 3D2FA 3M6GA 1UWBA 2E20A 3MCAB 1WB9A 1VQKN 4M3XA 5AFUH 5BN9A 1X9WA 1CZBA 1IG8A 2WC9A 4H5WA 4DFKA 3M8PA 2P9IA 3TU5A 3V6DA 4CZHA 5HRSA 5A2QO 1SAZA 4B3OA 3ALYA 4GMJB 4R5PA 5KGWA 1S22A 4H0OA 5KI6A 3FFIA 1ASUA 1IKYA 3O5BA 1HNWK 4OPAA 1HPMA 3KIOA 3RMDA 3PO4A 3L2RA 4DTUA 3P1GA 3PX4A 2O8DB 2F8TA 3DAWA 4KHPK 5FPDA 3FZKA 1TYQB 4KHNA 1JJ2M 4CGDA 4C8MA 3SBGA 5F0XA 3AA3A 4Z4EA 5ADXH 2O8BA 1X9SA 3MK6A 2OPPA 4E1MA 2UUAK 2P51A 4N56A 1QE1A 4YHHK 1KD1O 3OYGA 4AHSA 3O6WA 4OLBA 4LY7A 4BACA 1JLBA 3P83D 2HF4A 4CEBA 1SL1A 1HNVA 1JLFA 1JLGA 3K5LA 3TI0A 2QWQA 4EIAA 1T03A 1LWCA 1JCEA 5F2RA 1T8EA 4B9MA 1HYZA 4CZLA 2ZJRL 4ISEA 2XHBA 3TANA 2HOEA 2ASPA 4I6MA 4F8RA 4U67L 3VQ7A 2OTLN 4Z0UA 1TUUA 5SZTA 1QVFM 2F4VK 3AVGA 3UKUA 3CM6A 3IDHA 4CZEA 3K57A 2OZSA 2XY7A 1ASWA 2F9TA 4JRPA 1X1PA 3PX0A 1LOTB 3VQPA 5J2MA 3CMAN 1QVGM 3NCIA 2P9SB 3CFPA 2G8FA 4DR2K 1E4GT 3UKRB 2YKNA 5AQHA 3ZCMA 2AP1A 2QTDA 3OHRA 1W2BM 3HRGA 2VQEK 3I56N 3V1RA 4XIUA 3RMBA 3WQUA 3LP0A 5AQSA 4B08A 1EKEA 3MN5A 2P5OA 4B1ZA 4KI6A 3I0RA 3R6MA 4RW9A 3O9RA 3AO4A 4H0XB 1W9HA 4DF8A 3C6TA 3NF9A 4I2QA 4FZZA 4DV3K 4JYAK 3FZFA 4BC5A 4FWNA 3A2FA 5C15A 1NK9A 3DLHA 2ATQA 2O4GA 1D9FA 4YOTA 3CCUN 1YJWN 4F2SA 3KLGA 2FBVA 1C0FA 3N4QA 4XEIA 2WFBA 1I94K 5ADXA 2JGUA 1N34K 1LV5A 3LAMA 2WONA 4RCHA 3HPOA 4M42A 3D2FB 2BANA 2OPQA 3IKMA 3WQTA 4YOWA 3L0QA 3O9TA 4KO0A 2Y1IA 4FW1A 3K0SA 3BUZB 4NCBA 1GLLO 4BRCA 4X62K 1WSIA 4FJLA 5GADP 1VSLA 3TPQA 2Z1IA 3K2PA 3L2WA 4FJ5A 3VF2A 1HKGA 4CJSA 2AJQA 2OZMA 1S6PA 3LP3A 1KLNA 3K5OA 4ZHRA 5C12A 3MMVA 3CD6N 2X78A 3FZHA 4DU3A 3O4NA 1N6QA 2FBTA 3VN5A 2Q31A 3NGIA 3NFAA 1G99A 4AM7A 2E2OA 3J7AP 2W6LA 3QNNA 3HOSA 4GNIA 2YJEA 4CJVA 4DFJA 2XY5A 4FJMA 3HI0A 3TR8A 2Q36A 4CF9A 4PKIA 2O8BB 2UUCK 5AQWA 3SAGA 3VQBA 3SUNA 2HNDA 1TK5A 2F9WA 1VK0A 2OPSA 1HRHA 3OS0A 3VERA 2IVPA 3E9LA 4JAXA 5LY3A 1XHXA 2VG5A 4EFHA 2UXCK 3RMAA 1JCFA 3QDKA 4H03B 1S5JA 3D0PA 4ZTFA 4GKJK 5CHIA 1N36K 3LZIA 3SMPA 1NJZA 4O55A 4I6MB 4LF8K 1HX1A 4DFPA 4PWDA 3RWUA 4FLYA 3AGRA 2QEXN 4QS8A 3DLLL 4K43A 3SZ2A 1BHLA 5J2QA 3VQ6A 1GOBA 2JWLA 5C2DA 4I9QA 2UYTA 3TSQA 1Q18A 4PQUA 3KK1A 4B9LA 4WCEL 3U9DA 3H3NO 4A62A 1VSFA 1Y97A 2KQ2A 2VWKA 5CE3A 3A5NC 3NVKA 4BRNA 4FJ7A 1BDGA 3NGYA 4DSIA 5FPNA 1RBVA 4BRQA 2RPIA 2HHSA 1KSPA 3JAMO 4OPHA 3VGKA 1JKHA 3ZT1A 4DMNA 1VQNN 4CBUA 4JK7A 2B5JA 2E2PA 1J54A 4CK1A 2QWNA 1S1VA 3CQYA 1FXXA 3E1YA 3RR7A 5JS1A 3DRPA 4B8CA 2KZZA 3QIPA 4JKEA 3MEDA
chains in the Genus database with same CATH topology
5EU7A 3AO3A 2DFFA 3AVLA 4CJKA 4K8XA 3QEVA 2HB5A 4CFAA 5HRNA 3M8SA 1TK0A 1DTTA 5D3GA 2HHXA 4M45A 2DFEA 1BIZA 3CFOA 3AO2A 3AVJA 3HT3A 3OJUA 2E6LA 3OYFA 2BE2A 3KLIA 3EZ5A 2YNHA 3MAQA 4ID1A 1R0AA 5FRNA 1Z25A 1ASVA 4CGJA 3G10A 4EP5A 3SI6A 3PY8A 5K14A 4CERA 4YFUA 3KLHA 4E3SA 4B9VA 4KRFA 1WNSA 3VQAA 2I5JA 3RRGA 4EZ9A 4DQIA 1I39A 4OGCA 1RT6A 3QLHA 2ZQBA 3VQ8A 1X9MA 3HVRA 4DQSA 4ELUA 2FC0A 3LWLA 4I9LA 3U6FA 1SKRA 1RDDA 3K5NA 4DF4A 4B9TA 1TKZA 4O44A 5J2PA 4GVMA 1EX4A 1TAQA 4OKJA 1BCMA 3OYEA 4CIEA 1L5UA 3SQ0A 4JLHA 4CGHA 3U3GA 4LH5A 3ZSZA 4CJFA 5J1EA 3SJJA 4H4OA 4IFVA 1SV5A 4J2AA 3VQEA 1NK0A 3K59A 3TABA 3IG1A 3OS1A 4DWIA 3CYMA 1RTDA 4CJ5A 2ZD1A 3AV9A 1NJWA 4KKOA 3OYAA 3OYNA 4CJLA 4RW6A 1HPZA 3MEGA 2G8KA 5KRTA 3HP6A 3SV3A 1C6VA 4AHVA 4BDPA 1FKOA 1S6QA 2OPRA 3QO9A 4IBNA 4EP4A 3OYHA 3EYZA 1XHZA 1XC9A 4PUOA 2KFZA 4DTXA 4OKEA 4LH4A 2KTQA 3O3FA 3C95A 4OLAA 3S3NA 4KPYA 3QEIA 2QKKA 1BQNA 2ITGA 3H08A 4G1QA 3OJSA 4FYDA 4B9SA 2D0CA 4FZXC 2Z1GA 4AHTA 3E01A 5C24A 3CFRA 3O3GA 1HQUA 4FM2A 1TV6A 2YNGA 4OKKA 5T7BA 3NHGA 4CEEA 2HVIA 2DTUA 5DK5A 4M3RA 2YV0X 3ZSQA 1G15A 1RBUA 1LW0A 2JLEA 1VSDA 2O4IA 3I0SA 3TAFA 2W42A 1HQEA 4CJPA 4Q0BA 1WSFA 3L2QA 3TARA 1FK9A 2QKBA 4FLXA 3ASMA 1NKCA 4FM0A 4FLVA 1TK8A 3OYIA 1RBRA 2HHTA 3TAPA 4CHYA 3KK2A 4FM1A 5DMRA 3JYTA 3HVTA 3C94A 4HUFA 1SL2A 1J9AA 1YVUA 3V9WA 2A1RA 3ZSOA 3KLEA 1EP4A 2PYLA 1RNHA 1LWEA 1YT3A 4IG3A 5HP1A 1KVAA 3HPGA 3OS2A 1QQCA 2HNYA 3L2VA 3LDSA 2HMIA 2Z1HA 4PA1A 3VQCA 3TAMA 1WAFA 3MECA 4DFMA 3PV8A 3AVBA 4M3TA 3AO1A 4FJGA 4QAGA 4E7LA 2XY6A 1HNIA 1LWFA 1U47A 4FJJA 4QCLA 4DQQA 1RTJA 3TAQA 3L8BA 3WNHA 2IDOA 3DLRA 1JL1A 4HUEA 4RW8A 1TKTA 3ITHA 5E41A 4DG1A 1T7PA 3QINA 1IKXA 4KREA 3AVCA 3ISNC 1VSEA 4RW7A 1RTIA 3ZT3A 4CF1A 4KI6A 4IFYA 4FK2A 2IAJA 3KTQA 3SQ1A 5CYMA 3KK3A 1RT4A 3LZJA 4FZYA 2KZMA 3V9XA 4DSFA 4K8ZA 1VRTA 4CJTA 2QXFA 3SUPA 3QEPA 1TVRA 1SL0A 3BGRA 4HHTA 1VSMA 2EX3A 3OVNA 4C8NA 4CJWA 1JLAA 4QOZB 1RT2A 3M8QA 1KFSA 3BDPA 1LAVA 2BGGA 5KTQA 4KV8A 4CEQA 1YTAA 4BWJA 4BE0A 3NE6A 4DS5A 4KB1A 4YNQA 2OYQA 4MQ3A 4NCAA 4IG0A 3WNFA 1U4BA 2RKIA 4B9NA 5HBMA 1HYVA 1ZBHA 4BDZA 4CHOA 3M8RA 5HRPA 4E7HA 4H4MA 2PY5A 5C25A 3RRHA 3DMJA 1L3SA 3QESA 3V1QA 2P1JA 1C0UA 3F9KA 4H8KA 4FLWA 1BI4B 2EHGA 3QEWA 4FVMA 2GUIA 1QTMA 1KTQA 4DU1A 1WAJA 5JS2A 3VA3A 1RT7A 4CGGA 3SYZA 1UWBA 3PO5A 1ZBUA 1WN7A 3AA4A 4CFCA 1LW2A 5CZ2A 4CJUA 4KTWA 3F73A 2OA8A 4M3XA 2F8SA 1X9WA 3KD1E 1UA0A 3ZT2A 1CZBA 2G8HA 4DFKA 1VRUA 3M8PA 4LSNA 3V6DA 3SUOA 3NH1A 1NK6A 5HRSA 1T05A 4DTNA 4FW2A 1ZBLA 1DTQA 3IS9A 3S3OA 4DS4A 4OGEA 4W5TA 4B3OA 3ALYA 4GMJB 3NGZA 1SUQA 4R5PA 1J53A 5KGWA 3L3UA 4CJ3A 4FJXA 2NUBA 1HYSA 2HNZA 5KI6A 4DTRA 3FFIA 1ASUA 1IKYA 3ZT0A 1TL1A 4CJQA 4CGFA 2X6SA 3SQ2A 4DTMA 4FJHA 1RDCA 3KIOA 3RMDA 2RN2A 3PO4A 4CFBA 3L2RA 2ETJA 3P1GA 4DTUA 1VSJA 4BE2A 3PX4A 1S9GA 2F8TA 3P5JA 3QNOA 1N5YA 4FJIA 3HPHA 4KHNA 3NH2A 2YKMA 5HLFA 2G8WA 2LSNA 3LWMA 2PZSA 3OYMA 2A1SA 1RBSA 4CGDA 1FKPA 1XI1A 4C8MA 1NK7A 2DY4A 3AVIA 4Y1CA 4Z4GA 4CESA 1BIUA 2HHUA 3AA3A 2HHQA 4CHZA 4Z4EA 4Z4HA 4FJNA 1X9SA 4W5OA 2OPPA 4E1MA 3B6PA 2P51A 4N56A 1QE1A 3PX6A 1Q9YA 4DSEA 3OYGA 3LP2A 4AHSA 3DRRA 1CZ9A 3VQ4A 4OLBA 4LY7A 1WSJA 2Q3SA 4BACA 1JLBA 3P83D 4CEBA 3VA0A 1SL1A 1CXUA 4M3ZA 5FRMA 1HNVA 1JLFA 4OPJA 1Q9XA 1JLGA 1Z26A 3K5LA 3QERA 3TI0A 1Q8IA 3ZSRA 2X74A 1T03A 1LWCA 5C42A 3S3MA 4LD0A 4UQGA 1T8EA 4B9MA 3ZSYA 1HYZA 1EXQA 1XWLA 3IRXA 1SKWA 2IC3A 3DRSA 4DTOA 4E0DA 2KW4A 3MEEA 4KFBA 4I7FA 3V9UA 4N5SA 1S1WA 4CEOA 2XHBA 4DTPA 5I42A 3TANA 1DLOA 1JXBA 4DTSA 1D8YA 3KD5E 4F8RA 1WSGA 4J2BA 3L2UA 4CHQA 3VQ7A 3V9SA 3U3YA 3MXJA 4Z0UA 5SZTA 3ZSVA 2P5GA 3AVKA 2GBZA 3AVGA 1C0TA 4O0IA 1NK5A 1BGXT 2YHAA 3VQQA 1L3VA 2GV9A 3OYLA 3CM6A 1KLMA 3K57A 2YNFA 3SQ4A 2F96A 2OZSA 4BE1A 4B8AB 2XY7A 1ASWA 4AHUA 3HJFA 4PY5A 2KFNA 1RDAA 1RT5A 3QEXA 4KTQA 3O4QA 1HMVA 4Z4FA 3DYAA 4JRPA 3IAYA 3LANA 3EY1A 2G8IA 1UOCA 1X1PA 3PX0A 5J2MA 3VQPA 1C1AA 2VG6A 2IS3A 3NCIA 4DTJA 3CG7A 4GW6A 3HYFA 3CFPA 2G8FA 2XO7A 1B92A 2YKNA 1TGOA 4Q5VA 3LPUA 3ZCMA 4W5RA 4E7JA 4CGIA 4DSJA 2IGIA 4O0JA 1JLQA 4N47A 4BDYA 1NKEA 4N41A 1ZYQA 4FXDA 1C0MA 1IG9A 2KZZA 1TL3A 3LP1A 4F3TA 4M3YA 1GOAA 3V1RA 4HTUA 3T3FA 4XIUA 3SPZA 3LPTA 3OYKA 3RMBA 4HCCA 4OPKA 3LP0A 1NJYA 4B08A 1EKEA 3V1OA 1RDBA 2P5OA 4DSLA 3RMCA 5HROA 1GOCA 2E4LA 2FBYA 2VG7A 2YHBA 3I0RA 3QIOA 3ZT4A 4OJRA 4C8KA 1JXEA 4RW9A 4FK4A 1QS4A 3AO4A 3T19A 3SPYA 4NYNA 1W9HA 4ELVA 1RTHA 3C6TA 3NF9A 4DF8A 4KHUA 4I2QA 4FZZA 3AO5A 4C8LA 2YNIA 4F3OA 3DI6A 1A5XA 5HRRA 5CZ1A 3NF8A 3CQ8A 3A2FA 1RT1A 4CFDA 1NK9A 3DLHA 3MXMA 1BISA 1TKXA 2ATQA 5KGXA 3TAEA 2O4GA 1D9FA 3DLBA 4HCBA 4LSLA 3KKSA 3LAKA 5J2NA 4F2SA 4AHCA 3V81A 4L8RB 1C1BA 2D0BA 2FBVA 3KLGA 3UIQA 3SV4A 1UAXA 4EZ6A 4O5BA 3WNEA 1MU2A 1VSIA 3HO1A 4C8OA 4O4GA 3AVMA 2JGUA 1IO2A 1WLJA 2HW3A 1NOYA 4TSXA 1LV5A 1BL3A 3LAMA 2WONA 3HPOA 1JL2A 1HJRA 3SCXA 2IOCA 4JS5A 3HP9A 4M42A 1KCFA 2BANA 3VQ5A 2OPQA 1L3UA 3OYBA 4KO0A 4M41A 2Y1IA 1J5OA 4FW1A 4DLGA 1ITGA 1RT3A 3RR8A 4F4KA 4NCBA 1KVCA 1U48A 4CK3A 3AVNA 1WSIA 1IH7A 3KLFA 2E6MA 4FJLA 4MFBA 5SWMA 4CECA 1VSLA 2DFHA 2Z1JA 1UA1A 1D5AA 3O3HA 3HM9A 3NDKA 2Z1IA 3DOKA 3K2PA 3AVHA 3L2WA 4DU4A 1U45A 4FJ5A 1S1XA 3DOLA 4CJSA 4KB0A 2AJQA 2OZMA 1WSEA 1TKDA 3T1AA 3L3VA 1CXQA 1RBTA 1S6PA 4CF0A 2Y1JA 3LP3A 1KLNA 3OYCA 3K5OA 4ZHRA 4KHQA 4W5NA 3C6UA 1KFDA 3NBPA 4Y1DA 3QETA 1IKWA 2X78A 4DU3A 5I3UA 3O4NA 4E19A 1N6QA 2FBTA 3V4IA 3VN5A 4E89A 3NGIA 3NFAA 1NK8A 3NF7A 1TAUA 1U49A 3AVAA 3SUQA 3QNNA 1JLEA 4IDKA 3VQDA 1QSYA 1VSKA 3OYDA 4DSKA 4CJVA 3KJVA 4DFJA 2XY5A 4FJMA 2QK9A 2WOMA 3TR8A 4ID5A 1U04A 3LALA 4ICLA 4AHRA 4CEFA 4CE9A 4CF9A 4DQRA 3S9HA 3VQBA 1I3AA 3VQ9A 4JS4A 4AILC 2HNDA 3SUNA 4E7IA 1TK5A 2G8UA 4FJ8A 4E7KA 5CY4A 4J2DA 1QHTA 1VK0A 2FBXA 2OPSA 1HRHA 2XY8A 3OS0A 3G0ZA 3AVFA 4DLEA 1LAWA 3AA5X 3NF6A 1QSLA 3PUFA 1NKBA 1XHXA 4M3UA 3AA2A 4M3WA 1REVA 2VG5A 3V9ZA 1ZBIA 4KHYA 3JSMA 1O1WA 2D0AA 3HL8A 3RMAA 1ZBFA 3D45A 3OYJA 3DLEA 3MXIA 2HHWA 1K6YA 4E1NA 3NH0A 4Z4IA 1S5JA 3D0PA 2B4JA 4CEZA 4ZTFA 2VWJA 1VSHA 2ZE2A 1IKVA 4CEAA 3LZIA 1NJZA 4B9UA 4CIFA 4O55A 5CYQA 4ZTJA 5FROA 4AH9A 1CLQA 4Z4CA 3TWHA 4FLUA 4CEDA 3HSTB 4FLTA 4BWMA 4CF2A 4DFPA 1A5VA 1S1TA 3HK2A 1S9EA 4PWDA 4CJEA 4HUGA 3RWUA 1NOZA 3RTVA 1BQMA 4J2EA 4FLYA 1EETA 3THVA 4RG8A 4FCYA 4NCGA 3TAGA 4CF8A 4FJKA 4CHPA 1W0HA 2BDPA 1S1UA 3SZ2A 1BHLA 2X6NA 4CK2A 3ZSWA 1BCOA 3ZSXA 3K5MA 4FK0A 5J2QA 3CM5A 3SNNA 3VQ6A 1GOBA 1F21A 4I9QA 4N76A 3OY9A 2R7YA 1SKSA 4KHWA 4IKFA 4KHSA 4PQUA 1D9DA 3KK1A 4B9LA 4W5QA 5FDLA 4FJ9A 3B6OA 4CHNA 1VSFA 1Y97A 2KQ2A 2VWKA 1QSSA 4CCHA 4NYFA 4F2RA 1RCHA 3DM2A 4FJ7A 4ELTA 4RW4A 3NGYA 1KVBA 4CJ4A 4DSIA 1JLCA 3DLGA 1A5WA 1YTUA 1RBVA 2RPIA 2HHSA 1KSPA 2XRIA 4JRQA 2G8VA 3NAEA 2RF2A 3KKRA 4CIGA 3DLKA 4KAZA 5KRSA 1JKHA 1L3TA 3ZT1A 2D5RA 4DMNA 3I8DA 2B6AA 4WE1A 4CJRA 2B5JA 1KRPA 1J54A 4CK1A 2PYJA 4KTZA 1S1VA 4FLZA 4DQPA 1FXXA 4I2PA 3RR7A 4KI4A 2HHVA 3ULDA 3DRPA 1BI4A 3HXMA 2HVHA 3WNGA 4HVJA 3K58A 5JS1A 1B9FA 1B9DA 1C1CA 4B8CA 1WSHA 1NK4A 1NJXA 3QIPA 4OVLA 3MEDA 1RILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EU7 A;  3AO3 A;  2DFF A;  3AVL A;  4CJK A;  4K8X A;  3QEV A;  2HB5 A;  4CFA A;  5HRN A;  3M8S A;  1TK0 A;  1DTT A;  5D3G A;  2HHX A;  4M45 A;  2DFE A;  1BIZ A;  3CFO A;  3AO2 A;  3AVJ A;  3HT3 A;  3OJU A;  2E6L A;  3OYF A;  2BE2 A;  3KLI A;  3EZ5 A;  2YNH A;  3MAQ A;  4ID1 A;  1R0A A;  5FRN A;  1Z25 A;  1ASV A;  4CGJ A;  3G10 A;  4EP5 A;  3SI6 A;  3PY8 A;  5K14 A;  4CER A;  4YFU A;  3KLH A;  4E3S A;  4B9V A;  4KRF A;  1WNS A;  3VQA A;  2I5J A;  3RRG A;  4EZ9 A;  4DQI A;  1I39 A;  4OGC A;  1RT6 A;  3QLH A;  2ZQB A;  3VQ8 A;  1X9M A;  3HVR A;  4DQS A;  4ELU A;  2FC0 A;  3LWL A;  4I9L A;  3U6F A;  1SKR A;  1RDD A;  3K5N A;  4DF4 A;  4B9T A;  1TKZ A;  4O44 A;  5J2P A;  4GVM A;  1EX4 A;  1TAQ A;  4OKJ A;  1BCM A;  3OYE A;  4CIE A;  1L5U A;  3SQ0 A;  4JLH A;  4CGH A;  3U3G A;  4LH5 A;  3ZSZ A;  4CJF A;  5J1E A;  3SJJ A;  4H4O A;  4IFV A;  1SV5 A;  4J2A A;  3VQE A;  1NK0 A;  3K59 A;  3TAB A;  3IG1 A;  3OS1 A;  4DWI A;  3CYM A;  1RTD A;  4CJ5 A;  2ZD1 A;  3AV9 A;  1NJW A;  4KKO A;  3OYA A;  3OYN A;  4CJL A;  4RW6 A;  1HPZ A;  3MEG A;  2G8K A;  5KRT A;  3HP6 A;  3SV3 A;  1C6V A;  4AHV A;  4BDP A;  1FKO A;  1S6Q A;  2OPR A;  3QO9 A;  4IBN A;  4EP4 A;  3OYH A;  3EYZ A;  1XHZ A;  1XC9 A;  4PUO A;  2KFZ A;  4DTX A;  4OKE A;  4LH4 A;  2KTQ A;  3O3F A;  3C95 A;  4OLA A;  3S3N A;  4KPY A;  3QEI A;  2QKK A;  1BQN A;  2ITG A;  3H08 A;  4G1Q A;  3OJS A;  4FYD A;  4B9S A;  2D0C A;  4FZX C;  2Z1G A;  4AHT A;  3E01 A;  5C24 A;  3CFR A;  3O3G A;  1HQU A;  4FM2 A;  1TV6 A;  2YNG A;  4OKK A;  5T7B A;  3NHG A;  4CEE A;  2HVI A;  2DTU A;  5DK5 A;  4M3R A;  2YV0 X;  3ZSQ A;  1G15 A;  1RBU A;  1LW0 A;  2JLE A;  1VSD A;  2O4I A;  3I0S A;  3TAF A;  2W42 A;  1HQE A;  4CJP A;  4Q0B A;  1WSF A;  3L2Q A;  3TAR A;  1FK9 A;  2QKB A;  4FLX A;  3ASM A;  1NKC A;  4FM0 A;  4FLV A;  1TK8 A;  3OYI A;  1RBR A;  2HHT A;  3TAP A;  4CHY A;  3KK2 A;  4FM1 A;  5DMR A;  3JYT A;  3HVT A;  3C94 A;  4HUF A;  1SL2 A;  1J9A A;  1YVU A;  3V9W A;  2A1R A;  3ZSO A;  3KLE A;  1EP4 A;  2PYL A;  1RNH A;  1LWE A;  1YT3 A;  4IG3 A;  5HP1 A;  1KVA A;  3HPG A;  3OS2 A;  1QQC A;  2HNY A;  3L2V A;  3LDS A;  2HMI A;  2Z1H A;  4PA1 A;  3VQC A;  3TAM A;  1WAF A;  3MEC A;  4DFM A;  3PV8 A;  3AVB A;  4M3T A;  3AO1 A;  4FJG A;  4QAG A;  4E7L A;  2XY6 A;  1HNI A;  1LWF A;  1U47 A;  4FJJ A;  4QCL A;  4DQQ A;  1RTJ A;  3TAQ A;  3L8B A;  3WNH A;  2IDO A;  3DLR A;  1JL1 A;  4HUE A;  4RW8 A;  1TKT A;  3ITH A;  5E41 A;  4DG1 A;  1T7P A;  3QIN A;  1IKX A;  4KRE A;  3AVC A;  3ISN C;  1VSE A;  4RW7 A;  1RTI A;  3ZT3 A;  4CF1 A;  4KI6 A;  4IFY A;  4FK2 A;  2IAJ A;  3KTQ A;  3SQ1 A;  5CYM A;  3KK3 A;  1RT4 A;  3LZJ A;  4FZY A;  2KZM A;  3V9X A;  4DSF A;  4K8Z A;  1VRT A;  4CJT A;  2QXF A;  3SUP A;  3QEP A;  1TVR A;  1SL0 A;  3BGR A;  4HHT A;  1VSM A;  2EX3 A;  3OVN A;  4C8N A;  4CJW A;  1JLA A;  4QOZ B;  1RT2 A;  3M8Q A;  1KFS A;  3BDP A;  1LAV A;  2BGG A;  5KTQ A;  4KV8 A;  4CEQ A;  1YTA A;  4BWJ A;  4BE0 A;  3NE6 A;  4DS5 A;  4KB1 A;  4YNQ A;  2OYQ A;  4MQ3 A;  4NCA A;  4IG0 A;  3WNF A;  1U4B A;  2RKI A;  4B9N A;  5HBM A;  1HYV A;  1ZBH A;  4BDZ A;  4CHO A;  3M8R A;  5HRP A;  4E7H A;  4H4M A;  2PY5 A;  5C25 A;  3RRH A;  3DMJ A;  1L3S A;  3QES A;  3V1Q A;  2P1J A;  1C0U A;  3F9K A;  4H8K A;  4FLW A;  1BI4 B;  2EHG A;  3QEW A;  4FVM A;  2GUI A;  1QTM A;  1KTQ A;  4DU1 A;  1WAJ A;  5JS2 A;  3VA3 A;  1RT7 A;  4CGG A;  3SYZ A;  1UWB A;  3PO5 A;  1ZBU A;  1WN7 A;  3AA4 A;  4CFC A;  1LW2 A;  5CZ2 A;  4CJU A;  4KTW A;  3F73 A;  2OA8 A;  4M3X A;  2F8S A;  1X9W A;  3KD1 E;  1UA0 A;  3ZT2 A;  1CZB A;  2G8H A;  4DFK A;  1VRU A;  3M8P A;  4LSN A;  3V6D A;  3SUO A;  3NH1 A;  1NK6 A;  5HRS A;  1T05 A;  4DTN A;  4FW2 A;  1ZBL A;  1DTQ A;  3IS9 A;  3S3O A;  4DS4 A;  4OGE A;  4W5T A;  4B3O A;  3ALY A;  4GMJ B;  3NGZ A;  1SUQ A;  4R5P A;  1J53 A;  5KGW A;  3L3U A;  4CJ3 A;  4FJX A;  2NUB A;  1HYS A;  2HNZ A;  5KI6 A;  4DTR A;  3FFI A;  1ASU A;  1IKY A;  3ZT0 A;  1TL1 A;  4CJQ A;  4CGF A;  2X6S A;  3SQ2 A;  4DTM A;  4FJH A;  1RDC A;  3KIO A;  3RMD A;  2RN2 A;  3PO4 A;  4CFB A;  3L2R A;  2ETJ A;  3P1G A;  4DTU A;  1VSJ A;  4BE2 A;  3PX4 A;  1S9G A;  2F8T A;  3P5J A;  3QNO A;  1N5Y A;  4FJI A;  3HPH A;  4KHN A;  3NH2 A;  2YKM A;  5HLF A;  2G8W A;  2LSN A;  3LWM A;  2PZS A;  3OYM A;  2A1S A;  1RBS A;  4CGD A;  1FKP A;  1XI1 A;  4C8M A;  1NK7 A;  2DY4 A;  3AVI A;  4Y1C A;  4Z4G A;  4CES A;  1BIU A;  2HHU A;  3AA3 A;  2HHQ A;  4CHZ A;  4Z4E A;  4Z4H A;  4FJN A;  1X9S A;  4W5O A;  2OPP A;  4E1M A;  3B6P A;  2P51 A;  4N56 A;  1QE1 A;  3PX6 A;  1Q9Y A;  4DSE A;  3OYG A;  3LP2 A;  4AHS A;  3DRR A;  1CZ9 A;  3VQ4 A;  4OLB A;  4LY7 A;  1WSJ A;  2Q3S A;  4BAC A;  1JLB A;  3P83 D;  4CEB A;  3VA0 A;  1SL1 A;  1CXU A;  4M3Z A;  5FRM A;  1HNV A;  1JLF A;  4OPJ A;  1Q9X A;  1JLG A;  1Z26 A;  3K5L A;  3QER A;  3TI0 A;  1Q8I A;  3ZSR A;  2X74 A;  1T03 A;  1LWC A;  5C42 A;  3S3M A;  4LD0 A;  4UQG A;  1T8E A;  4B9M A;  3ZSY A;  1HYZ A;  1EXQ A;  1XWL A;  3IRX A;  1SKW A;  2IC3 A;  3DRS A;  4DTO A;  4E0D A;  2KW4 A;  3MEE A;  4KFB A;  4I7F A;  3V9U A;  4N5S A;  1S1W A;  4CEO A;  2XHB A;  4DTP A;  5I42 A;  3TAN A;  1DLO A;  1JXB A;  4DTS A;  1D8Y A;  3KD5 E;  4F8R A;  1WSG A;  4J2B A;  3L2U A;  4CHQ A;  3VQ7 A;  3V9S A;  3U3Y A;  3MXJ A;  4Z0U A;  5SZT A;  3ZSV A;  2P5G A;  3AVK A;  2GBZ A;  3AVG A;  1C0T A;  4O0I A;  1NK5 A;  1BGX T;  2YHA A;  3VQQ A;  1L3V A;  2GV9 A;  3OYL A;  3CM6 A;  1KLM A;  3K57 A;  2YNF A;  3SQ4 A;  2F96 A;  2OZS A;  4BE1 A;  4B8A B;  2XY7 A;  1ASW A;  4AHU A;  3HJF A;  4PY5 A;  2KFN A;  1RDA A;  1RT5 A;  3QEX A;  4KTQ A;  3O4Q A;  1HMV A;  4Z4F A;  3DYA A;  4JRP A;  3IAY A;  3LAN A;  3EY1 A;  2G8I A;  1UOC A;  1X1P A;  3PX0 A;  5J2M A;  3VQP A;  1C1A A;  2VG6 A;  2IS3 A;  3NCI A;  4DTJ A;  3CG7 A;  4GW6 A;  3HYF A;  3CFP A;  2G8F A;  2XO7 A;  1B92 A;  2YKN A;  1TGO A;  4Q5V A;  3LPU A;  3ZCM A;  4W5R A;  4E7J A;  4CGI A;  4DSJ A;  2IGI A;  4O0J A;  1JLQ A;  4N47 A;  4BDY A;  1NKE A;  4N41 A;  1ZYQ A;  4FXD A;  1C0M A;  1IG9 A;  2KZZ A;  1TL3 A;  3LP1 A;  4F3T A;  4M3Y A;  1GOA A;  3V1R A;  4HTU A;  3T3F A;  4XIU A;  3SPZ A;  3LPT A;  3OYK A;  3RMB A;  4HCC A;  4OPK A;  3LP0 A;  1NJY A;  4B08 A;  1EKE A;  3V1O A;  1RDB A;  2P5O A;  4DSL A;  3RMC A;  5HRO A;  1GOC A;  2E4L A;  2FBY A;  2VG7 A;  2YHB A;  3I0R A;  3QIO A;  3ZT4 A;  4OJR A;  4C8K A;  1JXE A;  4RW9 A;  4FK4 A;  1QS4 A;  3AO4 A;  3T19 A;  3SPY A;  4NYN A;  1W9H A;  4ELV A;  1RTH A;  3C6T A;  3NF9 A;  4DF8 A;  4KHU A;  4I2Q A;  4FZZ A;  3AO5 A;  4C8L A;  2YNI A;  4F3O A;  3DI6 A;  1A5X A;  5HRR A;  5CZ1 A;  3NF8 A;  3CQ8 A;  3A2F A;  1RT1 A;  4CFD A;  1NK9 A;  3DLH A;  3MXM A;  1BIS A;  1TKX A;  2ATQ A;  5KGX A;  3TAE A;  2O4G A;  1D9F A;  3DLB A;  4HCB A;  4LSL A;  3KKS A;  3LAK A;  5J2N A;  4F2S A;  4AHC A;  3V81 A;  4L8R B;  1C1B A;  2D0B A;  2FBV A;  3KLG A;  3UIQ A;  3SV4 A;  1UAX A;  4EZ6 A;  4O5B A;  3WNE A;  1MU2 A;  1VSI A;  3HO1 A;  4C8O A;  4O4G A;  3AVM A;  2JGU A;  1IO2 A;  1WLJ A;  2HW3 A;  1NOY A;  4TSX A;  1LV5 A;  1BL3 A;  3LAM A;  2WON A;  3HPO A;  1JL2 A;  1HJR A;  3SCX A;  2IOC A;  4JS5 A;  3HP9 A;  4M42 A;  1KCF A;  2BAN A;  3VQ5 A;  2OPQ A;  1L3U A;  3OYB A;  4KO0 A;  4M41 A;  2Y1I A;  1J5O A;  4FW1 A;  4DLG A;  1ITG A;  1RT3 A;  3RR8 A;  4F4K A;  4NCB A;  1KVC A;  1U48 A;  4CK3 A;  3AVN A;  1WSI A;  1IH7 A;  3KLF A;  2E6M A;  4FJL A;  4MFB A;  5SWM A;  4CEC A;  1VSL A;  2DFH A;  2Z1J A;  1UA1 A;  1D5A A;  3O3H A;  3HM9 A;  3NDK A;  2Z1I A;  3DOK A;  3K2P A;  3AVH A;  3L2W A;  4DU4 A;  1U45 A;  4FJ5 A;  1S1X A;  3DOL A;  4CJS A;  4KB0 A;  2AJQ A;  2OZM A;  1WSE A;  1TKD A;  3T1A A;  3L3V A;  1CXQ A;  1RBT A;  1S6P A;  4CF0 A;  2Y1J A;  3LP3 A;  1KLN A;  3OYC A;  3K5O A;  4ZHR A;  4KHQ A;  4W5N A;  3C6U A;  1KFD A;  3NBP A;  4Y1D A;  3QET A;  1IKW A;  2X78 A;  4DU3 A;  5I3U A;  3O4N A;  4E19 A;  1N6Q A;  2FBT A;  3V4I A;  3VN5 A;  4E89 A;  3NGI A;  3NFA A;  1NK8 A;  3NF7 A;  1TAU A;  1U49 A;  3AVA A;  3SUQ A;  3QNN A;  1JLE A;  4IDK A;  3VQD A;  1QSY A;  1VSK A;  3OYD A;  4DSK A;  4CJV A;  3KJV A;  4DFJ A;  2XY5 A;  4FJM A;  2QK9 A;  2WOM A;  3TR8 A;  4ID5 A;  1U04 A;  3LAL A;  4ICL A;  4AHR A;  4CEF A;  4CE9 A;  4CF9 A;  4DQR A;  3S9H A;  3VQB A;  1I3A A;  3VQ9 A;  4JS4 A;  4AIL C;  2HND A;  3SUN A;  4E7I A;  1TK5 A;  2G8U A;  4FJ8 A;  4E7K A;  5CY4 A;  4J2D A;  1QHT A;  1VK0 A;  2FBX A;  2OPS A;  1HRH A;  2XY8 A;  3OS0 A;  3G0Z A;  3AVF A;  4DLE A;  1LAW A;  3AA5 X;  3NF6 A;  1QSL A;  3PUF A;  1NKB A;  1XHX A;  4M3U A;  3AA2 A;  4M3W A;  1REV A;  2VG5 A;  3V9Z A;  1ZBI A;  4KHY A;  3JSM A;  1O1W A;  2D0A A;  3HL8 A;  3RMA A;  1ZBF A;  3D45 A;  3OYJ A;  3DLE A;  3MXI A;  2HHW A;  1K6Y A;  4E1N A;  3NH0 A;  4Z4I A;  1S5J A;  3D0P A;  2B4J A;  4CEZ A;  4ZTF A;  2VWJ A;  1VSH A;  2ZE2 A;  1IKV A;  4CEA A;  3LZI A;  1NJZ A;  4B9U A;  4CIF A;  4O55 A;  5CYQ A;  4ZTJ A;  5FRO A;  4AH9 A;  1CLQ A;  4Z4C A;  3TWH A;  4FLU A;  4CED A;  3HST B;  4FLT A;  4BWM A;  4CF2 A;  4DFP A;  1A5V A;  1S1T A;  3HK2 A;  1S9E A;  4PWD A;  4CJE A;  4HUG A;  3RWU A;  1NOZ A;  3RTV A;  1BQM A;  4J2E A;  4FLY A;  1EET A;  3THV A;  4RG8 A;  4FCY A;  4NCG A;  3TAG A;  4CF8 A;  4FJK A;  4CHP A;  1W0H A;  2BDP A;  1S1U A;  3SZ2 A;  1BHL A;  2X6N A;  4CK2 A;  3ZSW A;  1BCO A;  3ZSX A;  3K5M A;  4FK0 A;  5J2Q A;  3CM5 A;  3SNN A;  3VQ6 A;  1GOB A;  1F21 A;  4I9Q A;  4N76 A;  3OY9 A;  2R7Y A;  1SKS A;  4KHW A;  4IKF A;  4KHS A;  4PQU A;  1D9D A;  3KK1 A;  4B9L A;  4W5Q A;  5FDL A;  4FJ9 A;  3B6O A;  4CHN A;  1VSF A;  1Y97 A;  2KQ2 A;  2VWK A;  1QSS A;  4CCH A;  4NYF A;  4F2R A;  1RCH A;  3DM2 A;  4FJ7 A;  4ELT A;  4RW4 A;  3NGY A;  1KVB A;  4CJ4 A;  4DSI A;  1JLC A;  3DLG A;  1A5W A;  1YTU A;  1RBV A;  2RPI A;  2HHS A;  1KSP A;  2XRI A;  4JRQ A;  2G8V A;  3NAE A;  2RF2 A;  3KKR A;  4CIG A;  3DLK A;  4KAZ A;  5KRS A;  1JKH A;  1L3T A;  3ZT1 A;  2D5R A;  4DMN A;  3I8D A;  2B6A A;  4WE1 A;  4CJR A;  2B5J A;  1KRP A;  1J54 A;  4CK1 A;  2PYJ A;  4KTZ A;  1S1V A;  4FLZ A;  4DQP A;  1FXX A;  4I2P A;  3RR7 A;  4KI4 A;  2HHV A;  3ULD A;  3DRP A;  1BI4 A;  3HXM A;  2HVH A;  3WNG A;  4HVJ A;  3K58 A;  5JS1 A;  1B9F A;  1B9D A;  1C1C A;  4B8C A;  1WSH A;  1NK4 A;  1NJX A;  3QIP A;  4OVL A;  3MED A;  1RIL A; 
#chains in the Genus database with same CATH topology
 5BRD A;  4K8X A;  4C1N K;  2HHX A;  2DFE A;  3CI5 A;  4IOC L;  2BE2 A;  3O08 A;  3CJ7 A;  4CGJ A;  3KLH A;  4O5F A;  1RT6 A;  1T3V A;  1NMD A;  3HVR A;  4BR7 A;  4WQ4 A;  4ELU A;  3Q7C A;  1SKR A;  4B9T A;  5KQD A;  2NRX A;  1L5U A;  1NWK A;  2FSN A;  3U3G A;  3ZSZ A;  5J1E A;  4PKG A;  1SV5 A;  3F5T A;  5AQJ A;  3PSF A;  4DWI A;  3CC4 N;  2ZD1 A;  1IV0 A;  1TUY A;  3EZW A;  1NJW A;  4KKO A;  3MCP A;  4DR6 K;  4RW6 A;  2G8K A;  4QS9 A;  1C6V A;  1FKO A;  1S6Q A;  3OYH A;  2HF3 A;  4JV5 K;  1T6D A;  2UU9 K;  4O8U A;  4OKE A;  5EXW A;  3H08 A;  4NXN K;  4AHT A;  5C24 A;  4CJ7 A;  3CFR A;  1HQU A;  3CCE N;  1XUP O;  3NHG A;  4CEE A;  4FL9 A;  2ZGY A;  2HVI A;  1RBU A;  4AQY K;  3UB5 A;  2O4I A;  1HQE A;  3THX A;  1WSF A;  3THW A;  1NKC A;  5LJV A;  5BR8 K;  1RBR A;  3TAP A;  2CGL A;  4CHY A;  5FPM A;  3HVT A;  1SL2 A;  1DEJ A;  3OS2 A;  3L2V A;  4PA1 A;  3TAM A;  3MEC A;  3AO1 A;  4JKG B;  2FSJ A;  4FJG A;  4B9Q A;  5E84 A;  4DUZ K;  3LM9 A;  2ASM A;  1YXQ A;  4DG1 A;  1BOT O;  5AQX A;  4B3T K;  1VSE A;  5E26 A;  2CH6 A;  5BPN A;  5CYM A;  4FZY A;  3V9X A;  4PHT X;  4M63 C;  4BGB A;  1ZBS A;  2QXF A;  3QEP A;  1TVR A;  3OVN A;  4M7X A;  4CJW A;  1RT2 A;  3M8Q A;  1LAV A;  3VEW A;  4KV8 A;  3G4S N;  3AAP A;  4DS5 A;  1K8K B;  2OYQ A;  1HKC A;  5HL7 L;  3F9M A;  4GV3 A;  2E88 A;  5HBM A;  4B9N A;  4C1N I;  1HYV A;  4F9O A;  1ZBH A;  2D0O A;  1XMO K;  2PY5 A;  4G9Z A;  2VQF K;  3SJH A;  3DMJ A;  1L3S A;  3QES A;  1C0U A;  3LM2 A;  3QEW A;  3ZYY X;  2GUI A;  1QTM A;  1WAJ A;  3VA3 A;  1E3M A;  1RT7 A;  3BZC A;  1WN7 A;  4LF7 K;  1NLV A;  2G8H A;  4PL7 A;  1KQS M;  1ESV A;  1VQ8 N;  3LDO A;  1HLU A;  4LSN A;  3RSE B;  4H0V B;  4DV5 K;  2AA4 A;  2QWP A;  4Z94 A;  1T05 A;  4A2B A;  4FW2 A;  3KHY A;  1DTQ A;  4LFB K;  3VEV A;  3BP8 A;  1J53 A;  2NUB A;  5AQI A;  4DTR A;  4MLE A;  3ZT0 A;  3EKS A;  4DTM A;  4FJH A;  5AQQ A;  5H1S Q;  4CFB A;  2NRH A;  4BR9 A;  3U9Z A;  1OKJ A;  3A5O C;  3NH2 A;  2LSN A;  1N8R O;  1EO1 A;  3LWM A;  5B8H A;  2PZS A;  1NK7 A;  3VEX A;  1FKP A;  3AVI A;  4Y1C A;  4DV1 K;  1BIU A;  3HOT A;  2HBK A;  4Z4H A;  5JLH A;  3B6P A;  2YCH A;  4FVU A;  3CCS N;  3BEX A;  1M90 O;  1EWR A;  3DRR A;  1CZ9 A;  5AQV A;  2D4W A;  5MLC Q;  2HST A;  3JS6 A;  4OPJ A;  1Z26 A;  4JKH A;  1MWK A;  1Q8I A;  4JI3 K;  4JI8 K;  3S3M A;  4WQ5 C;  4UQG A;  1KAX A;  3ZSY A;  3IRX A;  1SKW A;  4C23 A;  1WBB A;  4BVO A;  4DTO A;  4E0D A;  1X3N A;  3MEE A;  4KFB A;  4DTP A;  4NXM K;  5I42 A;  4JI6 K;  1JXB A;  4GY2 B;  5GIN A;  2IVO A;  4J2B A;  4CHQ A;  3P39 A;  3V9S A;  3U3Y A;  3THX B;  3THW B;  3ZSV A;  1O13 A;  4CZI A;  4O0I A;  3MN6 A;  1KLM A;  4IO9 L;  2YNF A;  3KVG A;  2F96 A;  3SQ4 A;  4BE1 A;  1SZ2 A;  5EOY A;  2A6A A;  3DYA A;  4BGA A;  1UOC A;  1C1A A;  4WF9 L;  2VG6 A;  2IS3 A;  3O9U A;  3CG7 A;  2XO7 A;  5M1F A;  3LPU A;  4W5R A;  4CGI A;  2QA4 N;  3CJB A;  2IGI A;  4O0J A;  1NKE A;  4N41 A;  1ZYQ A;  1IG9 A;  1TL3 A;  5IWA K;  4JN4 A;  4F3T A;  3ZLJ A;  3SPZ A;  4HTU A;  3OYK A;  4FPB A;  3ZX2 A;  1QHA A;  3EE8 A;  4B3R K;  4BRO A;  1GOC A;  1WUA A;  2Q0R A;  3ZT4 A;  3FLC O;  1KAY A;  1JXE A;  1QS4 A;  4B1V A;  3SPY A;  1RTH A;  4KHU A;  5LJW A;  2YNI A;  2E2N A;  5AJ3 K;  3CQ8 A;  3ENH A;  5TKY A;  1RT1 A;  5GAH P;  2O8F A;  1BIS A;  3TAE A;  5KPR A;  4LSL A;  3KKS A;  3LAK A;  3V81 A;  2E5L K;  1C1B A;  4L8R B;  1BG3 A;  1UAX A;  3WNE A;  5AQN A;  1VSI A;  1IO2 A;  2HW3 A;  4BY9 C;  4TSX A;  1BL3 A;  4GVE A;  4MLH A;  1IBM K;  1JL2 A;  2IOC A;  4DKW A;  1W7A A;  4JD2 A;  3L4Q A;  1J5O A;  4DLG A;  1ITG A;  3TTD A;  4CK3 A;  1WOQ A;  3AVN A;  3KLF A;  1IH7 A;  3R8E A;  2F7T A;  2P9P A;  4MFB A;  4CVN E;  4CEC A;  5TKW A;  2DFH A;  2FF3 B;  2Z1J A;  1UA1 A;  3O3H A;  2QM1 A;  3HM9 A;  3DOK A;  3AVH A;  1U45 A;  2ZF5 O;  4X64 K;  1TKD A;  2ZJP L;  1RBT A;  4CF0 A;  1NM1 A;  3OYC A;  5AZJ B;  1KFD A;  1Q7Y O;  1ZC6 A;  3V4I A;  2QI2 A;  4HWI A;  3E9O A;  1NK8 A;  1NGG A;  1OH5 A;  3VQD A;  1Y64 A;  3OA9 A;  4BG9 A;  4JI7 K;  3KJV A;  2WOM A;  3C7N B;  4ID5 A;  4ICL A;  4CEF A;  3G25 A;  3EL2 A;  4K0K K;  4DR5 K;  3THY A;  1I3A A;  3VQ9 A;  4AIL C;  2G8U A;  4E7K A;  5CY4 A;  4J2D A;  2D1K A;  5GAE P;  3IFR A;  4FWO A;  3ZX0 A;  4H5V A;  1NKB A;  1GLF O;  3AA2 A;  4IOX A;  1EQY A;  4KHY A;  5C0Y A;  1ZBF A;  4CBX A;  3MXI A;  1R59 O;  3D6R A;  2A5X A;  2HBJ A;  3SLC A;  3HTV A;  4E1N A;  2ZWH A;  1VSH A;  3MWP A;  2ZE2 A;  5M1O A;  1IKV A;  4B1U B;  4EHU A;  4CEA A;  4FWQ A;  4L3Q A;  4B9U A;  4CIF A;  5CYQ A;  5EX5 A;  3AAQ A;  2O8C B;  4CI6 A;  4CF2 A;  1A5V A;  3H46 O;  4CJE A;  4HUG A;  4RWT A;  5C2F A;  3ID6 A;  4K41 A;  4NCG A;  4CF8 A;  4BRE A;  3OW2 M;  4CHP A;  5LMU K;  5AFU A;  3VGM A;  2X6N A;  3ZSW A;  4YDU A;  3CM5 A;  3FE1 A;  4YOU A;  1F21 A;  4N76 A;  4KHS A;  5AQP A;  1D9D A;  1KC8 O;  3S41 A;  4LF9 K;  4CCH A;  3Q7B A;  3NMU A;  4F2R A;  1KVB A;  1YTU A;  2ITM A;  1A5W A;  1ATR A;  4WFB L;  1RGI A;  2XRI A;  4JRQ A;  2G8V A;  2RF2 A;  4KAZ A;  2Q1N A;  5KRS A;  4KH6 A;  2D5R A;  2B6A A;  4WE1 A;  1KRP A;  4KTZ A;  2NRT A;  4FLZ A;  2HHV A;  3G71 N;  3ULD A;  1BI4 A;  4DR4 K;  4BRF A;  3VEZ A;  1WSH A;  1NK4 A;  1Q86 O;  4OVL A;  3NF7 A;  1RIL A;  3AVL A;  3HSC A;  3QEV A;  5D3G A;  4M45 A;  2VCP A;  4YOX A;  2O8F B;  3HT3 A;  1R0A A;  3MAQ A;  3DWL A;  4LF4 K;  3IMX A;  1ASV A;  2WTU A;  4E3S A;  3VQA A;  3DJC A;  2ZJQ L;  2VGM A;  1X9M A;  3HBT A;  3CET A;  4I9L A;  1ATS A;  1RDD A;  3I33 A;  4GVM A;  4FOE A;  1TAQ A;  1Q82 O;  2OCE A;  2NRR A;  3TTC A;  3SQ0 A;  4JD2 B;  4JLH A;  2Q2R A;  4E1J A;  4J2A A;  1NK0 A;  3TAB A;  3CYM A;  4IO8 A;  2P9P B;  3AV9 A;  2O8E A;  2Q97 A;  3OYA A;  5M1Q A;  3A5M C;  4BDP A;  1XHZ A;  4IBN A;  2OPR A;  2KFZ A;  3EYZ A;  5EVZ A;  2NRZ A;  4OLA A;  3S3N A;  2HBM A;  2PAV A;  2ITG A;  4G1Q A;  3OJS A;  3DXK A;  1QZ5 A;  4B9S A;  4YY3 K;  4BR5 A;  3OTO K;  1NGJ A;  3TSU A;  3O3G A;  4FM2 A;  2YNG A;  2DTU A;  3THY B;  1IBL K;  1G15 A;  1LW0 A;  3QB0 A;  1VSD A;  4A59 A;  3I0S A;  4CJP A;  3TAR A;  3ASM A;  1TK8 A;  4JKG A;  2HHT A;  4FM1 A;  3JYT A;  4HUF A;  3KLE A;  2PYL A;  3EEQ A;  2E1Z A;  1KVA A;  3FGU A;  3VQC A;  4DFM A;  3PV8 A;  3AVB A;  4QAG A;  4E7L A;  3DXM A;  1U47 A;  4QCL A;  3L8B A;  3WNH A;  1JL1 A;  3FFK B;  1EWQ A;  4RW8 A;  3H1V X;  1TKT A;  1T7P A;  3QIN A;  1IKX A;  1NGI A;  4BQL A;  4RW7 A;  3ZT3 A;  4V19 S;  4IFY A;  4DR7 K;  4FK2 A;  2IAJ A;  3SQ1 A;  1Z6R A;  3KK3 A;  1RT4 A;  3LZJ A;  1K8K A;  4PL8 A;  4K8Z A;  4CJT A;  3SUP A;  1SL0 A;  3H1Q A;  4HHT A;  3T7Z A;  4QOZ B;  4BRK A;  1KFS A;  3BDP A;  5BR9 A;  2RHK A;  2BGG A;  5KTQ A;  4CEQ A;  4BWJ A;  2A40 A;  4JK9 A;  3CCM N;  3ZEU A;  4JI0 K;  4NCA A;  3WNF A;  3R1X A;  2RKI A;  3SAF A;  3ATV A;  5DM7 L;  3VET A;  5C25 A;  4DR1 K;  3RRH A;  2QXL A;  2P1J A;  3RSE A;  3M5R A;  1VQ4 N;  1BI4 B;  2EHG A;  4DU1 A;  5JS2 A;  2V7Z A;  3H3O B;  4CGG A;  3VTH A;  2OA8 A;  3F73 A;  2GUP A;  1UA0 A;  1BUP A;  4JI5 K;  1VRU A;  3QML A;  3SUO A;  4FWR A;  3NH1 A;  3VF4 A;  1ZBL A;  4IJN A;  3S3O A;  4W5T A;  4BQZ A;  1SUQ A;  2CH5 A;  4CJ3 A;  1HYS A;  2HNZ A;  1VQ5 N;  1IBK K;  1NGD A;  4CJQ A;  1NGC A;  1RDU A;  3A0I X;  2UUB K;  2PFU A;  1RDC A;  3ENB A;  2RN2 A;  1U2V A;  5LL6 Z;  2ETJ A;  1GLE G;  2V51 B;  1S9G A;  1X3M A;  3QNO A;  1N5Y A;  3HPH A;  2YKM A;  2G8W A;  1OVY A;  3OYM A;  1RBS A;  3CCL N;  2O8E B;  4LF5 K;  3GDQ A;  1NJI O;  2HHQ A;  1HJO A;  2W40 A;  3IUC A;  4OO1 J;  3PX6 A;  4MO5 A;  5GIO A;  3ID8 A;  3D7E O;  3LP2 A;  2BTF A;  1YUW A;  3VA0 A;  1CXU A;  5FRM A;  5BRF A;  3ZSR A;  3DXK B;  3QFP A;  1EXQ A;  4M7Y A;  3SMS A;  3OBY A;  3DRS A;  5AQR A;  1K9M O;  3JXU A;  1LCU A;  1CZA N;  2KW4 A;  4I7F A;  3CCQ N;  4N5S A;  1S1W A;  3N4P A;  1DLO A;  1P90 A;  1WSG A;  2P5G A;  3AVK A;  1C0T A;  1NK5 A;  2YHA A;  3VQQ A;  1L3V A;  4GV6 A;  2KKZ A;  4B8A B;  4AHU A;  4GV9 A;  3R3L A;  1RDA A;  2IIR A;  3T1Y K;  4KTQ A;  3IAY A;  3LAN A;  1JCG A;  3DXM B;  3C65 A;  4Q5V A;  3J8A A;  4DSJ A;  1JLQ A;  1OVQ A;  1YIT N;  1C0M A;  2QWM A;  3F2K A;  3LP1 A;  3TTF A;  3CPE A;  4M3Y A;  4WQ4 C;  3CC7 N;  3QFU A;  4NLB A;  4OPK A;  1Q81 O;  3AAR A;  1RDB A;  5HOO A;  3QIC A;  4O8K A;  3RMC A;  5HRO A;  2FBY A;  2E4L A;  2VG7 A;  2YHB A;  4H5R A;  4OJR A;  2ZGZ A;  3T19 A;  4NYN A;  3NVM A;  4ELV A;  2GEM A;  4C8L A;  4F3O A;  3DI6 A;  1A5X A;  5HRR A;  4JKF A;  5CZ1 A;  3ZEU B;  4CFD A;  1E4F T;  3MXM A;  5KGX A;  4HCB A;  3ULE A;  3GG4 A;  3SV4 A;  4EZ6 A;  4O5B A;  3HO1 A;  4C8O A;  4O4G A;  3AVM A;  1YF5 L;  1NOY A;  1K73 O;  3CER A;  4QS7 A;  2YHX A;  1YI2 N;  3SCX A;  1KCF A;  3VQ5 A;  1NG9 A;  3A8Y A;  3OYB A;  4A5B A;  4M41 A;  1RT3 A;  3C0B A;  3RR8 A;  5AQL A;  4YOV A;  1KVC A;  1U48 A;  5AZJ A;  1QQN A;  4DV6 K;  2E6M A;  4AF1 A;  1D5A A;  2QW9 A;  5BRE A;  3NDK A;  4DU4 A;  4KB0 A;  1WSE A;  3T1A A;  4CZJ A;  4KHQ A;  3C7N A;  3QBX A;  4Y1D A;  3C6U A;  2W6K A;  3NBP A;  3QET A;  1IKW A;  1S72 N;  5I3U A;  1U2V B;  4E19 A;  4H0T B;  4B1Y B;  4BC3 A;  1TAU A;  3SUQ A;  4IDK A;  3VGL A;  1JLE A;  2GWJ A;  4KH4 A;  1QSY A;  4EAH D;  3OBW A;  4R79 A;  1DKG D;  3H45 C;  3LAL A;  3I8B A;  4AHR A;  4CE9 A;  4FWP A;  2V7Y A;  4E7I A;  4OX9 K;  3P4I A;  3LDQ A;  3AVF A;  4JKD A;  1LAW A;  3AA5 X;  3NF6 A;  1QSL A;  3PUF A;  2VWB A;  1XNQ K;  4M3U A;  1VQL N;  4M3W A;  2O8C A;  1ZBI A;  3D45 A;  4JKB A;  1BWF O;  4FWK A;  3OYJ A;  3DLE A;  1YJ9 N;  2HHW A;  4CZM A;  1K6Y A;  4Z4I A;  3ENO A;  2B4J A;  2VWJ A;  1T6C A;  4IJA A;  5AQU A;  4IEE A;  4AH9 A;  5KQ8 A;  4Z4C A;  3TWH A;  4FLU A;  4BWM A;  3HK2 A;  1S9E A;  1XC3 A;  1BQM A;  4J2E A;  1EET A;  1NGE A;  4FJK A;  1WBD A;  1S1U A;  1BCO A;  4FK0 A;  3K5M A;  2FXU A;  3K9J A;  4X66 K;  4DV2 K;  3OY9 A;  2R7Y A;  4KHW A;  4IKF A;  2NLX A;  2Q0U A;  1HUX A;  4FJ9 A;  1HNZ K;  3B6O A;  4CHN A;  3CCJ N;  4NYF A;  4ELT A;  3CJ1 A;  4RW4 A;  4XH4 A;  4CJ4 A;  3DLG A;  4LC9 B;  4BVP A;  5M1P A;  2A42 A;  4ISF A;  4CIG A;  4A5A A;  4IOA L;  4ILH A;  2PBD A;  1DGK N;  4CJR A;  1NNE A;  4KI4 A;  3AY9 A;  4DQP A;  4I2P A;  3WXL A;  4DV4 K;  4JKC A;  4HVJ A;  1GLD G;  4YOR A;  1B9F A;  1B9D A;  1C1C A;  1NJX A;  3KWI A;  3HM8 A;  2WBN A;  3AO3 A;  2HB5 A;  1TK0 A;  1BIZ A;  3CFO A;  3AO2 A;  3AVJ A;  3WT0 A;  3D2E A;  2E6L A;  1RFQ A;  3T69 A;  3KLI A;  3ULE B;  1Z05 A;  3OJU A;  3EZ5 A;  3CME N;  5FRN A;  1XNR K;  1QQM A;  1Z25 A;  4EP5 A;  3G10 A;  2GWK A;  4A2A A;  3PY8 A;  5K14 A;  4BRA A;  4CER A;  4YFU A;  4B9V A;  1WNS A;  4EZ9 A;  3RRG A;  1I39 A;  4OGC A;  3QLH A;  2ZQB A;  2YHW A;  3CPW M;  3GE1 A;  3CJ9 A;  2FC0 A;  3LWL A;  4DB3 A;  1VQ7 N;  5J2P A;  4O44 A;  3OYE A;  1EX4 A;  4OKJ A;  4CIE A;  4LH5 A;  3G6E N;  2J4R A;  4BC2 A;  3SJJ A;  4CJF A;  3VQE A;  3K59 A;  3CCV N;  3IG1 A;  1U6Z A;  1RTD A;  3OYN A;  4CJL A;  1GLB G;  3J7Y P;  1HPZ A;  1N32 K;  3SK3 A;  3SV3 A;  4AHV A;  3J7Z O;  4PUO A;  3QO9 A;  3WUH A;  2WUS A;  3VOV A;  3GBT A;  4DQ8 A;  3O3F A;  4JI2 K;  3K9K A;  4BR2 A;  4KPY A;  3QEI A;  4CD1 A;  5AQY A;  1KXP A;  4FYD A;  4FZX C;  2D0C A;  3U8X A;  3M1F A;  5JVH L;  5T7B A;  1XMQ K;  4JI1 K;  1VQM N;  5DK5 A;  4M3R A;  3ZSQ A;  2YX6 A;  2CGK A;  3W0L A;  2JLE A;  4CZG A;  3MN9 A;  3TAF A;  1DT9 A;  2W42 A;  3U4L A;  1YIJ N;  1NGA A;  2QKB A;  4FLX A;  3CCR N;  2V52 B;  4FOI A;  1YJN N;  3RVC A;  4B1W B;  5GAG P;  3MWT A;  4IXC A;  1C0G A;  1J9A A;  1EP4 A;  1LWE A;  1YT3 A;  4NLC A;  5HP1 A;  3MX2 A;  3HPG A;  2HMI A;  2HNY A;  5AQT A;  1BO5 O;  1WAF A;  4M3T A;  3MN7 A;  1HNI A;  1LWF A;  2ASO A;  2VYP A;  3TAQ A;  2IDO A;  3DLR A;  4HUE A;  5E41 A;  4LF6 K;  3ISN C;  1RTI A;  1YAG A;  4CF1 A;  2QWL A;  2KZM A;  4H5N A;  1BA1 A;  3P31 A;  3FR0 A;  1VSM A;  1NMN A;  4C8N A;  4CZK A;  3C6H A;  5EY4 A;  5AQK A;  1YTA A;  5AR0 A;  3NE6 A;  3O9Q A;  1M1K O;  4KB1 A;  4NB4 A;  3O9S A;  4MQ3 A;  3PSI A;  3CF5 L;  4B3M K;  4BDZ A;  3W3D A;  4CHO A;  1VAZ A;  5HRP A;  3J81 O;  3M8R A;  1HKB A;  4E7H A;  1S3X A;  3CJC A;  3F9K A;  4H8K A;  4FLW A;  1V4S A;  3C6A A;  3FZM A;  4K42 A;  2P9U A;  5JLF A;  3PO5 A;  5M1K A;  3SYZ A;  1ZBU A;  4CFC A;  3AA4 A;  4CJU A;  1LW2 A;  5CZ2 A;  4KTW A;  1MWM A;  1QZ6 A;  3CC2 N;  3KD1 E;  2F8S A;  2JWK A;  3ZT2 A;  2QWR A;  3O4W A;  3D2E B;  3VPZ A;  3E9P A;  1NK6 A;  1P8Z A;  4DTN A;  3EE9 A;  3SBT A;  3IS9 A;  5AZI A;  4DS4 A;  4OGE A;  3NGZ A;  2YJF A;  2BH1 A;  3L3U A;  3ZET A;  4FJX A;  5JIC A;  1TL1 A;  2OTJ N;  4CGF A;  2X6S A;  3SQ2 A;  2P9I B;  4X65 K;  3BZK A;  5BN8 A;  5AQF A;  4LFA K;  4A57 A;  1YHQ N;  1VSJ A;  2BUP A;  4BE2 A;  3P5J A;  4BRG A;  4JK8 A;  4FJI A;  4UY8 O;  5HLF A;  3WXM B;  2A1S A;  1XI1 A;  2DY4 A;  4Z4G A;  4CES A;  3TSP A;  5BRH A;  2UXD K;  2HHU A;  4CHZ A;  4FJN A;  4GKK K;  1J5E K;  4W5O A;  5AQM A;  1Q9Y A;  3I55 N;  5IT9 O;  4FWM A;  4DSE A;  3BF3 A;  3VQ4 A;  3B8A X;  4CD3 A;  1WSJ A;  2Q3S A;  4M3Z A;  1OH6 A;  1SS6 A;  3ZX3 A;  4YDU C;  1Q9X A;  3QER A;  1NGB A;  2I7N A;  2X74 A;  5C42 A;  4LD0 A;  4CZF A;  1XWL A;  2IC3 A;  2QWO A;  1N33 K;  3KWG A;  3V9U A;  3CXC M;  4BRL A;  4CEO A;  4DTS A;  1D8Y A;  2ZM6 K;  3KD5 E;  3L2U A;  4JHD A;  3MXJ A;  4H5T A;  5AQZ A;  2GBZ A;  1BGX T;  1KAZ A;  3QBW A;  2GV9 A;  3OYL A;  2E1Y A;  2KFN A;  3WEE A;  3HJF A;  4PY5 A;  1RT5 A;  4H0Y B;  3QEX A;  3O4Q A;  1HMV A;  4WYB A;  4Z4F A;  2G8I A;  3EY1 A;  5JVG L;  4IEI A;  3VEN A;  2GX9 A;  4DTJ A;  4GW6 A;  3UKU B;  3HYF A;  3O8M A;  3VEY A;  5F1X A;  1B92 A;  1TGO A;  4FWS A;  4E7J A;  4DV7 K;  3GOI A;  4N47 A;  4BDY A;  4FXD A;  1GOA A;  3HZ6 A;  5FLX O;  3T3F A;  3LPT A;  4HCC A;  4BRH A;  3KK7 A;  1HR0 K;  1NJY A;  3BF1 A;  3V1O A;  4DSL A;  3PIP L;  4C8K A;  3QIO A;  2D0P A;  1ATN A;  4FK4 A;  3AO5 A;  3AGK A;  3WXJ A;  3NF8 A;  2P9L A;  4ILJ A;  1TKX A;  3DLB A;  5LMN K;  5J2N A;  4AHC A;  2D0B A;  1K8A O;  3UIQ A;  1MU2 A;  2E8A A;  5BPL A;  3KZB A;  3FZL A;  1WLJ A;  2VGN A;  4Y0W A;  2P9U B;  5ELZ A;  2P9K A;  1HJR A;  4JS5 A;  3HP9 A;  4IDH A;  4XH1 A;  1L3U A;  1OH7 A;  2GEL A;  4F4K A;  1VQO N;  5CR4 A;  5FPE A;  4KBO A;  3A5L C;  3GL1 A;  3O1B A;  5SWM A;  5AZI B;  2NZT A;  2DPN A;  1S1X A;  3DOL A;  3ZET B;  3L3V A;  1CXQ A;  2Y1J A;  1BA0 A;  3P38 A;  3LL3 A;  4W5N A;  4XH5 A;  4DHY A;  1NBW A;  5C10 A;  4E89 A;  3VF6 A;  2HHH K;  1BU6 O;  1U49 A;  3AVA A;  4DSK A;  1VSK A;  2A41 A;  3OYD A;  4FPA A;  3E66 A;  2GTD A;  2QK9 A;  1U04 A;  1XQS C;  4DQR A;  2P9N A;  1D4X A;  2RE2 A;  3O80 A;  4DR3 K;  4JS4 A;  3S9H A;  1ZXO A;  4FJ8 A;  1QHT A;  4NO7 A;  2FBX A;  5DM6 L;  1W97 L;  2XY8 A;  1V4T A;  1IJJ A;  3G0Z A;  4DLE A;  4CBW A;  3VTI A;  4FWL A;  4KH5 A;  1REV A;  3J80 O;  3V9Z A;  4JKA A;  3JSM A;  1O1W A;  2D0A A;  3HL8 A;  1VQ9 N;  1MA9 B;  3VMF B;  2IVN A;  3UE5 A;  3NH0 A;  3EKU A;  4CEZ A;  3VEO A;  1NU0 A;  3CJA A;  4ZTJ A;  2HMP A;  5I9E B;  2YI1 A;  5FRO A;  4JHD B;  1CLQ A;  4DUY K;  4CED A;  3HST B;  4IWV A;  4FLT A;  5JMV A;  1QQO A;  1S1T A;  1NOZ A;  3RTV A;  3THV A;  3MX5 A;  3EO3 A;  4RG8 A;  4FCY A;  3TAG A;  2H3G X;  1W0H A;  4FSV A;  2BDP A;  3WEE B;  3WXK A;  5GIP A;  4CK2 A;  2FF6 A;  4RTF D;  3ZSX A;  3SNN A;  1X9J A;  3SAH A;  1RDW X;  1SKS A;  4WQ5 A;  1GLA G;  4W5Q A;  5FDL A;  1FJG K;  4B3S K;  1QSS A;  1RCH A;  3DM2 A;  1JLC A;  2NRW A;  3PIO L;  4BRI A;  2A3Z A;  3NAE A;  3MDQ A;  3KKR A;  2EWS A;  3DLK A;  2E2Q A;  4U7B A;  3L4I A;  1L3T A;  3VES A;  4MDA A;  3I8D A;  2PYJ A;  3EN9 A;  3H6E A;  4BRM A;  4JNE A;  2HVH A;  3HXM A;  3WNG A;  3K58 A;  4H0P A;  1ILY A;  5EU7 A;  2DFF A;  4CJK A;  4CFA A;  5HRN A;  3M8S A;  2P9L B;  1DTT A;  3OYF A;  2YNH A;  2NRV A;  4ID1 A;  5AQO A;  3SI6 A;  4KRF A;  2I5J A;  4DQI A;  4WFA L;  3M3Z A;  3VQ8 A;  4YOY A;  4DQS A;  3U6F A;  3K5N A;  4DF4 A;  3WXI A;  2P9K B;  1TKZ A;  1BCM A;  4CGH A;  2O8D A;  1NGH A;  2UXB K;  2CGJ A;  4H4O A;  4IFV A;  1TYQ A;  1OH8 A;  5M1N A;  4DV0 K;  2I7P A;  3OS1 A;  4A61 A;  4CJ5 A;  1SQK A;  3MEG A;  5KRT A;  4J8F A;  3HP6 A;  3PLA A;  4ISG A;  2W41 A;  4EP4 A;  1XC9 A;  3T1H K;  4DTX A;  4JI4 K;  2YHY A;  4LH4 A;  2KTQ A;  3C95 A;  4LFC K;  4IZ9 A;  1VQP N;  2QKK A;  1BQN A;  4B1X B;  4BC4 A;  1VQ6 N;  1T44 A;  3ATU A;  2Z1G A;  3E01 A;  4BRP A;  1J6Z A;  3CIP A;  1H1V A;  5AQG A;  2OAN A;  4MDB A;  1TV6 A;  4OKK A;  2P9N B;  2YV0 X;  4HTL A;  1GLC G;  4Q0B A;  3L2Q A;  1FK9 A;  4MO4 A;  4FM0 A;  4FLV A;  3OYI A;  1NGF A;  1MDU B;  4K25 A;  4FO0 A;  3KK2 A;  5DMR A;  4PKH A;  3C94 A;  1YVU A;  3V9W A;  2A1R A;  3ZSO A;  1RNH A;  1HNX K;  2KHO A;  4IG3 A;  2FSK A;  3LDS A;  1QQC A;  2Z1H A;  3CQX A;  3LDP A;  3CHW A;  5BPM A;  4WFN L;  2XY6 A;  2P9S A;  4IFE A;  4BG8 A;  4FJJ A;  4DQQ A;  3UKR A;  1RTJ A;  3ITH A;  4KRE A;  3AVC A;  5KPT A;  2NNW A;  3O1W A;  3KTQ A;  4BRD A;  4DSF A;  4BR0 A;  5KPZ A;  1VRT A;  2FLO A;  3BGR A;  2EX3 A;  3LDN A;  1JLA A;  4BR4 A;  4EHT A;  3BY5 A;  1GLJ O;  4BE0 A;  4CW7 B;  2KLA A;  4ILG B;  4YNQ A;  4IG0 A;  4AM6 A;  2HBL A;  1U4B A;  1VHX A;  4JEP A;  3R9P A;  4H4M A;  3L6Q A;  3V1Q A;  1FW6 A;  3LDL A;  4DCH A;  4FVM A;  1KTQ A;  1YVN A;  3D2F A;  3M6G A;  1UWB A;  2E20 A;  3MCA B;  1WB9 A;  1VQK N;  4M3X A;  5AFU H;  5BN9 A;  1X9W A;  1CZB A;  1IG8 A;  2WC9 A;  4H5W A;  4DFK A;  3M8P A;  2P9I A;  3TU5 A;  3V6D A;  4CZH A;  5HRS A;  5A2Q O;  1SAZ A;  4B3O A;  3ALY A;  4GMJ B;  4R5P A;  5KGW A;  1S22 A;  4H0O A;  5KI6 A;  3FFI A;  1ASU A;  1IKY A;  3O5B A;  1HNW K;  4OPA A;  1HPM A;  3KIO A;  3RMD A;  3PO4 A;  3L2R A;  4DTU A;  3P1G A;  3PX4 A;  2O8D B;  2F8T A;  3DAW A;  4KHP K;  5FPD A;  3FZK A;  1TYQ B;  4KHN A;  1JJ2 M;  4CGD A;  4C8M A;  3SBG A;  5F0X A;  3AA3 A;  4Z4E A;  5ADX H;  2O8B A;  1X9S A;  3MK6 A;  2OPP A;  4E1M A;  2UUA K;  2P51 A;  4N56 A;  1QE1 A;  4YHH K;  1KD1 O;  3OYG A;  4AHS A;  3O6W A;  4OLB A;  4LY7 A;  4BAC A;  1JLB A;  3P83 D;  2HF4 A;  4CEB A;  1SL1 A;  1HNV A;  1JLF A;  1JLG A;  3K5L A;  3TI0 A;  2QWQ A;  4EIA A;  1T03 A;  1LWC A;  1JCE A;  5F2R A;  1T8E A;  4B9M A;  1HYZ A;  4CZL A;  2ZJR L;  4ISE A;  2XHB A;  3TAN A;  2HOE A;  2ASP A;  4I6M A;  4F8R A;  4U67 L;  3VQ7 A;  2OTL N;  4Z0U A;  1TUU A;  5SZT A;  1QVF M;  2F4V K;  3AVG A;  3UKU A;  3CM6 A;  3IDH A;  4CZE A;  3K57 A;  2OZS A;  2XY7 A;  1ASW A;  2F9T A;  4JRP A;  1X1P A;  3PX0 A;  1LOT B;  3VQP A;  5J2M A;  3CMA N;  1QVG M;  3NCI A;  2P9S B;  3CFP A;  2G8F A;  4DR2 K;  1E4G T;  3UKR B;  2YKN A;  5AQH A;  3ZCM A;  2AP1 A;  2QTD A;  3OHR A;  1W2B M;  3HRG A;  2VQE K;  3I56 N;  3V1R A;  4XIU A;  3RMB A;  3WQU A;  3LP0 A;  5AQS A;  4B08 A;  1EKE A;  3MN5 A;  2P5O A;  4B1Z A;  4KI6 A;  3I0R A;  3R6M A;  4RW9 A;  3O9R A;  3AO4 A;  4H0X B;  1W9H A;  4DF8 A;  3C6T A;  3NF9 A;  4I2Q A;  4FZZ A;  4DV3 K;  4JYA K;  3FZF A;  4BC5 A;  4FWN A;  3A2F A;  5C15 A;  1NK9 A;  3DLH A;  2ATQ A;  2O4G A;  1D9F A;  4YOT A;  3CCU N;  1YJW N;  4F2S A;  3KLG A;  2FBV A;  1C0F A;  3N4Q A;  4XEI A;  2WFB A;  1I94 K;  5ADX A;  2JGU A;  1N34 K;  1LV5 A;  3LAM A;  2WON A;  4RCH A;  3HPO A;  4M42 A;  3D2F B;  2BAN A;  2OPQ A;  3IKM A;  3WQT A;  4YOW A;  3L0Q A;  3O9T A;  4KO0 A;  2Y1I A;  4FW1 A;  3K0S A;  3BUZ B;  4NCB A;  1GLL O;  4BRC A;  4X62 K;  1WSI A;  4FJL A;  5GAD P;  1VSL A;  3TPQ A;  2Z1I A;  3K2P A;  3L2W A;  4FJ5 A;  3VF2 A;  1HKG A;  4CJS A;  2AJQ A;  2OZM A;  1S6P A;  3LP3 A;  1KLN A;  3K5O A;  4ZHR A;  5C12 A;  3MMV A;  3CD6 N;  2X78 A;  3FZH A;  4DU3 A;  3O4N A;  1N6Q A;  2FBT A;  3VN5 A;  2Q31 A;  3NGI A;  3NFA A;  1G99 A;  4AM7 A;  2E2O A;  3J7A P;  2W6L A;  3QNN A;  3HOS A;  4GNI A;  2YJE A;  4CJV A;  4DFJ A;  2XY5 A;  4FJM A;  3HI0 A;  3TR8 A;  2Q36 A;  4CF9 A;  4PKI A;  2O8B B;  2UUC K;  5AQW A;  3SAG A;  3VQB A;  3SUN A;  2HND A;  1TK5 A;  2F9W A;  1VK0 A;  2OPS A;  1HRH A;  3OS0 A;  3VER A;  2IVP A;  3E9L A;  4JAX A;  5LY3 A;  1XHX A;  2VG5 A;  4EFH A;  2UXC K;  3RMA A;  1JCF A;  3QDK A;  4H03 B;  1S5J A;  3D0P A;  4ZTF A;  4GKJ K;  5CHI A;  1N36 K;  3LZI A;  3SMP A;  1NJZ A;  4O55 A;  4I6M B;  4LF8 K;  1HX1 A;  4DFP A;  4PWD A;  3RWU A;  4FLY A;  3AGR A;  2QEX N;  4QS8 A;  3DLL L;  4K43 A;  3SZ2 A;  1BHL A;  5J2Q A;  3VQ6 A;  1GOB A;  2JWL A;  5C2D A;  4I9Q A;  2UYT A;  3TSQ A;  1Q18 A;  4PQU A;  3KK1 A;  4B9L A;  4WCE L;  3U9D A;  3H3N O;  4A62 A;  1VSF A;  1Y97 A;  2KQ2 A;  2VWK A;  5CE3 A;  3A5N C;  3NVK A;  4BRN A;  4FJ7 A;  1BDG A;  3NGY A;  4DSI A;  5FPN A;  1RBV A;  4BRQ A;  2RPI A;  2HHS A;  1KSP A;  3JAM O;  4OPH A;  3VGK A;  1JKH A;  3ZT1 A;  4DMN A;  1VQN N;  4CBU A;  4JK7 A;  2B5J A;  2E2P A;  1J54 A;  4CK1 A;  2QWN A;  1S1V A;  3CQY A;  1FXX A;  3E1Y A;  3RR7 A;  5JS1 A;  3DRP A;  4B8C A;  2KZZ A;  3QIP A;  4JKE A;  3MED A; 
#chains in the Genus database with same CATH homology
 5EU7 A;  3AO3 A;  2DFF A;  3AVL A;  4CJK A;  4K8X A;  3QEV A;  2HB5 A;  4CFA A;  5HRN A;  3M8S A;  1TK0 A;  1DTT A;  5D3G A;  2HHX A;  4M45 A;  2DFE A;  1BIZ A;  3CFO A;  3AO2 A;  3AVJ A;  3HT3 A;  3OJU A;  2E6L A;  3OYF A;  2BE2 A;  3KLI A;  3EZ5 A;  2YNH A;  3MAQ A;  4ID1 A;  1R0A A;  5FRN A;  1Z25 A;  1ASV A;  4CGJ A;  3G10 A;  4EP5 A;  3SI6 A;  3PY8 A;  5K14 A;  4CER A;  4YFU A;  3KLH A;  4E3S A;  4B9V A;  4KRF A;  1WNS A;  3VQA A;  2I5J A;  3RRG A;  4EZ9 A;  4DQI A;  1I39 A;  4OGC A;  1RT6 A;  3QLH A;  2ZQB A;  3VQ8 A;  1X9M A;  3HVR A;  4DQS A;  4ELU A;  2FC0 A;  3LWL A;  4I9L A;  3U6F A;  1SKR A;  1RDD A;  3K5N A;  4DF4 A;  4B9T A;  1TKZ A;  4O44 A;  5J2P A;  4GVM A;  1EX4 A;  1TAQ A;  4OKJ A;  1BCM A;  3OYE A;  4CIE A;  1L5U A;  3SQ0 A;  4JLH A;  4CGH A;  3U3G A;  4LH5 A;  3ZSZ A;  4CJF A;  5J1E A;  3SJJ A;  4H4O A;  4IFV A;  1SV5 A;  4J2A A;  3VQE A;  1NK0 A;  3K59 A;  3TAB A;  3IG1 A;  3OS1 A;  4DWI A;  3CYM A;  1RTD A;  4CJ5 A;  2ZD1 A;  3AV9 A;  1NJW A;  4KKO A;  3OYA A;  3OYN A;  4CJL A;  4RW6 A;  1HPZ A;  3MEG A;  2G8K A;  5KRT A;  3HP6 A;  3SV3 A;  1C6V A;  4AHV A;  4BDP A;  1FKO A;  1S6Q A;  2OPR A;  3QO9 A;  4IBN A;  4EP4 A;  3OYH A;  3EYZ A;  1XHZ A;  1XC9 A;  4PUO A;  2KFZ A;  4DTX A;  4OKE A;  4LH4 A;  2KTQ A;  3O3F A;  3C95 A;  4OLA A;  3S3N A;  4KPY A;  3QEI A;  2QKK A;  1BQN A;  2ITG A;  3H08 A;  4G1Q A;  3OJS A;  4FYD A;  4B9S A;  2D0C A;  4FZX C;  2Z1G A;  4AHT A;  3E01 A;  5C24 A;  3CFR A;  3O3G A;  1HQU A;  4FM2 A;  1TV6 A;  2YNG A;  4OKK A;  5T7B A;  3NHG A;  4CEE A;  2HVI A;  2DTU A;  5DK5 A;  4M3R A;  2YV0 X;  3ZSQ A;  1G15 A;  1RBU A;  1LW0 A;  2JLE A;  1VSD A;  2O4I A;  3I0S A;  3TAF A;  2W42 A;  1HQE A;  4CJP A;  4Q0B A;  1WSF A;  3L2Q A;  3TAR A;  1FK9 A;  2QKB A;  4FLX A;  3ASM A;  1NKC A;  4FM0 A;  4FLV A;  1TK8 A;  3OYI A;  1RBR A;  2HHT A;  3TAP A;  4CHY A;  3KK2 A;  4FM1 A;  5DMR A;  3JYT A;  3HVT A;  3C94 A;  4HUF A;  1SL2 A;  1J9A A;  1YVU A;  3V9W A;  2A1R A;  3ZSO A;  3KLE A;  1EP4 A;  2PYL A;  1RNH A;  1LWE A;  1YT3 A;  4IG3 A;  5HP1 A;  1KVA A;  3HPG A;  3OS2 A;  1QQC A;  2HNY A;  3L2V A;  3LDS A;  2HMI A;  2Z1H A;  4PA1 A;  3VQC A;  3TAM A;  1WAF A;  3MEC A;  4DFM A;  3PV8 A;  3AVB A;  4M3T A;  3AO1 A;  4FJG A;  4QAG A;  4E7L A;  2XY6 A;  1HNI A;  1LWF A;  1U47 A;  4FJJ A;  4QCL A;  4DQQ A;  1RTJ A;  3TAQ A;  3L8B A;  3WNH A;  2IDO A;  3DLR A;  1JL1 A;  4HUE A;  4RW8 A;  1TKT A;  3ITH A;  5E41 A;  4DG1 A;  1T7P A;  3QIN A;  1IKX A;  4KRE A;  3AVC A;  3ISN C;  1VSE A;  4RW7 A;  1RTI A;  3ZT3 A;  4CF1 A;  4KI6 A;  4IFY A;  4FK2 A;  2IAJ A;  3KTQ A;  3SQ1 A;  5CYM A;  3KK3 A;  1RT4 A;  3LZJ A;  4FZY A;  2KZM A;  3V9X A;  4DSF A;  4K8Z A;  1VRT A;  4CJT A;  2QXF A;  3SUP A;  3QEP A;  1TVR A;  1SL0 A;  3BGR A;  4HHT A;  1VSM A;  2EX3 A;  3OVN A;  4C8N A;  4CJW A;  1JLA A;  4QOZ B;  1RT2 A;  3M8Q A;  1KFS A;  3BDP A;  1LAV A;  2BGG A;  5KTQ A;  4KV8 A;  4CEQ A;  1YTA A;  4BWJ A;  4BE0 A;  3NE6 A;  4DS5 A;  4KB1 A;  4YNQ A;  2OYQ A;  4MQ3 A;  4NCA A;  4IG0 A;  3WNF A;  1U4B A;  2RKI A;  4B9N A;  5HBM A;  1HYV A;  1ZBH A;  4BDZ A;  4CHO A;  3M8R A;  5HRP A;  4E7H A;  4H4M A;  2PY5 A;  5C25 A;  3RRH A;  3DMJ A;  1L3S A;  3QES A;  3V1Q A;  2P1J A;  1C0U A;  3F9K A;  4H8K A;  4FLW A;  1BI4 B;  2EHG A;  3QEW A;  4FVM A;  2GUI A;  1QTM A;  1KTQ A;  4DU1 A;  1WAJ A;  5JS2 A;  3VA3 A;  1RT7 A;  4CGG A;  3SYZ A;  1UWB A;  3PO5 A;  1ZBU A;  1WN7 A;  3AA4 A;  4CFC A;  1LW2 A;  5CZ2 A;  4CJU A;  4KTW A;  3F73 A;  2OA8 A;  4M3X A;  2F8S A;  1X9W A;  3KD1 E;  1UA0 A;  3ZT2 A;  1CZB A;  2G8H A;  4DFK A;  1VRU A;  3M8P A;  4LSN A;  3V6D A;  3SUO A;  3NH1 A;  1NK6 A;  5HRS A;  1T05 A;  4DTN A;  4FW2 A;  1ZBL A;  1DTQ A;  3IS9 A;  3S3O A;  4DS4 A;  4OGE A;  4W5T A;  4B3O A;  3ALY A;  4GMJ B;  3NGZ A;  1SUQ A;  4R5P A;  1J53 A;  5KGW A;  3L3U A;  4CJ3 A;  4FJX A;  2NUB A;  1HYS A;  2HNZ A;  5KI6 A;  4DTR A;  3FFI A;  1ASU A;  1IKY A;  3ZT0 A;  1TL1 A;  4CJQ A;  4CGF A;  2X6S A;  3SQ2 A;  4DTM A;  4FJH A;  1RDC A;  3KIO A;  3RMD A;  2RN2 A;  3PO4 A;  4CFB A;  3L2R A;  2ETJ A;  3P1G A;  4DTU A;  1VSJ A;  4BE2 A;  3PX4 A;  1S9G A;  2F8T A;  3P5J A;  3QNO A;  1N5Y A;  4FJI A;  3HPH A;  4KHN A;  3NH2 A;  2YKM A;  5HLF A;  2G8W A;  2LSN A;  3LWM A;  2PZS A;  3OYM A;  2A1S A;  1RBS A;  4CGD A;  1FKP A;  1XI1 A;  4C8M A;  1NK7 A;  2DY4 A;  3AVI A;  4Y1C A;  4Z4G A;  4CES A;  1BIU A;  2HHU A;  3AA3 A;  2HHQ A;  4CHZ A;  4Z4E A;  4Z4H A;  4FJN A;  1X9S A;  4W5O A;  2OPP A;  4E1M A;  3B6P A;  2P51 A;  4N56 A;  1QE1 A;  3PX6 A;  1Q9Y A;  4DSE A;  3OYG A;  3LP2 A;  4AHS A;  3DRR A;  1CZ9 A;  3VQ4 A;  4OLB A;  4LY7 A;  1WSJ A;  2Q3S A;  4BAC A;  1JLB A;  3P83 D;  4CEB A;  3VA0 A;  1SL1 A;  1CXU A;  4M3Z A;  5FRM A;  1HNV A;  1JLF A;  4OPJ A;  1Q9X A;  1JLG A;  1Z26 A;  3K5L A;  3QER A;  3TI0 A;  1Q8I A;  3ZSR A;  2X74 A;  1T03 A;  1LWC A;  5C42 A;  3S3M A;  4LD0 A;  4UQG A;  1T8E A;  4B9M A;  3ZSY A;  1HYZ A;  1EXQ A;  1XWL A;  3IRX A;  1SKW A;  2IC3 A;  3DRS A;  4DTO A;  4E0D A;  2KW4 A;  3MEE A;  4KFB A;  4I7F A;  3V9U A;  4N5S A;  1S1W A;  4CEO A;  2XHB A;  4DTP A;  5I42 A;  3TAN A;  1DLO A;  1JXB A;  4DTS A;  1D8Y A;  3KD5 E;  4F8R A;  1WSG A;  4J2B A;  3L2U A;  4CHQ A;  3VQ7 A;  3V9S A;  3U3Y A;  3MXJ A;  4Z0U A;  5SZT A;  3ZSV A;  2P5G A;  3AVK A;  2GBZ A;  3AVG A;  1C0T A;  4O0I A;  1NK5 A;  1BGX T;  2YHA A;  3VQQ A;  1L3V A;  2GV9 A;  3OYL A;  3CM6 A;  1KLM A;  3K57 A;  2YNF A;  3SQ4 A;  2F96 A;  2OZS A;  4BE1 A;  4B8A B;  2XY7 A;  1ASW A;  4AHU A;  3HJF A;  4PY5 A;  2KFN A;  1RDA A;  1RT5 A;  3QEX A;  4KTQ A;  3O4Q A;  1HMV A;  4Z4F A;  3DYA A;  4JRP A;  3IAY A;  3LAN A;  3EY1 A;  2G8I A;  1UOC A;  1X1P A;  3PX0 A;  5J2M A;  3VQP A;  1C1A A;  2VG6 A;  2IS3 A;  3NCI A;  4DTJ A;  3CG7 A;  4GW6 A;  3HYF A;  3CFP A;  2G8F A;  2XO7 A;  1B92 A;  2YKN A;  1TGO A;  4Q5V A;  3LPU A;  3ZCM A;  4W5R A;  4E7J A;  4CGI A;  4DSJ A;  2IGI A;  4O0J A;  1JLQ A;  4N47 A;  4BDY A;  1NKE A;  4N41 A;  1ZYQ A;  4FXD A;  1C0M A;  1IG9 A;  2KZZ A;  1TL3 A;  3LP1 A;  4F3T A;  4M3Y A;  1GOA A;  3V1R A;  4HTU A;  3T3F A;  4XIU A;  3SPZ A;  3LPT A;  3OYK A;  3RMB A;  4HCC A;  4OPK A;  3LP0 A;  1NJY A;  4B08 A;  1EKE A;  3V1O A;  1RDB A;  2P5O A;  4DSL A;  3RMC A;  5HRO A;  1GOC A;  2E4L A;  2FBY A;  2VG7 A;  2YHB A;  3I0R A;  3QIO A;  3ZT4 A;  4OJR A;  4C8K A;  1JXE A;  4RW9 A;  4FK4 A;  1QS4 A;  3AO4 A;  3T19 A;  3SPY A;  4NYN A;  1W9H A;  4ELV A;  1RTH A;  3C6T A;  3NF9 A;  4DF8 A;  4KHU A;  4I2Q A;  4FZZ A;  3AO5 A;  4C8L A;  2YNI A;  4F3O A;  3DI6 A;  1A5X A;  5HRR A;  5CZ1 A;  3NF8 A;  3CQ8 A;  3A2F A;  1RT1 A;  4CFD A;  1NK9 A;  3DLH A;  3MXM A;  1BIS A;  1TKX A;  2ATQ A;  5KGX A;  3TAE A;  2O4G A;  1D9F A;  3DLB A;  4HCB A;  4LSL A;  3KKS A;  3LAK A;  5J2N A;  4F2S A;  4AHC A;  3V81 A;  4L8R B;  1C1B A;  2D0B A;  2FBV A;  3KLG A;  3UIQ A;  3SV4 A;  1UAX A;  4EZ6 A;  4O5B A;  3WNE A;  1MU2 A;  1VSI A;  3HO1 A;  4C8O A;  4O4G A;  3AVM A;  2JGU A;  1IO2 A;  1WLJ A;  2HW3 A;  1NOY A;  4TSX A;  1LV5 A;  1BL3 A;  3LAM A;  2WON A;  3HPO A;  1JL2 A;  1HJR A;  3SCX A;  2IOC A;  4JS5 A;  3HP9 A;  4M42 A;  1KCF A;  2BAN A;  3VQ5 A;  2OPQ A;  1L3U A;  3OYB A;  4KO0 A;  4M41 A;  2Y1I A;  1J5O A;  4FW1 A;  4DLG A;  1ITG A;  1RT3 A;  3RR8 A;  4F4K A;  4NCB A;  1KVC A;  1U48 A;  4CK3 A;  3AVN A;  1WSI A;  1IH7 A;  3KLF A;  2E6M A;  4FJL A;  4MFB A;  5SWM A;  4CEC A;  1VSL A;  2DFH A;  2Z1J A;  1UA1 A;  1D5A A;  3O3H A;  3HM9 A;  3NDK A;  2Z1I A;  3DOK A;  3K2P A;  3AVH A;  3L2W A;  4DU4 A;  1U45 A;  4FJ5 A;  1S1X A;  3DOL A;  4CJS A;  4KB0 A;  2AJQ A;  2OZM A;  1WSE A;  1TKD A;  3T1A A;  3L3V A;  1CXQ A;  1RBT A;  1S6P A;  4CF0 A;  2Y1J A;  3LP3 A;  1KLN A;  3OYC A;  3K5O A;  4ZHR A;  4KHQ A;  4W5N A;  3C6U A;  1KFD A;  3NBP A;  4Y1D A;  3QET A;  1IKW A;  2X78 A;  4DU3 A;  5I3U A;  3O4N A;  4E19 A;  1N6Q A;  2FBT A;  3V4I A;  3VN5 A;  4E89 A;  3NGI A;  3NFA A;  1NK8 A;  3NF7 A;  1TAU A;  1U49 A;  3AVA A;  3SUQ A;  3QNN A;  1JLE A;  4IDK A;  3VQD A;  1QSY A;  1VSK A;  3OYD A;  4DSK A;  4CJV A;  3KJV A;  4DFJ A;  2XY5 A;  4FJM A;  2QK9 A;  2WOM A;  3TR8 A;  4ID5 A;  1U04 A;  3LAL A;  4ICL A;  4AHR A;  4CEF A;  4CE9 A;  4CF9 A;  4DQR A;  3S9H A;  3VQB A;  1I3A A;  3VQ9 A;  4JS4 A;  4AIL C;  2HND A;  3SUN A;  4E7I A;  1TK5 A;  2G8U A;  4FJ8 A;  4E7K A;  5CY4 A;  4J2D A;  1QHT A;  1VK0 A;  2FBX A;  2OPS A;  1HRH A;  2XY8 A;  3OS0 A;  3G0Z A;  3AVF A;  4DLE A;  1LAW A;  3AA5 X;  3NF6 A;  1QSL A;  3PUF A;  1NKB A;  1XHX A;  4M3U A;  3AA2 A;  4M3W A;  1REV A;  2VG5 A;  3V9Z A;  1ZBI A;  4KHY A;  3JSM A;  1O1W A;  2D0A A;  3HL8 A;  3RMA A;  1ZBF A;  3D45 A;  3OYJ A;  3DLE A;  3MXI A;  2HHW A;  1K6Y A;  4E1N A;  3NH0 A;  4Z4I A;  1S5J A;  3D0P A;  2B4J A;  4CEZ A;  4ZTF A;  2VWJ A;  1VSH A;  2ZE2 A;  1IKV A;  4CEA A;  3LZI A;  1NJZ A;  4B9U A;  4CIF A;  4O55 A;  5CYQ A;  4ZTJ A;  5FRO A;  4AH9 A;  1CLQ A;  4Z4C A;  3TWH A;  4FLU A;  4CED A;  3HST B;  4FLT A;  4BWM A;  4CF2 A;  4DFP A;  1A5V A;  1S1T A;  3HK2 A;  1S9E A;  4PWD A;  4CJE A;  4HUG A;  3RWU A;  1NOZ A;  3RTV A;  1BQM A;  4J2E A;  4FLY A;  1EET A;  3THV A;  4RG8 A;  4FCY A;  4NCG A;  3TAG A;  4CF8 A;  4FJK A;  4CHP A;  1W0H A;  2BDP A;  1S1U A;  3SZ2 A;  1BHL A;  2X6N A;  4CK2 A;  3ZSW A;  1BCO A;  3ZSX A;  3K5M A;  4FK0 A;  5J2Q A;  3CM5 A;  3SNN A;  3VQ6 A;  1GOB A;  1F21 A;  4I9Q A;  4N76 A;  3OY9 A;  2R7Y A;  1SKS A;  4KHW A;  4IKF A;  4KHS A;  4PQU A;  1D9D A;  3KK1 A;  4B9L A;  4W5Q A;  5FDL A;  4FJ9 A;  3B6O A;  4CHN A;  1VSF A;  1Y97 A;  2KQ2 A;  2VWK A;  1QSS A;  4CCH A;  4NYF A;  4F2R A;  1RCH A;  3DM2 A;  4FJ7 A;  4ELT A;  4RW4 A;  3NGY A;  1KVB A;  4CJ4 A;  4DSI A;  1JLC A;  3DLG A;  1A5W A;  1YTU A;  1RBV A;  2RPI A;  2HHS A;  1KSP A;  2XRI A;  4JRQ A;  2G8V A;  3NAE A;  2RF2 A;  3KKR A;  4CIG A;  3DLK A;  4KAZ A;  5KRS A;  1JKH A;  1L3T A;  3ZT1 A;  2D5R A;  4DMN A;  3I8D A;  2B6A A;  4WE1 A;  4CJR A;  2B5J A;  1KRP A;  1J54 A;  4CK1 A;  2PYJ A;  4KTZ A;  1S1V A;  4FLZ A;  4DQP A;  1FXX A;  4I2P A;  3RR7 A;  4KI4 A;  2HHV A;  3ULD A;  3DRP A;  1BI4 A;  3HXM A;  2HVH A;  3WNG A;  4HVJ A;  3K58 A;  5JS1 A;  1B9F A;  1B9D A;  1C1C A;  4B8C A;  1WSH A;  1NK4 A;  1NJX A;  3QIP A;  4OVL A;  3MED A;  1RIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...