4DV5K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv5K00
4DR7K 4JI7K 4DUYK 4LF4K 2ZM6K 4X65K 4B3TK 1N32K 1IBKK 4LF5K 4DV7K 5LMUK 4AQYK 4YHHK 1XNRK 4CVNE 2UXBK 4DV5K 4NXMK 3JAMO 4DR1K 2UUAK 4LF9K 5AJ3K 1FJGK 1J5EK 3J81O 4X62K 5IWAK 1XMQK 4JI5K 5BR8K 4OX9K 4DV4K 4CW7B 3J7YP 4DR5K 1N33K 4LF7K 4X66K 4GKJK 3J7AP 1N34K 4JI0K 1HR0K 4KHPK 4DV6K 4JV5K 4LF8K 4DR3K 4DV3K 4X64K 1XMOK 3T1HK 1HNZK 4LFCK 2HHHK 4LFBK 4JI2K 4YY3K 1I94K 2UXDK 1HNXK 4LF6K 4DR6K 2UU9K 5LMNK 2UUBK 5A2QO 4DV0K 2UUCK 3OTOK 2VQFK 1N36K 4LFAK 4JI1K 2F4VK 4JI3K 5LL6Z 4NXNK 4DR4K 2VQEK 4JI8K 1XNQK 4JYAK 4V19S 5FLXO 5IT9O 4JI4K 4DV2K 4B3RK 1IBLK 1HNWK 4K0KK 3T1YK 2E5LK 2UXCK 4B3MK 4DV1K 4GKKK 3J80O 4JI6K 4DR2K 1IBMK 4DUZK 4B3SK
chains in the Genus database with same CATH superfamily
2YKMA 5M1PA 3RMCA 1NM1A 5BN8A 4EP4A 2VWKA 1LAWA 4CF1A 1SZ2A 3EO3A 5HOOA 1NGEA 1MU2A 4DV7K 5F2RA 3O3GA 1BCOA 3PIOL 1TGOA 1KRPA 3MAQA 3VF2A 4KV8A 3VERA 1VQ8N 3IFRA 3CQYA 4ELVA 3ZSXA 4CHNA 3ZT1A 4FM0A 4O0JA 5CYQA 1WLJA 2GUIA 2QWPA 1BOTO 5KGWA 4BWMA 3FZMA 3LP1A 4JD2A 4N5SA 1J53A 4DKWA 5AQJA 2IAJA 3FR0A 1C0MA 2HNZA 4WQ5A 1QE1A 4CJFA 1RBVA 3FE1A 3RSEA 1BA1A 3N4QA 4UY8O 4JI2K 3HPOA 3BUZB 3WNEA 3HZ6A 2CGKA 2UXDK 3WQTA 2P9UB 1KXPA 1JLQA 2NRVA 1UWBA 1KVBA 2B4JA 2UUBK 1SS6A 4W5RA 3QBWA 3OYBA 1DGKN 3O80A 4N47A 2DTUA 4L8RB 4FL9A 3Q7CA 3K5LA 3I33A 5AQUA 3NH1A 3H08A 1QS4A 1ESVA 4NCBA 3KIOA 4DF8A 2GEMA 4JKGB 5CZ2A 4JYAK 2E2OA 3ISNC 5IT9O 1FK9A 4FPAA 4AILC 3O9QA 1WBBA 1BIZA 4OVLA 4G9ZA 4E7HA 1RT4A 4HUGA 4M3TA 3WXIA 1WBDA 1WOQA 4LD0A 3OYAA 3I0SA 4DFPA 2BANA 4GKKK 3VQ4A 1T6CA 3CM5A 2BTFA 4A2BA 5HRNA 5M1NA 3JYTA 1XC3A 4FPBA 4CJQA 2KZMA 1ZYQA 2KLAA 4DSJA 5AQXA 4BR4A 5CY4A 2F9WA 3CCSN 1DT9A 4E1JA 3NDKA 5AQKA 1LWEA 5AQSA 3OYLA 4DR1K 3CIPA 2B5JA 2FBVA 2Q97A 3G10A 4FM2A 1D8YA 4F9OA 3K57A 3LZJA 4DQ8A 2Q0UA 1JKHA 4B1WB 5GIPA 3JXUA 3K9JA 4CZFA 5FRMA 4A5BA 2FBYA 4OGCA 2NRWA 2XY6A 3F73A 2X6SA 4I9LA 3KVGA 5KTQA 1YT3A 4DV6K 1ZBSA 5HROA 3CMAN 1VQNN 3DOLA 1BUPA 4JLHA 3NCIA 1KD1O 1NGHA 3QB0A 4BRPA 2Q3SA 4R79A 4ISEA 3DXKA 4BR5A 1Q8IA 1OVYA 3AGRA 5KRTA 2W40A 3A2FA 4B1VA 3LM9A 1XHXA 3UKUB 2E6MA 4IFVA 4FJKA 3TSUA 4AHTA 4FZYA 4AHUA 2V7ZA 3CETA 2NRTA 2P9LB 2IIRA 2ASMA 3QEPA 1SQKA 1A5VA 1VSHA 1A5XA 1S1UA 3K9KA 4H8KA 2F7TA 1Q18A 1S6QA 3EEQA 3SAGA 4IWVA 3O3FA 2P9NA 4ID5A 3A5NC 3S3NA 3FZFA 3FFKB 3TTDA 3VOVA 4CGFA 4IOCL 3S9HA 3SPZA 5CZ1A 4I9QA 1I39A 1ZXOA 3OS2A 3VQQA 1VSEA 2FBTA 5MLCQ 4I6MB 3AVFA 1SL0A 2ZM6K 1D4XA 3ATVA 3VQAA 5BPNA 2A5XA 4FWRA 2WTUA 3CJ9A 5J2QA 4WE1A 1X1PA 1RTIA 3S3MA 2QW9A 4FLTA 1N5YA 1XC9A 4ZHRA 5JVGL 5DK5A 2QWNA 2ZQBA 1J5EK 3LAKA 3NMUA 3HT3A 4FYDA 2O4GA 1K8KA 1NGFA 4JK7A 1BHLA 3DRPA 4W5TA 2G8HA 3HP6A 5FPNA 3ZSOA 1NGIA 1ZBHA 3HO1A 1Q9YA 3KLFA 3VEXA 3SK3A 4AF1A 3IRXA 2O4IA 2W41A 2CGLA 3VEYA 3HRGA 1FXXA 3ZT3A 3T19A 4CEAA 3E9OA 3VA0A 4M41A 1QQNA 4BC3A 1HPMA 2RE2A 4H0PA 2P9SB 1I94K 1NK5A 1ASWA 1RDAA 2BH1A 3O3HA 1LWCA 3P38A 4JRPA 1G15A 4CBWA 1L3UA 3OYGA 3THXB 4DR6K 2D0BA 2ITMA 3AARA 4FJNA 3HVRA 3DM2A 3IAYA 3OTOK 3ZSZA 1HQEA 4K8ZA 3ULDA 4BGBA 4B08A 5C0YA 1UOCA 3V9SA 2ASOA 3AO4A 1IO2A 1LW2A 4MO5A 1JLFA 3PX6A 4BC5A 3FZLA 4WYBA 3HP9A 3AVAA 5AFUA 2FSNA 3F9KA 4HCCA 1S1TA 4CF9A 1RT5A 4CJRA 1U2VA 4FWPA 1S22A 1K8AO 3J7ZO 4B9MA 1E4FT 4DTOA 2EX3A 3H6EA 3SCXA 2WC9A 5HLFA 1ASVA 1Q9XA 4PKIA 2A6AA 3V9XA 1UAXA 3SQ4A 4OKEA 4FJJA 1BQMA 5H1SQ 4W5QA 2HHSA 4FWMA 4XIUA 4I2PA 4DTRA 3NF8A 5JLFA 4TSXA 3EN9A 3BZCA 2OA8A 1J9AA 1NGCA 5BR8K 1ZBIA 4FLUA 3J7YP 3AAPA 1VSFA 4CJEA 3OW2M 4O4GA 4JKBA 3EKUA 4N56A 4JI0K 2QKBA 4RW8A 4DB3A 4KHYA 4YOUA 3MN9A 1TAQA 4BR2A 4E7KA 4C8LA 2YNHA 2GX9A 4LFCK 1OH5A 2D0OA 5E26A 3RSEB 3C6UA 3AVJA 4R5PA 4FK2A 3LALA 1RTJA 4DSLA 3ZETB 2UU9K 1NGGA 2D4WA 3DLLL 3C7NA 2E1YA 3JS6A 2OTJN 3RMAA 3VQDA 2HBKA 2VQFK 3MECA 4FJ7A 3UKUA 4QS9A 4O55A 1NMNA 4B1UB 4GMJB 2YHAA 3ZX3A 3IG1A 3NGIA 1GLAG 1Z25A 3OA9A 3SAHA 3U4LA 1K73O 5C25A 2BDPA 3K58A 1NGBA 1NK6A 3P31A 4CJ4A 4B3RK 2NUBA 3HPHA 1S1WA 1B9DA 3O4QA 4CZKA 4DSKA 1WB9A 5C42A 4IDKA 4OPAA 3QO9A 2FF3B 3NF7A 1NK0A 1VQ6N 3QLHA 2XO7A 3D0PA 3PO5A 1BL3A 3M5RA 1R0AA 3CC7N 4KHSA 3P1GA 2J4RA 5AQOA 3VTHA 1K8KB 3HM8A 2OZMA 2G8IA 3IUCA 1RTDA 2P5OA 5FPMA 4EHTA 4B3OA 1D9FA 4IKFA 4F2RA 3L0QA 1JL2A 3DLKA 1FKPA 1RT7A 1TL3A 4RW9A 2PFUA 1XWLA 1VSDA 3G4SN 2JLEA 1YVNA 2KW4A 4CJTA 1T44A 2Q1NA 3NGYA 4EFHA 1WSEA 5E41A 4M3UA 4RG8A 3DJCA 3VEWA 1L3VA 3ZSVA 2R7YA 3VEVA 4OPJA 3WUHA 4KTZA 3I55N 5JS1A 3THXA 4JAXA 3D6RA 3CMEN 4DV3K 3BF3A 5AQWA 1RDWX 4HHTA 3IS9A 4CFAA 3V1RA 5M1KA 4DTUA 1NOZA 3ZEUB 2P9IB 4I7FA 1T6DA 1WSFA 4E1NA 1X9SA 4BVPA 4YDUA 1BO5O 3O9RA 3CCQN 3AVBA 2FC0A 5AQTA 2XY7A 2P9SA 2VGNA 4Q0BA 3IMXA 2IVNA 4FO0A 3O1WA 4BC2A 4F3OA 1BI4B 4RTFD 2VGMA 3OYDA 3T7ZA 3MMVA 5I3UA 4DTSA 3KLIA 3MX5A 3NF6A 5C2DA 4EHUA 2VWJA 1U45A 5C2FA 3OYMA 4O5BA 3QNNA 3RRHA 3OYEA 4DFMA 1V4SA 1BQNA 3PLAA 4G1QA 2ITGA 4Q5VA 3VQ7A 1HNVA 1E4GT 5C12A 4DV1K 1HRHA 2NZTA 1JLBA 3S3OA 4CBXA 3CJCA 1ATSA 1SL2A 2AP1A 4Y0WA 4WCEL 1EX4A 4YOWA 1TUUA 2ZE2A 4DS4A 1RT3A 4CF8A 3TPQA 3AVCA 1VQ9N 3MCAB 4CGDA 1BDGA 3TU5A 1GLFO 1WSIA 2YNGA 1N32K 4BRQA 2AJQA 2E6LA 3ZSRA 4JKAA 4CK1A 3I8DA 3QNOA 1IKYA 3LPUA 1SKSA 4PKHA 1U6ZA 3DWLA 4X62K 4NCGA 4JI5K 4CK2A 1S1XA 1O13A 2O8EA 1WSGA 4E7JA 4IOAL 3KKSA 3SV3A 5AR0A 2ZJRL 1BU6O 1Z6RA 5BRHA 1ATRA 4K25A 2H3GX 4CECA 3BF1A 4CEEA 1ZC6A 2HB5A 1YTUA 2IS3A 1KAYA 4NLCA 3QEVA 5AQIA 3T1HK 3MEDA 4WQ4A 2XY5A 4HCBA 2FSJA 1Q81O 3ZX0A 3L2VA 5GAGP 5HBMA 3M8QA 4BRKA 3PIPL 3L8BA 3H3OB 2E2NA 1W2BM 3TI0A 3LDSA 1B9FA 3J8AA 3F9MA 5CR4A 3CCMN 2XY8A 1NGDA 4LC9B 2IGIA 2QK9A 4FWNA 3M8SA 4HVJA 2A3ZA 4CCHA 4BRAA 3OS0A 2HHTA 4IO9L 1N36K 3AO1A 4B1XB 3SUQA 4ISGA 1C1AA 4CJWA 3EY1A 5AZJA 3TR8A 1Q7YO 4KAZA 1QQCA 4IBNA 4JS4A 3ENOA 5KPTA 1R59O 1JL1A 4KB1A 3QEXA 1RILA 1W9HA 4CIEA 2HHQA 3WNHA 4OLAA 1NWKA 3ZLJA 4DTXA 3V1QA 2OPSA 1OVQA 4BR0A 4PUOA 4CZJA 1JCGA 2YI1A 3VGMA 1FKOA 5CE3A 3RRGA 2KTQA 2BUPA 3HOTA 4CF2A 3NE6A 2YNIA 3TANA 2E2PA 1JXEA 3T3FA 4NYFA 5DM7L 4IZ9A 1L5UA 4DG1A 4OKJA 4HTUA 1YI2N 1W7AA 1OKJA 1TKTA 4B9QA 1P90A 5JVHL 3TAPA 5KRSA 1G99A 3MN7A 1U2VB 3A5LC 3R9PA 3R3LA 4CIFA 2PY5A 4AH9A 2QWOA 3DMJA 1RDBA 4BREA 3SI6A 2G8VA 1X9JA 1CXUA 4C8MA 2OPQA 1EKEA 2IC3A 3B6OA 3SMSA 4M63C 4CK3A 3TWHA 5LMUK 4CEBA 1EQYA 2HW3A 4Z4IA 4MDAA 1YVUA 4CESA 3OJSA 4ZTJA 2P9NB 4LF9K 4CZGA 1VQLN 1GLLO 1FJGK 5TKYA 5J1EA 3SJHA 3O6WA 2OPPA 4H0OA 2VWBA 1TK0A 1S9GA 4JK9A 4FOIA 4FWQA 4A62A 4CGHA 4BDZA 3WNFA 4AHCA 1VHXA 4KTWA 3P4IA 2HMPA 3SUNA 4I6MA 4O0IA 4B9SA 4DLGA 2KQ2A 1P8ZA 1IG8A 3CD6N 4H5NA 3QICA 2YV0X 3EE9A 3DLBA 3DOKA 1VQ7N 2P9KB 3DRSA 4E19A 4BDYA 4CD1A 3OYJA 2V52B 1GLBG 4C1NK 4DTPA 1HUXA 3DLHA 1QQMA 4WQ4C 2AA4A 3BDPA 3RTVA 2G8UA 2O8BB 3KLGA 2ZJPL 4DV0K 3KTQA 4WFBL 3C65A 3U3GA 3CCUN 4U67L 1HPZA 3UKRB 1QSLA 1LCUA 3CPWM 1WUAA 3B6PA 1TYQB 5FLXO 4JI4K 3TAGA 4H5VA 1D5AA 2O8CB 4DFJA 5M1FA 4B3MK 3D2FB 5KPZA 3TTFA 2ETJA 5BPLA 1S3XA 1VSLA 5JS2A 4Y1CA 4FSVA 3HPGA 4FVMA 3RWUA 4FLZA 4DQPA 3U9DA 5SZTA 4FLYA 4DFKA 3DXMA 5AQQA 4B3TK 5GADP 1HX1A 3U8XA 4IXCA 2WONA 2YHWA 4CFDA 4YHHK 2P9KA 4K8XA 1RFQA 3L4QA 2G8FA 1EETA 2G8KA 1NJXA 2UXBK 2GWJA 4E7IA 3MXIA 3E01A 2WBNA 3JAMO 1YUWA 1E3MA 2ZGZA 4AHSA 2E4LA 2Y1JA 3MEEA 2E8AA 2VCPA 2Z1HA 5J2NA 3P5JA 5BPMA 5M1OA 4H5WA 4K41A 3OY9A 3THYA 2E20A 3PSIA 1LAVA 3SBTA 4H5TA 3O8MA 3O4NA 3R1XA 4IEIA 2GV9A 3GOIA 2QWMA 3NVMA 1KTQA 1RCHA 4JD2B 3W0LA 1H1VA 2JWKA 3ID8A 2CH5A 5EY4A 4BE1A 3L6QA 3K59A 4DR3K 4JHDA 3BY5A 4KTQA 2HNYA 4CZHA 4FVUA 2HHHK 3NAEA 3O5BA 1TV6A 3K0SA 4E1MA 3UIQA 1S9EA 2RHKA 5EOYA 5FPDA 2P9LA 3M8PA 3V9WA 3QMLA 4IJAA 3AVHA 2P9IA 1HYZA 4BROA 1JCFA 4HTLA 3K2PA 2NRXA 1BA0A 1O1WA 3OYCA 1JLAA 1KQSM 3VMFB 1HKCA 2G8WA 4O44A 4XH5A 1RDCA 3CF5L 4BRFA 3VQPA 4DF4A 3VGKA 3KK1A 1U49A 2EHGA 1RDUA 1DLOA 2YX6A 1S1VA 3C94A 3L2RA 5HP1A 5AZIA 3VF4A 2Z1IA 4FW1A 1F21A 3BGRA 3LDNA 4KO0A 3QDKA 2UXCK 1Z26A 1TK8A 3THYB 1IBMK 2NRZA 4CJLA 1UA1A 4YORA 5FRNA 4JKEA 4FJXA 4BRIA 3MCPA 4IFEA 4ICLA 3GG4A 2Q0RA 4IG3A 2O8EB 3FZKA 4LF5K 3K5MA 1V4TA 3G71N 3ZT4A 3DLGA 3QEIA 3VETA 2X6NA 3NH2A 5AZIB 4CHPA 3NF9A 4NXMK 3KZBA 4O5FA 4J8FA 2I7PA 4DQIA 3H3NO 4C8OA 3SQ0A 1ATNA 5I9EB 3HSCA 3PX4A 3I56N 3HBTA 3TSPA 3CQ8A 3OYHA 3G25A 4OX9K 4QOZB 1IKXA 4H4MA 4KBOA 2CH6A 4FJ8A 2OTLN 2VG7A 5EXWA 4DU1A 3G0ZA 1VRUA 4XEIA 3MK6A 4AM7A 5BREA 2IDOA 4ILGB 4BG8A 1XMOK 1RGIA 1HNZK 4XH1A 1IV0A 1IKVA 3QETA 4NYNA 1QSYA 2P5GA 3QESA 4O8UA 4BQLA 4B8AB 3SBGA 4YFUA 4B9TA 1HJOA 3C0BA 4DQQA 4ZTFA 4DSFA 2QXLA 3A8YA 5J2PA 2QTDA 3KWIA 4JI1K 4LFAK 4CZEA 3GL1A 1U4BA 3M1FA 1T8EA 1C6VA 1T7PA 4Z94A 4JKHA 1T03A 2VG5A 4PL7A 4MLHA 3VGLA 2DPNA 4H0VB 4M7XA 4JEPA 1XUPO 2X74A 5AQHA 3OYKA 3DAWA 3ZETA 3MN5A 3E9PA 3AA2A 1NLVA 4PL8A 2ZJQL 5HRSA 1VQMN 4FJ5A 3PY8A 1CXQA 3DXMB 4CJSA 4BGAA 1NK7A 4CI6A 2IVOA 4Z0UA 3E1YA 1ZBFA 2D1KA 4JI6K 4KHWA 4GW6A 4FWOA 4OO1J 3WEEA 2XRIA 3CXCM 3AA5X 4M3XA 3GE1A 3NBPA 4CF0A 3AO2A 3MDQA 3EL2A 1XNRK 2P51A 4WFAL 2DY4A 3P83D 3H1VX 3NGZA 1TUYA 1X9WA 4FWKA 4Z4FA 1KFSA 1DEJA 3QINA 1BWFO 4FJ9A 1HYVA 4FM1A 4LY7A 5CHIA 3MX2A 1EWRA 4QS7A 3AGKA 2HVIA 4BRNA 3TAMA 1NJIO 1HKBA 2FXUA 4N41A 1U04A 3FGUA 2XHBA 2OPRA 3J7AP 1IH7A 4DMNA 3LWLA 2HBLA 4OGEA 4Z4GA 3THWA 1TL1A 2IVPA 4BDPA 3KLHA 4C8NA 4LF8K 4EZ9A 1C0UA 3AVIA 2JGUA 3HYFA 3OYNA 5F0XA 3QIPA 4FJIA 4YY3K 3ATUA 3A5OC 4GNIA 4PY5A 3ENHA 4LF6K 2D5RA 2WOMA 2D0PA 4EAHD 3V6DA 4JHDB 3V9UA 4CHOA 4W5NA 4NLBA 2ZWHA 4KHQA 1VSJA 3WEEB 3AY9A 4C1NI 1NKCA 2KFNA 3SQ1A 2Q36A 3LDOA 2LSNA 3RVCA 2OANA 3AVLA 3UB5A 4PHTX 2HF4A 3EZ5A 1L3TA 4JI3K 1BISA 3B8AX 2HF3A 3AVNA 1WAFA 3O08A 3A5MC 2WFBA 3L4IA 4B9VA 4M3WA 1JXBA 1KFDA 3S41A 4Z4HA 3F5TA 3NVKA 5JICA 1LWFA 5TKWA 3QERA 4XH4A 3SLCA 3CCJN 4J2DA 2P9PA 4QCLA 3ENBA 3SMPA 2E1ZA 3SV4A 4JS5A 4CHQA 1GOAA 5EU7A 3PX0A 1TK5A 3LAMA 1K6YA 4CJ7A 3RMBA 3U3YA 1XHZA 3HL8A 4EIAA 1EO1A 2VYPA 3FZHA 5AZJB 4FZXC 1NNEA 1KVAA 4JKFA 4H5RA 3CG7A 2HBJA 3L3UA 3W3DA 5ADXA 5ADXH 1HMVA 1S5JA 2BE2A 2UUAK 1NK8A 2QWLA 4Y1DA 3WQUA 4KKOA 4BRMA 4CJVA 3QFUA 3L2WA 3HOSA 3J81O 5IWAK 1HYSA 1KVCA 1DTQA 1T05A 4YDUC 3CJAA 5AQLA 3CC4N 1IG9A 1N33K 4QS8A 3KKRA 1XI1A 5DMRA 3AA4A 3LZIA 3CFPA 3ULEB 4BR7A 3HJFA 4CJ5A 3ZSQA 2HBMA 1KAXA 2IOCA 1HNIA 1U47A 2A40A 1HLUA 3WXJA 4BC4A 3C6AA 1J54A 3V81A 1GLDG 3VQBA 4CJKA 2B6AA 3VN5A 5A2QO 3AO3A 3LDLA 5HRPA 1EXQA 4FK0A 3LANA 3VQ8A 3CC2N 3THVA 3VENA 5BRFA 1WNSA 3HM9A 2YHXA 3C95A 4FLWA 3SUPA 4KH4A 3OS1A 3OJUA 4CERA 4BRCA 5LL6Z 1EWQA 4B8CA 1QTMA 4CHYA 3TARA 3LM2A 2VQEK 3CPEA 1M1KO 4CZIA 4PWDA 1S6PA 3FFIA 3KWGA 3UE5A 1VQ4N 3LPTA 3MXJA 1S72N 4F4KA 4JK8A 1JLEA 2X78A 5AQRA 3VQ9A 2RKIA 1VQKN 1Q86O 3M8RA 3DRRA 3OVNA 4BRLA 3DYAA 3KHYA 1XQSC 1NGAA 4WF9L 2HHVA 4BE0A 1J6ZA 2O8FB 4JI7K 2BGGA 1NKEA 4GV6A 4YOTA 5AQVA 3HK2A 3O9UA 3WT0A 5AQNA 4AM6A 3E9LA 2QA4N 4O8KA 1BG3A 5KGXA 4F3TA 4M45A 2O8CA 2DFFA 4PQUA 4BACA 2O8BA 4MLEA 3VQEA 1GOCA 1K9MO 3D2FA 2HOEA 5AJ3K 4JKGA 1WSHA 1NJWA 2CGJA 4CW7B 4WFNL 1NU0A 4DR5K 4H0XB 3VEOA 4X66K 1QQOA 4ELTA 1TAUA 3TAFA 4GKJK 1MDUB 3LDQA 3CJ1A 1B92A 1LW0A 2HSTA 1VRTA 3SAFA 4MDBA 1QHTA 1OH7A 3PSFA 2QI2A 3TAQA 4LFBK 1FW6A 4BVOA 1VSMA 2ZGYA 1W97L 2DFHA 5ELZA 4IOXA 1ZBUA 3D7EO 4CZLA 3KLEA 1N6QA 2V51B 1RBUA 1KAZA 5BN9A 3CFRA 2HVHA 3ID6A 3T69A 2ZD1A 5AFUH 3ZT0A 3DXKB 1RBRA 5DM6L 2QXFA 3ASMA 4KHNA 3VF6A 1BI4A 2FLOA 2DFEA 4NXNK 2F8SA 3AVKA 4OPKA 3KK7A 4FWSA 3WNGA 4DCHA 4LH4A 1NKBA 2W6LA 3MN6A 4IG0A 4CD3A 1DKGD 1I3AA 3ZCMA 3QEWA 1IBLK 4ELUA 4KB0A 4QAGA 3H1QA 4FK4A 3SNNA 2F8TA 4M42A 1REVA 3CCRN 4RW4A 3J80O 4BG9A 3DI6A 4A2AA 4FLVA 3OBWA 1RTHA 3HVTA 3D2EA 5AQMA 3OBYA 1KCFA 2P9PB 3OYFA 1C1BA 2KZZA 3SZ2A 3H45C 4A57A 3SYZA 5JMVA 4IEEA 5GINA 4CVNE 3CJBA 4FCYA 1YXQA 3MWPA 4CGIA 4E3SA 4H0TB 5FPEA 4JKDA 1U48A 4RW6A 4DTNA 3CCEN 4K43A 2QWQA 3CHWA 4B1YB 2KFZA 1YTAA 4CJUA 4DV4K 2GBZA 1YF5L 4NO7A 4CFCA 1TKZA 4CZMA 1N8RO 3AVMA 2HHXA 3MXMA 1WAJA 4FJHA 3ZSYA 1QSSA 3PV8A 2WUSA 1N34K 2YHBA 3IKMA 4BY9C 4BRHA 1GLEG 4L3QA 4E7LA 5BRDA 4IJNA 3KJVA 2Y1IA 1MWKA 1X3NA 4X64K 1NOYA 2GELA 4FJLA 1X9MA 4YOYA 2ZF5O 4FWLA 1GOBA 2GUPA 4LSNA 5JLHA 1C0TA 4EZ6A 3BZKA 1JLCA 2FBXA 3KD1E 4IDHA 5LMNK 4M3YA 2W6KA 3O1BA 4CEFA 4FOEA 3IDHA 1ZBLA 1JLGA 3ZT2A 5FDLA 4RWTA 3KD5E 3V9ZA 1VK0A 4YOVA 4JI8K 3E66A 2YCHA 3CERA 4ISFA 4V19S 3OHRA 4H0YB 3SJJA 2I5JA 1Y97A 2D0CA 1HNWK 5AQGA 3LDPA 3TTCA 3OYIA 3T1YK 3CFOA 4BRGA 3O4WA 4DSEA 1NJYA 5D3GA 1TVRA 2QWRA 1GLJO 5HRRA 3CJ7A 5CYMA 4BRDA 1NK9A 4ILJA 3CCLN 3L2UA 3SUOA 1RT2A 3VESA 4DR2K 2A41A 1RDDA 4BE2A 2I7NA 4U7BA 4FW2A 1VQON 4B3SK 3EZWA 2F96A 2YKNA 3TSQA 1KLNA 4KPYA 4LF4K 4X65K 4M3ZA 1IBKK 3HXMA 3CI5A 5C10A 5F1XA 1CZAN 4KI6A 4HUEA 4KH5A 4B9LA 3ULEA 4J2EA 4KRFA 2QM1A 4CHZA 4GVEA 1VSKA 3C6HA 3KK3A 1NJZA 2YHYA 3ZYYX 1RBTA 2PAVA 1SAZA 4CEQA 3ZSWA 2PBDA 4J2AA 4LF7K 2Q2RA 3MWTA 3F2KA 1MWMA 4BR9A 2D0AA 3A0IX 4KH6A 3PUFA 4PKGA 1UA0A 1BCMA 1YJWN 1NGJA 4DSIA 2Z1GA 1M90O 4JN4A 2P9UA 2HHWA 1C0GA 3ALYA 2RF2A 3Q7BA 1HNXK 4DTMA 1Y64A 2OCEA 5LJWA 1VQPN 1CZ9A 4CFBA 4JRQA 3R6MA 5GAHP 1TYQA 1KSPA 2UUCK 3K5NA 1OH8A 3U9ZA 1JJ2M 2ASPA 4CBUA 3WXMB 5KQDA 3QIOA 1NK4A 1OH6A 3RR7A 4RW7A 3C6TA 5K14A 1X3MA 3ZEUA 2FSKA 3I0RA 4DU3A 4FZZA 3SQ2A 3HSTB 1GLCG 4CEZA 5KPRA 4DTJA 3L2QA 3AO5A 4CGGA 4EP5A 4DV2K 3QBXA 5J2MA 4KI4A 1J5OA 5GIOA 2OYQA 2YJEA 2F9TA 4I2QA 2E5LK 5T7BA 4OPHA 5AQPA 3VA3A 5I42A 3JSMA 1Q82O 1CLQA 1ASUA 2GTDA 3P39A 3THWB 2NRRA 3LL3A 1WSJA 4DR7K 2YNFA 5KI6A 3GDQA 3HI0A 1YJ9N 4DUYK 3V1OA 4LSLA 4B1ZA 2Q31A 4N76A 2RN2A 4E89A 1TKDA 4HWIA 4FLXA 2KHOA 4W5OA 4DV5K 4LH5A 4BQZA 1QHAA 5AQFA 3CCVN 4NCAA 3WXLA 4H03B 3T1AA 4MO4A 4KFBA 1SKWA 1C1CA 3HTVA 4MFBA 1CZBA 1YITN 4DQSA 4GY2B 5AQYA 4IFYA 1W0HA 1Z05A 2E2QA 1TKXA 4CIGA 4A5AA 4B9UA 4GV9A 4KHPK 2NNWA 3CQXA 3UKRA 1LOTB 2P1JA 1KLMA 1QVGM 4F8RA 3D45A 4DWIA 3AV9A 2QEXN 3V4IA 1NMDA 2OZSA 3L3VA 3H46O 1QZ6A 4Z4EA 2A42A 4AHRA 1SL1A 1D9DA 2W42A 5GAEP 4M3RA 4Z4CA 3PO4A 4FJGA 5EVZA 2FF6A 1HQUA 4B9NA 2HHUA 3ZX2A 1MA9B 2PZSA 3VTIA 2VG6A 5B8HA 1SUQA 4YNQA 3VQCA 4F2SA 3VPZA 1YIJN 3CYMA 4CJ3A 1BIUA 1L3SA 1IJJA 4CEOA 1RBSA 4CE9A 3WXKA 3NHGA 4K0KK 4JNEA 1JCEA 1YAGA 1QZ5A 5E84A 3QFPA 4NB4A 4CEDA 1HKGA 1ITGA 1SKRA 2PYLA 4A61A 4CJPA 3AA3A 3ITHA 3M3ZA 4DUZK 4ILHA 4DLEA 5C24A 2Z1JA 1SV5A 3RMDA 4IO8A 4KREA 3O9SA 4FJMA 3RR8A 3D2EB 1A5WA 4AQYK 3VEZA 3EE8A 1HJRA 1T3VA 2JWLA 4RCHA 1IKWA 1YJNN 2HMIA 3AAQA 2GWKA 3EKSA 4OKKA 4J2BA 5KQ8A 4PA1A 1XMQK 4GVMA 3M6GA 2A1SA 4K42A 4KHUA 1EP4A 1BGXT 4BWJA 3DLEA 3TAEA 1ILYA 5FROA 4WQ5C 3VQ6A 3C7NB 4MQ3A 4M7YA 2O8FA 5M1QA 4C8KA 5BR9A 3LWMA 3SPYA 1HR0K 4DS5A 4DQRA 4HUFA 4JV5K 1RT6A 4YOXA 3K5OA 4OJRA 2ATQA 3U6FA 1WN7A 2UYTA 4ID1A 5SWMA 3N4PA 2HNDA 3AVGA 3EYZA 5LY3A 4H4OA 4C23A 3O9TA 3LP3A 3BP8A 4DHYA 1QVFM 2PYJA 5EX5A 3NFAA 1C0FA 2KKZA 4E0DA 1LV5A 1RT1A 1YHQN 3KK2A 2O8DA 1NBWA 1VAZA 4AHVA 4OLBA 2F4VK 5C15A 3CM6A 2YJFA 3LP2A 3I8BA 1RNHA 2V7YA 3DLRA 3BEXA 4DR4K 2NRHA 1DTTA 4GV3A 2EWSA 5LJVA 4JKCA 1XNQK 3GBTA 2E88A 3LP0A 5AQZA 1VQ5N 3MEGA 3NH0A 2RPIA 4DU4A 5HL7L 1NG9A 4A59A 1KC8O 3VQ5A 4FXDA 2NLXA 1VSIA 4UQGA 3R8EA 4CGJA 3TABA 2A1RA 3G6EN 3FLCO 2O8DB 2QKKA
chains in the Genus database with same CATH topology
4DR7K 4JI7K 4DUYK 4LF4K 2ZM6K 4X65K 4B3TK 1N32K 1IBKK 4LF5K 4DV7K 5LMUK 4AQYK 4YHHK 1XNRK 4CVNE 2UXBK 4DV5K 4NXMK 3JAMO 4DR1K 2UUAK 4LF9K 5AJ3K 1FJGK 1J5EK 3J81O 4X62K 5IWAK 1XMQK 4JI5K 5BR8K 4OX9K 4DV4K 4CW7B 3J7YP 4DR5K 1N33K 4LF7K 4X66K 4GKJK 3J7AP 1N34K 4JI0K 1HR0K 4KHPK 4DV6K 4JV5K 4LF8K 4DR3K 4DV3K 4X64K 1XMOK 3T1HK 1HNZK 4LFCK 2HHHK 4LFBK 4JI2K 4YY3K 1I94K 2UXDK 1HNXK 4LF6K 4DR6K 2UU9K 5LMNK 2UUBK 5A2QO 4DV0K 2UUCK 3OTOK 2VQFK 1N36K 4LFAK 4JI1K 2F4VK 4JI3K 5LL6Z 4NXNK 4DR4K 2VQEK 4JI8K 1XNQK 4JYAK 4V19S 5FLXO 5IT9O 4JI4K 4DV2K 4B3RK 1IBLK 1HNWK 4K0KK 3T1YK 2E5LK 2UXCK 4B3MK 4DV1K 4GKKK 3J80O 4JI6K 4DR2K 1IBMK 4DUZK 4B3SK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 K;  4JI7 K;  4DUY K;  4LF4 K;  2ZM6 K;  4X65 K;  4B3T K;  1N32 K;  1IBK K;  4LF5 K;  4DV7 K;  5LMU K;  4AQY K;  4YHH K;  1XNR K;  4CVN E;  2UXB K;  4DV5 K;  4NXM K;  3JAM O;  4DR1 K;  2UUA K;  4LF9 K;  5AJ3 K;  1FJG K;  1J5E K;  3J81 O;  4X62 K;  5IWA K;  1XMQ K;  4JI5 K;  5BR8 K;  4OX9 K;  4DV4 K;  4CW7 B;  3J7Y P;  4DR5 K;  1N33 K;  4LF7 K;  4X66 K;  4GKJ K;  3J7A P;  1N34 K;  4JI0 K;  1HR0 K;  4KHP K;  4DV6 K;  4JV5 K;  4LF8 K;  4DR3 K;  4DV3 K;  4X64 K;  1XMO K;  3T1H K;  1HNZ K;  4LFC K;  2HHH K;  4LFB K;  4JI2 K;  4YY3 K;  1I94 K;  2UXD K;  1HNX K;  4LF6 K;  4DR6 K;  2UU9 K;  5LMN K;  2UUB K;  5A2Q O;  4DV0 K;  2UUC K;  3OTO K;  2VQF K;  1N36 K;  4LFA K;  4JI1 K;  2F4V K;  4JI3 K;  5LL6 Z;  4NXN K;  4DR4 K;  2VQE K;  4JI8 K;  1XNQ K;  4JYA K;  4V19 S;  5FLX O;  5IT9 O;  4JI4 K;  4DV2 K;  4B3R K;  1IBL K;  1HNW K;  4K0K K;  3T1Y K;  2E5L K;  2UXC K;  4B3M K;  4DV1 K;  4GKK K;  3J80 O;  4JI6 K;  4DR2 K;  1IBM K;  4DUZ K;  4B3S K; 
#chains in the Genus database with same CATH topology
 2YKM A;  5M1P A;  3RMC A;  1NM1 A;  5BN8 A;  4EP4 A;  2VWK A;  1LAW A;  4CF1 A;  1SZ2 A;  3EO3 A;  5HOO A;  1NGE A;  1MU2 A;  4DV7 K;  5F2R A;  3O3G A;  1BCO A;  3PIO L;  1TGO A;  1KRP A;  3MAQ A;  3VF2 A;  4KV8 A;  3VER A;  1VQ8 N;  3IFR A;  3CQY A;  4ELV A;  3ZSX A;  4CHN A;  3ZT1 A;  4FM0 A;  4O0J A;  5CYQ A;  1WLJ A;  2GUI A;  2QWP A;  1BOT O;  5KGW A;  4BWM A;  3FZM A;  3LP1 A;  4JD2 A;  4N5S A;  1J53 A;  4DKW A;  5AQJ A;  2IAJ A;  3FR0 A;  1C0M A;  2HNZ A;  4WQ5 A;  1QE1 A;  4CJF A;  1RBV A;  3FE1 A;  3RSE A;  1BA1 A;  3N4Q A;  4UY8 O;  4JI2 K;  3HPO A;  3BUZ B;  3WNE A;  3HZ6 A;  2CGK A;  2UXD K;  3WQT A;  2P9U B;  1KXP A;  1JLQ A;  2NRV A;  1UWB A;  1KVB A;  2B4J A;  2UUB K;  1SS6 A;  4W5R A;  3QBW A;  3OYB A;  1DGK N;  3O80 A;  4N47 A;  2DTU A;  4L8R B;  4FL9 A;  3Q7C A;  3K5L A;  3I33 A;  5AQU A;  3NH1 A;  3H08 A;  1QS4 A;  1ESV A;  4NCB A;  3KIO A;  4DF8 A;  2GEM A;  4JKG B;  5CZ2 A;  4JYA K;  2E2O A;  3ISN C;  5IT9 O;  1FK9 A;  4FPA A;  4AIL C;  3O9Q A;  1WBB A;  1BIZ A;  4OVL A;  4G9Z A;  4E7H A;  1RT4 A;  4HUG A;  4M3T A;  3WXI A;  1WBD A;  1WOQ A;  4LD0 A;  3OYA A;  3I0S A;  4DFP A;  2BAN A;  4GKK K;  3VQ4 A;  1T6C A;  3CM5 A;  2BTF A;  4A2B A;  5HRN A;  5M1N A;  3JYT A;  1XC3 A;  4FPB A;  4CJQ A;  2KZM A;  1ZYQ A;  2KLA A;  4DSJ A;  5AQX A;  4BR4 A;  5CY4 A;  2F9W A;  3CCS N;  1DT9 A;  4E1J A;  3NDK A;  5AQK A;  1LWE A;  5AQS A;  3OYL A;  4DR1 K;  3CIP A;  2B5J A;  2FBV A;  2Q97 A;  3G10 A;  4FM2 A;  1D8Y A;  4F9O A;  3K57 A;  3LZJ A;  4DQ8 A;  2Q0U A;  1JKH A;  4B1W B;  5GIP A;  3JXU A;  3K9J A;  4CZF A;  5FRM A;  4A5B A;  2FBY A;  4OGC A;  2NRW A;  2XY6 A;  3F73 A;  2X6S A;  4I9L A;  3KVG A;  5KTQ A;  1YT3 A;  4DV6 K;  1ZBS A;  5HRO A;  3CMA N;  1VQN N;  3DOL A;  1BUP A;  4JLH A;  3NCI A;  1KD1 O;  1NGH A;  3QB0 A;  4BRP A;  2Q3S A;  4R79 A;  4ISE A;  3DXK A;  4BR5 A;  1Q8I A;  1OVY A;  3AGR A;  5KRT A;  2W40 A;  3A2F A;  4B1V A;  3LM9 A;  1XHX A;  3UKU B;  2E6M A;  4IFV A;  4FJK A;  3TSU A;  4AHT A;  4FZY A;  4AHU A;  2V7Z A;  3CET A;  2NRT A;  2P9L B;  2IIR A;  2ASM A;  3QEP A;  1SQK A;  1A5V A;  1VSH A;  1A5X A;  1S1U A;  3K9K A;  4H8K A;  2F7T A;  1Q18 A;  1S6Q A;  3EEQ A;  3SAG A;  4IWV A;  3O3F A;  2P9N A;  4ID5 A;  3A5N C;  3S3N A;  3FZF A;  3FFK B;  3TTD A;  3VOV A;  4CGF A;  4IOC L;  3S9H A;  3SPZ A;  5CZ1 A;  4I9Q A;  1I39 A;  1ZXO A;  3OS2 A;  3VQQ A;  1VSE A;  2FBT A;  5MLC Q;  4I6M B;  3AVF A;  1SL0 A;  2ZM6 K;  1D4X A;  3ATV A;  3VQA A;  5BPN A;  2A5X A;  4FWR A;  2WTU A;  3CJ9 A;  5J2Q A;  4WE1 A;  1X1P A;  1RTI A;  3S3M A;  2QW9 A;  4FLT A;  1N5Y A;  1XC9 A;  4ZHR A;  5JVG L;  5DK5 A;  2QWN A;  2ZQB A;  1J5E K;  3LAK A;  3NMU A;  3HT3 A;  4FYD A;  2O4G A;  1K8K A;  1NGF A;  4JK7 A;  1BHL A;  3DRP A;  4W5T A;  2G8H A;  3HP6 A;  5FPN A;  3ZSO A;  1NGI A;  1ZBH A;  3HO1 A;  1Q9Y A;  3KLF A;  3VEX A;  3SK3 A;  4AF1 A;  3IRX A;  2O4I A;  2W41 A;  2CGL A;  3VEY A;  3HRG A;  1FXX A;  3ZT3 A;  3T19 A;  4CEA A;  3E9O A;  3VA0 A;  4M41 A;  1QQN A;  4BC3 A;  1HPM A;  2RE2 A;  4H0P A;  2P9S B;  1I94 K;  1NK5 A;  1ASW A;  1RDA A;  2BH1 A;  3O3H A;  1LWC A;  3P38 A;  4JRP A;  1G15 A;  4CBW A;  1L3U A;  3OYG A;  3THX B;  4DR6 K;  2D0B A;  2ITM A;  3AAR A;  4FJN A;  3HVR A;  3DM2 A;  3IAY A;  3OTO K;  3ZSZ A;  1HQE A;  4K8Z A;  3ULD A;  4BGB A;  4B08 A;  5C0Y A;  1UOC A;  3V9S A;  2ASO A;  3AO4 A;  1IO2 A;  1LW2 A;  4MO5 A;  1JLF A;  3PX6 A;  4BC5 A;  3FZL A;  4WYB A;  3HP9 A;  3AVA A;  5AFU A;  2FSN A;  3F9K A;  4HCC A;  1S1T A;  4CF9 A;  1RT5 A;  4CJR A;  1U2V A;  4FWP A;  1S22 A;  1K8A O;  3J7Z O;  4B9M A;  1E4F T;  4DTO A;  2EX3 A;  3H6E A;  3SCX A;  2WC9 A;  5HLF A;  1ASV A;  1Q9X A;  4PKI A;  2A6A A;  3V9X A;  1UAX A;  3SQ4 A;  4OKE A;  4FJJ A;  1BQM A;  5H1S Q;  4W5Q A;  2HHS A;  4FWM A;  4XIU A;  4I2P A;  4DTR A;  3NF8 A;  5JLF A;  4TSX A;  3EN9 A;  3BZC A;  2OA8 A;  1J9A A;  1NGC A;  5BR8 K;  1ZBI A;  4FLU A;  3J7Y P;  3AAP A;  1VSF A;  4CJE A;  3OW2 M;  4O4G A;  4JKB A;  3EKU A;  4N56 A;  4JI0 K;  2QKB A;  4RW8 A;  4DB3 A;  4KHY A;  4YOU A;  3MN9 A;  1TAQ A;  4BR2 A;  4E7K A;  4C8L A;  2YNH A;  2GX9 A;  4LFC K;  1OH5 A;  2D0O A;  5E26 A;  3RSE B;  3C6U A;  3AVJ A;  4R5P A;  4FK2 A;  3LAL A;  1RTJ A;  4DSL A;  3ZET B;  2UU9 K;  1NGG A;  2D4W A;  3DLL L;  3C7N A;  2E1Y A;  3JS6 A;  2OTJ N;  3RMA A;  3VQD A;  2HBK A;  2VQF K;  3MEC A;  4FJ7 A;  3UKU A;  4QS9 A;  4O55 A;  1NMN A;  4B1U B;  4GMJ B;  2YHA A;  3ZX3 A;  3IG1 A;  3NGI A;  1GLA G;  1Z25 A;  3OA9 A;  3SAH A;  3U4L A;  1K73 O;  5C25 A;  2BDP A;  3K58 A;  1NGB A;  1NK6 A;  3P31 A;  4CJ4 A;  4B3R K;  2NUB A;  3HPH A;  1S1W A;  1B9D A;  3O4Q A;  4CZK A;  4DSK A;  1WB9 A;  5C42 A;  4IDK A;  4OPA A;  3QO9 A;  2FF3 B;  3NF7 A;  1NK0 A;  1VQ6 N;  3QLH A;  2XO7 A;  3D0P A;  3PO5 A;  1BL3 A;  3M5R A;  1R0A A;  3CC7 N;  4KHS A;  3P1G A;  2J4R A;  5AQO A;  3VTH A;  1K8K B;  3HM8 A;  2OZM A;  2G8I A;  3IUC A;  1RTD A;  2P5O A;  5FPM A;  4EHT A;  4B3O A;  1D9F A;  4IKF A;  4F2R A;  3L0Q A;  1JL2 A;  3DLK A;  1FKP A;  1RT7 A;  1TL3 A;  4RW9 A;  2PFU A;  1XWL A;  1VSD A;  3G4S N;  2JLE A;  1YVN A;  2KW4 A;  4CJT A;  1T44 A;  2Q1N A;  3NGY A;  4EFH A;  1WSE A;  5E41 A;  4M3U A;  4RG8 A;  3DJC A;  3VEW A;  1L3V A;  3ZSV A;  2R7Y A;  3VEV A;  4OPJ A;  3WUH A;  4KTZ A;  3I55 N;  5JS1 A;  3THX A;  4JAX A;  3D6R A;  3CME N;  4DV3 K;  3BF3 A;  5AQW A;  1RDW X;  4HHT A;  3IS9 A;  4CFA A;  3V1R A;  5M1K A;  4DTU A;  1NOZ A;  3ZEU B;  2P9I B;  4I7F A;  1T6D A;  1WSF A;  4E1N A;  1X9S A;  4BVP A;  4YDU A;  1BO5 O;  3O9R A;  3CCQ N;  3AVB A;  2FC0 A;  5AQT A;  2XY7 A;  2P9S A;  2VGN A;  4Q0B A;  3IMX A;  2IVN A;  4FO0 A;  3O1W A;  4BC2 A;  4F3O A;  1BI4 B;  4RTF D;  2VGM A;  3OYD A;  3T7Z A;  3MMV A;  5I3U A;  4DTS A;  3KLI A;  3MX5 A;  3NF6 A;  5C2D A;  4EHU A;  2VWJ A;  1U45 A;  5C2F A;  3OYM A;  4O5B A;  3QNN A;  3RRH A;  3OYE A;  4DFM A;  1V4S A;  1BQN A;  3PLA A;  4G1Q A;  2ITG A;  4Q5V A;  3VQ7 A;  1HNV A;  1E4G T;  5C12 A;  4DV1 K;  1HRH A;  2NZT A;  1JLB A;  3S3O A;  4CBX A;  3CJC A;  1ATS A;  1SL2 A;  2AP1 A;  4Y0W A;  4WCE L;  1EX4 A;  4YOW A;  1TUU A;  2ZE2 A;  4DS4 A;  1RT3 A;  4CF8 A;  3TPQ A;  3AVC A;  1VQ9 N;  3MCA B;  4CGD A;  1BDG A;  3TU5 A;  1GLF O;  1WSI A;  2YNG A;  1N32 K;  4BRQ A;  2AJQ A;  2E6L A;  3ZSR A;  4JKA A;  4CK1 A;  3I8D A;  3QNO A;  1IKY A;  3LPU A;  1SKS A;  4PKH A;  1U6Z A;  3DWL A;  4X62 K;  4NCG A;  4JI5 K;  4CK2 A;  1S1X A;  1O13 A;  2O8E A;  1WSG A;  4E7J A;  4IOA L;  3KKS A;  3SV3 A;  5AR0 A;  2ZJR L;  1BU6 O;  1Z6R A;  5BRH A;  1ATR A;  4K25 A;  2H3G X;  4CEC A;  3BF1 A;  4CEE A;  1ZC6 A;  2HB5 A;  1YTU A;  2IS3 A;  1KAY A;  4NLC A;  3QEV A;  5AQI A;  3T1H K;  3MED A;  4WQ4 A;  2XY5 A;  4HCB A;  2FSJ A;  1Q81 O;  3ZX0 A;  3L2V A;  5GAG P;  5HBM A;  3M8Q A;  4BRK A;  3PIP L;  3L8B A;  3H3O B;  2E2N A;  1W2B M;  3TI0 A;  3LDS A;  1B9F A;  3J8A A;  3F9M A;  5CR4 A;  3CCM N;  2XY8 A;  1NGD A;  4LC9 B;  2IGI A;  2QK9 A;  4FWN A;  3M8S A;  4HVJ A;  2A3Z A;  4CCH A;  4BRA A;  3OS0 A;  2HHT A;  4IO9 L;  1N36 K;  3AO1 A;  4B1X B;  3SUQ A;  4ISG A;  1C1A A;  4CJW A;  3EY1 A;  5AZJ A;  3TR8 A;  1Q7Y O;  4KAZ A;  1QQC A;  4IBN A;  4JS4 A;  3ENO A;  5KPT A;  1R59 O;  1JL1 A;  4KB1 A;  3QEX A;  1RIL A;  1W9H A;  4CIE A;  2HHQ A;  3WNH A;  4OLA A;  1NWK A;  3ZLJ A;  4DTX A;  3V1Q A;  2OPS A;  1OVQ A;  4BR0 A;  4PUO A;  4CZJ A;  1JCG A;  2YI1 A;  3VGM A;  1FKO A;  5CE3 A;  3RRG A;  2KTQ A;  2BUP A;  3HOT A;  4CF2 A;  3NE6 A;  2YNI A;  3TAN A;  2E2P A;  1JXE A;  3T3F A;  4NYF A;  5DM7 L;  4IZ9 A;  1L5U A;  4DG1 A;  4OKJ A;  4HTU A;  1YI2 N;  1W7A A;  1OKJ A;  1TKT A;  4B9Q A;  1P90 A;  5JVH L;  3TAP A;  5KRS A;  1G99 A;  3MN7 A;  1U2V B;  3A5L C;  3R9P A;  3R3L A;  4CIF A;  2PY5 A;  4AH9 A;  2QWO A;  3DMJ A;  1RDB A;  4BRE A;  3SI6 A;  2G8V A;  1X9J A;  1CXU A;  4C8M A;  2OPQ A;  1EKE A;  2IC3 A;  3B6O A;  3SMS A;  4M63 C;  4CK3 A;  3TWH A;  5LMU K;  4CEB A;  1EQY A;  2HW3 A;  4Z4I A;  4MDA A;  1YVU A;  4CES A;  3OJS A;  4ZTJ A;  2P9N B;  4LF9 K;  4CZG A;  1VQL N;  1GLL O;  1FJG K;  5TKY A;  5J1E A;  3SJH A;  3O6W A;  2OPP A;  4H0O A;  2VWB A;  1TK0 A;  1S9G A;  4JK9 A;  4FOI A;  4FWQ A;  4A62 A;  4CGH A;  4BDZ A;  3WNF A;  4AHC A;  1VHX A;  4KTW A;  3P4I A;  2HMP A;  3SUN A;  4I6M A;  4O0I A;  4B9S A;  4DLG A;  2KQ2 A;  1P8Z A;  1IG8 A;  3CD6 N;  4H5N A;  3QIC A;  2YV0 X;  3EE9 A;  3DLB A;  3DOK A;  1VQ7 N;  2P9K B;  3DRS A;  4E19 A;  4BDY A;  4CD1 A;  3OYJ A;  2V52 B;  1GLB G;  4C1N K;  4DTP A;  1HUX A;  3DLH A;  1QQM A;  4WQ4 C;  2AA4 A;  3BDP A;  3RTV A;  2G8U A;  2O8B B;  3KLG A;  2ZJP L;  4DV0 K;  3KTQ A;  4WFB L;  3C65 A;  3U3G A;  3CCU N;  4U67 L;  1HPZ A;  3UKR B;  1QSL A;  1LCU A;  3CPW M;  1WUA A;  3B6P A;  1TYQ B;  5FLX O;  4JI4 K;  3TAG A;  4H5V A;  1D5A A;  2O8C B;  4DFJ A;  5M1F A;  4B3M K;  3D2F B;  5KPZ A;  3TTF A;  2ETJ A;  5BPL A;  1S3X A;  1VSL A;  5JS2 A;  4Y1C A;  4FSV A;  3HPG A;  4FVM A;  3RWU A;  4FLZ A;  4DQP A;  3U9D A;  5SZT A;  4FLY A;  4DFK A;  3DXM A;  5AQQ A;  4B3T K;  5GAD P;  1HX1 A;  3U8X A;  4IXC A;  2WON A;  2YHW A;  4CFD A;  4YHH K;  2P9K A;  4K8X A;  1RFQ A;  3L4Q A;  2G8F A;  1EET A;  2G8K A;  1NJX A;  2UXB K;  2GWJ A;  4E7I A;  3MXI A;  3E01 A;  2WBN A;  3JAM O;  1YUW A;  1E3M A;  2ZGZ A;  4AHS A;  2E4L A;  2Y1J A;  3MEE A;  2E8A A;  2VCP A;  2Z1H A;  5J2N A;  3P5J A;  5BPM A;  5M1O A;  4H5W A;  4K41 A;  3OY9 A;  3THY A;  2E20 A;  3PSI A;  1LAV A;  3SBT A;  4H5T A;  3O8M A;  3O4N A;  3R1X A;  4IEI A;  2GV9 A;  3GOI A;  2QWM A;  3NVM A;  1KTQ A;  1RCH A;  4JD2 B;  3W0L A;  1H1V A;  2JWK A;  3ID8 A;  2CH5 A;  5EY4 A;  4BE1 A;  3L6Q A;  3K59 A;  4DR3 K;  4JHD A;  3BY5 A;  4KTQ A;  2HNY A;  4CZH A;  4FVU A;  2HHH K;  3NAE A;  3O5B A;  1TV6 A;  3K0S A;  4E1M A;  3UIQ A;  1S9E A;  2RHK A;  5EOY A;  5FPD A;  2P9L A;  3M8P A;  3V9W A;  3QML A;  4IJA A;  3AVH A;  2P9I A;  1HYZ A;  4BRO A;  1JCF A;  4HTL A;  3K2P A;  2NRX A;  1BA0 A;  1O1W A;  3OYC A;  1JLA A;  1KQS M;  3VMF B;  1HKC A;  2G8W A;  4O44 A;  4XH5 A;  1RDC A;  3CF5 L;  4BRF A;  3VQP A;  4DF4 A;  3VGK A;  3KK1 A;  1U49 A;  2EHG A;  1RDU A;  1DLO A;  2YX6 A;  1S1V A;  3C94 A;  3L2R A;  5HP1 A;  5AZI A;  3VF4 A;  2Z1I A;  4FW1 A;  1F21 A;  3BGR A;  3LDN A;  4KO0 A;  3QDK A;  2UXC K;  1Z26 A;  1TK8 A;  3THY B;  1IBM K;  2NRZ A;  4CJL A;  1UA1 A;  4YOR A;  5FRN A;  4JKE A;  4FJX A;  4BRI A;  3MCP A;  4IFE A;  4ICL A;  3GG4 A;  2Q0R A;  4IG3 A;  2O8E B;  3FZK A;  4LF5 K;  3K5M A;  1V4T A;  3G71 N;  3ZT4 A;  3DLG A;  3QEI A;  3VET A;  2X6N A;  3NH2 A;  5AZI B;  4CHP A;  3NF9 A;  4NXM K;  3KZB A;  4O5F A;  4J8F A;  2I7P A;  4DQI A;  3H3N O;  4C8O A;  3SQ0 A;  1ATN A;  5I9E B;  3HSC A;  3PX4 A;  3I56 N;  3HBT A;  3TSP A;  3CQ8 A;  3OYH A;  3G25 A;  4OX9 K;  4QOZ B;  1IKX A;  4H4M A;  4KBO A;  2CH6 A;  4FJ8 A;  2OTL N;  2VG7 A;  5EXW A;  4DU1 A;  3G0Z A;  1VRU A;  4XEI A;  3MK6 A;  4AM7 A;  5BRE A;  2IDO A;  4ILG B;  4BG8 A;  1XMO K;  1RGI A;  1HNZ K;  4XH1 A;  1IV0 A;  1IKV A;  3QET A;  4NYN A;  1QSY A;  2P5G A;  3QES A;  4O8U A;  4BQL A;  4B8A B;  3SBG A;  4YFU A;  4B9T A;  1HJO A;  3C0B A;  4DQQ A;  4ZTF A;  4DSF A;  2QXL A;  3A8Y A;  5J2P A;  2QTD A;  3KWI A;  4JI1 K;  4LFA K;  4CZE A;  3GL1 A;  1U4B A;  3M1F A;  1T8E A;  1C6V A;  1T7P A;  4Z94 A;  4JKH A;  1T03 A;  2VG5 A;  4PL7 A;  4MLH A;  3VGL A;  2DPN A;  4H0V B;  4M7X A;  4JEP A;  1XUP O;  2X74 A;  5AQH A;  3OYK A;  3DAW A;  3ZET A;  3MN5 A;  3E9P A;  3AA2 A;  1NLV A;  4PL8 A;  2ZJQ L;  5HRS A;  1VQM N;  4FJ5 A;  3PY8 A;  1CXQ A;  3DXM B;  4CJS A;  4BGA A;  1NK7 A;  4CI6 A;  2IVO A;  4Z0U A;  3E1Y A;  1ZBF A;  2D1K A;  4JI6 K;  4KHW A;  4GW6 A;  4FWO A;  4OO1 J;  3WEE A;  2XRI A;  3CXC M;  3AA5 X;  4M3X A;  3GE1 A;  3NBP A;  4CF0 A;  3AO2 A;  3MDQ A;  3EL2 A;  1XNR K;  2P51 A;  4WFA L;  2DY4 A;  3P83 D;  3H1V X;  3NGZ A;  1TUY A;  1X9W A;  4FWK A;  4Z4F A;  1KFS A;  1DEJ A;  3QIN A;  1BWF O;  4FJ9 A;  1HYV A;  4FM1 A;  4LY7 A;  5CHI A;  3MX2 A;  1EWR A;  4QS7 A;  3AGK A;  2HVI A;  4BRN A;  3TAM A;  1NJI O;  1HKB A;  2FXU A;  4N41 A;  1U04 A;  3FGU A;  2XHB A;  2OPR A;  3J7A P;  1IH7 A;  4DMN A;  3LWL A;  2HBL A;  4OGE A;  4Z4G A;  3THW A;  1TL1 A;  2IVP A;  4BDP A;  3KLH A;  4C8N A;  4LF8 K;  4EZ9 A;  1C0U A;  3AVI A;  2JGU A;  3HYF A;  3OYN A;  5F0X A;  3QIP A;  4FJI A;  4YY3 K;  3ATU A;  3A5O C;  4GNI A;  4PY5 A;  3ENH A;  4LF6 K;  2D5R A;  2WOM A;  2D0P A;  4EAH D;  3V6D A;  4JHD B;  3V9U A;  4CHO A;  4W5N A;  4NLB A;  2ZWH A;  4KHQ A;  1VSJ A;  3WEE B;  3AY9 A;  4C1N I;  1NKC A;  2KFN A;  3SQ1 A;  2Q36 A;  3LDO A;  2LSN A;  3RVC A;  2OAN A;  3AVL A;  3UB5 A;  4PHT X;  2HF4 A;  3EZ5 A;  1L3T A;  4JI3 K;  1BIS A;  3B8A X;  2HF3 A;  3AVN A;  1WAF A;  3O08 A;  3A5M C;  2WFB A;  3L4I A;  4B9V A;  4M3W A;  1JXB A;  1KFD A;  3S41 A;  4Z4H A;  3F5T A;  3NVK A;  5JIC A;  1LWF A;  5TKW A;  3QER A;  4XH4 A;  3SLC A;  3CCJ N;  4J2D A;  2P9P A;  4QCL A;  3ENB A;  3SMP A;  2E1Z A;  3SV4 A;  4JS5 A;  4CHQ A;  1GOA A;  5EU7 A;  3PX0 A;  1TK5 A;  3LAM A;  1K6Y A;  4CJ7 A;  3RMB A;  3U3Y A;  1XHZ A;  3HL8 A;  4EIA A;  1EO1 A;  2VYP A;  3FZH A;  5AZJ B;  4FZX C;  1NNE A;  1KVA A;  4JKF A;  4H5R A;  3CG7 A;  2HBJ A;  3L3U A;  3W3D A;  5ADX A;  5ADX H;  1HMV A;  1S5J A;  2BE2 A;  2UUA K;  1NK8 A;  2QWL A;  4Y1D A;  3WQU A;  4KKO A;  4BRM A;  4CJV A;  3QFU A;  3L2W A;  3HOS A;  3J81 O;  5IWA K;  1HYS A;  1KVC A;  1DTQ A;  1T05 A;  4YDU C;  3CJA A;  5AQL A;  3CC4 N;  1IG9 A;  1N33 K;  4QS8 A;  3KKR A;  1XI1 A;  5DMR A;  3AA4 A;  3LZI A;  3CFP A;  3ULE B;  4BR7 A;  3HJF A;  4CJ5 A;  3ZSQ A;  2HBM A;  1KAX A;  2IOC A;  1HNI A;  1U47 A;  2A40 A;  1HLU A;  3WXJ A;  4BC4 A;  3C6A A;  1J54 A;  3V81 A;  1GLD G;  3VQB A;  4CJK A;  2B6A A;  3VN5 A;  5A2Q O;  3AO3 A;  3LDL A;  5HRP A;  1EXQ A;  4FK0 A;  3LAN A;  3VQ8 A;  3CC2 N;  3THV A;  3VEN A;  5BRF A;  1WNS A;  3HM9 A;  2YHX A;  3C95 A;  4FLW A;  3SUP A;  4KH4 A;  3OS1 A;  3OJU A;  4CER A;  4BRC A;  5LL6 Z;  1EWQ A;  4B8C A;  1QTM A;  4CHY A;  3TAR A;  3LM2 A;  2VQE K;  3CPE A;  1M1K O;  4CZI A;  4PWD A;  1S6P A;  3FFI A;  3KWG A;  3UE5 A;  1VQ4 N;  3LPT A;  3MXJ A;  1S72 N;  4F4K A;  4JK8 A;  1JLE A;  2X78 A;  5AQR A;  3VQ9 A;  2RKI A;  1VQK N;  1Q86 O;  3M8R A;  3DRR A;  3OVN A;  4BRL A;  3DYA A;  3KHY A;  1XQS C;  1NGA A;  4WF9 L;  2HHV A;  4BE0 A;  1J6Z A;  2O8F B;  4JI7 K;  2BGG A;  1NKE A;  4GV6 A;  4YOT A;  5AQV A;  3HK2 A;  3O9U A;  3WT0 A;  5AQN A;  4AM6 A;  3E9L A;  2QA4 N;  4O8K A;  1BG3 A;  5KGX A;  4F3T A;  4M45 A;  2O8C A;  2DFF A;  4PQU A;  4BAC A;  2O8B A;  4MLE A;  3VQE A;  1GOC A;  1K9M O;  3D2F A;  2HOE A;  5AJ3 K;  4JKG A;  1WSH A;  1NJW A;  2CGJ A;  4CW7 B;  4WFN L;  1NU0 A;  4DR5 K;  4H0X B;  3VEO A;  4X66 K;  1QQO A;  4ELT A;  1TAU A;  3TAF A;  4GKJ K;  1MDU B;  3LDQ A;  3CJ1 A;  1B92 A;  1LW0 A;  2HST A;  1VRT A;  3SAF A;  4MDB A;  1QHT A;  1OH7 A;  3PSF A;  2QI2 A;  3TAQ A;  4LFB K;  1FW6 A;  4BVO A;  1VSM A;  2ZGY A;  1W97 L;  2DFH A;  5ELZ A;  4IOX A;  1ZBU A;  3D7E O;  4CZL A;  3KLE A;  1N6Q A;  2V51 B;  1RBU A;  1KAZ A;  5BN9 A;  3CFR A;  2HVH A;  3ID6 A;  3T69 A;  2ZD1 A;  5AFU H;  3ZT0 A;  3DXK B;  1RBR A;  5DM6 L;  2QXF A;  3ASM A;  4KHN A;  3VF6 A;  1BI4 A;  2FLO A;  2DFE A;  4NXN K;  2F8S A;  3AVK A;  4OPK A;  3KK7 A;  4FWS A;  3WNG A;  4DCH A;  4LH4 A;  1NKB A;  2W6L A;  3MN6 A;  4IG0 A;  4CD3 A;  1DKG D;  1I3A A;  3ZCM A;  3QEW A;  1IBL K;  4ELU A;  4KB0 A;  4QAG A;  3H1Q A;  4FK4 A;  3SNN A;  2F8T A;  4M42 A;  1REV A;  3CCR N;  4RW4 A;  3J80 O;  4BG9 A;  3DI6 A;  4A2A A;  4FLV A;  3OBW A;  1RTH A;  3HVT A;  3D2E A;  5AQM A;  3OBY A;  1KCF A;  2P9P B;  3OYF A;  1C1B A;  2KZZ A;  3SZ2 A;  3H45 C;  4A57 A;  3SYZ A;  5JMV A;  4IEE A;  5GIN A;  4CVN E;  3CJB A;  4FCY A;  1YXQ A;  3MWP A;  4CGI A;  4E3S A;  4H0T B;  5FPE A;  4JKD A;  1U48 A;  4RW6 A;  4DTN A;  3CCE N;  4K43 A;  2QWQ A;  3CHW A;  4B1Y B;  2KFZ A;  1YTA A;  4CJU A;  4DV4 K;  2GBZ A;  1YF5 L;  4NO7 A;  4CFC A;  1TKZ A;  4CZM A;  1N8R O;  3AVM A;  2HHX A;  3MXM A;  1WAJ A;  4FJH A;  3ZSY A;  1QSS A;  3PV8 A;  2WUS A;  1N34 K;  2YHB A;  3IKM A;  4BY9 C;  4BRH A;  1GLE G;  4L3Q A;  4E7L A;  5BRD A;  4IJN A;  3KJV A;  2Y1I A;  1MWK A;  1X3N A;  4X64 K;  1NOY A;  2GEL A;  4FJL A;  1X9M A;  4YOY A;  2ZF5 O;  4FWL A;  1GOB A;  2GUP A;  4LSN A;  5JLH A;  1C0T A;  4EZ6 A;  3BZK A;  1JLC A;  2FBX A;  3KD1 E;  4IDH A;  5LMN K;  4M3Y A;  2W6K A;  3O1B A;  4CEF A;  4FOE A;  3IDH A;  1ZBL A;  1JLG A;  3ZT2 A;  5FDL A;  4RWT A;  3KD5 E;  3V9Z A;  1VK0 A;  4YOV A;  4JI8 K;  3E66 A;  2YCH A;  3CER A;  4ISF A;  4V19 S;  3OHR A;  4H0Y B;  3SJJ A;  2I5J A;  1Y97 A;  2D0C A;  1HNW K;  5AQG A;  3LDP A;  3TTC A;  3OYI A;  3T1Y K;  3CFO A;  4BRG A;  3O4W A;  4DSE A;  1NJY A;  5D3G A;  1TVR A;  2QWR A;  1GLJ O;  5HRR A;  3CJ7 A;  5CYM A;  4BRD A;  1NK9 A;  4ILJ A;  3CCL N;  3L2U A;  3SUO A;  1RT2 A;  3VES A;  4DR2 K;  2A41 A;  1RDD A;  4BE2 A;  2I7N A;  4U7B A;  4FW2 A;  1VQO N;  4B3S K;  3EZW A;  2F96 A;  2YKN A;  3TSQ A;  1KLN A;  4KPY A;  4LF4 K;  4X65 K;  4M3Z A;  1IBK K;  3HXM A;  3CI5 A;  5C10 A;  5F1X A;  1CZA N;  4KI6 A;  4HUE A;  4KH5 A;  4B9L A;  3ULE A;  4J2E A;  4KRF A;  2QM1 A;  4CHZ A;  4GVE A;  1VSK A;  3C6H A;  3KK3 A;  1NJZ A;  2YHY A;  3ZYY X;  1RBT A;  2PAV A;  1SAZ A;  4CEQ A;  3ZSW A;  2PBD A;  4J2A A;  4LF7 K;  2Q2R A;  3MWT A;  3F2K A;  1MWM A;  4BR9 A;  2D0A A;  3A0I X;  4KH6 A;  3PUF A;  4PKG A;  1UA0 A;  1BCM A;  1YJW N;  1NGJ A;  4DSI A;  2Z1G A;  1M90 O;  4JN4 A;  2P9U A;  2HHW A;  1C0G A;  3ALY A;  2RF2 A;  3Q7B A;  1HNX K;  4DTM A;  1Y64 A;  2OCE A;  5LJW A;  1VQP N;  1CZ9 A;  4CFB A;  4JRQ A;  3R6M A;  5GAH P;  1TYQ A;  1KSP A;  2UUC K;  3K5N A;  1OH8 A;  3U9Z A;  1JJ2 M;  2ASP A;  4CBU A;  3WXM B;  5KQD A;  3QIO A;  1NK4 A;  1OH6 A;  3RR7 A;  4RW7 A;  3C6T A;  5K14 A;  1X3M A;  3ZEU A;  2FSK A;  3I0R A;  4DU3 A;  4FZZ A;  3SQ2 A;  3HST B;  1GLC G;  4CEZ A;  5KPR A;  4DTJ A;  3L2Q A;  3AO5 A;  4CGG A;  4EP5 A;  4DV2 K;  3QBX A;  5J2M A;  4KI4 A;  1J5O A;  5GIO A;  2OYQ A;  2YJE A;  2F9T A;  4I2Q A;  2E5L K;  5T7B A;  4OPH A;  5AQP A;  3VA3 A;  5I42 A;  3JSM A;  1Q82 O;  1CLQ A;  1ASU A;  2GTD A;  3P39 A;  3THW B;  2NRR A;  3LL3 A;  1WSJ A;  4DR7 K;  2YNF A;  5KI6 A;  3GDQ A;  3HI0 A;  1YJ9 N;  4DUY K;  3V1O A;  4LSL A;  4B1Z A;  2Q31 A;  4N76 A;  2RN2 A;  4E89 A;  1TKD A;  4HWI A;  4FLX A;  2KHO A;  4W5O A;  4DV5 K;  4LH5 A;  4BQZ A;  1QHA A;  5AQF A;  3CCV N;  4NCA A;  3WXL A;  4H03 B;  3T1A A;  4MO4 A;  4KFB A;  1SKW A;  1C1C A;  3HTV A;  4MFB A;  1CZB A;  1YIT N;  4DQS A;  4GY2 B;  5AQY A;  4IFY A;  1W0H A;  1Z05 A;  2E2Q A;  1TKX A;  4CIG A;  4A5A A;  4B9U A;  4GV9 A;  4KHP K;  2NNW A;  3CQX A;  3UKR A;  1LOT B;  2P1J A;  1KLM A;  1QVG M;  4F8R A;  3D45 A;  4DWI A;  3AV9 A;  2QEX N;  3V4I A;  1NMD A;  2OZS A;  3L3V A;  3H46 O;  1QZ6 A;  4Z4E A;  2A42 A;  4AHR A;  1SL1 A;  1D9D A;  2W42 A;  5GAE P;  4M3R A;  4Z4C A;  3PO4 A;  4FJG A;  5EVZ A;  2FF6 A;  1HQU A;  4B9N A;  2HHU A;  3ZX2 A;  1MA9 B;  2PZS A;  3VTI A;  2VG6 A;  5B8H A;  1SUQ A;  4YNQ A;  3VQC A;  4F2S A;  3VPZ A;  1YIJ N;  3CYM A;  4CJ3 A;  1BIU A;  1L3S A;  1IJJ A;  4CEO A;  1RBS A;  4CE9 A;  3WXK A;  3NHG A;  4K0K K;  4JNE A;  1JCE A;  1YAG A;  1QZ5 A;  5E84 A;  3QFP A;  4NB4 A;  4CED A;  1HKG A;  1ITG A;  1SKR A;  2PYL A;  4A61 A;  4CJP A;  3AA3 A;  3ITH A;  3M3Z A;  4DUZ K;  4ILH A;  4DLE A;  5C24 A;  2Z1J A;  1SV5 A;  3RMD A;  4IO8 A;  4KRE A;  3O9S A;  4FJM A;  3RR8 A;  3D2E B;  1A5W A;  4AQY K;  3VEZ A;  3EE8 A;  1HJR A;  1T3V A;  2JWL A;  4RCH A;  1IKW A;  1YJN N;  2HMI A;  3AAQ A;  2GWK A;  3EKS A;  4OKK A;  4J2B A;  5KQ8 A;  4PA1 A;  1XMQ K;  4GVM A;  3M6G A;  2A1S A;  4K42 A;  4KHU A;  1EP4 A;  1BGX T;  4BWJ A;  3DLE A;  3TAE A;  1ILY A;  5FRO A;  4WQ5 C;  3VQ6 A;  3C7N B;  4MQ3 A;  4M7Y A;  2O8F A;  5M1Q A;  4C8K A;  5BR9 A;  3LWM A;  3SPY A;  1HR0 K;  4DS5 A;  4DQR A;  4HUF A;  4JV5 K;  1RT6 A;  4YOX A;  3K5O A;  4OJR A;  2ATQ A;  3U6F A;  1WN7 A;  2UYT A;  4ID1 A;  5SWM A;  3N4P A;  2HND A;  3AVG A;  3EYZ A;  5LY3 A;  4H4O A;  4C23 A;  3O9T A;  3LP3 A;  3BP8 A;  4DHY A;  1QVF M;  2PYJ A;  5EX5 A;  3NFA A;  1C0F A;  2KKZ A;  4E0D A;  1LV5 A;  1RT1 A;  1YHQ N;  3KK2 A;  2O8D A;  1NBW A;  1VAZ A;  4AHV A;  4OLB A;  2F4V K;  5C15 A;  3CM6 A;  2YJF A;  3LP2 A;  3I8B A;  1RNH A;  2V7Y A;  3DLR A;  3BEX A;  4DR4 K;  2NRH A;  1DTT A;  4GV3 A;  2EWS A;  5LJV A;  4JKC A;  1XNQ K;  3GBT A;  2E88 A;  3LP0 A;  5AQZ A;  1VQ5 N;  3MEG A;  3NH0 A;  2RPI A;  4DU4 A;  5HL7 L;  1NG9 A;  4A59 A;  1KC8 O;  3VQ5 A;  4FXD A;  2NLX A;  1VSI A;  4UQG A;  3R8E A;  4CGJ A;  3TAB A;  2A1R A;  3G6E N;  3FLC O;  2O8D B;  2QKK A; 
#chains in the Genus database with same CATH homology
 4DR7 K;  4JI7 K;  4DUY K;  4LF4 K;  2ZM6 K;  4X65 K;  4B3T K;  1N32 K;  1IBK K;  4LF5 K;  4DV7 K;  5LMU K;  4AQY K;  4YHH K;  1XNR K;  4CVN E;  2UXB K;  4DV5 K;  4NXM K;  3JAM O;  4DR1 K;  2UUA K;  4LF9 K;  5AJ3 K;  1FJG K;  1J5E K;  3J81 O;  4X62 K;  5IWA K;  1XMQ K;  4JI5 K;  5BR8 K;  4OX9 K;  4DV4 K;  4CW7 B;  3J7Y P;  4DR5 K;  1N33 K;  4LF7 K;  4X66 K;  4GKJ K;  3J7A P;  1N34 K;  4JI0 K;  1HR0 K;  4KHP K;  4DV6 K;  4JV5 K;  4LF8 K;  4DR3 K;  4DV3 K;  4X64 K;  1XMO K;  3T1H K;  1HNZ K;  4LFC K;  2HHH K;  4LFB K;  4JI2 K;  4YY3 K;  1I94 K;  2UXD K;  1HNX K;  4LF6 K;  4DR6 K;  2UU9 K;  5LMN K;  2UUB K;  5A2Q O;  4DV0 K;  2UUC K;  3OTO K;  2VQF K;  1N36 K;  4LFA K;  4JI1 K;  2F4V K;  4JI3 K;  5LL6 Z;  4NXN K;  4DR4 K;  2VQE K;  4JI8 K;  1XNQ K;  4JYA K;  4V19 S;  5FLX O;  5IT9 O;  4JI4 K;  4DV2 K;  4B3R K;  1IBL K;  1HNW K;  4K0K K;  3T1Y K;  2E5L K;  2UXC K;  4B3M K;  4DV1 K;  4GKK K;  3J80 O;  4JI6 K;  4DR2 K;  1IBM K;  4DUZ K;  4B3S K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...