3AVIA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aviA00
4M45A 3BDPA 4CIGA 4CEQA 1EP4A 2OZMA 4FLZA 3LPTA 1S1XA 3O3GA 2YHAA 3CFPA 1XHZA 3QNOA 1HNVA 3OY9A 2F8SA 4RW9A 3VQAA 1WSIA 1ASUA 1T03A 3LZIA 3JYTA 4DSKA 4CJEA 3S3OA 4NYFA 2RF2A 4FK0A 3IRXA 1CLQA 4CEFA 3V9WA 4AHRA 4C8KA 3P5JA 2RN2A 4FJIA 5KGWA 4AH9A 1S1TA 4CJWA 2WOMA 2XY6A 3F73A 3O4QA 1JLFA 4N5SA 4RW8A 3DMJA 1KCFA 3SUOA 1N6QA 3ASMA 3M8PA 2HHSA 3RR7A 4JLHA 2VG5A 3L2WA 1KRPA 3LZJA 1N5YA 2QK9A 4FK2A 3EZ5A 4E7IA 3S3NA 4E0DA 1C6VA 4CCHA 3OYKA 3MXIA 3MXJA 4LH5A 3LPUA 4KB1A 2A1SA 2B4JA 3QEXA 4F4KA 3HVRA 4Z4IA 1GOAA 4OLBA 3TAEA 3C6UA 4CIEA 1ZBFA 4CJFA 3KK3A 2XHBA 1XC9A 1ZYQA 4J2DA 3DOLA 4FJ7A 3QINA 4KV8A 1UA1A 4CF9A 4FVMA 1L3UA 1YTAA 3TAQA 1SKRA 4OKKA 5J1EA 4BDZA 5K14A 3SPYA 4W5QA 5I42A 1LW0A 1GOCA 3V1QA 1TAQA 4CJKA 4KPYA 4FZXC 3C6TA 4BE0A 4DU3A 4FJLA 1HNIA 2RKIA 4TSXA 3RRHA 1RT7A 4PY5A 4KO0A 3OS1A 4ZTJA 1RT6A 1L3TA 4CJ3A 2X78A 1S1VA 2Z1HA 3AVGA 3NH1A 1REVA 1S6QA 3AA3A 1VSEA 3AO5A 5KTQA 4DFMA 1RT2A 2Q3SA 4LY7A 2YNHA 3MEGA 3QESA 3V6DA 5I3UA 4MFBA 3CFRA 4F2SA 4W5OA 4FM0A 4FJMA 4I9LA 4BACA 2OPPA 4IDKA 3AV9A 1HQEA 4DTUA 3PUFA 1UOCA 1BI4B 1C0UA 3ISNC 4CECA 4HTUA 4M3UA 2G8IA 4B3OA 1A5VA 2HMIA 1KVBA 3V1RA 3WNEA 3OYLA 1LWEA 2HNDA 4GMJB 3RRGA 3SUNA 1QSSA 4KHQA 5CZ1A 4KREA 1L3VA 3CM5A 1B92A 1WAFA 3PX4A 1RDCA 4JRQA 1SL1A 1TVRA 2YNGA 3KTQA 4KTQA 4W5NA 1S1WA 4DTMA 2X6SA 3TAFA 3CYMA 3LP1A 4J2EA 3OVNA 3QLHA 4H4MA 1IO2A 3TI0A 3LAKA 2G8KA 1NK0A 3QEVA 1WSGA 4M3RA 1LWFA 2ETJA 3QERA 3DLBA 4EP4A 5J2QA 3CM6A 3WNFA 3DLKA 4AHUA 4FJNA 2GUIA 2HHXA 1RNHA 3DYAA 3MEEA 5D3GA 2QKBA 1VSFA 4E7HA 3O4NA 1KTQA 1RBTA 4CEOA 4E7LA 4ICLA 3LDSA 3L8BA 4GVMA 3KJVA 5DK5A 2YNIA 1YTUA 1QS4A 4DG1A 3DLHA 1RT5A 2XY7A 3VQ9A 4L8RB 4KI6A 3B6OA 4M3ZA 1C1BA 3AVNA 5FROA 2PY5A 2OZSA 2GV9A 3VQEA 3RMBA 2W42A 1RBRA 5HRRA 2VG7A 3VN5A 3ALYA 1F21A 1RCHA 3LP0A 4DTOA 4OGCA 1RDAA 3DRRA 3VQ4A 3SQ1A 4Z4HA 4JRPA 4C8LA 2P51A 3EY1A 3ZCMA 3SV4A 4B08A 3SI6A 2IOCA 1RTHA 4F3TA 4DFKA 2YV0X 4CEAA 1UA0A 4F8RA 3CFOA 3NF6A 2VWJA 5JS1A 4ELUA 2HNZA 4DF4A 1NJZA 4M3TA 2HVHA 4FLVA 3WNHA 2Z1JA 3AVBA 1S9EA 4BWMA 1ZBUA 1Z26A 4F3OA 5SZTA 4DTJA 4R5PA 2KW4A 4H4OA 3AO1A 3JSMA 2BGGA 4FW1A 1ZBIA 1BIUA 1CXQA 1JLCA 3L2QA 1ASVA 1JLGA 1KFDA 4BDYA 4KRFA 3ZSOA 4O0JA 4CJLA 4BE1A 2OYQA 1XWLA 4CIFA 4E1NA 2QXFA 4DMNA 4CJ4A 1BHLA 1BL3A 4O4GA 5HROA 5J2PA 4FLUA 5HLFA 1LWCA 4DLGA 2D5RA 1Q9YA 3E01A 3LANA 4DU4A 1Z25A 3K2PA 4E7JA 3KLHA 1C0MA 1S1UA 4PA1A 4OKJA 4HUGA 2E6MA 3VQBA 4E1MA 4FM1A 1NJWA 4DQIA 2X6NA 4ID1A 4Y1CA 1O1WA 2KFZA 4B9VA 4Q5VA 1IH7A 4KHUA 2NUBA 1X9MA 3NF8A 2ZE2A 2X74A 1FK9A 3TAMA 3VA3A 3HP9A 2LSNA 1ITGA 5KRSA 4FJXA 4I9QA 4DWIA 1Q9XA 2DFFA 4DSIA 4YNQA 4M3WA 3MAQA 1QSLA 1CZ9A 1A5WA 4YFUA 1IKVA 4Z4CA 2KQ2A 1TL1A 1C1AA 1YT3A 5CY4A 2A1RA 3HVTA 4FJKA 3V4IA 1CXUA 5CYQA 3ULDA 3K59A 1FXXA 2ZQBA 3LALA 4H8KA 2IS3A 4JS5A 3VQ5A 1L5UA 1MU2A 4KHWA 2DFEA 1JLBA 3HXMA 1D9DA 4FLYA 4F2RA 1EXQA 2PYLA 1JL2A 4M41A 3ZSRA 3HM9A 4B9SA 1TK5A 3AVCA 3KKRA 3O3HA 3U3YA 3L2VA 3ZSYA 3TANA 1BISA 3NGYA 4Y1DA 3KLEA 2FBVA 2B5JA 3DI6A 1TV6A 3PO5A 1X1PA 4B9MA 1VSLA 3KK1A 3HT3A 1T7PA 3DRSA 1JL1A 3NF7A 1BCMA 3HK2A 3P1GA 3FFIA 4CF8A 2F96A 3ZSXA 2HB5A 4Z4EA 1J54A 3VA0A 3OYMA 3NGIA 3PX6A 3KLGA 1KLNA 2G8FA 4FZYA 1U4BA 3AVJA 3DLGA 4PUOA 1A5XA 4N41A 3ZT1A 4IFVA 3PV8A 4FLWA 4DFPA 4QCLA 2D0AA 4QAGA 1UAXA 4HHTA 4ELTA 2P1JA 3L3UA 5C42A 3OYGA 4I7FA 3M8SA 3U6FA 2HHTA 2Y1IA 4BE2A 3TAPA 3AVIA 4CGFA 4CESA 4CF2A 3NHGA 1NKEA 1L3SA 4BDPA 4LSLA 2PYJA 4J2BA 3NFAA 4FJJA 5DMRA 1FKPA 4M3XA 5FRMA 2IAJA 4CJTA 3G0ZA 2VG6A 3VQPA 4AILC 1QTMA 1JLAA 4HUFA 3RTVA 4XIUA 2HHWA 3LP3A 5FDLA 1QSYA 1CZBA 3OJSA 4EZ9A 4NCAA 2EHGA 3A2FA 4B8AB 4E7KA 4OLAA 4WE1A 1XHXA 4CJVA 1U48A 2JLEA 1VSHA 4FJHA 1NK6A 3K58A 4W5TA 1IKYA 1LV5A 2I5JA 1W0HA 5C25A 1J5OA 3B6PA 5SWMA 4FJ5A 1HYSA 2HHQA 3AA4A 3C94A 1RDBA 1Y97A 3M8QA 2PZSA 1HYZA 4OGEA 4CHPA 4KB0A 2E4LA 3PX0A 2QKKA 4CGJA 1VSKA 4CEZA 3T19A 4CEBA 3O3FA 1C1CA 4CFCA 4O0IA 5J2MA 3OS0A 3ZT2A 4CF1A 1I39A 2HVIA 4CHYA 1TKZA 2IC3A 1G15A 2VWKA 3SYZA 3MXMA 1NK7A 4O5BA 3HPHA 4ZHRA 3VQDA 5T7BA 1RT3A 2FBYA 3QEIA 1TAUA 2RPIA 4J2AA 2IDOA 1C0TA 4CGHA 3AVLA 4UQGA 4CE9A 1WSHA 1TK0A 3HSTB 1T05A 2AJQA 1JLQA 3VQ8A 3QETA 3KLIA 2DFHA 3OYCA 4FCYA 4CK3A 4KAZA 3K57A 3KLFA 3QIOA 2KZZA 4KHSA 4AHSA 3NH0A 1JLEA 3AVAA 3DLRA 4RW7A 4E19A 3U3GA 3AA2A 1TK8A 3SQ4A 1EETA 3M8RA 1WLJA 2Z1IA 2OPQA 3ZT4A 1TGOA 2YNFA 4FW2A 1RBSA 3K5MA 1HMVA 1ZBLA 1KSPA 4FK4A 1EKEA 4IBNA 3KIOA 4I2QA 4CEDA 4O44A 5E41A 4C8OA 3SUQA 2R7YA 1B9FA 4M3YA 3SV3A 3V9XA 3SQ2A 2ITGA 4KHNA 1SUQA 4FM2A 4DQPA 4DSJA 4M42A 2DY4A 1NK8A 1U49A 1WSFA 2D0BA 3S3MA 4IFYA 3HL8A 4DTPA 1WAJA 4Z4GA 4OKEA 3NAEA 1HPZA 1TL3A 3I0RA 4DQRA 1IG9A 2HW3A 3KKSA 4DTNA 3AVKA 4O55A 4DQQA 4KTZA 1D9FA 1LW2A 1RBUA 3VQ7A 1R0AA 1TKXA 3P83D 3ZSWA 4DF8A 3SZ2A 1WSEA 3NCIA 4NCBA 3OS2A 3NE6A 5CYMA 4AHVA 1BGXT 1S9GA 2HHVA 2DTUA 2HHUA 3THVA 2XY8A 4EZ6A 3V81A 1U47A 4CJPA 3HP6A 1UWBA 1RT4A 4IG3A 4JS4A 4DSEA 4CJUA 4FJGA 2JGUA 3WNGA 4Z4FA 3NH2A 3OYHA 1SL0A 2E6LA 4ID5A 1JXEA 3L2RA 4K8ZA 4MQ3A 1D5AA 1QQCA 2G8HA 4CEEA 1IKXA 4PQUA 3RR8A 4CJ5A 2FBXA 3K5NA 4FYDA 4DS4A 4HCCA 1WSJA 2XO7A 1HJRA 1VSMA 1VRUA 2YKMA 4DS5A 3HO1A 1GOBA 1NOZA 1S5JA 4GW6A 1I3AA 3UIQA 3C95A 4CJQA 4CGGA 3OYBA 4AHCA 5HRSA 1X9WA 3I8DA 2O4IA 3V1OA 3OYNA 2FBTA 1SKWA 3RMDA 4FZZA 4EP5A 3SUPA 5HP1A 2YKNA 3NDKA 2KTQA 1RT1A 4B9TA 4DTXA 1DLOA 4W5RA 3L3VA 2OPSA 1HYVA 4KFBA 3ZSVA 4CHQA 4C8NA 3KD1E 1LAVA 3PY8A 1VSJA 1BCOA 2WONA 2XRIA 2Z1GA 5C24A 3AVHA 4BWJA 1XI1A 2G8WA 2G8UA 4HVJA 2BDPA 4Q0BA 4DQSA 4CGIA 1VSDA 2BE2A 1D8YA 3OYIA 5FRNA 4CJSA 1Q8IA 2HNYA 3KK2A 1NKCA 1KFSA 4FLXA 1KLMA 1VSIA 3DLEA 5CZ2A 3QIPA 5KI6A 3OYFA 4DTRA 3V9SA 4Z0UA 1NOYA 2F8TA 1J9AA 4NCGA 3HJFA 3OJUA 3AO2A 1SL2A 3QO9A 1J53A 3S9HA 4FJ9A 2D0CA 5KGXA 4ELVA 3AVFA 4DSFA 3EYZA 1NK4A 4DTSA 1B9DA 1YVUA 4N47A 4CFAA 4CHZA 1IKWA 1S6PA 2XY5A 1RBVA 3NGZA 2ZD1A 3CG7A 4LD0A 4CFBA 3IS9A 4CF0A 3MEDA 3ZT0A 4FLTA 3NF9A 2P5OA 4IKFA 2O4GA 1U04A 4CFDA 4OVLA 3QEWA 4NYNA 3SJJA 3LAMA 4C8MA 3HPOA 4HCBA 3OYAA 3K5OA 4OPJA 4N56A 4RW4A 3OYDA 1BQMA 1QHTA 3DRPA 3F9KA 3V9UA 4OPKA 4KTWA 2G8VA 1DTQA 2BANA 1RTJA 4OJRA 4CHNA 1ASWA 3TR8A 1NK9A 4E89A 4LH4A 3T3FA 4LSNA 3L2UA 3SNNA 1JKHA 3QNNA 3LP2A 4DFJA 3IAYA 2P5GA 1LAWA 4KHYA 4B9NA 1RILA 3MECA 5JS2A 3D45A 4FXDA 4CK1A 2EX3A 3ZT3A 4HUEA 3TABA 4ZTFA 3TWHA 4CERA 1HQUA 4K8XA 3VQ6A 3K5LA 3AO3A 1X9SA 1SKSA 1NK5A 3AA5X 1TKTA 4CK2A 1VK0A 4KI4A 1BQNA 1EX4A 1RTDA 4CGDA 1KVCA 1W9HA 3NBPA 4G1QA 3LWLA 1NKBA 5HBMA 3QEPA 4FJ8A 3DOKA 3RMCA 1BI4A 4B9UA 1K6YA 1BIZA 3KD5E 3G10A 4RG8A 1JXBA 5HRPA 1KVAA 3CQ8A 3IG1A 1TKDA 2OPRA 3LWMA 4QOZB 2FC0A 3VQQA 5HRNA 1RTIA 4RW6A 3OYJA 1RDDA 3D0PA 2OA8A 4KKOA 1NJYA 2B6AA 1NJXA 3BGRA 1WNSA 2GBZA 5KRTA 3OYEA 1FKOA 1SV5A 4AHTA 1T8EA 3RWUA 4I2PA 4B8CA 2KFNA 1U45A 2YHBA 3ITHA 5J2NA 3V9ZA 4CJRA 2KZMA 3ZSZA 3ZSQA 3PO4A 1ZBHA 4B9LA 2IGIA 3T1AA 1HRHA 3H08A 4IG0A 2Y1JA 3SCXA 4E3SA 1DTTA 3HPGA 4DU1A 3TAGA 4DLEA 3SQ0A 3DM2A 3AO4A 3VQCA 3HYFA 4N76A 3SPZA 4CHOA 4PWDA 1QE1A 1WN7A 3I0SA 3RMAA 1VRTA 3AVMA 3TARA 5EU7A 4DSLA 2ATQA
chains in the Genus database with same CATH superfamily
5KQDA 1S1XA 3NVKA 4GV3A 3OY9A 2F8SA 1OH5A 2E2QA 4QS9A 3LZIA 4NYFA 2RF2A 2JWLA 4C8KA 2QWRA 4AHRA 3P5JA 4FJIA 5AQSA 3F73A 3O4QA 3CCUN 2O8EA 3DMJA 1KCFA 1N6QA 2E2OA 3RR7A 4JLHA 2VG5A 1KRPA 4WFBL 1N5YA 4FK2A 4E0DA 3OYKA 4UY8O 4A2AA 2B4JA 3H46O 3HVRA 4JI1K 3TAEA 2QEXN 3DJCA 5AR0A 1XC9A 2UYTA 1UA1A 4CF9A 4BDZA 4W5QA 1MWMA 1LW0A 3VEYA 4EHUA 3ULEA 4MLHA 3C6TA 2YHXA 3KVGA 4FJLA 2RKIA 3RRHA 2FF3B 3FZFA 1L3TA 2YHWA 2Z1HA 1S6QA 3QESA 1N33K 4PL8A 4LY7A 3V6DA 3QB0A 1E3MA 4F2SA 4FJMA 2H3GX 3U8XA 4FM0A 3PLAA 4JK9A 4C1NI 4YOTA 1KVBA 3OYLA 3AARA 1QSSA 1L3VA 3PX4A 2YNGA 4DTMA 2X6SA 3CYMA 1ATSA 4IWVA 4HTLA 1IO2A 2G8KA 1NWKA 3TSPA 1NK0A 3DXMB 2FSKA 3G25A 3QICA 3DLBA 3TTDA 4FVUA 4FJNA 4BRQA 2GUIA 1RNHA 3MEEA 1NJIO 3CCJN 3HOSA 3CIPA 3LDSA 4GVMA 3L8BA 5DK5A 1WBBA 3VQ9A 4L8RB 1EWRA 3ZETA 1BA0A 1O13A 3CXCM 3DWLA 1RBRA 2VG7A 3VN5A 1RDAA 4JRPA 3P38A 4IDHA 5AQQA 2IOCA 3VMFB 3G6EN 4BVOA 3CFOA 3NF6A 5JS1A 4DCHA 2HVHA 1ZBUA 4ILGB 4DTJA 2GUPA 2KW4A 1TUUA 5AZIA 4JD2A 4YY3K 1BIUA 1JLCA 3L2QA 1GLCG 4O0JA 4CJLA 4BE1A 2OYQA 3NVMA 4QS7A 2QI2A 2QXFA 4K25A 3VPZA 1BHLA 4BRKA 5HROA 5J2PA 5HLFA 1EQYA 4DLGA 2D5RA 1XMQK 1Z25A 3LL3A 1C0MA 3O5BA 1QQMA 4HUGA 3VQBA 4LFBK 4DQIA 4Q5VA 4B1YB 1X9MA 4BC3A 1GLBG 1NGFA 3VA3A 3HP9A 1ITGA 4L3QA 1VQLN 2DFFA 4DSIA 1IKVA 4Z4CA 2KQ2A 2P9IB 1YT3A 2A1RA 4FJKA 1HKCA 1YHQN 3K59A 3WXKA 4IO8A 3CMAN 1D9DA 5MLCQ 1KAYA 4B9SA 1KXPA 2V7ZA 4JKFA 1NMDA 3L2VA 3CJ1A 1NNEA 4H0VB 4B9MA 1VSLA 2P9LB 3EEQA 2UUBK 1JL1A 3HK2A 1BCMA 3FFIA 3VA0A 4FZYA 3OYMA 3AVJA 5FLXO 3VGKA 5HOOA 4HHTA 4XH5A 4I7FA 4KH6A 1T3VA 2VCPA 1BG3A 2HHTA 3AVIA 4CGFA 4CESA 4CF2A 3U9DA 4BDPA 2WFBA 4EAHD 3NFAA 3ENHA 3VQPA 3RTVA 2A5XA 4XIUA 1CZBA 4BR5A 4DUZK 4WE1A 1XHXA 3WQTA 1U48A 1VSHA 3M1FA 5LMUK 3MCAB 4YOUA 5C25A 3SK3A 5SWMA 4FJ5A 1HYSA 2HHQA 3AA4A 3GDQA 2ITMA 1Y97A 3FZLA 4IFEA 1IBLK 4CGJA 4CEZA 3H45C 4BC5A 4O0IA 4YOWA 5M1OA 4JKDA 1I39A 3SYZA 1RT3A 4CD3A 3CC7N 1TUYA 4LF5K 5M1QA 2IDOA 1C0TA 3HSTB 3VEZA 1T05A 1JLQA 3EZWA 4FCYA 4CK3A 3K57A 5E84A 4AHSA 3NH0A 4RW7A 4BR2A 4FOEA 4E19A 3U3GA 3SQ4A 1WLJA 3MN6A 2YNFA 3HZ6A 4B9QA 3K5MA 1ZBLA 4BRLA 5BRDA 3KIOA 3OA9A 4I2QA 4C8OA 3LDPA 2R7YA 4X64K 1SUQA 1S22A 1NK8A 3O1WA 3S3MA 3BZKA 2W6LA 1WAJA 3HRGA 3NAEA 1HPZA 3I0RA 1IG9A 4IOXA 5KPZA 3AGRA 2EWSA 2HF3A 2IVNA 1RBUA 4DHYA 4A62A 2P9NB 5GIPA 3NCIA 3OS2A 1BGXT 4RTFD 2HHUA 5C0YA 4JKEA 3V81A 1U47A 4CBWA 2O8DB 5AQVA 2JGUA 3OYHA 1SL0A 4ID5A 1JXEA 4MO5A 5AQLA 2ZJRL 2G8HA 4CEEA 1EO1A 4BRNA 3RR8A 5M1NA 4FYDA 4I6MA 1VSMA 1NLVA 1VRUA 3HO1A 3HI0A 1NOZA 3UIQA 1I3AA 2ZWHA 3OTOK 3C6HA 1VAZA 2D4WA 4DTXA 5A2QO 4JI5K 3D6RA 1DLOA 4BQZA 1HYVA 4DUYK 4C8NA 4A57A 1XI1A 4BR4A 4Q0BA 2BE2A 1D8YA 2YJEA 5FRNA 4CJSA 2HNYA 2FXUA 3U9ZA 2RHKA 3DLEA 1HKBA 5CZ2A 3QIPA 1DEJA 3IFRA 3OYFA 1NOYA 2HF4A 4CZKA 4PKIA 1J9AA 3CPEA 3OJUA 4LF7K 3AO2A 5AQGA 5BN8A 1J53A 4BG8A 5KGXA 2Q31A 5M1FA 1B9DA 3OHRA 1W2BM 4CZEA 2XY5A 2ZD1A 2NRVA 3MEDA 3ZT0A 3L4IA 3CQXA 4IKFA 1U04A 3HM8A 3BZCA 5AZJB 3CJ9A 3ATUA 3OYAA 4K41A 3K5OA 4KTWA 4NLBA 2KLAA 4CHNA 4DKWA 4PHTX 1JKHA 3LP2A 3SLCA 1Q81O 1RILA 5JS2A 3Q7CA 4XH4A 2F9WA 2P9KA 4FXDA 2EX3A 3ZT3A 4KHPK 4CERA 2OCEA 4Z94A 1HQUA 3ZYYX 3VQ6A 1X9SA 2RE2A 1TKTA 5JICA 4DV3K 4KI4A 1BQNA 5AQRA 1EX4A 1RTDA 1E4FT 4CGDA 3BUZB 3NBPA 4G1QA 3LWLA 5HBMA 4CZLA 3QEPA 1N8RO 3DOKA 1W7AA 2JWKA 2A41A 1Z05A 1K6YA 4BRPA 3C7NA 3G10A 4RG8A 1TKDA 4JKBA 2FC0A 4YOYA 5HRNA 5BRFA 1NJYA 1HJOA 3E9OA 3EE8A 3H1QA 1WNSA 4GVEA 1FKOA 3A5MC 1HNXK 2E88A 2YHBA 3CETA 3ITHA 5J2NA 3ZSQA 1YITN 4KREA 3HPGA 3TAGA 2QWLA 4N76A 4A5BA 4DSLA 4M45A 3BDPA 4CIGA 4CEQA 1NGJA 1Q18A 3LPTA 4BROA 2YHAA 3O3GA 3CFPA 1VQPN 3QNOA 2BTFA 3K9KA 3VQAA 1ASUA 4FK0A 4CJEA 3S3OA 2ZJPL 2RN2A 4MDAA 1S1TA 4CJWA 2XY6A 1W97L 2PBDA 4N5SA 4C23A 3E1YA 3L4QA 3M8PA 2HHSA 4IOCL 3FR0A 4YDUC 2QK9A 2QW9A 3EZ5A 1K73O 1Q7YO 3MXIA 3MXJA 2GWKA 3IUCA 1ESVA 4WFAL 4CJFA 2XHBA 4FOIA 2WTUA 4JNEA 3DOLA 3EN9A 3QINA 3B8AX 2E1ZA 4FVMA 1L3UA 1YTAA 1SKRA 5K14A 3T1YK 1QZ6A 2VWBA 3GBTA 2YI1A 3V1QA 1HNIA 4H0YB 4TSXA 1RT7A 4KH5A 4CJ3A 4CBUA 4IJAA 4DFMA 4X62K 3AA3A 3CJCA 1RT2A 2Q3SA 2YNHA 3MEGA 4MFBA 4W5OA 4I9LA 4IDKA 3AV9A 1HQEA 4HTUA 4M3UA 3T69A 4HWIA 2HMIA 1LWEA 2F9TA 3SUNA 3NMUA 3CM5A 1WAFA 1RDCA 4KTQA 4W5NA 3KTQA 1S1WA 3D2EB 4J2EA 3OVNA 3QLHA 3LAKA 3THXA 4AM6A 1NGEA 3K9JA 3CM6A 3DLKA 2HHXA 1YF5L 3DXKB 5BR9A 1KTQA 4E7LA 4ICLA 3RVCA 3KJVA 3O9QA 3VGMA 5GINA 2XY7A 4KI6A 3VENA 3CJBA 4CW7B 1C1BA 2WC9A 1IBKK 2GV9A 3VQEA 3RMBA 4GKKK 1F21A 1X3MA 4OGCA 3ZEUA 4LF9K 3CCEN 4Z4HA 4ISFA 2P51A 1M1KO 3JS6A 3EY1A 3ZCMA 3SI6A 1RTHA 4F3TA 4DFKA 4F8RA 3GE1A 2HNZA 5AQXA 2Z1JA 1S9EA 4F3OA 2O8EB 1ASVA 1JLGA 3JAMO 4RCHA 4DMNA 5AQPA 5EY4A 4DV7K 1VQ5N 5FPNA 1LWCA 1Q9YA 3E01A 3EKSA 4E7JA 4FSVA 4QS8A 4PA1A 4FM1A 1NJWA 4BQLA 2E2PA 1K8KA 3H3OB 4ID1A 3O9TA 4MO4A 2KFZA 3ULEB 1IH7A 4KHUA 1K9MO 3C65A 3NF8A 4B1WB 3VERA 3TAMA 2LSNA 2QWMA 1VQNN 3FFKB 2D1KA 3TSUA 4M3WA 3MAQA 2W40A 1A5WA 3PIOL 3P4IA 3PSFA 3HVTA 2GX9A 3V4IA 1OVQA 4H5RA 4CVNE 4YDUA 3HXMA 4FLYA 3VEVA 3J8AA 2PYLA 3FLCO 4F2RA 4M41A 3HM9A 3AVCA 3KKRA 2NRWA 3U3YA 4CZHA 4Y1DA 2ASMA 3KLEA 2B5JA 3G71N 4JI4K 1T7PA 3DRSA 4H5WA 4CF8A 1WBDA 4Z4EA 1J54A 3NGIA 3KLGA 2CH6A 2QWQA 3CCVN 1U4BA 4N41A 3FZMA 4IFVA 4FLWA 2D0AA 3ZETB 1KAXA 2HMPA 3NHGA 3IMXA 3C6AA 5FRMA 3SAGA 4M3XA 3G0ZA 2VG6A 4JYAK 5AQHA 4HUFA 2HHWA 3LP3A 4EZ9A 1QSYA 4ILJA 2EHGA 3MX5A 3A5OC 2JLEA 3A8YA 4WQ4C 1NK6A 1IKYA 1LV5A 2UXBK 1J5OA 5AZIB 4JD2B 3I55N 1V4TA 3C94A 3M8QA 2PZSA 4KB0A 4BRIA 3PX0A 5ELZA 1VSKA 2NLXA 1C1CA 5J2MA 3HSCA 3ZT2A 1MDUB 4CF1A 1G15A 2VWKA 4O5BA 3VQDA 3QEIA 4FWKA 3AVLA 1WSHA 4H0PA 1TK0A 2HBJA 3VQ8A 2GWJA 2KKZA 3KLIA 2KZZA 1LOTB 3AVAA 1NGAA 1CZAN 3UKUB 1EETA 3ZX2A 3M8RA 3WXIA 2Z1IA 3ZT4A 3CD6N 1TGOA 4FW2A 5GIOA 1RBSA 1HMVA 4IEEA 1KSPA 4FK4A 1BUPA 3BF1A 5DM7L 5E41A 4CI6A 1B9FA 4M7YA 4B3MK 3SV3A 3V9XA 4M42A 4DSJA 2NZTA 2DY4A 2D0BA 5AQUA 3HL8A 4OKEA 1ZXOA 1TL3A 3H6EA 2HW3A 4B1ZA 4BY9C 4DTNA 2ZGYA 3SJHA 4DF8A 2E2NA 4NCBA 5KQ8A 5CYMA 4M7XA 2CGJA 1S9GA 1X3NA 3R9PA 2HHVA 4EZ6A 3U4LA 4NXNK 4FL9A 3HBTA 4NO7A 3CJAA 4JI3K 1WB9A 4CJUA 4FJGA 3WNGA 4GKJK 3CF5L 3H1VX 1QQCA 4PQUA 2FBXA 5AQTA 3HOTA 4HCCA 2XO7A 1HJRA 4DS5A 2QTDA 3ID6A 4GW6A 1NG9A 4CGGA 3OYBA 3I8DA 1XUPO 3OYNA 3SUPA 5HP1A 2YKNA 4B9TA 3LDNA 5JLHA 4W5RA 3L3VA 5IWAK 3VEWA 3EKUA 4CHQA 4JKGA 4EFHA 2Q97A 4DR1K 5KPRA 1VSJA 2XRIA 2Z1GA 2G8UA 1YXQA 3P31A 1VSDA 1Q82O 5EVZA 1C0GA 3I56N 2DPNA 4FLXA 1IBMK 3I8BA 3SMPA 1XNRK 5KI6A 4DTRA 4DV0K 3WT0A 2F8TA 4NCGA 2VYPA 4H5TA 3PSIA 5ADXA 4O8UA 3KWIA 5JVGL 2VQEK 1SL2A 3QO9A 3S9HA 1DT9A 4BRCA 4X65K 4ELVA 4DSFA 1BWFO 1N32K 1DKGD 1YVUA 2BH1A 3I33A 4AM7A 1IKWA 5AQZA 4CFAA 4CHZA 4E1JA 5JLFA 3CC4N 2P9IA 3E9LA 1T6DA 2OANA 3SJJA 4JI2K 4V19S 3VTHA 4BREA 2GELA 4RW4A 3OYDA 1BQMA 1QHTA 4AF1A 1BA1A 4OPKA 4OJRA 2Q2RA 3TR8A 1NK9A 4LF6K 2O8FA 3SNNA 1NGBA 3IAYA 4DFJA 5IT9O 2P5GA 1R59O 3LDOA 3D45A 2P9PA 3TWHA 2D0PA 2P9SA 4GY2B 2NRRA 1HPMA 1SKSA 4WYBA 1XMOK 1FW6A 3ZLJA 3MWTA 1HKGA 1W9HA 3A5LC 5AQFA 4I6MB 4FJ8A 1BI4A 4B9UA 3G4SN 3FZKA 2PFUA 2CGKA 2A42A 1JXBA 4DR7K 5HRPA 5H1SQ 3CQ8A 2OPRA 3VQQA 1NGHA 1RTIA 3FGUA 3QFPA 4FWNA 3OYJA 2OA8A 4KKOA 3BGRA 3OYEA 3RWUA 3J81O 4H5NA 4AHTA 4I2PA 2KFNA 4DV6K 4CJRA 3PO4A 5AQNA 4O8KA 2IGIA 3T1AA 4ELTA 4IG0A 3SCXA 4E3SA 4A61A 3DM2A 3VQCA 3HYFA 4JK7A 3SPZA 1QE1A 1WN7A 5CR4A 5EU7A 2ATQA 2HHHK 2E8AA 1QZ5A 2OZMA 4FLZA 4WFNL 3WXJA 3THYA 4BVPA 1HNVA 4RW9A 5BR8K 1T03A 4DSKA 4OX9K 2FSJA 4CEFA 1RGIA 4AH9A 4G9ZA 4JI6K 4RW8A 3SUOA 2O8CA 1U2VB 3DLLL 4FWOA 4GV9A 4OO1J 4E7IA 1C6VA 4DV5K 5AQJA 2A3ZA 1IG8A 3SAHA 3QEXA 4Z4IA 1N34K 1GOAA 3WUHA 2I7PA 4CIEA 5BPLA 1ZBFA 3EL2A 4FJ7A 4KV8A 3RSEA 4CZIA 4BE0A 4U7BA 3SAFA 2PAVA 3CC2N 4GNIA 4ZTJA 3CMEN 1J6ZA 1RT6A 1S72N 4Y0WA 1REVA 3AO5A 1GLFO 4OPHA 4EIAA 4BACA 2O8DA 4DTUA 4JK8A 1UOCA 1QQOA 4CECA 3ISNC 3O08A 3OBWA 5AFUA 3WNEA 3VETA 2HNDA 4GMJB 4DB3A 4JHDA 1NBWA 5CZ1A 1TVRA 1RDWX 4K42A 3LP1A 4LC9B 4H4MA 3TI0A 1QHAA 1HLUA 1ATRA 3QERA 4EP4A 4AHUA 5D3GA 1VSFA 4E7HA 3O4NA 3UKRB 1YTUA 4IJNA 2YNIA 3O8MA 3DLHA 1GLDG 5FROA 2PY5A 5C15A 5HRRA 3DRRA 3VQ4A 1NGGA 4A2BA 3J7AP 1JJ2M 3SV4A 1YVNA 3VF4A 2VWJA 4DF4A 3AVBA 4BWMA 4H4OA 2ASOA 3JSMA 2BGGA 4FW1A 1CXQA 1OVYA 1BU6O 3KK7A 3W3DA 3ZSOA 1XWLA 4CIFA 1M90O 4CJ4A 2ASPA 4IOAL 5AZJA 2VGNA 1BOTO 4XH1A 3LANA 3N4QA 4OKJA 4A5AA 2X6NA 4BC2A 1VQ6N 2X74A 1FK9A 2P9UA 2HBMA 3ENOA 4I9QA 1Q9XA 4YNQA 3F5TA 4DR4K 1YIJN 1TL1A 1C1AA 5CY4A 4CZGA 1XC3A 3QMLA 5CYQA 4JN4A 3ULDA 2QWOA 2YCHA 4BG9A 4H8KA 3LALA 5CE3A 1L5UA 1MU2A 4KHWA 2DFEA 1JLBA 2CGLA 1EXQA 4IXCA 3KWGA 1TK5A 3L0QA 3ZSYA 3TANA 1BISA 3NGYA 3DI6A 1LCUA 4WCEL 3PO5A 1X1PA 1T6CA 3KK1A 4DV1K 3NF7A 3P1GA 3TSQA 2F96A 3ZSXA 2HB5A 1JCGA 1KLNA 3DLGA 3ZT1A 4QAGA 1UAXA 3AY9A 3OYGA 2GEMA 3M8SA 3U6FA 4WF9L 2Y1IA 4BE2A 3TAPA 3EO3A 1NKEA 1XNQK 1XQSC 3O80A 1T44A 4LSLA 3ZEUB 2PYJA 4J2BA 4FJJA 2ZF5O 1FKPA 2IAJA 2Q1NA 2UUCK 1QTMA 1JLAA 4FPBA 2HBKA 3J80O 5FDLA 3OJSA 2ZM6K 4W5TA 2I5JA 4DR3K 2IVPA 4CD1A 4A59A 4OGEA 1H1VA 4CHPA 4JI7K 1ILYA 4RWTA 1U6ZA 2YJFA 4CFCA 3OS0A 3GOIA 1KQSM 2A6AA 3SBTA 3MXMA 1NK7A 3QFUA 5C2FA 4JKCA 2F4VK 2FBYA 2KHOA 1NM1A 4J2AA 4CGHA 2E20A 1EWQA 5JVHL 3MDQA 3MN7A 4OPAA 1TYQA 2AJQA 3D7EO 3Q7BA 3QETA 3OYCA 2DFHA 4KAZA 3KLFA 3QIOA 1X9JA 4KHSA 4O5FA 4JKHA 3AA2A 1TK8A 3T7ZA 4NB4A 4BRHA 3DAWA 2OPQA 3GG4A 4CEDA 4O44A 3AAQA 4M3YA 2ITGA 4KHNA 4YOVA 4DQPA 3THWA 2O8BA 4DTPA 4Z4GA 4DQRA 2J4RA 1D4XA 3O9RA 4O55A 4DQQA 1D9FA 1LW2A 3MK6A 2CH5A 4DV2K 1TKXA 3P83D 3ZSWA 3SZ2A 1VQKN 1WSEA 4JV5K 4AHVA 4X66K 4JAXA 1Z6RA 1WUAA 3IDHA 2IVOA 2E5LK 3HP6A 5GAGP 3PIPL 4YHHK 3BY5A 4IEIA 1G99A 4IG3A 1QVFM 4DSEA 1J5EK 3L2RA 4K8ZA 5AQYA 1D5AA 1IKXA 4CJ5A 2W6KA 4FWMA 4EHTA 1MA9B 2YKMA 3KHYA 4CZFA 3MN9A 4AHCA 5HRSA 5AQOA 3WEEA 2FBTA 4FZZA 4ISEA 1RT1A 5FPMA 1ATNA 4BR9A 1NU0A 4B3RK 2OPSA 3ZSVA 4YOXA 3AVHA 4BWJA 3QBXA 3S41A 2BDPA 1VQ7N 3OYIA 1Q8IA 4GV6A 2OTJN 1NKCA 1KLMA 3MMVA 3D2FA 4LFAK 3V9SA 4B3SK 3LM2A 3EE9A 4FPAA 1C0FA 4FJ9A 2QA4N 4B3TK 4DTSA 4H0TB 2YX6A 4N47A 1RBVA 3NGZA 3CG7A 4LD0A 1E4GT 3IS9A 3UE5A 4CF0A 4FLTA 3WXLA 3NF9A 2P5OA 4CFDA 4NXMK 4OVLA 4CBXA 3QEWA 1GLEG 2V51B 3HPOA 2HSTA 2F7TA 4HCBA 4OPJA 3MN5A 4N56A 3ID8A 3DRPA 2G8VA 2BANA 1RTJA 3VGLA 1ASWA 4DR5K 4LH4A 3AGKA 3QNNA 1RDUA 1JCEA 1OH7A 2VGMA 3BP8A 5F1XA 5GAEP 1GLLO 2ZGZA 1VQ9N 3ATVA 1I94K 3ZX0A 5LJWA 2FSNA 4CZJA 2HOEA 5FPEA 1HUXA 3K5LA 3P39A 1YAGA 3MCPA 3AA5X 4CK2A 5M1KA 3T1HK 1P90A 1NKBA 1VQMN 4PL7A 3M3ZA 3RMCA 2HBLA 2GTDA 3KD5E 4K43A 1KVAA 3IG1A 3SBGA 4RW6A 5BRHA 1OH6A 5GAHP 4M63C 1NJXA 2GBZA 2V7YA 1SV5A 4LF4K 4B8CA 3DXMA 4JKGB 1U45A 3LDLA 4R79A 3V9ZA 3LDQA 3ZSZA 4OLAA 3TAQA 1HRHA 1NMNA 2Y1JA 3OW2M 1DTTA 4DLEA 3TU5A 3AO4A 3R8EA 2VQFK 1SS6A 2UXCK 4PWDA 1BDGA 3RMAA 3VEOA 1VRTA 4JEPA 4FWQA 4PKGA 3CI5A 1EP4A 3OBYA 1XHZA 1NGDA 4MLEA 1WSIA 2QKBA 3JYTA 1Q86O 4FWSA 3IRXA 1CLQA 3V9WA 3UKUA 4CJ7A 3CCLN 2NNWA 5KGWA 2WOMA 1JCFA 4ILHA 5LMNK 1JLFA 3ASMA 3L2WA 3LZJA 3S3NA 4C1NK 5CHIA 4CCHA 5I9EB 4LH5A 3LPUA 4KB1A 2A1SA 4F4KA 1N36K 4OLBA 3C6UA 3KK3A 2O8FB 4J2DA 1ZYQA 4BRFA 3M6GA 1P8ZA 1V4SA 3C0BA 4LF8K 4OKKA 5J1EA 5I42A 3SPYA 1GOCA 4FO0A 1TAQA 4CJKA 4KPYA 4FZXC 4DU3A 4JI8K 2P9PB 4WQ4A 4B1VA 4BR0A 5GADP 4PY5A 4KO0A 3OS1A 2P9SB 5TKYA 3BF3A 3R1XA 2X78A 1S1VA 3AVGA 3NH1A 5KTQA 2QWNA 1VSEA 5I3UA 3CFRA 1GLAG 2OPPA 2FLOA 3PUFA 3J7ZO 1BI4B 1C0UA 4B3OA 2G8IA 1A5VA 1YJ9N 3V1RA 4BRMA 5C10A 4DQ8A 3RRGA 4KHQA 4IO9L 1B92A 1SL1A 1KAZA 4JRQA 2UU9K 4NLCA 1DGKN 3TAFA 3JXUA 2W41A 3QEVA 1WSGA 4M3RA 1LWFA 2ETJA 5J2QA 3WNFA 2P9LA 3CERA 3DYAA 3CJ7A 4CEOA 1RBTA 4DR2K 1QS4A 4DG1A 1RT5A 3FZHA 3B6OA 5BPMA 4M3ZA 3AVNA 4JKAA 1K8AO 2OZSA 1MWKA 1QQNA 2W42A 3ALYA 3LP0A 1RCHA 3GL1A 4DTOA 3SQ1A 4C8LA 1S3XA 3THYB 4B08A 5DM6L 2D0OA 2YV0X 3K0SA 4LFCK 4CEAA 1UA0A 1VQ4N 2YHYA 4ELUA 1NJZA 4M3TA 4FLVA 3WNHA 1Z26A 5SZTA 4R5PA 5EOYA 3AO1A 1ZBIA 4BDYA 4KRFA 1KFDA 2O8CB 3VOVA 4BRGA 4E1NA 1BL3A 4O4GA 4FLUA 5AJ3K 4K0KK 4DU4A 3QDKA 3K2PA 3KLHA 1S1UA 2E6MA 4IZ9A 4E1MA 3R6MA 3RSEB 4Y1CA 1O1WA 3W0LA 4B9VA 2NUBA 1VQ8N 2ZE2A 2WBNA 2NRTA 1YI2N 1YJNN 1GLJO 1QVGM 2OTLN 5KRSA 4FJXA 4J8FA 3O1BA 4DWIA 2AA4A 4FWLA 4AQYK 1QSLA 1CZ9A 4YFUA 1ZC6A 4BGAA 4H5VA 3QBWA 3AAPA 3IKMA 1CXUA 5F2RA 5ADXH 1FXXA 1SQKA 2ZQBA 4JHDB 2IS3A 4JS5A 3VQ5A 1SAZA 3LM9A 1JL2A 3ZSRA 3O3HA 1HNWK 2FBVA 3F2KA 3UB5A 1TV6A 1BO5O 3HT3A 4MDBA 3F9MA 4YORA 3PX6A 2G8FA 2P9KB 2P9NA 4PUOA 1A5XA 3PV8A 3KZBA 2NRXA 4DFPA 4QCLA 1OKJA 5C2DA 2P1JA 3L3UA 5C42A 1ZBSA 2UUAK 1IV0A 3CCSN 5LJVA 1L3SA 2I7NA 1HR0K 5DMRA 4CJTA 3CHWA 1SZ2A 4AILC 1Y64A 3N4PA 4F9OA 5BPNA 3J7YP 4NCAA 4PKHA 2ZJQL 3A2FA 4B8AB 4E7KA 4BRDA 4CJVA 4JI0K 4FJHA 3C7NB 5FPDA 2QXLA 1NGIA 3K58A 1WOQA 1W0HA 2NRHA 2QM1A 3B6PA 4B1XB 3O6WA 1RDBA 1HYZA 2E4LA 2QKKA 4DV4K 3T19A 4CEBA 3O3FA 2AP1A 2HVIA 4CHYA 1TKZA 2IC3A 1U2VA 3HPHA 4ZHRA 5T7BA 1TAUA 3E66A 2RPIA 1IJJA 4H0OA 4UQGA 4CE9A 2E1YA 2P9UB 1JLEA 5EX5A 3DLRA 4BR7A 3A5NC 1EKEA 4IBNA 1YUWA 3WQUA 1HNZK 3SUQA 3H3NO 3O9UA 3SQ2A 1FJGK 4FM2A 1OH8A 1U49A 1WSFA 4IFYA 4H0XB 3VEXA 2FF6A 3KKSA 3AVKA 5E26A 4KTZA 1KC8O 3VQ7A 2QWPA 1R0AA 3NE6A 2DTUA 2BUPA 4U67L 4FWRA 3THVA 2XY8A 4CJPA 4WQ5C 4FWPA 1UWBA 1RT4A 3UKRA 3CCRN 2Q0UA 3E9PA 4BRAA 4JS4A 4Z4FA 3NH2A 2E6LA 3MX2A 3A0IX 5F0XA 4MQ3A 4BC4A 3K5NA 4DS4A 2V52B 5HL7L 1WSJA 5BN9A 1GOBA 1S5JA 3THXB 3C95A 4CJQA 1X9WA 2O4IA 3V1OA 1SKWA 3RMDA 4EP5A 5AFUH 2KTQA 3NDKA 3FE1A 1YJWN 5KPTA 4KFBA 3CCMN 4KBOA 3CPWM 1LAVA 3PY8A 5C24A 1BCOA 2WONA 5BREA 2G8WA 4HVJA 1VQON 4DQSA 4CGIA 1TYQB 3KK2A 2IIRA 3ENBA 1KFSA 1VSIA 5LL6Z 3WXMB 3HTVA 5AQKA 4Z0UA 3BEXA 3SMSA 3HJFA 2WUSA 3MWPA 2D0CA 3AVFA 3EYZA 1NK4A 1S6PA 3TTCA 5C12A 4CFBA 3O9SA 3THWB 2O4GA 3VF6A 2O8BB 4NYNA 5AQIA 3LAMA 4C8MA 3R3LA 5EXWA 1K8KB 3F9KA 3V9UA 3M5RA 1DTQA 4KH4A 4E89A 5TKWA 3T3FA 4LSNA 4CZMA 3L2UA 5AQWA 4B1UB 1LAWA 4KHYA 1VHXA 3MECA 5LY3A 5M1PA 3VTIA 4CK1A 4HUEA 3TABA 4ZTFA 2NRZA 4K8XA 3AO3A 3VESA 1NK5A 4H03B 1VK0A 1NGCA 4DR6K 1KVCA 3CCQN 2Q36A 4ISGA 1BIZA 3WEEB 3ZX3A 2Q0RA 5AQMA 2A40A 3LWMA 3L6QA 4QOZB 3D2EA 1RDDA 3D0PA 2B6AA 5KRTA 1T8EA 1RFQA 1KD1O 3TPQA 4XEIA 5B8HA 3VF2A 2KZMA 3DXKA 1HX1A 3TTFA 1ZBHA 4B9LA 4WQ5A 3H08A 3TARA 4DU1A 3SQ0A 4CHOA 3O4WA 3D2FB 4BGBA 3I0SA 3CQYA 5JMVA 3AVMA 2UXDK 3KD1E 4B9NA
chains in the Genus database with same CATH topology
4M45A 3BDPA 4CIGA 4CEQA 1EP4A 2OZMA 4FLZA 3LPTA 1S1XA 3O3GA 2YHAA 3CFPA 1XHZA 3QNOA 1HNVA 3OY9A 2F8SA 4RW9A 3VQAA 1WSIA 1ASUA 1T03A 3LZIA 3JYTA 4DSKA 4CJEA 3S3OA 4NYFA 2RF2A 4FK0A 3IRXA 1CLQA 4CEFA 3V9WA 4AHRA 4C8KA 3P5JA 2RN2A 4FJIA 5KGWA 4AH9A 1S1TA 4CJWA 2WOMA 2XY6A 3F73A 3O4QA 1JLFA 4N5SA 4RW8A 3DMJA 1KCFA 3SUOA 1N6QA 3ASMA 3M8PA 2HHSA 3RR7A 4JLHA 2VG5A 3L2WA 1KRPA 3LZJA 1N5YA 2QK9A 4FK2A 3EZ5A 4E7IA 3S3NA 4E0DA 1C6VA 4CCHA 3OYKA 3MXIA 3MXJA 4LH5A 3LPUA 4KB1A 2A1SA 2B4JA 3QEXA 4F4KA 3HVRA 4Z4IA 1GOAA 4OLBA 3TAEA 3C6UA 4CIEA 1ZBFA 4CJFA 3KK3A 2XHBA 1XC9A 1ZYQA 4J2DA 3DOLA 4FJ7A 3QINA 4KV8A 1UA1A 4CF9A 4FVMA 1L3UA 1YTAA 3TAQA 1SKRA 4OKKA 5J1EA 4BDZA 5K14A 3SPYA 4W5QA 5I42A 1LW0A 1GOCA 3V1QA 1TAQA 4CJKA 4KPYA 4FZXC 3C6TA 4BE0A 4DU3A 4FJLA 1HNIA 2RKIA 4TSXA 3RRHA 1RT7A 4PY5A 4KO0A 3OS1A 4ZTJA 1RT6A 1L3TA 4CJ3A 2X78A 1S1VA 2Z1HA 3AVGA 3NH1A 1REVA 1S6QA 3AA3A 1VSEA 3AO5A 5KTQA 4DFMA 1RT2A 2Q3SA 4LY7A 2YNHA 3MEGA 3QESA 3V6DA 5I3UA 4MFBA 3CFRA 4F2SA 4W5OA 4FM0A 4FJMA 4I9LA 4BACA 2OPPA 4IDKA 3AV9A 1HQEA 4DTUA 3PUFA 1UOCA 1BI4B 1C0UA 3ISNC 4CECA 4HTUA 4M3UA 2G8IA 4B3OA 1A5VA 2HMIA 1KVBA 3V1RA 3WNEA 3OYLA 1LWEA 2HNDA 4GMJB 3RRGA 3SUNA 1QSSA 4KHQA 5CZ1A 4KREA 1L3VA 3CM5A 1B92A 1WAFA 3PX4A 1RDCA 4JRQA 1SL1A 1TVRA 2YNGA 3KTQA 4KTQA 4W5NA 1S1WA 4DTMA 2X6SA 3TAFA 3CYMA 3LP1A 4J2EA 3OVNA 3QLHA 4H4MA 1IO2A 3TI0A 3LAKA 2G8KA 1NK0A 3QEVA 1WSGA 4M3RA 1LWFA 2ETJA 3QERA 3DLBA 4EP4A 5J2QA 3CM6A 3WNFA 3DLKA 4AHUA 4FJNA 2GUIA 2HHXA 1RNHA 3DYAA 3MEEA 5D3GA 2QKBA 1VSFA 4E7HA 3O4NA 1KTQA 1RBTA 4CEOA 4E7LA 4ICLA 3LDSA 3L8BA 4GVMA 3KJVA 5DK5A 2YNIA 1YTUA 1QS4A 4DG1A 3DLHA 1RT5A 2XY7A 3VQ9A 4L8RB 4KI6A 3B6OA 4M3ZA 1C1BA 3AVNA 5FROA 2PY5A 2OZSA 2GV9A 3VQEA 3RMBA 2W42A 1RBRA 5HRRA 2VG7A 3VN5A 3ALYA 1F21A 1RCHA 3LP0A 4DTOA 4OGCA 1RDAA 3DRRA 3VQ4A 3SQ1A 4Z4HA 4JRPA 4C8LA 2P51A 3EY1A 3ZCMA 3SV4A 4B08A 3SI6A 2IOCA 1RTHA 4F3TA 4DFKA 2YV0X 4CEAA 1UA0A 4F8RA 3CFOA 3NF6A 2VWJA 5JS1A 4ELUA 2HNZA 4DF4A 1NJZA 4M3TA 2HVHA 4FLVA 3WNHA 2Z1JA 3AVBA 1S9EA 4BWMA 1ZBUA 1Z26A 4F3OA 5SZTA 4DTJA 4R5PA 2KW4A 4H4OA 3AO1A 3JSMA 2BGGA 4FW1A 1ZBIA 1BIUA 1CXQA 1JLCA 3L2QA 1ASVA 1JLGA 1KFDA 4BDYA 4KRFA 3ZSOA 4O0JA 4CJLA 4BE1A 2OYQA 1XWLA 4CIFA 4E1NA 2QXFA 4DMNA 4CJ4A 1BHLA 1BL3A 4O4GA 5HROA 5J2PA 4FLUA 5HLFA 1LWCA 4DLGA 2D5RA 1Q9YA 3E01A 3LANA 4DU4A 1Z25A 3K2PA 4E7JA 3KLHA 1C0MA 1S1UA 4PA1A 4OKJA 4HUGA 2E6MA 3VQBA 4E1MA 4FM1A 1NJWA 4DQIA 2X6NA 4ID1A 4Y1CA 1O1WA 2KFZA 4B9VA 4Q5VA 1IH7A 4KHUA 2NUBA 1X9MA 3NF8A 2ZE2A 2X74A 1FK9A 3TAMA 3VA3A 3HP9A 2LSNA 1ITGA 5KRSA 4FJXA 4I9QA 4DWIA 1Q9XA 2DFFA 4DSIA 4YNQA 4M3WA 3MAQA 1QSLA 1CZ9A 1A5WA 4YFUA 1IKVA 4Z4CA 2KQ2A 1TL1A 1C1AA 1YT3A 5CY4A 2A1RA 3HVTA 4FJKA 3V4IA 1CXUA 5CYQA 3ULDA 3K59A 1FXXA 2ZQBA 3LALA 4H8KA 2IS3A 4JS5A 3VQ5A 1L5UA 1MU2A 4KHWA 2DFEA 1JLBA 3HXMA 1D9DA 4FLYA 4F2RA 1EXQA 2PYLA 1JL2A 4M41A 3ZSRA 3HM9A 4B9SA 1TK5A 3AVCA 3KKRA 3O3HA 3U3YA 3L2VA 3ZSYA 3TANA 1BISA 3NGYA 4Y1DA 3KLEA 2FBVA 2B5JA 3DI6A 1TV6A 3PO5A 1X1PA 4B9MA 1VSLA 3KK1A 3HT3A 1T7PA 3DRSA 1JL1A 3NF7A 1BCMA 3HK2A 3P1GA 3FFIA 4CF8A 2F96A 3ZSXA 2HB5A 4Z4EA 1J54A 3VA0A 3OYMA 3NGIA 3PX6A 3KLGA 1KLNA 2G8FA 4FZYA 1U4BA 3AVJA 3DLGA 4PUOA 1A5XA 4N41A 3ZT1A 4IFVA 3PV8A 4FLWA 4DFPA 4QCLA 2D0AA 4QAGA 1UAXA 4HHTA 4ELTA 2P1JA 3L3UA 5C42A 3OYGA 4I7FA 3M8SA 3U6FA 2HHTA 2Y1IA 4BE2A 3TAPA 3AVIA 4CGFA 4CESA 4CF2A 3NHGA 1NKEA 1L3SA 4BDPA 4LSLA 2PYJA 4J2BA 3NFAA 4FJJA 5DMRA 1FKPA 4M3XA 5FRMA 2IAJA 4CJTA 3G0ZA 2VG6A 3VQPA 4AILC 1QTMA 1JLAA 4HUFA 3RTVA 4XIUA 2HHWA 3LP3A 5FDLA 1QSYA 1CZBA 3OJSA 4EZ9A 4NCAA 2EHGA 3A2FA 4B8AB 4E7KA 4OLAA 4WE1A 1XHXA 4CJVA 1U48A 2JLEA 1VSHA 4FJHA 1NK6A 3K58A 4W5TA 1IKYA 1LV5A 2I5JA 1W0HA 5C25A 1J5OA 3B6PA 5SWMA 4FJ5A 1HYSA 2HHQA 3AA4A 3C94A 1RDBA 1Y97A 3M8QA 2PZSA 1HYZA 4OGEA 4CHPA 4KB0A 2E4LA 3PX0A 2QKKA 4CGJA 1VSKA 4CEZA 3T19A 4CEBA 3O3FA 1C1CA 4CFCA 4O0IA 5J2MA 3OS0A 3ZT2A 4CF1A 1I39A 2HVIA 4CHYA 1TKZA 2IC3A 1G15A 2VWKA 3SYZA 3MXMA 1NK7A 4O5BA 3HPHA 4ZHRA 3VQDA 5T7BA 1RT3A 2FBYA 3QEIA 1TAUA 2RPIA 4J2AA 2IDOA 1C0TA 4CGHA 3AVLA 4UQGA 4CE9A 1WSHA 1TK0A 3HSTB 1T05A 2AJQA 1JLQA 3VQ8A 3QETA 3KLIA 2DFHA 3OYCA 4FCYA 4CK3A 4KAZA 3K57A 3KLFA 3QIOA 2KZZA 4KHSA 4AHSA 3NH0A 1JLEA 3AVAA 3DLRA 4RW7A 4E19A 3U3GA 3AA2A 1TK8A 3SQ4A 1EETA 3M8RA 1WLJA 2Z1IA 2OPQA 3ZT4A 1TGOA 2YNFA 4FW2A 1RBSA 3K5MA 1HMVA 1ZBLA 1KSPA 4FK4A 1EKEA 4IBNA 3KIOA 4I2QA 4CEDA 4O44A 5E41A 4C8OA 3SUQA 2R7YA 1B9FA 4M3YA 3SV3A 3V9XA 3SQ2A 2ITGA 4KHNA 1SUQA 4FM2A 4DQPA 4DSJA 4M42A 2DY4A 1NK8A 1U49A 1WSFA 2D0BA 3S3MA 4IFYA 3HL8A 4DTPA 1WAJA 4Z4GA 4OKEA 3NAEA 1HPZA 1TL3A 3I0RA 4DQRA 1IG9A 2HW3A 3KKSA 4DTNA 3AVKA 4O55A 4DQQA 4KTZA 1D9FA 1LW2A 1RBUA 3VQ7A 1R0AA 1TKXA 3P83D 3ZSWA 4DF8A 3SZ2A 1WSEA 3NCIA 4NCBA 3OS2A 3NE6A 5CYMA 4AHVA 1BGXT 1S9GA 2HHVA 2DTUA 2HHUA 3THVA 2XY8A 4EZ6A 3V81A 1U47A 4CJPA 3HP6A 1UWBA 1RT4A 4IG3A 4JS4A 4DSEA 4CJUA 4FJGA 2JGUA 3WNGA 4Z4FA 3NH2A 3OYHA 1SL0A 2E6LA 4ID5A 1JXEA 3L2RA 4K8ZA 4MQ3A 1D5AA 1QQCA 2G8HA 4CEEA 1IKXA 4PQUA 3RR8A 4CJ5A 2FBXA 3K5NA 4FYDA 4DS4A 4HCCA 1WSJA 2XO7A 1HJRA 1VSMA 1VRUA 2YKMA 4DS5A 3HO1A 1GOBA 1NOZA 1S5JA 4GW6A 1I3AA 3UIQA 3C95A 4CJQA 4CGGA 3OYBA 4AHCA 5HRSA 1X9WA 3I8DA 2O4IA 3V1OA 3OYNA 2FBTA 1SKWA 3RMDA 4FZZA 4EP5A 3SUPA 5HP1A 2YKNA 3NDKA 2KTQA 1RT1A 4B9TA 4DTXA 1DLOA 4W5RA 3L3VA 2OPSA 1HYVA 4KFBA 3ZSVA 4CHQA 4C8NA 3KD1E 1LAVA 3PY8A 1VSJA 1BCOA 2WONA 2XRIA 2Z1GA 5C24A 3AVHA 4BWJA 1XI1A 2G8WA 2G8UA 4HVJA 2BDPA 4Q0BA 4DQSA 4CGIA 1VSDA 2BE2A 1D8YA 3OYIA 5FRNA 4CJSA 1Q8IA 2HNYA 3KK2A 1NKCA 1KFSA 4FLXA 1KLMA 1VSIA 3DLEA 5CZ2A 3QIPA 5KI6A 3OYFA 4DTRA 3V9SA 4Z0UA 1NOYA 2F8TA 1J9AA 4NCGA 3HJFA 3OJUA 3AO2A 1SL2A 3QO9A 1J53A 3S9HA 4FJ9A 2D0CA 5KGXA 4ELVA 3AVFA 4DSFA 3EYZA 1NK4A 4DTSA 1B9DA 1YVUA 4N47A 4CFAA 4CHZA 1IKWA 1S6PA 2XY5A 1RBVA 3NGZA 2ZD1A 3CG7A 4LD0A 4CFBA 3IS9A 4CF0A 3MEDA 3ZT0A 4FLTA 3NF9A 2P5OA 4IKFA 2O4GA 1U04A 4CFDA 4OVLA 3QEWA 4NYNA 3SJJA 3LAMA 4C8MA 3HPOA 4HCBA 3OYAA 3K5OA 4OPJA 4N56A 4RW4A 3OYDA 1BQMA 1QHTA 3DRPA 3F9KA 3V9UA 4OPKA 4KTWA 2G8VA 1DTQA 2BANA 1RTJA 4OJRA 4CHNA 1ASWA 3TR8A 1NK9A 4E89A 4LH4A 3T3FA 4LSNA 3L2UA 3SNNA 1JKHA 3QNNA 3LP2A 4DFJA 3IAYA 2P5GA 1LAWA 4KHYA 4B9NA 1RILA 3MECA 5JS2A 3D45A 4FXDA 4CK1A 2EX3A 3ZT3A 4HUEA 3TABA 4ZTFA 3TWHA 4CERA 1HQUA 4K8XA 3VQ6A 3K5LA 3AO3A 1X9SA 1SKSA 1NK5A 3AA5X 1TKTA 4CK2A 1VK0A 4KI4A 1BQNA 1EX4A 1RTDA 4CGDA 1KVCA 1W9HA 3NBPA 4G1QA 3LWLA 1NKBA 5HBMA 3QEPA 4FJ8A 3DOKA 3RMCA 1BI4A 4B9UA 1K6YA 1BIZA 3KD5E 3G10A 4RG8A 1JXBA 5HRPA 1KVAA 3CQ8A 3IG1A 1TKDA 2OPRA 3LWMA 4QOZB 2FC0A 3VQQA 5HRNA 1RTIA 4RW6A 3OYJA 1RDDA 3D0PA 2OA8A 4KKOA 1NJYA 2B6AA 1NJXA 3BGRA 1WNSA 2GBZA 5KRTA 3OYEA 1FKOA 1SV5A 4AHTA 1T8EA 3RWUA 4I2PA 4B8CA 2KFNA 1U45A 2YHBA 3ITHA 5J2NA 3V9ZA 4CJRA 2KZMA 3ZSZA 3ZSQA 3PO4A 1ZBHA 4B9LA 2IGIA 3T1AA 1HRHA 3H08A 4IG0A 2Y1JA 3SCXA 4E3SA 1DTTA 3HPGA 4DU1A 3TAGA 4DLEA 3SQ0A 3DM2A 3AO4A 3VQCA 3HYFA 4N76A 3SPZA 4CHOA 4PWDA 1QE1A 1WN7A 3I0SA 3RMAA 1VRTA 3AVMA 3TARA 5EU7A 4DSLA 2ATQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M45 A;  3BDP A;  4CIG A;  4CEQ A;  1EP4 A;  2OZM A;  4FLZ A;  3LPT A;  1S1X A;  3O3G A;  2YHA A;  3CFP A;  1XHZ A;  3QNO A;  1HNV A;  3OY9 A;  2F8S A;  4RW9 A;  3VQA A;  1WSI A;  1ASU A;  1T03 A;  3LZI A;  3JYT A;  4DSK A;  4CJE A;  3S3O A;  4NYF A;  2RF2 A;  4FK0 A;  3IRX A;  1CLQ A;  4CEF A;  3V9W A;  4AHR A;  4C8K A;  3P5J A;  2RN2 A;  4FJI A;  5KGW A;  4AH9 A;  1S1T A;  4CJW A;  2WOM A;  2XY6 A;  3F73 A;  3O4Q A;  1JLF A;  4N5S A;  4RW8 A;  3DMJ A;  1KCF A;  3SUO A;  1N6Q A;  3ASM A;  3M8P A;  2HHS A;  3RR7 A;  4JLH A;  2VG5 A;  3L2W A;  1KRP A;  3LZJ A;  1N5Y A;  2QK9 A;  4FK2 A;  3EZ5 A;  4E7I A;  3S3N A;  4E0D A;  1C6V A;  4CCH A;  3OYK A;  3MXI A;  3MXJ A;  4LH5 A;  3LPU A;  4KB1 A;  2A1S A;  2B4J A;  3QEX A;  4F4K A;  3HVR A;  4Z4I A;  1GOA A;  4OLB A;  3TAE A;  3C6U A;  4CIE A;  1ZBF A;  4CJF A;  3KK3 A;  2XHB A;  1XC9 A;  1ZYQ A;  4J2D A;  3DOL A;  4FJ7 A;  3QIN A;  4KV8 A;  1UA1 A;  4CF9 A;  4FVM A;  1L3U A;  1YTA A;  3TAQ A;  1SKR A;  4OKK A;  5J1E A;  4BDZ A;  5K14 A;  3SPY A;  4W5Q A;  5I42 A;  1LW0 A;  1GOC A;  3V1Q A;  1TAQ A;  4CJK A;  4KPY A;  4FZX C;  3C6T A;  4BE0 A;  4DU3 A;  4FJL A;  1HNI A;  2RKI A;  4TSX A;  3RRH A;  1RT7 A;  4PY5 A;  4KO0 A;  3OS1 A;  4ZTJ A;  1RT6 A;  1L3T A;  4CJ3 A;  2X78 A;  1S1V A;  2Z1H A;  3AVG A;  3NH1 A;  1REV A;  1S6Q A;  3AA3 A;  1VSE A;  3AO5 A;  5KTQ A;  4DFM A;  1RT2 A;  2Q3S A;  4LY7 A;  2YNH A;  3MEG A;  3QES A;  3V6D A;  5I3U A;  4MFB A;  3CFR A;  4F2S A;  4W5O A;  4FM0 A;  4FJM A;  4I9L A;  4BAC A;  2OPP A;  4IDK A;  3AV9 A;  1HQE A;  4DTU A;  3PUF A;  1UOC A;  1BI4 B;  1C0U A;  3ISN C;  4CEC A;  4HTU A;  4M3U A;  2G8I A;  4B3O A;  1A5V A;  2HMI A;  1KVB A;  3V1R A;  3WNE A;  3OYL A;  1LWE A;  2HND A;  4GMJ B;  3RRG A;  3SUN A;  1QSS A;  4KHQ A;  5CZ1 A;  4KRE A;  1L3V A;  3CM5 A;  1B92 A;  1WAF A;  3PX4 A;  1RDC A;  4JRQ A;  1SL1 A;  1TVR A;  2YNG A;  3KTQ A;  4KTQ A;  4W5N A;  1S1W A;  4DTM A;  2X6S A;  3TAF A;  3CYM A;  3LP1 A;  4J2E A;  3OVN A;  3QLH A;  4H4M A;  1IO2 A;  3TI0 A;  3LAK A;  2G8K A;  1NK0 A;  3QEV A;  1WSG A;  4M3R A;  1LWF A;  2ETJ A;  3QER A;  3DLB A;  4EP4 A;  5J2Q A;  3CM6 A;  3WNF A;  3DLK A;  4AHU A;  4FJN A;  2GUI A;  2HHX A;  1RNH A;  3DYA A;  3MEE A;  5D3G A;  2QKB A;  1VSF A;  4E7H A;  3O4N A;  1KTQ A;  1RBT A;  4CEO A;  4E7L A;  4ICL A;  3LDS A;  3L8B A;  4GVM A;  3KJV A;  5DK5 A;  2YNI A;  1YTU A;  1QS4 A;  4DG1 A;  3DLH A;  1RT5 A;  2XY7 A;  3VQ9 A;  4L8R B;  4KI6 A;  3B6O A;  4M3Z A;  1C1B A;  3AVN A;  5FRO A;  2PY5 A;  2OZS A;  2GV9 A;  3VQE A;  3RMB A;  2W42 A;  1RBR A;  5HRR A;  2VG7 A;  3VN5 A;  3ALY A;  1F21 A;  1RCH A;  3LP0 A;  4DTO A;  4OGC A;  1RDA A;  3DRR A;  3VQ4 A;  3SQ1 A;  4Z4H A;  4JRP A;  4C8L A;  2P51 A;  3EY1 A;  3ZCM A;  3SV4 A;  4B08 A;  3SI6 A;  2IOC A;  1RTH A;  4F3T A;  4DFK A;  2YV0 X;  4CEA A;  1UA0 A;  4F8R A;  3CFO A;  3NF6 A;  2VWJ A;  5JS1 A;  4ELU A;  2HNZ A;  4DF4 A;  1NJZ A;  4M3T A;  2HVH A;  4FLV A;  3WNH A;  2Z1J A;  3AVB A;  1S9E A;  4BWM A;  1ZBU A;  1Z26 A;  4F3O A;  5SZT A;  4DTJ A;  4R5P A;  2KW4 A;  4H4O A;  3AO1 A;  3JSM A;  2BGG A;  4FW1 A;  1ZBI A;  1BIU A;  1CXQ A;  1JLC A;  3L2Q A;  1ASV A;  1JLG A;  1KFD A;  4BDY A;  4KRF A;  3ZSO A;  4O0J A;  4CJL A;  4BE1 A;  2OYQ A;  1XWL A;  4CIF A;  4E1N A;  2QXF A;  4DMN A;  4CJ4 A;  1BHL A;  1BL3 A;  4O4G A;  5HRO A;  5J2P A;  4FLU A;  5HLF A;  1LWC A;  4DLG A;  2D5R A;  1Q9Y A;  3E01 A;  3LAN A;  4DU4 A;  1Z25 A;  3K2P A;  4E7J A;  3KLH A;  1C0M A;  1S1U A;  4PA1 A;  4OKJ A;  4HUG A;  2E6M A;  3VQB A;  4E1M A;  4FM1 A;  1NJW A;  4DQI A;  2X6N A;  4ID1 A;  4Y1C A;  1O1W A;  2KFZ A;  4B9V A;  4Q5V A;  1IH7 A;  4KHU A;  2NUB A;  1X9M A;  3NF8 A;  2ZE2 A;  2X74 A;  1FK9 A;  3TAM A;  3VA3 A;  3HP9 A;  2LSN A;  1ITG A;  5KRS A;  4FJX A;  4I9Q A;  4DWI A;  1Q9X A;  2DFF A;  4DSI A;  4YNQ A;  4M3W A;  3MAQ A;  1QSL A;  1CZ9 A;  1A5W A;  4YFU A;  1IKV A;  4Z4C A;  2KQ2 A;  1TL1 A;  1C1A A;  1YT3 A;  5CY4 A;  2A1R A;  3HVT A;  4FJK A;  3V4I A;  1CXU A;  5CYQ A;  3ULD A;  3K59 A;  1FXX A;  2ZQB A;  3LAL A;  4H8K A;  2IS3 A;  4JS5 A;  3VQ5 A;  1L5U A;  1MU2 A;  4KHW A;  2DFE A;  1JLB A;  3HXM A;  1D9D A;  4FLY A;  4F2R A;  1EXQ A;  2PYL A;  1JL2 A;  4M41 A;  3ZSR A;  3HM9 A;  4B9S A;  1TK5 A;  3AVC A;  3KKR A;  3O3H A;  3U3Y A;  3L2V A;  3ZSY A;  3TAN A;  1BIS A;  3NGY A;  4Y1D A;  3KLE A;  2FBV A;  2B5J A;  3DI6 A;  1TV6 A;  3PO5 A;  1X1P A;  4B9M A;  1VSL A;  3KK1 A;  3HT3 A;  1T7P A;  3DRS A;  1JL1 A;  3NF7 A;  1BCM A;  3HK2 A;  3P1G A;  3FFI A;  4CF8 A;  2F96 A;  3ZSX A;  2HB5 A;  4Z4E A;  1J54 A;  3VA0 A;  3OYM A;  3NGI A;  3PX6 A;  3KLG A;  1KLN A;  2G8F A;  4FZY A;  1U4B A;  3AVJ A;  3DLG A;  4PUO A;  1A5X A;  4N41 A;  3ZT1 A;  4IFV A;  3PV8 A;  4FLW A;  4DFP A;  4QCL A;  2D0A A;  4QAG A;  1UAX A;  4HHT A;  4ELT A;  2P1J A;  3L3U A;  5C42 A;  3OYG A;  4I7F A;  3M8S A;  3U6F A;  2HHT A;  2Y1I A;  4BE2 A;  3TAP A;  3AVI A;  4CGF A;  4CES A;  4CF2 A;  3NHG A;  1NKE A;  1L3S A;  4BDP A;  4LSL A;  2PYJ A;  4J2B A;  3NFA A;  4FJJ A;  5DMR A;  1FKP A;  4M3X A;  5FRM A;  2IAJ A;  4CJT A;  3G0Z A;  2VG6 A;  3VQP A;  4AIL C;  1QTM A;  1JLA A;  4HUF A;  3RTV A;  4XIU A;  2HHW A;  3LP3 A;  5FDL A;  1QSY A;  1CZB A;  3OJS A;  4EZ9 A;  4NCA A;  2EHG A;  3A2F A;  4B8A B;  4E7K A;  4OLA A;  4WE1 A;  1XHX A;  4CJV A;  1U48 A;  2JLE A;  1VSH A;  4FJH A;  1NK6 A;  3K58 A;  4W5T A;  1IKY A;  1LV5 A;  2I5J A;  1W0H A;  5C25 A;  1J5O A;  3B6P A;  5SWM A;  4FJ5 A;  1HYS A;  2HHQ A;  3AA4 A;  3C94 A;  1RDB A;  1Y97 A;  3M8Q A;  2PZS A;  1HYZ A;  4OGE A;  4CHP A;  4KB0 A;  2E4L A;  3PX0 A;  2QKK A;  4CGJ A;  1VSK A;  4CEZ A;  3T19 A;  4CEB A;  3O3F A;  1C1C A;  4CFC A;  4O0I A;  5J2M A;  3OS0 A;  3ZT2 A;  4CF1 A;  1I39 A;  2HVI A;  4CHY A;  1TKZ A;  2IC3 A;  1G15 A;  2VWK A;  3SYZ A;  3MXM A;  1NK7 A;  4O5B A;  3HPH A;  4ZHR A;  3VQD A;  5T7B A;  1RT3 A;  2FBY A;  3QEI A;  1TAU A;  2RPI A;  4J2A A;  2IDO A;  1C0T A;  4CGH A;  3AVL A;  4UQG A;  4CE9 A;  1WSH A;  1TK0 A;  3HST B;  1T05 A;  2AJQ A;  1JLQ A;  3VQ8 A;  3QET A;  3KLI A;  2DFH A;  3OYC A;  4FCY A;  4CK3 A;  4KAZ A;  3K57 A;  3KLF A;  3QIO A;  2KZZ A;  4KHS A;  4AHS A;  3NH0 A;  1JLE A;  3AVA A;  3DLR A;  4RW7 A;  4E19 A;  3U3G A;  3AA2 A;  1TK8 A;  3SQ4 A;  1EET A;  3M8R A;  1WLJ A;  2Z1I A;  2OPQ A;  3ZT4 A;  1TGO A;  2YNF A;  4FW2 A;  1RBS A;  3K5M A;  1HMV A;  1ZBL A;  1KSP A;  4FK4 A;  1EKE A;  4IBN A;  3KIO A;  4I2Q A;  4CED A;  4O44 A;  5E41 A;  4C8O A;  3SUQ A;  2R7Y A;  1B9F A;  4M3Y A;  3SV3 A;  3V9X A;  3SQ2 A;  2ITG A;  4KHN A;  1SUQ A;  4FM2 A;  4DQP A;  4DSJ A;  4M42 A;  2DY4 A;  1NK8 A;  1U49 A;  1WSF A;  2D0B A;  3S3M A;  4IFY A;  3HL8 A;  4DTP A;  1WAJ A;  4Z4G A;  4OKE A;  3NAE A;  1HPZ A;  1TL3 A;  3I0R A;  4DQR A;  1IG9 A;  2HW3 A;  3KKS A;  4DTN A;  3AVK A;  4O55 A;  4DQQ A;  4KTZ A;  1D9F A;  1LW2 A;  1RBU A;  3VQ7 A;  1R0A A;  1TKX A;  3P83 D;  3ZSW A;  4DF8 A;  3SZ2 A;  1WSE A;  3NCI A;  4NCB A;  3OS2 A;  3NE6 A;  5CYM A;  4AHV A;  1BGX T;  1S9G A;  2HHV A;  2DTU A;  2HHU A;  3THV A;  2XY8 A;  4EZ6 A;  3V81 A;  1U47 A;  4CJP A;  3HP6 A;  1UWB A;  1RT4 A;  4IG3 A;  4JS4 A;  4DSE A;  4CJU A;  4FJG A;  2JGU A;  3WNG A;  4Z4F A;  3NH2 A;  3OYH A;  1SL0 A;  2E6L A;  4ID5 A;  1JXE A;  3L2R A;  4K8Z A;  4MQ3 A;  1D5A A;  1QQC A;  2G8H A;  4CEE A;  1IKX A;  4PQU A;  3RR8 A;  4CJ5 A;  2FBX A;  3K5N A;  4FYD A;  4DS4 A;  4HCC A;  1WSJ A;  2XO7 A;  1HJR A;  1VSM A;  1VRU A;  2YKM A;  4DS5 A;  3HO1 A;  1GOB A;  1NOZ A;  1S5J A;  4GW6 A;  1I3A A;  3UIQ A;  3C95 A;  4CJQ A;  4CGG A;  3OYB A;  4AHC A;  5HRS A;  1X9W A;  3I8D A;  2O4I A;  3V1O A;  3OYN A;  2FBT A;  1SKW A;  3RMD A;  4FZZ A;  4EP5 A;  3SUP A;  5HP1 A;  2YKN A;  3NDK A;  2KTQ A;  1RT1 A;  4B9T A;  4DTX A;  1DLO A;  4W5R A;  3L3V A;  2OPS A;  1HYV A;  4KFB A;  3ZSV A;  4CHQ A;  4C8N A;  3KD1 E;  1LAV A;  3PY8 A;  1VSJ A;  1BCO A;  2WON A;  2XRI A;  2Z1G A;  5C24 A;  3AVH A;  4BWJ A;  1XI1 A;  2G8W A;  2G8U A;  4HVJ A;  2BDP A;  4Q0B A;  4DQS A;  4CGI A;  1VSD A;  2BE2 A;  1D8Y A;  3OYI A;  5FRN A;  4CJS A;  1Q8I A;  2HNY A;  3KK2 A;  1NKC A;  1KFS A;  4FLX A;  1KLM A;  1VSI A;  3DLE A;  5CZ2 A;  3QIP A;  5KI6 A;  3OYF A;  4DTR A;  3V9S A;  4Z0U A;  1NOY A;  2F8T A;  1J9A A;  4NCG A;  3HJF A;  3OJU A;  3AO2 A;  1SL2 A;  3QO9 A;  1J53 A;  3S9H A;  4FJ9 A;  2D0C A;  5KGX A;  4ELV A;  3AVF A;  4DSF A;  3EYZ A;  1NK4 A;  4DTS A;  1B9D A;  1YVU A;  4N47 A;  4CFA A;  4CHZ A;  1IKW A;  1S6P A;  2XY5 A;  1RBV A;  3NGZ A;  2ZD1 A;  3CG7 A;  4LD0 A;  4CFB A;  3IS9 A;  4CF0 A;  3MED A;  3ZT0 A;  4FLT A;  3NF9 A;  2P5O A;  4IKF A;  2O4G A;  1U04 A;  4CFD A;  4OVL A;  3QEW A;  4NYN A;  3SJJ A;  3LAM A;  4C8M A;  3HPO A;  4HCB A;  3OYA A;  3K5O A;  4OPJ A;  4N56 A;  4RW4 A;  3OYD A;  1BQM A;  1QHT A;  3DRP A;  3F9K A;  3V9U A;  4OPK A;  4KTW A;  2G8V A;  1DTQ A;  2BAN A;  1RTJ A;  4OJR A;  4CHN A;  1ASW A;  3TR8 A;  1NK9 A;  4E89 A;  4LH4 A;  3T3F A;  4LSN A;  3L2U A;  3SNN A;  1JKH A;  3QNN A;  3LP2 A;  4DFJ A;  3IAY A;  2P5G A;  1LAW A;  4KHY A;  4B9N A;  1RIL A;  3MEC A;  5JS2 A;  3D45 A;  4FXD A;  4CK1 A;  2EX3 A;  3ZT3 A;  4HUE A;  3TAB A;  4ZTF A;  3TWH A;  4CER A;  1HQU A;  4K8X A;  3VQ6 A;  3K5L A;  3AO3 A;  1X9S A;  1SKS A;  1NK5 A;  3AA5 X;  1TKT A;  4CK2 A;  1VK0 A;  4KI4 A;  1BQN A;  1EX4 A;  1RTD A;  4CGD A;  1KVC A;  1W9H A;  3NBP A;  4G1Q A;  3LWL A;  1NKB A;  5HBM A;  3QEP A;  4FJ8 A;  3DOK A;  3RMC A;  1BI4 A;  4B9U A;  1K6Y A;  1BIZ A;  3KD5 E;  3G10 A;  4RG8 A;  1JXB A;  5HRP A;  1KVA A;  3CQ8 A;  3IG1 A;  1TKD A;  2OPR A;  3LWM A;  4QOZ B;  2FC0 A;  3VQQ A;  5HRN A;  1RTI A;  4RW6 A;  3OYJ A;  1RDD A;  3D0P A;  2OA8 A;  4KKO A;  1NJY A;  2B6A A;  1NJX A;  3BGR A;  1WNS A;  2GBZ A;  5KRT A;  3OYE A;  1FKO A;  1SV5 A;  4AHT A;  1T8E A;  3RWU A;  4I2P A;  4B8C A;  2KFN A;  1U45 A;  2YHB A;  3ITH A;  5J2N A;  3V9Z A;  4CJR A;  2KZM A;  3ZSZ A;  3ZSQ A;  3PO4 A;  1ZBH A;  4B9L A;  2IGI A;  3T1A A;  1HRH A;  3H08 A;  4IG0 A;  2Y1J A;  3SCX A;  4E3S A;  1DTT A;  3HPG A;  4DU1 A;  3TAG A;  4DLE A;  3SQ0 A;  3DM2 A;  3AO4 A;  3VQC A;  3HYF A;  4N76 A;  3SPZ A;  4CHO A;  4PWD A;  1QE1 A;  1WN7 A;  3I0S A;  3RMA A;  1VRT A;  3AVM A;  3TAR A;  5EU7 A;  4DSL A;  2ATQ A; 
#chains in the Genus database with same CATH topology
 5KQD A;  1S1X A;  3NVK A;  4GV3 A;  3OY9 A;  2F8S A;  1OH5 A;  2E2Q A;  4QS9 A;  3LZI A;  4NYF A;  2RF2 A;  2JWL A;  4C8K A;  2QWR A;  4AHR A;  3P5J A;  4FJI A;  5AQS A;  3F73 A;  3O4Q A;  3CCU N;  2O8E A;  3DMJ A;  1KCF A;  1N6Q A;  2E2O A;  3RR7 A;  4JLH A;  2VG5 A;  1KRP A;  4WFB L;  1N5Y A;  4FK2 A;  4E0D A;  3OYK A;  4UY8 O;  4A2A A;  2B4J A;  3H46 O;  3HVR A;  4JI1 K;  3TAE A;  2QEX N;  3DJC A;  5AR0 A;  1XC9 A;  2UYT A;  1UA1 A;  4CF9 A;  4BDZ A;  4W5Q A;  1MWM A;  1LW0 A;  3VEY A;  4EHU A;  3ULE A;  4MLH A;  3C6T A;  2YHX A;  3KVG A;  4FJL A;  2RKI A;  3RRH A;  2FF3 B;  3FZF A;  1L3T A;  2YHW A;  2Z1H A;  1S6Q A;  3QES A;  1N33 K;  4PL8 A;  4LY7 A;  3V6D A;  3QB0 A;  1E3M A;  4F2S A;  4FJM A;  2H3G X;  3U8X A;  4FM0 A;  3PLA A;  4JK9 A;  4C1N I;  4YOT A;  1KVB A;  3OYL A;  3AAR A;  1QSS A;  1L3V A;  3PX4 A;  2YNG A;  4DTM A;  2X6S A;  3CYM A;  1ATS A;  4IWV A;  4HTL A;  1IO2 A;  2G8K A;  1NWK A;  3TSP A;  1NK0 A;  3DXM B;  2FSK A;  3G25 A;  3QIC A;  3DLB A;  3TTD A;  4FVU A;  4FJN A;  4BRQ A;  2GUI A;  1RNH A;  3MEE A;  1NJI O;  3CCJ N;  3HOS A;  3CIP A;  3LDS A;  4GVM A;  3L8B A;  5DK5 A;  1WBB A;  3VQ9 A;  4L8R B;  1EWR A;  3ZET A;  1BA0 A;  1O13 A;  3CXC M;  3DWL A;  1RBR A;  2VG7 A;  3VN5 A;  1RDA A;  4JRP A;  3P38 A;  4IDH A;  5AQQ A;  2IOC A;  3VMF B;  3G6E N;  4BVO A;  3CFO A;  3NF6 A;  5JS1 A;  4DCH A;  2HVH A;  1ZBU A;  4ILG B;  4DTJ A;  2GUP A;  2KW4 A;  1TUU A;  5AZI A;  4JD2 A;  4YY3 K;  1BIU A;  1JLC A;  3L2Q A;  1GLC G;  4O0J A;  4CJL A;  4BE1 A;  2OYQ A;  3NVM A;  4QS7 A;  2QI2 A;  2QXF A;  4K25 A;  3VPZ A;  1BHL A;  4BRK A;  5HRO A;  5J2P A;  5HLF A;  1EQY A;  4DLG A;  2D5R A;  1XMQ K;  1Z25 A;  3LL3 A;  1C0M A;  3O5B A;  1QQM A;  4HUG A;  3VQB A;  4LFB K;  4DQI A;  4Q5V A;  4B1Y B;  1X9M A;  4BC3 A;  1GLB G;  1NGF A;  3VA3 A;  3HP9 A;  1ITG A;  4L3Q A;  1VQL N;  2DFF A;  4DSI A;  1IKV A;  4Z4C A;  2KQ2 A;  2P9I B;  1YT3 A;  2A1R A;  4FJK A;  1HKC A;  1YHQ N;  3K59 A;  3WXK A;  4IO8 A;  3CMA N;  1D9D A;  5MLC Q;  1KAY A;  4B9S A;  1KXP A;  2V7Z A;  4JKF A;  1NMD A;  3L2V A;  3CJ1 A;  1NNE A;  4H0V B;  4B9M A;  1VSL A;  2P9L B;  3EEQ A;  2UUB K;  1JL1 A;  3HK2 A;  1BCM A;  3FFI A;  3VA0 A;  4FZY A;  3OYM A;  3AVJ A;  5FLX O;  3VGK A;  5HOO A;  4HHT A;  4XH5 A;  4I7F A;  4KH6 A;  1T3V A;  2VCP A;  1BG3 A;  2HHT A;  3AVI A;  4CGF A;  4CES A;  4CF2 A;  3U9D A;  4BDP A;  2WFB A;  4EAH D;  3NFA A;  3ENH A;  3VQP A;  3RTV A;  2A5X A;  4XIU A;  1CZB A;  4BR5 A;  4DUZ K;  4WE1 A;  1XHX A;  3WQT A;  1U48 A;  1VSH A;  3M1F A;  5LMU K;  3MCA B;  4YOU A;  5C25 A;  3SK3 A;  5SWM A;  4FJ5 A;  1HYS A;  2HHQ A;  3AA4 A;  3GDQ A;  2ITM A;  1Y97 A;  3FZL A;  4IFE A;  1IBL K;  4CGJ A;  4CEZ A;  3H45 C;  4BC5 A;  4O0I A;  4YOW A;  5M1O A;  4JKD A;  1I39 A;  3SYZ A;  1RT3 A;  4CD3 A;  3CC7 N;  1TUY A;  4LF5 K;  5M1Q A;  2IDO A;  1C0T A;  3HST B;  3VEZ A;  1T05 A;  1JLQ A;  3EZW A;  4FCY A;  4CK3 A;  3K57 A;  5E84 A;  4AHS A;  3NH0 A;  4RW7 A;  4BR2 A;  4FOE A;  4E19 A;  3U3G A;  3SQ4 A;  1WLJ A;  3MN6 A;  2YNF A;  3HZ6 A;  4B9Q A;  3K5M A;  1ZBL A;  4BRL A;  5BRD A;  3KIO A;  3OA9 A;  4I2Q A;  4C8O A;  3LDP A;  2R7Y A;  4X64 K;  1SUQ A;  1S22 A;  1NK8 A;  3O1W A;  3S3M A;  3BZK A;  2W6L A;  1WAJ A;  3HRG A;  3NAE A;  1HPZ A;  3I0R A;  1IG9 A;  4IOX A;  5KPZ A;  3AGR A;  2EWS A;  2HF3 A;  2IVN A;  1RBU A;  4DHY A;  4A62 A;  2P9N B;  5GIP A;  3NCI A;  3OS2 A;  1BGX T;  4RTF D;  2HHU A;  5C0Y A;  4JKE A;  3V81 A;  1U47 A;  4CBW A;  2O8D B;  5AQV A;  2JGU A;  3OYH A;  1SL0 A;  4ID5 A;  1JXE A;  4MO5 A;  5AQL A;  2ZJR L;  2G8H A;  4CEE A;  1EO1 A;  4BRN A;  3RR8 A;  5M1N A;  4FYD A;  4I6M A;  1VSM A;  1NLV A;  1VRU A;  3HO1 A;  3HI0 A;  1NOZ A;  3UIQ A;  1I3A A;  2ZWH A;  3OTO K;  3C6H A;  1VAZ A;  2D4W A;  4DTX A;  5A2Q O;  4JI5 K;  3D6R A;  1DLO A;  4BQZ A;  1HYV A;  4DUY K;  4C8N A;  4A57 A;  1XI1 A;  4BR4 A;  4Q0B A;  2BE2 A;  1D8Y A;  2YJE A;  5FRN A;  4CJS A;  2HNY A;  2FXU A;  3U9Z A;  2RHK A;  3DLE A;  1HKB A;  5CZ2 A;  3QIP A;  1DEJ A;  3IFR A;  3OYF A;  1NOY A;  2HF4 A;  4CZK A;  4PKI A;  1J9A A;  3CPE A;  3OJU A;  4LF7 K;  3AO2 A;  5AQG A;  5BN8 A;  1J53 A;  4BG8 A;  5KGX A;  2Q31 A;  5M1F A;  1B9D A;  3OHR A;  1W2B M;  4CZE A;  2XY5 A;  2ZD1 A;  2NRV A;  3MED A;  3ZT0 A;  3L4I A;  3CQX A;  4IKF A;  1U04 A;  3HM8 A;  3BZC A;  5AZJ B;  3CJ9 A;  3ATU A;  3OYA A;  4K41 A;  3K5O A;  4KTW A;  4NLB A;  2KLA A;  4CHN A;  4DKW A;  4PHT X;  1JKH A;  3LP2 A;  3SLC A;  1Q81 O;  1RIL A;  5JS2 A;  3Q7C A;  4XH4 A;  2F9W A;  2P9K A;  4FXD A;  2EX3 A;  3ZT3 A;  4KHP K;  4CER A;  2OCE A;  4Z94 A;  1HQU A;  3ZYY X;  3VQ6 A;  1X9S A;  2RE2 A;  1TKT A;  5JIC A;  4DV3 K;  4KI4 A;  1BQN A;  5AQR A;  1EX4 A;  1RTD A;  1E4F T;  4CGD A;  3BUZ B;  3NBP A;  4G1Q A;  3LWL A;  5HBM A;  4CZL A;  3QEP A;  1N8R O;  3DOK A;  1W7A A;  2JWK A;  2A41 A;  1Z05 A;  1K6Y A;  4BRP A;  3C7N A;  3G10 A;  4RG8 A;  1TKD A;  4JKB A;  2FC0 A;  4YOY A;  5HRN A;  5BRF A;  1NJY A;  1HJO A;  3E9O A;  3EE8 A;  3H1Q A;  1WNS A;  4GVE A;  1FKO A;  3A5M C;  1HNX K;  2E88 A;  2YHB A;  3CET A;  3ITH A;  5J2N A;  3ZSQ A;  1YIT N;  4KRE A;  3HPG A;  3TAG A;  2QWL A;  4N76 A;  4A5B A;  4DSL A;  4M45 A;  3BDP A;  4CIG A;  4CEQ A;  1NGJ A;  1Q18 A;  3LPT A;  4BRO A;  2YHA A;  3O3G A;  3CFP A;  1VQP N;  3QNO A;  2BTF A;  3K9K A;  3VQA A;  1ASU A;  4FK0 A;  4CJE A;  3S3O A;  2ZJP L;  2RN2 A;  4MDA A;  1S1T A;  4CJW A;  2XY6 A;  1W97 L;  2PBD A;  4N5S A;  4C23 A;  3E1Y A;  3L4Q A;  3M8P A;  2HHS A;  4IOC L;  3FR0 A;  4YDU C;  2QK9 A;  2QW9 A;  3EZ5 A;  1K73 O;  1Q7Y O;  3MXI A;  3MXJ A;  2GWK A;  3IUC A;  1ESV A;  4WFA L;  4CJF A;  2XHB A;  4FOI A;  2WTU A;  4JNE A;  3DOL A;  3EN9 A;  3QIN A;  3B8A X;  2E1Z A;  4FVM A;  1L3U A;  1YTA A;  1SKR A;  5K14 A;  3T1Y K;  1QZ6 A;  2VWB A;  3GBT A;  2YI1 A;  3V1Q A;  1HNI A;  4H0Y B;  4TSX A;  1RT7 A;  4KH5 A;  4CJ3 A;  4CBU A;  4IJA A;  4DFM A;  4X62 K;  3AA3 A;  3CJC A;  1RT2 A;  2Q3S A;  2YNH A;  3MEG A;  4MFB A;  4W5O A;  4I9L A;  4IDK A;  3AV9 A;  1HQE A;  4HTU A;  4M3U A;  3T69 A;  4HWI A;  2HMI A;  1LWE A;  2F9T A;  3SUN A;  3NMU A;  3CM5 A;  1WAF A;  1RDC A;  4KTQ A;  4W5N A;  3KTQ A;  1S1W A;  3D2E B;  4J2E A;  3OVN A;  3QLH A;  3LAK A;  3THX A;  4AM6 A;  1NGE A;  3K9J A;  3CM6 A;  3DLK A;  2HHX A;  1YF5 L;  3DXK B;  5BR9 A;  1KTQ A;  4E7L A;  4ICL A;  3RVC A;  3KJV A;  3O9Q A;  3VGM A;  5GIN A;  2XY7 A;  4KI6 A;  3VEN A;  3CJB A;  4CW7 B;  1C1B A;  2WC9 A;  1IBK K;  2GV9 A;  3VQE A;  3RMB A;  4GKK K;  1F21 A;  1X3M A;  4OGC A;  3ZEU A;  4LF9 K;  3CCE N;  4Z4H A;  4ISF A;  2P51 A;  1M1K O;  3JS6 A;  3EY1 A;  3ZCM A;  3SI6 A;  1RTH A;  4F3T A;  4DFK A;  4F8R A;  3GE1 A;  2HNZ A;  5AQX A;  2Z1J A;  1S9E A;  4F3O A;  2O8E B;  1ASV A;  1JLG A;  3JAM O;  4RCH A;  4DMN A;  5AQP A;  5EY4 A;  4DV7 K;  1VQ5 N;  5FPN A;  1LWC A;  1Q9Y A;  3E01 A;  3EKS A;  4E7J A;  4FSV A;  4QS8 A;  4PA1 A;  4FM1 A;  1NJW A;  4BQL A;  2E2P A;  1K8K A;  3H3O B;  4ID1 A;  3O9T A;  4MO4 A;  2KFZ A;  3ULE B;  1IH7 A;  4KHU A;  1K9M O;  3C65 A;  3NF8 A;  4B1W B;  3VER A;  3TAM A;  2LSN A;  2QWM A;  1VQN N;  3FFK B;  2D1K A;  3TSU A;  4M3W A;  3MAQ A;  2W40 A;  1A5W A;  3PIO L;  3P4I A;  3PSF A;  3HVT A;  2GX9 A;  3V4I A;  1OVQ A;  4H5R A;  4CVN E;  4YDU A;  3HXM A;  4FLY A;  3VEV A;  3J8A A;  2PYL A;  3FLC O;  4F2R A;  4M41 A;  3HM9 A;  3AVC A;  3KKR A;  2NRW A;  3U3Y A;  4CZH A;  4Y1D A;  2ASM A;  3KLE A;  2B5J A;  3G71 N;  4JI4 K;  1T7P A;  3DRS A;  4H5W A;  4CF8 A;  1WBD A;  4Z4E A;  1J54 A;  3NGI A;  3KLG A;  2CH6 A;  2QWQ A;  3CCV N;  1U4B A;  4N41 A;  3FZM A;  4IFV A;  4FLW A;  2D0A A;  3ZET B;  1KAX A;  2HMP A;  3NHG A;  3IMX A;  3C6A A;  5FRM A;  3SAG A;  4M3X A;  3G0Z A;  2VG6 A;  4JYA K;  5AQH A;  4HUF A;  2HHW A;  3LP3 A;  4EZ9 A;  1QSY A;  4ILJ A;  2EHG A;  3MX5 A;  3A5O C;  2JLE A;  3A8Y A;  4WQ4 C;  1NK6 A;  1IKY A;  1LV5 A;  2UXB K;  1J5O A;  5AZI B;  4JD2 B;  3I55 N;  1V4T A;  3C94 A;  3M8Q A;  2PZS A;  4KB0 A;  4BRI A;  3PX0 A;  5ELZ A;  1VSK A;  2NLX A;  1C1C A;  5J2M A;  3HSC A;  3ZT2 A;  1MDU B;  4CF1 A;  1G15 A;  2VWK A;  4O5B A;  3VQD A;  3QEI A;  4FWK A;  3AVL A;  1WSH A;  4H0P A;  1TK0 A;  2HBJ A;  3VQ8 A;  2GWJ A;  2KKZ A;  3KLI A;  2KZZ A;  1LOT B;  3AVA A;  1NGA A;  1CZA N;  3UKU B;  1EET A;  3ZX2 A;  3M8R A;  3WXI A;  2Z1I A;  3ZT4 A;  3CD6 N;  1TGO A;  4FW2 A;  5GIO A;  1RBS A;  1HMV A;  4IEE A;  1KSP A;  4FK4 A;  1BUP A;  3BF1 A;  5DM7 L;  5E41 A;  4CI6 A;  1B9F A;  4M7Y A;  4B3M K;  3SV3 A;  3V9X A;  4M42 A;  4DSJ A;  2NZT A;  2DY4 A;  2D0B A;  5AQU A;  3HL8 A;  4OKE A;  1ZXO A;  1TL3 A;  3H6E A;  2HW3 A;  4B1Z A;  4BY9 C;  4DTN A;  2ZGY A;  3SJH A;  4DF8 A;  2E2N A;  4NCB A;  5KQ8 A;  5CYM A;  4M7X A;  2CGJ A;  1S9G A;  1X3N A;  3R9P A;  2HHV A;  4EZ6 A;  3U4L A;  4NXN K;  4FL9 A;  3HBT A;  4NO7 A;  3CJA A;  4JI3 K;  1WB9 A;  4CJU A;  4FJG A;  3WNG A;  4GKJ K;  3CF5 L;  3H1V X;  1QQC A;  4PQU A;  2FBX A;  5AQT A;  3HOT A;  4HCC A;  2XO7 A;  1HJR A;  4DS5 A;  2QTD A;  3ID6 A;  4GW6 A;  1NG9 A;  4CGG A;  3OYB A;  3I8D A;  1XUP O;  3OYN A;  3SUP A;  5HP1 A;  2YKN A;  4B9T A;  3LDN A;  5JLH A;  4W5R A;  3L3V A;  5IWA K;  3VEW A;  3EKU A;  4CHQ A;  4JKG A;  4EFH A;  2Q97 A;  4DR1 K;  5KPR A;  1VSJ A;  2XRI A;  2Z1G A;  2G8U A;  1YXQ A;  3P31 A;  1VSD A;  1Q82 O;  5EVZ A;  1C0G A;  3I56 N;  2DPN A;  4FLX A;  1IBM K;  3I8B A;  3SMP A;  1XNR K;  5KI6 A;  4DTR A;  4DV0 K;  3WT0 A;  2F8T A;  4NCG A;  2VYP A;  4H5T A;  3PSI A;  5ADX A;  4O8U A;  3KWI A;  5JVG L;  2VQE K;  1SL2 A;  3QO9 A;  3S9H A;  1DT9 A;  4BRC A;  4X65 K;  4ELV A;  4DSF A;  1BWF O;  1N32 K;  1DKG D;  1YVU A;  2BH1 A;  3I33 A;  4AM7 A;  1IKW A;  5AQZ A;  4CFA A;  4CHZ A;  4E1J A;  5JLF A;  3CC4 N;  2P9I A;  3E9L A;  1T6D A;  2OAN A;  3SJJ A;  4JI2 K;  4V19 S;  3VTH A;  4BRE A;  2GEL A;  4RW4 A;  3OYD A;  1BQM A;  1QHT A;  4AF1 A;  1BA1 A;  4OPK A;  4OJR A;  2Q2R A;  3TR8 A;  1NK9 A;  4LF6 K;  2O8F A;  3SNN A;  1NGB A;  3IAY A;  4DFJ A;  5IT9 O;  2P5G A;  1R59 O;  3LDO A;  3D45 A;  2P9P A;  3TWH A;  2D0P A;  2P9S A;  4GY2 B;  2NRR A;  1HPM A;  1SKS A;  4WYB A;  1XMO K;  1FW6 A;  3ZLJ A;  3MWT A;  1HKG A;  1W9H A;  3A5L C;  5AQF A;  4I6M B;  4FJ8 A;  1BI4 A;  4B9U A;  3G4S N;  3FZK A;  2PFU A;  2CGK A;  2A42 A;  1JXB A;  4DR7 K;  5HRP A;  5H1S Q;  3CQ8 A;  2OPR A;  3VQQ A;  1NGH A;  1RTI A;  3FGU A;  3QFP A;  4FWN A;  3OYJ A;  2OA8 A;  4KKO A;  3BGR A;  3OYE A;  3RWU A;  3J81 O;  4H5N A;  4AHT A;  4I2P A;  2KFN A;  4DV6 K;  4CJR A;  3PO4 A;  5AQN A;  4O8K A;  2IGI A;  3T1A A;  4ELT A;  4IG0 A;  3SCX A;  4E3S A;  4A61 A;  3DM2 A;  3VQC A;  3HYF A;  4JK7 A;  3SPZ A;  1QE1 A;  1WN7 A;  5CR4 A;  5EU7 A;  2ATQ A;  2HHH K;  2E8A A;  1QZ5 A;  2OZM A;  4FLZ A;  4WFN L;  3WXJ A;  3THY A;  4BVP A;  1HNV A;  4RW9 A;  5BR8 K;  1T03 A;  4DSK A;  4OX9 K;  2FSJ A;  4CEF A;  1RGI A;  4AH9 A;  4G9Z A;  4JI6 K;  4RW8 A;  3SUO A;  2O8C A;  1U2V B;  3DLL L;  4FWO A;  4GV9 A;  4OO1 J;  4E7I A;  1C6V A;  4DV5 K;  5AQJ A;  2A3Z A;  1IG8 A;  3SAH A;  3QEX A;  4Z4I A;  1N34 K;  1GOA A;  3WUH A;  2I7P A;  4CIE A;  5BPL A;  1ZBF A;  3EL2 A;  4FJ7 A;  4KV8 A;  3RSE A;  4CZI A;  4BE0 A;  4U7B A;  3SAF A;  2PAV A;  3CC2 N;  4GNI A;  4ZTJ A;  3CME N;  1J6Z A;  1RT6 A;  1S72 N;  4Y0W A;  1REV A;  3AO5 A;  1GLF O;  4OPH A;  4EIA A;  4BAC A;  2O8D A;  4DTU A;  4JK8 A;  1UOC A;  1QQO A;  4CEC A;  3ISN C;  3O08 A;  3OBW A;  5AFU A;  3WNE A;  3VET A;  2HND A;  4GMJ B;  4DB3 A;  4JHD A;  1NBW A;  5CZ1 A;  1TVR A;  1RDW X;  4K42 A;  3LP1 A;  4LC9 B;  4H4M A;  3TI0 A;  1QHA A;  1HLU A;  1ATR A;  3QER A;  4EP4 A;  4AHU A;  5D3G A;  1VSF A;  4E7H A;  3O4N A;  3UKR B;  1YTU A;  4IJN A;  2YNI A;  3O8M A;  3DLH A;  1GLD G;  5FRO A;  2PY5 A;  5C15 A;  5HRR A;  3DRR A;  3VQ4 A;  1NGG A;  4A2B A;  3J7A P;  1JJ2 M;  3SV4 A;  1YVN A;  3VF4 A;  2VWJ A;  4DF4 A;  3AVB A;  4BWM A;  4H4O A;  2ASO A;  3JSM A;  2BGG A;  4FW1 A;  1CXQ A;  1OVY A;  1BU6 O;  3KK7 A;  3W3D A;  3ZSO A;  1XWL A;  4CIF A;  1M90 O;  4CJ4 A;  2ASP A;  4IOA L;  5AZJ A;  2VGN A;  1BOT O;  4XH1 A;  3LAN A;  3N4Q A;  4OKJ A;  4A5A A;  2X6N A;  4BC2 A;  1VQ6 N;  2X74 A;  1FK9 A;  2P9U A;  2HBM A;  3ENO A;  4I9Q A;  1Q9X A;  4YNQ A;  3F5T A;  4DR4 K;  1YIJ N;  1TL1 A;  1C1A A;  5CY4 A;  4CZG A;  1XC3 A;  3QML A;  5CYQ A;  4JN4 A;  3ULD A;  2QWO A;  2YCH A;  4BG9 A;  4H8K A;  3LAL A;  5CE3 A;  1L5U A;  1MU2 A;  4KHW A;  2DFE A;  1JLB A;  2CGL A;  1EXQ A;  4IXC A;  3KWG A;  1TK5 A;  3L0Q A;  3ZSY A;  3TAN A;  1BIS A;  3NGY A;  3DI6 A;  1LCU A;  4WCE L;  3PO5 A;  1X1P A;  1T6C A;  3KK1 A;  4DV1 K;  3NF7 A;  3P1G A;  3TSQ A;  2F96 A;  3ZSX A;  2HB5 A;  1JCG A;  1KLN A;  3DLG A;  3ZT1 A;  4QAG A;  1UAX A;  3AY9 A;  3OYG A;  2GEM A;  3M8S A;  3U6F A;  4WF9 L;  2Y1I A;  4BE2 A;  3TAP A;  3EO3 A;  1NKE A;  1XNQ K;  1XQS C;  3O80 A;  1T44 A;  4LSL A;  3ZEU B;  2PYJ A;  4J2B A;  4FJJ A;  2ZF5 O;  1FKP A;  2IAJ A;  2Q1N A;  2UUC K;  1QTM A;  1JLA A;  4FPB A;  2HBK A;  3J80 O;  5FDL A;  3OJS A;  2ZM6 K;  4W5T A;  2I5J A;  4DR3 K;  2IVP A;  4CD1 A;  4A59 A;  4OGE A;  1H1V A;  4CHP A;  4JI7 K;  1ILY A;  4RWT A;  1U6Z A;  2YJF A;  4CFC A;  3OS0 A;  3GOI A;  1KQS M;  2A6A A;  3SBT A;  3MXM A;  1NK7 A;  3QFU A;  5C2F A;  4JKC A;  2F4V K;  2FBY A;  2KHO A;  1NM1 A;  4J2A A;  4CGH A;  2E20 A;  1EWQ A;  5JVH L;  3MDQ A;  3MN7 A;  4OPA A;  1TYQ A;  2AJQ A;  3D7E O;  3Q7B A;  3QET A;  3OYC A;  2DFH A;  4KAZ A;  3KLF A;  3QIO A;  1X9J A;  4KHS A;  4O5F A;  4JKH A;  3AA2 A;  1TK8 A;  3T7Z A;  4NB4 A;  4BRH A;  3DAW A;  2OPQ A;  3GG4 A;  4CED A;  4O44 A;  3AAQ A;  4M3Y A;  2ITG A;  4KHN A;  4YOV A;  4DQP A;  3THW A;  2O8B A;  4DTP A;  4Z4G A;  4DQR A;  2J4R A;  1D4X A;  3O9R A;  4O55 A;  4DQQ A;  1D9F A;  1LW2 A;  3MK6 A;  2CH5 A;  4DV2 K;  1TKX A;  3P83 D;  3ZSW A;  3SZ2 A;  1VQK N;  1WSE A;  4JV5 K;  4AHV A;  4X66 K;  4JAX A;  1Z6R A;  1WUA A;  3IDH A;  2IVO A;  2E5L K;  3HP6 A;  5GAG P;  3PIP L;  4YHH K;  3BY5 A;  4IEI A;  1G99 A;  4IG3 A;  1QVF M;  4DSE A;  1J5E K;  3L2R A;  4K8Z A;  5AQY A;  1D5A A;  1IKX A;  4CJ5 A;  2W6K A;  4FWM A;  4EHT A;  1MA9 B;  2YKM A;  3KHY A;  4CZF A;  3MN9 A;  4AHC A;  5HRS A;  5AQO A;  3WEE A;  2FBT A;  4FZZ A;  4ISE A;  1RT1 A;  5FPM A;  1ATN A;  4BR9 A;  1NU0 A;  4B3R K;  2OPS A;  3ZSV A;  4YOX A;  3AVH A;  4BWJ A;  3QBX A;  3S41 A;  2BDP A;  1VQ7 N;  3OYI A;  1Q8I A;  4GV6 A;  2OTJ N;  1NKC A;  1KLM A;  3MMV A;  3D2F A;  4LFA K;  3V9S A;  4B3S K;  3LM2 A;  3EE9 A;  4FPA A;  1C0F A;  4FJ9 A;  2QA4 N;  4B3T K;  4DTS A;  4H0T B;  2YX6 A;  4N47 A;  1RBV A;  3NGZ A;  3CG7 A;  4LD0 A;  1E4G T;  3IS9 A;  3UE5 A;  4CF0 A;  4FLT A;  3WXL A;  3NF9 A;  2P5O A;  4CFD A;  4NXM K;  4OVL A;  4CBX A;  3QEW A;  1GLE G;  2V51 B;  3HPO A;  2HST A;  2F7T A;  4HCB A;  4OPJ A;  3MN5 A;  4N56 A;  3ID8 A;  3DRP A;  2G8V A;  2BAN A;  1RTJ A;  3VGL A;  1ASW A;  4DR5 K;  4LH4 A;  3AGK A;  3QNN A;  1RDU A;  1JCE A;  1OH7 A;  2VGM A;  3BP8 A;  5F1X A;  5GAE P;  1GLL O;  2ZGZ A;  1VQ9 N;  3ATV A;  1I94 K;  3ZX0 A;  5LJW A;  2FSN A;  4CZJ A;  2HOE A;  5FPE A;  1HUX A;  3K5L A;  3P39 A;  1YAG A;  3MCP A;  3AA5 X;  4CK2 A;  5M1K A;  3T1H K;  1P90 A;  1NKB A;  1VQM N;  4PL7 A;  3M3Z A;  3RMC A;  2HBL A;  2GTD A;  3KD5 E;  4K43 A;  1KVA A;  3IG1 A;  3SBG A;  4RW6 A;  5BRH A;  1OH6 A;  5GAH P;  4M63 C;  1NJX A;  2GBZ A;  2V7Y A;  1SV5 A;  4LF4 K;  4B8C A;  3DXM A;  4JKG B;  1U45 A;  3LDL A;  4R79 A;  3V9Z A;  3LDQ A;  3ZSZ A;  4OLA A;  3TAQ A;  1HRH A;  1NMN A;  2Y1J A;  3OW2 M;  1DTT A;  4DLE A;  3TU5 A;  3AO4 A;  3R8E A;  2VQF K;  1SS6 A;  2UXC K;  4PWD A;  1BDG A;  3RMA A;  3VEO A;  1VRT A;  4JEP A;  4FWQ A;  4PKG A;  3CI5 A;  1EP4 A;  3OBY A;  1XHZ A;  1NGD A;  4MLE A;  1WSI A;  2QKB A;  3JYT A;  1Q86 O;  4FWS A;  3IRX A;  1CLQ A;  3V9W A;  3UKU A;  4CJ7 A;  3CCL N;  2NNW A;  5KGW A;  2WOM A;  1JCF A;  4ILH A;  5LMN K;  1JLF A;  3ASM A;  3L2W A;  3LZJ A;  3S3N A;  4C1N K;  5CHI A;  4CCH A;  5I9E B;  4LH5 A;  3LPU A;  4KB1 A;  2A1S A;  4F4K A;  1N36 K;  4OLB A;  3C6U A;  3KK3 A;  2O8F B;  4J2D A;  1ZYQ A;  4BRF A;  3M6G A;  1P8Z A;  1V4S A;  3C0B A;  4LF8 K;  4OKK A;  5J1E A;  5I42 A;  3SPY A;  1GOC A;  4FO0 A;  1TAQ A;  4CJK A;  4KPY A;  4FZX C;  4DU3 A;  4JI8 K;  2P9P B;  4WQ4 A;  4B1V A;  4BR0 A;  5GAD P;  4PY5 A;  4KO0 A;  3OS1 A;  2P9S B;  5TKY A;  3BF3 A;  3R1X A;  2X78 A;  1S1V A;  3AVG A;  3NH1 A;  5KTQ A;  2QWN A;  1VSE A;  5I3U A;  3CFR A;  1GLA G;  2OPP A;  2FLO A;  3PUF A;  3J7Z O;  1BI4 B;  1C0U A;  4B3O A;  2G8I A;  1A5V A;  1YJ9 N;  3V1R A;  4BRM A;  5C10 A;  4DQ8 A;  3RRG A;  4KHQ A;  4IO9 L;  1B92 A;  1SL1 A;  1KAZ A;  4JRQ A;  2UU9 K;  4NLC A;  1DGK N;  3TAF A;  3JXU A;  2W41 A;  3QEV A;  1WSG A;  4M3R A;  1LWF A;  2ETJ A;  5J2Q A;  3WNF A;  2P9L A;  3CER A;  3DYA A;  3CJ7 A;  4CEO A;  1RBT A;  4DR2 K;  1QS4 A;  4DG1 A;  1RT5 A;  3FZH A;  3B6O A;  5BPM A;  4M3Z A;  3AVN A;  4JKA A;  1K8A O;  2OZS A;  1MWK A;  1QQN A;  2W42 A;  3ALY A;  3LP0 A;  1RCH A;  3GL1 A;  4DTO A;  3SQ1 A;  4C8L A;  1S3X A;  3THY B;  4B08 A;  5DM6 L;  2D0O A;  2YV0 X;  3K0S A;  4LFC K;  4CEA A;  1UA0 A;  1VQ4 N;  2YHY A;  4ELU A;  1NJZ A;  4M3T A;  4FLV A;  3WNH A;  1Z26 A;  5SZT A;  4R5P A;  5EOY A;  3AO1 A;  1ZBI A;  4BDY A;  4KRF A;  1KFD A;  2O8C B;  3VOV A;  4BRG A;  4E1N A;  1BL3 A;  4O4G A;  4FLU A;  5AJ3 K;  4K0K K;  4DU4 A;  3QDK A;  3K2P A;  3KLH A;  1S1U A;  2E6M A;  4IZ9 A;  4E1M A;  3R6M A;  3RSE B;  4Y1C A;  1O1W A;  3W0L A;  4B9V A;  2NUB A;  1VQ8 N;  2ZE2 A;  2WBN A;  2NRT A;  1YI2 N;  1YJN N;  1GLJ O;  1QVG M;  2OTL N;  5KRS A;  4FJX A;  4J8F A;  3O1B A;  4DWI A;  2AA4 A;  4FWL A;  4AQY K;  1QSL A;  1CZ9 A;  4YFU A;  1ZC6 A;  4BGA A;  4H5V A;  3QBW A;  3AAP A;  3IKM A;  1CXU A;  5F2R A;  5ADX H;  1FXX A;  1SQK A;  2ZQB A;  4JHD B;  2IS3 A;  4JS5 A;  3VQ5 A;  1SAZ A;  3LM9 A;  1JL2 A;  3ZSR A;  3O3H A;  1HNW K;  2FBV A;  3F2K A;  3UB5 A;  1TV6 A;  1BO5 O;  3HT3 A;  4MDB A;  3F9M A;  4YOR A;  3PX6 A;  2G8F A;  2P9K B;  2P9N A;  4PUO A;  1A5X A;  3PV8 A;  3KZB A;  2NRX A;  4DFP A;  4QCL A;  1OKJ A;  5C2D A;  2P1J A;  3L3U A;  5C42 A;  1ZBS A;  2UUA K;  1IV0 A;  3CCS N;  5LJV A;  1L3S A;  2I7N A;  1HR0 K;  5DMR A;  4CJT A;  3CHW A;  1SZ2 A;  4AIL C;  1Y64 A;  3N4P A;  4F9O A;  5BPN A;  3J7Y P;  4NCA A;  4PKH A;  2ZJQ L;  3A2F A;  4B8A B;  4E7K A;  4BRD A;  4CJV A;  4JI0 K;  4FJH A;  3C7N B;  5FPD A;  2QXL A;  1NGI A;  3K58 A;  1WOQ A;  1W0H A;  2NRH A;  2QM1 A;  3B6P A;  4B1X B;  3O6W A;  1RDB A;  1HYZ A;  2E4L A;  2QKK A;  4DV4 K;  3T19 A;  4CEB A;  3O3F A;  2AP1 A;  2HVI A;  4CHY A;  1TKZ A;  2IC3 A;  1U2V A;  3HPH A;  4ZHR A;  5T7B A;  1TAU A;  3E66 A;  2RPI A;  1IJJ A;  4H0O A;  4UQG A;  4CE9 A;  2E1Y A;  2P9U B;  1JLE A;  5EX5 A;  3DLR A;  4BR7 A;  3A5N C;  1EKE A;  4IBN A;  1YUW A;  3WQU A;  1HNZ K;  3SUQ A;  3H3N O;  3O9U A;  3SQ2 A;  1FJG K;  4FM2 A;  1OH8 A;  1U49 A;  1WSF A;  4IFY A;  4H0X B;  3VEX A;  2FF6 A;  3KKS A;  3AVK A;  5E26 A;  4KTZ A;  1KC8 O;  3VQ7 A;  2QWP A;  1R0A A;  3NE6 A;  2DTU A;  2BUP A;  4U67 L;  4FWR A;  3THV A;  2XY8 A;  4CJP A;  4WQ5 C;  4FWP A;  1UWB A;  1RT4 A;  3UKR A;  3CCR N;  2Q0U A;  3E9P A;  4BRA A;  4JS4 A;  4Z4F A;  3NH2 A;  2E6L A;  3MX2 A;  3A0I X;  5F0X A;  4MQ3 A;  4BC4 A;  3K5N A;  4DS4 A;  2V52 B;  5HL7 L;  1WSJ A;  5BN9 A;  1GOB A;  1S5J A;  3THX B;  3C95 A;  4CJQ A;  1X9W A;  2O4I A;  3V1O A;  1SKW A;  3RMD A;  4EP5 A;  5AFU H;  2KTQ A;  3NDK A;  3FE1 A;  1YJW N;  5KPT A;  4KFB A;  3CCM N;  4KBO A;  3CPW M;  1LAV A;  3PY8 A;  5C24 A;  1BCO A;  2WON A;  5BRE A;  2G8W A;  4HVJ A;  1VQO N;  4DQS A;  4CGI A;  1TYQ B;  3KK2 A;  2IIR A;  3ENB A;  1KFS A;  1VSI A;  5LL6 Z;  3WXM B;  3HTV A;  5AQK A;  4Z0U A;  3BEX A;  3SMS A;  3HJF A;  2WUS A;  3MWP A;  2D0C A;  3AVF A;  3EYZ A;  1NK4 A;  1S6P A;  3TTC A;  5C12 A;  4CFB A;  3O9S A;  3THW B;  2O4G A;  3VF6 A;  2O8B B;  4NYN A;  5AQI A;  3LAM A;  4C8M A;  3R3L A;  5EXW A;  1K8K B;  3F9K A;  3V9U A;  3M5R A;  1DTQ A;  4KH4 A;  4E89 A;  5TKW A;  3T3F A;  4LSN A;  4CZM A;  3L2U A;  5AQW A;  4B1U B;  1LAW A;  4KHY A;  1VHX A;  3MEC A;  5LY3 A;  5M1P A;  3VTI A;  4CK1 A;  4HUE A;  3TAB A;  4ZTF A;  2NRZ A;  4K8X A;  3AO3 A;  3VES A;  1NK5 A;  4H03 B;  1VK0 A;  1NGC A;  4DR6 K;  1KVC A;  3CCQ N;  2Q36 A;  4ISG A;  1BIZ A;  3WEE B;  3ZX3 A;  2Q0R A;  5AQM A;  2A40 A;  3LWM A;  3L6Q A;  4QOZ B;  3D2E A;  1RDD A;  3D0P A;  2B6A A;  5KRT A;  1T8E A;  1RFQ A;  1KD1 O;  3TPQ A;  4XEI A;  5B8H A;  3VF2 A;  2KZM A;  3DXK A;  1HX1 A;  3TTF A;  1ZBH A;  4B9L A;  4WQ5 A;  3H08 A;  3TAR A;  4DU1 A;  3SQ0 A;  4CHO A;  3O4W A;  3D2F B;  4BGB A;  3I0S A;  3CQY A;  5JMV A;  3AVM A;  2UXD K;  3KD1 E;  4B9N A; 
#chains in the Genus database with same CATH homology
 4M45 A;  3BDP A;  4CIG A;  4CEQ A;  1EP4 A;  2OZM A;  4FLZ A;  3LPT A;  1S1X A;  3O3G A;  2YHA A;  3CFP A;  1XHZ A;  3QNO A;  1HNV A;  3OY9 A;  2F8S A;  4RW9 A;  3VQA A;  1WSI A;  1ASU A;  1T03 A;  3LZI A;  3JYT A;  4DSK A;  4CJE A;  3S3O A;  4NYF A;  2RF2 A;  4FK0 A;  3IRX A;  1CLQ A;  4CEF A;  3V9W A;  4AHR A;  4C8K A;  3P5J A;  2RN2 A;  4FJI A;  5KGW A;  4AH9 A;  1S1T A;  4CJW A;  2WOM A;  2XY6 A;  3F73 A;  3O4Q A;  1JLF A;  4N5S A;  4RW8 A;  3DMJ A;  1KCF A;  3SUO A;  1N6Q A;  3ASM A;  3M8P A;  2HHS A;  3RR7 A;  4JLH A;  2VG5 A;  3L2W A;  1KRP A;  3LZJ A;  1N5Y A;  2QK9 A;  4FK2 A;  3EZ5 A;  4E7I A;  3S3N A;  4E0D A;  1C6V A;  4CCH A;  3OYK A;  3MXI A;  3MXJ A;  4LH5 A;  3LPU A;  4KB1 A;  2A1S A;  2B4J A;  3QEX A;  4F4K A;  3HVR A;  4Z4I A;  1GOA A;  4OLB A;  3TAE A;  3C6U A;  4CIE A;  1ZBF A;  4CJF A;  3KK3 A;  2XHB A;  1XC9 A;  1ZYQ A;  4J2D A;  3DOL A;  4FJ7 A;  3QIN A;  4KV8 A;  1UA1 A;  4CF9 A;  4FVM A;  1L3U A;  1YTA A;  3TAQ A;  1SKR A;  4OKK A;  5J1E A;  4BDZ A;  5K14 A;  3SPY A;  4W5Q A;  5I42 A;  1LW0 A;  1GOC A;  3V1Q A;  1TAQ A;  4CJK A;  4KPY A;  4FZX C;  3C6T A;  4BE0 A;  4DU3 A;  4FJL A;  1HNI A;  2RKI A;  4TSX A;  3RRH A;  1RT7 A;  4PY5 A;  4KO0 A;  3OS1 A;  4ZTJ A;  1RT6 A;  1L3T A;  4CJ3 A;  2X78 A;  1S1V A;  2Z1H A;  3AVG A;  3NH1 A;  1REV A;  1S6Q A;  3AA3 A;  1VSE A;  3AO5 A;  5KTQ A;  4DFM A;  1RT2 A;  2Q3S A;  4LY7 A;  2YNH A;  3MEG A;  3QES A;  3V6D A;  5I3U A;  4MFB A;  3CFR A;  4F2S A;  4W5O A;  4FM0 A;  4FJM A;  4I9L A;  4BAC A;  2OPP A;  4IDK A;  3AV9 A;  1HQE A;  4DTU A;  3PUF A;  1UOC A;  1BI4 B;  1C0U A;  3ISN C;  4CEC A;  4HTU A;  4M3U A;  2G8I A;  4B3O A;  1A5V A;  2HMI A;  1KVB A;  3V1R A;  3WNE A;  3OYL A;  1LWE A;  2HND A;  4GMJ B;  3RRG A;  3SUN A;  1QSS A;  4KHQ A;  5CZ1 A;  4KRE A;  1L3V A;  3CM5 A;  1B92 A;  1WAF A;  3PX4 A;  1RDC A;  4JRQ A;  1SL1 A;  1TVR A;  2YNG A;  3KTQ A;  4KTQ A;  4W5N A;  1S1W A;  4DTM A;  2X6S A;  3TAF A;  3CYM A;  3LP1 A;  4J2E A;  3OVN A;  3QLH A;  4H4M A;  1IO2 A;  3TI0 A;  3LAK A;  2G8K A;  1NK0 A;  3QEV A;  1WSG A;  4M3R A;  1LWF A;  2ETJ A;  3QER A;  3DLB A;  4EP4 A;  5J2Q A;  3CM6 A;  3WNF A;  3DLK A;  4AHU A;  4FJN A;  2GUI A;  2HHX A;  1RNH A;  3DYA A;  3MEE A;  5D3G A;  2QKB A;  1VSF A;  4E7H A;  3O4N A;  1KTQ A;  1RBT A;  4CEO A;  4E7L A;  4ICL A;  3LDS A;  3L8B A;  4GVM A;  3KJV A;  5DK5 A;  2YNI A;  1YTU A;  1QS4 A;  4DG1 A;  3DLH A;  1RT5 A;  2XY7 A;  3VQ9 A;  4L8R B;  4KI6 A;  3B6O A;  4M3Z A;  1C1B A;  3AVN A;  5FRO A;  2PY5 A;  2OZS A;  2GV9 A;  3VQE A;  3RMB A;  2W42 A;  1RBR A;  5HRR A;  2VG7 A;  3VN5 A;  3ALY A;  1F21 A;  1RCH A;  3LP0 A;  4DTO A;  4OGC A;  1RDA A;  3DRR A;  3VQ4 A;  3SQ1 A;  4Z4H A;  4JRP A;  4C8L A;  2P51 A;  3EY1 A;  3ZCM A;  3SV4 A;  4B08 A;  3SI6 A;  2IOC A;  1RTH A;  4F3T A;  4DFK A;  2YV0 X;  4CEA A;  1UA0 A;  4F8R A;  3CFO A;  3NF6 A;  2VWJ A;  5JS1 A;  4ELU A;  2HNZ A;  4DF4 A;  1NJZ A;  4M3T A;  2HVH A;  4FLV A;  3WNH A;  2Z1J A;  3AVB A;  1S9E A;  4BWM A;  1ZBU A;  1Z26 A;  4F3O A;  5SZT A;  4DTJ A;  4R5P A;  2KW4 A;  4H4O A;  3AO1 A;  3JSM A;  2BGG A;  4FW1 A;  1ZBI A;  1BIU A;  1CXQ A;  1JLC A;  3L2Q A;  1ASV A;  1JLG A;  1KFD A;  4BDY A;  4KRF A;  3ZSO A;  4O0J A;  4CJL A;  4BE1 A;  2OYQ A;  1XWL A;  4CIF A;  4E1N A;  2QXF A;  4DMN A;  4CJ4 A;  1BHL A;  1BL3 A;  4O4G A;  5HRO A;  5J2P A;  4FLU A;  5HLF A;  1LWC A;  4DLG A;  2D5R A;  1Q9Y A;  3E01 A;  3LAN A;  4DU4 A;  1Z25 A;  3K2P A;  4E7J A;  3KLH A;  1C0M A;  1S1U A;  4PA1 A;  4OKJ A;  4HUG A;  2E6M A;  3VQB A;  4E1M A;  4FM1 A;  1NJW A;  4DQI A;  2X6N A;  4ID1 A;  4Y1C A;  1O1W A;  2KFZ A;  4B9V A;  4Q5V A;  1IH7 A;  4KHU A;  2NUB A;  1X9M A;  3NF8 A;  2ZE2 A;  2X74 A;  1FK9 A;  3TAM A;  3VA3 A;  3HP9 A;  2LSN A;  1ITG A;  5KRS A;  4FJX A;  4I9Q A;  4DWI A;  1Q9X A;  2DFF A;  4DSI A;  4YNQ A;  4M3W A;  3MAQ A;  1QSL A;  1CZ9 A;  1A5W A;  4YFU A;  1IKV A;  4Z4C A;  2KQ2 A;  1TL1 A;  1C1A A;  1YT3 A;  5CY4 A;  2A1R A;  3HVT A;  4FJK A;  3V4I A;  1CXU A;  5CYQ A;  3ULD A;  3K59 A;  1FXX A;  2ZQB A;  3LAL A;  4H8K A;  2IS3 A;  4JS5 A;  3VQ5 A;  1L5U A;  1MU2 A;  4KHW A;  2DFE A;  1JLB A;  3HXM A;  1D9D A;  4FLY A;  4F2R A;  1EXQ A;  2PYL A;  1JL2 A;  4M41 A;  3ZSR A;  3HM9 A;  4B9S A;  1TK5 A;  3AVC A;  3KKR A;  3O3H A;  3U3Y A;  3L2V A;  3ZSY A;  3TAN A;  1BIS A;  3NGY A;  4Y1D A;  3KLE A;  2FBV A;  2B5J A;  3DI6 A;  1TV6 A;  3PO5 A;  1X1P A;  4B9M A;  1VSL A;  3KK1 A;  3HT3 A;  1T7P A;  3DRS A;  1JL1 A;  3NF7 A;  1BCM A;  3HK2 A;  3P1G A;  3FFI A;  4CF8 A;  2F96 A;  3ZSX A;  2HB5 A;  4Z4E A;  1J54 A;  3VA0 A;  3OYM A;  3NGI A;  3PX6 A;  3KLG A;  1KLN A;  2G8F A;  4FZY A;  1U4B A;  3AVJ A;  3DLG A;  4PUO A;  1A5X A;  4N41 A;  3ZT1 A;  4IFV A;  3PV8 A;  4FLW A;  4DFP A;  4QCL A;  2D0A A;  4QAG A;  1UAX A;  4HHT A;  4ELT A;  2P1J A;  3L3U A;  5C42 A;  3OYG A;  4I7F A;  3M8S A;  3U6F A;  2HHT A;  2Y1I A;  4BE2 A;  3TAP A;  3AVI A;  4CGF A;  4CES A;  4CF2 A;  3NHG A;  1NKE A;  1L3S A;  4BDP A;  4LSL A;  2PYJ A;  4J2B A;  3NFA A;  4FJJ A;  5DMR A;  1FKP A;  4M3X A;  5FRM A;  2IAJ A;  4CJT A;  3G0Z A;  2VG6 A;  3VQP A;  4AIL C;  1QTM A;  1JLA A;  4HUF A;  3RTV A;  4XIU A;  2HHW A;  3LP3 A;  5FDL A;  1QSY A;  1CZB A;  3OJS A;  4EZ9 A;  4NCA A;  2EHG A;  3A2F A;  4B8A B;  4E7K A;  4OLA A;  4WE1 A;  1XHX A;  4CJV A;  1U48 A;  2JLE A;  1VSH A;  4FJH A;  1NK6 A;  3K58 A;  4W5T A;  1IKY A;  1LV5 A;  2I5J A;  1W0H A;  5C25 A;  1J5O A;  3B6P A;  5SWM A;  4FJ5 A;  1HYS A;  2HHQ A;  3AA4 A;  3C94 A;  1RDB A;  1Y97 A;  3M8Q A;  2PZS A;  1HYZ A;  4OGE A;  4CHP A;  4KB0 A;  2E4L A;  3PX0 A;  2QKK A;  4CGJ A;  1VSK A;  4CEZ A;  3T19 A;  4CEB A;  3O3F A;  1C1C A;  4CFC A;  4O0I A;  5J2M A;  3OS0 A;  3ZT2 A;  4CF1 A;  1I39 A;  2HVI A;  4CHY A;  1TKZ A;  2IC3 A;  1G15 A;  2VWK A;  3SYZ A;  3MXM A;  1NK7 A;  4O5B A;  3HPH A;  4ZHR A;  3VQD A;  5T7B A;  1RT3 A;  2FBY A;  3QEI A;  1TAU A;  2RPI A;  4J2A A;  2IDO A;  1C0T A;  4CGH A;  3AVL A;  4UQG A;  4CE9 A;  1WSH A;  1TK0 A;  3HST B;  1T05 A;  2AJQ A;  1JLQ A;  3VQ8 A;  3QET A;  3KLI A;  2DFH A;  3OYC A;  4FCY A;  4CK3 A;  4KAZ A;  3K57 A;  3KLF A;  3QIO A;  2KZZ A;  4KHS A;  4AHS A;  3NH0 A;  1JLE A;  3AVA A;  3DLR A;  4RW7 A;  4E19 A;  3U3G A;  3AA2 A;  1TK8 A;  3SQ4 A;  1EET A;  3M8R A;  1WLJ A;  2Z1I A;  2OPQ A;  3ZT4 A;  1TGO A;  2YNF A;  4FW2 A;  1RBS A;  3K5M A;  1HMV A;  1ZBL A;  1KSP A;  4FK4 A;  1EKE A;  4IBN A;  3KIO A;  4I2Q A;  4CED A;  4O44 A;  5E41 A;  4C8O A;  3SUQ A;  2R7Y A;  1B9F A;  4M3Y A;  3SV3 A;  3V9X A;  3SQ2 A;  2ITG A;  4KHN A;  1SUQ A;  4FM2 A;  4DQP A;  4DSJ A;  4M42 A;  2DY4 A;  1NK8 A;  1U49 A;  1WSF A;  2D0B A;  3S3M A;  4IFY A;  3HL8 A;  4DTP A;  1WAJ A;  4Z4G A;  4OKE A;  3NAE A;  1HPZ A;  1TL3 A;  3I0R A;  4DQR A;  1IG9 A;  2HW3 A;  3KKS A;  4DTN A;  3AVK A;  4O55 A;  4DQQ A;  4KTZ A;  1D9F A;  1LW2 A;  1RBU A;  3VQ7 A;  1R0A A;  1TKX A;  3P83 D;  3ZSW A;  4DF8 A;  3SZ2 A;  1WSE A;  3NCI A;  4NCB A;  3OS2 A;  3NE6 A;  5CYM A;  4AHV A;  1BGX T;  1S9G A;  2HHV A;  2DTU A;  2HHU A;  3THV A;  2XY8 A;  4EZ6 A;  3V81 A;  1U47 A;  4CJP A;  3HP6 A;  1UWB A;  1RT4 A;  4IG3 A;  4JS4 A;  4DSE A;  4CJU A;  4FJG A;  2JGU A;  3WNG A;  4Z4F A;  3NH2 A;  3OYH A;  1SL0 A;  2E6L A;  4ID5 A;  1JXE A;  3L2R A;  4K8Z A;  4MQ3 A;  1D5A A;  1QQC A;  2G8H A;  4CEE A;  1IKX A;  4PQU A;  3RR8 A;  4CJ5 A;  2FBX A;  3K5N A;  4FYD A;  4DS4 A;  4HCC A;  1WSJ A;  2XO7 A;  1HJR A;  1VSM A;  1VRU A;  2YKM A;  4DS5 A;  3HO1 A;  1GOB A;  1NOZ A;  1S5J A;  4GW6 A;  1I3A A;  3UIQ A;  3C95 A;  4CJQ A;  4CGG A;  3OYB A;  4AHC A;  5HRS A;  1X9W A;  3I8D A;  2O4I A;  3V1O A;  3OYN A;  2FBT A;  1SKW A;  3RMD A;  4FZZ A;  4EP5 A;  3SUP A;  5HP1 A;  2YKN A;  3NDK A;  2KTQ A;  1RT1 A;  4B9T A;  4DTX A;  1DLO A;  4W5R A;  3L3V A;  2OPS A;  1HYV A;  4KFB A;  3ZSV A;  4CHQ A;  4C8N A;  3KD1 E;  1LAV A;  3PY8 A;  1VSJ A;  1BCO A;  2WON A;  2XRI A;  2Z1G A;  5C24 A;  3AVH A;  4BWJ A;  1XI1 A;  2G8W A;  2G8U A;  4HVJ A;  2BDP A;  4Q0B A;  4DQS A;  4CGI A;  1VSD A;  2BE2 A;  1D8Y A;  3OYI A;  5FRN A;  4CJS A;  1Q8I A;  2HNY A;  3KK2 A;  1NKC A;  1KFS A;  4FLX A;  1KLM A;  1VSI A;  3DLE A;  5CZ2 A;  3QIP A;  5KI6 A;  3OYF A;  4DTR A;  3V9S A;  4Z0U A;  1NOY A;  2F8T A;  1J9A A;  4NCG A;  3HJF A;  3OJU A;  3AO2 A;  1SL2 A;  3QO9 A;  1J53 A;  3S9H A;  4FJ9 A;  2D0C A;  5KGX A;  4ELV A;  3AVF A;  4DSF A;  3EYZ A;  1NK4 A;  4DTS A;  1B9D A;  1YVU A;  4N47 A;  4CFA A;  4CHZ A;  1IKW A;  1S6P A;  2XY5 A;  1RBV A;  3NGZ A;  2ZD1 A;  3CG7 A;  4LD0 A;  4CFB A;  3IS9 A;  4CF0 A;  3MED A;  3ZT0 A;  4FLT A;  3NF9 A;  2P5O A;  4IKF A;  2O4G A;  1U04 A;  4CFD A;  4OVL A;  3QEW A;  4NYN A;  3SJJ A;  3LAM A;  4C8M A;  3HPO A;  4HCB A;  3OYA A;  3K5O A;  4OPJ A;  4N56 A;  4RW4 A;  3OYD A;  1BQM A;  1QHT A;  3DRP A;  3F9K A;  3V9U A;  4OPK A;  4KTW A;  2G8V A;  1DTQ A;  2BAN A;  1RTJ A;  4OJR A;  4CHN A;  1ASW A;  3TR8 A;  1NK9 A;  4E89 A;  4LH4 A;  3T3F A;  4LSN A;  3L2U A;  3SNN A;  1JKH A;  3QNN A;  3LP2 A;  4DFJ A;  3IAY A;  2P5G A;  1LAW A;  4KHY A;  4B9N A;  1RIL A;  3MEC A;  5JS2 A;  3D45 A;  4FXD A;  4CK1 A;  2EX3 A;  3ZT3 A;  4HUE A;  3TAB A;  4ZTF A;  3TWH A;  4CER A;  1HQU A;  4K8X A;  3VQ6 A;  3K5L A;  3AO3 A;  1X9S A;  1SKS A;  1NK5 A;  3AA5 X;  1TKT A;  4CK2 A;  1VK0 A;  4KI4 A;  1BQN A;  1EX4 A;  1RTD A;  4CGD A;  1KVC A;  1W9H A;  3NBP A;  4G1Q A;  3LWL A;  1NKB A;  5HBM A;  3QEP A;  4FJ8 A;  3DOK A;  3RMC A;  1BI4 A;  4B9U A;  1K6Y A;  1BIZ A;  3KD5 E;  3G10 A;  4RG8 A;  1JXB A;  5HRP A;  1KVA A;  3CQ8 A;  3IG1 A;  1TKD A;  2OPR A;  3LWM A;  4QOZ B;  2FC0 A;  3VQQ A;  5HRN A;  1RTI A;  4RW6 A;  3OYJ A;  1RDD A;  3D0P A;  2OA8 A;  4KKO A;  1NJY A;  2B6A A;  1NJX A;  3BGR A;  1WNS A;  2GBZ A;  5KRT A;  3OYE A;  1FKO A;  1SV5 A;  4AHT A;  1T8E A;  3RWU A;  4I2P A;  4B8C A;  2KFN A;  1U45 A;  2YHB A;  3ITH A;  5J2N A;  3V9Z A;  4CJR A;  2KZM A;  3ZSZ A;  3ZSQ A;  3PO4 A;  1ZBH A;  4B9L A;  2IGI A;  3T1A A;  1HRH A;  3H08 A;  4IG0 A;  2Y1J A;  3SCX A;  4E3S A;  1DTT A;  3HPG A;  4DU1 A;  3TAG A;  4DLE A;  3SQ0 A;  3DM2 A;  3AO4 A;  3VQC A;  3HYF A;  4N76 A;  3SPZ A;  4CHO A;  4PWD A;  1QE1 A;  1WN7 A;  3I0S A;  3RMA A;  1VRT A;  3AVM A;  3TAR A;  5EU7 A;  4DSL A;  2ATQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...