5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
4N76A 4I9QA 1RT4B 3SFUA 3SZ2A 1S6PA 4ZMMA 4CIGA 3MR2A 2C2RA 1TGOA 2ATQA 5DLFA 1EP4A 3RMBA 1C0TA 4CF1A 4HUGA 4TSXA 3LANA 4DTRA 4CCHA 2DFEA 3OYEA 1JLBA 1LW2A 3HPOA 2P5OA 4Q44A 1NJWA 3H08A 4IG3A 3ZT4A 1KCFA 4DQPA 4RW4B 4FCYA 3GYNA 2JEGA 1KFSA 5CZ2A 3KNAA 3O3HA 3MR6A 4LH4A 1GOCA 5F9LA 3P5JA 3HVAA 1JLAA 1I39A 4OLBA 1RT7A 3MEGA 5KFKA 1MMLA 1JKHA 3JYTA 1BIUA 3IG1B 4FK4A 4RZRA 1RA6A 4HTUA 4NLOA 4CJ5A 1BQMB 1WSFA 1S97A 4TY8B 2RPIA 3C6UA 2V4RA 1HQUA 3NF7A 1RTDA 3KHGA 1L3VA 4B9SA 4IFVB 2IS3A 3NBPB 1S48A 4R8UA 4IRKA 4XPCA 3ZSYA 1S6QA 3ZSVA 4NLPA 2PZSA 2YNIA 4TLRA 1ZETA 1XHZA 2G8WA 4F8RA 2ZE2B 2XGQA 3CFOA 1KLMA 3V1OA 3CIZA 3QEVA 3JSMB 2GUIA 1WAJA 5KG6A 3OS2A 2ASLA 3KK3B 4OGCA 2YNGB 1VSFA 1HMVB 2W7PA 2OZSA 1N56A 5J2NA 4ID1A 2F8EX 4KO0B 3IS9A 4DTUA 4PQUA 3SQ1A 2WB4A 3SNNA 4NCGA 1TL3B 4KHRA 4DQQA 3VQ9A 3WNHA 1NOYA 4KTQA 1S1VB 4FJ8A 4Z4GA 5KFUA 1T7PA 1A5VA 4ZP8A 3MR3A 3CDEA 3V9XA 3AVGA 3D5MA 4K4XA 3KLGB 3ZSQA 1N4LA 3KLHB 3MAQA 3UR0A 4OPJA 3VA3A 4DLEA 1W9HA 4YMEA 4B9LA 3PV8A 4J9SA 4JS4A 3HPHA 3M8QB 4FLUA 1FK9A 4O44B 4GW6A 4DG1A 4CERA 3DLKB 4FJLA 1IM4A 4DEZA 1RCHA 3B6OA 4O3PA 3HK2A 4CEFA 4KAIA 2Z1JA 2R2SA 3OYLA 2I5JA 4NLUA 4ECWA 1WNEA 3VQ4A 4M3UA 4HCBA 2RKIA 4I2QB 4C8LA 2W42A 3EZUA 1LWEA 5KFOA 3M8PB 1WLJA 4KHYA 4IRCA 3ICLA 4ICLB 4ED6A 3VQ7A 3CO9A 4H4OB 1L3TA 4YR2A 3F73A 1RT2A 3H4BA 3IRXA 4QWEA 4FK2A 2B6AB 3QEWA 4HKQA 2OPQA 3SUOA 4IDKB 5KT5A 4NYZA 1VSJA 1TK5A 3OVNA 4Y2AA 3O4QA 1SL1A 5KFPA 5L1LA 4Y1DA 1JL1A 1GX6A 4MIAA 3O3GA 2JEFA 1HPZB 4K4VA 3LDSA 1IKVB 1VRUB 3QINA 2QXFA 3RRGA 4RU9A 2CKWA 1YTAA 4RW7A 3OHBA 3KLFB 1KVAA 2B43A 1ITGA 1YTUA 1TVRB 2Z1IA 4DL5A 5KT4A 3Q8SB 2FBXA 4JV0A 5KFQA 3C94A 3NGYA 4ECUA 3HP6A 2OPPB 1XI1A 3BSOA 3OYBA 4FLZA 3V9UA 3PZPA 2UVRA 3S3OA 1S1XA 1R0AB 5JUMA 3PX4A 3MEDB 1TAQA 2GIQA 3H5YA 4AHTA 3T5JA 3UIQA 2HHTA 3OL9A 3LP0A 4EO8A 4OGEA 1NJYA 3NH0A 4LSLB 2UVUA 1KLNA 2BQUA 4ED3A 3PJXA 5HBMB 4LQ9A 3V1RA 4QW8A 4C8OA 3AA3A 3SJJA 2RN2A 2W9BA 1D8YA 4ECVA 4E7IA 1JIHA 1RDRA 4WYLA 4ECQA 2XY8A 5C24B 3AVKA 4CJWA 4CIEA 4DL7A 4LSNB 1IKYB 1FKOA 2R8HA 3RBEA 5F9NA 4F4KA 1SH2A 4OKEA 3QIPB 3CFRA 4GC6A 3QEPA 3AVFA 1TAUA 3I5CA 4DFKA 4KI6A 3KD1E 2FVSA 1HQEA 3DLEB 3IAYA 1DTTA 1JXLA 4CFCA 2W8LA 3KKSA 3V6KA 4F3OA 5KFHA 4CEZA 1LWFB 2DTUA 3V81A 1QS4A 4NLQA 4ED2A 1DLOA 2IAJA 5J2MA 1T3NA 2XC9A 4FJ7A 3GILA 4CJFA 1C1BA 4I2PB 3GIJA 2HAIA 3AO1A 3BSAA 2YKMA 5CYMB 4MFBA 1D9FA 4O0IA 1S10A 1S1TA 5JXSA 1RDDA 1N5YA 4E7HA 5KGXA 4JV2A 4DMNA 4DTSA 1VSHA 4M42A 4YP3A 5DGBA 1RT6B 1F21A 4DL3A 3RB6A 1JLCA 4TYAA 1T03B 2WONA 4KB1A 3NE6A 1IKXB 3MFIA 4GC7A 4I7FA 3T19A 4KB7A 4E0DA 3DRSB 3CJ0A 3PX6A 1WAFA 1SKRA 4E3SA 4NZ0A 1CSJA 5KFGA 1WSJA 1FXXA 3PO5A 1RTJB 4DL6A 3D28A 3HKWA 1U48A 4EBCA 4NRTA 3CYMA 3ASMA 4NLGA 4M3ZA 1KFDA 2YNFA 5HRPA 1X9SA 1ZTWA 1LW0A 4B8CA 3KIOA 3VQ8A 3OLAA 2Z1GA 3VQAA 4DL2A 3KLVA 3M8RA 2GC8A 1VRTB 5KFFA 3O4NA 1RA7A 4FM0A 1SKWA 3ALYA 3ULDA 3OHAA 4J9RA 3KK1A 1RBUA 4ZPAA 3HL8A 4FS1A 1DTQA 4ED1A 3AA5X 4C8MA 3V1QA 1UA1A 2FVPA 1RDBA 4KHUA 1D0EA 4B9UA 3DOKB 3MEEA 2JGUA 4CGIA 2G8UA 1HNIA 1U49A 5CYQA 3AVCA 4OL8A 3KHRA 4DFPA 1HRHA 3OYCA 1KSPA 2OYQA 1JLBB 1BISA 4ZHRA 1NKBA 1S0NA 1TP7A 3PW7A 4WYWA 4AH9A 4KB0A 1S9EA 5HRRA 3HVRA 5FDLA 3RR7A 1JLGA 2OPRA 1N48A 4K4TA 1CZBA 5D3GB 5J1EA 4X2BA 4DTXA 2R8GA 3ZT2A 3BGRA 2BGGA 2O5DA 2BANA 2FLPA 4CJQA 2FVCA 3TABA 2F8SA 1VSKA 4F2SA 3VQDA 3QLHB 2QV6A 3G6YA 3VA0A 4YNQA 4J2DA 1REVA 1XR7A 2XCAA 1SV5B 3NH2A 1HQUB 4DSIA 2O4IA 2GBZA 2FBTA 2FBVA 4QPXA 1GX5A 4IRDA 2IOCA 3RTVA 1QE1A 1VSMA 3E01A 1C2PA 1L3UA 4FZZA 1L3SA 4DSEA 3NH1A 5CY4A 1RTHA 1NK7A 4M3XA 3EY1A 1NHUA 4DLGA 3I0RA 4OVLA 4FK0A 5KFNA 2IM2A 1JLQA 4ZVEA 2E9TA 3M9NB 1WNSA 3IGVA 4RUCA 1BIZA 4NCGB 3SUQA 2PYLA 4CJEA 3S3MA 3OJSA 2RDJA 3E51A 3TANA 4IOBA 3CG7A 4KHWA 1Q9YA 2HB5A 1Q9XA 2UVVA 5I3UB 3I5AA 4BDPA 4KE5A 4H4MB 2IM3A 4EEYA 1TKXB 3AVAA 3TAMB 1S9GA 1BQNA 4CF9A 3OYHA 3NGIA 1RT3B 3ZCMA 4EZ9A 4DG1B 3N6NA 3K5LA 4PUOA 1ZBFA 2XY5A 3MXJA 5J2PB 1S49A 3F9KA 1UWBA 3AA4A 4IH5A 4O3OA 1TKZB 1J9AA 5KI6A 4N5SA 1EXQA 3VQPA 3ZSZA 3GIMA 2JEJA 2PY5A 1T05B 4NLVA 2JC0A 3BSNA 2EC0A 3SV4A 4ECYA 1QSYA 2XRIA 3VQQA 1EETA 3H5UA 4F4XA 2BQ3A 1RTIB 3KLIA 3V4IA 5J2QA 2R8JA 3CFPA 1B92A 4Q0BB 4FJ9A 2E6LA 4DU3A 3DM2A 5DGAA 3DLGA 2Z1HA 5KFEA 2YKNB 1NK5A 5FRMA 4R5PA 2IBKA 3DI6A 4J2EA 4O4GA 5C25A 2XHBA 1CLQA 3G6VA 4Y34A 2WTFA 2OPQB 3LP1B 2IM1A 4IFYB 1ZBUA 1U4BA 5F8JA 3K5MA 1NNDA 5F8NA 4DTJA 1U45A 3AVBA 3T5HA 4Y2CA 1CZ9A 4CFAA 3OYDA 3OYIA 2HWIA 3EZ5A 4HUFA 1EX4A 4J9LA 4G1QB 4KREA 1BHLA 2ZKUA 2VG6A 2FVRA 3KMQA 5DK5A 1ASVA 4IG0A 2BR0A 3PR4A 2GV9A 4AHRA 3KK2A 4FJMA 5HP1A 2CJQA 1J5OA 3G86A 1BGXT 5C42B 3CVKA 2RF2A 4TYBA 1U04A 1ZYQA 3G0ZA 3PUFA 1TV6A 1S1UA 4KPYA 5KG3A 3M9MB 2KZMA 4WZQA 4JRPA 3OS1A 3QETA 1U09A 3TAEA 4WE1B 2LSNA 3DRRB 2UUWA 2AX1A 4QWAA 3L2RA 1BCMA 1K1QA 3K57A 5HLFB 4MKBA 5K14B 4WXOA 4QAGA 2J6SA 2R8KA 4OKKA 3G10A 1RYSA 4BWMA 2HNYA 3GIIA 2B5JA 2G8FA 4Z4FA 4BDYA 4BWJA 2HHUA 4EP4A 3KJVB 2I1RA 4E1NA 1SUQB 1MU2B 2WOMA 3QGHA 3QO9A 4ZP9A 4FJ5A 4CF2A 3PW4A 3I8DA 4MH8A 3KLEA 1XR6A 4KTWA 3I0SB 4ID5A 1KVCA 4AHUA 2QKKA 1JLEA 4JS5A 3AO2A 4DWIA 1RILA 4B8AB 3SI8A 2XI2A 3TAQA 4JLHA 1D5AA 5FROA 3SQ2A 1FKOB 2BE2A 2YNHB 3H4DA 4RW9B 4M3YA 3DYAA 4DF4A 2IJFA 2HNZA 3VQSA 4RW8A 3EPGA 5L1IA 1RYRA 4Y3CA 4IKAA 3Q8PB 5CZ1A 1JLFB 1TQLA 1TKDA 5KFZA 3DMJB 5L9XA 1XWLA 1N6QA 4B3OA 1RT4A 4ZPDA 2IDOA 2IM0A 2G8KA 5KRTA 2AGQA 4F4WA 3FDSA 3CM6A 3DOLB 3ZT0A 4MK7A 1FKPB 4W5OA 4DS5A 3M9OB 3NCIA 1RBSA 3SQ0A 2UVWA 2HHWA 4ED7A 5KFVA 4CJUA 3ZT3A 3GQCA 4RW4A 4H8KA 1N5YB 1BI4B 3LAKA 3BQ1A 1S1WA 4N41A 4ECXA 4LH5A 3D0PA 1EKEA 2AX0A 3G6XA 3PY8A 4F50A 3K5OA 4URSA 4QWDA 1VSDA 3NAIA 4DTPA 2FJXA 5E41A 4F4ZA 4NLRA 1JLCB 4KSEB 1LAWA 3QERA 3IG1A 2W9CB 4CHNA 1WSHA 3QEXA 1C0UA 3O3FA 5EDWA 4FLXA 4KV8B 4K4UA 3LP2B 3H98A 1BQMA 4E1MA 3UPFA 4BDZA 4TY8A 2X6SA 3TARA 2OPSB 1RBRA 3GV5B 1J54A 4W5TA 1HARA 4IFVA 4K4YA 4KFBB 3NBPA 4CGGA 5HROB 4F3TA 4TQSA 3HVTB 2D0CA 5SWMA 4CJ4A 2IJNA 2ZE2A 1C1AA 2IC3A 3C95A 4CK2A 3OYMA 2KQ2A 4KHMA 5KRSA 3JSMA 3SUPA 3Q8RB 3KK3A 3PW5A 2YNGA 5KFIA 1HMVA 3ITHB 3OYKA 3SCXA 4B9MA 1C1CB 2VG5B 3WNGA 5KT7A 4KO0A 3MECB 3AV9A 1IO2A 1XHXA 5SZTA 1TL3A 4DFMA 3CJ3A 2XWYA 4F2RA 1S1VA 1WSIA 1IKWB 1LWCB 4FXDA 3H59A 2ZD1A 3RMDA 3KLGA 3PJWA 4PWDA 4UQGA 5KFRA 1RDCA 3KLHA 3UQSA 1KTQA 3H5SA 4CEEA 3FFIA 4NLSA 1VK0A 3M8QA 4O44A 2ZQBA 4RUAA 2YHAA 4FW2A 3PX0A 4KKOB 1Z4UA 1NKCA 5KFYA 3OY9A 4FBUA 5DQGA 5L1JA 1KHWA 2FLNA 3NF9A 2KTQA 3N6MA 4DSFA 5KT2A 2BANB 3HVWA 1RT5B 2HMIA 4I2QA 5KG0A 2HHQA 3LPTA 3L2QA 1RT1B 4JUZA 1HJRA 5KT3A 3M8PA 4ICLA 4YFUA 2OH2A 4O3SA 1O1WA 3AVJA 3C6TB 4CHQA 2DFHA 4H4OA 1HNVB 3CJ2A 1G15A 1RAJA 3MTKA 1YT3A 4ECTA 2BRKA 1TK0A 4CGDA 1TL1B 4IDKA 1KHVA 4RNMA 1CXUA 1XR5A 4AHSA 3NFAA 1OS5A 2ITGA 3KKRA 5I42A 3KOAA 3V6JA 4K8XA 1QUVA 2VG7A 3NDKA 3DRPA 1HPZA 1IKVA 1VRUA 3LP3A 2YHBA 1K1SA 1KRPA 4MK8A 3BR9A 2GIRA 3FRZA 4O55A 3THVA 3IN5A 1TVRA 3AO4A 3VQ6A 4IKFA 4M3WA 1TKTB 3BQ2A 1QTMA 3L2WA 3V9ZA 4Q5VA 4RW6B 2J6UA 2OPPA 1RBVA 1D9DA 1BQNB 4ZVHA 2FLLA 2ALZA 1X9WA 1R0AA 1WSEA 4CJ3A 4FLTA 4PUOB 3MEDA 1I3AA 3NMAA 3RB4A 5HP1B 2HNDA 2E9RX 2E9ZA 4LSLA 4RG8A 1S6PB 4ECZA 4U7CA 1HYVA 3QNOA 3CQ8A 2KZZA 5HBMA 2IA6A 4K4WA 4DSLA 1EP4B 3D45A 4ZP7A 4FYDA 2HHVA 1C0TB 3MF5A 3DLBA 2W7OA 4TY9A 1WN7A 4M94A 3PR5B 3TAGA 4E7JA 1LW2B 4LD0A 4QW9A 3T1AA 4FLVA 4LSNA 4IG3B 3EYZA 3U6FA 1NK9A 1NJXA 4M3RA 3QIPA 4ZPBA 5DLGA 5KFAA 3V9SA 5DQIA 3L8BA 2D3ZA 1JLAB 2UUTA 1RT7B 3MEGB 1QAIA 5KGWA 1JKHB 4K4ZA 3JYTB 1U47A 3SQ4A 3DLEA 1C6VA 3KHHA 3PO4A 1K6YA 3SI6A 4F4YA 1LWFA 2ETJA 3C6UB 2XO7A 1JXBA 2ILZA 3QIDA 1X9MA 1RTDB 2E4LA 3QYYA 4NLTA 2OZMA 1RDAA 4KAZA 3QNNA 4R8UB 1ZBLA 1S6QB 5F8LA 1S9FA 3MFHA 2YNIB 5CYMA 5KFMA 4B9VA 5KFDA 2FBYA 5KFJA 1KLMB 1HYZA 4ZTFA 1KVBA 1VSLA 1S0MA 4ELTA 2Q3SA 4CEQA 4TXSA 5J2NB 3UDLA 4IQXA 1NK8A 3T5KA 3CDUA 4URQU 3OS0A 3HJFA 3IS9B 1T03A 4PQUB 4EO6A 4NCAA 4QOZB 1IKXA 3FQKA 3P83D 1NJZA 2X74A 3RAXA 2HNYB 3DRSA 2A1SA 2F8TA 2AU0A 3AVMA 2R8IA 4IBNA 3EPIA 1RTJA 3TI0A 1W25A 3BREA 3QIOA 4CGFA 4CJVA 5KFCA 4CJTA 2AQ4A 1LV5A 3SFGA 2XGPA 1FK9B 4H54A 4BACA 3RAQA 3V9WA 4PY5A 4CESA 4IR9A 3ISND 3OYAA 2ILYA 1VRTA 4KRFA 2I5JB 3L3VA 4CEBA 3LWMA 2RKIB 3S9HA 5DG8A 3QGGA 3OL6A 1VSIA 1ZTTA 3B6PA 4YQWA 4FJJA 1LWEB 2FJVA 3DOKA 1I6JA 1S5JA 4KBIA 3MR5A 3HHKA 3AO5A 4HHTA 4Z4EA 3ZT1A 3V6DA 3K2PA 4MIBA 4DFJA 2IMWP 4I9LA 1RT2B 3IRXB 4RNNA 4FJGA 5EWFA 3RB3A 3OSNA 4OLAA 3L2UA 2XY6A 2Y1JA 4O3RA 1S1WB 1T8EA 4PA1A 4DQIA 1S4FA 4Q8FA 5D3GA 4FM1A 3NGZA 4KHSA 3RRHA 5EWGA 3CJ4A 3Q8QB 3TQ1A 2RDIA 3DLRA 3CM5A 3H5XA 4ED0A 4RNOA 4LY7A 2DY4A 4B08A 3QLHA 1C0UB 4EP5A 4RW7B 4NLDA 4BE2A 4DL4A 2X6NA 3LAMA 1IH7A 5C5JA 1SL2A 3HPGA 1SV5A 3RBDA 2JC1A 5L1KA 3RWUA 4OKJA 5EWEA 2ASJA 4CFBA 4OJRA 3U3GA 4YR0A 2WCXA 3GIKA 4CJKA 3LALA 4ZTJA 3L2VA 1S1XB 2IC3B 2F96A 4Z4CA 1B9FA 2JLEA 4CF8A 2XI3A 3LP0B 4CGJA 5EU7A 3DDKA 3NHGA 3PVXA 4AILC 2W9BB 4N47A 4ELUA 3I5BA 4FW1A 3NAHA 5F8HA 4YR3A 3SYZA 4ZP6A 4IR1A 3T3FA 2ZD1B 1Q8IA 2X78A 4O5BA 3LZJA 3IGNA 4PWDB 3RB0A 4M3TA 4XO0A 5I3UA 4DU4A 4H4MA 3A2FA 4WFYA 2D7SA 2PYJA 3RR8A 3VQCA 1TKXA 4DQSA 3TAMA 1HYSA 1YVFA 3FFIB 5KFXA 1Y97A 4EZ6A 1RT3A 1L5UA 5KG2A 2E6MA 1HQEB 4M45A 5KTQA 2D3UA 1DTTB 3K5NA 4NYNA 4E19A 2WK4A 3NKYA 3V81B 3S3NA 5J2PA 1DLOB 4DSJA 2IAJB 5J2MB 1YVUA 3HO1A 1TKZA 3T5LA 4CJSA 4CEAA 2HMIB 1T05A 1C1BB 3VQBA 2D5RA 3HXMA 2D41A 3PHEA 2YKMB 4MFBB 4KTZA 4L8RB 1ZBIA 4JRQA 1S1TB 4NLXA 1RTIA 4AHCA 4CJPA 4KHQA 2P1JA 4O3NA 2OA8A 4Q0BA 3OL7A 1VSEA 2ATLA 3HM9A 4ZVFA 2YKNA 2AGPA 4CK1A 1NK4A 4K4SA 1SKSA 4GMJB 4OPKA 2WONB 3PW2A 2KFZA 4Q8EA 4XIUA 3QZ7A 2FVQA 3L3UA 4FLYA 3LP1A 4IFYA 1W0HA 4I7FB 3AVIA 2QKBA 5JS2A 5DG9A 3OL8A 1UOCA 2G8VA 5I42B 1QSLA 2V0NA 4J9PA 3GV8B 5KG7A 4Z0UA 2VG7B 5KFBA 3DRPB 3SUNA 4DTMA 4G1QA 1JL2A 4QWCA 4Q43A 4NCBA 1WSGA 4ECRA 4J9MA 2VA2A 2O4GA 4IH6A 2FJWA 3LPUA 3VN5A 2Y1IA 4ELVA 2YNFB 5C42A 3AVHA 1LW0B 3M8SA 3OYNA 3TWHA 3MXMA 4FJHA 2KFNA 4WE1A 3DRRA 5KG5A 3WNEA 3KK1B 4RNHA 5HLFA 3KTQA 5K14A 3ZSRA 3TAPA 1DTQB 2R7YA 3DLHA 5EUHA 1NOZA 4DTNA 4WZMA 4G3IA 2AGOA 1BCOA 4J2AA 1BL3A 2HNDB 4HCCA 3SPZA 1T94A 4FJIA 2HVIA 1C0MA 3MEEB 3KJVA 1SH3A 4FZXC 1SUQA 4C8NA 4CHYA 1A5WA 1HNIB 1MU2A 4FZYA 4QWBA 4BE0A 2DFFA 5CYQB 4FJKA 4URGA 4GVMA 3I0SA 2HHSA 4QCLA 1TK8A 4ZHRB 4Q45A 1X1PA 3OYJA 3QEIA 4Y1CA 3DLKA 2BDPA 1S9EB 4WXWA 4EYIB 2YNHA 5FDLB 1JLGB 2OPRB 4RW9A 5JS1A 4AHVA 3FSIA 4M95A 1QQCA 5J1EB 4CE9A 4FM2A 5FRNA 3QESA 1QSSA 3BGRB 2D0BA 2V4QA 1CXQA 4CJRA 5KFLA 2C2EA 2P51A 2WRMA 4MK9A 1JLFA 2R2TA 5T7BA 3DMJA 1Z26A 1XC9A 2P5GA 5KG4A 4NLYA 2A1RA 4J2BA 1REVB 4R0EA 1GOBA 4KI4A 3TR8A 4FJNA 3DOLA 3TAFA 2DPJA 1FKPA 1SH0A 4CGHA 3CJ5A 2NUBA 3GV7B 5KFWA 5T14A 3ZSXA 1A5XA 3KMSA 1QE1B 2B6AA 4TQRA 4NLWA 1BI4A 3E01B 4HUEA 3U3YA 1NKEA 4J9KA 4Z4IA 1JX4A 4CEDA 1RTHB 2FC0A 3LZIA 4CIFA 3I0RB 3N6LA 4Z4HA 1JLQB 4CFDA 3MXIA 2VWKA 3H2LA 3AO3A 2W9CA 5HRSA 4K8ZA 4KV8A 2HHXA 3LP2A 4EBEA 1B9DA 3KLFA 4WFXA 4TN2A 3AVLA 1NK0A 2OPSA 5KFTA 3H40A 3NF8A 4CJLA 2VA3A 4KFBA 3ISNC 4K50A 5HROA 1S9GB 1ASWA 4DF8A 1IG9A 3HVTA 2C22A 3QZ8A 2D0AA 3HT3A 4W5NA 4BE1A 3VQ5A 4B9TA 2QE5A 2HVHA 3ITHA 4CF0A 4J9NA 2W8KA 4MKAA 4C8KA 3OYFA 2AJQA 2HW3A 1NK6A 1C1CA 2VG5A 1UWBB 3VQEA 4MQ3A 3MECA 4DS4A 2VWJA 3K58A 2W9AA 5DMRA 4HYKA 5C24A 3HYFA 4W5RA 4NYFA 4J9QA 1IKWA 1LWCA 1NHVA 3LWLA 3OJUA 1GOAA 1IKYA 1EETB 3K59A 5KT6A 4DQRA 4IH7A 5DQHA 3RMCA 3KLIB 3V4IB 5J2QB 4JV1A 2J6TA 1S0OA 4XPEA 3V6DB 4KHNA 2BRLA 3DM2B 3DLGB 4O4RA 3RMAA 2YV0X 4LQ3A 5KFSA 4FVMA 4R5PB 4ED8A 3NL0A 3V6HA 3OLBA 3DI6B 2C2DA 4E7LA 3NF6A 4O4GB 5C25B 4CHPA 2AWZA 4CHZA 3NGDA 1QAJA 4FLWA 4KKOA 2R2UA 2EHGA 3SPYA 2B4JA 5KG1A 3BSCA 3KD5E 4FS2A 1ZBHA 1RT5A 2VG6B 5DG7A 3FQLA 4FBTA 4HVJA 4I2PA 4IG0B 3HSTB 3KK2B 4CEOA 3P1GA 2WHOA 1RT1A 3WNFA 4U6PA 4O0JA 1J5OB 4N56A 1SL0A 4ZVGA 4FJXA 3TVKA 2R2RA 4E89A 4CK3A 3AA2A 4DU1A 2RF2B 3AVNA 3C6TA 4EBDA 1TV6B 4RNFA 1S1UB 1HNVA 5F8IA 1J53A 1RT6A 3ZSWA 4DSKA 2IGIA 4ECSA 3CWJA 2ASDA 3BJYA 3ZSOA 4E7KA 1LAVA 1TL1A 3KHLA 1D1UA 2DPIA 1JXEA 2HWHA 2EX3A 1QHTA 3OSPA 4CHOA 3OYGA 3PW0A 1UAXA 2B5JB 4EYHB 2KW4A 4B9NA 4NRUA 2C28A 2WOMB 3QO9B 2QK9A 3KLEB 4WFZA 2JEIA 4ID5B 1JLEB 4W5QA 3HP9A 2XY7A 1Z25A 2G8HA 2BQRA 3BDPA 3QGIA 4M41A 2BE2B 3BQ0A 4DTOA 5F8MA 1TKTA 1RBTA 4ZPCA 3DYAB 3SV3A 4RW6A 5HRNA 1RNHA 3CDWA 1HYSB 2HNZB 2V9WA 4RW8B 4CECA 3NAEA 1ASUA 5F8GA 4J9OA 2G8IA 2XCPA 1UA0A 4O3QA 1N6QB 4B3OB
chains in the Genus database with same CATH superfamily
1RT4B 4OI6A 3O6WA 1S6PA 5DLFA 1Q8KA 1EP4A 1TUVA 3NGKA 4CF1A 4GV6A 4DTRA 4CCHA 3FZ2A 3B54A 5LMUF 3H08A 2XMVA 3GYNA 2JEGA 5FIIA 4I6AA 2F4VF 3O3HA 1HWIA 4X4VA 4CO2A 3P5JA 4M5MA 2R7RA 3Q2TC 2QL7B 3FZKA 3WXMB 4ZVRB 2WVFA 3A13A 1JKHA 3ADAC 4RZRA 2CDQA 2ALYB 2OMOA 3OVBA 3H25A 4JBCA 1C0FA 3R27A 3H1QA 2RPIA 3C6UA 2K2PA 2D0PA 1RTDA 1L3VA 1F9FA 1LXNA 3DLJA 4LF1A 4B9SA 4RBUA 3NS5A 4A46A 3NBPB 4YB7A 4IRKA 3ZSYA 2IVPA 2DRAA 1XHZA 1S12A 3CC2S 1Q81T 3CFOA 1KLMA 3V1OA 5IWAF 3TVZA 2J9DE 3GP9A 4USKA 2YNGB 3TX8A 3HM8A 3PIPL 3KDOA 1QQOA 4Y2MA 3VQ9A 4DR7J 1FNXH 2DR5A 3CJAA 1LNQA 3S7RA 5KFUA 1T7PA 4NXMF 3MR3A 3V9XA 4WQ5C 2A2CA 2RAQA 1I94J 3KLHB 3UR0A 3VA3A 1W9HA 5GAEP 4J91A 1WF2A 2P8IA 3G4SS 3TEGA 4U96A 2ZHAA 1NJIO 5AR0A 4FLUA 2AV5A 3S6EA 4DG1A 2VFUA 4OYMA 1NGDA 1IBKK 1Y3KA 1QVFM 3LGHA 3SCIE 3P4UB 4A8XA 5G0RB 5IOLA 1RCHA 3CJ7A 1R3NA 1PILA 1BA1A 2Z1JA 3OR1B 3DAWA 3NNHA 5L38A 2I5JA 4NLUA 4ECWA 3CPWR 3ZTSA 2DHHA 4U67Q 1VGYA 1VQLS 2RKIA 2QA4S 2Q2RA 2EPIA 1JJ2M 1CQMA 1LWEA 4AF1A 1RGIA 2MQQA 2BBEA 5KFOA 4K25A 2BJ8A 3ICLA 5U47A 5AZJA 3WUHA 1RT2A 1WHWA 1UVKA 5HQMA 4QWEA 1NCLA 4OHYA 1Y7PA 5HQ8A 1W7WA 2OPQA 5HMWA 3TTCA 1TK5A 3E9LA 1SL1A 4YOTA 5KFPA 5L1LA 3E66A 3OXFA 2KG1A 2E88A 2XMKA 2JEFA 1HPZB 3HHLB 3MUMP 4JI5J 1ATSA 1FD8A 1IKVB 2F9WA 4RU9A 1HJOA 3UN5A 2V67A 5ETQA 1HR0J 2DEIA 1YGYA 3GJSB 4RW7A 3A8JA 2H5IB 2XEXA 9RUBA 2B9WA 2FQQB 3AFGA 1AA1B 4DR6K 5CHCB 4UTGA 1IXKA 5KT4A 2WUSA 2A2DA 1NLKL 1HD0A 1VBXA 3HP6A 3V9UA 2BOAA 4M63A 2KM8B 1RBAA 5JMVA 3UKUA 1R0AB 3A4TA 4GRSA 2DGSA 2RRNA 4JB8B 5LJ3Y 3MEDB 1TAQA 3H5YA 2HHTA 3HSJA 1PBAA 4OGEA 4EO8A 2R7UA 2VODA 3MUVP 3NH0A 5HBMB 3V1RA 2MKHA 1NZ8A 4C1NI 4GVLA 4DV1J 3FZHA 2W9BA 1D8YA 1KQSR 3BO3A 2W2OP 3AVKA 4CJWA 5KPRA 4FXVA 1WJ9A 1VQ7S 3OBYA 2R8HA 5I9EB 3RBEA 4CH7A 4CD3A 2DH9A 3A5OC 4OKEA 2OEKA 3MWTA 2IHR1 3CFRA 4GC6A 1U8WA 1YJ9N 4DFKA 4KI6A 4DV0F 3FR0A 4LF9J 1WHVA 3V81A 4NI2B 4IJNA 3FCVA 3C16A 1WOPA 5EX3A 2DO4A 3K9JA 5EX5A 2QMXA 3AO1A 2YKMA 4O0IA 2NR0A 3FVYA 1OYEA 1N5YA 3W9HA 5CA5A 1GTHA 3M30A 2QFJA 5KGXA 2PE8A 4DMNA 3M5RA 1HX1A 4ETXA 4CO5A 4BRMA 2ZEJA 4YP3A 4KC5A 1JLCA 4Z37A 1T03B 5KOWA 1FEEA 4NMLA 2HLTA 1RLDA 2ZITA 4EHTA 3CMQA 4KB7A 4E0DA 3CJ0A 3PX6A 2PI5A 2Q1NA 1SKRA 2AYGA 4E3SA 2K1RA 5KFGA 1WSJA 4DL6A 2N82B 2ZBPA 4NA2A 2A1BA 3I56S 4DV7K 3ASMA 2ROGA 3G82A 3CD0A 4M3ZA 1KFDA 5A2QO 4X65J 3PIPQ 1XQSC 5ETMA 1LW0A 4CZFA 5GAEI 3V5RA 3KIOA 3CCLN 4DL2A 1YG0A 3TZYA 4WJBA 4WTOB 1SKWA 2P9IA 1GMWD 3OHAA 1GLAG 3KG4A 1Q16B 2KYZA 4L75A 4FS1A 1EB0A 1NPPA 5ADXH 4BRKA 5AQRA 3VHQA 3AA5X 1RAHB 5MLCQ 4DCHA 1EO1A 1RDBA 1YSJA 2KVQE 2XMJA 2HOEA 2JGUA 4CGIA 4DR3F 2G8UA 3EX7B 2Z58B 2VICA 1CJTB 2W4CA 1U49A 5C7PA 1UJ5A 1D4XA 1DBDA 2ASYA 3OYCA 4TKTA 1TP7A 4AH9A 4KB0A 3QDKA 3RR7A 1JLGA 2OPRA 2GUPA 4DPOA 4UY85 1VLOA 3MHYA 4X2BA 2UUBJ 2CQ2A 3A8EA 4P7TA 2YWWA 1Q7YO 2XSFA 5BYSA 4BROA 4BC2A 2UXCJ 1GLJO 3LW5C 2FVCA 3TABA 2F8SA 2HQCA 3G6YA 4RBVA 3VA0A 4YNQA 1REVA 1XR7A 2KKZA 3C6AA 1RDUA 4PL7A 1WOSA 1AUDA 3MURP 2CG4A 2E5HA 4ZLLA 1VC5A 3ENHA 4JI1F 2FBTA 2C2ZB 2RQCA 1B0TA 2CQGA 4OI3A 2W2MP 4RLEA 2CPIA 1KTVA 4RUHA 3GG4A 1VSMA 4XH5A 3BPSP 1YUWA 2E1AA 2KHCA 5T7LB 1X0PA 4Z2XA 4DSEA 4MTPA 5CY4A 2V9KA 1XBWA 3D6MB 2IM2A 4P2SA 4ZVEA 3GR1A 3CCQN 4OLOA 4CJEA 3EGNA 1HNZF 3OJSA 1FO1A 1J5EK 1MN9A 2L48A 4LFAK 2GA7A 2AKWB 3MMBB 2HB5A 4KE5A 4H4MB 5F3TA 3VF2A 2IM3A 3ILJA 1TKXB 3AVAA 3TAMB 2JWLA 1BQNA 1HBOB 1KWMA 1Z6RA 1GK8A 1FKAF 2V8DA 2AJ1A 4DG1B 2NUHA 3N6NA 2G0JA 4NA3A 2JFKA 4JI6F 2MKIA 1R59O 5K8MA 3GPAA 1Y64A 4PXDA 1S49A 3AA4A 2VV5A 3VQPA 3ZSZA 2JEJA 3VF6A 3UDCA 2PY5A 2CH5A 1M1KT 5HK4A 4DHVA 4HLBA 3E2EA 3TRGA 4CDIA 2W2NP 3THXA 1QSYA 5EGYA 4I6MA 1CJKB 1EETA 3VAGA 3ATUA 1KD1T 1B92A 4QU6A 4FJ9A 2W25A 3E8OA 2E6LA 3UNYA 4IYQA 2Z1HA 1UWAA 4UOGA 1RHUB 1NK5A 3KZBA 3LGMA 1KC8T 3DI6A 5BR9A 3B78A 3WX4A 1TMMA 3G6VA 2C2KB 2OPQB 2PIIA 4KHPJ 1U4BA 3BV8A 1NNDA 3A8KA 5F8NA 1U6ZA 4DTJA 2VASA 1U45A 4NB4A 3J7ZT 3AVBA 4B3TJ 4Y2CA 4CFAA 4LF4F 2OANA 1LEOA 4QQBA 3OYIA 4OX7A 5I3QA 3ZFVA 4G1QB 4KREA 1FFWB 1U0SA 1NU0A 2FVRA 1KAYA 4IG0A 3A0IX 4AHRA 4FJMA 1QHAA 3VVUA 3D0GE 1QDUB 3IP0A 4U7UK 3G9CA 1SZ2A 1WD6A 1YWXA 1MWKA 4B1WB 3OR2A 3HFVA 4DX5A 3MXHP 1U09A 2LSNA 3DRRB 2UUWA 4ISGA 2AX1A 2IY5B 3L2RA 1BCMA 3K8WA 1SQFA 5K14B 5IQQA 5HANA 4YN3B 4QAGA 2J6SA 2V2VA 5AE2A 3G10A 4BWMA 2NRHA 2HNYA 3GIIA 2PMHA 1YRUA 2G8FA 4Z4FA 2A18A 4BDYA 3R5JB 2E44A 5TKYA 3ZX2A 2WOMA 1F9HA 4LFCJ 4FJ5A 1CG2A 4MH8A 4A8QA 2VFVA 2O8EA 3BKTA 4DUZF 4ZOSA 2WC9A 1R43A 4JS5A 3AO2A 3CI5A 3SI8A 2E20A 4FWPA 1CULA 2DXFA 2PD1A 3OFEA 2CNKB 5FROA 4WQ4C 3M32B 3MCMA 2OSRA 2R7QA 1C0GA 1EQ0A 1VQ6S 1UCNA 4F4AA 3VQSA 3UVJA 2XULA 4RW8A 2OGUA 4Y3CA 4IKAA 3MN5A 1T9WA 5KFZA 3QPIA 2B7CB 3X3UA 4ZPDA 4X64J 2OTJN 1RAFB 2AGQA 3P31A 1U25A 2CPZA 4BRIA 3NNAA 4LF8F 4MK7A 2KG0A 2DB1A 3EDRB 1IWGA 2ZBCA 1V3RA 3BN7A 4JI8J 2HK3A 4CJUA 4H8KA 1N5YB 1BI4B 3LAKA 3IWNC 1WHXA 2Y0SD 4F50A 3K5OA 5LSOA 4QWDA 3IWXA 3CJBA 4NLRA 1P6TA 1JLCB 1TL4A 1U1PA 3NRBA 3QBXA 3QEXA 4TVAB 3O3FA 5EDWA 1T3OA 4K4UA 2YI1A 1BQMA 1Q1KA 3T1HK 4E1MA 3ZTPA 2Y1LB 2LXIA 3OFHA 2HSTA 3GV5B 3P8BB 2UUAK 1FW6A 2HG4A 5IV4A 4IFVA 4CLKA 4KFBB 5HROB 1CQNA 1RGVA 1NH7A 4KYZA 3SAGA 2OAUA 4C11A 4X62F 1MSWD 2QYGA 2ZE2A 2KQ2A 3F2KA 2XO6A 1N8RT 3KK3A 5KFIA 1HMVA 5IFMA 3OBWA 3SCXA 3WNGA 5KT7A 2J7WA 4PG6A 3QFPA 3MMVA 3WBZA 4H03B 5ETLA 4DFMA 3CJ3A 3CDBA 2V2ZA 2XWYA 4F2RA 1WSIA 1R89A 4OX9K 1HNWF 3EKSA 4FXDA 4OI2A 2ZD1A 5C2GA 1BU6O 3KLGA 2QLWA 2DGXA 4NZ7A 3MCSA 2VCPA 1U0HA 3H90A 3C7NB 3CQXA 2P2CB 4LFBJ 2FHJA 5BN8A 4LF7J 4ZJOA 3W8GA 4P52A 3M8QA 1YRTA 4JYAF 2ZQBA 2A6MA 7FD1A 2Z2YB 4YB6A 4K0KF 2IJRA 3BN4A 3GU0A 3KWIA 1UAWA 2V68A 5FD1A 4C1NK 4JI2K 1FJCA 2XZDB 5I4MA 3S41A 2FLNA 3NF9A 1T44A 1S72S 2P9PB 5CD4A 3N6MA 3K89A 2YPZA 1ZBSA 2E5LK 3PEHA 4XDCA 3CMAN 4OHWA 2H5EA 4HACB 3L2QA 4LT6A 2J0QD 1IJJA 4X66F 5H1SQ 3M8PA 1SPBP 1UZHA 3ZETB 5IQ6A 5GVQA 4YFUA 4ANEA 3CCJN 3AVJA 3C6TB 1SC3B 4CHQA 1HNVB 3MTKA 2BRKA 1SJ4P 3Q0AA 1TK0A 4K2JA 4AHSA 2HGLA 2ITGA 2ASMA 3FNNA 4C97A 1QUVA 1RABB 1YDLA 3CEDA 1RBOB 4PQAA 1VRUA 2WB1D 3WIUA 3TUJC 1H98A 4R0JA 2V7YA 4H0VB 3R5DA 4FL9A 3K2YA 4ZVOB 4DN9A 3AO4A 1HNXK 1FXRA 1MWQA 3V9ZA 1BQNB 4C23A 2FLLA 1NPRA 1SJQA 2ALZA 3NLCA 4RKUC 5CCLA 3FUYA 4LF5K 1WSEA 4FLTA 3ZZRA 3H0PA 1SQGA 4QYRA 2BE9B 2HNDA 3J80O 2GZOA 4CW7B 5LMNK 4ILRA 4BRNA 3QNOA 1GLCG 4M5LA 4DSLA 4HDHA 3WC0A 1XMQF 2EW9A 4M94A 5CHIA 3PR5B 2UXDJ 3T1AA 4F02A 3A5NC 4LSNA 2O3DA 3EYZA 6FDRA 2HRUA 6FD1A 4WWSA 1SS6A 4JK8A 1NSPA 1N32F 3UKRB 4ES3A 1RT7B 3MEGB 1E4GT 1U47A 4UW2A 5ETKA 2E1PA 1HIYA 4IJAA 3SI6A 2J9EA 4F4YA 1A9NB 1IBLF 1QUPA 3MR7A 2ETJA 3HDSA 3MM6A 1H2VZ 4ZCKA 2XO7A 4C0OC 2UUCJ 2CQHA 2C2MB 1WEYA 1PYTA 2CQPA 4NA1A 4UZCA 4R8UB 5AZIB 2QEXN 1S9FA 2YNIB 2H5JB 2P9SB 5KFDA 1HYZA 1NGHA 3THWB 2QXLA 1VSLA 3JXUA 3MMAA 2Q3SA 4CEQA 3M7VA 4TXSA 1VMBA 1IWAA 3CDUA 3CCEN 3HOSA 5K9FA 1J2VA 3SBMA 1N34F 1H72C 2FHKA 4CBXA 1NJZA 3HJVA 1RWPB 2HNYB 4DN0A 1MWZA 2VQFF 2A1SA 4KRWA 1FJGJ 2AU0A 1FXLA 1HWUA 3BEXA 4CJVA 4CJTA 2MQ8A 2H65B 1LV5A 3QBCA 1RWXB 2EFQA 2QSFA 2PA3A 1FK9B 4IO1A 2XYGB 3E1YA 2WW4A 2B4OA 4USVA 3L0QA 4CESA 2EFGA 2ILYA 1VRTA 4KRFA 3UVJB 1ROFA 2PA8D 2GVZA 3AXKA 3LWMA 4OZ0A 4CZCA 4FPRA 1ZTTA 4F3QA 1X9JA 4JKFA 4IEIA 2ZJQL 3V6DA 4JEPA 4DFJA 2MMYA 1ZAWA 3W3SA 1W2BM 5JLFA 3OSNA 4K2XA 2XY6A 2VFSA 3VWSA 4PA1A 4DQIA 1S4FA 1SCJB 1XJWB 3Q8VA 4LF6J 3Q8QB 5D4OA 4I64A 4H4KA 2ZGZA 1V5VA 1VQON 2G0IA 3O1BA 1Q18A 2PFFB 3SLCA 1X31C 3CM5A 4ED0A 3ATVA 4NLDA 1G6BA 4IOCQ 4BE2A 3DXSX 2BKOA 2X6NA 4L72B 2B4VA 1SL2A 4EWTA 1SV5A 3HPGA 2JC1A 3GYGA 3VGTA 1F9EB 2GW8A 3W65A 2RRAA 2YX1A 2NNWA 3U1NA 2LQ5A 1GQEA 4DPYA 2F96A 3AY9A 4L73A 3HHNB 5B0EA 2XYHB 2XI3A 3PSFA 3LP0B 2W24A 2UXBJ 4PRFA 4N7TA 2QA1A 4JAXA 2EFPA 3D4JA 4Q7AA 4AILC 1GT8A 3X1LB 1LFPA 4JI3J 3FK4A 3KDNA 3NAHA 5CABA 3CCQS 5A2QU 1JMTA 2ZD1B 1Q8IA 3IMQJ 3IGNA 3AARA 3TW0A 5I3UA 3BF3A 4DU4A 3A2FA 3TA1A 2RMLA 4WFYA 4DQ8A 3VQCA 2WSEC 1Y97A 3J7ZO 3FEXB 2FPHX 1HBNA 2D3UA 1DTTB 1U6BA 1ZM4A 4DV3J 3K5NA 1Q95G 4NYNA 2WK4A 3S3NA 3LGNA 3HD1A 3CCTA 4NWBA 1NM2A 2QLBB 4OV6A 1YVUA 1RAIB 1TKZA 1CEZA 4MYUA 5AQJA 1C1BB 4C48A 4EK2A 1S22A 1F0XA 2CGLA 4KTZA 2DGVA 4X4OA 1RTIA 4CJPA 1DZ5A 2P9NA 3QRPA 4DX7A 4K7QA 3HT0A 1ELOA 1VSEA 2CADA 2CJ9A 3B6BA 2DR9A 4CK1A 4GMJB 4OPKA 3D1QA 2GJIA 2CPDA 2JX2A 1UVLA 4Q8EA 4XIUA 3GIRA 1VHFA 3EE9A 3L3UA 4FLYA 1W0HA 3BZKA 5BR8F 1IV0A 3OL8A 2G8VA 2RJZA 3RG6A 4BRFA 4DCJB 4YEAA 1YVNA 4QWCA 3L7PA 4G65A 1WSGA 5LMUJ 3GJRB 2O4GA 2FJWA 2MLXA 2F4VJ 5C42A 2DHGA 3SCLE 2HURA 2HZCA 2J0XA 4DR1K 2PEBA 4W98A 2HBZB 3RUBL 2D9OA 4QIEA 1MA9B 4LBPA 4WE1A 2AEFA 3R8EA 4USUA 2P9KA 2BV3A 4YHHJ 4Y0FA 3O6QA 2R7YA 3VR1A 2AGOA 1BCOA 1U2VA 2HNDB 1SXLA 4ILMA 3H42A 3MEEB 3KJVA 4MMOA 1HNIB 1NHKL 4BE0A 4FJKA 1BMQB 4A5AA 2Q6BA 3G8SA 4ZCMA 1X1PA 2UU9J 1G7CB 4KH4A 3EXYA 2F3JA 4RW9A 4M95A 4RWWA 1QSSA 3T6JA 3BGRB 2GNKA 3CCRN 1EARA 2MEWA 2ZJQQ 3R7SB 1KNZA 2CQ1A 4MK9A 2R2TA 3JTPA 2QMUB 4EHUA 4FSVA 3G96A 2P5GA 1NZAA 1GOBA 5C2CA 1WDTA 2ZJRQ 3CJ5A 2NUBA 2FHJD 3AD9C 3ZSXA 2V4JA 4DV5K 2E7XA 3WXIA 1QE1B 4DR5K 3NOGA 3E01B 2HFSA 3THYA 1NKEA 3LQVA 4MKYA 2MKJA 2VJUA 3CJCA 2OTLN 4F0KA 1RTHB 5LM7E 3ETMA 2IIHA 4JI7F 1JLQB 2GTDA 3AO3A 3CF5L 2W9CA 1YK9A 5AQLA 2RD5C 3SIPB 4PKDB 2J9DA 2V34A 4DV7F 1S6UA 3NF8A 3LDQA 4JKDA 4G1IA 4K50A 2ZM6J 1S9GB 1ASWA 2VOPA 1P9YA 3PSIA 3PEJA 2NRZA 4PG7A 3UCUP 4DV6K 4CTAB 3VOVA 4B9TA 1NGGA 2N3OA 2HPUA 4IO8A 4B1VA 4CF0A 2HW3A 5E0OA 1NK6A 1ZM2A 3M2UA 4MQ3A 3MECA 2CQ0A 2F9TA 2KRBA 2KXFA 3F5TA 2VWJA 2BJ1A 5C24A 1RI7A 4DUYJ 3CJKA 4J9QA 1LWCA 4CJ7A 1IR0A 2I9SA 1GOAA 1YJWS 3K59A 5KT6A 4IH7A 5DQHA 2B9EA 2Q6CA 3RMCA 3VEVA 3V4IB 2DNGA 4USTA 2LQ8A 2J6TA 2I6WA 1VC0A 3V6DB 4KHNA 3DM2B 2ZUGA 1AZSB 2Q3PA 4ED8A 4O4GB 2AWZA 4BVOA 2NXCA 4ED5A 1KEKA 3NGDA 4FLWA 4L74A 2RS2A 2H4WB 4DCPB 4HTJA 4V19J 3MM9A 2BUPA 1JNRB 4A8KA 4FWMA 2B4JA 5KG1A 5SUHA 5B7WA 4WIIA 3D67A 2ZHBA 5F2RA 5M1FA 3MPWA 3T1YK 1YRXA 2VG6B 2CG8A 3GFHA 4I2PA 3CT9A 3SCJE 4CEOA 1HBMA 3T7ZA 1SL0A 3CMAS 4FJXA 3TVKA 3O44A 3W64A 4E89A 4CK3A 1RHJB 5LL6d 1B0PA 5LJVA 2OKQA 2VPXB 1U02A 1TV6B 2CRLA 1S1UB 2E2QA 3ZSWA 3CCJS 4NXNF 3CWJA 4PR6A 2ASDA 2XLIA 2YBVA 3QWUA 1VHXA 2BOPA 1TL1A 3AAPA 1JXEA 2DPIA 2HWHA 3QRRA 3QSYB 3OSPA 1GMUA 4CHOA 4E8UA 3CC4N 2OSQA 3D0HE 4EYHB 2W4DA 1V6HA 1J5EF 2QWPA 4J9VA 1E6VA 3B4MA 3AH6A 5ETSA 4LFAF 3DRYA 2YTCA 1YJ7A 2JEIA 4W5QA 1QVFR 1RWMB 1S7IA 2BQRA 2YH0A 3LUYA 3QGIA 4DTOA 1TKTA 1M5HA 1HD1A 1SI9A 4YB5A 2N4CA 2HNZB 1IVZA 2IFXA 1RBLA 3W63A 2BABA 1A0OB 2W41A 1JJ2R 2D3O1 2HRTA 1ASUA 4J9OA 1HBNB 2HIYA 2G8IA 3M6VA 4EFHA 5DO2A 4CLLA 5DZ6A 3SZ2A 3GSDA 3IM9A 1Q4RA 2GMHA 3MR2A 2ATQA 5L39A 4DDFA 1ZBTA 4TSXA 4USWA 5AQVA 3OYEA 1OYDA 5EX0A 2OP5A 1LW2A 2HHHJ 4Q44A 1NJWA 1UEVA 4OZ1A 1XC3A 4IG3A 4OO1J 4RW4B 1KFSA 2RHQB 5CZ2A 3AJ1A 1VK3A 1Q5YA 1JQGA 2DKOB 5BPNA 3I4HX 5F9LA 3PLAA 3HVAA 1JLAA 3AHPA 3OPKA 1I39A 4OLBA 2N3LA 4FNIA 1MMLA 4FWQA 4DR4J 1BIUA 2XZTB 3IG1B 3ZZYA 2LXUA 5BXIA 2JLGA 4HTUA 4NLOA 1WSFA 1WKLA 2P5VA 4DR3J 3O4WA 4TY8B 2L41A 4HHUA 2QRRA 3KHGA 4A8SA 4PXBA 1QAXA 2ZGYA 3POTB 3ET6A 4XPCA 4HR2A 1S6QA 5BJRA 1ZETA 3Q23A 3CF5Q 4F8RA 2Z8QA 4LR8A 3U9DA 1VFJA 5HVGA 3JSMB 1K44A 1HBUA 1WAJA 2VPWB 3OS2A 4OGCA 2MXYA 1VSFA 2OZSA 3CCZA 3HFZB 1UVIA 5IM0A 5GAGU 3PTWA 2YKQA 1IQTA 4LF9K 3N9UC 4IUFA 3IS9A 3IA0A 4DTUA 4PAAA 4NCGA 2EG2A 4KHRA 3HZGA 4A8FA 3WNHA 3CD6N 1SKUB 5FPMA 3CCES 1R27B 2VDIA 4FJ8A 4Z4GA 1U2VB 3E3XA 2F63A 2V50A 2O67A 3VGVA 4ZP8A 3CDEA 4ERDA 3EE8A 3PXGa 1N4LA 1FTRA 4JI1J 1ESVA 3AD8C 2V7ZA 3FSXA 1HLUA 4YMEA 3VAFA 4B9LA 2QFIA 3PV8A 2VOOA 4P71A 4J9SA 4U7UD 4JS4A 3HPHA 5B08A 4O44B 2W6LA 1R0CB 4CERA 4FJLA 2JZ5A 3QSIA 3VGKA 4DEZA 3C15B 3B6OA 4O3PA 3OHRA 3J80U 2BUNA 3MCAB 4CNYA 3OYLA 4DX8H 3VQ4A 4E2FB 1N33F 4ALZA 3M2RB 4I2QB 2BJ7A 3P96A 4OI4A 1ICEB 1RAAB 3QT7A 4CLZA 1WLJA 4KHYA 3K5PA 3ZZOA 4KY3A 2KHDA 4KGKA 1ZC6A 3F73A 3H4BA 4J37A 2VJVA 5C2DA 4HKQA 4IDKB 2Z2MA 3UDVA 4NYZA 1VSJA 4ILJA 4Y2AA 3O4QA 2V69A 5EY4A 2Q66A 2BH1A 1JL1A 1GX6A 3O3GA 2Y3YA 2IBOA 4FNHA 2RQMA 3T1HF 1UW4A 1ZM3A 3NGSA 3RRGA 2MDAA 2UUAF 3N28A 2CKWA 5ETRA 4FXWA 1VQYA 5DM6L 3OHBA 4D3HA 2R3VA 3M6XA 1ITGA 1YTUA 2FZGB 1TVRB 1IG8A 5FLXY 1NDPA 4DR2K 2HQGA 2MZ1A 3KG1A 3NGYA 2L9WA 1XI1A 3EGVA 3BSOA 2MKSA 4RUBA 2HGNA 4CP5A 2UVRA 1KQKA 3CC7S 3BGLA 1S1XA 5JUMA 2QA4G 3BM7A 2GIQA 1SVDA 4C98A 4AHTA 3UIQA 1YJTA 1NJYA 2ZOMA 3CHWA 4LF4J 4LSLB 3TJAA 3HI9A 2BQUA 2UXCK 2DHAA 3PJXA 2EFOA 4LQ9A 2GHPA 4MIWA 5DDRC 3M1FA 1JIHA 3PYGA 5C24B 2DGQA 2VU5A 2ZDPA 4A61A 3WT0A 4RCHA 1VQMN 5F3ZA 4P2XA 3L4IA 4M5KA 4JI2F 4A57A 1FFSB 1TAUA 1ZM9A 4KH1B 1H7XA 1HQEA 1RCXB 3DLEB 3IAYA 1Y5NB 5C0YA 4UOFA 2GX8A 1LWFB 3MPDA 4JD2B 1QS4A 4NLQA 4QYZK 1DLOA 3CE8A 2IAJA 4BC5A 3Q2SC 2B0GA 4DUZJ 1YIJN 2XC9A 3UD4P 3GILA 4I2PB 3GIJA 1KAXA 4DCOB 4M1KA 1N88A 3BSAA 4U7BA 4MFBA 3UR3C 2MYFA 4CT8A 1S10A 1S1TA 5JXSA 2Q79A 1VDHA 1FFGB 1WEXA 2EEYA 2CGJA 2BW2A 4DTSA 3EVOA 3EKUA 4QIFA 1BG3A 2B9XA 2NXNA 4M42A 3RB6A 1V9OA 2EBGA 2KN4A 4TYAA 2FDNA 1MG7A 2WONA 2W2QP 3NE6A 1IKXB 5F1XA 4BGBA 1WTFA 2LLZA 4P9SA 2AIRB 4Q2LA 4I7FA 1FT8A 4IOAL 4B3MK 3OTDA 4FOIA 1XMOJ 1Q82O 4ZITA 4LF8J 1NSAA 3D6HB 1T11A 3PO5A 4C0BA 3HKWA 3C65A 4EBCA 4NRTA 1GTEA 1HNXF 3TTFA 1PJ5A 2E29A 4NLGA 2K8GA 3IAS9 5HRPA 2O8FA 1JCEA 1ZTWA 3WXKA 3KK7A 1IBMJ 1T6DA 2QMWA 5D4NA 2PMWA 4LF5F 3BO2A 2Z1GA 1X4BA 4AT1B 1QQMA 2O8DA 5HN0A 5KFFA 3O4NA 3GR0A 3ULDA 4K8RA 1RBUA 4LR7A 1DQAA 1X5OA 5KOXA 4A8YA 1UA1A 2DO0A 4KHUA 1D0EA 1SBRA 2LU1A 3T9ZA 2OI2A 2MB0B 4M5GA 5AXKA 5CYQA 2X1GA 4OL8A 2DT9A 3VAMA 1KSPA 4CH1A 1OH8A 3MAAB 3DHWC 3PW7A 3QGPA 4WYWA 2B8PA 4WFAL 1S9EA 5HRRA 1TYQA 5BN9A 3G6ES 2EFVA 1N48A 1CZBA 1FRMA 4CBUA 4DTXA 4JKBA 2CWXA 3A3NB 4WFBL 3CCSN 2FLPA 5D4PA 1F5CA 3ZZTA 2ZVSA 4C3MA 1VSKA 1VCTA 1HNWJ 3CCRS 3VAIA 3HFKA 1YJUA 5IC6B 1R8CA 2QWLA 1M5OC 3FFKB 2YCHA 4J2DA 3DRXA 2CJKA 2XCAA 2O4IA 1UZDA 1S76D 3DWLA 2GBZA 4RL1A 1UVJA 2FBVA 4JYAJ 3UD3P 4K0KJ 4LMZA 5A0YA 4QR0A 3D2FA 3SDEA 2FC8A 5AJ3K 4FZZA 1L3SA 1FE4A 1B70B 1K9MT 2J8AA 2HHPA 3JTOA 5DM6Q 1NK7A 3EY1A 1NHUA 1YXQA 4OVLA 4FK0A 2LXFA 1M90T 2VB6A 2BTFA 1YKWA 2OTLS 1WNSA 3M9NB 1BIZA 4NCGB 2PYLA 4YDUA 1U1QA 2FD2A 1BWFO 1TZ0A 3D6FB 2ZZNA 4KHWA 1Q9YA 4I68A 4C8YA 2KRRA 3WIVA 1Q9XA 1HNZK 2UVVA 4CO0A 4BDPA 2AP6A 2N4DA 3TSUA 1V3ZA 3EZOA 4FWKA 3W0LA 3NGIA 3TVYA 1FERA 3ZCMA 4JV5F 4MDBA 3K5LA 4NEYA 1ZBFA 2FJDB 3MMJA 3K9KA 3UE5A 1P27B 3MXJA 5J2PB 4JI0F 2CNOB 2JLFA 1UWBA 2XQCA 4IH5A 4O3OA 1F5BA 5E2QA 2E7WA 4DU7A 3U9ZA 3GIMA 5G4DA 4NLVA 2JC0A 3BSNA 4ECYA 3Q89A 3VQQA 3BF1A 3EWGA 3SK3A 2CJBA 3KLIA 2K7JA 4FOEA 5J2QA 4Q0BB 3J7Z5 1QJHA 1VISA 1OSCA 3DLGA 3ZZPA 3QFWA 4FKYA 4R5PA 1X4DA 4HL9A 3QJJA 4J2EA 3H6EA 1GLEG 1RAOA 2E66A 2IIRA 3LP1B 3I6PA 2IM1A 1ZBUA 5F8JA 3A3PB 2NXEA 3BB5A 3CJ1A 3DDIA 4UZBA 2GQQA 1CZ9A 1VS3A 4P2MA 3EICA 5ETOA 4F3MA 2ZKUA 4NL5A 5DK5A 1DY3A 3PR4A 3J81O 1AUSL 4MT1A 2DR8A 1J5OA 3BGFA 2RRBA 5H9FK 1HHQA 2RF2A 1N32J 3OA9A 2HFVA 4TYBA 1QZ5A 2CQ4A 1U04A 1ZYQA 3PUFA 3FEZA 3FGVA 5KG3A 1SJRA 3TAEA 1V4SA 4QWAA 3N79A 4KGMA 2R8KA 4OKKA 1IBLJ 5GAHU 2Q97A 3B82A 5A8RA 3FZFA 1RSCA 2B5JA 3NMRA 1Y5IB 1F3VA 3MPVA 2HHUA 1MU2B 3AOCA 5GMDA 3QGHA 3QO9A 1O6XA 4ZP9A 3PW4A 3I8DA 3KLEA 2D1CA 1XR6A 4KTWA 3I0SB 1KVCA 4EFAC 4AHUA 4PHTX 1JLEA 2XI2A 3TAQA 4JLHA 1D5AA 1GEHA 3SQ2A 4JI4F 1LXJA 4ZN1A 4ANDA 4OX6A 4CZKA 2P9UB 5A2QY 3DYAA 1UVMA 3G8QA 2CQIA 4JKAA 2EWSA 3EPGA 5L1IA 1N34J 1JLFB 1TQLA 1RWKB 3DMJB 1U2RA 4DZ6A 4B3OA 2YQ0A 3ID6A 1RT4A 5DRKA 3VCDA 4FWRA 2IDOA 4F7VA 3O9TA 1K0TA 3SSQA 5KRTA 4YOWA 2QJ3A 3MM8B 4F4WA 4WFAQ 1HI0P 3N0VA 4Y65A 3DOLB 1R8HA 3ZT0A 5ADZA 1R0BG 2JVOA 3QFHA 3M9OB 3VF0B 1K73T 1DFDA 2HHWA 1FF2A 2C3OA 3MM7B 3ETOA 4WFBQ 3ZT3A 4ZLNA 5LJWA 1S1WA 1EKEA 3DDNA 2AX0A 3SQOP 4URSA 3J7AN 2FJXA 1U26A 3G71S 1FDNA 3DU6A 4F36A 2LVWA 2EKYA 3FLCO 1X60A 4JKEA 1VYAA 1WSHA 3EMTA 4ZLJA 4FLXA 3LP2B 3H98A 2NSCA 4BDZA 4IDHA 1SB6A 4HVZA 3GB0A 2ZH6A 2KLAA 4W5TA 1HARA 2GS8A 3NBPA 3HSZA 4B1YB 2UXDK 2W2PP 1RFQA 4DR1F 4WU2A 3O08A 3HVTB 1CC8A 2I7NA 3D1HA 4WP3A 2Z30B 2AYEA 2IC3A 3L9ZA 4CK2A 5KRSA 2MZSA 3LM2A 1K8AT 3SUPA 3V2UC 3Q8RB 3RGIA 2YNGA 3HF5A 4X62K 1XMBA 2WBMA 1LKZA 3U4LA 3TUPA 3DOMB 2XS5A 2GWKA 3W7BA 2BACA 1GLLO 1X8DA 3H59A 1OY8A 2WSCC 5GMKa 1D09B 4UQGA 4DL0C 3M3ZA 2G4BA 4OYPA 2F7TA 3KLHA 3NG8A 3UQSA 4OV1A 3ENOA 3LOUA 1KDNA 2V63A 4FPBA 4P75A 4RUAA 4FW2A 1LOUA 3PX0A 5E5NA 1EWRA 5G0RA 1Z4UA 5KFYA 4BC7A 2GAGC 2ZWPA 3OR1A 1WC1A 1R7IA 3H7HB 4PZVA 3F44A 4PEOA 5KT2A 4BRCA 4BRHA 4S0MA 4CO4A 3W8PA 1RT5B 2HHQA 2C3MA 3WQUA 2V8PA 4AQYK 1RT1B 1RU1A 2GGPB 4JKGA 3OTOF 4DV5F 1IBKJ 2OH2A 4O3SA 9ATCB 2C1EB 3VAHA 4FWSA 4DR5F 4X4UA 4X66K 4HHJA 2JFDA 3ULHA 1YT3A 3QBWA 1ZH5A 3IDHA 4PG5A 2HFNA 4QIGA 4O5FA 5BYQA 3KOAA 2IMOA 1HPZA 3HHLA 3NWRA 5BPLA 1IKVA 3AODA 5FPDA 1K1SA 3D54A 1KRPA 2AJ2A 4E98A 1X4FA 1RHRB 2MSSA 4XDDA 3ZTOA 3IN5A 2RILA 3VQ6A 4IKFA 1H38A 4WIQA 1SJ3P 4CZGA 1QTMA 5AE1A 2J6UA 4DV6F 1RBVA 2J8SA 1WOOA 4ZVHA 4ZA1A 1R0AA 2Z4PA 2B4PA 2J5AA 2NRVA 1LFWA 3MEDA 4LF6K 5ETPA 4U7CA 1HYVA 3O9RA 2J7UA 2KZZA 5HBMA 3BO4A 1W2BR 2IA6A 2HHVA 3D45A 1C0TB 4DR6J 3MF5A 1ZXOA 2POKA 4TY9A 2DXDA 2P9CA 4AL7A 3TAGA 1IJEB 4LD0A 2VF3A 5ETNA 4GY2B 4FLVA 1KS2A 1XMQK 5GIOA 3P45B 1NK9A 3O5TB 5HJYA 5DLGA 1TL5A 5KFAA 3V9SA 1CJVB 3L8BA 1YZ7A 1FVQA 5KGWA 3JYTB 3SQ4A 4RX6A 4BR7A 3RRKA 1O5JA 4LVNP 2B8QA 3T1YF 4NI2A 5H9EJ 1VAZA 4UY8T 2BXJA 2G2OA 4NLTA 4RBTA 1RDAA 1I94F 2M7SA 5F8LA 2G13A 3MFHA 4C8ZA 2ZVIA 5KFJA 3LTOA 1WUUA 3D9BA 1FA0A 1S0MA 3EN9A 5J2NB 4IQXA 5HSPA 1A7GE 2CA9A 3RW7A 4WP9A 2VIHA 4URQU 3M8YA 1T03A 4PQUB 2OD4A 4NCAA 4DV3K 4QOZB 5ITHA 2APOA 1KKHA 3I33A 1W2IA 3FQKA 1ZZNA 2X74A 4NLCA 1K8KA 3B8AX 1TUWA 2NREA 3AVMA 4IBNA 2RT3A 3TUIC 3M2VB 3TI0A 1NEEA 2ZWOA 3BR8A 2ZOGA 4NPOA 1ZZFA 3BREA 3QIOA 4X4NA 3ENAA 2AQ4A 1TTHB 2DJWA 4N8OA 3SFGA 3QMQA 3DGPB 4BACA 3RAQA 4JKCA 7FDRA 4ZPWR 1RZMA 3WQTA 1U1MA 3I9V9 2ZNYA 5DG8A 3QGGA 1Y3JA 3IMXA 3VALA 1WSVA 3OL6A 2HVDA 1G99A 1FDBA 2A3JA 1Z2LA 4DV7J 1VQ9N 3EO3A 3D6TB 1BWVA 2QX0A 3MR5A 3FBCA 5CD4H 3IFEA 8RUCA 1CJTA 1NNEA 4FPIA 4NASA 2IMWP 4UUXA 3VEOA 2PFDA 4X4QA 2ERRA 2WVBA 2WVEA 4WK3A 1VOMA 3W9JA 4F67A 2E2NA 3IRXB 2PDAA 4RNNA 3NCQA 1FRLA 4OLAA 3L2UA 5C2FA 1S1WB 2CH6A 4Q8FA 1WC6A 4KPCA 5HOOA 3RBXA 4KHSA 4CZEA 1TMJA 2BX6A 3RRHA 1NBWA 1EX8A 5CH7B 1EKSA 1N0VC 4YDXA 1FRXA 2DNZA 1MW7A 3O8WA 4BG9A 5IV3A 1T3VA 3LAMA 1NSKL 1IH7A 4KH5A 3RBDA 3MK6A 2BJ3A 2NZ4A 5L1KA 5EWEA 1JJCB 7AT1B 4CZHA 2FTRA 1X3MA 4LF2A 2XMTA 2UU9K 2WCXA 4CWBA 1FESA 4RR5A 4GKJK 3R8YA 4HI2A 2IC3B 3AGKA 2P9LB 4LF9F 2DNYA 5T7LA 3FZMA 5HATA 5HMXA 1Y10A 2K06A 2FLOA 5JVHL 1NB2A 3NHGA 2DHXA 3T6BA 3PVXA 3H1VX 1GAOA 2KB2A 3RBZA 2M70A 4YR3A 2XHWA 1X7VA 3LPEA 2GVDB 2FJBB 4CZIA 2YWKA 2XSJB 3MMBA 4Y00A 3T3FA 1UETA 3FJ2A 1WBBA 3RB0A 1VIXA 4H4MA 2D7SA 4ILHA 2PYJA 3RR8A 1TKXA 3MN7A 3TAMA 1HYSA 1HBOA 3I55N 4ISFA 2E6MA 1YBUA 4FPAA 4A62A 3GCXP 5CCMA 1KQFB 2V8GA 3SBGA 4LFAJ 5J2MB 3CJRA 4EAHD 4BRGA 5TKWA 3J80Y 4CEAA 3GG0A 1MROB 4LRAA 3OUYB 4ZLPA 2D5RA 3ONQA 1VJWA 2D41A 4DBQA 1CPZA 3R5BA 1CJKA 3BH6B 4JRQA 2FC9A 4BCAA 4X65F 2VUGA 2X1AA 4JKGB 3J7A1 3BPDA 4UUWA 3M6GA 4FKXA 2GO9A 5E3AA 3AGRA 4CZLA 1RQ0A 3TNVA 2RE1A 5K5MA 1Z1ZA 5B0CA 4ZVFA 4A8WA 2RS8A 3FC9A 4CZMA 4NZ6A 1I3OB 1OVQA 4GV3A 4ZVQB 5JS2A 4H0XB 2DTJA 2E1YA 2V0NA 1TUUA 4J9PA 3K8VA 5KG7A 3SUNA 4J9UE 5BR8K 4G1QA 1JL2A 1OSDA 3L95X 4NCBA 4CT9A 4J9MA 4DR2F 1WC4A 3LPUA 4GV9A 3A8YA 2KT5A 3VN5A 4ELVA 1HKCA 2YNFB 3KVGA 2I8EA 3AVHA 2V5HG 2HBKA 1DQ8A 4L3KA 1S3XA 2ACMA 1WELA 3DJCA 4ENOA 1XNQK 4YUDA 1PJ6A 3CXCM 1KOOA 1XNRK 1LK5A 3DRRA 1U7LA 2UUBF 2M5YA 5KG5A 5D0GA 3KK1B 4RNHA 2J76E 3KTQA 5K14A 2O1PA 3VGUA 2UXCF 4BG8A 4WP8A 1DTQB 4GVBB 5HO4A 4FYYB 4WZMA 1NUEA 1MMDA 2A42A 2R7TA 2ZH8A 4HCCA 3SPZA 1TUGB 3MEKA 2HVIA 3PCOB 3KUGA 1A5WA 2M2BA 1VHIA 5GADP 4QWBA 2DFFA 1BLUA 1QQNA 1RKJA 3ELHA 1HL6A 2EFNA 4QCLA 3Q83A 4ZHRB 4Q45A 3VEZA 3TJ9A 2P9GA 4NYOA 5AQGA 3M32A 5FDLB 1R6VA 3HTVA 2OO4A 2WW8A 2XMUA 3FSIA 1QQCA 4A2AA 5J1EB 4FM2A 2MGZB 5FRNA 2B3TB 4B1UB 5KFLA 2C2EA 3H3OB 4M5JA 3PKYA 5JLHA 1Z26A 3ID8A 2AT1B 2JSXA 1XC9A 3NVKA 4AL5A 3BKFA 2MQLA 4KI4A 3M1VB 1Q5VA 4FJNA 5M1QA 2JDJA 4RO0A 3N01A 4EGLA 3T9NA 4CGHA 1K8AO 1N0UA 1RXOB 3GV7B 3EL2A 3MN9A 1ZAXA 2NPFA 1A5XA 4NLWA 2VBWA 2B9YA 1BI4A 3CJQA 4HUEA 4J9KA 1G1XA 1JX4A 2ASPA 4CEDA 4MO4A 3I0RB 3N6LA 5AQPA 3CCUN 3DXBA 3EE3A 4B3MF 3VGSA 3H2LA 5ETTA 1T9TA 4QS8A 1PO6A 3J81U 4JI7K 4EBEA 5GAGP 1Z05A 1SC1B 4TN2A 3AVLA 1Q78A 1PG5B 3MM5B 3TQEA 3QNWB 1K8KB 3C6HA 3H40A 4CJLA 3I87A 4KFBA 2O8BA 2HHHK 5HROA 1W26A 3KWMA 1IG9A 1DARA 1WG4A 5JVHQ 1L3KA 3IM8A 2B56A 1TL7B 3VQ5A 1KN6A 3EEQA 4BC4A 3MMCB 1DEJA 2QE5A 3PIOL 4J9NA 4C8KA 2LECA 3T1HJ 1PJ7A 3R5AA 4DR4K 5THWA 3MD3A 1OQ6A 3VQEA 2LA4A 2PSZA 4DS4A 1TFWA 3HHLD 3LF0A 2ZH4A 2YX7A 4W5RA 3JAMO 3LWLA 5DDQC 3GWCA 1IKYA 3GDQA 2O66A 3NWGA 3D3CJ 5AQQA 1T6CA 1S0OA 3C7NA 2BRLA 1KBRA 2KHOA 4NX9A 2Y1RI 1M5KC 4O4RA 3RMAA 2YV0X 2ZH3A 4DI6A 3V6HA 1KVKA 2C2DA 3JXOA 4E7LA 5C25B 3DC2A 3OVSA 4YOVA 1FCAA 4CHZA 4ZS6A 1WWHA 2R2UA 2RB7A 3MI7X 4OX9J 3KYLA 5A8WB 2P9PA 3BSCA 3R6GB 1SC6A 3DCAA 4FBTA 3CC2N 4HVJA 5DDOC 4HACA 3KK2B 2WHOA 3WNFA 4O0JA 4N56A 2AJ0A 2XHCA 4ZVGA 2R2RA 1RWVB 3ZETA 2YHYA 1TUYA 3C6TA 1HNVA 5AJ3F 1RT6A 4ECSA 3CD7A 2HQDA 1F6TA 1YX2A 3KHLA 5LL6Z 2XTJP 3NS7B 3R6MA 4YB1P 1D1UA 4B3SK 1Z2ZA 3UDEA 4LJMA 2E5LJ 1TFYA 4NXNK 1XTZA 2EX3A 3P3DA 1OVYA 5FPEA 2KW4A 4B9NA 3CSKA 2OEMA 3G4SN 2QK9A 3RSEB 4B1XB 4ID5B 2XY7A 1Z25A 5GADI 4MO5A 3BH7B 1U1LA 1C4AA 2DHSA 5A8KB 4GVEA 2BE2B 5F8MA 5KPTA 2HVZA 3UNGC 5HRNA 1HYSB 1XN9A 2V9WA 3K0SA 2QA4N 3ENVA 2I7PA 1UA0A 4RWTA 4GO7X 3TANA 1N6QB 3TWHA 3D3BJ 4N76A 4I9QA 3TYTA 1FXDA 1IM6A 4CIGA 2C2RA 1K47A 3JSBA 4QR1A 4HUGA 1HNXJ 2LP4A 2DFEA 4KGZB 3NGTA 2WBRA 1W97L 1OH6A 1JLBA 2VL1A 2P5OA 4FO0A 3ZT4A 1NO8A 4FCYA 2XLKA 1WC3A 3KNAA 4LF5J 3MR6A 3THTA 1URNA 3J8AA 3GFXA 2Q43A 3W60A 4AD6A 2BW7A 1GOCA 3UKRA 1HFEL 2RQ4A 1RT7A 3MEGA 5LMNJ 4FYXB 3OTCA 1QZ6A 5EN1A 1RU2A 3PM9A 5KPZA 2FXUA 4FK4A 1GNKA 3ZZZA 3UE2A 2QSWA 1EWQA 2RHKA 1S97A 4PWWA 3R6LB 4PXCA 3NF7A 2P6SA 2I2YA 5GAGI 5HMZA 1PC5A 1S48A 4R8UA 5AQFA 4YOUA 1RCOB 3UO0A 4JNEA 5AZIA 4UOHA 5C10A 3TA2A 4HTLA 3ZSVA 4NLPA 2PZSA 2YNIA 2CJYB 2P9SA 4XTTA 2XGQA 3THWA 2DK2A 5F0WA 2GUIA 5KG6A 2DNHA 2W7PA 2E5JA 3B8HA 4ID1A 1VQPN 4PKGA 2FGOA 4KO0B 2OMLA 2GIFA 2A5XA 1TL3B 2HAFA 2NRTA 1VQ7N 3U8XA 4FZVA 3MUTP 1NXIA 1NOYA 3P49B 1S1VB 2QG9B 4BGAA 1A5VA 3AVGA 4K4XA 5E3PA 3ZSQA 3P4IA 3MAQA 1WI6A 3PIOQ 1LQ9A 2JHEA 4DMZA 1S6OA 1HA1A 2F65A 1FK9A 1NMDA 4GW6A 4IFEA 4H0YB 2VDHA 4TU9A 1BUXA 5AQMA 1S4EA 4GMKA 3HK2A 4CEFA 4KAIA 1B7FA 1MWYA 4BY9C 3OBIA 2XZWA 2IVMA 1WNEA 1NLVA 1M5SA 3ZTQA 4C8LA 4M8LA 2VQEJ 5JICA 1YLXA 1QY7A 1N33K 4IRCA 3ULEB 4M5HA 4ICLB 4ED6A 1VQ9S 1DQ9A 3VQ7A 1Q81O 3CCMN 5LOQA 4H4OB 4ZVSB 1L3TA 4ES1A 3SCKE 4AYBD 4YR2A 1NBEB 1JCGA 3ZNUA 3QWPA 4FK2A 3CUNA 3SUOA 5KT5A 3OVNA 5HAOA 2MZTA 3G2XA 2RU3A 1OIAA 4MIAA 4C6AA 3HD2A 2V2KA 3CMEN 3LDSA 1DURA 3CJSA 1JXVA 3OXGA 2QXFA 5AQYA 1G4CA 1RHQB 2VGMA 2UXDF 3KG0A 1KVAA 5CE3A 4DL5A 2Y8YA 2ZJPL 2G2YA 5E84A 4JV0A 5KFQA 1H73A 3C94A 2Q1LA 2O8BB 2OPPB 4BREA 3OYBA 4FLZA 1YITN 3PZPA 2M4MA 1ZA2B 1WF1A 3PHTA 3S3OA 2QLFB 4WQ5A 3PX4A 1FNMA 3OL9A 3LP0A 4UQTA 4CO1A 3CB4A 1KLNA 3EJMA 2GFFA 1F2HA 2JRSA 3LPYA 3ENQA 2BM1A 2J0SD 4C8OA 3AA3A 2UUCF 4E7IA 4WYLA 4ECQA 2XY8A 4Z7YA 2FB0A 4CIEA 4DL7A 1J6ZA 2E5GA 3ZLJA 1IKYB 4WF9L 4PYAA 1OO0B 4F4KA 2YWFA 2L08A 3UI3A 4CZJA 3QIPB 2ZZMA 2O8CA 4P73A 3I5CA 1FD2A 4I6YA 3KD1E 1U8SA 3VERA 1FWLA 5M1NA 1DTTA 4CFCA 2W8LA 3KKSA 2AEMA 3V6KA 5KFHA 3P5BP 3EDQB 2OELA 2CJXB 2A41A 4ED2A 4YY3K 4AQYF 1H74A 5BRHA 2CPHA 4DHYA 2A10A 2PGCA 1C1BA 4OHXA 4DZDA 2CQDA 3TR5A 2HAIA 2CVIA 5CYMB 1RDDA 4B3RK 3D2EB 2R7SA 5LSRA 4E7HA 4JV2A 4KH0B 4D3GA 3D1OA 1VSHA 4IOXA 2EI5A 1WKKA 1RT6B 1F21A 2KT2A 4B02A 2Z57B 2FHOB 1TU0B 4KB1A 2OIHA 3MFIA 5DM7L 2J7KA 2NXJA 5BRFA 4MDAA 3T19A 1Q7YT 3DRSB 1X4GA 4KH6A 4NZ0A 1HPMA 1CSJA 2ZH9A 2DGOA 5F0UA 1GLFO 1WUAA 2QWRA 1RTJB 3D28A 4WU3A 5GAHP 2HEKA 1U48A 4ITSA 3FBFA 3VV2B 4LRBA 3GJQB 3C8YA 3D2WA 3CIMA 4ZVPB 2IYGA 1PC4A 3FCWA 4CLUA 4DKWA 4W90B 1N36K 3BYRA 4EIAA 3KLVA 3M8RA 3MGJA 2JOQA 1NGJA 5CR4A 1HLWA 4FM0A 4LF6F 4AXIA 4J9RA 2ZH1A 4N8NA 3HL8A 4KIAA 2EKNA 2F5GA 4ED1A 3V1QA 4B9UA 3DOKB 2ZUAA 2GO8A 3MEEA 5IT9O 1HNIA 4JKHA 2DNLA 2B4UA 1KXPA 2VKRA 2XG8A 3C14B 3J81j 3AVCA 3KHRA 4DFPA 1YJNN 1MNEA 1JLBB 3RU0A 1S0NA 1HWKA 4MLEA 3BKUA 4WPAA 2YWHA 2QL5B 4HTIA 5D3GB 4C4WA 2FF6A 3M6WA 2VYPA 3QT8A 3ZT2A 3BGRA 2UXBF 2O5DA 1Q8LA 4CJQA 4F2SA 1YJ9S 4OQJA 3R2CJ 3QLHB 3PFEA 1Q53A 1OPZA 3MDQA 3NH2A 2EG1A 2DNPA 4DSIA 5K8NA 1RWUA 2Q36A 3I9ZA 4BS2A 4QPXA 4IRDA 1XIQA 3RTVA 2L9DA 1QE1A 2G9OA 4C2MA 3E01A 1L3UA 2PEHA 2X51A 1YZ6A 4DV3F 2A6OA 2LQBA 3IRWP 1RTHA 4M3XA 4YDDB 2PO4A 2QYCA 4A4JA 3VESA 1JLQA 2ZJPQ 2E9TA 1E6YB 3IGVA 4RUCA 3AA8A 4OI1A 3CCUS 3S3MA 4AXJA 2RUGA 1W7AA 5B0DA 3CG7A 4LRCA 2C2NA 2HBMA 4WKRA 3I31A 3WEEB 2DRBA 1NRKA 4GKKK 4DR5J 3KUEA 4LSZB 3QJLA 3I5AA 1F60B 4EEYA 2HFZA 3NXZA 1S9GA 4CF9A 1RT3B 2KO1A 3CIPA 2DITA 2QLXA 3WX8A 2IVYA 4F04B 5D77A 2H4YB 4CTAA 5LJ5Y 3W2VB 1S57A 5AE3A 2KT3A 2G0CA 4JV5K 2HS3A 4WF9Q 1BO5O 3R1HA 3F9KA 1J9AA 3CCLS 3NNCA 5KI6A 4N5SA 1EXQA 2Q0RA 4C9DA 1UPPA 1T05B 4JI0K 2D69A 2LEBA 2XRIA 2BZ2A 2N7CA 3H5UA 1FI4A 2BQ3A 3V4IA 1N5QA 1ZS6A 3CFPA 1BOTO 4DV6J 1H3DA 1Q0NA 1VQ4N 4DU3A 3DM2A 5DGAA 2DNMA 3GMGA 2JL9A 1AZSA 5KFEA 3NY0A 2YKNB 5FRMA 3HHDA 4K41A 4O4GA 2D1KA 2YHXA 4V19S 3G87A 5LT5A 2XHBA 1CLQA 4IZ9A 1N52B 2DVIA 4YHHF 4IFYB 4XH1A 1S77D 2HLUA 3SSRA 3T5HA 2HZVA 2HWIA 2GV1A 4ZN3A 4HUFA 1EX4A 4J9LA 1BHLA 2VG6A 3H45C 2BR0A 2GV9A 5EVZA 3DXKB 3QAEA 3G86A 5BPMA 1BGXT 1NM1A 5GAHI 3LO3A 3PRVA 5E3RA 2UU9F 3CVKA 2ZOFA 5DM7Q 4GKJF 3F56A 3VQTA 3G25A 3FMBA 1TV6A 3FBBA 1S1UA 4B17A 2FSNA 4KPYA 1JJ4A 4WZQA 3QETA 1NDCA 3D0IE 5KAKA 4DV2K 2QTDA 5HLFB 4MKBA 1TR0A 4WXOA 5HL7L 3T1YJ 4WCEL 1D8ZA 3SQGB 1M1KO 3N5FA 5KQDA 4EP4A 3R7BB 2I1RA 2NRXA 4MAKA 1SUQB 2MQPA 1ILYA 4FWLA 1ITPA 1KD1O 3HRGA 3HLUA 4DWIA 3VEWA 4HI1A 1KC8O 3SAFA 2YNHB 1QVGM 2KDOA 3H4DA 2GX9A 1S72N 4A59A 3VETA 4DF4A 2HNZA 4JI4K 2O8CB 3GZ7A 4M5DA 2XS7A 4I0WA 3QFUA 1RYRA 5AQTA 2MPUA 3Q8PB 2QL9B 2RE2A 2LKZA 2H1YA 3ILIA 1XWLA 1IR1A 4JN4A 2EBEA 1PIEA 4Q2MA 2BE7D 3UCZP 3JAMU 2G8KA 1V3SA 5K8PA 2FIUA 2V6AA 1FKPB 4DS5A 4AE5A 2HRYA 3GSIA 3IUCA 3SQ0A 2GAHC 2YQ3A 2UVWA 1CVJA 2ZM6F 4ED7A 5KFVA 4RW4A 4OZJA 2XWXA 3BQ1A 5AT1B 1S7HA 4N41A 2HBYB 4PL8A 3G6XA 3PY8A 1VSDA 3NAIA 6AT1B 3DLLL 4KSEB 1LAWA 2VBXA 5B09A 3IG1A 3QERA 4NYPA 4CHNA 1C0UA 4KV8B 4CYUB 3T69A 3VTIA 4MYTA 5LY3A 3VTHA 3UPFA 2FY8A 2W01A 4DUYF 4DV4K 4L3NA 4TY8A 2CPJA 2X6SA 3TARA 2OPSB 3J7YU 1FJEB 4XEIA 4FP9A 5D4LA 2DY1A 4K4YA 2FY1A 2OFHX 4C0HA 3POTA 4F3TA 4TQSA 4FF2A 2VC1A 2D0CA 5SWMA 4K59A 4OYXA 1XNQF 1C1AA 1XNRF 2LDYA 3JSMA 3KUHA 5AQSA 3PW5A 5EXWA 3CGIA 2MQOA 3ITHB 2HFOA 2C42A 4KJIA 3OYKA 4KT0C 1C1CB 2VG5B 3AV9A 1XHXA 4H5WA 1VQPS 3IKMA 2VC0A 4WQ4A 5D0EA 4FF4A 4BRDA 5H9EK 4LIWA 2M52A 1IKWB 1JCFA 4PWDA 5KFRA 4ZJQA 1RDCA 2GMJA 2QN6B 4FVUA 1KTQA 2QWQA 3S01A 2YY3A 4CEEA 4FF1A 4BVPA 1IN0A 3FFIA 3SAHA 4JHDB 3J7AP 2MZJA 3HSGA 4OMFG 4O44A 5IWAJ 2YHAA 3G8TA 3O9QA 1U1NA 3K0JA 3MOZA 4KKOB 1NKCA 3UN3A 3LA0A 3C15A 4J5OA 4FBUA 5L1JA 3TU5A 4PG4A 2KTQA 4BRAA 2KJWA 2XMMA 3H2UB 4DSFA 1RB0A 3M2RA 4I2QA 3LPTA 2AF6A 1OH7A 4NXMJ 2JNJA 4HT7A 4JUZA 1RWWB 2KYXA 5KT3A 1HKGA 1FRKA 3W2WB 2OTJS 1EAYC 2AD9A 1C4CA 4BBYA 3CJ2A 2HBJA 2DH8A 5L46A 1N8RO 1G15A 2CPFA 3CCMS 4CLFA 3OTOK 1DRZA 4QS9A 4G9ZA 4ECTA 4CH0S 4CGDA 4IDKA 4RNMA 2MZQA 2ZBQA 5DETA 1NSQA 3R97A 3NFAA 1OS5A 3KKRA 1HW9A 2CXEA 4HEA9 4K8XA 1MDUB 1M1GA 3NDKA 3DRPA 2QGFB 2VBZA 2DGUA 3LP3A 1U1RA 2P6TA 3CMES 1CJUB 4MK8A 1T9UA 3BR9A 2GIRA 3TPQA 2HHHF 1TVRA 5HL7Q 2DNKA 4M3WA 4EUVA 3J81Y 4WCEQ 2PAVA 4Y2KA 4CRJA 4Q5VA 4RW6B 4DUTA 1X9WA 2V8HA 1HI8A 1YITS 4DR4F 3VZIA 1I3AA 3NMAA 1EQYA 5HP1B 2OFGX 2E9RX 4RU2A 2E9ZA 4LSLA 4RG8A 1S6PB 5JMNA 2XMWA 3CQ8A 4K4WA 1EP4B 1FX2A 1GFWB