5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
3ZSWA 3HYFA 3AA5X 4YR2A 3O3GA 4DSJA 3QERA 3QIPA 3HVAA 3AVCA 3V1OA 1BL3A 4H54A 1X9MA 4KB1A 4ECYA 1UOCA 5J2PA 3QIOA 3OL6A 3CM6A 5HRNA 5L1KA 2KFNA 4RUAA 3M9NB 3T3FA 4CGIA 3DRPB 3I0SA 3DRSA 1SH3A 1T7PA 4KHNA 1Z4UA 3KLVA 1Q9YA 1QE1A 2VWKA 4Y3CA 4H4MA 3DOKB 2QKKA 4E19A 4LQ3A 4TQRA 4QW8A 3OJSA 3NBPA 3NF7A 5KRTA 1RDRA 1DTTB 1RTHA 4FZXC 5DQIA 4BWMA 1HQEB 1LWEB 4NLSA 1GOAA 1U48A 4ECVA 2ATLA 1RT2B 4ECXA 1J54A 4NLUA 4RUCA 1T05A 2VWJA 4DL3A 2R8JA 4TLRA 3DLKB 4MIAA 1TKXA 2YKNB 2DPIA 1LV5A 4O44A 4CK3A 1N4LA 3IG1A 4L8RB 4KV8B 1KVCA 3KD5E 4J9OA 1R0AB 2GUIA 1QSYA 1QTMA 2G8UA 1HPZA 5F8LA 4AHTA 1TVRB 1BCOA 3OHBA 3GV8B 2HNYB 1KFDA 3GV5B 4EBDA 2YNIA 3RAQA 4KI4A 1KHVA 4HKQA 3LWMA 1KLMA 4DLEA 4ED6A 3H4BA 3T5JA 4E7IA 5KFBA 3BJYA 4TY8A 2O5DA 3SNNA 1RT3A 3HO1A 2ATQA 3MECB 4ID5B 3MEEB 3LP0B 3IAYA 2J6UA 1U09A 1XR5A 4CEBA 3CG7A 2NUBA 3DYAA 3NCIA 3H4DA 1RBSA 1UWBA 4ELTA 1S6QB 2OH2A 1ZETA 3PVXA 1ZYQA 1TGOA 1U45A 5KG0A 3DLHA 3HKWA 1ZTWA 1TL3B 2IA6A 4OLBA 3DLRA 1SKSA 5D3GA 3NFAA 3V81B 5DGAA 1RT5B 4QW9A 3HP9A 3JSMB 4K4WA 1B9FA 4K4SA 3FRZA 4CK2A 1S9EA 3DOLA 4CFCA 1XWLA 2VG6B 4DSEA 2YKNA 1ZBIA 4B9LA 3OVNA 3RRGA 4IFYB 3KLEA 4CIFA 3LP2B 4YQWA 3C6UA 3IGVA 4K8XA 1BHLA 4FYDA 3JYTA 3NDKA 3CWJA 4FLWA 2BRKA 5SZTA 4WXOA 1Y97A 2BGGA 3T19A 3DYAB 3KHGA 2G8IA 1S9FA 5EWFA 1EX4A 2KFZA 4K4TA 4CECA 4QWBA 3A2FA 1W0HA 2KQ2A 4JS4A 3ZSRA 3M9OB 1ASWA 1N5YB 2E9RX 2UUWA 4YR0A 4DS5A 2BANA 2VG6A 2HVIA 1S9EB 4DTMA 3DRPA 3I0SB 4Z0UA 4ECZA 1VRTA 1RA7A 4CE9A 3V9UA 4ZPAA 5KG6A 2E6MA 1KTQA 2BR0A 4J9LA 2A1SA 4DTNA 4FLYA 5KFCA 3KLGB 5EUHA 3V9XA 1J53A 1ZBHA 4JS5A 2D0CA 4QWDA 3H2LA 3KK3A 3G0ZA 2PY5A 3QIPB 3KIOA 5KTQA 1VSEA 1NKBA 4HVJA 3VQBA 2HB5A 2DPJA 4E1MA 4YFUA 4ZP8A 3GIJA 3AVKA 3NH1A 4DU3A 4DLGA 1DLOB 4KHRA 3SPZA 2C2RA 3ZT1A 3OSNA 2R2SA 4W5TA 4BE2A 4NLWA 4FJXA 4I2QA 1KVBA 2FC0A 4WYLA 3SQ2A 1S1VA 4NCGA 1RDAA 3PW4A 4R0EA 4CJKA 3CVKA 3H98A 3VQ4A 4Y2AA 3AVAA 3QESA 4DWIA 3CJ0A 5KFTA 1LWCB 4QPXA 4Q8FA 5J2MB 2IM3A 4BE1A 2I5JA 3UIQA 1RTIB 4CF1A 4ZP9A 3C6UB 3ASMA 3MXMA 5JS2A 5CYQB 3OLBA 4ZHRA 4IFVA 1EETB 4W5OA 5KFVA 4BWJA 2W8KA 3SCXA 3SFUA 4J9RA 4IG3A 3PY8A 1T03B 2HHQA 4J2EA 1VSHA 3NBPB 3KLFB 4B9MA 4F4YA 3VQ8A 3I8DA 2WB4A 2DFHA 5SWMA 3RBDA 4EBCA 3TABA 2QV6A 4CJ4A 4NLGA 4B9SA 4FLXA 4E3SA 4XPEA 1QE1B 1KSPA 1D1UA 4CF8A 4EZ6A 5CYMA 1UWBB 4F2RA 1WSIA 1S6QA 4QWAA 4MQ3A 5DG9A 2Z1HA 4URGA 1ZTTA 3DLBA 2UUTA 4ID5A 5F9NA 3AA3A 2G8VA 4OKEA 2HWHA 3D5MA 3OYMA 1RT3B 5KFJA 3MR2A 5KFIA 3OYCA 2J6SA 3VQQA 3EPIA 3RR8A 5HP1A 4O3OA 4ZTJA 1I39A 1S9GA 4RW4A 4RW9B 3V6DA 3VQDA 1DTQB 2J6TA 4AILC 3NAHA 1SL0A 3PR5B 4Q8EA 4ED2A 5DLGA 3HPGA 2Z1IA 2Y1JA 2XO7A 2BQRA 2DFEA 1S0OA 1JLGB 3RB0A 3NGIA 2I1RA 3OL9A 1T03A 2ZD1A 3ZSQA 3M9MB 4UQGA 3RMBA 2HNZB 3RMDA 1EP4B 3SFGA 4FCYA 1FKPA 5F8JA 2ZE2B 2R2UA 1T05B 1WLJA 4PQUB 1C2PA 1HNVA 4FK2A 3ICLA 3S3OA 3V9ZA 1C1AA 2AGOA 2IAJA 5CZ1A 3DLGA 1WSHA 4BE0A 5KFGA 3PR4A 2YNHA 3SV4A 3MR6A 2KZMA 1NOZA 3Q8QB 3AVFA 3DM2B 5KFQA 3QNOA 4K50A 1NJZA 3F9KA 2OPSB 4ZPBA 2KTQA 5KFKA 3D0PA 3MXJA 4KHYA 4I2PB 4WZQA 1BQNA 2FVSA 2YHBA 1KLMB 4K8ZA 4YNQA 4EYIB 2JEFA 5KFAA 2HHTA 1Z25A 2BDPA 1BGXT 4O4RA 4TY9A 3IS9A 1C0UA 4FJIA 3TAPA 1LW2B 4H4OA 4KHWA 3QYYA 1RT7A 2R8IA 2F8SA 1RT1B 2AQ4A 4XIUA 4HUGA 3KK1B 2PZSA 1TP7A 2ASDA 5J2NA 4B08A 3SV3A 2IC3B 2OPPB 3ITHA 5HROB 3M8SA 2Z1JA 3Q8RB 3LZJA 4E89A 5KG2A 3U3YA 3I5AA 2WOMB 2W8LA 1KLNA 3RBEA 4AHUA 1NK0A 2D3UA 2ZKUA 1BIZA 4MH8A 3GQCA 1BQNB 2XGPA 1WNEA 1S1UB 4WFZA 3B6PA 3KLIA 4Z4GA 1JLQA 3D45A 3HSTB 3OYEA 1RCHA 1HYZA 1TQLA 1RTIA 4NYNA 1EKEA 4ECRA 3K57A 3M8PA 2CJQA 3DOLB 3FQLA 4K4XA 3V6HA 4IRDA 5KFHA 1VSIA 4FLUA 1RT4A 3N6LA 4CJPA 2UVWA 1A5XA 5K14B 5DLFA 4I9LA 3AO3A 4OKJA 1LW0A 1YVUA 3QGIA 3OY9A 3VQEA 4IH5A 1CSJA 4CJ3A 4PUOA 4Z4EA 2WCXA 3AVJA 5KT3A 2WRMA 4E1NA 3KKRA 2WONB 4KRFA 1BI4B 2B5JA 1C1BB 4HYKA 4EP5A 2HNDB 2RF2B 1T8EA 3KK3B 2AGQA 3IS9B 2X6NA 3OSPA 3QO9A 3KHRA 5KFRA 2PYJA 3N6NA 4PWDB 1C1BA 1RTJB 1J5OA 4JLHA 4RW4B 5KFSA 4M3WA 5L9XA 3OL8A 2RKIA 4NYZA 5J1EA 4R8UA 1MU2A 3QO9B 3K59A 3S3NA 1NK4A 1D8YA 3V9SA 1GOCA 4AHVA 4R5PA 1HPZB 4IDKB 3H5SA 4DQQA 4KI6A 4ICLA 2XY8A 4DTJA 2IM2A 2HMIB 2YNHB 5DG8A 1RBVA 1RT4B 4DG1B 3H40A 2FVQA 2E4LA 1B92A 4CEAA 5FROA 4KFBB 1Q9XA 4KTWA 2B4JA 3AV9A 2QKBA 4I7FB 5KG4A 1L5UA 4N56A 1CXQA 4CHQA 2UVVA 4ELUA 1VSMA 3NMAA 2IJNA 3ZT4A 5HBMA 1JL1A 3NF8A 3S3MA 2ASLA 3TAQA 4RNNA 4IG3B 3QZ7A 4B9TA 3HK2A 2P51A 3PW2A 1BISA 4NLQA 1ZBUA 3V81A 4CJUA 1ZBLA 1LW2A 1X1PA 3PJWA 5I42A 4EEYA 1SUQA 4Z4IA 1IKVA 1RT6A 3SYZA 3I0RA 5EU7A 4Q5VA 2AU0A 3L2VA 2AJQA 4IOBA 4NLTA 4FJHA 3WNHA 1NJYA 1D0EA 4IG0B 4DL7A 1B9DA 3NAEA 5DQHA 1TKDA 4RG8A 2XY6A 5J2PB 4OL8A 4F4KA 5KT7A 1FXXA 3KHLA 2W9AA 1HYSA 2HHWA 4N5SA 5KFNA 3H08A 3QNNA 4DU1A 1RT1A 1W25A 5DQGA 1J5OB 2OPQA 3TWHA 3KLHB 4KE5A 3NHGA 3CYMA 4MK9A 3E01B 4M41A 3RB3A 3KK2B 2XWYA 3AA2A 1RAJA 4FJLA 4C8LA 1NHVA 4GVMA 2BE2B 3H59A 3OYBA 5C24B 4IQXA 1RNHA 3NF6A 1R0AA 4FJ9A 3G6XA 4KV8A 1FKPB 2BQUA 3T5LA 1SH2A 4KREA 4KHMA 2HNZA 4XPCA 3GIIA 5T14A 2FLNA 3ZSOA 2B43A 1EETA 4CK1A 4O4GA 4YMEA 5C24A 1LW0B 2FLLA 4HUEA 4ZVFA 4ECQA 2YKMA 3ITHB 4KO0B 1LAWA 4IBNA 4CFDA 4CGFA 4DTOA 1XHXA 4JV1A 1WSFA 5DG7A 1L3TA 3PV8A 5EWGA 5F8GA 1NK6A 5HLFA 3SQ1A 3DMJA 1X9SA 1HNIA 4RNMA 4FZYA 4ELVA 3V1RA 2VG7A 1LWFB 1W9HA 3TAEA 2B6AB 3LP3A 4CHOA 3BSNA 4EP4A 3MR3A 4R8UB 4Y34A 2RKIB 4M3RA 3PX6A 3ISNC 4J9KA 3K5NA 3T5HA 1JLFB 3HXMA 2D0BA 3AVLA 3C95A 4O55A 2WOMA 1RTDB 5CYMB 4FJ7A 5D3GB 3V4IA 3D28A 4DL6A 4DSFA 3LPUA 2ZQBA 5C42A 3SZ2A 3GIKA 3C94A 3BREA 3I5CA 4Y1DA 3AVMA 2XCAA 4CESA 1RTDA 1FKOB 3MEGA 2YNFB 3RTVA 3WNFA 3ZSZA 2F96A 3KOAA 4HCCA 3LANA 4J9SA 4DTXA 4DQSA 3ISND 2C22A 3BSCA 2BANB 4QAGA 2KZZA 4W5NA 2Z1GA 1N5YA 3UDLA 4Q0BB 2BQ3A 3QINA 4Z4HA 4CEDA 5F9LA 3QGGA 3AVBA 4DQRA 4FJ8A 5K14A 3CFOA 4CHPA 5KFWA 1C0MA 1SV5B 2AWZA 1JLEB 1DTTA 4DSLA 3DLEB 2HMIA 4GC7A 1SL2A 5CY4A 3I0RB 3VA3A 1S10A 4F3TA 4C8OA 1SUQB 4F4XA 2YV0X 3MFHA 2D3ZA 3KNAA 3PO4A 1VRUA 4IH6A 2Q3SA 4M3TA 4JV0A 4RW6A 4O0JA 1LWCA 1S1UA 5EDWA 4CEOA 3SUOA 1CLQA 5KFEA 2GIRA 2JGUA 3VQPA 4IRKA 3KHHA 2IMWP 1JX4A 1I3AA 4DQPA 4I2QB 4U6PA 4GC6A 4RW8B 3OYIA 3OL7A 3OS2A 1L3UA 3O4QA 3KLHA 1EP4A 1DLOA 5KFOA 1NK5A 2OYQA 2RPIA 3U6FA 1JLCA 1GOBA 1A5WA 2V4QA 3MEEA 4ZPDA 4CHNA 5EWEA 3UPFA 1GX5A 3EZ5A 5J2QB 4CGDA 2G8KA 3DRSB 3ZT0A 1VSKA 3KMSA 3QLHA 3L3VA 3KLFA 2GBZA 4JRPA 3FFIA 1N48A 5KG1A 1HMVB 2IBKA 3K58A 4Q43A 2Y1IA 3AA4A 3MFIA 3KD1E 2OPSA 1ITGA 4OVLA 1NK8A 3T5KA 4WZMA 3NF9A 3SUPA 3KLIB 1QAJA 1KHWA 1TKZA 4YR3A 1SV5A 4LQ9A 4PA1A 1TKXB 4Y2CA 3RAXA 3CJ4A 3QEIA 2IJFA 2YNGB 3CM5A 4OPKA 3DLKA 5CYQA 4DQIA 4FJ5A 5F8IA 4RW8A 1TL3A 1TL1B 4RNHA 3JYTB 1WSJA 3QEWA 5CZ2A 4MK7A 1S1WA 5KFPA 4DFPA 1Q8IA 5KI6A 1LWEA 4F4ZA 5J2NB 2YNGA 2EC0A 1JIHA 2ZE2A 4OGEA 1S6PA 4DMNA 1N6QB 3OYJA 4HHTA 4ED8A 1JL2A 3IN5A 3LAMA 1JLAA 3EYZA 4CJSA 2ILZA 3SUNA 4CEQA 4I9QA 1TKTA 2FJVA 3LAKA 2FBXA 1CZBA 3PW5A 1HQUA 3IGNA 3NAIA 5FDLA 1DTQA 2QK9A 4CIEA 4FM1A 3FFIB 2JEGA 1VK0A 2G8FA 4OPJA 3LP0A 3CJ3A 2WK4A 2V4RA 1NHUA 2FVPA 5JUMA 3V6KA 4B9UA 1VSJA 5FRMA 3HL8A 3LPTA 2F8TA 2FJWA 2OA8A 4CJLA 3PW7A 4IRCA 1VRTB 4AHCA 1S1TA 4CF2A 2IGIA 2XRIA 2YNFA 4MK8A 5C25B 3OYKA 4FJJA 3KJVB 3H5YA 1RYSA 1JKHB 1WAFA 3SQ0A 2V9WA 1KFSA 3TQ1A 1RA6A 4CGJA 3NH2A 1REVA 3M8QA 1HQUB 2FBVA 4WYWA 1C1CB 1TL1A 4AHSA 3V9WA 3DI6B 4ZP6A 4O4GB 3NGYA 3LDSA 4CCHA 4FK4A 3NL0A 1S1XA 1XR6A 1TKZB 2VA3A 3OYNA 1N6QA 4CGGA 3LALA 4NLVA 3DI6A 1NNDA 4K4ZA 2XHBA 2QXFA 1VRUB 3FQKA 1TKTB 1RT2A 1ASVA 4CEFA 3HVTB 3BQ1A 1XI1A 3HPOA 3UQSA 1BCMA 4KFBA 4EO6A 2OPRB 2JEJA 4KTQA 1YVFA 4O44B 2XI2A 3RR7A 1J9AA 4E7KA 5L1JA 3OYLA 2W9CB 4RNFA 4KB7A 5J2QA 2IS3A 4DL5A 3GYNA 2HHXA 5KFMA 5E41A 3VQCA 4KTZA 4IKFA 1U49A 2XGQA 1SL1A 2VG5B 3QIDA 3CFPA 4C8NA 4IR1A 1RTHB 1X9WA 1UAXA 3ZSXA 4DFMA 1JLCB 1S1TB 3LWLA 4WFYA 4CEEA 3QGHA 3RRHA 1XR7A 4CJ5A 1NK7A 4KBIA 1REVB 3M8QB 2O4GA 4TY8B 4OKKA 4F50A 4FS2A 3QETA 4CF9A 5KGXA 2ASJA 5I3UA 4I2PA 2W7PA 4BACA 2YNIB 2W9BB 5KFXA 3G6VA 3SPYA 3QEPA 2R8GA 4CHYA 3CO9A 4Q44A 4KKOA 4ZVHA 1QSSA 4ZTFA 4O3QA 3IG1B 5T7BA 2UVRA 1TAQA 1OS5A 1NKCA 2GV9A 4M3XA 3AVIA 5JS1A 1JXLA 2PYLA 2OPRA 1BQMB 1QHTA 3K2PA 4RW6B 2HNYA 3MR5A 4LSNA 3HHKA 3QEXA 1L3VA 4Q45A 4BDPA 3BGRA 3LP2A 1S4FA 4IFYA 1T94A 3AVNA 5KGWA 3S9HA 4QWEA 4LSLB 5J1EB 3V1QA 1LAVA 2JC1A 2CKWA 4ID1A 1S6PB 5KT4A 2A1RA 4FM2A 3QLHB 4W5RA 4CJQA 2OZMA 1XHZA 4E7HA 4E7LA 4KAIA 2RDJA 3CJ5A 3SQ4A 4K4UA 3LP1B 3Q8PB 1XC9A 2C2EA 4ED0A 4BDYA 3E01A 4DFJA 3RB4A 4QWCA 4FVMA 3V4IB 4M3ZA 3CDEA 5C25A 4IR9A 3SUQA 1QS4A 1S5JA 4CJVA 1ZBFA 1IKWA 3MXIA 1YT3A 4J9QA 3AO4A 4GW6A 3ZCMA 5HRSA 5KFZA 3MECA 4TN2A 4J9MA 4R5PB 3HVWA 4Z4FA 3OLAA 4FJNA 4FBUA 2GC8A 2FBTA 3UR0A 3QZ8A 4CHZA 4O0IA 5KG3A 1IKYA 1HNIB 4TXSA 4RW7A 4CEZA 2G8HA 3M8PB 4KHUA 1C0TA 3ULDA 4DTPA 3HVTA 3LP1A 1IKVB 4FJGA 2HHUA 5KG7A 4Y1CA 2B6AA 1RYRA 3K5LA 1NJWA 2RN2A 4CERA 1JLQB 4E7JA 3H5UA 1IG9A 1WAJA 3FDSA 1JLFA 2D41A 2E9ZA 3KMQA 5HLFB 1S1XB 3TAFA 4G1QB 4LSLA 3TI0A 4M3UA 3DLGB 3G10A 2WHOA 4EYHB 3MF5A 4J2DA 4NYFA 1LWFA 4PY5A 3ZSYA 4CJTA 2G8WA 5KFYA 3BSAA 5KFLA 3AO5A 3NE6A 4CGHA 5DK5A 2UVUA 4Z4CA 3VQAA 1NOYA 4ED3A 1IKXB 4NZ0A 1UA0A 2W42A 4KO0A 4DTUA 3M8RA 2AGPA 2HWIA 2HHSA 3DRRA 4J9NA 4HCBA 2IDOA 4Q0BA 1K6YA 4H4MB 3KLEB 2DTUA 4CF0A 4C8MA 2XCPA 3HM9A 3PUFA 3BQ0A 3Q8SB 4FLZA 3RWUA 3ZSVA 1MU2B 3DLEA 4DEZA 4F4WA 1D9FA 1JLEA 1N56A 1TK0A 4O3SA 1S49A 3MEDA 2ETJA 2VA2A 1RBTA 2ILYA 3JSMA 4B9NA 4DS4A 1IM4A 3VQ7A 3P1GA 2GIQA 4LH5A 2HAIA 1NJXA 1HARA 4ZMMA 4NLRA 3TAMA 4WE1A 4FJMA 4B8AB 1JKHA 1IH7A 4DF4A 3DM2A 3P5JA 4TQSA 3SI6A 3C6TB 1WSEA 1QUVA 4B3OB 1RILA 2FJXA 3MEGB 3RMAA 4K4YA 3T1AA 1RT7B 4M42A 4RNOA 4WE1B 3MTKA 5KFDA 3HVRA 3PHEA 4CIGA 3CQ8A 2LSNA 4FS1A 4PQUA 1CXUA 1RBUA 2D0AA 4CFBA 2BRLA 4M45A 1GX6A 4NLXA 5KT5A 1YTUA 1HQEA 4M95A 2E9TA 3CIZA 4DSIA 4CJRA 3IRXB 1WN7A 4DG1A 3PO5A 4G3IA 2JLEA 4DL2A 1RT6B 2HVHA 4DSKA 3O4NA 4IDKA 3ALYA 3DRRB 5KT2A 1TV6B 1K1QA 4ED7A 1SKWA 4MKAA 4FW1A 1JLAB 3OYAA 4J9PA 4O5BA 4KHSA 3BDPA 4O3RA 3L2RA 1C6VA 1QAIA 3NGDA 3VQSA 2R2RA 4AHRA 4NCGB 1ASUA 4ZPCA 1HYSB 2EHGA 3P83D 2X6SA 3RMCA 1SKRA 5HROA 3E51A 1JLBA 3NH0A 1S48A 4J2AA 2W7OA 2HNDA 4MFBB 5KFUA 4EO8A 3GV7B 3HP6A 3HPHA 3BQ2A 2IM1A 3KKSA 3CFRA 4KHQA 3I5BA 4IG0A 4FW2A 4OLAA 3C6TA 4ECSA 2OZSA 2DFFA 1U4BA 5KT6A 4FZZA 2BE2A 4N76A 4DU4A 5F8MA 3FSIA 5L1IA 4QCLA 1I6JA 5C42B 2RDIA 2HHVA 1C0UB 4JV2A 3L8BA 4BDZA 3TARA 4NLPA 2WONA 2OPQB 3CDWA 5L1LA 1JXBA 4LY7A 1IKYB 3H5XA 4E0DA 4GMJB 4F2SA 1WNSA 1BIUA 1UA1A 1TV6A 1KVAA 1CZ9A 1TVRA 1JLBB 5J2MA 3NKYA 2XY7A 3KTQA 1BI4A 1IKXA 3OYDA 1NKEA 1QSLA 1F21A 4HUFA 4KAZA 2XY5A 3AVHA 4PUOB 1IO2A 4N47A 3EPGA 3TR8A 4B8CA 4DTSA 1NK9A 1TK5A 3PJXA 1U47A 5HBMB 4ICLB 1HNVB 1YTAA 2R8KA 2D7SA 4KKOB 3VQ5A 3KK1A 3AVGA 4CJEA 4KSEB 2IOCA 4OGCA 3VQ6A 3K5OA 2ZD1B 4MIBA 3NGZA 3HJFA 2F8EX 4M94A 4FM0A 3TVKA 4RU9A 4W5QA 1VSFA 4H4OB 3N6MA 3PX0A 3VN5A 3L3UA 3KK2A 4TYAA 4MKBA 1C0TB 2C28A 2V0NA 1HMVA 4URSA 3WNGA 4FJKA 4CJWA 3SJJA 4AH9A 5HP1B 4FLTA 4F3OA 4OJRA 4IH7A 1RBRA 2XC9A 2P1JA 3OYGA 1T3NA 3OJUA 3G86A 3SI8A 4DFKA 4RZRA 4K4VA 3DMJB 1HJRA 3OHAA 4ECTA 1MMLA 1RTJA 5FDLB 3AO2A 4KPYA 3VA0A 3TANA 4NLOA 5I42B 4DF8A 2XI3A 1L3SA 5DGBA 3L2UA 5F8NA 3OS1A 2B5JB 4FK0A 3MAQA 4ZVGA 1HYVA 4ED1A 1QQCA 3IRXA 4EBEA 2HW3A 2D5RA 3PW0A 4N41A 3OYHA 1RT5A 4MFBA 4ZHRB 4ZVEA 2E6LA 4IFVB 4LD0A 1S1WB 4C8KA 1S0NA 3G6YA 4QOZB 2VG7B 2IC3A 4LSNB 2FVRA 4TSXA 1BQMA 4ECUA 1TK8A 3KJVA 4B9VA 4G1QA 3O3HA 3WNEA 4RW9A 3V6DB 4DTRA 1S0MA 1S9GB 5F8HA 4U7CA 3O3FA 1KRPA 5DMRA 4FXDA 3BR9A 2JC0A 3VQ9A 4JRQA 3L2QA 4NRUA 2YKMB 4NLYA 3K5MA 4NCBA 4YP3A 3GILA 4DL4A 1K1SA 1D5AA 3OS0A 3V6JA 4JUZA 4EZ9A 1SH0A 2C2DA 1G15A 1KCFA 1TAUA 1FKOA 1O1WA 4O3PA 2JEIA 2R7YA 4F8RA 3GIMA 2X78A 3LZIA 1C1CA 3TAMB 3OYFA 1A5VA 3CJ2A 2RF2A 4HTUA 3KLGA 4URQU 2ALZA 4NRTA 4O3NA 2R8HA 2KW4A 5JXSA 3MEDB 3DDKA 1S97A 4B3OA 2FVCA 1FK9A 1RDDA 1Z26A 2AX1A 1EXQA 5KRSA 5FRNA 4LH4A 2VG5A 2R2TA 4NLDA 3QEVA 3L2WA 3CDUA 2I5JB 3RB6A 5HRPA 2DY4A 4X2BA 1IKWB 2W9CA 2ITGA 3B6OA 3BSOA 5HRRA 4J2BA 4CJFA 4M3YA 3TAGA 3AO1A 2IAJB 2EX3A 1S1VB 3ZT2A 1JLGA 1RDCA 1U04A 2YHAA 3ZT3A 1JXEA 4FLVA 3DOKA 3THVA 1VSLA 1HRHA 4CFAA 4ZP7A 2W9BA 2QE5A 4WFXA 3F73A 5I3UB 4H8KA 5KFFA 4RW7B 2P5OA 2X74A 1RDBA 4KB0A 2FLPA 3PX4A 5C5JA 4NCAA 4PWDA 3BGRB 2FBYA 4XO0A 2AX0A 4WXWA 2P5GA 4FBTA 2O4IA 4IKAA 3HT3A 1D9DA 3EY1A 3PZPA 4TYBA 4I7FA 3EZUA 2OPPA 1VSDA 1WSGA 2IM0A 4ECWA 1FK9B 2WTFA 5KG5A 3U3GA
chains in the Genus database with same CATH superfamily
2H9ZA 5C2DA 3EKUA 1IBMJ 2W25A 4CLTA 3L95X 3QIPA 3HVAA 3QERA 4H54A 4CD3A 3LQVA 1ATSA 3LM9A 2O8DA 4RUAA 2AJ4A 4USVA 2V2VA 4FXWA 3T3FA 4CGIA 3WQTA 1SH3A 1WHXA 3KLVA 5KPTA 1WJ9A 4X4OA 5EN1A 2XEXA 4S0MA 4DR6F 1ZPVA 2Y8YA 2EPIA 3O5BA 4Y3CA 3ID8A 3DOKB 4M5HA 1H7WA 4AQYK 5B8HA 1DURA 4EK2A 1BOTO 4LQ3A 1OY6A 1JJCB 2DXDA 3NBPA 2VHGA 3QAEA 1ZA1B 4BRNA 5AQNA 4BWMA 2RQCA 1U2CA 1LWEB 3AXMA 1VBXA 3MX2A 1GOAA 4KJIA 4ECVA 2NPFA 5C2GA 2L3MA 1J54A 4WPAA 4RUCA 2QEXN 4JP8A 1U6BA 2HGNA 2R8JA 4TLRA 4YN3B 1BD6A 1TKXA 5E84A 2HLUA 2C3MA 4K41A 1VRQC 2JLGA 3SJHA 4L8RB 2WB1D 4LR9A 4J9OA 1OY8A 3C8YA 1W2BR 1NJIT 4E2FB 4B1ZA 3W64A 1BCOA 4BRFA 2NZ4A 2G2OA 3OHBA 5FPEA 1M5OC 2E66A 2W2PP 3GV5B 1MLAA 2LCWA 3RAQA 4EMDA 3GG1A 1KHVA 3WQUA 1S79A 3NY0A 4HKQA 3QFHA 3H4BA 3T5JA 1NSPA 5MAOA 2VC0A 4TY8A 2CWXA 4JKBA 2V4JB 2ATQA 4ID5B 3MEEB 3VCDA 3LP0B 3WC0A 5K8PA 3J7AP 4A4JA 3G9CA 2JWKA 3CG7A 4NMXA 2NUBA 3H4DA 2FSJA 1RBSA 3QFPA 2VCPA 1S3XA 4OYAA 1ZYQA 4ILMA 4ZVQB 4X62K 2B56A 1X4AA 3DLHA 3A4TA 2CZ4A 3DHWC 2AYGA 3EE3A 2GMLA 1G1XA 4V19X 3JSMB 4K4WA 1A0OB 3C0BA 4CK2A 1S9EA 3PYEA 1YJNS 1XWLA 2VG6B 4B9LA 5SUHA 4CLWA 3RRGA 4IFYB 3KLEA 3I55N 1U02A 1RWKB 2QA4G 3AFGA 3AAPA 1BHLA 3R9PA 1TYQB 3CWJA 5F0UA 3TTDA 4UOHA 4M7XA 2BRKA 1Y5NB 4DPUA 5U47A 1CJVA 3I32A 4ZJLA 2P9SB 1URNA 3KDNA 5IS2A 3EX7B 5IC4B 3GG4A 1S9FA 2D1CA 4JI0K 2ZWHA 2KJWA 1Q8LA 3W3DA 2KQ2A 5FLXO 2QFIA 3HMJG 3OW2R 3M9OB 2N4DA 4PYAA 1HBNB 4DS5A 4BBYA 1OSCA 1QZ5A 1S9EB 4DTMA 4JI6K 2QSWA 1KTQA 2BR0A 2A1SA 4DTNA 4FLYA 1CPZA 2D0CA 2NLXA 4LVNP 1M1KT 2G1DA 3H2LA 5CCLA 3KIOA 1VSEA 3C15B 4G1IA 4JI7F 4BRPA 2GO9A 2E1ZA 2DPJA 3IDHA 4CI6A 3AVKA 4PPDA 1SVDA 3OTOJ 4DLGA 2P9KA 3BZCA 1NGEA 2Q2RA 3SPZA 3ZT1A 1M5KC 3KKFA 4DV2F 3C66A 4BE2A 4O0NA 3A5LC 2CPYA 1U8WA 4FN5A 3HFKA 3SLCA 1N5VA 2HF4A 5DRKA 5K5MA 2P6TA 4CJKA 3VQ4A 2EVZA 5AXKA 3FCVA 1KD1O 4HR2A 5KFTA 2QZ8A 1TUVA 2A42A 4BE1A 2B9EA 2I5JA 3VGSA 1W7AA 3ASMA 1GK8A 3M1FA 3OLBA 2ZOGA 3WUHA 4IFVA 1XNRF 1PYOB 3SCXA 3PY8A 1T03B 2HHQA 1V3SA 1VSHA 2CJAA 3NBPB 2EFOA 4F4YA 3I8DA 3TSUA 4R79A 2DFHA 3D2EB 5SWMA 1HI8A 2B7CB 4IOXA 4CZKA 2GQ2A 3EDRB 3TU5A 1VC6A 4FLXA 4E3SA 3MD1A 1QE1B 2DRAA 5M2RA 1D1UA 2OD4A 3BGOP 2GHPA 5CYMA 3N4QA 1S6QA 4QWAA 3WXJA 2LYVA 5AQSA 2Z1HA 5B7WA 2NNWA 1UWAA 2A18A 4HLBA 2UUTA 5F9NA 2OD6A 2Z2MA 2LEBA 4WIQA 3WIVA 2G8VA 4DQ8A 3N5BA 1KNZA 5KFJA 5KFIA 3OYCA 3CCJN 3DLJA 5AE2A 1C0FA 3S01A 5D4OA 3B4MA 1GLJO 1I39A 1S9GA 3ZZOA 3N79A 2WFBA 3O3LA 1CJTA 4HDHA 4AILC 3O1BA 2QXLA 3MX5A 4DR5K 3UE2A 2BQRA 3ILLA 1JCFA 1J5EJ 5J1NA 3A0IX 1EWQA 5CQGA 4USUA 3RB0A 2DNKA 3OL9A 3EICA 3ZSQA 4UQGA 2NSCA 3SFGA 4FCYA 1FKPA 4OI1A 2VDHA 3SSRA 3A5MC 4PQUB 1IWAA 2DGQA 3TUPA 1M5SA 2V7YA 3V9ZA 1YJWS 2ZJQL 3DLGA 1PAEX 4BE0A 1R8HA 1YRXA 3KG1A 3NGUA 2KZMA 3WZ0A 2I0XA 2ZHBA 4B3SK 3U27A 2AT1B 4V1Ak 5KFQA 3QNOA 2VQFJ 3BPSP 4USTA 4J7CA 2DHHA 3THPA 4DR6J 5TKWA 4ZPBA 5DO2A 4ZKAA 3WXKA 4JYAK 4DKWA 5FPMA 3UN3A 5GAGP 3MXJA 4LF4K 3TP2A 1DBDA 2WAQD 2WBMA 3CCSS 1BQNA 5H9EJ 2CQPA 2ZZMA 4DPYA 2YHBA 4XAKA 1KLMB 1GXTA 3ZX3A 1YRTA 4EYIB 3HSCA 1H3DA 2HHTA 1Y9OA 2APOA 3OFFA 2BDPA 3CCVS 2OEMA 2MKIA 3NMUA 3C14A 1U2VB 1ZA2B 2H3GX 2QX0A 2ABYA 3FBBA 4XIUA 1M5PC 4LFBJ 2PZSA 1RXOB 2Z58B 5J2NA 3AOCA 4B08A 1NM1A 1JJHA 3UD4P 5HROB 3SMZA 3BZQA 4K5RA 3KJQB 4E89A 2XHWA 3AY0A 3D2EA 5L8RC 3UB5A 4AHUA 3VTIA 4LF7K 2KJVA 2QJ3A 1BQNB 3UFCX 4WFZA 3TJ8A 1NDCA 3EO3A 5E0OA 3T9ZA 4DV5K 4JK7A 2BKPA 4U9RA 1CG2A 2J8AA 4Z4GA 3QB0A 3OYEA 1RCHA 1HYZA 2IY5B 1T9XA 4FPIA 4EGLA 2BM0A 3GFHA 3LA0A 3MTJA 3PKMA 1GH8A 3FQLA 3DOLB 3V6HA 5KFHA 4WFAQ 2O01C 1RWPB 3R6MA 3N6LA 1A5XA 4BS2A 5HI7A 4NEYA 5C7PA 2HFSA 1YTYA 5AT1B 3TSQA 4OMFG 2WBRA 4DR4F 4QR1A 3OY9A 2D1KA 4C0HA 1HNWF 4DUZF 2XS5A 4C2MA 3GB0A 2ZBIA 4IH5A 5A8RA 2C2OB 4Z4EA 1YQHA 4LIWA 2QWMA 2WRMA 4H0YB 2B5JA 2OSRA 4DU8A 4JYAJ 1T8EA 4FYXB 3NP5A 4ANDA 2VQFK 2JX2A 3OSPA 3KHRA 5KFRA 4OX9K 3H2UB 1DFDA 2L9WA 5L9XA 2ZH2A 3FLCO 3BKFA 4NYZA 2M52A 3S3NA 3AB2B 5I3QA 1NK4A 1HR0F 2BV3A 5F2RA 4HVZA 4GKKK 1FXDA 1HPZB 3H5SA 4JYAF 4L75A 5AQGA 1NDLA 4DTJA 1X4GA 2O66A 1YJRA 3LGMA 3HHLC 1F3FA 3H6EA 1RBVA 1RT4B 1FF2A 3VGUA 1OY9A 4CEAA 1WHWA 4KTWA 3AV9A 3G25A 4QQBA 1MROA 2BOAA 3NMAA 2IJNA 4A57A 1MMDA 2Y9HA 3NF8A 3S3MA 2ASLA 3W2WB 4ZLJA 4KQZA 1Q82T 3JTNA 3QZ7A 4B9TA 2P51A 1BO5O 3P3DA 3VEXA 5ETNA 5AQOA 4C8YA 4DZDA 3HF5A 4KIAA 1LW2A 4TU7A 5ETPA 1X1PA 3PJWA 1ELOA 4EEYA 1SUQA 1J5EF 1WEYA 1IKVA 1RT6A 5EU7A 3MDFA 4Q5VA 4NZ6A 1I3OB 1M5HA 4ZVRB 1TKDA 4JI1F 3HHNB 2XY6A 3GU0A 4RG8A 5J2PB 3DGPA 2Y0SD 3AQOA 4BR4A 2NRVA 3DXMA 5KFNA 3UD5A 1RT1A 4CDIA 2JFDA 1UPPA 3J7YI 1HKBA 1QVFR 2EFNA 3SCLE 3KLHB 2W40A 4ILRA 1TUYA 1SBRA 3RVCA 4KHPJ 1EWRA 1RAJA 2UXDJ 1NHVA 4GVMA 2BE2B 3OYBA 5IM0A 4IQXA 3NF6A 1R0AA 3T1YF 3G6XA 2L41A 2XG8A 3ZSOA 1UJ6A 3J80U 1EETA 3QAUA 3NNAA 1LKZA 2FLLA 3MPVA 2AJFE 3B8AX 1F5BA 4GVEA 1CJKA 2BA9A 4CFDA 1HBUB 1L3TA 5EWGA 2MZ1A 1P90A 3HCXA 5BN8A 3I4HX 1M1GA 3UVJB 4FZYA 3QJPA 4GO5X 1U1NA 2V8DA 4OZ2A 4EP4A 1YITS 3FRYA 3O08A 3OD2A 1ZZNA 4M3RA 2FIUA 4JI2K 1JLFB 3C95A 2VBYA 4IDHA 1VIXA 2WOMA 7FD1A 4FJ7A 4O23A 3MWBA 2CQ3A 3V4IA 5HMZA 4IO8A 1B70B 3LPUA 2ZQBA 2W01A 3A12A 3C94A 3BREA 3I5CA 4Y1DA 4WKRA 3HHLA 4JOUA 9RUBA 3H90A 3WNFA 2CPFA 4HCCA 1N5SA 3LANA 4J9SA 4DR1J 4DTXA 4DQSA 4DV5F 2BANB 1ZBTA 3LPEA 5A8KB 1BXNA 4LRDA 2HRYA 4Q0BB 1HLWA 1Q86T 2BQ3A 4Z4HA 4CEDA 3BV8A 5F9LA 4ZCKA 2EWHA 5K14A 4OJGA 1N8RO 4CZHA 2R7QA 4LR8A 5KFWA 1C0MA 3VEYA 4PXBA 2CGJA 4CO0A 1JLEB 2H5IB 2Q43A 4DSLA 2HMIA 4GC7A 1SL2A 2HG4A 5AXNA 3VA3A 1Q86O 1M90O 4C8OA 4LF5F 1SUQB 1FVQA 4DV2K 1TUUA 2LQJA 3Q7CA 3HSJA 1WI8A 2R7VA 2ZH9A 1Y0HA 1YGYA 2NXEA 4DR3J 4M3TA 4JV0A 4DR2F 4O0JA 5B09A 1N34K 1S1UA 1QDUB 2MKKA 3VQPA 1T44A 5LMUF 2ZJPL 3DFEA 3OHRA 4RW8B 3NEKA 3O6QA 5M1QA 1DQAA 3O4QA 4MJKA 1KD1T 3OR1B 3KLHA 4ID8A 3TWZA 2UP1A 2DNPA 2RUGA 3VGLA 1R27B 2RB7A 2RPIA 3NG8A 4LIRA 2BJEA 2ZHOA 4YOUA 3MEEA 4WP3A 2VQEF 2FPHX 4PXEA 4QIFA 2CNNB 2V2ZA 2K1RA 1EIYB 1K0TA 2DEJA 3KMSA 3QLHA 3L3VA 3TUZC 2CJXB 4U7UK 2DNOA 2L9DA 5KG1A 1HMVB 2NYIA 3R7NB 3J80Y 5BXIA 3EGVA 3MFIA 1N54B 4KGXB 4OQJA 1SPBP 1NAQA 5DDQC 3MCAB 3R1HA 3ZEUB 1DJ0A 1KHWA 3O2IA 1IBLF 4LC9B 1IN0A 2MJUA 4PA1A 2SXLA 1HKAA 4Y2CA 3RAXA 1R31A 5LY3A 2JHEA 4OPKA 4DQIA 3Q83A 3TR5A 1J27A 5KFPA 4RJVA 4DFPA 3Q7BA 4IXCA 3NVMA 4C98A 1VQPN 2YNGA 2E1YA 4BROA 1HKCA 3T1HK 1JL2A 2E1PA 3M2VA 3Q23A 3QFUA 1JLAA 5M1KA 2ALYB 4CEQA 1OYDA 3HBTA 2C2NA 2FJVA 3BBFA 3CXCM 1CZBA 1IBCB 3IWLA 2DHXA 3EWGA 3IGNA 3F5TA 1DTQA 2ZBQA 2JWNA 4JKDA 2MYFA 3FFIB 5GAEP 2HMPA 3S41A 2F63A 2G8FA 3FR0A 3HFVA 2G4BA 2OHDA 3DLLL 3CJ3A 3EUNA 2WK4A 2FVPA 4LFCF 1UP1A 1VSJA 3ZFVA 5L39A 2YWEA 1E3MA 1KEKA 1FFSB 1IVZA 4IRCA 3M6XA 4AHCA 4CF2A 2IVMA 4RUHA 5AR0A 3TA2A 4MK8A 3TX0A 3OYKA 1XUPO 3KJVB 2GQCA 3H5YA 1JKHB 1RYSA 3M2UA 3C65A 5BPLA 1VQ5N 4CD1A 1H7XA 3M8QA 2FBVA 3LDPA 1TL1A 5ETRA 1GAOA 4HHHA 4USIA 2JH3A 5A8WA 2H4YB 2CIMA 4FK4A 1P6TA 4WK1A 2O8EB 2UUBK 1HBOB 3OYNA 1RADB 4CGGA 3EMTA 3VZIA 5LL6d 3DI6A 2QL9B 4K4ZA 2XHBA 3A3NB 1EZZB 4AM7A 1TMJA 4DV3F 3M8WA 1VRUB 4B3MJ 3G87A 5AQHA 3BQ1A 1QM9A 1XI1A 3SQGA 2QLWA 2HHHK 2PA3A 1YVFA 3N28A 4MT1A 3RR7A 4E7KA 2B51A 4Y00A 3GYNA 3VQCA 4KTZA 4IKFA 4V19J 3C46A 2KM8C 2CQIA 4RPFA 4C8NA 3D6RA 3H20A 1NH7A 3ZSXA 1WEXA 3THYB 4WFYA 4XH5A 3FCHA 1E4FT 2QWPA 5FLXY 4UOFA 3ZEUA 5BRFA 2ADCA 2D3O1 3I9V9 4E98A 2FY8A 1REVB 3E3XA 1QTNB 3CMQA 2AP1A 2FF3B 4AL5A 3EKSA 4CRJA 2ZEJA 4F50A 4QS8A 1VC0A 2NCKL 4DCHA 4YOEA 5KGXA 1JMTA 5F0WA 2BOPA 5IT9U 1T11A 3CMAN 3G6VA 5KFXA 3QEPA 4X4QA 1VQSA 1WI6A 1FRJA 1Y10A 4NLCA 4ZTFA 3R7SB 3IG1B 5T7BA 2UVRA 1TAQA 1RAEB 5HANA 1NKCA 1ZBSA 2GV9A 4M3XA 3HI9A 2D4WA 1BQMB 4BRLA 1MW7A 1FW6A 3IR5B 2HNYA 4PAAA 3K8WA 1L3VA 3BGRA 2WZ1A 2E2OA 1S4FA 4IFYA 5KGWA 1Y11A 3S9HA 4QWEA 1Y3JA 3THXA 2J9EA 1LAVA 3V1QA 4UOCA 2R7SA 4ID1A 1S6PB 2A1RA 1HWJA 2GTDA 2OZMA 4FL9A 4E7LA 3SQ4A 4K4UA 2L9NA 3LP1B 2J76E 4WF9L 4BDYA 2ZWPA 4QWCA 2CPEA 3JTPA 4KGMA 4M3ZA 3EGZA 3MCNA 1LOUA 1NNEA 1AFIA 1IKWA 3FVYA 4J9QA 3AO4A 4GW6A 2DRDA 5J1PA 3C6AA 4Z4FA 2FBTA 2Q1NA 2HBMA 4CHZA 1IKYA 2AJ2A 4B3TJ 1HNIB 3H42A 3M8PB 1C0TA 1UW9A 3LP1A 3BR8A 1OJ4A 1NJWA 1KVIA 3VF4A 3PG9A 4CERA 4ES1A 4QU7A 3BB5A 4AFFA 1WAJA 1JLFA 2D41A 2E9ZA 3HOSA 3CEDA 1S1XB 3TAFA 3R8EA 1CBKA 4M3UA 1NM2A 2WHOA 2BJ3A 1YBTA 3QBWA 3LO3A 2IVOA 1QVGM 1RAGB 3CCRS 1HNXF 2RQ4A 4WU2A 5GIOA 2HQIA 2GIFA 3BSAA 2FGCA 4QIWD 5JVGQ 3SCJE 3VPZA 1R6VA 5DK5A 5H9EK 2N3LA 4Z4CA 3VQAA 4HHUA 3CSKA 1NOYA 1IKXB 4NZ0A 3UKUB 2YQ3A 4DTUA 3DRRA 3GBTA 4J9NA 2IDOA 4OZ0A 2MKSA 1K6YA 4GKJF 2ASYA 4PKIA 3IWNC 2NSBA 3NNHA 4N8OA 4QR0A 5E33A 3PUFA 3TW0A 2DRBA 1JLEA 3D68A 5HN0A 4O3SA 3Q22A 1W26A 4DS4A 3M6GA 3CCEN 1LEOA 4UZCA 3P1GA 2GIQA 2QLFB 2HAIA 5GIPA 5AZIB 4ZMMA 3QT5A 4NLRA 3H7HB 2HHPA 4ED4A 2Z30B 1PJ5A 1KQSR 1JKHA 1KBRA 2YKAA 4DF4A 1UEKA 4A59A 3P5JA 3ULHA 2J0SD 3C6TB 3MPDA 3Q8UA 1QUVA 5KOXA 4B3OB 2DVIA 3MEGB 3M8ZA 4M42A 4RNOA 3QMQA 5KFDA 1X4HA 1GLFO 1WTBA 1EO1A 2QLXA 3A5NC 4GKJJ 3CQ8A 2ZDPA 4USHA 4CFBA 3R5DA 1KS2A 5KT5A 4M95A 3O9TA 2E9TA 4G3IA 1YZ7A 3BO3A 3CD5A 2N7YA 5D8HB 4DSKA 4FWRA 2GX8A 4LFCK 3KNGA 4YOWA 4PWWA 1K1QA 2V69A 2ADBA 3V5RA 3A8EA 2XWXA 3OYAA 4WQ4C 4O5BA 4KHSA 1RZMA 1SCJB 4O3RA 2E2QA 1YJTA 1XMOJ 4DB3A 1HBMA 3VQSA 1HYSB 3P83D 2DR9A 1SKRA 1JLBA 1FEEA 3NH0A 4H5WA 3SMSA 4C48A 4W92B 4EO8A 3HP6A 1A7GE 3HPHA 2GELA 3BQ2A 3CFRA 1VQNS 4OLAA 2DNNA 2OZSA 1TZ0A 4JKAA 1RAHB 4FZZA 5F8MA 4HI1A 3MUVP 1ZM2A 3FSIA 2E2PA 3J8AA 2OTJN 1I6JA 5BPMA 4JV2A 3L8BA 5B0CA 1VAZA 3D6HB 1AUSL 2KFYA 3CDWA 4ITSA 3JQKA 3R5CA 3D2FA 3H5XA 4KH6A 2DITA 4BC5A 2VUGA 4TVAB 1UA1A 1PSDA 2P9LB 1TVRA 4AXJA 3VAIA 2VH7A 3EZWA 2JRSA 4A62A 4H0PA 3ID6A 1Z05A 1BI4A 1IKXA 5T7LA 3OYDA 1QSLA 3UNYA 2VDIA 4RR5A 3D3CJ 3TZYA 3EPGA 1NK9A 2PC6A 2J0XA 2XLKA 1Y5LB 1CJKB 1V5IB 4KGZB 1YTAA 2D7SA 3FE1A 4PEOA 3BYPA 3TVYA 3EE8A 3IMQJ 2VKRA 4JI6F 2IOCA 3P31A 4ETXA 1LXJA 3BH7B 3MCSA 2EEYA 1NWKA 4PCQA 1XN9A 4AM6A 3CJ9A 1IXKA 4ZOSA 1P9QC 1B64A 2FYXA 4YB6A 4X65J 1ZOTA 2I9SA 1CEZA 2DGWA 4CJWA 4GRSA 2ACMA 4LBHA 5HP1B 3T1HJ 4FLTA 3NRBA 3OYGA 2P1JA 3CCWA 2MEWA 1Z2ZA 4NXNK 3NWGA 4AQYJ 4FOIA 2UXBF 1WDDA 4RO0A 2P9IB 4H4KA 4JD2B 3BPDA 1KVKA 1XJWB 2FUG9 3SDEA 1RCXB 3AO2A 3MPUB 5C2CA 3W65A 4NLOA 4NWBA 1XBWA 1RAIB 2XI3A 2DBBA 4HDGA 5DGBA 4WP9A 5HO4A 2NRXA 4XDDA 2HQ3A 5HVHA 4FK0A 5HJXA 2V50A 3DXKA 2G13A 2UUAF 5LSOA 1OKJA 4OJ1A 4F26A 4ZVEA 2E6LA 2K3KA 2R7RA 5IM0B 3M8YA 2P9NA 4ZCIA 4QOZB 4I68A 4M5MA 3DXSX 2VG7B 5HATA 2FVRA 4TSXA 1BQMA 4LF7J 3FEXB 3AD9C 1GLDG 3KG4A 4P10A 1N0VC 4P52A 4DTRA 4C23A 1S9GB 1HD0A 4EAHD 1VJWA 3O3FA 4FXDA 5G0RA 1NMNA 4JRQA 4NRUA 2ZZTA 1Q18A 4NLYA 2PFUA 4NCBA 5AZJA 3GILA 1BA0A 1D5AA 3OS0A 3ZTOA 3QICA 4LBIA 4YUDA 1X4BA 1KN6A 2JEIA 1RWMB 2XSJB 1NGDA 2MHEA 3GIMA 3VAFA 2PFDA 2HVDA 1C1CA 4QPTA 3TAMB 1E6YA 1A5VA 4A8SA 2RF2A 4URQU 5HMWA 1P1LA 3PIPQ 4B3OA 2FD2A 2ZJQQ 4GVBB 1EXQA 4A8YA 1FJGF 1QUPA 5M2UA 3TZXA 2ZH3A 5BRHA 4EU0A 2AEFA 1KVJA 3O6WA 3SSQA 2H1YA 2GMJA 1S7HA 3CDUA 3ZC4A 3RB6A 2AIRB 4NXNJ 3B6OA 3BSOA 2OMLA 2QMUB 4DN0A 4JHDB 4CJFA 4M3YA 1GMVA 3AO1A 1MG7A 1KQFB 1UL3A 1S1VB 1HQ2A 3RYLA 2PMHA 1U7LA 1NSQA 1UVLA 5FD1A 2XQCA 2DD8S 3VAKA 4CFAA 4ZP7A 5AQLA 2G2ZA 3J7AN 4RW7B 2P5OA 2X74A 2IJRA 2IVYA 4A8KA 2YBVA 2HURA 3PX4A 2CYYA 3G8TA 3BGRB 4NPOA 1RISA 2P5GA 1BC6A 4IKAA 2OPPA 3AAQA 4X84A 4DCJB 2B4PA 4F04B 2EKYA 3AA9A 2IM0A 4ECWA 4QR2A 3TTFA 1FK9B 4FDFA 5K8NA 3MM7B 3ZSWA 4DSJA 3AVCA 2ZM6K 4KB1A 4ECYA 5DM7Q 4K0KF 3QIOA 4B1YB 2NRTA 2XMVA 5HRNA 2KFNA 5L1KA 5ETLA 2LXUA 4YOVA 3CDAA 2IVNA 2DCUB 3DRPB 3I0SA 8RUCA 1F2GA 1T7PA 3HD1A 2VWKA 4J9VA 2I2YA 2A6MA 3CD6N 2UU9J 1Q5VA 2QKKA 2LMIA 4IOAQ 3RSEB 2EG1A 3OJSA 4C8ZA 3W2VB 5KRTA 1Q7YT 3F0NA 1RDRA 3D3BJ 4N7TA 1DTTB 1RTHA 4FZXC 4YHHF 1PC5A 2PEHA 4CQ1A 1Q82O 2XMWA 1U48A 2ZC4A 2D69A 2GVZB 2LQBA 2K8GA 1W2IA 1VIOA 3K8VA 2OLWA 1T05A 2VWJA 3PIPL 4DL3A 1WORA 3R7BB 4MIAA 4JNEA 1JK9B 4IO1A 2RNEA 1ZM9A 2ASPA 2ROGA 4CK3A 3IG1A 4KV8B 1KVCA 1R0AB 1QTMA 2UU9F 3CPWR 4PZVA 1HPZA 4AHTA 1TVRB 1RAFB 2WUSA 1SC1B 2HNYB 1VBKA 2OTJS 4NLBA 4B3RJ 2WTUA 5AQQA 3WC2A 3T6JA 4ED6A 3IRWP 4E7IA 1M0SA 3OXGA 4LJMA 2O5DA 4DMZA 2Q3PA 4C9DA 4IEEA 1Z6RA 2WBNA 4CI0B 5FPDA 4JI8K 5EVZA 2J6UA 2HWTA 3ET6A 4H5TA 1EQ0A 3NCIA 3W8GA 2MDAA 1JJ2M 1S6QB 3PVXA 1TGOA 3ZETB 1T9WA 5DZ6A 4UOGA 2MZTA 1T95A 3HKWA 3EE9A 1ZTWA 5BJRA 2XNRA 4F4AA 1TL3B 3JQJA 4X66K 4U8VA 1DEJA 4OLBA 3NFAA 1HHSA 4GNIA 5DGAA 3AOBA 4QW9A 3HP9A 4NXMK 1B9FA 2GWJA 2XMTA 3OTOK 3Q8VA 3DOLA 1VQ5S 2P8IA 4DSEA 3VGMA 2UXCK 2DY9A 1NBWA 3IGVA 4FYDA 3NDKA 5GAEI 3ADAC 2QA4N 2Q0UA 3U1NA 1KR4A 2BGGA 2DY1A 4A8OA 3DYAB 2BJDA 1EX4A 4HL9A 2KFZA 4K4TA 3KZBA 4H0XB 1HHQA 4TLQA 1UJ5A 4DR3K 5HQMA 3ZSRA 3IWXA 3G4SN 3D6FB 4YR0A 2FLOA 2YWHA 2CGKA 2YWWA 1TL5A 2HVIA 2MLYA 3I87A 3DRPA 3I0SB 4Z0UA 3CCUN 1VRTA 1RA7A 3V9UA 3GL1A 2E6MA 3JAMO 2DNQA 3H0PA 5CHCB 4NO7A 5KFCA 3C14B 3V9XA 4JS5A 3KK3A 3KWMA 3ZNJ1 3G0ZA 1NKBA 1KAXA 4DUZK 5B08A 3CMES 5GAEU 4ZP8A 5ETTA 4KHRA 2X7IA 1S6OA 2JWLA 2AP6A 1C0GA 4I2QA 3UO0A 3SQ2A 1S1VA 3CCQN 4R0EA 3E1YA 3CJ0A 1X4FA 1LWCB 1U25A 1HNZJ 2Q6BA 4Q8FA 2YH1A 3HM8A 4HWIA 1SKUB 2HGLA 4BGBA 4ZP9A 3MXMA 1K8KA 5JS2A 4GO7X 5L38A 4ZHRA 1T9VA 1EETB 4W5OA 5KFVA 4DUYF 4BWJA 3UKRA 2W8KA 3SBGA 3SFUA 4IG3A 2GGPA 3ATUA 4Y2KA 2B8PA 2VQEK 4GV6A 1ZH5A 5F3TA 1D9AA 4NLGA 2HFOA 4B9SA 4XPEA 4EZ6A 3L7OA 2OIHA 2RUSA 3ETOA 2KYXA 3GSDA 3A8YA 2AYEA 5CYJA 4OZLA 3J81U 4DPTA 2HWHA 3D5MA 5GAHP 1RT3B 2ASMA 2JOQA 5DDRC 2N82B 3EPIA 4BRIA 2XSJA 3W1YC 5HP1A 1OIAA 1NO8A 4IWVA 1FFGB 3D2WA 2DPNA 1DTQB 1XC3A 4EWTA 1NRKA 3CJ1A 4OYXA 3LGHA 4Q8EA 4ED2A 3DKDA 2HGMA 2XO7A 2Y1JA 3OPKA 2DFEA 1PG5B 1T03A 2NYHA 2JVOA 1NDPA 1YJUA 3CCZA 2HNZB 4ZCLA 1UZDA 3VGKA 4X62J 3OR1A 2R2UA 4CLFA 4OPHA 2XYHB 3T6BA 5KPRA 1KKHA 1HNVA 4M7YA 1I51B 1F3VA 4AE5A 2V8PA 2UXDK 5CABA 5CZ1A 3MPYA 3GONA 1WSHA 1G3OA 5KFGA 4E8UA 1RBOB 3PR4A 1HNZK 5T7LB 2PFFB 3Q8QB 2E7VA 4CTAB 3P49B 3GCXP 2CQGA 1NJZA 4JI8F 2RRNA 5KFKA 4I2PB 4FO0A 3VQTA 2FVSA 4B3SJ 1XNQK 1YDLA 4YNQA 3PRVA 4F0KA 3W63A 3CT9A 4O4RA 7FDRA 4JI0F 3W9JA 5K20B 4YEAA 3LL3A 4BRKA 1YG0A 1LW2B 1HNWK 2GJIA 1NGIA 3I55S 4EI2A 1ZPWX 2UXBK 1YIJN 1LK7A 3DDNA 2AQ4A 1YSJA 3BBBA 3KXDA 2LA4A 3KK1B 1FJGK 2ASDA 3FBCA 4AT1B 3VTHA 3AODA 3ITHA 4LSZB 2Z1JA 4NI2B 3FBFA 5EX5A 2AYMA 3EVMA 5KG2A 3VHQA 1Y3KA 1GLCG 3A1YG 2O8CA 4WJBA 4MH8A 3GQCA 4DV1F 2PBDA 2F9TA 4C11A 3ZNUA 2D0OA 3E9OA 1JQGA 3U1LA 1EKEA 3K57A 3GZ7A 4DV6J 4IRDA 4QIEA 1VS3A 4CZCA 4NL5A 4B3TF 2DH7A 4CJPA 1TL7A 2UUAJ 3DOMB 3NMRA 4LF9F 4I9LA 5LXYA 5ITHA 3K7RA 3DWLA 1EKSA 4OKJA 4OX9J 3M1VB 4JK8A 2HFUA 1FWPA 4I64A 2FHJD 4UTGA 4JI7K 1G6BA 4P6QA 3W66A 1FCAA 2MQNA 2KHOA 1BWVA 4P73A 1HR0J 5KT3A 4KRFA 5BREA 4EP5A 3C15A 3KK3B 2DR6A 2LKZA 2GJFA 3D54A 3QO9A 2KT5A 3N6NA 4PWDB 2AZ1A 2BJ9A 4JLHA 2GO8A 1V3RA 1QVFM 2C2MB 3W2WA 1VBZA 5J1EA 2NXUA 4M5DB 1Z2LA 4Q2MA 3V9SA 3BKUA 2DNMA 2RS8A 4IDKB 4DQQA 3H46O 2XY8A 3QPIA 4CZIA 4BRQA 2IM2A 2HMIB 1FO1A 2RHQB 5DG8A 3BF1A 4DG1B 4JI5F 3PYGA 2E4LA 1CVJA 4ZPWR 3W7BA 5FROA 4CJ7A 1Q9XA 1H72C 2QKBA 4CHQA 1VSMA 2F9WA 3PSFA 4TKTA 2PEBA 3ZT4A 2RQKA 2YPYA 3NOCA 2J9DE 4YB1P 3HRGA 3TAQA 4EHTA 2DH9A 1MN7A 3HK2A 2UXCJ 3M6UA 3SAHA 3OFGA 2Z56B 1ZBUA 3N0VA 3IKMA 3KG0A 5AQTA 1WWHA 3I0RA 1NGBA 2PN6A 2BZ2A 1RUSA 2AU0A 3L2VA 4C4WA 4IOBA 2DHSA 5D0RA 4IG0B 4DL7A 2FXUA 2E5IA 4N77A 4F67A 4OL8A 4ILLA 2HBRB 4F4KA 5JJBA 5KT7A 1FXXA 4KHPK 2CDQA 2HHWA 4YHHJ 4DHVA 2GX9A 2OPQA 3N9UC 4U95A 5IOLA 4UT4A 3NHGA 2PO4A 5GAGU 1K9MO 5M1PA 3AA2A 4BC7A 1CC8A 3PEJA 2MZRA 3TJAA 2D0PA 1UZHA 1GMWD 5FJ4A 4KV8A 1FKPB 4KREA 4M5JA 4KHMA 2HNZA 1X60A 3FMWA 2QG9B 1K9MT 2FLNA 2B43A 1RSCA 2UU9K 2XSFA 2AKWB 1LW0B 4LF6J 3I9ZA 4ZVFA 3HJVA 2P2CB 3L7UA 2YKMA 3ITHB 3FUYA 3EL2A 1Q7YO 4CGFA 1GT8A 1XHXA 3MZIA 1WSFA 2BKOA 5DG7A 3TA1A 3PV8A 5F8GA 5HLFA 3DMJA 1XIQA 1WD6A 1HNIA 4ELVA 3GFZA 3ILIA 2VG7A 4USJC 4WK3A 1LWFB 4RWXA 2YX4A 4CZLA 4CHOA 3BSNA 3FBEA 2D74B 3NVKA 3MR3A 2VBXA 4Y34A 2RKIB 3LOUA 2BYCA 2BABA 4WBFA 3HXMA 3T5HA 4O55A 5K8MA 1XNQF 5CYMB 3BF3A 5D3GB 3D28A 1U2VA 1S59A 5C42A 4A8WA 2CVIA 1S72S 4A46A 1HFEL 1U0HA 3GIKA 4M8LA 2CQDA 2XCAA 4X65F 2QFJA 3MEGA 2XNQA 3CJRA 3RTVA 3KOAA 1ULRA 3QBXA 2C22A 1EQYA 3CIMA 4QAGA 2KZZA 2B9XA 5EX0A 3CC4N 2O8BA 1HNWJ 4DR2J 4BRHA 4B3RF 4FJ8A 3UKUA 1A6LA 2Y0BB 3CFOA 1RWOB 4J37A 1DTTA 4CO1A 1HW8A 1VHFA 3MMVA 2RT3A 3DDIA 4WTYA 3I0RB 2GJ2A 1S10A 3E9PA 4WCEL 4F3TA 3BGFA 2J9CA 2YV0X 3O9UA 4LRCA 1IBMF 2D3ZA 1N52B 3PO4A 1SQFA 3OUYA 2MY7A 3D67A 4JI0J 2J0WA 3E66A 4DUYK 4AL6A 4G1PA 2E8AA 1LWCA 1PCAA 2P9KB 2E1RA 3D9BA 5EDWA 3FZMA 4CEOA 4CNZA 1CLQA 5LMNK 2GIRA 2PIIA 1VQLS 1VISA 3KHHA 2IMWP 1JX4A 4DR7F 4DQPA 1I3AA 2IA0A 1Q4RA 3EDQB 4U6PA 4FPAA 3D1OA 2O8BB 2VFSA 4I6YA 2FZKB 5BR8F 2E29A 2V63A 3W0LA 4A8MP 1EP4A 4ZJOA 3DC2A 4JI5J 1NK5A 2FB0A 3L9ZA 1JLCA 1GOBA 2DXFA 3HHEA 3UNGC 2C1EB 1EX8A 2KU7A 1SJ1A 2V4QA 4ZPDA 4CHNA 5EWEA 2ZH6A 3WDOA 3VF6A 1GX5A 2U2FA 5J2QB 1VSKA 3UN2A 2IRYA 3D2FB 3BUZB 3KLFA 2GHVC 3FZHA 5FPNA 5BYSA 3MM6B 3ILJA 5DM6Q 4UW2A 2Y1IA 3KD1E 2OPSA 1ITGA 5ETQA 4B9QA 3KLIB 1LOTB 3SAGA 3EXCX 1HBOA 3R5BA 4YR3A 1SV5A 4YOTA 5A0YA 1HBNA 2IJFA 5IT4A 5IT0A 5JLFA 1G4CA 4KH1B 1HLUA 3P6YC 1BA1A 4RW8A 1N32F 1RKIA 4RNHA 1WSJA 2H65B 3QEWA 4MK7A 1ACMB 1S1WA 4DR4K 1DARA 1LWEA 3FEYB 2EC0A 4F4ZA 1JIHA 1SB6A 2KYZA 1S6PA 5L46A 4KBOA 1WC0A 3OYJA 2DIVA 5EXWA 3TTCA 3LAMA 3H1QA 4LMZA 3EYZA 2ILZA 2W6KA 2KB2A 2ZHAA 1TKTA 3GWCA 5A6WA 3LAKA 2FBXA 3BP8A 3PW5A 1HQUA 3J7YU 5D77A 4YB7A 2QK9A 2O8CB 1U1MA 1AROP 4K2XA 1VK0A 1P8ZA 3J81j 2K3IA 1FA0A 3JSBA 1NHUA 1VQMN 5FRMA 2W2QP 3HL8A 3LPTA 2OA8A 3K9JA 5ADZA 1UVNA 2AJ1A 1YJNN 3C16A 2XRIA 2YNFA 2M70A 1SJRA 5IT9O 1S6UA 1RA6A 3SSSA 4CGJA 4PWUA 1HQUB 5LMUJ 1C1CB 3UW1A 1APSA 3V9WA 2N4CA 5IZHA 3CC2S 3NGYA 2V94A 3T41A 3THYA 3CO0P 2IBOA 1TKZB 4P2SA 2MSSA 3AHPA 3LALA 4NLVA 3QWUA 2HK3A 2QXFA 4H5RA 3S8SA 4L72B 2WC9A 3FQKA 2VODA 1RT2A 1ASVA 4CEFA 1U6ZA 4P75A 1BCMA 3POTA 2OPRB 4ZLNA 4DX8H 4ER8A 2XI2A 5AQIA 4RNFA 3BM7A 5J2QA 1OYEA 3NGKA 4DL5A 1MA9B 4PRFA 1MWMA 1U49A 1SL1A 4L76A 3CFPA 4IR1A 4Z7YA 1X9WA 1RKJA 1UAXA 5AQWA 1S1TB 3UCGA 2NQPA 4CEEA 1H74A 3RRHA 1XR7A 3DJCA 4CJ5A 1TFWA 4JI4K 2C2KB 2VFTA 2WVDA 2CADA 3NCRA 2IRXA 4OYBA 4OKKA 1DQ9A 4FS2A 2DNGA 1Y4ZB 4CF9A 4YOYA 1S4EA 2ASJA 3MAAA 4I2PA 4NA3A 4DX7A 4CLLA 3MWPA 1WOSA 4K25A 3CO9A 4Q44A 4KKOA 3V4MA 3WX4A 4ZVHA 4KH4A 3BEGB 3R6GB 4MAKA 1OS5A 5G4DA 4YHHK 2ZH1A 3G2XA 2KHCA 3MR5A 2A41A 3CCJS 5K8OA 3HHKA 2F8HA 1VQ8N 1KTVA 1HX1A 4Q45A 1WBBA 3LP2A 1WKJA 4BR7A 4OJ3A 5LJ3Y 2BTFA 2MLXA 3OV7A 4JI2F 1YJ7A 4U8YA 3Q24A 5A76A 4W5RA 2O8DB 2VASA 1FJEB 3CC7S 3CJ5A 3W5YA 1T9YA 4ED0A 3MMAB 3RB4A 4FVCA 2PMZD 5C25A 4IR9A 4ES2A 3IXQA 1QS4A 2CQCA 2G0IA 4HH0A 4OI2A 4CJVA 1FE4A 4C7QA 3MXIA 3CJQA 3THTA 3I56N 3ZCMA 5HRSA 2JJ4D 4U96A 4F3QA 2V8HA 2QMWA 5C12A 3K89A 4DOZA 4FXVA 1DHMA 3QZ8A 4GKKJ 2FC9A 4Z94A 4I67A 2R9LA 1YIJS 3TPQA 4CLZA 4RW7A 3HSGA 4CEZA 4AUKA 1BUXA 2G8HA 1WDTA 3HVTA 2HHUA 5KG7A 4Y1CA 3MURP 1RYRA 3K5LA 4WCEQ 2PI4A 4E7JA 1FJCA 3FDSA 2IIRA 4CZFA 3KMQA 3THXB 3QT8A 1NZAA 4DCPB 1Q95G 2RRAA 2DJWA 4EYHB 4ISFA 4LF1A 3QRQA 1U2RA 3KUGA 2HBQB 4NXMJ 2G8WA 3E8OA 4H03B 5KFYA 3AO5A 1Q8BA 3BN4A 1BE4A 4CGHA 3TEHB 3UD3P 1NBEB 1UA0A 2W42A 2NRZA 4PG7A 2AGPA 2HWIA 2HHSA 3MCPA 3PFEA 2MQ8A 4EHUA 4HCBA 3ZZRA 1WUAA 4CF0A 4DV6K 4C8MA 3CJ8A 1VQ4N 3DLEA 4DEZA 3W9HA 2EBEA 2B9WA 2A40A 1N56A 1TK0A 1N33K 4WTOB 1NJIO 1S49A 2VA2A 1BQXA 4B9NA 1IM4A 5D4NA 1RWVB 5MLCV 1MSWD 1NJXA 1HARA 4CO2A 3LDLA 6AT1B 5AQVA 3MN6A 4B8AB 1WG4A 3DM2A 1FESA 4OLOA 3QT7A 3U02A 3SI6A 2V68A 1EARA 4BG9A 3B4DA 1NHKL 4K4YA 3T1AA 5D78A 3AB4B 2KL8A 2RMLA 2LVWA 2KG1A 4FS1A 1AA1B 4LF5J 1Q0NA 4PQUA 1GX6A 2FZGB 2VFVA 3PJ9A 1HQEA 1FFWB 2GHWA 3B54A 3CIZA 4DSIA 4DR1F 4DG1A 3PO5A 3CDBA 5AE3A 4B1XB 4Y2MA 3QSIA 2F5GA 1X0FA 3R5GA 3O4NA 1GTHA 4LF4J 1TV6B 1O5JA 3VGTA 2DEIA 4MKAA 2D9PA 1HHTP 3BDPA 4BC9A 2OFHX 1QAIA 3AAWB 1GLEG 2EHGA 1YJVA 3C7NB 3ENWA 4QJVA 3BY5A 2WSEC 2W7OA 1GLBG 1VQMS 4PG4A 2ZBRA 1XMQF 2NR0A 1RB0A 3MN5A 3I5BA 5HAOA 1O13A 4FW2A 2C3PA 4ECSA 5GMEA 4M5IA 3ZX0A 1FRXA 1V9OA 1Q8KA 1U4BA 1NLVA 1VQ9N 1AUDA 1VK8A 4DU4A 3HHLB 3A8IA 2J5AA 2LP4A 3S6EA 2ZJRQ 2LXFA 1C0UB 2VGNA 1RACB 4AL7A 3JS9A 1DGKN 4CVNE 1S77D 1WEZA 2Z8QA 2CNLB 3TNVA 2ZGYA 4GMJB 1PGZA 1MWKA 5DM6L 4JBCA 1VQPS 4OZNA 1BIUA 4R25A 1R0BG 3NKYA 1Q5YA 1O8BA 1JCEA 1RAAB 2CPJA 4KAZA 4PUOB 1IO2A 2IYIA 4KYZA 3PJXA 5HBMB 4CM0A 2C2ZB 4BQLA 3H3NO 1KQKA 4I69A 3DHXA 5AE1A 3AVGA 2ZFHA 3VQ6A 3K5OA 2CXEA 3VENA 3HJFA 2BMBA 4M94A 1RCOB 3TVKA 4FM0A 4IZ9A 1VQOS 4H4OB 1F60B 3PX0A 3VN5A 1CQNA 4MKBA 3P4IA 2C28A 4C1NK 3ENVA 3WNGA 1NSAA 4FJKA 4F02A 4M63C 2GAHC 1QJHA 3W3SA 4LFBK 5I9EB 5AXLA 4OJRA 4IH7A 1RBRA 2XS2A 2XC9A 2P9LA 4DBQA 3OW2M 5HMYA 5GADP 3G86A 5MLCQ 4OYMA 3SI8A 1OPIA 4DFKA 3GDQA 1NXIA 3UE5A 2LU2A 4K4VA 3DMJB 3OHAA 4A2BA 4DR7J 4DDFA 5FDLB 1ATNA 1RQ0A 3VA0A 1VR6A 5I42B 1TYQA 4DF8A 4P9SA 3LDQA 1L3SA 5F8NA 3OS1A 4KH5A 2B5JB 1AFJA 4OHWA 3CF5Q 4MIWA 3MAQA 4MYUA 1HYVA 2DGOA 4ED1A 5DM7L 3IRXA 4LF9J 4A47A 2HQFA 3PW0A 2MGZA 3OYHA 3IM9A 2YHWA 4ALZA 4C8KA 2CAJA 1YI2N 2MY8A 4QS9A 2OGUA 3ZTPA 5LJVA 2DTJA 3R6LB 4F7VA 3BYRA 1PIEA 2JZ5A 4TNOA 1ATRA 3DN9A 3KJVA 3O3HA 3CCVN 1KRPA 3MWTA 5DMRA 2JC0A 4LFCJ 1NH8A 3MOZA 2YKMB 4IQMA 3WXMB 1HWUA 2OSQA 4P2XA 3MM8B 1Q78A 4YP3A 4DL4A 2CFXA 5D4PA 2B4UA 3OVAA 2W4CA 4DV4J 3DU6A 4ZVSB 4EZ9A 1PYTA 2C2DA 3ENOA 1TAUA 1FKOA 1T9TA 1O1WA 4O3PA 3HI0A 4CH1A 2Q97A 3ONQA 3AGRA 4ILGB 2QYCA 5A6PA 4OZ3A 3CJ2A 2YWGA 3KLGA 4O3NA 3MEDB 3DDKA 1H2UX 2FVCA 3NNCA 1YRUA 5FRNA 4ZA1A 3JSRA 2XMAA 4LH4A 2VG5A 5AQKA 3VVTA 3PLAA 2Q36A 2EFGA 4NLDA 4JI4F 2I5JB 5HRPA 4CTAA 4X64F 2DY4A 2W9CA 4X4PA 3X1LB 3CF5L 2VL1A 2NPIA 2EWSA 1WC4A 2KVIA 3NGTA 3US5A 3UR3C 1FWLA 1FEHA 2IAJB 5HOOA 4CT8A 2EX3A 3ZT2A 2ZGZA 3HFZB 3VV2B 2YH0A 4GKJK 2X3DA 2BJ1A 1AT1B 2JL9A 2W9BA 1OH6A 2QE5A 5I3UB 4H8KA 3R8YA 2ZITA 1R59O 2GW8A 2CVEA 3NS6A 4C3KA 2M5YA 2FBYA 3O8WA 4NI2A 1NB2A 3AD8C 4DV7J 3UCZP 3IBCB 1KC8T 1D9DA 3EY1A 3PZPA 3PDNA 3VALA 1VSDA 1GLAG 1U1QA 4DPOA 1KOHA 4ISEA 1U1RA 2XBPA 3Q89A 2XTJP 5KG5A 1H2TZ 4OLPA 2PSZA 3W2VA 2ACYA 1P1TA 4BRCA 2KLAA 1X5TA 3HYFA 3AA5X 2WSCC 4A48A 3V1OA 4WFAL 2VBZA 3R5AA 2ITMA 1X9MA 3CMAS 3SBMA 1R8CA 4O8KA 3OL6A 4BQZA 2EBGA 1J2VA 3M9NB 2CRLA 3J7Z5 4P2MA 2PE8A 4KRWA 4PABA 4DJBA 1Z4UA 3CCRN 4KHNA 3U8XA 1RHRB 1QE1A 2BE7D 1UFWA 1OPZA 4OV6A 3W9IA 3PACA 4H4MA 3CPWM 2RQMA 2IDEA 1GNKA 4TQRA 1N36J 3PM9A 4ZCMA 3NF7A 1AB8A 3M2RA 1Q81T 5B0FA 4ZVOB 5KQ8A 3CQXA 2OI2A 4MDBA 2F7TA 4QYZJ 2AV5A 2YWKA 3POTB 3RRKA 1VDHA 3W5XA 4JI3F 1K8KB 4ECXA 2LFVA 3FSYA 1VQ7S 1RABB 4NLUA 1FXRA 1SQEA 1UKUA 4UY85 2V51B 1OH7A 2YKNB 3OTOF 3D6TB 1X3NA 1ROFA 1N4LA 2F7VA 1V4SA 1EB0A 3KD5E 2GUIA 1QSYA 2HRTA 5F8LA 3PXGa 1S57A 1ZM4A 3GV8B 1KFDA 1ZAXA 4M5DA 2YNIA 5FLXU 4JKEA 4KI4A 1JCGA 1F5CA 3VOVA 3OBIA 4IYQA 3L4QA 4DLEA 3NXZA 1JJ4A 5KFBA 5A8WB 4LREA 2IFXA 1Q1KA 2KDOA 3SNNA 1RT3A 1SIWB 1Q16B 1FNXH 3HO1A 3MECB 2R3VA 2IVFB 2CG8A 4LFAF 1XR5A 2B8QA 2BBEA 2F4VJ 4CEBA 3H25A 3CD7A 3DYAA 4HHJA 2DHGA 4CZMA 3MK6A 2EFPA 1YWXA 4RL1A 2OH2A 1ZETA 3I96A 5H1SQ 4FWOA 4DV0F 2IA6A 2BKNA 1SKSA 5D3GA 3TJ9A 2E5GA 3ETMA 4QBUA 3FRZA 2UUAK 1ZBIA 1OSDA 3OVNA 4CBWA 3BEXA 4CIFA 3LP2B 4YQWA 4P71A 4I6WA 3JYTA 4FLWA 5SZTA 4WXOA 1WELA 2G2YA 1Y97A 2CZVC 3D6MB 4RKUC 3T19A 2H51B 2K7JA 1AZSB 1KAZA 4WQ5C 2G8IA 5EWFA 1YLXA 4PL8A 1KOOA 4QWBA 2Y8WA 3K9KA 4Y0FA 2W4PA 1X5SA 1AW0A 1YHQS 1N5YB 3VEWA 2MLZA 2QO3A 4PPZA 2BW7A 4ECZA 3BN7A 3HHLD 2YCHA 4ZPAA 3MOJB 2FZCB 4J90A 5KG6A 5AQZA 3RJMB 4DV3J 2GUPA 3ZLJA 1BMQB 2RRBA 5EUHA 2AD9A 1ZBHA 1E6YB 3HDSA 5KTQA 1PC4A 1S7IA 4FF3A 1GXUA 2B7BB 3VQBA 4E1MA 4YFUA 1LCUA 1HNZF 3NH1A 3P38A 3ULEB 1DLOB 3JS6A 4M63A 3OSNA 1Q53A 5KOWA 4BC2A 3L7PA 3MXHP 4FJXA 2MQOA 1RK8A 4NCGA 3M32A 2M4MA 2AJ0A 1CQMA 3IAS9 4Q7AA 3AVAA 4DWIA 3M6VA 4ZVPB 2Z57B 1FHTA 2IM3A 1V4TA 4CF1A 3C6UB 3MM9B 5CYQB 2PGCA 4X65K 5HL7Q 3NCPA 3ENHA 5M1NA 3H8YA 3LPYA 4J2EA 4B9MA 3VWSA 1YJ9S 3VQ8A 2WB4A 5ETVA 3TABA 4DV5J 1B0TA 2QWNA 4CJ4A 4CF8A 3OBWA 1NCLA 2HS0A 4UY8T 1UWBB 3MM7A 4A5BA 2O3DA 2FY1A 4ZN3A 1O0PA 5A8RB 2YVSA 3DLBA 4ID5A 3AA3A 2W1BA 3MR2A 4U7UD 3HZ6A 4CP5A 1EQMA 2J6SA 4DXLA 1N0UA 3RR8A 4O3OA 3CCLN 1IQTA 1RU1A 4RW4A 3VQDA 2FJAB 2XYGB 3HULA 5DDPC 3PR5B 4KGKA 2WVCA 5GAHU 3HPGA 2OUGA 2Z1IA 4QU6A 5CXTA 3GJRB 3QRRA 1S0OA 2CQ4A 3E2EA 2W2NP 2I1RA 3VZHA 2PMWA 3M9MB 2KKZA 1UAWA 5F8JA 1T05B 1SAZA 1PJ7A 2HBJA 1C2PA 4DN9A 4FK2A 2NLWA 3ICLA 4KC5A 3S3OA 1RWXB 1C1AA 1IBLJ 2AGOA 2WW4A 4N8NA 2MGZB 2X1BA 2YNHA 1UVJA 3SV4A 3MR6A 3AVFA 5F3ZA 2UUCK 2XS7A 3F9KA 2OPSB 1H6KX 4KT0C 3G8QA 3CB4A 2MHNA 4HI2A 3H1VX 2DYAA 2C3OA 3CMEN 4KHYA 2HEKA 3GJTB 2FHMA 1HUXA 3I8BA 2J9DA 4K8ZA 1B0PA 3AQPA 4DV1J 2ZOMA 2JEFA 8AT1B 1BGXT 4TY9A 2M7SA 4ATNA 3TAPA 4RBVA 4OV1A 5THWA 4H4OA 4KHWA 2PAVA 2ZVIA 3K2YA 1IBKF 2R8IA 2F8SA 2ZBCA 4HUGA 3SV3A 5CHIA 5AJ3J 2HIQA 3M8SA 2A1BA 5BR8J 3QJJA 3Q8RB 1UPMB 1NGFA 3LZJA 1Q79A 2WOMB 2W8LA 2D3UA 4BGAA 1D4XA 1VQYA 2QA2A 2XGPA 1S1UB 3HZEA 3B6PA 3KLIA 4QOTA 1JLQA 4I4BA 3QDKA 3HSTB 2Q66A 3JAMU 4OZJA 1RTIA 2GNKA 4NYNA 2X51A 4CLSA 3U7JA 5JICA 1G2EA 4OYPA 1WG1A 2CJQA 1VSIA 3R3TA 2UV8A 2VJVA 5BN9A 2E5LK 3G6ES 2IYGA 2UVWA 5DS7A 1CS4A 5K14B 5DLFA 3WX8A 3NOGA 1LQ9A 2VB6A 1LW0A 3T1YJ 1YVUA 3QGIA 1VOMA 2JDJA 4FPRA 4CJ3A 3O8MA 4PUOA 1OWXA 5CZXA 4Y6IA 3O4WA 3AVJA 3KKRA 1BI4B 1C1BB 1WF2A 2MMYA 2RF2B 2AGQA 4Y0WA 3IS9B 2X3GA 3FJ2A 2X6NA 1KAYA 1HNXK 4PXCA 2PYJA 1R8AA 4DL0C 2L48A 3OL8A 2RKIA 3MN7A 4R8UA 2XB2D 3QO9B 1GLLO 3K59A 1FJ7A 1D8YA 3OFHA 3VERA 1GOCA 4AHVA 2VOOA 4KI6A 1A9NB 2EI5A 1VQ6S 1UVIA 2YNHB 1FX2A 2FVQA 4G65A 1B92A 3T9NA 2UUCJ 2RU3A 2V8VA 1XMOK 4KFBB 1NGJA 2B4JA 3CE8A 4RWWA 5KG4A 4N56A 2OAUA 3IBFB 3OT9A 4PQAA 4O5FA 3PEHA 5HBMA 1JL1A 4BCAA 2RD5C 1PYSB 5F0XA 4RNNA 1IBKK 4IG3B 3IR7B 1BISA 5TKYA 2KKHA 4K5SA 4NLQA 3LDOA 1OO0B 3KFWX 2ZM6J 3V81A 3DNCA 1KP6A 1VLYA 5I42A 4IO9Q 1RHQB 3SYZA 4B3MK 1IG8A 4UZBA 4UUXA 4IOAL 1U6FA 2AJQA 3B6BA 4NLTA 4FJHA 4D3GA 1GMUA 1D0EA 2OJ3A 5ETSA 3TA0A 2Q31A 2C3UA 4DR3F 2DGXA 1YKWA 2GMHA 2CQ0A 4USKA 3L09A 1VQKS 2W9AA 1FKAF 3AJ2A 1HYSA 2Q0RA 1FTRA 3GYXB 3H08A 4CO5A 4GVBA 1GTEA 4LF8F 1HBMB 1W25A 1J5OB 1U24A 1B7YB 2ZJPQ 2MTLA 2HQCA 1IQZA 3MHYA 3U9DA 5HMXA 3NGRA 5HQ8A 4JI8J 1RHUB 3KK2B 4FJLA 4C8LA 2HS3A 3H59A 5C24B 3PCOB 1RNHA 1UEUA 4ILJA 3DAWA 3Q2TC 4XK8C 3O80A 3M4XA 2BQUA 1SC3B 4XPCA 3HT0A 4PKDB 3ZO7A 1WSRA 1VI7A 4O4GA 1F9HA 3D0IE 4HUEA 2XZTB 4JKFA 5AQRA 4RLEA 2E88A 4ECQA 1U1OA 2FDNA 4KO0B 1LAWA 1VCTA 2YY3A 2YXLA 2Y1LB 3SQ1A 1X9SA 4RNMA 3OXLA 4IJAA 2MZSA 4UF4A 3V1RA 4LF9K 1F2HA 3L4IA 1WKLA 3IA0A 1W9HA 5T41A 5LOQA 3CNQP 2K06A 4R8UB 2FGOA 3PX6A 1RLDA 3HZGA 3K5NA 4J9KA 2D0BA 3FMBA 1UJ4A 5F1XA 2O8FA 3ATVA 3A8JA 1RTDB 2KN4A 2FQQB 3LM2A 4A5AA 3WXIA 4M5LA 4CZGA 3AVMA 2UXDF 1X31C 1HW9A 1FVSA 1FKOB 2UUBJ 2YNFB 3ZSZA 2F96A 1UFKA 3ISND 4P74A 2BJ7A 1MMNA 3RBZA 2Z1GA 2XMKA 3UDLA 4ZIWA 3CQYA 3QGGA 4DQRA 4BRDA 2E1AA 3RAMA 2YQ1A 3CUNA 4DUYJ 2YQ0A 2R7TA 1SV5B 2HOEA 4MO5A 4YDUC 2UUBF 2QA4S 1XMOF 5CY4A 2NXCA 1MNEA 4F4XA 3MFHA 1QAYA 1OVQA 4GKKF 3BGLA 3I56S 3SMPA 3F2KA 2H5EA 2DH8A 1TUGB 3SUOA 4JI5K 1ZAVA 3J7ZT 2JGUA 1IR1A 4IRKA 3O44A 5KPZA 2N7CA 2RS2A 4QYZK 4MYTA 4GC6A 2V6AA 3CC7N 3U9ZA 3OL7A 3OS2A 1URRA 2VIHA 1DLOA 2OYQA 2NRRA 1A5WA 2CQ1A 1G7CB 1I5OB 2W4DA 1AYEA 5ETKA 2IPOB 3N01A 1ZAWA 2EG2A 9ATCB 4A61A 3TO8A 2F9JA 1AXQA 5CH7B 1DZ5A 3TSPA 3SQOP 4CYUA 3EZ5A 2G8KA 4CGDA 3DRSB 4O8UA 3KWGA 3O9QA 1H98A 4JRPA 3FFIA 4DU7A 2H4WB 4CLKA 4CIOA 2KI2A 2MQMA 2IBKA 5IWAK 3SK3A 4BREA 2V67A 4JV5K 3AA4A 1RWNB 1NG9A 3D0GE 2K7KA 4OVLA 5E2QA 1SJ4P 1NK8A 5JVHQ 5E3QA 3NF9A 2VKZG 4WWSA 1TKZA 3TZWA 1VJQA 2W7AA 4LQ9A 3CJ4A 3BDEA 2L08A 2PD1A 1FRKA 3EXYA 3DLKA 4DV0K 1TL1B 3GSIA 4WFBL 3JYTB 4NZ7A 2AW0A 3IBWA 3JB9k 2Z2YB 1R7IA 3PKYA 4X4NA 1F1BB 4DMNA 1N6QB 3OR2B 3MAHA 4HHTA 4X4SA 3IN5A 2JVRA 1NU0A 1VQNN 1EAYC 2W6LA 4NASA 3JTOA 3R2DJ 4CJSA 2Z2LA 1QQOA 1B7FA 2QN6B 2M8HA 2E1CA 5GMDA 2MSTA 3NAIA 2HBLA 1TL4A 2MJNA 4CIEA 4FM1A 4L6V3 2ZVSA 2YHYA 3CCTA 2VPWB 2QTDA