2GEMA

2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
216
Chain Sequence
b'MRILAIDTATEACSVALWNNGTINAHFELCEHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Gram negative resuscitation promoting factor
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 67
structure length 216
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gemA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gemA02
3GL1A 4BR2A 3QMLA 5BREA 1DEJA 2GEMA 4BRKA 5AQFA 2EWSA 3GBTA 3VETA 3HBTA 5FPEA 3QICA 4A62A 2VWBA 3VEYA 3UKRA 3DAWA 3H3NO 3QBWA 2BUPA 3WEEA 2P9PA 1U2VB 4B1WB 4H5RA 3VGLA 3H45C 5BN8A 1NM1A 1TYQA 3IUCA 3EN9A 3SK3A 3DXMA 4XH1A 3VGMA 1T6CA 2D1KA 2W40A 3O8MA 2A42A 1J6ZA 3MDQA 4ISGA 4CZFA 2QW9A 5KPRA 5B8HA 5AR0A 4J8FA 2GTDA 1HLUA 4JN4A 2P9SB 4BGBA 3ZEUB 4CZHA 2CGKA 5AQTA 4JD2A 3RSEB 3FZHA 2E2QA 4DQ8A 3VEOA 3KZBA 4FL9A 3VEXA 1DGKN 2KHOA 1HUXA 2WUSA 3S41A 3C0BA 2I7NA 3MN7A 3FGUA 4MO5A 5BRHA 4CJ7A 3I8BA 1T44A 2A40A 2H3GX 2V51B 3LL3A 3VOVA 3MN5A 1BG3A 4WQ5C 4CBXA 4BREA 4FPBA 5AQHA 3ZX0A 4JHDB 2FF6A 4B1XB 1MA9B 2A41A 2ZGYA 3CQYA 3HM8A 3ZX2A 1Z6RA 5AZIB 2ZGZA 4K43A 4F9OA 1YAGA 3CIPA 2HMPA 4PL8A 3DWLA 1JCFA 1NGGA 1BDGA 3BF3A 3IDHA 5BPLA 2P9KB 4BRIA 3KHYA 4BVOA 4MLHA 3W3DA 5FPMA 4BROA 4IJNA 5AQSA 4WQ4C 1C0FA 3IFRA 2NZTA 3WQTA 2CGJA 2PAVA 1D4XA 3VESA 3A0IX 3MCPA 2F9TA 2P9SA 5F1XA 5EX5A 4EFHA 5EVZA 2A6AA 3DXKA 3U9DA 2FXUA 3GE1A 2ASPA 2YI1A 3J8AA 1GLJO 1KXPA 3WEEB 2NLXA 3WXLA 3FFKB 2P9PB 1Y64A 2Q36A 1QZ6A 3HZ6A 4ISEA 1NGEA 1TYQB 4FWRA 4AM6A 3EKSA 3DXMB 2YHYA 2QM1A 2D4WA 3LDOA 3LM2A 5AFUA 5BPMA 5JLFA 3ATUA 1NGFA 2CGLA 4CZMA 1HKGA 3O80A 1ZC6A 4CZKA 2FSNA 3O1WA 4CD3A 1LOTB 2D0OA 4A2BA 3ID8A 2A3ZA 5KPZA 4BG9A 4H5TA 4PKGA 1T6DA 3WQUA 4BC5A 3LM9A 1QQMA 3VF6A 4BRFA 4FWSA 3A5LC 1IG8A 1XQSC 4BG8A 4M7YA 2FSKA 4Y0WA 2P9UA 1NWKA 2QWLA 1NMDA 3W0LA 1BA0A 3I33A 1SZ2A 4RCHA 1X3NA 2E1ZA 2CH5A 3FZFA 3F9MA 4XEIA 1MWMA 4CZIA 5BR9A 4IXCA 4QS9A 2IIRA 1SAZA 4QS8A 5FPNA 5JMVA 4PKIA 2E1YA 2V52B 3MMVA 3VEZA 1MDUB 5KQDA 4GY2B 3OHRA 3UKUB 4FPAA 3JXUA 4PKHA 1DKGD 4YDUA 4BRMA 5E84A 5E26A 4CI6A 5AQKA 4KBOA 5AQLA 4H5WA 2FF3B 4CZLA 1G99A 1R59O 3GG4A 3DXKB 1QZ5A 3M1FA 5AQPA 5LY3A 4FWMA 1P8ZA 4FWPA 4H03B 2AP1A 1GLLO 1RGIA 4O8KA 4EHTA 3CERA 4FWOA 3SLCA 1KAYA 4BR4A 3D2FA 1E4FT 5BPNA 2QWMA 2E2NA 1QQOA 1SQKA 3WXKA 4FWNA 1QHAA 5AQZA 4BRHA 3EO3A 3VGKA 2YHWA 5ADXH 3C7NA 1NGDA 1EQYA 1WOQA 2A5XA 2HF4A 5AQYA 5AQXA 1KAXA 2CH6A 2NRHA 5AQUA 1WUAA 2GWKA 3SJHA 3VEVA 3SMPA 1Q18A 3MN9A 3LDPA 4H0YB 3TU5A 1X9JA 4FWKA 4DCHA 3VEWA 1XUPO 4H0OA 4BRNA 5AQRA 4M63C 4NO7A 4RTFD 2V7YA 3GDQA 3UKUA 2VYPA 3A5OC 1NLVA 4IZ9A 3ZETB 5LJVA 5CE3A 1BUPA 4L3QA 1HJOA 3EL2A 3R6MA 3ULEA 2ZWHA 2Q97A 2P9UB 3CJ9A 3GOIA 3LDQA 2YJFA 2HF3A 4BRDA 1NBWA 2GWJA 4RWTA 1NGCA 3CJ7A 1S3XA 3FZLA 2FSJA 3U8XA 5AQVA 3HI0A 2ITMA 3CQXA 3U4LA 1H1VA 1LCUA 2YJEA 4EIAA 1ATNA 4BVPA 1E4GT 3ENHA 4QS7A 4E1JA 5KQ8A 4BRGA 1RDWX 3TPQA 2PBDA 3A8YA 4DHYA 3FZMA 5FPDA 2IVPA 5ADXA 4FWQA 3WUHA 1CZAN 4HWIA 2E88A 4IJAA 3HSCA 1BO5O 1YVNA 5LJWA 3O6WA 4K41A 3BP8A 4BR7A 4K25A 2IVOA 4XH5A 3WXJA 4CD1A 4DB3A 3AY9A 3O08A 4B1VA 3D2EA 2OANA 2ZF5O 2P9LA 1GLEG 4H5VA 4BRPA 4I6MB 4WYBA 4B1YB 1HX1A 3H3OB 2GUPA 1GLBG 2I7PA 3BUZB 4EHUA 3L0QA 4BQLA 4A2AA 3D7EO 2QXLA 3ZETA 2FLOA 2J4RA 2Q0RA 3D2FB 1KAZA 1U6ZA 5JLHA 2E20A 1NGBA 2QWQA 1HKBA 4C23A 5F0XA 4FWLA 3H1VX 4B1UB 4YDUC 3C7NB 5AQWA 3U9ZA 3LDNA 4H0XB 4MO4A 3M6GA 3CETA 1NGHA 3P4IA 4EAHD 4H0PA 3H46O 3QDKA 2GELA 2HOEA 3CHWA 3EZWA 2YCHA 1GLAG 3JS6A 1ATSA 2F9WA 2P9NA 1NGAA 2E8AA 4GNIA 5AQNA 4HTLA 3BEXA 3IMXA 1IJJA 4ISFA 5I9EB 3FZKA 1Z05A 3VF2A 4BR9A 1OKJA 3CI5A 5AFUH 3ULEB 3A5MC 4AM7A 2Q0UA 4BGAA 2E2OA 4I6MA 5AZJA 3WT0A 2QWOA 2V7ZA 5F2RA 1V4SA 1TUUA 1S22A 1XC3A 4K42A 3MN6A 1MWKA 4BR5A 4LC9B 4A61A 1BA1A 4Z94A 3KVGA 1BOTO 4BQZA 1K8KA 1YUWA 3CJ1A 4O5FA 5AQMA 2QWPA 2P9IA 2UYTA 1ZXOA 2Q1NA 3QFPA 4H5NA 4BRQA 3A5NC 3DJCA 4H0TB 4JAXA 4CBUA 5KPTA 3D2EB 5EXWA 4BRLA 2P9LB 4B9QA 4IWVA 4B1ZA 1JCEA 3LDLA 4JNEA 1ZBSA 3QBXA 1HKCA 2ASOA 1RFQA 2AA4A 3G25A 5BRFA 4FOEA 4PL7A 4NB4A 4BC3A 3AAQA 1U2VA 3FR0A 4FO0A 4H0VB 3B8AX 3QB0A 2VCPA 4CZJA 1BU6O 3CJCA 5AQIA 3VF4A 3ZX3A 1GLCG 3VPZA 1NGJA 5ELZA 5EOYA 4XH4A 1YXQA 3CJAA 5AQGA 1X3MA 2Q31A 3HTVA 5TKYA 5BN9A 4BC4A 4WQ5A 4MLEA 2P9NB 3CJBA 3H6EA 3ZEUA 2D0PA 1GLDG 2IVNA 3RSEA 4CBWA 3H1QA 5AQQA 4IO8A 4FOIA 1ESVA 5AQOA 1C0GA 1V4TA 3UKRB 2Q2RA 3L4IA 3R9PA 3UE5A 4CZGA 3L6QA 3ENOA 5BRDA 2BTFA 2E2PA 3EKUA 5AQJA 3M3ZA 3MK6A 3R8EA 4WQ4A 5AZJB 4BRCA 3BF1A 3QFUA 2YHXA 2W41A 3AARA 2QWRA 1JCGA 2QWNA 4JHDA 1ATRA 5EY4A 1GLFO 1HPMA 3O4WA 3ATVA 4FSVA 3UB5A 3AAPA 3FE1A 3FLCO 4CZEA 1TUYA 2DPNA 5AZIA 3VENA 1NGIA 1BWFO 1QQNA 3O1BA 4BR0A 1K8KB 4M7XA 2P9KA 3O5BA 4BRAA 3SMSA 3VERA 5JICA 4BC2A 2P9IB 4JD2B 2ASMA 3WXIA
chains in the Genus database with same CATH superfamily
4AHTA 2E6MA 3LP1A 4CCHA 4DV0K 2HHSA 1TL1A 4KV8A 1KQSM 1A5XA 4PHTX 3SPZA 4I2QA 3G71N 2G8KA 3VETA 4RW4A 4AF1A 1KRPA 4Z0UA 2DTUA 2O8BB 5C24A 3QICA 4DV6K 3HPHA 4CGFA 4NXNK 3WEEA 3H3NO 4KHYA 3VQQA 5KTQA 4HUGA 1IBKK 2YNHA 5BN8A 4DTOA 4R79A 1REVA 3D6RA 4FLYA 3AVCA 2W40A 3O8MA 4ISGA 2FBXA 2R7YA 3HOSA 3ISNC 5HRRA 1NK8A 3LALA 1VRTA 4DTPA 4WE1A 1HLUA 4DLEA 1WN7A 3RRGA 4BGBA 2CGKA 4Q5VA 4GVMA 3SAHA 3RSEB 2IC3A 3DM2A 3K9KA 4W5OA 1JLCA 5LMNK 4FJXA 4PWDA 3OS0A 2WUSA 4FZXC 3MN7A 4MO5A 3KLEA 5J1EA 1RDCA 3TAMA 2H3GX 2BDPA 1BG3A 4CBXA 4FPBA 4C8LA 3LAMA 3LAKA 2D0CA 1D8YA 4BACA 2A41A 5GINA 2ZGYA 4E7HA 5FLXO 2ZGZA 3AA4A 4K43A 2P5GA 1J54A 2HMPA 1XNRK 2O8FB 3DWLA 2BE2A 5BPLA 3PY8A 2W6KA 4I2PA 1TKDA 2OPPA 1WBBA 1NU0A 1C0FA 3M8QA 1D4XA 3A0IX 3MCPA 5EX5A 4JI4K 2RHKA 2A6AA 3JYTA 4U67L 3GE1A 1OVQA 3SCXA 5FRMA 4RW9A 1Q86O 3CC7N 4FYDA 4DSKA 4A57A 4FJLA 4CGIA 1WSIA 3CCJN 3WXLA 5KRTA 1TK8A 3AVAA 3ZT2A 4BDPA 1RBSA 1S72N 4FWRA 3OS2A 4AM6A 2O8DA 4CJTA 3SUQA 4OLAA 4AHUA 3TSQA 1RBUA 5JLFA 1W2BM 2QKBA 1HKGA 4ELTA 3LPTA 3O80A 1ZC6A 3T19A 4CD3A 3HT3A 4A2BA 3ID8A 4JKFA 4PKGA 2RKIA 5M1QA 3VQDA 3LM9A 1EWQA 2Z1GA 4DQIA 4CJ5A 3SZ2A 2VGNA 4FWSA 1A5VA 4WCEL 3D45A 4DR4K 4JLHA 4KHQA 4HTUA 2O8EA 1NWKA 1NMDA 1X9MA 4CHZA 4XEIA 3EY1A 4F3OA 3V1RA 1CLQA 1MWMA 1BIUA 3RVCA 5BR9A 3O3FA 4QS9A 2F8SA 4WFAL 3OVNA 3ZSVA 1NG9A 3EYZA 2E1YA 2V52B 4TSXA 3VEZA 4X66K 4CEDA 5KQDA 1N34K 2NRZA 1DKGD 3O4QA 4BRMA 1DTQA 1R0AA 3NH2A 2KZMA 3LDSA 1VSLA 4OKJA 1QZ5A 4YORA 4DR7K 5DM7L 3NCIA 4OPJA 4H03B 4KI4A 2AP1A 4EHTA 4O8KA 1KAYA 5BPNA 4CK2A 4I9LA 4FLUA 1SQKA 1L3UA 4FWNA 3P5JA 5ADXH 3C7NA 1EQYA 3TAFA 1RTIA 5AQXA 2NRHA 5C10A 3K5NA 5J2PA 4DSEA 4AQYK 4X64K 2UUBK 3SMPA 1U45A 1ILYA 3LDPA 3NF7A 2Y1IA 2WBNA 1XMOK 4DCHA 3VEWA 1D5AA 4HHTA 3RTVA 1IKYA 4M63C 4RTFD 3M8SA 2O8CA 3CCLN 4CEFA 1BUPA 3VQ7A 1HJOA 3MXJA 3CJ9A 1RT4A 1NBWA 1HNWK 1S9EA 3C95A 4RWTA 1NGCA 4OX9K 4LSNA 4KHPK 3HI0A 2ITMA 5CR4A 3CQXA 3AA2A 4EIAA 1LAVA 1ATNA 4YNQA 2HB5A 4BVPA 1OH7A 3QO9A 5GADP 4IKFA 1RDWX 3TPQA 1VQ5N 1SS6A 3A8YA 4GV9A 5FPDA 1JXBA 2IVPA 4FWQA 4DTMA 1YTUA 3SYZA 4NCGA 1YVNA 3O6WA 5AJ3K 4CHQA 4K25A 2IVOA 2VWJA 4CD1A 3AY9A 3NVKA 1RCHA 3HVRA 2OANA 2UXCK 2P9LA 4H5VA 4WYBA 4JI3K 1HX1A 2KW4A 1IH7A 2I7PA 3BUZB 4EHUA 3L0QA 2QXLA 3SI6A 2FLOA 3THYA 1J53A 3JAMO 1U6ZA 1RNHA 4F4KA 1XNQK 5JLHA 3DRRA 1NGBA 3CM6A 2NRRA 2B4JA 3ZYYX 1FKOA 2PYLA 4CIEA 1C1CA 1QSYA 3QEXA 4EAHD 1LWFA 3C65A 4H0PA 2VWKA 4M3XA 4JKAA 2HOEA 3CHWA 3ZSWA 1YF5L 3EZWA 1GLAG 3PSFA 2P9NA 1IBLK 1WSEA 3TTFA 3BEXA 1IKVA 3DLRA 3THWA 2LSNA 3MX5A 5KI6A 3VF2A 4BR9A 5IWAK 3PIPL 4ELVA 1EETA 3CI5A 2IDOA 4AM7A 4E7JA 1NK6A 3QEVA 5AZJA 2E4LA 1NKEA 4DTXA 2DFFA 1SKWA 1TUUA 4KAZA 3KWGA 4FJMA 1S22A 1XC3A 4LC9B 3NGYA 2HBMA 3TI0A 2HW3A 4BE0A 3OYEA 3KVGA 1BOTO 3F73A 4BQZA 4IEEA 3OYIA 4NLBA 1WNSA 4E19A 5AQMA 4GKJK 3L3UA 3ZT1A 5HRSA 3KD1E 4H5NA 3AO4A 4CBUA 3O3HA 3SBGA 3C94A 2XY5A 2XY8A 3AVLA 4IG3A 3H08A 4B9QA 1JCEA 1YT3A 3G25A 1HQUA 2AA4A 4PL7A 2OTJN 4BC3A 4FJKA 1S6QA 3FR0A 3SQ4A 4GKKK 1CZBA 3QB0A 3F9KA 3QERA 4HCBA 1VQNN 4A5AA 3ZX3A 3VPZA 3VQ6A 4JK9A 4H8KA 1YXQA 5AQGA 3KIOA 4NYFA 5TKYA 3OYCA 2I5JA 3EZ5A 4MLEA 2ZM6K 2WOMA 3BZCA 3S9HA 1Q9YA 1YI2N 4C8MA 3RSEA 3RMCA 5AQQA 3AGRA 4NYNA 2VQFK 4BE1A 2P1JA 3AVMA 1NOZA 2Q2RA 4KH4A 3R9PA 3ENOA 5BRDA 2BTFA 3C6UA 4K8XA 3M3ZA 3CFRA 2ATQA 3NDKA 4Z4EA 1XC9A 3R8EA 4FM0A 4WQ4A 1HNZK 4DR6K 1Q82O 2YHXA 1NJXA 1JCGA 3SQ1A 1HPMA 4DV4K 1UWBA 2KFNA 1UOCA 4CZEA 1RDAA 2KKZA 3KWIA 4G9ZA 4Z4HA 4CK3A 1RT3A 1K8KB 2HNDA 1WBDA 3CYMA 5JICA 3DLLL 3WNEA 4BC2A 4JD2B 3LDOA 2ASMA 3DOLA 3GL1A 3SAGA 2BH1A 4G1QA 4CF8A 3QMLA 3C6AA 1T03A 1ZBLA 4C8NA 3T1AA 4OLBA 4CJSA 5DM6L 3LP0A 5GIOA 5EU7A 5FPEA 4A62A 3CCUN 4B9MA 2JLEA 2W6LA 3DAWA 4B1WB 1U2VB 3M8PA 3H45C 4HVJA 1TGOA 4W5TA 4F3TA 3LWLA 1TKZA 3KLIA 4BY9C 1LW0A 1K6YA 3ZT0A 1T6CA 3TARA 4CEQA 2D1KA 3VQCA 4MDBA 4O5BA 3ZLJA 4CZFA 1I3AA 2QW9A 5B8HA 4DSIA 2GTDA 4O0JA 1Q9XA 2P9SB 4JK8A 3EE9A 3PV8A 1HYVA 3EEQA 3K9JA 3E01A 3ZSRA 5AQTA 5FROA 3P38A 3L8BA 3FZHA 4JI1K 1SV5A 1JLFA 4DQ8A 5M1KA 1YHQN 4DWIA 1DGKN 4CEOA 3AVGA 1HUXA 3C0BA 1N8RO 2F96A 3J7ZO 1T44A 2A40A 3BZKA 3VOVA 3MN5A 4WQ5C 2ZD1A 3HXMA 4BDYA 3ZX0A 3TAGA 1VQMN 4DFMA 2FF6A 1MA9B 4KTWA 5HBMA 4IDKA 3KK3A 5AZIB 1YAGA 4OJRA 3M5RA 3EE8A 1NGGA 3WNGA 4A5BA 1SUQA 4BRIA 5HROA 1K8AO 3V1OA 3ZT3A 5A2QO 4BVOA 1BQMA 4F8RA 4IJNA 1KC8O 4RG8A 4ELUA 3IFRA 4CHYA 2CGJA 2WC9A 1UA0A 2E6LA 2F9TA 5J2QA 4FJ8A 3E9LA 3VQEA 3KLHA 2Z1IA 5EVZA 4CECA 1LWEA 2GX9A 1QE1A 4QAGA 4YOTA 2ASPA 3J8AA 3ZCMA 1C1AA 4YHHK 3NF6A 2Z1JA 2NNWA 4DU4A 1QQCA 2P9PB 4DTJA 1TAUA 3VA0A 3R1XA 3SUNA 3HZ6A 1TYQB 3EKSA 4KTZA 4JK7A 3V9UA 1EWRA 2QM1A 2G8FA 2QXFA 4DF4A 3LM2A 3CCQN 5AFUA 1NK7A 4OO1J 1NGFA 2CGLA 4FM2A 4B9VA 2D0OA 1CZ9A 2A3ZA 4BG9A 4CIGA 1T6DA 3WQUA 4MDAA 1RT1A 5SWMA 1BCOA 2D5RA 2G8HA 3A5LC 1IG8A 2ZJRL 1BA0A 2KZZA 1OH5A 1X9WA 3KKRA 4JKBA 4FJHA 4JKCA 1RT5A 5M1OA 2DFHA 3FZFA 3F9MA 3THVA 1KFSA 1RBTA 3KLGA 1Q7YO 3CD6N 2ZQBA 4CEZA 2HSTA 3E1YA 5JMVA 3NGIA 4H4OA 1MDUB 4GY2B 3AO1A 3UKUB 4FPAA 3PX0A 4DG1A 2OZSA 4DTUA 4PKHA 4YDUA 3F2KA 5AQKA 4KBOA 3V9WA 1VQ8N 1S1UA 3KTQA 1EP4A 3GG4A 4PA1A 4N5SA 2OTLN 3VQ9A 1IKWA 4E89A 1P8ZA 3NFAA 1KSPA 5JVGL 3TWHA 3CERA 2X74A 3SLCA 4BR4A 4X65K 5M1NA 4CJPA 1KCFA 1RDBA 3KKSA 3CF5L 4DTNA 5AQZA 2YHWA 1EX4A 1NGDA 1NOYA 1TVRA 5JS1A 1UA1A 1KAXA 3AVBA 3IS9A 1RILA 1WUAA 3S3MA 2GWKA 3Q7BA 5T7BA 3SJHA 4J2DA 3NVMA 1X9JA 3TAEA 3LZJA 3OYKA 4H0OA 3O9RA 3K0SA 4B3MK 5AQRA 4NO7A 5HLFA 1RDDA 4KREA 3A5OC 2ZE2A 3ZETB 5C12A 4L3QA 3EL2A 3LPUA 4JV5K 4E1NA 4N56A 2Q97A 3LDQA 3CG7A 2HF3A 2GWJA 4DSLA 4CFBA 4GVEA 3FZLA 2FSJA 4Y1DA 3U8XA 1H1VA 5TKWA 1HNXK 1VSIA 2PBDA 3K5LA 5JS2A 4DHYA 1D9FA 4JI6K 1QSLA 3CCEN 1O13A 3HP6A 3BY5A 3PX6A 3LZIA 5I42A 4IJAA 1IKXA 1BI4B 2B6AA 1VQKN 1VQON 3QIPA 4XH5A 3TAPA 3WXJA 1X1PA 2HHUA 1P90A 1TK5A 3VQBA 4J2AA 3L2QA 2A1SA 1GLEG 3AO3A 1W9HA 4B1YB 4CFCA 3H3OB 4WF9L 4BQLA 5J2MA 4B9SA 4KKOA 3D2FB 2FC0A 3OBYA 4IFYA 2FBVA 4C23A 4FWLA 4JI5K 4B1UB 4BWMA 3LDNA 4H0XB 4FW2A 3M6GA 2NRWA 1TKTA 3ZSQA 3P4IA 1K9MO 3CCRN 3QDKA 4FW1A 4IO9L 3PO5A 3JS6A 2F9WA 3MWTA 4GNIA 3ITHA 1DT9A 3L3VA 2HHQA 4BDZA 4JRPA 3IMXA 4KH6A 1MU2A 1HRHA 4CESA 1KD1O 2HNYA 1OKJA 3ULEB 1N32K 3CCSN 4I6MA 4PQUA 3WT0A 5F2RA 4DV5K 3CCVN 4A61A 4LFCK 1C0MA 2O4GA 3C6TA 1BA1A 4Z94A 4CJQA 3ALYA 1K8KA 2KTQA 3CJ1A 3L4QA 4FK2A 2QWPA 4DFPA 4IOXA 3THXB 1B9FA 3L2WA 3D0PA 5KPTA 4JKGB 1WSFA 2X6SA 5EXWA 3AO5A 2OA8A 1FKPA 4E0DA 2YNFA 4B1ZA 3LDLA 4DS4A 1ZBSA 1VQ6N 4OGCA 4Q0BA 4YFUA 5BRFA 4FOEA 3KJVA 3V9ZA 2UU9K 4CJUA 3AAQA 5C2FA 1U2VA 5IT9O 2VCPA 3AVIA 4CZJA 3CJCA 3L2RA 1NJYA 3OS1A 1J5OA 3J80O 1NGJA 3T1YK 4JYAK 4DTRA 4OGEA 4XH4A 3B6OA 1X3MA 4AHCA 2Y1JA 4DS5A 1KVBA 5KRSA 2ZJQL 5BN9A 3VA3A 3HP9A 4KPYA 2IGIA 3H6EA 5M1FA 3OYNA 2HBJA 5J2NA 4CBWA 1YTAA 1NKBA 1VSJA 3RMAA 4UQGA 1KFDA 3ZSXA 3EKUA 3BF1A 4W5QA 2QI2A 4CJRA 3OBWA 4DR5K 1FW6A 3MXIA 3NGZA 4CEAA 3B6PA 3G6EN 3ATVA 4FSVA 1YJNN 4DFJA 4M3YA 4CJFA 4LY7A 2QEXN 1TUYA 3SV4A 5AZIA 3VENA 1NGIA 3M8RA 4ID5A 3NHGA 1RTDA 3O5BA 4YOXA 3VERA 4JI2K 3VN5A 3AVJA 3PX4A 3CPWM 3S3OA 3O4NA 4BR2A 2NRXA 2NUBA 4DU3A 1DEJA 3O9SA 1RT7A 3QINA 5AQFA 2EWSA 4BWJA 3G0ZA 3HBTA 1JL2A 1JLEA 3QLHA 5GAGP 5HOOA 3UKRA 3QBWA 4AH9A 3OYJA 1FXXA 2BUPA 2P9PA 4H5RA 5CYQA 1TYQA 3IUCA 2KLAA 3EN9A 4XH1A 3TTDA 4OKEA 3VGMA 5CHIA 4RW8A 2OCEA 2A42A 1N33K 4W5RA 1J6ZA 3MDQA 3K5MA 1VSMA 4M3TA 4DSJA 3OYFA 5AR0A 4AHRA 4ILJA 1YVUA 4JN4A 3ZEUB 4CZHA 3ENBA 1NNEA 4B08A 4KFBA 3TTCA 4DUZK 2OZMA 4O0IA 1T05A 4CJLA 1EO1A 2YHBA 4BE2A 2E2QA 3VEOA 3VTIA 4FZZA 2KHOA 4LF9K 1YJWN 1RBVA 3FGUA 4ILGB 1JLBA 3I8BA 4FLTA 4IOAL 3LL3A 2V51B 2UXDK 2O8BA 3VMFB 5AQHA 1NKCA 3HPGA 1IG9A 5CYMA 4B1XB 3HJFA 4FK4A 3OA9A 1QS4A 1JJ2M 4FJGA 3TR8A 3CQYA 4CF2A 3ZX2A 3CIPA 1RBRA 4XIUA 4B8AB 1JCFA 1BDGA 4NXMK 2P9KB 2WFBA 2HMIA 3QEPA 4FLWA 3G4SN 3KHYA 4MLHA 3OW2M 2A1RA 3HL8A 5AQSA 1WSJA 4CFDA 2XO7A 4CGDA 5FRNA 1IO2A 3VESA 2ITGA 4EZ9A 4IG0A 5F1XA 4CJ4A 1S1XA 2FXUA 3VQPA 2YI1A 1KXPA 1GOCA 2NLXA 3I56N 4E3SA 2P5OA 4FVMA 1QZ6A 4AHVA 3L2UA 2HHVA 3HRGA 3DXMB 3JSMA 1M90O 1BIZA 3V6DA 3ATUA 4DV3K 3AVHA 4CZMA 1BISA 2QTDA 3TAQA 2FSNA 3O1WA 1LOTB 4CJ3A 1WAJA 4FZYA 2O8FA 2D0AA 1T8EA 4GMJB 1C0TA 4BC5A 1OH8A 3TSPA 4BRFA 1TKXA 3AA5X 3OYGA 1XQSC 1L5UA 4BG8A 4M7YA 2FSKA 1O1WA 3CC2N 4JS5A 3CCMN 2X6NA 1QHTA 2XY6A 4RCHA 1X3NA 1WLJA 1J9AA 3V1QA 1I94K 3WNHA 4IXCA 3NBPA 3DOKA 3AVFA 1LV5A 3MXMA 3OHRA 3HK2A 4YOVA 4B9NA 3JXUA 5D3GA 4PUOA 5E84A 5E26A 4M41A 4Z4IA 3MCAB 2FF3B 2NRVA 4CZLA 1G99A 4FK0A 3MX2A 5AQPA 3DXKB 5LY3A 2YKMA 4FWMA 4FWPA 1GLLO 2B5JA 1VQPN 2G8UA 5FDLA 3D2FA 2QWMA 5HRPA 2E2NA 1QQOA 2AJQA 4HUFA 4BRHA 1QHAA 4M3RA 3EO3A 3O9QA 2RF2A 4CFAA 4DSFA 5AQYA 1YJ9N 5AQUA 3NE6A 1Q18A 3MN9A 2G8VA 1X9SA 4H0YB 4DQSA 4CHNA 4ILHA 1XUPO 3NF8A 1Z25A 4CGHA 1TAQA 3GDQA 4ZHRA 1KLNA 2VYPA 1T7PA 1NLVA 4IZ9A 2FBYA 3RRHA 3V9SA 3THYB 3R6MA 3ULEA 2P9UB 4CK1A 1C6VA 4BRDA 5HL7L 4QOZB 4LH4A 1VSHA 1S3XA 4DR3K 3QNOA 2YJEA 1LCUA 1NJIO 1VAZA 4KO0A 4E1JA 3SQ0A 2KFZA 3SUOA 1G15A 1VRUA 3NAEA 3WUHA 1UAXA 1CZAN 4B3OA 1EKEA 5JVHL 4I9QA 4LF5K 3HYFA 5LJWA 3THXA 3ID6A 1BQNA 4Z4CA 3BP8A 3HSTB 3MECA 2D0BA 2DFEA 4DB3A 4J2BA 3E9OA 1JKHA 1U48A 3O9TA 1FJGK 4B1VA 3TABA 2ZF5O 3MEDA 3MEGA 5KGXA 4GV3A 1GLBG 2JWKA 3P83D 4CGJA 3C6HA 4JKHA 3CM5A 2Q0RA 2IS3A 1HJRA 1KAZA 4O55A 4LF4K 4KHUA 5C0YA 2XRIA 2QK9A 1Y97A 2E20A 1T3VA 1OH6A 2QWQA 1HKBA 3QETA 3DMJA 5F0XA 1LAWA 3CMAN 3H1VX 3U9ZA 5AQWA 1HQEA 4MO4A 4F2RA 1LW2A 3MWPA 1NGHA 1I39A 2IOCA 4MFBA 3T7ZA 3I8DA 4NCAA 2GELA 1ZBUA 2YCHA 2UUAK 1ATSA 4E7KA 1NGAA 5HRNA 4DFKA 3U6FA 4HTLA 1EXQA 3K59A 3BGRA 3N4PA 3PUFA 2YKNA 3PIOL 3V81A 1NK4A 5C25A 2PZSA 3K58A 1NJWA 5AFUH 1YITN 5BR8K 2Q0UA 3RR7A 4X62K 2E2OA 4CERA 3AO2A 3CQ8A 2Q3SA 2V7ZA 4JRQA 1V4SA 3DRSA 4DV2K 4K42A 2YV0X 1MWKA 3MN6A 4H4MA 1SKRA 1VSDA 4CHPA 4FLZA 4B3TK 3NF9A 4R5PA 4YOWA 3WXMB 5I3UA 3DLKA 2HBLA 1YUWA 1JL1A 1ZBHA 1ZXOA 4M45A 2Q1NA 4DQRA 2E5LK 3PLAA 4LD0A 3A5NC 4H0TB 5DK5A 2F4VK 1S6PA 1IBMK 1BCMA 3D2EB 4BRLA 4M3UA 4JNEA 2WONA 3T1HK 1KVCA 1HKCA 2ASOA 3VQ4A 2FBTA 3HVTA 1BL3A 3UIQA 1N36K 1QSSA 4FO0A 2VQEK 3B8AX 3I55N 5C42A 3VQ8A 4V19S 4ZTJA 2PYJA 3VF4A 2VG6A 3CFPA 1GLCG 3DLGA 5ELZA 3DLEA 1Q81O 1VQ9N 1HPZA 4N41A 3G10A 1S1TA 3HM9A 4EZ6A 3QIOA 4QCLA 4B9UA 4WQ5A 1JXEA 4FXDA 2YX6A 3CJBA 4KB1A 1VQ4N 4OVLA 3CFOA 4U7BA 3ZEUA 3E9PA 3J7YP 1N6QA 4IO8A 3AA3A 1JLQA 1ESVA 4FOIA 4C8OA 4DU1A 1NK5A 1V4TA 3L4IA 3UE5A 2IAJA 5KGWA 3L6QA 1XHXA 4HUEA 2E2PA 5C15A 4ID1A 3OYLA 1W0HA 1ASWA 3MK6A 3OYMA 1L3TA 1D9DA 3J7AP 4BRCA 4DUYK 3QFUA 1BHLA 2W41A 5CY4A 3ASMA 4EP4A 2QWNA 5EY4A 3UB5A 3O4WA 1U4BA 3AAPA 1ZYQA 2DPNA 1VSKA 1BWFO 4B3SK 3O1BA 4BR0A 4M7XA 2P9KA 3T3FA 4BRAA 3SMSA 2XHBA 2HNZA 3SBTA 2P9IB 3WXIA 4I7FA 5ADXA 4KHSA 1NK0A 4WFBL 4Y1CA 2GBZA 4NCBA 4JKDA 1U49A 5BREA 2GEMA 4OPHA 4BRKA 5E41A 3CC4N 4Z4GA 3GBTA 5CZ2A 3AV9A 2VWBA 3VEYA 3WNFA 2RE2A 4B9LA 1SL2A 3VGLA 3P31A 2X78A 4CJKA 1NM1A 1U47A 4DV7K 3SK3A 3DXMA 4N76A 4CE9A 3KK7A 4CF1A 4HCCA 3K57A 4J2EA 2UUCK 3OYAA 1IV0A 4RW7A 1BGXT 4LF8K 5KPRA 3SPYA 4CVNE 2PFUA 4J8FA 5C2DA 3SJJA 4E7LA 4JD2A 5M1PA 4O4GA 2JWLA 3KZBA 4FL9A 3VEXA 3S41A 2I7NA 3NH0A 5BRHA 4CJ7A 4DQQA 3IRXA 2JGUA 4O44A 3RMDA 1RDUA 4BREA 4JHDB 1B92A 1S5JA 2VGMA 3HM8A 4F9OA 1Z6RA 3TSUA 2YHAA 4PL8A 3VTHA 5H1SQ 3BF3A 3IDHA 1JLGA 3FFIA 3R3LA 3I0SA 3W3DA 3SNNA 5FPMA 4BROA 4WQ4C 3IG1A 4CF0A 2HVHA 3RMBA 1HYSA 2HHHK 2NZTA 3WQTA 2PAVA 2P9SA 4C1NI 4LH5A 4EFHA 1HR0K 3DXKA 1WSGA 3U9DA 1WAFA 1ZBIA 4CJVA 2W42A 1GLJO 1SKSA 3U3YA 3WEEB 3FFKB 4O8UA 3KLFA 5K14A 1FK9A 1Y64A 2Q36A 4ISEA 1NGEA 2YHYA 2D4WA 4CW7B 1NMNA 2O4IA 5BPMA 1Q8IA 3K5OA 1VQLN 4CZKA 4KI6A 1HMVA 5KPZA 4H5TA 2OYQA 3LWMA 1NK9A 1ZBFA 4CEEA 1QQMA 3VF6A 1RT6A 4DR2K 1HYZA 4Y0WA 2P9UA 2QWLA 3W0LA 1VK0A 3NMUA 4LSLA 3I33A 1F21A 1SZ2A 2G8WA 5GAEP 2E1ZA 1RT2A 2CH5A 3KK2A 3SUPA 1N5YA 1ASUA 3TANA 4CZIA 4KB0A 3P1GA 1C0UA 4JS4A 2IIRA 4DKWA 4CJEA 3KD5E 1SAZA 2BANA 2P51A 4QS8A 5FPNA 4PKIA 4JI0K 4ICLA 3MMVA 4ZTFA 4FVUA 1VSEA 4M3ZA 1C1BA 1S1WA 4CI6A 5AQLA 3P39A 4LF7K 2HHTA 4H5WA 2HBKA 3AVKA 1R59O 3M1FA 3RR8A 3V9XA 5DMRA 1SL0A 3SV3A 3DLHA 1RGIA 4CEBA 4CF9A 4FWOA 1W7AA 2NRTA 1E4FT 4AILC 2YNGA 3CXCM 4FLXA 4LFBK 1HNVA 4YOYA 3SQ2A 3J81O 3WXKA 2O8DB 3VGKA 3U3GA 4FCYA 3OYBA 1WOQA 2A5XA 3ZSZA 2HF4A 1NJZA 1RTJA 3ZSOA 2CH6A 1GOBA 3VEVA 3RWUA 3TU5A 3DRPA 4OKKA 4FWKA 2F7TA 3DYAA 4KTQA 1U04A 3ZT4A 4BRNA 3HPOA 1WB9A 4FJ7A 2V7YA 3UKUA 3F5TA 5LJVA 5CE3A 1XWLA 1JLAA 2O8EB 5CZ1A 1VHXA 2ZWHA 3GOIA 1K73O 4NLCA 2OPRA 4JI8K 2YJFA 4IDHA 2OPQA 3OY9A 4FJIA 3CJ7A 3Q7CA 4CIFA 5AQVA 3U4LA 1E4GT 3AGKA 3ENHA 4QS7A 3SAFA 5KQ8A 4BRGA 1S1VA 4M3WA 4A59A 2ZJPL 3FZMA 4IOCL 3A2FA 1OVYA 3MEEA 2RPIA 3NH1A 4HWIA 2E88A 3HSCA 1BO5O 4RW6A 4W5NA 4K41A 4BR7A 3T69A 3PO4A 3HO1A 2HVIA 1TV6A 3CMEN 1KVAA 3MAQA 3O08A 3ULDA 3D2EA 4FJ5A 4BRPA 4I6MB 2KQ2A 2GUPA 4A2AA 3D7EO 3ZETA 2J4RA 1TL3A 1L3VA 1S9GA 3K2PA 5LMUK 2GUIA 3DLBA 2QKKA 4L8RB 4DQPA 1HNIA 3HOTA 4YDUC 3C7NB 4KH5A 1XMQK 4DR1K 3CETA 5SZTA 3H46O 4DF8A 2QA4N 2E8AA 1VQ7N 5AQNA 1GOAA 4FM1A 2HHXA 2RN2A 4C8KA 2O8CB 1BI4A 1IJJA 4ISFA 5I9EB 3FZKA 1QVGM 1Z05A 1QTMA 1QVFM 4IFEA 2BGGA 3PSIA 3A5MC 4BGAA 3OYHA 4FLVA 4LF6K 3IAYA 2VG7A 2QWOA 4AHSA 4FJJA 3KK1A 2PY5A 3N4QA 1DLOA 1KTQA 4N47A 4BR5A 1DTTA 1TK0A 1Z26A 4OPKA 1L3SA 4JI7K 2F8TA 4B9TA 2HHWA 4IBNA 3LP3A 4FJNA 1W97L 3BDPA 2DY4A 3IKMA 1RTHA 2YNIA 4YOUA 2EX3A 4EP5A 1XI1A 4O5FA 4KRFA 3I0RA 3AVNA 4JKEA 4K8ZA 4IFVA 2P9IA 3QEIA 2UYTA 4DMNA 1ASVA 2ETJA 3QFPA 4BRQA 2WTUA 2G8IA 3ZSYA 4JAXA 3DJCA 1B9DA 4F2SA 5LL6Z 4M42A 4GV6A 5GAHP 3OJSA 2P9LB 4IWVA 3QBXA 2GV9A 1RFQA 3L2VA 1XHZA 3OJUA 4NB4A 4OPAA 3VQ5A 4FJ9A 1WSHA 4H0VB 4DV1K 4KHNA 1CXUA 4CGGA 1BU6O 5AQIA 2UXBK 3LP2A 5EOYA 2OPSA 5GIPA 3OYDA 3S3NA 3CJAA 4KHWA 4DTSA 5MLCQ 2Q31A 4UY8O 3HTVA 4MQ3A 1LWCA 4GW6A 4IEIA 4Z4FA 4BC4A 3E66A 3O3GA 2P9NB 1CXQA 4WFNL 1ITGA 3THWB 2D0PA 1J5EK 3DI6A 1GLDG 2IVNA 1A5WA 3H1QA 4E1MA 1SL1A 3OTOK 3VQAA 5AQOA 1C0GA 3UKRB 4JKGA 4CZGA 4B8CA 5HP1A 4LFAK 4YY3K 1M1KO 4CJWA 5AQJA 4PY5A 4JEPA 2XY7A 3QNNA 5AZJB 1KLMA 3AARA 2QWRA 4JHDA 3LANA 1ATRA 2EHGA 1GLFO 4C1NK 3O9UA 3FE1A 3FLCO 4CHOA 1QQNA 4B3RK 1E3MA 2VG5A 3V4IA 3QEWA 1YIJN 3CPEA 4E7IA 3QESA 4K0KK 2Z1HA 4DLGA 1VSFA
chains in the Genus database with same CATH topology
3GL1A 2BH1A 4WFBL 4BR2A 2NRXA 4JKDA 3QMLA 1KQSM 3C6AA 5BREA 1DEJA 2GEMA 3O9SA 4OPHA 4PHTX 4BRKA 5DM6L 3G71N 3CC4N 5AQFA 2EWSA 3GBTA 3VETA 4AF1A 5GIOA 3HBTA 5FPEA 3QICA 4A62A 2VWBA 3CCUN 3VEYA 5GAGP 5HOOA 3UKRA 3DAWA 3H3NO 2RE2A 2BUPA 3QBWA 3WEEA 2P9PA 1U2VB 4B1WB 4H5RA 3VGLA 3P31A 3H45C 5BN8A 1NM1A 1TYQA 3IUCA 2KLAA 3EN9A 3SK3A 4R79A 3DXMA 4XH1A 4BY9C 3D6RA 3TTDA 3KK7A 3VGMA 5CHIA 1T6CA 2D1KA 2W40A 3O8MA 2A42A 4MDBA 1J6ZA 3MDQA 4ISGA 4CZFA 2QW9A 3HOSA 5KPRA 5B8HA 2PFUA 4J8FA 5AR0A 2GTDA 1HLUA 5C2DA 4ILJA 4JN4A 2P9SB 4JK8A 4BGBA 3ZEUB 3EE9A 4CZHA 2CGKA 3ENBA 3K9JA 3SAHA 5AQTA 3TTCA 3P38A 4JD2A 3RSEB 3K9KA 3FZHA 1EO1A 2E2QA 5M1PA 4DQ8A 3VEOA 2JWLA 3VTIA 3KZBA 4FL9A 3VEXA 5M1KA 1DGKN 1YHQN 2KHOA 1HUXA 2WUSA 3S41A 1YJWN 3C0BA 2I7NA 3MN7A 3FGUA 4MO5A 4ILGB 5BRHA 4CJ7A 1N8RO 3I8BA 3J7ZO 1T44A 2A40A 4IOAL 2H3GX 2V51B 3LL3A 3VOVA 3MN5A 1BG3A 4WQ5C 1RDUA 4BREA 4CBXA 3VMFB 4FPBA 5AQHA 3ZX0A 1VQMN 4JHDB 2FF6A 4B1XB 1MA9B 3OA9A 2A41A 5GINA 1JJ2M 2VGMA 2ZGYA 3CQYA 3HM8A 3ZX2A 1Z6RA 5AZIB 2ZGZA 4K43A 3TSUA 4F9OA 1YAGA 3CIPA 2HMPA 4PL8A 3M5RA 3VTHA 5H1SQ 3DWLA 1JCFA 1NGGA 1BDGA 3BF3A 3EE8A 3IDHA 4A5BA 2P9KB 2WFBA 4BRIA 5BPLA 1K8AO 3R3LA 3G4SN 3KHYA 4BVOA 4MLHA 3W3DA 5FPMA 4BROA 3OW2M 4IJNA 5AQSA 4WQ4C 1KC8O 1C0FA 3IFRA 2NZTA 3WQTA 2CGJA 2WC9A 2PAVA 1D4XA 3VESA 3A0IX 3MCPA 2F9TA 2P9SA 4C1NI 3E9LA 5F1XA 5EX5A 4EFHA 2RHKA 5EVZA 2A6AA 3DXKA 2GX9A 3U9DA 2FXUA 4YOTA 4U67L 3GE1A 2ASPA 2YI1A 1Q86O 3CC7N 3J8AA 1GLJO 4A57A 1KXPA 2NNWA 3WEEB 2NLXA 3WXLA 3CCJN 3FFKB 4O8UA 2P9PB 3I56N 1Y64A 2Q36A 1QZ6A 3R1XA 3HZ6A 4ISEA 1NGEA 1TYQB 4FWRA 1S72N 4AM6A 3EKSA 3HRGA 3DXMB 4JK7A 2YHYA 2QM1A 1M90O 2D4WA 3LDOA 3LM2A 3CCQN 5AFUA 3TSQA 5BPMA 5JLFA 3ATUA 1W2BM 4OO1J 1NGFA 2CGLA 4CZMA 1HKGA 1VQLN 2QTDA 3O80A 1ZC6A 4CZKA 2FSNA 3O1WA 4CD3A 1LOTB 2D0OA 4A2BA 3ID8A 2A3ZA 4JKFA 5KPZA 4BG9A 4H5TA 4PKGA 1T6DA 5M1QA 3WQUA 4BC5A 4MDAA 3LM9A 3TSPA 1QQMA 3VF6A 4BRFA 2VGNA 4FWSA 3A5LC 1IG8A 2ZJRL 1XQSC 4WCEL 4BG8A 4M7YA 2FSKA 4Y0WA 2P9UA 1NWKA 2QWLA 1NMDA 3W0LA 3CC2N 3CCMN 3NMUA 1BA0A 3I33A 4JKBA 1SZ2A 4RCHA 1X3NA 5GAEP 2E1ZA 4JKCA 5M1OA 2CH5A 3FZFA 3F9MA 4XEIA 1MWMA 4CZIA 3RVCA 5BR9A 4IXCA 4QS9A 2IIRA 4WFAL 4DKWA 1Q7YO 3CD6N 1SAZA 4QS8A 5FPNA 2HSTA 3E1YA 5JMVA 4PKIA 2E1YA 2V52B 3MMVA 3VEZA 1MDUB 5KQDA 4GY2B 2NRZA 3OHRA 3UKUB 4FVUA 4FPAA 4YOVA 3JXUA 4PKHA 1DKGD 4YDUA 4BRMA 5E84A 5E26A 3F2KA 4CI6A 3MCAB 5AQKA 3P39A 4KBOA 5AQLA 4H5WA 2FF3B 2HBKA 2NRVA 4CZLA 1VQ8N 1G99A 1R59O 3GG4A 3DXKB 1QZ5A 3M1FA 3MX2A 4YORA 5AQPA 5LY3A 2OTLN 4FWMA 5DM7L 1P8ZA 4FWPA 4H03B 5JVGL 2AP1A 1GLLO 1RGIA 4O8KA 4EHTA 3CERA 4FWOA 3SLCA 1KAYA 4BR4A 1VQPN 5M1NA 2NRTA 3D2FA 1E4FT 5BPNA 2QWMA 3CXCM 2E2NA 1QQOA 4YOYA 3CF5L 1SQKA 3WXKA 4FWNA 1QHAA 5AQZA 4BRHA 3EO3A 3VGKA 2YHWA 3O9QA 5ADXH 3C7NA 1NGDA 1EQYA 1WOQA 2A5XA 2HF4A 5AQYA 1YJ9N 5AQXA 5C10A 1KAXA 2CH6A 2NRHA 5AQUA 1WUAA 2GWKA 3Q7BA 3SJHA 3VEVA 3SMPA 1Q18A 3MN9A 1ILYA 3LDPA 3NVMA 4H0YB 1X9JA 3TU5A 2WBNA 4FWKA 2F7TA 3VEWA 4ILHA 4DCHA 1XUPO 4H0OA 3O9RA 4BRNA 5AQRA 4M63C 4NO7A 4RTFD 2V7YA 3GDQA 3UKUA 3F5TA 3CCLN 2VYPA 3A5OC 1NLVA 4IZ9A 3ZETB 5LJVA 5C12A 5CE3A 1BUPA 4L3QA 1HJOA 3EL2A 3R6MA 3ULEA 2ZWHA 2Q97A 2P9UB 3CJ9A 3GOIA 4NLCA 3LDQA 1K73O 2YJFA 2HF3A 4IDHA 4BRDA 1NBWA 2GWJA 5HL7L 4GVEA 4RWTA 1NGCA 3CJ7A 1S3XA 3FZLA 3Q7CA 2FSJA 3U8XA 5AQVA 3HI0A 2ITMA 5CR4A 3CQXA 3U4LA 1H1VA 1LCUA 2YJEA 5TKWA 1ATNA 4EIAA 1NJIO 4BVPA 1E4GT 3AGKA 3ENHA 4QS7A 3SAFA 1VAZA 4E1JA 5KQ8A 5GADP 4BRGA 1RDWX 3TPQA 1VQ5N 2PBDA 1SS6A 3A8YA 4A59A 4DHYA 4GV9A 2ZJPL 3FZMA 5FPDA 2IVPA 5ADXA 4FWQA 3WUHA 3CCEN 1O13A 4IOCL 1CZAN 1OVYA 5JVHL 4HWIA 2E88A 4IJAA 3HSCA 1BO5O 1YVNA 5LJWA 1VQON 1VQKN 3ID6A 3O6WA 4K41A 3BP8A 4BR7A 4K25A 3T69A 2IVOA 4XH5A 3WXJA 4CD1A 4DB3A 1P90A 3AY9A 3E9OA 3CMEN 3NVKA 3O9TA 3O08A 4B1VA 3D2EA 2OANA 2ZF5O 2P9LA 1GLEG 4H5VA 4BRPA 4I6MB 4WYBA 4B1YB 1HX1A 4GV3A 3H3OB 2GUPA 1GLBG 2I7PA 2JWKA 3BUZB 4WF9L 4EHUA 3L0QA 4BQLA 3C6HA 3D7EO 4A2AA 4JKHA 2QXLA 3ZETA 2FLOA 2J4RA 2Q0RA 3D2FB 1KAZA 3OBYA 5C0YA 1U6ZA 5JLHA 2E20A 1T3VA 1NGBA 2QWQA 1HKBA 4C23A 5F0XA 2NRRA 3ZYYX 4FWLA 3H1VX 3CMAN 4B1UB 3HOTA 4YDUC 3C7NB 5AQWA 4KH5A 3LDNA 4H0XB 3U9ZA 4MO4A 3M6GA 2NRWA 3MWPA 3CETA 1NGHA 3P4IA 4EAHD 3C65A 4H0PA 3T7ZA 1K9MO 3CCRN 3H46O 3QDKA 2GELA 4JKAA 2HOEA 3CHWA 4IO9L 1YF5L 2QA4N 3EZWA 2YCHA 1GLAG 3JS6A 1ATSA 2F9WA 2P9NA 1NGAA 2E8AA 3MWTA 4GNIA 1VQ7N 5AQNA 4HTLA 3TTFA 1DT9A 3BEXA 3IMXA 3N4PA 4KH6A 3PIOL 3MX5A 1IJJA 4ISFA 5I9EB 1KD1O 3FZKA 1QVGM 1Z05A 3VF2A 4BR9A 1OKJA 3PIPL 1QVFM 3CI5A 4IFEA 5AFUH 1YITN 3ULEB 1YJNN 3A5MC 4AM7A 2Q0UA 4BGAA 3CCSN 2E2OA 4I6MA 5AZJA 3WT0A 2QWOA 2V7ZA 5F2RA 1V4SA 1TUUA 3KWGA 3CCVN 1S22A 1XC3A 4K42A 3MN6A 1MWKA 3N4QA 4BR5A 4LC9B 4A61A 2HBMA 1BA1A 1W97L 4Z94A 3IKMA 3KVGA 1BOTO 4YOWA 4YOUA 3WXMB 4BQZA 1K8KA 2HBLA 4IEEA 1YUWA 4NLBA 3CJ1A 3L4QA 4O5FA 5AQMA 2QWPA 4JKEA 2P9IA 2UYTA 1ZXOA 3PLAA 2Q1NA 4IOXA 3QFPA 4H5NA 4BRQA 3A5NC 3DJCA 4H0TB 4JAXA 4CBUA 5KPTA 3SBGA 4JKGB 4GV6A 3D2EB 5EXWA 5GAHP 4BRLA 2P9LB 4B9QA 4IWVA 4B1ZA 1JCEA 3LDLA 4JNEA 1ZBSA 1VQ6N 3QBXA 1HKCA 2ASOA 1RFQA 2AA4A 3G25A 5BRFA 4FOEA 4PL7A 2OTJN 4NB4A 4OPAA 4BC3A 3AAQA 5C2FA 1U2VA 3FR0A 4FO0A 4H0VB 3B8AX 3QB0A 3I55N 2VCPA 4CZJA 1BU6O 3CJCA 5AQIA 1VQNN 3VF4A 4A5AA 3ZX3A 1GLCG 3VPZA 1NGJA 5ELZA 5EOYA 4JK9A 4XH4A 1YXQA 5GIPA 1Q81O 3CJAA 5AQGA 1VQ9N 1X3MA 5MLCQ 2Q31A 4UY8O 3HTVA 5TKYA 2ZJQL 4IEIA 5BN9A 4BC4A 3E66A 4WQ5A 4MLEA 2YX6A 2P9NB 3CJBA 1VQ4N 3H6EA 4U7BA 3ZEUA 3E9PA 5M1FA 4WFNL 2HBJA 2D0PA 1YI2N 1GLDG 2IVNA 3RSEA 4CBWA 3H1QA 5AQQA 3AGRA 4IO8A 4FOIA 1ESVA 5AQOA 1C0GA 1V4TA 3UKRB 2Q2RA 3L4IA 4KH4A 4JKGA 3R9PA 3UE5A 4CZGA 3L6QA 3ENOA 5BRDA 2BTFA 2E2PA 5C15A 1M1KO 3EKUA 5AQJA 3M3ZA 3MK6A 4JEPA 3R8EA 4WQ4A 5AZJB 4BRCA 3BF1A 3QFUA 1Q82O 2YHXA 2W41A 3AARA 2QI2A 3OBWA 2QWRA 1JCGA 2QWNA 4JHDA 1ATRA 5EY4A 1GLFO 1HPMA 3O4WA 3ATVA 3O9UA 4FSVA 3UB5A 4C1NK 3G6EN 3AAPA 3FE1A 3FLCO 4CZEA 2QEXN 1TUYA 2DPNA 5AZIA 3VENA 1NGIA 1BWFO 1QQNA 2KKZA 3KWIA 3O1BA 4G9ZA 4BR0A 1K8KB 4M7XA 2P9KA 3O5BA 4YOXA 1YIJN 4BRAA 3CPEA 3SMSA 3VERA 3SBTA 3DLLL 5JICA 4BC2A 2P9IB 4JD2B 2ASMA 3WXIA 3CPWM 3SAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL1 A;  4BR2 A;  3QML A;  5BRE A;  1DEJ A;  2GEM A;  4BRK A;  5AQF A;  2EWS A;  3GBT A;  3VET A;  3HBT A;  5FPE A;  3QIC A;  4A62 A;  2VWB A;  3VEY A;  3UKR A;  3DAW A;  3H3N O;  3QBW A;  2BUP A;  3WEE A;  2P9P A;  1U2V B;  4B1W B;  4H5R A;  3VGL A;  3H45 C;  5BN8 A;  1NM1 A;  1TYQ A;  3IUC A;  3EN9 A;  3SK3 A;  3DXM A;  4XH1 A;  3VGM A;  1T6C A;  2D1K A;  2W40 A;  3O8M A;  2A42 A;  1J6Z A;  3MDQ A;  4ISG A;  4CZF A;  2QW9 A;  5KPR A;  5B8H A;  5AR0 A;  4J8F A;  2GTD A;  1HLU A;  4JN4 A;  2P9S B;  4BGB A;  3ZEU B;  4CZH A;  2CGK A;  5AQT A;  4JD2 A;  3RSE B;  3FZH A;  2E2Q A;  4DQ8 A;  3VEO A;  3KZB A;  4FL9 A;  3VEX A;  1DGK N;  2KHO A;  1HUX A;  2WUS A;  3S41 A;  3C0B A;  2I7N A;  3MN7 A;  3FGU A;  4MO5 A;  5BRH A;  4CJ7 A;  3I8B A;  1T44 A;  2A40 A;  2H3G X;  2V51 B;  3LL3 A;  3VOV A;  3MN5 A;  1BG3 A;  4WQ5 C;  4CBX A;  4BRE A;  4FPB A;  5AQH A;  3ZX0 A;  4JHD B;  2FF6 A;  4B1X B;  1MA9 B;  2A41 A;  2ZGY A;  3CQY A;  3HM8 A;  3ZX2 A;  1Z6R A;  5AZI B;  2ZGZ A;  4K43 A;  4F9O A;  1YAG A;  3CIP A;  2HMP A;  4PL8 A;  3DWL A;  1JCF A;  1NGG A;  1BDG A;  3BF3 A;  3IDH A;  5BPL A;  2P9K B;  4BRI A;  3KHY A;  4BVO A;  4MLH A;  3W3D A;  5FPM A;  4BRO A;  4IJN A;  5AQS A;  4WQ4 C;  1C0F A;  3IFR A;  2NZT A;  3WQT A;  2CGJ A;  2PAV A;  1D4X A;  3VES A;  3A0I X;  3MCP A;  2F9T A;  2P9S A;  5F1X A;  5EX5 A;  4EFH A;  5EVZ A;  2A6A A;  3DXK A;  3U9D A;  2FXU A;  3GE1 A;  2ASP A;  2YI1 A;  3J8A A;  1GLJ O;  1KXP A;  3WEE B;  2NLX A;  3WXL A;  3FFK B;  2P9P B;  1Y64 A;  2Q36 A;  1QZ6 A;  3HZ6 A;  4ISE A;  1NGE A;  1TYQ B;  4FWR A;  4AM6 A;  3EKS A;  3DXM B;  2YHY A;  2QM1 A;  2D4W A;  3LDO A;  3LM2 A;  5AFU A;  5BPM A;  5JLF A;  3ATU A;  1NGF A;  2CGL A;  4CZM A;  1HKG A;  3O80 A;  1ZC6 A;  4CZK A;  2FSN A;  3O1W A;  4CD3 A;  1LOT B;  2D0O A;  4A2B A;  3ID8 A;  2A3Z A;  5KPZ A;  4BG9 A;  4H5T A;  4PKG A;  1T6D A;  3WQU A;  4BC5 A;  3LM9 A;  1QQM A;  3VF6 A;  4BRF A;  4FWS A;  3A5L C;  1IG8 A;  1XQS C;  4BG8 A;  4M7Y A;  2FSK A;  4Y0W A;  2P9U A;  1NWK A;  2QWL A;  1NMD A;  3W0L A;  1BA0 A;  3I33 A;  1SZ2 A;  4RCH A;  1X3N A;  2E1Z A;  2CH5 A;  3FZF A;  3F9M A;  4XEI A;  1MWM A;  4CZI A;  5BR9 A;  4IXC A;  4QS9 A;  2IIR A;  1SAZ A;  4QS8 A;  5FPN A;  5JMV A;  4PKI A;  2E1Y A;  2V52 B;  3MMV A;  3VEZ A;  1MDU B;  5KQD A;  4GY2 B;  3OHR A;  3UKU B;  4FPA A;  3JXU A;  4PKH A;  1DKG D;  4YDU A;  4BRM A;  5E84 A;  5E26 A;  4CI6 A;  5AQK A;  4KBO A;  5AQL A;  4H5W A;  2FF3 B;  4CZL A;  1G99 A;  1R59 O;  3GG4 A;  3DXK B;  1QZ5 A;  3M1F A;  5AQP A;  5LY3 A;  4FWM A;  1P8Z A;  4FWP A;  4H03 B;  2AP1 A;  1GLL O;  1RGI A;  4O8K A;  4EHT A;  3CER A;  4FWO A;  3SLC A;  1KAY A;  4BR4 A;  3D2F A;  1E4F T;  5BPN A;  2QWM A;  2E2N A;  1QQO A;  1SQK A;  3WXK A;  4FWN A;  1QHA A;  5AQZ A;  4BRH A;  3EO3 A;  3VGK A;  2YHW A;  5ADX H;  3C7N A;  1NGD A;  1EQY A;  1WOQ A;  2A5X A;  2HF4 A;  5AQY A;  5AQX A;  1KAX A;  2CH6 A;  2NRH A;  5AQU A;  1WUA A;  2GWK A;  3SJH A;  3VEV A;  3SMP A;  1Q18 A;  3MN9 A;  3LDP A;  4H0Y B;  3TU5 A;  1X9J A;  4FWK A;  4DCH A;  3VEW A;  1XUP O;  4H0O A;  4BRN A;  5AQR A;  4M63 C;  4NO7 A;  4RTF D;  2V7Y A;  3GDQ A;  3UKU A;  2VYP A;  3A5O C;  1NLV A;  4IZ9 A;  3ZET B;  5LJV A;  5CE3 A;  1BUP A;  4L3Q A;  1HJO A;  3EL2 A;  3R6M A;  3ULE A;  2ZWH A;  2Q97 A;  2P9U B;  3CJ9 A;  3GOI A;  3LDQ A;  2YJF A;  2HF3 A;  4BRD A;  1NBW A;  2GWJ A;  4RWT A;  1NGC A;  3CJ7 A;  1S3X A;  3FZL A;  2FSJ A;  3U8X A;  5AQV A;  3HI0 A;  2ITM A;  3CQX A;  3U4L A;  1H1V A;  1LCU A;  2YJE A;  4EIA A;  1ATN A;  4BVP A;  1E4G T;  3ENH A;  4QS7 A;  4E1J A;  5KQ8 A;  4BRG A;  1RDW X;  3TPQ A;  2PBD A;  3A8Y A;  4DHY A;  3FZM A;  5FPD A;  2IVP A;  5ADX A;  4FWQ A;  3WUH A;  1CZA N;  4HWI A;  2E88 A;  4IJA A;  3HSC A;  1BO5 O;  1YVN A;  5LJW A;  3O6W A;  4K41 A;  3BP8 A;  4BR7 A;  4K25 A;  2IVO A;  4XH5 A;  3WXJ A;  4CD1 A;  4DB3 A;  3AY9 A;  3O08 A;  4B1V A;  3D2E A;  2OAN A;  2ZF5 O;  2P9L A;  1GLE G;  4H5V A;  4BRP A;  4I6M B;  4WYB A;  4B1Y B;  1HX1 A;  3H3O B;  2GUP A;  1GLB G;  2I7P A;  3BUZ B;  4EHU A;  3L0Q A;  4BQL A;  4A2A A;  3D7E O;  2QXL A;  3ZET A;  2FLO A;  2J4R A;  2Q0R A;  3D2F B;  1KAZ A;  1U6Z A;  5JLH A;  2E20 A;  1NGB A;  2QWQ A;  1HKB A;  4C23 A;  5F0X A;  4FWL A;  3H1V X;  4B1U B;  4YDU C;  3C7N B;  5AQW A;  3U9Z A;  3LDN A;  4H0X B;  4MO4 A;  3M6G A;  3CET A;  1NGH A;  3P4I A;  4EAH D;  4H0P A;  3H46 O;  3QDK A;  2GEL A;  2HOE A;  3CHW A;  3EZW A;  2YCH A;  1GLA G;  3JS6 A;  1ATS A;  2F9W A;  2P9N A;  1NGA A;  2E8A A;  4GNI A;  5AQN A;  4HTL A;  3BEX A;  3IMX A;  1IJJ A;  4ISF A;  5I9E B;  3FZK A;  1Z05 A;  3VF2 A;  4BR9 A;  1OKJ A;  3CI5 A;  5AFU H;  3ULE B;  3A5M C;  4AM7 A;  2Q0U A;  4BGA A;  2E2O A;  4I6M A;  5AZJ A;  3WT0 A;  2QWO A;  2V7Z A;  5F2R A;  1V4S A;  1TUU A;  1S22 A;  1XC3 A;  4K42 A;  3MN6 A;  1MWK A;  4BR5 A;  4LC9 B;  4A61 A;  1BA1 A;  4Z94 A;  3KVG A;  1BOT O;  4BQZ A;  1K8K A;  1YUW A;  3CJ1 A;  4O5F A;  5AQM A;  2QWP A;  2P9I A;  2UYT A;  1ZXO A;  2Q1N A;  3QFP A;  4H5N A;  4BRQ A;  3A5N C;  3DJC A;  4H0T B;  4JAX A;  4CBU A;  5KPT A;  3D2E B;  5EXW A;  4BRL A;  2P9L B;  4B9Q A;  4IWV A;  4B1Z A;  1JCE A;  3LDL A;  4JNE A;  1ZBS A;  3QBX A;  1HKC A;  2ASO A;  1RFQ A;  2AA4 A;  3G25 A;  5BRF A;  4FOE A;  4PL7 A;  4NB4 A;  4BC3 A;  3AAQ A;  1U2V A;  3FR0 A;  4FO0 A;  4H0V B;  3B8A X;  3QB0 A;  2VCP A;  4CZJ A;  1BU6 O;  3CJC A;  5AQI A;  3VF4 A;  3ZX3 A;  1GLC G;  3VPZ A;  1NGJ A;  5ELZ A;  5EOY A;  4XH4 A;  1YXQ A;  3CJA A;  5AQG A;  1X3M A;  2Q31 A;  3HTV A;  5TKY A;  5BN9 A;  4BC4 A;  4WQ5 A;  4MLE A;  2P9N B;  3CJB A;  3H6E A;  3ZEU A;  2D0P A;  1GLD G;  2IVN A;  3RSE A;  4CBW A;  3H1Q A;  5AQQ A;  4IO8 A;  4FOI A;  1ESV A;  5AQO A;  1C0G A;  1V4T A;  3UKR B;  2Q2R A;  3L4I A;  3R9P A;  3UE5 A;  4CZG A;  3L6Q A;  3ENO A;  5BRD A;  2BTF A;  2E2P A;  3EKU A;  5AQJ A;  3M3Z A;  3MK6 A;  3R8E A;  4WQ4 A;  5AZJ B;  4BRC A;  3BF1 A;  3QFU A;  2YHX A;  2W41 A;  3AAR A;  2QWR A;  1JCG A;  2QWN A;  4JHD A;  1ATR A;  5EY4 A;  1GLF O;  1HPM A;  3O4W A;  3ATV A;  4FSV A;  3UB5 A;  3AAP A;  3FE1 A;  3FLC O;  4CZE A;  1TUY A;  2DPN A;  5AZI A;  3VEN A;  1NGI A;  1BWF O;  1QQN A;  3O1B A;  4BR0 A;  1K8K B;  4M7X A;  2P9K A;  3O5B A;  4BRA A;  3SMS A;  3VER A;  5JIC A;  4BC2 A;  2P9I B;  4JD2 B;  2ASM A;  3WXI A; 
#chains in the Genus database with same CATH topology
 4AHT A;  2E6M A;  3LP1 A;  4CCH A;  4DV0 K;  2HHS A;  1TL1 A;  4KV8 A;  1KQS M;  1A5X A;  4PHT X;  3SPZ A;  4I2Q A;  3G71 N;  2G8K A;  3VET A;  4RW4 A;  4AF1 A;  1KRP A;  4Z0U A;  2DTU A;  2O8B B;  5C24 A;  3QIC A;  4DV6 K;  3HPH A;  4CGF A;  4NXN K;  3WEE A;  3H3N O;  4KHY A;  3VQQ A;  5KTQ A;  4HUG A;  1IBK K;  2YNH A;  5BN8 A;  4DTO A;  4R79 A;  1REV A;  3D6R A;  4FLY A;  3AVC A;  2W40 A;  3O8M A;  4ISG A;  2FBX A;  2R7Y A;  3HOS A;  3ISN C;  5HRR A;  1NK8 A;  3LAL A;  1VRT A;  4DTP A;  4WE1 A;  1HLU A;  4DLE A;  1WN7 A;  3RRG A;  4BGB A;  2CGK A;  4Q5V A;  4GVM A;  3SAH A;  3RSE B;  2IC3 A;  3DM2 A;  3K9K A;  4W5O A;  1JLC A;  5LMN K;  4FJX A;  4PWD A;  3OS0 A;  2WUS A;  4FZX C;  3MN7 A;  4MO5 A;  3KLE A;  5J1E A;  1RDC A;  3TAM A;  2H3G X;  2BDP A;  1BG3 A;  4CBX A;  4FPB A;  4C8L A;  3LAM A;  3LAK A;  2D0C A;  1D8Y A;  4BAC A;  2A41 A;  5GIN A;  2ZGY A;  4E7H A;  5FLX O;  2ZGZ A;  3AA4 A;  4K43 A;  2P5G A;  1J54 A;  2HMP A;  1XNR K;  2O8F B;  3DWL A;  2BE2 A;  5BPL A;  3PY8 A;  2W6K A;  4I2P A;  1TKD A;  2OPP A;  1WBB A;  1NU0 A;  1C0F A;  3M8Q A;  1D4X A;  3A0I X;  3MCP A;  5EX5 A;  4JI4 K;  2RHK A;  2A6A A;  3JYT A;  4U67 L;  3GE1 A;  1OVQ A;  3SCX A;  5FRM A;  4RW9 A;  1Q86 O;  3CC7 N;  4FYD A;  4DSK A;  4A57 A;  4FJL A;  4CGI A;  1WSI A;  3CCJ N;  3WXL A;  5KRT A;  1TK8 A;  3AVA A;  3ZT2 A;  4BDP A;  1RBS A;  1S72 N;  4FWR A;  3OS2 A;  4AM6 A;  2O8D A;  4CJT A;  3SUQ A;  4OLA A;  4AHU A;  3TSQ A;  1RBU A;  5JLF A;  1W2B M;  2QKB A;  1HKG A;  4ELT A;  3LPT A;  3O80 A;  1ZC6 A;  3T19 A;  4CD3 A;  3HT3 A;  4A2B A;  3ID8 A;  4JKF A;  4PKG A;  2RKI A;  5M1Q A;  3VQD A;  3LM9 A;  1EWQ A;  2Z1G A;  4DQI A;  4CJ5 A;  3SZ2 A;  2VGN A;  4FWS A;  1A5V A;  4WCE L;  3D45 A;  4DR4 K;  4JLH A;  4KHQ A;  4HTU A;  2O8E A;  1NWK A;  1NMD A;  1X9M A;  4CHZ A;  4XEI A;  3EY1 A;  4F3O A;  3V1R A;  1CLQ A;  1MWM A;  1BIU A;  3RVC A;  5BR9 A;  3O3F A;  4QS9 A;  2F8S A;  4WFA L;  3OVN A;  3ZSV A;  1NG9 A;  3EYZ A;  2E1Y A;  2V52 B;  4TSX A;  3VEZ A;  4X66 K;  4CED A;  5KQD A;  1N34 K;  2NRZ A;  1DKG D;  3O4Q A;  4BRM A;  1DTQ A;  1R0A A;  3NH2 A;  2KZM A;  3LDS A;  1VSL A;  4OKJ A;  1QZ5 A;  4YOR A;  4DR7 K;  5DM7 L;  3NCI A;  4OPJ A;  4H03 B;  4KI4 A;  2AP1 A;  4EHT A;  4O8K A;  1KAY A;  5BPN A;  4CK2 A;  4I9L A;  4FLU A;  1SQK A;  1L3U A;  4FWN A;  3P5J A;  5ADX H;  3C7N A;  1EQY A;  3TAF A;  1RTI A;  5AQX A;  2NRH A;  5C10 A;  3K5N A;  5J2P A;  4DSE A;  4AQY K;  4X64 K;  2UUB K;  3SMP A;  1U45 A;  1ILY A;  3LDP A;  3NF7 A;  2Y1I A;  2WBN A;  1XMO K;  4DCH A;  3VEW A;  1D5A A;  4HHT A;  3RTV A;  1IKY A;  4M63 C;  4RTF D;  3M8S A;  2O8C A;  3CCL N;  4CEF A;  1BUP A;  3VQ7 A;  1HJO A;  3MXJ A;  3CJ9 A;  1RT4 A;  1NBW A;  1HNW K;  1S9E A;  3C95 A;  4RWT A;  1NGC A;  4OX9 K;  4LSN A;  4KHP K;  3HI0 A;  2ITM A;  5CR4 A;  3CQX A;  3AA2 A;  4EIA A;  1LAV A;  1ATN A;  4YNQ A;  2HB5 A;  4BVP A;  1OH7 A;  3QO9 A;  5GAD P;  4IKF A;  1RDW X;  3TPQ A;  1VQ5 N;  1SS6 A;  3A8Y A;  4GV9 A;  5FPD A;  1JXB A;  2IVP A;  4FWQ A;  4DTM A;  1YTU A;  3SYZ A;  4NCG A;  1YVN A;  3O6W A;  5AJ3 K;  4CHQ A;  4K25 A;  2IVO A;  2VWJ A;  4CD1 A;  3AY9 A;  3NVK A;  1RCH A;  3HVR A;  2OAN A;  2UXC K;  2P9L A;  4H5V A;  4WYB A;  4JI3 K;  1HX1 A;  2KW4 A;  1IH7 A;  2I7P A;  3BUZ B;  4EHU A;  3L0Q A;  2QXL A;  3SI6 A;  2FLO A;  3THY A;  1J53 A;  3JAM O;  1U6Z A;  1RNH A;  4F4K A;  1XNQ K;  5JLH A;  3DRR A;  1NGB A;  3CM6 A;  2NRR A;  2B4J A;  3ZYY X;  1FKO A;  2PYL A;  4CIE A;  1C1C A;  1QSY A;  3QEX A;  4EAH D;  1LWF A;  3C65 A;  4H0P A;  2VWK A;  4M3X A;  4JKA A;  2HOE A;  3CHW A;  3ZSW A;  1YF5 L;  3EZW A;  1GLA G;  3PSF A;  2P9N A;  1IBL K;  1WSE A;  3TTF A;  3BEX A;  1IKV A;  3DLR A;  3THW A;  2LSN A;  3MX5 A;  5KI6 A;  3VF2 A;  4BR9 A;  5IWA K;  3PIP L;  4ELV A;  1EET A;  3CI5 A;  2IDO A;  4AM7 A;  4E7J A;  1NK6 A;  3QEV A;  5AZJ A;  2E4L A;  1NKE A;  4DTX A;  2DFF A;  1SKW A;  1TUU A;  4KAZ A;  3KWG A;  4FJM A;  1S22 A;  1XC3 A;  4LC9 B;  3NGY A;  2HBM A;  3TI0 A;  2HW3 A;  4BE0 A;  3OYE A;  3KVG A;  1BOT O;  3F73 A;  4BQZ A;  4IEE A;  3OYI A;  4NLB A;  1WNS A;  4E19 A;  5AQM A;  4GKJ K;  3L3U A;  3ZT1 A;  5HRS A;  3KD1 E;  4H5N A;  3AO4 A;  4CBU A;  3O3H A;  3SBG A;  3C94 A;  2XY5 A;  2XY8 A;  3AVL A;  4IG3 A;  3H08 A;  4B9Q A;  1JCE A;  1YT3 A;  3G25 A;  1HQU A;  2AA4 A;  4PL7 A;  2OTJ N;  4BC3 A;  4FJK A;  1S6Q A;  3FR0 A;  3SQ4 A;  4GKK K;  1CZB A;  3QB0 A;  3F9K A;  3QER A;  4HCB A;  1VQN N;  4A5A A;  3ZX3 A;  3VPZ A;  3VQ6 A;  4JK9 A;  4H8K A;  1YXQ A;  5AQG A;  3KIO A;  4NYF A;  5TKY A;  3OYC A;  2I5J A;  3EZ5 A;  4MLE A;  2ZM6 K;  2WOM A;  3BZC A;  3S9H A;  1Q9Y A;  1YI2 N;  4C8M A;  3RSE A;  3RMC A;  5AQQ A;  3AGR A;  4NYN A;  2VQF K;  4BE1 A;  2P1J A;  3AVM A;  1NOZ A;  2Q2R A;  4KH4 A;  3R9P A;  3ENO A;  5BRD A;  2BTF A;  3C6U A;  4K8X A;  3M3Z A;  3CFR A;  2ATQ A;  3NDK A;  4Z4E A;  1XC9 A;  3R8E A;  4FM0 A;  4WQ4 A;  1HNZ K;  4DR6 K;  1Q82 O;  2YHX A;  1NJX A;  1JCG A;  3SQ1 A;  1HPM A;  4DV4 K;  1UWB A;  2KFN A;  1UOC A;  4CZE A;  1RDA A;  2KKZ A;  3KWI A;  4G9Z A;  4Z4H A;  4CK3 A;  1RT3 A;  1K8K B;  2HND A;  1WBD A;  3CYM A;  5JIC A;  3DLL L;  3WNE A;  4BC2 A;  4JD2 B;  3LDO A;  2ASM A;  3DOL A;  3GL1 A;  3SAG A;  2BH1 A;  4G1Q A;  4CF8 A;  3QML A;  3C6A A;  1T03 A;  1ZBL A;  4C8N A;  3T1A A;  4OLB A;  4CJS A;  5DM6 L;  3LP0 A;  5GIO A;  5EU7 A;  5FPE A;  4A62 A;  3CCU N;  4B9M A;  2JLE A;  2W6L A;  3DAW A;  4B1W B;  1U2V B;  3M8P A;  3H45 C;  4HVJ A;  1TGO A;  4W5T A;  4F3T A;  3LWL A;  1TKZ A;  3KLI A;  4BY9 C;  1LW0 A;  1K6Y A;  3ZT0 A;  1T6C A;  3TAR A;  4CEQ A;  2D1K A;  3VQC A;  4MDB A;  4O5B A;  3ZLJ A;  4CZF A;  1I3A A;  2QW9 A;  5B8H A;  4DSI A;  2GTD A;  4O0J A;  1Q9X A;  2P9S B;  4JK8 A;  3EE9 A;  3PV8 A;  1HYV A;  3EEQ A;  3K9J A;  3E01 A;  3ZSR A;  5AQT A;  5FRO A;  3P38 A;  3L8B A;  3FZH A;  4JI1 K;  1SV5 A;  1JLF A;  4DQ8 A;  5M1K A;  1YHQ N;  4DWI A;  1DGK N;  4CEO A;  3AVG A;  1HUX A;  3C0B A;  1N8R O;  2F96 A;  3J7Z O;  1T44 A;  2A40 A;  3BZK A;  3VOV A;  3MN5 A;  4WQ5 C;  2ZD1 A;  3HXM A;  4BDY A;  3ZX0 A;  3TAG A;  1VQM N;  4DFM A;  2FF6 A;  1MA9 B;  4KTW A;  5HBM A;  4IDK A;  3KK3 A;  5AZI B;  1YAG A;  4OJR A;  3M5R A;  3EE8 A;  1NGG A;  3WNG A;  4A5B A;  1SUQ A;  4BRI A;  5HRO A;  1K8A O;  3V1O A;  3ZT3 A;  5A2Q O;  4BVO A;  1BQM A;  4F8R A;  4IJN A;  1KC8 O;  4RG8 A;  4ELU A;  3IFR A;  4CHY A;  2CGJ A;  2WC9 A;  1UA0 A;  2E6L A;  2F9T A;  5J2Q A;  4FJ8 A;  3E9L A;  3VQE A;  3KLH A;  2Z1I A;  5EVZ A;  4CEC A;  1LWE A;  2GX9 A;  1QE1 A;  4QAG A;  4YOT A;  2ASP A;  3J8A A;  3ZCM A;  1C1A A;  4YHH K;  3NF6 A;  2Z1J A;  2NNW A;  4DU4 A;  1QQC A;  2P9P B;  4DTJ A;  1TAU A;  3VA0 A;  3R1X A;  3SUN A;  3HZ6 A;  1TYQ B;  3EKS A;  4KTZ A;  4JK7 A;  3V9U A;  1EWR A;  2QM1 A;  2G8F A;  2QXF A;  4DF4 A;  3LM2 A;  3CCQ N;  5AFU A;  1NK7 A;  4OO1 J;  1NGF A;  2CGL A;  4FM2 A;  4B9V A;  2D0O A;  1CZ9 A;  2A3Z A;  4BG9 A;  4CIG A;  1T6D A;  3WQU A;  4MDA A;  1RT1 A;  5SWM A;  1BCO A;  2D5R A;  2G8H A;  3A5L C;  1IG8 A;  2ZJR L;  1BA0 A;  2KZZ A;  1OH5 A;  1X9W A;  3KKR A;  4JKB A;  4FJH A;  4JKC A;  1RT5 A;  5M1O A;  2DFH A;  3FZF A;  3F9M A;  3THV A;  1KFS A;  1RBT A;  3KLG A;  1Q7Y O;  3CD6 N;  2ZQB A;  4CEZ A;  2HST A;  3E1Y A;  5JMV A;  3NGI A;  4H4O A;  1MDU B;  4GY2 B;  3AO1 A;  3UKU B;  4FPA A;  3PX0 A;  4DG1 A;  2OZS A;  4DTU A;  4PKH A;  4YDU A;  3F2K A;  5AQK A;  4KBO A;  3V9W A;  1VQ8 N;  1S1U A;  3KTQ A;  1EP4 A;  3GG4 A;  4PA1 A;  4N5S A;  2OTL N;  3VQ9 A;  1IKW A;  4E89 A;  1P8Z A;  3NFA A;  1KSP A;  5JVG L;  3TWH A;  3CER A;  2X74 A;  3SLC A;  4BR4 A;  4X65 K;  5M1N A;  4CJP A;  1KCF A;  1RDB A;  3KKS A;  3CF5 L;  4DTN A;  5AQZ A;  2YHW A;  1EX4 A;  1NGD A;  1NOY A;  1TVR A;  5JS1 A;  1UA1 A;  1KAX A;  3AVB A;  3IS9 A;  1RIL A;  1WUA A;  3S3M A;  2GWK A;  3Q7B A;  5T7B A;  3SJH A;  4J2D A;  3NVM A;  1X9J A;  3TAE A;  3LZJ A;  3OYK A;  4H0O A;  3O9R A;  3K0S A;  4B3M K;  5AQR A;  4NO7 A;  5HLF A;  1RDD A;  4KRE A;  3A5O C;  2ZE2 A;  3ZET B;  5C12 A;  4L3Q A;  3EL2 A;  3LPU A;  4JV5 K;  4E1N A;  4N56 A;  2Q97 A;  3LDQ A;  3CG7 A;  2HF3 A;  2GWJ A;  4DSL A;  4CFB A;  4GVE A;  3FZL A;  2FSJ A;  4Y1D A;  3U8X A;  1H1V A;  5TKW A;  1HNX K;  1VSI A;  2PBD A;  3K5L A;  5JS2 A;  4DHY A;  1D9F A;  4JI6 K;  1QSL A;  3CCE N;  1O13 A;  3HP6 A;  3BY5 A;  3PX6 A;  3LZI A;  5I42 A;  4IJA A;  1IKX A;  1BI4 B;  2B6A A;  1VQK N;  1VQO N;  3QIP A;  4XH5 A;  3TAP A;  3WXJ A;  1X1P A;  2HHU A;  1P90 A;  1TK5 A;  3VQB A;  4J2A A;  3L2Q A;  2A1S A;  1GLE G;  3AO3 A;  1W9H A;  4B1Y B;  4CFC A;  3H3O B;  4WF9 L;  4BQL A;  5J2M A;  4B9S A;  4KKO A;  3D2F B;  2FC0 A;  3OBY A;  4IFY A;  2FBV A;  4C23 A;  4FWL A;  4JI5 K;  4B1U B;  4BWM A;  3LDN A;  4H0X B;  4FW2 A;  3M6G A;  2NRW A;  1TKT A;  3ZSQ A;  3P4I A;  1K9M O;  3CCR N;  3QDK A;  4FW1 A;  4IO9 L;  3PO5 A;  3JS6 A;  2F9W A;  3MWT A;  4GNI A;  3ITH A;  1DT9 A;  3L3V A;  2HHQ A;  4BDZ A;  4JRP A;  3IMX A;  4KH6 A;  1MU2 A;  1HRH A;  4CES A;  1KD1 O;  2HNY A;  1OKJ A;  3ULE B;  1N32 K;  3CCS N;  4I6M A;  4PQU A;  3WT0 A;  5F2R A;  4DV5 K;  3CCV N;  4A61 A;  4LFC K;  1C0M A;  2O4G A;  3C6T A;  1BA1 A;  4Z94 A;  4CJQ A;  3ALY A;  1K8K A;  2KTQ A;  3CJ1 A;  3L4Q A;  4FK2 A;  2QWP A;  4DFP A;  4IOX A;  3THX B;  1B9F A;  3L2W A;  3D0P A;  5KPT A;  4JKG B;  1WSF A;  2X6S A;  5EXW A;  3AO5 A;  2OA8 A;  1FKP A;  4E0D A;  2YNF A;  4B1Z A;  3LDL A;  4DS4 A;  1ZBS A;  1VQ6 N;  4OGC A;  4Q0B A;  4YFU A;  5BRF A;  4FOE A;  3KJV A;  3V9Z A;  2UU9 K;  4CJU A;  3AAQ A;  5C2F A;  1U2V A;  5IT9 O;  2VCP A;  3AVI A;  4CZJ A;  3CJC A;  3L2R A;  1NJY A;  3OS1 A;  1J5O A;  3J80 O;  1NGJ A;  3T1Y K;  4JYA K;  4DTR A;  4OGE A;  4XH4 A;  3B6O A;  1X3M A;  4AHC A;  2Y1J A;  4DS5 A;  1KVB A;  5KRS A;  2ZJQ L;  5BN9 A;  3VA3 A;  3HP9 A;  4KPY A;  2IGI A;  3H6E A;  5M1F A;  3OYN A;  2HBJ A;  5J2N A;  4CBW A;  1YTA A;  1NKB A;  1VSJ A;  3RMA A;  4UQG A;  1KFD A;  3ZSX A;  3EKU A;  3BF1 A;  4W5Q A;  2QI2 A;  4CJR A;  3OBW A;  4DR5 K;  1FW6 A;  3MXI A;  3NGZ A;  4CEA A;  3B6P A;  3G6E N;  3ATV A;  4FSV A;  1YJN N;  4DFJ A;  4M3Y A;  4CJF A;  4LY7 A;  2QEX N;  1TUY A;  3SV4 A;  5AZI A;  3VEN A;  1NGI A;  3M8R A;  4ID5 A;  3NHG A;  1RTD A;  3O5B A;  4YOX A;  3VER A;  4JI2 K;  3VN5 A;  3AVJ A;  3PX4 A;  3CPW M;  3S3O A;  3O4N A;  4BR2 A;  2NRX A;  2NUB A;  4DU3 A;  1DEJ A;  3O9S A;  1RT7 A;  3QIN A;  5AQF A;  2EWS A;  4BWJ A;  3G0Z A;  3HBT A;  1JL2 A;  1JLE A;  3QLH A;  5GAG P;  5HOO A;  3UKR A;  3QBW A;  4AH9 A;  3OYJ A;  1FXX A;  2BUP A;  2P9P A;  4H5R A;  5CYQ A;  1TYQ A;  3IUC A;  2KLA A;  3EN9 A;  4XH1 A;  3TTD A;  4OKE A;  3VGM A;  5CHI A;  4RW8 A;  2OCE A;  2A42 A;  1N33 K;  4W5R A;  1J6Z A;  3MDQ A;  3K5M A;  1VSM A;  4M3T A;  4DSJ A;  3OYF A;  5AR0 A;  4AHR A;  4ILJ A;  1YVU A;  4JN4 A;  3ZEU B;  4CZH A;  3ENB A;  1NNE A;  4B08 A;  4KFB A;  3TTC A;  4DUZ K;  2OZM A;  4O0I A;  1T05 A;  4CJL A;  1EO1 A;  2YHB A;  4BE2 A;  2E2Q A;  3VEO A;  3VTI A;  4FZZ A;  2KHO A;  4LF9 K;  1YJW N;  1RBV A;  3FGU A;  4ILG B;  1JLB A;  3I8B A;  4FLT A;  4IOA L;  3LL3 A;  2V51 B;  2UXD K;  2O8B A;  3VMF B;  5AQH A;  1NKC A;  3HPG A;  1IG9 A;  5CYM A;  4B1X B;  3HJF A;  4FK4 A;  3OA9 A;  1QS4 A;  1JJ2 M;  4FJG A;  3TR8 A;  3CQY A;  4CF2 A;  3ZX2 A;  3CIP A;  1RBR A;  4XIU A;  4B8A B;  1JCF A;  1BDG A;  4NXM K;  2P9K B;  2WFB A;  2HMI A;  3QEP A;  4FLW A;  3G4S N;  3KHY A;  4MLH A;  3OW2 M;  2A1R A;  3HL8 A;  5AQS A;  1WSJ A;  4CFD A;  2XO7 A;  4CGD A;  5FRN A;  1IO2 A;  3VES A;  2ITG A;  4EZ9 A;  4IG0 A;  5F1X A;  4CJ4 A;  1S1X A;  2FXU A;  3VQP A;  2YI1 A;  1KXP A;  1GOC A;  2NLX A;  3I56 N;  4E3S A;  2P5O A;  4FVM A;  1QZ6 A;  4AHV A;  3L2U A;  2HHV A;  3HRG A;  3DXM B;  3JSM A;  1M90 O;  1BIZ A;  3V6D A;  3ATU A;  4DV3 K;  3AVH A;  4CZM A;  1BIS A;  2QTD A;  3TAQ A;  2FSN A;  3O1W A;  1LOT B;  4CJ3 A;  1WAJ A;  4FZY A;  2O8F A;  2D0A A;  1T8E A;  4GMJ B;  1C0T A;  4BC5 A;  1OH8 A;  3TSP A;  4BRF A;  1TKX A;  3AA5 X;  3OYG A;  1XQS C;  1L5U A;  4BG8 A;  4M7Y A;  2FSK A;  1O1W A;  3CC2 N;  4JS5 A;  3CCM N;  2X6N A;  1QHT A;  2XY6 A;  4RCH A;  1X3N A;  1WLJ A;  1J9A A;  3V1Q A;  1I94 K;  3WNH A;  4IXC A;  3NBP A;  3DOK A;  3AVF A;  1LV5 A;  3MXM A;  3OHR A;  3HK2 A;  4YOV A;  4B9N A;  3JXU A;  5D3G A;  4PUO A;  5E84 A;  5E26 A;  4M41 A;  4Z4I A;  3MCA B;  2FF3 B;  2NRV A;  4CZL A;  1G99 A;  4FK0 A;  3MX2 A;  5AQP A;  3DXK B;  5LY3 A;  2YKM A;  4FWM A;  4FWP A;  1GLL O;  2B5J A;  1VQP N;  2G8U A;  5FDL A;  3D2F A;  2QWM A;  5HRP A;  2E2N A;  1QQO A;  2AJQ A;  4HUF A;  4BRH A;  1QHA A;  4M3R A;  3EO3 A;  3O9Q A;  2RF2 A;  4CFA A;  4DSF A;  5AQY A;  1YJ9 N;  5AQU A;  3NE6 A;  1Q18 A;  3MN9 A;  2G8V A;  1X9S A;  4H0Y B;  4DQS A;  4CHN A;  4ILH A;  1XUP O;  3NF8 A;  1Z25 A;  4CGH A;  1TAQ A;  3GDQ A;  4ZHR A;  1KLN A;  2VYP A;  1T7P A;  1NLV A;  4IZ9 A;  2FBY A;  3RRH A;  3V9S A;  3THY B;  3R6M A;  3ULE A;  2P9U B;  4CK1 A;  1C6V A;  4BRD A;  5HL7 L;  4QOZ B;  4LH4 A;  1VSH A;  1S3X A;  4DR3 K;  3QNO A;  2YJE A;  1LCU A;  1NJI O;  1VAZ A;  4KO0 A;  4E1J A;  3SQ0 A;  2KFZ A;  3SUO A;  1G15 A;  1VRU A;  3NAE A;  3WUH A;  1UAX A;  1CZA N;  4B3O A;  1EKE A;  5JVH L;  4I9Q A;  4LF5 K;  3HYF A;  5LJW A;  3THX A;  3ID6 A;  1BQN A;  4Z4C A;  3BP8 A;  3HST B;  3MEC A;  2D0B A;  2DFE A;  4DB3 A;  4J2B A;  3E9O A;  1JKH A;  1U48 A;  3O9T A;  1FJG K;  4B1V A;  3TAB A;  2ZF5 O;  3MED A;  3MEG A;  5KGX A;  4GV3 A;  1GLB G;  2JWK A;  3P83 D;  4CGJ A;  3C6H A;  4JKH A;  3CM5 A;  2Q0R A;  2IS3 A;  1HJR A;  1KAZ A;  4O55 A;  4LF4 K;  4KHU A;  5C0Y A;  2XRI A;  2QK9 A;  1Y97 A;  2E20 A;  1T3V A;  1OH6 A;  2QWQ A;  1HKB A;  3QET A;  3DMJ A;  5F0X A;  1LAW A;  3CMA N;  3H1V X;  3U9Z A;  5AQW A;  1HQE A;  4MO4 A;  4F2R A;  1LW2 A;  3MWP A;  1NGH A;  1I39 A;  2IOC A;  4MFB A;  3T7Z A;  3I8D A;  4NCA A;  2GEL A;  1ZBU A;  2YCH A;  2UUA K;  1ATS A;  4E7K A;  1NGA A;  5HRN A;  4DFK A;  3U6F A;  4HTL A;  1EXQ A;  3K59 A;  3BGR A;  3N4P A;  3PUF A;  2YKN A;  3PIO L;  3V81 A;  1NK4 A;  5C25 A;  2PZS A;  3K58 A;  1NJW A;  5AFU H;  1YIT N;  5BR8 K;  2Q0U A;  3RR7 A;  4X62 K;  2E2O A;  4CER A;  3AO2 A;  3CQ8 A;  2Q3S A;  2V7Z A;  4JRQ A;  1V4S A;  3DRS A;  4DV2 K;  4K42 A;  2YV0 X;  1MWK A;  3MN6 A;  4H4M A;  1SKR A;  1VSD A;  4CHP A;  4FLZ A;  4B3T K;  3NF9 A;  4R5P A;  4YOW A;  3WXM B;  5I3U A;  3DLK A;  2HBL A;  1YUW A;  1JL1 A;  1ZBH A;  1ZXO A;  4M45 A;  2Q1N A;  4DQR A;  2E5L K;  3PLA A;  4LD0 A;  3A5N C;  4H0T B;  5DK5 A;  2F4V K;  1S6P A;  1IBM K;  1BCM A;  3D2E B;  4BRL A;  4M3U A;  4JNE A;  2WON A;  3T1H K;  1KVC A;  1HKC A;  2ASO A;  3VQ4 A;  2FBT A;  3HVT A;  1BL3 A;  3UIQ A;  1N36 K;  1QSS A;  4FO0 A;  2VQE K;  3B8A X;  3I55 N;  5C42 A;  3VQ8 A;  4V19 S;  4ZTJ A;  2PYJ A;  3VF4 A;  2VG6 A;  3CFP A;  1GLC G;  3DLG A;  5ELZ A;  3DLE A;  1Q81 O;  1VQ9 N;  1HPZ A;  4N41 A;  3G10 A;  1S1T A;  3HM9 A;  4EZ6 A;  3QIO A;  4QCL A;  4B9U A;  4WQ5 A;  1JXE A;  4FXD A;  2YX6 A;  3CJB A;  4KB1 A;  1VQ4 N;  4OVL A;  3CFO A;  4U7B A;  3ZEU A;  3E9P A;  3J7Y P;  1N6Q A;  4IO8 A;  3AA3 A;  1JLQ A;  1ESV A;  4FOI A;  4C8O A;  4DU1 A;  1NK5 A;  1V4T A;  3L4I A;  3UE5 A;  2IAJ A;  5KGW A;  3L6Q A;  1XHX A;  4HUE A;  2E2P A;  5C15 A;  4ID1 A;  3OYL A;  1W0H A;  1ASW A;  3MK6 A;  3OYM A;  1L3T A;  1D9D A;  3J7A P;  4BRC A;  4DUY K;  3QFU A;  1BHL A;  2W41 A;  5CY4 A;  3ASM A;  4EP4 A;  2QWN A;  5EY4 A;  3UB5 A;  3O4W A;  1U4B A;  3AAP A;  1ZYQ A;  2DPN A;  1VSK A;  1BWF O;  4B3S K;  3O1B A;  4BR0 A;  4M7X A;  2P9K A;  3T3F A;  4BRA A;  3SMS A;  2XHB A;  2HNZ A;  3SBT A;  2P9I B;  3WXI A;  4I7F A;  5ADX A;  4KHS A;  1NK0 A;  4WFB L;  4Y1C A;  2GBZ A;  4NCB A;  4JKD A;  1U49 A;  5BRE A;  2GEM A;  4OPH A;  4BRK A;  5E41 A;  3CC4 N;  4Z4G A;  3GBT A;  5CZ2 A;  3AV9 A;  2VWB A;  3VEY A;  3WNF A;  2RE2 A;  4B9L A;  1SL2 A;  3VGL A;  3P31 A;  2X78 A;  4CJK A;  1NM1 A;  1U47 A;  4DV7 K;  3SK3 A;  3DXM A;  4N76 A;  4CE9 A;  3KK7 A;  4CF1 A;  4HCC A;  3K57 A;  4J2E A;  2UUC K;  3OYA A;  1IV0 A;  4RW7 A;  1BGX T;  4LF8 K;  5KPR A;  3SPY A;  4CVN E;  2PFU A;  4J8F A;  5C2D A;  3SJJ A;  4E7L A;  4JD2 A;  5M1P A;  4O4G A;  2JWL A;  3KZB A;  4FL9 A;  3VEX A;  3S41 A;  2I7N A;  3NH0 A;  5BRH A;  4CJ7 A;  4DQQ A;  3IRX A;  2JGU A;  4O44 A;  3RMD A;  1RDU A;  4BRE A;  4JHD B;  1B92 A;  1S5J A;  2VGM A;  3HM8 A;  4F9O A;  1Z6R A;  3TSU A;  2YHA A;  4PL8 A;  3VTH A;  5H1S Q;  3BF3 A;  3IDH A;  1JLG A;  3FFI A;  3R3L A;  3I0S A;  3W3D A;  3SNN A;  5FPM A;  4BRO A;  4WQ4 C;  3IG1 A;  4CF0 A;  2HVH A;  3RMB A;  1HYS A;  2HHH K;  2NZT A;  3WQT A;  2PAV A;  2P9S A;  4C1N I;  4LH5 A;  4EFH A;  1HR0 K;  3DXK A;  1WSG A;  3U9D A;  1WAF A;  1ZBI A;  4CJV A;  2W42 A;  1GLJ O;  1SKS A;  3U3Y A;  3WEE B;  3FFK B;  4O8U A;  3KLF A;  5K14 A;  1FK9 A;  1Y64 A;  2Q36 A;  4ISE A;  1NGE A;  2YHY A;  2D4W A;  4CW7 B;  1NMN A;  2O4I A;  5BPM A;  1Q8I A;  3K5O A;  1VQL N;  4CZK A;  4KI6 A;  1HMV A;  5KPZ A;  4H5T A;  2OYQ A;  3LWM A;  1NK9 A;  1ZBF A;  4CEE A;  1QQM A;  3VF6 A;  1RT6 A;  4DR2 K;  1HYZ A;  4Y0W A;  2P9U A;  2QWL A;  3W0L A;  1VK0 A;  3NMU A;  4LSL A;  3I33 A;  1F21 A;  1SZ2 A;  2G8W A;  5GAE P;  2E1Z A;  1RT2 A;  2CH5 A;  3KK2 A;  3SUP A;  1N5Y A;  1ASU A;  3TAN A;  4CZI A;  4KB0 A;  3P1G A;  1C0U A;  4JS4 A;  2IIR A;  4DKW A;  4CJE A;  3KD5 E;  1SAZ A;  2BAN A;  2P51 A;  4QS8 A;  5FPN A;  4PKI A;  4JI0 K;  4ICL A;  3MMV A;  4ZTF A;  4FVU A;  1VSE A;  4M3Z A;  1C1B A;  1S1W A;  4CI6 A;  5AQL A;  3P39 A;  4LF7 K;  2HHT A;  4H5W A;  2HBK A;  3AVK A;  1R59 O;  3M1F A;  3RR8 A;  3V9X A;  5DMR A;  1SL0 A;  3SV3 A;  3DLH A;  1RGI A;  4CEB A;  4CF9 A;  4FWO A;  1W7A A;  2NRT A;  1E4F T;  4AIL C;  2YNG A;  3CXC M;  4FLX A;  4LFB K;  1HNV A;  4YOY A;  3SQ2 A;  3J81 O;  3WXK A;  2O8D B;  3VGK A;  3U3G A;  4FCY A;  3OYB A;  1WOQ A;  2A5X A;  3ZSZ A;  2HF4 A;  1NJZ A;  1RTJ A;  3ZSO A;  2CH6 A;  1GOB A;  3VEV A;  3RWU A;  3TU5 A;  3DRP A;  4OKK A;  4FWK A;  2F7T A;  3DYA A;  4KTQ A;  1U04 A;  3ZT4 A;  4BRN A;  3HPO A;  1WB9 A;  4FJ7 A;  2V7Y A;  3UKU A;  3F5T A;  5LJV A;  5CE3 A;  1XWL A;  1JLA A;  2O8E B;  5CZ1 A;  1VHX A;  2ZWH A;  3GOI A;  1K73 O;  4NLC A;  2OPR A;  4JI8 K;  2YJF A;  4IDH A;  2OPQ A;  3OY9 A;  4FJI A;  3CJ7 A;  3Q7C A;  4CIF A;  5AQV A;  3U4L A;  1E4G T;  3AGK A;  3ENH A;  4QS7 A;  3SAF A;  5KQ8 A;  4BRG A;  1S1V A;  4M3W A;  4A59 A;  2ZJP L;  3FZM A;  4IOC L;  3A2F A;  1OVY A;  3MEE A;  2RPI A;  3NH1 A;  4HWI A;  2E88 A;  3HSC A;  1BO5 O;  4RW6 A;  4W5N A;  4K41 A;  4BR7 A;  3T69 A;  3PO4 A;  3HO1 A;  2HVI A;  1TV6 A;  3CME N;  1KVA A;  3MAQ A;  3O08 A;  3ULD A;  3D2E A;  4FJ5 A;  4BRP A;  4I6M B;  2KQ2 A;  2GUP A;  4A2A A;  3D7E O;  3ZET A;  2J4R A;  1TL3 A;  1L3V A;  1S9G A;  3K2P A;  5LMU K;  2GUI A;  3DLB A;  2QKK A;  4L8R B;  4DQP A;  1HNI A;  3HOT A;  4YDU C;  3C7N B;  4KH5 A;  1XMQ K;  4DR1 K;  3CET A;  5SZT A;  3H46 O;  4DF8 A;  2QA4 N;  2E8A A;  1VQ7 N;  5AQN A;  1GOA A;  4FM1 A;  2HHX A;  2RN2 A;  4C8K A;  2O8C B;  1BI4 A;  1IJJ A;  4ISF A;  5I9E B;  3FZK A;  1QVG M;  1Z05 A;  1QTM A;  1QVF M;  4IFE A;  2BGG A;  3PSI A;  3A5M C;  4BGA A;  3OYH A;  4FLV A;  4LF6 K;  3IAY A;  2VG7 A;  2QWO A;  4AHS A;  4FJJ A;  3KK1 A;  2PY5 A;  3N4Q A;  1DLO A;  1KTQ A;  4N47 A;  4BR5 A;  1DTT A;  1TK0 A;  1Z26 A;  4OPK A;  1L3S A;  4JI7 K;  2F8T A;  4B9T A;  2HHW A;  4IBN A;  3LP3 A;  4FJN A;  1W97 L;  3BDP A;  2DY4 A;  3IKM A;  1RTH A;  2YNI A;  4YOU A;  2EX3 A;  4EP5 A;  1XI1 A;  4O5F A;  4KRF A;  3I0R A;  3AVN A;  4JKE A;  4K8Z A;  4IFV A;  2P9I A;  3QEI A;  2UYT A;  4DMN A;  1ASV A;  2ETJ A;  3QFP A;  4BRQ A;  2WTU A;  2G8I A;  3ZSY A;  4JAX A;  3DJC A;  1B9D A;  4F2S A;  5LL6 Z;  4M42 A;  4GV6 A;  5GAH P;  3OJS A;  2P9L B;  4IWV A;  3QBX A;  2GV9 A;  1RFQ A;  3L2V A;  1XHZ A;  3OJU A;  4NB4 A;  4OPA A;  3VQ5 A;  4FJ9 A;  1WSH A;  4H0V B;  4DV1 K;  4KHN A;  1CXU A;  4CGG A;  1BU6 O;  5AQI A;  2UXB K;  3LP2 A;  5EOY A;  2OPS A;  5GIP A;  3OYD A;  3S3N A;  3CJA A;  4KHW A;  4DTS A;  5MLC Q;  2Q31 A;  4UY8 O;  3HTV A;  4MQ3 A;  1LWC A;  4GW6 A;  4IEI A;  4Z4F A;  4BC4 A;  3E66 A;  3O3G A;  2P9N B;  1CXQ A;  4WFN L;  1ITG A;  3THW B;  2D0P A;  1J5E K;  3DI6 A;  1GLD G;  2IVN A;  1A5W A;  3H1Q A;  4E1M A;  1SL1 A;  3OTO K;  3VQA A;  5AQO A;  1C0G A;  3UKR B;  4JKG A;  4CZG A;  4B8C A;  5HP1 A;  4LFA K;  4YY3 K;  1M1K O;  4CJW A;  5AQJ A;  4PY5 A;  4JEP A;  2XY7 A;  3QNN A;  5AZJ B;  1KLM A;  3AAR A;  2QWR A;  4JHD A;  3LAN A;  1ATR A;  2EHG A;  1GLF O;  4C1N K;  3O9U A;  3FE1 A;  3FLC O;  4CHO A;  1QQN A;  4B3R K;  1E3M A;  2VG5 A;  3V4I A;  3QEW A;  1YIJ N;  3CPE A;  4E7I A;  3QES A;  4K0K K;  2Z1H A;  4DLG A;  1VSF A; 
#chains in the Genus database with same CATH homology
 3GL1 A;  2BH1 A;  4WFB L;  4BR2 A;  2NRX A;  4JKD A;  3QML A;  1KQS M;  3C6A A;  5BRE A;  1DEJ A;  2GEM A;  3O9S A;  4OPH A;  4PHT X;  4BRK A;  5DM6 L;  3G71 N;  3CC4 N;  5AQF A;  2EWS A;  3GBT A;  3VET A;  4AF1 A;  5GIO A;  3HBT A;  5FPE A;  3QIC A;  4A62 A;  2VWB A;  3CCU N;  3VEY A;  5GAG P;  5HOO A;  3UKR A;  3DAW A;  3H3N O;  2RE2 A;  2BUP A;  3QBW A;  3WEE A;  2P9P A;  1U2V B;  4B1W B;  4H5R A;  3VGL A;  3P31 A;  3H45 C;  5BN8 A;  1NM1 A;  1TYQ A;  3IUC A;  2KLA A;  3EN9 A;  3SK3 A;  4R79 A;  3DXM A;  4XH1 A;  4BY9 C;  3D6R A;  3TTD A;  3KK7 A;  3VGM A;  5CHI A;  1T6C A;  2D1K A;  2W40 A;  3O8M A;  2A42 A;  4MDB A;  1J6Z A;  3MDQ A;  4ISG A;  4CZF A;  2QW9 A;  3HOS A;  5KPR A;  5B8H A;  2PFU A;  4J8F A;  5AR0 A;  2GTD A;  1HLU A;  5C2D A;  4ILJ A;  4JN4 A;  2P9S B;  4JK8 A;  4BGB A;  3ZEU B;  3EE9 A;  4CZH A;  2CGK A;  3ENB A;  3K9J A;  3SAH A;  5AQT A;  3TTC A;  3P38 A;  4JD2 A;  3RSE B;  3K9K A;  3FZH A;  1EO1 A;  2E2Q A;  5M1P A;  4DQ8 A;  3VEO A;  2JWL A;  3VTI A;  3KZB A;  4FL9 A;  3VEX A;  5M1K A;  1DGK N;  1YHQ N;  2KHO A;  1HUX A;  2WUS A;  3S41 A;  1YJW N;  3C0B A;  2I7N A;  3MN7 A;  3FGU A;  4MO5 A;  4ILG B;  5BRH A;  4CJ7 A;  1N8R O;  3I8B A;  3J7Z O;  1T44 A;  2A40 A;  4IOA L;  2H3G X;  2V51 B;  3LL3 A;  3VOV A;  3MN5 A;  1BG3 A;  4WQ5 C;  1RDU A;  4BRE A;  4CBX A;  3VMF B;  4FPB A;  5AQH A;  3ZX0 A;  1VQM N;  4JHD B;  2FF6 A;  4B1X B;  1MA9 B;  3OA9 A;  2A41 A;  5GIN A;  1JJ2 M;  2VGM A;  2ZGY A;  3CQY A;  3HM8 A;  3ZX2 A;  1Z6R A;  5AZI B;  2ZGZ A;  4K43 A;  3TSU A;  4F9O A;  1YAG A;  3CIP A;  2HMP A;  4PL8 A;  3M5R A;  3VTH A;  5H1S Q;  3DWL A;  1JCF A;  1NGG A;  1BDG A;  3BF3 A;  3EE8 A;  3IDH A;  4A5B A;  2P9K B;  2WFB A;  4BRI A;  5BPL A;  1K8A O;  3R3L A;  3G4S N;  3KHY A;  4BVO A;  4MLH A;  3W3D A;  5FPM A;  4BRO A;  3OW2 M;  4IJN A;  5AQS A;  4WQ4 C;  1KC8 O;  1C0F A;  3IFR A;  2NZT A;  3WQT A;  2CGJ A;  2WC9 A;  2PAV A;  1D4X A;  3VES A;  3A0I X;  3MCP A;  2F9T A;  2P9S A;  4C1N I;  3E9L A;  5F1X A;  5EX5 A;  4EFH A;  2RHK A;  5EVZ A;  2A6A A;  3DXK A;  2GX9 A;  3U9D A;  2FXU A;  4YOT A;  4U67 L;  3GE1 A;  2ASP A;  2YI1 A;  1Q86 O;  3CC7 N;  3J8A A;  1GLJ O;  4A57 A;  1KXP A;  2NNW A;  3WEE B;  2NLX A;  3WXL A;  3CCJ N;  3FFK B;  4O8U A;  2P9P B;  3I56 N;  1Y64 A;  2Q36 A;  1QZ6 A;  3R1X A;  3HZ6 A;  4ISE A;  1NGE A;  1TYQ B;  4FWR A;  1S72 N;  4AM6 A;  3EKS A;  3HRG A;  3DXM B;  4JK7 A;  2YHY A;  2QM1 A;  1M90 O;  2D4W A;  3LDO A;  3LM2 A;  3CCQ N;  5AFU A;  3TSQ A;  5BPM A;  5JLF A;  3ATU A;  1W2B M;  4OO1 J;  1NGF A;  2CGL A;  4CZM A;  1HKG A;  1VQL N;  2QTD A;  3O80 A;  1ZC6 A;  4CZK A;  2FSN A;  3O1W A;  4CD3 A;  1LOT B;  2D0O A;  4A2B A;  3ID8 A;  2A3Z A;  4JKF A;  5KPZ A;  4BG9 A;  4H5T A;  4PKG A;  1T6D A;  5M1Q A;  3WQU A;  4BC5 A;  4MDA A;  3LM9 A;  3TSP A;  1QQM A;  3VF6 A;  4BRF A;  2VGN A;  4FWS A;  3A5L C;  1IG8 A;  2ZJR L;  1XQS C;  4WCE L;  4BG8 A;  4M7Y A;  2FSK A;  4Y0W A;  2P9U A;  1NWK A;  2QWL A;  1NMD A;  3W0L A;  3CC2 N;  3CCM N;  3NMU A;  1BA0 A;  3I33 A;  4JKB A;  1SZ2 A;  4RCH A;  1X3N A;  5GAE P;  2E1Z A;  4JKC A;  5M1O A;  2CH5 A;  3FZF A;  3F9M A;  4XEI A;  1MWM A;  4CZI A;  3RVC A;  5BR9 A;  4IXC A;  4QS9 A;  2IIR A;  4WFA L;  4DKW A;  1Q7Y O;  3CD6 N;  1SAZ A;  4QS8 A;  5FPN A;  2HST A;  3E1Y A;  5JMV A;  4PKI A;  2E1Y A;  2V52 B;  3MMV A;  3VEZ A;  1MDU B;  5KQD A;  4GY2 B;  2NRZ A;  3OHR A;  3UKU B;  4FVU A;  4FPA A;  4YOV A;  3JXU A;  4PKH A;  1DKG D;  4YDU A;  4BRM A;  5E84 A;  5E26 A;  3F2K A;  4CI6 A;  3MCA B;  5AQK A;  3P39 A;  4KBO A;  5AQL A;  4H5W A;  2FF3 B;  2HBK A;  2NRV A;  4CZL A;  1VQ8 N;  1G99 A;  1R59 O;  3GG4 A;  3DXK B;  1QZ5 A;  3M1F A;  3MX2 A;  4YOR A;  5AQP A;  5LY3 A;  2OTL N;  4FWM A;  5DM7 L;  1P8Z A;  4FWP A;  4H03 B;  5JVG L;  2AP1 A;  1GLL O;  1RGI A;  4O8K A;  4EHT A;  3CER A;  4FWO A;  3SLC A;  1KAY A;  4BR4 A;  1VQP N;  5M1N A;  2NRT A;  3D2F A;  1E4F T;  5BPN A;  2QWM A;  3CXC M;  2E2N A;  1QQO A;  4YOY A;  3CF5 L;  1SQK A;  3WXK A;  4FWN A;  1QHA A;  5AQZ A;  4BRH A;  3EO3 A;  3VGK A;  2YHW A;  3O9Q A;  5ADX H;  3C7N A;  1NGD A;  1EQY A;  1WOQ A;  2A5X A;  2HF4 A;  5AQY A;  1YJ9 N;  5AQX A;  5C10 A;  1KAX A;  2CH6 A;  2NRH A;  5AQU A;  1WUA A;  2GWK A;  3Q7B A;  3SJH A;  3VEV A;  3SMP A;  1Q18 A;  3MN9 A;  1ILY A;  3LDP A;  3NVM A;  4H0Y B;  1X9J A;  3TU5 A;  2WBN A;  4FWK A;  2F7T A;  3VEW A;  4ILH A;  4DCH A;  1XUP O;  4H0O A;  3O9R A;  4BRN A;  5AQR A;  4M63 C;  4NO7 A;  4RTF D;  2V7Y A;  3GDQ A;  3UKU A;  3F5T A;  3CCL N;  2VYP A;  3A5O C;  1NLV A;  4IZ9 A;  3ZET B;  5LJV A;  5C12 A;  5CE3 A;  1BUP A;  4L3Q A;  1HJO A;  3EL2 A;  3R6M A;  3ULE A;  2ZWH A;  2Q97 A;  2P9U B;  3CJ9 A;  3GOI A;  4NLC A;  3LDQ A;  1K73 O;  2YJF A;  2HF3 A;  4IDH A;  4BRD A;  1NBW A;  2GWJ A;  5HL7 L;  4GVE A;  4RWT A;  1NGC A;  3CJ7 A;  1S3X A;  3FZL A;  3Q7C A;  2FSJ A;  3U8X A;  5AQV A;  3HI0 A;  2ITM A;  5CR4 A;  3CQX A;  3U4L A;  1H1V A;  1LCU A;  2YJE A;  5TKW A;  1ATN A;  4EIA A;  1NJI O;  4BVP A;  1E4G T;  3AGK A;  3ENH A;  4QS7 A;  3SAF A;  1VAZ A;  4E1J A;  5KQ8 A;  5GAD P;  4BRG A;  1RDW X;  3TPQ A;  1VQ5 N;  2PBD A;  1SS6 A;  3A8Y A;  4A59 A;  4DHY A;  4GV9 A;  2ZJP L;  3FZM A;  5FPD A;  2IVP A;  5ADX A;  4FWQ A;  3WUH A;  3CCE N;  1O13 A;  4IOC L;  1CZA N;  1OVY A;  5JVH L;  4HWI A;  2E88 A;  4IJA A;  3HSC A;  1BO5 O;  1YVN A;  5LJW A;  1VQO N;  1VQK N;  3ID6 A;  3O6W A;  4K41 A;  3BP8 A;  4BR7 A;  4K25 A;  3T69 A;  2IVO A;  4XH5 A;  3WXJ A;  4CD1 A;  4DB3 A;  1P90 A;  3AY9 A;  3E9O A;  3CME N;  3NVK A;  3O9T A;  3O08 A;  4B1V A;  3D2E A;  2OAN A;  2ZF5 O;  2P9L A;  1GLE G;  4H5V A;  4BRP A;  4I6M B;  4WYB A;  4B1Y B;  1HX1 A;  4GV3 A;  3H3O B;  2GUP A;  1GLB G;  2I7P A;  2JWK A;  3BUZ B;  4WF9 L;  4EHU A;  3L0Q A;  4BQL A;  3C6H A;  3D7E O;  4A2A A;  4JKH A;  2QXL A;  3ZET A;  2FLO A;  2J4R A;  2Q0R A;  3D2F B;  1KAZ A;  3OBY A;  5C0Y A;  1U6Z A;  5JLH A;  2E20 A;  1T3V A;  1NGB A;  2QWQ A;  1HKB A;  4C23 A;  5F0X A;  2NRR A;  3ZYY X;  4FWL A;  3H1V X;  3CMA N;  4B1U B;  3HOT A;  4YDU C;  3C7N B;  5AQW A;  4KH5 A;  3LDN A;  4H0X B;  3U9Z A;  4MO4 A;  3M6G A;  2NRW A;  3MWP A;  3CET A;  1NGH A;  3P4I A;  4EAH D;  3C65 A;  4H0P A;  3T7Z A;  1K9M O;  3CCR N;  3H46 O;  3QDK A;  2GEL A;  4JKA A;  2HOE A;  3CHW A;  4IO9 L;  1YF5 L;  2QA4 N;  3EZW A;  2YCH A;  1GLA G;  3JS6 A;  1ATS A;  2F9W A;  2P9N A;  1NGA A;  2E8A A;  3MWT A;  4GNI A;  1VQ7 N;  5AQN A;  4HTL A;  3TTF A;  1DT9 A;  3BEX A;  3IMX A;  3N4P A;  4KH6 A;  3PIO L;  3MX5 A;  1IJJ A;  4ISF A;  5I9E B;  1KD1 O;  3FZK A;  1QVG M;  1Z05 A;  3VF2 A;  4BR9 A;  1OKJ A;  3PIP L;  1QVF M;  3CI5 A;  4IFE A;  5AFU H;  1YIT N;  3ULE B;  1YJN N;  3A5M C;  4AM7 A;  2Q0U A;  4BGA A;  3CCS N;  2E2O A;  4I6M A;  5AZJ A;  3WT0 A;  2QWO A;  2V7Z A;  5F2R A;  1V4S A;  1TUU A;  3KWG A;  3CCV N;  1S22 A;  1XC3 A;  4K42 A;  3MN6 A;  1MWK A;  3N4Q A;  4BR5 A;  4LC9 B;  4A61 A;  2HBM A;  1BA1 A;  1W97 L;  4Z94 A;  3IKM A;  3KVG A;  1BOT O;  4YOW A;  4YOU A;  3WXM B;  4BQZ A;  1K8K A;  2HBL A;  4IEE A;  1YUW A;  4NLB A;  3CJ1 A;  3L4Q A;  4O5F A;  5AQM A;  2QWP A;  4JKE A;  2P9I A;  2UYT A;  1ZXO A;  3PLA A;  2Q1N A;  4IOX A;  3QFP A;  4H5N A;  4BRQ A;  3A5N C;  3DJC A;  4H0T B;  4JAX A;  4CBU A;  5KPT A;  3SBG A;  4JKG B;  4GV6 A;  3D2E B;  5EXW A;  5GAH P;  4BRL A;  2P9L B;  4B9Q A;  4IWV A;  4B1Z A;  1JCE A;  3LDL A;  4JNE A;  1ZBS A;  1VQ6 N;  3QBX A;  1HKC A;  2ASO A;  1RFQ A;  2AA4 A;  3G25 A;  5BRF A;  4FOE A;  4PL7 A;  2OTJ N;  4NB4 A;  4OPA A;  4BC3 A;  3AAQ A;  5C2F A;  1U2V A;  3FR0 A;  4FO0 A;  4H0V B;  3B8A X;  3QB0 A;  3I55 N;  2VCP A;  4CZJ A;  1BU6 O;  3CJC A;  5AQI A;  1VQN N;  3VF4 A;  4A5A A;  3ZX3 A;  1GLC G;  3VPZ A;  1NGJ A;  5ELZ A;  5EOY A;  4JK9 A;  4XH4 A;  1YXQ A;  5GIP A;  1Q81 O;  3CJA A;  5AQG A;  1VQ9 N;  1X3M A;  5MLC Q;  2Q31 A;  4UY8 O;  3HTV A;  5TKY A;  2ZJQ L;  4IEI A;  5BN9 A;  4BC4 A;  3E66 A;  4WQ5 A;  4MLE A;  2YX6 A;  2P9N B;  3CJB A;  1VQ4 N;  3H6E A;  4U7B A;  3ZEU A;  3E9P A;  5M1F A;  4WFN L;  2HBJ A;  2D0P A;  1YI2 N;  1GLD G;  2IVN A;  3RSE A;  4CBW A;  3H1Q A;  5AQQ A;  3AGR A;  4IO8 A;  4FOI A;  1ESV A;  5AQO A;  1C0G A;  1V4T A;  3UKR B;  2Q2R A;  3L4I A;  4KH4 A;  4JKG A;  3R9P A;  3UE5 A;  4CZG A;  3L6Q A;  3ENO A;  5BRD A;  2BTF A;  2E2P A;  5C15 A;  1M1K O;  3EKU A;  5AQJ A;  3M3Z A;  3MK6 A;  4JEP A;  3R8E A;  4WQ4 A;  5AZJ B;  4BRC A;  3BF1 A;  3QFU A;  1Q82 O;  2YHX A;  2W41 A;  3AAR A;  2QI2 A;  3OBW A;  2QWR A;  1JCG A;  2QWN A;  4JHD A;  1ATR A;  5EY4 A;  1GLF O;  1HPM A;  3O4W A;  3ATV A;  3O9U A;  4FSV A;  3UB5 A;  4C1N K;  3G6E N;  3AAP A;  3FE1 A;  3FLC O;  4CZE A;  2QEX N;  1TUY A;  2DPN A;  5AZI A;  3VEN A;  1NGI A;  1BWF O;  1QQN A;  2KKZ A;  3KWI A;  3O1B A;  4G9Z A;  4BR0 A;  1K8K B;  4M7X A;  2P9K A;  3O5B A;  4YOX A;  1YIJ N;  4BRA A;  3CPE A;  3SMS A;  3VER A;  3SBT A;  3DLL L;  5JIC A;  4BC2 A;  2P9I B;  4JD2 B;  2ASM A;  3WXI A;  3CPW M;  3SAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...