4KAZA

Crystal structure of rnase t in complex with a y structured dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
206
Chain Sequence
b'TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 61
structure length 206
sequence length 206
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kazA00
1CXUA 1N6QA 2BGGA 3AVAA 1TAQA 4ID1A 3DLBA 3DLEA 5C25A 3LWLA 4RW6A 3RR8A 3CM6A 4H4OA 5KTQA 4KTWA 4H4MA 3VA0A 1KLNA 3HXMA 3T3FA 3M8SA 3M8RA 1RCHA 4CIEA 3L3VA 1LAVA 3IAYA 1WSGA 1XHZA 1YTUA 3CG7A 3MEDA 4F8RA 1RBTA 4K8XA 4DQRA 2HMIA 4ZHRA 1NK6A 5K14A 4FJGA 1SL1A 1WAJA 3A2FA 2QKBA 2BE2A 4LSNA 1L5UA 3S3NA 3QNNA 4Z4HA 4CK2A 3KTQA 4B8AB 3DLGA 1ZBLA 1RT2A 3LP1A 2OPSA 4GMJB 3UIQA 4CF9A 5FRNA 1Y97A 4FLZA 4O0IA 4IG3A 4O5BA 3SQ4A 3VQ7A 4OVLA 4NCGA 2YNHA 3M8PA 4KV8A 4PQUA 2F8SA 4FJIA 4DFKA 3HK2A 2OA8A 4KHYA 1FKPA 1S1XA 4O4GA 3WNFA 1L3UA 3LAKA 1U48A 4HUGA 4CEQA 4Y1CA 4B8CA 1KVAA 3RMAA 1RT4A 4M45A 4ELTA 4FLTA 2GBZA 1KCFA 3V1OA 4CCHA 4B9LA 1S1TA 3MEEA 3PUFA 3VQPA 3D0PA 4JRQA 2OPQA 3K5OA 3VQ4A 1CLQA 3K5MA 4CJFA 4Z0UA 1XI1A 2OZSA 1RNHA 1QE1A 3VQQA 4O0JA 3KLIA 4OGCA 4N76A 2DFFA 3S3OA 3V9ZA 4LH4A 1KVCA 4QAGA 1F21A 1RBUA 3P5JA 2JLEA 1BCOA 2KW4A 2YKMA 1LW0A 4MFBA 4JS4A 1UA1A 1HNIA 3DM2A 4M3WA 2BANA 3TABA 3RMDA 1TKZA 3RMCA 4CFDA 2FBYA 3DOLA 3AVBA 1S1WA 3ZSWA 3SV4A 2ITGA 1C0TA 3LWMA 3AVLA 3ZSRA 1BIZA 3SUQA 1TGOA 4CEDA 4E7IA 1L3SA 4KTZA 1VSLA 4DF4A 2VG7A 1TK5A 4M42A 3P83D 1IKYA 1RT7A 4DSFA 4CERA 1JLGA 4CEZA 3NCIA 4FM2A 1TK0A 1FK9A 1T8EA 3QINA 4NYFA 5JS2A 3TAEA 3BDPA 4J2AA 5DK5A 4AHSA 1JLEA 3ZSQA 1UWBA 4CJEA 1HQUA 2PY5A 4CHZA 2G8HA 3OVNA 4OKKA 4FLWA 3DYAA 1X9MA 4MQ3A 4J2EA 3OS2A 3OYNA 4BDZA 4BE1A 4M3YA 4B3OA 2D5RA 4F3OA 4B9TA 2Z1JA 4CGFA 1UAXA 3AA4A 3SUNA 4CJKA 5JS1A 3U6FA 1G15A 3V4IA 3T1AA 3DRRA 4G1QA 4N41A 4CEAA 4DTOA 1BHLA 4FYDA 3DLKA 3TARA 4CJ5A 4C8NA 2G8UA 1U49A 3PX4A 1BI4B 1RT3A 5E41A 5DMRA 3S3MA 1GOBA 1DTTA 4LH5A 1QSLA 1U47A 1SKRA 3LP3A 3ITHA 3I0SA 2XY6A 3OJSA 3KLFA 3AVHA 2HHWA 4B08A 3LDSA 1KFDA 1ZBUA 3V1QA 1TKXA 3WNGA 4ZTJA 1U04A 3NH0A 2FBTA 2IC3A 2HVHA 3SV3A 2JGUA 3RRGA 2XY7A 3OYCA 3HT3A 5HRPA 2IGIA 1EP4A 4M3UA 3ALYA 3LP0A 3KKRA 1LV5A 4FZZA 1DLOA 1XHXA 3WNEA 1ZBHA 4FK2A 4CE9A 4E89A 1S6QA 3HO1A 3QERA 1JLFA 1HYZA 4JS5A 4DFJA 3THVA 1WAFA 3K5NA 4FLUA 2O4GA 4FJNA 1SV5A 4EZ6A 2B6AA 3HYFA 3LPTA 4HCBA 2KFNA 3LZIA 4KHNA 2F8TA 4FJXA 3O4QA 3L2WA 3HM9A 1C1AA 3C94A 2IS3A 3VQAA 1CZ9A 1QHTA 2GUIA 2I5JA 3KIOA 4ID5A 4ICLA 4NYNA 3CFRA 2PZSA 1TVRA 4E0DA 2Y1IA 3F9KA 1Z26A 1QS4A 1S5JA 3AO3A 1JLQA 3WNHA 4M3RA 3CQ8A 1LAWA 2GV9A 2YHBA 4AHRA 3NF8A 4BDYA 4FM1A 1L3TA 1KFSA 1VSFA 1IKVA 4N56A 4DG1A 1J53A 2XHBA 1U4BA 1RT1A 3V1RA 1NJXA 4FVMA 1HNVA 3KK3A 1B9FA 3HP9A 3ZT4A 3NAEA 3ZT2A 4DU1A 4DTUA 2P5GA 3V6DA 4E7HA 3L2RA 5KRSA 4FJ5A 3ASMA 3DLRA 1VSMA 4Q5VA 4CJLA 3SYZA 4DSJA 3RRHA 3VQDA 4E1NA 4W5NA 4BDPA 2WOMA 1RBVA 1D8YA 3DLHA 4CJPA 1UOCA 3OYDA 4E7LA 3SCXA 3TI0A 4KHWA 4HUEA 3KK2A 3DRPA 4J2DA 1NK9A 1GOAA 4ZTFA 5HLFA 1QSSA 3V9UA 3ZSOA 4FCYA 4DTXA 2G8IA 1A5VA 1BQMA 3ZT1A 3CFPA 3SPZA 4GW6A 2DY4A 4CF2A 1C1CA 2OPPA 4CIGA 3S9HA 2RKIA 3G10A 4WE1A 4Z4GA 5I42A 1XWLA 3HSTB 3MEGA 3OYAA 4IFVA 3KKSA 3L2UA 1WNSA 5HRNA 4FK4A 3AVIA 1VRUA 2YNGA 3BGRA 4FW1A 3OJUA 3PO4A 2X6NA 1W9HA 2X74A 4EZ9A 4IFYA 1Q9XA 3TAGA 4KTQA 1R0AA 1JXBA 3OYBA 2P51A 4CGGA 4KRFA 2HHUA 2LSNA 3CM5A 2IAJA 1B9DA 3AO2A 1C6VA 3AV9A 4LSLA 4I9LA 1I39A 3TAPA 3QO9A 4RW4A 4KO0A 1WSIA 4BACA 5CYMA 5I3UA 4BWJA 5J2PA 2KZZA 3L8BA 2HNYA 1U45A 4CIFA 1RTJA 1RTIA 3U3YA 3LAMA 4CHPA 3LZJA 1VK0A 3KLEA 4FJMA 1ITGA 2ZD1A 5J1EA 3O3GA 2VWJA 3PV8A 2ZE2A 5CYQA 4DTNA 3QEWA 1VSHA 2Z1GA 2HNZA 2IOCA 4DSKA 2HHSA 1RTDA 4DFMA 4OGEA 4DQIA 4I7FA 1LWFA 5KRTA 3AA5X 5HRRA 4DTMA 2FBXA 1NOZA 2QXFA 4DS5A 1WSFA 4PWDA 2EHGA 2ETJA 2HNDA 4IBNA 4AHCA 3ZSVA 3AVCA 4C8OA 1WLJA 3VQBA 1SUQA 3QIPA 1IKWA 1HQEA 3L2QA 4CHOA 3HJFA 2D0AA 3ISNC 4CFCA 3K58A 1Z25A 4KB0A 1T05A 3IRXA 3L3UA 2G8FA 5J2NA 3OY9A 3IS9A 4ELVA 1S1VA 3C6TA 1W0HA 3OS1A 1SL0A 2YKNA 4HHTA 2VG6A 4EP5A 1QTMA 3SQ0A 4RG8A 3AVKA 1D9DA 3MXMA 4XIUA 4HTUA 1JLCA 4KPYA 4KHUA 1TL3A 4LY7A 3RR7A 4C8MA 3SZ2A 3CYMA 4IKFA 1WSEA 4B9MA 2OZMA 1HYVA 2O4IA 3LP2A 4CGJA 2G8WA 2QK9A 1JL2A 4BWMA 4KKOA 1C1BA 4J2BA 1ASVA 1EXQA 1T03A 1RDBA 1WSHA 1JKHA 3O3FA 2QKKA 4QOZB 4FJJA 2NUBA 4CJ3A 1N5YA 3QESA 4DQPA 4F4KA 3K59A 3NH2A 4F3TA 4Z4EA 1J5OA 5CY4A 2FC0A 4CGIA 4KI6A 3ULDA 5FRMA 1NK0A 4RW7A 3L2VA 4RW9A 1VSDA 3MECA 4H8KA 2EX3A 3M8QA 4DSEA 4DQSA 4M3XA 2X6SA 1T7PA 4CEBA 3TAFA 3AVGA 3T19A 1KSPA 4F2RA 1J9AA 5KGXA 3VQEA 2RN2A 1YTAA 4IG0A 3HP6A 1C0UA 4FJHA 2Q3SA 4YNQA 3EZ5A 5CZ2A 4W5OA 3AO4A 1JLAA 2Z1IA 2ZQBA 3I0RA 4TSXA 3OYIA 1S9GA 1HMVA 1YVUA 4JLHA 1B92A 1RDAA 2Z1HA 4UQGA 1KRPA 4C8KA 4K8ZA 1IH7A 5T7BA 4B9UA 4OLBA 4FK0A 4HUFA 1NK8A 3U3GA 3OYKA 3EYZA 4CF8A 4I2PA 4OPKA 1VRTA 1C0MA 3QIOA 2D0CA 3CFOA 4CHNA 1KVBA 4OPJA 3V9XA 3SJJA 3PX6A 4NCAA 4CJ4A 4E19A 4R5PA 3KK1A 5EU7A 1FXXA 1VSKA 2WONA 4DTRA 4DSIA 3F73A 3DMJA 1BL3A 2YV0X 1JXEA 2IDOA 4CESA 1UA0A 1VSEA 3LALA 1RDCA 2DFHA 1MU2A 2RF2A 3NFAA 4FM0A 3HPHA 1NJZA 1IG9A 1D9FA 3TWHA 2PYLA 3V9SA 1J54A 3NGIA 4FZXC 1JL1A 3PX0A 4CJQA 2BDPA 4O44A 3NE6A 1O1WA 4KHQA 1TL1A 3MXJA 5KI6A 4CEFA 4N5SA 4FLVA 2HHTA 1EKEA 3NH1A 4LD0A 4FW2A 2XY5A 3HPOA 1ASUA 4O55A 3ZSYA 1NKEA 4CGHA 2YHAA 4AHVA 1RILA 4FXDA 3K57A 3NF7A 4I2QA 1LW2A 4IDKA 3VQ6A 3VQ9A 1EX4A 4BE2A 4DTJA 1QSYA 5CZ1A 3NF9A 4HVJA 3KLGA 1RT5A 4CEOA 4F2SA 4CK1A 1RT6A 3HVRA 1TV6A 3ZT3A 1RBSA 4E1MA 1CXQA 1CZBA 3AVJA 4N47A 3OYHA 1REVA 3AVNA 3EY1A 2ATQA 3VN5A 5HP1A 4KAZA 3QLHA 4DU4A 3P1GA 4OKEA 5FDLA 4FLYA 1NKBA 3RTVA 1NKCA 3PY8A 3NF6A 2D0BA 4L8RB 1IKXA 1BISA 3KD5E 4DLEA 3SPYA 4YFUA 4DU3A 2OPRA 5D3GA 2E6MA 3QETA 3NHGA 4FJ8A 3SQ2A 1HRHA 3HPGA 2VWKA 3RMBA 4Z4IA 4CJTA 2HHQA 4RW8A 1VSJA 3FFIA 2DFEA 1ZBIA 3H08A 1IO2A 1Q9YA 3V9WA 4DQQA 3AA3A 3SNNA 3C95A 3VQ5A 2F96A 1XC9A 4DTSA 2XRIA 3SUPA 3KD1E 4DF8A 1KLMA 1NOYA 3OS0A 4Y1DA 4KREA 2Y1JA 3MXIA 4W5TA 1SKSA 3QEVA 4PA1A 1ZBFA 3OYMA 1NJWA 3KLHA 2KTQA 4AHUA 4PUOA 2HHVA 2KZMA 2DTUA 1HPZA 1Q8IA 3ZT0A 1X9SA 1RBRA 5HROA 4C8LA 2YNFA 3C6UA 4Z4FA 3NGZA 4EP4A 4E7KA 2YNIA 3QNOA 3B6PA 4DFPA 2HVIA 4CECA 1X9WA 4OLAA 3G0ZA 4M3TA 4E7JA 3TR8A 5SZTA 4B9SA 4ELUA 4CJWA 2W42A 4FJKA 1YT3A 3VQCA 1RTHA 2G8KA 4CGDA 2RPIA 2HHXA 4CFBA 1TAUA 1QQCA 4DWIA 1TKTA 1S6PA 1TKDA 3OYGA 3NBPA 4CF1A 4PY5A 4OJRA 4CJUA 4W5RA 3O3HA 4DS4A 1RDDA 3LANA 2R7YA 3V81A 1NK5A 2PYJA 3OYFA 4DLGA 3RWUA 4HCCA 3KJVA 4Q0BA 3IG1A 4KI4A 4CK3A 1KTQA 4CJRA 4KB1A 4B9NA 3SQ1A 2HW3A 3JSMA 1DTQA 4AH9A 1A5XA 3I8DA 1TK8A 1S1UA 3D45A 4FZYA 1NJYA 3OYEA 2VG5A 2AJQA 1X1PA 4CEEA 1NK4A 5C42A 1ZYQA 4CF0A 2E4LA 2KFZA 4OKJA 3SUOA 1L3VA 3O4NA 3K2PA 3SI6A 2HB5A 3MAQA 1EETA 4BE0A 4FJ7A 1BI4A 4FJ9A 4CHQA 3QEIA 3PO5A 2OYQA 1BIUA 5C24A 1ASWA 3ZCMA 4GVMA 4FLXA 3NDKA 3AA2A 1GOCA 5HBMA 3VA3A 3B6OA 1BQNA 1SL2A 3TAQA 1SKWA 1WN7A 3DOKA 4AHTA 4Z4CA 3HL8A 4B9VA 3QEPA 1FKOA 3AVMA 4CJVA 4KHSA 3OYJA 4JRPA 2P5OA 3TAMA 1K6YA 4E3SA 3DRSA 4DMNA 2XY8A 1LWCA 3ZSXA 1BGXT 4I9QA 1A5WA 4KFBA 4CHYA 2FBVA 4CFAA 1D5AA 3HVTA 2B4JA 5SWMA 2A1SA 5J2QA 5HRSA 1NK7A 4FJLA 4DTPA 5KGWA 2KQ2A 1JLBA 4W5QA 2A1RA 2P1JA 4NCBA 4M3ZA 3OYLA 4M41A 5J2MA 2E6LA 3NGYA 5FROA 1S9EA 3QEXA 3TANA 3ZSZA 2B5JA 3AVFA 2X78A 4AILC 2G8VA 3AO1A 1VSIA 3AO5A 3DI6A 1BCMA 1LWEA 2XO7A 3K5LA 3VQ8A 4CJSA 1WSJA 4QCLA 1I3AA 3E01A 3LPUA 1HJRA 1HYSA 3JYTA 4DSLA
chains in the Genus database with same CATH superfamily
1FW6A 1CXUA 3AVAA 1YVNA 3DLBA 4RW6A 5M1FA 1HKCA 3BZCA 4DR1K 4KTWA 3ZETA 3VA0A 4CD3A 1T6DA 3CC7N 4CIEA 4YOTA 4GY2B 1DT9A 1WSGA 1XHZA 4LFAK 3CG7A 2IVOA 4BREA 1SL1A 2NRHA 4BQLA 5C12A 3A2FA 3S3NA 2O8DA 1VQ8N 1ZBLA 1SZ2A 3WEEA 3ZLJA 3UIQA 5FRNA 4FLZA 3VQ7A 4JKCA 1KAXA 1QQNA 4KV8A 4FJIA 3DXMB 1YJNN 2UUAK 4DFKA 3LAKA 1IV0A 5IT9O 4JHDB 1RT4A 4ELTA 1KCFA 4B1YB 4JD2B 4H0VB 3U9DA 1CLQA 3GBTA 4ILHA 3SMSA 5EVZA 2UUBK 5M1QA 1KVCA 2ZWHA 1NMNA 4H0XB 3P5JA 4JKHA 4B9QA 4X66K 4JS4A 4M3WA 4BC5A 3TABA 3RMCA 1NWKA 1S1WA 3SV4A 4C1NK 2E1ZA 1C0TA 3K9JA 4E1JA 1E4GT 3SUQA 1TGOA 3ID6A 4CEDA 1L3SA 1WB9A 1HYSA 3P83D 1IKYA 4DSFA 4CERA 4CEZA 1FK9A 3QINA 3OW2M 3P38A 1HNWK 1JLEA 3ZSQA 1UWBA 4IDHA 1HQUA 4J2EA 3OS2A 4BE1A 4B9TA 2QEXN 3TSQA 4B3TK 1UAXA 2NRXA 2P9UA 3KHYA 5AQGA 4C8NA 2G8UA 3QB0A 1RT3A 5DMRA 3S3MA 1GOBA 1DTTA 4LH5A 3CCEN 3LP3A 4PHTX 2P9LA 2XY6A 1MWMA 3OJSA 3KLFA 2HHWA 4BR7A 4ZTJA 4HWIA 3CETA 1U04A 2DPNA 3I55N 1EP4A 3E66A 1LV5A 4FZZA 4CD1A 1XHXA 1YIJN 4BR4A 1ZBHA 1NGIA 4E89A 3TSPA 3THVA 1XUPO 3K5NA 4FLUA 2O4GA 4FJNA 4A61A 4HCBA 3J7YP 4JI5K 4FJXA 4FPAA 3KIOA 1YHQN 1LOTB 3AAPA 4E0DA 3PIOL 3CJCA 3RSEB 3VEOA 4WFNL 3I8BA 1LAWA 5C2DA 3ZETB 5FPMA 2O8CA 1U4BA 3G25A 4FVMA 3HP9A 3R8EA 2P5GA 1W97L 4E7HA 4FJ5A 1YJWN 4DSJA 3VQDA 1D8YA 4CJPA 3SCXA 3TI0A 2O8DB 3KK2A 4ZTFA 3ZSOA 2QWMA 2G8IA 1A5VA 1NGCA 3SPZA 2DY4A 1R59O 4CF2A 5AQPA 2OPPA 4CIGA 1N32K 3HSTB 1NGBA 3FZHA 3KKSA 4IFVA 3L2UA 2GELA 3AVIA 5LMUK 3OJUA 2X74A 1Q9XA 1R0AA 1EWRA 2IAJA 3CJ9A 1B9DA 3EE9A 3TAPA 4DUYK 3MCAB 3GDQA 5I3UA 1MDUB 3LDOA 3KVGA 3K0SA 3LZJA 4JI1K 3CCRN 3O3GA 3PV8A 1OH5A 4JK7A 4LF5K 5DM6L 1GLDG 4H5RA 2Z1GA 4YDUA 5AQFA 4DSKA 2HHSA 4YORA 4DFMA 3AARA 4DTMA 3ZEUA 4DS5A 2EHGA 2VQFK 2NRVA 4C8OA 3L6QA 1WLJA 3VQBA 2A41A 1SUQA 3QIPA 1HQEA 3L2QA 4CHOA 4FWMA 3CMAN 1Z25A 2I7NA 2FSNA 4KB0A 3IRXA 5GINA 4LF7K 3OY9A 3IS9A 1SL0A 1QTMA 2VG6A 3FR0A 3SQ0A 4O5FA 3MXMA 4XIUA 4HTUA 1TL3A 4LY7A 2P9UB 3RR7A 3P31A 3A8YA 3AGRA 2OZMA 3LP2A 4CGJA 4L3QA 2QWOA 4WQ5A 1C1BA 3C6AA 1T03A 1WSHA 1T6CA 1JKHA 3O3FA 2QKKA 2FSKA 2E2NA 2BH1A 5AR0A 1U2VA 4DQPA 4F4KA 4Z4EA 2P9LB 1J5OA 3ULDA 4H8KA 1HKBA 3M6GA 5JICA 4DQSA 4M3XA 5H1SQ 5C2FA 4IOXA 1KSPA 4F2RA 5KGXA 4DCHA 3VQEA 4DB3A 5CZ2A 3DJCA 1YVUA 4K8ZA 1KRPA 4XH5A 1GLLO 4BRNA 3EYZA 4CF8A 3CPWM 3PIPL 2D0CA 4OPJA 3ENHA 2FF3B 4CJ4A 4R5PA 1FXXA 2YI1A 2Q2RA 3F73A 3D2EA 1UA0A 3LALA 1RDCA 3NFAA 3HOSA 4FM0A 3TWHA 4FZXC 1JL1A 4JYAK 2I7PA 4FLVA 4LFBK 1EKEA 2CGKA 4NLCA 4LD0A 3T69A 4FW2A 2XY5A 1NKEA 3ZSYA 3SBTA 3K57A 3CF5L 3VQ6A 5M1OA 1EX4A 3VMFB 4BE2A 1Q81O 3H3NO 4B3RK 2BUPA 4F2SA 4CK1A 1RT6A 3HVRA 1J5EK 4PKHA 1RBSA 4E1MA 1K8KA 3OYHA 4N47A 3VN5A 4JK8A 5GAHP 4KAZA 4K43A 2ZJPL 2F9TA 3BY5A 2D0BA 2E2PA 2CGLA 4RTFD 3RMBA 2HHQA 4DR6K 3EEQA 3BF3A 4H5TA 3FFIA 2DFEA 1IO2A 4CBUA 1Q9YA 3V9WA 3AA3A 3C95A 2F96A 3KD1E 1KLMA 1NOYA 1QVFM 2Y1JA 3MXIA 4W5TA 5BRHA 3H1QA 2HHVA 3CI5A 3SJHA 5HROA 3ZEUB 3C6UA 4Z4FA 4Y0WA 3VPZA 2Q31A 3QNOA 4DFPA 1GLFO 4CECA 4B9SA 4ELUA 4ISFA 2W6KA 1XNRK 3VQCA 1RTHA 4DR4K 3VEYA 4FOEA 4CF1A 3MN6A 3OYFA 3KJVA 3FZLA 4EHUA 4KB1A 4B9NA 2HW3A 3I8DA 4IEEA 1NJYA 3OYEA 2VG5A 4MDBA 1SAZA 2AP1A 1BOTO 1NK4A 1ZYQA 1U2VB 3CJ7A 4OKJA 3FFKB 3K2PA 3SI6A 2HB5A 3MAQA 5LJVA 4BE0A 4FJ7A 1BI4A 4FJ9A 1EO1A 3LM2A 4GV3A 3NDKA 2V7YA 1SKWA 2ASMA 3HL8A 3O1WA 3WXLA 4WCEL 3OYJA 2P5OA 2XY8A 3ZSXA 3WUHA 3LL3A 1MA9B 5KGWA 3WXJA 3HBTA 3OYLA 1V4SA 3VF6A 3J7AP 4F3TA 4YY3K 2X78A 3U6FA 1LWEA 2O8EA 4QCLA 2QA4N 3CJAA 4DSLA 3LDPA 1N6QA 2F7TA 4ID1A 3RR8A 3CM6A 3VOVA 1EWQA 4H4MA 4IJAA 1NLVA 4BRMA 1NMDA 3L3VA 1NGFA 1TUYA 1LAVA 5C15A 2RHKA 1RBTA 4A57A 1NK6A 1WAJA 3K9KA 4JNEA 4GKJK 1K8KB 4LSNA 5BN8A 3QNNA 4CK2A 3KTQA 4B8AB 5BPMA 1VQON 3DLGA 4GMJB 2UYTA 1M90O 4GKKK 4H0PA 4OVLA 2YNHA 1C0GA 3M8PA 2OA8A 4KHYA 3WNFA 1S1XA 4O4GA 1TUUA 1L3UA 2ZGYA 4H0YB 2P9SB 3RMAA 1Z6RA 4M45A 2UXDK 4FLTA 1ATRA 5GIPA 4NLBA 1OKJA 3D0PA 4JRQA 2OPQA 4Z0UA 3VQQA 4O0JA 3KLIA 2ASOA 4OGCA 5HOOA 4WYBA 4LH4A 3BF1A 1F21A 1VQ6N 5KPTA 2JLEA 2KW4A 1KAYA 3RMDA 1XQSC 4A62A 2FBYA 3AVBA 5AQVA 3ZSWA 4YOXA 5AZJA 3LWMA 1QHAA 1VSLA 3QFUA 1TK5A 1RT7A 1JLGA 4FM2A 3BDPA 3TAEA 4J2AA 4K41A 1HUXA 3H45C 5BRDA 5JLFA 4CHZA 2G8HA 4OKKA 1LCUA 4MQ3A 2D5RA 5BREA 2ZJQL 5TKYA 3R9PA 3W3DA 3SUNA 4LF6K 5JS1A 1X9JA 1G15A 3DRRA 4G1QA 4QS7A 1BHLA 4WQ4C 4FYDA 4U67L 1U49A 2QWPA 3IKMA 3E9LA 1BI4B 2V51B 1U47A 1SKRA 2HMPA 3AVHA 4IO9L 4DV6K 4MO4A 3HT3A 4WQ4A 5HRPA 2E2QA 3KKRA 3LP0A 5AQUA 1DLOA 1H1VA 4CE9A 3CCUN 4FK2A 2Q0UA 4MLEA 4A5BA 1WAFA 3GE1A 1SQKA 1SV5A 4EZ6A 2B6AA 2KFNA 3LZIA 2O8EB 3VGKA 1CZ9A 4BQZA 4ICLA 1TVRA 1Z26A 2GUPA 4M3RA 3CQ8A 2ZF5O 2GV9A 2YHBA 4AHRA 3SMPA 4FM1A 4N56A 4YOUA 2XHBA 3NAEA 4DU1A 3VEXA 3L2RA 5KRSA 3DLRA 4CJLA 4RCHA 2FLOA 4W5NA 4KHWA 5AQQA 3HSCA 3TTFA 3THXA 4DTXA 3F2KA 1BQMA 3CFPA 3PLAA 1ZBSA 3BUZB 4Z4GA 3D6RA 3OYAA 1WNSA 4BR9A 2YNGA 4B1VA 4FW1A 3PO4A 2A5XA 5AQRA 1Y64A 4EZ9A 3L4IA 4RWTA 4KRFA 4CGGA 1QQMA 2LSNA 3CM5A 2CH5A 4LSLA 1QQOA 2JWKA 4I9LA 4BACA 4BWJA 5J2PA 3L8BA 5JLHA 3U3YA 4A2BA 1Q86O 3MX5A 2QW9A 4BC3A 4FJMA 1ITGA 4AM6A 3ZYYX 3QEWA 2O8BA 2IOCA 1RTDA 1GLJO 4DQIA 3AA5X 3CERA 4CZGA 5AZJB 4PWDA 3O4WA 4LF8K 2HNDA 4IBNA 3ZSVA 3AVCA 1KD1O 4CZJA 5AQOA 5AQXA 4CFCA 1BG3A 4YOWA 3L3UA 2G8FA 2CH6A 4NXNK 4ELVA 1XNQK 3O9TA 3AVKA 1D9DA 1KQSM 4BRPA 3QICA 3NVMA 4FPBA 5MLCQ 1JLCA 4KPYA 2W6LA 4DR5K 4C8MA 3HTVA 4CBWA 4BWMA 3H3OB 4J2BA 1HPMA 1DEJA 3VEWA 4FJJA 3QESA 3NH2A 2KKZA 4CGIA 5FRMA 4RW7A 1OVYA 4RW9A 4UY8O 1O13A 2EX3A 1BWFO 4M63C 1XC3A 3J8AA 3TAFA 2RN2A 1YTAA 4IOCL 1C0UA 4FJHA 2PAVA 3CPEA 3AO4A 1JLAA 2Z1IA 2ZQBA 4WFAL 4LF9K 2IIRA 1S9GA 4EAHD 4C8KA 1NGJA 4B9UA 4FWRA 3O6WA 4FK0A 4HUFA 3MN5A 1NK8A 4QS9A 1V4TA 4I2PA 4OPKA 3V9XA 3CFOA 1KVBA 1Z05A 3PX6A 1EQYA 1NGHA 4JKFA 1VQPN 3THYA 1P90A 2YV0X 4CESA 3TTDA 1VSEA 1VAZA 1MU2A 5TKWA 4BRKA 1J54A 3NGIA 4CW7B 3HZ6A 4LFCK 3FLCO 3PX0A 4EIAA 4KHQA 1TL1A 4N5SA 2HHTA 3NH1A 2PFUA 3THWA 4JI8K 1HX1A 3AY9A 4AHVA 4FXDA 2ZJRL 3E1YA 5CZ1A 4JV5K 3KLGA 5BN9A 3THXB 3UE5A 3EZWA 1CZBA 1RFQA 1JCGA 4JI6K 3EY1A 3M5RA 3QLHA 1NKCA 4L8RB 3RTVA 3PY8A 3SPYA 4DU3A 3KZBA 4YDUC 3QETA 5LL6Z 4IOAL 4FJ8A 2NRWA 3SQ2A 1HRHA 3EE8A 3ZX3A 4BGAA 4BRCA 1ATNA 3OTOK 1VQ7N 3CCLN 1IBLK 3SNNA 2W41A 1XC9A 1Q82O 3TPQA 4DTSA 2XRIA 3E9OA 3CHWA 4A59A 3QMLA 5LY3A 3QEVA 1NJWA 5AQKA 3OYMA 2O8BB 3NMUA 1I94K 5GIOA 4OX9K 4JI4K 3CCVN 5AZIA 2WFBA 4E7KA 2YNIA 4AF1A 2QXLA 4WQ5C 5AQTA 5ADXH 4CJWA 3CMEN 4BGBA 3P39A 3CCSN 3FE1A 2G8KA 3A5OC 4BC4A 2HHXA 3ATVA 1S6PA 4KHPK 3OYGA 4W5RA 4DS4A 3O3HA 2PYJA 3LANA 4JK9A 2R7YA 4O8UA 3J80O 3TSUA 4OO1J 3C6HA 3ZX0A 1A5XA 4NXMK 5AQYA 4FZYA 2AJQA 1X1PA 2Q36A 3SUOA 3IMXA 1L3VA 4JKBA 1WUAA 3PO5A 2OYQA 4XH4A 1GLCG 5C24A 1ASWA 3ZCMA 5EY4A 4GVMA 1OH7A 1GOCA 3ENBA 3VA3A 1SL2A 1ZXOA 3DAWA 4B9VA 1FKOA 4CJVA 4KHSA 1VQ9N 1K6YA 1FJGK 4DMNA 3HOTA 5AQLA 3HRGA 1A5WA 4KFBA 2FBVA 4CFAA 1D5AA 2B4JA 2YHWA 4U7BA 4NCBA 1JLBA 2A1RA 2P1JA 3CCJN 5J2MA 1W7AA 3NGYA 3VERA 1VQNN 3TANA 3ZSZA 2B5JA 3AVFA 3THYB 3AO1A 3K5LA 2GTDA 3VQ8A 4CJSA 1WSJA 1I3AA 3LPUA 4BRQA 5HL7L 4JEPA 3JYTA 2D4WA 5C25A 4H4OA 4GNIA 5LMNK 1KLNA 3M8SA 1BO5O 1RCHA 3T7ZA 3THWB 2CGJA 3MEDA 4F8RA 4DQRA 4FJGA 1QVGM 2GWJA 4QS8A 2QKBA 2BE2A 4ISGA 3ULEB 1L5UA 1RDUA 3TTCA 4CZMA 1P8ZA 4BRHA 3FZFA 3LP1A 2OPSA 1NNEA 4BRLA 5KQDA 2P9NA 4K0KK 4DR7K 4B1XB 3SAFA 3IDHA 2VQEK 2F8SA 1WOQA 2P9SA 1FKPA 3OA9A 4CEQA 3WQTA 2O8FA 4Y1CA 1NM1A 3RVCA 4B9LA 3MEEA 3K5OA 4A5AA 4CJFA 1XI1A 1RNHA 1QE1A 3JXUA 4N76A 3UKRA 1ZC6A 1RBUA 4DUZK 4V19S 1BCOA 1LW0A 4MFBA 5AZIB 1UA1A 1HNIA 4B1UB 4JKEA 3JS6A 3AGKA 3H6EA 4A2AA 4CFDA 3DOLA 2ITGA 3AVLA 3ZSRA 3MX2A 1BIZA 5CR4A 5I9EB 4DF4A 1RDWX 5E84A 3NCIA 2BTFA 1T8EA 4NYFA 5JS2A 2FSJA 4H0OA 3JAMO 2PY5A 1J6ZA 3OVNA 3T1HK 4FLWA 3DYAA 1X9MA 5M1KA 3OYNA 4M3YA 2OTLN 4ISEA 3AA4A 1ESVA 3T1AA 3FZMA 2JWLA 3O8MA 4N41A 1SS6A 4CEAA 4CZIA 3DLKA 3TARA 4MLHA 3CQXA 3ITHA 3I0SA 2V52B 4B08A 1KFDA 2P9IA 1TKXA 3WXKA 3CJBA 1BA0A 3WXMB 4JI7K 2FBTA 2IC3A 2HVHA 3LDLA 2XY7A 3OYCA 4M3UA 3ALYA 4NO7A 3L0QA 5C10A 4YOYA 2YCHA 3HO1A 3QERA 1JLFA 1Q7YO 1HYZA 2F4VK 4JS5A 4DFJA 3EO3A 4BROA 2RE2A 1M1KO 3F5TA 3HYFA 3LPTA 4KHNA 2F8TA 3O4QA 3HM9A 1C1AA 2IS3A 3VESA 1QHTA 4ID5A 2I5JA 3VGMA 2A40A 2PZSA 4NYNA 3WQUA 4H03B 4K42A 4BG9A 3F9KA 5AFUA 1KFSA 1L3TA 2HF3A 2QTDA 1VSFA 2E20A 3CC4N 4DG1A 1J53A 1RT1A 3V1RA 4JI0K 1HNVA 3KK3A 1B9FA 3U9ZA 2Q97A 3V6DA 3TU5A 4Q5VA 1VSMA 3RRHA 4BDPA 5FLXO 2WOMA 1RBVA 4YOVA 5LJWA 3DLHA 1UOCA 1NU0A 1NK9A 3V9UA 3P4IA 3MN7A 3R6MA 2UXCK 3S9HA 2RKIA 4WE1A 2P9NB 3CJ1A 1XWLA 3HI0A 4FK4A 1MWKA 4H0TB 2X6NA 2O8FB 4IFYA 3M1FA 4KTQA 2YJFA 3OYBA 2HHUA 1C0FA 1S22A 3AO2A 3KK7A 1I39A 3QO9A 4RW4A 3UKRB 2HNYA 1U45A 5FPEA 2J4RA 4DQ8A 1RTIA 3ATUA 3LAMA 4CHPA 1VK0A 4DR2K 5J1EA 2VWJA 3T1YK 5CYQA 1VSHA 1TYQA 4I7FA 3QFPA 5HRRA 1N36K 2FBXA 3Q7CA 1NOZA 2WBNA 1VQ5N 1IKWA 3HJFA 3K58A 1T05A 4BC2A 4BR5A 5KQ8A 2YKNA 4HHTA 4EP5A 4LF4K 2OCEA 5GAGP 3N4QA 4KBOA 1WSEA 1YJ9N 4B9MA 4PL8A 4XEIA 2ITMA 3MMVA 2QK9A 1ASVA 1RDBA 1YITN 2NUBA 4MDAA 1VQ4N 3K59A 3S41A 5CY4A 4KI6A 3O80A 2P9IB 3L2VA 2VYPA 3IUCA 3MECA 1KXPA 2X6SA 1T7PA 2NNWA 2YJEA 3AVGA 3T19A 1J9AA 4Z94A 1IJJA 2D1KA 4JI2K 4YNQA 3EZ5A 2E1YA 3I0RA 4AQYK 4JLHA 2Z1HA 1RDAA 2P9KA 4J8FA 5T7BA 4F9OA 4JKAA 3OYKA 4BRFA 1VRTA 1C0MA 3QIOA 5CHIA 3SJJA 4NCAA 3BEXA 4E19A 3KK1A 5EU7A 3UB5A 1VSKA 4DSIA 1GLBG 2KLAA 4FVUA 3DMJA 1BL3A 1JXEA 2IDOA 4IEIA 1VHXA 2DFHA 2RF2A 3VEVA 4CJ7A 1YXQA 1D9FA 2HHHK 4CJQA 2UXBK 2BDPA 3D2FA 1K8AO 3MXJA 4CEFA 1OVQA 3HPOA 4O55A 2YHAA 3WT0A 2IVPA 3NF7A 3O9QA 3VQ9A 4IDKA 4DKWA 4BRGA 4CVNE 1YF5L 5GAEP 4M7XA 1ILYA 1RT5A 3ZT3A 4CZEA 1CXQA 3A5LC 1BU6O 3CCQN 3AVNA 5A2QO 1W2BM 2ATQA 5JVGL 5HP1A 1NKBA 3P1GA 4OKEA 5FDLA 4BVPA 4FLYA 1BISA 3KD5E 3GL1A 4DLEA 5F1XA 2OPRA 2E6MA 3NHGA 1K73O 2UUCK 1E4FT 3AAQA 3HPGA 4Z4IA 4RW8A 1ZBIA 3H08A 4I6MA 4DQQA 3VEZA 1Q18A 5AQMA 1IG8A 1NGDA 5GADP 2Q0RA 3BP8A 2QM1A 4IO8A 4DF8A 5FPNA 2ZGZA 3OS0A 1GLEG 4KREA 3VTHA 1SKSA 4PA1A 1ZBFA 2KZMA 2DTUA 3KLHA 4DV7K 4PUOA 1Q8IA 1TYQB 4XH1A 3ZT0A 1X9SA 1RBRA 2YNFA 3A5NC 3NGZA 4EP4A 2HBJA 3O9SA 2HVIA 1X9WA 4PKGA 4OLAA 4E7JA 5SZTA 2D0PA 3CXCM 4DHYA 3KWIA 2W42A 4NB4A 4CGDA 2RPIA 3O08A 4FWKA 1QQCA 1TAUA 4DWIA 1TKTA 3O9RA 5AQIA 4DV0K 1TKDA 4PY5A 4OJRA 4CJUA 3V81A 1RDDA 4HCCA 4Q0BA 2OTJN 3CCMN 2NRRA 1HNZK 3SQ1A 4AM7A 1TK8A 1S1UA 3W0LA 2F9WA 4HTLA 4CEEA 2E4LA 3Q7BA 2KFZA 5BR8K 1QZ6A 3H1VX 4K25A 2OANA 3QEIA 3SK3A 1K9MO 3AA2A 3GG4A 5HBMA 3TAQA 3DOKA 4Z4CA 3QEPA 4ILJA 4JI3K 3QBWA 3TAMA 2P9KB 3DRSA 5E26A 2FXUA 3ID8A 3HVTA 5AJ3K 2A1SA 1S3XA 5HRSA 1NK7A 4DTPA 2QWQA 4ILGB 2E6LA 5FROA 3QEXA 3QDKA 4AILC 4JKGA 1VSIA 1BCMA 3E01A 5M1PA 1XMQK 1HJRA 1N5YA 5B8HA 2BGGA 2A6AA 1TAQA 3DLEA 3MDQA 3LWLA 2QWRA 3D2FB 5KTQA 4C1NI 3HXMA 3T3FA 3M8RA 1RGIA 3IAYA 1YTUA 4K8XA 2HMIA 4ZHRA 5K14A 3ULEA 4YHHK 3KWGA 4IXCA 4BRAA 3CIPA 1VQMN 2VGNA 4Z4HA 1XMOK 1DGKN 3H46O 1BDGA 1RT2A 3VTIA 4CF9A 1Y97A 4O0IA 1X3NA 4IG3A 4O5BA 2NRTA 1HLUA 5KPRA 3SQ4A 4NCGA 3WEEB 1NGAA 4PQUA 4DV3K 4GVEA 3ENOA 3HK2A 4I6MB 1U48A 4HUGA 3VETA 2P9PA 4B8CA 1KVAA 2GBZA 3V1OA 4CCHA 2WC9A 1YAGA 1S1TA 3C7NA 3PUFA 3VQPA 4KH5A 3VQ4A 3K5MA 2YHXA 2OZSA 2DFFA 3S3OA 3V9ZA 4QAGA 4DR3K 1X3MA 2YKMA 2QWLA 2H3GX 3DM2A 3LDNA 4GV6A 2BANA 1TKZA 3O5BA 2EWSA 3LDQA 1YI2N 5CE3A 3UKUA 4E7IA 4IFEA 4KTZA 2VG7A 4M42A 1TK0A 1IBKK 5ADXA 1VQKN 3EKSA 5DK5A 4AHSA 4DV4K 4CJEA 3BZKA 3J81O 5BR9A 3MK6A 4B3OA 2YHYA 4BDZA 3O1BA 4F3OA 4O8KA 2Z1JA 4CGFA 4BR2A 4CJKA 4PL7A 3V4IA 4FO0A 4DTOA 4R79A 1QZ5A 3B8AX 1N34K 4CJ5A 3PX4A 1D4XA 3EKUA 5E41A 3OHRA 4PKIA 2WTUA 1QSLA 2KHOA 1KC8O 3LDSA 5FPDA 1ZBUA 2HOEA 3V1QA 3WNGA 3QBXA 4BRIA 2E2OA 3NH0A 2UU9K 3SV3A 2JGUA 3RRGA 1CZAN 4FOIA 2IGIA 5F2RA 4IWVA 3C0BA 3R1XA 3WNEA 3G6EN 1NGEA 4DV2K 1S6QA 5IWAK 4JN4A 3SAHA 1G99A 3D7EO 5AQJA 5JVHL 3I33A 3A0IX 4BVOA 3L4QA 4JKGB 3L2WA 3C94A 3VQAA 2GUIA 3CQYA 3CFRA 3M3ZA 2Y1IA 1QS4A 1S5JA 2NLXA 1JLQA 3AO3A 3WNHA 4KH6A 4CZFA 4M7YA 1T3VA 4BDYA 3NF8A 1IKVA 4FWOA 2QI2A 1NJXA 3MCPA 5EXWA 3ZT4A 2O8CB 3ZT2A 4DTUA 2W40A 5AQNA 2IVNA 3ASMA 4FWNA 3SYZA 4E1NA 2GEMA 4FWQA 3OYDA 4E7LA 1T44A 3WXIA 4HUEA 5BPLA 4KH4A 3DRPA 4J2DA 1GOAA 5ELZA 5HLFA 1QSSA 4FCYA 3ZT1A 4GW6A 1IBMK 1C1CA 1NGGA 3G10A 5I42A 3MEGA 2HF4A 5HRNA 1VRUA 3BGRA 4DV1K 1W9HA 4GV9A 2P9PB 2VWBA 1NBWA 3TAGA 1JXBA 2P51A 3C7NB 1C6VA 3AV9A 2FF6A 4KO0A 1WSIA 2KZZA 5CYMA 4BG8A 4CIFA 1RTJA 3KLEA 2QWNA 2ZD1A 2HSTA 2ZE2A 4DTNA 3VGLA 4WF9L 2HNZA 4OGEA 1LWFA 5KRTA 4X64K 2QXFA 1WSFA 4BRDA 2AA4A 2ETJA 3UKUB 1HR0K 4AHCA 3EN9A 4FWLA 2D0AA 3ISNC 4B1WB 2PBDA 5J2NA 1S1VA 3C6TA 1W0HA 1YUWA 3OS1A 3MWPA 3I56N 4B3SK 4RG8A 3ZX2A 4LC9B 3VF4A 2HBKA 4KHUA 3U8XA 1OH8A 3SZ2A 3CYMA 4IKFA 5C0YA 2O4IA 1HYVA 2G8WA 1JL2A 4KKOA 4BR0A 1EXQA 5DM7L 4QOZB 4X62K 1VQLN 4CJ3A 2E8AA 2FC0A 3SLCA 1GLAG 1NK0A 1VSDA 2ASPA 3M8QA 4DSEA 3VENA 4JAXA 4CEBA 3GOIA 4DV5K 4IG0A 5JMVA 3HP6A 2Q3SA 2YX6A 4W5OA 4TSXA 3OYIA 1HMVA 4H5WA 1B92A 4UQGA 1S72N 1IH7A 4OLBA 1E3MA 1BUPA 3DWLA 2A42A 3U3GA 4FWSA 4CZLA 4CHNA 2NRZA 4CZKA 3DXKA 2WONA 5F0XA 4DTRA 3NVKA 1NJZA 3HPHA 5AFUH 1IG9A 3D2EB 2PYLA 1WBDA 3V9SA 4OPHA 2V7ZA 3FZKA 1NJIO 1JCFA 4O44A 5M1NA 3J7ZO 3NE6A 1O1WA 5KI6A 1N33K 4OPAA 1ASUA 3CC2N 4CGHA 3OBYA 1DKGD 2HBMA 1RILA 3F9MA 3G71N 2GWKA 4I2QA 1QSYA 1LW2A 4DTJA 5AQZA 4H5VA 3NF9A 4HVJA 4CEOA 3E9PA 1OH6A 1TV6A 5BPNA 4B1ZA 3AVJA 1REVA 1KAZA 5AQSA 5KPZA 4DU4A 2WUSA 3NF6A 4B3MK 1IKXA 4YFUA 5D3GA 3CD6N 1JJ2M 2Q1NA 5EOYA 2VWKA 4CJTA 5AQHA 4EHTA 1VSJA 3DXMA 4JKDA 3MN9A 3R3LA 3HM8A 3C65A 4FSVA 3SBGA 4JHDA 3VQ5A 3VF2A 3SUPA 4JD2A 1HNXK 4FL9A 4IJNA 4Y1DA 3DLLL 4H5NA 2KTQA 4AHUA 1HPZA 4FWPA 1N8RO 4C8LA 4WFBL 1JCEA 3G4SN 2A3ZA 5BRFA 3B6PA 1BA1A 3G0ZA 4M3TA 3PSIA 3TR8A 3PSFA 4CZHA 4FJKA 1YT3A 3FGUA 3SAGA 1NG9A 4CFBA 4EFHA 2E5LK 3NBPA 1U6ZA 4IZ9A 1NK5A 3RWUA 4DLGA 3IG1A 5AQWA 2VCPA 4KI4A 4CK3A 4G9ZA 1KTQA 4CJRA 3U4LA 3JSMA 1DTQA 4AH9A 3D45A 4CI6A 5C42A 4CF0A 2D0OA 2E88A 3O4NA 1HJOA 1EETA 3OBWA 4CHQA 1WBBA 4CBXA 1BIUA 4FLXA 4BY9C 3IFRA 3O9UA 3B6OA 1BQNA 4X65K 1WN7A 4AHTA 3AVMA 2HBLA 3N4PA 3LM9A 4C23A 2ZM6K 2VGMA 1ATSA 4JRPA 4E3SA 2NZTA 5EX5A 1LWCA 1BGXT 4MO5A 4I9QA 4CHYA 5SWMA 5J2QA 4FJLA 4W5QA 2KQ2A 3A5MC 4M3ZA 4M41A 3DXKB 1S9EA 2G8VA 3DI6A 3AO5A 2GX9A 2XO7A 1HKGA 3MWTA 3EL2A 3RSEA
chains in the Genus database with same CATH topology
1CXUA 1N6QA 2BGGA 3AVAA 1TAQA 4ID1A 3DLBA 3DLEA 5C25A 3LWLA 4RW6A 3RR8A 3CM6A 4H4OA 5KTQA 4KTWA 4H4MA 3VA0A 1KLNA 3HXMA 3T3FA 3M8SA 3M8RA 1RCHA 4CIEA 3L3VA 1LAVA 3IAYA 1WSGA 1XHZA 1YTUA 3CG7A 3MEDA 4F8RA 1RBTA 4K8XA 4DQRA 2HMIA 4ZHRA 1NK6A 5K14A 4FJGA 1SL1A 1WAJA 3A2FA 2QKBA 2BE2A 4LSNA 1L5UA 3S3NA 3QNNA 4Z4HA 4CK2A 3KTQA 4B8AB 3DLGA 1ZBLA 1RT2A 3LP1A 2OPSA 4GMJB 3UIQA 4CF9A 5FRNA 1Y97A 4FLZA 4O0IA 4IG3A 4O5BA 3SQ4A 3VQ7A 4OVLA 4NCGA 2YNHA 3M8PA 4KV8A 4PQUA 2F8SA 4FJIA 4DFKA 3HK2A 2OA8A 4KHYA 1FKPA 1S1XA 4O4GA 3WNFA 1L3UA 3LAKA 1U48A 4HUGA 4CEQA 4Y1CA 4B8CA 1KVAA 3RMAA 1RT4A 4M45A 4ELTA 4FLTA 2GBZA 1KCFA 3V1OA 4CCHA 4B9LA 1S1TA 3MEEA 3PUFA 3VQPA 3D0PA 4JRQA 2OPQA 3K5OA 3VQ4A 1CLQA 3K5MA 4CJFA 4Z0UA 1XI1A 2OZSA 1RNHA 1QE1A 3VQQA 4O0JA 3KLIA 4OGCA 4N76A 2DFFA 3S3OA 3V9ZA 4LH4A 1KVCA 4QAGA 1F21A 1RBUA 3P5JA 2JLEA 1BCOA 2KW4A 2YKMA 1LW0A 4MFBA 4JS4A 1UA1A 1HNIA 3DM2A 4M3WA 2BANA 3TABA 3RMDA 1TKZA 3RMCA 4CFDA 2FBYA 3DOLA 3AVBA 1S1WA 3ZSWA 3SV4A 2ITGA 1C0TA 3LWMA 3AVLA 3ZSRA 1BIZA 3SUQA 1TGOA 4CEDA 4E7IA 1L3SA 4KTZA 1VSLA 4DF4A 2VG7A 1TK5A 4M42A 3P83D 1IKYA 1RT7A 4DSFA 4CERA 1JLGA 4CEZA 3NCIA 4FM2A 1TK0A 1FK9A 1T8EA 3QINA 4NYFA 5JS2A 3TAEA 3BDPA 4J2AA 5DK5A 4AHSA 1JLEA 3ZSQA 1UWBA 4CJEA 1HQUA 2PY5A 4CHZA 2G8HA 3OVNA 4OKKA 4FLWA 3DYAA 1X9MA 4MQ3A 4J2EA 3OS2A 3OYNA 4BDZA 4BE1A 4M3YA 4B3OA 2D5RA 4F3OA 4B9TA 2Z1JA 4CGFA 1UAXA 3AA4A 3SUNA 4CJKA 5JS1A 3U6FA 1G15A 3V4IA 3T1AA 3DRRA 4G1QA 4N41A 4CEAA 4DTOA 1BHLA 4FYDA 3DLKA 3TARA 4CJ5A 4C8NA 2G8UA 1U49A 3PX4A 1BI4B 1RT3A 5E41A 5DMRA 3S3MA 1GOBA 1DTTA 4LH5A 1QSLA 1U47A 1SKRA 3LP3A 3ITHA 3I0SA 2XY6A 3OJSA 3KLFA 3AVHA 2HHWA 4B08A 3LDSA 1KFDA 1ZBUA 3V1QA 1TKXA 3WNGA 4ZTJA 1U04A 3NH0A 2FBTA 2IC3A 2HVHA 3SV3A 2JGUA 3RRGA 2XY7A 3OYCA 3HT3A 5HRPA 2IGIA 1EP4A 4M3UA 3ALYA 3LP0A 3KKRA 1LV5A 4FZZA 1DLOA 1XHXA 3WNEA 1ZBHA 4FK2A 4CE9A 4E89A 1S6QA 3HO1A 3QERA 1JLFA 1HYZA 4JS5A 4DFJA 3THVA 1WAFA 3K5NA 4FLUA 2O4GA 4FJNA 1SV5A 4EZ6A 2B6AA 3HYFA 3LPTA 4HCBA 2KFNA 3LZIA 4KHNA 2F8TA 4FJXA 3O4QA 3L2WA 3HM9A 1C1AA 3C94A 2IS3A 3VQAA 1CZ9A 1QHTA 2GUIA 2I5JA 3KIOA 4ID5A 4ICLA 4NYNA 3CFRA 2PZSA 1TVRA 4E0DA 2Y1IA 3F9KA 1Z26A 1QS4A 1S5JA 3AO3A 1JLQA 3WNHA 4M3RA 3CQ8A 1LAWA 2GV9A 2YHBA 4AHRA 3NF8A 4BDYA 4FM1A 1L3TA 1KFSA 1VSFA 1IKVA 4N56A 4DG1A 1J53A 2XHBA 1U4BA 1RT1A 3V1RA 1NJXA 4FVMA 1HNVA 3KK3A 1B9FA 3HP9A 3ZT4A 3NAEA 3ZT2A 4DU1A 4DTUA 2P5GA 3V6DA 4E7HA 3L2RA 5KRSA 4FJ5A 3ASMA 3DLRA 1VSMA 4Q5VA 4CJLA 3SYZA 4DSJA 3RRHA 3VQDA 4E1NA 4W5NA 4BDPA 2WOMA 1RBVA 1D8YA 3DLHA 4CJPA 1UOCA 3OYDA 4E7LA 3SCXA 3TI0A 4KHWA 4HUEA 3KK2A 3DRPA 4J2DA 1NK9A 1GOAA 4ZTFA 5HLFA 1QSSA 3V9UA 3ZSOA 4FCYA 4DTXA 2G8IA 1A5VA 1BQMA 3ZT1A 3CFPA 3SPZA 4GW6A 2DY4A 4CF2A 1C1CA 2OPPA 4CIGA 3S9HA 2RKIA 3G10A 4WE1A 4Z4GA 5I42A 1XWLA 3HSTB 3MEGA 3OYAA 4IFVA 3KKSA 3L2UA 1WNSA 5HRNA 4FK4A 3AVIA 1VRUA 2YNGA 3BGRA 4FW1A 3OJUA 3PO4A 2X6NA 1W9HA 2X74A 4EZ9A 4IFYA 1Q9XA 3TAGA 4KTQA 1R0AA 1JXBA 3OYBA 2P51A 4CGGA 4KRFA 2HHUA 2LSNA 3CM5A 2IAJA 1B9DA 3AO2A 1C6VA 3AV9A 4LSLA 4I9LA 1I39A 3TAPA 3QO9A 4RW4A 4KO0A 1WSIA 4BACA 5CYMA 5I3UA 4BWJA 5J2PA 2KZZA 3L8BA 2HNYA 1U45A 4CIFA 1RTJA 1RTIA 3U3YA 3LAMA 4CHPA 3LZJA 1VK0A 3KLEA 4FJMA 1ITGA 2ZD1A 5J1EA 3O3GA 2VWJA 3PV8A 2ZE2A 5CYQA 4DTNA 3QEWA 1VSHA 2Z1GA 2HNZA 2IOCA 4DSKA 2HHSA 1RTDA 4DFMA 4OGEA 4DQIA 4I7FA 1LWFA 5KRTA 3AA5X 5HRRA 4DTMA 2FBXA 1NOZA 2QXFA 4DS5A 1WSFA 4PWDA 2EHGA 2ETJA 2HNDA 4IBNA 4AHCA 3ZSVA 3AVCA 4C8OA 1WLJA 3VQBA 1SUQA 3QIPA 1IKWA 1HQEA 3L2QA 4CHOA 3HJFA 2D0AA 3ISNC 4CFCA 3K58A 1Z25A 4KB0A 1T05A 3IRXA 3L3UA 2G8FA 5J2NA 3OY9A 3IS9A 4ELVA 1S1VA 3C6TA 1W0HA 3OS1A 1SL0A 2YKNA 4HHTA 2VG6A 4EP5A 1QTMA 3SQ0A 4RG8A 3AVKA 1D9DA 3MXMA 4XIUA 4HTUA 1JLCA 4KPYA 4KHUA 1TL3A 4LY7A 3RR7A 4C8MA 3SZ2A 3CYMA 4IKFA 1WSEA 4B9MA 2OZMA 1HYVA 2O4IA 3LP2A 4CGJA 2G8WA 2QK9A 1JL2A 4BWMA 4KKOA 1C1BA 4J2BA 1ASVA 1EXQA 1T03A 1RDBA 1WSHA 1JKHA 3O3FA 2QKKA 4QOZB 4FJJA 2NUBA 4CJ3A 1N5YA 3QESA 4DQPA 4F4KA 3K59A 3NH2A 4F3TA 4Z4EA 1J5OA 5CY4A 2FC0A 4CGIA 4KI6A 3ULDA 5FRMA 1NK0A 4RW7A 3L2VA 4RW9A 1VSDA 3MECA 4H8KA 2EX3A 3M8QA 4DSEA 4DQSA 4M3XA 2X6SA 1T7PA 4CEBA 3TAFA 3AVGA 3T19A 1KSPA 4F2RA 1J9AA 5KGXA 3VQEA 2RN2A 1YTAA 4IG0A 3HP6A 1C0UA 4FJHA 2Q3SA 4YNQA 3EZ5A 5CZ2A 4W5OA 3AO4A 1JLAA 2Z1IA 2ZQBA 3I0RA 4TSXA 3OYIA 1S9GA 1HMVA 1YVUA 4JLHA 1B92A 1RDAA 2Z1HA 4UQGA 1KRPA 4C8KA 4K8ZA 1IH7A 5T7BA 4B9UA 4OLBA 4FK0A 4HUFA 1NK8A 3U3GA 3OYKA 3EYZA 4CF8A 4I2PA 4OPKA 1VRTA 1C0MA 3QIOA 2D0CA 3CFOA 4CHNA 1KVBA 4OPJA 3V9XA 3SJJA 3PX6A 4NCAA 4CJ4A 4E19A 4R5PA 3KK1A 5EU7A 1FXXA 1VSKA 2WONA 4DTRA 4DSIA 3F73A 3DMJA 1BL3A 2YV0X 1JXEA 2IDOA 4CESA 1UA0A 1VSEA 3LALA 1RDCA 2DFHA 1MU2A 2RF2A 3NFAA 4FM0A 3HPHA 1NJZA 1IG9A 1D9FA 3TWHA 2PYLA 3V9SA 1J54A 3NGIA 4FZXC 1JL1A 3PX0A 4CJQA 2BDPA 4O44A 3NE6A 1O1WA 4KHQA 1TL1A 3MXJA 5KI6A 4CEFA 4N5SA 4FLVA 2HHTA 1EKEA 3NH1A 4LD0A 4FW2A 2XY5A 3HPOA 1ASUA 4O55A 3ZSYA 1NKEA 4CGHA 2YHAA 4AHVA 1RILA 4FXDA 3K57A 3NF7A 4I2QA 1LW2A 4IDKA 3VQ6A 3VQ9A 1EX4A 4BE2A 4DTJA 1QSYA 5CZ1A 3NF9A 4HVJA 3KLGA 1RT5A 4CEOA 4F2SA 4CK1A 1RT6A 3HVRA 1TV6A 3ZT3A 1RBSA 4E1MA 1CXQA 1CZBA 3AVJA 4N47A 3OYHA 1REVA 3AVNA 3EY1A 2ATQA 3VN5A 5HP1A 4KAZA 3QLHA 4DU4A 3P1GA 4OKEA 5FDLA 4FLYA 1NKBA 3RTVA 1NKCA 3PY8A 3NF6A 2D0BA 4L8RB 1IKXA 1BISA 3KD5E 4DLEA 3SPYA 4YFUA 4DU3A 2OPRA 5D3GA 2E6MA 3QETA 3NHGA 4FJ8A 3SQ2A 1HRHA 3HPGA 2VWKA 3RMBA 4Z4IA 4CJTA 2HHQA 4RW8A 1VSJA 3FFIA 2DFEA 1ZBIA 3H08A 1IO2A 1Q9YA 3V9WA 4DQQA 3AA3A 3SNNA 3C95A 3VQ5A 2F96A 1XC9A 4DTSA 2XRIA 3SUPA 3KD1E 4DF8A 1KLMA 1NOYA 3OS0A 4Y1DA 4KREA 2Y1JA 3MXIA 4W5TA 1SKSA 3QEVA 4PA1A 1ZBFA 3OYMA 1NJWA 3KLHA 2KTQA 4AHUA 4PUOA 2HHVA 2KZMA 2DTUA 1HPZA 1Q8IA 3ZT0A 1X9SA 1RBRA 5HROA 4C8LA 2YNFA 3C6UA 4Z4FA 3NGZA 4EP4A 4E7KA 2YNIA 3QNOA 3B6PA 4DFPA 2HVIA 4CECA 1X9WA 4OLAA 3G0ZA 4M3TA 4E7JA 3TR8A 5SZTA 4B9SA 4ELUA 4CJWA 2W42A 4FJKA 1YT3A 3VQCA 1RTHA 2G8KA 4CGDA 2RPIA 2HHXA 4CFBA 1TAUA 1QQCA 4DWIA 1TKTA 1S6PA 1TKDA 3OYGA 3NBPA 4CF1A 4PY5A 4OJRA 4CJUA 4W5RA 3O3HA 4DS4A 1RDDA 3LANA 2R7YA 3V81A 1NK5A 2PYJA 3OYFA 4DLGA 3RWUA 4HCCA 3KJVA 4Q0BA 3IG1A 4KI4A 4CK3A 1KTQA 4CJRA 4KB1A 4B9NA 3SQ1A 2HW3A 3JSMA 1DTQA 4AH9A 1A5XA 3I8DA 1TK8A 1S1UA 3D45A 4FZYA 1NJYA 3OYEA 2VG5A 2AJQA 1X1PA 4CEEA 1NK4A 5C42A 1ZYQA 4CF0A 2E4LA 2KFZA 4OKJA 3SUOA 1L3VA 3O4NA 3K2PA 3SI6A 2HB5A 3MAQA 1EETA 4BE0A 4FJ7A 1BI4A 4FJ9A 4CHQA 3QEIA 3PO5A 2OYQA 1BIUA 5C24A 1ASWA 3ZCMA 4GVMA 4FLXA 3NDKA 3AA2A 1GOCA 5HBMA 3VA3A 3B6OA 1BQNA 1SL2A 3TAQA 1SKWA 1WN7A 3DOKA 4AHTA 4Z4CA 3HL8A 4B9VA 3QEPA 1FKOA 3AVMA 4CJVA 4KHSA 3OYJA 4JRPA 2P5OA 3TAMA 1K6YA 4E3SA 3DRSA 4DMNA 2XY8A 1LWCA 3ZSXA 1BGXT 4I9QA 1A5WA 4KFBA 4CHYA 2FBVA 4CFAA 1D5AA 3HVTA 2B4JA 5SWMA 2A1SA 5J2QA 5HRSA 1NK7A 4FJLA 4DTPA 5KGWA 2KQ2A 1JLBA 4W5QA 2A1RA 2P1JA 4NCBA 4M3ZA 3OYLA 4M41A 5J2MA 2E6LA 3NGYA 5FROA 1S9EA 3QEXA 3TANA 3ZSZA 2B5JA 3AVFA 2X78A 4AILC 2G8VA 3AO1A 1VSIA 3AO5A 3DI6A 1BCMA 1LWEA 2XO7A 3K5LA 3VQ8A 4CJSA 1WSJA 4QCLA 1I3AA 3E01A 3LPUA 1HJRA 1HYSA 3JYTA 4DSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXU A;  1N6Q A;  2BGG A;  3AVA A;  1TAQ A;  4ID1 A;  3DLB A;  3DLE A;  5C25 A;  3LWL A;  4RW6 A;  3RR8 A;  3CM6 A;  4H4O A;  5KTQ A;  4KTW A;  4H4M A;  3VA0 A;  1KLN A;  3HXM A;  3T3F A;  3M8S A;  3M8R A;  1RCH A;  4CIE A;  3L3V A;  1LAV A;  3IAY A;  1WSG A;  1XHZ A;  1YTU A;  3CG7 A;  3MED A;  4F8R A;  1RBT A;  4K8X A;  4DQR A;  2HMI A;  4ZHR A;  1NK6 A;  5K14 A;  4FJG A;  1SL1 A;  1WAJ A;  3A2F A;  2QKB A;  2BE2 A;  4LSN A;  1L5U A;  3S3N A;  3QNN A;  4Z4H A;  4CK2 A;  3KTQ A;  4B8A B;  3DLG A;  1ZBL A;  1RT2 A;  3LP1 A;  2OPS A;  4GMJ B;  3UIQ A;  4CF9 A;  5FRN A;  1Y97 A;  4FLZ A;  4O0I A;  4IG3 A;  4O5B A;  3SQ4 A;  3VQ7 A;  4OVL A;  4NCG A;  2YNH A;  3M8P A;  4KV8 A;  4PQU A;  2F8S A;  4FJI A;  4DFK A;  3HK2 A;  2OA8 A;  4KHY A;  1FKP A;  1S1X A;  4O4G A;  3WNF A;  1L3U A;  3LAK A;  1U48 A;  4HUG A;  4CEQ A;  4Y1C A;  4B8C A;  1KVA A;  3RMA A;  1RT4 A;  4M45 A;  4ELT A;  4FLT A;  2GBZ A;  1KCF A;  3V1O A;  4CCH A;  4B9L A;  1S1T A;  3MEE A;  3PUF A;  3VQP A;  3D0P A;  4JRQ A;  2OPQ A;  3K5O A;  3VQ4 A;  1CLQ A;  3K5M A;  4CJF A;  4Z0U A;  1XI1 A;  2OZS A;  1RNH A;  1QE1 A;  3VQQ A;  4O0J A;  3KLI A;  4OGC A;  4N76 A;  2DFF A;  3S3O A;  3V9Z A;  4LH4 A;  1KVC A;  4QAG A;  1F21 A;  1RBU A;  3P5J A;  2JLE A;  1BCO A;  2KW4 A;  2YKM A;  1LW0 A;  4MFB A;  4JS4 A;  1UA1 A;  1HNI A;  3DM2 A;  4M3W A;  2BAN A;  3TAB A;  3RMD A;  1TKZ A;  3RMC A;  4CFD A;  2FBY A;  3DOL A;  3AVB A;  1S1W A;  3ZSW A;  3SV4 A;  2ITG A;  1C0T A;  3LWM A;  3AVL A;  3ZSR A;  1BIZ A;  3SUQ A;  1TGO A;  4CED A;  4E7I A;  1L3S A;  4KTZ A;  1VSL A;  4DF4 A;  2VG7 A;  1TK5 A;  4M42 A;  3P83 D;  1IKY A;  1RT7 A;  4DSF A;  4CER A;  1JLG A;  4CEZ A;  3NCI A;  4FM2 A;  1TK0 A;  1FK9 A;  1T8E A;  3QIN A;  4NYF A;  5JS2 A;  3TAE A;  3BDP A;  4J2A A;  5DK5 A;  4AHS A;  1JLE A;  3ZSQ A;  1UWB A;  4CJE A;  1HQU A;  2PY5 A;  4CHZ A;  2G8H A;  3OVN A;  4OKK A;  4FLW A;  3DYA A;  1X9M A;  4MQ3 A;  4J2E A;  3OS2 A;  3OYN A;  4BDZ A;  4BE1 A;  4M3Y A;  4B3O A;  2D5R A;  4F3O A;  4B9T A;  2Z1J A;  4CGF A;  1UAX A;  3AA4 A;  3SUN A;  4CJK A;  5JS1 A;  3U6F A;  1G15 A;  3V4I A;  3T1A A;  3DRR A;  4G1Q A;  4N41 A;  4CEA A;  4DTO A;  1BHL A;  4FYD A;  3DLK A;  3TAR A;  4CJ5 A;  4C8N A;  2G8U A;  1U49 A;  3PX4 A;  1BI4 B;  1RT3 A;  5E41 A;  5DMR A;  3S3M A;  1GOB A;  1DTT A;  4LH5 A;  1QSL A;  1U47 A;  1SKR A;  3LP3 A;  3ITH A;  3I0S A;  2XY6 A;  3OJS A;  3KLF A;  3AVH A;  2HHW A;  4B08 A;  3LDS A;  1KFD A;  1ZBU A;  3V1Q A;  1TKX A;  3WNG A;  4ZTJ A;  1U04 A;  3NH0 A;  2FBT A;  2IC3 A;  2HVH A;  3SV3 A;  2JGU A;  3RRG A;  2XY7 A;  3OYC A;  3HT3 A;  5HRP A;  2IGI A;  1EP4 A;  4M3U A;  3ALY A;  3LP0 A;  3KKR A;  1LV5 A;  4FZZ A;  1DLO A;  1XHX A;  3WNE A;  1ZBH A;  4FK2 A;  4CE9 A;  4E89 A;  1S6Q A;  3HO1 A;  3QER A;  1JLF A;  1HYZ A;  4JS5 A;  4DFJ A;  3THV A;  1WAF A;  3K5N A;  4FLU A;  2O4G A;  4FJN A;  1SV5 A;  4EZ6 A;  2B6A A;  3HYF A;  3LPT A;  4HCB A;  2KFN A;  3LZI A;  4KHN A;  2F8T A;  4FJX A;  3O4Q A;  3L2W A;  3HM9 A;  1C1A A;  3C94 A;  2IS3 A;  3VQA A;  1CZ9 A;  1QHT A;  2GUI A;  2I5J A;  3KIO A;  4ID5 A;  4ICL A;  4NYN A;  3CFR A;  2PZS A;  1TVR A;  4E0D A;  2Y1I A;  3F9K A;  1Z26 A;  1QS4 A;  1S5J A;  3AO3 A;  1JLQ A;  3WNH A;  4M3R A;  3CQ8 A;  1LAW A;  2GV9 A;  2YHB A;  4AHR A;  3NF8 A;  4BDY A;  4FM1 A;  1L3T A;  1KFS A;  1VSF A;  1IKV A;  4N56 A;  4DG1 A;  1J53 A;  2XHB A;  1U4B A;  1RT1 A;  3V1R A;  1NJX A;  4FVM A;  1HNV A;  3KK3 A;  1B9F A;  3HP9 A;  3ZT4 A;  3NAE A;  3ZT2 A;  4DU1 A;  4DTU A;  2P5G A;  3V6D A;  4E7H A;  3L2R A;  5KRS A;  4FJ5 A;  3ASM A;  3DLR A;  1VSM A;  4Q5V A;  4CJL A;  3SYZ A;  4DSJ A;  3RRH A;  3VQD A;  4E1N A;  4W5N A;  4BDP A;  2WOM A;  1RBV A;  1D8Y A;  3DLH A;  4CJP A;  1UOC A;  3OYD A;  4E7L A;  3SCX A;  3TI0 A;  4KHW A;  4HUE A;  3KK2 A;  3DRP A;  4J2D A;  1NK9 A;  1GOA A;  4ZTF A;  5HLF A;  1QSS A;  3V9U A;  3ZSO A;  4FCY A;  4DTX A;  2G8I A;  1A5V A;  1BQM A;  3ZT1 A;  3CFP A;  3SPZ A;  4GW6 A;  2DY4 A;  4CF2 A;  1C1C A;  2OPP A;  4CIG A;  3S9H A;  2RKI A;  3G10 A;  4WE1 A;  4Z4G A;  5I42 A;  1XWL A;  3HST B;  3MEG A;  3OYA A;  4IFV A;  3KKS A;  3L2U A;  1WNS A;  5HRN A;  4FK4 A;  3AVI A;  1VRU A;  2YNG A;  3BGR A;  4FW1 A;  3OJU A;  3PO4 A;  2X6N A;  1W9H A;  2X74 A;  4EZ9 A;  4IFY A;  1Q9X A;  3TAG A;  4KTQ A;  1R0A A;  1JXB A;  3OYB A;  2P51 A;  4CGG A;  4KRF A;  2HHU A;  2LSN A;  3CM5 A;  2IAJ A;  1B9D A;  3AO2 A;  1C6V A;  3AV9 A;  4LSL A;  4I9L A;  1I39 A;  3TAP A;  3QO9 A;  4RW4 A;  4KO0 A;  1WSI A;  4BAC A;  5CYM A;  5I3U A;  4BWJ A;  5J2P A;  2KZZ A;  3L8B A;  2HNY A;  1U45 A;  4CIF A;  1RTJ A;  1RTI A;  3U3Y A;  3LAM A;  4CHP A;  3LZJ A;  1VK0 A;  3KLE A;  4FJM A;  1ITG A;  2ZD1 A;  5J1E A;  3O3G A;  2VWJ A;  3PV8 A;  2ZE2 A;  5CYQ A;  4DTN A;  3QEW A;  1VSH A;  2Z1G A;  2HNZ A;  2IOC A;  4DSK A;  2HHS A;  1RTD A;  4DFM A;  4OGE A;  4DQI A;  4I7F A;  1LWF A;  5KRT A;  3AA5 X;  5HRR A;  4DTM A;  2FBX A;  1NOZ A;  2QXF A;  4DS5 A;  1WSF A;  4PWD A;  2EHG A;  2ETJ A;  2HND A;  4IBN A;  4AHC A;  3ZSV A;  3AVC A;  4C8O A;  1WLJ A;  3VQB A;  1SUQ A;  3QIP A;  1IKW A;  1HQE A;  3L2Q A;  4CHO A;  3HJF A;  2D0A A;  3ISN C;  4CFC A;  3K58 A;  1Z25 A;  4KB0 A;  1T05 A;  3IRX A;  3L3U A;  2G8F A;  5J2N A;  3OY9 A;  3IS9 A;  4ELV A;  1S1V A;  3C6T A;  1W0H A;  3OS1 A;  1SL0 A;  2YKN A;  4HHT A;  2VG6 A;  4EP5 A;  1QTM A;  3SQ0 A;  4RG8 A;  3AVK A;  1D9D A;  3MXM A;  4XIU A;  4HTU A;  1JLC A;  4KPY A;  4KHU A;  1TL3 A;  4LY7 A;  3RR7 A;  4C8M A;  3SZ2 A;  3CYM A;  4IKF A;  1WSE A;  4B9M A;  2OZM A;  1HYV A;  2O4I A;  3LP2 A;  4CGJ A;  2G8W A;  2QK9 A;  1JL2 A;  4BWM A;  4KKO A;  1C1B A;  4J2B A;  1ASV A;  1EXQ A;  1T03 A;  1RDB A;  1WSH A;  1JKH A;  3O3F A;  2QKK A;  4QOZ B;  4FJJ A;  2NUB A;  4CJ3 A;  1N5Y A;  3QES A;  4DQP A;  4F4K A;  3K59 A;  3NH2 A;  4F3T A;  4Z4E A;  1J5O A;  5CY4 A;  2FC0 A;  4CGI A;  4KI6 A;  3ULD A;  5FRM A;  1NK0 A;  4RW7 A;  3L2V A;  4RW9 A;  1VSD A;  3MEC A;  4H8K A;  2EX3 A;  3M8Q A;  4DSE A;  4DQS A;  4M3X A;  2X6S A;  1T7P A;  4CEB A;  3TAF A;  3AVG A;  3T19 A;  1KSP A;  4F2R A;  1J9A A;  5KGX A;  3VQE A;  2RN2 A;  1YTA A;  4IG0 A;  3HP6 A;  1C0U A;  4FJH A;  2Q3S A;  4YNQ A;  3EZ5 A;  5CZ2 A;  4W5O A;  3AO4 A;  1JLA A;  2Z1I A;  2ZQB A;  3I0R A;  4TSX A;  3OYI A;  1S9G A;  1HMV A;  1YVU A;  4JLH A;  1B92 A;  1RDA A;  2Z1H A;  4UQG A;  1KRP A;  4C8K A;  4K8Z A;  1IH7 A;  5T7B A;  4B9U A;  4OLB A;  4FK0 A;  4HUF A;  1NK8 A;  3U3G A;  3OYK A;  3EYZ A;  4CF8 A;  4I2P A;  4OPK A;  1VRT A;  1C0M A;  3QIO A;  2D0C A;  3CFO A;  4CHN A;  1KVB A;  4OPJ A;  3V9X A;  3SJJ A;  3PX6 A;  4NCA A;  4CJ4 A;  4E19 A;  4R5P A;  3KK1 A;  5EU7 A;  1FXX A;  1VSK A;  2WON A;  4DTR A;  4DSI A;  3F73 A;  3DMJ A;  1BL3 A;  2YV0 X;  1JXE A;  2IDO A;  4CES A;  1UA0 A;  1VSE A;  3LAL A;  1RDC A;  2DFH A;  1MU2 A;  2RF2 A;  3NFA A;  4FM0 A;  3HPH A;  1NJZ A;  1IG9 A;  1D9F A;  3TWH A;  2PYL A;  3V9S A;  1J54 A;  3NGI A;  4FZX C;  1JL1 A;  3PX0 A;  4CJQ A;  2BDP A;  4O44 A;  3NE6 A;  1O1W A;  4KHQ A;  1TL1 A;  3MXJ A;  5KI6 A;  4CEF A;  4N5S A;  4FLV A;  2HHT A;  1EKE A;  3NH1 A;  4LD0 A;  4FW2 A;  2XY5 A;  3HPO A;  1ASU A;  4O55 A;  3ZSY A;  1NKE A;  4CGH A;  2YHA A;  4AHV A;  1RIL A;  4FXD A;  3K57 A;  3NF7 A;  4I2Q A;  1LW2 A;  4IDK A;  3VQ6 A;  3VQ9 A;  1EX4 A;  4BE2 A;  4DTJ A;  1QSY A;  5CZ1 A;  3NF9 A;  4HVJ A;  3KLG A;  1RT5 A;  4CEO A;  4F2S A;  4CK1 A;  1RT6 A;  3HVR A;  1TV6 A;  3ZT3 A;  1RBS A;  4E1M A;  1CXQ A;  1CZB A;  3AVJ A;  4N47 A;  3OYH A;  1REV A;  3AVN A;  3EY1 A;  2ATQ A;  3VN5 A;  5HP1 A;  4KAZ A;  3QLH A;  4DU4 A;  3P1G A;  4OKE A;  5FDL A;  4FLY A;  1NKB A;  3RTV A;  1NKC A;  3PY8 A;  3NF6 A;  2D0B A;  4L8R B;  1IKX A;  1BIS A;  3KD5 E;  4DLE A;  3SPY A;  4YFU A;  4DU3 A;  2OPR A;  5D3G A;  2E6M A;  3QET A;  3NHG A;  4FJ8 A;  3SQ2 A;  1HRH A;  3HPG A;  2VWK A;  3RMB A;  4Z4I A;  4CJT A;  2HHQ A;  4RW8 A;  1VSJ A;  3FFI A;  2DFE A;  1ZBI A;  3H08 A;  1IO2 A;  1Q9Y A;  3V9W A;  4DQQ A;  3AA3 A;  3SNN A;  3C95 A;  3VQ5 A;  2F96 A;  1XC9 A;  4DTS A;  2XRI A;  3SUP A;  3KD1 E;  4DF8 A;  1KLM A;  1NOY A;  3OS0 A;  4Y1D A;  4KRE A;  2Y1J A;  3MXI A;  4W5T A;  1SKS A;  3QEV A;  4PA1 A;  1ZBF A;  3OYM A;  1NJW A;  3KLH A;  2KTQ A;  4AHU A;  4PUO A;  2HHV A;  2KZM A;  2DTU A;  1HPZ A;  1Q8I A;  3ZT0 A;  1X9S A;  1RBR A;  5HRO A;  4C8L A;  2YNF A;  3C6U A;  4Z4F A;  3NGZ A;  4EP4 A;  4E7K A;  2YNI A;  3QNO A;  3B6P A;  4DFP A;  2HVI A;  4CEC A;  1X9W A;  4OLA A;  3G0Z A;  4M3T A;  4E7J A;  3TR8 A;  5SZT A;  4B9S A;  4ELU A;  4CJW A;  2W42 A;  4FJK A;  1YT3 A;  3VQC A;  1RTH A;  2G8K A;  4CGD A;  2RPI A;  2HHX A;  4CFB A;  1TAU A;  1QQC A;  4DWI A;  1TKT A;  1S6P A;  1TKD A;  3OYG A;  3NBP A;  4CF1 A;  4PY5 A;  4OJR A;  4CJU A;  4W5R A;  3O3H A;  4DS4 A;  1RDD A;  3LAN A;  2R7Y A;  3V81 A;  1NK5 A;  2PYJ A;  3OYF A;  4DLG A;  3RWU A;  4HCC A;  3KJV A;  4Q0B A;  3IG1 A;  4KI4 A;  4CK3 A;  1KTQ A;  4CJR A;  4KB1 A;  4B9N A;  3SQ1 A;  2HW3 A;  3JSM A;  1DTQ A;  4AH9 A;  1A5X A;  3I8D A;  1TK8 A;  1S1U A;  3D45 A;  4FZY A;  1NJY A;  3OYE A;  2VG5 A;  2AJQ A;  1X1P A;  4CEE A;  1NK4 A;  5C42 A;  1ZYQ A;  4CF0 A;  2E4L A;  2KFZ A;  4OKJ A;  3SUO A;  1L3V A;  3O4N A;  3K2P A;  3SI6 A;  2HB5 A;  3MAQ A;  1EET A;  4BE0 A;  4FJ7 A;  1BI4 A;  4FJ9 A;  4CHQ A;  3QEI A;  3PO5 A;  2OYQ A;  1BIU A;  5C24 A;  1ASW A;  3ZCM A;  4GVM A;  4FLX A;  3NDK A;  3AA2 A;  1GOC A;  5HBM A;  3VA3 A;  3B6O A;  1BQN A;  1SL2 A;  3TAQ A;  1SKW A;  1WN7 A;  3DOK A;  4AHT A;  4Z4C A;  3HL8 A;  4B9V A;  3QEP A;  1FKO A;  3AVM A;  4CJV A;  4KHS A;  3OYJ A;  4JRP A;  2P5O A;  3TAM A;  1K6Y A;  4E3S A;  3DRS A;  4DMN A;  2XY8 A;  1LWC A;  3ZSX A;  1BGX T;  4I9Q A;  1A5W A;  4KFB A;  4CHY A;  2FBV A;  4CFA A;  1D5A A;  3HVT A;  2B4J A;  5SWM A;  2A1S A;  5J2Q A;  5HRS A;  1NK7 A;  4FJL A;  4DTP A;  5KGW A;  2KQ2 A;  1JLB A;  4W5Q A;  2A1R A;  2P1J A;  4NCB A;  4M3Z A;  3OYL A;  4M41 A;  5J2M A;  2E6L A;  3NGY A;  5FRO A;  1S9E A;  3QEX A;  3TAN A;  3ZSZ A;  2B5J A;  3AVF A;  2X78 A;  4AIL C;  2G8V A;  3AO1 A;  1VSI A;  3AO5 A;  3DI6 A;  1BCM A;  1LWE A;  2XO7 A;  3K5L A;  3VQ8 A;  4CJS A;  1WSJ A;  4QCL A;  1I3A A;  3E01 A;  3LPU A;  1HJR A;  1HYS A;  3JYT A;  4DSL A; 
#chains in the Genus database with same CATH topology
 1FW6 A;  1CXU A;  3AVA A;  1YVN A;  3DLB A;  4RW6 A;  5M1F A;  1HKC A;  3BZC A;  4DR1 K;  4KTW A;  3ZET A;  3VA0 A;  4CD3 A;  1T6D A;  3CC7 N;  4CIE A;  4YOT A;  4GY2 B;  1DT9 A;  1WSG A;  1XHZ A;  4LFA K;  3CG7 A;  2IVO A;  4BRE A;  1SL1 A;  2NRH A;  4BQL A;  5C12 A;  3A2F A;  3S3N A;  2O8D A;  1VQ8 N;  1ZBL A;  1SZ2 A;  3WEE A;  3ZLJ A;  3UIQ A;  5FRN A;  4FLZ A;  3VQ7 A;  4JKC A;  1KAX A;  1QQN A;  4KV8 A;  4FJI A;  3DXM B;  1YJN N;  2UUA K;  4DFK A;  3LAK A;  1IV0 A;  5IT9 O;  4JHD B;  1RT4 A;  4ELT A;  1KCF A;  4B1Y B;  4JD2 B;  4H0V B;  3U9D A;  1CLQ A;  3GBT A;  4ILH A;  3SMS A;  5EVZ A;  2UUB K;  5M1Q A;  1KVC A;  2ZWH A;  1NMN A;  4H0X B;  3P5J A;  4JKH A;  4B9Q A;  4X66 K;  4JS4 A;  4M3W A;  4BC5 A;  3TAB A;  3RMC A;  1NWK A;  1S1W A;  3SV4 A;  4C1N K;  2E1Z A;  1C0T A;  3K9J A;  4E1J A;  1E4G T;  3SUQ A;  1TGO A;  3ID6 A;  4CED A;  1L3S A;  1WB9 A;  1HYS A;  3P83 D;  1IKY A;  4DSF A;  4CER A;  4CEZ A;  1FK9 A;  3QIN A;  3OW2 M;  3P38 A;  1HNW K;  1JLE A;  3ZSQ A;  1UWB A;  4IDH A;  1HQU A;  4J2E A;  3OS2 A;  4BE1 A;  4B9T A;  2QEX N;  3TSQ A;  4B3T K;  1UAX A;  2NRX A;  2P9U A;  3KHY A;  5AQG A;  4C8N A;  2G8U A;  3QB0 A;  1RT3 A;  5DMR A;  3S3M A;  1GOB A;  1DTT A;  4LH5 A;  3CCE N;  3LP3 A;  4PHT X;  2P9L A;  2XY6 A;  1MWM A;  3OJS A;  3KLF A;  2HHW A;  4BR7 A;  4ZTJ A;  4HWI A;  3CET A;  1U04 A;  2DPN A;  3I55 N;  1EP4 A;  3E66 A;  1LV5 A;  4FZZ A;  4CD1 A;  1XHX A;  1YIJ N;  4BR4 A;  1ZBH A;  1NGI A;  4E89 A;  3TSP A;  3THV A;  1XUP O;  3K5N A;  4FLU A;  2O4G A;  4FJN A;  4A61 A;  4HCB A;  3J7Y P;  4JI5 K;  4FJX A;  4FPA A;  3KIO A;  1YHQ N;  1LOT B;  3AAP A;  4E0D A;  3PIO L;  3CJC A;  3RSE B;  3VEO A;  4WFN L;  3I8B A;  1LAW A;  5C2D A;  3ZET B;  5FPM A;  2O8C A;  1U4B A;  3G25 A;  4FVM A;  3HP9 A;  3R8E A;  2P5G A;  1W97 L;  4E7H A;  4FJ5 A;  1YJW N;  4DSJ A;  3VQD A;  1D8Y A;  4CJP A;  3SCX A;  3TI0 A;  2O8D B;  3KK2 A;  4ZTF A;  3ZSO A;  2QWM A;  2G8I A;  1A5V A;  1NGC A;  3SPZ A;  2DY4 A;  1R59 O;  4CF2 A;  5AQP A;  2OPP A;  4CIG A;  1N32 K;  3HST B;  1NGB A;  3FZH A;  3KKS A;  4IFV A;  3L2U A;  2GEL A;  3AVI A;  5LMU K;  3OJU A;  2X74 A;  1Q9X A;  1R0A A;  1EWR A;  2IAJ A;  3CJ9 A;  1B9D A;  3EE9 A;  3TAP A;  4DUY K;  3MCA B;  3GDQ A;  5I3U A;  1MDU B;  3LDO A;  3KVG A;  3K0S A;  3LZJ A;  4JI1 K;  3CCR N;  3O3G A;  3PV8 A;  1OH5 A;  4JK7 A;  4LF5 K;  5DM6 L;  1GLD G;  4H5R A;  2Z1G A;  4YDU A;  5AQF A;  4DSK A;  2HHS A;  4YOR A;  4DFM A;  3AAR A;  4DTM A;  3ZEU A;  4DS5 A;  2EHG A;  2VQF K;  2NRV A;  4C8O A;  3L6Q A;  1WLJ A;  3VQB A;  2A41 A;  1SUQ A;  3QIP A;  1HQE A;  3L2Q A;  4CHO A;  4FWM A;  3CMA N;  1Z25 A;  2I7N A;  2FSN A;  4KB0 A;  3IRX A;  5GIN A;  4LF7 K;  3OY9 A;  3IS9 A;  1SL0 A;  1QTM A;  2VG6 A;  3FR0 A;  3SQ0 A;  4O5F A;  3MXM A;  4XIU A;  4HTU A;  1TL3 A;  4LY7 A;  2P9U B;  3RR7 A;  3P31 A;  3A8Y A;  3AGR A;  2OZM A;  3LP2 A;  4CGJ A;  4L3Q A;  2QWO A;  4WQ5 A;  1C1B A;  3C6A A;  1T03 A;  1WSH A;  1T6C A;  1JKH A;  3O3F A;  2QKK A;  2FSK A;  2E2N A;  2BH1 A;  5AR0 A;  1U2V A;  4DQP A;  4F4K A;  4Z4E A;  2P9L B;  1J5O A;  3ULD A;  4H8K A;  1HKB A;  3M6G A;  5JIC A;  4DQS A;  4M3X A;  5H1S Q;  5C2F A;  4IOX A;  1KSP A;  4F2R A;  5KGX A;  4DCH A;  3VQE A;  4DB3 A;  5CZ2 A;  3DJC A;  1YVU A;  4K8Z A;  1KRP A;  4XH5 A;  1GLL O;  4BRN A;  3EYZ A;  4CF8 A;  3CPW M;  3PIP L;  2D0C A;  4OPJ A;  3ENH A;  2FF3 B;  4CJ4 A;  4R5P A;  1FXX A;  2YI1 A;  2Q2R A;  3F73 A;  3D2E A;  1UA0 A;  3LAL A;  1RDC A;  3NFA A;  3HOS A;  4FM0 A;  3TWH A;  4FZX C;  1JL1 A;  4JYA K;  2I7P A;  4FLV A;  4LFB K;  1EKE A;  2CGK A;  4NLC A;  4LD0 A;  3T69 A;  4FW2 A;  2XY5 A;  1NKE A;  3ZSY A;  3SBT A;  3K57 A;  3CF5 L;  3VQ6 A;  5M1O A;  1EX4 A;  3VMF B;  4BE2 A;  1Q81 O;  3H3N O;  4B3R K;  2BUP A;  4F2S A;  4CK1 A;  1RT6 A;  3HVR A;  1J5E K;  4PKH A;  1RBS A;  4E1M A;  1K8K A;  3OYH A;  4N47 A;  3VN5 A;  4JK8 A;  5GAH P;  4KAZ A;  4K43 A;  2ZJP L;  2F9T A;  3BY5 A;  2D0B A;  2E2P A;  2CGL A;  4RTF D;  3RMB A;  2HHQ A;  4DR6 K;  3EEQ A;  3BF3 A;  4H5T A;  3FFI A;  2DFE A;  1IO2 A;  4CBU A;  1Q9Y A;  3V9W A;  3AA3 A;  3C95 A;  2F96 A;  3KD1 E;  1KLM A;  1NOY A;  1QVF M;  2Y1J A;  3MXI A;  4W5T A;  5BRH A;  3H1Q A;  2HHV A;  3CI5 A;  3SJH A;  5HRO A;  3ZEU B;  3C6U A;  4Z4F A;  4Y0W A;  3VPZ A;  2Q31 A;  3QNO A;  4DFP A;  1GLF O;  4CEC A;  4B9S A;  4ELU A;  4ISF A;  2W6K A;  1XNR K;  3VQC A;  1RTH A;  4DR4 K;  3VEY A;  4FOE A;  4CF1 A;  3MN6 A;  3OYF A;  3KJV A;  3FZL A;  4EHU A;  4KB1 A;  4B9N A;  2HW3 A;  3I8D A;  4IEE A;  1NJY A;  3OYE A;  2VG5 A;  4MDB A;  1SAZ A;  2AP1 A;  1BOT O;  1NK4 A;  1ZYQ A;  1U2V B;  3CJ7 A;  4OKJ A;  3FFK B;  3K2P A;  3SI6 A;  2HB5 A;  3MAQ A;  5LJV A;  4BE0 A;  4FJ7 A;  1BI4 A;  4FJ9 A;  1EO1 A;  3LM2 A;  4GV3 A;  3NDK A;  2V7Y A;  1SKW A;  2ASM A;  3HL8 A;  3O1W A;  3WXL A;  4WCE L;  3OYJ A;  2P5O A;  2XY8 A;  3ZSX A;  3WUH A;  3LL3 A;  1MA9 B;  5KGW A;  3WXJ A;  3HBT A;  3OYL A;  1V4S A;  3VF6 A;  3J7A P;  4F3T A;  4YY3 K;  2X78 A;  3U6F A;  1LWE A;  2O8E A;  4QCL A;  2QA4 N;  3CJA A;  4DSL A;  3LDP A;  1N6Q A;  2F7T A;  4ID1 A;  3RR8 A;  3CM6 A;  3VOV A;  1EWQ A;  4H4M A;  4IJA A;  1NLV A;  4BRM A;  1NMD A;  3L3V A;  1NGF A;  1TUY A;  1LAV A;  5C15 A;  2RHK A;  1RBT A;  4A57 A;  1NK6 A;  1WAJ A;  3K9K A;  4JNE A;  4GKJ K;  1K8K B;  4LSN A;  5BN8 A;  3QNN A;  4CK2 A;  3KTQ A;  4B8A B;  5BPM A;  1VQO N;  3DLG A;  4GMJ B;  2UYT A;  1M90 O;  4GKK K;  4H0P A;  4OVL A;  2YNH A;  1C0G A;  3M8P A;  2OA8 A;  4KHY A;  3WNF A;  1S1X A;  4O4G A;  1TUU A;  1L3U A;  2ZGY A;  4H0Y B;  2P9S B;  3RMA A;  1Z6R A;  4M45 A;  2UXD K;  4FLT A;  1ATR A;  5GIP A;  4NLB A;  1OKJ A;  3D0P A;  4JRQ A;  2OPQ A;  4Z0U A;  3VQQ A;  4O0J A;  3KLI A;  2ASO A;  4OGC A;  5HOO A;  4WYB A;  4LH4 A;  3BF1 A;  1F21 A;  1VQ6 N;  5KPT A;  2JLE A;  2KW4 A;  1KAY A;  3RMD A;  1XQS C;  4A62 A;  2FBY A;  3AVB A;  5AQV A;  3ZSW A;  4YOX A;  5AZJ A;  3LWM A;  1QHA A;  1VSL A;  3QFU A;  1TK5 A;  1RT7 A;  1JLG A;  4FM2 A;  3BDP A;  3TAE A;  4J2A A;  4K41 A;  1HUX A;  3H45 C;  5BRD A;  5JLF A;  4CHZ A;  2G8H A;  4OKK A;  1LCU A;  4MQ3 A;  2D5R A;  5BRE A;  2ZJQ L;  5TKY A;  3R9P A;  3W3D A;  3SUN A;  4LF6 K;  5JS1 A;  1X9J A;  1G15 A;  3DRR A;  4G1Q A;  4QS7 A;  1BHL A;  4WQ4 C;  4FYD A;  4U67 L;  1U49 A;  2QWP A;  3IKM A;  3E9L A;  1BI4 B;  2V51 B;  1U47 A;  1SKR A;  2HMP A;  3AVH A;  4IO9 L;  4DV6 K;  4MO4 A;  3HT3 A;  4WQ4 A;  5HRP A;  2E2Q A;  3KKR A;  3LP0 A;  5AQU A;  1DLO A;  1H1V A;  4CE9 A;  3CCU N;  4FK2 A;  2Q0U A;  4MLE A;  4A5B A;  1WAF A;  3GE1 A;  1SQK A;  1SV5 A;  4EZ6 A;  2B6A A;  2KFN A;  3LZI A;  2O8E B;  3VGK A;  1CZ9 A;  4BQZ A;  4ICL A;  1TVR A;  1Z26 A;  2GUP A;  4M3R A;  3CQ8 A;  2ZF5 O;  2GV9 A;  2YHB A;  4AHR A;  3SMP A;  4FM1 A;  4N56 A;  4YOU A;  2XHB A;  3NAE A;  4DU1 A;  3VEX A;  3L2R A;  5KRS A;  3DLR A;  4CJL A;  4RCH A;  2FLO A;  4W5N A;  4KHW A;  5AQQ A;  3HSC A;  3TTF A;  3THX A;  4DTX A;  3F2K A;  1BQM A;  3CFP A;  3PLA A;  1ZBS A;  3BUZ B;  4Z4G A;  3D6R A;  3OYA A;  1WNS A;  4BR9 A;  2YNG A;  4B1V A;  4FW1 A;  3PO4 A;  2A5X A;  5AQR A;  1Y64 A;  4EZ9 A;  3L4I A;  4RWT A;  4KRF A;  4CGG A;  1QQM A;  2LSN A;  3CM5 A;  2CH5 A;  4LSL A;  1QQO A;  2JWK A;  4I9L A;  4BAC A;  4BWJ A;  5J2P A;  3L8B A;  5JLH A;  3U3Y A;  4A2B A;  1Q86 O;  3MX5 A;  2QW9 A;  4BC3 A;  4FJM A;  1ITG A;  4AM6 A;  3ZYY X;  3QEW A;  2O8B A;  2IOC A;  1RTD A;  1GLJ O;  4DQI A;  3AA5 X;  3CER A;  4CZG A;  5AZJ B;  4PWD A;  3O4W A;  4LF8 K;  2HND A;  4IBN A;  3ZSV A;  3AVC A;  1KD1 O;  4CZJ A;  5AQO A;  5AQX A;  4CFC A;  1BG3 A;  4YOW A;  3L3U A;  2G8F A;  2CH6 A;  4NXN K;  4ELV A;  1XNQ K;  3O9T A;  3AVK A;  1D9D A;  1KQS M;  4BRP A;  3QIC A;  3NVM A;  4FPB A;  5MLC Q;  1JLC A;  4KPY A;  2W6L A;  4DR5 K;  4C8M A;  3HTV A;  4CBW A;  4BWM A;  3H3O B;  4J2B A;  1HPM A;  1DEJ A;  3VEW A;  4FJJ A;  3QES A;  3NH2 A;  2KKZ A;  4CGI A;  5FRM A;  4RW7 A;  1OVY A;  4RW9 A;  4UY8 O;  1O13 A;  2EX3 A;  1BWF O;  4M63 C;  1XC3 A;  3J8A A;  3TAF A;  2RN2 A;  1YTA A;  4IOC L;  1C0U A;  4FJH A;  2PAV A;  3CPE A;  3AO4 A;  1JLA A;  2Z1I A;  2ZQB A;  4WFA L;  4LF9 K;  2IIR A;  1S9G A;  4EAH D;  4C8K A;  1NGJ A;  4B9U A;  4FWR A;  3O6W A;  4FK0 A;  4HUF A;  3MN5 A;  1NK8 A;  4QS9 A;  1V4T A;  4I2P A;  4OPK A;  3V9X A;  3CFO A;  1KVB A;  1Z05 A;  3PX6 A;  1EQY A;  1NGH A;  4JKF A;  1VQP N;  3THY A;  1P90 A;  2YV0 X;  4CES A;  3TTD A;  1VSE A;  1VAZ A;  1MU2 A;  5TKW A;  4BRK A;  1J54 A;  3NGI A;  4CW7 B;  3HZ6 A;  4LFC K;  3FLC O;  3PX0 A;  4EIA A;  4KHQ A;  1TL1 A;  4N5S A;  2HHT A;  3NH1 A;  2PFU A;  3THW A;  4JI8 K;  1HX1 A;  3AY9 A;  4AHV A;  4FXD A;  2ZJR L;  3E1Y A;  5CZ1 A;  4JV5 K;  3KLG A;  5BN9 A;  3THX B;  3UE5 A;  3EZW A;  1CZB A;  1RFQ A;  1JCG A;  4JI6 K;  3EY1 A;  3M5R A;  3QLH A;  1NKC A;  4L8R B;  3RTV A;  3PY8 A;  3SPY A;  4DU3 A;  3KZB A;  4YDU C;  3QET A;  5LL6 Z;  4IOA L;  4FJ8 A;  2NRW A;  3SQ2 A;  1HRH A;  3EE8 A;  3ZX3 A;  4BGA A;  4BRC A;  1ATN A;  3OTO K;  1VQ7 N;  3CCL N;  1IBL K;  3SNN A;  2W41 A;  1XC9 A;  1Q82 O;  3TPQ A;  4DTS A;  2XRI A;  3E9O A;  3CHW A;  4A59 A;  3QML A;  5LY3 A;  3QEV A;  1NJW A;  5AQK A;  3OYM A;  2O8B B;  3NMU A;  1I94 K;  5GIO A;  4OX9 K;  4JI4 K;  3CCV N;  5AZI A;  2WFB A;  4E7K A;  2YNI A;  4AF1 A;  2QXL A;  4WQ5 C;  5AQT A;  5ADX H;  4CJW A;  3CME N;  4BGB A;  3P39 A;  3CCS N;  3FE1 A;  2G8K A;  3A5O C;  4BC4 A;  2HHX A;  3ATV A;  1S6P A;  4KHP K;  3OYG A;  4W5R A;  4DS4 A;  3O3H A;  2PYJ A;  3LAN A;  4JK9 A;  2R7Y A;  4O8U A;  3J80 O;  3TSU A;  4OO1 J;  3C6H A;  3ZX0 A;  1A5X A;  4NXM K;  5AQY A;  4FZY A;  2AJQ A;  1X1P A;  2Q36 A;  3SUO A;  3IMX A;  1L3V A;  4JKB A;  1WUA A;  3PO5 A;  2OYQ A;  4XH4 A;  1GLC G;  5C24 A;  1ASW A;  3ZCM A;  5EY4 A;  4GVM A;  1OH7 A;  1GOC A;  3ENB A;  3VA3 A;  1SL2 A;  1ZXO A;  3DAW A;  4B9V A;  1FKO A;  4CJV A;  4KHS A;  1VQ9 N;  1K6Y A;  1FJG K;  4DMN A;  3HOT A;  5AQL A;  3HRG A;  1A5W A;  4KFB A;  2FBV A;  4CFA A;  1D5A A;  2B4J A;  2YHW A;  4U7B A;  4NCB A;  1JLB A;  2A1R A;  2P1J A;  3CCJ N;  5J2M A;  1W7A A;  3NGY A;  3VER A;  1VQN N;  3TAN A;  3ZSZ A;  2B5J A;  3AVF A;  3THY B;  3AO1 A;  3K5L A;  2GTD A;  3VQ8 A;  4CJS A;  1WSJ A;  1I3A A;  3LPU A;  4BRQ A;  5HL7 L;  4JEP A;  3JYT A;  2D4W A;  5C25 A;  4H4O A;  4GNI A;  5LMN K;  1KLN A;  3M8S A;  1BO5 O;  1RCH A;  3T7Z A;  3THW B;  2CGJ A;  3MED A;  4F8R A;  4DQR A;  4FJG A;  1QVG M;  2GWJ A;  4QS8 A;  2QKB A;  2BE2 A;  4ISG A;  3ULE B;  1L5U A;  1RDU A;  3TTC A;  4CZM A;  1P8Z A;  4BRH A;  3FZF A;  3LP1 A;  2OPS A;  1NNE A;  4BRL A;  5KQD A;  2P9N A;  4K0K K;  4DR7 K;  4B1X B;  3SAF A;  3IDH A;  2VQE K;  2F8S A;  1WOQ A;  2P9S A;  1FKP A;  3OA9 A;  4CEQ A;  3WQT A;  2O8F A;  4Y1C A;  1NM1 A;  3RVC A;  4B9L A;  3MEE A;  3K5O A;  4A5A A;  4CJF A;  1XI1 A;  1RNH A;  1QE1 A;  3JXU A;  4N76 A;  3UKR A;  1ZC6 A;  1RBU A;  4DUZ K;  4V19 S;  1BCO A;  1LW0 A;  4MFB A;  5AZI B;  1UA1 A;  1HNI A;  4B1U B;  4JKE A;  3JS6 A;  3AGK A;  3H6E A;  4A2A A;  4CFD A;  3DOL A;  2ITG A;  3AVL A;  3ZSR A;  3MX2 A;  1BIZ A;  5CR4 A;  5I9E B;  4DF4 A;  1RDW X;  5E84 A;  3NCI A;  2BTF A;  1T8E A;  4NYF A;  5JS2 A;  2FSJ A;  4H0O A;  3JAM O;  2PY5 A;  1J6Z A;  3OVN A;  3T1H K;  4FLW A;  3DYA A;  1X9M A;  5M1K A;  3OYN A;  4M3Y A;  2OTL N;  4ISE A;  3AA4 A;  1ESV A;  3T1A A;  3FZM A;  2JWL A;  3O8M A;  4N41 A;  1SS6 A;  4CEA A;  4CZI A;  3DLK A;  3TAR A;  4MLH A;  3CQX A;  3ITH A;  3I0S A;  2V52 B;  4B08 A;  1KFD A;  2P9I A;  1TKX A;  3WXK A;  3CJB A;  1BA0 A;  3WXM B;  4JI7 K;  2FBT A;  2IC3 A;  2HVH A;  3LDL A;  2XY7 A;  3OYC A;  4M3U A;  3ALY A;  4NO7 A;  3L0Q A;  5C10 A;  4YOY A;  2YCH A;  3HO1 A;  3QER A;  1JLF A;  1Q7Y O;  1HYZ A;  2F4V K;  4JS5 A;  4DFJ A;  3EO3 A;  4BRO A;  2RE2 A;  1M1K O;  3F5T A;  3HYF A;  3LPT A;  4KHN A;  2F8T A;  3O4Q A;  3HM9 A;  1C1A A;  2IS3 A;  3VES A;  1QHT A;  4ID5 A;  2I5J A;  3VGM A;  2A40 A;  2PZS A;  4NYN A;  3WQU A;  4H03 B;  4K42 A;  4BG9 A;  3F9K A;  5AFU A;  1KFS A;  1L3T A;  2HF3 A;  2QTD A;  1VSF A;  2E20 A;  3CC4 N;  4DG1 A;  1J53 A;  1RT1 A;  3V1R A;  4JI0 K;  1HNV A;  3KK3 A;  1B9F A;  3U9Z A;  2Q97 A;  3V6D A;  3TU5 A;  4Q5V A;  1VSM A;  3RRH A;  4BDP A;  5FLX O;  2WOM A;  1RBV A;  4YOV A;  5LJW A;  3DLH A;  1UOC A;  1NU0 A;  1NK9 A;  3V9U A;  3P4I A;  3MN7 A;  3R6M A;  2UXC K;  3S9H A;  2RKI A;  4WE1 A;  2P9N B;  3CJ1 A;  1XWL A;  3HI0 A;  4FK4 A;  1MWK A;  4H0T B;  2X6N A;  2O8F B;  4IFY A;  3M1F A;  4KTQ A;  2YJF A;  3OYB A;  2HHU A;  1C0F A;  1S22 A;  3AO2 A;  3KK7 A;  1I39 A;  3QO9 A;  4RW4 A;  3UKR B;  2HNY A;  1U45 A;  5FPE A;  2J4R A;  4DQ8 A;  1RTI A;  3ATU A;  3LAM A;  4CHP A;  1VK0 A;  4DR2 K;  5J1E A;  2VWJ A;  3T1Y K;  5CYQ A;  1VSH A;  1TYQ A;  4I7F A;  3QFP A;  5HRR A;  1N36 K;  2FBX A;  3Q7C A;  1NOZ A;  2WBN A;  1VQ5 N;  1IKW A;  3HJF A;  3K58 A;  1T05 A;  4BC2 A;  4BR5 A;  5KQ8 A;  2YKN A;  4HHT A;  4EP5 A;  4LF4 K;  2OCE A;  5GAG P;  3N4Q A;  4KBO A;  1WSE A;  1YJ9 N;  4B9M A;  4PL8 A;  4XEI A;  2ITM A;  3MMV A;  2QK9 A;  1ASV A;  1RDB A;  1YIT N;  2NUB A;  4MDA A;  1VQ4 N;  3K59 A;  3S41 A;  5CY4 A;  4KI6 A;  3O80 A;  2P9I B;  3L2V A;  2VYP A;  3IUC A;  3MEC A;  1KXP A;  2X6S A;  1T7P A;  2NNW A;  2YJE A;  3AVG A;  3T19 A;  1J9A A;  4Z94 A;  1IJJ A;  2D1K A;  4JI2 K;  4YNQ A;  3EZ5 A;  2E1Y A;  3I0R A;  4AQY K;  4JLH A;  2Z1H A;  1RDA A;  2P9K A;  4J8F A;  5T7B A;  4F9O A;  4JKA A;  3OYK A;  4BRF A;  1VRT A;  1C0M A;  3QIO A;  5CHI A;  3SJJ A;  4NCA A;  3BEX A;  4E19 A;  3KK1 A;  5EU7 A;  3UB5 A;  1VSK A;  4DSI A;  1GLB G;  2KLA A;  4FVU A;  3DMJ A;  1BL3 A;  1JXE A;  2IDO A;  4IEI A;  1VHX A;  2DFH A;  2RF2 A;  3VEV A;  4CJ7 A;  1YXQ A;  1D9F A;  2HHH K;  4CJQ A;  2UXB K;  2BDP A;  3D2F A;  1K8A O;  3MXJ A;  4CEF A;  1OVQ A;  3HPO A;  4O55 A;  2YHA A;  3WT0 A;  2IVP A;  3NF7 A;  3O9Q A;  3VQ9 A;  4IDK A;  4DKW A;  4BRG A;  4CVN E;  1YF5 L;  5GAE P;  4M7X A;  1ILY A;  1RT5 A;  3ZT3 A;  4CZE A;  1CXQ A;  3A5L C;  1BU6 O;  3CCQ N;  3AVN A;  5A2Q O;  1W2B M;  2ATQ A;  5JVG L;  5HP1 A;  1NKB A;  3P1G A;  4OKE A;  5FDL A;  4BVP A;  4FLY A;  1BIS A;  3KD5 E;  3GL1 A;  4DLE A;  5F1X A;  2OPR A;  2E6M A;  3NHG A;  1K73 O;  2UUC K;  1E4F T;  3AAQ A;  3HPG A;  4Z4I A;  4RW8 A;  1ZBI A;  3H08 A;  4I6M A;  4DQQ A;  3VEZ A;  1Q18 A;  5AQM A;  1IG8 A;  1NGD A;  5GAD P;  2Q0R A;  3BP8 A;  2QM1 A;  4IO8 A;  4DF8 A;  5FPN A;  2ZGZ A;  3OS0 A;  1GLE G;  4KRE A;  3VTH A;  1SKS A;  4PA1 A;  1ZBF A;  2KZM A;  2DTU A;  3KLH A;  4DV7 K;  4PUO A;  1Q8I A;  1TYQ B;  4XH1 A;  3ZT0 A;  1X9S A;  1RBR A;  2YNF A;  3A5N C;  3NGZ A;  4EP4 A;  2HBJ A;  3O9S A;  2HVI A;  1X9W A;  4PKG A;  4OLA A;  4E7J A;  5SZT A;  2D0P A;  3CXC M;  4DHY A;  3KWI A;  2W42 A;  4NB4 A;  4CGD A;  2RPI A;  3O08 A;  4FWK A;  1QQC A;  1TAU A;  4DWI A;  1TKT A;  3O9R A;  5AQI A;  4DV0 K;  1TKD A;  4PY5 A;  4OJR A;  4CJU A;  3V81 A;  1RDD A;  4HCC A;  4Q0B A;  2OTJ N;  3CCM N;  2NRR A;  1HNZ K;  3SQ1 A;  4AM7 A;  1TK8 A;  1S1U A;  3W0L A;  2F9W A;  4HTL A;  4CEE A;  2E4L A;  3Q7B A;  2KFZ A;  5BR8 K;  1QZ6 A;  3H1V X;  4K25 A;  2OAN A;  3QEI A;  3SK3 A;  1K9M O;  3AA2 A;  3GG4 A;  5HBM A;  3TAQ A;  3DOK A;  4Z4C A;  3QEP A;  4ILJ A;  4JI3 K;  3QBW A;  3TAM A;  2P9K B;  3DRS A;  5E26 A;  2FXU A;  3ID8 A;  3HVT A;  5AJ3 K;  2A1S A;  1S3X A;  5HRS A;  1NK7 A;  4DTP A;  2QWQ A;  4ILG B;  2E6L A;  5FRO A;  3QEX A;  3QDK A;  4AIL C;  4JKG A;  1VSI A;  1BCM A;  3E01 A;  5M1P A;  1XMQ K;  1HJR A;  1N5Y A;  5B8H A;  2BGG A;  2A6A A;  1TAQ A;  3DLE A;  3MDQ A;  3LWL A;  2QWR A;  3D2F B;  5KTQ A;  4C1N I;  3HXM A;  3T3F A;  3M8R A;  1RGI A;  3IAY A;  1YTU A;  4K8X A;  2HMI A;  4ZHR A;  5K14 A;  3ULE A;  4YHH K;  3KWG A;  4IXC A;  4BRA A;  3CIP A;  1VQM N;  2VGN A;  4Z4H A;  1XMO K;  1DGK N;  3H46 O;  1BDG A;  1RT2 A;  3VTI A;  4CF9 A;  1Y97 A;  4O0I A;  1X3N A;  4IG3 A;  4O5B A;  2NRT A;  1HLU A;  5KPR A;  3SQ4 A;  4NCG A;  3WEE B;  1NGA A;  4PQU A;  4DV3 K;  4GVE A;  3ENO A;  3HK2 A;  4I6M B;  1U48 A;  4HUG A;  3VET A;  2P9P A;  4B8C A;  1KVA A;  2GBZ A;  3V1O A;  4CCH A;  2WC9 A;  1YAG A;  1S1T A;  3C7N A;  3PUF A;  3VQP A;  4KH5 A;  3VQ4 A;  3K5M A;  2YHX A;  2OZS A;  2DFF A;  3S3O A;  3V9Z A;  4QAG A;  4DR3 K;  1X3M A;  2YKM A;  2QWL A;  2H3G X;  3DM2 A;  3LDN A;  4GV6 A;  2BAN A;  1TKZ A;  3O5B A;  2EWS A;  3LDQ A;  1YI2 N;  5CE3 A;  3UKU A;  4E7I A;  4IFE A;  4KTZ A;  2VG7 A;  4M42 A;  1TK0 A;  1IBK K;  5ADX A;  1VQK N;  3EKS A;  5DK5 A;  4AHS A;  4DV4 K;  4CJE A;  3BZK A;  3J81 O;  5BR9 A;  3MK6 A;  4B3O A;  2YHY A;  4BDZ A;  3O1B A;  4F3O A;  4O8K A;  2Z1J A;  4CGF A;  4BR2 A;  4CJK A;  4PL7 A;  3V4I A;  4FO0 A;  4DTO A;  4R79 A;  1QZ5 A;  3B8A X;  1N34 K;  4CJ5 A;  3PX4 A;  1D4X A;  3EKU A;  5E41 A;  3OHR A;  4PKI A;  2WTU A;  1QSL A;  2KHO A;  1KC8 O;  3LDS A;  5FPD A;  1ZBU A;  2HOE A;  3V1Q A;  3WNG A;  3QBX A;  4BRI A;  2E2O A;  3NH0 A;  2UU9 K;  3SV3 A;  2JGU A;  3RRG A;  1CZA N;  4FOI A;  2IGI A;  5F2R A;  4IWV A;  3C0B A;  3R1X A;  3WNE A;  3G6E N;  1NGE A;  4DV2 K;  1S6Q A;  5IWA K;  4JN4 A;  3SAH A;  1G99 A;  3D7E O;  5AQJ A;  5JVH L;  3I33 A;  3A0I X;  4BVO A;  3L4Q A;  4JKG B;  3L2W A;  3C94 A;  3VQA A;  2GUI A;  3CQY A;  3CFR A;  3M3Z A;  2Y1I A;  1QS4 A;  1S5J A;  2NLX A;  1JLQ A;  3AO3 A;  3WNH A;  4KH6 A;  4CZF A;  4M7Y A;  1T3V A;  4BDY A;  3NF8 A;  1IKV A;  4FWO A;  2QI2 A;  1NJX A;  3MCP A;  5EXW A;  3ZT4 A;  2O8C B;  3ZT2 A;  4DTU A;  2W40 A;  5AQN A;  2IVN A;  3ASM A;  4FWN A;  3SYZ A;  4E1N A;  2GEM A;  4FWQ A;  3OYD A;  4E7L A;  1T44 A;  3WXI A;  4HUE A;  5BPL A;  4KH4 A;  3DRP A;  4J2D A;  1GOA A;  5ELZ A;  5HLF A;  1QSS A;  4FCY A;  3ZT1 A;  4GW6 A;  1IBM K;  1C1C A;  1NGG A;  3G10 A;  5I42 A;  3MEG A;  2HF4 A;  5HRN A;  1VRU A;  3BGR A;  4DV1 K;  1W9H A;  4GV9 A;  2P9P B;  2VWB A;  1NBW A;  3TAG A;  1JXB A;  2P51 A;  3C7N B;  1C6V A;  3AV9 A;  2FF6 A;  4KO0 A;  1WSI A;  2KZZ A;  5CYM A;  4BG8 A;  4CIF A;  1RTJ A;  3KLE A;  2QWN A;  2ZD1 A;  2HST A;  2ZE2 A;  4DTN A;  3VGL A;  4WF9 L;  2HNZ A;  4OGE A;  1LWF A;  5KRT A;  4X64 K;  2QXF A;  1WSF A;  4BRD A;  2AA4 A;  2ETJ A;  3UKU B;  1HR0 K;  4AHC A;  3EN9 A;  4FWL A;  2D0A A;  3ISN C;  4B1W B;  2PBD A;  5J2N A;  1S1V A;  3C6T A;  1W0H A;  1YUW A;  3OS1 A;  3MWP A;  3I56 N;  4B3S K;  4RG8 A;  3ZX2 A;  4LC9 B;  3VF4 A;  2HBK A;  4KHU A;  3U8X A;  1OH8 A;  3SZ2 A;  3CYM A;  4IKF A;  5C0Y A;  2O4I A;  1HYV A;  2G8W A;  1JL2 A;  4KKO A;  4BR0 A;  1EXQ A;  5DM7 L;  4QOZ B;  4X62 K;  1VQL N;  4CJ3 A;  2E8A A;  2FC0 A;  3SLC A;  1GLA G;  1NK0 A;  1VSD A;  2ASP A;  3M8Q A;  4DSE A;  3VEN A;  4JAX A;  4CEB A;  3GOI A;  4DV5 K;  4IG0 A;  5JMV A;  3HP6 A;  2Q3S A;  2YX6 A;  4W5O A;  4TSX A;  3OYI A;  1HMV A;  4H5W A;  1B92 A;  4UQG A;  1S72 N;  1IH7 A;  4OLB A;  1E3M A;  1BUP A;  3DWL A;  2A42 A;  3U3G A;  4FWS A;  4CZL A;  4CHN A;  2NRZ A;  4CZK A;  3DXK A;  2WON A;  5F0X A;  4DTR A;  3NVK A;  1NJZ A;  3HPH A;  5AFU H;  1IG9 A;  3D2E B;  2PYL A;  1WBD A;  3V9S A;  4OPH A;  2V7Z A;  3FZK A;  1NJI O;  1JCF A;  4O44 A;  5M1N A;  3J7Z O;  3NE6 A;  1O1W A;  5KI6 A;  1N33 K;  4OPA A;  1ASU A;  3CC2 N;  4CGH A;  3OBY A;  1DKG D;  2HBM A;  1RIL A;  3F9M A;  3G71 N;  2GWK A;  4I2Q A;  1QSY A;  1LW2 A;  4DTJ A;  5AQZ A;  4H5V A;  3NF9 A;  4HVJ A;  4CEO A;  3E9P A;  1OH6 A;  1TV6 A;  5BPN A;  4B1Z A;  3AVJ A;  1REV A;  1KAZ A;  5AQS A;  5KPZ A;  4DU4 A;  2WUS A;  3NF6 A;  4B3M K;  1IKX A;  4YFU A;  5D3G A;  3CD6 N;  1JJ2 M;  2Q1N A;  5EOY A;  2VWK A;  4CJT A;  5AQH A;  4EHT A;  1VSJ A;  3DXM A;  4JKD A;  3MN9 A;  3R3L A;  3HM8 A;  3C65 A;  4FSV A;  3SBG A;  4JHD A;  3VQ5 A;  3VF2 A;  3SUP A;  4JD2 A;  1HNX K;  4FL9 A;  4IJN A;  4Y1D A;  3DLL L;  4H5N A;  2KTQ A;  4AHU A;  1HPZ A;  4FWP A;  1N8R O;  4C8L A;  4WFB L;  1JCE A;  3G4S N;  2A3Z A;  5BRF A;  3B6P A;  1BA1 A;  3G0Z A;  4M3T A;  3PSI A;  3TR8 A;  3PSF A;  4CZH A;  4FJK A;  1YT3 A;  3FGU A;  3SAG A;  1NG9 A;  4CFB A;  4EFH A;  2E5L K;  3NBP A;  1U6Z A;  4IZ9 A;  1NK5 A;  3RWU A;  4DLG A;  3IG1 A;  5AQW A;  2VCP A;  4KI4 A;  4CK3 A;  4G9Z A;  1KTQ A;  4CJR A;  3U4L A;  3JSM A;  1DTQ A;  4AH9 A;  3D45 A;  4CI6 A;  5C42 A;  4CF0 A;  2D0O A;  2E88 A;  3O4N A;  1HJO A;  1EET A;  3OBW A;  4CHQ A;  1WBB A;  4CBX A;  1BIU A;  4FLX A;  4BY9 C;  3IFR A;  3O9U A;  3B6O A;  1BQN A;  4X65 K;  1WN7 A;  4AHT A;  3AVM A;  2HBL A;  3N4P A;  3LM9 A;  4C23 A;  2ZM6 K;  2VGM A;  1ATS A;  4JRP A;  4E3S A;  2NZT A;  5EX5 A;  1LWC A;  1BGX T;  4MO5 A;  4I9Q A;  4CHY A;  5SWM A;  5J2Q A;  4FJL A;  4W5Q A;  2KQ2 A;  3A5M C;  4M3Z A;  4M41 A;  3DXK B;  1S9E A;  2G8V A;  3DI6 A;  3AO5 A;  2GX9 A;  2XO7 A;  1HKG A;  3MWT A;  3EL2 A;  3RSE A; 
#chains in the Genus database with same CATH homology
 1CXU A;  1N6Q A;  2BGG A;  3AVA A;  1TAQ A;  4ID1 A;  3DLB A;  3DLE A;  5C25 A;  3LWL A;  4RW6 A;  3RR8 A;  3CM6 A;  4H4O A;  5KTQ A;  4KTW A;  4H4M A;  3VA0 A;  1KLN A;  3HXM A;  3T3F A;  3M8S A;  3M8R A;  1RCH A;  4CIE A;  3L3V A;  1LAV A;  3IAY A;  1WSG A;  1XHZ A;  1YTU A;  3CG7 A;  3MED A;  4F8R A;  1RBT A;  4K8X A;  4DQR A;  2HMI A;  4ZHR A;  1NK6 A;  5K14 A;  4FJG A;  1SL1 A;  1WAJ A;  3A2F A;  2QKB A;  2BE2 A;  4LSN A;  1L5U A;  3S3N A;  3QNN A;  4Z4H A;  4CK2 A;  3KTQ A;  4B8A B;  3DLG A;  1ZBL A;  1RT2 A;  3LP1 A;  2OPS A;  4GMJ B;  3UIQ A;  4CF9 A;  5FRN A;  1Y97 A;  4FLZ A;  4O0I A;  4IG3 A;  4O5B A;  3SQ4 A;  3VQ7 A;  4OVL A;  4NCG A;  2YNH A;  3M8P A;  4KV8 A;  4PQU A;  2F8S A;  4FJI A;  4DFK A;  3HK2 A;  2OA8 A;  4KHY A;  1FKP A;  1S1X A;  4O4G A;  3WNF A;  1L3U A;  3LAK A;  1U48 A;  4HUG A;  4CEQ A;  4Y1C A;  4B8C A;  1KVA A;  3RMA A;  1RT4 A;  4M45 A;  4ELT A;  4FLT A;  2GBZ A;  1KCF A;  3V1O A;  4CCH A;  4B9L A;  1S1T A;  3MEE A;  3PUF A;  3VQP A;  3D0P A;  4JRQ A;  2OPQ A;  3K5O A;  3VQ4 A;  1CLQ A;  3K5M A;  4CJF A;  4Z0U A;  1XI1 A;  2OZS A;  1RNH A;  1QE1 A;  3VQQ A;  4O0J A;  3KLI A;  4OGC A;  4N76 A;  2DFF A;  3S3O A;  3V9Z A;  4LH4 A;  1KVC A;  4QAG A;  1F21 A;  1RBU A;  3P5J A;  2JLE A;  1BCO A;  2KW4 A;  2YKM A;  1LW0 A;  4MFB A;  4JS4 A;  1UA1 A;  1HNI A;  3DM2 A;  4M3W A;  2BAN A;  3TAB A;  3RMD A;  1TKZ A;  3RMC A;  4CFD A;  2FBY A;  3DOL A;  3AVB A;  1S1W A;  3ZSW A;  3SV4 A;  2ITG A;  1C0T A;  3LWM A;  3AVL A;  3ZSR A;  1BIZ A;  3SUQ A;  1TGO A;  4CED A;  4E7I A;  1L3S A;  4KTZ A;  1VSL A;  4DF4 A;  2VG7 A;  1TK5 A;  4M42 A;  3P83 D;  1IKY A;  1RT7 A;  4DSF A;  4CER A;  1JLG A;  4CEZ A;  3NCI A;  4FM2 A;  1TK0 A;  1FK9 A;  1T8E A;  3QIN A;  4NYF A;  5JS2 A;  3TAE A;  3BDP A;  4J2A A;  5DK5 A;  4AHS A;  1JLE A;  3ZSQ A;  1UWB A;  4CJE A;  1HQU A;  2PY5 A;  4CHZ A;  2G8H A;  3OVN A;  4OKK A;  4FLW A;  3DYA A;  1X9M A;  4MQ3 A;  4J2E A;  3OS2 A;  3OYN A;  4BDZ A;  4BE1 A;  4M3Y A;  4B3O A;  2D5R A;  4F3O A;  4B9T A;  2Z1J A;  4CGF A;  1UAX A;  3AA4 A;  3SUN A;  4CJK A;  5JS1 A;  3U6F A;  1G15 A;  3V4I A;  3T1A A;  3DRR A;  4G1Q A;  4N41 A;  4CEA A;  4DTO A;  1BHL A;  4FYD A;  3DLK A;  3TAR A;  4CJ5 A;  4C8N A;  2G8U A;  1U49 A;  3PX4 A;  1BI4 B;  1RT3 A;  5E41 A;  5DMR A;  3S3M A;  1GOB A;  1DTT A;  4LH5 A;  1QSL A;  1U47 A;  1SKR A;  3LP3 A;  3ITH A;  3I0S A;  2XY6 A;  3OJS A;  3KLF A;  3AVH A;  2HHW A;  4B08 A;  3LDS A;  1KFD A;  1ZBU A;  3V1Q A;  1TKX A;  3WNG A;  4ZTJ A;  1U04 A;  3NH0 A;  2FBT A;  2IC3 A;  2HVH A;  3SV3 A;  2JGU A;  3RRG A;  2XY7 A;  3OYC A;  3HT3 A;  5HRP A;  2IGI A;  1EP4 A;  4M3U A;  3ALY A;  3LP0 A;  3KKR A;  1LV5 A;  4FZZ A;  1DLO A;  1XHX A;  3WNE A;  1ZBH A;  4FK2 A;  4CE9 A;  4E89 A;  1S6Q A;  3HO1 A;  3QER A;  1JLF A;  1HYZ A;  4JS5 A;  4DFJ A;  3THV A;  1WAF A;  3K5N A;  4FLU A;  2O4G A;  4FJN A;  1SV5 A;  4EZ6 A;  2B6A A;  3HYF A;  3LPT A;  4HCB A;  2KFN A;  3LZI A;  4KHN A;  2F8T A;  4FJX A;  3O4Q A;  3L2W A;  3HM9 A;  1C1A A;  3C94 A;  2IS3 A;  3VQA A;  1CZ9 A;  1QHT A;  2GUI A;  2I5J A;  3KIO A;  4ID5 A;  4ICL A;  4NYN A;  3CFR A;  2PZS A;  1TVR A;  4E0D A;  2Y1I A;  3F9K A;  1Z26 A;  1QS4 A;  1S5J A;  3AO3 A;  1JLQ A;  3WNH A;  4M3R A;  3CQ8 A;  1LAW A;  2GV9 A;  2YHB A;  4AHR A;  3NF8 A;  4BDY A;  4FM1 A;  1L3T A;  1KFS A;  1VSF A;  1IKV A;  4N56 A;  4DG1 A;  1J53 A;  2XHB A;  1U4B A;  1RT1 A;  3V1R A;  1NJX A;  4FVM A;  1HNV A;  3KK3 A;  1B9F A;  3HP9 A;  3ZT4 A;  3NAE A;  3ZT2 A;  4DU1 A;  4DTU A;  2P5G A;  3V6D A;  4E7H A;  3L2R A;  5KRS A;  4FJ5 A;  3ASM A;  3DLR A;  1VSM A;  4Q5V A;  4CJL A;  3SYZ A;  4DSJ A;  3RRH A;  3VQD A;  4E1N A;  4W5N A;  4BDP A;  2WOM A;  1RBV A;  1D8Y A;  3DLH A;  4CJP A;  1UOC A;  3OYD A;  4E7L A;  3SCX A;  3TI0 A;  4KHW A;  4HUE A;  3KK2 A;  3DRP A;  4J2D A;  1NK9 A;  1GOA A;  4ZTF A;  5HLF A;  1QSS A;  3V9U A;  3ZSO A;  4FCY A;  4DTX A;  2G8I A;  1A5V A;  1BQM A;  3ZT1 A;  3CFP A;  3SPZ A;  4GW6 A;  2DY4 A;  4CF2 A;  1C1C A;  2OPP A;  4CIG A;  3S9H A;  2RKI A;  3G10 A;  4WE1 A;  4Z4G A;  5I42 A;  1XWL A;  3HST B;  3MEG A;  3OYA A;  4IFV A;  3KKS A;  3L2U A;  1WNS A;  5HRN A;  4FK4 A;  3AVI A;  1VRU A;  2YNG A;  3BGR A;  4FW1 A;  3OJU A;  3PO4 A;  2X6N A;  1W9H A;  2X74 A;  4EZ9 A;  4IFY A;  1Q9X A;  3TAG A;  4KTQ A;  1R0A A;  1JXB A;  3OYB A;  2P51 A;  4CGG A;  4KRF A;  2HHU A;  2LSN A;  3CM5 A;  2IAJ A;  1B9D A;  3AO2 A;  1C6V A;  3AV9 A;  4LSL A;  4I9L A;  1I39 A;  3TAP A;  3QO9 A;  4RW4 A;  4KO0 A;  1WSI A;  4BAC A;  5CYM A;  5I3U A;  4BWJ A;  5J2P A;  2KZZ A;  3L8B A;  2HNY A;  1U45 A;  4CIF A;  1RTJ A;  1RTI A;  3U3Y A;  3LAM A;  4CHP A;  3LZJ A;  1VK0 A;  3KLE A;  4FJM A;  1ITG A;  2ZD1 A;  5J1E A;  3O3G A;  2VWJ A;  3PV8 A;  2ZE2 A;  5CYQ A;  4DTN A;  3QEW A;  1VSH A;  2Z1G A;  2HNZ A;  2IOC A;  4DSK A;  2HHS A;  1RTD A;  4DFM A;  4OGE A;  4DQI A;  4I7F A;  1LWF A;  5KRT A;  3AA5 X;  5HRR A;  4DTM A;  2FBX A;  1NOZ A;  2QXF A;  4DS5 A;  1WSF A;  4PWD A;  2EHG A;  2ETJ A;  2HND A;  4IBN A;  4AHC A;  3ZSV A;  3AVC A;  4C8O A;  1WLJ A;  3VQB A;  1SUQ A;  3QIP A;  1IKW A;  1HQE A;  3L2Q A;  4CHO A;  3HJF A;  2D0A A;  3ISN C;  4CFC A;  3K58 A;  1Z25 A;  4KB0 A;  1T05 A;  3IRX A;  3L3U A;  2G8F A;  5J2N A;  3OY9 A;  3IS9 A;  4ELV A;  1S1V A;  3C6T A;  1W0H A;  3OS1 A;  1SL0 A;  2YKN A;  4HHT A;  2VG6 A;  4EP5 A;  1QTM A;  3SQ0 A;  4RG8 A;  3AVK A;  1D9D A;  3MXM A;  4XIU A;  4HTU A;  1JLC A;  4KPY A;  4KHU A;  1TL3 A;  4LY7 A;  3RR7 A;  4C8M A;  3SZ2 A;  3CYM A;  4IKF A;  1WSE A;  4B9M A;  2OZM A;  1HYV A;  2O4I A;  3LP2 A;  4CGJ A;  2G8W A;  2QK9 A;  1JL2 A;  4BWM A;  4KKO A;  1C1B A;  4J2B A;  1ASV A;  1EXQ A;  1T03 A;  1RDB A;  1WSH A;  1JKH A;  3O3F A;  2QKK A;  4QOZ B;  4FJJ A;  2NUB A;  4CJ3 A;  1N5Y A;  3QES A;  4DQP A;  4F4K A;  3K59 A;  3NH2 A;  4F3T A;  4Z4E A;  1J5O A;  5CY4 A;  2FC0 A;  4CGI A;  4KI6 A;  3ULD A;  5FRM A;  1NK0 A;  4RW7 A;  3L2V A;  4RW9 A;  1VSD A;  3MEC A;  4H8K A;  2EX3 A;  3M8Q A;  4DSE A;  4DQS A;  4M3X A;  2X6S A;  1T7P A;  4CEB A;  3TAF A;  3AVG A;  3T19 A;  1KSP A;  4F2R A;  1J9A A;  5KGX A;  3VQE A;  2RN2 A;  1YTA A;  4IG0 A;  3HP6 A;  1C0U A;  4FJH A;  2Q3S A;  4YNQ A;  3EZ5 A;  5CZ2 A;  4W5O A;  3AO4 A;  1JLA A;  2Z1I A;  2ZQB A;  3I0R A;  4TSX A;  3OYI A;  1S9G A;  1HMV A;  1YVU A;  4JLH A;  1B92 A;  1RDA A;  2Z1H A;  4UQG A;  1KRP A;  4C8K A;  4K8Z A;  1IH7 A;  5T7B A;  4B9U A;  4OLB A;  4FK0 A;  4HUF A;  1NK8 A;  3U3G A;  3OYK A;  3EYZ A;  4CF8 A;  4I2P A;  4OPK A;  1VRT A;  1C0M A;  3QIO A;  2D0C A;  3CFO A;  4CHN A;  1KVB A;  4OPJ A;  3V9X A;  3SJJ A;  3PX6 A;  4NCA A;  4CJ4 A;  4E19 A;  4R5P A;  3KK1 A;  5EU7 A;  1FXX A;  1VSK A;  2WON A;  4DTR A;  4DSI A;  3F73 A;  3DMJ A;  1BL3 A;  2YV0 X;  1JXE A;  2IDO A;  4CES A;  1UA0 A;  1VSE A;  3LAL A;  1RDC A;  2DFH A;  1MU2 A;  2RF2 A;  3NFA A;  4FM0 A;  3HPH A;  1NJZ A;  1IG9 A;  1D9F A;  3TWH A;  2PYL A;  3V9S A;  1J54 A;  3NGI A;  4FZX C;  1JL1 A;  3PX0 A;  4CJQ A;  2BDP A;  4O44 A;  3NE6 A;  1O1W A;  4KHQ A;  1TL1 A;  3MXJ A;  5KI6 A;  4CEF A;  4N5S A;  4FLV A;  2HHT A;  1EKE A;  3NH1 A;  4LD0 A;  4FW2 A;  2XY5 A;  3HPO A;  1ASU A;  4O55 A;  3ZSY A;  1NKE A;  4CGH A;  2YHA A;  4AHV A;  1RIL A;  4FXD A;  3K57 A;  3NF7 A;  4I2Q A;  1LW2 A;  4IDK A;  3VQ6 A;  3VQ9 A;  1EX4 A;  4BE2 A;  4DTJ A;  1QSY A;  5CZ1 A;  3NF9 A;  4HVJ A;  3KLG A;  1RT5 A;  4CEO A;  4F2S A;  4CK1 A;  1RT6 A;  3HVR A;  1TV6 A;  3ZT3 A;  1RBS A;  4E1M A;  1CXQ A;  1CZB A;  3AVJ A;  4N47 A;  3OYH A;  1REV A;  3AVN A;  3EY1 A;  2ATQ A;  3VN5 A;  5HP1 A;  4KAZ A;  3QLH A;  4DU4 A;  3P1G A;  4OKE A;  5FDL A;  4FLY A;  1NKB A;  3RTV A;  1NKC A;  3PY8 A;  3NF6 A;  2D0B A;  4L8R B;  1IKX A;  1BIS A;  3KD5 E;  4DLE A;  3SPY A;  4YFU A;  4DU3 A;  2OPR A;  5D3G A;  2E6M A;  3QET A;  3NHG A;  4FJ8 A;  3SQ2 A;  1HRH A;  3HPG A;  2VWK A;  3RMB A;  4Z4I A;  4CJT A;  2HHQ A;  4RW8 A;  1VSJ A;  3FFI A;  2DFE A;  1ZBI A;  3H08 A;  1IO2 A;  1Q9Y A;  3V9W A;  4DQQ A;  3AA3 A;  3SNN A;  3C95 A;  3VQ5 A;  2F96 A;  1XC9 A;  4DTS A;  2XRI A;  3SUP A;  3KD1 E;  4DF8 A;  1KLM A;  1NOY A;  3OS0 A;  4Y1D A;  4KRE A;  2Y1J A;  3MXI A;  4W5T A;  1SKS A;  3QEV A;  4PA1 A;  1ZBF A;  3OYM A;  1NJW A;  3KLH A;  2KTQ A;  4AHU A;  4PUO A;  2HHV A;  2KZM A;  2DTU A;  1HPZ A;  1Q8I A;  3ZT0 A;  1X9S A;  1RBR A;  5HRO A;  4C8L A;  2YNF A;  3C6U A;  4Z4F A;  3NGZ A;  4EP4 A;  4E7K A;  2YNI A;  3QNO A;  3B6P A;  4DFP A;  2HVI A;  4CEC A;  1X9W A;  4OLA A;  3G0Z A;  4M3T A;  4E7J A;  3TR8 A;  5SZT A;  4B9S A;  4ELU A;  4CJW A;  2W42 A;  4FJK A;  1YT3 A;  3VQC A;  1RTH A;  2G8K A;  4CGD A;  2RPI A;  2HHX A;  4CFB A;  1TAU A;  1QQC A;  4DWI A;  1TKT A;  1S6P A;  1TKD A;  3OYG A;  3NBP A;  4CF1 A;  4PY5 A;  4OJR A;  4CJU A;  4W5R A;  3O3H A;  4DS4 A;  1RDD A;  3LAN A;  2R7Y A;  3V81 A;  1NK5 A;  2PYJ A;  3OYF A;  4DLG A;  3RWU A;  4HCC A;  3KJV A;  4Q0B A;  3IG1 A;  4KI4 A;  4CK3 A;  1KTQ A;  4CJR A;  4KB1 A;  4B9N A;  3SQ1 A;  2HW3 A;  3JSM A;  1DTQ A;  4AH9 A;  1A5X A;  3I8D A;  1TK8 A;  1S1U A;  3D45 A;  4FZY A;  1NJY A;  3OYE A;  2VG5 A;  2AJQ A;  1X1P A;  4CEE A;  1NK4 A;  5C42 A;  1ZYQ A;  4CF0 A;  2E4L A;  2KFZ A;  4OKJ A;  3SUO A;  1L3V A;  3O4N A;  3K2P A;  3SI6 A;  2HB5 A;  3MAQ A;  1EET A;  4BE0 A;  4FJ7 A;  1BI4 A;  4FJ9 A;  4CHQ A;  3QEI A;  3PO5 A;  2OYQ A;  1BIU A;  5C24 A;  1ASW A;  3ZCM A;  4GVM A;  4FLX A;  3NDK A;  3AA2 A;  1GOC A;  5HBM A;  3VA3 A;  3B6O A;  1BQN A;  1SL2 A;  3TAQ A;  1SKW A;  1WN7 A;  3DOK A;  4AHT A;  4Z4C A;  3HL8 A;  4B9V A;  3QEP A;  1FKO A;  3AVM A;  4CJV A;  4KHS A;  3OYJ A;  4JRP A;  2P5O A;  3TAM A;  1K6Y A;  4E3S A;  3DRS A;  4DMN A;  2XY8 A;  1LWC A;  3ZSX A;  1BGX T;  4I9Q A;  1A5W A;  4KFB A;  4CHY A;  2FBV A;  4CFA A;  1D5A A;  3HVT A;  2B4J A;  5SWM A;  2A1S A;  5J2Q A;  5HRS A;  1NK7 A;  4FJL A;  4DTP A;  5KGW A;  2KQ2 A;  1JLB A;  4W5Q A;  2A1R A;  2P1J A;  4NCB A;  4M3Z A;  3OYL A;  4M41 A;  5J2M A;  2E6L A;  3NGY A;  5FRO A;  1S9E A;  3QEX A;  3TAN A;  3ZSZ A;  2B5J A;  3AVF A;  2X78 A;  4AIL C;  2G8V A;  3AO1 A;  1VSI A;  3AO5 A;  3DI6 A;  1BCM A;  1LWE A;  2XO7 A;  3K5L A;  3VQ8 A;  4CJS A;  1WSJ A;  4QCL A;  1I3A A;  3E01 A;  3LPU A;  1HJR A;  1HYS A;  3JYT A;  4DSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...