4B3SK

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3sK00
4JI5K 4X66K 1N32K 2UUCK 4JI6K 3J80O 3T1YK 4LFAK 1N36K 1HNXK 4DV0K 4OX9K 4NXNK 4K0KK 4NXMK 4DR5K 1HNZK 4DR6K 4GKJK 4DUYK 1XMQK 3JAMO 2E5LK 4LF4K 5FLXO 4YY3K 4DR2K 3J7YP 4DV7K 4B3RK 4X64K 2HHHK 4V19S 5BR8K 4JV5K 3J81O 5IWAK 5LMNK 1IBLK 2UU9K 2UUBK 4JI2K 5AJ3K 1I94K 4DV5K 4JYAK 4DR1K 4DV2K 4DR7K 4DV6K 4KHPK 5IT9O 4YHHK 4LF8K 4GKKK 4JI1K 4JI4K 3T1HK 4X65K 1N34K 2UXCK 5A2QO 4DR3K 4LFCK 4DV3K 4DR4K 1XMOK 4B3SK 1FJGK 3J7AP 2ZM6K 2F4VK 4JI8K 1XNQK 5LMUK 4DV1K 1IBMK 4JI0K 5LL6Z 4LF5K 4DUZK 4JI7K 1HNWK 2UUAK 1N33K 1XNRK 4DV4K 4B3MK 4LF7K 3OTOK 4CW7B 4LFBK 1J5EK 4LF6K 4B3TK 2UXDK 4X62K 4JI3K 1HR0K 4AQYK 1IBKK 2VQEK 2UXBK 4LF9K 4CVNE 2VQFK
chains in the Genus database with same CATH superfamily
4JAXA 1NJYA 1X9MA 1QSLA 4EZ6A 1NJIO 2O8BA 3E01A 3LP3A 4WFAL 2FBXA 3BDPA 1SKRA 3VGMA 4MFBA 4JRPA 1TKZA 3U9DA 1VK0A 3ZYYX 1U6ZA 3SNNA 1SL1A 2OPPA 1O1WA 1KCFA 3LWMA 1N8RO 1VQLN 4B1VA 5CR4A 1Q9XA 3HRGA 4ZHRA 3O8MA 1Q8IA 4B3RK 5BRDA 1KFDA 1S1WA 3I0SA 4I9QA 3OYEA 4KB1A 3G0ZA 1U2VB 1NGAA 1JCGA 3IDHA 1KSPA 4JYAK 4O8UA 2E20A 4KH4A 5AQOA 4KH6A 5AQVA 4C8NA 1YIJN 1J9AA 1T7PA 3T1HK 4U67L 1REVA 4C23A 3K5NA 3P83D 5C24A 3V1OA 2GX9A 4CZHA 4ISGA 3L2RA 2YNFA 2F7TA 4DQRA 1WSHA 1YVUA 3ZEUA 4DU4A 3KKRA 3L6QA 4O4GA 1KVAA 3AO1A 3CM5A 1RT5A 3K5OA 3QFPA 2Q31A 4I7FA 3CFPA 4O55A 1V4TA 2KFNA 4RW9A 1L3SA 3CC7N 1OVYA 3MEEA 2NRRA 4KTWA 1Q82O 1JLFA 1VQMN 4FLWA 3DLBA 3ISNC 1RBTA 2G8IA 4WFNL 1JKHA 4AHVA 1J53A 3L8BA 2V52B 5BR9A 3D2FA 5C15A 2UXDK 1MWMA 3LP2A 3OS0A 1XWLA 5EOYA 3P39A 1TAUA 5JLHA 2O4IA 1OKJA 2F9WA 2HHUA 5I9EB 4PQUA 4BE0A 5ADXA 3SZ2A 4C8KA 1RT4A 4CZGA 3JXUA 4CIFA 4DQSA 3RRGA 4BRCA 1N36K 2WUSA 3THXB 1W7AA 4CJ4A 1E3MA 5JVHL 5AQPA 1BO5O 4DUYK 4FPAA 4RTFD 3ID8A 1NM1A 2O4GA 2FSNA 5FLXO 3NF9A 3AVAA 4CERA 3SMPA 4DV7K 1BQMA 4LH5A 1WB9A 4M3WA 1NK9A 4E7LA 2HVHA 2X74A 3QIPA 2O8EB 4EP4A 4CZEA 2WTUA 1VQPN 2F8TA 3VGLA 4FJXA 3VENA 1YAGA 3EZ5A 3N4QA 3HSCA 4DF4A 4DV5K 3LL3A 3VQAA 2YHWA 4K8ZA 2YKNA 2D4WA 3NDKA 1VQ7N 4KHNA 4KFBA 1JLCA 3C6TA 5AQFA 4CZJA 3ZEUB 4CJFA 2HHSA 3L3UA 2KQ2A 4OLAA 4IEEA 4WQ5A 4FM2A 3OHRA 1WBBA 4W5TA 3AO2A 3CYMA 2OZSA 2ZF5O 1IO2A 4PKIA 2YNHA 1YF5L 3V6DA 3TAPA 2YKMA 3T69A 4HWIA 4FLXA 3MEDA 3LWLA 3IRXA 3AVFA 4QCLA 4FK0A 3QICA 4YOWA 4DFJA 2HHXA 5CYQA 1YJWN 3QEXA 2RN2A 1GOBA 4H03B 1WSEA 4OKEA 3DM2A 1NMDA 1FXXA 1X9JA 5F1XA 2XY6A 4YDUA 4WQ5C 2P9SB 3IFRA 4BRIA 1X1PA 4FK2A 2YHBA 1G15A 1O13A 5ELZA 5I42A 2QWPA 3F73A 3JSMA 3L4IA 5AQJA 3VF4A 4JEPA 4BRLA 4Z0UA 1A5VA 3K9KA 2E2PA 1U49A 1S1TA 3LZIA 4BREA 1JL1A 3CXCM 3QDKA 1HQUA 3ZSOA 4FLZA 4LF9K 2ASMA 3M8RA 2ZGZA 1EETA 5AQYA 4YDUC 3KD1E 4YOVA 2O8FA 1HYSA 1NGCA 5FRNA 1C0MA 1TYQB 2W40A 1ILYA 3HVTA 2KLAA 3FR0A 1XUPO 5MLCQ 2E8AA 4HTLA 2QXFA 4GMJB 4LF4K 4H4OA 4IWVA 4FZYA 3ZT3A 3LAMA 4F9OA 1R59O 5M1FA 3U8XA 4WE1A 2HNDA 4E1JA 4IFYA 4J2BA 1VQ5N 4H8KA 4M45A 3NFAA 1VSKA 4Z4EA 4WFBL 4BRQA 2HOEA 4IKFA 2OA8A 5GADP 3WNEA 4L3QA 4FJ5A 4LF8K 1EO1A 3ZSWA 2Q2RA 3OYIA 4BE1A 4IBNA 1LWEA 2D1KA 2A5XA 1T3VA 5BPMA 2BUPA 4Z94A 3SI6A 4I6MA 3BUZB 3V1QA 1HUXA 1NGJA 3OYNA 5C25A 2HBMA 3AA4A 5JVGL 1VSMA 1TGOA 3TR8A 4CIEA 4EAHD 2Q3SA 2E2NA 1VSEA 4Z4IA 1TKDA 4LF7K 3QEIA 2PBDA 4F2SA 1ATNA 1OH7A 3KD5E 5BN8A 5AQZA 4LY7A 5M1OA 4DTPA 4CEOA 4B3TK 1R0AA 4JD2A 1Z6RA 4JI3K 4FW1A 4CBUA 3PIPL 2OTJN 2KHOA 3ATVA 4CFDA 2O8DA 3ZLJA 3TTDA 1D5AA 2RPIA 3W0LA 3RR7A 4CEQA 4Z4CA 4GVEA 5M1QA 4FJGA 2O8FB 3LPTA 1VQNN 4BR4A 3ZT1A 2QWRA 5J2NA 3QIOA 3CC2N 1IKXA 3SYZA 3OYBA 2GEMA 1SL2A 3HO1A 5AR0A 1LOTB 4O0IA 4O0JA 2KZMA 3IUCA 4MLHA 1BCOA 3PSFA 4B9SA 1WSIA 1UA1A 3DLEA 1XMQK 4H0TB 4XH1A 2EHGA 3UKUA 5C2FA 1C0UA 3V9SA 2P9IA 5HP1A 4E7JA 2PYLA 5AQQA 1ZBUA 3PO4A 1V4SA 2EWSA 5BN9A 1MDUB 2YI1A 1QHAA 2HHHK 2AA4A 3K9JA 2A1SA 4FJ7A 3Q7CA 3ZX0A 4H4MA 3DRSA 4FO0A 4A62A 2B4JA 3VPZA 3THVA 4JKFA 1NKCA 1C0GA 3BGRA 3NGIA 3OA9A 3JYTA 4HCCA 3J8AA 4FPBA 2P9KA 2NRHA 5DMRA 3KWGA 4CGJA 3FZMA 4JI1K 4JKBA 3L2UA 1GLDG 3GDQA 5EVZA 3ASMA 2Q0UA 4Y1CA 3DJCA 4CEFA 1DTQA 5J2PA 2BANA 3ZSZA 4B8CA 3TABA 5FDLA 5M1PA 1LWFA 4CHYA 5JS1A 3OYDA 1C0TA 4BVPA 3BP8A 4RW8A 2ZJQL 3KLIA 4A5BA 3OYJA 4Y0WA 1C1BA 3AGRA 4BWMA 2DTUA 1H1VA 4DB3A 1VQ9N 1G99A 3ZETB 3S41A 4FVUA 3LM9A 3K59A 4DU3A 4AHCA 3MN7A 2Q36A 1UA0A 2DFFA 1DEJA 1HX1A 3AAQA 2YHAA 1Y64A 4JK9A 1BISA 3THYB 5KTQA 4GV9A 1SQKA 2UXBK 3K0SA 1JLBA 1IKVA 4WQ4A 5JLFA 3AVNA 2B6AA 3V1RA 4CEBA 3P1GA 1X3MA 4JI5K 2WBNA 2G8UA 4K43A 3THWA 3MECA 2CGKA 4CF9A 2XY5A 4DV0K 3AVMA 3H08A 4CBWA 3C6UA 1RTDA 4GKJK 1EKEA 3KKSA 3HTVA 4ISFA 4DSIA 2OPRA 2FBYA 3JAMO 3K2PA 4BRNA 1JXEA 2OCEA 1C6VA 1ASVA 2I5JA 1TK0A 4WQ4C 4DR2K 3DMJA 3ZT4A 4V19S 2IOCA 3TPQA 4DFKA 1XC3A 4J2AA 3L2VA 2O8CA 4KHUA 1EX4A 4H0PA 4EIAA 4ZTJA 3KTQA 1T44A 5LMNK 3RMBA 2FF6A 2P9PB 2KZZA 3O5BA 2CH5A 3T19A 1IJJA 2Q1NA 3HK2A 4BDPA 1KC8O 1S6PA 4H0VB 3UKRA 4JI4K 3EZWA 3QMLA 4BR0A 4X65K 3VQBA 1W9HA 3O6WA 3CG7A 2ZGYA 1CLQA 2HB5A 3QNOA 3VTHA 1LAVA 4B1YB 4E89A 4CGDA 2QK9A 3O4QA 5CY4A 4NCGA 2F4VK 4L8RB 1HYVA 2E88A 4OKJA 2G8VA 4CJWA 1GLFO 4M3XA 4B1ZA 4LF5K 1S22A 4IJAA 1U04A 3G6EN 3SCXA 4QOZB 1DTTA 2R7YA 1U2VA 3CERA 3DXMB 1A5XA 3L2WA 2NRXA 3U3YA 3JS6A 3HVRA 4M3RA 1QZ5A 3VEYA 3HBTA 1FW6A 4CEDA 3VEVA 3QINA 4DQQA 3K5LA 1BIZA 4KI4A 4AHSA 4O5BA 3THWB 4F4KA 1JCEA 1RT2A 4YNQA 1N5YA 4BACA 1YUWA 3DLGA 2RF2A 4NLBA 5CZ1A 4HUFA 3O3GA 3HPGA 4JI6K 3O1BA 5F0XA 4DHYA 3TU5A 1HPZA 3NCIA 3I8BA 2F96A 4FLUA 1RGIA 2XY8A 4NLCA 2G8FA 3CETA 2RE2A 3NVMA 4NCAA 1NGGA 1RNHA 3KK1A 3WXLA 5F2RA 1S9GA 4X64K 5KRTA 4AF1A 2VYPA 3D45A 4DSJA 1ZBIA 4FW2A 3HM8A 1NU0A 1WNSA 2QWNA 1L3VA 3VQ4A 3DLRA 1I94K 4PA1A 3UKRB 2Q97A 3N4PA 2HF3A 1QZ6A 2VGNA 3G4SN 3SQ4A 4B3OA 3DOKA 3C65A 4KHPK 1VSJA 4A59A 1RDBA 3THXA 3A5MC 1GLAG 3QEVA 3LP0A 1NK4A 4CEZA 3VN5A 2GWKA 2YNIA 1BL3A 3SUPA 4BQZA 2FSJA 4OPJA 2QM1A 1A5WA 3SLCA 4FLVA 3VETA 3HOSA 2A40A 3QFUA 4H5RA 2WC9A 1NK6A 4A2BA 3HYFA 1RTHA 5EU7A 1TK8A 4J2EA 1XNQK 1DKGD 2F9TA 2P5OA 2Q0RA 2O8EA 3SJHA 4HVJA 3TSQA 5GIPA 2X6NA 4CZLA 4LC9B 3SQ0A 2D0AA 4C1NK 3VESA 4RW6A 4BDZA 1XHZA 4KV8A 5KI6A 3DLLL 4I2PA 4LFBK 1RTIA 4FM1A 4M63C 4H0OA 4FWMA 3KJVA 3PX4A 3WNHA 4OPKA 4K41A 4FJJA 1HJOA 1HNIA 5AQNA 4M7XA 3CCSN 4AM6A 4CGFA 3O08A 1QQOA 4A61A 5JMVA 1JL2A 2IIRA 3VMFB 3DLHA 4B9TA 4N76A 1D4XA 3V9ZA 1T6DA 2QWOA 3T1YK 3VQ8A 3T3FA 2OYQA 4KB0A 1ITGA 4BR5A 1HNXK 4OX9K 4GNIA 4CHQA 2P9SA 1X9WA 2V7ZA 3CHWA 4FK4A 1YVNA 3PSIA 4YOXA 3DXKA 5KPZA 3LDPA 2V7YA 3O3FA 5E84A 4Q5VA 4M3YA 1X3NA 1UAXA 3A8YA 5B8HA 1RT3A 2W41A 5E26A 4BRHA 2IDOA 1UWBA 1DLOA 1KVBA 4BC3A 2P9LB 5E41A 4LD0A 4AH9A 1BA1A 4JI2K 1JLEA 3HPHA 1U47A 4PHTX 2Z1HA 4O44A 5KRSA 1WOQA 4BRMA 4CCHA 1SS6A 1RBVA 3AAPA 3AVCA 5C10A 3R9PA 1D8YA 1TYQA 2P9NA 4ZTFA 3P31A 1NOZA 3ULEB 1ZBHA 4OKKA 4MDBA 4BQLA 1SKSA 1KRPA 5C0YA 2DFEA 4GVMA 3CQ8A 1EWQA 2QW9A 2IAJA 4K42A 1UOCA 5C2DA 1U4BA 1ATRA 4QAGA 1VQ8N 1HPMA 4DQPA 1IBMK 3ZSQA 3C7NB 3VERA 4JKDA 3M6GA 4FJLA 1QS4A 2FC0A 3EN9A 4RG8A 1B9DA 4CJLA 4BROA 1S1XA 2FSKA 3LDNA 3GE1A 4JK8A 1T8EA 3CF5L 3PY8A 1C1CA 2DPNA 3G71N 4N56A 4XEIA 4CD1A 3EKSA 3AARA 3FLCO 2OTLN 4CHPA 4DTXA 3OY9A 3I56N 4LSLA 2W6KA 3SAHA 1W2BM 5J2MA 4BR7A 3I33A 3I55N 2QKKA 1WLJA 1E4GT 4X66K 2P5GA 1OVQA 2UUCK 4PY5A 5LY3A 3RMDA 2ZD1A 2NLXA 4BR9A 4LSNA 3DXKB 4DR5K 3K58A 1CXUA 4JHDB 1S9EA 3BF1A 3QO9A 2BE2A 4N5SA 4F3TA 5HRPA 1WUAA 3TAMA 1X9SA 1RDCA 4DTOA 4GV3A 4JV5K 5T7BA 3U3GA 1GLJO 2CGLA 3AVLA 4U7BA 5SZTA 4BC4A 1BCMA 3TARA 1ZYQA 4F8RA 5AQGA 3MN5A 4CFBA 1RFQA 2P9NB 4QS8A 1YI2N 3WUHA 2AP1A 4IOAL 1EQYA 2PAVA 1K8AO 3CPWM 4CK1A 5D3GA 2VCPA 2D0CA 3LZJA 1RBRA 3VQ5A 4B08A 3SPZA 3KLFA 2HHTA 1XMOK 2WOMA 5AQRA 3A0IX 2ZJRL 4CI6A 1RDWX 4KKOA 1WAFA 1WSFA 3GL1A 3KK2A 4JI0K 3MWPA 3PX6A 4N41A 3MCAB 4FL9A 1Q7YO 1N33K 4PWDA 1NGEA 2HHWA 5I3UA 3B8AX 3OVNA 2CGJA 4IG0A 4M7YA 4CEEA 3OTOK 1IKYA 4NB4A 5FROA 4J8FA 3FZFA 3MX2A 4IFVA 2GUPA 3H45C 3CQXA 4CJSA 1QVFM 3EO3A 2AJQA 3SAGA 5KQDA 1TL1A 3GOIA 3J7ZO 1SUQA 4H5VA 5KGXA 3H3OB 3G10A 5H1SQ 3RMCA 3AVJA 5AQKA 4CESA 1ESVA 2FF3B 4UY8O 2IVOA 1KAZA 3R6MA 4GY2B 5AQSA 3CCJN 2ZJPL 1T6CA 2JWLA 1NGHA 3DYAA 2JWKA 3PLAA 3ZETA 5HLFA 4AHRA 1YITN 3FGUA 3P4IA 3T1AA 4C8MA 1CXQA 4ICLA 2E5LK 3LM2A 4YFUA 4CJQA 3KZBA 3O4NA 2Z1GA 3IMXA 3THYA 5TKWA 4CE9A 5IWAK 1JCFA 2PZSA 2FBVA 4BWJA 4FYDA 3EE8A 4DLGA 1RBSA 2NRTA 3AA5X 3AVHA 4BG8A 3VF6A 5AJ3K 4HUGA 1C1AA 3MDQA 2OZMA 1KLMA 3ATUA 4DR1K 1KLNA 2FLOA 3SBTA 5AZIB 4C8OA 4M3TA 4FWRA 1RDAA 1J54A 4DWIA 3P38A 4DQ8A 1JLQA 3KK3A 1M90O 4B1WB 1NMNA 3M1FA 4DS5A 4DV3K 4B9VA 4MO5A 2GELA 1NJXA 3AVBA 2IGIA 1IKWA 4EHUA 3PX0A 2YJEA 2D0OA 3AO3A 2NNWA 2OPSA 3O9SA 3HJFA 1T03A 3E9OA 1S5JA 3VA3A 3QETA 2UUAK 1VQ4N 4FZZA 2P9PA 4G1QA 3L2QA 5AZJB 5HROA 4B3MK 1NKEA 1JJ2M 4CW7B 4BRGA 4CBXA 1NK5A 4CK2A 2NRVA 3G25A 5C42A 3OS2A 1J5EK 2NZTA 1BU6O 4M3UA 1J6ZA 4CF2A 1HR0K 4A57A 2GUIA 4KTQA 4JKCA 1JLAA 4YOYA 1WAJA 3QEWA 2Z1IA 3CIPA 5M1NA 4KTZA 1JLGA 3LP1A 5BRFA 4K0KK 4NXMK 1NNEA 3DXMA 4DR6K 1RILA 4B9QA 4O5FA 3SQ2A 1SAZA 3O80A 3RMAA 4OJRA 1BGXT 3EKUA 1WN7A 3MK6A 3MMVA 1E4FT 3SK3A 1NOYA 5EX5A 4CHOA 2GTDA 4M41A 2ETJA 3ULDA 1QSYA 1ZBSA 3J81O 1BIUA 3OBWA 2Y1JA 1D9FA 1L3UA 1TUUA 3MXJA 1BOTO 5HRRA 3QBXA 2QTDA 3KWIA 3PUFA 3AVKA 4DFPA 4M3ZA 5CHIA 3D0PA 4DV6K 3PV8A 1YXQA 3RRHA 5AQWA 1N34K 1HMVA 3E66A 3ZSVA 2YX6A 3RSEB 5FRMA 4FJ8A 4ILJA 3NF8A 3QESA 3CM6A 5KPTA 4EP5A 5AQTA 3E9LA 1HYZA 3MCPA 2QI2A 3Q7BA 4FJHA 3H46O 4CF1A 2E1ZA 4CD3A 3VA0A 4FCYA 1VQKN 3ALYA 1RDDA 4KBOA 3CFRA 4JKGA 3CJAA 5FPMA 1Q18A 5CZ2A 2D0BA 1BWFO 3GBTA 4W5OA 2D0PA 1RTJA 1LW2A 2NUBA 4JK7A 3C0BA 1MU2A 3GG4A 3I0RA 4YOUA 1IBKK 1ZC6A 5SWMA 3OYLA 4F3OA 4W5QA 4Y1DA 1TKTA 5TKYA 1YT3A 1LCUA 3OBYA 4DSEA 5BR8K 3NHGA 3QNNA 4DTRA 2YJFA 1VHXA 4CGGA 3K57A 1Q86O 3UB5A 1KVCA 4CF0A 2E4LA 3L0QA 4CJVA 4NXNK 1L3TA 4OGEA 3WNGA 1HQEA 3TTFA 3S3OA 3OW2M 2ZQBA 4DMNA 1CZ9A 4DTJA 1IV0A 4NO7A 4KO0A 1TVRA 3BZCA 1MWKA 4BG9A 4KHSA 4GW6A 5BPNA 5ADXH 3OYMA 4CHZA 4NCBA 3LANA 3F5TA 3R8EA 4RW4A 2UUBK 1BI4A 3KHYA 3TAQA 2BH1A 4DV2K 4DKWA 1EWRA 4H5WA 4FJKA 1T05A 2I7NA 2VGMA 3CMAN 3TI0A 2FBTA 4DTUA 3QB0A 3TTCA 3VQPA 5BRHA 1XHXA 3RWUA 4DR3K 2P51A 3SUNA 2V51B 4FJMA 1GLLO 2HBLA 4CZMA 3NF7A 4KHYA 3S3NA 4FLYA 4KPYA 4I2QA 3WXIA 3J7AP 2NRZA 1QQMA 1OH8A 1VSHA 1ASWA 3FFKB 1U48A 1LW0A 2WONA 3T7ZA 2A1RA 2QWLA 4BRDA 4JKGB 4AHUA 2IS3A 3WQUA 4IZ9A 3PO5A 3OJUA 2P9LA 5FPDA 3SUOA 1NK0A 4KREA 3L3VA 1GLEG 1KTQA 3UIQA 2G8WA 2HMIA 4CJEA 2B5JA 5K14A 4FOEA 1P8ZA 3KK7A 5HL7L 4E7KA 3ENHA 3DRPA 1GOAA 2PY5A 2A6AA 3R1XA 4YOTA 4JS5A 1NGFA 1KAYA 3ULEA 2P9UA 3WNFA 3SPYA 3FZKA 1BQNA 5KQ8A 4IEIA 4DLEA 3HM9A 3KIOA 5J2QA 4MDAA 4DS4A 4E19A 2A42A 1GLBG 3EE9A 3C7NA 2NRWA 4FWNA 5DM7L 4UQGA 4LFAK 4FJNA 2E6LA 1WSGA 5C12A 3NGYA 4XIUA 1NJWA 1DT9A 3C95A 4G9ZA 5AQUA 2JGUA 4H5TA 1S1VA 1Z25A 1NLVA 1EP4A 3TAEA 4MLEA 4TSXA 4BRKA 1BI4B 3J7YP 4Z4GA 4DTMA 2BGGA 1K6YA 2HHQA 3CCRN 3B6OA 3LALA 4OO1J 3NVKA 4WF9L 4XH5A 4RCHA 4BC5A 2PFUA 4DSLA 1VSLA 4CHNA 2HNZA 2DY4A 3SAFA 3E1YA 4YORA 3QLHA 2X6SA 3AV9A 3AA2A 3HXMA 5LJVA 3WEEA 3WXKA 2XO7A 3WXMB 2ASOA 3BEXA 4JHDA 4Z4HA 2ASPA 2JLEA 4ELTA 3D7EO 4WCEL 4ILGB 4IXCA 4DF8A 3IG1A 4NYFA 2KKZA 3O4WA 4OPAA 4JRQA 1OH5A 4MO4A 3ZSRA 5DM6L 3W3DA 3OS1A 2O8BB 1ATSA 4E7IA 4F2RA 3CJCA 1FK9A 4DSFA 3BZKA 4LH4A 4DUZK 4JI7K 5HRNA 3OYAA 1NGIA 5AFUA 4AILC 4W5RA 4K8XA 1B9FA 2QEXN 4OVLA 3QBWA 2P9UB 3AO4A 4KRFA 2QKBA 3KVGA 1BHLA 3O9UA 1QQCA 2VG6A 2E1YA 2W42A 2BTFA 2IC3A 5JS2A 3MX5A 2HW3A 4AQYK 3CCEN 3ZSXA 2VQEK 2KW4A 5DK5A 2F8SA 1S6QA 4FWLA 4CVNE 3I8DA 1KFSA 1YJ9N 4WYBA 1LAWA 2VWJA 1NWKA 4CEAA 3J80O 3NF6A 1LWCA 3AA3A 5EY4A 3CJ7A 4BE2A 4RWTA 3NGZA 1FKPA 3KLHA 4CJ5A 1VSIA 2VWBA 3BF3A 4BR2A 1I3AA 1D9DA 2KTQA 1Z05A 1HLUA 2HBKA 4NYNA 1BA0A 3NH2A 4A5AA 1ASUA 4IO9L 2VG5A 4CFAA 1QHTA 2ATQA 3WT0A 1K73O 4DCHA 1VQ6N 3WEEB 2VG7A 3P5JA 3IS9A 3CCQN 3TWHA 3V81A 2ZE2A 4EZ9A 1P90A 3L4QA 3U6FA 2ZWHA 3WXJA 3VQDA 4IDHA 3D2FB 3NMUA 2FXUA 2UXCK 1KXPA 4FOIA 4DTNA 4LFCK 2HHVA 3TANA 4FM0A 3D2EA 3M8QA 5BPLA 3CFOA 4CJKA 4OLBA 1NK8A 2QWMA 3ENOA 3S9HA 1NG9A 2BDPA 4B9MA 1Z26A 5LJWA 4QS7A 2QWQA 5LMUK 2X78A 5BREA 3OJSA 1HNWK 1K9MO 3ZT2A 1TUYA 2XY7A 1TAQA 2J4RA 4BGAA 4FJIA 4E7HA 4W5NA 5AZIA 4J2DA 3SUQA 3OYHA 4AHTA 4BY9C 2GV9A 1C0FA 4IFEA 2OPQA 4X62K 2QA4N 3IAYA 1SZ2A 3SBGA 3ZX2A 1W97L 1K8KA 3ZSYA 3SMSA 3MN9A 3VQ9A 4CIGA 3HPOA 4E1MA 4ISEA 3ZX3A 4FWOA 2LSNA 5KPRA 4MQ3A 4CZFA 5AZJA 1YJNN 1HNZK 1J5OA 2GBZA 4RW7A 4FWSA 2OANA 4HTUA 4Z4FA 3VQEA 5KGWA 3S3MA 1VQON 4KH5A 2E6MA 5GINA 4QS9A 4ID1A 4YY3K 3FZLA 1GOCA 3LAKA 4A2AA 4H0YB 2A3ZA 3CJ1A 2PYJA 2RHKA 3UE5A 5GIOA 1JXBA 1CZBA 1Y97A 4BC2A 4IG3A 5GAEP 3CCUN 3NE6A 4CJUA 4CGHA 1ZBLA 1SKWA 3OYGA 3O9QA 1RT6A 3D2EB 1WBDA 3TSPA 1B92A 3FZHA 3C6HA 1U45A 3EY1A 1IG8A 2RKIA 3A2FA 4FWQA 4BRPA 5A2QO 3QEPA 3H1VX 1S3XA 1YTUA 3FFIA 3CPEA 2HF4A 3OYKA 1FJGK 3PIOL 1OH6A 4PKHA 4HHTA 1VSDA 2EX3A 3AO5A 1YTAA 4EFHA 2E2OA 3VEXA 3VGKA 4DSKA 4DV1K 3QERA 3RVCA 2P1JA 4E3SA 1RCHA 5AQIA 3CI5A 1HKCA 4FXDA 1ZBFA 1YHQN 4E1NA 1M1KO 1SV5A 3VQ7A 2YV0X 4OGCA 5M1KA 3SJJA 2YHXA 3ID6A 3CCVN 4PL8A 4I9LA 5GAHP 1VRTA 1TV6A 3O9RA 1RT1A 3A5LC 3VEOA 3SQ1A 1K8KB 3HOTA 4B1UB 4B9LA 3F9KA 4KI6A 3HI0A 3E9PA 2GWJA 3R3LA 4PKGA 4JKHA 1QSSA 2HMPA 3RSEA 1DGKN 4IOXA 3DRRA 2HVIA 2G8HA 4M42A 3MN6A 2CH6A 4C8LA 1S1UA 3KLGA 2VQFK 4FZXC 2IVPA 5HOOA 4FSVA 1LV5A 3SV3A 4CZIA 5JICA 4ELUA 4O8KA 2ITGA 3WQTA 4JS4A 1VRUA 4B9UA 3LDLA 4CJ3A 1QE1A 4CECA 4DG1A 1NKBA 3V9WA 2QXLA 4BGBA 4HCBA 2I7PA 1BUPA 2UYTA 3V9UA 3VF2A 3LDQA 1TKXA 3MAQA 3CC4N 2DFHA 5J1EA 4H0XB 3SV4A 4BDYA 4I6MB 3LDOA 3VEZA 1NBWA 1BDGA 2IVNA 4E0DA 3RTVA 1MA9B 3HP9A 3H3NO 3HSTB 1IBLK 3HT3A 3OYFA 2ITMA 1N6QA 1W0HA 1XQSC 4R79A 4FLTA 3MXIA 4FVMA 3VQQA 3V9XA 3KLEA 3M8SA 4DR7K 3O3HA 3ZCMA 4CFCA 3F9MA 3U9ZA 5IT9O 3AVIA 4YHHK 3NBPA 3VQ6A 1S72N 1L5UA 1Q81O 4ID5A 4JD2B 4BRFA 3TAGA 2O8DB 1IG9A 4JNEA 3DWLA 4JKAA 3C6AA 4N47A 2HSTA 1VSFA 4B3SK 3O1WA 3F2KA 3LDSA 4IOCL 4JLHA 1XI1A 3NH0A 4CJTA 1FKOA 3DI6A 4BRAA 3BY5A 4B1XB 4C1NI 4BVOA 3DAWA 2VWKA 3VOVA 3M8PA 4HUEA 3M5RA 5FPEA 1F21A 3U4LA 1HKGA 3UKUB 2P9IB 4IJNA 3TSUA 5GAGP 3B6PA 1RT7A 3IKMA 3NH1A 3TAFA 4JN4A 1CZAN 3DOLA 4B8AB 4LF6K 4KHWA 3A5OC 4CGIA 1WSJA 2XHBA 3DLKA 3MEGA 5CYMA 3AGKA 5AQHA 4DTSA 3CCLN 1NGDA 1VAZA 2H3GX 1N32K 4JKEA 4DQIA 3H6EA 3M3ZA 3CJ9A 2G8KA 4FWKA 3CMEN 4KHQA 3D6RA 5AQMA 2P9KB 4ILHA 2YNGA 5HBMA 3ZT0A 3EEQA 2W6LA 5EXWA 2HNYA 1NK7A 4ELVA 2KFZA 4GV6A 5CE3A 3VEWA 3ITHA 3LPUA 4DU1A 3CD6N 3O9TA 4CZKA 3CJBA 2E2QA 3HL8A 5HRSA 2YHYA 4CJPA 1QVGM 1HRHA 2UU9K 1QQNA 1ZXOA 3EL2A 3FE1A 4H5NA 1QTMA 4CJ7A 1KQSM 1BG3A 2Y1IA 4FJ9A 4AM7A 4CJRA 1KD1O 2HBJA 4OPHA 4K25A 1TK5A 3CCMN 3VQCA 3NAEA 4GKKK 3EYZA 2A41A 4PUOA 3CQYA 4DR4K 3V4IA 5AQLA 1HNVA 1RBUA 2WFBA 3OYCA 1HJRA 2XRIA 2ZM6K 4CK3A 3AY9A 4B9NA 4JI8K 3MXMA 1SL0A 4XH4A 1KAXA 1HKBA 5LL6Z 3H1QA 4R5PA 1NJZA 3AVGA 4EHTA 4IDKA 1EXQA 1GLCG 1XNRK 3A5NC 1Q9YA 4DV4K 5AQXA 1IH7A 1TL3A 5AFUH 1XC9A 3HP6A 4FWPA 3HZ6A 1I39A 4PL7A 3RR8A 3ENBA 3K5MA 2Z1JA 3C94A 2D5RA 4CF8A 1NGBA 4Q0BA 1RDUA 5FPNA 3MWTA 4KAZA 3VTIA 2YCHA 2O8CB 4DFMA 4IO8A
chains in the Genus database with same CATH topology
4JI5K 4X66K 1N32K 2UUCK 4JI6K 3J80O 3T1YK 4LFAK 1N36K 1HNXK 4DV0K 4OX9K 4NXNK 4K0KK 4NXMK 4DR5K 1HNZK 4DR6K 4GKJK 4DUYK 1XMQK 3JAMO 2E5LK 4LF4K 5FLXO 4YY3K 4DR2K 3J7YP 4DV7K 4B3RK 4X64K 2HHHK 4V19S 5BR8K 4JV5K 3J81O 5IWAK 5LMNK 1IBLK 2UU9K 2UUBK 4JI2K 5AJ3K 1I94K 4DV5K 4JYAK 4DR1K 4DV2K 4DR7K 4DV6K 4KHPK 5IT9O 4YHHK 4LF8K 4GKKK 4JI1K 4JI4K 3T1HK 4X65K 1N34K 2UXCK 5A2QO 4DR3K 4LFCK 4DV3K 4DR4K 1XMOK 4B3SK 1FJGK 3J7AP 2ZM6K 2F4VK 4JI8K 1XNQK 5LMUK 4DV1K 1IBMK 4JI0K 5LL6Z 4LF5K 4DUZK 4JI7K 1HNWK 2UUAK 1N33K 1XNRK 4DV4K 4B3MK 4LF7K 3OTOK 4CW7B 4LFBK 1J5EK 4LF6K 4B3TK 2UXDK 4X62K 4JI3K 1HR0K 4AQYK 1IBKK 2VQEK 2UXBK 4LF9K 4CVNE 2VQFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  4X66 K;  1N32 K;  2UUC K;  4JI6 K;  3J80 O;  3T1Y K;  4LFA K;  1N36 K;  1HNX K;  4DV0 K;  4OX9 K;  4NXN K;  4K0K K;  4NXM K;  4DR5 K;  1HNZ K;  4DR6 K;  4GKJ K;  4DUY K;  1XMQ K;  3JAM O;  2E5L K;  4LF4 K;  5FLX O;  4YY3 K;  4DR2 K;  3J7Y P;  4DV7 K;  4B3R K;  4X64 K;  2HHH K;  4V19 S;  5BR8 K;  4JV5 K;  3J81 O;  5IWA K;  5LMN K;  1IBL K;  2UU9 K;  2UUB K;  4JI2 K;  5AJ3 K;  1I94 K;  4DV5 K;  4JYA K;  4DR1 K;  4DV2 K;  4DR7 K;  4DV6 K;  4KHP K;  5IT9 O;  4YHH K;  4LF8 K;  4GKK K;  4JI1 K;  4JI4 K;  3T1H K;  4X65 K;  1N34 K;  2UXC K;  5A2Q O;  4DR3 K;  4LFC K;  4DV3 K;  4DR4 K;  1XMO K;  4B3S K;  1FJG K;  3J7A P;  2ZM6 K;  2F4V K;  4JI8 K;  1XNQ K;  5LMU K;  4DV1 K;  1IBM K;  4JI0 K;  5LL6 Z;  4LF5 K;  4DUZ K;  4JI7 K;  1HNW K;  2UUA K;  1N33 K;  1XNR K;  4DV4 K;  4B3M K;  4LF7 K;  3OTO K;  4CW7 B;  4LFB K;  1J5E K;  4LF6 K;  4B3T K;  2UXD K;  4X62 K;  4JI3 K;  1HR0 K;  4AQY K;  1IBK K;  2VQE K;  2UXB K;  4LF9 K;  4CVN E;  2VQF K; 
#chains in the Genus database with same CATH topology
 4JAX A;  1NJY A;  1X9M A;  1QSL A;  4EZ6 A;  1NJI O;  2O8B A;  3E01 A;  3LP3 A;  4WFA L;  2FBX A;  3BDP A;  1SKR A;  3VGM A;  4MFB A;  4JRP A;  1TKZ A;  3U9D A;  1VK0 A;  3ZYY X;  1U6Z A;  3SNN A;  1SL1 A;  2OPP A;  1O1W A;  1KCF A;  3LWM A;  1N8R O;  1VQL N;  4B1V A;  5CR4 A;  1Q9X A;  3HRG A;  4ZHR A;  3O8M A;  1Q8I A;  4B3R K;  5BRD A;  1KFD A;  1S1W A;  3I0S A;  4I9Q A;  3OYE A;  4KB1 A;  3G0Z A;  1U2V B;  1NGA A;  1JCG A;  3IDH A;  1KSP A;  4JYA K;  4O8U A;  2E20 A;  4KH4 A;  5AQO A;  4KH6 A;  5AQV A;  4C8N A;  1YIJ N;  1J9A A;  1T7P A;  3T1H K;  4U67 L;  1REV A;  4C23 A;  3K5N A;  3P83 D;  5C24 A;  3V1O A;  2GX9 A;  4CZH A;  4ISG A;  3L2R A;  2YNF A;  2F7T A;  4DQR A;  1WSH A;  1YVU A;  3ZEU A;  4DU4 A;  3KKR A;  3L6Q A;  4O4G A;  1KVA A;  3AO1 A;  3CM5 A;  1RT5 A;  3K5O A;  3QFP A;  2Q31 A;  4I7F A;  3CFP A;  4O55 A;  1V4T A;  2KFN A;  4RW9 A;  1L3S A;  3CC7 N;  1OVY A;  3MEE A;  2NRR A;  4KTW A;  1Q82 O;  1JLF A;  1VQM N;  4FLW A;  3DLB A;  3ISN C;  1RBT A;  2G8I A;  4WFN L;  1JKH A;  4AHV A;  1J53 A;  3L8B A;  2V52 B;  5BR9 A;  3D2F A;  5C15 A;  2UXD K;  1MWM A;  3LP2 A;  3OS0 A;  1XWL A;  5EOY A;  3P39 A;  1TAU A;  5JLH A;  2O4I A;  1OKJ A;  2F9W A;  2HHU A;  5I9E B;  4PQU A;  4BE0 A;  5ADX A;  3SZ2 A;  4C8K A;  1RT4 A;  4CZG A;  3JXU A;  4CIF A;  4DQS A;  3RRG A;  4BRC A;  1N36 K;  2WUS A;  3THX B;  1W7A A;  4CJ4 A;  1E3M A;  5JVH L;  5AQP A;  1BO5 O;  4DUY K;  4FPA A;  4RTF D;  3ID8 A;  1NM1 A;  2O4G A;  2FSN A;  5FLX O;  3NF9 A;  3AVA A;  4CER A;  3SMP A;  4DV7 K;  1BQM A;  4LH5 A;  1WB9 A;  4M3W A;  1NK9 A;  4E7L A;  2HVH A;  2X74 A;  3QIP A;  2O8E B;  4EP4 A;  4CZE A;  2WTU A;  1VQP N;  2F8T A;  3VGL A;  4FJX A;  3VEN A;  1YAG A;  3EZ5 A;  3N4Q A;  3HSC A;  4DF4 A;  4DV5 K;  3LL3 A;  3VQA A;  2YHW A;  4K8Z A;  2YKN A;  2D4W A;  3NDK A;  1VQ7 N;  4KHN A;  4KFB A;  1JLC A;  3C6T A;  5AQF A;  4CZJ A;  3ZEU B;  4CJF A;  2HHS A;  3L3U A;  2KQ2 A;  4OLA A;  4IEE A;  4WQ5 A;  4FM2 A;  3OHR A;  1WBB A;  4W5T A;  3AO2 A;  3CYM A;  2OZS A;  2ZF5 O;  1IO2 A;  4PKI A;  2YNH A;  1YF5 L;  3V6D A;  3TAP A;  2YKM A;  3T69 A;  4HWI A;  4FLX A;  3MED A;  3LWL A;  3IRX A;  3AVF A;  4QCL A;  4FK0 A;  3QIC A;  4YOW A;  4DFJ A;  2HHX A;  5CYQ A;  1YJW N;  3QEX A;  2RN2 A;  1GOB A;  4H03 B;  1WSE A;  4OKE A;  3DM2 A;  1NMD A;  1FXX A;  1X9J A;  5F1X A;  2XY6 A;  4YDU A;  4WQ5 C;  2P9S B;  3IFR A;  4BRI A;  1X1P A;  4FK2 A;  2YHB A;  1G15 A;  1O13 A;  5ELZ A;  5I42 A;  2QWP A;  3F73 A;  3JSM A;  3L4I A;  5AQJ A;  3VF4 A;  4JEP A;  4BRL A;  4Z0U A;  1A5V A;  3K9K A;  2E2P A;  1U49 A;  1S1T A;  3LZI A;  4BRE A;  1JL1 A;  3CXC M;  3QDK A;  1HQU A;  3ZSO A;  4FLZ A;  4LF9 K;  2ASM A;  3M8R A;  2ZGZ A;  1EET A;  5AQY A;  4YDU C;  3KD1 E;  4YOV A;  2O8F A;  1HYS A;  1NGC A;  5FRN A;  1C0M A;  1TYQ B;  2W40 A;  1ILY A;  3HVT A;  2KLA A;  3FR0 A;  1XUP O;  5MLC Q;  2E8A A;  4HTL A;  2QXF A;  4GMJ B;  4LF4 K;  4H4O A;  4IWV A;  4FZY A;  3ZT3 A;  3LAM A;  4F9O A;  1R59 O;  5M1F A;  3U8X A;  4WE1 A;  2HND A;  4E1J A;  4IFY A;  4J2B A;  1VQ5 N;  4H8K A;  4M45 A;  3NFA A;  1VSK A;  4Z4E A;  4WFB L;  4BRQ A;  2HOE A;  4IKF A;  2OA8 A;  5GAD P;  3WNE A;  4L3Q A;  4FJ5 A;  4LF8 K;  1EO1 A;  3ZSW A;  2Q2R A;  3OYI A;  4BE1 A;  4IBN A;  1LWE A;  2D1K A;  2A5X A;  1T3V A;  5BPM A;  2BUP A;  4Z94 A;  3SI6 A;  4I6M A;  3BUZ B;  3V1Q A;  1HUX A;  1NGJ A;  3OYN A;  5C25 A;  2HBM A;  3AA4 A;  5JVG L;  1VSM A;  1TGO A;  3TR8 A;  4CIE A;  4EAH D;  2Q3S A;  2E2N A;  1VSE A;  4Z4I A;  1TKD A;  4LF7 K;  3QEI A;  2PBD A;  4F2S A;  1ATN A;  1OH7 A;  3KD5 E;  5BN8 A;  5AQZ A;  4LY7 A;  5M1O A;  4DTP A;  4CEO A;  4B3T K;  1R0A A;  4JD2 A;  1Z6R A;  4JI3 K;  4FW1 A;  4CBU A;  3PIP L;  2OTJ N;  2KHO A;  3ATV A;  4CFD A;  2O8D A;  3ZLJ A;  3TTD A;  1D5A A;  2RPI A;  3W0L A;  3RR7 A;  4CEQ A;  4Z4C A;  4GVE A;  5M1Q A;  4FJG A;  2O8F B;  3LPT A;  1VQN N;  4BR4 A;  3ZT1 A;  2QWR A;  5J2N A;  3QIO A;  3CC2 N;  1IKX A;  3SYZ A;  3OYB A;  2GEM A;  1SL2 A;  3HO1 A;  5AR0 A;  1LOT B;  4O0I A;  4O0J A;  2KZM A;  3IUC A;  4MLH A;  1BCO A;  3PSF A;  4B9S A;  1WSI A;  1UA1 A;  3DLE A;  1XMQ K;  4H0T B;  4XH1 A;  2EHG A;  3UKU A;  5C2F A;  1C0U A;  3V9S A;  2P9I A;  5HP1 A;  4E7J A;  2PYL A;  5AQQ A;  1ZBU A;  3PO4 A;  1V4S A;  2EWS A;  5BN9 A;  1MDU B;  2YI1 A;  1QHA A;  2HHH K;  2AA4 A;  3K9J A;  2A1S A;  4FJ7 A;  3Q7C A;  3ZX0 A;  4H4M A;  3DRS A;  4FO0 A;  4A62 A;  2B4J A;  3VPZ A;  3THV A;  4JKF A;  1NKC A;  1C0G A;  3BGR A;  3NGI A;  3OA9 A;  3JYT A;  4HCC A;  3J8A A;  4FPB A;  2P9K A;  2NRH A;  5DMR A;  3KWG A;  4CGJ A;  3FZM A;  4JI1 K;  4JKB A;  3L2U A;  1GLD G;  3GDQ A;  5EVZ A;  3ASM A;  2Q0U A;  4Y1C A;  3DJC A;  4CEF A;  1DTQ A;  5J2P A;  2BAN A;  3ZSZ A;  4B8C A;  3TAB A;  5FDL A;  5M1P A;  1LWF A;  4CHY A;  5JS1 A;  3OYD A;  1C0T A;  4BVP A;  3BP8 A;  4RW8 A;  2ZJQ L;  3KLI A;  4A5B A;  3OYJ A;  4Y0W A;  1C1B A;  3AGR A;  4BWM A;  2DTU A;  1H1V A;  4DB3 A;  1VQ9 N;  1G99 A;  3ZET B;  3S41 A;  4FVU A;  3LM9 A;  3K59 A;  4DU3 A;  4AHC A;  3MN7 A;  2Q36 A;  1UA0 A;  2DFF A;  1DEJ A;  1HX1 A;  3AAQ A;  2YHA A;  1Y64 A;  4JK9 A;  1BIS A;  3THY B;  5KTQ A;  4GV9 A;  1SQK A;  2UXB K;  3K0S A;  1JLB A;  1IKV A;  4WQ4 A;  5JLF A;  3AVN A;  2B6A A;  3V1R A;  4CEB A;  3P1G A;  1X3M A;  4JI5 K;  2WBN A;  2G8U A;  4K43 A;  3THW A;  3MEC A;  2CGK A;  4CF9 A;  2XY5 A;  4DV0 K;  3AVM A;  3H08 A;  4CBW A;  3C6U A;  1RTD A;  4GKJ K;  1EKE A;  3KKS A;  3HTV A;  4ISF A;  4DSI A;  2OPR A;  2FBY A;  3JAM O;  3K2P A;  4BRN A;  1JXE A;  2OCE A;  1C6V A;  1ASV A;  2I5J A;  1TK0 A;  4WQ4 C;  4DR2 K;  3DMJ A;  3ZT4 A;  4V19 S;  2IOC A;  3TPQ A;  4DFK A;  1XC3 A;  4J2A A;  3L2V A;  2O8C A;  4KHU A;  1EX4 A;  4H0P A;  4EIA A;  4ZTJ A;  3KTQ A;  1T44 A;  5LMN K;  3RMB A;  2FF6 A;  2P9P B;  2KZZ A;  3O5B A;  2CH5 A;  3T19 A;  1IJJ A;  2Q1N A;  3HK2 A;  4BDP A;  1KC8 O;  1S6P A;  4H0V B;  3UKR A;  4JI4 K;  3EZW A;  3QML A;  4BR0 A;  4X65 K;  3VQB A;  1W9H A;  3O6W A;  3CG7 A;  2ZGY A;  1CLQ A;  2HB5 A;  3QNO A;  3VTH A;  1LAV A;  4B1Y B;  4E89 A;  4CGD A;  2QK9 A;  3O4Q A;  5CY4 A;  4NCG A;  2F4V K;  4L8R B;  1HYV A;  2E88 A;  4OKJ A;  2G8V A;  4CJW A;  1GLF O;  4M3X A;  4B1Z A;  4LF5 K;  1S22 A;  4IJA A;  1U04 A;  3G6E N;  3SCX A;  4QOZ B;  1DTT A;  2R7Y A;  1U2V A;  3CER A;  3DXM B;  1A5X A;  3L2W A;  2NRX A;  3U3Y A;  3JS6 A;  3HVR A;  4M3R A;  1QZ5 A;  3VEY A;  3HBT A;  1FW6 A;  4CED A;  3VEV A;  3QIN A;  4DQQ A;  3K5L A;  1BIZ A;  4KI4 A;  4AHS A;  4O5B A;  3THW B;  4F4K A;  1JCE A;  1RT2 A;  4YNQ A;  1N5Y A;  4BAC A;  1YUW A;  3DLG A;  2RF2 A;  4NLB A;  5CZ1 A;  4HUF A;  3O3G A;  3HPG A;  4JI6 K;  3O1B A;  5F0X A;  4DHY A;  3TU5 A;  1HPZ A;  3NCI A;  3I8B A;  2F96 A;  4FLU A;  1RGI A;  2XY8 A;  4NLC A;  2G8F A;  3CET A;  2RE2 A;  3NVM A;  4NCA A;  1NGG A;  1RNH A;  3KK1 A;  3WXL A;  5F2R A;  1S9G A;  4X64 K;  5KRT A;  4AF1 A;  2VYP A;  3D45 A;  4DSJ A;  1ZBI A;  4FW2 A;  3HM8 A;  1NU0 A;  1WNS A;  2QWN A;  1L3V A;  3VQ4 A;  3DLR A;  1I94 K;  4PA1 A;  3UKR B;  2Q97 A;  3N4P A;  2HF3 A;  1QZ6 A;  2VGN A;  3G4S N;  3SQ4 A;  4B3O A;  3DOK A;  3C65 A;  4KHP K;  1VSJ A;  4A59 A;  1RDB A;  3THX A;  3A5M C;  1GLA G;  3QEV A;  3LP0 A;  1NK4 A;  4CEZ A;  3VN5 A;  2GWK A;  2YNI A;  1BL3 A;  3SUP A;  4BQZ A;  2FSJ A;  4OPJ A;  2QM1 A;  1A5W A;  3SLC A;  4FLV A;  3VET A;  3HOS A;  2A40 A;  3QFU A;  4H5R A;  2WC9 A;  1NK6 A;  4A2B A;  3HYF A;  1RTH A;  5EU7 A;  1TK8 A;  4J2E A;  1XNQ K;  1DKG D;  2F9T A;  2P5O A;  2Q0R A;  2O8E A;  3SJH A;  4HVJ A;  3TSQ A;  5GIP A;  2X6N A;  4CZL A;  4LC9 B;  3SQ0 A;  2D0A A;  4C1N K;  3VES A;  4RW6 A;  4BDZ A;  1XHZ A;  4KV8 A;  5KI6 A;  3DLL L;  4I2P A;  4LFB K;  1RTI A;  4FM1 A;  4M63 C;  4H0O A;  4FWM A;  3KJV A;  3PX4 A;  3WNH A;  4OPK A;  4K41 A;  4FJJ A;  1HJO A;  1HNI A;  5AQN A;  4M7X A;  3CCS N;  4AM6 A;  4CGF A;  3O08 A;  1QQO A;  4A61 A;  5JMV A;  1JL2 A;  2IIR A;  3VMF B;  3DLH A;  4B9T A;  4N76 A;  1D4X A;  3V9Z A;  1T6D A;  2QWO A;  3T1Y K;  3VQ8 A;  3T3F A;  2OYQ A;  4KB0 A;  1ITG A;  4BR5 A;  1HNX K;  4OX9 K;  4GNI A;  4CHQ A;  2P9S A;  1X9W A;  2V7Z A;  3CHW A;  4FK4 A;  1YVN A;  3PSI A;  4YOX A;  3DXK A;  5KPZ A;  3LDP A;  2V7Y A;  3O3F A;  5E84 A;  4Q5V A;  4M3Y A;  1X3N A;  1UAX A;  3A8Y A;  5B8H A;  1RT3 A;  2W41 A;  5E26 A;  4BRH A;  2IDO A;  1UWB A;  1DLO A;  1KVB A;  4BC3 A;  2P9L B;  5E41 A;  4LD0 A;  4AH9 A;  1BA1 A;  4JI2 K;  1JLE A;  3HPH A;  1U47 A;  4PHT X;  2Z1H A;  4O44 A;  5KRS A;  1WOQ A;  4BRM A;  4CCH A;  1SS6 A;  1RBV A;  3AAP A;  3AVC A;  5C10 A;  3R9P A;  1D8Y A;  1TYQ A;  2P9N A;  4ZTF A;  3P31 A;  1NOZ A;  3ULE B;  1ZBH A;  4OKK A;  4MDB A;  4BQL A;  1SKS A;  1KRP A;  5C0Y A;  2DFE A;  4GVM A;  3CQ8 A;  1EWQ A;  2QW9 A;  2IAJ A;  4K42 A;  1UOC A;  5C2D A;  1U4B A;  1ATR A;  4QAG A;  1VQ8 N;  1HPM A;  4DQP A;  1IBM K;  3ZSQ A;  3C7N B;  3VER A;  4JKD A;  3M6G A;  4FJL A;  1QS4 A;  2FC0 A;  3EN9 A;  4RG8 A;  1B9D A;  4CJL A;  4BRO A;  1S1X A;  2FSK A;  3LDN A;  3GE1 A;  4JK8 A;  1T8E A;  3CF5 L;  3PY8 A;  1C1C A;  2DPN A;  3G71 N;  4N56 A;  4XEI A;  4CD1 A;  3EKS A;  3AAR A;  3FLC O;  2OTL N;  4CHP A;  4DTX A;  3OY9 A;  3I56 N;  4LSL A;  2W6K A;  3SAH A;  1W2B M;  5J2M A;  4BR7 A;  3I33 A;  3I55 N;  2QKK A;  1WLJ A;  1E4G T;  4X66 K;  2P5G A;  1OVQ A;  2UUC K;  4PY5 A;  5LY3 A;  3RMD A;  2ZD1 A;  2NLX A;  4BR9 A;  4LSN A;  3DXK B;  4DR5 K;  3K58 A;  1CXU A;  4JHD B;  1S9E A;  3BF1 A;  3QO9 A;  2BE2 A;  4N5S A;  4F3T A;  5HRP A;  1WUA A;  3TAM A;  1X9S A;  1RDC A;  4DTO A;  4GV3 A;  4JV5 K;  5T7B A;  3U3G A;  1GLJ O;  2CGL A;  3AVL A;  4U7B A;  5SZT A;  4BC4 A;  1BCM A;  3TAR A;  1ZYQ A;  4F8R A;  5AQG A;  3MN5 A;  4CFB A;  1RFQ A;  2P9N B;  4QS8 A;  1YI2 N;  3WUH A;  2AP1 A;  4IOA L;  1EQY A;  2PAV A;  1K8A O;  3CPW M;  4CK1 A;  5D3G A;  2VCP A;  2D0C A;  3LZJ A;  1RBR A;  3VQ5 A;  4B08 A;  3SPZ A;  3KLF A;  2HHT A;  1XMO K;  2WOM A;  5AQR A;  3A0I X;  2ZJR L;  4CI6 A;  1RDW X;  4KKO A;  1WAF A;  1WSF A;  3GL1 A;  3KK2 A;  4JI0 K;  3MWP A;  3PX6 A;  4N41 A;  3MCA B;  4FL9 A;  1Q7Y O;  1N33 K;  4PWD A;  1NGE A;  2HHW A;  5I3U A;  3B8A X;  3OVN A;  2CGJ A;  4IG0 A;  4M7Y A;  4CEE A;  3OTO K;  1IKY A;  4NB4 A;  5FRO A;  4J8F A;  3FZF A;  3MX2 A;  4IFV A;  2GUP A;  3H45 C;  3CQX A;  4CJS A;  1QVF M;  3EO3 A;  2AJQ A;  3SAG A;  5KQD A;  1TL1 A;  3GOI A;  3J7Z O;  1SUQ A;  4H5V A;  5KGX A;  3H3O B;  3G10 A;  5H1S Q;  3RMC A;  3AVJ A;  5AQK A;  4CES A;  1ESV A;  2FF3 B;  4UY8 O;  2IVO A;  1KAZ A;  3R6M A;  4GY2 B;  5AQS A;  3CCJ N;  2ZJP L;  1T6C A;  2JWL A;  1NGH A;  3DYA A;  2JWK A;  3PLA A;  3ZET A;  5HLF A;  4AHR A;  1YIT N;  3FGU A;  3P4I A;  3T1A A;  4C8M A;  1CXQ A;  4ICL A;  2E5L K;  3LM2 A;  4YFU A;  4CJQ A;  3KZB A;  3O4N A;  2Z1G A;  3IMX A;  3THY A;  5TKW A;  4CE9 A;  5IWA K;  1JCF A;  2PZS A;  2FBV A;  4BWJ A;  4FYD A;  3EE8 A;  4DLG A;  1RBS A;  2NRT A;  3AA5 X;  3AVH A;  4BG8 A;  3VF6 A;  5AJ3 K;  4HUG A;  1C1A A;  3MDQ A;  2OZM A;  1KLM A;  3ATU A;  4DR1 K;  1KLN A;  2FLO A;  3SBT A;  5AZI B;  4C8O A;  4M3T A;  4FWR A;  1RDA A;  1J54 A;  4DWI A;  3P38 A;  4DQ8 A;  1JLQ A;  3KK3 A;  1M90 O;  4B1W B;  1NMN A;  3M1F A;  4DS5 A;  4DV3 K;  4B9V A;  4MO5 A;  2GEL A;  1NJX A;  3AVB A;  2IGI A;  1IKW A;  4EHU A;  3PX0 A;  2YJE A;  2D0O A;  3AO3 A;  2NNW A;  2OPS A;  3O9S A;  3HJF A;  1T03 A;  3E9O A;  1S5J A;  3VA3 A;  3QET A;  2UUA K;  1VQ4 N;  4FZZ A;  2P9P A;  4G1Q A;  3L2Q A;  5AZJ B;  5HRO A;  4B3M K;  1NKE A;  1JJ2 M;  4CW7 B;  4BRG A;  4CBX A;  1NK5 A;  4CK2 A;  2NRV A;  3G25 A;  5C42 A;  3OS2 A;  1J5E K;  2NZT A;  1BU6 O;  4M3U A;  1J6Z A;  4CF2 A;  1HR0 K;  4A57 A;  2GUI A;  4KTQ A;  4JKC A;  1JLA A;  4YOY A;  1WAJ A;  3QEW A;  2Z1I A;  3CIP A;  5M1N A;  4KTZ A;  1JLG A;  3LP1 A;  5BRF A;  4K0K K;  4NXM K;  1NNE A;  3DXM A;  4DR6 K;  1RIL A;  4B9Q A;  4O5F A;  3SQ2 A;  1SAZ A;  3O80 A;  3RMA A;  4OJR A;  1BGX T;  3EKU A;  1WN7 A;  3MK6 A;  3MMV A;  1E4F T;  3SK3 A;  1NOY A;  5EX5 A;  4CHO A;  2GTD A;  4M41 A;  2ETJ A;  3ULD A;  1QSY A;  1ZBS A;  3J81 O;  1BIU A;  3OBW A;  2Y1J A;  1D9F A;  1L3U A;  1TUU A;  3MXJ A;  1BOT O;  5HRR A;  3QBX A;  2QTD A;  3KWI A;  3PUF A;  3AVK A;  4DFP A;  4M3Z A;  5CHI A;  3D0P A;  4DV6 K;  3PV8 A;  1YXQ A;  3RRH A;  5AQW A;  1N34 K;  1HMV A;  3E66 A;  3ZSV A;  2YX6 A;  3RSE B;  5FRM A;  4FJ8 A;  4ILJ A;  3NF8 A;  3QES A;  3CM6 A;  5KPT A;  4EP5 A;  5AQT A;  3E9L A;  1HYZ A;  3MCP A;  2QI2 A;  3Q7B A;  4FJH A;  3H46 O;  4CF1 A;  2E1Z A;  4CD3 A;  3VA0 A;  4FCY A;  1VQK N;  3ALY A;  1RDD A;  4KBO A;  3CFR A;  4JKG A;  3CJA A;  5FPM A;  1Q18 A;  5CZ2 A;  2D0B A;  1BWF O;  3GBT A;  4W5O A;  2D0P A;  1RTJ A;  1LW2 A;  2NUB A;  4JK7 A;  3C0B A;  1MU2 A;  3GG4 A;  3I0R A;  4YOU A;  1IBK K;  1ZC6 A;  5SWM A;  3OYL A;  4F3O A;  4W5Q A;  4Y1D A;  1TKT A;  5TKY A;  1YT3 A;  1LCU A;  3OBY A;  4DSE A;  5BR8 K;  3NHG A;  3QNN A;  4DTR A;  2YJF A;  1VHX A;  4CGG A;  3K57 A;  1Q86 O;  3UB5 A;  1KVC A;  4CF0 A;  2E4L A;  3L0Q A;  4CJV A;  4NXN K;  1L3T A;  4OGE A;  3WNG A;  1HQE A;  3TTF A;  3S3O A;  3OW2 M;  2ZQB A;  4DMN A;  1CZ9 A;  4DTJ A;  1IV0 A;  4NO7 A;  4KO0 A;  1TVR A;  3BZC A;  1MWK A;  4BG9 A;  4KHS A;  4GW6 A;  5BPN A;  5ADX H;  3OYM A;  4CHZ A;  4NCB A;  3LAN A;  3F5T A;  3R8E A;  4RW4 A;  2UUB K;  1BI4 A;  3KHY A;  3TAQ A;  2BH1 A;  4DV2 K;  4DKW A;  1EWR A;  4H5W A;  4FJK A;  1T05 A;  2I7N A;  2VGM A;  3CMA N;  3TI0 A;  2FBT A;  4DTU A;  3QB0 A;  3TTC A;  3VQP A;  5BRH A;  1XHX A;  3RWU A;  4DR3 K;  2P51 A;  3SUN A;  2V51 B;  4FJM A;  1GLL O;  2HBL A;  4CZM A;  3NF7 A;  4KHY A;  3S3N A;  4FLY A;  4KPY A;  4I2Q A;  3WXI A;  3J7A P;  2NRZ A;  1QQM A;  1OH8 A;  1VSH A;  1ASW A;  3FFK B;  1U48 A;  1LW0 A;  2WON A;  3T7Z A;  2A1R A;  2QWL A;  4BRD A;  4JKG B;  4AHU A;  2IS3 A;  3WQU A;  4IZ9 A;  3PO5 A;  3OJU A;  2P9L A;  5FPD A;  3SUO A;  1NK0 A;  4KRE A;  3L3V A;  1GLE G;  1KTQ A;  3UIQ A;  2G8W A;  2HMI A;  4CJE A;  2B5J A;  5K14 A;  4FOE A;  1P8Z A;  3KK7 A;  5HL7 L;  4E7K A;  3ENH A;  3DRP A;  1GOA A;  2PY5 A;  2A6A A;  3R1X A;  4YOT A;  4JS5 A;  1NGF A;  1KAY A;  3ULE A;  2P9U A;  3WNF A;  3SPY A;  3FZK A;  1BQN A;  5KQ8 A;  4IEI A;  4DLE A;  3HM9 A;  3KIO A;  5J2Q A;  4MDA A;  4DS4 A;  4E19 A;  2A42 A;  1GLB G;  3EE9 A;  3C7N A;  2NRW A;  4FWN A;  5DM7 L;  4UQG A;  4LFA K;  4FJN A;  2E6L A;  1WSG A;  5C12 A;  3NGY A;  4XIU A;  1NJW A;  1DT9 A;  3C95 A;  4G9Z A;  5AQU A;  2JGU A;  4H5T A;  1S1V A;  1Z25 A;  1NLV A;  1EP4 A;  3TAE A;  4MLE A;  4TSX A;  4BRK A;  1BI4 B;  3J7Y P;  4Z4G A;  4DTM A;  2BGG A;  1K6Y A;  2HHQ A;  3CCR N;  3B6O A;  3LAL A;  4OO1 J;  3NVK A;  4WF9 L;  4XH5 A;  4RCH A;  4BC5 A;  2PFU A;  4DSL A;  1VSL A;  4CHN A;  2HNZ A;  2DY4 A;  3SAF A;  3E1Y A;  4YOR A;  3QLH A;  2X6S A;  3AV9 A;  3AA2 A;  3HXM A;  5LJV A;  3WEE A;  3WXK A;  2XO7 A;  3WXM B;  2ASO A;  3BEX A;  4JHD A;  4Z4H A;  2ASP A;  2JLE A;  4ELT A;  3D7E O;  4WCE L;  4ILG B;  4IXC A;  4DF8 A;  3IG1 A;  4NYF A;  2KKZ A;  3O4W A;  4OPA A;  4JRQ A;  1OH5 A;  4MO4 A;  3ZSR A;  5DM6 L;  3W3D A;  3OS1 A;  2O8B B;  1ATS A;  4E7I A;  4F2R A;  3CJC A;  1FK9 A;  4DSF A;  3BZK A;  4LH4 A;  4DUZ K;  4JI7 K;  5HRN A;  3OYA A;  1NGI A;  5AFU A;  4AIL C;  4W5R A;  4K8X A;  1B9F A;  2QEX N;  4OVL A;  3QBW A;  2P9U B;  3AO4 A;  4KRF A;  2QKB A;  3KVG A;  1BHL A;  3O9U A;  1QQC A;  2VG6 A;  2E1Y A;  2W42 A;  2BTF A;  2IC3 A;  5JS2 A;  3MX5 A;  2HW3 A;  4AQY K;  3CCE N;  3ZSX A;  2VQE K;  2KW4 A;  5DK5 A;  2F8S A;  1S6Q A;  4FWL A;  4CVN E;  3I8D A;  1KFS A;  1YJ9 N;  4WYB A;  1LAW A;  2VWJ A;  1NWK A;  4CEA A;  3J80 O;  3NF6 A;  1LWC A;  3AA3 A;  5EY4 A;  3CJ7 A;  4BE2 A;  4RWT A;  3NGZ A;  1FKP A;  3KLH A;  4CJ5 A;  1VSI A;  2VWB A;  3BF3 A;  4BR2 A;  1I3A A;  1D9D A;  2KTQ A;  1Z05 A;  1HLU A;  2HBK A;  4NYN A;  1BA0 A;  3NH2 A;  4A5A A;  1ASU A;  4IO9 L;  2VG5 A;  4CFA A;  1QHT A;  2ATQ A;  3WT0 A;  1K73 O;  4DCH A;  1VQ6 N;  3WEE B;  2VG7 A;  3P5J A;  3IS9 A;  3CCQ N;  3TWH A;  3V81 A;  2ZE2 A;  4EZ9 A;  1P90 A;  3L4Q A;  3U6F A;  2ZWH A;  3WXJ A;  3VQD A;  4IDH A;  3D2F B;  3NMU A;  2FXU A;  2UXC K;  1KXP A;  4FOI A;  4DTN A;  4LFC K;  2HHV A;  3TAN A;  4FM0 A;  3D2E A;  3M8Q A;  5BPL A;  3CFO A;  4CJK A;  4OLB A;  1NK8 A;  2QWM A;  3ENO A;  3S9H A;  1NG9 A;  2BDP A;  4B9M A;  1Z26 A;  5LJW A;  4QS7 A;  2QWQ A;  5LMU K;  2X78 A;  5BRE A;  3OJS A;  1HNW K;  1K9M O;  3ZT2 A;  1TUY A;  2XY7 A;  1TAQ A;  2J4R A;  4BGA A;  4FJI A;  4E7H A;  4W5N A;  5AZI A;  4J2D A;  3SUQ A;  3OYH A;  4AHT A;  4BY9 C;  2GV9 A;  1C0F A;  4IFE A;  2OPQ A;  4X62 K;  2QA4 N;  3IAY A;  1SZ2 A;  3SBG A;  3ZX2 A;  1W97 L;  1K8K A;  3ZSY A;  3SMS A;  3MN9 A;  3VQ9 A;  4CIG A;  3HPO A;  4E1M A;  4ISE A;  3ZX3 A;  4FWO A;  2LSN A;  5KPR A;  4MQ3 A;  4CZF A;  5AZJ A;  1YJN N;  1HNZ K;  1J5O A;  2GBZ A;  4RW7 A;  4FWS A;  2OAN A;  4HTU A;  4Z4F A;  3VQE A;  5KGW A;  3S3M A;  1VQO N;  4KH5 A;  2E6M A;  5GIN A;  4QS9 A;  4ID1 A;  4YY3 K;  3FZL A;  1GOC A;  3LAK A;  4A2A A;  4H0Y B;  2A3Z A;  3CJ1 A;  2PYJ A;  2RHK A;  3UE5 A;  5GIO A;  1JXB A;  1CZB A;  1Y97 A;  4BC2 A;  4IG3 A;  5GAE P;  3CCU N;  3NE6 A;  4CJU A;  4CGH A;  1ZBL A;  1SKW A;  3OYG A;  3O9Q A;  1RT6 A;  3D2E B;  1WBD A;  3TSP A;  1B92 A;  3FZH A;  3C6H A;  1U45 A;  3EY1 A;  1IG8 A;  2RKI A;  3A2F A;  4FWQ A;  4BRP A;  5A2Q O;  3QEP A;  3H1V X;  1S3X A;  1YTU A;  3FFI A;  3CPE A;  2HF4 A;  3OYK A;  1FJG K;  3PIO L;  1OH6 A;  4PKH A;  4HHT A;  1VSD A;  2EX3 A;  3AO5 A;  1YTA A;  4EFH A;  2E2O A;  3VEX A;  3VGK A;  4DSK A;  4DV1 K;  3QER A;  3RVC A;  2P1J A;  4E3S A;  1RCH A;  5AQI A;  3CI5 A;  1HKC A;  4FXD A;  1ZBF A;  1YHQ N;  4E1N A;  1M1K O;  1SV5 A;  3VQ7 A;  2YV0 X;  4OGC A;  5M1K A;  3SJJ A;  2YHX A;  3ID6 A;  3CCV N;  4PL8 A;  4I9L A;  5GAH P;  1VRT A;  1TV6 A;  3O9R A;  1RT1 A;  3A5L C;  3VEO A;  3SQ1 A;  1K8K B;  3HOT A;  4B1U B;  4B9L A;  3F9K A;  4KI6 A;  3HI0 A;  3E9P A;  2GWJ A;  3R3L A;  4PKG A;  4JKH A;  1QSS A;  2HMP A;  3RSE A;  1DGK N;  4IOX A;  3DRR A;  2HVI A;  2G8H A;  4M42 A;  3MN6 A;  2CH6 A;  4C8L A;  1S1U A;  3KLG A;  2VQF K;  4FZX C;  2IVP A;  5HOO A;  4FSV A;  1LV5 A;  3SV3 A;  4CZI A;  5JIC A;  4ELU A;  4O8K A;  2ITG A;  3WQT A;  4JS4 A;  1VRU A;  4B9U A;  3LDL A;  4CJ3 A;  1QE1 A;  4CEC A;  4DG1 A;  1NKB A;  3V9W A;  2QXL A;  4BGB A;  4HCB A;  2I7P A;  1BUP A;  2UYT A;  3V9U A;  3VF2 A;  3LDQ A;  1TKX A;  3MAQ A;  3CC4 N;  2DFH A;  5J1E A;  4H0X B;  3SV4 A;  4BDY A;  4I6M B;  3LDO A;  3VEZ A;  1NBW A;  1BDG A;  2IVN A;  4E0D A;  3RTV A;  1MA9 B;  3HP9 A;  3H3N O;  3HST B;  1IBL K;  3HT3 A;  3OYF A;  2ITM A;  1N6Q A;  1W0H A;  1XQS C;  4R79 A;  4FLT A;  3MXI A;  4FVM A;  3VQQ A;  3V9X A;  3KLE A;  3M8S A;  4DR7 K;  3O3H A;  3ZCM A;  4CFC A;  3F9M A;  3U9Z A;  5IT9 O;  3AVI A;  4YHH K;  3NBP A;  3VQ6 A;  1S72 N;  1L5U A;  1Q81 O;  4ID5 A;  4JD2 B;  4BRF A;  3TAG A;  2O8D B;  1IG9 A;  4JNE A;  3DWL A;  4JKA A;  3C6A A;  4N47 A;  2HST A;  1VSF A;  4B3S K;  3O1W A;  3F2K A;  3LDS A;  4IOC L;  4JLH A;  1XI1 A;  3NH0 A;  4CJT A;  1FKO A;  3DI6 A;  4BRA A;  3BY5 A;  4B1X B;  4C1N I;  4BVO A;  3DAW A;  2VWK A;  3VOV A;  3M8P A;  4HUE A;  3M5R A;  5FPE A;  1F21 A;  3U4L A;  1HKG A;  3UKU B;  2P9I B;  4IJN A;  3TSU A;  5GAG P;  3B6P A;  1RT7 A;  3IKM A;  3NH1 A;  3TAF A;  4JN4 A;  1CZA N;  3DOL A;  4B8A B;  4LF6 K;  4KHW A;  3A5O C;  4CGI A;  1WSJ A;  2XHB A;  3DLK A;  3MEG A;  5CYM A;  3AGK A;  5AQH A;  4DTS A;  3CCL N;  1NGD A;  1VAZ A;  2H3G X;  1N32 K;  4JKE A;  4DQI A;  3H6E A;  3M3Z A;  3CJ9 A;  2G8K A;  4FWK A;  3CME N;  4KHQ A;  3D6R A;  5AQM A;  2P9K B;  4ILH A;  2YNG A;  5HBM A;  3ZT0 A;  3EEQ A;  2W6L A;  5EXW A;  2HNY A;  1NK7 A;  4ELV A;  2KFZ A;  4GV6 A;  5CE3 A;  3VEW A;  3ITH A;  3LPU A;  4DU1 A;  3CD6 N;  3O9T A;  4CZK A;  3CJB A;  2E2Q A;  3HL8 A;  5HRS A;  2YHY A;  4CJP A;  1QVG M;  1HRH A;  2UU9 K;  1QQN A;  1ZXO A;  3EL2 A;  3FE1 A;  4H5N A;  1QTM A;  4CJ7 A;  1KQS M;  1BG3 A;  2Y1I A;  4FJ9 A;  4AM7 A;  4CJR A;  1KD1 O;  2HBJ A;  4OPH A;  4K25 A;  1TK5 A;  3CCM N;  3VQC A;  3NAE A;  4GKK K;  3EYZ A;  2A41 A;  4PUO A;  3CQY A;  4DR4 K;  3V4I A;  5AQL A;  1HNV A;  1RBU A;  2WFB A;  3OYC A;  1HJR A;  2XRI A;  2ZM6 K;  4CK3 A;  3AY9 A;  4B9N A;  4JI8 K;  3MXM A;  1SL0 A;  4XH4 A;  1KAX A;  1HKB A;  5LL6 Z;  3H1Q A;  4R5P A;  1NJZ A;  3AVG A;  4EHT A;  4IDK A;  1EXQ A;  1GLC G;  1XNR K;  3A5N C;  1Q9Y A;  4DV4 K;  5AQX A;  1IH7 A;  1TL3 A;  5AFU H;  1XC9 A;  3HP6 A;  4FWP A;  3HZ6 A;  1I39 A;  4PL7 A;  3RR8 A;  3ENB A;  3K5M A;  2Z1J A;  3C94 A;  2D5R A;  4CF8 A;  1NGB A;  4Q0B A;  1RDU A;  5FPN A;  3MWT A;  4KAZ A;  3VTI A;  2YCH A;  2O8C B;  4DFM A;  4IO8 A; 
#chains in the Genus database with same CATH homology
 4JI5 K;  4X66 K;  1N32 K;  2UUC K;  4JI6 K;  3J80 O;  3T1Y K;  4LFA K;  1N36 K;  1HNX K;  4DV0 K;  4OX9 K;  4NXN K;  4K0K K;  4NXM K;  4DR5 K;  1HNZ K;  4DR6 K;  4GKJ K;  4DUY K;  1XMQ K;  3JAM O;  2E5L K;  4LF4 K;  5FLX O;  4YY3 K;  4DR2 K;  3J7Y P;  4DV7 K;  4B3R K;  4X64 K;  2HHH K;  4V19 S;  5BR8 K;  4JV5 K;  3J81 O;  5IWA K;  5LMN K;  1IBL K;  2UU9 K;  2UUB K;  4JI2 K;  5AJ3 K;  1I94 K;  4DV5 K;  4JYA K;  4DR1 K;  4DV2 K;  4DR7 K;  4DV6 K;  4KHP K;  5IT9 O;  4YHH K;  4LF8 K;  4GKK K;  4JI1 K;  4JI4 K;  3T1H K;  4X65 K;  1N34 K;  2UXC K;  5A2Q O;  4DR3 K;  4LFC K;  4DV3 K;  4DR4 K;  1XMO K;  4B3S K;  1FJG K;  3J7A P;  2ZM6 K;  2F4V K;  4JI8 K;  1XNQ K;  5LMU K;  4DV1 K;  1IBM K;  4JI0 K;  5LL6 Z;  4LF5 K;  4DUZ K;  4JI7 K;  1HNW K;  2UUA K;  1N33 K;  1XNR K;  4DV4 K;  4B3M K;  4LF7 K;  3OTO K;  4CW7 B;  4LFB K;  1J5E K;  4LF6 K;  4B3T K;  2UXD K;  4X62 K;  4JI3 K;  1HR0 K;  4AQY K;  1IBK K;  2VQE K;  2UXB K;  4LF9 K;  4CVN E;  2VQF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...