4KAZA

Crystal structure of rnase t in complex with a y structured dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 61
structure length 206
sequence length 206
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kazA00
4GMJB 4CESA 4K8ZA 1Y97A 3T3FA 1BHLA 3L2RA 4Q0BA 3G0ZA 1KVBA 1S1UA 4NCAA 3OYKA 4B8CA 3IG1A 2LSNA 2E6MA 4CEFA 5FDLA 5J2QA 3QETA 3PO4A 1WSIA 4Z0UA 1IKVA 1RTJA 2P1JA 3OYMA 4DSKA 4DTXA 2NUBA 3A2FA 5FRMA 1BI4B 3LDSA 3LP3A 4CGJA 1NJZA 3P1GA 3P83D 1RDDA 3DLRA 3VQEA 1RDBA 3RMBA 3L3VA 1RT5A 4DSIA 3AA3A 3VQBA 3ASMA 3LAMA 4F3TA 4PA1A 1LV5A 2PZSA 3CYMA 1J53A 3OVNA 1N5YA 5KRTA 3K5OA 1KLMA 1K6YA 1KFSA 4B9MA 1B9FA 5KRSA 1A5WA 1JLEA 2ZE2A 1JL1A 4I9LA 1IG9A 4IDKA 4F2SA 1QQCA 1RTHA 5J2NA 1BGXT 5HRRA 4FJ8A 4QOZB 1RT3A 3KKSA 4O0JA 4DQRA 3RR7A 2JLEA 3O4QA 2HHUA 4E7HA 3QNOA 4W5RA 1XI1A 3NGIA 1I3AA 3VQ8A 4FJNA 4W5TA 4ELUA 1S5JA 1DTQA 1BQNA 1RNHA 3LALA 4QAGA 2FBYA 3AVJA 4BWJA 3VQ9A 4BDYA 1CXUA 4CCHA 1I39A 2RPIA 2E6LA 3HVTA 1SKWA 4I7FA 5J2MA 3HSTB 5C25A 4CEOA 3NH2A 3TAPA 3OYEA 4M3RA 3S3OA 1VSDA 1U04A 3V6DA 1R0AA 4FK2A 1D8YA 5K14A 1WSFA 4CFBA 1YTUA 2AJQA 1BI4A 4C8NA 1S1VA 3QEXA 4AHCA 4DU1A 4B9UA 3TAMA 1YVUA 3MAQA 1NKEA 1Q9XA 1RBRA 3DM2A 3SUOA 4IG0A 4O0IA 1RTDA 1S1WA 4CEDA 1NOZA 1UA0A 4AHSA 4HTUA 4F2RA 4IKFA 2RN2A 1ITGA 3NE6A 4DFKA 2DFHA 4EZ9A 3EY1A 1KVAA 3B6OA 3IS9A 4E7JA 2I5JA 4CGHA 1FK9A 2KFNA 3PX0A 1NOYA 1XHXA 2IS3A 3VQ5A 3LANA 4KHWA 1RBVA 3V9ZA 4KV8A 3S3NA 1L3TA 3PV8A 4C8OA 1NKCA 2Z1HA 2O4IA 4AHUA 1U4BA 4ICLA 4N41A 3HM9A 4DQSA 3SQ1A 2G8UA 3U6FA 1HRHA 4E3SA 1L3UA 4IFYA 3PO5A 1RDCA 1A5VA 4FJXA 3IRXA 1GOAA 2ITGA 4OPJA 4OKEA 2VWJA 3V9WA 2VWKA 1ZBLA 1NJYA 3KLFA 3LZIA 3MEEA 1UWBA 4CJUA 1TKDA 2KZMA 4M42A 4LH5A 4Y1DA 3HO1A 1HNIA 3NF7A 4GVMA 4FLZA 2QKBA 2X6SA 4DQPA 4C8MA 3WNEA 4CHOA 4BE1A 4DTRA 3THVA 3ULDA 1SKSA 4DSJA 4F4KA 4J2BA 1WSJA 3TAFA 1ZBFA 4DFPA 4CF8A 1X9MA 3ALYA 3OS2A 4Q5VA 3AA5X 1LWFA 1S1XA 3AO5A 4DLGA 3TAQA 1IKYA 3L8BA 1U48A 3HP9A 1S6PA 1KVCA 3SQ2A 2IOCA 4F8RA 1ASWA 4FJIA 4Z4CA 3HXMA 3V1QA 4Z4FA 5CYQA 4B9SA 4DLEA 3RMDA 1TKZA 3NBPA 3SPZA 3D0PA 5KTQA 2HHQA 1YT3A 1HMVA 2F96A 3K59A 4XIUA 3SQ4A 1N6QA 3HJFA 5SWMA 1RT1A 1RT2A 3VQ4A 3OJUA 3B6PA 3VQQA 5DK5A 2IGIA 1SKRA 3NDKA 3M8QA 4DTPA 4FJGA 3HPOA 1LW0A 3L2WA 4KHQA 4UQGA 3NH1A 3M8RA 1VRUA 4IBNA 3CG7A 5HBMA 4FYDA 4EP4A 4E19A 1RBTA 5T7BA 1JLFA 3DLBA 4FJ5A 4KHYA 4FJJA 3LP2A 1C1CA 1VRTA 3KK1A 4BE2A 2G8KA 3AVCA 1ZBUA 3CFOA 2YHBA 1UOCA 1XHZA 1IH7A 3VQ6A 3NGYA 4E1MA 3LZJA 4N56A 3KKRA 3CQ8A 5CZ2A 2HHXA 1HJRA 2X74A 3OJSA 1S9GA 1C0MA 2D0CA 3ZSVA 3F9KA 4B08A 3PY8A 3V9SA 1O1WA 3SUPA 4CJ3A 4FM2A 1RT4A 1NJWA 4B9NA 1S6QA 3LPUA 4DF8A 1NK9A 3VA0A 1MU2A 4DU4A 4KRFA 4FLXA 4FVMA 4CGGA 3L2QA 4YFUA 3SYZA 3VA3A 4Z4GA 3V81A 4RW9A 3L2UA 2XY5A 2Q3SA 3OYAA 4HUGA 1U49A 2IC3A 3OYNA 2FBVA 4RG8A 3V4IA 3DLHA 4DWIA 1JKHA 1QE1A 2G8VA 4CERA 2BDPA 1TKTA 4ZHRA 1QHTA 2B6AA 4OGEA 4KO0A 4RW4A 5KGXA 4CK3A 3CFPA 3SNNA 1L3SA 2G8WA 4DQIA 4CEQA 2ATQA 4KREA 4AHVA 4DF4A 2RF2A 4M3YA 1TAUA 4J2DA 1J5OA 4Z4EA 3KIOA 3MEDA 3KLHA 5C42A 1Z25A 2X78A 4CJ5A 1NJXA 2XHBA 2YHAA 2RKIA 4ZTFA 3QEWA 3QLHA 1WNSA 5E41A 3TABA 4KB0A 3KLGA 4I2QA 1VSKA 4JRQA 1SL2A 4KHUA 3DLEA 4H8KA 3AVGA 1VSHA 3FFIA 4CFDA 3TWHA 2P5GA 5JS1A 1HNVA 3CM6A 3L2VA 1TK8A 2HHVA 5KGWA 4B8AB 5SZTA 1D9DA 2Z1JA 2G8IA 3K2PA 4CF0A 3I8DA 4PQUA 1NKBA 1BISA 1JLQA 1JXEA 5KI6A 4CGFA 3SV4A 3TAEA 4KB1A 3BGRA 1S1TA 3NFAA 2HHSA 2HNDA 3F73A 1ZBHA 1B9DA 2ETJA 1FXXA 4CK2A 3VQPA 2QKKA 3QERA 3AVAA 3LP1A 4JS4A 4KTQA 4M3ZA 3ZSWA 3SV3A 1EKEA 4CIFA 2IAJA 2JGUA 4Z4HA 2GV9A 1QS4A 2O4GA 4CK1A 1JL2A 3AO2A 3NCIA 4E0DA 1UAXA 5J2PA 2Z1GA 3NGZA 3M8SA 2B4JA 3O3GA 2DY4A 1LAVA 4O4GA 3LWMA 4B9LA 4DSLA 3RTVA 1C1BA 3CM5A 4DTUA 2DFFA 4FM0A 1J9AA 3P5JA 3QINA 3RRHA 3QESA 4N76A 4KI4A 1IO2A 4HUFA 3QEIA 4KTZA 3QIPA 2HNYA 1C0TA 1Q8IA 4HHTA 5CY4A 1TL1A 4M3TA 4Z4IA 4AHRA 2KW4A 2YNHA 1TGOA 4E7LA 3K5LA 3HL8A 1VK0A 1LWCA 2HHTA 1BIZA 3SPYA 2YNFA 4O5BA 1KRPA 4ELTA 3JSMA 4QCLA 2KZZA 2FC0A 1LAWA 4CJEA 3V1RA 4CJQA 4BACA 3BDPA 2W42A 1LWEA 3ZT3A 4CGIA 4N5SA 3ZCMA 4CJSA 1BQMA 4H4OA 3ZT2A 1SV5A 3MXIA 1SL1A 3SUQA 2BANA 1D9FA 3ZSRA 1VSIA 4DTSA 1T7PA 4LSNA 3VQAA 4L8RB 2XY8A 3OYDA 3M8PA 2VG5A 4E7KA 3TANA 1ASVA 2G8HA 4FXDA 4OLAA 1FKPA 1ASUA 3ZSZA 4FW2A 4BE0A 4ID5A 3TARA 3AO1A 3K5MA 1WAFA 3ITHA 3NHGA 2D0AA 4CJPA 5CYMA 1TK5A 3OS0A 1L5UA 3AO3A 4G1QA 4PWDA 2KFZA 3OYHA 3S9HA 3UIQA 5DMRA 1TV6A 2HNZA 1G15A 4WE1A 4J2AA 2HVIA 3O4NA 4HCBA 3AA4A 5HP1A 1QSSA 4CHNA 2BGGA 4B9TA 4PY5A 1WAJA 3ZT1A 1X1PA 4CEAA 1X9SA 1KSPA 1C1AA 3WNHA 4AH9A 3OYJA 4KHSA 4O55A 1BCMA 1U47A 2BE2A 4NCGA 1HYSA 1XC9A 4ZTJA 3AVBA 4CF2A 3V9UA 3V1OA 2P5OA 1IKWA 5EU7A 2OPPA 1EX4A 4JRPA 4FJHA 1HQEA 4IG3A 4MFBA 4CJKA 3KJVA 2PYJA 4FLWA 2IDOA 3HK2A 1CLQA 2QXFA 1RBSA 4CIGA 3SQ0A 4JLHA 3OS1A 4ELVA 2OPRA 2P51A 3JYTA 1TVRA 4CJWA 4CIEA 4FCYA 3QIOA 3VQ7A 4B3OA 1WN7A 3E01A 5I3UA 3T1AA 2XRIA 3MEGA 3HYFA 1QSLA 4CJLA 3TAGA 1TAQA 3KK3A 3DMJA 3EZ5A 3DLGA 4KPYA 4CHYA 2ZD1A 3C6UA 3WNGA 4C8LA 2HVHA 3DOLA 3DRPA 3SZ2A 4DU3A 1JLGA 4W5QA 3KLEA 4KFBA 4FZXC 1VSEA 1W0HA 2HHWA 4DTOA 1JLBA 3I0SA 2OPQA 3ZSYA 1REVA 3AVLA 1NK0A 4M3WA 3SUNA 3VQCA 3L3UA 3SI6A 4FJKA 3ZT4A 4FJ7A 4HUEA 2Y1IA 4M3XA 4LSLA 4EZ6A 2F8TA 1TL3A 5HRSA 1JLCA 1NK7A 2DTUA 3NF8A 4HCCA 3C95A 1W9HA 3VN5A 3OYGA 3PUFA 2YV0X 4I9QA 3H08A 3CFRA 4BDZA 1T8EA 3OY9A 1T05A 1ZBIA 1KTQA 3HPHA 4DFMA 4BDPA 2Z1IA 4FJ9A 1IKXA 4OPKA 3HP6A 3KD5E 4FLUA 1C6VA 2YNIA 3VQDA 4NCBA 1RT6A 5CZ1A 3OYBA 3OYFA 5FRNA 3G10A 2WONA 1KCFA 4CHPA 1NK6A 1GOCA 2YKMA 3AVNA 1WSEA 1C0UA 2ZQBA 4K8XA 4FJMA 3LWLA 2OPSA 4FZZA 3QO9A 3ZSQA 1D5AA 1TKXA 4C8KA 4CGDA 1VSMA 5C24A 3AVKA 4KHNA 4LY7A 1BIUA 4BWMA 4CHZA 4CJFA 4N47A 1B92A 1CXQA 4TSXA 1U45A 3KD1E 3AVHA 3DRRA 2GUIA 1BL3A 3S3MA 3C6TA 1WSGA 1NK5A 1RT7A 5HROA 2D0BA 1T03A 1S9EA 4OKJA 2D5RA 3HVRA 1RCHA 4OLBA 3OYLA 2OYQA 4W5NA 5HLFA 3HPGA 1HYVA 2B5JA 3K57A 3ZSOA 4CFAA 1XWLA 1YTAA 3PX4A 4GW6A 3AVMA 5J1EA 3K5NA 4F3OA 2X6NA 1Z26A 1L3VA 4RW8A 3ZT0A 4B9VA 4FK4A 1VSLA 1WLJA 3LAKA 1RBUA 1SL0A 2YNGA 3NF6A 4LD0A 5JS2A 1HYZA 4CE9A 2E4LA 3U3GA 4ID1A 2XY7A 3SCXA 1KFDA 4DSFA 2Y1JA 4CF1A 1NK4A 2OZSA 1EXQA 4M41A 3K58A 4E7IA 3I0RA 4O44A 4CF9A 5I42A 4M3UA 3AVFA 1UA1A 2EHGA 2G8FA 4EP5A 2PYLA 1EP4A 3QNNA 1LW2A 1SUQA 1F21A 3ZSXA 5HRPA 4CJ4A 4RW6A 4FM1A 2OZMA 3LP0A 1HPZA 3DI6A 3C94A 2PY5A 4W5OA 2VG6A 1A5XA 3MECA 4OGCA 4NYNA 4DTNA 1DTTA 4KI6A 1RTIA 3AA2A 4CFCA 5HRNA 3RMCA 4DTMA 3T19A 3MXMA 4CJTA 4IFVA 1ZYQA 3O3HA 4R5PA 1KLNA 2R7YA 3QEPA 1CZ9A 2F8SA 3DYAA 3NH0A 2DFEA 4CEZA 4E1NA 1DLOA 3KTQA 4PUOA 4LH4A 4DS4A 4HVJA 4DG1A 3O3FA 2WOMA 3SJJA 3TI0A 1X9WA 1J54A 4CEEA 4FLYA 2XY6A 3TR8A 4AILC 4NYFA 2OA8A 4DQQA 2A1SA 4CHQA 4DFJA 3RWUA 1JXBA 3U3YA 5D3GA 3RR8A 4DTJA 3ISNC 4YNQA 3DLKA 4FZYA 3PX6A 4E89A 4FW1A 3EYZA 4KTWA 4I2PA 4RW7A 3WNFA 3D45A 2FBXA 4CEBA 3AVIA 4M45A 4DS5A 2GBZA 3V9XA 4AHTA 3DRSA 1HQUA 3MXJA 2XO7A 4DMNA 4Y1CA 4CECA 4FJLA 2KTQA 1TK0A 2HW3A 2FBTA 1WSHA 1FKOA 3HT3A 1BCOA 3KLIA 1CZBA 4JS5A 3QEVA 3RMAA 2HMIA 2QK9A 3AO4A 4OJRA 4FK0A 1VSFA 2KQ2A 3NF9A 1GOBA 1RILA 3NAEA 3RRGA 4DSEA 4FLVA 1QTMA 1EETA 3AV9A 4CJVA 4OVLA 5FROA 3OYCA 1NK8A 4H4MA 1QSYA 1RDAA 3DOKA 3OYIA 4OKKA 2EX3A 3IAYA 4MQ3A 2VG7A 4J2EA 2HB5A 4CJRA 4FLTA 1Q9YA 4KAZA 1JLAA 3LPTA 4KKOA 1VSJA 2A1RA 2YKNA 3KK2A
chains in the Genus database with same CATH superfamily
4CESA 5JLFA 1BHLA 3G0ZA 3BUZB 5HL7L 2E88A 4B8CA 3IG1A 1VHXA 2E6MA 4CEFA 5J2QA 3HI0A 1WSIA 2IVOA 4DSKA 5FRMA 3LP3A 4CGJA 3UKUB 3P83D 4BC4A 1RDDA 3KWIA 5AQRA 4YOYA 1QZ6A 3IKMA 3CQXA 4PA1A 2EWSA 1LV5A 2QWOA 3CYMA 2PZSA 4BC3A 1N5YA 1KLMA 5KRSA 4F2SA 1QQCA 1RTHA 2YI1A 5HRRA 3RR7A 4DQRA 3MN6A 4IOXA 4W5RA 4IXCA 5AZJA 4FJNA 1KD1O 4CCHA 3LALA 3VQ9A 1CXUA 2RPIA 3UKRB 1XMOK 5J2MA 5CR4A 3J81O 3NH2A 3OYEA 3V6DA 4I6MA 4NXMK 3LDLA 1WSFA 4CFBA 3VMFB 5B8HA 4DR4K 1I94K 3TAMA 1Q9XA 1V4SA 3DM2A 1ZBSA 3SUOA 5CHIA 4IG0A 4CVNE 4AHSA 3K9JA 1ITGA 2A6AA 4A62A 3WXLA 4E7JA 3B6OA 5M1FA 2I5JA 4CGHA 2HMPA 3PX0A 1KAYA 1XHXA 3VQ5A 4EAHD 4ISGA 1RBVA 3PV8A 3VF4A 4C8OA 4AHUA 1U4BA 4DQSA 1MA9B 3PLAA 1HRHA 2HBKA 4E3SA 1L3UA 4IO9L 1GOAA 4OKEA 2VWJA 2VWKA 3DXKB 3MEEA 3GDQA 5LJVA 4JI7K 4FLZA 1QVFM 2QKBA 4DQPA 4JKGA 4BE1A 1SKSA 1DEJA 2FXUA 2O8EA 1WSJA 3TAFA 3LDNA 1Q86O 1S1XA 4DLGA 3L8BA 4F8RA 2IOCA 3CF5L 3E9OA 2NLXA 4FVUA 4LC9B 4B9SA 3CC4N 1TKZA 3D0PA 5KTQA 2HHQA 1HMVA 3SQ4A 3HJFA 2QWLA 1RT1A 3M5RA 5TKYA 3B6PA 3VQQA 3FLCO 2P9NA 4OO1J 3VEXA 4DTPA 4KHQA 3KK7A 4UQGA 1DGKN 3M8RA 3EE8A 4GKJK 4PHTX 3QBXA 4EP4A 1M90O 2NRTA 1G99A 3PSIA 1VRTA 2G8KA 4ISFA 3H6EA 4E1MA 1KQSM 1HJRA 4B1ZA 1S9GA 3ID8A 4B08A 1D4XA 2I7NA 3V9SA 2E2OA 4CJ3A 4FM2A 1RT4A 4CBXA 2QW9A 5BPLA 4B9NA 2QWRA 3LPUA 1NK9A 1MU2A 4DU4A 4CGGA 4H0PA 4Z4GA 4RW9A 4L3QA 2Q3SA 3OYAA 2IC3A 2HBLA 1Z05A 5EY4A 4CERA 4RWTA 3CJBA 3SNNA 2G8WA 4DQIA 2ATQA 3D2FA 4FWLA 1TAUA 4J2DA 2QTDA 4Z4EA 1C0GA 2ZF5O 3KLHA 3KWGA 4B9QA 3JS6A 1DKGD 2XHBA 1Q82O 2NRVA 1JJ2M 3FFIA 1RGIA 1VSHA 3TWHA 2P5GA 5AQJA 1ATSA 3N4QA 3L2VA 3HBTA 1D9DA 4FOIA 3I56N 3TAEA 2QWMA 3EL2A 5KI6A 1S1TA 2HNDA 1ZBHA 1B9DA 2ETJA 2O8FA 3AVAA 3LP1A 1Q81O 4H0YB 5LY3A 2IAJA 1J5EK 1QS4A 1UAXA 1HNWK 1LAVA 4B9LA 4DTUA 3CM5A 4FM0A 4FWKA 4KTZA 3QIPA 3E1YA 1TL1A 1NGBA 2IIRA 4AHRA 5AQGA 1TGOA 1GLLO 4B3SK 1LWCA 3P4IA 5AQUA 1TUUA 3SPYA 5BPMA 2KZZA 2FC0A 4B3TK 3V1RA 4CJQA 5FPMA 4BR2A 4CGIA 1HPMA 4N5SA 3C6HA 4H4OA 4RTFD 1SV5A 4CZFA 4BQLA 1SL1A 3SUQA 1D9FA 2QWPA 1VSIA 4DTSA 1BWFO 4YY3K 3OYDA 3M8PA 4E7KA 4OLAA 1FKPA 4ID5A 5I9EB 5AQZA 4H0TB 4LF4K 4PWDA 4G1QA 2JWLA 5DMRA 3DXMB 1G15A 3O4NA 4MO5A 3AA4A 2P9PA 3THXA 4CEAA 1C1AA 3ZETB 2O8DB 1E4GT 1W2BM 5MLCQ 4BRHA 2BE2A 1XC9A 4CF2A 4FO0A 5BPNA 4JRPA 1EX4A 4H0VB 4FJHA 4CW7B 1HQEA 1NBWA 2IDOA 1RBSA 4JLHA 3OS1A 2OPRA 2P51A 4CJWA 3QIOA 5I3UA 3T1AA 4DR5K 3MEGA 1CZAN 4CJLA 5ADXH 3TAGA 2QEXN 5AQYA 3DMJA 3KK3A 3EZ5A 5JVHL 3C6UA 5AR0A 1YXQA 2NRRA 2HVHA 4DKWA 3G6EN 3C7NA 4KFBA 3O9SA 1NK0A 4M3WA 1W7AA 4H03B 3L3UA 2OTJN 1HLUA 3D6RA 4BC2A 4M3XA 2Y1IA 4EZ6A 5HRSA 3NF8A 4HCCA 4FWQA 3OYGA 3L4QA 3PUFA 2YV0X 3G71N 1ZBIA 4BDZA 3FZHA 3OY9A 3ID6A 2A40A 4BDPA 4FJ9A 3CCRN 4FLUA 5CZ1A 3OYBA 1XMQK 1T6CA 4CHPA 1J6ZA 4K8XA 4JD2B 3LWLA 1XNQK 1TKXA 1VQ8N 4BWMA 4B1VA 4N47A 1EWRA 1B92A 1U45A 3JAMO 3AVHA 3DRRA 2CGLA 3VEOA 1BL3A 3MX5A 3SLCA 1IG8A 1SS6A 4OLBA 1N8RO 2OYQA 5HLFA 4K0KK 3HPGA 2B5JA 3K57A 2BUPA 4BRDA 3AVMA 2UXBK 3F9MA 3K5NA 3CERA 1Z26A 2WUSA 1VQ4N 2HF4A 1L3VA 4RW8A 3A5LC 5C2FA 1RBUA 3HTVA 5AQSA 1HYZA 2E4LA 4DSFA 1K8KB 2E20A 3MX2A 4CF1A 1EXQA 4K25A 4E7IA 3WXKA 3AVFA 1K9MO 5GINA 2FLOA 2G8FA 1SUQA 1F21A 3ATUA 1BU6O 2OZMA 3H1QA 3DI6A 2BH1A 3RSEA 3I55N 2FSJA 3O4WA 2V7YA 4R5PA 3QEPA 3CCVN 2F8SA 2DFEA 4E1NA 1DLOA 3C6AA 4LH4A 4IEIA 3CETA 3PIPL 3AAPA 3O3FA 1K73O 1X9WA 2Q1NA 3MCAB 4CEEA 3OHRA 3IFRA 4NYFA 3DJCA 2OA8A 4DQQA 1JXBA 3U3YA 2E1ZA 1ZXOA 3ISNC 2YHYA 4JI4K 4E89A 2UXDK 4I2PA 4JK8A 4Z94A 2GBZA 4FJLA 4CECA 2KTQA 2FBTA 1WSHA 3HT3A 3KLIA 2QK9A 1VSFA 1RILA 1EETA 4CJVA 1NK8A 4O8KA 4LF7K 1IBMK 2EX3A 4MQ3A 1NU0A 4WFBL 2HB5A 1Y64A 4FLTA 4KAZA 4BQZA 5AZJB 4KKOA 1VSJA 3CC2N 2YKNA 3KK2A 4ILHA 4A2AA 3NMUA 3T3FA 4JK9A 3L2RA 3LDPA 4NCAA 3OYKA 2LSNA 4YOTA 1U6ZA 4Z0UA 1IKVA 2P1JA 4H5TA 3SMSA 2NUBA 3LDSA 3P1GA 3KVGA 3VQEA 3MN5A 3L3VA 4DSIA 4BRIA 1LCUA 4WF9L 1J53A 4KH4A 4BG8A 1K6YA 4BRCA 1KFSA 1NGIA 1B9FA 1JLEA 2ZE2A 2UYTA 1HKBA 4QOZB 2E2PA 4FJ8A 4OX9K 1RT3A 4O0JA 2JLEA 4DV6K 1I3AA 4IOAL 4ELUA 1S5JA 1BQNA 4MO4A 1I39A 5C25A 4CEOA 5KPZA 3TAPA 2ASMA 4M3RA 1VSDA 4WQ5A 1D8YA 5A2QO 1BI4A 4C8NA 4AHCA 3LDOA 3O8MA 4DU1A 4B9UA 5EVZA 4JI1K 4O0IA 2Q31A 5IWAK 1RTDA 1NOZA 3K9KA 4HTUA 2RN2A 2DFHA 4EZ9A 3EY1A 1KVAA 3IS9A 4FOEA 1FK9A 3T1HK 2IS3A 1HNZK 4KV8A 1L3TA 1IJJA 4ICLA 2P9NB 4IFYA 2ITGA 3V9WA 1NNEA 1ZBLA 4AM7A 4BREA 3LZIA 1UWBA 1TKDA 4M42A 4GVMA 3NF7A 3A5NC 2GWKA 1S3XA 3THVA 4F4KA 2WC9A 1YI2N 4CF8A 2Q2RA 3OS2A 2ZWHA 1S6PA 1KVCA 3SQ2A 1ASWA 4Z4FA 4Z4CA 3HXMA 3UE5A 4DLEA 4JKHA 2NRWA 4AQYK 1N6QA 3FE1A 3M1FA 4XIUA 2A42A 3OJUA 4B1XB 1TUYA 3NDKA 5M1PA 3HPOA 3O9UA 1OVQA 3NH1A 1VRUA 4WCEL 3CG7A 4FYDA 2D4WA 1NGHA 5ADXA 4E19A 3D2FB 2KKZA 5T7BA 3DLBA 4KHYA 4FJJA 1WOQA 4BE2A 4WQ4C 1H1VA 3CQ8A 4N56A 3KKRA 2X74A 3I33A 3OJSA 1C0MA 2D0CA 2FSKA 4XH4A 3F9KA 3CCQN 3PY8A 1QQNA 1MWMA 4JKBA 4H5NA 4FWRA 4CZMA 4DCHA 2HOEA 2YHXA 1E4FT 4DF8A 3VA0A 4NLCA 2P9LA 4KRFA 4FLXA 4ILGB 4QS7A 4PKIA 2XY5A 2FBVA 3V4IA 3DLHA 4DWIA 1JKHA 4XH1A 4YOUA 1GLDG 3CFPA 4ZHRA 4OGEA 1L3SA 2BDPA 2KZMA 3OBYA 3ZYYX 4DF4A 2RF2A 5BN8A 1J5OA 3AAQA 3MEDA 4BR0A 5JMVA 4R79A 3EZWA 1Z25A 4CJ5A 2P9IA 4DUZK 2YHAA 3VESA 4ZTFA 2PFUA 3THYA 5M1NA 5AQOA 4I2QA 1SL2A 4JRQA 4KHUA 4H8KA 5JS1A 3OW2M 3CQYA 1IBLK 3CCLN 3U9ZA 5KGWA 1VQNN 5FPEA 5SZTA 2G8IA 3CMEN 3K2PA 3VF6A 1YVNA 4PQUA 3SV4A 1JXEA 3KHYA 3F5TA 5TKWA 1VQMN 4CD1A 2J4RA 4JI8K 4JS4A 1WUAA 4PKGA 4KTQA 4M3ZA 3SV3A 4CIFA 4WQ5C 3B8AX 5EXWA 2JGUA 3DLLL 2O4GA 3WXJA 2VYPA 4X65K 3M8SA 3O3GA 2DY4A 1N32K 3RTVA 2E2NA 3NVMA 3P5JA 3QINA 3QESA 3WQTA 2Q36A 3UB5A 4HUFA 3QEIA 4GV6A 3ULEA 3ATVA 3VGLA 3ENOA 4M3TA 2P9PB 2YNHA 3O80A 5LJWA 3THXB 3P39A 3QFPA 3CCSN 2HHTA 4BR4A 4DR6K 4BACA 2ZM6K 5FLXO 1BQMA 1RDWX 2YX6A 1GLAG 3VQAA 4EFHA 3WXMB 2G8HA 3HOTA 1ASVA 3CIPA 4BE0A 5AZIA 3AO1A 1VQON 2D0AA 3O1BA 4BRKA 4DV1K 2KFZA 3S9HA 2HNZA 4B1UB 4HCBA 4CHNA 1X1PA 4AH9A 3WNHA 3C7NB 4LF6K 4DV2K 4KHSA 4O55A 2F9TA 4ZTJA 3V9UA 1XQSC 4H5RA 3U9DA 3V1OA 4IG3A 3KJVA 2PYJA 1XNRK 3HK2A 4DR7K 3CMAN 5AQFA 3DWLA 3U8XA 4CZLA 4ELVA 4CIEA 4FL9A 4FCYA 3A5OC 3E01A 2DPNA 3CCEN 4B3MK 4ILJA 4KPYA 1BA0A 2ZD1A 1V4TA 4V19S 1TYQA 3SZ2A 2ASOA 4W5QA 3MCPA 4FZXC 2E1YA 5C0YA 2OPQA 2A3ZA 1REVA 1VAZA 5KQ8A 3VEYA 3ZT4A 4HUEA 1KAZA 4LSLA 4CBUA 1NK7A 4A59A 3VN5A 3H08A 1T05A 1OH6A 3U4LA 1XUPO 3HPHA 4DFMA 2NRZA 2Z1IA 2VCPA 4NCBA 4OPKA 4LF5K 1C6VA 2YNIA 3VQDA 5FRNA 4U7BA 2YKMA 3TTDA 1WSEA 1C0UA 4FZZA 3QO9A 3D7EO 1D5AA 5C24A 3AVKA 4LY7A 4CJFA 5H1SQ 1C0FA 1HUXA 5GADP 2GUIA 4K42A 4MLEA 3S3MA 4WYBA 5HROA 1T03A 4OKJA 1R59O 2D5RA 1RCHA 4CFAA 3PX4A 4GKKK 2X6NA 1ILYA 1VQKN 2JWKA 4BRQA 4B9VA 4FK4A 1MDUB 2NRXA 1SZ2A 2YNGA 1O13A 5E26A 4JKFA 3CHWA 2XY7A 4ID1A 3SCXA 1NK4A 3J80O 3CJAA 3K58A 1P8ZA 3I0RA 4CF9A 4JI2K 4NLBA 3P31A 1EP4A 4M63C 1LW2A 5BR9A 3ZSXA 1HPZA 4NB4A 2PY5A 4W5OA 2VG6A 1A5XA 3MECA 4NYNA 2YHWA 5AQIA 4DTMA 3O3HA 4DR2K 4PL8A 3MN9A 3KZBA 4BR5A 2E5LK 3W0LA 4B1WB 2F7TA 4HVJA 2WOMA 3SJJA 2XY6A 3TR8A 4C23A 2A1SA 4DFJA 3BEXA 5BR8K 5AQHA 4YNQA 1RDUA 2ITMA 3DLKA 4FZYA 3PX6A 4FW1A 4RW7A 3WEEA 4KBOA 3GOIA 3VOVA 4CEBA 3AVIA 1GLCG 4M45A 4DS5A 4AHTA 4DMNA 4Y1CA 5I42A 2HVIA 4JS5A 1CZBA 2HMIA 3HM8A 4CI6A 4FK0A 1N34K 1GOBA 1VQPN 4FLVA 3OYCA 3OYIA 1YHQN 5AQQA 4C1NI 3LPTA 1WB9A 4M7YA 2QWNA 2A1RA 4GMJB 3VETA 3QMLA 5GAEP 4K8ZA 1Y97A 1YJ9N 1VQLN 1K8AO 3PO4A 2AA4A 1HKCA 3QETA 1JCFA 1RTJA 3OYMA 3A2FA 1BI4B 3T69A 1RDBA 3RMBA 1RT5A 3VQBA 3ASMA 1S22A 3LAMA 5KRTA 3K5OA 3EO3A 3VENA 4B9MA 4I9LA 1JL1A 1JCGA 1GLBG 4IDKA 4A2BA 1IG9A 1QQMA 4JHDA 2HHUA 4E7HA 3QNOA 3NGIA 3SBGA 1RNHA 2FBYA 5AQLA 4DV0K 1SKWA 3HVTA 1NGCA 3LM9A 3O6WA 3S3OA 2VQEK 3O9TA 5GIPA 4X64K 1YVUA 1GLEG 1HX1A 1RBRA 1T3VA 1S1WA 4CEDA 1UA0A 4IKFA 4F2RA 2D0PA 4DFKA 1QZ5A 2KFNA 1NOYA 3LANA 3V9ZA 3S3NA 1NKCA 2Z1HA 4N41A 2P9KA 3HM9A 2ASPA 2G8UA 3U6FA 4FWOA 3PO5A 1RDCA 1A5VA 2ZGZA 4BRNA 1NJYA 5GAGP 5EOYA 1QHAA 4LH5A 4DV7K 3RVCA 4C8MA 3WNEA 4FWMA 4KH5A 4DSJA 4J2BA 1NGFA 1ZBFA 2PAVA 3BP8A 2O8BA 4FWPA 4Q5VA 3AO5A 3MDQA 3TAQA 1IKYA 2PBDA 3FR0A 3R1XA 4JI3K 3WT0A 4B3RK 4FJIA 5AFUH 4YOWA 3RMDA 3NBPA 4QS9A 3ZEUA 2P9LB 1X3MA 1RT2A 3VQ4A 4BRFA 3M8QA 3L2WA 4IBNA 5C15A 4JI6K 1RBTA 1JLFA 3KK1A 2V51B 3F2KA 2FF6A 5EX5A 1ZBUA 2YHBA 4JYAK 1IH7A 3E66A 3QB0A 2HHXA 2HHSA 4DUYK 2P9IB 3FZLA 1Q7YO 3THYB 5KPRA 1S6QA 2WBNA 3L2QA 3SYZA 3VA3A 3V81A 4I6MB 3L2UA 1ATNA 4HUGA 1U49A 1QQOA 3OYNA 2OTLN 3J7ZO 3DXMA 2G8VA 3QBWA 3TPQA 4CK3A 1JCEA 3G4SN 4KREA 3ENHA 5AQTA 4Y0WA 1YIJN 3GL1A 3KIOA 1YF5L 5C42A 1S72N 2VGNA 5AJ3K 4WFAL 3T7ZA 2RKIA 3QEWA 3QLHA 1WNSA 4YORA 3ULEB 2VQFK 3KLGA 3CCJN 3AVGA 3M3ZA 3MWTA 1TK8A 4B8AB 2Z1JA 4BGBA 1BISA 1JLQA 4CGFA 4CJ7A 3NFAA 4JKGB 3F73A 4JEPA 2O8EB 4CK2A 3VQPA 2QKKA 3QERA 2A41A 2Q97A 3ZSWA 2GV9A 4CZKA 3NCIA 2QWQA 4J8FA 3HSCA 2AP1A 5J2PA 3SAFA 1LOTB 5BN9A 2WTUA 1YUWA 1Q18A 4K41A 4O4GA 3LWMA 1C1BA 2P9UA 2DFFA 1J9AA 4GVEA 4N76A 4KI4A 4JK7A 4CZGA 4B1YB 1IO2A 3THWA 1C0TA 5FPDA 1Q8IA 2V7ZA 5CY4A 4CZJA 2KW4A 4E7LA 3K5LA 3TU5A 4CZEA 1BIZA 4BRLA 3EKSA 4A5AA 1KRPA 4ELTA 3I8BA 5F2RA 1LAWA 3BDPA 3AGRA 3AARA 4CJSA 3R8EA 4BGAA 1BUPA 3ZSRA 1T7PA 2XY8A 2VG5A 3TANA 4FXDA 5CE3A 2O8CA 4FW2A 3LL3A 3TARA 3K5MA 3NHGA 5CYMA 3R6MA 1L5UA 3AO3A 4JKAA 4DQ8A 3MWPA 3UIQA 4FWSA 3GE1A 2HSTA 3O1WA 1VQ6N 4WE1A 3A8YA 2VGMA 1OH8A 5HP1A 1QSSA 3TSUA 4B9TA 1TYQB 4PY5A 1WAJA 4NO7A 1KSPA 3OYJA 3L6QA 3MMVA 4C1NK 3HOSA 3SK3A 5M1OA 2BTFA 1NGGA 2KLAA 2CH6A 3PSFA 5EU7A 1U2VA 3GG4A 1OVYA 1DT9A 4CIGA 3SQ0A 3QICA 3AY9A 4AF1A 1TVRA 3VQ7A 3SAHA 1GLFO 1WN7A 2ZJRL 4DR1K 4IJNA 3JXUA 1HJOA 2E2QA 3HYFA 3TSPA 3IMXA 1FJGK 4PL7A 2O8FB 4U67L 4BVPA 5BREA 4CHYA 4JI5K 4BVOA 1HR0K 4C8LA 3WUHA 1W97L 3DRPA 3W3DA 1JLGA 2RHKA 5AQKA 3KLEA 1W0HA 3I0SA 2HBJA 3ZSYA 4WFNL 3AVLA 3WXIA 3VPZA 1BDGA 3CCUN 2Q0UA 2GUPA 4FJKA 4FJ7A 3ZX2A 2F8TA 1TL3A 4HTLA 1BOTO 1JLCA 2DTUA 4O5FA 4I9QA 1T8EA 3CFRA 5E84A 5AQVA 3EE9A 2NRHA 1IKXA 1RT6A 4HWIA 4LFBK 3OYFA 3G10A 3VEVA 2WONA 1KCFA 5DM6L 1GOCA 3AVNA 4O8UA 4FJMA 2P9SA 3ZSQA 3IUCA 2D0OA 4C8KA 4CGDA 1VSMA 1N36K 1BA1A 4KHNA 4KHPK 3AGKA 2CH5A 4TSXA 2ZJQL 5AQNA 3CJ1A 5JICA 3KD1E 3H3OB 3C6TA 1WSGA 4F9OA 1NK5A 1RT7A 3CJ7A 3VEWA 1XC3A 2D0BA 3BZKA 3OYLA 1OKJA 4W5NA 4MDAA 1HYVA 3ZSOA 2YJEA 4OPAA 4GW6A 5J1EA 4F3OA 1YJWN 3ZT0A 1VSLA 3LAKA 3NF6A 2GELA 1EQYA 4LD0A 5JS2A 4CE9A 3D2EA 3U3GA 5AFUA 2OZSA 2IVNA 4GNIA 3WEEB 3G25A 3CJCA 1UA1A 3QFUA 4EP5A 3QNNA 4H5WA 1X9JA 4AM6A 5HRPA 4CJ4A 4RW6A 4FM1A 2F9WA 4A5BA 4OGCA 4KI6A 3AA2A 4CFCA 4LFCK 1ZYQA 3VTIA 3T19A 1KLNA 4IFVA 1YITN 3DYAA 4CEZA 5FPNA 4PUOA 4FPAA 4DS4A 4DG1A 5M1QA 1J54A 4FLYA 1HNXK 4AILC 4CHQA 1NGJA 4DTJA 3CD6N 3E9PA 3LM2A 4KTWA 3D45A 2UUAK 1HQUA 3MXJA 1TK0A 2HW3A 3QEVA 1BCOA 3RMAA 4OJRA 3NF9A 3NAEA 4MLHA 4DSEA 1QTMA 2QXLA 3AV9A 1QSYA 4OVLA 1YAGA 4CD3A 1RDAA 4OKKA 2VG7A 4K43A 4J2EA 4CZIA 4JHDB 1Q9YA 4UY8O 4BC5A 1JLAA 3ZLJA 2GX9A 1NJIO 4Q0BA 1KVBA 1S1UA 2CGKA 3A0IX 4GY2B 5FDLA 3VTHA 2GWJA 3E9LA 4DTXA 4JN4A 1NJZA 2W41A 3DLRA 4JKCA 3AA3A 4EHUA 5M1KA 4F3TA 3TTCA 3J7YP 3OVNA 4DV5K 1IBKK 1A5WA 5J2NA 1BGXT 4BRPA 3KKSA 3O4QA 4BG9A 1XI1A 4CZHA 2P9KB 3VQ8A 4W5TA 1DTQA 4YDUA 4BWJA 4QAGA 4KHWA 3AVJA 4BDYA 1EWQA 2E6LA 4I7FA 3VGMA 3HSTB 1NM1A 5C2DA 2ZJPL 4ISEA 2UUBK 5GIOA 4X66K 3RSEB 2OANA 1R0AA 1U04A 4FK2A 5K14A 4JV5K 1YTUA 5LMUK 2AJQA 3QEXA 1S1VA 3UKUA 3MAQA 4BR7A 1NKEA 2O8BB 2W40A 2ZGYA 4YOXA 1P90A 3NE6A 2NZTA 2NNWA 3IDHA 1KAXA 1N33K 4A61A 3WQUA 3ZEUB 4XEIA 3EKUA 3K0SA 1VQ5N 4JAXA 2O4IA 3SQ1A 2GEMA 5IT9O 4FJXA 3IRXA 3UKRA 4OPJA 3KLFA 2RE2A 4CJUA 4DR3K 4XH5A 4Y1DA 3HO1A 1HNIA 3CC7N 4FPBA 2X6SA 1FW6A 4DTRA 4CHOA 3ULDA 4JI0K 4DFPA 2W6KA 1X9MA 3ALYA 3O9QA 4DHYA 4IEEA 3AA5X 1LWFA 1U48A 3HP9A 5F1XA 1KXPA 4H0OA 3V1QA 5CYQA 3N4PA 3SPZA 1Z6RA 3OA9A 1YT3A 2F96A 3M6GA 3K59A 5DM7L 5AQPA 3H3NO 5SWMA 3ZX3A 5DK5A 2IGIA 1SKRA 2GTDA 3GBTA 1LW0A 3CXCM 5HBMA 3DXKA 4A57A 1KC8O 4FJ5A 3LP2A 1C1CA 1OH5A 3P38A 3AVCA 3VEZA 3CFOA 1XHZA 1UOCA 2HHHK 3VQ6A 3LZJA 3NGYA 5CZ2A 2KHOA 3H46O 4DV4K 3ZSVA 2H3GX 2QA4N 1SQKA 4G9ZA 5HOOA 3L0QA 1O1WA 4CBWA 3SUPA 1NJWA 4YHHK 4IWVA 4FVMA 4YFUA 5AQMA 1YJNN 1GLJO 1M1KO 1ATRA 4KH6A 4RG8A 1QE1A 3CPEA 1TKTA 3R9PA 1QHTA 2B6AA 5C10A 1ZC6A 4KO0A 4RW4A 5KGXA 4FJGA 4LFAK 4BY9C 4CEQA 4AHVA 2FF3B 3PIOL 4M3YA 5LMNK 3SAGA 4H0XB 3S41A 1IV0A 2X78A 1NJXA 2P9UB 1NGEA 3H1VX 5E41A 3TABA 3THWB 4KB0A 4RCHA 1VSKA 3DLEA 4CFDA 4NXNK 1HNVA 1NMNA 3CM6A 3O5BA 2HHVA 1EO1A 2VWBA 3C65A 4CF0A 3I8DA 1NKBA 4KB1A 3BGRA 4YDUC 4DB3A 3FFKB 4FWNA 4X62K 1FXXA 4YOVA 1EKEA 4Z4HA 4CK1A 1JL2A 3AO2A 2D1KA 3R3LA 4E0DA 2O8CB 2Z1GA 3NGZA 2B4JA 4BRMA 4DSLA 5BRFA 3RRHA 3BF1A 4BRGA 1HKGA 1E3MA 2HNYA 4HHTA 4Z4IA 4OPHA 3HL8A 1VK0A 2YNFA 4O5BA 5BRHA 5JLHA 3JSMA 4QCLA 4CJEA 2W42A 1LWEA 3ZT3A 3ZCMA 3FZMA 3Q7CA 2QI2A 3ZT2A 3MXIA 1U2VB 2BANA 5F0XA 1VQ9N 4LSNA 4L8RB 3SBTA 1ASUA 3ENBA 3ZSZA 1NLVA 2YCHA 1WAFA 3ITHA 1BO5O 4CJPA 1TK5A 3OS0A 4IDHA 3OYHA 1BG3A 3CCMN 1TV6A 4IJAA 4J2AA 4BRAA 1X3NA 2BGGA 2E8AA 3ZT1A 1X9SA 3SMPA 4IO8A 1BCMA 1U47A 4NCGA 1HYSA 3FZFA 3OTOK 3AVBA 2P5OA 1IKWA 1NG9A 2OPPA 3J7AP 4EIAA 4MFBA 4CJKA 4FLWA 3OBWA 1CLQA 2QXFA 3O08A 3T1YK 2F4VK 4WQ4A 3FGUA 2CGJA 3JYTA 4DV3K 3CI5A 3BZCA 4JKEA 4B3OA 3C0BA 1OH7A 2XRIA 1QSLA 1TAQA 3EEQA 3DLGA 4E1JA 2P9SB 3WNGA 3J8AA 3EN9A 3DOLA 2QM1A 4DU3A 3ZETA 2O8DA 1VSEA 2HHWA 4DTOA 1JLBA 5BRDA 3CPWM 3SUNA 3VQCA 3Q7BA 1RFQA 4FSVA 3SI6A 4H5VA 3A5MC 3C95A 1W9HA 2UXCK 2WFBA 4GV3A 1KTQA 3VF2A 3ZX0A 3HP6A 1NMDA 3KD5E 2Q0RA 2A5XA 2HBMA 4EHTA 1NGAA 1NK6A 4IFEA 1VQ7N 1MWKA 3D2EB 5JVGL 2ZQBA 5C12A 4GV9A 2OPSA 3DAWA 3MK6A 4MDBA 3FZKA 3CJ9A 1BIUA 4CHZA 1CXQA 2V52B 2I7PA 1WBDA 3L4IA 5AZIB 5GAHP 1S9EA 3HVRA 2UU9K 5LL6Z 2FSNA 1WBBA 4M7XA 3O9RA 3HRGA 1XWLA 1YTAA 2HF3A 1T6DA 1NWKA 1WLJA 1NGDA 1SL0A 2W6LA 4LF9K 1QVGM 3HZ6A 4QS8A 4IOCL 1KFDA 2Y1JA 4JD2A 4PKHA 3SJHA 4M41A 4M3UA 4O44A 4IZ9A 2EHGA 2PYLA 3TSQA 3LP0A 3MN7A 3BF3A 3C94A 3QDKA 1DTTA 4DTNA 5ELZA 3NVKA 1RTIA 5HRNA 3RMCA 3MXMA 4CJTA 4JNEA 2R7YA 1CZ9A 3TTFA 2IVPA 3NH0A 3KTQA 4LF8K 4BROA 4BR9A 3TI0A 3VGKA 3RWUA 3BY5A 5D3GA 3RR8A 1ESVA 2YJFA 1K8KA 1SAZA 3EYZA 3WNFA 2FBXA 3VERA 1T44A 5AQXA 2UUCK 3V9XA 3DRSA 3LDQA 2XO7A 1FKOA 4JKDA 3AO4A 2KQ2A 5AQWA 3RRGA 5FROA 3H45C 4H4MA 3DOKA 5KPTA 3IAYA 4CJRA 5KQDA 2OCEA
chains in the Genus database with same CATH topology
4GMJB 4CESA 4K8ZA 1Y97A 3T3FA 1BHLA 3L2RA 4Q0BA 3G0ZA 1KVBA 1S1UA 4NCAA 3OYKA 4B8CA 3IG1A 2LSNA 2E6MA 4CEFA 5FDLA 5J2QA 3QETA 3PO4A 1WSIA 4Z0UA 1IKVA 1RTJA 2P1JA 3OYMA 4DSKA 4DTXA 2NUBA 3A2FA 5FRMA 1BI4B 3LDSA 3LP3A 4CGJA 1NJZA 3P1GA 3P83D 1RDDA 3DLRA 3VQEA 1RDBA 3RMBA 3L3VA 1RT5A 4DSIA 3AA3A 3VQBA 3ASMA 3LAMA 4F3TA 4PA1A 1LV5A 2PZSA 3CYMA 1J53A 3OVNA 1N5YA 5KRTA 3K5OA 1KLMA 1K6YA 1KFSA 4B9MA 1B9FA 5KRSA 1A5WA 1JLEA 2ZE2A 1JL1A 4I9LA 1IG9A 4IDKA 4F2SA 1QQCA 1RTHA 5J2NA 1BGXT 5HRRA 4FJ8A 4QOZB 1RT3A 3KKSA 4O0JA 4DQRA 3RR7A 2JLEA 3O4QA 2HHUA 4E7HA 3QNOA 4W5RA 1XI1A 3NGIA 1I3AA 3VQ8A 4FJNA 4W5TA 4ELUA 1S5JA 1DTQA 1BQNA 1RNHA 3LALA 4QAGA 2FBYA 3AVJA 4BWJA 3VQ9A 4BDYA 1CXUA 4CCHA 1I39A 2RPIA 2E6LA 3HVTA 1SKWA 4I7FA 5J2MA 3HSTB 5C25A 4CEOA 3NH2A 3TAPA 3OYEA 4M3RA 3S3OA 1VSDA 1U04A 3V6DA 1R0AA 4FK2A 1D8YA 5K14A 1WSFA 4CFBA 1YTUA 2AJQA 1BI4A 4C8NA 1S1VA 3QEXA 4AHCA 4DU1A 4B9UA 3TAMA 1YVUA 3MAQA 1NKEA 1Q9XA 1RBRA 3DM2A 3SUOA 4IG0A 4O0IA 1RTDA 1S1WA 4CEDA 1NOZA 1UA0A 4AHSA 4HTUA 4F2RA 4IKFA 2RN2A 1ITGA 3NE6A 4DFKA 2DFHA 4EZ9A 3EY1A 1KVAA 3B6OA 3IS9A 4E7JA 2I5JA 4CGHA 1FK9A 2KFNA 3PX0A 1NOYA 1XHXA 2IS3A 3VQ5A 3LANA 4KHWA 1RBVA 3V9ZA 4KV8A 3S3NA 1L3TA 3PV8A 4C8OA 1NKCA 2Z1HA 2O4IA 4AHUA 1U4BA 4ICLA 4N41A 3HM9A 4DQSA 3SQ1A 2G8UA 3U6FA 1HRHA 4E3SA 1L3UA 4IFYA 3PO5A 1RDCA 1A5VA 4FJXA 3IRXA 1GOAA 2ITGA 4OPJA 4OKEA 2VWJA 3V9WA 2VWKA 1ZBLA 1NJYA 3KLFA 3LZIA 3MEEA 1UWBA 4CJUA 1TKDA 2KZMA 4M42A 4LH5A 4Y1DA 3HO1A 1HNIA 3NF7A 4GVMA 4FLZA 2QKBA 2X6SA 4DQPA 4C8MA 3WNEA 4CHOA 4BE1A 4DTRA 3THVA 3ULDA 1SKSA 4DSJA 4F4KA 4J2BA 1WSJA 3TAFA 1ZBFA 4DFPA 4CF8A 1X9MA 3ALYA 3OS2A 4Q5VA 3AA5X 1LWFA 1S1XA 3AO5A 4DLGA 3TAQA 1IKYA 3L8BA 1U48A 3HP9A 1S6PA 1KVCA 3SQ2A 2IOCA 4F8RA 1ASWA 4FJIA 4Z4CA 3HXMA 3V1QA 4Z4FA 5CYQA 4B9SA 4DLEA 3RMDA 1TKZA 3NBPA 3SPZA 3D0PA 5KTQA 2HHQA 1YT3A 1HMVA 2F96A 3K59A 4XIUA 3SQ4A 1N6QA 3HJFA 5SWMA 1RT1A 1RT2A 3VQ4A 3OJUA 3B6PA 3VQQA 5DK5A 2IGIA 1SKRA 3NDKA 3M8QA 4DTPA 4FJGA 3HPOA 1LW0A 3L2WA 4KHQA 4UQGA 3NH1A 3M8RA 1VRUA 4IBNA 3CG7A 5HBMA 4FYDA 4EP4A 4E19A 1RBTA 5T7BA 1JLFA 3DLBA 4FJ5A 4KHYA 4FJJA 3LP2A 1C1CA 1VRTA 3KK1A 4BE2A 2G8KA 3AVCA 1ZBUA 3CFOA 2YHBA 1UOCA 1XHZA 1IH7A 3VQ6A 3NGYA 4E1MA 3LZJA 4N56A 3KKRA 3CQ8A 5CZ2A 2HHXA 1HJRA 2X74A 3OJSA 1S9GA 1C0MA 2D0CA 3ZSVA 3F9KA 4B08A 3PY8A 3V9SA 1O1WA 3SUPA 4CJ3A 4FM2A 1RT4A 1NJWA 4B9NA 1S6QA 3LPUA 4DF8A 1NK9A 3VA0A 1MU2A 4DU4A 4KRFA 4FLXA 4FVMA 4CGGA 3L2QA 4YFUA 3SYZA 3VA3A 4Z4GA 3V81A 4RW9A 3L2UA 2XY5A 2Q3SA 3OYAA 4HUGA 1U49A 2IC3A 3OYNA 2FBVA 4RG8A 3V4IA 3DLHA 4DWIA 1JKHA 1QE1A 2G8VA 4CERA 2BDPA 1TKTA 4ZHRA 1QHTA 2B6AA 4OGEA 4KO0A 4RW4A 5KGXA 4CK3A 3CFPA 3SNNA 1L3SA 2G8WA 4DQIA 4CEQA 2ATQA 4KREA 4AHVA 4DF4A 2RF2A 4M3YA 1TAUA 4J2DA 1J5OA 4Z4EA 3KIOA 3MEDA 3KLHA 5C42A 1Z25A 2X78A 4CJ5A 1NJXA 2XHBA 2YHAA 2RKIA 4ZTFA 3QEWA 3QLHA 1WNSA 5E41A 3TABA 4KB0A 3KLGA 4I2QA 1VSKA 4JRQA 1SL2A 4KHUA 3DLEA 4H8KA 3AVGA 1VSHA 3FFIA 4CFDA 3TWHA 2P5GA 5JS1A 1HNVA 3CM6A 3L2VA 1TK8A 2HHVA 5KGWA 4B8AB 5SZTA 1D9DA 2Z1JA 2G8IA 3K2PA 4CF0A 3I8DA 4PQUA 1NKBA 1BISA 1JLQA 1JXEA 5KI6A 4CGFA 3SV4A 3TAEA 4KB1A 3BGRA 1S1TA 3NFAA 2HHSA 2HNDA 3F73A 1ZBHA 1B9DA 2ETJA 1FXXA 4CK2A 3VQPA 2QKKA 3QERA 3AVAA 3LP1A 4JS4A 4KTQA 4M3ZA 3ZSWA 3SV3A 1EKEA 4CIFA 2IAJA 2JGUA 4Z4HA 2GV9A 1QS4A 2O4GA 4CK1A 1JL2A 3AO2A 3NCIA 4E0DA 1UAXA 5J2PA 2Z1GA 3NGZA 3M8SA 2B4JA 3O3GA 2DY4A 1LAVA 4O4GA 3LWMA 4B9LA 4DSLA 3RTVA 1C1BA 3CM5A 4DTUA 2DFFA 4FM0A 1J9AA 3P5JA 3QINA 3RRHA 3QESA 4N76A 4KI4A 1IO2A 4HUFA 3QEIA 4KTZA 3QIPA 2HNYA 1C0TA 1Q8IA 4HHTA 5CY4A 1TL1A 4M3TA 4Z4IA 4AHRA 2KW4A 2YNHA 1TGOA 4E7LA 3K5LA 3HL8A 1VK0A 1LWCA 2HHTA 1BIZA 3SPYA 2YNFA 4O5BA 1KRPA 4ELTA 3JSMA 4QCLA 2KZZA 2FC0A 1LAWA 4CJEA 3V1RA 4CJQA 4BACA 3BDPA 2W42A 1LWEA 3ZT3A 4CGIA 4N5SA 3ZCMA 4CJSA 1BQMA 4H4OA 3ZT2A 1SV5A 3MXIA 1SL1A 3SUQA 2BANA 1D9FA 3ZSRA 1VSIA 4DTSA 1T7PA 4LSNA 3VQAA 4L8RB 2XY8A 3OYDA 3M8PA 2VG5A 4E7KA 3TANA 1ASVA 2G8HA 4FXDA 4OLAA 1FKPA 1ASUA 3ZSZA 4FW2A 4BE0A 4ID5A 3TARA 3AO1A 3K5MA 1WAFA 3ITHA 3NHGA 2D0AA 4CJPA 5CYMA 1TK5A 3OS0A 1L5UA 3AO3A 4G1QA 4PWDA 2KFZA 3OYHA 3S9HA 3UIQA 5DMRA 1TV6A 2HNZA 1G15A 4WE1A 4J2AA 2HVIA 3O4NA 4HCBA 3AA4A 5HP1A 1QSSA 4CHNA 2BGGA 4B9TA 4PY5A 1WAJA 3ZT1A 1X1PA 4CEAA 1X9SA 1KSPA 1C1AA 3WNHA 4AH9A 3OYJA 4KHSA 4O55A 1BCMA 1U47A 2BE2A 4NCGA 1HYSA 1XC9A 4ZTJA 3AVBA 4CF2A 3V9UA 3V1OA 2P5OA 1IKWA 5EU7A 2OPPA 1EX4A 4JRPA 4FJHA 1HQEA 4IG3A 4MFBA 4CJKA 3KJVA 2PYJA 4FLWA 2IDOA 3HK2A 1CLQA 2QXFA 1RBSA 4CIGA 3SQ0A 4JLHA 3OS1A 4ELVA 2OPRA 2P51A 3JYTA 1TVRA 4CJWA 4CIEA 4FCYA 3QIOA 3VQ7A 4B3OA 1WN7A 3E01A 5I3UA 3T1AA 2XRIA 3MEGA 3HYFA 1QSLA 4CJLA 3TAGA 1TAQA 3KK3A 3DMJA 3EZ5A 3DLGA 4KPYA 4CHYA 2ZD1A 3C6UA 3WNGA 4C8LA 2HVHA 3DOLA 3DRPA 3SZ2A 4DU3A 1JLGA 4W5QA 3KLEA 4KFBA 4FZXC 1VSEA 1W0HA 2HHWA 4DTOA 1JLBA 3I0SA 2OPQA 3ZSYA 1REVA 3AVLA 1NK0A 4M3WA 3SUNA 3VQCA 3L3UA 3SI6A 4FJKA 3ZT4A 4FJ7A 4HUEA 2Y1IA 4M3XA 4LSLA 4EZ6A 2F8TA 1TL3A 5HRSA 1JLCA 1NK7A 2DTUA 3NF8A 4HCCA 3C95A 1W9HA 3VN5A 3OYGA 3PUFA 2YV0X 4I9QA 3H08A 3CFRA 4BDZA 1T8EA 3OY9A 1T05A 1ZBIA 1KTQA 3HPHA 4DFMA 4BDPA 2Z1IA 4FJ9A 1IKXA 4OPKA 3HP6A 3KD5E 4FLUA 1C6VA 2YNIA 3VQDA 4NCBA 1RT6A 5CZ1A 3OYBA 3OYFA 5FRNA 3G10A 2WONA 1KCFA 4CHPA 1NK6A 1GOCA 2YKMA 3AVNA 1WSEA 1C0UA 2ZQBA 4K8XA 4FJMA 3LWLA 2OPSA 4FZZA 3QO9A 3ZSQA 1D5AA 1TKXA 4C8KA 4CGDA 1VSMA 5C24A 3AVKA 4KHNA 4LY7A 1BIUA 4BWMA 4CHZA 4CJFA 4N47A 1B92A 1CXQA 4TSXA 1U45A 3KD1E 3AVHA 3DRRA 2GUIA 1BL3A 3S3MA 3C6TA 1WSGA 1NK5A 1RT7A 5HROA 2D0BA 1T03A 1S9EA 4OKJA 2D5RA 3HVRA 1RCHA 4OLBA 3OYLA 2OYQA 4W5NA 5HLFA 3HPGA 1HYVA 2B5JA 3K57A 3ZSOA 4CFAA 1XWLA 1YTAA 3PX4A 4GW6A 3AVMA 5J1EA 3K5NA 4F3OA 2X6NA 1Z26A 1L3VA 4RW8A 3ZT0A 4B9VA 4FK4A 1VSLA 1WLJA 3LAKA 1RBUA 1SL0A 2YNGA 3NF6A 4LD0A 5JS2A 1HYZA 4CE9A 2E4LA 3U3GA 4ID1A 2XY7A 3SCXA 1KFDA 4DSFA 2Y1JA 4CF1A 1NK4A 2OZSA 1EXQA 4M41A 3K58A 4E7IA 3I0RA 4O44A 4CF9A 5I42A 4M3UA 3AVFA 1UA1A 2EHGA 2G8FA 4EP5A 2PYLA 1EP4A 3QNNA 1LW2A 1SUQA 1F21A 3ZSXA 5HRPA 4CJ4A 4RW6A 4FM1A 2OZMA 3LP0A 1HPZA 3DI6A 3C94A 2PY5A 4W5OA 2VG6A 1A5XA 3MECA 4OGCA 4NYNA 4DTNA 1DTTA 4KI6A 1RTIA 3AA2A 4CFCA 5HRNA 3RMCA 4DTMA 3T19A 3MXMA 4CJTA 4IFVA 1ZYQA 3O3HA 4R5PA 1KLNA 2R7YA 3QEPA 1CZ9A 2F8SA 3DYAA 3NH0A 2DFEA 4CEZA 4E1NA 1DLOA 3KTQA 4PUOA 4LH4A 4DS4A 4HVJA 4DG1A 3O3FA 2WOMA 3SJJA 3TI0A 1X9WA 1J54A 4CEEA 4FLYA 2XY6A 3TR8A 4AILC 4NYFA 2OA8A 4DQQA 2A1SA 4CHQA 4DFJA 3RWUA 1JXBA 3U3YA 5D3GA 3RR8A 4DTJA 3ISNC 4YNQA 3DLKA 4FZYA 3PX6A 4E89A 4FW1A 3EYZA 4KTWA 4I2PA 4RW7A 3WNFA 3D45A 2FBXA 4CEBA 3AVIA 4M45A 4DS5A 2GBZA 3V9XA 4AHTA 3DRSA 1HQUA 3MXJA 2XO7A 4DMNA 4Y1CA 4CECA 4FJLA 2KTQA 1TK0A 2HW3A 2FBTA 1WSHA 1FKOA 3HT3A 1BCOA 3KLIA 1CZBA 4JS5A 3QEVA 3RMAA 2HMIA 2QK9A 3AO4A 4OJRA 4FK0A 1VSFA 2KQ2A 3NF9A 1GOBA 1RILA 3NAEA 3RRGA 4DSEA 4FLVA 1QTMA 1EETA 3AV9A 4CJVA 4OVLA 5FROA 3OYCA 1NK8A 4H4MA 1QSYA 1RDAA 3DOKA 3OYIA 4OKKA 2EX3A 3IAYA 4MQ3A 2VG7A 4J2EA 2HB5A 4CJRA 4FLTA 1Q9YA 4KAZA 1JLAA 3LPTA 4KKOA 1VSJA 2A1RA 2YKNA 3KK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMJ B;  4CES A;  4K8Z A;  1Y97 A;  3T3F A;  1BHL A;  3L2R A;  4Q0B A;  3G0Z A;  1KVB A;  1S1U A;  4NCA A;  3OYK A;  4B8C A;  3IG1 A;  2LSN A;  2E6M A;  4CEF A;  5FDL A;  5J2Q A;  3QET A;  3PO4 A;  1WSI A;  4Z0U A;  1IKV A;  1RTJ A;  2P1J A;  3OYM A;  4DSK A;  4DTX A;  2NUB A;  3A2F A;  5FRM A;  1BI4 B;  3LDS A;  3LP3 A;  4CGJ A;  1NJZ A;  3P1G A;  3P83 D;  1RDD A;  3DLR A;  3VQE A;  1RDB A;  3RMB A;  3L3V A;  1RT5 A;  4DSI A;  3AA3 A;  3VQB A;  3ASM A;  3LAM A;  4F3T A;  4PA1 A;  1LV5 A;  2PZS A;  3CYM A;  1J53 A;  3OVN A;  1N5Y A;  5KRT A;  3K5O A;  1KLM A;  1K6Y A;  1KFS A;  4B9M A;  1B9F A;  5KRS A;  1A5W A;  1JLE A;  2ZE2 A;  1JL1 A;  4I9L A;  1IG9 A;  4IDK A;  4F2S A;  1QQC A;  1RTH A;  5J2N A;  1BGX T;  5HRR A;  4FJ8 A;  4QOZ B;  1RT3 A;  3KKS A;  4O0J A;  4DQR A;  3RR7 A;  2JLE A;  3O4Q A;  2HHU A;  4E7H A;  3QNO A;  4W5R A;  1XI1 A;  3NGI A;  1I3A A;  3VQ8 A;  4FJN A;  4W5T A;  4ELU A;  1S5J A;  1DTQ A;  1BQN A;  1RNH A;  3LAL A;  4QAG A;  2FBY A;  3AVJ A;  4BWJ A;  3VQ9 A;  4BDY A;  1CXU A;  4CCH A;  1I39 A;  2RPI A;  2E6L A;  3HVT A;  1SKW A;  4I7F A;  5J2M A;  3HST B;  5C25 A;  4CEO A;  3NH2 A;  3TAP A;  3OYE A;  4M3R A;  3S3O A;  1VSD A;  1U04 A;  3V6D A;  1R0A A;  4FK2 A;  1D8Y A;  5K14 A;  1WSF A;  4CFB A;  1YTU A;  2AJQ A;  1BI4 A;  4C8N A;  1S1V A;  3QEX A;  4AHC A;  4DU1 A;  4B9U A;  3TAM A;  1YVU A;  3MAQ A;  1NKE A;  1Q9X A;  1RBR A;  3DM2 A;  3SUO A;  4IG0 A;  4O0I A;  1RTD A;  1S1W A;  4CED A;  1NOZ A;  1UA0 A;  4AHS A;  4HTU A;  4F2R A;  4IKF A;  2RN2 A;  1ITG A;  3NE6 A;  4DFK A;  2DFH A;  4EZ9 A;  3EY1 A;  1KVA A;  3B6O A;  3IS9 A;  4E7J A;  2I5J A;  4CGH A;  1FK9 A;  2KFN A;  3PX0 A;  1NOY A;  1XHX A;  2IS3 A;  3VQ5 A;  3LAN A;  4KHW A;  1RBV A;  3V9Z A;  4KV8 A;  3S3N A;  1L3T A;  3PV8 A;  4C8O A;  1NKC A;  2Z1H A;  2O4I A;  4AHU A;  1U4B A;  4ICL A;  4N41 A;  3HM9 A;  4DQS A;  3SQ1 A;  2G8U A;  3U6F A;  1HRH A;  4E3S A;  1L3U A;  4IFY A;  3PO5 A;  1RDC A;  1A5V A;  4FJX A;  3IRX A;  1GOA A;  2ITG A;  4OPJ A;  4OKE A;  2VWJ A;  3V9W A;  2VWK A;  1ZBL A;  1NJY A;  3KLF A;  3LZI A;  3MEE A;  1UWB A;  4CJU A;  1TKD A;  2KZM A;  4M42 A;  4LH5 A;  4Y1D A;  3HO1 A;  1HNI A;  3NF7 A;  4GVM A;  4FLZ A;  2QKB A;  2X6S A;  4DQP A;  4C8M A;  3WNE A;  4CHO A;  4BE1 A;  4DTR A;  3THV A;  3ULD A;  1SKS A;  4DSJ A;  4F4K A;  4J2B A;  1WSJ A;  3TAF A;  1ZBF A;  4DFP A;  4CF8 A;  1X9M A;  3ALY A;  3OS2 A;  4Q5V A;  3AA5 X;  1LWF A;  1S1X A;  3AO5 A;  4DLG A;  3TAQ A;  1IKY A;  3L8B A;  1U48 A;  3HP9 A;  1S6P A;  1KVC A;  3SQ2 A;  2IOC A;  4F8R A;  1ASW A;  4FJI A;  4Z4C A;  3HXM A;  3V1Q A;  4Z4F A;  5CYQ A;  4B9S A;  4DLE A;  3RMD A;  1TKZ A;  3NBP A;  3SPZ A;  3D0P A;  5KTQ A;  2HHQ A;  1YT3 A;  1HMV A;  2F96 A;  3K59 A;  4XIU A;  3SQ4 A;  1N6Q A;  3HJF A;  5SWM A;  1RT1 A;  1RT2 A;  3VQ4 A;  3OJU A;  3B6P A;  3VQQ A;  5DK5 A;  2IGI A;  1SKR A;  3NDK A;  3M8Q A;  4DTP A;  4FJG A;  3HPO A;  1LW0 A;  3L2W A;  4KHQ A;  4UQG A;  3NH1 A;  3M8R A;  1VRU A;  4IBN A;  3CG7 A;  5HBM A;  4FYD A;  4EP4 A;  4E19 A;  1RBT A;  5T7B A;  1JLF A;  3DLB A;  4FJ5 A;  4KHY A;  4FJJ A;  3LP2 A;  1C1C A;  1VRT A;  3KK1 A;  4BE2 A;  2G8K A;  3AVC A;  1ZBU A;  3CFO A;  2YHB A;  1UOC A;  1XHZ A;  1IH7 A;  3VQ6 A;  3NGY A;  4E1M A;  3LZJ A;  4N56 A;  3KKR A;  3CQ8 A;  5CZ2 A;  2HHX A;  1HJR A;  2X74 A;  3OJS A;  1S9G A;  1C0M A;  2D0C A;  3ZSV A;  3F9K A;  4B08 A;  3PY8 A;  3V9S A;  1O1W A;  3SUP A;  4CJ3 A;  4FM2 A;  1RT4 A;  1NJW A;  4B9N A;  1S6Q A;  3LPU A;  4DF8 A;  1NK9 A;  3VA0 A;  1MU2 A;  4DU4 A;  4KRF A;  4FLX A;  4FVM A;  4CGG A;  3L2Q A;  4YFU A;  3SYZ A;  3VA3 A;  4Z4G A;  3V81 A;  4RW9 A;  3L2U A;  2XY5 A;  2Q3S A;  3OYA A;  4HUG A;  1U49 A;  2IC3 A;  3OYN A;  2FBV A;  4RG8 A;  3V4I A;  3DLH A;  4DWI A;  1JKH A;  1QE1 A;  2G8V A;  4CER A;  2BDP A;  1TKT A;  4ZHR A;  1QHT A;  2B6A A;  4OGE A;  4KO0 A;  4RW4 A;  5KGX A;  4CK3 A;  3CFP A;  3SNN A;  1L3S A;  2G8W A;  4DQI A;  4CEQ A;  2ATQ A;  4KRE A;  4AHV A;  4DF4 A;  2RF2 A;  4M3Y A;  1TAU A;  4J2D A;  1J5O A;  4Z4E A;  3KIO A;  3MED A;  3KLH A;  5C42 A;  1Z25 A;  2X78 A;  4CJ5 A;  1NJX A;  2XHB A;  2YHA A;  2RKI A;  4ZTF A;  3QEW A;  3QLH A;  1WNS A;  5E41 A;  3TAB A;  4KB0 A;  3KLG A;  4I2Q A;  1VSK A;  4JRQ A;  1SL2 A;  4KHU A;  3DLE A;  4H8K A;  3AVG A;  1VSH A;  3FFI A;  4CFD A;  3TWH A;  2P5G A;  5JS1 A;  1HNV A;  3CM6 A;  3L2V A;  1TK8 A;  2HHV A;  5KGW A;  4B8A B;  5SZT A;  1D9D A;  2Z1J A;  2G8I A;  3K2P A;  4CF0 A;  3I8D A;  4PQU A;  1NKB A;  1BIS A;  1JLQ A;  1JXE A;  5KI6 A;  4CGF A;  3SV4 A;  3TAE A;  4KB1 A;  3BGR A;  1S1T A;  3NFA A;  2HHS A;  2HND A;  3F73 A;  1ZBH A;  1B9D A;  2ETJ A;  1FXX A;  4CK2 A;  3VQP A;  2QKK A;  3QER A;  3AVA A;  3LP1 A;  4JS4 A;  4KTQ A;  4M3Z A;  3ZSW A;  3SV3 A;  1EKE A;  4CIF A;  2IAJ A;  2JGU A;  4Z4H A;  2GV9 A;  1QS4 A;  2O4G A;  4CK1 A;  1JL2 A;  3AO2 A;  3NCI A;  4E0D A;  1UAX A;  5J2P A;  2Z1G A;  3NGZ A;  3M8S A;  2B4J A;  3O3G A;  2DY4 A;  1LAV A;  4O4G A;  3LWM A;  4B9L A;  4DSL A;  3RTV A;  1C1B A;  3CM5 A;  4DTU A;  2DFF A;  4FM0 A;  1J9A A;  3P5J A;  3QIN A;  3RRH A;  3QES A;  4N76 A;  4KI4 A;  1IO2 A;  4HUF A;  3QEI A;  4KTZ A;  3QIP A;  2HNY A;  1C0T A;  1Q8I A;  4HHT A;  5CY4 A;  1TL1 A;  4M3T A;  4Z4I A;  4AHR A;  2KW4 A;  2YNH A;  1TGO A;  4E7L A;  3K5L A;  3HL8 A;  1VK0 A;  1LWC A;  2HHT A;  1BIZ A;  3SPY A;  2YNF A;  4O5B A;  1KRP A;  4ELT A;  3JSM A;  4QCL A;  2KZZ A;  2FC0 A;  1LAW A;  4CJE A;  3V1R A;  4CJQ A;  4BAC A;  3BDP A;  2W42 A;  1LWE A;  3ZT3 A;  4CGI A;  4N5S A;  3ZCM A;  4CJS A;  1BQM A;  4H4O A;  3ZT2 A;  1SV5 A;  3MXI A;  1SL1 A;  3SUQ A;  2BAN A;  1D9F A;  3ZSR A;  1VSI A;  4DTS A;  1T7P A;  4LSN A;  3VQA A;  4L8R B;  2XY8 A;  3OYD A;  3M8P A;  2VG5 A;  4E7K A;  3TAN A;  1ASV A;  2G8H A;  4FXD A;  4OLA A;  1FKP A;  1ASU A;  3ZSZ A;  4FW2 A;  4BE0 A;  4ID5 A;  3TAR A;  3AO1 A;  3K5M A;  1WAF A;  3ITH A;  3NHG A;  2D0A A;  4CJP A;  5CYM A;  1TK5 A;  3OS0 A;  1L5U A;  3AO3 A;  4G1Q A;  4PWD A;  2KFZ A;  3OYH A;  3S9H A;  3UIQ A;  5DMR A;  1TV6 A;  2HNZ A;  1G15 A;  4WE1 A;  4J2A A;  2HVI A;  3O4N A;  4HCB A;  3AA4 A;  5HP1 A;  1QSS A;  4CHN A;  2BGG A;  4B9T A;  4PY5 A;  1WAJ A;  3ZT1 A;  1X1P A;  4CEA A;  1X9S A;  1KSP A;  1C1A A;  3WNH A;  4AH9 A;  3OYJ A;  4KHS A;  4O55 A;  1BCM A;  1U47 A;  2BE2 A;  4NCG A;  1HYS A;  1XC9 A;  4ZTJ A;  3AVB A;  4CF2 A;  3V9U A;  3V1O A;  2P5O A;  1IKW A;  5EU7 A;  2OPP A;  1EX4 A;  4JRP A;  4FJH A;  1HQE A;  4IG3 A;  4MFB A;  4CJK A;  3KJV A;  2PYJ A;  4FLW A;  2IDO A;  3HK2 A;  1CLQ A;  2QXF A;  1RBS A;  4CIG A;  3SQ0 A;  4JLH A;  3OS1 A;  4ELV A;  2OPR A;  2P51 A;  3JYT A;  1TVR A;  4CJW A;  4CIE A;  4FCY A;  3QIO A;  3VQ7 A;  4B3O A;  1WN7 A;  3E01 A;  5I3U A;  3T1A A;  2XRI A;  3MEG A;  3HYF A;  1QSL A;  4CJL A;  3TAG A;  1TAQ A;  3KK3 A;  3DMJ A;  3EZ5 A;  3DLG A;  4KPY A;  4CHY A;  2ZD1 A;  3C6U A;  3WNG A;  4C8L A;  2HVH A;  3DOL A;  3DRP A;  3SZ2 A;  4DU3 A;  1JLG A;  4W5Q A;  3KLE A;  4KFB A;  4FZX C;  1VSE A;  1W0H A;  2HHW A;  4DTO A;  1JLB A;  3I0S A;  2OPQ A;  3ZSY A;  1REV A;  3AVL A;  1NK0 A;  4M3W A;  3SUN A;  3VQC A;  3L3U A;  3SI6 A;  4FJK A;  3ZT4 A;  4FJ7 A;  4HUE A;  2Y1I A;  4M3X A;  4LSL A;  4EZ6 A;  2F8T A;  1TL3 A;  5HRS A;  1JLC A;  1NK7 A;  2DTU A;  3NF8 A;  4HCC A;  3C95 A;  1W9H A;  3VN5 A;  3OYG A;  3PUF A;  2YV0 X;  4I9Q A;  3H08 A;  3CFR A;  4BDZ A;  1T8E A;  3OY9 A;  1T05 A;  1ZBI A;  1KTQ A;  3HPH A;  4DFM A;  4BDP A;  2Z1I A;  4FJ9 A;  1IKX A;  4OPK A;  3HP6 A;  3KD5 E;  4FLU A;  1C6V A;  2YNI A;  3VQD A;  4NCB A;  1RT6 A;  5CZ1 A;  3OYB A;  3OYF A;  5FRN A;  3G10 A;  2WON A;  1KCF A;  4CHP A;  1NK6 A;  1GOC A;  2YKM A;  3AVN A;  1WSE A;  1C0U A;  2ZQB A;  4K8X A;  4FJM A;  3LWL A;  2OPS A;  4FZZ A;  3QO9 A;  3ZSQ A;  1D5A A;  1TKX A;  4C8K A;  4CGD A;  1VSM A;  5C24 A;  3AVK A;  4KHN A;  4LY7 A;  1BIU A;  4BWM A;  4CHZ A;  4CJF A;  4N47 A;  1B92 A;  1CXQ A;  4TSX A;  1U45 A;  3KD1 E;  3AVH A;  3DRR A;  2GUI A;  1BL3 A;  3S3M A;  3C6T A;  1WSG A;  1NK5 A;  1RT7 A;  5HRO A;  2D0B A;  1T03 A;  1S9E A;  4OKJ A;  2D5R A;  3HVR A;  1RCH A;  4OLB A;  3OYL A;  2OYQ A;  4W5N A;  5HLF A;  3HPG A;  1HYV A;  2B5J A;  3K57 A;  3ZSO A;  4CFA A;  1XWL A;  1YTA A;  3PX4 A;  4GW6 A;  3AVM A;  5J1E A;  3K5N A;  4F3O A;  2X6N A;  1Z26 A;  1L3V A;  4RW8 A;  3ZT0 A;  4B9V A;  4FK4 A;  1VSL A;  1WLJ A;  3LAK A;  1RBU A;  1SL0 A;  2YNG A;  3NF6 A;  4LD0 A;  5JS2 A;  1HYZ A;  4CE9 A;  2E4L A;  3U3G A;  4ID1 A;  2XY7 A;  3SCX A;  1KFD A;  4DSF A;  2Y1J A;  4CF1 A;  1NK4 A;  2OZS A;  1EXQ A;  4M41 A;  3K58 A;  4E7I A;  3I0R A;  4O44 A;  4CF9 A;  5I42 A;  4M3U A;  3AVF A;  1UA1 A;  2EHG A;  2G8F A;  4EP5 A;  2PYL A;  1EP4 A;  3QNN A;  1LW2 A;  1SUQ A;  1F21 A;  3ZSX A;  5HRP A;  4CJ4 A;  4RW6 A;  4FM1 A;  2OZM A;  3LP0 A;  1HPZ A;  3DI6 A;  3C94 A;  2PY5 A;  4W5O A;  2VG6 A;  1A5X A;  3MEC A;  4OGC A;  4NYN A;  4DTN A;  1DTT A;  4KI6 A;  1RTI A;  3AA2 A;  4CFC A;  5HRN A;  3RMC A;  4DTM A;  3T19 A;  3MXM A;  4CJT A;  4IFV A;  1ZYQ A;  3O3H A;  4R5P A;  1KLN A;  2R7Y A;  3QEP A;  1CZ9 A;  2F8S A;  3DYA A;  3NH0 A;  2DFE A;  4CEZ A;  4E1N A;  1DLO A;  3KTQ A;  4PUO A;  4LH4 A;  4DS4 A;  4HVJ A;  4DG1 A;  3O3F A;  2WOM A;  3SJJ A;  3TI0 A;  1X9W A;  1J54 A;  4CEE A;  4FLY A;  2XY6 A;  3TR8 A;  4AIL C;  4NYF A;  2OA8 A;  4DQQ A;  2A1S A;  4CHQ A;  4DFJ A;  3RWU A;  1JXB A;  3U3Y A;  5D3G A;  3RR8 A;  4DTJ A;  3ISN C;  4YNQ A;  3DLK A;  4FZY A;  3PX6 A;  4E89 A;  4FW1 A;  3EYZ A;  4KTW A;  4I2P A;  4RW7 A;  3WNF A;  3D45 A;  2FBX A;  4CEB A;  3AVI A;  4M45 A;  4DS5 A;  2GBZ A;  3V9X A;  4AHT A;  3DRS A;  1HQU A;  3MXJ A;  2XO7 A;  4DMN A;  4Y1C A;  4CEC A;  4FJL A;  2KTQ A;  1TK0 A;  2HW3 A;  2FBT A;  1WSH A;  1FKO A;  3HT3 A;  1BCO A;  3KLI A;  1CZB A;  4JS5 A;  3QEV A;  3RMA A;  2HMI A;  2QK9 A;  3AO4 A;  4OJR A;  4FK0 A;  1VSF A;  2KQ2 A;  3NF9 A;  1GOB A;  1RIL A;  3NAE A;  3RRG A;  4DSE A;  4FLV A;  1QTM A;  1EET A;  3AV9 A;  4CJV A;  4OVL A;  5FRO A;  3OYC A;  1NK8 A;  4H4M A;  1QSY A;  1RDA A;  3DOK A;  3OYI A;  4OKK A;  2EX3 A;  3IAY A;  4MQ3 A;  2VG7 A;  4J2E A;  2HB5 A;  4CJR A;  4FLT A;  1Q9Y A;  4KAZ A;  1JLA A;  3LPT A;  4KKO A;  1VSJ A;  2A1R A;  2YKN A;  3KK2 A; 
#chains in the Genus database with same CATH topology
 4CES A;  5JLF A;  1BHL A;  3G0Z A;  3BUZ B;  5HL7 L;  2E88 A;  4B8C A;  3IG1 A;  1VHX A;  2E6M A;  4CEF A;  5J2Q A;  3HI0 A;  1WSI A;  2IVO A;  4DSK A;  5FRM A;  3LP3 A;  4CGJ A;  3UKU B;  3P83 D;  4BC4 A;  1RDD A;  3KWI A;  5AQR A;  4YOY A;  1QZ6 A;  3IKM A;  3CQX A;  4PA1 A;  2EWS A;  1LV5 A;  2QWO A;  3CYM A;  2PZS A;  4BC3 A;  1N5Y A;  1KLM A;  5KRS A;  4F2S A;  1QQC A;  1RTH A;  2YI1 A;  5HRR A;  3RR7 A;  4DQR A;  3MN6 A;  4IOX A;  4W5R A;  4IXC A;  5AZJ A;  4FJN A;  1KD1 O;  4CCH A;  3LAL A;  3VQ9 A;  1CXU A;  2RPI A;  3UKR B;  1XMO K;  5J2M A;  5CR4 A;  3J81 O;  3NH2 A;  3OYE A;  3V6D A;  4I6M A;  4NXM K;  3LDL A;  1WSF A;  4CFB A;  3VMF B;  5B8H A;  4DR4 K;  1I94 K;  3TAM A;  1Q9X A;  1V4S A;  3DM2 A;  1ZBS A;  3SUO A;  5CHI A;  4IG0 A;  4CVN E;  4AHS A;  3K9J A;  1ITG A;  2A6A A;  4A62 A;  3WXL A;  4E7J A;  3B6O A;  5M1F A;  2I5J A;  4CGH A;  2HMP A;  3PX0 A;  1KAY A;  1XHX A;  3VQ5 A;  4EAH D;  4ISG A;  1RBV A;  3PV8 A;  3VF4 A;  4C8O A;  4AHU A;  1U4B A;  4DQS A;  1MA9 B;  3PLA A;  1HRH A;  2HBK A;  4E3S A;  1L3U A;  4IO9 L;  1GOA A;  4OKE A;  2VWJ A;  2VWK A;  3DXK B;  3MEE A;  3GDQ A;  5LJV A;  4JI7 K;  4FLZ A;  1QVF M;  2QKB A;  4DQP A;  4JKG A;  4BE1 A;  1SKS A;  1DEJ A;  2FXU A;  2O8E A;  1WSJ A;  3TAF A;  3LDN A;  1Q86 O;  1S1X A;  4DLG A;  3L8B A;  4F8R A;  2IOC A;  3CF5 L;  3E9O A;  2NLX A;  4FVU A;  4LC9 B;  4B9S A;  3CC4 N;  1TKZ A;  3D0P A;  5KTQ A;  2HHQ A;  1HMV A;  3SQ4 A;  3HJF A;  2QWL A;  1RT1 A;  3M5R A;  5TKY A;  3B6P A;  3VQQ A;  3FLC O;  2P9N A;  4OO1 J;  3VEX A;  4DTP A;  4KHQ A;  3KK7 A;  4UQG A;  1DGK N;  3M8R A;  3EE8 A;  4GKJ K;  4PHT X;  3QBX A;  4EP4 A;  1M90 O;  2NRT A;  1G99 A;  3PSI A;  1VRT A;  2G8K A;  4ISF A;  3H6E A;  4E1M A;  1KQS M;  1HJR A;  4B1Z A;  1S9G A;  3ID8 A;  4B08 A;  1D4X A;  2I7N A;  3V9S A;  2E2O A;  4CJ3 A;  4FM2 A;  1RT4 A;  4CBX A;  2QW9 A;  5BPL A;  4B9N A;  2QWR A;  3LPU A;  1NK9 A;  1MU2 A;  4DU4 A;  4CGG A;  4H0P A;  4Z4G A;  4RW9 A;  4L3Q A;  2Q3S A;  3OYA A;  2IC3 A;  2HBL A;  1Z05 A;  5EY4 A;  4CER A;  4RWT A;  3CJB A;  3SNN A;  2G8W A;  4DQI A;  2ATQ A;  3D2F A;  4FWL A;  1TAU A;  4J2D A;  2QTD A;  4Z4E A;  1C0G A;  2ZF5 O;  3KLH A;  3KWG A;  4B9Q A;  3JS6 A;  1DKG D;  2XHB A;  1Q82 O;  2NRV A;  1JJ2 M;  3FFI A;  1RGI A;  1VSH A;  3TWH A;  2P5G A;  5AQJ A;  1ATS A;  3N4Q A;  3L2V A;  3HBT A;  1D9D A;  4FOI A;  3I56 N;  3TAE A;  2QWM A;  3EL2 A;  5KI6 A;  1S1T A;  2HND A;  1ZBH A;  1B9D A;  2ETJ A;  2O8F A;  3AVA A;  3LP1 A;  1Q81 O;  4H0Y B;  5LY3 A;  2IAJ A;  1J5E K;  1QS4 A;  1UAX A;  1HNW K;  1LAV A;  4B9L A;  4DTU A;  3CM5 A;  4FM0 A;  4FWK A;  4KTZ A;  3QIP A;  3E1Y A;  1TL1 A;  1NGB A;  2IIR A;  4AHR A;  5AQG A;  1TGO A;  1GLL O;  4B3S K;  1LWC A;  3P4I A;  5AQU A;  1TUU A;  3SPY A;  5BPM A;  2KZZ A;  2FC0 A;  4B3T K;  3V1R A;  4CJQ A;  5FPM A;  4BR2 A;  4CGI A;  1HPM A;  4N5S A;  3C6H A;  4H4O A;  4RTF D;  1SV5 A;  4CZF A;  4BQL A;  1SL1 A;  3SUQ A;  1D9F A;  2QWP A;  1VSI A;  4DTS A;  1BWF O;  4YY3 K;  3OYD A;  3M8P A;  4E7K A;  4OLA A;  1FKP A;  4ID5 A;  5I9E B;  5AQZ A;  4H0T B;  4LF4 K;  4PWD A;  4G1Q A;  2JWL A;  5DMR A;  3DXM B;  1G15 A;  3O4N A;  4MO5 A;  3AA4 A;  2P9P A;  3THX A;  4CEA A;  1C1A A;  3ZET B;  2O8D B;  1E4G T;  1W2B M;  5MLC Q;  4BRH A;  2BE2 A;  1XC9 A;  4CF2 A;  4FO0 A;  5BPN A;  4JRP A;  1EX4 A;  4H0V B;  4FJH A;  4CW7 B;  1HQE A;  1NBW A;  2IDO A;  1RBS A;  4JLH A;  3OS1 A;  2OPR A;  2P51 A;  4CJW A;  3QIO A;  5I3U A;  3T1A A;  4DR5 K;  3MEG A;  1CZA N;  4CJL A;  5ADX H;  3TAG A;  2QEX N;  5AQY A;  3DMJ A;  3KK3 A;  3EZ5 A;  5JVH L;  3C6U A;  5AR0 A;  1YXQ A;  2NRR A;  2HVH A;  4DKW A;  3G6E N;  3C7N A;  4KFB A;  3O9S A;  1NK0 A;  4M3W A;  1W7A A;  4H03 B;  3L3U A;  2OTJ N;  1HLU A;  3D6R A;  4BC2 A;  4M3X A;  2Y1I A;  4EZ6 A;  5HRS A;  3NF8 A;  4HCC A;  4FWQ A;  3OYG A;  3L4Q A;  3PUF A;  2YV0 X;  3G71 N;  1ZBI A;  4BDZ A;  3FZH A;  3OY9 A;  3ID6 A;  2A40 A;  4BDP A;  4FJ9 A;  3CCR N;  4FLU A;  5CZ1 A;  3OYB A;  1XMQ K;  1T6C A;  4CHP A;  1J6Z A;  4K8X A;  4JD2 B;  3LWL A;  1XNQ K;  1TKX A;  1VQ8 N;  4BWM A;  4B1V A;  4N47 A;  1EWR A;  1B92 A;  1U45 A;  3JAM O;  3AVH A;  3DRR A;  2CGL A;  3VEO A;  1BL3 A;  3MX5 A;  3SLC A;  1IG8 A;  1SS6 A;  4OLB A;  1N8R O;  2OYQ A;  5HLF A;  4K0K K;  3HPG A;  2B5J A;  3K57 A;  2BUP A;  4BRD A;  3AVM A;  2UXB K;  3F9M A;  3K5N A;  3CER A;  1Z26 A;  2WUS A;  1VQ4 N;  2HF4 A;  1L3V A;  4RW8 A;  3A5L C;  5C2F A;  1RBU A;  3HTV A;  5AQS A;  1HYZ A;  2E4L A;  4DSF A;  1K8K B;  2E20 A;  3MX2 A;  4CF1 A;  1EXQ A;  4K25 A;  4E7I A;  3WXK A;  3AVF A;  1K9M O;  5GIN A;  2FLO A;  2G8F A;  1SUQ A;  1F21 A;  3ATU A;  1BU6 O;  2OZM A;  3H1Q A;  3DI6 A;  2BH1 A;  3RSE A;  3I55 N;  2FSJ A;  3O4W A;  2V7Y A;  4R5P A;  3QEP A;  3CCV N;  2F8S A;  2DFE A;  4E1N A;  1DLO A;  3C6A A;  4LH4 A;  4IEI A;  3CET A;  3PIP L;  3AAP A;  3O3F A;  1K73 O;  1X9W A;  2Q1N A;  3MCA B;  4CEE A;  3OHR A;  3IFR A;  4NYF A;  3DJC A;  2OA8 A;  4DQQ A;  1JXB A;  3U3Y A;  2E1Z A;  1ZXO A;  3ISN C;  2YHY A;  4JI4 K;  4E89 A;  2UXD K;  4I2P A;  4JK8 A;  4Z94 A;  2GBZ A;  4FJL A;  4CEC A;  2KTQ A;  2FBT A;  1WSH A;  3HT3 A;  3KLI A;  2QK9 A;  1VSF A;  1RIL A;  1EET A;  4CJV A;  1NK8 A;  4O8K A;  4LF7 K;  1IBM K;  2EX3 A;  4MQ3 A;  1NU0 A;  4WFB L;  2HB5 A;  1Y64 A;  4FLT A;  4KAZ A;  4BQZ A;  5AZJ B;  4KKO A;  1VSJ A;  3CC2 N;  2YKN A;  3KK2 A;  4ILH A;  4A2A A;  3NMU A;  3T3F A;  4JK9 A;  3L2R A;  3LDP A;  4NCA A;  3OYK A;  2LSN A;  4YOT A;  1U6Z A;  4Z0U A;  1IKV A;  2P1J A;  4H5T A;  3SMS A;  2NUB A;  3LDS A;  3P1G A;  3KVG A;  3VQE A;  3MN5 A;  3L3V A;  4DSI A;  4BRI A;  1LCU A;  4WF9 L;  1J53 A;  4KH4 A;  4BG8 A;  1K6Y A;  4BRC A;  1KFS A;  1NGI A;  1B9F A;  1JLE A;  2ZE2 A;  2UYT A;  1HKB A;  4QOZ B;  2E2P A;  4FJ8 A;  4OX9 K;  1RT3 A;  4O0J A;  2JLE A;  4DV6 K;  1I3A A;  4IOA L;  4ELU A;  1S5J A;  1BQN A;  4MO4 A;  1I39 A;  5C25 A;  4CEO A;  5KPZ A;  3TAP A;  2ASM A;  4M3R A;  1VSD A;  4WQ5 A;  1D8Y A;  5A2Q O;  1BI4 A;  4C8N A;  4AHC A;  3LDO A;  3O8M A;  4DU1 A;  4B9U A;  5EVZ A;  4JI1 K;  4O0I A;  2Q31 A;  5IWA K;  1RTD A;  1NOZ A;  3K9K A;  4HTU A;  2RN2 A;  2DFH A;  4EZ9 A;  3EY1 A;  1KVA A;  3IS9 A;  4FOE A;  1FK9 A;  3T1H K;  2IS3 A;  1HNZ K;  4KV8 A;  1L3T A;  1IJJ A;  4ICL A;  2P9N B;  4IFY A;  2ITG A;  3V9W A;  1NNE A;  1ZBL A;  4AM7 A;  4BRE A;  3LZI A;  1UWB A;  1TKD A;  4M42 A;  4GVM A;  3NF7 A;  3A5N C;  2GWK A;  1S3X A;  3THV A;  4F4K A;  2WC9 A;  1YI2 N;  4CF8 A;  2Q2R A;  3OS2 A;  2ZWH A;  1S6P A;  1KVC A;  3SQ2 A;  1ASW A;  4Z4F A;  4Z4C A;  3HXM A;  3UE5 A;  4DLE A;  4JKH A;  2NRW A;  4AQY K;  1N6Q A;  3FE1 A;  3M1F A;  4XIU A;  2A42 A;  3OJU A;  4B1X B;  1TUY A;  3NDK A;  5M1P A;  3HPO A;  3O9U A;  1OVQ A;  3NH1 A;  1VRU A;  4WCE L;  3CG7 A;  4FYD A;  2D4W A;  1NGH A;  5ADX A;  4E19 A;  3D2F B;  2KKZ A;  5T7B A;  3DLB A;  4KHY A;  4FJJ A;  1WOQ A;  4BE2 A;  4WQ4 C;  1H1V A;  3CQ8 A;  4N56 A;  3KKR A;  2X74 A;  3I33 A;  3OJS A;  1C0M A;  2D0C A;  2FSK A;  4XH4 A;  3F9K A;  3CCQ N;  3PY8 A;  1QQN A;  1MWM A;  4JKB A;  4H5N A;  4FWR A;  4CZM A;  4DCH A;  2HOE A;  2YHX A;  1E4F T;  4DF8 A;  3VA0 A;  4NLC A;  2P9L A;  4KRF A;  4FLX A;  4ILG B;  4QS7 A;  4PKI A;  2XY5 A;  2FBV A;  3V4I A;  3DLH A;  4DWI A;  1JKH A;  4XH1 A;  4YOU A;  1GLD G;  3CFP A;  4ZHR A;  4OGE A;  1L3S A;  2BDP A;  2KZM A;  3OBY A;  3ZYY X;  4DF4 A;  2RF2 A;  5BN8 A;  1J5O A;  3AAQ A;  3MED A;  4BR0 A;  5JMV A;  4R79 A;  3EZW A;  1Z25 A;  4CJ5 A;  2P9I A;  4DUZ K;  2YHA A;  3VES A;  4ZTF A;  2PFU A;  3THY A;  5M1N A;  5AQO A;  4I2Q A;  1SL2 A;  4JRQ A;  4KHU A;  4H8K A;  5JS1 A;  3OW2 M;  3CQY A;  1IBL K;  3CCL N;  3U9Z A;  5KGW A;  1VQN N;  5FPE A;  5SZT A;  2G8I A;  3CME N;  3K2P A;  3VF6 A;  1YVN A;  4PQU A;  3SV4 A;  1JXE A;  3KHY A;  3F5T A;  5TKW A;  1VQM N;  4CD1 A;  2J4R A;  4JI8 K;  4JS4 A;  1WUA A;  4PKG A;  4KTQ A;  4M3Z A;  3SV3 A;  4CIF A;  4WQ5 C;  3B8A X;  5EXW A;  2JGU A;  3DLL L;  2O4G A;  3WXJ A;  2VYP A;  4X65 K;  3M8S A;  3O3G A;  2DY4 A;  1N32 K;  3RTV A;  2E2N A;  3NVM A;  3P5J A;  3QIN A;  3QES A;  3WQT A;  2Q36 A;  3UB5 A;  4HUF A;  3QEI A;  4GV6 A;  3ULE A;  3ATV A;  3VGL A;  3ENO A;  4M3T A;  2P9P B;  2YNH A;  3O80 A;  5LJW A;  3THX B;  3P39 A;  3QFP A;  3CCS N;  2HHT A;  4BR4 A;  4DR6 K;  4BAC A;  2ZM6 K;  5FLX O;  1BQM A;  1RDW X;  2YX6 A;  1GLA G;  3VQA A;  4EFH A;  3WXM B;  2G8H A;  3HOT A;  1ASV A;  3CIP A;  4BE0 A;  5AZI A;  3AO1 A;  1VQO N;  2D0A A;  3O1B A;  4BRK A;  4DV1 K;  2KFZ A;  3S9H A;  2HNZ A;  4B1U B;  4HCB A;  4CHN A;  1X1P A;  4AH9 A;  3WNH A;  3C7N B;  4LF6 K;  4DV2 K;  4KHS A;  4O55 A;  2F9T A;  4ZTJ A;  3V9U A;  1XQS C;  4H5R A;  3U9D A;  3V1O A;  4IG3 A;  3KJV A;  2PYJ A;  1XNR K;  3HK2 A;  4DR7 K;  3CMA N;  5AQF A;  3DWL A;  3U8X A;  4CZL A;  4ELV A;  4CIE A;  4FL9 A;  4FCY A;  3A5O C;  3E01 A;  2DPN A;  3CCE N;  4B3M K;  4ILJ A;  4KPY A;  1BA0 A;  2ZD1 A;  1V4T A;  4V19 S;  1TYQ A;  3SZ2 A;  2ASO A;  4W5Q A;  3MCP A;  4FZX C;  2E1Y A;  5C0Y A;  2OPQ A;  2A3Z A;  1REV A;  1VAZ A;  5KQ8 A;  3VEY A;  3ZT4 A;  4HUE A;  1KAZ A;  4LSL A;  4CBU A;  1NK7 A;  4A59 A;  3VN5 A;  3H08 A;  1T05 A;  1OH6 A;  3U4L A;  1XUP O;  3HPH A;  4DFM A;  2NRZ A;  2Z1I A;  2VCP A;  4NCB A;  4OPK A;  4LF5 K;  1C6V A;  2YNI A;  3VQD A;  5FRN A;  4U7B A;  2YKM A;  3TTD A;  1WSE A;  1C0U A;  4FZZ A;  3QO9 A;  3D7E O;  1D5A A;  5C24 A;  3AVK A;  4LY7 A;  4CJF A;  5H1S Q;  1C0F A;  1HUX A;  5GAD P;  2GUI A;  4K42 A;  4MLE A;  3S3M A;  4WYB A;  5HRO A;  1T03 A;  4OKJ A;  1R59 O;  2D5R A;  1RCH A;  4CFA A;  3PX4 A;  4GKK K;  2X6N A;  1ILY A;  1VQK N;  2JWK A;  4BRQ A;  4B9V A;  4FK4 A;  1MDU B;  2NRX A;  1SZ2 A;  2YNG A;  1O13 A;  5E26 A;  4JKF A;  3CHW A;  2XY7 A;  4ID1 A;  3SCX A;  1NK4 A;  3J80 O;  3CJA A;  3K58 A;  1P8Z A;  3I0R A;  4CF9 A;  4JI2 K;  4NLB A;  3P31 A;  1EP4 A;  4M63 C;  1LW2 A;  5BR9 A;  3ZSX A;  1HPZ A;  4NB4 A;  2PY5 A;  4W5O A;  2VG6 A;  1A5X A;  3MEC A;  4NYN A;  2YHW A;  5AQI A;  4DTM A;  3O3H A;  4DR2 K;  4PL8 A;  3MN9 A;  3KZB A;  4BR5 A;  2E5L K;  3W0L A;  4B1W B;  2F7T A;  4HVJ A;  2WOM A;  3SJJ A;  2XY6 A;  3TR8 A;  4C23 A;  2A1S A;  4DFJ A;  3BEX A;  5BR8 K;  5AQH A;  4YNQ A;  1RDU A;  2ITM A;  3DLK A;  4FZY A;  3PX6 A;  4FW1 A;  4RW7 A;  3WEE A;  4KBO A;  3GOI A;  3VOV A;  4CEB A;  3AVI A;  1GLC G;  4M45 A;  4DS5 A;  4AHT A;  4DMN A;  4Y1C A;  5I42 A;  2HVI A;  4JS5 A;  1CZB A;  2HMI A;  3HM8 A;  4CI6 A;  4FK0 A;  1N34 K;  1GOB A;  1VQP N;  4FLV A;  3OYC A;  3OYI A;  1YHQ N;  5AQQ A;  4C1N I;  3LPT A;  1WB9 A;  4M7Y A;  2QWN A;  2A1R A;  4GMJ B;  3VET A;  3QML A;  5GAE P;  4K8Z A;  1Y97 A;  1YJ9 N;  1VQL N;  1K8A O;  3PO4 A;  2AA4 A;  1HKC A;  3QET A;  1JCF A;  1RTJ A;  3OYM A;  3A2F A;  1BI4 B;  3T69 A;  1RDB A;  3RMB A;  1RT5 A;  3VQB A;  3ASM A;  1S22 A;  3LAM A;  5KRT A;  3K5O A;  3EO3 A;  3VEN A;  4B9M A;  4I9L A;  1JL1 A;  1JCG A;  1GLB G;  4IDK A;  4A2B A;  1IG9 A;  1QQM A;  4JHD A;  2HHU A;  4E7H A;  3QNO A;  3NGI A;  3SBG A;  1RNH A;  2FBY A;  5AQL A;  4DV0 K;  1SKW A;  3HVT A;  1NGC A;  3LM9 A;  3O6W A;  3S3O A;  2VQE K;  3O9T A;  5GIP A;  4X64 K;  1YVU A;  1GLE G;  1HX1 A;  1RBR A;  1T3V A;  1S1W A;  4CED A;  1UA0 A;  4IKF A;  4F2R A;  2D0P A;  4DFK A;  1QZ5 A;  2KFN A;  1NOY A;  3LAN A;  3V9Z A;  3S3N A;  1NKC A;  2Z1H A;  4N41 A;  2P9K A;  3HM9 A;  2ASP A;  2G8U A;  3U6F A;  4FWO A;  3PO5 A;  1RDC A;  1A5V A;  2ZGZ A;  4BRN A;  1NJY A;  5GAG P;  5EOY A;  1QHA A;  4LH5 A;  4DV7 K;  3RVC A;  4C8M A;  3WNE A;  4FWM A;  4KH5 A;  4DSJ A;  4J2B A;  1NGF A;  1ZBF A;  2PAV A;  3BP8 A;  2O8B A;  4FWP A;  4Q5V A;  3AO5 A;  3MDQ A;  3TAQ A;  1IKY A;  2PBD A;  3FR0 A;  3R1X A;  4JI3 K;  3WT0 A;  4B3R K;  4FJI A;  5AFU H;  4YOW A;  3RMD A;  3NBP A;  4QS9 A;  3ZEU A;  2P9L B;  1X3M A;  1RT2 A;  3VQ4 A;  4BRF A;  3M8Q A;  3L2W A;  4IBN A;  5C15 A;  4JI6 K;  1RBT A;  1JLF A;  3KK1 A;  2V51 B;  3F2K A;  2FF6 A;  5EX5 A;  1ZBU A;  2YHB A;  4JYA K;  1IH7 A;  3E66 A;  3QB0 A;  2HHX A;  2HHS A;  4DUY K;  2P9I B;  3FZL A;  1Q7Y O;  3THY B;  5KPR A;  1S6Q A;  2WBN A;  3L2Q A;  3SYZ A;  3VA3 A;  3V81 A;  4I6M B;  3L2U A;  1ATN A;  4HUG A;  1U49 A;  1QQO A;  3OYN A;  2OTL N;  3J7Z O;  3DXM A;  2G8V A;  3QBW A;  3TPQ A;  4CK3 A;  1JCE A;  3G4S N;  4KRE A;  3ENH A;  5AQT A;  4Y0W A;  1YIJ N;  3GL1 A;  3KIO A;  1YF5 L;  5C42 A;  1S72 N;  2VGN A;  5AJ3 K;  4WFA L;  3T7Z A;  2RKI A;  3QEW A;  3QLH A;  1WNS A;  4YOR A;  3ULE B;  2VQF K;  3KLG A;  3CCJ N;  3AVG A;  3M3Z A;  3MWT A;  1TK8 A;  4B8A B;  2Z1J A;  4BGB A;  1BIS A;  1JLQ A;  4CGF A;  4CJ7 A;  3NFA A;  4JKG B;  3F73 A;  4JEP A;  2O8E B;  4CK2 A;  3VQP A;  2QKK A;  3QER A;  2A41 A;  2Q97 A;  3ZSW A;  2GV9 A;  4CZK A;  3NCI A;  2QWQ A;  4J8F A;  3HSC A;  2AP1 A;  5J2P A;  3SAF A;  1LOT B;  5BN9 A;  2WTU A;  1YUW A;  1Q18 A;  4K41 A;  4O4G A;  3LWM A;  1C1B A;  2P9U A;  2DFF A;  1J9A A;  4GVE A;  4N76 A;  4KI4 A;  4JK7 A;  4CZG A;  4B1Y B;  1IO2 A;  3THW A;  1C0T A;  5FPD A;  1Q8I A;  2V7Z A;  5CY4 A;  4CZJ A;  2KW4 A;  4E7L A;  3K5L A;  3TU5 A;  4CZE A;  1BIZ A;  4BRL A;  3EKS A;  4A5A A;  1KRP A;  4ELT A;  3I8B A;  5F2R A;  1LAW A;  3BDP A;  3AGR A;  3AAR A;  4CJS A;  3R8E A;  4BGA A;  1BUP A;  3ZSR A;  1T7P A;  2XY8 A;  2VG5 A;  3TAN A;  4FXD A;  5CE3 A;  2O8C A;  4FW2 A;  3LL3 A;  3TAR A;  3K5M A;  3NHG A;  5CYM A;  3R6M A;  1L5U A;  3AO3 A;  4JKA A;  4DQ8 A;  3MWP A;  3UIQ A;  4FWS A;  3GE1 A;  2HST A;  3O1W A;  1VQ6 N;  4WE1 A;  3A8Y A;  2VGM A;  1OH8 A;  5HP1 A;  1QSS A;  3TSU A;  4B9T A;  1TYQ B;  4PY5 A;  1WAJ A;  4NO7 A;  1KSP A;  3OYJ A;  3L6Q A;  3MMV A;  4C1N K;  3HOS A;  3SK3 A;  5M1O A;  2BTF A;  1NGG A;  2KLA A;  2CH6 A;  3PSF A;  5EU7 A;  1U2V A;  3GG4 A;  1OVY A;  1DT9 A;  4CIG A;  3SQ0 A;  3QIC A;  3AY9 A;  4AF1 A;  1TVR A;  3VQ7 A;  3SAH A;  1GLF O;  1WN7 A;  2ZJR L;  4DR1 K;  4IJN A;  3JXU A;  1HJO A;  2E2Q A;  3HYF A;  3TSP A;  3IMX A;  1FJG K;  4PL7 A;  2O8F B;  4U67 L;  4BVP A;  5BRE A;  4CHY A;  4JI5 K;  4BVO A;  1HR0 K;  4C8L A;  3WUH A;  1W97 L;  3DRP A;  3W3D A;  1JLG A;  2RHK A;  5AQK A;  3KLE A;  1W0H A;  3I0S A;  2HBJ A;  3ZSY A;  4WFN L;  3AVL A;  3WXI A;  3VPZ A;  1BDG A;  3CCU N;  2Q0U A;  2GUP A;  4FJK A;  4FJ7 A;  3ZX2 A;  2F8T A;  1TL3 A;  4HTL A;  1BOT O;  1JLC A;  2DTU A;  4O5F A;  4I9Q A;  1T8E A;  3CFR A;  5E84 A;  5AQV A;  3EE9 A;  2NRH A;  1IKX A;  1RT6 A;  4HWI A;  4LFB K;  3OYF A;  3G10 A;  3VEV A;  2WON A;  1KCF A;  5DM6 L;  1GOC A;  3AVN A;  4O8U A;  4FJM A;  2P9S A;  3ZSQ A;  3IUC A;  2D0O A;  4C8K A;  4CGD A;  1VSM A;  1N36 K;  1BA1 A;  4KHN A;  4KHP K;  3AGK A;  2CH5 A;  4TSX A;  2ZJQ L;  5AQN A;  3CJ1 A;  5JIC A;  3KD1 E;  3H3O B;  3C6T A;  1WSG A;  4F9O A;  1NK5 A;  1RT7 A;  3CJ7 A;  3VEW A;  1XC3 A;  2D0B A;  3BZK A;  3OYL A;  1OKJ A;  4W5N A;  4MDA A;  1HYV A;  3ZSO A;  2YJE A;  4OPA A;  4GW6 A;  5J1E A;  4F3O A;  1YJW N;  3ZT0 A;  1VSL A;  3LAK A;  3NF6 A;  2GEL A;  1EQY A;  4LD0 A;  5JS2 A;  4CE9 A;  3D2E A;  3U3G A;  5AFU A;  2OZS A;  2IVN A;  4GNI A;  3WEE B;  3G25 A;  3CJC A;  1UA1 A;  3QFU A;  4EP5 A;  3QNN A;  4H5W A;  1X9J A;  4AM6 A;  5HRP A;  4CJ4 A;  4RW6 A;  4FM1 A;  2F9W A;  4A5B A;  4OGC A;  4KI6 A;  3AA2 A;  4CFC A;  4LFC K;  1ZYQ A;  3VTI A;  3T19 A;  1KLN A;  4IFV A;  1YIT N;  3DYA A;  4CEZ A;  5FPN A;  4PUO A;  4FPA A;  4DS4 A;  4DG1 A;  5M1Q A;  1J54 A;  4FLY A;  1HNX K;  4AIL C;  4CHQ A;  1NGJ A;  4DTJ A;  3CD6 N;  3E9P A;  3LM2 A;  4KTW A;  3D45 A;  2UUA K;  1HQU A;  3MXJ A;  1TK0 A;  2HW3 A;  3QEV A;  1BCO A;  3RMA A;  4OJR A;  3NF9 A;  3NAE A;  4MLH A;  4DSE A;  1QTM A;  2QXL A;  3AV9 A;  1QSY A;  4OVL A;  1YAG A;  4CD3 A;  1RDA A;  4OKK A;  2VG7 A;  4K43 A;  4J2E A;  4CZI A;  4JHD B;  1Q9Y A;  4UY8 O;  4BC5 A;  1JLA A;  3ZLJ A;  2GX9 A;  1NJI O;  4Q0B A;  1KVB A;  1S1U A;  2CGK A;  3A0I X;  4GY2 B;  5FDL A;  3VTH A;  2GWJ A;  3E9L A;  4DTX A;  4JN4 A;  1NJZ A;  2W41 A;  3DLR A;  4JKC A;  3AA3 A;  4EHU A;  5M1K A;  4F3T A;  3TTC A;  3J7Y P;  3OVN A;  4DV5 K;  1IBK K;  1A5W A;  5J2N A;  1BGX T;  4BRP A;  3KKS A;  3O4Q A;  4BG9 A;  1XI1 A;  4CZH A;  2P9K B;  3VQ8 A;  4W5T A;  1DTQ A;  4YDU A;  4BWJ A;  4QAG A;  4KHW A;  3AVJ A;  4BDY A;  1EWQ A;  2E6L A;  4I7F A;  3VGM A;  3HST B;  1NM1 A;  5C2D A;  2ZJP L;  4ISE A;  2UUB K;  5GIO A;  4X66 K;  3RSE B;  2OAN A;  1R0A A;  1U04 A;  4FK2 A;  5K14 A;  4JV5 K;  1YTU A;  5LMU K;  2AJQ A;  3QEX A;  1S1V A;  3UKU A;  3MAQ A;  4BR7 A;  1NKE A;  2O8B B;  2W40 A;  2ZGY A;  4YOX A;  1P90 A;  3NE6 A;  2NZT A;  2NNW A;  3IDH A;  1KAX A;  1N33 K;  4A61 A;  3WQU A;  3ZEU B;  4XEI A;  3EKU A;  3K0S A;  1VQ5 N;  4JAX A;  2O4I A;  3SQ1 A;  2GEM A;  5IT9 O;  4FJX A;  3IRX A;  3UKR A;  4OPJ A;  3KLF A;  2RE2 A;  4CJU A;  4DR3 K;  4XH5 A;  4Y1D A;  3HO1 A;  1HNI A;  3CC7 N;  4FPB A;  2X6S A;  1FW6 A;  4DTR A;  4CHO A;  3ULD A;  4JI0 K;  4DFP A;  2W6K A;  1X9M A;  3ALY A;  3O9Q A;  4DHY A;  4IEE A;  3AA5 X;  1LWF A;  1U48 A;  3HP9 A;  5F1X A;  1KXP A;  4H0O A;  3V1Q A;  5CYQ A;  3N4P A;  3SPZ A;  1Z6R A;  3OA9 A;  1YT3 A;  2F96 A;  3M6G A;  3K59 A;  5DM7 L;  5AQP A;  3H3N O;  5SWM A;  3ZX3 A;  5DK5 A;  2IGI A;  1SKR A;  2GTD A;  3GBT A;  1LW0 A;  3CXC M;  5HBM A;  3DXK A;  4A57 A;  1KC8 O;  4FJ5 A;  3LP2 A;  1C1C A;  1OH5 A;  3P38 A;  3AVC A;  3VEZ A;  3CFO A;  1XHZ A;  1UOC A;  2HHH K;  3VQ6 A;  3LZJ A;  3NGY A;  5CZ2 A;  2KHO A;  3H46 O;  4DV4 K;  3ZSV A;  2H3G X;  2QA4 N;  1SQK A;  4G9Z A;  5HOO A;  3L0Q A;  1O1W A;  4CBW A;  3SUP A;  1NJW A;  4YHH K;  4IWV A;  4FVM A;  4YFU A;  5AQM A;  1YJN N;  1GLJ O;  1M1K O;  1ATR A;  4KH6 A;  4RG8 A;  1QE1 A;  3CPE A;  1TKT A;  3R9P A;  1QHT A;  2B6A A;  5C10 A;  1ZC6 A;  4KO0 A;  4RW4 A;  5KGX A;  4FJG A;  4LFA K;  4BY9 C;  4CEQ A;  4AHV A;  2FF3 B;  3PIO L;  4M3Y A;  5LMN K;  3SAG A;  4H0X B;  3S41 A;  1IV0 A;  2X78 A;  1NJX A;  2P9U B;  1NGE A;  3H1V X;  5E41 A;  3TAB A;  3THW B;  4KB0 A;  4RCH A;  1VSK A;  3DLE A;  4CFD A;  4NXN K;  1HNV A;  1NMN A;  3CM6 A;  3O5B A;  2HHV A;  1EO1 A;  2VWB A;  3C65 A;  4CF0 A;  3I8D A;  1NKB A;  4KB1 A;  3BGR A;  4YDU C;  4DB3 A;  3FFK B;  4FWN A;  4X62 K;  1FXX A;  4YOV A;  1EKE A;  4Z4H A;  4CK1 A;  1JL2 A;  3AO2 A;  2D1K A;  3R3L A;  4E0D A;  2O8C B;  2Z1G A;  3NGZ A;  2B4J A;  4BRM A;  4DSL A;  5BRF A;  3RRH A;  3BF1 A;  4BRG A;  1HKG A;  1E3M A;  2HNY A;  4HHT A;  4Z4I A;  4OPH A;  3HL8 A;  1VK0 A;  2YNF A;  4O5B A;  5BRH A;  5JLH A;  3JSM A;  4QCL A;  4CJE A;  2W42 A;  1LWE A;  3ZT3 A;  3ZCM A;  3FZM A;  3Q7C A;  2QI2 A;  3ZT2 A;  3MXI A;  1U2V B;  2BAN A;  5F0X A;  1VQ9 N;  4LSN A;  4L8R B;  3SBT A;  1ASU A;  3ENB A;  3ZSZ A;  1NLV A;  2YCH A;  1WAF A;  3ITH A;  1BO5 O;  4CJP A;  1TK5 A;  3OS0 A;  4IDH A;  3OYH A;  1BG3 A;  3CCM N;  1TV6 A;  4IJA A;  4J2A A;  4BRA A;  1X3N A;  2BGG A;  2E8A A;  3ZT1 A;  1X9S A;  3SMP A;  4IO8 A;  1BCM A;  1U47 A;  4NCG A;  1HYS A;  3FZF A;  3OTO K;  3AVB A;  2P5O A;  1IKW A;  1NG9 A;  2OPP A;  3J7A P;  4EIA A;  4MFB A;  4CJK A;  4FLW A;  3OBW A;  1CLQ A;  2QXF A;  3O08 A;  3T1Y K;  2F4V K;  4WQ4 A;  3FGU A;  2CGJ A;  3JYT A;  4DV3 K;  3CI5 A;  3BZC A;  4JKE A;  4B3O A;  3C0B A;  1OH7 A;  2XRI A;  1QSL A;  1TAQ A;  3EEQ A;  3DLG A;  4E1J A;  2P9S B;  3WNG A;  3J8A A;  3EN9 A;  3DOL A;  2QM1 A;  4DU3 A;  3ZET A;  2O8D A;  1VSE A;  2HHW A;  4DTO A;  1JLB A;  5BRD A;  3CPW M;  3SUN A;  3VQC A;  3Q7B A;  1RFQ A;  4FSV A;  3SI6 A;  4H5V A;  3A5M C;  3C95 A;  1W9H A;  2UXC K;  2WFB A;  4GV3 A;  1KTQ A;  3VF2 A;  3ZX0 A;  3HP6 A;  1NMD A;  3KD5 E;  2Q0R A;  2A5X A;  2HBM A;  4EHT A;  1NGA A;  1NK6 A;  4IFE A;  1VQ7 N;  1MWK A;  3D2E B;  5JVG L;  2ZQB A;  5C12 A;  4GV9 A;  2OPS A;  3DAW A;  3MK6 A;  4MDB A;  3FZK A;  3CJ9 A;  1BIU A;  4CHZ A;  1CXQ A;  2V52 B;  2I7P A;  1WBD A;  3L4I A;  5AZI B;  5GAH P;  1S9E A;  3HVR A;  2UU9 K;  5LL6 Z;  2FSN A;  1WBB A;  4M7X A;  3O9R A;  3HRG A;  1XWL A;  1YTA A;  2HF3 A;  1T6D A;  1NWK A;  1WLJ A;  1NGD A;  1SL0 A;  2W6L A;  4LF9 K;  1QVG M;  3HZ6 A;  4QS8 A;  4IOC L;  1KFD A;  2Y1J A;  4JD2 A;  4PKH A;  3SJH A;  4M41 A;  4M3U A;  4O44 A;  4IZ9 A;  2EHG A;  2PYL A;  3TSQ A;  3LP0 A;  3MN7 A;  3BF3 A;  3C94 A;  3QDK A;  1DTT A;  4DTN A;  5ELZ A;  3NVK A;  1RTI A;  5HRN A;  3RMC A;  3MXM A;  4CJT A;  4JNE A;  2R7Y A;  1CZ9 A;  3TTF A;  2IVP A;  3NH0 A;  3KTQ A;  4LF8 K;  4BRO A;  4BR9 A;  3TI0 A;  3VGK A;  3RWU A;  3BY5 A;  5D3G A;  3RR8 A;  1ESV A;  2YJF A;  1K8K A;  1SAZ A;  3EYZ A;  3WNF A;  2FBX A;  3VER A;  1T44 A;  5AQX A;  2UUC K;  3V9X A;  3DRS A;  3LDQ A;  2XO7 A;  1FKO A;  4JKD A;  3AO4 A;  2KQ2 A;  5AQW A;  3RRG A;  5FRO A;  3H45 C;  4H4M A;  3DOK A;  5KPT A;  3IAY A;  4CJR A;  5KQD A;  2OCE A; 
#chains in the Genus database with same CATH homology
 4GMJ B;  4CES A;  4K8Z A;  1Y97 A;  3T3F A;  1BHL A;  3L2R A;  4Q0B A;  3G0Z A;  1KVB A;  1S1U A;  4NCA A;  3OYK A;  4B8C A;  3IG1 A;  2LSN A;  2E6M A;  4CEF A;  5FDL A;  5J2Q A;  3QET A;  3PO4 A;  1WSI A;  4Z0U A;  1IKV A;  1RTJ A;  2P1J A;  3OYM A;  4DSK A;  4DTX A;  2NUB A;  3A2F A;  5FRM A;  1BI4 B;  3LDS A;  3LP3 A;  4CGJ A;  1NJZ A;  3P1G A;  3P83 D;  1RDD A;  3DLR A;  3VQE A;  1RDB A;  3RMB A;  3L3V A;  1RT5 A;  4DSI A;  3AA3 A;  3VQB A;  3ASM A;  3LAM A;  4F3T A;  4PA1 A;  1LV5 A;  2PZS A;  3CYM A;  1J53 A;  3OVN A;  1N5Y A;  5KRT A;  3K5O A;  1KLM A;  1K6Y A;  1KFS A;  4B9M A;  1B9F A;  5KRS A;  1A5W A;  1JLE A;  2ZE2 A;  1JL1 A;  4I9L A;  1IG9 A;  4IDK A;  4F2S A;  1QQC A;  1RTH A;  5J2N A;  1BGX T;  5HRR A;  4FJ8 A;  4QOZ B;  1RT3 A;  3KKS A;  4O0J A;  4DQR A;  3RR7 A;  2JLE A;  3O4Q A;  2HHU A;  4E7H A;  3QNO A;  4W5R A;  1XI1 A;  3NGI A;  1I3A A;  3VQ8 A;  4FJN A;  4W5T A;  4ELU A;  1S5J A;  1DTQ A;  1BQN A;  1RNH A;  3LAL A;  4QAG A;  2FBY A;  3AVJ A;  4BWJ A;  3VQ9 A;  4BDY A;  1CXU A;  4CCH A;  1I39 A;  2RPI A;  2E6L A;  3HVT A;  1SKW A;  4I7F A;  5J2M A;  3HST B;  5C25 A;  4CEO A;  3NH2 A;  3TAP A;  3OYE A;  4M3R A;  3S3O A;  1VSD A;  1U04 A;  3V6D A;  1R0A A;  4FK2 A;  1D8Y A;  5K14 A;  1WSF A;  4CFB A;  1YTU A;  2AJQ A;  1BI4 A;  4C8N A;  1S1V A;  3QEX A;  4AHC A;  4DU1 A;  4B9U A;  3TAM A;  1YVU A;  3MAQ A;  1NKE A;  1Q9X A;  1RBR A;  3DM2 A;  3SUO A;  4IG0 A;  4O0I A;  1RTD A;  1S1W A;  4CED A;  1NOZ A;  1UA0 A;  4AHS A;  4HTU A;  4F2R A;  4IKF A;  2RN2 A;  1ITG A;  3NE6 A;  4DFK A;  2DFH A;  4EZ9 A;  3EY1 A;  1KVA A;  3B6O A;  3IS9 A;  4E7J A;  2I5J A;  4CGH A;  1FK9 A;  2KFN A;  3PX0 A;  1NOY A;  1XHX A;  2IS3 A;  3VQ5 A;  3LAN A;  4KHW A;  1RBV A;  3V9Z A;  4KV8 A;  3S3N A;  1L3T A;  3PV8 A;  4C8O A;  1NKC A;  2Z1H A;  2O4I A;  4AHU A;  1U4B A;  4ICL A;  4N41 A;  3HM9 A;  4DQS A;  3SQ1 A;  2G8U A;  3U6F A;  1HRH A;  4E3S A;  1L3U A;  4IFY A;  3PO5 A;  1RDC A;  1A5V A;  4FJX A;  3IRX A;  1GOA A;  2ITG A;  4OPJ A;  4OKE A;  2VWJ A;  3V9W A;  2VWK A;  1ZBL A;  1NJY A;  3KLF A;  3LZI A;  3MEE A;  1UWB A;  4CJU A;  1TKD A;  2KZM A;  4M42 A;  4LH5 A;  4Y1D A;  3HO1 A;  1HNI A;  3NF7 A;  4GVM A;  4FLZ A;  2QKB A;  2X6S A;  4DQP A;  4C8M A;  3WNE A;  4CHO A;  4BE1 A;  4DTR A;  3THV A;  3ULD A;  1SKS A;  4DSJ A;  4F4K A;  4J2B A;  1WSJ A;  3TAF A;  1ZBF A;  4DFP A;  4CF8 A;  1X9M A;  3ALY A;  3OS2 A;  4Q5V A;  3AA5 X;  1LWF A;  1S1X A;  3AO5 A;  4DLG A;  3TAQ A;  1IKY A;  3L8B A;  1U48 A;  3HP9 A;  1S6P A;  1KVC A;  3SQ2 A;  2IOC A;  4F8R A;  1ASW A;  4FJI A;  4Z4C A;  3HXM A;  3V1Q A;  4Z4F A;  5CYQ A;  4B9S A;  4DLE A;  3RMD A;  1TKZ A;  3NBP A;  3SPZ A;  3D0P A;  5KTQ A;  2HHQ A;  1YT3 A;  1HMV A;  2F96 A;  3K59 A;  4XIU A;  3SQ4 A;  1N6Q A;  3HJF A;  5SWM A;  1RT1 A;  1RT2 A;  3VQ4 A;  3OJU A;  3B6P A;  3VQQ A;  5DK5 A;  2IGI A;  1SKR A;  3NDK A;  3M8Q A;  4DTP A;  4FJG A;  3HPO A;  1LW0 A;  3L2W A;  4KHQ A;  4UQG A;  3NH1 A;  3M8R A;  1VRU A;  4IBN A;  3CG7 A;  5HBM A;  4FYD A;  4EP4 A;  4E19 A;  1RBT A;  5T7B A;  1JLF A;  3DLB A;  4FJ5 A;  4KHY A;  4FJJ A;  3LP2 A;  1C1C A;  1VRT A;  3KK1 A;  4BE2 A;  2G8K A;  3AVC A;  1ZBU A;  3CFO A;  2YHB A;  1UOC A;  1XHZ A;  1IH7 A;  3VQ6 A;  3NGY A;  4E1M A;  3LZJ A;  4N56 A;  3KKR A;  3CQ8 A;  5CZ2 A;  2HHX A;  1HJR A;  2X74 A;  3OJS A;  1S9G A;  1C0M A;  2D0C A;  3ZSV A;  3F9K A;  4B08 A;  3PY8 A;  3V9S A;  1O1W A;  3SUP A;  4CJ3 A;  4FM2 A;  1RT4 A;  1NJW A;  4B9N A;  1S6Q A;  3LPU A;  4DF8 A;  1NK9 A;  3VA0 A;  1MU2 A;  4DU4 A;  4KRF A;  4FLX A;  4FVM A;  4CGG A;  3L2Q A;  4YFU A;  3SYZ A;  3VA3 A;  4Z4G A;  3V81 A;  4RW9 A;  3L2U A;  2XY5 A;  2Q3S A;  3OYA A;  4HUG A;  1U49 A;  2IC3 A;  3OYN A;  2FBV A;  4RG8 A;  3V4I A;  3DLH A;  4DWI A;  1JKH A;  1QE1 A;  2G8V A;  4CER A;  2BDP A;  1TKT A;  4ZHR A;  1QHT A;  2B6A A;  4OGE A;  4KO0 A;  4RW4 A;  5KGX A;  4CK3 A;  3CFP A;  3SNN A;  1L3S A;  2G8W A;  4DQI A;  4CEQ A;  2ATQ A;  4KRE A;  4AHV A;  4DF4 A;  2RF2 A;  4M3Y A;  1TAU A;  4J2D A;  1J5O A;  4Z4E A;  3KIO A;  3MED A;  3KLH A;  5C42 A;  1Z25 A;  2X78 A;  4CJ5 A;  1NJX A;  2XHB A;  2YHA A;  2RKI A;  4ZTF A;  3QEW A;  3QLH A;  1WNS A;  5E41 A;  3TAB A;  4KB0 A;  3KLG A;  4I2Q A;  1VSK A;  4JRQ A;  1SL2 A;  4KHU A;  3DLE A;  4H8K A;  3AVG A;  1VSH A;  3FFI A;  4CFD A;  3TWH A;  2P5G A;  5JS1 A;  1HNV A;  3CM6 A;  3L2V A;  1TK8 A;  2HHV A;  5KGW A;  4B8A B;  5SZT A;  1D9D A;  2Z1J A;  2G8I A;  3K2P A;  4CF0 A;  3I8D A;  4PQU A;  1NKB A;  1BIS A;  1JLQ A;  1JXE A;  5KI6 A;  4CGF A;  3SV4 A;  3TAE A;  4KB1 A;  3BGR A;  1S1T A;  3NFA A;  2HHS A;  2HND A;  3F73 A;  1ZBH A;  1B9D A;  2ETJ A;  1FXX A;  4CK2 A;  3VQP A;  2QKK A;  3QER A;  3AVA A;  3LP1 A;  4JS4 A;  4KTQ A;  4M3Z A;  3ZSW A;  3SV3 A;  1EKE A;  4CIF A;  2IAJ A;  2JGU A;  4Z4H A;  2GV9 A;  1QS4 A;  2O4G A;  4CK1 A;  1JL2 A;  3AO2 A;  3NCI A;  4E0D A;  1UAX A;  5J2P A;  2Z1G A;  3NGZ A;  3M8S A;  2B4J A;  3O3G A;  2DY4 A;  1LAV A;  4O4G A;  3LWM A;  4B9L A;  4DSL A;  3RTV A;  1C1B A;  3CM5 A;  4DTU A;  2DFF A;  4FM0 A;  1J9A A;  3P5J A;  3QIN A;  3RRH A;  3QES A;  4N76 A;  4KI4 A;  1IO2 A;  4HUF A;  3QEI A;  4KTZ A;  3QIP A;  2HNY A;  1C0T A;  1Q8I A;  4HHT A;  5CY4 A;  1TL1 A;  4M3T A;  4Z4I A;  4AHR A;  2KW4 A;  2YNH A;  1TGO A;  4E7L A;  3K5L A;  3HL8 A;  1VK0 A;  1LWC A;  2HHT A;  1BIZ A;  3SPY A;  2YNF A;  4O5B A;  1KRP A;  4ELT A;  3JSM A;  4QCL A;  2KZZ A;  2FC0 A;  1LAW A;  4CJE A;  3V1R A;  4CJQ A;  4BAC A;  3BDP A;  2W42 A;  1LWE A;  3ZT3 A;  4CGI A;  4N5S A;  3ZCM A;  4CJS A;  1BQM A;  4H4O A;  3ZT2 A;  1SV5 A;  3MXI A;  1SL1 A;  3SUQ A;  2BAN A;  1D9F A;  3ZSR A;  1VSI A;  4DTS A;  1T7P A;  4LSN A;  3VQA A;  4L8R B;  2XY8 A;  3OYD A;  3M8P A;  2VG5 A;  4E7K A;  3TAN A;  1ASV A;  2G8H A;  4FXD A;  4OLA A;  1FKP A;  1ASU A;  3ZSZ A;  4FW2 A;  4BE0 A;  4ID5 A;  3TAR A;  3AO1 A;  3K5M A;  1WAF A;  3ITH A;  3NHG A;  2D0A A;  4CJP A;  5CYM A;  1TK5 A;  3OS0 A;  1L5U A;  3AO3 A;  4G1Q A;  4PWD A;  2KFZ A;  3OYH A;  3S9H A;  3UIQ A;  5DMR A;  1TV6 A;  2HNZ A;  1G15 A;  4WE1 A;  4J2A A;  2HVI A;  3O4N A;  4HCB A;  3AA4 A;  5HP1 A;  1QSS A;  4CHN A;  2BGG A;  4B9T A;  4PY5 A;  1WAJ A;  3ZT1 A;  1X1P A;  4CEA A;  1X9S A;  1KSP A;  1C1A A;  3WNH A;  4AH9 A;  3OYJ A;  4KHS A;  4O55 A;  1BCM A;  1U47 A;  2BE2 A;  4NCG A;  1HYS A;  1XC9 A;  4ZTJ A;  3AVB A;  4CF2 A;  3V9U A;  3V1O A;  2P5O A;  1IKW A;  5EU7 A;  2OPP A;  1EX4 A;  4JRP A;  4FJH A;  1HQE A;  4IG3 A;  4MFB A;  4CJK A;  3KJV A;  2PYJ A;  4FLW A;  2IDO A;  3HK2 A;  1CLQ A;  2QXF A;  1RBS A;  4CIG A;  3SQ0 A;  4JLH A;  3OS1 A;  4ELV A;  2OPR A;  2P51 A;  3JYT A;  1TVR A;  4CJW A;  4CIE A;  4FCY A;  3QIO A;  3VQ7 A;  4B3O A;  1WN7 A;  3E01 A;  5I3U A;  3T1A A;  2XRI A;  3MEG A;  3HYF A;  1QSL A;  4CJL A;  3TAG A;  1TAQ A;  3KK3 A;  3DMJ A;  3EZ5 A;  3DLG A;  4KPY A;  4CHY A;  2ZD1 A;  3C6U A;  3WNG A;  4C8L A;  2HVH A;  3DOL A;  3DRP A;  3SZ2 A;  4DU3 A;  1JLG A;  4W5Q A;  3KLE A;  4KFB A;  4FZX C;  1VSE A;  1W0H A;  2HHW A;  4DTO A;  1JLB A;  3I0S A;  2OPQ A;  3ZSY A;  1REV A;  3AVL A;  1NK0 A;  4M3W A;  3SUN A;  3VQC A;  3L3U A;  3SI6 A;  4FJK A;  3ZT4 A;  4FJ7 A;  4HUE A;  2Y1I A;  4M3X A;  4LSL A;  4EZ6 A;  2F8T A;  1TL3 A;  5HRS A;  1JLC A;  1NK7 A;  2DTU A;  3NF8 A;  4HCC A;  3C95 A;  1W9H A;  3VN5 A;  3OYG A;  3PUF A;  2YV0 X;  4I9Q A;  3H08 A;  3CFR A;  4BDZ A;  1T8E A;  3OY9 A;  1T05 A;  1ZBI A;  1KTQ A;  3HPH A;  4DFM A;  4BDP A;  2Z1I A;  4FJ9 A;  1IKX A;  4OPK A;  3HP6 A;  3KD5 E;  4FLU A;  1C6V A;  2YNI A;  3VQD A;  4NCB A;  1RT6 A;  5CZ1 A;  3OYB A;  3OYF A;  5FRN A;  3G10 A;  2WON A;  1KCF A;  4CHP A;  1NK6 A;  1GOC A;  2YKM A;  3AVN A;  1WSE A;  1C0U A;  2ZQB A;  4K8X A;  4FJM A;  3LWL A;  2OPS A;  4FZZ A;  3QO9 A;  3ZSQ A;  1D5A A;  1TKX A;  4C8K A;  4CGD A;  1VSM A;  5C24 A;  3AVK A;  4KHN A;  4LY7 A;  1BIU A;  4BWM A;  4CHZ A;  4CJF A;  4N47 A;  1B92 A;  1CXQ A;  4TSX A;  1U45 A;  3KD1 E;  3AVH A;  3DRR A;  2GUI A;  1BL3 A;  3S3M A;  3C6T A;  1WSG A;  1NK5 A;  1RT7 A;  5HRO A;  2D0B A;  1T03 A;  1S9E A;  4OKJ A;  2D5R A;  3HVR A;  1RCH A;  4OLB A;  3OYL A;  2OYQ A;  4W5N A;  5HLF A;  3HPG A;  1HYV A;  2B5J A;  3K57 A;  3ZSO A;  4CFA A;  1XWL A;  1YTA A;  3PX4 A;  4GW6 A;  3AVM A;  5J1E A;  3K5N A;  4F3O A;  2X6N A;  1Z26 A;  1L3V A;  4RW8 A;  3ZT0 A;  4B9V A;  4FK4 A;  1VSL A;  1WLJ A;  3LAK A;  1RBU A;  1SL0 A;  2YNG A;  3NF6 A;  4LD0 A;  5JS2 A;  1HYZ A;  4CE9 A;  2E4L A;  3U3G A;  4ID1 A;  2XY7 A;  3SCX A;  1KFD A;  4DSF A;  2Y1J A;  4CF1 A;  1NK4 A;  2OZS A;  1EXQ A;  4M41 A;  3K58 A;  4E7I A;  3I0R A;  4O44 A;  4CF9 A;  5I42 A;  4M3U A;  3AVF A;  1UA1 A;  2EHG A;  2G8F A;  4EP5 A;  2PYL A;  1EP4 A;  3QNN A;  1LW2 A;  1SUQ A;  1F21 A;  3ZSX A;  5HRP A;  4CJ4 A;  4RW6 A;  4FM1 A;  2OZM A;  3LP0 A;  1HPZ A;  3DI6 A;  3C94 A;  2PY5 A;  4W5O A;  2VG6 A;  1A5X A;  3MEC A;  4OGC A;  4NYN A;  4DTN A;  1DTT A;  4KI6 A;  1RTI A;  3AA2 A;  4CFC A;  5HRN A;  3RMC A;  4DTM A;  3T19 A;  3MXM A;  4CJT A;  4IFV A;  1ZYQ A;  3O3H A;  4R5P A;  1KLN A;  2R7Y A;  3QEP A;  1CZ9 A;  2F8S A;  3DYA A;  3NH0 A;  2DFE A;  4CEZ A;  4E1N A;  1DLO A;  3KTQ A;  4PUO A;  4LH4 A;  4DS4 A;  4HVJ A;  4DG1 A;  3O3F A;  2WOM A;  3SJJ A;  3TI0 A;  1X9W A;  1J54 A;  4CEE A;  4FLY A;  2XY6 A;  3TR8 A;  4AIL C;  4NYF A;  2OA8 A;  4DQQ A;  2A1S A;  4CHQ A;  4DFJ A;  3RWU A;  1JXB A;  3U3Y A;  5D3G A;  3RR8 A;  4DTJ A;  3ISN C;  4YNQ A;  3DLK A;  4FZY A;  3PX6 A;  4E89 A;  4FW1 A;  3EYZ A;  4KTW A;  4I2P A;  4RW7 A;  3WNF A;  3D45 A;  2FBX A;  4CEB A;  3AVI A;  4M45 A;  4DS5 A;  2GBZ A;  3V9X A;  4AHT A;  3DRS A;  1HQU A;  3MXJ A;  2XO7 A;  4DMN A;  4Y1C A;  4CEC A;  4FJL A;  2KTQ A;  1TK0 A;  2HW3 A;  2FBT A;  1WSH A;  1FKO A;  3HT3 A;  1BCO A;  3KLI A;  1CZB A;  4JS5 A;  3QEV A;  3RMA A;  2HMI A;  2QK9 A;  3AO4 A;  4OJR A;  4FK0 A;  1VSF A;  2KQ2 A;  3NF9 A;  1GOB A;  1RIL A;  3NAE A;  3RRG A;  4DSE A;  4FLV A;  1QTM A;  1EET A;  3AV9 A;  4CJV A;  4OVL A;  5FRO A;  3OYC A;  1NK8 A;  4H4M A;  1QSY A;  1RDA A;  3DOK A;  3OYI A;  4OKK A;  2EX3 A;  3IAY A;  4MQ3 A;  2VG7 A;  4J2E A;  2HB5 A;  4CJR A;  4FLT A;  1Q9Y A;  4KAZ A;  1JLA A;  3LPT A;  4KKO A;  1VSJ A;  2A1R A;  2YKN A;  3KK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...