3AVIA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aviA00
2KFZA 4KB0A 1I39A 1RTHA 4MQ3A 3MXMA 3ZT2A 3TANA 3AA5X 3A2FA 5C42A 4QCLA 4LSNA 1C6VA 4M42A 3AVKA 3THVA 3K58A 1NJZA 1XC9A 1L3VA 1NOYA 4F3TA 1KVAA 1B9FA 1C0UA 3QIOA 3O3HA 4FLVA 1BGXT 3VQPA 1A5XA 2QXFA 1RBTA 1KLNA 2YV0X 3TAPA 1A5WA 4TSXA 1RBVA 1QQCA 4I7FA 5FDLA 3OS0A 3V9XA 3QERA 3TAQA 1WSHA 1ASVA 3SQ2A 1BHLA 2IGIA 4W5TA 2HVHA 4N41A 1VSKA 3DI6A 5HRRA 2KTQA 1BQNA 4UQGA 2HMIA 4DFMA 4CGFA 4CIFA 4Z4EA 1QSSA 1D5AA 4RW7A 2PYJA 4J2DA 1HYVA 1WSFA 3SCXA 1L3UA 1HPZA 2G8KA 5KI6A 3F9KA 3ISNC 4CFDA 3HYFA 4E1NA 3JYTA 3S3OA 2DFEA 3ZSXA 4XIUA 4BACA 4O0JA 3F73A 3ZSZA 1ASWA 4HHTA 5EU7A 3V81A 3TI0A 2E4LA 2P1JA 1BCMA 5SZTA 3CM6A 1KFSA 3O4QA 4DQSA 3HL8A 4CHOA 5J2MA 1JXEA 1RDAA 3AO4A 4DWIA 1RNHA 4IG0A 3QEXA 4BE1A 4B3OA 3VA0A 4Z4IA 1GOAA 4I2PA 3LZIA 4NYNA 4JS5A 3LZJA 4DTRA 3RR7A 3KLEA 4ELTA 4B9TA 3V1QA 1DLOA 1RBUA 1RDCA 1S1VA 3LAKA 4OVLA 4CEAA 2E6LA 4CE9A 3V9WA 3HPHA 5DK5A 4CJVA 1LW0A 4M45A 4DFJA 3DLBA 4KI4A 3NF6A 3SI6A 1IKWA 3NFAA 2G8VA 1HJRA 4BE0A 4CJ5A 4IBNA 3PX4A 4C8KA 3VQ7A 4CGDA 2OPPA 2QKKA 3OJSA 3L2UA 3OYAA 4F2RA 5K14A 4BWMA 4CJSA 1J53A 3T3FA 2Z1IA 3SUPA 3M8RA 2XY8A 5HP1A 3ASMA 3OYGA 2R7YA 1N5YA 4M3TA 1FKPA 4PWDA 1RT2A 3FFIA 1SL2A 1LAVA 4KO0A 1CXQA 3K57A 3RMDA 1EX4A 4FJ8A 4DU4A 1SL0A 4E7JA 4J2EA 1VSLA 2ITGA 4I9QA 1RT5A 3NGZA 3SNNA 4FLWA 4LSLA 1D9FA 2HHSA 2QK9A 4OGEA 1KCFA 3KTQA 4DLGA 1RDDA 4B9LA 3U3GA 4E7KA 3AA2A 1B9DA 4YFUA 4CF1A 2Y1JA 1T8EA 2X6SA 4J2AA 4CK2A 4KHYA 4FYDA 4M3WA 4PQUA 4CEEA 1U45A 1TKXA 1Y97A 3SUOA 3UIQA 3C95A 5HRPA 3V6DA 1FXXA 3P5JA 3ZSWA 4O55A 5J2PA 1JLEA 3HPGA 4E7LA 3M8QA 3OYIA 2VG6A 4CJFA 2IC3A 2HVIA 3NH1A 1HNIA 1KFDA 4RG8A 1NK6A 1GOCA 4KB1A 1RCHA 1VSJA 1NK4A 3OYMA 2YNIA 3VQ9A 2ATQA 3NE6A 3MECA 3SUNA 4PUOA 4JLHA 4Y1CA 3VN5A 1TKDA 4DSEA 2HHVA 3OJUA 2IAJA 2GV9A 3VQEA 2A1SA 1RTJA 3NF9A 5CZ2A 4CIEA 1JLQA 4B9NA 4DSJA 4F3OA 3TARA 4WE1A 1HRHA 4B9VA 4DSLA 3C94A 3NF7A 1VSHA 4NCGA 1IO2A 4B8CA 1SV5A 1W0HA 2I5JA 4FJJA 5D3GA 4CGGA 5CYQA 1C0TA 4HVJA 2VWJA 3HJFA 4W5OA 1BCOA 3WNFA 2HHQA 1WAFA 3HM9A 4Z4CA 3KLFA 3NH2A 3QEPA 4CESA 5I42A 3LALA 3AVJA 3SQ4A 1HNVA 3LP3A 5KRTA 2D5RA 4NYFA 3BGRA 4CFAA 3VA3A 4FLXA 1W9HA 1BIUA 1ITGA 1VSDA 4CEOA 4DF8A 1NJYA 3V9SA 4E7IA 5HLFA 1SKRA 2OPQA 3LANA 4N76A 1S1WA 1C0MA 4OKEA 5HBMA 3RTVA 4KI6A 1QSLA 5DMRA 4ZTJA 4KTQA 1VSFA 4CGJA 1BL3A 2KW4A 3VQAA 3L2RA 1IKYA 4DU3A 2B4JA 4FK4A 1BISA 2OZSA 3LWMA 2OYQA 3DOLA 3KIOA 4FM0A 3RMBA 4FJ9A 1J5OA 1LW2A 1TKZA 4KAZA 4FJMA 2FBTA 4E89A 2XHBA 4CF9A 3P1GA 4CF8A 3CFOA 4CJWA 2B5JA 3ZSQA 4R5PA 4FZXC 3LP0A 1L5UA 4OJRA 1U48A 3NCIA 2VG7A 1HMVA 5KTQA 3PO5A 3HP6A 3AO1A 1TK0A 2RPIA 4KHNA 2Z1HA 3HT3A 3KK2A 1X1PA 2G8UA 1IKVA 3IAYA 1UOCA 3T19A 3VQCA 3P83D 4JRQA 1Q9XA 2RKIA 3G0ZA 4MFBA 3D45A 3KLHA 4F4KA 3AO5A 1U4BA 4DF4A 1U49A 1CZBA 4J2BA 1ZBLA 3PO4A 3KKRA 1CLQA 1RILA 4RW9A 1BQMA 4FLTA 2KQ2A 4DQRA 4DTUA 1JL1A 3KD5E 1VRTA 1FKOA 1Z26A 3OYJA 4F8RA 1JL2A 3SJJA 4FJ5A 4FJIA 4HUGA 3V1RA 3L2QA 1S6QA 3NBPA 2HHTA 4FM2A 3TAGA 4IFVA 1LWFA 4DU1A 3ZT1A 1S9GA 3NGYA 4CF2A 2FBVA 1SUQA 3AVBA 3OYHA 3VQBA 4YNQA 3RWUA 3SPYA 1QHTA 3S3NA 5HRSA 5C24A 3KJVA 5HROA 1KRPA 2FC0A 3AA4A 3NDKA 5KRSA 1RDBA 2YHBA 3V9ZA 4BDZA 3OYEA 4LD0A 4RW8A 3CFRA 4FLYA 4Q0BA 3L8BA 3CQ8A 3DYAA 5CYMA 4CERA 3S9HA 3PX6A 3HP9A 4CEBA 3NAEA 2HNYA 2YNHA 2G8HA 1C1AA 4GMJB 2PZSA 1EP4A 1WNSA 3KK3A 1U04A 3VQ6A 3I8DA 5JS1A 4CF0A 5J2QA 3ULDA 4GVMA 5KGXA 2XY7A 4K8XA 2YHAA 3VQ5A 2PYLA 5SWMA 4CHYA 3M8PA 3K2PA 4I2QA 4CHZA 2BDPA 4Z4GA 2DFHA 3QNOA 1LWEA 4HTUA 4W5NA 3NGIA 1L3TA 2EHGA 1J9AA 4KTZA 3K5MA 3CFPA 4FM1A 3PX0A 2IDOA 2W42A 4B9UA 1C1CA 4ELUA 3PY8A 4F2SA 3MEGA 3ZSYA 1NOZA 1D8YA 4HUEA 4DS4A 3MAQA 4LY7A 4FJ7A 3WNGA 1KLMA 2IOCA 3KLGA 4K8ZA 1ASUA 1KVBA 4G1QA 3ZT3A 3L3VA 4DG1A 2WONA 4FW1A 3PV8A 1NKEA 3DM2A 3EY1A 2XO7A 1VSEA 4C8NA 4E3SA 1QTMA 1Q8IA 2GUIA 4CJPA 3NHGA 4BDPA 1HYZA 3MXJA 4CJQA 3KKSA 4CEQA 1L3SA 1WN7A 4EP5A 4JS4A 3RMAA 4KTWA 2KZZA 3OYLA 4EZ9A 4E19A 4M41A 1RBSA 1WSIA 1XHXA 4EP4A 4DFPA 1UA1A 3LPUA 2G8IA 2HHUA 3QLHA 3WNHA 3HO1A 4B9MA 5C25A 3K59A 4BE2A 3DRSA 3TAEA 3DLEA 2JLEA 3HSTB 3DRRA 1NJXA 2OPRA 4E7HA 1NK0A 1KSPA 4AHUA 4FLZA 1IKXA 3AA3A 4CJUA 5I3UA 4ZTFA 4BDYA 2HHWA 1X9MA 3TAFA 1X9WA 3AVCA 4LH4A 1IH7A 3IS9A 3AVGA 3C6TA 1CZ9A 3V9UA 4CJKA 1ZBUA 1UA0A 1QS4A 2ZE2A 4OGCA 1TK8A 3B6PA 3NF8A 3SV4A 3RRGA 4EZ6A 3AVLA 4C8OA 1X9SA 1YVUA 1QSYA 4DTNA 3AO3A 3AO2A 1SL1A 4LH5A 3V1OA 1WSGA 4FLUA 4DTMA 1D9DA 2E6MA 3SYZA 3AVAA 4OLBA 3G10A 1TL3A 5FRMA 4IG3A 1TVRA 1RT6A 3B6OA 4Y1DA 4AILC 2FBYA 1JLAA 1HYSA 3DMJA 4H4OA 3HVRA 3OYNA 3QNNA 4FW2A 2G8WA 2HNZA 2VWKA 2Q3SA 2ZD1A 3L2WA 4DQPA 3ITHA 4PA1A 2DTUA 4B08A 3WNEA 3LWLA 1NK5A 4N5SA 1BI4B 1S9EA 3HK2A 4FXDA 3AVNA 1J54A 4O44A 1XHZA 3AVFA 2OA8A 1KTQA 4KRFA 1TAUA 3L2VA 4CFCA 1RT1A 3IRXA 3VQQA 4CHQA 2RF2A 4KKOA 2ETJA 4OPKA 3DLGA 2RN2A 1TAQA 1I3AA 1LAWA 3ZSRA 4FJLA 3PUFA 3QESA 1K6YA 4FVMA 1B92A 3OYKA 2F8SA 4HUFA 1RTDA 4N47A 2PY5A 3OS1A 2X74A 1JLGA 1RT3A 3LP2A 4CJTA 2B6AA 3O3GA 3M8SA 4DTSA 2WOMA 4DTXA 4B9SA 3TAMA 3KD1E 3LPTA 3OYCA 3SPZA 2QKBA 1TKTA 2XRIA 1CXUA 2LSNA 4C8MA 4FCYA 4FJGA 2D0AA 4DMNA 4QOZB 2O4GA 3S3MA 1WSEA 2GBZA 2NUBA 1WLJA 4IDKA 3QEVA 4QAGA 4M3ZA 3EZ5A 1VK0A 3SUQA 3AVIA 1QE1A 4FJNA 1G15A 3ZT0A 3OY9A 3QEIA 3LAMA 2XY5A 3OYDA 3NH0A 2XY6A 4C8LA 4CK3A 3CM5A 3L3UA 5JS2A 3VQDA 1JXBA 2Z1JA 3T1AA 3K5OA 4Q5VA 1YTUA 2KFNA 3BDPA 3SZ2A 4Z4FA 1TL1A 2ZQBA 5J2NA 3QETA 1NJWA 4N56A 3K5LA 1BIZA 4L8RB 2OZMA 3MEEA 1N6QA 4KREA 4FZYA 2YKNA 4HCBA 1NK7A 1C1BA 4AHSA 4CJ3A 4CIGA 4O5BA 3DLRA 4DTJA 3RR8A 2BGGA 4DSFA 4RW4A 4DSKA 2X78A 4IFYA 1NK8A 4M3XA 4M3YA 3JSMA 1XI1A 1JKHA 3I0RA 5CZ1A 5T7BA 2X6NA 2BANA 2OPSA 2VG5A 1EKEA 1HQEA 3DOKA 2P5OA 4KPYA 1F21A 4KHQA 1T05A 4DSIA 4CFBA 3I0SA 4CK1A 4CGHA 2HB5A 3DRPA 4DLEA 1NK9A 3ZSVA 1LV5A 4ELVA 2HHXA 4CEFA 3SV3A 4FJXA 4RW6A 1S1XA 1ZYQA 4E0DA 1S5JA 5J1EA 4W5RA 4CJ4A 3CG7A 1NKCA 4OKKA 1SKWA 4CJLA 1XWLA 4FJKA 1EETA 4FK0A 3QIPA 4OLAA 4KV8A 1Q9YA 4M3UA 3VQ4A 4IKFA 4AHCA 4CHPA 4ICLA 1YT3A 2D0BA 4ID1A 1EXQA 2G8FA 4FZZA 3H08A 3C6UA 4FJHA 3MEDA 4OKJA 3HXMA 3TWHA 3KLIA 1KVCA 4CCHA 3OS2A 3RRHA 1U47A 4DFKA 3TR8A 5FRNA 1BI4A 1RT7A 1WSJA 1TV6A 1VSIA 5KGWA 4BWJA 3QEWA 3KK1A 2A1RA 1RTIA 1RBRA 1HQUA 2YNFA 3QINA 4ID5A 3RMCA 2AJQA 4GW6A 5CY4A 1JLCA 3DLHA 3EYZA 4Z0UA 3O3FA 2P5GA 4DS5A 1UWBA 2EX3A 3SQ0A 1R0AA 1ZBIA 4DTOA 3TABA 1GOBA 1JLBA 3AV9A 1JLFA 2D0CA 2F96A 4NCAA 1ZBHA 1DTQA 3AVHA 4CGIA 3SQ1A 4DTPA 3OYBA 5E41A 5FROA 4JRPA 1T7PA 3ZSOA 4AHTA 2DY4A 3DLKA 4AHVA 2YNGA 4CJRA 4KHUA 2Z1GA 2HNDA 4CHNA 4H4MA 2BE2A 1ZBFA 1WAJA 3MXIA 3ZCMA 1SKSA 4M3RA 3QO9A 4CEDA 5HRNA 1S6PA 4HCCA 4KHWA 1YTAA 2HW3A 4Z4HA 1RT4A 4CJEA 3VQ8A 3CYMA 3K5NA 1MU2A 2IS3A 1DTTA 3IG1A 1IG9A 4KHSA 1REVA 2F8TA 2P51A 4PY5A 4KFBA 4NCBA 3LDSA 1S1UA 4I9LA 1UAXA 4O0IA 3AVMA 1LWCA 1T03A 3U3YA 3D0PA 4DQIA 2YKMA 3O4NA 1S1TA 1NKBA 4AHRA 1TK5A 4B8AB 2KZMA 1FK9A 4AH9A 2DFFA 4H8KA 3U6FA 1TGOA 3HPOA 1Z25A 3V4IA 4W5QA 4E1MA 2FBXA 3LP1A 1VSMA 2O4IA 1A5VA 4O4GA 4FK2A 4CECA 3HVTA 2Y1IA 4CEZA 3E01A 1VRUA 4OPJA 4ZHRA 1O1WA 3OVNA 3ZT4A 2JGUA 3ALYA 4DQQA 3OYFA
chains in the Genus database with same CATH superfamily
3C6AA 2KFZA 1I39A 3AA5X 3QBXA 1C6VA 1XUPO 1IG8A 3K58A 1L3VA 1KVAA 3H3NO 3VQPA 3ZLJA 1RBTA 3CQYA 1KLNA 4TSXA 5FDLA 3QERA 3A5NC 2IGIA 2V51B 2KTQA 4GY2B 2HMIA 4JD2B 4DFMA 5GIPA 4CIFA 1QSSA 1YJNN 2O8FB 1D5AA 3LDNA 1HPZA 5KI6A 3F9KA 1C0GA 1YI2N 1W2BM 4BACA 5EU7A 3V81A 1VQKN 2KHOA 3TI0A 3AARA 1BCMA 3EEQA 5J2MA 2QWNA 4DR3K 1BDGA 2ASMA 1RNHA 4IG0A 3ZX2A 4I2PA 4NYNA 4JS5A 1HNXK 4DTRA 3V1QA 1DLOA 3W0LA 2E6LA 3V9WA 3HPHA 4ILHA 1LW0A 4DFJA 3NF6A 3TSPA 5M1QA 2HF3A 4CJ5A 3PX4A 2OPPA 4CJSA 4FL9A 3T1YK 3SK3A 2Z1IA 3SUPA 2V52B 5AQXA 2XY8A 3CIPA 1N5YA 5AZJA 4WQ5A 3MWPA 4BG8A 1EX4A 4FJ8A 1SL0A 3H45C 1VSLA 3A0IX 3N4QA 3ID6A 1KCFA 3KTQA 1RDDA 4KHYA 1U45A 3BEXA 1TKXA 3E66A 1FXXA 3P5JA 3ZSWA 3HPGA 3M8QA 3OYIA 3KK7A 1R59O 1NNEA 3O1WA 1KFDA 1GOCA 1X3MA 2YNIA 2ATQA 3NE6A 3R9PA 3SUNA 4X65K 3OJUA 4DSJA 4FSVA 5LMNK 2VGMA 3C94A 3MCAB 3TTDA 1IO2A 4HVJA 3HJFA 2HHQA 3HM9A 2YJEA 3NH2A 3QEPA 4CESA 5I42A 3AVJA 3LP3A 5JVHL 4FLXA 1NJYA 1ITGA 3V9SA 5MLCQ 2P9LA 2OPQA 2OANA 3EZWA 1MWMA 1S1WA 1SKRA 3RTVA 4F9OA 4KI6A 5DMRA 4ZTJA 4KTQA 3I56N 3QB0A 4FPAA 1MA9B 3D6RA 1LW2A 4NXNK 2FBTA 1S22A 4R5PA 2FSNA 3AAQA 4H5TA 1U48A 3NCIA 5AQJA 1VAZA 4JYAK 3THYA 1HMVA 5KTQA 3HP6A 1LOTB 5AQNA 3IAYA 3P83D 4L3QA 3CC4N 4DF4A 1U49A 1CZBA 3VF4A 2YHXA 3PO4A 4RW9A 2KQ2A 2QWPA 1Z26A 1VRTA 1U6ZA 2ZM6K 4DV2K 3L2QA 4M63C 2HHTA 2Q31A 4FM2A 1Q81O 3J80O 1H1VA 3ZT1A 2GELA 1GLAG 2FBVA 3THWB 4MDAA 3RWUA 3SPYA 1QHTA 4M7YA 3S3NA 2D1KA 5HROA 2FC0A 3AA4A 1ATRA 5KRSA 2VQFK 3CFRA 3BY5A 4K41A 2O8FA 2PZSA 1WNSA 3TTFA 4GVMA 4BRLA 4K8XA 5SWMA 1U2VA 3ZEUA 1HKCA 3K2PA 5GAHP 2DFHA 3I33A 4HTUA 4WFNL 1VQ8N 3NGIA 1L3TA 2EHGA 4KTZA 3CJAA 4RTFD 2W42A 3K9KA 4DR6K 3VPZA 4HUEA 3MAQA 3MN5A 3WNGA 4K8ZA 3KLGA 4G1QA 5C2DA 3L3VA 4JNEA 4DG1A 2WONA 2IVOA 1NKEA 2O8CB 1VSEA 3HZ6A 2GUIA 3NHGA 1HYZA 3MXJA 4CJQA 1NMNA 4K0KK 3VOVA 1WN7A 4KTWA 2KZZA 4EZ9A 1E4GT 5KPTA 2G8IA 2HHUA 5HL7L 3DRRA 2QTDA 4BC3A 3BZKA 3TAFA 2P9PA 3K0SA 3IS9A 3AVGA 1NU0A 2UXBK 4JI6K 2E2QA 1UA0A 2ZE2A 4K42A 4EZ6A 1X9SA 3AO3A 3VEZA 4LH5A 1EQYA 4FWPA 5AZIA 2CH5A 1RDWX 3G10A 1RFQA 5KPZA 4OLBA 5FRMA 1NWKA 4Y1DA 3DMJA 3OYNA 4FW2A 2G8WA 3L2WA 1CZAN 2D4WA 3EKSA 3WNEA 3H6EA 1S9EA 1W97L 2NRTA 4IEEA 2HBLA 4O44A 2YCHA 1RT1A 3QICA 3VQQA 1EWRA 2RF2A 1RDUA 1JCGA 2GX9A 1I3AA 4B1XB 3UKRB 4FJLA 1DGKN 2FSJA 3OYKA 4HTLA 2PY5A 3OS1A 2Q0RA 4FJMA 2WOMA 4B9SA 1CXUA 4FCYA 4FJGA 3D2FA 4DMNA 4QOZB 1BU6O 4M3ZA 2P9IA 1VK0A 1QE1A 4FJNA 2O8EA 1TUYA 3FE1A 3LAMA 2XY5A 4J8FA 4A62A 4CK3A 1BA0A 1JXBA 1TYQB 4Q5VA 1Q18A 1QZ6A 4BR5A 1BIZA 2OZMA 1HX1A 1QQNA 5BRDA 3VTIA 1NK7A 1C1BA 4CJ3A 4CIGA 4DTJA 3F9MA 4O5BA 2BGGA 2VYPA 1ESVA 4RW4A 4IFYA 5BPLA 1HR0K 3U4LA 1XI1A 2HBMA 4IOAL 3UKUB 3TSQA 2P5OA 2NRZA 3O9UA 3MN6A 4CFBA 4CK1A 1NK9A 4DLEA 1LV5A 3PSFA 3HI0A 4E0DA 5LL6Z 4CJ4A 4W5RA 1NKCA 3T1HK 1XWLA 1EETA 2PBDA 1Q9YA 1BA1A 5F1XA 2P9PB 5GINA 3ZX0A 4ID1A 2VGNA 3HBTA 2OCEA 3CJ1A 2E20A 3RRHA 4JHDA 4BWJA 4X66K 1RTIA 3RMCA 4GKJK 5AQQA 4XH5A 2EX3A 3T69A 3SQ0A 1R0AA 1GOBA 3A5LC 3CJ7A 2D0CA 2F96A 1DTQA 4CGIA 1K8AO 3SQ1A 4DTPA 2DY4A 4AHTA 3DLKA 4KHUA 4CBUA 5CR4A 4H4MA 4B9QA 1NG9A 1SKSA 3DXKA 4WF9L 3FLCO 4HCCA 1YTAA 2HF4A 3CYMA 3K5NA 1MU2A 1IG9A 1Y64A 5AQIA 1HNZK 4KFBA 1YAGA 1U2VB 3M5RA 1UAXA 1WBDA 1LWCA 3U3YA 2QWMA 2YKMA 3O4NA 2P9SB 2WFBA 3D2EB 3RSEB 3U6FA 2VWBA 3CJBA 1Z25A 4E1MA 1A5VA 1O1WA 2P9UB 4YORA 4FWNA 3OYFA 4KB0A 3O5BA 3MXMA 5A2QO 4MLEA 3HM8A 4K43A 4FLVA 1B9FA 3QIOA 2O8EB 2ZGZA 2YV0X 1A5WA 1RBVA 1QQCA 3V9XA 3SQ2A 4W5TA 1XQSC 4N41A 5HRRA 1BQNA 4UQGA 3CF5L 1J6ZA 4CGFA 4Z4EA 4YOWA 3UKRA 4J2DA 4CZHA 1L3UA 5KQDA 2YJFA 4CFDA 4JI3K 2E88A 1NGHA 4XIUA 2W6KA 2FXUA 4O0JA 5BR9A 3F73A 3ZSZA 1ASWA 3PSIA 4R79A 3CI5A 3D2EA 3G4SN 1KFSA 3HL8A 3VMFB 1RDAA 3AO4A 4GV9A 4CZLA 1GOAA 3R1XA 1XMOK 2Q0UA 1D4XA 3KLEA 1LCUA 4B9TA 4OVLA 3DLBA 4KI4A 4B1WB 1VQMN 4YOTA 4CGDA 4WFBL 3OBWA 1IBKK 3T3FA 4LFBK 4B1YB 3OYGA 3THXA 1SL2A 1LAVA 3RMDA 3M1FA 4O5FA 3VGMA 4DU4A 4E7JA 4J2EA 4I9QA 1RT5A 3NGZA 4AF1A 2HHSA 3BUZB 2QK9A 3W3DA 4B9LA 3CCRN 4E7KA 3WEEB 4J2AA 2X6SA 1Q86O 1N32K 3MCPA 4CEEA 5AQVA 3J7YP 3C95A 1JCEA 3O9RA 4O55A 1JLEA 1XMQK 4E7LA 2IC3A 2HVIA 3NH1A 1HNIA 1HUXA 1VSJA 5EXWA 3OYMA 4BG9A 3DXMB 2BUPA 4JLHA 3VN5A 2GV9A 1RTJA 1HRHA 4DSLA 2P9KB 1I94K 1VHXA 3G6EN 4B8CA 3K9JA 2ASOA 4PKIA 5AQFA 3BF3A 1TYQA 4BC2A 3WQUA 4W5OA 2V7ZA 1WAFA 3KLFA 3IMXA 3KHYA 3UB5A 1HNVA 1QQOA 3N4PA 4CFAA 4A59A 4CEOA 3PIPL 5EOYA 3JAMO 4N76A 4JK8A 1QSLA 3EN9A 3GG4A 3CMEN 1YITN 1BWFO 4C23A 3RMBA 4KH5A 4E89A 3MK6A 3CFOA 3ZSQA 3MMVA 4FWMA 3VGKA 3LP0A 5JMVA 5AQLA 2P9KA 1SS6A 2NRXA 3ENOA 4LF6K 2RPIA 4CW7B 4KHNA 5ADXH 2G8UA 1IKVA 3GOIA 3VQCA 2RKIA 3G0ZA 1EO1A 3AO5A 1GLFO 1ZBLA 4BRKA 1BQMA 4JKGB 4F8RA 1WUAA 3E1YA 3OA9A 1Q7YO 2F9TA 4HUGA 3JS6A 4A2BA 3TAGA 4IFVA 4DU1A 1S9GA 3NGYA 5AQUA 1SUQA 3OYHA 3VQBA 4YNQA 1BO5O 3BZCA 5HRSA 4EHTA 1KRPA 4H0VB 3NMUA 4DR1K 3V9ZA 3L6QA 4FLYA 4Q0BA 3L8BA 3WEEA 3ZETA 4JK7A 3DYAA 1FW6A 2HMPA 3S9HA 2OTLN 3WQTA 1EP4A 5IWAK 2JWLA 3KK3A 1U04A 2YHAA 4CHZA 2BDPA 4Z4GA 2NRWA 4NXMK 4BRPA 4B1ZA 4WQ4C 1J9AA 3CFPA 3K5MA 1V4TA 3H1QA 4JHDB 4ELUA 1V4SA 3PY8A 3ENBA 5AQRA 1D8YA 3PIOL 3KVGA 1NGFA 2I7NA 4FJ7A 4U67L 5KPRA 1KLMA 4GV3A 1ASUA 1KVBA 1NGJA 4FW1A 3EY1A 4BDPA 4CJPA 1L3SA 4EP5A 3RMAA 3OYLA 2O8BA 3LDPA 1GLCG 1WSIA 4EP4A 4JKCA 1GLDG 3I8BA 4DQ8A 3LPUA 1GLBG 2NNWA 4DFPA 2E2NA 4BE2A 2JLEA 2OPRA 4Z94A 4MDBA 1NK0A 3AA3A 4CJUA 4BR2A 4JKEA 3THWA 4LF7K 1CZ9A 4YOVA 1ZBUA 4DR4K 4DV7K 5CE3A 4H0OA 3NF8A 3CQXA 1QSYA 4DTNA 4DTMA 1WSGA 4FLUA 4OO1J 3SAHA 2P9IB 1Z05A 4IG3A 1TVRA 1RT6A 4H4OA 3HVRA 2HNZA 2Q3SA 2ZD1A 3ITHA 4PA1A 2QM1A 3J8AA 1BI4B 2P9UA 1J54A 4DUZK 1XHZA 3AVFA 2KLAA 3RSEA 1BUPA 4KRFA 3IRXA 2NLXA 4CHQA 4KKOA 4PL8A 4JI8K 4OPKA 3WXLA 3DLGA 2RN2A 1LAWA 4ISFA 4BY9C 4FVMA 1B92A 1MDUB 2KKZA 2F8SA 1DT9A 4JD2A 1NGBA 2UUAK 4FZXC 3LP2A 3O3GA 3LPTA 3OYCA 3QFUA 2D0AA 2W6LA 2O4GA 1FJGK 2GBZA 3QEVA 1WLJA 2P9LB 3AVIA 4RCHA 2UUCK 4FWKA 5BPMA 1G15A 3P31A 3QEIA 1DEJA 1NLVA 2UXDK 4C8LA 1YIJN 3CM5A 4FOIA 5BRFA 3VQDA 2Z1JA 3T1AA 3K5OA 2KFNA 1YTUA 3TTCA 2ZQBA 1RGIA 3VEXA 4L8RB 1N6QA 3MX2A 3L4QA 2YKNA 4AHSA 1VQ9N 1X3NA 4DSFA 2ZJPL 3LM9A 1JKHA 5CZ1A 5T7BA 5GADP 3DOKA 2VG5A 3C65A 4KPYA 4FVUA 1YXQA 1F21A 4H0XB 4YDUC 2HB5A 3DRPA 4JN4A 1K8KB 3SV3A 5J1EA 4OKKA 4CJLA 4BRCA 1KXPA 1T3VA 4FK0A 4OLAA 4AHCA 3J7ZO 1YT3A 2D0BA 1ZXOA 3CJCA 4FZZA 3C6UA 4WYBA 3MEDA 3L4IA 3TWHA 1S72N 3ATVA 3VEOA 5FRNA 4WCEL 1RT7A 5KGWA 4IOCL 4BRFA 1RBRA 3AY9A 1E3MA 1IJJA 2AJQA 5CY4A 3ZEUB 3EYZA 2P5GA 4BR7A 3CPWM 4LF8K 4YDUA 1UWBA 5IT9O 4DTOA 3TABA 1JLBA 1T44A 4CZJA 3BF1A 5C0YA 3OYBA 3ZSOA 4CHNA 4CZKA 3ENHA 1NGAA 1WAJA 4CEDA 5HRNA 1KAYA 1S6PA 4BR4A 4KHWA 3UE5A 2HW3A 4Z4HA 5ELZA 1RT4A 1XNRK 4KHSA 3IG1A 1REVA 2F8TA 1QVFM 3VF6A 4BQLA 2P51A 3LDSA 1KQSM 1T03A 4DQIA 1VQPN 3GL1A 1S1TA 1N8RO 3HRGA 2KZMA 4AH9A 4CZIA 5F2RA 5AQHA 1TGOA 3V4IA 2FBXA 1VSMA 2O4IA 4O4GA 1BG3A 4FK2A 1VRUA 3ZT4A 3OVNA 1QTMA 1YJWN 2HBJA 4MQ3A 3ZX3A 2UUBK 4BGAA 3TANA 5C42A 4E1JA 4M42A 3THVA 1NJZA 1XC9A 1NOYA 4F3TA 1C0UA 3BP8A 4FWOA 4DCHA 3TAPA 3TAQA 4I7FA 5CHIA 5AQWA 1KD1O 1WSHA 3E9PA 1ASVA 2PAVA 4WFAL 2HVHA 3AGRA 5C12A 1VSKA 3DI6A 4X64K 5AQYA 4CZMA 5AFUH 2E1YA 1HYVA 2G8KA 3ISNC 3O80A 4CVNE 4E1NA 3MN7A 3JYTA 3S3OA 2DFEA 3ZSXA 4BR0A 1JCFA 5HOOA 4B3MK 3CM6A 3O4QA 4CHOA 4DWIA 3QEXA 4B3OA 5KQ8A 3VA0A 4Z4IA 3LZIA 1E4FT 3LZJA 1YJ9N 3RR7A 1S1VA 1RDCA 4CE9A 4CEAA 4EIAA 5DK5A 4CJVA 4M45A 2Q36A 1IKWA 3NFAA 2G8VA 3CHWA 3SJHA 4JKGA 4BE0A 4C8KA 2QKKA 3OJSA 3L2UA 3OYAA 4F2RA 4BWMA 1HJOA 3FZLA 1J53A 4IOXA 4XH4A 4M3TA 3ASMA 4QS8A 1HKBA 3MN9A 1FKPA 5AFUA 3FFIA 4KO0A 5BR8K 3O4WA 5FPMA 2ITGA 3SNNA 4JKAA 4LSLA 1D9FA 4DKWA 2F7TA 3CETA 3LM2A 4DLGA 3U3GA 3AA2A 1B9DA 4BRNA 4CF1A 2A40A 4YFUA 4CK2A 4DB3A 4PQUA 1Y97A 3SUOA 2WBNA 2FLOA 4A2AA 4BRDA 4IXCA 1VQ4N 4CJFA 4G9ZA 2GWKA 1NK6A 4KB1A 3H46O 2A3ZA 3VQ9A 1ATNA 2IVNA 4PUOA 3QMLA 3ULEA 4BRAA 5CZ2A 3NF9A 4CIEA 1YUWA 3TARA 4WE1A 3NF7A 4H0TB 1P8ZA 1W0HA 2I5JA 4FJJA 4CI6A 4BRMA 3CCUN 3FFKB 5CYQA 4CGGA 3THYB 5D3GA 1C0TA 2VWJA 2QA4N 3HTVA 1BCOA 3WNFA 4Z4CA 3LALA 5AQPA 2D5RA 3BGRA 2D0OA 1BIUA 4DF8A 5LJVA 2UU9K 2E8AA 4H03B 1VQNN 1C0MA 4OKEA 5B8HA 4CBWA 2KW4A 3VQAA 3L2RA 1YF5L 2FF3B 2P9NB 4DU3A 4FK4A 1BISA 1VQON 2OYQA 2OZSA 3KIOA 1J5OA 4DV0K 1OH8A 1IBLK 3DWLA 4CF9A 4CF8A 4CJWA 2B5JA 2W41A 1L5UA 3DJCA 4OJRA 1BOTO 1TUUA 5DM6L 2VG7A 5C2FA 4ILJA 4C1NK 1VQ5N 3AO1A 2YHYA 1TK0A 2Z1HA 3HT3A 1X1PA 3G71N 1Q9XA 4JRQA 4MFBA 3D45A 3KLHA 3LDLA 3VF2A 3KKRA 1HNWK 1CLQA 1RILA 4FLTA 4DQRA 3KD5E 3ZETB 3OYJA 3FZKA 1JL2A 3SJJA 4FJ5A 4FJIA 1EWQA 1VQLN 2DPNA 1S6QA 3NBPA 4A5AA 1NGGA 2GEMA 4CF2A 5AQMA 2YHWA 3EO3A 3FGUA 5TKYA 2A41A 2AP1A 2JWKA 2CGKA 3NDKA 2YHBA 4BDZA 4LD0A 2WUSA 4YOXA 5BN9A 4GV6A 4CERA 2WTUA 3PX6A 4YHHK 3NAEA 1WOQA 2YNHA 1XNQK 2ZF5O 3EKUA 3CCEN 3VQ6A 3I8DA 5JS1A 2GTDA 3ULDA 1ZC6A 2XY7A 4DV6K 1N33K 3VEWA 4CHYA 4I2QA 3ZYYX 3QNOA 4JI0K 4W5NA 3A8YA 4F2SA 3MEGA 4M7XA 4DS4A 5M1OA 3C7NB 2IOCA 5JLFA 3HOSA 3ZT3A 3PV8A 3CCSN 4U7BA 2BH1A 2XO7A 4C8NA 1NBWA 1OH7A 4CEQA 5M1NA 3ID8A 5TKWA 4B1VA 4E19A 1M1KO 4ILGB 5DM7L 4DV5K 4JKBA 4JI1K 2PFUA 3QLHA 5FPNA 4CZEA 3O9QA 2A5XA 3HO1A 4B9MA 5AJ3K 3HSTB 1NJXA 4E7HA 4B3SK 4FLZA 5I3UA 2HHWA 3R3LA 1X9MA 4GKKK 4DR2K 4JKFA 3O6WA 3OHRA 3OBYA 1TK8A 3B6PA 3RRGA 4UY8O 3AVLA 4C8OA 3VTHA 1YVUA 4JKHA 3AO2A 1D9DA 3V1OA 1QHAA 3SYZA 3AVAA 4H0YB 5EX5A 4IO8A 3B6OA 3P4IA 3U8XA 4AILC 4V19S 1JLAA 5AQTA 5M1FA 2E5LK 1HYSA 3QNNA 1C0FA 3LWLA 1NK5A 2QEXN 3SBGA 3WXMB 2E2OA 4YOYA 4YY3K 2OA8A 1KTQA 3L2VA 4IJNA 5FLXO 2Q1NA 1K6YA 1ZBSA 3U9DA 3THXB 4HUFA 3VERA 3M8SA 1JLGA 1RT3A 4AM6A 3GBTA 4DTXA 3TAMA 1TKTA 3P39A 2LSNA 1ATSA 1WSEA 4I6MB 5FPDA 2NUBA 4IDKA 3TPQA 3EZ5A 1WB9A 4CZGA 3L0QA 3OYDA 3NH0A 1WBBA 1NJIO 3L3UA 4PKHA 3VETA 3BDPA 3SZ2A 3O9TA 4Z4FA 1TL1A 5J2NA 3QETA 3K5LA 1OKJA 2NRVA 2IIRA 3MEEA 4FZYA 3FZFA 3LDOA 4EAHD 5I9EB 4DUYK 3RR8A 2NZTA 4DSKA 5AQZA 3JSMA 3I0RA 3ATUA 2X6NA 2OPSA 1EKEA 4KHQA 1QVGM 4DSIA 4ELVA 4CGHA 3U9ZA 4JKDA 2EWSA 2Q2RA 1S1XA 3SMSA 1SKWA 3CG7A 4JI2K 3SAGA 5AQSA 5GIOA 1HPMA 1IV0A 4KHPK 3QIPA 4MO5A 3CPEA 4KV8A 1NGEA 4IKFA 4CHPA 1T6DA 5GAGP 4ICLA 1SQKA 4RWTA 4DV3K 4FJHA 3CCJN 4OKJA 3HXMA 2D0PA 3IDHA 3KLIA 1U47A 3TR8A 4CJ7A 1BI4A 2HHHK 1TV6A 1HQUA 2YNFA 3QINA 1GLJO 4GW6A 4IZ9A 3CCQN 4Z0UA 5C10A 3O3FA 1W7AA 3CC7N 2ZJQL 3Q7BA 1YVNA 4LF5K 4NCAA 1JLFA 1ZBHA 3AVHA 3JXUA 4AHVA 4C1NI 2Z1GA 2BE2A 3P38A 3MXIA 1NMDA 2P9SA 3CMAN 3CC2N 4NLCA 4BR9A 3MWTA 2IS3A 4PY5A 4I9LA 4LFCK 1NKBA 4AHRA 3DXKB 3QBWA 4QS9A 1NM1A 1OH5A 2FF6A 2DFFA 4H8KA 5JVGL 3R8EA 3LP1A 3F2KA 4CECA 3HVTA 2Y1IA 4CEZA 3E01A 3O08A 4OPJA 3VGLA 3EL2A 5F0XA 3E9OA 2JGUA 3ALYA 4DQQA 4FWQA 2GWJA 3A5OC 3CJ9A 1RTHA 2CH6A 3LDQA 3ZT2A 4BC5A 3A2FA 3WXIA 2UXCK 3Q7CA 4QCLA 4LSNA 3AVKA 2O8CA 3O3HA 1BGXT 1A5XA 2QXFA 2HBKA 3OS0A 1U4BA 4YOUA 1BHLA 2J4RA 1N34K 2CGJA 2RHKA 4ISEA 4RW7A 2PYJA 1WSFA 3SCXA 3UKUA 5JLHA 3GDQA 3HYFA 2ZJRL 2I7PA 3QFPA 4LFAK 4HHTA 1MWKA 4OX9K 4X62K 2E4LA 2P1JA 3VENA 5SZTA 4DV1K 5H1SQ 1NGCA 4DQSA 1OVQA 1JXEA 2NRRA 3EE8A 3WXKA 4CZFA 3QDKA 4BE1A 5AZJB 4BVOA 4BVPA 4ELTA 1RBUA 3LAKA 2W40A 2ASPA 4B1UB 2YX6A 3SI6A 1HJRA 3R6MA 4MLHA 2V7YA 4IBNA 2RE2A 4LF4K 3VQ7A 4CD1A 4BRHA 2E1ZA 4AM7A 1SAZA 5K14A 3E9LA 5AQGA 4BGBA 3M8RA 5HP1A 2VCPA 2R7YA 4FWRA 3NVMA 3CCVN 1RT2A 2ZGYA 1CXQA 3K57A 3ULEB 4WQ4A 3J81O 1VQ7N 3OTOK 2OTJN 4FLWA 3SMPA 1Z6RA 4OGEA 2CGLA 1K73O 4FWLA 1YHQN 2Y1JA 1T8EA 4M3WA 4XEIA 3UIQA 4PWDA 5HRPA 3V6DA 3KWGA 5J2PA 2VG6A 4RG8A 4FWSA 4BREA 1RCHA 5AZIB 1NK4A 4DR5K 3CXCM 4JI7K 1X9JA 3MECA 4Y1CA 3IUCA 4BROA 1TKDA 4DSEA 1Q82O 3GE1A 2HHVA 2IAJA 3VQEA 5E84A 2A1SA 4F3OA 1JLQA 4B9NA 4B9VA 3CCMN 1VSHA 4NCGA 1SV5A 5AQKA 3AAPA 1GLEG 3EE9A 3SQ4A 5KRTA 3VA3A 4NYFA 5LY3A 3H3OB 3SLCA 1W9HA 1VSDA 4O8UA 4BQZA 5HLFA 4E7IA 3PLAA 3LANA 5HBMA 1VSFA 3HSCA 4CGJA 1BL3A 1IKYA 3CCLN 1GLLO 4DV4K 2B4JA 3LWMA 4H5RA 3DOLA 4FM0A 4FJ9A 1TKZA 4KAZA 3CD6N 3F5TA 3O9SA 2O8DB 2XHBA 2BTFA 3P1GA 4JV5K 4A61A 4BRIA 4CBXA 3PO5A 3KK2A 1UOCA 3T19A 1VQ6N 3SBTA 4IWVA 3VEVA 4F4KA 3VEYA 2FSKA 4J2BA 1NGDA 4DTUA 1JL1A 2Q97A 1FKOA 4JAXA 3FZMA 3V1RA 3FZHA 2QWRA 5FPEA 1LWFA 3O8MA 3KWIA 3AVBA 3LL3A 4EFHA 3D2FB 5C24A 3KJVA 1HKGA 2F9WA 3O1BA 1ILYA 1RDBA 3OYEA 5ADXA 4RW8A 1M90O 3CQ8A 4HWIA 5CYMA 3HP9A 4CEBA 2G8HA 2HNYA 1C1AA 4GMJB 2F4VK 4LF9K 4CF0A 5J2QA 5KGXA 3VQ5A 4JI4K 2PYLA 3M8PA 4GNIA 4A5BA 4BC4A 1LWEA 3C7NA 4B9UA 3PX0A 1T6CA 4FM1A 2IDOA 1C1CA 4KBOA 1HLUA 3ZSYA 1NOZA 2A6AA 4LY7A 3TSUA 3DXMA 3T7ZA 3DAWA 3DM2A 4E3SA 1Q8IA 3KKSA 4PL7A 4FOEA 4JS4A 4M41A 1RBSA 1XHXA 3IFRA 1UA1A 3C0BA 4KH4A 3WNHA 2H3GX 5BPNA 3S41A 5C25A 3K59A 3TAEA 3DRSA 1G99A 3DLEA 2O8BB 1KSPA 4AHUA 1IKXA 4ZTFA 4BDYA 3KZBA 4BRGA 1X9WA 2E2PA 3AVCA 4LH4A 4NO7A 1IH7A 4JK9A 3C6TA 3V9UA 4CJKA 1NGIA 2IVPA 1QS4A 2NRHA 4OGCA 5M1PA 3SV4A 4MO4A 1K8KA 5GAEP 1SL1A 2E6MA 2QI2A 2QW9A 1TL3A 4I6MA 2FBYA 3FR0A 2A42A 4H5VA 5EY4A 2VWKA 4IFEA 4NB4A 4DQPA 2DTUA 4B08A 5C15A 3HK2A 4N5SA 2YI1A 4FXDA 3TU5A 2QWLA 3AVNA 5LMUK 2VQEK 1TAUA 4CFCA 1OH6A 4IDHA 2ETJA 4A57A 3D7EO 1TAQA 3ZSRA 4DR7K 3PUFA 3QESA 4NLBA 4O8KA 1IBMK 2HSTA 3NVKA 1RTDA 4N47A 2X74A 4DTSA 4CJTA 2B6AA 3KD1E 2P9NA 3SPZA 2QKBA 2XRIA 4C8MA 4JI5K 3A5MC 4IJAA 4XH1A 3S3MA 4QAGA 1K9MO 5BREA 3SUQA 3OW2M 3ZT0A 5JICA 3OY9A 3AGKA 3M6GA 4PKGA 2XY6A 3WT0A 5JS2A 4K25A 1SZ2A 4B3TK 4H5WA 4JEPA 3SAFA 2HOEA 1NJWA 4N56A 1QZ5A 1DKGD 3DLLL 4KREA 5EVZA 3MDQA 4HCBA 3RVCA 3VESA 3DLRA 5LJWA 2X78A 4DHYA 1NK8A 4M3XA 4M3YA 4B3RK 2BANA 2QXLA 1HQEA 1P90A 1T05A 4FYDA 3I0SA 4GVEA 3ZSVA 2UYTA 2HHXA 4CEFA 4FJXA 4RW6A 1ZYQA 1S5JA 1KAXA 2AA4A 4KH6A 4OPAA 4FJKA 1O13A 1QQMA 4QS7A 3HOTA 3WUHA 2GUPA 4M3UA 3VQ4A 1OVYA 3J7AP 4IO9L 1EXQA 3IKMA 2G8FA 3H08A 5BN8A 3H1VX 4CCHA 1KVCA 3OS2A 3G25A 4DFKA 1WSJA 3QEWA 1VSIA 2A1RA 1S3XA 1KC8O 3KK1A 4ID5A 4WQ5C 1JLCA 3DLHA 2QWOA 4DS5A 1ZBIA 2WC9A 3AV9A 3I55N 3MX5A 2ITMA 1JJ2M 4JRPA 5E41A 4H0PA 5FROA 1T7PA 2YNGA 4CJRA 2O8DA 2HNDA 5AR0A 5M1KA 1ZBFA 3ZCMA 4M3RA 3QO9A 5E26A 5AQOA 5BRHA 4OPHA 3C6HA 1J5EK 4CJEA 3M3ZA 4BRQA 1XC3A 3VQ8A 4IEIA 4Y0WA 1DTTA 4NCBA 1S1UA 4EHUA 2ZWHA 3AVMA 4LC9B 4O0IA 3D0PA 4AQYK 1N36K 4H5NA 4FO0A 1TK5A 4FPBA 4B8AB 1FK9A 3HPOA 2QWQA 3CERA 4W5QA 3WXJA 4ISGA 3B8AX 4PHTX 4CD3A 4ZHRA 1KAZA
chains in the Genus database with same CATH topology
2KFZA 4KB0A 1I39A 1RTHA 4MQ3A 3MXMA 3ZT2A 3TANA 3AA5X 3A2FA 5C42A 4QCLA 4LSNA 1C6VA 4M42A 3AVKA 3THVA 3K58A 1NJZA 1XC9A 1L3VA 1NOYA 4F3TA 1KVAA 1B9FA 1C0UA 3QIOA 3O3HA 4FLVA 1BGXT 3VQPA 1A5XA 2QXFA 1RBTA 1KLNA 2YV0X 3TAPA 1A5WA 4TSXA 1RBVA 1QQCA 4I7FA 5FDLA 3OS0A 3V9XA 3QERA 3TAQA 1WSHA 1ASVA 3SQ2A 1BHLA 2IGIA 4W5TA 2HVHA 4N41A 1VSKA 3DI6A 5HRRA 2KTQA 1BQNA 4UQGA 2HMIA 4DFMA 4CGFA 4CIFA 4Z4EA 1QSSA 1D5AA 4RW7A 2PYJA 4J2DA 1HYVA 1WSFA 3SCXA 1L3UA 1HPZA 2G8KA 5KI6A 3F9KA 3ISNC 4CFDA 3HYFA 4E1NA 3JYTA 3S3OA 2DFEA 3ZSXA 4XIUA 4BACA 4O0JA 3F73A 3ZSZA 1ASWA 4HHTA 5EU7A 3V81A 3TI0A 2E4LA 2P1JA 1BCMA 5SZTA 3CM6A 1KFSA 3O4QA 4DQSA 3HL8A 4CHOA 5J2MA 1JXEA 1RDAA 3AO4A 4DWIA 1RNHA 4IG0A 3QEXA 4BE1A 4B3OA 3VA0A 4Z4IA 1GOAA 4I2PA 3LZIA 4NYNA 4JS5A 3LZJA 4DTRA 3RR7A 3KLEA 4ELTA 4B9TA 3V1QA 1DLOA 1RBUA 1RDCA 1S1VA 3LAKA 4OVLA 4CEAA 2E6LA 4CE9A 3V9WA 3HPHA 5DK5A 4CJVA 1LW0A 4M45A 4DFJA 3DLBA 4KI4A 3NF6A 3SI6A 1IKWA 3NFAA 2G8VA 1HJRA 4BE0A 4CJ5A 4IBNA 3PX4A 4C8KA 3VQ7A 4CGDA 2OPPA 2QKKA 3OJSA 3L2UA 3OYAA 4F2RA 5K14A 4BWMA 4CJSA 1J53A 3T3FA 2Z1IA 3SUPA 3M8RA 2XY8A 5HP1A 3ASMA 3OYGA 2R7YA 1N5YA 4M3TA 1FKPA 4PWDA 1RT2A 3FFIA 1SL2A 1LAVA 4KO0A 1CXQA 3K57A 3RMDA 1EX4A 4FJ8A 4DU4A 1SL0A 4E7JA 4J2EA 1VSLA 2ITGA 4I9QA 1RT5A 3NGZA 3SNNA 4FLWA 4LSLA 1D9FA 2HHSA 2QK9A 4OGEA 1KCFA 3KTQA 4DLGA 1RDDA 4B9LA 3U3GA 4E7KA 3AA2A 1B9DA 4YFUA 4CF1A 2Y1JA 1T8EA 2X6SA 4J2AA 4CK2A 4KHYA 4FYDA 4M3WA 4PQUA 4CEEA 1U45A 1TKXA 1Y97A 3SUOA 3UIQA 3C95A 5HRPA 3V6DA 1FXXA 3P5JA 3ZSWA 4O55A 5J2PA 1JLEA 3HPGA 4E7LA 3M8QA 3OYIA 2VG6A 4CJFA 2IC3A 2HVIA 3NH1A 1HNIA 1KFDA 4RG8A 1NK6A 1GOCA 4KB1A 1RCHA 1VSJA 1NK4A 3OYMA 2YNIA 3VQ9A 2ATQA 3NE6A 3MECA 3SUNA 4PUOA 4JLHA 4Y1CA 3VN5A 1TKDA 4DSEA 2HHVA 3OJUA 2IAJA 2GV9A 3VQEA 2A1SA 1RTJA 3NF9A 5CZ2A 4CIEA 1JLQA 4B9NA 4DSJA 4F3OA 3TARA 4WE1A 1HRHA 4B9VA 4DSLA 3C94A 3NF7A 1VSHA 4NCGA 1IO2A 4B8CA 1SV5A 1W0HA 2I5JA 4FJJA 5D3GA 4CGGA 5CYQA 1C0TA 4HVJA 2VWJA 3HJFA 4W5OA 1BCOA 3WNFA 2HHQA 1WAFA 3HM9A 4Z4CA 3KLFA 3NH2A 3QEPA 4CESA 5I42A 3LALA 3AVJA 3SQ4A 1HNVA 3LP3A 5KRTA 2D5RA 4NYFA 3BGRA 4CFAA 3VA3A 4FLXA 1W9HA 1BIUA 1ITGA 1VSDA 4CEOA 4DF8A 1NJYA 3V9SA 4E7IA 5HLFA 1SKRA 2OPQA 3LANA 4N76A 1S1WA 1C0MA 4OKEA 5HBMA 3RTVA 4KI6A 1QSLA 5DMRA 4ZTJA 4KTQA 1VSFA 4CGJA 1BL3A 2KW4A 3VQAA 3L2RA 1IKYA 4DU3A 2B4JA 4FK4A 1BISA 2OZSA 3LWMA 2OYQA 3DOLA 3KIOA 4FM0A 3RMBA 4FJ9A 1J5OA 1LW2A 1TKZA 4KAZA 4FJMA 2FBTA 4E89A 2XHBA 4CF9A 3P1GA 4CF8A 3CFOA 4CJWA 2B5JA 3ZSQA 4R5PA 4FZXC 3LP0A 1L5UA 4OJRA 1U48A 3NCIA 2VG7A 1HMVA 5KTQA 3PO5A 3HP6A 3AO1A 1TK0A 2RPIA 4KHNA 2Z1HA 3HT3A 3KK2A 1X1PA 2G8UA 1IKVA 3IAYA 1UOCA 3T19A 3VQCA 3P83D 4JRQA 1Q9XA 2RKIA 3G0ZA 4MFBA 3D45A 3KLHA 4F4KA 3AO5A 1U4BA 4DF4A 1U49A 1CZBA 4J2BA 1ZBLA 3PO4A 3KKRA 1CLQA 1RILA 4RW9A 1BQMA 4FLTA 2KQ2A 4DQRA 4DTUA 1JL1A 3KD5E 1VRTA 1FKOA 1Z26A 3OYJA 4F8RA 1JL2A 3SJJA 4FJ5A 4FJIA 4HUGA 3V1RA 3L2QA 1S6QA 3NBPA 2HHTA 4FM2A 3TAGA 4IFVA 1LWFA 4DU1A 3ZT1A 1S9GA 3NGYA 4CF2A 2FBVA 1SUQA 3AVBA 3OYHA 3VQBA 4YNQA 3RWUA 3SPYA 1QHTA 3S3NA 5HRSA 5C24A 3KJVA 5HROA 1KRPA 2FC0A 3AA4A 3NDKA 5KRSA 1RDBA 2YHBA 3V9ZA 4BDZA 3OYEA 4LD0A 4RW8A 3CFRA 4FLYA 4Q0BA 3L8BA 3CQ8A 3DYAA 5CYMA 4CERA 3S9HA 3PX6A 3HP9A 4CEBA 3NAEA 2HNYA 2YNHA 2G8HA 1C1AA 4GMJB 2PZSA 1EP4A 1WNSA 3KK3A 1U04A 3VQ6A 3I8DA 5JS1A 4CF0A 5J2QA 3ULDA 4GVMA 5KGXA 2XY7A 4K8XA 2YHAA 3VQ5A 2PYLA 5SWMA 4CHYA 3M8PA 3K2PA 4I2QA 4CHZA 2BDPA 4Z4GA 2DFHA 3QNOA 1LWEA 4HTUA 4W5NA 3NGIA 1L3TA 2EHGA 1J9AA 4KTZA 3K5MA 3CFPA 4FM1A 3PX0A 2IDOA 2W42A 4B9UA 1C1CA 4ELUA 3PY8A 4F2SA 3MEGA 3ZSYA 1NOZA 1D8YA 4HUEA 4DS4A 3MAQA 4LY7A 4FJ7A 3WNGA 1KLMA 2IOCA 3KLGA 4K8ZA 1ASUA 1KVBA 4G1QA 3ZT3A 3L3VA 4DG1A 2WONA 4FW1A 3PV8A 1NKEA 3DM2A 3EY1A 2XO7A 1VSEA 4C8NA 4E3SA 1QTMA 1Q8IA 2GUIA 4CJPA 3NHGA 4BDPA 1HYZA 3MXJA 4CJQA 3KKSA 4CEQA 1L3SA 1WN7A 4EP5A 4JS4A 3RMAA 4KTWA 2KZZA 3OYLA 4EZ9A 4E19A 4M41A 1RBSA 1WSIA 1XHXA 4EP4A 4DFPA 1UA1A 3LPUA 2G8IA 2HHUA 3QLHA 3WNHA 3HO1A 4B9MA 5C25A 3K59A 4BE2A 3DRSA 3TAEA 3DLEA 2JLEA 3HSTB 3DRRA 1NJXA 2OPRA 4E7HA 1NK0A 1KSPA 4AHUA 4FLZA 1IKXA 3AA3A 4CJUA 5I3UA 4ZTFA 4BDYA 2HHWA 1X9MA 3TAFA 1X9WA 3AVCA 4LH4A 1IH7A 3IS9A 3AVGA 3C6TA 1CZ9A 3V9UA 4CJKA 1ZBUA 1UA0A 1QS4A 2ZE2A 4OGCA 1TK8A 3B6PA 3NF8A 3SV4A 3RRGA 4EZ6A 3AVLA 4C8OA 1X9SA 1YVUA 1QSYA 4DTNA 3AO3A 3AO2A 1SL1A 4LH5A 3V1OA 1WSGA 4FLUA 4DTMA 1D9DA 2E6MA 3SYZA 3AVAA 4OLBA 3G10A 1TL3A 5FRMA 4IG3A 1TVRA 1RT6A 3B6OA 4Y1DA 4AILC 2FBYA 1JLAA 1HYSA 3DMJA 4H4OA 3HVRA 3OYNA 3QNNA 4FW2A 2G8WA 2HNZA 2VWKA 2Q3SA 2ZD1A 3L2WA 4DQPA 3ITHA 4PA1A 2DTUA 4B08A 3WNEA 3LWLA 1NK5A 4N5SA 1BI4B 1S9EA 3HK2A 4FXDA 3AVNA 1J54A 4O44A 1XHZA 3AVFA 2OA8A 1KTQA 4KRFA 1TAUA 3L2VA 4CFCA 1RT1A 3IRXA 3VQQA 4CHQA 2RF2A 4KKOA 2ETJA 4OPKA 3DLGA 2RN2A 1TAQA 1I3AA 1LAWA 3ZSRA 4FJLA 3PUFA 3QESA 1K6YA 4FVMA 1B92A 3OYKA 2F8SA 4HUFA 1RTDA 4N47A 2PY5A 3OS1A 2X74A 1JLGA 1RT3A 3LP2A 4CJTA 2B6AA 3O3GA 3M8SA 4DTSA 2WOMA 4DTXA 4B9SA 3TAMA 3KD1E 3LPTA 3OYCA 3SPZA 2QKBA 1TKTA 2XRIA 1CXUA 2LSNA 4C8MA 4FCYA 4FJGA 2D0AA 4DMNA 4QOZB 2O4GA 3S3MA 1WSEA 2GBZA 2NUBA 1WLJA 4IDKA 3QEVA 4QAGA 4M3ZA 3EZ5A 1VK0A 3SUQA 3AVIA 1QE1A 4FJNA 1G15A 3ZT0A 3OY9A 3QEIA 3LAMA 2XY5A 3OYDA 3NH0A 2XY6A 4C8LA 4CK3A 3CM5A 3L3UA 5JS2A 3VQDA 1JXBA 2Z1JA 3T1AA 3K5OA 4Q5VA 1YTUA 2KFNA 3BDPA 3SZ2A 4Z4FA 1TL1A 2ZQBA 5J2NA 3QETA 1NJWA 4N56A 3K5LA 1BIZA 4L8RB 2OZMA 3MEEA 1N6QA 4KREA 4FZYA 2YKNA 4HCBA 1NK7A 1C1BA 4AHSA 4CJ3A 4CIGA 4O5BA 3DLRA 4DTJA 3RR8A 2BGGA 4DSFA 4RW4A 4DSKA 2X78A 4IFYA 1NK8A 4M3XA 4M3YA 3JSMA 1XI1A 1JKHA 3I0RA 5CZ1A 5T7BA 2X6NA 2BANA 2OPSA 2VG5A 1EKEA 1HQEA 3DOKA 2P5OA 4KPYA 1F21A 4KHQA 1T05A 4DSIA 4CFBA 3I0SA 4CK1A 4CGHA 2HB5A 3DRPA 4DLEA 1NK9A 3ZSVA 1LV5A 4ELVA 2HHXA 4CEFA 3SV3A 4FJXA 4RW6A 1S1XA 1ZYQA 4E0DA 1S5JA 5J1EA 4W5RA 4CJ4A 3CG7A 1NKCA 4OKKA 1SKWA 4CJLA 1XWLA 4FJKA 1EETA 4FK0A 3QIPA 4OLAA 4KV8A 1Q9YA 4M3UA 3VQ4A 4IKFA 4AHCA 4CHPA 4ICLA 1YT3A 2D0BA 4ID1A 1EXQA 2G8FA 4FZZA 3H08A 3C6UA 4FJHA 3MEDA 4OKJA 3HXMA 3TWHA 3KLIA 1KVCA 4CCHA 3OS2A 3RRHA 1U47A 4DFKA 3TR8A 5FRNA 1BI4A 1RT7A 1WSJA 1TV6A 1VSIA 5KGWA 4BWJA 3QEWA 3KK1A 2A1RA 1RTIA 1RBRA 1HQUA 2YNFA 3QINA 4ID5A 3RMCA 2AJQA 4GW6A 5CY4A 1JLCA 3DLHA 3EYZA 4Z0UA 3O3FA 2P5GA 4DS5A 1UWBA 2EX3A 3SQ0A 1R0AA 1ZBIA 4DTOA 3TABA 1GOBA 1JLBA 3AV9A 1JLFA 2D0CA 2F96A 4NCAA 1ZBHA 1DTQA 3AVHA 4CGIA 3SQ1A 4DTPA 3OYBA 5E41A 5FROA 4JRPA 1T7PA 3ZSOA 4AHTA 2DY4A 3DLKA 4AHVA 2YNGA 4CJRA 4KHUA 2Z1GA 2HNDA 4CHNA 4H4MA 2BE2A 1ZBFA 1WAJA 3MXIA 3ZCMA 1SKSA 4M3RA 3QO9A 4CEDA 5HRNA 1S6PA 4HCCA 4KHWA 1YTAA 2HW3A 4Z4HA 1RT4A 4CJEA 3VQ8A 3CYMA 3K5NA 1MU2A 2IS3A 1DTTA 3IG1A 1IG9A 4KHSA 1REVA 2F8TA 2P51A 4PY5A 4KFBA 4NCBA 3LDSA 1S1UA 4I9LA 1UAXA 4O0IA 3AVMA 1LWCA 1T03A 3U3YA 3D0PA 4DQIA 2YKMA 3O4NA 1S1TA 1NKBA 4AHRA 1TK5A 4B8AB 2KZMA 1FK9A 4AH9A 2DFFA 4H8KA 3U6FA 1TGOA 3HPOA 1Z25A 3V4IA 4W5QA 4E1MA 2FBXA 3LP1A 1VSMA 2O4IA 1A5VA 4O4GA 4FK2A 4CECA 3HVTA 2Y1IA 4CEZA 3E01A 1VRUA 4OPJA 4ZHRA 1O1WA 3OVNA 3ZT4A 2JGUA 3ALYA 4DQQA 3OYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFZ A;  4KB0 A;  1I39 A;  1RTH A;  4MQ3 A;  3MXM A;  3ZT2 A;  3TAN A;  3AA5 X;  3A2F A;  5C42 A;  4QCL A;  4LSN A;  1C6V A;  4M42 A;  3AVK A;  3THV A;  3K58 A;  1NJZ A;  1XC9 A;  1L3V A;  1NOY A;  4F3T A;  1KVA A;  1B9F A;  1C0U A;  3QIO A;  3O3H A;  4FLV A;  1BGX T;  3VQP A;  1A5X A;  2QXF A;  1RBT A;  1KLN A;  2YV0 X;  3TAP A;  1A5W A;  4TSX A;  1RBV A;  1QQC A;  4I7F A;  5FDL A;  3OS0 A;  3V9X A;  3QER A;  3TAQ A;  1WSH A;  1ASV A;  3SQ2 A;  1BHL A;  2IGI A;  4W5T A;  2HVH A;  4N41 A;  1VSK A;  3DI6 A;  5HRR A;  2KTQ A;  1BQN A;  4UQG A;  2HMI A;  4DFM A;  4CGF A;  4CIF A;  4Z4E A;  1QSS A;  1D5A A;  4RW7 A;  2PYJ A;  4J2D A;  1HYV A;  1WSF A;  3SCX A;  1L3U A;  1HPZ A;  2G8K A;  5KI6 A;  3F9K A;  3ISN C;  4CFD A;  3HYF A;  4E1N A;  3JYT A;  3S3O A;  2DFE A;  3ZSX A;  4XIU A;  4BAC A;  4O0J A;  3F73 A;  3ZSZ A;  1ASW A;  4HHT A;  5EU7 A;  3V81 A;  3TI0 A;  2E4L A;  2P1J A;  1BCM A;  5SZT A;  3CM6 A;  1KFS A;  3O4Q A;  4DQS A;  3HL8 A;  4CHO A;  5J2M A;  1JXE A;  1RDA A;  3AO4 A;  4DWI A;  1RNH A;  4IG0 A;  3QEX A;  4BE1 A;  4B3O A;  3VA0 A;  4Z4I A;  1GOA A;  4I2P A;  3LZI A;  4NYN A;  4JS5 A;  3LZJ A;  4DTR A;  3RR7 A;  3KLE A;  4ELT A;  4B9T A;  3V1Q A;  1DLO A;  1RBU A;  1RDC A;  1S1V A;  3LAK A;  4OVL A;  4CEA A;  2E6L A;  4CE9 A;  3V9W A;  3HPH A;  5DK5 A;  4CJV A;  1LW0 A;  4M45 A;  4DFJ A;  3DLB A;  4KI4 A;  3NF6 A;  3SI6 A;  1IKW A;  3NFA A;  2G8V A;  1HJR A;  4BE0 A;  4CJ5 A;  4IBN A;  3PX4 A;  4C8K A;  3VQ7 A;  4CGD A;  2OPP A;  2QKK A;  3OJS A;  3L2U A;  3OYA A;  4F2R A;  5K14 A;  4BWM A;  4CJS A;  1J53 A;  3T3F A;  2Z1I A;  3SUP A;  3M8R A;  2XY8 A;  5HP1 A;  3ASM A;  3OYG A;  2R7Y A;  1N5Y A;  4M3T A;  1FKP A;  4PWD A;  1RT2 A;  3FFI A;  1SL2 A;  1LAV A;  4KO0 A;  1CXQ A;  3K57 A;  3RMD A;  1EX4 A;  4FJ8 A;  4DU4 A;  1SL0 A;  4E7J A;  4J2E A;  1VSL A;  2ITG A;  4I9Q A;  1RT5 A;  3NGZ A;  3SNN A;  4FLW A;  4LSL A;  1D9F A;  2HHS A;  2QK9 A;  4OGE A;  1KCF A;  3KTQ A;  4DLG A;  1RDD A;  4B9L A;  3U3G A;  4E7K A;  3AA2 A;  1B9D A;  4YFU A;  4CF1 A;  2Y1J A;  1T8E A;  2X6S A;  4J2A A;  4CK2 A;  4KHY A;  4FYD A;  4M3W A;  4PQU A;  4CEE A;  1U45 A;  1TKX A;  1Y97 A;  3SUO A;  3UIQ A;  3C95 A;  5HRP A;  3V6D A;  1FXX A;  3P5J A;  3ZSW A;  4O55 A;  5J2P A;  1JLE A;  3HPG A;  4E7L A;  3M8Q A;  3OYI A;  2VG6 A;  4CJF A;  2IC3 A;  2HVI A;  3NH1 A;  1HNI A;  1KFD A;  4RG8 A;  1NK6 A;  1GOC A;  4KB1 A;  1RCH A;  1VSJ A;  1NK4 A;  3OYM A;  2YNI A;  3VQ9 A;  2ATQ A;  3NE6 A;  3MEC A;  3SUN A;  4PUO A;  4JLH A;  4Y1C A;  3VN5 A;  1TKD A;  4DSE A;  2HHV A;  3OJU A;  2IAJ A;  2GV9 A;  3VQE A;  2A1S A;  1RTJ A;  3NF9 A;  5CZ2 A;  4CIE A;  1JLQ A;  4B9N A;  4DSJ A;  4F3O A;  3TAR A;  4WE1 A;  1HRH A;  4B9V A;  4DSL A;  3C94 A;  3NF7 A;  1VSH A;  4NCG A;  1IO2 A;  4B8C A;  1SV5 A;  1W0H A;  2I5J A;  4FJJ A;  5D3G A;  4CGG A;  5CYQ A;  1C0T A;  4HVJ A;  2VWJ A;  3HJF A;  4W5O A;  1BCO A;  3WNF A;  2HHQ A;  1WAF A;  3HM9 A;  4Z4C A;  3KLF A;  3NH2 A;  3QEP A;  4CES A;  5I42 A;  3LAL A;  3AVJ A;  3SQ4 A;  1HNV A;  3LP3 A;  5KRT A;  2D5R A;  4NYF A;  3BGR A;  4CFA A;  3VA3 A;  4FLX A;  1W9H A;  1BIU A;  1ITG A;  1VSD A;  4CEO A;  4DF8 A;  1NJY A;  3V9S A;  4E7I A;  5HLF A;  1SKR A;  2OPQ A;  3LAN A;  4N76 A;  1S1W A;  1C0M A;  4OKE A;  5HBM A;  3RTV A;  4KI6 A;  1QSL A;  5DMR A;  4ZTJ A;  4KTQ A;  1VSF A;  4CGJ A;  1BL3 A;  2KW4 A;  3VQA A;  3L2R A;  1IKY A;  4DU3 A;  2B4J A;  4FK4 A;  1BIS A;  2OZS A;  3LWM A;  2OYQ A;  3DOL A;  3KIO A;  4FM0 A;  3RMB A;  4FJ9 A;  1J5O A;  1LW2 A;  1TKZ A;  4KAZ A;  4FJM A;  2FBT A;  4E89 A;  2XHB A;  4CF9 A;  3P1G A;  4CF8 A;  3CFO A;  4CJW A;  2B5J A;  3ZSQ A;  4R5P A;  4FZX C;  3LP0 A;  1L5U A;  4OJR A;  1U48 A;  3NCI A;  2VG7 A;  1HMV A;  5KTQ A;  3PO5 A;  3HP6 A;  3AO1 A;  1TK0 A;  2RPI A;  4KHN A;  2Z1H A;  3HT3 A;  3KK2 A;  1X1P A;  2G8U A;  1IKV A;  3IAY A;  1UOC A;  3T19 A;  3VQC A;  3P83 D;  4JRQ A;  1Q9X A;  2RKI A;  3G0Z A;  4MFB A;  3D45 A;  3KLH A;  4F4K A;  3AO5 A;  1U4B A;  4DF4 A;  1U49 A;  1CZB A;  4J2B A;  1ZBL A;  3PO4 A;  3KKR A;  1CLQ A;  1RIL A;  4RW9 A;  1BQM A;  4FLT A;  2KQ2 A;  4DQR A;  4DTU A;  1JL1 A;  3KD5 E;  1VRT A;  1FKO A;  1Z26 A;  3OYJ A;  4F8R A;  1JL2 A;  3SJJ A;  4FJ5 A;  4FJI A;  4HUG A;  3V1R A;  3L2Q A;  1S6Q A;  3NBP A;  2HHT A;  4FM2 A;  3TAG A;  4IFV A;  1LWF A;  4DU1 A;  3ZT1 A;  1S9G A;  3NGY A;  4CF2 A;  2FBV A;  1SUQ A;  3AVB A;  3OYH A;  3VQB A;  4YNQ A;  3RWU A;  3SPY A;  1QHT A;  3S3N A;  5HRS A;  5C24 A;  3KJV A;  5HRO A;  1KRP A;  2FC0 A;  3AA4 A;  3NDK A;  5KRS A;  1RDB A;  2YHB A;  3V9Z A;  4BDZ A;  3OYE A;  4LD0 A;  4RW8 A;  3CFR A;  4FLY A;  4Q0B A;  3L8B A;  3CQ8 A;  3DYA A;  5CYM A;  4CER A;  3S9H A;  3PX6 A;  3HP9 A;  4CEB A;  3NAE A;  2HNY A;  2YNH A;  2G8H A;  1C1A A;  4GMJ B;  2PZS A;  1EP4 A;  1WNS A;  3KK3 A;  1U04 A;  3VQ6 A;  3I8D A;  5JS1 A;  4CF0 A;  5J2Q A;  3ULD A;  4GVM A;  5KGX A;  2XY7 A;  4K8X A;  2YHA A;  3VQ5 A;  2PYL A;  5SWM A;  4CHY A;  3M8P A;  3K2P A;  4I2Q A;  4CHZ A;  2BDP A;  4Z4G A;  2DFH A;  3QNO A;  1LWE A;  4HTU A;  4W5N A;  3NGI A;  1L3T A;  2EHG A;  1J9A A;  4KTZ A;  3K5M A;  3CFP A;  4FM1 A;  3PX0 A;  2IDO A;  2W42 A;  4B9U A;  1C1C A;  4ELU A;  3PY8 A;  4F2S A;  3MEG A;  3ZSY A;  1NOZ A;  1D8Y A;  4HUE A;  4DS4 A;  3MAQ A;  4LY7 A;  4FJ7 A;  3WNG A;  1KLM A;  2IOC A;  3KLG A;  4K8Z A;  1ASU A;  1KVB A;  4G1Q A;  3ZT3 A;  3L3V A;  4DG1 A;  2WON A;  4FW1 A;  3PV8 A;  1NKE A;  3DM2 A;  3EY1 A;  2XO7 A;  1VSE A;  4C8N A;  4E3S A;  1QTM A;  1Q8I A;  2GUI A;  4CJP A;  3NHG A;  4BDP A;  1HYZ A;  3MXJ A;  4CJQ A;  3KKS A;  4CEQ A;  1L3S A;  1WN7 A;  4EP5 A;  4JS4 A;  3RMA A;  4KTW A;  2KZZ A;  3OYL A;  4EZ9 A;  4E19 A;  4M41 A;  1RBS A;  1WSI A;  1XHX A;  4EP4 A;  4DFP A;  1UA1 A;  3LPU A;  2G8I A;  2HHU A;  3QLH A;  3WNH A;  3HO1 A;  4B9M A;  5C25 A;  3K59 A;  4BE2 A;  3DRS A;  3TAE A;  3DLE A;  2JLE A;  3HST B;  3DRR A;  1NJX A;  2OPR A;  4E7H A;  1NK0 A;  1KSP A;  4AHU A;  4FLZ A;  1IKX A;  3AA3 A;  4CJU A;  5I3U A;  4ZTF A;  4BDY A;  2HHW A;  1X9M A;  3TAF A;  1X9W A;  3AVC A;  4LH4 A;  1IH7 A;  3IS9 A;  3AVG A;  3C6T A;  1CZ9 A;  3V9U A;  4CJK A;  1ZBU A;  1UA0 A;  1QS4 A;  2ZE2 A;  4OGC A;  1TK8 A;  3B6P A;  3NF8 A;  3SV4 A;  3RRG A;  4EZ6 A;  3AVL A;  4C8O A;  1X9S A;  1YVU A;  1QSY A;  4DTN A;  3AO3 A;  3AO2 A;  1SL1 A;  4LH5 A;  3V1O A;  1WSG A;  4FLU A;  4DTM A;  1D9D A;  2E6M A;  3SYZ A;  3AVA A;  4OLB A;  3G10 A;  1TL3 A;  5FRM A;  4IG3 A;  1TVR A;  1RT6 A;  3B6O A;  4Y1D A;  4AIL C;  2FBY A;  1JLA A;  1HYS A;  3DMJ A;  4H4O A;  3HVR A;  3OYN A;  3QNN A;  4FW2 A;  2G8W A;  2HNZ A;  2VWK A;  2Q3S A;  2ZD1 A;  3L2W A;  4DQP A;  3ITH A;  4PA1 A;  2DTU A;  4B08 A;  3WNE A;  3LWL A;  1NK5 A;  4N5S A;  1BI4 B;  1S9E A;  3HK2 A;  4FXD A;  3AVN A;  1J54 A;  4O44 A;  1XHZ A;  3AVF A;  2OA8 A;  1KTQ A;  4KRF A;  1TAU A;  3L2V A;  4CFC A;  1RT1 A;  3IRX A;  3VQQ A;  4CHQ A;  2RF2 A;  4KKO A;  2ETJ A;  4OPK A;  3DLG A;  2RN2 A;  1TAQ A;  1I3A A;  1LAW A;  3ZSR A;  4FJL A;  3PUF A;  3QES A;  1K6Y A;  4FVM A;  1B92 A;  3OYK A;  2F8S A;  4HUF A;  1RTD A;  4N47 A;  2PY5 A;  3OS1 A;  2X74 A;  1JLG A;  1RT3 A;  3LP2 A;  4CJT A;  2B6A A;  3O3G A;  3M8S A;  4DTS A;  2WOM A;  4DTX A;  4B9S A;  3TAM A;  3KD1 E;  3LPT A;  3OYC A;  3SPZ A;  2QKB A;  1TKT A;  2XRI A;  1CXU A;  2LSN A;  4C8M A;  4FCY A;  4FJG A;  2D0A A;  4DMN A;  4QOZ B;  2O4G A;  3S3M A;  1WSE A;  2GBZ A;  2NUB A;  1WLJ A;  4IDK A;  3QEV A;  4QAG A;  4M3Z A;  3EZ5 A;  1VK0 A;  3SUQ A;  3AVI A;  1QE1 A;  4FJN A;  1G15 A;  3ZT0 A;  3OY9 A;  3QEI A;  3LAM A;  2XY5 A;  3OYD A;  3NH0 A;  2XY6 A;  4C8L A;  4CK3 A;  3CM5 A;  3L3U A;  5JS2 A;  3VQD A;  1JXB A;  2Z1J A;  3T1A A;  3K5O A;  4Q5V A;  1YTU A;  2KFN A;  3BDP A;  3SZ2 A;  4Z4F A;  1TL1 A;  2ZQB A;  5J2N A;  3QET A;  1NJW A;  4N56 A;  3K5L A;  1BIZ A;  4L8R B;  2OZM A;  3MEE A;  1N6Q A;  4KRE A;  4FZY A;  2YKN A;  4HCB A;  1NK7 A;  1C1B A;  4AHS A;  4CJ3 A;  4CIG A;  4O5B A;  3DLR A;  4DTJ A;  3RR8 A;  2BGG A;  4DSF A;  4RW4 A;  4DSK A;  2X78 A;  4IFY A;  1NK8 A;  4M3X A;  4M3Y A;  3JSM A;  1XI1 A;  1JKH A;  3I0R A;  5CZ1 A;  5T7B A;  2X6N A;  2BAN A;  2OPS A;  2VG5 A;  1EKE A;  1HQE A;  3DOK A;  2P5O A;  4KPY A;  1F21 A;  4KHQ A;  1T05 A;  4DSI A;  4CFB A;  3I0S A;  4CK1 A;  4CGH A;  2HB5 A;  3DRP A;  4DLE A;  1NK9 A;  3ZSV A;  1LV5 A;  4ELV A;  2HHX A;  4CEF A;  3SV3 A;  4FJX A;  4RW6 A;  1S1X A;  1ZYQ A;  4E0D A;  1S5J A;  5J1E A;  4W5R A;  4CJ4 A;  3CG7 A;  1NKC A;  4OKK A;  1SKW A;  4CJL A;  1XWL A;  4FJK A;  1EET A;  4FK0 A;  3QIP A;  4OLA A;  4KV8 A;  1Q9Y A;  4M3U A;  3VQ4 A;  4IKF A;  4AHC A;  4CHP A;  4ICL A;  1YT3 A;  2D0B A;  4ID1 A;  1EXQ A;  2G8F A;  4FZZ A;  3H08 A;  3C6U A;  4FJH A;  3MED A;  4OKJ A;  3HXM A;  3TWH A;  3KLI A;  1KVC A;  4CCH A;  3OS2 A;  3RRH A;  1U47 A;  4DFK A;  3TR8 A;  5FRN A;  1BI4 A;  1RT7 A;  1WSJ A;  1TV6 A;  1VSI A;  5KGW A;  4BWJ A;  3QEW A;  3KK1 A;  2A1R A;  1RTI A;  1RBR A;  1HQU A;  2YNF A;  3QIN A;  4ID5 A;  3RMC A;  2AJQ A;  4GW6 A;  5CY4 A;  1JLC A;  3DLH A;  3EYZ A;  4Z0U A;  3O3F A;  2P5G A;  4DS5 A;  1UWB A;  2EX3 A;  3SQ0 A;  1R0A A;  1ZBI A;  4DTO A;  3TAB A;  1GOB A;  1JLB A;  3AV9 A;  1JLF A;  2D0C A;  2F96 A;  4NCA A;  1ZBH A;  1DTQ A;  3AVH A;  4CGI A;  3SQ1 A;  4DTP A;  3OYB A;  5E41 A;  5FRO A;  4JRP A;  1T7P A;  3ZSO A;  4AHT A;  2DY4 A;  3DLK A;  4AHV A;  2YNG A;  4CJR A;  4KHU A;  2Z1G A;  2HND A;  4CHN A;  4H4M A;  2BE2 A;  1ZBF A;  1WAJ A;  3MXI A;  3ZCM A;  1SKS A;  4M3R A;  3QO9 A;  4CED A;  5HRN A;  1S6P A;  4HCC A;  4KHW A;  1YTA A;  2HW3 A;  4Z4H A;  1RT4 A;  4CJE A;  3VQ8 A;  3CYM A;  3K5N A;  1MU2 A;  2IS3 A;  1DTT A;  3IG1 A;  1IG9 A;  4KHS A;  1REV A;  2F8T A;  2P51 A;  4PY5 A;  4KFB A;  4NCB A;  3LDS A;  1S1U A;  4I9L A;  1UAX A;  4O0I A;  3AVM A;  1LWC A;  1T03 A;  3U3Y A;  3D0P A;  4DQI A;  2YKM A;  3O4N A;  1S1T A;  1NKB A;  4AHR A;  1TK5 A;  4B8A B;  2KZM A;  1FK9 A;  4AH9 A;  2DFF A;  4H8K A;  3U6F A;  1TGO A;  3HPO A;  1Z25 A;  3V4I A;  4W5Q A;  4E1M A;  2FBX A;  3LP1 A;  1VSM A;  2O4I A;  1A5V A;  4O4G A;  4FK2 A;  4CEC A;  3HVT A;  2Y1I A;  4CEZ A;  3E01 A;  1VRU A;  4OPJ A;  4ZHR A;  1O1W A;  3OVN A;  3ZT4 A;  2JGU A;  3ALY A;  4DQQ A;  3OYF A; 
#chains in the Genus database with same CATH topology
 3C6A A;  2KFZ A;  1I39 A;  3AA5 X;  3QBX A;  1C6V A;  1XUP O;  1IG8 A;  3K58 A;  1L3V A;  1KVA A;  3H3N O;  3VQP A;  3ZLJ A;  1RBT A;  3CQY A;  1KLN A;  4TSX A;  5FDL A;  3QER A;  3A5N C;  2IGI A;  2V51 B;  2KTQ A;  4GY2 B;  2HMI A;  4JD2 B;  4DFM A;  5GIP A;  4CIF A;  1QSS A;  1YJN N;  2O8F B;  1D5A A;  3LDN A;  1HPZ A;  5KI6 A;  3F9K A;  1C0G A;  1YI2 N;  1W2B M;  4BAC A;  5EU7 A;  3V81 A;  1VQK N;  2KHO A;  3TI0 A;  3AAR A;  1BCM A;  3EEQ A;  5J2M A;  2QWN A;  4DR3 K;  1BDG A;  2ASM A;  1RNH A;  4IG0 A;  3ZX2 A;  4I2P A;  4NYN A;  4JS5 A;  1HNX K;  4DTR A;  3V1Q A;  1DLO A;  3W0L A;  2E6L A;  3V9W A;  3HPH A;  4ILH A;  1LW0 A;  4DFJ A;  3NF6 A;  3TSP A;  5M1Q A;  2HF3 A;  4CJ5 A;  3PX4 A;  2OPP A;  4CJS A;  4FL9 A;  3T1Y K;  3SK3 A;  2Z1I A;  3SUP A;  2V52 B;  5AQX A;  2XY8 A;  3CIP A;  1N5Y A;  5AZJ A;  4WQ5 A;  3MWP A;  4BG8 A;  1EX4 A;  4FJ8 A;  1SL0 A;  3H45 C;  1VSL A;  3A0I X;  3N4Q A;  3ID6 A;  1KCF A;  3KTQ A;  1RDD A;  4KHY A;  1U45 A;  3BEX A;  1TKX A;  3E66 A;  1FXX A;  3P5J A;  3ZSW A;  3HPG A;  3M8Q A;  3OYI A;  3KK7 A;  1R59 O;  1NNE A;  3O1W A;  1KFD A;  1GOC A;  1X3M A;  2YNI A;  2ATQ A;  3NE6 A;  3R9P A;  3SUN A;  4X65 K;  3OJU A;  4DSJ A;  4FSV A;  5LMN K;  2VGM A;  3C94 A;  3MCA B;  3TTD A;  1IO2 A;  4HVJ A;  3HJF A;  2HHQ A;  3HM9 A;  2YJE A;  3NH2 A;  3QEP A;  4CES A;  5I42 A;  3AVJ A;  3LP3 A;  5JVH L;  4FLX A;  1NJY A;  1ITG A;  3V9S A;  5MLC Q;  2P9L A;  2OPQ A;  2OAN A;  3EZW A;  1MWM A;  1S1W A;  1SKR A;  3RTV A;  4F9O A;  4KI6 A;  5DMR A;  4ZTJ A;  4KTQ A;  3I56 N;  3QB0 A;  4FPA A;  1MA9 B;  3D6R A;  1LW2 A;  4NXN K;  2FBT A;  1S22 A;  4R5P A;  2FSN A;  3AAQ A;  4H5T A;  1U48 A;  3NCI A;  5AQJ A;  1VAZ A;  4JYA K;  3THY A;  1HMV A;  5KTQ A;  3HP6 A;  1LOT B;  5AQN A;  3IAY A;  3P83 D;  4L3Q A;  3CC4 N;  4DF4 A;  1U49 A;  1CZB A;  3VF4 A;  2YHX A;  3PO4 A;  4RW9 A;  2KQ2 A;  2QWP A;  1Z26 A;  1VRT A;  1U6Z A;  2ZM6 K;  4DV2 K;  3L2Q A;  4M63 C;  2HHT A;  2Q31 A;  4FM2 A;  1Q81 O;  3J80 O;  1H1V A;  3ZT1 A;  2GEL A;  1GLA G;  2FBV A;  3THW B;  4MDA A;  3RWU A;  3SPY A;  1QHT A;  4M7Y A;  3S3N A;  2D1K A;  5HRO A;  2FC0 A;  3AA4 A;  1ATR A;  5KRS A;  2VQF K;  3CFR A;  3BY5 A;  4K41 A;  2O8F A;  2PZS A;  1WNS A;  3TTF A;  4GVM A;  4BRL A;  4K8X A;  5SWM A;  1U2V A;  3ZEU A;  1HKC A;  3K2P A;  5GAH P;  2DFH A;  3I33 A;  4HTU A;  4WFN L;  1VQ8 N;  3NGI A;  1L3T A;  2EHG A;  4KTZ A;  3CJA A;  4RTF D;  2W42 A;  3K9K A;  4DR6 K;  3VPZ A;  4HUE A;  3MAQ A;  3MN5 A;  3WNG A;  4K8Z A;  3KLG A;  4G1Q A;  5C2D A;  3L3V A;  4JNE A;  4DG1 A;  2WON A;  2IVO A;  1NKE A;  2O8C B;  1VSE A;  3HZ6 A;  2GUI A;  3NHG A;  1HYZ A;  3MXJ A;  4CJQ A;  1NMN A;  4K0K K;  3VOV A;  1WN7 A;  4KTW A;  2KZZ A;  4EZ9 A;  1E4G T;  5KPT A;  2G8I A;  2HHU A;  5HL7 L;  3DRR A;  2QTD A;  4BC3 A;  3BZK A;  3TAF A;  2P9P A;  3K0S A;  3IS9 A;  3AVG A;  1NU0 A;  2UXB K;  4JI6 K;  2E2Q A;  1UA0 A;  2ZE2 A;  4K42 A;  4EZ6 A;  1X9S A;  3AO3 A;  3VEZ A;  4LH5 A;  1EQY A;  4FWP A;  5AZI A;  2CH5 A;  1RDW X;  3G10 A;  1RFQ A;  5KPZ A;  4OLB A;  5FRM A;  1NWK A;  4Y1D A;  3DMJ A;  3OYN A;  4FW2 A;  2G8W A;  3L2W A;  1CZA N;  2D4W A;  3EKS A;  3WNE A;  3H6E A;  1S9E A;  1W97 L;  2NRT A;  4IEE A;  2HBL A;  4O44 A;  2YCH A;  1RT1 A;  3QIC A;  3VQQ A;  1EWR A;  2RF2 A;  1RDU A;  1JCG A;  2GX9 A;  1I3A A;  4B1X B;  3UKR B;  4FJL A;  1DGK N;  2FSJ A;  3OYK A;  4HTL A;  2PY5 A;  3OS1 A;  2Q0R A;  4FJM A;  2WOM A;  4B9S A;  1CXU A;  4FCY A;  4FJG A;  3D2F A;  4DMN A;  4QOZ B;  1BU6 O;  4M3Z A;  2P9I A;  1VK0 A;  1QE1 A;  4FJN A;  2O8E A;  1TUY A;  3FE1 A;  3LAM A;  2XY5 A;  4J8F A;  4A62 A;  4CK3 A;  1BA0 A;  1JXB A;  1TYQ B;  4Q5V A;  1Q18 A;  1QZ6 A;  4BR5 A;  1BIZ A;  2OZM A;  1HX1 A;  1QQN A;  5BRD A;  3VTI A;  1NK7 A;  1C1B A;  4CJ3 A;  4CIG A;  4DTJ A;  3F9M A;  4O5B A;  2BGG A;  2VYP A;  1ESV A;  4RW4 A;  4IFY A;  5BPL A;  1HR0 K;  3U4L A;  1XI1 A;  2HBM A;  4IOA L;  3UKU B;  3TSQ A;  2P5O A;  2NRZ A;  3O9U A;  3MN6 A;  4CFB A;  4CK1 A;  1NK9 A;  4DLE A;  1LV5 A;  3PSF A;  3HI0 A;  4E0D A;  5LL6 Z;  4CJ4 A;  4W5R A;  1NKC A;  3T1H K;  1XWL A;  1EET A;  2PBD A;  1Q9Y A;  1BA1 A;  5F1X A;  2P9P B;  5GIN A;  3ZX0 A;  4ID1 A;  2VGN A;  3HBT A;  2OCE A;  3CJ1 A;  2E20 A;  3RRH A;  4JHD A;  4BWJ A;  4X66 K;  1RTI A;  3RMC A;  4GKJ K;  5AQQ A;  4XH5 A;  2EX3 A;  3T69 A;  3SQ0 A;  1R0A A;  1GOB A;  3A5L C;  3CJ7 A;  2D0C A;  2F96 A;  1DTQ A;  4CGI A;  1K8A O;  3SQ1 A;  4DTP A;  2DY4 A;  4AHT A;  3DLK A;  4KHU A;  4CBU A;  5CR4 A;  4H4M A;  4B9Q A;  1NG9 A;  1SKS A;  3DXK A;  4WF9 L;  3FLC O;  4HCC A;  1YTA A;  2HF4 A;  3CYM A;  3K5N A;  1MU2 A;  1IG9 A;  1Y64 A;  5AQI A;  1HNZ K;  4KFB A;  1YAG A;  1U2V B;  3M5R A;  1UAX A;  1WBD A;  1LWC A;  3U3Y A;  2QWM A;  2YKM A;  3O4N A;  2P9S B;  2WFB A;  3D2E B;  3RSE B;  3U6F A;  2VWB A;  3CJB A;  1Z25 A;  4E1M A;  1A5V A;  1O1W A;  2P9U B;  4YOR A;  4FWN A;  3OYF A;  4KB0 A;  3O5B A;  3MXM A;  5A2Q O;  4MLE A;  3HM8 A;  4K43 A;  4FLV A;  1B9F A;  3QIO A;  2O8E B;  2ZGZ A;  2YV0 X;  1A5W A;  1RBV A;  1QQC A;  3V9X A;  3SQ2 A;  4W5T A;  1XQS C;  4N41 A;  5HRR A;  1BQN A;  4UQG A;  3CF5 L;  1J6Z A;  4CGF A;  4Z4E A;  4YOW A;  3UKR A;  4J2D A;  4CZH A;  1L3U A;  5KQD A;  2YJF A;  4CFD A;  4JI3 K;  2E88 A;  1NGH A;  4XIU A;  2W6K A;  2FXU A;  4O0J A;  5BR9 A;  3F73 A;  3ZSZ A;  1ASW A;  3PSI A;  4R79 A;  3CI5 A;  3D2E A;  3G4S N;  1KFS A;  3HL8 A;  3VMF B;  1RDA A;  3AO4 A;  4GV9 A;  4CZL A;  1GOA A;  3R1X A;  1XMO K;  2Q0U A;  1D4X A;  3KLE A;  1LCU A;  4B9T A;  4OVL A;  3DLB A;  4KI4 A;  4B1W B;  1VQM N;  4YOT A;  4CGD A;  4WFB L;  3OBW A;  1IBK K;  3T3F A;  4LFB K;  4B1Y B;  3OYG A;  3THX A;  1SL2 A;  1LAV A;  3RMD A;  3M1F A;  4O5F A;  3VGM A;  4DU4 A;  4E7J A;  4J2E A;  4I9Q A;  1RT5 A;  3NGZ A;  4AF1 A;  2HHS A;  3BUZ B;  2QK9 A;  3W3D A;  4B9L A;  3CCR N;  4E7K A;  3WEE B;  4J2A A;  2X6S A;  1Q86 O;  1N32 K;  3MCP A;  4CEE A;  5AQV A;  3J7Y P;  3C95 A;  1JCE A;  3O9R A;  4O55 A;  1JLE A;  1XMQ K;  4E7L A;  2IC3 A;  2HVI A;  3NH1 A;  1HNI A;  1HUX A;  1VSJ A;  5EXW A;  3OYM A;  4BG9 A;  3DXM B;  2BUP A;  4JLH A;  3VN5 A;  2GV9 A;  1RTJ A;  1HRH A;  4DSL A;  2P9K B;  1I94 K;  1VHX A;  3G6E N;  4B8C A;  3K9J A;  2ASO A;  4PKI A;  5AQF A;  3BF3 A;  1TYQ A;  4BC2 A;  3WQU A;  4W5O A;  2V7Z A;  1WAF A;  3KLF A;  3IMX A;  3KHY A;  3UB5 A;  1HNV A;  1QQO A;  3N4P A;  4CFA A;  4A59 A;  4CEO A;  3PIP L;  5EOY A;  3JAM O;  4N76 A;  4JK8 A;  1QSL A;  3EN9 A;  3GG4 A;  3CME N;  1YIT N;  1BWF O;  4C23 A;  3RMB A;  4KH5 A;  4E89 A;  3MK6 A;  3CFO A;  3ZSQ A;  3MMV A;  4FWM A;  3VGK A;  3LP0 A;  5JMV A;  5AQL A;  2P9K A;  1SS6 A;  2NRX A;  3ENO A;  4LF6 K;  2RPI A;  4CW7 B;  4KHN A;  5ADX H;  2G8U A;  1IKV A;  3GOI A;  3VQC A;  2RKI A;  3G0Z A;  1EO1 A;  3AO5 A;  1GLF O;  1ZBL A;  4BRK A;  1BQM A;  4JKG B;  4F8R A;  1WUA A;  3E1Y A;  3OA9 A;  1Q7Y O;  2F9T A;  4HUG A;  3JS6 A;  4A2B A;  3TAG A;  4IFV A;  4DU1 A;  1S9G A;  3NGY A;  5AQU A;  1SUQ A;  3OYH A;  3VQB A;  4YNQ A;  1BO5 O;  3BZC A;  5HRS A;  4EHT A;  1KRP A;  4H0V B;  3NMU A;  4DR1 K;  3V9Z A;  3L6Q A;  4FLY A;  4Q0B A;  3L8B A;  3WEE A;  3ZET A;  4JK7 A;  3DYA A;  1FW6 A;  2HMP A;  3S9H A;  2OTL N;  3WQT A;  1EP4 A;  5IWA K;  2JWL A;  3KK3 A;  1U04 A;  2YHA A;  4CHZ A;  2BDP A;  4Z4G A;  2NRW A;  4NXM K;  4BRP A;  4B1Z A;  4WQ4 C;  1J9A A;  3CFP A;  3K5M A;  1V4T A;  3H1Q A;  4JHD B;  4ELU A;  1V4S A;  3PY8 A;  3ENB A;  5AQR A;  1D8Y A;  3PIO L;  3KVG A;  1NGF A;  2I7N A;  4FJ7 A;  4U67 L;  5KPR A;  1KLM A;  4GV3 A;  1ASU A;  1KVB A;  1NGJ A;  4FW1 A;  3EY1 A;  4BDP A;  4CJP A;  1L3S A;  4EP5 A;  3RMA A;  3OYL A;  2O8B A;  3LDP A;  1GLC G;  1WSI A;  4EP4 A;  4JKC A;  1GLD G;  3I8B A;  4DQ8 A;  3LPU A;  1GLB G;  2NNW A;  4DFP A;  2E2N A;  4BE2 A;  2JLE A;  2OPR A;  4Z94 A;  4MDB A;  1NK0 A;  3AA3 A;  4CJU A;  4BR2 A;  4JKE A;  3THW A;  4LF7 K;  1CZ9 A;  4YOV A;  1ZBU A;  4DR4 K;  4DV7 K;  5CE3 A;  4H0O A;  3NF8 A;  3CQX A;  1QSY A;  4DTN A;  4DTM A;  1WSG A;  4FLU A;  4OO1 J;  3SAH A;  2P9I B;  1Z05 A;  4IG3 A;  1TVR A;  1RT6 A;  4H4O A;  3HVR A;  2HNZ A;  2Q3S A;  2ZD1 A;  3ITH A;  4PA1 A;  2QM1 A;  3J8A A;  1BI4 B;  2P9U A;  1J54 A;  4DUZ K;  1XHZ A;  3AVF A;  2KLA A;  3RSE A;  1BUP A;  4KRF A;  3IRX A;  2NLX A;  4CHQ A;  4KKO A;  4PL8 A;  4JI8 K;  4OPK A;  3WXL A;  3DLG A;  2RN2 A;  1LAW A;  4ISF A;  4BY9 C;  4FVM A;  1B92 A;  1MDU B;  2KKZ A;  2F8S A;  1DT9 A;  4JD2 A;  1NGB A;  2UUA K;  4FZX C;  3LP2 A;  3O3G A;  3LPT A;  3OYC A;  3QFU A;  2D0A A;  2W6L A;  2O4G A;  1FJG K;  2GBZ A;  3QEV A;  1WLJ A;  2P9L B;  3AVI A;  4RCH A;  2UUC K;  4FWK A;  5BPM A;  1G15 A;  3P31 A;  3QEI A;  1DEJ A;  1NLV A;  2UXD K;  4C8L A;  1YIJ N;  3CM5 A;  4FOI A;  5BRF A;  3VQD A;  2Z1J A;  3T1A A;  3K5O A;  2KFN A;  1YTU A;  3TTC A;  2ZQB A;  1RGI A;  3VEX A;  4L8R B;  1N6Q A;  3MX2 A;  3L4Q A;  2YKN A;  4AHS A;  1VQ9 N;  1X3N A;  4DSF A;  2ZJP L;  3LM9 A;  1JKH A;  5CZ1 A;  5T7B A;  5GAD P;  3DOK A;  2VG5 A;  3C65 A;  4KPY A;  4FVU A;  1YXQ A;  1F21 A;  4H0X B;  4YDU C;  2HB5 A;  3DRP A;  4JN4 A;  1K8K B;  3SV3 A;  5J1E A;  4OKK A;  4CJL A;  4BRC A;  1KXP A;  1T3V A;  4FK0 A;  4OLA A;  4AHC A;  3J7Z O;  1YT3 A;  2D0B A;  1ZXO A;  3CJC A;  4FZZ A;  3C6U A;  4WYB A;  3MED A;  3L4I A;  3TWH A;  1S72 N;  3ATV A;  3VEO A;  5FRN A;  4WCE L;  1RT7 A;  5KGW A;  4IOC L;  4BRF A;  1RBR A;  3AY9 A;  1E3M A;  1IJJ A;  2AJQ A;  5CY4 A;  3ZEU B;  3EYZ A;  2P5G A;  4BR7 A;  3CPW M;  4LF8 K;  4YDU A;  1UWB A;  5IT9 O;  4DTO A;  3TAB A;  1JLB A;  1T44 A;  4CZJ A;  3BF1 A;  5C0Y A;  3OYB A;  3ZSO A;  4CHN A;  4CZK A;  3ENH A;  1NGA A;  1WAJ A;  4CED A;  5HRN A;  1KAY A;  1S6P A;  4BR4 A;  4KHW A;  3UE5 A;  2HW3 A;  4Z4H A;  5ELZ A;  1RT4 A;  1XNR K;  4KHS A;  3IG1 A;  1REV A;  2F8T A;  1QVF M;  3VF6 A;  4BQL A;  2P51 A;  3LDS A;  1KQS M;  1T03 A;  4DQI A;  1VQP N;  3GL1 A;  1S1T A;  1N8R O;  3HRG A;  2KZM A;  4AH9 A;  4CZI A;  5F2R A;  5AQH A;  1TGO A;  3V4I A;  2FBX A;  1VSM A;  2O4I A;  4O4G A;  1BG3 A;  4FK2 A;  1VRU A;  3ZT4 A;  3OVN A;  1QTM A;  1YJW N;  2HBJ A;  4MQ3 A;  3ZX3 A;  2UUB K;  4BGA A;  3TAN A;  5C42 A;  4E1J A;  4M42 A;  3THV A;  1NJZ A;  1XC9 A;  1NOY A;  4F3T A;  1C0U A;  3BP8 A;  4FWO A;  4DCH A;  3TAP A;  3TAQ A;  4I7F A;  5CHI A;  5AQW A;  1KD1 O;  1WSH A;  3E9P A;  1ASV A;  2PAV A;  4WFA L;  2HVH A;  3AGR A;  5C12 A;  1VSK A;  3DI6 A;  4X64 K;  5AQY A;  4CZM A;  5AFU H;  2E1Y A;  1HYV A;  2G8K A;  3ISN C;  3O80 A;  4CVN E;  4E1N A;  3MN7 A;  3JYT A;  3S3O A;  2DFE A;  3ZSX A;  4BR0 A;  1JCF A;  5HOO A;  4B3M K;  3CM6 A;  3O4Q A;  4CHO A;  4DWI A;  3QEX A;  4B3O A;  5KQ8 A;  3VA0 A;  4Z4I A;  3LZI A;  1E4F T;  3LZJ A;  1YJ9 N;  3RR7 A;  1S1V A;  1RDC A;  4CE9 A;  4CEA A;  4EIA A;  5DK5 A;  4CJV A;  4M45 A;  2Q36 A;  1IKW A;  3NFA A;  2G8V A;  3CHW A;  3SJH A;  4JKG A;  4BE0 A;  4C8K A;  2QKK A;  3OJS A;  3L2U A;  3OYA A;  4F2R A;  4BWM A;  1HJO A;  3FZL A;  1J53 A;  4IOX A;  4XH4 A;  4M3T A;  3ASM A;  4QS8 A;  1HKB A;  3MN9 A;  1FKP A;  5AFU A;  3FFI A;  4KO0 A;  5BR8 K;  3O4W A;  5FPM A;  2ITG A;  3SNN A;  4JKA A;  4LSL A;  1D9F A;  4DKW A;  2F7T A;  3CET A;  3LM2 A;  4DLG A;  3U3G A;  3AA2 A;  1B9D A;  4BRN A;  4CF1 A;  2A40 A;  4YFU A;  4CK2 A;  4DB3 A;  4PQU A;  1Y97 A;  3SUO A;  2WBN A;  2FLO A;  4A2A A;  4BRD A;  4IXC A;  1VQ4 N;  4CJF A;  4G9Z A;  2GWK A;  1NK6 A;  4KB1 A;  3H46 O;  2A3Z A;  3VQ9 A;  1ATN A;  2IVN A;  4PUO A;  3QML A;  3ULE A;  4BRA A;  5CZ2 A;  3NF9 A;  4CIE A;  1YUW A;  3TAR A;  4WE1 A;  3NF7 A;  4H0T B;  1P8Z A;  1W0H A;  2I5J A;  4FJJ A;  4CI6 A;  4BRM A;  3CCU N;  3FFK B;  5CYQ A;  4CGG A;  3THY B;  5D3G A;  1C0T A;  2VWJ A;  2QA4 N;  3HTV A;  1BCO A;  3WNF A;  4Z4C A;  3LAL A;  5AQP A;  2D5R A;  3BGR A;  2D0O A;  1BIU A;  4DF8 A;  5LJV A;  2UU9 K;  2E8A A;  4H03 B;  1VQN N;  1C0M A;  4OKE A;  5B8H A;  4CBW A;  2KW4 A;  3VQA A;  3L2R A;  1YF5 L;  2FF3 B;  2P9N B;  4DU3 A;  4FK4 A;  1BIS A;  1VQO N;  2OYQ A;  2OZS A;  3KIO A;  1J5O A;  4DV0 K;  1OH8 A;  1IBL K;  3DWL A;  4CF9 A;  4CF8 A;  4CJW A;  2B5J A;  2W41 A;  1L5U A;  3DJC A;  4OJR A;  1BOT O;  1TUU A;  5DM6 L;  2VG7 A;  5C2F A;  4ILJ A;  4C1N K;  1VQ5 N;  3AO1 A;  2YHY A;  1TK0 A;  2Z1H A;  3HT3 A;  1X1P A;  3G71 N;  1Q9X A;  4JRQ A;  4MFB A;  3D45 A;  3KLH A;  3LDL A;  3VF2 A;  3KKR A;  1HNW K;  1CLQ A;  1RIL A;  4FLT A;  4DQR A;  3KD5 E;  3ZET B;  3OYJ A;  3FZK A;  1JL2 A;  3SJJ A;  4FJ5 A;  4FJI A;  1EWQ A;  1VQL N;  2DPN A;  1S6Q A;  3NBP A;  4A5A A;  1NGG A;  2GEM A;  4CF2 A;  5AQM A;  2YHW A;  3EO3 A;  3FGU A;  5TKY A;  2A41 A;  2AP1 A;  2JWK A;  2CGK A;  3NDK A;  2YHB A;  4BDZ A;  4LD0 A;  2WUS A;  4YOX A;  5BN9 A;  4GV6 A;  4CER A;  2WTU A;  3PX6 A;  4YHH K;  3NAE A;  1WOQ A;  2YNH A;  1XNQ K;  2ZF5 O;  3EKU A;  3CCE N;  3VQ6 A;  3I8D A;  5JS1 A;  2GTD A;  3ULD A;  1ZC6 A;  2XY7 A;  4DV6 K;  1N33 K;  3VEW A;  4CHY A;  4I2Q A;  3ZYY X;  3QNO A;  4JI0 K;  4W5N A;  3A8Y A;  4F2S A;  3MEG A;  4M7X A;  4DS4 A;  5M1O A;  3C7N B;  2IOC A;  5JLF A;  3HOS A;  3ZT3 A;  3PV8 A;  3CCS N;  4U7B A;  2BH1 A;  2XO7 A;  4C8N A;  1NBW A;  1OH7 A;  4CEQ A;  5M1N A;  3ID8 A;  5TKW A;  4B1V A;  4E19 A;  1M1K O;  4ILG B;  5DM7 L;  4DV5 K;  4JKB A;  4JI1 K;  2PFU A;  3QLH A;  5FPN A;  4CZE A;  3O9Q A;  2A5X A;  3HO1 A;  4B9M A;  5AJ3 K;  3HST B;  1NJX A;  4E7H A;  4B3S K;  4FLZ A;  5I3U A;  2HHW A;  3R3L A;  1X9M A;  4GKK K;  4DR2 K;  4JKF A;  3O6W A;  3OHR A;  3OBY A;  1TK8 A;  3B6P A;  3RRG A;  4UY8 O;  3AVL A;  4C8O A;  3VTH A;  1YVU A;  4JKH A;  3AO2 A;  1D9D A;  3V1O A;  1QHA A;  3SYZ A;  3AVA A;  4H0Y B;  5EX5 A;  4IO8 A;  3B6O A;  3P4I A;  3U8X A;  4AIL C;  4V19 S;  1JLA A;  5AQT A;  5M1F A;  2E5L K;  1HYS A;  3QNN A;  1C0F A;  3LWL A;  1NK5 A;  2QEX N;  3SBG A;  3WXM B;  2E2O A;  4YOY A;  4YY3 K;  2OA8 A;  1KTQ A;  3L2V A;  4IJN A;  5FLX O;  2Q1N A;  1K6Y A;  1ZBS A;  3U9D A;  3THX B;  4HUF A;  3VER A;  3M8S A;  1JLG A;  1RT3 A;  4AM6 A;  3GBT A;  4DTX A;  3TAM A;  1TKT A;  3P39 A;  2LSN A;  1ATS A;  1WSE A;  4I6M B;  5FPD A;  2NUB A;  4IDK A;  3TPQ A;  3EZ5 A;  1WB9 A;  4CZG A;  3L0Q A;  3OYD A;  3NH0 A;  1WBB A;  1NJI O;  3L3U A;  4PKH A;  3VET A;  3BDP A;  3SZ2 A;  3O9T A;  4Z4F A;  1TL1 A;  5J2N A;  3QET A;  3K5L A;  1OKJ A;  2NRV A;  2IIR A;  3MEE A;  4FZY A;  3FZF A;  3LDO A;  4EAH D;  5I9E B;  4DUY K;  3RR8 A;  2NZT A;  4DSK A;  5AQZ A;  3JSM A;  3I0R A;  3ATU A;  2X6N A;  2OPS A;  1EKE A;  4KHQ A;  1QVG M;  4DSI A;  4ELV A;  4CGH A;  3U9Z A;  4JKD A;  2EWS A;  2Q2R A;  1S1X A;  3SMS A;  1SKW A;  3CG7 A;  4JI2 K;  3SAG A;  5AQS A;  5GIO A;  1HPM A;  1IV0 A;  4KHP K;  3QIP A;  4MO5 A;  3CPE A;  4KV8 A;  1NGE A;  4IKF A;  4CHP A;  1T6D A;  5GAG P;  4ICL A;  1SQK A;  4RWT A;  4DV3 K;  4FJH A;  3CCJ N;  4OKJ A;  3HXM A;  2D0P A;  3IDH A;  3KLI A;  1U47 A;  3TR8 A;  4CJ7 A;  1BI4 A;  2HHH K;  1TV6 A;  1HQU A;  2YNF A;  3QIN A;  1GLJ O;  4GW6 A;  4IZ9 A;  3CCQ N;  4Z0U A;  5C10 A;  3O3F A;  1W7A A;  3CC7 N;  2ZJQ L;  3Q7B A;  1YVN A;  4LF5 K;  4NCA A;  1JLF A;  1ZBH A;  3AVH A;  3JXU A;  4AHV A;  4C1N I;  2Z1G A;  2BE2 A;  3P38 A;  3MXI A;  1NMD A;  2P9S A;  3CMA N;  3CC2 N;  4NLC A;  4BR9 A;  3MWT A;  2IS3 A;  4PY5 A;  4I9L A;  4LFC K;  1NKB A;  4AHR A;  3DXK B;  3QBW A;  4QS9 A;  1NM1 A;  1OH5 A;  2FF6 A;  2DFF A;  4H8K A;  5JVG L;  3R8E A;  3LP1 A;  3F2K A;  4CEC A;  3HVT A;  2Y1I A;  4CEZ A;  3E01 A;  3O08 A;  4OPJ A;  3VGL A;  3EL2 A;  5F0X A;  3E9O A;  2JGU A;  3ALY A;  4DQQ A;  4FWQ A;  2GWJ A;  3A5O C;  3CJ9 A;  1RTH A;  2CH6 A;  3LDQ A;  3ZT2 A;  4BC5 A;  3A2F A;  3WXI A;  2UXC K;  3Q7C A;  4QCL A;  4LSN A;  3AVK A;  2O8C A;  3O3H A;  1BGX T;  1A5X A;  2QXF A;  2HBK A;  3OS0 A;  1U4B A;  4YOU A;  1BHL A;  2J4R A;  1N34 K;  2CGJ A;  2RHK A;  4ISE A;  4RW7 A;  2PYJ A;  1WSF A;  3SCX A;  3UKU A;  5JLH A;  3GDQ A;  3HYF A;  2ZJR L;  2I7P A;  3QFP A;  4LFA K;  4HHT A;  1MWK A;  4OX9 K;  4X62 K;  2E4L A;  2P1J A;  3VEN A;  5SZT A;  4DV1 K;  5H1S Q;  1NGC A;  4DQS A;  1OVQ A;  1JXE A;  2NRR A;  3EE8 A;  3WXK A;  4CZF A;  3QDK A;  4BE1 A;  5AZJ B;  4BVO A;  4BVP A;  4ELT A;  1RBU A;  3LAK A;  2W40 A;  2ASP A;  4B1U B;  2YX6 A;  3SI6 A;  1HJR A;  3R6M A;  4MLH A;  2V7Y A;  4IBN A;  2RE2 A;  4LF4 K;  3VQ7 A;  4CD1 A;  4BRH A;  2E1Z A;  4AM7 A;  1SAZ A;  5K14 A;  3E9L A;  5AQG A;  4BGB A;  3M8R A;  5HP1 A;  2VCP A;  2R7Y A;  4FWR A;  3NVM A;  3CCV N;  1RT2 A;  2ZGY A;  1CXQ A;  3K57 A;  3ULE B;  4WQ4 A;  3J81 O;  1VQ7 N;  3OTO K;  2OTJ N;  4FLW A;  3SMP A;  1Z6R A;  4OGE A;  2CGL A;  1K73 O;  4FWL A;  1YHQ N;  2Y1J A;  1T8E A;  4M3W A;  4XEI A;  3UIQ A;  4PWD A;  5HRP A;  3V6D A;  3KWG A;  5J2P A;  2VG6 A;  4RG8 A;  4FWS A;  4BRE A;  1RCH A;  5AZI B;  1NK4 A;  4DR5 K;  3CXC M;  4JI7 K;  1X9J A;  3MEC A;  4Y1C A;  3IUC A;  4BRO A;  1TKD A;  4DSE A;  1Q82 O;  3GE1 A;  2HHV A;  2IAJ A;  3VQE A;  5E84 A;  2A1S A;  4F3O A;  1JLQ A;  4B9N A;  4B9V A;  3CCM N;  1VSH A;  4NCG A;  1SV5 A;  5AQK A;  3AAP A;  1GLE G;  3EE9 A;  3SQ4 A;  5KRT A;  3VA3 A;  4NYF A;  5LY3 A;  3H3O B;  3SLC A;  1W9H A;  1VSD A;  4O8U A;  4BQZ A;  5HLF A;  4E7I A;  3PLA A;  3LAN A;  5HBM A;  1VSF A;  3HSC A;  4CGJ A;  1BL3 A;  1IKY A;  3CCL N;  1GLL O;  4DV4 K;  2B4J A;  3LWM A;  4H5R A;  3DOL A;  4FM0 A;  4FJ9 A;  1TKZ A;  4KAZ A;  3CD6 N;  3F5T A;  3O9S A;  2O8D B;  2XHB A;  2BTF A;  3P1G A;  4JV5 K;  4A61 A;  4BRI A;  4CBX A;  3PO5 A;  3KK2 A;  1UOC A;  3T19 A;  1VQ6 N;  3SBT A;  4IWV A;  3VEV A;  4F4K A;  3VEY A;  2FSK A;  4J2B A;  1NGD A;  4DTU A;  1JL1 A;  2Q97 A;  1FKO A;  4JAX A;  3FZM A;  3V1R A;  3FZH A;  2QWR A;  5FPE A;  1LWF A;  3O8M A;  3KWI A;  3AVB A;  3LL3 A;  4EFH A;  3D2F B;  5C24 A;  3KJV A;  1HKG A;  2F9W A;  3O1B A;  1ILY A;  1RDB A;  3OYE A;  5ADX A;  4RW8 A;  1M90 O;  3CQ8 A;  4HWI A;  5CYM A;  3HP9 A;  4CEB A;  2G8H A;  2HNY A;  1C1A A;  4GMJ B;  2F4V K;  4LF9 K;  4CF0 A;  5J2Q A;  5KGX A;  3VQ5 A;  4JI4 K;  2PYL A;  3M8P A;  4GNI A;  4A5B A;  4BC4 A;  1LWE A;  3C7N A;  4B9U A;  3PX0 A;  1T6C A;  4FM1 A;  2IDO A;  1C1C A;  4KBO A;  1HLU A;  3ZSY A;  1NOZ A;  2A6A A;  4LY7 A;  3TSU A;  3DXM A;  3T7Z A;  3DAW A;  3DM2 A;  4E3S A;  1Q8I A;  3KKS A;  4PL7 A;  4FOE A;  4JS4 A;  4M41 A;  1RBS A;  1XHX A;  3IFR A;  1UA1 A;  3C0B A;  4KH4 A;  3WNH A;  2H3G X;  5BPN A;  3S41 A;  5C25 A;  3K59 A;  3TAE A;  3DRS A;  1G99 A;  3DLE A;  2O8B B;  1KSP A;  4AHU A;  1IKX A;  4ZTF A;  4BDY A;  3KZB A;  4BRG A;  1X9W A;  2E2P A;  3AVC A;  4LH4 A;  4NO7 A;  1IH7 A;  4JK9 A;  3C6T A;  3V9U A;  4CJK A;  1NGI A;  2IVP A;  1QS4 A;  2NRH A;  4OGC A;  5M1P A;  3SV4 A;  4MO4 A;  1K8K A;  5GAE P;  1SL1 A;  2E6M A;  2QI2 A;  2QW9 A;  1TL3 A;  4I6M A;  2FBY A;  3FR0 A;  2A42 A;  4H5V A;  5EY4 A;  2VWK A;  4IFE A;  4NB4 A;  4DQP A;  2DTU A;  4B08 A;  5C15 A;  3HK2 A;  4N5S A;  2YI1 A;  4FXD A;  3TU5 A;  2QWL A;  3AVN A;  5LMU K;  2VQE K;  1TAU A;  4CFC A;  1OH6 A;  4IDH A;  2ETJ A;  4A57 A;  3D7E O;  1TAQ A;  3ZSR A;  4DR7 K;  3PUF A;  3QES A;  4NLB A;  4O8K A;  1IBM K;  2HST A;  3NVK A;  1RTD A;  4N47 A;  2X74 A;  4DTS A;  4CJT A;  2B6A A;  3KD1 E;  2P9N A;  3SPZ A;  2QKB A;  2XRI A;  4C8M A;  4JI5 K;  3A5M C;  4IJA A;  4XH1 A;  3S3M A;  4QAG A;  1K9M O;  5BRE A;  3SUQ A;  3OW2 M;  3ZT0 A;  5JIC A;  3OY9 A;  3AGK A;  3M6G A;  4PKG A;  2XY6 A;  3WT0 A;  5JS2 A;  4K25 A;  1SZ2 A;  4B3T K;  4H5W A;  4JEP A;  3SAF A;  2HOE A;  1NJW A;  4N56 A;  1QZ5 A;  1DKG D;  3DLL L;  4KRE A;  5EVZ A;  3MDQ A;  4HCB A;  3RVC A;  3VES A;  3DLR A;  5LJW A;  2X78 A;  4DHY A;  1NK8 A;  4M3X A;  4M3Y A;  4B3R K;  2BAN A;  2QXL A;  1HQE A;  1P90 A;  1T05 A;  4FYD A;  3I0S A;  4GVE A;  3ZSV A;  2UYT A;  2HHX A;  4CEF A;  4FJX A;  4RW6 A;  1ZYQ A;  1S5J A;  1KAX A;  2AA4 A;  4KH6 A;  4OPA A;  4FJK A;  1O13 A;  1QQM A;  4QS7 A;  3HOT A;  3WUH A;  2GUP A;  4M3U A;  3VQ4 A;  1OVY A;  3J7A P;  4IO9 L;  1EXQ A;  3IKM A;  2G8F A;  3H08 A;  5BN8 A;  3H1V X;  4CCH A;  1KVC A;  3OS2 A;  3G25 A;  4DFK A;  1WSJ A;  3QEW A;  1VSI A;  2A1R A;  1S3X A;  1KC8 O;  3KK1 A;  4ID5 A;  4WQ5 C;  1JLC A;  3DLH A;  2QWO A;  4DS5 A;  1ZBI A;  2WC9 A;  3AV9 A;  3I55 N;  3MX5 A;  2ITM A;  1JJ2 M;  4JRP A;  5E41 A;  4H0P A;  5FRO A;  1T7P A;  2YNG A;  4CJR A;  2O8D A;  2HND A;  5AR0 A;  5M1K A;  1ZBF A;  3ZCM A;  4M3R A;  3QO9 A;  5E26 A;  5AQO A;  5BRH A;  4OPH A;  3C6H A;  1J5E K;  4CJE A;  3M3Z A;  4BRQ A;  1XC3 A;  3VQ8 A;  4IEI A;  4Y0W A;  1DTT A;  4NCB A;  1S1U A;  4EHU A;  2ZWH A;  3AVM A;  4LC9 B;  4O0I A;  3D0P A;  4AQY K;  1N36 K;  4H5N A;  4FO0 A;  1TK5 A;  4FPB A;  4B8A B;  1FK9 A;  3HPO A;  2QWQ A;  3CER A;  4W5Q A;  3WXJ A;  4ISG A;  3B8A X;  4PHT X;  4CD3 A;  4ZHR A;  1KAZ A; 
#chains in the Genus database with same CATH homology
 2KFZ A;  4KB0 A;  1I39 A;  1RTH A;  4MQ3 A;  3MXM A;  3ZT2 A;  3TAN A;  3AA5 X;  3A2F A;  5C42 A;  4QCL A;  4LSN A;  1C6V A;  4M42 A;  3AVK A;  3THV A;  3K58 A;  1NJZ A;  1XC9 A;  1L3V A;  1NOY A;  4F3T A;  1KVA A;  1B9F A;  1C0U A;  3QIO A;  3O3H A;  4FLV A;  1BGX T;  3VQP A;  1A5X A;  2QXF A;  1RBT A;  1KLN A;  2YV0 X;  3TAP A;  1A5W A;  4TSX A;  1RBV A;  1QQC A;  4I7F A;  5FDL A;  3OS0 A;  3V9X A;  3QER A;  3TAQ A;  1WSH A;  1ASV A;  3SQ2 A;  1BHL A;  2IGI A;  4W5T A;  2HVH A;  4N41 A;  1VSK A;  3DI6 A;  5HRR A;  2KTQ A;  1BQN A;  4UQG A;  2HMI A;  4DFM A;  4CGF A;  4CIF A;  4Z4E A;  1QSS A;  1D5A A;  4RW7 A;  2PYJ A;  4J2D A;  1HYV A;  1WSF A;  3SCX A;  1L3U A;  1HPZ A;  2G8K A;  5KI6 A;  3F9K A;  3ISN C;  4CFD A;  3HYF A;  4E1N A;  3JYT A;  3S3O A;  2DFE A;  3ZSX A;  4XIU A;  4BAC A;  4O0J A;  3F73 A;  3ZSZ A;  1ASW A;  4HHT A;  5EU7 A;  3V81 A;  3TI0 A;  2E4L A;  2P1J A;  1BCM A;  5SZT A;  3CM6 A;  1KFS A;  3O4Q A;  4DQS A;  3HL8 A;  4CHO A;  5J2M A;  1JXE A;  1RDA A;  3AO4 A;  4DWI A;  1RNH A;  4IG0 A;  3QEX A;  4BE1 A;  4B3O A;  3VA0 A;  4Z4I A;  1GOA A;  4I2P A;  3LZI A;  4NYN A;  4JS5 A;  3LZJ A;  4DTR A;  3RR7 A;  3KLE A;  4ELT A;  4B9T A;  3V1Q A;  1DLO A;  1RBU A;  1RDC A;  1S1V A;  3LAK A;  4OVL A;  4CEA A;  2E6L A;  4CE9 A;  3V9W A;  3HPH A;  5DK5 A;  4CJV A;  1LW0 A;  4M45 A;  4DFJ A;  3DLB A;  4KI4 A;  3NF6 A;  3SI6 A;  1IKW A;  3NFA A;  2G8V A;  1HJR A;  4BE0 A;  4CJ5 A;  4IBN A;  3PX4 A;  4C8K A;  3VQ7 A;  4CGD A;  2OPP A;  2QKK A;  3OJS A;  3L2U A;  3OYA A;  4F2R A;  5K14 A;  4BWM A;  4CJS A;  1J53 A;  3T3F A;  2Z1I A;  3SUP A;  3M8R A;  2XY8 A;  5HP1 A;  3ASM A;  3OYG A;  2R7Y A;  1N5Y A;  4M3T A;  1FKP A;  4PWD A;  1RT2 A;  3FFI A;  1SL2 A;  1LAV A;  4KO0 A;  1CXQ A;  3K57 A;  3RMD A;  1EX4 A;  4FJ8 A;  4DU4 A;  1SL0 A;  4E7J A;  4J2E A;  1VSL A;  2ITG A;  4I9Q A;  1RT5 A;  3NGZ A;  3SNN A;  4FLW A;  4LSL A;  1D9F A;  2HHS A;  2QK9 A;  4OGE A;  1KCF A;  3KTQ A;  4DLG A;  1RDD A;  4B9L A;  3U3G A;  4E7K A;  3AA2 A;  1B9D A;  4YFU A;  4CF1 A;  2Y1J A;  1T8E A;  2X6S A;  4J2A A;  4CK2 A;  4KHY A;  4FYD A;  4M3W A;  4PQU A;  4CEE A;  1U45 A;  1TKX A;  1Y97 A;  3SUO A;  3UIQ A;  3C95 A;  5HRP A;  3V6D A;  1FXX A;  3P5J A;  3ZSW A;  4O55 A;  5J2P A;  1JLE A;  3HPG A;  4E7L A;  3M8Q A;  3OYI A;  2VG6 A;  4CJF A;  2IC3 A;  2HVI A;  3NH1 A;  1HNI A;  1KFD A;  4RG8 A;  1NK6 A;  1GOC A;  4KB1 A;  1RCH A;  1VSJ A;  1NK4 A;  3OYM A;  2YNI A;  3VQ9 A;  2ATQ A;  3NE6 A;  3MEC A;  3SUN A;  4PUO A;  4JLH A;  4Y1C A;  3VN5 A;  1TKD A;  4DSE A;  2HHV A;  3OJU A;  2IAJ A;  2GV9 A;  3VQE A;  2A1S A;  1RTJ A;  3NF9 A;  5CZ2 A;  4CIE A;  1JLQ A;  4B9N A;  4DSJ A;  4F3O A;  3TAR A;  4WE1 A;  1HRH A;  4B9V A;  4DSL A;  3C94 A;  3NF7 A;  1VSH A;  4NCG A;  1IO2 A;  4B8C A;  1SV5 A;  1W0H A;  2I5J A;  4FJJ A;  5D3G A;  4CGG A;  5CYQ A;  1C0T A;  4HVJ A;  2VWJ A;  3HJF A;  4W5O A;  1BCO A;  3WNF A;  2HHQ A;  1WAF A;  3HM9 A;  4Z4C A;  3KLF A;  3NH2 A;  3QEP A;  4CES A;  5I42 A;  3LAL A;  3AVJ A;  3SQ4 A;  1HNV A;  3LP3 A;  5KRT A;  2D5R A;  4NYF A;  3BGR A;  4CFA A;  3VA3 A;  4FLX A;  1W9H A;  1BIU A;  1ITG A;  1VSD A;  4CEO A;  4DF8 A;  1NJY A;  3V9S A;  4E7I A;  5HLF A;  1SKR A;  2OPQ A;  3LAN A;  4N76 A;  1S1W A;  1C0M A;  4OKE A;  5HBM A;  3RTV A;  4KI6 A;  1QSL A;  5DMR A;  4ZTJ A;  4KTQ A;  1VSF A;  4CGJ A;  1BL3 A;  2KW4 A;  3VQA A;  3L2R A;  1IKY A;  4DU3 A;  2B4J A;  4FK4 A;  1BIS A;  2OZS A;  3LWM A;  2OYQ A;  3DOL A;  3KIO A;  4FM0 A;  3RMB A;  4FJ9 A;  1J5O A;  1LW2 A;  1TKZ A;  4KAZ A;  4FJM A;  2FBT A;  4E89 A;  2XHB A;  4CF9 A;  3P1G A;  4CF8 A;  3CFO A;  4CJW A;  2B5J A;  3ZSQ A;  4R5P A;  4FZX C;  3LP0 A;  1L5U A;  4OJR A;  1U48 A;  3NCI A;  2VG7 A;  1HMV A;  5KTQ A;  3PO5 A;  3HP6 A;  3AO1 A;  1TK0 A;  2RPI A;  4KHN A;  2Z1H A;  3HT3 A;  3KK2 A;  1X1P A;  2G8U A;  1IKV A;  3IAY A;  1UOC A;  3T19 A;  3VQC A;  3P83 D;  4JRQ A;  1Q9X A;  2RKI A;  3G0Z A;  4MFB A;  3D45 A;  3KLH A;  4F4K A;  3AO5 A;  1U4B A;  4DF4 A;  1U49 A;  1CZB A;  4J2B A;  1ZBL A;  3PO4 A;  3KKR A;  1CLQ A;  1RIL A;  4RW9 A;  1BQM A;  4FLT A;  2KQ2 A;  4DQR A;  4DTU A;  1JL1 A;  3KD5 E;  1VRT A;  1FKO A;  1Z26 A;  3OYJ A;  4F8R A;  1JL2 A;  3SJJ A;  4FJ5 A;  4FJI A;  4HUG A;  3V1R A;  3L2Q A;  1S6Q A;  3NBP A;  2HHT A;  4FM2 A;  3TAG A;  4IFV A;  1LWF A;  4DU1 A;  3ZT1 A;  1S9G A;  3NGY A;  4CF2 A;  2FBV A;  1SUQ A;  3AVB A;  3OYH A;  3VQB A;  4YNQ A;  3RWU A;  3SPY A;  1QHT A;  3S3N A;  5HRS A;  5C24 A;  3KJV A;  5HRO A;  1KRP A;  2FC0 A;  3AA4 A;  3NDK A;  5KRS A;  1RDB A;  2YHB A;  3V9Z A;  4BDZ A;  3OYE A;  4LD0 A;  4RW8 A;  3CFR A;  4FLY A;  4Q0B A;  3L8B A;  3CQ8 A;  3DYA A;  5CYM A;  4CER A;  3S9H A;  3PX6 A;  3HP9 A;  4CEB A;  3NAE A;  2HNY A;  2YNH A;  2G8H A;  1C1A A;  4GMJ B;  2PZS A;  1EP4 A;  1WNS A;  3KK3 A;  1U04 A;  3VQ6 A;  3I8D A;  5JS1 A;  4CF0 A;  5J2Q A;  3ULD A;  4GVM A;  5KGX A;  2XY7 A;  4K8X A;  2YHA A;  3VQ5 A;  2PYL A;  5SWM A;  4CHY A;  3M8P A;  3K2P A;  4I2Q A;  4CHZ A;  2BDP A;  4Z4G A;  2DFH A;  3QNO A;  1LWE A;  4HTU A;  4W5N A;  3NGI A;  1L3T A;  2EHG A;  1J9A A;  4KTZ A;  3K5M A;  3CFP A;  4FM1 A;  3PX0 A;  2IDO A;  2W42 A;  4B9U A;  1C1C A;  4ELU A;  3PY8 A;  4F2S A;  3MEG A;  3ZSY A;  1NOZ A;  1D8Y A;  4HUE A;  4DS4 A;  3MAQ A;  4LY7 A;  4FJ7 A;  3WNG A;  1KLM A;  2IOC A;  3KLG A;  4K8Z A;  1ASU A;  1KVB A;  4G1Q A;  3ZT3 A;  3L3V A;  4DG1 A;  2WON A;  4FW1 A;  3PV8 A;  1NKE A;  3DM2 A;  3EY1 A;  2XO7 A;  1VSE A;  4C8N A;  4E3S A;  1QTM A;  1Q8I A;  2GUI A;  4CJP A;  3NHG A;  4BDP A;  1HYZ A;  3MXJ A;  4CJQ A;  3KKS A;  4CEQ A;  1L3S A;  1WN7 A;  4EP5 A;  4JS4 A;  3RMA A;  4KTW A;  2KZZ A;  3OYL A;  4EZ9 A;  4E19 A;  4M41 A;  1RBS A;  1WSI A;  1XHX A;  4EP4 A;  4DFP A;  1UA1 A;  3LPU A;  2G8I A;  2HHU A;  3QLH A;  3WNH A;  3HO1 A;  4B9M A;  5C25 A;  3K59 A;  4BE2 A;  3DRS A;  3TAE A;  3DLE A;  2JLE A;  3HST B;  3DRR A;  1NJX A;  2OPR A;  4E7H A;  1NK0 A;  1KSP A;  4AHU A;  4FLZ A;  1IKX A;  3AA3 A;  4CJU A;  5I3U A;  4ZTF A;  4BDY A;  2HHW A;  1X9M A;  3TAF A;  1X9W A;  3AVC A;  4LH4 A;  1IH7 A;  3IS9 A;  3AVG A;  3C6T A;  1CZ9 A;  3V9U A;  4CJK A;  1ZBU A;  1UA0 A;  1QS4 A;  2ZE2 A;  4OGC A;  1TK8 A;  3B6P A;  3NF8 A;  3SV4 A;  3RRG A;  4EZ6 A;  3AVL A;  4C8O A;  1X9S A;  1YVU A;  1QSY A;  4DTN A;  3AO3 A;  3AO2 A;  1SL1 A;  4LH5 A;  3V1O A;  1WSG A;  4FLU A;  4DTM A;  1D9D A;  2E6M A;  3SYZ A;  3AVA A;  4OLB A;  3G10 A;  1TL3 A;  5FRM A;  4IG3 A;  1TVR A;  1RT6 A;  3B6O A;  4Y1D A;  4AIL C;  2FBY A;  1JLA A;  1HYS A;  3DMJ A;  4H4O A;  3HVR A;  3OYN A;  3QNN A;  4FW2 A;  2G8W A;  2HNZ A;  2VWK A;  2Q3S A;  2ZD1 A;  3L2W A;  4DQP A;  3ITH A;  4PA1 A;  2DTU A;  4B08 A;  3WNE A;  3LWL A;  1NK5 A;  4N5S A;  1BI4 B;  1S9E A;  3HK2 A;  4FXD A;  3AVN A;  1J54 A;  4O44 A;  1XHZ A;  3AVF A;  2OA8 A;  1KTQ A;  4KRF A;  1TAU A;  3L2V A;  4CFC A;  1RT1 A;  3IRX A;  3VQQ A;  4CHQ A;  2RF2 A;  4KKO A;  2ETJ A;  4OPK A;  3DLG A;  2RN2 A;  1TAQ A;  1I3A A;  1LAW A;  3ZSR A;  4FJL A;  3PUF A;  3QES A;  1K6Y A;  4FVM A;  1B92 A;  3OYK A;  2F8S A;  4HUF A;  1RTD A;  4N47 A;  2PY5 A;  3OS1 A;  2X74 A;  1JLG A;  1RT3 A;  3LP2 A;  4CJT A;  2B6A A;  3O3G A;  3M8S A;  4DTS A;  2WOM A;  4DTX A;  4B9S A;  3TAM A;  3KD1 E;  3LPT A;  3OYC A;  3SPZ A;  2QKB A;  1TKT A;  2XRI A;  1CXU A;  2LSN A;  4C8M A;  4FCY A;  4FJG A;  2D0A A;  4DMN A;  4QOZ B;  2O4G A;  3S3M A;  1WSE A;  2GBZ A;  2NUB A;  1WLJ A;  4IDK A;  3QEV A;  4QAG A;  4M3Z A;  3EZ5 A;  1VK0 A;  3SUQ A;  3AVI A;  1QE1 A;  4FJN A;  1G15 A;  3ZT0 A;  3OY9 A;  3QEI A;  3LAM A;  2XY5 A;  3OYD A;  3NH0 A;  2XY6 A;  4C8L A;  4CK3 A;  3CM5 A;  3L3U A;  5JS2 A;  3VQD A;  1JXB A;  2Z1J A;  3T1A A;  3K5O A;  4Q5V A;  1YTU A;  2KFN A;  3BDP A;  3SZ2 A;  4Z4F A;  1TL1 A;  2ZQB A;  5J2N A;  3QET A;  1NJW A;  4N56 A;  3K5L A;  1BIZ A;  4L8R B;  2OZM A;  3MEE A;  1N6Q A;  4KRE A;  4FZY A;  2YKN A;  4HCB A;  1NK7 A;  1C1B A;  4AHS A;  4CJ3 A;  4CIG A;  4O5B A;  3DLR A;  4DTJ A;  3RR8 A;  2BGG A;  4DSF A;  4RW4 A;  4DSK A;  2X78 A;  4IFY A;  1NK8 A;  4M3X A;  4M3Y A;  3JSM A;  1XI1 A;  1JKH A;  3I0R A;  5CZ1 A;  5T7B A;  2X6N A;  2BAN A;  2OPS A;  2VG5 A;  1EKE A;  1HQE A;  3DOK A;  2P5O A;  4KPY A;  1F21 A;  4KHQ A;  1T05 A;  4DSI A;  4CFB A;  3I0S A;  4CK1 A;  4CGH A;  2HB5 A;  3DRP A;  4DLE A;  1NK9 A;  3ZSV A;  1LV5 A;  4ELV A;  2HHX A;  4CEF A;  3SV3 A;  4FJX A;  4RW6 A;  1S1X A;  1ZYQ A;  4E0D A;  1S5J A;  5J1E A;  4W5R A;  4CJ4 A;  3CG7 A;  1NKC A;  4OKK A;  1SKW A;  4CJL A;  1XWL A;  4FJK A;  1EET A;  4FK0 A;  3QIP A;  4OLA A;  4KV8 A;  1Q9Y A;  4M3U A;  3VQ4 A;  4IKF A;  4AHC A;  4CHP A;  4ICL A;  1YT3 A;  2D0B A;  4ID1 A;  1EXQ A;  2G8F A;  4FZZ A;  3H08 A;  3C6U A;  4FJH A;  3MED A;  4OKJ A;  3HXM A;  3TWH A;  3KLI A;  1KVC A;  4CCH A;  3OS2 A;  3RRH A;  1U47 A;  4DFK A;  3TR8 A;  5FRN A;  1BI4 A;  1RT7 A;  1WSJ A;  1TV6 A;  1VSI A;  5KGW A;  4BWJ A;  3QEW A;  3KK1 A;  2A1R A;  1RTI A;  1RBR A;  1HQU A;  2YNF A;  3QIN A;  4ID5 A;  3RMC A;  2AJQ A;  4GW6 A;  5CY4 A;  1JLC A;  3DLH A;  3EYZ A;  4Z0U A;  3O3F A;  2P5G A;  4DS5 A;  1UWB A;  2EX3 A;  3SQ0 A;  1R0A A;  1ZBI A;  4DTO A;  3TAB A;  1GOB A;  1JLB A;  3AV9 A;  1JLF A;  2D0C A;  2F96 A;  4NCA A;  1ZBH A;  1DTQ A;  3AVH A;  4CGI A;  3SQ1 A;  4DTP A;  3OYB A;  5E41 A;  5FRO A;  4JRP A;  1T7P A;  3ZSO A;  4AHT A;  2DY4 A;  3DLK A;  4AHV A;  2YNG A;  4CJR A;  4KHU A;  2Z1G A;  2HND A;  4CHN A;  4H4M A;  2BE2 A;  1ZBF A;  1WAJ A;  3MXI A;  3ZCM A;  1SKS A;  4M3R A;  3QO9 A;  4CED A;  5HRN A;  1S6P A;  4HCC A;  4KHW A;  1YTA A;  2HW3 A;  4Z4H A;  1RT4 A;  4CJE A;  3VQ8 A;  3CYM A;  3K5N A;  1MU2 A;  2IS3 A;  1DTT A;  3IG1 A;  1IG9 A;  4KHS A;  1REV A;  2F8T A;  2P51 A;  4PY5 A;  4KFB A;  4NCB A;  3LDS A;  1S1U A;  4I9L A;  1UAX A;  4O0I A;  3AVM A;  1LWC A;  1T03 A;  3U3Y A;  3D0P A;  4DQI A;  2YKM A;  3O4N A;  1S1T A;  1NKB A;  4AHR A;  1TK5 A;  4B8A B;  2KZM A;  1FK9 A;  4AH9 A;  2DFF A;  4H8K A;  3U6F A;  1TGO A;  3HPO A;  1Z25 A;  3V4I A;  4W5Q A;  4E1M A;  2FBX A;  3LP1 A;  1VSM A;  2O4I A;  1A5V A;  4O4G A;  4FK2 A;  4CEC A;  3HVT A;  2Y1I A;  4CEZ A;  3E01 A;  1VRU A;  4OPJ A;  4ZHR A;  1O1W A;  3OVN A;  3ZT4 A;  2JGU A;  3ALY A;  4DQQ A;  3OYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...