3AVIA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aviA00
1ASWA 4E1MA 1TKZA 3HK2A 2Q3SA 3KD1E 3DLEA 3NF9A 3HXMA 1U47A 3ITHA 1TL1A 1NJXA 1FKPA 3L2RA 2HHSA 4W5NA 3LAMA 2HHQA 4CJKA 1HPZA 1U49A 4KAZA 1KLMA 1JL1A 2E4LA 1VRUA 2EHGA 4CF2A 4CF9A 2ETJA 1C0UA 4AHVA 4KKOA 4CE9A 4CHYA 3KK2A 4FLTA 1T03A 4CGJA 3D0PA 3G0ZA 3AVCA 3C94A 3AA2A 5HRSA 3S3NA 4FK4A 4DFKA 2XY6A 2BGGA 3SYZA 3U6FA 4FVMA 4FCYA 2B4JA 3AV9A 4DQRA 3OYBA 3SV3A 2VG6A 1NKEA 4KRFA 2YNFA 1NOZA 1ZYQA 4H4OA 3QO9A 3MAQA 4Z4EA 1NK8A 4PY5A 2D0CA 3RMDA 3TAQA 3HSTB 4BE0A 1HQUA 4B9VA 4OGCA 4CEBA 1RT3A 3K5OA 4C8NA 2XHBA 1QHTA 3QEWA 3SQ0A 2FBXA 1S1WA 1EX4A 3AVMA 3MEDA 2OZSA 3DLGA 1RILA 3ZT4A 1KSPA 1IKXA 1C0MA 4K8XA 4BE1A 3O3GA 3K57A 3SI6A 3SNNA 4C8OA 4FJ8A 3AA4A 3MXJA 1HQEA 2RN2A 1T8EA 3QEIA 3VQBA 1Z25A 4M3RA 1J5OA 1RTDA 3QIOA 1XHXA 3KLHA 3AO5A 1QE1A 4FLVA 4CF1A 1SKWA 4M42A 3THVA 3OYFA 4N41A 3DLKA 1C1CA 4AILC 1SUQA 3QLHA 3WNHA 3SV4A 4LY7A 5EU7A 4CFDA 4DTJA 3IRXA 3O4QA 4N76A 4RG8A 4DU4A 2I5JA 2R7YA 1KFDA 2DFFA 1RNHA 2IGIA 4AH9A 4W5TA 3K5NA 5SWMA 4DTSA 4E7KA 4NCGA 5HBMA 4G1QA 1EP4A 3NAEA 1C0TA 1N6QA 2OZMA 4DSJA 2G8VA 4I9QA 1Q9YA 1YVUA 4OJRA 3OVNA 3CFRA 1TL3A 1VRTA 2VWKA 3K2PA 1SKSA 3VQ7A 3NE6A 1BHLA 2DTUA 3L3VA 3OYIA 4GW6A 1KFSA 2YHAA 4BACA 3V9XA 4E89A 5I3UA 4Q5VA 3F73A 3HP6A 4I7FA 4OLBA 1DTQA 2XRIA 5E41A 3KLGA 4BDPA 1S6QA 3F9KA 1TK5A 2F96A 4JLHA 4CHNA 3HPHA 4HUEA 3M8SA 1XI1A 4C8LA 4EP4A 1BI4A 2HHVA 2PYLA 1KLNA 4ICLA 2ZQBA 1B92A 3DLHA 1KCFA 2HNDA 4OKKA 4C8MA 2IS3A 1N5YA 1RDDA 1YT3A 1BQNA 3VQ4A 4CJRA 1JL2A 1JLBA 2JGUA 3U3GA 1RDBA 4DTUA 3RR7A 2X74A 1B9FA 4B9UA 3LDSA 2Z1HA 4FJ9A 4QAGA 1RT4A 3SJJA 1ASVA 1BQMA 4E19A 3RRHA 4Z4FA 1HMVA 3U3YA 1T05A 1RBTA 4DF8A 4QCLA 3L2QA 3OYJA 3JSMA 3NF8A 1I39A 4FZXC 4FM1A 4KI4A 3QEPA 3EYZA 4M41A 4CJEA 4KFBA 2ZE2A 4R5PA 5D3GA 1EKEA 3PO5A 4PQUA 3QINA 3AVFA 2IAJA 3VQ9A 4DMNA 2PZSA 3O3FA 2VG7A 1RDCA 4FXDA 4LH4A 1JLEA 3SUQA 4AHUA 4IBNA 1UAXA 4DTXA 3ZSYA 1HJRA 1RCHA 4OKJA 2KZZA 1KVCA 1EETA 1ZBIA 3CQ8A 2A1SA 3CFOA 3KJVA 3P1GA 2HHXA 1U45A 4FM0A 1CLQA 4FJHA 3A2FA 4CESA 3OYDA 4M3UA 3OS1A 2NUBA 1HYVA 1SL1A 4CK1A 3KKSA 1BCOA 3HVTA 1VSIA 4FLWA 1BISA 4LH5A 3ZT0A 3QEVA 2G8WA 4J2BA 3KIOA 5T7BA 2DY4A 3AVIA 1D5AA 5C25A 3K58A 4DQQA 3D45A 1CXUA 1VSDA 1WAFA 4I2QA 4WE1A 4OGEA 4JS5A 3V1OA 1NK6A 1RBSA 3WNEA 1NK0A 1NOYA 4CJ4A 1JLCA 3OS0A 4N47A 4Q0BA 4NCAA 2O4GA 1VSKA 3CM5A 4HUGA 4TSXA 4E7LA 4Z4IA 4CHZA 3MEEA 2Z1GA 4B8CA 4Y1DA 3HT3A 3SZ2A 1QTMA 3DM2A 3JYTA 3NH0A 3OYGA 1RBRA 1UOCA 1IKVA 2KQ2A 2QXFA 3K59A 2BANA 4J2EA 3PV8A 2B6AA 4KTZA 4Z4CA 1QSSA 4DSEA 4DS5A 1RT7A 2HHTA 3MXMA 3KTQA 1ZBHA 4NYFA 5KGWA 3ISNC 5JS1A 4CEOA 1A5WA 3AVKA 1BL3A 2Z1JA 5CYMA 4JRPA 4BDYA 4CJSA 5J2MA 4F8RA 4HCCA 5HP1A 3OYCA 1O1WA 1VSEA 3AO3A 3HL8A 1RBVA 4CJ3A 2HNYA 4B8AB 1QSLA 4O5BA 4EP5A 1FXXA 4CJPA 3VQ8A 4DU1A 3LPUA 1LAVA 2D5RA 3VQ6A 3KLEA 1S1XA 1QQCA 3LPTA 4CJVA 3AVJA 2F8TA 1UWBA 5SZTA 3SUPA 3LAKA 3RMAA 4KI6A 1Q8IA 4I9LA 3PX6A 3V9UA 4DU3A 3C6TA 2YNGA 2XY5A 3OYMA 3KLIA 3NFAA 3QEXA 4E7HA 1JLQA 5DK5A 2HB5A 2WOMA 3TAEA 4DSLA 4KREA 4ELVA 2FBYA 3AVBA 4B9SA 1X9SA 4M45A 4H8KA 2YNHA 2F8SA 3NGYA 1VSMA 3DI6A 3NBPA 4Z4GA 3T3FA 3DRSA 1HYSA 3SQ1A 2FC0A 2OPQA 5CYQA 3T1AA 2VWJA 4KTQA 1LW0A 3DRRA 1HRHA 2D0AA 1XC9A 1D9FA 4KHUA 3ZSOA 4KHWA 4JRQA 1X9WA 4CF0A 1L3VA 4K8ZA 4FJMA 1IO2A 5FDLA 3CG7A 4RW6A 4CJFA 1NJYA 3OYAA 3M8QA 4ID1A 3KK1A 1RTIA 4CGGA 2Y1IA 2FBTA 2HHWA 3HPOA 4B9MA 1VK0A 1WNSA 2P5OA 1G15A 4FK0A 3BDPA 3OS2A 4C8KA 3E01A 3AA5X 3AVLA 1W9HA 1B9DA 1GOCA 3QNOA 1S9EA 4KHNA 4IG0A 1RT5A 4CEZA 5KGXA 3SUOA 1MU2A 2FBVA 4NYNA 3LZJA 4FJGA 2IOCA 4OLAA 1S1UA 1S5JA 1RTHA 2JLEA 3M8RA 2XY7A 5HRRA 4CEEA 2G8UA 4CEFA 4RW4A 4XIUA 4FK2A 1J9AA 4DF4A 5FROA 4W5QA 1VSHA 3QIPA 3VQQA 3VN5A 3HJFA 3TANA 1U4BA 3PY8A 4MFBA 2OPSA 1WLJA 3DYAA 2HVHA 3AVGA 4CK2A 4CHQA 2W42A 1SL0A 2EX3A 4LSNA 2ATQA 3S3MA 2G8FA 3LZIA 3PX4A 1J53A 1X1PA 3O4NA 3OYLA 1RTJA 4JS4A 1TK8A 2P5GA 1TV6A 5J2PA 4DSKA 4CJLA 2GBZA 4CCHA 3V1RA 4OVLA 3NGIA 4YFUA 3KKRA 1C6VA 4M3YA 3UIQA 3KD5E 3RTVA 2P51A 1RT2A 2YHBA 2A1RA 5HLFA 1JKHA 3O3HA 3NF6A 3L3UA 2DFEA 4E7IA 2IDOA 2Z1IA 3DOLA 1NK5A 3VQAA 1TGOA 4FW2A 3OYEA 3OJUA 4B9NA 3L2VA 2RPIA 3IS9A 4CHPA 3V81A 1LWCA 1RDAA 4Z0UA 3WNGA 2AJQA 2P1JA 1DTTA 1CZ9A 2RKIA 3BGRA 4RW8A 4BWMA 3PO4A 3IAYA 3HYFA 3VA0A 3OY9A 2HMIA 3ZT1A 3TAGA 3SPYA 3NHGA 3TABA 3SPZA 3LP0A 1ITGA 1HNVA 5J2NA 1UA1A 4FJJA 4FJLA 3TAPA 1JLAA 2X78A 4W5RA 3L8BA 3MEGA 4PA1A 1J54A 2E6LA 3DRPA 1XWLA 1JXEA 5J2QA 4FZZA 1WSIA 4O0IA 4E3SA 2HW3A 3LWMA 1JXBA 4AHTA 3NCIA 1WN7A 3EZ5A 4M3TA 3VQEA 3LP3A 4CGIA 4BWJA 3ZSQA 4DWIA 1QS4A 2ZD1A 4M3XA 4HCBA 4OPJA 1TK0A 4DTNA 3SUNA 5C24A 3ZSVA 3V9SA 4DTRA 2Y1JA 1VSLA 1L5UA 3OYKA 1Q9XA 1CZBA 3PUFA 4E0DA 4ZTJA 1U48A 4F2SA 2GV9A 4LSLA 2KZMA 1R0AA 1REVA 5KI6A 3M8PA 3OYHA 3NF7A 2HVIA 4FJ5A 4FLYA 2YKMA 2O4IA 1TKDA 1HNIA 3RRGA 3L2WA 3HVRA 4KV8A 2IC3A 2LSNA 4HUFA 2HNZA 1NK9A 1JLGA 1T7PA 1C1AA 4AHRA 4CEAA 1S6PA 3V9WA 1K6YA 4KPYA 1LWEA 3L2UA 3ZT2A 4H4MA 3V1QA 4N5SA 1SL2A 1TKXA 2WONA 3AA3A 4J2AA 4F2RA 4AHSA 3ZCMA 2BDPA 5DMRA 1TAQA 1QSYA 4KB1A 4CEQA 4CJQA 4BDZA 5HROA 3KK3A 3I8DA 4Z4HA 2KW4A 3P5JA 4CJWA 1UA0A 4CJTA 3TWHA 4GVMA 2PY5A 4YNQA 4KO0A 4M3WA 4DLEA 4DLGA 3TAFA 1ZBUA 1NK7A 1S1VA 4FJNA 1CXQA 2QKKA 1WSHA 4O4GA 4DG1A 4EZ9A 3HO1A 1EXQA 2XY8A 4HHTA 3SQ4A 1LW2A 4IDKA 3VA3A 4CEDA 1ZBFA 4ID5A 4DTMA 3CM6A 4CJUA 4DFJA 3RMBA 4M3ZA 4ELUA 4B08A 4F3OA 4FJIA 3QETA 1NJWA 3HPGA 1RBUA 1BIUA 1VSFA 1KTQA 4I2PA 4RW9A 2GUIA 2X6SA 4E7JA 3S3OA 4CIEA 3QNNA 4CERA 1U04A 3K5LA 3ZSWA 3ULDA 1Z26A 4CFAA 3AVHA 1DLOA 4DFPA 1LWFA 4FLZA 5CZ1A 1WAJA 4CFBA 3RWUA 4L8RB 1F21A 2B5JA 4BE2A 2G8KA 4CK3A 5J1EA 5FRMA 3TR8A 3LANA 3DLRA 2XO7A 4CGHA 1VSJA 3OJSA 4DQIA 4DTPA 1TKTA 3AVAA 1YTAA 2KFZA 3DOKA 5C42A 4N56A 2G8IA 5KRTA 3SCXA 4FJ7A 1C1BA 3B6PA 3NH2A 1W0HA 4EZ6A 1NJZA 4HVJA 4E1NA 2QKBA 4DSIA 4QOZB 4IFVA 2E6MA 3LP1A 4B9TA 4FLXA 3IG1A 2YV0X 3VQPA 3I0SA 3K5MA 3QESA 3WNFA 5HRPA 3OYNA 3TARA 4PWDA 3HM9A 3VQCA 5HRNA 4KHYA 4Y1CA 4DFMA 2D0BA 1D8YA 3C95A 3TAMA 4CGFA 4CIFA 3MXIA 1BIZA 1GOAA 2ITGA 4OKEA 1SKRA 5K14A 3CFPA 2KTQA 3LWLA 4FLUA 3DMJA 4O44A 3ZSXA 5KTQA 1NK4A 3FFIA 3QERA 1A5VA 4ELTA 3LP2A 2X6NA 3HP9A 3VQ5A 1D9DA 1IKWA 1GOBA 5CZ2A 2PYJA 2YNIA 1NKBA 4CECA 4ZHRA 4DQSA 3V6DA 4NCBA 3ASMA 4IG3A 1S9GA 3S9HA 3V9ZA 3RMCA 1HYZA 4OPKA 2OPPA 1WSFA 1ZBLA 3AO4A 1RT6A 3AO2A 4DQPA 1JLFA 4FJKA 1KVAA 3VQDA 2OPRA 1BI4B 1TAUA 3EY1A 1L3SA 3NDKA 4DS4A 2BE2A 1NKCA 4FZYA 3V4IA 3CYMA 3MECA 3ZT3A 4B9LA 1I3AA 4CGDA 3ZSZA 4UQGA 4KHQA 2OYQA 1XHZA 1BCMA 4RW7A 4KTWA 3RR8A 3H08A 3C6UA 1RT1A 4GMJB 4O0JA 5KRSA 3P83D 1Y97A 2YKNA 1YTUA 1WSGA 2VG5A 4DTOA 3PX0A 1A5XA 4LD0A 4CIGA 4DSFA 1KVBA 1SV5A 1WSJA 4CJ5A 3G10A 3B6OA 1TVRA 1FKOA 1X9MA 1IG9A 4O55A 4FM2A 4F4KA 3ZSRA 3T19A 3NGZA 4IKFA 1S1TA 2KFNA 4MQ3A 1IH7A 3ALYA 4AHCA 3I0RA 5I42A 4KHSA 3AO1A 1FK9A 1BGXT 1KRPA 5FRNA 4CHOA 4FJXA 1WSEA 4F3TA 4HTUA 4IFYA 2HHUA 4CF8A 1L3UA 4FW1A 1IKYA 4ZTFA 4B3OA 3SQ2A 4W5OA 1LV5A 4CFCA 2OA8A 2RF2A 3NH1A 5CY4A 3KLFA 5JS2A 3DLBA 4J2DA 3LALA 2G8HA 4KB0A 2DFHA 1LAWA 4PUOA 3AVNA 3TI0A 4FYDA 2QK9A 1L3TA 1ASUA
chains in the Genus database with same CATH superfamily
5HOOA 1TL1A 3CIPA 5EOYA 1KLMA 2E4LA 4CF9A 4FOIA 4AHVA 4CE9A 1S72N 3VOVA 4YOYA 3PIPL 3C6AA 2XY6A 3SYZA 1KC8O 4FVMA 4FCYA 4DQRA 3HSCA 1NKEA 2YNFA 4PKGA 4H5NA 1NGHA 4V19S 4PY5A 3HSTB 4PL7A 1HQUA 2FBXA 2FSJA 1DT9A 3DLGA 2F9TA 3O4WA 4U67L 5M1FA 4FJ8A 4C8OA 2AP1A 1M1KO 3AA4A 3ENOA 3VEOA 5AFUA 4DR4K 2RN2A 3J7AP 1Z25A 4FLVA 1QE1A 1SKWA 4CF1A 3THVA 4BRCA 4N41A 3DLKA 3O1BA 1HKGA 3O4QA 2DFFA 2A5XA 2HBJA 4JI1K 1WOQA 5SWMA 4E7KA 4NCGA 1N6QA 5C2DA 3HRGA 3F9MA 1YVUA 3OVNA 3CFRA 2QWLA 4RTFD 5KPZA 3VQ7A 3OYIA 4BACA 4JYAK 4DB3A 3CQXA 4CBWA 3F73A 2E2PA 4OLBA 1DTQA 5E41A 3KLGA 2F96A 3LM9A 1W7AA 4CHNA 4HUEA 1XI1A 3ZETA 4FWNA 2HHVA 2IVPA 1B92A 2HNDA 4K43A 4OKKA 4JKHA 1N5YA 1RDDA 3VQ4A 1JL2A 2JGUA 4QAGA 1RT4A 1ASVA 4E19A 1VQNN 1LOTB 5M1PA 1NGIA 1U6ZA 3QEPA 1GLDG 4M41A 4PQUA 3LDLA 2KKZA 3PO5A 3AVFA 3VQ9A 2F9WA 3SUQA 4IBNA 1VQMN 1UAXA 4JKGA 1O13A 5AQFA 3IMXA 2CH5A 2A1SA 3HOSA 2HHXA 4BRNA 1U45A 4FM0A 2VGNA 1NWKA 4A5BA 3G6EN 2RHKA 4CK1A 3BUZB 3HVTA 3KKSA 3UB5A 3QEVA 4LH5A 3ZT0A 4MLHA 5T7BA 3GL1A 4BR0A 2CGLA 4B1ZA 2ZM6K 3VEZA 5C25A 1Q82O 3D45A 1CXUA 1VSDA 1QVFM 4OGEA 3V1OA 5AFUH 3WNEA 4PKIA 1JLCA 3O9RA 2O4GA 4ISFA 1NMNA 4TSXA 5AQLA 4CHZA 2BUPA 3SZ2A 1BU6O 3JYTA 3H3OB 1WB9A 1T3VA 2QXFA 1IKVA 5LL6Z 5AZIB 4FWKA 4FWRA 4J2EA 3PV8A 4DSEA 4DS5A 3MXMA 1ZBHA 1E3MA 3FZLA 1A5WA 3AVKA 4JRPA 4H0YB 1QSLA 4FVUA 4O5BA 4BREA 2D5RA 2YCHA 3H46O 1XNRK 1QQCA 3LPTA 3CCLN 1DEJA 3OA9A 5BN9A 4IJAA 1YHQN 3RMAA 1Q8IA 3ZX3A 3CERA 3THXB 4LF6K 1X9JA 2NRXA 4BR7A 3NFAA 3G4SN 4KREA 3AVBA 4B9SA 4M45A 3SJHA 2YNHA 3OBYA 3VF4A 3NBPA 1HYSA 4M7YA 3T1AA 1XC9A 5AQMA 5I9EB 4CF0A 5FDLA 4RW6A 4CJFA 4B9MA 1WNSA 4YY3K 1T6CA 5A2QO 4DR6K 3AA5X 3AVLA 4MO4A 4NYNA 2FBVA 4WFBL 4FPAA 2O8BB 1J9AA 5GINA 5FROA 4W5QA 3HJFA 1HPMA 1U4BA 4MFBA 1Q86O 3DYAA 3MWTA 5B8HA 2Q97A 3THYB 1J53A 4JI2K 2P5GA 4CCHA 1C6VA 2W41A 2A1RA 3MN7A 1HKBA 4GVEA 1NK5A 3VQAA 1VQ4N 4DR1K 2AJQA 4Z0UA 2P1JA 3CPWM 4RW8A 1CZ9A 2RKIA 3PO4A 2FSKA 3HYFA 3OY9A 3NHGA 1ITGA 5J2NA 3TAPA 1J54A 3L4QA 5AQHA 2H3GX 3UKUA 1P90A 1JXBA 4AHTA 4WF9L 1WN7A 4BGBA 2BH1A 4M3TA 1EWRA 3LP3A 4BWJA 4CZHA 4JKDA 5AZIA 5C12A 1E4FT 3ZSVA 3V9SA 3ULEB 4CD1A 3OYKA 1Q9XA 3I55N 5M1KA 4ZTJA 1U48A 5GAEP 4LSLA 2V52B 5EVZA 3M8PA 4H0XB 4FLYA 3CCJN 4WQ5C 3DXMA 1HNIA 1NNEA 3QMLA 2IC3A 4HUFA 2GX9A 2D4WA 4H0VB 1OKJA 1K6YA 1LWEA 1NGGA 2A41A 3V1QA 4G9ZA 4J2AA 1TAQA 3M3ZA 2NLXA 2UU9K 3KK3A 1MWKA 3P5JA 4CJWA 3P31A 4DLGA 1NGBA 1WSHA 4DG1A 5AQXA 1IBMK 3HO1A 3DXKB 4BR2A 4IDKA 1OH8A 3BZKA 5GIPA 2YI1A 4DUYK 3D2FB 4ELUA 3RSEB 3HPGA 4RW9A 2QA4N 2GUIA 4E7JA 3S3OA 4CIEA 3QNNA 3ZSWA 3HZ6A 4CFAA 1S22A 2J4RA 1XUPO 2ZJPL 4A57A 1WAJA 5JLHA 5GAHP 3RWUA 4L8RB 1KAZA 2B5JA 3O5BA 5J1EA 3TR8A 1X3MA 4C1NK 4CGHA 2WBNA 3CCRN 1RFQA 3GG4A 4DQIA 4DTPA 2UXBK 5BPLA 2O8BA 2NRVA 1YTAA 2G8IA 2P9NA 1ATSA 4BQZA 1VHXA 2CH6A 3NH2A 5CE3A 3NVMA 2QWPA 3NMUA 4DV7K 3ATVA 4QOZB 2QXLA 4IFVA 4B3TK 1GLJO 4FLXA 2QWRA 3U9ZA 4PWDA 1OVYA 5HRPA 1YXQA 2ITGA 4BRHA 4IFEA 1SKRA 2D0PA 2KTQA 4OPAA 1NGFA 3DMJA 1N34K 3QERA 3T7ZA 4ELTA 3LP2A 5BPNA 5JVHL 3VQ5A 4BRIA 5CZ2A 2D1KA 1S9GA 1NGCA 4DQPA 1ZBLA 2OPPA 1WSFA 3AO4A 3MMVA 1KVAA 1QQNA 4YDUC 3J7YP 3CQYA 3V4IA 2Q2RA 4DV0K 2OYQA 3H08A 3C6UA 1JJ2M 3P83D 1Y97A 1WSGA 3DLLL 1KVBA 1TVRA 1YJWN 3HBTA 2UUAK 4LF7K 1S1TA 3E9LA 4MQ3A 3CJCA 5I42A 4X66K 1FK9A 4HTUA 3CMEN 3H1VX 3A5LC 4FW1A 3SQ2A 4W5OA 3CCEN 4CFCA 5FPDA 2FXUA 3AVNA 1OH6A 3TSUA 4CZMA 4IOCL 3FZMA 1ASWA 4E1MA 1TKZA 4DV5K 3DLEA 2JWLA 3NF9A 1XMOK 3J80O 1FKPA 4W5NA 3LAMA 3R6MA 2HHQA 1U49A 1JL1A 2EHGA 4CHYA 4CI6A 4A61A 4CGJA 3AVCA 3S3NA 3AA2A 4FK4A 3FZFA 3AV9A 4NLBA 3Q7BA 3L0QA 4KRFA 1QQOA 4FWSA 3CCSN 3QO9A 3MAQA 4Z4EA 3RMDA 4BE0A 1KAXA 4CEBA 2WC9A 3M1FA 3K5OA 4C8NA 3SQ0A 3QEWA 3AVMA 1EX4A 2OZSA 1RILA 4JEPA 1SS6A 1KSPA 3CJ7A 5FPMA 4BE1A 3SNNA 3CHWA 4FOEA 3PSIA 1J5OA 3VQBA 1J5EK 1GLBG 3KLHA 3AO5A 4AILC 1SUQA 4CFDA 5AQGA 3W0LA 4N76A 2O8FA 5AQUA 4DU4A 2R7YA 1KFDA 2IGIA 4AH9A 4EAHD 5CR4A 2OZMA 4DSJA 1VRTA 2VWKA 3K2PA 2P9KA 3VGKA 4LF4K 3L3VA 3IDHA 3V9XA 1Q7YO 5TKYA 3HP6A 3F9KA 1TK5A 2P9SA 4C8LA 3HTVA 2PYLA 3CF5L 4IZ9A 3AAPA 1BQNA 5BRHA 2V7YA 3U3GA 1RDBA 4DTUA 5BRDA 2X74A 5C2FA 3J81O 3LDSA 2Z1HA 3RR7A 3SJJA 1T05A 4QCLA 4IWVA 3SMPA 3L2QA 3JSMA 1I39A 2E2OA 3EYZA 5AQYA 4KFBA 2ZE2A 4R5PA 1EKEA 2VG7A 4KH5A 4FWLA 4DTXA 2KLAA 4YOWA 2KZZA 1KVCA 3CD6N 3CQ8A 4O8UA 5MLCQ 3AARA 5LJVA 3H3NO 3KZBA 3OYDA 4WQ4C 3A5OC 2NUBA 3OS1A 1BCOA 1NMDA 3H45C 1BISA 2DY4A 3L4IA 2V51B 5AQIA 3AVIA 2QW9A 3O9TA 4B1VA 4QS9A 4WE1A 1NK0A 1NOYA 4Q0BA 4N47A 4KH4A 4NCAA 3E9OA 2AA4A 3VETA 1VSKA 3CM5A 4HUGA 1W2BM 3KHYA 4IEIA 5F2RA 3DM2A 1K9MO 3OBWA 3NH0A 1RBRA 2KQ2A 3K59A 2BANA 4KTZA 4Z4CA 1QSSA 1J6ZA 2W6LA 3SBTA 2YHXA 1BL3A 2Z1JA 5CYMA 5J2MA 4H0PA 1O1WA 1RBVA 5FPNA 4CJ3A 1FXXA 3LPUA 3AVJA 2YJFA 3SUPA 3LAKA 3D2EB 4A5AA 4I9LA 3PX6A 1Z05A 4DU3A 3FFKB 3KLIA 3DAWA 2WOMA 3TAEA 1YF5L 2UXCK 4LFBK 4H8KA 3BEXA 4Z4GA 4DUZK 3DRSA 3R8EA 2FC0A 2VWJA 3VTHA 1LW0A 4ILHA 4KHUA 3ZSOA 1TYQB 4YORA 1BG3A 4JRQA 4FJMA 1L3VA 1IO2A 5FPEA 3CG7A 3OYAA 3M8QA 4BC2A 1V4TA 3BDPA 4C8KA 3E01A 1P8ZA 1W9HA 1GOCA 3QNOA 4KHNA 3KWGA 3SUOA 1RT5A 4CEZA 5KGXA 4FJGA 1MU2A 2IOCA 1S5JA 4GY2B 4BY9C 5HRRA 3VQQA 3VN5A 1NGJA 2HVHA 3AVGA 2EX3A 2ATQA 2G8FA 1QZ5A 3LZIA 1TK8A 5LMNK 1RTJA 1TV6A 4JHDA 4B3SK 3V1RA 4OVLA 4B1WB 4YFUA 1VQ6N 3UIQA 4YOXA 2P51A 1JKHA 3M6GA 3O3HA 3NF6A 3L3UA 4E7IA 2Z1IA 1QQMA 5JMVA 1GLFO 3OYEA 2OTLN 4A2BA 2RPIA 4DQ8A 1N32K 1LWCA 3ULEA 3WNGA 4K0KK 4BROA 2ASOA 3IAYA 1VAZA 5CHIA 2HMIA 3TABA 3LP0A 1UA1A 2X78A 4W5RA 1BWFO 3DRPA 3DXMB 1JXEA 5FLXO 5J2QA 4FZZA 4WQ5A 5AQSA 5AQRA 3SAFA 4B1XB 4DV4K 5JLFA 1Q18A 4LF9K 3ZSQA 4DWIA 2ZD1A 4NXMK 4HCBA 5C24A 4B1UB 1VSLA 1L5UA 2P9PB 3W3DA 2GV9A 1DKGD 2KZMA 3H1QA 4H0TB 2HVIA 2O4IA 2E1ZA 1TKDA 3F2KA 1EO1A 4A59A 4KPYA 3L2UA 3HM8A 3D2EA 3ZETB 3ZT2A 4JI0K 1SL2A 1TKXA 3AA3A 2BDPA 1XC3A 3C65A 4H5WA 2KW4A 1UA0A 2PY5A 4B3MK 4A2AA 4CJTA 4YNQA 2Q31A 3UE5A 1VQON 4FJNA 4CVNE 4O4GA 4MLEA 1HR0K 1EXQA 3NVKA 4HHTA 1LW2A 2Q1NA 3CM6A 4DFJA 3RMBA 4M3ZA 3QETA 1NJWA 1VSFA 1BIUA 1WBDA 3BF1A 1KD1O 3K5LA 3PSFA 4DFPA 1DLOA 1LWFA 3BP8A 2ASMA 1YUWA 2ITMA 1W97L 3CETA 3THYA 2G8KA 4CW7B 4JI8K 3DLRA 2XO7A 2O8CA 5C42A 1U2VA 1C1BA 3B6PA 2VYPA 2D0OA 3IUCA 4E1NA 2ZGYA 1NGAA 4DSIA 3N4QA 4MDAA 3VQPA 5BN8A 3WNFA 2E20A 4JHDB 3TARA 3HM9A 1JCGA 1ZBSA 3VQCA 4DFMA 3C95A 3OW2M 2QWOA 3TAMA 1NLVA 4GV3A 5K14A 2FF6A 4XH4A 3LWLA 4B9QA 4FLUA 1NK4A 5KTQA 5LMUK 2X6NA 3HP9A 4JN4A 4DR5K 1GOBA 4NCBA 2YNIA 1NKBA 4BVPA 4CECA 4ZHRA 4DQSA 1I94K 2OANA 4IG3A 3RMCA 3SBGA 2NRTA 4F9OA 2OPRA 4JK9A 1TAUA 4ISGA 3VESA 3SLCA 3QBXA 4EHTA 2BE2A 4FZYA 4LF8K 3MECA 3VGMA 1GLAG 3EZWA 4CGDA 4KHQA 5EXWA 4KTWA 4H5RA 4LFCK 3T69A 3MWPA 2UXDK 4DTOA 1A5XA 4LD0A 5AZJA 1SV5A 4BRAA 5LY3A 3A5MC 3G10A 3SK3A 1ZXOA 1X9MA 3VENA 4IKFA 3NGZA 1IH7A 3I0RA 1BA0A 4KH6A 4CHOA 4U7BA 1WSEA 4FJXA 4GKKK 4IFYA 4DKWA 2HHUA 4CF8A 1L3UA 1ATNA 3P39A 1LV5A 4CJ7A 2RF2A 5CY4A 3THWB 2ZJQL 3DLBA 4J2DA 3GBTA 3LALA 1N36K 5BREA 4YHHK 1RGIA 3HK2A 2Q3SA 3KD1E 4CZFA 3HXMA 3ITHA 3B8AX 1NJXA 4BG8A 3GDQA 4H03B 3KK2A 4FLTA 3D0PA 3G0ZA 4BRMA 5HRSA 4HTLA 2Q0UA 2BGGA 4JAXA 3U6FA 3MX5A 3FGUA 2P9IA 2ZJRL 2O8FB 4H4OA 5AQOA 1NK8A 3WXKA 4B9VA 4FWOA 4OGCA 2P9NB 2QWMA 3J7ZO 2XHBA 4BRKA 3LDNA 3WEEA 1IKXA 2YHYA 4FWPA 1C0MA 2P9KB 3SMSA 4K8XA 3O3GA 3SI6A 2E5LK 4L3QA 2ZGZA 1T8EA 2VQEK 4M3RA 5BR8K 2O8CB 4M42A 1BUPA 2QI2A 2P9SB 3OYFA 5ADXH 4NXNK 3O9SA 4LY7A 5EU7A 3IRXA 1BOTO 5BPMA 4CZGA 2O8EB 4W5TA 3K5NA 4DTSA 3IKMA 4JI5K 5HBMA 3NAEA 1C0TA 2G8VA 5AQTA 4K41A 1R59O 3NE6A 2NRRA 2DTUA 4GW6A 4E1JA 4JKAA 4Q5VA 5AQPA 4BDPA 4JI3K 2IVOA 1S6QA 4JLHA 5E26A 2E2NA 3HI0A 3DJCA 4C8MA 2IS3A 5AQKA 4CJRA 1JLBA 4JKCA 3WXMB 4B9UA 1B9FA 1HNWK 3ZX0A 3RRHA 1HMVA 5AQQA 1YJNN 1RBTA 1HX1A 3NF8A 3G25A 3ID8A 4FM1A 3LDQA 4CJEA 3EL2A 5D3GA 5AQWA 3WQTA 2IAJA 2PZSA 4DMNA 3CMAN 1RDCA 4FXDA 4LH4A 4OKJA 4ILGB 4IOAL 3P1GA 1CLQA 3D2FA 5EY4A 4BQLA 4JK8A 5JICA 1HJOA 2F7TA 3GE1A 3LDPA 5AJ3K 4J2BA 4DV1K 1VSIA 2G8WA 3ENHA 4JKEA 3MDQA 3O9QA 3A5NC 4I2QA 4JS5A 1NK6A 1RBSA 1EWQA 4CJ4A 4ISEA 5BRFA 3VMFB 4E7LA 2UUCK 3BY5A 4Y1DA 5AQJA 1QTMA 1C0FA 1WBBA 3OYGA 3TTFA 5M1NA 3FZKA 3KTQA 4NYFA 2CGJA 5JS1A 2QM1A 4BDYA 4CJSA 4F8RA 4DR7K 5HP1A 4O8KA 3QB0A 2FSNA 2HNYA 5M1QA 4WFNL 4EP5A 1V4SA 3VQ8A 3MCAB 5GAGP 1LAVA 2RE2A 3CCUN 4CJVA 4XH1A 3VPZA 3K9KA 1UWBA 5SZTA 1IBKK 4KI6A 2YNGA 3OYMA 1DGKN 1JLQA 2P9LB 2HB5A 3CJ1A 4ELVA 3MN9A 1HNXK 2GELA 1ATRA 2F8SA 3NGYA 1VSMA 3U4LA 5CYQA 2OPQA 3G71N 3DRRA 2D0AA 1D9FA 4KHWA 1XNQK 1X9WA 2NRHA 1MWMA 1VQ8N 4AM6A 4CGGA 4WFAL 1HUXA 2FBTA 3JS6A 3VEYA 2HHWA 4JI7K 4GNIA 4AQYK 3OS2A 2GTDA 1B9DA 1S9EA 1VQ5N 4IG0A 2JLEA 2G8UA 3VTIA 4CEEA 4Z94A 4FK2A 4DF4A 1VSHA 3QIPA 4BRLA 2HBLA 3TANA 3PY8A 2OPSA 4AM7A 1WLJA 1GLCG 2W42A 4CK2A 3JAMO 4LSNA 3S3MA 3EO3A 3PX4A 3O4NA 4JS4A 3BF3A 4OPHA 5J2PA 4CJLA 2GBZA 1T6DA 4CZJA 1XMQK 1K8KA 3KKRA 4M3YA 4YOTA 3KD5E 1D4XA 1RT2A 4DV6K 2DFEA 3DOLA 1TGOA 4FW2A 3UKRA 2VQFK 3P4IA 4CHPA 3V81A 4K25A 4C23A 4BWMA 3BGRA 3VA0A 3PIOL 3ZT1A 2GEMA 3TAGA 3SPZA 4FJLA 1JLAA 3OHRA 4PA1A 2E6LA 3VEWA 3VF6A 3CJAA 1WSIA 2HW3A 3LWMA 4BR9A 3EZ5A 4BG9A 1QS4A 5KPTA 2NRWA 4OPJA 4DTNA 4WCEL 3TU5A 4DTRA 2Y1JA 3PUFA 2CGKA 1JCFA 4CZIA 4R79A 2NZTA 4IDHA 1REVA 3OYHA 2YKMA 1OVQA 3RRGA 3L2WA 4IO9L 2HNZA 1NK9A 1T7PA 2DPNA 3V9WA 4CZKA 4DV3K 4H4MA 2WONA 1WUAA 3WXLA 4AHSA 2VCPA 2BTFA 4CEQA 4BDZA 5HROA 4MO5A 5F1XA 4Z4HA 3I8DA 2QTDA 3TWHA 1Q81O 3TAFA 1ZBUA 2F4VK 2QKKA 3WT0A 2GWJA 4KHPK 3VA3A 4CEDA 4DTMA 4CJUA 3IFRA 3JXUA 4F3OA 4B08A 3E1YA 2Q0RA 4I2PA 1KTQA 1NG9A 1U04A 1GLLO 1Z26A 4B1YB 4BVOA 4EFHA 4AF1A 5CZ1A 1E4GT 3N4PA 2A40A 2HOEA 1HNZK 4BE2A 4CK3A 4QS7A 4RWTA 2NNWA 1VSJA 1VQ7N 2QEXN 1TKTA 3CJBA 3DOKA 4OO1J 4N56A 5ADXA 4FPBA 1W0HA 4M7XA 1NJZA 4HVJA 2QKBA 3EN9A 2WFBA 1YVNA 3LP1A 4B9TA 3IG1A 2YV0X 3K5MA 3CC7N 1K73O 3OYNA 3O8MA 5HRNA 1K8KB 4Y1CA 1CZAN 5C15A 2D0BA 2GWKA 5AQNA 1VQ9N 4CGFA 1YI2N 5AZJB 3CFPA 3UKRB 4O44A 4BRDA 3ZSXA 1VQLN 3VEXA 3FFIA 4A62A 1A5VA 1D9DA 1IKWA 3V6DA 3S9HA 3V9ZA 1QVGM 3VERA 4OPKA 1RT6A 4MDBA 3AO2A 1T44A 1BI4B 3EY1A 3NDKA 4DS4A 3MN6A 1NKCA 4GV9A 4B9LA 3CYMA 3ZT3A 4GKJK 2ZF5O 2GUPA 4UQGA 4BRQA 1XHZA 1BCMA 2P9PA 4RW7A 1RT1A 4GMJB 4DHYA 5KRSA 3OTOK 2VG5A 3PX0A 3AAQA 4M63C 4IEEA 4DSFA 3R1XA 1WSJA 4CJ5A 3B6OA 1FKOA 3C6HA 4FM2A 3ZSRA 3ALYA 4KHSA 4RCHA 3AO1A 3VEVA 3KWIA 3TTCA 4BC5A 3Q7CA 1IKYA 3D7EO 4JI4K 3EKSA 5E84A 2I7PA 4H5VA 4BGAA 3S41A 5JS2A 4KB0A 1BO5O 2DFHA 1LAWA 2W6KA 4FYDA 2O8DB 2QK9A 1L3TA 4JKGB 1U47A 3L2RA 3MK6A 2HHSA 4CJKA 1HPZA 4KAZA 4UY8O 1VRUA 4CF2A 2YJEA 2ETJA 1C0UA 1T03A 4KKOA 2Q36A 4EZ6A 4DV2K 3C94A 4DFKA 4EHUA 3MX2A 3KVGA 3AGRA 2B4JA 2A3ZA 3WQUA 1IJJA 1C0GA 3OYBA 3T1YK 3SAHA 3SV3A 2VG6A 3U9DA 2W40A 5BR9A 1NOZA 1ZYQA 3CC2N 1VQKN 1YAGA 2D0CA 3TAQA 2HBMA 4WQ4A 4C1NI 5JVGL 1U2VB 1RT3A 4BRFA 1QHTA 1S1WA 3MEDA 3ZT4A 3E9PA 1Y64A 5C10A 3FZHA 1SQKA 3K57A 2P9UB 3MXJA 1HQEA 4DR3K 3VGLA 3QEIA 5KPRA 4PUOA 1RTDA 3QIOA 1XHXA 4J8FA 3A8YA 1C1CA 3QLHA 3WNHA 2HMPA 3SV4A 3CJ9A 4DTJA 3WXIA 3D6RA 4FSVA 4RG8A 1NGEA 2I5JA 4EIAA 1RNHA 3CCQN 4LC9B 4G1QA 1EP4A 3CC4N 4I9QA 1BA1A 3VF2A 2OCEA 1Q9YA 1YIJN 4OJRA 3TSQA 5DM6L 1TL3A 1SKSA 5IT9O 1BHLA 3HOTA 3GOIA 3QFPA 3QICA 2YHAA 1KFSA 4E89A 5I3UA 2E8AA 1K8AO 4I7FA 4JNEA 2XRIA 4FWQA 3HPHA 3R9PA 3M8SA 4YDUA 5GADP 1GLEG 4EP4A 5AQZA 1BI4A 4YOVA 1KLNA 1LCUA 4ICLA 1BDGA 2ZQBA 3DLHA 1KCFA 4FL9A 4PKHA 1YT3A 1KAYA 3DXKA 4XEIA 4FJ9A 5DM7L 1BQMA 4Z4FA 3CCMN 3U3YA 4DF8A 3SAGA 1RDWX 3OYJA 4FZXC 4KI4A 4H5TA 3E66A 3THWA 3QINA 3O3FA 2FLOA 1JLEA 3AY9A 4AHUA 3ZSYA 1HJRA 1RCHA 4NLCA 3WXJA 4PL8A 1ZBIA 1EETA 3CFOA 3KJVA 3U8XA 2PFUA 4BR5A 1Z6RA 4FJHA 3A2FA 4CESA 4M3UA 4LF5K 1HYVA 4IJNA 1MDUB 1SL1A 1HKCA 2UYTA 4FLWA 3KIOA 4WYBA 1D5AA 4DQQA 3K58A 2VWBA 1XQSC 1WAFA 3OS0A 3ZEUA 3BZCA 4Z4IA 3MEEA 2Z1GA 4HWIA 4B8CA 3HT3A 3WEEB 2HHHK 5HL7L 4PHTX 1UOCA 2I7NA 4JV5K 4OX9K 2B6AA 5EX5A 3CPEA 1RT7A 2HHTA 1NM1A 5KGWA 1X3NA 3ISNC 4CEOA 4CD3A 2YX6A 3LDOA 4HCCA 2QWNA 1M90O 3OYCA 4LFAK 1VSEA 3AO3A 4KBOA 3HL8A 4B8AB 2P9UA 4IXCA 4CJPA 4DU1A 1MA9B 3O9UA 3EE8A 4NO7A 5C0YA 3KLEA 3WUHA 2HF4A 1S1XA 3ATUA 3VQ6A 1FJGK 3FE1A 2F8TA 1TUUA 1HLUA 3V9UA 4GV6A 3C6TA 2XY5A 3CI5A 4JD2B 3TTDA 3QEXA 4E7HA 5DK5A 4DSLA 2FBYA 1X9SA 1QHAA 2PBDA 3DI6A 4BRGA 3T3FA 1JCEA 4BC3A 4CBXA 3SQ1A 4KTQA 1HRHA 3EE9A 4K8ZA 1NJYA 3T1HK 4ID1A 3KK1A 3FLCO 1RTIA 3ZYYX 5LJWA 2WTUA 2Y1IA 4IOXA 3P38A 3HPOA 3THXA 1VK0A 4XH5A 3EEQA 2P5OA 1G15A 4B3RK 4CZLA 4FK0A 1NJIO 3MCPA 3LZJA 4OLAA 1S1UA 3M8RA 1RTHA 3DWLA 2XY7A 2JWKA 1TUYA 4DCHA 4CEFA 3AGKA 4RW4A 4XIUA 4CBUA 4I6MA 1YITN 1NU0A 3C7NB 3I56N 1IBLK 4CHQA 1SL0A 5AQVA 1X1PA 3OYLA 4DSKA 5GIOA 2QWQA 1IG8A 2V7ZA 4X64K 5IWAK 3NGIA 1YJ9N 4JI6K 3RTVA 2YHBA 5HLFA 2A42A 2IDOA 2P9IB 3L6QA 3OJUA 4B9NA 1G99A 2IIRA 2NRZA 3L2VA 3IS9A 1KQSM 3CXCM 3H6EA 3ZLJA 1RDAA 1DTTA 3O1WA 3SPYA 1HNVA 5H1SQ 3K0SA 4FJJA 3O80A 3QDKA 2VGMA 3L8BA 3MEGA 4JK7A 3ZEUB 1XWLA 2EWSA 4O0IA 4E3SA 2WUSA 3PLAA 3NCIA 2ZWHA 1FW6A 3VQEA 3QFUA 4CGIA 4ILJA 1KXPA 3ZX2A 5ELZA 4FWMA 4M3XA 1TK0A 3SUNA 2O8EA 3ID6A 4DR2K 4JKFA 1NBWA 1CZBA 4E0DA 1NGDA 4F2SA 3R3LA 1R0AA 5KI6A 3NF7A 4FJ5A 4Y0WA 1S3XA 2KHOA 2P9LA 4QS8A 3HVRA 3UKUB 4KV8A 2LSNA 3K9JA 4H0OA 1OH5A 1JLGA 1C1AA 4AHRA 4CEAA 1S6PA 1IV0A 4N5SA 4F2RA 4O5FA 3ZCMA 5DMRA 4JD2A 1QSYA 4KB1A 4CJQA 3O08A 4GVMA 3TSPA 4KO0A 4M3WA 4DLEA 1NK7A 1S1VA 1CXQA 4EZ9A 2XY8A 3O6WA 1N33K 3SQ4A 4JKBA 1ZBFA 4ID5A 3TPQA 4BR4A 2ASPA 2A6AA 4FJIA 1RBUA 1EQYA 2X6SA 4BRPA 4IO8A 4CERA 3LM2A 3ULDA 3AVHA 2YHWA 1ZC6A 4FLZA 4BC4A 4NB4A 2PAVA 4CFBA 3QBWA 1F21A 3LL3A 5FRMA 3LANA 1OH7A 2HSTA 3OJSA 1QZ6A 3AVAA 4I6MB 2IVNA 3CCVN 5KRTA 3EKUA 3SCXA 1RDUA 2HF3A 4FJ7A 5M1OA 3KK7A 3RSEA 3C7NA 1VQPN 5KQ8A 1ILYA 2E6MA 3I0SA 4X65K 3QESA 4KHYA 1D8YA 1SAZA 2E1YA 4X62K 4CIFA 3MXIA 1BIZA 1GOAA 4OKEA 4YOUA 5AR0A 2E88A 2HBKA 2FF3B 2PYJA 2E2QA 3ASMA 3I33A 2OTJN 1HYZA 3RVCA 2KFZA 4FJKA 1JLFA 3VQDA 1L3SA 3ENBA 3FR0A 1I3AA 3ZSZA 1N8RO 3RR8A 4O0JA 2YKNA 1YTUA 5KQDA 4CIGA 2O8DA 3A0IX 1IG9A 1H1VA 1TYQA 4O55A 4CZEA 4F4KA 3T19A 2KFNA 4AHCA 3MN5A 1SZ2A 1BGXT 1KRPA 5FRNA 4F3TA 3F5TA 3C0BA 4FO0A 2UUBK 5TKWA 4ZTFA 4B3OA 3J8AA 3M5RA 2OA8A 3NH1A 3KLFA 4K42A 2G8HA 3I8BA 5F0XA 3TI0A 1ASUA 1ESVA
chains in the Genus database with same CATH topology
1ASWA 4E1MA 1TKZA 3HK2A 2Q3SA 3KD1E 3DLEA 3NF9A 3HXMA 1U47A 3ITHA 1TL1A 1NJXA 1FKPA 3L2RA 2HHSA 4W5NA 3LAMA 2HHQA 4CJKA 1HPZA 1U49A 4KAZA 1KLMA 1JL1A 2E4LA 1VRUA 2EHGA 4CF2A 4CF9A 2ETJA 1C0UA 4AHVA 4KKOA 4CE9A 4CHYA 3KK2A 4FLTA 1T03A 4CGJA 3D0PA 3G0ZA 3AVCA 3C94A 3AA2A 5HRSA 3S3NA 4FK4A 4DFKA 2XY6A 2BGGA 3SYZA 3U6FA 4FVMA 4FCYA 2B4JA 3AV9A 4DQRA 3OYBA 3SV3A 2VG6A 1NKEA 4KRFA 2YNFA 1NOZA 1ZYQA 4H4OA 3QO9A 3MAQA 4Z4EA 1NK8A 4PY5A 2D0CA 3RMDA 3TAQA 3HSTB 4BE0A 1HQUA 4B9VA 4OGCA 4CEBA 1RT3A 3K5OA 4C8NA 2XHBA 1QHTA 3QEWA 3SQ0A 2FBXA 1S1WA 1EX4A 3AVMA 3MEDA 2OZSA 3DLGA 1RILA 3ZT4A 1KSPA 1IKXA 1C0MA 4K8XA 4BE1A 3O3GA 3K57A 3SI6A 3SNNA 4C8OA 4FJ8A 3AA4A 3MXJA 1HQEA 2RN2A 1T8EA 3QEIA 3VQBA 1Z25A 4M3RA 1J5OA 1RTDA 3QIOA 1XHXA 3KLHA 3AO5A 1QE1A 4FLVA 4CF1A 1SKWA 4M42A 3THVA 3OYFA 4N41A 3DLKA 1C1CA 4AILC 1SUQA 3QLHA 3WNHA 3SV4A 4LY7A 5EU7A 4CFDA 4DTJA 3IRXA 3O4QA 4N76A 4RG8A 4DU4A 2I5JA 2R7YA 1KFDA 2DFFA 1RNHA 2IGIA 4AH9A 4W5TA 3K5NA 5SWMA 4DTSA 4E7KA 4NCGA 5HBMA 4G1QA 1EP4A 3NAEA 1C0TA 1N6QA 2OZMA 4DSJA 2G8VA 4I9QA 1Q9YA 1YVUA 4OJRA 3OVNA 3CFRA 1TL3A 1VRTA 2VWKA 3K2PA 1SKSA 3VQ7A 3NE6A 1BHLA 2DTUA 3L3VA 3OYIA 4GW6A 1KFSA 2YHAA 4BACA 3V9XA 4E89A 5I3UA 4Q5VA 3F73A 3HP6A 4I7FA 4OLBA 1DTQA 2XRIA 5E41A 3KLGA 4BDPA 1S6QA 3F9KA 1TK5A 2F96A 4JLHA 4CHNA 3HPHA 4HUEA 3M8SA 1XI1A 4C8LA 4EP4A 1BI4A 2HHVA 2PYLA 1KLNA 4ICLA 2ZQBA 1B92A 3DLHA 1KCFA 2HNDA 4OKKA 4C8MA 2IS3A 1N5YA 1RDDA 1YT3A 1BQNA 3VQ4A 4CJRA 1JL2A 1JLBA 2JGUA 3U3GA 1RDBA 4DTUA 3RR7A 2X74A 1B9FA 4B9UA 3LDSA 2Z1HA 4FJ9A 4QAGA 1RT4A 3SJJA 1ASVA 1BQMA 4E19A 3RRHA 4Z4FA 1HMVA 3U3YA 1T05A 1RBTA 4DF8A 4QCLA 3L2QA 3OYJA 3JSMA 3NF8A 1I39A 4FZXC 4FM1A 4KI4A 3QEPA 3EYZA 4M41A 4CJEA 4KFBA 2ZE2A 4R5PA 5D3GA 1EKEA 3PO5A 4PQUA 3QINA 3AVFA 2IAJA 3VQ9A 4DMNA 2PZSA 3O3FA 2VG7A 1RDCA 4FXDA 4LH4A 1JLEA 3SUQA 4AHUA 4IBNA 1UAXA 4DTXA 3ZSYA 1HJRA 1RCHA 4OKJA 2KZZA 1KVCA 1EETA 1ZBIA 3CQ8A 2A1SA 3CFOA 3KJVA 3P1GA 2HHXA 1U45A 4FM0A 1CLQA 4FJHA 3A2FA 4CESA 3OYDA 4M3UA 3OS1A 2NUBA 1HYVA 1SL1A 4CK1A 3KKSA 1BCOA 3HVTA 1VSIA 4FLWA 1BISA 4LH5A 3ZT0A 3QEVA 2G8WA 4J2BA 3KIOA 5T7BA 2DY4A 3AVIA 1D5AA 5C25A 3K58A 4DQQA 3D45A 1CXUA 1VSDA 1WAFA 4I2QA 4WE1A 4OGEA 4JS5A 3V1OA 1NK6A 1RBSA 3WNEA 1NK0A 1NOYA 4CJ4A 1JLCA 3OS0A 4N47A 4Q0BA 4NCAA 2O4GA 1VSKA 3CM5A 4HUGA 4TSXA 4E7LA 4Z4IA 4CHZA 3MEEA 2Z1GA 4B8CA 4Y1DA 3HT3A 3SZ2A 1QTMA 3DM2A 3JYTA 3NH0A 3OYGA 1RBRA 1UOCA 1IKVA 2KQ2A 2QXFA 3K59A 2BANA 4J2EA 3PV8A 2B6AA 4KTZA 4Z4CA 1QSSA 4DSEA 4DS5A 1RT7A 2HHTA 3MXMA 3KTQA 1ZBHA 4NYFA 5KGWA 3ISNC 5JS1A 4CEOA 1A5WA 3AVKA 1BL3A 2Z1JA 5CYMA 4JRPA 4BDYA 4CJSA 5J2MA 4F8RA 4HCCA 5HP1A 3OYCA 1O1WA 1VSEA 3AO3A 3HL8A 1RBVA 4CJ3A 2HNYA 4B8AB 1QSLA 4O5BA 4EP5A 1FXXA 4CJPA 3VQ8A 4DU1A 3LPUA 1LAVA 2D5RA 3VQ6A 3KLEA 1S1XA 1QQCA 3LPTA 4CJVA 3AVJA 2F8TA 1UWBA 5SZTA 3SUPA 3LAKA 3RMAA 4KI6A 1Q8IA 4I9LA 3PX6A 3V9UA 4DU3A 3C6TA 2YNGA 2XY5A 3OYMA 3KLIA 3NFAA 3QEXA 4E7HA 1JLQA 5DK5A 2HB5A 2WOMA 3TAEA 4DSLA 4KREA 4ELVA 2FBYA 3AVBA 4B9SA 1X9SA 4M45A 4H8KA 2YNHA 2F8SA 3NGYA 1VSMA 3DI6A 3NBPA 4Z4GA 3T3FA 3DRSA 1HYSA 3SQ1A 2FC0A 2OPQA 5CYQA 3T1AA 2VWJA 4KTQA 1LW0A 3DRRA 1HRHA 2D0AA 1XC9A 1D9FA 4KHUA 3ZSOA 4KHWA 4JRQA 1X9WA 4CF0A 1L3VA 4K8ZA 4FJMA 1IO2A 5FDLA 3CG7A 4RW6A 4CJFA 1NJYA 3OYAA 3M8QA 4ID1A 3KK1A 1RTIA 4CGGA 2Y1IA 2FBTA 2HHWA 3HPOA 4B9MA 1VK0A 1WNSA 2P5OA 1G15A 4FK0A 3BDPA 3OS2A 4C8KA 3E01A 3AA5X 3AVLA 1W9HA 1B9DA 1GOCA 3QNOA 1S9EA 4KHNA 4IG0A 1RT5A 4CEZA 5KGXA 3SUOA 1MU2A 2FBVA 4NYNA 3LZJA 4FJGA 2IOCA 4OLAA 1S1UA 1S5JA 1RTHA 2JLEA 3M8RA 2XY7A 5HRRA 4CEEA 2G8UA 4CEFA 4RW4A 4XIUA 4FK2A 1J9AA 4DF4A 5FROA 4W5QA 1VSHA 3QIPA 3VQQA 3VN5A 3HJFA 3TANA 1U4BA 3PY8A 4MFBA 2OPSA 1WLJA 3DYAA 2HVHA 3AVGA 4CK2A 4CHQA 2W42A 1SL0A 2EX3A 4LSNA 2ATQA 3S3MA 2G8FA 3LZIA 3PX4A 1J53A 1X1PA 3O4NA 3OYLA 1RTJA 4JS4A 1TK8A 2P5GA 1TV6A 5J2PA 4DSKA 4CJLA 2GBZA 4CCHA 3V1RA 4OVLA 3NGIA 4YFUA 3KKRA 1C6VA 4M3YA 3UIQA 3KD5E 3RTVA 2P51A 1RT2A 2YHBA 2A1RA 5HLFA 1JKHA 3O3HA 3NF6A 3L3UA 2DFEA 4E7IA 2IDOA 2Z1IA 3DOLA 1NK5A 3VQAA 1TGOA 4FW2A 3OYEA 3OJUA 4B9NA 3L2VA 2RPIA 3IS9A 4CHPA 3V81A 1LWCA 1RDAA 4Z0UA 3WNGA 2AJQA 2P1JA 1DTTA 1CZ9A 2RKIA 3BGRA 4RW8A 4BWMA 3PO4A 3IAYA 3HYFA 3VA0A 3OY9A 2HMIA 3ZT1A 3TAGA 3SPYA 3NHGA 3TABA 3SPZA 3LP0A 1ITGA 1HNVA 5J2NA 1UA1A 4FJJA 4FJLA 3TAPA 1JLAA 2X78A 4W5RA 3L8BA 3MEGA 4PA1A 1J54A 2E6LA 3DRPA 1XWLA 1JXEA 5J2QA 4FZZA 1WSIA 4O0IA 4E3SA 2HW3A 3LWMA 1JXBA 4AHTA 3NCIA 1WN7A 3EZ5A 4M3TA 3VQEA 3LP3A 4CGIA 4BWJA 3ZSQA 4DWIA 1QS4A 2ZD1A 4M3XA 4HCBA 4OPJA 1TK0A 4DTNA 3SUNA 5C24A 3ZSVA 3V9SA 4DTRA 2Y1JA 1VSLA 1L5UA 3OYKA 1Q9XA 1CZBA 3PUFA 4E0DA 4ZTJA 1U48A 4F2SA 2GV9A 4LSLA 2KZMA 1R0AA 1REVA 5KI6A 3M8PA 3OYHA 3NF7A 2HVIA 4FJ5A 4FLYA 2YKMA 2O4IA 1TKDA 1HNIA 3RRGA 3L2WA 3HVRA 4KV8A 2IC3A 2LSNA 4HUFA 2HNZA 1NK9A 1JLGA 1T7PA 1C1AA 4AHRA 4CEAA 1S6PA 3V9WA 1K6YA 4KPYA 1LWEA 3L2UA 3ZT2A 4H4MA 3V1QA 4N5SA 1SL2A 1TKXA 2WONA 3AA3A 4J2AA 4F2RA 4AHSA 3ZCMA 2BDPA 5DMRA 1TAQA 1QSYA 4KB1A 4CEQA 4CJQA 4BDZA 5HROA 3KK3A 3I8DA 4Z4HA 2KW4A 3P5JA 4CJWA 1UA0A 4CJTA 3TWHA 4GVMA 2PY5A 4YNQA 4KO0A 4M3WA 4DLEA 4DLGA 3TAFA 1ZBUA 1NK7A 1S1VA 4FJNA 1CXQA 2QKKA 1WSHA 4O4GA 4DG1A 4EZ9A 3HO1A 1EXQA 2XY8A 4HHTA 3SQ4A 1LW2A 4IDKA 3VA3A 4CEDA 1ZBFA 4ID5A 4DTMA 3CM6A 4CJUA 4DFJA 3RMBA 4M3ZA 4ELUA 4B08A 4F3OA 4FJIA 3QETA 1NJWA 3HPGA 1RBUA 1BIUA 1VSFA 1KTQA 4I2PA 4RW9A 2GUIA 2X6SA 4E7JA 3S3OA 4CIEA 3QNNA 4CERA 1U04A 3K5LA 3ZSWA 3ULDA 1Z26A 4CFAA 3AVHA 1DLOA 4DFPA 1LWFA 4FLZA 5CZ1A 1WAJA 4CFBA 3RWUA 4L8RB 1F21A 2B5JA 4BE2A 2G8KA 4CK3A 5J1EA 5FRMA 3TR8A 3LANA 3DLRA 2XO7A 4CGHA 1VSJA 3OJSA 4DQIA 4DTPA 1TKTA 3AVAA 1YTAA 2KFZA 3DOKA 5C42A 4N56A 2G8IA 5KRTA 3SCXA 4FJ7A 1C1BA 3B6PA 3NH2A 1W0HA 4EZ6A 1NJZA 4HVJA 4E1NA 2QKBA 4DSIA 4QOZB 4IFVA 2E6MA 3LP1A 4B9TA 4FLXA 3IG1A 2YV0X 3VQPA 3I0SA 3K5MA 3QESA 3WNFA 5HRPA 3OYNA 3TARA 4PWDA 3HM9A 3VQCA 5HRNA 4KHYA 4Y1CA 4DFMA 2D0BA 1D8YA 3C95A 3TAMA 4CGFA 4CIFA 3MXIA 1BIZA 1GOAA 2ITGA 4OKEA 1SKRA 5K14A 3CFPA 2KTQA 3LWLA 4FLUA 3DMJA 4O44A 3ZSXA 5KTQA 1NK4A 3FFIA 3QERA 1A5VA 4ELTA 3LP2A 2X6NA 3HP9A 3VQ5A 1D9DA 1IKWA 1GOBA 5CZ2A 2PYJA 2YNIA 1NKBA 4CECA 4ZHRA 4DQSA 3V6DA 4NCBA 3ASMA 4IG3A 1S9GA 3S9HA 3V9ZA 3RMCA 1HYZA 4OPKA 2OPPA 1WSFA 1ZBLA 3AO4A 1RT6A 3AO2A 4DQPA 1JLFA 4FJKA 1KVAA 3VQDA 2OPRA 1BI4B 1TAUA 3EY1A 1L3SA 3NDKA 4DS4A 2BE2A 1NKCA 4FZYA 3V4IA 3CYMA 3MECA 3ZT3A 4B9LA 1I3AA 4CGDA 3ZSZA 4UQGA 4KHQA 2OYQA 1XHZA 1BCMA 4RW7A 4KTWA 3RR8A 3H08A 3C6UA 1RT1A 4GMJB 4O0JA 5KRSA 3P83D 1Y97A 2YKNA 1YTUA 1WSGA 2VG5A 4DTOA 3PX0A 1A5XA 4LD0A 4CIGA 4DSFA 1KVBA 1SV5A 1WSJA 4CJ5A 3G10A 3B6OA 1TVRA 1FKOA 1X9MA 1IG9A 4O55A 4FM2A 4F4KA 3ZSRA 3T19A 3NGZA 4IKFA 1S1TA 2KFNA 4MQ3A 1IH7A 3ALYA 4AHCA 3I0RA 5I42A 4KHSA 3AO1A 1FK9A 1BGXT 1KRPA 5FRNA 4CHOA 4FJXA 1WSEA 4F3TA 4HTUA 4IFYA 2HHUA 4CF8A 1L3UA 4FW1A 1IKYA 4ZTFA 4B3OA 3SQ2A 4W5OA 1LV5A 4CFCA 2OA8A 2RF2A 3NH1A 5CY4A 3KLFA 5JS2A 3DLBA 4J2DA 3LALA 2G8HA 4KB0A 2DFHA 1LAWA 4PUOA 3AVNA 3TI0A 4FYDA 2QK9A 1L3TA 1ASUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASW A;  4E1M A;  1TKZ A;  3HK2 A;  2Q3S A;  3KD1 E;  3DLE A;  3NF9 A;  3HXM A;  1U47 A;  3ITH A;  1TL1 A;  1NJX A;  1FKP A;  3L2R A;  2HHS A;  4W5N A;  3LAM A;  2HHQ A;  4CJK A;  1HPZ A;  1U49 A;  4KAZ A;  1KLM A;  1JL1 A;  2E4L A;  1VRU A;  2EHG A;  4CF2 A;  4CF9 A;  2ETJ A;  1C0U A;  4AHV A;  4KKO A;  4CE9 A;  4CHY A;  3KK2 A;  4FLT A;  1T03 A;  4CGJ A;  3D0P A;  3G0Z A;  3AVC A;  3C94 A;  3AA2 A;  5HRS A;  3S3N A;  4FK4 A;  4DFK A;  2XY6 A;  2BGG A;  3SYZ A;  3U6F A;  4FVM A;  4FCY A;  2B4J A;  3AV9 A;  4DQR A;  3OYB A;  3SV3 A;  2VG6 A;  1NKE A;  4KRF A;  2YNF A;  1NOZ A;  1ZYQ A;  4H4O A;  3QO9 A;  3MAQ A;  4Z4E A;  1NK8 A;  4PY5 A;  2D0C A;  3RMD A;  3TAQ A;  3HST B;  4BE0 A;  1HQU A;  4B9V A;  4OGC A;  4CEB A;  1RT3 A;  3K5O A;  4C8N A;  2XHB A;  1QHT A;  3QEW A;  3SQ0 A;  2FBX A;  1S1W A;  1EX4 A;  3AVM A;  3MED A;  2OZS A;  3DLG A;  1RIL A;  3ZT4 A;  1KSP A;  1IKX A;  1C0M A;  4K8X A;  4BE1 A;  3O3G A;  3K57 A;  3SI6 A;  3SNN A;  4C8O A;  4FJ8 A;  3AA4 A;  3MXJ A;  1HQE A;  2RN2 A;  1T8E A;  3QEI A;  3VQB A;  1Z25 A;  4M3R A;  1J5O A;  1RTD A;  3QIO A;  1XHX A;  3KLH A;  3AO5 A;  1QE1 A;  4FLV A;  4CF1 A;  1SKW A;  4M42 A;  3THV A;  3OYF A;  4N41 A;  3DLK A;  1C1C A;  4AIL C;  1SUQ A;  3QLH A;  3WNH A;  3SV4 A;  4LY7 A;  5EU7 A;  4CFD A;  4DTJ A;  3IRX A;  3O4Q A;  4N76 A;  4RG8 A;  4DU4 A;  2I5J A;  2R7Y A;  1KFD A;  2DFF A;  1RNH A;  2IGI A;  4AH9 A;  4W5T A;  3K5N A;  5SWM A;  4DTS A;  4E7K A;  4NCG A;  5HBM A;  4G1Q A;  1EP4 A;  3NAE A;  1C0T A;  1N6Q A;  2OZM A;  4DSJ A;  2G8V A;  4I9Q A;  1Q9Y A;  1YVU A;  4OJR A;  3OVN A;  3CFR A;  1TL3 A;  1VRT A;  2VWK A;  3K2P A;  1SKS A;  3VQ7 A;  3NE6 A;  1BHL A;  2DTU A;  3L3V A;  3OYI A;  4GW6 A;  1KFS A;  2YHA A;  4BAC A;  3V9X A;  4E89 A;  5I3U A;  4Q5V A;  3F73 A;  3HP6 A;  4I7F A;  4OLB A;  1DTQ A;  2XRI A;  5E41 A;  3KLG A;  4BDP A;  1S6Q A;  3F9K A;  1TK5 A;  2F96 A;  4JLH A;  4CHN A;  3HPH A;  4HUE A;  3M8S A;  1XI1 A;  4C8L A;  4EP4 A;  1BI4 A;  2HHV A;  2PYL A;  1KLN A;  4ICL A;  2ZQB A;  1B92 A;  3DLH A;  1KCF A;  2HND A;  4OKK A;  4C8M A;  2IS3 A;  1N5Y A;  1RDD A;  1YT3 A;  1BQN A;  3VQ4 A;  4CJR A;  1JL2 A;  1JLB A;  2JGU A;  3U3G A;  1RDB A;  4DTU A;  3RR7 A;  2X74 A;  1B9F A;  4B9U A;  3LDS A;  2Z1H A;  4FJ9 A;  4QAG A;  1RT4 A;  3SJJ A;  1ASV A;  1BQM A;  4E19 A;  3RRH A;  4Z4F A;  1HMV A;  3U3Y A;  1T05 A;  1RBT A;  4DF8 A;  4QCL A;  3L2Q A;  3OYJ A;  3JSM A;  3NF8 A;  1I39 A;  4FZX C;  4FM1 A;  4KI4 A;  3QEP A;  3EYZ A;  4M41 A;  4CJE A;  4KFB A;  2ZE2 A;  4R5P A;  5D3G A;  1EKE A;  3PO5 A;  4PQU A;  3QIN A;  3AVF A;  2IAJ A;  3VQ9 A;  4DMN A;  2PZS A;  3O3F A;  2VG7 A;  1RDC A;  4FXD A;  4LH4 A;  1JLE A;  3SUQ A;  4AHU A;  4IBN A;  1UAX A;  4DTX A;  3ZSY A;  1HJR A;  1RCH A;  4OKJ A;  2KZZ A;  1KVC A;  1EET A;  1ZBI A;  3CQ8 A;  2A1S A;  3CFO A;  3KJV A;  3P1G A;  2HHX A;  1U45 A;  4FM0 A;  1CLQ A;  4FJH A;  3A2F A;  4CES A;  3OYD A;  4M3U A;  3OS1 A;  2NUB A;  1HYV A;  1SL1 A;  4CK1 A;  3KKS A;  1BCO A;  3HVT A;  1VSI A;  4FLW A;  1BIS A;  4LH5 A;  3ZT0 A;  3QEV A;  2G8W A;  4J2B A;  3KIO A;  5T7B A;  2DY4 A;  3AVI A;  1D5A A;  5C25 A;  3K58 A;  4DQQ A;  3D45 A;  1CXU A;  1VSD A;  1WAF A;  4I2Q A;  4WE1 A;  4OGE A;  4JS5 A;  3V1O A;  1NK6 A;  1RBS A;  3WNE A;  1NK0 A;  1NOY A;  4CJ4 A;  1JLC A;  3OS0 A;  4N47 A;  4Q0B A;  4NCA A;  2O4G A;  1VSK A;  3CM5 A;  4HUG A;  4TSX A;  4E7L A;  4Z4I A;  4CHZ A;  3MEE A;  2Z1G A;  4B8C A;  4Y1D A;  3HT3 A;  3SZ2 A;  1QTM A;  3DM2 A;  3JYT A;  3NH0 A;  3OYG A;  1RBR A;  1UOC A;  1IKV A;  2KQ2 A;  2QXF A;  3K59 A;  2BAN A;  4J2E A;  3PV8 A;  2B6A A;  4KTZ A;  4Z4C A;  1QSS A;  4DSE A;  4DS5 A;  1RT7 A;  2HHT A;  3MXM A;  3KTQ A;  1ZBH A;  4NYF A;  5KGW A;  3ISN C;  5JS1 A;  4CEO A;  1A5W A;  3AVK A;  1BL3 A;  2Z1J A;  5CYM A;  4JRP A;  4BDY A;  4CJS A;  5J2M A;  4F8R A;  4HCC A;  5HP1 A;  3OYC A;  1O1W A;  1VSE A;  3AO3 A;  3HL8 A;  1RBV A;  4CJ3 A;  2HNY A;  4B8A B;  1QSL A;  4O5B A;  4EP5 A;  1FXX A;  4CJP A;  3VQ8 A;  4DU1 A;  3LPU A;  1LAV A;  2D5R A;  3VQ6 A;  3KLE A;  1S1X A;  1QQC A;  3LPT A;  4CJV A;  3AVJ A;  2F8T A;  1UWB A;  5SZT A;  3SUP A;  3LAK A;  3RMA A;  4KI6 A;  1Q8I A;  4I9L A;  3PX6 A;  3V9U A;  4DU3 A;  3C6T A;  2YNG A;  2XY5 A;  3OYM A;  3KLI A;  3NFA A;  3QEX A;  4E7H A;  1JLQ A;  5DK5 A;  2HB5 A;  2WOM A;  3TAE A;  4DSL A;  4KRE A;  4ELV A;  2FBY A;  3AVB A;  4B9S A;  1X9S A;  4M45 A;  4H8K A;  2YNH A;  2F8S A;  3NGY A;  1VSM A;  3DI6 A;  3NBP A;  4Z4G A;  3T3F A;  3DRS A;  1HYS A;  3SQ1 A;  2FC0 A;  2OPQ A;  5CYQ A;  3T1A A;  2VWJ A;  4KTQ A;  1LW0 A;  3DRR A;  1HRH A;  2D0A A;  1XC9 A;  1D9F A;  4KHU A;  3ZSO A;  4KHW A;  4JRQ A;  1X9W A;  4CF0 A;  1L3V A;  4K8Z A;  4FJM A;  1IO2 A;  5FDL A;  3CG7 A;  4RW6 A;  4CJF A;  1NJY A;  3OYA A;  3M8Q A;  4ID1 A;  3KK1 A;  1RTI A;  4CGG A;  2Y1I A;  2FBT A;  2HHW A;  3HPO A;  4B9M A;  1VK0 A;  1WNS A;  2P5O A;  1G15 A;  4FK0 A;  3BDP A;  3OS2 A;  4C8K A;  3E01 A;  3AA5 X;  3AVL A;  1W9H A;  1B9D A;  1GOC A;  3QNO A;  1S9E A;  4KHN A;  4IG0 A;  1RT5 A;  4CEZ A;  5KGX A;  3SUO A;  1MU2 A;  2FBV A;  4NYN A;  3LZJ A;  4FJG A;  2IOC A;  4OLA A;  1S1U A;  1S5J A;  1RTH A;  2JLE A;  3M8R A;  2XY7 A;  5HRR A;  4CEE A;  2G8U A;  4CEF A;  4RW4 A;  4XIU A;  4FK2 A;  1J9A A;  4DF4 A;  5FRO A;  4W5Q A;  1VSH A;  3QIP A;  3VQQ A;  3VN5 A;  3HJF A;  3TAN A;  1U4B A;  3PY8 A;  4MFB A;  2OPS A;  1WLJ A;  3DYA A;  2HVH A;  3AVG A;  4CK2 A;  4CHQ A;  2W42 A;  1SL0 A;  2EX3 A;  4LSN A;  2ATQ A;  3S3M A;  2G8F A;  3LZI A;  3PX4 A;  1J53 A;  1X1P A;  3O4N A;  3OYL A;  1RTJ A;  4JS4 A;  1TK8 A;  2P5G A;  1TV6 A;  5J2P A;  4DSK A;  4CJL A;  2GBZ A;  4CCH A;  3V1R A;  4OVL A;  3NGI A;  4YFU A;  3KKR A;  1C6V A;  4M3Y A;  3UIQ A;  3KD5 E;  3RTV A;  2P51 A;  1RT2 A;  2YHB A;  2A1R A;  5HLF A;  1JKH A;  3O3H A;  3NF6 A;  3L3U A;  2DFE A;  4E7I A;  2IDO A;  2Z1I A;  3DOL A;  1NK5 A;  3VQA A;  1TGO A;  4FW2 A;  3OYE A;  3OJU A;  4B9N A;  3L2V A;  2RPI A;  3IS9 A;  4CHP A;  3V81 A;  1LWC A;  1RDA A;  4Z0U A;  3WNG A;  2AJQ A;  2P1J A;  1DTT A;  1CZ9 A;  2RKI A;  3BGR A;  4RW8 A;  4BWM A;  3PO4 A;  3IAY A;  3HYF A;  3VA0 A;  3OY9 A;  2HMI A;  3ZT1 A;  3TAG A;  3SPY A;  3NHG A;  3TAB A;  3SPZ A;  3LP0 A;  1ITG A;  1HNV A;  5J2N A;  1UA1 A;  4FJJ A;  4FJL A;  3TAP A;  1JLA A;  2X78 A;  4W5R A;  3L8B A;  3MEG A;  4PA1 A;  1J54 A;  2E6L A;  3DRP A;  1XWL A;  1JXE A;  5J2Q A;  4FZZ A;  1WSI A;  4O0I A;  4E3S A;  2HW3 A;  3LWM A;  1JXB A;  4AHT A;  3NCI A;  1WN7 A;  3EZ5 A;  4M3T A;  3VQE A;  3LP3 A;  4CGI A;  4BWJ A;  3ZSQ A;  4DWI A;  1QS4 A;  2ZD1 A;  4M3X A;  4HCB A;  4OPJ A;  1TK0 A;  4DTN A;  3SUN A;  5C24 A;  3ZSV A;  3V9S A;  4DTR A;  2Y1J A;  1VSL A;  1L5U A;  3OYK A;  1Q9X A;  1CZB A;  3PUF A;  4E0D A;  4ZTJ A;  1U48 A;  4F2S A;  2GV9 A;  4LSL A;  2KZM A;  1R0A A;  1REV A;  5KI6 A;  3M8P A;  3OYH A;  3NF7 A;  2HVI A;  4FJ5 A;  4FLY A;  2YKM A;  2O4I A;  1TKD A;  1HNI A;  3RRG A;  3L2W A;  3HVR A;  4KV8 A;  2IC3 A;  2LSN A;  4HUF A;  2HNZ A;  1NK9 A;  1JLG A;  1T7P A;  1C1A A;  4AHR A;  4CEA A;  1S6P A;  3V9W A;  1K6Y A;  4KPY A;  1LWE A;  3L2U A;  3ZT2 A;  4H4M A;  3V1Q A;  4N5S A;  1SL2 A;  1TKX A;  2WON A;  3AA3 A;  4J2A A;  4F2R A;  4AHS A;  3ZCM A;  2BDP A;  5DMR A;  1TAQ A;  1QSY A;  4KB1 A;  4CEQ A;  4CJQ A;  4BDZ A;  5HRO A;  3KK3 A;  3I8D A;  4Z4H A;  2KW4 A;  3P5J A;  4CJW A;  1UA0 A;  4CJT A;  3TWH A;  4GVM A;  2PY5 A;  4YNQ A;  4KO0 A;  4M3W A;  4DLE A;  4DLG A;  3TAF A;  1ZBU A;  1NK7 A;  1S1V A;  4FJN A;  1CXQ A;  2QKK A;  1WSH A;  4O4G A;  4DG1 A;  4EZ9 A;  3HO1 A;  1EXQ A;  2XY8 A;  4HHT A;  3SQ4 A;  1LW2 A;  4IDK A;  3VA3 A;  4CED A;  1ZBF A;  4ID5 A;  4DTM A;  3CM6 A;  4CJU A;  4DFJ A;  3RMB A;  4M3Z A;  4ELU A;  4B08 A;  4F3O A;  4FJI A;  3QET A;  1NJW A;  3HPG A;  1RBU A;  1BIU A;  1VSF A;  1KTQ A;  4I2P A;  4RW9 A;  2GUI A;  2X6S A;  4E7J A;  3S3O A;  4CIE A;  3QNN A;  4CER A;  1U04 A;  3K5L A;  3ZSW A;  3ULD A;  1Z26 A;  4CFA A;  3AVH A;  1DLO A;  4DFP A;  1LWF A;  4FLZ A;  5CZ1 A;  1WAJ A;  4CFB A;  3RWU A;  4L8R B;  1F21 A;  2B5J A;  4BE2 A;  2G8K A;  4CK3 A;  5J1E A;  5FRM A;  3TR8 A;  3LAN A;  3DLR A;  2XO7 A;  4CGH A;  1VSJ A;  3OJS A;  4DQI A;  4DTP A;  1TKT A;  3AVA A;  1YTA A;  2KFZ A;  3DOK A;  5C42 A;  4N56 A;  2G8I A;  5KRT A;  3SCX A;  4FJ7 A;  1C1B A;  3B6P A;  3NH2 A;  1W0H A;  4EZ6 A;  1NJZ A;  4HVJ A;  4E1N A;  2QKB A;  4DSI A;  4QOZ B;  4IFV A;  2E6M A;  3LP1 A;  4B9T A;  4FLX A;  3IG1 A;  2YV0 X;  3VQP A;  3I0S A;  3K5M A;  3QES A;  3WNF A;  5HRP A;  3OYN A;  3TAR A;  4PWD A;  3HM9 A;  3VQC A;  5HRN A;  4KHY A;  4Y1C A;  4DFM A;  2D0B A;  1D8Y A;  3C95 A;  3TAM A;  4CGF A;  4CIF A;  3MXI A;  1BIZ A;  1GOA A;  2ITG A;  4OKE A;  1SKR A;  5K14 A;  3CFP A;  2KTQ A;  3LWL A;  4FLU A;  3DMJ A;  4O44 A;  3ZSX A;  5KTQ A;  1NK4 A;  3FFI A;  3QER A;  1A5V A;  4ELT A;  3LP2 A;  2X6N A;  3HP9 A;  3VQ5 A;  1D9D A;  1IKW A;  1GOB A;  5CZ2 A;  2PYJ A;  2YNI A;  1NKB A;  4CEC A;  4ZHR A;  4DQS A;  3V6D A;  4NCB A;  3ASM A;  4IG3 A;  1S9G A;  3S9H A;  3V9Z A;  3RMC A;  1HYZ A;  4OPK A;  2OPP A;  1WSF A;  1ZBL A;  3AO4 A;  1RT6 A;  3AO2 A;  4DQP A;  1JLF A;  4FJK A;  1KVA A;  3VQD A;  2OPR A;  1BI4 B;  1TAU A;  3EY1 A;  1L3S A;  3NDK A;  4DS4 A;  2BE2 A;  1NKC A;  4FZY A;  3V4I A;  3CYM A;  3MEC A;  3ZT3 A;  4B9L A;  1I3A A;  4CGD A;  3ZSZ A;  4UQG A;  4KHQ A;  2OYQ A;  1XHZ A;  1BCM A;  4RW7 A;  4KTW A;  3RR8 A;  3H08 A;  3C6U A;  1RT1 A;  4GMJ B;  4O0J A;  5KRS A;  3P83 D;  1Y97 A;  2YKN A;  1YTU A;  1WSG A;  2VG5 A;  4DTO A;  3PX0 A;  1A5X A;  4LD0 A;  4CIG A;  4DSF A;  1KVB A;  1SV5 A;  1WSJ A;  4CJ5 A;  3G10 A;  3B6O A;  1TVR A;  1FKO A;  1X9M A;  1IG9 A;  4O55 A;  4FM2 A;  4F4K A;  3ZSR A;  3T19 A;  3NGZ A;  4IKF A;  1S1T A;  2KFN A;  4MQ3 A;  1IH7 A;  3ALY A;  4AHC A;  3I0R A;  5I42 A;  4KHS A;  3AO1 A;  1FK9 A;  1BGX T;  1KRP A;  5FRN A;  4CHO A;  4FJX A;  1WSE A;  4F3T A;  4HTU A;  4IFY A;  2HHU A;  4CF8 A;  1L3U A;  4FW1 A;  1IKY A;  4ZTF A;  4B3O A;  3SQ2 A;  4W5O A;  1LV5 A;  4CFC A;  2OA8 A;  2RF2 A;  3NH1 A;  5CY4 A;  3KLF A;  5JS2 A;  3DLB A;  4J2D A;  3LAL A;  2G8H A;  4KB0 A;  2DFH A;  1LAW A;  4PUO A;  3AVN A;  3TI0 A;  4FYD A;  2QK9 A;  1L3T A;  1ASU A; 
#chains in the Genus database with same CATH topology
 5HOO A;  1TL1 A;  3CIP A;  5EOY A;  1KLM A;  2E4L A;  4CF9 A;  4FOI A;  4AHV A;  4CE9 A;  1S72 N;  3VOV A;  4YOY A;  3PIP L;  3C6A A;  2XY6 A;  3SYZ A;  1KC8 O;  4FVM A;  4FCY A;  4DQR A;  3HSC A;  1NKE A;  2YNF A;  4PKG A;  4H5N A;  1NGH A;  4V19 S;  4PY5 A;  3HST B;  4PL7 A;  1HQU A;  2FBX A;  2FSJ A;  1DT9 A;  3DLG A;  2F9T A;  3O4W A;  4U67 L;  5M1F A;  4FJ8 A;  4C8O A;  2AP1 A;  1M1K O;  3AA4 A;  3ENO A;  3VEO A;  5AFU A;  4DR4 K;  2RN2 A;  3J7A P;  1Z25 A;  4FLV A;  1QE1 A;  1SKW A;  4CF1 A;  3THV A;  4BRC A;  4N41 A;  3DLK A;  3O1B A;  1HKG A;  3O4Q A;  2DFF A;  2A5X A;  2HBJ A;  4JI1 K;  1WOQ A;  5SWM A;  4E7K A;  4NCG A;  1N6Q A;  5C2D A;  3HRG A;  3F9M A;  1YVU A;  3OVN A;  3CFR A;  2QWL A;  4RTF D;  5KPZ A;  3VQ7 A;  3OYI A;  4BAC A;  4JYA K;  4DB3 A;  3CQX A;  4CBW A;  3F73 A;  2E2P A;  4OLB A;  1DTQ A;  5E41 A;  3KLG A;  2F96 A;  3LM9 A;  1W7A A;  4CHN A;  4HUE A;  1XI1 A;  3ZET A;  4FWN A;  2HHV A;  2IVP A;  1B92 A;  2HND A;  4K43 A;  4OKK A;  4JKH A;  1N5Y A;  1RDD A;  3VQ4 A;  1JL2 A;  2JGU A;  4QAG A;  1RT4 A;  1ASV A;  4E19 A;  1VQN N;  1LOT B;  5M1P A;  1NGI A;  1U6Z A;  3QEP A;  1GLD G;  4M41 A;  4PQU A;  3LDL A;  2KKZ A;  3PO5 A;  3AVF A;  3VQ9 A;  2F9W A;  3SUQ A;  4IBN A;  1VQM N;  1UAX A;  4JKG A;  1O13 A;  5AQF A;  3IMX A;  2CH5 A;  2A1S A;  3HOS A;  2HHX A;  4BRN A;  1U45 A;  4FM0 A;  2VGN A;  1NWK A;  4A5B A;  3G6E N;  2RHK A;  4CK1 A;  3BUZ B;  3HVT A;  3KKS A;  3UB5 A;  3QEV A;  4LH5 A;  3ZT0 A;  4MLH A;  5T7B A;  3GL1 A;  4BR0 A;  2CGL A;  4B1Z A;  2ZM6 K;  3VEZ A;  5C25 A;  1Q82 O;  3D45 A;  1CXU A;  1VSD A;  1QVF M;  4OGE A;  3V1O A;  5AFU H;  3WNE A;  4PKI A;  1JLC A;  3O9R A;  2O4G A;  4ISF A;  1NMN A;  4TSX A;  5AQL A;  4CHZ A;  2BUP A;  3SZ2 A;  1BU6 O;  3JYT A;  3H3O B;  1WB9 A;  1T3V A;  2QXF A;  1IKV A;  5LL6 Z;  5AZI B;  4FWK A;  4FWR A;  4J2E A;  3PV8 A;  4DSE A;  4DS5 A;  3MXM A;  1ZBH A;  1E3M A;  3FZL A;  1A5W A;  3AVK A;  4JRP A;  4H0Y B;  1QSL A;  4FVU A;  4O5B A;  4BRE A;  2D5R A;  2YCH A;  3H46 O;  1XNR K;  1QQC A;  3LPT A;  3CCL N;  1DEJ A;  3OA9 A;  5BN9 A;  4IJA A;  1YHQ N;  3RMA A;  1Q8I A;  3ZX3 A;  3CER A;  3THX B;  4LF6 K;  1X9J A;  2NRX A;  4BR7 A;  3NFA A;  3G4S N;  4KRE A;  3AVB A;  4B9S A;  4M45 A;  3SJH A;  2YNH A;  3OBY A;  3VF4 A;  3NBP A;  1HYS A;  4M7Y A;  3T1A A;  1XC9 A;  5AQM A;  5I9E B;  4CF0 A;  5FDL A;  4RW6 A;  4CJF A;  4B9M A;  1WNS A;  4YY3 K;  1T6C A;  5A2Q O;  4DR6 K;  3AA5 X;  3AVL A;  4MO4 A;  4NYN A;  2FBV A;  4WFB L;  4FPA A;  2O8B B;  1J9A A;  5GIN A;  5FRO A;  4W5Q A;  3HJF A;  1HPM A;  1U4B A;  4MFB A;  1Q86 O;  3DYA A;  3MWT A;  5B8H A;  2Q97 A;  3THY B;  1J53 A;  4JI2 K;  2P5G A;  4CCH A;  1C6V A;  2W41 A;  2A1R A;  3MN7 A;  1HKB A;  4GVE A;  1NK5 A;  3VQA A;  1VQ4 N;  4DR1 K;  2AJQ A;  4Z0U A;  2P1J A;  3CPW M;  4RW8 A;  1CZ9 A;  2RKI A;  3PO4 A;  2FSK A;  3HYF A;  3OY9 A;  3NHG A;  1ITG A;  5J2N A;  3TAP A;  1J54 A;  3L4Q A;  5AQH A;  2H3G X;  3UKU A;  1P90 A;  1JXB A;  4AHT A;  4WF9 L;  1WN7 A;  4BGB A;  2BH1 A;  4M3T A;  1EWR A;  3LP3 A;  4BWJ A;  4CZH A;  4JKD A;  5AZI A;  5C12 A;  1E4F T;  3ZSV A;  3V9S A;  3ULE B;  4CD1 A;  3OYK A;  1Q9X A;  3I55 N;  5M1K A;  4ZTJ A;  1U48 A;  5GAE P;  4LSL A;  2V52 B;  5EVZ A;  3M8P A;  4H0X B;  4FLY A;  3CCJ N;  4WQ5 C;  3DXM A;  1HNI A;  1NNE A;  3QML A;  2IC3 A;  4HUF A;  2GX9 A;  2D4W A;  4H0V B;  1OKJ A;  1K6Y A;  1LWE A;  1NGG A;  2A41 A;  3V1Q A;  4G9Z A;  4J2A A;  1TAQ A;  3M3Z A;  2NLX A;  2UU9 K;  3KK3 A;  1MWK A;  3P5J A;  4CJW A;  3P31 A;  4DLG A;  1NGB A;  1WSH A;  4DG1 A;  5AQX A;  1IBM K;  3HO1 A;  3DXK B;  4BR2 A;  4IDK A;  1OH8 A;  3BZK A;  5GIP A;  2YI1 A;  4DUY K;  3D2F B;  4ELU A;  3RSE B;  3HPG A;  4RW9 A;  2QA4 N;  2GUI A;  4E7J A;  3S3O A;  4CIE A;  3QNN A;  3ZSW A;  3HZ6 A;  4CFA A;  1S22 A;  2J4R A;  1XUP O;  2ZJP L;  4A57 A;  1WAJ A;  5JLH A;  5GAH P;  3RWU A;  4L8R B;  1KAZ A;  2B5J A;  3O5B A;  5J1E A;  3TR8 A;  1X3M A;  4C1N K;  4CGH A;  2WBN A;  3CCR N;  1RFQ A;  3GG4 A;  4DQI A;  4DTP A;  2UXB K;  5BPL A;  2O8B A;  2NRV A;  1YTA A;  2G8I A;  2P9N A;  1ATS A;  4BQZ A;  1VHX A;  2CH6 A;  3NH2 A;  5CE3 A;  3NVM A;  2QWP A;  3NMU A;  4DV7 K;  3ATV A;  4QOZ B;  2QXL A;  4IFV A;  4B3T K;  1GLJ O;  4FLX A;  2QWR A;  3U9Z A;  4PWD A;  1OVY A;  5HRP A;  1YXQ A;  2ITG A;  4BRH A;  4IFE A;  1SKR A;  2D0P A;  2KTQ A;  4OPA A;  1NGF A;  3DMJ A;  1N34 K;  3QER A;  3T7Z A;  4ELT A;  3LP2 A;  5BPN A;  5JVH L;  3VQ5 A;  4BRI A;  5CZ2 A;  2D1K A;  1S9G A;  1NGC A;  4DQP A;  1ZBL A;  2OPP A;  1WSF A;  3AO4 A;  3MMV A;  1KVA A;  1QQN A;  4YDU C;  3J7Y P;  3CQY A;  3V4I A;  2Q2R A;  4DV0 K;  2OYQ A;  3H08 A;  3C6U A;  1JJ2 M;  3P83 D;  1Y97 A;  1WSG A;  3DLL L;  1KVB A;  1TVR A;  1YJW N;  3HBT A;  2UUA K;  4LF7 K;  1S1T A;  3E9L A;  4MQ3 A;  3CJC A;  5I42 A;  4X66 K;  1FK9 A;  4HTU A;  3CME N;  3H1V X;  3A5L C;  4FW1 A;  3SQ2 A;  4W5O A;  3CCE N;  4CFC A;  5FPD A;  2FXU A;  3AVN A;  1OH6 A;  3TSU A;  4CZM A;  4IOC L;  3FZM A;  1ASW A;  4E1M A;  1TKZ A;  4DV5 K;  3DLE A;  2JWL A;  3NF9 A;  1XMO K;  3J80 O;  1FKP A;  4W5N A;  3LAM A;  3R6M A;  2HHQ A;  1U49 A;  1JL1 A;  2EHG A;  4CHY A;  4CI6 A;  4A61 A;  4CGJ A;  3AVC A;  3S3N A;  3AA2 A;  4FK4 A;  3FZF A;  3AV9 A;  4NLB A;  3Q7B A;  3L0Q A;  4KRF A;  1QQO A;  4FWS A;  3CCS N;  3QO9 A;  3MAQ A;  4Z4E A;  3RMD A;  4BE0 A;  1KAX A;  4CEB A;  2WC9 A;  3M1F A;  3K5O A;  4C8N A;  3SQ0 A;  3QEW A;  3AVM A;  1EX4 A;  2OZS A;  1RIL A;  4JEP A;  1SS6 A;  1KSP A;  3CJ7 A;  5FPM A;  4BE1 A;  3SNN A;  3CHW A;  4FOE A;  3PSI A;  1J5O A;  3VQB A;  1J5E K;  1GLB G;  3KLH A;  3AO5 A;  4AIL C;  1SUQ A;  4CFD A;  5AQG A;  3W0L A;  4N76 A;  2O8F A;  5AQU A;  4DU4 A;  2R7Y A;  1KFD A;  2IGI A;  4AH9 A;  4EAH D;  5CR4 A;  2OZM A;  4DSJ A;  1VRT A;  2VWK A;  3K2P A;  2P9K A;  3VGK A;  4LF4 K;  3L3V A;  3IDH A;  3V9X A;  1Q7Y O;  5TKY A;  3HP6 A;  3F9K A;  1TK5 A;  2P9S A;  4C8L A;  3HTV A;  2PYL A;  3CF5 L;  4IZ9 A;  3AAP A;  1BQN A;  5BRH A;  2V7Y A;  3U3G A;  1RDB A;  4DTU A;  5BRD A;  2X74 A;  5C2F A;  3J81 O;  3LDS A;  2Z1H A;  3RR7 A;  3SJJ A;  1T05 A;  4QCL A;  4IWV A;  3SMP A;  3L2Q A;  3JSM A;  1I39 A;  2E2O A;  3EYZ A;  5AQY A;  4KFB A;  2ZE2 A;  4R5P A;  1EKE A;  2VG7 A;  4KH5 A;  4FWL A;  4DTX A;  2KLA A;  4YOW A;  2KZZ A;  1KVC A;  3CD6 N;  3CQ8 A;  4O8U A;  5MLC Q;  3AAR A;  5LJV A;  3H3N O;  3KZB A;  3OYD A;  4WQ4 C;  3A5O C;  2NUB A;  3OS1 A;  1BCO A;  1NMD A;  3H45 C;  1BIS A;  2DY4 A;  3L4I A;  2V51 B;  5AQI A;  3AVI A;  2QW9 A;  3O9T A;  4B1V A;  4QS9 A;  4WE1 A;  1NK0 A;  1NOY A;  4Q0B A;  4N47 A;  4KH4 A;  4NCA A;  3E9O A;  2AA4 A;  3VET A;  1VSK A;  3CM5 A;  4HUG A;  1W2B M;  3KHY A;  4IEI A;  5F2R A;  3DM2 A;  1K9M O;  3OBW A;  3NH0 A;  1RBR A;  2KQ2 A;  3K59 A;  2BAN A;  4KTZ A;  4Z4C A;  1QSS A;  1J6Z A;  2W6L A;  3SBT A;  2YHX A;  1BL3 A;  2Z1J A;  5CYM A;  5J2M A;  4H0P A;  1O1W A;  1RBV A;  5FPN A;  4CJ3 A;  1FXX A;  3LPU A;  3AVJ A;  2YJF A;  3SUP A;  3LAK A;  3D2E B;  4A5A A;  4I9L A;  3PX6 A;  1Z05 A;  4DU3 A;  3FFK B;  3KLI A;  3DAW A;  2WOM A;  3TAE A;  1YF5 L;  2UXC K;  4LFB K;  4H8K A;  3BEX A;  4Z4G A;  4DUZ K;  3DRS A;  3R8E A;  2FC0 A;  2VWJ A;  3VTH A;  1LW0 A;  4ILH A;  4KHU A;  3ZSO A;  1TYQ B;  4YOR A;  1BG3 A;  4JRQ A;  4FJM A;  1L3V A;  1IO2 A;  5FPE A;  3CG7 A;  3OYA A;  3M8Q A;  4BC2 A;  1V4T A;  3BDP A;  4C8K A;  3E01 A;  1P8Z A;  1W9H A;  1GOC A;  3QNO A;  4KHN A;  3KWG A;  3SUO A;  1RT5 A;  4CEZ A;  5KGX A;  4FJG A;  1MU2 A;  2IOC A;  1S5J A;  4GY2 B;  4BY9 C;  5HRR A;  3VQQ A;  3VN5 A;  1NGJ A;  2HVH A;  3AVG A;  2EX3 A;  2ATQ A;  2G8F A;  1QZ5 A;  3LZI A;  1TK8 A;  5LMN K;  1RTJ A;  1TV6 A;  4JHD A;  4B3S K;  3V1R A;  4OVL A;  4B1W B;  4YFU A;  1VQ6 N;  3UIQ A;  4YOX A;  2P51 A;  1JKH A;  3M6G A;  3O3H A;  3NF6 A;  3L3U A;  4E7I A;  2Z1I A;  1QQM A;  5JMV A;  1GLF O;  3OYE A;  2OTL N;  4A2B A;  2RPI A;  4DQ8 A;  1N32 K;  1LWC A;  3ULE A;  3WNG A;  4K0K K;  4BRO A;  2ASO A;  3IAY A;  1VAZ A;  5CHI A;  2HMI A;  3TAB A;  3LP0 A;  1UA1 A;  2X78 A;  4W5R A;  1BWF O;  3DRP A;  3DXM B;  1JXE A;  5FLX O;  5J2Q A;  4FZZ A;  4WQ5 A;  5AQS A;  5AQR A;  3SAF A;  4B1X B;  4DV4 K;  5JLF A;  1Q18 A;  4LF9 K;  3ZSQ A;  4DWI A;  2ZD1 A;  4NXM K;  4HCB A;  5C24 A;  4B1U B;  1VSL A;  1L5U A;  2P9P B;  3W3D A;  2GV9 A;  1DKG D;  2KZM A;  3H1Q A;  4H0T B;  2HVI A;  2O4I A;  2E1Z A;  1TKD A;  3F2K A;  1EO1 A;  4A59 A;  4KPY A;  3L2U A;  3HM8 A;  3D2E A;  3ZET B;  3ZT2 A;  4JI0 K;  1SL2 A;  1TKX A;  3AA3 A;  2BDP A;  1XC3 A;  3C65 A;  4H5W A;  2KW4 A;  1UA0 A;  2PY5 A;  4B3M K;  4A2A A;  4CJT A;  4YNQ A;  2Q31 A;  3UE5 A;  1VQO N;  4FJN A;  4CVN E;  4O4G A;  4MLE A;  1HR0 K;  1EXQ A;  3NVK A;  4HHT A;  1LW2 A;  2Q1N A;  3CM6 A;  4DFJ A;  3RMB A;  4M3Z A;  3QET A;  1NJW A;  1VSF A;  1BIU A;  1WBD A;  3BF1 A;  1KD1 O;  3K5L A;  3PSF A;  4DFP A;  1DLO A;  1LWF A;  3BP8 A;  2ASM A;  1YUW A;  2ITM A;  1W97 L;  3CET A;  3THY A;  2G8K A;  4CW7 B;  4JI8 K;  3DLR A;  2XO7 A;  2O8C A;  5C42 A;  1U2V A;  1C1B A;  3B6P A;  2VYP A;  2D0O A;  3IUC A;  4E1N A;  2ZGY A;  1NGA A;  4DSI A;  3N4Q A;  4MDA A;  3VQP A;  5BN8 A;  3WNF A;  2E20 A;  4JHD B;  3TAR A;  3HM9 A;  1JCG A;  1ZBS A;  3VQC A;  4DFM A;  3C95 A;  3OW2 M;  2QWO A;  3TAM A;  1NLV A;  4GV3 A;  5K14 A;  2FF6 A;  4XH4 A;  3LWL A;  4B9Q A;  4FLU A;  1NK4 A;  5KTQ A;  5LMU K;  2X6N A;  3HP9 A;  4JN4 A;  4DR5 K;  1GOB A;  4NCB A;  2YNI A;  1NKB A;  4BVP A;  4CEC A;  4ZHR A;  4DQS A;  1I94 K;  2OAN A;  4IG3 A;  3RMC A;  3SBG A;  2NRT A;  4F9O A;  2OPR A;  4JK9 A;  1TAU A;  4ISG A;  3VES A;  3SLC A;  3QBX A;  4EHT A;  2BE2 A;  4FZY A;  4LF8 K;  3MEC A;  3VGM A;  1GLA G;  3EZW A;  4CGD A;  4KHQ A;  5EXW A;  4KTW A;  4H5R A;  4LFC K;  3T69 A;  3MWP A;  2UXD K;  4DTO A;  1A5X A;  4LD0 A;  5AZJ A;  1SV5 A;  4BRA A;  5LY3 A;  3A5M C;  3G10 A;  3SK3 A;  1ZXO A;  1X9M A;  3VEN A;  4IKF A;  3NGZ A;  1IH7 A;  3I0R A;  1BA0 A;  4KH6 A;  4CHO A;  4U7B A;  1WSE A;  4FJX A;  4GKK K;  4IFY A;  4DKW A;  2HHU A;  4CF8 A;  1L3U A;  1ATN A;  3P39 A;  1LV5 A;  4CJ7 A;  2RF2 A;  5CY4 A;  3THW B;  2ZJQ L;  3DLB A;  4J2D A;  3GBT A;  3LAL A;  1N36 K;  5BRE A;  4YHH K;  1RGI A;  3HK2 A;  2Q3S A;  3KD1 E;  4CZF A;  3HXM A;  3ITH A;  3B8A X;  1NJX A;  4BG8 A;  3GDQ A;  4H03 B;  3KK2 A;  4FLT A;  3D0P A;  3G0Z A;  4BRM A;  5HRS A;  4HTL A;  2Q0U A;  2BGG A;  4JAX A;  3U6F A;  3MX5 A;  3FGU A;  2P9I A;  2ZJR L;  2O8F B;  4H4O A;  5AQO A;  1NK8 A;  3WXK A;  4B9V A;  4FWO A;  4OGC A;  2P9N B;  2QWM A;  3J7Z O;  2XHB A;  4BRK A;  3LDN A;  3WEE A;  1IKX A;  2YHY A;  4FWP A;  1C0M A;  2P9K B;  3SMS A;  4K8X A;  3O3G A;  3SI6 A;  2E5L K;  4L3Q A;  2ZGZ A;  1T8E A;  2VQE K;  4M3R A;  5BR8 K;  2O8C B;  4M42 A;  1BUP A;  2QI2 A;  2P9S B;  3OYF A;  5ADX H;  4NXN K;  3O9S A;  4LY7 A;  5EU7 A;  3IRX A;  1BOT O;  5BPM A;  4CZG A;  2O8E B;  4W5T A;  3K5N A;  4DTS A;  3IKM A;  4JI5 K;  5HBM A;  3NAE A;  1C0T A;  2G8V A;  5AQT A;  4K41 A;  1R59 O;  3NE6 A;  2NRR A;  2DTU A;  4GW6 A;  4E1J A;  4JKA A;  4Q5V A;  5AQP A;  4BDP A;  4JI3 K;  2IVO A;  1S6Q A;  4JLH A;  5E26 A;  2E2N A;  3HI0 A;  3DJC A;  4C8M A;  2IS3 A;  5AQK A;  4CJR A;  1JLB A;  4JKC A;  3WXM B;  4B9U A;  1B9F A;  1HNW K;  3ZX0 A;  3RRH A;  1HMV A;  5AQQ A;  1YJN N;  1RBT A;  1HX1 A;  3NF8 A;  3G25 A;  3ID8 A;  4FM1 A;  3LDQ A;  4CJE A;  3EL2 A;  5D3G A;  5AQW A;  3WQT A;  2IAJ A;  2PZS A;  4DMN A;  3CMA N;  1RDC A;  4FXD A;  4LH4 A;  4OKJ A;  4ILG B;  4IOA L;  3P1G A;  1CLQ A;  3D2F A;  5EY4 A;  4BQL A;  4JK8 A;  5JIC A;  1HJO A;  2F7T A;  3GE1 A;  3LDP A;  5AJ3 K;  4J2B A;  4DV1 K;  1VSI A;  2G8W A;  3ENH A;  4JKE A;  3MDQ A;  3O9Q A;  3A5N C;  4I2Q A;  4JS5 A;  1NK6 A;  1RBS A;  1EWQ A;  4CJ4 A;  4ISE A;  5BRF A;  3VMF B;  4E7L A;  2UUC K;  3BY5 A;  4Y1D A;  5AQJ A;  1QTM A;  1C0F A;  1WBB A;  3OYG A;  3TTF A;  5M1N A;  3FZK A;  3KTQ A;  4NYF A;  2CGJ A;  5JS1 A;  2QM1 A;  4BDY A;  4CJS A;  4F8R A;  4DR7 K;  5HP1 A;  4O8K A;  3QB0 A;  2FSN A;  2HNY A;  5M1Q A;  4WFN L;  4EP5 A;  1V4S A;  3VQ8 A;  3MCA B;  5GAG P;  1LAV A;  2RE2 A;  3CCU N;  4CJV A;  4XH1 A;  3VPZ A;  3K9K A;  1UWB A;  5SZT A;  1IBK K;  4KI6 A;  2YNG A;  3OYM A;  1DGK N;  1JLQ A;  2P9L B;  2HB5 A;  3CJ1 A;  4ELV A;  3MN9 A;  1HNX K;  2GEL A;  1ATR A;  2F8S A;  3NGY A;  1VSM A;  3U4L A;  5CYQ A;  2OPQ A;  3G71 N;  3DRR A;  2D0A A;  1D9F A;  4KHW A;  1XNQ K;  1X9W A;  2NRH A;  1MWM A;  1VQ8 N;  4AM6 A;  4CGG A;  4WFA L;  1HUX A;  2FBT A;  3JS6 A;  3VEY A;  2HHW A;  4JI7 K;  4GNI A;  4AQY K;  3OS2 A;  2GTD A;  1B9D A;  1S9E A;  1VQ5 N;  4IG0 A;  2JLE A;  2G8U A;  3VTI A;  4CEE A;  4Z94 A;  4FK2 A;  4DF4 A;  1VSH A;  3QIP A;  4BRL A;  2HBL A;  3TAN A;  3PY8 A;  2OPS A;  4AM7 A;  1WLJ A;  1GLC G;  2W42 A;  4CK2 A;  3JAM O;  4LSN A;  3S3M A;  3EO3 A;  3PX4 A;  3O4N A;  4JS4 A;  3BF3 A;  4OPH A;  5J2P A;  4CJL A;  2GBZ A;  1T6D A;  4CZJ A;  1XMQ K;  1K8K A;  3KKR A;  4M3Y A;  4YOT A;  3KD5 E;  1D4X A;  1RT2 A;  4DV6 K;  2DFE A;  3DOL A;  1TGO A;  4FW2 A;  3UKR A;  2VQF K;  3P4I A;  4CHP A;  3V81 A;  4K25 A;  4C23 A;  4BWM A;  3BGR A;  3VA0 A;  3PIO L;  3ZT1 A;  2GEM A;  3TAG A;  3SPZ A;  4FJL A;  1JLA A;  3OHR A;  4PA1 A;  2E6L A;  3VEW A;  3VF6 A;  3CJA A;  1WSI A;  2HW3 A;  3LWM A;  4BR9 A;  3EZ5 A;  4BG9 A;  1QS4 A;  5KPT A;  2NRW A;  4OPJ A;  4DTN A;  4WCE L;  3TU5 A;  4DTR A;  2Y1J A;  3PUF A;  2CGK A;  1JCF A;  4CZI A;  4R79 A;  2NZT A;  4IDH A;  1REV A;  3OYH A;  2YKM A;  1OVQ A;  3RRG A;  3L2W A;  4IO9 L;  2HNZ A;  1NK9 A;  1T7P A;  2DPN A;  3V9W A;  4CZK A;  4DV3 K;  4H4M A;  2WON A;  1WUA A;  3WXL A;  4AHS A;  2VCP A;  2BTF A;  4CEQ A;  4BDZ A;  5HRO A;  4MO5 A;  5F1X A;  4Z4H A;  3I8D A;  2QTD A;  3TWH A;  1Q81 O;  3TAF A;  1ZBU A;  2F4V K;  2QKK A;  3WT0 A;  2GWJ A;  4KHP K;  3VA3 A;  4CED A;  4DTM A;  4CJU A;  3IFR A;  3JXU A;  4F3O A;  4B08 A;  3E1Y A;  2Q0R A;  4I2P A;  1KTQ A;  1NG9 A;  1U04 A;  1GLL O;  1Z26 A;  4B1Y B;  4BVO A;  4EFH A;  4AF1 A;  5CZ1 A;  1E4G T;  3N4P A;  2A40 A;  2HOE A;  1HNZ K;  4BE2 A;  4CK3 A;  4QS7 A;  4RWT A;  2NNW A;  1VSJ A;  1VQ7 N;  2QEX N;  1TKT A;  3CJB A;  3DOK A;  4OO1 J;  4N56 A;  5ADX A;  4FPB A;  1W0H A;  4M7X A;  1NJZ A;  4HVJ A;  2QKB A;  3EN9 A;  2WFB A;  1YVN A;  3LP1 A;  4B9T A;  3IG1 A;  2YV0 X;  3K5M A;  3CC7 N;  1K73 O;  3OYN A;  3O8M A;  5HRN A;  1K8K B;  4Y1C A;  1CZA N;  5C15 A;  2D0B A;  2GWK A;  5AQN A;  1VQ9 N;  4CGF A;  1YI2 N;  5AZJ B;  3CFP A;  3UKR B;  4O44 A;  4BRD A;  3ZSX A;  1VQL N;  3VEX A;  3FFI A;  4A62 A;  1A5V A;  1D9D A;  1IKW A;  3V6D A;  3S9H A;  3V9Z A;  1QVG M;  3VER A;  4OPK A;  1RT6 A;  4MDB A;  3AO2 A;  1T44 A;  1BI4 B;  3EY1 A;  3NDK A;  4DS4 A;  3MN6 A;  1NKC A;  4GV9 A;  4B9L A;  3CYM A;  3ZT3 A;  4GKJ K;  2ZF5 O;  2GUP A;  4UQG A;  4BRQ A;  1XHZ A;  1BCM A;  2P9P A;  4RW7 A;  1RT1 A;  4GMJ B;  4DHY A;  5KRS A;  3OTO K;  2VG5 A;  3PX0 A;  3AAQ A;  4M63 C;  4IEE A;  4DSF A;  3R1X A;  1WSJ A;  4CJ5 A;  3B6O A;  1FKO A;  3C6H A;  4FM2 A;  3ZSR A;  3ALY A;  4KHS A;  4RCH A;  3AO1 A;  3VEV A;  3KWI A;  3TTC A;  4BC5 A;  3Q7C A;  1IKY A;  3D7E O;  4JI4 K;  3EKS A;  5E84 A;  2I7P A;  4H5V A;  4BGA A;  3S41 A;  5JS2 A;  4KB0 A;  1BO5 O;  2DFH A;  1LAW A;  2W6K A;  4FYD A;  2O8D B;  2QK9 A;  1L3T A;  4JKG B;  1U47 A;  3L2R A;  3MK6 A;  2HHS A;  4CJK A;  1HPZ A;  4KAZ A;  4UY8 O;  1VRU A;  4CF2 A;  2YJE A;  2ETJ A;  1C0U A;  1T03 A;  4KKO A;  2Q36 A;  4EZ6 A;  4DV2 K;  3C94 A;  4DFK A;  4EHU A;  3MX2 A;  3KVG A;  3AGR A;  2B4J A;  2A3Z A;  3WQU A;  1IJJ A;  1C0G A;  3OYB A;  3T1Y K;  3SAH A;  3SV3 A;  2VG6 A;  3U9D A;  2W40 A;  5BR9 A;  1NOZ A;  1ZYQ A;  3CC2 N;  1VQK N;  1YAG A;  2D0C A;  3TAQ A;  2HBM A;  4WQ4 A;  4C1N I;  5JVG L;  1U2V B;  1RT3 A;  4BRF A;  1QHT A;  1S1W A;  3MED A;  3ZT4 A;  3E9P A;  1Y64 A;  5C10 A;  3FZH A;  1SQK A;  3K57 A;  2P9U B;  3MXJ A;  1HQE A;  4DR3 K;  3VGL A;  3QEI A;  5KPR A;  4PUO A;  1RTD A;  3QIO A;  1XHX A;  4J8F A;  3A8Y A;  1C1C A;  3QLH A;  3WNH A;  2HMP A;  3SV4 A;  3CJ9 A;  4DTJ A;  3WXI A;  3D6R A;  4FSV A;  4RG8 A;  1NGE A;  2I5J A;  4EIA A;  1RNH A;  3CCQ N;  4LC9 B;  4G1Q A;  1EP4 A;  3CC4 N;  4I9Q A;  1BA1 A;  3VF2 A;  2OCE A;  1Q9Y A;  1YIJ N;  4OJR A;  3TSQ A;  5DM6 L;  1TL3 A;  1SKS A;  5IT9 O;  1BHL A;  3HOT A;  3GOI A;  3QFP A;  3QIC A;  2YHA A;  1KFS A;  4E89 A;  5I3U A;  2E8A A;  1K8A O;  4I7F A;  4JNE A;  2XRI A;  4FWQ A;  3HPH A;  3R9P A;  3M8S A;  4YDU A;  5GAD P;  1GLE G;  4EP4 A;  5AQZ A;  1BI4 A;  4YOV A;  1KLN A;  1LCU A;  4ICL A;  1BDG A;  2ZQB A;  3DLH A;  1KCF A;  4FL9 A;  4PKH A;  1YT3 A;  1KAY A;  3DXK A;  4XEI A;  4FJ9 A;  5DM7 L;  1BQM A;  4Z4F A;  3CCM N;  3U3Y A;  4DF8 A;  3SAG A;  1RDW X;  3OYJ A;  4FZX C;  4KI4 A;  4H5T A;  3E66 A;  3THW A;  3QIN A;  3O3F A;  2FLO A;  1JLE A;  3AY9 A;  4AHU A;  3ZSY A;  1HJR A;  1RCH A;  4NLC A;  3WXJ A;  4PL8 A;  1ZBI A;  1EET A;  3CFO A;  3KJV A;  3U8X A;  2PFU A;  4BR5 A;  1Z6R A;  4FJH A;  3A2F A;  4CES A;  4M3U A;  4LF5 K;  1HYV A;  4IJN A;  1MDU B;  1SL1 A;  1HKC A;  2UYT A;  4FLW A;  3KIO A;  4WYB A;  1D5A A;  4DQQ A;  3K58 A;  2VWB A;  1XQS C;  1WAF A;  3OS0 A;  3ZEU A;  3BZC A;  4Z4I A;  3MEE A;  2Z1G A;  4HWI A;  4B8C A;  3HT3 A;  3WEE B;  2HHH K;  5HL7 L;  4PHT X;  1UOC A;  2I7N A;  4JV5 K;  4OX9 K;  2B6A A;  5EX5 A;  3CPE A;  1RT7 A;  2HHT A;  1NM1 A;  5KGW A;  1X3N A;  3ISN C;  4CEO A;  4CD3 A;  2YX6 A;  3LDO A;  4HCC A;  2QWN A;  1M90 O;  3OYC A;  4LFA K;  1VSE A;  3AO3 A;  4KBO A;  3HL8 A;  4B8A B;  2P9U A;  4IXC A;  4CJP A;  4DU1 A;  1MA9 B;  3O9U A;  3EE8 A;  4NO7 A;  5C0Y A;  3KLE A;  3WUH A;  2HF4 A;  1S1X A;  3ATU A;  3VQ6 A;  1FJG K;  3FE1 A;  2F8T A;  1TUU A;  1HLU A;  3V9U A;  4GV6 A;  3C6T A;  2XY5 A;  3CI5 A;  4JD2 B;  3TTD A;  3QEX A;  4E7H A;  5DK5 A;  4DSL A;  2FBY A;  1X9S A;  1QHA A;  2PBD A;  3DI6 A;  4BRG A;  3T3F A;  1JCE A;  4BC3 A;  4CBX A;  3SQ1 A;  4KTQ A;  1HRH A;  3EE9 A;  4K8Z A;  1NJY A;  3T1H K;  4ID1 A;  3KK1 A;  3FLC O;  1RTI A;  3ZYY X;  5LJW A;  2WTU A;  2Y1I A;  4IOX A;  3P38 A;  3HPO A;  3THX A;  1VK0 A;  4XH5 A;  3EEQ A;  2P5O A;  1G15 A;  4B3R K;  4CZL A;  4FK0 A;  1NJI O;  3MCP A;  3LZJ A;  4OLA A;  1S1U A;  3M8R A;  1RTH A;  3DWL A;  2XY7 A;  2JWK A;  1TUY A;  4DCH A;  4CEF A;  3AGK A;  4RW4 A;  4XIU A;  4CBU A;  4I6M A;  1YIT N;  1NU0 A;  3C7N B;  3I56 N;  1IBL K;  4CHQ A;  1SL0 A;  5AQV A;  1X1P A;  3OYL A;  4DSK A;  5GIO A;  2QWQ A;  1IG8 A;  2V7Z A;  4X64 K;  5IWA K;  3NGI A;  1YJ9 N;  4JI6 K;  3RTV A;  2YHB A;  5HLF A;  2A42 A;  2IDO A;  2P9I B;  3L6Q A;  3OJU A;  4B9N A;  1G99 A;  2IIR A;  2NRZ A;  3L2V A;  3IS9 A;  1KQS M;  3CXC M;  3H6E A;  3ZLJ A;  1RDA A;  1DTT A;  3O1W A;  3SPY A;  1HNV A;  5H1S Q;  3K0S A;  4FJJ A;  3O80 A;  3QDK A;  2VGM A;  3L8B A;  3MEG A;  4JK7 A;  3ZEU B;  1XWL A;  2EWS A;  4O0I A;  4E3S A;  2WUS A;  3PLA A;  3NCI A;  2ZWH A;  1FW6 A;  3VQE A;  3QFU A;  4CGI A;  4ILJ A;  1KXP A;  3ZX2 A;  5ELZ A;  4FWM A;  4M3X A;  1TK0 A;  3SUN A;  2O8E A;  3ID6 A;  4DR2 K;  4JKF A;  1NBW A;  1CZB A;  4E0D A;  1NGD A;  4F2S A;  3R3L A;  1R0A A;  5KI6 A;  3NF7 A;  4FJ5 A;  4Y0W A;  1S3X A;  2KHO A;  2P9L A;  4QS8 A;  3HVR A;  3UKU B;  4KV8 A;  2LSN A;  3K9J A;  4H0O A;  1OH5 A;  1JLG A;  1C1A A;  4AHR A;  4CEA A;  1S6P A;  1IV0 A;  4N5S A;  4F2R A;  4O5F A;  3ZCM A;  5DMR A;  4JD2 A;  1QSY A;  4KB1 A;  4CJQ A;  3O08 A;  4GVM A;  3TSP A;  4KO0 A;  4M3W A;  4DLE A;  1NK7 A;  1S1V A;  1CXQ A;  4EZ9 A;  2XY8 A;  3O6W A;  1N33 K;  3SQ4 A;  4JKB A;  1ZBF A;  4ID5 A;  3TPQ A;  4BR4 A;  2ASP A;  2A6A A;  4FJI A;  1RBU A;  1EQY A;  2X6S A;  4BRP A;  4IO8 A;  4CER A;  3LM2 A;  3ULD A;  3AVH A;  2YHW A;  1ZC6 A;  4FLZ A;  4BC4 A;  4NB4 A;  2PAV A;  4CFB A;  3QBW A;  1F21 A;  3LL3 A;  5FRM A;  3LAN A;  1OH7 A;  2HST A;  3OJS A;  1QZ6 A;  3AVA A;  4I6M B;  2IVN A;  3CCV N;  5KRT A;  3EKU A;  3SCX A;  1RDU A;  2HF3 A;  4FJ7 A;  5M1O A;  3KK7 A;  3RSE A;  3C7N A;  1VQP N;  5KQ8 A;  1ILY A;  2E6M A;  3I0S A;  4X65 K;  3QES A;  4KHY A;  1D8Y A;  1SAZ A;  2E1Y A;  4X62 K;  4CIF A;  3MXI A;  1BIZ A;  1GOA A;  4OKE A;  4YOU A;  5AR0 A;  2E88 A;  2HBK A;  2FF3 B;  2PYJ A;  2E2Q A;  3ASM A;  3I33 A;  2OTJ N;  1HYZ A;  3RVC A;  2KFZ A;  4FJK A;  1JLF A;  3VQD A;  1L3S A;  3ENB A;  3FR0 A;  1I3A A;  3ZSZ A;  1N8R O;  3RR8 A;  4O0J A;  2YKN A;  1YTU A;  5KQD A;  4CIG A;  2O8D A;  3A0I X;  1IG9 A;  1H1V A;  1TYQ A;  4O55 A;  4CZE A;  4F4K A;  3T19 A;  2KFN A;  4AHC A;  3MN5 A;  1SZ2 A;  1BGX T;  1KRP A;  5FRN A;  4F3T A;  3F5T A;  3C0B A;  4FO0 A;  2UUB K;  5TKW A;  4ZTF A;  4B3O A;  3J8A A;  3M5R A;  2OA8 A;  3NH1 A;  3KLF A;  4K42 A;  2G8H A;  3I8B A;  5F0X A;  3TI0 A;  1ASU A;  1ESV A; 
#chains in the Genus database with same CATH homology
 1ASW A;  4E1M A;  1TKZ A;  3HK2 A;  2Q3S A;  3KD1 E;  3DLE A;  3NF9 A;  3HXM A;  1U47 A;  3ITH A;  1TL1 A;  1NJX A;  1FKP A;  3L2R A;  2HHS A;  4W5N A;  3LAM A;  2HHQ A;  4CJK A;  1HPZ A;  1U49 A;  4KAZ A;  1KLM A;  1JL1 A;  2E4L A;  1VRU A;  2EHG A;  4CF2 A;  4CF9 A;  2ETJ A;  1C0U A;  4AHV A;  4KKO A;  4CE9 A;  4CHY A;  3KK2 A;  4FLT A;  1T03 A;  4CGJ A;  3D0P A;  3G0Z A;  3AVC A;  3C94 A;  3AA2 A;  5HRS A;  3S3N A;  4FK4 A;  4DFK A;  2XY6 A;  2BGG A;  3SYZ A;  3U6F A;  4FVM A;  4FCY A;  2B4J A;  3AV9 A;  4DQR A;  3OYB A;  3SV3 A;  2VG6 A;  1NKE A;  4KRF A;  2YNF A;  1NOZ A;  1ZYQ A;  4H4O A;  3QO9 A;  3MAQ A;  4Z4E A;  1NK8 A;  4PY5 A;  2D0C A;  3RMD A;  3TAQ A;  3HST B;  4BE0 A;  1HQU A;  4B9V A;  4OGC A;  4CEB A;  1RT3 A;  3K5O A;  4C8N A;  2XHB A;  1QHT A;  3QEW A;  3SQ0 A;  2FBX A;  1S1W A;  1EX4 A;  3AVM A;  3MED A;  2OZS A;  3DLG A;  1RIL A;  3ZT4 A;  1KSP A;  1IKX A;  1C0M A;  4K8X A;  4BE1 A;  3O3G A;  3K57 A;  3SI6 A;  3SNN A;  4C8O A;  4FJ8 A;  3AA4 A;  3MXJ A;  1HQE A;  2RN2 A;  1T8E A;  3QEI A;  3VQB A;  1Z25 A;  4M3R A;  1J5O A;  1RTD A;  3QIO A;  1XHX A;  3KLH A;  3AO5 A;  1QE1 A;  4FLV A;  4CF1 A;  1SKW A;  4M42 A;  3THV A;  3OYF A;  4N41 A;  3DLK A;  1C1C A;  4AIL C;  1SUQ A;  3QLH A;  3WNH A;  3SV4 A;  4LY7 A;  5EU7 A;  4CFD A;  4DTJ A;  3IRX A;  3O4Q A;  4N76 A;  4RG8 A;  4DU4 A;  2I5J A;  2R7Y A;  1KFD A;  2DFF A;  1RNH A;  2IGI A;  4AH9 A;  4W5T A;  3K5N A;  5SWM A;  4DTS A;  4E7K A;  4NCG A;  5HBM A;  4G1Q A;  1EP4 A;  3NAE A;  1C0T A;  1N6Q A;  2OZM A;  4DSJ A;  2G8V A;  4I9Q A;  1Q9Y A;  1YVU A;  4OJR A;  3OVN A;  3CFR A;  1TL3 A;  1VRT A;  2VWK A;  3K2P A;  1SKS A;  3VQ7 A;  3NE6 A;  1BHL A;  2DTU A;  3L3V A;  3OYI A;  4GW6 A;  1KFS A;  2YHA A;  4BAC A;  3V9X A;  4E89 A;  5I3U A;  4Q5V A;  3F73 A;  3HP6 A;  4I7F A;  4OLB A;  1DTQ A;  2XRI A;  5E41 A;  3KLG A;  4BDP A;  1S6Q A;  3F9K A;  1TK5 A;  2F96 A;  4JLH A;  4CHN A;  3HPH A;  4HUE A;  3M8S A;  1XI1 A;  4C8L A;  4EP4 A;  1BI4 A;  2HHV A;  2PYL A;  1KLN A;  4ICL A;  2ZQB A;  1B92 A;  3DLH A;  1KCF A;  2HND A;  4OKK A;  4C8M A;  2IS3 A;  1N5Y A;  1RDD A;  1YT3 A;  1BQN A;  3VQ4 A;  4CJR A;  1JL2 A;  1JLB A;  2JGU A;  3U3G A;  1RDB A;  4DTU A;  3RR7 A;  2X74 A;  1B9F A;  4B9U A;  3LDS A;  2Z1H A;  4FJ9 A;  4QAG A;  1RT4 A;  3SJJ A;  1ASV A;  1BQM A;  4E19 A;  3RRH A;  4Z4F A;  1HMV A;  3U3Y A;  1T05 A;  1RBT A;  4DF8 A;  4QCL A;  3L2Q A;  3OYJ A;  3JSM A;  3NF8 A;  1I39 A;  4FZX C;  4FM1 A;  4KI4 A;  3QEP A;  3EYZ A;  4M41 A;  4CJE A;  4KFB A;  2ZE2 A;  4R5P A;  5D3G A;  1EKE A;  3PO5 A;  4PQU A;  3QIN A;  3AVF A;  2IAJ A;  3VQ9 A;  4DMN A;  2PZS A;  3O3F A;  2VG7 A;  1RDC A;  4FXD A;  4LH4 A;  1JLE A;  3SUQ A;  4AHU A;  4IBN A;  1UAX A;  4DTX A;  3ZSY A;  1HJR A;  1RCH A;  4OKJ A;  2KZZ A;  1KVC A;  1EET A;  1ZBI A;  3CQ8 A;  2A1S A;  3CFO A;  3KJV A;  3P1G A;  2HHX A;  1U45 A;  4FM0 A;  1CLQ A;  4FJH A;  3A2F A;  4CES A;  3OYD A;  4M3U A;  3OS1 A;  2NUB A;  1HYV A;  1SL1 A;  4CK1 A;  3KKS A;  1BCO A;  3HVT A;  1VSI A;  4FLW A;  1BIS A;  4LH5 A;  3ZT0 A;  3QEV A;  2G8W A;  4J2B A;  3KIO A;  5T7B A;  2DY4 A;  3AVI A;  1D5A A;  5C25 A;  3K58 A;  4DQQ A;  3D45 A;  1CXU A;  1VSD A;  1WAF A;  4I2Q A;  4WE1 A;  4OGE A;  4JS5 A;  3V1O A;  1NK6 A;  1RBS A;  3WNE A;  1NK0 A;  1NOY A;  4CJ4 A;  1JLC A;  3OS0 A;  4N47 A;  4Q0B A;  4NCA A;  2O4G A;  1VSK A;  3CM5 A;  4HUG A;  4TSX A;  4E7L A;  4Z4I A;  4CHZ A;  3MEE A;  2Z1G A;  4B8C A;  4Y1D A;  3HT3 A;  3SZ2 A;  1QTM A;  3DM2 A;  3JYT A;  3NH0 A;  3OYG A;  1RBR A;  1UOC A;  1IKV A;  2KQ2 A;  2QXF A;  3K59 A;  2BAN A;  4J2E A;  3PV8 A;  2B6A A;  4KTZ A;  4Z4C A;  1QSS A;  4DSE A;  4DS5 A;  1RT7 A;  2HHT A;  3MXM A;  3KTQ A;  1ZBH A;  4NYF A;  5KGW A;  3ISN C;  5JS1 A;  4CEO A;  1A5W A;  3AVK A;  1BL3 A;  2Z1J A;  5CYM A;  4JRP A;  4BDY A;  4CJS A;  5J2M A;  4F8R A;  4HCC A;  5HP1 A;  3OYC A;  1O1W A;  1VSE A;  3AO3 A;  3HL8 A;  1RBV A;  4CJ3 A;  2HNY A;  4B8A B;  1QSL A;  4O5B A;  4EP5 A;  1FXX A;  4CJP A;  3VQ8 A;  4DU1 A;  3LPU A;  1LAV A;  2D5R A;  3VQ6 A;  3KLE A;  1S1X A;  1QQC A;  3LPT A;  4CJV A;  3AVJ A;  2F8T A;  1UWB A;  5SZT A;  3SUP A;  3LAK A;  3RMA A;  4KI6 A;  1Q8I A;  4I9L A;  3PX6 A;  3V9U A;  4DU3 A;  3C6T A;  2YNG A;  2XY5 A;  3OYM A;  3KLI A;  3NFA A;  3QEX A;  4E7H A;  1JLQ A;  5DK5 A;  2HB5 A;  2WOM A;  3TAE A;  4DSL A;  4KRE A;  4ELV A;  2FBY A;  3AVB A;  4B9S A;  1X9S A;  4M45 A;  4H8K A;  2YNH A;  2F8S A;  3NGY A;  1VSM A;  3DI6 A;  3NBP A;  4Z4G A;  3T3F A;  3DRS A;  1HYS A;  3SQ1 A;  2FC0 A;  2OPQ A;  5CYQ A;  3T1A A;  2VWJ A;  4KTQ A;  1LW0 A;  3DRR A;  1HRH A;  2D0A A;  1XC9 A;  1D9F A;  4KHU A;  3ZSO A;  4KHW A;  4JRQ A;  1X9W A;  4CF0 A;  1L3V A;  4K8Z A;  4FJM A;  1IO2 A;  5FDL A;  3CG7 A;  4RW6 A;  4CJF A;  1NJY A;  3OYA A;  3M8Q A;  4ID1 A;  3KK1 A;  1RTI A;  4CGG A;  2Y1I A;  2FBT A;  2HHW A;  3HPO A;  4B9M A;  1VK0 A;  1WNS A;  2P5O A;  1G15 A;  4FK0 A;  3BDP A;  3OS2 A;  4C8K A;  3E01 A;  3AA5 X;  3AVL A;  1W9H A;  1B9D A;  1GOC A;  3QNO A;  1S9E A;  4KHN A;  4IG0 A;  1RT5 A;  4CEZ A;  5KGX A;  3SUO A;  1MU2 A;  2FBV A;  4NYN A;  3LZJ A;  4FJG A;  2IOC A;  4OLA A;  1S1U A;  1S5J A;  1RTH A;  2JLE A;  3M8R A;  2XY7 A;  5HRR A;  4CEE A;  2G8U A;  4CEF A;  4RW4 A;  4XIU A;  4FK2 A;  1J9A A;  4DF4 A;  5FRO A;  4W5Q A;  1VSH A;  3QIP A;  3VQQ A;  3VN5 A;  3HJF A;  3TAN A;  1U4B A;  3PY8 A;  4MFB A;  2OPS A;  1WLJ A;  3DYA A;  2HVH A;  3AVG A;  4CK2 A;  4CHQ A;  2W42 A;  1SL0 A;  2EX3 A;  4LSN A;  2ATQ A;  3S3M A;  2G8F A;  3LZI A;  3PX4 A;  1J53 A;  1X1P A;  3O4N A;  3OYL A;  1RTJ A;  4JS4 A;  1TK8 A;  2P5G A;  1TV6 A;  5J2P A;  4DSK A;  4CJL A;  2GBZ A;  4CCH A;  3V1R A;  4OVL A;  3NGI A;  4YFU A;  3KKR A;  1C6V A;  4M3Y A;  3UIQ A;  3KD5 E;  3RTV A;  2P51 A;  1RT2 A;  2YHB A;  2A1R A;  5HLF A;  1JKH A;  3O3H A;  3NF6 A;  3L3U A;  2DFE A;  4E7I A;  2IDO A;  2Z1I A;  3DOL A;  1NK5 A;  3VQA A;  1TGO A;  4FW2 A;  3OYE A;  3OJU A;  4B9N A;  3L2V A;  2RPI A;  3IS9 A;  4CHP A;  3V81 A;  1LWC A;  1RDA A;  4Z0U A;  3WNG A;  2AJQ A;  2P1J A;  1DTT A;  1CZ9 A;  2RKI A;  3BGR A;  4RW8 A;  4BWM A;  3PO4 A;  3IAY A;  3HYF A;  3VA0 A;  3OY9 A;  2HMI A;  3ZT1 A;  3TAG A;  3SPY A;  3NHG A;  3TAB A;  3SPZ A;  3LP0 A;  1ITG A;  1HNV A;  5J2N A;  1UA1 A;  4FJJ A;  4FJL A;  3TAP A;  1JLA A;  2X78 A;  4W5R A;  3L8B A;  3MEG A;  4PA1 A;  1J54 A;  2E6L A;  3DRP A;  1XWL A;  1JXE A;  5J2Q A;  4FZZ A;  1WSI A;  4O0I A;  4E3S A;  2HW3 A;  3LWM A;  1JXB A;  4AHT A;  3NCI A;  1WN7 A;  3EZ5 A;  4M3T A;  3VQE A;  3LP3 A;  4CGI A;  4BWJ A;  3ZSQ A;  4DWI A;  1QS4 A;  2ZD1 A;  4M3X A;  4HCB A;  4OPJ A;  1TK0 A;  4DTN A;  3SUN A;  5C24 A;  3ZSV A;  3V9S A;  4DTR A;  2Y1J A;  1VSL A;  1L5U A;  3OYK A;  1Q9X A;  1CZB A;  3PUF A;  4E0D A;  4ZTJ A;  1U48 A;  4F2S A;  2GV9 A;  4LSL A;  2KZM A;  1R0A A;  1REV A;  5KI6 A;  3M8P A;  3OYH A;  3NF7 A;  2HVI A;  4FJ5 A;  4FLY A;  2YKM A;  2O4I A;  1TKD A;  1HNI A;  3RRG A;  3L2W A;  3HVR A;  4KV8 A;  2IC3 A;  2LSN A;  4HUF A;  2HNZ A;  1NK9 A;  1JLG A;  1T7P A;  1C1A A;  4AHR A;  4CEA A;  1S6P A;  3V9W A;  1K6Y A;  4KPY A;  1LWE A;  3L2U A;  3ZT2 A;  4H4M A;  3V1Q A;  4N5S A;  1SL2 A;  1TKX A;  2WON A;  3AA3 A;  4J2A A;  4F2R A;  4AHS A;  3ZCM A;  2BDP A;  5DMR A;  1TAQ A;  1QSY A;  4KB1 A;  4CEQ A;  4CJQ A;  4BDZ A;  5HRO A;  3KK3 A;  3I8D A;  4Z4H A;  2KW4 A;  3P5J A;  4CJW A;  1UA0 A;  4CJT A;  3TWH A;  4GVM A;  2PY5 A;  4YNQ A;  4KO0 A;  4M3W A;  4DLE A;  4DLG A;  3TAF A;  1ZBU A;  1NK7 A;  1S1V A;  4FJN A;  1CXQ A;  2QKK A;  1WSH A;  4O4G A;  4DG1 A;  4EZ9 A;  3HO1 A;  1EXQ A;  2XY8 A;  4HHT A;  3SQ4 A;  1LW2 A;  4IDK A;  3VA3 A;  4CED A;  1ZBF A;  4ID5 A;  4DTM A;  3CM6 A;  4CJU A;  4DFJ A;  3RMB A;  4M3Z A;  4ELU A;  4B08 A;  4F3O A;  4FJI A;  3QET A;  1NJW A;  3HPG A;  1RBU A;  1BIU A;  1VSF A;  1KTQ A;  4I2P A;  4RW9 A;  2GUI A;  2X6S A;  4E7J A;  3S3O A;  4CIE A;  3QNN A;  4CER A;  1U04 A;  3K5L A;  3ZSW A;  3ULD A;  1Z26 A;  4CFA A;  3AVH A;  1DLO A;  4DFP A;  1LWF A;  4FLZ A;  5CZ1 A;  1WAJ A;  4CFB A;  3RWU A;  4L8R B;  1F21 A;  2B5J A;  4BE2 A;  2G8K A;  4CK3 A;  5J1E A;  5FRM A;  3TR8 A;  3LAN A;  3DLR A;  2XO7 A;  4CGH A;  1VSJ A;  3OJS A;  4DQI A;  4DTP A;  1TKT A;  3AVA A;  1YTA A;  2KFZ A;  3DOK A;  5C42 A;  4N56 A;  2G8I A;  5KRT A;  3SCX A;  4FJ7 A;  1C1B A;  3B6P A;  3NH2 A;  1W0H A;  4EZ6 A;  1NJZ A;  4HVJ A;  4E1N A;  2QKB A;  4DSI A;  4QOZ B;  4IFV A;  2E6M A;  3LP1 A;  4B9T A;  4FLX A;  3IG1 A;  2YV0 X;  3VQP A;  3I0S A;  3K5M A;  3QES A;  3WNF A;  5HRP A;  3OYN A;  3TAR A;  4PWD A;  3HM9 A;  3VQC A;  5HRN A;  4KHY A;  4Y1C A;  4DFM A;  2D0B A;  1D8Y A;  3C95 A;  3TAM A;  4CGF A;  4CIF A;  3MXI A;  1BIZ A;  1GOA A;  2ITG A;  4OKE A;  1SKR A;  5K14 A;  3CFP A;  2KTQ A;  3LWL A;  4FLU A;  3DMJ A;  4O44 A;  3ZSX A;  5KTQ A;  1NK4 A;  3FFI A;  3QER A;  1A5V A;  4ELT A;  3LP2 A;  2X6N A;  3HP9 A;  3VQ5 A;  1D9D A;  1IKW A;  1GOB A;  5CZ2 A;  2PYJ A;  2YNI A;  1NKB A;  4CEC A;  4ZHR A;  4DQS A;  3V6D A;  4NCB A;  3ASM A;  4IG3 A;  1S9G A;  3S9H A;  3V9Z A;  3RMC A;  1HYZ A;  4OPK A;  2OPP A;  1WSF A;  1ZBL A;  3AO4 A;  1RT6 A;  3AO2 A;  4DQP A;  1JLF A;  4FJK A;  1KVA A;  3VQD A;  2OPR A;  1BI4 B;  1TAU A;  3EY1 A;  1L3S A;  3NDK A;  4DS4 A;  2BE2 A;  1NKC A;  4FZY A;  3V4I A;  3CYM A;  3MEC A;  3ZT3 A;  4B9L A;  1I3A A;  4CGD A;  3ZSZ A;  4UQG A;  4KHQ A;  2OYQ A;  1XHZ A;  1BCM A;  4RW7 A;  4KTW A;  3RR8 A;  3H08 A;  3C6U A;  1RT1 A;  4GMJ B;  4O0J A;  5KRS A;  3P83 D;  1Y97 A;  2YKN A;  1YTU A;  1WSG A;  2VG5 A;  4DTO A;  3PX0 A;  1A5X A;  4LD0 A;  4CIG A;  4DSF A;  1KVB A;  1SV5 A;  1WSJ A;  4CJ5 A;  3G10 A;  3B6O A;  1TVR A;  1FKO A;  1X9M A;  1IG9 A;  4O55 A;  4FM2 A;  4F4K A;  3ZSR A;  3T19 A;  3NGZ A;  4IKF A;  1S1T A;  2KFN A;  4MQ3 A;  1IH7 A;  3ALY A;  4AHC A;  3I0R A;  5I42 A;  4KHS A;  3AO1 A;  1FK9 A;  1BGX T;  1KRP A;  5FRN A;  4CHO A;  4FJX A;  1WSE A;  4F3T A;  4HTU A;  4IFY A;  2HHU A;  4CF8 A;  1L3U A;  4FW1 A;  1IKY A;  4ZTF A;  4B3O A;  3SQ2 A;  4W5O A;  1LV5 A;  4CFC A;  2OA8 A;  2RF2 A;  3NH1 A;  5CY4 A;  3KLF A;  5JS2 A;  3DLB A;  4J2D A;  3LAL A;  2G8H A;  4KB0 A;  2DFH A;  1LAW A;  4PUO A;  3AVN A;  3TI0 A;  4FYD A;  2QK9 A;  1L3T A;  1ASU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...