4DV5K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv5K00
4GKJK 1XNQK 2UXCK 2UUCK 3OTOK 3J81O 4X64K 4JI4K 1FJGK 4LF5K 5A2QO 4DV0K 4JI3K 1N32K 1J5EK 4DV5K 4LFAK 4OX9K 4JI5K 3T1HK 2UU9K 4LF7K 4DV3K 1HNZK 2UUBK 4YHHK 2UXBK 4B3TK 4JI2K 2VQEK 1IBLK 2ZM6K 4CW7B 4JV5K 4B3MK 5LMUK 4DR2K 4JYAK 4NXMK 1I94K 1N33K 4GKKK 5LL6Z 4YY3K 1XMOK 1HR0K 2UXDK 3T1YK 4DUYK 4DR1K 2HHHK 4X66K 4NXNK 1IBKK 4X65K 4X62K 4B3SK 4DR6K 2UUAK 4LF8K 4DUZK 4DV4K 4B3RK 4KHPK 4LF4K 4AQYK 4DV6K 4DV1K 2F4VK 1IBMK 1N36K 5AJ3K 4LF6K 3JAMO 1XNRK 2VQFK 4DV2K 4DR3K 4LF9K 4CVNE 4DR5K 4LFCK 4LFBK 4V19S 1XMQK 4JI7K 5BR8K 5IT9O 5LMNK 4JI1K 4DR7K 3J7YP 4DR4K 4JI8K 4JI0K 4DV7K 5FLXO 3J7AP 1HNXK 5IWAK 4JI6K 3J80O 2E5LK 1N34K 4K0KK 1HNWK
chains in the Genus database with same CATH superfamily
3C94A 1SAZA 1YVUA 3ZT0A 2O4GA 3NDKA 2QKBA 1OKJA 1J6ZA 1VSKA 4KH5A 1T6CA 4BVOA 3LZJA 2E2OA 1BCMA 4K25A 3A5MC 1C6VA 4OKEA 1NGGA 4XH1A 3TAQA 2KZMA 4FW2A 3ID6A 3QICA 3H1QA 3S3NA 2JWKA 4HUGA 4FJKA 3RMDA 1RT7A 3VA0A 3HK2A 5EX5A 3NVMA 4FJHA 4CZJA 2PAVA 3ZX3A 4WCEL 4B1XB 4DSFA 3DWLA 3VQ7A 3ZEUB 2V7ZA 4A57A 4XIUA 4FPBA 1HNIA 1NGFA 1RBTA 4DSIA 2WFBA 1N33K 2WBNA 2YNGA 3JSMA 2GWJA 4DLEA 1N5YA 5AQXA 4M3UA 2P9UA 2YX6A 3PUFA 1F21A 4CJTA 5GAEP 4Y1DA 2VCPA 2OCEA 3T1YK 4BC3A 4BRCA 1U4BA 1IBKK 3K5NA 1KXPA 1S22A 3QESA 4W5RA 2P5OA 4DR6K 2UUAK 4DTPA 4CJLA 2E2PA 1NJXA 4AHRA 3V9UA 2NZTA 2P9UB 3J8AA 3S9HA 3CCQN 4EIAA 1QQOA 4H0VB 1W9HA 2O8EA 1JLAA 3CJ1A 3EYZA 3THYA 3M1FA 1NGIA 3RR8A 2VWBA 4CE9A 1P90A 2GBZA 3A5NC 1EETA 4QCLA 4B9MA 4CZGA 4RW7A 3NF8A 1NK0A 4F3TA 4CFCA 5J2NA 4W5OA 4OGEA 1GLFO 3OJUA 2YCHA 4FJMA 4KI6A 1OH6A 3PSFA 2V7YA 1FKOA 3AAPA 3AO2A 4IFYA 4JI0K 3C7NA 2JGUA 3VF2A 3AA2A 1M1KO 3HM9A 1GLBG 2Z1JA 4JI6K 3V9ZA 3P39A 1RBRA 1S1WA 1YTUA 2D0AA 4J2AA 1NNEA 4CBXA 3BGRA 4KB0A 2HNYA 1KLNA 2NRZA 4JKFA 2YHXA 1WSGA 3WQTA 2Q36A 3ZX0A 3SAFA 4K43A 4FO0A 3S3OA 1J54A 3LAMA 1RT3A 3D2FA 2PBDA 5BR9A 1T7PA 4O5BA 3IFRA 3FLCO 3ZCMA 1HQUA 4FK0A 3SUOA 1NJIO 3CMAN 1WAJA 4IDKA 4CW7B 1SZ2A 3QMLA 3D2FB 4CZIA 4MLHA 4FVMA 4KB1A 1C1AA 2CGKA 3RVCA 5GINA 4JK8A 3SPYA 3KLEA 3CJBA 2FBVA 3G6EN 1YJWN 4CESA 4AHVA 1T44A 4N41A 3H45C 3D0PA 3CM5A 1ILYA 4I9QA 3EE8A 4CJQA 4FVUA 1NGDA 3ASMA 3P5JA 4M63C 2VG7A 4BC2A 3A0IX 3NGZA 5CHIA 3AVAA 1IKWA 5HRSA 3DXMA 3CD6N 3TAGA 1XNRK 1ZBFA 4JKBA 4YOWA 1NKCA 4DG1A 2WOMA 4CHZA 4OPJA 3LWMA 1ZBLA 1WAFA 1XMQK 4ISGA 4LD0A 3DYAA 3LM9A 4JHDB 3MWPA 4JNEA 4NLCA 1T3VA 4AH9A 1BA1A 1LWEA 4CIFA 1WSIA 4FSVA 5FPDA 3J7AP 4IEIA 5LY3A 4N76A 3THXB 3LM2A 3AAQA 4NLBA 3OYHA 4I2PA 3OYDA 2HB5A 2UYTA 3F73A 5BN8A 1HJRA 3MX2A 3LDNA 4JI4K 3L4IA 3TTFA 3QEVA 3QIPA 3AY9A 2ZD1A 3EY1A 2E4LA 5J2PA 2YNHA 3THWA 1TYQA 4QAGA 1WB9A 1A5VA 1KAYA 2HBKA 5AQSA 4RTFD 4ICLA 4F2RA 1EX4A 2O4IA 5FROA 4IFVA 4WQ5C 1RDDA 3NH0A 1HUXA 3U3GA 3CQYA 1NKEA 4B1YB 4CBUA 2ZM6K 1KAZA 2OPQA 5M1PA 3C95A 4JYAK 4NO7A 4H0TB 4B9VA 3L3UA 1YT3A 1ATSA 4NXMK 1BIZA 4EHTA 4BRHA 3UIQA 1NGJA 4FWPA 4AF1A 1KVAA 2UXDK 3GDQA 5AQHA 4F3OA 1VQ8N 2KHOA 4XH5A 3DOLA 4O5FA 4OO1J 1VQ7N 2PYLA 2ZJRL 1EO1A 4H5NA 5M1NA 4QS7A 1H1VA 1T03A 2ITMA 2EX3A 3VTIA 5KTQA 2HVIA 4DV6K 4CJFA 3E9PA 2W42A 3I8BA 5JVHL 3ZSVA 4LF6K 3QEPA 1VSJA 2I5JA 2PY5A 1TGOA 3FZMA 1HLUA 2BUPA 4LFCK 2W40A 1ASUA 4BY9C 1QHAA 4DMNA 1MU2A 2NRXA 5SZTA 3RTVA 1K8KB 4DTSA 1SL1A 5KRSA 4CJSA 4KRFA 3HL8A 4CIEA 5AQKA 2WUSA 4FYDA 3QBXA 4KTQA 2YI1A 3EZWA 4DV7K 3O08A 1S1VA 1QVGM 1J5OA 1XC3A 3I33A 4XEIA 2HBMA 4EZ6A 1L3SA 1QZ5A 5HP1A 1U47A 3DLKA 4FOIA 4FM2A 4R5PA 3BP8A 4PL7A 4YFUA 3A5OC 3MEGA 4ISFA 1JLEA 1IKVA 4DTRA 4FJXA 5FDLA 4B9QA 3GL1A 2OANA 4PQUA 1IKXA 3VTHA 5C10A 2UU9K 4IO9L 3SV3A 1CXQA 4BR0A 3QIOA 4FLXA 4M3WA 2XY5A 2HF3A 3SK3A 3CJCA 1S72N 3K5LA 5BPLA 2VQEK 4MFBA 3HYFA 2DTUA 3TTDA 4M3XA 3ZT1A 2XO7A 4DR2K 5AZIA 4I6MB 4O4GA 2ZWHA 3AO3A 4DTNA 1U49A 5AQMA 2OZMA 5JLHA 3CIPA 2RPIA 3FZFA 2GUIA 5LL6Z 4YY3K 4M3TA 4Z4FA 1HR0K 4C8NA 3ATVA 4N56A 2X74A 4X65K 4YOYA 1BWFO 3HP9A 2NRWA 4FK2A 3MEEA 4KFBA 4CEFA 2LSNA 3AVGA 5I42A 1RBSA 4A61A 4LF8K 3SMPA 3QNOA 4DU4A 4DSLA 4Y0WA 1Y64A 2O8BB 4A5BA 2KQ2A 5CE3A 2D0OA 4F8RA 4J2EA 3ZSWA 4W5TA 4CFAA 1B9DA 3KWGA 4JS5A 4IWVA 1RTJA 4G9ZA 4FJ7A 4K42A 3T19A 4CZLA 1VQMN 4PWDA 1WLJA 3EN9A 3V1OA 2IOCA 4IO8A 3R9PA 1WSHA 3HPHA 2IVPA 4AM6A 3R1XA 4OGCA 4CHPA 4KHQA 1TKZA 4KPYA 1BDGA 3OW2M 2O8FA 3O9QA 2V51B 1Q81O 1BA0A 1QS4A 3AVHA 4J2BA 3CPEA 2HF4A 3BEXA 3CCVN 1XNQK 4H4OA 1L3VA 3GOIA 1HRHA 4IFEA 3QNNA 5BPNA 4CD3A 4ID1A 3LP0A 2A5XA 1WN7A 2YNIA 3T1AA 3ENOA 3FZKA 3KKRA 4H0PA 3HP6A 3V1RA 3V4IA 1HX1A 4FJ8A 4OX9K 1TVRA 5ELZA 5JVGL 1V4SA 1DKGD 3N4QA 4YNQA 4FLUA 3SLCA 1JCFA 1RT1A 3KHYA 3LP3A 2QWNA 4CZMA 3LZIA 1UOCA 2QEXN 1KTQA 2ZQBA 3TSQA 2ASOA 3QINA 3L2RA 2GELA 5FPEA 4C8OA 2RKIA 1DGKN 4CEQA 4BRQA 2G8KA 5AR0A 3OS0A 5C24A 3VQBA 1SKWA 4DUYK 5JLFA 1BGXT 2IDOA 1ZBHA 4E19A 3KD5E 4OKJA 1VSMA 4Q5VA 3C65A 3HVTA 3C6HA 3SQ0A 3HZ6A 3FFKB 1SL2A 3WXJA 3NE6A 4RCHA 5FPMA 3HT3A 1YITN 3DRPA 4OLAA 4EAHD 4WF9L 5JICA 4DU3A 2RF2A 5C2DA 4CZEA 3JYTA 3KLIA 5M1QA 3PY8A 2P9KA 4LF9K 3VMFB 4W5QA 4Z4EA 2FC0A 1C0FA 1X1PA 1NM1A 2HMIA 2E1YA 2G8HA 1HYZA 2WC9A 2AJQA 2B5JA 4H5WA 1CLQA 4JI1K 3LDSA 3FE1A 3FZHA 1VSFA 1C0GA 4MO5A 4CGFA 5GIOA 1NK8A 5FRNA 3OBWA 3BZCA 3VGKA 3WXLA 4J8FA 4Z94A 1TL1A 3MMVA 3VA3A 3MN7A 1IH7A 3CETA 3L2WA 4NCBA 2QWOA 3THVA 1EP4A 1A5WA 2H3GX 2FLOA 2OTLN 3U6FA 1UA0A 5F0XA 1C1CA 1KCFA 1FW6A 3S3MA 1TK0A 1JLQA 1IO2A 4IOCL 2F96A 3K5MA 3D45A 1IG9A 1NGHA 5AQYA 1TAQA 2W6LA 4DTUA 4B9UA 3C6TA 4I2QA 5C12A 1GLDG 4YHHK 4E7KA 1WUAA 3VPZA 2YHAA 3BUZB 3E01A 3TAFA 4PA1A 2ZGZA 4XH4A 4M3ZA 3O1WA 3VENA 4UQGA 1HMVA 2ATQA 3FGUA 3O3GA 3PIPL 4OPHA 4HTLA 4O8KA 3LP2A 4CZFA 1VQNN 1ESVA 3PX6A 1NKBA 4WYBA 1G99A 4BR7A 4DFJA 1XMOK 3MXJA 3P31A 5E84A 4FWKA 3CCEN 4B8CA 2DFFA 4CHYA 2B4JA 4B3SK 2I7PA 3VQDA 2DFEA 3HRGA 4JKGA 4C8LA 5KQ8A 3SBTA 3ENHA 2WONA 3MECA 4CJVA 3KVGA 1YJNN 3JAMO 4YOXA 1JL1A 3WNEA 4FJNA 1QVFM 3OYLA 1U48A 2KKZA 1DT9A 1CZAN 3AARA 1LAVA 4C23A 5IT9O 3O4QA 5CYQA 4A62A 2ASMA 4CD1A 3J7YP 4FXDA 1EQYA 4BRKA 3O5BA 1X3MA 3AVJA 3VQ4A 2P5GA 5FLXO 5IWAK 4LSLA 5BRHA 4BRAA 4K0KK 4B8AB 4CEDA 3E9LA 1MWKA 3TWHA 4MQ3A 2O8EB 2QWLA 4Z0UA 1XWLA 3THYB 1D9FA 3SZ2A 3HJFA 4GVEA 3AVMA 3HI0A 4GMJB 2Q1NA 4H5TA 2ZJQL 4WQ4A 3KLHA 3HO1A 4JKDA 4WQ5A 2CH6A 3CCUN 5KGWA 4DTXA 3SCXA 3T1HK 2E6LA 3L3VA 4DQRA 3R6MA 2NRVA 4MO4A 2Q31A 2YHWA 3AA3A 2NRHA 1VRTA 5AQQA 3C7NB 4BRPA 4JI2K 4E89A 3ULDA 5AQTA 3O9SA 1BO5O 4CJ4A 1T8EA 4GW6A 1VSDA 3TPQA 3AA5X 3KIOA 3NF7A 4JK9A 4JAXA 3A5LC 3CCSN 2HHHK 4CK2A 3RSEA 3TAMA 4LC9B 3WEEA 4AHUA 3D2EA 4E1JA 3OY9A 3MN6A 3VEWA 1L3UA 1V4TA 1Z05A 1CZ9A 2NLXA 3ATUA 3OYJA 2DY4A 2QKKA 3CG7A 3V9WA 1X9SA 3LL3A 4RW4A 4DTJA 5B8HA 1TK8A 4DV2K 1WSFA 3RMAA 4DR5K 1EWQA 1UAXA 3UKRA 2EWSA 1TL3A 3EL2A 4CF9A 4FL9A 3B8AX 1ZBUA 1EKEA 3K57A 2D5RA 4DKWA 5DM7L 3M8SA 4CJEA 4CEOA 3HOSA 4KHSA 2HHXA 1TV6A 4DQQA 1VQ6N 3SMSA 4CI6A 3ZSQA 1GLCG 4O44A 2FSKA 1TK5A 3O3HA 1XHZA 5AQWA 5AQIA 4CEAA 1QSLA 4M7YA 3L2QA 3LWLA 4Z4HA 1YXQA 4CIGA 5E41A 3DXMB 4DV0K 1VQLN 4C8KA 2P9IA 1OH7A 4JRPA 3SQ1A 3A2FA 4FJGA 1YHQN 4DV5K 2G8VA 1Q86O 3QLHA 4M3RA 1OH8A 1S1XA 3M3ZA 3TSPA 3L6QA 3L8BA 4CBWA 1HNZK 3CC4N 5HOOA 1RCHA 1NBWA 3CC2N 3SQ2A 1IBLK 4FCYA 3QEIA 5LMUK 5KPRA 5JS2A 3RWUA 1NK5A 3W0LA 5CYMA 2B6AA 4B08A 5GIPA 3M8PA 3ZT2A 4WQ4C 3VESA 5AQOA 4U7BA 1BIUA 5K14A 1RBVA 2IS3A 5AZJA 5CY4A 4CJPA 4BVPA 1MDUB 3THWB 3OBYA 1TYQB 3BF1A 2HHVA 1MA9B 2GV9A 4GV9A 1WSJA 4X62K 1NJZA 4K8XA 2D0PA 3VQCA 4AM7A 3I0SA 3CJ7A 1W2BM 2P9LA 3F9KA 1HPMA 4QS8A 5JMVA 1D5AA 3N4PA 2XY6A 3PX4A 1SQKA 1D4XA 3VQAA 1Q7YO 3M8QA 3IKMA 5AQPA 3ULEA 3MWTA 3OS2A 3EKUA 4E7JA 4FWQA 4DWIA 1YUWA 4Z4GA 5F2RA 1O1WA 3VEXA 2Q0UA 1JKHA 5AQZA 4BE0A 4GNIA 3IAYA 4BWMA 2E2NA 3QFPA 2QTDA 4PY5A 4BE2A 3IDHA 1Q9YA 3DLEA 3BDPA 3F9MA 4JRQA 1FKPA 3ITHA 4I7FA 3TAPA 1TAUA 1C0TA 1HNXK 5T7BA 3AVLA 4LH4A 2OPPA 4ID5A 1HNWK 3E9OA 5KQDA 4MDBA 3OYEA 1CXUA 2P9SA 3I56N 3K5OA 3KLGA 1TUUA 3VQ6A 1YIJN 4CEBA 1RILA 4BRNA 4CK1A 4DHYA 4CK3A 1IJJA 4OVLA 4DFMA 1JLGA 4CGIA 3SNNA 4JKCA 2XRIA 2QI2A 4JS4A 4CJRA 4G1QA 4DSJA 1QQMA 4O0IA 1UA1A 3T69A 2QWMA 3LANA 4KTWA 3I8DA 1QZ6A 4YOUA 3CYMA 4TSXA 1KFSA 1KLMA 1U2VA 3OYMA 2G8IA 4KTZA 4FZXC 4E7LA 3O1BA 4FLYA 3M5RA 3B6OA 4CFDA 3DAWA 1HPZA 4R79A 4O55A 1J53A 4M3YA 4BGAA 1QQCA 1LCUA 2BH1A 5BN9A 4FLZA 3GE1A 2D0CA 3O9TA 3AO4A 3H6EA 5TKWA 3NMUA 4DR1K 5F1XA 3F5TA 1NK6A 2P51A 3NFAA 5KI6A 3HTVA 3O6WA 3WUHA 1BOTO 1HJOA 5JS1A 1HKBA 3RMCA 5GAGP 4B3RK 3H08A 1RT2A 1S9GA 3GG4A 4ZHRA 4LF4K 1NGCA 3SUPA 3QDKA 2F4VK 2HVHA 4N5SA 3MDQA 1KVCA 3AV9A 5KPTA 3H3NO 1N36K 1KFDA 4OLBA 4ILJA 4E7HA 4DTMA 4HCCA 2WTUA 4DR3K 4DF4A 3K0SA 4FK4A 5AQGA 3A8YA 4BC4A 4KREA 5AZIB 1E4FT 3AVNA 4HUFA 3RRGA 2A42A 1VK0A 4YOVA 2GUPA 5HL7L 1Q82O 2P1JA 3SAGA 4H4MA 1HKGA 2QWQA 3O9UA 1R0AA 3E66A 4CGGA 4A59A 4DSKA 3C6UA 5H1SQ 5SWMA 2O8DA 2GWKA 3W3DA 2E5LK 4M7XA 4CCHA 2ZGYA 3KD1E 3VEOA 3CCJN 3QEXA 3G71N 4Q0BA 1A5XA 2CGLA 3UKUA 2BDPA 3VOVA 4CJKA 3MN9A 5A2QO 1WOQA 2KZZA 4CEZA 1NJYA 3DI6A 3OYKA 5EVZA 3EEQA 4JEPA 1JLCA 1QE1A 3U8XA 4JKHA 4KAZA 4LFAK 1KQSM 2YNFA 1JL2A 4JI5K 1XQSC 2OPSA 4LF7K 3QBWA 4H0YB 3CC7N 4FJ5A 4BDPA 5AQUA 3NH2A 4EFHA 5HBMA 4IEEA 2JLEA 1NU0A 4JD2A 2ZE2A 4GV3A 3MCAB 3HOTA 1NGAA 5HRNA 2O8FB 4JV5K 4B3MK 2FBTA 4E1NA 1S9EA 1HQEA 5LJWA 3HVRA 1GLAG 4CEEA 1I94K 2BGGA 4PKIA 3G0ZA 4FM1A 1K73O 1NG9A 3L4QA 2YKNA 3V6DA 4X66K 2A6AA 1BQNA 4E7IA 1LW0A 4FZYA 1JCGA 1LOTB 5CR4A 4CFBA 3TARA 1ZBSA 3DRRA 4KHPK 3K9KA 3CCMN 3WQUA 1KC8O 4DV1K 1HNVA 4DCHA 3JS6A 1J9AA 3CFOA 3ZSOA 3PO4A 1T05A 3WXIA 5AJ3K 2VQFK 3H46O 4BR2A 3CCLN 4RW8A 4E0DA 2Z1HA 5GAHP 4H8KA 4V19S 1DTTA 3E1YA 3OYIA 5BR8K 3DXKA 2P9NA 4H03B 4AILC 4BR9A 2IAJA 4B3OA 1U6ZA 4IG3A 4DR7K 3BY5A 2EHGA 3SUQA 4CZHA 2D0BA 5AQLA 1K8AO 3NVKA 2P9PA 4JI8K 4H5VA 4N47A 3CPWM 3OVNA 1KSPA 4DQIA 4HUEA 3BF3A 2V52B 3CJ9A 4EP4A 4B9SA 4JKEA 2A40A 2A1SA 3J80O 3ZLJA 4CF1A 4EHUA 3G25A 2UXCK 1RDBA 1RDWX 5AQRA 2Y1JA 4B9LA 1VAZA 3L0QA 3L2UA 2YJEA 2P9KB 4NB4A 1VQ4N 1GOAA 3DMJA 3VGMA 2VWJA 1YI2N 1HKCA 5DM6L 2GTDA 3QEWA 3NGIA 1ASVA 1WNSA 2AP1A 5FRMA 4MDAA 1REVA 4BG9A 2G8UA 4I9LA 2KLAA 1NK4A 3DRSA 3RRHA 1KRPA 2O8CA 5C0YA 4IZ9A 4M41A 5ADXA 1RBUA 3MAQA 3O4WA 5E26A 3NH1A 1C0MA 3EE9A 3DLGA 3P1GA 4FWLA 1VQON 4AHCA 3QB0A 3ZETA 1RFQA 3OHRA 3KKSA 1G15A 3EZ5A 3O4NA 3D7EO 4FPAA 1Z26A 1OVQA 3LDPA 3LPTA 5CZ2A 4K41A 4KKOA 3PX0A 4DUZK 4FM0A 1LWCA 4CHNA 1LV5A 4FJIA 3AVFA 2PZSA 3ZSRA 3TANA 4ILGB 1HYSA 3CQ8A 4B9NA 4DS4A 1NK9A 4CGDA 2D1KA 1RDUA 2ASPA 3T7ZA 2Y1IA 2DPNA 4OJRA 5AQNA 4B1WB 3KZBA 3IRXA 1RT5A 1M90O 4BE1A 3VERA 2HHTA 2F9WA 4FWRA 2YV0X 4KBOA 1BHLA 2HMPA 2FBXA 3DM2A 2FF3B 3BZKA 5EY4A 4EZ9A 4JKAA 4L3QA 4FW1A 4KHNA 3ZEUA 2HHSA 3AVBA 4IOAL 2IC3A 2NRTA 4JKGB 1BUPA 5HROA 1GLJO 1KD1O 1GLEG 4FLTA 1FJGK 4IXCA 2PYJA 3TAEA 3TSUA 4YDUC 3OS1A 3H1VX 3SJJA 4W5NA 5AQVA 3OYCA 2FXUA 3VETA 4BREA 2OPRA 4CGJA 4LY7A 4KHUA 4YOTA 2E88A 1S1TA 2XY8A 3OYNA 1X9WA 4CJ5A 5LJVA 4BGBA 5I9EB 2Q2RA 3VQ5A 4B3TK 5AQFA 1GOBA 1EWRA 4BC5A 3SPZA 1XC9A 3LDLA 3H3OB 3U9ZA 3VEZA 3ZYYX 1K6YA 3I0RA 4KH6A 4BRGA 2RE2A 1QQNA 4BR4A 4WFBL 2RN2A 1N8RO 5M1FA 1LW2A 4BRMA 3TU5A 3O3FA 3CFRA 4NXNK 5M1OA 2IIRA 2XHBA 3U9DA 4A5AA 4BRIA 1O13A 2HW3A 3OA9A 3QFUA 2E20A 4BROA 1B92A 1K9MO 1DEJA 1YVNA 3VEYA 3U4LA 4ZTJA 1ITGA 4IJAA 2BTFA 3CERA 3KK2A 5BRDA 3PV8A 4NYNA 1NOYA 5HRRA 2E1ZA 2W6KA 3NGYA 2QXLA 1D9DA 1KVBA 1YJ9N 4FLVA 4H0OA 3K2PA 4JI7K 3KLFA 3AA4A 1VSIA 5EXWA 3CJAA 4NCGA 4OPAA 4DB3A 1ASWA 3CCRN 3QERA 5J2MA 3VQ8A 4B1VA 3KJVA 4PKGA 3QO9A 2KFZA 3RSEB 3WEEB 4K8ZA 3V1QA 3D2EB 3TI0A 1RT6A 3ALYA 1NMNA 1TKXA 4DSEA 4Y1CA 1N34K 2Q97A 1CZBA 3K9JA 4CERA 3HM8A 4NYFA 3CHWA 3OJSA 3O9RA 2HOEA 4BRLA 2OTJN 5ADXH 1JJ2M 2FBYA 3EO3A 4LF5K 2A3ZA 4OPKA 1VQ5N 5FPNA 3TABA 3P83D 2E2QA 3AGRA 2YKMA 4QS9A 2Z1GA 3VN5A 1QTMA 2QA4N 1RGIA 3ZX2A 4Z4IA 2I7NA 4BG8A 3L2VA 4HHTA 4NCAA 3UKRB 2X6SA 3ZT4A 4C1NI 4DF8A 3LPUA 3SQ4A 4FOEA 1Q9XA 5AFUA 4ILHA 2A41A 4F9OA 1IG8A 1Y97A 3NCIA 4RG8A 4FJLA 2X78A 4WE1A 3ZSYA 3DOKA 3M8RA 3FZLA 1E4GT 4JHDA 4CECA 2FSJA 1S5JA 1WBBA 2VWKA 4FLWA 2ZF5O 2P9IB 2YJFA 1RT4A 1SKRA 2ITGA 2G8WA 3R8EA 3THXA 1T6DA 4O8UA 3KK1A 3PLAA 1C0UA 1NWKA 1RNHA 2BE2A 3WXMB 2R7YA 4BDYA 1RDAA 2IVNA 4YORA 4PUOA 4FZZA 2X6NA 4O0JA 4FJJA 3NAEA 1SL0A 3DLRA 4E3SA 4BACA 4BQZA 1NOZA 3HBTA 4LFBK 3LDQA 5GADP 3MEDA 2QM1A 3F2KA 1BQMA 3NF9A 4DQPA 2F7TA 3P4IA 1X9MA 5AZJB 1ZC6A 4MLEA 4BRFA 3AVIA 1WSEA 4FWOA 4F4KA 2YHYA 2HSTA 1RDCA 3CMEN 2DFHA 4CZKA 1BI4A 1I3AA 3VF4A 1VRUA 4B9TA 4DFKA 3LDOA 3OTOK 2P9LB 1P8ZA 4RW9A 3IMXA 4DFPA 3TR8A 4FWSA 3ID8A 1N6QA 3CQXA 4BWJA 5EOYA 1BISA 1BI4B 1VSEA 1YAGA 3ULEB 3M6GA 2J4RA 1I39A 1VHXA 2NNWA 3ENBA 4GVMA 5M1KA 5AQJA 1DTQA 3HSTB 4ZTFA 1UWBA 2HBJA 3NF6A 1ZBIA 2HHUA 3KTQA 4CJUA 2GX9A 5CZ1A 4OKKA 3J7ZO 3VGLA 1DLOA 2A1RA 4A2AA 4J2DA 1C1BA 4FWNA 1Z25A 3O8MA 2OA8A 1GLLO 3V9XA 2P9SB 1YF5L 2NRRA 3ZSXA 1K8KA 4IG0A 5J1EA 3SBGA 2OYQA 3P38A 3WNFA 4Z4CA 1SS6A 1RTHA 5I3UA 4CHOA 3RR7A 4ELVA 4IJNA 3G4SN 5C25A 3VQQA 2ETJA 4KHWA 3MXMA 4PHTX 4CGHA 4AQYK 4BDZA 4HTUA 4PL8A 3VF6A 4BR5A 4KV8A 1U2VB 2XY7A 1Q18A 1D8YA 1BG3A 3V81A 1VSHA 1QHTA 1VSLA 5HLFA 3OYBA 3HPOA 4H0XB 2VYPA 5J2QA 4IKFA 3CXCM 5TKYA 1QSSA 3KK7A 2Q0RA 4FJ9A 3MX5A 3SI6A 3K59A 3DLHA 1JXEA 5D3GA 1NK7A 4FWMA 3NBPA 3FR0A 1XI1A 3VQPA 5BPMA 3TTCA 2KFNA 3MXIA 2QXFA 4GKJK 4I6MA 1BCOA 5DMRA 2W41A 3LP1A 2UUCK 3KWIA 5AFUH 1XUPO 1LAWA 2QK9A 4C1NK 5KRTA 3NHGA 2HNDA 4JI3K 4IDHA 4RW6A 3O80A 4KH4A 3D6RA 3WXKA 2YHBA 1OH5A 5EU7A 3G10A 1VQKN 1SKSA 1LWFA 4H5RA 4U67L 4KO0A 4CF8A 2O8BA 4WFNL 3MK6A 3WNHA 3SJHA 1FXXA 4A2BA 4KI4A 2KTQA 4DTOA 3I55N 4UY8O 3VEVA 3MCPA 4B1UB 4DQ8A 4IBNA 1QSYA 2O8DB 4JLHA 2RHKA 1Z6RA 3C0BA 4CJWA 4CJ7A 1IV0A 3C6AA 3S41A 1NMDA 4DLGA 5C2FA 2F8TA 2G8FA 3UKUB 4JN4A 4PKHA 4HVJA 3UE5A 5DK5A 3PIOL 3AGKA 3B6PA 4CF0A 2KW4A 3VQ9A 4DV4K 1JXBA 5BRFA 3IS9A 2HNZA 1BU6O 3CM6A 2IGIA 4LH5A 4ISEA 1IBMK 1L3TA 1XHXA 4BQLA 1W7AA 1U45A 4EP5A 4JD2B 3OYGA 2FF6A 4CVNE 3K58A 3HSCA 1X3NA 1FK9A 2QWPA 1W97L 4CF2A 2VG5A 4CJ3A 3AO5A 3VQEA 4AHSA 2QW9A 3FFIA 4DS5A 4RWTA 4DR4K 2NUBA 1IKYA 1U04A 1KAXA 1NLVA 1NJWA 1W0HA 1BL3A 3DLLL 4B1ZA 3HPGA 1RTIA 3QETA 3JXUA 3V9SA 2BANA 4WFAL 4L8RB 1GOCA 3MN5A 3T3FA 3J81O 1S1UA 4X64K 1S6PA 4YDUA 1NGEA 1ZYQA 5C42A 3LALA 1N32K 2CH5A 3Q7BA 1B9FA 3UB5A 3PO5A 1VQPN 1J5EK 2AA4A 1E3MA 2D4WA 2GEMA 2HBLA 3IG1A 3DXKB 2P9NB 4F2SA 4ELTA 4M42A 4M45A 1VQ9N 3ZSZA 4DV3K 2OZSA 2UUBK 1HYVA 4KHYA 3CI5A 2UXBK 2P9PB 3AVKA 1TKDA 1R59O 4DQSA 3CFPA 1ATNA 3U3YA 1WBDA 3Q7CA 3SUNA 5BREA 1MWMA 1YTAA 3IUCA 2VG6A 1TUYA 2E8AA 1L5UA 5KGXA 3LAKA 4QOZB 3AO1A 2JWLA 3AVCA 4JK7A 2E6MA 3DLBA 4GKKK 4CHQA 2F9TA 1EXQA 1JLBA 3SYZA 3GBTA 3SAHA 4C8MA 5C15A 1Q8IA 2VGNA 3ISNC 1SUQA 2Q3SA 2PFUA 1S3XA 4GV6A 1ATRA 1S6QA 2HHQA 3WT0A 3WNGA 1JCEA 3KK3A 2ZJPL 2HHWA 3DJCA 2CGJA 4GY2B 2O8CB 1RTDA 2QWRA 2F8SA 3OYFA 1OVYA 4IOXA 2IVOA 3R3LA 3ZETB 3EKSA 3SV4A 4LSNA 3ZT3A 1JLFA 4AHTA 1TKTA 1ZXOA 5KPZA 5LMNK 2Z1IA 3PSIA 5HRPA 4HWIA 1SV5A 4ELUA 3OYAA 3RMBA 1NGBA 2FSNA 2VGMA 5MLCQ 4DU1A 4HCBA 3HXMA 3CF5L 1X9JA 4E1MA 4BRDA
chains in the Genus database with same CATH topology
4GKJK 1XNQK 2UXCK 2UUCK 3OTOK 3J81O 4X64K 4JI4K 1FJGK 4LF5K 5A2QO 4DV0K 4JI3K 1N32K 1J5EK 4DV5K 4LFAK 4OX9K 4JI5K 3T1HK 2UU9K 4LF7K 4DV3K 1HNZK 2UUBK 4YHHK 2UXBK 4B3TK 4JI2K 2VQEK 1IBLK 2ZM6K 4CW7B 4JV5K 4B3MK 5LMUK 4DR2K 4JYAK 4NXMK 1I94K 1N33K 4GKKK 5LL6Z 4YY3K 1XMOK 1HR0K 2UXDK 3T1YK 4DUYK 4DR1K 2HHHK 4X66K 4NXNK 1IBKK 4X65K 4X62K 4B3SK 4DR6K 2UUAK 4LF8K 4DUZK 4DV4K 4B3RK 4KHPK 4LF4K 4AQYK 4DV6K 4DV1K 2F4VK 1IBMK 1N36K 5AJ3K 4LF6K 3JAMO 1XNRK 2VQFK 4DV2K 4DR3K 4LF9K 4CVNE 4DR5K 4LFCK 4LFBK 4V19S 1XMQK 4JI7K 5BR8K 5IT9O 5LMNK 4JI1K 4DR7K 3J7YP 4DR4K 4JI8K 4JI0K 4DV7K 5FLXO 3J7AP 1HNXK 5IWAK 4JI6K 3J80O 2E5LK 1N34K 4K0KK 1HNWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ K;  1XNQ K;  2UXC K;  2UUC K;  3OTO K;  3J81 O;  4X64 K;  4JI4 K;  1FJG K;  4LF5 K;  5A2Q O;  4DV0 K;  4JI3 K;  1N32 K;  1J5E K;  4DV5 K;  4LFA K;  4OX9 K;  4JI5 K;  3T1H K;  2UU9 K;  4LF7 K;  4DV3 K;  1HNZ K;  2UUB K;  4YHH K;  2UXB K;  4B3T K;  4JI2 K;  2VQE K;  1IBL K;  2ZM6 K;  4CW7 B;  4JV5 K;  4B3M K;  5LMU K;  4DR2 K;  4JYA K;  4NXM K;  1I94 K;  1N33 K;  4GKK K;  5LL6 Z;  4YY3 K;  1XMO K;  1HR0 K;  2UXD K;  3T1Y K;  4DUY K;  4DR1 K;  2HHH K;  4X66 K;  4NXN K;  1IBK K;  4X65 K;  4X62 K;  4B3S K;  4DR6 K;  2UUA K;  4LF8 K;  4DUZ K;  4DV4 K;  4B3R K;  4KHP K;  4LF4 K;  4AQY K;  4DV6 K;  4DV1 K;  2F4V K;  1IBM K;  1N36 K;  5AJ3 K;  4LF6 K;  3JAM O;  1XNR K;  2VQF K;  4DV2 K;  4DR3 K;  4LF9 K;  4CVN E;  4DR5 K;  4LFC K;  4LFB K;  4V19 S;  1XMQ K;  4JI7 K;  5BR8 K;  5IT9 O;  5LMN K;  4JI1 K;  4DR7 K;  3J7Y P;  4DR4 K;  4JI8 K;  4JI0 K;  4DV7 K;  5FLX O;  3J7A P;  1HNX K;  5IWA K;  4JI6 K;  3J80 O;  2E5L K;  1N34 K;  4K0K K;  1HNW K; 
#chains in the Genus database with same CATH topology
 3C94 A;  1SAZ A;  1YVU A;  3ZT0 A;  2O4G A;  3NDK A;  2QKB A;  1OKJ A;  1J6Z A;  1VSK A;  4KH5 A;  1T6C A;  4BVO A;  3LZJ A;  2E2O A;  1BCM A;  4K25 A;  3A5M C;  1C6V A;  4OKE A;  1NGG A;  4XH1 A;  3TAQ A;  2KZM A;  4FW2 A;  3ID6 A;  3QIC A;  3H1Q A;  3S3N A;  2JWK A;  4HUG A;  4FJK A;  3RMD A;  1RT7 A;  3VA0 A;  3HK2 A;  5EX5 A;  3NVM A;  4FJH A;  4CZJ A;  2PAV A;  3ZX3 A;  4WCE L;  4B1X B;  4DSF A;  3DWL A;  3VQ7 A;  3ZEU B;  2V7Z A;  4A57 A;  4XIU A;  4FPB A;  1HNI A;  1NGF A;  1RBT A;  4DSI A;  2WFB A;  1N33 K;  2WBN A;  2YNG A;  3JSM A;  2GWJ A;  4DLE A;  1N5Y A;  5AQX A;  4M3U A;  2P9U A;  2YX6 A;  3PUF A;  1F21 A;  4CJT A;  5GAE P;  4Y1D A;  2VCP A;  2OCE A;  3T1Y K;  4BC3 A;  4BRC A;  1U4B A;  1IBK K;  3K5N A;  1KXP A;  1S22 A;  3QES A;  4W5R A;  2P5O A;  4DR6 K;  2UUA K;  4DTP A;  4CJL A;  2E2P A;  1NJX A;  4AHR A;  3V9U A;  2NZT A;  2P9U B;  3J8A A;  3S9H A;  3CCQ N;  4EIA A;  1QQO A;  4H0V B;  1W9H A;  2O8E A;  1JLA A;  3CJ1 A;  3EYZ A;  3THY A;  3M1F A;  1NGI A;  3RR8 A;  2VWB A;  4CE9 A;  1P90 A;  2GBZ A;  3A5N C;  1EET A;  4QCL A;  4B9M A;  4CZG A;  4RW7 A;  3NF8 A;  1NK0 A;  4F3T A;  4CFC A;  5J2N A;  4W5O A;  4OGE A;  1GLF O;  3OJU A;  2YCH A;  4FJM A;  4KI6 A;  1OH6 A;  3PSF A;  2V7Y A;  1FKO A;  3AAP A;  3AO2 A;  4IFY A;  4JI0 K;  3C7N A;  2JGU A;  3VF2 A;  3AA2 A;  1M1K O;  3HM9 A;  1GLB G;  2Z1J A;  4JI6 K;  3V9Z A;  3P39 A;  1RBR A;  1S1W A;  1YTU A;  2D0A A;  4J2A A;  1NNE A;  4CBX A;  3BGR A;  4KB0 A;  2HNY A;  1KLN A;  2NRZ A;  4JKF A;  2YHX A;  1WSG A;  3WQT A;  2Q36 A;  3ZX0 A;  3SAF A;  4K43 A;  4FO0 A;  3S3O A;  1J54 A;  3LAM A;  1RT3 A;  3D2F A;  2PBD A;  5BR9 A;  1T7P A;  4O5B A;  3IFR A;  3FLC O;  3ZCM A;  1HQU A;  4FK0 A;  3SUO A;  1NJI O;  3CMA N;  1WAJ A;  4IDK A;  4CW7 B;  1SZ2 A;  3QML A;  3D2F B;  4CZI A;  4MLH A;  4FVM A;  4KB1 A;  1C1A A;  2CGK A;  3RVC A;  5GIN A;  4JK8 A;  3SPY A;  3KLE A;  3CJB A;  2FBV A;  3G6E N;  1YJW N;  4CES A;  4AHV A;  1T44 A;  4N41 A;  3H45 C;  3D0P A;  3CM5 A;  1ILY A;  4I9Q A;  3EE8 A;  4CJQ A;  4FVU A;  1NGD A;  3ASM A;  3P5J A;  4M63 C;  2VG7 A;  4BC2 A;  3A0I X;  3NGZ A;  5CHI A;  3AVA A;  1IKW A;  5HRS A;  3DXM A;  3CD6 N;  3TAG A;  1XNR K;  1ZBF A;  4JKB A;  4YOW A;  1NKC A;  4DG1 A;  2WOM A;  4CHZ A;  4OPJ A;  3LWM A;  1ZBL A;  1WAF A;  1XMQ K;  4ISG A;  4LD0 A;  3DYA A;  3LM9 A;  4JHD B;  3MWP A;  4JNE A;  4NLC A;  1T3V A;  4AH9 A;  1BA1 A;  1LWE A;  4CIF A;  1WSI A;  4FSV A;  5FPD A;  3J7A P;  4IEI A;  5LY3 A;  4N76 A;  3THX B;  3LM2 A;  3AAQ A;  4NLB A;  3OYH A;  4I2P A;  3OYD A;  2HB5 A;  2UYT A;  3F73 A;  5BN8 A;  1HJR A;  3MX2 A;  3LDN A;  4JI4 K;  3L4I A;  3TTF A;  3QEV A;  3QIP A;  3AY9 A;  2ZD1 A;  3EY1 A;  2E4L A;  5J2P A;  2YNH A;  3THW A;  1TYQ A;  4QAG A;  1WB9 A;  1A5V A;  1KAY A;  2HBK A;  5AQS A;  4RTF D;  4ICL A;  4F2R A;  1EX4 A;  2O4I A;  5FRO A;  4IFV A;  4WQ5 C;  1RDD A;  3NH0 A;  1HUX A;  3U3G A;  3CQY A;  1NKE A;  4B1Y B;  4CBU A;  2ZM6 K;  1KAZ A;  2OPQ A;  5M1P A;  3C95 A;  4JYA K;  4NO7 A;  4H0T B;  4B9V A;  3L3U A;  1YT3 A;  1ATS A;  4NXM K;  1BIZ A;  4EHT A;  4BRH A;  3UIQ A;  1NGJ A;  4FWP A;  4AF1 A;  1KVA A;  2UXD K;  3GDQ A;  5AQH A;  4F3O A;  1VQ8 N;  2KHO A;  4XH5 A;  3DOL A;  4O5F A;  4OO1 J;  1VQ7 N;  2PYL A;  2ZJR L;  1EO1 A;  4H5N A;  5M1N A;  4QS7 A;  1H1V A;  1T03 A;  2ITM A;  2EX3 A;  3VTI A;  5KTQ A;  2HVI A;  4DV6 K;  4CJF A;  3E9P A;  2W42 A;  3I8B A;  5JVH L;  3ZSV A;  4LF6 K;  3QEP A;  1VSJ A;  2I5J A;  2PY5 A;  1TGO A;  3FZM A;  1HLU A;  2BUP A;  4LFC K;  2W40 A;  1ASU A;  4BY9 C;  1QHA A;  4DMN A;  1MU2 A;  2NRX A;  5SZT A;  3RTV A;  1K8K B;  4DTS A;  1SL1 A;  5KRS A;  4CJS A;  4KRF A;  3HL8 A;  4CIE A;  5AQK A;  2WUS A;  4FYD A;  3QBX A;  4KTQ A;  2YI1 A;  3EZW A;  4DV7 K;  3O08 A;  1S1V A;  1QVG M;  1J5O A;  1XC3 A;  3I33 A;  4XEI A;  2HBM A;  4EZ6 A;  1L3S A;  1QZ5 A;  5HP1 A;  1U47 A;  3DLK A;  4FOI A;  4FM2 A;  4R5P A;  3BP8 A;  4PL7 A;  4YFU A;  3A5O C;  3MEG A;  4ISF A;  1JLE A;  1IKV A;  4DTR A;  4FJX A;  5FDL A;  4B9Q A;  3GL1 A;  2OAN A;  4PQU A;  1IKX A;  3VTH A;  5C10 A;  2UU9 K;  4IO9 L;  3SV3 A;  1CXQ A;  4BR0 A;  3QIO A;  4FLX A;  4M3W A;  2XY5 A;  2HF3 A;  3SK3 A;  3CJC A;  1S72 N;  3K5L A;  5BPL A;  2VQE K;  4MFB A;  3HYF A;  2DTU A;  3TTD A;  4M3X A;  3ZT1 A;  2XO7 A;  4DR2 K;  5AZI A;  4I6M B;  4O4G A;  2ZWH A;  3AO3 A;  4DTN A;  1U49 A;  5AQM A;  2OZM A;  5JLH A;  3CIP A;  2RPI A;  3FZF A;  2GUI A;  5LL6 Z;  4YY3 K;  4M3T A;  4Z4F A;  1HR0 K;  4C8N A;  3ATV A;  4N56 A;  2X74 A;  4X65 K;  4YOY A;  1BWF O;  3HP9 A;  2NRW A;  4FK2 A;  3MEE A;  4KFB A;  4CEF A;  2LSN A;  3AVG A;  5I42 A;  1RBS A;  4A61 A;  4LF8 K;  3SMP A;  3QNO A;  4DU4 A;  4DSL A;  4Y0W A;  1Y64 A;  2O8B B;  4A5B A;  2KQ2 A;  5CE3 A;  2D0O A;  4F8R A;  4J2E A;  3ZSW A;  4W5T A;  4CFA A;  1B9D A;  3KWG A;  4JS5 A;  4IWV A;  1RTJ A;  4G9Z A;  4FJ7 A;  4K42 A;  3T19 A;  4CZL A;  1VQM N;  4PWD A;  1WLJ A;  3EN9 A;  3V1O A;  2IOC A;  4IO8 A;  3R9P A;  1WSH A;  3HPH A;  2IVP A;  4AM6 A;  3R1X A;  4OGC A;  4CHP A;  4KHQ A;  1TKZ A;  4KPY A;  1BDG A;  3OW2 M;  2O8F A;  3O9Q A;  2V51 B;  1Q81 O;  1BA0 A;  1QS4 A;  3AVH A;  4J2B A;  3CPE A;  2HF4 A;  3BEX A;  3CCV N;  1XNQ K;  4H4O A;  1L3V A;  3GOI A;  1HRH A;  4IFE A;  3QNN A;  5BPN A;  4CD3 A;  4ID1 A;  3LP0 A;  2A5X A;  1WN7 A;  2YNI A;  3T1A A;  3ENO A;  3FZK A;  3KKR A;  4H0P A;  3HP6 A;  3V1R A;  3V4I A;  1HX1 A;  4FJ8 A;  4OX9 K;  1TVR A;  5ELZ A;  5JVG L;  1V4S A;  1DKG D;  3N4Q A;  4YNQ A;  4FLU A;  3SLC A;  1JCF A;  1RT1 A;  3KHY A;  3LP3 A;  2QWN A;  4CZM A;  3LZI A;  1UOC A;  2QEX N;  1KTQ A;  2ZQB A;  3TSQ A;  2ASO A;  3QIN A;  3L2R A;  2GEL A;  5FPE A;  4C8O A;  2RKI A;  1DGK N;  4CEQ A;  4BRQ A;  2G8K A;  5AR0 A;  3OS0 A;  5C24 A;  3VQB A;  1SKW A;  4DUY K;  5JLF A;  1BGX T;  2IDO A;  1ZBH A;  4E19 A;  3KD5 E;  4OKJ A;  1VSM A;  4Q5V A;  3C65 A;  3HVT A;  3C6H A;  3SQ0 A;  3HZ6 A;  3FFK B;  1SL2 A;  3WXJ A;  3NE6 A;  4RCH A;  5FPM A;  3HT3 A;  1YIT N;  3DRP A;  4OLA A;  4EAH D;  4WF9 L;  5JIC A;  4DU3 A;  2RF2 A;  5C2D A;  4CZE A;  3JYT A;  3KLI A;  5M1Q A;  3PY8 A;  2P9K A;  4LF9 K;  3VMF B;  4W5Q A;  4Z4E A;  2FC0 A;  1C0F A;  1X1P A;  1NM1 A;  2HMI A;  2E1Y A;  2G8H A;  1HYZ A;  2WC9 A;  2AJQ A;  2B5J A;  4H5W A;  1CLQ A;  4JI1 K;  3LDS A;  3FE1 A;  3FZH A;  1VSF A;  1C0G A;  4MO5 A;  4CGF A;  5GIO A;  1NK8 A;  5FRN A;  3OBW A;  3BZC A;  3VGK A;  3WXL A;  4J8F A;  4Z94 A;  1TL1 A;  3MMV A;  3VA3 A;  3MN7 A;  1IH7 A;  3CET A;  3L2W A;  4NCB A;  2QWO A;  3THV A;  1EP4 A;  1A5W A;  2H3G X;  2FLO A;  2OTL N;  3U6F A;  1UA0 A;  5F0X A;  1C1C A;  1KCF A;  1FW6 A;  3S3M A;  1TK0 A;  1JLQ A;  1IO2 A;  4IOC L;  2F96 A;  3K5M A;  3D45 A;  1IG9 A;  1NGH A;  5AQY A;  1TAQ A;  2W6L A;  4DTU A;  4B9U A;  3C6T A;  4I2Q A;  5C12 A;  1GLD G;  4YHH K;  4E7K A;  1WUA A;  3VPZ A;  2YHA A;  3BUZ B;  3E01 A;  3TAF A;  4PA1 A;  2ZGZ A;  4XH4 A;  4M3Z A;  3O1W A;  3VEN A;  4UQG A;  1HMV A;  2ATQ A;  3FGU A;  3O3G A;  3PIP L;  4OPH A;  4HTL A;  4O8K A;  3LP2 A;  4CZF A;  1VQN N;  1ESV A;  3PX6 A;  1NKB A;  4WYB A;  1G99 A;  4BR7 A;  4DFJ A;  1XMO K;  3MXJ A;  3P31 A;  5E84 A;  4FWK A;  3CCE N;  4B8C A;  2DFF A;  4CHY A;  2B4J A;  4B3S K;  2I7P A;  3VQD A;  2DFE A;  3HRG A;  4JKG A;  4C8L A;  5KQ8 A;  3SBT A;  3ENH A;  2WON A;  3MEC A;  4CJV A;  3KVG A;  1YJN N;  3JAM O;  4YOX A;  1JL1 A;  3WNE A;  4FJN A;  1QVF M;  3OYL A;  1U48 A;  2KKZ A;  1DT9 A;  1CZA N;  3AAR A;  1LAV A;  4C23 A;  5IT9 O;  3O4Q A;  5CYQ A;  4A62 A;  2ASM A;  4CD1 A;  3J7Y P;  4FXD A;  1EQY A;  4BRK A;  3O5B A;  1X3M A;  3AVJ A;  3VQ4 A;  2P5G A;  5FLX O;  5IWA K;  4LSL A;  5BRH A;  4BRA A;  4K0K K;  4B8A B;  4CED A;  3E9L A;  1MWK A;  3TWH A;  4MQ3 A;  2O8E B;  2QWL A;  4Z0U A;  1XWL A;  3THY B;  1D9F A;  3SZ2 A;  3HJF A;  4GVE A;  3AVM A;  3HI0 A;  4GMJ B;  2Q1N A;  4H5T A;  2ZJQ L;  4WQ4 A;  3KLH A;  3HO1 A;  4JKD A;  4WQ5 A;  2CH6 A;  3CCU N;  5KGW A;  4DTX A;  3SCX A;  3T1H K;  2E6L A;  3L3V A;  4DQR A;  3R6M A;  2NRV A;  4MO4 A;  2Q31 A;  2YHW A;  3AA3 A;  2NRH A;  1VRT A;  5AQQ A;  3C7N B;  4BRP A;  4JI2 K;  4E89 A;  3ULD A;  5AQT A;  3O9S A;  1BO5 O;  4CJ4 A;  1T8E A;  4GW6 A;  1VSD A;  3TPQ A;  3AA5 X;  3KIO A;  3NF7 A;  4JK9 A;  4JAX A;  3A5L C;  3CCS N;  2HHH K;  4CK2 A;  3RSE A;  3TAM A;  4LC9 B;  3WEE A;  4AHU A;  3D2E A;  4E1J A;  3OY9 A;  3MN6 A;  3VEW A;  1L3U A;  1V4T A;  1Z05 A;  1CZ9 A;  2NLX A;  3ATU A;  3OYJ A;  2DY4 A;  2QKK A;  3CG7 A;  3V9W A;  1X9S A;  3LL3 A;  4RW4 A;  4DTJ A;  5B8H A;  1TK8 A;  4DV2 K;  1WSF A;  3RMA A;  4DR5 K;  1EWQ A;  1UAX A;  3UKR A;  2EWS A;  1TL3 A;  3EL2 A;  4CF9 A;  4FL9 A;  3B8A X;  1ZBU A;  1EKE A;  3K57 A;  2D5R A;  4DKW A;  5DM7 L;  3M8S A;  4CJE A;  4CEO A;  3HOS A;  4KHS A;  2HHX A;  1TV6 A;  4DQQ A;  1VQ6 N;  3SMS A;  4CI6 A;  3ZSQ A;  1GLC G;  4O44 A;  2FSK A;  1TK5 A;  3O3H A;  1XHZ A;  5AQW A;  5AQI A;  4CEA A;  1QSL A;  4M7Y A;  3L2Q A;  3LWL A;  4Z4H A;  1YXQ A;  4CIG A;  5E41 A;  3DXM B;  4DV0 K;  1VQL N;  4C8K A;  2P9I A;  1OH7 A;  4JRP A;  3SQ1 A;  3A2F A;  4FJG A;  1YHQ N;  4DV5 K;  2G8V A;  1Q86 O;  3QLH A;  4M3R A;  1OH8 A;  1S1X A;  3M3Z A;  3TSP A;  3L6Q A;  3L8B A;  4CBW A;  1HNZ K;  3CC4 N;  5HOO A;  1RCH A;  1NBW A;  3CC2 N;  3SQ2 A;  1IBL K;  4FCY A;  3QEI A;  5LMU K;  5KPR A;  5JS2 A;  3RWU A;  1NK5 A;  3W0L A;  5CYM A;  2B6A A;  4B08 A;  5GIP A;  3M8P A;  3ZT2 A;  4WQ4 C;  3VES A;  5AQO A;  4U7B A;  1BIU A;  5K14 A;  1RBV A;  2IS3 A;  5AZJ A;  5CY4 A;  4CJP A;  4BVP A;  1MDU B;  3THW B;  3OBY A;  1TYQ B;  3BF1 A;  2HHV A;  1MA9 B;  2GV9 A;  4GV9 A;  1WSJ A;  4X62 K;  1NJZ A;  4K8X A;  2D0P A;  3VQC A;  4AM7 A;  3I0S A;  3CJ7 A;  1W2B M;  2P9L A;  3F9K A;  1HPM A;  4QS8 A;  5JMV A;  1D5A A;  3N4P A;  2XY6 A;  3PX4 A;  1SQK A;  1D4X A;  3VQA A;  1Q7Y O;  3M8Q A;  3IKM A;  5AQP A;  3ULE A;  3MWT A;  3OS2 A;  3EKU A;  4E7J A;  4FWQ A;  4DWI A;  1YUW A;  4Z4G A;  5F2R A;  1O1W A;  3VEX A;  2Q0U A;  1JKH A;  5AQZ A;  4BE0 A;  4GNI A;  3IAY A;  4BWM A;  2E2N A;  3QFP A;  2QTD A;  4PY5 A;  4BE2 A;  3IDH A;  1Q9Y A;  3DLE A;  3BDP A;  3F9M A;  4JRQ A;  1FKP A;  3ITH A;  4I7F A;  3TAP A;  1TAU A;  1C0T A;  1HNX K;  5T7B A;  3AVL A;  4LH4 A;  2OPP A;  4ID5 A;  1HNW K;  3E9O A;  5KQD A;  4MDB A;  3OYE A;  1CXU A;  2P9S A;  3I56 N;  3K5O A;  3KLG A;  1TUU A;  3VQ6 A;  1YIJ N;  4CEB A;  1RIL A;  4BRN A;  4CK1 A;  4DHY A;  4CK3 A;  1IJJ A;  4OVL A;  4DFM A;  1JLG A;  4CGI A;  3SNN A;  4JKC A;  2XRI A;  2QI2 A;  4JS4 A;  4CJR A;  4G1Q A;  4DSJ A;  1QQM A;  4O0I A;  1UA1 A;  3T69 A;  2QWM A;  3LAN A;  4KTW A;  3I8D A;  1QZ6 A;  4YOU A;  3CYM A;  4TSX A;  1KFS A;  1KLM A;  1U2V A;  3OYM A;  2G8I A;  4KTZ A;  4FZX C;  4E7L A;  3O1B A;  4FLY A;  3M5R A;  3B6O A;  4CFD A;  3DAW A;  1HPZ A;  4R79 A;  4O55 A;  1J53 A;  4M3Y A;  4BGA A;  1QQC A;  1LCU A;  2BH1 A;  5BN9 A;  4FLZ A;  3GE1 A;  2D0C A;  3O9T A;  3AO4 A;  3H6E A;  5TKW A;  3NMU A;  4DR1 K;  5F1X A;  3F5T A;  1NK6 A;  2P51 A;  3NFA A;  5KI6 A;  3HTV A;  3O6W A;  3WUH A;  1BOT O;  1HJO A;  5JS1 A;  1HKB A;  3RMC A;  5GAG P;  4B3R K;  3H08 A;  1RT2 A;  1S9G A;  3GG4 A;  4ZHR A;  4LF4 K;  1NGC A;  3SUP A;  3QDK A;  2F4V K;  2HVH A;  4N5S A;  3MDQ A;  1KVC A;  3AV9 A;  5KPT A;  3H3N O;  1N36 K;  1KFD A;  4OLB A;  4ILJ A;  4E7H A;  4DTM A;  4HCC A;  2WTU A;  4DR3 K;  4DF4 A;  3K0S A;  4FK4 A;  5AQG A;  3A8Y A;  4BC4 A;  4KRE A;  5AZI B;  1E4F T;  3AVN A;  4HUF A;  3RRG A;  2A42 A;  1VK0 A;  4YOV A;  2GUP A;  5HL7 L;  1Q82 O;  2P1J A;  3SAG A;  4H4M A;  1HKG A;  2QWQ A;  3O9U A;  1R0A A;  3E66 A;  4CGG A;  4A59 A;  4DSK A;  3C6U A;  5H1S Q;  5SWM A;  2O8D A;  2GWK A;  3W3D A;  2E5L K;  4M7X A;  4CCH A;  2ZGY A;  3KD1 E;  3VEO A;  3CCJ N;  3QEX A;  3G71 N;  4Q0B A;  1A5X A;  2CGL A;  3UKU A;  2BDP A;  3VOV A;  4CJK A;  3MN9 A;  5A2Q O;  1WOQ A;  2KZZ A;  4CEZ A;  1NJY A;  3DI6 A;  3OYK A;  5EVZ A;  3EEQ A;  4JEP A;  1JLC A;  1QE1 A;  3U8X A;  4JKH A;  4KAZ A;  4LFA K;  1KQS M;  2YNF A;  1JL2 A;  4JI5 K;  1XQS C;  2OPS A;  4LF7 K;  3QBW A;  4H0Y B;  3CC7 N;  4FJ5 A;  4BDP A;  5AQU A;  3NH2 A;  4EFH A;  5HBM A;  4IEE A;  2JLE A;  1NU0 A;  4JD2 A;  2ZE2 A;  4GV3 A;  3MCA B;  3HOT A;  1NGA A;  5HRN A;  2O8F B;  4JV5 K;  4B3M K;  2FBT A;  4E1N A;  1S9E A;  1HQE A;  5LJW A;  3HVR A;  1GLA G;  4CEE A;  1I94 K;  2BGG A;  4PKI A;  3G0Z A;  4FM1 A;  1K73 O;  1NG9 A;  3L4Q A;  2YKN A;  3V6D A;  4X66 K;  2A6A A;  1BQN A;  4E7I A;  1LW0 A;  4FZY A;  1JCG A;  1LOT B;  5CR4 A;  4CFB A;  3TAR A;  1ZBS A;  3DRR A;  4KHP K;  3K9K A;  3CCM N;  3WQU A;  1KC8 O;  4DV1 K;  1HNV A;  4DCH A;  3JS6 A;  1J9A A;  3CFO A;  3ZSO A;  3PO4 A;  1T05 A;  3WXI A;  5AJ3 K;  2VQF K;  3H46 O;  4BR2 A;  3CCL N;  4RW8 A;  4E0D A;  2Z1H A;  5GAH P;  4H8K A;  4V19 S;  1DTT A;  3E1Y A;  3OYI A;  5BR8 K;  3DXK A;  2P9N A;  4H03 B;  4AIL C;  4BR9 A;  2IAJ A;  4B3O A;  1U6Z A;  4IG3 A;  4DR7 K;  3BY5 A;  2EHG A;  3SUQ A;  4CZH A;  2D0B A;  5AQL A;  1K8A O;  3NVK A;  2P9P A;  4JI8 K;  4H5V A;  4N47 A;  3CPW M;  3OVN A;  1KSP A;  4DQI A;  4HUE A;  3BF3 A;  2V52 B;  3CJ9 A;  4EP4 A;  4B9S A;  4JKE A;  2A40 A;  2A1S A;  3J80 O;  3ZLJ A;  4CF1 A;  4EHU A;  3G25 A;  2UXC K;  1RDB A;  1RDW X;  5AQR A;  2Y1J A;  4B9L A;  1VAZ A;  3L0Q A;  3L2U A;  2YJE A;  2P9K B;  4NB4 A;  1VQ4 N;  1GOA A;  3DMJ A;  3VGM A;  2VWJ A;  1YI2 N;  1HKC A;  5DM6 L;  2GTD A;  3QEW A;  3NGI A;  1ASV A;  1WNS A;  2AP1 A;  5FRM A;  4MDA A;  1REV A;  4BG9 A;  2G8U A;  4I9L A;  2KLA A;  1NK4 A;  3DRS A;  3RRH A;  1KRP A;  2O8C A;  5C0Y A;  4IZ9 A;  4M41 A;  5ADX A;  1RBU A;  3MAQ A;  3O4W A;  5E26 A;  3NH1 A;  1C0M A;  3EE9 A;  3DLG A;  3P1G A;  4FWL A;  1VQO N;  4AHC A;  3QB0 A;  3ZET A;  1RFQ A;  3OHR A;  3KKS A;  1G15 A;  3EZ5 A;  3O4N A;  3D7E O;  4FPA A;  1Z26 A;  1OVQ A;  3LDP A;  3LPT A;  5CZ2 A;  4K41 A;  4KKO A;  3PX0 A;  4DUZ K;  4FM0 A;  1LWC A;  4CHN A;  1LV5 A;  4FJI A;  3AVF A;  2PZS A;  3ZSR A;  3TAN A;  4ILG B;  1HYS A;  3CQ8 A;  4B9N A;  4DS4 A;  1NK9 A;  4CGD A;  2D1K A;  1RDU A;  2ASP A;  3T7Z A;  2Y1I A;  2DPN A;  4OJR A;  5AQN A;  4B1W B;  3KZB A;  3IRX A;  1RT5 A;  1M90 O;  4BE1 A;  3VER A;  2HHT A;  2F9W A;  4FWR A;  2YV0 X;  4KBO A;  1BHL A;  2HMP A;  2FBX A;  3DM2 A;  2FF3 B;  3BZK A;  5EY4 A;  4EZ9 A;  4JKA A;  4L3Q A;  4FW1 A;  4KHN A;  3ZEU A;  2HHS A;  3AVB A;  4IOA L;  2IC3 A;  2NRT A;  4JKG B;  1BUP A;  5HRO A;  1GLJ O;  1KD1 O;  1GLE G;  4FLT A;  1FJG K;  4IXC A;  2PYJ A;  3TAE A;  3TSU A;  4YDU C;  3OS1 A;  3H1V X;  3SJJ A;  4W5N A;  5AQV A;  3OYC A;  2FXU A;  3VET A;  4BRE A;  2OPR A;  4CGJ A;  4LY7 A;  4KHU A;  4YOT A;  2E88 A;  1S1T A;  2XY8 A;  3OYN A;  1X9W A;  4CJ5 A;  5LJV A;  4BGB A;  5I9E B;  2Q2R A;  3VQ5 A;  4B3T K;  5AQF A;  1GOB A;  1EWR A;  4BC5 A;  3SPZ A;  1XC9 A;  3LDL A;  3H3O B;  3U9Z A;  3VEZ A;  3ZYY X;  1K6Y A;  3I0R A;  4KH6 A;  4BRG A;  2RE2 A;  1QQN A;  4BR4 A;  4WFB L;  2RN2 A;  1N8R O;  5M1F A;  1LW2 A;  4BRM A;  3TU5 A;  3O3F A;  3CFR A;  4NXN K;  5M1O A;  2IIR A;  2XHB A;  3U9D A;  4A5A A;  4BRI A;  1O13 A;  2HW3 A;  3OA9 A;  3QFU A;  2E20 A;  4BRO A;  1B92 A;  1K9M O;  1DEJ A;  1YVN A;  3VEY A;  3U4L A;  4ZTJ A;  1ITG A;  4IJA A;  2BTF A;  3CER A;  3KK2 A;  5BRD A;  3PV8 A;  4NYN A;  1NOY A;  5HRR A;  2E1Z A;  2W6K A;  3NGY A;  2QXL A;  1D9D A;  1KVB A;  1YJ9 N;  4FLV A;  4H0O A;  3K2P A;  4JI7 K;  3KLF A;  3AA4 A;  1VSI A;  5EXW A;  3CJA A;  4NCG A;  4OPA A;  4DB3 A;  1ASW A;  3CCR N;  3QER A;  5J2M A;  3VQ8 A;  4B1V A;  3KJV A;  4PKG A;  3QO9 A;  2KFZ A;  3RSE B;  3WEE B;  4K8Z A;  3V1Q A;  3D2E B;  3TI0 A;  1RT6 A;  3ALY A;  1NMN A;  1TKX A;  4DSE A;  4Y1C A;  1N34 K;  2Q97 A;  1CZB A;  3K9J A;  4CER A;  3HM8 A;  4NYF A;  3CHW A;  3OJS A;  3O9R A;  2HOE A;  4BRL A;  2OTJ N;  5ADX H;  1JJ2 M;  2FBY A;  3EO3 A;  4LF5 K;  2A3Z A;  4OPK A;  1VQ5 N;  5FPN A;  3TAB A;  3P83 D;  2E2Q A;  3AGR A;  2YKM A;  4QS9 A;  2Z1G A;  3VN5 A;  1QTM A;  2QA4 N;  1RGI A;  3ZX2 A;  4Z4I A;  2I7N A;  4BG8 A;  3L2V A;  4HHT A;  4NCA A;  3UKR B;  2X6S A;  3ZT4 A;  4C1N I;  4DF8 A;  3LPU A;  3SQ4 A;  4FOE A;  1Q9X A;  5AFU A;  4ILH A;  2A41 A;  4F9O A;  1IG8 A;  1Y97 A;  3NCI A;  4RG8 A;  4FJL A;  2X78 A;  4WE1 A;  3ZSY A;  3DOK A;  3M8R A;  3FZL A;  1E4G T;  4JHD A;  4CEC A;  2FSJ A;  1S5J A;  1WBB A;  2VWK A;  4FLW A;  2ZF5 O;  2P9I B;  2YJF A;  1RT4 A;  1SKR A;  2ITG A;  2G8W A;  3R8E A;  3THX A;  1T6D A;  4O8U A;  3KK1 A;  3PLA A;  1C0U A;  1NWK A;  1RNH A;  2BE2 A;  3WXM B;  2R7Y A;  4BDY A;  1RDA A;  2IVN A;  4YOR A;  4PUO A;  4FZZ A;  2X6N A;  4O0J A;  4FJJ A;  3NAE A;  1SL0 A;  3DLR A;  4E3S A;  4BAC A;  4BQZ A;  1NOZ A;  3HBT A;  4LFB K;  3LDQ A;  5GAD P;  3MED A;  2QM1 A;  3F2K A;  1BQM A;  3NF9 A;  4DQP A;  2F7T A;  3P4I A;  1X9M A;  5AZJ B;  1ZC6 A;  4MLE A;  4BRF A;  3AVI A;  1WSE A;  4FWO A;  4F4K A;  2YHY A;  2HST A;  1RDC A;  3CME N;  2DFH A;  4CZK A;  1BI4 A;  1I3A A;  3VF4 A;  1VRU A;  4B9T A;  4DFK A;  3LDO A;  3OTO K;  2P9L B;  1P8Z A;  4RW9 A;  3IMX A;  4DFP A;  3TR8 A;  4FWS A;  3ID8 A;  1N6Q A;  3CQX A;  4BWJ A;  5EOY A;  1BIS A;  1BI4 B;  1VSE A;  1YAG A;  3ULE B;  3M6G A;  2J4R A;  1I39 A;  1VHX A;  2NNW A;  3ENB A;  4GVM A;  5M1K A;  5AQJ A;  1DTQ A;  3HST B;  4ZTF A;  1UWB A;  2HBJ A;  3NF6 A;  1ZBI A;  2HHU A;  3KTQ A;  4CJU A;  2GX9 A;  5CZ1 A;  4OKK A;  3J7Z O;  3VGL A;  1DLO A;  2A1R A;  4A2A A;  4J2D A;  1C1B A;  4FWN A;  1Z25 A;  3O8M A;  2OA8 A;  1GLL O;  3V9X A;  2P9S B;  1YF5 L;  2NRR A;  3ZSX A;  1K8K A;  4IG0 A;  5J1E A;  3SBG A;  2OYQ A;  3P38 A;  3WNF A;  4Z4C A;  1SS6 A;  1RTH A;  5I3U A;  4CHO A;  3RR7 A;  4ELV A;  4IJN A;  3G4S N;  5C25 A;  3VQQ A;  2ETJ A;  4KHW A;  3MXM A;  4PHT X;  4CGH A;  4AQY K;  4BDZ A;  4HTU A;  4PL8 A;  3VF6 A;  4BR5 A;  4KV8 A;  1U2V B;  2XY7 A;  1Q18 A;  1D8Y A;  1BG3 A;  3V81 A;  1VSH A;  1QHT A;  1VSL A;  5HLF A;  3OYB A;  3HPO A;  4H0X B;  2VYP A;  5J2Q A;  4IKF A;  3CXC M;  5TKY A;  1QSS A;  3KK7 A;  2Q0R A;  4FJ9 A;  3MX5 A;  3SI6 A;  3K59 A;  3DLH A;  1JXE A;  5D3G A;  1NK7 A;  4FWM A;  3NBP A;  3FR0 A;  1XI1 A;  3VQP A;  5BPM A;  3TTC A;  2KFN A;  3MXI A;  2QXF A;  4GKJ K;  4I6M A;  1BCO A;  5DMR A;  2W41 A;  3LP1 A;  2UUC K;  3KWI A;  5AFU H;  1XUP O;  1LAW A;  2QK9 A;  4C1N K;  5KRT A;  3NHG A;  2HND A;  4JI3 K;  4IDH A;  4RW6 A;  3O80 A;  4KH4 A;  3D6R A;  3WXK A;  2YHB A;  1OH5 A;  5EU7 A;  3G10 A;  1VQK N;  1SKS A;  1LWF A;  4H5R A;  4U67 L;  4KO0 A;  4CF8 A;  2O8B A;  4WFN L;  3MK6 A;  3WNH A;  3SJH A;  1FXX A;  4A2B A;  4KI4 A;  2KTQ A;  4DTO A;  3I55 N;  4UY8 O;  3VEV A;  3MCP A;  4B1U B;  4DQ8 A;  4IBN A;  1QSY A;  2O8D B;  4JLH A;  2RHK A;  1Z6R A;  3C0B A;  4CJW A;  4CJ7 A;  1IV0 A;  3C6A A;  3S41 A;  1NMD A;  4DLG A;  5C2F A;  2F8T A;  2G8F A;  3UKU B;  4JN4 A;  4PKH A;  4HVJ A;  3UE5 A;  5DK5 A;  3PIO L;  3AGK A;  3B6P A;  4CF0 A;  2KW4 A;  3VQ9 A;  4DV4 K;  1JXB A;  5BRF A;  3IS9 A;  2HNZ A;  1BU6 O;  3CM6 A;  2IGI A;  4LH5 A;  4ISE A;  1IBM K;  1L3T A;  1XHX A;  4BQL A;  1W7A A;  1U45 A;  4EP5 A;  4JD2 B;  3OYG A;  2FF6 A;  4CVN E;  3K58 A;  3HSC A;  1X3N A;  1FK9 A;  2QWP A;  1W97 L;  4CF2 A;  2VG5 A;  4CJ3 A;  3AO5 A;  3VQE A;  4AHS A;  2QW9 A;  3FFI A;  4DS5 A;  4RWT A;  4DR4 K;  2NUB A;  1IKY A;  1U04 A;  1KAX A;  1NLV A;  1NJW A;  1W0H A;  1BL3 A;  3DLL L;  4B1Z A;  3HPG A;  1RTI A;  3QET A;  3JXU A;  3V9S A;  2BAN A;  4WFA L;  4L8R B;  1GOC A;  3MN5 A;  3T3F A;  3J81 O;  1S1U A;  4X64 K;  1S6P A;  4YDU A;  1NGE A;  1ZYQ A;  5C42 A;  3LAL A;  1N32 K;  2CH5 A;  3Q7B A;  1B9F A;  3UB5 A;  3PO5 A;  1VQP N;  1J5E K;  2AA4 A;  1E3M A;  2D4W A;  2GEM A;  2HBL A;  3IG1 A;  3DXK B;  2P9N B;  4F2S A;  4ELT A;  4M42 A;  4M45 A;  1VQ9 N;  3ZSZ A;  4DV3 K;  2OZS A;  2UUB K;  1HYV A;  4KHY A;  3CI5 A;  2UXB K;  2P9P B;  3AVK A;  1TKD A;  1R59 O;  4DQS A;  3CFP A;  1ATN A;  3U3Y A;  1WBD A;  3Q7C A;  3SUN A;  5BRE A;  1MWM A;  1YTA A;  3IUC A;  2VG6 A;  1TUY A;  2E8A A;  1L5U A;  5KGX A;  3LAK A;  4QOZ B;  3AO1 A;  2JWL A;  3AVC A;  4JK7 A;  2E6M A;  3DLB A;  4GKK K;  4CHQ A;  2F9T A;  1EXQ A;  1JLB A;  3SYZ A;  3GBT A;  3SAH A;  4C8M A;  5C15 A;  1Q8I A;  2VGN A;  3ISN C;  1SUQ A;  2Q3S A;  2PFU A;  1S3X A;  4GV6 A;  1ATR A;  1S6Q A;  2HHQ A;  3WT0 A;  3WNG A;  1JCE A;  3KK3 A;  2ZJP L;  2HHW A;  3DJC A;  2CGJ A;  4GY2 B;  2O8C B;  1RTD A;  2QWR A;  2F8S A;  3OYF A;  1OVY A;  4IOX A;  2IVO A;  3R3L A;  3ZET B;  3EKS A;  3SV4 A;  4LSN A;  3ZT3 A;  1JLF A;  4AHT A;  1TKT A;  1ZXO A;  5KPZ A;  5LMN K;  2Z1I A;  3PSI A;  5HRP A;  4HWI A;  1SV5 A;  4ELU A;  3OYA A;  3RMB A;  1NGB A;  2FSN A;  2VGM A;  5MLC Q;  4DU1 A;  4HCB A;  3HXM A;  3CF5 L;  1X9J A;  4E1M A;  4BRD A; 
#chains in the Genus database with same CATH homology
 4GKJ K;  1XNQ K;  2UXC K;  2UUC K;  3OTO K;  3J81 O;  4X64 K;  4JI4 K;  1FJG K;  4LF5 K;  5A2Q O;  4DV0 K;  4JI3 K;  1N32 K;  1J5E K;  4DV5 K;  4LFA K;  4OX9 K;  4JI5 K;  3T1H K;  2UU9 K;  4LF7 K;  4DV3 K;  1HNZ K;  2UUB K;  4YHH K;  2UXB K;  4B3T K;  4JI2 K;  2VQE K;  1IBL K;  2ZM6 K;  4CW7 B;  4JV5 K;  4B3M K;  5LMU K;  4DR2 K;  4JYA K;  4NXM K;  1I94 K;  1N33 K;  4GKK K;  5LL6 Z;  4YY3 K;  1XMO K;  1HR0 K;  2UXD K;  3T1Y K;  4DUY K;  4DR1 K;  2HHH K;  4X66 K;  4NXN K;  1IBK K;  4X65 K;  4X62 K;  4B3S K;  4DR6 K;  2UUA K;  4LF8 K;  4DUZ K;  4DV4 K;  4B3R K;  4KHP K;  4LF4 K;  4AQY K;  4DV6 K;  4DV1 K;  2F4V K;  1IBM K;  1N36 K;  5AJ3 K;  4LF6 K;  3JAM O;  1XNR K;  2VQF K;  4DV2 K;  4DR3 K;  4LF9 K;  4CVN E;  4DR5 K;  4LFC K;  4LFB K;  4V19 S;  1XMQ K;  4JI7 K;  5BR8 K;  5IT9 O;  5LMN K;  4JI1 K;  4DR7 K;  3J7Y P;  4DR4 K;  4JI8 K;  4JI0 K;  4DV7 K;  5FLX O;  3J7A P;  1HNX K;  5IWA K;  4JI6 K;  3J80 O;  2E5L K;  1N34 K;  4K0K K;  1HNW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...