4KAZA

Crystal structure of rnase t in complex with a y structured dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 61
structure length 206
sequence length 206
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kazA00
3RMBA 3NAEA 3O4NA 3L3VA 4G1QA 4I7FA 3TAEA 4FK0A 4CE9A 2FBXA 1WSFA 4GW6A 4Y1DA 1SL2A 4DWIA 3ITHA 2JLEA 3HJFA 1ZYQA 4F4KA 3DRPA 1D9FA 4B9TA 1SUQA 4CGDA 2KZMA 4DSFA 3L2VA 2OPPA 5K14A 1D5AA 4EZ6A 2HVHA 3C95A 4FLYA 2ZE2A 4LH5A 2OA8A 4FJJA 2IDOA 4CJWA 4EP4A 2F8TA 3OS2A 5D3GA 2YNGA 4K8ZA 4DTJA 1VRTA 3KK1A 3L2QA 1JXEA 3B6OA 3VQDA 2D0CA 3CFOA 4KKOA 4H4OA 3PY8A 3A2FA 1TK5A 4UQGA 1VSDA 1KFDA 1DTTA 3C94A 5CY4A 3I0SA 2P5GA 5SWMA 4OPKA 1KFSA 1LWEA 2X78A 2IC3A 1L3VA 3OYMA 4Z0UA 2HVIA 2HHUA 4CHOA 1RTDA 1X9MA 4F3OA 1F21A 3VQCA 4CJTA 3TAGA 1C0MA 3K5OA 1SL1A 3L2WA 3RMDA 4OVLA 4CJLA 1JLEA 3DRSA 3MECA 4ELVA 1SKSA 1HYSA 3IAYA 3HM9A 1B9DA 4N5SA 2KZZA 1RNHA 1C6VA 3H08A 3RRHA 2X6SA 4KPYA 4M3TA 3SQ0A 5C42A 2DFFA 3OYAA 1KCFA 2DFEA 4CGIA 3LDSA 2Z1GA 4RG8A 4CIFA 2FBYA 1WSGA 1HNIA 1QSSA 3UIQA 3DOKA 1IH7A 4DFMA 4C8MA 3HYFA 4KRFA 1JL2A 1UWBA 4LY7A 4B9LA 3RRGA 3S3MA 3SZ2A 4DSKA 3NE6A 4FZYA 4KHYA 3AVGA 4Z4HA 1K6YA 2B6AA 4AHCA 2QKBA 2RF2A 1BL3A 3PO4A 4FJ8A 2RN2A 4CGFA 3KIOA 4CFAA 4HCBA 1WAFA 1FK9A 3LPUA 3LP2A 3SUPA 1J54A 4CEZA 2D0AA 4OKJA 2AJQA 1HQUA 4CIGA 3PX6A 4FJGA 3ZSZA 3K5NA 4CIEA 3OYGA 3VA0A 3TAQA 2ITGA 3M8SA 5HROA 1LW0A 4FJ7A 1HQEA 3G0ZA 3NF7A 3VQ7A 1EP4A 4CEOA 5KTQA 1HYVA 1NK0A 1ASVA 1GOBA 3AVMA 4TSXA 4FLUA 1IG9A 4ID5A 4AHTA 2VG6A 5FDLA 4YNQA 4DSEA 3EY1A 2HW3A 3K5LA 1CXQA 3VQ5A 3OJSA 3SQ2A 4RW7A 2D0BA 4W5NA 1D8YA 4B9VA 4OLBA 1U47A 4C8NA 3LP0A 4RW6A 3T3FA 5E41A 4C8KA 3HL8A 3NDKA 4ELUA 3AVBA 4F2SA 1RTHA 4M41A 3NH0A 2XO7A 1KRPA 3LWLA 1L3TA 2HHQA 1KLMA 1A5WA 4W5OA 1C1BA 3L3UA 3PUFA 3F9KA 4CHNA 4KO0A 1LWFA 1ITGA 1QE1A 1LW2A 2KQ2A 4PA1A 4DLGA 4DTMA 4CEAA 3V81A 4Z4EA 1I39A 2R7YA 5HP1A 1C1CA 1WN7A 3C6UA 4MFBA 4CFBA 4F2RA 5JS1A 3NFAA 4M3XA 1Q9XA 2HNYA 2OPRA 1NOYA 2BGGA 4KTQA 1S6PA 1B9FA 2KFNA 4Y1CA 3VQEA 4KB1A 1CXUA 1X9SA 1T03A 2F8SA 4I9QA 4BE0A 5DMRA 4LSLA 1MU2A 3QETA 4AHSA 3LWMA 5T7BA 2YNHA 5FROA 4IBNA 3KLEA 1D9DA 1KSPA 2G8VA 1IKWA 4KTWA 5J2PA 3SJJA 4B9MA 1UA0A 2YV0X 3DRRA 1ASUA 1TK8A 1W9HA 3VQQA 4H4MA 3G10A 4MQ3A 3V9SA 4CEDA 4Z4FA 3F73A 3DLHA 1EKEA 4Z4GA 3KTQA 3AO3A 5JS2A 2Z1IA 3NGZA 4DTRA 1WLJA 3KK3A 3MXJA 3LAMA 2HHWA 4FM1A 3V9UA 4E1NA 1BISA 4W5RA 4JRQA 3SNNA 3AVAA 1FKPA 3K59A 2F96A 3M8QA 4O0JA 5KGXA 3SPYA 4ZTFA 1FXXA 1N5YA 2KW4A 5FRMA 4I2QA 3VQ4A 1A5XA 1QSYA 1T8EA 2I5JA 3LANA 4ZHRA 4DQPA 1QSLA 1L3SA 4KAZA 2IAJA 4CJ4A 3ZSRA 4B8AB 2BANA 3KK2A 1JXBA 3L8BA 4E89A 2HHSA 2HHXA 1RCHA 4EP5A 3OYCA 4IKFA 3LALA 1RDAA 1VSMA 1DTQA 1VSIA 4QAGA 3VQBA 1YTUA 3BGRA 4CESA 1XHZA 3KKRA 1RBVA 1VSJA 3TR8A 4DQQA 4F8RA 4BWJA 1IKYA 4CJKA 1ZBLA 4CJQA 1CZBA 1TAQA 4PY5A 4M3YA 2ZQBA 4N76A 2YKMA 5HBMA 3DLEA 1EXQA 3OYEA 1HJRA 3OYHA 3MAQA 3LZJA 4CF9A 3AV9A 3NF6A 1S6QA 4FXDA 2EHGA 4DTNA 4O5BA 1EX4A 2G8WA 4DTXA 1RTIA 4AH9A 1RT7A 4CEBA 3T19A 4BACA 3EYZA 1NJZA 2FBVA 3RR7A 4FJHA 1YT3A 2PY5A 1ZBUA 1VSFA 2B4JA 3SYZA 4M42A 2O4GA 3AVJA 1LWCA 2XY5A 3PX4A 1SL0A 3ZSYA 4FW2A 2QKKA 4BDZA 2DFHA 1WSEA 4CGHA 1KVAA 2VG5A 4CJFA 1EETA 4I9LA 4N56A 1T7PA 4DF8A 4B9SA 1RBUA 4NCBA 3DLBA 4N47A 4KREA 1TV6A 4FVMA 3S3OA 3BDPA 1T05A 3RMAA 4FK4A 4FZXC 3V9ZA 3IRXA 3QEIA 3QEPA 1R0AA 3HPGA 2W42A 3DLKA 3T1AA 5J2MA 3ZT3A 2PZSA 1RBSA 2P51A 3SUOA 1N6QA 2RKIA 4FLTA 4M3ZA 3CG7A 4R5PA 3DM2A 3SV3A 2ETJA 4FLVA 2YNFA 1C0TA 4IFVA 3MEGA 3DYAA 1UA1A 3ZSXA 1BQNA 3I8DA 3ZCMA 3AVKA 4Z4CA 2IOCA 2Y1IA 4DF4A 2D5RA 4KHUA 4FJNA 4CJ5A 3SI6A 3M8RA 4M45A 3ISNC 2QK9A 4KHQA 3LZIA 4DQRA 1DLOA 3ULDA 2XY6A 1NJYA 4LH4A 4FJLA 3IG1A 4DQSA 1O1WA 1FKOA 4N41A 1LAWA 4IG0A 1JLAA 3PX0A 4KI6A 4CK1A 3MXMA 3LP3A 3FFIA 3ZT4A 3OYFA 4CGGA 4E7KA 1G15A 1XHXA 2VWKA 3B6PA 4LSNA 4O55A 3NH2A 3OYLA 2PYLA 4J2EA 4FYDA 3AA5X 1BCMA 1QHTA 3NHGA 3LAKA 3SUQA 1NJXA 1A5VA 1RDCA 3AVFA 3ZSQA 3JSMA 4DU3A 4O4GA 1NK6A 4E0DA 4CJUA 4CFDA 3L2UA 4DQIA 3PO5A 4BDPA 3QNNA 1Q9YA 3TWHA 4DU1A 2A1RA 3HVRA 3QEWA 3TI0A 2P5OA 1Q8IA 4DTPA 3OJUA 3HXMA 3JYTA 2FC0A 4K8XA 3QERA 1S5JA 2ATQA 4GVMA 1RT6A 1BGXT 3OYNA 5I3UA 2GBZA 4YFUA 2BDPA 4CGJA 2GUIA 3WNHA 1SKRA 2E6LA 4ZTJA 4E1MA 4CF2A 3U3YA 2YHBA 1GOAA 1XC9A 3VQ9A 1W0HA 3RWUA 5KGWA 3E01A 3ZSWA 4OPJA 4L8RB 3TABA 2HB5A 5J2QA 5J1EA 4NCGA 3CYMA 1U45A 4ELTA 4E7JA 1REVA 1JLCA 1VRUA 4CHZA 4CJRA 1Y97A 3S9HA 2G8FA 3V9XA 4DLEA 4DTOA 1UAXA 4NYFA 4CF0A 3HPHA 4Q5VA 1L5UA 3ALYA 4CERA 4LD0A 4Z4IA 3PV8A 4CJVA 3KJVA 1L3UA 3AO5A 5CYQA 3AVNA 4F3TA 2OPQA 3TANA 1Z26A 2LSNA 3SV4A 4DS4A 1BQMA 3WNGA 4HUEA 4FJ5A 1WAJA 3NCIA 3QESA 4WE1A 4BWMA 2RPIA 3QLHA 3V1QA 4CHPA 5FRNA 1YTAA 1JLFA 3NH1A 4M3WA 4AHVA 4E7IA 2Z1JA 3QIOA 1RILA 4Q0BA 2IS3A 4RW8A 5CYMA 1NK7A 4FJKA 3VN5A 4DFKA 3AVHA 1HRHA 3QIPA 3ZSOA 3OVNA 1JLBA 1VSEA 4HCCA 2O4IA 5HRNA 1NJWA 2XY8A 4W5QA 1JL1A 2X6NA 4KFBA 3AA2A 1BCOA 1BIZA 3QINA 1S9EA 4B8CA 4JS5A 4B3OA 1TL1A 4E3SA 1HPZA 4IFYA 5KRTA 3U6FA 1RT3A 1TL3A 2IGIA 5KRSA 4HTUA 1RTJA 1X9WA 1QS4A 5J2NA 2YKNA 1VSKA 2YNIA 1JKHA 3QO9A 3VQAA 1GOCA 1WSHA 3VQPA 1J9AA 2PYJA 3HK2A 3ZSVA 3OYBA 4J2DA 3KLHA 1NK5A 3AVLA 3ZT0A 3MEEA 1RDBA 4DU4A 2E4LA 3AA4A 3U3GA 2KFZA 3TAPA 2G8HA 4OKEA 4KB0A 4DS5A 3OS1A 5HLFA 2Z1HA 3L2RA 3M8PA 1YVUA 4CJEA 4PWDA 1RT1A 3WNFA 1CLQA 1C1AA 1SKWA 3RTVA 2NUBA 4W5TA 2A1SA 3QNOA 1BHLA 1U48A 3EZ5A 3QEXA 3SUNA 4CF1A 2OZMA 4H8KA 4NYNA 4QCLA 1RBTA 4M3UA 4AHUA 2Y1JA 1KTQA 1RT4A 2XRIA 1TK0A 4NCAA 1IKXA 3AA3A 1NOZA 3RMCA 3V4IA 4M3RA 5HRRA 4JLHA 4DTUA 1TGOA 2JGUA 2G8IA 3WNEA 3I0RA 4I2PA 1KVBA 1QQCA 1CZ9A 1RBRA 3NF8A 3O4QA 1UOCA 2VG7A 5HRSA 4FLWA 4DFPA 4DFJA 3VQ8A 4BE2A 4O0IA 1HNVA 2B5JA 2YHAA 1JLGA 1WSIA 2DY4A 5SZTA 3LPTA 3AVIA 1ZBHA 3C6TA 2ZD1A 3AO2A 3DLRA 3ZT1A 3HP9A 3K58A 3ASMA 3MXIA 4KV8A 2G8UA 4B9UA 4O44A 5KI6A 3KLGA 3RR8A 4B08A 3OY9A 4OLAA 4RW9A 4PQUA 1LV5A 3P5JA 4BDYA 4JRPA 1KVCA 1B92A 2WOMA 4CJSA 2GV9A 4E7HA 4CCHA 4PUOA 2BE2A 4CEEA 1X1PA 4JS4A 4CECA 1NK8A 1KLNA 2OYQA 4DSLA 3NF9A 1RT5A 1VSHA 1S1VA 1S1WA 1TKTA 2VWJA 4CEFA 1TVRA 4FK2A 2HHTA 3HP6A 4OGCA 3O3HA 4FW1A 3SCXA 1U4BA 3KD1E 4DG1A 1J53A 4CEQA 4RW4A 3AO4A 1VK0A 3CM5A 3TARA 4J2BA 3S3NA 3SQ1A 2HNDA 3OS0A 3OYKA 4FJ9A 2HMIA 1HYZA 1BI4A 3CM6A 3NGYA 4ICLA 4OGEA 3O3GA 3SPZA 1TKDA 4QOZB 2HHVA 4KHSA 2DTUA 1C0UA 4FM0A 4C8OA 1SV5A 4FZZA 4B9NA 2FBTA 3HSTB 3LP1A 4KTZA 2XHBA 4ID1A 1TKXA 4CF8A 4OKKA 4HUFA 3V1OA 4C8LA 1LAVA 1S1TA 1Z25A 1JLQA 3D45A 4DSJA 3MEDA 3TAFA 2P1JA 2X74A 3HT3A 2XY7A 4FM2A 1NKEA 5HRPA 1S9GA 1XWLA 1ZBFA 4HHTA 1XI1A 1RDDA 4KI4A 4XIUA 2QXFA 3THVA 3AO1A 3P83D 2G8KA 1BIUA 2HNZA 1U04A 3OYJA 4OJRA 2OPSA 4BE1A 5DK5A 1J5OA 4CHYA 4E19A 4HUGA 3CQ8A 1I3AA 3KD5E 4J2AA 3OYIA 3KLFA 4FCYA 4FJXA 3V9WA 1BI4B 5I42A 1VSLA 4AHRA 4E7LA 4CJ3A 5C24A 3QEVA 1NKCA 3AVCA 1NK4A 3VQ6A 4CFCA 1IKVA 1WSJA 2EX3A 4GMJB 4IDKA 4FLZA 1NK9A 3K57A 1RT2A 3NBPA 3TAMA 4KHWA 5CZ2A 3HVTA 4DTSA 3DI6A 3K2PA 2E6MA 5C25A 3O3FA 3K5MA 3CFRA 3V6DA 5CZ1A 3SQ4A 1S1UA 2Q3SA 5EU7A 2OZSA 3HPOA 4CK2A 4FLXA 3HO1A 3IS9A 3DMJA 1IO2A 3KKSA 1NKBA 3OYDA 3VA3A 3DLGA 4IG3A 3CFPA 3ZT2A 3D0PA 4AILC 4DSIA 1S1XA 3V1RA 1ZBIA 3P1GA 3DOLA 3KLIA 4CHQA 4CJPA 2WONA 4HVJA 4DMNA 4KHNA 4EZ9A 1ASWA 4CK3A 1WNSA 1U49A 1QTMA 4FJIA 3NGIA 4FJMA 2KTQA 1TAUA 1TKZA 1HMVA
chains in the Genus database with same CATH superfamily
3NAEA 3O4NA 2ZJRL 4BQZA 3L3VA 4A5BA 1BU6O 5MLCQ 1SL2A 4GW6A 4CGDA 4FLYA 4LH5A 4EP4A 3MN9A 3OS2A 5D3GA 2YNGA 4H5VA 3VQDA 4JK9A 1WBBA 1VQLN 1VSDA 1KFDA 2FXUA 4IOXA 4MDBA 3OBWA 2HBKA 1IBMK 2QWLA 4HTLA 2QWPA 1RTDA 1X3MA 1F21A 4NB4A 2O8DB 3L2WA 3ZX0A 4CJLA 3HM9A 1RNHA 3CD6N 3OYAA 1KCFA 1QHAA 1N34K 1NU0A 5AQSA 1N33K 3DOKA 1GLBG 1MWMA 1ILYA 4C8MA 3J8AA 4B1XB 4L3QA 4LY7A 2F4VK 3H45C 3S3MA 3SZ2A 3PSFA 3CMEN 4Z4HA 1K6YA 4AHCA 1YAGA 3H46O 1IBKK 1EWRA 3CJ9A 1J54A 1GLLO 5M1NA 4FJGA 4V19S 3CCEN 3EEQA 3OYGA 3VA0A 4H5RA 2P9IB 5HROA 5KTQA 1EP4A 1HYVA 4WQ5C 3VEYA 1GOBA 1NK0A 4O8UA 4FLUA 1IG9A 4AHTA 5ADXH 5DM6L 5AZJB 2PAVA 1CXQA 3OJSA 4RW7A 2A41A 4CZIA 4IFEA 4C8NA 2GWKA 4RW6A 1M90O 4LF9K 4F2SA 1RTHA 4M41A 3NH0A 4JD2B 2XO7A 1KRPA 2HHQA 5M1PA 3PUFA 1BUPA 4GKJK 1LWFA 1ITGA 2ASOA 3B8AX 4Z4EA 4MFBA 3LM9A 4CFBA 4BRGA 2QXLA 5DM7L 1DKGD 1QQMA 2HNYA 2V7ZA 1S6PA 1C0FA 3O9QA 1T03A 5JLFA 4X64K 3DXMA 2YNHA 5J2PA 3SJJA 2QWOA 3DRRA 1TK8A 1W9HA 1BOTO 3VQQA 4LF6K 1Z6RA 3FFKB 3G10A 4MQ3A 4CEDA 3F73A 1BWFO 5I9EB 1HKCA 3KTQA 4Z4GA 3NGZA 5BRHA 3KK3A 3MXJA 4FO0A 4FM1A 1W97L 1BISA 3MCAB 4ILGB 4W5RA 3SNNA 2E20A 3SPYA 4ZTFA 3VOVA 2KW4A 4DHYA 5FRMA 1A5XA 2I7NA 1U2VB 2IAJA 3L4IA 3FGUA 4JK7A 1JXBA 3MCPA 1GLDG 3I8BA 2HHXA 3F9MA 3LALA 1RDAA 3VQBA 5HL7L 3O1WA 1QZ5A 4CESA 3KKRA 4DV2K 2ZJPL 3G6EN 3D2FA 1BA0A 2P9KA 2ZQBA 2YKMA 1EXQA 3OYEA 4YOUA 1S6QA 4BQLA 3EO3A 2G8WA 3GL1A 4BRCA 3EYZA 2FBVA 3RR7A 4IDHA 2WBNA 4K42A 1YT3A 1ESVA 1VSFA 2O4GA 3AVJA 2XY5A 3ZSYA 2QKKA 2DFHA 1TAUA 1KVAA 1EETA 4I9LA 1T7PA 4JD2A 5BN9A 3AY9A 5AQTA 4FZXC 4BR4A 5J2MA 2PZSA 2NRZA 3LL3A 1RBSA 1N6QA 2OCEA 4KH6A 3CG7A 3DM2A 1NMDA 2YNFA 4FWNA 3KWIA 1BQNA 3I8DA 4Z4CA 2O8BB 4H0VB 2D5RA 2A6AA 3C0BA 4H0YB 5EVZA 3ISNC 3A8YA 4KHQA 2NLXA 3CCLN 4BRFA 3RSEB 3IG1A 1O1WA 1FKOA 5BRFA 1JLAA 3D2EB 3LP3A 4O5FA 2HOEA 3FFIA 5A2QO 1NGDA 5AFUH 4E7KA 1OH5A 1XHXA 3WXIA 3B6PA 3NH2A 3OYLA 4J2EA 1QHTA 3LAKA 3TTFA 2P9NB 1RDCA 3JSMA 1NK6A 3I56N 2D4WA 5IWAK 4CFDA 3L2UA 3QNNA 3OBYA 1Q9YA 4DU1A 3QEWA 3AAQA 2E2OA 4J8FA 1LOTB 5C2FA 3EL2A 3QB0A 1S5JA 2ATQA 5F2RA 2BDPA 1U6ZA 1YF5L 5ELZA 4E1MA 2NNWA 3U3YA 1VQMN 3E01A 5EY4A 4L8RB 4CZFA 5J1EA 4NCGA 5BR9A 2G8FA 4DTOA 1UAXA 1NGBA 3HPHA 4Q5VA 1L5UA 4CERA 4LD0A 5AQIA 1L3UA 2OPQA 3TANA 1Z26A 3SV4A 4HUEA 3L4QA 5AQLA 2RPIA 3VF2A 3O8MA 4GVEA 4B3RK 1XNQK 4OPAA 5KPRA 1C0GA 3CPWM 3VESA 5CYMA 1NK7A 2UUAK 3VN5A 5GADP 1TUUA 3SBTA 3ZSOA 3OVNA 4HCCA 4W5QA 2X6NA 5AFUA 1BIZA 4JS5A 3Q7CA 4E3SA 1HPZA 3EN9A 2IGIA 1QS4A 3E9OA 3SUOA 3ATVA 3BUZB 3QO9A 1GOCA 3VQPA 3HK2A 3OYBA 4J2DA 3AVLA 3AA4A 4YY3K 3OS1A 1OKJA 5AZIB 5M1OA 3T7ZA 4PKHA 3WNFA 3KVGA 5BPMA 3RTVA 2NUBA 2A1SA 1BHLA 3WXJA 3EZ5A 3QEXA 3SUNA 4H8KA 4NYNA 3DAWA 4M3UA 4JN4A 1TK0A 1VQNN 2XRIA 3FZFA 4NCAA 1IKXA 3RMCA 5B8HA 3ZETB 4JNEA 4I2PA 2P9UB 3BZCA 1UOCA 5HRSA 1P90A 3I55N 4H03B 3LPTA 4YOYA 2O8EA 4MO5A 2Q36A 2ZD1A 3MXIA 5BRDA 3RR8A 4OLAA 3VGLA 4RW9A 4JRPA 2WOMA 2IVOA 5FLXO 2GV9A 4K0KK 4XH4A 4CECA 1NK8A 5AQRA 4DV1K 1S1VA 1S1WA 4CEFA 2HHTA 2KKZA 4LF8K 4FW1A 1RGIA 4BGAA 4YOWA 3MWTA 4DG1A 2CGKA 2QWMA 2HNDA 3L0QA 3VGKA 3OYKA 3MN6A 1HYZA 5AQJA 5TKWA 2HHVA 1MA9B 3TSPA 1BG3A 3FLCO 1R59O 4C8OA 4B9NA 5AZJA 2FBTA 5BPLA 3LP1A 4H5TA 4ID1A 3TU5A 4F9OA 3TAFA 3CI5A 5HRPA 1XWLA 4HHTA 1BA1A 1KAZA 2QXFA 3EE8A 3THVA 3AO1A 3P83D 4XH5A 1J5OA 3ID6A 2P9SB 4JKDA 4H0PA 3CQ8A 3OYIA 2A3ZA 2IIRA 4AHRA 1NK4A 4CFCA 1WSJA 4IDKA 3T69A 2QI2A 1RT2A 4AM6A 3O3FA 1N32K 4YDUA 1S1UA 5EU7A 4FLXA 3L6QA 4IG3A 4AILC 4CZMA 2I7PA 2FF3B 4OO1J 1YITN 3DOLA 4CJPA 3EKSA 2WONA 3MX2A 3R6MA 5C12A 4KHNA 4EZ9A 4FJIA 4FJMA 3O9UA 3NGIA 2F8SA 4G1QA 1RDWX 4CI6A 1XMOK 4DWIA 4FOEA 2JLEA 1ZYQA 4F4KA 3DRPA 1D9FA 4B9TA 1SUQA 4BY9C 4DSFA 1IV0A 2OPPA 2HVHA 1D5AA 3C95A 2ZE2A 3CJ1A 2OA8A 4B1VA 2E2NA 4FJJA 2IDOA 4CJWA 1VRTA 1EWQA 4M3YA 2D0CA 5JVHL 4KKOA 3R8EA 4LF5K 3NVKA 4IO9L 3C94A 5CY4A 4OPKA 1V4SA 1VQ6N 1GLFO 5FPNA 3RSEA 3D6RA 1XMQK 1OH6A 4CJTA 3TAGA 1GLEG 3MECA 3G71N 2IVPA 4B3MK 4MO4A 1B9DA 4N5SA 3SJHA 2O8DA 4KPYA 3H08A 4M3TA 3SQ0A 5C42A 2DFFA 2DFEA 4CGIA 4JI3K 2YHWA 2Z1GA 4RG8A 2FBYA 1QSSA 1IH7A 4KRFA 4M7XA 2E2QA 4QS8A 4CD1A 3RRGA 4B9LA 4FZYA 3NE6A 2KHOA 3ZEUA 4BR2A 3CCRN 3FZHA 3PO4A 3S41A 2HHHK 2RN2A 3BF3A 3KIOA 4HCBA 2ASPA 2D0AA 4OKJA 2BUPA 1K8KB 3K5NA 4CIEA 3JS6A 3IFRA 3M8SA 1VQPN 1LW0A 2BTFA 3G0ZA 4CEOA 3O1BA 3DWLA 3O6WA 4TSXA 1XNRK 3AGRA 1NGAA 2Q31A 3EY1A 2HW3A 1KAYA 2D0BA 4A5AA 2D0OA 4W5NA 1D8YA 4OLBA 1QVFM 2A5XA 3DJCA 3LP0A 5E41A 1J6ZA 3AVBA 4OPHA 3VMFB 1QQOA 2E1YA 4FVUA 1U2VA 3LWLA 3P31A 1KLMA 2QTDA 4W5OA 2E5LK 1C1BA 2Q0UA 4DR2K 4JYAK 4DTMA 1Q82O 2R7YA 5HP1A 2QWRA 3C6UA 1MDUB 3NFAA 2BGGA 1B9FA 3VEOA 3VQEA 2QWQA 4I9QA 2HF3A 2QW9A 4BE0A 4LSLA 1MU2A 3KLEA 5FROA 4BRQA 2G8VA 1IKWA 4B9MA 3PIPL 4FOIA 1UA0A 2YV0X 4KH4A 4JHDA 4B1WB 3F2KA 1HNWK 3CF5L 3DLHA 3CJCA 3AO3A 4DTRA 2HHWA 3V9UA 4BROA 2FSKA 3CJAA 4JRQA 5LMUK 1NMNA 1FKPA 3AVAA 1N5YA 1FXXA 4ILHA 4R79A 5BR8K 3VQ4A 1Z05A 3K9KA 1W2BM 4DQPA 4KAZA 2I5JA 1L3SA 4CJ4A 4B8AB 2BANA 3TTDA 3A5NC 2UXCK 4A61A 4QAGA 1DTQA 1XHZA 3CC7N 4EFHA 3WT0A 4FWKA 1TAQA 4CJ7A 1O13A 3VEWA 3D7EO 3LZJA 2GELA 3H3NO 1T44A 3AV9A 3NF6A 4B9QA 4BC4A 3VGMA 5AQHA 1RTIA 4AH9A 3PIOL 3SBGA 4CEBA 2PY5A 3SYZA 2ZJQL 1Q7YO 4FW2A 1M1KO 4N56A 4CGHA 1NGEA 4NCBA 1FW6A 3DLBA 4N47A 5KPTA 4FK4A 2QM1A 1W7AA 3QEPA 3U4LA 4CW7B 2P51A 4I6MA 5CHIA 2RKIA 4M3ZA 4DB3A 4R5PA 3SV3A 5AQVA 1UA1A 1T3VA 3ZCMA 4FWRA 4BVPA 2IOCA 5LMNK 4FJNA 4CJ5A 3SI6A 3M8RA 4M45A 2FSNA 3LZIA 4DQRA 4KHPK 2H3GX 4FJLA 4DQSA 3U9DA 1LAWA 5JVGL 4IEEA 4KI6A 2YI1A 4CK1A 4B3SK 3DXMB 1HUXA 1H1VA 3FZLA 3ZT4A 2P9UA 3GG4A 3W0LA 2PYLA 2NRTA 3AA5X 3SUQA 3CETA 1V4TA 4O4GA 4E0DA 5C10A 4IO8A 4CJUA 4DQIA 4OX9K 3TI0A 2P5OA 1Q8IA 4BRKA 4DTPA 4H0XB 3OJUA 2FC0A 4K8XA 3JAMO 3OW2M 1BGXT 3OYNA 2GBZA 3P4IA 3CC2N 4B1ZA 2GUIA 4IJAA 4ZTJA 3M3ZA 3SMPA 4CF2A 2YHBA 1XC9A 3RWUA 3VQ9A 1W0HA 4WFNL 4DUYK 3U8XA 3WXKA 5FPEA 5GAHP 3UKUB 2HB5A 1U45A 3CYMA 1K9MO 2PBDA 4CHZA 1Y97A 3S9HA 4X66K 4BGBA 4CF0A 4JI6K 1YXQA 3OA9A 4QS7A 3PV8A 3BP8A 4Y0WA 4FWSA 4LC9B 4F3TA 2WTUA 4JV5K 4JI4K 3SAGA 1YIJN 4WQ5A 3NCIA 3C6AA 4WE1A 3QESA 4BWMA 4GV3A 3V1QA 4CHPA 5FRNA 1YTAA 2AA4A 3QIOA 4E7IA 1RILA 1HRHA 4O8KA 1VSEA 1WUAA 4LFAK 5HRNA 3MWPA 2GTDA 2Q97A 3G4SN 1JKHA 3M1FA 3ZSVA 5AQKA 1NK5A 3ZT0A 3MEEA 4CZHA 4DU4A 2E4LA 3U3GA 4NO7A 3LDQA 3TAPA 4OKEA 1NNEA 4KB0A 4CZKA 1X9JA 4H5NA 3L2RA 1C1AA 1SKWA 3QNOA 4I6MB 4CF1A 4X65K 3E66A 3ID8A 4FWPA 4JKGA 3V4IA 5HRRA 4YDUC 2P9NA 1TGOA 2JGUA 1QQCA 2AP1A 2P9SA 4JHDB 3OTOK 1CZ9A 1RBRA 3NF8A 3LDOA 1NGJA 2VG7A 4FLWA 2VGNA 4DFJA 3VQ8A 4O0IA 2YHAA 3D2FB 1WSIA 2DY4A 3VETA 3GOIA 1E4GT 3C6TA 3AO2A 3HP9A 1VQ9N 2G8UA 4U67L 4KV8A 4B9UA 1HX1A 5KI6A 5AQYA 3OY9A 1LV5A 3QBXA 1DT9A 2OTJN 2BE2A 2P9LA 4JKCA 3NF9A 5GINA 4JI5K 3QDKA 1RT5A 1VSHA 3UKRA 1TVRA 1JCEA 3PLAA 4RW4A 2O8CA 4YORA 1VK0A 3SAHA 3PSIA 3CHWA 3ENHA 4FJ9A 3CM6A 3THWA 4OGEA 4JI0K 3FR0A 1C0UA 3W3DA 4BRLA 4DR1K 1SV5A 3SAFA 2ZM6K 2XHBA 4BG9A 2E8AA 1HLUA 3J7ZO 5AQZA 4LFCK 1LAVA 3C7NA 1Z25A 1JLQA 3QMLA 2XY7A 4FM2A 1ATRA 3MMVA 2O8EB 1XI1A 5F0XA 3C7NB 1Q18A 5GAEP 3ZETA 1GLJO 1RDDA 4KI4A 4XIUA 3OYJA 2OPSA 2W40A 3GBTA 3EE9A 3T1HK 4Z94A 3CXCM 4A59A 1HNXK 4J2AA 2HBLA 3V9WA 4A62A 4CJ3A 3QEVA 3GDQA 2NRWA 4IOCL 2EX3A 4FLZA 3K57A 3HVTA 3E1YA 2YJFA 4H0TB 4G9ZA 4DTSA 3K2PA 3CFRA 5CZ1A 2Q3SA 2OZSA 2HMPA 3HPOA 4CK2A 3HO1A 5JLHA 1NKBA 3VA3A 3ZT2A 4DSIA 1S1XA 2WUSA 3KLIA 4NLBA 2P9IA 4CK3A 3U9ZA 5ADXA 2UUBK 3HOTA 1J5EK 1ATSA 4I7FA 4FK0A 3CC4N 4CE9A 3HJFA 1WSFA 1XUPO 4WQ4C 1IJJA 3O08A 3WQUA 3OHRA 5E26A 3L2VA 2RE2A 4BRPA 5JMVA 2F8TA 1VAZA 1JXEA 3B6OA 1TK5A 4UQGA 3Q7BA 1DTTA 3MN7A 4NXMK 3RVCA 1JCFA 2J4RA 3QICA 1YHQN 2P9PA 1DGKN 2IC3A 4Z0UA 4CHOA 4UY8O 4HWIA 3BY5A 3NMUA 3H3OB 4E1JA 4OVLA 3HM8A 1SKSA 1HYSA 3IAYA 3RRHA 2X6SA 3P38A 4DFMA 1UWBA 2CGLA 4KHYA 3VTHA 2RF2A 1BL3A 3HI0A 5CE3A 3AGKA 4FJ8A 1WAFA 1FK9A 3LP2A 3SUPA 3IMXA 1HQUA 4CIGA 3PX6A 2Q1NA 3ZSZA 3TAQA 2ITGA 1HQEA 3NF7A 3VQ7A 1IBLK 3EKUA 1KC8O 1ASVA 3AVMA 2KLAA 5FDLA 5AQPA 4GKKK 4XH1A 3K5LA 3DXKB 3VQ5A 4JKEA 3THYA 2ZWHA 4IEIA 1U47A 3H1VX 3VERA 3NDKA 4ELUA 3EZWA 4JK8A 4JI2K 3CQYA 3VF4A 4BR9A 1LCUA 3CCMN 4CHNA 4KO0A 4WCEL 2KQ2A 3N4QA 3THXB 1GLCG 4DV3K 1KQSM 4M3XA 3ULEA 3HBTA 2OPRA 1NOYA 1TYQA 4KTQA 1WOQA 1CXUA 2D0PA 4EIAA 1X9SA 4DV4K 4AHSA 2GUPA 3LWMA 5T7BA 3T1YK 4IBNA 1D9DA 4KTWA 3CCJN 1VQ4N 5F1XA 4H4MA 4H0OA 4CBXA 2UXDK 3G25A 4BRAA 4NXNK 5JS2A 2A40A 3SLCA 4YOTA 1WLJA 4WYBA 4E1NA 3VEZA 2YHXA 4I2QA 1E4FT 1QSYA 3LANA 4ZHRA 4BRDA 3L8BA 5AZIA 4E89A 2HHSA 1RCHA 3OYCA 1YTUA 1RBVA 1VSJA 3TR8A 4H5WA 4CVNE 4DQQA 1IKYA 2UU9K 1ZBLA 4M63C 4CJQA 1CZBA 4LFBK 4N76A 2E88A 3J80O 3OYHA 1HJRA 4CF9A 5M1KA 3VF6A 2EHGA 4DTNA 1TYQB 4O5BA 3WXMB 1EX4A 4DTXA 2VQFK 4B1UB 1RT7A 1T6DA 4BACA 1NJZA 2B4JA 2E2PA 3BZKA 3PX4A 1SL0A 4BDZA 1WSEA 2GWJA 2VG5A 3A5LC 1RBUA 2QA4N 3R1XA 4FVMA 5LJWA 3S3OA 3BDPA 1T05A 5EXWA 3FZKA 3HPGA 4DR7K 2O8CB 3DLKA 3T1AA 3ZT3A 3KHYA 1TUYA 2ITMA 4FLVA 1ZXOA 2ETJA 1C0TA 2Y1IA 4KHUA 1SAZA 2NZTA 2VCPA 2QK9A 4PL7A 1NJYA 3HTVA 1QVGM 3PX0A 3OYFA 1K8AO 3MX5A 3SK3A 3ATUA 2OANA 1G15A 4FYDA 4C23A 2HBJA 3ZX3A 1T6CA 1NJXA 3AVFA 3ZSQA 4DU3A 2CGJA 3TWHA 2A1RA 4DR4K 3HVRA 1JJ2M 1KXPA 4DUZK 1HKBA 4GVMA 5TKYA 5I3UA 4CGJA 4ILJA 2E6LA 1WBDA 2VQEK 1Q81O 3UKUA 3ZSWA 4DV5K 3LM2A 2NRHA 3KZBA 5J2QA 1Y64A 3QBWA 1REVA 1VRUA 4CJRA 2O8FB 4JKBA 3NVMA 3V9XA 4DLEA 4IWVA 2O8FA 3ALYA 1OH8A 4JI8K 4KBOA 3KJVA 4BRNA 3SMSA 3AO5A 3AVNA 3TSUA 2LSNA 1K8KA 1BQMA 3WNGA 4FJ5A 3QLHA 4DR6K 2F9TA 4EHUA 5AR0A 4M3WA 3LDLA 4Q0BA 2Z1JA 4BG8A 1NBWA 4RW8A 1EQYA 1SS6A 4K25A 4A2AA 4DFKA 2VGMA 3QIPA 2O4IA 1I94K 1NJWA 5AJ3K 4KFBA 3AA2A 3QFUA 4B8CA 4B3OA 1NJIO 2Q0RA 3U6FA 1RT3A 5KRSA 1RTJA 1X9WA 3TSQA 5M1FA 1VSKA 2YNIA 1NM1A 1WSHA 3CMAN 1J9AA 2WFBA 2PYJA 2V7YA 3KLHA 1RDBA 3O80A 3ENOA 4DS5A 5HLFA 4FSVA 2Z1HA 4CJEA 1RT1A 1CLQA 5EOYA 3CJBA 1U48A 2NRRA 1XC3A 2YX6A 1RBTA 4DQ8A 5LY3A 4K43A 1KTQA 1RT4A 4WQ4A 1NOZA 3AA3A 1OVYA 4M3RA 4CZJA 3WNEA 3ENBA 3UE5A 4WF9L 3HZ6A 4JEPA 4BE2A 1OH7A 2ZGZA 1HNVA 1CZAN 2B5JA 4XEIA 5SZTA 3AVIA 1G99A 3ZT1A 4DSLA 3ASMA 4GV6A 4B08A 4BVOA 4PQUA 2V52B 4E7HA 1GLAG 1B92A 1KVCA 4CJSA 4CCHA 4CEEA 5H1SQ 4JS4A 1KLNA 1HNZK 1JCGA 3R3LA 5LL6Z 2OYQA 4LF4K 4EHTA 2F7TA 2VWJA 2W41A 4FK2A 4DR5K 3HP6A 3O3HA 3SCXA 3KD1E 4FPAA 4CEQA 3AO4A 3CM5A 3O9RA 3H6EA 3TARA 4J2BA 5FPMA 2HMIA 1TKDA 3O3GA 4QOZB 2DTUA 3J7YP 4FM0A 3THYB 2ZGYA 3C65A 1ATNA 3HSTB 4CBWA 3J81O 4B1YB 4CF8A 2FLOA 3V1OA 4C8LA 2ZF5O 1S1TA 4B3TK 2P1JA 3HT3A 4U7BA 1ZBFA 2D1KA 4BRIA 5LJVA 1S22A 1KAXA 2RHKA 2G8KA 4JKGB 1U04A 4E19A 4YOXA 2HF4A 4BC5A 4FJXA 4FCYA 3VPZA 4E7LA 3TTCA 5C24A 4DR3K 1NKCA 4FL9A 3AVCA 5KQDA 1IKVA 1NK9A 3NBPA 1VHXA 5CZ2A 4M7YA 4PKIA 3DI6A 5C25A 3K5MA 3O9TA 3V6DA 3IS9A 3KKSA 3DLGA 3CFPA 3D0PA 2NRVA 1ZBIA 1YUWA 3P1GA 3ZYYX 4CHQA 4DMNA 3M5RA 1U49A 2VYPA 3DXKA 1QTMA 3LDNA 1HMVA 3RMBA 4RWTA 3TAEA 2FBXA 4Y1DA 5BN8A 3ITHA 2KZMA 2Q2RA 2HBMA 5K14A 4EZ6A 4DKWA 1K73O 3KWGA 3MDQA 4K8ZA 4DTJA 3IKMA 3KK1A 3L2QA 3PY8A 4ISEA 3KK7A 3CFOA 4H4OA 1VQ5N 3A2FA 4BR7A 3I0SA 2P5GA 5SWMA 3D2EA 5AQGA 4WFBL 1KFSA 1LWEA 2X78A 1L3VA 2HHUA 3OYMA 2HVIA 1NGCA 4MDAA 1P8ZA 1X9MA 4F3OA 3VQCA 4ISGA 3TPQA 1C0MA 3K5OA 1SL1A 1HPMA 3RMDA 4ELVA 1JLEA 3DRSA 1E3MA 2KZZA 4GY2B 1C6VA 3LDSA 4CZGA 4AQYK 4CIFA 1WSGA 1HNIA 3UIQA 3A0IX 3HYFA 5M1QA 1JL2A 4MLEA 4DSKA 1WB9A 3AVGA 1N8RO 2B6AA 2QKBA 1D4XA 4IZ9A 2QEXN 5AQNA 5AQWA 5IT9O 4CGFA 2YHYA 4CFAA 3LPUA 4CEZA 3QFPA 2AJQA 5AQOA 1S3XA 3LDPA 4FJ7A 1VQON 1Q86O 4BRHA 3WQTA 4ID5A 2VG6A 4YNQA 4DSEA 2NRXA 5C2DA 4JKAA 3JXUA 3CERA 3SQ2A 4B9VA 3MK6A 5AQXA 1YVNA 3THWB 3T3FA 4C8KA 3HL8A 3P39A 5BPNA 1VQKN 4A2BA 3CCVN 1L3TA 1A5WA 3L3UA 3F9KA 3UKRB 1QE1A 4DLGA 1LW2A 4PA1A 4CEAA 3V81A 1I39A 1OVQA 1C1CA 1WN7A 4F2RA 5JS1A 1Q9XA 4GV9A 3MN5A 4BR5A 2KFNA 2E1ZA 4Y1CA 1N36K 4KB1A 5DMRA 2FSJA 3QETA 3F5TA 4AM7A 2YJEA 1KSPA 3WUHA 5GIPA 3J7AP 1ASUA 1NWKA 2JWLA 4CD3A 2QWNA 3UB5A 4BC3A 4PHTX 4QS9A 5C15A 3V9SA 4Z4FA 1EKEA 4X62K 4KH5A 2Z1IA 4A57A 2O8BA 3LAMA 3THXA 3K59A 2F96A 3M8QA 4O0JA 5KGXA 5EX5A 2GEMA 1T8EA 1QSLA 1RFQA 5HOOA 3ZSRA 2W6LA 3KK2A 4JAXA 3N4PA 4EP5A 3HRGA 4IKFA 4C1NI 3CCQN 1VSMA 1VSIA 3BGRA 3WXLA 1QQNA 4F8RA 4BWJA 2P9LB 4CJKA 2FF6A 5FPDA 3ZX2A 4PY5A 1EO1A 5HBMA 3DLEA 3MAQA 4FXDA 4GNIA 5JICA 1BDGA 3T19A 2BH1A 4FJHA 3CPEA 1ZBUA 4M42A 4FWMA 1LWCA 3IUCA 3VENA 1IG8A 2GX9A 2W6KA 4CJFA 1SZ2A 4B9SA 4DF8A 4CZEA 4KREA 1TV6A 5BREA 3RMAA 3V9ZA 3IRXA 3QEIA 1R0AA 2W42A 3E9LA 3HOSA 4JI7K 4FLTA 3VTIA 4DV6K 4IFVA 3MEGA 3DYAA 3ZSXA 3A5OC 2V51B 3AVKA 4DF4A 2VWBA 1YJ9N 1DLOA 2WC9A 3ULDA 2XY6A 4LH4A 4FPBA 1VQ8N 4N41A 4IG0A 4RCHA 3MXMA 4FWQA 3C6HA 3M6GA 4CGGA 2VWKA 4BR0A 3A5MC 4LSNA 4O55A 4DV0K 3VEXA 3NHGA 1BCMA 2YCHA 1ZC6A 5GIOA 1YI2N 1A5VA 4RTFD 3PO5A 4BDPA 5KPZA 4YOVA 3AAPA 1NLVA 3JYTA 3HXMA 1RT6A 4YFUA 3CIPA 3FE1A 3WNHA 1SKRA 2F9WA 1GOAA 4JKFA 5KGWA 2JWKA 4BREA 4OPJA 3TABA 4PKGA 4ELTA 3VEVA 3HSCA 4E7JA 1JLCA 3WEEB 4K41A 3BEXA 1XQSC 3CCSN 3CCUN 1BO5O 3WEEA 4NYFA 4Z4IA 4CJVA 3DLLL 5CYQA 4CZLA 4DS4A 1WAJA 3O5BA 1JLFA 4IXCA 3NH1A 4AHVA 1NGGA 3FZMA 2IS3A 4FJKA 1FJGK 3AVHA 4IOAL 1JLBA 3H1QA 2XY8A 1JL1A 1BCOA 3QINA 1S9EA 4FWLA 1TL1A 1HR0K 2IVNA 4IFYA 5KRTA 3K9JA 1TL3A 4HTUA 5E84A 1DEJA 1X3NA 5J2NA 3QERA 3VQAA 2YKNA 5AQUA 3E9PA 3I33A 2OTLN 2KFZA 2UXBK 2G8HA 2P9PB 3M8PA 1YVUA 2HSTA 4PWDA 2A42A 3O9SA 4W5TA 3K0SA 2OZMA 4DV7K 4IJNA 1QZ6A 4QCLA 4AHUA 4C1NK 2Y1JA 1KD1O 4CBUA 4JLHA 4DTUA 1NGHA 1SQKA 2G8IA 3I0RA 1KVBA 4ISFA 3CQXA 4NLCA 5AQFA 3O4QA 4DFPA 1NGIA 1JLGA 2DPNA 2ASMA 1ZBHA 4WFAL 3K58A 3DLRA 4O44A 3KLGA 1ZBSA 4FWOA 3ZLJA 3O4WA 3P5JA 4BDYA 4PUOA 4PL8A 3CJ7A 1X1PA 1HKGA 1NGFA 1RDUA 3AARA 2PFUA 1TKTA 5AQQA 1NG9A 4OGCA 1U4BA 1VQ7N 1J53A 1HJOA 5AQMA 2UUCK 3S3NA 3SQ1A 3OS0A 3NGYA 1BI4A 4ICLA 3SPZA 4KHSA 4JI1K 2CH6A 4FZZA 4KTZA 4AF1A 1TKXA 5GAGP 4OKKA 4HUFA 4YHHK 4DSJA 3D45A 3MEDA 2X74A 1NKEA 1S9GA 3IDHA 2UYTA 3ULEB 2P9KB 1BIUA 2HNZA 1MWKA 5C0YA 4OJRA 4BE1A 2CH5A 5DK5A 4CHYA 1YJWN 4HUGA 3KD5E 1I3AA 3GE1A 3KLFA 5KQ8A 3ZEUB 1BI4B 5I42A 1VSLA 2EWSA 3BF1A 3VQ6A 4GMJB 4LF7K 4EAHD 3TAMA 4KHWA 4MLHA 4BRMA 2E6MA 1S72N 3SQ4A 3R9PA 3DMJA 1IO2A 3OYDA 4JKHA 4DCHA 3V1RA 1YJNN 5CR4A 4BC2A 4HVJA 1ASWA 1WNSA 2KTQA 1TKZA
chains in the Genus database with same CATH topology
3RMBA 3NAEA 3O4NA 3L3VA 4G1QA 4I7FA 3TAEA 4FK0A 4CE9A 2FBXA 1WSFA 4GW6A 4Y1DA 1SL2A 4DWIA 3ITHA 2JLEA 3HJFA 1ZYQA 4F4KA 3DRPA 1D9FA 4B9TA 1SUQA 4CGDA 2KZMA 4DSFA 3L2VA 2OPPA 5K14A 1D5AA 4EZ6A 2HVHA 3C95A 4FLYA 2ZE2A 4LH5A 2OA8A 4FJJA 2IDOA 4CJWA 4EP4A 2F8TA 3OS2A 5D3GA 2YNGA 4K8ZA 4DTJA 1VRTA 3KK1A 3L2QA 1JXEA 3B6OA 3VQDA 2D0CA 3CFOA 4KKOA 4H4OA 3PY8A 3A2FA 1TK5A 4UQGA 1VSDA 1KFDA 1DTTA 3C94A 5CY4A 3I0SA 2P5GA 5SWMA 4OPKA 1KFSA 1LWEA 2X78A 2IC3A 1L3VA 3OYMA 4Z0UA 2HVIA 2HHUA 4CHOA 1RTDA 1X9MA 4F3OA 1F21A 3VQCA 4CJTA 3TAGA 1C0MA 3K5OA 1SL1A 3L2WA 3RMDA 4OVLA 4CJLA 1JLEA 3DRSA 3MECA 4ELVA 1SKSA 1HYSA 3IAYA 3HM9A 1B9DA 4N5SA 2KZZA 1RNHA 1C6VA 3H08A 3RRHA 2X6SA 4KPYA 4M3TA 3SQ0A 5C42A 2DFFA 3OYAA 1KCFA 2DFEA 4CGIA 3LDSA 2Z1GA 4RG8A 4CIFA 2FBYA 1WSGA 1HNIA 1QSSA 3UIQA 3DOKA 1IH7A 4DFMA 4C8MA 3HYFA 4KRFA 1JL2A 1UWBA 4LY7A 4B9LA 3RRGA 3S3MA 3SZ2A 4DSKA 3NE6A 4FZYA 4KHYA 3AVGA 4Z4HA 1K6YA 2B6AA 4AHCA 2QKBA 2RF2A 1BL3A 3PO4A 4FJ8A 2RN2A 4CGFA 3KIOA 4CFAA 4HCBA 1WAFA 1FK9A 3LPUA 3LP2A 3SUPA 1J54A 4CEZA 2D0AA 4OKJA 2AJQA 1HQUA 4CIGA 3PX6A 4FJGA 3ZSZA 3K5NA 4CIEA 3OYGA 3VA0A 3TAQA 2ITGA 3M8SA 5HROA 1LW0A 4FJ7A 1HQEA 3G0ZA 3NF7A 3VQ7A 1EP4A 4CEOA 5KTQA 1HYVA 1NK0A 1ASVA 1GOBA 3AVMA 4TSXA 4FLUA 1IG9A 4ID5A 4AHTA 2VG6A 5FDLA 4YNQA 4DSEA 3EY1A 2HW3A 3K5LA 1CXQA 3VQ5A 3OJSA 3SQ2A 4RW7A 2D0BA 4W5NA 1D8YA 4B9VA 4OLBA 1U47A 4C8NA 3LP0A 4RW6A 3T3FA 5E41A 4C8KA 3HL8A 3NDKA 4ELUA 3AVBA 4F2SA 1RTHA 4M41A 3NH0A 2XO7A 1KRPA 3LWLA 1L3TA 2HHQA 1KLMA 1A5WA 4W5OA 1C1BA 3L3UA 3PUFA 3F9KA 4CHNA 4KO0A 1LWFA 1ITGA 1QE1A 1LW2A 2KQ2A 4PA1A 4DLGA 4DTMA 4CEAA 3V81A 4Z4EA 1I39A 2R7YA 5HP1A 1C1CA 1WN7A 3C6UA 4MFBA 4CFBA 4F2RA 5JS1A 3NFAA 4M3XA 1Q9XA 2HNYA 2OPRA 1NOYA 2BGGA 4KTQA 1S6PA 1B9FA 2KFNA 4Y1CA 3VQEA 4KB1A 1CXUA 1X9SA 1T03A 2F8SA 4I9QA 4BE0A 5DMRA 4LSLA 1MU2A 3QETA 4AHSA 3LWMA 5T7BA 2YNHA 5FROA 4IBNA 3KLEA 1D9DA 1KSPA 2G8VA 1IKWA 4KTWA 5J2PA 3SJJA 4B9MA 1UA0A 2YV0X 3DRRA 1ASUA 1TK8A 1W9HA 3VQQA 4H4MA 3G10A 4MQ3A 3V9SA 4CEDA 4Z4FA 3F73A 3DLHA 1EKEA 4Z4GA 3KTQA 3AO3A 5JS2A 2Z1IA 3NGZA 4DTRA 1WLJA 3KK3A 3MXJA 3LAMA 2HHWA 4FM1A 3V9UA 4E1NA 1BISA 4W5RA 4JRQA 3SNNA 3AVAA 1FKPA 3K59A 2F96A 3M8QA 4O0JA 5KGXA 3SPYA 4ZTFA 1FXXA 1N5YA 2KW4A 5FRMA 4I2QA 3VQ4A 1A5XA 1QSYA 1T8EA 2I5JA 3LANA 4ZHRA 4DQPA 1QSLA 1L3SA 4KAZA 2IAJA 4CJ4A 3ZSRA 4B8AB 2BANA 3KK2A 1JXBA 3L8BA 4E89A 2HHSA 2HHXA 1RCHA 4EP5A 3OYCA 4IKFA 3LALA 1RDAA 1VSMA 1DTQA 1VSIA 4QAGA 3VQBA 1YTUA 3BGRA 4CESA 1XHZA 3KKRA 1RBVA 1VSJA 3TR8A 4DQQA 4F8RA 4BWJA 1IKYA 4CJKA 1ZBLA 4CJQA 1CZBA 1TAQA 4PY5A 4M3YA 2ZQBA 4N76A 2YKMA 5HBMA 3DLEA 1EXQA 3OYEA 1HJRA 3OYHA 3MAQA 3LZJA 4CF9A 3AV9A 3NF6A 1S6QA 4FXDA 2EHGA 4DTNA 4O5BA 1EX4A 2G8WA 4DTXA 1RTIA 4AH9A 1RT7A 4CEBA 3T19A 4BACA 3EYZA 1NJZA 2FBVA 3RR7A 4FJHA 1YT3A 2PY5A 1ZBUA 1VSFA 2B4JA 3SYZA 4M42A 2O4GA 3AVJA 1LWCA 2XY5A 3PX4A 1SL0A 3ZSYA 4FW2A 2QKKA 4BDZA 2DFHA 1WSEA 4CGHA 1KVAA 2VG5A 4CJFA 1EETA 4I9LA 4N56A 1T7PA 4DF8A 4B9SA 1RBUA 4NCBA 3DLBA 4N47A 4KREA 1TV6A 4FVMA 3S3OA 3BDPA 1T05A 3RMAA 4FK4A 4FZXC 3V9ZA 3IRXA 3QEIA 3QEPA 1R0AA 3HPGA 2W42A 3DLKA 3T1AA 5J2MA 3ZT3A 2PZSA 1RBSA 2P51A 3SUOA 1N6QA 2RKIA 4FLTA 4M3ZA 3CG7A 4R5PA 3DM2A 3SV3A 2ETJA 4FLVA 2YNFA 1C0TA 4IFVA 3MEGA 3DYAA 1UA1A 3ZSXA 1BQNA 3I8DA 3ZCMA 3AVKA 4Z4CA 2IOCA 2Y1IA 4DF4A 2D5RA 4KHUA 4FJNA 4CJ5A 3SI6A 3M8RA 4M45A 3ISNC 2QK9A 4KHQA 3LZIA 4DQRA 1DLOA 3ULDA 2XY6A 1NJYA 4LH4A 4FJLA 3IG1A 4DQSA 1O1WA 1FKOA 4N41A 1LAWA 4IG0A 1JLAA 3PX0A 4KI6A 4CK1A 3MXMA 3LP3A 3FFIA 3ZT4A 3OYFA 4CGGA 4E7KA 1G15A 1XHXA 2VWKA 3B6PA 4LSNA 4O55A 3NH2A 3OYLA 2PYLA 4J2EA 4FYDA 3AA5X 1BCMA 1QHTA 3NHGA 3LAKA 3SUQA 1NJXA 1A5VA 1RDCA 3AVFA 3ZSQA 3JSMA 4DU3A 4O4GA 1NK6A 4E0DA 4CJUA 4CFDA 3L2UA 4DQIA 3PO5A 4BDPA 3QNNA 1Q9YA 3TWHA 4DU1A 2A1RA 3HVRA 3QEWA 3TI0A 2P5OA 1Q8IA 4DTPA 3OJUA 3HXMA 3JYTA 2FC0A 4K8XA 3QERA 1S5JA 2ATQA 4GVMA 1RT6A 1BGXT 3OYNA 5I3UA 2GBZA 4YFUA 2BDPA 4CGJA 2GUIA 3WNHA 1SKRA 2E6LA 4ZTJA 4E1MA 4CF2A 3U3YA 2YHBA 1GOAA 1XC9A 3VQ9A 1W0HA 3RWUA 5KGWA 3E01A 3ZSWA 4OPJA 4L8RB 3TABA 2HB5A 5J2QA 5J1EA 4NCGA 3CYMA 1U45A 4ELTA 4E7JA 1REVA 1JLCA 1VRUA 4CHZA 4CJRA 1Y97A 3S9HA 2G8FA 3V9XA 4DLEA 4DTOA 1UAXA 4NYFA 4CF0A 3HPHA 4Q5VA 1L5UA 3ALYA 4CERA 4LD0A 4Z4IA 3PV8A 4CJVA 3KJVA 1L3UA 3AO5A 5CYQA 3AVNA 4F3TA 2OPQA 3TANA 1Z26A 2LSNA 3SV4A 4DS4A 1BQMA 3WNGA 4HUEA 4FJ5A 1WAJA 3NCIA 3QESA 4WE1A 4BWMA 2RPIA 3QLHA 3V1QA 4CHPA 5FRNA 1YTAA 1JLFA 3NH1A 4M3WA 4AHVA 4E7IA 2Z1JA 3QIOA 1RILA 4Q0BA 2IS3A 4RW8A 5CYMA 1NK7A 4FJKA 3VN5A 4DFKA 3AVHA 1HRHA 3QIPA 3ZSOA 3OVNA 1JLBA 1VSEA 4HCCA 2O4IA 5HRNA 1NJWA 2XY8A 4W5QA 1JL1A 2X6NA 4KFBA 3AA2A 1BCOA 1BIZA 3QINA 1S9EA 4B8CA 4JS5A 4B3OA 1TL1A 4E3SA 1HPZA 4IFYA 5KRTA 3U6FA 1RT3A 1TL3A 2IGIA 5KRSA 4HTUA 1RTJA 1X9WA 1QS4A 5J2NA 2YKNA 1VSKA 2YNIA 1JKHA 3QO9A 3VQAA 1GOCA 1WSHA 3VQPA 1J9AA 2PYJA 3HK2A 3ZSVA 3OYBA 4J2DA 3KLHA 1NK5A 3AVLA 3ZT0A 3MEEA 1RDBA 4DU4A 2E4LA 3AA4A 3U3GA 2KFZA 3TAPA 2G8HA 4OKEA 4KB0A 4DS5A 3OS1A 5HLFA 2Z1HA 3L2RA 3M8PA 1YVUA 4CJEA 4PWDA 1RT1A 3WNFA 1CLQA 1C1AA 1SKWA 3RTVA 2NUBA 4W5TA 2A1SA 3QNOA 1BHLA 1U48A 3EZ5A 3QEXA 3SUNA 4CF1A 2OZMA 4H8KA 4NYNA 4QCLA 1RBTA 4M3UA 4AHUA 2Y1JA 1KTQA 1RT4A 2XRIA 1TK0A 4NCAA 1IKXA 3AA3A 1NOZA 3RMCA 3V4IA 4M3RA 5HRRA 4JLHA 4DTUA 1TGOA 2JGUA 2G8IA 3WNEA 3I0RA 4I2PA 1KVBA 1QQCA 1CZ9A 1RBRA 3NF8A 3O4QA 1UOCA 2VG7A 5HRSA 4FLWA 4DFPA 4DFJA 3VQ8A 4BE2A 4O0IA 1HNVA 2B5JA 2YHAA 1JLGA 1WSIA 2DY4A 5SZTA 3LPTA 3AVIA 1ZBHA 3C6TA 2ZD1A 3AO2A 3DLRA 3ZT1A 3HP9A 3K58A 3ASMA 3MXIA 4KV8A 2G8UA 4B9UA 4O44A 5KI6A 3KLGA 3RR8A 4B08A 3OY9A 4OLAA 4RW9A 4PQUA 1LV5A 3P5JA 4BDYA 4JRPA 1KVCA 1B92A 2WOMA 4CJSA 2GV9A 4E7HA 4CCHA 4PUOA 2BE2A 4CEEA 1X1PA 4JS4A 4CECA 1NK8A 1KLNA 2OYQA 4DSLA 3NF9A 1RT5A 1VSHA 1S1VA 1S1WA 1TKTA 2VWJA 4CEFA 1TVRA 4FK2A 2HHTA 3HP6A 4OGCA 3O3HA 4FW1A 3SCXA 1U4BA 3KD1E 4DG1A 1J53A 4CEQA 4RW4A 3AO4A 1VK0A 3CM5A 3TARA 4J2BA 3S3NA 3SQ1A 2HNDA 3OS0A 3OYKA 4FJ9A 2HMIA 1HYZA 1BI4A 3CM6A 3NGYA 4ICLA 4OGEA 3O3GA 3SPZA 1TKDA 4QOZB 2HHVA 4KHSA 2DTUA 1C0UA 4FM0A 4C8OA 1SV5A 4FZZA 4B9NA 2FBTA 3HSTB 3LP1A 4KTZA 2XHBA 4ID1A 1TKXA 4CF8A 4OKKA 4HUFA 3V1OA 4C8LA 1LAVA 1S1TA 1Z25A 1JLQA 3D45A 4DSJA 3MEDA 3TAFA 2P1JA 2X74A 3HT3A 2XY7A 4FM2A 1NKEA 5HRPA 1S9GA 1XWLA 1ZBFA 4HHTA 1XI1A 1RDDA 4KI4A 4XIUA 2QXFA 3THVA 3AO1A 3P83D 2G8KA 1BIUA 2HNZA 1U04A 3OYJA 4OJRA 2OPSA 4BE1A 5DK5A 1J5OA 4CHYA 4E19A 4HUGA 3CQ8A 1I3AA 3KD5E 4J2AA 3OYIA 3KLFA 4FCYA 4FJXA 3V9WA 1BI4B 5I42A 1VSLA 4AHRA 4E7LA 4CJ3A 5C24A 3QEVA 1NKCA 3AVCA 1NK4A 3VQ6A 4CFCA 1IKVA 1WSJA 2EX3A 4GMJB 4IDKA 4FLZA 1NK9A 3K57A 1RT2A 3NBPA 3TAMA 4KHWA 5CZ2A 3HVTA 4DTSA 3DI6A 3K2PA 2E6MA 5C25A 3O3FA 3K5MA 3CFRA 3V6DA 5CZ1A 3SQ4A 1S1UA 2Q3SA 5EU7A 2OZSA 3HPOA 4CK2A 4FLXA 3HO1A 3IS9A 3DMJA 1IO2A 3KKSA 1NKBA 3OYDA 3VA3A 3DLGA 4IG3A 3CFPA 3ZT2A 3D0PA 4AILC 4DSIA 1S1XA 3V1RA 1ZBIA 3P1GA 3DOLA 3KLIA 4CHQA 4CJPA 2WONA 4HVJA 4DMNA 4KHNA 4EZ9A 1ASWA 4CK3A 1WNSA 1U49A 1QTMA 4FJIA 3NGIA 4FJMA 2KTQA 1TAUA 1TKZA 1HMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMB A;  3NAE A;  3O4N A;  3L3V A;  4G1Q A;  4I7F A;  3TAE A;  4FK0 A;  4CE9 A;  2FBX A;  1WSF A;  4GW6 A;  4Y1D A;  1SL2 A;  4DWI A;  3ITH A;  2JLE A;  3HJF A;  1ZYQ A;  4F4K A;  3DRP A;  1D9F A;  4B9T A;  1SUQ A;  4CGD A;  2KZM A;  4DSF A;  3L2V A;  2OPP A;  5K14 A;  1D5A A;  4EZ6 A;  2HVH A;  3C95 A;  4FLY A;  2ZE2 A;  4LH5 A;  2OA8 A;  4FJJ A;  2IDO A;  4CJW A;  4EP4 A;  2F8T A;  3OS2 A;  5D3G A;  2YNG A;  4K8Z A;  4DTJ A;  1VRT A;  3KK1 A;  3L2Q A;  1JXE A;  3B6O A;  3VQD A;  2D0C A;  3CFO A;  4KKO A;  4H4O A;  3PY8 A;  3A2F A;  1TK5 A;  4UQG A;  1VSD A;  1KFD A;  1DTT A;  3C94 A;  5CY4 A;  3I0S A;  2P5G A;  5SWM A;  4OPK A;  1KFS A;  1LWE A;  2X78 A;  2IC3 A;  1L3V A;  3OYM A;  4Z0U A;  2HVI A;  2HHU A;  4CHO A;  1RTD A;  1X9M A;  4F3O A;  1F21 A;  3VQC A;  4CJT A;  3TAG A;  1C0M A;  3K5O A;  1SL1 A;  3L2W A;  3RMD A;  4OVL A;  4CJL A;  1JLE A;  3DRS A;  3MEC A;  4ELV A;  1SKS A;  1HYS A;  3IAY A;  3HM9 A;  1B9D A;  4N5S A;  2KZZ A;  1RNH A;  1C6V A;  3H08 A;  3RRH A;  2X6S A;  4KPY A;  4M3T A;  3SQ0 A;  5C42 A;  2DFF A;  3OYA A;  1KCF A;  2DFE A;  4CGI A;  3LDS A;  2Z1G A;  4RG8 A;  4CIF A;  2FBY A;  1WSG A;  1HNI A;  1QSS A;  3UIQ A;  3DOK A;  1IH7 A;  4DFM A;  4C8M A;  3HYF A;  4KRF A;  1JL2 A;  1UWB A;  4LY7 A;  4B9L A;  3RRG A;  3S3M A;  3SZ2 A;  4DSK A;  3NE6 A;  4FZY A;  4KHY A;  3AVG A;  4Z4H A;  1K6Y A;  2B6A A;  4AHC A;  2QKB A;  2RF2 A;  1BL3 A;  3PO4 A;  4FJ8 A;  2RN2 A;  4CGF A;  3KIO A;  4CFA A;  4HCB A;  1WAF A;  1FK9 A;  3LPU A;  3LP2 A;  3SUP A;  1J54 A;  4CEZ A;  2D0A A;  4OKJ A;  2AJQ A;  1HQU A;  4CIG A;  3PX6 A;  4FJG A;  3ZSZ A;  3K5N A;  4CIE A;  3OYG A;  3VA0 A;  3TAQ A;  2ITG A;  3M8S A;  5HRO A;  1LW0 A;  4FJ7 A;  1HQE A;  3G0Z A;  3NF7 A;  3VQ7 A;  1EP4 A;  4CEO A;  5KTQ A;  1HYV A;  1NK0 A;  1ASV A;  1GOB A;  3AVM A;  4TSX A;  4FLU A;  1IG9 A;  4ID5 A;  4AHT A;  2VG6 A;  5FDL A;  4YNQ A;  4DSE A;  3EY1 A;  2HW3 A;  3K5L A;  1CXQ A;  3VQ5 A;  3OJS A;  3SQ2 A;  4RW7 A;  2D0B A;  4W5N A;  1D8Y A;  4B9V A;  4OLB A;  1U47 A;  4C8N A;  3LP0 A;  4RW6 A;  3T3F A;  5E41 A;  4C8K A;  3HL8 A;  3NDK A;  4ELU A;  3AVB A;  4F2S A;  1RTH A;  4M41 A;  3NH0 A;  2XO7 A;  1KRP A;  3LWL A;  1L3T A;  2HHQ A;  1KLM A;  1A5W A;  4W5O A;  1C1B A;  3L3U A;  3PUF A;  3F9K A;  4CHN A;  4KO0 A;  1LWF A;  1ITG A;  1QE1 A;  1LW2 A;  2KQ2 A;  4PA1 A;  4DLG A;  4DTM A;  4CEA A;  3V81 A;  4Z4E A;  1I39 A;  2R7Y A;  5HP1 A;  1C1C A;  1WN7 A;  3C6U A;  4MFB A;  4CFB A;  4F2R A;  5JS1 A;  3NFA A;  4M3X A;  1Q9X A;  2HNY A;  2OPR A;  1NOY A;  2BGG A;  4KTQ A;  1S6P A;  1B9F A;  2KFN A;  4Y1C A;  3VQE A;  4KB1 A;  1CXU A;  1X9S A;  1T03 A;  2F8S A;  4I9Q A;  4BE0 A;  5DMR A;  4LSL A;  1MU2 A;  3QET A;  4AHS A;  3LWM A;  5T7B A;  2YNH A;  5FRO A;  4IBN A;  3KLE A;  1D9D A;  1KSP A;  2G8V A;  1IKW A;  4KTW A;  5J2P A;  3SJJ A;  4B9M A;  1UA0 A;  2YV0 X;  3DRR A;  1ASU A;  1TK8 A;  1W9H A;  3VQQ A;  4H4M A;  3G10 A;  4MQ3 A;  3V9S A;  4CED A;  4Z4F A;  3F73 A;  3DLH A;  1EKE A;  4Z4G A;  3KTQ A;  3AO3 A;  5JS2 A;  2Z1I A;  3NGZ A;  4DTR A;  1WLJ A;  3KK3 A;  3MXJ A;  3LAM A;  2HHW A;  4FM1 A;  3V9U A;  4E1N A;  1BIS A;  4W5R A;  4JRQ A;  3SNN A;  3AVA A;  1FKP A;  3K59 A;  2F96 A;  3M8Q A;  4O0J A;  5KGX A;  3SPY A;  4ZTF A;  1FXX A;  1N5Y A;  2KW4 A;  5FRM A;  4I2Q A;  3VQ4 A;  1A5X A;  1QSY A;  1T8E A;  2I5J A;  3LAN A;  4ZHR A;  4DQP A;  1QSL A;  1L3S A;  4KAZ A;  2IAJ A;  4CJ4 A;  3ZSR A;  4B8A B;  2BAN A;  3KK2 A;  1JXB A;  3L8B A;  4E89 A;  2HHS A;  2HHX A;  1RCH A;  4EP5 A;  3OYC A;  4IKF A;  3LAL A;  1RDA A;  1VSM A;  1DTQ A;  1VSI A;  4QAG A;  3VQB A;  1YTU A;  3BGR A;  4CES A;  1XHZ A;  3KKR A;  1RBV A;  1VSJ A;  3TR8 A;  4DQQ A;  4F8R A;  4BWJ A;  1IKY A;  4CJK A;  1ZBL A;  4CJQ A;  1CZB A;  1TAQ A;  4PY5 A;  4M3Y A;  2ZQB A;  4N76 A;  2YKM A;  5HBM A;  3DLE A;  1EXQ A;  3OYE A;  1HJR A;  3OYH A;  3MAQ A;  3LZJ A;  4CF9 A;  3AV9 A;  3NF6 A;  1S6Q A;  4FXD A;  2EHG A;  4DTN A;  4O5B A;  1EX4 A;  2G8W A;  4DTX A;  1RTI A;  4AH9 A;  1RT7 A;  4CEB A;  3T19 A;  4BAC A;  3EYZ A;  1NJZ A;  2FBV A;  3RR7 A;  4FJH A;  1YT3 A;  2PY5 A;  1ZBU A;  1VSF A;  2B4J A;  3SYZ A;  4M42 A;  2O4G A;  3AVJ A;  1LWC A;  2XY5 A;  3PX4 A;  1SL0 A;  3ZSY A;  4FW2 A;  2QKK A;  4BDZ A;  2DFH A;  1WSE A;  4CGH A;  1KVA A;  2VG5 A;  4CJF A;  1EET A;  4I9L A;  4N56 A;  1T7P A;  4DF8 A;  4B9S A;  1RBU A;  4NCB A;  3DLB A;  4N47 A;  4KRE A;  1TV6 A;  4FVM A;  3S3O A;  3BDP A;  1T05 A;  3RMA A;  4FK4 A;  4FZX C;  3V9Z A;  3IRX A;  3QEI A;  3QEP A;  1R0A A;  3HPG A;  2W42 A;  3DLK A;  3T1A A;  5J2M A;  3ZT3 A;  2PZS A;  1RBS A;  2P51 A;  3SUO A;  1N6Q A;  2RKI A;  4FLT A;  4M3Z A;  3CG7 A;  4R5P A;  3DM2 A;  3SV3 A;  2ETJ A;  4FLV A;  2YNF A;  1C0T A;  4IFV A;  3MEG A;  3DYA A;  1UA1 A;  3ZSX A;  1BQN A;  3I8D A;  3ZCM A;  3AVK A;  4Z4C A;  2IOC A;  2Y1I A;  4DF4 A;  2D5R A;  4KHU A;  4FJN A;  4CJ5 A;  3SI6 A;  3M8R A;  4M45 A;  3ISN C;  2QK9 A;  4KHQ A;  3LZI A;  4DQR A;  1DLO A;  3ULD A;  2XY6 A;  1NJY A;  4LH4 A;  4FJL A;  3IG1 A;  4DQS A;  1O1W A;  1FKO A;  4N41 A;  1LAW A;  4IG0 A;  1JLA A;  3PX0 A;  4KI6 A;  4CK1 A;  3MXM A;  3LP3 A;  3FFI A;  3ZT4 A;  3OYF A;  4CGG A;  4E7K A;  1G15 A;  1XHX A;  2VWK A;  3B6P A;  4LSN A;  4O55 A;  3NH2 A;  3OYL A;  2PYL A;  4J2E A;  4FYD A;  3AA5 X;  1BCM A;  1QHT A;  3NHG A;  3LAK A;  3SUQ A;  1NJX A;  1A5V A;  1RDC A;  3AVF A;  3ZSQ A;  3JSM A;  4DU3 A;  4O4G A;  1NK6 A;  4E0D A;  4CJU A;  4CFD A;  3L2U A;  4DQI A;  3PO5 A;  4BDP A;  3QNN A;  1Q9Y A;  3TWH A;  4DU1 A;  2A1R A;  3HVR A;  3QEW A;  3TI0 A;  2P5O A;  1Q8I A;  4DTP A;  3OJU A;  3HXM A;  3JYT A;  2FC0 A;  4K8X A;  3QER A;  1S5J A;  2ATQ A;  4GVM A;  1RT6 A;  1BGX T;  3OYN A;  5I3U A;  2GBZ A;  4YFU A;  2BDP A;  4CGJ A;  2GUI A;  3WNH A;  1SKR A;  2E6L A;  4ZTJ A;  4E1M A;  4CF2 A;  3U3Y A;  2YHB A;  1GOA A;  1XC9 A;  3VQ9 A;  1W0H A;  3RWU A;  5KGW A;  3E01 A;  3ZSW A;  4OPJ A;  4L8R B;  3TAB A;  2HB5 A;  5J2Q A;  5J1E A;  4NCG A;  3CYM A;  1U45 A;  4ELT A;  4E7J A;  1REV A;  1JLC A;  1VRU A;  4CHZ A;  4CJR A;  1Y97 A;  3S9H A;  2G8F A;  3V9X A;  4DLE A;  4DTO A;  1UAX A;  4NYF A;  4CF0 A;  3HPH A;  4Q5V A;  1L5U A;  3ALY A;  4CER A;  4LD0 A;  4Z4I A;  3PV8 A;  4CJV A;  3KJV A;  1L3U A;  3AO5 A;  5CYQ A;  3AVN A;  4F3T A;  2OPQ A;  3TAN A;  1Z26 A;  2LSN A;  3SV4 A;  4DS4 A;  1BQM A;  3WNG A;  4HUE A;  4FJ5 A;  1WAJ A;  3NCI A;  3QES A;  4WE1 A;  4BWM A;  2RPI A;  3QLH A;  3V1Q A;  4CHP A;  5FRN A;  1YTA A;  1JLF A;  3NH1 A;  4M3W A;  4AHV A;  4E7I A;  2Z1J A;  3QIO A;  1RIL A;  4Q0B A;  2IS3 A;  4RW8 A;  5CYM A;  1NK7 A;  4FJK A;  3VN5 A;  4DFK A;  3AVH A;  1HRH A;  3QIP A;  3ZSO A;  3OVN A;  1JLB A;  1VSE A;  4HCC A;  2O4I A;  5HRN A;  1NJW A;  2XY8 A;  4W5Q A;  1JL1 A;  2X6N A;  4KFB A;  3AA2 A;  1BCO A;  1BIZ A;  3QIN A;  1S9E A;  4B8C A;  4JS5 A;  4B3O A;  1TL1 A;  4E3S A;  1HPZ A;  4IFY A;  5KRT A;  3U6F A;  1RT3 A;  1TL3 A;  2IGI A;  5KRS A;  4HTU A;  1RTJ A;  1X9W A;  1QS4 A;  5J2N A;  2YKN A;  1VSK A;  2YNI A;  1JKH A;  3QO9 A;  3VQA A;  1GOC A;  1WSH A;  3VQP A;  1J9A A;  2PYJ A;  3HK2 A;  3ZSV A;  3OYB A;  4J2D A;  3KLH A;  1NK5 A;  3AVL A;  3ZT0 A;  3MEE A;  1RDB A;  4DU4 A;  2E4L A;  3AA4 A;  3U3G A;  2KFZ A;  3TAP A;  2G8H A;  4OKE A;  4KB0 A;  4DS5 A;  3OS1 A;  5HLF A;  2Z1H A;  3L2R A;  3M8P A;  1YVU A;  4CJE A;  4PWD A;  1RT1 A;  3WNF A;  1CLQ A;  1C1A A;  1SKW A;  3RTV A;  2NUB A;  4W5T A;  2A1S A;  3QNO A;  1BHL A;  1U48 A;  3EZ5 A;  3QEX A;  3SUN A;  4CF1 A;  2OZM A;  4H8K A;  4NYN A;  4QCL A;  1RBT A;  4M3U A;  4AHU A;  2Y1J A;  1KTQ A;  1RT4 A;  2XRI A;  1TK0 A;  4NCA A;  1IKX A;  3AA3 A;  1NOZ A;  3RMC A;  3V4I A;  4M3R A;  5HRR A;  4JLH A;  4DTU A;  1TGO A;  2JGU A;  2G8I A;  3WNE A;  3I0R A;  4I2P A;  1KVB A;  1QQC A;  1CZ9 A;  1RBR A;  3NF8 A;  3O4Q A;  1UOC A;  2VG7 A;  5HRS A;  4FLW A;  4DFP A;  4DFJ A;  3VQ8 A;  4BE2 A;  4O0I A;  1HNV A;  2B5J A;  2YHA A;  1JLG A;  1WSI A;  2DY4 A;  5SZT A;  3LPT A;  3AVI A;  1ZBH A;  3C6T A;  2ZD1 A;  3AO2 A;  3DLR A;  3ZT1 A;  3HP9 A;  3K58 A;  3ASM A;  3MXI A;  4KV8 A;  2G8U A;  4B9U A;  4O44 A;  5KI6 A;  3KLG A;  3RR8 A;  4B08 A;  3OY9 A;  4OLA A;  4RW9 A;  4PQU A;  1LV5 A;  3P5J A;  4BDY A;  4JRP A;  1KVC A;  1B92 A;  2WOM A;  4CJS A;  2GV9 A;  4E7H A;  4CCH A;  4PUO A;  2BE2 A;  4CEE A;  1X1P A;  4JS4 A;  4CEC A;  1NK8 A;  1KLN A;  2OYQ A;  4DSL A;  3NF9 A;  1RT5 A;  1VSH A;  1S1V A;  1S1W A;  1TKT A;  2VWJ A;  4CEF A;  1TVR A;  4FK2 A;  2HHT A;  3HP6 A;  4OGC A;  3O3H A;  4FW1 A;  3SCX A;  1U4B A;  3KD1 E;  4DG1 A;  1J53 A;  4CEQ A;  4RW4 A;  3AO4 A;  1VK0 A;  3CM5 A;  3TAR A;  4J2B A;  3S3N A;  3SQ1 A;  2HND A;  3OS0 A;  3OYK A;  4FJ9 A;  2HMI A;  1HYZ A;  1BI4 A;  3CM6 A;  3NGY A;  4ICL A;  4OGE A;  3O3G A;  3SPZ A;  1TKD A;  4QOZ B;  2HHV A;  4KHS A;  2DTU A;  1C0U A;  4FM0 A;  4C8O A;  1SV5 A;  4FZZ A;  4B9N A;  2FBT A;  3HST B;  3LP1 A;  4KTZ A;  2XHB A;  4ID1 A;  1TKX A;  4CF8 A;  4OKK A;  4HUF A;  3V1O A;  4C8L A;  1LAV A;  1S1T A;  1Z25 A;  1JLQ A;  3D45 A;  4DSJ A;  3MED A;  3TAF A;  2P1J A;  2X74 A;  3HT3 A;  2XY7 A;  4FM2 A;  1NKE A;  5HRP A;  1S9G A;  1XWL A;  1ZBF A;  4HHT A;  1XI1 A;  1RDD A;  4KI4 A;  4XIU A;  2QXF A;  3THV A;  3AO1 A;  3P83 D;  2G8K A;  1BIU A;  2HNZ A;  1U04 A;  3OYJ A;  4OJR A;  2OPS A;  4BE1 A;  5DK5 A;  1J5O A;  4CHY A;  4E19 A;  4HUG A;  3CQ8 A;  1I3A A;  3KD5 E;  4J2A A;  3OYI A;  3KLF A;  4FCY A;  4FJX A;  3V9W A;  1BI4 B;  5I42 A;  1VSL A;  4AHR A;  4E7L A;  4CJ3 A;  5C24 A;  3QEV A;  1NKC A;  3AVC A;  1NK4 A;  3VQ6 A;  4CFC A;  1IKV A;  1WSJ A;  2EX3 A;  4GMJ B;  4IDK A;  4FLZ A;  1NK9 A;  3K57 A;  1RT2 A;  3NBP A;  3TAM A;  4KHW A;  5CZ2 A;  3HVT A;  4DTS A;  3DI6 A;  3K2P A;  2E6M A;  5C25 A;  3O3F A;  3K5M A;  3CFR A;  3V6D A;  5CZ1 A;  3SQ4 A;  1S1U A;  2Q3S A;  5EU7 A;  2OZS A;  3HPO A;  4CK2 A;  4FLX A;  3HO1 A;  3IS9 A;  3DMJ A;  1IO2 A;  3KKS A;  1NKB A;  3OYD A;  3VA3 A;  3DLG A;  4IG3 A;  3CFP A;  3ZT2 A;  3D0P A;  4AIL C;  4DSI A;  1S1X A;  3V1R A;  1ZBI A;  3P1G A;  3DOL A;  3KLI A;  4CHQ A;  4CJP A;  2WON A;  4HVJ A;  4DMN A;  4KHN A;  4EZ9 A;  1ASW A;  4CK3 A;  1WNS A;  1U49 A;  1QTM A;  4FJI A;  3NGI A;  4FJM A;  2KTQ A;  1TAU A;  1TKZ A;  1HMV A; 
#chains in the Genus database with same CATH topology
 3NAE A;  3O4N A;  2ZJR L;  4BQZ A;  3L3V A;  4A5B A;  1BU6 O;  5MLC Q;  1SL2 A;  4GW6 A;  4CGD A;  4FLY A;  4LH5 A;  4EP4 A;  3MN9 A;  3OS2 A;  5D3G A;  2YNG A;  4H5V A;  3VQD A;  4JK9 A;  1WBB A;  1VQL N;  1VSD A;  1KFD A;  2FXU A;  4IOX A;  4MDB A;  3OBW A;  2HBK A;  1IBM K;  2QWL A;  4HTL A;  2QWP A;  1RTD A;  1X3M A;  1F21 A;  4NB4 A;  2O8D B;  3L2W A;  3ZX0 A;  4CJL A;  3HM9 A;  1RNH A;  3CD6 N;  3OYA A;  1KCF A;  1QHA A;  1N34 K;  1NU0 A;  5AQS A;  1N33 K;  3DOK A;  1GLB G;  1MWM A;  1ILY A;  4C8M A;  3J8A A;  4B1X B;  4L3Q A;  4LY7 A;  2F4V K;  3H45 C;  3S3M A;  3SZ2 A;  3PSF A;  3CME N;  4Z4H A;  1K6Y A;  4AHC A;  1YAG A;  3H46 O;  1IBK K;  1EWR A;  3CJ9 A;  1J54 A;  1GLL O;  5M1N A;  4FJG A;  4V19 S;  3CCE N;  3EEQ A;  3OYG A;  3VA0 A;  4H5R A;  2P9I B;  5HRO A;  5KTQ A;  1EP4 A;  1HYV A;  4WQ5 C;  3VEY A;  1GOB A;  1NK0 A;  4O8U A;  4FLU A;  1IG9 A;  4AHT A;  5ADX H;  5DM6 L;  5AZJ B;  2PAV A;  1CXQ A;  3OJS A;  4RW7 A;  2A41 A;  4CZI A;  4IFE A;  4C8N A;  2GWK A;  4RW6 A;  1M90 O;  4LF9 K;  4F2S A;  1RTH A;  4M41 A;  3NH0 A;  4JD2 B;  2XO7 A;  1KRP A;  2HHQ A;  5M1P A;  3PUF A;  1BUP A;  4GKJ K;  1LWF A;  1ITG A;  2ASO A;  3B8A X;  4Z4E A;  4MFB A;  3LM9 A;  4CFB A;  4BRG A;  2QXL A;  5DM7 L;  1DKG D;  1QQM A;  2HNY A;  2V7Z A;  1S6P A;  1C0F A;  3O9Q A;  1T03 A;  5JLF A;  4X64 K;  3DXM A;  2YNH A;  5J2P A;  3SJJ A;  2QWO A;  3DRR A;  1TK8 A;  1W9H A;  1BOT O;  3VQQ A;  4LF6 K;  1Z6R A;  3FFK B;  3G10 A;  4MQ3 A;  4CED A;  3F73 A;  1BWF O;  5I9E B;  1HKC A;  3KTQ A;  4Z4G A;  3NGZ A;  5BRH A;  3KK3 A;  3MXJ A;  4FO0 A;  4FM1 A;  1W97 L;  1BIS A;  3MCA B;  4ILG B;  4W5R A;  3SNN A;  2E20 A;  3SPY A;  4ZTF A;  3VOV A;  2KW4 A;  4DHY A;  5FRM A;  1A5X A;  2I7N A;  1U2V B;  2IAJ A;  3L4I A;  3FGU A;  4JK7 A;  1JXB A;  3MCP A;  1GLD G;  3I8B A;  2HHX A;  3F9M A;  3LAL A;  1RDA A;  3VQB A;  5HL7 L;  3O1W A;  1QZ5 A;  4CES A;  3KKR A;  4DV2 K;  2ZJP L;  3G6E N;  3D2F A;  1BA0 A;  2P9K A;  2ZQB A;  2YKM A;  1EXQ A;  3OYE A;  4YOU A;  1S6Q A;  4BQL A;  3EO3 A;  2G8W A;  3GL1 A;  4BRC A;  3EYZ A;  2FBV A;  3RR7 A;  4IDH A;  2WBN A;  4K42 A;  1YT3 A;  1ESV A;  1VSF A;  2O4G A;  3AVJ A;  2XY5 A;  3ZSY A;  2QKK A;  2DFH A;  1TAU A;  1KVA A;  1EET A;  4I9L A;  1T7P A;  4JD2 A;  5BN9 A;  3AY9 A;  5AQT A;  4FZX C;  4BR4 A;  5J2M A;  2PZS A;  2NRZ A;  3LL3 A;  1RBS A;  1N6Q A;  2OCE A;  4KH6 A;  3CG7 A;  3DM2 A;  1NMD A;  2YNF A;  4FWN A;  3KWI A;  1BQN A;  3I8D A;  4Z4C A;  2O8B B;  4H0V B;  2D5R A;  2A6A A;  3C0B A;  4H0Y B;  5EVZ A;  3ISN C;  3A8Y A;  4KHQ A;  2NLX A;  3CCL N;  4BRF A;  3RSE B;  3IG1 A;  1O1W A;  1FKO A;  5BRF A;  1JLA A;  3D2E B;  3LP3 A;  4O5F A;  2HOE A;  3FFI A;  5A2Q O;  1NGD A;  5AFU H;  4E7K A;  1OH5 A;  1XHX A;  3WXI A;  3B6P A;  3NH2 A;  3OYL A;  4J2E A;  1QHT A;  3LAK A;  3TTF A;  2P9N B;  1RDC A;  3JSM A;  1NK6 A;  3I56 N;  2D4W A;  5IWA K;  4CFD A;  3L2U A;  3QNN A;  3OBY A;  1Q9Y A;  4DU1 A;  3QEW A;  3AAQ A;  2E2O A;  4J8F A;  1LOT B;  5C2F A;  3EL2 A;  3QB0 A;  1S5J A;  2ATQ A;  5F2R A;  2BDP A;  1U6Z A;  1YF5 L;  5ELZ A;  4E1M A;  2NNW A;  3U3Y A;  1VQM N;  3E01 A;  5EY4 A;  4L8R B;  4CZF A;  5J1E A;  4NCG A;  5BR9 A;  2G8F A;  4DTO A;  1UAX A;  1NGB A;  3HPH A;  4Q5V A;  1L5U A;  4CER A;  4LD0 A;  5AQI A;  1L3U A;  2OPQ A;  3TAN A;  1Z26 A;  3SV4 A;  4HUE A;  3L4Q A;  5AQL A;  2RPI A;  3VF2 A;  3O8M A;  4GVE A;  4B3R K;  1XNQ K;  4OPA A;  5KPR A;  1C0G A;  3CPW M;  3VES A;  5CYM A;  1NK7 A;  2UUA K;  3VN5 A;  5GAD P;  1TUU A;  3SBT A;  3ZSO A;  3OVN A;  4HCC A;  4W5Q A;  2X6N A;  5AFU A;  1BIZ A;  4JS5 A;  3Q7C A;  4E3S A;  1HPZ A;  3EN9 A;  2IGI A;  1QS4 A;  3E9O A;  3SUO A;  3ATV A;  3BUZ B;  3QO9 A;  1GOC A;  3VQP A;  3HK2 A;  3OYB A;  4J2D A;  3AVL A;  3AA4 A;  4YY3 K;  3OS1 A;  1OKJ A;  5AZI B;  5M1O A;  3T7Z A;  4PKH A;  3WNF A;  3KVG A;  5BPM A;  3RTV A;  2NUB A;  2A1S A;  1BHL A;  3WXJ A;  3EZ5 A;  3QEX A;  3SUN A;  4H8K A;  4NYN A;  3DAW A;  4M3U A;  4JN4 A;  1TK0 A;  1VQN N;  2XRI A;  3FZF A;  4NCA A;  1IKX A;  3RMC A;  5B8H A;  3ZET B;  4JNE A;  4I2P A;  2P9U B;  3BZC A;  1UOC A;  5HRS A;  1P90 A;  3I55 N;  4H03 B;  3LPT A;  4YOY A;  2O8E A;  4MO5 A;  2Q36 A;  2ZD1 A;  3MXI A;  5BRD A;  3RR8 A;  4OLA A;  3VGL A;  4RW9 A;  4JRP A;  2WOM A;  2IVO A;  5FLX O;  2GV9 A;  4K0K K;  4XH4 A;  4CEC A;  1NK8 A;  5AQR A;  4DV1 K;  1S1V A;  1S1W A;  4CEF A;  2HHT A;  2KKZ A;  4LF8 K;  4FW1 A;  1RGI A;  4BGA A;  4YOW A;  3MWT A;  4DG1 A;  2CGK A;  2QWM A;  2HND A;  3L0Q A;  3VGK A;  3OYK A;  3MN6 A;  1HYZ A;  5AQJ A;  5TKW A;  2HHV A;  1MA9 B;  3TSP A;  1BG3 A;  3FLC O;  1R59 O;  4C8O A;  4B9N A;  5AZJ A;  2FBT A;  5BPL A;  3LP1 A;  4H5T A;  4ID1 A;  3TU5 A;  4F9O A;  3TAF A;  3CI5 A;  5HRP A;  1XWL A;  4HHT A;  1BA1 A;  1KAZ A;  2QXF A;  3EE8 A;  3THV A;  3AO1 A;  3P83 D;  4XH5 A;  1J5O A;  3ID6 A;  2P9S B;  4JKD A;  4H0P A;  3CQ8 A;  3OYI A;  2A3Z A;  2IIR A;  4AHR A;  1NK4 A;  4CFC A;  1WSJ A;  4IDK A;  3T69 A;  2QI2 A;  1RT2 A;  4AM6 A;  3O3F A;  1N32 K;  4YDU A;  1S1U A;  5EU7 A;  4FLX A;  3L6Q A;  4IG3 A;  4AIL C;  4CZM A;  2I7P A;  2FF3 B;  4OO1 J;  1YIT N;  3DOL A;  4CJP A;  3EKS A;  2WON A;  3MX2 A;  3R6M A;  5C12 A;  4KHN A;  4EZ9 A;  4FJI A;  4FJM A;  3O9U A;  3NGI A;  2F8S A;  4G1Q A;  1RDW X;  4CI6 A;  1XMO K;  4DWI A;  4FOE A;  2JLE A;  1ZYQ A;  4F4K A;  3DRP A;  1D9F A;  4B9T A;  1SUQ A;  4BY9 C;  4DSF A;  1IV0 A;  2OPP A;  2HVH A;  1D5A A;  3C95 A;  2ZE2 A;  3CJ1 A;  2OA8 A;  4B1V A;  2E2N A;  4FJJ A;  2IDO A;  4CJW A;  1VRT A;  1EWQ A;  4M3Y A;  2D0C A;  5JVH L;  4KKO A;  3R8E A;  4LF5 K;  3NVK A;  4IO9 L;  3C94 A;  5CY4 A;  4OPK A;  1V4S A;  1VQ6 N;  1GLF O;  5FPN A;  3RSE A;  3D6R A;  1XMQ K;  1OH6 A;  4CJT A;  3TAG A;  1GLE G;  3MEC A;  3G71 N;  2IVP A;  4B3M K;  4MO4 A;  1B9D A;  4N5S A;  3SJH A;  2O8D A;  4KPY A;  3H08 A;  4M3T A;  3SQ0 A;  5C42 A;  2DFF A;  2DFE A;  4CGI A;  4JI3 K;  2YHW A;  2Z1G A;  4RG8 A;  2FBY A;  1QSS A;  1IH7 A;  4KRF A;  4M7X A;  2E2Q A;  4QS8 A;  4CD1 A;  3RRG A;  4B9L A;  4FZY A;  3NE6 A;  2KHO A;  3ZEU A;  4BR2 A;  3CCR N;  3FZH A;  3PO4 A;  3S41 A;  2HHH K;  2RN2 A;  3BF3 A;  3KIO A;  4HCB A;  2ASP A;  2D0A A;  4OKJ A;  2BUP A;  1K8K B;  3K5N A;  4CIE A;  3JS6 A;  3IFR A;  3M8S A;  1VQP N;  1LW0 A;  2BTF A;  3G0Z A;  4CEO A;  3O1B A;  3DWL A;  3O6W A;  4TSX A;  1XNR K;  3AGR A;  1NGA A;  2Q31 A;  3EY1 A;  2HW3 A;  1KAY A;  2D0B A;  4A5A A;  2D0O A;  4W5N A;  1D8Y A;  4OLB A;  1QVF M;  2A5X A;  3DJC A;  3LP0 A;  5E41 A;  1J6Z A;  3AVB A;  4OPH A;  3VMF B;  1QQO A;  2E1Y A;  4FVU A;  1U2V A;  3LWL A;  3P31 A;  1KLM A;  2QTD A;  4W5O A;  2E5L K;  1C1B A;  2Q0U A;  4DR2 K;  4JYA K;  4DTM A;  1Q82 O;  2R7Y A;  5HP1 A;  2QWR A;  3C6U A;  1MDU B;  3NFA A;  2BGG A;  1B9F A;  3VEO A;  3VQE A;  2QWQ A;  4I9Q A;  2HF3 A;  2QW9 A;  4BE0 A;  4LSL A;  1MU2 A;  3KLE A;  5FRO A;  4BRQ A;  2G8V A;  1IKW A;  4B9M A;  3PIP L;  4FOI A;  1UA0 A;  2YV0 X;  4KH4 A;  4JHD A;  4B1W B;  3F2K A;  1HNW K;  3CF5 L;  3DLH A;  3CJC A;  3AO3 A;  4DTR A;  2HHW A;  3V9U A;  4BRO A;  2FSK A;  3CJA A;  4JRQ A;  5LMU K;  1NMN A;  1FKP A;  3AVA A;  1N5Y A;  1FXX A;  4ILH A;  4R79 A;  5BR8 K;  3VQ4 A;  1Z05 A;  3K9K A;  1W2B M;  4DQP A;  4KAZ A;  2I5J A;  1L3S A;  4CJ4 A;  4B8A B;  2BAN A;  3TTD A;  3A5N C;  2UXC K;  4A61 A;  4QAG A;  1DTQ A;  1XHZ A;  3CC7 N;  4EFH A;  3WT0 A;  4FWK A;  1TAQ A;  4CJ7 A;  1O13 A;  3VEW A;  3D7E O;  3LZJ A;  2GEL A;  3H3N O;  1T44 A;  3AV9 A;  3NF6 A;  4B9Q A;  4BC4 A;  3VGM A;  5AQH A;  1RTI A;  4AH9 A;  3PIO L;  3SBG A;  4CEB A;  2PY5 A;  3SYZ A;  2ZJQ L;  1Q7Y O;  4FW2 A;  1M1K O;  4N56 A;  4CGH A;  1NGE A;  4NCB A;  1FW6 A;  3DLB A;  4N47 A;  5KPT A;  4FK4 A;  2QM1 A;  1W7A A;  3QEP A;  3U4L A;  4CW7 B;  2P51 A;  4I6M A;  5CHI A;  2RKI A;  4M3Z A;  4DB3 A;  4R5P A;  3SV3 A;  5AQV A;  1UA1 A;  1T3V A;  3ZCM A;  4FWR A;  4BVP A;  2IOC A;  5LMN K;  4FJN A;  4CJ5 A;  3SI6 A;  3M8R A;  4M45 A;  2FSN A;  3LZI A;  4DQR A;  4KHP K;  2H3G X;  4FJL A;  4DQS A;  3U9D A;  1LAW A;  5JVG L;  4IEE A;  4KI6 A;  2YI1 A;  4CK1 A;  4B3S K;  3DXM B;  1HUX A;  1H1V A;  3FZL A;  3ZT4 A;  2P9U A;  3GG4 A;  3W0L A;  2PYL A;  2NRT A;  3AA5 X;  3SUQ A;  3CET A;  1V4T A;  4O4G A;  4E0D A;  5C10 A;  4IO8 A;  4CJU A;  4DQI A;  4OX9 K;  3TI0 A;  2P5O A;  1Q8I A;  4BRK A;  4DTP A;  4H0X B;  3OJU A;  2FC0 A;  4K8X A;  3JAM O;  3OW2 M;  1BGX T;  3OYN A;  2GBZ A;  3P4I A;  3CC2 N;  4B1Z A;  2GUI A;  4IJA A;  4ZTJ A;  3M3Z A;  3SMP A;  4CF2 A;  2YHB A;  1XC9 A;  3RWU A;  3VQ9 A;  1W0H A;  4WFN L;  4DUY K;  3U8X A;  3WXK A;  5FPE A;  5GAH P;  3UKU B;  2HB5 A;  1U45 A;  3CYM A;  1K9M O;  2PBD A;  4CHZ A;  1Y97 A;  3S9H A;  4X66 K;  4BGB A;  4CF0 A;  4JI6 K;  1YXQ A;  3OA9 A;  4QS7 A;  3PV8 A;  3BP8 A;  4Y0W A;  4FWS A;  4LC9 B;  4F3T A;  2WTU A;  4JV5 K;  4JI4 K;  3SAG A;  1YIJ N;  4WQ5 A;  3NCI A;  3C6A A;  4WE1 A;  3QES A;  4BWM A;  4GV3 A;  3V1Q A;  4CHP A;  5FRN A;  1YTA A;  2AA4 A;  3QIO A;  4E7I A;  1RIL A;  1HRH A;  4O8K A;  1VSE A;  1WUA A;  4LFA K;  5HRN A;  3MWP A;  2GTD A;  2Q97 A;  3G4S N;  1JKH A;  3M1F A;  3ZSV A;  5AQK A;  1NK5 A;  3ZT0 A;  3MEE A;  4CZH A;  4DU4 A;  2E4L A;  3U3G A;  4NO7 A;  3LDQ A;  3TAP A;  4OKE A;  1NNE A;  4KB0 A;  4CZK A;  1X9J A;  4H5N A;  3L2R A;  1C1A A;  1SKW A;  3QNO A;  4I6M B;  4CF1 A;  4X65 K;  3E66 A;  3ID8 A;  4FWP A;  4JKG A;  3V4I A;  5HRR A;  4YDU C;  2P9N A;  1TGO A;  2JGU A;  1QQC A;  2AP1 A;  2P9S A;  4JHD B;  3OTO K;  1CZ9 A;  1RBR A;  3NF8 A;  3LDO A;  1NGJ A;  2VG7 A;  4FLW A;  2VGN A;  4DFJ A;  3VQ8 A;  4O0I A;  2YHA A;  3D2F B;  1WSI A;  2DY4 A;  3VET A;  3GOI A;  1E4G T;  3C6T A;  3AO2 A;  3HP9 A;  1VQ9 N;  2G8U A;  4U67 L;  4KV8 A;  4B9U A;  1HX1 A;  5KI6 A;  5AQY A;  3OY9 A;  1LV5 A;  3QBX A;  1DT9 A;  2OTJ N;  2BE2 A;  2P9L A;  4JKC A;  3NF9 A;  5GIN A;  4JI5 K;  3QDK A;  1RT5 A;  1VSH A;  3UKR A;  1TVR A;  1JCE A;  3PLA A;  4RW4 A;  2O8C A;  4YOR A;  1VK0 A;  3SAH A;  3PSI A;  3CHW A;  3ENH A;  4FJ9 A;  3CM6 A;  3THW A;  4OGE A;  4JI0 K;  3FR0 A;  1C0U A;  3W3D A;  4BRL A;  4DR1 K;  1SV5 A;  3SAF A;  2ZM6 K;  2XHB A;  4BG9 A;  2E8A A;  1HLU A;  3J7Z O;  5AQZ A;  4LFC K;  1LAV A;  3C7N A;  1Z25 A;  1JLQ A;  3QML A;  2XY7 A;  4FM2 A;  1ATR A;  3MMV A;  2O8E B;  1XI1 A;  5F0X A;  3C7N B;  1Q18 A;  5GAE P;  3ZET A;  1GLJ O;  1RDD A;  4KI4 A;  4XIU A;  3OYJ A;  2OPS A;  2W40 A;  3GBT A;  3EE9 A;  3T1H K;  4Z94 A;  3CXC M;  4A59 A;  1HNX K;  4J2A A;  2HBL A;  3V9W A;  4A62 A;  4CJ3 A;  3QEV A;  3GDQ A;  2NRW A;  4IOC L;  2EX3 A;  4FLZ A;  3K57 A;  3HVT A;  3E1Y A;  2YJF A;  4H0T B;  4G9Z A;  4DTS A;  3K2P A;  3CFR A;  5CZ1 A;  2Q3S A;  2OZS A;  2HMP A;  3HPO A;  4CK2 A;  3HO1 A;  5JLH A;  1NKB A;  3VA3 A;  3ZT2 A;  4DSI A;  1S1X A;  2WUS A;  3KLI A;  4NLB A;  2P9I A;  4CK3 A;  3U9Z A;  5ADX A;  2UUB K;  3HOT A;  1J5E K;  1ATS A;  4I7F A;  4FK0 A;  3CC4 N;  4CE9 A;  3HJF A;  1WSF A;  1XUP O;  4WQ4 C;  1IJJ A;  3O08 A;  3WQU A;  3OHR A;  5E26 A;  3L2V A;  2RE2 A;  4BRP A;  5JMV A;  2F8T A;  1VAZ A;  1JXE A;  3B6O A;  1TK5 A;  4UQG A;  3Q7B A;  1DTT A;  3MN7 A;  4NXM K;  3RVC A;  1JCF A;  2J4R A;  3QIC A;  1YHQ N;  2P9P A;  1DGK N;  2IC3 A;  4Z0U A;  4CHO A;  4UY8 O;  4HWI A;  3BY5 A;  3NMU A;  3H3O B;  4E1J A;  4OVL A;  3HM8 A;  1SKS A;  1HYS A;  3IAY A;  3RRH A;  2X6S A;  3P38 A;  4DFM A;  1UWB A;  2CGL A;  4KHY A;  3VTH A;  2RF2 A;  1BL3 A;  3HI0 A;  5CE3 A;  3AGK A;  4FJ8 A;  1WAF A;  1FK9 A;  3LP2 A;  3SUP A;  3IMX A;  1HQU A;  4CIG A;  3PX6 A;  2Q1N A;  3ZSZ A;  3TAQ A;  2ITG A;  1HQE A;  3NF7 A;  3VQ7 A;  1IBL K;  3EKU A;  1KC8 O;  1ASV A;  3AVM A;  2KLA A;  5FDL A;  5AQP A;  4GKK K;  4XH1 A;  3K5L A;  3DXK B;  3VQ5 A;  4JKE A;  3THY A;  2ZWH A;  4IEI A;  1U47 A;  3H1V X;  3VER A;  3NDK A;  4ELU A;  3EZW A;  4JK8 A;  4JI2 K;  3CQY A;  3VF4 A;  4BR9 A;  1LCU A;  3CCM N;  4CHN A;  4KO0 A;  4WCE L;  2KQ2 A;  3N4Q A;  3THX B;  1GLC G;  4DV3 K;  1KQS M;  4M3X A;  3ULE A;  3HBT A;  2OPR A;  1NOY A;  1TYQ A;  4KTQ A;  1WOQ A;  1CXU A;  2D0P A;  4EIA A;  1X9S A;  4DV4 K;  4AHS A;  2GUP A;  3LWM A;  5T7B A;  3T1Y K;  4IBN A;  1D9D A;  4KTW A;  3CCJ N;  1VQ4 N;  5F1X A;  4H4M A;  4H0O A;  4CBX A;  2UXD K;  3G25 A;  4BRA A;  4NXN K;  5JS2 A;  2A40 A;  3SLC A;  4YOT A;  1WLJ A;  4WYB A;  4E1N A;  3VEZ A;  2YHX A;  4I2Q A;  1E4F T;  1QSY A;  3LAN A;  4ZHR A;  4BRD A;  3L8B A;  5AZI A;  4E89 A;  2HHS A;  1RCH A;  3OYC A;  1YTU A;  1RBV A;  1VSJ A;  3TR8 A;  4H5W A;  4CVN E;  4DQQ A;  1IKY A;  2UU9 K;  1ZBL A;  4M63 C;  4CJQ A;  1CZB A;  4LFB K;  4N76 A;  2E88 A;  3J80 O;  3OYH A;  1HJR A;  4CF9 A;  5M1K A;  3VF6 A;  2EHG A;  4DTN A;  1TYQ B;  4O5B A;  3WXM B;  1EX4 A;  4DTX A;  2VQF K;  4B1U B;  1RT7 A;  1T6D A;  4BAC A;  1NJZ A;  2B4J A;  2E2P A;  3BZK A;  3PX4 A;  1SL0 A;  4BDZ A;  1WSE A;  2GWJ A;  2VG5 A;  3A5L C;  1RBU A;  2QA4 N;  3R1X A;  4FVM A;  5LJW A;  3S3O A;  3BDP A;  1T05 A;  5EXW A;  3FZK A;  3HPG A;  4DR7 K;  2O8C B;  3DLK A;  3T1A A;  3ZT3 A;  3KHY A;  1TUY A;  2ITM A;  4FLV A;  1ZXO A;  2ETJ A;  1C0T A;  2Y1I A;  4KHU A;  1SAZ A;  2NZT A;  2VCP A;  2QK9 A;  4PL7 A;  1NJY A;  3HTV A;  1QVG M;  3PX0 A;  3OYF A;  1K8A O;  3MX5 A;  3SK3 A;  3ATU A;  2OAN A;  1G15 A;  4FYD A;  4C23 A;  2HBJ A;  3ZX3 A;  1T6C A;  1NJX A;  3AVF A;  3ZSQ A;  4DU3 A;  2CGJ A;  3TWH A;  2A1R A;  4DR4 K;  3HVR A;  1JJ2 M;  1KXP A;  4DUZ K;  1HKB A;  4GVM A;  5TKY A;  5I3U A;  4CGJ A;  4ILJ A;  2E6L A;  1WBD A;  2VQE K;  1Q81 O;  3UKU A;  3ZSW A;  4DV5 K;  3LM2 A;  2NRH A;  3KZB A;  5J2Q A;  1Y64 A;  3QBW A;  1REV A;  1VRU A;  4CJR A;  2O8F B;  4JKB A;  3NVM A;  3V9X A;  4DLE A;  4IWV A;  2O8F A;  3ALY A;  1OH8 A;  4JI8 K;  4KBO A;  3KJV A;  4BRN A;  3SMS A;  3AO5 A;  3AVN A;  3TSU A;  2LSN A;  1K8K A;  1BQM A;  3WNG A;  4FJ5 A;  3QLH A;  4DR6 K;  2F9T A;  4EHU A;  5AR0 A;  4M3W A;  3LDL A;  4Q0B A;  2Z1J A;  4BG8 A;  1NBW A;  4RW8 A;  1EQY A;  1SS6 A;  4K25 A;  4A2A A;  4DFK A;  2VGM A;  3QIP A;  2O4I A;  1I94 K;  1NJW A;  5AJ3 K;  4KFB A;  3AA2 A;  3QFU A;  4B8C A;  4B3O A;  1NJI O;  2Q0R A;  3U6F A;  1RT3 A;  5KRS A;  1RTJ A;  1X9W A;  3TSQ A;  5M1F A;  1VSK A;  2YNI A;  1NM1 A;  1WSH A;  3CMA N;  1J9A A;  2WFB A;  2PYJ A;  2V7Y A;  3KLH A;  1RDB A;  3O80 A;  3ENO A;  4DS5 A;  5HLF A;  4FSV A;  2Z1H A;  4CJE A;  1RT1 A;  1CLQ A;  5EOY A;  3CJB A;  1U48 A;  2NRR A;  1XC3 A;  2YX6 A;  1RBT A;  4DQ8 A;  5LY3 A;  4K43 A;  1KTQ A;  1RT4 A;  4WQ4 A;  1NOZ A;  3AA3 A;  1OVY A;  4M3R A;  4CZJ A;  3WNE A;  3ENB A;  3UE5 A;  4WF9 L;  3HZ6 A;  4JEP A;  4BE2 A;  1OH7 A;  2ZGZ A;  1HNV A;  1CZA N;  2B5J A;  4XEI A;  5SZT A;  3AVI A;  1G99 A;  3ZT1 A;  4DSL A;  3ASM A;  4GV6 A;  4B08 A;  4BVO A;  4PQU A;  2V52 B;  4E7H A;  1GLA G;  1B92 A;  1KVC A;  4CJS A;  4CCH A;  4CEE A;  5H1S Q;  4JS4 A;  1KLN A;  1HNZ K;  1JCG A;  3R3L A;  5LL6 Z;  2OYQ A;  4LF4 K;  4EHT A;  2F7T A;  2VWJ A;  2W41 A;  4FK2 A;  4DR5 K;  3HP6 A;  3O3H A;  3SCX A;  3KD1 E;  4FPA A;  4CEQ A;  3AO4 A;  3CM5 A;  3O9R A;  3H6E A;  3TAR A;  4J2B A;  5FPM A;  2HMI A;  1TKD A;  3O3G A;  4QOZ B;  2DTU A;  3J7Y P;  4FM0 A;  3THY B;  2ZGY A;  3C65 A;  1ATN A;  3HST B;  4CBW A;  3J81 O;  4B1Y B;  4CF8 A;  2FLO A;  3V1O A;  4C8L A;  2ZF5 O;  1S1T A;  4B3T K;  2P1J A;  3HT3 A;  4U7B A;  1ZBF A;  2D1K A;  4BRI A;  5LJV A;  1S22 A;  1KAX A;  2RHK A;  2G8K A;  4JKG B;  1U04 A;  4E19 A;  4YOX A;  2HF4 A;  4BC5 A;  4FJX A;  4FCY A;  3VPZ A;  4E7L A;  3TTC A;  5C24 A;  4DR3 K;  1NKC A;  4FL9 A;  3AVC A;  5KQD A;  1IKV A;  1NK9 A;  3NBP A;  1VHX A;  5CZ2 A;  4M7Y A;  4PKI A;  3DI6 A;  5C25 A;  3K5M A;  3O9T A;  3V6D A;  3IS9 A;  3KKS A;  3DLG A;  3CFP A;  3D0P A;  2NRV A;  1ZBI A;  1YUW A;  3P1G A;  3ZYY X;  4CHQ A;  4DMN A;  3M5R A;  1U49 A;  2VYP A;  3DXK A;  1QTM A;  3LDN A;  1HMV A;  3RMB A;  4RWT A;  3TAE A;  2FBX A;  4Y1D A;  5BN8 A;  3ITH A;  2KZM A;  2Q2R A;  2HBM A;  5K14 A;  4EZ6 A;  4DKW A;  1K73 O;  3KWG A;  3MDQ A;  4K8Z A;  4DTJ A;  3IKM A;  3KK1 A;  3L2Q A;  3PY8 A;  4ISE A;  3KK7 A;  3CFO A;  4H4O A;  1VQ5 N;  3A2F A;  4BR7 A;  3I0S A;  2P5G A;  5SWM A;  3D2E A;  5AQG A;  4WFB L;  1KFS A;  1LWE A;  2X78 A;  1L3V A;  2HHU A;  3OYM A;  2HVI A;  1NGC A;  4MDA A;  1P8Z A;  1X9M A;  4F3O A;  3VQC A;  4ISG A;  3TPQ A;  1C0M A;  3K5O A;  1SL1 A;  1HPM A;  3RMD A;  4ELV A;  1JLE A;  3DRS A;  1E3M A;  2KZZ A;  4GY2 B;  1C6V A;  3LDS A;  4CZG A;  4AQY K;  4CIF A;  1WSG A;  1HNI A;  3UIQ A;  3A0I X;  3HYF A;  5M1Q A;  1JL2 A;  4MLE A;  4DSK A;  1WB9 A;  3AVG A;  1N8R O;  2B6A A;  2QKB A;  1D4X A;  4IZ9 A;  2QEX N;  5AQN A;  5AQW A;  5IT9 O;  4CGF A;  2YHY A;  4CFA A;  3LPU A;  4CEZ A;  3QFP A;  2AJQ A;  5AQO A;  1S3X A;  3LDP A;  4FJ7 A;  1VQO N;  1Q86 O;  4BRH A;  3WQT A;  4ID5 A;  2VG6 A;  4YNQ A;  4DSE A;  2NRX A;  5C2D A;  4JKA A;  3JXU A;  3CER A;  3SQ2 A;  4B9V A;  3MK6 A;  5AQX A;  1YVN A;  3THW B;  3T3F A;  4C8K A;  3HL8 A;  3P39 A;  5BPN A;  1VQK N;  4A2B A;  3CCV N;  1L3T A;  1A5W A;  3L3U A;  3F9K A;  3UKR B;  1QE1 A;  4DLG A;  1LW2 A;  4PA1 A;  4CEA A;  3V81 A;  1I39 A;  1OVQ A;  1C1C A;  1WN7 A;  4F2R A;  5JS1 A;  1Q9X A;  4GV9 A;  3MN5 A;  4BR5 A;  2KFN A;  2E1Z A;  4Y1C A;  1N36 K;  4KB1 A;  5DMR A;  2FSJ A;  3QET A;  3F5T A;  4AM7 A;  2YJE A;  1KSP A;  3WUH A;  5GIP A;  3J7A P;  1ASU A;  1NWK A;  2JWL A;  4CD3 A;  2QWN A;  3UB5 A;  4BC3 A;  4PHT X;  4QS9 A;  5C15 A;  3V9S A;  4Z4F A;  1EKE A;  4X62 K;  4KH5 A;  2Z1I A;  4A57 A;  2O8B A;  3LAM A;  3THX A;  3K59 A;  2F96 A;  3M8Q A;  4O0J A;  5KGX A;  5EX5 A;  2GEM A;  1T8E A;  1QSL A;  1RFQ A;  5HOO A;  3ZSR A;  2W6L A;  3KK2 A;  4JAX A;  3N4P A;  4EP5 A;  3HRG A;  4IKF A;  4C1N I;  3CCQ N;  1VSM A;  1VSI A;  3BGR A;  3WXL A;  1QQN A;  4F8R A;  4BWJ A;  2P9L B;  4CJK A;  2FF6 A;  5FPD A;  3ZX2 A;  4PY5 A;  1EO1 A;  5HBM A;  3DLE A;  3MAQ A;  4FXD A;  4GNI A;  5JIC A;  1BDG A;  3T19 A;  2BH1 A;  4FJH A;  3CPE A;  1ZBU A;  4M42 A;  4FWM A;  1LWC A;  3IUC A;  3VEN A;  1IG8 A;  2GX9 A;  2W6K A;  4CJF A;  1SZ2 A;  4B9S A;  4DF8 A;  4CZE A;  4KRE A;  1TV6 A;  5BRE A;  3RMA A;  3V9Z A;  3IRX A;  3QEI A;  1R0A A;  2W42 A;  3E9L A;  3HOS A;  4JI7 K;  4FLT A;  3VTI A;  4DV6 K;  4IFV A;  3MEG A;  3DYA A;  3ZSX A;  3A5O C;  2V51 B;  3AVK A;  4DF4 A;  2VWB A;  1YJ9 N;  1DLO A;  2WC9 A;  3ULD A;  2XY6 A;  4LH4 A;  4FPB A;  1VQ8 N;  4N41 A;  4IG0 A;  4RCH A;  3MXM A;  4FWQ A;  3C6H A;  3M6G A;  4CGG A;  2VWK A;  4BR0 A;  3A5M C;  4LSN A;  4O55 A;  4DV0 K;  3VEX A;  3NHG A;  1BCM A;  2YCH A;  1ZC6 A;  5GIO A;  1YI2 N;  1A5V A;  4RTF D;  3PO5 A;  4BDP A;  5KPZ A;  4YOV A;  3AAP A;  1NLV A;  3JYT A;  3HXM A;  1RT6 A;  4YFU A;  3CIP A;  3FE1 A;  3WNH A;  1SKR A;  2F9W A;  1GOA A;  4JKF A;  5KGW A;  2JWK A;  4BRE A;  4OPJ A;  3TAB A;  4PKG A;  4ELT A;  3VEV A;  3HSC A;  4E7J A;  1JLC A;  3WEE B;  4K41 A;  3BEX A;  1XQS C;  3CCS N;  3CCU N;  1BO5 O;  3WEE A;  4NYF A;  4Z4I A;  4CJV A;  3DLL L;  5CYQ A;  4CZL A;  4DS4 A;  1WAJ A;  3O5B A;  1JLF A;  4IXC A;  3NH1 A;  4AHV A;  1NGG A;  3FZM A;  2IS3 A;  4FJK A;  1FJG K;  3AVH A;  4IOA L;  1JLB A;  3H1Q A;  2XY8 A;  1JL1 A;  1BCO A;  3QIN A;  1S9E A;  4FWL A;  1TL1 A;  1HR0 K;  2IVN A;  4IFY A;  5KRT A;  3K9J A;  1TL3 A;  4HTU A;  5E84 A;  1DEJ A;  1X3N A;  5J2N A;  3QER A;  3VQA A;  2YKN A;  5AQU A;  3E9P A;  3I33 A;  2OTL N;  2KFZ A;  2UXB K;  2G8H A;  2P9P B;  3M8P A;  1YVU A;  2HST A;  4PWD A;  2A42 A;  3O9S A;  4W5T A;  3K0S A;  2OZM A;  4DV7 K;  4IJN A;  1QZ6 A;  4QCL A;  4AHU A;  4C1N K;  2Y1J A;  1KD1 O;  4CBU A;  4JLH A;  4DTU A;  1NGH A;  1SQK A;  2G8I A;  3I0R A;  1KVB A;  4ISF A;  3CQX A;  4NLC A;  5AQF A;  3O4Q A;  4DFP A;  1NGI A;  1JLG A;  2DPN A;  2ASM A;  1ZBH A;  4WFA L;  3K58 A;  3DLR A;  4O44 A;  3KLG A;  1ZBS A;  4FWO A;  3ZLJ A;  3O4W A;  3P5J A;  4BDY A;  4PUO A;  4PL8 A;  3CJ7 A;  1X1P A;  1HKG A;  1NGF A;  1RDU A;  3AAR A;  2PFU A;  1TKT A;  5AQQ A;  1NG9 A;  4OGC A;  1U4B A;  1VQ7 N;  1J53 A;  1HJO A;  5AQM A;  2UUC K;  3S3N A;  3SQ1 A;  3OS0 A;  3NGY A;  1BI4 A;  4ICL A;  3SPZ A;  4KHS A;  4JI1 K;  2CH6 A;  4FZZ A;  4KTZ A;  4AF1 A;  1TKX A;  5GAG P;  4OKK A;  4HUF A;  4YHH K;  4DSJ A;  3D45 A;  3MED A;  2X74 A;  1NKE A;  1S9G A;  3IDH A;  2UYT A;  3ULE B;  2P9K B;  1BIU A;  2HNZ A;  1MWK A;  5C0Y A;  4OJR A;  4BE1 A;  2CH5 A;  5DK5 A;  4CHY A;  1YJW N;  4HUG A;  3KD5 E;  1I3A A;  3GE1 A;  3KLF A;  5KQ8 A;  3ZEU B;  1BI4 B;  5I42 A;  1VSL A;  2EWS A;  3BF1 A;  3VQ6 A;  4GMJ B;  4LF7 K;  4EAH D;  3TAM A;  4KHW A;  4MLH A;  4BRM A;  2E6M A;  1S72 N;  3SQ4 A;  3R9P A;  3DMJ A;  1IO2 A;  3OYD A;  4JKH A;  4DCH A;  3V1R A;  1YJN N;  5CR4 A;  4BC2 A;  4HVJ A;  1ASW A;  1WNS A;  2KTQ A;  1TKZ A; 
#chains in the Genus database with same CATH homology
 3RMB A;  3NAE A;  3O4N A;  3L3V A;  4G1Q A;  4I7F A;  3TAE A;  4FK0 A;  4CE9 A;  2FBX A;  1WSF A;  4GW6 A;  4Y1D A;  1SL2 A;  4DWI A;  3ITH A;  2JLE A;  3HJF A;  1ZYQ A;  4F4K A;  3DRP A;  1D9F A;  4B9T A;  1SUQ A;  4CGD A;  2KZM A;  4DSF A;  3L2V A;  2OPP A;  5K14 A;  1D5A A;  4EZ6 A;  2HVH A;  3C95 A;  4FLY A;  2ZE2 A;  4LH5 A;  2OA8 A;  4FJJ A;  2IDO A;  4CJW A;  4EP4 A;  2F8T A;  3OS2 A;  5D3G A;  2YNG A;  4K8Z A;  4DTJ A;  1VRT A;  3KK1 A;  3L2Q A;  1JXE A;  3B6O A;  3VQD A;  2D0C A;  3CFO A;  4KKO A;  4H4O A;  3PY8 A;  3A2F A;  1TK5 A;  4UQG A;  1VSD A;  1KFD A;  1DTT A;  3C94 A;  5CY4 A;  3I0S A;  2P5G A;  5SWM A;  4OPK A;  1KFS A;  1LWE A;  2X78 A;  2IC3 A;  1L3V A;  3OYM A;  4Z0U A;  2HVI A;  2HHU A;  4CHO A;  1RTD A;  1X9M A;  4F3O A;  1F21 A;  3VQC A;  4CJT A;  3TAG A;  1C0M A;  3K5O A;  1SL1 A;  3L2W A;  3RMD A;  4OVL A;  4CJL A;  1JLE A;  3DRS A;  3MEC A;  4ELV A;  1SKS A;  1HYS A;  3IAY A;  3HM9 A;  1B9D A;  4N5S A;  2KZZ A;  1RNH A;  1C6V A;  3H08 A;  3RRH A;  2X6S A;  4KPY A;  4M3T A;  3SQ0 A;  5C42 A;  2DFF A;  3OYA A;  1KCF A;  2DFE A;  4CGI A;  3LDS A;  2Z1G A;  4RG8 A;  4CIF A;  2FBY A;  1WSG A;  1HNI A;  1QSS A;  3UIQ A;  3DOK A;  1IH7 A;  4DFM A;  4C8M A;  3HYF A;  4KRF A;  1JL2 A;  1UWB A;  4LY7 A;  4B9L A;  3RRG A;  3S3M A;  3SZ2 A;  4DSK A;  3NE6 A;  4FZY A;  4KHY A;  3AVG A;  4Z4H A;  1K6Y A;  2B6A A;  4AHC A;  2QKB A;  2RF2 A;  1BL3 A;  3PO4 A;  4FJ8 A;  2RN2 A;  4CGF A;  3KIO A;  4CFA A;  4HCB A;  1WAF A;  1FK9 A;  3LPU A;  3LP2 A;  3SUP A;  1J54 A;  4CEZ A;  2D0A A;  4OKJ A;  2AJQ A;  1HQU A;  4CIG A;  3PX6 A;  4FJG A;  3ZSZ A;  3K5N A;  4CIE A;  3OYG A;  3VA0 A;  3TAQ A;  2ITG A;  3M8S A;  5HRO A;  1LW0 A;  4FJ7 A;  1HQE A;  3G0Z A;  3NF7 A;  3VQ7 A;  1EP4 A;  4CEO A;  5KTQ A;  1HYV A;  1NK0 A;  1ASV A;  1GOB A;  3AVM A;  4TSX A;  4FLU A;  1IG9 A;  4ID5 A;  4AHT A;  2VG6 A;  5FDL A;  4YNQ A;  4DSE A;  3EY1 A;  2HW3 A;  3K5L A;  1CXQ A;  3VQ5 A;  3OJS A;  3SQ2 A;  4RW7 A;  2D0B A;  4W5N A;  1D8Y A;  4B9V A;  4OLB A;  1U47 A;  4C8N A;  3LP0 A;  4RW6 A;  3T3F A;  5E41 A;  4C8K A;  3HL8 A;  3NDK A;  4ELU A;  3AVB A;  4F2S A;  1RTH A;  4M41 A;  3NH0 A;  2XO7 A;  1KRP A;  3LWL A;  1L3T A;  2HHQ A;  1KLM A;  1A5W A;  4W5O A;  1C1B A;  3L3U A;  3PUF A;  3F9K A;  4CHN A;  4KO0 A;  1LWF A;  1ITG A;  1QE1 A;  1LW2 A;  2KQ2 A;  4PA1 A;  4DLG A;  4DTM A;  4CEA A;  3V81 A;  4Z4E A;  1I39 A;  2R7Y A;  5HP1 A;  1C1C A;  1WN7 A;  3C6U A;  4MFB A;  4CFB A;  4F2R A;  5JS1 A;  3NFA A;  4M3X A;  1Q9X A;  2HNY A;  2OPR A;  1NOY A;  2BGG A;  4KTQ A;  1S6P A;  1B9F A;  2KFN A;  4Y1C A;  3VQE A;  4KB1 A;  1CXU A;  1X9S A;  1T03 A;  2F8S A;  4I9Q A;  4BE0 A;  5DMR A;  4LSL A;  1MU2 A;  3QET A;  4AHS A;  3LWM A;  5T7B A;  2YNH A;  5FRO A;  4IBN A;  3KLE A;  1D9D A;  1KSP A;  2G8V A;  1IKW A;  4KTW A;  5J2P A;  3SJJ A;  4B9M A;  1UA0 A;  2YV0 X;  3DRR A;  1ASU A;  1TK8 A;  1W9H A;  3VQQ A;  4H4M A;  3G10 A;  4MQ3 A;  3V9S A;  4CED A;  4Z4F A;  3F73 A;  3DLH A;  1EKE A;  4Z4G A;  3KTQ A;  3AO3 A;  5JS2 A;  2Z1I A;  3NGZ A;  4DTR A;  1WLJ A;  3KK3 A;  3MXJ A;  3LAM A;  2HHW A;  4FM1 A;  3V9U A;  4E1N A;  1BIS A;  4W5R A;  4JRQ A;  3SNN A;  3AVA A;  1FKP A;  3K59 A;  2F96 A;  3M8Q A;  4O0J A;  5KGX A;  3SPY A;  4ZTF A;  1FXX A;  1N5Y A;  2KW4 A;  5FRM A;  4I2Q A;  3VQ4 A;  1A5X A;  1QSY A;  1T8E A;  2I5J A;  3LAN A;  4ZHR A;  4DQP A;  1QSL A;  1L3S A;  4KAZ A;  2IAJ A;  4CJ4 A;  3ZSR A;  4B8A B;  2BAN A;  3KK2 A;  1JXB A;  3L8B A;  4E89 A;  2HHS A;  2HHX A;  1RCH A;  4EP5 A;  3OYC A;  4IKF A;  3LAL A;  1RDA A;  1VSM A;  1DTQ A;  1VSI A;  4QAG A;  3VQB A;  1YTU A;  3BGR A;  4CES A;  1XHZ A;  3KKR A;  1RBV A;  1VSJ A;  3TR8 A;  4DQQ A;  4F8R A;  4BWJ A;  1IKY A;  4CJK A;  1ZBL A;  4CJQ A;  1CZB A;  1TAQ A;  4PY5 A;  4M3Y A;  2ZQB A;  4N76 A;  2YKM A;  5HBM A;  3DLE A;  1EXQ A;  3OYE A;  1HJR A;  3OYH A;  3MAQ A;  3LZJ A;  4CF9 A;  3AV9 A;  3NF6 A;  1S6Q A;  4FXD A;  2EHG A;  4DTN A;  4O5B A;  1EX4 A;  2G8W A;  4DTX A;  1RTI A;  4AH9 A;  1RT7 A;  4CEB A;  3T19 A;  4BAC A;  3EYZ A;  1NJZ A;  2FBV A;  3RR7 A;  4FJH A;  1YT3 A;  2PY5 A;  1ZBU A;  1VSF A;  2B4J A;  3SYZ A;  4M42 A;  2O4G A;  3AVJ A;  1LWC A;  2XY5 A;  3PX4 A;  1SL0 A;  3ZSY A;  4FW2 A;  2QKK A;  4BDZ A;  2DFH A;  1WSE A;  4CGH A;  1KVA A;  2VG5 A;  4CJF A;  1EET A;  4I9L A;  4N56 A;  1T7P A;  4DF8 A;  4B9S A;  1RBU A;  4NCB A;  3DLB A;  4N47 A;  4KRE A;  1TV6 A;  4FVM A;  3S3O A;  3BDP A;  1T05 A;  3RMA A;  4FK4 A;  4FZX C;  3V9Z A;  3IRX A;  3QEI A;  3QEP A;  1R0A A;  3HPG A;  2W42 A;  3DLK A;  3T1A A;  5J2M A;  3ZT3 A;  2PZS A;  1RBS A;  2P51 A;  3SUO A;  1N6Q A;  2RKI A;  4FLT A;  4M3Z A;  3CG7 A;  4R5P A;  3DM2 A;  3SV3 A;  2ETJ A;  4FLV A;  2YNF A;  1C0T A;  4IFV A;  3MEG A;  3DYA A;  1UA1 A;  3ZSX A;  1BQN A;  3I8D A;  3ZCM A;  3AVK A;  4Z4C A;  2IOC A;  2Y1I A;  4DF4 A;  2D5R A;  4KHU A;  4FJN A;  4CJ5 A;  3SI6 A;  3M8R A;  4M45 A;  3ISN C;  2QK9 A;  4KHQ A;  3LZI A;  4DQR A;  1DLO A;  3ULD A;  2XY6 A;  1NJY A;  4LH4 A;  4FJL A;  3IG1 A;  4DQS A;  1O1W A;  1FKO A;  4N41 A;  1LAW A;  4IG0 A;  1JLA A;  3PX0 A;  4KI6 A;  4CK1 A;  3MXM A;  3LP3 A;  3FFI A;  3ZT4 A;  3OYF A;  4CGG A;  4E7K A;  1G15 A;  1XHX A;  2VWK A;  3B6P A;  4LSN A;  4O55 A;  3NH2 A;  3OYL A;  2PYL A;  4J2E A;  4FYD A;  3AA5 X;  1BCM A;  1QHT A;  3NHG A;  3LAK A;  3SUQ A;  1NJX A;  1A5V A;  1RDC A;  3AVF A;  3ZSQ A;  3JSM A;  4DU3 A;  4O4G A;  1NK6 A;  4E0D A;  4CJU A;  4CFD A;  3L2U A;  4DQI A;  3PO5 A;  4BDP A;  3QNN A;  1Q9Y A;  3TWH A;  4DU1 A;  2A1R A;  3HVR A;  3QEW A;  3TI0 A;  2P5O A;  1Q8I A;  4DTP A;  3OJU A;  3HXM A;  3JYT A;  2FC0 A;  4K8X A;  3QER A;  1S5J A;  2ATQ A;  4GVM A;  1RT6 A;  1BGX T;  3OYN A;  5I3U A;  2GBZ A;  4YFU A;  2BDP A;  4CGJ A;  2GUI A;  3WNH A;  1SKR A;  2E6L A;  4ZTJ A;  4E1M A;  4CF2 A;  3U3Y A;  2YHB A;  1GOA A;  1XC9 A;  3VQ9 A;  1W0H A;  3RWU A;  5KGW A;  3E01 A;  3ZSW A;  4OPJ A;  4L8R B;  3TAB A;  2HB5 A;  5J2Q A;  5J1E A;  4NCG A;  3CYM A;  1U45 A;  4ELT A;  4E7J A;  1REV A;  1JLC A;  1VRU A;  4CHZ A;  4CJR A;  1Y97 A;  3S9H A;  2G8F A;  3V9X A;  4DLE A;  4DTO A;  1UAX A;  4NYF A;  4CF0 A;  3HPH A;  4Q5V A;  1L5U A;  3ALY A;  4CER A;  4LD0 A;  4Z4I A;  3PV8 A;  4CJV A;  3KJV A;  1L3U A;  3AO5 A;  5CYQ A;  3AVN A;  4F3T A;  2OPQ A;  3TAN A;  1Z26 A;  2LSN A;  3SV4 A;  4DS4 A;  1BQM A;  3WNG A;  4HUE A;  4FJ5 A;  1WAJ A;  3NCI A;  3QES A;  4WE1 A;  4BWM A;  2RPI A;  3QLH A;  3V1Q A;  4CHP A;  5FRN A;  1YTA A;  1JLF A;  3NH1 A;  4M3W A;  4AHV A;  4E7I A;  2Z1J A;  3QIO A;  1RIL A;  4Q0B A;  2IS3 A;  4RW8 A;  5CYM A;  1NK7 A;  4FJK A;  3VN5 A;  4DFK A;  3AVH A;  1HRH A;  3QIP A;  3ZSO A;  3OVN A;  1JLB A;  1VSE A;  4HCC A;  2O4I A;  5HRN A;  1NJW A;  2XY8 A;  4W5Q A;  1JL1 A;  2X6N A;  4KFB A;  3AA2 A;  1BCO A;  1BIZ A;  3QIN A;  1S9E A;  4B8C A;  4JS5 A;  4B3O A;  1TL1 A;  4E3S A;  1HPZ A;  4IFY A;  5KRT A;  3U6F A;  1RT3 A;  1TL3 A;  2IGI A;  5KRS A;  4HTU A;  1RTJ A;  1X9W A;  1QS4 A;  5J2N A;  2YKN A;  1VSK A;  2YNI A;  1JKH A;  3QO9 A;  3VQA A;  1GOC A;  1WSH A;  3VQP A;  1J9A A;  2PYJ A;  3HK2 A;  3ZSV A;  3OYB A;  4J2D A;  3KLH A;  1NK5 A;  3AVL A;  3ZT0 A;  3MEE A;  1RDB A;  4DU4 A;  2E4L A;  3AA4 A;  3U3G A;  2KFZ A;  3TAP A;  2G8H A;  4OKE A;  4KB0 A;  4DS5 A;  3OS1 A;  5HLF A;  2Z1H A;  3L2R A;  3M8P A;  1YVU A;  4CJE A;  4PWD A;  1RT1 A;  3WNF A;  1CLQ A;  1C1A A;  1SKW A;  3RTV A;  2NUB A;  4W5T A;  2A1S A;  3QNO A;  1BHL A;  1U48 A;  3EZ5 A;  3QEX A;  3SUN A;  4CF1 A;  2OZM A;  4H8K A;  4NYN A;  4QCL A;  1RBT A;  4M3U A;  4AHU A;  2Y1J A;  1KTQ A;  1RT4 A;  2XRI A;  1TK0 A;  4NCA A;  1IKX A;  3AA3 A;  1NOZ A;  3RMC A;  3V4I A;  4M3R A;  5HRR A;  4JLH A;  4DTU A;  1TGO A;  2JGU A;  2G8I A;  3WNE A;  3I0R A;  4I2P A;  1KVB A;  1QQC A;  1CZ9 A;  1RBR A;  3NF8 A;  3O4Q A;  1UOC A;  2VG7 A;  5HRS A;  4FLW A;  4DFP A;  4DFJ A;  3VQ8 A;  4BE2 A;  4O0I A;  1HNV A;  2B5J A;  2YHA A;  1JLG A;  1WSI A;  2DY4 A;  5SZT A;  3LPT A;  3AVI A;  1ZBH A;  3C6T A;  2ZD1 A;  3AO2 A;  3DLR A;  3ZT1 A;  3HP9 A;  3K58 A;  3ASM A;  3MXI A;  4KV8 A;  2G8U A;  4B9U A;  4O44 A;  5KI6 A;  3KLG A;  3RR8 A;  4B08 A;  3OY9 A;  4OLA A;  4RW9 A;  4PQU A;  1LV5 A;  3P5J A;  4BDY A;  4JRP A;  1KVC A;  1B92 A;  2WOM A;  4CJS A;  2GV9 A;  4E7H A;  4CCH A;  4PUO A;  2BE2 A;  4CEE A;  1X1P A;  4JS4 A;  4CEC A;  1NK8 A;  1KLN A;  2OYQ A;  4DSL A;  3NF9 A;  1RT5 A;  1VSH A;  1S1V A;  1S1W A;  1TKT A;  2VWJ A;  4CEF A;  1TVR A;  4FK2 A;  2HHT A;  3HP6 A;  4OGC A;  3O3H A;  4FW1 A;  3SCX A;  1U4B A;  3KD1 E;  4DG1 A;  1J53 A;  4CEQ A;  4RW4 A;  3AO4 A;  1VK0 A;  3CM5 A;  3TAR A;  4J2B A;  3S3N A;  3SQ1 A;  2HND A;  3OS0 A;  3OYK A;  4FJ9 A;  2HMI A;  1HYZ A;  1BI4 A;  3CM6 A;  3NGY A;  4ICL A;  4OGE A;  3O3G A;  3SPZ A;  1TKD A;  4QOZ B;  2HHV A;  4KHS A;  2DTU A;  1C0U A;  4FM0 A;  4C8O A;  1SV5 A;  4FZZ A;  4B9N A;  2FBT A;  3HST B;  3LP1 A;  4KTZ A;  2XHB A;  4ID1 A;  1TKX A;  4CF8 A;  4OKK A;  4HUF A;  3V1O A;  4C8L A;  1LAV A;  1S1T A;  1Z25 A;  1JLQ A;  3D45 A;  4DSJ A;  3MED A;  3TAF A;  2P1J A;  2X74 A;  3HT3 A;  2XY7 A;  4FM2 A;  1NKE A;  5HRP A;  1S9G A;  1XWL A;  1ZBF A;  4HHT A;  1XI1 A;  1RDD A;  4KI4 A;  4XIU A;  2QXF A;  3THV A;  3AO1 A;  3P83 D;  2G8K A;  1BIU A;  2HNZ A;  1U04 A;  3OYJ A;  4OJR A;  2OPS A;  4BE1 A;  5DK5 A;  1J5O A;  4CHY A;  4E19 A;  4HUG A;  3CQ8 A;  1I3A A;  3KD5 E;  4J2A A;  3OYI A;  3KLF A;  4FCY A;  4FJX A;  3V9W A;  1BI4 B;  5I42 A;  1VSL A;  4AHR A;  4E7L A;  4CJ3 A;  5C24 A;  3QEV A;  1NKC A;  3AVC A;  1NK4 A;  3VQ6 A;  4CFC A;  1IKV A;  1WSJ A;  2EX3 A;  4GMJ B;  4IDK A;  4FLZ A;  1NK9 A;  3K57 A;  1RT2 A;  3NBP A;  3TAM A;  4KHW A;  5CZ2 A;  3HVT A;  4DTS A;  3DI6 A;  3K2P A;  2E6M A;  5C25 A;  3O3F A;  3K5M A;  3CFR A;  3V6D A;  5CZ1 A;  3SQ4 A;  1S1U A;  2Q3S A;  5EU7 A;  2OZS A;  3HPO A;  4CK2 A;  4FLX A;  3HO1 A;  3IS9 A;  3DMJ A;  1IO2 A;  3KKS A;  1NKB A;  3OYD A;  3VA3 A;  3DLG A;  4IG3 A;  3CFP A;  3ZT2 A;  3D0P A;  4AIL C;  4DSI A;  1S1X A;  3V1R A;  1ZBI A;  3P1G A;  3DOL A;  3KLI A;  4CHQ A;  4CJP A;  2WON A;  4HVJ A;  4DMN A;  4KHN A;  4EZ9 A;  1ASW A;  4CK3 A;  1WNS A;  1U49 A;  1QTM A;  4FJI A;  3NGI A;  4FJM A;  2KTQ A;  1TAU A;  1TKZ A;  1HMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...