3AVIA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aviA00
4M45A 4DSIA 3OYEA 4LY7A 1J5OA 3OYAA 3G10A 4CIEA 4BDYA 2A1RA 4N41A 1TK0A 3LP2A 1LV5A 4BWJA 3NFAA 1BI4B 2O4GA 1KSPA 3BDPA 4FJJA 1KVCA 3L3VA 5HP1A 4FW1A 4DWIA 1KVBA 3HP6A 4B9SA 2B6AA 1SUQA 1A5XA 3V6DA 1VSEA 1T05A 3NF9A 3PUFA 4ID5A 3SJJA 4O4GA 4FLTA 1RTJA 3S3OA 1XI1A 2HMIA 3ZSYA 3SNNA 4M42A 1RNHA 3F9KA 5EU7A 1Z26A 4OKJA 3D0PA 4KHWA 3AA5X 4CGJA 4IG3A 3PY8A 4JLHA 2G8VA 3DOLA 1ZYQA 1L5UA 1TGOA 3DYAA 1JKHA 2HHQA 2B5JA 4YFUA 4FJGA 3JYTA 2F8TA 1RT5A 2G8HA 2YNGA 2PY5A 4QOZB 5KTQA 4E0DA 4Z4HA 4CGDA 4W5RA 3EZ5A 3ZT3A 3PV8A 3U6FA 4O0IA 3HSTB 1LAVA 1FXXA 4C8MA 3TR8A 3NCIA 3T1AA 3LZIA 1ZBUA 3OYGA 2ZE2A 3T3FA 4PY5A 4HUGA 1QTMA 3CQ8A 2GBZA 4LH5A 4LD0A 4CJ5A 5SZTA 3THVA 4B9TA 5J2MA 1C0UA 4O55A 1ITGA 1HYVA 4FM2A 3AO3A 3RMAA 3ZSOA 1TL1A 3OS0A 4E7JA 4DS4A 3WNGA 3V1QA 4KHNA 1G15A 3VA0A 4I7FA 5I42A 1XHXA 4KTWA 2YKMA 1WSHA 4CJEA 4FLVA 3DLEA 3MEEA 5FDLA 4B8AB 3P83D 3KK2A 4DSFA 4DSLA 4BWMA 4AHUA 5J1EA 4FW2A 2BDPA 4JRPA 3IAYA 5CZ1A 3M8RA 5J2QA 2HHUA 3QIOA 3ULDA 2YNFA 1JL1A 4YNQA 3VQDA 4CJKA 4FJHA 3TAGA 4B08A 3O4NA 1HRHA 4GVMA 3HPGA 3I0RA 3LALA 3ZSRA 3RMBA 3KD5E 1BIZA 1F21A 2BANA 3NF7A 3QEPA 2P5GA 2QKKA 4G1QA 1C0TA 3LPUA 4KHSA 4B8CA 1FK9A 1YT3A 3OYNA 1T7PA 1X1PA 3NDKA 4CHQA 1CZ9A 4B9VA 1VSJA 1C6VA 1LAWA 3QLHA 3NHGA 2JGUA 3KK3A 1TKTA 2Z1HA 4E3SA 2X6NA 1NK4A 1CLQA 3ZSVA 4RG8A 4FCYA 3VQ6A 4DTOA 3SUPA 3VQ8A 1KLNA 2HB5A 1EETA 4DTMA 3KD1E 3LZJA 4KV8A 1NJXA 2D0AA 4E7KA 3MXMA 1U45A 1T03A 4CEQA 4DQRA 4B9UA 4Z4GA 3OYFA 3HVTA 3PX0A 2XY7A 4ZTJA 3KK1A 1VSFA 4Z4CA 2Y1IA 1HNVA 4PUOA 3K59A 5K14A 1C1AA 4DFPA 3HO1A 4CJUA 1GOAA 3E01A 3AO2A 2PYLA 1TAQA 5KRTA 3ZT4A 1JXEA 1IKWA 3QINA 5CYMA 3PX4A 4I9LA 3HXMA 1GOCA 4DMNA 2OZMA 1S1XA 3OYKA 1TVRA 2IOCA 3AO4A 3AVAA 1LWFA 2IGIA 2VG6A 2OYQA 2P51A 4IFVA 1NOZA 4H4OA 5DMRA 3M8SA 2RF2A 4IFYA 5C24A 1KCFA 1QSYA 4FZXC 3DI6A 4FZYA 1ZBFA 4CJQA 3KKSA 1XHZA 4KREA 1L3VA 4GMJB 2F96A 1KFDA 4BDPA 1NK8A 4CGFA 2WOMA 4B9LA 1HYZA 3AVFA 2FBTA 3QEVA 2XY5A 2G8WA 1VK0A 3TAMA 3HPHA 2KW4A 3ZSZA 5KGXA 3AA2A 4C8NA 3L2VA 4KPYA 2QKBA 3ASMA 3HPOA 1EKEA 2EX3A 1SV5A 1O1WA 3VQEA 3NH2A 1YTUA 2BGGA 4WE1A 4OGCA 2WONA 1UWBA 3BGRA 3HYFA 1Q8IA 2D0CA 4BE1A 4DFJA 2FC0A 4CK3A 2YKNA 3SPYA 3O3FA 3OJUA 5HRNA 4OJRA 4RW7A 2RN2A 3D45A 1U47A 3A2FA 4K8XA 4CHZA 2HHVA 4HHTA 1JLFA 4E1NA 3QEIA 5J2PA 4PQUA 4GW6A 3ZSQA 2B4JA 3V9SA 2ITGA 2VWJA 3OS2A 3RTVA 4FYDA 1RDCA 2Y1JA 2HHWA 3K57A 3V9UA 3QEWA 1HMVA 2GV9A 4FJNA 1SKRA 4XIUA 4RW4A 1WSFA 4OGEA 4DU4A 4FJIA 3G0ZA 4IDKA 3T19A 1SL0A 1WSGA 2IAJA 5I3UA 3MXIA 3PO5A 4KB0A 1UOCA 3C6TA 1RDDA 4CECA 3QNNA 4ZTFA 4W5QA 4PWDA 4KFBA 5C42A 1TKXA 3RR8A 4RW6A 4FVMA 1QSLA 1C1BA 1RT7A 1ASWA 4CEAA 3SYZA 3MECA 3VQPA 3DLBA 1X9SA 5HRRA 3DLHA 1GOBA 1D5AA 1DTTA 1JLGA 4KHUA 4HVJA 1B9FA 2Z1JA 4M3RA 5E41A 5KGWA 1NJWA 4C8KA 2AJQA 1I3AA 4KHYA 2DFHA 4CHNA 3ZSWA 3OYDA 4W5OA 3ZCMA 4OPKA 2IDOA 3NAEA 4FM1A 2O4IA 4BACA 4BE2A 3AO5A 3MXJA 3ZT1A 4W5TA 3MAQA 2RKIA 1S6PA 5HBMA 2E6LA 3VA3A 2HHTA 3JSMA 1EP4A 4FJMA 2ATQA 1WSIA 3CM5A 4EZ6A 4AHVA 3TAEA 3RR7A 4IKFA 4RW8A 5CZ2A 3IRXA 2KFNA 4FM0A 2G8FA 1YVUA 2I5JA 1HQEA 4DTNA 1VSHA 3SV3A 3S3NA 5FRMA 4LSLA 4CFCA 4KB1A 1N6QA 2KZZA 3DRSA 4CFAA 1U48A 4DSJA 1LW2A 4KKOA 1HNIA 4TSXA 4Y1DA 3WNFA 4M3XA 4CF8A 2G8KA 1S1TA 3QO9A 1NK9A 3L2UA 1Z25A 1KFSA 2E4LA 3KIOA 4FLXA 4CFDA 4NYFA 4AHCA 3MEDA 1ASVA 3AVBA 4DTSA 4DTPA 1NKBA 1DTQA 1TL3A 2XRIA 3LAMA 4KAZA 3V1RA 3AVKA 5SWMA 3P5JA 1VSMA 4HUFA 5D3GA 3K5OA 3WNHA 3AVLA 3NGIA 4OKKA 1NKCA 1TV6A 4FJKA 4J2BA 1S6QA 4OKEA 3M8PA 3VQ5A 3TARA 2QK9A 1BHLA 1WLJA 4K8ZA 4DU3A 1DLOA 3NH1A 3LWLA 2R7YA 2OA8A 2XY6A 1BQMA 5CYQA 4E7HA 4FZZA 4DG1A 1J53A 4HCCA 2OPRA 4CCHA 3OYJA 1SL2A 3SUQA 5CY4A 3VQ7A 1REVA 4E7LA 2P1JA 1RCHA 3ZSXA 2HNYA 1UA1A 2VG5A 3SI6A 1RT4A 4DTXA 4CJVA 4E7IA 3TAQA 3UIQA 4CEOA 2HNZA 2D0BA 4CJRA 3OY9A 3KLHA 1TKDA 2KQ2A 3O3HA 3SQ4A 1IKXA 1VSKA 3K5NA 1B9DA 1RBVA 1NKEA 3P1GA 3V81A 4M3TA 3L2WA 1D9FA 3AVIA 2VWKA 3AVHA 1BISA 1TK5A 4F3TA 4FLWA 1NK5A 3AVGA 4M3WA 4CEZA 4DF4A 4H4MA 4CJPA 1Q9YA 4FXDA 4CF9A 4ELUA 4NYNA 3KLEA 4N56A 4FLZA 2FBVA 1NK6A 3CFPA 1HJRA 1KTQA 2G8UA 4N5SA 3ALYA 3KTQA 4DLGA 1RDAA 1NJYA 4KHQA 3NBPA 3OS1A 2HVIA 5JS2A 4HTUA 2X6SA 4DQQA 2ZQBA 4DF8A 5FRNA 1L3TA 2QXFA 1ZBIA 1A5VA 4B3OA 4QCLA 3SQ0A 2KTQA 1C0MA 3OYMA 4CK1A 4IG0A 2NUBA 3OYIA 1NK0A 2LSNA 1VSLA 4I2PA 3QNOA 4DFMA 3S9HA 1BQNA 4CEBA 4Q5VA 1X9WA 1SL1A 1WAJA 3DLKA 1U49A 2F8SA 4OLAA 4CJWA 4C8LA 1W9HA 3OYHA 4Z0UA 1ZBHA 3QETA 3VQCA 1S9GA 3AA3A 3VN5A 1NOYA 1IH7A 1RT3A 1JLQA 3LP0A 4FLUA 3TAPA 4CK2A 4O0JA 4KI6A 3PX6A 4CJSA 4R5PA 2XHBA 2RPIA 3HVRA 1RT1A 1QHTA 2YHBA 4CEDA 1X9MA 2ETJA 3TI0A 4CJFA 4ID1A 4CF0A 1A5WA 4EP5A 4CFBA 4KTQA 3QESA 2OPSA 3V4IA 4B9NA 3I0SA 1CZBA 4CIFA 4DTRA 4FJ9A 1HYSA 4DTUA 3SQ2A 3LWMA 1W0HA 4B9MA 1S5JA 3HM9A 1CXQA 5J2NA 4PA1A 3SUOA 1NK7A 3V9XA 4DQIA 4LH4A 5DK5A 4H8KA 4FJLA 3AA4A 1SKSA 1LW0A 1IKYA 2DFEA 2YNIA 2Z1GA 1JXBA 3AVCA 1WSEA 2ZD1A 3HP9A 4CJTA 4DLEA 1RT6A 4M41A 4N76A 4FK4A 2Z1IA 2X74A 4O44A 5KRSA 4DU1A 1XWLA 3C95A 1HPZA 3FFIA 4C8OA 4M3YA 3PO4A 2YNHA 3LANA 5HRPA 4FJXA 1Y97A 1T8EA 2IS3A 1R0AA 1FKOA 1IO2A 4AHSA 3LAKA 3TANA 3SUNA 2OPPA 2OPQA 3CG7A 4FJ8A 1RTIA 1TAUA 3NE6A 3CFOA 2PYJA 1FKPA 3CFRA 4KTZA 3K5LA 1RILA 2EHGA 3K2PA 3KKRA 3NF6A 4F2RA 3AVMA 2E6MA 2HHXA 2DY4A 3ITHA 5FROA 2JLEA 1LWEA 2HNDA 4CHYA 4M3ZA 4CESA 2G8IA 1LWCA 2DFFA 3L3UA 1VSIA 4CF2A 4HUEA 3QEXA 2DTUA 2X78A 3B6PA 4O5BA 5T7BA 3K5MA 4DSKA 3NGZA 1B92A 3VQQA 3VQ9A 1QS4A 3RMCA 5C25A 3SQ1A 3M8QA 4OLBA 4DFKA 1RBRA 3KLGA 4NCGA 3LDSA 3LP1A 1IG9A 1J9AA 1TKZA 3LPTA 1UAXA 1JL2A 3DRPA 3H08A 5KI6A 4DSEA 4KRFA 4DS5A 3L8BA 3C94A 2XY8A 1RDBA 4I2QA 1K6YA 4CEEA 4OPJA 4BE0A 3SV4A 4Y1CA 4CHOA 3IS9A 4CJLA 3HK2A 1BCMA 3QERA 1RTHA 4EZ9A 3DM2A 3CM6A 4J2DA 3NH0A 2W42A 4HCBA 3U3YA 2HVHA 3F73A 1S1WA 2Q3SA 3NGYA 4J2EA 3AVJA 4Z4FA 2FBXA 3ISNC 4N47A 3K58A 4JRQA 2KZMA 4Z4EA 1TK8A 4FJ5A 4DTJA 4CJ4A 1MU2A 4MQ3A 4QAGA 4Q0BA 4BDZA 3OYCA 4F4KA 1VRUA 1HQUA 1WNSA 3VQBA 4AH9A 4E89A 1RTDA 3VQAA 1KRPA 4FK2A 1D8YA 4F8RA 5HROA 1RBSA 3V1OA 4I9QA 4J2AA 4KO0A 3B6OA 3NF8A 3U3GA 3O3GA 1UA0A 1RBTA 3O4QA 3OYBA 1JLBA 1RBUA 3DRRA 1SKWA 3AO1A 3DOKA 1QSSA 3RRGA 2FBYA 4FLYA 1J54A 1JLAA 1JLEA 1L3UA 4Z4IA 4AHTA 1QE1A 1EX4A 3WNEA 1WSJA 1WAFA 1BCOA 3QIPA 3I8DA 3TWHA 4F3OA 4UQGA 4KI4A 1Q9XA 1KVAA 2PZSA 4CGGA 3OJSA 3OVNA 4RW9A 2GUIA 3CYMA 1QQCA 3KJVA 1D9DA 1VRTA 2OZSA 1BIUA 4FK0A 3DLGA 3ZT2A 4NCAA 4LSNA 1VSDA 2A1SA 4OVLA 1KLMA 3C6UA 4CIGA 2P5OA 3VQ4A 3HJFA 4CE9A 1ZBLA 1L3SA 3OYLA 2HHSA 1U04A 4F2SA 3V9ZA 2KFZA 3KLFA 2XO7A 4E1MA 4AILC 3KLIA 3HT3A 1XC9A 1RT2A 1S1UA 3RWUA 3S3MA 4ICLA 4MFBA 3IG1A 3ZT0A 1ASUA 4ZHRA 3V9WA 3RMDA 4L8RB 2HW3A 3DMJA 4W5NA 1WN7A 3L2QA 1IKVA 3HL8A 1YTAA 1U4BA 4ELVA 2BE2A 3AV9A 3SCXA 3EY1A 5HLFA 2YHAA 4JS4A 3LP3A 4ELTA 4CHPA 4CEFA 3RRHA 1BL3A 1EXQA 1I39A 2IC3A 5HRSA 4CF1A 4JS5A 4NCBA 3MEGA 1BGXT 2YV0X 3DLRA 3TAFA 1BI4A 1S9EA 4CGIA 3TABA 1NJZA 3SZ2A 1JLCA 4DQSA 2VG7A 4E19A 3L2RA 3SPZA 1C1CA 4FJ7A 5JS1A 4IBNA 4DQPA 4M3UA 1S1VA 4AHRA 1CXUA 2D5RA 3AVNA 4CGHA 3EYZA 1N5YA 4CJ3A 4EP4A 4CERA
chains in the Genus database with same CATH superfamily
4M45A 3WQTA 3OYEA 4LY7A 3OYAA 4CIEA 2A1RA 4BDYA 1NGJA 4N41A 3LP2A 4JKFA 3LDNA 1OKJA 2A5XA 4YOTA 4KH6A 1BI4B 4FJJA 5FPNA 1KVCA 1SS6A 4FW1A 4K42A 4DWIA 4XH5A 3W3DA 1A5XA 3NF9A 3PUFA 5BPMA 3SJJA 3OHRA 3AAPA 4B1YB 2UYTA 3P4IA 1XI1A 3CCQN 3ZSYA 4M42A 2H3GX 4OKJA 4K25A 4KHWA 5AQGA 3DWLA 2DPNA 4JN4A 3PY8A 3IUCA 2NRHA 5GIPA 4H5NA 1L5UA 4BC5A 3VGKA 3CQXA 1RT5A 5I9EB 2G8HA 1H1VA 2HBLA 4K41A 3F2KA 1WB9A 3ZT3A 3PV8A 3HSTB 1LAVA 4C8MA 5FPMA 3A8YA 1YIJN 2GBZA 1TUUA 1C0UA 4O55A 1ITGA 5AQPA 4JI6K 2IVPA 2VGNA 4BY9C 5KQDA 3OS0A 4E7JA 3DXMB 5IWAK 3VA0A 1XHXA 4KTWA 3DLEA 3MEEA 4B8AB 3H6EA 3M6GA 5AR0A 5BREA 1VQ5N 5E84A 3B8AX 3IAYA 3M8RA 3ULDA 3JXUA 3VQDA 3DLLL 4FJHA 4K0KK 3O4NA 3FFKB 1QQMA 1BIZA 1F21A 3CI5A 1SZ2A 3NF7A 3MK6A 3TPQA 1HUXA 2QKKA 2P5GA 3QBXA 2NRXA 1NLVA 4H5RA 4CHQA 5C10A 1C6VA 4YDUC 3NHGA 4FL9A 2ASOA 3CCMN 1XNQK 3LDQA 2YCHA 1NJXA 4K43A 4CEQA 4DQRA 4B9UA 4Z4GA 4ZTJA 4WQ5A 2OCEA 2GWKA 4DFPA 2OTJN 1GOAA 5KRTA 3ZT4A 1JXEA 3PX4A 3KWIA 3AVAA 2UXBK 4DV5K 2OYQA 3LM2A 1NOZA 2RF2A 4DB3A 3E1YA 1QSYA 1XHZA 4KREA 1K8AO 2CH5A 4AQYK 1NK8A 4CGFA 1HX1A 2FBTA 3C6AA 2G8WA 1VK0A 2BH1A 3IMXA 2QKBA 3L2VA 4MDBA 3HPOA 1SV5A 1UWBA 3E9PA 1IBLK 5AFUA 4BE1A 3WEEA 3EKSA 3SPYA 4CD3A 5HRNA 2RN2A 2HHVA 3CC4N 4E1NA 5B8HA 3ZSQA 2A40A 3GOIA 1VQNN 3OS2A 4H5TA 1N8RO 2Y1JA 3K57A 4FJNA 1SQKA 4Y0WA 4JKHA 4DU4A 4OGEA 4FJIA 5I3UA 5JLHA 5JVHL 3TTCA 3QNNA 5C42A 3K0SA 3RR8A 2A42A 3EL2A 4RW6A 1ASWA 3DLBA 3MECA 3D2FA 3L4QA 1GOBA 1BOTO 2Z1JA 4BR2A 2AJQA 1HR0K 2DFHA 4FM1A 3ZSWA 4E7KA 1YI2N 4YY3K 5AQOA 2J4RA 4W5TA 1RFQA 2RKIA 3MAQA 2HHTA 1VQPN 1EP4A 2ATQA 3CM5A 3CD6N 1R59O 4RW8A 2PFUA 4IDHA 3UKUB 2I5JA 4IJAA 1N6QA 2KZZA 1LW2A 4KKOA 2QWNA 4CZIA 3CC2N 3QO9A 1J6ZA 3L2UA 4CFDA 4NYFA 1ASVA 4NB4A 1NKBA 1DTQA 1TL3A 3K9JA 4V19S 3AVKA 5SWMA 2WUSA 1VSMA 3NGIA 4OKKA 1TV6A 3L4IA 2QK9A 1WLJA 3LWLA 2R7YA 2OA8A 3FR0A 3OYJA 1NU0A 1REVA 2P1JA 3ENOA 2NRWA 2VG5A 2P9UA 3TAQA 4JNEA 4CJRA 3N4QA 2Q1NA 3KZBA 1NKEA 4M3TA 3VEZA 2VWKA 1BISA 1BO5O 4FLWA 2VYPA 4WQ4C 4M3WA 4CEZA 4B9QA 4NO7A 1DKGD 3H1QA 3VF6A 3CF5L 1VQ6N 3ALYA 2VGMA 3J7YP 4DLGA 5JS2A 2IVNA 4HTUA 4DF8A 3I56N 1C0MA 3OYMA 4IG0A 3OYIA 4FJLA 1VSLA 3WXJA 3U9ZA 4Q5VA 3PSIA 1YJNN 4DQ8A 1GLFO 2ZJRL 4CJWA 4C8LA 1W9HA 1VQKN 3J7AP 4EFHA 1E4GT 2QXLA 1OH7A 1S9GA 1XC3A 3AA3A 1NOYA 1IH7A 3CMAN 1RT3A 4FLUA 1XMOK 3J80O 1NG9A 3T7ZA 2XHBA 1NGEA 1X9MA 4CZJA 4KTQA 4EP5A 4CFBA 3QESA 2Q36A 3VEOA 3I0SA 4CIFA 4DTRA 2QW9A 1S5JA 1CXQA 1KQSM 4DQIA 4LH4A 5DK5A 3WEEB 3AA4A 4LF5K 1LW0A 1GLJO 2Z1GA 3AVCA 1WSEA 1X3MA 1W97L 4CJTA 4DLEA 4M41A 4A2AA 1Z6RA 3VEWA 2X74A 5AZJB 1XWLA 4JK9A 4C8OA 4QS9A 3WXLA 5LMNK 2HF3A 1Y97A 2IS3A 4JAXA 2FSJA 1XUPO 2OPPA 3CG7A 1TAUA 1QZ6A 3CFRA 1BDGA 3K5LA 4FPBA 2EHGA 5AQWA 4F2RA 3AVMA 2E6MA 4OO1J 3D2FB 4JI0K 2DFFA 4HUEA 2Q0RA 2X78A 4DSKA 3K5MA 4DHYA 3J81O 1NJIO 5FLXO 1DT9A 5C25A 2ITMA 1RBRA 2QI2A 4K8XA 1HNZK 4BRDA 5KI6A 3M1FA 5LJWA 4IEEA 1OH5A 2XY8A 3SV4A 4Y1CA 3U4LA 4BR0A 1BA0A 1Q81O 5HOOA 3F73A 4YOYA 4J2EA 3AVJA 3I33A 5KPRA 3ISNC 3DXKA 3WXMB 1TK8A 4FJ5A 4DTJA 4BDZA 2KLAA 1VRUA 5JVGL 4AH9A 3OBWA 4FK2A 1RBSA 3B6OA 3U3GA 5TKWA 3O4QA 1QSSA 1RBUA 2GX9A 2UXCK 3RRGA 3CHWA 1J54A 1JLAA 5M1QA 4AHTA 2A6AA 3WNEA 3TWHA 5EX5A 4H0PA 3QIPA 4YOWA 4KI4A 1Q9XA 4CVNE 1QQCA 1VRTA 2VQEK 3ZT2A 4CBUA 4NCAA 2VWBA 4OVLA 4CZHA 4GV9A 1KLMA 3C6UA 4O8KA 4C1NI 4CIGA 2P5OA 3KVGA 1ZBLA 3OYLA 4F2SA 3O08A 1WUAA 3KLIA 3HT3A 1RT2A 3S3MA 4MFBA 3IG1A 3V9WA 4WFAL 3HL8A 3ZETB 2QWQA 2BE2A 3BEXA 3ZX3A 4LF4K 4JS4A 4ELTA 3THXB 3JS6A 1I39A 5AQIA 1BGXT 3TAFA 1BI4A 1S9EA 2CGLA 4R79A 1JLCA 2VG7A 4BR7A 4IFEA 4B1UB 4M3UA 1S1VA 4CZMA 2UUAK 4IEIA 4FWOA 3MDQA 1NBWA 4PKIA 4IO8A 4JI3K 4JK8A 2KHOA 4KBOA 5HP1A 1KD1O 4BRNA 1KVBA 2E2PA 3GG4A 3V6DA 3MN9A 1T05A 2HF4A 4ID5A 4ISGA 4O4GA 2O8FB 2HBKA 3KWGA 1BWFO 3C7NB 4CGJA 2YI1A 3ZYYX 2NRRA 3UB5A 2F4VK 5AQHA 1TGOA 1NGAA 1JKHA 2HHQA 4YFUA 4FJGA 5M1OA 1QQNA 2F8TA 3DXMA 1NGFA 4DV3K 2PY5A 1M90O 2Q31A 4J8FA 4W5RA 1KAYA 4E1JA 5ELZA 3LZIA 3TR8A 3T1AA 3VEVA 4PY5A 3CQ8A 3THVA 3UKRA 3THYB 5AFUH 4AF1A 1Q86O 3AO3A 1TL1A 3WNGA 4KHNA 1G15A 5I42A 4I7FA 2ZWHA 3VMFB 4CJEA 1FW6A 5M1FA 3P83D 3KK2A 4PKGA 5J1EA 2BDPA 4JRPA 5CZ1A 1LOTB 3QIOA 4X64K 1JL1A 4YNQA 4CJKA 4B08A 2P9NB 4GVMA 3I0RA 3LALA 3RMBA 1NNEA 3KD5E 5AZIB 3SJHA 2QWOA 3WXKA 4B8CA 1YT3A 1T7PA 4B3MK 3NDKA 2P9KB 3QLHA 1LAWA 2JGUA 4FWMA 3O80A 2NRVA 4RG8A 4DTOA 2FSKA 1SAZA 5BPLA 2O8DB 3D2EA 3LZJA 2D0AA 3MXMA 1U45A 1C0FA 1Q7YO 3KHYA 3HVTA 2XY7A 4Z4CA 2Y1IA 3K59A 4JV5K 3E01A 3AGRA 1TAQA 5AQQA 1BUPA 4B3RK 1GOCA 1JCFA 1K9MO 1TVRA 3AO4A 2IGIA 2VG6A 2OTLN 5KQ8A 3G71N 2OANA 3MWTA 1ZBSA 5JICA 4BDPA 2WOMA 4BC3A 1KC8O 1YUWA 2XY5A 3HSCA 4G9ZA 3TAMA 3ZSZA 5KGXA 4C8NA 4KPYA 3EE9A 4QS7A 1O1WA 2BGGA 3WQUA 2D0CA 1IG8A 4FSVA 2W6LA 2YJEA 4GY2B 3O3FA 3OJUA 4OJRA 1JLFA 3QEIA 5J2PA 1NGCA 4OPHA 4PQUA 5C0YA 2VWJA 1RDCA 3V9UA 5AQXA 1SKRA 1VQLN 4RW4A 3PIPL 4BR4A 1WSGA 3PO5A 3MXIA 3C6TA 1RDDA 4ZTFA 4W5QA 5FPDA 3H45C 1C1BA 1RT7A 3SYZA 3MX5A 1X9SA 5HRRA 3UKUA 3DLHA 1XNRK 4YOVA 1D5AA 1JLGA 4M3RA 3F9MA 3H3NO 3OYDA 3NAEA 2O4IA 4BE2A 3HOSA 3AO5A 5LY3A 4A61A 4H5WA 4DCHA 4AHVA 1E4FT 3TAEA 3IRXA 4FM0A 2G8FA 4JI5K 1HQEA 4DTNA 3SV3A 3S3NA 4LSLA 2ASMA 4L3QA 3DRSA 5AQRA 1U48A 4DSJA 4Y1DA 4QS8A 3P39A 4JKBA 3SAFA 3UKRB 2G8KA 1S1TA 1M1KO 1NK9A 1Z25A 1YVNA 4DTPA 2ZGYA 2XRIA 4EAHD 4HUFA 3THWA 3JAMO 3WNHA 2QWMA 5A2QO 1S6QA 4OKEA 3VQ5A 4J2BA 3AY9A 4K8ZA 3NH1A 3TSUA 4RWTA 1NGBA 1GLEG 1S72N 2XY6A 4FZZA 4DG1A 1J53A 2OPRA 1YJWN 3MN7A 3SUQA 3VQ7A 4E7LA 1ATSA 3ZSXA 5AQFA 1UA1A 3SI6A 4CJVA 3UIQA 2F9TA 3KLHA 2KQ2A 3E9OA 3SQ4A 4IO9L 1VSKA 3K5NA 1B9DA 4B1ZA 4DV6K 3P1GA 2YHWA 3V81A 1D9FA 1TK5A 2O8EB 1T44A 3D2EB 3G4SN 1GLBG 2QM1A 4H4MA 4FXDA 4CF9A 4ELUA 4WF9L 4O8UA 4GV6A 4BGBA 4H0XB 1V4SA 1NJYA 3NBPA 3OS1A 2HVIA 5C2DA 2X6SA 5FRNA 2ZQBA 4JEPA 3CPEA 4F9OA 5M1KA 3QNOA 4DFMA 3S9HA 1BQNA 4CEBA 1X9WA 1SL1A 3DLKA 1U49A 2F8SA 1Y64A 1ZBHA 5MLCQ 2O8CB 3LP0A 4O0JA 1YF5L 3SBTA 3E9LA 4YDUA 4R5PA 1RT1A 2UU9K 4CEDA 3TI0A 4CJFA 4CF0A 1NWKA 2OPSA 3V4IA 5ADXH 3CCEN 3R6MA 5AZJA 3SQ2A 3LWMA 1W0HA 4B9MA 3C65A 5J2NA 4PA1A 3SUOA 3V9XA 3J7ZO 2QA4N 2YNIA 3CCRN 3EO3A 1MWMA 2HHHK 4N76A 2GTDA 4FK4A 5LMUK 3AARA 4DU1A 2E1ZA 4NLBA 2GWJA 2YNHA 3LANA 5HRPA 1R0AA 3TANA 1IBMK 2ZF5O 4FPAA 1RTIA 3FZKA 5AQNA 2PYJA 4JD2B 3WXIA 2Q97A 2VCPA 2JLEA 1WBDA 4CESA 2G8IA 1LWCA 4CF2A 5M1NA 4O5BA 5T7BA 3VQ9A 1QS4A 4U7BA 4NCGA 1IG9A 3VERA 1J9AA 4KRFA 3DRPA 1OVQA 3FZFA 1ILYA 3C94A 1RDBA 1K6YA 2ZJPL 3CJ9A 3VGMA 2YHYA 3BY5A 3VPZA 4OX9K 4HCBA 3EKUA 3HBTA 1S1WA 1VQ4N 2Q3SA 3VTHA 1DGKN 3BF1A 4BRHA 3W0LA 1GLLO 4CJ4A 5BPNA 1MU2A 5BRDA 5BRFA 4LFAK 1HQUA 3THWB 4ISEA 4Z94A 2F9WA 5HROA 3V1OA 3I8BA 3NF8A 4JYAK 3QFPA 3UE5A 2I7PA 4DR6K 4CZLA 2IIRA 3OYBA 3MN5A 3T1YK 4LF9K 2Q0UA 2P9SB 1QE1A 1VQMN 1WSJA 1WAFA 3D6RA 1XMQK 2PZSA 3OJSA 2GUIA 2OZSA 4BC4A 1BIUA 1RDUA 3CJAA 4LSNA 1VSDA 3ZETA 2A1SA 3VETA 3EN9A 4BRQA 3CCUN 3N4PA 4BRLA 3THXA 4CBWA 2HOEA 4CE9A 4IJNA 2HHSA 3CJCA 3V9ZA 4YOUA 3R8EA 3RWUA 3RMDA 5F2RA 4L8RB 5GADP 1IKVA 1YTAA 3T1HK 3AV9A 4IZ9A 1BL3A 5EY4A 4IOCL 5HRSA 4CF1A 1HKBA 3K9KA 1E3MA 1HJOA 2YV0X 4FWPA 3ULEB 3HRGA 3SZ2A 4FJ7A 4BRPA 5JS1A 4IBNA 4DQPA 4NXNK 4LC9B 4AHRA 5LL6Z 2CGKA 2D5RA 5EOYA 3F5TA 4CJ3A 2O8FA 1VHXA 3QICA 3C7NA 5KPZA 1HPMA 3G10A 3GL1A 1LV5A 3NFAA 3O9RA 1KSPA 3EE8A 3TSQA 4GKKK 4WQ4A 3HP6A 3CIPA 2B6AA 5CHIA 2VQFK 3C0BA 5BR9A 5GAGP 1EQYA 5EVZA 3S3OA 3LM9A 1RNHA 3F9KA 3D0PA 2I7NA 3RSEB 4JLHA 3THYA 3DOLA 1IJJA 5C15A 1W2BM 3JYTA 3I55N 4QOZB 3VTIA 5KTQA 4E0DA 3EZ5A 3U6FA 4O0IA 1GLDG 1FXXA 3CJ1A 3NCIA 1ZBUA 4YOXA 3OYGA 3T3FA 4HUGA 2YHXA 3PSFA 2FLOA 4LD0A 5SZTA 4CJ5A 1GLAG 4EHUA 2UXDK 3P31A 4EHTA 1HYVA 4FM2A 5FPEA 2EWSA 2P9NA 4DS4A 3V1QA 1BU6O 4X65K 1WSHA 1OVYA 3PLAA 1EO1A 4BRAA 5AZIA 4OPAA 4DSLA 1EWRA 4AHUA 4FW2A 2P9KA 5J2QA 4LF7K 2HHUA 2YNFA 3TAGA 3O9QA 5AQLA 1HRHA 3HPGA 1ATNA 3ZSRA 2O8DA 1U6ZA 3MX2A 3QEPA 1C0TA 4KHSA 3OYNA 1CZ9A 1VSJA 5CE3A 3KK3A 1TKTA 2X6NA 1NK4A 2HSTA 5AQZA 5ADXA 5GINA 3ZSVA 5KPTA 3SUPA 2NZTA 4IOXA 1KLNA 2HB5A 2HBJA 4CZKA 4DTMA 4KV8A 1T03A 4BRIA 3PX0A 3FE1A 3KK1A 3BUZB 4PUOA 5K14A 1C1AA 2CH6A 4BREA 4CJUA 3AO2A 2PYLA 3VEXA 3QINA 5CYMA 3NMUA 4DMNA 5JLFA 2IOCA 4FWSA 3ATVA 4WCEL 2P51A 3ATUA 4H4OA 5DMRA 3FZMA 1Q18A 4IFYA 5IT9O 4FZXC 4FZYA 1ZBFA 4CJQA 3KKSA 4FWRA 4GMJB 1L3VA 4ILGB 5AQUA 1K8KB 1NMDA 4KH4A 5BRHA 3QMLA 3HPHA 2KW4A 3A5NC 3AA2A 1BA1A 3VQEA 3NH2A 3FZLA 4WE1A 4OGCA 2UUBK 3HYFA 1D4XA 4WFNL 5GIOA 4BG8A 1VAZA 2E1YA 4CK3A 2YKNA 4GVEA 4RW7A 4WYBA 4CHZA 3QDKA 1I94K 4A57A 5AQSA 2QTDA 2Q2RA 1FJGK 3G0ZA 3T19A 2IAJA 3RVCA 1ZC6A 4RTFD 4PWDA 4KFBA 3O9UA 1TKXA 4U67L 4FWNA 1KXPA 1QSLA 5AQMA 4CEAA 3VQPA 4HVJA 1B9FA 5E41A 1NJWA 5KGWA 4BGAA 3BZKA 4C8KA 4ISFA 4XEIA 4CHNA 3ZCMA 2IDOA 1G99A 3MXJA 3ZX0A 2E6LA 3JSMA 4DV4K 1WSIA 4EZ6A 1RDWX 4IKFA 3CQYA 2W41A 4JI4K 1YVUA 2V52B 3A5OC 5FRMA 4CFCA 4CFAA 3WT0A 1HNIA 4NXMK 4BQZA 1K73O 4CF8A 5F0XA 1KFSA 2E4LA 3KIOA 4FLXA 4AHCA 3MEDA 3AVBA 1VQ8N 2KKZA 4KAZA 4BVOA 5DM7L 1O13A 1TYQA 3J8AA 3P5JA 1XQSC 1N34K 5D3GA 4FJKA 4GKJK 1Z05A 3M8PA 1BHLA 4MO4A 1HNWK 1OH6A 3FLCO 1N33K 3VGLA 3MCAB 1N36K 5CYQA 5EXWA 4E7HA 2O8EA 4CCHA 1SL2A 5CY4A 1RCHA 3OBYA 1RT4A 3ZX2A 3OY9A 2HNZA 1NMNA 2A41A 3R9PA 1RBVA 3L2WA 2NNWA 3AVIA 3D7EO 4M7XA 2BTFA 3CXCM 1NK5A 3AVGA 4JI2K 4CJPA 1Q9YA 4B3TK 2E2NA 4BG9A 1NGIA 4NYNA 2E2QA 3KLEA 4N56A 4FLZA 2O8CA 2FBVA 3H1VX 1HJRA 1KTQA 3T69A 4N5SA 3KTQA 2P9LB 4B3OA 3LL3A 1L3TA 2QXFA 3SQ0A 2KTQA 1NK0A 2LSNA 1WAJA 4Z0UA 1ATRA 4RCHA 3TAPA 4KI6A 3PX6A 4CJSA 3HVRA 1QHTA 2YHBA 2ETJA 3VESA 4FWQA 3OW2M 4O5FA 5AQVA 3G6EN 4BRMA 4B9NA 1CZBA 1HYSA 4FJ9A 1S22A 4MLHA 3U9DA 2NRTA 1BG3A 4MLEA 4JI1K 4ILHA 2V7YA 1SKSA 1IKYA 5H1SQ 2O8BB 1JXBA 4JD2A 3GBTA 3HP9A 3O4WA 4DV2K 4JHDB 2Z1IA 3HOTA 5KRSA 4BR5A 1HPZA 3FFIA 3O1WA 4M3YA 3CPWM 3ZEUB 3CCJN 1T8EA 1FKOA 3LAKA 3SUNA 1U2VA 2OPQA 3VOVA 3O6WA 3NE6A 1FKPA 3CCLN 4KHPK 4LF8K 3K2PA 3KKRA 5HL7L 3OTOK 3LDOA 1NGHA 3ITHA 4WQ5C 1LWEA 2HNDA 3L3UA 1VSIA 4H0VB 2E5LK 1OH8A 4CI6A 3NVKA 2W40A 3RMCA 4DFKA 3KLGA 3MWPA 3LDSA 3LP1A 3LPTA 4DSEA 1JL2A 3H08A 3L8BA 4MO5A 4I2QA 4CEEA 4OPJA 4CHOA 3HK2A 1BCMA 3QERA 1LCUA 1RTHA 3DM2A 4I6MB 4J2DA 2W42A 2HVHA 1MDUB 1TUYA 3NGYA 1S3XA 2CGJA 4NLCA 4M7YA 2FBXA 4Z4FA 4FWKA 2KZMA 4BVPA 4JRQA 1VQ9N 3HZ6A 3TTDA 4Z4EA 4MDAA 2P9SA 4QAGA 3OYCA 2GUPA 1TYQB 1IV0A 4E89A 1RTDA 3VQAA 1KRPA 3QBWA 4F8RA 4AM7A 4KO0A 4H5VA 3O3GA 1HKGA 4BROA 1RBTA 4DKWA 3AO1A 4IWVA 5DM6L 2FBYA 4FLYA 2WFBA 5GAEP 1IBKK 3I8DA 4DR4K 1KVAA 4YHHK 1HKCA 4CGGA 1V4TA 3R3LA 3KJVA 1D9DA 3OA9A 4JI8K 4BRKA 5AQYA 3A5LC 4LF6K 3HJFA 3M3ZA 1U04A 3ULEA 2XO7A 3MMVA 4E1MA 1XC9A 3HTVA 2PAVA 3ZT0A 1ASUA 2HW3A 1WN7A 3L2QA 4XH4A 1U4BA 3Q7BA 3SCXA 5HLFA 2YHAA 3LP3A 2HMPA 4CEFA 2WC9A 4BRCA 4DV7K 4GNIA 4JS5A 3MEGA 3BZCA 3DLRA 1QHAA 3Q7CA 4CGIA 1NJZA 3L2RA 3HM8A 5AQJA 2UUCK 1JCEA 2P9PB 1N5YA 3ENHA 4DR5K 4CERA 4DSIA 5JMVA 1J5OA 1TK0A 5LJVA 4BWJA 3RSEA 4A5BA 2O4GA 3L3VA 3P38A 3O9TA 4B9SA 1SUQA 2F7TA 3AAQA 1VSEA 4FLTA 1RTJA 2HMIA 3SNNA 1YJ9N 5EU7A 1Z26A 2YX6A 4GV3A 3AA5X 3A0IX 4IG3A 2G8VA 1ZYQA 4A62A 4H0YB 3DYAA 2B5JA 1X9JA 2YNGA 2QWRA 4Z4HA 2QEXN 4CGDA 3BDPA 4DR3K 5AQTA 1U2VB 2ZE2A 1QTMA 2P9IA 4LH5A 3DAWA 4B9TA 1QQOA 5J2MA 1P90A 3RMAA 2E8AA 3ZSOA 1QVFM 3IFRA 3ID8A 1YAGA 3M5RA 2AA4A 2YKMA 3GE1A 3VF2A 4FLVA 1C0GA 5FDLA 3SBGA 4DSFA 4BWMA 3O5BA 3H46O 1WBBA 3O9SA 3LDLA 3MN6A 4BC2A 4DR1K 2BANA 3TSPA 4G1QA 1RGIA 3LPUA 1FK9A 1X1PA 3VENA 4B9VA 2V51B 4C23A 1NGGA 2Z1HA 4E3SA 3SMPA 1CLQA 1WOQA 4FCYA 3VQ6A 3EEQA 2ZGZA 3VQ8A 1DEJA 1EETA 3KD1E 3OYFA 3SK3A 1VSFA 1HNVA 4FOIA 3HO1A 5M1PA 2YJFA 2ZM6K 1IKWA 4I9LA 3HXMA 1K8KA 2OZMA 4FVUA 1S1XA 5BN8A 3OYKA 4UY8O 1LWFA 4IFVA 4JKEA 4CZFA 3M8SA 5C24A 1KCFA 2JWKA 3DI6A 4CJ7A 2GELA 2F96A 2E2OA 1KFDA 3VEYA 3CJ7A 4B9LA 1HYZA 3AVFA 4A2BA 3A5MC 3QEVA 3CCSN 2V7ZA 3ASMA 1Q82O 1EKEA 1YITN 2EX3A 1YTUA 2WONA 2E88A 3BGRA 1Q8IA 3BF3A 4DFJA 2FC0A 4PL8A 4DR7K 3D45A 3SMSA 1U47A 1MA9B 3A2FA 4HHTA 4CBXA 5CR4A 4XH1A 4GW6A 4JK7A 2B4JA 3V9SA 2ITGA 3RTVA 1YHQN 4FYDA 2HHWA 3QEWA 1HMVA 2GV9A 4XIUA 4CZEA 3IKMA 1WSFA 1T6CA 4IDKA 1SL0A 4KB0A 1UOCA 1NM1A 4CZGA 4DR2K 4CECA 4DV0K 3R1XA 4PL7A 4FVMA 3FZHA 3EZWA 1DTTA 4KHUA 3PIOL 4BR9A 1I3AA 4KHYA 4W5OA 4OPKA 2E20A 4BACA 3ZT1A 1QZ5A 1S6PA 5HBMA 4JKCA 3VA3A 4FJMA 3SLCA 3RR7A 5CZ2A 2KFNA 4IOAL 2FF6A 2FSNA 1VSHA 4KB1A 1YXQA 2P9IB 4X66K 4B3SK 4M3XA 3WNFA 4TSXA 2IVOA 3CERA 3HI0A 4DTSA 1P8ZA 5AJ3K 3LAMA 3V1RA 4BQLA 1W7AA 1NGDA 1CZAN 3K5OA 3AVLA 1NKCA 1X3NA 3TARA 4DU3A 1DLOA 4X62K 5GAHP 4H0TB 1BQMA 3O1BA 4HCCA 1ZXOA 2JWLA 3DJCA 2HNYA 4DTXA 4E7IA 4C1NK 4CEOA 2D0BA 1TKDA 2RE2A 3O3HA 3QB0A 2P9LA 1IKXA 1J5EK 3CETA 3AVHA 2D0PA 4BRGA 4F3TA 3U8XA 4DF4A 4EIAA 2WTUA 4JKGA 3TTFA 4B1VA 4HTLA 1GLCG 3SAHA 3ENBA 2P9UB 4IXCA 1NK6A 3WUHA 3CFPA 2G8UA 3C6HA 4JI7K 4KHQA 1RDAA 1T6DA 3QFUA 2RHKA 4DQQA 1ZBIA 4QCLA 1A5VA 4CK1A 2NUBA 4I2PA 2NLXA 4OLAA 4H0OA 3O8MA 3OYHA 3ZLJA 1VQON 3QETA 3VQCA 3VN5A 1JLQA 3CJBA 3KK7A 4CK2A 1VQ7N 2NRZA 4B1WB 2RPIA 4FO0A 5TKYA 2O8BA 2BUPA 4ID1A 4H03B 1A5WA 3H3OB 2A3ZA 4JHDA 4DTUA 3HM9A 3ZEUA 3TU5A 5E26A 1NK7A 4H8KA 3LDPA 2DFEA 1KAZA 1EWQA 2ZD1A 1RT6A 4O44A 2D1KA 3C95A 3CMEN 4CW7B 3PO4A 3GDQA 3L6QA 3VF4A 4FJXA 4AHSA 1IO2A 1KAXA 4FJ8A 3CFOA 4KTZA 4YORA 1RILA 4FWLA 3G25A 3NF6A 4DUZK 2HHXA 2DY4A 1JJ2M 3ID6A 1ESVA 1T3VA 4HWIA 5FROA 4CD1A 4CHYA 4M3ZA 5AQKA 4I6MA 3QEXA 2DTUA 3B6PA 3NGZA 1B92A 3VQQA 2ASPA 2D0OA 3IDHA 3SQ1A 3M8QA 4OLBA 1JCGA 1TKZA 2AP1A 1UAXA 4ILJA 4DS5A 1HLUA 4BE0A 2FF3B 4M63C 2PBDA 3IS9A 4CJLA 4EZ9A 3CM6A 3NH0A 3U3YA 5BN9A 4N47A 3K58A 3BP8A 4B1XB 2QWLA 4MQ3A 4DV1K 4Q0BA 1N32K 4F4KA 3CCVN 3VQBA 1WNSA 5C2FA 4KH5A 4PHTX 2ZJQL 5F1XA 1D8YA 4I9QA 4J2AA 2D4WA 1UA0A 1SKWA 1JLBA 3DRRA 3DOKA 2WBNA 4LFBK 3DXKB 4PKHA 1JLEA 1L3UA 4Z4IA 4F3OA 1EX4A 1MWKA 1BCOA 4UQGA 3SAGA 4JKAA 3OVNA 4RW9A 4JKDA 3CYMA 2FXUA 4FK0A 3DLGA 4LFCK 1HNXK 4AM6A 3VQ4A 4A5AA 1L3SA 2KFZA 3KLFA 4JKGB 4AILC 1S1UA 1QVGM 4ICLA 4ZHRA 3MCPA 5BR8K 4W5NA 3DMJA 2HBMA 2P9PA 3AGKA 4WFBL 3L0QA 2W6KA 4ELVA 3E66A 3EY1A 4CHPA 3RRHA 1EXQA 2IC3A 2QWPA 4BRFA 4NCBA 4FOEA 4DUYK 3TABA 5C12A 4DQSA 3SPZA 3S41A 4E19A 1C1CA 3CC7N 1CXUA 2GEMA 3AVNA 4CGHA 3EYZA 3NVMA 4A59A 4EP4A 3FGUA
chains in the Genus database with same CATH topology
4M45A 4DSIA 3OYEA 4LY7A 1J5OA 3OYAA 3G10A 4CIEA 4BDYA 2A1RA 4N41A 1TK0A 3LP2A 1LV5A 4BWJA 3NFAA 1BI4B 2O4GA 1KSPA 3BDPA 4FJJA 1KVCA 3L3VA 5HP1A 4FW1A 4DWIA 1KVBA 3HP6A 4B9SA 2B6AA 1SUQA 1A5XA 3V6DA 1VSEA 1T05A 3NF9A 3PUFA 4ID5A 3SJJA 4O4GA 4FLTA 1RTJA 3S3OA 1XI1A 2HMIA 3ZSYA 3SNNA 4M42A 1RNHA 3F9KA 5EU7A 1Z26A 4OKJA 3D0PA 4KHWA 3AA5X 4CGJA 4IG3A 3PY8A 4JLHA 2G8VA 3DOLA 1ZYQA 1L5UA 1TGOA 3DYAA 1JKHA 2HHQA 2B5JA 4YFUA 4FJGA 3JYTA 2F8TA 1RT5A 2G8HA 2YNGA 2PY5A 4QOZB 5KTQA 4E0DA 4Z4HA 4CGDA 4W5RA 3EZ5A 3ZT3A 3PV8A 3U6FA 4O0IA 3HSTB 1LAVA 1FXXA 4C8MA 3TR8A 3NCIA 3T1AA 3LZIA 1ZBUA 3OYGA 2ZE2A 3T3FA 4PY5A 4HUGA 1QTMA 3CQ8A 2GBZA 4LH5A 4LD0A 4CJ5A 5SZTA 3THVA 4B9TA 5J2MA 1C0UA 4O55A 1ITGA 1HYVA 4FM2A 3AO3A 3RMAA 3ZSOA 1TL1A 3OS0A 4E7JA 4DS4A 3WNGA 3V1QA 4KHNA 1G15A 3VA0A 4I7FA 5I42A 1XHXA 4KTWA 2YKMA 1WSHA 4CJEA 4FLVA 3DLEA 3MEEA 5FDLA 4B8AB 3P83D 3KK2A 4DSFA 4DSLA 4BWMA 4AHUA 5J1EA 4FW2A 2BDPA 4JRPA 3IAYA 5CZ1A 3M8RA 5J2QA 2HHUA 3QIOA 3ULDA 2YNFA 1JL1A 4YNQA 3VQDA 4CJKA 4FJHA 3TAGA 4B08A 3O4NA 1HRHA 4GVMA 3HPGA 3I0RA 3LALA 3ZSRA 3RMBA 3KD5E 1BIZA 1F21A 2BANA 3NF7A 3QEPA 2P5GA 2QKKA 4G1QA 1C0TA 3LPUA 4KHSA 4B8CA 1FK9A 1YT3A 3OYNA 1T7PA 1X1PA 3NDKA 4CHQA 1CZ9A 4B9VA 1VSJA 1C6VA 1LAWA 3QLHA 3NHGA 2JGUA 3KK3A 1TKTA 2Z1HA 4E3SA 2X6NA 1NK4A 1CLQA 3ZSVA 4RG8A 4FCYA 3VQ6A 4DTOA 3SUPA 3VQ8A 1KLNA 2HB5A 1EETA 4DTMA 3KD1E 3LZJA 4KV8A 1NJXA 2D0AA 4E7KA 3MXMA 1U45A 1T03A 4CEQA 4DQRA 4B9UA 4Z4GA 3OYFA 3HVTA 3PX0A 2XY7A 4ZTJA 3KK1A 1VSFA 4Z4CA 2Y1IA 1HNVA 4PUOA 3K59A 5K14A 1C1AA 4DFPA 3HO1A 4CJUA 1GOAA 3E01A 3AO2A 2PYLA 1TAQA 5KRTA 3ZT4A 1JXEA 1IKWA 3QINA 5CYMA 3PX4A 4I9LA 3HXMA 1GOCA 4DMNA 2OZMA 1S1XA 3OYKA 1TVRA 2IOCA 3AO4A 3AVAA 1LWFA 2IGIA 2VG6A 2OYQA 2P51A 4IFVA 1NOZA 4H4OA 5DMRA 3M8SA 2RF2A 4IFYA 5C24A 1KCFA 1QSYA 4FZXC 3DI6A 4FZYA 1ZBFA 4CJQA 3KKSA 1XHZA 4KREA 1L3VA 4GMJB 2F96A 1KFDA 4BDPA 1NK8A 4CGFA 2WOMA 4B9LA 1HYZA 3AVFA 2FBTA 3QEVA 2XY5A 2G8WA 1VK0A 3TAMA 3HPHA 2KW4A 3ZSZA 5KGXA 3AA2A 4C8NA 3L2VA 4KPYA 2QKBA 3ASMA 3HPOA 1EKEA 2EX3A 1SV5A 1O1WA 3VQEA 3NH2A 1YTUA 2BGGA 4WE1A 4OGCA 2WONA 1UWBA 3BGRA 3HYFA 1Q8IA 2D0CA 4BE1A 4DFJA 2FC0A 4CK3A 2YKNA 3SPYA 3O3FA 3OJUA 5HRNA 4OJRA 4RW7A 2RN2A 3D45A 1U47A 3A2FA 4K8XA 4CHZA 2HHVA 4HHTA 1JLFA 4E1NA 3QEIA 5J2PA 4PQUA 4GW6A 3ZSQA 2B4JA 3V9SA 2ITGA 2VWJA 3OS2A 3RTVA 4FYDA 1RDCA 2Y1JA 2HHWA 3K57A 3V9UA 3QEWA 1HMVA 2GV9A 4FJNA 1SKRA 4XIUA 4RW4A 1WSFA 4OGEA 4DU4A 4FJIA 3G0ZA 4IDKA 3T19A 1SL0A 1WSGA 2IAJA 5I3UA 3MXIA 3PO5A 4KB0A 1UOCA 3C6TA 1RDDA 4CECA 3QNNA 4ZTFA 4W5QA 4PWDA 4KFBA 5C42A 1TKXA 3RR8A 4RW6A 4FVMA 1QSLA 1C1BA 1RT7A 1ASWA 4CEAA 3SYZA 3MECA 3VQPA 3DLBA 1X9SA 5HRRA 3DLHA 1GOBA 1D5AA 1DTTA 1JLGA 4KHUA 4HVJA 1B9FA 2Z1JA 4M3RA 5E41A 5KGWA 1NJWA 4C8KA 2AJQA 1I3AA 4KHYA 2DFHA 4CHNA 3ZSWA 3OYDA 4W5OA 3ZCMA 4OPKA 2IDOA 3NAEA 4FM1A 2O4IA 4BACA 4BE2A 3AO5A 3MXJA 3ZT1A 4W5TA 3MAQA 2RKIA 1S6PA 5HBMA 2E6LA 3VA3A 2HHTA 3JSMA 1EP4A 4FJMA 2ATQA 1WSIA 3CM5A 4EZ6A 4AHVA 3TAEA 3RR7A 4IKFA 4RW8A 5CZ2A 3IRXA 2KFNA 4FM0A 2G8FA 1YVUA 2I5JA 1HQEA 4DTNA 1VSHA 3SV3A 3S3NA 5FRMA 4LSLA 4CFCA 4KB1A 1N6QA 2KZZA 3DRSA 4CFAA 1U48A 4DSJA 1LW2A 4KKOA 1HNIA 4TSXA 4Y1DA 3WNFA 4M3XA 4CF8A 2G8KA 1S1TA 3QO9A 1NK9A 3L2UA 1Z25A 1KFSA 2E4LA 3KIOA 4FLXA 4CFDA 4NYFA 4AHCA 3MEDA 1ASVA 3AVBA 4DTSA 4DTPA 1NKBA 1DTQA 1TL3A 2XRIA 3LAMA 4KAZA 3V1RA 3AVKA 5SWMA 3P5JA 1VSMA 4HUFA 5D3GA 3K5OA 3WNHA 3AVLA 3NGIA 4OKKA 1NKCA 1TV6A 4FJKA 4J2BA 1S6QA 4OKEA 3M8PA 3VQ5A 3TARA 2QK9A 1BHLA 1WLJA 4K8ZA 4DU3A 1DLOA 3NH1A 3LWLA 2R7YA 2OA8A 2XY6A 1BQMA 5CYQA 4E7HA 4FZZA 4DG1A 1J53A 4HCCA 2OPRA 4CCHA 3OYJA 1SL2A 3SUQA 5CY4A 3VQ7A 1REVA 4E7LA 2P1JA 1RCHA 3ZSXA 2HNYA 1UA1A 2VG5A 3SI6A 1RT4A 4DTXA 4CJVA 4E7IA 3TAQA 3UIQA 4CEOA 2HNZA 2D0BA 4CJRA 3OY9A 3KLHA 1TKDA 2KQ2A 3O3HA 3SQ4A 1IKXA 1VSKA 3K5NA 1B9DA 1RBVA 1NKEA 3P1GA 3V81A 4M3TA 3L2WA 1D9FA 3AVIA 2VWKA 3AVHA 1BISA 1TK5A 4F3TA 4FLWA 1NK5A 3AVGA 4M3WA 4CEZA 4DF4A 4H4MA 4CJPA 1Q9YA 4FXDA 4CF9A 4ELUA 4NYNA 3KLEA 4N56A 4FLZA 2FBVA 1NK6A 3CFPA 1HJRA 1KTQA 2G8UA 4N5SA 3ALYA 3KTQA 4DLGA 1RDAA 1NJYA 4KHQA 3NBPA 3OS1A 2HVIA 5JS2A 4HTUA 2X6SA 4DQQA 2ZQBA 4DF8A 5FRNA 1L3TA 2QXFA 1ZBIA 1A5VA 4B3OA 4QCLA 3SQ0A 2KTQA 1C0MA 3OYMA 4CK1A 4IG0A 2NUBA 3OYIA 1NK0A 2LSNA 1VSLA 4I2PA 3QNOA 4DFMA 3S9HA 1BQNA 4CEBA 4Q5VA 1X9WA 1SL1A 1WAJA 3DLKA 1U49A 2F8SA 4OLAA 4CJWA 4C8LA 1W9HA 3OYHA 4Z0UA 1ZBHA 3QETA 3VQCA 1S9GA 3AA3A 3VN5A 1NOYA 1IH7A 1RT3A 1JLQA 3LP0A 4FLUA 3TAPA 4CK2A 4O0JA 4KI6A 3PX6A 4CJSA 4R5PA 2XHBA 2RPIA 3HVRA 1RT1A 1QHTA 2YHBA 4CEDA 1X9MA 2ETJA 3TI0A 4CJFA 4ID1A 4CF0A 1A5WA 4EP5A 4CFBA 4KTQA 3QESA 2OPSA 3V4IA 4B9NA 3I0SA 1CZBA 4CIFA 4DTRA 4FJ9A 1HYSA 4DTUA 3SQ2A 3LWMA 1W0HA 4B9MA 1S5JA 3HM9A 1CXQA 5J2NA 4PA1A 3SUOA 1NK7A 3V9XA 4DQIA 4LH4A 5DK5A 4H8KA 4FJLA 3AA4A 1SKSA 1LW0A 1IKYA 2DFEA 2YNIA 2Z1GA 1JXBA 3AVCA 1WSEA 2ZD1A 3HP9A 4CJTA 4DLEA 1RT6A 4M41A 4N76A 4FK4A 2Z1IA 2X74A 4O44A 5KRSA 4DU1A 1XWLA 3C95A 1HPZA 3FFIA 4C8OA 4M3YA 3PO4A 2YNHA 3LANA 5HRPA 4FJXA 1Y97A 1T8EA 2IS3A 1R0AA 1FKOA 1IO2A 4AHSA 3LAKA 3TANA 3SUNA 2OPPA 2OPQA 3CG7A 4FJ8A 1RTIA 1TAUA 3NE6A 3CFOA 2PYJA 1FKPA 3CFRA 4KTZA 3K5LA 1RILA 2EHGA 3K2PA 3KKRA 3NF6A 4F2RA 3AVMA 2E6MA 2HHXA 2DY4A 3ITHA 5FROA 2JLEA 1LWEA 2HNDA 4CHYA 4M3ZA 4CESA 2G8IA 1LWCA 2DFFA 3L3UA 1VSIA 4CF2A 4HUEA 3QEXA 2DTUA 2X78A 3B6PA 4O5BA 5T7BA 3K5MA 4DSKA 3NGZA 1B92A 3VQQA 3VQ9A 1QS4A 3RMCA 5C25A 3SQ1A 3M8QA 4OLBA 4DFKA 1RBRA 3KLGA 4NCGA 3LDSA 3LP1A 1IG9A 1J9AA 1TKZA 3LPTA 1UAXA 1JL2A 3DRPA 3H08A 5KI6A 4DSEA 4KRFA 4DS5A 3L8BA 3C94A 2XY8A 1RDBA 4I2QA 1K6YA 4CEEA 4OPJA 4BE0A 3SV4A 4Y1CA 4CHOA 3IS9A 4CJLA 3HK2A 1BCMA 3QERA 1RTHA 4EZ9A 3DM2A 3CM6A 4J2DA 3NH0A 2W42A 4HCBA 3U3YA 2HVHA 3F73A 1S1WA 2Q3SA 3NGYA 4J2EA 3AVJA 4Z4FA 2FBXA 3ISNC 4N47A 3K58A 4JRQA 2KZMA 4Z4EA 1TK8A 4FJ5A 4DTJA 4CJ4A 1MU2A 4MQ3A 4QAGA 4Q0BA 4BDZA 3OYCA 4F4KA 1VRUA 1HQUA 1WNSA 3VQBA 4AH9A 4E89A 1RTDA 3VQAA 1KRPA 4FK2A 1D8YA 4F8RA 5HROA 1RBSA 3V1OA 4I9QA 4J2AA 4KO0A 3B6OA 3NF8A 3U3GA 3O3GA 1UA0A 1RBTA 3O4QA 3OYBA 1JLBA 1RBUA 3DRRA 1SKWA 3AO1A 3DOKA 1QSSA 3RRGA 2FBYA 4FLYA 1J54A 1JLAA 1JLEA 1L3UA 4Z4IA 4AHTA 1QE1A 1EX4A 3WNEA 1WSJA 1WAFA 1BCOA 3QIPA 3I8DA 3TWHA 4F3OA 4UQGA 4KI4A 1Q9XA 1KVAA 2PZSA 4CGGA 3OJSA 3OVNA 4RW9A 2GUIA 3CYMA 1QQCA 3KJVA 1D9DA 1VRTA 2OZSA 1BIUA 4FK0A 3DLGA 3ZT2A 4NCAA 4LSNA 1VSDA 2A1SA 4OVLA 1KLMA 3C6UA 4CIGA 2P5OA 3VQ4A 3HJFA 4CE9A 1ZBLA 1L3SA 3OYLA 2HHSA 1U04A 4F2SA 3V9ZA 2KFZA 3KLFA 2XO7A 4E1MA 4AILC 3KLIA 3HT3A 1XC9A 1RT2A 1S1UA 3RWUA 3S3MA 4ICLA 4MFBA 3IG1A 3ZT0A 1ASUA 4ZHRA 3V9WA 3RMDA 4L8RB 2HW3A 3DMJA 4W5NA 1WN7A 3L2QA 1IKVA 3HL8A 1YTAA 1U4BA 4ELVA 2BE2A 3AV9A 3SCXA 3EY1A 5HLFA 2YHAA 4JS4A 3LP3A 4ELTA 4CHPA 4CEFA 3RRHA 1BL3A 1EXQA 1I39A 2IC3A 5HRSA 4CF1A 4JS5A 4NCBA 3MEGA 1BGXT 2YV0X 3DLRA 3TAFA 1BI4A 1S9EA 4CGIA 3TABA 1NJZA 3SZ2A 1JLCA 4DQSA 2VG7A 4E19A 3L2RA 3SPZA 1C1CA 4FJ7A 5JS1A 4IBNA 4DQPA 4M3UA 1S1VA 4AHRA 1CXUA 2D5RA 3AVNA 4CGHA 3EYZA 1N5YA 4CJ3A 4EP4A 4CERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M45 A;  4DSI A;  3OYE A;  4LY7 A;  1J5O A;  3OYA A;  3G10 A;  4CIE A;  4BDY A;  2A1R A;  4N41 A;  1TK0 A;  3LP2 A;  1LV5 A;  4BWJ A;  3NFA A;  1BI4 B;  2O4G A;  1KSP A;  3BDP A;  4FJJ A;  1KVC A;  3L3V A;  5HP1 A;  4FW1 A;  4DWI A;  1KVB A;  3HP6 A;  4B9S A;  2B6A A;  1SUQ A;  1A5X A;  3V6D A;  1VSE A;  1T05 A;  3NF9 A;  3PUF A;  4ID5 A;  3SJJ A;  4O4G A;  4FLT A;  1RTJ A;  3S3O A;  1XI1 A;  2HMI A;  3ZSY A;  3SNN A;  4M42 A;  1RNH A;  3F9K A;  5EU7 A;  1Z26 A;  4OKJ A;  3D0P A;  4KHW A;  3AA5 X;  4CGJ A;  4IG3 A;  3PY8 A;  4JLH A;  2G8V A;  3DOL A;  1ZYQ A;  1L5U A;  1TGO A;  3DYA A;  1JKH A;  2HHQ A;  2B5J A;  4YFU A;  4FJG A;  3JYT A;  2F8T A;  1RT5 A;  2G8H A;  2YNG A;  2PY5 A;  4QOZ B;  5KTQ A;  4E0D A;  4Z4H A;  4CGD A;  4W5R A;  3EZ5 A;  3ZT3 A;  3PV8 A;  3U6F A;  4O0I A;  3HST B;  1LAV A;  1FXX A;  4C8M A;  3TR8 A;  3NCI A;  3T1A A;  3LZI A;  1ZBU A;  3OYG A;  2ZE2 A;  3T3F A;  4PY5 A;  4HUG A;  1QTM A;  3CQ8 A;  2GBZ A;  4LH5 A;  4LD0 A;  4CJ5 A;  5SZT A;  3THV A;  4B9T A;  5J2M A;  1C0U A;  4O55 A;  1ITG A;  1HYV A;  4FM2 A;  3AO3 A;  3RMA A;  3ZSO A;  1TL1 A;  3OS0 A;  4E7J A;  4DS4 A;  3WNG A;  3V1Q A;  4KHN A;  1G15 A;  3VA0 A;  4I7F A;  5I42 A;  1XHX A;  4KTW A;  2YKM A;  1WSH A;  4CJE A;  4FLV A;  3DLE A;  3MEE A;  5FDL A;  4B8A B;  3P83 D;  3KK2 A;  4DSF A;  4DSL A;  4BWM A;  4AHU A;  5J1E A;  4FW2 A;  2BDP A;  4JRP A;  3IAY A;  5CZ1 A;  3M8R A;  5J2Q A;  2HHU A;  3QIO A;  3ULD A;  2YNF A;  1JL1 A;  4YNQ A;  3VQD A;  4CJK A;  4FJH A;  3TAG A;  4B08 A;  3O4N A;  1HRH A;  4GVM A;  3HPG A;  3I0R A;  3LAL A;  3ZSR A;  3RMB A;  3KD5 E;  1BIZ A;  1F21 A;  2BAN A;  3NF7 A;  3QEP A;  2P5G A;  2QKK A;  4G1Q A;  1C0T A;  3LPU A;  4KHS A;  4B8C A;  1FK9 A;  1YT3 A;  3OYN A;  1T7P A;  1X1P A;  3NDK A;  4CHQ A;  1CZ9 A;  4B9V A;  1VSJ A;  1C6V A;  1LAW A;  3QLH A;  3NHG A;  2JGU A;  3KK3 A;  1TKT A;  2Z1H A;  4E3S A;  2X6N A;  1NK4 A;  1CLQ A;  3ZSV A;  4RG8 A;  4FCY A;  3VQ6 A;  4DTO A;  3SUP A;  3VQ8 A;  1KLN A;  2HB5 A;  1EET A;  4DTM A;  3KD1 E;  3LZJ A;  4KV8 A;  1NJX A;  2D0A A;  4E7K A;  3MXM A;  1U45 A;  1T03 A;  4CEQ A;  4DQR A;  4B9U A;  4Z4G A;  3OYF A;  3HVT A;  3PX0 A;  2XY7 A;  4ZTJ A;  3KK1 A;  1VSF A;  4Z4C A;  2Y1I A;  1HNV A;  4PUO A;  3K59 A;  5K14 A;  1C1A A;  4DFP A;  3HO1 A;  4CJU A;  1GOA A;  3E01 A;  3AO2 A;  2PYL A;  1TAQ A;  5KRT A;  3ZT4 A;  1JXE A;  1IKW A;  3QIN A;  5CYM A;  3PX4 A;  4I9L A;  3HXM A;  1GOC A;  4DMN A;  2OZM A;  1S1X A;  3OYK A;  1TVR A;  2IOC A;  3AO4 A;  3AVA A;  1LWF A;  2IGI A;  2VG6 A;  2OYQ A;  2P51 A;  4IFV A;  1NOZ A;  4H4O A;  5DMR A;  3M8S A;  2RF2 A;  4IFY A;  5C24 A;  1KCF A;  1QSY A;  4FZX C;  3DI6 A;  4FZY A;  1ZBF A;  4CJQ A;  3KKS A;  1XHZ A;  4KRE A;  1L3V A;  4GMJ B;  2F96 A;  1KFD A;  4BDP A;  1NK8 A;  4CGF A;  2WOM A;  4B9L A;  1HYZ A;  3AVF A;  2FBT A;  3QEV A;  2XY5 A;  2G8W A;  1VK0 A;  3TAM A;  3HPH A;  2KW4 A;  3ZSZ A;  5KGX A;  3AA2 A;  4C8N A;  3L2V A;  4KPY A;  2QKB A;  3ASM A;  3HPO A;  1EKE A;  2EX3 A;  1SV5 A;  1O1W A;  3VQE A;  3NH2 A;  1YTU A;  2BGG A;  4WE1 A;  4OGC A;  2WON A;  1UWB A;  3BGR A;  3HYF A;  1Q8I A;  2D0C A;  4BE1 A;  4DFJ A;  2FC0 A;  4CK3 A;  2YKN A;  3SPY A;  3O3F A;  3OJU A;  5HRN A;  4OJR A;  4RW7 A;  2RN2 A;  3D45 A;  1U47 A;  3A2F A;  4K8X A;  4CHZ A;  2HHV A;  4HHT A;  1JLF A;  4E1N A;  3QEI A;  5J2P A;  4PQU A;  4GW6 A;  3ZSQ A;  2B4J A;  3V9S A;  2ITG A;  2VWJ A;  3OS2 A;  3RTV A;  4FYD A;  1RDC A;  2Y1J A;  2HHW A;  3K57 A;  3V9U A;  3QEW A;  1HMV A;  2GV9 A;  4FJN A;  1SKR A;  4XIU A;  4RW4 A;  1WSF A;  4OGE A;  4DU4 A;  4FJI A;  3G0Z A;  4IDK A;  3T19 A;  1SL0 A;  1WSG A;  2IAJ A;  5I3U A;  3MXI A;  3PO5 A;  4KB0 A;  1UOC A;  3C6T A;  1RDD A;  4CEC A;  3QNN A;  4ZTF A;  4W5Q A;  4PWD A;  4KFB A;  5C42 A;  1TKX A;  3RR8 A;  4RW6 A;  4FVM A;  1QSL A;  1C1B A;  1RT7 A;  1ASW A;  4CEA A;  3SYZ A;  3MEC A;  3VQP A;  3DLB A;  1X9S A;  5HRR A;  3DLH A;  1GOB A;  1D5A A;  1DTT A;  1JLG A;  4KHU A;  4HVJ A;  1B9F A;  2Z1J A;  4M3R A;  5E41 A;  5KGW A;  1NJW A;  4C8K A;  2AJQ A;  1I3A A;  4KHY A;  2DFH A;  4CHN A;  3ZSW A;  3OYD A;  4W5O A;  3ZCM A;  4OPK A;  2IDO A;  3NAE A;  4FM1 A;  2O4I A;  4BAC A;  4BE2 A;  3AO5 A;  3MXJ A;  3ZT1 A;  4W5T A;  3MAQ A;  2RKI A;  1S6P A;  5HBM A;  2E6L A;  3VA3 A;  2HHT A;  3JSM A;  1EP4 A;  4FJM A;  2ATQ A;  1WSI A;  3CM5 A;  4EZ6 A;  4AHV A;  3TAE A;  3RR7 A;  4IKF A;  4RW8 A;  5CZ2 A;  3IRX A;  2KFN A;  4FM0 A;  2G8F A;  1YVU A;  2I5J A;  1HQE A;  4DTN A;  1VSH A;  3SV3 A;  3S3N A;  5FRM A;  4LSL A;  4CFC A;  4KB1 A;  1N6Q A;  2KZZ A;  3DRS A;  4CFA A;  1U48 A;  4DSJ A;  1LW2 A;  4KKO A;  1HNI A;  4TSX A;  4Y1D A;  3WNF A;  4M3X A;  4CF8 A;  2G8K A;  1S1T A;  3QO9 A;  1NK9 A;  3L2U A;  1Z25 A;  1KFS A;  2E4L A;  3KIO A;  4FLX A;  4CFD A;  4NYF A;  4AHC A;  3MED A;  1ASV A;  3AVB A;  4DTS A;  4DTP A;  1NKB A;  1DTQ A;  1TL3 A;  2XRI A;  3LAM A;  4KAZ A;  3V1R A;  3AVK A;  5SWM A;  3P5J A;  1VSM A;  4HUF A;  5D3G A;  3K5O A;  3WNH A;  3AVL A;  3NGI A;  4OKK A;  1NKC A;  1TV6 A;  4FJK A;  4J2B A;  1S6Q A;  4OKE A;  3M8P A;  3VQ5 A;  3TAR A;  2QK9 A;  1BHL A;  1WLJ A;  4K8Z A;  4DU3 A;  1DLO A;  3NH1 A;  3LWL A;  2R7Y A;  2OA8 A;  2XY6 A;  1BQM A;  5CYQ A;  4E7H A;  4FZZ A;  4DG1 A;  1J53 A;  4HCC A;  2OPR A;  4CCH A;  3OYJ A;  1SL2 A;  3SUQ A;  5CY4 A;  3VQ7 A;  1REV A;  4E7L A;  2P1J A;  1RCH A;  3ZSX A;  2HNY A;  1UA1 A;  2VG5 A;  3SI6 A;  1RT4 A;  4DTX A;  4CJV A;  4E7I A;  3TAQ A;  3UIQ A;  4CEO A;  2HNZ A;  2D0B A;  4CJR A;  3OY9 A;  3KLH A;  1TKD A;  2KQ2 A;  3O3H A;  3SQ4 A;  1IKX A;  1VSK A;  3K5N A;  1B9D A;  1RBV A;  1NKE A;  3P1G A;  3V81 A;  4M3T A;  3L2W A;  1D9F A;  3AVI A;  2VWK A;  3AVH A;  1BIS A;  1TK5 A;  4F3T A;  4FLW A;  1NK5 A;  3AVG A;  4M3W A;  4CEZ A;  4DF4 A;  4H4M A;  4CJP A;  1Q9Y A;  4FXD A;  4CF9 A;  4ELU A;  4NYN A;  3KLE A;  4N56 A;  4FLZ A;  2FBV A;  1NK6 A;  3CFP A;  1HJR A;  1KTQ A;  2G8U A;  4N5S A;  3ALY A;  3KTQ A;  4DLG A;  1RDA A;  1NJY A;  4KHQ A;  3NBP A;  3OS1 A;  2HVI A;  5JS2 A;  4HTU A;  2X6S A;  4DQQ A;  2ZQB A;  4DF8 A;  5FRN A;  1L3T A;  2QXF A;  1ZBI A;  1A5V A;  4B3O A;  4QCL A;  3SQ0 A;  2KTQ A;  1C0M A;  3OYM A;  4CK1 A;  4IG0 A;  2NUB A;  3OYI A;  1NK0 A;  2LSN A;  1VSL A;  4I2P A;  3QNO A;  4DFM A;  3S9H A;  1BQN A;  4CEB A;  4Q5V A;  1X9W A;  1SL1 A;  1WAJ A;  3DLK A;  1U49 A;  2F8S A;  4OLA A;  4CJW A;  4C8L A;  1W9H A;  3OYH A;  4Z0U A;  1ZBH A;  3QET A;  3VQC A;  1S9G A;  3AA3 A;  3VN5 A;  1NOY A;  1IH7 A;  1RT3 A;  1JLQ A;  3LP0 A;  4FLU A;  3TAP A;  4CK2 A;  4O0J A;  4KI6 A;  3PX6 A;  4CJS A;  4R5P A;  2XHB A;  2RPI A;  3HVR A;  1RT1 A;  1QHT A;  2YHB A;  4CED A;  1X9M A;  2ETJ A;  3TI0 A;  4CJF A;  4ID1 A;  4CF0 A;  1A5W A;  4EP5 A;  4CFB A;  4KTQ A;  3QES A;  2OPS A;  3V4I A;  4B9N A;  3I0S A;  1CZB A;  4CIF A;  4DTR A;  4FJ9 A;  1HYS A;  4DTU A;  3SQ2 A;  3LWM A;  1W0H A;  4B9M A;  1S5J A;  3HM9 A;  1CXQ A;  5J2N A;  4PA1 A;  3SUO A;  1NK7 A;  3V9X A;  4DQI A;  4LH4 A;  5DK5 A;  4H8K A;  4FJL A;  3AA4 A;  1SKS A;  1LW0 A;  1IKY A;  2DFE A;  2YNI A;  2Z1G A;  1JXB A;  3AVC A;  1WSE A;  2ZD1 A;  3HP9 A;  4CJT A;  4DLE A;  1RT6 A;  4M41 A;  4N76 A;  4FK4 A;  2Z1I A;  2X74 A;  4O44 A;  5KRS A;  4DU1 A;  1XWL A;  3C95 A;  1HPZ A;  3FFI A;  4C8O A;  4M3Y A;  3PO4 A;  2YNH A;  3LAN A;  5HRP A;  4FJX A;  1Y97 A;  1T8E A;  2IS3 A;  1R0A A;  1FKO A;  1IO2 A;  4AHS A;  3LAK A;  3TAN A;  3SUN A;  2OPP A;  2OPQ A;  3CG7 A;  4FJ8 A;  1RTI A;  1TAU A;  3NE6 A;  3CFO A;  2PYJ A;  1FKP A;  3CFR A;  4KTZ A;  3K5L A;  1RIL A;  2EHG A;  3K2P A;  3KKR A;  3NF6 A;  4F2R A;  3AVM A;  2E6M A;  2HHX A;  2DY4 A;  3ITH A;  5FRO A;  2JLE A;  1LWE A;  2HND A;  4CHY A;  4M3Z A;  4CES A;  2G8I A;  1LWC A;  2DFF A;  3L3U A;  1VSI A;  4CF2 A;  4HUE A;  3QEX A;  2DTU A;  2X78 A;  3B6P A;  4O5B A;  5T7B A;  3K5M A;  4DSK A;  3NGZ A;  1B92 A;  3VQQ A;  3VQ9 A;  1QS4 A;  3RMC A;  5C25 A;  3SQ1 A;  3M8Q A;  4OLB A;  4DFK A;  1RBR A;  3KLG A;  4NCG A;  3LDS A;  3LP1 A;  1IG9 A;  1J9A A;  1TKZ A;  3LPT A;  1UAX A;  1JL2 A;  3DRP A;  3H08 A;  5KI6 A;  4DSE A;  4KRF A;  4DS5 A;  3L8B A;  3C94 A;  2XY8 A;  1RDB A;  4I2Q A;  1K6Y A;  4CEE A;  4OPJ A;  4BE0 A;  3SV4 A;  4Y1C A;  4CHO A;  3IS9 A;  4CJL A;  3HK2 A;  1BCM A;  3QER A;  1RTH A;  4EZ9 A;  3DM2 A;  3CM6 A;  4J2D A;  3NH0 A;  2W42 A;  4HCB A;  3U3Y A;  2HVH A;  3F73 A;  1S1W A;  2Q3S A;  3NGY A;  4J2E A;  3AVJ A;  4Z4F A;  2FBX A;  3ISN C;  4N47 A;  3K58 A;  4JRQ A;  2KZM A;  4Z4E A;  1TK8 A;  4FJ5 A;  4DTJ A;  4CJ4 A;  1MU2 A;  4MQ3 A;  4QAG A;  4Q0B A;  4BDZ A;  3OYC A;  4F4K A;  1VRU A;  1HQU A;  1WNS A;  3VQB A;  4AH9 A;  4E89 A;  1RTD A;  3VQA A;  1KRP A;  4FK2 A;  1D8Y A;  4F8R A;  5HRO A;  1RBS A;  3V1O A;  4I9Q A;  4J2A A;  4KO0 A;  3B6O A;  3NF8 A;  3U3G A;  3O3G A;  1UA0 A;  1RBT A;  3O4Q A;  3OYB A;  1JLB A;  1RBU A;  3DRR A;  1SKW A;  3AO1 A;  3DOK A;  1QSS A;  3RRG A;  2FBY A;  4FLY A;  1J54 A;  1JLA A;  1JLE A;  1L3U A;  4Z4I A;  4AHT A;  1QE1 A;  1EX4 A;  3WNE A;  1WSJ A;  1WAF A;  1BCO A;  3QIP A;  3I8D A;  3TWH A;  4F3O A;  4UQG A;  4KI4 A;  1Q9X A;  1KVA A;  2PZS A;  4CGG A;  3OJS A;  3OVN A;  4RW9 A;  2GUI A;  3CYM A;  1QQC A;  3KJV A;  1D9D A;  1VRT A;  2OZS A;  1BIU A;  4FK0 A;  3DLG A;  3ZT2 A;  4NCA A;  4LSN A;  1VSD A;  2A1S A;  4OVL A;  1KLM A;  3C6U A;  4CIG A;  2P5O A;  3VQ4 A;  3HJF A;  4CE9 A;  1ZBL A;  1L3S A;  3OYL A;  2HHS A;  1U04 A;  4F2S A;  3V9Z A;  2KFZ A;  3KLF A;  2XO7 A;  4E1M A;  4AIL C;  3KLI A;  3HT3 A;  1XC9 A;  1RT2 A;  1S1U A;  3RWU A;  3S3M A;  4ICL A;  4MFB A;  3IG1 A;  3ZT0 A;  1ASU A;  4ZHR A;  3V9W A;  3RMD A;  4L8R B;  2HW3 A;  3DMJ A;  4W5N A;  1WN7 A;  3L2Q A;  1IKV A;  3HL8 A;  1YTA A;  1U4B A;  4ELV A;  2BE2 A;  3AV9 A;  3SCX A;  3EY1 A;  5HLF A;  2YHA A;  4JS4 A;  3LP3 A;  4ELT A;  4CHP A;  4CEF A;  3RRH A;  1BL3 A;  1EXQ A;  1I39 A;  2IC3 A;  5HRS A;  4CF1 A;  4JS5 A;  4NCB A;  3MEG A;  1BGX T;  2YV0 X;  3DLR A;  3TAF A;  1BI4 A;  1S9E A;  4CGI A;  3TAB A;  1NJZ A;  3SZ2 A;  1JLC A;  4DQS A;  2VG7 A;  4E19 A;  3L2R A;  3SPZ A;  1C1C A;  4FJ7 A;  5JS1 A;  4IBN A;  4DQP A;  4M3U A;  1S1V A;  4AHR A;  1CXU A;  2D5R A;  3AVN A;  4CGH A;  3EYZ A;  1N5Y A;  4CJ3 A;  4EP4 A;  4CER A; 
#chains in the Genus database with same CATH topology
 4M45 A;  3WQT A;  3OYE A;  4LY7 A;  3OYA A;  4CIE A;  2A1R A;  4BDY A;  1NGJ A;  4N41 A;  3LP2 A;  4JKF A;  3LDN A;  1OKJ A;  2A5X A;  4YOT A;  4KH6 A;  1BI4 B;  4FJJ A;  5FPN A;  1KVC A;  1SS6 A;  4FW1 A;  4K42 A;  4DWI A;  4XH5 A;  3W3D A;  1A5X A;  3NF9 A;  3PUF A;  5BPM A;  3SJJ A;  3OHR A;  3AAP A;  4B1Y B;  2UYT A;  3P4I A;  1XI1 A;  3CCQ N;  3ZSY A;  4M42 A;  2H3G X;  4OKJ A;  4K25 A;  4KHW A;  5AQG A;  3DWL A;  2DPN A;  4JN4 A;  3PY8 A;  3IUC A;  2NRH A;  5GIP A;  4H5N A;  1L5U A;  4BC5 A;  3VGK A;  3CQX A;  1RT5 A;  5I9E B;  2G8H A;  1H1V A;  2HBL A;  4K41 A;  3F2K A;  1WB9 A;  3ZT3 A;  3PV8 A;  3HST B;  1LAV A;  4C8M A;  5FPM A;  3A8Y A;  1YIJ N;  2GBZ A;  1TUU A;  1C0U A;  4O55 A;  1ITG A;  5AQP A;  4JI6 K;  2IVP A;  2VGN A;  4BY9 C;  5KQD A;  3OS0 A;  4E7J A;  3DXM B;  5IWA K;  3VA0 A;  1XHX A;  4KTW A;  3DLE A;  3MEE A;  4B8A B;  3H6E A;  3M6G A;  5AR0 A;  5BRE A;  1VQ5 N;  5E84 A;  3B8A X;  3IAY A;  3M8R A;  3ULD A;  3JXU A;  3VQD A;  3DLL L;  4FJH A;  4K0K K;  3O4N A;  3FFK B;  1QQM A;  1BIZ A;  1F21 A;  3CI5 A;  1SZ2 A;  3NF7 A;  3MK6 A;  3TPQ A;  1HUX A;  2QKK A;  2P5G A;  3QBX A;  2NRX A;  1NLV A;  4H5R A;  4CHQ A;  5C10 A;  1C6V A;  4YDU C;  3NHG A;  4FL9 A;  2ASO A;  3CCM N;  1XNQ K;  3LDQ A;  2YCH A;  1NJX A;  4K43 A;  4CEQ A;  4DQR A;  4B9U A;  4Z4G A;  4ZTJ A;  4WQ5 A;  2OCE A;  2GWK A;  4DFP A;  2OTJ N;  1GOA A;  5KRT A;  3ZT4 A;  1JXE A;  3PX4 A;  3KWI A;  3AVA A;  2UXB K;  4DV5 K;  2OYQ A;  3LM2 A;  1NOZ A;  2RF2 A;  4DB3 A;  3E1Y A;  1QSY A;  1XHZ A;  4KRE A;  1K8A O;  2CH5 A;  4AQY K;  1NK8 A;  4CGF A;  1HX1 A;  2FBT A;  3C6A A;  2G8W A;  1VK0 A;  2BH1 A;  3IMX A;  2QKB A;  3L2V A;  4MDB A;  3HPO A;  1SV5 A;  1UWB A;  3E9P A;  1IBL K;  5AFU A;  4BE1 A;  3WEE A;  3EKS A;  3SPY A;  4CD3 A;  5HRN A;  2RN2 A;  2HHV A;  3CC4 N;  4E1N A;  5B8H A;  3ZSQ A;  2A40 A;  3GOI A;  1VQN N;  3OS2 A;  4H5T A;  1N8R O;  2Y1J A;  3K57 A;  4FJN A;  1SQK A;  4Y0W A;  4JKH A;  4DU4 A;  4OGE A;  4FJI A;  5I3U A;  5JLH A;  5JVH L;  3TTC A;  3QNN A;  5C42 A;  3K0S A;  3RR8 A;  2A42 A;  3EL2 A;  4RW6 A;  1ASW A;  3DLB A;  3MEC A;  3D2F A;  3L4Q A;  1GOB A;  1BOT O;  2Z1J A;  4BR2 A;  2AJQ A;  1HR0 K;  2DFH A;  4FM1 A;  3ZSW A;  4E7K A;  1YI2 N;  4YY3 K;  5AQO A;  2J4R A;  4W5T A;  1RFQ A;  2RKI A;  3MAQ A;  2HHT A;  1VQP N;  1EP4 A;  2ATQ A;  3CM5 A;  3CD6 N;  1R59 O;  4RW8 A;  2PFU A;  4IDH A;  3UKU B;  2I5J A;  4IJA A;  1N6Q A;  2KZZ A;  1LW2 A;  4KKO A;  2QWN A;  4CZI A;  3CC2 N;  3QO9 A;  1J6Z A;  3L2U A;  4CFD A;  4NYF A;  1ASV A;  4NB4 A;  1NKB A;  1DTQ A;  1TL3 A;  3K9J A;  4V19 S;  3AVK A;  5SWM A;  2WUS A;  1VSM A;  3NGI A;  4OKK A;  1TV6 A;  3L4I A;  2QK9 A;  1WLJ A;  3LWL A;  2R7Y A;  2OA8 A;  3FR0 A;  3OYJ A;  1NU0 A;  1REV A;  2P1J A;  3ENO A;  2NRW A;  2VG5 A;  2P9U A;  3TAQ A;  4JNE A;  4CJR A;  3N4Q A;  2Q1N A;  3KZB A;  1NKE A;  4M3T A;  3VEZ A;  2VWK A;  1BIS A;  1BO5 O;  4FLW A;  2VYP A;  4WQ4 C;  4M3W A;  4CEZ A;  4B9Q A;  4NO7 A;  1DKG D;  3H1Q A;  3VF6 A;  3CF5 L;  1VQ6 N;  3ALY A;  2VGM A;  3J7Y P;  4DLG A;  5JS2 A;  2IVN A;  4HTU A;  4DF8 A;  3I56 N;  1C0M A;  3OYM A;  4IG0 A;  3OYI A;  4FJL A;  1VSL A;  3WXJ A;  3U9Z A;  4Q5V A;  3PSI A;  1YJN N;  4DQ8 A;  1GLF O;  2ZJR L;  4CJW A;  4C8L A;  1W9H A;  1VQK N;  3J7A P;  4EFH A;  1E4G T;  2QXL A;  1OH7 A;  1S9G A;  1XC3 A;  3AA3 A;  1NOY A;  1IH7 A;  3CMA N;  1RT3 A;  4FLU A;  1XMO K;  3J80 O;  1NG9 A;  3T7Z A;  2XHB A;  1NGE A;  1X9M A;  4CZJ A;  4KTQ A;  4EP5 A;  4CFB A;  3QES A;  2Q36 A;  3VEO A;  3I0S A;  4CIF A;  4DTR A;  2QW9 A;  1S5J A;  1CXQ A;  1KQS M;  4DQI A;  4LH4 A;  5DK5 A;  3WEE B;  3AA4 A;  4LF5 K;  1LW0 A;  1GLJ O;  2Z1G A;  3AVC A;  1WSE A;  1X3M A;  1W97 L;  4CJT A;  4DLE A;  4M41 A;  4A2A A;  1Z6R A;  3VEW A;  2X74 A;  5AZJ B;  1XWL A;  4JK9 A;  4C8O A;  4QS9 A;  3WXL A;  5LMN K;  2HF3 A;  1Y97 A;  2IS3 A;  4JAX A;  2FSJ A;  1XUP O;  2OPP A;  3CG7 A;  1TAU A;  1QZ6 A;  3CFR A;  1BDG A;  3K5L A;  4FPB A;  2EHG A;  5AQW A;  4F2R A;  3AVM A;  2E6M A;  4OO1 J;  3D2F B;  4JI0 K;  2DFF A;  4HUE A;  2Q0R A;  2X78 A;  4DSK A;  3K5M A;  4DHY A;  3J81 O;  1NJI O;  5FLX O;  1DT9 A;  5C25 A;  2ITM A;  1RBR A;  2QI2 A;  4K8X A;  1HNZ K;  4BRD A;  5KI6 A;  3M1F A;  5LJW A;  4IEE A;  1OH5 A;  2XY8 A;  3SV4 A;  4Y1C A;  3U4L A;  4BR0 A;  1BA0 A;  1Q81 O;  5HOO A;  3F73 A;  4YOY A;  4J2E A;  3AVJ A;  3I33 A;  5KPR A;  3ISN C;  3DXK A;  3WXM B;  1TK8 A;  4FJ5 A;  4DTJ A;  4BDZ A;  2KLA A;  1VRU A;  5JVG L;  4AH9 A;  3OBW A;  4FK2 A;  1RBS A;  3B6O A;  3U3G A;  5TKW A;  3O4Q A;  1QSS A;  1RBU A;  2GX9 A;  2UXC K;  3RRG A;  3CHW A;  1J54 A;  1JLA A;  5M1Q A;  4AHT A;  2A6A A;  3WNE A;  3TWH A;  5EX5 A;  4H0P A;  3QIP A;  4YOW A;  4KI4 A;  1Q9X A;  4CVN E;  1QQC A;  1VRT A;  2VQE K;  3ZT2 A;  4CBU A;  4NCA A;  2VWB A;  4OVL A;  4CZH A;  4GV9 A;  1KLM A;  3C6U A;  4O8K A;  4C1N I;  4CIG A;  2P5O A;  3KVG A;  1ZBL A;  3OYL A;  4F2S A;  3O08 A;  1WUA A;  3KLI A;  3HT3 A;  1RT2 A;  3S3M A;  4MFB A;  3IG1 A;  3V9W A;  4WFA L;  3HL8 A;  3ZET B;  2QWQ A;  2BE2 A;  3BEX A;  3ZX3 A;  4LF4 K;  4JS4 A;  4ELT A;  3THX B;  3JS6 A;  1I39 A;  5AQI A;  1BGX T;  3TAF A;  1BI4 A;  1S9E A;  2CGL A;  4R79 A;  1JLC A;  2VG7 A;  4BR7 A;  4IFE A;  4B1U B;  4M3U A;  1S1V A;  4CZM A;  2UUA K;  4IEI A;  4FWO A;  3MDQ A;  1NBW A;  4PKI A;  4IO8 A;  4JI3 K;  4JK8 A;  2KHO A;  4KBO A;  5HP1 A;  1KD1 O;  4BRN A;  1KVB A;  2E2P A;  3GG4 A;  3V6D A;  3MN9 A;  1T05 A;  2HF4 A;  4ID5 A;  4ISG A;  4O4G A;  2O8F B;  2HBK A;  3KWG A;  1BWF O;  3C7N B;  4CGJ A;  2YI1 A;  3ZYY X;  2NRR A;  3UB5 A;  2F4V K;  5AQH A;  1TGO A;  1NGA A;  1JKH A;  2HHQ A;  4YFU A;  4FJG A;  5M1O A;  1QQN A;  2F8T A;  3DXM A;  1NGF A;  4DV3 K;  2PY5 A;  1M90 O;  2Q31 A;  4J8F A;  4W5R A;  1KAY A;  4E1J A;  5ELZ A;  3LZI A;  3TR8 A;  3T1A A;  3VEV A;  4PY5 A;  3CQ8 A;  3THV A;  3UKR A;  3THY B;  5AFU H;  4AF1 A;  1Q86 O;  3AO3 A;  1TL1 A;  3WNG A;  4KHN A;  1G15 A;  5I42 A;  4I7F A;  2ZWH A;  3VMF B;  4CJE A;  1FW6 A;  5M1F A;  3P83 D;  3KK2 A;  4PKG A;  5J1E A;  2BDP A;  4JRP A;  5CZ1 A;  1LOT B;  3QIO A;  4X64 K;  1JL1 A;  4YNQ A;  4CJK A;  4B08 A;  2P9N B;  4GVM A;  3I0R A;  3LAL A;  3RMB A;  1NNE A;  3KD5 E;  5AZI B;  3SJH A;  2QWO A;  3WXK A;  4B8C A;  1YT3 A;  1T7P A;  4B3M K;  3NDK A;  2P9K B;  3QLH A;  1LAW A;  2JGU A;  4FWM A;  3O80 A;  2NRV A;  4RG8 A;  4DTO A;  2FSK A;  1SAZ A;  5BPL A;  2O8D B;  3D2E A;  3LZJ A;  2D0A A;  3MXM A;  1U45 A;  1C0F A;  1Q7Y O;  3KHY A;  3HVT A;  2XY7 A;  4Z4C A;  2Y1I A;  3K59 A;  4JV5 K;  3E01 A;  3AGR A;  1TAQ A;  5AQQ A;  1BUP A;  4B3R K;  1GOC A;  1JCF A;  1K9M O;  1TVR A;  3AO4 A;  2IGI A;  2VG6 A;  2OTL N;  5KQ8 A;  3G71 N;  2OAN A;  3MWT A;  1ZBS A;  5JIC A;  4BDP A;  2WOM A;  4BC3 A;  1KC8 O;  1YUW A;  2XY5 A;  3HSC A;  4G9Z A;  3TAM A;  3ZSZ A;  5KGX A;  4C8N A;  4KPY A;  3EE9 A;  4QS7 A;  1O1W A;  2BGG A;  3WQU A;  2D0C A;  1IG8 A;  4FSV A;  2W6L A;  2YJE A;  4GY2 B;  3O3F A;  3OJU A;  4OJR A;  1JLF A;  3QEI A;  5J2P A;  1NGC A;  4OPH A;  4PQU A;  5C0Y A;  2VWJ A;  1RDC A;  3V9U A;  5AQX A;  1SKR A;  1VQL N;  4RW4 A;  3PIP L;  4BR4 A;  1WSG A;  3PO5 A;  3MXI A;  3C6T A;  1RDD A;  4ZTF A;  4W5Q A;  5FPD A;  3H45 C;  1C1B A;  1RT7 A;  3SYZ A;  3MX5 A;  1X9S A;  5HRR A;  3UKU A;  3DLH A;  1XNR K;  4YOV A;  1D5A A;  1JLG A;  4M3R A;  3F9M A;  3H3N O;  3OYD A;  3NAE A;  2O4I A;  4BE2 A;  3HOS A;  3AO5 A;  5LY3 A;  4A61 A;  4H5W A;  4DCH A;  4AHV A;  1E4F T;  3TAE A;  3IRX A;  4FM0 A;  2G8F A;  4JI5 K;  1HQE A;  4DTN A;  3SV3 A;  3S3N A;  4LSL A;  2ASM A;  4L3Q A;  3DRS A;  5AQR A;  1U48 A;  4DSJ A;  4Y1D A;  4QS8 A;  3P39 A;  4JKB A;  3SAF A;  3UKR B;  2G8K A;  1S1T A;  1M1K O;  1NK9 A;  1Z25 A;  1YVN A;  4DTP A;  2ZGY A;  2XRI A;  4EAH D;  4HUF A;  3THW A;  3JAM O;  3WNH A;  2QWM A;  5A2Q O;  1S6Q A;  4OKE A;  3VQ5 A;  4J2B A;  3AY9 A;  4K8Z A;  3NH1 A;  3TSU A;  4RWT A;  1NGB A;  1GLE G;  1S72 N;  2XY6 A;  4FZZ A;  4DG1 A;  1J53 A;  2OPR A;  1YJW N;  3MN7 A;  3SUQ A;  3VQ7 A;  4E7L A;  1ATS A;  3ZSX A;  5AQF A;  1UA1 A;  3SI6 A;  4CJV A;  3UIQ A;  2F9T A;  3KLH A;  2KQ2 A;  3E9O A;  3SQ4 A;  4IO9 L;  1VSK A;  3K5N A;  1B9D A;  4B1Z A;  4DV6 K;  3P1G A;  2YHW A;  3V81 A;  1D9F A;  1TK5 A;  2O8E B;  1T44 A;  3D2E B;  3G4S N;  1GLB G;  2QM1 A;  4H4M A;  4FXD A;  4CF9 A;  4ELU A;  4WF9 L;  4O8U A;  4GV6 A;  4BGB A;  4H0X B;  1V4S A;  1NJY A;  3NBP A;  3OS1 A;  2HVI A;  5C2D A;  2X6S A;  5FRN A;  2ZQB A;  4JEP A;  3CPE A;  4F9O A;  5M1K A;  3QNO A;  4DFM A;  3S9H A;  1BQN A;  4CEB A;  1X9W A;  1SL1 A;  3DLK A;  1U49 A;  2F8S A;  1Y64 A;  1ZBH A;  5MLC Q;  2O8C B;  3LP0 A;  4O0J A;  1YF5 L;  3SBT A;  3E9L A;  4YDU A;  4R5P A;  1RT1 A;  2UU9 K;  4CED A;  3TI0 A;  4CJF A;  4CF0 A;  1NWK A;  2OPS A;  3V4I A;  5ADX H;  3CCE N;  3R6M A;  5AZJ A;  3SQ2 A;  3LWM A;  1W0H A;  4B9M A;  3C65 A;  5J2N A;  4PA1 A;  3SUO A;  3V9X A;  3J7Z O;  2QA4 N;  2YNI A;  3CCR N;  3EO3 A;  1MWM A;  2HHH K;  4N76 A;  2GTD A;  4FK4 A;  5LMU K;  3AAR A;  4DU1 A;  2E1Z A;  4NLB A;  2GWJ A;  2YNH A;  3LAN A;  5HRP A;  1R0A A;  3TAN A;  1IBM K;  2ZF5 O;  4FPA A;  1RTI A;  3FZK A;  5AQN A;  2PYJ A;  4JD2 B;  3WXI A;  2Q97 A;  2VCP A;  2JLE A;  1WBD A;  4CES A;  2G8I A;  1LWC A;  4CF2 A;  5M1N A;  4O5B A;  5T7B A;  3VQ9 A;  1QS4 A;  4U7B A;  4NCG A;  1IG9 A;  3VER A;  1J9A A;  4KRF A;  3DRP A;  1OVQ A;  3FZF A;  1ILY A;  3C94 A;  1RDB A;  1K6Y A;  2ZJP L;  3CJ9 A;  3VGM A;  2YHY A;  3BY5 A;  3VPZ A;  4OX9 K;  4HCB A;  3EKU A;  3HBT A;  1S1W A;  1VQ4 N;  2Q3S A;  3VTH A;  1DGK N;  3BF1 A;  4BRH A;  3W0L A;  1GLL O;  4CJ4 A;  5BPN A;  1MU2 A;  5BRD A;  5BRF A;  4LFA K;  1HQU A;  3THW B;  4ISE A;  4Z94 A;  2F9W A;  5HRO A;  3V1O A;  3I8B A;  3NF8 A;  4JYA K;  3QFP A;  3UE5 A;  2I7P A;  4DR6 K;  4CZL A;  2IIR A;  3OYB A;  3MN5 A;  3T1Y K;  4LF9 K;  2Q0U A;  2P9S B;  1QE1 A;  1VQM N;  1WSJ A;  1WAF A;  3D6R A;  1XMQ K;  2PZS A;  3OJS A;  2GUI A;  2OZS A;  4BC4 A;  1BIU A;  1RDU A;  3CJA A;  4LSN A;  1VSD A;  3ZET A;  2A1S A;  3VET A;  3EN9 A;  4BRQ A;  3CCU N;  3N4P A;  4BRL A;  3THX A;  4CBW A;  2HOE A;  4CE9 A;  4IJN A;  2HHS A;  3CJC A;  3V9Z A;  4YOU A;  3R8E A;  3RWU A;  3RMD A;  5F2R A;  4L8R B;  5GAD P;  1IKV A;  1YTA A;  3T1H K;  3AV9 A;  4IZ9 A;  1BL3 A;  5EY4 A;  4IOC L;  5HRS A;  4CF1 A;  1HKB A;  3K9K A;  1E3M A;  1HJO A;  2YV0 X;  4FWP A;  3ULE B;  3HRG A;  3SZ2 A;  4FJ7 A;  4BRP A;  5JS1 A;  4IBN A;  4DQP A;  4NXN K;  4LC9 B;  4AHR A;  5LL6 Z;  2CGK A;  2D5R A;  5EOY A;  3F5T A;  4CJ3 A;  2O8F A;  1VHX A;  3QIC A;  3C7N A;  5KPZ A;  1HPM A;  3G10 A;  3GL1 A;  1LV5 A;  3NFA A;  3O9R A;  1KSP A;  3EE8 A;  3TSQ A;  4GKK K;  4WQ4 A;  3HP6 A;  3CIP A;  2B6A A;  5CHI A;  2VQF K;  3C0B A;  5BR9 A;  5GAG P;  1EQY A;  5EVZ A;  3S3O A;  3LM9 A;  1RNH A;  3F9K A;  3D0P A;  2I7N A;  3RSE B;  4JLH A;  3THY A;  3DOL A;  1IJJ A;  5C15 A;  1W2B M;  3JYT A;  3I55 N;  4QOZ B;  3VTI A;  5KTQ A;  4E0D A;  3EZ5 A;  3U6F A;  4O0I A;  1GLD G;  1FXX A;  3CJ1 A;  3NCI A;  1ZBU A;  4YOX A;  3OYG A;  3T3F A;  4HUG A;  2YHX A;  3PSF A;  2FLO A;  4LD0 A;  5SZT A;  4CJ5 A;  1GLA G;  4EHU A;  2UXD K;  3P31 A;  4EHT A;  1HYV A;  4FM2 A;  5FPE A;  2EWS A;  2P9N A;  4DS4 A;  3V1Q A;  1BU6 O;  4X65 K;  1WSH A;  1OVY A;  3PLA A;  1EO1 A;  4BRA A;  5AZI A;  4OPA A;  4DSL A;  1EWR A;  4AHU A;  4FW2 A;  2P9K A;  5J2Q A;  4LF7 K;  2HHU A;  2YNF A;  3TAG A;  3O9Q A;  5AQL A;  1HRH A;  3HPG A;  1ATN A;  3ZSR A;  2O8D A;  1U6Z A;  3MX2 A;  3QEP A;  1C0T A;  4KHS A;  3OYN A;  1CZ9 A;  1VSJ A;  5CE3 A;  3KK3 A;  1TKT A;  2X6N A;  1NK4 A;  2HST A;  5AQZ A;  5ADX A;  5GIN A;  3ZSV A;  5KPT A;  3SUP A;  2NZT A;  4IOX A;  1KLN A;  2HB5 A;  2HBJ A;  4CZK A;  4DTM A;  4KV8 A;  1T03 A;  4BRI A;  3PX0 A;  3FE1 A;  3KK1 A;  3BUZ B;  4PUO A;  5K14 A;  1C1A A;  2CH6 A;  4BRE A;  4CJU A;  3AO2 A;  2PYL A;  3VEX A;  3QIN A;  5CYM A;  3NMU A;  4DMN A;  5JLF A;  2IOC A;  4FWS A;  3ATV A;  4WCE L;  2P51 A;  3ATU A;  4H4O A;  5DMR A;  3FZM A;  1Q18 A;  4IFY A;  5IT9 O;  4FZX C;  4FZY A;  1ZBF A;  4CJQ A;  3KKS A;  4FWR A;  4GMJ B;  1L3V A;  4ILG B;  5AQU A;  1K8K B;  1NMD A;  4KH4 A;  5BRH A;  3QML A;  3HPH A;  2KW4 A;  3A5N C;  3AA2 A;  1BA1 A;  3VQE A;  3NH2 A;  3FZL A;  4WE1 A;  4OGC A;  2UUB K;  3HYF A;  1D4X A;  4WFN L;  5GIO A;  4BG8 A;  1VAZ A;  2E1Y A;  4CK3 A;  2YKN A;  4GVE A;  4RW7 A;  4WYB A;  4CHZ A;  3QDK A;  1I94 K;  4A57 A;  5AQS A;  2QTD A;  2Q2R A;  1FJG K;  3G0Z A;  3T19 A;  2IAJ A;  3RVC A;  1ZC6 A;  4RTF D;  4PWD A;  4KFB A;  3O9U A;  1TKX A;  4U67 L;  4FWN A;  1KXP A;  1QSL A;  5AQM A;  4CEA A;  3VQP A;  4HVJ A;  1B9F A;  5E41 A;  1NJW A;  5KGW A;  4BGA A;  3BZK A;  4C8K A;  4ISF A;  4XEI A;  4CHN A;  3ZCM A;  2IDO A;  1G99 A;  3MXJ A;  3ZX0 A;  2E6L A;  3JSM A;  4DV4 K;  1WSI A;  4EZ6 A;  1RDW X;  4IKF A;  3CQY A;  2W41 A;  4JI4 K;  1YVU A;  2V52 B;  3A5O C;  5FRM A;  4CFC A;  4CFA A;  3WT0 A;  1HNI A;  4NXM K;  4BQZ A;  1K73 O;  4CF8 A;  5F0X A;  1KFS A;  2E4L A;  3KIO A;  4FLX A;  4AHC A;  3MED A;  3AVB A;  1VQ8 N;  2KKZ A;  4KAZ A;  4BVO A;  5DM7 L;  1O13 A;  1TYQ A;  3J8A A;  3P5J A;  1XQS C;  1N34 K;  5D3G A;  4FJK A;  4GKJ K;  1Z05 A;  3M8P A;  1BHL A;  4MO4 A;  1HNW K;  1OH6 A;  3FLC O;  1N33 K;  3VGL A;  3MCA B;  1N36 K;  5CYQ A;  5EXW A;  4E7H A;  2O8E A;  4CCH A;  1SL2 A;  5CY4 A;  1RCH A;  3OBY A;  1RT4 A;  3ZX2 A;  3OY9 A;  2HNZ A;  1NMN A;  2A41 A;  3R9P A;  1RBV A;  3L2W A;  2NNW A;  3AVI A;  3D7E O;  4M7X A;  2BTF A;  3CXC M;  1NK5 A;  3AVG A;  4JI2 K;  4CJP A;  1Q9Y A;  4B3T K;  2E2N A;  4BG9 A;  1NGI A;  4NYN A;  2E2Q A;  3KLE A;  4N56 A;  4FLZ A;  2O8C A;  2FBV A;  3H1V X;  1HJR A;  1KTQ A;  3T69 A;  4N5S A;  3KTQ A;  2P9L B;  4B3O A;  3LL3 A;  1L3T A;  2QXF A;  3SQ0 A;  2KTQ A;  1NK0 A;  2LSN A;  1WAJ A;  4Z0U A;  1ATR A;  4RCH A;  3TAP A;  4KI6 A;  3PX6 A;  4CJS A;  3HVR A;  1QHT A;  2YHB A;  2ETJ A;  3VES A;  4FWQ A;  3OW2 M;  4O5F A;  5AQV A;  3G6E N;  4BRM A;  4B9N A;  1CZB A;  1HYS A;  4FJ9 A;  1S22 A;  4MLH A;  3U9D A;  2NRT A;  1BG3 A;  4MLE A;  4JI1 K;  4ILH A;  2V7Y A;  1SKS A;  1IKY A;  5H1S Q;  2O8B B;  1JXB A;  4JD2 A;  3GBT A;  3HP9 A;  3O4W A;  4DV2 K;  4JHD B;  2Z1I A;  3HOT A;  5KRS A;  4BR5 A;  1HPZ A;  3FFI A;  3O1W A;  4M3Y A;  3CPW M;  3ZEU B;  3CCJ N;  1T8E A;  1FKO A;  3LAK A;  3SUN A;  1U2V A;  2OPQ A;  3VOV A;  3O6W A;  3NE6 A;  1FKP A;  3CCL N;  4KHP K;  4LF8 K;  3K2P A;  3KKR A;  5HL7 L;  3OTO K;  3LDO A;  1NGH A;  3ITH A;  4WQ5 C;  1LWE A;  2HND A;  3L3U A;  1VSI A;  4H0V B;  2E5L K;  1OH8 A;  4CI6 A;  3NVK A;  2W40 A;  3RMC A;  4DFK A;  3KLG A;  3MWP A;  3LDS A;  3LP1 A;  3LPT A;  4DSE A;  1JL2 A;  3H08 A;  3L8B A;  4MO5 A;  4I2Q A;  4CEE A;  4OPJ A;  4CHO A;  3HK2 A;  1BCM A;  3QER A;  1LCU A;  1RTH A;  3DM2 A;  4I6M B;  4J2D A;  2W42 A;  2HVH A;  1MDU B;  1TUY A;  3NGY A;  1S3X A;  2CGJ A;  4NLC A;  4M7Y A;  2FBX A;  4Z4F A;  4FWK A;  2KZM A;  4BVP A;  4JRQ A;  1VQ9 N;  3HZ6 A;  3TTD A;  4Z4E A;  4MDA A;  2P9S A;  4QAG A;  3OYC A;  2GUP A;  1TYQ B;  1IV0 A;  4E89 A;  1RTD A;  3VQA A;  1KRP A;  3QBW A;  4F8R A;  4AM7 A;  4KO0 A;  4H5V A;  3O3G A;  1HKG A;  4BRO A;  1RBT A;  4DKW A;  3AO1 A;  4IWV A;  5DM6 L;  2FBY A;  4FLY A;  2WFB A;  5GAE P;  1IBK K;  3I8D A;  4DR4 K;  1KVA A;  4YHH K;  1HKC A;  4CGG A;  1V4T A;  3R3L A;  3KJV A;  1D9D A;  3OA9 A;  4JI8 K;  4BRK A;  5AQY A;  3A5L C;  4LF6 K;  3HJF A;  3M3Z A;  1U04 A;  3ULE A;  2XO7 A;  3MMV A;  4E1M A;  1XC9 A;  3HTV A;  2PAV A;  3ZT0 A;  1ASU A;  2HW3 A;  1WN7 A;  3L2Q A;  4XH4 A;  1U4B A;  3Q7B A;  3SCX A;  5HLF A;  2YHA A;  3LP3 A;  2HMP A;  4CEF A;  2WC9 A;  4BRC A;  4DV7 K;  4GNI A;  4JS5 A;  3MEG A;  3BZC A;  3DLR A;  1QHA A;  3Q7C A;  4CGI A;  1NJZ A;  3L2R A;  3HM8 A;  5AQJ A;  2UUC K;  1JCE A;  2P9P B;  1N5Y A;  3ENH A;  4DR5 K;  4CER A;  4DSI A;  5JMV A;  1J5O A;  1TK0 A;  5LJV A;  4BWJ A;  3RSE A;  4A5B A;  2O4G A;  3L3V A;  3P38 A;  3O9T A;  4B9S A;  1SUQ A;  2F7T A;  3AAQ A;  1VSE A;  4FLT A;  1RTJ A;  2HMI A;  3SNN A;  1YJ9 N;  5EU7 A;  1Z26 A;  2YX6 A;  4GV3 A;  3AA5 X;  3A0I X;  4IG3 A;  2G8V A;  1ZYQ A;  4A62 A;  4H0Y B;  3DYA A;  2B5J A;  1X9J A;  2YNG A;  2QWR A;  4Z4H A;  2QEX N;  4CGD A;  3BDP A;  4DR3 K;  5AQT A;  1U2V B;  2ZE2 A;  1QTM A;  2P9I A;  4LH5 A;  3DAW A;  4B9T A;  1QQO A;  5J2M A;  1P90 A;  3RMA A;  2E8A A;  3ZSO A;  1QVF M;  3IFR A;  3ID8 A;  1YAG A;  3M5R A;  2AA4 A;  2YKM A;  3GE1 A;  3VF2 A;  4FLV A;  1C0G A;  5FDL A;  3SBG A;  4DSF A;  4BWM A;  3O5B A;  3H46 O;  1WBB A;  3O9S A;  3LDL A;  3MN6 A;  4BC2 A;  4DR1 K;  2BAN A;  3TSP A;  4G1Q A;  1RGI A;  3LPU A;  1FK9 A;  1X1P A;  3VEN A;  4B9V A;  2V51 B;  4C23 A;  1NGG A;  2Z1H A;  4E3S A;  3SMP A;  1CLQ A;  1WOQ A;  4FCY A;  3VQ6 A;  3EEQ A;  2ZGZ A;  3VQ8 A;  1DEJ A;  1EET A;  3KD1 E;  3OYF A;  3SK3 A;  1VSF A;  1HNV A;  4FOI A;  3HO1 A;  5M1P A;  2YJF A;  2ZM6 K;  1IKW A;  4I9L A;  3HXM A;  1K8K A;  2OZM A;  4FVU A;  1S1X A;  5BN8 A;  3OYK A;  4UY8 O;  1LWF A;  4IFV A;  4JKE A;  4CZF A;  3M8S A;  5C24 A;  1KCF A;  2JWK A;  3DI6 A;  4CJ7 A;  2GEL A;  2F96 A;  2E2O A;  1KFD A;  3VEY A;  3CJ7 A;  4B9L A;  1HYZ A;  3AVF A;  4A2B A;  3A5M C;  3QEV A;  3CCS N;  2V7Z A;  3ASM A;  1Q82 O;  1EKE A;  1YIT N;  2EX3 A;  1YTU A;  2WON A;  2E88 A;  3BGR A;  1Q8I A;  3BF3 A;  4DFJ A;  2FC0 A;  4PL8 A;  4DR7 K;  3D45 A;  3SMS A;  1U47 A;  1MA9 B;  3A2F A;  4HHT A;  4CBX A;  5CR4 A;  4XH1 A;  4GW6 A;  4JK7 A;  2B4J A;  3V9S A;  2ITG A;  3RTV A;  1YHQ N;  4FYD A;  2HHW A;  3QEW A;  1HMV A;  2GV9 A;  4XIU A;  4CZE A;  3IKM A;  1WSF A;  1T6C A;  4IDK A;  1SL0 A;  4KB0 A;  1UOC A;  1NM1 A;  4CZG A;  4DR2 K;  4CEC A;  4DV0 K;  3R1X A;  4PL7 A;  4FVM A;  3FZH A;  3EZW A;  1DTT A;  4KHU A;  3PIO L;  4BR9 A;  1I3A A;  4KHY A;  4W5O A;  4OPK A;  2E20 A;  4BAC A;  3ZT1 A;  1QZ5 A;  1S6P A;  5HBM A;  4JKC A;  3VA3 A;  4FJM A;  3SLC A;  3RR7 A;  5CZ2 A;  2KFN A;  4IOA L;  2FF6 A;  2FSN A;  1VSH A;  4KB1 A;  1YXQ A;  2P9I B;  4X66 K;  4B3S K;  4M3X A;  3WNF A;  4TSX A;  2IVO A;  3CER A;  3HI0 A;  4DTS A;  1P8Z A;  5AJ3 K;  3LAM A;  3V1R A;  4BQL A;  1W7A A;  1NGD A;  1CZA N;  3K5O A;  3AVL A;  1NKC A;  1X3N A;  3TAR A;  4DU3 A;  1DLO A;  4X62 K;  5GAH P;  4H0T B;  1BQM A;  3O1B A;  4HCC A;  1ZXO A;  2JWL A;  3DJC A;  2HNY A;  4DTX A;  4E7I A;  4C1N K;  4CEO A;  2D0B A;  1TKD A;  2RE2 A;  3O3H A;  3QB0 A;  2P9L A;  1IKX A;  1J5E K;  3CET A;  3AVH A;  2D0P A;  4BRG A;  4F3T A;  3U8X A;  4DF4 A;  4EIA A;  2WTU A;  4JKG A;  3TTF A;  4B1V A;  4HTL A;  1GLC G;  3SAH A;  3ENB A;  2P9U B;  4IXC A;  1NK6 A;  3WUH A;  3CFP A;  2G8U A;  3C6H A;  4JI7 K;  4KHQ A;  1RDA A;  1T6D A;  3QFU A;  2RHK A;  4DQQ A;  1ZBI A;  4QCL A;  1A5V A;  4CK1 A;  2NUB A;  4I2P A;  2NLX A;  4OLA A;  4H0O A;  3O8M A;  3OYH A;  3ZLJ A;  1VQO N;  3QET A;  3VQC A;  3VN5 A;  1JLQ A;  3CJB A;  3KK7 A;  4CK2 A;  1VQ7 N;  2NRZ A;  4B1W B;  2RPI A;  4FO0 A;  5TKY A;  2O8B A;  2BUP A;  4ID1 A;  4H03 B;  1A5W A;  3H3O B;  2A3Z A;  4JHD A;  4DTU A;  3HM9 A;  3ZEU A;  3TU5 A;  5E26 A;  1NK7 A;  4H8K A;  3LDP A;  2DFE A;  1KAZ A;  1EWQ A;  2ZD1 A;  1RT6 A;  4O44 A;  2D1K A;  3C95 A;  3CME N;  4CW7 B;  3PO4 A;  3GDQ A;  3L6Q A;  3VF4 A;  4FJX A;  4AHS A;  1IO2 A;  1KAX A;  4FJ8 A;  3CFO A;  4KTZ A;  4YOR A;  1RIL A;  4FWL A;  3G25 A;  3NF6 A;  4DUZ K;  2HHX A;  2DY4 A;  1JJ2 M;  3ID6 A;  1ESV A;  1T3V A;  4HWI A;  5FRO A;  4CD1 A;  4CHY A;  4M3Z A;  5AQK A;  4I6M A;  3QEX A;  2DTU A;  3B6P A;  3NGZ A;  1B92 A;  3VQQ A;  2ASP A;  2D0O A;  3IDH A;  3SQ1 A;  3M8Q A;  4OLB A;  1JCG A;  1TKZ A;  2AP1 A;  1UAX A;  4ILJ A;  4DS5 A;  1HLU A;  4BE0 A;  2FF3 B;  4M63 C;  2PBD A;  3IS9 A;  4CJL A;  4EZ9 A;  3CM6 A;  3NH0 A;  3U3Y A;  5BN9 A;  4N47 A;  3K58 A;  3BP8 A;  4B1X B;  2QWL A;  4MQ3 A;  4DV1 K;  4Q0B A;  1N32 K;  4F4K A;  3CCV N;  3VQB A;  1WNS A;  5C2F A;  4KH5 A;  4PHT X;  2ZJQ L;  5F1X A;  1D8Y A;  4I9Q A;  4J2A A;  2D4W A;  1UA0 A;  1SKW A;  1JLB A;  3DRR A;  3DOK A;  2WBN A;  4LFB K;  3DXK B;  4PKH A;  1JLE A;  1L3U A;  4Z4I A;  4F3O A;  1EX4 A;  1MWK A;  1BCO A;  4UQG A;  3SAG A;  4JKA A;  3OVN A;  4RW9 A;  4JKD A;  3CYM A;  2FXU A;  4FK0 A;  3DLG A;  4LFC K;  1HNX K;  4AM6 A;  3VQ4 A;  4A5A A;  1L3S A;  2KFZ A;  3KLF A;  4JKG B;  4AIL C;  1S1U A;  1QVG M;  4ICL A;  4ZHR A;  3MCP A;  5BR8 K;  4W5N A;  3DMJ A;  2HBM A;  2P9P A;  3AGK A;  4WFB L;  3L0Q A;  2W6K A;  4ELV A;  3E66 A;  3EY1 A;  4CHP A;  3RRH A;  1EXQ A;  2IC3 A;  2QWP A;  4BRF A;  4NCB A;  4FOE A;  4DUY K;  3TAB A;  5C12 A;  4DQS A;  3SPZ A;  3S41 A;  4E19 A;  1C1C A;  3CC7 N;  1CXU A;  2GEM A;  3AVN A;  4CGH A;  3EYZ A;  3NVM A;  4A59 A;  4EP4 A;  3FGU A; 
#chains in the Genus database with same CATH homology
 4M45 A;  4DSI A;  3OYE A;  4LY7 A;  1J5O A;  3OYA A;  3G10 A;  4CIE A;  4BDY A;  2A1R A;  4N41 A;  1TK0 A;  3LP2 A;  1LV5 A;  4BWJ A;  3NFA A;  1BI4 B;  2O4G A;  1KSP A;  3BDP A;  4FJJ A;  1KVC A;  3L3V A;  5HP1 A;  4FW1 A;  4DWI A;  1KVB A;  3HP6 A;  4B9S A;  2B6A A;  1SUQ A;  1A5X A;  3V6D A;  1VSE A;  1T05 A;  3NF9 A;  3PUF A;  4ID5 A;  3SJJ A;  4O4G A;  4FLT A;  1RTJ A;  3S3O A;  1XI1 A;  2HMI A;  3ZSY A;  3SNN A;  4M42 A;  1RNH A;  3F9K A;  5EU7 A;  1Z26 A;  4OKJ A;  3D0P A;  4KHW A;  3AA5 X;  4CGJ A;  4IG3 A;  3PY8 A;  4JLH A;  2G8V A;  3DOL A;  1ZYQ A;  1L5U A;  1TGO A;  3DYA A;  1JKH A;  2HHQ A;  2B5J A;  4YFU A;  4FJG A;  3JYT A;  2F8T A;  1RT5 A;  2G8H A;  2YNG A;  2PY5 A;  4QOZ B;  5KTQ A;  4E0D A;  4Z4H A;  4CGD A;  4W5R A;  3EZ5 A;  3ZT3 A;  3PV8 A;  3U6F A;  4O0I A;  3HST B;  1LAV A;  1FXX A;  4C8M A;  3TR8 A;  3NCI A;  3T1A A;  3LZI A;  1ZBU A;  3OYG A;  2ZE2 A;  3T3F A;  4PY5 A;  4HUG A;  1QTM A;  3CQ8 A;  2GBZ A;  4LH5 A;  4LD0 A;  4CJ5 A;  5SZT A;  3THV A;  4B9T A;  5J2M A;  1C0U A;  4O55 A;  1ITG A;  1HYV A;  4FM2 A;  3AO3 A;  3RMA A;  3ZSO A;  1TL1 A;  3OS0 A;  4E7J A;  4DS4 A;  3WNG A;  3V1Q A;  4KHN A;  1G15 A;  3VA0 A;  4I7F A;  5I42 A;  1XHX A;  4KTW A;  2YKM A;  1WSH A;  4CJE A;  4FLV A;  3DLE A;  3MEE A;  5FDL A;  4B8A B;  3P83 D;  3KK2 A;  4DSF A;  4DSL A;  4BWM A;  4AHU A;  5J1E A;  4FW2 A;  2BDP A;  4JRP A;  3IAY A;  5CZ1 A;  3M8R A;  5J2Q A;  2HHU A;  3QIO A;  3ULD A;  2YNF A;  1JL1 A;  4YNQ A;  3VQD A;  4CJK A;  4FJH A;  3TAG A;  4B08 A;  3O4N A;  1HRH A;  4GVM A;  3HPG A;  3I0R A;  3LAL A;  3ZSR A;  3RMB A;  3KD5 E;  1BIZ A;  1F21 A;  2BAN A;  3NF7 A;  3QEP A;  2P5G A;  2QKK A;  4G1Q A;  1C0T A;  3LPU A;  4KHS A;  4B8C A;  1FK9 A;  1YT3 A;  3OYN A;  1T7P A;  1X1P A;  3NDK A;  4CHQ A;  1CZ9 A;  4B9V A;  1VSJ A;  1C6V A;  1LAW A;  3QLH A;  3NHG A;  2JGU A;  3KK3 A;  1TKT A;  2Z1H A;  4E3S A;  2X6N A;  1NK4 A;  1CLQ A;  3ZSV A;  4RG8 A;  4FCY A;  3VQ6 A;  4DTO A;  3SUP A;  3VQ8 A;  1KLN A;  2HB5 A;  1EET A;  4DTM A;  3KD1 E;  3LZJ A;  4KV8 A;  1NJX A;  2D0A A;  4E7K A;  3MXM A;  1U45 A;  1T03 A;  4CEQ A;  4DQR A;  4B9U A;  4Z4G A;  3OYF A;  3HVT A;  3PX0 A;  2XY7 A;  4ZTJ A;  3KK1 A;  1VSF A;  4Z4C A;  2Y1I A;  1HNV A;  4PUO A;  3K59 A;  5K14 A;  1C1A A;  4DFP A;  3HO1 A;  4CJU A;  1GOA A;  3E01 A;  3AO2 A;  2PYL A;  1TAQ A;  5KRT A;  3ZT4 A;  1JXE A;  1IKW A;  3QIN A;  5CYM A;  3PX4 A;  4I9L A;  3HXM A;  1GOC A;  4DMN A;  2OZM A;  1S1X A;  3OYK A;  1TVR A;  2IOC A;  3AO4 A;  3AVA A;  1LWF A;  2IGI A;  2VG6 A;  2OYQ A;  2P51 A;  4IFV A;  1NOZ A;  4H4O A;  5DMR A;  3M8S A;  2RF2 A;  4IFY A;  5C24 A;  1KCF A;  1QSY A;  4FZX C;  3DI6 A;  4FZY A;  1ZBF A;  4CJQ A;  3KKS A;  1XHZ A;  4KRE A;  1L3V A;  4GMJ B;  2F96 A;  1KFD A;  4BDP A;  1NK8 A;  4CGF A;  2WOM A;  4B9L A;  1HYZ A;  3AVF A;  2FBT A;  3QEV A;  2XY5 A;  2G8W A;  1VK0 A;  3TAM A;  3HPH A;  2KW4 A;  3ZSZ A;  5KGX A;  3AA2 A;  4C8N A;  3L2V A;  4KPY A;  2QKB A;  3ASM A;  3HPO A;  1EKE A;  2EX3 A;  1SV5 A;  1O1W A;  3VQE A;  3NH2 A;  1YTU A;  2BGG A;  4WE1 A;  4OGC A;  2WON A;  1UWB A;  3BGR A;  3HYF A;  1Q8I A;  2D0C A;  4BE1 A;  4DFJ A;  2FC0 A;  4CK3 A;  2YKN A;  3SPY A;  3O3F A;  3OJU A;  5HRN A;  4OJR A;  4RW7 A;  2RN2 A;  3D45 A;  1U47 A;  3A2F A;  4K8X A;  4CHZ A;  2HHV A;  4HHT A;  1JLF A;  4E1N A;  3QEI A;  5J2P A;  4PQU A;  4GW6 A;  3ZSQ A;  2B4J A;  3V9S A;  2ITG A;  2VWJ A;  3OS2 A;  3RTV A;  4FYD A;  1RDC A;  2Y1J A;  2HHW A;  3K57 A;  3V9U A;  3QEW A;  1HMV A;  2GV9 A;  4FJN A;  1SKR A;  4XIU A;  4RW4 A;  1WSF A;  4OGE A;  4DU4 A;  4FJI A;  3G0Z A;  4IDK A;  3T19 A;  1SL0 A;  1WSG A;  2IAJ A;  5I3U A;  3MXI A;  3PO5 A;  4KB0 A;  1UOC A;  3C6T A;  1RDD A;  4CEC A;  3QNN A;  4ZTF A;  4W5Q A;  4PWD A;  4KFB A;  5C42 A;  1TKX A;  3RR8 A;  4RW6 A;  4FVM A;  1QSL A;  1C1B A;  1RT7 A;  1ASW A;  4CEA A;  3SYZ A;  3MEC A;  3VQP A;  3DLB A;  1X9S A;  5HRR A;  3DLH A;  1GOB A;  1D5A A;  1DTT A;  1JLG A;  4KHU A;  4HVJ A;  1B9F A;  2Z1J A;  4M3R A;  5E41 A;  5KGW A;  1NJW A;  4C8K A;  2AJQ A;  1I3A A;  4KHY A;  2DFH A;  4CHN A;  3ZSW A;  3OYD A;  4W5O A;  3ZCM A;  4OPK A;  2IDO A;  3NAE A;  4FM1 A;  2O4I A;  4BAC A;  4BE2 A;  3AO5 A;  3MXJ A;  3ZT1 A;  4W5T A;  3MAQ A;  2RKI A;  1S6P A;  5HBM A;  2E6L A;  3VA3 A;  2HHT A;  3JSM A;  1EP4 A;  4FJM A;  2ATQ A;  1WSI A;  3CM5 A;  4EZ6 A;  4AHV A;  3TAE A;  3RR7 A;  4IKF A;  4RW8 A;  5CZ2 A;  3IRX A;  2KFN A;  4FM0 A;  2G8F A;  1YVU A;  2I5J A;  1HQE A;  4DTN A;  1VSH A;  3SV3 A;  3S3N A;  5FRM A;  4LSL A;  4CFC A;  4KB1 A;  1N6Q A;  2KZZ A;  3DRS A;  4CFA A;  1U48 A;  4DSJ A;  1LW2 A;  4KKO A;  1HNI A;  4TSX A;  4Y1D A;  3WNF A;  4M3X A;  4CF8 A;  2G8K A;  1S1T A;  3QO9 A;  1NK9 A;  3L2U A;  1Z25 A;  1KFS A;  2E4L A;  3KIO A;  4FLX A;  4CFD A;  4NYF A;  4AHC A;  3MED A;  1ASV A;  3AVB A;  4DTS A;  4DTP A;  1NKB A;  1DTQ A;  1TL3 A;  2XRI A;  3LAM A;  4KAZ A;  3V1R A;  3AVK A;  5SWM A;  3P5J A;  1VSM A;  4HUF A;  5D3G A;  3K5O A;  3WNH A;  3AVL A;  3NGI A;  4OKK A;  1NKC A;  1TV6 A;  4FJK A;  4J2B A;  1S6Q A;  4OKE A;  3M8P A;  3VQ5 A;  3TAR A;  2QK9 A;  1BHL A;  1WLJ A;  4K8Z A;  4DU3 A;  1DLO A;  3NH1 A;  3LWL A;  2R7Y A;  2OA8 A;  2XY6 A;  1BQM A;  5CYQ A;  4E7H A;  4FZZ A;  4DG1 A;  1J53 A;  4HCC A;  2OPR A;  4CCH A;  3OYJ A;  1SL2 A;  3SUQ A;  5CY4 A;  3VQ7 A;  1REV A;  4E7L A;  2P1J A;  1RCH A;  3ZSX A;  2HNY A;  1UA1 A;  2VG5 A;  3SI6 A;  1RT4 A;  4DTX A;  4CJV A;  4E7I A;  3TAQ A;  3UIQ A;  4CEO A;  2HNZ A;  2D0B A;  4CJR A;  3OY9 A;  3KLH A;  1TKD A;  2KQ2 A;  3O3H A;  3SQ4 A;  1IKX A;  1VSK A;  3K5N A;  1B9D A;  1RBV A;  1NKE A;  3P1G A;  3V81 A;  4M3T A;  3L2W A;  1D9F A;  3AVI A;  2VWK A;  3AVH A;  1BIS A;  1TK5 A;  4F3T A;  4FLW A;  1NK5 A;  3AVG A;  4M3W A;  4CEZ A;  4DF4 A;  4H4M A;  4CJP A;  1Q9Y A;  4FXD A;  4CF9 A;  4ELU A;  4NYN A;  3KLE A;  4N56 A;  4FLZ A;  2FBV A;  1NK6 A;  3CFP A;  1HJR A;  1KTQ A;  2G8U A;  4N5S A;  3ALY A;  3KTQ A;  4DLG A;  1RDA A;  1NJY A;  4KHQ A;  3NBP A;  3OS1 A;  2HVI A;  5JS2 A;  4HTU A;  2X6S A;  4DQQ A;  2ZQB A;  4DF8 A;  5FRN A;  1L3T A;  2QXF A;  1ZBI A;  1A5V A;  4B3O A;  4QCL A;  3SQ0 A;  2KTQ A;  1C0M A;  3OYM A;  4CK1 A;  4IG0 A;  2NUB A;  3OYI A;  1NK0 A;  2LSN A;  1VSL A;  4I2P A;  3QNO A;  4DFM A;  3S9H A;  1BQN A;  4CEB A;  4Q5V A;  1X9W A;  1SL1 A;  1WAJ A;  3DLK A;  1U49 A;  2F8S A;  4OLA A;  4CJW A;  4C8L A;  1W9H A;  3OYH A;  4Z0U A;  1ZBH A;  3QET A;  3VQC A;  1S9G A;  3AA3 A;  3VN5 A;  1NOY A;  1IH7 A;  1RT3 A;  1JLQ A;  3LP0 A;  4FLU A;  3TAP A;  4CK2 A;  4O0J A;  4KI6 A;  3PX6 A;  4CJS A;  4R5P A;  2XHB A;  2RPI A;  3HVR A;  1RT1 A;  1QHT A;  2YHB A;  4CED A;  1X9M A;  2ETJ A;  3TI0 A;  4CJF A;  4ID1 A;  4CF0 A;  1A5W A;  4EP5 A;  4CFB A;  4KTQ A;  3QES A;  2OPS A;  3V4I A;  4B9N A;  3I0S A;  1CZB A;  4CIF A;  4DTR A;  4FJ9 A;  1HYS A;  4DTU A;  3SQ2 A;  3LWM A;  1W0H A;  4B9M A;  1S5J A;  3HM9 A;  1CXQ A;  5J2N A;  4PA1 A;  3SUO A;  1NK7 A;  3V9X A;  4DQI A;  4LH4 A;  5DK5 A;  4H8K A;  4FJL A;  3AA4 A;  1SKS A;  1LW0 A;  1IKY A;  2DFE A;  2YNI A;  2Z1G A;  1JXB A;  3AVC A;  1WSE A;  2ZD1 A;  3HP9 A;  4CJT A;  4DLE A;  1RT6 A;  4M41 A;  4N76 A;  4FK4 A;  2Z1I A;  2X74 A;  4O44 A;  5KRS A;  4DU1 A;  1XWL A;  3C95 A;  1HPZ A;  3FFI A;  4C8O A;  4M3Y A;  3PO4 A;  2YNH A;  3LAN A;  5HRP A;  4FJX A;  1Y97 A;  1T8E A;  2IS3 A;  1R0A A;  1FKO A;  1IO2 A;  4AHS A;  3LAK A;  3TAN A;  3SUN A;  2OPP A;  2OPQ A;  3CG7 A;  4FJ8 A;  1RTI A;  1TAU A;  3NE6 A;  3CFO A;  2PYJ A;  1FKP A;  3CFR A;  4KTZ A;  3K5L A;  1RIL A;  2EHG A;  3K2P A;  3KKR A;  3NF6 A;  4F2R A;  3AVM A;  2E6M A;  2HHX A;  2DY4 A;  3ITH A;  5FRO A;  2JLE A;  1LWE A;  2HND A;  4CHY A;  4M3Z A;  4CES A;  2G8I A;  1LWC A;  2DFF A;  3L3U A;  1VSI A;  4CF2 A;  4HUE A;  3QEX A;  2DTU A;  2X78 A;  3B6P A;  4O5B A;  5T7B A;  3K5M A;  4DSK A;  3NGZ A;  1B92 A;  3VQQ A;  3VQ9 A;  1QS4 A;  3RMC A;  5C25 A;  3SQ1 A;  3M8Q A;  4OLB A;  4DFK A;  1RBR A;  3KLG A;  4NCG A;  3LDS A;  3LP1 A;  1IG9 A;  1J9A A;  1TKZ A;  3LPT A;  1UAX A;  1JL2 A;  3DRP A;  3H08 A;  5KI6 A;  4DSE A;  4KRF A;  4DS5 A;  3L8B A;  3C94 A;  2XY8 A;  1RDB A;  4I2Q A;  1K6Y A;  4CEE A;  4OPJ A;  4BE0 A;  3SV4 A;  4Y1C A;  4CHO A;  3IS9 A;  4CJL A;  3HK2 A;  1BCM A;  3QER A;  1RTH A;  4EZ9 A;  3DM2 A;  3CM6 A;  4J2D A;  3NH0 A;  2W42 A;  4HCB A;  3U3Y A;  2HVH A;  3F73 A;  1S1W A;  2Q3S A;  3NGY A;  4J2E A;  3AVJ A;  4Z4F A;  2FBX A;  3ISN C;  4N47 A;  3K58 A;  4JRQ A;  2KZM A;  4Z4E A;  1TK8 A;  4FJ5 A;  4DTJ A;  4CJ4 A;  1MU2 A;  4MQ3 A;  4QAG A;  4Q0B A;  4BDZ A;  3OYC A;  4F4K A;  1VRU A;  1HQU A;  1WNS A;  3VQB A;  4AH9 A;  4E89 A;  1RTD A;  3VQA A;  1KRP A;  4FK2 A;  1D8Y A;  4F8R A;  5HRO A;  1RBS A;  3V1O A;  4I9Q A;  4J2A A;  4KO0 A;  3B6O A;  3NF8 A;  3U3G A;  3O3G A;  1UA0 A;  1RBT A;  3O4Q A;  3OYB A;  1JLB A;  1RBU A;  3DRR A;  1SKW A;  3AO1 A;  3DOK A;  1QSS A;  3RRG A;  2FBY A;  4FLY A;  1J54 A;  1JLA A;  1JLE A;  1L3U A;  4Z4I A;  4AHT A;  1QE1 A;  1EX4 A;  3WNE A;  1WSJ A;  1WAF A;  1BCO A;  3QIP A;  3I8D A;  3TWH A;  4F3O A;  4UQG A;  4KI4 A;  1Q9X A;  1KVA A;  2PZS A;  4CGG A;  3OJS A;  3OVN A;  4RW9 A;  2GUI A;  3CYM A;  1QQC A;  3KJV A;  1D9D A;  1VRT A;  2OZS A;  1BIU A;  4FK0 A;  3DLG A;  3ZT2 A;  4NCA A;  4LSN A;  1VSD A;  2A1S A;  4OVL A;  1KLM A;  3C6U A;  4CIG A;  2P5O A;  3VQ4 A;  3HJF A;  4CE9 A;  1ZBL A;  1L3S A;  3OYL A;  2HHS A;  1U04 A;  4F2S A;  3V9Z A;  2KFZ A;  3KLF A;  2XO7 A;  4E1M A;  4AIL C;  3KLI A;  3HT3 A;  1XC9 A;  1RT2 A;  1S1U A;  3RWU A;  3S3M A;  4ICL A;  4MFB A;  3IG1 A;  3ZT0 A;  1ASU A;  4ZHR A;  3V9W A;  3RMD A;  4L8R B;  2HW3 A;  3DMJ A;  4W5N A;  1WN7 A;  3L2Q A;  1IKV A;  3HL8 A;  1YTA A;  1U4B A;  4ELV A;  2BE2 A;  3AV9 A;  3SCX A;  3EY1 A;  5HLF A;  2YHA A;  4JS4 A;  3LP3 A;  4ELT A;  4CHP A;  4CEF A;  3RRH A;  1BL3 A;  1EXQ A;  1I39 A;  2IC3 A;  5HRS A;  4CF1 A;  4JS5 A;  4NCB A;  3MEG A;  1BGX T;  2YV0 X;  3DLR A;  3TAF A;  1BI4 A;  1S9E A;  4CGI A;  3TAB A;  1NJZ A;  3SZ2 A;  1JLC A;  4DQS A;  2VG7 A;  4E19 A;  3L2R A;  3SPZ A;  1C1C A;  4FJ7 A;  5JS1 A;  4IBN A;  4DQP A;  4M3U A;  1S1V A;  4AHR A;  1CXU A;  2D5R A;  3AVN A;  4CGH A;  3EYZ A;  1N5Y A;  4CJ3 A;  4EP4 A;  4CER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...