4KAZA

Crystal structure of rnase t in complex with a y structured dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 61
structure length 206
sequence length 206
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kazA00
2QXFA 2JGUA 4RW6A 1VSDA 4RW8A 2G8KA 4DQSA 1D9DA 2HHWA 2AJQA 4W5NA 3EY1A 4G1QA 4CJTA 2G8FA 3SPZA 3BDPA 3PV8A 1UWBA 3DMJA 4LH4A 3NH0A 3G0ZA 1L3VA 1F21A 4RW9A 3CM6A 2KZMA 5C42A 5J2QA 4CJ5A 2XY6A 4J2DA 4CJUA 4E1NA 4CEBA 1S1VA 3OY9A 4FJXA 1RBUA 2GBZA 4QOZB 3EZ5A 1DTQA 2P51A 1RBRA 3KLIA 4FXDA 1X1PA 4DQPA 4O4GA 3VQBA 3U3GA 1B92A 3D45A 3LWMA 4HUGA 1HQUA 1WN7A 1CZBA 2E4LA 4H4MA 4IBNA 5SWMA 1HPZA 3SJJA 4FW1A 5C24A 1BIUA 2OPQA 1N6QA 1ASVA 1T7PA 3OYNA 1VRTA 3C6UA 1I39A 1JLEA 3AVMA 4DTJA 2O4GA 3D0PA 1FK9A 3I0RA 4FZYA 2KZZA 1HNIA 4PY5A 2DFEA 4FJJA 2YHAA 1SL1A 1JKHA 4CGHA 3NF9A 3NHGA 4KI4A 5FRMA 3SPYA 1KFSA 5JS1A 3AVGA 3SV4A 4B9UA 4E19A 3JYTA 1JXBA 1JLBA 4AH9A 4B9NA 4CIFA 3CG7A 4RW4A 5T7BA 3VQQA 3PX4A 1NK7A 2QKKA 1HQEA 4OPJA 1EX4A 3SUOA 1JLAA 3OYCA 4C8LA 4LSNA 4M3XA 3HP9A 1RTHA 1UAXA 2IAJA 3K5NA 3IS9A 5KRTA 4DFMA 1X9WA 4M3UA 1QHTA 2ETJA 2YNIA 4R5PA 1B9DA 3SV3A 3S3MA 4NYFA 4KAZA 3P1GA 2JLEA 2P1JA 3SUQA 3SQ1A 1A5WA 1LW2A 1VSEA 2E6LA 1RDCA 3V1QA 4DMNA 1L3TA 2KFZA 3OYJA 4CK1A 2OPSA 4ELTA 4Z0UA 3LAKA 4NCBA 3KKRA 2HNYA 1EXQA 1RCHA 5HBMA 3O3HA 4HCCA 1LAVA 5CYMA 3WNGA 3QESA 1FXXA 2WOMA 1UA0A 2YV0X 3ZSVA 4CEDA 2FBTA 2ZD1A 4ZHRA 3ZSQA 4B08A 3OS1A 1U45A 1T8EA 4AILC 3LDSA 4KO0A 4DTSA 3ZSWA 3AO2A 3WNFA 3DRPA 4DSIA 4CHNA 2KQ2A 3AO3A 4B9MA 1BIZA 4FM0A 2X6SA 4FK2A 4DSEA 1G15A 4DTPA 3SQ0A 3VQ6A 4BACA 1IKXA 3ALYA 4NCAA 3U6FA 3OYHA 4BE2A 4FLWA 2BGGA 3AA3A 4C8MA 3TR8A 1LWCA 1TAQA 3P83D 4OGCA 4FJIA 1TVRA 3PY8A 3M8PA 1S9EA 2HHXA 3RTVA 3KKSA 1O1WA 4E1MA 3RMCA 4FK4A 3RMDA 4CEZA 4ELVA 1BCOA 4O55A 3V9UA 1BCMA 4CHZA 3ZSXA 4BWMA 4O0IA 4O44A 1QSYA 4JLHA 1WSGA 3RWUA 4KI6A 3E01A 3TI0A 1RDBA 3VQPA 2DTUA 1JLFA 3VQ4A 4QAGA 3ZT1A 2D0BA 4CHYA 1VRUA 3KJVA 3LWLA 3KK2A 5J2PA 4M3YA 4OLBA 2HVIA 5E41A 3O3FA 3OYDA 1NOYA 4KHSA 3V9ZA 2Z1JA 2RN2A 4OKJA 4CJRA 2Y1IA 4E7HA 1RT5A 1TKZA 2LSNA 3K59A 4KTQA 4KHQA 4H4OA 1WAFA 1C0UA 1EETA 2YKMA 3QO9A 4DFPA 4J2BA 4FLVA 1SV5A 3OYBA 4DTOA 3LANA 4IDKA 4BWJA 3SQ4A 2YNHA 4YFUA 4DSLA 1XHXA 4FJMA 3SI6A 1XHZA 4CCHA 4L8RB 2OA8A 3LZIA 3DOKA 4DS5A 3AA5X 3IAYA 4CJWA 5CY4A 4AHUA 3KLHA 1MU2A 4CHOA 3HL8A 3DYAA 3LPUA 4WE1A 4E3SA 1L3UA 3UIQA 1RT6A 4W5TA 4HTUA 4GW6A 4OGEA 3T1AA 5I42A 3L2UA 3V1RA 4FZXC 4DU4A 2W42A 1SKRA 3TAMA 3F9KA 4CF9A 3SUNA 4CFDA 3CQ8A 4ZTJA 1IKWA 4BDPA 4AHVA 2R7YA 3S9HA 3ITHA 3AV9A 4W5QA 1IKYA 2HNZA 1N5YA 2HHTA 4CGJA 2PYLA 4Z4FA 4CECA 3OYAA 4DF4A 3HVRA 3L2WA 4F4KA 5KRSA 3QNOA 1B9FA 2VWJA 3KD1E 2EX3A 4KRFA 1T05A 1S1TA 4JS4A 3TWHA 4CEAA 5KI6A 2O4IA 1GOAA 4M3TA 4K8XA 1HRHA 3QLHA 3AO1A 1VSLA 3OYFA 1JL1A 1K6YA 1RT7A 1HNVA 4KPYA 4LSLA 1TKXA 1NK6A 4CJ4A 2YKNA 4F3TA 1TGOA 4FJKA 3TAFA 5CZ2A 4CGDA 1RT1A 3NCIA 2FC0A 4PWDA 1TK8A 1RT4A 1XWLA 2HW3A 2IS3A 1TK0A 4M3ZA 4B9TA 3DLEA 5J2NA 3TANA 4OLAA 1S6QA 3ZT3A 3HPGA 3ZSZA 1CXUA 1VK0A 1KCFA 4E7IA 3LZJA 2OZSA 1TL1A 3C95A 3OJSA 2G8IA 4DTRA 3VQCA 1YVUA 4F8RA 1NK0A 2OPRA 2Z1IA 4NCGA 1D5AA 3LALA 4CEFA 4N56A 4FLYA 4KHUA 4DLEA 4FJHA 3P5JA 3HVTA 1RTIA 3LP3A 4O5BA 4CFCA 2BE2A 1GOCA 3OS2A 3L2VA 3QEIA 3VQ5A 2ATQA 4DWIA 4M45A 4M3RA 4KV8A 4EP5A 4HUFA 4FM2A 1LW0A 3AA4A 1DLOA 3LP0A 4DFJA 4FLZA 4C8KA 4CERA 4DG1A 2PYJA 1J54A 4CFBA 3DLRA 4KB0A 2OZMA 4CHQA 4N5SA 2Z1GA 4KREA 1RDDA 2XY7A 3L2RA 2E6MA 1JLCA 3WNHA 5SZTA 3JSMA 3OVNA 3PX0A 4CJSA 1U47A 2B5JA 4DTXA 1UOCA 5J1EA 3OJUA 2VG5A 3BGRA 1KVAA 3NDKA 4DQRA 1VSIA 3TAGA 3AVCA 4CJQA 1S1WA 1KLMA 3ZSOA 4FJ8A 4CF0A 5KTQA 3NAEA 3L8BA 4DTMA 4C8OA 1YTAA 1RBVA 4DSKA 3PO4A 2HB5A 1WSHA 3K58A 4B9VA 3M8QA 1U4BA 1NK4A 1NK9A 4B9LA 1D9FA 4DSJA 1Y97A 1QE1A 3NE6A 1DTTA 3HSTB 1SKSA 2QK9A 1CZ9A 4DLGA 3O4QA 3HM9A 3RRGA 2F8SA 3KLEA 3ULDA 4FJNA 3KK3A 1ZBHA 4E7JA 2HVHA 1REVA 4FM1A 1A5VA 3MEEA 3HT3A 1TK5A 4HCBA 3TABA 1J53A 1W0HA 1HYZA 3CM5A 1C1AA 4I7FA 4CEOA 4OPKA 3K5OA 2Y1JA 3MXJA 1KSPA 3SQ2A 5KGWA 4IFYA 3RR8A 3A2FA 4ICLA 1VSHA 3K57A 3K2PA 1ZYQA 1JLGA 1QSSA 1R0AA 4AHCA 3AVLA 3DRRA 1NJYA 4Y1CA 3HO1A 3VQEA 4UQGA 4FLUA 4AHRA 1U48A 3HPHA 1C1BA 4BDZA 5HROA 1LWEA 4IG0A 5KGXA 2X6NA 4CJPA 1IH7A 3HJFA 3AVFA 4W5OA 3OYIA 2PY5A 5D3GA 1QSLA 1KVCA 4OKKA 1Q8IA 4ELUA 4CEEA 4Z4IA 2KTQA 1ITGA 4Q5VA 4O0JA 3AO4A 3EYZA 4Q0BA 4HVJA 3V4IA 2HHQA 5HRPA 4CF2A 3HP6A 1LWFA 4ID5A 3ISNC 1ASUA 4FK0A 2EHGA 4EZ6A 2B6AA 1CXQA 2B4JA 2IGIA 5FRNA 1RILA 4LH5A 4Y1DA 3KIOA 2RKIA 4CESA 4FJ5A 2QKBA 3LAMA 3ZT4A 3VQ9A 2GV9A 3AVHA 3AVKA 4FLTA 4N41A 2IC3A 1Z26A 2VG7A 4CHPA 4CJVA 1VSKA 3VA0A 1IG9A 1U04A 2XHBA 1SL0A 3NF7A 3NH2A 4OVLA 5DMRA 4F2RA 4OKEA 4KHWA 4BE1A 1TKTA 2X78A 4CE9A 4XIUA 3KK1A 3QEPA 4FJ9A 3OYGA 3SUPA 2RPIA 4CK3A 4FJ7A 1WNSA 1BGXT 4CJ3A 4RG8A 4FCYA 3QIOA 1WLJA 3ASMA 5FDLA 1KLNA 3KD5E 1SUQA 3QNNA 4RW7A 3NGIA 4CGFA 4E89A 3CFPA 1YT3A 4CJKA 4GMJB 1ZBLA 3QEWA 1X9MA 2RF2A 3VA3A 1RTJA 1Q9YA 1BI4A 1C0MA 4I2PA 2XO7A 1SKWA 2BDPA 2G8HA 1TAUA 2HHVA 2F96A 5HRSA 4DQQA 4I2QA 5CYQA 3L3UA 3U3YA 2YNGA 1GOBA 3DLBA 4N76A 4M41A 2DY4A 4FW2A 1WSIA 4FJGA 4M42A 1IO2A 1RT3A 3VQAA 2NUBA 4DU1A 3DLHA 1ZBUA 3LPTA 3NH1A 5HRNA 1U49A 1NKCA 1L3SA 4B8AB 2ZE2A 3NF6A 2XRIA 4LD0A 3OYEA 3ZT0A 1HYSA 1BISA 3NGZA 3KLFA 4JS5A 3SYZA 1C6VA 4PA1A 1BQNA 3I0SA 3AA2A 4CJEA 4CJFA 3QETA 3DOLA 2A1SA 2D0CA 1XC9A 1EKEA 1S5JA 2YHBA 3AVNA 3AO5A 3QERA 1HJRA 3RR7A 3PO5A 4FYDA 4BE0A 3T19A 3OS0A 4J2EA 1C0TA 2A1RA 4DU3A 5I3UA 3MEDA 2FBYA 4F3OA 1ZBIA 3HXMA 2Q3SA 3DLKA 3NFAA 4J2AA 4CJLA 5C25A 4FLXA 3SZ2A 4B9SA 4KTZA 4EP4A 3K5LA 1J5OA 1ZBFA 2GUIA 2KW4A 3VQ7A 3L3VA 5CZ1A 1HYVA 2HNDA 3THVA 4Z4EA 5FROA 2IDOA 1Z25A 3KLGA 1NKEA 1LAWA 3M8SA 1T03A 3CFOA 3V9WA 2OYQA 4CK2A 2D5RA 2FBVA 1WSJA 1NJXA 5J2MA 3S3NA 4KHNA 3RMAA 2VWKA 3PUFA 4KKOA 2G8WA 1RDAA 4I9QA 1S1XA 4B3OA 1JXEA 3SCXA 4CGIA 1LV5A 4HUEA 4F2SA 3HK2A 4CIGA 1YTUA 3MECA 1VSFA 4C8NA 3DM2A 4PUOA 4CIEA 4I9LA 3TAEA 4DTNA 2WONA 4CFAA 4CEQA 3OYLA 3AVAA 4E7LA 1RNHA 2X74A 3H08A 3SNNA 4H8KA 4NYNA 3NF8A 4DS4A 2KFNA 1RT2A 1NK5A 3ZSYA 1JLQA 1WSFA 2F8TA 2XY5A 4FJLA 3ZCMA 1WAJA 4N47A 1HMVA 3VQ8A 2P5GA 4IKFA 2XY8A 4KFBA 3C94A 2BANA 3V6DA 3PX6A 2P5OA 4YNQA 3OYMA 3CFRA 1KVBA 1QQCA 1BHLA 3TARA 4CGGA 1KRPA 1KFDA 2IOCA 1SL2A 3MEGA 3HYFA 5JS2A 3ZT2A 3O3GA 1D8YA 3QINA 1RBTA 3NBPA 4LY7A 2YNFA 3IRXA 1BQMA 4IFVA 4M3WA 4W5RA 1RTDA 3RRHA 3QIPA 3V1OA 4GVMA 4HHTA 4TSXA 4BDYA 3AVIA 4KTWA 3KTQA 4CF1A 1FKPA 4CF8A 2HHSA 3QEVA 1CLQA 3WNEA 1I3AA 3FFIA 2I5JA 1BI4B 2Z1HA 4KHYA 3DLGA 3G10A 3M8RA 4E7KA 3V9SA 3C6TA 1QS4A 2D0AA 2DFFA 2ZQBA 2G8UA 4JRQA 2OPPA 4DTUA 4Z4GA 3AVJA 1VSMA 3L2QA 1S6PA 1S1UA 1IKVA 1TL3A 2DFHA 4AHTA 4Z4HA 1WSEA 3OYKA 1FKOA 2PZSA 1JL2A 4DF8A 3DRSA 3QEXA 1XI1A 2VG6A 3DI6A 3AVBA 4IG3A 1UA1A 1TKDA 4KB1A 1J9AA 1TV6A 4PQUA 3I8DA 3NGYA 1EP4A 1X9SA 3CYMA 1NJZA 3F73A 5HRRA 4E0DA 3LP1A 2ITGA 5DK5A 3K5MA 5HP1A 4K8ZA 3MXMA 4AHSA 3T3FA 3VN5A 4Z4CA 4JRPA 3LP2A 4ID1A 4DFKA 3VQDA 1BL3A 1S9GA 3HPOA 1NKBA 3V9XA 1KTQA 5EU7A 3RMBA 2FBXA 3TAPA 4DQIA 4FVMA 4MFBA 2HHUA 4MQ3A 3MXIA 1A5XA 1NOZA 5HLFA 4EZ9A 1NK8A 2HMIA 4QCLA 3S3OA 3ZSRA 4B8CA 3B6PA 4DSFA 4ZTFA 1QTMA 3MAQA 4FZZA 1C1CA 3TAQA 3O4NA 1L5UA 1NJWA 1ASWA 1Q9XA 1W9HA 3V81A 4OJRA 2G8VA 5K14A 3B6OA 1RBSA 1VSJA 3IG1A
chains in the Genus database with same CATH superfamily
2JGUA 4RW8A 4BRKA 2ZJPL 3AY9A 2HF4A 3TPQA 3NH0A 1M90O 1SAZA 1F21A 2ZJQL 3CCVN 3G71N 5LJWA 4JKHA 1RBUA 4JI6K 3EZ5A 2P51A 1RBRA 4FXDA 3VENA 4ISFA 4DQPA 1IV0A 4FOEA 1JCEA 2O8FB 4HUGA 4H4MA 3OHRA 4IBNA 3WT0A 1K8AO 1EWRA 4DB3A 3SJJA 3BUZB 4JAXA 3ZETB 4FW1A 4DR3K 2UYTA 1NNEA 4X66K 1I39A 3AVMA 1FK9A 2YHAA 1SL1A 1HUXA 4O8KA 3L4QA 2KHOA 1NGHA 3MN9A 4H03B 4RTFD 4K42A 1U2VA 5JVGL 4H5WA 2QKKA 3PX4A 1EX4A 1OH6A 3JAMO 1UAXA 5AQYA 5KRTA 4M3UA 2ETJA 3VOVA 5JLFA 3P1GA 4DV4K 1LW2A 1RDCA 1HNZK 5HOOA 2OPSA 3THXB 1EXQA 5I9EB 4HCCA 2YV0X 3ZSQA 4B08A 2DPNA 4IO8A 1XNRK 5F0XA 4DTSA 3AO2A 3WNFA 1BO5O 2UU9K 4CHNA 3AO3A 4JI0K 2X6SA 4JHDA 3VQ6A 3D2FA 4NCAA 4FLWA 2QI2A 2UUAK 2ZJRL 3J7ZO 5AQQA 5BREA 2P9IB 1TVRA 3G6EN 3MN5A 3UKUB 2HHXA 1O1WA 4ELVA 1BCOA 1OH5A 4AM7A 1BCMA 4B1YB 4O44A 4JHDB 4JLHA 1WSGA 1JLFA 4CHYA 4QAGA 1VRUA 3LWLA 3PLAA 1FJGK 4BRPA 3OA9A 4KHSA 2RN2A 1GLJO 1T44A 4XEIA 2Y1IA 3LDPA 1N33K 4E7HA 2PAVA 1RT5A 1TKZA 4BRMA 5JICA 3QO9A 4DFPA 4J2BA 4FLVA 3OYBA 3WXLA 1SZ2A 4FJMA 4CCHA 3LZIA 3AA5X 3CF5L 1QZ5A 1MU2A 3EO3A 5GIPA 1VHXA 2VQEK 4EHTA 2W42A 3SUNA 1WBBA 3FGUA 4CZHA 1IKWA 2FXUA 5AQVA 2R7YA 4JV5K 1ESVA 4CGJA 3O6WA 3H3NO 3GOIA 1W7AA 4Z4FA 3MK6A 4CECA 3A5OC 2A6AA 4KH6A 3G25A 3QNOA 2VWJA 1T05A 1ATRA 1S1TA 3TWHA 2GWJA 1HRHA 2JWKA 4FWOA 4LSLA 1NK6A 2YKNA 4CGDA 1OVYA 1TK0A 1VAZA 1S6QA 1HPMA 1CXUA 2P9KB 3C95A 5KPRA 1VQMN 4CEFA 4GNIA 3P5JA 4DS5A 3LP3A 4O5BA 3QEIA 3MWTA 4KV8A 3AA4A 4MLEA 3ZEUB 1MA9B 3THXA 1S72N 3DLRA 4FSVA 1VQ6N 2WFBA 5AQIA 1HNXK 2UUCK 1U47A 3C7NA 2B5JA 3OJUA 1Z05A 3NDKA 3CJ1A 4FJ8A 4WQ4C 5E26A 4BC4A 1RBVA 3PO4A 3FZHA 4ILHA 3K58A 4FWKA 4CZGA 4DSJA 3ID8A 1DTTA 3TTDA 4DLGA 2F8SA 3HM9A 3ULDA 2W41A 4E7JA 3VGKA 3ATVA 1A5VA 3HT3A 1J53A 1HYSA 1HYZA 4OPKA 3RR8A 3A2FA 4ICLA 3I56N 5F1XA 3K57A 3K2PA 3FZKA 1QSSA 3CCRN 3HO1A 3VQEA 4JKCA 4IG0A 3T1YK 4JI1K 4CJPA 1IH7A 3OYIA 1VQLN 2PY5A 5D3GA 1Q8IA 1ZC6A 4JKGB 4FWQA 4O0JA 3CJAA 4BR2A 3EYZA 4HTLA 1ASUA 2FSKA 1ZBSA 2EHGA 2O8EB 2B6AA 4MO4A 2IGIA 1NGBA 1EWQA 4N41A 4MDAA 4IDHA 3LL3A 3J80O 2XHBA 3NF7A 2UXDK 3J81O 2X78A 4XIUA 4FJ9A 3QEPA 3OYGA 4CK3A 4C1NI 1BGXT 4OPHA 4RG8A 3QIOA 5C2DA 4DR2K 4DQ8A 4CGFA 3CPWM 1VQ4N 5A2QO 4CJKA 4GMJB 5HL7L 4EHUA 1X9MA 3VA3A 4JD2A 2XO7A 2BDPA 2VWBA 1ATNA 3LM9A 4DR4K 3U3YA 2YNGA 3WXMB 2DY4A 4FW2A 3UB5A 4M42A 1IO2A 3DLHA 1LCUA 2QWPA 5HRNA 1L3SA 2XRIA 1BISA 1VQPN 3SYZA 4CJEA 4PA1A 1BQNA 3I0SA 2V7ZA 3AA2A 3AVNA 4LFAK 1HJRA 3OS0A 1C0TA 2A1RA 2Q3SA 1K8KB 3EKUA 3CCJN 4CZMA 4CJLA 3EN9A 2E2PA 3E9PA 3VQ7A 3MX5A 5CZ1A 1HYVA 1YJWN 2IDOA 1NKEA 1LAWA 4FPAA 1T03A 4I6MB 2FBVA 3KK7A 3OW2M 4U7BA 1WSJA 2YX6A 3QICA 5J2MA 2VWKA 2G8WA 4I6MA 5AZIA 5TKYA 2CH6A 2IIRA 1YTUA 3CC4N 4J8FA 4BR4A 1NMNA 3ENBA 3MECA 1VSFA 4C8NA 4CIEA 4DTNA 4CEQA 3SNNA 2V7YA 2A40A 5BR9A 3J7AP 3PIOL 1WSFA 3THWB 1HMVA 3ZX3A 3GL1A 2P5GA 4KFBA 1QVGM 1VQKN 4GV6A 2A3ZA 5KQ8A 1KVBA 1BHLA 4CGGA 1TYQB 2IOCA 1SL2A 3HYFA 3QINA 1RBTA 1H1VA 2YNFA 2YJEA 3V1OA 5AQFA 3A5MC 4IOCL 2NRRA 2I5JA 2Z1HA 3MDQA 5EOYA 1QS4A 1W97L 2DFFA 3AVJA 3O1WA 2PZSA 3WEEB 3DRSA 1XI1A 4IG3A 3AVBA 1J9AA 2VGMA 5AQGA 4PKGA 5FPNA 1SS6A 4A2AA 1GLBG 4K8ZA 3MXMA 1E3MA 4JRPA 3LP2A 4DFKA 2A5XA 1NKBA 4B3MK 3RMBA 2FBXA 3WEEA 4FVMA 1YITN 4MQ3A 1WBDA 3ZSRA 1C1CA 4C23A 3F2KA 4ISGA 3B6OA 3NVMA 1VSJA 3IG1A 2QXFA 2G8KA 1D9DA 4IZ9A 4NLCA 3CMAN 4A62A 1NGCA 3SPZA 3BDPA 3PV8A 4LH4A 3VETA 1L3VA 4DR6K 5J2QA 4CJ5A 4OO1J 4J2DA 4CJUA 4JI8K 2Q31A 4QOZB 5KPTA 1X1PA 4YOWA 1B92A 3M5RA 1HQUA 1CZBA 3ZLJA 3UE5A 1HPZA 5C24A 1BIUA 1N6QA 1ASVA 3MMVA 4BY9C 3OYNA 3C6UA 1JLEA 4DTJA 2O4GA 3CIPA 3I0RA 3VEWA 4FJJA 4QS9A 4CGHA 1YXQA 1KFSA 4E19A 2O8CB 1XC3A 1JLBA 1BUPA 1XNQK 4CIFA 4RW4A 3VQQA 5AZIB 1HQEA 4OPJA 2BUPA 1JLAA 2PFUA 3WQUA 3OYCA 4LSNA 4M3XA 5AQLA 4DFMA 1X9WA 3SLCA 3LDOA 2W40A 1B9DA 1VQON 4NYFA 1MWMA 2JLEA 5AR0A 3SQ1A 4BRNA 1A5WA 1VSEA 5BR8K 1L3TA 4EFHA 1X3MA 3SJHA 3ULEA 3OYJA 4JKDA 4H0TB 4PL7A 4NCBA 3U4LA 1ILYA 1RCHA 1NJIO 3DAWA 1LAVA 2V51B 3TTFA 4DCHA 2ZD1A 4G9ZA 3R1XA 3OS1A 4H0XB 1U45A 1P90A 1T8EA 4AILC 3E66A 1J6ZA 4DSIA 3VTIA 3DXKA 1BIZA 4FM0A 4FK2A 1G15A 4H0PA 4DTPA 1YIJN 3CJBA 5JVHL 4BACA 1KAZA 3ALYA 3U6FA 4CJ7A 3OYHA 4BE2A 1V4SA 1QQMA 4WQ4A 3TR8A 1LWCA 3CD6N 3PY8A 3SMPA 3KKSA 4E1MA 3RMCA 3EEQA 3RMDA 1OKJA 5ELZA 3DJCA 3ZSXA 2DTUA 3VQ4A 5CHIA 4OLBA 2P9KA 3UKRA 1NOYA 3FR0A 4OKJA 2O8BA 4H4OA 1C0UA 1EETA 4OPAA 4IJNA 1SV5A 3ZEUA 4DTOA 4IDKA 3EKSA 4BWJA 3CERA 2YNHA 3VESA 4DSLA 4L8RB 1V4TA 3IAYA 4CJWA 5FRMA 3PIPL 4CHOA 3HL8A 3LPUA 4WE1A 2W6LA 4W5TA 3T1AA 4IJAA 3L4IA 4FZXC 1HNWK 4CFDA 4FOIA 4YOVA 3CQ8A 4ZTJA 4L3QA 2WC9A 3S9HA 3ITHA 3AV9A 4W5QA 2HNZA 1N5YA 5M1KA 3VEVA 3U9ZA 2PYLA 3BEXA 1LOTB 4QS8A 3AAPA 2OTJN 5C15A 2HHHK 5KRSA 1B9FA 4FWMA 4WCEL 3H1QA 2ZWHA 2O4IA 5AQPA 4K8XA 5M1QA 1XMOK 3AO1A 2ZF5O 3P4IA 1TKXA 5C0YA 3CCLN 1YHQN 5CZ2A 5CR4A 4NO7A 1XWLA 3HOTA 4B9TA 3HPGA 2F4VK 4E7IA 3LZJA 1GLEG 1TL1A 2G8IA 4DTRA 3O9UA 4FLYA 3LALA 4BGBA 2O8DA 3HVTA 5JS1A 4DWIA 1GOCA 2ATQA 4M45A 4BC2A 1I94K 4FM2A 4FLZA 2PYJA 1J54A 4CFBA 4CHQA 5JLHA 4A5AA 2XY7A 3L2RA 2E6MA 1JLCA 3WNHA 4JKEA 3OVNA 3A5NC 2NRZA 2O8DB 2VG5A 1KVAA 4DQRA 3AVCA 1KLMA 3ZSOA 1DGKN 1Q18A 4CF0A 4DTMA 5LL6Z 2KKZA 3CJ9A 5AJ3K 1YTAA 4BQLA 2GX9A 3FLCO 4C1NK 3M8QA 1NK4A 2AA4A 5EX5A 3NE6A 3HSTB 5LMNK 1SKSA 3O4QA 2YHWA 1ZBHA 4JD2B 4FM1A 1TK5A 1GLLO 2NRVA 4HCBA 2O8FA 3CM5A 3M1FA 4CEOA 2Y1JA 5LJVA 4BRHA 4IFYA 2P9LB 1JLGA 3HBTA 2CH5A 4FLUA 4DR7K 3Q7CA 5C12A 4BDZA 5HROA 5KGXA 3CHWA 3AVFA 3K9KA 1KVCA 4OKKA 4ELUA 1ITGA 4JI7K 3LDQA 1GLFO 4HVJA 3HP6A 1NMDA 4DV5K 3ISNC 4FK0A 3N4PA 2FF6A 2OTLN 5FRNA 4LH5A 4B3TK 4BC5A 3KIOA 2RKIA 3BF3A 1VQ8N 4FJ5A 3LAMA 2QKBA 3ZX0A 4K0KK 4GV9A 2E88A 1N8RO 4IEEA 2IC3A 4JI2K 1VSKA 1SL0A 3NH2A 3I33A 4OVLA 5DMRA 1TKTA 4CE9A 3WUHA 3RSEB 1E4GT 1WNSA 4CJ3A 1WLJA 4JKBA 1KLNA 4RW7A 2I7NA 1ZBLA 4A2BA 4LFCK 5DM7L 1EO1A 1Q9YA 3CCMN 2G8HA 4FWSA 2QWNA 2HHVA 5HRSA 5BRFA 2HSTA 3DLBA 1K8KA 3FFKB 1WSIA 1RT3A 2NUBA 1U49A 1NKCA 4B8AB 4LD0A 3NGZA 4F9OA 1C6VA 1YAGA 4JN4A 1XC9A 2A1SA 4BRQA 3DOLA 1S5JA 3QERA 3RR7A 4FYDA 3C6AA 2JWLA 4BE0A 5BN8A 2NRXA 4F3OA 2FBYA 1ZBIA 3DLKA 3WQTA 4J2AA 3SZ2A 5LY3A 3K5LA 2GUIA 3L3VA 3ULEB 3THVA 4Z4EA 3D2EB 1KAYA 4DR1K 2I7PA 3KLGA 2PBDA 3BZCA 3CCEN 3M8SA 4CK2A 2D5RA 3ENHA 3ID6A 5EXWA 3VERA 4H0VB 3VF4A 3S3NA 3J7YP 3RMAA 4IOAL 1KAXA 4I9QA 3OBYA 1LV5A 1YUWA 4YOXA 3DM2A 5JMVA 3CCSN 4CFAA 4E7LA 2QWQA 3OTOK 3D2EA 1M1KO 1GLAG 1RT2A 4FJLA 1WAJA 3VQ8A 2XY8A 4GKJK 3H46O 4CZJA 4X64K 4WQ5C 4R79A 1YJNN 3MEGA 5JS2A 3HZ6A 3O3GA 3NBPA 3IRXA 3AVIA 3KTQA 5AFUA 3NMUA 2V52B 4KHYA 4E7KA 3C6TA 1VQ7N 2D0AA 2ZQBA 4Z4GA 3ZYYX 4AM6A 4KH4A 5GAGP 3L2QA 1Y64A 1S6PA 1S1UA 3ZETA 2DFHA 3IUCA 5KQDA 5FPMA 2VG6A 1TKDA 4KB1A 4FWRA 1QVFM 3VTHA 3RSEA 4PQUA 3I8DA 3ATUA 4E0DA 3LP1A 2ITGA 5DK5A 3IKMA 3T3FA 4JKAA 1BG3A 1XQSC 1KTQA 1NGAA 1A5XA 1NOZA 1NM1A 3C7NB 1NK8A 3CI5A 3S3OA 3IMXA 3CXCM 4FZZA 3MAQA 3TAQA 5BRDA 4CZKA 2NZTA 1ASWA 1QQNA 4OJRA 1RBSA 1IBKK 3R3LA 2AJQA 4W5NA 4G1QA 5AQTA 1UWBA 3I55N 1Q7YO 3O1BA 5AFUH 5C42A 1KC8O 4CEBA 5GAHP 3QMLA 4FJXA 2GBZA 3R9PA 4EIAA 1DTQA 4B9QA 5AZJB 3CC2N 2VCPA 4O4GA 1JCGA 3DWLA 3VQBA 3U3GA 3LWMA 1WN7A 3PSIA 5SWMA 2E8AA 1ATSA 4YORA 4CD3A 1T7PA 3T69A 1VRTA 4JEPA 5AQJA 3VEYA 3D0PA 2F9TA 4PY5A 2DFEA 1O13A 1JKHA 3NHGA 3DLLL 3FZMA 3QBWA 3SPYA 3AVGA 3SV4A 2O8CA 1JXBA 4AH9A 2QTDA 5AQXA 1RGIA 3H45C 3KWIA 5T7BA 1NK7A 1IBMK 4C8LA 2FSJA 3HP9A 1RTHA 4B3OA 3K5NA 3IS9A 3P38A 2P9UB 3AGKA 4BRIA 3UKUA 2QW9A 2P1JA 3QDKA 2E6LA 3BY5A 1YVNA 4CK1A 3LAKA 5M1PA 3KKRA 4H5NA 5CYMA 1HLUA 3QESA 1BA1A 3AGRA 5GINA 2A42A 4YY3K 3QFPA 2CGKA 4KO0A 2QWRA 2KQ2A 3VF2A 3G4SN 4DSEA 3SK3A 1IKXA 3J8AA 4EAHD 2BGGA 3AA3A 4C8MA 3W0LA 1TAQA 3P83D 4OGCA 3HM8A 4NLBA 2ASOA 1S9EA 5C2FA 2NRTA 3EE8A 3RTVA 2O8BB 3CQXA 3VEZA 5IWAK 2Q2RA 2NLXA 4BWMA 1QSYA 4KI6A 1NWKA 1RDBA 3VQPA 3ZT1A 4M3YA 2D0BA 4FWPA 5J2PA 2Q0RA 1VQNN 2HVIA 5E41A 3OYDA 4CZEA 3HRGA 3E9LA 4MDBA 4CJRA 5E84A 4KTQA 4KHQA 1WAFA 2YKMA 3CC7N 4B1WB 4AQYK 3SQ4A 3BP8A 4YFUA 3DXMB 1XHXA 1XHZA 2OA8A 1G99A 3WXKA 2E5LK 4AHUA 3KLHA 4E3SA 3CJ7A 3UIQA 1RT6A 4HTUA 4GW6A 4OGEA 3L2UA 3V1RA 4DU4A 3TAMA 2D0PA 1U6ZA 3MCAB 3GE1A 3F9MA 4BDPA 4AHVA 2WUSA 4BG9A 4GY2B 1WOQA 1NGJA 1RDWX 3VGLA 4B1UB 4X62K 2D1KA 5BRHA 4F4KA 1XMQK 5AQHA 4BROA 5KPZA 4JS4A 4LF6K 3D2FB 5KI6A 1GOAA 4M3TA 3EL2A 1VSLA 1JL1A 1K6YA 1RT7A 2HOEA 1HNVA 4KPYA 5C10A 1J5EK 4WYBA 4CJ4A 1TGOA 5DM6L 4BR7A 1RT1A 4BC3A 2FC0A 4PWDA 5M1NA 2HW3A 2CGJA 4M3ZA 3DLEA 5J2NA 3TANA 4OLAA 3ZSZA 4JI3K 2OZSA 4CI6A 4F8RA 1YVUA 1D5AA 4KHUA 4DLEA 4IFEA 4FJHA 4CFCA 2HBKA 3L2VA 2BE2A 2ASMA 3THYB 3AARA 4M3RA 1ZXOA 1LW0A 3C65A 3HSCA 1DLOA 3LP0A 1BDGA 4DG1A 4KB0A 3R8EA 4KREA 1RDDA 3JSMA 3LM2A 3BF1A 3PX0A 4V19S 2GUPA 4JYAK 4DTXA 4CJQA 1S1WA 2F7TA 1QZ6A 5KTQA 3L8BA 4JNEA 4DSKA 2HB5A 1SQKA 2NNWA 3E1YA 4B9VA 2E2NA 4A61A 3WXIA 1U4BA 1BA0A 1Y97A 1QE1A 2QK9A 1IG8A 2P9SB 3KLEA 1REVA 3A5LC 4O8UA 5GADP 4IXCA 3T7ZA 1W0HA 1YI2N 3K5OA 1S3XA 1GLDG 1KSPA 4BREA 1VSHA 3CCUN 1ZYQA 1R0AA 1NJYA 5F2RA 1RFQA 3HPHA 4MO5A 3TSPA 2X6NA 4W5OA 3VEXA 1OVQA 4CVNE 4CEEA 4Z4IA 4WQ5A 4Q5VA 3AO4A 3V4IA 5HRPA 4CF2A 1LWFA 3C0BA 1WB9A 4IOXA 2B4JA 3DXMA 1HKCA 3SBTA 3W3DA 2ZGYA 3O08A 3AVHA 3CETA 4CJVA 1C0GA 3ENOA 3OBWA 1IBLK 5AZJA 3SMSA 4KHWA 4BE1A 3H6EA 5EVZA 4K25A 3GDQA 3ASMA 5FDLA 3KD5E 1SUQA 3NGIA 5ADXA 4E89A 3CFPA 3BZKA 4A5BA 3QEWA 4JKFA 1RTJA 1T6DA 1BI4A 2KLAA 1DEJA 4I2PA 2NRWA 4CZFA 5EY4A 1SKWA 1TAUA 4CBWA 4DQQA 3GG4A 4FL9A 4DUZK 4N76A 5AQRA 1N32K 4FJGA 3VQAA 4DU1A 1ZBUA 3LPTA 4XH4A 4JK7A 2ZE2A 1QHAA 3NF6A 3OYEA 2IVOA 3KLFA 4FZYA 4CJFA 2ITMA 3QETA 3T1HK 2YHYA 3O80A 1EKEA 3PO5A 3AO5A 3T19A 4BRCA 4DU3A 3MEDA 2O8EA 3NFAA 4U67L 1GLCG 4KTZA 1J5OA 2KW4A 2HNDA 4BQZA 3CQYA 1Z25A 3EZWA 3V9WA 2OYQA 4BRGA 1NJXA 3MX2A 5M1OA 4KHNA 4OX9K 3AAQA 1RDAA 2YJFA 1JXEA 3FZLA 4CGIA 3SCXA 4HUEA 2VYPA 3F5TA 4I9LA 2VQFK 4RWTA 1Z6RA 3OYLA 3AVAA 4LF5K 4DV0K 2CGLA 4H8KA 4NYNA 4BRLA 3NF8A 1K73O 4PKIA 1NK5A 5LMUK 3ZSYA 4X65K 5IT9O 5GAEP 4YOYA 3C94A 2BANA 3V6DA 2HF3A 1QQCA 3TARA 1KRPA 3KZBA 3ZT2A 1D8YA 4RCHA 4LY7A 4M3WA 4W5RA 2ZGZA 3RRHA 4BDYA 4HHTA 4TSXA 3U8XA 1FKPA 2GEMA 4CF8A 3QEVA 1CLQA 3WNEA 1T3VA 3FFIA 3HTVA 3IFRA 1HR0K 1W2BM 2G8UA 5AQNA 1VSMA 1IKVA 1TL3A 4AHTA 1WSEA 2KFNA 4IWVA 1DT9A 1TUYA 1TV6A 2HBMA 4LC9B 4O5FA 3NGYA 1EP4A 1C0FA 3L0QA 5HRRA 3SAFA 5HP1A 4AHSA 1T6CA 3VN5A 4Y0WA 1BL3A 1MWKA 5EU7A 3V9XA 3TAPA 3PSFA 4B3SK 1RDUA 4H5VA 5HLFA 4EZ9A 4FWLA 4GV3A 4QCLA 4DSFA 5BPMA 3P31A 1L5UA 1NJWA 5K14A 1NGFA 3NVKA 1QQOA 4WFNL 4RW6A 2XY5A 1VSDA 3TSUA 2P9PB 4DQSA 2HHWA 3H3OB 3SAHA 3O9RA 4CJTA 3EY1A 2G8FA 1Q86O 3DMJA 3O5BA 3G0ZA 4RW9A 3CM6A 2KZMA 2FLOA 4DV1K 4FWNA 2XY6A 4JK8A 4E1NA 3OY9A 1S1VA 3P39A 3KLIA 4PL8A 3D45A 2FF3B 2E4LA 4WFAL 2OPQA 2Q97A 3FZFA 3Q7BA 1DKGD 5FPDA 4KH5A 2KZZA 1HNIA 4JI5K 3KVGA 4DHYA 3NF9A 2QEXN 4KI4A 4FVUA 2P9SA 1BU6O 4B9UA 3JYTA 1U2VB 4ISEA 4B9NA 3N4QA 3CG7A 2ASPA 2EWSA 2P9LA 3SUOA 2IAJA 1N34K 1QHTA 2YNIA 1N36K 4R5PA 1YJ9N 3S3MA 3SV3A 4KAZA 4NXMK 3SUQA 4DMNA 3V1QA 4CZIA 2KFZA 4ELTA 4Z0UA 4BGAA 2HNYA 5HBMA 3O3HA 4HWIA 3WNGA 1FXXA 1EQYA 1YF5L 2WOMA 1HKBA 2GWKA 1UA0A 2YCHA 1NBWA 3ZSVA 4KHPK 4CEDA 2FBTA 4ZHRA 3CPEA 1VQ5N 3LDSA 3L6QA 3ZSWA 3DRPA 4B9MA 3ZX2A 3RVCA 3SQ0A 2Q1NA 1WUAA 3QFUA 2OANA 2P9NB 3U9DA 4FJIA 5AQUA 5TKWA 4H0OA 3M8PA 2H3GX 2YI1A 4FK4A 1HX1A 1JCFA 4CEZA 4O55A 3CMEN 3V9UA 4CHZA 2IVNA 4O0IA 3RWUA 3E01A 3TI0A 3M3ZA 3C6HA 3KJVA 3KK2A 1IJJA 3GBTA 3O3FA 3V9ZA 3MN6A 3O9TA 1X9JA 2Z1JA 5AQZA 2NRHA 4LF4K 3HOSA 2LSNA 3K59A 4DV3K 3QBXA 3VEOA 5ADXH 3WXJA 1NGEA 3LANA 2UUBK 4CZLA 1NGGA 2P9IA 2UXBK 4UY8O 3SI6A 3DOKA 5BPLA 5CY4A 3DYAA 1L3UA 4MLHA 4Z94A 1R59O 5I42A 3KHYA 4XH1A 1SKRA 3F9KA 4CF9A 3KWGA 4B1ZA 2QXLA 4FPBA 3VMFB 4YDUC 3O9QA 2QWMA 4B1VA 1IKYA 4CD1A 5BN9A 4E1JA 2HHTA 2E2OA 4PKHA 4YDUA 4XH5A 3OYAA 4DF4A 3HVRA 3L2WA 4YOUA 3KD1E 2EX3A 4KRFA 4CEAA 4LFBK 4FO0A 2GELA 3QLHA 3OYFA 1JJ2M 3MN7A 2E1YA 3THYA 3TTCA 2AP1A 4F3TA 4FJKA 3TAFA 1KQSM 5CE3A 3NCIA 4DKWA 1TK8A 1RT4A 2IS3A 2BTFA 3ZT3A 5B8HA 1VK0A 1KCFA 3H1VX 3OJSA 5AQOA 3VQCA 1NK0A 2OPRA 2Z1IA 4NCGA 4N56A 1RTIA 3OS2A 5FLXO 3K9JA 3VQ5A 4B1XB 5BPNA 4EP5A 4HUFA 4DFJA 4C8KA 4CERA 2YHXA 2OZMA 4N5SA 2Z1GA 5M1FA 5SZTA 4H5RA 2J4RA 4CJSA 1UOCA 5J1EA 3BGRA 1VSIA 3TAGA 1NGDA 3NAEA 5AQKA 4C8OA 1HJOA 1WSHA 1NK9A 4B9LA 4DV6K 1D9FA 1MDUB 1CZ9A 2E1ZA 1BOTO 3RRGA 4BRDA 4FJNA 3KK3A 5H1SQ 2P9NA 2HVHA 1FW6A 3JS6A 3MEEA 3TABA 4I7FA 1C1AA 3MXJA 3SQ2A 5KGWA 4YHHK 3HI0A 5FPEA 4JI4K 2OCEA 4AHCA 3AVLA 3DRRA 2HBJA 4Y1CA 4UQGA 4AHRA 1U48A 1C1BA 1LWEA 4B3RK 2RHKA 3HJFA 3VF6A 1QSLA 3LDNA 2KTQA 3SBGA 3A0IX 4YOTA 1Q81O 4A59A 4BRAA 4Q0BA 2HHQA 2D4WA 4ID5A 4BVOA 2P9PA 4A57A 3O8MA 2Q36A 3THWA 2P9UA 1CXQA 3R6MA 1RILA 4Y1DA 4CESA 3ZT4A 3VQ9A 2GV9A 2WBNA 3AVKA 4FLTA 3I8BA 2WTUA 1NLVA 4DR5K 4CHPA 1Z26A 2VG7A 1S22A 3VPZA 1IG9A 3VA0A 1U04A 4F2RA 4OKEA 3JXUA 1Q82O 3KK1A 3SUPA 2RPIA 3UKRB 4FJ7A 1NG9A 4DUYK 4FCYA 2W6KA 3A8YA 3QNNA 2VGNA 1YT3A 4LF9K 4BRFA 4NXNK 2RF2A 1C0MA 3O4WA 2BH1A 2F96A 3DXKB 4I2QA 5CYQA 3L3UA 1GOBA 4M41A 3NH1A 3CCQN 3VGMA 1TUUA 3S41A 3ZT0A 4WFBL 4JS5A 4DV7K 4BR0A 2D0CA 2YHBA 2ZM6K 2QWOA 4CW7B 4M7XA 4J2EA 5GIOA 5I3UA 3HXMA 5C25A 4IO9L 4FLXA 4B9SA 2GTDA 4EP4A 1ZBFA 3MWPA 2QWLA 1KD1O 5FROA 3CFOA 4BG8A 3SAGA 2RE2A 4LF8K 4DV2K 3PUFA 4KKOA 4BR5A 4CBXA 1S1XA 4F2SA 3HK2A 4CIGA 2F9WA 3MCPA 4K41A 4PUOA 3TAEA 2WONA 1HKGA 3E9OA 1RNHA 1OH8A 4GKKK 2X74A 3H08A 1CZAN 4BVPA 2QA4N 4DS4A 4LF7K 1JLQA 4M63C 2F8TA 5AQWA 1BWFO 3ZCMA 4N47A 4IKFA 4H5TA 4CBUA 2QM1A 1X3NA 2A41A 2P5OA 3PX6A 4YNQA 5MLCQ 3OYMA 3CFRA 4KBOA 4PHTX 1NGIA 2HBLA 3FE1A 3EE9A 1TYQA 1KFDA 2FSNA 1BQMA 4IFVA 4JK9A 1RTDA 2D0OA 3M6GA 1D4XA 5AQMA 3QIPA 4GVMA 4KTWA 5AQSA 1P8ZA 4CF1A 2HHSA 1I3AA 3D7EO 1BI4B 3QB0A 3DLGA 3G10A 3M8RA 3V9SA 2Q0UA 3K0SA 1E4FT 4JRQA 2OPPA 4DTUA 3CJCA 1K9MO 3OYKA 4Z4HA 4EZ6A 1NU0A 1FKOA 2IVPA 1JL2A 4IEIA 4DF8A 3QEXA 1UA1A 3DI6A 3TU5A 4BR9A 3IDHA 2UXCK 1X9SA 3CYMA 1NJZA 3F73A 3K5MA 4QS7A 4AF1A 4GVEA 4Z4CA 4WF9L 4NB4A 4ID1A 3D6RA 3VQDA 1S9GA 3B8AX 3TSQA 3HPOA 4M7YA 4DQIA 4H0YB 3O9SA 4MFBA 2HHUA 3MXIA 2HMIA 1OH7A 4B8CA 3B6PA 4ILGB 4ZTFA 1QTMA 1KXPA 1XUPO 3LDLA 3O4NA 4ILJA 2E20A 4JKGA 4K43A 1Q9XA 1W9HA 3V81A 1VQ9N 2G8VA 2E2QA 2HMPA
chains in the Genus database with same CATH topology
2QXFA 2JGUA 4RW6A 1VSDA 4RW8A 2G8KA 4DQSA 1D9DA 2HHWA 2AJQA 4W5NA 3EY1A 4G1QA 4CJTA 2G8FA 3SPZA 3BDPA 3PV8A 1UWBA 3DMJA 4LH4A 3NH0A 3G0ZA 1L3VA 1F21A 4RW9A 3CM6A 2KZMA 5C42A 5J2QA 4CJ5A 2XY6A 4J2DA 4CJUA 4E1NA 4CEBA 1S1VA 3OY9A 4FJXA 1RBUA 2GBZA 4QOZB 3EZ5A 1DTQA 2P51A 1RBRA 3KLIA 4FXDA 1X1PA 4DQPA 4O4GA 3VQBA 3U3GA 1B92A 3D45A 3LWMA 4HUGA 1HQUA 1WN7A 1CZBA 2E4LA 4H4MA 4IBNA 5SWMA 1HPZA 3SJJA 4FW1A 5C24A 1BIUA 2OPQA 1N6QA 1ASVA 1T7PA 3OYNA 1VRTA 3C6UA 1I39A 1JLEA 3AVMA 4DTJA 2O4GA 3D0PA 1FK9A 3I0RA 4FZYA 2KZZA 1HNIA 4PY5A 2DFEA 4FJJA 2YHAA 1SL1A 1JKHA 4CGHA 3NF9A 3NHGA 4KI4A 5FRMA 3SPYA 1KFSA 5JS1A 3AVGA 3SV4A 4B9UA 4E19A 3JYTA 1JXBA 1JLBA 4AH9A 4B9NA 4CIFA 3CG7A 4RW4A 5T7BA 3VQQA 3PX4A 1NK7A 2QKKA 1HQEA 4OPJA 1EX4A 3SUOA 1JLAA 3OYCA 4C8LA 4LSNA 4M3XA 3HP9A 1RTHA 1UAXA 2IAJA 3K5NA 3IS9A 5KRTA 4DFMA 1X9WA 4M3UA 1QHTA 2ETJA 2YNIA 4R5PA 1B9DA 3SV3A 3S3MA 4NYFA 4KAZA 3P1GA 2JLEA 2P1JA 3SUQA 3SQ1A 1A5WA 1LW2A 1VSEA 2E6LA 1RDCA 3V1QA 4DMNA 1L3TA 2KFZA 3OYJA 4CK1A 2OPSA 4ELTA 4Z0UA 3LAKA 4NCBA 3KKRA 2HNYA 1EXQA 1RCHA 5HBMA 3O3HA 4HCCA 1LAVA 5CYMA 3WNGA 3QESA 1FXXA 2WOMA 1UA0A 2YV0X 3ZSVA 4CEDA 2FBTA 2ZD1A 4ZHRA 3ZSQA 4B08A 3OS1A 1U45A 1T8EA 4AILC 3LDSA 4KO0A 4DTSA 3ZSWA 3AO2A 3WNFA 3DRPA 4DSIA 4CHNA 2KQ2A 3AO3A 4B9MA 1BIZA 4FM0A 2X6SA 4FK2A 4DSEA 1G15A 4DTPA 3SQ0A 3VQ6A 4BACA 1IKXA 3ALYA 4NCAA 3U6FA 3OYHA 4BE2A 4FLWA 2BGGA 3AA3A 4C8MA 3TR8A 1LWCA 1TAQA 3P83D 4OGCA 4FJIA 1TVRA 3PY8A 3M8PA 1S9EA 2HHXA 3RTVA 3KKSA 1O1WA 4E1MA 3RMCA 4FK4A 3RMDA 4CEZA 4ELVA 1BCOA 4O55A 3V9UA 1BCMA 4CHZA 3ZSXA 4BWMA 4O0IA 4O44A 1QSYA 4JLHA 1WSGA 3RWUA 4KI6A 3E01A 3TI0A 1RDBA 3VQPA 2DTUA 1JLFA 3VQ4A 4QAGA 3ZT1A 2D0BA 4CHYA 1VRUA 3KJVA 3LWLA 3KK2A 5J2PA 4M3YA 4OLBA 2HVIA 5E41A 3O3FA 3OYDA 1NOYA 4KHSA 3V9ZA 2Z1JA 2RN2A 4OKJA 4CJRA 2Y1IA 4E7HA 1RT5A 1TKZA 2LSNA 3K59A 4KTQA 4KHQA 4H4OA 1WAFA 1C0UA 1EETA 2YKMA 3QO9A 4DFPA 4J2BA 4FLVA 1SV5A 3OYBA 4DTOA 3LANA 4IDKA 4BWJA 3SQ4A 2YNHA 4YFUA 4DSLA 1XHXA 4FJMA 3SI6A 1XHZA 4CCHA 4L8RB 2OA8A 3LZIA 3DOKA 4DS5A 3AA5X 3IAYA 4CJWA 5CY4A 4AHUA 3KLHA 1MU2A 4CHOA 3HL8A 3DYAA 3LPUA 4WE1A 4E3SA 1L3UA 3UIQA 1RT6A 4W5TA 4HTUA 4GW6A 4OGEA 3T1AA 5I42A 3L2UA 3V1RA 4FZXC 4DU4A 2W42A 1SKRA 3TAMA 3F9KA 4CF9A 3SUNA 4CFDA 3CQ8A 4ZTJA 1IKWA 4BDPA 4AHVA 2R7YA 3S9HA 3ITHA 3AV9A 4W5QA 1IKYA 2HNZA 1N5YA 2HHTA 4CGJA 2PYLA 4Z4FA 4CECA 3OYAA 4DF4A 3HVRA 3L2WA 4F4KA 5KRSA 3QNOA 1B9FA 2VWJA 3KD1E 2EX3A 4KRFA 1T05A 1S1TA 4JS4A 3TWHA 4CEAA 5KI6A 2O4IA 1GOAA 4M3TA 4K8XA 1HRHA 3QLHA 3AO1A 1VSLA 3OYFA 1JL1A 1K6YA 1RT7A 1HNVA 4KPYA 4LSLA 1TKXA 1NK6A 4CJ4A 2YKNA 4F3TA 1TGOA 4FJKA 3TAFA 5CZ2A 4CGDA 1RT1A 3NCIA 2FC0A 4PWDA 1TK8A 1RT4A 1XWLA 2HW3A 2IS3A 1TK0A 4M3ZA 4B9TA 3DLEA 5J2NA 3TANA 4OLAA 1S6QA 3ZT3A 3HPGA 3ZSZA 1CXUA 1VK0A 1KCFA 4E7IA 3LZJA 2OZSA 1TL1A 3C95A 3OJSA 2G8IA 4DTRA 3VQCA 1YVUA 4F8RA 1NK0A 2OPRA 2Z1IA 4NCGA 1D5AA 3LALA 4CEFA 4N56A 4FLYA 4KHUA 4DLEA 4FJHA 3P5JA 3HVTA 1RTIA 3LP3A 4O5BA 4CFCA 2BE2A 1GOCA 3OS2A 3L2VA 3QEIA 3VQ5A 2ATQA 4DWIA 4M45A 4M3RA 4KV8A 4EP5A 4HUFA 4FM2A 1LW0A 3AA4A 1DLOA 3LP0A 4DFJA 4FLZA 4C8KA 4CERA 4DG1A 2PYJA 1J54A 4CFBA 3DLRA 4KB0A 2OZMA 4CHQA 4N5SA 2Z1GA 4KREA 1RDDA 2XY7A 3L2RA 2E6MA 1JLCA 3WNHA 5SZTA 3JSMA 3OVNA 3PX0A 4CJSA 1U47A 2B5JA 4DTXA 1UOCA 5J1EA 3OJUA 2VG5A 3BGRA 1KVAA 3NDKA 4DQRA 1VSIA 3TAGA 3AVCA 4CJQA 1S1WA 1KLMA 3ZSOA 4FJ8A 4CF0A 5KTQA 3NAEA 3L8BA 4DTMA 4C8OA 1YTAA 1RBVA 4DSKA 3PO4A 2HB5A 1WSHA 3K58A 4B9VA 3M8QA 1U4BA 1NK4A 1NK9A 4B9LA 1D9FA 4DSJA 1Y97A 1QE1A 3NE6A 1DTTA 3HSTB 1SKSA 2QK9A 1CZ9A 4DLGA 3O4QA 3HM9A 3RRGA 2F8SA 3KLEA 3ULDA 4FJNA 3KK3A 1ZBHA 4E7JA 2HVHA 1REVA 4FM1A 1A5VA 3MEEA 3HT3A 1TK5A 4HCBA 3TABA 1J53A 1W0HA 1HYZA 3CM5A 1C1AA 4I7FA 4CEOA 4OPKA 3K5OA 2Y1JA 3MXJA 1KSPA 3SQ2A 5KGWA 4IFYA 3RR8A 3A2FA 4ICLA 1VSHA 3K57A 3K2PA 1ZYQA 1JLGA 1QSSA 1R0AA 4AHCA 3AVLA 3DRRA 1NJYA 4Y1CA 3HO1A 3VQEA 4UQGA 4FLUA 4AHRA 1U48A 3HPHA 1C1BA 4BDZA 5HROA 1LWEA 4IG0A 5KGXA 2X6NA 4CJPA 1IH7A 3HJFA 3AVFA 4W5OA 3OYIA 2PY5A 5D3GA 1QSLA 1KVCA 4OKKA 1Q8IA 4ELUA 4CEEA 4Z4IA 2KTQA 1ITGA 4Q5VA 4O0JA 3AO4A 3EYZA 4Q0BA 4HVJA 3V4IA 2HHQA 5HRPA 4CF2A 3HP6A 1LWFA 4ID5A 3ISNC 1ASUA 4FK0A 2EHGA 4EZ6A 2B6AA 1CXQA 2B4JA 2IGIA 5FRNA 1RILA 4LH5A 4Y1DA 3KIOA 2RKIA 4CESA 4FJ5A 2QKBA 3LAMA 3ZT4A 3VQ9A 2GV9A 3AVHA 3AVKA 4FLTA 4N41A 2IC3A 1Z26A 2VG7A 4CHPA 4CJVA 1VSKA 3VA0A 1IG9A 1U04A 2XHBA 1SL0A 3NF7A 3NH2A 4OVLA 5DMRA 4F2RA 4OKEA 4KHWA 4BE1A 1TKTA 2X78A 4CE9A 4XIUA 3KK1A 3QEPA 4FJ9A 3OYGA 3SUPA 2RPIA 4CK3A 4FJ7A 1WNSA 1BGXT 4CJ3A 4RG8A 4FCYA 3QIOA 1WLJA 3ASMA 5FDLA 1KLNA 3KD5E 1SUQA 3QNNA 4RW7A 3NGIA 4CGFA 4E89A 3CFPA 1YT3A 4CJKA 4GMJB 1ZBLA 3QEWA 1X9MA 2RF2A 3VA3A 1RTJA 1Q9YA 1BI4A 1C0MA 4I2PA 2XO7A 1SKWA 2BDPA 2G8HA 1TAUA 2HHVA 2F96A 5HRSA 4DQQA 4I2QA 5CYQA 3L3UA 3U3YA 2YNGA 1GOBA 3DLBA 4N76A 4M41A 2DY4A 4FW2A 1WSIA 4FJGA 4M42A 1IO2A 1RT3A 3VQAA 2NUBA 4DU1A 3DLHA 1ZBUA 3LPTA 3NH1A 5HRNA 1U49A 1NKCA 1L3SA 4B8AB 2ZE2A 3NF6A 2XRIA 4LD0A 3OYEA 3ZT0A 1HYSA 1BISA 3NGZA 3KLFA 4JS5A 3SYZA 1C6VA 4PA1A 1BQNA 3I0SA 3AA2A 4CJEA 4CJFA 3QETA 3DOLA 2A1SA 2D0CA 1XC9A 1EKEA 1S5JA 2YHBA 3AVNA 3AO5A 3QERA 1HJRA 3RR7A 3PO5A 4FYDA 4BE0A 3T19A 3OS0A 4J2EA 1C0TA 2A1RA 4DU3A 5I3UA 3MEDA 2FBYA 4F3OA 1ZBIA 3HXMA 2Q3SA 3DLKA 3NFAA 4J2AA 4CJLA 5C25A 4FLXA 3SZ2A 4B9SA 4KTZA 4EP4A 3K5LA 1J5OA 1ZBFA 2GUIA 2KW4A 3VQ7A 3L3VA 5CZ1A 1HYVA 2HNDA 3THVA 4Z4EA 5FROA 2IDOA 1Z25A 3KLGA 1NKEA 1LAWA 3M8SA 1T03A 3CFOA 3V9WA 2OYQA 4CK2A 2D5RA 2FBVA 1WSJA 1NJXA 5J2MA 3S3NA 4KHNA 3RMAA 2VWKA 3PUFA 4KKOA 2G8WA 1RDAA 4I9QA 1S1XA 4B3OA 1JXEA 3SCXA 4CGIA 1LV5A 4HUEA 4F2SA 3HK2A 4CIGA 1YTUA 3MECA 1VSFA 4C8NA 3DM2A 4PUOA 4CIEA 4I9LA 3TAEA 4DTNA 2WONA 4CFAA 4CEQA 3OYLA 3AVAA 4E7LA 1RNHA 2X74A 3H08A 3SNNA 4H8KA 4NYNA 3NF8A 4DS4A 2KFNA 1RT2A 1NK5A 3ZSYA 1JLQA 1WSFA 2F8TA 2XY5A 4FJLA 3ZCMA 1WAJA 4N47A 1HMVA 3VQ8A 2P5GA 4IKFA 2XY8A 4KFBA 3C94A 2BANA 3V6DA 3PX6A 2P5OA 4YNQA 3OYMA 3CFRA 1KVBA 1QQCA 1BHLA 3TARA 4CGGA 1KRPA 1KFDA 2IOCA 1SL2A 3MEGA 3HYFA 5JS2A 3ZT2A 3O3GA 1D8YA 3QINA 1RBTA 3NBPA 4LY7A 2YNFA 3IRXA 1BQMA 4IFVA 4M3WA 4W5RA 1RTDA 3RRHA 3QIPA 3V1OA 4GVMA 4HHTA 4TSXA 4BDYA 3AVIA 4KTWA 3KTQA 4CF1A 1FKPA 4CF8A 2HHSA 3QEVA 1CLQA 3WNEA 1I3AA 3FFIA 2I5JA 1BI4B 2Z1HA 4KHYA 3DLGA 3G10A 3M8RA 4E7KA 3V9SA 3C6TA 1QS4A 2D0AA 2DFFA 2ZQBA 2G8UA 4JRQA 2OPPA 4DTUA 4Z4GA 3AVJA 1VSMA 3L2QA 1S6PA 1S1UA 1IKVA 1TL3A 2DFHA 4AHTA 4Z4HA 1WSEA 3OYKA 1FKOA 2PZSA 1JL2A 4DF8A 3DRSA 3QEXA 1XI1A 2VG6A 3DI6A 3AVBA 4IG3A 1UA1A 1TKDA 4KB1A 1J9AA 1TV6A 4PQUA 3I8DA 3NGYA 1EP4A 1X9SA 3CYMA 1NJZA 3F73A 5HRRA 4E0DA 3LP1A 2ITGA 5DK5A 3K5MA 5HP1A 4K8ZA 3MXMA 4AHSA 3T3FA 3VN5A 4Z4CA 4JRPA 3LP2A 4ID1A 4DFKA 3VQDA 1BL3A 1S9GA 3HPOA 1NKBA 3V9XA 1KTQA 5EU7A 3RMBA 2FBXA 3TAPA 4DQIA 4FVMA 4MFBA 2HHUA 4MQ3A 3MXIA 1A5XA 1NOZA 5HLFA 4EZ9A 1NK8A 2HMIA 4QCLA 3S3OA 3ZSRA 4B8CA 3B6PA 4DSFA 4ZTFA 1QTMA 3MAQA 4FZZA 1C1CA 3TAQA 3O4NA 1L5UA 1NJWA 1ASWA 1Q9XA 1W9HA 3V81A 4OJRA 2G8VA 5K14A 3B6OA 1RBSA 1VSJA 3IG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXF A;  2JGU A;  4RW6 A;  1VSD A;  4RW8 A;  2G8K A;  4DQS A;  1D9D A;  2HHW A;  2AJQ A;  4W5N A;  3EY1 A;  4G1Q A;  4CJT A;  2G8F A;  3SPZ A;  3BDP A;  3PV8 A;  1UWB A;  3DMJ A;  4LH4 A;  3NH0 A;  3G0Z A;  1L3V A;  1F21 A;  4RW9 A;  3CM6 A;  2KZM A;  5C42 A;  5J2Q A;  4CJ5 A;  2XY6 A;  4J2D A;  4CJU A;  4E1N A;  4CEB A;  1S1V A;  3OY9 A;  4FJX A;  1RBU A;  2GBZ A;  4QOZ B;  3EZ5 A;  1DTQ A;  2P51 A;  1RBR A;  3KLI A;  4FXD A;  1X1P A;  4DQP A;  4O4G A;  3VQB A;  3U3G A;  1B92 A;  3D45 A;  3LWM A;  4HUG A;  1HQU A;  1WN7 A;  1CZB A;  2E4L A;  4H4M A;  4IBN A;  5SWM A;  1HPZ A;  3SJJ A;  4FW1 A;  5C24 A;  1BIU A;  2OPQ A;  1N6Q A;  1ASV A;  1T7P A;  3OYN A;  1VRT A;  3C6U A;  1I39 A;  1JLE A;  3AVM A;  4DTJ A;  2O4G A;  3D0P A;  1FK9 A;  3I0R A;  4FZY A;  2KZZ A;  1HNI A;  4PY5 A;  2DFE A;  4FJJ A;  2YHA A;  1SL1 A;  1JKH A;  4CGH A;  3NF9 A;  3NHG A;  4KI4 A;  5FRM A;  3SPY A;  1KFS A;  5JS1 A;  3AVG A;  3SV4 A;  4B9U A;  4E19 A;  3JYT A;  1JXB A;  1JLB A;  4AH9 A;  4B9N A;  4CIF A;  3CG7 A;  4RW4 A;  5T7B A;  3VQQ A;  3PX4 A;  1NK7 A;  2QKK A;  1HQE A;  4OPJ A;  1EX4 A;  3SUO A;  1JLA A;  3OYC A;  4C8L A;  4LSN A;  4M3X A;  3HP9 A;  1RTH A;  1UAX A;  2IAJ A;  3K5N A;  3IS9 A;  5KRT A;  4DFM A;  1X9W A;  4M3U A;  1QHT A;  2ETJ A;  2YNI A;  4R5P A;  1B9D A;  3SV3 A;  3S3M A;  4NYF A;  4KAZ A;  3P1G A;  2JLE A;  2P1J A;  3SUQ A;  3SQ1 A;  1A5W A;  1LW2 A;  1VSE A;  2E6L A;  1RDC A;  3V1Q A;  4DMN A;  1L3T A;  2KFZ A;  3OYJ A;  4CK1 A;  2OPS A;  4ELT A;  4Z0U A;  3LAK A;  4NCB A;  3KKR A;  2HNY A;  1EXQ A;  1RCH A;  5HBM A;  3O3H A;  4HCC A;  1LAV A;  5CYM A;  3WNG A;  3QES A;  1FXX A;  2WOM A;  1UA0 A;  2YV0 X;  3ZSV A;  4CED A;  2FBT A;  2ZD1 A;  4ZHR A;  3ZSQ A;  4B08 A;  3OS1 A;  1U45 A;  1T8E A;  4AIL C;  3LDS A;  4KO0 A;  4DTS A;  3ZSW A;  3AO2 A;  3WNF A;  3DRP A;  4DSI A;  4CHN A;  2KQ2 A;  3AO3 A;  4B9M A;  1BIZ A;  4FM0 A;  2X6S A;  4FK2 A;  4DSE A;  1G15 A;  4DTP A;  3SQ0 A;  3VQ6 A;  4BAC A;  1IKX A;  3ALY A;  4NCA A;  3U6F A;  3OYH A;  4BE2 A;  4FLW A;  2BGG A;  3AA3 A;  4C8M A;  3TR8 A;  1LWC A;  1TAQ A;  3P83 D;  4OGC A;  4FJI A;  1TVR A;  3PY8 A;  3M8P A;  1S9E A;  2HHX A;  3RTV A;  3KKS A;  1O1W A;  4E1M A;  3RMC A;  4FK4 A;  3RMD A;  4CEZ A;  4ELV A;  1BCO A;  4O55 A;  3V9U A;  1BCM A;  4CHZ A;  3ZSX A;  4BWM A;  4O0I A;  4O44 A;  1QSY A;  4JLH A;  1WSG A;  3RWU A;  4KI6 A;  3E01 A;  3TI0 A;  1RDB A;  3VQP A;  2DTU A;  1JLF A;  3VQ4 A;  4QAG A;  3ZT1 A;  2D0B A;  4CHY A;  1VRU A;  3KJV A;  3LWL A;  3KK2 A;  5J2P A;  4M3Y A;  4OLB A;  2HVI A;  5E41 A;  3O3F A;  3OYD A;  1NOY A;  4KHS A;  3V9Z A;  2Z1J A;  2RN2 A;  4OKJ A;  4CJR A;  2Y1I A;  4E7H A;  1RT5 A;  1TKZ A;  2LSN A;  3K59 A;  4KTQ A;  4KHQ A;  4H4O A;  1WAF A;  1C0U A;  1EET A;  2YKM A;  3QO9 A;  4DFP A;  4J2B A;  4FLV A;  1SV5 A;  3OYB A;  4DTO A;  3LAN A;  4IDK A;  4BWJ A;  3SQ4 A;  2YNH A;  4YFU A;  4DSL A;  1XHX A;  4FJM A;  3SI6 A;  1XHZ A;  4CCH A;  4L8R B;  2OA8 A;  3LZI A;  3DOK A;  4DS5 A;  3AA5 X;  3IAY A;  4CJW A;  5CY4 A;  4AHU A;  3KLH A;  1MU2 A;  4CHO A;  3HL8 A;  3DYA A;  3LPU A;  4WE1 A;  4E3S A;  1L3U A;  3UIQ A;  1RT6 A;  4W5T A;  4HTU A;  4GW6 A;  4OGE A;  3T1A A;  5I42 A;  3L2U A;  3V1R A;  4FZX C;  4DU4 A;  2W42 A;  1SKR A;  3TAM A;  3F9K A;  4CF9 A;  3SUN A;  4CFD A;  3CQ8 A;  4ZTJ A;  1IKW A;  4BDP A;  4AHV A;  2R7Y A;  3S9H A;  3ITH A;  3AV9 A;  4W5Q A;  1IKY A;  2HNZ A;  1N5Y A;  2HHT A;  4CGJ A;  2PYL A;  4Z4F A;  4CEC A;  3OYA A;  4DF4 A;  3HVR A;  3L2W A;  4F4K A;  5KRS A;  3QNO A;  1B9F A;  2VWJ A;  3KD1 E;  2EX3 A;  4KRF A;  1T05 A;  1S1T A;  4JS4 A;  3TWH A;  4CEA A;  5KI6 A;  2O4I A;  1GOA A;  4M3T A;  4K8X A;  1HRH A;  3QLH A;  3AO1 A;  1VSL A;  3OYF A;  1JL1 A;  1K6Y A;  1RT7 A;  1HNV A;  4KPY A;  4LSL A;  1TKX A;  1NK6 A;  4CJ4 A;  2YKN A;  4F3T A;  1TGO A;  4FJK A;  3TAF A;  5CZ2 A;  4CGD A;  1RT1 A;  3NCI A;  2FC0 A;  4PWD A;  1TK8 A;  1RT4 A;  1XWL A;  2HW3 A;  2IS3 A;  1TK0 A;  4M3Z A;  4B9T A;  3DLE A;  5J2N A;  3TAN A;  4OLA A;  1S6Q A;  3ZT3 A;  3HPG A;  3ZSZ A;  1CXU A;  1VK0 A;  1KCF A;  4E7I A;  3LZJ A;  2OZS A;  1TL1 A;  3C95 A;  3OJS A;  2G8I A;  4DTR A;  3VQC A;  1YVU A;  4F8R A;  1NK0 A;  2OPR A;  2Z1I A;  4NCG A;  1D5A A;  3LAL A;  4CEF A;  4N56 A;  4FLY A;  4KHU A;  4DLE A;  4FJH A;  3P5J A;  3HVT A;  1RTI A;  3LP3 A;  4O5B A;  4CFC A;  2BE2 A;  1GOC A;  3OS2 A;  3L2V A;  3QEI A;  3VQ5 A;  2ATQ A;  4DWI A;  4M45 A;  4M3R A;  4KV8 A;  4EP5 A;  4HUF A;  4FM2 A;  1LW0 A;  3AA4 A;  1DLO A;  3LP0 A;  4DFJ A;  4FLZ A;  4C8K A;  4CER A;  4DG1 A;  2PYJ A;  1J54 A;  4CFB A;  3DLR A;  4KB0 A;  2OZM A;  4CHQ A;  4N5S A;  2Z1G A;  4KRE A;  1RDD A;  2XY7 A;  3L2R A;  2E6M A;  1JLC A;  3WNH A;  5SZT A;  3JSM A;  3OVN A;  3PX0 A;  4CJS A;  1U47 A;  2B5J A;  4DTX A;  1UOC A;  5J1E A;  3OJU A;  2VG5 A;  3BGR A;  1KVA A;  3NDK A;  4DQR A;  1VSI A;  3TAG A;  3AVC A;  4CJQ A;  1S1W A;  1KLM A;  3ZSO A;  4FJ8 A;  4CF0 A;  5KTQ A;  3NAE A;  3L8B A;  4DTM A;  4C8O A;  1YTA A;  1RBV A;  4DSK A;  3PO4 A;  2HB5 A;  1WSH A;  3K58 A;  4B9V A;  3M8Q A;  1U4B A;  1NK4 A;  1NK9 A;  4B9L A;  1D9F A;  4DSJ A;  1Y97 A;  1QE1 A;  3NE6 A;  1DTT A;  3HST B;  1SKS A;  2QK9 A;  1CZ9 A;  4DLG A;  3O4Q A;  3HM9 A;  3RRG A;  2F8S A;  3KLE A;  3ULD A;  4FJN A;  3KK3 A;  1ZBH A;  4E7J A;  2HVH A;  1REV A;  4FM1 A;  1A5V A;  3MEE A;  3HT3 A;  1TK5 A;  4HCB A;  3TAB A;  1J53 A;  1W0H A;  1HYZ A;  3CM5 A;  1C1A A;  4I7F A;  4CEO A;  4OPK A;  3K5O A;  2Y1J A;  3MXJ A;  1KSP A;  3SQ2 A;  5KGW A;  4IFY A;  3RR8 A;  3A2F A;  4ICL A;  1VSH A;  3K57 A;  3K2P A;  1ZYQ A;  1JLG A;  1QSS A;  1R0A A;  4AHC A;  3AVL A;  3DRR A;  1NJY A;  4Y1C A;  3HO1 A;  3VQE A;  4UQG A;  4FLU A;  4AHR A;  1U48 A;  3HPH A;  1C1B A;  4BDZ A;  5HRO A;  1LWE A;  4IG0 A;  5KGX A;  2X6N A;  4CJP A;  1IH7 A;  3HJF A;  3AVF A;  4W5O A;  3OYI A;  2PY5 A;  5D3G A;  1QSL A;  1KVC A;  4OKK A;  1Q8I A;  4ELU A;  4CEE A;  4Z4I A;  2KTQ A;  1ITG A;  4Q5V A;  4O0J A;  3AO4 A;  3EYZ A;  4Q0B A;  4HVJ A;  3V4I A;  2HHQ A;  5HRP A;  4CF2 A;  3HP6 A;  1LWF A;  4ID5 A;  3ISN C;  1ASU A;  4FK0 A;  2EHG A;  4EZ6 A;  2B6A A;  1CXQ A;  2B4J A;  2IGI A;  5FRN A;  1RIL A;  4LH5 A;  4Y1D A;  3KIO A;  2RKI A;  4CES A;  4FJ5 A;  2QKB A;  3LAM A;  3ZT4 A;  3VQ9 A;  2GV9 A;  3AVH A;  3AVK A;  4FLT A;  4N41 A;  2IC3 A;  1Z26 A;  2VG7 A;  4CHP A;  4CJV A;  1VSK A;  3VA0 A;  1IG9 A;  1U04 A;  2XHB A;  1SL0 A;  3NF7 A;  3NH2 A;  4OVL A;  5DMR A;  4F2R A;  4OKE A;  4KHW A;  4BE1 A;  1TKT A;  2X78 A;  4CE9 A;  4XIU A;  3KK1 A;  3QEP A;  4FJ9 A;  3OYG A;  3SUP A;  2RPI A;  4CK3 A;  4FJ7 A;  1WNS A;  1BGX T;  4CJ3 A;  4RG8 A;  4FCY A;  3QIO A;  1WLJ A;  3ASM A;  5FDL A;  1KLN A;  3KD5 E;  1SUQ A;  3QNN A;  4RW7 A;  3NGI A;  4CGF A;  4E89 A;  3CFP A;  1YT3 A;  4CJK A;  4GMJ B;  1ZBL A;  3QEW A;  1X9M A;  2RF2 A;  3VA3 A;  1RTJ A;  1Q9Y A;  1BI4 A;  1C0M A;  4I2P A;  2XO7 A;  1SKW A;  2BDP A;  2G8H A;  1TAU A;  2HHV A;  2F96 A;  5HRS A;  4DQQ A;  4I2Q A;  5CYQ A;  3L3U A;  3U3Y A;  2YNG A;  1GOB A;  3DLB A;  4N76 A;  4M41 A;  2DY4 A;  4FW2 A;  1WSI A;  4FJG A;  4M42 A;  1IO2 A;  1RT3 A;  3VQA A;  2NUB A;  4DU1 A;  3DLH A;  1ZBU A;  3LPT A;  3NH1 A;  5HRN A;  1U49 A;  1NKC A;  1L3S A;  4B8A B;  2ZE2 A;  3NF6 A;  2XRI A;  4LD0 A;  3OYE A;  3ZT0 A;  1HYS A;  1BIS A;  3NGZ A;  3KLF A;  4JS5 A;  3SYZ A;  1C6V A;  4PA1 A;  1BQN A;  3I0S A;  3AA2 A;  4CJE A;  4CJF A;  3QET A;  3DOL A;  2A1S A;  2D0C A;  1XC9 A;  1EKE A;  1S5J A;  2YHB A;  3AVN A;  3AO5 A;  3QER A;  1HJR A;  3RR7 A;  3PO5 A;  4FYD A;  4BE0 A;  3T19 A;  3OS0 A;  4J2E A;  1C0T A;  2A1R A;  4DU3 A;  5I3U A;  3MED A;  2FBY A;  4F3O A;  1ZBI A;  3HXM A;  2Q3S A;  3DLK A;  3NFA A;  4J2A A;  4CJL A;  5C25 A;  4FLX A;  3SZ2 A;  4B9S A;  4KTZ A;  4EP4 A;  3K5L A;  1J5O A;  1ZBF A;  2GUI A;  2KW4 A;  3VQ7 A;  3L3V A;  5CZ1 A;  1HYV A;  2HND A;  3THV A;  4Z4E A;  5FRO A;  2IDO A;  1Z25 A;  3KLG A;  1NKE A;  1LAW A;  3M8S A;  1T03 A;  3CFO A;  3V9W A;  2OYQ A;  4CK2 A;  2D5R A;  2FBV A;  1WSJ A;  1NJX A;  5J2M A;  3S3N A;  4KHN A;  3RMA A;  2VWK A;  3PUF A;  4KKO A;  2G8W A;  1RDA A;  4I9Q A;  1S1X A;  4B3O A;  1JXE A;  3SCX A;  4CGI A;  1LV5 A;  4HUE A;  4F2S A;  3HK2 A;  4CIG A;  1YTU A;  3MEC A;  1VSF A;  4C8N A;  3DM2 A;  4PUO A;  4CIE A;  4I9L A;  3TAE A;  4DTN A;  2WON A;  4CFA A;  4CEQ A;  3OYL A;  3AVA A;  4E7L A;  1RNH A;  2X74 A;  3H08 A;  3SNN A;  4H8K A;  4NYN A;  3NF8 A;  4DS4 A;  2KFN A;  1RT2 A;  1NK5 A;  3ZSY A;  1JLQ A;  1WSF A;  2F8T A;  2XY5 A;  4FJL A;  3ZCM A;  1WAJ A;  4N47 A;  1HMV A;  3VQ8 A;  2P5G A;  4IKF A;  2XY8 A;  4KFB A;  3C94 A;  2BAN A;  3V6D A;  3PX6 A;  2P5O A;  4YNQ A;  3OYM A;  3CFR A;  1KVB A;  1QQC A;  1BHL A;  3TAR A;  4CGG A;  1KRP A;  1KFD A;  2IOC A;  1SL2 A;  3MEG A;  3HYF A;  5JS2 A;  3ZT2 A;  3O3G A;  1D8Y A;  3QIN A;  1RBT A;  3NBP A;  4LY7 A;  2YNF A;  3IRX A;  1BQM A;  4IFV A;  4M3W A;  4W5R A;  1RTD A;  3RRH A;  3QIP A;  3V1O A;  4GVM A;  4HHT A;  4TSX A;  4BDY A;  3AVI A;  4KTW A;  3KTQ A;  4CF1 A;  1FKP A;  4CF8 A;  2HHS A;  3QEV A;  1CLQ A;  3WNE A;  1I3A A;  3FFI A;  2I5J A;  1BI4 B;  2Z1H A;  4KHY A;  3DLG A;  3G10 A;  3M8R A;  4E7K A;  3V9S A;  3C6T A;  1QS4 A;  2D0A A;  2DFF A;  2ZQB A;  2G8U A;  4JRQ A;  2OPP A;  4DTU A;  4Z4G A;  3AVJ A;  1VSM A;  3L2Q A;  1S6P A;  1S1U A;  1IKV A;  1TL3 A;  2DFH A;  4AHT A;  4Z4H A;  1WSE A;  3OYK A;  1FKO A;  2PZS A;  1JL2 A;  4DF8 A;  3DRS A;  3QEX A;  1XI1 A;  2VG6 A;  3DI6 A;  3AVB A;  4IG3 A;  1UA1 A;  1TKD A;  4KB1 A;  1J9A A;  1TV6 A;  4PQU A;  3I8D A;  3NGY A;  1EP4 A;  1X9S A;  3CYM A;  1NJZ A;  3F73 A;  5HRR A;  4E0D A;  3LP1 A;  2ITG A;  5DK5 A;  3K5M A;  5HP1 A;  4K8Z A;  3MXM A;  4AHS A;  3T3F A;  3VN5 A;  4Z4C A;  4JRP A;  3LP2 A;  4ID1 A;  4DFK A;  3VQD A;  1BL3 A;  1S9G A;  3HPO A;  1NKB A;  3V9X A;  1KTQ A;  5EU7 A;  3RMB A;  2FBX A;  3TAP A;  4DQI A;  4FVM A;  4MFB A;  2HHU A;  4MQ3 A;  3MXI A;  1A5X A;  1NOZ A;  5HLF A;  4EZ9 A;  1NK8 A;  2HMI A;  4QCL A;  3S3O A;  3ZSR A;  4B8C A;  3B6P A;  4DSF A;  4ZTF A;  1QTM A;  3MAQ A;  4FZZ A;  1C1C A;  3TAQ A;  3O4N A;  1L5U A;  1NJW A;  1ASW A;  1Q9X A;  1W9H A;  3V81 A;  4OJR A;  2G8V A;  5K14 A;  3B6O A;  1RBS A;  1VSJ A;  3IG1 A; 
#chains in the Genus database with same CATH topology
 2JGU A;  4RW8 A;  4BRK A;  2ZJP L;  3AY9 A;  2HF4 A;  3TPQ A;  3NH0 A;  1M90 O;  1SAZ A;  1F21 A;  2ZJQ L;  3CCV N;  3G71 N;  5LJW A;  4JKH A;  1RBU A;  4JI6 K;  3EZ5 A;  2P51 A;  1RBR A;  4FXD A;  3VEN A;  4ISF A;  4DQP A;  1IV0 A;  4FOE A;  1JCE A;  2O8F B;  4HUG A;  4H4M A;  3OHR A;  4IBN A;  3WT0 A;  1K8A O;  1EWR A;  4DB3 A;  3SJJ A;  3BUZ B;  4JAX A;  3ZET B;  4FW1 A;  4DR3 K;  2UYT A;  1NNE A;  4X66 K;  1I39 A;  3AVM A;  1FK9 A;  2YHA A;  1SL1 A;  1HUX A;  4O8K A;  3L4Q A;  2KHO A;  1NGH A;  3MN9 A;  4H03 B;  4RTF D;  4K42 A;  1U2V A;  5JVG L;  4H5W A;  2QKK A;  3PX4 A;  1EX4 A;  1OH6 A;  3JAM O;  1UAX A;  5AQY A;  5KRT A;  4M3U A;  2ETJ A;  3VOV A;  5JLF A;  3P1G A;  4DV4 K;  1LW2 A;  1RDC A;  1HNZ K;  5HOO A;  2OPS A;  3THX B;  1EXQ A;  5I9E B;  4HCC A;  2YV0 X;  3ZSQ A;  4B08 A;  2DPN A;  4IO8 A;  1XNR K;  5F0X A;  4DTS A;  3AO2 A;  3WNF A;  1BO5 O;  2UU9 K;  4CHN A;  3AO3 A;  4JI0 K;  2X6S A;  4JHD A;  3VQ6 A;  3D2F A;  4NCA A;  4FLW A;  2QI2 A;  2UUA K;  2ZJR L;  3J7Z O;  5AQQ A;  5BRE A;  2P9I B;  1TVR A;  3G6E N;  3MN5 A;  3UKU B;  2HHX A;  1O1W A;  4ELV A;  1BCO A;  1OH5 A;  4AM7 A;  1BCM A;  4B1Y B;  4O44 A;  4JHD B;  4JLH A;  1WSG A;  1JLF A;  4CHY A;  4QAG A;  1VRU A;  3LWL A;  3PLA A;  1FJG K;  4BRP A;  3OA9 A;  4KHS A;  2RN2 A;  1GLJ O;  1T44 A;  4XEI A;  2Y1I A;  3LDP A;  1N33 K;  4E7H A;  2PAV A;  1RT5 A;  1TKZ A;  4BRM A;  5JIC A;  3QO9 A;  4DFP A;  4J2B A;  4FLV A;  3OYB A;  3WXL A;  1SZ2 A;  4FJM A;  4CCH A;  3LZI A;  3AA5 X;  3CF5 L;  1QZ5 A;  1MU2 A;  3EO3 A;  5GIP A;  1VHX A;  2VQE K;  4EHT A;  2W42 A;  3SUN A;  1WBB A;  3FGU A;  4CZH A;  1IKW A;  2FXU A;  5AQV A;  2R7Y A;  4JV5 K;  1ESV A;  4CGJ A;  3O6W A;  3H3N O;  3GOI A;  1W7A A;  4Z4F A;  3MK6 A;  4CEC A;  3A5O C;  2A6A A;  4KH6 A;  3G25 A;  3QNO A;  2VWJ A;  1T05 A;  1ATR A;  1S1T A;  3TWH A;  2GWJ A;  1HRH A;  2JWK A;  4FWO A;  4LSL A;  1NK6 A;  2YKN A;  4CGD A;  1OVY A;  1TK0 A;  1VAZ A;  1S6Q A;  1HPM A;  1CXU A;  2P9K B;  3C95 A;  5KPR A;  1VQM N;  4CEF A;  4GNI A;  3P5J A;  4DS5 A;  3LP3 A;  4O5B A;  3QEI A;  3MWT A;  4KV8 A;  3AA4 A;  4MLE A;  3ZEU B;  1MA9 B;  3THX A;  1S72 N;  3DLR A;  4FSV A;  1VQ6 N;  2WFB A;  5AQI A;  1HNX K;  2UUC K;  1U47 A;  3C7N A;  2B5J A;  3OJU A;  1Z05 A;  3NDK A;  3CJ1 A;  4FJ8 A;  4WQ4 C;  5E26 A;  4BC4 A;  1RBV A;  3PO4 A;  3FZH A;  4ILH A;  3K58 A;  4FWK A;  4CZG A;  4DSJ A;  3ID8 A;  1DTT A;  3TTD A;  4DLG A;  2F8S A;  3HM9 A;  3ULD A;  2W41 A;  4E7J A;  3VGK A;  3ATV A;  1A5V A;  3HT3 A;  1J53 A;  1HYS A;  1HYZ A;  4OPK A;  3RR8 A;  3A2F A;  4ICL A;  3I56 N;  5F1X A;  3K57 A;  3K2P A;  3FZK A;  1QSS A;  3CCR N;  3HO1 A;  3VQE A;  4JKC A;  4IG0 A;  3T1Y K;  4JI1 K;  4CJP A;  1IH7 A;  3OYI A;  1VQL N;  2PY5 A;  5D3G A;  1Q8I A;  1ZC6 A;  4JKG B;  4FWQ A;  4O0J A;  3CJA A;  4BR2 A;  3EYZ A;  4HTL A;  1ASU A;  2FSK A;  1ZBS A;  2EHG A;  2O8E B;  2B6A A;  4MO4 A;  2IGI A;  1NGB A;  1EWQ A;  4N41 A;  4MDA A;  4IDH A;  3LL3 A;  3J80 O;  2XHB A;  3NF7 A;  2UXD K;  3J81 O;  2X78 A;  4XIU A;  4FJ9 A;  3QEP A;  3OYG A;  4CK3 A;  4C1N I;  1BGX T;  4OPH A;  4RG8 A;  3QIO A;  5C2D A;  4DR2 K;  4DQ8 A;  4CGF A;  3CPW M;  1VQ4 N;  5A2Q O;  4CJK A;  4GMJ B;  5HL7 L;  4EHU A;  1X9M A;  3VA3 A;  4JD2 A;  2XO7 A;  2BDP A;  2VWB A;  1ATN A;  3LM9 A;  4DR4 K;  3U3Y A;  2YNG A;  3WXM B;  2DY4 A;  4FW2 A;  3UB5 A;  4M42 A;  1IO2 A;  3DLH A;  1LCU A;  2QWP A;  5HRN A;  1L3S A;  2XRI A;  1BIS A;  1VQP N;  3SYZ A;  4CJE A;  4PA1 A;  1BQN A;  3I0S A;  2V7Z A;  3AA2 A;  3AVN A;  4LFA K;  1HJR A;  3OS0 A;  1C0T A;  2A1R A;  2Q3S A;  1K8K B;  3EKU A;  3CCJ N;  4CZM A;  4CJL A;  3EN9 A;  2E2P A;  3E9P A;  3VQ7 A;  3MX5 A;  5CZ1 A;  1HYV A;  1YJW N;  2IDO A;  1NKE A;  1LAW A;  4FPA A;  1T03 A;  4I6M B;  2FBV A;  3KK7 A;  3OW2 M;  4U7B A;  1WSJ A;  2YX6 A;  3QIC A;  5J2M A;  2VWK A;  2G8W A;  4I6M A;  5AZI A;  5TKY A;  2CH6 A;  2IIR A;  1YTU A;  3CC4 N;  4J8F A;  4BR4 A;  1NMN A;  3ENB A;  3MEC A;  1VSF A;  4C8N A;  4CIE A;  4DTN A;  4CEQ A;  3SNN A;  2V7Y A;  2A40 A;  5BR9 A;  3J7A P;  3PIO L;  1WSF A;  3THW B;  1HMV A;  3ZX3 A;  3GL1 A;  2P5G A;  4KFB A;  1QVG M;  1VQK N;  4GV6 A;  2A3Z A;  5KQ8 A;  1KVB A;  1BHL A;  4CGG A;  1TYQ B;  2IOC A;  1SL2 A;  3HYF A;  3QIN A;  1RBT A;  1H1V A;  2YNF A;  2YJE A;  3V1O A;  5AQF A;  3A5M C;  4IOC L;  2NRR A;  2I5J A;  2Z1H A;  3MDQ A;  5EOY A;  1QS4 A;  1W97 L;  2DFF A;  3AVJ A;  3O1W A;  2PZS A;  3WEE B;  3DRS A;  1XI1 A;  4IG3 A;  3AVB A;  1J9A A;  2VGM A;  5AQG A;  4PKG A;  5FPN A;  1SS6 A;  4A2A A;  1GLB G;  4K8Z A;  3MXM A;  1E3M A;  4JRP A;  3LP2 A;  4DFK A;  2A5X A;  1NKB A;  4B3M K;  3RMB A;  2FBX A;  3WEE A;  4FVM A;  1YIT N;  4MQ3 A;  1WBD A;  3ZSR A;  1C1C A;  4C23 A;  3F2K A;  4ISG A;  3B6O A;  3NVM A;  1VSJ A;  3IG1 A;  2QXF A;  2G8K A;  1D9D A;  4IZ9 A;  4NLC A;  3CMA N;  4A62 A;  1NGC A;  3SPZ A;  3BDP A;  3PV8 A;  4LH4 A;  3VET A;  1L3V A;  4DR6 K;  5J2Q A;  4CJ5 A;  4OO1 J;  4J2D A;  4CJU A;  4JI8 K;  2Q31 A;  4QOZ B;  5KPT A;  1X1P A;  4YOW A;  1B92 A;  3M5R A;  1HQU A;  1CZB A;  3ZLJ A;  3UE5 A;  1HPZ A;  5C24 A;  1BIU A;  1N6Q A;  1ASV A;  3MMV A;  4BY9 C;  3OYN A;  3C6U A;  1JLE A;  4DTJ A;  2O4G A;  3CIP A;  3I0R A;  3VEW A;  4FJJ A;  4QS9 A;  4CGH A;  1YXQ A;  1KFS A;  4E19 A;  2O8C B;  1XC3 A;  1JLB A;  1BUP A;  1XNQ K;  4CIF A;  4RW4 A;  3VQQ A;  5AZI B;  1HQE A;  4OPJ A;  2BUP A;  1JLA A;  2PFU A;  3WQU A;  3OYC A;  4LSN A;  4M3X A;  5AQL A;  4DFM A;  1X9W A;  3SLC A;  3LDO A;  2W40 A;  1B9D A;  1VQO N;  4NYF A;  1MWM A;  2JLE A;  5AR0 A;  3SQ1 A;  4BRN A;  1A5W A;  1VSE A;  5BR8 K;  1L3T A;  4EFH A;  1X3M A;  3SJH A;  3ULE A;  3OYJ A;  4JKD A;  4H0T B;  4PL7 A;  4NCB A;  3U4L A;  1ILY A;  1RCH A;  1NJI O;  3DAW A;  1LAV A;  2V51 B;  3TTF A;  4DCH A;  2ZD1 A;  4G9Z A;  3R1X A;  3OS1 A;  4H0X B;  1U45 A;  1P90 A;  1T8E A;  4AIL C;  3E66 A;  1J6Z A;  4DSI A;  3VTI A;  3DXK A;  1BIZ A;  4FM0 A;  4FK2 A;  1G15 A;  4H0P A;  4DTP A;  1YIJ N;  3CJB A;  5JVH L;  4BAC A;  1KAZ A;  3ALY A;  3U6F A;  4CJ7 A;  3OYH A;  4BE2 A;  1V4S A;  1QQM A;  4WQ4 A;  3TR8 A;  1LWC A;  3CD6 N;  3PY8 A;  3SMP A;  3KKS A;  4E1M A;  3RMC A;  3EEQ A;  3RMD A;  1OKJ A;  5ELZ A;  3DJC A;  3ZSX A;  2DTU A;  3VQ4 A;  5CHI A;  4OLB A;  2P9K A;  3UKR A;  1NOY A;  3FR0 A;  4OKJ A;  2O8B A;  4H4O A;  1C0U A;  1EET A;  4OPA A;  4IJN A;  1SV5 A;  3ZEU A;  4DTO A;  4IDK A;  3EKS A;  4BWJ A;  3CER A;  2YNH A;  3VES A;  4DSL A;  4L8R B;  1V4T A;  3IAY A;  4CJW A;  5FRM A;  3PIP L;  4CHO A;  3HL8 A;  3LPU A;  4WE1 A;  2W6L A;  4W5T A;  3T1A A;  4IJA A;  3L4I A;  4FZX C;  1HNW K;  4CFD A;  4FOI A;  4YOV A;  3CQ8 A;  4ZTJ A;  4L3Q A;  2WC9 A;  3S9H A;  3ITH A;  3AV9 A;  4W5Q A;  2HNZ A;  1N5Y A;  5M1K A;  3VEV A;  3U9Z A;  2PYL A;  3BEX A;  1LOT B;  4QS8 A;  3AAP A;  2OTJ N;  5C15 A;  2HHH K;  5KRS A;  1B9F A;  4FWM A;  4WCE L;  3H1Q A;  2ZWH A;  2O4I A;  5AQP A;  4K8X A;  5M1Q A;  1XMO K;  3AO1 A;  2ZF5 O;  3P4I A;  1TKX A;  5C0Y A;  3CCL N;  1YHQ N;  5CZ2 A;  5CR4 A;  4NO7 A;  1XWL A;  3HOT A;  4B9T A;  3HPG A;  2F4V K;  4E7I A;  3LZJ A;  1GLE G;  1TL1 A;  2G8I A;  4DTR A;  3O9U A;  4FLY A;  3LAL A;  4BGB A;  2O8D A;  3HVT A;  5JS1 A;  4DWI A;  1GOC A;  2ATQ A;  4M45 A;  4BC2 A;  1I94 K;  4FM2 A;  4FLZ A;  2PYJ A;  1J54 A;  4CFB A;  4CHQ A;  5JLH A;  4A5A A;  2XY7 A;  3L2R A;  2E6M A;  1JLC A;  3WNH A;  4JKE A;  3OVN A;  3A5N C;  2NRZ A;  2O8D B;  2VG5 A;  1KVA A;  4DQR A;  3AVC A;  1KLM A;  3ZSO A;  1DGK N;  1Q18 A;  4CF0 A;  4DTM A;  5LL6 Z;  2KKZ A;  3CJ9 A;  5AJ3 K;  1YTA A;  4BQL A;  2GX9 A;  3FLC O;  4C1N K;  3M8Q A;  1NK4 A;  2AA4 A;  5EX5 A;  3NE6 A;  3HST B;  5LMN K;  1SKS A;  3O4Q A;  2YHW A;  1ZBH A;  4JD2 B;  4FM1 A;  1TK5 A;  1GLL O;  2NRV A;  4HCB A;  2O8F A;  3CM5 A;  3M1F A;  4CEO A;  2Y1J A;  5LJV A;  4BRH A;  4IFY A;  2P9L B;  1JLG A;  3HBT A;  2CH5 A;  4FLU A;  4DR7 K;  3Q7C A;  5C12 A;  4BDZ A;  5HRO A;  5KGX A;  3CHW A;  3AVF A;  3K9K A;  1KVC A;  4OKK A;  4ELU A;  1ITG A;  4JI7 K;  3LDQ A;  1GLF O;  4HVJ A;  3HP6 A;  1NMD A;  4DV5 K;  3ISN C;  4FK0 A;  3N4P A;  2FF6 A;  2OTL N;  5FRN A;  4LH5 A;  4B3T K;  4BC5 A;  3KIO A;  2RKI A;  3BF3 A;  1VQ8 N;  4FJ5 A;  3LAM A;  2QKB A;  3ZX0 A;  4K0K K;  4GV9 A;  2E88 A;  1N8R O;  4IEE A;  2IC3 A;  4JI2 K;  1VSK A;  1SL0 A;  3NH2 A;  3I33 A;  4OVL A;  5DMR A;  1TKT A;  4CE9 A;  3WUH A;  3RSE B;  1E4G T;  1WNS A;  4CJ3 A;  1WLJ A;  4JKB A;  1KLN A;  4RW7 A;  2I7N A;  1ZBL A;  4A2B A;  4LFC K;  5DM7 L;  1EO1 A;  1Q9Y A;  3CCM N;  2G8H A;  4FWS A;  2QWN A;  2HHV A;  5HRS A;  5BRF A;  2HST A;  3DLB A;  1K8K A;  3FFK B;  1WSI A;  1RT3 A;  2NUB A;  1U49 A;  1NKC A;  4B8A B;  4LD0 A;  3NGZ A;  4F9O A;  1C6V A;  1YAG A;  4JN4 A;  1XC9 A;  2A1S A;  4BRQ A;  3DOL A;  1S5J A;  3QER A;  3RR7 A;  4FYD A;  3C6A A;  2JWL A;  4BE0 A;  5BN8 A;  2NRX A;  4F3O A;  2FBY A;  1ZBI A;  3DLK A;  3WQT A;  4J2A A;  3SZ2 A;  5LY3 A;  3K5L A;  2GUI A;  3L3V A;  3ULE B;  3THV A;  4Z4E A;  3D2E B;  1KAY A;  4DR1 K;  2I7P A;  3KLG A;  2PBD A;  3BZC A;  3CCE N;  3M8S A;  4CK2 A;  2D5R A;  3ENH A;  3ID6 A;  5EXW A;  3VER A;  4H0V B;  3VF4 A;  3S3N A;  3J7Y P;  3RMA A;  4IOA L;  1KAX A;  4I9Q A;  3OBY A;  1LV5 A;  1YUW A;  4YOX A;  3DM2 A;  5JMV A;  3CCS N;  4CFA A;  4E7L A;  2QWQ A;  3OTO K;  3D2E A;  1M1K O;  1GLA G;  1RT2 A;  4FJL A;  1WAJ A;  3VQ8 A;  2XY8 A;  4GKJ K;  3H46 O;  4CZJ A;  4X64 K;  4WQ5 C;  4R79 A;  1YJN N;  3MEG A;  5JS2 A;  3HZ6 A;  3O3G A;  3NBP A;  3IRX A;  3AVI A;  3KTQ A;  5AFU A;  3NMU A;  2V52 B;  4KHY A;  4E7K A;  3C6T A;  1VQ7 N;  2D0A A;  2ZQB A;  4Z4G A;  3ZYY X;  4AM6 A;  4KH4 A;  5GAG P;  3L2Q A;  1Y64 A;  1S6P A;  1S1U A;  3ZET A;  2DFH A;  3IUC A;  5KQD A;  5FPM A;  2VG6 A;  1TKD A;  4KB1 A;  4FWR A;  1QVF M;  3VTH A;  3RSE A;  4PQU A;  3I8D A;  3ATU A;  4E0D A;  3LP1 A;  2ITG A;  5DK5 A;  3IKM A;  3T3F A;  4JKA A;  1BG3 A;  1XQS C;  1KTQ A;  1NGA A;  1A5X A;  1NOZ A;  1NM1 A;  3C7N B;  1NK8 A;  3CI5 A;  3S3O A;  3IMX A;  3CXC M;  4FZZ A;  3MAQ A;  3TAQ A;  5BRD A;  4CZK A;  2NZT A;  1ASW A;  1QQN A;  4OJR A;  1RBS A;  1IBK K;  3R3L A;  2AJQ A;  4W5N A;  4G1Q A;  5AQT A;  1UWB A;  3I55 N;  1Q7Y O;  3O1B A;  5AFU H;  5C42 A;  1KC8 O;  4CEB A;  5GAH P;  3QML A;  4FJX A;  2GBZ A;  3R9P A;  4EIA A;  1DTQ A;  4B9Q A;  5AZJ B;  3CC2 N;  2VCP A;  4O4G A;  1JCG A;  3DWL A;  3VQB A;  3U3G A;  3LWM A;  1WN7 A;  3PSI A;  5SWM A;  2E8A A;  1ATS A;  4YOR A;  4CD3 A;  1T7P A;  3T69 A;  1VRT A;  4JEP A;  5AQJ A;  3VEY A;  3D0P A;  2F9T A;  4PY5 A;  2DFE A;  1O13 A;  1JKH A;  3NHG A;  3DLL L;  3FZM A;  3QBW A;  3SPY A;  3AVG A;  3SV4 A;  2O8C A;  1JXB A;  4AH9 A;  2QTD A;  5AQX A;  1RGI A;  3H45 C;  3KWI A;  5T7B A;  1NK7 A;  1IBM K;  4C8L A;  2FSJ A;  3HP9 A;  1RTH A;  4B3O A;  3K5N A;  3IS9 A;  3P38 A;  2P9U B;  3AGK A;  4BRI A;  3UKU A;  2QW9 A;  2P1J A;  3QDK A;  2E6L A;  3BY5 A;  1YVN A;  4CK1 A;  3LAK A;  5M1P A;  3KKR A;  4H5N A;  5CYM A;  1HLU A;  3QES A;  1BA1 A;  3AGR A;  5GIN A;  2A42 A;  4YY3 K;  3QFP A;  2CGK A;  4KO0 A;  2QWR A;  2KQ2 A;  3VF2 A;  3G4S N;  4DSE A;  3SK3 A;  1IKX A;  3J8A A;  4EAH D;  2BGG A;  3AA3 A;  4C8M A;  3W0L A;  1TAQ A;  3P83 D;  4OGC A;  3HM8 A;  4NLB A;  2ASO A;  1S9E A;  5C2F A;  2NRT A;  3EE8 A;  3RTV A;  2O8B B;  3CQX A;  3VEZ A;  5IWA K;  2Q2R A;  2NLX A;  4BWM A;  1QSY A;  4KI6 A;  1NWK A;  1RDB A;  3VQP A;  3ZT1 A;  4M3Y A;  2D0B A;  4FWP A;  5J2P A;  2Q0R A;  1VQN N;  2HVI A;  5E41 A;  3OYD A;  4CZE A;  3HRG A;  3E9L A;  4MDB A;  4CJR A;  5E84 A;  4KTQ A;  4KHQ A;  1WAF A;  2YKM A;  3CC7 N;  4B1W B;  4AQY K;  3SQ4 A;  3BP8 A;  4YFU A;  3DXM B;  1XHX A;  1XHZ A;  2OA8 A;  1G99 A;  3WXK A;  2E5L K;  4AHU A;  3KLH A;  4E3S A;  3CJ7 A;  3UIQ A;  1RT6 A;  4HTU A;  4GW6 A;  4OGE A;  3L2U A;  3V1R A;  4DU4 A;  3TAM A;  2D0P A;  1U6Z A;  3MCA B;  3GE1 A;  3F9M A;  4BDP A;  4AHV A;  2WUS A;  4BG9 A;  4GY2 B;  1WOQ A;  1NGJ A;  1RDW X;  3VGL A;  4B1U B;  4X62 K;  2D1K A;  5BRH A;  4F4K A;  1XMQ K;  5AQH A;  4BRO A;  5KPZ A;  4JS4 A;  4LF6 K;  3D2F B;  5KI6 A;  1GOA A;  4M3T A;  3EL2 A;  1VSL A;  1JL1 A;  1K6Y A;  1RT7 A;  2HOE A;  1HNV A;  4KPY A;  5C10 A;  1J5E K;  4WYB A;  4CJ4 A;  1TGO A;  5DM6 L;  4BR7 A;  1RT1 A;  4BC3 A;  2FC0 A;  4PWD A;  5M1N A;  2HW3 A;  2CGJ A;  4M3Z A;  3DLE A;  5J2N A;  3TAN A;  4OLA A;  3ZSZ A;  4JI3 K;  2OZS A;  4CI6 A;  4F8R A;  1YVU A;  1D5A A;  4KHU A;  4DLE A;  4IFE A;  4FJH A;  4CFC A;  2HBK A;  3L2V A;  2BE2 A;  2ASM A;  3THY B;  3AAR A;  4M3R A;  1ZXO A;  1LW0 A;  3C65 A;  3HSC A;  1DLO A;  3LP0 A;  1BDG A;  4DG1 A;  4KB0 A;  3R8E A;  4KRE A;  1RDD A;  3JSM A;  3LM2 A;  3BF1 A;  3PX0 A;  4V19 S;  2GUP A;  4JYA K;  4DTX A;  4CJQ A;  1S1W A;  2F7T A;  1QZ6 A;  5KTQ A;  3L8B A;  4JNE A;  4DSK A;  2HB5 A;  1SQK A;  2NNW A;  3E1Y A;  4B9V A;  2E2N A;  4A61 A;  3WXI A;  1U4B A;  1BA0 A;  1Y97 A;  1QE1 A;  2QK9 A;  1IG8 A;  2P9S B;  3KLE A;  1REV A;  3A5L C;  4O8U A;  5GAD P;  4IXC A;  3T7Z A;  1W0H A;  1YI2 N;  3K5O A;  1S3X A;  1GLD G;  1KSP A;  4BRE A;  1VSH A;  3CCU N;  1ZYQ A;  1R0A A;  1NJY A;  5F2R A;  1RFQ A;  3HPH A;  4MO5 A;  3TSP A;  2X6N A;  4W5O A;  3VEX A;  1OVQ A;  4CVN E;  4CEE A;  4Z4I A;  4WQ5 A;  4Q5V A;  3AO4 A;  3V4I A;  5HRP A;  4CF2 A;  1LWF A;  3C0B A;  1WB9 A;  4IOX A;  2B4J A;  3DXM A;  1HKC A;  3SBT A;  3W3D A;  2ZGY A;  3O08 A;  3AVH A;  3CET A;  4CJV A;  1C0G A;  3ENO A;  3OBW A;  1IBL K;  5AZJ A;  3SMS A;  4KHW A;  4BE1 A;  3H6E A;  5EVZ A;  4K25 A;  3GDQ A;  3ASM A;  5FDL A;  3KD5 E;  1SUQ A;  3NGI A;  5ADX A;  4E89 A;  3CFP A;  3BZK A;  4A5B A;  3QEW A;  4JKF A;  1RTJ A;  1T6D A;  1BI4 A;  2KLA A;  1DEJ A;  4I2P A;  2NRW A;  4CZF A;  5EY4 A;  1SKW A;  1TAU A;  4CBW A;  4DQQ A;  3GG4 A;  4FL9 A;  4DUZ K;  4N76 A;  5AQR A;  1N32 K;  4FJG A;  3VQA A;  4DU1 A;  1ZBU A;  3LPT A;  4XH4 A;  4JK7 A;  2ZE2 A;  1QHA A;  3NF6 A;  3OYE A;  2IVO A;  3KLF A;  4FZY A;  4CJF A;  2ITM A;  3QET A;  3T1H K;  2YHY A;  3O80 A;  1EKE A;  3PO5 A;  3AO5 A;  3T19 A;  4BRC A;  4DU3 A;  3MED A;  2O8E A;  3NFA A;  4U67 L;  1GLC G;  4KTZ A;  1J5O A;  2KW4 A;  2HND A;  4BQZ A;  3CQY A;  1Z25 A;  3EZW A;  3V9W A;  2OYQ A;  4BRG A;  1NJX A;  3MX2 A;  5M1O A;  4KHN A;  4OX9 K;  3AAQ A;  1RDA A;  2YJF A;  1JXE A;  3FZL A;  4CGI A;  3SCX A;  4HUE A;  2VYP A;  3F5T A;  4I9L A;  2VQF K;  4RWT A;  1Z6R A;  3OYL A;  3AVA A;  4LF5 K;  4DV0 K;  2CGL A;  4H8K A;  4NYN A;  4BRL A;  3NF8 A;  1K73 O;  4PKI A;  1NK5 A;  5LMU K;  3ZSY A;  4X65 K;  5IT9 O;  5GAE P;  4YOY A;  3C94 A;  2BAN A;  3V6D A;  2HF3 A;  1QQC A;  3TAR A;  1KRP A;  3KZB A;  3ZT2 A;  1D8Y A;  4RCH A;  4LY7 A;  4M3W A;  4W5R A;  2ZGZ A;  3RRH A;  4BDY A;  4HHT A;  4TSX A;  3U8X A;  1FKP A;  2GEM A;  4CF8 A;  3QEV A;  1CLQ A;  3WNE A;  1T3V A;  3FFI A;  3HTV A;  3IFR A;  1HR0 K;  1W2B M;  2G8U A;  5AQN A;  1VSM A;  1IKV A;  1TL3 A;  4AHT A;  1WSE A;  2KFN A;  4IWV A;  1DT9 A;  1TUY A;  1TV6 A;  2HBM A;  4LC9 B;  4O5F A;  3NGY A;  1EP4 A;  1C0F A;  3L0Q A;  5HRR A;  3SAF A;  5HP1 A;  4AHS A;  1T6C A;  3VN5 A;  4Y0W A;  1BL3 A;  1MWK A;  5EU7 A;  3V9X A;  3TAP A;  3PSF A;  4B3S K;  1RDU A;  4H5V A;  5HLF A;  4EZ9 A;  4FWL A;  4GV3 A;  4QCL A;  4DSF A;  5BPM A;  3P31 A;  1L5U A;  1NJW A;  5K14 A;  1NGF A;  3NVK A;  1QQO A;  4WFN L;  4RW6 A;  2XY5 A;  1VSD A;  3TSU A;  2P9P B;  4DQS A;  2HHW A;  3H3O B;  3SAH A;  3O9R A;  4CJT A;  3EY1 A;  2G8F A;  1Q86 O;  3DMJ A;  3O5B A;  3G0Z A;  4RW9 A;  3CM6 A;  2KZM A;  2FLO A;  4DV1 K;  4FWN A;  2XY6 A;  4JK8 A;  4E1N A;  3OY9 A;  1S1V A;  3P39 A;  3KLI A;  4PL8 A;  3D45 A;  2FF3 B;  2E4L A;  4WFA L;  2OPQ A;  2Q97 A;  3FZF A;  3Q7B A;  1DKG D;  5FPD A;  4KH5 A;  2KZZ A;  1HNI A;  4JI5 K;  3KVG A;  4DHY A;  3NF9 A;  2QEX N;  4KI4 A;  4FVU A;  2P9S A;  1BU6 O;  4B9U A;  3JYT A;  1U2V B;  4ISE A;  4B9N A;  3N4Q A;  3CG7 A;  2ASP A;  2EWS A;  2P9L A;  3SUO A;  2IAJ A;  1N34 K;  1QHT A;  2YNI A;  1N36 K;  4R5P A;  1YJ9 N;  3S3M A;  3SV3 A;  4KAZ A;  4NXM K;  3SUQ A;  4DMN A;  3V1Q A;  4CZI A;  2KFZ A;  4ELT A;  4Z0U A;  4BGA A;  2HNY A;  5HBM A;  3O3H A;  4HWI A;  3WNG A;  1FXX A;  1EQY A;  1YF5 L;  2WOM A;  1HKB A;  2GWK A;  1UA0 A;  2YCH A;  1NBW A;  3ZSV A;  4KHP K;  4CED A;  2FBT A;  4ZHR A;  3CPE A;  1VQ5 N;  3LDS A;  3L6Q A;  3ZSW A;  3DRP A;  4B9M A;  3ZX2 A;  3RVC A;  3SQ0 A;  2Q1N A;  1WUA A;  3QFU A;  2OAN A;  2P9N B;  3U9D A;  4FJI A;  5AQU A;  5TKW A;  4H0O A;  3M8P A;  2H3G X;  2YI1 A;  4FK4 A;  1HX1 A;  1JCF A;  4CEZ A;  4O55 A;  3CME N;  3V9U A;  4CHZ A;  2IVN A;  4O0I A;  3RWU A;  3E01 A;  3TI0 A;  3M3Z A;  3C6H A;  3KJV A;  3KK2 A;  1IJJ A;  3GBT A;  3O3F A;  3V9Z A;  3MN6 A;  3O9T A;  1X9J A;  2Z1J A;  5AQZ A;  2NRH A;  4LF4 K;  3HOS A;  2LSN A;  3K59 A;  4DV3 K;  3QBX A;  3VEO A;  5ADX H;  3WXJ A;  1NGE A;  3LAN A;  2UUB K;  4CZL A;  1NGG A;  2P9I A;  2UXB K;  4UY8 O;  3SI6 A;  3DOK A;  5BPL A;  5CY4 A;  3DYA A;  1L3U A;  4MLH A;  4Z94 A;  1R59 O;  5I42 A;  3KHY A;  4XH1 A;  1SKR A;  3F9K A;  4CF9 A;  3KWG A;  4B1Z A;  2QXL A;  4FPB A;  3VMF B;  4YDU C;  3O9Q A;  2QWM A;  4B1V A;  1IKY A;  4CD1 A;  5BN9 A;  4E1J A;  2HHT A;  2E2O A;  4PKH A;  4YDU A;  4XH5 A;  3OYA A;  4DF4 A;  3HVR A;  3L2W A;  4YOU A;  3KD1 E;  2EX3 A;  4KRF A;  4CEA A;  4LFB K;  4FO0 A;  2GEL A;  3QLH A;  3OYF A;  1JJ2 M;  3MN7 A;  2E1Y A;  3THY A;  3TTC A;  2AP1 A;  4F3T A;  4FJK A;  3TAF A;  1KQS M;  5CE3 A;  3NCI A;  4DKW A;  1TK8 A;  1RT4 A;  2IS3 A;  2BTF A;  3ZT3 A;  5B8H A;  1VK0 A;  1KCF A;  3H1V X;  3OJS A;  5AQO A;  3VQC A;  1NK0 A;  2OPR A;  2Z1I A;  4NCG A;  4N56 A;  1RTI A;  3OS2 A;  5FLX O;  3K9J A;  3VQ5 A;  4B1X B;  5BPN A;  4EP5 A;  4HUF A;  4DFJ A;  4C8K A;  4CER A;  2YHX A;  2OZM A;  4N5S A;  2Z1G A;  5M1F A;  5SZT A;  4H5R A;  2J4R A;  4CJS A;  1UOC A;  5J1E A;  3BGR A;  1VSI A;  3TAG A;  1NGD A;  3NAE A;  5AQK A;  4C8O A;  1HJO A;  1WSH A;  1NK9 A;  4B9L A;  4DV6 K;  1D9F A;  1MDU B;  1CZ9 A;  2E1Z A;  1BOT O;  3RRG A;  4BRD A;  4FJN A;  3KK3 A;  5H1S Q;  2P9N A;  2HVH A;  1FW6 A;  3JS6 A;  3MEE A;  3TAB A;  4I7F A;  1C1A A;  3MXJ A;  3SQ2 A;  5KGW A;  4YHH K;  3HI0 A;  5FPE A;  4JI4 K;  2OCE A;  4AHC A;  3AVL A;  3DRR A;  2HBJ A;  4Y1C A;  4UQG A;  4AHR A;  1U48 A;  1C1B A;  1LWE A;  4B3R K;  2RHK A;  3HJF A;  3VF6 A;  1QSL A;  3LDN A;  2KTQ A;  3SBG A;  3A0I X;  4YOT A;  1Q81 O;  4A59 A;  4BRA A;  4Q0B A;  2HHQ A;  2D4W A;  4ID5 A;  4BVO A;  2P9P A;  4A57 A;  3O8M A;  2Q36 A;  3THW A;  2P9U A;  1CXQ A;  3R6M A;  1RIL A;  4Y1D A;  4CES A;  3ZT4 A;  3VQ9 A;  2GV9 A;  2WBN A;  3AVK A;  4FLT A;  3I8B A;  2WTU A;  1NLV A;  4DR5 K;  4CHP A;  1Z26 A;  2VG7 A;  1S22 A;  3VPZ A;  1IG9 A;  3VA0 A;  1U04 A;  4F2R A;  4OKE A;  3JXU A;  1Q82 O;  3KK1 A;  3SUP A;  2RPI A;  3UKR B;  4FJ7 A;  1NG9 A;  4DUY K;  4FCY A;  2W6K A;  3A8Y A;  3QNN A;  2VGN A;  1YT3 A;  4LF9 K;  4BRF A;  4NXN K;  2RF2 A;  1C0M A;  3O4W A;  2BH1 A;  2F96 A;  3DXK B;  4I2Q A;  5CYQ A;  3L3U A;  1GOB A;  4M41 A;  3NH1 A;  3CCQ N;  3VGM A;  1TUU A;  3S41 A;  3ZT0 A;  4WFB L;  4JS5 A;  4DV7 K;  4BR0 A;  2D0C A;  2YHB A;  2ZM6 K;  2QWO A;  4CW7 B;  4M7X A;  4J2E A;  5GIO A;  5I3U A;  3HXM A;  5C25 A;  4IO9 L;  4FLX A;  4B9S A;  2GTD A;  4EP4 A;  1ZBF A;  3MWP A;  2QWL A;  1KD1 O;  5FRO A;  3CFO A;  4BG8 A;  3SAG A;  2RE2 A;  4LF8 K;  4DV2 K;  3PUF A;  4KKO A;  4BR5 A;  4CBX A;  1S1X A;  4F2S A;  3HK2 A;  4CIG A;  2F9W A;  3MCP A;  4K41 A;  4PUO A;  3TAE A;  2WON A;  1HKG A;  3E9O A;  1RNH A;  1OH8 A;  4GKK K;  2X74 A;  3H08 A;  1CZA N;  4BVP A;  2QA4 N;  4DS4 A;  4LF7 K;  1JLQ A;  4M63 C;  2F8T A;  5AQW A;  1BWF O;  3ZCM A;  4N47 A;  4IKF A;  4H5T A;  4CBU A;  2QM1 A;  1X3N A;  2A41 A;  2P5O A;  3PX6 A;  4YNQ A;  5MLC Q;  3OYM A;  3CFR A;  4KBO A;  4PHT X;  1NGI A;  2HBL A;  3FE1 A;  3EE9 A;  1TYQ A;  1KFD A;  2FSN A;  1BQM A;  4IFV A;  4JK9 A;  1RTD A;  2D0O A;  3M6G A;  1D4X A;  5AQM A;  3QIP A;  4GVM A;  4KTW A;  5AQS A;  1P8Z A;  4CF1 A;  2HHS A;  1I3A A;  3D7E O;  1BI4 B;  3QB0 A;  3DLG A;  3G10 A;  3M8R A;  3V9S A;  2Q0U A;  3K0S A;  1E4F T;  4JRQ A;  2OPP A;  4DTU A;  3CJC A;  1K9M O;  3OYK A;  4Z4H A;  4EZ6 A;  1NU0 A;  1FKO A;  2IVP A;  1JL2 A;  4IEI A;  4DF8 A;  3QEX A;  1UA1 A;  3DI6 A;  3TU5 A;  4BR9 A;  3IDH A;  2UXC K;  1X9S A;  3CYM A;  1NJZ A;  3F73 A;  3K5M A;  4QS7 A;  4AF1 A;  4GVE A;  4Z4C A;  4WF9 L;  4NB4 A;  4ID1 A;  3D6R A;  3VQD A;  1S9G A;  3B8A X;  3TSQ A;  3HPO A;  4M7Y A;  4DQI A;  4H0Y B;  3O9S A;  4MFB A;  2HHU A;  3MXI A;  2HMI A;  1OH7 A;  4B8C A;  3B6P A;  4ILG B;  4ZTF A;  1QTM A;  1KXP A;  1XUP O;  3LDL A;  3O4N A;  4ILJ A;  2E20 A;  4JKG A;  4K43 A;  1Q9X A;  1W9H A;  3V81 A;  1VQ9 N;  2G8V A;  2E2Q A;  2HMP A; 
#chains in the Genus database with same CATH homology
 2QXF A;  2JGU A;  4RW6 A;  1VSD A;  4RW8 A;  2G8K A;  4DQS A;  1D9D A;  2HHW A;  2AJQ A;  4W5N A;  3EY1 A;  4G1Q A;  4CJT A;  2G8F A;  3SPZ A;  3BDP A;  3PV8 A;  1UWB A;  3DMJ A;  4LH4 A;  3NH0 A;  3G0Z A;  1L3V A;  1F21 A;  4RW9 A;  3CM6 A;  2KZM A;  5C42 A;  5J2Q A;  4CJ5 A;  2XY6 A;  4J2D A;  4CJU A;  4E1N A;  4CEB A;  1S1V A;  3OY9 A;  4FJX A;  1RBU A;  2GBZ A;  4QOZ B;  3EZ5 A;  1DTQ A;  2P51 A;  1RBR A;  3KLI A;  4FXD A;  1X1P A;  4DQP A;  4O4G A;  3VQB A;  3U3G A;  1B92 A;  3D45 A;  3LWM A;  4HUG A;  1HQU A;  1WN7 A;  1CZB A;  2E4L A;  4H4M A;  4IBN A;  5SWM A;  1HPZ A;  3SJJ A;  4FW1 A;  5C24 A;  1BIU A;  2OPQ A;  1N6Q A;  1ASV A;  1T7P A;  3OYN A;  1VRT A;  3C6U A;  1I39 A;  1JLE A;  3AVM A;  4DTJ A;  2O4G A;  3D0P A;  1FK9 A;  3I0R A;  4FZY A;  2KZZ A;  1HNI A;  4PY5 A;  2DFE A;  4FJJ A;  2YHA A;  1SL1 A;  1JKH A;  4CGH A;  3NF9 A;  3NHG A;  4KI4 A;  5FRM A;  3SPY A;  1KFS A;  5JS1 A;  3AVG A;  3SV4 A;  4B9U A;  4E19 A;  3JYT A;  1JXB A;  1JLB A;  4AH9 A;  4B9N A;  4CIF A;  3CG7 A;  4RW4 A;  5T7B A;  3VQQ A;  3PX4 A;  1NK7 A;  2QKK A;  1HQE A;  4OPJ A;  1EX4 A;  3SUO A;  1JLA A;  3OYC A;  4C8L A;  4LSN A;  4M3X A;  3HP9 A;  1RTH A;  1UAX A;  2IAJ A;  3K5N A;  3IS9 A;  5KRT A;  4DFM A;  1X9W A;  4M3U A;  1QHT A;  2ETJ A;  2YNI A;  4R5P A;  1B9D A;  3SV3 A;  3S3M A;  4NYF A;  4KAZ A;  3P1G A;  2JLE A;  2P1J A;  3SUQ A;  3SQ1 A;  1A5W A;  1LW2 A;  1VSE A;  2E6L A;  1RDC A;  3V1Q A;  4DMN A;  1L3T A;  2KFZ A;  3OYJ A;  4CK1 A;  2OPS A;  4ELT A;  4Z0U A;  3LAK A;  4NCB A;  3KKR A;  2HNY A;  1EXQ A;  1RCH A;  5HBM A;  3O3H A;  4HCC A;  1LAV A;  5CYM A;  3WNG A;  3QES A;  1FXX A;  2WOM A;  1UA0 A;  2YV0 X;  3ZSV A;  4CED A;  2FBT A;  2ZD1 A;  4ZHR A;  3ZSQ A;  4B08 A;  3OS1 A;  1U45 A;  1T8E A;  4AIL C;  3LDS A;  4KO0 A;  4DTS A;  3ZSW A;  3AO2 A;  3WNF A;  3DRP A;  4DSI A;  4CHN A;  2KQ2 A;  3AO3 A;  4B9M A;  1BIZ A;  4FM0 A;  2X6S A;  4FK2 A;  4DSE A;  1G15 A;  4DTP A;  3SQ0 A;  3VQ6 A;  4BAC A;  1IKX A;  3ALY A;  4NCA A;  3U6F A;  3OYH A;  4BE2 A;  4FLW A;  2BGG A;  3AA3 A;  4C8M A;  3TR8 A;  1LWC A;  1TAQ A;  3P83 D;  4OGC A;  4FJI A;  1TVR A;  3PY8 A;  3M8P A;  1S9E A;  2HHX A;  3RTV A;  3KKS A;  1O1W A;  4E1M A;  3RMC A;  4FK4 A;  3RMD A;  4CEZ A;  4ELV A;  1BCO A;  4O55 A;  3V9U A;  1BCM A;  4CHZ A;  3ZSX A;  4BWM A;  4O0I A;  4O44 A;  1QSY A;  4JLH A;  1WSG A;  3RWU A;  4KI6 A;  3E01 A;  3TI0 A;  1RDB A;  3VQP A;  2DTU A;  1JLF A;  3VQ4 A;  4QAG A;  3ZT1 A;  2D0B A;  4CHY A;  1VRU A;  3KJV A;  3LWL A;  3KK2 A;  5J2P A;  4M3Y A;  4OLB A;  2HVI A;  5E41 A;  3O3F A;  3OYD A;  1NOY A;  4KHS A;  3V9Z A;  2Z1J A;  2RN2 A;  4OKJ A;  4CJR A;  2Y1I A;  4E7H A;  1RT5 A;  1TKZ A;  2LSN A;  3K59 A;  4KTQ A;  4KHQ A;  4H4O A;  1WAF A;  1C0U A;  1EET A;  2YKM A;  3QO9 A;  4DFP A;  4J2B A;  4FLV A;  1SV5 A;  3OYB A;  4DTO A;  3LAN A;  4IDK A;  4BWJ A;  3SQ4 A;  2YNH A;  4YFU A;  4DSL A;  1XHX A;  4FJM A;  3SI6 A;  1XHZ A;  4CCH A;  4L8R B;  2OA8 A;  3LZI A;  3DOK A;  4DS5 A;  3AA5 X;  3IAY A;  4CJW A;  5CY4 A;  4AHU A;  3KLH A;  1MU2 A;  4CHO A;  3HL8 A;  3DYA A;  3LPU A;  4WE1 A;  4E3S A;  1L3U A;  3UIQ A;  1RT6 A;  4W5T A;  4HTU A;  4GW6 A;  4OGE A;  3T1A A;  5I42 A;  3L2U A;  3V1R A;  4FZX C;  4DU4 A;  2W42 A;  1SKR A;  3TAM A;  3F9K A;  4CF9 A;  3SUN A;  4CFD A;  3CQ8 A;  4ZTJ A;  1IKW A;  4BDP A;  4AHV A;  2R7Y A;  3S9H A;  3ITH A;  3AV9 A;  4W5Q A;  1IKY A;  2HNZ A;  1N5Y A;  2HHT A;  4CGJ A;  2PYL A;  4Z4F A;  4CEC A;  3OYA A;  4DF4 A;  3HVR A;  3L2W A;  4F4K A;  5KRS A;  3QNO A;  1B9F A;  2VWJ A;  3KD1 E;  2EX3 A;  4KRF A;  1T05 A;  1S1T A;  4JS4 A;  3TWH A;  4CEA A;  5KI6 A;  2O4I A;  1GOA A;  4M3T A;  4K8X A;  1HRH A;  3QLH A;  3AO1 A;  1VSL A;  3OYF A;  1JL1 A;  1K6Y A;  1RT7 A;  1HNV A;  4KPY A;  4LSL A;  1TKX A;  1NK6 A;  4CJ4 A;  2YKN A;  4F3T A;  1TGO A;  4FJK A;  3TAF A;  5CZ2 A;  4CGD A;  1RT1 A;  3NCI A;  2FC0 A;  4PWD A;  1TK8 A;  1RT4 A;  1XWL A;  2HW3 A;  2IS3 A;  1TK0 A;  4M3Z A;  4B9T A;  3DLE A;  5J2N A;  3TAN A;  4OLA A;  1S6Q A;  3ZT3 A;  3HPG A;  3ZSZ A;  1CXU A;  1VK0 A;  1KCF A;  4E7I A;  3LZJ A;  2OZS A;  1TL1 A;  3C95 A;  3OJS A;  2G8I A;  4DTR A;  3VQC A;  1YVU A;  4F8R A;  1NK0 A;  2OPR A;  2Z1I A;  4NCG A;  1D5A A;  3LAL A;  4CEF A;  4N56 A;  4FLY A;  4KHU A;  4DLE A;  4FJH A;  3P5J A;  3HVT A;  1RTI A;  3LP3 A;  4O5B A;  4CFC A;  2BE2 A;  1GOC A;  3OS2 A;  3L2V A;  3QEI A;  3VQ5 A;  2ATQ A;  4DWI A;  4M45 A;  4M3R A;  4KV8 A;  4EP5 A;  4HUF A;  4FM2 A;  1LW0 A;  3AA4 A;  1DLO A;  3LP0 A;  4DFJ A;  4FLZ A;  4C8K A;  4CER A;  4DG1 A;  2PYJ A;  1J54 A;  4CFB A;  3DLR A;  4KB0 A;  2OZM A;  4CHQ A;  4N5S A;  2Z1G A;  4KRE A;  1RDD A;  2XY7 A;  3L2R A;  2E6M A;  1JLC A;  3WNH A;  5SZT A;  3JSM A;  3OVN A;  3PX0 A;  4CJS A;  1U47 A;  2B5J A;  4DTX A;  1UOC A;  5J1E A;  3OJU A;  2VG5 A;  3BGR A;  1KVA A;  3NDK A;  4DQR A;  1VSI A;  3TAG A;  3AVC A;  4CJQ A;  1S1W A;  1KLM A;  3ZSO A;  4FJ8 A;  4CF0 A;  5KTQ A;  3NAE A;  3L8B A;  4DTM A;  4C8O A;  1YTA A;  1RBV A;  4DSK A;  3PO4 A;  2HB5 A;  1WSH A;  3K58 A;  4B9V A;  3M8Q A;  1U4B A;  1NK4 A;  1NK9 A;  4B9L A;  1D9F A;  4DSJ A;  1Y97 A;  1QE1 A;  3NE6 A;  1DTT A;  3HST B;  1SKS A;  2QK9 A;  1CZ9 A;  4DLG A;  3O4Q A;  3HM9 A;  3RRG A;  2F8S A;  3KLE A;  3ULD A;  4FJN A;  3KK3 A;  1ZBH A;  4E7J A;  2HVH A;  1REV A;  4FM1 A;  1A5V A;  3MEE A;  3HT3 A;  1TK5 A;  4HCB A;  3TAB A;  1J53 A;  1W0H A;  1HYZ A;  3CM5 A;  1C1A A;  4I7F A;  4CEO A;  4OPK A;  3K5O A;  2Y1J A;  3MXJ A;  1KSP A;  3SQ2 A;  5KGW A;  4IFY A;  3RR8 A;  3A2F A;  4ICL A;  1VSH A;  3K57 A;  3K2P A;  1ZYQ A;  1JLG A;  1QSS A;  1R0A A;  4AHC A;  3AVL A;  3DRR A;  1NJY A;  4Y1C A;  3HO1 A;  3VQE A;  4UQG A;  4FLU A;  4AHR A;  1U48 A;  3HPH A;  1C1B A;  4BDZ A;  5HRO A;  1LWE A;  4IG0 A;  5KGX A;  2X6N A;  4CJP A;  1IH7 A;  3HJF A;  3AVF A;  4W5O A;  3OYI A;  2PY5 A;  5D3G A;  1QSL A;  1KVC A;  4OKK A;  1Q8I A;  4ELU A;  4CEE A;  4Z4I A;  2KTQ A;  1ITG A;  4Q5V A;  4O0J A;  3AO4 A;  3EYZ A;  4Q0B A;  4HVJ A;  3V4I A;  2HHQ A;  5HRP A;  4CF2 A;  3HP6 A;  1LWF A;  4ID5 A;  3ISN C;  1ASU A;  4FK0 A;  2EHG A;  4EZ6 A;  2B6A A;  1CXQ A;  2B4J A;  2IGI A;  5FRN A;  1RIL A;  4LH5 A;  4Y1D A;  3KIO A;  2RKI A;  4CES A;  4FJ5 A;  2QKB A;  3LAM A;  3ZT4 A;  3VQ9 A;  2GV9 A;  3AVH A;  3AVK A;  4FLT A;  4N41 A;  2IC3 A;  1Z26 A;  2VG7 A;  4CHP A;  4CJV A;  1VSK A;  3VA0 A;  1IG9 A;  1U04 A;  2XHB A;  1SL0 A;  3NF7 A;  3NH2 A;  4OVL A;  5DMR A;  4F2R A;  4OKE A;  4KHW A;  4BE1 A;  1TKT A;  2X78 A;  4CE9 A;  4XIU A;  3KK1 A;  3QEP A;  4FJ9 A;  3OYG A;  3SUP A;  2RPI A;  4CK3 A;  4FJ7 A;  1WNS A;  1BGX T;  4CJ3 A;  4RG8 A;  4FCY A;  3QIO A;  1WLJ A;  3ASM A;  5FDL A;  1KLN A;  3KD5 E;  1SUQ A;  3QNN A;  4RW7 A;  3NGI A;  4CGF A;  4E89 A;  3CFP A;  1YT3 A;  4CJK A;  4GMJ B;  1ZBL A;  3QEW A;  1X9M A;  2RF2 A;  3VA3 A;  1RTJ A;  1Q9Y A;  1BI4 A;  1C0M A;  4I2P A;  2XO7 A;  1SKW A;  2BDP A;  2G8H A;  1TAU A;  2HHV A;  2F96 A;  5HRS A;  4DQQ A;  4I2Q A;  5CYQ A;  3L3U A;  3U3Y A;  2YNG A;  1GOB A;  3DLB A;  4N76 A;  4M41 A;  2DY4 A;  4FW2 A;  1WSI A;  4FJG A;  4M42 A;  1IO2 A;  1RT3 A;  3VQA A;  2NUB A;  4DU1 A;  3DLH A;  1ZBU A;  3LPT A;  3NH1 A;  5HRN A;  1U49 A;  1NKC A;  1L3S A;  4B8A B;  2ZE2 A;  3NF6 A;  2XRI A;  4LD0 A;  3OYE A;  3ZT0 A;  1HYS A;  1BIS A;  3NGZ A;  3KLF A;  4JS5 A;  3SYZ A;  1C6V A;  4PA1 A;  1BQN A;  3I0S A;  3AA2 A;  4CJE A;  4CJF A;  3QET A;  3DOL A;  2A1S A;  2D0C A;  1XC9 A;  1EKE A;  1S5J A;  2YHB A;  3AVN A;  3AO5 A;  3QER A;  1HJR A;  3RR7 A;  3PO5 A;  4FYD A;  4BE0 A;  3T19 A;  3OS0 A;  4J2E A;  1C0T A;  2A1R A;  4DU3 A;  5I3U A;  3MED A;  2FBY A;  4F3O A;  1ZBI A;  3HXM A;  2Q3S A;  3DLK A;  3NFA A;  4J2A A;  4CJL A;  5C25 A;  4FLX A;  3SZ2 A;  4B9S A;  4KTZ A;  4EP4 A;  3K5L A;  1J5O A;  1ZBF A;  2GUI A;  2KW4 A;  3VQ7 A;  3L3V A;  5CZ1 A;  1HYV A;  2HND A;  3THV A;  4Z4E A;  5FRO A;  2IDO A;  1Z25 A;  3KLG A;  1NKE A;  1LAW A;  3M8S A;  1T03 A;  3CFO A;  3V9W A;  2OYQ A;  4CK2 A;  2D5R A;  2FBV A;  1WSJ A;  1NJX A;  5J2M A;  3S3N A;  4KHN A;  3RMA A;  2VWK A;  3PUF A;  4KKO A;  2G8W A;  1RDA A;  4I9Q A;  1S1X A;  4B3O A;  1JXE A;  3SCX A;  4CGI A;  1LV5 A;  4HUE A;  4F2S A;  3HK2 A;  4CIG A;  1YTU A;  3MEC A;  1VSF A;  4C8N A;  3DM2 A;  4PUO A;  4CIE A;  4I9L A;  3TAE A;  4DTN A;  2WON A;  4CFA A;  4CEQ A;  3OYL A;  3AVA A;  4E7L A;  1RNH A;  2X74 A;  3H08 A;  3SNN A;  4H8K A;  4NYN A;  3NF8 A;  4DS4 A;  2KFN A;  1RT2 A;  1NK5 A;  3ZSY A;  1JLQ A;  1WSF A;  2F8T A;  2XY5 A;  4FJL A;  3ZCM A;  1WAJ A;  4N47 A;  1HMV A;  3VQ8 A;  2P5G A;  4IKF A;  2XY8 A;  4KFB A;  3C94 A;  2BAN A;  3V6D A;  3PX6 A;  2P5O A;  4YNQ A;  3OYM A;  3CFR A;  1KVB A;  1QQC A;  1BHL A;  3TAR A;  4CGG A;  1KRP A;  1KFD A;  2IOC A;  1SL2 A;  3MEG A;  3HYF A;  5JS2 A;  3ZT2 A;  3O3G A;  1D8Y A;  3QIN A;  1RBT A;  3NBP A;  4LY7 A;  2YNF A;  3IRX A;  1BQM A;  4IFV A;  4M3W A;  4W5R A;  1RTD A;  3RRH A;  3QIP A;  3V1O A;  4GVM A;  4HHT A;  4TSX A;  4BDY A;  3AVI A;  4KTW A;  3KTQ A;  4CF1 A;  1FKP A;  4CF8 A;  2HHS A;  3QEV A;  1CLQ A;  3WNE A;  1I3A A;  3FFI A;  2I5J A;  1BI4 B;  2Z1H A;  4KHY A;  3DLG A;  3G10 A;  3M8R A;  4E7K A;  3V9S A;  3C6T A;  1QS4 A;  2D0A A;  2DFF A;  2ZQB A;  2G8U A;  4JRQ A;  2OPP A;  4DTU A;  4Z4G A;  3AVJ A;  1VSM A;  3L2Q A;  1S6P A;  1S1U A;  1IKV A;  1TL3 A;  2DFH A;  4AHT A;  4Z4H A;  1WSE A;  3OYK A;  1FKO A;  2PZS A;  1JL2 A;  4DF8 A;  3DRS A;  3QEX A;  1XI1 A;  2VG6 A;  3DI6 A;  3AVB A;  4IG3 A;  1UA1 A;  1TKD A;  4KB1 A;  1J9A A;  1TV6 A;  4PQU A;  3I8D A;  3NGY A;  1EP4 A;  1X9S A;  3CYM A;  1NJZ A;  3F73 A;  5HRR A;  4E0D A;  3LP1 A;  2ITG A;  5DK5 A;  3K5M A;  5HP1 A;  4K8Z A;  3MXM A;  4AHS A;  3T3F A;  3VN5 A;  4Z4C A;  4JRP A;  3LP2 A;  4ID1 A;  4DFK A;  3VQD A;  1BL3 A;  1S9G A;  3HPO A;  1NKB A;  3V9X A;  1KTQ A;  5EU7 A;  3RMB A;  2FBX A;  3TAP A;  4DQI A;  4FVM A;  4MFB A;  2HHU A;  4MQ3 A;  3MXI A;  1A5X A;  1NOZ A;  5HLF A;  4EZ9 A;  1NK8 A;  2HMI A;  4QCL A;  3S3O A;  3ZSR A;  4B8C A;  3B6P A;  4DSF A;  4ZTF A;  1QTM A;  3MAQ A;  4FZZ A;  1C1C A;  3TAQ A;  3O4N A;  1L5U A;  1NJW A;  1ASW A;  1Q9X A;  1W9H A;  3V81 A;  4OJR A;  2G8V A;  5K14 A;  3B6O A;  1RBS A;  1VSJ A;  3IG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...