2GEMA

2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
216
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCEHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
molecule keywords Putative Gram negative resuscitation promoting factor
total genus 67
structure length 216
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gemA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gemA02
2A3ZA 2J4RA 4M7YA 1RGIA 2FXUA 1GLJO 2YJFA 1K8KB 3O08A 4XH4A 2F9TA 3O80A 2E88A 2ZF5O 4H0XB 4YDUA 4BRQA 4MLEA 2KHOA 3L6QA 4H5WA 1HLUA 4JD2B 4ISGA 1JCFA 4DHYA 2IVNA 2P9LB 5AQUA 2I7NA 4JN4A 1ZC6A 4CZHA 4BRFA 4KBOA 1WOQA 5EVZA 3FZLA 5F1XA 1RFQA 4XEIA 1XC3A 3CI5A 2Q31A 3DJCA 5F0XA 3BF3A 4FWMA 4PL8A 4A62A 2AP1A 2VWBA 1YUWA 4CZFA 2CGKA 3CIPA 3DXMB 3UKRB 4H0YB 1ATSA 2Q1NA 3TU5A 1TUUA 5BPMA 2YCHA 2Q36A 3ATUA 4RCHA 1QZ5A 4CI6A 2D4WA 1KAXA 3KHYA 3UB5A 2FF3B 3VF6A 5AFUH 3AY9A 5AQGA 1NMDA 3WQUA 2UYTA 4H0PA 4FOIA 2CH6A 3ULEA 4CZIA 1NGAA 3FGUA 3MMVA 2QWOA 3CJ1A 4I6MB 4BG8A 5AZIA 3WXKA 3L4IA 2P9UB 5BN8A 2P9PA 4FO0A 1MA9B 4K43A 3LDOA 4BQZA 1RDWX 3R9PA 1NWKA 5EX5A 4Z94A 1IJJA 3LM9A 3BP8A 5AZIB 3MN6A 2FSKA 4CJ7A 3FZKA 1LOTB 4B1VA 1NGBA 5AQKA 2HMPA 3BUZB 4BRNA 3A8YA 2FSNA 3DWLA 3M3ZA 2V7ZA 2QWMA 4RWTA 5FPDA 3C7NB 2FLOA 1ZBSA 5EOYA 3J8AA 4JAXA 5EXWA 3VPZA 2W41A 4BRMA 4IJNA 3WQTA 3OHRA 5AQFA 2ZGZA 2H3GX 5ADXH 1Z05A 4MLHA 4BG9A 2QM1A 3CHWA 2VYPA 3A5NC 3MN9A 5AQLA 4BRIA 3DAWA 1GLAG 4NB4A 5TKYA 4DQ8A 2QXLA 4JHDA 5FPEA 4FPBA 3U9ZA 3VF2A 4WYBA 4CBXA 1J6ZA 2GWKA 2Q0UA 4JD2A 3D2FA 4EHTA 4BC5A 1C0GA 3CJ7A 1R59O 1BDGA 5EY4A 4DB3A 5E84A 2QW9A 3H46O 5F2RA 4K41A 3CETA 2HF4A 3SMPA 1HKBA 3D2EA 4PL7A 2PAVA 3AAQA 4BQLA 5AQTA 4BRGA 3AAPA 3QICA 1GLEG 4ISFA 4BRHA 1U2VB 3EZWA 3S41A 1NGDA 4GNIA 2BUPA 4HWIA 4CBUA 2HF3A 2IVPA 2DPNA 2NLXA 4FWLA 4M7XA 4B1WB 4BGBA 5LY3A 3C7NA 3WXJA 5CE3A 1NBWA 3DXMA 3A5MC 2YJEA 3BF1A 1V4SA 3M1FA 5BPLA 1TYQA 1DKGD 2P9IB 2HOEA 3VEVA 4FWOA 3FR0A 4J8FA 4BR4A 2GELA 1GLLO 2P9UA 1QHAA 3WT0A 1NM1A 3LL3A 1KAZA 4AM6A 1SZ2A 1BUPA 2P9LA 3VEYA 2YI1A 4BRCA 2I7PA 1QQOA 4Y0WA 2OANA 1ATNA 1Y64A 4IJAA 3HZ6A 1OKJA 3RSEB 1S3XA 2P9KA 1EQYA 3O8MA 5AQWA 2EWSA 1U2VA 5AQHA 1KXPA 3M6GA 4H0OA 1QQMA 4BRKA 5AQZA 5AR0A 5JICA 4EAHD 4FWNA 4PKGA 1U6ZA 3GG4A 4BR0A 4LC9B 1MWMA 1KAYA 3GE1A 4XH5A 3WXLA 3QBWA 4FL9A 3ENOA 3QFPA 5KPRA 3WXIA 3H3OB 4IZ9A 1X3NA 4BREA 4CD3A 3HI0A 3D2FB 4BROA 2NZTA 1GLFO 2V51B 4IWVA 1TUYA 1LCUA 5I9EB 2NRHA 3LDQA 3CJCA 3CJAA 2E1ZA 3SJHA 4GY2B 3VEWA 2E8AA 1BO5O 1YXQA 2IVOA 3MCPA 3A5OC 3ENHA 4EFHA 1MDUB 3I8BA 3LM2A 3LDPA 3D7EO 4FWPA 4MO4A 4O5FA 1ESVA 3H1QA 1DGKN 2QWRA 3VGLA 4O8KA 2YHXA 1V4TA 1DEJA 5JLFA 1X9JA 3G25A 4IXCA 5ELZA 4BRPA 3ZEUA 3EN9A 1MWKA 4FOEA 3D2EB 2A40A 4I6MA 3VERA 3U9DA 2E2QA 1Q18A 3R8EA 5AQXA 2VCPA 4QS7A 5BRFA 2A41A 5AQYA 3H45C 4FWRA 4L3QA 4K42A 4H5NA 3H3NO 3FE1A 5KQ8A 1HKCA 2F9WA 3L0QA 2P9NA 1HUXA 3ZETB 1YAGA 1Z6RA 4BGAA 3GDQA 3CQYA 5JLHA 3CJ9A 4B1YB 1GLBG 3RSEA 4CD1A 1TYQB 3W3DA 5AQJA 3MN7A 3C0BA 4BR7A 4FWQA 2ASOA 2GUPA 5AQVA 1BU6O 2Q0RA 4H5TA 3BEXA 5BRHA 4A2BA 2E20A 1D4XA 4HTLA 3A5LC 3FZFA 1ATRA 4EHUA 3O1BA 4H03B 5BR9A 2Q2RA 2CGJA 3H6EA 3QMLA 5AZJB 3SLCA 3GBTA 4H5RA 2ASMA 4A61A 2FSJA 4AM7A 4CZLA 3GL1A 3CJBA 2PBDA 3UKRA 4B1ZA 3O5BA 4IO8A 2E2OA 3EKSA 4PKIA 2GEMA 2AA4A 4CZMA 5KQDA 3IUCA 3A0IX 1XUPO 1NGJA 2ASPA 1E4FT 1P8ZA 5KPTA 1BOTO 1E4GT 1NGFA 2D0OA 4A2AA 2GWJA 2E2PA 4BRDA 1SQKA 5AQMA 4DCHA 4FWKA 3IMXA 3ZX0A 3DXKB 1IG8A 3FZHA 2QWQA 1WUAA 3WEEB 5BPNA 4B1UB 4CZGA 4FPAA 3VEOA 3IDHA 5KPZA 2YHWA 1CZAN 2E1YA 2WUSA 3EO3A 1YVNA 2QWLA 3VF4A 3O1WA 3ULEB 3FFKB 4QS8A 4CZEA 4E1JA 1T6DA 3ZEUB 3JXUA 3H1VX 2CH5A 4CZKA 4FSVA 1BA1A 2P9SA 1HJOA 2V7YA 1T6CA 3UKUA 4BC2A 4BR2A 5AQSA 1ZXOA 3WUHA 3VEZA 4BC4A 4K25A 4WQ4C 1HKGA 3JS6A 3P4IA 4XH1A 2D1KA 3LDNA 3AARA 3TPQA 4BR9A 3O4WA 3SK3A 1C0FA 3UE5A 3HSCA 2ITMA 2P9SB 3MK6A 3O6WA 4QS9A 3VENA 5ADXA 1T44A 3U8XA 3DXKA 2QWPA 5AQRA 5AQPA 2V52B 3CQXA 4PKHA 5BN9A 4EIAA 1XQSC 3LDLA 3QB0A 3EKUA 5E26A 4F9OA 5LJVA 1NLVA 1HX1A 2QWNA 3VOVA 2GTDA 4H0VB 2A6AA 3VGKA 1JCEA 3B8AX 1HPMA 3VESA 4H5VA 4JHDB 1H1VA 3VEXA 4B9QA 4BVPA 2P9NB 3KZBA 3ZETA 3W0LA 2P9PB 3QBXA 3VETA 1NGCA 4B1XB 3HM8A 2A42A 4ISEA 3HTVA 4H0TB 3EL2A 1QQNA 3ZX2A 3F9MA 4CBWA 2A5XA 1GLCG 5LJWA 5AQIA 4YDUC 5B8HA 3FZMA 2YHYA 2ZWHA 4WQ5C 3FLCO 4BR5A 3U4LA 5JMVA 1S22A 4MO5A 2CGLA 2ZGYA 3MDQA 3QFUA 4CZJA 5AZJA 2BTFA 1NGGA 5FPMA 3UKUB 3GOIA 4BRAA 4C23A 3MN5A 3R6MA 2IIRA 1BG3A 1SAZA 3ID8A 3SMSA 1X3MA 4WQ5A 5AFUA 1G99A 4RTFD 1QZ6A 4NO7A 5AQNA 1BA0A 5FPNA 3I33A 5AQQA 5BRDA 4FWSA 1JCGA 1BWFO 4M63C 4BC3A 4BVOA 3KVGA 3VGMA 2FF6A 2E2NA 3WEEA 3CERA 5BREA 3QDKA 2Q97A 2P9IA 2D0PA 1GLDG 2W40A 3HBTA 1K8KA 3IFRA 4WQ4A 1NGEA 4JNEA 2P9KB 4BRLA 3ATVA 3ZX3A 1NGHA 1NGIA 5AQOA
chains in the Genus database with same CATH superfamily
3EYZA 4DQQA 2W6LA 4NXMK 1VQ6N 2ZE2A 2YJFA 3CQ8A 1Z25A 4A57A 2ZJPL 1NKCA 5LL6Z 4XH4A 3O80A 4J2EA 4YDUA 3G6EN 3OS2A 1KD1O 4LY7A 3KLHA 1HLUA 3HSTB 3LDSA 4HUGA 5CZ2A 3G10A 4CZHA 3QETA 1WOQA 3FFIA 3Q7CA 5F1XA 2QEXN 3ZSVA 1RFQA 4XEIA 3ZYYX 4LSLA 3OYEA 3PY8A 2X74A 2PFUA 2Q31A 1Q81O 1YT3A 5CR4A 4CJFA 2G8KA 3RR7A 4A62A 4PL8A 3QEXA 1VQ7N 3DXMB 3UKRB 4H0YB 4FCYA 3NF9A 3ATUA 1QZ5A 4CI6A 3QEPA 4Z4IA 1KAXA 4N5SA 1VSKA 1NJYA 2WONA 2FF3B 4BWJA 3I55N 5AFUH 1VQON 1NMDA 1S72N 2O4IA 3HP9A 1RNHA 3ULEA 1S5JA 1XWLA 2OTLN 2QTDA 2YNGA 4PWDA 1K6YA 4BG8A 2RE2A 3L4IA 5BN8A 3TABA 1OH5A 1EWQA 3AV9A 1VHXA 4KO0A 4RW8A 4BQZA 1T7PA 3R9PA 3RRGA 1RDUA 3TAQA 4C1NI 4KTQA 3LM9A 3VQPA 2HNZA 3MN6A 4CJ7A 1D9FA 5TKWA 1NGBA 4CJSA 3BUZB 4BRNA 1BIZA 1VSLA 2QWMA 3J8AA 4JAXA 1JLEA 2YNHA 4GMJB 4JK8A 5C15A 3M8RA 4Z4FA 5C25A 3CXCM 3E66A 4CEBA 4DR3K 4PHTX 1Z05A 4LF8K 1HNWK 4BDYA 2WTUA 4DLGA 5AQLA 2RF2A 4QOZB 4DQ8A 4LFBK 1S1VA 3CCUN 1IO2A 3SPYA 4JD2A 4OO1J 3DLKA 1J53A 4BC5A 4OJRA 3U6FA 1HRHA 1VSJA 4K41A 3ZSYA 4Z0UA 3HVTA 2HF4A 2YHAA 1VQMN 4A59A 4CJ3A 4BQLA 5AQTA 3AAPA 3QICA 3V81A 3C6UA 3BDPA 1NOZA 2YNIA 2XO7A 1GLEG 4U7BA 4YOVA 1BISA 1NGDA 3HPGA 2NLXA 4B1WB 1SL1A 4DV1K 3C7NA 3KLGA 3ZT3A 5CE3A 3SAFA 3R1XA 4CCHA 1HNIA 1DKGD 2P9IB 3OJUA 2HOEA 1VQLN 3VEVA 2GELA 4JKGA 4PA1A 3L2RA 1VRUA 2G8WA 2P9UA 1NM1A 3LL3A 4AM6A 3VEYA 2I7PA 2P51A 3NF8A 4JKFA 4JKEA 3HZ6A 4HVJA 3M6GA 3S3OA 4CJTA 4O44A 4LF5K 1J5OA 4DS4A 2QI2A 1U6ZA 3GG4A 1Y97A 2OPQA 1IBKK 5JVGL 1T8EA 2JLEA 5HRRA 3WXIA 4HUEA 3SQ0A 4BREA 1I39A 4BROA 3T7ZA 2EHGA 1QSSA 3T19A 1DTTA 1IG9A 5I9EB 4DQIA 2O8EA 3K0SA 3F9KA 4GY2B 3SV3A 4Y1CA 2E8AA 5IWAK 4CIFA 1YXQA 3MCPA 3ENHA 1OVQA 1ZBLA 4FWPA 4AH9A 1JLQA 1ESVA 1TVRA 1U4BA 1RBRA 3OS0A 3L2QA 1DGKN 3VGLA 3NHGA 5AJ3K 2HVHA 4FZXC 4CJKA 1KFSA 4IXCA 5ELZA 3ZEUA 4YFUA 3EN9A 3RRHA 2IOCA 3R8EA 1Q18A 5I3UA 1W0HA 4KAZA 1IKYA 2A41A 1RDBA 1YF5L 2HNYA 4K42A 4H5NA 5D3GA 4B3MK 3NMUA 3AO1A 4FM0A 3LAMA 1HKCA 1NJWA 3ZETB 1YTUA 3PUFA 3G71N 4YORA 2KZZA 2NRTA 1Q9XA 3GDQA 3HP6A 1RDCA 4M41A 3CQYA 4KB1A 3PLAA 4CD1A 3RMCA 4U67L 3MN7A 3C0BA 3VQDA 2NNWA 2O8CA 4IDHA 3AVIA 2Q0RA 4QCLA 3BEXA 2VG5A 2FBVA 1C6VA 3MXIA 3THWB 4WFBL 3A5LC 5C2FA 5AZJB 4JI1K 3SLCA 4DU1A 3M8PA 4DKWA 3THXA 3GL1A 1TGOA 3CJBA 5C42A 4FM2A 3OTOK 4O5BA 4B1ZA 3A2FA 4CE9A 2AA4A 4CZMA 1ASVA 5KQDA 3CC4N 1XUPO 2F7TA 2ASPA 4DQRA 1JL1A 1NGFA 2D0OA 2WBNA 4DTXA 1TAQA 3PO5A 4GVEA 1WAJA 4UQGA 1N8RO 1RTJA 4FWKA 3ZX0A 1NJZA 5BPNA 4HUFA 4FJXA 3I0RA 4E7IA 2YX6A 3WNEA 2BGGA 3MWTA 4GKJK 3NBPA 4CZKA 3LPTA 2V7YA 4BC2A 4WF9L 4BC4A 2DY4A 3O9QA 5C12A 1XMOK 1HYSA 4DSEA 2D1KA 2O8BA 3DLGA 4BR9A 5GAGP 2OYQA 1C0UA 2O8FA 3HSCA 2ITMA 3TTDA 4QS9A 4FJ5A 5AQRA 5AQPA 3LWLA 1XQSC 4CFDA 1NLVA 1HX1A 4LH4A 2QWNA 4WCEL 2A6AA 1W9HA 1S6PA 4BE1A 4CFBA 3B8AX 5E41A 4H5VA 4JHDB 4CK1A 4B9QA 3KK1A 3T1YK 4NCBA 3K5LA 4FJNA 2XY7A 4CECA 3ZETA 3KZBA 3VQ8A 3TANA 4B1XB 2X6SA 4DV4K 2A42A 3ZX2A 5CHIA 4LF9K 5AQIA 5B8HA 3HJFA 4JLHA 4CJPA 2YHYA 2ZWHA 4B3OA 5M1QA 4NYNA 5JMVA 4MO5A 4JKBA 4WFAL 5AZJA 3L2WA 4N47A 3UKUB 1HQEA 3R6MA 1TK0A 1P90A 1SAZA 1X3MA 1G99A 4NO7A 4FW2A 3CD6N 2OZSA 3VA0A 5FRMA 1BA0A 1JLFA 1L3UA 1BWFO 1NK4A 3WEEA 1U04A 3CERA 4CIEA 5BREA 3OVNA 3CC2N 3NF7A 3ASMA 4B9NA 2HBLA 5H1SQ 3KJVA 3IFRA 3KLFA 4KREA 3CM6A 5GAEP 2DFFA 1Q7YO 2F8TA 3N4PA 2OPRA 3OYDA 1LWCA 1NGIA 5AQOA 1RGIA 2E4LA 3OY9A 3DM2A 1GLJO 2DFEA 1K8KB 4X66K 4Q5VA 1WBDA 1E3MA 3ITHA 2F9TA 5C24A 4YOXA 2E88A 2OPSA 4H0XB 3SUPA 4CJUA 4MLEA 3P5JA 2KHOA 4DSKA 3KWGA 4B9SA 3K2PA 4B8CA 2HNDA 4DHYA 4C8MA 1KVAA 4JN4A 4E0DA 4BRFA 4CEZA 1RT2A 3MEDA 4H8KA 1GOCA 4FJLA 3V1OA 3DLEA 4B3SK 3O3GA 2ZD1A 3CM5A 5GAHP 2AP1A 2G8FA 1ATSA 5BPMA 1TUUA 4RW4A 2Q36A 3DMJA 1NKEA 2XRIA 2D4WA 1RTDA 1K8AO 3TAFA 5AQGA 3NH0A 2R7YA 1LAWA 5K14A 3WXMB 3LP0A 3MMVA 4OGCA 4I6MB 5AZIA 5M1NA 3CMAN 4AILC 3PV8A 3WXKA 4K8ZA 3HOSA 4JKGB 4O0JA 1TL3A 5SZTA 2IDOA 4K43A 3T69A 3LDOA 4DV7K 4M3UA 1NWKA 4ID5A 4IDKA 1IJJA 2OTJN 3C6AA 3AA5X 4DTSA 1S1XA 3V9UA 2FSKA 2WFBA 4NCAA 1LOTB 1LAVA 2HMPA 1N34K 2BE2A 1VK0A 3AA2A 2V7ZA 3D0PA 1LWFA 4RWTA 3NAEA 1VQ8N 5KI6A 4BRMA 3LPUA 2P5GA 3OBYA 4E7LA 1C1CA 2Z1HA 3OHRA 3CCRN 2DTUA 1KLMA 3EEQA 3C6TA 3CMEN 1HPZA 2VYPA 3A5NC 4BRIA 4M3ZA 3DAWA 3BZKA 5TKYA 2QXLA 4JHDA 4CJQA 1QTMA 2Z1IA 4K0KK 3VF2A 3O4QA 4WYBA 4CBXA 1OH8A 5JS1A 1C0GA 3PX4A 5E84A 1SS6A 2WC9A 1JLAA 3DLLL 3CETA 5JVHL 1F21A 1RT4A 2E6LA 3EE9A 3O9SA 1XMQK 3C94A 4KTWA 4ZTFA 3ZT0A 4YHHK 3I56N 4DLEA 4EZ6A 3QIPA 3PIOL 3AAQA 3HVRA 4BRGA 1O1WA 1C1AA 1RT1A 3DRPA 2X78A 3JAMO 3TTFA 3AGRA 1U2VB 1T3VA 3C6HA 3S41A 4GNIA 4HWIA 2BUPA 3NCIA 5FDLA 4LFAK 4M7XA 5LY3A 4FWLA 1VQ4N 3AVNA 3WXJA 4CESA 3KK2A 5FROA 3QESA 3BF1A 5BPLA 4LFCK 1FJGK 2UUBK 4BE2A 4JEPA 4BR4A 3THYB 5GINA 3NVKA 1GLLO 3WNHA 1C0TA 1KCFA 3WT0A 4JK7A 1BUPA 4W5OA 4BRCA 1BGXT 4Y0WA 2OANA 1ATNA 3QEWA 2HB5A 1JKHA 3O8MA 5AQWA 3L2UA 4DV5K 4YOWA 3PO4A 5DMRA 3BGRA 3KK7A 1QQMA 2VG7A 1Z26A 4Z4CA 4DUYK 3LALA 4NLBA 4PKGA 4FW1A 3THWA 1NK6A 1KAYA 3LP1A 3ZCMA 2G8VA 3WNFA 3LP3A 2PYJA 4OVLA 4DSLA 3ENOA 3QFPA 4JI5K 3V4IA 3NGYA 1G15A 4CD3A 4FJIA 2RPIA 4HHTA 3SYZA 3DYAA 3HI0A 3D2FB 5GIPA 5KGXA 4KHUA 3B6PA 1RT3A 2VG6A 2W42A 1WSIA 3CJCA 3CJAA 3T3FA 2E1ZA 3VEWA 1VSIA 4DG1A 4W5NA 5M1FA 1BO5O 4LSNA 3S3MA 3A5OC 4IKFA 1MDUB 4ILGB 2O8BB 3I8BA 3K5NA 3LDPA 3D7EO 1ZBIA 1IKWA 3T1HK 4FJJA 2GUIA 1C1BA 3AVKA 4ILJA 2QWRA 2NRXA 4H4OA 4N76A 1X9JA 3CCMN 4KHNA 1RT7A 1IKVA 1MWKA 3L2VA 3D2EB 4YOUA 4CW7B 3VERA 3OYCA 4IEIA 2E2QA 4GV3A 4OPJA 3HK2A 1QSYA 5AQXA 4CFCA 2VCPA 4FWRA 3OYFA 3NDKA 3TAMA 3H3NO 3SQ2A 3E1YA 3P39A 3SUNA 1Q9YA 1SKRA 1ZBFA 4M3TA 1NMNA 3RVCA 3EZ5A 1Z6RA 4BGAA 1VAZA 2RN2A 4QAGA 2D0CA 3RSEA 4KTZA 1TYQB 4IO9L 3W3DA 4ZTJA 3HM9A 1WB9A 1W97L 4BR7A 4F2SA 2KKZA 2JGUA 2NUBA 2ASOA 4DQPA 4JKCA 4RG8A 3DOLA 4OKKA 4BWMA 3CFRA 2BDPA 4HTLA 4EHUA 5LMUK 1JLCA 4A61A 4CHOA 4CZLA 2E2OA 2KFNA 4PKIA 2ATQA 5FRNA 1X9MA 1N6QA 2D0BA 4DQSA 4DTJA 4HCCA 1E4FT 1P8ZA 4OGEA 1E4GT 3M8QA 2HHUA 2GWJA 2VGMA 3K9KA 4KKOA 5J2NA 1U48A 5AQMA 1WSEA 4DCHA 4YOTA 1HYVA 3DXKB 1IG8A 1N33K 3WEEB 3CCVN 3TSPA 4FPAA 3VEOA 3IDHA 5KPZA 2YHWA 1CZAN 1I3AA 4L8RB 4LF6K 1YVNA 1TK8A 3OBWA 3ZSXA 4E1JA 3QNNA 3KTQA 1ASUA 3ULDA 4KPYA 3H1VX 2CH5A 4X62K 4BY9C 2YV0X 3HYFA 5HRNA 1BA1A 1HJOA 1T6CA 4BR2A 5AQSA 1ZXOA 2YNFA 1WAFA 1TK5A 3VEZA 3QEVA 1D5AA 3V9WA 4E3SA 1YVUA 3JS6A 1NK8A 3SV4A 3LDNA 1LW0A 3SQ1A 1FXXA 2VQEK 3RWUA 4JI6K 3O3HA 3SCXA 4PUOA 3UE5A 3LP2A 3VENA 4ELTA 3PSFA 1B9DA 2V52B 3HPOA 1TKTA 3KLEA 4BACA 1TKZA 1QSLA 1U47A 3K5MA 4NYFA 4H0VB 4IBNA 3OS1A 3VQ4A 4JRQA 3E9OA 3AVHA 4CGDA 4HTUA 4MDAA 3ENBA 4IEEA 2NRZA 1KSPA 4CGIA 3L3VA 4FM1A 4ISEA 3HTVA 1VQ5N 1DLOA 1GLCG 1HR0K 4DU3A 4WQ5C 4CJVA 1J5EK 1S22A 3SZ2A 4BRAA 2IIRA 4OX9K 4KH6A 3SMSA 1EKEA 4DTRA 5AFUA 1OH6A 4RTFD 1QZ6A 1XHXA 3E9LA 5FPNA 2IAJA 3TTCA 1CZBA 1JCGA 3HT3A 1RTIA 4BC3A 1BI4A 5C2DA 2O8EB 1SV5A 4X64K 2Q97A 1TAUA 2HBMA 2KZMA 2GBZA 4WQ4A 1NGEA 4JNEA 2P9KB 3AVFA 4BRLA 3ZX3A 4DB3A 3DLHA 2J4RA 4M7YA 2RHKA 2FXUA 3TR8A 3OJSA 4IG0A 3O08A 3OYIA 1YHQN 4CK3A 4CHYA 3O9RA 2ZF5O 3OW2M 5CZ1A 4BRQA 3P31A 4A5BA 4JD2B 4ISGA 3J80O 1JCFA 2ZM6K 3CCSN 3VMFB 2IVNA 2PZSA 3CFOA 2I7NA 1ZC6A 1FK9A 3FZLA 4JI7K 4WFNL 1RBSA 1WLJA 1XC3A 2Z1GA 1WSJA 5J2PA 1SKWA 3DJCA 4CEDA 1KVCA 3MWPA 4CJ4A 3U3GA 4FWMA 4Z4HA 3NGZA 1A5WA 2VWBA 3OYHA 1YUWA 4CZFA 1BHLA 3PX6A 2KW4A 4B08A 4CHPA 3SAHA 1S9GA 4RCHA 2GX9A 3SBGA 3ALYA 3AA3A 3KHYA 4KI4A 4ILHA 4KFBA 4KHWA 3HOTA 3VQBA 2D5RA 1S9EA 1U49A 1NK5A 1KQSM 3WQUA 2UYTA 4CJ5A 4H0PA 4I2QA 3DI6A 3HL8A 2CH6A 1NGAA 1T03A 4GKKK 4C8OA 3CJ1A 2VGNA 4IOCL 1S1TA 4DF8A 1XNQK 1DTQA 2P9UB 4OPKA 3BY5A 4M42A 2P9PA 4FO0A 4RW6A 3L3UA 4BDPA 3AO5A 4AQYK 4F4KA 1RDWX 3VQQA 5EX5A 4Z94A 3BP8A 5AZIB 5KRTA 3THYA 3NH1A 3DOKA 2FC0A 4B1VA 3C65A 5AQKA 4CIGA 4JI2K 3A8YA 3DWLA 1VQ9N 3ZT1A 4CFAA 4W5RA 2FLOA 5EOYA 3MEEA 3OYNA 3VPZA 4N41A 5EXWA 3IKMA 4FXDA 4IJNA 4DMNA 4DR7K 1KVBA 4JI8K 3CCEN 4DTPA 5AQFA 4CF9A 2H3GX 5ADXH 4MLHA 4BG9A 4O4GA 3CHWA 3MN9A 3IAYA 3DLRA 1GLAG 1ITGA 4NB4A 5FPEA 4DTNA 2NRWA 3U9ZA 3E9PA 1YJWN 1J6ZA 2GWKA 4CJRA 3D2FA 2IC3A 4MDBA 1BDGA 2QW9A 5F2RA 4LH5A 4KHSA 3HRGA 2IGIA 4CEEA 3CG7A 3ZSRA 5KTQA 4M3YA 3OYJA 4JI0K 4FJ9A 1J54A 3KD1E 4ISFA 4FJ7A 3AVJA 4DR1K 2AJQA 5HP1A 2KQ2A 2HF3A 2DPNA 4BGBA 1S1WA 2DFHA 1JJ2M 1RT5A 1NBWA 4CERA 4W5TA 4F3TA 2YJEA 1JL2A 3M1FA 3THVA 2HMIA 4J8FA 1TV6A 1REVA 1KAZA 2BANA 4J2DA 1SZ2A 3AO4A 4CEOA 1QQOA 1Y64A 4IJAA 4CZIA 1OKJA 3RSEB 1A5XA 1S3XA 1EQYA 2P9KA 2PY5A 3VTHA 5AQHA 4H0OA 4BRKA 5AQZA 5JICA 2Q3SA 3EE8A 4RW7A 4CEAA 4BR0A 1HYZA 1I94K 3ZSWA 3S9HA 1MWMA 3WXLA 4Y1DA 3J81O 4DV3K 1HNXK 4W5QA 2YHBA 1X3NA 4B8AB 3KKRA 2A1SA 2NZTA 2V51B 3I0SA 4IWVA 4CHZA 4DV0K 1GOAA 4AHUA 4I9QA 1TUYA 1LCUA 2NRHA 4KH4A 4YNQA 1X9WA 2IVOA 3QLHA 4EFHA 1IKXA 3SI6A 2LSNA 4LF7K 1KTQA 3QINA 4JI4K 4B3RK 2XY6A 4O5FA 2Z1JA 4DV2K 3M5RA 2YHXA 1V4TA 1DEJA 4E89A 5JLFA 4B9LA 3ZSZA 2HBKA 4AHCA 5SWMA 1RBTA 4BRPA 2JWKA 5J1EA 5DM7L 4FOEA 5M1OA 1KLNA 2A40A 4I6MA 4CF0A 3MECA 4XIUA 4JV5K 4CF8A 3H45C 3EY1A 3TAPA 3MEGA 2HBJA 1CXUA 4L3QA 4LD0A 1VSFA 4FLWA 4CF2A 2NRVA 2Y1IA 3RTVA 3THXB 5KQ8A 2HVIA 3L0QA 1YAGA 4BE0A 4HCBA 3AVMA 3F73A 1ZBUA 1SKSA 3CJ9A 3LZIA 1LWEA 4CGGA 1SL2A 3RMDA 5J2MA 3K59A 4E19A 4C8KA 4FWQA 4Z4GA 5AQVA 2GV9A 1BU6O 2YKNA 4H5TA 3I8DA 1YTAA 5BRHA 4A2BA 4ELVA 3FZFA 1ATRA 4ID1A 4JYAK 1ASWA 5BR9A 2QXFA 2CGJA 3H6EA 1A5VA 3QMLA 2A1RA 3AVGA 4H5RA 1MU2A 3V1QA 2IS3A 4AM7A 1FW6A 1JXEA 3AVCA 4FK0A 3O5BA 4IO8A 5EU7A 2GEMA 3VQ9A 1BI4B 3TSQA 5A2QO 3IUCA 3A0IX 4CHQA 1UA0A 4DFMA 1BOTO 4JI3K 4I2PA 2NRRA 1HQUA 1SUQA 5BR8K 3JYTA 1D8YA 4MFBA 3K9JA 3V9SA 4KHYA 3K58A 1UWBA 1CZ9A 3IMXA 1YJNN 1RCHA 4WE1A 4B1UB 1QS4A 3OA9A 4FJ8A 2E1YA 2WUSA 1L3TA 4B9VA 1S1UA 3VF4A 3O1WA 3ULEB 1T6DA 3VA3A 1BL3A 1YI2N 1HMVA 3JXUA 2UUAK 1JLGA 3VQ5A 1IBLK 1EETA 4FSVA 2P9SA 4I9LA 3WUHA 1U45A 3CF5L 4FLUA 4K25A 1RDAA 1HNVA 2HSTA 3P4IA 1NJXA 4XH1A 1VRTA 3AARA 3TPQA 4KRFA 1C0FA 3SPZA 3O6WA 3U8XA 3DXKA 3G0ZA 2QWPA 3VQEA 3CQXA 4PKHA 4JKHA 5FLXO 3CPEA 3F5TA 2QK9A 2KTQA 4E1MA 3VOVA 3SNNA 2GTDA 3D6RA 3SQ4A 2UUCK 5JS2A 1B9FA 3VESA 1NNEA 2OPPA 1H1VA 3VQAA 1TL1A 3CCQN 3J7AP 2ETJA 3KLIA 4BVPA 2G8IA 3RMAA 3W0LA 4FK2A 1NGCA 3CFPA 1UA1A 2EX3A 2QKKA 1EX4A 3EL2A 4H0TB 1QVGM 4A5AA 1YIJN 3F9MA 2O8FB 4V19S 1XI1A 4DSIA 3KD5E 4YDUC 1XHZA 3FZMA 1EP4A 4KV8A 4BR5A 3U4LA 4E7KA 1L5UA 3K57A 2O8DA 2ZGYA 4X65K 2I5JA 3QFUA 4CZJA 3F2KA 1SL0A 2BTFA 5HBMA 1NGGA 1VSHA 3MN5A 4FK4A 2VWJA 3ID8A 1JLBA 4TSXA 5HOOA 3P1GA 5AQNA 4FYDA 4FLZA 5C0YA 3I33A 4B3TK 1BCOA 4EP4A 5BRDA 4M63C 1FKPA 4BVOA 3OYLA 4DSJA 1HNZK 3QDKA 1O13A 2P9IA 2D0PA 1GLDG 2E6MA 2FBXA 2W40A 4AF1A 2D0AA 3HBTA 4PY5A 4CEQA 3V9ZA 4FZYA 3AO3A 4JS4A 1UAXA 3ATVA 1NGHA 4M3WA 4IOXA 2A3ZA 4GV9A 4IG3A 1WN7A 4M3XA 3O9UA 3TAEA 3ISNC 1L3SA 2QKBA 5M1PA 4GW6A 3R3LA 3BZCA 3KIOA 3L6QA 4H5WA 4G1QA 1JXBA 4FJMA 5AQUA 2P9LB 2FBTA 2WOMA 3E01A 4ICLA 2UU9K 4KBOA 2B6AA 5EVZA 3CCJN 3JSMA 5M1KA 2YKMA 3CI5A 5I42A 2HHSA 5F0XA 3HO1A 5LMNK 3BF3A 4KHQA 4AHVA 4FZZA 2CGKA 3CIPA 4M45A 4IFVA 2Q1NA 3TU5A 4DFJA 2YCHA 3CYMA 3MX2A 1T05A 4YOYA 2UXBK 3UB5A 4DV6K 3VF6A 4ELUA 4JKAA 3RR8A 3CC7N 1ZBHA 3AY9A 4FOIA 1RILA 2G8UA 3FGUA 4DUZK 2QWOA 2E5LK 4IOAL 4BDZA 1Q8IA 2O4GA 4PQUA 1MA9B 2HHXA 3SJJA 2FBYA 4CEFA 3ZSOA 3WNGA 1QVFM 1QQCA 3TARA 1ZYQA 1M1KO 3FZKA 3U3YA 4O8UA 1ILYA 4H4MA 2FSNA 3M3ZA 3PSIA 4FLYA 4NXNK 3UIQA 1DT9A 2HHQA 5FPDA 3C7NB 1ZBSA 2UXCK 2W41A 4LF4K 5IT9O 4B9MA 2G8HA 3WQTA 1BIUA 1IV0A 3VQ6A 1LV5A 2ZGZA 1NOYA 3MXMA 3AA4A 2VQFK 1QHTA 2QM1A 4DTMA 2JWLA 1NK7A 4FPBA 3SAGA 2Q0UA 4DFPA 4EHTA 1WBBA 3CJ7A 2PYLA 1R59O 3VQ7A 4CGJA 5EY4A 2QA4N 1YITN 3H46O 1Q82O 1RTHA 5MLCQ 3G4SN 4E7HA 3SMPA 1WSHA 1HKBA 3D2EA 4PL7A 2PAVA 4KHPK 1VSEA 3NGIA 4G9ZA 4CK2A 3VTIA 1HJRA 5HLFA 4BRHA 3MXJA 4CGHA 2ZJRL 5CYMA 1VQPN 3K5OA 1OH7A 3EZWA 3OYAA 3IS9A 4CBUA 1K9MO 2IVPA 1CXQA 4AHRA 3DXMA 3A5MC 4F3OA 4NLCA 1W2BM 4J2BA 1V4SA 5DM6L 5CY4A 1EWRA 1TYQA 1S6QA 4FWOA 4Q0BA 3FR0A 3AVBA 1TKDA 1UOCA 2VWKA 4FLXA 2Y1JA 1QHAA 3OYMA 2XY5A 2P9LA 1WSGA 2YI1A 1VSMA 3V6DA 1X1PA 4O0IA 4JK9A 2BH1A 1U2VA 2EWSA 1K73O 4R79A 1KXPA 2F8SA 5AR0A 4KI6A 4EAHD 4FLTA 4FWNA 1L3VA 3VN5A 3AVLA 4DR2K 4LC9B 3MX5A 1VQKN 3AVAA 3GE1A 4XH5A 3RMBA 1NU0A 3ZLJA 3IRXA 3QBWA 1IBMK 4FL9A 3LZJA 1RBUA 3CCLN 4KB0A 1EXQA 4AHSA 5KPRA 1KRPA 3H3OB 1KFDA 4IZ9A 5KGWA 4M3RA 1D9DA 1GLFO 4Z4EA 3J7YP 3SUQA 4CGFA 3LDQA 1X9SA 4I7FA 3SJHA 3MCAB 4O55A 1R0AA 4CF1A 3B6OA 3LM2A 3O3FA 3CPWM 4MO4A 4ZHRA 3H1QA 5HRSA 3TWHA 2W6KA 4O8KA 5C10A 3NH2A 1B92A 3G25A 3S3NA 2HW3A 3D45A 5HL7L 3U9DA 2RKIA 4JS5A 3OYKA 4QS7A 5BRFA 5AQYA 4MQ3A 3ZSQA 3FE1A 1VSDA 4OLAA 2F9WA 4DF4A 2P9NA 1HUXA 4F2RA 4OPAA 2HHHK 4C8NA 5JLHA 4B1YB 1GLBG 2OCEA 4IFEA 5AQJA 2P5OA 4AHTA 4B9TA 4FLVA 3TI0A 4DU4A 5T7BA 2GUPA 3L4QA 1RBVA 2O8DB 3T1AA 1OVYA 3P83D 3OYBA 4CHNA 1NG9A 2HHTA 1BCMA 1D4XA 2E20A 3O1BA 4H03B 2KFZA 2Q2RA 1BQNA 5CYQA 4E1NA 3GBTA 2ASMA 2FSJA 5J2QA 3ID6A 4GVMA 1IH7A 1J9AA 2PBDA 3QO9A 3UKRA 3V9XA 3EKSA 5HROA 4F8RA 1NGJA 1QE1A 3KK3A 4N56A 5KPTA 3TSUA 3IG1A 4A2AA 1VQNN 4CJLA 3KKSA 2ITGA 2KLAA 3O4NA 1NKBA 2E2PA 4BRDA 1RT6A 1SQKA 1KC8O 4DR4K 2UXDK 3KWIA 3FZHA 2QWQA 1WUAA 4CZGA 4OLBA 3LAKA 3V1RA 2P1JA 4FVMA 1W7AA 3EO3A 4DWIA 2QWLA 2HHVA 3FFKB 4QS8A 4CJEA 4CZEA 3ZEUB 4JRPA 2F96A 2OZMA 2XY8A 3AO2A 2B4JA 1GOBA 4E7JA 4CJWA 3QEIA 4DSFA 4DR5K 3J7ZO 3UKUA 3LWMA 4OKEA 4DS5A 3AGKA 3HXMA 4FJGA 4WQ4C 3NF6A 4J2AA 1EO1A 1HKGA 3ZT4A 5KRSA 1TKXA 3NFAA 1LW2A 2B5JA 3DRSA 4RW9A 5GIOA 3OYGA 3QNOA 4KH5A 1BQMA 3O4WA 3O9TA 3SK3A 3M8SA 3L8BA 2P9SB 3MK6A 5ADXA 1M90O 1T44A 5DK5A 4EIAA 5BN9A 3LDLA 3QB0A 3PIPL 3EKUA 5E26A 4F9OA 5LJVA 4FJKA 4CVNE 2O8CB 4K8XA 1C0MA 4DTUA 4DFKA 3VGKA 4OPHA 1JCEA 4JKDA 1HPMA 2X6NA 1WNSA 3VEXA 4C1NK 4YY3K 4UY8O 2P9NB 2P9PB 3QBXA 3VETA 4NCGA 1RDDA 1NJIO 3HM8A 3QERA 4DR6K 3ZT2A 1QQNA 5HRPA 3PX0A 4CBWA 3NVMA 2A5XA 5LJWA 3HPHA 4C8LA 4DTOA 4FJHA 1N5YA 3P38A 3FLCO 1N36K 3Q7BA 2HHWA 4R5PA 2ZQBA 2CGLA 3MDQA 3C95A 1FKOA 1NK0A 3QIOA 5FPMA 4C23A 3GOIA 1NK9A 4GV6A 3H08A 1N32K 5GADP 3NE6A 3TAGA 1BG3A 3MAQA 4WQ5A 2F4VK 3VQCA 3SUOA 3SBTA 3DLBA 4EZ9A 5AQQA 4FWSA 1XNRK 3KVGA 1YJ9N 3VGMA 2FF6A 2E2NA 1XC9A 1WSFA 3DRRA 4FVUA 4EP5A 1K8KA 4B9UA 2XHBA 2OA8A 4OKJA 2ZJQL 1CLQA 3LANA 1Q86O 4IFYA 3N4QA
chains in the Genus database with same CATH topology
4IOXA 2A3ZA 2J4RA 4M7YA 2RHKA 1RGIA 2FXUA 4GV9A 3O9UA 1VQ6N 1GLJO 2YJFA 1K8KB 3O08A 2ZJPL 4A57A 1YHQN 5M1PA 4XH4A 2F9TA 3O9RA 3O80A 3R3LA 4YOXA 2E88A 2ZF5O 3OW2M 4H0XB 4YDUA 3G6EN 4BRQA 4MLEA 3P31A 1KD1O 2KHOA 4A5BA 3L6QA 4H5WA 1HLUA 3KWGA 4JD2B 4ISGA 1JCFA 3CCSN 3VMFB 4DHYA 2IVNA 2P9LB 5AQUA 2I7NA 4JN4A 1ZC6A 4CZHA 4BRFA 4KBOA 1WOQA 5EVZA 3FZLA 3Q7CA 5F1XA 4WFNL 2QEXN 1RFQA 4XEIA 3CCJN 3ZYYX 1XC3A 5M1KA 3CI5A 2PFUA 2Q31A 1Q81O 3DJCA 5CR4A 3MWPA 5F0XA 3BF3A 4FWMA 4PL8A 4A62A 5GAHP 2AP1A 2VWBA 1YUWA 1VQ7N 4CZFA 2CGKA 3CIPA 3DXMB 3UKRB 4H0YB 3SAHA 1ATSA 2Q1NA 3TU5A 1TUUA 5BPMA 2YCHA 2Q36A 3ATUA 2GX9A 4RCHA 1QZ5A 3SBGA 3MX2A 4CI6A 2D4WA 4YOYA 1KAXA 3KHYA 4ILHA 3UB5A 2FF3B 3I55N 3VF6A 4JKAA 3HOTA 1KQSM 5AFUH 3AY9A 1K8AO 3CC7N 5AQGA 1VQON 1NMDA 3WQUA 2UYTA 1S72N 4H0PA 4FOIA 3WXMB 2CH6A 3ULEA 4CZIA 1NGAA 2OTLN 3FGUA 2QTDA 3MMVA 2QWOA 3CJ1A 2VGNA 4IOCL 4IOAL 4I6MB 4BG8A 5AZIA 5M1NA 3CMAN 3WXKA 2RE2A 3L4IA 2P9UB 5BN8A 3HOSA 4JKGB 2P9PA 4FO0A 1MA9B 4K43A 3T69A 3LDOA 4BQZA 1RDWX 3R9PA 1NWKA 1RDUA 4C1NI 1QVFM 5EX5A 4Z94A 1IJJA 3LM9A 3BP8A 5AZIB 3C6AA 2OTJN 3MN6A 2FSKA 4CJ7A 2WFBA 1M1KO 3FZKA 5TKWA 1LOTB 4B1VA 1NGBA 3C65A 5AQKA 2HMPA 3BUZB 4O8UA 4BRNA 1ILYA 3A8YA 2FSNA 3DWLA 3M3ZA 1VQ9N 2V7ZA 2QWMA 1DT9A 4RWTA 5FPDA 3C7NB 2FLOA 1ZBSA 5EOYA 3J8AA 4JAXA 5EXWA 3VPZA 2W41A 3IKMA 1VQ8N 4BRMA 4IJNA 3WQTA 3OBYA 3CCEN 4JK8A 5C15A 3OHRA 3CCRN 5AQFA 2ZGZA 2H3GX 3CXCM 3E66A 3CMEN 4PHTX 1Z05A 5ADXH 4MLHA 4BG9A 2QM1A 3CHWA 2JWLA 2VYPA 3A5NC 3MN9A 5AQLA 4BRIA 3DAWA 1GLAG 4NB4A 5TKYA 4DQ8A 2QXLA 4JHDA 5FPEA 4FPBA 2NRWA 3U9ZA 3E9PA 3SAGA 1YJWN 3VF2A 3CCUN 4WYBA 4CBXA 1J6ZA 2GWKA 2Q0UA 4JD2A 3D2FA 4OO1J 4EHTA 4BC5A 1C0GA 3CJ7A 1R59O 4MDBA 1BDGA 5EY4A 4DB3A 5E84A 2QA4N 1SS6A 2WC9A 2QW9A 1YITN 3H46O 5F2RA 4K41A 3DLLL 3CETA 5JVHL 1Q82O 3EE9A 5MLCQ 3O9SA 2HF4A 3G4SN 3HRGA 3SMPA 1VQMN 4A59A 1HKBA 3D2EA 4PL7A 3I56N 2PAVA 3PIOL 3AAQA 4BQLA 5AQTA 4BRGA 3AAPA 4G9ZA 3QICA 3VTIA 1GLEG 4ISFA 3AGRA 3TTFA 4YOVA 4BRHA 4U7BA 1U2VB 2ZJRL 1T3VA 1VQPN 3C6HA 3EZWA 3S41A 1NGDA 4GNIA 2BUPA 4HWIA 4CBUA 1K9MO 2HF3A 2IVPA 2DPNA 2NLXA 4FWLA 4M7XA 4B1WB 4BGBA 5LY3A 1JJ2M 3C7NA 1VQ4N 3WXJA 5CE3A 1NBWA 3DXMA 3A5MC 3SAFA 3R1XA 4NLCA 1W2BM 2YJEA 3BF1A 1V4SA 3M1FA 5BPLA 5DM6L 1TYQA 1DKGD 2P9IB 1VQLN 2HOEA 3VEVA 4FWOA 4JEPA 3FR0A 4J8FA 4BR4A 2GELA 5GINA 4JKGA 3NVKA 1GLLO 2P9UA 1QHAA 3WT0A 1NM1A 3LL3A 1KAZA 4AM6A 1SZ2A 4JK7A 1BUPA 2P9LA 3VEYA 2YI1A 4BRCA 2I7PA 1QQOA 4Y0WA 2OANA 1ATNA 4JKFA 4JKEA 1Y64A 4IJAA 3HZ6A 1OKJA 4JK9A 1S3XA 2P9KA 1EQYA 3O8MA 5AQWA 3RSEB 3VTHA 2BH1A 1U2VA 2EWSA 5AQHA 1K73O 4R79A 4YOWA 1KXPA 3M6GA 3KK7A 1QQMA 4H0OA 4BRKA 5AQZA 5AR0A 5JICA 3EE8A 4EAHD 4FWNA 4NLBA 2QI2A 4PKGA 1U6ZA 3GG4A 4BR0A 4LC9B 3MX5A 5JVGL 1MWMA 1KAYA 1VQKN 3GE1A 4XH5A 3WXLA 3QBWA 4FL9A 3CCLN 3ENOA 3QFPA 5KPRA 3WXIA 3H3OB 4IZ9A 1X3NA 4BREA 4CD3A 3HI0A 3D2FB 5GIPA 4BROA 3T7ZA 2NZTA 1GLFO 2V51B 4IWVA 1TUYA 1LCUA 5I9EB 2NRHA 3LDQA 4KH4A 3CJCA 3CJAA 2E1ZA 3SJHA 3MCAB 4GY2B 3VEWA 5M1FA 2E8AA 1BO5O 1YXQA 2IVOA 3MCPA 3A5OC 3ENHA 4EFHA 1MDUB 4ILGB 3I8BA 3LM2A 3LDPA 3D7EO 3CPWM 4FWPA 4MO4A 4O5FA 1ESVA 3H1QA 4ILJA 1DGKN 2QWRA 3VGLA 4O8KA 3M5RA 2YHXA 1V4TA 2NRXA 5C10A 1DEJA 5JLFA 1X9JA 2HBKA 3CCMN 3G25A 4IXCA 5ELZA 4BRPA 3ZEUA 2JWKA 3EN9A 5DM7L 1MWKA 4FOEA 5M1OA 3D2EB 4YOUA 2A40A 4I6MA 3VERA 3U9DA 5HL7L 4IEIA 2E2QA 1Q18A 3R8EA 4GV3A 5AQXA 2VCPA 4QS7A 5BRFA 2A41A 5AQYA 3H45C 1YF5L 2HBJA 4FWRA 4L3QA 4K42A 4H5NA 2NRVA 3FE1A 3H3NO 3E1YA 3NMUA 3P39A 5KQ8A 1HKCA 2F9WA 3L0QA 2P9NA 1HUXA 3ZETB 1YAGA 4YORA 3G71N 3RVCA 2NRTA 4OPAA 1Z6RA 4BGAA 3GDQA 1VAZA 3CQYA 5JLHA 3CJ9A 4B1YB 1GLBG 3RSEA 3PLAA 4IFEA 1TYQB 4CD1A 4IO9L 3W3DA 5AQJA 4U67L 3MN7A 1W97L 3C0BA 4BR7A 2KKZA 2NNWA 4FWQA 2ASOA 4IDHA 2GUPA 3L4QA 5AQVA 1BU6O 2Q0RA 1OVYA 4JKCA 4H5TA 3BEXA 5BRHA 4A2BA 4WFBL 2E20A 1D4XA 4HTLA 3A5LC 3FZFA 1ATRA 4EHUA 3O1BA 4H03B 5BR9A 5C2FA 2Q2RA 2CGJA 3H6EA 3QMLA 5AZJB 3SLCA 3GBTA 4H5RA 2ASMA 4A61A 2FSJA 4AM7A 4DKWA 4CZLA 3ID6A 3GL1A 3CJBA 2PBDA 3UKRA 4B1ZA 3O5BA 4IO8A 2E2OA 3EKSA 4PKIA 2GEMA 2AA4A 4CZMA 5KQDA 3TSQA 3IUCA 3A0IX 3CC4N 1XUPO 2F7TA 1NGJA 2ASPA 1E4FT 1P8ZA 3TSUA 1BOTO 1E4GT 5KPTA 1NGFA 2D0OA 2WBNA 2NRRA 4A2AA 1VQNN 2GWJA 2VGMA 4GVEA 3K9JA 3K9KA 2KLAA 2E2PA 4BRDA 1N8RO 1SQKA 5AQMA 1KC8O 4DCHA 4FWKA 4YOTA 3IMXA 1YJNN 3ZX0A 3KWIA 3DXKB 1IG8A 3FZHA 2QWQA 1WUAA 3WEEB 5BPNA 3CCVN 3TSPA 4B1UB 4CZGA 1Q86O 4FPAA 3VEOA 2YX6A 3OA9A 3IDHA 5KPZA 2YHWA 1CZAN 2E1YA 2WUSA 3EO3A 1YVNA 2QWLA 3VF4A 3O1WA 3ULEB 3FFKB 4QS8A 3OBWA 4CZEA 4E1JA 1T6DA 3MWTA 3ZEUB 1YI2N 3JXUA 3H1VX 2CH5A 4CZKA 4BY9C 4FSVA 1BA1A 2P9SA 1HJOA 2V7YA 1T6CA 3UKUA 4BC2A 4WF9L 4BR2A 5AQSA 3AGKA 1ZXOA 3WUHA 3VEZA 3CF5L 4BC4A 4K25A 3O9QA 5C12A 4WQ4C 1EO1A 1HKGA 3JS6A 2HSTA 3P4IA 4XH1A 2D1KA 3LDNA 5GIOA 3AARA 4KH5A 3TPQA 4BR9A 5GAGP 3O4WA 3O9TA 3SK3A 1C0FA 3UE5A 3HSCA 2ITMA 2P9SB 3MK6A 3O6WA 4QS9A 3TTDA 3VENA 1T44A 5ADXA 3U8XA 3DXKA 1M90O 2QWPA 5AQRA 5AQPA 2V52B 3CQXA 4PKHA 4JKHA 5BN9A 4EIAA 1XQSC 3LDLA 3QB0A 3PIPL 3EKUA 5E26A 4F9OA 5LJVA 3CPEA 1NLVA 3F5TA 1HX1A 2QWNA 3VOVA 2GTDA 3D6RA 4H0VB 2A6AA 4WCEL 3VGKA 4OPHA 1JCEA 4JKDA 3B8AX 1HPMA 3VESA 4H5VA 4JHDB 1H1VA 3VEXA 4B9QA 4C1NK 4UY8O 3E9OA 3CCQN 4BVPA 4MDAA 2P9NB 3KZBA 3ZETA 3ENBA 4IEEA 3W0LA 2P9PB 3QBXA 3VETA 2NRZA 1NGCA 4B1XB 1NJIO 3HM8A 2A42A 4ISEA 3HTVA 4H0TB 3EL2A 1QVGM 1QQNA 1VQ5N 3ZX2A 5CHIA 4A5AA 1YIJN 3F9MA 4CBWA 3NVMA 2A5XA 1GLCG 5LJWA 5AQIA 4YDUC 5B8HA 3FZMA 2YHYA 2ZWHA 5M1QA 3P38A 4WQ5C 3FLCO 4BR5A 3Q7BA 3U4LA 5JMVA 1S22A 4MO5A 4JKBA 4WFAL 2CGLA 2ZGYA 3MDQA 3QFUA 4CZJA 3F2KA 5AZJA 2BTFA 1NGGA 5FPMA 3UKUB 3GOIA 4BRAA 4C23A 4GV6A 3MN5A 5GADP 3R6MA 2IIRA 1BG3A 4KH6A 1P90A 1SAZA 3ID8A 3SMSA 1X3MA 4WQ5A 5AFUA 5HOOA 1G99A 4RTFD 1QZ6A 3SBTA 4NO7A 3E9LA 3CD6N 5AQNA 5C0YA 1BA0A 5FPNA 3I33A 3TTCA 5AQQA 5BRDA 4FWSA 1JCGA 1BWFO 4M63C 4BC3A 4BVOA 3KVGA 3J7ZO 3VGMA 5C2DA 2FF6A 2E2NA 3WEEA 1YJ9N 3CERA 5BREA 3QDKA 2Q97A 1O13A 3CC2N 2P9IA 2D0PA 2HBLA 1GLDG 5H1SQ 2W40A 4AF1A 2HBMA 3HBTA 4FVUA 1K8KA 3IFRA 5GAEP 4WQ4A 1NGEA 2ZJQL 1Q7YO 4JNEA 2P9KB 3N4PA 4BRLA 3ATVA 3ZX3A 1NGHA 3N4QA 1NGIA 5AQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3Z A;  2J4R A;  4M7Y A;  1RGI A;  2FXU A;  1GLJ O;  2YJF A;  1K8K B;  3O08 A;  4XH4 A;  2F9T A;  3O80 A;  2E88 A;  2ZF5 O;  4H0X B;  4YDU A;  4BRQ A;  4MLE A;  2KHO A;  3L6Q A;  4H5W A;  1HLU A;  4JD2 B;  4ISG A;  1JCF A;  4DHY A;  2IVN A;  2P9L B;  5AQU A;  2I7N A;  4JN4 A;  1ZC6 A;  4CZH A;  4BRF A;  4KBO A;  1WOQ A;  5EVZ A;  3FZL A;  5F1X A;  1RFQ A;  4XEI A;  1XC3 A;  3CI5 A;  2Q31 A;  3DJC A;  5F0X A;  3BF3 A;  4FWM A;  4PL8 A;  4A62 A;  2AP1 A;  2VWB A;  1YUW A;  4CZF A;  2CGK A;  3CIP A;  3DXM B;  3UKR B;  4H0Y B;  1ATS A;  2Q1N A;  3TU5 A;  1TUU A;  5BPM A;  2YCH A;  2Q36 A;  3ATU A;  4RCH A;  1QZ5 A;  4CI6 A;  2D4W A;  1KAX A;  3KHY A;  3UB5 A;  2FF3 B;  3VF6 A;  5AFU H;  3AY9 A;  5AQG A;  1NMD A;  3WQU A;  2UYT A;  4H0P A;  4FOI A;  2CH6 A;  3ULE A;  4CZI A;  1NGA A;  3FGU A;  3MMV A;  2QWO A;  3CJ1 A;  4I6M B;  4BG8 A;  5AZI A;  3WXK A;  3L4I A;  2P9U B;  5BN8 A;  2P9P A;  4FO0 A;  1MA9 B;  4K43 A;  3LDO A;  4BQZ A;  1RDW X;  3R9P A;  1NWK A;  5EX5 A;  4Z94 A;  1IJJ A;  3LM9 A;  3BP8 A;  5AZI B;  3MN6 A;  2FSK A;  4CJ7 A;  3FZK A;  1LOT B;  4B1V A;  1NGB A;  5AQK A;  2HMP A;  3BUZ B;  4BRN A;  3A8Y A;  2FSN A;  3DWL A;  3M3Z A;  2V7Z A;  2QWM A;  4RWT A;  5FPD A;  3C7N B;  2FLO A;  1ZBS A;  5EOY A;  3J8A A;  4JAX A;  5EXW A;  3VPZ A;  2W41 A;  4BRM A;  4IJN A;  3WQT A;  3OHR A;  5AQF A;  2ZGZ A;  2H3G X;  5ADX H;  1Z05 A;  4MLH A;  4BG9 A;  2QM1 A;  3CHW A;  2VYP A;  3A5N C;  3MN9 A;  5AQL A;  4BRI A;  3DAW A;  1GLA G;  4NB4 A;  5TKY A;  4DQ8 A;  2QXL A;  4JHD A;  5FPE A;  4FPB A;  3U9Z A;  3VF2 A;  4WYB A;  4CBX A;  1J6Z A;  2GWK A;  2Q0U A;  4JD2 A;  3D2F A;  4EHT A;  4BC5 A;  1C0G A;  3CJ7 A;  1R59 O;  1BDG A;  5EY4 A;  4DB3 A;  5E84 A;  2QW9 A;  3H46 O;  5F2R A;  4K41 A;  3CET A;  2HF4 A;  3SMP A;  1HKB A;  3D2E A;  4PL7 A;  2PAV A;  3AAQ A;  4BQL A;  5AQT A;  4BRG A;  3AAP A;  3QIC A;  1GLE G;  4ISF A;  4BRH A;  1U2V B;  3EZW A;  3S41 A;  1NGD A;  4GNI A;  2BUP A;  4HWI A;  4CBU A;  2HF3 A;  2IVP A;  2DPN A;  2NLX A;  4FWL A;  4M7X A;  4B1W B;  4BGB A;  5LY3 A;  3C7N A;  3WXJ A;  5CE3 A;  1NBW A;  3DXM A;  3A5M C;  2YJE A;  3BF1 A;  1V4S A;  3M1F A;  5BPL A;  1TYQ A;  1DKG D;  2P9I B;  2HOE A;  3VEV A;  4FWO A;  3FR0 A;  4J8F A;  4BR4 A;  2GEL A;  1GLL O;  2P9U A;  1QHA A;  3WT0 A;  1NM1 A;  3LL3 A;  1KAZ A;  4AM6 A;  1SZ2 A;  1BUP A;  2P9L A;  3VEY A;  2YI1 A;  4BRC A;  2I7P A;  1QQO A;  4Y0W A;  2OAN A;  1ATN A;  1Y64 A;  4IJA A;  3HZ6 A;  1OKJ A;  3RSE B;  1S3X A;  2P9K A;  1EQY A;  3O8M A;  5AQW A;  2EWS A;  1U2V A;  5AQH A;  1KXP A;  3M6G A;  4H0O A;  1QQM A;  4BRK A;  5AQZ A;  5AR0 A;  5JIC A;  4EAH D;  4FWN A;  4PKG A;  1U6Z A;  3GG4 A;  4BR0 A;  4LC9 B;  1MWM A;  1KAY A;  3GE1 A;  4XH5 A;  3WXL A;  3QBW A;  4FL9 A;  3ENO A;  3QFP A;  5KPR A;  3WXI A;  3H3O B;  4IZ9 A;  1X3N A;  4BRE A;  4CD3 A;  3HI0 A;  3D2F B;  4BRO A;  2NZT A;  1GLF O;  2V51 B;  4IWV A;  1TUY A;  1LCU A;  5I9E B;  2NRH A;  3LDQ A;  3CJC A;  3CJA A;  2E1Z A;  3SJH A;  4GY2 B;  3VEW A;  2E8A A;  1BO5 O;  1YXQ A;  2IVO A;  3MCP A;  3A5O C;  3ENH A;  4EFH A;  1MDU B;  3I8B A;  3LM2 A;  3LDP A;  3D7E O;  4FWP A;  4MO4 A;  4O5F A;  1ESV A;  3H1Q A;  1DGK N;  2QWR A;  3VGL A;  4O8K A;  2YHX A;  1V4T A;  1DEJ A;  5JLF A;  1X9J A;  3G25 A;  4IXC A;  5ELZ A;  4BRP A;  3ZEU A;  3EN9 A;  1MWK A;  4FOE A;  3D2E B;  2A40 A;  4I6M A;  3VER A;  3U9D A;  2E2Q A;  1Q18 A;  3R8E A;  5AQX A;  2VCP A;  4QS7 A;  5BRF A;  2A41 A;  5AQY A;  3H45 C;  4FWR A;  4L3Q A;  4K42 A;  4H5N A;  3H3N O;  3FE1 A;  5KQ8 A;  1HKC A;  2F9W A;  3L0Q A;  2P9N A;  1HUX A;  3ZET B;  1YAG A;  1Z6R A;  4BGA A;  3GDQ A;  3CQY A;  5JLH A;  3CJ9 A;  4B1Y B;  1GLB G;  3RSE A;  4CD1 A;  1TYQ B;  3W3D A;  5AQJ A;  3MN7 A;  3C0B A;  4BR7 A;  4FWQ A;  2ASO A;  2GUP A;  5AQV A;  1BU6 O;  2Q0R A;  4H5T A;  3BEX A;  5BRH A;  4A2B A;  2E20 A;  1D4X A;  4HTL A;  3A5L C;  3FZF A;  1ATR A;  4EHU A;  3O1B A;  4H03 B;  5BR9 A;  2Q2R A;  2CGJ A;  3H6E A;  3QML A;  5AZJ B;  3SLC A;  3GBT A;  4H5R A;  2ASM A;  4A61 A;  2FSJ A;  4AM7 A;  4CZL A;  3GL1 A;  3CJB A;  2PBD A;  3UKR A;  4B1Z A;  3O5B A;  4IO8 A;  2E2O A;  3EKS A;  4PKI A;  2GEM A;  2AA4 A;  4CZM A;  5KQD A;  3IUC A;  3A0I X;  1XUP O;  1NGJ A;  2ASP A;  1E4F T;  1P8Z A;  5KPT A;  1BOT O;  1E4G T;  1NGF A;  2D0O A;  4A2A A;  2GWJ A;  2E2P A;  4BRD A;  1SQK A;  5AQM A;  4DCH A;  4FWK A;  3IMX A;  3ZX0 A;  3DXK B;  1IG8 A;  3FZH A;  2QWQ A;  1WUA A;  3WEE B;  5BPN A;  4B1U B;  4CZG A;  4FPA A;  3VEO A;  3IDH A;  5KPZ A;  2YHW A;  1CZA N;  2E1Y A;  2WUS A;  3EO3 A;  1YVN A;  2QWL A;  3VF4 A;  3O1W A;  3ULE B;  3FFK B;  4QS8 A;  4CZE A;  4E1J A;  1T6D A;  3ZEU B;  3JXU A;  3H1V X;  2CH5 A;  4CZK A;  4FSV A;  1BA1 A;  2P9S A;  1HJO A;  2V7Y A;  1T6C A;  3UKU A;  4BC2 A;  4BR2 A;  5AQS A;  1ZXO A;  3WUH A;  3VEZ A;  4BC4 A;  4K25 A;  4WQ4 C;  1HKG A;  3JS6 A;  3P4I A;  4XH1 A;  2D1K A;  3LDN A;  3AAR A;  3TPQ A;  4BR9 A;  3O4W A;  3SK3 A;  1C0F A;  3UE5 A;  3HSC A;  2ITM A;  2P9S B;  3MK6 A;  3O6W A;  4QS9 A;  3VEN A;  5ADX A;  1T44 A;  3U8X A;  3DXK A;  2QWP A;  5AQR A;  5AQP A;  2V52 B;  3CQX A;  4PKH A;  5BN9 A;  4EIA A;  1XQS C;  3LDL A;  3QB0 A;  3EKU A;  5E26 A;  4F9O A;  5LJV A;  1NLV A;  1HX1 A;  2QWN A;  3VOV A;  2GTD A;  4H0V B;  2A6A A;  3VGK A;  1JCE A;  3B8A X;  1HPM A;  3VES A;  4H5V A;  4JHD B;  1H1V A;  3VEX A;  4B9Q A;  4BVP A;  2P9N B;  3KZB A;  3ZET A;  3W0L A;  2P9P B;  3QBX A;  3VET A;  1NGC A;  4B1X B;  3HM8 A;  2A42 A;  4ISE A;  3HTV A;  4H0T B;  3EL2 A;  1QQN A;  3ZX2 A;  3F9M A;  4CBW A;  2A5X A;  1GLC G;  5LJW A;  5AQI A;  4YDU C;  5B8H A;  3FZM A;  2YHY A;  2ZWH A;  4WQ5 C;  3FLC O;  4BR5 A;  3U4L A;  5JMV A;  1S22 A;  4MO5 A;  2CGL A;  2ZGY A;  3MDQ A;  3QFU A;  4CZJ A;  5AZJ A;  2BTF A;  1NGG A;  5FPM A;  3UKU B;  3GOI A;  4BRA A;  4C23 A;  3MN5 A;  3R6M A;  2IIR A;  1BG3 A;  1SAZ A;  3ID8 A;  3SMS A;  1X3M A;  4WQ5 A;  5AFU A;  1G99 A;  4RTF D;  1QZ6 A;  4NO7 A;  5AQN A;  1BA0 A;  5FPN A;  3I33 A;  5AQQ A;  5BRD A;  4FWS A;  1JCG A;  1BWF O;  4M63 C;  4BC3 A;  4BVO A;  3KVG A;  3VGM A;  2FF6 A;  2E2N A;  3WEE A;  3CER A;  5BRE A;  3QDK A;  2Q97 A;  2P9I A;  2D0P A;  1GLD G;  2W40 A;  3HBT A;  1K8K A;  3IFR A;  4WQ4 A;  1NGE A;  4JNE A;  2P9K B;  4BRL A;  3ATV A;  3ZX3 A;  1NGH A;  1NGI A;  5AQO A; 
#chains in the Genus database with same CATH topology
 3EYZ A;  4DQQ A;  2W6L A;  4NXM K;  1VQ6 N;  2ZE2 A;  2YJF A;  3CQ8 A;  1Z25 A;  4A57 A;  2ZJP L;  1NKC A;  5LL6 Z;  4XH4 A;  3O80 A;  4J2E A;  4YDU A;  3G6E N;  3OS2 A;  1KD1 O;  4LY7 A;  3KLH A;  1HLU A;  3HST B;  3LDS A;  4HUG A;  5CZ2 A;  3G10 A;  4CZH A;  3QET A;  1WOQ A;  3FFI A;  3Q7C A;  5F1X A;  2QEX N;  3ZSV A;  1RFQ A;  4XEI A;  3ZYY X;  4LSL A;  3OYE A;  3PY8 A;  2X74 A;  2PFU A;  2Q31 A;  1Q81 O;  1YT3 A;  5CR4 A;  4CJF A;  2G8K A;  3RR7 A;  4A62 A;  4PL8 A;  3QEX A;  1VQ7 N;  3DXM B;  3UKR B;  4H0Y B;  4FCY A;  3NF9 A;  3ATU A;  1QZ5 A;  4CI6 A;  3QEP A;  4Z4I A;  1KAX A;  4N5S A;  1VSK A;  1NJY A;  2WON A;  2FF3 B;  4BWJ A;  3I55 N;  5AFU H;  1VQO N;  1NMD A;  1S72 N;  2O4I A;  3HP9 A;  1RNH A;  3ULE A;  1S5J A;  1XWL A;  2OTL N;  2QTD A;  2YNG A;  4PWD A;  1K6Y A;  4BG8 A;  2RE2 A;  3L4I A;  5BN8 A;  3TAB A;  1OH5 A;  1EWQ A;  3AV9 A;  1VHX A;  4KO0 A;  4RW8 A;  4BQZ A;  1T7P A;  3R9P A;  3RRG A;  1RDU A;  3TAQ A;  4C1N I;  4KTQ A;  3LM9 A;  3VQP A;  2HNZ A;  3MN6 A;  4CJ7 A;  1D9F A;  5TKW A;  1NGB A;  4CJS A;  3BUZ B;  4BRN A;  1BIZ A;  1VSL A;  2QWM A;  3J8A A;  4JAX A;  1JLE A;  2YNH A;  4GMJ B;  4JK8 A;  5C15 A;  3M8R A;  4Z4F A;  5C25 A;  3CXC M;  3E66 A;  4CEB A;  4DR3 K;  4PHT X;  1Z05 A;  4LF8 K;  1HNW K;  4BDY A;  2WTU A;  4DLG A;  5AQL A;  2RF2 A;  4QOZ B;  4DQ8 A;  4LFB K;  1S1V A;  3CCU N;  1IO2 A;  3SPY A;  4JD2 A;  4OO1 J;  3DLK A;  1J53 A;  4BC5 A;  4OJR A;  3U6F A;  1HRH A;  1VSJ A;  4K41 A;  3ZSY A;  4Z0U A;  3HVT A;  2HF4 A;  2YHA A;  1VQM N;  4A59 A;  4CJ3 A;  4BQL A;  5AQT A;  3AAP A;  3QIC A;  3V81 A;  3C6U A;  3BDP A;  1NOZ A;  2YNI A;  2XO7 A;  1GLE G;  4U7B A;  4YOV A;  1BIS A;  1NGD A;  3HPG A;  2NLX A;  4B1W B;  1SL1 A;  4DV1 K;  3C7N A;  3KLG A;  3ZT3 A;  5CE3 A;  3SAF A;  3R1X A;  4CCH A;  1HNI A;  1DKG D;  2P9I B;  3OJU A;  2HOE A;  1VQL N;  3VEV A;  2GEL A;  4JKG A;  4PA1 A;  3L2R A;  1VRU A;  2G8W A;  2P9U A;  1NM1 A;  3LL3 A;  4AM6 A;  3VEY A;  2I7P A;  2P51 A;  3NF8 A;  4JKF A;  4JKE A;  3HZ6 A;  4HVJ A;  3M6G A;  3S3O A;  4CJT A;  4O44 A;  4LF5 K;  1J5O A;  4DS4 A;  2QI2 A;  1U6Z A;  3GG4 A;  1Y97 A;  2OPQ A;  1IBK K;  5JVG L;  1T8E A;  2JLE A;  5HRR A;  3WXI A;  4HUE A;  3SQ0 A;  4BRE A;  1I39 A;  4BRO A;  3T7Z A;  2EHG A;  1QSS A;  3T19 A;  1DTT A;  1IG9 A;  5I9E B;  4DQI A;  2O8E A;  3K0S A;  3F9K A;  4GY2 B;  3SV3 A;  4Y1C A;  2E8A A;  5IWA K;  4CIF A;  1YXQ A;  3MCP A;  3ENH A;  1OVQ A;  1ZBL A;  4FWP A;  4AH9 A;  1JLQ A;  1ESV A;  1TVR A;  1U4B A;  1RBR A;  3OS0 A;  3L2Q A;  1DGK N;  3VGL A;  3NHG A;  5AJ3 K;  2HVH A;  4FZX C;  4CJK A;  1KFS A;  4IXC A;  5ELZ A;  3ZEU A;  4YFU A;  3EN9 A;  3RRH A;  2IOC A;  3R8E A;  1Q18 A;  5I3U A;  1W0H A;  4KAZ A;  1IKY A;  2A41 A;  1RDB A;  1YF5 L;  2HNY A;  4K42 A;  4H5N A;  5D3G A;  4B3M K;  3NMU A;  3AO1 A;  4FM0 A;  3LAM A;  1HKC A;  1NJW A;  3ZET B;  1YTU A;  3PUF A;  3G71 N;  4YOR A;  2KZZ A;  2NRT A;  1Q9X A;  3GDQ A;  3HP6 A;  1RDC A;  4M41 A;  3CQY A;  4KB1 A;  3PLA A;  4CD1 A;  3RMC A;  4U67 L;  3MN7 A;  3C0B A;  3VQD A;  2NNW A;  2O8C A;  4IDH A;  3AVI A;  2Q0R A;  4QCL A;  3BEX A;  2VG5 A;  2FBV A;  1C6V A;  3MXI A;  3THW B;  4WFB L;  3A5L C;  5C2F A;  5AZJ B;  4JI1 K;  3SLC A;  4DU1 A;  3M8P A;  4DKW A;  3THX A;  3GL1 A;  1TGO A;  3CJB A;  5C42 A;  4FM2 A;  3OTO K;  4O5B A;  4B1Z A;  3A2F A;  4CE9 A;  2AA4 A;  4CZM A;  1ASV A;  5KQD A;  3CC4 N;  1XUP O;  2F7T A;  2ASP A;  4DQR A;  1JL1 A;  1NGF A;  2D0O A;  2WBN A;  4DTX A;  1TAQ A;  3PO5 A;  4GVE A;  1WAJ A;  4UQG A;  1N8R O;  1RTJ A;  4FWK A;  3ZX0 A;  1NJZ A;  5BPN A;  4HUF A;  4FJX A;  3I0R A;  4E7I A;  2YX6 A;  3WNE A;  2BGG A;  3MWT A;  4GKJ K;  3NBP A;  4CZK A;  3LPT A;  2V7Y A;  4BC2 A;  4WF9 L;  4BC4 A;  2DY4 A;  3O9Q A;  5C12 A;  1XMO K;  1HYS A;  4DSE A;  2D1K A;  2O8B A;  3DLG A;  4BR9 A;  5GAG P;  2OYQ A;  1C0U A;  2O8F A;  3HSC A;  2ITM A;  3TTD A;  4QS9 A;  4FJ5 A;  5AQR A;  5AQP A;  3LWL A;  1XQS C;  4CFD A;  1NLV A;  1HX1 A;  4LH4 A;  2QWN A;  4WCE L;  2A6A A;  1W9H A;  1S6P A;  4BE1 A;  4CFB A;  3B8A X;  5E41 A;  4H5V A;  4JHD B;  4CK1 A;  4B9Q A;  3KK1 A;  3T1Y K;  4NCB A;  3K5L A;  4FJN A;  2XY7 A;  4CEC A;  3ZET A;  3KZB A;  3VQ8 A;  3TAN A;  4B1X B;  2X6S A;  4DV4 K;  2A42 A;  3ZX2 A;  5CHI A;  4LF9 K;  5AQI A;  5B8H A;  3HJF A;  4JLH A;  4CJP A;  2YHY A;  2ZWH A;  4B3O A;  5M1Q A;  4NYN A;  5JMV A;  4MO5 A;  4JKB A;  4WFA L;  5AZJ A;  3L2W A;  4N47 A;  3UKU B;  1HQE A;  3R6M A;  1TK0 A;  1P90 A;  1SAZ A;  1X3M A;  1G99 A;  4NO7 A;  4FW2 A;  3CD6 N;  2OZS A;  3VA0 A;  5FRM A;  1BA0 A;  1JLF A;  1L3U A;  1BWF O;  1NK4 A;  3WEE A;  1U04 A;  3CER A;  4CIE A;  5BRE A;  3OVN A;  3CC2 N;  3NF7 A;  3ASM A;  4B9N A;  2HBL A;  5H1S Q;  3KJV A;  3IFR A;  3KLF A;  4KRE A;  3CM6 A;  5GAE P;  2DFF A;  1Q7Y O;  2F8T A;  3N4P A;  2OPR A;  3OYD A;  1LWC A;  1NGI A;  5AQO A;  1RGI A;  2E4L A;  3OY9 A;  3DM2 A;  1GLJ O;  2DFE A;  1K8K B;  4X66 K;  4Q5V A;  1WBD A;  1E3M A;  3ITH A;  2F9T A;  5C24 A;  4YOX A;  2E88 A;  2OPS A;  4H0X B;  3SUP A;  4CJU A;  4MLE A;  3P5J A;  2KHO A;  4DSK A;  3KWG A;  4B9S A;  3K2P A;  4B8C A;  2HND A;  4DHY A;  4C8M A;  1KVA A;  4JN4 A;  4E0D A;  4BRF A;  4CEZ A;  1RT2 A;  3MED A;  4H8K A;  1GOC A;  4FJL A;  3V1O A;  3DLE A;  4B3S K;  3O3G A;  2ZD1 A;  3CM5 A;  5GAH P;  2AP1 A;  2G8F A;  1ATS A;  5BPM A;  1TUU A;  4RW4 A;  2Q36 A;  3DMJ A;  1NKE A;  2XRI A;  2D4W A;  1RTD A;  1K8A O;  3TAF A;  5AQG A;  3NH0 A;  2R7Y A;  1LAW A;  5K14 A;  3WXM B;  3LP0 A;  3MMV A;  4OGC A;  4I6M B;  5AZI A;  5M1N A;  3CMA N;  4AIL C;  3PV8 A;  3WXK A;  4K8Z A;  3HOS A;  4JKG B;  4O0J A;  1TL3 A;  5SZT A;  2IDO A;  4K43 A;  3T69 A;  3LDO A;  4DV7 K;  4M3U A;  1NWK A;  4ID5 A;  4IDK A;  1IJJ A;  2OTJ N;  3C6A A;  3AA5 X;  4DTS A;  1S1X A;  3V9U A;  2FSK A;  2WFB A;  4NCA A;  1LOT B;  1LAV A;  2HMP A;  1N34 K;  2BE2 A;  1VK0 A;  3AA2 A;  2V7Z A;  3D0P A;  1LWF A;  4RWT A;  3NAE A;  1VQ8 N;  5KI6 A;  4BRM A;  3LPU A;  2P5G A;  3OBY A;  4E7L A;  1C1C A;  2Z1H A;  3OHR A;  3CCR N;  2DTU A;  1KLM A;  3EEQ A;  3C6T A;  3CME N;  1HPZ A;  2VYP A;  3A5N C;  4BRI A;  4M3Z A;  3DAW A;  3BZK A;  5TKY A;  2QXL A;  4JHD A;  4CJQ A;  1QTM A;  2Z1I A;  4K0K K;  3VF2 A;  3O4Q A;  4WYB A;  4CBX A;  1OH8 A;  5JS1 A;  1C0G A;  3PX4 A;  5E84 A;  1SS6 A;  2WC9 A;  1JLA A;  3DLL L;  3CET A;  5JVH L;  1F21 A;  1RT4 A;  2E6L A;  3EE9 A;  3O9S A;  1XMQ K;  3C94 A;  4KTW A;  4ZTF A;  3ZT0 A;  4YHH K;  3I56 N;  4DLE A;  4EZ6 A;  3QIP A;  3PIO L;  3AAQ A;  3HVR A;  4BRG A;  1O1W A;  1C1A A;  1RT1 A;  3DRP A;  2X78 A;  3JAM O;  3TTF A;  3AGR A;  1U2V B;  1T3V A;  3C6H A;  3S41 A;  4GNI A;  4HWI A;  2BUP A;  3NCI A;  5FDL A;  4LFA K;  4M7X A;  5LY3 A;  4FWL A;  1VQ4 N;  3AVN A;  3WXJ A;  4CES A;  3KK2 A;  5FRO A;  3QES A;  3BF1 A;  5BPL A;  4LFC K;  1FJG K;  2UUB K;  4BE2 A;  4JEP A;  4BR4 A;  3THY B;  5GIN A;  3NVK A;  1GLL O;  3WNH A;  1C0T A;  1KCF A;  3WT0 A;  4JK7 A;  1BUP A;  4W5O A;  4BRC A;  1BGX T;  4Y0W A;  2OAN A;  1ATN A;  3QEW A;  2HB5 A;  1JKH A;  3O8M A;  5AQW A;  3L2U A;  4DV5 K;  4YOW A;  3PO4 A;  5DMR A;  3BGR A;  3KK7 A;  1QQM A;  2VG7 A;  1Z26 A;  4Z4C A;  4DUY K;  3LAL A;  4NLB A;  4PKG A;  4FW1 A;  3THW A;  1NK6 A;  1KAY A;  3LP1 A;  3ZCM A;  2G8V A;  3WNF A;  3LP3 A;  2PYJ A;  4OVL A;  4DSL A;  3ENO A;  3QFP A;  4JI5 K;  3V4I A;  3NGY A;  1G15 A;  4CD3 A;  4FJI A;  2RPI A;  4HHT A;  3SYZ A;  3DYA A;  3HI0 A;  3D2F B;  5GIP A;  5KGX A;  4KHU A;  3B6P A;  1RT3 A;  2VG6 A;  2W42 A;  1WSI A;  3CJC A;  3CJA A;  3T3F A;  2E1Z A;  3VEW A;  1VSI A;  4DG1 A;  4W5N A;  5M1F A;  1BO5 O;  4LSN A;  3S3M A;  3A5O C;  4IKF A;  1MDU B;  4ILG B;  2O8B B;  3I8B A;  3K5N A;  3LDP A;  3D7E O;  1ZBI A;  1IKW A;  3T1H K;  4FJJ A;  2GUI A;  1C1B A;  3AVK A;  4ILJ A;  2QWR A;  2NRX A;  4H4O A;  4N76 A;  1X9J A;  3CCM N;  4KHN A;  1RT7 A;  1IKV A;  1MWK A;  3L2V A;  3D2E B;  4YOU A;  4CW7 B;  3VER A;  3OYC A;  4IEI A;  2E2Q A;  4GV3 A;  4OPJ A;  3HK2 A;  1QSY A;  5AQX A;  4CFC A;  2VCP A;  4FWR A;  3OYF A;  3NDK A;  3TAM A;  3H3N O;  3SQ2 A;  3E1Y A;  3P39 A;  3SUN A;  1Q9Y A;  1SKR A;  1ZBF A;  4M3T A;  1NMN A;  3RVC A;  3EZ5 A;  1Z6R A;  4BGA A;  1VAZ A;  2RN2 A;  4QAG A;  2D0C A;  3RSE A;  4KTZ A;  1TYQ B;  4IO9 L;  3W3D A;  4ZTJ A;  3HM9 A;  1WB9 A;  1W97 L;  4BR7 A;  4F2S A;  2KKZ A;  2JGU A;  2NUB A;  2ASO A;  4DQP A;  4JKC A;  4RG8 A;  3DOL A;  4OKK A;  4BWM A;  3CFR A;  2BDP A;  4HTL A;  4EHU A;  5LMU K;  1JLC A;  4A61 A;  4CHO A;  4CZL A;  2E2O A;  2KFN A;  4PKI A;  2ATQ A;  5FRN A;  1X9M A;  1N6Q A;  2D0B A;  4DQS A;  4DTJ A;  4HCC A;  1E4F T;  1P8Z A;  4OGE A;  1E4G T;  3M8Q A;  2HHU A;  2GWJ A;  2VGM A;  3K9K A;  4KKO A;  5J2N A;  1U48 A;  5AQM A;  1WSE A;  4DCH A;  4YOT A;  1HYV A;  3DXK B;  1IG8 A;  1N33 K;  3WEE B;  3CCV N;  3TSP A;  4FPA A;  3VEO A;  3IDH A;  5KPZ A;  2YHW A;  1CZA N;  1I3A A;  4L8R B;  4LF6 K;  1YVN A;  1TK8 A;  3OBW A;  3ZSX A;  4E1J A;  3QNN A;  3KTQ A;  1ASU A;  3ULD A;  4KPY A;  3H1V X;  2CH5 A;  4X62 K;  4BY9 C;  2YV0 X;  3HYF A;  5HRN A;  1BA1 A;  1HJO A;  1T6C A;  4BR2 A;  5AQS A;  1ZXO A;  2YNF A;  1WAF A;  1TK5 A;  3VEZ A;  3QEV A;  1D5A A;  3V9W A;  4E3S A;  1YVU A;  3JS6 A;  1NK8 A;  3SV4 A;  3LDN A;  1LW0 A;  3SQ1 A;  1FXX A;  2VQE K;  3RWU A;  4JI6 K;  3O3H A;  3SCX A;  4PUO A;  3UE5 A;  3LP2 A;  3VEN A;  4ELT A;  3PSF A;  1B9D A;  2V52 B;  3HPO A;  1TKT A;  3KLE A;  4BAC A;  1TKZ A;  1QSL A;  1U47 A;  3K5M A;  4NYF A;  4H0V B;  4IBN A;  3OS1 A;  3VQ4 A;  4JRQ A;  3E9O A;  3AVH A;  4CGD A;  4HTU A;  4MDA A;  3ENB A;  4IEE A;  2NRZ A;  1KSP A;  4CGI A;  3L3V A;  4FM1 A;  4ISE A;  3HTV A;  1VQ5 N;  1DLO A;  1GLC G;  1HR0 K;  4DU3 A;  4WQ5 C;  4CJV A;  1J5E K;  1S22 A;  3SZ2 A;  4BRA A;  2IIR A;  4OX9 K;  4KH6 A;  3SMS A;  1EKE A;  4DTR A;  5AFU A;  1OH6 A;  4RTF D;  1QZ6 A;  1XHX A;  3E9L A;  5FPN A;  2IAJ A;  3TTC A;  1CZB A;  1JCG A;  3HT3 A;  1RTI A;  4BC3 A;  1BI4 A;  5C2D A;  2O8E B;  1SV5 A;  4X64 K;  2Q97 A;  1TAU A;  2HBM A;  2KZM A;  2GBZ A;  4WQ4 A;  1NGE A;  4JNE A;  2P9K B;  3AVF A;  4BRL A;  3ZX3 A;  4DB3 A;  3DLH A;  2J4R A;  4M7Y A;  2RHK A;  2FXU A;  3TR8 A;  3OJS A;  4IG0 A;  3O08 A;  3OYI A;  1YHQ N;  4CK3 A;  4CHY A;  3O9R A;  2ZF5 O;  3OW2 M;  5CZ1 A;  4BRQ A;  3P31 A;  4A5B A;  4JD2 B;  4ISG A;  3J80 O;  1JCF A;  2ZM6 K;  3CCS N;  3VMF B;  2IVN A;  2PZS A;  3CFO A;  2I7N A;  1ZC6 A;  1FK9 A;  3FZL A;  4JI7 K;  4WFN L;  1RBS A;  1WLJ A;  1XC3 A;  2Z1G A;  1WSJ A;  5J2P A;  1SKW A;  3DJC A;  4CED A;  1KVC A;  3MWP A;  4CJ4 A;  3U3G A;  4FWM A;  4Z4H A;  3NGZ A;  1A5W A;  2VWB A;  3OYH A;  1YUW A;  4CZF A;  1BHL A;  3PX6 A;  2KW4 A;  4B08 A;  4CHP A;  3SAH A;  1S9G A;  4RCH A;  2GX9 A;  3SBG A;  3ALY A;  3AA3 A;  3KHY A;  4KI4 A;  4ILH A;  4KFB A;  4KHW A;  3HOT A;  3VQB A;  2D5R A;  1S9E A;  1U49 A;  1NK5 A;  1KQS M;  3WQU A;  2UYT A;  4CJ5 A;  4H0P A;  4I2Q A;  3DI6 A;  3HL8 A;  2CH6 A;  1NGA A;  1T03 A;  4GKK K;  4C8O A;  3CJ1 A;  2VGN A;  4IOC L;  1S1T A;  4DF8 A;  1XNQ K;  1DTQ A;  2P9U B;  4OPK A;  3BY5 A;  4M42 A;  2P9P A;  4FO0 A;  4RW6 A;  3L3U A;  4BDP A;  3AO5 A;  4AQY K;  4F4K A;  1RDW X;  3VQQ A;  5EX5 A;  4Z94 A;  3BP8 A;  5AZI B;  5KRT A;  3THY A;  3NH1 A;  3DOK A;  2FC0 A;  4B1V A;  3C65 A;  5AQK A;  4CIG A;  4JI2 K;  3A8Y A;  3DWL A;  1VQ9 N;  3ZT1 A;  4CFA A;  4W5R A;  2FLO A;  5EOY A;  3MEE A;  3OYN A;  3VPZ A;  4N41 A;  5EXW A;  3IKM A;  4FXD A;  4IJN A;  4DMN A;  4DR7 K;  1KVB A;  4JI8 K;  3CCE N;  4DTP A;  5AQF A;  4CF9 A;  2H3G X;  5ADX H;  4MLH A;  4BG9 A;  4O4G A;  3CHW A;  3MN9 A;  3IAY A;  3DLR A;  1GLA G;  1ITG A;  4NB4 A;  5FPE A;  4DTN A;  2NRW A;  3U9Z A;  3E9P A;  1YJW N;  1J6Z A;  2GWK A;  4CJR A;  3D2F A;  2IC3 A;  4MDB A;  1BDG A;  2QW9 A;  5F2R A;  4LH5 A;  4KHS A;  3HRG A;  2IGI A;  4CEE A;  3CG7 A;  3ZSR A;  5KTQ A;  4M3Y A;  3OYJ A;  4JI0 K;  4FJ9 A;  1J54 A;  3KD1 E;  4ISF A;  4FJ7 A;  3AVJ A;  4DR1 K;  2AJQ A;  5HP1 A;  2KQ2 A;  2HF3 A;  2DPN A;  4BGB A;  1S1W A;  2DFH A;  1JJ2 M;  1RT5 A;  1NBW A;  4CER A;  4W5T A;  4F3T A;  2YJE A;  1JL2 A;  3M1F A;  3THV A;  2HMI A;  4J8F A;  1TV6 A;  1REV A;  1KAZ A;  2BAN A;  4J2D A;  1SZ2 A;  3AO4 A;  4CEO A;  1QQO A;  1Y64 A;  4IJA A;  4CZI A;  1OKJ A;  3RSE B;  1A5X A;  1S3X A;  1EQY A;  2P9K A;  2PY5 A;  3VTH A;  5AQH A;  4H0O A;  4BRK A;  5AQZ A;  5JIC A;  2Q3S A;  3EE8 A;  4RW7 A;  4CEA A;  4BR0 A;  1HYZ A;  1I94 K;  3ZSW A;  3S9H A;  1MWM A;  3WXL A;  4Y1D A;  3J81 O;  4DV3 K;  1HNX K;  4W5Q A;  2YHB A;  1X3N A;  4B8A B;  3KKR A;  2A1S A;  2NZT A;  2V51 B;  3I0S A;  4IWV A;  4CHZ A;  4DV0 K;  1GOA A;  4AHU A;  4I9Q A;  1TUY A;  1LCU A;  2NRH A;  4KH4 A;  4YNQ A;  1X9W A;  2IVO A;  3QLH A;  4EFH A;  1IKX A;  3SI6 A;  2LSN A;  4LF7 K;  1KTQ A;  3QIN A;  4JI4 K;  4B3R K;  2XY6 A;  4O5F A;  2Z1J A;  4DV2 K;  3M5R A;  2YHX A;  1V4T A;  1DEJ A;  4E89 A;  5JLF A;  4B9L A;  3ZSZ A;  2HBK A;  4AHC A;  5SWM A;  1RBT A;  4BRP A;  2JWK A;  5J1E A;  5DM7 L;  4FOE A;  5M1O A;  1KLN A;  2A40 A;  4I6M A;  4CF0 A;  3MEC A;  4XIU A;  4JV5 K;  4CF8 A;  3H45 C;  3EY1 A;  3TAP A;  3MEG A;  2HBJ A;  1CXU A;  4L3Q A;  4LD0 A;  1VSF A;  4FLW A;  4CF2 A;  2NRV A;  2Y1I A;  3RTV A;  3THX B;  5KQ8 A;  2HVI A;  3L0Q A;  1YAG A;  4BE0 A;  4HCB A;  3AVM A;  3F73 A;  1ZBU A;  1SKS A;  3CJ9 A;  3LZI A;  1LWE A;  4CGG A;  1SL2 A;  3RMD A;  5J2M A;  3K59 A;  4E19 A;  4C8K A;  4FWQ A;  4Z4G A;  5AQV A;  2GV9 A;  1BU6 O;  2YKN A;  4H5T A;  3I8D A;  1YTA A;  5BRH A;  4A2B A;  4ELV A;  3FZF A;  1ATR A;  4ID1 A;  4JYA K;  1ASW A;  5BR9 A;  2QXF A;  2CGJ A;  3H6E A;  1A5V A;  3QML A;  2A1R A;  3AVG A;  4H5R A;  1MU2 A;  3V1Q A;  2IS3 A;  4AM7 A;  1FW6 A;  1JXE A;  3AVC A;  4FK0 A;  3O5B A;  4IO8 A;  5EU7 A;  2GEM A;  3VQ9 A;  1BI4 B;  3TSQ A;  5A2Q O;  3IUC A;  3A0I X;  4CHQ A;  1UA0 A;  4DFM A;  1BOT O;  4JI3 K;  4I2P A;  2NRR A;  1HQU A;  1SUQ A;  5BR8 K;  3JYT A;  1D8Y A;  4MFB A;  3K9J A;  3V9S A;  4KHY A;  3K58 A;  1UWB A;  1CZ9 A;  3IMX A;  1YJN N;  1RCH A;  4WE1 A;  4B1U B;  1QS4 A;  3OA9 A;  4FJ8 A;  2E1Y A;  2WUS A;  1L3T A;  4B9V A;  1S1U A;  3VF4 A;  3O1W A;  3ULE B;  1T6D A;  3VA3 A;  1BL3 A;  1YI2 N;  1HMV A;  3JXU A;  2UUA K;  1JLG A;  3VQ5 A;  1IBL K;  1EET A;  4FSV A;  2P9S A;  4I9L A;  3WUH A;  1U45 A;  3CF5 L;  4FLU A;  4K25 A;  1RDA A;  1HNV A;  2HST A;  3P4I A;  1NJX A;  4XH1 A;  1VRT A;  3AAR A;  3TPQ A;  4KRF A;  1C0F A;  3SPZ A;  3O6W A;  3U8X A;  3DXK A;  3G0Z A;  2QWP A;  3VQE A;  3CQX A;  4PKH A;  4JKH A;  5FLX O;  3CPE A;  3F5T A;  2QK9 A;  2KTQ A;  4E1M A;  3VOV A;  3SNN A;  2GTD A;  3D6R A;  3SQ4 A;  2UUC K;  5JS2 A;  1B9F A;  3VES A;  1NNE A;  2OPP A;  1H1V A;  3VQA A;  1TL1 A;  3CCQ N;  3J7A P;  2ETJ A;  3KLI A;  4BVP A;  2G8I A;  3RMA A;  3W0L A;  4FK2 A;  1NGC A;  3CFP A;  1UA1 A;  2EX3 A;  2QKK A;  1EX4 A;  3EL2 A;  4H0T B;  1QVG M;  4A5A A;  1YIJ N;  3F9M A;  2O8F B;  4V19 S;  1XI1 A;  4DSI A;  3KD5 E;  4YDU C;  1XHZ A;  3FZM A;  1EP4 A;  4KV8 A;  4BR5 A;  3U4L A;  4E7K A;  1L5U A;  3K57 A;  2O8D A;  2ZGY A;  4X65 K;  2I5J A;  3QFU A;  4CZJ A;  3F2K A;  1SL0 A;  2BTF A;  5HBM A;  1NGG A;  1VSH A;  3MN5 A;  4FK4 A;  2VWJ A;  3ID8 A;  1JLB A;  4TSX A;  5HOO A;  3P1G A;  5AQN A;  4FYD A;  4FLZ A;  5C0Y A;  3I33 A;  4B3T K;  1BCO A;  4EP4 A;  5BRD A;  4M63 C;  1FKP A;  4BVO A;  3OYL A;  4DSJ A;  1HNZ K;  3QDK A;  1O13 A;  2P9I A;  2D0P A;  1GLD G;  2E6M A;  2FBX A;  2W40 A;  4AF1 A;  2D0A A;  3HBT A;  4PY5 A;  4CEQ A;  3V9Z A;  4FZY A;  3AO3 A;  4JS4 A;  1UAX A;  3ATV A;  1NGH A;  4M3W A;  4IOX A;  2A3Z A;  4GV9 A;  4IG3 A;  1WN7 A;  4M3X A;  3O9U A;  3TAE A;  3ISN C;  1L3S A;  2QKB A;  5M1P A;  4GW6 A;  3R3L A;  3BZC A;  3KIO A;  3L6Q A;  4H5W A;  4G1Q A;  1JXB A;  4FJM A;  5AQU A;  2P9L B;  2FBT A;  2WOM A;  3E01 A;  4ICL A;  2UU9 K;  4KBO A;  2B6A A;  5EVZ A;  3CCJ N;  3JSM A;  5M1K A;  2YKM A;  3CI5 A;  5I42 A;  2HHS A;  5F0X A;  3HO1 A;  5LMN K;  3BF3 A;  4KHQ A;  4AHV A;  4FZZ A;  2CGK A;  3CIP A;  4M45 A;  4IFV A;  2Q1N A;  3TU5 A;  4DFJ A;  2YCH A;  3CYM A;  3MX2 A;  1T05 A;  4YOY A;  2UXB K;  3UB5 A;  4DV6 K;  3VF6 A;  4ELU A;  4JKA A;  3RR8 A;  3CC7 N;  1ZBH A;  3AY9 A;  4FOI A;  1RIL A;  2G8U A;  3FGU A;  4DUZ K;  2QWO A;  2E5L K;  4IOA L;  4BDZ A;  1Q8I A;  2O4G A;  4PQU A;  1MA9 B;  2HHX A;  3SJJ A;  2FBY A;  4CEF A;  3ZSO A;  3WNG A;  1QVF M;  1QQC A;  3TAR A;  1ZYQ A;  1M1K O;  3FZK A;  3U3Y A;  4O8U A;  1ILY A;  4H4M A;  2FSN A;  3M3Z A;  3PSI A;  4FLY A;  4NXN K;  3UIQ A;  1DT9 A;  2HHQ A;  5FPD A;  3C7N B;  1ZBS A;  2UXC K;  2W41 A;  4LF4 K;  5IT9 O;  4B9M A;  2G8H A;  3WQT A;  1BIU A;  1IV0 A;  3VQ6 A;  1LV5 A;  2ZGZ A;  1NOY A;  3MXM A;  3AA4 A;  2VQF K;  1QHT A;  2QM1 A;  4DTM A;  2JWL A;  1NK7 A;  4FPB A;  3SAG A;  2Q0U A;  4DFP A;  4EHT A;  1WBB A;  3CJ7 A;  2PYL A;  1R59 O;  3VQ7 A;  4CGJ A;  5EY4 A;  2QA4 N;  1YIT N;  3H46 O;  1Q82 O;  1RTH A;  5MLC Q;  3G4S N;  4E7H A;  3SMP A;  1WSH A;  1HKB A;  3D2E A;  4PL7 A;  2PAV A;  4KHP K;  1VSE A;  3NGI A;  4G9Z A;  4CK2 A;  3VTI A;  1HJR A;  5HLF A;  4BRH A;  3MXJ A;  4CGH A;  2ZJR L;  5CYM A;  1VQP N;  3K5O A;  1OH7 A;  3EZW A;  3OYA A;  3IS9 A;  4CBU A;  1K9M O;  2IVP A;  1CXQ A;  4AHR A;  3DXM A;  3A5M C;  4F3O A;  4NLC A;  1W2B M;  4J2B A;  1V4S A;  5DM6 L;  5CY4 A;  1EWR A;  1TYQ A;  1S6Q A;  4FWO A;  4Q0B A;  3FR0 A;  3AVB A;  1TKD A;  1UOC A;  2VWK A;  4FLX A;  2Y1J A;  1QHA A;  3OYM A;  2XY5 A;  2P9L A;  1WSG A;  2YI1 A;  1VSM A;  3V6D A;  1X1P A;  4O0I A;  4JK9 A;  2BH1 A;  1U2V A;  2EWS A;  1K73 O;  4R79 A;  1KXP A;  2F8S A;  5AR0 A;  4KI6 A;  4EAH D;  4FLT A;  4FWN A;  1L3V A;  3VN5 A;  3AVL A;  4DR2 K;  4LC9 B;  3MX5 A;  1VQK N;  3AVA A;  3GE1 A;  4XH5 A;  3RMB A;  1NU0 A;  3ZLJ A;  3IRX A;  3QBW A;  1IBM K;  4FL9 A;  3LZJ A;  1RBU A;  3CCL N;  4KB0 A;  1EXQ A;  4AHS A;  5KPR A;  1KRP A;  3H3O B;  1KFD A;  4IZ9 A;  5KGW A;  4M3R A;  1D9D A;  1GLF O;  4Z4E A;  3J7Y P;  3SUQ A;  4CGF A;  3LDQ A;  1X9S A;  4I7F A;  3SJH A;  3MCA B;  4O55 A;  1R0A A;  4CF1 A;  3B6O A;  3LM2 A;  3O3F A;  3CPW M;  4MO4 A;  4ZHR A;  3H1Q A;  5HRS A;  3TWH A;  2W6K A;  4O8K A;  5C10 A;  3NH2 A;  1B92 A;  3G25 A;  3S3N A;  2HW3 A;  3D45 A;  5HL7 L;  3U9D A;  2RKI A;  4JS5 A;  3OYK A;  4QS7 A;  5BRF A;  5AQY A;  4MQ3 A;  3ZSQ A;  3FE1 A;  1VSD A;  4OLA A;  2F9W A;  4DF4 A;  2P9N A;  1HUX A;  4F2R A;  4OPA A;  2HHH K;  4C8N A;  5JLH A;  4B1Y B;  1GLB G;  2OCE A;  4IFE A;  5AQJ A;  2P5O A;  4AHT A;  4B9T A;  4FLV A;  3TI0 A;  4DU4 A;  5T7B A;  2GUP A;  3L4Q A;  1RBV A;  2O8D B;  3T1A A;  1OVY A;  3P83 D;  3OYB A;  4CHN A;  1NG9 A;  2HHT A;  1BCM A;  1D4X A;  2E20 A;  3O1B A;  4H03 B;  2KFZ A;  2Q2R A;  1BQN A;  5CYQ A;  4E1N A;  3GBT A;  2ASM A;  2FSJ A;  5J2Q A;  3ID6 A;  4GVM A;  1IH7 A;  1J9A A;  2PBD A;  3QO9 A;  3UKR A;  3V9X A;  3EKS A;  5HRO A;  4F8R A;  1NGJ A;  1QE1 A;  3KK3 A;  4N56 A;  5KPT A;  3TSU A;  3IG1 A;  4A2A A;  1VQN N;  4CJL A;  3KKS A;  2ITG A;  2KLA A;  3O4N A;  1NKB A;  2E2P A;  4BRD A;  1RT6 A;  1SQK A;  1KC8 O;  4DR4 K;  2UXD K;  3KWI A;  3FZH A;  2QWQ A;  1WUA A;  4CZG A;  4OLB A;  3LAK A;  3V1R A;  2P1J A;  4FVM A;  1W7A A;  3EO3 A;  4DWI A;  2QWL A;  2HHV A;  3FFK B;  4QS8 A;  4CJE A;  4CZE A;  3ZEU B;  4JRP A;  2F96 A;  2OZM A;  2XY8 A;  3AO2 A;  2B4J A;  1GOB A;  4E7J A;  4CJW A;  3QEI A;  4DSF A;  4DR5 K;  3J7Z O;  3UKU A;  3LWM A;  4OKE A;  4DS5 A;  3AGK A;  3HXM A;  4FJG A;  4WQ4 C;  3NF6 A;  4J2A A;  1EO1 A;  1HKG A;  3ZT4 A;  5KRS A;  1TKX A;  3NFA A;  1LW2 A;  2B5J A;  3DRS A;  4RW9 A;  5GIO A;  3OYG A;  3QNO A;  4KH5 A;  1BQM A;  3O4W A;  3O9T A;  3SK3 A;  3M8S A;  3L8B A;  2P9S B;  3MK6 A;  5ADX A;  1M90 O;  1T44 A;  5DK5 A;  4EIA A;  5BN9 A;  3LDL A;  3QB0 A;  3PIP L;  3EKU A;  5E26 A;  4F9O A;  5LJV A;  4FJK A;  4CVN E;  2O8C B;  4K8X A;  1C0M A;  4DTU A;  4DFK A;  3VGK A;  4OPH A;  1JCE A;  4JKD A;  1HPM A;  2X6N A;  1WNS A;  3VEX A;  4C1N K;  4YY3 K;  4UY8 O;  2P9N B;  2P9P B;  3QBX A;  3VET A;  4NCG A;  1RDD A;  1NJI O;  3HM8 A;  3QER A;  4DR6 K;  3ZT2 A;  1QQN A;  5HRP A;  3PX0 A;  4CBW A;  3NVM A;  2A5X A;  5LJW A;  3HPH A;  4C8L A;  4DTO A;  4FJH A;  1N5Y A;  3P38 A;  3FLC O;  1N36 K;  3Q7B A;  2HHW A;  4R5P A;  2ZQB A;  2CGL A;  3MDQ A;  3C95 A;  1FKO A;  1NK0 A;  3QIO A;  5FPM A;  4C23 A;  3GOI A;  1NK9 A;  4GV6 A;  3H08 A;  1N32 K;  5GAD P;  3NE6 A;  3TAG A;  1BG3 A;  3MAQ A;  4WQ5 A;  2F4V K;  3VQC A;  3SUO A;  3SBT A;  3DLB A;  4EZ9 A;  5AQQ A;  4FWS A;  1XNR K;  3KVG A;  1YJ9 N;  3VGM A;  2FF6 A;  2E2N A;  1XC9 A;  1WSF A;  3DRR A;  4FVU A;  4EP5 A;  1K8K A;  4B9U A;  2XHB A;  2OA8 A;  4OKJ A;  2ZJQ L;  1CLQ A;  3LAN A;  1Q86 O;  4IFY A;  3N4Q A; 
#chains in the Genus database with same CATH homology
 4IOX A;  2A3Z A;  2J4R A;  4M7Y A;  2RHK A;  1RGI A;  2FXU A;  4GV9 A;  3O9U A;  1VQ6 N;  1GLJ O;  2YJF A;  1K8K B;  3O08 A;  2ZJP L;  4A57 A;  1YHQ N;  5M1P A;  4XH4 A;  2F9T A;  3O9R A;  3O80 A;  3R3L A;  4YOX A;  2E88 A;  2ZF5 O;  3OW2 M;  4H0X B;  4YDU A;  3G6E N;  4BRQ A;  4MLE A;  3P31 A;  1KD1 O;  2KHO A;  4A5B A;  3L6Q A;  4H5W A;  1HLU A;  3KWG A;  4JD2 B;  4ISG A;  1JCF A;  3CCS N;  3VMF B;  4DHY A;  2IVN A;  2P9L B;  5AQU A;  2I7N A;  4JN4 A;  1ZC6 A;  4CZH A;  4BRF A;  4KBO A;  1WOQ A;  5EVZ A;  3FZL A;  3Q7C A;  5F1X A;  4WFN L;  2QEX N;  1RFQ A;  4XEI A;  3CCJ N;  3ZYY X;  1XC3 A;  5M1K A;  3CI5 A;  2PFU A;  2Q31 A;  1Q81 O;  3DJC A;  5CR4 A;  3MWP A;  5F0X A;  3BF3 A;  4FWM A;  4PL8 A;  4A62 A;  5GAH P;  2AP1 A;  2VWB A;  1YUW A;  1VQ7 N;  4CZF A;  2CGK A;  3CIP A;  3DXM B;  3UKR B;  4H0Y B;  3SAH A;  1ATS A;  2Q1N A;  3TU5 A;  1TUU A;  5BPM A;  2YCH A;  2Q36 A;  3ATU A;  2GX9 A;  4RCH A;  1QZ5 A;  3SBG A;  3MX2 A;  4CI6 A;  2D4W A;  4YOY A;  1KAX A;  3KHY A;  4ILH A;  3UB5 A;  2FF3 B;  3I55 N;  3VF6 A;  4JKA A;  3HOT A;  1KQS M;  5AFU H;  3AY9 A;  1K8A O;  3CC7 N;  5AQG A;  1VQO N;  1NMD A;  3WQU A;  2UYT A;  1S72 N;  4H0P A;  4FOI A;  3WXM B;  2CH6 A;  3ULE A;  4CZI A;  1NGA A;  2OTL N;  3FGU A;  2QTD A;  3MMV A;  2QWO A;  3CJ1 A;  2VGN A;  4IOC L;  4IOA L;  4I6M B;  4BG8 A;  5AZI A;  5M1N A;  3CMA N;  3WXK A;  2RE2 A;  3L4I A;  2P9U B;  5BN8 A;  3HOS A;  4JKG B;  2P9P A;  4FO0 A;  1MA9 B;  4K43 A;  3T69 A;  3LDO A;  4BQZ A;  1RDW X;  3R9P A;  1NWK A;  1RDU A;  4C1N I;  1QVF M;  5EX5 A;  4Z94 A;  1IJJ A;  3LM9 A;  3BP8 A;  5AZI B;  3C6A A;  2OTJ N;  3MN6 A;  2FSK A;  4CJ7 A;  2WFB A;  1M1K O;  3FZK A;  5TKW A;  1LOT B;  4B1V A;  1NGB A;  3C65 A;  5AQK A;  2HMP A;  3BUZ B;  4O8U A;  4BRN A;  1ILY A;  3A8Y A;  2FSN A;  3DWL A;  3M3Z A;  1VQ9 N;  2V7Z A;  2QWM A;  1DT9 A;  4RWT A;  5FPD A;  3C7N B;  2FLO A;  1ZBS A;  5EOY A;  3J8A A;  4JAX A;  5EXW A;  3VPZ A;  2W41 A;  3IKM A;  1VQ8 N;  4BRM A;  4IJN A;  3WQT A;  3OBY A;  3CCE N;  4JK8 A;  5C15 A;  3OHR A;  3CCR N;  5AQF A;  2ZGZ A;  2H3G X;  3CXC M;  3E66 A;  3CME N;  4PHT X;  1Z05 A;  5ADX H;  4MLH A;  4BG9 A;  2QM1 A;  3CHW A;  2JWL A;  2VYP A;  3A5N C;  3MN9 A;  5AQL A;  4BRI A;  3DAW A;  1GLA G;  4NB4 A;  5TKY A;  4DQ8 A;  2QXL A;  4JHD A;  5FPE A;  4FPB A;  2NRW A;  3U9Z A;  3E9P A;  3SAG A;  1YJW N;  3VF2 A;  3CCU N;  4WYB A;  4CBX A;  1J6Z A;  2GWK A;  2Q0U A;  4JD2 A;  3D2F A;  4OO1 J;  4EHT A;  4BC5 A;  1C0G A;  3CJ7 A;  1R59 O;  4MDB A;  1BDG A;  5EY4 A;  4DB3 A;  5E84 A;  2QA4 N;  1SS6 A;  2WC9 A;  2QW9 A;  1YIT N;  3H46 O;  5F2R A;  4K41 A;  3DLL L;  3CET A;  5JVH L;  1Q82 O;  3EE9 A;  5MLC Q;  3O9S A;  2HF4 A;  3G4S N;  3HRG A;  3SMP A;  1VQM N;  4A59 A;  1HKB A;  3D2E A;  4PL7 A;  3I56 N;  2PAV A;  3PIO L;  3AAQ A;  4BQL A;  5AQT A;  4BRG A;  3AAP A;  4G9Z A;  3QIC A;  3VTI A;  1GLE G;  4ISF A;  3AGR A;  3TTF A;  4YOV A;  4BRH A;  4U7B A;  1U2V B;  2ZJR L;  1T3V A;  1VQP N;  3C6H A;  3EZW A;  3S41 A;  1NGD A;  4GNI A;  2BUP A;  4HWI A;  4CBU A;  1K9M O;  2HF3 A;  2IVP A;  2DPN A;  2NLX A;  4FWL A;  4M7X A;  4B1W B;  4BGB A;  5LY3 A;  1JJ2 M;  3C7N A;  1VQ4 N;  3WXJ A;  5CE3 A;  1NBW A;  3DXM A;  3A5M C;  3SAF A;  3R1X A;  4NLC A;  1W2B M;  2YJE A;  3BF1 A;  1V4S A;  3M1F A;  5BPL A;  5DM6 L;  1TYQ A;  1DKG D;  2P9I B;  1VQL N;  2HOE A;  3VEV A;  4FWO A;  4JEP A;  3FR0 A;  4J8F A;  4BR4 A;  2GEL A;  5GIN A;  4JKG A;  3NVK A;  1GLL O;  2P9U A;  1QHA A;  3WT0 A;  1NM1 A;  3LL3 A;  1KAZ A;  4AM6 A;  1SZ2 A;  4JK7 A;  1BUP A;  2P9L A;  3VEY A;  2YI1 A;  4BRC A;  2I7P A;  1QQO A;  4Y0W A;  2OAN A;  1ATN A;  4JKF A;  4JKE A;  1Y64 A;  4IJA A;  3HZ6 A;  1OKJ A;  4JK9 A;  1S3X A;  2P9K A;  1EQY A;  3O8M A;  5AQW A;  3RSE B;  3VTH A;  2BH1 A;  1U2V A;  2EWS A;  5AQH A;  1K73 O;  4R79 A;  4YOW A;  1KXP A;  3M6G A;  3KK7 A;  1QQM A;  4H0O A;  4BRK A;  5AQZ A;  5AR0 A;  5JIC A;  3EE8 A;  4EAH D;  4FWN A;  4NLB A;  2QI2 A;  4PKG A;  1U6Z A;  3GG4 A;  4BR0 A;  4LC9 B;  3MX5 A;  5JVG L;  1MWM A;  1KAY A;  1VQK N;  3GE1 A;  4XH5 A;  3WXL A;  3QBW A;  4FL9 A;  3CCL N;  3ENO A;  3QFP A;  5KPR A;  3WXI A;  3H3O B;  4IZ9 A;  1X3N A;  4BRE A;  4CD3 A;  3HI0 A;  3D2F B;  5GIP A;  4BRO A;  3T7Z A;  2NZT A;  1GLF O;  2V51 B;  4IWV A;  1TUY A;  1LCU A;  5I9E B;  2NRH A;  3LDQ A;  4KH4 A;  3CJC A;  3CJA A;  2E1Z A;  3SJH A;  3MCA B;  4GY2 B;  3VEW A;  5M1F A;  2E8A A;  1BO5 O;  1YXQ A;  2IVO A;  3MCP A;  3A5O C;  3ENH A;  4EFH A;  1MDU B;  4ILG B;  3I8B A;  3LM2 A;  3LDP A;  3D7E O;  3CPW M;  4FWP A;  4MO4 A;  4O5F A;  1ESV A;  3H1Q A;  4ILJ A;  1DGK N;  2QWR A;  3VGL A;  4O8K A;  3M5R A;  2YHX A;  1V4T A;  2NRX A;  5C10 A;  1DEJ A;  5JLF A;  1X9J A;  2HBK A;  3CCM N;  3G25 A;  4IXC A;  5ELZ A;  4BRP A;  3ZEU A;  2JWK A;  3EN9 A;  5DM7 L;  1MWK A;  4FOE A;  5M1O A;  3D2E B;  4YOU A;  2A40 A;  4I6M A;  3VER A;  3U9D A;  5HL7 L;  4IEI A;  2E2Q A;  1Q18 A;  3R8E A;  4GV3 A;  5AQX A;  2VCP A;  4QS7 A;  5BRF A;  2A41 A;  5AQY A;  3H45 C;  1YF5 L;  2HBJ A;  4FWR A;  4L3Q A;  4K42 A;  4H5N A;  2NRV A;  3FE1 A;  3H3N O;  3E1Y A;  3NMU A;  3P39 A;  5KQ8 A;  1HKC A;  2F9W A;  3L0Q A;  2P9N A;  1HUX A;  3ZET B;  1YAG A;  4YOR A;  3G71 N;  3RVC A;  2NRT A;  4OPA A;  1Z6R A;  4BGA A;  3GDQ A;  1VAZ A;  3CQY A;  5JLH A;  3CJ9 A;  4B1Y B;  1GLB G;  3RSE A;  3PLA A;  4IFE A;  1TYQ B;  4CD1 A;  4IO9 L;  3W3D A;  5AQJ A;  4U67 L;  3MN7 A;  1W97 L;  3C0B A;  4BR7 A;  2KKZ A;  2NNW A;  4FWQ A;  2ASO A;  4IDH A;  2GUP A;  3L4Q A;  5AQV A;  1BU6 O;  2Q0R A;  1OVY A;  4JKC A;  4H5T A;  3BEX A;  5BRH A;  4A2B A;  4WFB L;  2E20 A;  1D4X A;  4HTL A;  3A5L C;  3FZF A;  1ATR A;  4EHU A;  3O1B A;  4H03 B;  5BR9 A;  5C2F A;  2Q2R A;  2CGJ A;  3H6E A;  3QML A;  5AZJ B;  3SLC A;  3GBT A;  4H5R A;  2ASM A;  4A61 A;  2FSJ A;  4AM7 A;  4DKW A;  4CZL A;  3ID6 A;  3GL1 A;  3CJB A;  2PBD A;  3UKR A;  4B1Z A;  3O5B A;  4IO8 A;  2E2O A;  3EKS A;  4PKI A;  2GEM A;  2AA4 A;  4CZM A;  5KQD A;  3TSQ A;  3IUC A;  3A0I X;  3CC4 N;  1XUP O;  2F7T A;  1NGJ A;  2ASP A;  1E4F T;  1P8Z A;  3TSU A;  1BOT O;  1E4G T;  5KPT A;  1NGF A;  2D0O A;  2WBN A;  2NRR A;  4A2A A;  1VQN N;  2GWJ A;  2VGM A;  4GVE A;  3K9J A;  3K9K A;  2KLA A;  2E2P A;  4BRD A;  1N8R O;  1SQK A;  5AQM A;  1KC8 O;  4DCH A;  4FWK A;  4YOT A;  3IMX A;  1YJN N;  3ZX0 A;  3KWI A;  3DXK B;  1IG8 A;  3FZH A;  2QWQ A;  1WUA A;  3WEE B;  5BPN A;  3CCV N;  3TSP A;  4B1U B;  4CZG A;  1Q86 O;  4FPA A;  3VEO A;  2YX6 A;  3OA9 A;  3IDH A;  5KPZ A;  2YHW A;  1CZA N;  2E1Y A;  2WUS A;  3EO3 A;  1YVN A;  2QWL A;  3VF4 A;  3O1W A;  3ULE B;  3FFK B;  4QS8 A;  3OBW A;  4CZE A;  4E1J A;  1T6D A;  3MWT A;  3ZEU B;  1YI2 N;  3JXU A;  3H1V X;  2CH5 A;  4CZK A;  4BY9 C;  4FSV A;  1BA1 A;  2P9S A;  1HJO A;  2V7Y A;  1T6C A;  3UKU A;  4BC2 A;  4WF9 L;  4BR2 A;  5AQS A;  3AGK A;  1ZXO A;  3WUH A;  3VEZ A;  3CF5 L;  4BC4 A;  4K25 A;  3O9Q A;  5C12 A;  4WQ4 C;  1EO1 A;  1HKG A;  3JS6 A;  2HST A;  3P4I A;  4XH1 A;  2D1K A;  3LDN A;  5GIO A;  3AAR A;  4KH5 A;  3TPQ A;  4BR9 A;  5GAG P;  3O4W A;  3O9T A;  3SK3 A;  1C0F A;  3UE5 A;  3HSC A;  2ITM A;  2P9S B;  3MK6 A;  3O6W A;  4QS9 A;  3TTD A;  3VEN A;  1T44 A;  5ADX A;  3U8X A;  3DXK A;  1M90 O;  2QWP A;  5AQR A;  5AQP A;  2V52 B;  3CQX A;  4PKH A;  4JKH A;  5BN9 A;  4EIA A;  1XQS C;  3LDL A;  3QB0 A;  3PIP L;  3EKU A;  5E26 A;  4F9O A;  5LJV A;  3CPE A;  1NLV A;  3F5T A;  1HX1 A;  2QWN A;  3VOV A;  2GTD A;  3D6R A;  4H0V B;  2A6A A;  4WCE L;  3VGK A;  4OPH A;  1JCE A;  4JKD A;  3B8A X;  1HPM A;  3VES A;  4H5V A;  4JHD B;  1H1V A;  3VEX A;  4B9Q A;  4C1N K;  4UY8 O;  3E9O A;  3CCQ N;  4BVP A;  4MDA A;  2P9N B;  3KZB A;  3ZET A;  3ENB A;  4IEE A;  3W0L A;  2P9P B;  3QBX A;  3VET A;  2NRZ A;  1NGC A;  4B1X B;  1NJI O;  3HM8 A;  2A42 A;  4ISE A;  3HTV A;  4H0T B;  3EL2 A;  1QVG M;  1QQN A;  1VQ5 N;  3ZX2 A;  5CHI A;  4A5A A;  1YIJ N;  3F9M A;  4CBW A;  3NVM A;  2A5X A;  1GLC G;  5LJW A;  5AQI A;  4YDU C;  5B8H A;  3FZM A;  2YHY A;  2ZWH A;  5M1Q A;  3P38 A;  4WQ5 C;  3FLC O;  4BR5 A;  3Q7B A;  3U4L A;  5JMV A;  1S22 A;  4MO5 A;  4JKB A;  4WFA L;  2CGL A;  2ZGY A;  3MDQ A;  3QFU A;  4CZJ A;  3F2K A;  5AZJ A;  2BTF A;  1NGG A;  5FPM A;  3UKU B;  3GOI A;  4BRA A;  4C23 A;  4GV6 A;  3MN5 A;  5GAD P;  3R6M A;  2IIR A;  1BG3 A;  4KH6 A;  1P90 A;  1SAZ A;  3ID8 A;  3SMS A;  1X3M A;  4WQ5 A;  5AFU A;  5HOO A;  1G99 A;  4RTF D;  1QZ6 A;  3SBT A;  4NO7 A;  3E9L A;  3CD6 N;  5AQN A;  5C0Y A;  1BA0 A;  5FPN A;  3I33 A;  3TTC A;  5AQQ A;  5BRD A;  4FWS A;  1JCG A;  1BWF O;  4M63 C;  4BC3 A;  4BVO A;  3KVG A;  3J7Z O;  3VGM A;  5C2D A;  2FF6 A;  2E2N A;  3WEE A;  1YJ9 N;  3CER A;  5BRE A;  3QDK A;  2Q97 A;  1O13 A;  3CC2 N;  2P9I A;  2D0P A;  2HBL A;  1GLD G;  5H1S Q;  2W40 A;  4AF1 A;  2HBM A;  3HBT A;  4FVU A;  1K8K A;  3IFR A;  5GAE P;  4WQ4 A;  1NGE A;  2ZJQ L;  1Q7Y O;  4JNE A;  2P9K B;  3N4P A;  4BRL A;  3ATV A;  3ZX3 A;  1NGH A;  3N4Q A;  1NGI A;  5AQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...