4BRDA

Legionella pneumophila ntpdase1 q193e crystal form ii, closed, mg amppnp complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVEIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 119
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brdA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brdA02
2P9PB 4BQLA 1KAXA 3RSEB 4MLEA 4ISEA 3HI0A 3MN6A 3DJCA 2CH5A 4K41A 3JXUA 5LJWA 1GLEG 1GLBG 3GDQA 1XUPO 2Q1NA 1NGHA 3ZETA 2F9WA 4BRAA 3VEXA 4K42A 2Q31A 3IFRA 3H46O 3LDLA 1BUPA 3WXIA 3KVGA 3MK6A 3AAQA 3DXMB 1TUUA 4BR4A 2Q36A 3R8EA 3HSCA 2CGJA 2P9NB 3EKUA 3MN5A 4GNIA 1WUAA 1U2VA 3QICA 1DEJA 3HM8A 3U9ZA 1JCEA 1T44A 1GLAG 4FWLA 1S22A 2J4RA 4CZMA 1Y64A 4IZ9A 5KPZA 3R9PA 2FF3B 3CHWA 2D0PA 5FPNA 4BRPA 3R6MA 3A5NC 5LY3A 2QW9A 3IDHA 4Y0WA 4BRQA 4FSVA 1H1VA 3SLCA 3ATUA 5AQYA 3MMVA 4H0OA 1Q18A 3CQXA 4H0XB 2GWKA 4EHTA 3O1BA 3LDOA 3TU5A 4BR9A 2Q0RA 3D7EO 3UKUA 1P8ZA 4PKGA 4QS9A 5JICA 4BC2A 3U9DA 1TYQA 3KZBA 2IVOA 3FZHA 4ISFA 5KPTA 2Q97A 4WQ5C 1D4XA 4BRKA 2P9UB 4K25A 3FFKB 5JMVA 2NLXA 2E2NA 1YXQA 2P9LB 5EXWA 5AQZA 4BC3A 2VWBA 3DAWA 4FWPA 3O6WA 1RDWX 1NGBA 3CERA 1K8KB 4IXCA 4BRHA 4B1WB 5AQLA 1OKJA 1V4SA 5AQRA 4BR5A 3U8XA 2AA4A 4K43A 1XC3A 2OANA 4BRMA 3KHYA 3CJCA 2AP1A 5AQGA 5F0XA 1HPMA 3BEXA 5AFUH 2GTDA 5AQQA 3QFUA 4DCHA 2GUPA 4J8FA 4WYBA 3VETA 4WQ4A 3SJHA 4FOEA 4YDUA 3A5MC 2E88A 3MN9A 2QWPA 2Q0UA 5EX5A 4BC4A 3H3NO 3WEEA 2A6AA 2QXLA 2YHWA 2D1KA 3W3DA 4BR2A 5E84A 4H5NA 5AFUA 5AQUA 2YJEA 3ZX0A 3VF6A 4PL8A 5AQTA 3JS6A 2FLOA 5LJVA 4H5TA 3UB5A 5JLHA 2FSNA 3ZX2A 3QBXA 4BC5A 3VEVA 3DWLA 4E1JA 1ZBSA 4CI6A 4CZHA 3CJBA 3MN7A 3ZETB 3A5OC 2D4WA 5KQDA 2IVPA 3J8AA 4BRFA 4CZFA 2KHOA 3FGUA 3G25A 1BU6O 4I6MA 1NGIA 2GWJA 4QS8A 4BRIA 4L3QA 4RTFD 1HJOA 3A0IX 1ATSA 4BGAA 3CQYA 4DQ8A 2ITMA 1U2VB 4BRLA 1BO5O 1ESVA 2I7PA 1IG8A 3GOIA 4EFHA 3QBWA 2HOEA 1MDUB 1G99A 1TUYA 4FWRA 5EOYA 3VGKA 3TPQA 3FE1A 1KAYA 3MDQA 4H5RA 4FOIA 1R59O 4H0TB 2QWNA 4O5FA 2ZWHA 3IUCA 3W0LA 3LM2A 1T6DA 2FXUA 3VF2A 3D2EA 5EY4A 3VENA 3ZX3A 3CETA 4GY2B 3LDQA 3FZFA 5AZIA 4XH5A 3A5LC 3UKUB 3DXKA 1DGKN 3AAPA 4WQ4C 4IJNA 1S3XA 4YDUC 1SAZA 2P9IA 4FWKA 1GLFO 3L6QA 2H3GX 4AM6A 1TYQB 5BN9A 1HX1A 4IWVA 3WUHA 4MLHA 3GBTA 1X3MA 5AQPA 1ZC6A 2E2QA 5KQ8A 5AQNA 2NZTA 3HTVA 3L4IA 1BWFO 2QWQA 1BDGA 1NGGA 4BG8A 2YHXA 1C0FA 2E8AA 2W40A 2QWLA 3BP8A 4CD3A 5AZJB 1QQMA 4BREA 2ASPA 3GE1A 2E2OA 2UYTA 5EVZA 5F1XA 4FWNA 5AQIA 4CZLA 4PL7A 2V52B 1IJJA 2QWRA 3FZLA 1KXPA 3M6GA 3U4LA 5AZJA 4Z94A 4XEIA 1JCFA 3CI5A 1CZAN 2FSJA 3ZEUA 4CBXA 3LM9A 5AQMA 2DPNA 3F9MA 5BREA 2CH6A 5AQHA 3FZKA 1HUXA 2V7YA 2VCPA 2HF3A 2BTFA 3O1WA 3O4WA 5KPRA 1RGIA 5ADXH 4JHDA 4CZIA 3C7NA 4EHUA 2NRHA 1J6ZA 1Z6RA 4H5VA 4CZEA 2IIRA 4B9QA 1JCGA 1T6CA 4H0VB 4JD2B 5BPNA 4B1ZA 3WEEB 5BRFA 3ENOA 4NB4A 2P9KA 3VEYA 3EO3A 1MWKA 3B8AX 1QZ5A 5AQXA 2PBDA 3H1VX 3QDKA 3BF1A 1E4FT 1ZXOA 1GLCG 4NO7A 5ADXA 5AQOA 1YVNA 4B1YB 3HZ6A 4JAXA 1NGFA 2QM1A 3WQTA 4BVPA 3LDPA 4A62A 4B1UB 2A42A 4BR7A 4BRGA 1BG3A 3A8YA 3LDNA 2W41A 1GLLO 2ZGYA 4IJAA 4M63C 2D0OA 3QMLA 4MO4A 4C23A 3D2FA 2E2PA 3BUZB 3ULEA 1HKCA 2A3ZA 5F2RA 3VEWA 4I6MB 1NGEA 3EL2A 3FLCO 4CD1A 3P4IA 4M7XA 2EWSA 2I7NA 2P9SA 2ZF5O 1RFQA 5BRHA 2ASOA 3SK3A 1WOQA 2YCHA 3H45C 4HTLA 1X3NA 3WT0A 1QQOA 4BRDA 3QFPA 1ATRA 4QS7A 2HF4A 5AQFA 1LCUA 4FWMA 5BPMA 2V51B 5AQJA 4H0PA 2YJFA 3AY9A 4FPBA 3EZWA 4JNEA 3VEOA 4BRNA 4EIAA 1NBWA 3ATVA 1QZ6A 3D2EB 3WXKA 4F9OA 1BA1A 5AZIB 4FWOA 4JD2A 4BVOA 2P9PA 3DXKB 5BN8A 3RSEA 2P9IB 4LC9B 3C0BA 1YUWA 2ZGZA 1NMDA 5JLFA 2F9TA 3LL3A 4BQZA 2BUPA 2YHYA 3CJ7A 2HMPA 2QWMA 3CIPA 4RWTA 3O8MA 3M1FA 2FSKA 4BROA 3O08A 3DXMA 2YI1A 3L0QA 5ELZA 1EQYA 1SQKA 3UKRB 1QQNA 3ENHA 3IMXA 2WUSA 4CJ7A 2P9NA 5BRDA 3MCPA 5CE3A 1NWKA 4PKIA 1V4TA 3O80A 1MWMA 3H1QA 4BRCA 1MA9B 3H3OB 3AARA 3FR0A 1HKBA 1X9JA 3ZEUB 2E1ZA 3UKRA 1KAZA 5AQSA 3CJAA 4FO0A 4A2BA 4H5WA 1NM1A 4CZJA 1NGJA 5FPMA 3VGLA 4JHDB 2Q2RA 3UE5A 2FF6A 4IO8A 5AQKA 4AM7A 4B1XB 3C7NB 4CBUA 4DB3A 2A41A 3GL1A 5AQVA 3WXJA 1HKGA 4FWSA 3ID8A 3VF4A 2QWOA 3CJ1A 2VYPA 3FZMA 2E20A 1HLUA 2P9KB 2ASMA 5E26A 3EKSA 5AR0A 3VEZA 2P9UA 3M3ZA 4B1VA 5AQWA 2CGKA 2PAVA 2CGLA 1U6ZA 3H6EA 2P9LA 3O5BA 4JN4A 1QHAA 3VERA 2V7ZA 3BF3A 4RCHA 3VOVA 4CBWA 5TKYA 3I8BA 1NLVA 3SMPA 3WQUA 4O8KA 4A2AA 5BR9A 1K8KA 1YAGA 3VGMA 1C0GA 3VESA 4FWQA 4CZKA 4H0YB 5BPLA 4BR0A 3QB0A 3D2FB 3HBTA 5FPDA 4DHYA 3ULEB 1LOTB 3SMSA 4A61A 1GLJO 4M7YA 2P9SB 4MO5A 1NGAA 2A5XA 1DKGD 1BA0A 4HWIA 3EN9A 1E4GT 4BG9A 4CZGA 2E1YA 1NGDA 3I33A 5B8HA 4WQ5A 4XH4A 3WXLA 5FPEA 1BOTO 4FL9A 4PKHA 3CJ9A 2IVNA 4FPAA 3GG4A 1NGCA 4KBOA 1SZ2A 1ATNA 4EAHD 4XH1A 2A40A 2GEMA 3OHRA 1GLDG 4BGBA 3VPZA 1Z05A 3S41A 1XQSC 2GELA 5I9EB 4ISGA 4H03B
chains in the Genus database with same CATH superfamily
3QEIA 3VQPA 1U47A 1MU2A 4MLEA 3V1QA 4EP5A 3OYAA 2CH5A 3RMCA 3F73A 3JXUA 3F2KA 4DTPA 2JLEA 4CEDA 4JI5K 1UWBA 4AHRA 2HVHA 1QSYA 4FJ7A 4L8RB 2RN2A 3SPZA 4K42A 3HVRA 3RMDA 1TUUA 4BR4A 2Y1JA 4CCHA 2P9NB 3MN5A 3CG7A 4GNIA 3SNNA 3TWHA 2G8KA 1JCEA 1T44A 3LP3A 3QIOA 1E3MA 4FLYA 3T19A 2HHVA 4JI6K 4CZMA 1Y64A 1GOCA 4CK2A 3R9PA 5GAHP 1QVFM 4AILC 2O8EA 4WFNL 3PSIA 4BE0A 1K6YA 3AVHA 4DFKA 4BRQA 1RTHA 1H1VA 3CC4N 4H0OA 1Q18A 2HSTA 1ASVA 3O1BA 3L4QA 1P8ZA 3PSFA 4JK9A 4CF1A 4DSJA 1EP4A 1JLGA 4BC2A 3U9DA 3TARA 3QEVA 3CCUN 1D4XA 4K25A 4IOCL 3MXMA 5IT9O 1RBUA 2NLXA 4PA1A 2P9LB 3LPUA 2OTLN 4CF0A 3G4SN 3DAWA 2O8DB 1NGBA 4ELVA 1NJIO 2WOMA 3CERA 2W42A 1A5XA 3NF7A 4NCBA 4DLEA 1VK0A 4K0KK 2D0BA 1L5UA 2UU9K 4B1WB 4PWDA 3LWMA 4DTMA 4BR5A 2KTQA 3U8XA 4FYDA 1XC3A 2JGUA 2OANA 4BDYA 3MEEA 5KGXA 1VSKA 3KHYA 2Q3SA 1YVUA 3K9KA 3SI6A 4DQQA 3T1AA 1JLQA 5FLXO 1O13A 4YDUA 3ZCMA 3MN9A 1J54A 4BC4A 2OPSA 3QLHA 4M3ZA 3H3NO 1KRPA 2HHTA 1Q9XA 5CY4A 2QXLA 3NH1A 1NK4A 4O44A 3SQ4A 5AQTA 3JS6A 3TABA 2E4LA 3NFAA 3O4QA 1JLBA 4KV8A 3ZX2A 3QBXA 1J5EK 4DSKA 3VEVA 4E1JA 3VTHA 4DFPA 3MXIA 1YJ9N 4CI6A 3NE6A 4KHYA 3QEXA 4HVJA 4AHSA 4NLCA 4BRFA 1NJWA 5IWAK 4JI7K 5CYQA 3FGUA 1TK8A 4IEIA 2GWJA 4QS8A 3ZT1A 4L3QA 1HJOA 5M1FA 3HVTA 3ULDA 2BANA 3LAMA 1ASUA 1IG8A 2ZJRL 3QBWA 2HOEA 5EOYA 3VGKA 1JLEA 3SV4A 4FJXA 3MDQA 4H5RA 2HHWA 4FOIA 1R59O 1REVA 1C1BA 4OX9K 3IUCA 3W0LA 3LM2A 3ZSVA 4DKWA 3OYFA 2FXUA 3VF2A 1T8EA 1XNQK 5EY4A 3VENA 3ZSXA 2NRRA 2R7YA 4PQUA 3HXMA 1SV5A 4JI4K 4W5OA 3UKUB 4IJNA 2D5RA 1SAZA 4YDUC 3CCQN 2Z1HA 3L6QA 1YHQN 4AM6A 4QAGA 1TYQB 4XIUA 3G71N 1X9WA 4JKCA 5KQ8A 1ZC6A 4E7LA 2NZTA 3HTVA 1IKYA 1HPZA 4CEFA 3SCXA 4CD3A 4M3UA 1QTMA 1BQMA 4KFBA 4Q0BA 1JLFA 2ASPA 4CGIA 3L2UA 4FWNA 4LH4A 5AQIA 4E1NA 4JK7A 1HYZA 4A57A 3HP6A 4NYNA 1KXPA 1D8YA 4IOAL 3C6UA 4BDPA 2FSJA 1RILA 3O9UA 3VQQA 4CBXA 3E9LA 3VQ5A 5AQMA 3LP0A 1HNXK 1VSMA 3KK7A 4KAZA 5ADXH 4FLXA 4BDZA 4H5VA 1S1VA 4J2DA 1JCGA 1RT2A 1JLAA 3IKMA 4H8KA 2G8VA 3KD5E 3ENOA 3VEYA 1Q81O 1T3VA 3H08A 4CJ4A 4PY5A 3B8AX 3K57A 2O8FB 1QZ5A 3VQDA 5AQXA 4W5TA 3EEQA 4BWMA 1ZXOA 3RR8A 4NO7A 1TV6A 4WFAL 2NUBA 3IS9A 2HBJA 4JAXA 4CEBA 3WQTA 1IH7A 4FLWA 1EO1A 1SKRA 3NGYA 4OPHA 1HRHA 4IO9L 1OH7A 4DU4A 3RWUA 3QMLA 1ZBLA 3SBTA 4KH4A 3ULEA 1HKCA 5F2RA 3ISNC 3VEWA 3PY8A 5KRSA 3EL2A 3O9QA 4CD1A 3P4IA 2EWSA 3OYLA 4M41A 1RFQA 1RBRA 2ASOA 1WOQA 5J1EA 3CC2N 1RT3A 2YCHA 4HTLA 4LF8K 4FLZA 4KH6A 3WNFA 3CD6N 1ATRA 3DLBA 4FJIA 1IV0A 2VGMA 4H0PA 2XY8A 4FPBA 3EZWA 1J9AA 1NBWA 3BGRA 4CJRA 2HHXA 2F8TA 4F9OA 1BA1A 4AHUA 4JD2A 4RW9A 1TL1A 4K8ZA 2Z1IA 1VQKN 3EE9A 2ZGZA 3J81O 1W2BM 5JLFA 4E7JA 2WONA 1VSJA 4RWTA 1A5WA 4CK3A 2Z1GA 2O4IA 2QKBA 4B9MA 1FXXA 1EQYA 3K9JA 3ENHA 2D0CA 1YTUA 4M3WA 3NH2A 1MWMA 3H1QA 1HNVA 4OPJA 1MA9B 3H3OB 4CJWA 1I94K 3ZEUB 1VSHA 1CZ9A 1KAZA 2G8UA 5AQSA 1N34K 3RRHA 1NK6A 1NM1A 4CZJA 3E66A 1NGJA 5FPMA 1FW6A 4JHDB 3UE5A 3WNGA 4IO8A 5AQKA 2DFFA 2PZSA 3OYMA 3VQBA 5AQVA 4OKJA 3WXJA 3AO3A 3V9UA 4FK2A 5JS2A 3IAYA 3CJ1A 2FBTA 2E20A 1HLUA 2P9KB 2HHQA 4CF9A 1XHZA 2F4VK 2WFBA 3M5RA 4F8RA 3QERA 2KZZA 2PYJA 3U3GA 4IOXA 3K5NA 3QNOA 2UXCK 4N41A 3VOVA 2F96A 3G10A 5TKYA 1IBKK 4JI8K 1KC8O 4FK0A 3WQUA 4YNQA 1S5JA 5BR9A 1K8KA 4J2BA 4BACA 3L2WA 3HPGA 3HPHA 4RW4A 4BR0A 4DSIA 3D2FB 4CIEA 3UIQA 3C6TA 4WF9L 3CCLN 4K8XA 2XY5A 5FRNA 4FJ8A 3RMAA 4HWIA 4RG8A 3EN9A 4B3OA 4I9LA 1O1WA 4WQ5A 5FPEA 1HNZK 5M1QA 1BOTO 4FL9A 3F9KA 3CJ9A 5J2MA 3GG4A 4IG0A 2RF2A 2A40A 3T7ZA 1OH6A 2YKNA 3TSUA 4KTQA 3OYBA 4IDHA 5I9EB 4H03B 4DV4K 2P9PB 3F5TA 5J2QA 4CJTA 3RSEB 3S3OA 2XY7A 4YOVA 3NVKA 3MN6A 3DJCA 1P90A 3BDPA 4K41A 3THYB 3SUQA 4CGFA 3SUOA 1VSLA 1XUPO 4KH5A 1NGHA 5E41A 3SZ2A 3ZETA 2F9WA 3TSPA 1FKPA 2A1SA 3H46O 4DTSA 3KVGA 3BZCA 2QKKA 3HSCA 4KHPK 2CGJA 2IC3A 3U6FA 3ZSOA 3SAFA 1B92A 3QICA 1YITN 2HVIA 1IG9A 2J4RA 4FZYA 3T3FA 5T7BA 3MECA 2VQEK 5C25A 2KFZA 5KPZA 2FF3B 1TKTA 1B9FA 2LSNA 2NRWA 4CERA 5LY3A 2QW9A 4FSVA 3MMVA 2RHKA 4GKKK 3LDOA 3V81A 5JICA 4JS4A 2E6MA 1D9DA 3FZHA 2KKZA 2UXBK 4WQ5C 2P9UB 4PUOA 4Q5VA 5JMVA 2E2NA 5KGWA 3HP9A 2VWBA 4WCEL 4LF6K 4DS4A 3O6WA 2UXDK 1RDWX 4DV5K 4RW7A 4DV3K 1N36K 4QOZB 4YOUA 1VQ5N 1VSDA 2B6AA 4DTXA 4FVMA 2FBXA 2P51A 1OKJA 5AQRA 3I0SA 5LL6Z 4BRMA 1XMQK 4AQYK 4O8UA 2AP1A 3SJJA 2GTDA 4DCHA 4J8FA 2ATQA 4WYBA 3VETA 1WBDA 4FOEA 4AF1A 2QWPA 4BWJA 4E3SA 4JYAK 3BY5A 3E9OA 3V9ZA 4A5AA 3W3DA 5E84A 1C0TA 4H5NA 5AFUA 4TSXA 4UQGA 3PX6A 3T1YK 3ZX0A 4PL8A 4HCCA 5GAGP 2FLOA 2YHAA 1XHXA 1UOCA 3KWGA 1HNWK 5HRSA 1JKHA 3TTFA 5JLHA 3TAEA 4FJLA 4BC5A 1HMVA 3V9XA 3TAMA 4Y1CA 3SYZA 1WNSA 5I42A 2D4WA 1LWEA 3P1GA 4CZFA 1KVBA 2X78A 2KHOA 1YF5L 2OZSA 3G25A 3D0PA 4BRIA 4RTFD 3ZT4A 4IKFA 3AO2A 3NCIA 3CCSN 2NRZA 1RDAA 4BRLA 5D3GA 1BO5O 3TSQA 3GOIA 4CJFA 1BIUA 2B5JA 2QK9A 3R3LA 1MDUB 3K5MA 2BH1A 1G99A 4FWRA 3PX4A 4G9ZA 3FE1A 4DU3A 2O8EB 3JYTA 3K5LA 2ZWHA 1RCHA 5C42A 1M1KO 3D2EA 4FM0A 1VRUA 4GY2B 4CHYA 3A5LC 3DXKA 1DGKN 3L2VA 4F3OA 1S3XA 2VWKA 2P9IA 1BIZA 1VSFA 3P39A 3MX2A 1HX1A 4DV1K 3THVA 3WUHA 4I2QA 4OPAA 1ZYQA 2NRTA 3O3GA 1BDGA 4BG8A 2W40A 1TGOA 2QWLA 4DV6K 4CJKA 4ELUA 1QQMA 4CHNA 3JSMA 4MFBA 1S1WA 4JRPA 5EVZA 3OJSA 3ZSZA 4CZLA 3AVAA 1IJJA 2QWRA 5GAEP 4XEIA 2DTUA 3OYCA 4DSLA 1HNIA 3K0SA 3AGKA 1ZBFA 4CGJA 4E89A 2CH6A 1HUXA 3A2FA 2HF3A 3TAFA 2BTFA 3O1WA 3O4WA 1GOBA 1F21A 5KPRA 3N4PA 1WSEA 3KTQA 2YX6A 5C2FA 2AJQA 1J6ZA 3OYGA 4B9QA 3E9PA 1IKXA 3SBGA 1SS6A 3EY1A 1KVCA 3AVMA 1VSIA 3QDKA 3E1YA 1RDDA 4CIFA 1YVNA 4ILJA 3VQ8A 3NVMA 4A62A 1TKXA 2BE2A 1TKDA 3HL8A 4B1UB 3ASMA 3A8YA 1K73O 1QQCA 2W41A 1VQON 3ZSWA 1RTDA 3AO4A 2D0OA 2HBMA 2VG7A 4C23A 1CZBA 1VQLN 2KFNA 3BUZB 3MEDA 3FLCO 4M7XA 4OGEA 1LV5A 1KLMA 1RT7A 4I9QA 1L3UA 3CFOA 1B9DA 1QS4A 2GV9A 3AVIA 3LZJA 3B6OA 1X3NA 4IFEA 1QQOA 1WSFA 4JKHA 1NKEA 3DLLL 1LCUA 2O4GA 4FWMA 1SL0A 2O8BA 1NU0A 4KHUA 2YJFA 4EIAA 1TVRA 1TL3A 5A2QO 3KIOA 2VQFK 5LMNK 1EWQA 4CEQA 5EU7A 1EWRA 2XRIA 4LC9B 1N32K 3C0BA 1YUWA 4U67L 3VA3A 1C1CA 1IBLK 5AJ3K 3LL3A 5CHIA 2BUPA 2HMPA 4DSFA 3MX5A 3WXMB 1NJYA 4DR1K 5DM7L 2QA4N 2FC0A 2B4JA 4KI6A 4DF8A 3DXMA 3M8RA 3DLKA 3LP1A 3ZYYX 4UY8O 1ZBHA 5FRMA 1BI4B 1NK8A 2ZJPL 3CF5L 1K8AO 3QINA 3OTOK 4J2EA 3AARA 1QSLA 1X9JA 1VQPN 4GVMA 4CEZA 4CJUA 3VQ7A 3LANA 1BI4A 1LAWA 1OVQA 1NK7A 4FO0A 3LALA 1NKBA 4GVEA 1XNRK 2Q2RA 3CFPA 3V9SA 4CBUA 2A41A 4YOWA 1HKGA 3ID8A 1TK0A 4M42A 5J2NA 2VYPA 2QTDA 4MDAA 4LSNA 5E26A 3PO4A 3EKSA 4JI2K 3VEZA 4JKFA 2OTJN 3AA3A 3M3ZA 3L8BA 2CGKA 1RBSA 1UA1A 2CGLA 4DS5A 1KD1O 4Z0UA 1RBVA 1HQUA 4RCHA 3OA9A 1VQMN 5J2PA 4ZTJA 2QXFA 3NGIA 3AA4A 5FROA 3I8BA 4NCGA 3SMPA 4O8KA 3C65A 1BISA 3QO9A 2GBZA 1XI1A 1C0GA 3AVCA 3VMFB 4H0YB 5BR8K 3QB0A 5FPDA 3ULEB 2XO7A 3OYHA 3V9WA 1A5VA 3SMSA 1GLJO 1Q82O 4M7YA 3R1XA 4CF8A 5HRNA 4DG1A 3AVFA 1DKGD 4GV6A 4OO1J 1BA0A 1TKZA 1Q9YA 3ZT3A 5CR4A 3DM2A 4CZGA 1QE1A 1FKOA 3KD1E 3I33A 5B8HA 4XH4A 3WXLA 2OYQA 4C1NI 1IKWA 4NXMK 4PKHA 2IVNA 1NGCA 1SL2A 1SZ2A 1ATNA 4EAHD 4B9LA 4XH1A 3S41A 1XQSC 4E7IA 4C8NA 4GV9A 2FBYA 4JD2B 3MCAB 1KTQA 4LY7A 2KLAA 4IFYA 2D0AA 4DQIA 1KAXA 2YKMA 3C95A 3HI0A 1S1TA 1NJXA 2RE2A 5LJWA 3HPOA 1GLBG 3IRXA 3NMUA 5K14A 3VEXA 4B9TA 2OZMA 3U3YA 2Q31A 3IFRA 1BUPA 3WXIA 3HRGA 3MK6A 4X64K 4DUZK 1WLJA 4MQ3A 4CVNE 1HYVA 3EKUA 4HUFA 1WUAA 4ZHRA 4IG3A 3HYFA 1U2VA 1DEJA 3HM8A 4FWLA 5CZ2A 1D9FA 3LP2A 1W9HA 4JK8A 5TKWA 4ZTFA 3KLFA 1JJ2M 3CHWA 2D0PA 5FPNA 4C1NK 3R6MA 3A5NC 4LFBK 4Y0WA 1BHLA 4J2AA 4FJJA 3VQ9A 3CQXA 4JKBA 4BR9A 4OGCA 2Q0RA 4QS9A 3BZKA 1C0UA 1CXQA 4W5NA 4C8OA 3KZBA 4ISFA 4JLHA 4HUGA 5KPTA 2Q97A 3OBWA 1WBBA 1QVGM 4BRKA 4FVUA 3IG1A 5AQZA 4BC3A 3TAGA 4FWPA 1WAFA 1NK9A 3AV9A 4EZ9A 1XWLA 1C6VA 1JL2A 4DV0K 1K8KB 4JKGA 3CYMA 4IXCA 3KK3A 3DOLA 4BRHA 1RDBA 5AQLA 4CK1A 5JVGL 1KCFA 3RVCA 5F0XA 2ETJA 3KJVA 5M1NA 1HQEA 4LF9K 1Q7YO 4WQ4A 5HL7L 3A5MC 2E88A 2Q0UA 3Q7CA 3S3NA 4B8AB 4B3MK 2XY6A 1T03A 1JXBA 2QEXN 3WEEA 3FFIA 3C6AA 4CJVA 5GIPA 4MDBA 2D1KA 4GKJK 1NOZA 3J80O 4OJRA 5HOOA 4CEAA 1I3AA 4H5TA 3UB5A 2W6LA 2Z1JA 1IO2A 1ZBSA 1RTIA 4C8MA 1EXQA 4CZHA 1S9EA 3CJBA 4X62K 3MN7A 4JEPA 3ZETB 4CIGA 3EZ5A 3PO5A 3NHGA 4RW6A 5KQDA 1WSHA 3J8AA 4B9VA 3CPEA 3K58A 1N8RO 1W7AA 4AHVA 3SV3A 1BU6O 4I6MA 1NGIA 4DTNA 2I5JA 3D45A 2O8CA 3LZIA 5KI6A 4BGAA 1ATSA 1K9MO 5HROA 4YOXA 1CXUA 4Z4IA 2WC9A 4C8LA 4N76A 1FJGK 2BGGA 1ESVA 2I7PA 3ZT0A 4FJMA 3TTDA 3DRRA 1VRTA 4LH5A 4DR7K 5KRTA 1TUYA 4CFDA 3WNEA 3VQ4A 2QWNA 4O5FA 5HP1A 3T69A 1T6DA 3OVNA 1ASWA 3ZX3A 3CETA 4DR2K 3TI0A 4M45A 3FZFA 5AZIA 4CHPA 4XH5A 3THWB 2RKIA 3VN5A 2WTUA 4WQ4C 4FW1A 3ZSRA 4FWKA 1GLFO 1N33K 2H3GX 3OYEA 1NNEA 5BN9A 1Z26A 4BE1A 3THWA 4MLHA 5AQPA 1X3MA 4AHCA 3CCMN 3VA0A 3O3HA 3L4IA 1BWFO 2HW3A 2VGNA 1SKWA 3HOSA 2YHXA 1C0FA 3SUPA 1QHTA 1R0AA 1BQNA 3QIPA 4DV2K 3AVLA 2V52B 4DMNA 4H4OA 3G0ZA 1BCOA 1CZAN 3KWIA 4KB0A 1UAXA 3P5JA 4DU1A 4B3RK 2KW4A 3L3VA 4ILHA 3F9MA 5BREA 3CM6A 1SKSA 4GV3A 5AQHA 5LMUK 3FZKA 2V7YA 2VCPA 4YY3K 1DTQA 2HMIA 1BGXT 1U48A 3C7NA 1UA0A 1W97L 1NMNA 1T6CA 2ZJQL 4R79A 2IAJA 5BRFA 4NB4A 5GIOA 3TAPA 4B3SK 5C15A 5MLCQ 1X1PA 4OKEA 3TAQA 3AVGA 1ZBIA 4JKDA 1GLCG 5ADXA 3PV8A 3HO1A 4BVPA 2QM1A 1J5OA 3ENBA 4DTJA 3MWPA 3LDPA 1T7PA 4DR3K 4KPYA 1BG3A 4C8KA 3NBPA 4IJAA 4M63C 5M1PA 4M3TA 3DYAA 4CEOA 3PUFA 4MO4A 4DV7K 1WSIA 3B6PA 2A3ZA 4CGDA 4B9UA 3MEGA 4M3RA 3OBYA 5M1OA 1LW0A 2I7NA 2P9SA 2ZF5O 1YJNN 1IKVA 3QETA 3SK3A 2OCEA 4CHOA 4O0JA 3H45C 2P5GA 1TK5A 3CM5A 4IBNA 3WT0A 4A5BA 4B3TK 3THXA 4CHQA 4QS7A 2HF4A 3M8PA 4B08A 4FJGA 3ITHA 2V51B 3P31A 5AQJA 1TAUA 3AY9A 4JNEA 4BRNA 3CCEN 4A59A 3RMBA 3ATVA 4DFJA 2HBKA 3D2EB 3WXKA 3QESA 4F4KA 1L3SA 2G8WA 1LW2A 4DTOA 1VQ8N 4BVOA 1L3TA 3DXKB 5BN8A 3K59A 2P9IB 3EE8A 2OPQA 4KTZA 4KHSA 1VQ6N 1NMDA 1M90O 3LPTA 1HJRA 4O5BA 2F9TA 4AHTA 4F2SA 5KTQA 4FJKA 3CJ7A 2QWMA 4CFAA 3CIPA 4JI1K 1NKCA 3KKSA 1KQSM 2IGIA 2GUIA 2P1JA 5CZ1A 3OS0A 3P83D 1CLQA 1NK0A 1YI2N 4BROA 3O08A 2YI1A 3L0QA 1S6QA 5ELZA 4FLUA 1SQKA 1GOAA 1QQNA 2P9NA 3MCPA 4HTUA 3SUNA 3FR0A 3O9RA 1XMOK 1N6QA 2E1ZA 3I56N 4CE9A 2HHHK 4A2BA 3OW2M 4OKKA 3NH0A 3OYJA 3J7YP 2WBNA 2FF6A 3S3MA 4B1XB 1S9GA 3GL1A 4LFCK 4Z4FA 2F8SA 4KHNA 1Y97A 3ID6A 4B9NA 3FZMA 1JLCA 2ASMA 3CCRN 4B1VA 5AQWA 2PAVA 3VQCA 1U6ZA 1VAZA 3H6EA 4IEEA 1U49A 3I0RA 2P9LA 3NDKA 2QI2A 3O5BA 4JN4A 3LDSA 1OH8A 1KLNA 3CQ8A 4DQSA 4YOYA 3MWTA 2IS3A 4HUEA 1S1XA 2O8DA 1NLVA 4ILGB 4X66K 1YAGA 4DF4A 3MAQA 3V1RA 3NF9A 3HBTA 4ID5A 1U4BA 4M3XA 4KI4A 1LOTB 3WNHA 3NF8A 3L2RA 4LF7K 4FJ5A 1NGAA 1DLOA 2A5XA 4BE2A 3SAGA 3DLHA 3SPYA 3QEWA 1JL1A 4DSEA 4CJPA 4DFMA 4CEEA 1E4GT 3SAHA 1J53A 2E1YA 2O8BB 3DLEA 3KLEA 1NK5A 2G8IA 1BL3A 4KBOA 4KKOA 4BGBA 2GEMA 3CC7N 1LWFA 2YNHA 2YNGA 2BDPA 4BQLA 1RDUA 4YOTA 3L3UA 3O4NA 4ISEA 3O9TA 2EHGA 1GLEG 3GDQA 4RW8A 2Q1NA 1U45A 4KREA 3V1OA 3AVNA 4BRAA 4ELTA 4FZZA 4JV5K 3LDLA 1IBMK 3OYNA 3AAQA 3DXMB 2Q36A 3R8EA 4CJQA 2IDOA 4Z4GA 3NF6A 3V4IA 4IDKA 4CJLA 3U9ZA 1EETA 1GLAG 4E7HA 1WN7A 4B9SA 1S22A 1RT1A 2ZQBA 4IZ9A 1RTJA 4DQPA 4BRPA 2DY4A 2Y1IA 2FBVA 3DI6A 3IDHA 3SLCA 3ATUA 5AQYA 3OS1A 4LF4K 4H0XB 4CECA 2GWKA 4EHTA 4CFCA 5DK5A 3TU5A 2KQ2A 3D7EO 3UKUA 4PKGA 3G6EN 4E1MA 2YHBA 1TYQA 1JXEA 1C1AA 4Z4CA 2IVOA 1HYSA 3NGZA 3QEPA 3FFKB 1EKEA 4FLTA 2UUCK 3AO1A 4EZ6A 1YXQA 5EXWA 3PX0A 3AVJA 1DTTA 1NG9A 2NRXA 3K5OA 4FM2A 4PHTX 4HHTA 5C24A 1X9SA 1V4SA 3DOKA 4JI0K 4FZXC 2RPIA 2AA4A 4K43A 4DWIA 4H4MA 4NYFA 4N47A 3OJUA 3CJCA 5AQGA 1HPMA 3BEXA 3JAMO 1WSGA 5AQQA 5AFUH 3QFUA 2GUPA 3KK1A 3CCVN 4JS5A 3AO5A 3SJHA 4JRQA 4FM1A 3CMEN 5EX5A 4V19S 3J7AP 1LWCA 1WSJA 2X74A 3TANA 1QSSA 2A6AA 4CJSA 1KSPA 2O8FA 2YHWA 4BR2A 4FLVA 5AQUA 4W5QA 2YJEA 4E7KA 3VF6A 1RT5A 2IOCA 4O55A 4KO0A 1TAQA 5LJVA 1N5YA 1EX4A 2FSNA 3N4QA 1WAJA 3DWLA 2OPPA 1Q86O 3A5OC 3DRSA 3KK2A 4DLGA 1HR0K 2IVPA 1KFDA 2G8FA 4G1QA 3C6HA 3A0IX 1L3VA 5DM6L 3T1HK 5JS1A 3CQYA 1VHXA 4DQ8A 2ITMA 4B8CA 1U2VB 5SWMA 3DLGA 4F2RA 4EP4A 4EFHA 4M3YA 4WFBL 4BY9C 3TPQA 4CF2A 4CJ3A 1KAYA 3DLRA 4H0TB 4DR6K 3V6DA 4X65K 5GINA 3LDQA 4HCBA 2DFEA 4NCAA 5DMRA 4Z4HA 3AAPA 1C0MA 3ZSQA 1ITGA 4LD0A 4IWVA 3GBTA 3SQ2A 2E2QA 2PFUA 5AQNA 2A1RA 2QWQA 1S1UA 1NGGA 2E8AA 3BP8A 4E19A 5AZJB 1ZBUA 4BREA 3GE1A 3VQEA 4FJ9A 2E2OA 2UYTA 4I2PA 2JWLA 5F1XA 1ILYA 1SUQA 4JKGB 4PL7A 1I39A 3FZLA 3M6GA 3U4LA 5AZJA 4FCYA 4Z94A 1JCFA 3E01A 3CI5A 3CCJN 3ZEUA 2X6SA 5CYMA 3LM9A 3AVBA 2DPNA 1FK9A 4Z4EA 3PIPL 4LSLA 3SQ1A 1VQ7N 3ZLJA 2VWJA 2JWKA 3OY9A 3VTIA 2ITGA 1RGIA 4JHDA 1RBTA 3CFRA 1VQ9N 3OYKA 4CZIA 1KFSA 4EHUA 2NRHA 1S72N 4CJEA 1Z6RA 4CZEA 2IIRA 4CGHA 4O4GA 4H0VB 3O9SA 4CJ5A 3QNNA 3S9HA 5BPNA 4JI3K 4B1ZA 3WEEB 4KB1A 3OYDA 2P9KA 3EO3A 4NLBA 1MWKA 1T05A 4CFBA 2W6KA 2HNYA 2DFHA 2PBDA 3AA2A 3H1VX 3BF1A 1E4FT 2YNIA 5AQOA 4W5RA 3KLGA 2PYLA 4B1YB 3HZ6A 2OPRA 1NGFA 5HRPA 2PY5A 3ALYA 3L2QA 2A42A 4BR7A 4BRGA 4FJHA 1LAVA 3HJFA 3O3FA 3LDNA 1W0HA 3HOTA 5HLFA 3CMAN 1GLLO 2ZGYA 1RNHA 1VQ4N 1BCMA 3AGRA 2EX3A 3LWLA 5JVHL 2HNZA 3D2FA 2E2PA 3I55N 4I6MB 1YTAA 1NGEA 4DR5K 1DT9A 4ID1A 2O8CB 2HB5A 4CHZA 1SL1A 5BRHA 3AA5X 2ZM6K 4E0DA 1RDCA 4R5PA 4ICLA 5C10A 3CXCM 5C0YA 4BRDA 3QFPA 3Q7BA 5AQFA 1XC9A 5BPMA 3ZSYA 4CW7B 3VEOA 1KVAA 5C2DA 1QZ6A 1S6PA 3TTCA 5AZIB 3M8QA 4FWOA 2G8HA 5M1KA 2P9PA 1RT4A 3RSEA 2X6NA 4OLAA 2NNWA 4FXDA 3THYA 4GW6A 4U7BA 5SZTA 4BQZA 2YHYA 2ZE2A 2UUAK 3M8SA 2GX9A 3O8MA 3M1FA 2FSKA 4N5SA 3KKRA 1YT3A 3UKRB 2XHBA 1VSEA 3IMXA 1WB9A 2UUBK 2WUSA 4CJ7A 5BRDA 5CE3A 1NWKA 3DRPA 4PKIA 1V4TA 3O80A 3NAEA 4BRCA 4IFVA 3SQ0A 1HKBA 3MXJA 4O0IA 3UKRA 4DUYK 4DR4K 3J7ZO 5C12A 3CJAA 3VQ6A 4OLBA 4AH9A 4QCLA 4H5WA 4KHQA 2VG5A 3RRGA 2YV0X 3ZT2A 4YFUA 3VGLA 3RTVA 4OVLA 3OYIA 3EYZA 4AM7A 5HBMA 3C7NB 4DB3A 2F7TA 4FWSA 2YNFA 2QWOA 3VF4A 3P38A 3HM9A 3DMJA 3HSTB 5AR0A 4DQRA 2E6LA 1Z25A 2HBLA 2P9UA 5HRRA 1NJZA 4KRFA 5H1SQ 3D6RA 1X9MA 2NRVA 2VG6A 4FK4A 4YORA 4NXNK 1QHAA 3VERA 4GMJB 4OPKA 2V7ZA 3BF3A 2HNDA 4LFAK 4CBWA 3RR7A 1YIJN 2KZMA 3HK2A 2ZD1A 4KHWA 1VQNN 4A2AA 3VGMA 1OH5A 3VESA 3AVKA 4FWQA 1OVYA 4CZKA 5BPLA 1G15A 3KLIA 4DTUA 4JKAA 4DHYA 4I7FA 2HHSA 4Y1DA 1YJWN 4YHHK 4A61A 3PLAA 2P9SB 3VQAA 1U04A 4KTWA 4MO5A 4CGGA 3K2PA 5GADP 3KLHA 3PIOL 3CPWM 4LF5K 1RT6A 5I3UA 4JKEA 2OA8A 3I8DA 2E5LK 4BG9A 2HHUA 3THXB 2P5OA 4FW2A 1NGDA 4N56A 4DTRA 4CESA 4FPAA 3OS2A 1NOYA 3OHRA 4F3TA 1D5AA 1GLDG 3HT3A 4FJNA 3VPZA 1Q8IA 1Z05A 5FDLA 3TR8A 2GELA 3LAKA 4ISGA 3C94A 4WE1A
chains in the Genus database with same CATH topology
2P9PB 3F5TA 4BQLA 1KAXA 3RSEB 1RDUA 4MLEA 4ISEA 4YOTA 3HI0A 4YOVA 3O9TA 3NVKA 3MN6A 3DJCA 1P90A 2CH5A 4K41A 3JXUA 2RE2A 3F2KA 5LJWA 1GLEG 1GLBG 3GDQA 1XUPO 2Q1NA 1NGHA 4KH5A 3ZETA 2F9WA 3NMUA 3TSPA 4BRAA 3VEXA 4K42A 2Q31A 3IFRA 3H46O 3LDLA 1BUPA 3WXIA 3KVGA 3HRGA 3AAQA 3DXMB 3MK6A 1TUUA 4BR4A 2Q36A 3R8EA 3HSCA 2CGJA 2P9NB 3EKUA 3MN5A 4GNIA 1WUAA 3SAFA 1U2VA 3QICA 1DEJA 1YITN 3HM8A 3U9ZA 1JCEA 1T44A 1GLAG 4FWLA 1S22A 2J4RA 4CZMA 4JK8A 1Y64A 4IZ9A 5TKWA 5KPZA 3R9PA 1JJ2M 2FF3B 3CHWA 5GAHP 2D0PA 5FPNA 4BRPA 4C1NK 1QVFM 3R6MA 4WFNL 5KQ8A 3A5NC 2NRWA 5LY3A 2QW9A 3IDHA 4Y0WA 4BRQA 4FSVA 1H1VA 3SLCA 3ATUA 5AQYA 3CC4N 3MMVA 4H0OA 2RHKA 1Q18A 2HSTA 3CQXA 2GWKA 4H0XB 4EHTA 3O1BA 3LDOA 4JKBA 3TU5A 4BR9A 2Q0RA 3D7EO 3UKUA 3L4QA 1P8ZA 4JK9A 4PKGA 4QS9A 3G6EN 5JICA 4BC2A 3U9DA 1TYQA 3KZBA 2IVOA 3FZHA 4ISFA 2KKZA 2Q97A 3OBWA 5KPTA 4WQ5C 1D4XA 3CCUN 1QVGM 4BRKA 2P9UB 4FVUA 4K25A 3FFKB 5JMVA 4IOCL 2NLXA 2E2NA 1YXQA 2P9LB 2OTLN 5EXWA 5AQZA 4BC3A 2VWBA 4WCEL 3G4SN 3DAWA 4FWPA 3O6WA 1RDWX 2NRXA 1NGBA 4PHTX 1NJIO 4YOUA 3CERA 1K8KB 4JKGA 1VQ5N 4IXCA 4BRHA 4B1WB 5AQLA 1OKJA 1V4SA 5AQRA 4BR5A 3U8XA 2AA4A 4K43A 1XC3A 2OANA 4BRMA 5JVGL 3KHYA 3CJCA 4O8UA 2AP1A 3RVCA 5AQGA 3K9KA 5F0XA 1HPMA 3BEXA 5AFUH 2GTDA 5AQQA 3QFUA 5M1NA 4DCHA 2GUPA 3CCVN 4J8FA 4WYBA 1O13A 1Q7YO 3VETA 4WQ4A 3SJHA 5HL7L 4FOEA 4YDUA 4AF1A 3A5MC 2E88A 3MN9A 3CMEN 2QWPA 2Q0UA 3Q7CA 5EX5A 4BC4A 3H3NO 3E9OA 2QEXN 3WEEA 2A6AA 3C6AA 2QXLA 5GIPA 4A5AA 4MDBA 2YHWA 2D1KA 3W3DA 4BR2A 5E84A 4H5NA 5AFUA 5AQUA 2YJEA 3ZX0A 3VF6A 4PL8A 5GAGP 5AQTA 3JS6A 5HOOA 2FLOA 5LJVA 3KWGA 4H5TA 3UB5A 5JLHA 2FSNA 3TTFA 3QBXA 3ZX2A 3N4QA 4BC5A 3VEVA 3DWLA 4E1JA 3VTHA 1ZBSA 1YJ9N 4CI6A 4CZHA 3CJBA 1Q86O 3MN7A 4JEPA 3ZETB 3A5OC 4NLCA 2D4WA 5KQDA 2IVPA 3J8AA 4BRFA 4CZFA 2KHOA 1YF5L 3CPEA 3FGUA 1N8RO 3G25A 1BU6O 4I6MA 4IEIA 1NGIA 2GWJA 4QS8A 4BRIA 4L3QA 4RTFD 3C6HA 1HJOA 3A0IX 1ATSA 4BGAA 5M1FA 5DM6L 1K9MO 3CQYA 4YOXA 4DQ8A 2ITMA 1U2VB 3CCSN 2NRZA 2WC9A 4BRLA 1BO5O 1ESVA 2I7PA 1IG8A 2ZJRL 3TSQA 3GOIA 4EFHA 3TTDA 3QBWA 2HOEA 3R3LA 1MDUB 4WFBL 2BH1A 1G99A 1TUYA 4FWRA 5EOYA 3VGKA 3TPQA 4BY9C 3FE1A 4G9ZA 1KAYA 3MDQA 4H5RA 4FOIA 1R59O 4H0TB 2QWNA 4O5FA 2ZWHA 3IUCA 3T69A 3LM2A 1T6DA 3W0LA 4DKWA 2FXUA 3VF2A 1M1KO 3D2EA 5EY4A 3VENA 3ZX3A 2NRRA 3CETA 4GY2B 5GINA 3LDQA 3FZFA 5AZIA 4XH5A 3A5LC 3UKUB 3DXKA 1DGKN 3AAPA 4WQ4C 4IJNA 1S3XA 4YDUC 1SAZA 3CCQN 2P9IA 4FWKA 1GLFO 3L6QA 2H3GX 4AM6A 1YHQN 3G71N 1TYQB 3P39A 3MX2A 1HX1A 5BN9A 4IWVA 3WUHA 4MLHA 3GBTA 1X3MA 4JKCA 1ZC6A 2E2QA 4OPAA 5AQPA 2NRTA 2PFUA 2NZTA 3HTVA 3L4IA 5AQNA 1BWFO 2QWQA 1BDGA 1NGGA 2VGNA 4BG8A 3HOSA 2YHXA 1C0FA 2E8AA 2W40A 2QWLA 3BP8A 4CD3A 5AZJB 1QQMA 4BREA 2ASPA 3GE1A 2E2OA 2UYTA 5EVZA 2JWLA 5F1XA 1ILYA 4FWNA 5AQIA 4CZLA 4JK7A 4JKGB 4PL7A 2V52B 1IJJA 4A57A 2QWRA 3FZLA 1KXPA 3M6GA 3U4LA 5AZJA 4IOAL 5GAEP 4XEIA 1JCFA 4Z94A 3CI5A 1CZAN 3KWIA 2FSJA 3CCJN 3ZEUA 3O9UA 4CBXA 3E9LA 3AGKA 4ILHA 3LM9A 5AQMA 2DPNA 3F9MA 5BREA 4GV3A 2CH6A 5AQHA 3FZKA 1HUXA 2V7YA 3PIPL 1VQ7N 2VCPA 2HF3A 3KK7A 2BTFA 2JWKA 3O1WA 3O4WA 3VTIA 5KPRA 1RGIA 3N4PA 5ADXH 4JHDA 1VQ9N 4CZIA 2YX6A 3C7NA 4EHUA 2NRHA 5C2FA 3CCMN 1S72N 1J6ZA 1W97L 1Z6RA 4H5VA 4CZEA 2IIRA 4B9QA 1JCGA 1T6CA 4H0VB 3O9SA 4JD2B 4R79A 2ZJQL 5BPNA 3E9PA 3IKMA 4B1ZA 3WEEB 5BRFA 3ENOA 4NB4A 2P9KA 3VEYA 5GIOA 1Q81O 1T3VA 3EO3A 1MWKA 4NLBA 3B8AX 5C15A 3SBGA 1QZ5A 1SS6A 5MLCQ 5AQXA 2PBDA 3H1VX 3QDKA 3BF1A 1E4FT 1ZXOA 3E1YA 1GLCG 4JKDA 4NO7A 5ADXA 5AQOA 4WFAL 1YVNA 4B1YB 4ILJA 3HZ6A 2HBJA 4JAXA 1NGFA 2QM1A 3WQTA 4BVPA 3ENBA 3MWPA 3LDPA 3NVMA 4A62A 1EO1A 4B1UB 2A42A 4BR7A 4BRGA 1BG3A 3A8YA 1K73O 3LDNA 2W41A 3HOTA 4OPHA 1VQON 3CMAN 1GLLO 2ZGYA 1VQ4N 4IO9L 4IJAA 4M63C 3AGRA 5M1PA 2D0OA 3QMLA 2HBMA 4MO4A 5JVHL 4C23A 3D2FA 3SBTA 2E2PA 3BUZB 1VQLN 4KH4A 3ULEA 1HKCA 2A3ZA 5F2RA 3VEWA 3I55N 3OBYA 4I6MB 5M1OA 1NGEA 3EL2A 3FLCO 1DT9A 3O9QA 3P4IA 4M7XA 4CD1A 2EWSA 2I7NA 2P9SA 2ZF5O 1RFQA 1YJNN 5BRHA 2ASOA 3SK3A 1WOQA 3CC2N 2YCHA 3H45C 4HTLA 1X3NA 3WT0A 4A5BA 4KH6A 4IFEA 5C10A 3CXCM 1QQOA 5C0YA 4JKHA 4BRDA 3QFPA 3CD6N 1ATRA 3Q7BA 2HF4A 4QS7A 1LCUA 5AQFA 4FWMA 3DLLL 5BPMA 2V51B 3P31A 5AQJA 2VGMA 4H0PA 2YJFA 3AY9A 4FPBA 3EZWA 4JNEA 3VEOA 4BRNA 4EIAA 1NBWA 5C2DA 4A59A 3CCEN 3ATVA 1QZ6A 2HBKA 3D2EB 3WXKA 3TTCA 4F9OA 1BA1A 5AZIB 4FWOA 4JD2A 1VQ8N 4BVOA 5M1KA 2P9PA 3DXKB 5BN8A 3RSEA 2P9IB 3EE8A 4LC9B 1VQKN 3C0BA 3EE9A 1YUWA 2ZGZA 4U67L 1W2BM 1VQ6N 1NMDA 2NNWA 1M90O 5JLFA 2F9TA 4U7BA 3LL3A 4BQZA 5CHIA 2BUPA 2YHYA 3CJ7A 2HMPA 2QWMA 3CIPA 4RWTA 3MX5A 3WXMB 1KQSM 5DM7L 2GX9A 2QA4N 3O8MA 3M1FA 2FSKA 1YI2N 4BROA 3O08A 3DXMA 2YI1A 3L0QA 5ELZA 3ZYYX 4UY8O 1EQYA 1SQKA 3K9JA 3UKRB 1QQNA 3ENHA 3IMXA 2ZJPL 2WUSA 4CJ7A 2P9NA 5BRDA 3MCPA 3CF5L 5CE3A 1NWKA 4PKIA 1K8AO 1V4TA 3O80A 1MWMA 3H1QA 4BRCA 1MA9B 3H3OB 3AARA 3FR0A 1HKBA 1X9JA 3O9RA 1VQPN 3ZEUB 2E1ZA 3UKRA 3I56N 3J7ZO 1KAZA 5AQSA 5C12A 3CJAA 4FO0A 4A2BA 3OW2M 4H5WA 1NM1A 4CZJA 3E66A 1NGJA 5FPMA 4GVEA 3VGLA 2WBNA 4JHDB 2Q2RA 3UE5A 2FF6A 4IO8A 5AQKA 4AM7A 4B1XB 3C7NB 4CBUA 4DB3A 2A41A 3GL1A 5AQVA 3WXJA 2F7TA 4YOWA 1HKGA 4FWSA 3ID8A 3VF4A 2QWOA 3CJ1A 3ID6A 2VYPA 2QTDA 3FZMA 4MDAA 3P38A 2E20A 1HLUA 2P9KB 2ASMA 5E26A 3EKSA 5AR0A 3VEZA 4JKFA 2OTJN 2WFBA 3M5RA 2HBLA 2P9UA 3M3ZA 3CCRN 4B1VA 5AQWA 2CGKA 2PAVA 2CGLA 1U6ZA 1VAZA 3H6EA 4IEEA 4IOXA 5H1SQ 3D6RA 2P9LA 1KD1O 2NRVA 2QI2A 4YORA 3O5BA 4JN4A 1QHAA 3VERA 2V7ZA 3BF3A 4YOYA 4RCHA 3MWTA 3OA9A 3VOVA 4CBWA 1VQMN 5TKYA 1YIJN 3I8BA 1KC8O 1NLVA 3SMPA 3WQUA 4O8KA 3C65A 1VQNN 4ILGB 4A2AA 5BR9A 1K8KA 1YAGA 3VGMA 1C0GA 3VESA 4FWQA 3VMFB 1OVYA 4CZKA 4H0YB 5BPLA 4BR0A 3QB0A 3D2FB 3HBTA 4JKAA 5FPDA 4DHYA 3ULEB 1LOTB 1YJWN 3SMSA 4WF9L 3CCLN 4A61A 1GLJO 1Q82O 4M7YA 3PLAA 2P9SB 3R1XA 4MO5A 1NGAA 2A5XA 3SAGA 1DKGD 4GV6A 5GADP 3PIOL 1BA0A 3CPWM 4OO1J 4JKEA 4HWIA 3EN9A 1E4GT 3SAHA 5CR4A 4BG9A 4CZGA 2E1YA 1NGDA 3I33A 5B8HA 4WQ5A 4XH4A 3WXLA 5FPEA 4C1NI 5M1QA 1BOTO 4FL9A 4PKHA 3CJ9A 2IVNA 4FPAA 3GG4A 1NGCA 4KBOA 1SZ2A 1ATNA 4EAHD 4XH1A 2A40A 2GEMA 3OHRA 1GLDG 3T7ZA 4BGBA 3TSUA 3VPZA 1Z05A 3S41A 1XQSC 3CC7N 4GV9A 2GELA 4IDHA 5I9EB 4ISGA 4H03B 3MCAB 2KLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P B;  4BQL A;  1KAX A;  3RSE B;  4MLE A;  4ISE A;  3HI0 A;  3MN6 A;  3DJC A;  2CH5 A;  4K41 A;  3JXU A;  5LJW A;  1GLE G;  1GLB G;  3GDQ A;  1XUP O;  2Q1N A;  1NGH A;  3ZET A;  2F9W A;  4BRA A;  3VEX A;  4K42 A;  2Q31 A;  3IFR A;  3H46 O;  3LDL A;  1BUP A;  3WXI A;  3KVG A;  3MK6 A;  3AAQ A;  3DXM B;  1TUU A;  4BR4 A;  2Q36 A;  3R8E A;  3HSC A;  2CGJ A;  2P9N B;  3EKU A;  3MN5 A;  4GNI A;  1WUA A;  1U2V A;  3QIC A;  1DEJ A;  3HM8 A;  3U9Z A;  1JCE A;  1T44 A;  1GLA G;  4FWL A;  1S22 A;  2J4R A;  4CZM A;  1Y64 A;  4IZ9 A;  5KPZ A;  3R9P A;  2FF3 B;  3CHW A;  2D0P A;  5FPN A;  4BRP A;  3R6M A;  3A5N C;  5LY3 A;  2QW9 A;  3IDH A;  4Y0W A;  4BRQ A;  4FSV A;  1H1V A;  3SLC A;  3ATU A;  5AQY A;  3MMV A;  4H0O A;  1Q18 A;  3CQX A;  4H0X B;  2GWK A;  4EHT A;  3O1B A;  3LDO A;  3TU5 A;  4BR9 A;  2Q0R A;  3D7E O;  3UKU A;  1P8Z A;  4PKG A;  4QS9 A;  5JIC A;  4BC2 A;  3U9D A;  1TYQ A;  3KZB A;  2IVO A;  3FZH A;  4ISF A;  5KPT A;  2Q97 A;  4WQ5 C;  1D4X A;  4BRK A;  2P9U B;  4K25 A;  3FFK B;  5JMV A;  2NLX A;  2E2N A;  1YXQ A;  2P9L B;  5EXW A;  5AQZ A;  4BC3 A;  2VWB A;  3DAW A;  4FWP A;  3O6W A;  1RDW X;  1NGB A;  3CER A;  1K8K B;  4IXC A;  4BRH A;  4B1W B;  5AQL A;  1OKJ A;  1V4S A;  5AQR A;  4BR5 A;  3U8X A;  2AA4 A;  4K43 A;  1XC3 A;  2OAN A;  4BRM A;  3KHY A;  3CJC A;  2AP1 A;  5AQG A;  5F0X A;  1HPM A;  3BEX A;  5AFU H;  2GTD A;  5AQQ A;  3QFU A;  4DCH A;  2GUP A;  4J8F A;  4WYB A;  3VET A;  4WQ4 A;  3SJH A;  4FOE A;  4YDU A;  3A5M C;  2E88 A;  3MN9 A;  2QWP A;  2Q0U A;  5EX5 A;  4BC4 A;  3H3N O;  3WEE A;  2A6A A;  2QXL A;  2YHW A;  2D1K A;  3W3D A;  4BR2 A;  5E84 A;  4H5N A;  5AFU A;  5AQU A;  2YJE A;  3ZX0 A;  3VF6 A;  4PL8 A;  5AQT A;  3JS6 A;  2FLO A;  5LJV A;  4H5T A;  3UB5 A;  5JLH A;  2FSN A;  3ZX2 A;  3QBX A;  4BC5 A;  3VEV A;  3DWL A;  4E1J A;  1ZBS A;  4CI6 A;  4CZH A;  3CJB A;  3MN7 A;  3ZET B;  3A5O C;  2D4W A;  5KQD A;  2IVP A;  3J8A A;  4BRF A;  4CZF A;  2KHO A;  3FGU A;  3G25 A;  1BU6 O;  4I6M A;  1NGI A;  2GWJ A;  4QS8 A;  4BRI A;  4L3Q A;  4RTF D;  1HJO A;  3A0I X;  1ATS A;  4BGA A;  3CQY A;  4DQ8 A;  2ITM A;  1U2V B;  4BRL A;  1BO5 O;  1ESV A;  2I7P A;  1IG8 A;  3GOI A;  4EFH A;  3QBW A;  2HOE A;  1MDU B;  1G99 A;  1TUY A;  4FWR A;  5EOY A;  3VGK A;  3TPQ A;  3FE1 A;  1KAY A;  3MDQ A;  4H5R A;  4FOI A;  1R59 O;  4H0T B;  2QWN A;  4O5F A;  2ZWH A;  3IUC A;  3W0L A;  3LM2 A;  1T6D A;  2FXU A;  3VF2 A;  3D2E A;  5EY4 A;  3VEN A;  3ZX3 A;  3CET A;  4GY2 B;  3LDQ A;  3FZF A;  5AZI A;  4XH5 A;  3A5L C;  3UKU B;  3DXK A;  1DGK N;  3AAP A;  4WQ4 C;  4IJN A;  1S3X A;  4YDU C;  1SAZ A;  2P9I A;  4FWK A;  1GLF O;  3L6Q A;  2H3G X;  4AM6 A;  1TYQ B;  5BN9 A;  1HX1 A;  4IWV A;  3WUH A;  4MLH A;  3GBT A;  1X3M A;  5AQP A;  1ZC6 A;  2E2Q A;  5KQ8 A;  5AQN A;  2NZT A;  3HTV A;  3L4I A;  1BWF O;  2QWQ A;  1BDG A;  1NGG A;  4BG8 A;  2YHX A;  1C0F A;  2E8A A;  2W40 A;  2QWL A;  3BP8 A;  4CD3 A;  5AZJ B;  1QQM A;  4BRE A;  2ASP A;  3GE1 A;  2E2O A;  2UYT A;  5EVZ A;  5F1X A;  4FWN A;  5AQI A;  4CZL A;  4PL7 A;  2V52 B;  1IJJ A;  2QWR A;  3FZL A;  1KXP A;  3M6G A;  3U4L A;  5AZJ A;  4Z94 A;  4XEI A;  1JCF A;  3CI5 A;  1CZA N;  2FSJ A;  3ZEU A;  4CBX A;  3LM9 A;  5AQM A;  2DPN A;  3F9M A;  5BRE A;  2CH6 A;  5AQH A;  3FZK A;  1HUX A;  2V7Y A;  2VCP A;  2HF3 A;  2BTF A;  3O1W A;  3O4W A;  5KPR A;  1RGI A;  5ADX H;  4JHD A;  4CZI A;  3C7N A;  4EHU A;  2NRH A;  1J6Z A;  1Z6R A;  4H5V A;  4CZE A;  2IIR A;  4B9Q A;  1JCG A;  1T6C A;  4H0V B;  4JD2 B;  5BPN A;  4B1Z A;  3WEE B;  5BRF A;  3ENO A;  4NB4 A;  2P9K A;  3VEY A;  3EO3 A;  1MWK A;  3B8A X;  1QZ5 A;  5AQX A;  2PBD A;  3H1V X;  3QDK A;  3BF1 A;  1E4F T;  1ZXO A;  1GLC G;  4NO7 A;  5ADX A;  5AQO A;  1YVN A;  4B1Y B;  3HZ6 A;  4JAX A;  1NGF A;  2QM1 A;  3WQT A;  4BVP A;  3LDP A;  4A62 A;  4B1U B;  2A42 A;  4BR7 A;  4BRG A;  1BG3 A;  3A8Y A;  3LDN A;  2W41 A;  1GLL O;  2ZGY A;  4IJA A;  4M63 C;  2D0O A;  3QML A;  4MO4 A;  4C23 A;  3D2F A;  2E2P A;  3BUZ B;  3ULE A;  1HKC A;  2A3Z A;  5F2R A;  3VEW A;  4I6M B;  1NGE A;  3EL2 A;  3FLC O;  4CD1 A;  3P4I A;  4M7X A;  2EWS A;  2I7N A;  2P9S A;  2ZF5 O;  1RFQ A;  5BRH A;  2ASO A;  3SK3 A;  1WOQ A;  2YCH A;  3H45 C;  4HTL A;  1X3N A;  3WT0 A;  1QQO A;  4BRD A;  3QFP A;  1ATR A;  4QS7 A;  2HF4 A;  5AQF A;  1LCU A;  4FWM A;  5BPM A;  2V51 B;  5AQJ A;  4H0P A;  2YJF A;  3AY9 A;  4FPB A;  3EZW A;  4JNE A;  3VEO A;  4BRN A;  4EIA A;  1NBW A;  3ATV A;  1QZ6 A;  3D2E B;  3WXK A;  4F9O A;  1BA1 A;  5AZI B;  4FWO A;  4JD2 A;  4BVO A;  2P9P A;  3DXK B;  5BN8 A;  3RSE A;  2P9I B;  4LC9 B;  3C0B A;  1YUW A;  2ZGZ A;  1NMD A;  5JLF A;  2F9T A;  3LL3 A;  4BQZ A;  2BUP A;  2YHY A;  3CJ7 A;  2HMP A;  2QWM A;  3CIP A;  4RWT A;  3O8M A;  3M1F A;  2FSK A;  4BRO A;  3O08 A;  3DXM A;  2YI1 A;  3L0Q A;  5ELZ A;  1EQY A;  1SQK A;  3UKR B;  1QQN A;  3ENH A;  3IMX A;  2WUS A;  4CJ7 A;  2P9N A;  5BRD A;  3MCP A;  5CE3 A;  1NWK A;  4PKI A;  1V4T A;  3O80 A;  1MWM A;  3H1Q A;  4BRC A;  1MA9 B;  3H3O B;  3AAR A;  3FR0 A;  1HKB A;  1X9J A;  3ZEU B;  2E1Z A;  3UKR A;  1KAZ A;  5AQS A;  3CJA A;  4FO0 A;  4A2B A;  4H5W A;  1NM1 A;  4CZJ A;  1NGJ A;  5FPM A;  3VGL A;  4JHD B;  2Q2R A;  3UE5 A;  2FF6 A;  4IO8 A;  5AQK A;  4AM7 A;  4B1X B;  3C7N B;  4CBU A;  4DB3 A;  2A41 A;  3GL1 A;  5AQV A;  3WXJ A;  1HKG A;  4FWS A;  3ID8 A;  3VF4 A;  2QWO A;  3CJ1 A;  2VYP A;  3FZM A;  2E20 A;  1HLU A;  2P9K B;  2ASM A;  5E26 A;  3EKS A;  5AR0 A;  3VEZ A;  2P9U A;  3M3Z A;  4B1V A;  5AQW A;  2CGK A;  2PAV A;  2CGL A;  1U6Z A;  3H6E A;  2P9L A;  3O5B A;  4JN4 A;  1QHA A;  3VER A;  2V7Z A;  3BF3 A;  4RCH A;  3VOV A;  4CBW A;  5TKY A;  3I8B A;  1NLV A;  3SMP A;  3WQU A;  4O8K A;  4A2A A;  5BR9 A;  1K8K A;  1YAG A;  3VGM A;  1C0G A;  3VES A;  4FWQ A;  4CZK A;  4H0Y B;  5BPL A;  4BR0 A;  3QB0 A;  3D2F B;  3HBT A;  5FPD A;  4DHY A;  3ULE B;  1LOT B;  3SMS A;  4A61 A;  1GLJ O;  4M7Y A;  2P9S B;  4MO5 A;  1NGA A;  2A5X A;  1DKG D;  1BA0 A;  4HWI A;  3EN9 A;  1E4G T;  4BG9 A;  4CZG A;  2E1Y A;  1NGD A;  3I33 A;  5B8H A;  4WQ5 A;  4XH4 A;  3WXL A;  5FPE A;  1BOT O;  4FL9 A;  4PKH A;  3CJ9 A;  2IVN A;  4FPA A;  3GG4 A;  1NGC A;  4KBO A;  1SZ2 A;  1ATN A;  4EAH D;  4XH1 A;  2A40 A;  2GEM A;  3OHR A;  1GLD G;  4BGB A;  3VPZ A;  1Z05 A;  3S41 A;  1XQS C;  2GEL A;  5I9E B;  4ISG A;  4H03 B; 
#chains in the Genus database with same CATH topology
 3QEI A;  3VQP A;  1U47 A;  1MU2 A;  4MLE A;  3V1Q A;  4EP5 A;  3OYA A;  2CH5 A;  3RMC A;  3F73 A;  3JXU A;  3F2K A;  4DTP A;  2JLE A;  4CED A;  4JI5 K;  1UWB A;  4AHR A;  2HVH A;  1QSY A;  4FJ7 A;  4L8R B;  2RN2 A;  3SPZ A;  4K42 A;  3HVR A;  3RMD A;  1TUU A;  4BR4 A;  2Y1J A;  4CCH A;  2P9N B;  3MN5 A;  3CG7 A;  4GNI A;  3SNN A;  3TWH A;  2G8K A;  1JCE A;  1T44 A;  3LP3 A;  3QIO A;  1E3M A;  4FLY A;  3T19 A;  2HHV A;  4JI6 K;  4CZM A;  1Y64 A;  1GOC A;  4CK2 A;  3R9P A;  5GAH P;  1QVF M;  4AIL C;  2O8E A;  4WFN L;  3PSI A;  4BE0 A;  1K6Y A;  3AVH A;  4DFK A;  4BRQ A;  1RTH A;  1H1V A;  3CC4 N;  4H0O A;  1Q18 A;  2HST A;  1ASV A;  3O1B A;  3L4Q A;  1P8Z A;  3PSF A;  4JK9 A;  4CF1 A;  4DSJ A;  1EP4 A;  1JLG A;  4BC2 A;  3U9D A;  3TAR A;  3QEV A;  3CCU N;  1D4X A;  4K25 A;  4IOC L;  3MXM A;  5IT9 O;  1RBU A;  2NLX A;  4PA1 A;  2P9L B;  3LPU A;  2OTL N;  4CF0 A;  3G4S N;  3DAW A;  2O8D B;  1NGB A;  4ELV A;  1NJI O;  2WOM A;  3CER A;  2W42 A;  1A5X A;  3NF7 A;  4NCB A;  4DLE A;  1VK0 A;  4K0K K;  2D0B A;  1L5U A;  2UU9 K;  4B1W B;  4PWD A;  3LWM A;  4DTM A;  4BR5 A;  2KTQ A;  3U8X A;  4FYD A;  1XC3 A;  2JGU A;  2OAN A;  4BDY A;  3MEE A;  5KGX A;  1VSK A;  3KHY A;  2Q3S A;  1YVU A;  3K9K A;  3SI6 A;  4DQQ A;  3T1A A;  1JLQ A;  5FLX O;  1O13 A;  4YDU A;  3ZCM A;  3MN9 A;  1J54 A;  4BC4 A;  2OPS A;  3QLH A;  4M3Z A;  3H3N O;  1KRP A;  2HHT A;  1Q9X A;  5CY4 A;  2QXL A;  3NH1 A;  1NK4 A;  4O44 A;  3SQ4 A;  5AQT A;  3JS6 A;  3TAB A;  2E4L A;  3NFA A;  3O4Q A;  1JLB A;  4KV8 A;  3ZX2 A;  3QBX A;  1J5E K;  4DSK A;  3VEV A;  4E1J A;  3VTH A;  4DFP A;  3MXI A;  1YJ9 N;  4CI6 A;  3NE6 A;  4KHY A;  3QEX A;  4HVJ A;  4AHS A;  4NLC A;  4BRF A;  1NJW A;  5IWA K;  4JI7 K;  5CYQ A;  3FGU A;  1TK8 A;  4IEI A;  2GWJ A;  4QS8 A;  3ZT1 A;  4L3Q A;  1HJO A;  5M1F A;  3HVT A;  3ULD A;  2BAN A;  3LAM A;  1ASU A;  1IG8 A;  2ZJR L;  3QBW A;  2HOE A;  5EOY A;  3VGK A;  1JLE A;  3SV4 A;  4FJX A;  3MDQ A;  4H5R A;  2HHW A;  4FOI A;  1R59 O;  1REV A;  1C1B A;  4OX9 K;  3IUC A;  3W0L A;  3LM2 A;  3ZSV A;  4DKW A;  3OYF A;  2FXU A;  3VF2 A;  1T8E A;  1XNQ K;  5EY4 A;  3VEN A;  3ZSX A;  2NRR A;  2R7Y A;  4PQU A;  3HXM A;  1SV5 A;  4JI4 K;  4W5O A;  3UKU B;  4IJN A;  2D5R A;  1SAZ A;  4YDU C;  3CCQ N;  2Z1H A;  3L6Q A;  1YHQ N;  4AM6 A;  4QAG A;  1TYQ B;  4XIU A;  3G71 N;  1X9W A;  4JKC A;  5KQ8 A;  1ZC6 A;  4E7L A;  2NZT A;  3HTV A;  1IKY A;  1HPZ A;  4CEF A;  3SCX A;  4CD3 A;  4M3U A;  1QTM A;  1BQM A;  4KFB A;  4Q0B A;  1JLF A;  2ASP A;  4CGI A;  3L2U A;  4FWN A;  4LH4 A;  5AQI A;  4E1N A;  4JK7 A;  1HYZ A;  4A57 A;  3HP6 A;  4NYN A;  1KXP A;  1D8Y A;  4IOA L;  3C6U A;  4BDP A;  2FSJ A;  1RIL A;  3O9U A;  3VQQ A;  4CBX A;  3E9L A;  3VQ5 A;  5AQM A;  3LP0 A;  1HNX K;  1VSM A;  3KK7 A;  4KAZ A;  5ADX H;  4FLX A;  4BDZ A;  4H5V A;  1S1V A;  4J2D A;  1JCG A;  1RT2 A;  1JLA A;  3IKM A;  4H8K A;  2G8V A;  3KD5 E;  3ENO A;  3VEY A;  1Q81 O;  1T3V A;  3H08 A;  4CJ4 A;  4PY5 A;  3B8A X;  3K57 A;  2O8F B;  1QZ5 A;  3VQD A;  5AQX A;  4W5T A;  3EEQ A;  4BWM A;  1ZXO A;  3RR8 A;  4NO7 A;  1TV6 A;  4WFA L;  2NUB A;  3IS9 A;  2HBJ A;  4JAX A;  4CEB A;  3WQT A;  1IH7 A;  4FLW A;  1EO1 A;  1SKR A;  3NGY A;  4OPH A;  1HRH A;  4IO9 L;  1OH7 A;  4DU4 A;  3RWU A;  3QML A;  1ZBL A;  3SBT A;  4KH4 A;  3ULE A;  1HKC A;  5F2R A;  3ISN C;  3VEW A;  3PY8 A;  5KRS A;  3EL2 A;  3O9Q A;  4CD1 A;  3P4I A;  2EWS A;  3OYL A;  4M41 A;  1RFQ A;  1RBR A;  2ASO A;  1WOQ A;  5J1E A;  3CC2 N;  1RT3 A;  2YCH A;  4HTL A;  4LF8 K;  4FLZ A;  4KH6 A;  3WNF A;  3CD6 N;  1ATR A;  3DLB A;  4FJI A;  1IV0 A;  2VGM A;  4H0P A;  2XY8 A;  4FPB A;  3EZW A;  1J9A A;  1NBW A;  3BGR A;  4CJR A;  2HHX A;  2F8T A;  4F9O A;  1BA1 A;  4AHU A;  4JD2 A;  4RW9 A;  1TL1 A;  4K8Z A;  2Z1I A;  1VQK N;  3EE9 A;  2ZGZ A;  3J81 O;  1W2B M;  5JLF A;  4E7J A;  2WON A;  1VSJ A;  4RWT A;  1A5W A;  4CK3 A;  2Z1G A;  2O4I A;  2QKB A;  4B9M A;  1FXX A;  1EQY A;  3K9J A;  3ENH A;  2D0C A;  1YTU A;  4M3W A;  3NH2 A;  1MWM A;  3H1Q A;  1HNV A;  4OPJ A;  1MA9 B;  3H3O B;  4CJW A;  1I94 K;  3ZEU B;  1VSH A;  1CZ9 A;  1KAZ A;  2G8U A;  5AQS A;  1N34 K;  3RRH A;  1NK6 A;  1NM1 A;  4CZJ A;  3E66 A;  1NGJ A;  5FPM A;  1FW6 A;  4JHD B;  3UE5 A;  3WNG A;  4IO8 A;  5AQK A;  2DFF A;  2PZS A;  3OYM A;  3VQB A;  5AQV A;  4OKJ A;  3WXJ A;  3AO3 A;  3V9U A;  4FK2 A;  5JS2 A;  3IAY A;  3CJ1 A;  2FBT A;  2E20 A;  1HLU A;  2P9K B;  2HHQ A;  4CF9 A;  1XHZ A;  2F4V K;  2WFB A;  3M5R A;  4F8R A;  3QER A;  2KZZ A;  2PYJ A;  3U3G A;  4IOX A;  3K5N A;  3QNO A;  2UXC K;  4N41 A;  3VOV A;  2F96 A;  3G10 A;  5TKY A;  1IBK K;  4JI8 K;  1KC8 O;  4FK0 A;  3WQU A;  4YNQ A;  1S5J A;  5BR9 A;  1K8K A;  4J2B A;  4BAC A;  3L2W A;  3HPG A;  3HPH A;  4RW4 A;  4BR0 A;  4DSI A;  3D2F B;  4CIE A;  3UIQ A;  3C6T A;  4WF9 L;  3CCL N;  4K8X A;  2XY5 A;  5FRN A;  4FJ8 A;  3RMA A;  4HWI A;  4RG8 A;  3EN9 A;  4B3O A;  4I9L A;  1O1W A;  4WQ5 A;  5FPE A;  1HNZ K;  5M1Q A;  1BOT O;  4FL9 A;  3F9K A;  3CJ9 A;  5J2M A;  3GG4 A;  4IG0 A;  2RF2 A;  2A40 A;  3T7Z A;  1OH6 A;  2YKN A;  3TSU A;  4KTQ A;  3OYB A;  4IDH A;  5I9E B;  4H03 B;  4DV4 K;  2P9P B;  3F5T A;  5J2Q A;  4CJT A;  3RSE B;  3S3O A;  2XY7 A;  4YOV A;  3NVK A;  3MN6 A;  3DJC A;  1P90 A;  3BDP A;  4K41 A;  3THY B;  3SUQ A;  4CGF A;  3SUO A;  1VSL A;  1XUP O;  4KH5 A;  1NGH A;  5E41 A;  3SZ2 A;  3ZET A;  2F9W A;  3TSP A;  1FKP A;  2A1S A;  3H46 O;  4DTS A;  3KVG A;  3BZC A;  2QKK A;  3HSC A;  4KHP K;  2CGJ A;  2IC3 A;  3U6F A;  3ZSO A;  3SAF A;  1B92 A;  3QIC A;  1YIT N;  2HVI A;  1IG9 A;  2J4R A;  4FZY A;  3T3F A;  5T7B A;  3MEC A;  2VQE K;  5C25 A;  2KFZ A;  5KPZ A;  2FF3 B;  1TKT A;  1B9F A;  2LSN A;  2NRW A;  4CER A;  5LY3 A;  2QW9 A;  4FSV A;  3MMV A;  2RHK A;  4GKK K;  3LDO A;  3V81 A;  5JIC A;  4JS4 A;  2E6M A;  1D9D A;  3FZH A;  2KKZ A;  2UXB K;  4WQ5 C;  2P9U B;  4PUO A;  4Q5V A;  5JMV A;  2E2N A;  5KGW A;  3HP9 A;  2VWB A;  4WCE L;  4LF6 K;  4DS4 A;  3O6W A;  2UXD K;  1RDW X;  4DV5 K;  4RW7 A;  4DV3 K;  1N36 K;  4QOZ B;  4YOU A;  1VQ5 N;  1VSD A;  2B6A A;  4DTX A;  4FVM A;  2FBX A;  2P51 A;  1OKJ A;  5AQR A;  3I0S A;  5LL6 Z;  4BRM A;  1XMQ K;  4AQY K;  4O8U A;  2AP1 A;  3SJJ A;  2GTD A;  4DCH A;  4J8F A;  2ATQ A;  4WYB A;  3VET A;  1WBD A;  4FOE A;  4AF1 A;  2QWP A;  4BWJ A;  4E3S A;  4JYA K;  3BY5 A;  3E9O A;  3V9Z A;  4A5A A;  3W3D A;  5E84 A;  1C0T A;  4H5N A;  5AFU A;  4TSX A;  4UQG A;  3PX6 A;  3T1Y K;  3ZX0 A;  4PL8 A;  4HCC A;  5GAG P;  2FLO A;  2YHA A;  1XHX A;  1UOC A;  3KWG A;  1HNW K;  5HRS A;  1JKH A;  3TTF A;  5JLH A;  3TAE A;  4FJL A;  4BC5 A;  1HMV A;  3V9X A;  3TAM A;  4Y1C A;  3SYZ A;  1WNS A;  5I42 A;  2D4W A;  1LWE A;  3P1G A;  4CZF A;  1KVB A;  2X78 A;  2KHO A;  1YF5 L;  2OZS A;  3G25 A;  3D0P A;  4BRI A;  4RTF D;  3ZT4 A;  4IKF A;  3AO2 A;  3NCI A;  3CCS N;  2NRZ A;  1RDA A;  4BRL A;  5D3G A;  1BO5 O;  3TSQ A;  3GOI A;  4CJF A;  1BIU A;  2B5J A;  2QK9 A;  3R3L A;  1MDU B;  3K5M A;  2BH1 A;  1G99 A;  4FWR A;  3PX4 A;  4G9Z A;  3FE1 A;  4DU3 A;  2O8E B;  3JYT A;  3K5L A;  2ZWH A;  1RCH A;  5C42 A;  1M1K O;  3D2E A;  4FM0 A;  1VRU A;  4GY2 B;  4CHY A;  3A5L C;  3DXK A;  1DGK N;  3L2V A;  4F3O A;  1S3X A;  2VWK A;  2P9I A;  1BIZ A;  1VSF A;  3P39 A;  3MX2 A;  1HX1 A;  4DV1 K;  3THV A;  3WUH A;  4I2Q A;  4OPA A;  1ZYQ A;  2NRT A;  3O3G A;  1BDG A;  4BG8 A;  2W40 A;  1TGO A;  2QWL A;  4DV6 K;  4CJK A;  4ELU A;  1QQM A;  4CHN A;  3JSM A;  4MFB A;  1S1W A;  4JRP A;  5EVZ A;  3OJS A;  3ZSZ A;  4CZL A;  3AVA A;  1IJJ A;  2QWR A;  5GAE P;  4XEI A;  2DTU A;  3OYC A;  4DSL A;  1HNI A;  3K0S A;  3AGK A;  1ZBF A;  4CGJ A;  4E89 A;  2CH6 A;  1HUX A;  3A2F A;  2HF3 A;  3TAF A;  2BTF A;  3O1W A;  3O4W A;  1GOB A;  1F21 A;  5KPR A;  3N4P A;  1WSE A;  3KTQ A;  2YX6 A;  5C2F A;  2AJQ A;  1J6Z A;  3OYG A;  4B9Q A;  3E9P A;  1IKX A;  3SBG A;  1SS6 A;  3EY1 A;  1KVC A;  3AVM A;  1VSI A;  3QDK A;  3E1Y A;  1RDD A;  4CIF A;  1YVN A;  4ILJ A;  3VQ8 A;  3NVM A;  4A62 A;  1TKX A;  2BE2 A;  1TKD A;  3HL8 A;  4B1U B;  3ASM A;  3A8Y A;  1K73 O;  1QQC A;  2W41 A;  1VQO N;  3ZSW A;  1RTD A;  3AO4 A;  2D0O A;  2HBM A;  2VG7 A;  4C23 A;  1CZB A;  1VQL N;  2KFN A;  3BUZ B;  3MED A;  3FLC O;  4M7X A;  4OGE A;  1LV5 A;  1KLM A;  1RT7 A;  4I9Q A;  1L3U A;  3CFO A;  1B9D A;  1QS4 A;  2GV9 A;  3AVI A;  3LZJ A;  3B6O A;  1X3N A;  4IFE A;  1QQO A;  1WSF A;  4JKH A;  1NKE A;  3DLL L;  1LCU A;  2O4G A;  4FWM A;  1SL0 A;  2O8B A;  1NU0 A;  4KHU A;  2YJF A;  4EIA A;  1TVR A;  1TL3 A;  5A2Q O;  3KIO A;  2VQF K;  5LMN K;  1EWQ A;  4CEQ A;  5EU7 A;  1EWR A;  2XRI A;  4LC9 B;  1N32 K;  3C0B A;  1YUW A;  4U67 L;  3VA3 A;  1C1C A;  1IBL K;  5AJ3 K;  3LL3 A;  5CHI A;  2BUP A;  2HMP A;  4DSF A;  3MX5 A;  3WXM B;  1NJY A;  4DR1 K;  5DM7 L;  2QA4 N;  2FC0 A;  2B4J A;  4KI6 A;  4DF8 A;  3DXM A;  3M8R A;  3DLK A;  3LP1 A;  3ZYY X;  4UY8 O;  1ZBH A;  5FRM A;  1BI4 B;  1NK8 A;  2ZJP L;  3CF5 L;  1K8A O;  3QIN A;  3OTO K;  4J2E A;  3AAR A;  1QSL A;  1X9J A;  1VQP N;  4GVM A;  4CEZ A;  4CJU A;  3VQ7 A;  3LAN A;  1BI4 A;  1LAW A;  1OVQ A;  1NK7 A;  4FO0 A;  3LAL A;  1NKB A;  4GVE A;  1XNR K;  2Q2R A;  3CFP A;  3V9S A;  4CBU A;  2A41 A;  4YOW A;  1HKG A;  3ID8 A;  1TK0 A;  4M42 A;  5J2N A;  2VYP A;  2QTD A;  4MDA A;  4LSN A;  5E26 A;  3PO4 A;  3EKS A;  4JI2 K;  3VEZ A;  4JKF A;  2OTJ N;  3AA3 A;  3M3Z A;  3L8B A;  2CGK A;  1RBS A;  1UA1 A;  2CGL A;  4DS5 A;  1KD1 O;  4Z0U A;  1RBV A;  1HQU A;  4RCH A;  3OA9 A;  1VQM N;  5J2P A;  4ZTJ A;  2QXF A;  3NGI A;  3AA4 A;  5FRO A;  3I8B A;  4NCG A;  3SMP A;  4O8K A;  3C65 A;  1BIS A;  3QO9 A;  2GBZ A;  1XI1 A;  1C0G A;  3AVC A;  3VMF B;  4H0Y B;  5BR8 K;  3QB0 A;  5FPD A;  3ULE B;  2XO7 A;  3OYH A;  3V9W A;  1A5V A;  3SMS A;  1GLJ O;  1Q82 O;  4M7Y A;  3R1X A;  4CF8 A;  5HRN A;  4DG1 A;  3AVF A;  1DKG D;  4GV6 A;  4OO1 J;  1BA0 A;  1TKZ A;  1Q9Y A;  3ZT3 A;  5CR4 A;  3DM2 A;  4CZG A;  1QE1 A;  1FKO A;  3KD1 E;  3I33 A;  5B8H A;  4XH4 A;  3WXL A;  2OYQ A;  4C1N I;  1IKW A;  4NXM K;  4PKH A;  2IVN A;  1NGC A;  1SL2 A;  1SZ2 A;  1ATN A;  4EAH D;  4B9L A;  4XH1 A;  3S41 A;  1XQS C;  4E7I A;  4C8N A;  4GV9 A;  2FBY A;  4JD2 B;  3MCA B;  1KTQ A;  4LY7 A;  2KLA A;  4IFY A;  2D0A A;  4DQI A;  1KAX A;  2YKM A;  3C95 A;  3HI0 A;  1S1T A;  1NJX A;  2RE2 A;  5LJW A;  3HPO A;  1GLB G;  3IRX A;  3NMU A;  5K14 A;  3VEX A;  4B9T A;  2OZM A;  3U3Y A;  2Q31 A;  3IFR A;  1BUP A;  3WXI A;  3HRG A;  3MK6 A;  4X64 K;  4DUZ K;  1WLJ A;  4MQ3 A;  4CVN E;  1HYV A;  3EKU A;  4HUF A;  1WUA A;  4ZHR A;  4IG3 A;  3HYF A;  1U2V A;  1DEJ A;  3HM8 A;  4FWL A;  5CZ2 A;  1D9F A;  3LP2 A;  1W9H A;  4JK8 A;  5TKW A;  4ZTF A;  3KLF A;  1JJ2 M;  3CHW A;  2D0P A;  5FPN A;  4C1N K;  3R6M A;  3A5N C;  4LFB K;  4Y0W A;  1BHL A;  4J2A A;  4FJJ A;  3VQ9 A;  3CQX A;  4JKB A;  4BR9 A;  4OGC A;  2Q0R A;  4QS9 A;  3BZK A;  1C0U A;  1CXQ A;  4W5N A;  4C8O A;  3KZB A;  4ISF A;  4JLH A;  4HUG A;  5KPT A;  2Q97 A;  3OBW A;  1WBB A;  1QVG M;  4BRK A;  4FVU A;  3IG1 A;  5AQZ A;  4BC3 A;  3TAG A;  4FWP A;  1WAF A;  1NK9 A;  3AV9 A;  4EZ9 A;  1XWL A;  1C6V A;  1JL2 A;  4DV0 K;  1K8K B;  4JKG A;  3CYM A;  4IXC A;  3KK3 A;  3DOL A;  4BRH A;  1RDB A;  5AQL A;  4CK1 A;  5JVG L;  1KCF A;  3RVC A;  5F0X A;  2ETJ A;  3KJV A;  5M1N A;  1HQE A;  4LF9 K;  1Q7Y O;  4WQ4 A;  5HL7 L;  3A5M C;  2E88 A;  2Q0U A;  3Q7C A;  3S3N A;  4B8A B;  4B3M K;  2XY6 A;  1T03 A;  1JXB A;  2QEX N;  3WEE A;  3FFI A;  3C6A A;  4CJV A;  5GIP A;  4MDB A;  2D1K A;  4GKJ K;  1NOZ A;  3J80 O;  4OJR A;  5HOO A;  4CEA A;  1I3A A;  4H5T A;  3UB5 A;  2W6L A;  2Z1J A;  1IO2 A;  1ZBS A;  1RTI A;  4C8M A;  1EXQ A;  4CZH A;  1S9E A;  3CJB A;  4X62 K;  3MN7 A;  4JEP A;  3ZET B;  4CIG A;  3EZ5 A;  3PO5 A;  3NHG A;  4RW6 A;  5KQD A;  1WSH A;  3J8A A;  4B9V A;  3CPE A;  3K58 A;  1N8R O;  1W7A A;  4AHV A;  3SV3 A;  1BU6 O;  4I6M A;  1NGI A;  4DTN A;  2I5J A;  3D45 A;  2O8C A;  3LZI A;  5KI6 A;  4BGA A;  1ATS A;  1K9M O;  5HRO A;  4YOX A;  1CXU A;  4Z4I A;  2WC9 A;  4C8L A;  4N76 A;  1FJG K;  2BGG A;  1ESV A;  2I7P A;  3ZT0 A;  4FJM A;  3TTD A;  3DRR A;  1VRT A;  4LH5 A;  4DR7 K;  5KRT A;  1TUY A;  4CFD A;  3WNE A;  3VQ4 A;  2QWN A;  4O5F A;  5HP1 A;  3T69 A;  1T6D A;  3OVN A;  1ASW A;  3ZX3 A;  3CET A;  4DR2 K;  3TI0 A;  4M45 A;  3FZF A;  5AZI A;  4CHP A;  4XH5 A;  3THW B;  2RKI A;  3VN5 A;  2WTU A;  4WQ4 C;  4FW1 A;  3ZSR A;  4FWK A;  1GLF O;  1N33 K;  2H3G X;  3OYE A;  1NNE A;  5BN9 A;  1Z26 A;  4BE1 A;  3THW A;  4MLH A;  5AQP A;  1X3M A;  4AHC A;  3CCM N;  3VA0 A;  3O3H A;  3L4I A;  1BWF O;  2HW3 A;  2VGN A;  1SKW A;  3HOS A;  2YHX A;  1C0F A;  3SUP A;  1QHT A;  1R0A A;  1BQN A;  3QIP A;  4DV2 K;  3AVL A;  2V52 B;  4DMN A;  4H4O A;  3G0Z A;  1BCO A;  1CZA N;  3KWI A;  4KB0 A;  1UAX A;  3P5J A;  4DU1 A;  4B3R K;  2KW4 A;  3L3V A;  4ILH A;  3F9M A;  5BRE A;  3CM6 A;  1SKS A;  4GV3 A;  5AQH A;  5LMU K;  3FZK A;  2V7Y A;  2VCP A;  4YY3 K;  1DTQ A;  2HMI A;  1BGX T;  1U48 A;  3C7N A;  1UA0 A;  1W97 L;  1NMN A;  1T6C A;  2ZJQ L;  4R79 A;  2IAJ A;  5BRF A;  4NB4 A;  5GIO A;  3TAP A;  4B3S K;  5C15 A;  5MLC Q;  1X1P A;  4OKE A;  3TAQ A;  3AVG A;  1ZBI A;  4JKD A;  1GLC G;  5ADX A;  3PV8 A;  3HO1 A;  4BVP A;  2QM1 A;  1J5O A;  3ENB A;  4DTJ A;  3MWP A;  3LDP A;  1T7P A;  4DR3 K;  4KPY A;  1BG3 A;  4C8K A;  3NBP A;  4IJA A;  4M63 C;  5M1P A;  4M3T A;  3DYA A;  4CEO A;  3PUF A;  4MO4 A;  4DV7 K;  1WSI A;  3B6P A;  2A3Z A;  4CGD A;  4B9U A;  3MEG A;  4M3R A;  3OBY A;  5M1O A;  1LW0 A;  2I7N A;  2P9S A;  2ZF5 O;  1YJN N;  1IKV A;  3QET A;  3SK3 A;  2OCE A;  4CHO A;  4O0J A;  3H45 C;  2P5G A;  1TK5 A;  3CM5 A;  4IBN A;  3WT0 A;  4A5B A;  4B3T K;  3THX A;  4CHQ A;  4QS7 A;  2HF4 A;  3M8P A;  4B08 A;  4FJG A;  3ITH A;  2V51 B;  3P31 A;  5AQJ A;  1TAU A;  3AY9 A;  4JNE A;  4BRN A;  3CCE N;  4A59 A;  3RMB A;  3ATV A;  4DFJ A;  2HBK A;  3D2E B;  3WXK A;  3QES A;  4F4K A;  1L3S A;  2G8W A;  1LW2 A;  4DTO A;  1VQ8 N;  4BVO A;  1L3T A;  3DXK B;  5BN8 A;  3K59 A;  2P9I B;  3EE8 A;  2OPQ A;  4KTZ A;  4KHS A;  1VQ6 N;  1NMD A;  1M90 O;  3LPT A;  1HJR A;  4O5B A;  2F9T A;  4AHT A;  4F2S A;  5KTQ A;  4FJK A;  3CJ7 A;  2QWM A;  4CFA A;  3CIP A;  4JI1 K;  1NKC A;  3KKS A;  1KQS M;  2IGI A;  2GUI A;  2P1J A;  5CZ1 A;  3OS0 A;  3P83 D;  1CLQ A;  1NK0 A;  1YI2 N;  4BRO A;  3O08 A;  2YI1 A;  3L0Q A;  1S6Q A;  5ELZ A;  4FLU A;  1SQK A;  1GOA A;  1QQN A;  2P9N A;  3MCP A;  4HTU A;  3SUN A;  3FR0 A;  3O9R A;  1XMO K;  1N6Q A;  2E1Z A;  3I56 N;  4CE9 A;  2HHH K;  4A2B A;  3OW2 M;  4OKK A;  3NH0 A;  3OYJ A;  3J7Y P;  2WBN A;  2FF6 A;  3S3M A;  4B1X B;  1S9G A;  3GL1 A;  4LFC K;  4Z4F A;  2F8S A;  4KHN A;  1Y97 A;  3ID6 A;  4B9N A;  3FZM A;  1JLC A;  2ASM A;  3CCR N;  4B1V A;  5AQW A;  2PAV A;  3VQC A;  1U6Z A;  1VAZ A;  3H6E A;  4IEE A;  1U49 A;  3I0R A;  2P9L A;  3NDK A;  2QI2 A;  3O5B A;  4JN4 A;  3LDS A;  1OH8 A;  1KLN A;  3CQ8 A;  4DQS A;  4YOY A;  3MWT A;  2IS3 A;  4HUE A;  1S1X A;  2O8D A;  1NLV A;  4ILG B;  4X66 K;  1YAG A;  4DF4 A;  3MAQ A;  3V1R A;  3NF9 A;  3HBT A;  4ID5 A;  1U4B A;  4M3X A;  4KI4 A;  1LOT B;  3WNH A;  3NF8 A;  3L2R A;  4LF7 K;  4FJ5 A;  1NGA A;  1DLO A;  2A5X A;  4BE2 A;  3SAG A;  3DLH A;  3SPY A;  3QEW A;  1JL1 A;  4DSE A;  4CJP A;  4DFM A;  4CEE A;  1E4G T;  3SAH A;  1J53 A;  2E1Y A;  2O8B B;  3DLE A;  3KLE A;  1NK5 A;  2G8I A;  1BL3 A;  4KBO A;  4KKO A;  4BGB A;  2GEM A;  3CC7 N;  1LWF A;  2YNH A;  2YNG A;  2BDP A;  4BQL A;  1RDU A;  4YOT A;  3L3U A;  3O4N A;  4ISE A;  3O9T A;  2EHG A;  1GLE G;  3GDQ A;  4RW8 A;  2Q1N A;  1U45 A;  4KRE A;  3V1O A;  3AVN A;  4BRA A;  4ELT A;  4FZZ A;  4JV5 K;  3LDL A;  1IBM K;  3OYN A;  3AAQ A;  3DXM B;  2Q36 A;  3R8E A;  4CJQ A;  2IDO A;  4Z4G A;  3NF6 A;  3V4I A;  4IDK A;  4CJL A;  3U9Z A;  1EET A;  1GLA G;  4E7H A;  1WN7 A;  4B9S A;  1S22 A;  1RT1 A;  2ZQB A;  4IZ9 A;  1RTJ A;  4DQP A;  4BRP A;  2DY4 A;  2Y1I A;  2FBV A;  3DI6 A;  3IDH A;  3SLC A;  3ATU A;  5AQY A;  3OS1 A;  4LF4 K;  4H0X B;  4CEC A;  2GWK A;  4EHT A;  4CFC A;  5DK5 A;  3TU5 A;  2KQ2 A;  3D7E O;  3UKU A;  4PKG A;  3G6E N;  4E1M A;  2YHB A;  1TYQ A;  1JXE A;  1C1A A;  4Z4C A;  2IVO A;  1HYS A;  3NGZ A;  3QEP A;  3FFK B;  1EKE A;  4FLT A;  2UUC K;  3AO1 A;  4EZ6 A;  1YXQ A;  5EXW A;  3PX0 A;  3AVJ A;  1DTT A;  1NG9 A;  2NRX A;  3K5O A;  4FM2 A;  4PHT X;  4HHT A;  5C24 A;  1X9S A;  1V4S A;  3DOK A;  4JI0 K;  4FZX C;  2RPI A;  2AA4 A;  4K43 A;  4DWI A;  4H4M A;  4NYF A;  4N47 A;  3OJU A;  3CJC A;  5AQG A;  1HPM A;  3BEX A;  3JAM O;  1WSG A;  5AQQ A;  5AFU H;  3QFU A;  2GUP A;  3KK1 A;  3CCV N;  4JS5 A;  3AO5 A;  3SJH A;  4JRQ A;  4FM1 A;  3CME N;  5EX5 A;  4V19 S;  3J7A P;  1LWC A;  1WSJ A;  2X74 A;  3TAN A;  1QSS A;  2A6A A;  4CJS A;  1KSP A;  2O8F A;  2YHW A;  4BR2 A;  4FLV A;  5AQU A;  4W5Q A;  2YJE A;  4E7K A;  3VF6 A;  1RT5 A;  2IOC A;  4O55 A;  4KO0 A;  1TAQ A;  5LJV A;  1N5Y A;  1EX4 A;  2FSN A;  3N4Q A;  1WAJ A;  3DWL A;  2OPP A;  1Q86 O;  3A5O C;  3DRS A;  3KK2 A;  4DLG A;  1HR0 K;  2IVP A;  1KFD A;  2G8F A;  4G1Q A;  3C6H A;  3A0I X;  1L3V A;  5DM6 L;  3T1H K;  5JS1 A;  3CQY A;  1VHX A;  4DQ8 A;  2ITM A;  4B8C A;  1U2V B;  5SWM A;  3DLG A;  4F2R A;  4EP4 A;  4EFH A;  4M3Y A;  4WFB L;  4BY9 C;  3TPQ A;  4CF2 A;  4CJ3 A;  1KAY A;  3DLR A;  4H0T B;  4DR6 K;  3V6D A;  4X65 K;  5GIN A;  3LDQ A;  4HCB A;  2DFE A;  4NCA A;  5DMR A;  4Z4H A;  3AAP A;  1C0M A;  3ZSQ A;  1ITG A;  4LD0 A;  4IWV A;  3GBT A;  3SQ2 A;  2E2Q A;  2PFU A;  5AQN A;  2A1R A;  2QWQ A;  1S1U A;  1NGG A;  2E8A A;  3BP8 A;  4E19 A;  5AZJ B;  1ZBU A;  4BRE A;  3GE1 A;  3VQE A;  4FJ9 A;  2E2O A;  2UYT A;  4I2P A;  2JWL A;  5F1X A;  1ILY A;  1SUQ A;  4JKG B;  4PL7 A;  1I39 A;  3FZL A;  3M6G A;  3U4L A;  5AZJ A;  4FCY A;  4Z94 A;  1JCF A;  3E01 A;  3CI5 A;  3CCJ N;  3ZEU A;  2X6S A;  5CYM A;  3LM9 A;  3AVB A;  2DPN A;  1FK9 A;  4Z4E A;  3PIP L;  4LSL A;  3SQ1 A;  1VQ7 N;  3ZLJ A;  2VWJ A;  2JWK A;  3OY9 A;  3VTI A;  2ITG A;  1RGI A;  4JHD A;  1RBT A;  3CFR A;  1VQ9 N;  3OYK A;  4CZI A;  1KFS A;  4EHU A;  2NRH A;  1S72 N;  4CJE A;  1Z6R A;  4CZE A;  2IIR A;  4CGH A;  4O4G A;  4H0V B;  3O9S A;  4CJ5 A;  3QNN A;  3S9H A;  5BPN A;  4JI3 K;  4B1Z A;  3WEE B;  4KB1 A;  3OYD A;  2P9K A;  3EO3 A;  4NLB A;  1MWK A;  1T05 A;  4CFB A;  2W6K A;  2HNY A;  2DFH A;  2PBD A;  3AA2 A;  3H1V X;  3BF1 A;  1E4F T;  2YNI A;  5AQO A;  4W5R A;  3KLG A;  2PYL A;  4B1Y B;  3HZ6 A;  2OPR A;  1NGF A;  5HRP A;  2PY5 A;  3ALY A;  3L2Q A;  2A42 A;  4BR7 A;  4BRG A;  4FJH A;  1LAV A;  3HJF A;  3O3F A;  3LDN A;  1W0H A;  3HOT A;  5HLF A;  3CMA N;  1GLL O;  2ZGY A;  1RNH A;  1VQ4 N;  1BCM A;  3AGR A;  2EX3 A;  3LWL A;  5JVH L;  2HNZ A;  3D2F A;  2E2P A;  3I55 N;  4I6M B;  1YTA A;  1NGE A;  4DR5 K;  1DT9 A;  4ID1 A;  2O8C B;  2HB5 A;  4CHZ A;  1SL1 A;  5BRH A;  3AA5 X;  2ZM6 K;  4E0D A;  1RDC A;  4R5P A;  4ICL A;  5C10 A;  3CXC M;  5C0Y A;  4BRD A;  3QFP A;  3Q7B A;  5AQF A;  1XC9 A;  5BPM A;  3ZSY A;  4CW7 B;  3VEO A;  1KVA A;  5C2D A;  1QZ6 A;  1S6P A;  3TTC A;  5AZI B;  3M8Q A;  4FWO A;  2G8H A;  5M1K A;  2P9P A;  1RT4 A;  3RSE A;  2X6N A;  4OLA A;  2NNW A;  4FXD A;  3THY A;  4GW6 A;  4U7B A;  5SZT A;  4BQZ A;  2YHY A;  2ZE2 A;  2UUA K;  3M8S A;  2GX9 A;  3O8M A;  3M1F A;  2FSK A;  4N5S A;  3KKR A;  1YT3 A;  3UKR B;  2XHB A;  1VSE A;  3IMX A;  1WB9 A;  2UUB K;  2WUS A;  4CJ7 A;  5BRD A;  5CE3 A;  1NWK A;  3DRP A;  4PKI A;  1V4T A;  3O80 A;  3NAE A;  4BRC A;  4IFV A;  3SQ0 A;  1HKB A;  3MXJ A;  4O0I A;  3UKR A;  4DUY K;  4DR4 K;  3J7Z O;  5C12 A;  3CJA A;  3VQ6 A;  4OLB A;  4AH9 A;  4QCL A;  4H5W A;  4KHQ A;  2VG5 A;  3RRG A;  2YV0 X;  3ZT2 A;  4YFU A;  3VGL A;  3RTV A;  4OVL A;  3OYI A;  3EYZ A;  4AM7 A;  5HBM A;  3C7N B;  4DB3 A;  2F7T A;  4FWS A;  2YNF A;  2QWO A;  3VF4 A;  3P38 A;  3HM9 A;  3DMJ A;  3HST B;  5AR0 A;  4DQR A;  2E6L A;  1Z25 A;  2HBL A;  2P9U A;  5HRR A;  1NJZ A;  4KRF A;  5H1S Q;  3D6R A;  1X9M A;  2NRV A;  2VG6 A;  4FK4 A;  4YOR A;  4NXN K;  1QHA A;  3VER A;  4GMJ B;  4OPK A;  2V7Z A;  3BF3 A;  2HND A;  4LFA K;  4CBW A;  3RR7 A;  1YIJ N;  2KZM A;  3HK2 A;  2ZD1 A;  4KHW A;  1VQN N;  4A2A A;  3VGM A;  1OH5 A;  3VES A;  3AVK A;  4FWQ A;  1OVY A;  4CZK A;  5BPL A;  1G15 A;  3KLI A;  4DTU A;  4JKA A;  4DHY A;  4I7F A;  2HHS A;  4Y1D A;  1YJW N;  4YHH K;  4A61 A;  3PLA A;  2P9S B;  3VQA A;  1U04 A;  4KTW A;  4MO5 A;  4CGG A;  3K2P A;  5GAD P;  3KLH A;  3PIO L;  3CPW M;  4LF5 K;  1RT6 A;  5I3U A;  4JKE A;  2OA8 A;  3I8D A;  2E5L K;  4BG9 A;  2HHU A;  3THX B;  2P5O A;  4FW2 A;  1NGD A;  4N56 A;  4DTR A;  4CES A;  4FPA A;  3OS2 A;  1NOY A;  3OHR A;  4F3T A;  1D5A A;  1GLD G;  3HT3 A;  4FJN A;  3VPZ A;  1Q8I A;  1Z05 A;  5FDL A;  3TR8 A;  2GEL A;  3LAK A;  4ISG A;  3C94 A;  4WE1 A; 
#chains in the Genus database with same CATH homology
 2P9P B;  3F5T A;  4BQL A;  1KAX A;  3RSE B;  1RDU A;  4MLE A;  4ISE A;  4YOT A;  3HI0 A;  4YOV A;  3O9T A;  3NVK A;  3MN6 A;  3DJC A;  1P90 A;  2CH5 A;  4K41 A;  3JXU A;  2RE2 A;  3F2K A;  5LJW A;  1GLE G;  1GLB G;  3GDQ A;  1XUP O;  2Q1N A;  1NGH A;  4KH5 A;  3ZET A;  2F9W A;  3NMU A;  3TSP A;  4BRA A;  3VEX A;  4K42 A;  2Q31 A;  3IFR A;  3H46 O;  3LDL A;  1BUP A;  3WXI A;  3KVG A;  3HRG A;  3AAQ A;  3DXM B;  3MK6 A;  1TUU A;  4BR4 A;  2Q36 A;  3R8E A;  3HSC A;  2CGJ A;  2P9N B;  3EKU A;  3MN5 A;  4GNI A;  1WUA A;  3SAF A;  1U2V A;  3QIC A;  1DEJ A;  1YIT N;  3HM8 A;  3U9Z A;  1JCE A;  1T44 A;  1GLA G;  4FWL A;  1S22 A;  2J4R A;  4CZM A;  4JK8 A;  1Y64 A;  4IZ9 A;  5TKW A;  5KPZ A;  3R9P A;  1JJ2 M;  2FF3 B;  3CHW A;  5GAH P;  2D0P A;  5FPN A;  4BRP A;  4C1N K;  1QVF M;  3R6M A;  4WFN L;  5KQ8 A;  3A5N C;  2NRW A;  5LY3 A;  2QW9 A;  3IDH A;  4Y0W A;  4BRQ A;  4FSV A;  1H1V A;  3SLC A;  3ATU A;  5AQY A;  3CC4 N;  3MMV A;  4H0O A;  2RHK A;  1Q18 A;  2HST A;  3CQX A;  2GWK A;  4H0X B;  4EHT A;  3O1B A;  3LDO A;  4JKB A;  3TU5 A;  4BR9 A;  2Q0R A;  3D7E O;  3UKU A;  3L4Q A;  1P8Z A;  4JK9 A;  4PKG A;  4QS9 A;  3G6E N;  5JIC A;  4BC2 A;  3U9D A;  1TYQ A;  3KZB A;  2IVO A;  3FZH A;  4ISF A;  2KKZ A;  2Q97 A;  3OBW A;  5KPT A;  4WQ5 C;  1D4X A;  3CCU N;  1QVG M;  4BRK A;  2P9U B;  4FVU A;  4K25 A;  3FFK B;  5JMV A;  4IOC L;  2NLX A;  2E2N A;  1YXQ A;  2P9L B;  2OTL N;  5EXW A;  5AQZ A;  4BC3 A;  2VWB A;  4WCE L;  3G4S N;  3DAW A;  4FWP A;  3O6W A;  1RDW X;  2NRX A;  1NGB A;  4PHT X;  1NJI O;  4YOU A;  3CER A;  1K8K B;  4JKG A;  1VQ5 N;  4IXC A;  4BRH A;  4B1W B;  5AQL A;  1OKJ A;  1V4S A;  5AQR A;  4BR5 A;  3U8X A;  2AA4 A;  4K43 A;  1XC3 A;  2OAN A;  4BRM A;  5JVG L;  3KHY A;  3CJC A;  4O8U A;  2AP1 A;  3RVC A;  5AQG A;  3K9K A;  5F0X A;  1HPM A;  3BEX A;  5AFU H;  2GTD A;  5AQQ A;  3QFU A;  5M1N A;  4DCH A;  2GUP A;  3CCV N;  4J8F A;  4WYB A;  1O13 A;  1Q7Y O;  3VET A;  4WQ4 A;  3SJH A;  5HL7 L;  4FOE A;  4YDU A;  4AF1 A;  3A5M C;  2E88 A;  3MN9 A;  3CME N;  2QWP A;  2Q0U A;  3Q7C A;  5EX5 A;  4BC4 A;  3H3N O;  3E9O A;  2QEX N;  3WEE A;  2A6A A;  3C6A A;  2QXL A;  5GIP A;  4A5A A;  4MDB A;  2YHW A;  2D1K A;  3W3D A;  4BR2 A;  5E84 A;  4H5N A;  5AFU A;  5AQU A;  2YJE A;  3ZX0 A;  3VF6 A;  4PL8 A;  5GAG P;  5AQT A;  3JS6 A;  5HOO A;  2FLO A;  5LJV A;  3KWG A;  4H5T A;  3UB5 A;  5JLH A;  2FSN A;  3TTF A;  3QBX A;  3ZX2 A;  3N4Q A;  4BC5 A;  3VEV A;  3DWL A;  4E1J A;  3VTH A;  1ZBS A;  1YJ9 N;  4CI6 A;  4CZH A;  3CJB A;  1Q86 O;  3MN7 A;  4JEP A;  3ZET B;  3A5O C;  4NLC A;  2D4W A;  5KQD A;  2IVP A;  3J8A A;  4BRF A;  4CZF A;  2KHO A;  1YF5 L;  3CPE A;  3FGU A;  1N8R O;  3G25 A;  1BU6 O;  4I6M A;  4IEI A;  1NGI A;  2GWJ A;  4QS8 A;  4BRI A;  4L3Q A;  4RTF D;  3C6H A;  1HJO A;  3A0I X;  1ATS A;  4BGA A;  5M1F A;  5DM6 L;  1K9M O;  3CQY A;  4YOX A;  4DQ8 A;  2ITM A;  1U2V B;  3CCS N;  2NRZ A;  2WC9 A;  4BRL A;  1BO5 O;  1ESV A;  2I7P A;  1IG8 A;  2ZJR L;  3TSQ A;  3GOI A;  4EFH A;  3TTD A;  3QBW A;  2HOE A;  3R3L A;  1MDU B;  4WFB L;  2BH1 A;  1G99 A;  1TUY A;  4FWR A;  5EOY A;  3VGK A;  3TPQ A;  4BY9 C;  3FE1 A;  4G9Z A;  1KAY A;  3MDQ A;  4H5R A;  4FOI A;  1R59 O;  4H0T B;  2QWN A;  4O5F A;  2ZWH A;  3IUC A;  3T69 A;  3LM2 A;  1T6D A;  3W0L A;  4DKW A;  2FXU A;  3VF2 A;  1M1K O;  3D2E A;  5EY4 A;  3VEN A;  3ZX3 A;  2NRR A;  3CET A;  4GY2 B;  5GIN A;  3LDQ A;  3FZF A;  5AZI A;  4XH5 A;  3A5L C;  3UKU B;  3DXK A;  1DGK N;  3AAP A;  4WQ4 C;  4IJN A;  1S3X A;  4YDU C;  1SAZ A;  3CCQ N;  2P9I A;  4FWK A;  1GLF O;  3L6Q A;  2H3G X;  4AM6 A;  1YHQ N;  3G71 N;  1TYQ B;  3P39 A;  3MX2 A;  1HX1 A;  5BN9 A;  4IWV A;  3WUH A;  4MLH A;  3GBT A;  1X3M A;  4JKC A;  1ZC6 A;  2E2Q A;  4OPA A;  5AQP A;  2NRT A;  2PFU A;  2NZT A;  3HTV A;  3L4I A;  5AQN A;  1BWF O;  2QWQ A;  1BDG A;  1NGG A;  2VGN A;  4BG8 A;  3HOS A;  2YHX A;  1C0F A;  2E8A A;  2W40 A;  2QWL A;  3BP8 A;  4CD3 A;  5AZJ B;  1QQM A;  4BRE A;  2ASP A;  3GE1 A;  2E2O A;  2UYT A;  5EVZ A;  2JWL A;  5F1X A;  1ILY A;  4FWN A;  5AQI A;  4CZL A;  4JK7 A;  4JKG B;  4PL7 A;  2V52 B;  1IJJ A;  4A57 A;  2QWR A;  3FZL A;  1KXP A;  3M6G A;  3U4L A;  5AZJ A;  4IOA L;  5GAE P;  4XEI A;  1JCF A;  4Z94 A;  3CI5 A;  1CZA N;  3KWI A;  2FSJ A;  3CCJ N;  3ZEU A;  3O9U A;  4CBX A;  3E9L A;  3AGK A;  4ILH A;  3LM9 A;  5AQM A;  2DPN A;  3F9M A;  5BRE A;  4GV3 A;  2CH6 A;  5AQH A;  3FZK A;  1HUX A;  2V7Y A;  3PIP L;  1VQ7 N;  2VCP A;  2HF3 A;  3KK7 A;  2BTF A;  2JWK A;  3O1W A;  3O4W A;  3VTI A;  5KPR A;  1RGI A;  3N4P A;  5ADX H;  4JHD A;  1VQ9 N;  4CZI A;  2YX6 A;  3C7N A;  4EHU A;  2NRH A;  5C2F A;  3CCM N;  1S72 N;  1J6Z A;  1W97 L;  1Z6R A;  4H5V A;  4CZE A;  2IIR A;  4B9Q A;  1JCG A;  1T6C A;  4H0V B;  3O9S A;  4JD2 B;  4R79 A;  2ZJQ L;  5BPN A;  3E9P A;  3IKM A;  4B1Z A;  3WEE B;  5BRF A;  3ENO A;  4NB4 A;  2P9K A;  3VEY A;  5GIO A;  1Q81 O;  1T3V A;  3EO3 A;  1MWK A;  4NLB A;  3B8A X;  5C15 A;  3SBG A;  1QZ5 A;  1SS6 A;  5MLC Q;  5AQX A;  2PBD A;  3H1V X;  3QDK A;  3BF1 A;  1E4F T;  1ZXO A;  3E1Y A;  1GLC G;  4JKD A;  4NO7 A;  5ADX A;  5AQO A;  4WFA L;  1YVN A;  4B1Y B;  4ILJ A;  3HZ6 A;  2HBJ A;  4JAX A;  1NGF A;  2QM1 A;  3WQT A;  4BVP A;  3ENB A;  3MWP A;  3LDP A;  3NVM A;  4A62 A;  1EO1 A;  4B1U B;  2A42 A;  4BR7 A;  4BRG A;  1BG3 A;  3A8Y A;  1K73 O;  3LDN A;  2W41 A;  3HOT A;  4OPH A;  1VQO N;  3CMA N;  1GLL O;  2ZGY A;  1VQ4 N;  4IO9 L;  4IJA A;  4M63 C;  3AGR A;  5M1P A;  2D0O A;  3QML A;  2HBM A;  4MO4 A;  5JVH L;  4C23 A;  3D2F A;  3SBT A;  2E2P A;  3BUZ B;  1VQL N;  4KH4 A;  3ULE A;  1HKC A;  2A3Z A;  5F2R A;  3VEW A;  3I55 N;  3OBY A;  4I6M B;  5M1O A;  1NGE A;  3EL2 A;  3FLC O;  1DT9 A;  3O9Q A;  3P4I A;  4M7X A;  4CD1 A;  2EWS A;  2I7N A;  2P9S A;  2ZF5 O;  1RFQ A;  1YJN N;  5BRH A;  2ASO A;  3SK3 A;  1WOQ A;  3CC2 N;  2YCH A;  3H45 C;  4HTL A;  1X3N A;  3WT0 A;  4A5B A;  4KH6 A;  4IFE A;  5C10 A;  3CXC M;  1QQO A;  5C0Y A;  4JKH A;  4BRD A;  3QFP A;  3CD6 N;  1ATR A;  3Q7B A;  2HF4 A;  4QS7 A;  1LCU A;  5AQF A;  4FWM A;  3DLL L;  5BPM A;  2V51 B;  3P31 A;  5AQJ A;  2VGM A;  4H0P A;  2YJF A;  3AY9 A;  4FPB A;  3EZW A;  4JNE A;  3VEO A;  4BRN A;  4EIA A;  1NBW A;  5C2D A;  4A59 A;  3CCE N;  3ATV A;  1QZ6 A;  2HBK A;  3D2E B;  3WXK A;  3TTC A;  4F9O A;  1BA1 A;  5AZI B;  4FWO A;  4JD2 A;  1VQ8 N;  4BVO A;  5M1K A;  2P9P A;  3DXK B;  5BN8 A;  3RSE A;  2P9I B;  3EE8 A;  4LC9 B;  1VQK N;  3C0B A;  3EE9 A;  1YUW A;  2ZGZ A;  4U67 L;  1W2B M;  1VQ6 N;  1NMD A;  2NNW A;  1M90 O;  5JLF A;  2F9T A;  4U7B A;  3LL3 A;  4BQZ A;  5CHI A;  2BUP A;  2YHY A;  3CJ7 A;  2HMP A;  2QWM A;  3CIP A;  4RWT A;  3MX5 A;  3WXM B;  1KQS M;  5DM7 L;  2GX9 A;  2QA4 N;  3O8M A;  3M1F A;  2FSK A;  1YI2 N;  4BRO A;  3O08 A;  3DXM A;  2YI1 A;  3L0Q A;  5ELZ A;  3ZYY X;  4UY8 O;  1EQY A;  1SQK A;  3K9J A;  3UKR B;  1QQN A;  3ENH A;  3IMX A;  2ZJP L;  2WUS A;  4CJ7 A;  2P9N A;  5BRD A;  3MCP A;  3CF5 L;  5CE3 A;  1NWK A;  4PKI A;  1K8A O;  1V4T A;  3O80 A;  1MWM A;  3H1Q A;  4BRC A;  1MA9 B;  3H3O B;  3AAR A;  3FR0 A;  1HKB A;  1X9J A;  3O9R A;  1VQP N;  3ZEU B;  2E1Z A;  3UKR A;  3I56 N;  3J7Z O;  1KAZ A;  5AQS A;  5C12 A;  3CJA A;  4FO0 A;  4A2B A;  3OW2 M;  4H5W A;  1NM1 A;  4CZJ A;  3E66 A;  1NGJ A;  5FPM A;  4GVE A;  3VGL A;  2WBN A;  4JHD B;  2Q2R A;  3UE5 A;  2FF6 A;  4IO8 A;  5AQK A;  4AM7 A;  4B1X B;  3C7N B;  4CBU A;  4DB3 A;  2A41 A;  3GL1 A;  5AQV A;  3WXJ A;  2F7T A;  4YOW A;  1HKG A;  4FWS A;  3ID8 A;  3VF4 A;  2QWO A;  3CJ1 A;  3ID6 A;  2VYP A;  2QTD A;  3FZM A;  4MDA A;  3P38 A;  2E20 A;  1HLU A;  2P9K B;  2ASM A;  5E26 A;  3EKS A;  5AR0 A;  3VEZ A;  4JKF A;  2OTJ N;  2WFB A;  3M5R A;  2HBL A;  2P9U A;  3M3Z A;  3CCR N;  4B1V A;  5AQW A;  2CGK A;  2PAV A;  2CGL A;  1U6Z A;  1VAZ A;  3H6E A;  4IEE A;  4IOX A;  5H1S Q;  3D6R A;  2P9L A;  1KD1 O;  2NRV A;  2QI2 A;  4YOR A;  3O5B A;  4JN4 A;  1QHA A;  3VER A;  2V7Z A;  3BF3 A;  4YOY A;  4RCH A;  3MWT A;  3OA9 A;  3VOV A;  4CBW A;  1VQM N;  5TKY A;  1YIJ N;  3I8B A;  1KC8 O;  1NLV A;  3SMP A;  3WQU A;  4O8K A;  3C65 A;  1VQN N;  4ILG B;  4A2A A;  5BR9 A;  1K8K A;  1YAG A;  3VGM A;  1C0G A;  3VES A;  4FWQ A;  3VMF B;  1OVY A;  4CZK A;  4H0Y B;  5BPL A;  4BR0 A;  3QB0 A;  3D2F B;  3HBT A;  4JKA A;  5FPD A;  4DHY A;  3ULE B;  1LOT B;  1YJW N;  3SMS A;  4WF9 L;  3CCL N;  4A61 A;  1GLJ O;  1Q82 O;  4M7Y A;  3PLA A;  2P9S B;  3R1X A;  4MO5 A;  1NGA A;  2A5X A;  3SAG A;  1DKG D;  4GV6 A;  5GAD P;  3PIO L;  1BA0 A;  3CPW M;  4OO1 J;  4JKE A;  4HWI A;  3EN9 A;  1E4G T;  3SAH A;  5CR4 A;  4BG9 A;  4CZG A;  2E1Y A;  1NGD A;  3I33 A;  5B8H A;  4WQ5 A;  4XH4 A;  3WXL A;  5FPE A;  4C1N I;  5M1Q A;  1BOT O;  4FL9 A;  4PKH A;  3CJ9 A;  2IVN A;  4FPA A;  3GG4 A;  1NGC A;  4KBO A;  1SZ2 A;  1ATN A;  4EAH D;  4XH1 A;  2A40 A;  2GEM A;  3OHR A;  1GLD G;  3T7Z A;  4BGB A;  3TSU A;  3VPZ A;  1Z05 A;  3S41 A;  1XQS C;  3CC7 N;  4GV9 A;  2GEL A;  4IDH A;  5I9E B;  4ISG A;  4H03 B;  3MCA B;  2KLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...