5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
2X74A 5KFMA 5KT3A 3PY8A 3I5CA 4HUEA 4E1MA 3I0RB 1B9FA 1HNVA 4PUOB 2Z1HA 4Z4HA 5KG7A 4ECRA 4NCBA 3VQ6A 4DFKA 4DF4A 4E89A 3CDUA 3SPYA 2LSNA 2ZE2B 5HROA 4H4OB 3FFIA 1LWFB 4QW9A 1VSIA 4AH9A 1HPZA 3CG7A 2O4IA 4KHWA 1S9EA 4XIUA 4CESA 3QNOA 2YV0X 2Z1IA 3F9KA 1RTIA 1RYSA 1RT6B 4IKFA 2RF2B 4OJRA 4H4MB 3K57A 1JLBA 4XPCA 3DOLB 4ECQA 4DSJA 5D3GB 3KK2B 4CERA 4O3NA 1WSJA 4RU9A 4ED6A 2W7PA 1UAXA 1HYSA 2P5OA 4J2DA 4NLYA 1D5AA 4O4RA 3CM5A 1ZBHA 1KTQA 4O5BA 3M8QA 1J5OB 3NBPA 3C6TB 3GIKA 1S1TB 4EP4A 4DU4A 3VQCA 1QUVA 2W9AA 4Q8FA 1TKDA 4IRDA 3T5JA 4W5NA 3TAMB 3NCIA 3ZT3A 5J1EA 3PX0A 4RNFA 1C1BB 1KLMA 5K14B 2I5JB 3IS9A 2ATLA 3V1QA 4LH4A 3KLIA 4ZPDA 4E7KA 4ECUA 3OYHA 4HUFA 2IMWP 5HRNA 1X9WA 2XY6A 1QQCA 1FKOA 3KLGA 4J9OA 4RW4B 3V9SA 1IG9A 1GX6A 2KTQA 1TAQA 4FLTA 1C2PA 2HHSA 4F4YA 4J9NA 4E7JA 4Z4IA 4NLRA 4URQU 1SKSA 4RW4A 4FJMA 1NJWA 2YNGA 1WNEA 4DF8A 3N6LA 5J2PA 3ZSRA 2ALZA 3GV8B 4O3SA 2VG5A 4ED1A 5J2MA 5L9XA 4DMNA 3SUQA 1BL3A 1VRTB 4RUCA 2I5JA 3IS9B 2J6SA 1DLOB 5CYMB 4H54A 4AHUA 3RB0A 4LSLA 3PR4A 1S97A 3AVMA 1FKOB 3KLGB 3KOAA 4O0IA 1KRPA 4TQSA 1C1CA 3H98A 4XO0A 4CEOA 3KIOA 3H2LA 1UA0A 4CGGA 2RN2A 3CJ4A 4AHSA 1C0MA 3I0RA 1KLMB 5J2PB 1J53A 3TI0A 2OPRA 1C6VA 4BDPA 4IOBA 1XR7A 5J2NA 3QIPB 2E6LA 3I5AA 3GIIA 4BWJA 3FFIB 1TV6B 2IS3A 5T14A 4WE1A 2YHAA 1A5XA 1NK7A 1RTJA 2XC9A 5F8HA 3TAEA 3G10A 4MKAA 3LWLA 5F8JA 5JXSA 3SUNA 3AVKA 3SJJA 1S9EB 3DLHA 3TVKA 4M3ZA 2YKMA 4PQUB 3BDPA 4NRUA 4H4MA 4RG8A 3CWJA 4CJEA 1QE1B 1BCMA 3AVLA 2ZKUA 2XY5A 3GV7B 2KFNA 2HNYA 3ALYA 2AU0A 1VSEA 4NLTA 1RDBA 4CF2A 3PVXA 3OYGA 3OYAA 1DTQB 3AVAA 4EBCA 5KG1A 1EP4B 4CF0A 4ECVA 4FBUA 4ECWA 2VG6A 3MR6A 1QHTA 3TABA 3MF5A 3EZUA 3V6KA 3OS2A 1IKXB 4CEDA 3SZ2A 4CGHA 5KFFA 1RBVA 4B9UA 3DYAA 5SWMA 2WRMA 4CJQA 1HNIA 2DFFA 1XR6A 1SL0A 3S3NA 1ZBFA 4EYIB 3MEDB 2BANA 2W7OA 2F8TA 1QTMA 4E7LA 5KG3A 1U4BA 1CXQA 4ZPBA 4CF9A 2F8EX 3CM6A 1LW2B 3KLVA 4HVJA 1R0AA 3MR2A 1S0MA 1SH0A 3NGYA 4C8LA 2ZD1B 1LWEA 1D9DA 1MU2B 1T3NA 5KTQA 2B5JA 1JKHB 4IH7A 2WOMB 2D3ZA 1O1WA 2G8UA 5KFQA 2B6AB 1Q9XA 3S3OA 2I1RA 3HVRA 3LP3A 4M42A 1BISA 1LAVA 5L1JA 4F3OA 4NYNA 3M9OB 3DRPA 3HT3A 4N5SA 3AO3A 4NLSA 4OPKA 5KFTA 4CE9A 4DTSA 2EHGA 1TL1B 2CKWA 3VQ5A 2R2UA 2IC3A 4DTRA 4KO0A 2BRKA 3U6FA 4NLPA 4JV0A 1BQMB 4ED0A 2QV6A 4I2PB 4DLEA 4O3PA 3BJYA 1REVA 3T19A 4FCYA 4B9TA 4QWCA 3LZJA 4ELVA 1YVUA 4ECYA 3A2FA 3DLBA 1RBTA 4OLAA 2B6AA 4PWDB 5KG0A 4CJKA 1QSYA 3ITHA 2HB5A 4DTMA 4ZP6A 1KVCA 2HHQA 3QGGA 4QAGA 3HKWA 2DFEA 4EZ9A 5FROA 1UOCA 3LP1A 4Y2CA 4URGA 1C0TB 2FJVA 4KHUA 1HQUB 4ECZA 1XHXA 5KT4A 2PZSA 4EP5A 1GOBA 4M45A 2JLEA 2O4GA 4I2PA 2YHBA 3L3UA 1NK8A 3NAEA 3HJFA 2HW3A 5DLGA 1X9MA 4TY9A 2E9TA 3MTKA 4F4ZA 4B3OB 4KREA 4FM0A 3QEIA 3AVCA 3UIQA 4IFVA 5F9LA 3AVIA 1HYZA 3H40A 3ISNC 3SUOA 4IRCA 5F8GA 4DFJA 1NK5A 1WSIA 3U3GA 5JUMA 5C25A 3DRRA 3RB4A 3OJUA 3HM9A 1C0TA 3T5HA 2OPPB 4IDKA 2UUTA 5F8IA 3DM2A 1T03B 5F8LA 4AHVA 2ASLA 5EDWA 1JX4A 1NJXA 3T5KA 5KFWA 2BR0A 4ICLA 4KI4A 1HQEB 2YNFA 4QW8A 1DTTA 4CFBA 3OYNA 2YKNB 1EXQA 3V6DB 2VA3A 2F8SA 4KBIA 3AA3A 1TKTB 1WSHA 1RT7B 3KJVA 4B9SA 1FXXA 2W9CB 3AV9A 2G8KA 4WYLA 3WNHA 2WONB 5T7BA 1KHVA 2OPSB 3MEEB 3BGRA 2P5GA 1ZBLA 1RT2B 2E4LA 1NK6A 2HMIB 5HLFA 3VQ8A 3NH0A 3P5JA 1RT3A 2FVSA 2YNFB 2R7YA 1VRUA 3HXMA 3TAGA 1ASWA 4KAZA 2VG7A 1WN7A 3DRPB 2GBZA 3SFGA 3L2RA 1TKTA 4Z0UA 3K59A 4Q0BA 2R8KA 1JXBA 4GC6A 2D7SA 2AX0A 4CHPA 4J9RA 3M8SA 3ZSOA 4QPXA 1TAUA 2F96A 3FSIA 3FQKA 4GC7A 1HYVA 1S5JA 3KLHA 2BANB 4FS1A 3H5XA 3NH1A 1LV5A 4YR0A 4W5OA 1LW0A 4IG3A 5KT2A 2V4RA 3BQ2A 1SV5B 3DMJA 4CJ3A 3L2WA 4KHYA 1VSHA 2E9RX 2XI3A 1C1AA 1RDAA 4JS4A 1HARA 1VSDA 2Z1JA 1ITGA 1TKZB 1LWCB 2XCAA 5K14A 1Q9YA 3M8RA 1NHUA 2GIRA 2AGQA 4TY8B 1NOYA 2AGOA 1S6PB 1BGXT 4XPEA 4ZTFA 1JLQA 3ZSQA 2KW4A 1JL2A 3G6YA 4Z4EA 4G3IA 2AJQA 3EPIA 1S1WB 2X6SA 5KRTA 1SV5A 2AQ4A 4DL2A 3AVFA 4F3TA 2QK9A 1LW0B 3PW5A 1D0EA 4ID5B 1W25A 4NCGB 4HUGA 3D5MA 4CK1A 4R5PB 4ZP7A 3OLAA 4B08A 4OL8A 4DL4A 3ZSWA 2C2DA 5DMRA 2IM1A 4I7FA 3PJWA 2DTUA 1IM4A 4ED7A 3K5LA 4FK0A 3K58A 4DSEA 4URSA 2DPIA 3PW4A 5JS2A 1FKPA 4I7FB 4O44A 2Y1JA 2OPSA 3MEEA 2HNZA 4C8KA 2HHWA 2RDIA 1HMVB 4IG0A 1FK9A 5KG4A 3NF8A 4EZ6A 3K5OA 4CEZA 4O0JA 3QEPA 2FVCA 3KK3A 3K5NA 3ITHB 3PR5B 4E0DA 2IM0A 5KFHA 2DY4A 4KTQA 3NF7A 3B6PA 4F2SA 2R2RA 1S6QA 4NCGA 1SH2A 1IKWA 4RNOA 1Y97A 1ASVA 2G8HA 5I42B 1D8YA 3PW0A 4FJ5A 4TQRA 4KB0A 1TL3B 4CF1A 4BACA 4CHOA 1CZBA 1I6JA 4ID1A 3V81A 1ZTWA 1QAJA 1T94A 3BREA 4NLOA 3OSPA 2UVWA 3DLKB 1YVFA 4O4GA 2JEFA 5EWGA 1GOAA 4O44B 3Q8QB 3ULDA 1RT3B 3QGIA 3GILA 2AX1A 2W8KA 1KVBA 2WTFA 4B9VA 3LP2A 1TKXA 4FJIA 3DI6B 4O3QA 1RT4B 4KTWA 2OPQA 2E9ZA 4F4WA 4DL6A 2B5JB 3H5YA 4DG1B 4FZZA 3DM2B 1T03A 4CEBA 4CGJA 1JLGA 4ECTA 2RPIA 4WXOA 1NKEA 1TL3A 1RYRA 4BE2A 5J2MB 4I9LA 1XC9A 4O3RA 3NGZA 1S1VA 4J9MA 1JLQB 5KG5A 2YNIA 3G86A 2D5RA 4F4KA 2ILZA 5KFDA 4BE1A 3I8DA 5CY4A 3RBDA 4YP3A 4RNHA 1C1CB 3PX4A 3AVGA 4FLWA 3O3FA 4RW6B 3CDEA 2FLPA 5EWEA 2BDPA 4KB7A 1DLOA 3VQ7A 4HCCA 3KMQA 4DU3A 4KV8B 1S10A 1IKYA 5F8NA 3NMAA 1JLFA 3M9NB 1JLEB 1I39A 3CFRA 1JKHA 1EP4A 3EPGA 1S0OA 4TN2A 5KFVA 3VA3A 1JLFB 5KRSA 3QZ7A 4FW2A 4DS4A 3NAIA 1UWBA 4Q0BB 2UUWA 1S9GA 4K4UA 5DG9A 2WHOA 5DLFA 1D1UA 1KVAA 4RW6A 3MXJA 3ZT2A 4F8RA 4EEYA 3RTVA 1TP7A 3NF6A 1TGOA 4MQ3A 4OKEA 1JXEA 4B9MA 3KKSA 4QWBA 4WZQA 3IRXA 3AA5X 4IH5A 3QYYA 2D41A 3LZIA 2FVQA 1A5WA 1R0AB 4KAIA 4YMEA 3SQ1A 2X78A 3V9ZA 1BIUA 4K4XA 4ED3A 4M3RA 3DRRB 4R8UA 1S1WA 3EZ5A 1GX5A 5KGXA 3OS1A 1RT1B 4Y3CA 1S6QB 3TAPA 1N48A 3HPHA 2W9CA 2YNGB 4NZ0A 2AGPA 2IBKA 1ZYQA 4FM2A 3BQ0A 3CJ0A 2HVIA 2OPRB 1NK9A 4OLBA 4I2QA 3QO9B 3NKYA 5KFOA 1ZBIA 3TAFA 4ECSA 4RW8B 1HQEA 1RTHB 1NHVA 4CEFA 2BE2B 2HNDB 4RZRA 4K50A 2D0BA 2FBYA 5KFYA 2XGQA 3K5MA 1BIZA 4YFUA 5J2QA 1BQNB 1VSKA 4TXSA 4RW9B 4MK9A 3TWHA 5DQGA 2R8IA 4IH6A 2JGUA 3NDKA 3AVNA 3NFAA 2O5DA 4AHRA 3SYZA 3PO5A 1SUQA 5F8MA 2D3UA 4ZP8A 1QAIA 4FJJA 2G8IA 4U7CA 4JS5A 3TARA 3PW2A 4E3SA 3OYJA 3I5BA 4CFCA 4CF8A 4R0EA 1S1VB 3MR5A 1F21A 2IM3A 3OYLA 5FRMA 1C0UB 2Y1IA 4LQ9A 4HTUA 2OZSA 1JLEA 1QSLA 5EUHA 4MK7A 4DS5A 4Q44A 2XCPA 2ASJA 1BQNA 3L3VA 2FBVA 4QCLA 1RT6A 3ASMA 4EBEA 1LAWA 3ZT4A 2JC1A 1N6QA 1KLNA 4ZVEA 3DLEB 3LDSA 3DLGA 4TYBA 3DLKA 1IH7A 3KNAA 3WNGA 4FZXC 2WONA 4E7IA 3SUPA 1JXLA 5HRSA 1D9FA 1W9HA 4N76A 3V81B 1EETB 4IRKA 1EX4A 1WSEA 4NRTA 1C0UA 2ZE2A 4KRFA 3LP0B 3CFOA 2HWIA 4CFAA 4X2BA 1RTIB 4CJ4A 3V1OA 4KHSA 2R2TA 2IC3B 1S1TA 3QLHA 1S9FA 3ICLA 1RDRA 3C6UA 4ELUA 1YTAA 3LAMA 3TAMA 1L5UA 4KE5A 1KHWA 3H08A 3C95A 3KK1A 2QXFA 3KTQA 4Y1DA 4E7HA 4RNMA 3H59A 3C6TA 2ETJA 1EKEA 5KFSA 4HKQA 1KCFA 3M8QB 4FJ7A 3THVA 3OS0A 5HP1B 5L1LA 3AO1A 3JSMB 2WK4A 1TK5A 3Q8PB 3AA4A 4M41A 2G8FA 3HL8A 1JLGB 4ZVGA 2HHUA 4CEAA 4CEEA 3KHLA 3AVBA 1RT2A 4B8CA 4CHZA 1IKWB 1MU2A 5E41A 3H5SA 2RF2A 4CGFA 2W42A 2J6UA 1IKYB 3I0SB 1NOZA 2IAJA 4CCHA 3E01B 2HNYB 2PYLA 4LD0A 3OLBA 2BGGA 3QGHA 1RDCA 4QWEA 1L3VA 3KKRA 3KMSA 4KSEB 4CEQA 1RT7A 3V9UA 1TVRB 3MECB 3RB3A 5KFKA 4Q5VA 3CIZA 3KLIB 3AA2A 4QOZB 2WCXA 3ZCMA 4KHMA 2GIQA 4LSNB 3D0PA 5HROB 4NLXA 2R8GA 3ZSZA 3MEDA 5CYMA 4LY7A 3VN5A 1SKWA 2FJXA 4IR9A 2HNZB 3HSTB 4Q8EA 3SQ2A 4KFBB 1RAJA 1JL1A 3UDLA 1K6YA 4FM1A 5KFUA 4DQQA 4FLUA 4WFXA 1CXUA 4M94A 1U47A 4FZYA 3PV8A 2W9BA 5HLFB 1T8EA 3OHBA 4U6PA 1U45A 3VQ9A 4NLQA 3RMDA 2ATQA 4PUOA 3G6VA 4MH8A 1JIHA 2HHVA 3SV3A 3LP0A 2X6NA 4NLDA 3HYFA 2OH2A 3G0ZA 1DTQA 3PX6A 3TQ1A 1KFSA 1TL1A 4IFYA 3N6NA 4IDKB 2OPPA 4DQIA 1JLAA 1K1SA 3LALA 2GUIA 3C6UB 4M3WA 3ZSVA 3QZ8A 3CO9A 3V6HA 3H4BA 1A5VA 3KHGA 3DOKA 1VSMA 4G1QB 1N5YB 4FLZA 4MKBA 1NNDA 2HAIA 4LSLB 4AHCA 1S6PA 4ZMMA 3BR9A 3BSAA 5C25B 3LWMA 3NBPB 4PY5A 2YNIB 3UQSA 3GV5B 1WLJA 3ZSXA 4ZTJA 3RMCA 2BRLA 3UPFA 3O4NA 4NCAA 3CFPA 4DTNA 5KFAA 4W5TA 4RW7A 3KLEA 2P1JA 1CSJA 5KFCA 2R8HA 4F50A 1J54A 1VK0A 4K4SA 3CJ3A 4JV2A 4CJPA 1SL1A 4Q43A 3RAXA 4JV1A 1T7PA 4Y34A 1YTUA 1T05B 4J9KA 3FQLA 1RBUA 1RCHA 4BWMA 5CYQA 1S1UB 2YKMB 5DG8A 2IJFA 2ZD1A 3QO9A 4AILC 4KPYA 4K4YA 2KQ2A 3KLHB 5CYQB 1HMVA 5C24B 2NUBA 4GVMA 4IFVB 4AHTA 1BHLA 1RTHA 1WSGA 3V6DA 3DMJB 3KLFA 2XGPA 3IRXB 3VQEA 4ZP9A 2A1SA 4FJGA 4CJUA 2P51A 1VRTA 5I3UA 3QETA 1LW2A 2RKIB 3CYMA 3C94A 3AO5A 1IKXA 4M3TA 4J2BA 4J9QA 3HVTB 4CHNA 4GMJB 4LQ3A 4ED8A 5DGAA 3H4DA 5EWFA 5KFNA 3CJ2A 1RTDB 2JEJA 2YNHA 3MECA 1LWEB 3OHAA 4TYAA 3V9WA 5KFZA 3LPUA 2D0CA 4WXWA 3VQPA 1MMLA 4BE0A 3BSCA 4EYHB 4CIFA 3V9XA 1BCOA 2V9WA 2FC0A 1RBSA 1VSFA 4IG0B 5DQHA 1RBRA 2W9BB 5KFGA 4F2RA 5HBMB 4CHQA 1ZETA 4DSFA 3SQ0A 2OZMA 2D0AA 1B92A 2UVUA 4DTUA 5JS1A 2C2RA 3IG1A 4J9PA 4DWIA 3OL6A 4E19A 3QINA 4M3UA 1C1BA 3OYKA 3E51A 4JRQA 3ZT0A 3MXMA 4ECXA 2QKBA 3DDKA 4EO6A 1LWCA 5KFXA 4RW7B 3KLEB 4RUAA 4Y1CA 3PO4A 2KFZA 4JRPA 3KK1B 5KT5A 1REVB 4ED2A 1JLCA 4DSLA 4WYWA 4QWAA 2E6MA 5KFRA 1ZTTA 4TSXA 2HHTA 1S0NA 3NE6A 3QERA 4J2EA 4CIGA 1QSSA 3D45A 3GQCA 3LP1B 4IBNA 1S48A 1U09A 4B9LA 4IFYB 1WNSA 1JLBB 2XY8A 4DG1A 3NF9A 4TLRA 5FRNA 1Z4UA 3HPOA 3NAHA 4JLHA 1HJRA 3CJ5A 1N4LA 4IQXA 1DTTB 4N47A 3V4IB 3SNNA 4DQPA 3AO4A 3SPZA 5F9NA 5HRPA 4JUZA 2EX3A 3VQSA 4DL5A 5KFLA 2XI2A 4RNNA 3V1RA 1TQLA 4K4TA 1RILA 4YQWA 4O3OA 4EO8A 2IDOA 4B3OA 2XHBA 4KHRA 1UA1A 4ELTA 2FBXA 2YKNA 3PUFA 3QEWA 1U49A 4UQGA 5HP1A 2PY5A 5I42A 4DTOA 4IR1A 4CGIA 1SUQB 3MR3A 1XWLA 3L8BA 4FJHA 4DQSA 1UWBB 4H8KA 3OYCA 3EYZA 4ZVFA 1EETA 5KFIA 3KHRA 4FJLA 3IGVA 4CFDA 4MFBA 2HHXA 3RBEA 3V4IA 3SFUA 4IKAA 5KG6A 4FW1A 3DYAB 4FBTA 2FLNA 1Z25A 4C8NA 2VWKA 1HRHA 3ISND 3SI6A 3QIDA 2R8JA 4MIAA 3TR8A 2FVPA 3SV4A 4FVMA 1S1UA 4QWDA 3IN5A 5L1KA 2G8VA 5D3GA 3PJXA 2KZZA 3AVHA 4LH5A 3V6JA 3IAYA 4KB1A 5C42A 5KT6A 3KK2A 3VQAA 2OA8A 3MEGB 4B9NA 4KKOB 4FYDA 4N41A 3VQQA 5I3UB 3DLEA 3UR0A 2QKKA 2IAJB 3WNFA 1J5OA 3DOKB 4I2QB 2W8LA 4J9SA 5KGWA 2UVRA 2EC0A 3ZSYA 2VG6B 1VRUB 4CJTA 1RT1A 4ZPCA 3M8PA 4OGCA 5J2QB 4KHQA 5J1EB 5KFEA 1GOCA 1CZ9A 3RAQA 3I0SA 2V4QA 3BGRB 5CZ2A 1HNVB 1FKPB 3RRGA 4CJWA 1IKVB 4KV8A 1NJYA 3QESA 3KHHA 4M3XA 2RKIA 5FDLB 2CJQA 4W5RA 1KSPA 4DSIA 1RA6A 4DEZA 3RMBA 1XI1A 1XR5A 1TK0A 2IM2A 3OYEA 1Z26A 3AO2A 4W5QA 4FJXA 2GC8A 1X1PA 1FK9B 3OYMA 3QIOA 4KFBA 3AVJA 3GIJA 1RTDA 4YR3A 2VWJA 4NYZA 4NYFA 4FJ9A 3QEXA 3LANA 5C42B 3OYFA 4HYKA 3RWUA 4ZHRB 4R5PA 4CGDA 4DLGA 4N56A 2OYQA 4KI6A 3JYTB 5CZ1A 4C8OA 5KFJA 1RDDA 3KK3B 3MXIA 3FDSA 5FDLA 1WAFA 1HNIB 4EBDA 1XHZA 3OJSA 3JSMA 4FLXA 1NKBA 4G1QA 1N5YA 2HMIA 3RR7A 2GV9A 3TANA 4FLYA 3VQBA 3DI6A 3S9HA 3IG1B 1U48A 1TK8A 2ZQBA 4Q45A 4OKJA 2PYJA 3DRSA 1JLAB 2BQ3A 3SQ4A 4DFMA 2C22A 3L2UA 4CJVA 4O4GB 5HRRA 1WSFA 4CHYA 3E01A 2IA6A 4GW6A 2ASDA 4FK4A 4WFYA 3HO1A 5C24A 4CECA 4WE1B 1N56A 3KLFB 3QEVA 1TV6A 2JC0A 3F73A 3O4QA 2Z1GA 2QE5A 1SL2A 4DU1A 4CK3A 3DLRA 1KFDA 4HCBA 2Q3SA 4DTPA 3QIPA 2J6TA 3QLHB 3DLGB 1G15A 3LP2B 3PW7A 3KJVB 1WAJA 3T3FA 3MEGA 2WB4A 3VQDA 4YNQA 1QE1A 3OY9A 1L3SA 4KO0B 4DSKA 5DQIA 4OGEA 2FVRA 2ITGA 2XY7A 4KKOA 3M9MB 4TY8A 4IG3B 3LAKA 3NHGA 2IOCA 1HPZB 3Q8RB 3BQ1A 4K4VA 3Q8SB 4KTZA 2FLLA 1LWFA 3DRSB 3HHKA 5KG2A 3BSNA 3L2VA 3SCXA 1NJZA 4NLUA 5KI6A 1TKXB 1NKCA 1YT3A 4J9LA 5C5JA 2IJNA 1IKVA 4YR2A 1HQUA 1RNHA 4ICLB 1S49A 3WNEA 4H4OA 4B8AB 3OYBA 1N6QB 1J9AA 3QNNA 1IO2A 1S1XA 5DG7A 1BI4B 3HP6A 3CQ8A 4Z4FA 4CJRA 4C8MA 1OS5A 2B4JA 3S3MA 1T05A 4WZMA 3FRZA 3P1GA 1TVRA 4DTJA 1RT4A 1S9GB 2XO7A 3RB6A 4FLVA 3U3YA 4L8RB 2VG7B 5DK5A 4DQRA 4PQUA 1RT5A 4MIBA 2XWYA 4HHTA 4Y2AA 4Z4GA 4MK8A 1TKZA 4ZVHA 3OL9A 4LSNA 1JLCB 3OYDA 3HK2A 2R2SA 4NLVA 1ZBUA 4DL7A 4FJNA 2BQRA 3HP9A 1S1XB 1BI4A 3GYNA 3IGNA 4FXDA 4PA1A 2KZMA 4RW9A 2VA2A 3TAQA 4FK2A 1SKRA 3G6XA 1U04A 3T1AA 2B43A 4K4WA 3T5LA 3PZPA 5L1IA 4FJKA 3NL0A 3HVWA 3DOLA 3NGIA 1RT5B 3KD1E 4R8UB 5KT7A 4RW8A 4FJ8A 1NK4A 3NH2A 2HVHA 1L3UA 2BE2A 2HNDA 1QS4A 5KFBA 1BQMA 3VQ4A 3OSNA 1W0HA 5EU7A 3MFIA 3LPTA 4M3YA 1CLQA 1B9DA 2IGIA 2ILYA 4WFZA 4J2AA 3OL8A 4O55A 3MAQA 4PWDA 3B6OA 3RMAA 3D28A 3HVAA 2UVVA 4BDYA 2C28A 3H5UA 5SZTA 2OPQB 1K1QA 3NGDA 1Q8IA 2JEGA 4CJLA 2G8WA 3OYIA 3RR8A 3CDWA 2HWHA 1HYSB 1L3TA 4NLGA 4MFBB 1VSLA 4DFPA 2WOMA 5J2NB 4I9QA 5HBMA 3N6MA 3RRHA 2FJWA 2V0NA 3VA0A 3HVTA 3HPGA 3P83D 1RTJB 4ID5A 1I3AA 2AWZA 3CVKA 3SI8A 4CIEA 2JEIA 4DTXA 4OPJA 4NLWA 1VSJA 3OL7A 2YNHB 4ZHRA 2FBTA 4OVLA 3M8PB 1ASUA 3L2QA 3O3GA 4ZPAA 3JYTA 3BSOA 5DGBA 3MFHA 3OVNA 2BQUA 3O3HA 4Z4CA 2DFHA 4OKKA 1S4FA 3ZT1A 2VG5B 2RDJA 4F4XA 4K8XA 4CK2A 1NK0A 1RA7A 3PHEA 3GIMA 2DPJA 2C2EA 4K8ZA 4M95A 5KFPA 4CJSA 4CJFA 3K2PA 2XRIA 4BDZA 4K4ZA 2A1RA 4KHNA 4DL3A 4CJ5A 1X9SA 4E1NA 3KD5E 3EY1A 1SH3A 4FS2A
chains in the Genus database with same CATH superfamily
2R4FA 5KFMA 3PY8A 1KVIA 4E1MA 1FFGB 3H45C 4HTLA 4UOCA 4PUOB 4N7TA 4ECRA 4WQ4A 3T1YF 1FJGF 2HBJA 3SPYA 2LSNA 3HFKA 1NB2A 4H4OB 5GAHI 3CG7A 2CNNB 2O4IA 4KHWA 3QNOA 3WEEB 1D9AA 4QYZK 4G9ZA 3F9KA 2PA8D 1RYSA 3IM9A 3LUYA 4XPCA 1PBAA 4DSJA 5D3GB 1WC5A 4CERA 1T11A 4RU9A 3O5TB 4ED6A 4JYAJ 2P5OA 4FWPA 3TVZA 3CM5A 1GFWB 2RB7A 5HQMA 1KTQA 4WP3A 1S1TB 1DHMA 2BACA 4ZVSB 2OMOA 3OUYA 3ZX2A 2FHJD 2N3LA 2ZHAA 3L7UA 1TKDA 4IRDA 3T5JA 2OJ3A 3PX0A 4DCPB 4CO3A 1CLFA 4DV1F 4DV3F 4P7TA 2A42A 1JB0C 2XS2A 2IMWP 2W01A 4Y2IA 4J9OA 4JI4J 4FLTA 2HHSA 2YHYA 2DGOA 1H98A 4QJVA 4UT4A 4RW4A 2VOPA 1Y11A 2YNGA 5JVGL 2NRRA 5E0OA 4DF8A 3N6LA 1ZXOA 1W7AA 4LVOP 2D9PA 5J2MA 3K17A 3SUQA 1VRTB 5LL6Z 2J6SA 1NGFA 4H54A 2B4UA 5DM7Q 2W2NP 4LSLA 3PR4A 1DARA 1DQ8A 4MIWA 1NGDA 3KOAA 4G6VB 4DR7F 2V2VA 1U1KA 4KY3A 4XO0A 3CNQP 2B56A 4CEOA 3H2LA 3PEJA 4DR4K 4CGGA 4F7VA 1NZ8A 2HPUA 4OX8A 3D7EO 3I0RA 3GR0A 4JKCA 1JJ2M 2NXEA 1TZ0A 3PEHA 1T3VA 2YPZA 1DRZA 5J2NA 3CQYA 3PFEA 2E6LA 3CJKB 1KP6A 4TNOA 5GAEU 4CO1A 2FXUA 3FFIB 2IS3A 5T14A 4A8QA 1NDLA 1VDHA 2FJDB 2XC9A 2Z0GA 5DM7L 5F8JA 1MWMA 1AZSB 5JXSA 2KI2A 3CCEN 3WIVA 4X4TA 1ILYA 4YEAA 2YKMA 3OXLA 3Q2TC 2CPHA 4OZ1A 3FVYA 1XMQJ 2EW9A 4H4MA 3CWJA 1GLAG 4JKGA 1QE1B 3HSDA 5AQJA 2EFNA 3AVLA 1QVGM 3OT9A 2DGTA 4ED4A 3H2UB 3S6EA 3TRGA 3TZZA 2Z8QA 3LDQA 2AU0A 1VSEA 1KVJA 4U67L 3OD2A 4ZPVR 4I6MA 4UW2A 4LBHA 3VEXA 3EVOA 4JI8J 2NLWA 5K9FA 3HZ6A 3MF5A 3C66A 3OS2A 5HL7Q 4CEDA 3QB0A 4JN4A 5KFFA 3VEVA 3A8JA 4LFAJ 1HNIA 2I0XA 1HBUA 1HLWA 2QT7A 4ZLJA 3MEDB 2BANA 2F8TA 3VENA 1BD6A 2X3DA 5IQ6A 1N33J 1LW2B 3I55N 1O8BA 2CIMA 1SH0A 1GLJO 2YKQA 4C8LA 1D9DA 3PYFA 2LDYA 3CCTA 1OH8A 5A0YB 2B5JA 3MMAA 1O1WA 2G8UA 1N0VC 5KFQA 3DGVA 5KOXA 2I1RA 2OD6A 2A1BA 3I33A 3TJAA 3M9OB 4CZGA 5AQFA 4BC3A 3DRPA 3ZTQA 2ZUGA 3TSQA 3MDFA 6FD1A 4PG4A 3NLCA 4P72A 4JV0A 4I2PB 4DX8H 1QVFM 4O3PA 3T19A 1I3OB 9ATCB 4FCYA 4QWCA 1YVUA 2WVBA 1QQMA 1KQKA 3A2FA 3A5MC 1J27A 2ROPA 4X64K 3ITHA 3DJCA 4ZP6A 5B8HA 3RAMA 4HL9A 2HHQA 3QQCD 2DFEA 3CJRA 2J7KA 1VQ8N 3UR3C 1UOCA 1E6VB 4KHUA 4ECZA 4FF2A 5KT4A 4YOXA 3BO3A 4DUYF 4OZ2A 1GXLA 2BM0A 3L3UA 1Q79A 4A8WA 2HEKA 2HQ3A 4TY9A 5LJ3Y 3THYA 3Q7BA 2G0IA 1YSJA 4QIWD 4F4ZA 3O9TA 4KREA 4FVUA 3AVCA 2QL9B 4LR7A 5D78A 1VQLN 3PACA 5F9LA 4H0PA 3L95X 1HYZA 3CMAS 3ISNC 1YWXA 4IRCA 5F8GA 4NYOA 1WSIA 3U3GA 5JUMA 3RB4A 3OJUA 3BP8A 1JNZB 3WIUA 4X4OA 3VVUA 5F8IA 4AHVA 4KYZA 5EDWA 1JX4A 3MD3A 2E5LF 2NRXA 4ICLA 2NQPA 1HR0J 1HQEB 4WFAL 2YNFA 1XNRF 3OYNA 3WXKA 1SC6A 3LDNA 3V6DB 1E6VA 4KH1B 5GADU 4B9SA 4DR1K 1J6ZA 3AD9C 4CNZA 3BN7A 4M5HA 3J81O 2G8KA 4L73A 3JAMO 4WYLA 4YOVA 2WONB 3CHWA 4CO2A 3BGRA 5EHHA 3TNVA 1RT2B 3TZXA 2LXFA 1J2VA 3P4IA 2BJ3A 3DDNA 1RT3A 2HSEB 2E20A 2R7YA 5HQLA 3BS9A 4HLBA 2VGNA 4ZVUB 2P6TA 4P6QA 2J8AA 3DRPB 5ADXH 3SFGA 3L2RA 3I6PA 4KPCA 3V2UC 1JXBA 2D7SA 3PJ9A 2YH1A 1HBNA 3M8SA 3C14B 4WFNL 4DCJB 3CCSS 4CLKA 1RWXB 3FSIA 2MQQA 3OTBA 4FS1A 4J37A 2Y3YA 1LV5A 4YR0A 2UUAF 5AQLA 2G0CA 5KT2A 2V4RA 4QOTA 2JSXA 1SV5B 5FPNA 3DMJA 4CJ3A 1VSHA 2E9RX 3QFPA 1C1AA 2GAGC 1XMOK 3P5BP 4F26A 2KDOA 5IV4A 2Z1JA 1ITGA 1HIYA 3NEKA 4U67Q 1Q81O 5ETNA 2QA4S 2DRAA 1FRMA 2AGQA 1GXTA 2JZ5A 3VGUA 3SBTA 4C1NK 4BROA 2Q1LA 1VQNS 2VPWB 1S1WB 2X6SA 5KRTA 4P2MA 4H0TB 4ZKAA 4DL2A 3ENWA 2LU1A 1LW0B 5CCLA 3D5MA 4CK1A 4ZP7A 2ZNYA 4B08A 2YXLA 4JI0J 2DTUA 4Y6IA 2QMWA 1IM4A 3K5LA 2FC8A 4DSEA 4HDGA 4ZLNA 4F04B 4BRFA 4WKRA 4JKBA 3A13A 3THPA 4O44A 1HNWF 2HHWA 4C8KA 1HMVB 5DDPC 3B54A 2ZITA 2DNKA 2FVCA 3VGSA 3PR5B 1UJ4A 2R2RA 4NCGA 1SH2A 5I42B 1Y4ZB 1D8YA 4D3GA 4S0MA 2ZC4A 3PW0A 4FJ5A 1CZBA 3OSPA 2CXEA 1M5HA 3I4HX 4C98A 2UVWA 1ZH5A 3WT0A 4UQTA 3WUHA 1RT3B 3FCVA 2F4VK 3QGIA 4A46A 5K8MA 4ZJOA 2W8KA 1PBUA 2IBOA 1R8PA 1HKGA 2X3GA 1X4CA 1YK9A 1RT4B 2OSRA 4DR1J 2MXYA 3J81Y 2B5JB 3MMAB 4WU3A 3A8IA 1CJKA 4N8NA 3AD7C 4KHPK 2RPIA 3FMBA 4K0KK 1TL3A 1RYRA 4BE2A 2XG8A 3M5RA 1ZM9A 3J7YU 3IFRA 1ZAXA 2FZCB 1ZOTA 5KG5A 2PAVA 2W2OP 2D5RA 3K0SA 5DDQC 4GVBB 5KFDA 4BE1A 3VF6A 3PM9A 3I8DA 1YDLA 1WF1A 1FDAA 4DR2J 3AVGA 3EGNA 4JI6F 2V5HG 4DR2K 1FNXH 1NJIO 1M0SA 1HNZF 4NASA 4AFFA 1TL5A 3VQ7A 2W4DA 2PFFB 1S10A 5CAAA 4KHPF 5CA5A 5FD1A 1RHRB 1JLFA 3M9NB 3CFRA 4IDHA 1S0OA 4TN2A 1M1KO 5KRSA 5FLXU 4JI0K 4GO5X 4DS4A 5H9FK 2UUWA 1NDPA 3MOJB 5DG9A 2GHWA 2VYPA 1KVAA 2NYIA 3MCMA 4F8RA 4EEYA 1NCLA 2HG4A 2LQ9A 4K42A 3KKSA 4MYTA 3IRXA 4B3RJ 2VFRA 1FA0A 1FRHA 1FDBA 4KAIA 5LOQA 4O23A 4K4XA 3WXMB 4M3RA 4HHJA 1S1WA 1S6QB 2Y0BB 3TZWA 3HPHA 1EKSA 2W9CA 2YNGB 2P9SA 1ZYQA 4JI3J 1UEKA 5TKYA 3CJ0A 2HVIA 4JI4K 4J7CA 1FFWB 2OPRB 5IQQA 3NKYA 3M6WA 5KFOA 1ZBIA 1XBWA 2VHGA 3THXA 2ZJQL 1RWNB 2D0BA 1CJUA 3DXMB 4EAHD 4DR6J 1C0GA 5D4NA 2P9EA 3R6LB 2JFKA 1B0TA 3OR2B 2MB0B 5DQGA 4IH6A 2JGUA 3WC0A 2XZDB 4BG9A 4CZKA 3AVNA 3UCZP 3NFAA 2VL1A 2D3UA 2DY1A 4FJJA 3KFWX 5LSLA 4U7CA 3EICA 2QC3A 3I32A 1H2VZ 2WUSA 3M32A 4E3SA 3OYJA 2VBXA 3QT8A 1S1VB 3OYLA 5FRMA 1C0UB 4LQ9A 3ZZ0A 3CUNA 4MK7A 4DS5A 2GS8A 2LQBA 3L3VA 2FBVA 1WB9A 3AQOA 3HHLD 3CQXA 4QCLA 5AXMA 2L41A 5M1FA 2NUUG 3ZT4A 3W5XA 3DLEB 2DBBA 4TYBA 2RD5C 1IH7A 2WONA 3SUPA 5HRSA 1X4GA 2PMHA 1IBMJ 1S72N 3LP0B 5ETMA 2R7SA 4X2BA 3OBWA 4KHSA 3HBTA 5ETSA 2PMZD 2KVIA 3T6JA 1S9FA 4NO7A 1RDRA 2P9CA 3EVWA 3ICLA 3PCOB 3KJFB 5D0GA 1GMVA 5C15A 3LAMA 4DL0C 3R6GB 3TAMA 1RAFB 3KNGA 1M5PC 3H08A 2CNLB 5L38A 2CJXB 3KTQA 3L6QA 4Y1DA 4IO9Q 3C6TA 5KFSA 2ADCA 4C11B 1RWKB 1N32K 4MAKA 2QL7B 3OS0A 3Q8PB 3DDIA 3ZLJA 2O8EA 5MLCV 3HL8A 2IVYA 4LFBJ 4M5JA 2F4VF 3MMBA 4CEEA 3AVBA 1XNRK 5I3PA 5M2UA 4M63A 2FD2A 2X51A 2EWHA 4CHZA 3H5SA 4ISEA 1IKYB 3F2KA 2HQDA 4RLEA 1Q5VA 4LF7J 3GCWP 2IVMA 3KMSA 1WSVA 4WK3A 1UPPA 1RT7A 1IVZA 4M5MA 2HBQB 4Q5VA 1QVGR 2CQCA 7AT1B 3BPSP 1QHAA 3ZCMA 1IUJA 4KHMA 2J0QD 2JWKA 1YG0A 4LSNB 3AOBA 3QRRA 3D0PA 2CAJA 2CJ9A 4NLXA 1Q5YA 3MEDA 5CYMA 1Q86O 5D15A 4XEIA 3HSTB 3N4WA 2VQFJ 1LFWA 1DURA 3SQ2A 2RS2A 3TQEA 1K6YA 4JI1K 4CLLA 2ZVSA 1FWLA 2P9NB 2JVRA 4F25A 3HDSA 4XH5A 1Z6RA 3IR5B 2A3ZA 3J81U 3VQ9A 3PLAA 1N36F 2ATQA 4PUOA 1C4CA 2QFJA 1H1VA 4MH8A 4GVBA 1YI2S 3BH6B 4TKTA 4ZK7M 4L75A 1RAAB 4FNHA 3LP0A 2OH2A 2CH6A 2IVOA 3E66A 3LM2A 4B3TK 3PX6A 2FJAB 3TQ1A 1U2RA 2I6WA 2QYGA 2M88A 3ULEB 2OTJN 1K1SA 3LALA 3ZSVA 4TLQA 3F9MA 4H0OA 1CULA 2RRNA 4G1QB 1N5YB 5BPMA 4MKBA 2NSCA 4AHCA 4ZMMA 4A2AA 2B8PA 3WBZA 2CJBA 1KONA 5L39A 1HI0P 2MQ8A 3BR9A 1ZAWA 5C25B 3S41A 4ZS6A 3UQSA 2MHNA 4C3LA 4LMZA 5IS2A 4ZTJA 2CQ3A 4NCAA 3F44A 4YS2A 5KFAA 2CQDA 2D1KA 3QJLA 2VZ9A 4C6AA 4RW7A 3OTOK 1CSJA 3TO8A 1X4BA 2DXFA 3CJ3A 1FJ7A 2E5JA 4WTYA 4JV2A 4CJPA 1SL1A 1DEJA 1WHXA 4J9VA 2GHVC 1WKLA 4JV1A 1UMJA 1T05B 3UE5A 4E2FB 5LXRA 1T6CA 1S1UB 1XNQJ 1VQON 3HSJA 1BWVA 2Z58B 3HCXA 3NS7B 2E5LK 5CYQB 5H9EK 4IUFA 5IM0B 4GVMA 2IVNA 1Y5LB 4AHTA 1WSGA 1SB6A 5EOYA 3D3CJ 3DMJB 1X5SA 4DOZA 1YJUA 3IRXB 3EXCX 3OR1B 4PZVA 1XMOJ 4ZPTR 2H4WB 2PEBA 5I3UA 2VOOA 2EKYA 2RKIB 3HKZD 5ADZA 2DYAA 4M3TA 4DV4K 2VODA 4UZBA 1IBKK 2VWBA 3ZEUB 2QW9A 2CPEA 4X65K 3P6YC 2I7NA 1MN9A 3PYDA 4U7UD 4BG8A 3A8KA 3EE9A 4GMJB 4LQ3A 1YZ6A 5DGAA 2AIRB 4FZVA 1REGX 5AQWA 2YNHA 5BN9A 3MECA 4LR9A 5IT9Y 3OHAA 3V9WA 3JQJA 3CGIA 4WXWA 5HO4A 4ATNA 2LXUA 4QIVA 3O6QA 4CIFA 1BCOA 5DM6L 1GAOA 1VSFA 2VKRA 2VJUA 3ZETA 5KFGA 5KPTA 2SXLA 5C2GA 4CHQA 5EXWA 5LSOA 4DSFA 1B0PA 3SQ0A 2M8HA 1TU0B 5H1SV 4DTUA 5JS1A 3W3SA 1DY3A 1ACMB 2G1DA 1K0VA 3MXMA 2J7WA 3CMEN 2YWEA 1KTVA 1LWCA 5KFXA 4LSZB 2KFZA 2V8DA 3M30A 3J7ZT 3PRVA 2B9XA 1JLCA 4WYWA 3U1LA 2E6MA 1ZTTA 1VQOS 1ATRA 1D4XA 3OV7A 2HBMA 3NE6A 1UVIA 3GFXA 3GYXB 4F0KA 4Z2XA 4C8YA 3LP1B 4IBNA 1U09A 2ZZTA 2ZZNA 1WNSA 3QWUA 1JLBB 3NF9A 5FRNA 3VZIA 3ZFVA 3NAHA 4B3SK 1L3KA 1R43A 1QVFR 1HJRA 3BKUA 3SNNA 3EZWA 1NGJA 4WPAA 4LF7K 3P49B 4GV9A 1TQLA 2YX4A 1RILA 4ZCKA 2IDEA 4YOWA 2Q31A 1SVDA 1UCNA 2FBXA 2DRBA 3PUFA 5AXKA 1U49A 2OO4A 2BXJA 4DTOA 5FJ4A 2GVZB 5LJWA 4DR4J 1BUXA 4FJHA 1U6ZA 3OYCA 3TSPA 1EETA 5KFIA 2B4VA 3KHRA 1RJJA 4C97A 3MUTP 1FWKA 2HHXA 3CB4A 2GQ2A 3V4IA 3SAHA 4IKAA 2DHXA 3BY5A 3DYAB 1WACA 2HVZA 4FOIA 2BUPA 2VIHA 1U0HA 1T9XA 2VWKA 3A8YA 2QMUB 3ISND 1NPPA 4PG8A 4FYWB 3VESA 4B17A 3W8GA 2HLTA 4QWDA 5L1KA 2DGWA 2G8VA 3OHRA 3PJXA 1UEVA 2GIFA 2MLYA 3CTRA 2FLOA 1KDNA 1X4DA 4KB1A 2EVZA 3VQAA 3KK2A 2VPXB 1G99A 1IBLK 3NGRA 4JKAA 4KKOB 3VQQA 4CLPA 5I3UB 4OHXA 3US5A 1HI1A 1JNRB 4GMKA 1YTYA 2FGOA 2UVRA 2EC0A 4JK9A 1OVYA 2FYXA 5J2QB 4KHQA 1QZ6A 3I0SA 2GJFA 4QYZJ 4WFBQ 3KHHA 3ETOA 5HMWA 4DB3A 1HKCA 3CCUS 4DSIA 1OYDA 4DEZA 3O1BA 2ZGZA 3HI0A 3BZKA 1QTNB 3U27A 3MGJA 1PGZA 4PRFA 4KFBA 3EWGA 2V2QA 2DR7A 3RJMB 4YR3A 3QEXA 3LANA 4LFAF 1WUAA 3THWB 3CETA 3WQTA 4ZHRB 3G8TA 4CGDA 4DLGA 1Y7PA 3BGLA 1V5IB 3JYTB 1VOMA 4ETXA 3FDSA 4DV2F 1WAFA 3LDOA 2PN6A 2HMIA 1R89A 4RO0A 4ZPWR 1TK8A 1V3RA 2ZQBA 4ZN1A 4OKJA 3VF2A 2DITA 2G2YA 2OKQA 2C2MB 3LO3A 1WWHA 2BQ3A 4DV5K 4NL5A 2KKHA 2LQJA 2IA6A 1XUPO 2ASDA 2JOQA 3HO1A 4C3KA 3TTDA 1N5QA 3JSRA 1N56A 3KLFB 3GG1A 1G4CA 2GVDB 2KFYA 5DZ6A 3F73A 3FZ2A 4DU1A 4CK3A 5CXTA 3DLRA 4DV6K 2H65B 2Q3SA 4NX9A 4RWWA 3IXQA 5DDOC 2OEJA 2KO1A 1N5TA 3HJVA 3KJVB 1WAJA 2WB4A 4FVCA 3ZZPA 2J0XA 4WJBA 3T1YK 1WG1A 3OY9A 4KO0B 4CZEA 1WDDA 5F1XA 2ITGA 2XY7A 4KKOA 3M9MB 4JBCA 4NXMJ 2VCPA 1HPZB 4P10A 4A48A 3BQ1A 5GIOA 1HBUB 3TPQA 2O66A 5KG2A 1S0VA 1YBUA 2YKOA 1NJZA 5LMNJ 2MZTA 1NKCA 4K8RA 2IJNA 2XS5A 4YR2A 4MLEA 1HQUA 4KR0B 3H46O 1S49A 1UVLA 3OYBA 1N6QB 3ILJA 1RHQB 3EN9A 4LF9K 1S1XA 1BI4B 3CQ8A 4Z4FA 4B3SF 3GONA 4WIIA 4LUBA 4JKHA 4JI4F 3G4SN 4AF1A 2P9PB 3ZO7A 3RB6A 4FLVA 3U3YA 2CGJA 3TA0A 2VG7B 4DQRA 1E6YA 4LBIA 2F3JA 1RT5A 1SC3B 5AT1B 3MM6B 2JWNA 3E3XA 3QAUA 4Y2AA 1S6UA 3FJ2A 3QAEA 3GSDA 3CCLS 1TKZA 2UUCJ 2EK1A 4B3RF 1RAHB 1GMWA 5HVHA 2GO9A 1EWRA 3FRYA 3IGNA 4YORA 2P8IA 3K7RA 4BVOA 2KZMA 1AXQA 3D68A 3GPAA 3N0VA 2YX7A 2OIHA 5AZJB 3SBGA 2HQGA 3JQMA 2CJYB 3HVWA 3PTWA 3L3CA 1GLDG 3BKFA 3KD1E 4R8UB 4I6WA 4ANDA 4FJ8A 4HHUA 1Q7LB 2L08A 5BRHA 2DH9A 1HX1A 5DZ7A 1CLQA 2IFXA 5GAEI 2O8BA 2ILYA 2C1EB 3OL8A 3MAQA 3MN7A 2G1HA 3M8WA 3AQPA 3SCJE 4PXCA 4DZ6A 5SZTA 4BC9A 2GGPB 2Q97A 4DR2F 3UKUB 1HHQA 3OYIA 2XHCA 3NXZA 3Q2SC 1VSLA 3MAAA 3VGKA 3EGZA 3RRHA 1HKBA 3GSIA 2V0NA 3IWXA 2HF3A 3BUZB 2P9KA 3HPGA 2HBRB 3IA0A 4ZIVA 3IAM9 3GG0A 2AWZA 3FZBA 4CIEA 3O44A 2JEIA 2E2QA 4OPJA 3OL7A 4KJIA 1JMTA 4H0YB 3D66A 1XN9A 3G82B 1KD1T 3VCDA 5IWAJ 3M8PB 1ASUA 5GAGP 3BSOA 2HYIB 2KB2A 2CQGA 1YRXA 4GKKJ 3TTCA 2DFHA 2QG9B 4K8XA 2QM1A 4CK2A 1APSA 1RA7A 2MLXA 4M5KA 1SPBP 1HUXA 3CJSA 2P9IB 4CJFA 2HIQA 2A1RA 4CJ5A 2XQCA 3MUMP 2VV5A 4LF4F 4FS2A 3R5JB 4EUVA 5LMNK 5KT3A 4DV1K 4CDIA 3G96A 1HNVA 2H4YB 5KG7A 3KXDA 4DF4A 4CBXA 1HNWJ 2GQQA 2ZE2B 3TA1A 5HROA 1LWFB 1VSIA 3QT7A 2MZRA 5C7PA 3CC7S 4CESA 3MM8A 1RU2A 2Z2YB 1RT6B 3QRPA 4CW7B 1HWJA 1RWVB 5B09A 2FY1A 2P5VA 5B0BA 5B0FA 2F9JA 1ROFA 4C8ZA 5BN8A 4FYVB 4BRKA 3MM6A 2O8BB 2ABYA 3U4LA 3DLLQ 1D5AA 4ZVOB 1ZBHA 4YOUA 4O5BA 3M8QA 3L7PA 5ETTA 3CT9A 4LFCF 1TL4A 1I94F 1O13A 1GTHA 5JLFA 3VQCA 1FJGK 2XYPB 5AFUH 2XB2D 4Q8FA 4DV5J 2C2OB 4XDDA 2G0JA 5M1KA 1MG7A 5J1EA 2QYCA 2YPYA 2NCKL 2CADA 3C15B 4RNFA 4Z94A 5K14B 2I5JB 1NDKA 4LH4A 3KLIA 1KQGB 4BR5A 3GG4A 4E7KA 4ECUA 3OYHA 2F8HA 1X9WA 1FE4A 3G71N 2XY6A 1QQCA 1IG9A 3I96A 2KTQA 5AQSA 3OVBA 3HD1A 5ETPA 4XH4A 1C2PA 4F4YA 3PRDA 4J9NA 1SKSA 4FJMA 3GV8B 4O3SA 4ED1A 4MJKA 2UUBK 1RHMB 4KGMA 1T3OA 2Z2MA 3IS9B 4CI6A 4WFBL 4V1Ak 4A5AA 3A5OC 3O8MA 4OYWA 4TQSA 1C1CA 2V34A 6FDRA 5GINA 3KIOA 2CZ4A 3UKRB 5GIPA 1AZSA 1UPMB 5LY3A 1J53A 3M05A 1C6VA 1BLUA 3MM8B 2GV1A 4BRDA 1Q0NA 1N8RT 2WTUA 4AQYK 3QIPB 2V50A 1V3SA 4FN5A 1TV6B 5EY4A 4BRAA 4WE1A 1RDUA 1NK7A 1A5XA 1U1RA 5F8HA 3NGUA 2R7WA 3TAEA 3G10A 5FLXO 1T95A 2RVJA 1JCGA 1YJNN 1S9EB 1VMBA 3TVKA 2GX8A 3Q86A 5AE3A 2GQCA 3HOTA 3QJPA 4F02A 4JEPA 1P9YA 2VBYA 4RG8A 2RHSB 5DETA 4A4JA 2V8VA 3F5TA 2KFNA 4NXMF 1EZZB 1VHXA 1H74A 5G0RA 3CF5Q 3TU5A 4NLTA 1RDBA 5C10A 4AM7A 3OYGA 2ASMA 1BY9A 2HS0A 5KG1A 4AXIA 4BHQA 2LFVA 4FBUA 3NWRA 2VG6A 1CQNA 1QHTA 2BZ2A 3SXLA 1OH6A 4I6YA 2WBMA 2G2OA 3LW5C 3NNHA 5AJ3F 4CGHA 1Y10A 2AV5A 2WRMA 3DXKB 1SL0A 1WOQA 3S3NA 4EYIB 4CZJA 1ITPA 5JVGQ 2Q2RA 1S77D 3TP2A 1QTMA 1IBLJ 1CXQA 3CC2N 2V67A 5FIIA 5D0RA 3MM9A 1QUPA 2F8EX 2RIJA 5HATA 3DCAA 3MR2A 1S0MA 2Z2LA 1OVQA 3NGYA 3H7HB 1MU2B 1T3NA 4OFZA 4PYAA 4C0BA 1RFQA 1JKHB 4IH7A 1GH8A 2XO6A 1GMUA 1SJQA 4ZVRB 1YLXA 3T9ZA 2DPNA 3HVRA 5GAHP 4M42A 1UAWA 2O8DB 1YHQS 1NH7A 5L1JA 4LFAK 2C3UA 3AO3A 2XSJB 3UVJB 4DTSA 3VGTA 1TL1B 1MROA 3S8SA 1KKHA 4WU2A 1IBMK 4EFAC 3MCPA 2QV6A 1RHKB 1V3ZA 3KUGA 1REVA 2KL8A 2YHWA 2DNRA 5A2QY 1W2IA 4OLAA 1DZ5A 2E2NA 1YKWA 1OWXA 1QSYA 1T44A 3ETMA 2OTLS 1SKUB 3U1MA 4C3MA 2ZHOA 3LDLA 5FROA 3R27A 4Y2CA 2X1AA 2R7QA 2E1CA 2PZSA 2FHKA 4EP5A 2IMOA 1UKUA 3ELHA 4LBPA 1VBYA 3EO3A 5U47A 4I2PA 3M6XA 1KAXA 3HJFA 2QXLA 1XC3A 4Y2KA 5JMNA 4B3OB 3NP5A 3R3LA 3QEIA 3GU0A 2MHEA 3UIQA 4IFVA 3B6BA 2HZCA 1P8ZA 1XMQF 2GAHC 3KUHA 2PFDA 4DFJA 1Q7YT 3DRRA 2M3DA 2V68A 1C0TA 3ZX3A 5IT0A 1MWYA 2GA7A 3NNCA 2ASLA 2KRRA 4I4BA 3THWA 2M70A 2VGMA 1RKJA 2BR0A 1F3FA 2WC9A 4QW8A 3AGRA 4X4NA 4EHTA 1DTTA 2VF3A 4F9OA 3LPEA 1EXQA 2IA0A 3MM9B 3ZXWA 2RSQA 4OX9F 1RK8A 3KJVA 4BCAA 2W9CB 7FD1A 2VPYB 3AV9A 4RBTA 2BVZA 3WNHA 2C2KB 4YY3K 1JCEA 3CCJN 4B3MF 4LF6F 2P5GA 5JMVA 1NK6A 2E4LA 5HLFA 3NH0A 1YJRA 5AQHA 3GWCA 4FWSA 5DS7A 1CBKA 1VRUA 3TAGA 2DIVA 1ASWA 2VG7A 1S79A 1K9MO 5A6PA 1HFEL 1H6KX 1DQAA 2FHMA 1OPZA 2R8KA 2MDAA 2AX0A 3MCAB 4CHPA 4J9RA 4KGXB 2YWHA 1TAUA 2AJFE 2F96A 2K1RB 1H7XA 1W26A 4BR9A 3PIOQ 4GC7A 3FBBA 1HYVA 3KLHA 2VH7A 4QR1A 3H5XA 2O8CA 3CXCR 4W5OA 1LW0A 1S7IA 3D2FB 1IR0A 3MMCA 1E6YB 3BQ2A 4DV1J 2XI3A 3HHNB 1RDAA 1HARA 4OYAA 1VSDA 4A8FA 2QEXN 3VZHA 1RBOB 1UW9A 5K14A 2D0PA 1Q9YA 3M8RA 4TY8B 2DH7A 2AGOA 1O51A 5HSPA 3CJ8A 1S6PB 1YIJS 4H03B 3ULHA 4Z4EA 2CQ2A 4JYAF 3TX8A 1PAUB 1ZM2A 1SV5A 1HWIA 4NE9C 1UTAA 3AVFA 4F3TA 3POTA 5MAOA 4ID5B 4H4KC 3D6RA 4NCGB 4IO8A 3RG6A 3JAMY 3OLAA 4OL8A 4DL4A 5M2PA 2XZWA 2C2DA 5DMRA 4BREA 1JJ2R 2O8FA 4J5OA 4WF9Q 4M1KA 1SQKA 4FK0A 2RQMA 4URSA 2DPIA 2YJEA 4PL7A 1WC6A 1FKPA 1YJ9S 4NB4A 3O9SA 4PWWA 3R7BB 2OPSA 3CMAN 2RDIA 2DRDA 3SDEA 2G9OA 5KG4A 3K5OA 3K5NA 4B1WB 4E0DA 2EFVA 2DY4A 1XMOF 1VFJA 2XMAA 3NF7A 4DJBA 1OQ6A 2V8HA 1ASVA 3VHQA 5BR9A 2D1CA 4TQRA 1TL3B 4CF1A 1RACB 4CHOA 2FZGB 3V81A 4BR7A 1QAJA 4NLOA 3TUJC 3MDQA 4PPDA 2XMKA 4WCEQ 3DLKB 1YVFA 1B3TA 5F2RA 3GJTB 4O44B 3Q8QB 2QEXS 3EGWB 5KPRA 3J80O 3ULDA 3CC4N 3GILA 1KVBA 2K8GA 2WTFA 3DXSX 4B9VA 1TKXA 4FJIA 1VQKS 5HMXA 3R1HA 5KPZA 4KTWA 4GO7X 4F4WA 4DL6A 2OAUA 4DG1B 4KT0C 3L4QA 4WQ5A 4ZA1A 1Q8KA 4B3RK 4ECTA 3HSCA 2FZKB 5J2MB 3NGZA 1VQ6S 3BN4A 2MKKA 2ILZA 2ASPA 2UYTA 3CIMA 4L3NA 5CY4A 2QTWA 1QJHA 1HBMB 3CJQA 3O3FA 2Q1NA 3CDEA 4ZLLA 1Q53A 3TA2A 1P8GA 1DLOA 5M1PA 1MWZA 4F3QA 4DU3A 4KV8B 1QQOA 2WB1D 5EX5A 4K43A 2DGQA 1AA1B 1W2BM 1F3VA 1I39A 2H5IB 2LQ8A 1EP4A 3QATA 5CD4H 2F7VA 3EPGA 3RVCA 1V5VA 2R7XA 2PI5A 1JLFB 4OHWA 1FRJA 1IWAA 1WKJA 3QZ7A 3CJAA 3N4QA 3CC2S 2MSSA 2LA4A 2A2CA 4FDFA 2FJEB 1UWBA 4H5RA 1ZPVA 4HH0A 3NOCA 3PRBA 4OYIA 5DLFA 4QIGA 5D0EA 2N7YA 4DQ8A 3S7RA 1U1PA 2NREA 4HT5A 4MQ3A 1OPIA 4GV3A 2MZJA 3HFZB 5H9EJ 4B9MA 2NYHA 2C3PA 2HQFA 4BY9C 2HFVA 2ZBCA 4CD1A 3QJJA 1LEOA 3LZIA 1R0AB 3SSQA 3A12A 1C4AA 3SQ1A 2X78A 1BIUA 1B4SA 1TYQA 3G6ES 3OS1A 2B0GA 2A2DA 1RT1B 2CG8A 4DN9A 1Q78A 2W2PP 3CPWR 5GAHU 2QTDA 3G9CA 4OPAA 2ITMA 4OLBA 3TAFA 4NI2B 1RTHB 1FRIA 1IBKJ 2HNDB 2FBYA 1SJFA 2XGQA 4YB7A 2JH3A 4CZIA 2G13A 1BQNB 4TXSA 3PIOL 3SQOP 3TWHA 3ZNJ1 1BUPA 4IFEA 3NDKA 3P8BB 4C48A 3BBCA 1A0OB 1FO1A 1LCUA 4LRAA 3F0NA 2CQPA 1SAZA 2G8IA 2IRXA 2KHOA 3KVGA 3GFHA 2E7XA 4R0EA 1F21A 1VQLS 4AQYJ 2OZSA 4HTUA 3UD3P 2XCPA 2XLKA 2JWLA 2YY3A 3DN9A 2ZOMA 1N32F 3ASMA 3GIRA 3KUEA 5A76A 4EBEA 1LAWA 2H1YA 1D3WA 3R6MA 3LDSA 3WNGA 3KNAA 5ELZA 1D9FA 4IOCL 4FOEA 2O8CB 3CULA 3MM7A 1WSEA 1NMNA 2HWIA 4Z7CA 2KT5A 2EG2A 3GDQA 4KGKA 4CJ4A 4EU0A 1S1TA 3MMBB 1F9FA 3QLHA 2UUBF 4OX9K 2C2NA 3MI7X 3MCSA 3C6UA 2BA9A 1AUDA 2W4PA 4ELUA 4MO4A 3HTVA 3TUZC 5ADXA 3OQ2A 1P90A 2H51B 1EO1A 4KE5A 2DIUA 4IYQA 4C11A 3KK1A 4E7HA 2W6KA 4NI2A 1EKEA 5BJRA 1NGIA 3THVA 3C3LA 5HP1B 1N34K 2MKCA 2WK4A 1N34F 2N4CA 4NYPA 4M41A 4FXVA 3K8WA 2MKIA 2HHUA 2XMTA 2EBEA 4DI6A 3KHLA 4YN3B 4LF1A 1IKWB 1MU2A 5E41A 3MPDA 5HN0A 2RF2A 1EJ7L 3CJCA 2W42A 5AZIA 1LK5A 2J6UA 1NOZA 3DFEA 4LD0A 3C7NB 1FT8A 2AMCB 3QGHA 1HW8A 4QWEA 3NWGA 1L3VA 1IM6A 4Y28C 2QWQA 3W0LA 4KSEB 1HNXF 3MCNA 4CEQA 4HI1A 1KQFB 4IZ9A 3DGPB 3MECB 3RB3A 5AXLA 2R7VA 1WEZA 1F5BA 2ALYB 4QBUA 3KJNB 2VU5A 3CIZA 3KLIB 4QOZB 2WCXA 4Q7AA 4CM0A 2RDDA 2GIQA 3G8QA 2J4RA 2NRHA 1P1LA 4NPOA 4LY7A 4QR0A 1SKWA 3VN5A 2FJXA 5L8RC 4JI3F 1JL1A 5KFUA 3J80Y 4WFXA 1CXUA 4HDHA 4OLPA 4PKDB 1WC3A 2F65A 4FZYA 3ONQA 2DXDA 2W9BA 2E1MC 3DC2A 1R0CB 1CS4A 1U45A 4PCQA 3RMDA 3MN9A 3G6VA 4X4UA 3ZZOA 1RBAA 1JIHA 1ZS6A 2JLFA 2P9SB 1TL1A 4HT7A 4Y0WA 4IDKB 2OPPA 1JLAA 4M3WA 3C6UB 1WDTA 4U7UK 3HLUA 1X5TA 4P2FA 4OZLA 3DOKA 2DR6A 4Y2MA 2CDRB 3AJ2A 2HAIA 3OFEA 4ZVPB 4A62A 1MMDA 1XIQA 3ILOA 2YVSA 2Q66A 4P75A 3SQGB 3MWBA 3NBPB 2EFQA 3PKYA 3GV5B 1HNXJ 3TJ8A 3QFHA 3UPFA 3FZKA 3CFPA 5FLXY 4DTNA 3Q8VA 5HMYA 4W5TA 3CCQN 1CQMA 3KLEA 4BC2A 4H5TA 1S7HA 4DR4F 4NXMK 2DNGA 1XTZA 4OX7A 4K0KF 1RI7A 2CQHA 4UOFA 4QZVB 3A0IX 1VQ9S 4DPOA 4A8MP 4FWQA 1TL7B 4Y34A 2W40A 1CZAN 3M1VB 2J9DA 1RCHA 5DG8A 2IJFA 3QO9A 3MM5A 1G1XA 3CF5L 3D6HB 3KLHB 1HMVA 2WAQD 5D4OA 2E1AA 3N5FA 5C2CA 1RTHA 1BHLA 1Y3JA 3AAQA 2XGPA 2QIFA 1GLLO 4IXCA 3CC4S 3VQEA 3IAS9 4ZP9A 1U7LA 5AQZA 4E1JA 1EWQA 2M9KA 2P51A 2MY7A 1VRTA 3QETA 1LW2A 2VONA 3CYMA 3C94A 3G71S 5D77A 4J2BA 3E9OA 1HNWK 4J9QA 2IDLA 2P9KB 2IYIA 2E1ZA 1WHWA 1AB8A 3J7A1 4ED8A 2J0SD 3H4DA 4LF9F 1MWQA 2J8SA 2F9DA 2B7CB 5IT4A 3J8AA 1RTDB 3VF4A 3B4MA 2L9DA 1N33K 1YUWA 4JHDA 5KFZA 5M2RA 3LPUA 3ENVA 2AJ1A 5HQ8A 1M90O 4GY2B 1Z2LA 4BE0A 4EYHB 3V9XA 3O4WA 3ZYYX 4UF4A 2V9WA 1GT8A 4BLGA 2AJ0A 2E1PA 3O6WA 1RBRA 2W9BB 5AQYA 5BREA 3FCWA 2CQIA 4F2RA 4HACA 4OJ1A 1PC5A 2QFIA 2VD3A 3G25A 1HA1A 3AY9A 1WF2A 2YTCA 2D0AA 4ALZA 1TMJA 5HMZA 5F0WA 4QU6A 1FJEB 4BRQA 1XQIA 3ZT0A 4IO9L 3UN5A 1ZPWX 1VQ5S 4L76A 2FHJA 4ECXA 1AW0A 5IC6B 2QKBA 3DDKA 1K73T 3PO4A 3KLEB 4CD3A 2UUAJ 1NU4A 5BYSA 2Y9HA 3CE8A 1RKIA 4IO1A 4TSXA 4FYXB 1PAEX 2P9UB 1FEHA 3D45A 3TZYA 1RGVA 2P9IA 4W92B 4DG1A 1KN6A 2XMWA 1CC7A 3SJHA 2HHPA 1P27B 4ILHA 1GMWD 4DU8A 2NSBA 3CJ5A 3R2CJ 1J5EK 4IQXA 1DTTB 3THTA 3VEZA 4Q2MA 1T9YA 1VC5A 4RJVA 4DL5A 3M1FA 3PDNA 4RNNA 2Q43A 4YQWA 1HWKA 2XHBA 4KHRA 3FZHA 5DO2A 1T9UA 5MLCQ 4ELTA 2YKNA 5D0HA 5HP1A 2F63A 4EI2A 3PYGA 1SUQB 3MR3A 1YJWS 4DQSA 5EN1A 1Y00A 4BC7A 1AT1B 3RRKA 1VLYA 1FXRA 2A10A 2E5LJ 2E1YA 4FW1A 2XWXA 2BE9B 1Z25A 1FXLA 3KZBA 3DRXA 3VWSA 1HHSA 3AXKA 4WTOB 2CG4A 3GE1A 2ZH2A 3U02A 3QIDA 3E2EA 2FVPA 4DN0A 3O5BA 4FVMA 3L09A 3IN5A 2DH8A 5D3GA 1FNOA 1UW4A 2PI4A 2AYGA 4LF6K 2FPHX 1VQPS 5KT6A 3MEGB 3P5TL 4B9NA 4ILJA 2ZWOA 4OV1A 3DLEA 3UR0A 2QKKA 2IAJB 3CC7N 1XMBA 3NGKA 1VJQA 3LQVA 2MMYA 2AJ2A 2VG6B 1VRUB 3MCOA 4YB5A 4ZPCA 2IIRA 3M8PA 2R7TA 4HTIA 4XDCA 1FRKA 5A8KB 4ZIWA 5KFEA 1GOCA 3RAQA 1CG2A 4DPTA 4DR5F 5CZ2A 2W25A 3RRGA 4CJWA 1IKVB 2XHWA 3QESA 2QLXA 4M3XA 2RKIA 2CJQA 4BGBA 4W5RA 1KSPA 4IEIA 1KWMA 2C42A 2IM2A 2J76E 3THYB 2V9KA 1Z26A 3CCLN 1X1PA 1Q18A 2VQFF 4FL9A 4JI2J 4PABA 4EGLA 3EJMA 3UKUA 2VWJA 4CTAB 4NYFA 2HGMA 4YHHJ 3N5BA 1QDUB 3A8EA 3H1VX 3RW6A 4HYKA 3EXYA 3RWUA 1A7GE 4D3HA 4RU2A 5CZ1A 1RDDA 3MXIA 1UJ5A 2QWLA 1ULRA 1XHZA 2R42A 4PWUA 3O9RA 5LMUF 2GV9A 4PXBA 4FLYA 3VQBA 1VQ7N 1GTEA 3IG1B 1SS6A 5E3PA 1TYQB 2CPFA 1JLAB 4LF8K 1RXOB 2NLXA 3ENHA 4O4GB 5HRRA 3QPIA 4CHYA 2EPIA 4WFYA 3FEXB 2UU9J 2YKPA 3SEOA 4X4PA 4MO5A 1Q82T 3D54A 5GMKa 1JK9B 1KC8T 3HHEA 1SL2A 1C0FA 2P9LB 3GOIA 4JI8F 2J6TA 3NOGA 4C23A 3N4PA 3OVSA 1NGEA 5D6GA 2DCLA 4B3TF 2V6AA 3EVMA 4YNQA 1JJ4A 5F3TA 3O1LA 4BRHA 2GWKA 4TY8A 4IG3B 5ETLA 4F4AA 2IOCA 1Q95G 4K4VA 5BYRA 3SIPB 4H5VA 8AT1B 1LWFA 1X4EA 5K20B 4U9RA 3L2VA 4P74A 4LIRA 2YI1A 4Y00A 3GJSB 3S01A 1NPRA 1RNHA 3IBFB 3W64A 1FD8A 2HKEA 1UVMA 3NNAA 1YITS 5FPMA 3ENAA 4ES3A 3K89A 3HP6A 1IO2A 5DG7A 4JI6K 1OS5A 3S3MA 4R79A 3H1QA 3FRZA 1TVRA 4X65F 4DTJA 4ZJLA 4DZDA 4PAAA 4X62F 3EKSA 4OX9J 3OVAA 1XEZA 2XO7A 3PKMA 4WWSA 4MIBA 3SLCA 2CA9A 2XWYA 3KWGA 3I4PA 2VQEF 4RBVA 1FF2A 4MK8A 1VQ4S 1U6BA 2ZH9A 4DR7J 3C46A 1X3NA 4ZVHA 3J81j 3HK2A 4MYUA 4NLVA 1ZBUA 4FJNA 2MPUA 1UETA 4KIAA 4M7YA 3GYNA 8RUCA 4I6MB 2MLZA 3TAQA 4FK2A 1SKRA 3G6XA 4Z37A 2C3YA 2B43A 2P9PA 5L1IA 2DNZA 2HFZA 3DOLA 3UFCX 1RT5B 2AKWB 3WHIA 2N3OA 1BU6O 1JQGA 1NK4A 3NH2A 2OLWA 4PL8A 2HNDA 4AXJA 2RHKA 5KFBA 1BQMA 4V19J 5M1NA 4FPAA 4DV3K 3MFIA 3LPTA 4NXNK 4M3YA 1YQHA 1MLAA 4DV3J 2CPXA 5D8HB 4DR3J 1R27B 2V8PA 3B6OA 3RMAA 3HVAA 2UVVA 1G7CB 3NY0A 2N4DA 2AW0A 2C28A 1S99A 5ETOA 3CI5A 2U1AA 5C2FA 2G8WA 3H42A 1FEEA 1BA0A 3RR8A 4UY8O 1HYSB 2NUHA 2HURA 1U1MA 4DFPA 1HBOB 1YF5L 2CPZA 2WOMA 4M8LA 5HBMA 1VQPN 2FJWA 4JI7K 1VQMN 3MPUB 1WOSA 5I3QA 4H5WA 4PEOA 3SI8A 1KXPA 2UXBF 4DTXA 4AL5A 3TTFA 4NLWA 2ZBQA 4GVLA 4JB8B 1VSJA 1IR1A 1B7FA 4YUDA 3D6FB 3VETA 4ZHRA 3O3GA 3JYTA 5E33A 3PSFA 3R5GA 2ZJRL 4OKKA 3ENQA 2RRAA 1H7WA 4F4XA 1H2UX 4JI6J 2GW8A 1R6VA 2N82B 2ZJPQ 1IQTA 3FSYA 2CNOB 2DPJA 2C2EA 5SUHA 1HHTP 4K8ZA 4DV4J 2LDIA 5KFPA 4CJSA 3GZ7A 2KXNB 4ENOA 3K2PA 2XRIA 4FXWA 4PXEA 4CBUA 1PG5B 2OEMA 4OJ3A 1PYOB 2C2ZB 1PCAA 2H3GX 1WTBA 3I0RB 4JI1F 1IR2A 3ET6A 1YIJN 4K5RA 3BYRA 3FNNA 2Z1HA 3M30B 3O8WA 2QLBB 3AD8C 3CCJS 4BRIA 4NCBA 3VQ6A 1H38A 1WTFA 3CDUA 5HL7L 3FC9A 3FFIA 2UXDJ 4JYAK 1HPZA 4OZ0A 2QZ8A 4FWOA 4XIUA 2YV0X 2Z1IA 2NS1B 5AQQA 2RF2B 2LEBA 4KBOA 4I0WA 3ZZTA 2LECA 1WI8A 4H4MB 4ISFA 4EHUA 1JLBA 4ECQA 3DOLB 1K8AO 2FSJA 4A47A 2D4WA 2KG0A 2W7PA 1HYSA 2HQIA 5LXYA 4NLYA 3MK6A 3T1HK 4OO1J 5AXNA 1J5OB 2Z57B 1WC0A 2O8DA 3L7OA 3O08A 4EP4A 3R9LA 1DT9A 1X4FA 5IT9O 2E66A 3HZEA 1ICEB 2W9AA 2GCFA 2NXNA 2V4JB 3Q0AA 4CZHA 4W5NA 1VRQC 4NZ7A 3NCIA 5BPNA 3UD5A 1PSDA 3ZTRA 4BBYA 5A8KA 2ZFHA 4RR5A 1PJ5A 3IS9A 4CJ7A 1U1NA 2WSEC 4JI0F 3VMFB 2A3JA 3DWLA 5AZIB 2ZM6J 2ZJRQ 4HUFA 2EEYA 1XJWB 5M1OA 3CEDA 2RQKA 1FKOA 3V9SA 1GX6A 2MQMA 1TAQA 1S6OA 2FDNA 1N54B 4BR2A 4E7JA 4DUZF 4JP8A 4URQU 3EDRB 1NJWA 1SJ3P 5J2PA 2ALZA 4MLHA 2VG5A 4YDUC 3BB5A 3HX9A 1BL3A 2I5JA 2V94A 1DLOB 3LGHA 1X31C 3ATUA 4B1XB 3RB0A 4B1UB 4J9UE 2EI5A 3NG8A 4BRCA 1S97A 3KLGB 2Y1LB 3WXLA 2EFOA 3UD4P 3N79A 4WBFA 4CI0B 1Y5IB 3CJ4A 3SK3A 2IPOB 4JV5F 3QGPA 5BR8J 3H8YA 4ITSA 2B8QA 4AHSA 3TI0A 4BDPA 3WX8A 4UY85 1QY7A 1LQ9A 3ULEA 2NXCA 1JXVA 4LRDA 2YHAA 1RTJA 1B70B 5B0EA 1NU0A 3LWLA 3CDBA 1NUEA 3AVKA 3DLHA 5F3ZA 5HOOA 2QLWA 4M3ZA 1I94J 1VQ4N 4PQUB 4HVZA 3ZZYA 3BDPA 4FF3A 1UZHA 2CDQA 4B9QA 4CJEA 1BCMA 3E8OA 3U1NA 2ZKUA 3IM8A 3OXGA 3GV7B 3DXKA 5A8WB 2PE8A 2HNYA 3ALYA 3EX7B 3ZZZA 5IM0A 4CLFA 3PVXA 3N01A 4Q2LA 1DTQB 1K44A 4ETZA 4EBCA 1EP4B 1P9QC 1WG4A 1XNRJ 2NXUA 4ECWA 3IR7B 4LFBK 3MR6A 3HHLB 3TABA 2CZVC 4OI0A 3EZUA 3V6KA 3SZ2A 2YX1A 2EFPA 2HWTA 4K5SA 5SWMA 3MM7B 3MHYA 3CIPA 2DFFA 2BKOA 3QFUA 2E5GA 2DNNA 2W7OA 3NCRA 2IVPA 2D3O1 4E7LA 2RILA 1U4BA 1IJJA 3J7YI 3BEXA 1TUYA 4OI1A 3CM6A 3KLVA 3D0IE 1FHTA 3CJ9A 3P38A 4HVJA 1R0AA 2O8EB 5AR0A 5H1SQ 2DNHA 3VAJA 5K8OA 2WOMB 1S4EA 3VAKA 2DR8A 2OHDA 3M8YA 1M5SA 4ID8A 4E98A 2EC2A 3EDQB 1BISA 2UUAK 1NPKA 4NYNA 3CJ7A 3ZEUA 1BDGA 2MKHA 3HT3A 4N5SA 4OPKA 4DV0F 2ACYA 5KFTA 2BOAA 4CE9A 3FFKB 2EHGA 5AJ3K 2GWJA 2KLAA 2W41A 4KO0A 2BRKA 3U6FA 2WVEA 2HZVA 4NLPA 1BQMB 4ED0A 4DLEA 3BJYA 3UN2A 3C14A 3IUCA 3FCHA 3AAPA 1RAEB 3DLBA 1RBTA 2B6AA 4PWDB 3IWLA 3FZMA 4CJKA 2HB5A 4DTMA 2Y8WA 1KVCA 3MPVA 4QAGA 2HK3A 3VAIA 2YQ0A 3X3UA 3UVJA 3LP1A 1C0TB 3HRGA 1HQUB 3R5BA 1IWGA 2XSJA 4F0MA 2MZQA 4M45A 3PIPQ 5DDRC 3TYTA 2KJVA 4JKFA 3NAEA 2HW3A 5DLGA 4ZCLA 4USMA 1KEKA 1FD2A 3RU0A 2E5IA 3MTKA 2YWFA 4FM0A 4PKGA 2F1FA 1M1KT 3VAGA 4LF5K 2PO4A 1VQ6N 4I64A 3H40A 4X4RA 3QSYB 3SUOA 2NRVA 2NNWA 1I1GA 2CVEA 2PIIA 4LT6A 5C25A 3HM9A 2Q36A 2AZ3A 1VQSA 3JSBA 1AROP 3DM2A 1T03B 5T7LB 1Z1ZA 2G4BA 3T5KA 1D8ZA 1U26A 3P45B 2GX9A 5KFWA 3EE8A 1CULB 2OMLA 2EKNA 2IRYA 2CFXA 2DNYA 4CFBA 4DR3F 2YKNB 1MSWD 2E44A 2ZJQQ 2FUG9 5I4MA 1F5CA 1XERA 1G6BA 2NRZA 4USUA 3AA3A 1TKTB 1WSHA 1WJ9A 5THWA 2AD9A 2QA2A 1DJ0A 1FXXA 2ZEJA 1HBMA 2QA1A 3HM8A 2RNEA 2F5GA 2KVQE 2AJ4A 3MEEB 5GAEP 5DRKA 5CD4A 2L9WA 2GZOA 2HMIB 3G2XA 1M5VC 4FWKA 4X64F 3JB9k 1R8AA 2W7AA 4W4MA 3HXMA 4KAZA 1WN7A 4LF6J 2GBZA 4WCEL 3IC1A 1SJRA 3K59A 2QO3A 2VQEJ 4GC6A 4UUXA 2VC0A 3C2PA 1R8CA 3UCUP 3CD0A 2A6AA 2A6OA 1UVKA 4WQ4C 2GJ2A 4X65J 2M52A 1S5JA 1XK8A 3FLCO 3NH1A 1MDUB 2J0WA 4LRBA 2DGVA 4IG3A 1RISA 5A8RB 3TEHB 2VBWA 4A8XA 5CZXA 1FVQA 3L2WA 4KHYA 4JS4A 1NM1A 5GAGI 3U7JA 1NGBA 4DHYA 4A8YA 1X3MA 2KJWA 3OR1A 4P52A 1LWCB 2XCAA 1D09B 1N8RO 4OI3A 2DISA 1F9HA 1DBDA 1M1GA 2D74B 1SC1B 1HLUA 4ZTFA 3ZSQA 2KW4A 4UOGA 3MAAB 2ZC3A 4G3IA 2DNPA 3QWPA 1RSCA 4LREA 2UUBJ 2QK9A 3UW1A 3OTOJ 3CCMS 1M1HA 2DO0A 3ADAC 4B3TJ 2LXIA 2ROGA 1YBTA 4R5PB 5AQVA 4AL7A 2XNRA 1TL7A 2IM1A 5IOLA 4I7FA 1VHFA 3PJWA 4LF2A 4ISGA 4WYBA 3K58A 4OPHA 3PW4A 1ZBTA 5JS2A 4L3KA 1WOOA 1CJUB 3MEEA 1M5KC 4L72B 4IG0A 1FK9A 3PHTA 3UNYA 2YWWA 3QEPA 3KK3A 3WC2A 2WVFA 5KFHA 3CCRN 1PILA 1Y0HA 4KTQA 4F2SA 5JVHQ 2QX0A 1S6QA 3U8XA 1IKWA 1ZBSA 2OCEA 3UDVA 2G8HA 1DAXA 4YDUA 2RUSA 4ID1A 1T94A 3BREA 1NZAA 2IVFB 4B1ZA 5TKWA 2OTLN 3IRWP 2JEFA 2MQNA 3DXMA 4OZ5A 2LVWA 1Q4RA 3OFFA 3MN6A 2CQ0A 3LP2A 2WW8A 1MNEA 2QWMA 2A18A 2NZCA 1FJGJ 4O3QA 1H0HB 2K2PA 4U7BA 2E9ZA 4BS2A 1IBKF 4QU7A 4YHHF 4CGJA 3MN5A 2KRBA 5CHCB 4WXOA 4GKJF 5CE3A 4JI2F 1K73O 1XC9A 4PG5A 3RSEA 4O3RA 1S1VA 3W2VB 4H5NA 2RMLA 4J9MA 2YNIA 2GNKA 3G86A 4F4KA 4DV7J 1YXQA 2ATCB 2AYMA 2MY8A 4HWIA 1TUWA 4RNHA 1C1CB 2VICA 4USHA 1VQ8S 3P4UB 1YJ9N 4FLWA 1PC4A 4RW6B 3I56S 4DR5J 1HQ2A 2BDPA 1BHNA 1YX2A 4HH1A 4USKA 2UXDK 5E26A 2GEMA 2CVIA 4I67A 4HCCA 2XLJA 1IV0A 3K2YA 3VGLA 2HK2A 2E8AA 5F8NA 4QPTA 3NMAA 3VGMA 3UE2A 1JLEB 3ZTPA 2GMLA 1SBRA 4JKEA 3CD6N 5KFVA 1LNQA 1ELOA 3BGOP 4FW2A 4YDXA 4WFNQ 3NAIA 1Q81T 4Q0BB 5GMEA 3M2UB 3S1TA 2DK2A 1S9GA 2P9GA 1D1UA 3ZT2A 1VQNN 3RTVA 4L74A 1AFIA 3NF6A 1TGOA 1OH7A 5JJBA 2AYBA 4OKEA 2COLA 1JXEA 3RW7A 4WZQA 4RKUC 2AEFA 4NMLA 3AA5X 4IH5A 2FVQA 4ZN3A 4DPUA 4YMEA 3V9ZA 2E5HA 4ED3A 2YQ3A 3EZ5A 1KAZA 1RWMB 3TAPA 2PD1A 3G4SS 2FB0A 5GADP 4NZ0A 3JTOA 1RQ0A 2IBKA 2WBRA 3M2VA 4FM2A 3BQ0A 2F40A 2ZJPL 2RJZA 4I2QA 3D1HA 3FEYB 2XNQA 3CCRS 2YX6A 1HQEA 1CJTB 2HBZB 5AQNA 1VQ9N 2W4CA 4BQZA 3AXMA 2FJBB 2AF6A 5B7WA 1SZ2A 3NS5A 4JI3K 1YJTA 5GVQA 2GELA 2R8IA 1NGCA 1WEYA 3CJTA 1S76D 2DEIA 3SCIE 3SYZA 3PO5A 2ASYA 1SUQA 2WFBA 2YJFA 3BZCA 5F8MA 3E9PA 4P7VA 4ZP8A 4WIQA 2BJEA 2F4FA 4DV6F 1TELA 1PYSB 4JS5A 2OI2A 3TARA 1NG9A 2BJ9A 3PW2A 2HHHJ 4CFCA 3VF0B 3MR5A 4NMXA 3GCXP 1GNKA 2YWGA 2Y1IA 5AE2A 4RCHA 2V63A 1JLEA 2DCUB 5K8NA 2CPIA 5EUHA 4IJNA 5IWAK 3WXIA 5AE1A 4Q44A 3VALA 2ASJA 1K8KB 4QS7A 1BQNA 3KWIA 4NEYA 2AP6A 4W98A 2CQ4A 4CZFA 1UP1A 1RT6A 4DV5F 1N6QA 4ZVEA 2BJ7A 3OW2R 3DLKA 4FZXC 4XK8C 4E7IA 1JXLA 4N76A 1W9HA 3V81B 4LC9B 3K9JA 4IRKA 3BM7A 4DR7K 3GLJA 2ZE2A 2Q3PA 3CW2C 1I51B 4KRFA 4IOXA 3CFOA 1EQYA 4UOHA 3RSEB 4CFAA 3EGVA 1RTIB 3M2UA 2R2TA 2IC3B 3W65A 3W63A 2MKYA 2J9DE 1YTAA 2W2QP 3OBYA 4RWTA 2J9CA 4QIFA 4GRSA 4EWTA 3CCUN 2OELA 3VAFA 2Q0RA 4DCOB 4LF9J 3C95A 1WBBA 4C9DA 3H59A 4ES2A 2ETJA 4M63C 1BQXA 4HKQA 3M8QB 3NGTA 4FJ7A 4P2SA 1CJTA 3AO1A 3JSMB 3HHLA 1TK5A 2W1BA 1NXIA 1JJHA 1V6HA 1JLGB 4ZVGA 2RUGA 3KHYA 1QM9A 3ET6B 3VQTA 4B8CA 1ESVA 5A0YA 5KQ8A 3JAMU 1HBNB 3D2WA 4B1VA 1KBRA 2AEMA 4DXLA 2E7VA 2HNYB 2PYLA 2WW4A 1A9NB 1FW6A 2BGGA 2QSFA 2DEJA 3KKRA 2A40A 1YRUA 1PYTA 3SMPA 1I5OB 1NDCA 2ZWHA 5LT5A 3AB2B 3IMQJ 3MPWA 2HOEA 1RAGB 5KFKA 4ANCA 4H0VB 3CPEA 2XBPA 1KAYA 1SC4B 2P9LA 3AA8A 2CYYA 1G3OA 3QFWA 4CLYA 2R8GA 5J1PA 1YBAA 2NPIA 1WSRA 4DX7A 5AQUA 4K0KJ 1S59A 4IR9A 3J7YP 3L9ZA 2MTLA 1OY6A 4KFBB 1VQ7S 3UDLA 4FM1A 4DQQA 1HW9A 2APOA 1NJIT 2MJUA 3O80A 4CZLA 5HLFB 3OHBA 4U6PA 3M8ZA 4L6V3 4FP9A 3VEOA 4ILRA 1VK3A 1HPMA 3KG1A 2HHVA 3GP9A 5AQMA 1MN7A 3DLLL 4DV0K 2YQ1A 4NLDA 3HYFA 3NS6A 1TFYA 2PGCA 4MMOA 4IFYA 5HANA 4DQIA 1LXNA 2GUIA 4GKJJ 2RAQA 1FESA 1ATSA 3QZ8A 3A3OB 3V6HA 3KHGA 1U6FA 1VSMA 2QA4G 4FLZA 4LSLB