4KAZA

Crystal structure of rnase t in complex with a y structured dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 206
sequence length 206
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kazA00
1ASVA 3WNFA 4RW7A 4E7HA 3AO4A 4CF8A 4XIUA 4AILC 2P5OA 3ASMA 1ZBHA 5FDLA 4BDZA 2KQ2A 5HLFA 2OPPA 2FC0A 2X6SA 4CGFA 4W5QA 1TV6A 3NH2A 3K5LA 1TK0A 2D0AA 2W42A 4HUFA 3U3YA 4UQGA 4RW9A 2O4GA 5EU7A 2QXFA 1YT3A 3L3UA 2G8IA 1C1BA 3I8DA 1JLEA 2KW4A 1R0AA 3OYKA 1A5WA 1I39A 1T7PA 5FRMA 3ZSQA 3ZT4A 4CGJA 4OPJA 4LSLA 3NGZA 3SPYA 4N41A 1BCOA 4DQIA 2RKIA 4NCGA 2HHXA 4QCLA 1D8YA 3V1RA 4KTZA 3KLEA 3SZ2A 3ZT3A 1D9FA 3DLHA 1VRTA 5J2QA 2ITGA 3NHGA 4FLZA 3TAEA 1JLFA 1ZBUA 2FBTA 3LALA 4E1MA 3L2RA 3AVBA 2RPIA 4BE0A 3HPGA 4CESA 3LAMA 4EP4A 4I9QA 1VSLA 4ICLA 1J54A 2QK9A 3AVLA 1RDDA 4K8ZA 1ASUA 1UA0A 3QINA 1C0UA 3L2WA 2DTUA 4O4GA 1S6QA 2ZQBA 2B6AA 4RW4A 3PX4A 4KTWA 3SCXA 3OYJA 1O1WA 3ZSRA 1KTQA 3AO2A 3SUPA 4OKJA 3AO1A 4CF9A 4FJKA 1BCMA 3JSMA 1U4BA 1U49A 3SQ0A 3NH0A 2XY6A 2Q3SA 2HMIA 1IO2A 3MXJA 4OPKA 3AVJA 3VQ4A 4CHZA 1JLBA 1RDBA 3RR8A 4ID5A 5FROA 2F8SA 1XWLA 1SKSA 4DMNA 3LWMA 3VA3A 2PYJA 4DFJA 3CQ8A 3RMCA 4DLGA 2HHTA 3MXMA 4ELUA 3VQEA 2HHUA 3VQDA 1FKOA 5CZ1A 3OYBA 3OYLA 1JLQA 4FM0A 4DQSA 5HROA 1SKWA 4KV8A 1RT6A 3S9HA 4FK2A 3SUQA 1SL0A 3AVMA 1CLQA 4EP5A 3CYMA 4CE9A 3O4NA 3QEXA 2IDOA 4CK3A 1QQCA 3ISNC 3TWHA 3SI6A 5CY4A 4B9NA 2QKBA 5KTQA 4N56A 2HW3A 3TANA 4KI4A 4QOZB 4IG0A 3OYCA 3KLFA 2JLEA 1NJXA 3ZSWA 3K58A 2D0CA 2I5JA 3MECA 1DLOA 3OYEA 5J2PA 4F2SA 1JXBA 3KLGA 4AHRA 3EY1A 3M8RA 1X1PA 5D3GA 1T05A 4FK4A 4DWIA 3LDSA 4DSFA 4KPYA 1LWEA 1YVUA 4CJ5A 3K5OA 3LANA 4I7FA 3V9SA 3OJUA 1C6VA 1QSSA 2PY5A 2BGGA 2D5RA 4CHPA 3ZSOA 2R7YA 3HVTA 2P1JA 3NBPA 1LAVA 3NF6A 1NK9A 2KZMA 2QKKA 5HP1A 4BWMA 1ZBLA 4B08A 3ULDA 1ZYQA 1RBUA 3RTVA 4DQQA 4W5RA 4DTPA 4DQPA 1NK8A 3NGYA 4HTUA 5C25A 4FW1A 4IKFA 5KRTA 4LSNA 4OKEA 2Z1JA 4CHYA 1RT7A 2HNDA 4Z4IA 2BE2A 1JL2A 4DFPA 4DSKA 2IAJA 2EX3A 1TGOA 5CYMA 4IFVA 3VQ6A 3TABA 4KB0A 3C6TA 4CJRA 4KFBA 3KJVA 3WNGA 3SV4A 2JGUA 1B92A 4CHQA 3WNHA 4FJ9A 1W0HA 2HNZA 3C94A 3DOLA 3VQBA 3O3GA 1C1CA 4CK2A 3OYHA 2OPQA 3ZT1A 1BISA 2XHBA 2IC3A 1L3VA 2YNIA 3CFPA 3SNNA 1RDAA 1C1AA 3NDKA 1NKBA 3LPUA 3OS1A 3G10A 4KHQA 1S1UA 1X9MA 1CXQA 4CJKA 3VQ7A 3O3HA 3TAPA 3AVHA 4LD0A 1QTMA 1L3SA 2WONA 4CF0A 3KLIA 3L2UA 4M3XA 3OY9A 2P5GA 4Z4FA 4AHTA 4FLXA 3AVFA 1TVRA 4L8RB 4HCBA 2X78A 4M3TA 1RBSA 3QNNA 1U47A 1VSEA 1DTTA 4C8LA 3QEWA 3TR8A 3ZCMA 4N5SA 1S6PA 4FCYA 1TK8A 3KK1A 4W5TA 4O0IA 4NYFA 2HHWA 4LH5A 4KHUA 1RTIA 4M45A 1J9AA 4F8RA 2XO7A 1RCHA 3ZSYA 4FK0A 2B4JA 1LV5A 1KSPA 4FXDA 1HYSA 4J2BA 1KFSA 3QESA 2B5JA 3OJSA 4CJUA 3EZ5A 4HHTA 4Z4HA 1JKHA 1KFDA 3I0RA 3MEDA 2YKNA 3K5NA 1GOCA 1UAXA 3ZT2A 3L2VA 3V9ZA 1EX4A 4PQUA 3V1QA 4JRQA 3SQ4A 1SL1A 1A5VA 4MFBA 1WLJA 3DYAA 4CGHA 1NK4A 3VA0A 4N47A 1RT2A 1S1XA 3B6OA 4BACA 3T3FA 1HRHA 1JLAA 4DTXA 4DU4A 3VN5A 1XI1A 1IH7A 3NCIA 5HRNA 3A2FA 3C95A 4FLVA 1FKPA 4G1QA 4DTSA 1Q8IA 3PY8A 4I9LA 1WSHA 4JS5A 4H8KA 4PA1A 3MAQA 4CF2A 4AHCA 1I3AA 4FLWA 4M3RA 1NJZA 1RT3A 4FJMA 3LP2A 1QE1A 1VSJA 4CEEA 4CEZA 3CFOA 1NOZA 3DLBA 3P83D 4BE2A 5CZ2A 3HO1A 4E3SA 4DTMA 4ZHRA 3DOKA 1WAFA 1IG9A 1VRUA 2OA8A 1LW2A 3OYGA 1BQNA 4E0DA 3QNOA 1GOBA 3LP0A 3WNEA 4B8AB 3AVCA 4YFUA 4IFYA 4FM2A 2OPSA 4KHSA 4KRFA 3LPTA 1TKDA 1Q9XA 3T1AA 3HM9A 2EHGA 4FLTA 1NOYA 2IOCA 3HP9A 2DFHA 1LWCA 3DM2A 3KKRA 1BIZA 1BI4B 2YKMA 4O0JA 4N76A 4OKKA 1J5OA 3PO5A 4FJXA 3LAKA 1GOAA 1C0MA 4I2PA 5CYQA 4CJSA 2GBZA 4NCBA 3HJFA 4CJWA 2KTQA 4QAGA 1BGXT 1S1WA 2VG6A 1KLNA 1N5YA 3HK2A 1TKZA 3AA3A 4CFDA 3OYDA 4DF8A 1ASWA 2YHBA 3EYZA 3MEEA 4DTJA 4GMJB 4CJTA 3SUOA 2G8UA 2DFEA 2F96A 2Z1HA 2XY8A 4CEFA 2Z1IA 4GVMA 3AV9A 3TAFA 4EZ6A 3M8QA 5J1EA 1NK5A 3MXIA 3TI0A 1RNHA 2ETJA 3KTQA 2E4LA 2YNHA 3PUFA 1VSKA 4H4OA 4FVMA 4C8NA 1EXQA 3VQ8A 4B9UA 4B9SA 3CM5A 4CF1A 3DI6A 4CHOA 3QEPA 1HNVA 4KREA 3FFIA 1B9DA 4DS4A 4J2DA 3V9WA 3V9XA 1RBRA 3AVGA 3ZSZA 4FLYA 3DLRA 3HVRA 4FJ8A 4DU1A 1F21A 2DY4A 1RTHA 3U6FA 4JLHA 3TAGA 2WOMA 1Y97A 4IDKA 2HHQA 4AHVA 4FJHA 4M3YA 3OYMA 2PZSA 3AA4A 4Q5VA 1KRPA 3DMJA 3HP6A 1KVCA 1IKVA 1WN7A 4DSJA 3OS0A 1EKEA 2FBYA 1TL3A 4H4MA 1S5JA 2YHAA 4Z4CA 3D45A 1RT1A 1N6QA 1CZ9A 4CJVA 4B9VA 5I3UA 2HVIA 3O4QA 2IGIA 3L3VA 4GW6A 1S1TA 4M41A 2KFNA 1UOCA 3M8PA 2Y1IA 2E6LA 4F3TA 1VSIA 3B6PA 3V9UA 2LSNA 3IG1A 1IKYA 3QETA 2YNGA 3NFAA 1RT4A 3DLEA 4HUEA 4E7JA 4OGEA 4Z4GA 4CJ4A 4DFMA 4JS4A 3UIQA 1TKTA 2YV0X 3HL8A 3IRXA 4F4KA 3CM6A 2ATQA 3SPZA 4RW8A 1KVBA 1QHTA 5HRPA 1JLCA 2ZD1A 4C8MA 1VSHA 3K5MA 3RMDA 3AVAA 2OZMA 4W5NA 2DFFA 4WE1A 2KZZA 1WAJA 2BANA 3LWLA 4CERA 1EP4A 4AHSA 4DLEA 4M3WA 3V81A 3L8BA 1YTUA 5C42A 2VWKA 1KCFA 2Z1GA 4AH9A 3RRGA 4NYNA 4CHNA 3VQ5A 3D0PA 3RWUA 4KAZA 4OLAA 3DRSA 2HHVA 5C24A 4FW2A 2ZE2A 4OGCA 4FJNA 4B9MA 3HT3A 3NAEA 2VG7A 2X6NA 1SUQA 4FZZA 3VQQA 1Q9YA 3HPHA 4K8XA 3PO4A 1A5XA 3T19A 3VQPA 4ZTJA 4FJ7A 3PX6A 4NCAA 3LZIA 3OYFA 3BGRA 3P5JA 3SJJA 3H08A 4AHUA 3RMAA 2YNFA 1U48A 3JYTA 3NF8A 4KO0A 3CFRA 1TL1A 4M42A 4KHWA 2RF2A 1XHZA 1VSFA 1C0TA 3LP1A 4RG8A 1W9HA 5SZTA 3HPOA 4EZ9A 1SL2A 4BDPA 2XY7A 3K59A 1RT5A 2AJQA 1U04A 3LP3A 4B8CA 1HYVA 4CIFA 4IBNA 4M3ZA 3HXMA 4DSLA 2HB5A 3DLGA 1IKXA 3THVA 1XC9A 1WSIA 4ID1A 4CEOA 4CJPA 4DSEA 4BDYA 5I42A 4RW6A 3K57A 3KK3A 2G8HA 1HNIA 2OPRA 3ALYA 4LY7A 1LWFA 4CFCA 4CK1A 4E89A 3RMBA 4KKOA 4KHNA 2OYQA 1HMVA 3C6UA 1J53A 1T03A 4KI6A 1TKXA 4E1NA 1YTAA 3DRPA 4OVLA 3VQAA 3OYIA 4FZXC 2FBXA 5FRNA 4LH4A 4KHYA 1SV5A 1QS4A 5HRSA 1B9FA 2HHSA 3QEIA 4CJ3A 4CJEA 3IAYA 4BE1A 4ELVA 4CECA 5K14A 1FK9A 3NF9A 3HSTB 1KLMA 1HQUA 4CEQA 4OJRA 4JRPA 3PV8A 4ZTFA 4CIGA 2XY5A 2RN2A 1CZBA 1D5AA 4E7LA 4DTUA 4Z0UA 3S3MA 4CGDA 1NJWA 1TAUA 1FXXA 2A1SA 2XRIA 4DTOA 3I0SA 1JL1A 4HCCA 5KGWA 1K6YA 3SUNA 1U45A 3V1OA 1QSYA 3BDPA 3SV3A 3QEVA 4DTNA 2BDPA 3KD5E 4HVJA 4CIEA 1SKRA 2P51A 5JS2A 4E19A 1Z25A 4Z4EA 1VSMA 4W5OA 1JLGA 1ZBIA 3HYFA 3AA5X 3AA2A 3AO3A 3OYNA 4FM1A 3TARA 4DSIA 4FLUA 4DTRA 4C8KA 4PWDA 3OVNA 5SWMA 4FZYA 3IS9A 3QERA 3F73A 1G15A 1L3TA 2PYLA 1S9EA 1HJRA 1S9GA 3DLKA 4O44A 1NK0A 4B3OA 3TAMA 5KI6A 2D0BA 4DU3A 1LW0A 3AVKA 3NF7A 5DK5A 4FJIA 3LZJA 4KTQA 3L2QA 1RDCA 1UA1A 2GUIA 4B9LA 3K2PA 4IG3A 4CGIA 5KRSA 4E7KA 4ELTA 2O4IA 1RBVA 5JS1A 1ZBFA 3KK2A 1WSEA 3DRRA 4Y1DA 3KLHA 2NUBA 3VQ9A 1T8EA 3CG7A 3ZSXA 1MU2A 2VWJA 5HBMA 4MQ3A 1NKEA 4J2AA 4CGGA 4CFBA 3AO5A 3SQ1A 3S3NA 4PUOA 3KIOA 1HPZA 3S3OA 4PY5A 1LAWA 3NH1A 3F9KA 1DTQA 4FJJA 4DQRA 1WSJA 1X9WA 1NJYA 1RBTA 1VSDA 1HYZA 4OLBA 4BWJA 4DFKA 4E7IA 2VG5A 1TK5A 1WNSA 5E41A 3OYAA 1CXUA 1BHLA 1ITGA 3QIPA 4O5BA 3ITHA 4YNQA 1RTDA 1Z26A 5DMRA 4F3OA 2HVHA 3U3GA 3ZSVA 4HUGA 2X74A 4FYDA 1EETA 1WSFA 2HNYA 3KD1E 4B9TA 4FJLA 4CJLA 2OZSA 1D9DA 4M3UA 4CEBA 1BL3A 1L5UA 4KB1A 4DF4A 3RR7A 1VK0A 3M8SA 1WSGA 4FJ5A 2FBVA 1KVAA 1RILA 5T7BA 3AVNA 3G0ZA 3QLHA 4DG1A 3OS2A 3SYZA 3V6DA 2KFZA 3PX0A 5J2NA 4CCHA 4C8OA 4DS5A 4Q0BA 3E01A 2G8VA 1BI4A 3QIOA 3O3FA 4CJFA 4J2EA 1REVA 3KKSA 4CEDA 1JXEA 5HRRA 4CFAA 3VQCA 3NE6A 5J2MA 1NK7A 5KGXA 4CJQA 3V4IA 3SQ2A 3TAQA 1RTJA 2IS3A 1L3UA 4Y1CA 3P1GA 1XHXA 1UWBA 4O55A 2G8WA 1S1VA 2A1RA 1NK6A 3ZT0A 4TSXA 4FJGA 4CEAA 2G8FA 3AVIA 4F2RA 4R5PA 2F8TA 2G8KA 1QSLA 1IKWA 2GV9A 1TAQA 1X9SA 3RRHA 1HQEA 3QO9A 1BIUA 1BQMA 1NKCA 4I2QA 3NGIA 2Y1JA 3MEGA 2E6MA
chains in the Genus database with same CATH superfamily
4RW7A 3ASMA 1CZAN 3QFUA 1NMNA 3NH2A 1TK0A 1T6CA 3HZ6A 5EU7A 3DXKA 2D1KA 3ZT4A 4CGJA 3QBXA 3SPYA 4N41A 4DQIA 2HHXA 1D8YA 3CCUN 3SZ2A 4CVNE 3WQUA 3TAEA 4BRDA 3LALA 3L2RA 5EOYA 1VSLA 3P4IA 4WFNL 2RE2A 1J54A 3AVLA 1RDDA 2HOEA 1ASUA 3S41A 4DUZK 1C0UA 4FPAA 2DTUA 4ILGB 5IWAK 3J81O 3OYJA 1ZXOA 3SUPA 4OKJA 3JSMA 3I56N 1U49A 2HMIA 1IO2A 3DLLL 1YJNN 3EZWA 3A5LC 1RDBA 4CHZA 3RR8A 2F8SA 1NU0A 2A40A 1N34K 2PYJA 1NGHA 3LM9A 3LM2A 4FM0A 1SKWA 4KV8A 3SUQA 3VF4A 1MWMA 3CYMA 2IDOA 3TWHA 3SI6A 4IG0A 4BGAA 2JLEA 2W6LA 3K58A 3THYA 2NRHA 3MECA 3OYEA 3BZKA 1YIJN 2GWKA 5I9EB 1T05A 4DSFA 4AQYK 1LWEA 3RSEA 1YVUA 4CJ5A 1C6VA 4ILHA 3I8BA 5MLCQ 1NK9A 4FSVA 3ULDA 1ZYQA 4B3RK 4HTUA 3IFRA 4OKEA 2Z1JA 3SMPA 2HNDA 4JHDB 1JL2A 1IBLK 3IKMA 4IFVA 5KQDA 2HBKA 2JGUA 3C94A 4IO8A 3CFPA 1C0GA 1XMOK 5EY4A 4I6MA 3OS1A 3G10A 4H5WA 3O3HA 4CJKA 3TAPA 4H0VB 2HHHK 2E8AA 4H0PA 4M63C 1EO1A 2WONA 1GLAG 1JCFA 4AHTA 3CD6N 3C6HA 4B1ZA 1ESVA 1RBSA 3C6AA 5GINA 2A41A 1DTTA 1VQNN 3TR8A 5ADXA 2FSKA 1TK8A 4QS9A 3U4LA 4O0IA 2GUPA 4NYFA 5AQSA 4KHUA 3CCEN 1XNRK 4O8UA 1RCHA 3ZSYA 2B4JA 5IT9O 4EHTA 1KSPA 1H1VA 1K8AO 4JI6K 4HHTA 3DXMA 3ZT2A 2GELA 2YCHA 3L2VA 4PQUA 3CI5A 4BR0A 3V1QA 3SQ4A 1SL1A 4MFBA 3D2EA 4N47A 1V4TA 2H3GX 3T3FA 1E4FT 1XI1A 1WOQA 3ATVA 4XEIA 1Q8IA 4PL8A 4FWRA 4Y0WA 4H8KA 4FL9A 4CF2A 4M3RA 4BR7A 4CEZA 3CFOA 5F1XA 3B8AX 3DOKA 1LW2A 5B8HA 3QNOA 1GOBA 3D6RA 2DPNA 4KRFA 2GWJA 3EEQA 2IOCA 2BUPA 1LWCA 2YJFA 3DM2A 4WFBL 4I2PA 4DV5K 2VG6A 1DKGD 3EE8A 1N5YA 3AA3A 5KPZA 3LL3A 1ASWA 3MEEA 2A42A 5M1FA 4LF9K 2F96A 2Z1HA 3TAFA 3G25A 2F9WA 1M1KO 3KTQA 3PUFA 2YNHA 3TTDA 4C8NA 3CM5A 1VQ6N 1B9DA 5AQRA 4DS4A 1KXPA 3V9WA 1RBRA 3ZSZA 2A5XA 3DLRA 4FJ8A 4IOXA 4CZJA 3TAGA 4JLHA 3ZYYX 4IDKA 4AHVA 4FJHA 4M3YA 3SAHA 5EVZA 3A8YA 2P9PA 1IKVA 5BN8A 1TL3A 1RT1A 3WEEA 3EKSA 4JEPA 1HPMA 4B9VA 4IJNA 4CW7B 2KFNA 1BOTO 3H3NO 3B6PA 2LSNA 2VYPA 2YNGA 4HUEA 4KHPK 2YV0X 4F4KA 3HL8A 4JAXA 3MWTA 4RW8A 1VQ8N 2P9KA 5HRPA 2ZD1A 4B1WB 1HNWK 4JNEA 4DR7K 1Q18A 1YTUA 5C42A 2VWKA 1KCFA 2Z1GA 4NYNA 1YJ9N 3VQ5A 2ITMA 2VG7A 2QEXN 1SUQA 4X64K 2A3ZA 3HPHA 3PO4A 4DR6K 4WQ4A 3MN7A 5AQKA 4ZTJA 4NCAA 3OYFA 3RMAA 2YNFA 3NF8A 1BU6O 2RF2A 4NXNK 4EIAA 2XY7A 5H1SQ 1VQKN 4OX9K 2AJQA 3HXMA 1WSIA 4CEOA 4PKHA 4BDYA 5I42A 5AQNA 1HNZK 1T44A 4CK1A 4LY7A 1LWFA 3O9RA 4KKOA 5E84A 1HMVA 3VTHA 3CCJN 3DRPA 3VQAA 3OYIA 4FZXC 2FBXA 3IMXA 4DV6K 5HRSA 3O08A 3QEIA 4CJEA 3UE5A 4BE1A 3IAYA 3CERA 3VEOA 5K14A 4ELVA 3HSTB 3PV8A 4JRPA 2XY5A 2RN2A 3S3MA 2AP1A 2A1SA 3O4WA 1JL1A 1GLEG 5KGWA 3SUNA 3V1OA 4FWLA 3BDPA 3CMAN 4DTNA 3ENOA 4RWTA 3W3DA 4E1JA 3AA5X 3AA2A 3AO3A 3OYNA 4FLUA 4DTRA 4C8KA 1TYQA 1QVFM 3IS9A 1IBKK 1DT9A 3HTVA 4DR5K 4GY2B 1L3TA 1JJ2M 3OA9A 1NMDA 1S9GA 4O44A 2O8FA 3M5RA 3D2FB 4DU3A 1KD1O 3NF7A 5DK5A 5DM7L 3LZJA 2Q97A 5EXWA 3OW2M 4WCEL 3R6MA 4ELTA 1RBVA 4ILJA 3LDLA 3BEXA 1MU2A 2VWJA 5HBMA 1NKEA 3THWB 3CXCM 1BUPA 3H1VX 3KIOA 1HPZA 3QB0A 1GLDG 3F9KA 4BRMA 4DQRA 3H1QA 1HYZA 4BROA 3K9KA 5E41A 1RTDA 2V7YA 2HVHA 4XH5A 3U3GA 2QWRA 4FYDA 2O8BB 4O8KA 3UKRA 4MLHA 4BRHA 2HNYA 3IDHA 3MMVA 1VK0A 2A6AA 4A5AA 3AVNA 4XH4A 2KFZA 3C7NB 3PX0A 1VQMN 5C0YA 2WUSA 4C8OA 1T6DA 4Q0BA 4BC5A 4CFAA 1JXEA 4JI2K 5J2MA 1NK7A 2E20A 4CJQA 3V4IA 3TAQA 1RTJA 2FF3B 2G8WA 3ZX0A 3NMUA 2A1RA 4KH6A 4FJGA 2P9NA 4CBWA 1QSLA 1IKWA 2GV9A 1TAQA 1X9SA 3CCQN 3RRHA 1HQEA 1E3MA 3MX5A 3ULEA 1BIUA 4ISFA 3HI0A 4PHTX 1YUWA 2Y1JA 1K8KB 2P5OA 1ZBHA 5FDLA 2QWLA 5HLFA 2W41A 2OPPA 2I7PA 3CF5L 2FC0A 3SK3A 1GLBG 3K5LA 1TV6A 2W42A 4HUFA 3U3YA 4UQGA 4RW9A 2QXFA 1YT3A 3L3UA 1C1BA 1R0AA 1JLEA 1A5WA 5FRMA 3U8XA 2NLXA 3ZSQA 4OPJA 4BQLA 1YJWN 1E4GT 4QCLA 2PBDA 3V1RA 2ITGA 3NHGA 1NNEA 4E1MA 4B3MK 4WYBA 2O8CA 2P9UA 2QWNA 4KH4A 2E1ZA 1NGFA 4K8ZA 5AQLA 3QINA 4WF9L 2B6AA 3FZFA 3PX4A 4KTWA 1KTQA 3AO1A 4CF9A 3VEVA 5LMNK 1U4BA 2O8DA 4YDUA 3NH0A 2Q3SA 3WT0A 5LY3A 5FROA 4DMNA 3LWMA 3VA3A 1O13A 3RMCA 2HHUA 4B1XB 5CZ1A 3OYLA 3ID6A 3S9HA 3H45C 3AVMA 5ADXH 4EP5A 4BRAA 5AZIA 4CK3A 4JI4K 2QKBA 2HW3A 4CBUA 4N56A 5FPMA 5BR8K 3TANA 1NJXA 3ATUA 2I5JA 2Q36A 1JXBA 3EY1A 4AHRA 1IG8A 1VQPN 3CQYA 2QM1A 3R9PA 4GV6A 3V9SA 2BGGA 1XC3A 2D5RA 3ZSOA 2R7YA 2P1JA 1LAVA 3NF6A 4LC9B 1I94K 2KZMA 4DV0K 2QKKA 1RBUA 3RTVA 4DQQA 2W40A 3DXKB 5C25A 5KRTA 4YOVA 1M90O 2YI1A 2IAJA 1XUPO 5CYMA 3C6TA 4KFBA 4B3SK 3SV4A 3WXIA 4CHQA 4FJ9A 3DOLA 5M1OA 3VQBA 3NVMA 1C1CA 4CK2A 3OYHA 2OPQA 3CJ1A 1BISA 2XHBA 2IC3A 2HMPA 2NRZA 1L3VA 3SNNA 2VGMA 1OH6A 3NDKA 4JN4A 4KHQA 2GEMA 3Q7CA 1HKGA 3PLAA 2HF4A 1QTMA 4LD0A 1Z6RA 1L3SA 3VTIA 2P5GA 3AARA 3AVFA 3ZLJA 4BRPA 2VCPA 4HCBA 2X78A 4M3TA 1GLJO 1U47A 3ZCMA 5AQXA 4N5SA 4KH5A 2NRRA 4F8RA 2XO7A 3H46O 1XNQK 4FXDA 4FWNA 1HYSA 1P8ZA 3O8MA 4CJUA 3MEDA 3THYB 4CZEA 2YKNA 3K5NA 1GOCA 1UAXA 3CJ9A 1S22A 3RSEB 2UXBK 2F7TA 4JRQA 4CGHA 4DR2K 1S1XA 3CCRN 4BY9C 1JLAA 4DU4A 3VN5A 3NCIA 4B1YB 3H6EA 3FFKB 3R1XA 3HM8A 5M1KA 3CJCA 1HNXK 4H5VA 4FLWA 1NJZA 4LF7K 1RT3A 3A0IX 4LFAK 3P83D 4E3SA 4DTMA 5AQPA 1WAFA 1IG9A 5AQUA 2OA8A 4A62A 3OYGA 2ASMA 5AQHA 3LP0A 5BN9A 2WTUA 4KHSA 1TKDA 3CC4N 4MDAA 4I6MB 4AM7A 3HM9A 1OH5A 2EWSA 3KKRA 3FZKA 1BI4B 4O0JA 1J5EK 1HKCA 1QQMA 1KAZA 3HJFA 3M3ZA 4F9OA 1TKZA 3OYDA 4DF8A 2YHBA 4H5NA 4GMJB 4CBXA 3SUOA 1N36K 2DFEA 2GX9A 2XY8A 1YITN 2Z1IA 4EZ6A 1NK5A 3MXIA 1RNHA 2ETJA 3MN5A 3PIPL 4B9UA 1HUXA 4K42A 3DI6A 5AFUA 4KREA 2OTLN 5GAEP 3C65A 3AGRA 4FLYA 3ENHA 5HL7L 2WOMA 1Y97A 2HHQA 2V51B 3DXMB 4O5FA 4YOWA 1KRPA 3HP6A 4DSJA 1WN7A 3OS0A 2YHAA 3D2EB 4Z4CA 3CHWA 4IXCA 4C23A 1N6QA 3VPZA 1CZ9A 1ILYA 4EAHD 2QWMA 2IGIA 4GW6A 5F0XA 3VERA 2E6LA 3IG1A 3RVCA 3K0SA 1RT4A 3DLEA 4E7JA 2UUAK 4BC3A 3VEXA 3VETA 2E2NA 3CM6A 3SPZA 4UY8O 1BG3A 3MCPA 4RCHA 1QHTA 4CZGA 2FLOA 3K5MA 3RMDA 2OZMA 3T69A 3JAMO 3BZCA 2DFFA 2IVPA 1WAJA 4GVEA 3LWLA 4M3WA 3L8BA 5BPLA 4B1UB 4KAZA 5FPNA 4YOTA 3OBWA 1Q86O 3VMFB 2ZE2A 5ELZA 4IO9L 5LL6Z 3NAEA 2X6NA 5AZJA 3AAPA 3SJHA 3VQPA 4FJ7A 4ISGA 1Q81O 1MWKA 4AHUA 1X3MA 4M42A 5CHIA 1XHZA 3LP1A 4RG8A 1W9HA 1QQNA 3HPOA 2UU9K 5BPMA 1XMQK 4U7BA 1RT5A 4WFAL 3EN9A 4CIFA 4IBNA 4M3ZA 4K25A 4ID1A 4CJPA 4C1NI 4RW6A 2P9PB 3KK3A 1HNIA 2OPRA 3ALYA 3RMBA 5TKYA 3P31A 3WEEB 3CPWM 4E1NA 1YTAA 5DM6L 2PFUA 4CECA 3NF9A 1Q7YO 4DQ8A 4CEQA 4CIGA 4DTUA 1NJWA 1FXXA 4DTOA 3I0SA 2IVOA 5A2QO 1U45A 3QEVA 2BDPA 3KD5E 2P9KB 4JK8A 4CIEA 4HVJA 3SAGA 3F5TA 3THXA 1JLGA 3HYFA 4FM1A 4PWDA 1BO5O 4JKGA 3WXJA 3QMLA 3SBTA 4H5TA 3VOVA 1NGBA 1NG9A 1MA9B 1WB9A 1K73O 3K2PA 4JI3K 1RGIA 1VHXA 3SLCA 4E7KA 5JS1A 1KAYA 2ZGZA 1ZBFA 5FPEA 3KK2A 3KLHA 2NUBA 3VQ9A 4BRCA 3D7EO 3SQ1A 4JI8K 4PUOA 3S3OA 4PY5A 1BWFO 1DTQA 3O9QA 2QWOA 1WSJA 1RBTA 1VSDA 1VAZA 4BWJA 4E7IA 2VG5A 3OYAA 1CXUA 4O5BA 4YNQA 4JI7K 3ITHA 1Z26A 3VF6A 1VQ5N 2WC9A 2X74A 1NGDA 3VEYA 2ZWHA 5BR9A 1WSFA 3KD1E 3ZEUA 4B9TA 2YX6A 2AA4A 2OZSA 1LOTB 1SZ2A 1BL3A 3VGKA 1X3NA 2P9SA 4KB1A 4DF4A 3T7ZA 3RR7A 2J4RA 2JWLA 4V19S 5C12A 1KVAA 1RILA 5T7BA 3QLHA 3OS2A 1VQ7N 5BRHA 4CCHA 4DS5A 4JV5K 2G8VA 3L0QA 3MX2A 4CJFA 3O3FA 1REVA 3KKSA 2JWKA 3VQCA 5KGXA 1MDUB 3SQ2A 1XHXA 2Q31A 3MN6A 4O55A 1N8RO 3AVIA 2F8TA 4JKHA 4YY3K 4YOXA 1BQMA 4I2QA 3NGIA 2ZM6K 2HBMA 1TYQB 4OPHA 1ASVA 1V4SA 3WNFA 4E7HA 3AO4A 4ISEA 4CF8A 4XIUA 1NBWA 4FWSA 5C2DA 2KQ2A 2X6SA 2O8EA 2O8FB 2D0AA 2O4GA 4IWVA 1T7PA 2KW4A 1QVGM 3L4QA 4MLEA 1BCOA 4NCGA 3KWIA 4WQ5A 4KTZA 3VENA 1D9FA 3ZT3A 4JK7A 5AR0A 1VRTA 3WUHA 5JICA 5J2QA 2E2OA 1JLFA 1ZBUA 3F9MA 2FBTA 4BE0A 4I9QA 4ICLA 3QBWA 5LMUK 2QK9A 2OCEA 1TUYA 3L2WA 1WBBA 4O4GA 1S6QA 4AF1A 1O1WA 3L4IA 3ZSRA 4IOAL 3AO2A 3UKRB 2UUCK 4PL7A 3SQ0A 2XY6A 4AM6A 4H0TB 1FJGK 4OPKA 3AVJA 3VQ4A 1ATSA 3CQXA 5BRDA 4ID5A 1XWLA 4DFJA 3CQ8A 1JCGA 4ELUA 5HROA 1JLQA 3QICA 1RT6A 4FK2A 1SL0A 3QEXA 5KTQA 1NJIO 2P9NB 4QOZB 3OYCA 2QA4N 2E1YA 1DLOA 1RDUA 3AGKA 5J2PA 3CCVN 4F2SA 3M8RA 4FK4A 3ULEB 4DR1K 4KPYA 4FO0A 3K5OA 3LANA 3WQTA 3OHRA 3W0LA 1VQON 5AQVA 3WXLA 4B08A 4LF6K 4W5RA 1NK8A 2WFBA 2BH1A 4FW1A 2P9IB 4CHYA 1RT7A 4Z4IA 4LFBK 2BE2A 2D0OA 4DSKA 2EX3A 3A5NC 4CI6A 4KB0A 1S3XA 4CJRA 3KJVA 1B92A 3TU5A 1W0HA 2HNZA 3O3GA 3FZMA 3LDPA 5JVHL 3TPQA 1RDAA 2O8CB 1C1AA 2P9UB 1W97L 3LPUA 1S1UA 1VQLN 4BC4A 1CXQA 5TKWA 4CZLA 2Q0UA 3CIPA 3AVHA 4IEEA 3L2UA 4Z4FA 2O8DB 1TVRA 3Q7BA 5KPTA 1VQ4N 4C8LA 3QEWA 1S6PA 1QZ6A 4CZHA 3O9TA 3KK1A 2NNWA 3E1YA 4W5TA 1K9MO 4BRGA 4LH5A 4JI5K 1RTIA 4M45A 4FK0A 5AZIB 4YOYA 1LV5A 4J2BA 5AFUH 4B1VA 3QESA 4H03B 4PKGA 3OJSA 3EZ5A 3R8EA 4Z4HA 3I0RA 1IV0A 4JKEA 3V9ZA 1BA1A 1EX4A 3DAWA 2IVNA 5GADP 2HSTA 1WLJA 3DYAA 1NK4A 1RT2A 3B6OA 4BACA 3THWA 1HRHA 4DV4K 1IH7A 4NB4A 5HRNA 3C95A 4JKFA 3CJ7A 3WXKA 3BUZB 4JS5A 3MAQA 1I3AA 3G6EN 4BG9A 3A5MC 4FJMA 1OVYA 2CGKA 4CEEA 2E2PA 4A2AA 3DLBA 4ZHRA 1VRUA 5E26A 1BQNA 4GNIA 2OANA 4YFUA 4FM2A 3LPTA 1Q9XA 3BF1A 3T1AA 2EHGA 4H0XB 3VGMA 4N76A 4OKKA 1ZBSA 1J5OA 5FLXO 3LAKA 5CYQA 4CJSA 4WQ4C 4CJWA 2KTQA 3CMEN 1BGXT 1S1WA 3HK2A 4CFDA 2QW9A 4NCBA 4J8FA 3EYZA 4DTJA 4CJTA 2G8UA 4NLBA 4BRFA 3M8QA 5J1EA 3TI0A 1VSKA 3VQ8A 4H4OA 2KKZA 3P39A 1EXQA 4B9QA 4CF1A 3QEPA 1N32K 3M6GA 4FOEA 1HNVA 1NGIA 3FFIA 4J2DA 5AQGA 3AVGA 4C1NK 3HVRA 4DU1A 4BR4A 4DR4K 1BDGA 3U6FA 4H0OA 2ZJQL 3ENBA 5GIOA 3VGLA 3AA4A 3DMJA 2CGJA 2FBYA 4CD3A 3A5OC 3FZHA 4CJVA 5I3UA 3O4QA 4JKAA 1UOCA 5C2FA 3VEWA 1X9JA 4F3TA 1VSIA 4JK9A 5AQTA 3V9UA 4M7XA 2F4VK 2P9LA 1W2BM 3BY5A 3NFAA 5AQOA 4OGEA 4CJ4A 4DFMA 4BVOA 3UIQA 1TKTA 2NRTA 4A2BA 2ZJRL 1KVBA 4B3TK 4FWKA 4JD2A 4FWPA 3AVAA 4W5NA 5AJ3K 1C0FA 2HBLA 4WE1A 3HOSA 2D0PA 1JCEA 2BANA 4PKIA 5BREA 3V81A 3H3OB 4BVPA 4AH9A 3RRGA 4OLAA 3VF2A 3D0PA 2HHVA 3DRSA 4FWQA 4IOCL 3E9PA 4FW2A 4OGCA 4FJNA 4QS8A 3HT3A 1KC8O 3VQQA 3SAFA 1Q9YA 4K8XA 3G71N 1A5XA 1D4XA 3PX6A 4JKDA 3P5JA 3SJJA 1OKJA 3FZLA 1EWQA 1YF5L 3JYTA 4KO0A 3CFRA 1TL1A 4KHWA 1U2VA 3QDKA 4EZ9A 1SL2A 4GV3A 3CETA 4B8CA 3LP3A 3DLGA 4DB3A 1XC9A 3HRGA 1IBMK 1GLLO 3K57A 3I33A 4GKJK 3PIOL 1YVNA 3GDQA 1U6ZA 4KHNA 2OYQA 3C6UA 1J53A 1T03A 4KI6A 4A59A 1W7AA 1B9FA 2FXUA 3TTFA 4OJRA 4FWOA 3I55N 5KQ8A 4IJAA 5AQMA 4E7LA 1CZBA 4DUYK 4Z0UA 1TAUA 3UKUA 4HCCA 1K6YA 1P90A 4BG8A 5JS2A 4CD1A 4E19A 5EX5A 1YI2N 1Z25A 2NRWA 1VSMA 2RHKA 1ZBIA 2E2QA 3ZETA 3OVNA 5SWMA 1G15A 3NVKA 2PYLA 1NGCA 4EHUA 1HJRA 1HLUA 3DLKA 2VWBA 3TAMA 5KI6A 2D0BA 3TTCA 4KTQA 5AQJA 3E9OA 5AZJB 3L2QA 1RDCA 2Q2RA 1UA1A 4B9LA 2O4IA 5HOOA 1WSEA 2BTFA 4Y1DA 1T8EA 3CG7A 3T1YK 4MQ3A 4J2AA 4CGGA 3AO5A 3S3NA 4X66K 3J7YP 4MO5A 1LAWA 4FJJA 1TUUA 2VQFK 4YDUC 4OLBA 4DFKA 3FR0A 3EL2A 1ITGA 4YOUA 1HR0K 4F3OA 3HOTA 1QHAA 3ZSVA 1NLVA 3KHYA 2YHWA 4CJLA 2UYTA 1D9DA 2FSNA 4LF8K 2QWQA 1L5UA 3ZX2A 3G4SN 1WSGA 4FJ5A 3QFPA 4X65K 3EKUA 1HKBA 4DCHA 3O1WA 1BI4A 1YXQA 4R79A 4J2EA 3PY8A 5HRRA 1UWBA 1NK6A 2G8FA 2G8KA 3THXB 3J8AA 3O1BA 4KBOA 2E6MA 4DR3K 1FW6A 4AILC 3CC7N 4JKGB 4IZ9A 4BDZA 4CGFA 4W5QA 4BR5A 5GIPA 3O9SA 4NLCA 4Z94A 2G8IA 3I8DA 3OYKA 1I39A 4JHDA 1SAZA 2V52B 3NGZA 4LSLA 1EWRA 2RKIA 1NGJA 3KLEA 3DLHA 4YORA 4FLZA 3AVBA 2RPIA 3HPGA 4CESA 3LAMA 4EP4A 1J6ZA 3GOIA 3P38A 2QI2A 1UA0A 4MO4A 4A57A 4RW4A 2ZQBA 3GG4A 3HSCA 5CR4A 5JLHA 3SCXA 5GAHP 3MN9A 4FJKA 5JVGL 2UXDK 1BCMA 3ZEUB 5LJWA 4GV9A 1OH8A 3MXJA 3MDQA 1S72N 2P9SB 5AQFA 5AQWA 1JLBA 3WXMB 5KPRA 1GLFO 3T1HK 1SKSA 1N33K 4DLGA 2HHTA 3MXMA 3VQEA 3VQDA 1FKOA 3OYBA 4DQSA 4H5RA 3J7ZO 1CLQA 4JI1K 4LF5K 4CE9A 3O4NA 4CZFA 1QQCA 3ISNC 2D4WA 3O6WA 5CY4A 4B9NA 3BF3A 4KI4A 3KLFA 3CJBA 3ZSWA 2D0CA 4EFHA 3KLGA 3J7AP 1X1PA 5D3GA 4DWIA 2YHXA 3LDSA 2E88A 3MWPA 2PY5A 4I7FA 1QSSA 3OJUA 1WUAA 4CHPA 5M1QA 3HVTA 3NBPA 4YHHK 1OH7A 2O8EB 5HP1A 4BWMA 1ZBLA 3CJAA 4DTPA 4DQPA 4HTLA 3NGYA 3LDNA 2CH5A 3N4QA 3L6QA 4IKFA 4LSNA 4DFPA 1TGOA 3VQ6A 3TABA 2VQEK 4RTFD 3WNGA 4BQZA 4OO1J 4DV1K 3WNHA 5AQIA 5C15A 1YAGA 3ZT1A 4A5BA 3GL1A 2YNIA 3J80O 1QZ5A 1NKBA 2IIRA 1GLCG 1X9MA 3VQ7A 1NGEA 4BREA 4IDHA 1VQ9N 2HBJA 1KAXA 4CF0A 4IEIA 3KLIA 4M3XA 3E9LA 3OY9A 4FLXA 3ZX3A 1HJOA 1Z05A 4L8RB 4K41A 3QNNA 1VSEA 4JI0K 3O5BA 4DV2K 2QWPA 4FCYA 3SMSA 3CPEA 2HHWA 3UB5A 3E66A 1J9AA 2YHYA 1LCUA 1KFSA 2B5JA 3N4PA 4OPAA 1JKHA 1KFDA 3TSQA 4MDBA 4U67L 1WBDA 1A5VA 2Q0RA 4NO7A 3VA0A 3CC2N 4DTXA 3A2FA 4FLVA 2I7NA 1FKPA 4G1QA 4DTSA 3KVGA 2ASOA 4FVUA 3FGUA 4I9LA 3F2KA 1WSHA 1BA0A 4L3QA 4PA1A 4AHCA 4BC2A 5AQYA 3LP2A 1QE1A 1VSJA 1NOZA 4BE2A 5CZ2A 3HO1A 4CZMA 4FPBA 2W6KA 4E0DA 4M7YA 3WNEA 4B8AB 3AVCA 3VEZA 4IFYA 2OPSA 1OVQA 3VESA 4FLTA 1NOYA 3HP9A 2DFHA 1DGKN 5M1NA 1BIZA 2YKMA 3C0BA 1RDWX 3PO5A 4FJXA 3M1FA 1GOAA 1C0MA 1ATRA 2GBZA 1ATNA 2QXLA 2KHOA 2NZTA 3EO3A 4QAGA 4BGBA 1KLNA 4CZIA 2CH6A 2Q1NA 3U9DA 1DEJA 1QQOA 2NRXA 3TSPA 2UXCK 4CEFA 4GVMA 3AV9A 2E4LA 4LF4K 4FVMA 4B9SA 4CHOA 3PSFA 3V9XA 3O9UA 2WBNA 1SQKA 1F21A 2DY4A 3KK7A 1RTHA 4FWMA 4JKCA 4BRQA 3OYMA 4H0YB 3HBTA 2PZSA 4Q5VA 3FE1A 5F2RA 1KVCA 3IUCA 1EKEA 4H4MA 5CE3A 1S5JA 3D45A 4LFCK 3DWLA 2HVIA 4M41A 3L3VA 1S1TA 4BRIA 3M8PA 4NXMK 2Y1IA 4G9ZA 4BR2A 4K0KK 1IKYA 3QETA 4FOIA 2YJEA 3KZBA 5BPNA 4Z4GA 2OTJN 4JS4A 5JLFA 3IRXA 2ATQA 3LDOA 5AQQA 1NWKA 3OTOK 2E5LK 1JLCA 4C8MA 3CCLN 2FSJA 1VSHA 4DV7K 1Q82O 2CGLA 1KQSM 2UUBK 1XQSC 2KZZA 4CERA 1EP4A 4AHSA 4DLEA 3RWUA 4CHNA 1NM1A 3D2FA 5C24A 2V7ZA 3K9JA 5C10A 4B9MA 2GTDA 4FZZA 1YHQN 1IJJA 3T19A 3LZIA 3BGRA 4BRKA 3H08A 3LDQA 1U48A 2KLAA 1VSFA 1C0TA 5SZTA 3AY9A 5FPDA 4BDPA 3K59A 5LJVA 1U04A 1HYVA 1EQYA 3O80A 1G99A 4A61A 1NGGA 3R3LA 2HB5A 4DSLA 1IKXA 3THVA 4K43A 2P9IA 4DV3K 4XH1A 3CCSN 1R59O 4DSEA 2ZF5O 2G8HA 3GE1A 4CFCA 4E89A 2O8BA 3BP8A 4QS7A 1TKXA 4OVLA 5FRNA 4LH4A 4KHYA 4BRNA 1SV5A 1QS4A 2F9TA 2HHSA 4CJ3A 1HX1A 3C7NA 1FK9A 3U9ZA 1KLMA 1HQUA 3JXUA 3AAQA 4ZTFA 2P9LB 1D5AA 1RFQA 2NRVA 4CJ7A 4CGDA 2XRIA 1QSYA 3SV3A 3FLCO 3DJCA 1SKRA 2P51A 2VGNA 4JD2B 3GBTA 4Z4EA 4BRLA 4W5OA 3TARA 4DSIA 1T3VA 1K8KA 1Y64A 4GKKK 4FZYA 4DKWA 3JS6A 3QERA 3F73A 1S9EA 1NK0A 4B3OA 1LW0A 3AVKA 4FJIA 4WQ5C 2GUIA 2FF6A 4IG3A 4CGIA 5KRSA 3KWGA 3ID8A 3DRRA 3EE9A 5M1PA 5JMVA 2QTDA 3ZSXA 3CCMN 2ASPA 4CFBA 4CZKA 1NGAA 1U2VB 4DHYA 3NH1A 2ZJPL 1NJYA 1X9WA 1TK5A 3TSUA 1WNSA 1SS6A 4JYAK 3QIPA 1BHLA 5GAGP 5DMRA 3OBYA 4BR9A 4JKBA 4HUGA 1EETA 1ZC6A 4FJLA 4M3UA 4CEBA 2HF3A 3MCAB 3SBGA 3M8SA 2ZGYA 2FBVA 5AQZA 3V6DA 3G0ZA 4DG1A 3SYZA 2PAVA 5J2NA 4X62K 3E01A 3QIOA 4IFEA 3MK6A 4CEDA 3NE6A 3UKUB 1L3UA 2IS3A 4Y1CA 3P1GA 5BRFA 1S1VA 3PSIA 3ZT0A 4TSXA 4CEAA 4R5PA 3QO9A 4HWIA 1NKCA 4F2RA 3MEGA 3ZETB
chains in the Genus database with same CATH topology
1ASVA 3WNFA 4RW7A 4E7HA 3AO4A 4CF8A 4XIUA 4AILC 2P5OA 3ASMA 1ZBHA 5FDLA 4BDZA 2KQ2A 5HLFA 2OPPA 2FC0A 2X6SA 4CGFA 4W5QA 1TV6A 3NH2A 3K5LA 1TK0A 2D0AA 2W42A 4HUFA 3U3YA 4UQGA 4RW9A 2O4GA 5EU7A 2QXFA 1YT3A 3L3UA 2G8IA 1C1BA 3I8DA 1JLEA 2KW4A 1R0AA 3OYKA 1A5WA 1I39A 1T7PA 5FRMA 3ZSQA 3ZT4A 4CGJA 4OPJA 4LSLA 3NGZA 3SPYA 4N41A 1BCOA 4DQIA 2RKIA 4NCGA 2HHXA 4QCLA 1D8YA 3V1RA 4KTZA 3KLEA 3SZ2A 3ZT3A 1D9FA 3DLHA 1VRTA 5J2QA 2ITGA 3NHGA 4FLZA 3TAEA 1JLFA 1ZBUA 2FBTA 3LALA 4E1MA 3L2RA 3AVBA 2RPIA 4BE0A 3HPGA 4CESA 3LAMA 4EP4A 4I9QA 1VSLA 4ICLA 1J54A 2QK9A 3AVLA 1RDDA 4K8ZA 1ASUA 1UA0A 3QINA 1C0UA 3L2WA 2DTUA 4O4GA 1S6QA 2ZQBA 2B6AA 4RW4A 3PX4A 4KTWA 3SCXA 3OYJA 1O1WA 3ZSRA 1KTQA 3AO2A 3SUPA 4OKJA 3AO1A 4CF9A 4FJKA 1BCMA 3JSMA 1U4BA 1U49A 3SQ0A 3NH0A 2XY6A 2Q3SA 2HMIA 1IO2A 3MXJA 4OPKA 3AVJA 3VQ4A 4CHZA 1JLBA 1RDBA 3RR8A 4ID5A 5FROA 2F8SA 1XWLA 1SKSA 4DMNA 3LWMA 3VA3A 2PYJA 4DFJA 3CQ8A 3RMCA 4DLGA 2HHTA 3MXMA 4ELUA 3VQEA 2HHUA 3VQDA 1FKOA 5CZ1A 3OYBA 3OYLA 1JLQA 4FM0A 4DQSA 5HROA 1SKWA 4KV8A 1RT6A 3S9HA 4FK2A 3SUQA 1SL0A 3AVMA 1CLQA 4EP5A 3CYMA 4CE9A 3O4NA 3QEXA 2IDOA 4CK3A 1QQCA 3ISNC 3TWHA 3SI6A 5CY4A 4B9NA 2QKBA 5KTQA 4N56A 2HW3A 3TANA 4KI4A 4QOZB 4IG0A 3OYCA 3KLFA 2JLEA 1NJXA 3ZSWA 3K58A 2D0CA 2I5JA 3MECA 1DLOA 3OYEA 5J2PA 4F2SA 1JXBA 3KLGA 4AHRA 3EY1A 3M8RA 1X1PA 5D3GA 1T05A 4FK4A 4DWIA 3LDSA 4DSFA 4KPYA 1LWEA 1YVUA 4CJ5A 3K5OA 3LANA 4I7FA 3V9SA 3OJUA 1C6VA 1QSSA 2PY5A 2BGGA 2D5RA 4CHPA 3ZSOA 2R7YA 3HVTA 2P1JA 3NBPA 1LAVA 3NF6A 1NK9A 2KZMA 2QKKA 5HP1A 4BWMA 1ZBLA 4B08A 3ULDA 1ZYQA 1RBUA 3RTVA 4DQQA 4W5RA 4DTPA 4DQPA 1NK8A 3NGYA 4HTUA 5C25A 4FW1A 4IKFA 5KRTA 4LSNA 4OKEA 2Z1JA 4CHYA 1RT7A 2HNDA 4Z4IA 2BE2A 1JL2A 4DFPA 4DSKA 2IAJA 2EX3A 1TGOA 5CYMA 4IFVA 3VQ6A 3TABA 4KB0A 3C6TA 4CJRA 4KFBA 3KJVA 3WNGA 3SV4A 2JGUA 1B92A 4CHQA 3WNHA 4FJ9A 1W0HA 2HNZA 3C94A 3DOLA 3VQBA 3O3GA 1C1CA 4CK2A 3OYHA 2OPQA 3ZT1A 1BISA 2XHBA 2IC3A 1L3VA 2YNIA 3CFPA 3SNNA 1RDAA 1C1AA 3NDKA 1NKBA 3LPUA 3OS1A 3G10A 4KHQA 1S1UA 1X9MA 1CXQA 4CJKA 3VQ7A 3O3HA 3TAPA 3AVHA 4LD0A 1QTMA 1L3SA 2WONA 4CF0A 3KLIA 3L2UA 4M3XA 3OY9A 2P5GA 4Z4FA 4AHTA 4FLXA 3AVFA 1TVRA 4L8RB 4HCBA 2X78A 4M3TA 1RBSA 3QNNA 1U47A 1VSEA 1DTTA 4C8LA 3QEWA 3TR8A 3ZCMA 4N5SA 1S6PA 4FCYA 1TK8A 3KK1A 4W5TA 4O0IA 4NYFA 2HHWA 4LH5A 4KHUA 1RTIA 4M45A 1J9AA 4F8RA 2XO7A 1RCHA 3ZSYA 4FK0A 2B4JA 1LV5A 1KSPA 4FXDA 1HYSA 4J2BA 1KFSA 3QESA 2B5JA 3OJSA 4CJUA 3EZ5A 4HHTA 4Z4HA 1JKHA 1KFDA 3I0RA 3MEDA 2YKNA 3K5NA 1GOCA 1UAXA 3ZT2A 3L2VA 3V9ZA 1EX4A 4PQUA 3V1QA 4JRQA 3SQ4A 1SL1A 1A5VA 4MFBA 1WLJA 3DYAA 4CGHA 1NK4A 3VA0A 4N47A 1RT2A 1S1XA 3B6OA 4BACA 3T3FA 1HRHA 1JLAA 4DTXA 4DU4A 3VN5A 1XI1A 1IH7A 3NCIA 5HRNA 3A2FA 3C95A 4FLVA 1FKPA 4G1QA 4DTSA 1Q8IA 3PY8A 4I9LA 1WSHA 4JS5A 4H8KA 4PA1A 3MAQA 4CF2A 4AHCA 1I3AA 4FLWA 4M3RA 1NJZA 1RT3A 4FJMA 3LP2A 1QE1A 1VSJA 4CEEA 4CEZA 3CFOA 1NOZA 3DLBA 3P83D 4BE2A 5CZ2A 3HO1A 4E3SA 4DTMA 4ZHRA 3DOKA 1WAFA 1IG9A 1VRUA 2OA8A 1LW2A 3OYGA 1BQNA 4E0DA 3QNOA 1GOBA 3LP0A 3WNEA 4B8AB 3AVCA 4YFUA 4IFYA 4FM2A 2OPSA 4KHSA 4KRFA 3LPTA 1TKDA 1Q9XA 3T1AA 3HM9A 2EHGA 4FLTA 1NOYA 2IOCA 3HP9A 2DFHA 1LWCA 3DM2A 3KKRA 1BIZA 1BI4B 2YKMA 4O0JA 4N76A 4OKKA 1J5OA 3PO5A 4FJXA 3LAKA 1GOAA 1C0MA 4I2PA 5CYQA 4CJSA 2GBZA 4NCBA 3HJFA 4CJWA 2KTQA 4QAGA 1BGXT 1S1WA 2VG6A 1KLNA 1N5YA 3HK2A 1TKZA 3AA3A 4CFDA 3OYDA 4DF8A 1ASWA 2YHBA 3EYZA 3MEEA 4DTJA 4GMJB 4CJTA 3SUOA 2G8UA 2DFEA 2F96A 2Z1HA 2XY8A 4CEFA 2Z1IA 4GVMA 3AV9A 3TAFA 4EZ6A 3M8QA 5J1EA 1NK5A 3MXIA 3TI0A 1RNHA 2ETJA 3KTQA 2E4LA 2YNHA 3PUFA 1VSKA 4H4OA 4FVMA 4C8NA 1EXQA 3VQ8A 4B9UA 4B9SA 3CM5A 4CF1A 3DI6A 4CHOA 3QEPA 1HNVA 4KREA 3FFIA 1B9DA 4DS4A 4J2DA 3V9WA 3V9XA 1RBRA 3AVGA 3ZSZA 4FLYA 3DLRA 3HVRA 4FJ8A 4DU1A 1F21A 2DY4A 1RTHA 3U6FA 4JLHA 3TAGA 2WOMA 1Y97A 4IDKA 2HHQA 4AHVA 4FJHA 4M3YA 3OYMA 2PZSA 3AA4A 4Q5VA 1KRPA 3DMJA 3HP6A 1KVCA 1IKVA 1WN7A 4DSJA 3OS0A 1EKEA 2FBYA 1TL3A 4H4MA 1S5JA 2YHAA 4Z4CA 3D45A 1RT1A 1N6QA 1CZ9A 4CJVA 4B9VA 5I3UA 2HVIA 3O4QA 2IGIA 3L3VA 4GW6A 1S1TA 4M41A 2KFNA 1UOCA 3M8PA 2Y1IA 2E6LA 4F3TA 1VSIA 3B6PA 3V9UA 2LSNA 3IG1A 1IKYA 3QETA 2YNGA 3NFAA 1RT4A 3DLEA 4HUEA 4E7JA 4OGEA 4Z4GA 4CJ4A 4DFMA 4JS4A 3UIQA 1TKTA 2YV0X 3HL8A 3IRXA 4F4KA 3CM6A 2ATQA 3SPZA 4RW8A 1KVBA 1QHTA 5HRPA 1JLCA 2ZD1A 4C8MA 1VSHA 3K5MA 3RMDA 3AVAA 2OZMA 4W5NA 2DFFA 4WE1A 2KZZA 1WAJA 2BANA 3LWLA 4CERA 1EP4A 4AHSA 4DLEA 4M3WA 3V81A 3L8BA 1YTUA 5C42A 2VWKA 1KCFA 2Z1GA 4AH9A 3RRGA 4NYNA 4CHNA 3VQ5A 3D0PA 3RWUA 4KAZA 4OLAA 3DRSA 2HHVA 5C24A 4FW2A 2ZE2A 4OGCA 4FJNA 4B9MA 3HT3A 3NAEA 2VG7A 2X6NA 1SUQA 4FZZA 3VQQA 1Q9YA 3HPHA 4K8XA 3PO4A 1A5XA 3T19A 3VQPA 4ZTJA 4FJ7A 3PX6A 4NCAA 3LZIA 3OYFA 3BGRA 3P5JA 3SJJA 3H08A 4AHUA 3RMAA 2YNFA 1U48A 3JYTA 3NF8A 4KO0A 3CFRA 1TL1A 4M42A 4KHWA 2RF2A 1XHZA 1VSFA 1C0TA 3LP1A 4RG8A 1W9HA 5SZTA 3HPOA 4EZ9A 1SL2A 4BDPA 2XY7A 3K59A 1RT5A 2AJQA 1U04A 3LP3A 4B8CA 1HYVA 4CIFA 4IBNA 4M3ZA 3HXMA 4DSLA 2HB5A 3DLGA 1IKXA 3THVA 1XC9A 1WSIA 4ID1A 4CEOA 4CJPA 4DSEA 4BDYA 5I42A 4RW6A 3K57A 3KK3A 2G8HA 1HNIA 2OPRA 3ALYA 4LY7A 1LWFA 4CFCA 4CK1A 4E89A 3RMBA 4KKOA 4KHNA 2OYQA 1HMVA 3C6UA 1J53A 1T03A 4KI6A 1TKXA 4E1NA 1YTAA 3DRPA 4OVLA 3VQAA 3OYIA 4FZXC 2FBXA 5FRNA 4LH4A 4KHYA 1SV5A 1QS4A 5HRSA 1B9FA 2HHSA 3QEIA 4CJ3A 4CJEA 3IAYA 4BE1A 4ELVA 4CECA 5K14A 1FK9A 3NF9A 3HSTB 1KLMA 1HQUA 4CEQA 4OJRA 4JRPA 3PV8A 4ZTFA 4CIGA 2XY5A 2RN2A 1CZBA 1D5AA 4E7LA 4DTUA 4Z0UA 3S3MA 4CGDA 1NJWA 1TAUA 1FXXA 2A1SA 2XRIA 4DTOA 3I0SA 1JL1A 4HCCA 5KGWA 1K6YA 3SUNA 1U45A 3V1OA 1QSYA 3BDPA 3SV3A 3QEVA 4DTNA 2BDPA 3KD5E 4HVJA 4CIEA 1SKRA 2P51A 5JS2A 4E19A 1Z25A 4Z4EA 1VSMA 4W5OA 1JLGA 1ZBIA 3HYFA 3AA5X 3AA2A 3AO3A 3OYNA 4FM1A 3TARA 4DSIA 4FLUA 4DTRA 4C8KA 4PWDA 3OVNA 5SWMA 4FZYA 3IS9A 3QERA 3F73A 1G15A 1L3TA 2PYLA 1S9EA 1HJRA 1S9GA 3DLKA 4O44A 1NK0A 4B3OA 3TAMA 5KI6A 2D0BA 4DU3A 1LW0A 3AVKA 3NF7A 5DK5A 4FJIA 3LZJA 4KTQA 3L2QA 1RDCA 1UA1A 2GUIA 4B9LA 3K2PA 4IG3A 4CGIA 5KRSA 4E7KA 4ELTA 2O4IA 1RBVA 5JS1A 1ZBFA 3KK2A 1WSEA 3DRRA 4Y1DA 3KLHA 2NUBA 3VQ9A 1T8EA 3CG7A 3ZSXA 1MU2A 2VWJA 5HBMA 4MQ3A 1NKEA 4J2AA 4CGGA 4CFBA 3AO5A 3SQ1A 3S3NA 4PUOA 3KIOA 1HPZA 3S3OA 4PY5A 1LAWA 3NH1A 3F9KA 1DTQA 4FJJA 4DQRA 1WSJA 1X9WA 1NJYA 1RBTA 1VSDA 1HYZA 4OLBA 4BWJA 4DFKA 4E7IA 2VG5A 1TK5A 1WNSA 5E41A 3OYAA 1CXUA 1BHLA 1ITGA 3QIPA 4O5BA 3ITHA 4YNQA 1RTDA 1Z26A 5DMRA 4F3OA 2HVHA 3U3GA 3ZSVA 4HUGA 2X74A 4FYDA 1EETA 1WSFA 2HNYA 3KD1E 4B9TA 4FJLA 4CJLA 2OZSA 1D9DA 4M3UA 4CEBA 1BL3A 1L5UA 4KB1A 4DF4A 3RR7A 1VK0A 3M8SA 1WSGA 4FJ5A 2FBVA 1KVAA 1RILA 5T7BA 3AVNA 3G0ZA 3QLHA 4DG1A 3OS2A 3SYZA 3V6DA 2KFZA 3PX0A 5J2NA 4CCHA 4C8OA 4DS5A 4Q0BA 3E01A 2G8VA 1BI4A 3QIOA 3O3FA 4CJFA 4J2EA 1REVA 3KKSA 4CEDA 1JXEA 5HRRA 4CFAA 3VQCA 3NE6A 5J2MA 1NK7A 5KGXA 4CJQA 3V4IA 3SQ2A 3TAQA 1RTJA 2IS3A 1L3UA 4Y1CA 3P1GA 1XHXA 1UWBA 4O55A 2G8WA 1S1VA 2A1RA 1NK6A 3ZT0A 4TSXA 4FJGA 4CEAA 2G8FA 3AVIA 4F2RA 4R5PA 2F8TA 2G8KA 1QSLA 1IKWA 2GV9A 1TAQA 1X9SA 3RRHA 1HQEA 3QO9A 1BIUA 1BQMA 1NKCA 4I2QA 3NGIA 2Y1JA 3MEGA 2E6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASV A;  3WNF A;  4RW7 A;  4E7H A;  3AO4 A;  4CF8 A;  4XIU A;  4AIL C;  2P5O A;  3ASM A;  1ZBH A;  5FDL A;  4BDZ A;  2KQ2 A;  5HLF A;  2OPP A;  2FC0 A;  2X6S A;  4CGF A;  4W5Q A;  1TV6 A;  3NH2 A;  3K5L A;  1TK0 A;  2D0A A;  2W42 A;  4HUF A;  3U3Y A;  4UQG A;  4RW9 A;  2O4G A;  5EU7 A;  2QXF A;  1YT3 A;  3L3U A;  2G8I A;  1C1B A;  3I8D A;  1JLE A;  2KW4 A;  1R0A A;  3OYK A;  1A5W A;  1I39 A;  1T7P A;  5FRM A;  3ZSQ A;  3ZT4 A;  4CGJ A;  4OPJ A;  4LSL A;  3NGZ A;  3SPY A;  4N41 A;  1BCO A;  4DQI A;  2RKI A;  4NCG A;  2HHX A;  4QCL A;  1D8Y A;  3V1R A;  4KTZ A;  3KLE A;  3SZ2 A;  3ZT3 A;  1D9F A;  3DLH A;  1VRT A;  5J2Q A;  2ITG A;  3NHG A;  4FLZ A;  3TAE A;  1JLF A;  1ZBU A;  2FBT A;  3LAL A;  4E1M A;  3L2R A;  3AVB A;  2RPI A;  4BE0 A;  3HPG A;  4CES A;  3LAM A;  4EP4 A;  4I9Q A;  1VSL A;  4ICL A;  1J54 A;  2QK9 A;  3AVL A;  1RDD A;  4K8Z A;  1ASU A;  1UA0 A;  3QIN A;  1C0U A;  3L2W A;  2DTU A;  4O4G A;  1S6Q A;  2ZQB A;  2B6A A;  4RW4 A;  3PX4 A;  4KTW A;  3SCX A;  3OYJ A;  1O1W A;  3ZSR A;  1KTQ A;  3AO2 A;  3SUP A;  4OKJ A;  3AO1 A;  4CF9 A;  4FJK A;  1BCM A;  3JSM A;  1U4B A;  1U49 A;  3SQ0 A;  3NH0 A;  2XY6 A;  2Q3S A;  2HMI A;  1IO2 A;  3MXJ A;  4OPK A;  3AVJ A;  3VQ4 A;  4CHZ A;  1JLB A;  1RDB A;  3RR8 A;  4ID5 A;  5FRO A;  2F8S A;  1XWL A;  1SKS A;  4DMN A;  3LWM A;  3VA3 A;  2PYJ A;  4DFJ A;  3CQ8 A;  3RMC A;  4DLG A;  2HHT A;  3MXM A;  4ELU A;  3VQE A;  2HHU A;  3VQD A;  1FKO A;  5CZ1 A;  3OYB A;  3OYL A;  1JLQ A;  4FM0 A;  4DQS A;  5HRO A;  1SKW A;  4KV8 A;  1RT6 A;  3S9H A;  4FK2 A;  3SUQ A;  1SL0 A;  3AVM A;  1CLQ A;  4EP5 A;  3CYM A;  4CE9 A;  3O4N A;  3QEX A;  2IDO A;  4CK3 A;  1QQC A;  3ISN C;  3TWH A;  3SI6 A;  5CY4 A;  4B9N A;  2QKB A;  5KTQ A;  4N56 A;  2HW3 A;  3TAN A;  4KI4 A;  4QOZ B;  4IG0 A;  3OYC A;  3KLF A;  2JLE A;  1NJX A;  3ZSW A;  3K58 A;  2D0C A;  2I5J A;  3MEC A;  1DLO A;  3OYE A;  5J2P A;  4F2S A;  1JXB A;  3KLG A;  4AHR A;  3EY1 A;  3M8R A;  1X1P A;  5D3G A;  1T05 A;  4FK4 A;  4DWI A;  3LDS A;  4DSF A;  4KPY A;  1LWE A;  1YVU A;  4CJ5 A;  3K5O A;  3LAN A;  4I7F A;  3V9S A;  3OJU A;  1C6V A;  1QSS A;  2PY5 A;  2BGG A;  2D5R A;  4CHP A;  3ZSO A;  2R7Y A;  3HVT A;  2P1J A;  3NBP A;  1LAV A;  3NF6 A;  1NK9 A;  2KZM A;  2QKK A;  5HP1 A;  4BWM A;  1ZBL A;  4B08 A;  3ULD A;  1ZYQ A;  1RBU A;  3RTV A;  4DQQ A;  4W5R A;  4DTP A;  4DQP A;  1NK8 A;  3NGY A;  4HTU A;  5C25 A;  4FW1 A;  4IKF A;  5KRT A;  4LSN A;  4OKE A;  2Z1J A;  4CHY A;  1RT7 A;  2HND A;  4Z4I A;  2BE2 A;  1JL2 A;  4DFP A;  4DSK A;  2IAJ A;  2EX3 A;  1TGO A;  5CYM A;  4IFV A;  3VQ6 A;  3TAB A;  4KB0 A;  3C6T A;  4CJR A;  4KFB A;  3KJV A;  3WNG A;  3SV4 A;  2JGU A;  1B92 A;  4CHQ A;  3WNH A;  4FJ9 A;  1W0H A;  2HNZ A;  3C94 A;  3DOL A;  3VQB A;  3O3G A;  1C1C A;  4CK2 A;  3OYH A;  2OPQ A;  3ZT1 A;  1BIS A;  2XHB A;  2IC3 A;  1L3V A;  2YNI A;  3CFP A;  3SNN A;  1RDA A;  1C1A A;  3NDK A;  1NKB A;  3LPU A;  3OS1 A;  3G10 A;  4KHQ A;  1S1U A;  1X9M A;  1CXQ A;  4CJK A;  3VQ7 A;  3O3H A;  3TAP A;  3AVH A;  4LD0 A;  1QTM A;  1L3S A;  2WON A;  4CF0 A;  3KLI A;  3L2U A;  4M3X A;  3OY9 A;  2P5G A;  4Z4F A;  4AHT A;  4FLX A;  3AVF A;  1TVR A;  4L8R B;  4HCB A;  2X78 A;  4M3T A;  1RBS A;  3QNN A;  1U47 A;  1VSE A;  1DTT A;  4C8L A;  3QEW A;  3TR8 A;  3ZCM A;  4N5S A;  1S6P A;  4FCY A;  1TK8 A;  3KK1 A;  4W5T A;  4O0I A;  4NYF A;  2HHW A;  4LH5 A;  4KHU A;  1RTI A;  4M45 A;  1J9A A;  4F8R A;  2XO7 A;  1RCH A;  3ZSY A;  4FK0 A;  2B4J A;  1LV5 A;  1KSP A;  4FXD A;  1HYS A;  4J2B A;  1KFS A;  3QES A;  2B5J A;  3OJS A;  4CJU A;  3EZ5 A;  4HHT A;  4Z4H A;  1JKH A;  1KFD A;  3I0R A;  3MED A;  2YKN A;  3K5N A;  1GOC A;  1UAX A;  3ZT2 A;  3L2V A;  3V9Z A;  1EX4 A;  4PQU A;  3V1Q A;  4JRQ A;  3SQ4 A;  1SL1 A;  1A5V A;  4MFB A;  1WLJ A;  3DYA A;  4CGH A;  1NK4 A;  3VA0 A;  4N47 A;  1RT2 A;  1S1X A;  3B6O A;  4BAC A;  3T3F A;  1HRH A;  1JLA A;  4DTX A;  4DU4 A;  3VN5 A;  1XI1 A;  1IH7 A;  3NCI A;  5HRN A;  3A2F A;  3C95 A;  4FLV A;  1FKP A;  4G1Q A;  4DTS A;  1Q8I A;  3PY8 A;  4I9L A;  1WSH A;  4JS5 A;  4H8K A;  4PA1 A;  3MAQ A;  4CF2 A;  4AHC A;  1I3A A;  4FLW A;  4M3R A;  1NJZ A;  1RT3 A;  4FJM A;  3LP2 A;  1QE1 A;  1VSJ A;  4CEE A;  4CEZ A;  3CFO A;  1NOZ A;  3DLB A;  3P83 D;  4BE2 A;  5CZ2 A;  3HO1 A;  4E3S A;  4DTM A;  4ZHR A;  3DOK A;  1WAF A;  1IG9 A;  1VRU A;  2OA8 A;  1LW2 A;  3OYG A;  1BQN A;  4E0D A;  3QNO A;  1GOB A;  3LP0 A;  3WNE A;  4B8A B;  3AVC A;  4YFU A;  4IFY A;  4FM2 A;  2OPS A;  4KHS A;  4KRF A;  3LPT A;  1TKD A;  1Q9X A;  3T1A A;  3HM9 A;  2EHG A;  4FLT A;  1NOY A;  2IOC A;  3HP9 A;  2DFH A;  1LWC A;  3DM2 A;  3KKR A;  1BIZ A;  1BI4 B;  2YKM A;  4O0J A;  4N76 A;  4OKK A;  1J5O A;  3PO5 A;  4FJX A;  3LAK A;  1GOA A;  1C0M A;  4I2P A;  5CYQ A;  4CJS A;  2GBZ A;  4NCB A;  3HJF A;  4CJW A;  2KTQ A;  4QAG A;  1BGX T;  1S1W A;  2VG6 A;  1KLN A;  1N5Y A;  3HK2 A;  1TKZ A;  3AA3 A;  4CFD A;  3OYD A;  4DF8 A;  1ASW A;  2YHB A;  3EYZ A;  3MEE A;  4DTJ A;  4GMJ B;  4CJT A;  3SUO A;  2G8U A;  2DFE A;  2F96 A;  2Z1H A;  2XY8 A;  4CEF A;  2Z1I A;  4GVM A;  3AV9 A;  3TAF A;  4EZ6 A;  3M8Q A;  5J1E A;  1NK5 A;  3MXI A;  3TI0 A;  1RNH A;  2ETJ A;  3KTQ A;  2E4L A;  2YNH A;  3PUF A;  1VSK A;  4H4O A;  4FVM A;  4C8N A;  1EXQ A;  3VQ8 A;  4B9U A;  4B9S A;  3CM5 A;  4CF1 A;  3DI6 A;  4CHO A;  3QEP A;  1HNV A;  4KRE A;  3FFI A;  1B9D A;  4DS4 A;  4J2D A;  3V9W A;  3V9X A;  1RBR A;  3AVG A;  3ZSZ A;  4FLY A;  3DLR A;  3HVR A;  4FJ8 A;  4DU1 A;  1F21 A;  2DY4 A;  1RTH A;  3U6F A;  4JLH A;  3TAG A;  2WOM A;  1Y97 A;  4IDK A;  2HHQ A;  4AHV A;  4FJH A;  4M3Y A;  3OYM A;  2PZS A;  3AA4 A;  4Q5V A;  1KRP A;  3DMJ A;  3HP6 A;  1KVC A;  1IKV A;  1WN7 A;  4DSJ A;  3OS0 A;  1EKE A;  2FBY A;  1TL3 A;  4H4M A;  1S5J A;  2YHA A;  4Z4C A;  3D45 A;  1RT1 A;  1N6Q A;  1CZ9 A;  4CJV A;  4B9V A;  5I3U A;  2HVI A;  3O4Q A;  2IGI A;  3L3V A;  4GW6 A;  1S1T A;  4M41 A;  2KFN A;  1UOC A;  3M8P A;  2Y1I A;  2E6L A;  4F3T A;  1VSI A;  3B6P A;  3V9U A;  2LSN A;  3IG1 A;  1IKY A;  3QET A;  2YNG A;  3NFA A;  1RT4 A;  3DLE A;  4HUE A;  4E7J A;  4OGE A;  4Z4G A;  4CJ4 A;  4DFM A;  4JS4 A;  3UIQ A;  1TKT A;  2YV0 X;  3HL8 A;  3IRX A;  4F4K A;  3CM6 A;  2ATQ A;  3SPZ A;  4RW8 A;  1KVB A;  1QHT A;  5HRP A;  1JLC A;  2ZD1 A;  4C8M A;  1VSH A;  3K5M A;  3RMD A;  3AVA A;  2OZM A;  4W5N A;  2DFF A;  4WE1 A;  2KZZ A;  1WAJ A;  2BAN A;  3LWL A;  4CER A;  1EP4 A;  4AHS A;  4DLE A;  4M3W A;  3V81 A;  3L8B A;  1YTU A;  5C42 A;  2VWK A;  1KCF A;  2Z1G A;  4AH9 A;  3RRG A;  4NYN A;  4CHN A;  3VQ5 A;  3D0P A;  3RWU A;  4KAZ A;  4OLA A;  3DRS A;  2HHV A;  5C24 A;  4FW2 A;  2ZE2 A;  4OGC A;  4FJN A;  4B9M A;  3HT3 A;  3NAE A;  2VG7 A;  2X6N A;  1SUQ A;  4FZZ A;  3VQQ A;  1Q9Y A;  3HPH A;  4K8X A;  3PO4 A;  1A5X A;  3T19 A;  3VQP A;  4ZTJ A;  4FJ7 A;  3PX6 A;  4NCA A;  3LZI A;  3OYF A;  3BGR A;  3P5J A;  3SJJ A;  3H08 A;  4AHU A;  3RMA A;  2YNF A;  1U48 A;  3JYT A;  3NF8 A;  4KO0 A;  3CFR A;  1TL1 A;  4M42 A;  4KHW A;  2RF2 A;  1XHZ A;  1VSF A;  1C0T A;  3LP1 A;  4RG8 A;  1W9H A;  5SZT A;  3HPO A;  4EZ9 A;  1SL2 A;  4BDP A;  2XY7 A;  3K59 A;  1RT5 A;  2AJQ A;  1U04 A;  3LP3 A;  4B8C A;  1HYV A;  4CIF A;  4IBN A;  4M3Z A;  3HXM A;  4DSL A;  2HB5 A;  3DLG A;  1IKX A;  3THV A;  1XC9 A;  1WSI A;  4ID1 A;  4CEO A;  4CJP A;  4DSE A;  4BDY A;  5I42 A;  4RW6 A;  3K57 A;  3KK3 A;  2G8H A;  1HNI A;  2OPR A;  3ALY A;  4LY7 A;  1LWF A;  4CFC A;  4CK1 A;  4E89 A;  3RMB A;  4KKO A;  4KHN A;  2OYQ A;  1HMV A;  3C6U A;  1J53 A;  1T03 A;  4KI6 A;  1TKX A;  4E1N A;  1YTA A;  3DRP A;  4OVL A;  3VQA A;  3OYI A;  4FZX C;  2FBX A;  5FRN A;  4LH4 A;  4KHY A;  1SV5 A;  1QS4 A;  5HRS A;  1B9F A;  2HHS A;  3QEI A;  4CJ3 A;  4CJE A;  3IAY A;  4BE1 A;  4ELV A;  4CEC A;  5K14 A;  1FK9 A;  3NF9 A;  3HST B;  1KLM A;  1HQU A;  4CEQ A;  4OJR A;  4JRP A;  3PV8 A;  4ZTF A;  4CIG A;  2XY5 A;  2RN2 A;  1CZB A;  1D5A A;  4E7L A;  4DTU A;  4Z0U A;  3S3M A;  4CGD A;  1NJW A;  1TAU A;  1FXX A;  2A1S A;  2XRI A;  4DTO A;  3I0S A;  1JL1 A;  4HCC A;  5KGW A;  1K6Y A;  3SUN A;  1U45 A;  3V1O A;  1QSY A;  3BDP A;  3SV3 A;  3QEV A;  4DTN A;  2BDP A;  3KD5 E;  4HVJ A;  4CIE A;  1SKR A;  2P51 A;  5JS2 A;  4E19 A;  1Z25 A;  4Z4E A;  1VSM A;  4W5O A;  1JLG A;  1ZBI A;  3HYF A;  3AA5 X;  3AA2 A;  3AO3 A;  3OYN A;  4FM1 A;  3TAR A;  4DSI A;  4FLU A;  4DTR A;  4C8K A;  4PWD A;  3OVN A;  5SWM A;  4FZY A;  3IS9 A;  3QER A;  3F73 A;  1G15 A;  1L3T A;  2PYL A;  1S9E A;  1HJR A;  1S9G A;  3DLK A;  4O44 A;  1NK0 A;  4B3O A;  3TAM A;  5KI6 A;  2D0B A;  4DU3 A;  1LW0 A;  3AVK A;  3NF7 A;  5DK5 A;  4FJI A;  3LZJ A;  4KTQ A;  3L2Q A;  1RDC A;  1UA1 A;  2GUI A;  4B9L A;  3K2P A;  4IG3 A;  4CGI A;  5KRS A;  4E7K A;  4ELT A;  2O4I A;  1RBV A;  5JS1 A;  1ZBF A;  3KK2 A;  1WSE A;  3DRR A;  4Y1D A;  3KLH A;  2NUB A;  3VQ9 A;  1T8E A;  3CG7 A;  3ZSX A;  1MU2 A;  2VWJ A;  5HBM A;  4MQ3 A;  1NKE A;  4J2A A;  4CGG A;  4CFB A;  3AO5 A;  3SQ1 A;  3S3N A;  4PUO A;  3KIO A;  1HPZ A;  3S3O A;  4PY5 A;  1LAW A;  3NH1 A;  3F9K A;  1DTQ A;  4FJJ A;  4DQR A;  1WSJ A;  1X9W A;  1NJY A;  1RBT A;  1VSD A;  1HYZ A;  4OLB A;  4BWJ A;  4DFK A;  4E7I A;  2VG5 A;  1TK5 A;  1WNS A;  5E41 A;  3OYA A;  1CXU A;  1BHL A;  1ITG A;  3QIP A;  4O5B A;  3ITH A;  4YNQ A;  1RTD A;  1Z26 A;  5DMR A;  4F3O A;  2HVH A;  3U3G A;  3ZSV A;  4HUG A;  2X74 A;  4FYD A;  1EET A;  1WSF A;  2HNY A;  3KD1 E;  4B9T A;  4FJL A;  4CJL A;  2OZS A;  1D9D A;  4M3U A;  4CEB A;  1BL3 A;  1L5U A;  4KB1 A;  4DF4 A;  3RR7 A;  1VK0 A;  3M8S A;  1WSG A;  4FJ5 A;  2FBV A;  1KVA A;  1RIL A;  5T7B A;  3AVN A;  3G0Z A;  3QLH A;  4DG1 A;  3OS2 A;  3SYZ A;  3V6D A;  2KFZ A;  3PX0 A;  5J2N A;  4CCH A;  4C8O A;  4DS5 A;  4Q0B A;  3E01 A;  2G8V A;  1BI4 A;  3QIO A;  3O3F A;  4CJF A;  4J2E A;  1REV A;  3KKS A;  4CED A;  1JXE A;  5HRR A;  4CFA A;  3VQC A;  3NE6 A;  5J2M A;  1NK7 A;  5KGX A;  4CJQ A;  3V4I A;  3SQ2 A;  3TAQ A;  1RTJ A;  2IS3 A;  1L3U A;  4Y1C A;  3P1G A;  1XHX A;  1UWB A;  4O55 A;  2G8W A;  1S1V A;  2A1R A;  1NK6 A;  3ZT0 A;  4TSX A;  4FJG A;  4CEA A;  2G8F A;  3AVI A;  4F2R A;  4R5P A;  2F8T A;  2G8K A;  1QSL A;  1IKW A;  2GV9 A;  1TAQ A;  1X9S A;  3RRH A;  1HQE A;  3QO9 A;  1BIU A;  1BQM A;  1NKC A;  4I2Q A;  3NGI A;  2Y1J A;  3MEG A;  2E6M A; 
#chains in the Genus database with same CATH topology
 4RW7 A;  3ASM A;  1CZA N;  3QFU A;  1NMN A;  3NH2 A;  1TK0 A;  1T6C A;  3HZ6 A;  5EU7 A;  3DXK A;  2D1K A;  3ZT4 A;  4CGJ A;  3QBX A;  3SPY A;  4N41 A;  4DQI A;  2HHX A;  1D8Y A;  3CCU N;  3SZ2 A;  4CVN E;  3WQU A;  3TAE A;  4BRD A;  3LAL A;  3L2R A;  5EOY A;  1VSL A;  3P4I A;  4WFN L;  2RE2 A;  1J54 A;  3AVL A;  1RDD A;  2HOE A;  1ASU A;  3S41 A;  4DUZ K;  1C0U A;  4FPA A;  2DTU A;  4ILG B;  5IWA K;  3J81 O;  3OYJ A;  1ZXO A;  3SUP A;  4OKJ A;  3JSM A;  3I56 N;  1U49 A;  2HMI A;  1IO2 A;  3DLL L;  1YJN N;  3EZW A;  3A5L C;  1RDB A;  4CHZ A;  3RR8 A;  2F8S A;  1NU0 A;  2A40 A;  1N34 K;  2PYJ A;  1NGH A;  3LM9 A;  3LM2 A;  4FM0 A;  1SKW A;  4KV8 A;  3SUQ A;  3VF4 A;  1MWM A;  3CYM A;  2IDO A;  3TWH A;  3SI6 A;  4IG0 A;  4BGA A;  2JLE A;  2W6L A;  3K58 A;  3THY A;  2NRH A;  3MEC A;  3OYE A;  3BZK A;  1YIJ N;  2GWK A;  5I9E B;  1T05 A;  4DSF A;  4AQY K;  1LWE A;  3RSE A;  1YVU A;  4CJ5 A;  1C6V A;  4ILH A;  3I8B A;  5MLC Q;  1NK9 A;  4FSV A;  3ULD A;  1ZYQ A;  4B3R K;  4HTU A;  3IFR A;  4OKE A;  2Z1J A;  3SMP A;  2HND A;  4JHD B;  1JL2 A;  1IBL K;  3IKM A;  4IFV A;  5KQD A;  2HBK A;  2JGU A;  3C94 A;  4IO8 A;  3CFP A;  1C0G A;  1XMO K;  5EY4 A;  4I6M A;  3OS1 A;  3G10 A;  4H5W A;  3O3H A;  4CJK A;  3TAP A;  4H0V B;  2HHH K;  2E8A A;  4H0P A;  4M63 C;  1EO1 A;  2WON A;  1GLA G;  1JCF A;  4AHT A;  3CD6 N;  3C6H A;  4B1Z A;  1ESV A;  1RBS A;  3C6A A;  5GIN A;  2A41 A;  1DTT A;  1VQN N;  3TR8 A;  5ADX A;  2FSK A;  1TK8 A;  4QS9 A;  3U4L A;  4O0I A;  2GUP A;  4NYF A;  5AQS A;  4KHU A;  3CCE N;  1XNR K;  4O8U A;  1RCH A;  3ZSY A;  2B4J A;  5IT9 O;  4EHT A;  1KSP A;  1H1V A;  1K8A O;  4JI6 K;  4HHT A;  3DXM A;  3ZT2 A;  2GEL A;  2YCH A;  3L2V A;  4PQU A;  3CI5 A;  4BR0 A;  3V1Q A;  3SQ4 A;  1SL1 A;  4MFB A;  3D2E A;  4N47 A;  1V4T A;  2H3G X;  3T3F A;  1E4F T;  1XI1 A;  1WOQ A;  3ATV A;  4XEI A;  1Q8I A;  4PL8 A;  4FWR A;  4Y0W A;  4H8K A;  4FL9 A;  4CF2 A;  4M3R A;  4BR7 A;  4CEZ A;  3CFO A;  5F1X A;  3B8A X;  3DOK A;  1LW2 A;  5B8H A;  3QNO A;  1GOB A;  3D6R A;  2DPN A;  4KRF A;  2GWJ A;  3EEQ A;  2IOC A;  2BUP A;  1LWC A;  2YJF A;  3DM2 A;  4WFB L;  4I2P A;  4DV5 K;  2VG6 A;  1DKG D;  3EE8 A;  1N5Y A;  3AA3 A;  5KPZ A;  3LL3 A;  1ASW A;  3MEE A;  2A42 A;  5M1F A;  4LF9 K;  2F96 A;  2Z1H A;  3TAF A;  3G25 A;  2F9W A;  1M1K O;  3KTQ A;  3PUF A;  2YNH A;  3TTD A;  4C8N A;  3CM5 A;  1VQ6 N;  1B9D A;  5AQR A;  4DS4 A;  1KXP A;  3V9W A;  1RBR A;  3ZSZ A;  2A5X A;  3DLR A;  4FJ8 A;  4IOX A;  4CZJ A;  3TAG A;  4JLH A;  3ZYY X;  4IDK A;  4AHV A;  4FJH A;  4M3Y A;  3SAH A;  5EVZ A;  3A8Y A;  2P9P A;  1IKV A;  5BN8 A;  1TL3 A;  1RT1 A;  3WEE A;  3EKS A;  4JEP A;  1HPM A;  4B9V A;  4IJN A;  4CW7 B;  2KFN A;  1BOT O;  3H3N O;  3B6P A;  2LSN A;  2VYP A;  2YNG A;  4HUE A;  4KHP K;  2YV0 X;  4F4K A;  3HL8 A;  4JAX A;  3MWT A;  4RW8 A;  1VQ8 N;  2P9K A;  5HRP A;  2ZD1 A;  4B1W B;  1HNW K;  4JNE A;  4DR7 K;  1Q18 A;  1YTU A;  5C42 A;  2VWK A;  1KCF A;  2Z1G A;  4NYN A;  1YJ9 N;  3VQ5 A;  2ITM A;  2VG7 A;  2QEX N;  1SUQ A;  4X64 K;  2A3Z A;  3HPH A;  3PO4 A;  4DR6 K;  4WQ4 A;  3MN7 A;  5AQK A;  4ZTJ A;  4NCA A;  3OYF A;  3RMA A;  2YNF A;  3NF8 A;  1BU6 O;  2RF2 A;  4NXN K;  4EIA A;  2XY7 A;  5H1S Q;  1VQK N;  4OX9 K;  2AJQ A;  3HXM A;  1WSI A;  4CEO A;  4PKH A;  4BDY A;  5I42 A;  5AQN A;  1HNZ K;  1T44 A;  4CK1 A;  4LY7 A;  1LWF A;  3O9R A;  4KKO A;  5E84 A;  1HMV A;  3VTH A;  3CCJ N;  3DRP A;  3VQA A;  3OYI A;  4FZX C;  2FBX A;  3IMX A;  4DV6 K;  5HRS A;  3O08 A;  3QEI A;  4CJE A;  3UE5 A;  4BE1 A;  3IAY A;  3CER A;  3VEO A;  5K14 A;  4ELV A;  3HST B;  3PV8 A;  4JRP A;  2XY5 A;  2RN2 A;  3S3M A;  2AP1 A;  2A1S A;  3O4W A;  1JL1 A;  1GLE G;  5KGW A;  3SUN A;  3V1O A;  4FWL A;  3BDP A;  3CMA N;  4DTN A;  3ENO A;  4RWT A;  3W3D A;  4E1J A;  3AA5 X;  3AA2 A;  3AO3 A;  3OYN A;  4FLU A;  4DTR A;  4C8K A;  1TYQ A;  1QVF M;  3IS9 A;  1IBK K;  1DT9 A;  3HTV A;  4DR5 K;  4GY2 B;  1L3T A;  1JJ2 M;  3OA9 A;  1NMD A;  1S9G A;  4O44 A;  2O8F A;  3M5R A;  3D2F B;  4DU3 A;  1KD1 O;  3NF7 A;  5DK5 A;  5DM7 L;  3LZJ A;  2Q97 A;  5EXW A;  3OW2 M;  4WCE L;  3R6M A;  4ELT A;  1RBV A;  4ILJ A;  3LDL A;  3BEX A;  1MU2 A;  2VWJ A;  5HBM A;  1NKE A;  3THW B;  3CXC M;  1BUP A;  3H1V X;  3KIO A;  1HPZ A;  3QB0 A;  1GLD G;  3F9K A;  4BRM A;  4DQR A;  3H1Q A;  1HYZ A;  4BRO A;  3K9K A;  5E41 A;  1RTD A;  2V7Y A;  2HVH A;  4XH5 A;  3U3G A;  2QWR A;  4FYD A;  2O8B B;  4O8K A;  3UKR A;  4MLH A;  4BRH A;  2HNY A;  3IDH A;  3MMV A;  1VK0 A;  2A6A A;  4A5A A;  3AVN A;  4XH4 A;  2KFZ A;  3C7N B;  3PX0 A;  1VQM N;  5C0Y A;  2WUS A;  4C8O A;  1T6D A;  4Q0B A;  4BC5 A;  4CFA A;  1JXE A;  4JI2 K;  5J2M A;  1NK7 A;  2E20 A;  4CJQ A;  3V4I A;  3TAQ A;  1RTJ A;  2FF3 B;  2G8W A;  3ZX0 A;  3NMU A;  2A1R A;  4KH6 A;  4FJG A;  2P9N A;  4CBW A;  1QSL A;  1IKW A;  2GV9 A;  1TAQ A;  1X9S A;  3CCQ N;  3RRH A;  1HQE A;  1E3M A;  3MX5 A;  3ULE A;  1BIU A;  4ISF A;  3HI0 A;  4PHT X;  1YUW A;  2Y1J A;  1K8K B;  2P5O A;  1ZBH A;  5FDL A;  2QWL A;  5HLF A;  2W41 A;  2OPP A;  2I7P A;  3CF5 L;  2FC0 A;  3SK3 A;  1GLB G;  3K5L A;  1TV6 A;  2W42 A;  4HUF A;  3U3Y A;  4UQG A;  4RW9 A;  2QXF A;  1YT3 A;  3L3U A;  1C1B A;  1R0A A;  1JLE A;  1A5W A;  5FRM A;  3U8X A;  2NLX A;  3ZSQ A;  4OPJ A;  4BQL A;  1YJW N;  1E4G T;  4QCL A;  2PBD A;  3V1R A;  2ITG A;  3NHG A;  1NNE A;  4E1M A;  4B3M K;  4WYB A;  2O8C A;  2P9U A;  2QWN A;  4KH4 A;  2E1Z A;  1NGF A;  4K8Z A;  5AQL A;  3QIN A;  4WF9 L;  2B6A A;  3FZF A;  3PX4 A;  4KTW A;  1KTQ A;  3AO1 A;  4CF9 A;  3VEV A;  5LMN K;  1U4B A;  2O8D A;  4YDU A;  3NH0 A;  2Q3S A;  3WT0 A;  5LY3 A;  5FRO A;  4DMN A;  3LWM A;  3VA3 A;  1O13 A;  3RMC A;  2HHU A;  4B1X B;  5CZ1 A;  3OYL A;  3ID6 A;  3S9H A;  3H45 C;  3AVM A;  5ADX H;  4EP5 A;  4BRA A;  5AZI A;  4CK3 A;  4JI4 K;  2QKB A;  2HW3 A;  4CBU A;  4N56 A;  5FPM A;  5BR8 K;  3TAN A;  1NJX A;  3ATU A;  2I5J A;  2Q36 A;  1JXB A;  3EY1 A;  4AHR A;  1IG8 A;  1VQP N;  3CQY A;  2QM1 A;  3R9P A;  4GV6 A;  3V9S A;  2BGG A;  1XC3 A;  2D5R A;  3ZSO A;  2R7Y A;  2P1J A;  1LAV A;  3NF6 A;  4LC9 B;  1I94 K;  2KZM A;  4DV0 K;  2QKK A;  1RBU A;  3RTV A;  4DQQ A;  2W40 A;  3DXK B;  5C25 A;  5KRT A;  4YOV A;  1M90 O;  2YI1 A;  2IAJ A;  1XUP O;  5CYM A;  3C6T A;  4KFB A;  4B3S K;  3SV4 A;  3WXI A;  4CHQ A;  4FJ9 A;  3DOL A;  5M1O A;  3VQB A;  3NVM A;  1C1C A;  4CK2 A;  3OYH A;  2OPQ A;  3CJ1 A;  1BIS A;  2XHB A;  2IC3 A;  2HMP A;  2NRZ A;  1L3V A;  3SNN A;  2VGM A;  1OH6 A;  3NDK A;  4JN4 A;  4KHQ A;  2GEM A;  3Q7C A;  1HKG A;  3PLA A;  2HF4 A;  1QTM A;  4LD0 A;  1Z6R A;  1L3S A;  3VTI A;  2P5G A;  3AAR A;  3AVF A;  3ZLJ A;  4BRP A;  2VCP A;  4HCB A;  2X78 A;  4M3T A;  1GLJ O;  1U47 A;  3ZCM A;  5AQX A;  4N5S A;  4KH5 A;  2NRR A;  4F8R A;  2XO7 A;  3H46 O;  1XNQ K;  4FXD A;  4FWN A;  1HYS A;  1P8Z A;  3O8M A;  4CJU A;  3MED A;  3THY B;  4CZE A;  2YKN A;  3K5N A;  1GOC A;  1UAX A;  3CJ9 A;  1S22 A;  3RSE B;  2UXB K;  2F7T A;  4JRQ A;  4CGH A;  4DR2 K;  1S1X A;  3CCR N;  4BY9 C;  1JLA A;  4DU4 A;  3VN5 A;  3NCI A;  4B1Y B;  3H6E A;  3FFK B;  3R1X A;  3HM8 A;  5M1K A;  3CJC A;  1HNX K;  4H5V A;  4FLW A;  1NJZ A;  4LF7 K;  1RT3 A;  3A0I X;  4LFA K;  3P83 D;  4E3S A;  4DTM A;  5AQP A;  1WAF A;  1IG9 A;  5AQU A;  2OA8 A;  4A62 A;  3OYG A;  2ASM A;  5AQH A;  3LP0 A;  5BN9 A;  2WTU A;  4KHS A;  1TKD A;  3CC4 N;  4MDA A;  4I6M B;  4AM7 A;  3HM9 A;  1OH5 A;  2EWS A;  3KKR A;  3FZK A;  1BI4 B;  4O0J A;  1J5E K;  1HKC A;  1QQM A;  1KAZ A;  3HJF A;  3M3Z A;  4F9O A;  1TKZ A;  3OYD A;  4DF8 A;  2YHB A;  4H5N A;  4GMJ B;  4CBX A;  3SUO A;  1N36 K;  2DFE A;  2GX9 A;  2XY8 A;  1YIT N;  2Z1I A;  4EZ6 A;  1NK5 A;  3MXI A;  1RNH A;  2ETJ A;  3MN5 A;  3PIP L;  4B9U A;  1HUX A;  4K42 A;  3DI6 A;  5AFU A;  4KRE A;  2OTL N;  5GAE P;  3C65 A;  3AGR A;  4FLY A;  3ENH A;  5HL7 L;  2WOM A;  1Y97 A;  2HHQ A;  2V51 B;  3DXM B;  4O5F A;  4YOW A;  1KRP A;  3HP6 A;  4DSJ A;  1WN7 A;  3OS0 A;  2YHA A;  3D2E B;  4Z4C A;  3CHW A;  4IXC A;  4C23 A;  1N6Q A;  3VPZ A;  1CZ9 A;  1ILY A;  4EAH D;  2QWM A;  2IGI A;  4GW6 A;  5F0X A;  3VER A;  2E6L A;  3IG1 A;  3RVC A;  3K0S A;  1RT4 A;  3DLE A;  4E7J A;  2UUA K;  4BC3 A;  3VEX A;  3VET A;  2E2N A;  3CM6 A;  3SPZ A;  4UY8 O;  1BG3 A;  3MCP A;  4RCH A;  1QHT A;  4CZG A;  2FLO A;  3K5M A;  3RMD A;  2OZM A;  3T69 A;  3JAM O;  3BZC A;  2DFF A;  2IVP A;  1WAJ A;  4GVE A;  3LWL A;  4M3W A;  3L8B A;  5BPL A;  4B1U B;  4KAZ A;  5FPN A;  4YOT A;  3OBW A;  1Q86 O;  3VMF B;  2ZE2 A;  5ELZ A;  4IO9 L;  5LL6 Z;  3NAE A;  2X6N A;  5AZJ A;  3AAP A;  3SJH A;  3VQP A;  4FJ7 A;  4ISG A;  1Q81 O;  1MWK A;  4AHU A;  1X3M A;  4M42 A;  5CHI A;  1XHZ A;  3LP1 A;  4RG8 A;  1W9H A;  1QQN A;  3HPO A;  2UU9 K;  5BPM A;  1XMQ K;  4U7B A;  1RT5 A;  4WFA L;  3EN9 A;  4CIF A;  4IBN A;  4M3Z A;  4K25 A;  4ID1 A;  4CJP A;  4C1N I;  4RW6 A;  2P9P B;  3KK3 A;  1HNI A;  2OPR A;  3ALY A;  3RMB A;  5TKY A;  3P31 A;  3WEE B;  3CPW M;  4E1N A;  1YTA A;  5DM6 L;  2PFU A;  4CEC A;  3NF9 A;  1Q7Y O;  4DQ8 A;  4CEQ A;  4CIG A;  4DTU A;  1NJW A;  1FXX A;  4DTO A;  3I0S A;  2IVO A;  5A2Q O;  1U45 A;  3QEV A;  2BDP A;  3KD5 E;  2P9K B;  4JK8 A;  4CIE A;  4HVJ A;  3SAG A;  3F5T A;  3THX A;  1JLG A;  3HYF A;  4FM1 A;  4PWD A;  1BO5 O;  4JKG A;  3WXJ A;  3QML A;  3SBT A;  4H5T A;  3VOV A;  1NGB A;  1NG9 A;  1MA9 B;  1WB9 A;  1K73 O;  3K2P A;  4JI3 K;  1RGI A;  1VHX A;  3SLC A;  4E7K A;  5JS1 A;  1KAY A;  2ZGZ A;  1ZBF A;  5FPE A;  3KK2 A;  3KLH A;  2NUB A;  3VQ9 A;  4BRC A;  3D7E O;  3SQ1 A;  4JI8 K;  4PUO A;  3S3O A;  4PY5 A;  1BWF O;  1DTQ A;  3O9Q A;  2QWO A;  1WSJ A;  1RBT A;  1VSD A;  1VAZ A;  4BWJ A;  4E7I A;  2VG5 A;  3OYA A;  1CXU A;  4O5B A;  4YNQ A;  4JI7 K;  3ITH A;  1Z26 A;  3VF6 A;  1VQ5 N;  2WC9 A;  2X74 A;  1NGD A;  3VEY A;  2ZWH A;  5BR9 A;  1WSF A;  3KD1 E;  3ZEU A;  4B9T A;  2YX6 A;  2AA4 A;  2OZS A;  1LOT B;  1SZ2 A;  1BL3 A;  3VGK A;  1X3N A;  2P9S A;  4KB1 A;  4DF4 A;  3T7Z A;  3RR7 A;  2J4R A;  2JWL A;  4V19 S;  5C12 A;  1KVA A;  1RIL A;  5T7B A;  3QLH A;  3OS2 A;  1VQ7 N;  5BRH A;  4CCH A;  4DS5 A;  4JV5 K;  2G8V A;  3L0Q A;  3MX2 A;  4CJF A;  3O3F A;  1REV A;  3KKS A;  2JWK A;  3VQC A;  5KGX A;  1MDU B;  3SQ2 A;  1XHX A;  2Q31 A;  3MN6 A;  4O55 A;  1N8R O;  3AVI A;  2F8T A;  4JKH A;  4YY3 K;  4YOX A;  1BQM A;  4I2Q A;  3NGI A;  2ZM6 K;  2HBM A;  1TYQ B;  4OPH A;  1ASV A;  1V4S A;  3WNF A;  4E7H A;  3AO4 A;  4ISE A;  4CF8 A;  4XIU A;  1NBW A;  4FWS A;  5C2D A;  2KQ2 A;  2X6S A;  2O8E A;  2O8F B;  2D0A A;  2O4G A;  4IWV A;  1T7P A;  2KW4 A;  1QVG M;  3L4Q A;  4MLE A;  1BCO A;  4NCG A;  3KWI A;  4WQ5 A;  4KTZ A;  3VEN A;  1D9F A;  3ZT3 A;  4JK7 A;  5AR0 A;  1VRT A;  3WUH A;  5JIC A;  5J2Q A;  2E2O A;  1JLF A;  1ZBU A;  3F9M A;  2FBT A;  4BE0 A;  4I9Q A;  4ICL A;  3QBW A;  5LMU K;  2QK9 A;  2OCE A;  1TUY A;  3L2W A;  1WBB A;  4O4G A;  1S6Q A;  4AF1 A;  1O1W A;  3L4I A;  3ZSR A;  4IOA L;  3AO2 A;  3UKR B;  2UUC K;  4PL7 A;  3SQ0 A;  2XY6 A;  4AM6 A;  4H0T B;  1FJG K;  4OPK A;  3AVJ A;  3VQ4 A;  1ATS A;  3CQX A;  5BRD A;  4ID5 A;  1XWL A;  4DFJ A;  3CQ8 A;  1JCG A;  4ELU A;  5HRO A;  1JLQ A;  3QIC A;  1RT6 A;  4FK2 A;  1SL0 A;  3QEX A;  5KTQ A;  1NJI O;  2P9N B;  4QOZ B;  3OYC A;  2QA4 N;  2E1Y A;  1DLO A;  1RDU A;  3AGK A;  5J2P A;  3CCV N;  4F2S A;  3M8R A;  4FK4 A;  3ULE B;  4DR1 K;  4KPY A;  4FO0 A;  3K5O A;  3LAN A;  3WQT A;  3OHR A;  3W0L A;  1VQO N;  5AQV A;  3WXL A;  4B08 A;  4LF6 K;  4W5R A;  1NK8 A;  2WFB A;  2BH1 A;  4FW1 A;  2P9I B;  4CHY A;  1RT7 A;  4Z4I A;  4LFB K;  2BE2 A;  2D0O A;  4DSK A;  2EX3 A;  3A5N C;  4CI6 A;  4KB0 A;  1S3X A;  4CJR A;  3KJV A;  1B92 A;  3TU5 A;  1W0H A;  2HNZ A;  3O3G A;  3FZM A;  3LDP A;  5JVH L;  3TPQ A;  1RDA A;  2O8C B;  1C1A A;  2P9U B;  1W97 L;  3LPU A;  1S1U A;  1VQL N;  4BC4 A;  1CXQ A;  5TKW A;  4CZL A;  2Q0U A;  3CIP A;  3AVH A;  4IEE A;  3L2U A;  4Z4F A;  2O8D B;  1TVR A;  3Q7B A;  5KPT A;  1VQ4 N;  4C8L A;  3QEW A;  1S6P A;  1QZ6 A;  4CZH A;  3O9T A;  3KK1 A;  2NNW A;  3E1Y A;  4W5T A;  1K9M O;  4BRG A;  4LH5 A;  4JI5 K;  1RTI A;  4M45 A;  4FK0 A;  5AZI B;  4YOY A;  1LV5 A;  4J2B A;  5AFU H;  4B1V A;  3QES A;  4H03 B;  4PKG A;  3OJS A;  3EZ5 A;  3R8E A;  4Z4H A;  3I0R A;  1IV0 A;  4JKE A;  3V9Z A;  1BA1 A;  1EX4 A;  3DAW A;  2IVN A;  5GAD P;  2HST A;  1WLJ A;  3DYA A;  1NK4 A;  1RT2 A;  3B6O A;  4BAC A;  3THW A;  1HRH A;  4DV4 K;  1IH7 A;  4NB4 A;  5HRN A;  3C95 A;  4JKF A;  3CJ7 A;  3WXK A;  3BUZ B;  4JS5 A;  3MAQ A;  1I3A A;  3G6E N;  4BG9 A;  3A5M C;  4FJM A;  1OVY A;  2CGK A;  4CEE A;  2E2P A;  4A2A A;  3DLB A;  4ZHR A;  1VRU A;  5E26 A;  1BQN A;  4GNI A;  2OAN A;  4YFU A;  4FM2 A;  3LPT A;  1Q9X A;  3BF1 A;  3T1A A;  2EHG A;  4H0X B;  3VGM A;  4N76 A;  4OKK A;  1ZBS A;  1J5O A;  5FLX O;  3LAK A;  5CYQ A;  4CJS A;  4WQ4 C;  4CJW A;  2KTQ A;  3CME N;  1BGX T;  1S1W A;  3HK2 A;  4CFD A;  2QW9 A;  4NCB A;  4J8F A;  3EYZ A;  4DTJ A;  4CJT A;  2G8U A;  4NLB A;  4BRF A;  3M8Q A;  5J1E A;  3TI0 A;  1VSK A;  3VQ8 A;  4H4O A;  2KKZ A;  3P39 A;  1EXQ A;  4B9Q A;  4CF1 A;  3QEP A;  1N32 K;  3M6G A;  4FOE A;  1HNV A;  1NGI A;  3FFI A;  4J2D A;  5AQG A;  3AVG A;  4C1N K;  3HVR A;  4DU1 A;  4BR4 A;  4DR4 K;  1BDG A;  3U6F A;  4H0O A;  2ZJQ L;  3ENB A;  5GIO A;  3VGL A;  3AA4 A;  3DMJ A;  2CGJ A;  2FBY A;  4CD3 A;  3A5O C;  3FZH A;  4CJV A;  5I3U A;  3O4Q A;  4JKA A;  1UOC A;  5C2F A;  3VEW A;  1X9J A;  4F3T A;  1VSI A;  4JK9 A;  5AQT A;  3V9U A;  4M7X A;  2F4V K;  2P9L A;  1W2B M;  3BY5 A;  3NFA A;  5AQO A;  4OGE A;  4CJ4 A;  4DFM A;  4BVO A;  3UIQ A;  1TKT A;  2NRT A;  4A2B A;  2ZJR L;  1KVB A;  4B3T K;  4FWK A;  4JD2 A;  4FWP A;  3AVA A;  4W5N A;  5AJ3 K;  1C0F A;  2HBL A;  4WE1 A;  3HOS A;  2D0P A;  1JCE A;  2BAN A;  4PKI A;  5BRE A;  3V81 A;  3H3O B;  4BVP A;  4AH9 A;  3RRG A;  4OLA A;  3VF2 A;  3D0P A;  2HHV A;  3DRS A;  4FWQ A;  4IOC L;  3E9P A;  4FW2 A;  4OGC A;  4FJN A;  4QS8 A;  3HT3 A;  1KC8 O;  3VQQ A;  3SAF A;  1Q9Y A;  4K8X A;  3G71 N;  1A5X A;  1D4X A;  3PX6 A;  4JKD A;  3P5J A;  3SJJ A;  1OKJ A;  3FZL A;  1EWQ A;  1YF5 L;  3JYT A;  4KO0 A;  3CFR A;  1TL1 A;  4KHW A;  1U2V A;  3QDK A;  4EZ9 A;  1SL2 A;  4GV3 A;  3CET A;  4B8C A;  3LP3 A;  3DLG A;  4DB3 A;  1XC9 A;  3HRG A;  1IBM K;  1GLL O;  3K57 A;  3I33 A;  4GKJ K;  3PIO L;  1YVN A;  3GDQ A;  1U6Z A;  4KHN A;  2OYQ A;  3C6U A;  1J53 A;  1T03 A;  4KI6 A;  4A59 A;  1W7A A;  1B9F A;  2FXU A;  3TTF A;  4OJR A;  4FWO A;  3I55 N;  5KQ8 A;  4IJA A;  5AQM A;  4E7L A;  1CZB A;  4DUY K;  4Z0U A;  1TAU A;  3UKU A;  4HCC A;  1K6Y A;  1P90 A;  4BG8 A;  5JS2 A;  4CD1 A;  4E19 A;  5EX5 A;  1YI2 N;  1Z25 A;  2NRW A;  1VSM A;  2RHK A;  1ZBI A;  2E2Q A;  3ZET A;  3OVN A;  5SWM A;  1G15 A;  3NVK A;  2PYL A;  1NGC A;  4EHU A;  1HJR A;  1HLU A;  3DLK A;  2VWB A;  3TAM A;  5KI6 A;  2D0B A;  3TTC A;  4KTQ A;  5AQJ A;  3E9O A;  5AZJ B;  3L2Q A;  1RDC A;  2Q2R A;  1UA1 A;  4B9L A;  2O4I A;  5HOO A;  1WSE A;  2BTF A;  4Y1D A;  1T8E A;  3CG7 A;  3T1Y K;  4MQ3 A;  4J2A A;  4CGG A;  3AO5 A;  3S3N A;  4X66 K;  3J7Y P;  4MO5 A;  1LAW A;  4FJJ A;  1TUU A;  2VQF K;  4YDU C;  4OLB A;  4DFK A;  3FR0 A;  3EL2 A;  1ITG A;  4YOU A;  1HR0 K;  4F3O A;  3HOT A;  1QHA A;  3ZSV A;  1NLV A;  3KHY A;  2YHW A;  4CJL A;  2UYT A;  1D9D A;  2FSN A;  4LF8 K;  2QWQ A;  1L5U A;  3ZX2 A;  3G4S N;  1WSG A;  4FJ5 A;  3QFP A;  4X65 K;  3EKU A;  1HKB A;  4DCH A;  3O1W A;  1BI4 A;  1YXQ A;  4R79 A;  4J2E A;  3PY8 A;  5HRR A;  1UWB A;  1NK6 A;  2G8F A;  2G8K A;  3THX B;  3J8A A;  3O1B A;  4KBO A;  2E6M A;  4DR3 K;  1FW6 A;  4AIL C;  3CC7 N;  4JKG B;  4IZ9 A;  4BDZ A;  4CGF A;  4W5Q A;  4BR5 A;  5GIP A;  3O9S A;  4NLC A;  4Z94 A;  2G8I A;  3I8D A;  3OYK A;  1I39 A;  4JHD A;  1SAZ A;  2V52 B;  3NGZ A;  4LSL A;  1EWR A;  2RKI A;  1NGJ A;  3KLE A;  3DLH A;  4YOR A;  4FLZ A;  3AVB A;  2RPI A;  3HPG A;  4CES A;  3LAM A;  4EP4 A;  1J6Z A;  3GOI A;  3P38 A;  2QI2 A;  1UA0 A;  4MO4 A;  4A57 A;  4RW4 A;  2ZQB A;  3GG4 A;  3HSC A;  5CR4 A;  5JLH A;  3SCX A;  5GAH P;  3MN9 A;  4FJK A;  5JVG L;  2UXD K;  1BCM A;  3ZEU B;  5LJW A;  4GV9 A;  1OH8 A;  3MXJ A;  3MDQ A;  1S72 N;  2P9S B;  5AQF A;  5AQW A;  1JLB A;  3WXM B;  5KPR A;  1GLF O;  3T1H K;  1SKS A;  1N33 K;  4DLG A;  2HHT A;  3MXM A;  3VQE A;  3VQD A;  1FKO A;  3OYB A;  4DQS A;  4H5R A;  3J7Z O;  1CLQ A;  4JI1 K;  4LF5 K;  4CE9 A;  3O4N A;  4CZF A;  1QQC A;  3ISN C;  2D4W A;  3O6W A;  5CY4 A;  4B9N A;  3BF3 A;  4KI4 A;  3KLF A;  3CJB A;  3ZSW A;  2D0C A;  4EFH A;  3KLG A;  3J7A P;  1X1P A;  5D3G A;  4DWI A;  2YHX A;  3LDS A;  2E88 A;  3MWP A;  2PY5 A;  4I7F A;  1QSS A;  3OJU A;  1WUA A;  4CHP A;  5M1Q A;  3HVT A;  3NBP A;  4YHH K;  1OH7 A;  2O8E B;  5HP1 A;  4BWM A;  1ZBL A;  3CJA A;  4DTP A;  4DQP A;  4HTL A;  3NGY A;  3LDN A;  2CH5 A;  3N4Q A;  3L6Q A;  4IKF A;  4LSN A;  4DFP A;  1TGO A;  3VQ6 A;  3TAB A;  2VQE K;  4RTF D;  3WNG A;  4BQZ A;  4OO1 J;  4DV1 K;  3WNH A;  5AQI A;  5C15 A;  1YAG A;  3ZT1 A;  4A5B A;  3GL1 A;  2YNI A;  3J80 O;  1QZ5 A;  1NKB A;  2IIR A;  1GLC G;  1X9M A;  3VQ7 A;  1NGE A;  4BRE A;  4IDH A;  1VQ9 N;  2HBJ A;  1KAX A;  4CF0 A;  4IEI A;  3KLI A;  4M3X A;  3E9L A;  3OY9 A;  4FLX A;  3ZX3 A;  1HJO A;  1Z05 A;  4L8R B;  4K41 A;  3QNN A;  1VSE A;  4JI0 K;  3O5B A;  4DV2 K;  2QWP A;  4FCY A;  3SMS A;  3CPE A;  2HHW A;  3UB5 A;  3E66 A;  1J9A A;  2YHY A;  1LCU A;  1KFS A;  2B5J A;  3N4P A;  4OPA A;  1JKH A;  1KFD A;  3TSQ A;  4MDB A;  4U67 L;  1WBD A;  1A5V A;  2Q0R A;  4NO7 A;  3VA0 A;  3CC2 N;  4DTX A;  3A2F A;  4FLV A;  2I7N A;  1FKP A;  4G1Q A;  4DTS A;  3KVG A;  2ASO A;  4FVU A;  3FGU A;  4I9L A;  3F2K A;  1WSH A;  1BA0 A;  4L3Q A;  4PA1 A;  4AHC A;  4BC2 A;  5AQY A;  3LP2 A;  1QE1 A;  1VSJ A;  1NOZ A;  4BE2 A;  5CZ2 A;  3HO1 A;  4CZM A;  4FPB A;  2W6K A;  4E0D A;  4M7Y A;  3WNE A;  4B8A B;  3AVC A;  3VEZ A;  4IFY A;  2OPS A;  1OVQ A;  3VES A;  4FLT A;  1NOY A;  3HP9 A;  2DFH A;  1DGK N;  5M1N A;  1BIZ A;  2YKM A;  3C0B A;  1RDW X;  3PO5 A;  4FJX A;  3M1F A;  1GOA A;  1C0M A;  1ATR A;  2GBZ A;  1ATN A;  2QXL A;  2KHO A;  2NZT A;  3EO3 A;  4QAG A;  4BGB A;  1KLN A;  4CZI A;  2CH6 A;  2Q1N A;  3U9D A;  1DEJ A;  1QQO A;  2NRX A;  3TSP A;  2UXC K;  4CEF A;  4GVM A;  3AV9 A;  2E4L A;  4LF4 K;  4FVM A;  4B9S A;  4CHO A;  3PSF A;  3V9X A;  3O9U A;  2WBN A;  1SQK A;  1F21 A;  2DY4 A;  3KK7 A;  1RTH A;  4FWM A;  4JKC A;  4BRQ A;  3OYM A;  4H0Y B;  3HBT A;  2PZS A;  4Q5V A;  3FE1 A;  5F2R A;  1KVC A;  3IUC A;  1EKE A;  4H4M A;  5CE3 A;  1S5J A;  3D45 A;  4LFC K;  3DWL A;  2HVI A;  4M41 A;  3L3V A;  1S1T A;  4BRI A;  3M8P A;  4NXM K;  2Y1I A;  4G9Z A;  4BR2 A;  4K0K K;  1IKY A;  3QET A;  4FOI A;  2YJE A;  3KZB A;  5BPN A;  4Z4G A;  2OTJ N;  4JS4 A;  5JLF A;  3IRX A;  2ATQ A;  3LDO A;  5AQQ A;  1NWK A;  3OTO K;  2E5L K;  1JLC A;  4C8M A;  3CCL N;  2FSJ A;  1VSH A;  4DV7 K;  1Q82 O;  2CGL A;  1KQS M;  2UUB K;  1XQS C;  2KZZ A;  4CER A;  1EP4 A;  4AHS A;  4DLE A;  3RWU A;  4CHN A;  1NM1 A;  3D2F A;  5C24 A;  2V7Z A;  3K9J A;  5C10 A;  4B9M A;  2GTD A;  4FZZ A;  1YHQ N;  1IJJ A;  3T19 A;  3LZI A;  3BGR A;  4BRK A;  3H08 A;  3LDQ A;  1U48 A;  2KLA A;  1VSF A;  1C0T A;  5SZT A;  3AY9 A;  5FPD A;  4BDP A;  3K59 A;  5LJV A;  1U04 A;  1HYV A;  1EQY A;  3O80 A;  1G99 A;  4A61 A;  1NGG A;  3R3L A;  2HB5 A;  4DSL A;  1IKX A;  3THV A;  4K43 A;  2P9I A;  4DV3 K;  4XH1 A;  3CCS N;  1R59 O;  4DSE A;  2ZF5 O;  2G8H A;  3GE1 A;  4CFC A;  4E89 A;  2O8B A;  3BP8 A;  4QS7 A;  1TKX A;  4OVL A;  5FRN A;  4LH4 A;  4KHY A;  4BRN A;  1SV5 A;  1QS4 A;  2F9T A;  2HHS A;  4CJ3 A;  1HX1 A;  3C7N A;  1FK9 A;  3U9Z A;  1KLM A;  1HQU A;  3JXU A;  3AAQ A;  4ZTF A;  2P9L B;  1D5A A;  1RFQ A;  2NRV A;  4CJ7 A;  4CGD A;  2XRI A;  1QSY A;  3SV3 A;  3FLC O;  3DJC A;  1SKR A;  2P51 A;  2VGN A;  4JD2 B;  3GBT A;  4Z4E A;  4BRL A;  4W5O A;  3TAR A;  4DSI A;  1T3V A;  1K8K A;  1Y64 A;  4GKK K;  4FZY A;  4DKW A;  3JS6 A;  3QER A;  3F73 A;  1S9E A;  1NK0 A;  4B3O A;  1LW0 A;  3AVK A;  4FJI A;  4WQ5 C;  2GUI A;  2FF6 A;  4IG3 A;  4CGI A;  5KRS A;  3KWG A;  3ID8 A;  3DRR A;  3EE9 A;  5M1P A;  5JMV A;  2QTD A;  3ZSX A;  3CCM N;  2ASP A;  4CFB A;  4CZK A;  1NGA A;  1U2V B;  4DHY A;  3NH1 A;  2ZJP L;  1NJY A;  1X9W A;  1TK5 A;  3TSU A;  1WNS A;  1SS6 A;  4JYA K;  3QIP A;  1BHL A;  5GAG P;  5DMR A;  3OBY A;  4BR9 A;  4JKB A;  4HUG A;  1EET A;  1ZC6 A;  4FJL A;  4M3U A;  4CEB A;  2HF3 A;  3MCA B;  3SBG A;  3M8S A;  2ZGY A;  2FBV A;  5AQZ A;  3V6D A;  3G0Z A;  4DG1 A;  3SYZ A;  2PAV A;  5J2N A;  4X62 K;  3E01 A;  3QIO A;  4IFE A;  3MK6 A;  4CED A;  3NE6 A;  3UKU B;  1L3U A;  2IS3 A;  4Y1C A;  3P1G A;  5BRF A;  1S1V A;  3PSI A;  3ZT0 A;  4TSX A;  4CEA A;  4R5P A;  3QO9 A;  4HWI A;  1NKC A;  4F2R A;  3MEG A;  3ZET B; 
#chains in the Genus database with same CATH homology
 1ASV A;  3WNF A;  4RW7 A;  4E7H A;  3AO4 A;  4CF8 A;  4XIU A;  4AIL C;  2P5O A;  3ASM A;  1ZBH A;  5FDL A;  4BDZ A;  2KQ2 A;  5HLF A;  2OPP A;  2FC0 A;  2X6S A;  4CGF A;  4W5Q A;  1TV6 A;  3NH2 A;  3K5L A;  1TK0 A;  2D0A A;  2W42 A;  4HUF A;  3U3Y A;  4UQG A;  4RW9 A;  2O4G A;  5EU7 A;  2QXF A;  1YT3 A;  3L3U A;  2G8I A;  1C1B A;  3I8D A;  1JLE A;  2KW4 A;  1R0A A;  3OYK A;  1A5W A;  1I39 A;  1T7P A;  5FRM A;  3ZSQ A;  3ZT4 A;  4CGJ A;  4OPJ A;  4LSL A;  3NGZ A;  3SPY A;  4N41 A;  1BCO A;  4DQI A;  2RKI A;  4NCG A;  2HHX A;  4QCL A;  1D8Y A;  3V1R A;  4KTZ A;  3KLE A;  3SZ2 A;  3ZT3 A;  1D9F A;  3DLH A;  1VRT A;  5J2Q A;  2ITG A;  3NHG A;  4FLZ A;  3TAE A;  1JLF A;  1ZBU A;  2FBT A;  3LAL A;  4E1M A;  3L2R A;  3AVB A;  2RPI A;  4BE0 A;  3HPG A;  4CES A;  3LAM A;  4EP4 A;  4I9Q A;  1VSL A;  4ICL A;  1J54 A;  2QK9 A;  3AVL A;  1RDD A;  4K8Z A;  1ASU A;  1UA0 A;  3QIN A;  1C0U A;  3L2W A;  2DTU A;  4O4G A;  1S6Q A;  2ZQB A;  2B6A A;  4RW4 A;  3PX4 A;  4KTW A;  3SCX A;  3OYJ A;  1O1W A;  3ZSR A;  1KTQ A;  3AO2 A;  3SUP A;  4OKJ A;  3AO1 A;  4CF9 A;  4FJK A;  1BCM A;  3JSM A;  1U4B A;  1U49 A;  3SQ0 A;  3NH0 A;  2XY6 A;  2Q3S A;  2HMI A;  1IO2 A;  3MXJ A;  4OPK A;  3AVJ A;  3VQ4 A;  4CHZ A;  1JLB A;  1RDB A;  3RR8 A;  4ID5 A;  5FRO A;  2F8S A;  1XWL A;  1SKS A;  4DMN A;  3LWM A;  3VA3 A;  2PYJ A;  4DFJ A;  3CQ8 A;  3RMC A;  4DLG A;  2HHT A;  3MXM A;  4ELU A;  3VQE A;  2HHU A;  3VQD A;  1FKO A;  5CZ1 A;  3OYB A;  3OYL A;  1JLQ A;  4FM0 A;  4DQS A;  5HRO A;  1SKW A;  4KV8 A;  1RT6 A;  3S9H A;  4FK2 A;  3SUQ A;  1SL0 A;  3AVM A;  1CLQ A;  4EP5 A;  3CYM A;  4CE9 A;  3O4N A;  3QEX A;  2IDO A;  4CK3 A;  1QQC A;  3ISN C;  3TWH A;  3SI6 A;  5CY4 A;  4B9N A;  2QKB A;  5KTQ A;  4N56 A;  2HW3 A;  3TAN A;  4KI4 A;  4QOZ B;  4IG0 A;  3OYC A;  3KLF A;  2JLE A;  1NJX A;  3ZSW A;  3K58 A;  2D0C A;  2I5J A;  3MEC A;  1DLO A;  3OYE A;  5J2P A;  4F2S A;  1JXB A;  3KLG A;  4AHR A;  3EY1 A;  3M8R A;  1X1P A;  5D3G A;  1T05 A;  4FK4 A;  4DWI A;  3LDS A;  4DSF A;  4KPY A;  1LWE A;  1YVU A;  4CJ5 A;  3K5O A;  3LAN A;  4I7F A;  3V9S A;  3OJU A;  1C6V A;  1QSS A;  2PY5 A;  2BGG A;  2D5R A;  4CHP A;  3ZSO A;  2R7Y A;  3HVT A;  2P1J A;  3NBP A;  1LAV A;  3NF6 A;  1NK9 A;  2KZM A;  2QKK A;  5HP1 A;  4BWM A;  1ZBL A;  4B08 A;  3ULD A;  1ZYQ A;  1RBU A;  3RTV A;  4DQQ A;  4W5R A;  4DTP A;  4DQP A;  1NK8 A;  3NGY A;  4HTU A;  5C25 A;  4FW1 A;  4IKF A;  5KRT A;  4LSN A;  4OKE A;  2Z1J A;  4CHY A;  1RT7 A;  2HND A;  4Z4I A;  2BE2 A;  1JL2 A;  4DFP A;  4DSK A;  2IAJ A;  2EX3 A;  1TGO A;  5CYM A;  4IFV A;  3VQ6 A;  3TAB A;  4KB0 A;  3C6T A;  4CJR A;  4KFB A;  3KJV A;  3WNG A;  3SV4 A;  2JGU A;  1B92 A;  4CHQ A;  3WNH A;  4FJ9 A;  1W0H A;  2HNZ A;  3C94 A;  3DOL A;  3VQB A;  3O3G A;  1C1C A;  4CK2 A;  3OYH A;  2OPQ A;  3ZT1 A;  1BIS A;  2XHB A;  2IC3 A;  1L3V A;  2YNI A;  3CFP A;  3SNN A;  1RDA A;  1C1A A;  3NDK A;  1NKB A;  3LPU A;  3OS1 A;  3G10 A;  4KHQ A;  1S1U A;  1X9M A;  1CXQ A;  4CJK A;  3VQ7 A;  3O3H A;  3TAP A;  3AVH A;  4LD0 A;  1QTM A;  1L3S A;  2WON A;  4CF0 A;  3KLI A;  3L2U A;  4M3X A;  3OY9 A;  2P5G A;  4Z4F A;  4AHT A;  4FLX A;  3AVF A;  1TVR A;  4L8R B;  4HCB A;  2X78 A;  4M3T A;  1RBS A;  3QNN A;  1U47 A;  1VSE A;  1DTT A;  4C8L A;  3QEW A;  3TR8 A;  3ZCM A;  4N5S A;  1S6P A;  4FCY A;  1TK8 A;  3KK1 A;  4W5T A;  4O0I A;  4NYF A;  2HHW A;  4LH5 A;  4KHU A;  1RTI A;  4M45 A;  1J9A A;  4F8R A;  2XO7 A;  1RCH A;  3ZSY A;  4FK0 A;  2B4J A;  1LV5 A;  1KSP A;  4FXD A;  1HYS A;  4J2B A;  1KFS A;  3QES A;  2B5J A;  3OJS A;  4CJU A;  3EZ5 A;  4HHT A;  4Z4H A;  1JKH A;  1KFD A;  3I0R A;  3MED A;  2YKN A;  3K5N A;  1GOC A;  1UAX A;  3ZT2 A;  3L2V A;  3V9Z A;  1EX4 A;  4PQU A;  3V1Q A;  4JRQ A;  3SQ4 A;  1SL1 A;  1A5V A;  4MFB A;  1WLJ A;  3DYA A;  4CGH A;  1NK4 A;  3VA0 A;  4N47 A;  1RT2 A;  1S1X A;  3B6O A;  4BAC A;  3T3F A;  1HRH A;  1JLA A;  4DTX A;  4DU4 A;  3VN5 A;  1XI1 A;  1IH7 A;  3NCI A;  5HRN A;  3A2F A;  3C95 A;  4FLV A;  1FKP A;  4G1Q A;  4DTS A;  1Q8I A;  3PY8 A;  4I9L A;  1WSH A;  4JS5 A;  4H8K A;  4PA1 A;  3MAQ A;  4CF2 A;  4AHC A;  1I3A A;  4FLW A;  4M3R A;  1NJZ A;  1RT3 A;  4FJM A;  3LP2 A;  1QE1 A;  1VSJ A;  4CEE A;  4CEZ A;  3CFO A;  1NOZ A;  3DLB A;  3P83 D;  4BE2 A;  5CZ2 A;  3HO1 A;  4E3S A;  4DTM A;  4ZHR A;  3DOK A;  1WAF A;  1IG9 A;  1VRU A;  2OA8 A;  1LW2 A;  3OYG A;  1BQN A;  4E0D A;  3QNO A;  1GOB A;  3LP0 A;  3WNE A;  4B8A B;  3AVC A;  4YFU A;  4IFY A;  4FM2 A;  2OPS A;  4KHS A;  4KRF A;  3LPT A;  1TKD A;  1Q9X A;  3T1A A;  3HM9 A;  2EHG A;  4FLT A;  1NOY A;  2IOC A;  3HP9 A;  2DFH A;  1LWC A;  3DM2 A;  3KKR A;  1BIZ A;  1BI4 B;  2YKM A;  4O0J A;  4N76 A;  4OKK A;  1J5O A;  3PO5 A;  4FJX A;  3LAK A;  1GOA A;  1C0M A;  4I2P A;  5CYQ A;  4CJS A;  2GBZ A;  4NCB A;  3HJF A;  4CJW A;  2KTQ A;  4QAG A;  1BGX T;  1S1W A;  2VG6 A;  1KLN A;  1N5Y A;  3HK2 A;  1TKZ A;  3AA3 A;  4CFD A;  3OYD A;  4DF8 A;  1ASW A;  2YHB A;  3EYZ A;  3MEE A;  4DTJ A;  4GMJ B;  4CJT A;  3SUO A;  2G8U A;  2DFE A;  2F96 A;  2Z1H A;  2XY8 A;  4CEF A;  2Z1I A;  4GVM A;  3AV9 A;  3TAF A;  4EZ6 A;  3M8Q A;  5J1E A;  1NK5 A;  3MXI A;  3TI0 A;  1RNH A;  2ETJ A;  3KTQ A;  2E4L A;  2YNH A;  3PUF A;  1VSK A;  4H4O A;  4FVM A;  4C8N A;  1EXQ A;  3VQ8 A;  4B9U A;  4B9S A;  3CM5 A;  4CF1 A;  3DI6 A;  4CHO A;  3QEP A;  1HNV A;  4KRE A;  3FFI A;  1B9D A;  4DS4 A;  4J2D A;  3V9W A;  3V9X A;  1RBR A;  3AVG A;  3ZSZ A;  4FLY A;  3DLR A;  3HVR A;  4FJ8 A;  4DU1 A;  1F21 A;  2DY4 A;  1RTH A;  3U6F A;  4JLH A;  3TAG A;  2WOM A;  1Y97 A;  4IDK A;  2HHQ A;  4AHV A;  4FJH A;  4M3Y A;  3OYM A;  2PZS A;  3AA4 A;  4Q5V A;  1KRP A;  3DMJ A;  3HP6 A;  1KVC A;  1IKV A;  1WN7 A;  4DSJ A;  3OS0 A;  1EKE A;  2FBY A;  1TL3 A;  4H4M A;  1S5J A;  2YHA A;  4Z4C A;  3D45 A;  1RT1 A;  1N6Q A;  1CZ9 A;  4CJV A;  4B9V A;  5I3U A;  2HVI A;  3O4Q A;  2IGI A;  3L3V A;  4GW6 A;  1S1T A;  4M41 A;  2KFN A;  1UOC A;  3M8P A;  2Y1I A;  2E6L A;  4F3T A;  1VSI A;  3B6P A;  3V9U A;  2LSN A;  3IG1 A;  1IKY A;  3QET A;  2YNG A;  3NFA A;  1RT4 A;  3DLE A;  4HUE A;  4E7J A;  4OGE A;  4Z4G A;  4CJ4 A;  4DFM A;  4JS4 A;  3UIQ A;  1TKT A;  2YV0 X;  3HL8 A;  3IRX A;  4F4K A;  3CM6 A;  2ATQ A;  3SPZ A;  4RW8 A;  1KVB A;  1QHT A;  5HRP A;  1JLC A;  2ZD1 A;  4C8M A;  1VSH A;  3K5M A;  3RMD A;  3AVA A;  2OZM A;  4W5N A;  2DFF A;  4WE1 A;  2KZZ A;  1WAJ A;  2BAN A;  3LWL A;  4CER A;  1EP4 A;  4AHS A;  4DLE A;  4M3W A;  3V81 A;  3L8B A;  1YTU A;  5C42 A;  2VWK A;  1KCF A;  2Z1G A;  4AH9 A;  3RRG A;  4NYN A;  4CHN A;  3VQ5 A;  3D0P A;  3RWU A;  4KAZ A;  4OLA A;  3DRS A;  2HHV A;  5C24 A;  4FW2 A;  2ZE2 A;  4OGC A;  4FJN A;  4B9M A;  3HT3 A;  3NAE A;  2VG7 A;  2X6N A;  1SUQ A;  4FZZ A;  3VQQ A;  1Q9Y A;  3HPH A;  4K8X A;  3PO4 A;  1A5X A;  3T19 A;  3VQP A;  4ZTJ A;  4FJ7 A;  3PX6 A;  4NCA A;  3LZI A;  3OYF A;  3BGR A;  3P5J A;  3SJJ A;  3H08 A;  4AHU A;  3RMA A;  2YNF A;  1U48 A;  3JYT A;  3NF8 A;  4KO0 A;  3CFR A;  1TL1 A;  4M42 A;  4KHW A;  2RF2 A;  1XHZ A;  1VSF A;  1C0T A;  3LP1 A;  4RG8 A;  1W9H A;  5SZT A;  3HPO A;  4EZ9 A;  1SL2 A;  4BDP A;  2XY7 A;  3K59 A;  1RT5 A;  2AJQ A;  1U04 A;  3LP3 A;  4B8C A;  1HYV A;  4CIF A;  4IBN A;  4M3Z A;  3HXM A;  4DSL A;  2HB5 A;  3DLG A;  1IKX A;  3THV A;  1XC9 A;  1WSI A;  4ID1 A;  4CEO A;  4CJP A;  4DSE A;  4BDY A;  5I42 A;  4RW6 A;  3K57 A;  3KK3 A;  2G8H A;  1HNI A;  2OPR A;  3ALY A;  4LY7 A;  1LWF A;  4CFC A;  4CK1 A;  4E89 A;  3RMB A;  4KKO A;  4KHN A;  2OYQ A;  1HMV A;  3C6U A;  1J53 A;  1T03 A;  4KI6 A;  1TKX A;  4E1N A;  1YTA A;  3DRP A;  4OVL A;  3VQA A;  3OYI A;  4FZX C;  2FBX A;  5FRN A;  4LH4 A;  4KHY A;  1SV5 A;  1QS4 A;  5HRS A;  1B9F A;  2HHS A;  3QEI A;  4CJ3 A;  4CJE A;  3IAY A;  4BE1 A;  4ELV A;  4CEC A;  5K14 A;  1FK9 A;  3NF9 A;  3HST B;  1KLM A;  1HQU A;  4CEQ A;  4OJR A;  4JRP A;  3PV8 A;  4ZTF A;  4CIG A;  2XY5 A;  2RN2 A;  1CZB A;  1D5A A;  4E7L A;  4DTU A;  4Z0U A;  3S3M A;  4CGD A;  1NJW A;  1TAU A;  1FXX A;  2A1S A;  2XRI A;  4DTO A;  3I0S A;  1JL1 A;  4HCC A;  5KGW A;  1K6Y A;  3SUN A;  1U45 A;  3V1O A;  1QSY A;  3BDP A;  3SV3 A;  3QEV A;  4DTN A;  2BDP A;  3KD5 E;  4HVJ A;  4CIE A;  1SKR A;  2P51 A;  5JS2 A;  4E19 A;  1Z25 A;  4Z4E A;  1VSM A;  4W5O A;  1JLG A;  1ZBI A;  3HYF A;  3AA5 X;  3AA2 A;  3AO3 A;  3OYN A;  4FM1 A;  3TAR A;  4DSI A;  4FLU A;  4DTR A;  4C8K A;  4PWD A;  3OVN A;  5SWM A;  4FZY A;  3IS9 A;  3QER A;  3F73 A;  1G15 A;  1L3T A;  2PYL A;  1S9E A;  1HJR A;  1S9G A;  3DLK A;  4O44 A;  1NK0 A;  4B3O A;  3TAM A;  5KI6 A;  2D0B A;  4DU3 A;  1LW0 A;  3AVK A;  3NF7 A;  5DK5 A;  4FJI A;  3LZJ A;  4KTQ A;  3L2Q A;  1RDC A;  1UA1 A;  2GUI A;  4B9L A;  3K2P A;  4IG3 A;  4CGI A;  5KRS A;  4E7K A;  4ELT A;  2O4I A;  1RBV A;  5JS1 A;  1ZBF A;  3KK2 A;  1WSE A;  3DRR A;  4Y1D A;  3KLH A;  2NUB A;  3VQ9 A;  1T8E A;  3CG7 A;  3ZSX A;  1MU2 A;  2VWJ A;  5HBM A;  4MQ3 A;  1NKE A;  4J2A A;  4CGG A;  4CFB A;  3AO5 A;  3SQ1 A;  3S3N A;  4PUO A;  3KIO A;  1HPZ A;  3S3O A;  4PY5 A;  1LAW A;  3NH1 A;  3F9K A;  1DTQ A;  4FJJ A;  4DQR A;  1WSJ A;  1X9W A;  1NJY A;  1RBT A;  1VSD A;  1HYZ A;  4OLB A;  4BWJ A;  4DFK A;  4E7I A;  2VG5 A;  1TK5 A;  1WNS A;  5E41 A;  3OYA A;  1CXU A;  1BHL A;  1ITG A;  3QIP A;  4O5B A;  3ITH A;  4YNQ A;  1RTD A;  1Z26 A;  5DMR A;  4F3O A;  2HVH A;  3U3G A;  3ZSV A;  4HUG A;  2X74 A;  4FYD A;  1EET A;  1WSF A;  2HNY A;  3KD1 E;  4B9T A;  4FJL A;  4CJL A;  2OZS A;  1D9D A;  4M3U A;  4CEB A;  1BL3 A;  1L5U A;  4KB1 A;  4DF4 A;  3RR7 A;  1VK0 A;  3M8S A;  1WSG A;  4FJ5 A;  2FBV A;  1KVA A;  1RIL A;  5T7B A;  3AVN A;  3G0Z A;  3QLH A;  4DG1 A;  3OS2 A;  3SYZ A;  3V6D A;  2KFZ A;  3PX0 A;  5J2N A;  4CCH A;  4C8O A;  4DS5 A;  4Q0B A;  3E01 A;  2G8V A;  1BI4 A;  3QIO A;  3O3F A;  4CJF A;  4J2E A;  1REV A;  3KKS A;  4CED A;  1JXE A;  5HRR A;  4CFA A;  3VQC A;  3NE6 A;  5J2M A;  1NK7 A;  5KGX A;  4CJQ A;  3V4I A;  3SQ2 A;  3TAQ A;  1RTJ A;  2IS3 A;  1L3U A;  4Y1C A;  3P1G A;  1XHX A;  1UWB A;  4O55 A;  2G8W A;  1S1V A;  2A1R A;  1NK6 A;  3ZT0 A;  4TSX A;  4FJG A;  4CEA A;  2G8F A;  3AVI A;  4F2R A;  4R5P A;  2F8T A;  2G8K A;  1QSL A;  1IKW A;  2GV9 A;  1TAQ A;  1X9S A;  3RRH A;  1HQE A;  3QO9 A;  1BIU A;  1BQM A;  1NKC A;  4I2Q A;  3NGI A;  2Y1J A;  3MEG A;  2E6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...