4BRDA

Legionella pneumophila ntpdase1 q193e crystal form ii, closed, mg amppnp complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVEIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 119
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brdA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brdA02
1NGFA 2PAVA 4BRDA 3UB5A 2YJFA 4BC3A 3CJ1A 2P9SA 2E2NA 2EWSA 3VPZA 5AQQA 3DXMB 4IXCA 3MN7A 3H1VX 2Q1NA 1Q18A 1JCGA 4BR0A 2YJEA 3AAQA 3MDQA 4QS8A 4FWLA 3VF2A 3CERA 1YXQA 2DPNA 3HM8A 3C7NB 4FWPA 2IVPA 3ID8A 1ZXOA 2NZTA 3L6QA 3TPQA 4WQ4A 3DWLA 3EKSA 4FWNA 1ESVA 4BRHA 3ZEUA 3IUCA 2VCPA 2CGKA 1BG3A 3S41A 4JD2A 3HI0A 2YHXA 1EQYA 5AFUA 3ZX2A 1KXPA 3LDQA 5BR9A 4CZFA 2E1YA 2QWPA 4QS7A 3WXJA 3CJAA 1X3NA 4H5TA 1SQKA 4O5FA 4BVOA 4FOIA 3W0LA 3P4IA 1MDUB 1YAGA 3H1QA 3GDQA 4CD1A 4H0XB 2E2QA 4AM6A 4CI6A 1ZBSA 4YDUA 3GG4A 5AZIA 4WYBA 1CZAN 3HSCA 5AQUA 5KPZA 1DEJA 3VOVA 3WEEB 3CJ9A 1BA1A 4IZ9A 2YHYA 5AZJA 3UKRA 3I8BA 4JN4A 3ZETB 4XEIA 1TYQB 3HBTA 1NWKA 3KVGA 4PL8A 4JNEA 2GWKA 3QDKA 4K43A 4LC9B 2KHOA 3U9DA 5AQGA 4CJ7A 3CJBA 1GLAG 3MCPA 5BPLA 3VEXA 3VESA 2P9IA 4DCHA 3A5LC 4BG8A 3ATUA 1KAXA 4DB3A 3CJ7A 5BN9A 3JS6A 4BRGA 3ULEA 3VETA 2E1ZA 1OKJA 4CZJA 4BRCA 2HMPA 1BUPA 3FZKA 4F9OA 1HX1A 1BDGA 5FPNA 1NM1A 4H0PA 4CBXA 3FR0A 3HTVA 1T6DA 1NGGA 1RDWX 3VGMA 4NO7A 3C0BA 5FPEA 3VEYA 2CH5A 3GL1A 3H3NO 4XH4A 4BRKA 1ATNA 3GBTA 5AQIA 3QICA 1NGDA 3EZWA 4H03B 2W41A 2WUSA 3VERA 1KAYA 3IMXA 2I7PA 1HJOA 4H5RA 3FGUA 3WXLA 1DKGD 3WT0A 1G99A 2E20A 4BRPA 5AQSA 3D2FB 3D2EA 2H3GX 4B1ZA 2ITMA 4GY2B 3U9ZA 4BG9A 5JICA 4K42A 3CJCA 5AQFA 2P9UB 4I6MB 3QBXA 4DQ8A 4A62A 2FXUA 3H46O 3RSEA 4BROA 2ASPA 3FZLA 2D1KA 5AQOA 1E4GT 2I7NA 3M1FA 1BWFO 4ISEA 1SZ2A 3VEZA 4Y0WA 3UE5A 1JCFA 1NGIA 1P8ZA 4BGBA 1HPMA 5ADXH 5KPRA 2AA4A 3SMSA 2D4WA 2VYPA 4B1UB 3AAPA 4CZLA 4A2AA 3LM9A 2QWLA 3MK6A 4E1JA 3DXMA 1HKGA 1U2VB 4BR7A 1IJJA 1S22A 4FO0A 3QMLA 3CQYA 4ISGA 3TU5A 4PL7A 4BRNA 3WUHA 5AQPA 3GE1A 4CZMA 3B8AX 1JCEA 2QM1A 2P9SB 4H5VA 1RFQA 2OANA 3KZBA 3MN6A 4GNIA 3VEWA 4FPBA 2FSKA 4WQ5A 3ZX3A 4PKGA 4BQZA 3M3ZA 4H0OA 2P9NB 1BO5O 5AFUH 1K8KB 3FE1A 3ENOA 3SLCA 5AQKA 4H5WA 2YHWA 4B1XB 2FSJA 3R6MA 2BUPA 3EKUA 3DXKB 2E2OA 3U8XA 2HF3A 5AQJA 3O6WA 2YI1A 4FWSA 2CH6A 3H6EA 4MO5A 2E88A 4BR9A 4RCHA 4RTFD 3VF6A 2QWRA 4EHTA 1XC3A 2FF6A 3SK3A 5KQDA 3LM2A 3AARA 3H45C 1HUXA 2P9KB 5BREA 5AQTA 3F9MA 1TYQA 4BRLA 1LCUA 1GLFO 1R59O 4M63C 4PKIA 4IWVA 2E8AA 2BTFA 5AZIB 2IVOA 4H0TB 4CD3A 3M6GA 4FWRA 3CHWA 3AY9A 1NMDA 1XQSC 2YCHA 3UKUB 5EX5A 1QQMA 2V51B 4CZEA 2A42A 4JHDA 4EFHA 4M7YA 1NGCA 4IO8A 4BRFA 3VGKA 2GELA 1GLJO 2P9IB 2HF4A 4NB4A 4WQ4C 3CIPA 4FWOA 4Z94A 3WQTA 3SJHA 4B1VA 4FWMA 3BF1A 1V4TA 1LOTB 5BPMA 2QW9A 3FZFA 3LDNA 2Q31A 3A5NC 3FZHA 5LJWA 3VENA 2D0OA 1ATSA 1IG8A 3O80A 3WXIA 2W40A 5LY3A 3L4IA 1Z6RA 3QB0A 2V7ZA 3A5MC 1T6CA 1QHAA 1QQNA 1SAZA 3H3OB 2GTDA 2P9LB 3LDLA 4FWKA 2P9PB 3LDPA 2A6AA 5BRFA 4BR4A 4BRMA 4I6MA 3FLCO 4YDUC 5ELZA 1E4FT 5JMVA 5F2RA 2IVNA 3A0IX 4DHYA 3FZMA 2ASOA 4FWQA 3HZ6A 5EOYA 4BC5A 1QQOA 1ZC6A 3BEXA 4J8FA 3R9PA 1GLEG 3ATVA 5F1XA 2D0PA 5AQVA 1J6ZA 4BVPA 5LJVA 1MA9B 4QS9A 2FF3B 4B1WB 2IIRA 1NGEA 1NLVA 2QWNA 1U2VA 3MN5A 1GLDG 2Q97A 2QWQA 3LL3A 3MMVA 4CZHA 2J4RA 3EO3A 4B9QA 1QZ6A 3CI5A 3C7NA 3DAWA 5BPNA 5ADXA 5JLHA 4EHUA 5TKYA 4L3QA 4CZIA 3WXKA 1NBWA 4BC4A 3QFUA 3L0QA 1NGBA 5AQXA 1GLCG 3ZX0A 4M7XA 1TUUA 2ZF5O 4BREA 3QBWA 2QXLA 3EL2A 2P9NA 4H0YB 1K8KA 1ATRA 3O8MA 2UYTA 5AR0A 4BGAA 3W3DA 3ZEUB 2A3ZA 4FL9A 2ASMA 3BUZB 5AQNA 3WQUA 5EXWA 3G25A 4BRQA 5E84A 2GWJA 4JD2B 3R8EA 5I9EB 4XH5A 3DXKA 3ENHA 4AM7A 2Q36A 3O5BA 1H1VA 2QWOA 1X9JA 4CBUA 3WEEA 3A5OC 3GOIA 5AQMA 1DGKN 1X3MA 1C0GA 1NGHA 2NRHA 3VEVA 1TUYA 1NGAA 3ZETA 2V7YA 1Z05A 5AQYA 1QZ5A 1KAZA 1BA0A 3DJCA 2P9KA 5CE3A 2Q2RA 3D7EO 5KPTA 5EY4A 1BU6O 4IJNA 1RGIA 2CGJA 4B1YB 3SMPA 3EN9A 4CZGA 2CGLA 3BF3A 2AP1A 4BR5A 3VGLA 2QWMA 1WUAA 1XUPO 4MLHA 1GLBG 5AQLA 5AQHA 1NGJA 5AZJB 3UKRB 1YVNA 3IDHA 4BRIA 3I33A 4K41A 5JLFA 5EVZA 5AQZA 3UKUA 2A40A 3J8AA 2V52B 3IFRA 4HWIA 3LDOA 5F0XA 1GLLO 4H0VB 1D4XA 2Q0UA 1WOQA 5E26A 5FPMA 2PBDA 3O1BA 1MWMA 2F9WA 1HLUA 3ULEB 4K25A 5BRDA 5AQRA 4WQ5C 4RWTA 4HTLA 4EAHD 3BP8A 1Y64A 4JHDB 4BQLA 4FOEA 2A5XA 3O08A 4FPAA 4EIAA 5FPDA 1HKBA 3CETA 4BRAA 3O1WA 2F9TA 4ISFA 1T44A 2ZGZA 4H5NA 1HKCA 4O8KA 3D2FA 3U4LA 2FLOA 4IJAA 5BRHA 2P9LA 3O4WA 4KBOA 4JAXA 4C23A 3OHRA 2P9PA 2VWBA 2P9UA 3KHYA 4PKHA 4MO4A 2HOEA 3MN9A 5BN8A 4FSVA 1MWKA 1S3XA 2FSNA 1C0FA 4MLEA 5KQ8A 3CQXA 3FFKB 4A61A 1U6ZA 3D2EB 3VEOA 3VF4A 2Q0RA 2A41A 2ZGYA 4BC2A 4CBWA 4A2BA 4CZKA 3JXUA 3RSEB 1BOTO 2GEMA 4XH1A 1YUWA 3A8YA 2NLXA 2E2PA 3QFPA 5B8HA 2ZWHA 5AQWA 4BR2A 2GUPA 1V4SA
chains in the Genus database with same CATH superfamily
4BY9C 1UAXA 5HRSA 2YHBA 4BC3A 3ZT1A 2E2NA 5HROA 3VPZA 3DXMB 1T8EA 4IXCA 3MN7A 3H1VX 3CMAN 3OYIA 1J5OA 1RDCA 2YJEA 4QS8A 4ILHA 2LSNA 2HW3A 1QS4A 4N41A 2YHAA 3WXMB 3NAEA 3CM6A 4JI2K 2HHUA 5CZ2A 4FWPA 2IVPA 1C6VA 2G8HA 3VTHA 1R0AA 5H1SQ 4DS4A 3I0SA 4H4MA 2FBVA 4FWNA 3IUCA 2OCEA 2B6AA 3NMUA 1VQ4N 1KLMA 3HI0A 2YHXA 4Z4FA 1VSJA 1QHTA 5BR9A 4CIEA 2QWPA 4YHHK 4QS7A 3WXJA 3ZSRA 3O3GA 3V4IA 4LY7A 4B9NA 2KFNA 4Y1DA 5LMUK 1YAGA 4CF0A 3K5NA 3H1QA 4FJ8A 3GDQA 4Z4HA 4YDUA 5AZIA 5CY4A 3HSCA 5C25A 4OLAA 4CECA 1C1AA 4F4KA 4ELTA 1TKDA 4HCCA 4EP5A 4KV8A 1TL1A 3UKRA 5C10A 3TR8A 3HP9A 4CJVA 1TYQB 3KVGA 2IS3A 4DU3A 1C1CA 4LC9B 3SZ2A 1YI2N 3CJBA 3TABA 3TTFA 4JKGB 3KIOA 3JSMA 2VQEK 4DCHA 3A5LC 4BG8A 3QNOA 3ATUA 1VQ9N 4DB3A 3BGRA 3CJ7A 5BN9A 3JS6A 4JRQA 2XO7A 3HPOA 3THYB 3VETA 4OVLA 1K9MO 1LWFA 1VQON 1EETA 3K0SA 1EWRA 4BRCA 2HMPA 2I5JA 4J2DA 3FZKA 4B3TK 1HX1A 1BDGA 1L3VA 3ZSXA 3E1YA 3LANA 4H0PA 3ZSYA 3IAYA 3HTVA 5FROA 1YHQN 4JKBA 2CH5A 5M1NA 4FJKA 4BRKA 5AQIA 3EZWA 4NCGA 1KAYA 5AJ3K 3VQPA 1DKGD 3NGYA 4DFPA 1OH6A 2E20A 3BZCA 4IFYA 2OTLN 1TAQA 4B1ZA 2QEXN 2ITMA 2B4JA 1TV6A 4K42A 5AQFA 4I6MB 4NCBA 4GV3A 1XWLA 1RBSA 4DTNA 2D1KA 1JJ2M 4X66K 4DU4A 1E4GT 2I7NA 1KSPA 4BWJA 4ISEA 4BE2A 1SZ2A 3CC7N 3UE5A 1JKHA 4BGBA 1QE1A 1HPMA 3PLAA 5KPRA 2VYPA 3S3MA 4KHWA 3BDPA 3DXMA 1HKGA 2XY6A 5E41A 4DV0K 1RT3A 4FLTA 3QMLA 1VSEA 4FLVA 4J2EA 2KW4A 4E1MA 1Q9YA 3B8AX 2AJQA 1ASVA 5C2DA 3KZBA 2HSTA 3PY8A 2PFUA 4FLUA 4GNIA 3P83D 3AGRA 3ZX3A 3KKSA 1GOCA 3LP2A 3MEDA 4PKGA 3M3ZA 2IOCA 4H0OA 1K8KB 3L3UA 2F8TA 1NK8A 3QEXA 1VAZA 3J7AP 1RDUA 4HUGA 3V81A 4JKFA 1Q8IA 2YHWA 1RT5A 1HNIA 3DXKB 5GINA 5GAEP 3U8XA 1NMNA 3RR7A 1RDBA 2YI1A 5JS1A 2HNDA 4BR9A 2E88A 4DTUA 4DTXA 1BCMA 1VHXA 3SYZA 4CFDA 3OYAA 3G71N 1WSIA 1S6QA 2FF6A 1D9DA 3DMJA 3AARA 1S1WA 2A1RA 4KAZA 1TYQA 2JLEA 3SV4A 1S1XA 4WCEL 4M63C 4RW4A 2IDOA 2F7TA 4AQYK 3J7YP 3HYFA 4JKGA 5DM7L 4H0TB 4LH4A 1J54A 4FWRA 2QXFA 1CXUA 3THYA 1U45A 1D8YA 2ZJQL 3EY1A 1NMDA 4G1QA 2YCHA 3UKUB 2V51B 4EFHA 4CJFA 2OTJN 3THXB 4M7YA 3VGKA 4NB4A 3CIPA 5C24A 2ATQA 4B1VA 1NKEA 2E6LA 1N5YA 1DT9A 1X9SA 1LOTB 3CYMA 3FZFA 3M8QA 2Q31A 3A5NC 5LJWA 4IG0A 4JS5A 1Q81O 4CGGA 4CFCA 1TKXA 1Y97A 3WXIA 2PYLA 3C65A 3QB0A 3A5MC 3C6UA 1QQNA 1SAZA 3H3OB 4O8UA 3K58A 1TKTA 4FWKA 5SZTA 3DM2A 3VQ8A 1WSEA 4BRMA 4I6MA 3FLCO 3DLKA 1E4FT 2IVNA 4CJ3A 3NH0A 3DI6A 4BC5A 3PUFA 3L2VA 3LWMA 1VQ8N 1GLEG 2O4GA 2HB5A 5AQVA 4OPHA 4BVPA 4JKAA 5LJVA 3OYDA 1MA9B 3QERA 4B1WB 2IIRA 3DYAA 3ZSVA 3SAGA 5IWAK 3TAPA 2QWNA 4FJHA 2Q97A 4DTRA 2J4RA 2BDPA 3EO3A 1QZ6A 1VRTA 3CI5A 4L8RB 5BPNA 3KK1A 4A59A 1RTDA 2YV0X 1A5XA 3K57A 3WXKA 2RKIA 3CFPA 3O3FA 3AVMA 4MFBA 1N6QA 5AQXA 1GLCG 3ID6A 4W5RA 4DV1K 4DR3K 3RMCA 2RHKA 1NK5A 4LF9K 4CEFA 4H0YB 1K8KA 3QEPA 3PSIA 1JL2A 4I7FA 3UIQA 4BGAA 5K14A 1U48A 1C0UA 4BRQA 1ITGA 5E84A 1KTQA 3O9SA 3SCXA 1CXQA 4JD2B 3EYZA 1P90A 3R8EA 3DXKA 3ENHA 3J80O 2OZMA 4KTQA 3O5BA 1VSIA 2ZM6K 1UA0A 3QLHA 4KHPK 4DUYK 3WEEA 1J5EK 1DGKN 1X3MA 1TGOA 4YOWA 4UQGA 1LAVA 3PV8A 3LPUA 2IC3A 1TUYA 3F5TA 4CK2A 3PX6A 1QZ5A 3DLBA 4CJ5A 3D7EO 5FRMA 3CG7A 2UXDK 1VSDA 2VG7A 4YOYA 3AVNA 4KTWA 1WAJA 3OYNA 4HUFA 3SMPA 5GIOA 3VGLA 1RBUA 4B8AB 1Z25A 5AQHA 4KH6A 3OYKA 4BRIA 1HQEA 3JAMO 4JI4K 2O8FA 5JLFA 4OKEA 5AQZA 3UKUA 4Z0UA 4E7IA 3THXA 2KTQA 3P5JA 1D4XA 1WOQA 1NK7A 2IGIA 3AVIA 3O1BA 3M5RA 4YOTA 5BRDA 5CHIA 2YNGA 4JLHA 3OJSA 2OPRA 4RWTA 4C1NI 4BQLA 5FPDA 4DTMA 3NF8A 3SUNA 3AO5A 3MXJA 3CETA 3O9TA 3D2FA 4O55A 3PX4A 2FLOA 3IRXA 4JAXA 3E9LA 1CLQA 2VWBA 2P9UA 1KCFA 4MO4A 1XHZA 1S3XA 1NJIO 3NDKA 5KQ8A 4JI7K 1XC9A 2ZQBA 1WSGA 4YOVA 1EP4A 3C95A 4BC2A 3VQ9A 4M3UA 4A2BA 2Y1JA 1BOTO 2GEMA 2KLAA 3QO9A 3QFPA 2ZWHA 5AQWA 4BR2A 3L2WA 1RBTA 2KZZA 3ZLJA 1NGFA 2PAVA 2W6KA 3K9KA 2YJFA 1JLAA 4E0DA 2EWSA 5AQQA 1Q18A 1JCGA 1VSKA 4FWLA 3AVFA 2DPNA 2HNZA 3C7NB 4I2PA 4O44A 1L3UA 1ZXOA 4DR6K 2NZTA 3MEGA 3L6QA 3TPQA 4CJEA 4CHYA 3CCUN 1OVQA 4KPYA 2O8BB 2CGKA 3ULDA 1EO1A 4CHQA 4JD2A 2NRTA 4Z4CA 1SL0A 1EQYA 3KK2A 3LDQA 1VQ6N 3V9XA 1NJZA 2E1YA 2G8IA 3CJAA 3RRGA 4O5FA 3SI6A 4FOIA 3W0LA 4B08A 3E9OA 3P4IA 1MDUB 3C6TA 1RT7A 2DFHA 3R1XA 2NNWA 4CD1A 4H0XB 1GOAA 2E2QA 4AM6A 3AO2A 2FBYA 5C15A 5AQUA 1DEJA 1W97L 1KFSA 2NRRA 4DTJA 4GV6A 1QSLA 5FDLA 4JN4A 2YKMA 4FZXC 1SV5A 3P31A 5HOOA 4E89A 3V9UA 1N32K 2GWKA 4K43A 4FM0A 2JWKA 4IEIA 4CJ7A 2ITGA 3VEXA 2P9IA 2GX9A 1TL3A 1KAXA 2P5GA 2UUCK 2OPSA 1YJ9N 4IFEA 4DQQA 1YITN 1UOCA 4DV3K 1OKJA 3VQDA 3T7ZA 3AVLA 3G10A 5MLCQ 4BE1A 4CJUA 4M3WA 1IKVA 5FPNA 4CBXA 4LSNA 4CEAA 3KD5E 1LW0A 3FR0A 1T6DA 4NO7A 3C0BA 4FLYA 5CYMA 3P38A 4XH4A 2FBTA 3RWUA 5FLXO 4H03B 4A57A 4DQRA 5HRNA 2WUSA 2O8DA 4KHQA 2I7PA 1HJOA 1HRHA 1HNZK 3WT0A 3S3OA 2DFEA 4BRPA 1KVBA 3CQ8A 4FJLA 5JS2A 2H3GX 4FVMA 3U9ZA 4BG9A 4CGFA 1B9FA 1FJGK 4DR4K 1VSLA 4DQ8A 2YNHA 3K5LA 4BROA 2ASPA 3FZLA 1O1WA 3TAFA 4CIFA 5J2QA 1U49A 1JCFA 1NGIA 4W5NA 2AA4A 2D4WA 4X62K 3AAPA 4A2AA 4CFAA 3VQ7A 3MK6A 4E7JA 4CEQA 1U2VB 4DFKA 1T05A 1Q9XA 2F96A 3T3FA 4FO0A 5I3UA 4FJ5A 4KHNA 2ZE2A 4M42A 2G8KA 2ETJA 3CQYA 3NF6A 1F21A 4ISGA 1RNHA 4PL7A 1FK9A 5KTQA 3V9SA 3CPEA 2JWLA 2D0CA 1JCEA 2P9SB 4H5VA 1WBBA 5GIPA 4DUZK 2XY5A 3VEWA 4C8KA 4FPBA 4O5BA 2O8BA 2FSKA 4KHUA 3IG1A 5HL7L 3CCVN 2KZMA 1EKEA 4BQZA 4CE9A 4FK4A 2P9NB 4DQPA 1HYVA 4FLZA 3RR8A 3VQEA 3RMDA 4RW6A 1VQKN 4FJ7A 5J1EA 2QTDA 1IKYA 4G9ZA 5AQKA 4O0JA 2PYJA 2FSJA 4JI5K 4JK9A 2E2OA 3OJUA 4KI4A 3V1OA 1BL3A 4EZ6A 3ZSOA 4YOXA 3RVCA 4FWSA 2CH6A 4EP4A 3VF6A 2Z1JA 4IDHA 1KFDA 3VMFB 1XC3A 3CCRN 5KQDA 1X1PA 3AA2A 3HPHA 2P9KB 5BREA 5AQTA 2KKZA 1LCUA 2XY7A 1R59O 4PKIA 4JV5K 1SUQA 2E8AA 3T69A 3S3NA 2IVOA 4B9SA 3M6GA 2FC0A 3IKMA 4DS5A 4CJLA 3F2KA 3QEWA 4KHSA 3OS1A 5HRRA 5EX5A 1QQMA 3VQQA 1NJXA 2A42A 4JHDA 3TAQA 2HHHK 1CZ9A 4BRFA 4KI6A 1GLJO 2HF4A 1QQCA 4FWOA 3ZSQA 4FWMA 3BF1A 3SQ1A 1V4TA 5KGWA 3PIPL 1QTMA 4GVMA 1EX4A 5BPMA 3C6AA 3QNNA 3FZHA 4NYFA 4BDYA 3VENA 2A1SA 1IG8A 4AH9A 3D6RA 1U04A 1Z6RA 4LSLA 2HHXA 2V7ZA 2FBXA 3VQ4A 3HK2A 4CEDA 4LD0A 1RT4A 2WBNA 4MDAA 4B9VA 3LDPA 1FKPA 5BRFA 4BR4A 1HPZA 5JMVA 4PQUA 4B8CA 4AHVA 1OH8A 4GVEA 3A0IX 2BH1A 2YNFA 4M3TA 5EOYA 4LFAK 4J8FA 3R9PA 4IOAL 2D0PA 4X65K 3RMAA 4QS9A 1NGEA 1XNQK 1NLVA 1U2VA 3MEEA 2QWQA 3LL3A 3TAMA 4O0IA 4B9QA 2P1JA 3HP6A 3P1GA 1NOZA 4DTSA 3L3VA 4FXDA 1IO2A 3KJVA 4EHUA 4KB0A 4DG1A 5TKYA 4L3QA 2WONA 1YVUA 1NOYA 1E3MA 4EZ9A 4CK1A 5TKWA 1M1KO 3SBTA 3QFUA 4OGCA 1RDAA 1NGBA 2KFZA 1S1VA 3C94A 5SWMA 1RTJA 3PSFA 4BREA 3SBGA 2QXLA 3EL2A 2P9NA 4YFUA 1B92A 3O8MA 5KRTA 4MQ3A 2BGGA 3CXCM 3W3DA 3ZEUB 5DMRA 1ZBUA 3G25A 4WFAL 2XY8A 3O3HA 2GWJA 1IKXA 4WF9L 1LWCA 1DTTA 4DFMA 5I9EB 1ASUA 4DLEA 1ASWA 1TK8A 4CEOA 1Q82O 2NRHA 3VEVA 3LZJA 5D3GA 4F2SA 2EHGA 1KAZA 5CE3A 2P9KA 2Q2RA 4CEEA 1XMQK 2HVIA 1RGIA 4B1YB 3JYTA 3CCSN 4B9MA 2BANA 1FKOA 2CGLA 5C2FA 1XUPO 3V1QA 1NGJA 1W9HA 4DTPA 5AZJB 4LF4K 3IDHA 4K41A 4OKJA 5HRPA 4CJWA 1W0HA 2V52B 3IFRA 4HWIA 3LDOA 4B3RK 4DF4A 2F9WA 4CEZA 5AQRA 4WQ5C 4M41A 4HTLA 1ZYQA 3BP8A 4CJTA 2O8CB 3SUOA 4FOEA 3U6FA 4DSEA 4FPAA 2G8VA 3Q7BA 1ZBIA 4ISFA 4CJQA 1DTQA 3NHGA 1HKCA 4O8KA 3M8SA 2VQFK 3U4LA 3O4WA 4IO9L 4LF7K 4CJPA 3EE9A 2HOEA 3MN9A 4FSVA 3HOSA 1RBVA 1NK9A 3DLLL 1WSJA 1C0FA 3P39A 4MLEA 3CQXA 3CPWM 3QEVA 4KRFA 4CCHA 1TK0A 3NBPA 4CBWA 3WNEA 2UUBK 2OPPA 3THWB 3RSEB 3LDSA 1YUWA 1C0MA 4A5BA 2E2PA 1VQ7N 5B8HA 4N56A 3AVGA 2KQ2A 2GUPA 2W6LA 4XIUA 4RW8A 3Q7CA 1S72N 2D5RA 2BE2A 1RDDA 3MWPA 1WSHA 4FJJA 1VQ5N 1YF5L 4KH4A 3AO1A 3VN5A 2HHQA 3S9HA 2OYQA 2HBMA 2DY4A 3HM8A 3ZYYX 3CCJN 5KRSA 3VQBA 3AVCA 1QVFM 4BDPA 3ID8A 3MCAB 2D0AA 1FW6A 3LZIA 1A5VA 3DWLA 3CMEN 3TARA 1XHXA 1ESVA 3ZEUA 1LWEA 4CVNE 2X6SA 2VCPA 3KLEA 4JI6K 3T19A 1BG3A 3R3LA 1IBLK 1XMOK 1I39A 3PO4A 3ZX2A 1Z26A 4CF2A 4DSLA 1X3NA 4H5TA 4BVOA 4BDZA 1A5WA 1X9WA 2ZD1A 1ZBFA 5KI6A 2X6NA 4OX9K 3AVBA 2RE2A 3I55N 4PA1A 4CESA 1VRUA 1WN7A 4CI6A 1RBRA 3VQ6A 3F9KA 4FZYA 3NGIA 3GG4A 4WYBA 1CZAN 5KPZA 3VOVA 2Y1IA 3CJ9A 4Q0BA 1BA1A 4W5TA 4DV2K 4IZ9A 5I42A 3MX5A 2YHYA 3L8BA 3HO1A 5AZJA 4C8OA 3VQCA 1ZBHA 4W5QA 3ZETB 4U7BA 4XEIA 3NH1A 3TI0A 3HBTA 2VGMA 5M1OA 1NWKA 1L5UA 3EZ5A 4IDKA 4JNEA 3QDKA 4I2QA 3U9DA 5AQGA 3MCPA 1GLAG 5BPLA 4YNQA 3VESA 4CIGA 4DWIA 1RT6A 3TANA 3MWTA 4A5AA 3TAGA 4CZJA 4UY8O 4FM1A 5HBMA 4KREA 4F9OA 4Q5VA 3KLIA 1VQPN 4CJSA 2E6MA 1NK0A 1N8RO 1L3TA 3ALYA 4CJKA 3AA5X 3VGMA 5FPEA 1BIUA 1SKSA 2VG5A 3QICA 4DFJA 3WNGA 4CF1A 1J53A 2W41A 4M3XA 4H5RA 2HBJA 3WXLA 2WFBA 3ZT3A 4IOCL 3O9UA 3EE8A 4DQSA 1WNSA 4GY2B 4FYDA 4FK0A 4DMNA 5CZ1A 3BY5A 1MU2A 4I9LA 2FXUA 3THWA 3RSEA 3OTOK 4B9LA 2GV9A 3VA3A 3M1FA 1BWFO 1HNXK 4BWMA 4FJGA 3VEZA 1P8ZA 5LL6Z 3N4PA 3ZT0A 4M3ZA 4CZLA 1O13A 4OJRA 3LM9A 3TWHA 1JLQA 4E1JA 4E7KA 4FJ9A 1IBMK 1KLNA 3NF9A 4H4OA 1S9EA 3TU5A 4BRNA 1SKWA 3WUHA 4C8NA 1TAUA 3ZT4A 4HTUA 3GE1A 2QM1A 3LAKA 4CHPA 2VG6A 3V1RA 3FFIA 3OYMA 4WQ5A 5J2PA 2PY5A 3CCMN 3AVJA 2G8WA 3OBWA 4JK7A 5AFUH 3OS0A 3LAMA 2ZJRL 4BACA 1DLOA 3SUPA 2QKBA 1UA1A 4PWDA 3ENOA 2VWKA 3OYEA 4FZZA 3TSPA 1UWBA 3I56N 5DM6L 1N34K 1RTHA 4B1XB 3R6MA 3DLGA 3EKUA 3V9ZA 4WFNL 3E9PA 4OLBA 2HF3A 5AQJA 4NCAA 3O6WA 2VGNA 3EEQA 1T03A 3D0PA 3H6EA 4MO5A 3OY9A 4RCHA 4RTFD 1BCOA 2QWRA 1ILYA 4OGEA 4M3YA 4KH5A 3LM2A 2NRVA 4DSJA 1HUXA 4FM2A 4LFBK 4E7HA 4DV4K 1EWQA 4IWVA 3AA4A 5AZIB 2OZSA 1I94K 4CD3A 3LALA 3AY9A 2GBZA 1XQSC 3AA3A 4NYNA 1IV0A 1SS6A 5A2QO 4ICLA 3I0RA 1NGCA 2UU9K 1U4BA 5CR4A 4JKHA 2W42A 4WQ4C 1OH5A 4Z94A 3SJHA 2Z1IA 1VQLN 2E4LA 3M8RA 2QW9A 4X64K 4DU1A 4C1NK 4CERA 3O80A 3ZSZA 5M1QA 5LY3A 3OYJA 5FRNA 4K8XA 3TTDA 2P9LB 3LP0A 3LDLA 4I9QA 2A6AA 4CEBA 4JEPA 1SKRA 2YNIA 4CK3A 2HHWA 5F2RA 4TSXA 3ENBA 1KC8O 3FZMA 4JKEA 3OYGA 1QQOA 1ZC6A 4R79A 3HVTA 4CW7B 3BEXA 4AHUA 4AILC 5F1XA 4AHTA 4CJRA 2Z1HA 3DLHA 3O4QA 4CZHA 3CCQN 2NUBA 4Y1CA 5GAHP 1K73O 4E7LA 1SL1A 2NRWA 3C7NA 5IT9O 3DAWA 3HSTB 4F2RA 3OYHA 1M90O 5ADXA 4IEEA 4O4GA 5JLHA 4F8RA 1L3SA 4LFCK 1T7PA 4LH5A 4V19S 1IKWA 3QIOA 3D45A 4OPAA 1NBWA 2HHVA 4BC4A 3LP3A 3ZT2A 4FJXA 4AF1A 1TUUA 1BQNA 2ZF5O 4CFBA 1BI4B 3RMBA 1D9FA 1G15A 3L2UA 1BISA 4N76A 2A3ZA 4OO1J 3WQUA 5C0YA 2JGUA 1TK5A 3HM9A 1B9DA 4XH5A 4GKJK 3CD6N 1KVCA 3HL8A 1T3VA 1YTAA 2Q36A 4AM7A 1H1VA 4BE0A 4AHSA 2E5LK 4CBUA 4B9TA 4YOUA 3GOIA 3K9JA 2WC9A 4IKFA 3OYBA 1NGAA 3B6PA 3CF5L 3KD1E 2V7YA 1Z05A 3DJCA 5KPTA 5EY4A 4IJNA 4JKCA 4CHZA 4E1NA 3EN9A 1WUAA 1GLBG 5AQLA 2HNYA 1S1TA 1YVNA 4FJMA 4Z4IA 3AVKA 1RTIA 5EVZA 4CGJA 1NKCA 1JXEA 1HMVA 3K5OA 1EXQA 3QINA 4ZTFA 3KTQA 1GLLO 1X9MA 4H0VB 5E26A 4ILGB 5FPMA 2WTUA 4DR2K 2PBDA 4NXMK 1NG9A 3HJFA 2G8FA 1HLUA 3ULEB 4B3MK 4ILJA 4KKOA 3K5MA 1NK6A 3OYFA 4N47A 4EAHD 3MX2A 4CGIA 3OYCA 3OYLA 2A5XA 3O08A 4EIAA 2NRXA 1W2BM 4CGDA 3SNNA 3O1WA 4RW7A 4DTOA 2ZGZA 4FLWA 4H5NA 3O9QA 3KLFA 4IJAA 2P9LA 4KBOA 4C23A 1HYZA 3OHRA 3I8DA 5HP1A 3KHYA 4PKHA 3NFAA 3KLGA 3ISNC 5J2MA 5J2NA 3DRPA 3D2EB 3VEOA 3VF4A 2Q0RA 2A41A 5GADP 1QVGM 4HCBA 3JXUA 3NVMA 3WNFA 3IS9A 3A8YA 1IBKK 1VQNN 4K8ZA 2NLXA 4KFBA 1YJNN 4OPKA 1HJRA 1V4SA 4FLXA 1YTUA 3QIPA 4BRDA 3UB5A 4DQIA 3DOLA 4HUEA 3AVAA 3CJ1A 2P9SA 1LAWA 3AVHA 3CFRA 1NNEA 2Q1NA 3C6HA 4BR0A 3AAQA 3MDQA 2IAJA 3VF2A 5JVHL 3CERA 1YXQA 1N33K 3G0ZA 2UUAK 1SL2A 4JKDA 3SQ0A 3L2RA 5C12A 1CZBA 1FXXA 1BI4A 4YORA 2UXCK 3H08A 4WQ4A 3EKSA 4BRHA 1ZBLA 3TSUA 1VSMA 3DOKA 3S41A 4FW1A 4IBNA 4NLCA 1WAFA 4B9UA 3PX0A 5AFUA 1KXPA 4JK8A 4CZFA 4K0KK 2OPQA 3PO5A 1SQKA 4C8LA 4IOXA 4DR7K 1QSYA 3CM5A 1Q86O 1C0TA 1C1BA 1WBDA 3K2PA 1RCHA 4ID1A 1ZBSA 1JLBA 3HRGA 1LW2A 3WEEB 4NLBA 4LF8K 5LMNK 3NF7A 3I8BA 4FCYA 5CYQA 2R7YA 4PL8A 2QI2A 5GAGP 2KHOA 4QOZB 3M8PA 4R5PA 4IG3A 2NRZA 4BRGA 3LPTA 3ULEA 1OH7A 1S5JA 2E1ZA 3G6EN 2O8FB 3AO4A 4RG8A 3NCIA 1BUPA 3K59A 2O8EB 4FW2A 3PIOL 4CJ4A 1NM1A 1KVAA 3SQ4A 3VA0A 1NGGA 1RDWX 3NVKA 3VEYA 4OKKA 3GL1A 4B3OA 3H3NO 3QETA 1ATNA 3GBTA 1NGDA 4GKKK 3VERA 3SV3A 3IMXA 4U67L 1XNRK 1HNWK 1REVA 3FGUA 1G99A 2P5OA 2Q3SA 5AQSA 3D2FB 3D2EA 4QAGA 3VTIA 2RN2A 4JRPA 3KWIA 5JICA 3A2FA 3CJCA 2P9UB 3HXMA 3QBXA 4A62A 3J7ZO 2HVHA 3H46O 2HHSA 3RRHA 2QK9A 4HHTA 1OVYA 5AQOA 4PHTX 3KLHA 3BZKA 1WLJA 3LP1A 2RPIA 1JLFA 4Y0WA 2D0BA 1YT3A 5ADXH 3SMSA 4B1UB 3U3GA 1NK4A 2QWLA 5M1KA 4BR7A 1IJJA 4DV7K 1NJWA 1S22A 4CGHA 1WB9A 1K8AO 4F3TA 3SQ2A 1YIJN 2X78A 1YJWN 5AQPA 4CZMA 2O4IA 3DRRA 3KK7A 1RFQA 2OANA 1VSFA 1U47A 3MN6A 4JI1K 3TSQA 1KRPA 4N5SA 4F3OA 1Q7YO 1BO5O 3TTCA 3FE1A 2EX3A 2B5JA 2XRIA 4Z4EA 3SLCA 4H5WA 3V6DA 2BUPA 4CHOA 3CFOA 5HLFA 4GV9A 4AHCA 4EHTA 4WFBL 2HBLA 3DRSA 3SK3A 4E3SA 3H45C 4FJIA 4NXNK 2F8SA 3F9MA 4DV6K 4BRLA 1GLFO 3VQ5A 4DR5K 2BTFA 3NE6A 4WE1A 3G4SN 3SPYA 3CHWA 3KKRA 2OA8A 1JLCA 4M45A 3ZSWA 3OBYA 3MXMA 4CZEA 2O8CA 5M1FA 4FK2A 2O8EA 4IO8A 2GELA 2P9IB 1JLGA 3WNHA 3WQTA 4LF5K 4HVJA 3SAFA 2DTUA 1RT2A 2HBKA 3HVRA 4W5OA 3LDNA 5DK5A 2VWJA 4DSFA 2D0OA 1ATSA 2YX6A 3T1AA 2W40A 3L4IA 5EU7A 4E19A 1S1UA 1NJYA 1T6CA 1QHAA 2WOMA 2GTDA 3O4NA 3V9WA 1HNVA 1VQMN 3E66A 2ZJPL 2P9PB 1JL1A 4DV5K 4Z4GA 4YDUC 1I3AA 5ELZA 1TKZA 2O8DB 3AO3A 3HPGA 4KTZA 1JXBA 4GMJB 4IFVA 4DKWA 3QEIA 4DHYA 1W7AA 2ASOA 3KWGA 2X74A 3HZ6A 4FWQA 4QCLA 4ELUA 3OW2M 3SPZA 3SAHA 3ATVA 3F73A 4KB1A 1J6ZA 3KK3A 3THVA 2FF3B 1BIZA 3MECA 4H8KA 3HOTA 4ELVA 3MN5A 1GLDG 3MMVA 3QESA 1NKBA 3OS2A 4RW9A 4ID5A 3OVNA 3OA9A 4JYAK 2F4VK 4DLGA 5KGXA 1HR0K 4CZIA 1XI1A 4DF8A 3DLEA 3HT3A 4PY5A 3L0QA 3SJJA 3L2QA 3ZX0A 1LV5A 4DSKA 4M7XA 2HHTA 4JI3K 1VK0A 3QBWA 4KHYA 1ATRA 3VQAA 2UYTA 5AR0A 3U3YA 4PUOA 4FL9A 3CCEN 2HMIA 2ASMA 3BUZB 5AQNA 2RF2A 3O9RA 5EXWA 1WSFA 3J81O 4C8MA 1RT1A 3NGZA 1QSSA 2G8UA 1BQMA 4JI8K 4OPJA 3ITHA 4KO0A 4CHNA 2QWOA 1X9JA 1JLEA 3T1HK 3A5OC 5AQMA 1VSHA 1NU0A 1C0GA 1NGHA 2YKNA 3ZETA 1S6PA 3MXIA 2QKKA 5AQYA 1BA0A 5C42A 4JS4A 2PZSA 1BU6O 1KD1O 4CF8A 2CGJA 4JI0K 4M3RA 4CZGA 3BF3A 2AP1A 4BR5A 4GW6A 2QWMA 2QA4N 4MLHA 5M1PA 4ZHRA 3UKRB 4FVUA 4ZTJA 4DSIA 3ZCMA 3I33A 4YY3K 5JVGL 3CCLN 2A40A 3J8AA 4FJNA 1BHLA 5F0XA 4J2AA 1J9AA 3AV9A 2Q0UA 1HYSA 3NH2A 1MWMA 4K25A 4AHRA 1N36K 2DFFA 3ASMA 3N4QA 1Y64A 4JHDB 2P51A 1IG9A 3CC2N 3SUQA 1HKBA 4BRAA 4CF9A 2UXBK 2F9TA 3TAEA 1T44A 1IH7A 5BRHA 3E01A 2P9PA 3B6OA 1K6YA 1BGXT 4DR1K 5BN8A 1D5AA 3AGKA 4J2BA 1MWKA 1RILA 2FSNA 4B3SK 3CC4N 1S9GA 4MDBA 3FFKB 1HQUA 4A61A 1U6ZA 3RTVA 4LF6K 1GOBA 2ZGYA 5T7BA 3L4QA 3DLRA 4CZKA 4XH1A 3MAQA 2XHBA 2GUIA 3LWLA 2Z1GA 1TVRA 5BR8K 1KQSM 3T1YK
chains in the Genus database with same CATH topology
3Q7CA 1S72N 4BY9C 1NGFA 2PAVA 3MWPA 4BRDA 3UB5A 3K9KA 2YJFA 4BC3A 3CJ1A 2P9SA 2E2NA 1VQ5N 2EWSA 3VPZA 5AQQA 3DXMB 1YF5L 4IXCA 3MN7A 3H1VX 4KH4A 2Q1NA 1Q18A 3CMAN 1JCGA 3C6HA 4BR0A 2YJEA 3AAQA 3MDQA 4QS8A 4FWLA 4ILHA 3VF2A 2HBMA 5JVHL 3CERA 3WXMB 1YXQA 2DPNA 3HM8A 3C7NB 4JKDA 3ZYYX 4FWPA 3CCJN 2IVPA 1QVFM 3VTHA 5C12A 3ID8A 3MCAB 1ZXOA 4YORA 2NZTA 5H1SQ 3L6QA 3TPQA 4WQ4A 3DWLA 3CMEN 3EKSA 4FWNA 1ESVA 4BRHA 3ZEUA 3IUCA 3TSUA 3CCUN 2VCPA 2CGKA 3NMUA 1EO1A 1BG3A 3R3LA 3S41A 1VQ4N 4JD2A 2NRTA 3HI0A 4NLCA 2YHXA 1EQYA 5AFUA 3ZX2A 1KXPA 3LDQA 4JK8A 4CZFA 5BR9A 2E1YA 2QWPA 1VQ6N 4QS7A 3WXJA 3CJAA 1X3NA 4H5TA 1SQKA 4O5FA 4BVOA 4FOIA 3W0LA 3E9OA 4IOXA 3P4IA 1MDUB 1Q86O 2RE2A 1YAGA 3R1XA 3I55N 3H1QA 2NNWA 3GDQA 4CD1A 4H0XB 2E2QA 4AM6A 4CI6A 1ZBSA 4YDUA 3GG4A 5AZIA 3HRGA 1CZAN 3HSCA 4WYBA 5C15A 5AQUA 5KPZA 1DEJA 3VOVA 1W97L 3WEEB 3CJ9A 1BA1A 2NRRA 4NLBA 4IZ9A 4GV6A 3MX5A 2YHYA 5AZJA 3UKRA 5C10A 3I8BA 4JN4A 3ZETB 4XEIA 4U7BA 3P31A 1TYQB 2VGMA 3HBTA 1NWKA 3KVGA 4PL8A 5M1OA 5HOOA 4JNEA 2GWKA 2QI2A 3QDKA 4K43A 2JWKA 4IEIA 4LC9B 2KHOA 5GAGP 3U9DA 1YI2N 5AQGA 4CJ7A 3CJBA 1GLAG 3MCPA 5BPLA 3TTFA 3VEXA 3VESA 2P9IA 4JKGB 2GX9A 4DCHA 3A5LC 4BG8A 1VQ9N 3ATUA 1KAXA 4DB3A 2NRZA 3CJ7A 5BN9A 3JS6A 4BRGA 1YJ9N 3MWTA 4IFEA 3ULEA 3VETA 4A5AA 1YITN 2E1ZA 1K9MO 1OKJA 3G6EN 1VQON 4CZJA 4UY8O 3T7ZA 4BRCA 5MLCQ 2HMPA 1BUPA 3FZKA 3PIOL 4F9OA 1HX1A 1BDGA 5FPNA 1VQPN 1NM1A 3E1YA 4H0PA 4CBXA 1N8RO 3FR0A 3HTVA 1T6DA 1NGGA 1RDWX 3VGMA 4NO7A 4JKBA 3C0BA 1YHQN 5FPEA 3VEYA 3NVKA 2CH5A 5M1NA 3GL1A 3P38A 3H3NO 4XH4A 4BRKA 1ATNA 3GBTA 5AQIA 3QICA 1NGDA 3EZWA 4H03B 4A57A 2W41A 2WUSA 3VERA 1KAYA 3IMXA 2I7PA 4U67L 1HJOA 4H5RA 2HBJA 3FGUA 3WXLA 2WFBA 1DKGD 3WT0A 1G99A 2E20A 4BRPA 4IOCL 3O9UA 5AQSA 3D2FB 3D2EA 3EE8A 3VTIA 2OTLN 2H3GX 4B1ZA 2QEXN 3KWIA 4GY2B 2ITMA 3U9ZA 4BG9A 5JICA 4K42A 3CJCA 5AQFA 2P9UB 4I6MB 3QBXA 4GV3A 4DQ8A 4A62A 3J7ZO 2FXUA 3H46O 3RSEA 4BROA 2ASPA 3FZLA 2D1KA 1JJ2M 1OVYA 5AQOA 4PHTX 1E4GT 2I7NA 3M1FA 1BWFO 4ISEA 1SZ2A 3VEZA 4Y0WA 3CC7N 3UE5A 1JCFA 1NGIA 1P8ZA 4BGBA 3N4PA 1HPMA 5ADXH 3PLAA 5KPRA 2AA4A 3SMSA 2D4WA 2VYPA 4B1UB 3AAPA 1O13A 4A2AA 4CZLA 3LM9A 2QWLA 3MK6A 5M1KA 4E1JA 3DXMA 1HKGA 1U2VB 4BR7A 1IJJA 1S22A 4FO0A 1K8AO 3QMLA 3CQYA 4ISGA 3TU5A 4PL7A 4BRNA 3WUHA 1YIJN 1YJWN 5AQPA 3CPEA 3GE1A 4CZMA 2JWLA 3B8AX 1JCEA 2QM1A 2P9SB 3KK7A 5C2DA 4H5VA 1RFQA 2OANA 5GIPA 3KZBA 2HSTA 3MN6A 2PFUA 4GNIA 3VEWA 4FPBA 3AGRA 2FSKA 4WQ5A 5HL7L 3TSQA 3ZX3A 3CCMN 3CCVN 4PKGA 3OBWA 4BQZA 3M3ZA 4JK7A 4H0OA 2P9NB 1Q7YO 1BO5O 5AFUH 1K8KB 3TTCA 2ZJRL 3FE1A 1VQKN 2QTDA 1VAZA 3ENOA 4G9ZA 3SLCA 5AQKA 3TSPA 3I56N 4H5WA 1RDUA 4JKFA 2YHWA 5DM6L 4B1XB 2FSJA 3R6MA 2BUPA 3EKUA 3DXKB 4JK9A 2E2OA 5GINA 4WFNL 3E9PA 5GAEP 3U8XA 2HF3A 5AQJA 3O6WA 2VGNA 2YI1A 3RVCA 4FWSA 2CH6A 3H6EA 4MO5A 2E88A 4BR9A 4YOXA 4RCHA 4RTFD 4IDHA 3VF6A 2QWRA 4GV9A 1ILYA 4EHTA 4WFBL 2HBLA 3VMFB 1XC3A 3G71N 2FF6A 3SK3A 3CCRN 5KQDA 4KH5A 3LM2A 2NRVA 3AARA 3H45C 1HUXA 2P9KB 5BREA 5AQTA 3F9MA 1TYQA 2KKZA 4BRLA 1LCUA 4WCEL 1GLFO 1R59O 4M63C 4PKIA 4IWVA 2E8AA 2BTFA 5AZIB 2F7TA 3T69A 3G4SN 4JKGA 5DM7L 2IVOA 4H0TB 4CD3A 3M6GA 4FWRA 3CHWA 3IKMA 3AY9A 3F2KA 2ZJQL 1NMDA 1XQSC 3OBYA 2YCHA 3UKUB 5EX5A 1QQMA 2V51B 4CZEA 2A42A 4JHDA 4EFHA 5M1FA 1SS6A 2OTJN 4M7YA 1NGCA 4IO8A 4BRFA 5CR4A 2GELA 1GLJO 2P9IB 4JKHA 3VGKA 2HF4A 4NB4A 4WQ4C 3CIPA 4FWOA 4Z94A 3WQTA 3SJHA 4B1VA 1VQLN 4FWMA 3BF1A 3SAFA 1V4TA 1DT9A 2HBKA 3PIPL 1LOTB 5BPMA 2QW9A 3C6AA 3FZFA 3LDNA 2Q31A 3A5NC 3FZHA 4C1NK 5LJWA 3VENA 1Q81O 2D0OA 1ATSA 2YX6A 1IG8A 3O80A 3WXIA 5M1QA 2W40A 5LY3A 3D6RA 3L4IA 1Z6RA 3C65A 3QB0A 2V7ZA 3A5MC 1T6CA 1QHAA 1QQNA 1SAZA 3H3OB 2GTDA 3TTDA 2P9LB 1VQMN 4O8UA 3LDLA 4FWKA 3E66A 2WBNA 2ZJPL 4MDAA 2P9PB 3LDPA 2A6AA 5BRFA 4JEPA 4BR4A 4BRMA 4I6MA 3FLCO 4YDUC 5ELZA 1E4FT 5JMVA 5F2RA 4GVEA 4DKWA 2IVNA 3A0IX 4DHYA 2BH1A 3ENBA 1KC8O 3FZMA 2ASOA 3KWGA 4FWQA 3HZ6A 4JKEA 5EOYA 4BC5A 1QQOA 1ZC6A 4R79A 3OW2M 3BEXA 4J8FA 3R9PA 3SAHA 1VQ8N 1GLEG 3ATVA 4IOAL 5F1XA 2D0PA 5AQVA 1J6ZA 4OPHA 4BVPA 4JKAA 5LJVA 1MA9B 4QS9A 2FF3B 4B1WB 2IIRA 3SAGA 1NGEA 3HOTA 1NLVA 2QWNA 1U2VA 3MN5A 1GLDG 2Q97A 2QWQA 3LL3A 3MMVA 4CZHA 3CCQN 2J4RA 5GAHP 1K73O 3EO3A 4B9QA 1QZ6A 3CI5A 2NRWA 3C7NA 3OA9A 3DAWA 5BPNA 4A59A 1M90O 5ADXA 4IEEA 5JLHA 4EHUA 5TKYA 4L3QA 4CZIA 4OPAA 3WXKA 1NBWA 5TKWA 1M1KO 4BC4A 3SBTA 3QFUA 3L0QA 1NGBA 5AQXA 1GLCG 3ZX0A 4AF1A 4M7XA 3ID6A 1TUUA 2ZF5O 2RHKA 4BREA 3QBWA 2QXLA 3SBGA 3EL2A 2P9NA 4H0YB 1K8KA 1ATRA 3O8MA 2UYTA 3CXCM 5AR0A 4BGAA 3W3DA 3ZEUB 2A3ZA 4FL9A 4OO1J 3CCEN 2ASMA 3BUZB 5AQNA 3WQUA 3O9RA 5EXWA 3G25A 4BRQA 4WFAL 5C0YA 5E84A 2GWJA 3O9SA 4WF9L 4JD2B 1P90A 3R8EA 5I9EB 4XH5A 3DXKA 3ENHA 3CD6N 1T3VA 4AM7A 2Q36A 3O5BA 1H1VA 2QWOA 1X9JA 4CBUA 4YOUA 3WEEA 3A5OC 3GOIA 3K9JA 5AQMA 1DGKN 1X3MA 1Q82O 4YOWA 1C0GA 1NGHA 2NRHA 2WC9A 3VEVA 1TUYA 3F5TA 1NGAA 3CF5L 3ZETA 2V7YA 1Z05A 5AQYA 1QZ5A 1KAZA 1BA0A 3DJCA 2P9KA 5CE3A 2Q2RA 3D7EO 5KPTA 5EY4A 1BU6O 1KD1O 4IJNA 4JKCA 4YOYA 1RGIA 2CGJA 4B1YB 3CCSN 3SMPA 5GIOA 3EN9A 4CZGA 2CGLA 3BF3A 2AP1A 4BR5A 3VGLA 2QWMA 5C2FA 2QA4N 1WUAA 1XUPO 4MLHA 5M1PA 1GLBG 5AQLA 5AQHA 1NGJA 4KH6A 5AZJB 3UKRB 4FVUA 1YVNA 3IDHA 4BRIA 3I33A 4K41A 5JVGL 3CCLN 5JLFA 5EVZA 5AQZA 3UKUA 2A40A 3J8AA 2V52B 3IFRA 4HWIA 3LDOA 5F0XA 1GLLO 4H0VB 1D4XA 2Q0UA 1WOQA 4ILGB 5E26A 2PBDA 5FPMA 3O1BA 1MWMA 2F9WA 1HLUA 3ULEB 4K25A 3M5RA 4YOTA 5BRDA 5AQRA 5CHIA 4WQ5C 4ILJA 4RWTA 4HTLA 3N4QA 4C1NI 3BP8A 3MX2A 4EAHD 1Y64A 4JHDB 4BQLA 4FOEA 2A5XA 3O08A 4FPAA 4EIAA 5FPDA 3Q7BA 2NRXA 1W2BM 3CC2N 1HKBA 3CETA 4BRAA 3O1WA 2F9TA 3O9TA 4ISFA 1T44A 2ZGZA 4H5NA 1HKCA 4O8KA 3D2FA 3U4LA 3O9QA 2FLOA 4IJAA 5BRHA 2P9LA 3O4WA 4IO9L 4KBOA 4JAXA 4C23A 3OHRA 3E9LA 2P9PA 2VWBA 3EE9A 2P9UA 3KHYA 4PKHA 4MO4A 2HOEA 3MN9A 5BN8A 3AGKA 4FSVA 3HOSA 1MWKA 1S3XA 2FSNA 1NJIO 3DLLL 1C0FA 3P39A 4MDBA 3CQXA 3FFKB 4MLEA 5KQ8A 3CC4N 4A61A 3CPWM 1U6ZA 4YOVA 3D2EB 3VEOA 3VF4A 2Q0RA 2A41A 5GADP 1QVGM 2ZGYA 4BC2A 4CBWA 4A2BA 3L4QA 4CZKA 3JXUA 3NVMA 3RSEB 1BOTO 2GEMA 2KLAA 4XH1A 1YUWA 3A8YA 1VQNN 2NLXA 4A5BA 2E2PA 3QFPA 5B8HA 1YJNN 2ZWHA 5AQWA 4BR2A 1VQ7N 2GUPA 1V4SA 1KQSM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGF A;  2PAV A;  4BRD A;  3UB5 A;  2YJF A;  4BC3 A;  3CJ1 A;  2P9S A;  2E2N A;  2EWS A;  3VPZ A;  5AQQ A;  3DXM B;  4IXC A;  3MN7 A;  3H1V X;  2Q1N A;  1Q18 A;  1JCG A;  4BR0 A;  2YJE A;  3AAQ A;  3MDQ A;  4QS8 A;  4FWL A;  3VF2 A;  3CER A;  1YXQ A;  2DPN A;  3HM8 A;  3C7N B;  4FWP A;  2IVP A;  3ID8 A;  1ZXO A;  2NZT A;  3L6Q A;  3TPQ A;  4WQ4 A;  3DWL A;  3EKS A;  4FWN A;  1ESV A;  4BRH A;  3ZEU A;  3IUC A;  2VCP A;  2CGK A;  1BG3 A;  3S41 A;  4JD2 A;  3HI0 A;  2YHX A;  1EQY A;  5AFU A;  3ZX2 A;  1KXP A;  3LDQ A;  5BR9 A;  4CZF A;  2E1Y A;  2QWP A;  4QS7 A;  3WXJ A;  3CJA A;  1X3N A;  4H5T A;  1SQK A;  4O5F A;  4BVO A;  4FOI A;  3W0L A;  3P4I A;  1MDU B;  1YAG A;  3H1Q A;  3GDQ A;  4CD1 A;  4H0X B;  2E2Q A;  4AM6 A;  4CI6 A;  1ZBS A;  4YDU A;  3GG4 A;  5AZI A;  4WYB A;  1CZA N;  3HSC A;  5AQU A;  5KPZ A;  1DEJ A;  3VOV A;  3WEE B;  3CJ9 A;  1BA1 A;  4IZ9 A;  2YHY A;  5AZJ A;  3UKR A;  3I8B A;  4JN4 A;  3ZET B;  4XEI A;  1TYQ B;  3HBT A;  1NWK A;  3KVG A;  4PL8 A;  4JNE A;  2GWK A;  3QDK A;  4K43 A;  4LC9 B;  2KHO A;  3U9D A;  5AQG A;  4CJ7 A;  3CJB A;  1GLA G;  3MCP A;  5BPL A;  3VEX A;  3VES A;  2P9I A;  4DCH A;  3A5L C;  4BG8 A;  3ATU A;  1KAX A;  4DB3 A;  3CJ7 A;  5BN9 A;  3JS6 A;  4BRG A;  3ULE A;  3VET A;  2E1Z A;  1OKJ A;  4CZJ A;  4BRC A;  2HMP A;  1BUP A;  3FZK A;  4F9O A;  1HX1 A;  1BDG A;  5FPN A;  1NM1 A;  4H0P A;  4CBX A;  3FR0 A;  3HTV A;  1T6D A;  1NGG A;  1RDW X;  3VGM A;  4NO7 A;  3C0B A;  5FPE A;  3VEY A;  2CH5 A;  3GL1 A;  3H3N O;  4XH4 A;  4BRK A;  1ATN A;  3GBT A;  5AQI A;  3QIC A;  1NGD A;  3EZW A;  4H03 B;  2W41 A;  2WUS A;  3VER A;  1KAY A;  3IMX A;  2I7P A;  1HJO A;  4H5R A;  3FGU A;  3WXL A;  1DKG D;  3WT0 A;  1G99 A;  2E20 A;  4BRP A;  5AQS A;  3D2F B;  3D2E A;  2H3G X;  4B1Z A;  2ITM A;  4GY2 B;  3U9Z A;  4BG9 A;  5JIC A;  4K42 A;  3CJC A;  5AQF A;  2P9U B;  4I6M B;  3QBX A;  4DQ8 A;  4A62 A;  2FXU A;  3H46 O;  3RSE A;  4BRO A;  2ASP A;  3FZL A;  2D1K A;  5AQO A;  1E4G T;  2I7N A;  3M1F A;  1BWF O;  4ISE A;  1SZ2 A;  3VEZ A;  4Y0W A;  3UE5 A;  1JCF A;  1NGI A;  1P8Z A;  4BGB A;  1HPM A;  5ADX H;  5KPR A;  2AA4 A;  3SMS A;  2D4W A;  2VYP A;  4B1U B;  3AAP A;  4CZL A;  4A2A A;  3LM9 A;  2QWL A;  3MK6 A;  4E1J A;  3DXM A;  1HKG A;  1U2V B;  4BR7 A;  1IJJ A;  1S22 A;  4FO0 A;  3QML A;  3CQY A;  4ISG A;  3TU5 A;  4PL7 A;  4BRN A;  3WUH A;  5AQP A;  3GE1 A;  4CZM A;  3B8A X;  1JCE A;  2QM1 A;  2P9S B;  4H5V A;  1RFQ A;  2OAN A;  3KZB A;  3MN6 A;  4GNI A;  3VEW A;  4FPB A;  2FSK A;  4WQ5 A;  3ZX3 A;  4PKG A;  4BQZ A;  3M3Z A;  4H0O A;  2P9N B;  1BO5 O;  5AFU H;  1K8K B;  3FE1 A;  3ENO A;  3SLC A;  5AQK A;  4H5W A;  2YHW A;  4B1X B;  2FSJ A;  3R6M A;  2BUP A;  3EKU A;  3DXK B;  2E2O A;  3U8X A;  2HF3 A;  5AQJ A;  3O6W A;  2YI1 A;  4FWS A;  2CH6 A;  3H6E A;  4MO5 A;  2E88 A;  4BR9 A;  4RCH A;  4RTF D;  3VF6 A;  2QWR A;  4EHT A;  1XC3 A;  2FF6 A;  3SK3 A;  5KQD A;  3LM2 A;  3AAR A;  3H45 C;  1HUX A;  2P9K B;  5BRE A;  5AQT A;  3F9M A;  1TYQ A;  4BRL A;  1LCU A;  1GLF O;  1R59 O;  4M63 C;  4PKI A;  4IWV A;  2E8A A;  2BTF A;  5AZI B;  2IVO A;  4H0T B;  4CD3 A;  3M6G A;  4FWR A;  3CHW A;  3AY9 A;  1NMD A;  1XQS C;  2YCH A;  3UKU B;  5EX5 A;  1QQM A;  2V51 B;  4CZE A;  2A42 A;  4JHD A;  4EFH A;  4M7Y A;  1NGC A;  4IO8 A;  4BRF A;  3VGK A;  2GEL A;  1GLJ O;  2P9I B;  2HF4 A;  4NB4 A;  4WQ4 C;  3CIP A;  4FWO A;  4Z94 A;  3WQT A;  3SJH A;  4B1V A;  4FWM A;  3BF1 A;  1V4T A;  1LOT B;  5BPM A;  2QW9 A;  3FZF A;  3LDN A;  2Q31 A;  3A5N C;  3FZH A;  5LJW A;  3VEN A;  2D0O A;  1ATS A;  1IG8 A;  3O80 A;  3WXI A;  2W40 A;  5LY3 A;  3L4I A;  1Z6R A;  3QB0 A;  2V7Z A;  3A5M C;  1T6C A;  1QHA A;  1QQN A;  1SAZ A;  3H3O B;  2GTD A;  2P9L B;  3LDL A;  4FWK A;  2P9P B;  3LDP A;  2A6A A;  5BRF A;  4BR4 A;  4BRM A;  4I6M A;  3FLC O;  4YDU C;  5ELZ A;  1E4F T;  5JMV A;  5F2R A;  2IVN A;  3A0I X;  4DHY A;  3FZM A;  2ASO A;  4FWQ A;  3HZ6 A;  5EOY A;  4BC5 A;  1QQO A;  1ZC6 A;  3BEX A;  4J8F A;  3R9P A;  1GLE G;  3ATV A;  5F1X A;  2D0P A;  5AQV A;  1J6Z A;  4BVP A;  5LJV A;  1MA9 B;  4QS9 A;  2FF3 B;  4B1W B;  2IIR A;  1NGE A;  1NLV A;  2QWN A;  1U2V A;  3MN5 A;  1GLD G;  2Q97 A;  2QWQ A;  3LL3 A;  3MMV A;  4CZH A;  2J4R A;  3EO3 A;  4B9Q A;  1QZ6 A;  3CI5 A;  3C7N A;  3DAW A;  5BPN A;  5ADX A;  5JLH A;  4EHU A;  5TKY A;  4L3Q A;  4CZI A;  3WXK A;  1NBW A;  4BC4 A;  3QFU A;  3L0Q A;  1NGB A;  5AQX A;  1GLC G;  3ZX0 A;  4M7X A;  1TUU A;  2ZF5 O;  4BRE A;  3QBW A;  2QXL A;  3EL2 A;  2P9N A;  4H0Y B;  1K8K A;  1ATR A;  3O8M A;  2UYT A;  5AR0 A;  4BGA A;  3W3D A;  3ZEU B;  2A3Z A;  4FL9 A;  2ASM A;  3BUZ B;  5AQN A;  3WQU A;  5EXW A;  3G25 A;  4BRQ A;  5E84 A;  2GWJ A;  4JD2 B;  3R8E A;  5I9E B;  4XH5 A;  3DXK A;  3ENH A;  4AM7 A;  2Q36 A;  3O5B A;  1H1V A;  2QWO A;  1X9J A;  4CBU A;  3WEE A;  3A5O C;  3GOI A;  5AQM A;  1DGK N;  1X3M A;  1C0G A;  1NGH A;  2NRH A;  3VEV A;  1TUY A;  1NGA A;  3ZET A;  2V7Y A;  1Z05 A;  5AQY A;  1QZ5 A;  1KAZ A;  1BA0 A;  3DJC A;  2P9K A;  5CE3 A;  2Q2R A;  3D7E O;  5KPT A;  5EY4 A;  1BU6 O;  4IJN A;  1RGI A;  2CGJ A;  4B1Y B;  3SMP A;  3EN9 A;  4CZG A;  2CGL A;  3BF3 A;  2AP1 A;  4BR5 A;  3VGL A;  2QWM A;  1WUA A;  1XUP O;  4MLH A;  1GLB G;  5AQL A;  5AQH A;  1NGJ A;  5AZJ B;  3UKR B;  1YVN A;  3IDH A;  4BRI A;  3I33 A;  4K41 A;  5JLF A;  5EVZ A;  5AQZ A;  3UKU A;  2A40 A;  3J8A A;  2V52 B;  3IFR A;  4HWI A;  3LDO A;  5F0X A;  1GLL O;  4H0V B;  1D4X A;  2Q0U A;  1WOQ A;  5E26 A;  5FPM A;  2PBD A;  3O1B A;  1MWM A;  2F9W A;  1HLU A;  3ULE B;  4K25 A;  5BRD A;  5AQR A;  4WQ5 C;  4RWT A;  4HTL A;  4EAH D;  3BP8 A;  1Y64 A;  4JHD B;  4BQL A;  4FOE A;  2A5X A;  3O08 A;  4FPA A;  4EIA A;  5FPD A;  1HKB A;  3CET A;  4BRA A;  3O1W A;  2F9T A;  4ISF A;  1T44 A;  2ZGZ A;  4H5N A;  1HKC A;  4O8K A;  3D2F A;  3U4L A;  2FLO A;  4IJA A;  5BRH A;  2P9L A;  3O4W A;  4KBO A;  4JAX A;  4C23 A;  3OHR A;  2P9P A;  2VWB A;  2P9U A;  3KHY A;  4PKH A;  4MO4 A;  2HOE A;  3MN9 A;  5BN8 A;  4FSV A;  1MWK A;  1S3X A;  2FSN A;  1C0F A;  4MLE A;  5KQ8 A;  3CQX A;  3FFK B;  4A61 A;  1U6Z A;  3D2E B;  3VEO A;  3VF4 A;  2Q0R A;  2A41 A;  2ZGY A;  4BC2 A;  4CBW A;  4A2B A;  4CZK A;  3JXU A;  3RSE B;  1BOT O;  2GEM A;  4XH1 A;  1YUW A;  3A8Y A;  2NLX A;  2E2P A;  3QFP A;  5B8H A;  2ZWH A;  5AQW A;  4BR2 A;  2GUP A;  1V4S A; 
#chains in the Genus database with same CATH topology
 4BY9 C;  1UAX A;  5HRS A;  2YHB A;  4BC3 A;  3ZT1 A;  2E2N A;  5HRO A;  3VPZ A;  3DXM B;  1T8E A;  4IXC A;  3MN7 A;  3H1V X;  3CMA N;  3OYI A;  1J5O A;  1RDC A;  2YJE A;  4QS8 A;  4ILH A;  2LSN A;  2HW3 A;  1QS4 A;  4N41 A;  2YHA A;  3WXM B;  3NAE A;  3CM6 A;  4JI2 K;  2HHU A;  5CZ2 A;  4FWP A;  2IVP A;  1C6V A;  2G8H A;  3VTH A;  1R0A A;  5H1S Q;  4DS4 A;  3I0S A;  4H4M A;  2FBV A;  4FWN A;  3IUC A;  2OCE A;  2B6A A;  3NMU A;  1VQ4 N;  1KLM A;  3HI0 A;  2YHX A;  4Z4F A;  1VSJ A;  1QHT A;  5BR9 A;  4CIE A;  2QWP A;  4YHH K;  4QS7 A;  3WXJ A;  3ZSR A;  3O3G A;  3V4I A;  4LY7 A;  4B9N A;  2KFN A;  4Y1D A;  5LMU K;  1YAG A;  4CF0 A;  3K5N A;  3H1Q A;  4FJ8 A;  3GDQ A;  4Z4H A;  4YDU A;  5AZI A;  5CY4 A;  3HSC A;  5C25 A;  4OLA A;  4CEC A;  1C1A A;  4F4K A;  4ELT A;  1TKD A;  4HCC A;  4EP5 A;  4KV8 A;  1TL1 A;  3UKR A;  5C10 A;  3TR8 A;  3HP9 A;  4CJV A;  1TYQ B;  3KVG A;  2IS3 A;  4DU3 A;  1C1C A;  4LC9 B;  3SZ2 A;  1YI2 N;  3CJB A;  3TAB A;  3TTF A;  4JKG B;  3KIO A;  3JSM A;  2VQE K;  4DCH A;  3A5L C;  4BG8 A;  3QNO A;  3ATU A;  1VQ9 N;  4DB3 A;  3BGR A;  3CJ7 A;  5BN9 A;  3JS6 A;  4JRQ A;  2XO7 A;  3HPO A;  3THY B;  3VET A;  4OVL A;  1K9M O;  1LWF A;  1VQO N;  1EET A;  3K0S A;  1EWR A;  4BRC A;  2HMP A;  2I5J A;  4J2D A;  3FZK A;  4B3T K;  1HX1 A;  1BDG A;  1L3V A;  3ZSX A;  3E1Y A;  3LAN A;  4H0P A;  3ZSY A;  3IAY A;  3HTV A;  5FRO A;  1YHQ N;  4JKB A;  2CH5 A;  5M1N A;  4FJK A;  4BRK A;  5AQI A;  3EZW A;  4NCG A;  1KAY A;  5AJ3 K;  3VQP A;  1DKG D;  3NGY A;  4DFP A;  1OH6 A;  2E20 A;  3BZC A;  4IFY A;  2OTL N;  1TAQ A;  4B1Z A;  2QEX N;  2ITM A;  2B4J A;  1TV6 A;  4K42 A;  5AQF A;  4I6M B;  4NCB A;  4GV3 A;  1XWL A;  1RBS A;  4DTN A;  2D1K A;  1JJ2 M;  4X66 K;  4DU4 A;  1E4G T;  2I7N A;  1KSP A;  4BWJ A;  4ISE A;  4BE2 A;  1SZ2 A;  3CC7 N;  3UE5 A;  1JKH A;  4BGB A;  1QE1 A;  1HPM A;  3PLA A;  5KPR A;  2VYP A;  3S3M A;  4KHW A;  3BDP A;  3DXM A;  1HKG A;  2XY6 A;  5E41 A;  4DV0 K;  1RT3 A;  4FLT A;  3QML A;  1VSE A;  4FLV A;  4J2E A;  2KW4 A;  4E1M A;  1Q9Y A;  3B8A X;  2AJQ A;  1ASV A;  5C2D A;  3KZB A;  2HST A;  3PY8 A;  2PFU A;  4FLU A;  4GNI A;  3P83 D;  3AGR A;  3ZX3 A;  3KKS A;  1GOC A;  3LP2 A;  3MED A;  4PKG A;  3M3Z A;  2IOC A;  4H0O A;  1K8K B;  3L3U A;  2F8T A;  1NK8 A;  3QEX A;  1VAZ A;  3J7A P;  1RDU A;  4HUG A;  3V81 A;  4JKF A;  1Q8I A;  2YHW A;  1RT5 A;  1HNI A;  3DXK B;  5GIN A;  5GAE P;  3U8X A;  1NMN A;  3RR7 A;  1RDB A;  2YI1 A;  5JS1 A;  2HND A;  4BR9 A;  2E88 A;  4DTU A;  4DTX A;  1BCM A;  1VHX A;  3SYZ A;  4CFD A;  3OYA A;  3G71 N;  1WSI A;  1S6Q A;  2FF6 A;  1D9D A;  3DMJ A;  3AAR A;  1S1W A;  2A1R A;  4KAZ A;  1TYQ A;  2JLE A;  3SV4 A;  1S1X A;  4WCE L;  4M63 C;  4RW4 A;  2IDO A;  2F7T A;  4AQY K;  3J7Y P;  3HYF A;  4JKG A;  5DM7 L;  4H0T B;  4LH4 A;  1J54 A;  4FWR A;  2QXF A;  1CXU A;  3THY A;  1U45 A;  1D8Y A;  2ZJQ L;  3EY1 A;  1NMD A;  4G1Q A;  2YCH A;  3UKU B;  2V51 B;  4EFH A;  4CJF A;  2OTJ N;  3THX B;  4M7Y A;  3VGK A;  4NB4 A;  3CIP A;  5C24 A;  2ATQ A;  4B1V A;  1NKE A;  2E6L A;  1N5Y A;  1DT9 A;  1X9S A;  1LOT B;  3CYM A;  3FZF A;  3M8Q A;  2Q31 A;  3A5N C;  5LJW A;  4IG0 A;  4JS5 A;  1Q81 O;  4CGG A;  4CFC A;  1TKX A;  1Y97 A;  3WXI A;  2PYL A;  3C65 A;  3QB0 A;  3A5M C;  3C6U A;  1QQN A;  1SAZ A;  3H3O B;  4O8U A;  3K58 A;  1TKT A;  4FWK A;  5SZT A;  3DM2 A;  3VQ8 A;  1WSE A;  4BRM A;  4I6M A;  3FLC O;  3DLK A;  1E4F T;  2IVN A;  4CJ3 A;  3NH0 A;  3DI6 A;  4BC5 A;  3PUF A;  3L2V A;  3LWM A;  1VQ8 N;  1GLE G;  2O4G A;  2HB5 A;  5AQV A;  4OPH A;  4BVP A;  4JKA A;  5LJV A;  3OYD A;  1MA9 B;  3QER A;  4B1W B;  2IIR A;  3DYA A;  3ZSV A;  3SAG A;  5IWA K;  3TAP A;  2QWN A;  4FJH A;  2Q97 A;  4DTR A;  2J4R A;  2BDP A;  3EO3 A;  1QZ6 A;  1VRT A;  3CI5 A;  4L8R B;  5BPN A;  3KK1 A;  4A59 A;  1RTD A;  2YV0 X;  1A5X A;  3K57 A;  3WXK A;  2RKI A;  3CFP A;  3O3F A;  3AVM A;  4MFB A;  1N6Q A;  5AQX A;  1GLC G;  3ID6 A;  4W5R A;  4DV1 K;  4DR3 K;  3RMC A;  2RHK A;  1NK5 A;  4LF9 K;  4CEF A;  4H0Y B;  1K8K A;  3QEP A;  3PSI A;  1JL2 A;  4I7F A;  3UIQ A;  4BGA A;  5K14 A;  1U48 A;  1C0U A;  4BRQ A;  1ITG A;  5E84 A;  1KTQ A;  3O9S A;  3SCX A;  1CXQ A;  4JD2 B;  3EYZ A;  1P90 A;  3R8E A;  3DXK A;  3ENH A;  3J80 O;  2OZM A;  4KTQ A;  3O5B A;  1VSI A;  2ZM6 K;  1UA0 A;  3QLH A;  4KHP K;  4DUY K;  3WEE A;  1J5E K;  1DGK N;  1X3M A;  1TGO A;  4YOW A;  4UQG A;  1LAV A;  3PV8 A;  3LPU A;  2IC3 A;  1TUY A;  3F5T A;  4CK2 A;  3PX6 A;  1QZ5 A;  3DLB A;  4CJ5 A;  3D7E O;  5FRM A;  3CG7 A;  2UXD K;  1VSD A;  2VG7 A;  4YOY A;  3AVN A;  4KTW A;  1WAJ A;  3OYN A;  4HUF A;  3SMP A;  5GIO A;  3VGL A;  1RBU A;  4B8A B;  1Z25 A;  5AQH A;  4KH6 A;  3OYK A;  4BRI A;  1HQE A;  3JAM O;  4JI4 K;  2O8F A;  5JLF A;  4OKE A;  5AQZ A;  3UKU A;  4Z0U A;  4E7I A;  3THX A;  2KTQ A;  3P5J A;  1D4X A;  1WOQ A;  1NK7 A;  2IGI A;  3AVI A;  3O1B A;  3M5R A;  4YOT A;  5BRD A;  5CHI A;  2YNG A;  4JLH A;  3OJS A;  2OPR A;  4RWT A;  4C1N I;  4BQL A;  5FPD A;  4DTM A;  3NF8 A;  3SUN A;  3AO5 A;  3MXJ A;  3CET A;  3O9T A;  3D2F A;  4O55 A;  3PX4 A;  2FLO A;  3IRX A;  4JAX A;  3E9L A;  1CLQ A;  2VWB A;  2P9U A;  1KCF A;  4MO4 A;  1XHZ A;  1S3X A;  1NJI O;  3NDK A;  5KQ8 A;  4JI7 K;  1XC9 A;  2ZQB A;  1WSG A;  4YOV A;  1EP4 A;  3C95 A;  4BC2 A;  3VQ9 A;  4M3U A;  4A2B A;  2Y1J A;  1BOT O;  2GEM A;  2KLA A;  3QO9 A;  3QFP A;  2ZWH A;  5AQW A;  4BR2 A;  3L2W A;  1RBT A;  2KZZ A;  3ZLJ A;  1NGF A;  2PAV A;  2W6K A;  3K9K A;  2YJF A;  1JLA A;  4E0D A;  2EWS A;  5AQQ A;  1Q18 A;  1JCG A;  1VSK A;  4FWL A;  3AVF A;  2DPN A;  2HNZ A;  3C7N B;  4I2P A;  4O44 A;  1L3U A;  1ZXO A;  4DR6 K;  2NZT A;  3MEG A;  3L6Q A;  3TPQ A;  4CJE A;  4CHY A;  3CCU N;  1OVQ A;  4KPY A;  2O8B B;  2CGK A;  3ULD A;  1EO1 A;  4CHQ A;  4JD2 A;  2NRT A;  4Z4C A;  1SL0 A;  1EQY A;  3KK2 A;  3LDQ A;  1VQ6 N;  3V9X A;  1NJZ A;  2E1Y A;  2G8I A;  3CJA A;  3RRG A;  4O5F A;  3SI6 A;  4FOI A;  3W0L A;  4B08 A;  3E9O A;  3P4I A;  1MDU B;  3C6T A;  1RT7 A;  2DFH A;  3R1X A;  2NNW A;  4CD1 A;  4H0X B;  1GOA A;  2E2Q A;  4AM6 A;  3AO2 A;  2FBY A;  5C15 A;  5AQU A;  1DEJ A;  1W97 L;  1KFS A;  2NRR A;  4DTJ A;  4GV6 A;  1QSL A;  5FDL A;  4JN4 A;  2YKM A;  4FZX C;  1SV5 A;  3P31 A;  5HOO A;  4E89 A;  3V9U A;  1N32 K;  2GWK A;  4K43 A;  4FM0 A;  2JWK A;  4IEI A;  4CJ7 A;  2ITG A;  3VEX A;  2P9I A;  2GX9 A;  1TL3 A;  1KAX A;  2P5G A;  2UUC K;  2OPS A;  1YJ9 N;  4IFE A;  4DQQ A;  1YIT N;  1UOC A;  4DV3 K;  1OKJ A;  3VQD A;  3T7Z A;  3AVL A;  3G10 A;  5MLC Q;  4BE1 A;  4CJU A;  4M3W A;  1IKV A;  5FPN A;  4CBX A;  4LSN A;  4CEA A;  3KD5 E;  1LW0 A;  3FR0 A;  1T6D A;  4NO7 A;  3C0B A;  4FLY A;  5CYM A;  3P38 A;  4XH4 A;  2FBT A;  3RWU A;  5FLX O;  4H03 B;  4A57 A;  4DQR A;  5HRN A;  2WUS A;  2O8D A;  4KHQ A;  2I7P A;  1HJO A;  1HRH A;  1HNZ K;  3WT0 A;  3S3O A;  2DFE A;  4BRP A;  1KVB A;  3CQ8 A;  4FJL A;  5JS2 A;  2H3G X;  4FVM A;  3U9Z A;  4BG9 A;  4CGF A;  1B9F A;  1FJG K;  4DR4 K;  1VSL A;  4DQ8 A;  2YNH A;  3K5L A;  4BRO A;  2ASP A;  3FZL A;  1O1W A;  3TAF A;  4CIF A;  5J2Q A;  1U49 A;  1JCF A;  1NGI A;  4W5N A;  2AA4 A;  2D4W A;  4X62 K;  3AAP A;  4A2A A;  4CFA A;  3VQ7 A;  3MK6 A;  4E7J A;  4CEQ A;  1U2V B;  4DFK A;  1T05 A;  1Q9X A;  2F96 A;  3T3F A;  4FO0 A;  5I3U A;  4FJ5 A;  4KHN A;  2ZE2 A;  4M42 A;  2G8K A;  2ETJ A;  3CQY A;  3NF6 A;  1F21 A;  4ISG A;  1RNH A;  4PL7 A;  1FK9 A;  5KTQ A;  3V9S A;  3CPE A;  2JWL A;  2D0C A;  1JCE A;  2P9S B;  4H5V A;  1WBB A;  5GIP A;  4DUZ K;  2XY5 A;  3VEW A;  4C8K A;  4FPB A;  4O5B A;  2O8B A;  2FSK A;  4KHU A;  3IG1 A;  5HL7 L;  3CCV N;  2KZM A;  1EKE A;  4BQZ A;  4CE9 A;  4FK4 A;  2P9N B;  4DQP A;  1HYV A;  4FLZ A;  3RR8 A;  3VQE A;  3RMD A;  4RW6 A;  1VQK N;  4FJ7 A;  5J1E A;  2QTD A;  1IKY A;  4G9Z A;  5AQK A;  4O0J A;  2PYJ A;  2FSJ A;  4JI5 K;  4JK9 A;  2E2O A;  3OJU A;  4KI4 A;  3V1O A;  1BL3 A;  4EZ6 A;  3ZSO A;  4YOX A;  3RVC A;  4FWS A;  2CH6 A;  4EP4 A;  3VF6 A;  2Z1J A;  4IDH A;  1KFD A;  3VMF B;  1XC3 A;  3CCR N;  5KQD A;  1X1P A;  3AA2 A;  3HPH A;  2P9K B;  5BRE A;  5AQT A;  2KKZ A;  1LCU A;  2XY7 A;  1R59 O;  4PKI A;  4JV5 K;  1SUQ A;  2E8A A;  3T69 A;  3S3N A;  2IVO A;  4B9S A;  3M6G A;  2FC0 A;  3IKM A;  4DS5 A;  4CJL A;  3F2K A;  3QEW A;  4KHS A;  3OS1 A;  5HRR A;  5EX5 A;  1QQM A;  3VQQ A;  1NJX A;  2A42 A;  4JHD A;  3TAQ A;  2HHH K;  1CZ9 A;  4BRF A;  4KI6 A;  1GLJ O;  2HF4 A;  1QQC A;  4FWO A;  3ZSQ A;  4FWM A;  3BF1 A;  3SQ1 A;  1V4T A;  5KGW A;  3PIP L;  1QTM A;  4GVM A;  1EX4 A;  5BPM A;  3C6A A;  3QNN A;  3FZH A;  4NYF A;  4BDY A;  3VEN A;  2A1S A;  1IG8 A;  4AH9 A;  3D6R A;  1U04 A;  1Z6R A;  4LSL A;  2HHX A;  2V7Z A;  2FBX A;  3VQ4 A;  3HK2 A;  4CED A;  4LD0 A;  1RT4 A;  2WBN A;  4MDA A;  4B9V A;  3LDP A;  1FKP A;  5BRF A;  4BR4 A;  1HPZ A;  5JMV A;  4PQU A;  4B8C A;  4AHV A;  1OH8 A;  4GVE A;  3A0I X;  2BH1 A;  2YNF A;  4M3T A;  5EOY A;  4LFA K;  4J8F A;  3R9P A;  4IOA L;  2D0P A;  4X65 K;  3RMA A;  4QS9 A;  1NGE A;  1XNQ K;  1NLV A;  1U2V A;  3MEE A;  2QWQ A;  3LL3 A;  3TAM A;  4O0I A;  4B9Q A;  2P1J A;  3HP6 A;  3P1G A;  1NOZ A;  4DTS A;  3L3V A;  4FXD A;  1IO2 A;  3KJV A;  4EHU A;  4KB0 A;  4DG1 A;  5TKY A;  4L3Q A;  2WON A;  1YVU A;  1NOY A;  1E3M A;  4EZ9 A;  4CK1 A;  5TKW A;  1M1K O;  3SBT A;  3QFU A;  4OGC A;  1RDA A;  1NGB A;  2KFZ A;  1S1V A;  3C94 A;  5SWM A;  1RTJ A;  3PSF A;  4BRE A;  3SBG A;  2QXL A;  3EL2 A;  2P9N A;  4YFU A;  1B92 A;  3O8M A;  5KRT A;  4MQ3 A;  2BGG A;  3CXC M;  3W3D A;  3ZEU B;  5DMR A;  1ZBU A;  3G25 A;  4WFA L;  2XY8 A;  3O3H A;  2GWJ A;  1IKX A;  4WF9 L;  1LWC A;  1DTT A;  4DFM A;  5I9E B;  1ASU A;  4DLE A;  1ASW A;  1TK8 A;  4CEO A;  1Q82 O;  2NRH A;  3VEV A;  3LZJ A;  5D3G A;  4F2S A;  2EHG A;  1KAZ A;  5CE3 A;  2P9K A;  2Q2R A;  4CEE A;  1XMQ K;  2HVI A;  1RGI A;  4B1Y B;  3JYT A;  3CCS N;  4B9M A;  2BAN A;  1FKO A;  2CGL A;  5C2F A;  1XUP O;  3V1Q A;  1NGJ A;  1W9H A;  4DTP A;  5AZJ B;  4LF4 K;  3IDH A;  4K41 A;  4OKJ A;  5HRP A;  4CJW A;  1W0H A;  2V52 B;  3IFR A;  4HWI A;  3LDO A;  4B3R K;  4DF4 A;  2F9W A;  4CEZ A;  5AQR A;  4WQ5 C;  4M41 A;  4HTL A;  1ZYQ A;  3BP8 A;  4CJT A;  2O8C B;  3SUO A;  4FOE A;  3U6F A;  4DSE A;  4FPA A;  2G8V A;  3Q7B A;  1ZBI A;  4ISF A;  4CJQ A;  1DTQ A;  3NHG A;  1HKC A;  4O8K A;  3M8S A;  2VQF K;  3U4L A;  3O4W A;  4IO9 L;  4LF7 K;  4CJP A;  3EE9 A;  2HOE A;  3MN9 A;  4FSV A;  3HOS A;  1RBV A;  1NK9 A;  3DLL L;  1WSJ A;  1C0F A;  3P39 A;  4MLE A;  3CQX A;  3CPW M;  3QEV A;  4KRF A;  4CCH A;  1TK0 A;  3NBP A;  4CBW A;  3WNE A;  2UUB K;  2OPP A;  3THW B;  3RSE B;  3LDS A;  1YUW A;  1C0M A;  4A5B A;  2E2P A;  1VQ7 N;  5B8H A;  4N56 A;  3AVG A;  2KQ2 A;  2GUP A;  2W6L A;  4XIU A;  4RW8 A;  3Q7C A;  1S72 N;  2D5R A;  2BE2 A;  1RDD A;  3MWP A;  1WSH A;  4FJJ A;  1VQ5 N;  1YF5 L;  4KH4 A;  3AO1 A;  3VN5 A;  2HHQ A;  3S9H A;  2OYQ A;  2HBM A;  2DY4 A;  3HM8 A;  3ZYY X;  3CCJ N;  5KRS A;  3VQB A;  3AVC A;  1QVF M;  4BDP A;  3ID8 A;  3MCA B;  2D0A A;  1FW6 A;  3LZI A;  1A5V A;  3DWL A;  3CME N;  3TAR A;  1XHX A;  1ESV A;  3ZEU A;  1LWE A;  4CVN E;  2X6S A;  2VCP A;  3KLE A;  4JI6 K;  3T19 A;  1BG3 A;  3R3L A;  1IBL K;  1XMO K;  1I39 A;  3PO4 A;  3ZX2 A;  1Z26 A;  4CF2 A;  4DSL A;  1X3N A;  4H5T A;  4BVO A;  4BDZ A;  1A5W A;  1X9W A;  2ZD1 A;  1ZBF A;  5KI6 A;  2X6N A;  4OX9 K;  3AVB A;  2RE2 A;  3I55 N;  4PA1 A;  4CES A;  1VRU A;  1WN7 A;  4CI6 A;  1RBR A;  3VQ6 A;  3F9K A;  4FZY A;  3NGI A;  3GG4 A;  4WYB A;  1CZA N;  5KPZ A;  3VOV A;  2Y1I A;  3CJ9 A;  4Q0B A;  1BA1 A;  4W5T A;  4DV2 K;  4IZ9 A;  5I42 A;  3MX5 A;  2YHY A;  3L8B A;  3HO1 A;  5AZJ A;  4C8O A;  3VQC A;  1ZBH A;  4W5Q A;  3ZET B;  4U7B A;  4XEI A;  3NH1 A;  3TI0 A;  3HBT A;  2VGM A;  5M1O A;  1NWK A;  1L5U A;  3EZ5 A;  4IDK A;  4JNE A;  3QDK A;  4I2Q A;  3U9D A;  5AQG A;  3MCP A;  1GLA G;  5BPL A;  4YNQ A;  3VES A;  4CIG A;  4DWI A;  1RT6 A;  3TAN A;  3MWT A;  4A5A A;  3TAG A;  4CZJ A;  4UY8 O;  4FM1 A;  5HBM A;  4KRE A;  4F9O A;  4Q5V A;  3KLI A;  1VQP N;  4CJS A;  2E6M A;  1NK0 A;  1N8R O;  1L3T A;  3ALY A;  4CJK A;  3AA5 X;  3VGM A;  5FPE A;  1BIU A;  1SKS A;  2VG5 A;  3QIC A;  4DFJ A;  3WNG A;  4CF1 A;  1J53 A;  2W41 A;  4M3X A;  4H5R A;  2HBJ A;  3WXL A;  2WFB A;  3ZT3 A;  4IOC L;  3O9U A;  3EE8 A;  4DQS A;  1WNS A;  4GY2 B;  4FYD A;  4FK0 A;  4DMN A;  5CZ1 A;  3BY5 A;  1MU2 A;  4I9L A;  2FXU A;  3THW A;  3RSE A;  3OTO K;  4B9L A;  2GV9 A;  3VA3 A;  3M1F A;  1BWF O;  1HNX K;  4BWM A;  4FJG A;  3VEZ A;  1P8Z A;  5LL6 Z;  3N4P A;  3ZT0 A;  4M3Z A;  4CZL A;  1O13 A;  4OJR A;  3LM9 A;  3TWH A;  1JLQ A;  4E1J A;  4E7K A;  4FJ9 A;  1IBM K;  1KLN A;  3NF9 A;  4H4O A;  1S9E A;  3TU5 A;  4BRN A;  1SKW A;  3WUH A;  4C8N A;  1TAU A;  3ZT4 A;  4HTU A;  3GE1 A;  2QM1 A;  3LAK A;  4CHP A;  2VG6 A;  3V1R A;  3FFI A;  3OYM A;  4WQ5 A;  5J2P A;  2PY5 A;  3CCM N;  3AVJ A;  2G8W A;  3OBW A;  4JK7 A;  5AFU H;  3OS0 A;  3LAM A;  2ZJR L;  4BAC A;  1DLO A;  3SUP A;  2QKB A;  1UA1 A;  4PWD A;  3ENO A;  2VWK A;  3OYE A;  4FZZ A;  3TSP A;  1UWB A;  3I56 N;  5DM6 L;  1N34 K;  1RTH A;  4B1X B;  3R6M A;  3DLG A;  3EKU A;  3V9Z A;  4WFN L;  3E9P A;  4OLB A;  2HF3 A;  5AQJ A;  4NCA A;  3O6W A;  2VGN A;  3EEQ A;  1T03 A;  3D0P A;  3H6E A;  4MO5 A;  3OY9 A;  4RCH A;  4RTF D;  1BCO A;  2QWR A;  1ILY A;  4OGE A;  4M3Y A;  4KH5 A;  3LM2 A;  2NRV A;  4DSJ A;  1HUX A;  4FM2 A;  4LFB K;  4E7H A;  4DV4 K;  1EWQ A;  4IWV A;  3AA4 A;  5AZI B;  2OZS A;  1I94 K;  4CD3 A;  3LAL A;  3AY9 A;  2GBZ A;  1XQS C;  3AA3 A;  4NYN A;  1IV0 A;  1SS6 A;  5A2Q O;  4ICL A;  3I0R A;  1NGC A;  2UU9 K;  1U4B A;  5CR4 A;  4JKH A;  2W42 A;  4WQ4 C;  1OH5 A;  4Z94 A;  3SJH A;  2Z1I A;  1VQL N;  2E4L A;  3M8R A;  2QW9 A;  4X64 K;  4DU1 A;  4C1N K;  4CER A;  3O80 A;  3ZSZ A;  5M1Q A;  5LY3 A;  3OYJ A;  5FRN A;  4K8X A;  3TTD A;  2P9L B;  3LP0 A;  3LDL A;  4I9Q A;  2A6A A;  4CEB A;  4JEP A;  1SKR A;  2YNI A;  4CK3 A;  2HHW A;  5F2R A;  4TSX A;  3ENB A;  1KC8 O;  3FZM A;  4JKE A;  3OYG A;  1QQO A;  1ZC6 A;  4R79 A;  3HVT A;  4CW7 B;  3BEX A;  4AHU A;  4AIL C;  5F1X A;  4AHT A;  4CJR A;  2Z1H A;  3DLH A;  3O4Q A;  4CZH A;  3CCQ N;  2NUB A;  4Y1C A;  5GAH P;  1K73 O;  4E7L A;  1SL1 A;  2NRW A;  3C7N A;  5IT9 O;  3DAW A;  3HST B;  4F2R A;  3OYH A;  1M90 O;  5ADX A;  4IEE A;  4O4G A;  5JLH A;  4F8R A;  1L3S A;  4LFC K;  1T7P A;  4LH5 A;  4V19 S;  1IKW A;  3QIO A;  3D45 A;  4OPA A;  1NBW A;  2HHV A;  4BC4 A;  3LP3 A;  3ZT2 A;  4FJX A;  4AF1 A;  1TUU A;  1BQN A;  2ZF5 O;  4CFB A;  1BI4 B;  3RMB A;  1D9F A;  1G15 A;  3L2U A;  1BIS A;  4N76 A;  2A3Z A;  4OO1 J;  3WQU A;  5C0Y A;  2JGU A;  1TK5 A;  3HM9 A;  1B9D A;  4XH5 A;  4GKJ K;  3CD6 N;  1KVC A;  3HL8 A;  1T3V A;  1YTA A;  2Q36 A;  4AM7 A;  1H1V A;  4BE0 A;  4AHS A;  2E5L K;  4CBU A;  4B9T A;  4YOU A;  3GOI A;  3K9J A;  2WC9 A;  4IKF A;  3OYB A;  1NGA A;  3B6P A;  3CF5 L;  3KD1 E;  2V7Y A;  1Z05 A;  3DJC A;  5KPT A;  5EY4 A;  4IJN A;  4JKC A;  4CHZ A;  4E1N A;  3EN9 A;  1WUA A;  1GLB G;  5AQL A;  2HNY A;  1S1T A;  1YVN A;  4FJM A;  4Z4I A;  3AVK A;  1RTI A;  5EVZ A;  4CGJ A;  1NKC A;  1JXE A;  1HMV A;  3K5O A;  1EXQ A;  3QIN A;  4ZTF A;  3KTQ A;  1GLL O;  1X9M A;  4H0V B;  5E26 A;  4ILG B;  5FPM A;  2WTU A;  4DR2 K;  2PBD A;  4NXM K;  1NG9 A;  3HJF A;  2G8F A;  1HLU A;  3ULE B;  4B3M K;  4ILJ A;  4KKO A;  3K5M A;  1NK6 A;  3OYF A;  4N47 A;  4EAH D;  3MX2 A;  4CGI A;  3OYC A;  3OYL A;  2A5X A;  3O08 A;  4EIA A;  2NRX A;  1W2B M;  4CGD A;  3SNN A;  3O1W A;  4RW7 A;  4DTO A;  2ZGZ A;  4FLW A;  4H5N A;  3O9Q A;  3KLF A;  4IJA A;  2P9L A;  4KBO A;  4C23 A;  1HYZ A;  3OHR A;  3I8D A;  5HP1 A;  3KHY A;  4PKH A;  3NFA A;  3KLG A;  3ISN C;  5J2M A;  5J2N A;  3DRP A;  3D2E B;  3VEO A;  3VF4 A;  2Q0R A;  2A41 A;  5GAD P;  1QVG M;  4HCB A;  3JXU A;  3NVM A;  3WNF A;  3IS9 A;  3A8Y A;  1IBK K;  1VQN N;  4K8Z A;  2NLX A;  4KFB A;  1YJN N;  4OPK A;  1HJR A;  1V4S A;  4FLX A;  1YTU A;  3QIP A;  4BRD A;  3UB5 A;  4DQI A;  3DOL A;  4HUE A;  3AVA A;  3CJ1 A;  2P9S A;  1LAW A;  3AVH A;  3CFR A;  1NNE A;  2Q1N A;  3C6H A;  4BR0 A;  3AAQ A;  3MDQ A;  2IAJ A;  3VF2 A;  5JVH L;  3CER A;  1YXQ A;  1N33 K;  3G0Z A;  2UUA K;  1SL2 A;  4JKD A;  3SQ0 A;  3L2R A;  5C12 A;  1CZB A;  1FXX A;  1BI4 A;  4YOR A;  2UXC K;  3H08 A;  4WQ4 A;  3EKS A;  4BRH A;  1ZBL A;  3TSU A;  1VSM A;  3DOK A;  3S41 A;  4FW1 A;  4IBN A;  4NLC A;  1WAF A;  4B9U A;  3PX0 A;  5AFU A;  1KXP A;  4JK8 A;  4CZF A;  4K0K K;  2OPQ A;  3PO5 A;  1SQK A;  4C8L A;  4IOX A;  4DR7 K;  1QSY A;  3CM5 A;  1Q86 O;  1C0T A;  1C1B A;  1WBD A;  3K2P A;  1RCH A;  4ID1 A;  1ZBS A;  1JLB A;  3HRG A;  1LW2 A;  3WEE B;  4NLB A;  4LF8 K;  5LMN K;  3NF7 A;  3I8B A;  4FCY A;  5CYQ A;  2R7Y A;  4PL8 A;  2QI2 A;  5GAG P;  2KHO A;  4QOZ B;  3M8P A;  4R5P A;  4IG3 A;  2NRZ A;  4BRG A;  3LPT A;  3ULE A;  1OH7 A;  1S5J A;  2E1Z A;  3G6E N;  2O8F B;  3AO4 A;  4RG8 A;  3NCI A;  1BUP A;  3K59 A;  2O8E B;  4FW2 A;  3PIO L;  4CJ4 A;  1NM1 A;  1KVA A;  3SQ4 A;  3VA0 A;  1NGG A;  1RDW X;  3NVK A;  3VEY A;  4OKK A;  3GL1 A;  4B3O A;  3H3N O;  3QET A;  1ATN A;  3GBT A;  1NGD A;  4GKK K;  3VER A;  3SV3 A;  3IMX A;  4U67 L;  1XNR K;  1HNW K;  1REV A;  3FGU A;  1G99 A;  2P5O A;  2Q3S A;  5AQS A;  3D2F B;  3D2E A;  4QAG A;  3VTI A;  2RN2 A;  4JRP A;  3KWI A;  5JIC A;  3A2F A;  3CJC A;  2P9U B;  3HXM A;  3QBX A;  4A62 A;  3J7Z O;  2HVH A;  3H46 O;  2HHS A;  3RRH A;  2QK9 A;  4HHT A;  1OVY A;  5AQO A;  4PHT X;  3KLH A;  3BZK A;  1WLJ A;  3LP1 A;  2RPI A;  1JLF A;  4Y0W A;  2D0B A;  1YT3 A;  5ADX H;  3SMS A;  4B1U B;  3U3G A;  1NK4 A;  2QWL A;  5M1K A;  4BR7 A;  1IJJ A;  4DV7 K;  1NJW A;  1S22 A;  4CGH A;  1WB9 A;  1K8A O;  4F3T A;  3SQ2 A;  1YIJ N;  2X78 A;  1YJW N;  5AQP A;  4CZM A;  2O4I A;  3DRR A;  3KK7 A;  1RFQ A;  2OAN A;  1VSF A;  1U47 A;  3MN6 A;  4JI1 K;  3TSQ A;  1KRP A;  4N5S A;  4F3O A;  1Q7Y O;  1BO5 O;  3TTC A;  3FE1 A;  2EX3 A;  2B5J A;  2XRI A;  4Z4E A;  3SLC A;  4H5W A;  3V6D A;  2BUP A;  4CHO A;  3CFO A;  5HLF A;  4GV9 A;  4AHC A;  4EHT A;  4WFB L;  2HBL A;  3DRS A;  3SK3 A;  4E3S A;  3H45 C;  4FJI A;  4NXN K;  2F8S A;  3F9M A;  4DV6 K;  4BRL A;  1GLF O;  3VQ5 A;  4DR5 K;  2BTF A;  3NE6 A;  4WE1 A;  3G4S N;  3SPY A;  3CHW A;  3KKR A;  2OA8 A;  1JLC A;  4M45 A;  3ZSW A;  3OBY A;  3MXM A;  4CZE A;  2O8C A;  5M1F A;  4FK2 A;  2O8E A;  4IO8 A;  2GEL A;  2P9I B;  1JLG A;  3WNH A;  3WQT A;  4LF5 K;  4HVJ A;  3SAF A;  2DTU A;  1RT2 A;  2HBK A;  3HVR A;  4W5O A;  3LDN A;  5DK5 A;  2VWJ A;  4DSF A;  2D0O A;  1ATS A;  2YX6 A;  3T1A A;  2W40 A;  3L4I A;  5EU7 A;  4E19 A;  1S1U A;  1NJY A;  1T6C A;  1QHA A;  2WOM A;  2GTD A;  3O4N A;  3V9W A;  1HNV A;  1VQM N;  3E66 A;  2ZJP L;  2P9P B;  1JL1 A;  4DV5 K;  4Z4G A;  4YDU C;  1I3A A;  5ELZ A;  1TKZ A;  2O8D B;  3AO3 A;  3HPG A;  4KTZ A;  1JXB A;  4GMJ B;  4IFV A;  4DKW A;  3QEI A;  4DHY A;  1W7A A;  2ASO A;  3KWG A;  2X74 A;  3HZ6 A;  4FWQ A;  4QCL A;  4ELU A;  3OW2 M;  3SPZ A;  3SAH A;  3ATV A;  3F73 A;  4KB1 A;  1J6Z A;  3KK3 A;  3THV A;  2FF3 B;  1BIZ A;  3MEC A;  4H8K A;  3HOT A;  4ELV A;  3MN5 A;  1GLD G;  3MMV A;  3QES A;  1NKB A;  3OS2 A;  4RW9 A;  4ID5 A;  3OVN A;  3OA9 A;  4JYA K;  2F4V K;  4DLG A;  5KGX A;  1HR0 K;  4CZI A;  1XI1 A;  4DF8 A;  3DLE A;  3HT3 A;  4PY5 A;  3L0Q A;  3SJJ A;  3L2Q A;  3ZX0 A;  1LV5 A;  4DSK A;  4M7X A;  2HHT A;  4JI3 K;  1VK0 A;  3QBW A;  4KHY A;  1ATR A;  3VQA A;  2UYT A;  5AR0 A;  3U3Y A;  4PUO A;  4FL9 A;  3CCE N;  2HMI A;  2ASM A;  3BUZ B;  5AQN A;  2RF2 A;  3O9R A;  5EXW A;  1WSF A;  3J81 O;  4C8M A;  1RT1 A;  3NGZ A;  1QSS A;  2G8U A;  1BQM A;  4JI8 K;  4OPJ A;  3ITH A;  4KO0 A;  4CHN A;  2QWO A;  1X9J A;  1JLE A;  3T1H K;  3A5O C;  5AQM A;  1VSH A;  1NU0 A;  1C0G A;  1NGH A;  2YKN A;  3ZET A;  1S6P A;  3MXI A;  2QKK A;  5AQY A;  1BA0 A;  5C42 A;  4JS4 A;  2PZS A;  1BU6 O;  1KD1 O;  4CF8 A;  2CGJ A;  4JI0 K;  4M3R A;  4CZG A;  3BF3 A;  2AP1 A;  4BR5 A;  4GW6 A;  2QWM A;  2QA4 N;  4MLH A;  5M1P A;  4ZHR A;  3UKR B;  4FVU A;  4ZTJ A;  4DSI A;  3ZCM A;  3I33 A;  4YY3 K;  5JVG L;  3CCL N;  2A40 A;  3J8A A;  4FJN A;  1BHL A;  5F0X A;  4J2A A;  1J9A A;  3AV9 A;  2Q0U A;  1HYS A;  3NH2 A;  1MWM A;  4K25 A;  4AHR A;  1N36 K;  2DFF A;  3ASM A;  3N4Q A;  1Y64 A;  4JHD B;  2P51 A;  1IG9 A;  3CC2 N;  3SUQ A;  1HKB A;  4BRA A;  4CF9 A;  2UXB K;  2F9T A;  3TAE A;  1T44 A;  1IH7 A;  5BRH A;  3E01 A;  2P9P A;  3B6O A;  1K6Y A;  1BGX T;  4DR1 K;  5BN8 A;  1D5A A;  3AGK A;  4J2B A;  1MWK A;  1RIL A;  2FSN A;  4B3S K;  3CC4 N;  1S9G A;  4MDB A;  3FFK B;  1HQU A;  4A61 A;  1U6Z A;  3RTV A;  4LF6 K;  1GOB A;  2ZGY A;  5T7B A;  3L4Q A;  3DLR A;  4CZK A;  4XH1 A;  3MAQ A;  2XHB A;  2GUI A;  3LWL A;  2Z1G A;  1TVR A;  5BR8 K;  1KQS M;  3T1Y K; 
#chains in the Genus database with same CATH homology
 3Q7C A;  1S72 N;  4BY9 C;  1NGF A;  2PAV A;  3MWP A;  4BRD A;  3UB5 A;  3K9K A;  2YJF A;  4BC3 A;  3CJ1 A;  2P9S A;  2E2N A;  1VQ5 N;  2EWS A;  3VPZ A;  5AQQ A;  3DXM B;  1YF5 L;  4IXC A;  3MN7 A;  3H1V X;  4KH4 A;  2Q1N A;  1Q18 A;  3CMA N;  1JCG A;  3C6H A;  4BR0 A;  2YJE A;  3AAQ A;  3MDQ A;  4QS8 A;  4FWL A;  4ILH A;  3VF2 A;  2HBM A;  5JVH L;  3CER A;  3WXM B;  1YXQ A;  2DPN A;  3HM8 A;  3C7N B;  4JKD A;  3ZYY X;  4FWP A;  3CCJ N;  2IVP A;  1QVF M;  3VTH A;  5C12 A;  3ID8 A;  3MCA B;  1ZXO A;  4YOR A;  2NZT A;  5H1S Q;  3L6Q A;  3TPQ A;  4WQ4 A;  3DWL A;  3CME N;  3EKS A;  4FWN A;  1ESV A;  4BRH A;  3ZEU A;  3IUC A;  3TSU A;  3CCU N;  2VCP A;  2CGK A;  3NMU A;  1EO1 A;  1BG3 A;  3R3L A;  3S41 A;  1VQ4 N;  4JD2 A;  2NRT A;  3HI0 A;  4NLC A;  2YHX A;  1EQY A;  5AFU A;  3ZX2 A;  1KXP A;  3LDQ A;  4JK8 A;  4CZF A;  5BR9 A;  2E1Y A;  2QWP A;  1VQ6 N;  4QS7 A;  3WXJ A;  3CJA A;  1X3N A;  4H5T A;  1SQK A;  4O5F A;  4BVO A;  4FOI A;  3W0L A;  3E9O A;  4IOX A;  3P4I A;  1MDU B;  1Q86 O;  2RE2 A;  1YAG A;  3R1X A;  3I55 N;  3H1Q A;  2NNW A;  3GDQ A;  4CD1 A;  4H0X B;  2E2Q A;  4AM6 A;  4CI6 A;  1ZBS A;  4YDU A;  3GG4 A;  5AZI A;  3HRG A;  1CZA N;  3HSC A;  4WYB A;  5C15 A;  5AQU A;  5KPZ A;  1DEJ A;  3VOV A;  1W97 L;  3WEE B;  3CJ9 A;  1BA1 A;  2NRR A;  4NLB A;  4IZ9 A;  4GV6 A;  3MX5 A;  2YHY A;  5AZJ A;  3UKR A;  5C10 A;  3I8B A;  4JN4 A;  3ZET B;  4XEI A;  4U7B A;  3P31 A;  1TYQ B;  2VGM A;  3HBT A;  1NWK A;  3KVG A;  4PL8 A;  5M1O A;  5HOO A;  4JNE A;  2GWK A;  2QI2 A;  3QDK A;  4K43 A;  2JWK A;  4IEI A;  4LC9 B;  2KHO A;  5GAG P;  3U9D A;  1YI2 N;  5AQG A;  4CJ7 A;  3CJB A;  1GLA G;  3MCP A;  5BPL A;  3TTF A;  3VEX A;  3VES A;  2P9I A;  4JKG B;  2GX9 A;  4DCH A;  3A5L C;  4BG8 A;  1VQ9 N;  3ATU A;  1KAX A;  4DB3 A;  2NRZ A;  3CJ7 A;  5BN9 A;  3JS6 A;  4BRG A;  1YJ9 N;  3MWT A;  4IFE A;  3ULE A;  3VET A;  4A5A A;  1YIT N;  2E1Z A;  1K9M O;  1OKJ A;  3G6E N;  1VQO N;  4CZJ A;  4UY8 O;  3T7Z A;  4BRC A;  5MLC Q;  2HMP A;  1BUP A;  3FZK A;  3PIO L;  4F9O A;  1HX1 A;  1BDG A;  5FPN A;  1VQP N;  1NM1 A;  3E1Y A;  4H0P A;  4CBX A;  1N8R O;  3FR0 A;  3HTV A;  1T6D A;  1NGG A;  1RDW X;  3VGM A;  4NO7 A;  4JKB A;  3C0B A;  1YHQ N;  5FPE A;  3VEY A;  3NVK A;  2CH5 A;  5M1N A;  3GL1 A;  3P38 A;  3H3N O;  4XH4 A;  4BRK A;  1ATN A;  3GBT A;  5AQI A;  3QIC A;  1NGD A;  3EZW A;  4H03 B;  4A57 A;  2W41 A;  2WUS A;  3VER A;  1KAY A;  3IMX A;  2I7P A;  4U67 L;  1HJO A;  4H5R A;  2HBJ A;  3FGU A;  3WXL A;  2WFB A;  1DKG D;  3WT0 A;  1G99 A;  2E20 A;  4BRP A;  4IOC L;  3O9U A;  5AQS A;  3D2F B;  3D2E A;  3EE8 A;  3VTI A;  2OTL N;  2H3G X;  4B1Z A;  2QEX N;  3KWI A;  4GY2 B;  2ITM A;  3U9Z A;  4BG9 A;  5JIC A;  4K42 A;  3CJC A;  5AQF A;  2P9U B;  4I6M B;  3QBX A;  4GV3 A;  4DQ8 A;  4A62 A;  3J7Z O;  2FXU A;  3H46 O;  3RSE A;  4BRO A;  2ASP A;  3FZL A;  2D1K A;  1JJ2 M;  1OVY A;  5AQO A;  4PHT X;  1E4G T;  2I7N A;  3M1F A;  1BWF O;  4ISE A;  1SZ2 A;  3VEZ A;  4Y0W A;  3CC7 N;  3UE5 A;  1JCF A;  1NGI A;  1P8Z A;  4BGB A;  3N4P A;  1HPM A;  5ADX H;  3PLA A;  5KPR A;  2AA4 A;  3SMS A;  2D4W A;  2VYP A;  4B1U B;  3AAP A;  1O13 A;  4A2A A;  4CZL A;  3LM9 A;  2QWL A;  3MK6 A;  5M1K A;  4E1J A;  3DXM A;  1HKG A;  1U2V B;  4BR7 A;  1IJJ A;  1S22 A;  4FO0 A;  1K8A O;  3QML A;  3CQY A;  4ISG A;  3TU5 A;  4PL7 A;  4BRN A;  3WUH A;  1YIJ N;  1YJW N;  5AQP A;  3CPE A;  3GE1 A;  4CZM A;  2JWL A;  3B8A X;  1JCE A;  2QM1 A;  2P9S B;  3KK7 A;  5C2D A;  4H5V A;  1RFQ A;  2OAN A;  5GIP A;  3KZB A;  2HST A;  3MN6 A;  2PFU A;  4GNI A;  3VEW A;  4FPB A;  3AGR A;  2FSK A;  4WQ5 A;  5HL7 L;  3TSQ A;  3ZX3 A;  3CCM N;  3CCV N;  4PKG A;  3OBW A;  4BQZ A;  3M3Z A;  4JK7 A;  4H0O A;  2P9N B;  1Q7Y O;  1BO5 O;  5AFU H;  1K8K B;  3TTC A;  2ZJR L;  3FE1 A;  1VQK N;  2QTD A;  1VAZ A;  3ENO A;  4G9Z A;  3SLC A;  5AQK A;  3TSP A;  3I56 N;  4H5W A;  1RDU A;  4JKF A;  2YHW A;  5DM6 L;  4B1X B;  2FSJ A;  3R6M A;  2BUP A;  3EKU A;  3DXK B;  4JK9 A;  2E2O A;  5GIN A;  4WFN L;  3E9P A;  5GAE P;  3U8X A;  2HF3 A;  5AQJ A;  3O6W A;  2VGN A;  2YI1 A;  3RVC A;  4FWS A;  2CH6 A;  3H6E A;  4MO5 A;  2E88 A;  4BR9 A;  4YOX A;  4RCH A;  4RTF D;  4IDH A;  3VF6 A;  2QWR A;  4GV9 A;  1ILY A;  4EHT A;  4WFB L;  2HBL A;  3VMF B;  1XC3 A;  3G71 N;  2FF6 A;  3SK3 A;  3CCR N;  5KQD A;  4KH5 A;  3LM2 A;  2NRV A;  3AAR A;  3H45 C;  1HUX A;  2P9K B;  5BRE A;  5AQT A;  3F9M A;  1TYQ A;  2KKZ A;  4BRL A;  1LCU A;  4WCE L;  1GLF O;  1R59 O;  4M63 C;  4PKI A;  4IWV A;  2E8A A;  2BTF A;  5AZI B;  2F7T A;  3T69 A;  3G4S N;  4JKG A;  5DM7 L;  2IVO A;  4H0T B;  4CD3 A;  3M6G A;  4FWR A;  3CHW A;  3IKM A;  3AY9 A;  3F2K A;  2ZJQ L;  1NMD A;  1XQS C;  3OBY A;  2YCH A;  3UKU B;  5EX5 A;  1QQM A;  2V51 B;  4CZE A;  2A42 A;  4JHD A;  4EFH A;  5M1F A;  1SS6 A;  2OTJ N;  4M7Y A;  1NGC A;  4IO8 A;  4BRF A;  5CR4 A;  2GEL A;  1GLJ O;  2P9I B;  4JKH A;  3VGK A;  2HF4 A;  4NB4 A;  4WQ4 C;  3CIP A;  4FWO A;  4Z94 A;  3WQT A;  3SJH A;  4B1V A;  1VQL N;  4FWM A;  3BF1 A;  3SAF A;  1V4T A;  1DT9 A;  2HBK A;  3PIP L;  1LOT B;  5BPM A;  2QW9 A;  3C6A A;  3FZF A;  3LDN A;  2Q31 A;  3A5N C;  3FZH A;  4C1N K;  5LJW A;  3VEN A;  1Q81 O;  2D0O A;  1ATS A;  2YX6 A;  1IG8 A;  3O80 A;  3WXI A;  5M1Q A;  2W40 A;  5LY3 A;  3D6R A;  3L4I A;  1Z6R A;  3C65 A;  3QB0 A;  2V7Z A;  3A5M C;  1T6C A;  1QHA A;  1QQN A;  1SAZ A;  3H3O B;  2GTD A;  3TTD A;  2P9L B;  1VQM N;  4O8U A;  3LDL A;  4FWK A;  3E66 A;  2WBN A;  2ZJP L;  4MDA A;  2P9P B;  3LDP A;  2A6A A;  5BRF A;  4JEP A;  4BR4 A;  4BRM A;  4I6M A;  3FLC O;  4YDU C;  5ELZ A;  1E4F T;  5JMV A;  5F2R A;  4GVE A;  4DKW A;  2IVN A;  3A0I X;  4DHY A;  2BH1 A;  3ENB A;  1KC8 O;  3FZM A;  2ASO A;  3KWG A;  4FWQ A;  3HZ6 A;  4JKE A;  5EOY A;  4BC5 A;  1QQO A;  1ZC6 A;  4R79 A;  3OW2 M;  3BEX A;  4J8F A;  3R9P A;  3SAH A;  1VQ8 N;  1GLE G;  3ATV A;  4IOA L;  5F1X A;  2D0P A;  5AQV A;  1J6Z A;  4OPH A;  4BVP A;  4JKA A;  5LJV A;  1MA9 B;  4QS9 A;  2FF3 B;  4B1W B;  2IIR A;  3SAG A;  1NGE A;  3HOT A;  1NLV A;  2QWN A;  1U2V A;  3MN5 A;  1GLD G;  2Q97 A;  2QWQ A;  3LL3 A;  3MMV A;  4CZH A;  3CCQ N;  2J4R A;  5GAH P;  1K73 O;  3EO3 A;  4B9Q A;  1QZ6 A;  3CI5 A;  2NRW A;  3C7N A;  3OA9 A;  3DAW A;  5BPN A;  4A59 A;  1M90 O;  5ADX A;  4IEE A;  5JLH A;  4EHU A;  5TKY A;  4L3Q A;  4CZI A;  4OPA A;  3WXK A;  1NBW A;  5TKW A;  1M1K O;  4BC4 A;  3SBT A;  3QFU A;  3L0Q A;  1NGB A;  5AQX A;  1GLC G;  3ZX0 A;  4AF1 A;  4M7X A;  3ID6 A;  1TUU A;  2ZF5 O;  2RHK A;  4BRE A;  3QBW A;  2QXL A;  3SBG A;  3EL2 A;  2P9N A;  4H0Y B;  1K8K A;  1ATR A;  3O8M A;  2UYT A;  3CXC M;  5AR0 A;  4BGA A;  3W3D A;  3ZEU B;  2A3Z A;  4FL9 A;  4OO1 J;  3CCE N;  2ASM A;  3BUZ B;  5AQN A;  3WQU A;  3O9R A;  5EXW A;  3G25 A;  4BRQ A;  4WFA L;  5C0Y A;  5E84 A;  2GWJ A;  3O9S A;  4WF9 L;  4JD2 B;  1P90 A;  3R8E A;  5I9E B;  4XH5 A;  3DXK A;  3ENH A;  3CD6 N;  1T3V A;  4AM7 A;  2Q36 A;  3O5B A;  1H1V A;  2QWO A;  1X9J A;  4CBU A;  4YOU A;  3WEE A;  3A5O C;  3GOI A;  3K9J A;  5AQM A;  1DGK N;  1X3M A;  1Q82 O;  4YOW A;  1C0G A;  1NGH A;  2NRH A;  2WC9 A;  3VEV A;  1TUY A;  3F5T A;  1NGA A;  3CF5 L;  3ZET A;  2V7Y A;  1Z05 A;  5AQY A;  1QZ5 A;  1KAZ A;  1BA0 A;  3DJC A;  2P9K A;  5CE3 A;  2Q2R A;  3D7E O;  5KPT A;  5EY4 A;  1BU6 O;  1KD1 O;  4IJN A;  4JKC A;  4YOY A;  1RGI A;  2CGJ A;  4B1Y B;  3CCS N;  3SMP A;  5GIO A;  3EN9 A;  4CZG A;  2CGL A;  3BF3 A;  2AP1 A;  4BR5 A;  3VGL A;  2QWM A;  5C2F A;  2QA4 N;  1WUA A;  1XUP O;  4MLH A;  5M1P A;  1GLB G;  5AQL A;  5AQH A;  1NGJ A;  4KH6 A;  5AZJ B;  3UKR B;  4FVU A;  1YVN A;  3IDH A;  4BRI A;  3I33 A;  4K41 A;  5JVG L;  3CCL N;  5JLF A;  5EVZ A;  5AQZ A;  3UKU A;  2A40 A;  3J8A A;  2V52 B;  3IFR A;  4HWI A;  3LDO A;  5F0X A;  1GLL O;  4H0V B;  1D4X A;  2Q0U A;  1WOQ A;  4ILG B;  5E26 A;  2PBD A;  5FPM A;  3O1B A;  1MWM A;  2F9W A;  1HLU A;  3ULE B;  4K25 A;  3M5R A;  4YOT A;  5BRD A;  5AQR A;  5CHI A;  4WQ5 C;  4ILJ A;  4RWT A;  4HTL A;  3N4Q A;  4C1N I;  3BP8 A;  3MX2 A;  4EAH D;  1Y64 A;  4JHD B;  4BQL A;  4FOE A;  2A5X A;  3O08 A;  4FPA A;  4EIA A;  5FPD A;  3Q7B A;  2NRX A;  1W2B M;  3CC2 N;  1HKB A;  3CET A;  4BRA A;  3O1W A;  2F9T A;  3O9T A;  4ISF A;  1T44 A;  2ZGZ A;  4H5N A;  1HKC A;  4O8K A;  3D2F A;  3U4L A;  3O9Q A;  2FLO A;  4IJA A;  5BRH A;  2P9L A;  3O4W A;  4IO9 L;  4KBO A;  4JAX A;  4C23 A;  3OHR A;  3E9L A;  2P9P A;  2VWB A;  3EE9 A;  2P9U A;  3KHY A;  4PKH A;  4MO4 A;  2HOE A;  3MN9 A;  5BN8 A;  3AGK A;  4FSV A;  3HOS A;  1MWK A;  1S3X A;  2FSN A;  1NJI O;  3DLL L;  1C0F A;  3P39 A;  4MDB A;  3CQX A;  3FFK B;  4MLE A;  5KQ8 A;  3CC4 N;  4A61 A;  3CPW M;  1U6Z A;  4YOV A;  3D2E B;  3VEO A;  3VF4 A;  2Q0R A;  2A41 A;  5GAD P;  1QVG M;  2ZGY A;  4BC2 A;  4CBW A;  4A2B A;  3L4Q A;  4CZK A;  3JXU A;  3NVM A;  3RSE B;  1BOT O;  2GEM A;  2KLA A;  4XH1 A;  1YUW A;  3A8Y A;  1VQN N;  2NLX A;  4A5B A;  2E2P A;  3QFP A;  5B8H A;  1YJN N;  2ZWH A;  5AQW A;  4BR2 A;  1VQ7 N;  2GUP A;  1V4S A;  1KQS M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...