5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
2X78A 2ZD1A 3KK1A 1WSFA 5KFOA 3MECB 5J2MA 3CDWA 5F9NA 1JLAA 2B4JA 3NF8A 2OH2A 4DFPA 2HHSA 3GV5B 2RDIA 4AHUA 2Y1JA 1RDCA 1C1BB 1FKOA 4QWDA 4ECQA 2C2EA 4CHNA 1L3TA 5HLFA 2DY4A 3H98A 3TANA 2ILZA 2XCAA 4FLTA 4BDZA 1D8YA 5C24B 3PR4A 2WONA 4FZZA 3KLFA 2I5JB 2C22A 3BGRB 5KRSA 5C25A 4I2QA 3AVFA 4CECA 1LV5A 3HHKA 1QTMA 2WOMA 3OJUA 1L5UA 3V6DA 1KLMA 2IM0A 4CFCA 4WFYA 3NGDA 1EP4B 3QEIA 3DYAA 1RBSA 4CFAA 4R0EA 3D28A 4N41A 3M8PB 2AX1A 1RT2B 1MU2B 4LSNB 5KFSA 3O4QA 4RZRA 4KPYA 4CJFA 1HYZA 4LQ9A 4ECVA 5KT4A 3O3HA 2O4IA 2V4RA 4FLYA 1IKXA 3M8QB 4MKBA 2RDJA 1TK8A 2V9WA 2BQUA 3AA2A 4DQQA 1NJYA 4B9SA 2IM1A 1C0UA 3LWLA 5KGXA 3LP0A 4E7HA 5DQIA 3V1RA 1N6QA 2YNIA 1BCOA 4FJ7A 4IG3B 1X9MA 1WAJA 3V81B 2ALZA 3QZ8A 5C5JA 1L3UA 2F8TA 4M3XA 3ZSRA 3V6JA 4JUZA 1ZBFA 2PYJA 5KFBA 3IG1A 3PX0A 3T19A 4Y1CA 2J6TA 4CGHA 3QETA 3ZT2A 1XI1A 1D9FA 4OJRA 3NAHA 1BI4A 1IKYA 2OPRB 3KNAA 4CJEA 1TAQA 1KVAA 4Y2AA 4CJ4A 3HPOA 5F8GA 5HRPA 3FSIA 4W5NA 4DSFA 4CJKA 5KFCA 1XR5A 3I0RB 4J9SA 4I7FB 3KJVB 3LANA 3V1OA 4TQRA 2EC0A 4FJHA 1LWCB 4PA1A 1ZTWA 1RT5A 3L3UA 4AHTA 3BQ1A 1GX6A 3CIZA 3TABA 1JLFB 3V1QA 4DLEA 4NYNA 4KAZA 4KI4A 3AO3A 4CHZA 1GOBA 4X2BA 5DLGA 1KCFA 1JLGA 1KRPA 3RAXA 2OZSA 4YNQA 4GMJB 4I2PB 5DK5A 4TSXA 2YHAA 2D0AA 4CJVA 1RTHB 3K5OA 1K1QA 4NLXA 4TLRA 4KHSA 4OPKA 3SUPA 4DFMA 1VSDA 2B6AB 3DLEA 4CJLA 2OZMA 3BQ0A 2FVSA 3C95A 4WYWA 4AILC 3PZPA 4IH6A 4ID5A 1ZETA 2AGQA 1IKWB 4QW9A 2ASLA 3VA3A 3HP9A 4PQUA 4PWDB 1RTJB 4FW1A 2BQRA 2HNZB 1VRUB 4ZP8A 3PW2A 4CEOA 4DTPA 3SJJA 4BWJA 2Q3SA 4CFBA 1RDAA 3SNNA 4E1NA 4NLWA 3KHLA 3CYMA 2IAJA 4LSLA 4NYZA 1LWEA 2G8WA 4HKQA 4FLXA 1JLCB 3CJ0A 3IGVA 3UDLA 1QUVA 2YKNA 1NK8A 2JGUA 4PUOA 5HP1A 4J9NA 2HNDB 4FLUA 3VQDA 3ITHB 4DF8A 4W5QA 3UPFA 3L2QA 3ZCMA 1T94A 1S1UB 1S6PA 5L1LA 4AH9A 4KHMA 3U3YA 3PHEA 4Q5VA 4J9PA 3M8RA 4ED3A 1JX4A 5KG4A 2D0BA 5KT6A 4XIUA 3MFIA 1EETB 3ZSXA 4CIFA 4K4ZA 2FVQA 4NYFA 4DU3A 3NH2A 3SPZA 3QIPA 3OHBA 4CGJA 3DLGB 1RT1B 3OL7A 4H54A 1NKCA 1XC9A 1TKDA 2J6UA 4BWMA 1QSLA 1B9FA 4N56A 4UQGA 4HCCA 1JXLA 5KFWA 1VSFA 3CFPA 2HWIA 1TKZA 3KLGA 3DI6A 3I5CA 4F2SA 1BL3A 2A1RA 2AU0A 1RTDA 3VA0A 4B3OB 4CGIA 5KFPA 3AA3A 4H4MA 4WFXA 2W7PA 4WXOA 4FJNA 5I3UB 2EHGA 4CK1A 2JEIA 1GOCA 1JLQB 5KFRA 1NK6A 2E6LA 2QV6A 2GV9A 1BQNA 4ED1A 5HROA 5DQGA 4GC6A 5F8JA 2VG6B 2DTUA 3TAMB 4F4ZA 3ISNC 2JEJA 2AQ4A 4J9OA 3DOKB 1QE1A 3FRZA 3SCXA 1LAWA 3ULDA 1IG9A 2XY7A 2LSNA 2G8HA 4LY7A 2AX0A 3S3MA 2DFFA 4KSEB 3OL8A 1KSPA 3RMBA 3IN5A 1RT7A 1DTTB 4QWEA 3HK2A 4DL7A 1WAFA 1NJZA 4AHCA 1S97A 3VN5A 3PW4A 4FYDA 2JC0A 4DSKA 4M3ZA 2Z1JA 1J5OB 1ZBIA 1K1SA 5KRTA 4RNMA 3TAEA 1QSYA 1XR7A 5DG8A 3K5LA 2HWHA 2Z1IA 3T5JA 3G6YA 4RW4A 4O0JA 3OYMA 3KLIA 1RBUA 2YNHB 3H4DA 2C2RA 3LAMA 2W9CA 2VG5A 2P5OA 1BQMB 1KFDA 2YKMB 3OVNA 3T5HA 3S3NA 1TKXB 4IFYA 4EYHB 4KAIA 4Z0UA 3RRHA 2FJVA 4EYIB 4RW8B 2HVIA 1S48A 3AO5A 2JLEA 1LW0A 1MMLA 5L9XA 2VA3A 3AVHA 5EWFA 5J2NA 4ICLA 3QLHA 3GV7B 4IRCA 3C6UA 4RW9B 4ECXA 4FJKA 3GIKA 3VQCA 3O3GA 1DTQB 2QE5A 2ZE2A 1SV5A 4RUAA 4RNNA 1NK0A 1U49A 4DFJA 2FBXA 3QINA 1SL2A 5T7BA 3PX4A 4H4OA 3ISND 1A5VA 1HNIB 1UWBA 4IQXA 2IM2A 3QO9B 3NGZA 3LZJA 3L3VA 5CYMB 2FVRA 1SUQA 1NHVA 4J2BA 1T7PA 5CZ1A 1TL3B 4B8AB 3VQSA 4OLAA 2UVWA 2X74A 1S49A 4ZPCA 3AA4A 4FJLA 2ZD1B 3CJ4A 2D41A 2OYQA 5KI6A 1S0NA 2HNYA 4IDKB 3AVNA 5J1EA 3NF6A 4FK0A 3H2LA 4Q45A 3E51A 3KHRA 2XWYA 3DRPB 1WLJA 1S9GB 3QNOA 1U4BA 5L1JA 1DLOB 2FLLA 3ZSVA 4E19A 4DQRA 4KI6A 4PY5A 4KO0B 3V9WA 4KHUA 3U3GA 4NLSA 4JLHA 4OL8A 3OS1A 3FQKA 2RPIA 4KV8A 3MEEB 4M3UA 1FK9A 1J53A 3DMJB 4CEBA 2FVPA 4CEFA 3V9UA 1IM4A 5CYQA 3DLRA 4I2QB 3K5NA 2ZKUA 4CEAA 4EO6A 3ALYA 4DS4A 3KLHB 2WOMB 1JLEA 4URQU 3FFIB 4CK2A 5KFHA 1KLMB 3S3OA 3NCIA 3QIOA 5CZ2A 4EP4A 1RYSA 2PZSA 1C0TB 1TL1B 3O3FA 4DTOA 4ZP6A 3DRSB 3HVTB 4QOZB 1S9EA 1HQUA 2HMIA 3H4BA 1IO2A 4C8MA 4MQ3A 1HMVB 2KTQA 4ZPAA 3PJXA 5KFMA 5KFEA 4M45A 4CFDA 2OPSA 1ZBLA 4QCLA 1Z26A 3OYKA 4K4TA 4TY8B 4QW8A 1SKRA 3LP3A 4E0DA 1NNDA 1S0MA 1RILA 2UUTA 2FBYA 1S9FA 3K2PA 4Z4EA 1C1CA 1S1TA 5C42A 1R0AA 3VQEA 2VG7B 3V9XA 3MAQA 3QGIA 1JKHA 3GIIA 1B9DA 3MEGA 3PR5B 1IKVA 3BDPA 4Q8EA 2DFEA 3NBPB 2HHQA 5DG7A 3MR5A 4F50A 4JV0A 3V6KA 5EWGA 4IBNA 4KE5A 4IOBA 4B9UA 4NLVA 3G6VA 1T05A 3DRRA 3RBDA 4KFBA 1JL2A 4R8UB 3I0SA 5E41A 4Q0BA 5KFUA 1QSSA 2G8IA 1RA7A 4OLBA 4O3RA 3OLBA 1N5YA 3KK3B 1HYSA 4FS1A 4FJXA 1X9SA 4BE0A 5EUHA 4Y34A 4CF8A 3LPTA 3LP2B 3NHGA 4R5PA 2IBKA 1J54A 4MIBA 3MF5A 3CJ3A 2Z1GA 3IAYA 4U7CA 2QXFA 2O4GA 1TVRA 3QEVA 2BQ3A 4BE2A 4E7JA 1RBVA 4QPXA 2C2DA 3JYTB 3MR2A 1RYRA 3N6NA 1F21A 5KFXA 3DM2A 3KK2B 3OSNA 4K4WA 1KLNA 3PJWA 4FS2A 5KG0A 3CDUA 4FJIA 1ZBHA 3SQ2A 1HRHA 2VWJA 3H5UA 4EBDA 2C28A 4KTQA 3KHHA 3IGNA 4ZHRA 4FK4A 3T1AA 3TAGA 4EO8A 5KG3A 4ED0A 3AVCA 2OPPA 2R8IA 4Z4HA 4EBCA 2R2RA 4O3NA 2ZQBA 3LPUA 1NKEA 3DLBA 3BREA 2HB5A 1UOCA 3QYYA 5J2PA 4IKAA 3VQAA 1FXXA 5L1KA 2Z1HA 1WSEA 3OYJA 2YNGA 2FJXA 5T14A 3CJ2A 4ID5B 3OLAA 3M8SA 3G10A 3NL0A 5D3GA 3SQ0A 2W8KA 2UUWA 4URGA 4O4GA 4NLPA 4F3OA 3HVWA 3SFUA 3MFHA 2G8FA 3RB4A 5F9LA 2UVUA 4YFUA 1HJRA 3F73A 1RT3B 2DPJA 3SV3A 4O0IA 4F3TA 1HPZB 1S1WA 1SL0A 2IAJB 2IGIA 2ATLA 1C1BA 4FM1A 4I9QA 4YP3A 1S1VB 4F4YA 4CEZA 4CGDA 2YNFB 1RCHA 3H08A 2ASJA 3NF7A 2I5JA 4KRFA 3BGRA 2XHBA 5CY4A 5I42B 3KMQA 3AVMA 2HW3A 1X1PA 4CJTA 2ITGA 3K5MA 4FM0A 4Y3CA 3KIOA 4ECSA 4FJGA 3SUNA 4IKFA 3OYEA 4DL4A 2WRMA 1ITGA 1EKEA 4DTNA 1EP4A 2GIRA 3H5XA 4J9LA 1S5JA 4HTUA 1RDRA 4RW7B 1BCMA 3M8PA 5J2QB 4DFKA 4ZTJA 3H5SA 4HUEA 3QIPB 2W42A 2RKIA 4NRTA 1RT2A 1MU2A 4LSNA 5KFLA 3SI8A 2XRIA 3D5MA 4W5TA 4IG0B 5KG1A 4DWIA 2KW4A 2E9ZA 1FKPB 3HO1A 1RTIA 3M8QA 4FVMA 3PW5A 3KLGB 5KFZA 1BGXT 4GVMA 4Z4GA 1HARA 3EPIA 5F8LA 2B5JB 2GBZA 2IJFA 1NK4A 4H4MB 3QGGA 4IR1A 1D9DA 4Y2CA 5FROA 2XY6A 4MK7A 1L3SA 2XGQA 4IG3A 4DL5A 4M41A 5DMRA 4DL6A 4J9KA 4WZMA 1LW2B 3B6OA 3QESA 3AVAA 3VQ6A 4FZYA 1BQNB 4DTRA 3JSMB 4O3PA 2IDOA 2XC9A 4ECTA 3AV9A 3UQSA 2XO7A 4KKOB 2OPRA 3G86A 3AVKA 3K59A 4BDYA 1K6YA 1TAUA 4NRUA 1RT7B 3ZSQA 1Z4UA 3I0RA 4AHSA 4I7FA 3KJVA 3HSTB 1Q9XA 4DTJA 1JLBB 1LWCA 1NK9A 4CF1A 1CZ9A 4NCGB 1W0HA 4Q44A 5K14A 2FBVA 3NGIA 3GV8B 4CHOA 2QK9A 5KFTA 1VSLA 4B8CA 3LP1B 2HHUA 4NLRA 4FW2A 4TQSA 2E9TA 2O5DA 4O3QA 4FCYA 2W9CB 3HYFA 1KVBA 3NFAA 4E7IA 2XY8A 4CF9A 3KLEB 3V9SA 3L2WA 3CFRA 3CDEA 3CO9A 1RTHA 4AHVA 3AVIA 4RNFA 5HBMB 1REVB 4DG1A 2KZZA 1QAJA 3IS9B 4WZQA 2B6AA 2VWKA 4RUCA 4WE1B 1QS4A 4CJ3A 3NH0A 4CF2A 4YMEA 3VQ4A 1XHXA 3MEDB 1A5XA 4DTUA 3MXJA 1BISA 4MK8A 4IFVA 4RU9A 1GOAA 2OPQB 3SI6A 1RTJA 3DLKB 4EEYA 2HNZA 4CHQA 1S1XB 1VRUA 3N6LA 5L1IA 1NJXA 3PW0A 2XI2A 3VQ5A 1VSJA 2HHWA 3OL6A 3AVJA 1NJWA 3M9NB 3RTVA 1SL1A 1JLCA 4O44B 4FZXC 4KB0A 5KG5A 4ZVFA 2BE2B 3IRXA 2HNDA 1OS5A 3ZSZA 3KKSA 4K4VA 3V4IA 5KFDA 2W9BB 2HNYB 3E01B 1C2PA 1T03B 1VSEA 1S1UA 4I9LA 1LAVA 5JS2A 4FLVA 4K4YA 1TK5A 4QWCA 3GQCA 3THVA 3DOLB 2BANA 1EETA 1HQEB 3RB6A 4CEDA 2FC0A 2IC3A 3C6TA 2PYLA 1HNVB 3DLGA 4ECYA 3ZSWA 2DPIA 4FJJA 1TV6B 1QQCA 4RW6B 4MH8A 4IR9A 3Q8PB 1VRTB 3OYNA 1S6QB 3EZUA 3RB3A 1ZBUA 4K4UA 1KTQA 2E9RX 4G1QA 5KGWA 2G8VA 4MKAA 3DLHA 2KFZA 1BIZA 4B3OA 4OPJA 2HMIB 4N47A 2J6SA 3BSAA 3CVKA 4O3OA 4Z4CA 3SFGA 3PY8A 5I3UA 3OS2A 4NZ0A 4ECUA 2G8KA 1JLQA 1U09A 1RT6B 5KFVA 1NOYA 5F8IA 3S9HA 2VG6A 3QEXA 3TVKA 2AGOA 4CESA 4DS5A 4AHRA 1S1TB 5HRNA 1LWFB 3PVXA 5KT3A 3KOAA 2JEGA 4NLQA 3AO4A 4BE1A 4BDPA 3KK1B 4Q8FA 3VQQA 4ZVGA 3KKRA 5J2MB 3Q8QB 1DTTA 1JLAB 1TKTA 4FBTA 4LH4A 1FKOB 4FM2A 1KVCA 2KFNA 4MFBA 1KFSA 1J5OA 5HLFB 5KFJA 1T05B 2EX3A 4NLOA 3HL8A 4B9TA 3KD1E 2CJQA 4ZTFA 2WONB 3KLFB 3L2UA 4HUFA 1U45A 4TN2A 5KFIA 4J2EA 1C1AA 5C25B 4QWAA 2YNHA 1SH0A 4DTXA 1W9HA 5KFQA 4CJUA 4R5PB 3SQ1A 2RF2A 2WHOA 4YR2A 3V6DB 1BQMA 3PO5A 1TKXA 5SWMA 3RB0A 3P1GA 4DMNA 3MR3A 3DYAB 2JC1A 4KHQA 4TXSA 1I39A 1GX5A 4J9MA 4YR0A 4H8KA 4FLWA 1T3NA 4QAGA 3LALA 3NH1A 3TARA 4DLGA 4RW9A 4Z4FA 3M9MB 1W25A 4DSEA 3VQ8A 4ECZA 3CWJA 3EY1A 1Q8IA 1TQLA 3VQPA 1VSMA 1N4LA 1DTQA 4B9LA 1WN7A 1I6JA 5FDLA 3ASMA 4TY9A 3RBEA 1IKXB 4ZPDA 1RDDA 5DQHA 5SZTA 4MK9A 4W5OA 1BHLA 1ASUA 1C0MA 1HNIA 1RBTA 1YTAA 4N5SA 2B43A 3EZ5A 3SQ4A 1C0UB 3LP0B 1HYVA 3QO9A 1CXUA 3GIJA 1N6QB 4OKKA 3ICLA 2YNIB 1C6VA 2E6MA 3QIDA 3HXMA 3OYLA 1TL3A 2AWZA 3ZSYA 2HHVA 3HPGA 2YNGB 2BRKA 2XI3A 5D3GB 3IG1B 4NCAA 1U47A 4EZ6A 1CZBA 3BSCA 3L2VA 1RT4A 4K50A 4IRKA 4IDKA 1BI4B 1IKYB 1RNHA 3HM9A 3DRPA 1S9GA 2HHXA 2D3UA 1IH7A 2WK4A 1S1WB 1DLOA 1SH2A 4CEEA 1NK5A 4KO0A 3I8DA 4JRQA 4NLGA 3MEEA 4FJ8A 1NKBA 2QKKA 4K8XA 4B9NA 4URSA 3NMAA 3DMJA 3AVLA 4CHYA 4NCBA 2IS3A 3VQ7A 1RT5B 4HYKA 4ED2A 4CGGA 3KLHA 3BSOA 2UVRA 3MR6A 3FFIA 1JIHA 1JXBA 4OKJA 2CKWA 4K4SA 3CFOA 1G15A 3OS0A 4TYBA 1YT3A 3CQ8A 1C0TA 4J9QA 3OY9A 1N56A 1TL1A 3DRSA 3HVTA 2XGPA 1JLGB 4O3SA 2BDPA 1HMVA 3SUOA 4F4XA 2RKIB 3BQ2A 4NLUA 4E7KA 3LWMA 4CERA 3VQBA 4KHYA 1D0EA 1QHTA 4M3TA 1L3VA 4IH7A 1WSJA 5KT2A 4TY8A 3DLEB 3N6MA 4M3YA 3RWUA 1RTIB 2ILYA 3TAPA 4EBEA 3T5LA 4JV1A 3PO4A 3ZT1A 2HAIA 2FVCA 4JV2A 4Y1DA 4FK2A 4KTZA 3LZIA 2VG7A 4CJPA 4PQUB 4CE9A 3OHAA 3NGYA 2NUBA 5KTQA 5FRMA 3MECA 3ZT4A 2X6NA 1UAXA 3NBPA 3NF9A 4DSIA 4LSLB 4FLZA 1LWEB 4FJ5A 2W7OA 5HRRA 3AO1A 4R8UA 4B08A 5C24A 1ZTTA 3EPGA 3OYAA 2YKNB 1KHVA 4JS5A 4PUOB 5HP1B 1YVUA 4O55A 3KK3A 2HHTA 2KZMA 1SKSA 3OSPA 2PY5A 2FLNA 4E3SA 4DQPA 3LP2A 4O4RA 5KFYA 2W8LA 1T8EA 1S6PB 1CLQA 4CJWA 1SH3A 2KQ2A 4RNOA 1ASVA 2ASDA 2YHBA 4BACA 3TI0A 1CXQA 2R2UA 4C8LA 3SV4A 1S4FA 3V9ZA 2G8UA 4C8KA 4XPCA 3AO2A 4DF4A 5KT7A 3JYTA 5F8NA 1U04A 2W9AA 2X6SA 2F8SA 5K14B 4C8NA 3KK2A 4CIEA 4GC7A 4M42A 1CSJA 2P5GA 2IOCA 4M3WA 5KFGA 2XCPA 3KMSA 3TWHA 2R2SA 4O5BA 3MXMA 4N76A 4ZVEA 4IRDA 2I1RA 1WNEA 1VK0A 4OVLA 2P1JA 3NE6A 1TKZB 3WNFA 3DI6B 4J2DA 5JXSA 2XY5A 3RMAA 4FXDA 3I5AA 4CF0A 1RTDB 4J9RA 4DU4A 4ED6A 4ECRA 4F2RA 2WB4A 4KHRA 1VSHA 4DG1B 3WNGA 3HKWA 3EYZA 2IJNA 3KTQA 5JS1A 4CCHA 4FJ9A 1O1WA 3SYZA 2R8HA 3V81A 3NDKA 2BGGA 5DLFA 4EZ9A 3T5KA 4XPEA 4U6PA 4IFVB 5HROB 2R2TA 2IMWP 2ATQA 2WTFA 1YVFA 2BRLA 4DEZA 1QE1B 4K4XA 3LAKA 4HCBA 3H40A 3VQ9A 1RT3A 1D5AA 4B9MA 1HPZA 5FRNA 1WSIA 3OYCA 1VSKA 4IH5A 1ZYQA 1S1VA 1YTUA 2FJWA 4DQSA 1WSGA 2YNFA 4KB7A 5KG6A 4ZP7A 3IRXB 4CEQA 2F96A 3U6FA 3GILA 5I42A 3V4IB 3O4NA 4C8OA 3UR0A 2R8KA 4RW4B 4LH5A 4OKEA 1JLFA 4F4KA 3KLIB 3RMCA 4WYLA 1KHWA 4MIAA 1UA0A 2AJQA 2VG5B 2IM3A 4EP5A 3OYGA 4DL3A 2BANB 1NHUA 4RW7A 1WSHA 4IFYB 3AVGA 4ZMMA 2IC3B 4ECWA 4XO0A 5J2QA 3QEPA 3C6TB 3OYFA 3DDKA 2QKBA 4I2PA 1TP7A 3PX6A 1LW0B 3CG7A 4M95A 4IG0A 4JS4A 1ASWA 5J2NB 4ICLB 4HHTA 5JUMA 3QLHB 3C6UB 4TYAA 1FKPA 1Q9YA 4G1QB 2ZE2B 1SV5B 3Q8SB 4E89A 1IKWA 4KBIA 2B5JA 1RBRA 4ED8A 4NLTA 1X9WA 4DU1A 4PWDA 4LQ3A 1TK0A 4H4OB 3C94A 1TGOA 2D0CA 3HT3A 4DQIA 1UWBB 4ZVHA 3QERA 2V4QA 1LW2A 5KG7A 2E4LA 1JL1A 1SUQB 4L8RB 2R8JA 2GIQA 4B9VA 1Z25A 3JSMA 4ZPBA 3ZSOA 1BIUA 2VA2A 3V6HA 3ZT0A 4FBUA 4KKOA 3ITHA 3HVAA 2D3ZA 3BJYA 5F8MA 5J1EB 4E1MA 5KFKA 4F8RA 2A1SA 1I3AA 4HUGA 5HRSA 1XHZA 4LD0A 1TKTB 1A5WA 3UIQA 4MFBB 3Q8RB 1RDBA 3K57A 1D1UA 1JLBA 3SUQA 3WNHA 5KG2A 2DFHA 4HVJA 4YQWA 4KV8B 2OA8A 4NCGA 1FK9B 3RMDA 1RT1A 2GUIA 5CYQB 2BR0A 4CHPA 3OYHA 3FQLA 3D0PA 1QAIA 3PV8A 3LP1A 4ELTA 4CJ5A 1JLEB 2RF2B 5KT5A 3QNNA 3D45A 5F8HA 3CM5A 4KTWA 3SPYA 4M3RA 4OGEA 4K8ZA 3KLEA 2R7YA 4ELVA 4CIGA 3OYIA 3TAQA 2GC8A 5DGAA 4KHWA 3OYDA 4DTMA 1S9EB 1HQUB 3NAEA 3GIMA 5HBMA 1REVA 3OYBA 4CJQA 2FBTA 3IS9A 1VSIA 4RNHA 3CM6A 2ETJA 1NK7A 3OJSA 4CK3A 4WE1A 1J9AA 2V0NA 3KD5E 3KHGA 2OPSB 3HVRA 1RA6A 3MTKA 3NAIA 4JRPA 3ZT3A 3PUFA 4RG8A 3I5BA 3MEDA 2UVVA 5FDLB 5KFAA 3L2RA 3BSNA 2AGPA 3G0ZA 2OPQA 3TAMA 4Q43A 3DLKA 1C1CB 3DOKA 5C42B 1S1XA 1R0AB 3AA5X 3P5JA 4CJRA 3BR9A 1JKHB 3QZ7A 4ELUA 2JEFA 3SZ2A 3MEGB 1IKVB 2WCXA 1S0OA 4KREA 4J2AA 3QGHA 4O44A 3PW7A 1XR6A 1N48A 1WNSA 2BE2A 4M94A 3LDSA 3DRRB 4WFZA 4KFBB 1EX4A 3I0SB 3H5YA 4Q0BB 2W9BA 1RT4B 3RR7A 3E01A 2FLPA 2P51A 3A2FA 4DTSA 1T03A 1N5YB 1HYSB 3HPHA 3RR8A 2IA6A 5DG9A 4KHNA 4DSJA 5EU7A 3M9OB 4YR3A 4WXWA 4ZP9A 4F4WA 3GYNA 1S10A 4ED7A 3G6XA 3DOLA 2YKMA 1HQEA 3K58A 4CJSA 1XWLA 1TVRB 3L8BA 3TQ1A 4RW8A 1HNVA 1TV6A 2F8EX 3AVBA 4RW6A 4GW6A 4E7LA 1VRTA 3P83D 3DM2B 1S6QA 3RAQA 2RN2A 2R8GA 3H59A 3MXIA 3OL9A 4FJMA 1SKWA 2D7SA 3T3FA 3F9KA 1EXQA 4OGCA 5EDWA 3HJFA 3WNEA 4ZHRB 4W5RA 3FDSA 1RAJA 5EWEA 1NOZA 2OPPB 4QWBA 3RRGA 1JXEA 2D5RA 3CJ5A 3HP6A 3NKYA 1UA1A 3B6PA 3TR8A 4NLDA 1B92A 1RT6A 3KLVA 5DGBA 1U48A 4G3IA 5CYMA 4ID1A 5J2PB 4DL2A 5KFNA 4KB1A 5KFFA 2Y1IA 4CGFA 1Y97A 3QEWA 4DSLA 2YV0X 1LWFA 3TAFA 2HVHA 4Z4IA 4NLYA 4O4GB
chains in the Genus database with same CATH superfamily
2V69A 2OEKA 4OHXA 2ERRA 3G8SA 1WSFA 5B08A 4PWUA 3CDWA 2E2PA 3O5BA 3AJ1A 2OH2A 3GV5B 4AHUA 2Y1JA 2UUCF 3VF2A 1RDCA 3U4LA 4V19J 1FKOA 2C2EA 3H98A 4BDZA 1VRQC 3CB4A 4KJIA 4A5AA 3F44A 2WONA 3KLFA 1Q82O 2UP1A 2HGMA 3PDNA 4Y2KA 1GXTA 2CGLA 5KRSA 5C25A 4CECA 1WSVA 2EVZA 3ILLA 4ZPVR 3TYTA 4X4VA 3FCVA 2RJZA 1F1BB 1L5UA 4YS2A 1KLMA 4DMZA 2IM0A 2DNOA 4HDGA 4ATNA 4CFCA 2QA1A 2B51A 2BE7D 1GQEA 5ETPA 3O8WA 5FD1A 1EP4B 4NA1A 3QEIA 1TL4A 3U1LA 1JCGA 3M8PB 5JVHQ 1VQ9N 2AX1A 2VGNA 3BH7B 1RT2B 1MU2B 4LSNB 5KFSA 3O4QA 3UDEA 4CLFA 4P2SA 1T0TV 4WTYA 4CJFA 1GNKA 1SJQA 4IFEA 1U0HB 1VQON 5LJ5Y 3THYA 1IJEB 3IWXA 4ECVA 2BA9A 2KXFA 3DRXA 2YH0A 2V4RA 4OI2A 4FLYA 1IKXA 3M8QB 2A3ZA 3CD6N 5AQLA 3AA2A 4UUXA 3BF1A 1DEJA 3R5CA 3X3UA 3ENHA 3ENQA 4DV3J 4ZITA 1X4CA 5DQIA 4FWNA 3V1RA 1N6QA 2AA4A 5DO2A 1BCOA 4FJ7A 3V81B 3QZ8A 1L3UA 2F8TA 5D4PA 2MZJA 3BZQA 3V6JA 2CH6A 3OTEA 3MCAB 5ETKA 1ZBFA 4PAAA 3IG1A 2LCWA 4B3RK 4PYDA 1J2VA 1YGYA 4BREA 4CGHA 2BYCA 4V1Ak 1U25A 3NAHA 1HR0J 1IKYA 2X3DA 4YB5A 2UV8A 3KNAA 4ZVOB 1TAQA 1NWKA 4PYAA 4DSFA 2HZAA 3F2KA 1XR5A 2ZJPQ 3KJVB 2ZUAA 1MROB 2ZH5A 4WKRA 4ZVRB 4A8YA 3OR1B 3CQXA 2JDJA 4FJHA 1SQGA 4M5GA 4PA1A 1RT5A 4YN3B 5HO4A 2FC9A 3VHQA 5GADI 2VODA 4AHTA 4DKWA 3CIZA 3TABA 2B8QA 2K3IA 1VQ9S 2M70A 2ZEJA 3IMQJ 3V1QA 4OV6A 5ETNA 2VU5A 2UXBK 3HSZA 3WUHA 5H9EK 1UL3A 3RAXA 4DV7J 2OSQA 2HOEA 3DU6A 1IBCB 2E5LK 1EAYC 1LFWA 4PG7A 1KONA 1A0OB 5IWAJ 4YY3J 2EFPA 5L8RC 4KHSA 2P9PA 3SUPA 2HURA 4HVZA 3DLEA 1N33J 4K0KF 4CJLA 1B4SA 2RS2A 4NI2B 1UW9A 1GXLA 4AILC 4ID5A 3UI3A 5AXNA 4PZVA 5KOWA 4FOIA 3LM2A 3RUBL 4ZIVA 2R7UA 4FW1A 1YKWA 2BQRA 3KJQB 3TSPA 3ZZTA 2ZFHA 4CEOA 2XSFA 1WELA 2QWNA 3SK3A 5IFMA 4E1NA 4IO1A 3CYMA 2IAJA 2F9TA 1AB8A 4NYZA 1LWEA 5AXLA 4FLXA 1JLCB 4CZEA 1SIZA 2A6MA 5DDPC 1FVQA 2IRYA 4PUOA 5HP1A 4ALZA 4J9NA 2Q0RA 1RHJB 1TMMA 1D4XA 2QA4N 2R9LA 1K0VA 4E2FB 4ES3A 1BUXA 1S6PA 5E3AA 4F25A 5L1LA 5EX0A 4AH9A 3BBBA 1BE4A 4NXMJ 4H5TA 2MKKA 2KYXA 5E33A 2HQ3A 4ED3A 1JX4A 2I6WA 3HULA 4Z94A 5KT6A 3MFIA 1EETB 4IJNA 3TPQA 3FKBA 2YWGA 2FVQA 4OZ0A 3QIPA 3DLGB 5E0OA 4DV2J 2KDOA 3QT7A 4OZLA 1NGAA 4H54A 5FLXY 1XC9A 3EUNA 4H4KC 4FXWA 3MM8B 1JXLA 5KFWA 4OYAA 3THXB 4JI1F 3FEZA 3KLGA 1U02A 3DI6A 2BE9B 2GGPB 3QJLA 3VA0A 5A0YA 5C2CA 4NLCA 1NZ8A 2XSJA 5JVGL 4WFXA 2W7PA 2EHGA 3W8GA 3PRVA 4CK1A 1PYOB 1GLJO 1GOCA 1JLQB 3QWPA 1NK6A 3ZTSA 2DB1A 1X3NA 2MQMA 2F7TA 2RD5C 2VG6B 4XH1A 1FFWB 2R7VA 1FDDA 3L4BC 3SCLE 3SCXA 1MDUB 2VFRA 3ULDA 1WKKA 5AT1B 3R1XA 2OLWA 4JI5J 1TMJA 5JLHA 2QA4S 4KSEB 4QU7A 3HK2A 3DCAA 2J9EA 4DL7A 1NJZA 1V3SA 4ZLLA 1S97A 3PW4A 3QBXA 4DSKA 4FO0A 2Z1JA 1J5OB 1ZBIA 1K1SA 4BRKA 4RNMA 3UN2A 2MQLA 7AT1B 2L9DA 2MJNA 3RGIA 3T5JA 3M6GA 3OYMA 2YNHB 3CIMA 2AJ0A 4CH0S 1O8BA 5JJBA 1CJKA 3J81U 2ZVIA 3OVNA 4IFYA 4EYHB 4Z0UA 6FD1A 3WQTA 3AO5A 4ILGB 5L9XA 5B0FA 3AVHA 4X66J 3JTNA 4U7UD 5EWFA 2ZGYA 2JFKA 3H20A 4OI3A 1S0VA 3IR5B 5AXMA 3AT1B 3VEWA 2CQ0A 4I67A 2BUPA 1VI7A 3NLCA 3SMPA 3HF5A 1ZPWX 1N5TA 3O3GA 1S6OA 2P9NA 1VQMN 1NK0A 3QINA 1VBZA 5A8WA 4NXNJ 2CDQA 3C0BA 1YZ6A 3CGIA 1UWBA 5BN9A 1NLVA 4IQXA 2Z4PA 2IM2A 1S76D 1VMBA 4K8RA 2YH1A 3QO9B 4X4QA 1BDGA 1XNQK 1HD0A 2FVRA 4J2BA 1NHVA 1T7PA 1DY3A 2FB0A 5JMNA 5C7PA 4LF4K 2X74A 4L72B 1S49A 4WYBA 3G87A 4ZPCA 3CC2N 3CCVN 2ZBCA 3V4MA 2A5XA 1S79A 2HLUA 2YJFA 2WAQD 4DR3F 3LDNA 3A5MC 3DRPB 4JNEA 4E19A 3ZSVA 2LDIA 4BC3A 4LF8F 4YEAA 4KHUA 4KV8A 3MEEB 3C7NB 4M3UA 2GQQA 1BD6A 3AOBA 1J53A 3VGMA 3K5NA 2ZKUA 4Y0WA 2VFSA 3ZFVA 4WU3A 3KLHB 4CBWA 4L76A 2WSEC 2YX4A 2DNMA 1SC1B 2O8BB 3S3OA 3QIOA 4AXJA 2PZSA 3QSYB 3M5RA 1F3VA 2PA3A 4KPCA 4X4PA 3HVTB 4H4KA 2WVDA 2YY3A 4C8MA 1U1PA 4MQ3A 1HMVB 1FTCA 2DPNA 1WSRA 5FIIA 2EFNA 4CQ1A 1RSCA 3HOTA 3TA2A 5CCMA 4YOVA 2FF3B 4C1NK 1Z26A 1NH8A 5AQZA 3MXHP 3LP3A 4JKEA 2D9PA 4GO5X 4Z4EA 1C1CA 1RHRB 3MAQA 5DJBA 4E8UA 4BC7A 3CC2S 3CCVS 1FTRA 3MEGA 3GMGA 1I94J 5DM6L 5G0RB 3W2VA 4BGAA 3BDPA 3L4IA 2D0OA 4Q8EA 2HHQA 3J80O 1FD8A 4F50A 3V6KA 5C12A 3FGUA 4KE5A 4B9UA 1ZH5A 3H1VX 2WSCC 2E7WA 3W2WA 2DXDA 2LQ9A 1T05A 3DRRA 3RBDA 3NVKA 3I0SA 2GW8A 2CDRB 5KFUA 2G8IA 2DXFA 1F5AA 1HW9A 3GTYX 4FKYA 4BRMA 2X1BA 4B3TF 1OKJA 4R5PA 2H5JB 3MF5A 1LQ9A 1YBTA 2VFTA 2JVOA 4U7CA 2UUAK 3G9CA 5EY4A 1JJ4A 3IAM9 1RBVA 4QPXA 2C2DA 4X4TA 3OSNA 1KLNA 3PJWA 1T11A 3CDUA 2VWJA 2K7JA 3MWBA 3H5UA 4EK2A 2HBJA 2C28A 3FCHA 2N3LA 4BBYA 3QFUA 3MDQA 3IGNA 3MN9A 4LR8A 4DU8A 1PJ6A 4EBCA 2ADCA 3B8AX 4DV1J 5AQRA 1DQ9A 3DLBA 1SQKA 1HHTP 1X5TA 2H51B 2XS2A 3VQAA 3CMEN 1HFEL 2YNGA 2QLWA 4JV5J 1M5HA 3OLAA 4GNIA 5CE3A 3O4WA 1Q7LB 3VGLA 2HVEA 4NZ7A 5B0AA 2G8FA 1GLAG 2C3OA 5AE2A 2WSFC 3M1VB 1HJRA 2DPJA 4O0IA 4GKJJ 1FRKA 3QFPA 3HTVA 4I9QA 4M5LA 1JJ2M 1UETA 2VBZA 2YNFB 3GYGA 2X1AA 3EVMA 3V2UC 2ASJA 1J6ZA 4A2BA 2XHBA 4M5KA 5F0UA 5CY4A 4DR1F 5KQ8A 2VH7A 3KIOA 2JLGA 4FWLA 5DRKA 4I6MB 2YQ1A 4WFBL 3NWGA 4ILHA 4DL4A 1EKEA 2NRXA 2KT3A 3SBGA 1NG9A 1EP4A 2CYYA 3H5XA 4J9LA 4YHHF 1RDRA 2R7RA 1UPMB 2M0GB 3QGPA 3IXQA 3M8PA 5J2QB 1MWMA 2CJKA 4HUEA 1OJ4A 4ZVPB 4BC2A 1RT2A 1MU2A 4LSNA 3MM6A 5HMYA 2PI5A 3TJ8A 4W5TA 5KG1A 3C8YA 4DWIA 1U0HA 2HWTA 1FXRA 4OZ1A 5D0GA 4LF6F 3PSIA 4AT1B 3M8QA 3G8TA 4DR4K 1AROP 1BGXT 1FT8A 3G4SS 3U8XA 3GBTA 1EWRA 5AQMA 2IJFA 1NK4A 1QAYA 3QGGA 1D9DA 2AKWB 4E1JA 5FROA 4MK7A 4DV0K 4U9RA 4ZJQA 4DL5A 5DMRA 3D1OA 4HTIA 4WZMA 1LW2B 3B6OA 1QUPA 3GB0A 3BO4A 5GADP 1BQNB 4RWTA 4DTRA 1OPZA 2EK1A 2YBVA 3T1YK 1FJGK 2EFGA 4QIFA 4HI1A 3S1TA 2XO7A 5HK4A 3R5GA 3AVKA 2CQ2A 1NUEA 3ONQA 1TUWA 1YI2N 2VIHA 3KJVA 1MROA 2QN6B 3OR1A 4RUBA 2B7BB 4Y6IA 1YJNS 5B0BA 5E26A 4K2XA 1NK9A 4UZCA 3AARA 1WI6A 3QMLA 3H2VE 3W60A 5BYQA 3NGIA 3DNCA 2A40A 3DGVA 4CHOA 4QPTA 5LMUF 4ID8A 1VHIA 2QK9A 5KFTA 4B8CA 1EQ0A 1IUJA 2Z57B 3AA9A 4NLRA 2E9TA 2O5DA 3ILJA 1UFLA 1KVBA 1UPPA 3DLLL 2YWKA 2FSKA 2UXDK 4DR6J 3EE9A 4CF9A 3V9SA 2PMWA 3U7JA 3M6UA 2GWKA 1REVB 2NSBA 3IS9B 4LFAF 3FZLA 4WZQA 1U8SA 2D74B 4RUCA 4NI2A 1NGCA 2BTFA 2OGUA 2DIUA 3BV8A 3R1HA 4DTUA 3K17A 1R59O 2MZQA 3JXOA 3SI6A 4Y2MA 4OPHA 3NOGA 2Y1RI 2DBBA 2M5YA 1S1XB 3BO3A 1NJXA 2AJ2A 3DHWC 1F0XA 1Q86O 3UW1A 4CLSA 5AJ3K 4PL8A 1RWPB 1JLCA 3FR0A 4O44B 4FZXC 4OFZA 1C0GA 3CDBA 3E8OA 3EICA 3POTB 2DXEA 1ZOTA 4H5RA 2W9BB 3WXJA 2KRRA 3E01B 1C2PA 1T03B 2M8HA 3O9TA 2DNRA 1LAVA 1SJ3P 3WIVA 3HHDA 1TK5A 3BP8A 4WF9L 4NYPA 3CPWM 1BMQB 2EI5A 1H7XA 4HLBA 4ZA1A 2BANA 1EETA 3RB6A 4P7TA 4LBHA 2GJFA 3DLGA 3ZSWA 4FJJA 2DYAA 1U6FA 3CO0P 3TSQA 1NEEA 5AZJB 4C7QA 2JFDA 2BACA 2HBKA 3PIOL 4K4UA 1IBKF 3S01A 5AQIA 3MM8A 5M2RA 3CI5A 4F0KA 2UU9F 3THXA 1XK8A 2IYIA 2IJRA 3QFWA 3HZ6A 2H4YB 2GGPA 4C8ZA 2CNKB 2H54B 1ZBSA 3DHXA 4WFNL 4OPJA 2DCUB 3CVKA 1X8DA 4LVOP 3SFGA 3W9IA 1RBLA 3PY8A 1R31A 4NZ0A 4LF5J 4ECUA 2G8KA 1JLQA 4X65J 3ETOA 4RPFA 2VG6A 3TVKA 4F02A 5HRNA 3HOSA 3PVXA 1X9JA 2DGXA 2VQFF 4NLQA 3MCPA 4DV4K 1LK7A 2CFXA 5AR0A 4Q8FA 1IBLK 2LU1A 1KVKA 2HK2A 1M5SA 4BRLA 3WEEB 4BRGA 2BZ2A 3LF0A 2MY7A 1TKTA 4A8FA 4FBTA 4IJAA 4FM2A 1BY9A 1P1LA 2MEWA 2DNYA 4MFBA 1KVJA 2NZCA 1J5OA 2NR0A 2EX3A 3HL8A 3KG1A 2XBPA 2E8AA 4ZTFA 3H3NO 1SS6A 2HRUA 1PAUB 4HUFA 1GMUA 3MMBA 4CLPA 1NSKL 3SDEA 4J2EA 5A6PA 5H1SV 5AE3A 5HMZA 5BPNA 4B3MK 4J9UE 2YNHA 1UVIA 1UJ6A 4WU2A 1BG3A 3RAMA 1N32J 4CJUA 5B0GA 2RF2A 1NGIA 1XQSC 3PO5A 2OMLA 1X3MA 2DISA 3ZZPA 1IN0A 2GAGC 1UAWA 3DYAB 4TXSA 4J9MA 4QAGA 4DV3K 1OO0B 3AGRA 5K20B 4Z4FA 2CA9A 1QVGM 3VQ8A 3EY1A 1RAFB 1I6JA 5FDLA 3ASMA 4DV5K 1G3OA 4TY9A 4H0VB 1NB7A 4ZPDA 1RDDA 2G9OA 5SZTA 5L38A 3LM9A 1BHLA 1RBTA 3SQ4A 3EVWA 1C0UB 1ACMB 3QO9A 1CXUA 2BBEA 3IBCB 2LYVA 4CP5A 1WOPA 3TUPA 1PIEA 3J81Y 1O6XA 4DUZF 3HSGA 4C11B 1RGVA 2RILA 2WB1D 2UUCJ 1NDKA 2FSNA 3QBWA 4NCAA 1U47A 1KQSR 3EGWB 2CVIA 4U7UK 3EDRB 4IRKA 2HBMA 2WBRA 1RNHA 3DRPA 1S1WB 1YF5L 1SH2A 1X4FA 2ZWPA 2NUHA 4BRFA 2WW4A 3QT6A 3BO2A 2E66A 4NLGA 3MEEA 1T9TA 3C7NA 1RB0A 4OV1A 4B9NA 3M6VA 3AVLA 2IS3A 4BRPA 3A8KA 4HYKA 1FXLA 4FWKA 1HWLA 4CGGA 3KLHA 4IOCQ 2UVRA 1MN9A 2DKOB 3I82A 3ULEB 4OKJA 2O8BA 1N33K 5FPMA 1Q0NA 3CCSN 3OBYA 2B0GA 2FHKA 3CQ8A 4O5FA 2NRZA 3HVTA 1S12A 4O3SA 1CJUB 3FRYA 1HMVA 1O5JA 4LFCF 1SKUB 4KHPK 4E7KA 2G0CA 3VAHA 4DU7A 1KTVA 4UQTA 5D8HB 4U95A 2C3PA 4EHTA 4Z37A 1U1KA 4KIAA 4M3YA 1WB9A 2W2QP 4JV1A 3T5LA 1HNZK 2RHSB 3H25A 1RAIB 1IWAA 1MSWD 4TNOA 4ETZA 3K8VA 1U1MA 2YPYA 4CJPA 5CAAA 3A12A 4WFAQ 5KTQA 5FRMA 4DZ6A 4RL1A 2N7CA 5KAKA 3MR7A 1HUXA 4JK7A 2DTJA 3OT9A 4LSLB 2PO4A 1S4EA 3FLCO 4RU2A 3AO1A 5C24A 1ZTTA 2Z0GA 4DI6A 2D0PA 1YVUA 2KM8B 2QSWA 4DV2K 2IVYA 2Q79A 4ILLA 1SKSA 3BH6B 1FO1A 4DQPA 2VB6A 4O4RA 4IYQA 2W8LA 3OUYB 1HBMB 1ZAXA 3E66A 1SH3A 2IA0A 1ASVA 2ASDA 4IDHA 3TI0A 2R2UA 3GE1A 4JI6K 3MD3A 1XNRF 2BH1A 3QJJA 5LSRA 3AO2A 4DF4A 4CO2A 4BR9A 3BKUA 1RHUB 4NE9C 4F26A 2F8SA 5K14B 3UKRB 1HI8A 2V8DA 2F9WA 4LC9B 2RUSA 2XCPA 3KMSA 4WK1A 2ZBPA 4GV3A 4O5BA 4CZJA 3MXMA 2I7NA 4HHJA 5BYSA 1RAOA 4IRDA 1VK0A 4OVLA 2P1JA 4K0KJ 4J2DA 1GFWB 4DR5K 4FXDA 4PQAA 4ED6A 2WB4A 5L46A 4KHRA 4DG1B 3FZFA 2IJNA 2V8PA 4LSZB 4R0JA 1ZS6A 4JI0F 2CQHA 5JS1A 4FJ9A 3Q0AA 1H1VA 1X4BA 3VF0B 3A3OB 1UVJA 4XDCA 3VGVA 4UY8O 5DLFA 2NNWA 5GAEI 3V5RA 4IFVB 1VISA 5HROB 1Q16B 1VQ7N 3N9UC 4DPXA 1M0SA 4DEZA 3AAQA 4HCBA 3M1VA 3H40A 1UFKA 3LGHA 1T3OA 1NGJA 1WSIA 1QZ5A 4RR5A 1OQ3A 1U8WA 1E6VA 3NS5A 1VSKA 1Y5NB 3QBCA 2FJWA 1WSGA 2YNFA 5D0RA 2R42A 4PXDA 3CCUN 3IRXB 1Q1KA 3KWMA 4GV6A 2HQDA 3V4IB 1V5VA 4XAKA 9RUBA 1T9XA 1SB6A 1XMQF 5AQOA 2AD9A 1JLFA 3ZLJA 4I6MA 4FPAA 1N5SA 1GLBG 1UA0A 4OZNA 2AJQA 2VG5B 1KKHA 4EP5A 3OYGA 3CCMN 1N34K 4ECWA 5J2QA 3QEPA 3DDKA 1TP7A 3PX6A 5BRHA 4JI1J 4JS4A 4ICLB 4HHTA 3C6UB 1NGFA 4PWWA 2DRDA 1NGGA 1A7GE 4G1QB 2NRHA 3D68A 2ZE2B 3Q8SB 3L0QA 4E89A 1IKWA 3Q8VA 3BYRA 3FEYB 2HVDA 1Q86T 4ED8A 4DU1A 4H4OB 1PAEX 1VQ7S 2JWKA 4ISFA 5JICA 3HT3A 3A8YA 1TZ0A 3BZKA 2V4QA 2PD1A 1LW2A 4QZVB 4UT4A 4L8RB 2R8JA 2GIQA 2XYPB 4XK8C 4PG6A 1VOMA 4ZPBA 4JBCA 5CA5A 3THPA 3ZZYA 3CCUS 4FBUA 3SQOP 3H6EA 2HG4A 5F8MA 3GFXA 1P6TA 1G7CB 4E1MA 3MX5A 1U1OA 1I3AA 8AT1B 4LD0A 3UNGC 3Q8RB 3K57A 1D1UA 1Q8KA 1CG2A 2VJUA 2OTJN 2DFHA 3CCMS 3U02A 3RMDA 2EBEA 2ACMA 4DN9A 3EZOA 2BR0A 4CHPA 1QAIA 1XQIA 4C6AA 4HEA9 1JLEB 2NXUA 4YOEA 5F8HA 2DHXA 3GR1A 1X4GA 2W25A 4C9DA 3MPWA 4W92B 4M3RA 4ELVA 3R7NB 3QB0A 2BJ1A 4M7XA 2CJYB 2ZDOA 5DGAA 2V2VA 1NSPA 3OYDA 2NRTA 1K8AT 4DTMA 1S9EB 1YJTA 1REVA 1EIYB 2NZ4A 4BRDA 4BLGA 3IS9A 2BKNA 2X1FA 1WACA 3CJCA 3OJSA 3AH6A 1I94K 4CK3A 1J9AA 4DDFA 3Q7CA 1EKRA 4JRPA 4CIOA 3ZT3A 3FZHA 3I5BA 1LK5A 1B99A 3GR0A 5KFAA 1XJWB 1WC6A 2AGPA 2IIHA 2GVZB 3D2EB 3O1BA 2JLFA 4Q43A 4HTJA 1BA0A 3DOKA 1S1XA 4JD2B 5BRFA 3F0NA 1R0AB 4J8FA 3TQEA 2CQIA 5E3QA 4KY3A 4NA3A 3BR9A 1JKHB 1CJVB 4ELUA 3SZ2A 1IKVB 1S0OA 4F0MA 1KD1T 4J2AA 3QGHA 4DR3J 1RTZA 4O44A 1UKUA 2JVRA 1WUUA 2QTDA 4LF8J 3E3XA 2W9BA 3E01A 2E7XA 1T03A 3D66A 4JKFA 1HYSB 5CXTA 3ATVA 1RHQB 1X4HA 4JI3F 1D8ZA 1FNMA 3OTDA 2OFGX 3W5YA 3P45B 4YR3A 2IDEA 5E3CA 4ZP9A 2CJ9A 1TUGB 4F4WA 1S10A 5FPDA 2DGSA 2YKMA 3AY9A 4CJSA 4IO9L 1XWLA 3L8BA 3WBZA 3TQ1A 4P75A 3B8HA 3U9ZA 4E7LA 5BR9A 3P83D 3DM2B 1YJ7A 2HZCA 4XDDA 4B3SK 3D9BA 2MQQA 2R8GA 3H59A 3T7ZA 3MXIA 4CZGA 1WORA 4LF9J 2D7SA 4OHZA 3T3FA 2OO4A 4OGCA 1B0VA 3WHIA 5EDWA 1FFSB 3R2CJ 1WKLA 3CDAA 4ZHRB 1BLUA 3W66A 4YDXA 2ZM6F 3FDSA 3RRGA 2OPPB 3LH2S 3CCQS 2DR5A 5BR8F 2CQBA 1R3NA 4NO7A 3NKYA 1OH8A 3B6PA 5AQHA 3H45C 2W4CA 1U48A 5CYMA 3ZZOA 2I7PA 3IRWP 1HBUB 2NYIA 2YTCA 1WC4A 4O4GB 2X78A 2XZWA 2ZD1A 4CO3A 5KFOA 4C0HA 4X4RA 5E7OB 4ZVQB 3WC2A 3WEEA 3DLJA 1VIXA 2RDIA 2KM8C 3OBWA 3TZXA 4QWDA 4ECQA 3IA0A 2V2ZA 3GPAA 3TANA 1SZ2A 4B3TJ 2QO3A 2ILZA 2XCAA 1HNXK 4FZZA 3CCRN 4DOZA 2J7WA 4CLLA 4I2QA 3M8WA 1LV5A 1QTMA 4LF7K 2N4DA 2WOMA 4C3KA 5JVGQ 1FKAF 4RJVA 1QD1A 3CCEN 4WFYA 4P52A 2ROPA 1X31C 3DYAA 3D28A 4ZDNA 1F5CA 4CD1A 4FWSA 2PI4A 2QMUB 5I9EB 3W62A 4ZN1A 5EX5A 1Y9OA 1T9YA 3K9KA 4V19S 4LQ9A 5GINA 4F67A 1PC5A 1P27B 1OY8A 1RUSA 2O4IA 1N36F 4MKBA 4EHUA 3TUJC 3VEOA 5A2QY 2V9WA 4WBFA 2XS7A 2BQUA 4ILMA 3Q23A 2LXUA 3LUYA 1NJYA 3RBXA 1EQYA 1C0UA 3LWLA 2D3O1 5CZXA 3U27A 5B09A 3W3DA 4E7HA 3HFZB 1PKUA 4OYOA 2QTWA 3ENBA 4IZ9A 2ALZA 2NXCA 3I87A 4M3XA 2RIJA 4JUZA 4PXBA 4C11A 2O8FA 4Y1CA 3CJKB 2MLZA 4CW7B 3QETA 3ZT2A 1FX2A 4DR7K 4B9QA 3CCRS 3KKFA 2VHGA 3HPOA 5F8GA 3CW2C 4M5DB 5HRPA 5D0HA 3FSIA 2HSTA 4W5NA 4CJKA 4ANCA 5KFCA 2KN4A 3I0RB 4J9SA 1GLLO 2E29A 4DR1J 5CH7B 2AYBA 2V50A 3LANA 1KQFB 4A8XA 3V1OA 2LU2A 1JK9B 4TQRA 4FOEA 2EC0A 1LWCB 1ZTWA 3UD5A 3CCES 4QIEA 2B8PA 1GLEG 2DVIA 2Y0SD 2UXCF 4YHHJ 3BQ1A 4OI6A 3ULEA 5IT0A 1URRA 5I3QA 3MMJA 2P9GA 2IIRA 4KBOA 4KI4A 1GOBA 5DLGA 1KCFA 3LPEA 4LF6J 3M1FA 2YHAA 1RTHB 3K5OA 2ZH2A 1LCUA 4NLXA 4TLRA 3SIPB 4UY8T 3AXKA 4DFMA 2B6AB 4D3HA 2H65B 1S3XA 4DN0A 4HDHA 3MN7A 1NPRA 4ZJOA 3C95A 4WYWA 4E98A 2CNNB 4IH6A 4OYZA 3TOQA 4CWBA 2AT1B 4A46A 3VA3A 3HP9A 5HMWA 2BXJA 4BQLA 3TVZA 4ZK7M 4ZP8A 5C10A 4BWJA 1DQAA 4CFBA 3ISZA 1SJFA 3UDVA 1Z2ZA 4JI2K 4FL9A 1E4GT 2QLFB 1RFQA 2R7TA 4LSLA 3SXLA 1U1NA 2HQIA 1DQ8A 2OJ3A 1Q8BA 2W24A 3W63A 1QUVA 2V9KA 1NK8A 2JGUA 3QRRA 1WOQA 3ITHB 3EKUA 4DF8A 4W5QA 2F8HA 2O1PA 1YSJA 1S1UB 3OUYA 2D4WA 2B56A 3SSRA 1HBMA 4KHMA 2B9YA 4CT9A 3U3YA 5HVGA 5RUBA 2ZWOA 3PHEA 4Q5VA 3IBFB 5LMUJ 4B3RF 2HEKA 1H72C 3HX9A 2B4OA 1R8AA 5BPLA 1ATNA 3DXKB 2W7AA 1VK3A 4K4ZA 4NYFA 4ZVUB 4DU3A 4MO4A 5K5MA 2FJDB 3JQMA 1RT1B 3UKRA 1WC0A 3OL7A 2FYXA 1RK8A 1RWKB 4ZPTR 1TKDA 2J6UA 4BWMA 2F5GA 4UQGA 4LFAJ 4X4NA 5DM6Q 3CFPA 2BABA 2HWIA 2EWSA 2MKHA 3OFFA 4OZ3A 1F9EB 3W9JA 1QVGR 3AA3A 3L09A 4H4MA 2UXBF 2O8EB 4MYUA 4FJNA 2V51B 2VBXA 3J80U 3GCWP 2JEIA 1WBDA 3RRKA 2K7KA 5KFRA 1AZSA 4QYZJ 2QV6A 2GV9A 1X4DA 2E5LF 4F04B 4N77A 3OFHA 5HROA 2DTUA 3TAMB 2GFFA 4F4ZA 3ISNC 2JEJA 1R27B 2AQ4A 2NZTA 4LBPA 1IG9A 2XY7A 4RLEA 4ILRA 4LREA 4LY7A 1JB0C 1KSPA 3HMJG 1EKSA 2DD8S 1RT7A 1WAFA 4AQYJ 4AHCA 4L74A 3TJAA 4OHWA 2CPDA 3VN5A 3LW5C 3N4PA 2AEFA 1ZM3A 2CQGA 4CO4A 1XR7A 3MCOA 3T6BA 2HWHA 1CJTB 3G6YA 4PHTX 1PC4A 1RBUA 2ZC3A 3D2FB 4JEPA 2I9SA 2W9CA 2VG5A 2P5OA 1YBAA 3S3NA 3KUGA 1TKXB 1GLCG 2RRNA 3VGKA 1IBKJ 4EYIB 4RW8B 3KYLA 3CCWA 3PTWA 2JLEA 3CERA 3VETA 2UU9J 2VA3A 2IMOA 4ICLA 3TA0A 4IRCA 1XUPO 3C6UA 4K5RA 3MAHA 4DCJB 1M5VC 1RAGB 2EKNA 5AQSA 2QZ8A 1V9OA 3NP5A 2DT9A 2JNJA 3CQYA 1DTQB 2ZE2A 2V63A 4RUAA 1WC3A 2XG8A 1ULRA 1SL2A 4LFBF 2FTRA 4H4OA 3ISND 1YVNA 1A5VA 2M9KA 3F5TA 3ZETB 4QQBA 1GLDG 1UCNA 2ZH9A 2Q36A 3NGZA 3LZJA 2A41A 1YQHA 4WIIA 2VQFJ 1RDWX 1H74A 2F9DA 3BYPA 2HSEB 4NWBA 2EPIA 4HTLA 3VQSA 4A8SA 3VCDA 4IWVA 3NCQA 2A0FB 3ZTPA 4WFBQ 4IUFA 3AA4A 4FJLA 1RWUA 3FGVA 2DH7A 2D41A 1RCOB 4BR4A 4IDKB 3NF6A 4FK0A 4Q45A 3E51A 1XERA 2DHAA 1WLJA 1DLOB 1IBMK 4KI6A 3T9NA 4HI2A 1NMDA 5F3ZA 4JLHA 2QL7B 3FQKA 2RPIA 3EL2A 1OSDA 3DMJB 2ZHBA 4CEBA 3KJFB 3TVYA 1TU0B 4EO6A 4DS4A 3ALYA 1UZDA 1JLEA 3FFIB 5KFHA 1KLMB 1K73T 2CZVC 4DPUA 3NCIA 4EP4A 3OTOK 4YDDB 2RQ4A 3CD7A 3U9DA 2G1DA 2L3MA 3O3FA 4ZP6A 1F60B 4AFFA 1UVKA 1S9EA 2HFUA 3KHYA 2KTQA 2E1CA 1GT8A 3K7RA 3A4TA 2E88A 2VL1A 4ZPWR 5KFMA 4CFDA 5ETQA 2Z2LA 3M32B 1ZBLA 4BR2A 2R7QA 1SKRA 2HMPA 1YTYA 1KR4A 2GVZA 4G65A 7FDRA 1S9FA 2FBYA 1S1TA 4USTA 4ZCLA 5GIPA 1R0AA 4UTGA 1UEKA 1HIYA 3QGIA 1JKHA 4CI0B 4DUZJ 1MW7A 2HHPA 1EARA 1IKVA 1Y0HA 5A8KB 3G82B 1DKGD 2DFEA 3NBPB 2H3EB 5DG7A 3MR5A 3GDQA 2W2OP 4IOBA 4NLVA 2Y8WA 2Q66A 5DZ6A 4DB3A 4UOFA 3G6VA 1JL2A 2WTUA 1QSSA 4I56A 3NS6A 3AAWB 5ADXH 3DLLQ 1T44A 4L75A 4ZJLA 1XNQF 1U26A 3JB9k 1HYSA 4ITSA 1AFIA 4Y34A 1WOSA 2YKOA 2B4UA 1QM9A 4CF8A 4LF4F 2IBKA 5J1PA 4MIBA 3TZZA 3CJ3A 4P2FA 3IAYA 2V67A 2QXFA 4U8VA 3SBMA 3JXUA 1FCAA 2AEMA 5CCLA 2DNKA 5DETA 3MR2A 3DM2A 3PHTA 4AM7A 1IR2A 4OQJA 5KG0A 4LFCJ 4FJIA 1ZBHA 3M05A 2PMZD 1HRHA 1B7YB 2A10A 3VERA 4RCHA 4KTQA 4DHVA 3J7Z5 3KHHA 3IFRA 3UE2A 4ZHRA 3T1AA 3TAGA 4EO8A 3AVCA 2OPPA 2OD6A 4Z4HA 2R2RA 3QICA 3M3ZA 4O3NA 2ZQBA 2AJ4A 3BREA 3OV7A 1UOCA 2A42A 3O8MA 3QYYA 4MLEA 1ZA2B 1HBUA 5T14A 3CJ2A 4ID5B 4ZCKA 4NL5A 1WBBA 5D3GA 3SQ0A 2W8KA 4O4GA 2YX1A 4NLPA 4DUYK 3RB4A 3FSXA 5F9LA 2FIUA 4H5WA 1LOUA 1HL6A 2XULA 1RT3B 2XMKA 5FLXU 3CD5A 2PE8A 1HPZB 2OUGA 2RNEA 3WZ0A 2IAJB 3O6WA 4YP3A 3N0VA 3D6HB 4OZJA 1XMOK 3T69A 3PIOQ 1H98A 5T7LB 1QVFM 4BS2A 1S99A 2LP4A 2RU9A 2ZH3A 3N28A 2XZTB 3NF7A 3FVYA 2NS1B 1FRLA 1ZM2A 4JI1K 3AVMA 1XNRJ 2EWHA 1XC3A 4WFNQ 2GMJA 2MZRA 6AT1B 3HD1A 2DITA 1VQPN 1IVZA 3JAMO 4C1NI 4OHVA 2LEBA 2WRMA 4DTNA 4HTUA 3VVUA 1YJVA 3DC2A 2C3MA 1WTFA 3HCXA 5A2QO 3QIPB 4JKAA 4N8NA 1DJ0A 4OX9F 1K9MT 1FWLA 4IG0B 3UVJA 2JX2A 2UUAF 2E9ZA 1U2FA 3VGUA 1SIWB 4X84A 2CQDA 4A8OA 1VLYA 4JI0J 3KLGB 3VPZA 4GVMA 4IO8A 2Q6CA 3UR3C 2FGOA 1HLUA 4Y2CA 2XY6A 2CH5A 3VQTA 2VASA 2BOAA 4J9KA 5G4DA 2DY1A 2FY1A 2C42A 5CYJA 4A59A 2JZ5A 4P73A 4WP8A 2FUG9 3UQSA 3FZKA 2VKRA 2QXLA 2ZJQL 3G86A 4M5DA 4BDYA 1TAUA 4NRUA 3ZSQA 4EGLA 1Z4UA 3PFEA 3I0RA 1F3FA 4FF4A 1VQPS 1EHWA 2VFVA 2WZ1A 4AL6A 1XMQJ 4RX6A 5ITHA 1VQSA 1JLBB 1UJ4A 1LWCA 4P6QA 1G2EA 3RU0A 1VQYA 4CF1A 4B1XB 2PFFB 4NCGB 2D9OA 3ZTRA 1H38A 2FBVA 4A47A 2Z56B 3M30B 4TQSA 4O3QA 4JI4K 3NFAA 4E7IA 2C2OB 3JQKA 1O13A 4RBVA 2XY8A 1R0CB 2RHQB 3L2WA 3CFRA 3CDEA 1RTHA 3I31A 4RNFA 4JYAK 3CPEA 5HBMB 1QAJA 2W6LA 2EC2A 2B6AA 1SJ1A 1MWQA 2NXNA 4I1TA 2ZZNA 4YMEA 4FNHA 3WQUA 3VQ4A 3W64A 2AW0A 3MEDB 1RGIA 3MXJA 1BISA 4MK8A 2FZGB 3SLCA 2DIVA 4LF8K 3MUTP 2KL8A 3N6LA 1Y10A 5EX3A 1Q8LA 3PW0A 2NPFA 2QJ3A 1VSJA 3HDSA 3AVJA 2R3VA 2HBLA 3A3PB 4DR4F 2RE2A 3DGPB 2MGZB 3N4WA 3CF5L 2JL9A 4CDIA 1HI1A 4DV0F 3ZSZA 4NA2A 4K4VA 4C0OC 3OW2R 1TUVA 2HQGA 5EN1A 2ZGZA 1S1UA 2Z58B 4I9LA 1H0HB 5JS2A 4FDFA 1X0FA 4WWSA 3T1YF 4K4YA 4QS9A 4DX7A 4LF9K 1YG0A 1RWMB 4PKHA 3BGOP 3THVA 3DOLB 3DXKA 2IC3A 2PYLA 1HNVB 2KHOA 3Q8PB 1N8RO 1S7IA 5K8MA 3EZUA 4JK9A 1KTQA 3PYFA 3ZZUA 2VOPA 5IQQA 1EZZB 4M5MA 3DLHA 2HVZA 2EEYA 2O8EA 4O3OA 5LMNK 5BRDA 3MOJB 4CJ7A 1ZAVA 2J76E 1U09A 4QJVA 2UXDF 2QWLA 5KFVA 3ZX3A 2ZNYA 5F8IA 3GSDA 2OD4A 1JNRB 3QEXA 2RAQA 1J5EK 4DS5A 4AHRA 4F3QA 3ELHA 1LWFB 3KOAA 1YJWS 4AL5A 2O01C 3AO4A 1I3OB 2BW2A 3NGKA 4ZVGA 3VQQA 4BHQA 1P8ZA 3QAUA 2H3GX 3EM1A 1FESA 4FYWB 2MQNA 1LKZA 4JI3J 5HLFB 5KFJA 1T05B 3D67A 4NLOA 2DR6A 3VAMA 3KXDA 4JAXA 2YCHA 1OYDA 4Q2MA 3KD1E 2GMHA 1RBAA 2RQCA 3L2UA 2ZJRL 5AJ3F 1CJTA 4TN2A 4KH4A 1C1AA 3D2FA 3J80Y 1SH0A 4CLUA 1W9HA 2EBGA 4R5PB 3SQ1A 5GAGU 4YR2A 3V6DB 3R2DJ 2KXHA 3D1QA 1TKXA 5J1NA 1LFPA 3J81j 5FJ4A 2OELA 1GLFO 3DAWA 3P1GA 4DMNA 1I39A 3SAHA 3CETA 2FPHX 5IC4B 3PFOA 1M1GA 1G1XA 3LALA 3N5FA 1UZHA 3TSUA 1L3KA 1U1LA 3M9MB 1IQZA 2ZM6J 5E2QA 1YUWA 5BR8J 1VSMA 3W61A 1DTQA 4B9LA 3PJ9A 1BWVA 2QX0A 1F9FA 4BC5A 5LXRA 5DQHA 2UUBK 4X64K 1K47A 1ASUA 4N5SA 2B43A 1N52B 3ZETA 3HFKA 2MB0B 3LP0B 2RB7A 3GIJA 4OKKA 3ICLA 2YNIB 2E6MA 2HGNA 3QIDA 3HXMA 3OYLA 4CZKA 1W97L 3ZSYA 2HHVA 2YNGB 3H46O 4PPDA 3PCOB 3R5JB 3W5ZA 3R6MA 2V7YA 2MKCA 1YLXA 1EWQA 4Y0FA 3ZO7A 1Z05A 4QS8A 5MAOA 1R6VA 4EIAA 1CZBA 1Y64A 5H9FK 3CHWA 4IDKA 2DRAA 3HM9A 2R7OA 5LJWA 1GTEA 2HHXA 3QATA 1DLOA 4CEEA 2QYGA 4KC5A 1NB2A 3CULA 4DV4F 4L6V3 2H9ZA 4FJ8A 2GA7A 1IBLF 4C3LA 3DMJA 4NCBA 2G13A 2GV1A 1RWWB 4ED2A 3FFIA 1JIHA 2CKWA 4K4SA 3OTBA 3CFOA 3O1WA 1YT3A 4OPAA 4DV6K 3OXFA 5EOYA 3PLAA 2FF6A 3RW6A 3JS9A 2OAUA 2YWHA 1OH6A 1U2RA 4O0NA 4B3MF 3IMXA 3ID8A 5B8HA 4BG8A 3ENWA 3SQGA 2BDPA 3SUOA 2FDNA 1OH7A 1N36J 3MM6B 3TUIC 4ANEA 1BHNA 3TTDA 1CZAN 1QHTA 2OSRA 4OYIA 3M32A 3EVOA 4I6AA 2PT0A 4NZ6A 4C48A 4CYUB 3KNGA 4NEYA 3RWUA 3JSRA 3TAPA 4EBEA 1Q5YA 3ZT1A 2J9DE 2Z2ZA 1CLFA 1VQ5N 2F9JA 1LNQA 5LXYA 3OHAA 4FF3A 1MMNA 3EN9A 3MECA 2KLAA 5A8KA 3G82A 1Z6RA 1M5KC 2JOQA 3NBPA 4DV5F 1X5OA 3R97A 2GQ2A 3NF9A 3Q2TC 2B4VA 4A2AA 3ZYYX 5AQFA 1VC6A 2E5JA 2BMBA 3EPGA 2YKNB 2VV5A 1FEHA 3HZGA 2KZMA 3OSPA 1VHFA 3P4IA 4E3SA 2PY5A 3UDCA 2QFIA 2VICA 1T8EA 1CLQA 4C98A 2UXCJ 2KQ2A 4RNOA 3GWCA 4BACA 1CXQA 3HSDA 1RABB 3V9ZA 2G8UA 3NY0A 4PCQA 4XPCA 4C8KA 2A6OA 5KT7A 4HACA 5F8NA 2W9AA 2GZOA 4GC7A 1CSJA 1WHVA 2MZ1A 2IOCA 1N5QA 4FZVA 5AE1A 2YHXA 1VIOA 3TZYA 4QYZK 4N76A 1VQOS 3RJMB 2CJXB 4CLYA 3NE6A 1EQMA 3RMAA 3CD6S 4CF0A 1RTDB 4JKGA 1VQ5S 3WNGA 2Z8QA 2BOPA 3KTQA 2N82B 3JQJA 1WHWA 1O1WA 1AYEA 2ZKTA 2KVIA 1KAXA 3R5DA 1V3ZA 4AQYK 2QA2A 3EJMA 2QMXA 2YPZA 2P9EA 3DWLA 2ZZTA 4KHPF 4KGKA 3NXZA 4NPOA 2WTFA 2LFVA 4YB6A 3M8YA 2VWBA 3VQ9A 2PEBA 1CS4A 1RT3A 4IO9Q 4B9MA 4MYTA 1A9NB 1KQSM 4J37A 1HPZA 3MGJA 1HNZF 3Q22A 2V8GA 2AHOB 4IH5A 1V6HA 1YTUA 5T7LA 2B7CB 3MTJA 3J7YI 5SUHA 2GIFA 1IBKK 1WDTA 4USUA 3OA9A 3U6FA 3BN4A 2UU9K 4B3RJ 5KOXA 3A13A 2IVMA 3UR0A 2R8KA 4LH5A 4OKEA 3KLIB 3VAGA 3I32A 4FF2A 4WYLA 3BGFA 1KHWA 3EGNA 1A6LA 2IM3A 2XWXA 2D3OR 2VC1A 2POKA 2BANB 1NHUA 4J9VA 3R7SB 1WSHA 2HLTA 3OYFA 2QKBA 4I2PA 1LW0B 2F4VK 4P9SA 2M2BA 2LKZA 4IG0A 2J0SD 5J2NB 4KGVB 1GH8A 3QLHB 1WEZA 3M2VB 2C2KB 2E1AA 3WX8A 1HKBA 3H0PA 4JI6F 5BXIA 2MSTA 2QLXA 2UXBJ 1SV5B 5H9EJ 3GU0A 4YOWA 3UKUB 1KQGB 4CLWA 4NLTA 1X9WA 4PWDA 2HBYB 5HN0A 1TK0A 2E5LJ 2AEJA 2D0CA 2G4BA 3D3BJ 2HF4A 2E1PA 4NMLA 4DQIA 4ZVHA 1FJ7A 3CJ1A 2LMIA 4X4SA 5M1OA 1VHXA 1JL1A 2FY8A 4RBUA 2W01A 1SUQB 2MKIA 1JNZB 4ZVSB 5GAEU 4DR5F 3LO3A 3ZC4A 5AZIA 1Z2LA 1Z25A 4OYMA 1ROFA 3LDQA 1BIUA 2Z2MA 4NLYA 3CCZA 4CLKA 1PBAA 1DRZA 4X62F 4L3NA 4P71A 4PRFA 4MJKA 2D3ZA 1PGZA 2NCKL 1R8CA 5AQPA 4JI7K 1XHZA 1TKTB 4MFBB 2B9XA 1JLBA 4YB7A 2VQEK 5GMKa 1NLKL 1N8RT 1HNWK 4YQWA 4NCGA 3MMBB 3SDEB 1BUPA 3IR7B 3E9LA 3D0HE 3OYHA 3D0PA 3M30A 4L3KA 2RF2B 1VGYA 3QNNA 3D45A 4WK3A 4KTWA 4A4JA 2GNKA 4K8ZA 2P8IA 1J27A 4KHWA 3IAS9 3GIMA 5HBMA 2MQ8A 2FBTA 3EGZA 3SAFA 2W4PA 1HW8A 1NK7A 4LFBJ 3KD5E 1VDHA 3HVRA 1BC6A 1N34F 1F5BA 3MEDA 2UVVA 5FDLB 3L2RA 2RE1A 3VAFA 3NMRA 1FWKA 3BF3A 5C42B 3LGNA 1YIJN 1XTZA 4FVUA 2K2PA 4CJRA 2HBZB 1NH7A 3GG1A 1UEUA 2CPZA 2WCXA 3PSFA 3HT0A 2U2FA 2UV8G 3QQCD 3DGPA 2MGZA 3R9PA 4QIWD 3LDSA 4DX5A 4Z7YA 3VR1A 3H5YA 2ZOGA 2B9WA 3L7OA 3MPVA 3H1QA 3RR7A 2FLPA 4B1YB 1N5YB 4HT5A 3SEOA 1QTNB 2IA6A 5E3RA 1SI9A 4KHNA 3GONA 1QVFR 3TX0A 1OMSA 3C16B 1IR1A 1MWKA 3GYNA 3DOLA 2OHDA 3HM8A 3K58A 3CJ9A 1TVRB 2G2YA 5HMXA 3CUNA 1HNVA 2ZUGA 4Y28C 3VMFB 2V2KA 5GAHU 4NEZA 4GW6A 4MO5A 3W7BA 1WWHA 3ENOA 2M4MA 3MWPA 4K5SA 3ZZ0A 4P10A 4PG5A 1WUAA 1EXQA 5A8RB 1VQMS 4V19X 3OPKA 4EFAC 3EO3A 1VAZA 4NYOA 5EWEA 2ATCB 1JXEA 1TR0A 2XHWA 2HFNA 4DUTA 4B1ZA 2YWWA 1B92A 2GVDB 1ZXOA 2E1YA 3FEXB 3HD2A 4UUWA 4CGFA 2P6SA 2ZWHA 1QDUB 4BQZA 1LWFA 3AOCA 5DDQC 2DR7A 2CPEA 4ETXA 3C19A 2E1ZA 2V2QA 3PM9A 4J91A 2B4JA 2MSSA 1XNQJ 2W40A 3FZBA 3Q24A 1M5PC 1C1BB 4YOTA 3CMQA 5HLFA 4B02A 4LF4J 5C24B 3PR4A 4CH7A 2I5JB 2BJ9A 3WXIA 1VQKN 3OD2A 2CZ9A 3M4XA 3M2RA 3V6DA 2ZH7A 1T02A 3TEGA 3P6YC 4I4BA 3NCRA 1GAOA 3L95X 2F8MA 4OJ3A 1BXNA 3CMAN 9ATCB 3NGDA 3R5AA 2D1KA 4CFAA 4R0EA 4N41A 4CZLA 2PSZA 2XMUA 5HVHA 2YWFA 1RWOB 4KPYA 3HI0A 1OPIA 4P74A 2ADBA 1WDDA 4HHHA 5IQ6A 5KT4A 3O3HA 3C3LA 4IOAL 2WC9A 3NEKA 3O2IA 2ZHOA 2RDJA 1TK8A 3IKMA 1YWXA 1E4FT 5CABA 4MIWA 4DQQA 4B9SA 3P31A 1VYAA 4B3SF 2IM1A 4ZCMA 3LP0A 5KGXA 1G99A 2YNIA 2QM1A 3MD1A 1X9MA 4FKXA 3UO0A 4FWPA 2AYMA 1R6YA 2PYJA 2CQ4A 2V68A 2GX9A 2VDHA 3PIPL 2H4WB 1U0SA 4ED4A 1M1HA 5MLCQ 3G2XA 3FNNA 1RE1B 2NUUG 5FPEA 1Q78A 2OPRB 4CJEA 1ICEB 3EMTA 4CJ4A 3HBTA 1E6VB 4KYZA 2Q97A 1VJWA 2I0XA 1VQNN 4I69A 2NREA 1FRXA 1U1QA 1RKIA 1XN9A 5HANA 2XNRA 4U67L 2KI2A 4A8MP 3UWTA 2QG9B 1Y5IB 2XMAA 4QOTA 3CMAS 3L3UA 1RBOB 1KDNA 2KFYA 2YHYA 1GX6A 2BV3A 4FP9A 5AQYA 3HFVA 3L3CA 1JLFB 5HQLA 4DLEA 4DL0C 1HI0P 3OR2A 4NYNA 2AZ3A 2IRUA 3B78A 2I38A 4OX9J 2LDYA 1HNXF 1AFJA 4HH0A 4CHZA 3FCWA 1KWMA 5TKWA 1HJOA 2UUAJ 2DH8A 4GMJB 5DK5A 4LF7F 2CNOB 3HI9A 4CJVA 2C3UA 5L39A 5EXWA 4OPKA 5C15A 3IWLA 1VSDA 4CYUA 2LVWA 1SQFA 5M1KA 4J90A 3D3CJ 3CMES 3CIPA 3PZPA 1OH5A 1ZETA 1VBKA 2AGQA 1IKWB 2ASLA 2OKQA 3T1HK 1FX4A 2IDLA 2PMHA 2DO4A 4DTPA 3SJJA 4GKKK 2Q3SA 1RDAA 4MLHA 4P2MA 1JJCB 3MPDA 4TVAB 5DM7L 3MMAB 3KHLA 1FNOA 1TL7B 1S5ZA 1FRHA 1R43A 1FNXH 2G8WA 4HKQA 2GJ2A 3FMWA 1VQNS 3IGVA 4BRHA 2YKNA 2ZZMA 2CQPA 2HNDB 4FLUA 3VQDA 3VTHA 2VC0A 2CIMA 3AQOA 3VALA 4WCEL 2F1FA 3L2QA 1T94A 2NQPA 1DZ5A 1K8KB 4DX8H 2E1MC 5B0DA 3IP0A 5LL6Z 3ENAA 1S59A 2B9EA 5KG4A 4JKHA 2D0BA 1CQMA 4BRQA 2L9WA 4DR7F 2E2NA 4USJC 2XYGB 1R0BG 3NH2A 3OHBA 1NGBA 3NVMA 4CNYA 1C4CA 1NKCA 3NGUA 5D0EA 5D78A 1B9FA 3DXMA 2ROGA 1F2HA 3NNCA 1VSFA 2D69A 2VD3A 3QT5A 2W4DA 2IVOA 2M52A 2A1RA 2AU0A 1RTDA 4B3OB 1YRXA 3MM5A 5KFPA 2CPFA 3G96A 1AUDA 1IR0A 4MAKA 4WXOA 2O67A 5I3UB 1DAXA 2RDDA 1KNZA 1YDLA 5A76A 5AQKA 5F8JA 4JHDB 4DR4J 3FSYA 4J9OA 3DOKB 1RI7A 2VF3A 3FRZA 1LAWA 3BEXA 2LSNA 2CUYA 4CM0A 2CPHA 1REGX 3RMBA 2QW9A 4DV0J 4AF1A 1DTTB 4QWEA 3I55N 5B0EA 2GEMA 1YI2S 1Q7YO 1WG1A 2JC0A 1KC8T 3T1YJ 1M1KO 3JTPA 1WG5A 3TAEA 1QSYA 2FXUA 3G6EN 3K5LA 4JI2F 3KLIA 2NSCA 3EZWA 2X7IA 5GAGI 3T41A 2C2RA 1Q18A 3LAMA 1BQMB 2YKMB 2PEHA 2CWXA 3EGVA 2VZ9A 4KAIA 1UVMA 1CC7A 2K1RB 1S48A 2MYFA 1LW0A 1P9YA 3MM7B 3HSJA 5J2NA 3PNIA 2FC8A 3P38A 3QLHA 3GV7B 1VC5A 3QRPA 3EKSA 4RW9B 1MLAA 3M2VA 5LT5A 3VQCA 2DEJA 3OVAA 2HRYA 1N5VA 2QE5A 4ES2A 1SV5A 2DGUA 4RNNA 2MDAA 2YX6A 3UKUA 5A6WA 2LA6A 1U49A 3TUZC 2FBXA 2UXDJ 4OMFG 1S22A 3MHYA 3PX4A 3FK4A 3TZWA 1PJ7A 3KUEA 1FERA 1K8AO 2J8SA 2DCLA 5K8NA 3ZEUB 3L3VA 5CYMB 1SUQA 4B8AB 2KJVA 3M2UA 3I55S 2QA4G 2EG2A 2JHEA 5IT9Y 3RSEB 2IFXA 3CC7N 3GSIA 1HBNB 2ZD1B 3CJ4A 2OYQA 1S0NA 2HNYA 3H2LA 3G6ES 3KHRA 5L1JA 2ZH1A 5AJ3J 4GVLA 2ALYB 3UE5A 4ZLNA 3ZTOA 2FZCB 1KD1O 1P8GA 1NGHA 4ISEA 3MUMP 4FWRA 4PXEA 5A2QU 4WQ4C 1R89A 4BROA 1KQKA 4CEFA 1N36K 4I2QB 4RKUC 4CD3A 2HBQB 2E2OA 1HQ2A 5HATA 4CEAA 2AYEA 1HKAA 2WOMB 1W2IA 2ZBQA 2GO9A 5CZ2A 5C2FA 2IVFB 2DGTA 1C0TB 2M3DA 4S0MA 4DTOA 3DRSB 5AQXA 4IEIA 4QOZB 2FJAB 2HMIA 3VF6A 1RWXB 1PG5B 4KR0B 1AW0A 3LL3A 1FW6A 4JKDA 5KFEA 3MWTA 2F65A 3I96A 1RLCL 1T6DA 2AP1A 3OYKA 5IT4A 4K4TA 4GVBB 4TY8B 4LF2A 4GO7X 4QW8A 2ZJQQ 3K5PA 1RILA 3NGTA 2UUTA 2KHCA 2HZVA 2R7XA 3Q7BA 5C42A 1GTHA 3VQEA 2VG7B 1HR0K 3OVSA 3V9XA 2FJBB 4RUHA 4JI8F 2P5VA 1B9DA 4BVOA 3CC7S 3PR5B 2Q2RA 3PKMA 4C0BA 3MOZA 4ENOA 2WBNA 5B7WA 2UXCK 4JV0A 4KGXB 5EWGA 4IBNA 1H2UX 2PN6A 5KPTA 3WC0A 2O8FB 4R8UB 5E41A 1RHKB 3S7RA 2KT2A 1N5YA 3KK3B 2FJEB 4DV4J 4FS1A 1X9SA 4BE0A 5EUHA 1CEZA 1IBLJ 3EDQB 3LP2B 2MZSA 4CZFA 3C16A 3BGLA 2QEXN 3IC1A 3AOAA 2W41A 4DV7K 2O4GA 1TVRA 4LT6A 3VEZA 3L6QA 1FRMA 4YY3K 5IWAK 2HBRB 3JYTB 2G1HA 3N6NA 4OYXA 1F21A 5KFXA 4U96A 4B3MJ 1IBMF 4FS2A 3N79A 4K25A 4EBDA 1R8HA 3CC4N 5A8RA 4FK4A 5KG3A 4ED0A 2R8IA 2VONA 3QDKA 4DQ8A 3OTOF 3CF5Q 3LPUA 1NKEA 3QFHA 2GVDA 1URNA 3D54A 4LRBA 2M7SA 2HB5A 3NS7B 1BA1A 3KWGA 2ABYA 3CJTA 5L1KA 2Z1HA 5CD4A 2FJXA 1N0UA 4R79A 3M8SA 3G10A 3NL0A 4DV5J 2LEAA 4URGA 5GVQA 4F3OA 3SFUA 1HX1A 2UVUA 2HAFA 1B0PA 2KG0A 3F73A 2GTDA 3SV3A 1NU0A 1NDPA 1AXQA 2PIIA 1SL0A 2H5EA 2DO0A 2ATLA 4NXMK 1C1BA 5K8PA 3MN6A 3G25A 2X51A 2AIRB 4FWQA 1VS3A 4F4YA 4CEZA 3ETMA 4CGDA 3RYLA 1NM1A 3AXMA 2QEXS 3AJ2A 1RCHA 4AXIA 2Y0BB 4PPZA 1VCTA 2I5JA 4JB8B 3KMQA 2BVZA 3MX2A 2QWQA 3K5MA 1ATSA 2HIQA 4ECSA 4WQ4A 4FJGA 2VOOA 3SUNA 2GJIA 3LDPA 3X1LB 4IKFA 1H2TZ 2XMWA 3CCSS 1B64A 4GY2B 3ZZZA 1Q81O 4ZIWA 2GIRA 1S5JA 2PFDA 2QFJA 1H73A 4PABA 1BCMA 5ADZA 1JWWA 3H42A 2KT5A 3H5SA 3JSBA 4K43A 2W42A 3CC4S 2RKIA 4NRTA 2LQ8A 5C2GA 3OFGA 2Q1LA 3SI8A 2XRIA 4I6WA 1OY9A 4ZLPA 2KYZA 3PEJA 2K06A 3HO1A 1RTIA 4OHYA 3FBFA 3D2WA 3PW5A 4I0WA 4Z4GA 3THTA 2L41A 4OYWA 5F8LA 2GBZA 3CXCR 5D4OA 5AQTA 4H4MB 1IM6A 4JI5K 4KHPJ 4ZKAA 3I4PA 4MKVA 2V52B 2KG1A 2LQBA 4QU6A 4DL6A 2ZJRQ 2WUSA 5B0CA 1AZSB 3LTOA 3ZX0A 4FZYA 4RO0A 1RCXB 1HNZJ 4USVA 3JSMB 2XLJA 4O3PA 1EJ7L 2IDOA 2XC9A 2ZVSA 4ECTA 1RAHB 2KKZA 1AA1B 3DOMB 1CQNA 5LSLA 3FBBA 2OPRA 3K59A 1K6YA 1RT7B 5AFUH 3B54A 4JK8A 4AHSA 2CNLB 1Q9XA 3BBCA 4DUYF 1YRUA 3WIUA 1ZZFA 3MEKA 3GFYA 4X66K 4OYPA 1CZ9A 2GO8A 5T41A 1K0TA 2APOA 3IM8A 3GV8B 1XMBA 4LFBK 1VSLA 1XMOF 1GMVA 1P9QC 1H7WA 2HHUA 1S72N 2YWEA 4CZCA 2W9CB 3HYFA 4NMXA 3CCLN 4AYBD 2AJFE 4JI6J 4NXNK 1DHMA 3CO9A 3AVIA 4KT0C 4B17A 2KZZA 3WQPA 3NRBA 3ZNUA 2O3DA 2KO1A 1X4EA 4WE1B 4CF2A 4ISGA 2QLBB 2CRLA 2V4JA 3US5A 5ETRA 3EE8A 2DY9A 2ZH4A 4N8OA 1ZM9A 3DLKB 2Y1LB 4DR5J 5L1IA 2JSXA 2XI2A 4HR2A 2Q31A 2UZAA 3AGKA 3VQ5A 4HHUA 3MAAB 4FXVA 2HHWA 3MMAA 4X62J 1TL7A 1Q7YT 2R4FA 3RTVA 3DRYA 1M1KT 3NNHA 3KZBA 2BKOA 1W2BR 1NPKA 4ZVFA 2J7UA 7FD1A 2HNDA