2GEMA

2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
216
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCEHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Putative Gram negative resuscitation promoting factor
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 67
structure length 216
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gemA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gemA02
4CBUA 3VGKA 5AQFA 4RTFD 2P9IA 1NLVA 3VERA 3M3ZA 2QW9A 4BRFA 4BVOA 3FZFA 4BR0A 3CJBA 3ATVA 4DCHA 3EKSA 3IDHA 2Q31A 1HKGA 4CBXA 5AFUA 5EXWA 3MCPA 4JNEA 1YAGA 3O1BA 4ISFA 4H5VA 2AP1A 4XH5A 4BQZA 3B8AX 3H1QA 1Z6RA 1NGCA 4Y0WA 4BGBA 3UKUB 4CZFA 4CZMA 5BR9A 3CJCA 1SAZA 3MN7A 4MLHA 1G99A 3O1WA 5F1XA 3O4WA 4O5FA 5LJWA 1HKCA 2QWRA 4ISEA 4CZIA 4IWVA 2A5XA 3MN6A 5AQGA 5F2RA 1GLBG 3SMSA 1NGEA 3J8AA 2FF3B 2P9KA 2HF4A 3KZBA 3VENA 2IVPA 1NBWA 1TYQB 4WQ4A 2P9UA 1LCUA 2FSJA 4I6MB 2WUSA 3QFUA 1LOTB 1SQKA 3EO3A 3ZETA 3GL1A 2QWPA 1J6ZA 4BRCA 1ZBSA 2AA4A 2A3ZA 4BRKA 4A61A 4YDUC 3CI5A 2P9SB 4H0OA 5ELZA 3CJAA 3MMVA 4BC5A 5F0XA 2Q1NA 4MO4A 3D2FB 3H3OB 3LDQA 5FPNA 4LC9B 4BREA 1GLCG 3WT0A 3FGUA 5JMVA 4A2AA 4B1VA 4BRIA 3I8BA 2CH6A 4CZGA 1T6CA 2YI1A 2FLOA 1XC3A 3IMXA 4WYBA 1BUPA 5AQSA 5JLHA 3LDLA 4FWMA 5BRHA 5KPZA 3VEXA 3S41A 2A40A 4H0TB 4ISGA 3WEEA 4PKHA 3HM8A 1X3NA 3O5BA 3A8YA 3IFRA 5AZJA 4B1ZA 3UB5A 3EL2A 3JS6A 3ZX3A 4QS8A 2Q97A 3BP8A 4F9OA 1S3XA 1E4FT 5JICA 3JXUA 4RCHA 5KPRA 2BTFA 3GDQA 1HX1A 2V7ZA 2BUPA 4H5TA 1NGAA 1WOQA 5AQKA 2YJFA 2CGLA 4BG9A 5FPMA 1Q18A 1E4GT 4HTLA 1GLJO 1RGIA 3U9DA 1S22A 4FWOA 2FSNA 1NGJA 3ENHA 4L3QA 3WUHA 2ZF5O 3CERA 4YDUA 2YJEA 4IZ9A 4A2BA 3C7NB 3HSCA 4FSVA 4BVPA 4CD3A 3A5LC 1H1VA 3VETA 1QQMA 3DXMB 1QQOA 4JAXA 1WUAA 3CHWA 1KAYA 1BU6O 4A62A 5AQIA 4H03B 2ASPA 1BA1A 4O8KA 4QS7A 4BRHA 1X3MA 1ATSA 3SMPA 1NGDA 4FWLA 3RSEA 1KXPA 3O08A 3WXJA 4BRDA 4BC2A 3KHYA 3FZHA 4BRPA 2V7YA 4E1JA 2V52B 3CJ1A 2IVOA 3G25A 5E26A 2ZGZA 3L4IA 2P9LA 5FPEA 2QM1A 3TU5A 5EX5A 1EQYA 3LM2A 2E1ZA 1P8ZA 3P4IA 3QBWA 4FPAA 1DKGD 3VF4A 1NGGA 4BQLA 4H5WA 3GOIA 3D2EB 4XEIA 1NWKA 1NMDA 3VPZA 2IIRA 5BPMA 3FE1A 4AM7A 3HTVA 4M7YA 1GLLO 1MA9B 3TPQA 4BRGA 2CH5A 1C0FA 1QZ6A 3LDPA 4FOEA 1NM1A 4JHDB 4KBOA 3FZLA 1NGFA 2GWKA 2HOEA 3DXKA 3MN9A 1KAXA 2KHOA 1Y64A 3QDKA 1BG3A 5AZIA 2GWJA 2H3GX 2NLXA 4QS9A 5AQQA 2ASMA 4JD2B 1KAZA 5AQZA 2QWQA 4JN4A 3FZKA 4BGAA 3QICA 4K43A 1GLEG 3GE1A 3CJ9A 1V4SA 2Q36A 2Q0UA 4EHUA 2E20A 3L0QA 1JCGA 4BC4A 5AFUH 4FWQA 5BPLA 1TUYA 2D0PA 3FR0A 5AQRA 3VEOA 5I9EB 2YHYA 5JLFA 2P9IB 2OANA 5AQOA 3H45C 3AY9A 5AQNA 3CQYA 4IJAA 3DJCA 3ULEA 4AM6A 4BRNA 2I7NA 4DQ8A 2I7PA 4B1YB 2A42A 3VEWA 1K8KA 3OHRA 4IO8A 2E8AA 1U2VA 3ZEUA 4K41A 4EAHD 1ZC6A 4GY2B 3R9PA 2E2OA 5EVZA 4CZEA 3H3NO 4CZJA 1XUPO 2P9PA 4H0PA 1C0GA 4EIAA 5LJVA 1BOTO 3ZX0A 3CETA 1BA0A 1GLDG 5BN9A 4CZKA 3DXKB 4K42A 4CZLA 2D1KA 1TUUA 5LY3A 3SLCA 3A5MC 2P9KB 2E2QA 3EN9A 3I33A 4FL9A 3HZ6A 1T6DA 2P9UB 5E84A 4CBWA 3KVGA 3ZX2A 2ASOA 3R6MA 5FPDA 3ZETB 2Q2RA 2ITMA 3SJHA 4H0VB 5AQJA 3R8EA 3UKUA 5AQMA 2NRHA 1Z05A 3EZWA 5ADXA 5EY4A 1MWMA 3D7EO 1OKJA 5BRDA 3MN5A 1GLFO 2QWMA 4PKGA 3DAWA 2CGJA 3A5NC 3MDQA 5KQDA 3LM9A 3QFPA 4XH1A 3UE5A 2D0OA 1YUWA 1TYQA 4CJ7A 3F9MA 2W40A 3VGLA 4I6MA 3H46O 2YHXA 1D4XA 1DGKN 3EKUA 3WEEB 1ZXOA 3AARA 5AQXA 5AZJB 1MDUB 2PAVA 3L6QA 2E88A 1X9JA 1IJJA 4BR4A 2P9SA 4BRMA 4BG8A 3VF2A 1V4TA 5BREA 1QHAA 2CGKA 5BN8A 3WXKA 3SK3A 1DEJA 4C23A 2FSKA 3D2FA 3VEVA 4CD1A 5TKYA 3AAQA 4XH4A 3A5OC 1CZAN 2VCPA 2E2PA 4H5RA 4NO7A 1QQNA 5AQWA 4BR2A 2A6AA 4WQ5C 5ADXH 2E1YA 4BROA 1HJOA 1RDWX 2QWOA 4B1WB 2GEMA 2VWBA 3U9ZA 3VF6A 2NZTA 2QWNA 5AQHA 5AQUA 2YCHA 1JCFA 2V51B 3VGMA 1HUXA 4EHTA 3O6WA 2GTDA 3GG4A 1XQSC 2QXLA 3LDOA 1BO5O 3A0IX 5KPTA 4IXCA 1NGBA 5CE3A 4FWSA 3O8MA 1HLUA 1HKBA 3FZMA 4FWPA 3U8XA 3RSEB 3VOVA 1ATRA 4DB3A 2HF3A 4MO5A 4B9QA 5EOYA 2F9TA 3ATUA 2P9LB 5BRFA 4BR9A 3BEXA 2A41A 2ZWHA 1IG8A 1JCEA 3VEZA 4J8FA 4B1UB 1BDGA 3C7NA 1ESVA 3UKRA 4IJNA 4NB4A 3BUZB 1NGHA 3C0BA 3DXMA 5KQ8A 2DPNA 2VYPA 3HBTA 2P9NA 3LDNA 4DHYA 3VESA 5B8HA 5AQYA 4H0XB 4BRAA 3ENOA 4FPBA 4BC3A 4WQ5A 3FLCO 3FFKB 4CI6A 2F9WA 1HPMA 4BRQA 2EWSA 2GELA 1U6ZA 4FO0A 4FWNA 5AZIB 3ID8A 2Q0RA 3BF1A 4HWIA 1RFQA 2HMPA 1GLAG 1T44A 2GUPA 3CJ7A 5BPNA 2E2NA 3VEYA 4BR7A 4H0YB 1R59O 3LL3A 3WQTA 5AQLA 1QZ5A 2ZGYA 2J4RA 3DWLA 5AQPA 3D2EA 3H1VX 5AR0A 4FOIA 1NGIA 3AAPA 2UYTA 4MLEA 4PL7A 3QBXA 4FWRA 4B1XB 3WXIA 4PL8A 1BWFO 2PBDA 3O80A 5AQVA 2FXUA 2FF6A 3W0LA 4JHDA 3ULEB 3CQXA 1YVNA 4PKIA 4CZHA 1YXQA 4BR5A 3H6EA 3MK6A 1MWKA 3BF3A 4RWTA 1K8KB 3CIPA 4FWKA 4M7XA 3M1FA 4BRLA 2YHWA 2D4WA 4JD2A 1U2VB 3ZEUB 4M63C 3WQUA 4Z94A 4EFHA 2QWLA 4GNIA 3WXLA 3QB0A 4WQ4C 3W3DA 3M6GA 2W41A 3UKRB 4H5NA 3GBTA 1SZ2A 2P9NB 1ATNA 5AQTA 3IUCA 4K25A 2P9PB 3HI0A 3QMLA 2IVNA 3U4LA
chains in the Genus database with same CATH superfamily
4ILHA 4CBUA 1RT3A 5HRRA 1NLVA 3VERA 3MEDA 4FLTA 3AA4A 2QW9A 3TTFA 4BR0A 4KHSA 3IDHA 3L8BA 4F8RA 3LALA 3MCPA 1J9AA 4R5PA 1YAGA 4E7IA 1IBMK 4H5VA 1UOCA 1LWFA 4BQZA 3SUNA 3ALYA 3K5LA 3L2WA 1L3UA 4ID1A 4Y0WA 3EYZA 3VQEA 3SNNA 4B9NA 4CK2A 3MN7A 3HOSA 3RMCA 4CJTA 3MXMA 1VQNN 5LJWA 4IKFA 4BDYA 3HVRA 2QWRA 4CZIA 4IWVA 3KKSA 2OTLN 2ETJA 5F2RA 1GLBG 2P9KA 3VENA 2FBVA 1NBWA 4CJ4A 2QKKA 1OH6A 2P9UA 1SKRA 4NLCA 3CCEN 3VQ5A 1I94K 3GL1A 1GOCA 2QWPA 4BRCA 1ZBSA 4E3SA 1XMQK 2P1JA 1QS4A 2HBMA 3HPHA 3CI5A 3O9TA 2P9SB 3AVIA 3SV4A 1OH8A 4E0DA 3CJAA 1OVQA 4ZHRA 3D2FB 4CEOA 4M3RA 1GLCG 4JRQA 2NRXA 3DM2A 5C10A 5KRSA 2HHSA 1J53A 4IEIA 1JJ2M 2Z1GA 2CH6A 3QIOA 1XC3A 3IMXA 2FBYA 3OYKA 4FWMA 4B9LA 5KPZA 3G0ZA 3KK2A 4ISGA 3E01A 3MAQA 5AZJA 1UWBA 3AVHA 4I2QA 4NCGA 4E7JA 3EL2A 2Q97A 3LPUA 3BP8A 5JICA 4FLZA 3T1YK 1YJ9N 3K0SA 1HX1A 1NK4A 4H5TA 2IOCA 5AQKA 1KQSM 4XIUA 3N4PA 4HTLA 1GLJO 4AH9A 1NGJA 3WUHA 2Z1JA 1VRTA 4W5NA 5CYMA 4YOVA 3BZCA 3T1HK 3C7NB 3LP0A 3A5LC 4JK8A 3P83D 5FDLA 1QQOA 2IGIA 3CHWA 5C24A 4A62A 3RMBA 1BA1A 3CYMA 4CHYA 1X3MA 1ATSA 3SMPA 1SKWA 3QESA 1FKPA 1KXPA 3O08A 3WXJA 1XHXA 4O8UA 3CCVN 1S1TA 1C1CA 3ISNC 3KHYA 3FZHA 4N5SA 4B9TA 4E1JA 2V52B 3CC2N 1G15A 2YKNA 4AHTA 3CCLN 4DSJA 2HVIA 2E1ZA 1ASWA 1P8ZA 4F4KA 4M3XA 3QBWA 1N32K 1I39A 2B5JA 1NGGA 3GOIA 4DR7K 4LH4A 1NMDA 2Y1IA 3IRXA 4M7YA 1GLLO 4BRGA 4OKEA 4Z4HA 3D0PA 1L5UA 3VQ7A 1LWEA 4CJSA 3G10A 4CJFA 4HUEA 1X1PA 3VTHA 3C6AA 1KAXA 5FROA 3VQ9A 3TAPA 4CGIA 1S9EA 4H8KA 4CHZA 5AQZA 4PQUA 3KLEA 2NRTA 4E7HA 1HNWK 3THYB 1D9DA 3V81A 2E20A 3KWIA 2HSTA 4BC4A 4LF6K 5AFUH 5BPLA 1JLFA 3ITHA 4CEZA 3SUQA 3VEOA 1RBVA 2W42A 3DOLA 1C6VA 2Q3SA 5HLFA 3CCRN 4CGGA 1RT5A 4B1YB 4PWDA 4OPAA 1K8KA 5FRMA 4DUYK 2E4LA 4M3YA 4IO8A 4IDKA 1U2VA 4AHUA 1HYZA 4GY2B 3R9PA 2GUIA 4CZEA 4AHVA 2A1RA 4JI4K 3M8SA 4KHPK 1XUPO 4CEAA 1NU0A 3C6UA 2HHQA 5LY3A 4O0IA 3SBTA 1WSJA 3CCSN 5BR8K 4FL9A 3I33A 4OJRA 1YITN 4O55A 4HUGA 4CBWA 3KLHA 3CFRA 1FKOA 3SYZA 3L2QA 4CEQA 4DV3K 3ZSWA 4I2PA 2NRHA 1SL2A 1WSIA 1LWCA 4JI5K 4CK1A 3MN5A 1A5XA 3VQQA 1MU2A 3IAYA 3SUOA 2G8VA 1M90O 1VQPN 4ELTA 4FW1A 3QFPA 2D0CA 4BE0A 3VQDA 3SAGA 4DQQA 5LL6Z 4YORA 1IKXA 3HSTB 3AA2A 4F2RA 3UIQA 4HHTA 3RRGA 3THWB 1D4XA 3AO3A 3HP9A 3WEEB 1TKDA 1RNHA 4CIEA 3AARA 2OTJN 3ZSQA 3NGIA 4DLEA 3L6QA 4IG0A 3K2PA 2P9SA 4W5QA 5BREA 5M1PA 3AVJA 1KC8O 3D2FA 4CD1A 1NK0A 4XH4A 3F5TA 4M45A 5AQWA 4H5RA 4BR2A 1QQNA 4AQYK 4M3TA 1L3SA 2A6AA 4GVMA 2E1YA 1VSJA 1VSFA 5SWMA 4LD0A 1UA1A 2RKIA 2VWBA 1QSLA 2KTQA 2F8TA 3VF6A 1TKXA 2ZE2A 3SQ1A 5AQUA 2YCHA 3SPYA 4F3OA 3J80O 1WN7A 1VRUA 3GG4A 1Q81O 3T1AA 4FM1A 4IOCL 3PUFA 1RT2A 4RW6A 1J54A 4E89A 4FWSA 4Z4FA 1N33K 1HKBA 4DTJA 1NK5A 3T19A 2RE2A 4FWPA 4DR3K 3OA9A 4MQ3A 4ELVA 4B9QA 1DTTA 2I5JA 1D5AA 3VQ4A 3KLIA 4FLVA 1C0TA 5T7BA 2P9LB 4CHQA 2KLAA 3CMEN 4Y1CA 2HHWA 1RTHA 4FZZA 3C7NA 3HVTA 1WLJA 3BUZB 5KQ8A 1LW2A 5C42A 3HBTA 1NKBA 2P9NA 4KFBA 3VQCA 3KKRA 1VK0A 2XRIA 4GV3A 3BZKA 3AO5A 5AQYA 4C1NK 1FK9A 3E9PA 4CHOA 2XY7A 3ZSVA 1QVFM 1BQNA 3FFKB 2ZJRL 3TTDA 2OPQA 1P90A 2GELA 1U6ZA 4FO0A 4FWNA 5AZIB 2O8BA 5CR4A 1BIUA 1RFQA 3FFIA 1GLAG 1T44A 3EZ5A 1VQ7N 3CJ7A 2P5OA 1VQKN 2E2NA 3LL3A 2RPIA 2ZGYA 1I3AA 5AR0A 2OYQA 4IBNA 3LDSA 3TTCA 3AAPA 4NCAA 4EP4A 3WXIA 4PL8A 5AQVA 2FF6A 3AV9A 4IOAL 3TABA 3VQAA 3V6DA 1QSSA 4Q5VA 1YXQA 1BQMA 5H1SQ 3C95A 3MK6A 3BF3A 1CZBA 4FWKA 5FRNA 4CF9A 2RF2A 2YHWA 4JEPA 3ZEUB 1BHLA 5M1FA 4BACA 2Z1HA 4L8RB 3THYA 1ZBUA 2W41A 1HR0K 3NMUA 4H5NA 3GBTA 3DLGA 5KGWA 1KSPA 3IUCA 2OA8A 1SL0A 3OBYA 5KI6A 3VGKA 3E9LA 5GINA 3M3ZA 2QXFA 4HCCA 5HBMA 3CJBA 3C94A 4DCHA 2IS3A 4DLGA 2Q31A 5SZTA 3BDPA 3OYLA 5EXWA 4JNEA 3QETA 3PX6A 4JKAA 5C2DA 4FJXA 3O1BA 1DLOA 4KAZA 4XH5A 4IFVA 4J2EA 4FJKA 3B8AX 1X9MA 3DLLL 1A5WA 2KKZA 4BGBA 1W9HA 3NVKA 5C25A 3CJCA 3THXB 1G99A 5CYQA 1D8YA 4DR1K 4O5FA 1RT4A 1HKCA 3PX4A 1NK7A 1C1AA 4ISEA 4U7BA 5AQGA 4DQIA 3SMSA 2D0BA 4CGDA 3KZBA 1TYQB 2OPRA 5GIOA 2WUSA 3QFUA 4M42A 4KB0A 3NE6A 1GOAA 4NYNA 1J6ZA 2JWKA 2YKMA 4BWMA 4KO0A 5J1EA 1HYSA 4FZXC 5M1QA 3OYNA 3CPWM 4LFAK 3MMVA 1EP4A 4KH5A 3OTOK 3KLGA 1C0UA 2VWKA 3KWGA 4O0JA 3V1RA 3H3OB 1T7PA 1KVBA 4KTWA 4LC9B 3WT0A 3ZT3A 1VSLA 3G6EN 3WNEA 3OYMA 2XHBA 1EWQA 1NOYA 1CXUA 4JI0K 3S41A 2A40A 3V9UA 3WEEA 2DFFA 3OYHA 1RBSA 3HM8A 3SUPA 3A8YA 3IFRA 3CD6N 4OKKA 1WBDA 3ZX3A 2WBNA 3MEGA 4RCHA 2BTFA 5HOOA 3ZLJA 2BUPA 1WOQA 4BG9A 4BDPA 2CGLA 3VQ6A 2HVHA 5FPMA 1E4GT 3U9DA 2FSNA 3ENHA 4L3QA 1RDAA 4DTOA 2ZF5O 4FLUA 3CERA 1VSKA 4IZ9A 3HSCA 4BVPA 5C2FA 4KI6A 1SV5A 1H1VA 4QCLA 3S3MA 3OYEA 1WUAA 1KAYA 1BU6O 3I56N 3AVKA 3ZSYA 4BRHA 4X65K 4FWLA 4BRDA 4Z4GA 5AJ3K 1JKHA 4BRPA 2V7YA 5FPEA 2ZGZA 3L4IA 2P9LA 4CFDA 4F3TA 1ASVA 3HYFA 3LM2A 4FJ5A 1E3MA 4FPAA 5J2PA 1JLEA 3M8PA 4H5WA 4XEIA 1NWKA 4Y1DA 4AM7A 3HTVA 3TPQA 1MA9B 1FW6A 4LF4K 4CE9A 2E6MA 1BI4B 2WFBA 1UA0A 4JHDB 3P38A 5M1KA 4KBOA 4X64K 4DV4K 3FZLA 1NGFA 3MN9A 4BE1A 3CC7N 4FJIA 1JL1A 5AZIA 4YOWA 4JI2K 3SAFA 1EXQA 3AO1A 3I55N 2QWQA 3QICA 3ZSXA 4K43A 2PYJA 1T03A 3SCXA 3CJ9A 2ZJQL 4DFKA 2G8IA 3NCIA 3FR0A 3CM5A 1RILA 3LP1A 2OANA 3K5MA 3LPTA 4FW2A 5AQNA 5M1OA 3HOTA 2E6LA 4JKEA 5MLCQ 2VG5A 1CZ9A 1KLNA 3QEPA 3OHRA 4CFAA 1DT9A 3AVBA 3WNFA 1TKTA 2E8AA 2BANA 3ZEUA 4K41A 4JKCA 3R3LA 4UQGA 3VA0A 3LWLA 3MWTA 1SS6A 3ZSRA 2UUAK 4H0PA 4CEEA 1C0GA 1WSEA 3O4QA 4E19A 3O3FA 5LJVA 1B92A 3JSMA 3CETA 2O8CB 1BA0A 5BN9A 4JI3K 3DXKB 4K42A 4G1QA 1NMNA 2D5RA 1KTQA 4O5BA 2HNZA 4CZLA 4WFAL 1TUUA 2ZD1A 3SQ0A 3D45A 2VGNA 1RBTA 2ATQA 1NOZA 3HZ6A 4B8AB 3AVFA 1BGXT 1SL1A 3KD1E 5E84A 3U3GA 4JKHA 1Z25A 4I9QA 1FXXA 3ZETB 2Q2RA 2ITMA 3SJHA 4H0VB 3J81O 4DTXA 1RT7A 3CCUN 1XNQK 2HBKA 1LAVA 4JKDA 2ZM6K 3V9WA 5ADXA 2KFNA 1NNEA 1RDUA 1OKJA 2ITGA 5BRDA 1XI1A 4PKGA 2QWMA 4A5BA 1Q7YO 3DAWA 2G8UA 2CGJA 3MDQA 5KQDA 2PZSA 4Z4EA 3LM9A 1VAZA 4XH1A 3UE5A 4GV9A 1S1XA 2D0OA 1TYQA 1HJRA 1YIJN 3F9MA 4DTMA 1OH7A 3NF7A 1W0HA 3TR8A 4LY7A 5FLXO 1HNIA 1DGKN 3DRPA 1ZXOA 4YFUA 4DKWA 3C6TA 1RTIA 1IJJA 5GAEP 3J7ZO 3C6HA 4KTQA 4FJMA 1TAQA 4ILJA 4R79A 2CGKA 5BN8A 3SK3A 3OW2M 1DEJA 4C23A 3DOKA 1EWRA 1RCHA 2HNDA 1IKYA 3QEXA 3TI0A 1XHZA 3KIOA 4FVUA 5LMNK 3PSFA 4ILGB 2E2PA 5DK5A 2UUBK 4LSLA 4WQ5C 5ADXH 5E41A 4EP5A 1TGOA 1EX4A 2QTDA 2GEMA 3HK2A 3OVNA 1VSIA 2HBLA 2HHHK 4CJQA 4DS4A 3PO4A 4LF8K 3NVMA 2GTDA 4GW6A 2GV9A 3MX2A 3PIPL 2QXLA 4LF5K 1X9WA 1HLUA 4CK3A 4NYFA 4OKJA 3RSEB 3VOVA 1ATRA 4MO5A 5JVHL 4CJRA 3ATUA 3MEEA 1YT3A 3BEXA 4BR9A 2O4GA 4DSFA 2JWLA 2NRVA 4IDHA 4DMNA 4F2SA 2G8FA 2RHKA 1O1WA 4NCBA 2W6KA 3MXIA 4DV0K 1U4BA 3VQ8A 4MDAA 1NGHA 1W7AA 3LDNA 4DUZK 1S1UA 4WE1A 3G4SN 4FPBA 3OYFA 1VSHA 4WQ5A 3FLCO 3CXCM 3SQ2A 1CLQA 4OLBA 2DFEA 2YV0X 4CJWA 3DLKA 3BF1A 4HWIA 4DFMA 3RWUA 3V1OA 2HMPA 3L2VA 4B8CA 2Z1IA 3DRSA 3VEYA 2X78A 1R59O 1QZ5A 2HNYA 2J4RA 3DWLA 3H1VX 3CFOA 3CFPA 1U04A 2UU9K 3OS1A 4FWRA 1BI4A 2FXUA 1RBRA 3QEWA 4JHDA 3ZT4A 2UXCK 2XY5A 1YVNA 3CQXA 4GVEA 3H6EA 3WNGA 3NHGA 4RWTA 4CCHA 4X66K 4IO9L 4M7XA 3TAMA 3M1FA 4BRLA 1QHTA 4Z94A 4C8OA 4M63C 4J2AA 4WFBL 3WXLA 4WQ4C 3W3DA 3RRHA 3UKRB 5JS1A 1SZ2A 1NJXA 5AQTA 3NGZA 4K25A 4FCYA 4WCEL 4DTSA 1IKVA 2W6LA 2OZSA 4W5RA 4ZTJA 5AQFA 3CCMN 3L3UA 1TK5A 1XNRK 2FBXA 4BRFA 4BVOA 3FZFA 3ATVA 3EKSA 1HKGA 3HJFA 2JGUA 5IT9O 4DTUA 1TL3A 3R1XA 3K5NA 1S6PA 1WSGA 4DV5K 3TAFA 3VTIA 3H1QA 1JLCA 1Z6RA 5TKWA 1RDDA 1NGCA 3LZJA 3UKUB 4CZMA 5BR9A 3S9HA 3SI6A 4V19S 1SAZA 4MLHA 3U6FA 3O1WA 2R7YA 5F1XA 4CJKA 1IKWA 3O4WA 4RW9A 3V9ZA 4CVNE 2O8CA 2QEXN 2A5XA 4PY5A 2D0AA 3V4IA 3J8AA 3AVGA 4CJEA 4JYAK 2FF3B 4AHCA 3VQBA 4OX9K 2IVPA 4WQ4A 1TVRA 4FJ9A 3BY5A 2KZZA 4CECA 1SQKA 3EO3A 3ZETA 4CGJA 4B9SA 3F73A 4CJLA 3EE9A 2AA4A 2A3ZA 4N56A 1VQ5N 4G9ZA 4A61A 2UXBK 4YDUC 3HL8A 4H0OA 1TAUA 3CC4N 1D9FA 4BC5A 2Q1NA 4MO4A 3LDQA 5FPNA 4E1NA 1TV6A 4N41A 4OLAA 3FGUA 2HBJA 2HHXA 2X74A 4A2AA 1IO2A 4BRIA 3I8BA 3SJJA 4GKJK 4WYBA 1BUPA 3P5JA 5JLHA 1NJZA 3LDLA 1W97L 5BRHA 4BY9C 2BGGA 3WNHA 4H0TB 4LSNA 5CZ1A 3AVAA 4PKHA 3PIOL 1RTJA 4B1ZA 5C12A 1YI2N 3NF9A 3JS6A 4FJ8A 4F9OA 3Q7CA 3C65A 1S3XA 1E4FT 3JXUA 2NRZA 3PV8A 2V7ZA 1BCMA 4B3SK 4KH4A 3NFAA 4B9VA 1U47A 2YJFA 4U67L 2YNIA 3U3YA 1Q18A 5HROA 1K73O 1RGIA 3I0SA 2A1SA 1KVCA 4YHHK 3K5OA 5HRPA 1ZYQA 2VGMA 4YDUA 4YOUA 2YJEA 4A59A 3V1QA 3QLHA 4FM0A 4A2BA 1S72N 2F7TA 2B4JA 4FSVA 4CD3A 4E1MA 4JKBA 3EE8A 2HHUA 2VG7A 3VETA 2FBTA 1TL1A 4O8KA 3AVMA 4QS7A 4JI7K 1RT6A 3DRRA 3RSEA 5DM6L 1EKEA 3VQPA 4BC2A 1NK9A 3G25A 2IVOA 5E26A 1YF5L 2QA4N 4YY3K 2OPPA 2QM1A 4B3MK 2KFZA 1JXBA 3ZYYX 3KLFA 3P4IA 4CFCA 4LF9K 1S5JA 3VPZA 5BPMA 3FE1A 2HB5A 1VHXA 1C0FA 1QZ6A 4FOEA 2O8EB 2NNWA 1NM1A 3HP6A 4CFBA 2GWKA 4KV8A 1IBLK 5GADP 1NKCA 4M3WA 3ULDA 3L3VA 1Y64A 3QDKA 1BG3A 1S1WA 5KTQA 2GWJA 4GMJB 2NLXA 1EO1A 4BE2A 2ASMA 4I9LA 3QERA 1KD1O 2OZMA 1KAZA 4JN4A 3FZKA 4BGAA 1GLEG 2VG6A 4KI4A 3P1GA 1NK6A 1V4SA 2Q36A 5GAGP 3KTQA 4EHUA 3L0QA 1JCGA 4M41A 1TK8A 3O3HA 4FWQA 1TUYA 5M1NA 5AQRA 1BL3A 5I9EB 1IG9A 2YHYA 1WBBA 2P9IB 3H45C 4JI6K 3AY9A 2EHGA 3CQYA 4IJAA 4AM6A 3AVCA 4OPKA 3HO1A 2I7NA 3NDKA 2AJQA 4DQ8A 1WAFA 2I7PA 2A42A 3VEWA 1EETA 2KQ2A 3MWPA 1ZBIA 3OYDA 4DSIA 1Q9XA 4DQPA 5CHIA 3LWMA 3AA5X 4EAHD 1RDCA 2F96A 4CF8A 4DQRA 1NG9A 1ZC6A 5EVZA 1RT1A 3THWA 3H3NO 3AVLA 4CZJA 3M8QA 5HRNA 4EIAA 1BOTO 3ZX0A 4CJ5A 3O3GA 1N34K 2D1KA 4QAGA 3SLCA 3ID6A 2YNGA 3A5MC 2E2QA 3EN9A 1N5YA 4DTPA 1T6DA 1RDBA 3JAMO 3DLEA 1RBUA 3P39A 3J7YP 2G8HA 4CGFA 3KVGA 4OPJA 4FK4A 1LAWA 4Q0BA 3R6MA 1JLGA 1KRPA 2ZJPL 3OJSA 4MDBA 3R8EA 3UKUA 2LSNA 3KK7A 4DTNA 1ZBLA 3EZWA 3J7AP 1JLAA 1NJIO 1MWMA 3D7EO 4DQSA 4DFJA 4W5TA 4DSEA 3QEVA 1GLFO 4H4MA 3D6RA 1WSFA 1JXEA 2X6SA 3TAGA 3A5NC 3IS9A 4FXDA 1IBKK 1IH7A 5I3UA 4CEBA 4DG1A 4DTRA 3KJVA 2W40A 2NRRA 3VGLA 3MXJA 1IV0A 3VA3A 4EZ9A 4O44A 3B6PA 5AQXA 1LV5A 2O8FB 2E88A 4BR4A 1K9MO 1SUQA 4BG8A 5HRSA 1QHAA 4C8NA 3VEVA 5TKYA 4WFNL 3AAQA 1BIZA 2NUBA 4FLXA 1WSHA 1UAXA 3TARA 4RG8A 4K8ZA 1RTDA 2UUCK 4JS4A 3ZSZA 3TANA 3DLRA 3LP2A 2QWOA 4DU1A 1W2BM 3U9ZA 2OPSA 2NZTA 3AGRA 4OGEA 3VGMA 1HUXA 4DR6K 3SZ2A 3CG7A 4HUFA 3AO2A 2DY4A 5A2QO 1CXQA 5KPTA 1NGBA 1TK0A 1QTMA 2IDOA 4DF4A 1QSYA 1K8AO 1NJYA 3U8XA 4TSXA 2BH1A 2GX9A 1REVA 4FJ7A 2O4IA 1M1KO 5BRFA 3O9SA 1IG8A 4DU4A 4I7FA 3VEZA 4J8FA 3NH1A 1BDGA 3CQ8A 3ASMA 1ESVA 4OGCA 2G8WA 4IEEA 3LZIA 4DHYA 2FC0A 4ID5A 1QQCA 5EU7A 4BRAA 3ENOA 3OYIA 3OYJA 4KTZA 1Q9YA 4CI6A 2F9WA 3DYAA 2QKBA 1VQ9N 4CIGA 4BRQA 1BISA 3K57A 3OYAA 4JKGB 3E66A 1SKSA 3NH0A 3ID8A 2Q0RA 1NKEA 3S3NA 4DR4K 3ZT0A 2B6AA 4CERA 5BPNA 4JRPA 4KHNA 4BR7A 4H0YB 4C8KA 5AQLA 5AQPA 4AHRA 1NJWA 4DR2K 4CIFA 4MLEA 4NXNK 4IFEA 5CY4A 3THXA 4B1XB 1HYVA 2O8DB 4NLBA 2O8EA 4CHPA 2E5LK 3W0LA 3ULEB 3E9OA 1L3VA 3HPOA 3CCJN 1U48A 4B9MA 1MWKA 5J2QA 1HPZA 4JI1K 1X9SA 5D3GA 2D4WA 3F9KA 2KW4A 3WQUA 3ZT2A 4DV7K 4J2DA 3M6GA 3OBWA 1Y97A 3PSIA 1YVUA 2P9NB 3QIPA 1A5VA 2P9PB 3HI0A 3QMLA 4KPYA 3HM9A 4ZTFA 4DSLA 2IVNA 3U4LA 4HCBA 4RTFD 2P9IA 4LH5A 1YJNN 2YHBA 1HRHA 1TKZA 4JK7A 5HP1A 4CBXA 5AFUA 2O8BB 3OYGA 1VQLN 1Q82O 4DS5A 4O4GA 4ISFA 2IC3A 5JS2A 2AP1A 4FVMA 4DF8A 3PLAA 3TSQA 3B6OA 4FJNA 4FK2A 1Z26A 1N36K 4CZFA 3QO9A 1Q86O 2DTUA 3LAMA 4C8MA 1YJWN 3N4QA 3MN6A 3ZT1A 3TAQA 1NGEA 4PA1A 1JLQA 2HF4A 2DFHA 4JV5K 1LCUA 2FSJA 4I6MB 1JLBA 4LFCK 1ILYA 3A2FA 1LOTB 3HT3A 4FK0A 3RMAA 4QOZB 1VQ8N 1BCOA 1KLMA 3Q7BA 4NXMK 4BRKA 4Z4CA 4FJJA 4DWIA 5ELZA 1L3TA 5F0XA 4B3TK 1YTUA 4BREA 3OY9A 4CF1A 5JMVA 4B1VA 3OS0A 1KFDA 3NF8A 4CZGA 1T6CA 2WONA 5KRTA 2YI1A 2FLOA 4JI8K 3MX5A 4DU3A 5AQSA 1FJGK 1J5OA 4OO1J 3VEXA 4BWJA 1X3NA 3O5BA 4JKFA 3SAHA 3BGRA 2O8FA 3UB5A 3E1YA 4QS8A 2QK9A 5KGXA 4RW4A 3M8RA 1OVYA 4X62K 4ICLA 1ITGA 5KPRA 3GDQA 4EZ6A 3EEQA 4A57A 3CF5L 2PYLA 1NGAA 5GIPA 1N6QA 1KCFA 1S22A 4FWOA 3DLHA 4DR5K 4FLYA 3KK3A 5CZ2A 4DSKA 1VSEA 1S6QA 2G8KA 1QQMA 4JLHA 3DXMB 4E7KA 3K59A 4JAXA 3WXMB 5AQIA 4H03B 3TSPA 3OYCA 2ASPA 2HHVA 4PUOA 4IOXA 3TSUA 2VQEK 2XY8A 2XY6A 4B9UA 1NGDA 1OH5A 3QINA 3CJ1A 1T05A 4CJUA 4KH6A 3RVCA 3TU5A 1YHQN 4DV2K 5EX5A 1EQYA 3MCAB 4CW7B 1DKGD 3VF4A 4BQLA 2XO7A 1HNZK 3D2EB 4B3OA 1C1BA 4KHQA 2IIRA 1ZBHA 4YOYA 2F4VK 1GOBA 2CH5A 3LDPA 1F21A 1O13A 4CEFA 3O9QA 4J2BA 1N8RO 4HVJA 4LFBK 2HOEA 1XWLA 2WOMA 3DXKA 1B9FA 1WNSA 3IG1A 2KHOA 4ELUA 4CEDA 4JKGA 4KB1A 3OYBA 2H3GX 4QS9A 5AQQA 3EY1A 4A5AA 4W5OA 1U45A 3PO5A 4JD2B 4CJVA 4K8XA 2KZMA 2VQFK 2RN2A 4N76A 3GE1A 3NBPA 2Q0UA 1J5EK 4M3ZA 1ASUA 2D0PA 2O8DA 5JLFA 5AQOA 3ULEA 3DJCA 4BRNA 2VWJA 3VMFB 3L4QA 2P51A 3K9JA 2YX6A 1NK8A 2YNHA 4IFYA 3VN5A 2WTUA 3CMAN 4CGHA 4CJ3A 5DM7L 2E2OA 3THVA 1T3VA 2BDPA 3NAEA 4Z0UA 5C0YA 2P9PA 5LMUK 4FYDA 4YOTA 1VQON 3M5RA 3S3OA 3F2KA 1GLDG 4CZKA 5GAHP 4C1NI 3T7ZA 4FJGA 2NRWA 3SQ4A 4M3UA 5IWAK 2P9KB 1KVAA 3NF6A 2P9UB 3ZX2A 2ASOA 4BDZA 4CF0A 5J2MA 3O9RA 4UY8O 1U49A 4B3RK 5FPDA 3HPGA 5AQJA 2EX3A 5AQMA 1Z05A 1WB9A 2PY5A 5EY4A 3TWHA 1HMVA 3DLBA 4LF7K 4CHNA 4KKOA 3PX0A 1QE1A 4CESA 1XMOK 4KRFA 3V9SA 3JYTA 1VQMN 3O4NA 1HQUA 1VSDA 5K14A 3O9UA 2GBZA 3G71N 4FM2A 4Z4IA 1YUWA 3LP3A 4FLWA 5I42A 4CJ7A 4GV6A 3I8DA 3CCQN 2Y1JA 4I6MA 3H46O 4GKKK 2YHXA 3SBGA 3V9XA 3AGKA 3EKUA 3LANA 5AZJB 1MDUB 2PAVA 1X9JA 1B9DA 4N47A 4BRMA 4AF1A 1WAJA 3VF2A 1V4TA 1S1VA 3WXKA 3SPZA 2FSKA 4E7LA 3L2RA 3A5OC 3LAKA 3NGYA 3ZCMA 3KD5E 1CZAN 2VCPA 4NO7A 1VQ6N 4BROA 3DI6A 3SV3A 1HJOA 1HNXK 1RDWX 3DMJA 4B1WB 4H4OA 1KFSA 2QWNA 5AQHA 4CJPA 3HXMA 1JCFA 1ZBFA 2V51B 3RMDA 4FZYA 4C8LA 4EHTA 3O6WA 4IG3A 1XQSC 3LDOA 1BO5O 3A0IX 3AVNA 4IXCA 4FJHA 5CE3A 4KREA 2HMIA 3O8MA 3HRGA 3KK1A 2P5GA 3FZMA 3RR7A 4MFBA 4DB3A 4CF2A 3H08A 1VQ4N 2HF3A 4DV6K 5EOYA 1JL2A 2UXDK 2F9TA 3K58A 4RW8A 2A41A 2WC9A 4HTUA 2ZWHA 3MECA 4KHWA 1JCEA 4OVLA 1QVGM 1R0AA 1K6YA 1YTAA 3PY8A 3P31A 4B1UB 3RTVA 3TAEA 5C15A 3IKMA 3UKRA 4KHUA 2X6NA 4IJNA 4NB4A 4JS5A 1T8EA 3RR8A 4B08A 3C0BA 3DXMA 3OS2A 4PHTX 2DPNA 2VYPA 4K0KK 3CPEA 3VESA 5B8HA 3QNOA 3QEIA 3T3FA 4H0XB 5JVGL 2ZQBA 4BC3A 1DTQA 1HNVA 5J2NA 1HPMA 2EWSA 3NH2A 4KHYA 2HW3A 2IAJA 2GUPA 3ZSOA 3CM6A 3WQTA 2YNFA 4WF9L 4YNQA 4AILC 3D2EA 3K9KA 4FOIA 4JK9A 4YOXA 1NGIA 4OPHA 2YHAA 4RW7A 3AA3A 5DMRA 2UYTA 4PL7A 3QBXA 3QNNA 3I0RA 1BWFO 2PBDA 3O80A 2F8SA 1XC9A 2QI2A 4DV1K 1VSMA 4PKIA 1HQEA 4CZHA 5HL7L 4BR5A 2JLEA 1K8KB 3CIPA 3T69A 4FJLA 4JD2A 3ENBA 1U2VB 2OCEA 4EFHA 1C0MA 2PFUA 2QWLA 4GNIA 2HHTA 3QB0A 1Q8IA 4AHSA 3AO4A 1ATNA 2BE2A 1S9GA 3L2UA 3OJUA 4DFPA 1LW0A
chains in the Genus database with same CATH topology
4ILHA 3OBYA 4CBUA 3VGKA 5AQFA 4RTFD 3E9LA 5GINA 2P9IA 1NLVA 3CCMN 3VERA 3M3ZA 1YJNN 2QW9A 4BRFA 4BVOA 3FZFA 3TTFA 3CJBA 3ATVA 4BR0A 4DCHA 3EKSA 3IDHA 4JK7A 2Q31A 1HKGA 4CBXA 5AFUA 5EXWA 3MCPA 4JNEA 1VQLN 1YAGA 4JKAA 1Q82O 5C2DA 3O1BA 4ISFA 4H5VA 3R1XA 2AP1A 4XH5A 4BQZA 3B8AX 3DLLL 3VTIA 3H1QA 3PLAA 5TKWA 1Z6RA 3TSQA 2KKZA 1NGCA 4Y0WA 4BGBA 3UKUB 4CZFA 4CZMA 5BR9A 3NVKA 3CJCA 1SAZA 3MN7A 4MLHA 1G99A 1Q86O 3O1WA 3HOSA 5F1XA 3O4WA 4O5FA 5LJWA 1VQNN 1YJWN 1HKCA 2QWRA 3N4QA 4ISEA 4CZIA 4IWVA 2OTLN 2QEXN 2A5XA 3MN6A 4U7BA 5AQGA 5F2RA 1GLBG 3SMSA 1NGEA 3J8AA 2FF3B 2P9KA 2HF4A 3KZBA 3VENA 2IVPA 1NBWA 1TYQB 4WQ4A 2P9UA 5GIOA 1LCUA 2FSJA 4I6MB 2WUSA 1ILYA 3QFUA 1LOTB 1SQKA 3EO3A 3ZETA 4NLCA 1VQ8N 3CCEN 3GL1A 2QWPA 1J6ZA 2JWKA 4BRCA 1ZBSA 3Q7BA 3EE9A 2AA4A 2A3ZA 4BRKA 1VQ5N 4G9ZA 2HBMA 4A61A 5M1QA 4YDUC 3CI5A 3O9TA 2P9SB 4H0OA 5ELZA 3CPWM 3CJAA 3MMVA 4KH5A 3CC4N 4BC5A 5F0XA 2Q1NA 3KWGA 4MO4A 3D2FB 3H3OB 3LDQA 5FPNA 4LC9B 4BREA 1GLCG 3WT0A 3FGUA 2HBJA 5JMVA 2NRXA 4A2AA 5C10A 4B1VA 4IEIA 1JJ2M 4BRIA 3G6EN 3I8BA 2CH6A 4CZGA 1T6CA 2YI1A 2FLOA 1XC3A 3IMXA 3MX5A 4WYBA 3CC2N 1BUPA 5AQSA 5JLHA 3LDLA 1W97L 4FWMA 5BRHA 4BY9C 5KPZA 3VEXA 4OO1J 3S41A 2A40A 4H0TB 4ISGA 3WEEA 4PKHA 3HM8A 1X3NA 3O5BA 3A8YA 3IFRA 4JKFA 3PIOL 5AZJA 3SAHA 3CD6N 4B1ZA 5C12A 3UB5A 1YI2N 3E1YA 3EL2A 3JS6A 3ZX3A 2WBNA 4QS8A 2Q97A 3BP8A 4F9OA 3Q7CA 3C65A 1S3XA 1E4FT 1OVYA 3JXUA 5JICA 1YJ9N 2NRZA 4RCHA 2BTFA 5KPRA 3GDQA 1HX1A 2V7ZA 5HOOA 4A57A 4KH4A 2BUPA 4H5TA 3CF5L 1NGAA 1WOQA 5AQKA 2YJFA 2CGLA 4BG9A 4U67L 1KQSM 3N4PA 5FPMA 1Q18A 1E4GT 4HTLA 1GLJO 1RGIA 3U9DA 5GIPA 1K73O 1S22A 4FWOA 2FSNA 1NGJA 3ENHA 4L3QA 3WUHA 2ZF5O 2VGMA 3CERA 4YOVA 4YDUA 4YOUA 2YJEA 4A59A 4IZ9A 4A2BA 1S72N 2F7TA 3C7NB 3HSCA 4FSVA 4BVPA 4CD3A 5C2FA 3A5LC 4JK8A 4JKBA 3EE8A 1H1VA 3VETA 1QQMA 3DXMB 1QQOA 4JAXA 1WUAA 3CHWA 3WXMB 1KAYA 1BU6O 4A62A 5AQIA 4H03B 3TSPA 2ASPA 3I56N 4IOXA 3TSUA 1BA1A 4O8KA 4QS7A 4BRHA 1X3MA 1ATSA 3SMPA 1NGDA 4FWLA 3RSEA 1KXPA 3O08A 3WXJA 4BRDA 5DM6L 4O8UA 3CCVN 4BC2A 3KHYA 3FZHA 4BRPA 2V7YA 4E1JA 2V52B 3CJ1A 2IVOA 3G25A 1YF5L 2ZGZA 3L4IA 2P9LA 5E26A 4KH6A 5FPEA 2QA4N 3RVCA 2QM1A 3TU5A 1YHQN 3CCLN 5EX5A 1EQYA 3LM2A 2E1ZA 3MCAB 3ZYYX 1P8ZA 3P4IA 3QBWA 4FPAA 1DKGD 3VF4A 1NGGA 4BQLA 4H5WA 3GOIA 3D2EB 4XEIA 1NWKA 1NMDA 3VPZA 2IIRA 5BPMA 3FE1A 4AM7A 4YOYA 3HTVA 4M7YA 1GLLO 1MA9B 3TPQA 4BRGA 2CH5A 1C0FA 1QZ6A 3LDPA 4FOEA 2NNWA 1O13A 1NM1A 2WFBA 3O9QA 1N8RO 4JHDB 3P38A 5M1KA 4KBOA 3VTHA 3FZLA 1NGFA 2GWKA 2HOEA 3DXKA 5GADP 3MN9A 3C6AA 1KAXA 2KHOA 3CC7N 1Y64A 3QDKA 1BG3A 4JKGA 5AZIA 4YOWA 3SAFA 2GWJA 2H3GX 2NLXA 4QS9A 5AQQA 1EO1A 4A5AA 2ASMA 3I55N 4JD2B 1KD1O 1KAZA 5AQZA 2QWQA 4JN4A 3FZKA 4BGAA 3QICA 2NRTA 4K43A 1GLEG 3GE1A 3CJ9A 2ZJQL 1V4SA 2Q36A 5GAGP 2Q0UA 4EHUA 2E20A 3KWIA 1JCGA 3L0QA 2HSTA 4BC4A 5AFUH 4FWQA 5BPLA 1TUYA 2D0PA 3FR0A 5M1NA 5AQRA 3VEOA 5I9EB 2YHYA 5JLFA 2P9IB 2OANA 5AQOA 3H45C 3AY9A 5AQNA 3CQYA 4IJAA 3DJCA 5M1OA 3ULEA 4AM6A 4BRNA 3HOTA 5MLCQ 4JKEA 3VMFB 3CCRN 3L4QA 2I7NA 4DQ8A 3K9JA 2I7PA 4B1YB 2A42A 3VEWA 4OPAA 1K8KA 2YX6A 3OHRA 1DT9A 3MWPA 4IO8A 5CHIA 2E8AA 1U2VA 3ZEUA 4K41A 4EAHD 4JKCA 3CMAN 3R3LA 1ZC6A 4GY2B 5DM7L 3R9PA 2E2OA 5EVZA 4CZEA 3MWTA 1T3VA 3H3NO 1SS6A 4CZJA 1XUPO 5C0YA 2P9PA 4H0PA 1C0GA 4YOTA 4EIAA 1VQON 3M5RA 5LJVA 1BOTO 3ZX0A 3CETA 3F2KA 1BA0A 1GLDG 5BN9A 4CZKA 3DXKB 4K42A 4WFAL 4CZLA 5GAHP 4C1NI 2D1KA 1TUUA 3T7ZA 5LY3A 3SBTA 2NRWA 3SLCA 3ID6A 3CCSN 2VGNA 3A5MC 2P9KB 2E2QA 3EN9A 3I33A 4FL9A 3HZ6A 1YITN 1T6DA 3P39A 2P9UB 5E84A 4CBWA 3KVGA 3ZX2A 2ASOA 4JKHA 3R6MA 3O9RA 4UY8O 5FPDA 3ZETB 2Q2RA 2ITMA 3SJHA 4H0VB 2ZJPL 4MDBA 5AQJA 3R8EA 3UKUA 5AQMA 3CCUN 2NRHA 3KK7A 1Z05A 2HBKA 4JKDA 3EZWA 5ADXA 5EY4A 1NJIO 1MWMA 1RDUA 3D7EO 1OKJA 5BRDA 3MN5A 1GLFO 2QWMA 4PKGA 4A5BA 3D6RA 1Q7YO 3DAWA 1VQMN 2CGJA 3A5NC 1M90O 1VQPN 3MDQA 5KQDA 3LM9A 1VAZA 3O9UA 3QFPA 3G71N 4XH1A 3UE5A 4GV9A 2D0OA 1YUWA 3SAGA 1TYQA 4CJ7A 3F9MA 1YIJN 2W40A 2NRRA 3CCQN 3VGLA 4YORA 4I6MA 3H46O 4GV6A 2YHXA 3SBGA 3AGKA 1D4XA 1DGKN 3EKUA 3WEEB 1ZXOA 3AARA 2OTJN 5AQXA 5AZJB 4DKWA 1MDUB 2PAVA 3L6QA 2E88A 1X9JA 1IJJA 4BR4A 5GAEP 1K9MO 3J7ZO 2P9SA 3C6HA 4BG8A 4AF1A 3VF2A 4BRMA 1V4TA 5BREA 1QHAA 4ILJA 2CGKA 5M1PA 5BN8A 4R79A 3WXKA 3SK3A 3OW2M 1KC8O 1DEJA 4C23A 2FSKA 3D2FA 3VEVA 4CD1A 5TKYA 4WFNL 3AAQA 4XH4A 3A5OC 4FVUA 3F5TA 4ILGB 1CZAN 2VCPA 2E2PA 4H5RA 4NO7A 1QQNA 5AQWA 4BR2A 1VQ6N 2A6AA 4WQ5C 5ADXH 2E1YA 4BROA 1HJOA 1RDWX 2QTDA 2QWOA 4B1WB 2GEMA 2VWBA 1W2BM 3U9ZA 3VF6A 2NZTA 2QWNA 5AQHA 2HBLA 3AGRA 5AQUA 2YCHA 1JCFA 2V51B 3VGMA 1HUXA 4EHTA 3O6WA 3NVMA 2GTDA 3GG4A 3MX2A 3PIPL 1Q81O 1XQSC 2QXLA 3LDOA 1BO5O 3A0IX 4IOCL 5KPTA 4IXCA 1NGBA 5CE3A 4FWSA 3O8MA 1HLUA 1HKBA 3HRGA 3FZMA 2RE2A 1K8AO 4FWPA 3OA9A 3RSEB 3U8XA 2BH1A 3VOVA 1ATRA 4DB3A 2GX9A 1VQ4N 2HF3A 4MO5A 4B9QA 5EOYA 5JVHL 2F9TA 1M1KO 3ATUA 2P9LB 5BRFA 2KLAA 4BR9A 3BEXA 3CMEN 2A41A 2WC9A 2JWLA 2NRVA 2ZWHA 4IDHA 3O9SA 1IG8A 1JCEA 1QVGM 3VEZA 4J8FA 2RHKA 3P31A 4B1UB 1BDGA 3C7NA 1ESVA 5C15A 3IKMA 3UKRA 4IJNA 4MDAA 4NB4A 3BUZB 3C0BA 1NGHA 3DXMA 4PHTX 2DPNA 2VYPA 3HBTA 2P9NA 4IEEA 5KQ8A 3LDNA 4GV3A 3CPEA 4DHYA 3VESA 5B8HA 5AQYA 4H0XB 4BRAA 3ENOA 4C1NK 4FPBA 3G4SN 3E9PA 4BC3A 5JVGL 4WQ5A 3CXCM 3FLCO 1QVFM 3FFKB 4CI6A 2ZJRL 2F9WA 1VQ9N 3TTDA 1HPMA 4BRQA 2EWSA 1P90A 2GELA 1U6ZA 4FO0A 3E66A 4FWNA 4JKGB 5AZIB 3ID8A 2Q0RA 3BF1A 4HWIA 5CR4A 1RFQA 2HMPA 1GLAG 1T44A 2GUPA 1VQ7N 3CJ7A 5BPNA 1VQKN 2E2NA 3VEYA 4BR7A 4H0YB 1R59O 3LL3A 3WQTA 5AQLA 1QZ5A 2ZGYA 4WF9L 2J4RA 3DWLA 5AQPA 3D2EA 3K9KA 3H1VX 5AR0A 4FOIA 4JK9A 4YOXA 1NGIA 4OPHA 3TTCA 3AAPA 2UYTA 4MLEA 4PL7A 3QBXA 4IFEA 4FWRA 4B1XB 3WXIA 4PL8A 4NLBA 1BWFO 2PBDA 3O80A 5AQVA 2FXUA 2FF6A 4IOAL 3W0LA 4JHDA 3ULEB 3E9OA 2QI2A 1YVNA 3CQXA 4PKIA 4CZHA 4GVEA 1YXQA 5H1SQ 5HL7L 3CCJN 4BR5A 3H6EA 3MK6A 1MWKA 3BF3A 4RWTA 1K8KB 3CIPA 3T69A 4FWKA 4M7XA 4IO9L 3M1FA 4BRLA 2YHWA 2D4WA 3ENBA 1U2VB 4JD2A 4JEPA 4M63C 3WQUA 3ZEUB 4EFHA 4Z94A 5M1FA 2PFUA 2QWLA 4GNIA 4WFBL 3WXLA 3QB0A 4WQ4C 3W3DA 3M6GA 2W41A 3OBWA 3UKRB 3NMUA 4H5NA 3GBTA 1SZ2A 2P9NB 1ATNA 5AQTA 3IUCA 4K25A 2P9PB 3HI0A 3QMLA 4WCEL 2IVNA 3U4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBU A;  3VGK A;  5AQF A;  4RTF D;  2P9I A;  1NLV A;  3VER A;  3M3Z A;  2QW9 A;  4BRF A;  4BVO A;  3FZF A;  4BR0 A;  3CJB A;  3ATV A;  4DCH A;  3EKS A;  3IDH A;  2Q31 A;  1HKG A;  4CBX A;  5AFU A;  5EXW A;  3MCP A;  4JNE A;  1YAG A;  3O1B A;  4ISF A;  4H5V A;  2AP1 A;  4XH5 A;  4BQZ A;  3B8A X;  3H1Q A;  1Z6R A;  1NGC A;  4Y0W A;  4BGB A;  3UKU B;  4CZF A;  4CZM A;  5BR9 A;  3CJC A;  1SAZ A;  3MN7 A;  4MLH A;  1G99 A;  3O1W A;  5F1X A;  3O4W A;  4O5F A;  5LJW A;  1HKC A;  2QWR A;  4ISE A;  4CZI A;  4IWV A;  2A5X A;  3MN6 A;  5AQG A;  5F2R A;  1GLB G;  3SMS A;  1NGE A;  3J8A A;  2FF3 B;  2P9K A;  2HF4 A;  3KZB A;  3VEN A;  2IVP A;  1NBW A;  1TYQ B;  4WQ4 A;  2P9U A;  1LCU A;  2FSJ A;  4I6M B;  2WUS A;  3QFU A;  1LOT B;  1SQK A;  3EO3 A;  3ZET A;  3GL1 A;  2QWP A;  1J6Z A;  4BRC A;  1ZBS A;  2AA4 A;  2A3Z A;  4BRK A;  4A61 A;  4YDU C;  3CI5 A;  2P9S B;  4H0O A;  5ELZ A;  3CJA A;  3MMV A;  4BC5 A;  5F0X A;  2Q1N A;  4MO4 A;  3D2F B;  3H3O B;  3LDQ A;  5FPN A;  4LC9 B;  4BRE A;  1GLC G;  3WT0 A;  3FGU A;  5JMV A;  4A2A A;  4B1V A;  4BRI A;  3I8B A;  2CH6 A;  4CZG A;  1T6C A;  2YI1 A;  2FLO A;  1XC3 A;  3IMX A;  4WYB A;  1BUP A;  5AQS A;  5JLH A;  3LDL A;  4FWM A;  5BRH A;  5KPZ A;  3VEX A;  3S41 A;  2A40 A;  4H0T B;  4ISG A;  3WEE A;  4PKH A;  3HM8 A;  1X3N A;  3O5B A;  3A8Y A;  3IFR A;  5AZJ A;  4B1Z A;  3UB5 A;  3EL2 A;  3JS6 A;  3ZX3 A;  4QS8 A;  2Q97 A;  3BP8 A;  4F9O A;  1S3X A;  1E4F T;  5JIC A;  3JXU A;  4RCH A;  5KPR A;  2BTF A;  3GDQ A;  1HX1 A;  2V7Z A;  2BUP A;  4H5T A;  1NGA A;  1WOQ A;  5AQK A;  2YJF A;  2CGL A;  4BG9 A;  5FPM A;  1Q18 A;  1E4G T;  4HTL A;  1GLJ O;  1RGI A;  3U9D A;  1S22 A;  4FWO A;  2FSN A;  1NGJ A;  3ENH A;  4L3Q A;  3WUH A;  2ZF5 O;  3CER A;  4YDU A;  2YJE A;  4IZ9 A;  4A2B A;  3C7N B;  3HSC A;  4FSV A;  4BVP A;  4CD3 A;  3A5L C;  1H1V A;  3VET A;  1QQM A;  3DXM B;  1QQO A;  4JAX A;  1WUA A;  3CHW A;  1KAY A;  1BU6 O;  4A62 A;  5AQI A;  4H03 B;  2ASP A;  1BA1 A;  4O8K A;  4QS7 A;  4BRH A;  1X3M A;  1ATS A;  3SMP A;  1NGD A;  4FWL A;  3RSE A;  1KXP A;  3O08 A;  3WXJ A;  4BRD A;  4BC2 A;  3KHY A;  3FZH A;  4BRP A;  2V7Y A;  4E1J A;  2V52 B;  3CJ1 A;  2IVO A;  3G25 A;  5E26 A;  2ZGZ A;  3L4I A;  2P9L A;  5FPE A;  2QM1 A;  3TU5 A;  5EX5 A;  1EQY A;  3LM2 A;  2E1Z A;  1P8Z A;  3P4I A;  3QBW A;  4FPA A;  1DKG D;  3VF4 A;  1NGG A;  4BQL A;  4H5W A;  3GOI A;  3D2E B;  4XEI A;  1NWK A;  1NMD A;  3VPZ A;  2IIR A;  5BPM A;  3FE1 A;  4AM7 A;  3HTV A;  4M7Y A;  1GLL O;  1MA9 B;  3TPQ A;  4BRG A;  2CH5 A;  1C0F A;  1QZ6 A;  3LDP A;  4FOE A;  1NM1 A;  4JHD B;  4KBO A;  3FZL A;  1NGF A;  2GWK A;  2HOE A;  3DXK A;  3MN9 A;  1KAX A;  2KHO A;  1Y64 A;  3QDK A;  1BG3 A;  5AZI A;  2GWJ A;  2H3G X;  2NLX A;  4QS9 A;  5AQQ A;  2ASM A;  4JD2 B;  1KAZ A;  5AQZ A;  2QWQ A;  4JN4 A;  3FZK A;  4BGA A;  3QIC A;  4K43 A;  1GLE G;  3GE1 A;  3CJ9 A;  1V4S A;  2Q36 A;  2Q0U A;  4EHU A;  2E20 A;  3L0Q A;  1JCG A;  4BC4 A;  5AFU H;  4FWQ A;  5BPL A;  1TUY A;  2D0P A;  3FR0 A;  5AQR A;  3VEO A;  5I9E B;  2YHY A;  5JLF A;  2P9I B;  2OAN A;  5AQO A;  3H45 C;  3AY9 A;  5AQN A;  3CQY A;  4IJA A;  3DJC A;  3ULE A;  4AM6 A;  4BRN A;  2I7N A;  4DQ8 A;  2I7P A;  4B1Y B;  2A42 A;  3VEW A;  1K8K A;  3OHR A;  4IO8 A;  2E8A A;  1U2V A;  3ZEU A;  4K41 A;  4EAH D;  1ZC6 A;  4GY2 B;  3R9P A;  2E2O A;  5EVZ A;  4CZE A;  3H3N O;  4CZJ A;  1XUP O;  2P9P A;  4H0P A;  1C0G A;  4EIA A;  5LJV A;  1BOT O;  3ZX0 A;  3CET A;  1BA0 A;  1GLD G;  5BN9 A;  4CZK A;  3DXK B;  4K42 A;  4CZL A;  2D1K A;  1TUU A;  5LY3 A;  3SLC A;  3A5M C;  2P9K B;  2E2Q A;  3EN9 A;  3I33 A;  4FL9 A;  3HZ6 A;  1T6D A;  2P9U B;  5E84 A;  4CBW A;  3KVG A;  3ZX2 A;  2ASO A;  3R6M A;  5FPD A;  3ZET B;  2Q2R A;  2ITM A;  3SJH A;  4H0V B;  5AQJ A;  3R8E A;  3UKU A;  5AQM A;  2NRH A;  1Z05 A;  3EZW A;  5ADX A;  5EY4 A;  1MWM A;  3D7E O;  1OKJ A;  5BRD A;  3MN5 A;  1GLF O;  2QWM A;  4PKG A;  3DAW A;  2CGJ A;  3A5N C;  3MDQ A;  5KQD A;  3LM9 A;  3QFP A;  4XH1 A;  3UE5 A;  2D0O A;  1YUW A;  1TYQ A;  4CJ7 A;  3F9M A;  2W40 A;  3VGL A;  4I6M A;  3H46 O;  2YHX A;  1D4X A;  1DGK N;  3EKU A;  3WEE B;  1ZXO A;  3AAR A;  5AQX A;  5AZJ B;  1MDU B;  2PAV A;  3L6Q A;  2E88 A;  1X9J A;  1IJJ A;  4BR4 A;  2P9S A;  4BRM A;  4BG8 A;  3VF2 A;  1V4T A;  5BRE A;  1QHA A;  2CGK A;  5BN8 A;  3WXK A;  3SK3 A;  1DEJ A;  4C23 A;  2FSK A;  3D2F A;  3VEV A;  4CD1 A;  5TKY A;  3AAQ A;  4XH4 A;  3A5O C;  1CZA N;  2VCP A;  2E2P A;  4H5R A;  4NO7 A;  1QQN A;  5AQW A;  4BR2 A;  2A6A A;  4WQ5 C;  5ADX H;  2E1Y A;  4BRO A;  1HJO A;  1RDW X;  2QWO A;  4B1W B;  2GEM A;  2VWB A;  3U9Z A;  3VF6 A;  2NZT A;  2QWN A;  5AQH A;  5AQU A;  2YCH A;  1JCF A;  2V51 B;  3VGM A;  1HUX A;  4EHT A;  3O6W A;  2GTD A;  3GG4 A;  1XQS C;  2QXL A;  3LDO A;  1BO5 O;  3A0I X;  5KPT A;  4IXC A;  1NGB A;  5CE3 A;  4FWS A;  3O8M A;  1HLU A;  1HKB A;  3FZM A;  4FWP A;  3U8X A;  3RSE B;  3VOV A;  1ATR A;  4DB3 A;  2HF3 A;  4MO5 A;  4B9Q A;  5EOY A;  2F9T A;  3ATU A;  2P9L B;  5BRF A;  4BR9 A;  3BEX A;  2A41 A;  2ZWH A;  1IG8 A;  1JCE A;  3VEZ A;  4J8F A;  4B1U B;  1BDG A;  3C7N A;  1ESV A;  3UKR A;  4IJN A;  4NB4 A;  3BUZ B;  1NGH A;  3C0B A;  3DXM A;  5KQ8 A;  2DPN A;  2VYP A;  3HBT A;  2P9N A;  3LDN A;  4DHY A;  3VES A;  5B8H A;  5AQY A;  4H0X B;  4BRA A;  3ENO A;  4FPB A;  4BC3 A;  4WQ5 A;  3FLC O;  3FFK B;  4CI6 A;  2F9W A;  1HPM A;  4BRQ A;  2EWS A;  2GEL A;  1U6Z A;  4FO0 A;  4FWN A;  5AZI B;  3ID8 A;  2Q0R A;  3BF1 A;  4HWI A;  1RFQ A;  2HMP A;  1GLA G;  1T44 A;  2GUP A;  3CJ7 A;  5BPN A;  2E2N A;  3VEY A;  4BR7 A;  4H0Y B;  1R59 O;  3LL3 A;  3WQT A;  5AQL A;  1QZ5 A;  2ZGY A;  2J4R A;  3DWL A;  5AQP A;  3D2E A;  3H1V X;  5AR0 A;  4FOI A;  1NGI A;  3AAP A;  2UYT A;  4MLE A;  4PL7 A;  3QBX A;  4FWR A;  4B1X B;  3WXI A;  4PL8 A;  1BWF O;  2PBD A;  3O80 A;  5AQV A;  2FXU A;  2FF6 A;  3W0L A;  4JHD A;  3ULE B;  3CQX A;  1YVN A;  4PKI A;  4CZH A;  1YXQ A;  4BR5 A;  3H6E A;  3MK6 A;  1MWK A;  3BF3 A;  4RWT A;  1K8K B;  3CIP A;  4FWK A;  4M7X A;  3M1F A;  4BRL A;  2YHW A;  2D4W A;  4JD2 A;  1U2V B;  3ZEU B;  4M63 C;  3WQU A;  4Z94 A;  4EFH A;  2QWL A;  4GNI A;  3WXL A;  3QB0 A;  4WQ4 C;  3W3D A;  3M6G A;  2W41 A;  3UKR B;  4H5N A;  3GBT A;  1SZ2 A;  2P9N B;  1ATN A;  5AQT A;  3IUC A;  4K25 A;  2P9P B;  3HI0 A;  3QML A;  2IVN A;  3U4L A; 
#chains in the Genus database with same CATH topology
 4ILH A;  4CBU A;  1RT3 A;  5HRR A;  1NLV A;  3VER A;  3MED A;  4FLT A;  3AA4 A;  2QW9 A;  3TTF A;  4BR0 A;  4KHS A;  3IDH A;  3L8B A;  4F8R A;  3LAL A;  3MCP A;  1J9A A;  4R5P A;  1YAG A;  4E7I A;  1IBM K;  4H5V A;  1UOC A;  1LWF A;  4BQZ A;  3SUN A;  3ALY A;  3K5L A;  3L2W A;  1L3U A;  4ID1 A;  4Y0W A;  3EYZ A;  3VQE A;  3SNN A;  4B9N A;  4CK2 A;  3MN7 A;  3HOS A;  3RMC A;  4CJT A;  3MXM A;  1VQN N;  5LJW A;  4IKF A;  4BDY A;  3HVR A;  2QWR A;  4CZI A;  4IWV A;  3KKS A;  2OTL N;  2ETJ A;  5F2R A;  1GLB G;  2P9K A;  3VEN A;  2FBV A;  1NBW A;  4CJ4 A;  2QKK A;  1OH6 A;  2P9U A;  1SKR A;  4NLC A;  3CCE N;  3VQ5 A;  1I94 K;  3GL1 A;  1GOC A;  2QWP A;  4BRC A;  1ZBS A;  4E3S A;  1XMQ K;  2P1J A;  1QS4 A;  2HBM A;  3HPH A;  3CI5 A;  3O9T A;  2P9S B;  3AVI A;  3SV4 A;  1OH8 A;  4E0D A;  3CJA A;  1OVQ A;  4ZHR A;  3D2F B;  4CEO A;  4M3R A;  1GLC G;  4JRQ A;  2NRX A;  3DM2 A;  5C10 A;  5KRS A;  2HHS A;  1J53 A;  4IEI A;  1JJ2 M;  2Z1G A;  2CH6 A;  3QIO A;  1XC3 A;  3IMX A;  2FBY A;  3OYK A;  4FWM A;  4B9L A;  5KPZ A;  3G0Z A;  3KK2 A;  4ISG A;  3E01 A;  3MAQ A;  5AZJ A;  1UWB A;  3AVH A;  4I2Q A;  4NCG A;  4E7J A;  3EL2 A;  2Q97 A;  3LPU A;  3BP8 A;  5JIC A;  4FLZ A;  3T1Y K;  1YJ9 N;  3K0S A;  1HX1 A;  1NK4 A;  4H5T A;  2IOC A;  5AQK A;  1KQS M;  4XIU A;  3N4P A;  4HTL A;  1GLJ O;  4AH9 A;  1NGJ A;  3WUH A;  2Z1J A;  1VRT A;  4W5N A;  5CYM A;  4YOV A;  3BZC A;  3T1H K;  3C7N B;  3LP0 A;  3A5L C;  4JK8 A;  3P83 D;  5FDL A;  1QQO A;  2IGI A;  3CHW A;  5C24 A;  4A62 A;  3RMB A;  1BA1 A;  3CYM A;  4CHY A;  1X3M A;  1ATS A;  3SMP A;  1SKW A;  3QES A;  1FKP A;  1KXP A;  3O08 A;  3WXJ A;  1XHX A;  4O8U A;  3CCV N;  1S1T A;  1C1C A;  3ISN C;  3KHY A;  3FZH A;  4N5S A;  4B9T A;  4E1J A;  2V52 B;  3CC2 N;  1G15 A;  2YKN A;  4AHT A;  3CCL N;  4DSJ A;  2HVI A;  2E1Z A;  1ASW A;  1P8Z A;  4F4K A;  4M3X A;  3QBW A;  1N32 K;  1I39 A;  2B5J A;  1NGG A;  3GOI A;  4DR7 K;  4LH4 A;  1NMD A;  2Y1I A;  3IRX A;  4M7Y A;  1GLL O;  4BRG A;  4OKE A;  4Z4H A;  3D0P A;  1L5U A;  3VQ7 A;  1LWE A;  4CJS A;  3G10 A;  4CJF A;  4HUE A;  1X1P A;  3VTH A;  3C6A A;  1KAX A;  5FRO A;  3VQ9 A;  3TAP A;  4CGI A;  1S9E A;  4H8K A;  4CHZ A;  5AQZ A;  4PQU A;  3KLE A;  2NRT A;  4E7H A;  1HNW K;  3THY B;  1D9D A;  3V81 A;  2E20 A;  3KWI A;  2HST A;  4BC4 A;  4LF6 K;  5AFU H;  5BPL A;  1JLF A;  3ITH A;  4CEZ A;  3SUQ A;  3VEO A;  1RBV A;  2W42 A;  3DOL A;  1C6V A;  2Q3S A;  5HLF A;  3CCR N;  4CGG A;  1RT5 A;  4B1Y B;  4PWD A;  4OPA A;  1K8K A;  5FRM A;  4DUY K;  2E4L A;  4M3Y A;  4IO8 A;  4IDK A;  1U2V A;  4AHU A;  1HYZ A;  4GY2 B;  3R9P A;  2GUI A;  4CZE A;  4AHV A;  2A1R A;  4JI4 K;  3M8S A;  4KHP K;  1XUP O;  4CEA A;  1NU0 A;  3C6U A;  2HHQ A;  5LY3 A;  4O0I A;  3SBT A;  1WSJ A;  3CCS N;  5BR8 K;  4FL9 A;  3I33 A;  4OJR A;  1YIT N;  4O55 A;  4HUG A;  4CBW A;  3KLH A;  3CFR A;  1FKO A;  3SYZ A;  3L2Q A;  4CEQ A;  4DV3 K;  3ZSW A;  4I2P A;  2NRH A;  1SL2 A;  1WSI A;  1LWC A;  4JI5 K;  4CK1 A;  3MN5 A;  1A5X A;  3VQQ A;  1MU2 A;  3IAY A;  3SUO A;  2G8V A;  1M90 O;  1VQP N;  4ELT A;  4FW1 A;  3QFP A;  2D0C A;  4BE0 A;  3VQD A;  3SAG A;  4DQQ A;  5LL6 Z;  4YOR A;  1IKX A;  3HST B;  3AA2 A;  4F2R A;  3UIQ A;  4HHT A;  3RRG A;  3THW B;  1D4X A;  3AO3 A;  3HP9 A;  3WEE B;  1TKD A;  1RNH A;  4CIE A;  3AAR A;  2OTJ N;  3ZSQ A;  3NGI A;  4DLE A;  3L6Q A;  4IG0 A;  3K2P A;  2P9S A;  4W5Q A;  5BRE A;  5M1P A;  3AVJ A;  1KC8 O;  3D2F A;  4CD1 A;  1NK0 A;  4XH4 A;  3F5T A;  4M45 A;  5AQW A;  4H5R A;  4BR2 A;  1QQN A;  4AQY K;  4M3T A;  1L3S A;  2A6A A;  4GVM A;  2E1Y A;  1VSJ A;  1VSF A;  5SWM A;  4LD0 A;  1UA1 A;  2RKI A;  2VWB A;  1QSL A;  2KTQ A;  2F8T A;  3VF6 A;  1TKX A;  2ZE2 A;  3SQ1 A;  5AQU A;  2YCH A;  3SPY A;  4F3O A;  3J80 O;  1WN7 A;  1VRU A;  3GG4 A;  1Q81 O;  3T1A A;  4FM1 A;  4IOC L;  3PUF A;  1RT2 A;  4RW6 A;  1J54 A;  4E89 A;  4FWS A;  4Z4F A;  1N33 K;  1HKB A;  4DTJ A;  1NK5 A;  3T19 A;  2RE2 A;  4FWP A;  4DR3 K;  3OA9 A;  4MQ3 A;  4ELV A;  4B9Q A;  1DTT A;  2I5J A;  1D5A A;  3VQ4 A;  3KLI A;  4FLV A;  1C0T A;  5T7B A;  2P9L B;  4CHQ A;  2KLA A;  3CME N;  4Y1C A;  2HHW A;  1RTH A;  4FZZ A;  3C7N A;  3HVT A;  1WLJ A;  3BUZ B;  5KQ8 A;  1LW2 A;  5C42 A;  3HBT A;  1NKB A;  2P9N A;  4KFB A;  3VQC A;  3KKR A;  1VK0 A;  2XRI A;  4GV3 A;  3BZK A;  3AO5 A;  5AQY A;  4C1N K;  1FK9 A;  3E9P A;  4CHO A;  2XY7 A;  3ZSV A;  1QVF M;  1BQN A;  3FFK B;  2ZJR L;  3TTD A;  2OPQ A;  1P90 A;  2GEL A;  1U6Z A;  4FO0 A;  4FWN A;  5AZI B;  2O8B A;  5CR4 A;  1BIU A;  1RFQ A;  3FFI A;  1GLA G;  1T44 A;  3EZ5 A;  1VQ7 N;  3CJ7 A;  2P5O A;  1VQK N;  2E2N A;  3LL3 A;  2RPI A;  2ZGY A;  1I3A A;  5AR0 A;  2OYQ A;  4IBN A;  3LDS A;  3TTC A;  3AAP A;  4NCA A;  4EP4 A;  3WXI A;  4PL8 A;  5AQV A;  2FF6 A;  3AV9 A;  4IOA L;  3TAB A;  3VQA A;  3V6D A;  1QSS A;  4Q5V A;  1YXQ A;  1BQM A;  5H1S Q;  3C95 A;  3MK6 A;  3BF3 A;  1CZB A;  4FWK A;  5FRN A;  4CF9 A;  2RF2 A;  2YHW A;  4JEP A;  3ZEU B;  1BHL A;  5M1F A;  4BAC A;  2Z1H A;  4L8R B;  3THY A;  1ZBU A;  2W41 A;  1HR0 K;  3NMU A;  4H5N A;  3GBT A;  3DLG A;  5KGW A;  1KSP A;  3IUC A;  2OA8 A;  1SL0 A;  3OBY A;  5KI6 A;  3VGK A;  3E9L A;  5GIN A;  3M3Z A;  2QXF A;  4HCC A;  5HBM A;  3CJB A;  3C94 A;  4DCH A;  2IS3 A;  4DLG A;  2Q31 A;  5SZT A;  3BDP A;  3OYL A;  5EXW A;  4JNE A;  3QET A;  3PX6 A;  4JKA A;  5C2D A;  4FJX A;  3O1B A;  1DLO A;  4KAZ A;  4XH5 A;  4IFV A;  4J2E A;  4FJK A;  3B8A X;  1X9M A;  3DLL L;  1A5W A;  2KKZ A;  4BGB A;  1W9H A;  3NVK A;  5C25 A;  3CJC A;  3THX B;  1G99 A;  5CYQ A;  1D8Y A;  4DR1 K;  4O5F A;  1RT4 A;  1HKC A;  3PX4 A;  1NK7 A;  1C1A A;  4ISE A;  4U7B A;  5AQG A;  4DQI A;  3SMS A;  2D0B A;  4CGD A;  3KZB A;  1TYQ B;  2OPR A;  5GIO A;  2WUS A;  3QFU A;  4M42 A;  4KB0 A;  3NE6 A;  1GOA A;  4NYN A;  1J6Z A;  2JWK A;  2YKM A;  4BWM A;  4KO0 A;  5J1E A;  1HYS A;  4FZX C;  5M1Q A;  3OYN A;  3CPW M;  4LFA K;  3MMV A;  1EP4 A;  4KH5 A;  3OTO K;  3KLG A;  1C0U A;  2VWK A;  3KWG A;  4O0J A;  3V1R A;  3H3O B;  1T7P A;  1KVB A;  4KTW A;  4LC9 B;  3WT0 A;  3ZT3 A;  1VSL A;  3G6E N;  3WNE A;  3OYM A;  2XHB A;  1EWQ A;  1NOY A;  1CXU A;  4JI0 K;  3S41 A;  2A40 A;  3V9U A;  3WEE A;  2DFF A;  3OYH A;  1RBS A;  3HM8 A;  3SUP A;  3A8Y A;  3IFR A;  3CD6 N;  4OKK A;  1WBD A;  3ZX3 A;  2WBN A;  3MEG A;  4RCH A;  2BTF A;  5HOO A;  3ZLJ A;  2BUP A;  1WOQ A;  4BG9 A;  4BDP A;  2CGL A;  3VQ6 A;  2HVH A;  5FPM A;  1E4G T;  3U9D A;  2FSN A;  3ENH A;  4L3Q A;  1RDA A;  4DTO A;  2ZF5 O;  4FLU A;  3CER A;  1VSK A;  4IZ9 A;  3HSC A;  4BVP A;  5C2F A;  4KI6 A;  1SV5 A;  1H1V A;  4QCL A;  3S3M A;  3OYE A;  1WUA A;  1KAY A;  1BU6 O;  3I56 N;  3AVK A;  3ZSY A;  4BRH A;  4X65 K;  4FWL A;  4BRD A;  4Z4G A;  5AJ3 K;  1JKH A;  4BRP A;  2V7Y A;  5FPE A;  2ZGZ A;  3L4I A;  2P9L A;  4CFD A;  4F3T A;  1ASV A;  3HYF A;  3LM2 A;  4FJ5 A;  1E3M A;  4FPA A;  5J2P A;  1JLE A;  3M8P A;  4H5W A;  4XEI A;  1NWK A;  4Y1D A;  4AM7 A;  3HTV A;  3TPQ A;  1MA9 B;  1FW6 A;  4LF4 K;  4CE9 A;  2E6M A;  1BI4 B;  2WFB A;  1UA0 A;  4JHD B;  3P38 A;  5M1K A;  4KBO A;  4X64 K;  4DV4 K;  3FZL A;  1NGF A;  3MN9 A;  4BE1 A;  3CC7 N;  4FJI A;  1JL1 A;  5AZI A;  4YOW A;  4JI2 K;  3SAF A;  1EXQ A;  3AO1 A;  3I55 N;  2QWQ A;  3QIC A;  3ZSX A;  4K43 A;  2PYJ A;  1T03 A;  3SCX A;  3CJ9 A;  2ZJQ L;  4DFK A;  2G8I A;  3NCI A;  3FR0 A;  3CM5 A;  1RIL A;  3LP1 A;  2OAN A;  3K5M A;  3LPT A;  4FW2 A;  5AQN A;  5M1O A;  3HOT A;  2E6L A;  4JKE A;  5MLC Q;  2VG5 A;  1CZ9 A;  1KLN A;  3QEP A;  3OHR A;  4CFA A;  1DT9 A;  3AVB A;  3WNF A;  1TKT A;  2E8A A;  2BAN A;  3ZEU A;  4K41 A;  4JKC A;  3R3L A;  4UQG A;  3VA0 A;  3LWL A;  3MWT A;  1SS6 A;  3ZSR A;  2UUA K;  4H0P A;  4CEE A;  1C0G A;  1WSE A;  3O4Q A;  4E19 A;  3O3F A;  5LJV A;  1B92 A;  3JSM A;  3CET A;  2O8C B;  1BA0 A;  5BN9 A;  4JI3 K;  3DXK B;  4K42 A;  4G1Q A;  1NMN A;  2D5R A;  1KTQ A;  4O5B A;  2HNZ A;  4CZL A;  4WFA L;  1TUU A;  2ZD1 A;  3SQ0 A;  3D45 A;  2VGN A;  1RBT A;  2ATQ A;  1NOZ A;  3HZ6 A;  4B8A B;  3AVF A;  1BGX T;  1SL1 A;  3KD1 E;  5E84 A;  3U3G A;  4JKH A;  1Z25 A;  4I9Q A;  1FXX A;  3ZET B;  2Q2R A;  2ITM A;  3SJH A;  4H0V B;  3J81 O;  4DTX A;  1RT7 A;  3CCU N;  1XNQ K;  2HBK A;  1LAV A;  4JKD A;  2ZM6 K;  3V9W A;  5ADX A;  2KFN A;  1NNE A;  1RDU A;  1OKJ A;  2ITG A;  5BRD A;  1XI1 A;  4PKG A;  2QWM A;  4A5B A;  1Q7Y O;  3DAW A;  2G8U A;  2CGJ A;  3MDQ A;  5KQD A;  2PZS A;  4Z4E A;  3LM9 A;  1VAZ A;  4XH1 A;  3UE5 A;  4GV9 A;  1S1X A;  2D0O A;  1TYQ A;  1HJR A;  1YIJ N;  3F9M A;  4DTM A;  1OH7 A;  3NF7 A;  1W0H A;  3TR8 A;  4LY7 A;  5FLX O;  1HNI A;  1DGK N;  3DRP A;  1ZXO A;  4YFU A;  4DKW A;  3C6T A;  1RTI A;  1IJJ A;  5GAE P;  3J7Z O;  3C6H A;  4KTQ A;  4FJM A;  1TAQ A;  4ILJ A;  4R79 A;  2CGK A;  5BN8 A;  3SK3 A;  3OW2 M;  1DEJ A;  4C23 A;  3DOK A;  1EWR A;  1RCH A;  2HND A;  1IKY A;  3QEX A;  3TI0 A;  1XHZ A;  3KIO A;  4FVU A;  5LMN K;  3PSF A;  4ILG B;  2E2P A;  5DK5 A;  2UUB K;  4LSL A;  4WQ5 C;  5ADX H;  5E41 A;  4EP5 A;  1TGO A;  1EX4 A;  2QTD A;  2GEM A;  3HK2 A;  3OVN A;  1VSI A;  2HBL A;  2HHH K;  4CJQ A;  4DS4 A;  3PO4 A;  4LF8 K;  3NVM A;  2GTD A;  4GW6 A;  2GV9 A;  3MX2 A;  3PIP L;  2QXL A;  4LF5 K;  1X9W A;  1HLU A;  4CK3 A;  4NYF A;  4OKJ A;  3RSE B;  3VOV A;  1ATR A;  4MO5 A;  5JVH L;  4CJR A;  3ATU A;  3MEE A;  1YT3 A;  3BEX A;  4BR9 A;  2O4G A;  4DSF A;  2JWL A;  2NRV A;  4IDH A;  4DMN A;  4F2S A;  2G8F A;  2RHK A;  1O1W A;  4NCB A;  2W6K A;  3MXI A;  4DV0 K;  1U4B A;  3VQ8 A;  4MDA A;  1NGH A;  1W7A A;  3LDN A;  4DUZ K;  1S1U A;  4WE1 A;  3G4S N;  4FPB A;  3OYF A;  1VSH A;  4WQ5 A;  3FLC O;  3CXC M;  3SQ2 A;  1CLQ A;  4OLB A;  2DFE A;  2YV0 X;  4CJW A;  3DLK A;  3BF1 A;  4HWI A;  4DFM A;  3RWU A;  3V1O A;  2HMP A;  3L2V A;  4B8C A;  2Z1I A;  3DRS A;  3VEY A;  2X78 A;  1R59 O;  1QZ5 A;  2HNY A;  2J4R A;  3DWL A;  3H1V X;  3CFO A;  3CFP A;  1U04 A;  2UU9 K;  3OS1 A;  4FWR A;  1BI4 A;  2FXU A;  1RBR A;  3QEW A;  4JHD A;  3ZT4 A;  2UXC K;  2XY5 A;  1YVN A;  3CQX A;  4GVE A;  3H6E A;  3WNG A;  3NHG A;  4RWT A;  4CCH A;  4X66 K;  4IO9 L;  4M7X A;  3TAM A;  3M1F A;  4BRL A;  1QHT A;  4Z94 A;  4C8O A;  4M63 C;  4J2A A;  4WFB L;  3WXL A;  4WQ4 C;  3W3D A;  3RRH A;  3UKR B;  5JS1 A;  1SZ2 A;  1NJX A;  5AQT A;  3NGZ A;  4K25 A;  4FCY A;  4WCE L;  4DTS A;  1IKV A;  2W6L A;  2OZS A;  4W5R A;  4ZTJ A;  5AQF A;  3CCM N;  3L3U A;  1TK5 A;  1XNR K;  2FBX A;  4BRF A;  4BVO A;  3FZF A;  3ATV A;  3EKS A;  1HKG A;  3HJF A;  2JGU A;  5IT9 O;  4DTU A;  1TL3 A;  3R1X A;  3K5N A;  1S6P A;  1WSG A;  4DV5 K;  3TAF A;  3VTI A;  3H1Q A;  1JLC A;  1Z6R A;  5TKW A;  1RDD A;  1NGC A;  3LZJ A;  3UKU B;  4CZM A;  5BR9 A;  3S9H A;  3SI6 A;  4V19 S;  1SAZ A;  4MLH A;  3U6F A;  3O1W A;  2R7Y A;  5F1X A;  4CJK A;  1IKW A;  3O4W A;  4RW9 A;  3V9Z A;  4CVN E;  2O8C A;  2QEX N;  2A5X A;  4PY5 A;  2D0A A;  3V4I A;  3J8A A;  3AVG A;  4CJE A;  4JYA K;  2FF3 B;  4AHC A;  3VQB A;  4OX9 K;  2IVP A;  4WQ4 A;  1TVR A;  4FJ9 A;  3BY5 A;  2KZZ A;  4CEC A;  1SQK A;  3EO3 A;  3ZET A;  4CGJ A;  4B9S A;  3F73 A;  4CJL A;  3EE9 A;  2AA4 A;  2A3Z A;  4N56 A;  1VQ5 N;  4G9Z A;  4A61 A;  2UXB K;  4YDU C;  3HL8 A;  4H0O A;  1TAU A;  3CC4 N;  1D9F A;  4BC5 A;  2Q1N A;  4MO4 A;  3LDQ A;  5FPN A;  4E1N A;  1TV6 A;  4N41 A;  4OLA A;  3FGU A;  2HBJ A;  2HHX A;  2X74 A;  4A2A A;  1IO2 A;  4BRI A;  3I8B A;  3SJJ A;  4GKJ K;  4WYB A;  1BUP A;  3P5J A;  5JLH A;  1NJZ A;  3LDL A;  1W97 L;  5BRH A;  4BY9 C;  2BGG A;  3WNH A;  4H0T B;  4LSN A;  5CZ1 A;  3AVA A;  4PKH A;  3PIO L;  1RTJ A;  4B1Z A;  5C12 A;  1YI2 N;  3NF9 A;  3JS6 A;  4FJ8 A;  4F9O A;  3Q7C A;  3C65 A;  1S3X A;  1E4F T;  3JXU A;  2NRZ A;  3PV8 A;  2V7Z A;  1BCM A;  4B3S K;  4KH4 A;  3NFA A;  4B9V A;  1U47 A;  2YJF A;  4U67 L;  2YNI A;  3U3Y A;  1Q18 A;  5HRO A;  1K73 O;  1RGI A;  3I0S A;  2A1S A;  1KVC A;  4YHH K;  3K5O A;  5HRP A;  1ZYQ A;  2VGM A;  4YDU A;  4YOU A;  2YJE A;  4A59 A;  3V1Q A;  3QLH A;  4FM0 A;  4A2B A;  1S72 N;  2F7T A;  2B4J A;  4FSV A;  4CD3 A;  4E1M A;  4JKB A;  3EE8 A;  2HHU A;  2VG7 A;  3VET A;  2FBT A;  1TL1 A;  4O8K A;  3AVM A;  4QS7 A;  4JI7 K;  1RT6 A;  3DRR A;  3RSE A;  5DM6 L;  1EKE A;  3VQP A;  4BC2 A;  1NK9 A;  3G25 A;  2IVO A;  5E26 A;  1YF5 L;  2QA4 N;  4YY3 K;  2OPP A;  2QM1 A;  4B3M K;  2KFZ A;  1JXB A;  3ZYY X;  3KLF A;  3P4I A;  4CFC A;  4LF9 K;  1S5J A;  3VPZ A;  5BPM A;  3FE1 A;  2HB5 A;  1VHX A;  1C0F A;  1QZ6 A;  4FOE A;  2O8E B;  2NNW A;  1NM1 A;  3HP6 A;  4CFB A;  2GWK A;  4KV8 A;  1IBL K;  5GAD P;  1NKC A;  4M3W A;  3ULD A;  3L3V A;  1Y64 A;  3QDK A;  1BG3 A;  1S1W A;  5KTQ A;  2GWJ A;  4GMJ B;  2NLX A;  1EO1 A;  4BE2 A;  2ASM A;  4I9L A;  3QER A;  1KD1 O;  2OZM A;  1KAZ A;  4JN4 A;  3FZK A;  4BGA A;  1GLE G;  2VG6 A;  4KI4 A;  3P1G A;  1NK6 A;  1V4S A;  2Q36 A;  5GAG P;  3KTQ A;  4EHU A;  3L0Q A;  1JCG A;  4M41 A;  1TK8 A;  3O3H A;  4FWQ A;  1TUY A;  5M1N A;  5AQR A;  1BL3 A;  5I9E B;  1IG9 A;  2YHY A;  1WBB A;  2P9I B;  3H45 C;  4JI6 K;  3AY9 A;  2EHG A;  3CQY A;  4IJA A;  4AM6 A;  3AVC A;  4OPK A;  3HO1 A;  2I7N A;  3NDK A;  2AJQ A;  4DQ8 A;  1WAF A;  2I7P A;  2A42 A;  3VEW A;  1EET A;  2KQ2 A;  3MWP A;  1ZBI A;  3OYD A;  4DSI A;  1Q9X A;  4DQP A;  5CHI A;  3LWM A;  3AA5 X;  4EAH D;  1RDC A;  2F96 A;  4CF8 A;  4DQR A;  1NG9 A;  1ZC6 A;  5EVZ A;  1RT1 A;  3THW A;  3H3N O;  3AVL A;  4CZJ A;  3M8Q A;  5HRN A;  4EIA A;  1BOT O;  3ZX0 A;  4CJ5 A;  3O3G A;  1N34 K;  2D1K A;  4QAG A;  3SLC A;  3ID6 A;  2YNG A;  3A5M C;  2E2Q A;  3EN9 A;  1N5Y A;  4DTP A;  1T6D A;  1RDB A;  3JAM O;  3DLE A;  1RBU A;  3P39 A;  3J7Y P;  2G8H A;  4CGF A;  3KVG A;  4OPJ A;  4FK4 A;  1LAW A;  4Q0B A;  3R6M A;  1JLG A;  1KRP A;  2ZJP L;  3OJS A;  4MDB A;  3R8E A;  3UKU A;  2LSN A;  3KK7 A;  4DTN A;  1ZBL A;  3EZW A;  3J7A P;  1JLA A;  1NJI O;  1MWM A;  3D7E O;  4DQS A;  4DFJ A;  4W5T A;  4DSE A;  3QEV A;  1GLF O;  4H4M A;  3D6R A;  1WSF A;  1JXE A;  2X6S A;  3TAG A;  3A5N C;  3IS9 A;  4FXD A;  1IBK K;  1IH7 A;  5I3U A;  4CEB A;  4DG1 A;  4DTR A;  3KJV A;  2W40 A;  2NRR A;  3VGL A;  3MXJ A;  1IV0 A;  3VA3 A;  4EZ9 A;  4O44 A;  3B6P A;  5AQX A;  1LV5 A;  2O8F B;  2E88 A;  4BR4 A;  1K9M O;  1SUQ A;  4BG8 A;  5HRS A;  1QHA A;  4C8N A;  3VEV A;  5TKY A;  4WFN L;  3AAQ A;  1BIZ A;  2NUB A;  4FLX A;  1WSH A;  1UAX A;  3TAR A;  4RG8 A;  4K8Z A;  1RTD A;  2UUC K;  4JS4 A;  3ZSZ A;  3TAN A;  3DLR A;  3LP2 A;  2QWO A;  4DU1 A;  1W2B M;  3U9Z A;  2OPS A;  2NZT A;  3AGR A;  4OGE A;  3VGM A;  1HUX A;  4DR6 K;  3SZ2 A;  3CG7 A;  4HUF A;  3AO2 A;  2DY4 A;  5A2Q O;  1CXQ A;  5KPT A;  1NGB A;  1TK0 A;  1QTM A;  2IDO A;  4DF4 A;  1QSY A;  1K8A O;  1NJY A;  3U8X A;  4TSX A;  2BH1 A;  2GX9 A;  1REV A;  4FJ7 A;  2O4I A;  1M1K O;  5BRF A;  3O9S A;  1IG8 A;  4DU4 A;  4I7F A;  3VEZ A;  4J8F A;  3NH1 A;  1BDG A;  3CQ8 A;  3ASM A;  1ESV A;  4OGC A;  2G8W A;  4IEE A;  3LZI A;  4DHY A;  2FC0 A;  4ID5 A;  1QQC A;  5EU7 A;  4BRA A;  3ENO A;  3OYI A;  3OYJ A;  4KTZ A;  1Q9Y A;  4CI6 A;  2F9W A;  3DYA A;  2QKB A;  1VQ9 N;  4CIG A;  4BRQ A;  1BIS A;  3K57 A;  3OYA A;  4JKG B;  3E66 A;  1SKS A;  3NH0 A;  3ID8 A;  2Q0R A;  1NKE A;  3S3N A;  4DR4 K;  3ZT0 A;  2B6A A;  4CER A;  5BPN A;  4JRP A;  4KHN A;  4BR7 A;  4H0Y B;  4C8K A;  5AQL A;  5AQP A;  4AHR A;  1NJW A;  4DR2 K;  4CIF A;  4MLE A;  4NXN K;  4IFE A;  5CY4 A;  3THX A;  4B1X B;  1HYV A;  2O8D B;  4NLB A;  2O8E A;  4CHP A;  2E5L K;  3W0L A;  3ULE B;  3E9O A;  1L3V A;  3HPO A;  3CCJ N;  1U48 A;  4B9M A;  1MWK A;  5J2Q A;  1HPZ A;  4JI1 K;  1X9S A;  5D3G A;  2D4W A;  3F9K A;  2KW4 A;  3WQU A;  3ZT2 A;  4DV7 K;  4J2D A;  3M6G A;  3OBW A;  1Y97 A;  3PSI A;  1YVU A;  2P9N B;  3QIP A;  1A5V A;  2P9P B;  3HI0 A;  3QML A;  4KPY A;  3HM9 A;  4ZTF A;  4DSL A;  2IVN A;  3U4L A;  4HCB A;  4RTF D;  2P9I A;  4LH5 A;  1YJN N;  2YHB A;  1HRH A;  1TKZ A;  4JK7 A;  5HP1 A;  4CBX A;  5AFU A;  2O8B B;  3OYG A;  1VQL N;  1Q82 O;  4DS5 A;  4O4G A;  4ISF A;  2IC3 A;  5JS2 A;  2AP1 A;  4FVM A;  4DF8 A;  3PLA A;  3TSQ A;  3B6O A;  4FJN A;  4FK2 A;  1Z26 A;  1N36 K;  4CZF A;  3QO9 A;  1Q86 O;  2DTU A;  3LAM A;  4C8M A;  1YJW N;  3N4Q A;  3MN6 A;  3ZT1 A;  3TAQ A;  1NGE A;  4PA1 A;  1JLQ A;  2HF4 A;  2DFH A;  4JV5 K;  1LCU A;  2FSJ A;  4I6M B;  1JLB A;  4LFC K;  1ILY A;  3A2F A;  1LOT B;  3HT3 A;  4FK0 A;  3RMA A;  4QOZ B;  1VQ8 N;  1BCO A;  1KLM A;  3Q7B A;  4NXM K;  4BRK A;  4Z4C A;  4FJJ A;  4DWI A;  5ELZ A;  1L3T A;  5F0X A;  4B3T K;  1YTU A;  4BRE A;  3OY9 A;  4CF1 A;  5JMV A;  4B1V A;  3OS0 A;  1KFD A;  3NF8 A;  4CZG A;  1T6C A;  2WON A;  5KRT A;  2YI1 A;  2FLO A;  4JI8 K;  3MX5 A;  4DU3 A;  5AQS A;  1FJG K;  1J5O A;  4OO1 J;  3VEX A;  4BWJ A;  1X3N A;  3O5B A;  4JKF A;  3SAH A;  3BGR A;  2O8F A;  3UB5 A;  3E1Y A;  4QS8 A;  2QK9 A;  5KGX A;  4RW4 A;  3M8R A;  1OVY A;  4X62 K;  4ICL A;  1ITG A;  5KPR A;  3GDQ A;  4EZ6 A;  3EEQ A;  4A57 A;  3CF5 L;  2PYL A;  1NGA A;  5GIP A;  1N6Q A;  1KCF A;  1S22 A;  4FWO A;  3DLH A;  4DR5 K;  4FLY A;  3KK3 A;  5CZ2 A;  4DSK A;  1VSE A;  1S6Q A;  2G8K A;  1QQM A;  4JLH A;  3DXM B;  4E7K A;  3K59 A;  4JAX A;  3WXM B;  5AQI A;  4H03 B;  3TSP A;  3OYC A;  2ASP A;  2HHV A;  4PUO A;  4IOX A;  3TSU A;  2VQE K;  2XY8 A;  2XY6 A;  4B9U A;  1NGD A;  1OH5 A;  3QIN A;  3CJ1 A;  1T05 A;  4CJU A;  4KH6 A;  3RVC A;  3TU5 A;  1YHQ N;  4DV2 K;  5EX5 A;  1EQY A;  3MCA B;  4CW7 B;  1DKG D;  3VF4 A;  4BQL A;  2XO7 A;  1HNZ K;  3D2E B;  4B3O A;  1C1B A;  4KHQ A;  2IIR A;  1ZBH A;  4YOY A;  2F4V K;  1GOB A;  2CH5 A;  3LDP A;  1F21 A;  1O13 A;  4CEF A;  3O9Q A;  4J2B A;  1N8R O;  4HVJ A;  4LFB K;  2HOE A;  1XWL A;  2WOM A;  3DXK A;  1B9F A;  1WNS A;  3IG1 A;  2KHO A;  4ELU A;  4CED A;  4JKG A;  4KB1 A;  3OYB A;  2H3G X;  4QS9 A;  5AQQ A;  3EY1 A;  4A5A A;  4W5O A;  1U45 A;  3PO5 A;  4JD2 B;  4CJV A;  4K8X A;  2KZM A;  2VQF K;  2RN2 A;  4N76 A;  3GE1 A;  3NBP A;  2Q0U A;  1J5E K;  4M3Z A;  1ASU A;  2D0P A;  2O8D A;  5JLF A;  5AQO A;  3ULE A;  3DJC A;  4BRN A;  2VWJ A;  3VMF B;  3L4Q A;  2P51 A;  3K9J A;  2YX6 A;  1NK8 A;  2YNH A;  4IFY A;  3VN5 A;  2WTU A;  3CMA N;  4CGH A;  4CJ3 A;  5DM7 L;  2E2O A;  3THV A;  1T3V A;  2BDP A;  3NAE A;  4Z0U A;  5C0Y A;  2P9P A;  5LMU K;  4FYD A;  4YOT A;  1VQO N;  3M5R A;  3S3O A;  3F2K A;  1GLD G;  4CZK A;  5GAH P;  4C1N I;  3T7Z A;  4FJG A;  2NRW A;  3SQ4 A;  4M3U A;  5IWA K;  2P9K B;  1KVA A;  3NF6 A;  2P9U B;  3ZX2 A;  2ASO A;  4BDZ A;  4CF0 A;  5J2M A;  3O9R A;  4UY8 O;  1U49 A;  4B3R K;  5FPD A;  3HPG A;  5AQJ A;  2EX3 A;  5AQM A;  1Z05 A;  1WB9 A;  2PY5 A;  5EY4 A;  3TWH A;  1HMV A;  3DLB A;  4LF7 K;  4CHN A;  4KKO A;  3PX0 A;  1QE1 A;  4CES A;  1XMO K;  4KRF A;  3V9S A;  3JYT A;  1VQM N;  3O4N A;  1HQU A;  1VSD A;  5K14 A;  3O9U A;  2GBZ A;  3G71 N;  4FM2 A;  4Z4I A;  1YUW A;  3LP3 A;  4FLW A;  5I42 A;  4CJ7 A;  4GV6 A;  3I8D A;  3CCQ N;  2Y1J A;  4I6M A;  3H46 O;  4GKK K;  2YHX A;  3SBG A;  3V9X A;  3AGK A;  3EKU A;  3LAN A;  5AZJ B;  1MDU B;  2PAV A;  1X9J A;  1B9D A;  4N47 A;  4BRM A;  4AF1 A;  1WAJ A;  3VF2 A;  1V4T A;  1S1V A;  3WXK A;  3SPZ A;  2FSK A;  4E7L A;  3L2R A;  3A5O C;  3LAK A;  3NGY A;  3ZCM A;  3KD5 E;  1CZA N;  2VCP A;  4NO7 A;  1VQ6 N;  4BRO A;  3DI6 A;  3SV3 A;  1HJO A;  1HNX K;  1RDW X;  3DMJ A;  4B1W B;  4H4O A;  1KFS A;  2QWN A;  5AQH A;  4CJP A;  3HXM A;  1JCF A;  1ZBF A;  2V51 B;  3RMD A;  4FZY A;  4C8L A;  4EHT A;  3O6W A;  4IG3 A;  1XQS C;  3LDO A;  1BO5 O;  3A0I X;  3AVN A;  4IXC A;  4FJH A;  5CE3 A;  4KRE A;  2HMI A;  3O8M A;  3HRG A;  3KK1 A;  2P5G A;  3FZM A;  3RR7 A;  4MFB A;  4DB3 A;  4CF2 A;  3H08 A;  1VQ4 N;  2HF3 A;  4DV6 K;  5EOY A;  1JL2 A;  2UXD K;  2F9T A;  3K58 A;  4RW8 A;  2A41 A;  2WC9 A;  4HTU A;  2ZWH A;  3MEC A;  4KHW A;  1JCE A;  4OVL A;  1QVG M;  1R0A A;  1K6Y A;  1YTA A;  3PY8 A;  3P31 A;  4B1U B;  3RTV A;  3TAE A;  5C15 A;  3IKM A;  3UKR A;  4KHU A;  2X6N A;  4IJN A;  4NB4 A;  4JS5 A;  1T8E A;  3RR8 A;  4B08 A;  3C0B A;  3DXM A;  3OS2 A;  4PHT X;  2DPN A;  2VYP A;  4K0K K;  3CPE A;  3VES A;  5B8H A;  3QNO A;  3QEI A;  3T3F A;  4H0X B;  5JVG L;  2ZQB A;  4BC3 A;  1DTQ A;  1HNV A;  5J2N A;  1HPM A;  2EWS A;  3NH2 A;  4KHY A;  2HW3 A;  2IAJ A;  2GUP A;  3ZSO A;  3CM6 A;  3WQT A;  2YNF A;  4WF9 L;  4YNQ A;  4AIL C;  3D2E A;  3K9K A;  4FOI A;  4JK9 A;  4YOX A;  1NGI A;  4OPH A;  2YHA A;  4RW7 A;  3AA3 A;  5DMR A;  2UYT A;  4PL7 A;  3QBX A;  3QNN A;  3I0R A;  1BWF O;  2PBD A;  3O80 A;  2F8S A;  1XC9 A;  2QI2 A;  4DV1 K;  1VSM A;  4PKI A;  1HQE A;  4CZH A;  5HL7 L;  4BR5 A;  2JLE A;  1K8K B;  3CIP A;  3T69 A;  4FJL A;  4JD2 A;  3ENB A;  1U2V B;  2OCE A;  4EFH A;  1C0M A;  2PFU A;  2QWL A;  4GNI A;  2HHT A;  3QB0 A;  1Q8I A;  4AHS A;  3AO4 A;  1ATN A;  2BE2 A;  1S9G A;  3L2U A;  3OJU A;  4DFP A;  1LW0 A; 
#chains in the Genus database with same CATH homology
 4ILH A;  3OBY A;  4CBU A;  3VGK A;  5AQF A;  4RTF D;  3E9L A;  5GIN A;  2P9I A;  1NLV A;  3CCM N;  3VER A;  3M3Z A;  1YJN N;  2QW9 A;  4BRF A;  4BVO A;  3FZF A;  3TTF A;  3CJB A;  3ATV A;  4BR0 A;  4DCH A;  3EKS A;  3IDH A;  4JK7 A;  2Q31 A;  1HKG A;  4CBX A;  5AFU A;  5EXW A;  3MCP A;  4JNE A;  1VQL N;  1YAG A;  4JKA A;  1Q82 O;  5C2D A;  3O1B A;  4ISF A;  4H5V A;  3R1X A;  2AP1 A;  4XH5 A;  4BQZ A;  3B8A X;  3DLL L;  3VTI A;  3H1Q A;  3PLA A;  5TKW A;  1Z6R A;  3TSQ A;  2KKZ A;  1NGC A;  4Y0W A;  4BGB A;  3UKU B;  4CZF A;  4CZM A;  5BR9 A;  3NVK A;  3CJC A;  1SAZ A;  3MN7 A;  4MLH A;  1G99 A;  1Q86 O;  3O1W A;  3HOS A;  5F1X A;  3O4W A;  4O5F A;  5LJW A;  1VQN N;  1YJW N;  1HKC A;  2QWR A;  3N4Q A;  4ISE A;  4CZI A;  4IWV A;  2OTL N;  2QEX N;  2A5X A;  3MN6 A;  4U7B A;  5AQG A;  5F2R A;  1GLB G;  3SMS A;  1NGE A;  3J8A A;  2FF3 B;  2P9K A;  2HF4 A;  3KZB A;  3VEN A;  2IVP A;  1NBW A;  1TYQ B;  4WQ4 A;  2P9U A;  5GIO A;  1LCU A;  2FSJ A;  4I6M B;  2WUS A;  1ILY A;  3QFU A;  1LOT B;  1SQK A;  3EO3 A;  3ZET A;  4NLC A;  1VQ8 N;  3CCE N;  3GL1 A;  2QWP A;  1J6Z A;  2JWK A;  4BRC A;  1ZBS A;  3Q7B A;  3EE9 A;  2AA4 A;  2A3Z A;  4BRK A;  1VQ5 N;  4G9Z A;  2HBM A;  4A61 A;  5M1Q A;  4YDU C;  3CI5 A;  3O9T A;  2P9S B;  4H0O A;  5ELZ A;  3CPW M;  3CJA A;  3MMV A;  4KH5 A;  3CC4 N;  4BC5 A;  5F0X A;  2Q1N A;  3KWG A;  4MO4 A;  3D2F B;  3H3O B;  3LDQ A;  5FPN A;  4LC9 B;  4BRE A;  1GLC G;  3WT0 A;  3FGU A;  2HBJ A;  5JMV A;  2NRX A;  4A2A A;  5C10 A;  4B1V A;  4IEI A;  1JJ2 M;  4BRI A;  3G6E N;  3I8B A;  2CH6 A;  4CZG A;  1T6C A;  2YI1 A;  2FLO A;  1XC3 A;  3IMX A;  3MX5 A;  4WYB A;  3CC2 N;  1BUP A;  5AQS A;  5JLH A;  3LDL A;  1W97 L;  4FWM A;  5BRH A;  4BY9 C;  5KPZ A;  3VEX A;  4OO1 J;  3S41 A;  2A40 A;  4H0T B;  4ISG A;  3WEE A;  4PKH A;  3HM8 A;  1X3N A;  3O5B A;  3A8Y A;  3IFR A;  4JKF A;  3PIO L;  5AZJ A;  3SAH A;  3CD6 N;  4B1Z A;  5C12 A;  3UB5 A;  1YI2 N;  3E1Y A;  3EL2 A;  3JS6 A;  3ZX3 A;  2WBN A;  4QS8 A;  2Q97 A;  3BP8 A;  4F9O A;  3Q7C A;  3C65 A;  1S3X A;  1E4F T;  1OVY A;  3JXU A;  5JIC A;  1YJ9 N;  2NRZ A;  4RCH A;  2BTF A;  5KPR A;  3GDQ A;  1HX1 A;  2V7Z A;  5HOO A;  4A57 A;  4KH4 A;  2BUP A;  4H5T A;  3CF5 L;  1NGA A;  1WOQ A;  5AQK A;  2YJF A;  2CGL A;  4BG9 A;  4U67 L;  1KQS M;  3N4P A;  5FPM A;  1Q18 A;  1E4G T;  4HTL A;  1GLJ O;  1RGI A;  3U9D A;  5GIP A;  1K73 O;  1S22 A;  4FWO A;  2FSN A;  1NGJ A;  3ENH A;  4L3Q A;  3WUH A;  2ZF5 O;  2VGM A;  3CER A;  4YOV A;  4YDU A;  4YOU A;  2YJE A;  4A59 A;  4IZ9 A;  4A2B A;  1S72 N;  2F7T A;  3C7N B;  3HSC A;  4FSV A;  4BVP A;  4CD3 A;  5C2F A;  3A5L C;  4JK8 A;  4JKB A;  3EE8 A;  1H1V A;  3VET A;  1QQM A;  3DXM B;  1QQO A;  4JAX A;  1WUA A;  3CHW A;  3WXM B;  1KAY A;  1BU6 O;  4A62 A;  5AQI A;  4H03 B;  3TSP A;  2ASP A;  3I56 N;  4IOX A;  3TSU A;  1BA1 A;  4O8K A;  4QS7 A;  4BRH A;  1X3M A;  1ATS A;  3SMP A;  1NGD A;  4FWL A;  3RSE A;  1KXP A;  3O08 A;  3WXJ A;  4BRD A;  5DM6 L;  4O8U A;  3CCV N;  4BC2 A;  3KHY A;  3FZH A;  4BRP A;  2V7Y A;  4E1J A;  2V52 B;  3CJ1 A;  2IVO A;  3G25 A;  1YF5 L;  2ZGZ A;  3L4I A;  2P9L A;  5E26 A;  4KH6 A;  5FPE A;  2QA4 N;  3RVC A;  2QM1 A;  3TU5 A;  1YHQ N;  3CCL N;  5EX5 A;  1EQY A;  3LM2 A;  2E1Z A;  3MCA B;  3ZYY X;  1P8Z A;  3P4I A;  3QBW A;  4FPA A;  1DKG D;  3VF4 A;  1NGG A;  4BQL A;  4H5W A;  3GOI A;  3D2E B;  4XEI A;  1NWK A;  1NMD A;  3VPZ A;  2IIR A;  5BPM A;  3FE1 A;  4AM7 A;  4YOY A;  3HTV A;  4M7Y A;  1GLL O;  1MA9 B;  3TPQ A;  4BRG A;  2CH5 A;  1C0F A;  1QZ6 A;  3LDP A;  4FOE A;  2NNW A;  1O13 A;  1NM1 A;  2WFB A;  3O9Q A;  1N8R O;  4JHD B;  3P38 A;  5M1K A;  4KBO A;  3VTH A;  3FZL A;  1NGF A;  2GWK A;  2HOE A;  3DXK A;  5GAD P;  3MN9 A;  3C6A A;  1KAX A;  2KHO A;  3CC7 N;  1Y64 A;  3QDK A;  1BG3 A;  4JKG A;  5AZI A;  4YOW A;  3SAF A;  2GWJ A;  2H3G X;  2NLX A;  4QS9 A;  5AQQ A;  1EO1 A;  4A5A A;  2ASM A;  3I55 N;  4JD2 B;  1KD1 O;  1KAZ A;  5AQZ A;  2QWQ A;  4JN4 A;  3FZK A;  4BGA A;  3QIC A;  2NRT A;  4K43 A;  1GLE G;  3GE1 A;  3CJ9 A;  2ZJQ L;  1V4S A;  2Q36 A;  5GAG P;  2Q0U A;  4EHU A;  2E20 A;  3KWI A;  1JCG A;  3L0Q A;  2HST A;  4BC4 A;  5AFU H;  4FWQ A;  5BPL A;  1TUY A;  2D0P A;  3FR0 A;  5M1N A;  5AQR A;  3VEO A;  5I9E B;  2YHY A;  5JLF A;  2P9I B;  2OAN A;  5AQO A;  3H45 C;  3AY9 A;  5AQN A;  3CQY A;  4IJA A;  3DJC A;  5M1O A;  3ULE A;  4AM6 A;  4BRN A;  3HOT A;  5MLC Q;  4JKE A;  3VMF B;  3CCR N;  3L4Q A;  2I7N A;  4DQ8 A;  3K9J A;  2I7P A;  4B1Y B;  2A42 A;  3VEW A;  4OPA A;  1K8K A;  2YX6 A;  3OHR A;  1DT9 A;  3MWP A;  4IO8 A;  5CHI A;  2E8A A;  1U2V A;  3ZEU A;  4K41 A;  4EAH D;  4JKC A;  3CMA N;  3R3L A;  1ZC6 A;  4GY2 B;  5DM7 L;  3R9P A;  2E2O A;  5EVZ A;  4CZE A;  3MWT A;  1T3V A;  3H3N O;  1SS6 A;  4CZJ A;  1XUP O;  5C0Y A;  2P9P A;  4H0P A;  1C0G A;  4YOT A;  4EIA A;  1VQO N;  3M5R A;  5LJV A;  1BOT O;  3ZX0 A;  3CET A;  3F2K A;  1BA0 A;  1GLD G;  5BN9 A;  4CZK A;  3DXK B;  4K42 A;  4WFA L;  4CZL A;  5GAH P;  4C1N I;  2D1K A;  1TUU A;  3T7Z A;  5LY3 A;  3SBT A;  2NRW A;  3SLC A;  3ID6 A;  3CCS N;  2VGN A;  3A5M C;  2P9K B;  2E2Q A;  3EN9 A;  3I33 A;  4FL9 A;  3HZ6 A;  1YIT N;  1T6D A;  3P39 A;  2P9U B;  5E84 A;  4CBW A;  3KVG A;  3ZX2 A;  2ASO A;  4JKH A;  3R6M A;  3O9R A;  4UY8 O;  5FPD A;  3ZET B;  2Q2R A;  2ITM A;  3SJH A;  4H0V B;  2ZJP L;  4MDB A;  5AQJ A;  3R8E A;  3UKU A;  5AQM A;  3CCU N;  2NRH A;  3KK7 A;  1Z05 A;  2HBK A;  4JKD A;  3EZW A;  5ADX A;  5EY4 A;  1NJI O;  1MWM A;  1RDU A;  3D7E O;  1OKJ A;  5BRD A;  3MN5 A;  1GLF O;  2QWM A;  4PKG A;  4A5B A;  3D6R A;  1Q7Y O;  3DAW A;  1VQM N;  2CGJ A;  3A5N C;  1M90 O;  1VQP N;  3MDQ A;  5KQD A;  3LM9 A;  1VAZ A;  3O9U A;  3QFP A;  3G71 N;  4XH1 A;  3UE5 A;  4GV9 A;  2D0O A;  1YUW A;  3SAG A;  1TYQ A;  4CJ7 A;  3F9M A;  1YIJ N;  2W40 A;  2NRR A;  3CCQ N;  3VGL A;  4YOR A;  4I6M A;  3H46 O;  4GV6 A;  2YHX A;  3SBG A;  3AGK A;  1D4X A;  1DGK N;  3EKU A;  3WEE B;  1ZXO A;  3AAR A;  2OTJ N;  5AQX A;  5AZJ B;  4DKW A;  1MDU B;  2PAV A;  3L6Q A;  2E88 A;  1X9J A;  1IJJ A;  4BR4 A;  5GAE P;  1K9M O;  3J7Z O;  2P9S A;  3C6H A;  4BG8 A;  4AF1 A;  3VF2 A;  4BRM A;  1V4T A;  5BRE A;  1QHA A;  4ILJ A;  2CGK A;  5M1P A;  5BN8 A;  4R79 A;  3WXK A;  3SK3 A;  3OW2 M;  1KC8 O;  1DEJ A;  4C23 A;  2FSK A;  3D2F A;  3VEV A;  4CD1 A;  5TKY A;  4WFN L;  3AAQ A;  4XH4 A;  3A5O C;  4FVU A;  3F5T A;  4ILG B;  1CZA N;  2VCP A;  2E2P A;  4H5R A;  4NO7 A;  1QQN A;  5AQW A;  4BR2 A;  1VQ6 N;  2A6A A;  4WQ5 C;  5ADX H;  2E1Y A;  4BRO A;  1HJO A;  1RDW X;  2QTD A;  2QWO A;  4B1W B;  2GEM A;  2VWB A;  1W2B M;  3U9Z A;  3VF6 A;  2NZT A;  2QWN A;  5AQH A;  2HBL A;  3AGR A;  5AQU A;  2YCH A;  1JCF A;  2V51 B;  3VGM A;  1HUX A;  4EHT A;  3O6W A;  3NVM A;  2GTD A;  3GG4 A;  3MX2 A;  3PIP L;  1Q81 O;  1XQS C;  2QXL A;  3LDO A;  1BO5 O;  3A0I X;  4IOC L;  5KPT A;  4IXC A;  1NGB A;  5CE3 A;  4FWS A;  3O8M A;  1HLU A;  1HKB A;  3HRG A;  3FZM A;  2RE2 A;  1K8A O;  4FWP A;  3OA9 A;  3RSE B;  3U8X A;  2BH1 A;  3VOV A;  1ATR A;  4DB3 A;  2GX9 A;  1VQ4 N;  2HF3 A;  4MO5 A;  4B9Q A;  5EOY A;  5JVH L;  2F9T A;  1M1K O;  3ATU A;  2P9L B;  5BRF A;  2KLA A;  4BR9 A;  3BEX A;  3CME N;  2A41 A;  2WC9 A;  2JWL A;  2NRV A;  2ZWH A;  4IDH A;  3O9S A;  1IG8 A;  1JCE A;  1QVG M;  3VEZ A;  4J8F A;  2RHK A;  3P31 A;  4B1U B;  1BDG A;  3C7N A;  1ESV A;  5C15 A;  3IKM A;  3UKR A;  4IJN A;  4MDA A;  4NB4 A;  3BUZ B;  3C0B A;  1NGH A;  3DXM A;  4PHT X;  2DPN A;  2VYP A;  3HBT A;  2P9N A;  4IEE A;  5KQ8 A;  3LDN A;  4GV3 A;  3CPE A;  4DHY A;  3VES A;  5B8H A;  5AQY A;  4H0X B;  4BRA A;  3ENO A;  4C1N K;  4FPB A;  3G4S N;  3E9P A;  4BC3 A;  5JVG L;  4WQ5 A;  3CXC M;  3FLC O;  1QVF M;  3FFK B;  4CI6 A;  2ZJR L;  2F9W A;  1VQ9 N;  3TTD A;  1HPM A;  4BRQ A;  2EWS A;  1P90 A;  2GEL A;  1U6Z A;  4FO0 A;  3E66 A;  4FWN A;  4JKG B;  5AZI B;  3ID8 A;  2Q0R A;  3BF1 A;  4HWI A;  5CR4 A;  1RFQ A;  2HMP A;  1GLA G;  1T44 A;  2GUP A;  1VQ7 N;  3CJ7 A;  5BPN A;  1VQK N;  2E2N A;  3VEY A;  4BR7 A;  4H0Y B;  1R59 O;  3LL3 A;  3WQT A;  5AQL A;  1QZ5 A;  2ZGY A;  4WF9 L;  2J4R A;  3DWL A;  5AQP A;  3D2E A;  3K9K A;  3H1V X;  5AR0 A;  4FOI A;  4JK9 A;  4YOX A;  1NGI A;  4OPH A;  3TTC A;  3AAP A;  2UYT A;  4MLE A;  4PL7 A;  3QBX A;  4IFE A;  4FWR A;  4B1X B;  3WXI A;  4PL8 A;  4NLB A;  1BWF O;  2PBD A;  3O80 A;  5AQV A;  2FXU A;  2FF6 A;  4IOA L;  3W0L A;  4JHD A;  3ULE B;  3E9O A;  2QI2 A;  1YVN A;  3CQX A;  4PKI A;  4CZH A;  4GVE A;  1YXQ A;  5H1S Q;  5HL7 L;  3CCJ N;  4BR5 A;  3H6E A;  3MK6 A;  1MWK A;  3BF3 A;  4RWT A;  1K8K B;  3CIP A;  3T69 A;  4FWK A;  4M7X A;  4IO9 L;  3M1F A;  4BRL A;  2YHW A;  2D4W A;  3ENB A;  1U2V B;  4JD2 A;  4JEP A;  4M63 C;  3WQU A;  3ZEU B;  4EFH A;  4Z94 A;  5M1F A;  2PFU A;  2QWL A;  4GNI A;  4WFB L;  3WXL A;  3QB0 A;  4WQ4 C;  3W3D A;  3M6G A;  2W41 A;  3OBW A;  3UKR B;  3NMU A;  4H5N A;  3GBT A;  1SZ2 A;  2P9N B;  1ATN A;  5AQT A;  3IUC A;  4K25 A;  2P9P B;  3HI0 A;  3QML A;  4WCE L;  2IVN A;  3U4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...