4B3SK

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3sK00
3T1YK 4CVNE 1XNQK 4B3SK 4DUZK 4B3TK 4NXNK 1XMQK 2UUCK 4DV1K 4DR7K 4JYAK 4DV5K 2UXBK 3J80O 4DV7K 1IBLK 4LF4K 4JI7K 4JI0K 5IT9O 4LF8K 4DR5K 4DR1K 2UUAK 1J5EK 1HR0K 5IWAK 4LFAK 1N34K 2UU9K 5LL6Z 1IBMK 2UXCK 3OTOK 4JI2K 4JI5K 3T1HK 4JI1K 4X66K 4DV6K 4DUYK 4DR2K 4LF7K 1FJGK 4LF6K 4YHHK 4DR6K 4DV4K 4LFBK 4DR4K 5AJ3K 5BR8K 1N36K 1I94K 2VQFK 3J7AP 4GKJK 2UXDK 4B3RK 4NXMK 4JI8K 4X65K 4DV0K 4JI4K 2ZM6K 4DV2K 1N32K 2E5LK 4JI6K 1HNZK 5A2QO 4AQYK 3J81O 2HHHK 5LMNK 1HNXK 4DV3K 5LMUK 4LF5K 4DR3K 3J7YP 1XMOK 4X64K 4K0KK 2F4VK 4X62K 4GKKK 3JAMO 1HNWK 2VQEK 4OX9K 1IBKK 4YY3K 4B3MK 4JV5K 2UUBK 1N33K 4KHPK 5FLXO 4LF9K 1XNRK 4V19S 4CW7B 4JI3K 4LFCK
chains in the Genus database with same CATH superfamily
3T1YK 5AQZA 2D0CA 2F8SA 2OTLN 4F2SA 3C6UA 4HCCA 4K41A 1L3SA 3ZT0A 4BWMA 4JYAK 2WTUA 4ILGB 4EIAA 4B1WB 1NK8A 3KHYA 3WNFA 2O4GA 4A62A 3SAFA 3CJ1A 3SZ2A 3OYAA 3LP0A 4H0YB 4FZYA 1NGDA 3SUPA 2GBZA 1ATSA 3MEEA 3UKRA 5BRHA 4FSVA 2NRZA 1ITGA 4KO0A 1IBMK 2FBXA 1WNSA 4FWRA 4E19A 4DLGA 1U2VA 3WEEA 4BR9A 1TAQA 4DSJA 3ISNC 4IFVA 4W5NA 2ITMA 1LWFA 1X9JA 4JI1K 2ITGA 4FVUA 3LDLA 3VF4A 4BR5A 4WQ4C 1P8ZA 5J2MA 4LF6K 1GLDG 4YHHK 4JAXA 2PFUA 4HUGA 4LY7A 4B3RK 4FJHA 4JS5A 2ZM6K 2Z1JA 3NH0A 1GLLO 1B9DA 3VTIA 4AHTA 3T7ZA 3V9SA 4DV3K 2HF4A 2E4LA 5AQTA 3THXA 1KLMA 1E3MA 2GUIA 1ZBLA 4KFBA 3HBTA 5AZIB 3HSTB 4BACA 4Z94A 4CE9A 3TSUA 4AHUA 4W5QA 1WSEA 3LWMA 1LW2A 3LPTA 1B92A 2WBNA 3CJCA 5FPNA 2XO7A 2HBKA 1IBKK 3RSEB 3KWIA 3WQTA 3OJUA 1U49A 5C2DA 3O3GA 1NM1A 1KVCA 3ZSVA 1XNQK 1C0UA 5AQQA 4M7XA 3TAGA 1CLQA 1F21A 2P9PA 2G8IA 4DV1K 4CEFA 3CXCM 4DV5K 2LSNA 3SCXA 4CBWA 4FO0A 3RVCA 3MEGA 3WNEA 2RHKA 1S1VA 2YX6A 5AQKA 3DM2A 2W6KA 3V4IA 3O80A 3EN9A 3V6DA 5JS2A 1NGCA 1SAZA 2KFZA 2P9LA 4PKGA 3EYZA 1BHLA 4CGHA 4CZHA 4AH9A 1E4FT 4HUEA 5LY3A 3CD6N 4JLHA 2BANA 5AQSA 3VF6A 4W5OA 1VQNN 1JJ2M 2P9NA 4LSLA 3G0ZA 1SKRA 1I3AA 5CZ1A 2NUBA 4CEBA 3WQUA 4JHDA 5AQWA 4DF8A 1E4GT 4DR2K 2O8BA 3BUZB 4B9VA 3OYEA 2X74A 1EETA 2KFNA 1ZC6A 2DY4A 1BL3A 4BE2A 2ZGZA 1UA0A 1JL1A 1MA9B 5EY4A 3QDKA 3G6EN 3HYFA 3OY9A 3EY1A 4DV2K 2NRRA 2O8CB 4NYNA 1RILA 2BH1A 3HPOA 4JRPA 4B1YB 2QWRA 1VHXA 4FCYA 5LMNK 3P39A 1RGIA 3QEXA 2YNFA 2Q1NA 1TKZA 3LM2A 3MX5A 1WAJA 4CGDA 4H5NA 4MDBA 4DSFA 4H8KA 4CHOA 4NYFA 1SV5A 3A8YA 3FFIA 1RT1A 3CCQN 1HNWK 1KXPA 4KHSA 4BC5A 4IO9L 2Z1IA 4OPHA 3HM9A 4FYDA 4RW9A 4O55A 4J8FA 1U45A 3VQ5A 4KI6A 1FK9A 3LDOA 2Q3SA 4JK8A 3CJBA 1BGXT 1O1WA 2FC0A 4MO4A 4FPBA 1SS6A 5AQVA 4WFAL 5AQUA 2NRTA 5KQDA 4QAGA 4UQGA 3C0BA 5F1XA 3V9WA 1WSJA 5BREA 2YJEA 3OS1A 3QB0A 1S1XA 2Q2RA 2HW3A 5GAEP 4Z4CA 4RWTA 2I7NA 4BRAA 4JKAA 2KHOA 4K25A 4R5PA 5AZIA 1QVGM 2ASOA 1LV5A 3QESA 1NWKA 4RG8A 4DS5A 3A0IX 3ID8A 3T3FA 4CD3A 2Q97A 3VQ9A 1V4TA 3BF1A 4FWOA 3VA0A 2D0AA 5HP1A 1UWBA 3DLGA 1Q82O 3T1HK 5AQRA 4LSNA 4DV6K 3CETA 1U48A 1BUPA 4CZGA 4F9OA 3HRGA 3ZT2A 4C8MA 5E26A 5J2NA 2Y1JA 2HNYA 3O1BA 4IWVA 3NDKA 2E6MA 3ZEUA 2KQ2A 1GOBA 3VGKA 3C95A 2QW9A 3FZHA 4DU4A 3GE1A 3IUCA 3DAWA 3EL2A 3P38A 1JCFA 4H5WA 1NMDA 2IAJA 2IIRA 3ALYA 3FZLA 1IKVA 3AO5A 2D4WA 3TR8A 5J1EA 4LF5K 4CK1A 4JK9A 4CFAA 4YOVA 1SQKA 3NF9A 1YT3A 5EOYA 4JKBA 4X62K 1YJNN 3CHWA 2RPIA 4CJKA 3CFRA 2HBMA 3ZSWA 1NK0A 4OX9K 4H03B 1YUWA 3RMBA 4EZ9A 3H45C 4CJ5A 4PWDA 3PX4A 1N33K 4H5TA 2IVNA 3VQDA 3AGRA 5BPMA 1VSLA 2HSTA 4KRFA 3TAFA 5ADXH 4CJ7A 2P1JA 1HKCA 3EZWA 5AQMA 3UKUB 3ID6A 4CHQA 3U6FA 4NB4A 5B8HA 2Z1GA 3M8SA 1VSHA 1RNHA 1ZBIA 3W0LA 4M3TA 4QS8A 1KLNA 2PAVA 1WUAA 2VG6A 1YJWN 2NZTA 4BRDA 3L4QA 2Q31A 3H08A 3QIPA 2IS3A 3SMSA 4BRNA 1UA1A 4LFAK 3DRSA 3KLIA 2DFHA 4CFBA 3TPQA 1GLAG 3F2KA 3O9RA 5LL6Z 3NAEA 5JS1A 5LJWA 4BR4A 3LANA 4CIEA 2UXCK 4CZLA 1L5UA 1BOTO 1YF5L 2RE2A 4OGEA 5EU7A 3CPWM 2D5RA 3MXIA 2IVPA 2E2NA 2KW4A 1JLAA 4QS9A 1GOCA 2FF3B 4FJGA 4G9ZA 2UXDK 4PY5A 1YVNA 1CXUA 5CYMA 4CEDA 4CZJA 1QSSA 4JD2A 5GADP 4GVMA 4B1UB 4CJUA 5LJVA 4YNQA 3K9KA 4BQLA 4A2AA 4FJXA 4DSKA 1OVYA 1QQCA 4BRHA 3QIOA 3SV4A 1X9MA 3MDQA 2ZJQL 4JKFA 5HLFA 1JLCA 2A1RA 1KVAA 1RDWX 1S5JA 3K5OA 1NGHA 4I9QA 1NGIA 1LAVA 3JAMO 3MCAB 4O5BA 1TKDA 3ITHA 4J2AA 1RT5A 1MWMA 2CGKA 3VGMA 3VF2A 4JNEA 4Z0UA 2HHWA 4DHYA 2NNWA 2F9WA 4LF9K 4V19S 3HPGA 1IKXA 1BI4B 1NKEA 3RR8A 3H1VX 5K14A 3WXLA 4FM0A 4WCEL 3S3NA 1FW6A 1WOQA 1VQ9N 2F7TA 1RCHA 5BN8A 4FM2A 1JL2A 4JEPA 1DTTA 4WQ4A 1TK5A 5CYQA 5ELZA 4DF4A 4ZTFA 1QSLA 2YJFA 4CIFA 1VQ4N 2A41A 3O9SA 5JVHL 3K57A 3RMCA 1BQMA 1HMVA 5AQIA 1IO2A 2WOMA 3AO4A 4E89A 3KK3A 1SL1A 2G8FA 2OPQA 1MDUB 3GBTA 4AM7A 4CF1A 3AVCA 2HHUA 2X78A 3C6HA 3VA3A 3QEWA 3UIQA 1C0FA 4LC9B 3WT0A 3ZSRA 4GMJB 2I5JA 1HYZA 4J2DA 1NGJA 4EP5A 1N6QA 1TK8A 3O4QA 3NMUA 1I94K 3BDPA 2VQFK 5FRMA 5AQGA 3SYZA 2YHBA 3D45A 4KH4A 3D2FB 4DV0K 3CFPA 4BR2A 4BROA 1KQSM 1T6CA 4FVMA 4DQRA 3HT3A 1RDDA 1VAZA 3LDQA 4ICLA 1A5WA 2HVIA 2E8AA 1TL1A 2VYPA 4KREA 1O13A 2VG5A 1GLJO 3TWHA 3B6PA 3RWUA 1SL0A 5HROA 2ZE2A 3BGRA 4X64K 3DJCA 3VEZA 3RRHA 4KHNA 4CGIA 3ZX2A 1VQLN 2VGNA 4I9LA 4ELUA 1RTJA 2P9UB 4C1NI 5C25A 4O8UA 3OYMA 4WFNL 2QWNA 4H4MA 2IVOA 3KVGA 4WQ5C 3EE9A 3VGLA 3O5BA 4O4GA 3AGKA 5DM7L 4B9NA 1TKTA 1SUQA 4C8LA 1NGAA 4AHRA 1LW0A 4YDUC 3IAYA 4ELVA 5AR0A 3LL3A 3TTFA 4DR7K 4BQZA 3MN7A 1CZAN 4FZXC 3A2FA 1VSDA 2WUSA 1K73O 4CHNA 4OKKA 2CH5A 4DR5K 4E7LA 4B9UA 4CK2A 3LDSA 3SUNA 5IWAK 4LH5A 4CBXA 1XUPO 1TAUA 3IFRA 1IJJA 4BC2A 1HPZA 3WXJA 4FWMA 3FR0A 2QXLA 1C0MA 4I6MB 4A5BA 4RW7A 1RTIA 2P5OA 1IG9A 3ZT3A 1GOAA 3PX0A 3CMAN 4JI5K 2W42A 1ZYQA 3LM9A 5SWMA 1BI4A 3SK3A 1KCFA 4DUYK 1U47A 2YNIA 4PKHA 4YOTA 3L8BA 2RKIA 4KH6A 1T7PA 4DV4K 1YIJN 3O3HA 4BC3A 5BR8K 1N36K 2PYLA 3J7AP 3L2UA 4DU1A 5DK5A 5JMVA 2V51B 3DLLL 3L2WA 3BZKA 5J2QA 1C0GA 3CJ9A 1JLEA 3O9QA 4NCAA 3N4QA 3WNGA 4JKGB 3SJHA 4IJNA 3C7NB 1VQ7N 4M3XA 1X9SA 1B9FA 2P9KA 3T19A 3AY9A 5BR9A 3VQEA 4IEEA 3KJVA 1G15A 4IXCA 4E1JA 1KAYA 5HOOA 4FXDA 1T05A 1NGFA 1WSIA 3D6RA 5M1OA 3DXMB 4NCGA 1VRTA 3OYFA 3H46O 4B3MK 1Z26A 2KTQA 4PL8A 4GVEA 4KHPK 4KBOA 3TANA 3U4LA 4NLBA 3GDQA 4CW7B 2E20A 4MLHA 1U4BA 1RT4A 2QM1A 4NO7A 2F96A 3CG7A 3MMVA 4N41A 4DTPA 1EWQA 4YOYA 4MLEA 3E01A 3AVLA 1KVBA 3D2FA 5HRNA 4BDZA 5F0XA 4YOWA 3J80O 2D0BA 4J2EA 3U8XA 4KAZA 4CEZA 1BISA 3KLEA 5FDLA 2P9SA 2JWKA 3KLGA 5AZJB 1N34K 3ZCMA 1UOCA 3AVKA 2OANA 4ID5A 1VK0A 1JCGA 5KPRA 1XI1A 3AO2A 1HKGA 4KTWA 4AF1A 4DKWA 4MO5A 4PHTX 3OTOK 5BRFA 2ZD1A 1RTHA 4DTOA 4EHTA 1BDGA 1NJZA 2CGJA 4E0DA 4X66K 3OYHA 2B6AA 4JKCA 1S22A 3THYB 3ENOA 3CIPA 1NBWA 4B1ZA 3S3MA 1A5XA 2OPSA 4CJWA 2EWSA 5EXWA 3VN5A 1J9AA 4JI4K 5AQNA 1BQNA 3AA4A 3THWB 3DXKB 1RT2A 5A2QO 1KFDA 3J81O 4CZKA 2HHHK 3VESA 2FBVA 3F9KA 2CGLA 4E7JA 1Y97A 5BN9A 2B5JA 4DR3K 4CHZA 5JLHA 1VQ5N 4IFYA 3C6AA 3KKSA 1KD1O 1QZ6A 4OLBA 1HRHA 4FWLA 2XY6A 4ISEA 4IDHA 3H6EA 4HTLA 2NRWA 2E1YA 1QHTA 3F5TA 1WBDA 4DTUA 3R9PA 4JI3K 4DMNA 3T69A 4FK4A 1MU2A 1JCEA 4ID1A 3HPHA 4ZHRA 4FJJA 3PSFA 1HPMA 1LWCA 3PO4A 2P5GA 1XQSC 3HO1A 4E1NA 3HP9A 4OVLA 1IBLK 1WN7A 4FWQA 1RDAA 5KRTA 1ASWA 1RBTA 4RW4A 1I39A 4FJ8A 5HRSA 4DG1A 5CR4A 3DWLA 2KZMA 3GG4A 3TTDA 3G25A 2P9IB 4RCHA 3OYGA 2GV9A 4WFBL 1X9WA 3I56N 2G8WA 3MN5A 3FFKB 2E2QA 1M90O 4XH4A 1OKJA 5C2FA 3DXMA 1VQMN 3SI6A 1YVUA 2DFFA 3KKRA 2HNDA 4A5AA 1D4XA 4NLCA 3C65A 3RR7A 1Z05A 1BA0A 4MFBA 4Y1CA 4ILJA 3E9LA 4C8NA 2E6LA 3CJ7A 3IMXA 4OPJA 2NRXA 3K5NA 3NF6A 3S3OA 4BGAA 1R0AA 4K8XA 4EAHD 4R79A 4RW8A 2RN2A 4AHVA 3RSEA 4KB0A 3RTVA 1Q18A 1ZBUA 2QWQA 3B6OA 3DRRA 3VQ8A 3AAQA 3DLKA 4B9QA 1BO5O 5LMUK 1BIUA 4CF0A 5CHIA 2GELA 2O8FB 1XMOK 3AVFA 1T44A 4BG9A 4PQUA 2YKMA 3A5OC 5FROA 2KKZA 1K8KB 4HUFA 4IZ9A 1W2BM 4DQIA 4K8ZA 2ZJPL 3L4IA 3KD5E 1T3VA 3SJJA 1VSMA 3SQ2A 3BZCA 1S9EA 1L3VA 4DTJA 5I42A 1RDCA 5FLXO 3DI6A 1QVFM 3D2EB 2A6AA 1XNRK 1N5YA 3TAPA 3VEOA 3AARA 4CGFA 5DM6L 1IH7A 2DTUA 3LP1A 3SLCA 3OYNA 4CGGA 4CF2A 4NXNK 2UUCK 1OH6A 3E66A 4FJ7A 3CCVN 1L3TA 3DXKA 5C12A 1P90A 4JI7K 2BE2A 3CQ8A 4TSXA 4DFJA 1W7AA 2UUAK 1RFQA 3H3OB 4JKHA 4B9LA 2X6NA 2GWJA 5GAGP 4JKEA 4W5TA 2OYQA 2NRHA 1HQUA 3LAKA 4DFMA 5HRRA 4A61A 4BRQA 2IDOA 3SMPA 3FZKA 4DTSA 3HVRA 2O8CA 4CZMA 2HNZA 4FJIA 3T1AA 4HHTA 4CCHA 3OA9A 1HUXA 3QEIA 3LPUA 2Y1IA 4CIGA 3SUOA 4AHCA 2G8HA 2OZSA 3CQYA 4DFKA 2A5XA 1WAFA 3CCEN 4BG8A 2Q36A 3IG1A 5KGXA 4N5SA 3UB5A 2HMIA 3SPYA 1VSIA 3QETA 3KLFA 1RDUA 3B8AX 3OYIA 4IO8A 4WQ5A 2A42A 4OJRA 2QWLA 4CEAA 2PZSA 3AV9A 1T03A 2FLOA 1R59O 3M8PA 3O4NA 4DTXA 4YDUA 1YAGA 1J6ZA 4HTUA 3J7YP 2JGUA 4CZFA 4Z4GA 1LAWA 3DLEA 4BRFA 2E2PA 3QFUA 4CFDA 4WE1A 5I9EB 2G8VA 2QK9A 2QI2A 2O4IA 2F9TA 1CZ9A 3HM8A 4KV8A 3CM5A 3I0SA 3VQQA 4Z4EA 3JSMA 3CJAA 1Q9YA 3EKUA 3AVGA 3ZSQA 2FSJA 3DLRA 4GNIA 3JS6A 1DTQA 3VERA 3ULEB 3M1FA 4DTMA 2VGMA 5AQOA 3QERA 3O1WA 2XY8A 2ETJA 4AHSA 1TGOA 4M3UA 5BPNA 1WSFA 4F3OA 4H0XB 1OH5A 3DOLA 4FLVA 1TUUA 4ZTJA 5I3UA 4CJVA 4NCBA 4U7BA 4KB1A 1Z6RA 4O44A 4OPKA 4KHYA 3OVNA 3TARA 4QOZB 2O8FA 2UU9K 4U67L 1MWKA 1G99A 3HOTA 2ZWHA 3TABA 1YTUA 4BRKA 4CF8A 5AQXA 1K8KA 3ASMA 2X6SA 1RDBA 3L2QA 1U6ZA 4HWIA 2VWKA 3MECA 1M1KO 4RTFD 5JLFA 1EP4A 1C0TA 2G8UA 3AVJA 3LDNA 1JLBA 4CGJA 1FKOA 3UKRB 3EZ5A 4JS4A 3OYDA 1TL3A 3TTCA 5M1FA 5KQ8A 3O9TA 1NG9A 4BRPA 4B9TA 2BGGA 3SQ0A 2Q0RA 3I8BA 4FOIA 4KTQA 1J54A 4A2BA 3TAMA 1QZ5A 3WEEB 1NJWA 1BWFO 1NNEA 4KPYA 4H4OA 3I8DA 3QO9A 1DLOA 3QNOA 4M3WA 1C6VA 3K59A 1ILYA 4IOCL 4OKJA 2BUPA 3G10A 4E1MA 1DKGD 3TAQA 3NF7A 3OBYA 4CK3A 3NGYA 4CEOA 4H5RA 4A57A 3UKUA 4F4KA 2HHVA 5KPTA 4O8KA 1DT9A 1ZXOA 3NBPA 4B3OA 5F2RA 5KGWA 5JICA 1SKSA 3H1QA 1KFSA 4PUOA 2HBLA 4CEEA 1IKYA 1OVQA 2VWBA 2GUPA 4YY3K 5KPZA 1IV0A 4L3QA 1KC8O 4FK2A 4BR7A 3MX2A 1VQ8N 2HBJA 1TV6A 4CJRA 4CD1A 4B08A 1W9HA 3ENBA 3AVMA 3L6QA 3MWPA 3G4SN 3K58A 1S1UA 2H3GX 2NLXA 4FLWA 4IBNA 3O4WA 1JLFA 1NKBA 1K6YA 2OZMA 3VQPA 1S72N 2D0OA 4CZEA 3SAGA 2GTDA 1JKHA 2RF2A 2O8DB 2IGIA 5H1SQ 4XH1A 3CCJN 1S9GA 1KTQA 4YOUA 3S9HA 4FM1A 3H3NO 4BRCA 1VRUA 2B4JA 2YKNA 4FZZA 4IDKA 2QKKA 3FE1A 5DMRA 3NVMA 4QS7A 1RT7A 4GV9A 1WBBA 1CXQA 2WC9A 1DGKN 3P4IA 2XY7A 2AJQA 5TKWA 1Y64A 2V52B 3SV3A 3KK7A 2FXUA 5FRNA 4QCLA 4F2RA 3ENHA 4CESA 4DSIA 2GWKA 4FJNA 3PIPL 4E7HA 4I2QA 2PBDA 3TSPA 2GEMA 4CJTA 1BCMA 1GLFO 4FLUA 2DFEA 2OPRA 3VEWA 4GKJK 1S1WA 1VSJA 3DLBA 2VG7A 4O0JA 2VCPA 4DFPA 2V7ZA 4DSLA 1H1VA 3R8EA 3EE8A 2Z1HA 3BP8A 1BA1A 2R7YA 1NGGA 2O8BB 3HZ6A 2IC3A 3O08A 3OYKA 4BDPA 2F4VK 1HX1A 3N4PA 1BCOA 3L3UA 1V4SA 4CJPA 2A1SA 3K0SA 3M8QA 3VOVA 3LP2A 4RW6A 4LD0A 4CJ4A 3E9PA 1XHZA 2OCEA 2HHXA 4N56A 1QTMA 3VQ7A 2YHAA 1VQPN 1K9MO 5C0YA 3CMEN 4O5FA 1C1AA 2FF6A 4I7FA 2DPNA 4BY9C 3VQCA 4HCBA 4JKDA 4E7KA 1Q7YO 1BG3A 3SBGA 4FJKA 2UXBK 3CC2N 3KLHA 5HBMA 3KTQA 4DR1K 3O3FA 4DWIA 3PX6A 1Z25A 3PIOL 3ZX0A 4Z4IA 4EZ6A 1GLBG 4BRLA 3NGZA 1XHXA 4DQSA 3VQ6A 3I0RA 2YNHA 5D3GA 2HHTA 4KKOA 4Y1DA 2E1ZA 4ILHA 1KAZA 1QSYA 4PKIA 3HJFA 3RMAA 1CZBA 1ZBSA 4IOAL 1XC3A 4H0TB 5E41A 3MCPA 1NK7A 1ZBFA 3ZSYA 3CI5A 1ASVA 1ASUA 5FPEA 2YV0X 4FL9A 3WUHA 1NOZA 5GIOA 4UY8O 5KRSA 1IKWA 1C1CA 3PSIA 5CZ2A 3VENA 3KWGA 1KSPA 1YXQA 4CJLA 5C42A 4FWNA 4CHYA 2A40A 2HMPA 4ELTA 2QWPA 5EX5A 2QEXN 4F3TA 4JI8K 3ZT4A 3VMFB 4FW2A 2O8DA 4CEQA 2D0PA 1NK5A 2P9UA 3HSCA 4FW1A 4KH5A 2E5LK 3M5RA 4AQYK 1HJRA 3VEXA 4DQPA 1Q9XA 4CJFA 2O8EB 1RT3A 1Q81O 3KD1E 4XEIA 3Q7CA 3CQXA 4PL7A 3WNHA 5GINA 1TVRA 2HOEA 1JXBA 3V1RA 3V1QA 1D9FA 1JLGA 4FWPA 4GKKK 3SNNA 3ZSOA 3ZEUB 4FWSA 4EP4A 4BC4A 2W40A 3J8AA 4BREA 4IOXA 4C1NK 2YNGA 2JLEA 4CHPA 2V7YA 4WF9L 3U3YA 5C24A 1VQON 3DLHA 2NRVA 2HVHA 3QEPA 5AQJA 3CCMN 4F8RA 4LFCK 3M8RA 1RTDA 1OH8A 2QXFA 3GL1A 1L3UA 3F9MA 3HVTA 3KK2A 1KAXA 4FPAA 3WXKA 1VQKN 2W41A 3FGUA 1D9DA 1K8AO 1NGEA 2KLAA 4H5VA 4I6MA 4BWJA 2ASPA 1HJOA 3SQ1A 3ZX3A 3LZIA 4C8OA 4ISFA 3MWTA 3R6MA 3NH1A 3ATUA 2I7PA 5AFUH 1N8RO 3PY8A 3TAEA 3BY5A 4OO1J 1YJ9N 4IJAA 4B9SA 1Q8IA 3CC7N 1A5VA 4DU3A 4K42A 2IOCA 3MN9A 1XC9A 3OYJA 1JXEA 3S41A 3OYCA 2CH6A 4H0PA 3J7ZO 1HNVA 4JKGA 2ZQBA 5EVZA 4I2PA 4GV6A 3CCRN 1S3XA 3C7NA 3CC4N 4FLZA 1XWLA 1RT6A 1X1PA 2ASMA 2A3ZA 3K2PA 1YITN 3CCLN 1RBUA 3MK6A 4DR6K 4LFBK 2FSKA 2ATQA 3I33A 3NCIA 3SPZA 2AA4A 1NGBA 1S6QA 3MXMA 3OS2A 3UE5A 3BEXA 3CERA 1HYSA 3GOIA 2PYJA 1T6DA 3A5MC 1N32K 1NK9A 1UAXA 1S1TA 3EO3A 4Y0WA 3K5MA 3NH2A 3QBXA 3SUQA 5SZTA 1HNXK 2FBYA 1TKXA 3DYAA 1REVA 1RBSA 4JK7A 1BIZA 5AQFA 3CCSN 1W0HA 4J2BA 2YHWA 2EX3A 4CF9A 2YI1A 4OPAA 3TSQA 2VWJA 3LWLA 4N76A 2BDPA 5M1QA 1EXQA 4MQ3A 1SKWA 2BTFA 3BF3A 4AM6A 1FXXA 5GIPA 4CJ3A 4Z4FA 4K43A 4KHUA 1SL2A 4E7IA 4XH5A 3ZETB 4JD2B 4CI6A 3FZFA 3FZMA 3VQAA 4FJMA 3AVHA 3OJSA 1NJIO 3IRXA 4K0KK 5AZJA 4B8CA 4FOEA 4CVNE 4JN4A 4OLAA 3KZBA 3LAMA 4DSEA 4DUZK 4Z4HA 3V9XA 4B3TK 3V81A 3VTHA 1EO1A 4OKEA 3AAPA 1DEJA 3I55N 5CY4A 3MXJA 2D1KA 1JLQA 4EFHA 3IKMA 4LF4K 4BVOA 1YTAA 5J2PA 1TK0A 2O8EA 3PO5A 3HP6A 1HQEA 4BE0A 3ZYYX 2XY5A 1J5EK 3HTVA 2P51A 3THYA 1NLVA 1X3NA 2WONA 1WSHA 4IG0A 3L3VA 3NF8A 1HYVA 4DCHA 1NOYA 3AVNA 3D0PA 3O8MA 3CF5L 2OTJN 2JWLA 3THWA 4W5RA 3SAHA 5AFUA 1GLCG 4M7YA 3ATVA 3VETA 4LF7K 2ZGYA 3RRGA 3C94A 4DTRA 2XHBA 4JRQA 3QLHA 2HHQA 1HLUA 1NJXA 4BRMA 5T7BA 4KTZA 5JVGL 3IDHA 1T8EA 3AA2A 4JI6K 2J4RA 3K9JA 2WFBA 1EQYA 1D5AA 2FBTA 1D8YA 2HF3A 5MLCQ 1EX4A 3P31A 4FJ5A 2YHXA 3V9ZA 4Q0BA 5KI6A 4DQQA 3KIOA 1LWEA 3LP3A 4FJ9A 4CZIA 4YFUA 3AA5X 2YHYA 3DMJA 3VEYA 1QQOA 3R1XA 4H0VB 3ZLJA 1TUYA 2VQEK 1NK6A 4M42A 3ZSXA 4BRIA 2EHGA 3KK1A 5M1PA 1S6PA 3OS0A 3OHRA 4JV5K 3C6TA 4CJQA 3QINA 4PA1A 3CPEA 2OPPA 3F73A 4BE1A 1QS4A 4CERA 3CYMA 1KRPA 3L2RA 2P9IA 4B3SK 3M3ZA 3P83D 1VSEA 3P1GA 4BGBA 1WB9A 1XMQK 5AQLA 2UYTA 4CBUA 4E3SA 4FK0A 1IG8A 4DV7K 3MN6A 4JI0K 5IT9O 4CJSA 1YHQN 4LF8K 4IKFA 3EEQA 3VQ4A 3NGIA 1J53A 5AQYA 2E2OA 3V9UA 3LZJA 5AQPA 3TU5A 3VPZA 1EWRA 4FLXA 3ULDA 5AQHA 5C15A 3L0QA 3CCUN 3NFAA 3ZETA 4GY2B 1NU0A 4FWKA 5FPMA 3IS9A 5M1KA 1VQ6N 3OBWA 4B1VA 1TYQB 1LOTB 3JYTA 1FJGK 4IFEA 3AA3A 3SBTA 4HVJA 5TKYA 5HRPA 3AVAA 4M3YA 1ATNA 5AJ3K 2E88A 3NHGA 3FLCO 4NXMK 3V1OA 2KZZA 3MAQA 4X65K 3L2VA 4XIUA 1W97L 1QE1A 3AVBA 1QQMA 2HB5A 3M6GA 2QA4N 3OYBA 3LALA 3D2EA 3TI0A 3U9ZA 5E84A 2HHSA 4IG3A 3DRPA 1OH7A 4BR0A 2OA8A 3ZSZA 4O0IA 3P5JA 4M63C 4GW6A 3THVA 4GV3A 1RBVA 4FJLA 3G71N 3LDPA 4KI4A 3R3LA 4B9MA 1U2VB 3A5NC 3AO1A 1SZ2A 1EKEA 3PUFA 2F8TA 3DOKA 1RBRA 3HI0A 4CFCA 2GX9A 2FSNA 3O9UA 1ZBHA 5ADXA 4YORA 4G1QA 1VSFA 3EKSA 2P9KB 4M3ZA 4DQ8A 4CJEA 1U04A 3U3GA 4DLEA 3K5LA 3WXMB 3MEDA 4DTNA 4H0OA 1J5OA 1HKBA 1WLJA 3NE6A 3PV8A 4Q5VA 3O6WA 1HR0K 3RMDA 3QNNA 5GAHP 4OGCA 4FLYA 2QWOA 3THXB 1NJYA 2YCHA 5BPLA 2W6LA 5KTQA 5HL7L 4A59A 3HXMA 2ZF5O 4DS4A 5M1NA 1Q86O 4YOXA 5FPDA 4C8KA 4B1XB 3OW2M 3QICA 3Q7BA 4EHUA 4JI2K 1NMNA 4CECA 4KHQA 5BRDA 3VEVA 3HK2A 3ZT1A 3CFOA 1C1BA 3AVIA 3HOSA 2QKBA 4FLTA 3VQBA 1BU6O 3HL8A 2P9SB 4IEIA 5CE3A 2G8KA 4M3RA 1YI2N 1ATRA 2XRIA 3E9OA 4DR4K 3WXIA 1NKCA 3QEVA 4ISGA 2ZJRL 2P9PB 3QMLA 3QFPA 1NK4A 1VSKA 1X3MA 3U9DA 1HNZK 3E1YA 4BRGA 4DB3A 3CM6A 2QWMA 4L8RB 4BVPA 5C10A 3NVKA 1FKPA 2Q0UA 4AILC 3ULEA 4M45A 2PY5A 4N47A 4BDYA 2QTDA 3QBWA 1HNIA 4B8AB 3D7EO 2P9LB 3JXUA 1QHAA 3SQ4A 1LCUA 3AO3A 1QQNA 1ESVA 3W3DA 3OYLA 4LH4A 4KHWA 1GLEG 2UUBK 2P9NB 4MDAA 1TYQA 2AP1A 1WSGA 4WYBA 4M41A 3PLAA 3A5LC 4C23A 4JHDB
chains in the Genus database with same CATH topology
3T1YK 4CVNE 1XNQK 4B3SK 4DUZK 4B3TK 4NXNK 1XMQK 2UUCK 4DV1K 4DR7K 4JYAK 4DV5K 2UXBK 3J80O 4DV7K 1IBLK 4LF4K 4JI7K 4JI0K 5IT9O 4LF8K 4DR5K 4DR1K 2UUAK 1J5EK 1HR0K 5IWAK 4LFAK 1N34K 2UU9K 5LL6Z 1IBMK 2UXCK 3OTOK 4JI2K 4JI5K 3T1HK 4JI1K 4X66K 4DV6K 4DUYK 4DR2K 4LF7K 1FJGK 4LF6K 4YHHK 4DR6K 4DV4K 4LFBK 4DR4K 5AJ3K 5BR8K 1N36K 1I94K 2VQFK 3J7AP 4GKJK 2UXDK 4B3RK 4NXMK 4JI8K 4X65K 4DV0K 4JI4K 2ZM6K 4DV2K 1N32K 2E5LK 4JI6K 1HNZK 5A2QO 4AQYK 3J81O 2HHHK 5LMNK 1HNXK 4DV3K 5LMUK 4LF5K 4DR3K 3J7YP 1XMOK 4X64K 4K0KK 2F4VK 4X62K 4GKKK 3JAMO 1HNWK 2VQEK 4OX9K 1IBKK 4YY3K 4B3MK 4JV5K 2UUBK 1N33K 4KHPK 5FLXO 4LF9K 1XNRK 4V19S 4CW7B 4JI3K 4LFCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y K;  4CVN E;  1XNQ K;  4B3S K;  4DUZ K;  4B3T K;  4NXN K;  1XMQ K;  2UUC K;  4DV1 K;  4DR7 K;  4JYA K;  4DV5 K;  2UXB K;  3J80 O;  4DV7 K;  1IBL K;  4LF4 K;  4JI7 K;  4JI0 K;  5IT9 O;  4LF8 K;  4DR5 K;  4DR1 K;  2UUA K;  1J5E K;  1HR0 K;  5IWA K;  4LFA K;  1N34 K;  2UU9 K;  5LL6 Z;  1IBM K;  2UXC K;  3OTO K;  4JI2 K;  4JI5 K;  3T1H K;  4JI1 K;  4X66 K;  4DV6 K;  4DUY K;  4DR2 K;  4LF7 K;  1FJG K;  4LF6 K;  4YHH K;  4DR6 K;  4DV4 K;  4LFB K;  4DR4 K;  5AJ3 K;  5BR8 K;  1N36 K;  1I94 K;  2VQF K;  3J7A P;  4GKJ K;  2UXD K;  4B3R K;  4NXM K;  4JI8 K;  4X65 K;  4DV0 K;  4JI4 K;  2ZM6 K;  4DV2 K;  1N32 K;  2E5L K;  4JI6 K;  1HNZ K;  5A2Q O;  4AQY K;  3J81 O;  2HHH K;  5LMN K;  1HNX K;  4DV3 K;  5LMU K;  4LF5 K;  4DR3 K;  3J7Y P;  1XMO K;  4X64 K;  4K0K K;  2F4V K;  4X62 K;  4GKK K;  3JAM O;  1HNW K;  2VQE K;  4OX9 K;  1IBK K;  4YY3 K;  4B3M K;  4JV5 K;  2UUB K;  1N33 K;  4KHP K;  5FLX O;  4LF9 K;  1XNR K;  4V19 S;  4CW7 B;  4JI3 K;  4LFC K; 
#chains in the Genus database with same CATH topology
 3T1Y K;  5AQZ A;  2D0C A;  2F8S A;  2OTL N;  4F2S A;  3C6U A;  4HCC A;  4K41 A;  1L3S A;  3ZT0 A;  4BWM A;  4JYA K;  2WTU A;  4ILG B;  4EIA A;  4B1W B;  1NK8 A;  3KHY A;  3WNF A;  2O4G A;  4A62 A;  3SAF A;  3CJ1 A;  3SZ2 A;  3OYA A;  3LP0 A;  4H0Y B;  4FZY A;  1NGD A;  3SUP A;  2GBZ A;  1ATS A;  3MEE A;  3UKR A;  5BRH A;  4FSV A;  2NRZ A;  1ITG A;  4KO0 A;  1IBM K;  2FBX A;  1WNS A;  4FWR A;  4E19 A;  4DLG A;  1U2V A;  3WEE A;  4BR9 A;  1TAQ A;  4DSJ A;  3ISN C;  4IFV A;  4W5N A;  2ITM A;  1LWF A;  1X9J A;  4JI1 K;  2ITG A;  4FVU A;  3LDL A;  3VF4 A;  4BR5 A;  4WQ4 C;  1P8Z A;  5J2M A;  4LF6 K;  1GLD G;  4YHH K;  4JAX A;  2PFU A;  4HUG A;  4LY7 A;  4B3R K;  4FJH A;  4JS5 A;  2ZM6 K;  2Z1J A;  3NH0 A;  1GLL O;  1B9D A;  3VTI A;  4AHT A;  3T7Z A;  3V9S A;  4DV3 K;  2HF4 A;  2E4L A;  5AQT A;  3THX A;  1KLM A;  1E3M A;  2GUI A;  1ZBL A;  4KFB A;  3HBT A;  5AZI B;  3HST B;  4BAC A;  4Z94 A;  4CE9 A;  3TSU A;  4AHU A;  4W5Q A;  1WSE A;  3LWM A;  1LW2 A;  3LPT A;  1B92 A;  2WBN A;  3CJC A;  5FPN A;  2XO7 A;  2HBK A;  1IBK K;  3RSE B;  3KWI A;  3WQT A;  3OJU A;  1U49 A;  5C2D A;  3O3G A;  1NM1 A;  1KVC A;  3ZSV A;  1XNQ K;  1C0U A;  5AQQ A;  4M7X A;  3TAG A;  1CLQ A;  1F21 A;  2P9P A;  2G8I A;  4DV1 K;  4CEF A;  3CXC M;  4DV5 K;  2LSN A;  3SCX A;  4CBW A;  4FO0 A;  3RVC A;  3MEG A;  3WNE A;  2RHK A;  1S1V A;  2YX6 A;  5AQK A;  3DM2 A;  2W6K A;  3V4I A;  3O80 A;  3EN9 A;  3V6D A;  5JS2 A;  1NGC A;  1SAZ A;  2KFZ A;  2P9L A;  4PKG A;  3EYZ A;  1BHL A;  4CGH A;  4CZH A;  4AH9 A;  1E4F T;  4HUE A;  5LY3 A;  3CD6 N;  4JLH A;  2BAN A;  5AQS A;  3VF6 A;  4W5O A;  1VQN N;  1JJ2 M;  2P9N A;  4LSL A;  3G0Z A;  1SKR A;  1I3A A;  5CZ1 A;  2NUB A;  4CEB A;  3WQU A;  4JHD A;  5AQW A;  4DF8 A;  1E4G T;  4DR2 K;  2O8B A;  3BUZ B;  4B9V A;  3OYE A;  2X74 A;  1EET A;  2KFN A;  1ZC6 A;  2DY4 A;  1BL3 A;  4BE2 A;  2ZGZ A;  1UA0 A;  1JL1 A;  1MA9 B;  5EY4 A;  3QDK A;  3G6E N;  3HYF A;  3OY9 A;  3EY1 A;  4DV2 K;  2NRR A;  2O8C B;  4NYN A;  1RIL A;  2BH1 A;  3HPO A;  4JRP A;  4B1Y B;  2QWR A;  1VHX A;  4FCY A;  5LMN K;  3P39 A;  1RGI A;  3QEX A;  2YNF A;  2Q1N A;  1TKZ A;  3LM2 A;  3MX5 A;  1WAJ A;  4CGD A;  4H5N A;  4MDB A;  4DSF A;  4H8K A;  4CHO A;  4NYF A;  1SV5 A;  3A8Y A;  3FFI A;  1RT1 A;  3CCQ N;  1HNW K;  1KXP A;  4KHS A;  4BC5 A;  4IO9 L;  2Z1I A;  4OPH A;  3HM9 A;  4FYD A;  4RW9 A;  4O55 A;  4J8F A;  1U45 A;  3VQ5 A;  4KI6 A;  1FK9 A;  3LDO A;  2Q3S A;  4JK8 A;  3CJB A;  1BGX T;  1O1W A;  2FC0 A;  4MO4 A;  4FPB A;  1SS6 A;  5AQV A;  4WFA L;  5AQU A;  2NRT A;  5KQD A;  4QAG A;  4UQG A;  3C0B A;  5F1X A;  3V9W A;  1WSJ A;  5BRE A;  2YJE A;  3OS1 A;  3QB0 A;  1S1X A;  2Q2R A;  2HW3 A;  5GAE P;  4Z4C A;  4RWT A;  2I7N A;  4BRA A;  4JKA A;  2KHO A;  4K25 A;  4R5P A;  5AZI A;  1QVG M;  2ASO A;  1LV5 A;  3QES A;  1NWK A;  4RG8 A;  4DS5 A;  3A0I X;  3ID8 A;  3T3F A;  4CD3 A;  2Q97 A;  3VQ9 A;  1V4T A;  3BF1 A;  4FWO A;  3VA0 A;  2D0A A;  5HP1 A;  1UWB A;  3DLG A;  1Q82 O;  3T1H K;  5AQR A;  4LSN A;  4DV6 K;  3CET A;  1U48 A;  1BUP A;  4CZG A;  4F9O A;  3HRG A;  3ZT2 A;  4C8M A;  5E26 A;  5J2N A;  2Y1J A;  2HNY A;  3O1B A;  4IWV A;  3NDK A;  2E6M A;  3ZEU A;  2KQ2 A;  1GOB A;  3VGK A;  3C95 A;  2QW9 A;  3FZH A;  4DU4 A;  3GE1 A;  3IUC A;  3DAW A;  3EL2 A;  3P38 A;  1JCF A;  4H5W A;  1NMD A;  2IAJ A;  2IIR A;  3ALY A;  3FZL A;  1IKV A;  3AO5 A;  2D4W A;  3TR8 A;  5J1E A;  4LF5 K;  4CK1 A;  4JK9 A;  4CFA A;  4YOV A;  1SQK A;  3NF9 A;  1YT3 A;  5EOY A;  4JKB A;  4X62 K;  1YJN N;  3CHW A;  2RPI A;  4CJK A;  3CFR A;  2HBM A;  3ZSW A;  1NK0 A;  4OX9 K;  4H03 B;  1YUW A;  3RMB A;  4EZ9 A;  3H45 C;  4CJ5 A;  4PWD A;  3PX4 A;  1N33 K;  4H5T A;  2IVN A;  3VQD A;  3AGR A;  5BPM A;  1VSL A;  2HST A;  4KRF A;  3TAF A;  5ADX H;  4CJ7 A;  2P1J A;  1HKC A;  3EZW A;  5AQM A;  3UKU B;  3ID6 A;  4CHQ A;  3U6F A;  4NB4 A;  5B8H A;  2Z1G A;  3M8S A;  1VSH A;  1RNH A;  1ZBI A;  3W0L A;  4M3T A;  4QS8 A;  1KLN A;  2PAV A;  1WUA A;  2VG6 A;  1YJW N;  2NZT A;  4BRD A;  3L4Q A;  2Q31 A;  3H08 A;  3QIP A;  2IS3 A;  3SMS A;  4BRN A;  1UA1 A;  4LFA K;  3DRS A;  3KLI A;  2DFH A;  4CFB A;  3TPQ A;  1GLA G;  3F2K A;  3O9R A;  5LL6 Z;  3NAE A;  5JS1 A;  5LJW A;  4BR4 A;  3LAN A;  4CIE A;  2UXC K;  4CZL A;  1L5U A;  1BOT O;  1YF5 L;  2RE2 A;  4OGE A;  5EU7 A;  3CPW M;  2D5R A;  3MXI A;  2IVP A;  2E2N A;  2KW4 A;  1JLA A;  4QS9 A;  1GOC A;  2FF3 B;  4FJG A;  4G9Z A;  2UXD K;  4PY5 A;  1YVN A;  1CXU A;  5CYM A;  4CED A;  4CZJ A;  1QSS A;  4JD2 A;  5GAD P;  4GVM A;  4B1U B;  4CJU A;  5LJV A;  4YNQ A;  3K9K A;  4BQL A;  4A2A A;  4FJX A;  4DSK A;  1OVY A;  1QQC A;  4BRH A;  3QIO A;  3SV4 A;  1X9M A;  3MDQ A;  2ZJQ L;  4JKF A;  5HLF A;  1JLC A;  2A1R A;  1KVA A;  1RDW X;  1S5J A;  3K5O A;  1NGH A;  4I9Q A;  1NGI A;  1LAV A;  3JAM O;  3MCA B;  4O5B A;  1TKD A;  3ITH A;  4J2A A;  1RT5 A;  1MWM A;  2CGK A;  3VGM A;  3VF2 A;  4JNE A;  4Z0U A;  2HHW A;  4DHY A;  2NNW A;  2F9W A;  4LF9 K;  4V19 S;  3HPG A;  1IKX A;  1BI4 B;  1NKE A;  3RR8 A;  3H1V X;  5K14 A;  3WXL A;  4FM0 A;  4WCE L;  3S3N A;  1FW6 A;  1WOQ A;  1VQ9 N;  2F7T A;  1RCH A;  5BN8 A;  4FM2 A;  1JL2 A;  4JEP A;  1DTT A;  4WQ4 A;  1TK5 A;  5CYQ A;  5ELZ A;  4DF4 A;  4ZTF A;  1QSL A;  2YJF A;  4CIF A;  1VQ4 N;  2A41 A;  3O9S A;  5JVH L;  3K57 A;  3RMC A;  1BQM A;  1HMV A;  5AQI A;  1IO2 A;  2WOM A;  3AO4 A;  4E89 A;  3KK3 A;  1SL1 A;  2G8F A;  2OPQ A;  1MDU B;  3GBT A;  4AM7 A;  4CF1 A;  3AVC A;  2HHU A;  2X78 A;  3C6H A;  3VA3 A;  3QEW A;  3UIQ A;  1C0F A;  4LC9 B;  3WT0 A;  3ZSR A;  4GMJ B;  2I5J A;  1HYZ A;  4J2D A;  1NGJ A;  4EP5 A;  1N6Q A;  1TK8 A;  3O4Q A;  3NMU A;  1I94 K;  3BDP A;  2VQF K;  5FRM A;  5AQG A;  3SYZ A;  2YHB A;  3D45 A;  4KH4 A;  3D2F B;  4DV0 K;  3CFP A;  4BR2 A;  4BRO A;  1KQS M;  1T6C A;  4FVM A;  4DQR A;  3HT3 A;  1RDD A;  1VAZ A;  3LDQ A;  4ICL A;  1A5W A;  2HVI A;  2E8A A;  1TL1 A;  2VYP A;  4KRE A;  1O13 A;  2VG5 A;  1GLJ O;  3TWH A;  3B6P A;  3RWU A;  1SL0 A;  5HRO A;  2ZE2 A;  3BGR A;  4X64 K;  3DJC A;  3VEZ A;  3RRH A;  4KHN A;  4CGI A;  3ZX2 A;  1VQL N;  2VGN A;  4I9L A;  4ELU A;  1RTJ A;  2P9U B;  4C1N I;  5C25 A;  4O8U A;  3OYM A;  4WFN L;  2QWN A;  4H4M A;  2IVO A;  3KVG A;  4WQ5 C;  3EE9 A;  3VGL A;  3O5B A;  4O4G A;  3AGK A;  5DM7 L;  4B9N A;  1TKT A;  1SUQ A;  4C8L A;  1NGA A;  4AHR A;  1LW0 A;  4YDU C;  3IAY A;  4ELV A;  5AR0 A;  3LL3 A;  3TTF A;  4DR7 K;  4BQZ A;  3MN7 A;  1CZA N;  4FZX C;  3A2F A;  1VSD A;  2WUS A;  1K73 O;  4CHN A;  4OKK A;  2CH5 A;  4DR5 K;  4E7L A;  4B9U A;  4CK2 A;  3LDS A;  3SUN A;  5IWA K;  4LH5 A;  4CBX A;  1XUP O;  1TAU A;  3IFR A;  1IJJ A;  4BC2 A;  1HPZ A;  3WXJ A;  4FWM A;  3FR0 A;  2QXL A;  1C0M A;  4I6M B;  4A5B A;  4RW7 A;  1RTI A;  2P5O A;  1IG9 A;  3ZT3 A;  1GOA A;  3PX0 A;  3CMA N;  4JI5 K;  2W42 A;  1ZYQ A;  3LM9 A;  5SWM A;  1BI4 A;  3SK3 A;  1KCF A;  4DUY K;  1U47 A;  2YNI A;  4PKH A;  4YOT A;  3L8B A;  2RKI A;  4KH6 A;  1T7P A;  4DV4 K;  1YIJ N;  3O3H A;  4BC3 A;  5BR8 K;  1N36 K;  2PYL A;  3J7A P;  3L2U A;  4DU1 A;  5DK5 A;  5JMV A;  2V51 B;  3DLL L;  3L2W A;  3BZK A;  5J2Q A;  1C0G A;  3CJ9 A;  1JLE A;  3O9Q A;  4NCA A;  3N4Q A;  3WNG A;  4JKG B;  3SJH A;  4IJN A;  3C7N B;  1VQ7 N;  4M3X A;  1X9S A;  1B9F A;  2P9K A;  3T19 A;  3AY9 A;  5BR9 A;  3VQE A;  4IEE A;  3KJV A;  1G15 A;  4IXC A;  4E1J A;  1KAY A;  5HOO A;  4FXD A;  1T05 A;  1NGF A;  1WSI A;  3D6R A;  5M1O A;  3DXM B;  4NCG A;  1VRT A;  3OYF A;  3H46 O;  4B3M K;  1Z26 A;  2KTQ A;  4PL8 A;  4GVE A;  4KHP K;  4KBO A;  3TAN A;  3U4L A;  4NLB A;  3GDQ A;  4CW7 B;  2E20 A;  4MLH A;  1U4B A;  1RT4 A;  2QM1 A;  4NO7 A;  2F96 A;  3CG7 A;  3MMV A;  4N41 A;  4DTP A;  1EWQ A;  4YOY A;  4MLE A;  3E01 A;  3AVL A;  1KVB A;  3D2F A;  5HRN A;  4BDZ A;  5F0X A;  4YOW A;  3J80 O;  2D0B A;  4J2E A;  3U8X A;  4KAZ A;  4CEZ A;  1BIS A;  3KLE A;  5FDL A;  2P9S A;  2JWK A;  3KLG A;  5AZJ B;  1N34 K;  3ZCM A;  1UOC A;  3AVK A;  2OAN A;  4ID5 A;  1VK0 A;  1JCG A;  5KPR A;  1XI1 A;  3AO2 A;  1HKG A;  4KTW A;  4AF1 A;  4DKW A;  4MO5 A;  4PHT X;  3OTO K;  5BRF A;  2ZD1 A;  1RTH A;  4DTO A;  4EHT A;  1BDG A;  1NJZ A;  2CGJ A;  4E0D A;  4X66 K;  3OYH A;  2B6A A;  4JKC A;  1S22 A;  3THY B;  3ENO A;  3CIP A;  1NBW A;  4B1Z A;  3S3M A;  1A5X A;  2OPS A;  4CJW A;  2EWS A;  5EXW A;  3VN5 A;  1J9A A;  4JI4 K;  5AQN A;  1BQN A;  3AA4 A;  3THW B;  3DXK B;  1RT2 A;  5A2Q O;  1KFD A;  3J81 O;  4CZK A;  2HHH K;  3VES A;  2FBV A;  3F9K A;  2CGL A;  4E7J A;  1Y97 A;  5BN9 A;  2B5J A;  4DR3 K;  4CHZ A;  5JLH A;  1VQ5 N;  4IFY A;  3C6A A;  3KKS A;  1KD1 O;  1QZ6 A;  4OLB A;  1HRH A;  4FWL A;  2XY6 A;  4ISE A;  4IDH A;  3H6E A;  4HTL A;  2NRW A;  2E1Y A;  1QHT A;  3F5T A;  1WBD A;  4DTU A;  3R9P A;  4JI3 K;  4DMN A;  3T69 A;  4FK4 A;  1MU2 A;  1JCE A;  4ID1 A;  3HPH A;  4ZHR A;  4FJJ A;  3PSF A;  1HPM A;  1LWC A;  3PO4 A;  2P5G A;  1XQS C;  3HO1 A;  4E1N A;  3HP9 A;  4OVL A;  1IBL K;  1WN7 A;  4FWQ A;  1RDA A;  5KRT A;  1ASW A;  1RBT A;  4RW4 A;  1I39 A;  4FJ8 A;  5HRS A;  4DG1 A;  5CR4 A;  3DWL A;  2KZM A;  3GG4 A;  3TTD A;  3G25 A;  2P9I B;  4RCH A;  3OYG A;  2GV9 A;  4WFB L;  1X9W A;  3I56 N;  2G8W A;  3MN5 A;  3FFK B;  2E2Q A;  1M90 O;  4XH4 A;  1OKJ A;  5C2F A;  3DXM A;  1VQM N;  3SI6 A;  1YVU A;  2DFF A;  3KKR A;  2HND A;  4A5A A;  1D4X A;  4NLC A;  3C65 A;  3RR7 A;  1Z05 A;  1BA0 A;  4MFB A;  4Y1C A;  4ILJ A;  3E9L A;  4C8N A;  2E6L A;  3CJ7 A;  3IMX A;  4OPJ A;  2NRX A;  3K5N A;  3NF6 A;  3S3O A;  4BGA A;  1R0A A;  4K8X A;  4EAH D;  4R79 A;  4RW8 A;  2RN2 A;  4AHV A;  3RSE A;  4KB0 A;  3RTV A;  1Q18 A;  1ZBU A;  2QWQ A;  3B6O A;  3DRR A;  3VQ8 A;  3AAQ A;  3DLK A;  4B9Q A;  1BO5 O;  5LMU K;  1BIU A;  4CF0 A;  5CHI A;  2GEL A;  2O8F B;  1XMO K;  3AVF A;  1T44 A;  4BG9 A;  4PQU A;  2YKM A;  3A5O C;  5FRO A;  2KKZ A;  1K8K B;  4HUF A;  4IZ9 A;  1W2B M;  4DQI A;  4K8Z A;  2ZJP L;  3L4I A;  3KD5 E;  1T3V A;  3SJJ A;  1VSM A;  3SQ2 A;  3BZC A;  1S9E A;  1L3V A;  4DTJ A;  5I42 A;  1RDC A;  5FLX O;  3DI6 A;  1QVF M;  3D2E B;  2A6A A;  1XNR K;  1N5Y A;  3TAP A;  3VEO A;  3AAR A;  4CGF A;  5DM6 L;  1IH7 A;  2DTU A;  3LP1 A;  3SLC A;  3OYN A;  4CGG A;  4CF2 A;  4NXN K;  2UUC K;  1OH6 A;  3E66 A;  4FJ7 A;  3CCV N;  1L3T A;  3DXK A;  5C12 A;  1P90 A;  4JI7 K;  2BE2 A;  3CQ8 A;  4TSX A;  4DFJ A;  1W7A A;  2UUA K;  1RFQ A;  3H3O B;  4JKH A;  4B9L A;  2X6N A;  2GWJ A;  5GAG P;  4JKE A;  4W5T A;  2OYQ A;  2NRH A;  1HQU A;  3LAK A;  4DFM A;  5HRR A;  4A61 A;  4BRQ A;  2IDO A;  3SMP A;  3FZK A;  4DTS A;  3HVR A;  2O8C A;  4CZM A;  2HNZ A;  4FJI A;  3T1A A;  4HHT A;  4CCH A;  3OA9 A;  1HUX A;  3QEI A;  3LPU A;  2Y1I A;  4CIG A;  3SUO A;  4AHC A;  2G8H A;  2OZS A;  3CQY A;  4DFK A;  2A5X A;  1WAF A;  3CCE N;  4BG8 A;  2Q36 A;  3IG1 A;  5KGX A;  4N5S A;  3UB5 A;  2HMI A;  3SPY A;  1VSI A;  3QET A;  3KLF A;  1RDU A;  3B8A X;  3OYI A;  4IO8 A;  4WQ5 A;  2A42 A;  4OJR A;  2QWL A;  4CEA A;  2PZS A;  3AV9 A;  1T03 A;  2FLO A;  1R59 O;  3M8P A;  3O4N A;  4DTX A;  4YDU A;  1YAG A;  1J6Z A;  4HTU A;  3J7Y P;  2JGU A;  4CZF A;  4Z4G A;  1LAW A;  3DLE A;  4BRF A;  2E2P A;  3QFU A;  4CFD A;  4WE1 A;  5I9E B;  2G8V A;  2QK9 A;  2QI2 A;  2O4I A;  2F9T A;  1CZ9 A;  3HM8 A;  4KV8 A;  3CM5 A;  3I0S A;  3VQQ A;  4Z4E A;  3JSM A;  3CJA A;  1Q9Y A;  3EKU A;  3AVG A;  3ZSQ A;  2FSJ A;  3DLR A;  4GNI A;  3JS6 A;  1DTQ A;  3VER A;  3ULE B;  3M1F A;  4DTM A;  2VGM A;  5AQO A;  3QER A;  3O1W A;  2XY8 A;  2ETJ A;  4AHS A;  1TGO A;  4M3U A;  5BPN A;  1WSF A;  4F3O A;  4H0X B;  1OH5 A;  3DOL A;  4FLV A;  1TUU A;  4ZTJ A;  5I3U A;  4CJV A;  4NCB A;  4U7B A;  4KB1 A;  1Z6R A;  4O44 A;  4OPK A;  4KHY A;  3OVN A;  3TAR A;  4QOZ B;  2O8F A;  2UU9 K;  4U67 L;  1MWK A;  1G99 A;  3HOT A;  2ZWH A;  3TAB A;  1YTU A;  4BRK A;  4CF8 A;  5AQX A;  1K8K A;  3ASM A;  2X6S A;  1RDB A;  3L2Q A;  1U6Z A;  4HWI A;  2VWK A;  3MEC A;  1M1K O;  4RTF D;  5JLF A;  1EP4 A;  1C0T A;  2G8U A;  3AVJ A;  3LDN A;  1JLB A;  4CGJ A;  1FKO A;  3UKR B;  3EZ5 A;  4JS4 A;  3OYD A;  1TL3 A;  3TTC A;  5M1F A;  5KQ8 A;  3O9T A;  1NG9 A;  4BRP A;  4B9T A;  2BGG A;  3SQ0 A;  2Q0R A;  3I8B A;  4FOI A;  4KTQ A;  1J54 A;  4A2B A;  3TAM A;  1QZ5 A;  3WEE B;  1NJW A;  1BWF O;  1NNE A;  4KPY A;  4H4O A;  3I8D A;  3QO9 A;  1DLO A;  3QNO A;  4M3W A;  1C6V A;  3K59 A;  1ILY A;  4IOC L;  4OKJ A;  2BUP A;  3G10 A;  4E1M A;  1DKG D;  3TAQ A;  3NF7 A;  3OBY A;  4CK3 A;  3NGY A;  4CEO A;  4H5R A;  4A57 A;  3UKU A;  4F4K A;  2HHV A;  5KPT A;  4O8K A;  1DT9 A;  1ZXO A;  3NBP A;  4B3O A;  5F2R A;  5KGW A;  5JIC A;  1SKS A;  3H1Q A;  1KFS A;  4PUO A;  2HBL A;  4CEE A;  1IKY A;  1OVQ A;  2VWB A;  2GUP A;  4YY3 K;  5KPZ A;  1IV0 A;  4L3Q A;  1KC8 O;  4FK2 A;  4BR7 A;  3MX2 A;  1VQ8 N;  2HBJ A;  1TV6 A;  4CJR A;  4CD1 A;  4B08 A;  1W9H A;  3ENB A;  3AVM A;  3L6Q A;  3MWP A;  3G4S N;  3K58 A;  1S1U A;  2H3G X;  2NLX A;  4FLW A;  4IBN A;  3O4W A;  1JLF A;  1NKB A;  1K6Y A;  2OZM A;  3VQP A;  1S72 N;  2D0O A;  4CZE A;  3SAG A;  2GTD A;  1JKH A;  2RF2 A;  2O8D B;  2IGI A;  5H1S Q;  4XH1 A;  3CCJ N;  1S9G A;  1KTQ A;  4YOU A;  3S9H A;  4FM1 A;  3H3N O;  4BRC A;  1VRU A;  2B4J A;  2YKN A;  4FZZ A;  4IDK A;  2QKK A;  3FE1 A;  5DMR A;  3NVM A;  4QS7 A;  1RT7 A;  4GV9 A;  1WBB A;  1CXQ A;  2WC9 A;  1DGK N;  3P4I A;  2XY7 A;  2AJQ A;  5TKW A;  1Y64 A;  2V52 B;  3SV3 A;  3KK7 A;  2FXU A;  5FRN A;  4QCL A;  4F2R A;  3ENH A;  4CES A;  4DSI A;  2GWK A;  4FJN A;  3PIP L;  4E7H A;  4I2Q A;  2PBD A;  3TSP A;  2GEM A;  4CJT A;  1BCM A;  1GLF O;  4FLU A;  2DFE A;  2OPR A;  3VEW A;  4GKJ K;  1S1W A;  1VSJ A;  3DLB A;  2VG7 A;  4O0J A;  2VCP A;  4DFP A;  2V7Z A;  4DSL A;  1H1V A;  3R8E A;  3EE8 A;  2Z1H A;  3BP8 A;  1BA1 A;  2R7Y A;  1NGG A;  2O8B B;  3HZ6 A;  2IC3 A;  3O08 A;  3OYK A;  4BDP A;  2F4V K;  1HX1 A;  3N4P A;  1BCO A;  3L3U A;  1V4S A;  4CJP A;  2A1S A;  3K0S A;  3M8Q A;  3VOV A;  3LP2 A;  4RW6 A;  4LD0 A;  4CJ4 A;  3E9P A;  1XHZ A;  2OCE A;  2HHX A;  4N56 A;  1QTM A;  3VQ7 A;  2YHA A;  1VQP N;  1K9M O;  5C0Y A;  3CME N;  4O5F A;  1C1A A;  2FF6 A;  4I7F A;  2DPN A;  4BY9 C;  3VQC A;  4HCB A;  4JKD A;  4E7K A;  1Q7Y O;  1BG3 A;  3SBG A;  4FJK A;  2UXB K;  3CC2 N;  3KLH A;  5HBM A;  3KTQ A;  4DR1 K;  3O3F A;  4DWI A;  3PX6 A;  1Z25 A;  3PIO L;  3ZX0 A;  4Z4I A;  4EZ6 A;  1GLB G;  4BRL A;  3NGZ A;  1XHX A;  4DQS A;  3VQ6 A;  3I0R A;  2YNH A;  5D3G A;  2HHT A;  4KKO A;  4Y1D A;  2E1Z A;  4ILH A;  1KAZ A;  1QSY A;  4PKI A;  3HJF A;  3RMA A;  1CZB A;  1ZBS A;  4IOA L;  1XC3 A;  4H0T B;  5E41 A;  3MCP A;  1NK7 A;  1ZBF A;  3ZSY A;  3CI5 A;  1ASV A;  1ASU A;  5FPE A;  2YV0 X;  4FL9 A;  3WUH A;  1NOZ A;  5GIO A;  4UY8 O;  5KRS A;  1IKW A;  1C1C A;  3PSI A;  5CZ2 A;  3VEN A;  3KWG A;  1KSP A;  1YXQ A;  4CJL A;  5C42 A;  4FWN A;  4CHY A;  2A40 A;  2HMP A;  4ELT A;  2QWP A;  5EX5 A;  2QEX N;  4F3T A;  4JI8 K;  3ZT4 A;  3VMF B;  4FW2 A;  2O8D A;  4CEQ A;  2D0P A;  1NK5 A;  2P9U A;  3HSC A;  4FW1 A;  4KH5 A;  2E5L K;  3M5R A;  4AQY K;  1HJR A;  3VEX A;  4DQP A;  1Q9X A;  4CJF A;  2O8E B;  1RT3 A;  1Q81 O;  3KD1 E;  4XEI A;  3Q7C A;  3CQX A;  4PL7 A;  3WNH A;  5GIN A;  1TVR A;  2HOE A;  1JXB A;  3V1R A;  3V1Q A;  1D9F A;  1JLG A;  4FWP A;  4GKK K;  3SNN A;  3ZSO A;  3ZEU B;  4FWS A;  4EP4 A;  4BC4 A;  2W40 A;  3J8A A;  4BRE A;  4IOX A;  4C1N K;  2YNG A;  2JLE A;  4CHP A;  2V7Y A;  4WF9 L;  3U3Y A;  5C24 A;  1VQO N;  3DLH A;  2NRV A;  2HVH A;  3QEP A;  5AQJ A;  3CCM N;  4F8R A;  4LFC K;  3M8R A;  1RTD A;  1OH8 A;  2QXF A;  3GL1 A;  1L3U A;  3F9M A;  3HVT A;  3KK2 A;  1KAX A;  4FPA A;  3WXK A;  1VQK N;  2W41 A;  3FGU A;  1D9D A;  1K8A O;  1NGE A;  2KLA A;  4H5V A;  4I6M A;  4BWJ A;  2ASP A;  1HJO A;  3SQ1 A;  3ZX3 A;  3LZI A;  4C8O A;  4ISF A;  3MWT A;  3R6M A;  3NH1 A;  3ATU A;  2I7P A;  5AFU H;  1N8R O;  3PY8 A;  3TAE A;  3BY5 A;  4OO1 J;  1YJ9 N;  4IJA A;  4B9S A;  1Q8I A;  3CC7 N;  1A5V A;  4DU3 A;  4K42 A;  2IOC A;  3MN9 A;  1XC9 A;  3OYJ A;  1JXE A;  3S41 A;  3OYC A;  2CH6 A;  4H0P A;  3J7Z O;  1HNV A;  4JKG A;  2ZQB A;  5EVZ A;  4I2P A;  4GV6 A;  3CCR N;  1S3X A;  3C7N A;  3CC4 N;  4FLZ A;  1XWL A;  1RT6 A;  1X1P A;  2ASM A;  2A3Z A;  3K2P A;  1YIT N;  3CCL N;  1RBU A;  3MK6 A;  4DR6 K;  4LFB K;  2FSK A;  2ATQ A;  3I33 A;  3NCI A;  3SPZ A;  2AA4 A;  1NGB A;  1S6Q A;  3MXM A;  3OS2 A;  3UE5 A;  3BEX A;  3CER A;  1HYS A;  3GOI A;  2PYJ A;  1T6D A;  3A5M C;  1N32 K;  1NK9 A;  1UAX A;  1S1T A;  3EO3 A;  4Y0W A;  3K5M A;  3NH2 A;  3QBX A;  3SUQ A;  5SZT A;  1HNX K;  2FBY A;  1TKX A;  3DYA A;  1REV A;  1RBS A;  4JK7 A;  1BIZ A;  5AQF A;  3CCS N;  1W0H A;  4J2B A;  2YHW A;  2EX3 A;  4CF9 A;  2YI1 A;  4OPA A;  3TSQ A;  2VWJ A;  3LWL A;  4N76 A;  2BDP A;  5M1Q A;  1EXQ A;  4MQ3 A;  1SKW A;  2BTF A;  3BF3 A;  4AM6 A;  1FXX A;  5GIP A;  4CJ3 A;  4Z4F A;  4K43 A;  4KHU A;  1SL2 A;  4E7I A;  4XH5 A;  3ZET B;  4JD2 B;  4CI6 A;  3FZF A;  3FZM A;  3VQA A;  4FJM A;  3AVH A;  3OJS A;  1NJI O;  3IRX A;  4K0K K;  5AZJ A;  4B8C A;  4FOE A;  4CVN E;  4JN4 A;  4OLA A;  3KZB A;  3LAM A;  4DSE A;  4DUZ K;  4Z4H A;  3V9X A;  4B3T K;  3V81 A;  3VTH A;  1EO1 A;  4OKE A;  3AAP A;  1DEJ A;  3I55 N;  5CY4 A;  3MXJ A;  2D1K A;  1JLQ A;  4EFH A;  3IKM A;  4LF4 K;  4BVO A;  1YTA A;  5J2P A;  1TK0 A;  2O8E A;  3PO5 A;  3HP6 A;  1HQE A;  4BE0 A;  3ZYY X;  2XY5 A;  1J5E K;  3HTV A;  2P51 A;  3THY A;  1NLV A;  1X3N A;  2WON A;  1WSH A;  4IG0 A;  3L3V A;  3NF8 A;  1HYV A;  4DCH A;  1NOY A;  3AVN A;  3D0P A;  3O8M A;  3CF5 L;  2OTJ N;  2JWL A;  3THW A;  4W5R A;  3SAH A;  5AFU A;  1GLC G;  4M7Y A;  3ATV A;  3VET A;  4LF7 K;  2ZGY A;  3RRG A;  3C94 A;  4DTR A;  2XHB A;  4JRQ A;  3QLH A;  2HHQ A;  1HLU A;  1NJX A;  4BRM A;  5T7B A;  4KTZ A;  5JVG L;  3IDH A;  1T8E A;  3AA2 A;  4JI6 K;  2J4R A;  3K9J A;  2WFB A;  1EQY A;  1D5A A;  2FBT A;  1D8Y A;  2HF3 A;  5MLC Q;  1EX4 A;  3P31 A;  4FJ5 A;  2YHX A;  3V9Z A;  4Q0B A;  5KI6 A;  4DQQ A;  3KIO A;  1LWE A;  3LP3 A;  4FJ9 A;  4CZI A;  4YFU A;  3AA5 X;  2YHY A;  3DMJ A;  3VEY A;  1QQO A;  3R1X A;  4H0V B;  3ZLJ A;  1TUY A;  2VQE K;  1NK6 A;  4M42 A;  3ZSX A;  4BRI A;  2EHG A;  3KK1 A;  5M1P A;  1S6P A;  3OS0 A;  3OHR A;  4JV5 K;  3C6T A;  4CJQ A;  3QIN A;  4PA1 A;  3CPE A;  2OPP A;  3F73 A;  4BE1 A;  1QS4 A;  4CER A;  3CYM A;  1KRP A;  3L2R A;  2P9I A;  4B3S K;  3M3Z A;  3P83 D;  1VSE A;  3P1G A;  4BGB A;  1WB9 A;  1XMQ K;  5AQL A;  2UYT A;  4CBU A;  4E3S A;  4FK0 A;  1IG8 A;  4DV7 K;  3MN6 A;  4JI0 K;  5IT9 O;  4CJS A;  1YHQ N;  4LF8 K;  4IKF A;  3EEQ A;  3VQ4 A;  3NGI A;  1J53 A;  5AQY A;  2E2O A;  3V9U A;  3LZJ A;  5AQP A;  3TU5 A;  3VPZ A;  1EWR A;  4FLX A;  3ULD A;  5AQH A;  5C15 A;  3L0Q A;  3CCU N;  3NFA A;  3ZET A;  4GY2 B;  1NU0 A;  4FWK A;  5FPM A;  3IS9 A;  5M1K A;  1VQ6 N;  3OBW A;  4B1V A;  1TYQ B;  1LOT B;  3JYT A;  1FJG K;  4IFE A;  3AA3 A;  3SBT A;  4HVJ A;  5TKY A;  5HRP A;  3AVA A;  4M3Y A;  1ATN A;  5AJ3 K;  2E88 A;  3NHG A;  3FLC O;  4NXM K;  3V1O A;  2KZZ A;  3MAQ A;  4X65 K;  3L2V A;  4XIU A;  1W97 L;  1QE1 A;  3AVB A;  1QQM A;  2HB5 A;  3M6G A;  2QA4 N;  3OYB A;  3LAL A;  3D2E A;  3TI0 A;  3U9Z A;  5E84 A;  2HHS A;  4IG3 A;  3DRP A;  1OH7 A;  4BR0 A;  2OA8 A;  3ZSZ A;  4O0I A;  3P5J A;  4M63 C;  4GW6 A;  3THV A;  4GV3 A;  1RBV A;  4FJL A;  3G71 N;  3LDP A;  4KI4 A;  3R3L A;  4B9M A;  1U2V B;  3A5N C;  3AO1 A;  1SZ2 A;  1EKE A;  3PUF A;  2F8T A;  3DOK A;  1RBR A;  3HI0 A;  4CFC A;  2GX9 A;  2FSN A;  3O9U A;  1ZBH A;  5ADX A;  4YOR A;  4G1Q A;  1VSF A;  3EKS A;  2P9K B;  4M3Z A;  4DQ8 A;  4CJE A;  1U04 A;  3U3G A;  4DLE A;  3K5L A;  3WXM B;  3MED A;  4DTN A;  4H0O A;  1J5O A;  1HKB A;  1WLJ A;  3NE6 A;  3PV8 A;  4Q5V A;  3O6W A;  1HR0 K;  3RMD A;  3QNN A;  5GAH P;  4OGC A;  4FLY A;  2QWO A;  3THX B;  1NJY A;  2YCH A;  5BPL A;  2W6L A;  5KTQ A;  5HL7 L;  4A59 A;  3HXM A;  2ZF5 O;  4DS4 A;  5M1N A;  1Q86 O;  4YOX A;  5FPD A;  4C8K A;  4B1X B;  3OW2 M;  3QIC A;  3Q7B A;  4EHU A;  4JI2 K;  1NMN A;  4CEC A;  4KHQ A;  5BRD A;  3VEV A;  3HK2 A;  3ZT1 A;  3CFO A;  1C1B A;  3AVI A;  3HOS A;  2QKB A;  4FLT A;  3VQB A;  1BU6 O;  3HL8 A;  2P9S B;  4IEI A;  5CE3 A;  2G8K A;  4M3R A;  1YI2 N;  1ATR A;  2XRI A;  3E9O A;  4DR4 K;  3WXI A;  1NKC A;  3QEV A;  4ISG A;  2ZJR L;  2P9P B;  3QML A;  3QFP A;  1NK4 A;  1VSK A;  1X3M A;  3U9D A;  1HNZ K;  3E1Y A;  4BRG A;  4DB3 A;  3CM6 A;  2QWM A;  4L8R B;  4BVP A;  5C10 A;  3NVK A;  1FKP A;  2Q0U A;  4AIL C;  3ULE A;  4M45 A;  2PY5 A;  4N47 A;  4BDY A;  2QTD A;  3QBW A;  1HNI A;  4B8A B;  3D7E O;  2P9L B;  3JXU A;  1QHA A;  3SQ4 A;  1LCU A;  3AO3 A;  1QQN A;  1ESV A;  3W3D A;  3OYL A;  4LH4 A;  4KHW A;  1GLE G;  2UUB K;  2P9N B;  4MDA A;  1TYQ A;  2AP1 A;  1WSG A;  4WYB A;  4M41 A;  3PLA A;  3A5L C;  4C23 A;  4JHD B; 
#chains in the Genus database with same CATH homology
 3T1Y K;  4CVN E;  1XNQ K;  4B3S K;  4DUZ K;  4B3T K;  4NXN K;  1XMQ K;  2UUC K;  4DV1 K;  4DR7 K;  4JYA K;  4DV5 K;  2UXB K;  3J80 O;  4DV7 K;  1IBL K;  4LF4 K;  4JI7 K;  4JI0 K;  5IT9 O;  4LF8 K;  4DR5 K;  4DR1 K;  2UUA K;  1J5E K;  1HR0 K;  5IWA K;  4LFA K;  1N34 K;  2UU9 K;  5LL6 Z;  1IBM K;  2UXC K;  3OTO K;  4JI2 K;  4JI5 K;  3T1H K;  4JI1 K;  4X66 K;  4DV6 K;  4DUY K;  4DR2 K;  4LF7 K;  1FJG K;  4LF6 K;  4YHH K;  4DR6 K;  4DV4 K;  4LFB K;  4DR4 K;  5AJ3 K;  5BR8 K;  1N36 K;  1I94 K;  2VQF K;  3J7A P;  4GKJ K;  2UXD K;  4B3R K;  4NXM K;  4JI8 K;  4X65 K;  4DV0 K;  4JI4 K;  2ZM6 K;  4DV2 K;  1N32 K;  2E5L K;  4JI6 K;  1HNZ K;  5A2Q O;  4AQY K;  3J81 O;  2HHH K;  5LMN K;  1HNX K;  4DV3 K;  5LMU K;  4LF5 K;  4DR3 K;  3J7Y P;  1XMO K;  4X64 K;  4K0K K;  2F4V K;  4X62 K;  4GKK K;  3JAM O;  1HNW K;  2VQE K;  4OX9 K;  1IBK K;  4YY3 K;  4B3M K;  4JV5 K;  2UUB K;  1N33 K;  4KHP K;  5FLX O;  4LF9 K;  1XNR K;  4V19 S;  4CW7 B;  4JI3 K;  4LFC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...