4B3SK

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3sK00
2VQEK 1N32K 2VQFK 1IBLK 4DV0K 1N36K 1XMQK 1HNWK 4GKKK 4JI0K 1XNRK 1I94K 2UXBK 1XNQK 4DUZK 1J5EK 4LF4K 4YY3K 4DR4K 4DR2K 4B3TK 4JI5K 4JI6K 4YHHK 5LL6Z 1XMOK 2UUAK 3J80O 4LF5K 2E5LK 4LF7K 4LFCK 4DV2K 4DV6K 2UUBK 4DR7K 1IBKK 4NXNK 4LF9K 2UXCK 4AQYK 1FJGK 4OX9K 1N33K 3J7AP 4DR6K 4B3MK 4V19S 2HHHK 2F4VK 3T1HK 5IT9O 4DV3K 1HNXK 4DR1K 4X64K 3T1YK 3OTOK 4DR3K 4LF8K 4JI1K 3J81O 4DV1K 3J7YP 4B3SK 5LMNK 1N34K 4X62K 4DV5K 4DR5K 4LF6K 1HNZK 5FLXO 4DV7K 4GKJK 5A2QO 4CVNE 5BR8K 3JAMO 4JV5K 5AJ3K 4JI4K 4K0KK 5IWAK 4LFBK 5LMUK 4JI8K 4LFAK 2ZM6K 4X65K 1IBMK 4JYAK 4JI2K 4DUYK 4JI7K 1HR0K 2UUCK 4CW7B 4B3RK 4KHPK 2UU9K 4NXMK 2UXDK 4JI3K 4DV4K 4X66K
chains in the Genus database with same CATH superfamily
3R8EA 4H5VA 4GNIA 4CBUA 3H6EA 2ETJA 4A2AA 1QQCA 4PUOA 1NMDA 3QEIA 5TKYA 5EXWA 3OS1A 1S5JA 4IZ9A 3TPQA 3P39A 3DWLA 2QTDA 4BRHA 3VGKA 3G71N 1U48A 1XNQK 3G25A 4H0VB 3CM5A 4DQPA 2P9SB 5C12A 3ZT1A 3SQ1A 5TKWA 4N56A 5HRSA 4DLGA 1JLAA 4B3TK 3OBYA 4CEFA 3VEOA 4JS4A 4FWLA 3L2UA 4MLHA 3LANA 4KI6A 5J2MA 4JLHA 2E5LK 1WUAA 4DG1A 3L2RA 1RILA 1S6QA 4DTXA 4LFCK 5BREA 1X9MA 3VGMA 5DMRA 1Z05A 4ISEA 1RCHA 4H8KA 3NBPA 4IDKA 3E9PA 4DFJA 3AA3A 4EIAA 4CBWA 4NLCA 2A1SA 3V1RA 3EZWA 2Q0UA 1YI2N 3IKMA 2F9WA 3L6QA 3CJ9A 4CHNA 4GV9A 4FK4A 4DU1A 2ASMA 2XY8A 2ZD1A 3M8RA 3TU5A 1I3AA 5I42A 3MK6A 2HBKA 2FBYA 3BZKA 4H4OA 3OYMA 3L4IA 1VQ5N 1OVQA 3E01A 1TK5A 4BDPA 2G8HA 1NK9A 2EX3A 4ID5A 1QTMA 3QMLA 4IO8A 1HNIA 3NH1A 5EVZA 1HQUA 4NCBA 1NJIO 1EWQA 4J2EA 3QETA 3PIPL 3HRGA 1CLQA 2B6AA 2HMIA 3WNFA 5CYMA 2Q1NA 2VGMA 4DUYK 3IDHA 4BR4A 1RDDA 3LDOA 4G1QA 3O4WA 4ELVA 4YOYA 4QAGA 4F3OA 4BRQA 4OVLA 3PSFA 1NGFA 2A41A 2EWSA 2X78A 4CZMA 1A5XA 4Z4EA 3CCEN 2BE2A 5JS2A 1RBTA 1VSEA 3CC7N 3WQUA 1VQKN 2P9LB 5C10A 3I8BA 1W9HA 2DFFA 3GDQA 2I7PA 4FLVA 3WEEA 4CK2A 4KI4A 4O8KA 3P4IA 3QEWA 3QERA 4FJ9A 1S9GA 4LF4K 2E2NA 1FW6A 4DS5A 1LWCA 4DR4K 4E89A 3DOLA 4HTUA 3VEZA 5KGWA 3EY1A 1S1WA 1GOAA 3NGIA 1DGKN 1XMOK 1NGJA 1Q86O 2XY5A 1QQOA 2E2QA 1W97L 4BR2A 3KD5E 1IBKK 5FPMA 1NK5A 4OPJA 1S1VA 1HX1A 5AQVA 4KFBA 3KLFA 3NAEA 4JRPA 3OVNA 1WSGA 2VG6A 2W6LA 2P1JA 5AQLA 1OH5A 2ZJQL 4FJLA 1HNVA 2XRIA 3B8AX 5BR9A 5ELZA 1J5OA 2WONA 1NWKA 2VG7A 2E20A 4BDZA 2NRRA 5J2PA 4JKFA 3OYFA 3J7YP 4X62K 3WXLA 3C94A 3DXKA 4DTSA 4JKCA 4ELTA 4H03B 4CGDA 2O8BA 3DJCA 4JI4K 4K0KK 2KLAA 2RF2A 2FBXA 3A5NC 1KFDA 3SQ4A 1KC8O 1NGHA 2KFNA 5EOYA 3V1QA 3IUCA 2O8FB 2QXFA 2X6NA 3L3VA 4W5RA 3LP0A 5KGXA 4BVPA 1VRUA 4JI7K 1NLVA 4CW7B 3A5LC 1U2VB 1FKPA 4BREA 3SMSA 3NFAA 3I0SA 5AQFA 4L8RB 3F5TA 3TAFA 1MWKA 4L3QA 3EO3A 3CC4N 3TAPA 2D0CA 3ZSQA 1C1CA 2QWQA 1SKSA 4CZLA 4CHZA 2A40A 3IMXA 5KPTA 2PZSA 3VEXA 2GELA 2WTUA 1RT5A 4WFBL 3BZCA 3I56N 1J5EK 1YITN 4FM0A 5AFUA 1LCUA 4C8LA 5I9EB 2OTJN 2DPNA 2JWKA 2Y1IA 4CFCA 5BPLA 2UUAK 4R5PA 1SQKA 3THVA 1WSJA 1E3MA 5LJWA 4OPAA 3C7NB 4H0PA 1HQEA 1X9SA 1NG9A 3L3UA 1ASUA 3CMEN 2F4VK 4RG8A 1VHXA 4N76A 1NBWA 3SZ2A 1NGEA 2RN2A 5CZ2A 4DR1K 1TL3A 4PQUA 2Y1JA 1J6ZA 1YXQA 4J2DA 4CZHA 5AQPA 5C25A 2RE2A 3DI6A 2F96A 3I55N 1REVA 3OA9A 3MDQA 4B08A 3M6GA 4DTNA 1TKZA 4BR0A 4IO9L 2EHGA 4LF6K 1HNZK 1RTIA 3KLGA 3E9OA 1GLBG 4GKJK 3NF7A 3RTVA 1VQ7N 2HBLA 4KH6A 1HJOA 1YVNA 3VQ6A 3F73A 3RMCA 4C8KA 4AHUA 2IAJA 4RCHA 1VK0A 5M1PA 4LFBK 4JI8K 4LFAK 1WOQA 4CHQA 3E66A 1J53A 3MN6A 1HRHA 1IBMK 3I8DA 4HVJA 4K8XA 2V51B 3AO2A 1TGOA 3O9TA 2HHVA 1GOBA 3HM9A 4CJ5A 1RFQA 3S41A 5DM6L 3SI6A 4CGJA 2NNWA 3CPEA 4CJFA 5ADXH 4KAZA 3O9UA 3DLLL 3TAMA 1C1BA 1HPMA 3QBWA 1X3NA 4AHTA 3VN5A 1EXQA 3V4IA 5D3GA 1WBBA 1BIUA 1IBLK 4C1NK 4DV0K 1QQNA 1XWLA 1HKGA 3WNEA 5AZJB 1VSLA 1RT2A 3VQPA 4CFDA 3SAFA 2UXBK 3MAQA 2P9KA 3DM2A 3DOKA 2VWJA 1JLCA 2O8CA 4GY2B 2WFBA 1P8ZA 1FXXA 4LH5A 2G8IA 2HMPA 3SLCA 4OKEA 3O9RA 3HSTB 3VTHA 4E1MA 2VWBA 1IG9A 3OYJA 1HPZA 1JLBA 3O5BA 3ZSXA 2HB5A 3GBTA 1VSHA 2IVNA 4DV2K 3MECA 4GMJB 3VF2A 4OLBA 4FVUA 3M1FA 1ILYA 4KH5A 3TI0A 1VQLN 2HW3A 2PYJA 4FWRA 2HHUA 1JLFA 4BRDA 1MDUB 1V4TA 2YJEA 4C23A 3AAQA 1WSEA 1CXUA 3O08A 4EFHA 4IBNA 1YVUA 3PX6A 4YOUA 2Q3SA 5CZ1A 1ZYQA 4FJ7A 2KHOA 4CK1A 3MEDA 2NRVA 3ENHA 4YOWA 1C0UA 4BE0A 3LZJA 4LF8K 4DMNA 4G9ZA 1VQ6N 1QS4A 4FJIA 4CGGA 1SS6A 4PA1A 4B1UB 3AO4A 5KQ8A 3KTQA 3GE1A 1IKXA 1SKRA 4B3OA 1N34K 3MXJA 2HSTA 3LAMA 5C2FA 2X74A 4RW7A 1LWEA 3N4PA 2FBTA 4HTLA 4JKEA 4JEPA 5IWAK 3BUZB 4CEAA 4E7JA 1I39A 3TR8A 3O6WA 2DY4A 5JS1A 5EX5A 4F2SA 3SMPA 2HHWA 5J2NA 5JVGL 3RMAA 4H0YB 5BPNA 3ENBA 2UU9K 3TAEA 4I9LA 1NK7A 3CXCM 3ZETB 3OYCA 4DV4K 2VQEK 3B6PA 4FYDA 2OCEA 3MCPA 1KVAA 5KPZA 4JI0K 4FK0A 3L0QA 3E9LA 4DTOA 1KAYA 4FZZA 1K6YA 4KHWA 4DUZK 4ISFA 4B8AB 1DEJA 3M8PA 4IOXA 3EKUA 5M1FA 2KQ2A 1QVFM 3HP9A 2QWPA 1ITGA 3KK1A 2XY6A 5FDLA 3OYDA 3PSIA 4CJEA 4E7HA 3CCSN 3QNOA 1CZBA 3QEXA 1S6PA 1QZ5A 3ZSOA 4OX9K 1U47A 1M1KO 2ATQA 4XH1A 3LWMA 3K58A 3LPTA 1ATNA 1GLEG 2KZZA 2DFEA 3CCRN 4X64K 3O9QA 5KI6A 3CM6A 3AVGA 3GOIA 2ASPA 2PAVA 2A1RA 1S3XA 4JN4A 1UWBA 3HK2A 3LZIA 5FLXO 4Z4FA 1E4FT 1XQSC 4IJNA 1NNEA 1GLCG 3SBTA 3S3NA 3WXIA 4M41A 3UKRA 4RW4A 3C7NA 4K8ZA 3OYAA 4FLTA 2O8EA 3LL3A 3BY5A 3VQ4A 4HCBA 1HLUA 3QINA 3PY8A 3T1AA 2FC0A 4A57A 2GEMA 3G4SN 3LDSA 2ITGA 3THXB 1QSSA 1N8RO 3H1QA 4HCCA 3TAQA 1VAZA 4QS7A 3MEEA 4B9VA 3I0RA 4E7KA 4W5NA 2OPRA 5FRNA 1KVBA 4CECA 5H1SQ 4OGEA 1XNRK 3AA2A 3DLGA 3THYA 4FJ5A 5CY4A 3QNNA 4O5FA 4U7BA 4LSLA 1SL2A 2IC3A 2YX6A 4LH4A 3VERA 4E0DA 4CEZA 2E2PA 3HT3A 4Z4HA 3O4NA 1WN7A 3PX0A 1W2BM 3AVHA 3RR7A 3LAKA 2CH6A 1X9WA 4LF9K 1TKXA 3O4QA 1EETA 2O8BB 3T1HK 1WAFA 4JKGA 4DSEA 4PY5A 1LW0A 3CJAA 3AV9A 2G8VA 1KXPA 1TAQA 2AP1A 3ZEUA 4CJSA 4DR3K 3EN9A 1TYQB 2VWKA 4K41A 3VGLA 2I5JA 4BR7A 4IEEA 4WYBA 3NGYA 3M3ZA 1ZBFA 3WQTA 5AQIA 4CZFA 1RT4A 4HUFA 3RRGA 4HUGA 1IH7A 2P5GA 1H1VA 4DLEA 1VRTA 1VSFA 4DKWA 2QWNA 4PKGA 5BN8A 4QCLA 1BI4B 1GLDG 4CEEA 4FWQA 1BI4A 1D5AA 2P9NB 4M45A 3JSMA 4PKHA 1T6CA 2NRWA 1BQNA 3HSCA 3ULEB 4BY9C 2QEXN 1WB9A 3QDKA 1R59O 3VTIA 2YHAA 4BRLA 1G99A 4CGFA 4DCHA 1N36K 1C0MA 4CCHA 3CCUN 3H46O 4KPYA 3SCXA 5F2RA 3THXA 4JHDA 3OYNA 3QFUA 3TTDA 1RTDA 4CBXA 2P5OA 4M3ZA 5KQDA 2QWMA 3TTFA 4FPBA 1RT1A 3WXKA 3CMAN 5M1QA 3UE5A 3CYMA 1NKCA 1KQSM 4FOIA 3O9SA 4B1WB 2FBVA 4CJVA 3F9KA 3ZETA 4A2BA 3VQDA 1VSKA 4A62A 3U6FA 3PO5A 3RMBA 4KHQA 5BRDA 1HNXK 4WQ5A 1TUUA 4B9UA 2HHXA 5KRTA 4EZ6A 3LM2A 1N5YA 4DSJA 3D7EO 3TSQA 4KV8A 4K25A 3ZX0A 5AQZA 2BH1A 1RDUA 3MEGA 4H0TB 5HOOA 5DM7L 1TK8A 3R6MA 3VQBA 1B9FA 3A0IX 1Q18A 4YFUA 3OBWA 4CZIA 1GLJO 4FWKA 3QESA 5BRFA 1WSFA 2P9PA 2V52B 4DFKA 1KTQA 1O1WA 5FROA 1VQON 4BDYA 4FCYA 3HVTA 5AQWA 5C24A 3VENA 4FWPA 3AA4A 4JNEA 1JXEA 3L8BA 3TWHA 4JKBA 3AA5X 4IOCL 4ELUA 1LOTB 3ATVA 3K5OA 4JRQA 4R79A 4GV6A 1IG8A 2ZGZA 4KHPK 3RMDA 1D9FA 4JK9A 1ZBSA 3L2QA 3DMJA 3P38A 3VEWA 1VSDA 2GWKA 3D2EB 3AVBA 5GAGP 4X66K 4KRFA 4FWOA 4BC4A 4B1ZA 5LY3A 3KK7A 4IXCA 1OH6A 1LWFA 3MMVA 4CHYA 1YAGA 4FWMA 1JL2A 2P9NA 3SQ0A 1U49A 3VF4A 1Z25A 1LW2A 4O5BA 5M1NA 3CJ1A 4FJNA 3NF6A 3ULEA 4J2BA 4MDAA 3FZMA 2W42A 4CD3A 4NO7A 3PLAA 4JAXA 2ZJRL 3KVGA 4KB0A 2AJQA 3H1VX 4JI5K 4KHUA 4M63C 3CERA 4CFBA 4WQ4C 3C6HA 4CEBA 3PV8A 2GWJA 4A59A 3KLEA 2D0PA 4JHDB 1VQPN 2UUBK 3B6OA 2QW9A 3JXUA 3AARA 4U67L 3TSUA 3CD6N 4GW6A 3KK2A 1GOCA 1UA1A 1N33K 1F21A 2OYQA 2O8FA 3SPZA 1FK9A 3SUPA 2QM1A 5I3UA 3O3GA 2YKMA 5JMVA 2P9KB 3R3LA 5JVHL 4CF0A 4BRIA 4KTZA 3K5NA 3RR8A 1A5WA 1YUWA 2BANA 1NOYA 2HVIA 3IS9A 3OS0A 4EP4A 3WNGA 5FPNA 3KWGA 1RBRA 5CR4A 3IRXA 1C6VA 4AF1A 4KTWA 4OJRA 1Q9XA 3TSPA 5LMNK 3VA0A 3GL1A 3PX4A 4DR5K 3HOTA 4DV7K 1JKHA 3R1XA 3K5MA 2CGJA 1IV0A 2YNHA 1Q7YO 1NJZA 4KHSA 1BHLA 4F8RA 5HP1A 5AQTA 5FRMA 4N41A 5E41A 3F2KA 5C0YA 3CJBA 1J54A 5C2DA 4IFYA 1KAXA 4OGCA 3DRRA 3ZSZA 5E26A 4HUEA 4MQ3A 2Q2RA 2P9LA 4B9SA 3ZT4A 3T69A 3VQCA 1DTTA 2P9PB 2E8AA 3K9JA 1QZ6A 3KWIA 3ZEUB 5HLFA 4H4MA 4NCAA 2RKIA 2IVOA 3QLHA 2D5RA 4B8CA 3KIOA 1QVGM 4DS4A 4DQIA 2G8FA 4BRMA 4XIUA 1HJRA 3NMUA 5HRPA 3K0SA 2Z1JA 1RT7A 1KD1O 3ULDA 3THWA 1IO2A 2O8DA 3SUQA 4EZ9A 3CFRA 1BWFO 4B9QA 3LALA 2Z1HA 2OZSA 4Q5VA 3G0ZA 3F9MA 1E4GT 3IAYA 2RPIA 1T6DA 5C42A 1MA9B 1JLGA 1P90A 4BR9A 3WUHA 2ZJPL 1DKGD 1Y64A 2YHYA 3C95A 2GUPA 5KRSA 1TV6A 4O55A 3H3NO 3U9DA 2BGGA 3CFPA 2VGNA 2G8UA 2KFZA 3G10A 3HYFA 3J7AP 4DR6K 3UKRB 4OKJA 4B9LA 1T44A 3LDPA 1HYZA 1RGIA 1NJXA 3V1OA 4E19A 2E6LA 3DXKB 1VQ9N 5HROA 5AQGA 1ATRA 1LAWA 3NGZA 1XC9A 3ENOA 3EKSA 4ZTFA 3HPHA 4ILJA 4CHPA 3OJUA 3SQ2A 4CJQA 4WQ5C 3A8YA 3AY9A 1BU6O 3DLEA 3AVNA 4AH9A 3OYLA 3CIPA 1WSHA 1RBSA 5AR0A 1L3UA 1U2VA 3KK3A 5JICA 2RHKA 2O8CB 4Z4IA 3OY9A 5AJ3K 1X3MA 3AVIA 4FK2A 1WNSA 4X65K 4B9MA 2OA8A 4CJLA 5SZTA 3V6DA 4RW6A 1HR0K 1NK4A 3EL2A 1JJ2M 3FZFA 3W0LA 3CJ7A 3O8MA 2IGIA 4DU4A 2P9UB 3EE8A 4PWDA 2QXLA 1B92A 1V4SA 2P9UA 2NRHA 2NRZA 2NRTA 2GV9A 3S9HA 4CESA 3A2FA 5AQYA 2D4WA 4LD0A 4BRPA 3GG4A 3UIQA 4F3TA 1XMQK 2O4GA 4DQRA 3CQYA 4RTFD 4IOAL 2BTFA 3M5RA 1VSIA 3DLRA 1HYSA 5EY4A 1ESVA 4YOTA 4FLXA 4DQSA 2Q97A 1EO1A 1NMNA 1UOCA 1KCFA 1NGBA 2OPSA 4DWIA 1OH7A 4KREA 2UYTA 2QWRA 3ZX2A 2VYPA 2PY5A 4CJKA 3VETA 4CIGA 1L3VA 3OYIA 4M3RA 1D4XA 4FWSA 1NK8A 4CJ4A 4JS5A 3OS2A 4BROA 1C0GA 2E1ZA 1TVRA 2B4JA 3FZKA 3JS6A 4DSIA 4JD2B 1SAZA 4CEDA 4JD2A 3D2FB 4I6MB 4CGIA 1YIJN 2F8TA 5AQHA 3SAHA 4MLEA 4AM7A 1ASWA 3JYTA 2HHTA 3Q7BA 3O80A 4LC9B 2PFUA 1K8KA 4AILC 1NGCA 1RNHA 4F9OA 1K8KB 2FSJA 3MWTA 3ZYYX 4DV5K 5GADP 4BE1A 3NVMA 3ZSVA 4FLWA 1JLQA 4M3YA 3NVKA 1BA0A 2V7ZA 1L5UA 3L2VA 4CI6A 1EX4A 3MN9A 4IJAA 4B1XB 1WSIA 4JKGB 1SL0A 3QFPA 2G8WA 4C1NI 1T03A 4IG3A 2WC9A 4AHRA 4TSXA 5AQSA 4MO5A 3CFOA 4N5SA 1IJJA 3V9SA 3NH2A 4O44A 1KLMA 3U3GA 1BO5O 3ZLJA 3RVCA 4Z0UA 4M3UA 1Q81O 5HRNA 1LAVA 3ZSWA 1N32K 4KHNA 4MO4A 3MXIA 5GAHP 4J8FA 4WFAL 3TABA 2ZWHA 3MX2A 4XH5A 5J1EA 3RWUA 3ZSYA 1HNWK 4GKKK 4FLUA 3A5MC 4OPHA 3VQAA 1X1PA 3KKSA 3MWPA 4ILGB 2NZTA 1RTHA 2QWOA 5AQOA 4FW1A 4YY3K 4B9TA 2GX9A 3HM8A 1VQNN 4CZJA 3QEVA 3SBGA 3CPWM 3IFRA 5AQUA 5T7BA 4O8UA 3SAGA 1EP4A 1IKVA 3CCMN 1L3SA 3UKUB 2YCHA 3DXMB 2YNIA 2CGKA 4FXDA 2JGUA 4Z94A 4UQGA 1JL1A 3HL8A 5J2QA 3LDLA 4QOZB 2IOCA 5M1KA 1CXQA 2YHWA 5DK5A 4CGHA 4M3XA 2ZGYA 1J9AA 4I7FA 2QA4N 2Z1IA 3U9ZA 4M3WA 3P1GA 1EKEA 1ZC6A 3CG7A 2OPQA 3VQ7A 3I33A 3FE1A 3ID8A 3FZHA 4Q0BA 4NLBA 5BR8K 1S1XA 4B9NA 1VSJA 1XUPO 1QQMA 4FVMA 4BG9A 1NJWA 4BQZA 2ZE2A 3C6TA 4BGAA 4WE1A 3NH0A 3BEXA 1XI1A 3M8SA 4B1YB 2OPPA 3R9PA 4FJ8A 3LP3A 3DAWA 1N6QA 1TAUA 3W3DA 1RDCA 4IEIA 3AVJA 1B9DA 2YV0X 3U8XA 3J8AA 4A5AA 4EHTA 4Z4CA 3SYZA 3NHGA 4DF8A 3MN7A 2KW4A 4BRAA 4CIFA 1GLAG 1S1TA 3HVRA 1TK0A 1MU2A 3OYBA 5AZJA 4W5QA 2A6AA 3OW2M 5F0XA 4Y0WA 1TYQA 4BC5A 1JLEA 3BDPA 3SUNA 3ALYA 3D45A 3T3FA 3DLBA 1WBDA 3ATUA 4AHCA 4CHOA 1Y97A 1Q82O 3DLKA 3SNNA 1DLOA 3HPOA 5HL7L 3VEVA 4HHTA 3ZX3A 4NXNK 4DU3A 4CZKA 4AQYK 4OO1J 1FKOA 5SWMA 1T8EA 4CE9A 2FSNA 4ILHA 4LY7A 4B3MK 3QB0A 4V19S 3VQ9A 4M3TA 2W40A 1T3VA 2HNYA 4KHYA 4JKDA 1KSPA 1YJNN 4M7YA 3KLIA 5AQRA 1YTUA 1KAZA 3MCAB 2Z1GA 3SV3A 1BISA 3C6AA 3T19A 1NM1A 3OJSA 1CZ9A 3K2PA 3OHRA 3WEEB 3KHYA 3SK3A 2QK9A 1C1AA 1VQMN 3AO3A 4FLYA 1IKWA 3O1WA 4CJWA 5A2QO 4CVNE 1KRPA 4BWMA 3JAMO 3CETA 3AGKA 3AVLA 4CFAA 4K42A 4A61A 2HOEA 1RDBA 3MN5A 2WUSA 4CF9A 1HYVA 4FPAA 4YDUC 4DB3A 4FJMA 2ITMA 4CF1A 5AQJA 3THWB 2O8DB 4ZTJA 4FM2A 3AVMA 4J2AA 3THYB 4B3RK 2GTDA 4I6MA 4H0OA 4NXMK 3SJJA 2E1YA 4OPKA 1T7PA 3VQQA 4IWVA 4CJ3A 2FLOA 3D6RA 5K14A 1WLJA 4CJUA 2Q31A 3T7ZA 2VQFK 1U45A 1SL1A 2VG5A 1VQ4N 2GUIA 3FZLA 1NK6A 1NGIA 3P5JA 4ID1A 3FLCO 3LPUA 1GLLO 2NLXA 4KB1A 3VESA 1OH8A 2OANA 4KO0A 4JK7A 1DT9A 2HBJA 5AQXA 1O13A 4FJJA 3G6EN 1K9MO 2I7NA 3HOSA 3CI5A 3UB5A 4YHHK 3LM9A 2WOMA 4BG8A 1BUPA 3OYHA 3S3MA 3WT0A 4FLZA 5GIPA 5BPMA 4DHYA 3U3YA 3SV4A 3E1YA 3EEQA 4DR7K 3CHWA 4E1JA 3CQXA 4NYNA 4H5TA 4NYFA 2KKZA 3L4QA 1JCEA 2JLEA 1GLFO 5BN9A 3VQEA 3LWLA 3QIPA 4BACA 4FWNA 5E84A 3EYZA 2BUPA 4DV3K 3K57A 1YHQN 1K8AO 2F7TA 2VCPA 3H08A 2D0AA 3AVFA 3SPYA 3Q7CA 3K59A 2DFHA 5FPDA 2CH5A 2J4RA 3TARA 2G8KA 1W0HA 1HUXA 4FZYA 1S9EA 4DV1K 2NUBA 1U6ZA 2ASOA 4DTUA 1MWMA 3HI0A 3V81A 1U4BA 4CERA 3V9XA 2Q36A 2A42A 1UA0A 3K9KA 4DTJA 2IVPA 3KJVA 1XHZA 2O8EB 5LMUK 3ZT0A 4CJRA 2JWLA 4I2QA 2ZM6K 1TKTA 5ADXA 3FR0A 5JLFA 3K5LA 3LP1A 2YNGA 3VMFB 2CGLA 2QKBA 1BCOA 2UUCK 3HBTA 1Q8IA 4ICLA 3HJFA 3AO5A 2UXDK 4JI3K 5GAEP 2BDPA 2P9IA 5KPRA 1M90O 3V9ZA 4CEOA 4CJTA 3P31A 2E88A 2NRXA 3LDNA 3VOVA 1XC3A 4ISGA 3O3FA 4JKAA 2W41A 3H3OB 4DFMA 3V9UA 3H45C 5HRRA 4H5WA 4Z4GA 3ZT3A 4WQ4A 3VPZA 5CYQA 5AQMA 4CK3A 5CHIA 3AAPA 4BWJA 4B1VA 4CF2A 4E7LA 4WF9L 4CD1A 4DQ8A 4JI6K 1NKEA 3SUOA 1BIZA 3BF3A 5EU7A 4LF7K 3A5OC 3L2WA 4IFVA 1TKDA 4C8NA 1NGDA 2IS3A 1K73O 4EAHD 5C15A 4I9QA 5IT9O 1X9JA 1A5VA 1OKJA 4RW8A 3VQ5A 4BQLA 4CF8A 2YNFA 4W5OA 3TAGA 1RDWX 1BQMA 1T05A 1JCGA 2HBMA 1QHAA 3C6UA 4YOVA 4FOEA 3OYGA 4YORA 1D9DA 3SJHA 4ZHRA 3DYAA 4IG0A 3HP6A 1QHTA 4JI1K 2E6MA 4QS8A 2DTUA 1C0TA 3HXMA 1RT3A 1YTAA 3EE9A 1ASVA 4K43A 1BOTO 4YDUA 3CC2N 4CZGA 4FJKA 1QE1A 1ZBUA 4AM6A 3DRSA 4YNQA 4BC3A 4BRKA 1EQYA 1JXBA 3OYEA 4DF4A 3M8QA 4PHTX 4GVEA 1W7AA 1KVCA 1SUQA 1XHXA 3NF9A 3ZCMA 4MFBA 5AQNA 3VQ8A 1SV5A 1KFSA 4JKHA 4IKFA 2FXUA 3D2FA 4WFNL 5B8HA 1S72N 1WAJA 1NK0A 4W5TA 3HTVA 4BC2A 4FZXC 3ITHA 4PKIA 4LSNA 2GBZA 1NKBA 2Q0RA 3AO1A 2XY7A 5FPEA 3UKUA 4NCGA 4BRCA 4KTQA 4XH4A 3HO1A 3DXMA 3PO4A 4CJPA 1Z6RA 1IKYA 3LDQA 4WCEL 1Q9YA 1ZBLA 1OVYA 4BRFA 1VQ8N 1L3TA 1EWRA 4JK8A 2XHBA 2YJFA 4HWIA 3QO9A 4I2PA 1BG3A 1SKWA 1SZ2A 2PBDA 1G15A 1UAXA 3P83D 2HHQA 3PUFA 4FJHA 4F2RA 5GINA 1ZBIA 4OKKA 3ZSRA 3DRPA 5LJVA 3J80O 3J7ZO 4BGBA 4LF5K 3WNHA 4CEQA 2PYLA 1ATSA 4DV6K 4DQQA 1RDAA 2P51A 3IG1A 3EZ5A 3AVKA 3BP8A 4EHUA 3O1BA 1FJGK 2ZF5O 5M1OA 3TTCA 1TUYA 5HBMA 2OZMA 1S22A 1C0FA 3S3OA 2QI2A 3MXMA 3WXJA 3RSEA 2QKKA 3NF8A 2R7YA 3FFIA 2AA4A 4H5RA 3ASMA 4IDHA 4O0IA 4O4GA 4CIEA 3CCVN 4M7XA 2IDOA 3CQ8A 4EP5A 1RBVA 3MX5A 3OYKA 1BGXT 4BR5A 4B3SK 3WXMB 4FSVA 2D1KA 5AFUH 3LP2A 3QICA 4Y1CA 1BCMA 2WBNA 3TANA 4PL8A 4XEIA 1LV5A 1ZXOA 4DSLA 4AHVA 5AQKA 1QSYA 2QWLA 3CCQN 4DTRA 2E4LA 4M42A 4F4KA 4KBOA 3AGRA 5AZIA 3AVCA 3AVAA 5AZIB 4GVMA 3KD1E 2ZQBA 1BA1A 2YHXA 4JYAK 4FO0A 4JI2K 1D8YA 2H3GX 2F9TA 3D0PA 3BGRA 3D2EA 2HHSA 4C8OA 4BE2A 1NU0A 2P9SA 3DLHA 1NGAA 3ISNC 1NJYA 2XO7A 4UY8O 4C8MA 5BRHA 1BL3A 2W6KA 1R0AA 1NOZA 5GIOA 1YT3A 3HPGA 1RBUA 3QEPA 1HMVA 4DTMA 4O0JA 3O3HA 1S1UA 1I94K 4E1NA 3C65A 4GV3A 1ZBHA 1RT6A 2D0BA 3ID6A 2HF3A 4Y1DA 3NCIA 2HVHA 3NDKA 4KH4A 4DR2K 1JCFA 4DSKA 3KKRA 3KZBA 5LL6Z 1BDGA 2IIRA 4FJXA 4OLAA 3RRHA 2YKNA 4YOXA 4CZEA 4RWTA 3PIOL 4H5NA 3ZT2A 4DTPA 3CCLN 2FF3B 2D0OA 2HNZA 2UXCK 3FGUA 3CCJN 4FJGA 1QSLA 1Z26A 3CJCA 2X6SA 2P9IB 2A3ZA 1CZAN 2HHHK 2F8SA 4BVOA 3CF5L 4N47A 4AHSA 1HKBA 1U04A 1HKCA 4DSFA 1NGGA 3T1YK 2YHBA 5F1XA 3OTOK 1YF5L 2KTQA 4E7IA 1RTJA 4FM1A 4KKOA 3BF1A 3J81O 5MLCQ 3HZ6A 2OTLN 3QBXA 4A5BA 2E2OA 2HNDA 4BRNA 4CJ7A 4MDBA 2FF6A 1TL1A 4FL9A 3RSEB 4E3SA 1YJ9N 4DFPA 2HF4A 3QIOA 3VF6A 3U4LA 4BRGA 3N4QA 4QS9A 5CE3A 3KLHA 2V7YA 3NE6A 4JV5K 5KTQA 2KZMA 4IFEA 1VSMA 4FW2A 3VA3A 1KLNA 2YI1A 2FSKA 4NB4A 2O4IA 3C0BA 3V9WA 2LSNA 4RW9A 1DTQA 4H0XB 2B5JA 2A5XA 3VEYA 3FFKB 5AQQA 5JLHA 4PL7A 1YJWN
chains in the Genus database with same CATH topology
2VQEK 1N32K 2VQFK 1IBLK 4DV0K 1N36K 1XMQK 1HNWK 4GKKK 4JI0K 1XNRK 1I94K 2UXBK 1XNQK 4DUZK 1J5EK 4LF4K 4YY3K 4DR4K 4DR2K 4B3TK 4JI5K 4JI6K 4YHHK 5LL6Z 1XMOK 2UUAK 3J80O 4LF5K 2E5LK 4LF7K 4LFCK 4DV2K 4DV6K 2UUBK 4DR7K 1IBKK 4NXNK 4LF9K 2UXCK 4AQYK 1FJGK 4OX9K 1N33K 3J7AP 4DR6K 4B3MK 4V19S 2HHHK 2F4VK 3T1HK 5IT9O 4DV3K 1HNXK 4DR1K 4X64K 3T1YK 3OTOK 4DR3K 4LF8K 4JI1K 3J81O 4DV1K 3J7YP 4B3SK 5LMNK 1N34K 4X62K 4DV5K 4DR5K 4LF6K 1HNZK 5FLXO 4DV7K 4GKJK 5A2QO 4CVNE 5BR8K 3JAMO 4JV5K 5AJ3K 4JI4K 4K0KK 5IWAK 4LFBK 5LMUK 4JI8K 4LFAK 2ZM6K 4X65K 1IBMK 4JYAK 4JI2K 4DUYK 4JI7K 1HR0K 2UUCK 4CW7B 4B3RK 4KHPK 2UU9K 4NXMK 2UXDK 4JI3K 4DV4K 4X66K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE K;  1N32 K;  2VQF K;  1IBL K;  4DV0 K;  1N36 K;  1XMQ K;  1HNW K;  4GKK K;  4JI0 K;  1XNR K;  1I94 K;  2UXB K;  1XNQ K;  4DUZ K;  1J5E K;  4LF4 K;  4YY3 K;  4DR4 K;  4DR2 K;  4B3T K;  4JI5 K;  4JI6 K;  4YHH K;  5LL6 Z;  1XMO K;  2UUA K;  3J80 O;  4LF5 K;  2E5L K;  4LF7 K;  4LFC K;  4DV2 K;  4DV6 K;  2UUB K;  4DR7 K;  1IBK K;  4NXN K;  4LF9 K;  2UXC K;  4AQY K;  1FJG K;  4OX9 K;  1N33 K;  3J7A P;  4DR6 K;  4B3M K;  4V19 S;  2HHH K;  2F4V K;  3T1H K;  5IT9 O;  4DV3 K;  1HNX K;  4DR1 K;  4X64 K;  3T1Y K;  3OTO K;  4DR3 K;  4LF8 K;  4JI1 K;  3J81 O;  4DV1 K;  3J7Y P;  4B3S K;  5LMN K;  1N34 K;  4X62 K;  4DV5 K;  4DR5 K;  4LF6 K;  1HNZ K;  5FLX O;  4DV7 K;  4GKJ K;  5A2Q O;  4CVN E;  5BR8 K;  3JAM O;  4JV5 K;  5AJ3 K;  4JI4 K;  4K0K K;  5IWA K;  4LFB K;  5LMU K;  4JI8 K;  4LFA K;  2ZM6 K;  4X65 K;  1IBM K;  4JYA K;  4JI2 K;  4DUY K;  4JI7 K;  1HR0 K;  2UUC K;  4CW7 B;  4B3R K;  4KHP K;  2UU9 K;  4NXM K;  2UXD K;  4JI3 K;  4DV4 K;  4X66 K; 
#chains in the Genus database with same CATH topology
 3R8E A;  4H5V A;  4GNI A;  4CBU A;  3H6E A;  2ETJ A;  4A2A A;  1QQC A;  4PUO A;  1NMD A;  3QEI A;  5TKY A;  5EXW A;  3OS1 A;  1S5J A;  4IZ9 A;  3TPQ A;  3P39 A;  3DWL A;  2QTD A;  4BRH A;  3VGK A;  3G71 N;  1U48 A;  1XNQ K;  3G25 A;  4H0V B;  3CM5 A;  4DQP A;  2P9S B;  5C12 A;  3ZT1 A;  3SQ1 A;  5TKW A;  4N56 A;  5HRS A;  4DLG A;  1JLA A;  4B3T K;  3OBY A;  4CEF A;  3VEO A;  4JS4 A;  4FWL A;  3L2U A;  4MLH A;  3LAN A;  4KI6 A;  5J2M A;  4JLH A;  2E5L K;  1WUA A;  4DG1 A;  3L2R A;  1RIL A;  1S6Q A;  4DTX A;  4LFC K;  5BRE A;  1X9M A;  3VGM A;  5DMR A;  1Z05 A;  4ISE A;  1RCH A;  4H8K A;  3NBP A;  4IDK A;  3E9P A;  4DFJ A;  3AA3 A;  4EIA A;  4CBW A;  4NLC A;  2A1S A;  3V1R A;  3EZW A;  2Q0U A;  1YI2 N;  3IKM A;  2F9W A;  3L6Q A;  3CJ9 A;  4CHN A;  4GV9 A;  4FK4 A;  4DU1 A;  2ASM A;  2XY8 A;  2ZD1 A;  3M8R A;  3TU5 A;  1I3A A;  5I42 A;  3MK6 A;  2HBK A;  2FBY A;  3BZK A;  4H4O A;  3OYM A;  3L4I A;  1VQ5 N;  1OVQ A;  3E01 A;  1TK5 A;  4BDP A;  2G8H A;  1NK9 A;  2EX3 A;  4ID5 A;  1QTM A;  3QML A;  4IO8 A;  1HNI A;  3NH1 A;  5EVZ A;  1HQU A;  4NCB A;  1NJI O;  1EWQ A;  4J2E A;  3QET A;  3PIP L;  3HRG A;  1CLQ A;  2B6A A;  2HMI A;  3WNF A;  5CYM A;  2Q1N A;  2VGM A;  4DUY K;  3IDH A;  4BR4 A;  1RDD A;  3LDO A;  4G1Q A;  3O4W A;  4ELV A;  4YOY A;  4QAG A;  4F3O A;  4BRQ A;  4OVL A;  3PSF A;  1NGF A;  2A41 A;  2EWS A;  2X78 A;  4CZM A;  1A5X A;  4Z4E A;  3CCE N;  2BE2 A;  5JS2 A;  1RBT A;  1VSE A;  3CC7 N;  3WQU A;  1VQK N;  2P9L B;  5C10 A;  3I8B A;  1W9H A;  2DFF A;  3GDQ A;  2I7P A;  4FLV A;  3WEE A;  4CK2 A;  4KI4 A;  4O8K A;  3P4I A;  3QEW A;  3QER A;  4FJ9 A;  1S9G A;  4LF4 K;  2E2N A;  1FW6 A;  4DS5 A;  1LWC A;  4DR4 K;  4E89 A;  3DOL A;  4HTU A;  3VEZ A;  5KGW A;  3EY1 A;  1S1W A;  1GOA A;  3NGI A;  1DGK N;  1XMO K;  1NGJ A;  1Q86 O;  2XY5 A;  1QQO A;  2E2Q A;  1W97 L;  4BR2 A;  3KD5 E;  1IBK K;  5FPM A;  1NK5 A;  4OPJ A;  1S1V A;  1HX1 A;  5AQV A;  4KFB A;  3KLF A;  3NAE A;  4JRP A;  3OVN A;  1WSG A;  2VG6 A;  2W6L A;  2P1J A;  5AQL A;  1OH5 A;  2ZJQ L;  4FJL A;  1HNV A;  2XRI A;  3B8A X;  5BR9 A;  5ELZ A;  1J5O A;  2WON A;  1NWK A;  2VG7 A;  2E20 A;  4BDZ A;  2NRR A;  5J2P A;  4JKF A;  3OYF A;  3J7Y P;  4X62 K;  3WXL A;  3C94 A;  3DXK A;  4DTS A;  4JKC A;  4ELT A;  4H03 B;  4CGD A;  2O8B A;  3DJC A;  4JI4 K;  4K0K K;  2KLA A;  2RF2 A;  2FBX A;  3A5N C;  1KFD A;  3SQ4 A;  1KC8 O;  1NGH A;  2KFN A;  5EOY A;  3V1Q A;  3IUC A;  2O8F B;  2QXF A;  2X6N A;  3L3V A;  4W5R A;  3LP0 A;  5KGX A;  4BVP A;  1VRU A;  4JI7 K;  1NLV A;  4CW7 B;  3A5L C;  1U2V B;  1FKP A;  4BRE A;  3SMS A;  3NFA A;  3I0S A;  5AQF A;  4L8R B;  3F5T A;  3TAF A;  1MWK A;  4L3Q A;  3EO3 A;  3CC4 N;  3TAP A;  2D0C A;  3ZSQ A;  1C1C A;  2QWQ A;  1SKS A;  4CZL A;  4CHZ A;  2A40 A;  3IMX A;  5KPT A;  2PZS A;  3VEX A;  2GEL A;  2WTU A;  1RT5 A;  4WFB L;  3BZC A;  3I56 N;  1J5E K;  1YIT N;  4FM0 A;  5AFU A;  1LCU A;  4C8L A;  5I9E B;  2OTJ N;  2DPN A;  2JWK A;  2Y1I A;  4CFC A;  5BPL A;  2UUA K;  4R5P A;  1SQK A;  3THV A;  1WSJ A;  1E3M A;  5LJW A;  4OPA A;  3C7N B;  4H0P A;  1HQE A;  1X9S A;  1NG9 A;  3L3U A;  1ASU A;  3CME N;  2F4V K;  4RG8 A;  1VHX A;  4N76 A;  1NBW A;  3SZ2 A;  1NGE A;  2RN2 A;  5CZ2 A;  4DR1 K;  1TL3 A;  4PQU A;  2Y1J A;  1J6Z A;  1YXQ A;  4J2D A;  4CZH A;  5AQP A;  5C25 A;  2RE2 A;  3DI6 A;  2F96 A;  3I55 N;  1REV A;  3OA9 A;  3MDQ A;  4B08 A;  3M6G A;  4DTN A;  1TKZ A;  4BR0 A;  4IO9 L;  2EHG A;  4LF6 K;  1HNZ K;  1RTI A;  3KLG A;  3E9O A;  1GLB G;  4GKJ K;  3NF7 A;  3RTV A;  1VQ7 N;  2HBL A;  4KH6 A;  1HJO A;  1YVN A;  3VQ6 A;  3F73 A;  3RMC A;  4C8K A;  4AHU A;  2IAJ A;  4RCH A;  1VK0 A;  5M1P A;  4LFB K;  4JI8 K;  4LFA K;  1WOQ A;  4CHQ A;  3E66 A;  1J53 A;  3MN6 A;  1HRH A;  1IBM K;  3I8D A;  4HVJ A;  4K8X A;  2V51 B;  3AO2 A;  1TGO A;  3O9T A;  2HHV A;  1GOB A;  3HM9 A;  4CJ5 A;  1RFQ A;  3S41 A;  5DM6 L;  3SI6 A;  4CGJ A;  2NNW A;  3CPE A;  4CJF A;  5ADX H;  4KAZ A;  3O9U A;  3DLL L;  3TAM A;  1C1B A;  1HPM A;  3QBW A;  1X3N A;  4AHT A;  3VN5 A;  1EXQ A;  3V4I A;  5D3G A;  1WBB A;  1BIU A;  1IBL K;  4C1N K;  4DV0 K;  1QQN A;  1XWL A;  1HKG A;  3WNE A;  5AZJ B;  1VSL A;  1RT2 A;  3VQP A;  4CFD A;  3SAF A;  2UXB K;  3MAQ A;  2P9K A;  3DM2 A;  3DOK A;  2VWJ A;  1JLC A;  2O8C A;  4GY2 B;  2WFB A;  1P8Z A;  1FXX A;  4LH5 A;  2G8I A;  2HMP A;  3SLC A;  4OKE A;  3O9R A;  3HST B;  3VTH A;  4E1M A;  2VWB A;  1IG9 A;  3OYJ A;  1HPZ A;  1JLB A;  3O5B A;  3ZSX A;  2HB5 A;  3GBT A;  1VSH A;  2IVN A;  4DV2 K;  3MEC A;  4GMJ B;  3VF2 A;  4OLB A;  4FVU A;  3M1F A;  1ILY A;  4KH5 A;  3TI0 A;  1VQL N;  2HW3 A;  2PYJ A;  4FWR A;  2HHU A;  1JLF A;  4BRD A;  1MDU B;  1V4T A;  2YJE A;  4C23 A;  3AAQ A;  1WSE A;  1CXU A;  3O08 A;  4EFH A;  4IBN A;  1YVU A;  3PX6 A;  4YOU A;  2Q3S A;  5CZ1 A;  1ZYQ A;  4FJ7 A;  2KHO A;  4CK1 A;  3MED A;  2NRV A;  3ENH A;  4YOW A;  1C0U A;  4BE0 A;  3LZJ A;  4LF8 K;  4DMN A;  4G9Z A;  1VQ6 N;  1QS4 A;  4FJI A;  4CGG A;  1SS6 A;  4PA1 A;  4B1U B;  3AO4 A;  5KQ8 A;  3KTQ A;  3GE1 A;  1IKX A;  1SKR A;  4B3O A;  1N34 K;  3MXJ A;  2HST A;  3LAM A;  5C2F A;  2X74 A;  4RW7 A;  1LWE A;  3N4P A;  2FBT A;  4HTL A;  4JKE A;  4JEP A;  5IWA K;  3BUZ B;  4CEA A;  4E7J A;  1I39 A;  3TR8 A;  3O6W A;  2DY4 A;  5JS1 A;  5EX5 A;  4F2S A;  3SMP A;  2HHW A;  5J2N A;  5JVG L;  3RMA A;  4H0Y B;  5BPN A;  3ENB A;  2UU9 K;  3TAE A;  4I9L A;  1NK7 A;  3CXC M;  3ZET B;  3OYC A;  4DV4 K;  2VQE K;  3B6P A;  4FYD A;  2OCE A;  3MCP A;  1KVA A;  5KPZ A;  4JI0 K;  4FK0 A;  3L0Q A;  3E9L A;  4DTO A;  1KAY A;  4FZZ A;  1K6Y A;  4KHW A;  4DUZ K;  4ISF A;  4B8A B;  1DEJ A;  3M8P A;  4IOX A;  3EKU A;  5M1F A;  2KQ2 A;  1QVF M;  3HP9 A;  2QWP A;  1ITG A;  3KK1 A;  2XY6 A;  5FDL A;  3OYD A;  3PSI A;  4CJE A;  4E7H A;  3CCS N;  3QNO A;  1CZB A;  3QEX A;  1S6P A;  1QZ5 A;  3ZSO A;  4OX9 K;  1U47 A;  1M1K O;  2ATQ A;  4XH1 A;  3LWM A;  3K58 A;  3LPT A;  1ATN A;  1GLE G;  2KZZ A;  2DFE A;  3CCR N;  4X64 K;  3O9Q A;  5KI6 A;  3CM6 A;  3AVG A;  3GOI A;  2ASP A;  2PAV A;  2A1R A;  1S3X A;  4JN4 A;  1UWB A;  3HK2 A;  3LZI A;  5FLX O;  4Z4F A;  1E4F T;  1XQS C;  4IJN A;  1NNE A;  1GLC G;  3SBT A;  3S3N A;  3WXI A;  4M41 A;  3UKR A;  4RW4 A;  3C7N A;  4K8Z A;  3OYA A;  4FLT A;  2O8E A;  3LL3 A;  3BY5 A;  3VQ4 A;  4HCB A;  1HLU A;  3QIN A;  3PY8 A;  3T1A A;  2FC0 A;  4A57 A;  2GEM A;  3G4S N;  3LDS A;  2ITG A;  3THX B;  1QSS A;  1N8R O;  3H1Q A;  4HCC A;  3TAQ A;  1VAZ A;  4QS7 A;  3MEE A;  4B9V A;  3I0R A;  4E7K A;  4W5N A;  2OPR A;  5FRN A;  1KVB A;  4CEC A;  5H1S Q;  4OGE A;  1XNR K;  3AA2 A;  3DLG A;  3THY A;  4FJ5 A;  5CY4 A;  3QNN A;  4O5F A;  4U7B A;  4LSL A;  1SL2 A;  2IC3 A;  2YX6 A;  4LH4 A;  3VER A;  4E0D A;  4CEZ A;  2E2P A;  3HT3 A;  4Z4H A;  3O4N A;  1WN7 A;  3PX0 A;  1W2B M;  3AVH A;  3RR7 A;  3LAK A;  2CH6 A;  1X9W A;  4LF9 K;  1TKX A;  3O4Q A;  1EET A;  2O8B B;  3T1H K;  1WAF A;  4JKG A;  4DSE A;  4PY5 A;  1LW0 A;  3CJA A;  3AV9 A;  2G8V A;  1KXP A;  1TAQ A;  2AP1 A;  3ZEU A;  4CJS A;  4DR3 K;  3EN9 A;  1TYQ B;  2VWK A;  4K41 A;  3VGL A;  2I5J A;  4BR7 A;  4IEE A;  4WYB A;  3NGY A;  3M3Z A;  1ZBF A;  3WQT A;  5AQI A;  4CZF A;  1RT4 A;  4HUF A;  3RRG A;  4HUG A;  1IH7 A;  2P5G A;  1H1V A;  4DLE A;  1VRT A;  1VSF A;  4DKW A;  2QWN A;  4PKG A;  5BN8 A;  4QCL A;  1BI4 B;  1GLD G;  4CEE A;  4FWQ A;  1BI4 A;  1D5A A;  2P9N B;  4M45 A;  3JSM A;  4PKH A;  1T6C A;  2NRW A;  1BQN A;  3HSC A;  3ULE B;  4BY9 C;  2QEX N;  1WB9 A;  3QDK A;  1R59 O;  3VTI A;  2YHA A;  4BRL A;  1G99 A;  4CGF A;  4DCH A;  1N36 K;  1C0M A;  4CCH A;  3CCU N;  3H46 O;  4KPY A;  3SCX A;  5F2R A;  3THX A;  4JHD A;  3OYN A;  3QFU A;  3TTD A;  1RTD A;  4CBX A;  2P5O A;  4M3Z A;  5KQD A;  2QWM A;  3TTF A;  4FPB A;  1RT1 A;  3WXK A;  3CMA N;  5M1Q A;  3UE5 A;  3CYM A;  1NKC A;  1KQS M;  4FOI A;  3O9S A;  4B1W B;  2FBV A;  4CJV A;  3F9K A;  3ZET A;  4A2B A;  3VQD A;  1VSK A;  4A62 A;  3U6F A;  3PO5 A;  3RMB A;  4KHQ A;  5BRD A;  1HNX K;  4WQ5 A;  1TUU A;  4B9U A;  2HHX A;  5KRT A;  4EZ6 A;  3LM2 A;  1N5Y A;  4DSJ A;  3D7E O;  3TSQ A;  4KV8 A;  4K25 A;  3ZX0 A;  5AQZ A;  2BH1 A;  1RDU A;  3MEG A;  4H0T B;  5HOO A;  5DM7 L;  1TK8 A;  3R6M A;  3VQB A;  1B9F A;  3A0I X;  1Q18 A;  4YFU A;  3OBW A;  4CZI A;  1GLJ O;  4FWK A;  3QES A;  5BRF A;  1WSF A;  2P9P A;  2V52 B;  4DFK A;  1KTQ A;  1O1W A;  5FRO A;  1VQO N;  4BDY A;  4FCY A;  3HVT A;  5AQW A;  5C24 A;  3VEN A;  4FWP A;  3AA4 A;  4JNE A;  1JXE A;  3L8B A;  3TWH A;  4JKB A;  3AA5 X;  4IOC L;  4ELU A;  1LOT B;  3ATV A;  3K5O A;  4JRQ A;  4R79 A;  4GV6 A;  1IG8 A;  2ZGZ A;  4KHP K;  3RMD A;  1D9F A;  4JK9 A;  1ZBS A;  3L2Q A;  3DMJ A;  3P38 A;  3VEW A;  1VSD A;  2GWK A;  3D2E B;  3AVB A;  5GAG P;  4X66 K;  4KRF A;  4FWO A;  4BC4 A;  4B1Z A;  5LY3 A;  3KK7 A;  4IXC A;  1OH6 A;  1LWF A;  3MMV A;  4CHY A;  1YAG A;  4FWM A;  1JL2 A;  2P9N A;  3SQ0 A;  1U49 A;  3VF4 A;  1Z25 A;  1LW2 A;  4O5B A;  5M1N A;  3CJ1 A;  4FJN A;  3NF6 A;  3ULE A;  4J2B A;  4MDA A;  3FZM A;  2W42 A;  4CD3 A;  4NO7 A;  3PLA A;  4JAX A;  2ZJR L;  3KVG A;  4KB0 A;  2AJQ A;  3H1V X;  4JI5 K;  4KHU A;  4M63 C;  3CER A;  4CFB A;  4WQ4 C;  3C6H A;  4CEB A;  3PV8 A;  2GWJ A;  4A59 A;  3KLE A;  2D0P A;  4JHD B;  1VQP N;  2UUB K;  3B6O A;  2QW9 A;  3JXU A;  3AAR A;  4U67 L;  3TSU A;  3CD6 N;  4GW6 A;  3KK2 A;  1GOC A;  1UA1 A;  1N33 K;  1F21 A;  2OYQ A;  2O8F A;  3SPZ A;  1FK9 A;  3SUP A;  2QM1 A;  5I3U A;  3O3G A;  2YKM A;  5JMV A;  2P9K B;  3R3L A;  5JVH L;  4CF0 A;  4BRI A;  4KTZ A;  3K5N A;  3RR8 A;  1A5W A;  1YUW A;  2BAN A;  1NOY A;  2HVI A;  3IS9 A;  3OS0 A;  4EP4 A;  3WNG A;  5FPN A;  3KWG A;  1RBR A;  5CR4 A;  3IRX A;  1C6V A;  4AF1 A;  4KTW A;  4OJR A;  1Q9X A;  3TSP A;  5LMN K;  3VA0 A;  3GL1 A;  3PX4 A;  4DR5 K;  3HOT A;  4DV7 K;  1JKH A;  3R1X A;  3K5M A;  2CGJ A;  1IV0 A;  2YNH A;  1Q7Y O;  1NJZ A;  4KHS A;  1BHL A;  4F8R A;  5HP1 A;  5AQT A;  5FRM A;  4N41 A;  5E41 A;  3F2K A;  5C0Y A;  3CJB A;  1J54 A;  5C2D A;  4IFY A;  1KAX A;  4OGC A;  3DRR A;  3ZSZ A;  5E26 A;  4HUE A;  4MQ3 A;  2Q2R A;  2P9L A;  4B9S A;  3ZT4 A;  3T69 A;  3VQC A;  1DTT A;  2P9P B;  2E8A A;  3K9J A;  1QZ6 A;  3KWI A;  3ZEU B;  5HLF A;  4H4M A;  4NCA A;  2RKI A;  2IVO A;  3QLH A;  2D5R A;  4B8C A;  3KIO A;  1QVG M;  4DS4 A;  4DQI A;  2G8F A;  4BRM A;  4XIU A;  1HJR A;  3NMU A;  5HRP A;  3K0S A;  2Z1J A;  1RT7 A;  1KD1 O;  3ULD A;  3THW A;  1IO2 A;  2O8D A;  3SUQ A;  4EZ9 A;  3CFR A;  1BWF O;  4B9Q A;  3LAL A;  2Z1H A;  2OZS A;  4Q5V A;  3G0Z A;  3F9M A;  1E4G T;  3IAY A;  2RPI A;  1T6D A;  5C42 A;  1MA9 B;  1JLG A;  1P90 A;  4BR9 A;  3WUH A;  2ZJP L;  1DKG D;  1Y64 A;  2YHY A;  3C95 A;  2GUP A;  5KRS A;  1TV6 A;  4O55 A;  3H3N O;  3U9D A;  2BGG A;  3CFP A;  2VGN A;  2G8U A;  2KFZ A;  3G10 A;  3HYF A;  3J7A P;  4DR6 K;  3UKR B;  4OKJ A;  4B9L A;  1T44 A;  3LDP A;  1HYZ A;  1RGI A;  1NJX A;  3V1O A;  4E19 A;  2E6L A;  3DXK B;  1VQ9 N;  5HRO A;  5AQG A;  1ATR A;  1LAW A;  3NGZ A;  1XC9 A;  3ENO A;  3EKS A;  4ZTF A;  3HPH A;  4ILJ A;  4CHP A;  3OJU A;  3SQ2 A;  4CJQ A;  4WQ5 C;  3A8Y A;  3AY9 A;  1BU6 O;  3DLE A;  3AVN A;  4AH9 A;  3OYL A;  3CIP A;  1WSH A;  1RBS A;  5AR0 A;  1L3U A;  1U2V A;  3KK3 A;  5JIC A;  2RHK A;  2O8C B;  4Z4I A;  3OY9 A;  5AJ3 K;  1X3M A;  3AVI A;  4FK2 A;  1WNS A;  4X65 K;  4B9M A;  2OA8 A;  4CJL A;  5SZT A;  3V6D A;  4RW6 A;  1HR0 K;  1NK4 A;  3EL2 A;  1JJ2 M;  3FZF A;  3W0L A;  3CJ7 A;  3O8M A;  2IGI A;  4DU4 A;  2P9U B;  3EE8 A;  4PWD A;  2QXL A;  1B92 A;  1V4S A;  2P9U A;  2NRH A;  2NRZ A;  2NRT A;  2GV9 A;  3S9H A;  4CES A;  3A2F A;  5AQY A;  2D4W A;  4LD0 A;  4BRP A;  3GG4 A;  3UIQ A;  4F3T A;  1XMQ K;  2O4G A;  4DQR A;  3CQY A;  4RTF D;  4IOA L;  2BTF A;  3M5R A;  1VSI A;  3DLR A;  1HYS A;  5EY4 A;  1ESV A;  4YOT A;  4FLX A;  4DQS A;  2Q97 A;  1EO1 A;  1NMN A;  1UOC A;  1KCF A;  1NGB A;  2OPS A;  4DWI A;  1OH7 A;  4KRE A;  2UYT A;  2QWR A;  3ZX2 A;  2VYP A;  2PY5 A;  4CJK A;  3VET A;  4CIG A;  1L3V A;  3OYI A;  4M3R A;  1D4X A;  4FWS A;  1NK8 A;  4CJ4 A;  4JS5 A;  3OS2 A;  4BRO A;  1C0G A;  2E1Z A;  1TVR A;  2B4J A;  3FZK A;  3JS6 A;  4DSI A;  4JD2 B;  1SAZ A;  4CED A;  4JD2 A;  3D2F B;  4I6M B;  4CGI A;  1YIJ N;  2F8T A;  5AQH A;  3SAH A;  4MLE A;  4AM7 A;  1ASW A;  3JYT A;  2HHT A;  3Q7B A;  3O80 A;  4LC9 B;  2PFU A;  1K8K A;  4AIL C;  1NGC A;  1RNH A;  4F9O A;  1K8K B;  2FSJ A;  3MWT A;  3ZYY X;  4DV5 K;  5GAD P;  4BE1 A;  3NVM A;  3ZSV A;  4FLW A;  1JLQ A;  4M3Y A;  3NVK A;  1BA0 A;  2V7Z A;  1L5U A;  3L2V A;  4CI6 A;  1EX4 A;  3MN9 A;  4IJA A;  4B1X B;  1WSI A;  4JKG B;  1SL0 A;  3QFP A;  2G8W A;  4C1N I;  1T03 A;  4IG3 A;  2WC9 A;  4AHR A;  4TSX A;  5AQS A;  4MO5 A;  3CFO A;  4N5S A;  1IJJ A;  3V9S A;  3NH2 A;  4O44 A;  1KLM A;  3U3G A;  1BO5 O;  3ZLJ A;  3RVC A;  4Z0U A;  4M3U A;  1Q81 O;  5HRN A;  1LAV A;  3ZSW A;  1N32 K;  4KHN A;  4MO4 A;  3MXI A;  5GAH P;  4J8F A;  4WFA L;  3TAB A;  2ZWH A;  3MX2 A;  4XH5 A;  5J1E A;  3RWU A;  3ZSY A;  1HNW K;  4GKK K;  4FLU A;  3A5M C;  4OPH A;  3VQA A;  1X1P A;  3KKS A;  3MWP A;  4ILG B;  2NZT A;  1RTH A;  2QWO A;  5AQO A;  4FW1 A;  4YY3 K;  4B9T A;  2GX9 A;  3HM8 A;  1VQN N;  4CZJ A;  3QEV A;  3SBG A;  3CPW M;  3IFR A;  5AQU A;  5T7B A;  4O8U A;  3SAG A;  1EP4 A;  1IKV A;  3CCM N;  1L3S A;  3UKU B;  2YCH A;  3DXM B;  2YNI A;  2CGK A;  4FXD A;  2JGU A;  4Z94 A;  4UQG A;  1JL1 A;  3HL8 A;  5J2Q A;  3LDL A;  4QOZ B;  2IOC A;  5M1K A;  1CXQ A;  2YHW A;  5DK5 A;  4CGH A;  4M3X A;  2ZGY A;  1J9A A;  4I7F A;  2QA4 N;  2Z1I A;  3U9Z A;  4M3W A;  3P1G A;  1EKE A;  1ZC6 A;  3CG7 A;  2OPQ A;  3VQ7 A;  3I33 A;  3FE1 A;  3ID8 A;  3FZH A;  4Q0B A;  4NLB A;  5BR8 K;  1S1X A;  4B9N A;  1VSJ A;  1XUP O;  1QQM A;  4FVM A;  4BG9 A;  1NJW A;  4BQZ A;  2ZE2 A;  3C6T A;  4BGA A;  4WE1 A;  3NH0 A;  3BEX A;  1XI1 A;  3M8S A;  4B1Y B;  2OPP A;  3R9P A;  4FJ8 A;  3LP3 A;  3DAW A;  1N6Q A;  1TAU A;  3W3D A;  1RDC A;  4IEI A;  3AVJ A;  1B9D A;  2YV0 X;  3U8X A;  3J8A A;  4A5A A;  4EHT A;  4Z4C A;  3SYZ A;  3NHG A;  4DF8 A;  3MN7 A;  2KW4 A;  4BRA A;  4CIF A;  1GLA G;  1S1T A;  3HVR A;  1TK0 A;  1MU2 A;  3OYB A;  5AZJ A;  4W5Q A;  2A6A A;  3OW2 M;  5F0X A;  4Y0W A;  1TYQ A;  4BC5 A;  1JLE A;  3BDP A;  3SUN A;  3ALY A;  3D45 A;  3T3F A;  3DLB A;  1WBD A;  3ATU A;  4AHC A;  4CHO A;  1Y97 A;  1Q82 O;  3DLK A;  3SNN A;  1DLO A;  3HPO A;  5HL7 L;  3VEV A;  4HHT A;  3ZX3 A;  4NXN K;  4DU3 A;  4CZK A;  4AQY K;  4OO1 J;  1FKO A;  5SWM A;  1T8E A;  4CE9 A;  2FSN A;  4ILH A;  4LY7 A;  4B3M K;  3QB0 A;  4V19 S;  3VQ9 A;  4M3T A;  2W40 A;  1T3V A;  2HNY A;  4KHY A;  4JKD A;  1KSP A;  1YJN N;  4M7Y A;  3KLI A;  5AQR A;  1YTU A;  1KAZ A;  3MCA B;  2Z1G A;  3SV3 A;  1BIS A;  3C6A A;  3T19 A;  1NM1 A;  3OJS A;  1CZ9 A;  3K2P A;  3OHR A;  3WEE B;  3KHY A;  3SK3 A;  2QK9 A;  1C1A A;  1VQM N;  3AO3 A;  4FLY A;  1IKW A;  3O1W A;  4CJW A;  5A2Q O;  4CVN E;  1KRP A;  4BWM A;  3JAM O;  3CET A;  3AGK A;  3AVL A;  4CFA A;  4K42 A;  4A61 A;  2HOE A;  1RDB A;  3MN5 A;  2WUS A;  4CF9 A;  1HYV A;  4FPA A;  4YDU C;  4DB3 A;  4FJM A;  2ITM A;  4CF1 A;  5AQJ A;  3THW B;  2O8D B;  4ZTJ A;  4FM2 A;  3AVM A;  4J2A A;  3THY B;  4B3R K;  2GTD A;  4I6M A;  4H0O A;  4NXM K;  3SJJ A;  2E1Y A;  4OPK A;  1T7P A;  3VQQ A;  4IWV A;  4CJ3 A;  2FLO A;  3D6R A;  5K14 A;  1WLJ A;  4CJU A;  2Q31 A;  3T7Z A;  2VQF K;  1U45 A;  1SL1 A;  2VG5 A;  1VQ4 N;  2GUI A;  3FZL A;  1NK6 A;  1NGI A;  3P5J A;  4ID1 A;  3FLC O;  3LPU A;  1GLL O;  2NLX A;  4KB1 A;  3VES A;  1OH8 A;  2OAN A;  4KO0 A;  4JK7 A;  1DT9 A;  2HBJ A;  5AQX A;  1O13 A;  4FJJ A;  3G6E N;  1K9M O;  2I7N A;  3HOS A;  3CI5 A;  3UB5 A;  4YHH K;  3LM9 A;  2WOM A;  4BG8 A;  1BUP A;  3OYH A;  3S3M A;  3WT0 A;  4FLZ A;  5GIP A;  5BPM A;  4DHY A;  3U3Y A;  3SV4 A;  3E1Y A;  3EEQ A;  4DR7 K;  3CHW A;  4E1J A;  3CQX A;  4NYN A;  4H5T A;  4NYF A;  2KKZ A;  3L4Q A;  1JCE A;  2JLE A;  1GLF O;  5BN9 A;  3VQE A;  3LWL A;  3QIP A;  4BAC A;  4FWN A;  5E84 A;  3EYZ A;  2BUP A;  4DV3 K;  3K57 A;  1YHQ N;  1K8A O;  2F7T A;  2VCP A;  3H08 A;  2D0A A;  3AVF A;  3SPY A;  3Q7C A;  3K59 A;  2DFH A;  5FPD A;  2CH5 A;  2J4R A;  3TAR A;  2G8K A;  1W0H A;  1HUX A;  4FZY A;  1S9E A;  4DV1 K;  2NUB A;  1U6Z A;  2ASO A;  4DTU A;  1MWM A;  3HI0 A;  3V81 A;  1U4B A;  4CER A;  3V9X A;  2Q36 A;  2A42 A;  1UA0 A;  3K9K A;  4DTJ A;  2IVP A;  3KJV A;  1XHZ A;  2O8E B;  5LMU K;  3ZT0 A;  4CJR A;  2JWL A;  4I2Q A;  2ZM6 K;  1TKT A;  5ADX A;  3FR0 A;  5JLF A;  3K5L A;  3LP1 A;  2YNG A;  3VMF B;  2CGL A;  2QKB A;  1BCO A;  2UUC K;  3HBT A;  1Q8I A;  4ICL A;  3HJF A;  3AO5 A;  2UXD K;  4JI3 K;  5GAE P;  2BDP A;  2P9I A;  5KPR A;  1M90 O;  3V9Z A;  4CEO A;  4CJT A;  3P31 A;  2E88 A;  2NRX A;  3LDN A;  3VOV A;  1XC3 A;  4ISG A;  3O3F A;  4JKA A;  2W41 A;  3H3O B;  4DFM A;  3V9U A;  3H45 C;  5HRR A;  4H5W A;  4Z4G A;  3ZT3 A;  4WQ4 A;  3VPZ A;  5CYQ A;  5AQM A;  4CK3 A;  5CHI A;  3AAP A;  4BWJ A;  4B1V A;  4CF2 A;  4E7L A;  4WF9 L;  4CD1 A;  4DQ8 A;  4JI6 K;  1NKE A;  3SUO A;  1BIZ A;  3BF3 A;  5EU7 A;  4LF7 K;  3A5O C;  3L2W A;  4IFV A;  1TKD A;  4C8N A;  1NGD A;  2IS3 A;  1K73 O;  4EAH D;  5C15 A;  4I9Q A;  5IT9 O;  1X9J A;  1A5V A;  1OKJ A;  4RW8 A;  3VQ5 A;  4BQL A;  4CF8 A;  2YNF A;  4W5O A;  3TAG A;  1RDW X;  1BQM A;  1T05 A;  1JCG A;  2HBM A;  1QHA A;  3C6U A;  4YOV A;  4FOE A;  3OYG A;  4YOR A;  1D9D A;  3SJH A;  4ZHR A;  3DYA A;  4IG0 A;  3HP6 A;  1QHT A;  4JI1 K;  2E6M A;  4QS8 A;  2DTU A;  1C0T A;  3HXM A;  1RT3 A;  1YTA A;  3EE9 A;  1ASV A;  4K43 A;  1BOT O;  4YDU A;  3CC2 N;  4CZG A;  4FJK A;  1QE1 A;  1ZBU A;  4AM6 A;  3DRS A;  4YNQ A;  4BC3 A;  4BRK A;  1EQY A;  1JXB A;  3OYE A;  4DF4 A;  3M8Q A;  4PHT X;  4GVE A;  1W7A A;  1KVC A;  1SUQ A;  1XHX A;  3NF9 A;  3ZCM A;  4MFB A;  5AQN A;  3VQ8 A;  1SV5 A;  1KFS A;  4JKH A;  4IKF A;  2FXU A;  3D2F A;  4WFN L;  5B8H A;  1S72 N;  1WAJ A;  1NK0 A;  4W5T A;  3HTV A;  4BC2 A;  4FZX C;  3ITH A;  4PKI A;  4LSN A;  2GBZ A;  1NKB A;  2Q0R A;  3AO1 A;  2XY7 A;  5FPE A;  3UKU A;  4NCG A;  4BRC A;  4KTQ A;  4XH4 A;  3HO1 A;  3DXM A;  3PO4 A;  4CJP A;  1Z6R A;  1IKY A;  3LDQ A;  4WCE L;  1Q9Y A;  1ZBL A;  1OVY A;  4BRF A;  1VQ8 N;  1L3T A;  1EWR A;  4JK8 A;  2XHB A;  2YJF A;  4HWI A;  3QO9 A;  4I2P A;  1BG3 A;  1SKW A;  1SZ2 A;  2PBD A;  1G15 A;  1UAX A;  3P83 D;  2HHQ A;  3PUF A;  4FJH A;  4F2R A;  5GIN A;  1ZBI A;  4OKK A;  3ZSR A;  3DRP A;  5LJV A;  3J80 O;  3J7Z O;  4BGB A;  4LF5 K;  3WNH A;  4CEQ A;  2PYL A;  1ATS A;  4DV6 K;  4DQQ A;  1RDA A;  2P51 A;  3IG1 A;  3EZ5 A;  3AVK A;  3BP8 A;  4EHU A;  3O1B A;  1FJG K;  2ZF5 O;  5M1O A;  3TTC A;  1TUY A;  5HBM A;  2OZM A;  1S22 A;  1C0F A;  3S3O A;  2QI2 A;  3MXM A;  3WXJ A;  3RSE A;  2QKK A;  3NF8 A;  2R7Y A;  3FFI A;  2AA4 A;  4H5R A;  3ASM A;  4IDH A;  4O0I A;  4O4G A;  4CIE A;  3CCV N;  4M7X A;  2IDO A;  3CQ8 A;  4EP5 A;  1RBV A;  3MX5 A;  3OYK A;  1BGX T;  4BR5 A;  4B3S K;  3WXM B;  4FSV A;  2D1K A;  5AFU H;  3LP2 A;  3QIC A;  4Y1C A;  1BCM A;  2WBN A;  3TAN A;  4PL8 A;  4XEI A;  1LV5 A;  1ZXO A;  4DSL A;  4AHV A;  5AQK A;  1QSY A;  2QWL A;  3CCQ N;  4DTR A;  2E4L A;  4M42 A;  4F4K A;  4KBO A;  3AGR A;  5AZI A;  3AVC A;  3AVA A;  5AZI B;  4GVM A;  3KD1 E;  2ZQB A;  1BA1 A;  2YHX A;  4JYA K;  4FO0 A;  4JI2 K;  1D8Y A;  2H3G X;  2F9T A;  3D0P A;  3BGR A;  3D2E A;  2HHS A;  4C8O A;  4BE2 A;  1NU0 A;  2P9S A;  3DLH A;  1NGA A;  3ISN C;  1NJY A;  2XO7 A;  4UY8 O;  4C8M A;  5BRH A;  1BL3 A;  2W6K A;  1R0A A;  1NOZ A;  5GIO A;  1YT3 A;  3HPG A;  1RBU A;  3QEP A;  1HMV A;  4DTM A;  4O0J A;  3O3H A;  1S1U A;  1I94 K;  4E1N A;  3C65 A;  4GV3 A;  1ZBH A;  1RT6 A;  2D0B A;  3ID6 A;  2HF3 A;  4Y1D A;  3NCI A;  2HVH A;  3NDK A;  4KH4 A;  4DR2 K;  1JCF A;  4DSK A;  3KKR A;  3KZB A;  5LL6 Z;  1BDG A;  2IIR A;  4FJX A;  4OLA A;  3RRH A;  2YKN A;  4YOX A;  4CZE A;  4RWT A;  3PIO L;  4H5N A;  3ZT2 A;  4DTP A;  3CCL N;  2FF3 B;  2D0O A;  2HNZ A;  2UXC K;  3FGU A;  3CCJ N;  4FJG A;  1QSL A;  1Z26 A;  3CJC A;  2X6S A;  2P9I B;  2A3Z A;  1CZA N;  2HHH K;  2F8S A;  4BVO A;  3CF5 L;  4N47 A;  4AHS A;  1HKB A;  1U04 A;  1HKC A;  4DSF A;  1NGG A;  3T1Y K;  2YHB A;  5F1X A;  3OTO K;  1YF5 L;  2KTQ A;  4E7I A;  1RTJ A;  4FM1 A;  4KKO A;  3BF1 A;  3J81 O;  5MLC Q;  3HZ6 A;  2OTL N;  3QBX A;  4A5B A;  2E2O A;  2HND A;  4BRN A;  4CJ7 A;  4MDB A;  2FF6 A;  1TL1 A;  4FL9 A;  3RSE B;  4E3S A;  1YJ9 N;  4DFP A;  2HF4 A;  3QIO A;  3VF6 A;  3U4L A;  4BRG A;  3N4Q A;  4QS9 A;  5CE3 A;  3KLH A;  2V7Y A;  3NE6 A;  4JV5 K;  5KTQ A;  2KZM A;  4IFE A;  1VSM A;  4FW2 A;  3VA3 A;  1KLN A;  2YI1 A;  2FSK A;  4NB4 A;  2O4I A;  3C0B A;  3V9W A;  2LSN A;  4RW9 A;  1DTQ A;  4H0X B;  2B5J A;  2A5X A;  3VEY A;  3FFK B;  5AQQ A;  5JLH A;  4PL7 A;  1YJW N; 
#chains in the Genus database with same CATH homology
 2VQE K;  1N32 K;  2VQF K;  1IBL K;  4DV0 K;  1N36 K;  1XMQ K;  1HNW K;  4GKK K;  4JI0 K;  1XNR K;  1I94 K;  2UXB K;  1XNQ K;  4DUZ K;  1J5E K;  4LF4 K;  4YY3 K;  4DR4 K;  4DR2 K;  4B3T K;  4JI5 K;  4JI6 K;  4YHH K;  5LL6 Z;  1XMO K;  2UUA K;  3J80 O;  4LF5 K;  2E5L K;  4LF7 K;  4LFC K;  4DV2 K;  4DV6 K;  2UUB K;  4DR7 K;  1IBK K;  4NXN K;  4LF9 K;  2UXC K;  4AQY K;  1FJG K;  4OX9 K;  1N33 K;  3J7A P;  4DR6 K;  4B3M K;  4V19 S;  2HHH K;  2F4V K;  3T1H K;  5IT9 O;  4DV3 K;  1HNX K;  4DR1 K;  4X64 K;  3T1Y K;  3OTO K;  4DR3 K;  4LF8 K;  4JI1 K;  3J81 O;  4DV1 K;  3J7Y P;  4B3S K;  5LMN K;  1N34 K;  4X62 K;  4DV5 K;  4DR5 K;  4LF6 K;  1HNZ K;  5FLX O;  4DV7 K;  4GKJ K;  5A2Q O;  4CVN E;  5BR8 K;  3JAM O;  4JV5 K;  5AJ3 K;  4JI4 K;  4K0K K;  5IWA K;  4LFB K;  5LMU K;  4JI8 K;  4LFA K;  2ZM6 K;  4X65 K;  1IBM K;  4JYA K;  4JI2 K;  4DUY K;  4JI7 K;  1HR0 K;  2UUC K;  4CW7 B;  4B3R K;  4KHP K;  2UU9 K;  4NXM K;  2UXD K;  4JI3 K;  4DV4 K;  4X66 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...