5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
1B9DA 3NMAA 1TAUA 4DSEA 1XR7A 3NF6A 3KD5E 3LAKA 4NLSA 3AVBA 3V1RA 4C8KA 4IG3B 2BDPA 4CJPA 4I2PA 4FW2A 3VQQA 4JRQA 4QWCA 5KT5A 3LWMA 4WFXA 1QSSA 4DSIA 2ZD1A 3B6OA 1X9SA 3KLEA 5KFJA 2GIRA 4DU4A 4F4WA 4B9VA 2OH2A 3BGRB 1IKVB 5C25B 3V6KA 3NGZA 3TARA 4W5OA 4IR1A 3LPUA 1RTJB 3HKWA 2X78A 5HLFA 3G6YA 2WRMA 5HBMA 3LP0B 1TL1B 2XY5A 2IJFA 4B9TA 2DPJA 3SUPA 2D0AA 4Z4CA 4HCBA 4CK1A 2D0BA 3TI0A 4CHYA 1X1PA 3ZT1A 4CJRA 4KB7A 5KFBA 4WFYA 4IR9A 1QSLA 4MIAA 4RW4B 3MAQA 5I42A 4Z4GA 3KK3B 5KT6A 3TR8A 1SH2A 5JXSA 1U45A 3MEGB 3QGIA 4DU3A 2VG5B 4NLTA 3CJ3A 4CGIA 4F8RA 2I5JB 3AVAA 3DRPA 2YNGB 4MKAA 3JYTA 2WHOA 5KFNA 2X74A 2O4GA 3OYIA 1ZYQA 4EZ6A 5KFPA 1CXUA 4B3OB 3QGHA 1BCMA 2R7YA 4E7HA 5J2NB 3CQ8A 3CM5A 3PW5A 4U7CA 4NLRA 4ECSA 4ZVEA 2X6SA 4LSNA 3KHLA 4URQU 3DLBA 2J6SA 4ZPBA 4ZVFA 2W9BA 4CHNA 3OYCA 1JKHA 1NKCA 3OYAA 4DTJA 4QW9A 3U3GA 4DL2A 1T05B 4OPKA 4M3ZA 4RZRA 3CDEA 5KT7A 2R2RA 3QGGA 1TL3A 1S9GB 4GC7A 2JEGA 4K4SA 3SV3A 4ED7A 4NYFA 4O3QA 5KFSA 5J2QA 1R0AA 1HPZA 1I6JA 1TQLA 3KKSA 4CEDA 4NLQA 3QEIA 4HCCA 2C2DA 1JLFA 3HPOA 1SH0A 2P5GA 1MU2B 1C6VA 3KLIA 3H08A 1JLCA 5KGWA 1ZBLA 1K1QA 1UWBB 1HQEA 4B9UA 2FJVA 2GV9A 2OPSB 1BISA 2WB4A 2BQ3A 3MEEB 3V1QA 2IJNA 1QHTA 4FS1A 1KVAA 1JLEB 4IG3A 3KHHA 1EXQA 1EETB 4FZYA 3BDPA 2A1SA 1TVRA 1VSFA 2V0NA 3G10A 1VSKA 3PW2A 1S10A 3LANA 2OZSA 4KV8B 1KLMB 2J6UA 1WSGA 4DSLA 3T1AA 3VQBA 5KRSA 4IOBA 3BGRA 3MFHA 4FJ5A 5C25A 2XHBA 4EO8A 3A2FA 1IKWA 3AO3A 2OYQA 4HVJA 4KI4A 4QCLA 4B9NA 1RTJA 2D41A 5CZ1A 1T3NA 2ASLA 4IQXA 1BCOA 3LP0A 4WFZA 3AA4A 1TL1A 4QWEA 1S1TB 3OSNA 4HKQA 2IOCA 3RB6A 1WAJA 3BSOA 3CM6A 4DS4A 2F96A 4Y1CA 3RMAA 2IAJB 3I0SA 2UVRA 3HYFA 3OHAA 4CJ4A 2ZE2B 3BSCA 3CWJA 4EBEA 4E7JA 4M3UA 1VRTB 4IRDA 4RW4A 3GQCA 4ZP6A 4DF8A 4M41A 5KFEA 3H4DA 3KK3A 3OYJA 1W25A 5EDWA 1RDBA 3IN5A 2Z1GA 5HRRA 3OYHA 1CLQA 3MEGA 3ZT2A 2VG5A 1ZTWA 2C28A 1HJRA 4WXOA 1S1WB 2I5JA 3ASMA 4IH6A 3HO1A 3KOAA 1N48A 5KFQA 4B3OA 4WXWA 4JV1A 5KI6A 2OPQB 4YNQA 5J2NA 4FLVA 3QEXA 5KTQA 2C2EA 5J2PB 1C0TB 2IM1A 2BQUA 2DFFA 1DTTB 3QEPA 2GBZA 4EYIB 2WOMB 1ASUA 1NOYA 4MK7A 4WE1B 1IH7A 4XIUA 3HP9A 4M3WA 1W9HA 1RTDB 4X2BA 1JXEA 4H4MB 2ILYA 2FVQA 1T05A 4AILC 4J9RA 1LW0B 3QLHB 3F9KA 4CEOA 1RBUA 4DFJA 4WZMA 2CKWA 3IAYA 1J5OB 5KGXA 3CDUA 1S9GA 4FM0A 3PR5B 1J9AA 2W8LA 3ULDA 4TYBA 1LWEB 3RRGA 1RAJA 4KTQA 4NYZA 3KD1E 4GW6A 4FJIA 2R8GA 2X6NA 1MU2A 4KO0A 3PX0A 2RDIA 4TLRA 1UWBA 1S0NA 1Y97A 5KT4A 2OPSA 3ZSRA 3LP1B 4CJ3A 3MEEA 5KFAA 4DTPA 2UUTA 3D0PA 2RF2A 4PWDB 3CYMA 1JLEA 4NLOA 1EETA 4J2BA 4K4WA 4ZP8A 4O3RA 4J9NA 4ECRA 3EY1A 4CJSA 3H2LA 3ZSWA 3KTQA 2DPIA 4TY8B 1T8EA 4KV8A 4ED6A 1KLMA 4EBCA 4OKEA 4AH9A 2KQ2A 2FVSA 4BACA 4NLUA 1TKXB 1SL1A 3V9WA 3FRZA 3OLBA 3GV7B 3ZSZA 1SUQB 2IC3B 1KTQA 4ELUA 3Q8RB 4JS4A 1XHXA 3WNGA 2ALZA 3EYZA 4YFUA 3I5CA 2E6MA 2AGPA 3S9HA 3G86A 1S1TA 3VQ7A 4DL7A 2VWJA 4CEZA 3QESA 1DLOB 4CFCA 1U4BA 3QIOA 2IAJA 3NAHA 3SI8A 4ID5B 5L1IA 2ZE2A 1S6PB 3NAEA 1UA0A 4CJVA 1VRTA 3V6JA 2FVRA 3BREA 2D5RA 4FJHA 3OVNA 3DM2A 1Z26A 4ECYA 4CEFA 1ZBHA 3QERA 2W9CB 4ECXA 1S1WA 2OA8A 3PR4A 4HUFA 5FROA 1L5UA 3KNAA 3NKYA 2OPQA 2BRKA 2ATQA 2WONA 5KG6A 3PW0A 2KFZA 5J2PA 3SNNA 1QE1A 4DSFA 1C0TA 3T19A 3MR3A 3RWUA 1DTTA 5T7BA 2WOMA 4ZPAA 1FKOB 4WE1A 3QIDA 3CJ5A 1S0OA 2XGPA 3D45A 3VQEA 4B9MA 1RTDA 2DFHA 4H4MA 1ZBIA 3ZSOA 4OJRA 1LW0A 3LDSA 3QLHA 3DOLB 5DK5A 3ALYA 1J5OA 1S9EB 3MR5A 3TAEA 1ZETA 5KFMA 4BDYA 2HVIA 2AWZA 2XGQA 4J2DA 4KHYA 1LWEA 3RTVA 5HRPA 4CIGA 4KHNA 5KFTA 2HWHA 3N6LA 3NGDA 3PUFA 3NE6A 4QAGA 1B92A 4GVMA 1S5JA 5KFCA 2P5OA 4KHRA 2VA3A 3L2UA 3GIJA 5DGAA 2RKIB 3TAGA 3V81B 1RT4A 3VQ9A 4E7IA 4BWJA 5DMRA 4CF0A 3N6MA 4ECVA 3LZIA 3LP1A 5FDLB 2QXFA 4E89A 5JS2A 3OL9A 1XHZA 4PWDA 5C42B 2YHBA 4KPYA 2QE5A 4O3NA 5KFFA 2XCPA 5F8GA 4CF2A 5KG1A 3D5MA 2JGUA 4FM2A 4FJ8A 2B4JA 4C8LA 1N5YB 1EKEA 4TY8A 4Q8EA 3NGYA 4IFVB 4ICLA 4KAZA 4NLDA 1ZBUA 1CSJA 1TKXA 4CIEA 3VN5A 3ITHB 4F4YA 1SUQA 2IC3A 4CF8A 4G3IA 2XWYA 2W8KA 3QEWA 1W0HA 4JRPA 5EWEA 4BDPA 1DLOA 4M45A 2OPPB 2HHSA 5KT3A 4LQ3A 3PO5A 4I2QB 3B6PA 4ID5A 4F2SA 1HQUB 1S6PA 1GOBA 3K58A 2ATLA 2IMWP 4RW8A 2FVCA 3HVTB 4URSA 4R5PB 4IKAA 4BDZA 4CIFA 3M8QB 1LV5A 2HHVA 1NK6A 1IG9A 2W9CA 3HPGA 2KFNA 3QO9B 4MH8A 2JEIA 5T14A 4RNMA 3VQDA 5KFXA 4TQRA 5L1JA 3V1OA 3WNFA 1VSEA 4CEQA 3HK2A 4K4VA 4F3OA 3H59A 2W9AA 5L1KA 2HVHA 2G8FA 4BE2A 2JLEA 1WSHA 4CEBA 3BSAA 4NLXA 3D28A 3NF8A 4RW7B 4OLAA 4YMEA 5CYMB 2HNYB 3T3FA 3AVKA 3HT3A 1LWCB 3DLGB 4IH5A 4WYLA 3DOLA 5C5JA 5KG2A 1C0UB 4IRCA 3KK1B 1S9EA 1B9FA 4C8OA 3OYGA 3NH2A 2VG6B 1D9FA 3PJXA 1QTMA 1VSJA 4Z4IA 4GMJB 1YTUA 3DLKB 4FJ9A 4QWAA 1TV6B 3L3UA 2O4IA 3SFGA 4F3TA 1LAWA 5KFWA 3RAQA 1WNSA 4Y1DA 4ELVA 2RKIA 3NBPB 3G0ZA 4IG0B 3V81A 3VQ6A 3ZCMA 1REVA 4DQRA 3AA5X 5FDLA 2IA6A 1VSIA 4AHUA 4CEEA 2DY4A 3OYFA 5C42A 3NL0A 4EZ9A 5KRTA 4DQSA 1KLNA 3SQ1A 3T5KA 3L2RA 1N5YA 4CJUA 1A5XA 3ZSXA 1DTQB 3RRHA 1ZTTA 4IFVA 5DG7A 1Q9YA 4CERA 3MXJA 3IGNA 1G15A 3V9XA 3MF5A 4ED3A 2XI3A 5KG5A 3NGIA 3NDKA 1S48A 3ITHA 5J2MB 1D0EA 2HHWA 3SV4A 2VA2A 4KTWA 1N56A 1KRPA 4Q0BB 1JLGB 1RT1B 4Q8FA 4YR0A 3JSMA 4EYHB 3CG7A 3S3NA 2FJWA 4DL5A 1BHLA 2OPPA 4FK0A 4CK3A 3VA0A 4I2QA 4FZZA 3OJSA 1RT6B 4OGCA 2G8WA 4FJNA 3QZ8A 3VQ4A 3OL6A 1RDAA 1Z25A 4DFMA 3HVTA 5DLGA 4FLTA 4R5PA 5KFZA 3OS0A 4XO0A 4CGHA 3TANA 3M8QA 1JLBB 4RW6B 1TKDA 4E19A 4E1NA 4CHOA 3KHGA 3KMQA 2VWKA 1T94A 2PY5A 5EWFA 5DG8A 1C1BB 2WK4A 3UPFA 4DFKA 5F8MA 3QO9A 3MEDB 1XR5A 3NAIA 1IKVA 4TN2A 5KFYA 1FK9B 1D8YA 1NKBA 1U09A 4ED2A 2HNZB 3DOKB 1JLQB 3K5OA 5HP1B 4ECQA 4DEZA 3E01B 4RW7A 4FLUA 1RDCA 4TQSA 4KFBB 5CYMA 4W5TA 4J2EA 2BR0A 2HNYA 1RBSA 4DLEA 3QETA 1LWCA 1S1VB 3DLGA 5FRNA 4IH7A 1F21A 1C0UA 3KK1A 3QNNA 3RR7A 3OJUA 1WNEA 5EUHA 4AHCA 4FK2A 2XRIA 2VG6A 4NRUA 1NHUA 5F8JA 3O4QA 3HP6A 1J54A 4CF1A 2GC8A 1EP4B 3DLKA 3DDKA 4BE0A 2VG7B 1YT3A 1TV6A 3EPGA 4AHRA 4Y2AA 5K14B 3M8RA 2UVVA 2YNGA 4J9PA 4CFBA 4CCHA 2FC0A 2Z1HA 3NBPA 3PX4A 4IG0A 3KKRA 2BANB 1HNVB 4BWMA 4CFDA 3MTKA 2BQRA 4Q44A 1SKRA 1U47A 1IKYB 4RNOA 3FSIA 3KLVA 2Z1IA 1WLJA 4H8KA 1YVUA 5KFUA 4F4XA 4BE1A 3VQ5A 2AQ4A 4KBIA 1EX4A 3HPHA 4W5NA 4XPCA 1NK0A 1DTQA 4J9QA 5F8HA 3OY9A 3SUNA 4DTXA 3Q8QB 1RYRA 1S1XB 4ZHRB 2V9WA 4KE5A 2ASJA 1TKZB 5J2MA 2B6AB 4O55A 2P51A 3C6TB 4TXSA 2DFEA 4Q0BA 1K6YA 1JLGA 1RT1A 4DTRA 4WYWA 1UOCA 3RAXA 4Z4HA 4DMNA 3ISNC 4R0EA 4ZP9A 4DTNA 5HROB 4FW1A 4NYNA 4NLGA 4LH5A 3BSNA 4KI6A 1RT6A 1BQMB 4NZ0A 1RBVA 4ZVGA 1JX4A 4UQGA 3M8PB 2E6LA 3RB4A 4R8UB 1L3UA 2F8EX 3DLRA 2FBXA 2YHAA 4Q45A 2C22A 1RDDA 3CFOA 1JLBA 4RW6A 2FJXA 3LP3A 5DQIA 1K1SA 3QEVA 3QNOA 1C1BA 4ZMMA 1RTIB 1TAQA 2YKNB 2R2SA 3MEDA 5EWGA 3BJYA 3G6VA 2AJQA 3ZT4A 5L9XA 1FK9A 5HRNA 4NLWA 3T5HA 2HNZA 3DOKA 1JLQA 2KW4A 4FZXC 3CJ2A 4FVMA 3NCIA 3H5XA 3CO9A 1JXBA 5HP1A 4J2AA 2BE2B 4OPJA 3AO5A 1UA1A 3E01A 3SFUA 4ZP7A 3RBDA 4U6PA 1KSPA 2IDOA 5KFGA 4E1MA 4KFBA 4OL8A 4ZTFA 4FXDA 3CFPA 1RBRA 5F9LA 4FYDA 3ZSYA 1D1UA 2GUIA 1RTHB 2XY7A 3U6FA 3QYYA 3K57A 3I8DA 3L2QA 4DS5A 2V4QA 3THVA 3HVWA 4NCGB 1T03B 4RG8A 2G8UA 4M3TA 4KB0A 2F8SA 4O3SA 3KLGB 2VG7A 3V6HA 4M42A 5K14A 1UAXA 3EZUA 2FBVA 3HVAA 3T5JA 1ITGA 3K59A 1LW2B 2D3UA 1RT3B 4AHSA 4J9SA 5DG9A 2IM2A 4NLYA 5J1EB 3KMSA 2IS3A 3DI6B 3VQPA 1NK9A 1RNHA 4O3OA 2BANA 2HHUA 1HNVA 4FJ7A 3DRRB 3AV9A 3K5NA 4KHWA 4ED8A 2HW3A 4RNHA 1IKYA 1JIHA 4RNFA 1RT2B 4OKKA 3ISND 4JUZA 1NNDA 2BRLA 2OPRB 1TK0A 4IRKA 4RU9A 1CXQA 3IRXB 3ICLA 3SUOA 4ZPDA 1FKPB 4DQIA 4CGFA 5FRMA 4DTSA 1S1XA 4ZHRA 2R2TA 1TKZA 1VSLA 2B6AA 3ZSQA 3QIPB 3C6TA 5I3UB 1N6QB 4URGA 1T7PA 4B08A 3ZT0A 3RB3A 4XPEA 3TAPA 3OS2A 1VSHA 4DTOA 2E4LA 3P5JA 3PX6A 3MECB 3O4NA 1OS5A 3HM9A 4H54A 2R8JA 3V9ZA 1BQMA 5KFDA 1RYSA 4ZTJA 2YKMB 3OL8A 3M8PA 1JLAB 2JEJA 4DG1B 3JYTB 3CJ0A 4R8UA 2EHGA 1BI4B 3M9MB 1FXXA 1KVCA 4N47A 2UVWA 1RCHA 3TAQA 4LD0A 1RTIA 3AA3A 2YKNA 5KFRA 2ILZA 2HNDB 1C0MA 3T5LA 3SCXA 4DFPA 2JEFA 2HHQA 4RW9B 1XR6A 1IKXB 4GC6A 1NK5A 2XI2A 4EO6A 4JS5A 3SI6A 4FCYA 3KK2B 2BE2A 4DTMA 2XY8A 3MR2A 1HYZA 1L3VA 2WCXA 4Y34A 4JLHA 3AO2A 3IG1B 5DLFA 1I3AA 4K4UA 4J9LA 4CFAA 2R8KA 1RTHA 4W5RA 1QS4A 4CJTA 5KG7A 4K8XA 2W7PA 4ED0A 1S9FA 4FLWA 3GYNA 3M9NB 4K4XA 2RPIA 1SKSA 4NCGA 4HTUA 2RN2A 1T03A 3TVKA 1WN7A 1HYVA 4CJFA 1TK5A 2PZSA 4CJEA 3KLGA 1QSYA 2XY6A 2YNFB 1LW2A 1X9MA 1RT3A 4E7LA 2HHTA 3H5UA 4O44B 5J1EA 3WNHA 3DI6A 4TSXA 3OYEA 4F4ZA 1TVRB 3DRRA 3C94A 1XWLA 5F8NA 4NLPA 3IS9B 3BR9A 4M95A 4Y3CA 1RT2A 4Z0UA 4I7FB 3HJFA 4YR2A 4C8NA 4CHPA 3MR6A 3TQ1A 2OPRA 1IKWB 1FKOA 3V6DB 4Z4EA 3DYAB 3H5YA 3L2WA 2B5JB 2R8HA 3KJVB 3IRXA 1FKPA 3ZSVA 3VQCA 2KZMA 1BQNB 5SWMA 4LY7A 4HUEA 1TK8A 4C8MA 4CJ5A 2PYJA 2CJQA 2G8IA 3I0SB 4W5QA 3QIPA 2E9ZA 5I3UA 1N6QA 1NK7A 2AX1A 2PYLA 3MXMA 2HMIB 4RUAA 5KG0A 1VSMA 3OS1A 4KKOB 3M9OB 2B43A 4E7KA 4J9OA 2YV0X 4ECWA 2OZMA 3MECA 4EEYA 2FLPA 4K50A 3VQSA 1RILA 1NK4A 3WNEA 3GV5B 3IGVA 4NCBA 2D0CA 4E3SA 4DWIA 1S4FA 5C24B 4O0JA 2YKMA 4FJJA 2R2UA 1JLAA 4K4YA 4DG1A 4RUCA 3M8SA 2ETJA 1BI4A 3I0RB 1QQCA 3V9SA 3HXMA 4N76A 2A1RA 4CHQA 3MFIA 3V9UA 3GIIA 4CESA 4ED1A 3DLEB 4FBTA 4CEAA 1LWFB 2FLLA 4H4OB 2FLNA 4CJLA 4I9LA 5CYQB 1O1WA 1WSEA 1GX5A 1CZBA 2HNDA 4TY9A 4CGGA 4FJXA 4ELTA 1HRHA 4O4GB 4J9KA 4CJQA 3CJ4A 2HWIA 5CY4A 4RW9A 2D3ZA 1IKXA 1S97A 2O5DA 4QOZB 4DQQA 2E9RX 3PV8A 4NCAA 3E51A 2XO7A 3PJWA 3KK2A 4OLBA 4CJWA 4QW8A 2AGQA 1BIUA 2HHXA 1J53A 1S6QB 2NUBA 4O5BA 3PW4A 4IDKB 4FK4A 3O3FA 3IG1A 4MIBA 2I1RA 1L3SA 1RT5B 4KSEB 4QWDA 1HQUA 5DQHA 4DF4A 4YQWA 1NJZA 4N56A 1QUVA 1ASVA 4IFYB 4KO0B 5DQGA 4ECTA 1IM4A 4JV2A 4J9MA 4F2RA 4PY5A 2P1JA 4OGEA 3RBEA 3CVKA 1KHVA 3H40A 1C1CB 1RBTA 3AA2A 1KFSA 3EZ5A 4DU1A 3K5LA 4OVLA 1ASWA 3LPTA 2RF2B 1A5WA 2YNFA 4DLGA 1SL2A 1C1AA 3AO4A 4NRTA 4O44A 2ASDA 2IBKA 2EC0A 3KLHB 1WSIA 1HARA 3RMBA 3BQ1A 1IO2A 1GOAA 2Y1JA 3IS9A 4FJKA 3N6NA 5F9NA 3OLAA 4ZPCA 4I7FA 3TAMB 2HAIA 4CE9A 3VQ8A 2DTUA 3V6DA 1U04A 4O0IA 4IBNA 3I5AA 4O4RA 3DYAA 3AVMA 3OYMA 3H5SA 4DQPA 1D9DA 2B5JA 1A5VA 3KJVA 4FM1A 1WSFA 1YTAA 5KG3A 1LAVA 1RA6A 1BQNA 4MK8A 2XC9A 3LALA 4LQ9A 5KFOA 1HNIB 3RMCA 4ID1A 3UQSA 3CIZA 4MK9A 1U49A 3FFIB 4K4ZA 3TAFA 3AVGA 2HMIA 2G8HA 2WTFA 4PQUB 4EP4A 1NK8A 3SPZA 1KVBA 3Q8PB 4O3PA 1Q9XA 4KKOA 3KIOA 4CGJA 2FBTA 3C6UB 3DMJB 2IM3A 3DM2B 2YNIB 4DSKA 1WAFA 2W7OA 1JL2A 2JC0A 1HMVB 2V4RA 3KLFB 1NOZA 1RT7B 5C24A 3QINA 3DRSB 5D3GB 3I0RA 5JS1A 2FBYA 4Y2CA 1NJWA 3DLEA 1TP7A 4RNNA 2WONB 1LWFA 3LP2B 4KREA 3AVNA 4H4OA 3PZPA 5CYQA 1QE1B 3S3OA 4LSLB 1Q8IA 5SZTA 3EPIA 2F8TA 3QZ7A 1I39A 1S49A 4HHTA 1SV5B 4CGDA 4FJMA 3L3VA 1S0MA 4O4GA 3OYKA 1D5AA 3AVHA 1KHWA 3S3MA 2HB5A 4FLYA 1S1UB 4K8ZA 5E41A 3H4BA 4MFBB 2J6TA 3OHBA 4N41A 3FQKA 1S6QA 3NF7A 1NKEA 4IDKA 1CZ9A 1SL0A 3V4IB 4QPXA 1RT5A 4CHZA 4Z4FA 3AVLA 3PVXA 5JUMA 4F4KA 3UDLA 3VQAA 1XC9A 3SQ0A 4IFYA 5KFKA 1HYSB 3P83D 5KG4A 4KRFA 3O3HA 3NFAA 4OKJA 1RT4B 4E0DA 1C1CA 5KT2A 3SYZA 4CJKA 1QAIA 3G6XA 5F8IA 4AHVA 4FBUA 2YNHB 4DL4A 1TKTB 1GOCA 2E9TA 4CECA 4PUOB 3HHKA 1ZBFA 3AO1A 4KHSA 4MQ3A 4KTZA 2IGIA 5F8LA 3DLHA 3KLHA 4G1QB 3RB0A 2AGOA 3RR8A 1VRUB 4DTUA 3O3GA 4DSJA 4L8RB 4ICLB 2G8KA 1JL1A 3AVIA 5L1LA 3TAMA 3OYNA 3CDWA 2UUWA 4B8AB 3C95A 2Y1IA 4B9SA 1MMLA 4N5SA 3L2VA 1SH3A 2G8VA 1S1VA 3PHEA 3H98A 5KFIA 3UIQA 3HSTB 5KFVA 4YR3A 4FS2A 3NH0A 3AVCA 1HNIA 5DGBA 3FDSA 4TYAA 3FFIA 1EP4A 2UVUA 1BGXT 2IM0A 4RW8B 4PQUA 2RDJA 4CF9A 3OSPA 3C6UA 3GIMA 4JV0A 4I2PB 4HUGA 4DL6A 3DMJA 4FLXA 3PW7A 2JC1A 4FLZA 2YNIA 4ECUA 3P1GA 1HMVA 2ZD1B 3KLFA 1RT7A 3KLEB 3DRSA 3Q8SB 5D3GA 1WSJA 4PA1A 3SJJA 4YP3A 3U3YA 1NHVA 3SPYA 3K5MA 1U48A 2D7SA 4CK2A 4KAIA 1QAJA 3OYBA 3L8BA 3NF9A 3LP2A 2GIQA 3UR0A 3GIKA 4B8CA 5HLFB 3RMDA 2XCAA 1N4LA 4LSLA 5HBMB 1SKWA 4ECZA 1KFDA 2QK9A 4NLVA 4F50A 1BIZA 4M3RA 1XI1A 3TWHA 3HL8A 1SV5A 4FJLA 3OYLA 4M94A 2EX3A 3LZJA 4QWBA 3BQ0A 1L3TA 4M3YA 1RDRA 3F73A 4I9QA 3CFRA 2C2RA 2Z1JA 1S1UA 4MFBA 4Q5VA 2KTQA 5I42B 1VK0A 3PO4A 5EU7A 4AHTA 5HROA 4HYKA 3BQ2A 2Q3SA 1Z4UA 3V4IA 3I5BA 1NJYA 4EBDA 3PY8A 4ZVHA 2QKKA 2ZKUA 1VSDA 2AU0A 3NHGA 3DRPB 4IKFA 1GX6A 1HYSA 5KFLA 4KB1A 2QV6A 3KHRA 3MXIA 4EP5A 3NH1A 2R8IA 4LH4A 1REVB 2ZQBA 4M3XA 4KHUA 5KFHA 3AVJA 4LSNB 2YNHA 1TKTA 3OYDA 4PUOA 3LAMA 3LWLA 2BGGA 2LSNA 2W9BB 3HVRA 1NJXA 1X9WA 2AX0A 1JKHB 4KHMA 3OL7A 4G1QA 1TGOA 1VRUA 3SUQA 4FJGA 4DL3A 3GV8B 3TABA 4K4TA 2ITGA 3ZT3A 5HRSA 3VA3A 4B9LA 2FVPA 1TL3B 1YVFA 3FQLA 4KHQA 1BL3A 1RA7A 4WZQA 3SQ2A 5J2QB 1R0AB 1HPZB 3SZ2A 2KZZA 3GILA 1JXLA 1C2PA 5CZ2A 4Q43A 1JLFB 2W42A 3KLIB 2QKBA 3AVFA 3JSMB 3K2PA 1JLCB 1KCFA 1HQEB 4MKBA 3SQ4A
chains in the Genus database with same CATH superfamily
3K0SA 1ZA1B 1B9DA 4C8ZA 4DSEA 4GVBB 1RISA 4LRAA 3NF6A 3ZEUB 2KT3A 4J37A 2ZKTA 4OJHA 5ETPA 2DNZA 2FYXA 4C8KA 1RAGB 2MQLA 2BDPA 1Q82T 4FW2A 5BRDA 4KC5A 3VQQA 4JRQA 4QWCA 5KT5A 3M6XA 2ZD1A 5JJBA 3DN9A 2QWRA 1PKUA 5HVHA 3ZETA 5IWAJ 3UNGC 1UZHA 2OH2A 3V6KA 4DQ8A 1IBLK 1Q5YA 2YKAA 3NGZA 5J1NA 1C0GA 4IR1A 3HKWA 5GAEU 2MLXA 3GG0A 2XY5A 3SUPA 2OMLA 5C2GA 4HCBA 4PKGA 4DV1J 4ANCA 3MM6B 4DXLA 4WFYA 3HULA 4K2JA 1QSLA 1RDUA 4ITSA 4J5OA 3T9ZA 3TR8A 1Q78A 5HSPA 1SH2A 1FVSA 1CULB 2QA4N 2BH1A 2F5GA 4CNYA 1EHWA 4NLTA 1VBYA 4F8RA 5LJVA 3AVAA 5A2QU 1YDLA 2WHOA 4Z7CA 1BDGA 2X74A 1NZ8A 2B9EA 4HWIA 1YXQA 5KFPA 3QGHA 1BCMA 4E7HA 2RE2A 3U02A 1AT1B 2X6SA 5IWAF 4LSNA 3CE8A 3OTDA 4FP9A 2W9BA 4NO7A 2JWNA 3CPWR 4H03B 1JKHA 4FWRA 2HIYA 3OYAA 4OYWA 5MAOA 3U3GA 4X84A 4DL2A 1T05B 4OPKA 4M3ZA 3CDEA 2XSJA 3M2VB 1XUPO 4ED7A 4P7TA 2NSBA 3OFGA 2N4CA 4CEDA 4HCCA 1R3NA 1GMWA 1MU2B 1C6VA 1VQ5S 2VD3A 3QWPA 2V5HG 5A8KB 1JLCA 2GVZB 3VOVA 5KGWA 1UWBB 4B9UA 5BRHA 3DKDA 4DUTA 2GV9A 2KO1A 2PN6A 1SJ4P 1DJ0A 1Q53A 4GVBA 1QHTA 3WXKA 4FS1A 3KHHA 1EXQA 4FZYA 2A1SA 3CIMA 3IR6B 4CIOA 1TVRA 1NPPA 4WTOB 3O1BA 2DGWA 3G10A 2E7XA 4DR6F 2VQEJ 3O2IA 4JK7A 2V4JB 3BH7B 5KRSA 3UDEA 2YKOA 1YF5L 1UCNA 4EO8A 3A2FA 2UZAA 2QWMA 3L95X 3H3OB 4DV7J 4B9NA 4IQXA 1BCOA 2EG1A 2P9PB 4P2XA 2HBKA 3AA4A 4QWEA 4F0MA 5JVGL 4HKQA 1R31A 2B9YA 3H2UB 1WAJA 3CM6A 1MDUB 4X64J 2ZNZA 3RMAA 3I0SA 2UVRA 4CO4A 3HYFA 3DGVA 3MM6A 2M2BA 1VRTB 2G1HA 2HLTA 1CJTB 3GQCA 2HBMA 4DF8A 1WEYA 2KG1A 4M41A 5EDWA 5M1QA 1CULA 3IUCA 1R8AA 2ZEJA 1ZTWA 2D1CA 4PG8A 1HJRA 4OX9F 2VICA 1BY9A 4I1TA 2I7PA 4BC7A 4HTJA 5AFUH 4PL7A 5KFQA 3FCHA 4JI5F 1VS3A 4WXWA 3TEGA 3MMAA 4CZEA 3M6VA 1ZZFA 2VQEF 3TSUA 1Q8LA 4F36A 5A6WA 2DFFA 2HKEA 4GY2B 2B8PA 3R3LA 1QTNB 3D7EO 4FOEA 1HI1A 4M3WA 4W98A 3VF4A 7FD1A 1F9EB 4DV7F 5M2UA 4H4MB 1T05A 5B0BA 2YI1A 4ZJOA 1XMOJ 1RBUA 4WZMA 2UP1A 4JI0F 4BRHA 3M2VA 3CDUA 3U7JA 2YQ3A 3QAEA 4ED4A 4X64F 3M7VA 3PR5B 1SIZA 1J9AA 3AJ1A 2PDAA 3SMPA 1RAJA 2RE1A 1K0VA 4YN3B 3GIRA 3KD1E 5DDRC 4GW6A 3GJQB 2FXUA 2I7NA 1MU2A 3IFRA 2M70A 5A8KA 4CH1A 2GVZA 1HA1A 5DRKA 4B3SF 1UWBA 1AROP 3ZSRA 3LF0A 3HZGA 5D77A 2OP5A 1UEVA 5KFAA 4DTPA 2UUTA 2RF2A 1DY3A 4PWDB 2AEFA 3CYMA 3CCEN 1F2HA 4NLOA 4K4WA 4ZP8A 1JJ4A 4CJSA 3T1YF 3ZSWA 3KTQA 2AP1A 3EGWB 4LVNP 1NMNA 3PJ9A 4ED6A 5HK4A 4EBCA 4AH9A 4P7VA 2V4JA 4F7VA 4BACA 2HQFA 2KRRA 3EMTA 1UP1A 3SBTA 3W2WA 4W4MA 2ZWHA 1SI9A 4XDDA 4C97A 3R7NB 4JS4A 1R8BA 2BZ2A 3CC2S 3PM9A 2P9PA 1Y11A 3WUHA 3S9HA 4DL7A 4CFCA 3MMVA 4Z2XA 4WFBQ 1VJWA 1UA0A 3J81Y 4CJVA 1SQGA 2KHCA 1VRTA 5F41A 1CJTA 2BW7A 1BWEA 2XMKA 3IP0A 2HOEA 3DM2A 2DH7A 2LQ5A 4OZJA 1TUGB 2M4MA 3M8ZA 2IVNA 4HUFA 4OI3A 1YG0A 4BCAA 3BBCA 3QSIA 3MDFA 5KG6A 2VHGA 1MW7A 2UU9K 2AJ2A 4GMKA 4B1XB 1GLJO 2HG4A 1YTYA 3OA9A 1VRQC 4RL1A 4ZPAA 2VJVA 4C8YA 1WOSA 1S0OA 3VQEA 3D45A 2XGPA 3M6GA 2DFHA 3QRRA 2Y8WA 4H4MA 1F5AA 2KXNB 3CJ9A 2QWQA 4CRJA 3BGLA 5DK5A 1IR0A 3DNCA 3ALYA 2MZ1A 2XMTA 4WK1A 4X65K 4NA2A 3J7AN 3N5FA 2FC8A 3A1YG 2V7YA 1SCJB 2CJKA 1Y4ZB 2DH8A 3JTPA 4ANEA 2J9EA 4RTFD 1XC3A 1VDHA 3I96A 1KS2A 2BOPA 3JSRA 2CXEA 3TAGA 1RT4A 2B4OA 3UN3A 4CF0A 3MM7B 3CC4S 1YGYA 1RHKB 1U1LA 4U9RA 3I8BA 3OL9A 3LPYA 4PWDA 5C42B 2YHBA 2UXDF 2HBYB 2JLFA 4O3NA 4HTIA 5GAGU 2JGUA 2QFIA 3CCRN 2B4JA 2P9SB 4Q8EA 4IO8A 1GNKA 1K8AO 4ICLA 1WC3A 1HR0K 2A3JA 3A5OC 1FNMA 2MJNA 1VQ7S 4QIFA 2BX6A 4DDFA 4OYXA 1KC8O 4XH5A 2MQNA 4G3IA 1X4AA 3QEWA 4B02A 2ZJRL 1NGCA 5EWEA 3HLUA 4BDPA 2DGUA 2OPPB 4M5MA 2HHSA 5KT3A 1N33F 3MWPA 4I2QB 3B6PA 1HNZJ 4C1NK 1GOBA 4OPAA 1KTVA 1WSRA 2BKPA 3A0IX 4URSA 2MZSA 3D9BA 5C15A 3CCJN 1RGVA 2CQ4A 5FD1A 3LOUA 4NXNF 2V63A 5LL6d 3MN7A 3A3PB 2VFSA 3G9CA 2XYHB 3A5NC 1R8CA 4MH8A 3SCJE 1Q79A 3KG1A 4JBCA 5HJXA 4TQRA 2R7TA 2EFQA 2DR6A 5E2QA 1WSHA 3A13A 4FYXB 3S1TA 4OLAA 2DCLA 1WEZA 2E5JA 4CW7B 1PILA 2HNYB 2MMYA 4X4PA 1WBDA 3HT3A 4PYDA 3VQTA 5C5JA 4A5AA 1C0UB 4AXJA 3D0HE 1N5VA 3NH2A 1WC1A 2R7VA 2ADCA 4WBFA 3L3UA 2BTFA 3OTOF 3NGRA 1M90O 2IRUA 2R7QA 1UFLA 3HMJG 4CBXA 3AOAA 2WZ1A 3MM7A 4LFBJ 2N4DA 3AA5X 2IA6A 3TU5A 1BXNA 3W9IA 2YWGA 4I6MB 5F0WA 2W2QP 2R9LA 2DY4A 2QJ3A 5C42A 1ZOTA 4CLUA 4J90A 4DR2J 4DQSA 1KLNA 4WYBA 3L2RA 2P9SA 2V7ZA 4Y0WA 1A5XA 3ZSXA 1DTQB 3RRHA 2H1YA 2AMCB 3CCWA 2ATCB 3ENVA 3H90A 4B1VA 2XI3A 4DV5K 2QMWA 4C2MA 3VEXA 3NDKA 1IVZA 5EN1A 2VPWB 2VA2A 4YB7A 1RT1B 4Q8FA 4ERDA 4EYHB 5A8WB 3CG7A 2FJWA 4DL5A 1NB7A 2OPPA 2EBEA 2HHHJ 5HJYA 3G96A 4FK0A 3A8EA 3P4IA 4I2QA 4FZZA 3IBFB 3JTNA 4DKWA 2QL5B 1N32K 4OGCA 1N0VC 1X4BA 2R7UA 1RDAA 4LF5J 2FC9A 5DLGA 3OS0A 4JK8A 4CGHA 4YHHK 4R25A 4LFBF 1XTZA 1RUSA 4DV0K 3GCXP 1IJEB 5DG8A 3K9JA 1B0PA 1M1KO 1RJJA 4TN2A 5KFYA 1FJ7A 4E8UA 4FZVA 1FO1A 1NKBA 1U09A 3DOKB 3K5OA 4V19X 2QXLA 2NRHA 1LXJA 5HP1B 5AZIB 3SCIE 4B1ZA 3E01B 1DURA 4TQSA 4W5TA 2HNYA 3OUYB 2ROGA 3G8QA 4DLEA 3QETA 1S1VB 4BR7A 5F3ZA 4IH7A 1SJFA 1C0UA 3HSJA 5AQKA 3CD7A 2CVEA 1IBLJ 2HHHF 5EUHA 3I4PA 4FK2A 3TZWA 2H3GX 4NRUA 3FZ2A 5F8JA 1WG4A 1S6OA 2VG7B 1YT3A 3D2EB 4IEEA 2Q1NA 2YNGA 4J9PA 1IBCB 4CCHA 4QIGA 5E26A 1IWGA 1RKJA 5BR9A 4WPAA 2E1AA 2F8HA 3MWTA 3NLCA 2BQRA 3JAMY 1VQ4S 4I6MA 3OXLA 3DFEA 1U47A 2Z1IA 1WLJA 4H8KA 5AE3A 3C46A 3AAQA 4BE1A 2AQ4A 3HPHA 4W5NA 1WKKA 3J80Y 1DTQA 2EFVA 4J9QA 3OY9A 2GO8A 1YJWN 3MMBB 3Q8QB 3K7RA 2V9WA 2B3TB 3UE2A 4O55A 3A4TA 5LMNJ 1VQ9S 4TXSA 1K6YA 1RT1A 3ULEB 5A8WA 1Z1ZA 4Z4HA 1IBLF 2XB2D 1MWKA 5CQGA 1VBZA 3FZHA 3KNGA 4NYNA 2E1ZA 3BSNA 4KI6A 2XMVA 1R43A 2J0XA 4NASA 4NZ0A 1RBVA 3ENQA 2PFDA 4P10A 4HL9A 1U1KA 1M5OC 4R8UB 3VEZA 3E3XA 2FJXA 3IR5B 3CSKA 2AEJA 1TYQB 1FVQA 1KEKA 3FR0A 1WOQA 2CQBA 1XN9A 2CGLA 4L3QA 1EQYA 5EGYA 3CQYA 2AJQA 2IYIA 2HHPA 4RR5A 3VEWA 3T5HA 3DOKA 2OEKA 3M30B 1YITN 3NCQA 4Y28C 4LFCK 3VF0B 1JXBA 5HP1A 2F3JA 3PRVA 4J2AA 2FGCA 1IQZA 3E01A 5ETVA 3RBDA 1KSPA 4UT4A 4BC2A 4LIWA 2CPDA 4OL8A 2MLZA 3CFPA 1Q8KA 3OUYA 5BYQA 3OW2R 4JI7J 1OYDA 2DEIA 1RTHB 2W24A 2YX7A 2GUIA 3QYYA 3R5AA 3NWRA 1U02A 2ZC4A 1FJCA 2V4QA 3HVWA 4C3LA 4NCGB 2WBNA 4EFAC 4M3TA 3U1LA 4DV2J 2F8SA 5CD4H 1IBMJ 2VG7A 5FIIA 3V6HA 4QIWD 3D2EA 4ETXA 1RWWB 3B6BA 2DXDA 2LQ8A 4AHSA 4J9SA 2QL9B 3KMSA 2IS3A 3VQPA 3P49B 3DI6B 1RZMA 4WJBA 4O3OA 3DRRB 4L3KA 4KGVB 3NVKA 1K0TA 3ENWA 5GMKa 3K9KA 5AT1B 1JIHA 3DWLA 4OPHA 1T6CA 1RT2B 1NZAA 1T9WA 3ISND 5AE2A 4ZLJA 3QJJA 3US5A 1ZM4A 4PL8A 4RU9A 2BUNA 1CXQA 3QFPA 3EXCX 2OEMA 3MMBA 1RU1A 2FJDB 2R2TA 1ICEB 4A62A 2NPIA 1HD1A 1BOTO 2NQPA 1T7PA 4OYZA 1QZ6A 3TAPA 2IJRA 1HHTP 4PG4A 2QA1A 4DTOA 2E4LA 2DNYA 3HM9A 2A5XA 3SK3A 4CLYA 1X4EA 4Q7AA 5KOWA 4OYBA 1IBMF 4H54A 2R8JA 2YKMB 2GHWA 1W2BM 3OL8A 1G2EA 1JLAB 3FZFA 4DG1B 2WW8A 3JYTB 3CJ0A 3ILLA 4R8UA 2VPXB 3M9MB 3NS5A 4O8KA 2YCHA 1TYQA 3TAQA 5AQUA 3Q7CA 1RWMB 2ZF5O 2D69A 2GHVC 4RWTA 2OO4A 3ZYYX 2ZVIA 5FPDA 2OMOA 3MM9B 2G1DA 3ZTPA 4KGKA 4OHZA 1NK5A 4USHA 1D09B 3O9RA 3M30A 4TVAB 3S6EA 3J7YU 3A12A 4IDHA 5IZHA 3SI6A 2Y3YA 1QD1A 4K0KK 4DTMA 2UXCK 3JSBA 4B3MK 3MR2A 1HYZA 1HKCA 1V6HA 2WCXA 1S4EA 1IQTA 1Y9OA 2GMHA 1ROFA 1H98A 3NGSA 3J7ZO 4K4UA 4BGBA 4CFAA 1UFWA 4YY3J 4B9QA 1RTHA 2HFSA 2M5YA 4CJTA 4I6AA 1S9FA 3GYNA 3M1FA 4BBYA 4CZIA 4NCGA 4HTUA 3E66A 3EE9A 1KAYA 5E3AA 1V3ZA 3TA0A 1JK9B 1YZ6A 2NSCA 3W1YC 2GCFA 1T02A 4ES1A 3C19A 4Y00A 3DI6A 1FXLA 1H1VA 3OYEA 3DRRA 3FBFA 4FOIA 3C94A 1XWLA 3AFGA 5C0YA 1FWPA 4M95A 1RT2A 3A8JA 3ID8A 4C8NA 1T44A 4H5WA 4CHPA 3MR6A 3BF3A 4OI2A 1IKWB 1ZPWX 4FXVA 1GH8A 3C16B 3GWCA 4WFNL 4UUXA 1Q81O 3G4SS 3ZSVA 3DCAA 1U0HB 3IBWA 2MXYA 2G8IA 4YY3F 4W5QA 2E9ZA 1NK7A 2UU9J 2PYLA 3MXMA 2HMIB 1RCXB 2KL8A 3M9OB 1GEHA 2KHOA 1RILA 4USUA 3NCPA 4JKEA 2E2QA 2D0CA 4QBUA 2X7IA 1BQXA 5C24B 2YKMA 1JLAA 4K4YA 2DKOB 3D7SB 4DG1A 2LP4A 3IM8A 3M8SA 3I0RB 3D0IE 4P2FA 3HXMA 3F9MA 3W65A 1R8HA 3GIIA 4FBTA 2D0OA 1O1WA 4LBIA 1WSEA 4DN0A 5AZJB 4LF8K 1CZBA 1N5QA 4TY9A 5GAGP 2DGQA 4FJXA 3MM9A 2Q43A 5AE1A 2HWIA 4CLLA 1O51A 2D3ZA 2XMWA 3CCVN 1CPZA 2HQCA 3E51A 3PSIA 4BRAA 2UUBK 9ATCB 3PIPL 3UN2A 2AGQA 1VQSA 1KN6A 4QR1A 3PW4A 4FK4A 4G65A 2E66A 2ZJQL 3HM8A 3CTRA 2I1RA 2UU9F 1L3SA 1SS6A 1DQAA 4QWDA 5DQHA 2XMJA 5M1OA 2DGXA 4IFYB 4KO0B 2AV5A 5DQGA 3IKMA 1IM4A 1YRUA 1QM9A 2BJ1A 1AFIA 4OGEA 2O8DB 3RBEA 3CVKA 1BLUA 1C1CB 3X1LB 3AA2A 2A3ZA 1PJ5A 4DV4K 5BN8A 1T0TV 4ENOA 5AQPA 4OX7A 3SMZA 3CCMS 1A5WA 3SSQA 2IVOA 2XG8A 3P38A 1XMQJ 3CMES 2CPZA 4CT9A 3UN5A 1HARA 3ENAA 3OR2A 1IO2A 2Y1JA 4PEOA 1HWLA 5BR8J 1RAIB 4GNIA 4FJKA 5L46A 3N6NA 5F9NA 3BN4A 3OLAA 4ZPCA 4CE9A 1T3OA 5JVGQ 3CEDA 2DY1A 2DTUA 2R42A 4Y0FA 1DFDA 4F02A 2F63A 1U04A 3OYMA 1NO8A 4P2SA 3C16A 1DBDA 2F7TA 1WSFA 1NGAA 5KG3A 1LAVA 2JVOA 4JKCA 4MT1A 1PAUB 1MWQA 4MK8A 2XC9A 1U0HA 4CYUB 4LQ9A 4QYRA 5KFOA 1HNIB 5ETSA 3CIZA 3CUNA 3D2FB 2E7VA 3OBYA 1HR0F 2HMIA 4PQUB 2LEAA 2VFVA 3Q8PB 1T9TA 2HRYA 3C6UB 3TUPA 3P39A 3DMJB 3GJRB 4BC3A 2VDHA 3L0QA 3FCVA 4JD2B 3KLFB 1RHRB 3ZXWA 2MZQA 5C24A 3DRSB 3E9PA 3I0RA 5JS1A 4ZCIA 4EFHA 3DU5A 1TP7A 3MR7A 3K8WA 3W5ZA 4KREA 3AVNA 4ZPTR 2HFNA 1FEEA 5AZJA 3HZEA 3QGPA 3OR1B 4LSLB 4O23A 5SZTA 3EPIA 2CGKA 2HGMA 5HL7Q 1UVKA 1IR1A 1ZAVA 1SV5B 3OYKA 2GIFA 1QQNA 1D5AA 2YWHA 3IDHA 4MFBB 3V2UC 4AM6A 3OHBA 3IA0A 2MKKA 1NKEA 2VC1A 4NMLA 1CZ9A 3B8HA 1SL0A 5BPLA 3V4IB 4AF1A 4ID8A 3CCSS 4RUHA 2RT3A 1XC9A 2LCWA 1MN9A 4IFYA 4MAKA 2P9NB 5KG4A 4KH5A 3O3HA 1NGDA 3NFAA 3D66A 2O8DA 4OKJA 1C1CA 2CQPA 1FFWB 1QAIA 4CJKA 1YK9A 4PWWA 5CXTA 5F8IA 3IWLA 2IVMA 4WKYA 4FBUA 2YNHB 4ZIWA 4TU9A 3GSIA 3NOCA 4PUOB 2XMUA 3HDSA 1APSA 2QT7A 1ZBFA 4KHSA 2X3GA 4MQ3A 1OH7A 4DV3J 3DLHA 3VTHA 3BGOP 2AGOA 4U67Q 2VBXA 1N54B 1HPMA 3O3GA 2G8KA 1H3DA 3VAHA 3ZO7A 4UQTA 2YHYA 1MMLA 2YKQA 4WP3A 1NU4A 5KFIA 3R97A 3UIQA 2BE9B 5AJ3K 1U7LA 3NH0A 4CYUA 1UJ6A 1HNIA 3EGNA 3NOGA 3D2FA 3FVYA 1H2TZ 2WVCA 2IM0A 4PQUA 4ISGA 4DV5F 3DXBA 4FWPA 2DNQA 3HT0A 3R2DJ 3C6UA 3GIMA 2CQ0A 4HUGA 4DL6A 3DMJA 4FLXA 4FLZA 1T9YA 2H5JB 4JD2A 3KLFA 4PKIA 1VQKN 5H9FK 3VENA 3P31A 2HK2A 3DRSA 4PA1A 1IXKA 2ZFHA 2WVBA 1NSQA 5LXYA 1IN0A 4YP3A 1VQNN 3H7HB 3K5MA 1U48A 2R7XA 4CK2A 1N32F 2X1AA 3NF9A 2GIQA 3GIKA 4B8CA 5HLFB 3RMDA 3ILOA 3OR1A 1N4LA 4LSLA 5HBMB 5AQRA 2X1GA 1KFDA 1M1GA 3R5CA 4WQ5C 4KH0B 3GPAA 4YHHF 5D4NA 4F50A 1BIZA 2E7WA 3R8EA 4M3RA 2FY1A 3HL8A 1SV5A 5IM0B 4DV0F 3GE1A 3CCQS 4QWBA 3BQ0A 2ERRA 1L3TA 3KWGA 3F73A 4F9OA 2E5HA 3SEOA 2BW2A 1U1NA 4MFBA 5E0OA 1M5SA 2CPJA 4IOAL 1NHKL 2KTQA 5I42B 2H5IB 5GAEI 5GAHU 4HYKA 2RILA 3ZZYA 3BKFA 3PIOL 2I2YA 3V4IA 3WIVA 2HBRB 3PY8A 2AU0A 1AA1B 1E4FT 2P9NA 1OO0B 1F0XA 3NH1A 4LH4A 1KOHA 4M3XA 4YDUC 1F3VA 2YNHA 4UZBA 1FJGK 1RLDA 5HMZA 4OZ0A 4PUOA 3LWLA 1O8BA 2BGGA 1U1MA 5K8OA 4M63C 1X9WA 4LFAJ 5K8NA 1NGJA 1NG9A 1JJCB 4LF6K 1TGOA 4FJGA 2EWSA 4K4TA 3WQPA 2ITGA 4QPTA 2ZJRQ 4C4WA 4KHQA 2LQJA 2XULA 1BL3A 1HW9A 4EGLA 5EY4A 1HPZB 1VHIA 1C2PA 3ZZOA 2RHQB 2W42A 5LM7E 3JSMB 1EQ0A 2UUAK 4GV9A 3ATUA 1P6TA 2X51A 1M90T 3OFEA 2XNQA 2Q2RA 1OSDA 4NEZA 1HIYA 4RU2A 2DRDA 4K59A 3V1RA 4HI2A 2RMLA 4JV5K 2GEMA 2CH5A 2FJBB 3AAPA 3M3ZA 3E2EA 1KXPA 5IT9O 3B6OA 2R7SA 1A6LA 1X9SA 4JI3J 2D1KA 3VVTA 3BDEA 5KFJA 2LDYA 4DU4A 3QB0A 4BRNA 3BGRB 1IKVB 4JI4J 1TUWA 3TARA 2BBEA 2R7RA 3WIUA 5LOQA 3LPUA 5CE3A 5HLFA 3DXKB 2RQMA 2RSQA 3G6YA 2WRMA 5HBMA 1ZAWA 3ZZRA 1TL1B 2DPJA 1HWJA 4Z4CA 3BF4A 4PABA 5IM0A 3FFKB 2N7YA 7FDRA 4MO5A 3ZT1A 2WTUA 2E44A 1S72N 4IR9A 4BVOA 4MIAA 3MAQA 5I42A 3KK3B 1YX2A 2KVQE 1BE4A 2Q1LA 3QGIA 4LFCF 4J91A 2PA3A 1M5KC 5ETMA 1TL7B 1M1KT 3O9QA 3OYIA 2CFXA 1PCAA 1CXUA 4B3OB 3CCES 1XNRJ 2R7YA 5J2NB 3CM5A 3PW5A 3O80A 4U7CA 4NLRA 4DN9A 2A1BA 2GA7A 3MUTP 1Y3KA 1Q82O 3C0BA 1NKCA 4M5GA 4OHYA 1J5EK 4QW9A 4DMZA 3AB4B 5E3PA 5M1FA 4RZRA 1UW9A 1RE1B 2M88A 3OV7A 3HOSA 1B0VA 1U6ZA 3QGGA 3FCWA 4X4UA 3I33A 1O0PA 3EXYA 4O3QA 3EEQA 1HPZA 2W2NP 1D8ZA 2P5GA 1CZAN 1F5BA 1RHUB 4YOUA 1IJJA 2GAHC 4NPOA 3Q0AA 1K1QA 1OQ3A 1NSPA 2FJVA 4CLTA 1BISA 3C6AA 2WB4A 2VFTA 2GMJA 2A18A 2J0QD 3C3LA 2XLIA 3SBMA 5K20B 4PZVA 3QT5A 5D4LA 2UXCJ 1JLEB 2NZ4A 1BA0A 2P9LB 1YBTA 3BDPA 1YJUA 3CCLS 4YOTA 2ZZTA 3PW2A 2ZOGA 2OZSA 3LANA 1CLFA 5IOLA 3MDQA 4NE9C 3SQGB 3VQBA 4J7CA 3BGRA 4FJ5A 4MKYA 2OUGA 3CC7N 4DV6K 2O8FB 1SXLA 2KYZA 4KI4A 1E6VB 3AODA 4Q2LA 3DXKA 1T3NA 4BR2A 5GIOA 4NOHA 1XNQJ 2Z4PA 1TL1A 4NYOA 1S1TB 1FDNA 2IOCA 3BSOA 4E98A 1ZH5A 3MM5B 1GMVA 3IFEA 1X5TA 3DDIA 3CWJA 1XBWA 4EBEA 4E7JA 4M3UA 4IRDA 4CM2A 1EX8A 3H4DA 3KK3A 1W25A 2AYGA 2J0WA 4X4RA 5HRRA 2DHAA 1CLQA 3ZT2A 2KFYA 4K0KF 4WXOA 1S1WB 3VAKA 2UXCF 2L9DA 3ASMA 4B3MF 2EPIA 1UVMA 1Y7PA 3HO1A 4QIVA 1M5VC 2CNKB 4B3OA 2DT9A 4LC9B 5J2NA 1FF2A 3E9LA 4UOGA 2AYMA 1WOOA 1DAXA 3I56N 2BQUA 5CCLA 1DTTB 3QEPA 3BYRA 4EYIB 1ASUA 2DGSA 2BJ8A 2WSCC 1IH7A 3HP9A 2Q97A 4P71A 4HDHA 3SMSA 2ILYA 4AILC 1LW0B 2MQMA 2ZH2A 1XNQF 4CEOA 2BABA 3DGPB 3FUYA 4C3KA 5FLXY 1X4HA 4TYBA 3CD6N 2A2DA 4JHDB 2CUYA 1HFEL 1O13A 3LGMA 1S77D 2Z57B 1VAZA 4Y6IA 5RUBA 2IIHA 3C6HA 1R6VA 1S0NA 1Y97A 3K17A 1SC1B 4M7XA 2W4CA 3LP1B 4CJ3A 5D15A 5DM6L 4BLGA 2UUBJ 1RADB 2PO4A 2W2MP 2X1FA 2ZM6J 1JLEA 4EIAA 2A6OA 4J2BA 2P9LA 3QRQA 4O3RA 1YJ7A 5IC6B 3EY1A 1X8DA 4QZVB 3H2LA 3BF1A 2HBZB 3W8PA 1R0BG 1HD0A 4CD1A 1DRZA 4OKEA 3SQGA 1YI2N 5HVGA 3FMWA 2E2NA 4HI1A 1G6BA 3FRZA 3OLBA 5AQSA 4H0XB 1Z2LA 2O8FA 3UNYA 3CJBA 2XM3A 2R3VA 4JI6J 1XHXA 2ALZA 3MK6A 3EYZA 1Y00A 4YFUA 5AQNA 3G86A 1S1TA 1NM2A 3VQ7A 2VWJA 2KXFA 4CEZA 1DLOB 1X5PA 1U4BA 1KQSM 1WD6A 1X4GA 3FSXA 4C6AA 2C1EB 3SI8A 3TW0A 4LF8F 3CT9A 2O3DA 1HWKA 3AD7C 2VV5A 4EHUA 2WC9A 2Y8YA 2D5RA 1P9QC 1NLVA 5A2QY 3ENBA 1Z26A 2XS7A 3TTDA 4WFBL 1ZBHA 1N36J 2W6LA 3QERA 4FKYA 2IMOA 2UUBF 2ZH3A 4ECXA 1S1WA 2OA8A 2G0JA 5FROA 2IIRA 6FDRA 2OKQA 5HMYA 3TVYA 5CR4A 3GYXB 3OTBA 2CPEA 2QLBB 3QMQA 4JI1K 2FSNA 1QE1A 4DSFA 2HMPA 4LF9K 3MR3A 4DR7J 3MAHA 1S57A 1DTTA 3IMXA 2MKSA 4NXMK 3EL2A 1G3OA 2HVZA 2FY8A 5M2PA 1FKOB 1KQGB 3GR1A 3CJ5A 3BS9A 1TMJA 4WCEQ 4B9MA 2QC3A 3ZSOA 4OJRA 1LW0A 3LDSA 1TL5A 3TEHB 3UW1A 3DGPA 3MR5A 4N8OA 5KFMA 1HBMB 2CNOB 3JQJA 3W3DA 2QLJB 5KFTA 3PUFA 3NE6A 4QAGA 3DJCA 4WU3A 4KHRA 3L2UA 4OQJA 5DGAA 2RKIB 1FERA 3CMAN 2Z58B 4LF7K 1X5SA 3LZIA 3LP1A 5FDLB 3BB5A 2QXFA 1M5HA 2YJEA 1HBOB 3NNAA 4FXWA 2FHKA 1WHXA 2ZH1A 2YH0A 3KUHA 4OV6A 2QE5A 3LDLA 5F8GA 1SIWB 3QQCD 4FM2A 4C8LA 4DR3J 4CH7A 2W40A 3NGYA 2A6MA 2HQDA 5IS2A 2CDRB 2ZH7A 1Q81T 5KPZA 3EKUA 4CIEA 3VN5A 4B3TJ 4DHVA 5BYRA 3I4HX 2C2NA 4DR4J 2HZCA 2CNNB 2XWYA 4A8FA 2W8KA 4JRPA 2VF3A 1G4CA 4FWQA 4QQBA 4H0PA 1DLOA 4M45A 1KNZA 3MD3A 2D0PA 4LQ3A 3R6GB 1UEUA 4WIQA 4G6VB 3EO3A 1PYSB 5K8MA 3K58A 3PEHA 2MGZA 4R5PB 4IKAA 1RWVB 4BDZA 5ITHA 2KKZA 2VB6A 3M6WA 2HHVA 1BMQB 1NK6A 1IG9A 3N5BA 4CZCA 2KFNA 4CO1A 1HUXA 2V50A 2CJAA 5L1JA 4RCHA 3V1OA 4A2AA 4QU6A 4F3OA 1FRIA 4KH4A 3H59A 3N0VA 2W9AA 1X5OA 2G8FA 2ZDPA 3MCPA 5HQLA 4WFNQ 2GHPA 1LFWA 3D28A 1NU0A 3NF8A 1YJWS 3QBCA 3MI7X 3A5MC 3ILJA 4C48A 5H9FJ 1OPZA 3E9OA 1LWCB 3DLGB 5B0GA 4IH5A 1NDPA 4WYLA 5B0AA 4IRCA 2DRAA 2NR0A 4DR1K 1HBMA 3ZC4A 5HMXA 1UVNA 4FN5A 4ZK7M 1QTMA 1NSAA 1YKWA 4H0VB 2VKZG 5KFWA 3UFCX 1S12A 3RZAA 1WNSA 2GGPB 3BBBA 4GO5X 2RKIA 3VQ6A 1GQEA 5A0YB 3O3LA 5FDLA 4H5VA 5K8PA 4U7BA 4CEEA 4UF4A 2EWHA 3WC2A 2FSKA 5AJ3F 1HNWK 4EZ9A 5E5NA 2DXEA 2HPUA 4HR2A 3H25A 3W60A 1U2VB 1M0SA 3ZX0A 3EKSA 4CJUA 4HH1A 3D6FB 5DG7A 4P72A 3PG9A 4CERA 1Q9YA 3IGNA 3O8WA 1G15A 3MF5A 3O1LA 2MTLA 3PCOB 1MA9B 3D6MB 2LECA 5J2MB 2NZTA 2IVPA 1D0EA 2C3OA 2ZJQQ 5F0UA 1WHWA 4OFZA 2NUUG 1KRPA 4Q0BB 1ATNA 1JLGB 3A8YA 2OI2A 1FTCA 1YVNA 3CJ7A 2XS2A 4KRWA 2DR9A 3VGLA 2J7UA 4DFMA 5AQJA 4HT7A 4FLTA 4R5PA 5KFZA 3X3UA 5GINA 4GKJJ 1WB9A 3BKUA 2CQHA 4FWOA 3KMQA 1JNRB 5C7PA 2PY5A 2IPOB 3UPFA 4DFKA 3TUIC 2ROEA 4QIEA 1CQMA 3MEDB 4JP8A 2F9WA 4CI0B 4ED2A 4B17A 2JOQA 1PBAA 2GX9A 2IY5B 1HWUA 3QWUA 3HTVA 4IJNA 1G99A 1FRKA 3EE8A 2FHJA 3HHDA 1V4SA 2BUPA 2YWKA 3P4UB 1RBSA 5HQ8A 5AXKA 2HGLA 1H74A 5H9EJ 1LWCA 3DLGA 3THTA 4ZVRB 3TJ8A 3MCSA 2HRTA 5I4MA 1WNEA 3CJQA 2XRIA 3U9ZA 2ZBQA 3O4QA 1JMTA 4CF1A 1DKGD 3KFWX 3DDKA 4BE0A 2FLOA 3SBGA 4AHRA 3MHYA 5D0HA 4V19S 1CC7A 4DPTA 3JS9A 3FE1A 3CETA 4BWMA 2BKNA 1W2BR 2AZ1A 3PFEA 2ACYA 2YWEA 5A0YA 2KYXA 4P6QA 1TUYA 1H72C 5TKWA 3KLVA 1NGFA 3KJFB 1WBBA 2YXLA 3J81j 5KFUA 1GLDG 1U2VA 2W4DA 3VQ5A 2ZH9A 4KBIA 1EX4A 2VQFK 2OEJA 1NK0A 5U47A 3POTB 1I94K 1RHMB 2BJ7A 3GYGA 4DTXA 4JV5F 1RYRA 1MWZA 8ATCB 4BR0A 1PBUA 4D3GA 3VAJA 4S0MA 2GQQA 4KE5A 1Y64A 5J2MA 5E3CA 3SQOP 3OVBA 1I5OB 2P51A 4ZLLA 2ZVSA 3CCUS 3BY5A 4JKGB 4Q0BA 1JLGA 4PG5A 3JQMA 3GBTA 3ISNC 1OSCA 4DTNA 5HROB 4P74A 4NLGA 3AH6A 4LH5A 3AGKA 2P5VA 1ZBSA 3DHWC 1YJNN 2E6LA 2F8EX 5ADXA 2DHXA 2YHAA 2C22A 3B4MA 3CFOA 4WWSA 3LP3A 1QVFR 5DQIA 1PJ7A 4UW2A 4OZ5A 1Y0HA 2GS8A 1TAQA 2LYVA 4GKKK 3MEDA 2AKWB 3FGUA 1T6DA 1EWQA 5B0FA 3VESA 4U7UD 2KW4A 1ILYA 3CJ2A 2GELA 1HKAA 3VV2B 3SFUA 2EFOA 1F60B 1VQ5N 3ZSYA 4C7QA 4DUYJ 4ZA1A 3U6FA 4M5JA 2MJUA 3PACA 4ZVSB 3I8DA 3J7YI 3L2QA 4NLCA 4DS5A 1W7AA 1C4AA 4PHTX 2CJYB 5B09A 1J5EF 2G8UA 2GJIA 3AB2B 5E33A 3QT8A 2VOOA 4M42A 1V5IB 3HVAA 3T5JA 3GL1A 2V6AA 2D3UA 4JI8K 4B1UB 1RNHA 5D4OA 2HHUA 1XJWB 4KGZB 4FJ7A 3K5NA 4KHWA 2NXNA 3CXCR 3F56A 3ONQA 4RNHA 8AT1B 4RNFA 1R27B 4OKKA 2OFGX 1NNDA 3AOBA 1TK0A 1O6XA 4RPFA 4ZVQB 2XZWA 1V3SA 4UTGA 2AYEA 2JJ4D 1AUDA 3POTA 2CADA 1LOUA 3MUVP 4M8LA 1AFJA 1WDDA 3ICLA 3SUOA 1RB0A 1FKPB 3CCVS 4IOAQ 3PSFA 3IBCB 5IXUA 2C3YA 2ASYA 4OMFG 1N5SA 3ZSQA 2C3PA 1N6QB 3CF5Q 4V1Ak 1VQ8S 1IG8A 4XPEA 1U2RA 5GVQA 1OPIA 3HHLD 3R5JB 4C0BA 4DV6F 1FW6A 3PX6A 4ANDA 3O4NA 2UUCK 1OS5A 1WKJA 1YWXA 3NS6A 5KFDA 1WC4A 3BEXA 3O1WA 4ILMA 2K06A 1V5VA 1BI4B 5C2FA 2GJ2A 4QR0A 2KM8C 3JAMU 2OJ3A 3FBEA 1JXVA 2B7BB 2PI4A 1KBRA 1KAZA 4L75A 5EXWA 2WVEA 3ZZZA 4FPRA 2YPYA 2ILZA 3DOMB 4QS8A 1FNOA 1C0MA 3T5LA 5F3TA 3VTIA 4FPBA 1JJHA 2JEFA 1LFPA 4GC6A 2WBMA 4DZ6A 3G2XA 4JS5A 2JFKA 2H3EB 5LSRA 1V3RA 2XY8A 1U2CA 4JLHA 1FA0A 4DPXA 2XLJA 2CG4A 3IG1B 5DLFA 4KJIA 1RAAB 3UB5A 2MKHA 4A8QA 4CZKA 2QYCA 2C42A 2W7PA 4I6YA 3M9NB 4CBWA 2RN2A 3EGZA 2PZSA 2XNRA 2QSFA 1FFGB 2FZKB 4CJEA 2B7CB 2LU1A 2DNRA 1QSYA 3JSYA 1UVIA 2M9KA 2YNFB 1RAHB 1WI8A 2CVIA 1B4SA 2UV8A 3A8KA 3H5UA 4TSXA 1R8PA 2GW8A 1TVRB 1SZ2A 5F8NA 1JNZB 4JB8B 1KQKA 1RXOB 4I69A 4YR2A 5AQQA 3TQ1A 3V6DB 3H1QA 3ZZ0A 3H5YA 2X3DA 1ACMB 2Z2ZA 2B5JB 2FHJD 4H0TB 1FKPA 3UO0A 5AQVA 2OGUA 5AFUA 4LY7A 1J2VA 4HUEA 2JZ5A 4A8SA 4O5FA 5JMVA 4CJ5A 4OV1A 3I0SB 1YRXA 2F4VJ 3PTWA 2ZUGA 1N6QA 4AQYK 1X0PA 3OS1A 4NXMJ 2AJ0A 3NMUA 4HH0A 2LEPA 2OZMA 5LT5A 3BEGB 2FLPA 3VQSA 4FVCA 1NK4A 3GV5B 1NNEA 2M0GB 4NCBA 5ELZA 4E3SA 2R2UA 1BI4A 5AXNA 2D9OA 5BXIA 1QQCA 3MZIA 1S76D 3AD9C 3V9SA 4K42A 4N76A 3LGHA 5LY3A 1K73O 1I51B 3MFIA 4ED1A 4CEAA 3MMAB 4BQZA 2FLLA 4H4OB 4DU7A 2FLNA 5CYQB 2BEFA 5BREA 3EJMA 1GX5A 4DR6J 3DOMA 3SAGA 4LF7J 4CGGA 5LMUK 3F41A 4CJQA 1BD6A 3AQPA 4DQQA 4NCAA 3PV8A 2E9RX 4LIRA 3HSCA 3DXMB 2GJFA 4O5BA 1EQMA 2LA6A 4JI1F 2F4VF 2KN4A 2ZBPA 3O3FA 3IG1A 5KAKA 4MIBA 1HQUA 1Q7LB 4OI6A 1EKSA 1ASVA 4R0JA 4JKDA 2IVYA 4NXMF 1VC5A 1PAEX 2CIMA 4F2RA 3CJKB 3H6EA 1KHVA 3H40A 1RBTA 2BVZA 1DEJA 2EK1A 3EM1A 3LPTA 3GJTB 1H38A 2RF2B 3HSDA 2YNFA 1VQKS 4UY85 4OX9J 4NRTA 2ASDA 2IBKA 1WELA 3ZTRA 3NCRA 4C23A 4JI5J 4PXDA 3RMBA 2AYBA 1HLUA 2QWNA 2AJFE 1VIXA 2ROPA 3TAMB 1CG2A 1UPMB 4LF7F 4N77A 2VL1A 4YDDB 3V6DA 3W2WB 1VQOS 3I5AA 4O4RA 3AVMA 2NRTA 3H5SA 3RBXA 4DQPA 2B5JA 1A5VA 3OD2A 4OYIA 3N01A 2CJXB 4NEYA 2E1CA 1YTAA 1H7XA 4AM7A 4JI0J 1RA6A 1Q7YT 2ADBA 4USWA 2JL9A 1SC4B 3GZ7A 1P1LA 1GLLO 3RMCA 4CH0S 2WTFA 3THYA 4EP4A 1NK8A 3KIOA 4OJ1A 2OLWA 2IM3A 3DM2B 2CNLB 1WC5A 1ZA2B 1LNQA 3RW7A 4B3SJ 3FEXB 2W7OA 2R4FA 4I6WA 5F0XA 1NOZA 4QOTA 3BV8A 4RO0A 2B9XA 4F0HA 3MAAB 4Y2CA 1TU0B 1U8SA 4RNNA 5E3QA 3T1YJ 4OZLA 3LP2B 2RS2A 4H4OA 2IVFB 4I68A 5CYQA 3S3OA 2QMUB 3B54A 4DX5A 1Q8IA 1Q86O 2KXHA 1OQ6A 1NPRA 2QYGA 3QZ7A 4DJBA 3LO3A 4DUZK 5M1KA 1QVGR 1RTZA 4IO9Q 2V94A 2QSWA 3L3VA 3F0NA 5C2DA 3NMRA 1ZZNA 1C4CA 5I3PA 2SXLA 4AT1B 2PFFB 2H4YB 5JMNA 5E41A 3D1HA 5HL7L 1HNWJ 3DXMA 1LWXA 3HHNB 1RHQB 1BG3A 2HZAA 1KD1T 3D68A 1GAOA 1CJUB 2OD6A 1RWPB 4F4KA 1H2VZ 5DM6Q 3O5TB 4USJC 1HYSB 1Q5VA 3P83D 3CJKA 2YH1A 1RT4B 5KT2A 3SYZA 5GAHI 3G6XA 2B9WA 4DR1F 4BC5A 4ZVUB 4DL4A 1TKTB 3HHKA 3UCZP 1FE0A 1LK5A 2EEYA 4CBUA 2IGIA 5F8LA 4CLWA 1CJVA 2XHWA 4G1QB 3WDOA 4DTUA 2L08A 4ICLB 2VJUA 1M1HA 3PDNA 1BO5O 5AQFA 1PYTA 2DEJA 1VQMS 1ATRA 2MHNA 3TAMA 3CDWA 2UUWA 4C0HA 2LVWA 4IJAA 2UV8G 1VBXA 4U67L 4AL5A 4OZ2A 1SH3A 2G8VA 4ZJLA 3PHEA 3QPIA 2EG2A 1HNWF 2QTWA 3ZZTA 3VERA 1B70B 4XEIA 2GFFA 5KFVA 4YR3A 1W7WA 3H45C 4OYOA 5DGBA 5IT0A 4A59A 2V8DA 4A57A 1EP4A 2NNWA 4DOZA 3MXHP 2VH7A 2QRRA 1R7IA 2UVUA 2ZHOA 3QBXA 2RDJA 4FF1A 1OH8A 4CF9A 1GT8A 3MWBA 4I2PB 3V4MA 1XIQA 2QGFB 3M2UB 5CH7B 2KT2A 3W61A 2XHCA 4DV1K 4OHWA 3GMGA 2J7WA 2CG8A 3FRYA 3DAWA 3G6EN 1R6YA 1MLAA 1WSJA 1WG5A 3SJJA 4NI2B 5T41A 3U3YA 2UXDJ 3MAAA 1OY8A 3BGFA 2RVJA 2D7SA 1FKAF 1BWFO 1QLNA 4WFAL 1QAJA 1VC0A 3OYBA 3LP2A 3G71N 2XCAA 1I3OB 3OPKA 1SKWA 3J81O 1B64A 2QK9A 3R6LB 4HVZA 4K43A 4FJLA 2K2PA 3T1HK 5C10A 5HQMA 3MPVA 3LZJA 1OH6A 3SXLA 1MNEA 3S01A 2OHDA 3Q8YA 2B4VA 2BJ3A 4YB1P 4Q5VA 3PO4A 3OBWA 4I0WA 2VQFJ 3NNHA 2F9JA 1N33J 1CJUA 5CZVA 1RDWX 4EBDA 3EDQB 2J5AA 3DRPB 4AD6A 1HYSA 2QI2A 4KB1A 2QV6A 5MLCQ 2JHEA 4EP5A 2O8BB 3MOJB 2ZQBA 1ELOA 5IT4A 4C0OC 5KFHA 1VMBA 4NXNJ 1GXTA 2CGJA 1TKTA 5C2CA 2L3MA 3C65A 4LRDA 5LXRA 3UD4P 4KHMA 4CDIA 3OL7A 4G1QA 4XH4A 2AF6A 1HQ2A 4DL3A 3T41A 3FBBA 3O6QA 2R7WA 2KT5A 3ZT3A 5B08A 4L6V3 1TL3B 3HZ6A 2KHDA 5LL6Z 1RA7A 4WZQA 3SQ2A 5J2QB 2Q6BA 2BMBA 4DCPB 2PC6A 1JXLA 4Q43A 3K5PA 2QKBA 3K2PA 4GKKJ 1IUJA 3VZHA 1KCFA 1NDKA 1HQEB 3QFWA 2VQFF 2RNEA 4MKBA 2BM1A 3SQ4A 3GR0A 3B78A 1I94F 2HQIA 3HD1A 2MSTA 2P6TA 3CPEA 2HF3A 2HFUA 1OWXA 2EBGA 4K5SA 4B1WB 3OTOJ 3BGUA 1M5PC 1FRMA 2XEXA 3HX9A 5B0EA 4CJPA 4I2PA 4A8XA 2MQ8A 3M2UA 3C15B 3LWMA 4DSIA 3NY0A 1TUVA 2CZVC 5D8HB 2YTCA 2A10A 4F4WA 3I56S 4B9VA 1ZM9A 4NI2A 1UPPA 2OSRA 4W5OA 5KQDA 1S3XA 1RTJB 3KJNB 2WW4A 3A3OB 4IYQA 3MN9A 2AIRB 4PAAA 2QWLA 3OW2M 2IJFA 4AL6A 2D0AA 2MQPA 4CK1A 2HSEB 3TI0A 1MWMA 1FHTA 3VPZA 4CHYA 2BJ9A 1DGKN 2KM8B 2LMIA 4KB7A 3EGVA 4H5NA 4QU7A 1CEZA 5KFBA 4GKKF 3THPA 1KAXA 4Z4GA 2RH3A 1U45A 1PJ6A 2P2CB 3KUEA 1T9UA 3MEGB 2DGVA 4DU3A 3KJQB 3LQVA 3BO3A 2VG5B 1X0FA 3C2PA 3CJ3A 2I5JB 4NX9A 1XMOK 3AY9A 3DRPA 2YNGB 4MKAA 2F1FA 1YBUA 2B4UA 2VFUA 2O8BA 1VQLS 3CQ8A 1QHAA 4ZVEA 2Z8QA 2I0XA 3DLBA 3JXUA 2J6SA 4ZPBA 3W8GA 2M52A 2VGMA 1CQNA 2IBOA 2YQ1A 4MKVA 3OYCA 2PSZA 4F25A 2Q66A 2F8MA 4DTJA 1GLFO 2DO4A 2CQ1A 2QMXA 4CLFA 5KT7A 2R2RA 4JI8F 1WG1A 4PR6A 3ENHA 1TL3A 1EKRA 4GC7A 2JEGA 3KG0A 4I64A 3SV3A 3R6MA 4NYFA 2RUSA 5J2QA 1I6JA 1TQLA 4IXCA 3KKSA 3QEIA 3CB4A 5K9FA 3H08A 5ETKA 4CZLA 1KQSR 1FWLA 4RBVA 3A5LC 1ZPVA 3AT1B 1ZBLA 1HQEA 1P1TA 2A6AA 2BV3A 2KRBA 4YDXA 1VJQA 3V1QA 2ZBRA 2CJ9A 1OVYA 4L3NA 4MIWA 2IJNA 2FD2A 4PXCA 5FPMA 4LF4K 1EARA 1UFKA 4CVNE 4OO1J 2E5IA 3JXOA 3C15A 2QLFB 2V0NA 5LSLA 5E7OB 1PC4A 5D0GA 1WSGA 1VGYA 1X3NA 3T1AA 4IOBA 4CWBA 2UUCF 2RU9A 4A8OA 1BA1A 3AO3A 3W5XA 2OYQA 1S7IA 2JNJA 2KH9A 2KVIA 1RTJA 2D41A 5CZ1A 3UR3C 2MQOA 2ASLA 1ZBTA 2J7KA 3OSNA 4BRKA 1OH5A 3RB6A 5IT9U 4Z94A 1JJ2R 2F96A 4Y1CA 3L4BC 4CJ4A 2ZE2B 1OVQA 3BSCA 5GAEP 1OY6A 2FGOA 4ZP6A 4L73A 1WTBA 3HD2A 3IN5A 3CMAS 2CRLA 2HS0A 3MEGA 1FCAA 2VG5A 4HACB 2I5JA 3UI3A 4UZCA 4IH6A 3ID6A 2LU2A 3KOAA 1N48A 4HHJA 5KI6A 2OPQB 1ZM2A 1GLCG 5J2PB 1C0TB 1WSVA 2IM1A 3LL3A 3DLLL 4PXEA 2WOMB 4RWWA 2APOA 1NOYA 4MK7A 4WE1B 1W9HA 1JXEA 4X2BA 2FVQA 1T9VA 4J9RA 2ZZNA 4B3RK 2YVSA 2CKWA 3IAYA 3WBZA 4M1KA 2C2OB 2K3IA 2W8LA 3ULDA 1LWEB 2P6SA 3RRGA 4KTQA 4USMA 4NYZA 1E4GT 2DNNA 4FJIA 2R8GA 2X6NA 3JAMO 3PX0A 4NZ7A 3NWGA 3TWZA 2GZOA 3MN6A 5LMUJ 2J8AA 5KT4A 5D6GA 3FEZA 1BUPA 4DI6A 3RSEB 1FWKA 3SAFA 3J80O 3ADAC 3D0PA 2WUSA 3AHPA 3M8WA 5H1SQ 1VYAA 4XH1A 4FF4A 3EUNA 2MKYA 3VCDA 2I9SA 1HNZK 4WF9Q 1R0CB 1U26A 5AQOA 4I67A 3FKBA 4GV3A 2KQ2A 4NLUA 1SL1A 3V9WA 1PIEA 3GV7B 3MD1A 2J0SD 2IC3B 1KTQA 3Q8RB 3WNGA 5FPNA 1J6ZA 1V9OA 2ZNYA 3I5CA 2E6MA 1UEKA 2PFUA 3D3CJ 1VK3A 2AGPA 3OXGA 2PMHA 3QESA 1IJFB 1TFWA 3QIOA 4FL9A 2VUGA 1YHQN 5L1IA 3FNNA 5IQ6A 2ZE2A 4TLQA 1S6PB 3Q86A 1NBWA 1SJ1A 2NLWA 4PQAA 1VFJA 2FVRA 2HGNA 3BREA 5LMUF 4FJHA 1Q4RA 2E20A 4CEFA 4HACA 2W9CB 2W41A 3PR4A 4M5HA 3CMEN 3BO4A 4NYPA 3GCWP 3AARA 3KNAA 1MG7A 2OPQA 2ATQA 2WONA 2YHXA 3PW0A 2KFZA 5J2PA 1C0TA 3T19A 3M2RB 4USIA 3RWUA 2FQQB 2QFJA 2V34A 5T7BA 2WOMA 3I9V9 1FD8A 2HQGA 2RQ4A 4WE1A 1VHFA 3BH6B 4AYBD 1IM6A 3FSYA 2Z2LA 1ZBIA 3AGRA 3DOLB 1S9EB 3TAEA 4BDYA 2HVIA 3VGSA 2AWZA 2P9CA 3NEKA 4EHTA 4DR2K 2XGQA 3OVSA 1LWEA 3RTVA 4WCEL 4ISEA 2O1PA 4CIGA 4KHNA 2G2OA 2HWHA 2K7JA 3N6LA 4GVMA 1PC5A 2KDOA 1Q16B 2VBWA 5KFCA 2P5OA 4HT5A 2AW0A 3T9NA 3GIJA 2YQ0A 2IYGA 1L3KA 3V81B 3FZLA 3VQ9A 2B4PA 4BWJA 2DNKA 2E5GA 2EKYA 4ECVA 1KQFB 3RSEA 1EZZB 5JS2A 5EX3A 4EMDA 1REGX 1XHZA 2ZZMA 4MDBA 4YUDA 3GFHA 3W63A 5KFFA 4CF2A 2HHHK 1YJ9N 4FJ8A 2XBPA 1T3VA 2DNHA 4KAZA 1QZ5A 2C3MA 4MTPA 4LF5K 3MPWA 2NRRA 1CSJA 3WT0A 1YQHA 3TP2A 4BRFA 5BJRA 3ITHB 3WQUA 4F4YA 2IC3A 1VHXA 2JRSA 4CF8A 3KK7A 4X4NA 2NXUA 4X66K 1GLEG 3P8BB 1ZC6A 3TNVA 2DNGA 3TA2A 3CCSN 2EC2A 3PO5A 3THWA 1S6PA 4RW8A 2FVCA 4DUZF 3Q7BA 2Y9HA 2V68A 3WX8A 2ZH5A 3O6WA 2DB1A 1LV5A 3BPDA 1K73T 5F2RA 2W9CA 3HPGA 1YJTA 3QO9B 2AT1B 2QLXA 3FC9A 2JEIA 5T14A 3VQDA 3WNFA 4CEQA 1VSEA 3HK2A 3ZTQA 3OR2B 3UD3P 2UXBK 4DX7A 5L1KA 3M2RA 2LDIA 5DDQC 3KWIA 3BSAA 3CJAA 3OVAA 2H9ZA 3PNIA 1RQ0A 2F9DA 2RJZA 3W7BA 2MZRA 3DOLA 3VGUA 3OQ2A 3KK1B 1S9EA 3VGTA 3I55S 4C8OA 3OYGA 2CQDA 2QW9A 4NA1A 2VG6B 4ZCLA 3TJAA 3UKRB 3PJXA 4TKTA 1VSJA 4Z4IA 4G1IA 3KUGA 3DLKB 2FJEB 4OHVA 1TZ0A 2O4IA 2PD1A 4LRFA 1YJNS 4ELVA 3U27A 4IG0B 3LA0A 3V81A 3T1HJ 3ZCMA 3CO0P 1REVA 4DQRA 5LMNK 1Q95G 2N7CA 1YIJN 1E3MA 2EK6A 2G0IA 4M5LA 3OYFA 2V8PA 3NL0A 4X65J 2LXIA 5KRTA 2YX4A 3T5KA 3DU6A 5C12A 1WI6A 4LT6A 1ZTTA 1D3WA 3Q2TC 1SJQA 3D3BJ 1B0TA 3P5TL 4CI6A 3KZBA 3CCQN 2MDAA 4DV1F 3ITHA 3ELHA 4NMXA 1U1PA 4YOXA 4ZOSA 1IV0A 3HFZB 4YR0A 4H4KA 3S3NA 2JWLA 4LBHA 1VQ6S 2F4FA 4BQLA 4DL0C 5AQMA 4CK3A 1RT6B 3H1VX 2LFVA 2MZTA 4FJNA 3ZEUA 3VQ4A 2BOAA 2RHSB 1Z25A 1HR0J 4WQ4A 2XWXA 4H5RA 2WAQD 3T1HF 3TANA 5LJ3Y 1RCOB 1TKDA 4E19A 4L76A 4E1NA 4CHOA 4RUBA 1KOOA 1T94A 4JI7K 3GFXA 4J9UE 1C1BB 2WK4A 3HHEA 3QO9A 5F8MA 4ZLNA 4X65F 3ZLJA 2L41A 1Q86T 2KU7A 4MMOA 4IOCL 1FK9B 2HNZB 4DCJB 1C0FA 4DV2K 1IBMK 4EWTA 5AQIA 1KKHA 4YB6A 4USKA 4PPDA 3TYTA 3UDCA 5HOOA 2ZBIA 2KJWA 3CDBA 5FRNA 1F21A 3KK1A 3KDNA 4TU8A 3OJUA 4AHCA 3HI0A 2VG6A 3UKRA 4RLEA 5B0DA 3I87A 3DLKA 3EPGA 1RWKB 3M8RA 4EAHD 2Z1HA 3PX4A 4IG0A 4JKAA 1HNVB 4IQMA 2MQQA 3MTKA 4IWVA 3GONA 1SKRA 3TTFA 2RUGA 1IKYB 4RNOA 1KVJA 2Q3PA 3FSIA 2C2MB 1NJIO 3RW6A 2W2OP 1UVLA 1U1OA 1YVUA 3I6PA 5ETLA 4BC4A 5GADI 5F8HA 4UY8T 2HIQA 5KPTA 2RIJA 2AA4A 1S1XB 2NZCA 4P9SA 2ASJA 3IMQJ 1TKZB 2B6AB 1R89A 3QJPA 3C6TB 3LH2S 2DFEA 1HKBA 4ZJQA 4NWBA 4WYWA 1UOCA 5LJ5Y 2PMWA 4DMNA 5DM7L 3RVCA 4FVUA 1WHYA 4FW1A 5AXMA 4HHHA 3N4QA 2QA2A 3JS6A 1RT6A 1UWAA 1JX4A 1WJ9A 3FMBA 5IFMA 1DARA 3TJ9A 4DV5J 2QIFA 2NRZA 2W6KA 5FPEA 3QATA 4Q45A 3R1HA 3M4XA 1RDDA 1G1XA 3O4WA 3KYLA 2GNKA 3QEVA 4YY3K 3QNOA 2QA4G 1C1BA 1RBOB 1RTIB 3HHLC 2YKNB 2NCKL 2JSXA 3Q22A 3CD0A 2HVEA 3BJYA 1XMBA 1T11A 1RSCA 1FK9A 5HRNA 2ZBCA 2HNZA 4FPAA 4BVPA 4BRMA 1N32J 1XMOF 4FVMA 1S59A 3CO9A 3TSQA 4BG9A 4LF4J 4OPJA 3AO5A 4U6PA 4ZCMA 4YHHJ 2IDOA 5DO2A 4E1MA 4X4SA 4ZTFA 4FXDA 1RBRA 3L7PA 4DV0J 4FYDA 2GX8A 1D1UA 3ET6B 8RUCA 2BE7D 4ATNA 2KI2A 3CJ1A 4RG8A 2V9KA 1TFYA 4KB0A 3C8YA 4LMZA 4M7YA 2VIHA 2HQ3A 4ZIVA 2CPIA 4IUFA 1AZSB 1UAXA 1XERA 3EZUA 2QA4S 1W26A 2FBVA 3FZBA 3K59A 1ITGA 4WIIA 2M3DA 1RT3B 5J1EB 2GQCA 3M05A 3CCLN 5DZ7A 2CDQA 1HNVA 4BR5A 4AFFA 5AR0A 4WFAQ 1NSKL 4ED8A 4I4BA 4JKFA 3D1QA 2ZOMA 1VQPN 3VAMA 1IKYA 4M5DB 1ULRA 4JUZA 2Z30B 2BRLA 2OPRB 3TQEA 2EFGA 1VI7A 4CLKA 4IRKA 4AL7A 4YOVA 2GWJA 3IRXB 4LF4F 4ZPDA 5M1NA 3BP8A 1SKUB 1F2GA 3TTCA 5FRMA 3MOZA 1S1XA 1S22A 3VVUA 1RLCL 4LVOP 1TKZA 2B6AA 3C6TA 5I3UB 4URGA 5A6PA 3GTYX 3ZT0A 2I8EA 3EE3A 1VSHA 5CHIA 1ESVA 3GG4A 3P5JA 3EVOA 3MECB 2IFXA 3R7SB 3CF5L 1BHNA 1UVJA 4C9DA 5CA5A 5EX5A 4B3RJ 4EUVA 5IC4B 3GOIA 1RYSA 4LF1A 1BWVA 3LDQA 4DPWA 2JEJA 3KG4A 3W62A 3RRKA 1FT8A 2Q6CA