4BRDA

Legionella pneumophila ntpdase1 q193e crystal form ii, closed, mg amppnp complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVEIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 119
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brdA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brdA02
3HSCA 4NB4A 2BTFA 1P8ZA 3A5MC 3FE1A 3VEOA 4A2AA 3CJ7A 3EN9A 3FLCO 3WEEB 2BUPA 2Q0UA 2P9KB 3U9ZA 3MCPA 4BREA 2E2PA 4BRCA 2J4RA 2P9LB 3QBWA 2E1YA 4FSVA 2E2NA 2F9WA 3WT0A 4CZJA 2YHWA 1HKCA 4WQ4C 4FWKA 3ATUA 4AM6A 2ITMA 2HF4A 3M6GA 1IG8A 3A8YA 3D7EO 3L0QA 1ZBSA 2E8AA 3DJCA 4M63C 3RSEB 3JXUA 4PL8A 4H5RA 4HWIA 4CD1A 4K25A 3VETA 2QWMA 3VF4A 1XUPO 3H3NO 2P9NB 2PAVA 4BRDA 2FSKA 2QWRA 5AZJB 1GLDG 2AA4A 4BRAA 5AQVA 3P4IA 4BGBA 3UB5A 5I9EB 2CH5A 2YJEA 3O8MA 5JLFA 3UKRB 2D0PA 3ENHA 3WXLA 5FPDA 3ENOA 2A40A 1U2VB 4K43A 4CZMA 2UYTA 5AQSA 3O4WA 1NWKA 4F9OA 4FPBA 1MWKA 4BR9A 3WXJA 1BA1A 4GY2B 1EQYA 3DXMA 3ULEA 4NO7A 4RTFD 5LJVA 3EKSA 2YJFA 2Q1NA 1GLAG 2W41A 5AQQA 1QZ6A 4PKHA 2A41A 2Q2RA 3H3OB 4WQ4A 1RFQA 2P9IB 4BRQA 3AAQA 1U6ZA 4CBWA 3A5LC 3FFKB 5ELZA 1E4GT 1LCUA 3BF3A 1RGIA 2D0OA 1MWMA 5AR0A 1JCFA 4FOEA 4CZGA 4AM7A 1T44A 2VCPA 4FWQA 2V7YA 4FWSA 3VESA 4ISEA 3FZLA 1X3NA 5KPZA 4CZKA 4BR0A 1BO5O 4BG9A 3R9PA 4H0VB 4H5WA 4BG8A 4BVPA 3UKUB 3VGMA 3HZ6A 5KQDA 1SZ2A 4JHDA 1Q18A 4BGAA 3AARA 3FGUA 1XQSC 3FZKA 4EFHA 5AZIA 2IVNA 3QICA 3VF6A 1Z05A 1QZ5A 4BR4A 3SK3A 1LOTB 4FWRA 1G99A 2FXUA 1BWFO 3ID8A 1NLVA 4RWTA 3A5OC 3GBTA 4DCHA 4DHYA 2GTDA 2ZGZA 3SLCA 3CJCA 3F9MA 5EXWA 5ADXH 2QWLA 1GLLO 4BR2A 3WUHA 1NGGA 4XH5A 1ATNA 2E2QA 1MA9B 5TKYA 2NRHA 2YHXA 5EOYA 3U9DA 2FLOA 5KPRA 5BRDA 3DWLA 4EIAA 1GLJO 2E2OA 4BC5A 2VWBA 3GOIA 4Y0WA 1X9JA 1HPMA 4BRFA 5AFUH 1R59O 4JAXA 4BVOA 1ATRA 4B1ZA 3DXMB 3ULEB 5FPMA 1SAZA 2IIRA 4LC9B 1C0GA 5AQKA 3DXKA 3CI5A 1HUXA 4MLHA 4B1WB 3CJBA 4YDUC 5ADXA 2H3GX 2FF6A 3VEYA 4ISFA 3MDQA 1NGFA 3VEWA 2D4WA 4JNEA 2I7NA 1NGIA 4CZEA 1JCEA 3GL1A 1GLCG 5AQTA 1XC3A 5AQOA 3MN7A 2V52B 5EVZA 3QMLA 3IMXA 4GNIA 3GG4A 4IJNA 4JN4A 1E4FT 4BRLA 2ZF5O 1DEJA 3HI0A 5AFUA 3VGLA 3R6MA 3M1FA 2V7ZA 2FF3B 2E20A 3D2FA 4JHDB 4BRIA 1C0FA 2QM1A 4H0XB 2ASOA 4BRPA 3MN6A 2GUPA 5AQIA 5AZIB 3ATVA 3UE5A 2PBDA 4B1VA 3O80A 5E26A 3LM2A 4YDUA 3ZX0A 1BA0A 4IZ9A 4HTLA 4MO4A 1YXQA 1NGAA 3CQXA 4MLEA 3ZEUA 3LM9A 1ZXOA 3O5BA 1NGEA 1Y64A 5BPMA 3IUCA 3C0BA 4WQ5C 1WUAA 3VPZA 4EHTA 3CERA 2I7PA 1K8KA 3B8AX 2A5XA 2FSJA 3H6EA 3WXKA 5AQHA 3LDQA 4ISGA 2ASMA 4XH4A 3SMPA 3ZX3A 1KAZA 1CZAN 2YHYA 2DPNA 4O8KA 3BP8A 3QDKA 4BRGA 1IJJA 3VOVA 1OKJA 3O08A 3CHWA 2E1ZA 4IWVA 3QFPA 3CQYA 2ZGYA 4FWLA 3WQTA 1NBWA 5AQYA 2NZTA 5AQPA 5BRFA 1GLEG 1HJOA 5FPEA 1NGCA 3J8AA 3VEXA 4I6MA 4QS8A 3DXKB 2HF3A 1GLBG 4BRMA 2Q0RA 4DQ8A 1BOTO 1KAXA 2P9SA 3H1QA 4MO5A 1X3MA 2QWPA 5AQRA 5BREA 1JCGA 3CJ9A 4CI6A 1BG3A 1TUYA 4WQ5A 5BPNA 1SQKA 2HMPA 4FWOA 4BC4A 4FL9A 3HBTA 4DB3A 4PL7A 3BF1A 4CZHA 3BUZB 3O1BA 4BQLA 4H0YB 3AAPA 3HM8A 1NMDA 2CGKA 4CZFA 2YCHA 5FPNA 1T6CA 1YUWA 4FO0A 5EX5A 4H0TB 4WYBA 2V51B 1NGJA 1V4TA 3D2FB 4PKGA 1GLFO 1QQMA 3EKUA 1T6DA 3FZFA 3VF2A 1V4SA 3U8XA 2P9UA 1NGDA 5LJWA 3KHYA 4J8FA 1MDUB 1ESVA 3D2EA 2HOEA 4BR7A 4IO8A 1DKGD 3S41A 1TUUA 1QHAA 2YI1A 5AQXA 2GEMA 3G25A 3GE1A 3HTVA 4CBUA 4Z94A 1YAGA 3LDLA 2GELA 4BRNA 3QB0A 3ZEUB 1HKBA 2GWKA 5AQUA 4FWNA 4B1YB 4B1XB 4H0OA 5AQNA 1TYQA 2CGJA 2A3ZA 3EO3A 5B8HA 3ZETA 1H1VA 5KPTA 1K8KB 2Q36A 3LDPA 3AY9A 1BDGA 2QWOA 4BC2A 3BEXA 3MN5A 3KZBA 4PKIA 4CJ7A 3M3ZA 3I8BA 4FWMA 1ZC6A 3FR0A 3A5NC 4BQZA 4H5NA 3H45C 3SMSA 4XH1A 2EWSA 4RCHA 2ASPA 2QWNA 5AQMA 3EZWA 3I33A 4H03B 3VEZA 1BUPA 1KXPA 2KHOA 3W0LA 5F1XA 5BPLA 4BC3A 4JD2A 4K41A 4M7XA 2A6AA 5AQLA 4CZIA 3LDNA 3CIPA 3EL2A 3C7NA 4I6MB 2GWJA 2P9PA 4BRHA 3O6WA 4QS7A 3KVGA 4QS9A 2P9SB 1HKGA 5JMVA 1QQNA 4CD3A 1HX1A 1NGBA 3VEVA 2E88A 3U4LA 2CH6A 4L3QA 4O5FA 5JICA 5CE3A 3JS6A 2A42A 3LL3A 1KAYA 4C23A 1YVNA 3W3DA 5F2RA 3L4IA 3WEEA 3TPQA 5BN8A 2IVOA 3MN9A 2P9KA 3VENA 1DGKN 3TU5A 5BRHA 4B9QA 4IXCA 4E1JA 2P9LA 3L6QA 2P9UB 1NGHA 1BU6O 4CZLA 3D2EB 5AQGA 4IJAA 3QBXA 2NLXA 3WXIA 1D4XA 2Q31A 3CJ1A 2W40A 3OHRA 3RSEA 1Z6RA 4H0PA 4M7YA 2P9NA 3QFUA 4B1UB 4BR5A 5AZJA 5BN9A 3A0IX 2WUSA 2FSNA 2VYPA 4EHUA 3FZHA 5E84A 2OANA 5EY4A 3CETA 4EAHD 5LY3A 1TYQB 4BRKA 5AQJA 3UKRA 2QW9A 1J6ZA 1ATSA 2IVPA 4K42A 5AQWA 2QWQA 2QXLA 3ZETB 1U2VA 3SJHA 2F9TA 1NM1A 3WQUA 3IDHA 3H1VX 3IFRA 5KQ8A 5AQZA 4FWPA 3VGKA 2CGLA 3FZMA 1S3XA 4H5VA 4FPAA 2P9IA 3R8EA 3MMVA 4A2BA 4KBOA 4JD2B 5BR9A 2AP1A 5AQFA 4A62A 2Q97A 4BROA 4XEIA 3C7NB 1HLUA 2ZWHA 2P9PB 3GDQA 3VERA 1QQOA 3CJAA 1RDWX 3ZX2A 3MK6A 3LDOA 3O1WA 4FOIA 5F0XA 5JLHA 3DAWA 3UKUA 4CBXA 1WOQA 3H46O 4H5TA 4A61A 1S22A 2D1KA
chains in the Genus database with same CATH superfamily
4NB4A 4E0DA 4IEEA 3A5MC 1T3VA 4W5RA 2YV0X 3EN9A 2Q0UA 4CIFA 4CHNA 5CYQA 4BREA 3C6UA 4BRCA 1NJXA 2J4RA 4M45A 3QBWA 3P5JA 4ELTA 3VQ7A 4FJLA 2YHWA 4AM6A 4WQ4C 3QIPA 1IKVA 4O0IA 4JI0K 1ZBSA 4CD1A 4JI4K 3H3NO 2QKBA 2FSKA 2QWRA 5AZJB 4C8LA 3VTIA 3HK2A 4BGBA 5I9EB 1YHQN 2YJEA 3CCMN 4BDZA 1QVGM 3OYFA 2G8VA 4BY9C 4K43A 4CZMA 4CFAA 4RW6A 5HRPA 3OYJA 1C6VA 3NGIA 4J2DA 1L3UA 1VQMN 2ZJRL 3TABA 2O8CA 4YOUA 2Q1NA 3TSUA 3ZYYX 4NYFA 4KHSA 4CGFA 3ZLJA 4AF1A 1I3AA 3H3OB 1RFQA 3M8RA 4YY3K 1GOCA 4DF8A 4DU1A 3FFKB 4B9SA 2A1SA 5ELZA 1E4GT 3E01A 1D5AA 1TL3A 1RGIA 5AR0A 4DFMA 1TL1A 3C65A 3VN5A 4CZGA 3PX0A 1K73O 5KPZA 1X3NA 4CJWA 3LALA 4KO0A 4BG8A 1EX4A 3UKUB 5LMNK 4W5TA 2P5GA 1SZ2A 1Q18A 4BGAA 3AARA 1CXQA 3QEIA 1VSLA 2PZSA 3VQPA 5IWAK 1Z05A 4MQ3A 4BR4A 1LOTB 3RR8A 1BWFO 1S1WA 3ID8A 3ENBA 4DV5K 1YJ9N 5M1PA 3SLCA 3T1HK 3F9MA 5EXWA 4PHTX 3THWA 1GLLO 1KRPA 2YNHA 2VWJA 3WUHA 4LF9K 4YORA 5TKYA 4ZHRA 2NRHA 3OYBA 3IKMA 5KPRA 3LANA 2D0AA 5BRDA 5CYMA 5C2FA 3B6PA 2E2OA 3DM2A 3E66A 4JS4A 3GOIA 1X9JA 5HRNA 4CJTA 2KW4A 3N4QA 3ITHA 1ATRA 3DXMB 1S9GA 1LAVA 4CF2A 1SAZA 3V9UA 5AQKA 3DXKA 3CI5A 3F2KA 4B1WB 4CGIA 1NU0A 2VGNA 4NXNK 3IAYA 2YX6A 2WONA 1SL1A 3KKRA 3T3FA 1JCEA 5KTQA 1VQPN 2P51A 5AQOA 4FJMA 2V52B 1VSDA 1HYVA 1VQ9N 3Q7CA 4IDHA 3ULDA 2ZF5O 3THXB 1NK5A 4CJLA 1TGOA 3OBWA 4CEQA 2FF3B 3KLHA 3AGKA 1IBLK 3S9HA 4JHDB 2HHXA 4CJQA 4B8CA 2ASOA 2FBYA 2QK9A 3MWTA 4JKCA 5AQIA 2NRVA 4PUOA 5E26A 5C12A 1TK5A 4YDUA 4DQRA 4IG3A 5HL7L 4DLEA 1UA0A 2NRRA 1SS6A 3RWUA 1NGAA 3SV4A 4MLEA 4KB1A 1HQEA 3CFRA 1NGEA 2GBZA 4KHUA 5BPMA 4YFUA 4OPAA 1HNVA 4JI1K 3K5MA 3SAFA 4N76A 1K8KA 2OPSA 3B8AX 1Q81O 3WXKA 4FLVA 3IRXA 4JI8K 4O8KA 1JLGA 1OH8A 4CK1A 1RDUA 1KFSA 2E1ZA 1J5OA 3E1YA 1RT5A 4FJNA 1OVYA 4RW8A 5BRFA 3K58A 2F4VK 3SI6A 4GV9A 3HP9A 1HR0K 2QWPA 3NGZA 3S3MA 5J2NA 4WQ5A 5BPNA 2O8FB 1SQKA 3O9TA 3TAMA 4KHNA 4FLXA 4FL9A 3HBTA 4DB3A 1A5VA 3HPOA 4CZHA 3BUZB 1BQMA 2KTQA 2Z1JA 2CGKA 3VQ8A 4KAZA 3NE6A 4FO0A 3O4NA 3G4SN 4DLGA 4JI7K 3K5OA 2V51B 4OPJA 4CJEA 3VF2A 1V4SA 1NKEA 2NRWA 3U8XA 3V4IA 3VQ4A 4J8FA 2ZQBA 4R79A 1ESVA 3K57A 1T03A 3OYAA 4F3TA 1QHAA 3PO4A 4DTJA 1HPZA 4C8NA 2G8UA 4EP5A 4DFKA 2YI1A 3T1YK 1N8RO 4B9TA 3HTVA 3V9XA 1X1PA 4BRNA 3QB0A 1YJWN 3AVMA 3NAEA 1LW0A 1S72N 5KPTA 1S1XA 4Z4HA 4JI3K 1BDGA 2QWOA 5DK5A 4RW7A 3MXIA 3MN5A 5I42A 3KZBA 4CJ7A 2HBLA 3I8BA 1M1KO 3VQ5A 1ZC6A 2UU9K 4M42A 1ZBFA 4JK8A 1QSSA 3KD1E 4FJ7A 1REVA 3I33A 3VEZA 1YT3A 3KD5E 4CEFA 5DM7L 5BPLA 4BC3A 2Y1JA 1IKWA 4K41A 2A6AA 3G10A 4JRQA 2P9PA 4FJKA 4BRHA 4DR7K 4QS7A 2P9SB 5CHIA 3I8DA 4B8AB 1KCFA 5LL6Z 4DV6K 1UAXA 3U4LA 2CH6A 3CF5L 4A5BA 5C2DA 2D0BA 4O5FA 5CY4A 4X65K 3LAMA 4M41A 1WBDA 2YHAA 1B92A 3AVBA 3SPYA 5F2RA 3WEEA 4CK2A 4KHQA 1RT2A 1DGKN 3TU5A 4DR2K 2UUBK 3V9WA 1I94K 2IGIA 4FW2A 1JLFA 2NLXA 3WXIA 2Q31A 3OHRA 4WFBL 3OYMA 4M7YA 3OY9A 4B1UB 4F3OA 4EHUA 3FZHA 5E84A 4CF8A 3CETA 4BRKA 5AQJA 3UKRA 5AQWA 4DFPA 3T1AA 4CGDA 3O3FA 3SJHA 5AJ3K 3C6TA 4CF0A 1JKHA 2HSTA 3HYFA 3IDHA 1ZBIA 1U04A 4CJKA 3RMCA 1U48A 1RT7A 3DLBA 4FWPA 4PA1A 3VGKA 3O3GA 4CGHA 3FZMA 4FPAA 3R8EA 3MMVA 4KBOA 1TKDA 4DTOA 1QVFM 2PYLA 2OZMA 4BACA 3AO1A 5BR9A 1K9MO 3PIOL 5AQFA 4A62A 4DSJA 1B9DA 3TAFA 1HMVA 2ZWHA 3JYTA 3PUFA 4JK7A 3C95A 3CJAA 4H4MA 3D45A 3MK6A 1S6QA 2OPPA 2I5JA 3SUOA 3TTFA 3OW2M 2UUAK 2E5LK 5AQYA 3CYMA 2BTFA 4JKHA 1P8ZA 2Z1IA 4DQPA 1RCHA 5GADP 2Q3SA 3VEOA 2BGGA 3CJ7A 1TK8A 3J7AP 2BUPA 2O8DB 1BI4A 3MCPA 4O55A 4CJ5A 2E2PA 2P9LB 3ISNC 3N4PA 3O9QA 4WE1A 3WT0A 1RBTA 1HNIA 1RDDA 3M6GA 1IG8A 3G0ZA 4N5SA 1JL2A 2E8AA 3DJCA 1Q7YO 4H5RA 4HWIA 3DI6A 2QWMA 3VF4A 3MCAB 4BRDA 1D9FA 4KPYA 2E6LA 1FK9A 4I2PA 2AA4A 3JAMO 1Q9YA 3UB5A 4ELVA 1VHXA 4OO1J 3WXLA 5FPDA 5GIOA 1U2VB 3CFPA 1DTTA 3O4WA 3SAHA 3SQ0A 1MWKA 4BR9A 4FLZA 4AQYK 3SQ2A 3ULEA 3V1OA 1W2BM 4RTFD 3J7YP 3OYGA 3EZ5A 4DQIA 2YHBA 1P90A 2A41A 3CCUN 3SQ4A 4K8XA 4KREA 3L2UA 1U6ZA 4CBWA 4OPKA 3A5LC 1XC9A 4CJRA 1IG9A 1LCUA 1MWMA 1YITN 4FOEA 3ZSOA 4AM7A 3VQQA 2VCPA 4FWQA 1KC8O 2V7YA 3AVIA 1WNSA 4ISEA 4C8KA 3NF9A 4BR0A 4Z4GA 4B9MA 1C1CA 4DTUA 4DR6K 4BVPA 3VGMA 1J53A 4KTWA 3G6EN 3QERA 4H4OA 4LH5A 3FGUA 1NJYA 1OH5A 3FZKA 4EFHA 4E7HA 2IVNA 1X9WA 4BE0A 4N47A 4AHUA 1WBBA 4DR1K 1G99A 2FXUA 1OH7A 5HOOA 1NLVA 3NHGA 3A5OC 4DHYA 2GTDA 3TSQA 4U67L 1XHXA 2ZJQL 3CJCA 3VQ9A 5JS1A 2YKNA 3ZSVA 4CJ4A 5BR8K 4XIUA 2AJQA 1TK0A 4CIEA 2F8TA 1VSEA 4NYNA 2YHXA 3U9DA 3IG1A 1VQNN 3TR8A 4CVNE 2NRXA 5C24A 1JLEA 2X6SA 3HSTB 1S1UA 2KKZA 1HPMA 1R59O 3K2PA 3LPTA 3CXCM 2KZZA 1VSFA 3NGYA 3CG7A 3VTHA 3QO9A 2O8CB 2HBMA 5GIPA 1T8EA 1HQUA 3K5NA 4HUEA 3HOSA 4KH6A 2IIRA 1C0GA 5M1NA 3EYZA 3AGRA 1HUXA 2KQ2A 1NJWA 4CW7B 3MXMA 1Z26A 4YDUC 1LV5A 2FBVA 3VEWA 1HJRA 1XNRK 2I7NA 4IDKA 4CZEA 1RDBA 3CCRN 2O8BA 1GLCG 3SUQA 5EVZA 4IJNA 4BRLA 3MEGA 2OPQA 3OYCA 3QEVA 2HVHA 2HB5A 2VG7A 3M1FA 3L2RA 2OYQA 3D2FA 1VK0A 3E9LA 4B9LA 3VQAA 3NF7A 1C0FA 4N41A 3T69A 4BRPA 3MN6A 1NK0A 3ATVA 4PQUA 3O80A 1SV5A 4DWIA 1EKEA 1W0HA 3ZX0A 1BA0A 4HTLA 3TANA 3SYZA 2XHBA 4DG1A 3L8BA 5FDLA 4ZTFA 1Y64A 3THWB 3RVCA 1NG9A 3IUCA 1SKWA 1HNWK 3O9RA 4WQ5C 2JGUA 3VPZA 3CERA 1SKRA 3EEQA 2I7PA 5K14A 2HNYA 3NBPA 2UUCK 3DOLA 4FYDA 2A5XA 3LDQA 1RTDA 1BGXT 3LZIA 3TTCA 3BP8A 3QDKA 4BRGA 2KZMA 3KLEA 3CHWA 4IWVA 3QFPA 4CFCA 5C25A 1ZBHA 1UWBA 3CCSN 3R1XA 1RTIA 3AVNA 1HJOA 3MEDA 1NGCA 3J8AA 5JVHL 3VEXA 4KHWA 3DXKB 2HF3A 1GLBG 3MECA 4DQ8A 1BOTO 1KAXA 4MO5A 5AQRA 2HHTA 4CGJA 2RF2A 3CJ9A 1BG3A 1GOAA 3KLIA 2PY5A 1C1AA 4IOXA 2YNFA 3AVLA 3NVMA 4BC4A 4E1MA 4FJ9A 4CZFA 4FVUA 1FW6A 1YUWA 5EX5A 4WYBA 1NGJA 4CHYA 1NMNA 1RTJA 4OKEA 3FZFA 2P9UA 1NGDA 5LJWA 4FK2A 4O0JA 4R5PA 3EE9A 3S41A 4RG8A 1TUUA 4DMNA 3H08A 3KLFA 3DLLL 4HCCA 3GE1A 1YAGA 1XMOK 4IFVA 4DV0K 1HKBA 1DT9A 2GWKA 3V1QA 4EZ6A 5C42A 3SQ1A 1C0TA 1KSPA 2A3ZA 1NK4A 5B8HA 1SKSA 3ZETA 3LZJA 1K8KB 4GV3A 4BC2A 4DTNA 3AA2A 3AVKA 3WXMB 1VQON 4M3TA 1BQNA 4BQZA 5C10A 4KHPK 3H45C 3OTOK 3SMSA 1QS4A 4NLCA 4RCHA 4FLYA 4MDBA 2G8FA 1QE1A 4KFBA 5F1XA 2KHOA 3W0LA 4C1NI 4B3MK 3KWGA 3KWIA 3MWPA 5CZ2A 3LDNA 3PSIA 3C7NA 3OS1A 4CJVA 3HP6A 2RKIA 4L8RB 2E6MA 3AVHA 3KVGA 4QS9A 3VMFB 5JMVA 1YJNN 1I39A 4CD3A 1HX1A 5FLXO 3D6RA 4LFAK 4KHYA 4FJ8A 2GUIA 5KGWA 4B08A 2HMIA 1C0UA 3JS6A 4PY5A 1KAYA 4DQQA 4KTZA 1JLBA 3U6FA 3P83D 4J2BA 3L4IA 5BN8A 2P9KA 1TAUA 5A2QO 3ZSYA 4B9VA 4B9QA 3HPGA 3L6QA 5SZTA 2BDPA 3AO2A 2ZJPL 4CZLA 1S9EA 4IJAA 1WSGA 1VQKN 1D4XA 1NK7A 1XI1A 3CJ1A 2DTUA 3RSEA 5GAGP 4KH4A 1D9DA 4B9UA 1N6QA 2P9NA 3OBYA 3QFUA 2X6NA 3A0IX 3E9OA 5EY4A 2HNDA 1BHLA 4EAHD 5LY3A 4DTPA 2QW9A 4MDAA 1J6ZA 4K42A 4I9QA 3RRHA 4CEZA 3O3HA 3ZSQA 3WQUA 4CFBA 3H1VX 2VQEK 1JLAA 2PYJA 4NCGA 4C1NK 4JKAA 3EY1A 1KFDA 5CZ1A 4A57A 3OYDA 1S3XA 4CJPA 4H5VA 2P9IA 4A2BA 2P1JA 5GAEP 2BH1A 3HPHA 5C0YA 3OJUA 4BROA 4LF6K 4WCEL 2P9PB 1L3TA 2X78A 3ZSZA 4E1NA 1QQOA 4ILHA 4CGGA 3KKSA 1DTQA 5JLHA 3DAWA 3Q7BA 3QNNA 1WOQA 4OGEA 1S22A 2F8SA 1Z25A 3HSCA 4FK4A 3NMUA 1EETA 3FE1A 3QETA 4A2AA 3WEEB 3DLEA 3CCJN 3U9ZA 4ZTJA 1CZBA 1X9MA 3V81A 4LF7K 4FM1A 5T7BA 1HYZA 4M3XA 4FSVA 1Q9XA 2E2NA 2F9WA 3E9PA 4CZJA 1HNZK 1BL3A 4B3TK 4DU3A 1HKCA 4FWKA 3ATUA 4OKKA 4CEEA 3A8YA 4LF4K 3L0QA 2O8EA 4M63C 4PL8A 1U49A 3O9UA 4K25A 3VETA 1XUPO 4F2RA 2OZSA 4QCLA 4O5BA 4IEIA 3FFIA 5AQVA 3P4IA 3THYA 5JLFA 2HW3A 3UKRB 4J2AA 3BZKA 2HHVA 3ENHA 1ZYQA 3V6DA 1G15A 3ENOA 3BY5A 2UYTA 5AQSA 1JLCA 1NWKA 4F9OA 4FPBA 3ZSRA 4Q0BA 1ZBLA 1XNQK 4GY2B 1EQYA 4CF1A 1GLAG 2W41A 3PV8A 1QZ6A 3B6OA 4PKHA 2EHGA 5SWMA 2Q2RA 4JKDA 4RW4A 1XMQK 4OVLA 4M3UA 2HBJA 5MLCQ 3CPEA 1D8YA 3IS9A 1CZ9A 3BF3A 1YI2N 3HL8A 4FVMA 2HHUA 4N56A 4DSFA 3PX4A 4KI4A 1TKXA 1TKZA 3R3LA 3VESA 4FJHA 1RILA 1X9SA 1BO5O 4H0VB 5J2PA 3K59A 4JKBA 2HVIA 3HZ6A 4YOYA 2B5JA 3VQBA 5FRMA 2G8HA 2HNZA 3OYEA 4DTMA 3SUNA 1BI4B 5AZIA 4CCHA 3DRSA 3VF6A 1IH7A 3SK3A 3WNHA 3K5LA 2YKMA 4FWRA 4CK3A 1KVAA 4DR4K 3MAQA 3GBTA 4OLAA 1BIZA 5M1FA 4G1QA 2E4LA 4NLBA 1WSJA 4GVEA 4BR2A 4DS5A 1NGGA 4YOXA 4XH5A 1BCMA 4CECA 3CMEN 3AVAA 4JKEA 5HBMA 4FK0A 1C1BA 3DWLA 4EIAA 1GLJO 1NOYA 1ASUA 1TAQA 4BC5A 3OS0A 3LP1A 2VWBA 4I9LA 1RT4A 4Y0WA 3HXMA 1NK6A 2QXFA 1M90O 5KI6A 1JL1A 4JAXA 4BVOA 3TTDA 4DSLA 4W5QA 4HUFA 3ULEB 4JKFA 4X64K 3NCIA 4CFDA 3DRPA 4LC9B 2VG5A 3CCEN 4MLHA 3CJBA 4J2EA 2Z1HA 2H3GX 1RT6A 4BDPA 2FF6A 4ISFA 3MDQA 1NGFA 2D4WA 4JNEA 1NGIA 3L3UA 3BGRA 5KRTA 4EP4A 4FXDA 1N36K 4LFCK 1UOCA 3AA5X 5AQTA 1XC3A 3MN7A 4H8KA 4DV7K 3HM9A 3QMLA 3IMXA 1VQ8N 4JN4A 2WC9A 1CXUA 1E4FT 3NH1A 1DEJA 3HI0A 4CJ3A 3VGLA 3L4QA 4Y1DA 5M1QA 4E3SA 3SBTA 2XY7A 3OYHA 4BRIA 4CHPA 4H0XB 1W9HA 2GUPA 3NH2A 1YTAA 3P39A 1HYSA 2F7TA 2PBDA 4DV3K 2O4GA 2D5RA 2QEXN 2JLEA 3LM2A 3S3OA 4F2SA 3CQXA 3ZEUA 3LM9A 1ZXOA 4PWDA 4ILJA 1ASWA 3QIOA 3OYLA 2ETJA 3C0BA 4O44A 1IKXA 4O4GA 3HVTA 2D0CA 4OLBA 3C6HA 5AQHA 1VSHA 4DV1K 2ASMA 4XH4A 3ZX3A 1CZAN 2IS3A 3D0PA 2HHQA 1RDAA 4U7BA 4CJSA 1IJJA 4UQGA 1B9FA 1OKJA 3VOVA 3O08A 4IOCL 1LWEA 3CQYA 1YF5L 2ZGYA 4FWLA 1NBWA 3WQTA 1HNXK 1VQ5N 1VQ6N 4AHSA 3ALYA 4QOZB 3LPUA 5FPEA 4E89A 4I6MA 4QS8A 1BIUA 2EX3A 3ASMA 5BREA 1J54A 1X3MA 2HMPA 3V1RA 3TI0A 2FBTA 4FWOA 3ZSWA 3AVCA 4FW1A 1GOBA 4AHVA 2Y1IA 2O8BB 4IKFA 1EP4A 2NRZA 4PL7A 3BF1A 3TARA 3WNFA 4BQLA 2IOCA 3HM8A 1NMDA 2O4IA 1WB9A 3ZT0A 1T6CA 3DOKA 3F5TA 4K8ZA 3KIOA 4H0TB 1V4TA 5M1OA 4KB0A 3D2FB 3O4QA 4CEOA 1GLFO 3EKUA 4KV8A 1RTHA 4IO9L 4KI6A 3D2EA 2HOEA 4BR7A 1VSIA 4CF9A 4W5OA 1KQSM 4W5NA 4M3RA 5AQXA 2GEMA 3G25A 3M8QA 4Z94A 2IDOA 3M8SA 4LF5K 3LDLA 4IFEA 5AQUA 4B1YB 4FWNA 4B1XB 4M3ZA 4CJFA 5AQNA 3F9KA 1TYQA 4JI5K 1N34K 1WSHA 1ITGA 4JKGA 4JI6K 3J80O 4Z0UA 3EO3A 1A5WA 4GKJK 2Q36A 3LDPA 3AY9A 3TAQA 1J9AA 4PKIA 2B6AA 3J7ZO 3M3ZA 3BZCA 1IKYA 3LDSA 3FR0A 4CIGA 4H5NA 3RMAA 4AILC 3DLKA 2EWSA 2HHHK 4E7LA 2ASPA 3V9ZA 3SV3A 1NJIO 4E7JA 4FJ5A 2ATQA 4JD2A 4M7XA 3I55N 5AQLA 4CZIA 2RHKA 4JLHA 4ICLA 3EL2A 2QI2A 1EWRA 2GWJA 1HKGA 1Q86O 1NGBA 3VEVA 4AH9A 1L5UA 1SL0A 5JICA 3LP2A 2JWLA 5CE3A 2A42A 3L3VA 1KLNA 3QLHA 3CC2N 1YVNA 3WNGA 3CQ8A 3TPQA 2UXCK 2IVOA 4E7KA 2FBXA 3NDKA 4DU4A 1XHZA 1VSMA 1C0MA 2A1RA 3DMJA 2P9UB 4FZXC 3AV9A 3K0SA 2YNIA 5AQGA 3QBXA 3ZT1A 1RBVA 2OTLN 3K9KA 3T7ZA 4X66K 3J81O 5KRSA 2QTDA 3U3GA 1NK9A 1Z6RA 1TVRA 3DLGA 4H0PA 1QQCA 4BR5A 5AZJA 2Z1GA 5BN9A 3BDPA 2WUSA 2FSNA 3SUPA 2OANA 2NUBA 3AVJA 5GINA 4Z4CA 4DR5K 4OJRA 2QWQA 3ZETB 4RW9A 1NM1A 1WSEA 2BE2A 4JS5A 2VWKA 1N32K 4LSNA 4BWJA 1J5EK 3C6AA 4LSLA 5TKWA 4FZZA 3CD6N 4KH5A 1FJGK 1KVCA 4FLUA 3CCLN 1IBKK 3I0SA 2CGLA 2VQFK 1L3VA 5HRSA 2WFBA 3KLGA 4DSEA 2AP1A 4FJJA 1KVBA 1F21A 4XEIA 3C7NB 4GW6A 3QESA 1HLUA 3GDQA 3NVKA 2DFEA 4OPHA 3ZSXA 1RDWX 3KJVA 5HROA 3LDOA 4DTXA 2XY5A 4NCBA 1JXEA 4Z4IA 1KD1O 5F0XA 3OVNA 3UKUA 4CHQA 3T19A 4IG0A 4H5TA 4A61A 2D1KA 2XY8A 4B9NA 1Y97A 2RPIA 4Y1CA 2OCEA 3FLCO 2P9KB 4KKOA 3MEEA 5J1EA 1NJZA 1LW2A 4LFBK 2E1YA 3PSFA 4OGCA 5E41A 1IBMK 3JSMA 2ITMA 2HF4A 3HJFA 3D7EO 2RE2A 3RSEB 3JXUA 3VQCA 1EO1A 1RDCA 2P9NB 2PAVA 3CC7N 2OA8A 1GLDG 2NRTA 3PX6A 4BRAA 1VQ7N 1LWFA 2CH5A 3O8MA 3V9SA 1VAZA 2D0PA 4FM0A 3HRGA 4C8OA 4FCYA 2HHWA 2A40A 1YIJN 4K0KK 4DUYK 2WTUA 3AVGA 3QEXA 3WXJA 1BA1A 3ZCMA 3DXMA 2NNWA 4YOVA 4NO7A 1Q8IA 1U47A 5LJVA 3EKSA 3RRGA 2YJFA 1O1WA 2VG6A 5AQQA 1TV6A 4WQ4A 2P9IB 2XY6A 4MFBA 4BRQA 3AAQA 1O13A 3VA0A 2B4JA 4JRPA 3SAGA 3CM5A 1K8AO 2D0OA 4B3OA 1JCFA 3KK3A 1T44A 5D3GA 2LSNA 4WFNL 3RTVA 4FWSA 3FZLA 4CZKA 3P1GA 4BG9A 3NFAA 4BE1A 3R9PA 1NNEA 4YOWA 4H5WA 5H1SQ 3THXA 2IC3A 3TAGA 3HVRA 3NH0A 5KQDA 2WBNA 4JHDA 1JLQA 3HT3A 3PO5A 2HBKA 3VQDA 4FLWA 3KK2A 1XQSC 3QICA 2X74A 3VQ6A 1QZ5A 4DV4K 5EU7A 3CPWM 4HTUA 4KTQA 3OS2A 3DRRA 1NOZA 4RWTA 3L2VA 4GMJB 4DCHA 2ZGZA 1OH6A 4B3RK 1ILYA 2O8EB 4M3WA 1E3MA 3MXJA 5ADXH 2QWLA 3F73A 1S1VA 3AVFA 1JJ2M 4ID5A 4FJXA 5LMUK 1RT3A 1ATNA 1K6YA 1MA9B 2E2QA 4CESA 4CHZA 3TAPA 2OPRA 3THYB 5EOYA 2VGMA 2FLOA 3DLRA 3CCVN 4X62K 3P31A 5JS2A 4M3YA 4JK9A 1FKPA 4FZYA 5M1KA 4DV2K 5HP1A 2DY4A 3WNEA 4O8UA 5AFUH 4BRFA 4B1ZA 1CLQA 1VRTA 5FPMA 3NF6A 2QKKA 3K9JA 4DQSA 1IO2A 2QA4N 4ILGB 1KLMA 3MX2A 1T7PA 5ADXA 4I7FA 3VEYA 2O8FA 4FJGA 1ASVA 2JWKA 4DS4A 4DSIA 3GL1A 3L2QA 1LAWA 4E7IA 3O9SA 1MU2A 1WLJA 4GNIA 4CEAA 3GG4A 3QEWA 3TAEA 4NCAA 1RT1A 5AFUA 4AHTA 1L3SA 3KTQA 1VRUA 3R6MA 2XO7A 2V7ZA 5DMRA 2E20A 2IAJA 2YNGA 4Z4FA 3TSPA 2QM1A 4YNQA 1KTQA 3SCXA 4HCBA 3G71N 3SPZA 5AZIB 3UE5A 5FROA 2ZD1A 4B1VA 4IOAL 4G9ZA 3OA9A 3I0RA 3HOTA 3L2WA 4CJUA 4IZ9A 4MO4A 3LWLA 1YXQA 3O5BA 3P38A 4B3SK 3CC4N 3EE8A 3AA3A 1WUAA 4WFAL 4GV6A 4EHTA 4GVMA 5GAHP 1WSFA 3NF8A 1EXQA 2FSJA 3ZT3A 3H6EA 4ISGA 5C15A 4A5AA 5FRNA 3SMPA 2R7YA 1KAZA 4JI2K 2ITGA 4CEDA 3OYIA 1TKTA 3ZT4A 1WN7A 2YHYA 1W7AA 2DPNA 1NK8A 2FC0A 5J2MA 1A5XA 3M8PA 3PLAA 1U45A 4ELUA 1S5JA 2NZTA 1U4BA 5AQPA 1GLEG 4DUZK 1IV0A 4C8MA 3QNOA 4CERA 3SJJA 4BRMA 2Q0RA 2P9SA 3H1QA 2W6LA 1JCGA 4CI6A 1TUYA 1NKBA 3MX5A 3SNNA 4I2QA 1JXBA 4DSKA 3O1BA 4YHHK 3KK7A 3CMAN 3TWHA 3AO5A 4A59A 4UY8O 4H0YB 5IT9O 3AAPA 1WAJA 2YCHA 5FPNA 4F8RA 1FXXA 1UA1A 4PKGA 3CM6A 1QQMA 1T6DA 4BWMA 3AO3A 3LP3A 4HUGA 3KHYA 1MDUB 3CCQN 1WSIA 2ZE2A 1VQ4N 3KK1A 4IO8A 3VA3A 1DKGD 4HHTA 1HRHA 4CBUA 2KFZA 3LP0A 4FLTA 2GELA 2DFHA 3ZEUB 3AA4A 4KRFA 3DYAA 2G8IA 4DFJA 2WOMA 4LY7A 4YOTA 4H0OA 3RR7A 3LWMA 2KLAA 3ZT2A 2CGJA 1YVUA 3QINA 1QTMA 4OKJA 2PFUA 4JV5K 4LD0A 3RMDA 1H1VA 3S3NA 1LWCA 1S1TA 3PY8A 3SZ2A 3BEXA 4CHOA 4TSXA 3QEPA 4FWMA 3A5NC 3U3YA 4BDYA 4WF9L 1OVQA 4DF4A 5I3UA 4XH1A 5KGXA 1VQLN 4AHCA 2QWNA 5AQMA 3EZWA 4H03B 1BUPA 1KXPA 4BE2A 3LAKA 1RBRA 3ID6A 4Z4EA 1SUQA 3CIPA 3DLHA 4I6MB 3CFOA 1DLOA 2KFNA 3AO4A 3O6WA 2GV9A 1N33K 1RNHA 1QQNA 4NXMK 1SL2A 2E88A 4L3QA 4DTRA 2UXBK 4F4KA 1NKCA 1R0AA 2F96A 4DR3K 4GKKK 3LL3A 4EZ9A 2UXDK 3PIPL 4C23A 1EWQA 1N5YA 3W3DA 4OX9K 4LF8K 2GX9A 2O8DA 3MN9A 3VENA 3SBGA 5BRHA 4IXCA 4E1JA 2P9LA 4IBNA 1NGHA 1BU6O 4IFYA 3I56N 3OYNA 3D2EB 4LH4A 5HLFA 1QHTA 5JVGL 1YTUA 2W40A 2OTJN 2G8WA 2BANA 4E19A 5HRRA 2W42A 3OJSA 2VYPA 1RBUA 2XRIA 4HVJA 1BISA 1TYQB 1QSLA 4JKGB 4AHRA 2IVPA 1ATSA 4DKWA 4DTSA 1BCOA 2QXLA 1U2VA 4FM2A 2F9TA 4JEPA 1WAFA 2HHSA 4Q5VA 4JYAK 3THVA 1XWLA 3IFRA 5KQ8A 2RN2A 5AQZA 3UIQA 1W97L 5CR4A 3OYKA 1T05A 1VSJA 1RBSA 2W6KA 4JD2B 3VQEA 5J2QA 2Q97A 3RMBA 4V19S 4ID1A 1VSKA 4CE9A 3VERA 4CEBA 4QAGA 3HO1A 2ZM6K 2DFFA 1FKOA 3ZX2A 2P5OA 3O1WA 4FJIA 1Q82O 1S6PA 4FOIA 2G8KA 4CBXA 5DM6L 3A2FA 3H46O 3C94A 1QSYA 3M5RA 1ZBUA
chains in the Genus database with same CATH topology
3HSCA 4NB4A 4IEEA 2BTFA 4JKHA 1P8ZA 3A5MC 3NMUA 3FE1A 1T3VA 5GADP 3VEOA 4A2AA 3CJ7A 3EN9A 3FLCO 3WEEB 2BUPA 2Q0UA 2P9KB 3CCJN 3U9ZA 3MCPA 4BREA 2E2PA 4BRCA 2J4RA 2P9LB 3N4PA 3QBWA 3O9QA 2E1YA 4FSVA 2E2NA 2F9WA 3E9PA 3WT0A 4CZJA 2YHWA 1HKCA 4WQ4C 4FWKA 3ATUA 4AM6A 2ITMA 2HF4A 3M6GA 1IG8A 3A8YA 3D7EO 3L0QA 2RE2A 1ZBSA 2E8AA 3DJCA 4M63C 3RSEB 3JXUA 1Q7YO 4PL8A 4H5RA 4HWIA 4CD1A 3O9UA 4K25A 1EO1A 3VETA 2QWMA 3VF4A 1XUPO 3H3NO 2P9NB 2PAVA 3MCAB 4BRDA 2FSKA 2QWRA 5AZJB 3CC7N 3VTIA 1GLDG 2NRTA 4IEIA 1VQMN 2AA4A 4BRAA 5AQVA 3P4IA 4BGBA 3UB5A 1VQ7N 5I9EB 1YHQN 2CH5A 2YJEA 3O8MA 5JLFA 3CCMN 1VAZA 3UKRB 2D0PA 3ENHA 4OO1J 1QVGM 3HRGA 3WXLA 5FPDA 3ENOA 2A40A 5GIOA 1U2VB 1YIJN 4BY9C 4K43A 4CZMA 2UYTA 5AQSA 3O4WA 1NWKA 4F9OA 4FPBA 3SAHA 1MWKA 4BR9A 3WXJA 1BA1A 4GY2B 1EQYA 3DXMA 2NNWA 3ULEA 4YOVA 4NO7A 4RTFD 2ZJRL 1W2BM 5LJVA 3EKSA 4YOUA 2YJFA 2Q1NA 3TSUA 3ZYYX 1GLAG 2W41A 5AQQA 4AF1A 1QZ6A 3CCUN 1P90A 2A41A 4PKHA 2Q2RA 3H3OB 4WQ4A 1RFQA 4JKDA 2P9IB 4BRQA 3AAQA 2HBJA 1U6ZA 5MLCQ 3CPEA 4CBWA 3A5LC 1O13A 3FFKB 3SAGA 5ELZA 1E4GT 1LCUA 3BF3A 1YI2N 1K8AO 1RGIA 2D0OA 1MWMA 5AR0A 1JCFA 1YITN 3C65A 4FOEA 4CZGA 4AM7A 1K73O 1T44A 2VCPA 4FWQA 1KC8O 2V7YA 4WFNL 4FWSA 3R3LA 3VESA 4ISEA 3FZLA 1X3NA 5KPZA 4CZKA 4BR0A 1BO5O 4BG9A 3R9PA 4YOWA 4H0VB 4H5WA 5H1SQ 4BG8A 4BVPA 3UKUB 3VGMA 4JKBA 3HZ6A 4YOYA 3G6EN 5KQDA 2WBNA 1SZ2A 4JHDA 1Q18A 4BGAA 3AARA 3FGUA 2HBKA 1XQSC 3FZKA 4EFHA 5AZIA 2IVNA 3QICA 3VF6A 1Z05A 1QZ5A 4BR4A 3SK3A 1LOTB 3CPWM 4FWRA 1G99A 2FXUA 1BWFO 3ID8A 5HOOA 1NLVA 3ENBA 1YJ9N 4RWTA 3A5OC 3GBTA 4DCHA 4DHYA 2GTDA 2ZGZA 5M1PA 3SLCA 3TSQA 4U67L 2ZJQL 1ILYA 3CJCA 5M1FA 3F9MA 5EXWA 4NLBA 4PHTX 2QWLA 5ADXH 1GLLO 4GVEA 4BR2A 1JJ2M 3WUHA 1NGGA 4YOXA 4XH5A 1ATNA 3CMEN 2E2QA 1MA9B 4YORA 5TKYA 2NRHA 4JKEA 2YHXA 5EOYA 3U9DA 2VGMA 2FLOA 3IKMA 5KPRA 3CCVN 1VQNN 5BRDA 5C2FA 3DWLA 2NRXA 3P31A 4EIAA 1GLJO 4JK9A 2E2OA 5M1KA 3E66A 4BC5A 2VWBA 3GOIA 4Y0WA 1X9JA 1M90O 2KKZA 1HPMA 4BRFA 4O8UA 1R59O 5AFUH 4JAXA 4BVOA 3CXCM 3TTDA 3N4QA 1ATRA 4B1ZA 3VTHA 3DXMB 4JKFA 5FPMA 3ULEB 2HBMA 5GIPA 3K9JA 1SAZA 4KH6A 3HOSA 2IIRA 4LC9B 1C0GA 5M1NA 2QA4N 5AQKA 3AGRA 3CI5A 1HUXA 3DXKA 4ILGB 3F2KA 4MLHA 4B1WB 3CCEN 3MX2A 3CJBA 2VGNA 4YDUC 5ADXA 2H3GX 2FF6A 3VEYA 4ISFA 2YX6A 1NGFA 3MDQA 3VEWA 2D4WA 4JNEA 2I7NA 1NGIA 4CZEA 2JWKA 1JCEA 3CCRN 3GL1A 1VQPN 1GLCG 3O9SA 5AQTA 1XC3A 5AQOA 3MN7A 2V52B 5EVZA 3QMLA 3IMXA 1VQ9N 1VQ8N 3Q7CA 4GNIA 3GG4A 4IDHA 4IJNA 4JN4A 2WC9A 1E4FT 4BRLA 2ZF5O 1DEJA 3HI0A 5AFUA 3VGLA 3L4QA 3R6MA 5M1QA 3M1FA 2V7ZA 2FF3B 3OBWA 2E20A 3D2FA 3AGKA 3SBTA 3E9LA 4JHDB 4BRIA 1C0FA 3TSPA 2QM1A 4H0XB 3T69A 2ASOA 4BRPA 3MWTA 3MN6A 2GUPA 3G71N 4JKCA 5AQIA 5AZIB 3ATVA 3P39A 3UE5A 2F7TA 2PBDA 2NRVA 4B1VA 3O80A 5E26A 5C12A 4IOAL 4G9ZA 3OA9A 2QEXN 3LM2A 4YDUA 3HOTA 5HL7L 3ZX0A 1BA0A 2NRRA 1SS6A 4IZ9A 4HTLA 4MO4A 1YXQA 1NGAA 3CQXA 4MLEA 3ZEUA 3LM9A 1ZXOA 3O5BA 3P38A 4ILJA 3CC4N 1NGEA 3EE8A 1Y64A 3RVCA 5BPMA 3IUCA 3C0BA 3O9RA 1WUAA 4WQ5C 4WFAL 3VPZA 4OPAA 4EHTA 4GV6A 3CERA 2I7PA 5GAHP 3SAFA 1K8KA 3B8AX 3C6HA 2A5XA 2FSJA 1Q81O 3H6EA 3WXKA 5AQHA 3LDQA 4ISGA 5C15A 4A5AA 2ASMA 4XH4A 3SMPA 3ZX3A 1KAZA 1CZAN 2YHYA 2DPNA 3TTCA 4O8KA 3BP8A 3QDKA 4BRGA 4U7BA 1IJJA 3VOVA 1OKJA 1RDUA 3O08A 3CHWA 4IOCL 2E1ZA 4IWVA 3PLAA 3E1YA 3QFPA 3CQYA 1YF5L 2ZGYA 4FWLA 1NBWA 5AQYA 3WQTA 1OVYA 1VQ5N 2NZTA 1VQ6N 5AQPA 5BRFA 3CCSN 1GLEG 3R1XA 1HJOA 5FPEA 1NGCA 3J8AA 5JVHL 3VEXA 4I6MA 4QS8A 3DXKB 4GV9A 2HF3A 1GLBG 4BRMA 2Q0RA 4DQ8A 1BOTO 1KAXA 2P9SA 3H1QA 4MO5A 1X3MA 2QWPA 5AQRA 5BREA 1JCGA 3CJ9A 4CI6A 1BG3A 1TUYA 4WQ5A 5BPNA 1SQKA 2HMPA 3O9TA 4IOXA 3MX5A 4FWOA 3NVMA 4BC4A 4FL9A 3HBTA 4DB3A 2NRZA 4PL7A 3BF1A 4CZHA 3BUZB 3O1BA 3KK7A 3CMAN 4A59A 4BQLA 4UY8O 4H0YB 3AAPA 3HM8A 1NMDA 2CGKA 4CZFA 2YCHA 5FPNA 4FVUA 1T6CA 1YUWA 4FO0A 3G4SN 3F5TA 5EX5A 4H0TB 4WYBA 2V51B 1NGJA 1V4TA 5M1OA 3D2FB 4PKGA 1GLFO 1QQMA 3EKUA 1T6DA 3FZFA 3VF2A 1V4SA 2NRWA 2P9UA 3U8XA 1NGDA 5LJWA 3KHYA 4J8FA 1MDUB 3CCQN 4IO9L 4R79A 1VQ4N 1ESVA 3D2EA 2HOEA 4BR7A 4IO8A 1DKGD 3EE9A 3S41A 1KQSM 1TUUA 1QHAA 3DLLL 2YI1A 1N8RO 5AQXA 2GEMA 3G25A 3GE1A 3HTVA 4CBUA 4Z94A 1YAGA 3LDLA 2GELA 4BRNA 3QB0A 1YJWN 3ZEUB 1HKBA 1DT9A 2GWKA 4FWNA 4IFEA 5AQUA 4B1YB 4B1XB 4YOTA 4H0OA 5AQNA 1TYQA 2KLAA 2CGJA 2A3ZA 4JKGA 3EO3A 5B8HA 2PFUA 3ZETA 1H1VA 1S72N 5KPTA 1K8KB 4GV3A 2Q36A 3LDPA 3AY9A 1BDGA 2QWOA 4BC2A 3WXMB 3BEXA 3MN5A 3KZBA 4PKIA 1VQON 4CJ7A 2HBLA 3J7ZO 3M3ZA 3I8BA 1M1KO 4FWMA 1ZC6A 3FR0A 3A5NC 4BQZA 5C10A 4H5NA 3H45C 4WF9L 4JK8A 3SMSA 4NLCA 4XH1A 2EWSA 4RCHA 1VQLN 2ASPA 4MDBA 2QWNA 5AQMA 3EZWA 3I33A 4H03B 3VEZA 1BUPA 1KXPA 2KHOA 3W0LA 5F1XA 1NJIO 4C1NI 5DM7L 3KWGA 5BPLA 3KWIA 4BC3A 3MWPA 4JD2A 4K41A 4M7XA 2A6AA 3ID6A 3I55N 5AQLA 4CZIA 3LDNA 2RHKA 3CIPA 3C7NA 3EL2A 2QI2A 4I6MB 2GWJA 2P9PA 4BRHA 3O6WA 4QS7A 3KVGA 4QS9A 2P9SB 3VMFB 5CHIA 1HKGA 5JMVA 1YJNN 1Q86O 1QQNA 4CD3A 1HX1A 3D6RA 1NGBA 3VEVA 2E88A 3U4LA 2CH6A 3CF5L 4L3QA 4A5BA 5C2DA 4O5FA 5JICA 2JWLA 5CE3A 3JS6A 2A42A 3LL3A 1KAYA 3PIPL 4C23A 3CC2N 1YVNA 3W3DA 5F2RA 3L4IA 3WEEA 2GX9A 3TPQA 5BN8A 2IVOA 3MN9A 2P9KA 3VENA 1DGKN 3SBGA 3TU5A 5BRHA 4B9QA 4IXCA 4E1JA 2P9LA 3L6QA 2P9UB 1NGHA 1BU6O 2ZJPL 4CZLA 3I56N 3D2EB 5AQGA 4IJAA 3QBXA 2NLXA 3WXIA 2OTLN 1VQKN 1D4XA 2Q31A 3K9KA 3CJ1A 3T7ZA 5JVGL 2OTJN 2W40A 3OHRA 3RSEA 5GAGP 2QTDA 4KH4A 4WFBL 1Z6RA 4H0PA 4M7YA 2P9NA 3OBYA 3QFUA 4B1UB 4BR5A 5AZJA 5BN9A 3A0IX 2WUSA 2FSNA 2VYPA 4EHUA 3FZHA 5E84A 2OANA 3E9OA 5EY4A 3CETA 4EAHD 5LY3A 1TYQB 4BRKA 5AQJA 3UKRA 5GINA 2QW9A 4JKGB 4MDAA 1J6ZA 1ATSA 2IVPA 4K42A 5AQWA 4DKWA 2QWQA 2QXLA 3ZETB 1U2VA 3SJHA 2F9TA 1NM1A 4JEPA 3WQUA 2HSTA 3IDHA 3H1VX 3C6AA 5TKWA 3CD6N 4KH5A 4C1NK 4JKAA 3IFRA 5KQ8A 5AQZA 3CCLN 1W97L 4FWPA 3VGKA 4A57A 5CR4A 2CGLA 3FZMA 1S3XA 4H5VA 4FPAA 2P9IA 3R8EA 3MMVA 4A2BA 5GAEP 4KBOA 2BH1A 1QVFM 2WFBA 4JD2B 1K9MO 5BR9A 5C0YA 2AP1A 5AQFA 4A62A 3PIOL 2Q97A 4BROA 4XEIA 3C7NB 4WCEL 1HLUA 2ZWHA 2P9PB 3GDQA 3VERA 3NVKA 4OPHA 4JK7A 1QQOA 4ILHA 3CJAA 1RDWX 3ZX2A 3MK6A 3LDOA 3O1WA 1Q82O 4FOIA 1KD1O 5F0XA 5JLHA 3TTFA 3DAWA 3Q7BA 3UKUA 3OW2M 4CBXA 1WOQA 5DM6L 3H46O 4H5TA 4A61A 3M5RA 1S22A 2D1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSC A;  4NB4 A;  2BTF A;  1P8Z A;  3A5M C;  3FE1 A;  3VEO A;  4A2A A;  3CJ7 A;  3EN9 A;  3FLC O;  3WEE B;  2BUP A;  2Q0U A;  2P9K B;  3U9Z A;  3MCP A;  4BRE A;  2E2P A;  4BRC A;  2J4R A;  2P9L B;  3QBW A;  2E1Y A;  4FSV A;  2E2N A;  2F9W A;  3WT0 A;  4CZJ A;  2YHW A;  1HKC A;  4WQ4 C;  4FWK A;  3ATU A;  4AM6 A;  2ITM A;  2HF4 A;  3M6G A;  1IG8 A;  3A8Y A;  3D7E O;  3L0Q A;  1ZBS A;  2E8A A;  3DJC A;  4M63 C;  3RSE B;  3JXU A;  4PL8 A;  4H5R A;  4HWI A;  4CD1 A;  4K25 A;  3VET A;  2QWM A;  3VF4 A;  1XUP O;  3H3N O;  2P9N B;  2PAV A;  4BRD A;  2FSK A;  2QWR A;  5AZJ B;  1GLD G;  2AA4 A;  4BRA A;  5AQV A;  3P4I A;  4BGB A;  3UB5 A;  5I9E B;  2CH5 A;  2YJE A;  3O8M A;  5JLF A;  3UKR B;  2D0P A;  3ENH A;  3WXL A;  5FPD A;  3ENO A;  2A40 A;  1U2V B;  4K43 A;  4CZM A;  2UYT A;  5AQS A;  3O4W A;  1NWK A;  4F9O A;  4FPB A;  1MWK A;  4BR9 A;  3WXJ A;  1BA1 A;  4GY2 B;  1EQY A;  3DXM A;  3ULE A;  4NO7 A;  4RTF D;  5LJV A;  3EKS A;  2YJF A;  2Q1N A;  1GLA G;  2W41 A;  5AQQ A;  1QZ6 A;  4PKH A;  2A41 A;  2Q2R A;  3H3O B;  4WQ4 A;  1RFQ A;  2P9I B;  4BRQ A;  3AAQ A;  1U6Z A;  4CBW A;  3A5L C;  3FFK B;  5ELZ A;  1E4G T;  1LCU A;  3BF3 A;  1RGI A;  2D0O A;  1MWM A;  5AR0 A;  1JCF A;  4FOE A;  4CZG A;  4AM7 A;  1T44 A;  2VCP A;  4FWQ A;  2V7Y A;  4FWS A;  3VES A;  4ISE A;  3FZL A;  1X3N A;  5KPZ A;  4CZK A;  4BR0 A;  1BO5 O;  4BG9 A;  3R9P A;  4H0V B;  4H5W A;  4BG8 A;  4BVP A;  3UKU B;  3VGM A;  3HZ6 A;  5KQD A;  1SZ2 A;  4JHD A;  1Q18 A;  4BGA A;  3AAR A;  3FGU A;  1XQS C;  3FZK A;  4EFH A;  5AZI A;  2IVN A;  3QIC A;  3VF6 A;  1Z05 A;  1QZ5 A;  4BR4 A;  3SK3 A;  1LOT B;  4FWR A;  1G99 A;  2FXU A;  1BWF O;  3ID8 A;  1NLV A;  4RWT A;  3A5O C;  3GBT A;  4DCH A;  4DHY A;  2GTD A;  2ZGZ A;  3SLC A;  3CJC A;  3F9M A;  5EXW A;  5ADX H;  2QWL A;  1GLL O;  4BR2 A;  3WUH A;  1NGG A;  4XH5 A;  1ATN A;  2E2Q A;  1MA9 B;  5TKY A;  2NRH A;  2YHX A;  5EOY A;  3U9D A;  2FLO A;  5KPR A;  5BRD A;  3DWL A;  4EIA A;  1GLJ O;  2E2O A;  4BC5 A;  2VWB A;  3GOI A;  4Y0W A;  1X9J A;  1HPM A;  4BRF A;  5AFU H;  1R59 O;  4JAX A;  4BVO A;  1ATR A;  4B1Z A;  3DXM B;  3ULE B;  5FPM A;  1SAZ A;  2IIR A;  4LC9 B;  1C0G A;  5AQK A;  3DXK A;  3CI5 A;  1HUX A;  4MLH A;  4B1W B;  3CJB A;  4YDU C;  5ADX A;  2H3G X;  2FF6 A;  3VEY A;  4ISF A;  3MDQ A;  1NGF A;  3VEW A;  2D4W A;  4JNE A;  2I7N A;  1NGI A;  4CZE A;  1JCE A;  3GL1 A;  1GLC G;  5AQT A;  1XC3 A;  5AQO A;  3MN7 A;  2V52 B;  5EVZ A;  3QML A;  3IMX A;  4GNI A;  3GG4 A;  4IJN A;  4JN4 A;  1E4F T;  4BRL A;  2ZF5 O;  1DEJ A;  3HI0 A;  5AFU A;  3VGL A;  3R6M A;  3M1F A;  2V7Z A;  2FF3 B;  2E20 A;  3D2F A;  4JHD B;  4BRI A;  1C0F A;  2QM1 A;  4H0X B;  2ASO A;  4BRP A;  3MN6 A;  2GUP A;  5AQI A;  5AZI B;  3ATV A;  3UE5 A;  2PBD A;  4B1V A;  3O80 A;  5E26 A;  3LM2 A;  4YDU A;  3ZX0 A;  1BA0 A;  4IZ9 A;  4HTL A;  4MO4 A;  1YXQ A;  1NGA A;  3CQX A;  4MLE A;  3ZEU A;  3LM9 A;  1ZXO A;  3O5B A;  1NGE A;  1Y64 A;  5BPM A;  3IUC A;  3C0B A;  4WQ5 C;  1WUA A;  3VPZ A;  4EHT A;  3CER A;  2I7P A;  1K8K A;  3B8A X;  2A5X A;  2FSJ A;  3H6E A;  3WXK A;  5AQH A;  3LDQ A;  4ISG A;  2ASM A;  4XH4 A;  3SMP A;  3ZX3 A;  1KAZ A;  1CZA N;  2YHY A;  2DPN A;  4O8K A;  3BP8 A;  3QDK A;  4BRG A;  1IJJ A;  3VOV A;  1OKJ A;  3O08 A;  3CHW A;  2E1Z A;  4IWV A;  3QFP A;  3CQY A;  2ZGY A;  4FWL A;  3WQT A;  1NBW A;  5AQY A;  2NZT A;  5AQP A;  5BRF A;  1GLE G;  1HJO A;  5FPE A;  1NGC A;  3J8A A;  3VEX A;  4I6M A;  4QS8 A;  3DXK B;  2HF3 A;  1GLB G;  4BRM A;  2Q0R A;  4DQ8 A;  1BOT O;  1KAX A;  2P9S A;  3H1Q A;  4MO5 A;  1X3M A;  2QWP A;  5AQR A;  5BRE A;  1JCG A;  3CJ9 A;  4CI6 A;  1BG3 A;  1TUY A;  4WQ5 A;  5BPN A;  1SQK A;  2HMP A;  4FWO A;  4BC4 A;  4FL9 A;  3HBT A;  4DB3 A;  4PL7 A;  3BF1 A;  4CZH A;  3BUZ B;  3O1B A;  4BQL A;  4H0Y B;  3AAP A;  3HM8 A;  1NMD A;  2CGK A;  4CZF A;  2YCH A;  5FPN A;  1T6C A;  1YUW A;  4FO0 A;  5EX5 A;  4H0T B;  4WYB A;  2V51 B;  1NGJ A;  1V4T A;  3D2F B;  4PKG A;  1GLF O;  1QQM A;  3EKU A;  1T6D A;  3FZF A;  3VF2 A;  1V4S A;  3U8X A;  2P9U A;  1NGD A;  5LJW A;  3KHY A;  4J8F A;  1MDU B;  1ESV A;  3D2E A;  2HOE A;  4BR7 A;  4IO8 A;  1DKG D;  3S41 A;  1TUU A;  1QHA A;  2YI1 A;  5AQX A;  2GEM A;  3G25 A;  3GE1 A;  3HTV A;  4CBU A;  4Z94 A;  1YAG A;  3LDL A;  2GEL A;  4BRN A;  3QB0 A;  3ZEU B;  1HKB A;  2GWK A;  5AQU A;  4FWN A;  4B1Y B;  4B1X B;  4H0O A;  5AQN A;  1TYQ A;  2CGJ A;  2A3Z A;  3EO3 A;  5B8H A;  3ZET A;  1H1V A;  5KPT A;  1K8K B;  2Q36 A;  3LDP A;  3AY9 A;  1BDG A;  2QWO A;  4BC2 A;  3BEX A;  3MN5 A;  3KZB A;  4PKI A;  4CJ7 A;  3M3Z A;  3I8B A;  4FWM A;  1ZC6 A;  3FR0 A;  3A5N C;  4BQZ A;  4H5N A;  3H45 C;  3SMS A;  4XH1 A;  2EWS A;  4RCH A;  2ASP A;  2QWN A;  5AQM A;  3EZW A;  3I33 A;  4H03 B;  3VEZ A;  1BUP A;  1KXP A;  2KHO A;  3W0L A;  5F1X A;  5BPL A;  4BC3 A;  4JD2 A;  4K41 A;  4M7X A;  2A6A A;  5AQL A;  4CZI A;  3LDN A;  3CIP A;  3EL2 A;  3C7N A;  4I6M B;  2GWJ A;  2P9P A;  4BRH A;  3O6W A;  4QS7 A;  3KVG A;  4QS9 A;  2P9S B;  1HKG A;  5JMV A;  1QQN A;  4CD3 A;  1HX1 A;  1NGB A;  3VEV A;  2E88 A;  3U4L A;  2CH6 A;  4L3Q A;  4O5F A;  5JIC A;  5CE3 A;  3JS6 A;  2A42 A;  3LL3 A;  1KAY A;  4C23 A;  1YVN A;  3W3D A;  5F2R A;  3L4I A;  3WEE A;  3TPQ A;  5BN8 A;  2IVO A;  3MN9 A;  2P9K A;  3VEN A;  1DGK N;  3TU5 A;  5BRH A;  4B9Q A;  4IXC A;  4E1J A;  2P9L A;  3L6Q A;  2P9U B;  1NGH A;  1BU6 O;  4CZL A;  3D2E B;  5AQG A;  4IJA A;  3QBX A;  2NLX A;  3WXI A;  1D4X A;  2Q31 A;  3CJ1 A;  2W40 A;  3OHR A;  3RSE A;  1Z6R A;  4H0P A;  4M7Y A;  2P9N A;  3QFU A;  4B1U B;  4BR5 A;  5AZJ A;  5BN9 A;  3A0I X;  2WUS A;  2FSN A;  2VYP A;  4EHU A;  3FZH A;  5E84 A;  2OAN A;  5EY4 A;  3CET A;  4EAH D;  5LY3 A;  1TYQ B;  4BRK A;  5AQJ A;  3UKR A;  2QW9 A;  1J6Z A;  1ATS A;  2IVP A;  4K42 A;  5AQW A;  2QWQ A;  2QXL A;  3ZET B;  1U2V A;  3SJH A;  2F9T A;  1NM1 A;  3WQU A;  3IDH A;  3H1V X;  3IFR A;  5KQ8 A;  5AQZ A;  4FWP A;  3VGK A;  2CGL A;  3FZM A;  1S3X A;  4H5V A;  4FPA A;  2P9I A;  3R8E A;  3MMV A;  4A2B A;  4KBO A;  4JD2 B;  5BR9 A;  2AP1 A;  5AQF A;  4A62 A;  2Q97 A;  4BRO A;  4XEI A;  3C7N B;  1HLU A;  2ZWH A;  2P9P B;  3GDQ A;  3VER A;  1QQO A;  3CJA A;  1RDW X;  3ZX2 A;  3MK6 A;  3LDO A;  3O1W A;  4FOI A;  5F0X A;  5JLH A;  3DAW A;  3UKU A;  4CBX A;  1WOQ A;  3H46 O;  4H5T A;  4A61 A;  1S22 A;  2D1K A; 
#chains in the Genus database with same CATH topology
 4NB4 A;  4E0D A;  4IEE A;  3A5M C;  1T3V A;  4W5R A;  2YV0 X;  3EN9 A;  2Q0U A;  4CIF A;  4CHN A;  5CYQ A;  4BRE A;  3C6U A;  4BRC A;  1NJX A;  2J4R A;  4M45 A;  3QBW A;  3P5J A;  4ELT A;  3VQ7 A;  4FJL A;  2YHW A;  4AM6 A;  4WQ4 C;  3QIP A;  1IKV A;  4O0I A;  4JI0 K;  1ZBS A;  4CD1 A;  4JI4 K;  3H3N O;  2QKB A;  2FSK A;  2QWR A;  5AZJ B;  4C8L A;  3VTI A;  3HK2 A;  4BGB A;  5I9E B;  1YHQ N;  2YJE A;  3CCM N;  4BDZ A;  1QVG M;  3OYF A;  2G8V A;  4BY9 C;  4K43 A;  4CZM A;  4CFA A;  4RW6 A;  5HRP A;  3OYJ A;  1C6V A;  3NGI A;  4J2D A;  1L3U A;  1VQM N;  2ZJR L;  3TAB A;  2O8C A;  4YOU A;  2Q1N A;  3TSU A;  3ZYY X;  4NYF A;  4KHS A;  4CGF A;  3ZLJ A;  4AF1 A;  1I3A A;  3H3O B;  1RFQ A;  3M8R A;  4YY3 K;  1GOC A;  4DF8 A;  4DU1 A;  3FFK B;  4B9S A;  2A1S A;  5ELZ A;  1E4G T;  3E01 A;  1D5A A;  1TL3 A;  1RGI A;  5AR0 A;  4DFM A;  1TL1 A;  3C65 A;  3VN5 A;  4CZG A;  3PX0 A;  1K73 O;  5KPZ A;  1X3N A;  4CJW A;  3LAL A;  4KO0 A;  4BG8 A;  1EX4 A;  3UKU B;  5LMN K;  4W5T A;  2P5G A;  1SZ2 A;  1Q18 A;  4BGA A;  3AAR A;  1CXQ A;  3QEI A;  1VSL A;  2PZS A;  3VQP A;  5IWA K;  1Z05 A;  4MQ3 A;  4BR4 A;  1LOT B;  3RR8 A;  1BWF O;  1S1W A;  3ID8 A;  3ENB A;  4DV5 K;  1YJ9 N;  5M1P A;  3SLC A;  3T1H K;  3F9M A;  5EXW A;  4PHT X;  3THW A;  1GLL O;  1KRP A;  2YNH A;  2VWJ A;  3WUH A;  4LF9 K;  4YOR A;  5TKY A;  4ZHR A;  2NRH A;  3OYB A;  3IKM A;  5KPR A;  3LAN A;  2D0A A;  5BRD A;  5CYM A;  5C2F A;  3B6P A;  2E2O A;  3DM2 A;  3E66 A;  4JS4 A;  3GOI A;  1X9J A;  5HRN A;  4CJT A;  2KW4 A;  3N4Q A;  3ITH A;  1ATR A;  3DXM B;  1S9G A;  1LAV A;  4CF2 A;  1SAZ A;  3V9U A;  5AQK A;  3DXK A;  3CI5 A;  3F2K A;  4B1W B;  4CGI A;  1NU0 A;  2VGN A;  4NXN K;  3IAY A;  2YX6 A;  2WON A;  1SL1 A;  3KKR A;  3T3F A;  1JCE A;  5KTQ A;  1VQP N;  2P51 A;  5AQO A;  4FJM A;  2V52 B;  1VSD A;  1HYV A;  1VQ9 N;  3Q7C A;  4IDH A;  3ULD A;  2ZF5 O;  3THX B;  1NK5 A;  4CJL A;  1TGO A;  3OBW A;  4CEQ A;  2FF3 B;  3KLH A;  3AGK A;  1IBL K;  3S9H A;  4JHD B;  2HHX A;  4CJQ A;  4B8C A;  2ASO A;  2FBY A;  2QK9 A;  3MWT A;  4JKC A;  5AQI A;  2NRV A;  4PUO A;  5E26 A;  5C12 A;  1TK5 A;  4YDU A;  4DQR A;  4IG3 A;  5HL7 L;  4DLE A;  1UA0 A;  2NRR A;  1SS6 A;  3RWU A;  1NGA A;  3SV4 A;  4MLE A;  4KB1 A;  1HQE A;  3CFR A;  1NGE A;  2GBZ A;  4KHU A;  5BPM A;  4YFU A;  4OPA A;  1HNV A;  4JI1 K;  3K5M A;  3SAF A;  4N76 A;  1K8K A;  2OPS A;  3B8A X;  1Q81 O;  3WXK A;  4FLV A;  3IRX A;  4JI8 K;  4O8K A;  1JLG A;  1OH8 A;  4CK1 A;  1RDU A;  1KFS A;  2E1Z A;  1J5O A;  3E1Y A;  1RT5 A;  4FJN A;  1OVY A;  4RW8 A;  5BRF A;  3K58 A;  2F4V K;  3SI6 A;  4GV9 A;  3HP9 A;  1HR0 K;  2QWP A;  3NGZ A;  3S3M A;  5J2N A;  4WQ5 A;  5BPN A;  2O8F B;  1SQK A;  3O9T A;  3TAM A;  4KHN A;  4FLX A;  4FL9 A;  3HBT A;  4DB3 A;  1A5V A;  3HPO A;  4CZH A;  3BUZ B;  1BQM A;  2KTQ A;  2Z1J A;  2CGK A;  3VQ8 A;  4KAZ A;  3NE6 A;  4FO0 A;  3O4N A;  3G4S N;  4DLG A;  4JI7 K;  3K5O A;  2V51 B;  4OPJ A;  4CJE A;  3VF2 A;  1V4S A;  1NKE A;  2NRW A;  3U8X A;  3V4I A;  3VQ4 A;  4J8F A;  2ZQB A;  4R79 A;  1ESV A;  3K57 A;  1T03 A;  3OYA A;  4F3T A;  1QHA A;  3PO4 A;  4DTJ A;  1HPZ A;  4C8N A;  2G8U A;  4EP5 A;  4DFK A;  2YI1 A;  3T1Y K;  1N8R O;  4B9T A;  3HTV A;  3V9X A;  1X1P A;  4BRN A;  3QB0 A;  1YJW N;  3AVM A;  3NAE A;  1LW0 A;  1S72 N;  5KPT A;  1S1X A;  4Z4H A;  4JI3 K;  1BDG A;  2QWO A;  5DK5 A;  4RW7 A;  3MXI A;  3MN5 A;  5I42 A;  3KZB A;  4CJ7 A;  2HBL A;  3I8B A;  1M1K O;  3VQ5 A;  1ZC6 A;  2UU9 K;  4M42 A;  1ZBF A;  4JK8 A;  1QSS A;  3KD1 E;  4FJ7 A;  1REV A;  3I33 A;  3VEZ A;  1YT3 A;  3KD5 E;  4CEF A;  5DM7 L;  5BPL A;  4BC3 A;  2Y1J A;  1IKW A;  4K41 A;  2A6A A;  3G10 A;  4JRQ A;  2P9P A;  4FJK A;  4BRH A;  4DR7 K;  4QS7 A;  2P9S B;  5CHI A;  3I8D A;  4B8A B;  1KCF A;  5LL6 Z;  4DV6 K;  1UAX A;  3U4L A;  2CH6 A;  3CF5 L;  4A5B A;  5C2D A;  2D0B A;  4O5F A;  5CY4 A;  4X65 K;  3LAM A;  4M41 A;  1WBD A;  2YHA A;  1B92 A;  3AVB A;  3SPY A;  5F2R A;  3WEE A;  4CK2 A;  4KHQ A;  1RT2 A;  1DGK N;  3TU5 A;  4DR2 K;  2UUB K;  3V9W A;  1I94 K;  2IGI A;  4FW2 A;  1JLF A;  2NLX A;  3WXI A;  2Q31 A;  3OHR A;  4WFB L;  3OYM A;  4M7Y A;  3OY9 A;  4B1U B;  4F3O A;  4EHU A;  3FZH A;  5E84 A;  4CF8 A;  3CET A;  4BRK A;  5AQJ A;  3UKR A;  5AQW A;  4DFP A;  3T1A A;  4CGD A;  3O3F A;  3SJH A;  5AJ3 K;  3C6T A;  4CF0 A;  1JKH A;  2HST A;  3HYF A;  3IDH A;  1ZBI A;  1U04 A;  4CJK A;  3RMC A;  1U48 A;  1RT7 A;  3DLB A;  4FWP A;  4PA1 A;  3VGK A;  3O3G A;  4CGH A;  3FZM A;  4FPA A;  3R8E A;  3MMV A;  4KBO A;  1TKD A;  4DTO A;  1QVF M;  2PYL A;  2OZM A;  4BAC A;  3AO1 A;  5BR9 A;  1K9M O;  3PIO L;  5AQF A;  4A62 A;  4DSJ A;  1B9D A;  3TAF A;  1HMV A;  2ZWH A;  3JYT A;  3PUF A;  4JK7 A;  3C95 A;  3CJA A;  4H4M A;  3D45 A;  3MK6 A;  1S6Q A;  2OPP A;  2I5J A;  3SUO A;  3TTF A;  3OW2 M;  2UUA K;  2E5L K;  5AQY A;  3CYM A;  2BTF A;  4JKH A;  1P8Z A;  2Z1I A;  4DQP A;  1RCH A;  5GAD P;  2Q3S A;  3VEO A;  2BGG A;  3CJ7 A;  1TK8 A;  3J7A P;  2BUP A;  2O8D B;  1BI4 A;  3MCP A;  4O55 A;  4CJ5 A;  2E2P A;  2P9L B;  3ISN C;  3N4P A;  3O9Q A;  4WE1 A;  3WT0 A;  1RBT A;  1HNI A;  1RDD A;  3M6G A;  1IG8 A;  3G0Z A;  4N5S A;  1JL2 A;  2E8A A;  3DJC A;  1Q7Y O;  4H5R A;  4HWI A;  3DI6 A;  2QWM A;  3VF4 A;  3MCA B;  4BRD A;  1D9F A;  4KPY A;  2E6L A;  1FK9 A;  4I2P A;  2AA4 A;  3JAM O;  1Q9Y A;  3UB5 A;  4ELV A;  1VHX A;  4OO1 J;  3WXL A;  5FPD A;  5GIO A;  1U2V B;  3CFP A;  1DTT A;  3O4W A;  3SAH A;  3SQ0 A;  1MWK A;  4BR9 A;  4FLZ A;  4AQY K;  3SQ2 A;  3ULE A;  3V1O A;  1W2B M;  4RTF D;  3J7Y P;  3OYG A;  3EZ5 A;  4DQI A;  2YHB A;  1P90 A;  2A41 A;  3CCU N;  3SQ4 A;  4K8X A;  4KRE A;  3L2U A;  1U6Z A;  4CBW A;  4OPK A;  3A5L C;  1XC9 A;  4CJR A;  1IG9 A;  1LCU A;  1MWM A;  1YIT N;  4FOE A;  3ZSO A;  4AM7 A;  3VQQ A;  2VCP A;  4FWQ A;  1KC8 O;  2V7Y A;  3AVI A;  1WNS A;  4ISE A;  4C8K A;  3NF9 A;  4BR0 A;  4Z4G A;  4B9M A;  1C1C A;  4DTU A;  4DR6 K;  4BVP A;  3VGM A;  1J53 A;  4KTW A;  3G6E N;  3QER A;  4H4O A;  4LH5 A;  3FGU A;  1NJY A;  1OH5 A;  3FZK A;  4EFH A;  4E7H A;  2IVN A;  1X9W A;  4BE0 A;  4N47 A;  4AHU A;  1WBB A;  4DR1 K;  1G99 A;  2FXU A;  1OH7 A;  5HOO A;  1NLV A;  3NHG A;  3A5O C;  4DHY A;  2GTD A;  3TSQ A;  4U67 L;  1XHX A;  2ZJQ L;  3CJC A;  3VQ9 A;  5JS1 A;  2YKN A;  3ZSV A;  4CJ4 A;  5BR8 K;  4XIU A;  2AJQ A;  1TK0 A;  4CIE A;  2F8T A;  1VSE A;  4NYN A;  2YHX A;  3U9D A;  3IG1 A;  1VQN N;  3TR8 A;  4CVN E;  2NRX A;  5C24 A;  1JLE A;  2X6S A;  3HST B;  1S1U A;  2KKZ A;  1HPM A;  1R59 O;  3K2P A;  3LPT A;  3CXC M;  2KZZ A;  1VSF A;  3NGY A;  3CG7 A;  3VTH A;  3QO9 A;  2O8C B;  2HBM A;  5GIP A;  1T8E A;  1HQU A;  3K5N A;  4HUE A;  3HOS A;  4KH6 A;  2IIR A;  1C0G A;  5M1N A;  3EYZ A;  3AGR A;  1HUX A;  2KQ2 A;  1NJW A;  4CW7 B;  3MXM A;  1Z26 A;  4YDU C;  1LV5 A;  2FBV A;  3VEW A;  1HJR A;  1XNR K;  2I7N A;  4IDK A;  4CZE A;  1RDB A;  3CCR N;  2O8B A;  1GLC G;  3SUQ A;  5EVZ A;  4IJN A;  4BRL A;  3MEG A;  2OPQ A;  3OYC A;  3QEV A;  2HVH A;  2HB5 A;  2VG7 A;  3M1F A;  3L2R A;  2OYQ A;  3D2F A;  1VK0 A;  3E9L A;  4B9L A;  3VQA A;  3NF7 A;  1C0F A;  4N41 A;  3T69 A;  4BRP A;  3MN6 A;  1NK0 A;  3ATV A;  4PQU A;  3O80 A;  1SV5 A;  4DWI A;  1EKE A;  1W0H A;  3ZX0 A;  1BA0 A;  4HTL A;  3TAN A;  3SYZ A;  2XHB A;  4DG1 A;  3L8B A;  5FDL A;  4ZTF A;  1Y64 A;  3THW B;  3RVC A;  1NG9 A;  3IUC A;  1SKW A;  1HNW K;  3O9R A;  4WQ5 C;  2JGU A;  3VPZ A;  3CER A;  1SKR A;  3EEQ A;  2I7P A;  5K14 A;  2HNY A;  3NBP A;  2UUC K;  3DOL A;  4FYD A;  2A5X A;  3LDQ A;  1RTD A;  1BGX T;  3LZI A;  3TTC A;  3BP8 A;  3QDK A;  4BRG A;  2KZM A;  3KLE A;  3CHW A;  4IWV A;  3QFP A;  4CFC A;  5C25 A;  1ZBH A;  1UWB A;  3CCS N;  3R1X A;  1RTI A;  3AVN A;  1HJO A;  3MED A;  1NGC A;  3J8A A;  5JVH L;  3VEX A;  4KHW A;  3DXK B;  2HF3 A;  1GLB G;  3MEC A;  4DQ8 A;  1BOT O;  1KAX A;  4MO5 A;  5AQR A;  2HHT A;  4CGJ A;  2RF2 A;  3CJ9 A;  1BG3 A;  1GOA A;  3KLI A;  2PY5 A;  1C1A A;  4IOX A;  2YNF A;  3AVL A;  3NVM A;  4BC4 A;  4E1M A;  4FJ9 A;  4CZF A;  4FVU A;  1FW6 A;  1YUW A;  5EX5 A;  4WYB A;  1NGJ A;  4CHY A;  1NMN A;  1RTJ A;  4OKE A;  3FZF A;  2P9U A;  1NGD A;  5LJW A;  4FK2 A;  4O0J A;  4R5P A;  3EE9 A;  3S41 A;  4RG8 A;  1TUU A;  4DMN A;  3H08 A;  3KLF A;  3DLL L;  4HCC A;  3GE1 A;  1YAG A;  1XMO K;  4IFV A;  4DV0 K;  1HKB A;  1DT9 A;  2GWK A;  3V1Q A;  4EZ6 A;  5C42 A;  3SQ1 A;  1C0T A;  1KSP A;  2A3Z A;  1NK4 A;  5B8H A;  1SKS A;  3ZET A;  3LZJ A;  1K8K B;  4GV3 A;  4BC2 A;  4DTN A;  3AA2 A;  3AVK A;  3WXM B;  1VQO N;  4M3T A;  1BQN A;  4BQZ A;  5C10 A;  4KHP K;  3H45 C;  3OTO K;  3SMS A;  1QS4 A;  4NLC A;  4RCH A;  4FLY A;  4MDB A;  2G8F A;  1QE1 A;  4KFB A;  5F1X A;  2KHO A;  3W0L A;  4C1N I;  4B3M K;  3KWG A;  3KWI A;  3MWP A;  5CZ2 A;  3LDN A;  3PSI A;  3C7N A;  3OS1 A;  4CJV A;  3HP6 A;  2RKI A;  4L8R B;  2E6M A;  3AVH A;  3KVG A;  4QS9 A;  3VMF B;  5JMV A;  1YJN N;  1I39 A;  4CD3 A;  1HX1 A;  5FLX O;  3D6R A;  4LFA K;  4KHY A;  4FJ8 A;  2GUI A;  5KGW A;  4B08 A;  2HMI A;  1C0U A;  3JS6 A;  4PY5 A;  1KAY A;  4DQQ A;  4KTZ A;  1JLB A;  3U6F A;  3P83 D;  4J2B A;  3L4I A;  5BN8 A;  2P9K A;  1TAU A;  5A2Q O;  3ZSY A;  4B9V A;  4B9Q A;  3HPG A;  3L6Q A;  5SZT A;  2BDP A;  3AO2 A;  2ZJP L;  4CZL A;  1S9E A;  4IJA A;  1WSG A;  1VQK N;  1D4X A;  1NK7 A;  1XI1 A;  3CJ1 A;  2DTU A;  3RSE A;  5GAG P;  4KH4 A;  1D9D A;  4B9U A;  1N6Q A;  2P9N A;  3OBY A;  3QFU A;  2X6N A;  3A0I X;  3E9O A;  5EY4 A;  2HND A;  1BHL A;  4EAH D;  5LY3 A;  4DTP A;  2QW9 A;  4MDA A;  1J6Z A;  4K42 A;  4I9Q A;  3RRH A;  4CEZ A;  3O3H A;  3ZSQ A;  3WQU A;  4CFB A;  3H1V X;  2VQE K;  1JLA A;  2PYJ A;  4NCG A;  4C1N K;  4JKA A;  3EY1 A;  1KFD A;  5CZ1 A;  4A57 A;  3OYD A;  1S3X A;  4CJP A;  4H5V A;  2P9I A;  4A2B A;  2P1J A;  5GAE P;  2BH1 A;  3HPH A;  5C0Y A;  3OJU A;  4BRO A;  4LF6 K;  4WCE L;  2P9P B;  1L3T A;  2X78 A;  3ZSZ A;  4E1N A;  1QQO A;  4ILH A;  4CGG A;  3KKS A;  1DTQ A;  5JLH A;  3DAW A;  3Q7B A;  3QNN A;  1WOQ A;  4OGE A;  1S22 A;  2F8S A;  1Z25 A;  3HSC A;  4FK4 A;  3NMU A;  1EET A;  3FE1 A;  3QET A;  4A2A A;  3WEE B;  3DLE A;  3CCJ N;  3U9Z A;  4ZTJ A;  1CZB A;  1X9M A;  3V81 A;  4LF7 K;  4FM1 A;  5T7B A;  1HYZ A;  4M3X A;  4FSV A;  1Q9X A;  2E2N A;  2F9W A;  3E9P A;  4CZJ A;  1HNZ K;  1BL3 A;  4B3T K;  4DU3 A;  1HKC A;  4FWK A;  3ATU A;  4OKK A;  4CEE A;  3A8Y A;  4LF4 K;  3L0Q A;  2O8E A;  4M63 C;  4PL8 A;  1U49 A;  3O9U A;  4K25 A;  3VET A;  1XUP O;  4F2R A;  2OZS A;  4QCL A;  4O5B A;  4IEI A;  3FFI A;  5AQV A;  3P4I A;  3THY A;  5JLF A;  2HW3 A;  3UKR B;  4J2A A;  3BZK A;  2HHV A;  3ENH A;  1ZYQ A;  3V6D A;  1G15 A;  3ENO A;  3BY5 A;  2UYT A;  5AQS A;  1JLC A;  1NWK A;  4F9O A;  4FPB A;  3ZSR A;  4Q0B A;  1ZBL A;  1XNQ K;  4GY2 B;  1EQY A;  4CF1 A;  1GLA G;  2W41 A;  3PV8 A;  1QZ6 A;  3B6O A;  4PKH A;  2EHG A;  5SWM A;  2Q2R A;  4JKD A;  4RW4 A;  1XMQ K;  4OVL A;  4M3U A;  2HBJ A;  5MLC Q;  3CPE A;  1D8Y A;  3IS9 A;  1CZ9 A;  3BF3 A;  1YI2 N;  3HL8 A;  4FVM A;  2HHU A;  4N56 A;  4DSF A;  3PX4 A;  4KI4 A;  1TKX A;  1TKZ A;  3R3L A;  3VES A;  4FJH A;  1RIL A;  1X9S A;  1BO5 O;  4H0V B;  5J2P A;  3K59 A;  4JKB A;  2HVI A;  3HZ6 A;  4YOY A;  2B5J A;  3VQB A;  5FRM A;  2G8H A;  2HNZ A;  3OYE A;  4DTM A;  3SUN A;  1BI4 B;  5AZI A;  4CCH A;  3DRS A;  3VF6 A;  1IH7 A;  3SK3 A;  3WNH A;  3K5L A;  2YKM A;  4FWR A;  4CK3 A;  1KVA A;  4DR4 K;  3MAQ A;  3GBT A;  4OLA A;  1BIZ A;  5M1F A;  4G1Q A;  2E4L A;  4NLB A;  1WSJ A;  4GVE A;  4BR2 A;  4DS5 A;  1NGG A;  4YOX A;  4XH5 A;  1BCM A;  4CEC A;  3CME N;  3AVA A;  4JKE A;  5HBM A;  4FK0 A;  1C1B A;  3DWL A;  4EIA A;  1GLJ O;  1NOY A;  1ASU A;  1TAQ A;  4BC5 A;  3OS0 A;  3LP1 A;  2VWB A;  4I9L A;  1RT4 A;  4Y0W A;  3HXM A;  1NK6 A;  2QXF A;  1M90 O;  5KI6 A;  1JL1 A;  4JAX A;  4BVO A;  3TTD A;  4DSL A;  4W5Q A;  4HUF A;  3ULE B;  4JKF A;  4X64 K;  3NCI A;  4CFD A;  3DRP A;  4LC9 B;  2VG5 A;  3CCE N;  4MLH A;  3CJB A;  4J2E A;  2Z1H A;  2H3G X;  1RT6 A;  4BDP A;  2FF6 A;  4ISF A;  3MDQ A;  1NGF A;  2D4W A;  4JNE A;  1NGI A;  3L3U A;  3BGR A;  5KRT A;  4EP4 A;  4FXD A;  1N36 K;  4LFC K;  1UOC A;  3AA5 X;  5AQT A;  1XC3 A;  3MN7 A;  4H8K A;  4DV7 K;  3HM9 A;  3QML A;  3IMX A;  1VQ8 N;  4JN4 A;  2WC9 A;  1CXU A;  1E4F T;  3NH1 A;  1DEJ A;  3HI0 A;  4CJ3 A;  3VGL A;  3L4Q A;  4Y1D A;  5M1Q A;  4E3S A;  3SBT A;  2XY7 A;  3OYH A;  4BRI A;  4CHP A;  4H0X B;  1W9H A;  2GUP A;  3NH2 A;  1YTA A;  3P39 A;  1HYS A;  2F7T A;  2PBD A;  4DV3 K;  2O4G A;  2D5R A;  2QEX N;  2JLE A;  3LM2 A;  3S3O A;  4F2S A;  3CQX A;  3ZEU A;  3LM9 A;  1ZXO A;  4PWD A;  4ILJ A;  1ASW A;  3QIO A;  3OYL A;  2ETJ A;  3C0B A;  4O44 A;  1IKX A;  4O4G A;  3HVT A;  2D0C A;  4OLB A;  3C6H A;  5AQH A;  1VSH A;  4DV1 K;  2ASM A;  4XH4 A;  3ZX3 A;  1CZA N;  2IS3 A;  3D0P A;  2HHQ A;  1RDA A;  4U7B A;  4CJS A;  1IJJ A;  4UQG A;  1B9F A;  1OKJ A;  3VOV A;  3O08 A;  4IOC L;  1LWE A;  3CQY A;  1YF5 L;  2ZGY A;  4FWL A;  1NBW A;  3WQT A;  1HNX K;  1VQ5 N;  1VQ6 N;  4AHS A;  3ALY A;  4QOZ B;  3LPU A;  5FPE A;  4E89 A;  4I6M A;  4QS8 A;  1BIU A;  2EX3 A;  3ASM A;  5BRE A;  1J54 A;  1X3M A;  2HMP A;  3V1R A;  3TI0 A;  2FBT A;  4FWO A;  3ZSW A;  3AVC A;  4FW1 A;  1GOB A;  4AHV A;  2Y1I A;  2O8B B;  4IKF A;  1EP4 A;  2NRZ A;  4PL7 A;  3BF1 A;  3TAR A;  3WNF A;  4BQL A;  2IOC A;  3HM8 A;  1NMD A;  2O4I A;  1WB9 A;  3ZT0 A;  1T6C A;  3DOK A;  3F5T A;  4K8Z A;  3KIO A;  4H0T B;  1V4T A;  5M1O A;  4KB0 A;  3D2F B;  3O4Q A;  4CEO A;  1GLF O;  3EKU A;  4KV8 A;  1RTH A;  4IO9 L;  4KI6 A;  3D2E A;  2HOE A;  4BR7 A;  1VSI A;  4CF9 A;  4W5O A;  1KQS M;  4W5N A;  4M3R A;  5AQX A;  2GEM A;  3G25 A;  3M8Q A;  4Z94 A;  2IDO A;  3M8S A;  4LF5 K;  3LDL A;  4IFE A;  5AQU A;  4B1Y B;  4FWN A;  4B1X B;  4M3Z A;  4CJF A;  5AQN A;  3F9K A;  1TYQ A;  4JI5 K;  1N34 K;  1WSH A;  1ITG A;  4JKG A;  4JI6 K;  3J80 O;  4Z0U A;  3EO3 A;  1A5W A;  4GKJ K;  2Q36 A;  3LDP A;  3AY9 A;  3TAQ A;  1J9A A;  4PKI A;  2B6A A;  3J7Z O;  3M3Z A;  3BZC A;  1IKY A;  3LDS A;  3FR0 A;  4CIG A;  4H5N A;  3RMA A;  4AIL C;  3DLK A;  2EWS A;  2HHH K;  4E7L A;  2ASP A;  3V9Z A;  3SV3 A;  1NJI O;  4E7J A;  4FJ5 A;  2ATQ A;  4JD2 A;  4M7X A;  3I55 N;  5AQL A;  4CZI A;  2RHK A;  4JLH A;  4ICL A;  3EL2 A;  2QI2 A;  1EWR A;  2GWJ A;  1HKG A;  1Q86 O;  1NGB A;  3VEV A;  4AH9 A;  1L5U A;  1SL0 A;  5JIC A;  3LP2 A;  2JWL A;  5CE3 A;  2A42 A;  3L3V A;  1KLN A;  3QLH A;  3CC2 N;  1YVN A;  3WNG A;  3CQ8 A;  3TPQ A;  2UXC K;  2IVO A;  4E7K A;  2FBX A;  3NDK A;  4DU4 A;  1XHZ A;  1VSM A;  1C0M A;  2A1R A;  3DMJ A;  2P9U B;  4FZX C;  3AV9 A;  3K0S A;  2YNI A;  5AQG A;  3QBX A;  3ZT1 A;  1RBV A;  2OTL N;  3K9K A;  3T7Z A;  4X66 K;  3J81 O;  5KRS A;  2QTD A;  3U3G A;  1NK9 A;  1Z6R A;  1TVR A;  3DLG A;  4H0P A;  1QQC A;  4BR5 A;  5AZJ A;  2Z1G A;  5BN9 A;  3BDP A;  2WUS A;  2FSN A;  3SUP A;  2OAN A;  2NUB A;  3AVJ A;  5GIN A;  4Z4C A;  4DR5 K;  4OJR A;  2QWQ A;  3ZET B;  4RW9 A;  1NM1 A;  1WSE A;  2BE2 A;  4JS5 A;  2VWK A;  1N32 K;  4LSN A;  4BWJ A;  1J5E K;  3C6A A;  4LSL A;  5TKW A;  4FZZ A;  3CD6 N;  4KH5 A;  1FJG K;  1KVC A;  4FLU A;  3CCL N;  1IBK K;  3I0S A;  2CGL A;  2VQF K;  1L3V A;  5HRS A;  2WFB A;  3KLG A;  4DSE A;  2AP1 A;  4FJJ A;  1KVB A;  1F21 A;  4XEI A;  3C7N B;  4GW6 A;  3QES A;  1HLU A;  3GDQ A;  3NVK A;  2DFE A;  4OPH A;  3ZSX A;  1RDW X;  3KJV A;  5HRO A;  3LDO A;  4DTX A;  2XY5 A;  4NCB A;  1JXE A;  4Z4I A;  1KD1 O;  5F0X A;  3OVN A;  3UKU A;  4CHQ A;  3T19 A;  4IG0 A;  4H5T A;  4A61 A;  2D1K A;  2XY8 A;  4B9N A;  1Y97 A;  2RPI A;  4Y1C A;  2OCE A;  3FLC O;  2P9K B;  4KKO A;  3MEE A;  5J1E A;  1NJZ A;  1LW2 A;  4LFB K;  2E1Y A;  3PSF A;  4OGC A;  5E41 A;  1IBM K;  3JSM A;  2ITM A;  2HF4 A;  3HJF A;  3D7E O;  2RE2 A;  3RSE B;  3JXU A;  3VQC A;  1EO1 A;  1RDC A;  2P9N B;  2PAV A;  3CC7 N;  2OA8 A;  1GLD G;  2NRT A;  3PX6 A;  4BRA A;  1VQ7 N;  1LWF A;  2CH5 A;  3O8M A;  3V9S A;  1VAZ A;  2D0P A;  4FM0 A;  3HRG A;  4C8O A;  4FCY A;  2HHW A;  2A40 A;  1YIJ N;  4K0K K;  4DUY K;  2WTU A;  3AVG A;  3QEX A;  3WXJ A;  1BA1 A;  3ZCM A;  3DXM A;  2NNW A;  4YOV A;  4NO7 A;  1Q8I A;  1U47 A;  5LJV A;  3EKS A;  3RRG A;  2YJF A;  1O1W A;  2VG6 A;  5AQQ A;  1TV6 A;  4WQ4 A;  2P9I B;  2XY6 A;  4MFB A;  4BRQ A;  3AAQ A;  1O13 A;  3VA0 A;  2B4J A;  4JRP A;  3SAG A;  3CM5 A;  1K8A O;  2D0O A;  4B3O A;  1JCF A;  3KK3 A;  1T44 A;  5D3G A;  2LSN A;  4WFN L;  3RTV A;  4FWS A;  3FZL A;  4CZK A;  3P1G A;  4BG9 A;  3NFA A;  4BE1 A;  3R9P A;  1NNE A;  4YOW A;  4H5W A;  5H1S Q;  3THX A;  2IC3 A;  3TAG A;  3HVR A;  3NH0 A;  5KQD A;  2WBN A;  4JHD A;  1JLQ A;  3HT3 A;  3PO5 A;  2HBK A;  3VQD A;  4FLW A;  3KK2 A;  1XQS C;  3QIC A;  2X74 A;  3VQ6 A;  1QZ5 A;  4DV4 K;  5EU7 A;  3CPW M;  4HTU A;  4KTQ A;  3OS2 A;  3DRR A;  1NOZ A;  4RWT A;  3L2V A;  4GMJ B;  4DCH A;  2ZGZ A;  1OH6 A;  4B3R K;  1ILY A;  2O8E B;  4M3W A;  1E3M A;  3MXJ A;  5ADX H;  2QWL A;  3F73 A;  1S1V A;  3AVF A;  1JJ2 M;  4ID5 A;  4FJX A;  5LMU K;  1RT3 A;  1ATN A;  1K6Y A;  1MA9 B;  2E2Q A;  4CES A;  4CHZ A;  3TAP A;  2OPR A;  3THY B;  5EOY A;  2VGM A;  2FLO A;  3DLR A;  3CCV N;  4X62 K;  3P31 A;  5JS2 A;  4M3Y A;  4JK9 A;  1FKP A;  4FZY A;  5M1K A;  4DV2 K;  5HP1 A;  2DY4 A;  3WNE A;  4O8U A;  5AFU H;  4BRF A;  4B1Z A;  1CLQ A;  1VRT A;  5FPM A;  3NF6 A;  2QKK A;  3K9J A;  4DQS A;  1IO2 A;  2QA4 N;  4ILG B;  1KLM A;  3MX2 A;  1T7P A;  5ADX A;  4I7F A;  3VEY A;  2O8F A;  4FJG A;  1ASV A;  2JWK A;  4DS4 A;  4DSI A;  3GL1 A;  3L2Q A;  1LAW A;  4E7I A;  3O9S A;  1MU2 A;  1WLJ A;  4GNI A;  4CEA A;  3GG4 A;  3QEW A;  3TAE A;  4NCA A;  1RT1 A;  5AFU A;  4AHT A;  1L3S A;  3KTQ A;  1VRU A;  3R6M A;  2XO7 A;  2V7Z A;  5DMR A;  2E20 A;  2IAJ A;  2YNG A;  4Z4F A;  3TSP A;  2QM1 A;  4YNQ A;  1KTQ A;  3SCX A;  4HCB A;  3G71 N;  3SPZ A;  5AZI B;  3UE5 A;  5FRO A;  2ZD1 A;  4B1V A;  4IOA L;  4G9Z A;  3OA9 A;  3I0R A;  3HOT A;  3L2W A;  4CJU A;  4IZ9 A;  4MO4 A;  3LWL A;  1YXQ A;  3O5B A;  3P38 A;  4B3S K;  3CC4 N;  3EE8 A;  3AA3 A;  1WUA A;  4WFA L;  4GV6 A;  4EHT A;  4GVM A;  5GAH P;  1WSF A;  3NF8 A;  1EXQ A;  2FSJ A;  3ZT3 A;  3H6E A;  4ISG A;  5C15 A;  4A5A A;  5FRN A;  3SMP A;  2R7Y A;  1KAZ A;  4JI2 K;  2ITG A;  4CED A;  3OYI A;  1TKT A;  3ZT4 A;  1WN7 A;  2YHY A;  1W7A A;  2DPN A;  1NK8 A;  2FC0 A;  5J2M A;  1A5X A;  3M8P A;  3PLA A;  1U45 A;  4ELU A;  1S5J A;  2NZT A;  1U4B A;  5AQP A;  1GLE G;  4DUZ K;  1IV0 A;  4C8M A;  3QNO A;  4CER A;  3SJJ A;  4BRM A;  2Q0R A;  2P9S A;  3H1Q A;  2W6L A;  1JCG A;  4CI6 A;  1TUY A;  1NKB A;  3MX5 A;  3SNN A;  4I2Q A;  1JXB A;  4DSK A;  3O1B A;  4YHH K;  3KK7 A;  3CMA N;  3TWH A;  3AO5 A;  4A59 A;  4UY8 O;  4H0Y B;  5IT9 O;  3AAP A;  1WAJ A;  2YCH A;  5FPN A;  4F8R A;  1FXX A;  1UA1 A;  4PKG A;  3CM6 A;  1QQM A;  1T6D A;  4BWM A;  3AO3 A;  3LP3 A;  4HUG A;  3KHY A;  1MDU B;  3CCQ N;  1WSI A;  2ZE2 A;  1VQ4 N;  3KK1 A;  4IO8 A;  3VA3 A;  1DKG D;  4HHT A;  1HRH A;  4CBU A;  2KFZ A;  3LP0 A;  4FLT A;  2GEL A;  2DFH A;  3ZEU B;  3AA4 A;  4KRF A;  3DYA A;  2G8I A;  4DFJ A;  2WOM A;  4LY7 A;  4YOT A;  4H0O A;  3RR7 A;  3LWM A;  2KLA A;  3ZT2 A;  2CGJ A;  1YVU A;  3QIN A;  1QTM A;  4OKJ A;  2PFU A;  4JV5 K;  4LD0 A;  3RMD A;  1H1V A;  3S3N A;  1LWC A;  1S1T A;  3PY8 A;  3SZ2 A;  3BEX A;  4CHO A;  4TSX A;  3QEP A;  4FWM A;  3A5N C;  3U3Y A;  4BDY A;  4WF9 L;  1OVQ A;  4DF4 A;  5I3U A;  4XH1 A;  5KGX A;  1VQL N;  4AHC A;  2QWN A;  5AQM A;  3EZW A;  4H03 B;  1BUP A;  1KXP A;  4BE2 A;  3LAK A;  1RBR A;  3ID6 A;  4Z4E A;  1SUQ A;  3CIP A;  3DLH A;  4I6M B;  3CFO A;  1DLO A;  2KFN A;  3AO4 A;  3O6W A;  2GV9 A;  1N33 K;  1RNH A;  1QQN A;  4NXM K;  1SL2 A;  2E88 A;  4L3Q A;  4DTR A;  2UXB K;  4F4K A;  1NKC A;  1R0A A;  2F96 A;  4DR3 K;  4GKK K;  3LL3 A;  4EZ9 A;  2UXD K;  3PIP L;  4C23 A;  1EWQ A;  1N5Y A;  3W3D A;  4OX9 K;  4LF8 K;  2GX9 A;  2O8D A;  3MN9 A;  3VEN A;  3SBG A;  5BRH A;  4IXC A;  4E1J A;  2P9L A;  4IBN A;  1NGH A;  1BU6 O;  4IFY A;  3I56 N;  3OYN A;  3D2E B;  4LH4 A;  5HLF A;  1QHT A;  5JVG L;  1YTU A;  2W40 A;  2OTJ N;  2G8W A;  2BAN A;  4E19 A;  5HRR A;  2W42 A;  3OJS A;  2VYP A;  1RBU A;  2XRI A;  4HVJ A;  1BIS A;  1TYQ B;  1QSL A;  4JKG B;  4AHR A;  2IVP A;  1ATS A;  4DKW A;  4DTS A;  1BCO A;  2QXL A;  1U2V A;  4FM2 A;  2F9T A;  4JEP A;  1WAF A;  2HHS A;  4Q5V A;  4JYA K;  3THV A;  1XWL A;  3IFR A;  5KQ8 A;  2RN2 A;  5AQZ A;  3UIQ A;  1W97 L;  5CR4 A;  3OYK A;  1T05 A;  1VSJ A;  1RBS A;  2W6K A;  4JD2 B;  3VQE A;  5J2Q A;  2Q97 A;  3RMB A;  4V19 S;  4ID1 A;  1VSK A;  4CE9 A;  3VER A;  4CEB A;  4QAG A;  3HO1 A;  2ZM6 K;  2DFF A;  1FKO A;  3ZX2 A;  2P5O A;  3O1W A;  4FJI A;  1Q82 O;  1S6P A;  4FOI A;  2G8K A;  4CBX A;  5DM6 L;  3A2F A;  3H46 O;  3C94 A;  1QSY A;  3M5R A;  1ZBU A; 
#chains in the Genus database with same CATH homology
 3HSC A;  4NB4 A;  4IEE A;  2BTF A;  4JKH A;  1P8Z A;  3A5M C;  3NMU A;  3FE1 A;  1T3V A;  5GAD P;  3VEO A;  4A2A A;  3CJ7 A;  3EN9 A;  3FLC O;  3WEE B;  2BUP A;  2Q0U A;  2P9K B;  3CCJ N;  3U9Z A;  3MCP A;  4BRE A;  2E2P A;  4BRC A;  2J4R A;  2P9L B;  3N4P A;  3QBW A;  3O9Q A;  2E1Y A;  4FSV A;  2E2N A;  2F9W A;  3E9P A;  3WT0 A;  4CZJ A;  2YHW A;  1HKC A;  4WQ4 C;  4FWK A;  3ATU A;  4AM6 A;  2ITM A;  2HF4 A;  3M6G A;  1IG8 A;  3A8Y A;  3D7E O;  3L0Q A;  2RE2 A;  1ZBS A;  2E8A A;  3DJC A;  4M63 C;  3RSE B;  3JXU A;  1Q7Y O;  4PL8 A;  4H5R A;  4HWI A;  4CD1 A;  3O9U A;  4K25 A;  1EO1 A;  3VET A;  2QWM A;  3VF4 A;  1XUP O;  3H3N O;  2P9N B;  2PAV A;  3MCA B;  4BRD A;  2FSK A;  2QWR A;  5AZJ B;  3CC7 N;  3VTI A;  1GLD G;  2NRT A;  4IEI A;  1VQM N;  2AA4 A;  4BRA A;  5AQV A;  3P4I A;  4BGB A;  3UB5 A;  1VQ7 N;  5I9E B;  1YHQ N;  2CH5 A;  2YJE A;  3O8M A;  5JLF A;  3CCM N;  1VAZ A;  3UKR B;  2D0P A;  3ENH A;  4OO1 J;  1QVG M;  3HRG A;  3WXL A;  5FPD A;  3ENO A;  2A40 A;  5GIO A;  1U2V B;  1YIJ N;  4BY9 C;  4K43 A;  4CZM A;  2UYT A;  5AQS A;  3O4W A;  1NWK A;  4F9O A;  4FPB A;  3SAH A;  1MWK A;  4BR9 A;  3WXJ A;  1BA1 A;  4GY2 B;  1EQY A;  3DXM A;  2NNW A;  3ULE A;  4YOV A;  4NO7 A;  4RTF D;  2ZJR L;  1W2B M;  5LJV A;  3EKS A;  4YOU A;  2YJF A;  2Q1N A;  3TSU A;  3ZYY X;  1GLA G;  2W41 A;  5AQQ A;  4AF1 A;  1QZ6 A;  3CCU N;  1P90 A;  2A41 A;  4PKH A;  2Q2R A;  3H3O B;  4WQ4 A;  1RFQ A;  4JKD A;  2P9I B;  4BRQ A;  3AAQ A;  2HBJ A;  1U6Z A;  5MLC Q;  3CPE A;  4CBW A;  3A5L C;  1O13 A;  3FFK B;  3SAG A;  5ELZ A;  1E4G T;  1LCU A;  3BF3 A;  1YI2 N;  1K8A O;  1RGI A;  2D0O A;  1MWM A;  5AR0 A;  1JCF A;  1YIT N;  3C65 A;  4FOE A;  4CZG A;  4AM7 A;  1K73 O;  1T44 A;  2VCP A;  4FWQ A;  1KC8 O;  2V7Y A;  4WFN L;  4FWS A;  3R3L A;  3VES A;  4ISE A;  3FZL A;  1X3N A;  5KPZ A;  4CZK A;  4BR0 A;  1BO5 O;  4BG9 A;  3R9P A;  4YOW A;  4H0V B;  4H5W A;  5H1S Q;  4BG8 A;  4BVP A;  3UKU B;  3VGM A;  4JKB A;  3HZ6 A;  4YOY A;  3G6E N;  5KQD A;  2WBN A;  1SZ2 A;  4JHD A;  1Q18 A;  4BGA A;  3AAR A;  3FGU A;  2HBK A;  1XQS C;  3FZK A;  4EFH A;  5AZI A;  2IVN A;  3QIC A;  3VF6 A;  1Z05 A;  1QZ5 A;  4BR4 A;  3SK3 A;  1LOT B;  3CPW M;  4FWR A;  1G99 A;  2FXU A;  1BWF O;  3ID8 A;  5HOO A;  1NLV A;  3ENB A;  1YJ9 N;  4RWT A;  3A5O C;  3GBT A;  4DCH A;  4DHY A;  2GTD A;  2ZGZ A;  5M1P A;  3SLC A;  3TSQ A;  4U67 L;  2ZJQ L;  1ILY A;  3CJC A;  5M1F A;  3F9M A;  5EXW A;  4NLB A;  4PHT X;  2QWL A;  5ADX H;  1GLL O;  4GVE A;  4BR2 A;  1JJ2 M;  3WUH A;  1NGG A;  4YOX A;  4XH5 A;  1ATN A;  3CME N;  2E2Q A;  1MA9 B;  4YOR A;  5TKY A;  2NRH A;  4JKE A;  2YHX A;  5EOY A;  3U9D A;  2VGM A;  2FLO A;  3IKM A;  5KPR A;  3CCV N;  1VQN N;  5BRD A;  5C2F A;  3DWL A;  2NRX A;  3P31 A;  4EIA A;  1GLJ O;  4JK9 A;  2E2O A;  5M1K A;  3E66 A;  4BC5 A;  2VWB A;  3GOI A;  4Y0W A;  1X9J A;  1M90 O;  2KKZ A;  1HPM A;  4BRF A;  4O8U A;  1R59 O;  5AFU H;  4JAX A;  4BVO A;  3CXC M;  3TTD A;  3N4Q A;  1ATR A;  4B1Z A;  3VTH A;  3DXM B;  4JKF A;  5FPM A;  3ULE B;  2HBM A;  5GIP A;  3K9J A;  1SAZ A;  4KH6 A;  3HOS A;  2IIR A;  4LC9 B;  1C0G A;  5M1N A;  2QA4 N;  5AQK A;  3AGR A;  3CI5 A;  1HUX A;  3DXK A;  4ILG B;  3F2K A;  4MLH A;  4B1W B;  3CCE N;  3MX2 A;  3CJB A;  2VGN A;  4YDU C;  5ADX A;  2H3G X;  2FF6 A;  3VEY A;  4ISF A;  2YX6 A;  1NGF A;  3MDQ A;  3VEW A;  2D4W A;  4JNE A;  2I7N A;  1NGI A;  4CZE A;  2JWK A;  1JCE A;  3CCR N;  3GL1 A;  1VQP N;  1GLC G;  3O9S A;  5AQT A;  1XC3 A;  5AQO A;  3MN7 A;  2V52 B;  5EVZ A;  3QML A;  3IMX A;  1VQ9 N;  1VQ8 N;  3Q7C A;  4GNI A;  3GG4 A;  4IDH A;  4IJN A;  4JN4 A;  2WC9 A;  1E4F T;  4BRL A;  2ZF5 O;  1DEJ A;  3HI0 A;  5AFU A;  3VGL A;  3L4Q A;  3R6M A;  5M1Q A;  3M1F A;  2V7Z A;  2FF3 B;  3OBW A;  2E20 A;  3D2F A;  3AGK A;  3SBT A;  3E9L A;  4JHD B;  4BRI A;  1C0F A;  3TSP A;  2QM1 A;  4H0X B;  3T69 A;  2ASO A;  4BRP A;  3MWT A;  3MN6 A;  2GUP A;  3G71 N;  4JKC A;  5AQI A;  5AZI B;  3ATV A;  3P39 A;  3UE5 A;  2F7T A;  2PBD A;  2NRV A;  4B1V A;  3O80 A;  5E26 A;  5C12 A;  4IOA L;  4G9Z A;  3OA9 A;  2QEX N;  3LM2 A;  4YDU A;  3HOT A;  5HL7 L;  3ZX0 A;  1BA0 A;  2NRR A;  1SS6 A;  4IZ9 A;  4HTL A;  4MO4 A;  1YXQ A;  1NGA A;  3CQX A;  4MLE A;  3ZEU A;  3LM9 A;  1ZXO A;  3O5B A;  3P38 A;  4ILJ A;  3CC4 N;  1NGE A;  3EE8 A;  1Y64 A;  3RVC A;  5BPM A;  3IUC A;  3C0B A;  3O9R A;  1WUA A;  4WQ5 C;  4WFA L;  3VPZ A;  4OPA A;  4EHT A;  4GV6 A;  3CER A;  2I7P A;  5GAH P;  3SAF A;  1K8K A;  3B8A X;  3C6H A;  2A5X A;  2FSJ A;  1Q81 O;  3H6E A;  3WXK A;  5AQH A;  3LDQ A;  4ISG A;  5C15 A;  4A5A A;  2ASM A;  4XH4 A;  3SMP A;  3ZX3 A;  1KAZ A;  1CZA N;  2YHY A;  2DPN A;  3TTC A;  4O8K A;  3BP8 A;  3QDK A;  4BRG A;  4U7B A;  1IJJ A;  3VOV A;  1OKJ A;  1RDU A;  3O08 A;  3CHW A;  4IOC L;  2E1Z A;  4IWV A;  3PLA A;  3E1Y A;  3QFP A;  3CQY A;  1YF5 L;  2ZGY A;  4FWL A;  1NBW A;  5AQY A;  3WQT A;  1OVY A;  1VQ5 N;  2NZT A;  1VQ6 N;  5AQP A;  5BRF A;  3CCS N;  1GLE G;  3R1X A;  1HJO A;  5FPE A;  1NGC A;  3J8A A;  5JVH L;  3VEX A;  4I6M A;  4QS8 A;  3DXK B;  4GV9 A;  2HF3 A;  1GLB G;  4BRM A;  2Q0R A;  4DQ8 A;  1BOT O;  1KAX A;  2P9S A;  3H1Q A;  4MO5 A;  1X3M A;  2QWP A;  5AQR A;  5BRE A;  1JCG A;  3CJ9 A;  4CI6 A;  1BG3 A;  1TUY A;  4WQ5 A;  5BPN A;  1SQK A;  2HMP A;  3O9T A;  4IOX A;  3MX5 A;  4FWO A;  3NVM A;  4BC4 A;  4FL9 A;  3HBT A;  4DB3 A;  2NRZ A;  4PL7 A;  3BF1 A;  4CZH A;  3BUZ B;  3O1B A;  3KK7 A;  3CMA N;  4A59 A;  4BQL A;  4UY8 O;  4H0Y B;  3AAP A;  3HM8 A;  1NMD A;  2CGK A;  4CZF A;  2YCH A;  5FPN A;  4FVU A;  1T6C A;  1YUW A;  4FO0 A;  3G4S N;  3F5T A;  5EX5 A;  4H0T B;  4WYB A;  2V51 B;  1NGJ A;  1V4T A;  5M1O A;  3D2F B;  4PKG A;  1GLF O;  1QQM A;  3EKU A;  1T6D A;  3FZF A;  3VF2 A;  1V4S A;  2NRW A;  2P9U A;  3U8X A;  1NGD A;  5LJW A;  3KHY A;  4J8F A;  1MDU B;  3CCQ N;  4IO9 L;  4R79 A;  1VQ4 N;  1ESV A;  3D2E A;  2HOE A;  4BR7 A;  4IO8 A;  1DKG D;  3EE9 A;  3S41 A;  1KQS M;  1TUU A;  1QHA A;  3DLL L;  2YI1 A;  1N8R O;  5AQX A;  2GEM A;  3G25 A;  3GE1 A;  3HTV A;  4CBU A;  4Z94 A;  1YAG A;  3LDL A;  2GEL A;  4BRN A;  3QB0 A;  1YJW N;  3ZEU B;  1HKB A;  1DT9 A;  2GWK A;  4FWN A;  4IFE A;  5AQU A;  4B1Y B;  4B1X B;  4YOT A;  4H0O A;  5AQN A;  1TYQ A;  2KLA A;  2CGJ A;  2A3Z A;  4JKG A;  3EO3 A;  5B8H A;  2PFU A;  3ZET A;  1H1V A;  1S72 N;  5KPT A;  1K8K B;  4GV3 A;  2Q36 A;  3LDP A;  3AY9 A;  1BDG A;  2QWO A;  4BC2 A;  3WXM B;  3BEX A;  3MN5 A;  3KZB A;  4PKI A;  1VQO N;  4CJ7 A;  2HBL A;  3J7Z O;  3M3Z A;  3I8B A;  1M1K O;  4FWM A;  1ZC6 A;  3FR0 A;  3A5N C;  4BQZ A;  5C10 A;  4H5N A;  3H45 C;  4WF9 L;  4JK8 A;  3SMS A;  4NLC A;  4XH1 A;  2EWS A;  4RCH A;  1VQL N;  2ASP A;  4MDB A;  2QWN A;  5AQM A;  3EZW A;  3I33 A;  4H03 B;  3VEZ A;  1BUP A;  1KXP A;  2KHO A;  3W0L A;  5F1X A;  1NJI O;  4C1N I;  5DM7 L;  3KWG A;  5BPL A;  3KWI A;  4BC3 A;  3MWP A;  4JD2 A;  4K41 A;  4M7X A;  2A6A A;  3ID6 A;  3I55 N;  5AQL A;  4CZI A;  3LDN A;  2RHK A;  3CIP A;  3C7N A;  3EL2 A;  2QI2 A;  4I6M B;  2GWJ A;  2P9P A;  4BRH A;  3O6W A;  4QS7 A;  3KVG A;  4QS9 A;  2P9S B;  3VMF B;  5CHI A;  1HKG A;  5JMV A;  1YJN N;  1Q86 O;  1QQN A;  4CD3 A;  1HX1 A;  3D6R A;  1NGB A;  3VEV A;  2E88 A;  3U4L A;  2CH6 A;  3CF5 L;  4L3Q A;  4A5B A;  5C2D A;  4O5F A;  5JIC A;  2JWL A;  5CE3 A;  3JS6 A;  2A42 A;  3LL3 A;  1KAY A;  3PIP L;  4C23 A;  3CC2 N;  1YVN A;  3W3D A;  5F2R A;  3L4I A;  3WEE A;  2GX9 A;  3TPQ A;  5BN8 A;  2IVO A;  3MN9 A;  2P9K A;  3VEN A;  1DGK N;  3SBG A;  3TU5 A;  5BRH A;  4B9Q A;  4IXC A;  4E1J A;  2P9L A;  3L6Q A;  2P9U B;  1NGH A;  1BU6 O;  2ZJP L;  4CZL A;  3I56 N;  3D2E B;  5AQG A;  4IJA A;  3QBX A;  2NLX A;  3WXI A;  2OTL N;  1VQK N;  1D4X A;  2Q31 A;  3K9K A;  3CJ1 A;  3T7Z A;  5JVG L;  2OTJ N;  2W40 A;  3OHR A;  3RSE A;  5GAG P;  2QTD A;  4KH4 A;  4WFB L;  1Z6R A;  4H0P A;  4M7Y A;  2P9N A;  3OBY A;  3QFU A;  4B1U B;  4BR5 A;  5AZJ A;  5BN9 A;  3A0I X;  2WUS A;  2FSN A;  2VYP A;  4EHU A;  3FZH A;  5E84 A;  2OAN A;  3E9O A;  5EY4 A;  3CET A;  4EAH D;  5LY3 A;  1TYQ B;  4BRK A;  5AQJ A;  3UKR A;  5GIN A;  2QW9 A;  4JKG B;  4MDA A;  1J6Z A;  1ATS A;  2IVP A;  4K42 A;  5AQW A;  4DKW A;  2QWQ A;  2QXL A;  3ZET B;  1U2V A;  3SJH A;  2F9T A;  1NM1 A;  4JEP A;  3WQU A;  2HST A;  3IDH A;  3H1V X;  3C6A A;  5TKW A;  3CD6 N;  4KH5 A;  4C1N K;  4JKA A;  3IFR A;  5KQ8 A;  5AQZ A;  3CCL N;  1W97 L;  4FWP A;  3VGK A;  4A57 A;  5CR4 A;  2CGL A;  3FZM A;  1S3X A;  4H5V A;  4FPA A;  2P9I A;  3R8E A;  3MMV A;  4A2B A;  5GAE P;  4KBO A;  2BH1 A;  1QVF M;  2WFB A;  4JD2 B;  1K9M O;  5BR9 A;  5C0Y A;  2AP1 A;  5AQF A;  4A62 A;  3PIO L;  2Q97 A;  4BRO A;  4XEI A;  3C7N B;  4WCE L;  1HLU A;  2ZWH A;  2P9P B;  3GDQ A;  3VER A;  3NVK A;  4OPH A;  4JK7 A;  1QQO A;  4ILH A;  3CJA A;  1RDW X;  3ZX2 A;  3MK6 A;  3LDO A;  3O1W A;  1Q82 O;  4FOI A;  1KD1 O;  5F0X A;  5JLH A;  3TTF A;  3DAW A;  3Q7B A;  3UKU A;  3OW2 M;  4CBX A;  1WOQ A;  5DM6 L;  3H46 O;  4H5T A;  4A61 A;  3M5R A;  1S22 A;  2D1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...