5J2NA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
total genus 158
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2nA05
2J6SA 4O44B 3RB3A 2ZD1A 4MKBA 3OS2A 1EP4A 5F8IA 2HHQA 1Q8IA 2F96A 2XCAA 3RMCA 1ZBLA 5F8HA 5KFBA 3NF6A 2WONB 3TAFA 2DPIA 3K5MA 2KW4A 4NLXA 3ZCMA 3M9OB 1KLNA 2JGUA 3QEXA 4WFZA 1BI4B 4DQRA 4CEDA 5F8NA 4H4MA 4EBDA 3JYTB 3G6YA 3VQAA 4HUEA 4OKJA 4OL8A 5KFPA 3GV7B 3LWLA 1HNIA 4WZQA 2KQ2A 1JXBA 4IR1A 4Q43A 4IBNA 2YNGB 3MR3A 1TKZB 4H4OB 4DF8A 4Y3CA 2BGGA 1S49A 3DI6B 2YKNA 3VQ7A 2IMWP 4KHMA 2OPSB 4EP5A 2RDJA 3MXIA 4IRDA 1C6VA 1HQUA 3ZT0A 1VSKA 2AGQA 2BRKA 2HB5A 4N5SA 1ZBHA 1SH2A 2D41A 4KKOA 1SH0A 4TY9A 1O1WA 1XHXA 3DRRB 4K4TA 5KG1A 3DMJA 4ECSA 3M8QA 4RW9A 3EZUA 4MIAA 4B8AB 3CDWA 4ECRA 2W9CA 1RT4A 4F4WA 1A5VA 4Z4CA 4DU4A 2W9AA 4KHYA 4J9LA 1RA7A 1N5YB 2G8IA 2Z1IA 4PUOB 4E1NA 2WK4A 4CJPA 3FQLA 3HSTB 4K8ZA 5KG7A 3D5MA 4KO0B 3WNHA 1TVRB 3SQ2A 4NLTA 3OVNA 3HYFA 3BJYA 3H98A 2X6SA 1RTJB 3H08A 1TKTA 2BQ3A 3KNAA 3D45A 3I0RA 1REVA 4QWAA 4KI6A 3KK2A 4LSNB 1FKPA 4BDPA 1RILA 3PUFA 2IC3A 3OYCA 4JS5A 2QKBA 2ILYA 3VQ8A 2UVVA 1S1XB 2BANA 2HNDA 1XWLA 4OPKA 3HT3A 2XY6A 3SCXA 1WSEA 4M45A 3PV8A 4DTJA 4O3NA 4KV8B 4WE1B 3HVAA 5FRMA 2B5JA 4DSLA 1RDDA 2O4GA 1LAWA 1NK6A 1DLOA 4G1QB 1S1XA 1IKWB 4DS4A 3ASMA 3KLGA 1T3NA 2HWHA 4DQIA 4RW8A 2YKMB 3CM5A 5CZ2A 1NK7A 1TKTB 1RYSA 4FJNA 3QNOA 4FJIA 1ZBFA 3CYMA 5KFCA 5J2PA 4CJRA 1TGOA 5C5JA 3RAXA 4FLVA 4MK9A 1I39A 1JLCA 4RW6B 5HLFB 3OL7A 3NDKA 2W7PA 4RUAA 3OHBA 4TY8B 1VRUA 2BE2B 4NRTA 5DQIA 3KLIA 4CJVA 1RBSA 5JS2A 4OLBA 1TQLA 4RW9B 5KFYA 4IG3A 4TSXA 1N6QB 3DMJB 2B6AB 3IG1B 2R2SA 3SV4A 4ED6A 4NLQA 2EX3A 1IM4A 1C2PA 1HYVA 1EKEA 4WFYA 1VSLA 5KFVA 3CQ8A 4YR3A 3ZSWA 3DRSA 1IG9A 1RTHB 1C1BA 4RW4B 3AVMA 4O5BA 4CJTA 4DSFA 5FRNA 4CFDA 3OJSA 2YKNB 4LSLA 5KFOA 1HQUB 1GX5A 1J5OA 4ZP8A 1TK5A 5J1EB 4M94A 2Q3SA 3ZSXA 5C24A 4IKFA 5KT6A 2HHVA 3DM2B 1LWCB 1JX4A 3AO4A 2G8FA 2HHTA 4F3OA 2FVPA 3I5AA 4CEOA 2FVRA 2W8LA 4H4MB 3RBEA 2P1JA 5DLGA 2I5JB 1LWFA 1RT6B 4IFYA 1LWEA 1N4LA 3LP3A 5HROA 3MAQA 4DL7A 5KFHA 2RPIA 1C1BB 3I5CA 4CE9A 2HNZA 1VRTB 1BQNB 4PQUA 3NAEA 3ITHB 1X9MA 4NCAA 4M3XA 1HQEA 4CJKA 1GOAA 2WONA 3FRZA 2V0NA 4NLSA 1X1PA 4U7CA 1NK5A 4URGA 4KHWA 5T14A 2J6TA 5DMRA 2ZD1B 3HP9A 2Z1GA 2PZSA 5KFGA 4FLTA 5KFQA 3QETA 4QWEA 4FK0A 3O3GA 3HVWA 4CJ5A 1KTQA 3LZJA 4E7LA 3BQ2A 2FBTA 2W7OA 5CYMA 3P5JA 3BSCA 4ECTA 1SL2A 1XR7A 1WNSA 2UVWA 4ZP7A 1LW0B 3KHRA 1S6PB 2OPQA 1DTQB 2EC0A 4FJ8A 1C1AA 3Q8RB 3MXMA 3M9NB 2ASJA 1JLFB 3HO1A 1KVCA 3AA4A 2D3ZA 1HQEB 3CWJA 4L8RB 2P5OA 3HPOA 3PX4A 3DLBA 2YHBA 1BQNA 2IS3A 3QEIA 4B3OB 5T7BA 1D8YA 3QO9B 2ETJA 4C8LA 2HVIA 4Q5VA 3OYBA 4CK2A 1A5XA 4CF8A 5DGBA 3IRXA 2GC8A 1X9WA 5CY4A 5JS1A 3L2UA 4HCCA 5HROB 4F4YA 1NKEA 4WXOA 4NYFA 3RMDA 5KFUA 3DM2A 2JLEA 3GIMA 2IDOA 5J1EA 4FS2A 1YTAA 4DFJA 4C8KA 3OY9A 2WTFA 3WNFA 4DLEA 3CJ4A 4WXWA 4QWDA 3LAMA 3KIOA 2KZMA 3V6KA 5DGAA 3T5LA 2VG6A 3LP2B 1YVFA 4DTSA 4N47A 4E7IA 1T03B 3T19A 4NLPA 2VG5B 4DF4A 4FLXA 4CEFA 3H59A 1S4FA 3V6JA 3UR0A 5DG8A 4E19A 4TYBA 1W9HA 3IS9A 4DU3A 1MMLA 4W5QA 3KJVB 3THVA 1KFSA 3JSMB 1QS4A 4ED2A 4ZPDA 5HBMA 1TKXA 3G86A 4DG1B 1RT3B 4TLRA 5DLFA 5DG9A 4CK1A 3V1OA 2YNHB 1WSHA 1S1TB 1N6QA 4TY8A 4NZ0A 4DTPA 3M8QB 4CEQA 4Q44A 2XGQA 3JSMA 3OLBA 3RB0A 3V9WA 3WNEA 3AVCA 1RT3A 2ZKUA 3H5YA 2VA2A 2VG5A 2JEFA 3O3FA 4DEZA 3LP2A 2IGIA 4O4GB 3LP1A 3IN5A 4R5PA 4RW8B 1EX4A 4FLWA 3CM6A 3LDSA 1T05A 2FJVA 3DLGA 2KZZA 2KTQA 1S9EB 3QERA 5J2MB 3AVKA 3OYJA 4HKQA 3QEPA 3DRPA 3PW0A 1TKDA 4OLAA 3GIIA 1QHTA 4LH4A 4R8UA 4ZVFA 1WSGA 1HYZA 4ECVA 5KFMA 1NHUA 3GQCA 2NUBA 3KMQA 5J2QB 1RT1B 3OYKA 1TP7A 2OYQA 3OYEA 3SV3A 2W9BA 3RRGA 4CF2A 4LSNA 3N6LA 5KFEA 3GIJA 3EZ5A 4R5PB 4J9MA 4O44A 5J2NA 1ITGA 3LP1B 3QLHB 3ZSYA 3OYLA 2D0BA 1ASVA 1TK0A 2FVCA 1HMVB 3HK2A 1BHLA 3C6UB 5EWFA 2IBKA 4DS5A 3OS1A 2XGPA 4DSKA 4FM1A 3PX6A 2HMIA 5KFIA 3S3OA 4DTUA 5HRRA 3ICLA 3AA5X 1YT3A 4NLYA 5CYMB 4K4VA 3MECA 2UUTA 4KPYA 3V6DB 2IOCA 4CFCA 4ECYA 4CHQA 4CIEA 3CO9A 3AO5A 5L1LA 2E6MA 1RTDA 3AA3A 2YHAA 1IKVA 4K4YA 3RWUA 2E9RX 2ATLA 2ASLA 1RBRA 4F4KA 4B9NA 1TL1A 3E01A 4M42A 3LAKA 4EZ6A 2C22A 3M8SA 1L5UA 4I9LA 4AHCA 2FVSA 4O4RA 4I7FB 3AVIA 4RW7B 3ITHA 1RT5B 2ITGA 4Q0BB 3L2WA 1CLQA 4ZPCA 5SWMA 1C0TA 3DLEB 2Y1JA 4I2QA 2E9TA 1JLBA 3VN5A 2XC9A 2XCPA 4YR2A 4M3YA 3GILA 4ECZA 4AHTA 4NYZA 2F8TA 5KI6A 1HNIB 4Q8FA 1BI4A 4Q0BA 4W5RA 2EHGA 5KRTA 3RMAA 3VQBA 4I2QB 3CJ3A 3CVKA 1NK9A 3V9SA 3NF7A 5KFFA 3C94A 1KSPA 3F9KA 3DOKB 5DG7A 4CHYA 2AU0A 4QWCA 4LSLB 1N48A 5K14B 3E01B 4ECXA 1B9FA 1UA1A 3OYAA 2DTUA 3KLFA 1OS5A 1CZBA 4IOBA 2QE5A 3NF8A 1JLFA 3WNGA 2DPJA 3OLAA 1GOBA 1MU2B 1S1VB 1TAUA 1Y97A 4ELTA 5KGXA 4O0JA 1RTIA 3QIPA 5I42A 1TL3A 3KLIB 1Z4UA 4FJHA 1VSHA 1C1CA 5KFNA 2C2RA 4DTMA 4RNHA 3GV5B 1VSMA 2HMIB 3PR4A 3OYDA 1JXLA 3NAIA 4K4ZA 3T3FA 2R2RA 3LANA 1NK8A 3KOAA 4QOZB 4B08A 3T5KA 2O5DA 1N56A 4Z4FA 4DTNA 2A1RA 3DOLB 4I9QA 4ZHRA 2FBVA 5FDLB 1SV5A 2P51A 2XI3A 4E7KA 3VQ6A 4OPJA 2YV0X 1K1SA 3AVNA 3QLHA 3HVTA 1FKOA 3NBPA 4OKKA 4CIFA 3Q8PB 2G8VA 5HRNA 1CZ9A 3NE6A 1IKWA 4PQUB 4J9KA 1SUQA 3NKYA 4TYAA 3OL6A 3KLVA 4EZ9A 1JLGA 4FJ7A 4IKAA 3T1AA 4DL4A 3FFIA 1WSJA 2FC0A 4KHQA 1U04A 4B9SA 3KK1B 3ISNC 4J9QA 4HUGA 1ASWA 4CGHA 3TAEA 1GX6A 1BCMA 1UOCA 2BANB 1LWCA 3MEDA 3PR5B 5C24B 3RBDA 4X2BA 4LY7A 3VQ5A 3K57A 2GIRA 5D3GB 4F2SA 2B43A 3SQ1A 3BR9A 1RDAA 1TV6A 2X74A 1RTHA 1TVRA 3CFPA 5DQGA 4O4GA 1ZETA 4KO0A 5JUMA 3CG7A 4CF9A 3VA0A 5KTQA 4CEAA 1SL0A 4GC6A 1L3TA 4RZRA 4J9NA 5FROA 3AA2A 4BE2A 4AHRA 4PY5A 3AO2A 5KFRA 2I1RA 3VQCA 4B8CA 4QW9A 4O0IA 3RB6A 4H8KA 4IH6A 3SUNA 2GIQA 4CJEA 1TKXB 3HL8A 4FW2A 2W9CB 4FJ9A 1KCFA 1VRUB 2YNHA 3DLRA 5HLFA 3NHGA 4FJXA 4N76A 3L2RA 3VQ4A 3LP0A 5K14A 1K6YA 3A2FA 4DTXA 4IH7A 4BWMA 3V9UA 5KFDA 2VG6B 1KVAA 3OYGA 4JV0A 3TANA 3SJJA 4ED7A 3ZT2A 3AVLA 3K5OA 1QSSA 4KSEB 3NH1A 4ID1A 4R0EA 3D28A 1TKZA 4H4OA 3SUQA 3VQEA 2ATQA 4Y1DA 3PO5A 3DI6A 1D9FA 1KRPA 3KHGA 3U3GA 2XRIA 1S9GA 2WOMA 3C95A 3EPGA 4DSEA 2C2DA 3HM9A 4JLHA 3V4IB 4K4UA 3AO3A 5KG5A 5DK5A 1RA6A 1S1WA 4QW8A 2DFFA 4FBUA 3MF5A 1IKXB 4ZPAA 1D0EA 3CJ2A 3ZSQA 2D7SA 2AX1A 1TAQA 1WSFA 5F9NA 1ZBUA 1U48A 1IKYB 4NLDA 4JS4A 2HHXA 4B3OA 4QCLA 3D0PA 2V4QA 4ZTJA 2R2TA 4ZVGA 1RDCA 3K59A 4KI4A 3BSAA 3V1QA 2WHOA 4CEZA 4DU1A 1NJYA 4TQRA 3MEGA 4NLVA 3O4QA 3SPZA 4FK2A 1KLMA 4CJFA 4JV1A 3TARA 1S10A 4FK4A 5KFSA 2AGPA 1VK0A 2VA3A 1TL3B 3QIPB 4NLRA 2RKIA 4FLUA 1MU2A 4FLZA 4ECQA 4YQWA 4U6PA 1SKWA 1RT2B 2UVUA 4YR0A 3QYYA 4FJJA 3KK3B 3L3VA 1UWBA 1WAJA 4M3ZA 3ZSZA 1QAJA 5KT2A 3VQ9A 4KB1A 1RBUA 1VRTA 3FSIA 2R8JA 3PX0A 4FJLA 1FK9B 3MFIA 4B9LA 2RN2A 3DOKA 2RF2A 4HUFA 2HNZB 4IFYB 2V4RA 3QGIA 3AO1A 4I2PA 3V4IA 4J2BA 4F2RA 2E6LA 2CJQA 2OPPB 4CJQA 1ZTTA 2QK9A 2VG7A 2HAIA 3DYAA 4DWIA 3KLHB 2E4LA 1NKCA 4J2DA 3KLHA 3MR6A 1U45A 2WOMB 3OL8A 5F8GA 1NK4A 1HRHA 3G6VA 3CFRA 3QIDA 3OS0A 3B6PA 5EWGA 2G8HA 3DLEA 3P83D 4M3UA 3AVFA 3AVAA 1NNDA 5EDWA 4RW4A 2BQUA 4B9MA 4ZP6A 1CXUA 2Y1IA 4HCBA 4Y34A 4HTUA 1TL1B 4KHSA 1KFDA 4OJRA 3N6MA 5KT3A 1IO2A 1J54A 3LP0B 2D3UA 1S0OA 3MECB 4TN2A 4F4ZA 4PWDA 4IDKA 3H40A 1KHWA 2PYJA 3IG1A 4EP4A 1WNEA 2HNYA 1S1TA 1WAFA 1JL1A 4Q8EA 2JC1A 2RKIB 4O3SA 4CK3A 4IQXA 4OVLA 3H5UA 4LD0A 4J9RA 5EU7A 4GC7A 4PA1A 3NGYA 3G6XA 3KJVA 4F3TA 4BE1A 2BDPA 4KTZA 1JLCB 4RW6A 4E0DA 1GOCA 3NH2A 3U6FA 3MR5A 4BDZA 3PJWA 3EYZA 4CHNA 3UPFA 2W9BB 3EY1A 2IAJA 2YNIA 1S5JA 4CF1A 5J2NB 3V9XA 3TABA 1LW2A 2G8KA 1RNHA 3VA3A 1IKYA 3P1GA 3ZSRA 4MKAA 3SQ4A 1QTMA 5D3GA 1HARA 2IM0A 1RBTA 3SZ2A 3KLGB 2OPRA 4O3OA 3OL9A 1BCOA 4DQSA 3SI6A 5F8JA 2FBXA 3QINA 2QXFA 4ID5A 4K4SA 2G8WA 4Y1CA 3FFIB 1BQMB 3PW2A 2LSNA 1BQMA 5KG3A 3OYIA 3KK1A 1XC9A 2XY7A 2BQRA 5JXSA 1ZYQA 2HNDB 3DRPB 2E9ZA 1L3UA 2KFZA 4AHSA 3TAGA 1JKHA 1RCHA 3KK2B 3NAHA 4H54A 3KLEB 3MFHA 4J9SA 5C42B 2AWZA 2FLNA 5CYQB 1I3AA 1B92A 2G8UA 3S3MA 4ZPBA 1I6JA 3VQQA 5FDLA 3M8PB 3HVTB 2A1SA 3I5BA 1S6PA 5L9XA 3NGIA 4M3TA 4Z4HA 4DLGA 2O4IA 2HHWA 4NYNA 4O3PA 1DTTA 4DFPA 3DOLA 5KFZA 4ED1A 4CFBA 1VSJA 2ZE2B 3UIQA 1HNVA 3CDEA 4Z4GA 3E51A 3MXJA 4NLOA 1CSJA 1JXEA 4KHUA 4ELVA 4J2EA 3TVKA 3ZT3A 3HJFA 2HW3A 2UVRA 4DG1A 3SUOA 2BRLA 1QE1B 3DRRA 4EBEA 4WZMA 4M95A 4CJUA 4FW1A 1L3SA 1UAXA 1JL2A 5L1KA 4KAZA 4KTWA 1D1UA 3QGGA 2UUWA 3CFOA 2OA8A 1L3VA 2R8IA 4KB0A 4FXDA 4XIUA 3QZ7A 4DL5A 1B9DA 4KAIA 2JC0A 1QSLA 4LH5A 4C8MA 5EWEA 1HYSB 1YVUA 3OSNA 4E7JA 3TAPA 1S6QA 3NCIA 3DYAB 1S6QB 3V81A 4CEEA 4MK7A 3N6NA 4NLWA 3DLHA 1NJZA 4FBTA 1KVBA 4WYWA 4JV2A 4FCYA 2ILZA 3UQSA 4FZXC 1RAJA 3CDUA 4CJSA 3IRXB 1XR5A 4NLGA 4M3WA 4CJ3A 3DLKB 1D9DA 3KD1E 2R7YA 3IGNA 3NBPB 1FKOB 2PYLA 1DTQA 2OPQB 4EEYA 4YMEA 4FJKA 3NL0A 1LAVA 3RRHA 2HHUA 1SKSA 1UWBB 4FS1A 4CJWA 1SV5B 1ASUA 2Z1JA 3NH0A 4O55A 1J53A 2JEGA 3QEVA 1G15A 3RR8A 4NCGA 4FM2A 3RTVA 2IJFA 4ECUA 1VSEA 4IRKA 3T5HA 2JEIA 4KFBB 2AQ4A 4KHNA 4GW6A 4FZYA 1RBVA 1RTIB 3IAYA 3OHAA 5KGWA 1WLJA 1IH7A 1XHZA 3M8PA 1QAIA 3NGZA 1QQCA 3S9HA 5KG0A 4NCBA 1Q9XA 1HMVA 4Z0UA 3DLKA 4DFMA 3NFAA 3ZT1A 1S0MA 1JKHB 4KREA 1S1WB 4K50A 3ZT4A 4BE0A 5KRSA 2I5JA 3TAMB 5KFLA 1U49A 4DL3A 3C6TA 4MH8A 3CJ5A 5KG4A 2XY8A 4KTQA 1JLQB 5KFJA 2YNFA 2OZMA 4ID5B 4ZP9A 2WRMA 4B9VA 4E3SA 1J5OB 3BQ1A 4XPEA 4XO0A 1BL3A 4Z4EA 2AJQA 1X9SA 4DTRA 2XY5A 2VWKA 5KG2A 3MR2A 3RMBA 1C0TB 4DSIA 5J2MA 1LW2B 4W5OA 3RB4A 2B4JA 3I8DA 1S1UA 3PJXA 2YNIB 1BGXT 3V9ZA 4W5TA 1JIHA 1EETA 5HP1B 1XI1A 4Y2CA 1UA0A 1U09A 2KFNA 4WYLA 4ED8A 3O3HA 2D5RA 3HKWA 1QSYA 4CHZA 4PUOA 1QE1A 1Q9YA 1NOZA 4RUCA 1HPZA 5I3UA 4IH5A 1Z25A 4IFVB 3UDLA 4CGFA 2IM3A 3AVBA 2BE2A 1HNVB 3K5LA 3T5JA 4FM0A 2XI2A 3LPTA 1K1QA 1R0AA 3F73A 4EYIB 3IS9B 4KKOB 3K58A 3NMAA 5HBMB 4CGIA 5F9LA 1JLEB 2C2EA 3OJUA 2BR0A 5KG6A 2FBYA 4M3RA 5KFWA 1SKRA 3M8RA 1C0UB 1QUVA 3NGDA 3QIOA 2F8SA 2YNGA 3KMSA 2YKMA 1T8EA 1RT1A 2X6NA 4KV8A 3MEDB 4YNQA 4E7HA 4E89A 4BWJA 4N41A 1T94A 2VWJA 3JYTA 3C6TB 2CKWA 5HRSA 1VSDA 4CESA 2GUIA 2P5GA 3VQSA 4DFKA 4GVMA 1U4BA 2FVQA 3H5SA 3K2PA 5F8LA 4IG0B 3Q8QB 1F21A 1SH3A 2DY4A 2AX0A 3ZSVA 4B9UA 4W5NA 1FKPB 1RTJA 3QO9A 3HVRA 4DQQA 1XR6A 5KFTA 3U3YA 2IAJB 2HWIA 3I0SB 2D0AA 4LQ3A 4KBIA 1HJRA 1FXXA 4F8RA 3RR7A 5CZ1A 4QPXA 4ZHRB 1VSIA 5SZTA 1N5YA 3H4BA 3H4DA 3VQPA 4DTOA 4ELUA 4JRPA 1A5WA 3PZPA 3BGRB 4HHTA 2QV6A 2HNYB 2FLLA 1NK0A 4FVMA 5KFKA 3H5XA 4AHVA 4PWDB 4CGDA 4C8OA 3M9MB 3G0ZA 1NKBA 2R2UA 5I42B 1HPZB 4MQ3A 4IDKB 3G10A 3BSNA 4FJ5A 2R8KA 3FQKA 1S1VA 1YTUA 2ALZA 3GIKA 4B9TA 3LPUA 3O4NA 3HPGA 4CGGA 1RT7A 3CJ0A 1S97A 2GBZA 3SQ0A 3KLFB 4YP3A 3FDSA 3KKSA 4CECA 2IM1A 3ULDA 4MK8A 4RG8A 2W42A 4OGCA 1S1UB 4CFAA 1NHVA 4FJMA 4M41A 4DL2A 3LWMA 4URQU 3KKRA 3AVGA 3SFGA 1LWEB 3QEWA 2VG7B 4BDYA 4ICLA 4ED0A 2FJWA 2WCXA 4I2PB 2HHSA 4URSA 3TQ1A 3NF9A 1RT5A 3QESA 4CF0A 3KHLA 1JLBB 5KT5A 4AILC 1FK9A 3TAMA 2XWYA 5HRPA 5F8MA 3SYZA 3DRSB 1RT7B 3PO4A 2R8GA 1CXQA 5KFAA 4ZTFA 1RTDB 5KT4A 1WSIA 3HHKA 4CGJA 3VQDA 3KK3A 3PHEA 3ISND 4ZVHA 3BREA 1T7PA 4AH9A 3SNNA 1IKVB 2OZSA 5KT7A 2XO7A 3KHHA 3LZIA 1LW0A 3AVHA 3OYMA 3MEEA 3V6DA 3ZSOA 1W25A 4TQSA 4KFBA 3L2VA 1ZTWA 4RNOA 3QGHA 2IJNA 2ZQBA 2PY5A 2Z1HA 1TK8A 3BGRA 4C8NA 1NOYA 4FLYA 3EPIA 3AVJA 4CIGA 3PVXA 1DTTB 3KD5E 5J2PB 3C6UA 4ZMMA 4IRCA 4RNNA 3I0SA 1RDRA 4JUZA 4K4XA 2DFEA 4WFXA 4J2AA 1C0MA 3SFUA 4IG0A 4N56A 1IKXA 5J2QA 5C42A 1EXQA 2D0CA 4UQGA 2FJXA 3LALA 4Q45A 4G3IA 4O3QA 4J9PA 1S0NA 4OKEA 3GV8B 3CIZA 1LWFB 1RT6A 2AGOA 4J9OA 4FJGA 4WE1A 4ZVEA 4XPCA 2HVHA 4OGEA 4R8UB 3V81B 3BDPA 1S9GB 3PY8A 4DSJA 1VSFA 1S9EA 2JEJA 1SUQB 3V6HA 3IGVA 2R8HA 2OPRB 1HYSA 2IC3B 1S9FA 1C0UA 2XHBA 4TXSA 3DLGB 4Y2AA 4IR9A 1T05B 1SL1A 4JRQA 1REVB 3Q8SB 4MFBA 4CHPA 1JLAA 3QZ8A 4QWBA 3L2QA 1Z26A 2FLPA 3HP6A 1JLEA 1ZBIA 1R0AB 4GMJB 5C25A 4CERA 4KHRA 3TWHA 3DDKA 1BIZA 1J9AA 4HYKA 2J6UA 2B6AA 4NRUA 4EO6A 2V9WA 4IG3B 3MEEB 4DL6A 3PW4A 1RT4B 5C25B 2W8KA 4IFVA 1U47A 5I3UB 4AHUA 2ZE2A 4EYHB 4E1MA 2QKKA 1T03A 4ED3A 2DFHA 2ASDA 4FYDA 5DQHA 1EETB 5HP1A 2C28A 4KE5A 4O3RA 1NJWA 3GYNA 1JLAB 5EUHA 3RAQA 1RYRA 4F50A 4MFBB 3QNNA 2OPSA 3HXMA 4EO8A 1WN7A 1TV6B 5CYQA 3KLEA 2WB4A 4LQ9A 1W0HA 5KFXA 4YFUA 4CJLA 2IA6A 1DLOB 4G1QA 4ICLB 4FZZA 3H2LA 3SPYA 4HVJA 1JLQA 5L1JA 2IM2A 2B5JB 3HPHA 2OPPA 1S48A 2GV9A 2F8EX 3OYHA 3OSPA 5L1IA 2YNFB 4Z4IA 2RF2B 1BISA 3SI8A 4BACA 4RW7A 2X78A 1JLGB 4I7FA 4MIBA 4CEBA 1D5AA 1RDBA 4RU9A 1NJXA 3AV9A 3L3UA 3I0RB 4K8XA 2OH2A 4CCHA 3TI0A 3B6OA 3TR8A 4ECWA 1EP4B 3KTQA 5E41A 3V1RA 3OYNA 3L8BA 4CJ4A 4RNMA 4K4WA 3ALYA 4CHOA 1RT2A 4QAGA 4DMNA 3SUPA 3BSOA 2RDIA 4DQPA 3PW7A 4F4XA 1C1CB 4RNFA 3BQ0A 3OYFA 4NLUA 3TAQA 3MEGB 4NCGB 3PW5A 3S3NA 1LV5A 1KHVA 3K5NA 4KRFA 1KLMB 4KB7A 1BIUA 3MTKA 4EBCA
chains in the Genus database with same CATH superfamily
4DV2J 3RB3A 3OS2A 3S01A 2ZH7A 2HLUA 4MIWA 2XCAA 3J7YU 4JI3J 3NF6A 4I68A 2R7QA 3O44A 3TAFA 3NGSA 2HIYA 3K5MA 1OO0B 4NLXA 3M9OB 3D0IE 3QEXA 2FIUA 3J7AN 2O8DB 4JI4F 1NG9A 1HNZF 2BACA 3I33A 1SCJB 1HI1A 3MD1A 3VQAA 3GV7B 1VLOA 1HNIA 1SC3B 2RB7A 4OPHA 4PWUA 2KQ2A 3MCPA 1HNZJ 1JXBA 2JHEA 1G6BA 3L09A 4Y3CA 3O9TA 2XWXA 3GE9A 3DI6B 3VQ7A 1X4FA 1H0HB 2OPSB 4EP5A 3NGKA 1E6YA 1IWAA 2DHSA 1VSKA 3VERA 4FF2A 1D4XA 2GJFA 2FSJA 2ROGA 1W2IA 3EE8A 3RSEA 4X4VA 1ZBHA 2M88A 2V8VA 1SH2A 2D41A 4KHPF 3FUYA 5IQQA 2PEBA 4HT7A 3DRRB 1AYEA 4K4TA 3WC0A 1XNQJ 3K8WA 3CDWA 1YI2N 4ECRA 3O08A 2W9CA 2VOOA 3OTEA 1FD8A 2QX0A 1A5VA 4DV4F 5EN1A 5EHHA 4DU4A 4KHYA 3M1VA 5IT4A 1U0HA 2LXIA 4LR7A 3P8BB 3HSTB 5GADP 4KO0B 5L38A 5BR8K 2CG4A 1N34J 3SQ2A 3M32A 4KGKA 3HKZD 3HYFA 4WP9A 1YX2A 3SCJE 1VYAA 1C0GA 1TKTA 2BQ3A 3IBFB 4YDUA 2PO4A 2H9ZA 3SJHA 2HGLA 2HFUA 3QATA 3PUFA 2FSNA 2Q31A 1KVKA 4B3SF 1ICEB 4JS5A 2ILYA 2HRYA 1LK7A 2HBQB 1XWLA 1WORA 4UOGA 3PV8A 1PCAA 4IYQA 2PD1A 2VFRA 4I67A 4TU7A 5FRMA 2B5JA 4DSLA 3VEWA 3NGTA 2QMUB 1Z6RA 2EFOA 2I7NA 2O4GA 3OR2B 1LWXA 1DT9A 1LAWA 2CWKA 1NK6A 1DLOA 1S1XA 5L46A 4ILRA 2XHWA 4JI4K 2HWHA 4CIOA 2YKMB 4HH1A 3RUBL 3OVAA 3BGFA 2ZBRA 2HK2A 3QNOA 3CYMA 5KFCA 5J2PA 2V68A 2VB6A 4OYIA 3E1YA 5C5JA 3RAXA 1Q5YA 2HF4A 1PSDA 2MXYA 4FLVA 4PABA 3LM9A 3EVWA 2OJ3A 3OHBA 1H6KX 4CJVA 4OLBA 3NMRA 4RW9B 3J7YP 5KFYA 2DR7A 5A8RA 4OX8A 2B6AB 3IG1B 4QIWD 1KOHA 3POTB 3THWB 4ES1A 3SV4A 4NLQA 2DISA 5D0GA 2Z0GA 1HYVA 1HBUA 1NEEA 5LJ3Y 4WFYA 2M70A 2P9LB 2FXUA 4BG8A 3QT5A 4RW4B 4CJTA 3SCKE 3GJRB 2IVNA 1CS4A 1NPRA 1EO1A 1GX5A 2A0FB 3I31A 5J1EB 2Q3SA 4DR2K 4H0YB 5C24A 4AYBD 3FE1A 5KT6A 2HHVA 2HK3A 2HHTA 4ZPVR 3ZYYX 2Z2MA 2XTJP 3LPEA 5EGYA 2W8LA 1GLDG 1MDUB 1H2UX 2QEXS 4JBCA 1HBNB 2R7VA 5DLGA 1CC7A 1Q79A 2Q6BA 3O5TB 3EXCX 5HROA 3C65A 3UKRA 3FRYA 4W90B 1BO5O 1M5SA 1HI0P 1C1BB 1VRTB 2ZWOA 3SSSA 3SBMA 4PQUA 1X9JA 3ITHB 1X9MA 2PN6A 1U02A 1HQEA 4CJKA 5HQMA 1X1PA 1YQHA 4U7CA 2V34A 3MN5A 5T14A 2EEYA 2PFFB 5DMRA 1K8KA 2ZD1B 3HP9A 4JYAK 2L3MA 3R5GA 1GNKA 2NLWA 1HNXF 4E7LA 1KTQA 2CUYA 3HOSA 2VBZA 1FFSB 3W2VB 1FDDA 5CYMA 1RWMB 3EM1A 4ECTA 1XIQA 2CPYA 2OTLN 4FWLA 1LW0B 1NUEA 1RXOB 1U1KA 4I64A 1DTQB 4PEOA 2RDDA 3A8JA 1KVCA 3AA4A 4OI6A 4USIA 4HR2A 3HPOA 2ZH6A 2KT3A 1DURA 3QEIA 3W62A 2VJUA 4C8LA 4Q5VA 4LVNP 1CEZA 1A5XA 3R7SB 3H46O 4NMLA 1X9WA 5SUHA 3D6MB 3DLJA 1TUYA 5CY4A 5JS1A 1TR0A 2XO6A 3D6RA 5HROB 2QLJB 2DK2A 4JI4J 4NYFA 2KG1A 2JLEA 3GIMA 2YWEA 4ZPTR 3S8SA 3CD6N 4FS2A 4LBPA 3W61A 4FOIA 4C8KA 3ENAA 5FPDA 5JMNA 2ROEA 4FO0A 2D4WA 3MM7A 2KZMA 1NPKA 6FD1A 4BC5A 1VHXA 3C7NA 1GLJO 3T19A 1S4FA 2D69A 5FIIA 2YHXA 1KFSA 5DDPC 3THVA 2V2QA 4ED2A 4BRFA 4AL6A 4DG1B 5DG9A 2GQ2A 2YNHB 1GMWA 2COLA 1T0TV 4NZ0A 2OFGX 3EXYA 1WHWA 2FD2A 4KH0B 2K1RB 1EX8A 4CEQA 3BGUA 1JK9B 4NEZA 1G99A 3HSCA 4G9ZA 3DFEA 1RT3A 4BBYA 1VI7A 2BOAA 2ZKUA 3VVUA 1F9EB 3O3FA 2LYVA 4LFBK 3NP5A 3R6MA 4A8KA 2JZ5A 4DR3J 1WC4A 3D2EA 4R5PA 7AT1B 4RW8B 3CM6A 1T05A 5E3AA 4X84A 2KZZA 1QZ5A 3QERA 5LJ5Y 5J2MB 2R42A 4JI1K 2NRVA 4X4PA 1TKDA 1VQOS 5E3CA 8AT1B 2DPNA 3ENWA 3THYB 4Y2IA 4R8UA 1UVIA 3FK4A 4MDBA 3R1XA 3BR8A 4CLLA 2VDIA 1J5EF 1SJ4P 1TP7A 2RIJA 4M5DB 2D9PA 1NGHA 3DRYA 3CC4S 4NL5A 3OYEA 2ZOGA 4CF2A 3N6LA 3P4UB 3GIJA 4UT4A 3LP1B 4RU2A 4HDGA 1T95A 2KHDA 1MN7A 4WFNQ 2FVCA 1HMVB 3C6UB 5EWFA 2IBKA 3P4IA 4JI8K 4X4QA 1NB7A 4Y0FA 3MM5B 4DSKA 1X31C 4FM1A 2DTJA 4USKA 1U0HB 3ICLA 4L3KA 2R7SA 5CXTA 1WKJA 3TTCA 2UUTA 3OTDA 2W4CA 2H4YB 2UU9K 3EUNA 4RBTA 5L1LA 3T1HF 2VCPA 2YHAA 4F02A 4NO7A 4JP8A 2E9RX 1OQ3A 4Z2XA 5GINA 1TL1A 3E01A 2WW4A 1WACA 5HOOA 3M8SA 4O4RA 2LXUA 3AVIA 4DUTA 4RW7B 2L9DA 1PIEA 3BYRA 1MG7A 5HVGA 2ITGA 3L2WA 4ZPCA 3DLEB 4A46A 4I2QA 4WU2A 1JLBA 3GILA 4F04B 4F4AA 1R8CA 4WKYA 1D3WA 1XNRJ 2KO1A 1NDPA 1WBDA 1HNIB 4XTTA 1BI4A 4Q0BA 1KC8T 2EHGA 5KRTA 3RMAA 3VQBA 2AEJA 4I2QB 4P52A 3MDQA 3V9SA 2Z2YB 3A8KA 3QBXA 4OZ0A 3T1YJ 2QFIA 3DOKB 2AU0A 4QWCA 1BG3A 4LSLB 5K14B 3CCMN 3E01B 1B9FA 3OYAA 1VS3A 2DTUA 1B4SA 2QE5A 3NF8A 3WNGA 1YF5L 4O8UA 3BYPA 1GOBA 3RW6A 1IBKJ 2XMUA 3BBFA 2YH0A 3OTBA 3WXLA 1H1VA 3QIPA 1KD1T 1TL3A 4H0VB 4FJHA 5ETKA 3W5YA 2CRLA 2VQFF 1FTRA 2A42A 1X60A 3NAIA 1P1LA 1NLVA 2R2RA 3TZZA 4DUYK 1NMNA 2XS5A 2A1RA 2LMIA 3DOLB 5FDLB 2VBWA 3VQ6A 4OPJA 2YV0X 3RJMB 3H2VE 3A5OC 2OAUA 4OPAA 3NBPA 4WKRA 2ZHAA 4X66F 5K8MA 2G8VA 1E6VB 2BZ2A 2FC8A 1VQON 1SUQA 3W65A 1UP1A 1RB0A 4M5DA 3NKYA 1U8WA 1EZZB 4EZ9A 1JLGA 4P6QA 5A8KA 5B08A 1SQEA 2R7UA 2CAJA 3FFIA 4CW7B 1U0SA 4B9SA 4LF7J 3DDIA 4LC9B 1Q16B 4A2AA 1ZA1B 1B7YB 2GCFA 1T11A 1UOCA 2J0SD 1OYDA 3O80A 1W26A 2F4FA 4QOTA 4CBWA 3RBDA 3VQ5A 3K57A 3P3DA 3R9PA 4DR2F 2NSBA 2XS2A 1TV6A 1X3NA 4KC5A 4LF8F 5DQGA 1ZETA 3G87A 4KO0A 5ADZA 3ZX2A 1CQNA 3UN2A 1VRQC 4IJAA 3AA2A 3CTRA 4B8CA 4OI1A 1QJHA 3CCUN 1QVGR 3RB6A 4H8KA 2IVFB 2HFOA 1W2BM 2JVOA 2DH9A 4CJEA 2LEAA 1TKXB 2XEXA 3HL8A 4FW2A 3HCXA 4OHWA 2YNHA 2OI2A 3SBTA 2N4CA 5TKWA 4DV4J 2K7JA 1KNZA 1HA1A 1UFKA 2DCLA 3TQEA 2QEXN 1ACMB 5K14A 2CZ9A 3AJ1A 4DTXA 4IH7A 4BWMA 3S1TA 1KVAA 4OYWA 1X4EA 3CSKA 3SJJA 1M90O 3C7NB 1HNWJ 4KSEB 4JI8J 3OTOK 3VGLA 1IWGA 2ATQA 2KB2A 1D9FA 6AT1B 1KRPA 2BMBA 4M63C 2CZ4A 2RQMA 1S9GA 2WOMA 4DX7A 3EPGA 1ZH5A 4F25A 3V4IB 5KG5A 1VC6A 1RA6A 4QW8A 1NGCA 1EB0A 4BROA 2MLYA 4GVBB 4KJIA 4FP9A 5KOWA 4RO0A 4ZTJA 4ZVGA 2CQBA 1RDCA 4KI4A 3BSAA 4ZA1A 1R8BA 2PBDA 4DU1A 3QQCD 2GWJA 4FK2A 1KLMA 2Y0BB 3W5XA 3TARA 2FSKA 1TL3B 3QIPB 3MAAA 1A9NB 4HACB 3SK3A 3PG9A 2V7YA 2DGVA 3I56S 2XSFA 4YQWA 2W1BA 4U6PA 1SKWA 3OFEA 1R43A 1RT2B 3UKUA 2EFPA 5DM7L 4YR0A 2XMKA 1Q4RA 2ZUAA 5AXNA 3L3VA 4UW2A 5BN8A 3ZSZA 1SJ1A 4ZCMA 2AJ1A 4I6YA 1QAJA 3VQ9A 2BKOA 3FSIA 2BBEA 1HW8A 2CFXA 5BRFA 2C2KB 1V9OA 1R3NA 2RF2A 3D54A 4FDFA 4Y2KA 4BREA 5F2RA 4I2PA 3RW7A 4JB8B 2CJQA 3U1MA 3PHTA 2QK9A 2VG7A 2HAIA 3DYAA 1TUVA 2A2CA 5MLCV 4WP3A 2MKJA 2PDAA 3MR6A 1P90A 3EGWB 3G4SN 3OL8A 2AEFA 2X3DA 1U6ZA 3CFRA 3BN7A 1CJVA 1S22A 5EWGA 2G8HA 3NNCA 3ZTQA 3P83D 1NNDA 5EDWA 4ZP6A 5GAGI 2P9PA 4Z7CA 3ZZPA 3MXHP 4DN0A 3CC7N 2K3KA 2OSRA 2Q97A 4HCBA 1P8ZA 4OJRA 2P9LA 1CJUA 1RUSA 4N8OA 1J54A 3C6HA 2D3UA 1E4FT 1FWLA 3IG1A 2BM0A 4EP4A 3QGPA 4OVLA 2YJFA 4JI5K 2WUSA 3MM5A 4LD0A 4J9RA 4GC7A 2C2ZB 3G6XA 4C9DA 3PACA 4E0DA 1GOCA 1JCEA 4BS2A 3DXSX 1HNXK 1T9UA 4CZEA 3EYZA 4CHNA 1WD6A 3JXOA 4ZCKA 3V9XA 2V7ZA 3TABA 4J90A 4FL9A 3ZC4A 1WEXA 1QTMA 5D3GA 2YQ0A 3MX2A 3W9HA 2CJBA 1ZBSA 2OEKA 4JI3F 5AQNA 3FC9A 3Q8VA 3CJRA 1BCOA 4JKEA 3SI6A 4C3LA 2CQ4A 2XQCA 2B8QA 1PAEX 2ZDPA 3AB2B 4YDDB 2OKQA 2XY7A 2NRXA 3HI0A 3LGHA 5A2QY 4K25A 3HT0A 2ZJQL 2ASMA 3ZZRA 2KFZA 1V3ZA 4OYZA 4H54A 1T9WA 5KPTA 3JAMY 3C2PA 3MFHA 1HKGA 3VAJA 3MK6A 1UEVA 2EPIA 3RBXA 1B92A 1NBWA 2WSCC 3BF4A 3VQQA 2UUBJ 4NYOA 4OZLA 3NGIA 4RR5A 3CCQS 3VZIA 4QIFA 5LL6Z 2FY8A 1VSJA 1C4AA 2IIHA 4BGAA 4K7QA 3MXJA 1CSJA 1JXEA 2H54B 4PAAA 3TVKA 2CPZA 2V2KA 1K47A 3HJFA 3IR5B 1XTZA 2BRLA 5KOXA 3TYTA 2MZ1A 1KQGB 2RHKA 3DRRA 4EBEA 3OPKA 3IFEA 4OYOA 1L3SA 1UAXA 5L1KA 4KTWA 4HTLA 2Y1LB 1NJIO 2LQ9A 2UUWA 4U8VA 2QXLA 2YWKA 3G82B 1N32J 3KWIA 3QZ7A 4DL5A 1B9DA 1E6YB 5EWEA 3QWUA 1UL3A 4E7JA 2FZCB 5GAHP 3UCUP 3DYAB 5RUBA 3UNGC 3ZNUA 3PDNA 1S6QB 3T1YK 4YB5A 3R2CJ 3QWPA 2FHKA 4YOVA 3CJTA 2YQ3A 5CAAA 4DV2K 5KPRA 4FZXC 1RAJA 4CJSA 3GG0A 1R8HA 2MQNA 1Z05A 1FRXA 3GJTB 4BC4A 1U2RA 4YS2A 3KD1E 4UUXA 4B3MJ 3VEOA 2HRTA 1FJCA 2E1ZA 3NBPB 4F9OA 1DTQA 4JD2B 3NL0A 2XZTB 1SKSA 2JOQA 1OH7A 1FE0A 1J27A 4CJWA 3KDNA 2Z1JA 5A8RB 1VFJA 1MWMA 4V19J 4JV5J 2NZTA 1G15A 4UY8O 3NVKA 3GFZA 3RTVA 3TUIC 2DKOB 2UV8G 3M1FA 1OSDA 2L41A 4KHNA 4GW6A 1WKKA 1ZM9A 4FZYA 5IM0B 4NEYA 2VFTA 3Q22A 4V19X 2VD3A 1YRUA 2CQ3A 1JNRB 1Q9XA 3PIOQ 1Y3KA 3U8XA 3IBWA 3UDCA 2ROPA 4DPOA 2LEBA 1T3OA 1S0MA 2KU7A 4K50A 3ZT4A 2CQDA 2RE2A 1FO1A 1JJCB 4L6V3 1HBNA 3O1WA 3LGNA 2PE8A 4KTQA 2XY8A 1VQSA 5KFJA 2YNFA 3ZZZA 4LREA 2OZMA 2WRMA 2UXDJ 2VFUA 3JQMA 4E3SA 1UVNA 5E26A 5I3QA 4XPEA 4Z4EA 2B51A 5KG2A 2GHWA 4DSIA 1LW2B 1FNMA 2B4JA 2QL5B 1DKGD 2RT3A 3LF0A 1XMBA 3TW0A 3V9ZA 1RAGB 1EETA 1XI1A 4Y2CA 5AT1B 3H7HB 3IWNC 2IIRA 4WYLA 1AFJA 3H3OB 4DL0C 1KTVA 2X7IA 4EIAA 1WSVA 4GNIA 1EKSA 1QSYA 2YHWA 2P2CB 2YXLA 1YHQN 1QE1A 4PXEA 2UYTA 3HSDA 2B7BB 3J81U 2HYIB 4IH5A 3IA0A 4IFVB 2IVYA 1ZM2A 5F1XA 4WTOB 1V6HA 3K5LA 4FM0A 2XI2A 1B0VA 3W63A 3F73A 5HBMB 1HWIA 5LSRA 3OXFA 4Q2MA 1F2HA 1WSRA 2LKZA 3BZQA 2GTDA 3R2DJ 2FBYA 4M3RA 4LRFA 4TU9A 3UW1A 3P39A 1C0UB 1RWVB 1M1GA 2F8SA 4PL8A 4DV5J 5AXLA 3MEDB 3TA0A 4ENOA 2B9YA 4YNQA 3WDOA 1J2VA 4E89A 3TX8A 4BWJA 1RHQB 3R5AA 4N77A 1MN9A 1OYEA 3VEVA 1FDBA 3ZO7A 2GVDB 2LDIA 2GUIA 2NXUA 3QJLA 4LF7F 2FVQA 3H5SA 3T69A 4U8YA 1XNRK 3EE3A 4IG0B 1VBKA 4FPAA 1SH3A 2AX0A 4LF4F 2DY1A 1FKPB 2VIHA 5HQ8A 3W64A 4JKFA 3HVRA 3AJ2A 4P9SA 3D66A 3U3YA 3OVSA 4Y28C 2DBBA 1VBYA 4LF9J 4LQ3A 1FXXA 4ZHRB 3DXKB 5SZTA 3H4BA 2QWRA 3T7ZA 1Y5LB 3VQPA 5M1KA 3IXQA 5M2PA 3H8YA 2RILA 3PZPA 3ZX0A 1AZSA 3M3ZA 2BUPA 5K8OA 5GIOA 2R9LA 4PWDB 1RK8A 4CGDA 3SSQA 5JJBA 4BRGA 2MDAA 1SJ3P 2V52B 2ZJRL 3HZ6A 1FI4A 3FQKA 3RSEB 2B4OA 3GIKA 3AD7C 2ERRA 3LPUA 3HPGA 1FCAA 1RT7A 2IM1A 2W2NP 2ITMA 4MK8A 4RG8A 5I9EB 4HLBA 1HPMA 1WI8A 3H20A 1RBOB 3CI5A 3LWMA 4JI8F 3AVGA 3NMUA 1NSPA 3K9KA 2HHSA 4URSA 3CDAA 3NF9A 4FWSA 4YY3J 1Y4ZB 4PZVA 5KT5A 4PXDA 3TAMA 5HRPA 5D15A 1WHVA 4CZFA 4BCAA 4OHZA 1Q86O 1RKJA 1HWKA 1CXQA 5KFAA 1J5EJ 4FNHA 5KT4A 3B8AX 1WSIA 4CLWA 3BREA 5L39A 1IKVB 3KVGA 2OZSA 5KT7A 3R8EA 1Q7LB 3D6FB 1VQ5N 3EO3A 1LW0A 2WBRA 3MEKA 4LFBJ 2DB1A 3GE1A 2WVDA 4MMOA 4DKWA 1ZTWA 1PKUA 1QTNB 2IJNA 3Q7CA 1CJTB 4U7UK 1TK8A 3BGRA 4LSZB 2ZBQA 5CYJA 3EPIA 3PVXA 3F2KA 4MT1A 4BVOA 4UF4A 1VJWA 1K8KB 2KVIA 3ZZYA 1P6TA 3ATVA 2P9SB 4ZMMA 4IRCA 4U95A 3I0SA 1RDRA 3DGPB 2RQKA 3P5TL 3SFUA 4N56A 4CD3A 3QT6A 4J9UE 5C42A 3OXGA 4JKAA 5AQYA 2GO9A 2D0CA 3BO2A 1S0NA 2Q2RA 1FESA 3KWGA 2GS8A 4DV3K 4DV6F 1FFWB 4J9OA 3K8VA 4Y6IA 2AP6A 2HVHA 3BDPA 2AJ2A 4DR5J 2E2NA 1KR4A 1FRMA 2WZ1A 1VCTA 3IGVA 2JDJA 1XNRF 2OPRB 3EWGA 9ATCB 2XSJB 3JS9A 3J7Z5 1VQKS 2XHBA 3DLGB 1SL1A 2DH8A 2CH6A 1XMOF 4YHHF 4BRMA 3A0IX 4CHPA 2O8BA 5HMZA 4QWBA 4BY9C 3PLAA 4OZNA 1R0AB 4L74A 5AZIB 1ZBIA 3MR7A 4MDAA 1WOSA 2GGPA 1HLWA 4DV3J 1J9AA 2ZFHA 4HYKA 4ITSA 4L75A 2B6AA 4P75A 1G3OA 4OJ1A 1NPPA 1RT4B 4LUBA 5C25B 3W8GA 5ETLA 1B99A 4DPYA 4ISGA 2ZE2A 1UETA 5B0GA 3THTA 5AQZA 4MLHA 4CZLA 2ASDA 4FYDA 4WF9Q 5HP1A 3N4QA 3AOAA 1NJWA 2D1CA 4U7BA 1RYRA 2U1AA 1R27B 1O51A 1WN7A 2C2OB 3EN9A 5AQRA 1BA1A 2UUAJ 3MCOA 2LVWA 2Z56B 3R3TA 3GCWP 3MN7A 2KT5A 2YBVA 2IA6A 4OZ1A 1DLOB 1WF2A 4FZZA 3LTOA 1AUDA 1N36J 1B0TA 2UUAF 3AFGA 2B5JB 4LT6A 2B4UA 3H0PA 2ZZNA 2F8EX 5B0CA 2V2VA 1FF2A 4CH7A 4LFAK 1BISA 2AT1B 3GB0A 4I7FA 4LF5J 4CEBA 2X3GA 1NJXA 4JK9A 4R25A 4OHVA 2QTDA 4K8XA 5A0YB 2OH2A 3D1QA 1KQKA 4CCHA 4UZBA 3V1RA 3OYNA 4CJ4A 2E7WA 1D9AA 1V3SA 3H1VX 2UUBF 2I6WA 3BSOA 3UD4P 4DQPA 2OD6A 1SQGA 1C1CB 4RNFA 3GL1A 3UE2A 4WQ5A 2V63A 2J76E 4IOAQ 3V2UC 4IEIA 3S3NA 3PYEA 4K2XA 3OUYB 1U6BA 2E1MC 4AUKA 4KB7A 3EDRB 2HZCA 1R0CB 1LK5A 1XBWA 1RU2A 4DB3A 2IA0A 2HHQA 2GVZA 2F96A 5FJ4A 2MMYA 3FR0A 5F8HA 4FWNA 1U1MA 2MSTA 3LGMA 2DPIA 2KW4A 3ZCMA 3UKRB 2I8EA 4CYUB 3JSYA 4WFZA 5CABA 5F8NA 5D0HA 3VEYA 4EAHD 3JYTB 4OKJA 3LWLA 3GOIA 3HFZB 4WZQA 2Q6CA 4ZVSB 2FJAB 3R97A 1NSAA 2DH7A 4GKJF 4ERDA 2RHSB 3M2RA 1BC6A 3M8YA 2XYHB 3WQPA 3ZLJA 4CJ7A 4KHMA 2LP4A 1TFYA 3ATUA 1HIYA 5D4OA 1HQUA 2VHGA 5D0EA 2BRKA 4UOCA 2ZF5O 5B7WA 3E2EA 3DU5A 4KKOA 1SH0A 2NYIA 1O1WA 1XHXA 3W2WB 3B82A 2KRBA 4RW9A 3EZUA 4CO1A 1VJQA 5AQSA 2VU5A 3R27A 3MPVA 4CI6A 1B70B 4FSVA 4Z4CA 2GA7A 2Y8WA 2DHHA 1XJWB 3I9ZA 2PAVA 1RA7A 1N5YB 4ZJLA 4PUOB 3MCMA 4ZLJA 5KG7A 4B3SK 4C3KA 1QAYA 2JNJA 1H7XA 1TVRB 4LRDA 4ZLPA 4HEA9 4NLTA 3OVNA 3H98A 3BB5A 3H08A 2V2ZA 1VDHA 4JI0J 4Y65A 3KK2A 5GAHI 3OBYA 1Q78A 4BDPA 1MSWD 1IR0A 2IC3A 2XG8A 4IO8A 2E44A 3VQ8A 5HATA 4CD1A 3HDSA 2BANA 4OPKA 3MOZA 3P5BP 1HNWK 2A18A 4MYTA 3S7RA 1WSEA 3SCXA 4X4UA 5GMDA 4KV8B 2VQEJ 1NWKA 2W4PA 3ZEUB 3MWBA 2HFNA 3CPWM 2GJIA 3ID6A 1IKWB 3I56N 2CQIA 3CM5A 3M05A 4FWMA 1TKTB 1RYSA 4FJNA 4B1UB 4JN4A 1X4BA 2D9OA 2F4VF 2VPWB 3DXMA 4CJRA 2E5LJ 2VYPA 1MWKA 1C4CA 4YHHJ 2GQQA 2HIQA 3GMGA 2P9UA 3FZLA 1JLCA 4RW6B 3WQTA 5HLFB 2W7PA 4RUAA 2GV1A 1FJ7A 2CQ0A 2WC9A 5FPNA 4NRTA 2P6TA 5AE2A 5DQIA 3MMAB 3KLIA 2H4WB 1WTBA 4DV0J 4IG3A 3J7ZO 1U2FA 2MKKA 3VESA 2AZ1A 5M1OA 2R2SA 5IT9O 4ZN3A 4DDFA 4DV7J 1C2PA 3E3XA 2FHJA 2LDYA 1YJNN 1U1QA 2ZNYA 5U47A 2GIFA 3ZX3A 1QVGM 3VWSA 1K9MO 1RE1B 2OMLA 1IG9A 4DSFA 3US5A 1M1KT 3AVMA 1Q18A 5FRNA 1XUPO 1HQUB 4JHDA 4XH1A 1J5OA 4BRHA 4ZP8A 1TK5A 3GG4A 4M94A 3ZSXA 2AIRB 4IKFA 3DM2B 4H5WA 1LWCB 3AO4A 2G8FA 2OEMA 2FY1A 2RHQB 3QJJA 1JXVA 4LFCF 2G0CA 2PMHA 3SEOA 3WIVA 1RT6B 2AMCB 1LWEA 3OR1B 3LP3A 3MAQA 4DL7A 2ZJPQ 2BABA 3MDFA 3NGRA 3I5CA 1BQNB 1AB8A 2DIVA 3BH7B 3D2FB 2CVEA 4HWIA 4DCPB 4BR0A 2V0NA 2CYYA 4NLSA 5EX5A 2HMPA 2JRSA 3ZTRA 1FD2A 4C11B 2Z1GA 1OMSA 1BHNA 3QETA 4JKDA 5LJVA 4CJ5A 1KVJA 3SBGA 2FBTA 4QR1A 2BXJA 5IZHA 4U96A 3BSCA 2QIFA 8RUCA 1XR7A 2PFDA 5DJBA 3ULEB 2AYMA 3TA2A 1NGBA 4X4NA 2EC0A 3DXMB 4FJ8A 3OV7A 2KXNB 1JLFB 3HO1A 2P5OA 3DLBA 2YHBA 4B3OB 1D8YA 3QO9B 2O66A 3ET6B 4OI0A 3OYBA 2H51B 4ZS6A 4G1IA 4CF8A 2J0WA 3IRXA 3DC2A 4KH4A 1UW4A 3DHWC 3CJKA 3GR1A 2V94A 3SMZA 1RAHB 3T6BA 4FZVA 2OIHA 3RMDA 1VQPS 1QVFM 2IDOA 2QL7B 4NMXA 3IMQJ 3OY9A 3WNFA 1YWXA 3A3PB 5AQJA 4QR0A 3TSPA 4DR7K 2DNMA 1WC0A 2QSWA 3A13A 4M5LA 2IVOA 3LP2B 2P8IA 4DPXA 1CLFA 3LDOA 1YVFA 4DTSA 2IVMA 4E7IA 3IC1A 2UUCJ 4EU0A 4FLXA 3V6JA 3FEYB 3UD5A 3O8MA 3MMBA 4DU3A 2R7OA 4B3TF 2WAQD 4W5QA 2ZNZA 4ZPDA 3G86A 2BOPA 1Z2ZA 3GYXB 3NY0A 1WSHA 2B4VA 4TY8A 1CPZA 3WIUA 1Q81T 1JCGA 5CQGA 3W7BA 4ZVTB 3WNEA 3AQOA 2GGPB 5AQQA 1ZBTA 3NOGA 2VG5A 4I4BA 1PJ5A 4DEZA 4O4GB 4C1NI 1CC8A 1Y3JA 1CJKB 1HD0A 1IUJA 1QVFR 3LDSA 2FJVA 3KFWX 3DLGA 2VOPA 1VAZA 3C15A 3TA1A 3OYJA 4HKQA 3QEPA 4DV1K 3N79A 3PW0A 1QHTA 2PI5A 1UJ6A 3FCWA 3PTWA 1WSGA 2K3IA 3CIPA 2QA4N 3GQCA 2NUBA 2HBJA 2UXDF 3A3NB 3CCWA 1KQFB 3T41A 4CLUA 2OYQA 1TZ0A 3ENHA 1S6OA 3JTOA 2W9BA 4LSNA 3V4MA 2RNEA 3MUTP 5J2NA 1CJKA 3OYLA 1TK0A 4RBUA 5G4DA 3VV2B 1ELOA 1RBLA 3OUYA 4CZJA 3ZZUA 3OQ2A 3HHLB 2HMIA 3J7AP 4B1YB 3S3OA 5AE3A 2V67A 4USHA 4WTYA 3AA5X 3FZHA 1WG4A 3MECA 4KPYA 1YDLA 4CHQA 1YIJS 4O23A 1HKCA 4CIEA 1F9HA 3CO9A 3AO5A 3VEZA 2Q1LA 3DJCA 1IKVA 1NDCA 2VQEK 3ILLA 2ATLA 2VFVA 4B9NA 4F4KA 3I82A 1WC6A 4M42A 4EZ6A 1L5UA 2FVSA 4I7FB 1IVZA 4HVZA 5D77A 3D7SB 1RT5B 3LUYA 3O2IA 3PRVA 1CLQA 5SWMA 1C0TA 2K06A 1HR0F 2E9TA 3VN5A 2ABYA 2MQPA 4YR2A 4M5GA 4M3YA 1UVJA 2CJKA 3H42A 4AHTA 5AQLA 1T9XA 3F5TA 2RMLA 1YXQA 1V4TA 3JSBA 3CVKA 3S6EA 1NK9A 4X4OA 3GIRA 5DG7A 5F0UA 3W9JA 1K0VA 4QS8A 2VQFK 2CH5A 1GMVA 1RQ0A 2OD4A 1VGYA 1UA1A 1SIZA 1JLFA 2FB0A 4H0OA 3OLAA 1TAUA 1RCXB 1Y97A 4ELTA 1UZHA 3EGNA 5I4MA 1FERA 5KGXA 4ZKAA 3J80O 3Q24A 3GONA 1BUPA 4WCEQ 2C2RA 1VQ7N 4RNHA 3GV5B 2CPJA 2HMIB 3I32A 1O13A 3GR0A 3KOAA 1TUGB 3AHPA 1RDUA 5AZIA 2O5DA 2PEHA 1N56A 2WTUA 5JVHL 2O8BB 5CE3A 4ZHRA 2FBVA 3DXKA 2XI3A 3C0BA 2J9CA 2HGMA 3AVNA 1YJVA 3QLHA 3A5LC 2NXJA 2W2OP 5JLFA 3AA8A 3MHYA 1CZ9A 3BP8A 3NE6A 2RE1A 5THWA 2UXCF 3KK7A 1S3XA 2VASA 3KLVA 3OL6A 2QW9A 1U8SA 1S5ZA 3N5BA 2G2YA 4D3GA 1WSJA 4IOCQ 4KHQA 1WUAA 2DNNA 3ISNC 4J9QA 4EFAC 3WQUA 1ASWA 4CGHA 2HQDA 3TAEA 1GX6A 2UUCK 2BANB 1LWCA 3MEDA 3GYGA 2E5JA 3NCRA 5CZVA 1UPMB 4HTIA 2GX9A 1Y10A 4FWQA 3DGPA 3GFXA 1PYSB 4F2SA 3TVYA 4ES3A 4YB1P 3SQ1A 1N54B 3E9OA 4MTPA 1RDAA 1UKUA 1C0FA 3BF3A 3VA0A 3MM8A 4CEAA 4GC6A 1L3TA 1XERA 2XB2D 4RZRA 4YN3B 4OX7A 3LDLA 5FROA 3IM8A 3HSZA 4AHRA 4PY5A 1ZAXA 2DXDA 2HBLA 4IH6A 4KGMA 1WF1A 4LFBF 3DLRA 4DCOB 5HLFA 3TP2A 3A12A 4C0OC 4N76A 1U24A 3LP0A 2LU1A 1K6YA 3A2FA 4NWBA 1NGIA 4AQYF 5KFDA 4DR4F 2W2QP 1U1NA 4JV0A 4DU8A 3J80U 5D6GA 4HI2A 1RAFB 1KAYA 3TPQA 4CZMA 2YX1A 4QBUA 3VQEA 3R7BB 4M63A 4XDDA 2QYGA 3FVYA 3CC2S 5F3TA 3OVBA 1OY9A 3KHGA 3U3GA 4DBQA 1N34K 2W2MP 2ZGZA 3HFVA 4K4UA 2MYFA 3AO3A 5BR9A 5DK5A 3R3LA 1S1WA 3HM8A 3MF5A 2O3DA 1IKXB 3VAGA 1D0EA 4P7VA 2JX2A 2D7SA 2AHOB 5F9NA 4KHPJ 1U48A 3VAFA 3M2VB 3SCIE 4C6AA 4JS4A 1LFWA 3CMES 2R2TA 4GO7X 3K59A 1CQMA 2VKRA 1H72C 1GLFO 2HS3A 4V1Ak 3MEGA 4NLVA 4IZ9A 3SPZA 1N5TA 3LH2S 4F0KA 2GHVC 1YVNA 3MZIA 1VK0A 2K7KA 2VA3A 3CXCM 2RKIA 3TTDA 3PYFA 2PMWA 4C11A 4OYAA 4DV0F 4ILLA 2F8HA 3QSYB 4B3TK 2AW0A 1WAJA 4M3ZA 2R7TA 3M2VA 4FYVB 4JD2A 3MUMP 2A6AA 1RBUA 2BTFA 1X4AA 2R8JA 5CA5A 2XNQA 3PX0A 4FJLA 1FK9B 3MFIA 5GAEI 4L73A 1N8RO 5AZJB 4HUFA 2GVDA 4C3MA 5BRHA 1BOTO 2V4RA 3QGIA 4EMDA 2YPYA 3FMBA 2ZWPA 4F2RA 4A8MP 3PNIA 7FD1A 3MX5A 2NPFA 3A1YG 3KLHA 4M5MA 1VK3A 5F8GA 2EBEA 1OH6A 3IKMA 2E29A 1Q5VA 2JVRA 2E5LK 3W1YC 3MPDA 3UDEA 2HF3A 3AVFA 3I96A 3AVAA 3H90A 1Q7YT 2DHGA 1G1XA 3I87A 1VQ9S 3G82A 5LMNJ 2HZVA 5KPZA 4KHSA 1KFDA 3NOCA 2QG9B 2I9SA 3N6MA 3LDNA 5LMNF 2F5GA 4JEPA 1M1HA 2XHCA 4F4ZA 4AFFA 9RUBA 2IYGA 2HNYA 1S1TA 1JL1A 4HT5A 4O3SA 2E2PA 1WEYA 3H5UA 4A4JA 3B4MA 3HF5A 5AQFA 5IWAF 3U6FA 4XAKA 2VBYA 2ACMA 5AR0A 3UPFA 1S72S 3HSGA 3N01A 5K9FA 2DNHA 1S5JA 5KQ8A 1ROFA 4CF1A 5J2NB 1LW2A 3TR5A 2G8KA 5BYSA 2HQCA 2Q66A 4MKAA 3ZTPA 3SQ4A 3ZEUA 2IM0A 3W8PA 3SZ2A 4CZIA 4JI7K 5I3PA 2OPRA 4CO4A 2MSSA 2XLJA 3OL9A 4DQSA 5F8JA 3QINA 1VQ4N 2N82B 2NLXA 1RHJB 4NX9A 4K4SA 2O67A 1Y64A 2ZEJA 2CIMA 1SS6A 2LSNA 5KG3A 3OYIA 3KK1A 1YJ7A 2BQRA 5JXSA 1GQEA 1KOOA 1OQ6A 4UTGA 2X51A 1RI7A 1GXUA 1RCHA 1VQ8N 3KK2B 3Q86A 4CRJA 5HO4A 3D7EO 5CR4A 5GAHU 1TELA 2P9NA 4J9SA 2AKWB 4F0HA 5C42B 2AWZA 5AJ3F 2DR6A 2YX4A 3VF6A 2G8UA 2GAGC 3S3MA 4ZPBA 3HVTB 1S6PA 1F0XA 5L9XA 2C2MB 3AH6A 4W98A 2HHWA 4NYNA 3FCVA 4O3PA 4LF2A 3JTPA 1HWJA 1U7LA 4ED1A 5E3PA 2ZE2B 2MKYA 2RH3A 4GVEA 3FEXB 4DV1J 2RQ4A 5H9FJ 2RVJA 4QYRA 1FRHA 2QWQA 2HBKA 4ELVA 3C16B 4J8FA 4J2EA 4JKGB 2UVRA 2L9NA 3Q23A 3W2WA 3HI9A 1S77D 4DR3K 1D8ZA 3MD3A 1LXJA 1EQMA 2BE9B 1JL2A 1D1UA 2ZH2A 1YJWN 2G0IA 2WVFA 3V5RA 2OA8A 1L3VA 2DYAA 2R8IA 4KB0A 4AQYJ 4XIUA 3M6GA 4WBFA 4LH5A 1L3KA 1S6QA 3NCIA 3ADAC 3M30A 3LL3A 3BBCA 4MKVA 1MW7A 4CEEA 3H1QA 5GAGP 4NPOA 3KHYA 2DNGA 1PBAA 3WEEB 2J7KA 4ETZA 3O6QA 4WJBA 1S7HA 1NJZA 4WYWA 4JV2A 1S7IA 3UQSA 3CDUA 3IRXB 3J8AA 5M1FA 2OUGA 2VPYB 1FJEB 2J0QD 4YB7A 2R7YA 4ZLNA 2ADBA 1Q1KA 3TUPA 1FKOB 2PYLA 2OPQB 1PBUA 4W92B 2A41A 3RRHA 1FJGF 2HHUA 3JAMO 2MPUA 1SV5B 2F3JA 3DRXA 2QWNA 3NH0A 4CZHA 3AQPA 3MPYA 1J53A 3G8TA 3QEVA 2KT2A 4JI0K 2GJ2A 3J81O 4NCGA 4FM2A 3CC4N 5AQMA 2IJFA 4ECUA 5AQUA 3IP0A 4IRKA 1N34F 1Q8LA 4E8UA 4L3NA 4Z7YA 1KN6A 1VQLS 5MLCQ 1RBVA 2HHPA 2Q0UA 4I6MA 4BR4A 3OHAA 1VQ8S 1FRLA 1WLJA 2DHXA 5A0YA 2QSFA 4LRCA 2NZCA 1HX1A 2MKSA 4DFMA 1EQ0A 2D0OA 3DHXA 4M7YA 1QUPA 2ZVIA 4PKIA 5E0OA 1VQNN 2RUGA 4OX9F 4KREA 4MKYA 1QD1A 2HFSA 4AE5A 5KRSA 3CJAA 3TAMB 1WTFA 4DL3A 1IXKA 5EX3A 3C6TA 4MH8A 3QSIA 1X5SA 3OR1A 1WB9A 3HD1A 3M30B 4LF6J 4OYPA 3CCSS 3QAEA 3KUHA 4LRBA 4JYAJ 4LF8K 3C15B 1PILA 1N33J 4XO0A 1BL3A 2AJQA 4LFCJ 3H25A 3RMBA 4W5OA 1DY3A 4FWKA 2H65B 1N33F 2HBRB 5C2GA 4W5TA 5HP1B 4DV0K 2CWXA 4Y0WA 1JJ4A 1U09A 3RGIA 4AXIA 2RRNA 3WUHA 4JV5K 3CJ9A 1URNA 3U4LA 5HSPA 4CHZA 2CG8A 1OH5A 5BJRA 4PPDA 4FNIA 3C6AA 4HHHA 1BQXA 1FNXH 4USUA 3CUNA 1R7IA 1SC1B 1S12A 1K73T 4G65A 3G6ES 1HHQA 1N8RT 1U6FA 3F0NA 1R0AA 4EYIB 4YB6A 1JWWA 1OVYA 4JK8A 4CGIA 5E33A 5F9LA 3CF5L 4BRCA 1JLEB 3PRDA 3OJUA 2ZJRQ 4DV5K 2BR0A 2P9NB 2E5HA 2ZJPL 4Q2LA 2W4DA 4K59A 1FW6A 1SKRA 1X5PA 4DHVA 2JH3A 1H74A 3T9ZA 3GU0A 3CCEN 1RT1A 1HLUA 5LMNK 2JL9A 1S79A 4E7HA 4N41A 1XNQK 2MKHA 2KM8C 3KUEA 2CKWA 4CLZA 2YVSA 4K5SA 1HQ2A 1VSDA 1Z2LA 1PAUB 3D2WA 3T1YF 4DFKA 2MZSA 2A1BA 3ZETB 2PIIA 3UFCX 2DGUA 3QFHA 4W5NA 2FGCA 1RTJA 4AXJA 3L7UA 3J7A1 2CPIA 3M7VA 4DR1F 3OBWA 1XR6A 4KH6A 5KFTA 2IAJB 2E5IA 4KBIA 5HANA 4YOWA 1X4CA 2KI2A 3RR7A 1I94J 4X64K 3A3OB 2BEFA 1VSIA 1NGDA 2NUUG 4C4WA 4B3TJ 2HNYB 3IRWP 1I94F 5FD1A 3H5XA 1FNOA 4C8OA 4PQAA 3M9MB 3G0ZA 2NRZA 5AQWA 4A47A 5C2CA 1S72N 2QMXA 2Z4PA 2YJEA 4CDIA 1U1OA 1DJ0A 2VH7A 4IDKB 3G10A 3BSNA 4BQZA 1YTUA 1UVKA 2ALZA 3CULA 2DT9A 4B9TA 4CGGA 1IBMK 4WFBQ 3SQ0A 4CBXA 5D78A 2CNKB 3PKYA 3ULDA 1GLBG 4DXLA 1F9FA 5DM7Q 4TLQA 4M41A 2E5GA 3IO1A 4K42A 2XULA 1P8GA 4URQU 3M2RB 3KKRA 3SFGA 3QEWA 3IBCB 3TRGA 2EXUA 2QL9B 2O8CB 2WCXA 2NNWA 3TQ1A 3MM6A 3QNWB 3QESA 3KHLA 1JLBB 4AILC 1FK9A 4DPUA 1X5TA 1NO8A 4CYUA 3NRBA 5F8MA 4LF8J 1RT7B 3PO4A 4DX8H 1R8AA 2R8GA 4FWPA 5F3ZA 3I55N 4ZTFA 5AQKA 1RTDB 3EZWA 3HHKA 2GMJA 3MMCA 3PHEA 3ISND 4CQ1A 2I38A 3SNNA 3CCUS 1QQNA 1ZZFA 3O9RA 5BYRA 3AODA 3SQGA 3KHHA 1DFDA 3LZIA 3OYMA 1FJGJ 3MEEA 2Z57B 2DNPA 2JFDA 1W25A 3QGHA 3AB4B 2ZQBA 4OI3A 1S57A 2DIUA 2Z1HA 3D0GE 1NOYA 3O9QA 3HHLC 4JK7A 5ETQA 3C6UA 3DU6A 5BR8F 2PFUA 4RNNA 2DFEA 4JUZA 4IO1A 4J2AA 1C0MA 4IG0A 2Z8QA 1IKXA 5J2QA 1AFIA 1EXQA 2NRWA 1H2TZ 3LALA 1WHXA 4LR8A 4G1PA 4Q45A 4G3IA 4J9PA 2A6MA 4F0MA 1W7AA 3BV8A 4RJVA 4OKEA 1WF0A 1BMQB 4X62F 1LWFB 2AGOA 4WE1A 5JVHQ 3QAUA 4OGEA 4R8UB 5DRKA 2JEJA 4ILJA 3KJQB 1NJIT 1SUQB 4Q7AA 3AXKA 1TL4A 1LOTB 2UXBK 1S9FA 3ZXWA 4TXSA 4IR9A 2LEPA 1T05B 1REVB 5HAOA 3L2QA 3CCES 2DEJA 1Z26A 2FLPA 1HHTP 3CC2N 4CERA 4JI7F 1WUUA 2MTLA 2FHMA 1BIZA 1F5AA 4ZN1A 5G0RB 1NCLA 3EEQA 4NRUA 2LQ5A 4EO6A 5E7OB 2G13A 3LA0A 5IWAK 5I3UB 2EKNA 3MM8B 5F0WA 2A3ZA 2QLFB 2YI1A 3WX8A 4A8QA 3BO4A 3G6EN 1T03A 4ED3A 2DFHA 5BPMA 4AM7A 2QWMA 4PRFA 1EETB 2BH1A 1GXTA 4KE5A 5CH7B 4WFBL 3HXMA 1M1KO 1FFGB 1IJFB 2P9PB 4BGBA 5EY4A 1SVDA 3KXDA 3QRQA 3HHLD 4YFUA 4Z94A 4CJLA 3PM9A 4G1QA 4M8LA 4ICLB 4H03B 3SPYA 5L1JA 2M3DA 2OPPA 2Q36A 5JICA 1Q7YO 4C97A 3DAWA 1RWKB 4RW7A 4MIBA 5F0XA 1EQYA 4PG7A 4WQ4A 2GW8A 2H48B 2FZGB 4EGLA 2VFSA 3AV9A 4PKDB 4CT9A 5D4PA 5LY3A 4CH1A 3B6OA 2H5JB 1EP4B 5IM0A 5E41A 4RNMA 4K4WA 4GKKF 4CH0S 1RT2A 2AJ4A 2AYEA 4CO0A 2UV8A 3K7RA 3PW7A 2Q79A 3BQ0A 2P9KA 3OYFA 1CJTA 4NLUA 1N33K 1EARA 5KAKA 4CLPA 2K2PA 1KHVA 2A10A 1YK9A 1KLMB 4BC9A 3G71N 3MTKA 2ZD1A 4MLEA 3O1BA 2AYBA 2NXCA 1EP4A 1URRA 3D9BA 3AY9A 4E1JA 3DNCA 1LKZA 4LFAJ 1Q8IA 1ZBLA 3VEXA 4BR5A 5KFBA 4JI2F 1KLNA 4J9VA 1WOPA 1NSQA 4H4MA 4EBDA 5B0EA 3O5BA 1VR6A 4HUEA 4OL8A 1CULA 2VL1A 1OIAA 3BGOP 4FWRA 2M8DB 1BWEA 4IR1A 2ZITA 4CLSA 3SLCA 4EWTA 2YNGB 3MWTA 3MR3A 1TKZB 4H4OB 2BGGA 3W66A 2A6OA 2EKYA 1FX2A 3O8WA 3MXIA 4NXNK 2E66A 1ATNA 3DCAA 3HHDA 3VPZA 1BLUA 3ZT0A 2AGQA 4QZVB 5ADXH 4BQLA 4N5SA 2HG4A 2DNZA 3MURP 4TY9A 1U1LA 4JI6K 4I6WA 5KG1A 3DMJA 2MJNA 4GRSA 4ECSA 1IJEB 1P9QC 1X4HA 4B8AB 5IT9Y 2J7UA 2DNYA 2I2YA 1KP6A 2W9AA 5ADXA 3C66A 3R1LA 2G8IA 1WG1A 2EVZA 1JCFA 2QLXA 3FQLA 4K8ZA 3WNHA 3DKDA 3TO8A 3U27A 3VTHA 2H3EB 1F1BB 1FRJA 4NXMJ 3GBTA 2AYGA 3BJYA 2X6SA 4BR7A 3D45A 3MM7B 3I0RA 3WHIA 1REVA 4KI6A 5DDRC 1FKPA 1T44A 4R0JA 1RILA 4BR2A 1M5KC 2QKBA 1PYOB 2UVVA 4QR2A 1S1XB 3KG4A 4WK1A 2HNDA 1W7WA 3OHRA 3HT3A 1EIYB 2VWBA 4I6AA 4M45A 1IBLJ 3TUZC 3VGUA 4O3NA 1QQOA 2X1FA 2MZJA 4WE1B 4K0KJ 1GMUA 3EICA 3K2YA 1IBLF 3ASMA 3KLGA 1T3NA 2AEMA 1YJUA 4DQIA 4K0KF 5CZ2A 3M8WA 1NK7A 2EK1A 3R6GB 1T9VA 2X1BA 3P49B 5L8RC 2P9SA 2VBXA 4QIGA 3OTOJ 2LU2A 3FZFA 5C7PA 1AXQA 4MK9A 1MWQA 2BJDA 3GDQA 2FYXA 4TY8B 3K9JA 5FLXY 2BJ8A 2BE2B 3W2VA 4JAXA 5HMWA 1RBSA 5JS2A 2PT0A 4HH0A 1VC0A 4L3QA 1N6QB 3T1HJ 4CTAA 1WKLA 1KQSR 2ZVSA 4F3MA 1IM4A 2EC2A 3SQGB 4GV3A 3BF1A 3D6TB 1EKEA 1VSLA 4ES2A 1Q95G 2QWLA 2KN4A 3ZSWA 4P2MA 1YTYA 1C1BA 2OELA 3W3SA 4O5BA 5IWAJ 1NM1A 1KD1O 4CFDA 4CO5A 2YKNB 4LSLA 5KFOA 2DNRA 5DO2A 1NGFA 1RWWB 1X7VA 4HTJA 4CWBA 2BM1A 3NGUA 1SJFA 3P45B 2MY8A 3R9LA 3SMPA 1JX4A 2XMTA 2FVPA 5EVZA 1RSCA 2R4FA 5C2FA 3I5AA 4X65K 4RWTA 2BX6A 2O8CA 2NYHA 3RBEA 2P1JA 2EK6A 2I5JB 4PL7A 2W7AA 4R79A 2CGKA 2YKOA 2ZOFA 3IWXA 4WFAQ 2W25A 1IR1A 1X0FA 1GH8A 2QRRA 4CE9A 2HNZA 4M5HA 4N8NA 3M2UA 4P74A 4M3XA 1ZPVA 5HI7A 3UE5A 4A8FA 2DRBA 3ZFVA 1NK5A 1IQTA 3UKUB 5ETSA 2KXHA 4FLTA 2PI4A 3CNQP 4QWEA 2XYPB 2QLWA 5HL7L 3QB0A 3MAAB 3LZJA 2UZAA 4ILHA 3CMEN 3P5JA 4ZCLA 5IC6B 1HNXJ 1WNSA 1I5OB 2UVWA 2CGLA 1IN0A 1X8DA 1JNZB 1SAZA 3KHRA 5DM6L 5M1PA 1C1AA 3Q8RB 3MXMA 2ASJA 2WSEC 3DGVA 3CWJA 4L8RB 3PX4A 5ETPA 1BQNA 4NOHA 5T7BA 3FMWA 2ETJA 2HVIA 3M2UB 1NMEB 4CK2A 4YORA 1M5OC 3NS6A 5DGBA 4X66K 5A76A 2GC8A 3TVZA 3EL2A 2QWPA 3NS5A 3NCQA 3L2UA 1MMNA 1U25A 5KFUA 2CQPA 1ATSA 3DM2A 2NUHA 4ZCIA 3CC7S 1Y11A 1VQ6S 4DFJA 4YDUC 1B0PA 2A3JA 2GWKA 1AUSL 4DLEA 2BJ3A 3CJ4A 4B3MK 3QFWA 3LAMA 3KIOA 2F7VA 3V6KA 2HRUA 5DGAA 3P31A 3GJSB 3T5LA 4WFAL 2JFKA 4DF4A 4NLPA 3D2EB 3DXBA 5L9NA 3H59A 3RBZA 2P9GA 5DG8A 3DDNA 4TYBA 3KJVB 3JSMB 1WC3A 2QFJA 1QS4A 3UI3A 5GAEP 1TKXA 4DX6A 5DLFA 1RT3B 4JI2K 1NGEA 5JMVA 4CK1A 4CLFA 2R7RA 3V1OA 4M5KA 2L9WA 1N6QA 1LEOA 1M5PC 2K1RA 4DTPA 4CM2A 2HLTA 2B7CB 2DGTA 4PKHA 2XM3A 3W5ZA 4B1XB 3JSMA 1HNZK 3OLBA 2LCWA 2B9EA 1NGJA 3RB0A 1U2VB 5IT0A 2ACYA 4X4SA 2G4BA 4KH1B 3GP9A 2U2FA 2JEFA 3CCSN 1RHRB 2XZWA 2E1YA 2IGIA 4OO1J 1DEJA 3LP1A 1UEUA 2RS2A 3IN5A 2VJVA 2GHPA 3QPIA 5ETVA 5MAOA 1VIOA 2ZH8A 2AP1A 1P27B 4K43A 2W6KA 1S9EB 3AVKA 5BYQA 1LNQA 3SXLA 3GIIA 4A2BA 4DR6K 6FDRA 4LH4A 4QQBA 2OFHX 1TL7A 4KHPK 3Q7BA 2GEMA 4IWVA 2MB0B 5ETOA 4ZVFA 5KFMA 1NHUA 4DR7J 4UOHA 2YKQA 4PWWA 3KMQA 4JYAF 4B17A 3N28A 1KEKA 3RRKA 2NR0A 3KG0A 2B3TB 2EFVA 1ZC6A 3EZ5A 4R5PB 4J9MA 4IDHA 1OKJA 5DETA 3PIPL 3JAMU 3SQOP 2ZZMA 2D0BA 4JV5F 1XMQK 4DS5A 3UN3A 2C42A 2XGPA 4OYXA 4I6MB 3IAS9 3VETA 3PX6A 5KFIA 5B0DA 4DTUA 3Q0AA 2M0GB 5HRRA 4NLYA 4PG6A 5CYMB 4GV6A 7FDRA 2IOCA 4KT0C 1RHMB 1DHMA 3O1LA 2QA4S 4P10A 1RWXB 1GLEG 2YTCA 4JI6F 2E6MA 2BVZA 2ZWHA 3AA3A 4K4YA 2OTJS 3HLUA 2ASLA 3NVMA 3GJQB 1RBRA 2IRYA 3LAKA 4I9LA 3HMJG 4JI6J 1S6UA 2F9DA 3ITHA 1NZ8A 4E2FB 4Q0BB 3CO0P 1VLYA 4BRQA 3P38A 1SI9A 3CCMS 2XCPA 1VBXA 4X64F 4USMA 2ASYA 4ECZA 4FYWB 3JTNA 4NYZA 5KI6A 4I1TA 1KAXA 4RPFA 2JWLA 3A5NC 1SBRA 3CJ3A 4B02A 3MPWA 2WBMA 4DPWA 3F9KA 1N52B 1KS2A 1EHWA 3CD5A 4LFCK 1IBKF 3L4BC 3KLFA 3CETA 2G1DA 4IOBA 4V19S 4FPBA 2P9IA 2VQFJ 1MU2B 4NB4A 1HR0K 1RTIA 3THWA 3BPDA 3MAHA 1VSHA 2HEKA 1FVSA 1C1CA 3NNAA 5KFNA 1I3OB 4CZCA 3HHNB 3H2UB 1K9MT 3PR4A 3C16A 3CCVN 4K4ZA 3LANA 2V9KA 2P9KB 4B08A 2Y1RI 3T5KA 1MWYA 2GO8A 3WXKA 2FGOA 4I9QA 4E7KA 2E2OA 2MZRA 3R6LB 1VC5A 3HVTA 1VOMA 4OKKA 2E1AA 3Q8PB 1O8BA 1OJ4A 4PQUB 3J7YI 4LFAF 1O0PA 3RVCA 3CCLS 2LQBA 4TYAA 2OCEA 3QICA 1X4DA 3CJ8A 4FJ7A 1S4EA 2IVPA 2QI2A 1NRKA 3T1AA 2EFNA 3SIPB 3W60A 3KK1B 1TYQA 1TL7B 5A8WB 2C3MA 4HUGA 3AT1B 2OTLS 5LT5A 3Q8UA 1X3MA 4CBUA 3PR5B 5C24B 2DD8S 4DUYF 2XMJA 2VONA 1DAXA 4P7TA 4X2BA 4LY7A 2YCHA 1EKRA 3R5JB 3R8YA 1X5OA 5K8NA 1H3DA 4FN5A 1F3FA 1T9YA 2XMMA 4OZ5A 1IR2A 5AXKA 5DS7A 1YJ9S 4DR2J 5JUMA 2FDNA 2RUSA 5KTQA 4KGZB 1SL0A 4BRIA 1XC3A 4KGVB 1UWAA 3HD2A 3C8YA 4PXCA 4BE2A 2I1RA 5H1SQ 3CCRS 2F63A 4FVCA 2EBGA 3SUNA 3VQTA 2W9CB 4FJ9A 2OTJN 4ISFA 4ED4A 4RL1A 1CJUB 3IM9A 5ETNA 3VGTA 2ZH1A 3CCJS 2ATCB 5FPEA 3V9UA 1EJ7L 3OYGA 2WFBA 3TANA 1WC1A 2D74B 4X65J 4ED7A 2EW9A 1G7CB 3ZT2A 2ZKTA 3AVLA 3K5OA 1QSSA 4ID1A 3D28A 1TKZA 4H4OA 5M1NA 3SUQA 3PO5A 1K0TA 3BZCA 4BVPA 3DI6A 5A8WA 3M4XA 4GKJJ 1ZZNA 2J9DE 3C95A 2JSXA 4ZIWA 4DSEA 1NGGA 3HM9A 2AZ3A 4A8YA 3VTIA 4ANCA 1DZ5A 2NRHA 3CD6S 5J1PA 3VMFB 3VAMA 3VHQA 3D3CJ 1ZOTA 4JI5F 1TAQA 2AX1A 1ZBUA 2RSQA 1IKYB 3L3CA 4NLDA 3D0PA 1IV0A 2V4QA 1HI8A 4LBHA 2IDLA 4JI5J 3M32B 2WHOA 1NJYA 4TQRA 3O4QA 3UVJA 3OTOF 3TSUA 1FRIA 3AGRA 4BRKA 4CJFA 4JV1A 1S10A 3MOJB 4FK4A 5KFSA 4IO9Q 4JI7J 3M6XA 4KGXB 2D3O1 3D67A 4FLUA 2ZBCA 1MU2A 1FWPA 4USWA 1KKHA 1TL5A 4NLBA 3PEJA 1QDUB 1PO6A 3MM9B 3THPA 3THXB 3QYYA 4NA2A 3VAIA 3TEGA 2ZHBA 1YJTA 4CP5A 4KB1A 2DGSA 4J7CA 5D8HB 1VRTA 1IBLK 1O5JA 4B9LA 3DOKA 3CE8A 2RD5C 2HNZB 4NLCA 5LSOA 1SQFA 3AO1A 3V4IA 2CJYB 2E6LA 4UZCA 5HQLA 2OPPB 1Q81O 4CJQA 1ZTTA 3MM6B 1WC5A 3L7OA 2R3VA 2J8SA 3LO3A 1NK4A 1IJJA 5DZ6A 4LF5K 3OS0A 3B6PA 2Y9HA 2HFVA 1CS4B 3DLEA 2H1YA 2MKCA 4EI2A 2O8DA 4RW4A 4B9MA 1CXUA 4Y2MA 5BREA 3PIOL 3L95X 2Y1IA 3EE9A 4Y34A 1TL1B 2H5IB 1B3TA 4CO2A 5KT3A 1IO2A 3LP0B 3ZTOA 3JSRA 1S0OA 5GMEA 3VF2A 4PWDA 1T02A 4IDKA 1FDAA 3H40A 2DXEA 1WNEA 5IC4B 3SSRA 3CMAN 1WAFA 3E9PA 4Q8EA 3VGMA 2JC1A 4I0WA 3IDHA 3GWCA 1W2BR 5AQIA 1ESVA 1WI6A 5EU7A 4K41A 2UXDK 3NGYA 3KJVA 4YUDA 2BDPA 4KTZA 5AQOA 3A8IA 3D68A 3QFUA 3EKSA 3CD0A 2ZH5A 2IAJA 2YNIA 2J7WA 2CQHA 4DV2F 1NU0A 3VA3A 4LBIA 1IKYA