5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
3KLGB 4ECSA 2OPSA 1BIUA 2HMIA 3AVFA 2I5JB 4F4WA 1HPZB 4J9RA 4CHPA 4PA1A 2D3ZA 4F8RA 2YKMA 2HNDB 4N5SA 3KK2B 1HYSB 3ZT2A 3TANA 3KTQA 4MIAA 1HQUB 3RMAA 4RW9B 1S1XB 5DQGA 1S49A 3V81B 1BL3A 3PY8A 4TLRA 4ZPDA 1HYVA 3OYBA 1S0NA 1RTIA 1LW2B 3QZ8A 2IMWP 3NFAA 4BDZA 1YVUA 2YNGB 4ED7A 2W7OA 4CF2A 4RW7A 3NF6A 2D5RA 4ID5A 3EY1A 5HROB 5L1KA 5KFIA 2BQ3A 4DL6A 2IA6A 3PHEA 5EWEA 1BIZA 3KLHA 3LP0B 2D0BA 4J9MA 4YR2A 3NBPB 4B9NA 1KHVA 3L2WA 4LH4A 1TK0A 4MK8A 1T7PA 1VSHA 4B8CA 2XI3A 1KHWA 4WE1A 1RT5A 1F21A 1ASVA 3D28A 1L3SA 2G8KA 3B6PA 5DQHA 2KW4A 1NJYA 1LWFA 2WONB 3TAEA 1RT2A 5KFTA 4K8XA 4ZPCA 4QWAA 4LQ3A 1WSFA 3AVBA 3LPUA 4PY5A 1K1SA 4KHNA 4B3OB 4Q45A 4CIGA 3SCXA 5KFJA 1S10A 2X6SA 5EU7A 2E9RX 3RBDA 3JYTA 3PVXA 4WZMA 3CFRA 5K14A 3SFGA 1TKTB 4EP4A 3M8RA 4W5QA 5KG2A 4CJ3A 5KT2A 3DMJA 1TK8A 3AVNA 4Q44A 4RU9A 1EETB 3AO5A 5F9LA 1S1WA 5HP1B 2D3UA 3G6YA 3NHGA 1U09A 4IKFA 1BQMA 3AVCA 4FLTA 3CJ2A 3C6UB 4GVMA 1IKXA 2G8HA 1JLGA 1QHTA 1ZTWA 1X9WA 2VA3A 3KK1B 4HUFA 1U47A 2PYLA 4NLSA 2B5JB 4CK3A 4KHQA 1VRTA 3CJ5A 4ICLA 4RNFA 1SUQB 1RA6A 3DLBA 4KHMA 3VQPA 3RAXA 3PZPA 5KFRA 5KFKA 3RAQA 3FQLA 5KFHA 4FJJA 2I1RA 3PW4A 4DTOA 4ELTA 5KFSA 4FM0A 1U45A 1DTQB 4R8UB 3EPGA 2GBZA 1GOBA 3L2QA 4I2PA 4GMJB 4FLWA 4O3NA 4DFPA 3I0SA 3MXJA 3LALA 2IAJA 3T5HA 4FJNA 4CGJA 1QSSA 3DLKA 2IGIA 3VN5A 4DS5A 2HNZB 3UIQA 3ZT3A 1S6QB 3ZSYA 2F8SA 4BWMA 1L5UA 3ZSVA 3OYDA 5C24B 2R8HA 4AHTA 3OL7A 2OPRA 3C6TB 2YV0X 3A2FA 4FLZA 1DLOA 3QIDA 4KFBB 1CZBA 3PW5A 1B92A 2FBXA 3DLEA 2C22A 3L2UA 4B9MA 1JXBA 1D8YA 1YT3A 4RUCA 2OZSA 1RDCA 3CJ4A 1C1BA 3BSOA 4HYKA 3MECB 4TYBA 1CLQA 4K50A 2BR0A 3E01A 3AO2A 1Z4UA 5JUMA 4CF0A 3T1AA 2JEFA 4G1QA 4J9NA 4NLTA 5F9NA 5EDWA 2HB5A 4DSFA 3RMCA 4FS1A 3CG7A 2VWJA 2B43A 3NCIA 3KHHA 2FJWA 3OHAA 3SPZA 5KG0A 4AHVA 3M9MB 3P5JA 2QKBA 5KFXA 2W9CA 4CEDA 4WXWA 3DM2A 4NLRA 5KRTA 3S9HA 3LAKA 2R8JA 4B9SA 2PYJA 1HRHA 4I9QA 1LWEA 3CO9A 1XC9A 1HMVB 4PQUA 3V9ZA 1QSLA 5F8JA 3C95A 3KIOA 3FSIA 1HNIB 4CFDA 4CJKA 4Q5VA 4W5OA 1S1VA 4CJUA 2W7PA 3PW2A 4NCGB 1HNVA 3KLEA 4C8NA 2FVPA 3OYNA 3GV7B 4HUEA 4J2EA 3VQSA 2VA2A 3H5XA 3CDEA 2W42A 2B6AA 1K1QA 1VSEA 2IM1A 3QGIA 3KKRA 2FJVA 5E41A 1RT7A 1U49A 5KFCA 4M3XA 4KB0A 3HVTA 4LY7A 1JLEB 3KLIB 2LSNA 1TAUA 4RZRA 3ZSQA 1SKSA 1D9FA 4Z4HA 1TP7A 4ZPAA 4DQIA 4DFMA 4KTZA 1T03A 3GILA 5J2MA 2D7SA 3CJ3A 4NLPA 3GIKA 1FK9A 3MEDA 3VQ9A 3KJVB 4K4WA 4FLVA 3LP1A 5D3GA 4LSLB 3AVGA 3SV3A 2QXFA 1RTJA 2UVRA 1RA7A 3F73A 4M3UA 4B9TA 5CZ2A 1QUVA 2OPPA 4FLUA 4FJ7A 3M8QB 2I5JA 4F2RA 2HHUA 5I3UA 4URGA 3MAQA 3K5OA 1IO2A 1TV6B 4FVMA 1JKHA 3N6LA 2HNDA 4KI4A 4ELVA 4W5TA 3NF8A 3HVRA 2G8FA 3MF5A 5J2QB 4ECTA 2UUTA 5KFAA 5KTQA 3DRSA 3M8SA 3M8PA 2A1SA 3V9UA 5KFUA 4DLEA 3KLVA 4CJ4A 3MR3A 1T8EA 2ALZA 2R2SA 3QESA 1RTDB 5DGBA 3PO4A 4DU1A 3HXMA 4E3SA 3AVJA 3OYEA 3NH2A 4R5PB 3V4IA 1QE1B 1NJXA 1RT1B 4JV1A 1JXEA 2V0NA 3DLGB 4OPKA 1RAJA 4H54A 3Q8PB 4CF8A 1C0UB 3AO1A 4KKOA 3QO9B 1IKVA 4PUOA 3FFIB 3BQ1A 4OKKA 2RF2B 1KLNA 4H4OB 3NL0A 2P51A 2HHTA 3AVKA 4BACA 3PX6A 4FBUA 1KFDA 4CEBA 2XWYA 4YQWA 4CFAA 4NYNA 1N5YA 4B3OA 3VQAA 2R2TA 1VRUB 2JC0A 3DOLA 4I2QB 3GV8B 4MIBA 2IM3A 2BE2B 2GIRA 1J5OB 4J9OA 4ZHRB 1IH7A 3AVLA 3HSTB 2YNFB 3DYAB 2YNIB 4MK9A 3QNNA 4E19A 1CSJA 4M94A 4KREA 3V6KA 3EPIA 3QGGA 4KBIA 3SQ1A 3SI6A 2ZD1B 4BDPA 4H4MB 2E9TA 1T05B 2Y1JA 2IJFA 4DQPA 5CYMB 4C8KA 4IRCA 3O3FA 2UVWA 2FBVA 3ZT1A 4AILC 1UAXA 3NDKA 5C25A 3KK1A 3JSMB 3PJXA 1NK6A 4B9UA 4JS5A 4FK2A 2B5JA 4ED0A 2VG5B 3QIPB 3LP3A 1S9EB 2Z1HA 2OA8A 4XO0A 4DWIA 3IRXB 4DG1A 1QTMA 1RBTA 1Q9XA 1X9SA 3TVKA 3N6NA 3DI6B 3IS9B 2E4LA 2J6SA 3TAFA 4URQU 4RNNA 1KSPA 3ASMA 3HP9A 2D0AA 3O3GA 4CHOA 1HJRA 1RT4B 3SUOA 3AA5X 3CVKA 4HUGA 4TY9A 5HBMB 4EBDA 1WSGA 4NLQA 1RILA 2KZMA 1FKOB 2AGOA 4NLDA 5HLFA 3RB6A 4FCYA 4QCLA 2R8GA 4CF9A 1S1TA 3OJSA 2AU0A 2FLPA 2AGPA 2F8EX 1N48A 3DRPA 3QYYA 3TAPA 5C24A 3OLBA 3IG1B 2C28A 1CXUA 3TAGA 3NH1A 1C0TA 1Z25A 4DL4A 2VG6B 1BISA 2QE5A 4FZZA 1VSLA 5KFMA 4CFBA 4CEFA 4YR0A 4N47A 4FYDA 4IFYB 4Q8EA 1MU2B 2HNYA 1JLCB 1BQNA 1D1UA 4ECUA 1TL3A 2KQ2A 5FRNA 2YKNB 4CEZA 3H08A 2C2RA 1NKCA 2KZZA 2NUBA 1LV5A 3CDWA 2E9ZA 1RCHA 2O5DA 1KVAA 1QAIA 3GV5B 4IBNA 2IJNA 4DEZA 5KI6A 3HYFA 4M3YA 1LW0B 1A5WA 4K4XA 4XPCA 5DG8A 3OYKA 1NK8A 5J1EB 4TQSA 3K57A 1XR7A 4J2BA 3G86A 1TKXA 4KHUA 3VQ7A 2QKKA 3RB4A 1KLMB 2BQRA 3NGIA 3SFUA 2R8KA 5C42B 5KFVA 4KHWA 3PW7A 2QK9A 3I0RB 3KLFB 5J2NB 4O4GA 2BANB 3HM9A 4I7FA 1SV5B 3CM6A 3V6DA 4ED3A 4F4XA 3BGRB 2R7YA 2YHBA 4IQXA 5EUHA 1XR6A 3NGZA 2P1JA 3PUFA 4YP3A 3AV9A 1QS4A 1A5XA 1N6QB 4M3WA 3I5BA 3OSPA 1RTHA 3V9SA 1HQEB 4O44A 2X78A 3VQDA 3TAMA 4CGDA 4NLWA 2W9BA 4DSKA 4TXSA 4MFBB 2JEGA 4O0IA 4U7CA 1RYSA 3WNFA 3MEGB 2OPQB 3OL8A 1ZBIA 1JLBA 3CIZA 1JLFB 2XY7A 4HVJA 5DK5A 4BE0A 4DS4A 4KO0A 3AVHA 2XI2A 4RW6A 3IAYA 3CYMA 4L8RB 3ZT4A 2RKIA 4AH9A 4MK7A 1BI4A 4LSLA 3L8BA 1KRPA 3ZCMA 2WTFA 3AO3A 1FKPB 1IKYB 3H59A 1S1UB 1EP4A 3OYMA 2HW3A 3M8QA 3BSCA 4ID1A 2EC0A 3AO4A 1TV6A 3OYHA 3MXMA 3HVWA 5KT6A 5DG7A 2IM0A 2JLEA 4JV0A 2P5GA 4QOZB 3VQ8A 1ZBLA 2XGPA 2ZKUA 3CFOA 5I42B 4CJSA 5KFOA 4NLVA 1RBRA 4OJRA 3SNNA 1Y97A 3HT3A 4NYZA 3LWLA 3ITHB 4R5PA 4Y1CA 1TK5A 1JLAB 5KFBA 3MEEA 3LPTA 4CHNA 4Q43A 1TKZB 5KRSA 3V1OA 4M95A 1JLQB 4J9QA 4YR3A 4Q0BB 2YNHA 4BE1A 1RT6B 4RNHA 4KHSA 4RW8A 2AWZA 3LAMA 3MTKA 1NK4A 2XCPA 4QW8A 4IG0A 2BRLA 4EBEA 3F9KA 3DOKA 4IOBA 4TY8A 4NLYA 4EZ9A 2XY5A 4O4RA 3ZSOA 2RF2A 5FDLA 4MKAA 3DRRB 3T5LA 4DTJA 3MFIA 3K58A 1T3NA 5KFLA 1S6PB 3G6VA 3HJFA 5J2PA 3E51A 2OPSB 1QAJA 1VSJA 2IC3A 5KFNA 4RNOA 4CK2A 2HMIB 1L3VA 2GUIA 4OLBA 1VRUA 4NRTA 2XO7A 5KFFA 4ZMMA 4I2QA 4ZVHA 2FC0A 5JS1A 1Q8IA 3MXIA 4ECXA 1K6YA 5DGAA 1NNDA 4ZHRA 4U6PA 4CESA 1W0HA 5L1LA 2YNFA 3DYAA 2V4QA 3M9OB 4K4TA 4M3TA 2YNIA 4CJQA 1XWLA 2IDOA 4WYLA 1GX6A 3LP2B 4IKAA 1RTIB 3QEPA 2JC1A 2D0CA 3NGDA 2ZD1A 1SH0A 4Z4CA 5JXSA 2D41A 3IGNA 2ASLA 5CYMA 4CHQA 4LSNA 2ILZA 4CJWA 1UA1A 2DFEA 4N76A 5EWGA 4BWJA 3OL6A 3OYIA 4IH7A 3JSMA 1ZBFA 2R2RA 3MR6A 4IDKA 3KLHB 3NAHA 1IKWA 1RDDA 3VQCA 1B9DA 4CEEA 1S9EA 4KAIA 3ZT0A 4KB1A 3L2RA 2BQUA 4WE1B 1ZETA 1RT5B 4FJIA 1VSMA 3NGYA 5CYQA 2WOMA 2QV6A 3NMAA 1JL2A 4EP5A 3QEIA 3V6HA 2J6UA 1RT2B 2O4IA 3ZSRA 4DTUA 1LWCB 1KFSA 4EYIB 4HHTA 5KT7A 1D0EA 4NRUA 2AX1A 3T3FA 3SJJA 3H5YA 3JYTB 4E7LA 3QLHA 5KFDA 4CGGA 5K14B 3OYLA 1C1CA 4ED1A 1GOCA 3PX4A 4DMNA 4KI6A 4DTSA 1SH3A 3SPYA 3VQQA 1LAVA 3DMJB 1RDRA 1RBVA 3IG1A 2HHVA 1BCOA 4PWDB 3KLGA 3H2LA 2WHOA 4FZYA 4DLGA 5KFWA 4NLOA 1D5AA 1HPZA 4Z4FA 4B8AB 2HVIA 4ZP6A 3VA3A 4B08A 4IFYA 4EO6A 1ASWA 3U6FA 3M9NB 3BDPA 5KG6A 3KOAA 3KK2A 1HYSA 4M3ZA 2ZE2B 1JLGB 3O4NA 5DLFA 3QERA 2Y1IA 1MU2A 5KT5A 3HP6A 3UDLA 1HQUA 1A5VA 1L3TA 4DSIA 4RW9A 3KK3B 1S1XA 2YKNA 3V81A 1VRTB 2G8VA 4FLXA 4ICLB 3LZJA 4K8ZA 2BRKA 1DTTB 1WSIA 1LW2A 4F50A 4N41A 4FJ8A 3LWMA 2FVQA 4Y1DA 2YNGA 4F4ZA 4O3RA 4I9LA 3QETA 1W25A 4O3QA 4ECRA 3KHGA 4B9VA 4FJKA 1LW0A 4ZP9A 4CGIA 1ZBHA 1JL1A 2F8TA 5L1JA 5HROA 2HVHA 1VK0A 1W9HA 3LP0A 4IG3B 1RBUA 1UOCA 2PZSA 1X9MA 1X1PA 4I2PB 3NBPA 4DF8A 1ASUA 4E7JA 3OJUA 3I0SB 2WCXA 2FLLA 3KLFA 3Q8QB 1JX4A 2IAJB 3MR2A 3DLKB 3KMSA 1SV5A 2WONA 3OSNA 2HWIA 1N56A 2DY4A 3OYJA 3OS0A 4CHZA 4FJGA 1SKRA 1Q9YA 3CQ8A 3AA2A 3KMQA 3G0ZA 3L3VA 5F8LA 4DFJA 1UWBB 3DLEB 1J9AA 3NH0A 4CFCA 1WSJA 5F8HA 3UPFA 3AVMA 4QWEA 3OS2A 1HQEA 3B6OA 1NJZA 2DPIA 1TKTA 4JLHA 4C8OA 1RBSA 2CKWA 3H5UA 3V6JA 1S0MA 3RMBA 3BQ2A 4MFBA 4BDYA 4YNQA 4IR9A 1RNHA 4CJTA 4N56A 1XR5A 1EETA 2X6NA 3UR0A 2JEIA 3QINA 4ZPBA 3RB0A 5HP1A 4CERA 1ZYQA 2FVRA 4ED2A 3ZSWA 4FM2A 3H40A 3ZSXA 5FROA 5C5JA 1NHUA 1TL1B 4FW2A 3NKYA 4C8LA 1KVBA 3RWUA 1KCFA 4IH6A 3C6UA 1D9DA 2P5OA 2W9CB 4CJPA 3P1GA 3RB3A 3DM2B 1TVRB 1UA0A 4OKEA 3H4DA 3S3MA 3VQ6A 3H98A 4CJEA 2GV9A 2IS3A 4DU3A 1SUQA 2UVUA 2UVVA 1KTQA 2EX3A 3UQSA 4O3PA 4HCBA 4DF4A 1GOAA 4J2DA 4K4ZA 2EHGA 3KD5E 4GC7A 2AGQA 4EYHB 3OY9A 1KVCA 3SUQA 4DTNA 2ATQA 4JS4A 1DTQA 4R8UA 1I39A 4KAZA 1RYRA 2IOCA 2AX0A 3WNHA 1ITGA 2PY5A 4LQ9A 4WYWA 1LAWA 3OYAA 4CCHA 4JV2A 1TKZA 4M41A 1JLQA 2B6AB 5KFYA 3SQ2A 3Q8SB 1C0MA 4Q0BA 3K5LA 4JUZA 2HNZA 2UUWA 3T5KA 2J6TA 1RT6A 4E7IA 1S6QA 2G8UA 5KG3A 3QEXA 1XHXA 5DG9A 1JXLA 2KFNA 3C6TA 5T7BA 4KFBA 1T03B 3RRGA 5CY4A 2X74A 2HHXA 3RRHA 5L9XA 1RDAA 5F8GA 2G8IA 4Y2AA 5KFPA 4WFXA 3LP1B 3MECA 3D45A 1S0OA 3HPOA 5L1IA 4DTRA 2KFZA 1G15A 2WRMA 1RTJB 1S6PA 4M45A 3BR9A 3GIJA 3TQ1A 4E0DA 3MFHA 2OPPB 2FVSA 3VQEA 2XY6A 4NLGA 5I3UB 4J2AA 4C8MA 4F4YA 4X2BA 1WSEA 1JKHB 2ITGA 4AHUA 3VA0A 4AHRA 4CIFA 4ECYA 3C94A 5F8IA 1BHLA 3DRSB 3ISNC 3M8PB 3V1QA 3FQKA 1S9GB 3WNEA 3LP2A 3I8DA 2RN2A 4Z0UA 4CEOA 2V4RA 3PW0A 3GYNA 2ETJA 4FJ9A 4QAGA 3V4IB 4ZVEA 1HMVA 4ZP7A 4O0JA 1TQLA 2Z1GA 3TABA 4K4SA 1HNIA 2GC8A 1HYZA 3EZ5A 3SYZA 4WXOA 4G3IA 3HK2A 1EX4A 1WLJA 1U4BA 4KKOB 4Y34A 4EEYA 5HRRA 4NCGA 1REVB 1IKVB 4PUOB 4W5RA 3HKWA 1WN7A 3L3UA 4CF1A 4DSEA 1SL2A 4URSA 4FK4A 2KTQA 4OLAA 3BJYA 3DDKA 4KE5A 1SL0A 4RW4B 4FJLA 4FJMA 4F4KA 3CJ0A 4QWBA 1LWCA 1R0AB 4FZXC 1N5YB 3NAEA 1JLEA 3KLIA 4E7HA 1FXXA 1MMLA 2G8WA 1NKEA 4AHSA 4ED6A 4OGEA 3DLHA 3OYFA 2ASDA 4O55A 3DOLB 5F8NA 2O4GA 4CHYA 2FBTA 4O3OA 3TI0A 2FBYA 4DFKA 2AJQA 5KFEA 4CEQA 1TKDA 4ZP8A 3SUNA 3S3NA 4E1MA 3KJVA 3RMDA 3RR7A 3N6MA 4FXDA 3OL9A 4PWDA 3IN5A 3GIIA 4EZ6A 3D0PA 2XCAA 2XHBA 3BSAA 3PR5B 3I5CA 3TARA 4E7KA 2CJQA 4MQ3A 4JRPA 3O4QA 3SZ2A 2ZE2A 4Z4GA 1U04A 5C25B 3O3HA 4NCBA 5J2QA 1C2PA 3KK3A 4B9LA 3Q8RB 4R0EA 1I6JA 3HL8A 1DTTA 2VG7B 4JRQA 2BDPA 4IRKA 2E6LA 4KV8B 1RTDA 4DG1B 3PR4A 3SQ0A 4DTXA 3H5SA 3ALYA 5DMRA 1QE1A 1RT1A 2ATLA 1RT3B 3DLGA 3KKSA 1WAJA 4TN2A 1C6VA 1NK7A 1ZTTA 4IG3A 4KTWA 1C0UA 2FJXA 2AQ4A 3QO9A 4KTQA 3FFIA 3V9WA 3CFPA 5HLFB 3LZIA 4RUAA 4IFVB 5DLGA 4WZQA 1S1TB 2C2DA 4F3TA 4H4OA 2E6MA 4CE9A 3QEVA 1SKWA 1WNSA 3FRZA 1VSFA 3DRPB 1YVFA 4CEAA 3QZ7A 3AA4A 4QWDA 4NZ0A 3U3YA 5DQIA 1WNEA 4EO8A 4M42A 4Z4EA 1C0TB 4DTMA 1C1AA 1UWBA 4W5NA 1QQCA 4YFUA 4DQSA 4QWCA 2HHWA 4HCCA 4DQQA 2YHAA 2YKMB 2BE2A 3KHRA 2F96A 1J5OA 1U48A 2HNYB 2HHQA 1BQNB 1TL3B 3NF7A 1SH2A 4CJLA 3HO1A 4CJ5A 3CDUA 4FW1A 3RTVA 4HKQA 4ZTFA 2R8IA 3OHBA 3ZSZA 4H4MA 1NK5A 1T05A 4H8KA 1TL1A 4RW7B 1O1WA 1YTAA 2ILYA 4ID5B 4O3SA 4ECZA 1J54A 1L3UA 1NKBA 3NAIA 1EKEA 4Y2CA 3HPGA 1TKXB 4KHYA 1TVRA 2DTUA 4DL7A 4MKBA 2VG5A 3QIPA 2IBKA 3BSNA 3IRXA 5FRMA 3SQ4A 4K4YA 3QEWA 5KT3A 2HHSA 3SV4A 3K59A 3DI6A 4O4GB 3HVAA 1QSYA 3BREA 3D5MA 4I7FB 1IM4A 4K4UA 3IS9A 2DFHA 4IH5A 1LWFB 3V6DB 1S97A 1S5JA 2Z1IA 3TAQA 4RNMA 4DL5A 4F3OA 1RT4A 3I5AA 4FJHA 4DSJA 1NHVA 5KG1A 4XPEA 5HBMA 2V9WA 2XC9A 1RTHB 3CWJA 5KG4A 3PJWA 4KB7A 1FKOA 2JEJA 4O44B 1N4LA 3LANA 4OKJA 2IM2A 3TAMB 2W9AA 4ECWA 3CM5A 4CJVA 2W9BB 3THVA 4OGCA 1IG9A 3KD1E 2FVCA 2VWKA 3T19A 4HTUA 1TGOA 4J9SA 4Z4IA 2RDJA 1JLBB 4FJXA 5HRPA 4O5BA 5CZ1A 1EXQA 4NYFA 1S1WB 2XGQA 3H4BA 2FLNA 3AA3A 3QNOA 2VG6A 4KO0B 3BQ0A 3K5MA 2R2UA 4RW6B 1BGXT 3AVAA 5HRSA 2RKIB 3FDSA 4K4VA 2W8LA 3S3OA 1BQMB 1BI4B 4J9PA 1IKXB 4DTPA 2HAIA 1CXQA 2DFFA 1JLCA 3TR8A 4DL2A 3QIOA 4M3RA 1EP4B 4FJ5A 1JIHA 2A1RA 3SUPA 4CK1A 4KRFA 3RBEA 4DSLA 2WB4A 3L2VA 4E89A 4IR1A 1S4FA 3OYGA 1NK9A 2Q3SA 3GIMA 3HHKA 2DPJA 3OS1A 4YMEA 4CECA 2C2EA 2GIQA 3PX0A 1S9GA 5J1EA 2OZMA 3TWHA 4CIEA 4WFZA 1BCMA 4NLXA 4QW9A 3OYCA 5KG7A 1KLMA 2ZQBA 1SL1A 4DL3A 4UQGA 3QGHA 1J53A 3MEEB 5C42A 3EZUA 3I0RA 5J2NA 3IGVA 2BANA 2OYQA 2YNHB 3VQBA 5SZTA 3BGRA 4TYAA 1NOZA 4RW8B 4TQRA 1TAQA 2WK4A 2OPRB 4CJFA 4IG0B 1REVA 1DLOB 3DOKB 4RG8A 4TY8B 1WSHA 5T14A 1N6QA 5FDLB 4ZVFA 5KFQA 1CZ9A 4FLYA 2OH2A 3LDSA 4IRDA 3KNAA 1C1BB 5KT4A 5HRNA 3PO5A 4GC6A 4RW4A 2Z1JA 3E01B 5EWFA 1R0AA 3DLRA 4EBCA 4LH5A 3MEGA 2OPQA 5J2PB 4G1QB 4FS2A 4CGFA 2IC3B 3NE6A 2XY8A 3OVNA 1JLFA 4J9KA 4ZVGA 4CJRA 2XRIA 1T94A 1Z26A 4KHRA 5JS2A 1NK0A 3V1RA 3ICLA 5SWMA 1FKPA 4DQRA 4KPYA 1IKYA 1YTUA 1S1UA 2BGGA 4ED8A 3WNGA 3K5NA 3SI8A 4E1NA 3U3GA 1LWEB 1VSIA 1NOYA 5F8MA 4MH8A 4PQUB 4NLUA 4LSNB 5KGWA 4XIUA 4ELUA 4FK0A 4IDKB 4TSXA 4FM1A 2ASJA 4KSEB 1IKWB 3V9XA 3RR8A 5I42A 1S1VB 3K2PA 1B9FA 4DU4A 4QPXA 2VG7A 1HNVB 4ZTJA 4KV8A 3VQ5A 3KLEB 2RPIA 1XI1A 3P83D 3KHLA 4F2SA 2B4JA 4LD0A 5CYQB 2WOMB 2JGUA 4OPJA 3ITHA 1HARA 1JLAA 3OLAA 4OVLA 3AVIA 1RT3A 1S48A 4Y3CA 1I3AA 1RT7B 3G6XA 4GW6A 1RDBA 4BE2A 1NJWA 4NCAA 3HVTB 4OL8A 5KG5A 4J9LA 2W8KA 1VSKA 3MR5A 1ZBUA 3NF9A 1GX5A 5KGXA 3EYZA 4CGHA 3QLHB 1WAFA 4IFVA 3ISND 5J2MB 1C1CB 4ECVA 3T5JA 1S9FA 4AHCA 2HWHA 3DRRA 3G10A 3PV8A 1VSDA 3GQCA 4FBTA 4ECQA 1FK9B 3MEDB 3HPHA 4WFYA 2RDIA 5D3GB 5KFZA 4Q8FA 3VQ4A 1OS5A 1XHZA 3ULDA 5KFGA
chains in the Genus database with same CATH superfamily
3RGIA 2IVYA 2OPSA 1FCAA 1YJ9S 3UKUA 2I5JB 3ZETB 4CHPA 4F8RA 3QWUA 2GWKA 2LP4A 3ZT2A 1OH8A 2GVDA 3BO3A 4DUYK 1S1XB 1S49A 2NXJA 4TLRA 4EFHA 1IQTA 1HLWA 5D8HB 1FERA 5J1PA 2CVEA 2F4VJ 4P75A 2QO3A 4OI0A 4ED7A 2W7OA 4CZIA 2DEIA 4KC5A 4ZIVA 3W9JA 3T9ZA 3PHEA 1BIZA 1RAGB 2ZC3A 2VB6A 2CDRB 3KLHA 4JN4A 4KH1B 4NA1A 2A6OA 4B9NA 1Y5NB 3OTDA 4MK8A 5AE2A 2M52A 4NYOA 1NEEA 1Q5VA 4B1ZA 3MCNA 2HLUA 4DCOB 2KW4A 3TAEA 4FWMA 1RWPB 1J5EK 4C2MA 4LQ3A 1WSFA 3AVBA 4C0OC 3LPUA 1K1SA 4Q45A 4CIGA 5E33A 3GB0A 2JWLA 2RD5C 4KIAA 5EU7A 4YOVA 1NSPA 3T69A 1N36K 2QWMA 1TKTB 4P52A 1HR0J 4CJ3A 5BRDA 1K9MO 3NNCA 5FLXY 3AVNA 2PFFB 4RR5A 5E7OB 2R7XA 3AO5A 4L74A 1U0HA 3NHGA 3CMES 2OEKA 4XH5A 4YS2A 1BQMA 3C6UB 1IKXA 2G8HA 2QN6B 1JLGA 3N79A 4X64K 3AD7C 4I67A 1X9WA 4P2FA 3UWTA 2BJ1A 2DNOA 4WQ4A 1Z05A 2DIVA 1QVFR 3EJMA 4FYWB 1SUQB 1RA6A 2MHEA 2XLKA 3DLBA 4CWBA 3VQPA 3RAXA 5KFKA 5CYJA 3O9QA 2ASMA 5KFHA 2CPEA 4LMZA 1N33F 2I1RA 3D6TB 4ELTA 1RWWB 2QI2A 4FWRA 4FM0A 4R8UB 1FTRA 3RUBL 1S5ZA 2U2FA 1GLLO 3HTVA 4I2PA 3MPYA 2H4YB 4F3MA 4C48A 4DFPA 1M0SA 3KDNA 1UMJA 4BRIA 3LALA 1U1KA 3UB5A 1YTYA 4CGJA 1N32K 1JNRB 2AIRB 1P6TA 2XNQA 4BWMA 3ZSVA 2R8HA 3Q86A 3OL7A 2OPRA 3C6TB 7FD1A 2YV0X 3A2FA 3R1XA 3O1BA 3MPVA 1CJTA 2GNKA 1JJ4A 1NHKL 3L2UA 1YT3A 4CH0S 3HDSA 4RUCA 2OZSA 4MMOA 4CLLA 2DY1A 2QL9B 4DUZK 3AY9A 4AFFA 4CT8A 3MECB 5D6GA 4C1NI 4DV3J 3D4JA 2C3MA 3CJ1A 3A5NC 3MURP 1VQSA 4J9NA 4NLTA 5F9NA 3R7SB 3NGSA 3O3LA 3RMCA 4YUDA 3CG7A 1ZC6A 2HZCA 4O0NA 3PYEA 4CD3A 1YHQN 1CULB 2VBZA 1CC8A 2VIHA 4AHVA 1X3MA 1ZS6A 3ZZZA 3KJFB 3K2YA 4NZ7A 4CEDA 2AJ4A 3LAKA 4B9SA 1HRHA 3H8YA 1I94J 4X65J 4BC7A 3EVWA 4PQUA 3ENHA 4ZJLA 2ZH2A 3ENOA 2IFXA 3U9ZA 5DZ6A 2DGVA 4CFDA 9ATCB 4IZ9A 4H0TB 3IM8A 3IRWP 1OY9A 2W7PA 3PW2A 3RW7A 3LGNA 1IBLK 3R9PA 4LF8F 3PACA 3CSKA 2FVPA 2H5JB 4J7CA 2VFTA 2R7QA 5F3TA 1GLFO 2DK2A 4JP8A 1YBTA 1J6ZA 4NXMF 3H5XA 1QY7A 3CDEA 4MJKA 2AA4A 3TWZA 2W42A 4LF7F 3KKRA 5E41A 5KFCA 2L9DA 4HTLA 5EN1A 1CQMA 1NSQA 2JSXA 3HVTA 3KLIB 2IBOA 2GHVC 3ZSQA 1FE4A 4DI6A 4Z4HA 4CBWA 2D69A 3GILA 4C3KA 5J2MA 1V5VA 4JI5K 4PPZA 3NS7B 3G96A 2LXIA 4OJGA 2CZVC 2K1RB 3US5A 5D3GA 4B1VA 5ETVA 2HS4A 1C4CA 1RA7A 3F73A 2HFSA 2KHCA 2ZJPQ 3ENVA 1OQ3A 1KD1O 2OPPA 4FLUA 2I5JA 3T1YJ 2F1FA 5I3UA 2PBDA 4M7YA 2F40A 3W2WA 3MCAB 1Q7LB 3HSGA 1GMWD 1IO2A 3MMAB 4MKYA 2EFVA 3HHNB 1H3DA 3NF8A 4CJ7A 3MF5A 2VOPA 1FJGF 2BJ3A 5A8WB 3OR2B 4NPOA 1IR0A 2VHGA 2V68A 1DHMA 4CJ4A 4BREA 4JYAJ 3QMLA 3V4MA 3QESA 3E66A 1UWAA 1V4SA 4E3SA 1UVJA 3I55S 4JKEA 1QE1B 4ZLLA 1JXEA 5CH7B 2XZDB 1WDTA 3WIVA 4OI6A 4EWTA 4P71A 1RAJA 4H54A 2PSZA 4HDHA 2MEWA 4LC9B 3QBXA 4KKOA 3ZC4A 3FFIB 3OBYA 4LSZB 4FWPA 3LA0A 3TP2A 1U1PA 4L75A 4H4OB 1Y00A 1PCAA 2HHTA 3N9UC 4BACA 4G65A 4ZJQA 4CFAA 2JFKA 5THWA 1N5YA 1UPMB 2D4WA 3NGTA 1X0FA 1TL7B 1VRUB 2XEXA 4CI0B 3GV8B 5BR8K 1EB0A 2A3JA 2PI4A 4ZHRB 2QSWA 3HSTB 3I56N 1DBDA 3IAM9 2MB0B 5BN8A 1H7XA 1YAGA 3M1FA 1WELA 3SQ1A 4NE9C 2ZD1B 4BDPA 3C65A 3SI6A 2CQBA 2E9TA 4Y2MA 3W9IA 2Y1JA 1LXNA 2XMAA 2HQGA 1PBUA 4IRCA 5MLCV 3M3ZA 2FBVA 3VAFA 4Y65A 4AILC 5KOXA 3NDKA 4DUTA 3TSQA 1NK6A 4B9UA 2DR7A 4FKYA 4FK2A 2A5XA 2VG5B 4BC3A 4BRKA 3ATVA 3FSXA 2OA8A 2WBMA 2MZ1A 3PSFA 4ILGB 2QIFA 4BR5A 1Q9XA 2DYAA 3N6NA 3WBZA 5AQZA 2ZJQQ 1OMSA 1C4AA 2B4UA 1DT9A 3DLJA 2PA3A 3O3GA 1FFSB 3SUOA 4TY9A 4EBDA 4LBHA 5C2CA 3TUZC 2OHDA 2KZMA 1CLFA 1FKOB 3I87A 1U02A 4LIWA 4PXEA 4NLDA 1M1HA 2R8GA 1S1TA 1S7IA 2AU0A 1DZ5A 2HMPA 1AXQA 3CD0A 3W1YC 3DRPA 4ETXA 3GG0A 1FEHA 1C0TA 3EM1A 1U6FA 4C0BA 2RE1A 1VSLA 3J7A1 5KFMA 4N47A 2J9DE 1VQ9N 4JI0J 5AQNA 2X7IA 4HI2A 2OUGA 1CJUA 2YTCA 1MU2B 2HNYA 5BRHA 1JLCB 2KQ2A 2W24A 4R25A 3G8SA 5CAAA 2KZZA 3UD3P 2ZBCA 2M8HA 1YKWA 2NLWA 2HK2A 4OMFG 4DEZA 1A5WA 2WVFA 1UVNA 4K4XA 5HANA 1XNQF 4DV4J 5DG8A 5J1EB 4JI6F 4K41A 1UW9A 4ZJOA 3NLCA 1XR7A 2ROEA 1ZZFA 5DO2A 1R8PA 4M7XA 4JI4J 3RB4A 1ICEB 3BBFA 2BQRA 2P9SB 2F9JA 5KFVA 3PW7A 5J2NB 2KG0A 1SV5B 3CM6A 4F4XA 3TPQA 2R7YA 2I7NA 2X51A 2R7OA 2ADCA 2DVIA 8RUCA 3NGZA 1SXLA 3U27A 3ZTOA 4LRCA 4BRMA 3G71N 3C15B 3I5BA 5A0YA 3OSPA 4OJ3A 2RSQA 2HFVA 4NB4A 2X78A 2DGSA 3VQDA 3LQVA 2DH9A 1NBWA 4TU8A 4NLWA 2Q3PA 4TXSA 3WIUA 4MTPA 4U7CA 3MEGB 3R97A 1ZBIA 1FESA 3CIZA 4JHDA 1MWMA 1JLFB 2OMOA 3Q89A 2GHWA 1KNZA 1NDPA 4OLOA 2V7ZA 4KO0A 3AVHA 2XI2A 3HM8A 3UDCA 3CYMA 4L8RB 1M1GA 5BN9A 1OYEA 1VYAA 1I1GA 3UW1A 1S22A 3L8BA 3MMJA 2EFNA 2CPIA 4P2MA 2MKKA 2OTLN 4JKHA 2DD8S 5AQVA 2L9NA 1H98A 2QLXA 4OZ1A 3MWTA 2E7WA 1YZ6A 2AZ1A 3OYHA 1X7VA 3DXMA 5DG7A 4PKDB 1ZM4A 2ZVIA 4RPFA 4QOZB 1U0SA 4ITSA 5D77A 2K7JA 2XGPA 2E7VA 2ZBPA 3H6EA 3CCRN 3M8ZA 5AE3A 1OY8A 1YBUA 4C8ZA 4NYZA 3ITHB 3H25A 2VQFF 4FXWA 3DLLL 5KFBA 4Q43A 1TKZB 3WUHA 1U2VA 3V1OA 4X84A 2O01C 3ZX2A 2RMLA 2BKOA 3W8PA 3THXB 1OH7A 4RW8A 5E3QA 3LAMA 1O51A 2WZ1A 1NK4A 1KBRA 2XS5A 1SVDA 2XCPA 1RBOB 1XMOJ 3RZAA 1MSWD 4NLYA 3ZSOA 5AXNA 1IUJA 2P8IA 1X8DA 3DRRB 2E1RA 2UUCF 1WHXA 3PEHA 4IOAQ 2Z2ZA 4YDXA 3G6VA 2P9CA 4QS8A 4DR3K 3W7BA 4RNOA 4CK2A 2HMIB 2WAQD 2V2KA 1VRUA 2YHWA 3J7ZO 1Q8IA 2EWSA 4IFEA 2DGUA 5DGAA 4ZHRA 4CESA 1AYEA 3OUYA 3DXKB 4CJQA 3OFFA 5D4PA 3X1LB 4X4RA 3R5DA 3QEPA 1HKAA 2D0CA 1YF5L 4IO1A 2ZD1A 4Z4CA 2D41A 2R4FA 2OKQA 3VETA 2ILZA 4YY3J 1UA1A 5EWGA 1FVSA 4IH7A 4IDKA 1F60B 2OAUA 2OP5A 3E9LA 3ENAA 1RDDA 2HIQA 4KAIA 4DZ6A 4H03B 2OTJS 3TTDA 3L2RA 2BQUA 4WE1B 3DHWC 1VSMA 3NGYA 5CYQA 2WOMA 1BY9A 2ZNYA 2QV6A 1UVMA 3NMAA 4UOHA 2EKNA 5K5MA 3QEIA 5DDOC 4ZPVR 4JI8F 4EYIB 1IJEB 1Y5IB 2G0JA 4JI3F 3RBZA 3D9BA 3VZHA 4NLBA 1X4FA 4E7LA 5KFDA 2W6LA 2UUAK 4QIFA 2A10A 4DTSA 1SH3A 4I56A 3SPYA 3LDNA 1ZOTA 3VQQA 1UJ5A 3CD6S 3DMJB 3W3DA 3A0IX 1RBVA 4ETZA 5GADI 2HHVA 3SXLA 3ILLA 1HBNB 4PWDB 3LDOA 4E8UA 4EGLA 1HPZA 4B8AB 4ZP6A 4B08A 1UCNA 2CGLA 3J80Y 3RRKA 3M9NB 1K8KB 3BDPA 4H4KA 2AMCB 2V51B 2ZE2B 2ZH3A 2Y1IA 1MU2A 5KT5A 3HP6A 4DU8A 3TX8A 3IFRA 4DSIA 4RW9A 1WC0A 4P72A 3MOJB 3WXMB 3KK3B 3V81A 2G8VA 4DPOA 4FLXA 1U6ZA 4ICLB 2V94A 3J81U 1YJNS 4AQYK 4Y1DA 4F4ZA 1HBUB 5K9FA 1FA0A 4USIA 5D78A 3SIPB 3IBWA 3R9LA 2F8TA 3VR1A 2ZWPA 2HVHA 2N82B 5JVGL 2NYIA 3KZBA 3CJKB 1YX2A 5I9EB 2OI2A 5CE3A 2QA1A 3VAKA 4B3TJ 1VBKA 2J0QD 2YI1A 1NB7A 2P9SA 4DF8A 4DX7A 1ASUA 4DV5K 2DNYA 2K7KA 3HOSA 3MR2A 1WC1A 4LFCF 1SV5A 2M2BA 4FYXB 2ITMA 2O3DA 4BRNA 1SKRA 3W61A 4AL6A 3D67A 1Y9OA 5F8LA 4WF9L 3DLEB 4M5GA 3C15A 3QAEA 4NOHA 2CPFA 1GNKA 1WORA 1FD2A 1UZHA 2Y1RI 2OFGX 3EKSA 1NJZA 2DPIA 3P5BP 1S0MA 3H5UA 3MAAB 3VGMA 4YNQA 1RNHA 3MM7B 1I51B 3CCSN 1XR5A 2YX4A 1S0VA 2JEIA 4B3MF 1HNXK 2FVRA 4FM2A 3ZSWA 5C5JA 3UNGC 2CNLB 1TL1B 3HOTA 4NWBA 1KVBA 3RWUA 4IH6A 1LK7A 4OZ5A 1N52B 4CJPA 3P1GA 3CUNA 2ZZNA 3DM2B 3D7EO 2J7WA 1K9MT 1UA0A 1HKCA 1G3OA 3H4DA 3NVMA 1AA1B 5D0GA 3H98A 1XTZA 4NA2A 5A8KB 3E9PA 4X4QA 4J90A 2UVVA 1Q79A 3UQSA 4O3PA 4NASA 4DF4A 4GKJJ 3GMGA 4J2DA 3KD5E 2FHJA 4GC7A 3SUQA 2NPIA 2ABYA 3T1HK 4DTNA 2VH7A 3MCOA 2YX6A 3I6PA 1FX4A 2XWXA 2BOPA 2IOCA 2ZH4A 3H2VE 2PY5A 2CH6A 2ZUGA 3L7OA 1U2CA 4WYWA 2CPXA 3QSIA 5G0RA 1TKZA 4JV5K 1RSCA 3SQ2A 3R2CJ 3EMTA 1OWXA 3K5LA 3A4TA 2HNZA 3THXA 3U9DA 2AJ2A 4I69A 3AJDA 1BO5O 2G8UA 2B3TB 3Q83A 1B3TA 1HNWK 2LU1A 1XHXA 4FOIA 1JXLA 2KFNA 1IBMJ 4LF6K 1XIQA 5T7BA 2O8BA 3IFEA 1WHYA 3M8YA 3BY5A 3VEWA 3BBCA 2HHXA 4PL8A 4QPTA 4XDCA 3J7AP 4Y2AA 1J2VA 3D45A 5ETOA 3WC0A 1VQOS 2VFRA 3TUPA 3B8AX 3TQ1A 2CQ4A 2EFQA 2GCFA 4FF2A 4J2AA 2DGTA 2GTDA 5M2RA 1D4XA 3E9OA 2LQ8A 4X2BA 3IA0A 4AHRA 4CIFA 4ECYA 3EGNA 3SCJE 3DXKA 3CCMS 1ZPVA 3WNEA 4RU2A 4IJNA 3ELHA 5E84A 4OO1J 4CEOA 1QVGM 3PW0A 3MN6A 3TYTA 3WEEA 1F3VA 4I6YA 4FJ9A 1O13A 4B9QA 2XQCA 4JKDA 1HMVA 4IXCA 1DJ0A 4ILHA 4O0JA 2Z1GA 2AJ1A 3MCSA 5EY4A 3SYZA 1U1LA 1RB0A 4WXOA 1WLJA 4HHHA 1U4BA 4PXDA 1IKVB 4W5RA 3PIPQ 2MDAA 3VF4A 4X4VA 4CF1A 4DSEA 5B7WA 1P9YA 2CYYA 4FK4A 1QJHA 2NCKL 3LW5C 2Q1LA 2IRUA 4K0KJ 4OLAA 4TU7A 4QZVB 2GO9A 1SL0A 3V2UC 1T6DA 1R0AB 5AJ3F 2PN6A 1JLEA 3I4HX 3RAMA 2F8HA 1MMLA 3C14A 4IWVA 1Q8LA 1RAFB 1KOOA 5AQJA 5L46A 3H46O 1Q7YO 5F8NA 4CHYA 1RWMB 1NGDA 2JLGA 5GAGI 2VASA 1SS6A 4M8LA 4CEQA 2W2MP 5JJBA 2HHHF 2DIUA 4OYOA 2H51B 4MIWA 3WX4A 1WC4A 3RR7A 3RMDA 4X4TA 1ZBSA 2CPZA 4PWDA 3PIOL 1U1MA 2XCAA 5FPNA 4IOCL 3TARA 3BGFA 4JRPA 2JOQA 1K8KA 1SQEA 2UUBK 1FDAA 4ID8A 4DR5J 2ZE2A 4FWKA 5C25B 3O3HA 5J2QA 4B3SJ 3KK3A 3UKRB 2HBRB 2C3YA 1I3OB 3HL8A 2E6LA 4DG1B 3SQ0A 4DTXA 1S6OA 1HBUA 4LFAF 2W1BA 3H5SA 4Y0FA 1KD1T 3ALYA 2FGOA 2DR6A 3QAUA 4ZVPB 5GAHU 5IQ6A 2M7SA 2ATLA 5A8RA 4BR7A 3KKSA 4CP5A 3G6ES 1WF0A 4AL7A 4DPYA 1ATNA 3CJKA 1C6VA 4HEA9 4M5IA 1ZTTA 3M6UA 3QFPA 3NS6A 1HL6A 4DR2J 2FJXA 2AQ4A 3DOMA 3X3UA 3QO9A 3V9WA 3CFPA 4OYWA 3LZIA 3LUYA 5DLGA 2BX6A 1QQMA 4F3TA 1F2GA 5H9EK 3VALA 2MZQA 1R31A 3QEVA 1WNSA 4CO4A 4CEAA 4CLTA 3U3YA 3PEJA 1PJ5A 4TNOA 4W5NA 1QQCA 3HHLA 4YFUA 2QA4S 2B9YA 4QWCA 2X1BA 1M5HA 5E0OA 3FUYA 1LKZA 1MROA 1U48A 5HQMA 3UFCX 3Q2SC 5LMUF 5CZXA 3IR6B 4FN5A 2PT0A 4PG6A 4ZCLA 5M1KA 3HMJG 2OEMA 4USKA 1UPPA 1RHJB 4DR4J 1TL1A 3C16B 1WB9A 1UEVA 3IBFB 1U7LA 3M4XA 1K47A 1J54A 5LT5A 5ETMA 3NAIA 2G1HA 3QATA 1TKXB 3MM8A 4MKBA 3QIPA 4CBUA 1YI2S 2HQIA 4DOZA 1JXVA 5A8KA 4ANEA 3IRXA 3U02A 3FMWA 3QEWA 3SV4A 1TUYA 1E6YB 3HVAA 2O8EB 3IS9A 3V6DB 5D4OA 5LMNJ 2Z1IA 4RUBA 1N32F 2YH0A 1RT4A 4X62J 1NHVA 3L9ZA 4XPEA 4WYBA 2XC9A 1RTHB 3CWJA 5KG4A 3PJWA 4KB7A 2JEJA 1SPBP 2XHWA 1RBLA 2ZH9A 4QIVA 1N4LA 4OKJA 2IM2A 3TAMB 3AOAA 3NWGA 2W9AA 3RG6A 4ECWA 1SCJB 3CCVN 1B0PA 1CZAN 4DUZF 3KG1A 4GKKF 4HTUA 1TGOA 4Z4IA 5K20B 4LF9F 4DV1F 5IT9O 4A62A 5D4NA 3TEHB 4NYFA 1JWWA 2VG6A 3BQ0A 2R2UA 2PFUA 4ZPWR 2FHJD 1BI4B 5AT1B 3P3DA 1CXQA 4JI2F 1TUWA 4M3RA 1EP4B 2OELA 3OVBA 3M1VA 4WBFA 3RBEA 3MWPA 1Y5LB 1SIZA 4DR6J 1S4FA 4I68A 3HHKA 2DPJA 1HWUA 2YKQA 3VF0B 1KDNA 4CLUA 3P31A 3ENBA 4F0MA 4JI1K 2OZMA 3S8SA 3WT0A 3MN9A 4OX9F 4QW9A 1SJ4P 1KLMA 1YJ9N 1SL1A 4DX8H 1IBLF 2MQOA 3FGVA 2V69A 3MEEB 5C42A 5AXMA 5AZJA 4YOYA 5RUBA 1CQNA 4NLCA 5E26A 1JB0C 2OYQA 2HQ3A 2YNHB 3VQBA 2MKIA 2KU7A 3D6MB 5DM7Q 3DDIA 1HWJA 4IG0B 1DLOB 4GV6A 2V6AA 1WSHA 1TL5A 4DPXA 3ENWA 4ZVFA 2PAVA 2PD1A 1IBKK 2E2OA 4P10A 1FWKA 3VHQA 5ADXA 5KT4A 5IXUA 4K8RA 1U6BA 1PYTA 3FEZA 3IO1A 3E01B 1R0AA 3DLRA 2J8SA 4EBCA 5DZ7A 4G1QB 2IC3B 3NE6A 1GQEA 4OFZA 2DR5A 3MUVP 4CJRA 2CPYA 4N77A 2FD2A 1Z26A 3ICLA 3W5XA 2GS8A 2MLYA 3CMAS 1FKPA 4DQRA 3VV2B 1IKYA 3MMVA 3N01A 2FJAB 3WNGA 3K5NA 4E1NA 3U3GA 4EU0A 1LWEB 3AHPA 1NOYA 4W98A 4FYYB 4LSNB 2P9NA 1T6CA 4FWSA 4ZLJA 4N8NA 3UDVA 2ASJA 1IKWB 2WVEA 5EX0A 5H9FK 5I42A 1CJKB 1S1VB 2VC1A 3K2PA 4QPXA 3KG0A 5M1NA 2RPIA 3EDQB 3KHLA 4KGXB 3MPDA 2B4JA 2E5LJ 4OZJA 2JGUA 2Q31A 2FPHX 3CMEN 3D6FB 1JLAA 2OD6A 1XERA 5C10A 5E3PA 3QRPA 2ASOA 2VQEJ 1RDBA 4BE2A 1B64A 2Q36A 4OL8A 4J9LA 3IKMA 4PR6A 3O5TB 5GAHP 1GX5A 3VEOA 3MPWA 2MPUA 4CGHA 3QLHB 3SDEB 1N0VC 3T5JA 3ISND 1DKGD 2AZ3A 2WVCA 1FK9B 1WEXA 1QTNB 2FZKB 4WFYA 4OV6A 1PYOB 3HHEA 4ZVOB 1XHZA 2BABA 3TEGA 1K8AO 3KLGB 1FT8A 4V19S 5HATA 4F4WA 1Q81O 2D3ZA 2L48A 2HBLA 2HNDB 2F8MA 3KK2B 3KTQA 2LDIA 4NXNJ 5DQGA 3KUGA 2Z58B 4YORA 2KJWA 4NX9A 3NMRA 3OYBA 3PYFA 3QMQA 1S0NA 5BPMA 1KS2A 4DZDA 1LW2B 1M5SA 4DPWA 4BDZA 2YNGB 3PRVA 4RWWA 1SQFA 4CF2A 3C16A 2D5RA 3SQGA 3J7ZT 5KFIA 4UY85 3HLUA 2X3GA 3D68A 2X1AA 2ZUAA 3CJ8A 3LP0B 5AQQA 3DGPA 4YR2A 5HQ8A 4M5KA 1KHVA 3CJCA 3OXGA 2VICA 1VC5A 2XI3A 1KHWA 1RT5A 1F21A 1X5OA 2R7VA 2ZWOA 3D28A 2G8KA 3GLJA 4X4NA 3RSEA 1E6YA 4XK8C 1N33K 2O8EA 3B6PA 3W5YA 1NJYA 1EQYA 2YHXA 2WONB 3ZO7A 3CJ9A 4JBCA 5M1QA 4K8XA 1KVIA 4ZPCA 4QWAA 1VC0A 3RJMB 1YSJA 5IWAJ 2F4VF 3M2VA 1NGEA 4Z94A 3JYTA 4WZMA 1VLOA 3KXDA 1M90O 1SZ2A 3C7NA 4W5QA 1S59A 2WBRA 1JQGA 3Q8VA 3KWGA 5AZIA 5KT2A 2A1BA 4Q44A 5EOYA 1I5OB 2WFBA 3UE5A 4WIIA 2H9ZA 3GCWP 1VQ7S 5F9LA 3NEKA 5HP1B 3POTA 5FPMA 2RQCA 3TJAA 4BVPA 5GMKa 2LFVA 4C3MA 2D9OA 1PJ7A 2HVDA 4LT6A 1QHTA 1IJFB 3SAFA 2VA3A 1U47A 4KHQA 4NLSA 5D0EA 2DNZA 3CJ5A 3TJ9A 4RNFA 3CULA 4DCHA 3PZPA 5KFRA 3MUTP 4CTAA 3FQLA 2YBVA 4FJJA 2N4DA 2CQ2A 1KAXA 4AD6A 2BVZA 1U45A 3UR3C 3EPGA 3KUEA 3CCLS 1N8RO 1GOBA 1ATRA 4BROA 3MCPA 3PNIA 3KNGA 2IAJA 3T5HA 3D54A 3O2IA 1BWEA 3DLKA 2IGIA 3D2WA 3UIQA 1S6QB 3ZSYA 4LF8K 1X60A 4AHTA 4ZVTB 4FLZA 1DLOA 1CZBA 3PW5A 2C2MB 4NXMK 3EE9A 2GVZB 5GADP 1JXBA 3PYGA 2ZJRL 3UN2A 2DO0A 3O9TA 3I55N 4FNIA 4ED5A 4HLBA 3KHYA 2I0XA 3FCWA 4HYKA 4ALZA 3E01A 4B1YB 3OXLA 2RDDA 4G1QA 2RQKA 1W7AA 1TR0A 5EDWA 3CJAA 2HB5A 2DGQA 3VPZA 4L72B 4KYZA 3CIPA 1ILYA 3IWXA 1GLDG 3OHAA 1NB2A 4WCEQ 5KG0A 4YHHJ 3P5JA 2QKBA 1S77D 4ZDNA 2W9CA 4H5TA 2RRNA 1M5KC 4NLRA 5KRTA 3EL2A 2HBYB 3DDNA 1LWEA 3CO9A 4I6AA 1HI0P 1XC9A 1HD1A 4KH4A 3V9ZA 2EEYA 3W8GA 3M8WA 4F7VA 3GOIA 4CZKA 4RO0A 4Q5VA 3U7JA 4ZLPA 2VZ9A 1S1VA 4CJUA 2ZM6J 1GLAG 4NCGB 1AUSL 2IDLA 3OYNA 4LF5J 2UXBJ 2CQIA 3EZWA 3GV7B 2AKWB 4J2EA 2D0OA 3MM9A 1WC5A 4DPUA 1X5SA 2YCHA 4BQLA 2B6AA 1VSEA 3QGIA 1UJ6A 1U49A 2RHSB 3W3SA 2HOEA 3EICA 3Q22A 4M3XA 3A8KA 2K3IA 1YJRA 4PG7A 2LSNA 2O8FB 1TAUA 2KG1A 4DN9A 1I94F 1C0FA 3PKMA 1TP7A 3BPSP 4DFMA 1RHQB 1T03A 3UCZP 1FJEB 2YWHA 1Q1KA 1FK9A 4DV0J 4PXBA 3VQ9A 5B0FA 3KJVB 4K4WA 3DHXA 4RL1A 3MDFA 4FLVA 5CQGA 2RU9A 4LSLB 3A1YG 4PQAA 1RTJA 5E2QA 3R7BB 2UVRA 2HAFA 4FF3A 5HMWA 3WDOA 3H3NO 1H72C 2MSTA 2IHR1 2GMJA 1NJIO 5IFMA 2MKCA 2ZVSA 2HNDA 4CLYA 1XNRJ 3DJCA 3GPAA 3W2VB 1WACA 2IJRA 4ECTA 5KFAA 3DRSA 3M8SA 3M8PA 3V9UA 5KFUA 4DLEA 2XULA 1RHRB 4UT4A 3KLVA 5A6WA 3PSIA 4P7TA 2ALZA 4B02A 2R2SA 1RTDB 4B17A 1SIWB 4DU1A 3HXMA 2GX8A 3ZEUB 3E3XA 3NH2A 4DCPB 3V4IA 3OYEA 1ZAVA 3OW2M 3DLGB 3GSIA 5ETSA 1DGKN 2G4BA 1FVQA 1B70B 3PXGa 3T1YF 3ZZPA 1OJ4A 2BUNA 3HJVA 4IYQA 3BQ1A 5KQDA 1P9QC 3SK3A 2RF2B 2DNGA 3KYLA 4WFAQ 1IM6A 3VEZA 1ZXOA 1F5CA 2JVOA 3SSSA 2B4PA 3PX6A 1SJ3P 4Y28C 3BO4A 3PKYA 1FW6A 1PO6A 3FKBA 2ACYA 4ER8A 1BWFO 2M4MA 4UOCA 3VQAA 2QG9B 3BF3A 2R3VA 3AQOA 2NRHA 5EHHA 5AE1A 3DOLA 2CZ9A 4HH1A 2BE2B 2PDAA 2HKEA 2P6SA 3QGPA 2Q66A 3AVLA 2FSKA 2YNFB 5I3PA 3DYAB 3OBWA 4LF4J 1GFWB 4MK9A 2HGMA 2VPYB 4LRAA 3R8YA 3S6EA 2C3OA 3GR0A 1HA1A 3F9MA 3IXQA 2CNNB 4KREA 3V6KA 5CHCB 3TUJC 2C2OB 2Z2LA 5HJYA 2DKOB 2KFYA 3U4LA 3A8JA 4DQPA 5CYMB 3PM9A 3EKUA 2DGOA 3ZX3A 3CQXA 1Q7YT 1D3WA 4ZVSB 2UVWA 1VBYA 3ZT1A 1UAXA 5FPEA 1X4EA 3HKZD 3IDHA 1GLBG 2AEFA 1WC6A 3LP3A 3VTHA 2V9KA 1S9EB 2F5GA 1VQMS 1CVJA 4DR1J 3A8YA 5I3QA 2PIIA 3CC4S 1R8AA 4QU6A 1RBTA 3BEGB 1TUVA 2MJUA 2AV5A 1XNQK 1RWKB 2E4LA 3TAFA 4JI6K 1U1OA 5T41A 3OBIA 2KHOA 2QEXS 1SKUB 3O1WA 2CWXA 1HJRA 3R5AA 4DV7J 3CVKA 4HL9A 2Q6CA 3QFUA 2XSJB 3O80A 2AGOA 3OQ2A 2A40A 1BC6A 1GLCG 4QCLA 4CF9A 3Q24A 2COLA 3R6GB 2FLPA 4DXLA 1NMEB 2Q43A 5GAEU 1N48A 4BCAA 1KKHA 3IG1B 2C28A 2GFFA 3TAGA 1XMQK 2E1YA 3BO2A 1Z25A 3AB4B 2WTUA 1BISA 4NEYA 4CFBA 4IFYB 2KL8A 1KAYA 4JEPA 4BC2A 3TZXA 4P73A 1D1UA 4DL0C 1TL3A 2GAGC 1KN6A 5FRNA 2YKNB 4CEZA 3Q7CA 1F9EB 2C2RA 2NUBA 3CCQS 2E9ZA 1RCHA 2B4VA 1B4SA 1QAIA 4IBNA 2DEJA 3HYFA 2ZKTA 1QAYA 2ZEJA 2EBGA 2GAHC 1NK8A 3OYKA 3BKTA 1U1NA 1WOSA 3G86A 4PAAA 3VQ7A 4A8FA 2QKKA 4DR7J 3HT0A 1XJWB 4WP8A 5DM6L 1QAXA 4KHWA 4JI0F 3OR1B 3ETOA 4O4GA 1UFKA 3MM5A 2XNRA 4A46A 2IDEA 2BV3A 1FKAF 2NRWA 3BGRB 4IQXA 4HH0A 3U1NA 2VQFK 3FMBA 3AV9A 1QS4A 1A5XA 2QW9A 2J9DA 1N6QB 2G2OA 3P96A 1K0TA 2UXDJ 1Z2ZA 3I4PA 4O44A 2A41A 3SSQA 2CJ9A 4CH7A 4OYZA 5AQOA 1RYSA 4OV1A 1RWXB 1UL3A 4JI4F 1JLBA 3P49B 4IJAA 2UYTA 3JXOA 5DK5A 2OTJN 2UUCK 4D3GA 1KVJA 5DDPC 3OTOJ 3IAYA 3NMUA 3ZT4A 3OTBA 4A57A 4AH9A 4LSLA 1KRPA 3ZCMA 3GJTB 3PRBA 4OLPA 1S1UB 4QYZJ 2ZBQA 2ATCB 3R2DJ 4OZNA 2HW3A 1YG0A 3D3BJ 2OGUA 1YUWA 1C0GA 3HVWA 5KT6A 4JV0A 3W2VA 3GFYA 2P5GA 2NUUG 3VQ8A 1CJVB 2GV1A 3NGKA 4LFBJ 3CD6N 2ZKUA 3CFOA 3BBBA 4CJSA 3K17A 5KFOA 1VIXA 4NLVA 4Y2KA 1RBRA 4OJRA 1Y97A 4U7BA 3HT3A 1PG5B 3WQUA 3EGZA 3ZEUA 2DJWA 2UV8G 1VJWA 3LPTA 4M95A 1JLQB 1W26A 2VFUA 4J9QA 4Q0BB 2KI2A 1SC3B 1VQLS 2UU9J 3TA1A 2FC8A 1H2TZ 4EBEA 4IOBA 4TY8A 1RWOB 3NRBA 2RF2A 5FDLA 4MKAA 1B7YB 4I6MB 3ZZUA 3T5LA 4JI8K 2CJKA 2AP1A 2ZH6A 2BJ7A 4USUA 4JI3K 5KFLA 4Z37A 3HJFA 5J2PA 4NA3A 1GXUA 2OPSB 3CTRA 1VSJA 3UKUB 4MKVA 1RKJA 5KFFA 3QT5A 4ZVHA 4JK9A 1XUPO 1NNDA 4U6PA 2GVDB 3EWGA 5L1LA 2YNFA 4LF7J 3DYAA 4K4TA 4CBXA 4DQ8A 4WYLA 3H20A 2BUPA 4WFBQ 2UXCJ 2HRTA 3EVMA 1VCTA 4JKBA 1XMOF 4CQ1A 1SH0A 1NGGA 3IGNA 2ASLA 4DV6J 1QVFM 3GFXA 5CYMA 3CCJS 4CJWA 2DFEA 4GO5X 4BWJA 1LFPA 1BU6O 3OYIA 3CE8A 4RWXA 4H0PA 3KLHB 3F2KA 1DAXA 3VQCA 2VF3A 2YVSA 1B9DA 1S9EA 2VYPA 4ZN3A 4USVA 3OW2R 3AGKA 3TRGA 4FJIA 4OIXA 3FZMA 2NXEA 2J6UA 1TYQA 4OYMA 2O4IA 3ZSRA 4DTUA 1LWCB 1FJGJ 3GFZA 1D0EA 2RT3A 4P9SA 2XSJA 2UV8A 4FL9A 4CT9A 4LFCK 2A3ZA 2O8DA 1C1CA 2NUHA 3M32A 3P8BB 2DH8A 2VFSA 4DMNA 2DGWA 1EWQA 1LAVA 1RAIB 4CNYA 5HSPA 3IG1A 1X5TA 2YH1A 1BCOA 5LL6d 3ZZYA 1GLEG 1V3ZA 4DLGA 5KFWA 2KXNB 1WKLA 4QS7A 2HVIA 5GAEP 4IFYA 4EO6A 2AD9A 5KG6A 3KOAA 1HYSA 3KDOA 1JLGB 3QERA 3MEKA 3UDLA 1HQUA 5IT9U 2YKNA 4B3MK 4LBIA 3LZJA 2QLFB 4JI7J 4L73A 2BRKA 1DTTB 4F50A 1K8AT 3SSRA 1B0TA 2EG1A 3QETA 4CZMA 1R59O 3R8EA 1WUUA 4FWQA 5L1JA 1Q81T 5HROA 5L8RC 3IR5B 4FO0A 3FFKB 2BA9A 2FLOA 1VQON 3BH6B 3H2UB 1X9MA 4I2PB 4WFNL 3NBPA 3GZ7A 5B0BA 2O8CA 5HL7Q 3OJUA 5AQLA 3HI9A 1NRKA 4NZ6A 3OR1A 3ZTPA 2VPWB 2JFDA 4JKFA 1IJJA 3HF5A 4GVLA 3KMSA 1Z6RA 3VAMA 3OSNA 2QXLA 2I2YA 1NH8A 2DY4A 3OYJA 3OS0A 3RU0A 4WKYA 2MQPA 3CCMN 2E29A 3AA2A 3CJ7A 3L3VA 3JAMO 4DFJA 1UWBB 3DXBA 4CFCA 3NGUA 1WSJA 5F8HA 3H1QA 1IBCB 4LF1A 4MLEA 4YDUC 3N4PA 2GEMA 2IVOA 2Z2MA 1Q0NA 4J37A 1E3MA 5AQSA 2YWWA 1Y7PA 4CJTA 2HBKA 4N56A 3OHRA 2P5VA 1EETA 2X6NA 4B3TF 3UR0A 2IY5B 4S0MA 2DHHA 2ZBIA 3AD9C 3ZSXA 5FROA 3D0GE 2DRDA 5C12A 2V8VA 4C11A 3L4BC 3CCTA 1M90T 2CFXA 1D9DA 2E8AA 4JI1F 1FXRA 1GLJO 4OKEA 2LU2A 3ILJA 2IS3A 3CJTA 4CH1A 2UVUA 4QYRA 2EX3A 4K59A 3LGMA 1QZ5A 3SBGA 2V8PA 4YOXA 5D0RA 1GOAA 2Y1LB 2NRVA 2EHGA 2AGQA 4EYHB 1KVCA 1YXQA 1FI4A 4JS4A 1DTQA 1T95A 2AX0A 2XMTA 1LAWA 4TLQA 4JV2A 2L41A 2QX0A 1JLQA 4YDDB 4Q0BA 3C3LA 3HZGA 5DDQC 2DTJA 5DG9A 3TZYA 4KFBA 4EI2A 1RLDA 3R5JB 3AJ1A 1N8RT 2FGCA 1WDDA 3FC9A 2NS1B 4AM7A 1FWLA 4I6MA 3RRHA 5F8GA 4UY8O 5HVHA 4GKJF 5AJ3K 3HPOA 2ZGYA 5B08A 5L1IA 3G6EN 2CQDA 4FSVA 2KO1A 3OTEA 2QRRA 4M45A 3HD2A 1R8HA 4FVCA 2IVMA 4ZK7M 3AAWB 4E0DA 2OPPB 2FVSA 2XY6A 3VQEA 4CO0A 4UOFA 5I3UB 4FXVA 3W2WB 5IM0A 2HHHK 3PRDA 4NO7A 3VA0A 2QC3A 4BY9C 4BRPA 5F8IA 2JH3A 1HHQA 1EX8A 1NPKA 1MWQA 3ISNC 3M7VA 4NI2A 2VWBA 1WOOA 1OYDA 3LL3A 1S9GB 5G4DA 4WTOB 3I8DA 4IO9L 1UZDA 1PGZA 1IBMF 2H1YA 4Z0UA 2ZITA 1P8GA 5BYSA 1BG3A 1WWHA 1P27B 3W60A 4QR0A 2QA4N 4KHPK 4ANDA 4X4OA 4YB7A 3L7UA 4ZVEA 2B9WA 3C8YA 3SCKE 2MGZA 1GXLA 2B56A 3UE2A 1RP5A 1MLAA 4HTJA 4OZ2A 1HYZA 1HNIA 1SJ1A 1JNZB 3TVZA 3DAWA 1SAZA 4KKOB 5HRRA 4LFAK 3J8AA 1YITS 1RWUA 3HKWA 1WN7A 4PKIA 1YJWS 1PBAA 2KTQA 3AJ2A 3WXJA 1SJRA 4RW4B 4FJLA 4FJMA 4F4KA 4C98A 1LWCA 2VGMA 5FJ4A 2YPZA 1N5YB 2ZNZA 3VTIA 3NCQA 3P45B 1T11A 4AXIA 1FXXA 3OD2A 2RAQA 4AHSA 1YI2N 4LR9A 4OGEA 1VK3A 4IEEA 4O55A 2DNRA 4O3OA 2Y8YA 1G4CA 2B8PA 5KFEA 1TKDA 1SQGA 4ZP8A 4A8SA 3S3NA 4QIGA 3WXIA 3NNHA 3D2FA 3N6MA 3LO3A 3OL9A 4H5WA 3I96A 3Q23A 3GWCA 3AAPA 2LXUA 3U1MA 3JB9k 2CJQA 4E7KA 4K0KF 3SZ2A 1EZZB 5LMUK 3A3NB 4K25A 4MLHA 1C2PA 3L4IA 3KWMA 3Q8RB 2I38A 3VOVA 1B99A 5H1SV 1DTTA 2BDPA 2VONA 4KV8B 1X4AA 5FLXU 4X66J 3CW2C 2L9WA 4RJVA 2RQMA 5DMRA 2C2NA 1NJIT 1RT1A 4GVBA 2PMWA 1WAJA 5ETQA 4OQJA 1RDUA 4KTWA 1RFQA 5D4LA 1CEZA 1C0UA 3G4SS 1DEJA 2HG4A 5JMVA 4RUAA 4WZQA 4IFVB 4WK1A 1S1TB 5ETPA 4DR5F 2E6MA 3TZWA 3FZLA 2ZOMA 1N34J 4JAXA 2L3MA 4B3SF 3DRPB 1YVFA 3AA4A 4WU3A 2D1KA 1WNEA 1MWZA 1C0TB 1C1AA 1UWBA 3CHWA 4DV2J 3QB0A 1QHAA 3JXUA 1Q53A 2F3JA 2ZGZA 1Q86O 2FYXA 4HCCA 2NSBA 1V9OA 4WK3A 1AB8A 4TU9A 2YHAA 1HFEL 1WI8A 2FHOB 1CJUB 3KHRA 2BH1A 1J5OA 1LFWA 1MA9B 4GKKK 3TO8A 4Y00A 5HN0A 2HNYB 2HHQA 3L4QA 3KVGA 4LF9K 1HBOB 3NF7A 4CJLA 4DV1K 3HO1A 3WXLA 1R7IA 3CDUA 4P6QA 4BRCA 3G71S 2ZF5O 4H4MA 1T05A 1OPZA 2XB2D 2JHEA 1O1WA 1YTAA 1NU4A 2ILYA 2JJ4D 2NQPA 4JI2K 3K0JA 3MX2A 4GO7X 1EKEA 1M5VC 2IIHA 4KHYA 4J9UE 1F3FA 4I64A 1HNZJ 4QR2A 3EX7B 3TVYA 2MLXA 3BSNA 4L3QA 1XBWA 2YWEA 4Y2IA 3DI6A 1QSYA 2B4OA 4K4UA 2DFHA 1HI8A 4FVUA 2DXFA 3M6WA 1S97A 1S5JA 4OX9K 3TAQA 4RNMA 3CMAN 2FJEB 2EG2A 5HBMA 3TNVA 2V9WA 2PMHA 2Y0BB 1FDBA 5A0YB 3JS6A 2IA0A 1S72S 4OYBA 5F41A 4HT5A 4HI1A 4OYPA 1GK8A 3ETMA 4N7TA 1WUAA 1F9FA 5M1OA 3VMFB 2KB2A 2RDJA 4JHDB 4PEOA 4PWWA 4O5BA 1EXQA 1CC7A 2FLNA 2EPIA 4KO0B 3K5MA 2XYPB 4EMDA 1IR2A 1BGXT 1LK5A 1VQ4S 5HRSA 2A6AA 2W8LA 5LMNF 4ZVRB 3P6YC 5KPTA 1NGJA 2DFFA 3TR8A 4DL2A 1BE4A 3QIOA 5MLCQ 5C0YA 3C6HA 3SMZA 4OHZA 2HF4A 2ZHAA 3O5BA 2CA9A 2CJYB 4IR1A 3OYGA 3DXMB 3VGSA 4H5NA 2R7RA 3HSDA 3OS1A 3JSBA 2HQDA 2EKYA 1YJ7A 3P4IA 3QJPA 1S9GA 4P74A 1RCXB 2CDQA 4DL3A 5LJWA 1J53A 3LOUA 4OHXA 3I0RA 1U2VB 2CH5A 2G2ZA 4PZVA 2BANA 4Q7AA 1PKUA 1Z1ZA 4TYAA 3PHTA 4RW8B 4A59A 1TAQA 1NUEA 2E2NA 2G9OA 2HS3A 2AEJA 2YQ0A 4DR6F 1NCLA 2IMOA 2Q1NA 1KOHA 1P1LA 3AD8C 3KNAA 1C1BB 1X4HA 2E5HA 2EFGA 7FDRA 3R3TA 4RW4A 4WWSA 4F0KA 2Z1JA 1E4GT 1WBDA 2P9EA 1V6HA 3A3PB 4U7UK 2OPQA 1SC1B 4FS2A 4CGFA 1V3SA 3R3LA 2JL9A 1P90A 2XY8A 2PEBA 5DJBA 3N5BA 5JVHL 2IRYA 4B1XB 3CB4A 4B3RJ 3BDEA 1NWKA 4AT1B 4O8UA 3QNWB 4KHRA 3OUYB 5JS2A 2HVZA 4UW2A 2DISA 2EFOA 2LMIA 4ED8A 4XTTA 2Y0SD 1VJQA 1VSIA 3DGVA 2HSEB 5ETNA 4ELUA 4IDKB 3V9XA 4F9OA 4PRFA 2D0PA 4GV3A 4GMKA 1PSDA 5HK4A 1RCOB 4KV8A 3VQ5A 1VQ7N 4F2SA 3IMQJ 5CYQB 2WOMB 1HARA 4OVLA 2DRBA 4ZN1A 1S48A 4Y3CA 3K5PA 1I3AA 1RT7B 2XYHB 4GW6A 2YXLA 4G1IA 2QMWA 1NJWA 2P9PA 2WSFC 2J7UA 1S7HA 2DXEA 1FDNA 3MR5A 3GL1A 3AT1B 1TUGB 2V2ZA 3L3CA 4OYXA 3M05A 4IFVA 4CZCA 2JWNA 2E2QA 1VOMA 3G10A 4WU2A 4HACB 4ECQA 4YOUA 3MEDB 3HPHA 2FUG9 2RDIA 5KFZA 4UTGA 2ZH5A 1OS5A 2F4VK 2OD4A 1FDDA 3CCLN 2PO4A 2POKA 3CCES 3AVFA 2YX1A 1HPZB 2R9LA 2E5LF 1QM9A 2XTJP 2Y9HA 4MO5A 4N5SA 4MIAA 2VQEF 3AQPA 3B78A 2H48B 3RMAA 4U95A 4RW9B 1HBOA 4YB6A 1N5TA 3V81B 2E1MC 4ZPDA 3AODA 1HYVA 3DLLQ 4JB8B 1R89A 3GTYX 1RTIA 2I9SA 3QZ8A 2IMWP 3SQOP 2CGKA 1LOUA 1YVUA 1VQ5S 1NDKA 3A3OB 3NF6A 4FWOA 3EY1A 2G1DA 5EWEA 1LCUA 2BJEA 4J9MA 1FRJA 4DUYJ 1F1BB 2LQBA 2NRXA 3OV7A 1QLNA 1TK0A 1T7PA 1VSHA 4B8CA 3ULHA 1ASVA 1HR0K 2M8DB 5DQHA 2RS2A 2XHCA 4NXNF 1FXDA 1U1QA 1RT2A 4HHUA 5KFTA 4A8KA 3S1TA 2NNWA 3LM2A 2BZ2A 4PY5A 4KHNA 3NP5A 2KVIA 3SCXA 5KFJA 3MMBB 1S10A 1SQKA 2MKJA 4G6VB 1XMQF 3RBDA 3PVXA 3Q0AA 1HQ2A 5K14A 5AQKA 3M8RA 4EP4A 2BW7A 1T9TA 5KG2A 3G25A 5BYQA 2VOOA 4BC4A 3NXZA 2BJ8A 4CLFA 4TKTA 1OIAA 2C3UA 3B8HA 2DXDA 3G82A 1PC4A 1J5EJ 1Q5YA 3PFEA 3G6YA 2E1PA 4F25A 1WJ9A 1U09A 1X5PA 1IG8A 4RX6A 4M5NA 1TL4A 4FLTA 3AVCA 3CJ2A 3BF1A 2J8AA 3ZTSA 1N36J 3W0LA 1ZTWA 3GG1A 5HJXA 4U96A 3KK1B 4HUFA 1CS4A 4ILMA 4CK3A 1VRTA 1B0VA 5GMEA 5IWAF 2RHKA 2E1ZA 3VEXA 4F26A 1Q8BA 5MAOA 3O9RA 1IVZA 1N34K 4KHMA 3AB2B 2K3KA 3TOQA 3RAQA 1TFWA 4ILLA 3MPUB 3CERA 3N0VA 3P4UB 5ETLA 4LR7A 4X64J 1RXOB 1WTBA 1KEKA 2KT2A 5K8PA 2DNHA 2VODA 4GMJB 2CNKB 4FLWA 2IRXA 2HLTA 6FD1A 4DB3A 3I0SA 5G0RB 1YZ7A 4DV3K 4FJNA 4X4UA 2OSQA 2GELA 3D7SB 2HNZB 3D2EA 5AQFA 3ZT3A 3W63A 3OYDA 2W2PP 5C24B 2HHPA 3H90A 2O8BB 2GGPB 3M6VA 2FBXA 2ZC4A 2E66A 4I1TA 1Y4ZB 4B9MA 2HFOA 2MZTA 3TU5A 1RDCA 4OI2A 1C1BA 2OFHX 2MXYA 3BSOA 1CLQA 1GAOA 2GA7A 3CT9A 5JUMA 4CF0A 5IZHA 3M2RA 2JEFA 1AW0A 2YJEA 1N32J 1I94K 4X65K 2W7AA 1NLKL 4LRFA 1W2BR 1NBEB 2D1CA 5JVGQ 4FS1A 4KRWA 2VWJA 3JSYA 1U2RA 4JOUA 3QICA 3HBTA 3NCIA 3HFVA 3KHHA 2JZ5A 4CZGA 2FJWA 3F44A 1VQPS 3SPZA 1Q16B 2QWRA 3O08A 3M30A 3R5CA 4WXWA 3S9HA 2R8JA 3DU6A 2PYJA 3THWA 3WEEB 4I9QA 5C2FA 1HMVB 5F8JA 5LSOA 2C1EB 3G8QA 1MNEA 4JKGA 3KIOA 3GYGA 3FSIA 2KYXA 4PWUA 5ETRA 3J7Z5 4U67L 3O6QA 3IM9A 4WF9Q 3AXMA 5EGYA 4BR0A 4PG8A 2QYCA 3VAGA 2H4WB 4I4BA 4HUEA 3MWBA 1YRTA 4CI6A 3VQSA 2VA2A 3B6BA 1K1QA 1WKJA 2IM1A 4UOGA 2FJVA 2WUSA 1RT7A 2D9PA 2P9KA 4YHHF 4USWA 4LRDA 2Y3YA 4KB0A 4W4MA 3T1YK 3CETA 1JLEB 4LY7A 3CGIA 4RZRA 3C14B 3ZTRA 1SKSA 2Q79A 1D9FA 4FNHA 1MDUB 4ZPAA 4DQIA 5M2UA 1H1VA 1X31C 1VQMN 3I82A 3CC4N 1IBLJ 1F6TA 2D7SA 3CJ3A 1VBXA 2CADA 4HACA 1VQKS 3PLAA 4OYAA 3MEDA 3LP1A 2GW8A 2GZOA 4JYAK 3SV3A 2QEXN 3R6MA 2ZM6F 1QUVA 4FJ7A 4F2RA 2UXBF 2W2QP 4LF5F 3FEXB 3D0IE 1QQNA 2KJVA 3MAQA 3K5OA 1TV6B 1JKHA 3I8BA 4KI4A 2HFUA 4JI5J 5J2QB 3VEYA 2UUTA 5KTQA 4UY8T 3N28A 4OI3A 2A1SA 2ROGA 3GJRB 2QL5B 1RE1B 1WG4A 2V67A 4M1KA 3CPEA 3PO4A 1T9UA 3O4WA 5B0CA 3CC2S 1XC3A 2IVFB 1VHIA 1BHNA 4D3HA 1NGAA 4DV0F 2VU5A 5A8RB 1D9AA 5A2QY 4OPKA 1LQ9A 2GJIA 3J80U 1VQNS 4CF8A 4QU7A 4FOEA 3DOMB 3OFHA 3PTWA 3QO9B 2R7TA 1SI9A 4PUOA 1E4FT 4OKKA 2MQQA 2PMZD 1TFYA 3SBMA 3CCQN 3JAMY 3D3CJ 2VJUA 3HSCA 2IYGA 1FFWB 5IV4A 1XNRF 3DKDA 2P51A 1NGIA 4WJBA 4FBUA 3FZFA 2XWYA 5ADXH 4NYNA 3MMBA 2HRUA 4G1PA 3HHLB 1G99A 2CQPA 2R2TA 4XH4A 3A8IA 5ETKA 2JC0A 4BR9A 2QA4G 4I2QB 5AXKA 3MCMA 1QQOA 1MROB 3JQMA 5HMXA 3SBTA 1VHFA 4J9OA 4UZCA 2YNIB 1IR1A 2HQCA 4PYAA 4OPHA 4E19A 1M1KO 2Z4PA 2GIFA 2YJFA 2M3DA 3EPIA 3CD7A 1NPRA 5CD4H 3O3FA 3GSDA 5BR8J 3KK1A 5T7LA 3MM8B 1A7GE 4ED0A 1FRHA 2KXHA 3T6BA 3QIPB 1VQ8S 1UTAA 2Z1HA 3FBEA 4XO0A 3P38A 3THTA 3IRXB 2D3O1 1QTMA 1NGCA 3IS9B 1Q95G 3ASMA 4LF4F 3HP9A 4L76A 1KVKA 4CHOA 1RT4B 3AA5X 4HUGA 1URRA 3MUMP 1WSGA 4NLQA 1RILA 5TKYA 3AGRA 4JI0K 3VERA 2P2CB 3VEVA 4Q2LA 2J0SD 3P39A 3RB6A 5HLFA 2BJ9A 2GUPA 2AGPA 3PIOQ 2YWFA 2MMYA 2F8EX 3M6XA 4A8MP 1AFJA 4IOCQ 3QYYA 5C24A 2A0FB 4GRSA 2ASYA 1CXUA 3W65A 3TQEA 2GGPA 1EARA 2NLXA 4DR1F 4DL4A 4H0XB 2VG6B 4YR0A 4FYDA 1R8CA 3EXCX 4DV4K 2WW4A 4Q8EA 2GMLA 4HDGA 4K2XA 4JI4K 1YIJS 1BQNA 1OKJA 2XYGB 5AQUA 1VQLN 4DV7F 3M1VB 3B4MA 3CI5A 1MMDA 1MWYA 2A18A 1NKCA 1LV5A 2HYIB 2O5DA 1B7FA 4C8YA 2V4JB 5KAKA 1W97L 5KI6A 4M3YA 1Q86T 4DJBA 4XPCA 3CF5L 4TQSA 3K57A 4J2BA 2CJBA 3TJ8A 1U1RA 2C2KB 3TX0A 2FSNA 1KLMB 3VGLA 4ZS6A 3F0NA 4ISFA 2NSCA 5EX3A 3NGIA 2K06A 3SFUA 2IIRA 4ERDA 5C42B 5AZJB 3KLFB 4PG5A 4QS9A 4I7FA 4ED3A 2AJFE 2SXLA 2IVPA 2YHBA 3FZKA 1XR6A 3PUFA 3ZZOA 2J7KA 2NYHA 3I31A 4JD2B 2YQ1A 4F67A 2BACA 1HQEB 4DX5A 2OMLA 3Q8YA 3SCIE 1G7CB 2BTFA 3CCJN 2W9BA 4BBYA 2GO8A 2XZWA 3OL8A 2NRTA 4O23A 4ED4A 4DR7F 2XY7A 1RAHB 4BE0A 4DS4A 4RW6A 5ADZA 2RKIA 3QT8A 4M5LA 1WG1A 2WTFA 1FKPB 2X1GA 2QFIA 3GCXP 1IKYB 3QJJA 2OJ3A 5TKWA 3OYMA 3BSCA 2RH3A 2UXDF 2EC0A 3AO4A 1TV6A 2J4RA 4KHPF 3MXMA 1HKGA 1YGYA 2P9NB 2IM0A 2JLEA 3VCDA 3IWNC 3IP0A 1PC5A 2XM3A 4KGVB 1P1TA 3D66A 2WB1D 1D09B 1XMOK 5I42B 3SNNA 1RHMB 3NOCA 1N88A 3CXCR 3BP8A 4A5AA 3OTOF 1JLAB 1NLVA 1WF2A 3IMXA 3TR5A 4CHNA 2VBWA 4OI1A 1A9NB 5HOOA 4YR3A 1ZH5A 4BE1A 1VLYA 4RNHA 4J9VA 1NM2A 2AEMA 2AWZA 4YB1P 3QFHA 4FF4A 1ZAWA 2BRLA 2V63A 3F9KA 3DOKA 3GU0A 2XY5A 1DQAA 4O4RA 5BPNA 2DHAA 1VC6A 3CQYA 1HHTP 2GQQA 4LRBA 5AQTA 1JK9B 2DB1A 4DTJA 3MFIA 1XK8A 4OZ0A 4LFBF 4QQBA 3E51A 3HHDA 1QAJA 3CO0P 1L3VA 2QWLA 4OLBA 2FDNA 5C2GA 4NRTA 4YY3K 4I2QA 2FC0A 5JS1A 4FPBA 3V5RA 4ECXA 3DC2A 1RISA 2E44A 3AOBA 4UF4A 1W0HA 2V4QA 4M3TA 2YNIA 2UU9F 2IDOA 1O0PA 4USJC 1GX6A 3GE9A 3KJNB 3ZTQA 4ZVQB 3RVCA 2P9UA 2JC1A 3ZX0A 4J91A 3JTNA 4C97A 4CLKA 3NGDA 4F02A 5JXSA 4DR3J 1DQ9A 2CWKA 3SQGB 1JMTA 4N76A 1U25A 3OL6A 1HI1A 1ZBFA 3CCWA 3SLCA 2R2RA 4QR1A 3MR6A 1T3VA 2ZOFA 4M5DA 1RADB 3DGPB 2Q6BA 2QJ3A 3ZT0A 4KB1A 1NDLA 5JICA 3IC1A 1WHVA 1ZETA 1RT5B 2ASPA 1KQFB 2DO4A 1EIYB 3RSEB 1NMDA 4MYUA 1NSAA 2Z0GA 4EP5A 1A0OB 4QBUA 1KFSA 3MMCA 2UXCF 3HX9A 3ILOA 2DNKA 3BUZB 5IT4A 2JX2A 4WP3A 2O66A 2AX1A 2PA8D 2CG8A 2EK6A 3T3FA 3M2VB 3MN7A 3H5YA 4DV6F 3JYTB 4CGGA 1CBKA 1U8WA 3OYLA 4HHJA 3C7NB 3BZCA 4KI6A 1UAWA 2HK3A 2DCUB 4K43A 5D0HA 5AZIB 1LNQA 4BRHA 3VWSA 4G9ZA 2Q2RA 2RIJA 4CYUB 2WHOA 3POTB 2MZJA 4FZYA 1EO1A 3UCUP 2J0XA 1HWIA 4NLOA 1D5AA 4Z4FA 3ZETA 1OPIA 3VA3A 3UCGA 4C23A 5L9NA 4F3QA 4ENOA 1TMJA 2AW0A 5K8OA 2UUAJ 1A5VA 4B3TK 1S1XA 4O5FA 5BRFA 1U8SA 3QFWA 1VS3A 1WSIA 1OY6A 2ZFHA 4A8OA 3UVJB 2V4JA 1W25A 4ECRA 3KHGA 4FJKA 1ZBHA 4ZP9A 4CTAB 1JL1A 4ZCIA 1EKRA 3H3OB 4P7VA 4OX7A 3HSJA 4UUXA 3ZYYX 2CJXB 1UOCA 2AYGA 2PZSA 1X1PA 1ZM2A 2M88A 4E7JA 4KR0B 3W64A 3KLFA 1JX4A 2IAJB 4AQYJ 5GADU 3DLKB 4OZ3A 3D6RA 3VF6A 4BQZA 2YKAA 1OSCA 1N56A 4CHZA 4FJGA 2HF3A 1Q9YA 4JI7F 3KMQA 2HGNA 2BM0A 1J9AA 4JD2A 3BZKA 3UPFA 2GJFA 4FP9A 3RBXA 3OS2A 1HQEA 2ROPA 4A4JA 1MMNA 3TA0A 4DV5J 1BQXA 3GR1A 1TKTA 4JLHA 4IQMA 4C8OA 3NCPA 1OVQA 2VDHA 4E98A 1DQ8A 4BDYA 4IR9A 1H73A