4DV5K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv5K00
4JYAK 4DV2K 4NXNK 4GKKK 5A2QO 4B3SK 1XMOK 5BR8K 4DV7K 4LF9K 2HHHK 2UUAK 1N32K 4YHHK 4DV0K 2UXCK 3JAMO 2UXDK 2E5LK 5AJ3K 4DV3K 4X62K 2UUCK 4JI0K 2UXBK 2VQEK 2VQFK 4DR5K 4X66K 4LF5K 4CW7B 5LMNK 4GKJK 3J81O 3J80O 4LFAK 3J7AP 1J5EK 4LF7K 4V19S 4DR2K 1IBKK 4JI5K 5IT9O 4JI6K 1XMQK 4B3TK 4AQYK 3T1HK 2ZM6K 5LMUK 4JI3K 4B3RK 4X64K 4DV1K 4DUZK 4DV5K 4LF8K 4NXMK 4JI4K 1HNWK 1N33K 2UUBK 4DR7K 3J7YP 2UU9K 4X65K 1HNXK 3OTOK 4LFBK 4DUYK 4DR4K 2F4VK 1XNQK 5FLXO 1IBMK 4JI7K 4DV6K 1N34K 3T1YK 1XNRK 4JI1K 4JI8K 4KHPK 4DR6K 4DR3K 4JV5K 5LL6Z 1HR0K 4LFCK 5IWAK 4OX9K 4B3MK 4K0KK 1I94K 4JI2K 4YY3K 1N36K 4LF4K 4DR1K 1HNZK 4CVNE 1FJGK 1IBLK 4LF6K 4DV4K
chains in the Genus database with same CATH superfamily
2FXUA 1FKPA 4CJWA 4YOVA 4F4KA 2GUIA 2KW4A 3M3ZA 4IXCA 4ISGA 4ID1A 4BRGA 5GAEP 1JCGA 5CR4A 1EWRA 2EHGA 1RFQA 4OKJA 4NYFA 3K5NA 4DQIA 5AQKA 3PSFA 4GW6A 3OYGA 1HX1A 3O08A 4UY8O 1VQNN 5BPMA 2J4RA 2D0CA 1Q18A 3A5NC 3A2FA 4BRHA 4IDKA 3VPZA 3I0RA 3N4PA 4KH6A 3F2KA 2QEXN 4GMJB 5FROA 4OO1J 4CJUA 3ITHA 3LDLA 4DHYA 3ZSRA 4BC2A 4H8KA 4GKJK 2VWBA 1O1WA 3QO9A 5DK5A 4LF7K 1HYSA 2OTJN 4E1MA 5C25A 4B3TK 3QESA 3MN5A 3OS0A 3T1HK 5CYQA 4ZHRA 5SWMA 1WSEA 3DRSA 4OPKA 1HKGA 1QE1A 4XH1A 2O8CA 4WQ5A 4X64K 3Q7BA 1NK9A 2YHBA 3HPOA 1RBSA 1QVGM 4CJ4A 5JS2A 1XQSC 2HHVA 5FPNA 4HCBA 3ASMA 2WC9A 1VSEA 1HKBA 3NE6A 3WXIA 2Z1HA 2WBNA 2D4WA 3AGRA 2F4VK 5TKWA 4DMNA 1NGDA 5DMRA 1RTDA 3VA3A 4H5NA 2XY7A 3VGLA 1T44A 2O4IA 3K9JA 3CQ8A 3TSUA 4H4MA 2E88A 4BQZA 5D3GA 3V6DA 1NKCA 1ZYQA 2QM1A 3H1VX 3UKUA 3WXKA 4BGBA 3CPEA 2O8CB 4N5SA 1HYZA 1HR0K 1B9FA 3P5JA 1S3XA 3O4QA 4GV3A 4E19A 1LWFA 3E66A 3CJ7A 1E4GT 2P9IA 4CGHA 4CESA 2HOEA 3QEPA 4BY9C 2FLOA 3CMAN 5C10A 4FJ9A 1VSFA 4E7HA 1S5JA 1BG3A 4J2EA 2YNFA 3FZFA 3ZSWA 4ELTA 2IVNA 2E2NA 2YKNA 3EYZA 4AHUA 4DSFA 5EXWA 3CFOA 3MAQA 2DFFA 3L4QA 3DLKA 4A2AA 4X62K 2UUCK 1NGEA 3JYTA 2XO7A 1EKEA 3TTFA 3CHWA 5ADXA 4ILGB 4Y0WA 3EE9A 4L8RB 1BL3A 4CW7B 1BI4A 1K6YA 2ZWHA 4DTOA 3OBYA 3BDPA 4H5WA 3O3FA 4NLCA 4KHNA 2Q0RA 4V19S 4J2DA 3LDNA 2P9IB 2QK9A 3QINA 1IKVA 3THYA 5F1XA 1QSSA 1EO1A 3LM2A 3NBPA 3V1OA 3NMUA 1RT3A 3CMEN 2DY4A 4O4GA 3UKRA 2PY5A 3DJCA 5KTQA 2CGJA 3AA2A 2KLAA 3VQBA 5FPMA 4E1NA 3MCPA 1KXPA 3QBWA 3E9OA 3LPTA 4PQUA 1DTQA 3QEIA 1MWMA 4FZZA 2ASMA 1BI4B 1RDCA 3SJHA 3WEEA 4FK4A 4AHSA 4BR9A 2GUPA 3FE1A 4H4OA 4C1NI 4FK0A 2ZGYA 3MN9A 1W7AA 5HRNA 3WXLA 4MQ3A 4JI8K 1BCOA 1NGJA 3THYB 1CXQA 3HP6A 5AFUH 3FLCO 1KAYA 5BPLA 3ZT3A 1VQ9N 2FBXA 3HM8A 3TAFA 3BZCA 3GBTA 1LV5A 2X74A 3UKRB 5M1PA 3AO2A 4ELUA 5LJWA 1ATSA 4U67L 1TK0A 4H5TA 4E7IA 4C8LA 4BDPA 3AVCA 4Z94A 3K57A 3CCRN 1Q86O 2Z1IA 3S3OA 4E3SA 3DOKA 1NGIA 2G8IA 5A2QO 2VCPA 4MO5A 3O1WA 4JKEA 4AH9A 5AQUA 2HHHK 4WE1A 3JSMA 2HBMA 4CGFA 1S9EA 1X3NA 3FFIA 3VEYA 3SMPA 5JS1A 1NJXA 2PFUA 3I33A 2E1ZA 3BF3A 1Z6RA 1IKWA 3NAEA 1VQPN 1DEJA 4L3QA 1M1KO 2AJQA 3AAQA 1X9MA 2PYLA 3RVCA 4DR2K 3QFUA 3R6MA 1XHXA 4H0TB 3LZJA 4FWPA 3CPWM 4EFHA 3A8YA 2Q36A 4FJHA 4FJ5A 2G8VA 4LY7A 4PL8A 4JI3K 5JICA 4BR2A 3ULEA 3RTVA 2GX9A 3KWGA 2XY5A 1NJIO 1NK5A 4BRCA 3O80A 4BROA 3AVKA 3CJBA 4KFBA 1N33K 1SKWA 1V4SA 2O8EA 4O55A 1HYVA 1JLEA 1QQMA 5GIOA 3IRXA 4QS9A 4Q0BA 2DFEA 4IOXA 4RTFD 3KTQA 4KH4A 4CK2A 2V7YA 3OYCA 4RW4A 4AM7A 5BN8A 3AVJA 3LP2A 3H08A 1YHQN 1BUPA 4BACA 3WQTA 5HLFA 1JLQA 1OH8A 2QTDA 5BRFA 3VENA 4CJQA 2HHQA 1S1UA 4B9VA 2Q2RA 2E2PA 4FJIA 5CZ1A 3VEVA 4AHVA 1U4BA 4FWQA 1ITGA 3SCXA 4KI4A 1YUWA 5AQPA 3FGUA 1WNSA 5C2DA 2E6LA 1ASVA 2Q31A 1BA0A 2W42A 2GEMA 3VESA 5E26A 4R79A 5H1SQ 1OH7A 4DSEA 2O8EB 3KK1A 2CH6A 3SUOA 1GOCA 3VQEA 4KTZA 4JKFA 3ZEUA 2Q97A 4CEEA 4XH5A 2ITMA 5SZTA 3TI0A 1C1CA 4LF9K 3NF6A 1ZXOA 2RKIA 1NK6A 3CQYA 4OPHA 4FVMA 1OVQA 3T69A 3QEXA 3KLGA 4IG0A 1VQKN 5KPRA 1RILA 3MX2A 3KD5E 3AV9A 3L3VA 4B9LA 4CD1A 3HT3A 4DSLA 3TABA 1NJYA 5AQNA 3M8SA 1S6PA 2VQFK 5GADP 4WQ4C 4CF8A 2GBZA 2OPQA 3O6WA 3VQAA 4LC9B 1IBKK 4JI5K 5J2MA 3CC2N 1K73O 2NRHA 1SKRA 4BRMA 2AP1A 1T7PA 3PX4A 5AQMA 4EP5A 1H1VA 1QTMA 2W40A 4B3RK 2OPRA 1KAZA 3O9UA 1NWKA 1VSHA 4IFYA 3EL2A 2X78A 4BC5A 1Z25A 3VGKA 4O44A 3AARA 5HRRA 3V9UA 2XHBA 3FZKA 3CJCA 5M1OA 5CZ2A 3HPHA 1C0MA 3AVIA 2D0AA 4XEIA 3ZYYX 4AILC 2ZJQL 2KQ2A 3PO5A 2PZSA 1VAZA 4CF0A 3PIPL 4AHCA 1KVAA 5AQXA 1BQMA 4DV6K 4DTUA 1KD1O 4DS5A 1VQ5N 5E84A 1XNRK 4FJMA 1TGOA 4O8KA 2E20A 4O8UA 2KKZA 1RNHA 4G9ZA 1WSFA 4KTQA 4DR3K 4WF9L 3UB5A 1J5OA 4M42A 1VQ4N 3LPUA 1TK5A 5C42A 3G0ZA 3ZETA 1BIUA 3QIOA 3QIPA 4WQ4A 5AR0A 1N36K 1C0GA 4DR1K 2OTLN 1A5WA 1QQNA 1MA9B 1YAGA 1C0UA 4FYDA 3DMJA 3NH0A 1D4XA 1ZC6A 4KHSA 2OA8A 3WUHA 2OCEA 3RR8A 2D5RA 2CH5A 5HP1A 5I3UA 4PUOA 3QETA 4FZYA 2UXDK 1W0HA 2FSJA 1WSJA 3AO1A 5AQOA 4IKFA 4MO4A 3VF6A 3OYNA 3NFAA 2YHAA 4K43A 3GE1A 1YIJN 4Z4HA 1FKOA 1FW6A 1GLFO 3CM5A 3M8PA 3DI6A 2NRRA 3SQ0A 2E4LA 4IEIA 4C8OA 3QBXA 3ZSOA 5CE3A 3AO3A 5IT9O 3DOLA 3FZMA 1RDWX 1QSLA 2V52B 4A5BA 1R59O 3DM2A 4DKWA 3ZCMA 2FSKA 5KPTA 3IS9A 4DQPA 3RSEA 2IVOA 4FLUA 2ZD1A 3QERA 3LAMA 1LAWA 3MEGA 1RCHA 1G15A 4JKHA 4CZEA 3O9SA 3Q7CA 4AHRA 3VERA 4BDYA 1WB9A 2E6MA 2DPNA 3HZ6A 3ZX3A 3SYZA 4E7LA 1QZ6A 4HUEA 4CF9A 2W41A 4JI7K 1M90O 1F21A 2IS3A 4FOIA 4LH4A 3QNOA 4BR5A 5KRTA 3OYJA 1A5VA 4BQLA 3O1BA 4Z4CA 1WBBA 4RG8A 3KLIA 3MXMA 4R5PA 2Y1IA 4DTMA 2QWMA 2I7PA 5LL6Z 2Q0UA 3G71N 3RSEB 1I94K 4CBWA 1HJRA 2WOMA 3E9PA 4H0XB 2NNWA 4YY3K 4PL7A 4CEBA 1FJGK 1B92A 3C65A 4DV4K 4CGGA 3H3NO 2P1JA 1DT9A 5AQIA 3QICA 3WT0A 2EWSA 3ISNC 4I9LA 2X6NA 4CF2A 3CCJN 4ISFA 3KHYA 4FJNA 4KRFA 1VSJA 4CGDA 1U6ZA 1RDDA 1A5XA 4DWIA 3PLAA 4CECA 3VQ6A 2P51A 5E41A 5HRSA 2E1YA 4LF5K 1C1BA 5FDLA 4OGCA 1WLJA 3BEXA 1J5EK 1ASWA 1NJZA 4DTPA 2E2QA 2QI2A 5TKYA 1I39A 3KJVA 3TAEA 4JK8A 3F5TA 4JKAA 4KI6A 2R7YA 4CHYA 3UE5A 4A59A 3V9ZA 3CIPA 5FPDA 3FFKB 4BRKA 4W5OA 4FXDA 3EZ5A 5AQGA 3J7YP 3CI5A 4CFBA 3F9KA 1JKHA 3LDOA 1GLAG 3N4QA 2LSNA 3IMXA 1NK7A 1EWQA 1C0TA 1OKJA 3WNFA 4CERA 4BC4A 3MXIA 2G8KA 1YXQA 4XIUA 4OPJA 3MWPA 1QHTA 5EVZA 3OW2M 1X9WA 4Z4FA 2HBKA 3THWA 2XRIA 3I55N 4RCHA 4EAHD 4FWOA 1CZAN 4OLBA 1RBTA 3JXUA 1SUQA 2HNZA 3GG4A 1WAJA 3SAFA 2HNYA 1KTQA 1W97L 4GNIA 3SQ4A 2I5JA 3KLFA 4M7YA 2F8SA 1BGXT 3UIQA 1Y64A 4HUFA 3NH2A 1TUYA 4M7XA 5AJ3K 3TSPA 2FBTA 4CEQA 2FBVA 3FZLA 3LANA 2F9TA 3OYFA 3THWB 2ATQA 3ID8A 3CG7A 3J80O 3AO5A 4G1QA 3DLHA 1X1PA 3H45C 3OYKA 3CF5L 4OVLA 1HNVA 2QW9A 3OYEA 4BG9A 2B4JA 5BPNA 3OYBA 4GVMA 5ELZA 3LDSA 5KGXA 1SV5A 4YOYA 4M3WA 1J9AA 3QFPA 3LZIA 2VGNA 2GWKA 5ADXH 1IJJA 3UKUB 4Z0UA 1LCUA 4BVOA 4HCCA 1RDUA 4M45A 2HHUA 2O4GA 5HOOA 1G99A 1L3TA 1BOTO 3P4IA 2BANA 1U47A 5KPZA 3ZSZA 4M63C 3R1XA 4YFUA 4J2BA 1KFSA 4A57A 1NGBA 5EX5A 4BC3A 4YDUC 5FLXO 3L3UA 3EN9A 3NCIA 1K9MO 3NVKA 3LL3A 3H3OB 2RE2A 3MN7A 4ID5A 4NCGA 3V1QA 4E89A 4DTJA 2YCHA 4CZIA 1N8RO 4F8RA 3SJJA 3C6UA 3SK3A 1S72N 1ASUA 2Z1JA 2NUBA 4BR7A 3TAPA 4BE2A 4C8NA 3ATUA 4F9OA 2VWJA 4FVUA 1YVUA 2YJFA 1LAVA 4BR4A 4B3MK 4A5AA 4FWMA 1TKDA 2RPIA 5GIPA 2O8FA 4HTUA 4CJ7A 4QCLA 4NXNK 1QVFM 5BRDA 4B3OA 4HWIA 4B3SK 3WNHA 3ID6A 3AY9A 3VQQA 3OYDA 3L0QA 2UUAK 1N32K 1REVA 2BUPA 4WFBL 1YTUA 1HKCA 3VN5A 3IFRA 3U6FA 2B5JA 3CCVN 1UWBA 2A3ZA 3LALA 4EP4A 1NK0A 3SMSA 1BA1A 4W5RA 2VQEK 3JS6A 4X66K 4JKDA 1S1XA 4CZMA 4BE1A 1DTTA 1X3MA 1JCEA 2P9UA 3VTIA 4LFAK 3FZHA 3QEVA 4PY5A 3AA5X 2QWOA 4YDUA 2HVIA 4EZ9A 4E7JA 2V51B 4K25A 4BG8A 2O8FB 3WEEB 3VTHA 3M8QA 5CYMA 1GLBG 2A42A 2F8TA 3ENOA 4JKBA 4CIFA 3HP9A 3VOVA 1LWEA 4NCAA 3CC7N 3C7NA 4C23A 2NLXA 3HOSA 4B9UA 4DTRA 4DR7K 5F2RA 4X65K 3D2EA 3M5RA 3WNGA 4DR4K 3D45A 4QOZB 2EX3A 1IO2A 4HVJA 3CCQN 3V1RA 2P9UB 4YOXA 4M41A 2D0BA 1GLLO 4C8KA 2HNDA 1SAZA 4FWKA 4H5RA 4AM6A 1ZBSA 5JLFA 2A5XA 4O5FA 1UOCA 1BO5O 4KBOA 4KHWA 1KAXA 1VK0A 3QNNA 3C94A 5M1KA 3C7NB 2WUSA 4JI2K 5C15A 3CJ1A 3QLHA 3O9QA 3AVMA 3CERA 2Q3SA 2P9KA 4PKIA 1W9HA 2O8BA 1NBWA 4BWMA 4CZKA 2VGMA 4CJ3A 1TL1A 4FPAA 1D5AA 4C1NK 1YT3A 5GAHP 1TKZA 3ULEB 4NCBA 4IFEA 4DU3A 3OHRA 1S1WA 4DTNA 4M3YA 3K59A 2DTUA 3CCLN 1EXQA 1VSDA 2AA4A 1GOBA 4I7FA 4JHDA 3CC4N 3SPZA 2B6AA 1J54A 3J81O 3CJ9A 3LDQA 3AVLA 2V7ZA 2YNHA 4BWJA 5F0XA 4RW6A 1Q81O 3P39A 2D0PA 1N5YA 4CZHA 3HO1A 3ULDA 2P9KB 3OY9A 4LD0A 3HOTA 3C6AA 4DV5K 1L3UA 3TAGA 1BU6O 3LDPA 3I0SA 1C1AA 4UQGA 3V81A 4FJLA 1RT4A 3PUFA 4PKGA 2PAVA 1KRPA 3B6OA 4M3UA 4ZTFA 1XNQK 4BREA 3VEWA 1KSPA 1B9DA 4JHDB 1KC8O 1BCMA 3AA4A 3KWIA 3NF7A 2WTUA 3ZEUB 5J2QA 1FXXA 4JRPA 3SAHA 3EY1A 4FLWA 2G8HA 4M3TA 3HVRA 1ZBIA 4FK2A 5FRMA 4DQSA 2KFZA 4CEZA 2IC3A 1NG9A 1DKGD 1VRTA 1IH7A 5KRSA 1Z26A 4OJRA 4LSLA 4CJSA 4KH5A 1J6ZA 5JVGL 1NJWA 3ZSYA 1QSYA 3S3NA 2ASOA 1T6DA 4WFNL 4FJGA 4KKOA 4BRLA 1LWCA 3EE8A 1WN7A 3AVAA 5J2PA 4LF4K 3DXMA 3C6TA 3NGIA 1CZBA 4CJLA 4JK7A 1ATRA 1HLUA 4CCHA 4LSNA 4YOUA 4CJVA 4I2PA 3NGZA 4J2AA 2ZQBA 2HHWA 1ILYA 4B1ZA 4IO8A 5I9EB 4JN4A 4JLHA 5AQWA 4CGIA 2E5LK 1O13A 4DQ8A 1SKSA 2JLEA 1HPZA 4FLVA 2Y1JA 4MLEA 4OGEA 3K58A 4IWVA 4JAXA 4HUGA 3CCEN 1VRUA 4YOTA 1NOYA 5AZJA 2YKMA 3MXJA 1HJOA 4F3TA 1KCFA 2H3GX 4CJFA 1VSMA 2CGKA 3DXMB 5AQVA 5AZIA 3LP1A 4NXMK 1IKYA 4PA1A 1UA1A 2HVHA 3TTDA 5FPEA 3HXMA 2GV9A 4CE9A 3P31A 2FF6A 3SBTA 3VEZA 4RW9A 4B9MA 1WUAA 4FSVA 5C2FA 4IO9L 1VSLA 4FZXC 4W5TA 3VA0A 3O8MA 3ZETB 4ILHA 4CF1A 4WCEL 4Y1CA 3C95A 3T3FA 4DG1A 2HHSA 1E4FT 3WNEA 3A5MC 4CZFA 3OYMA 3V4IA 3EKUA 1YVNA 3TSQA 4B1UB 5KQDA 1ZBHA 5AZJB 3PX0A 3TWHA 3RMAA 3K5LA 4A62A 1NGCA 1Q8IA 4DQQA 5AQZA 4KHPK 3VQ8A 1KVCA 2OZSA 4B9NA 1U2VA 5BR9A 4FO0A 1NNEA 5IWAK 1V4TA 4EHUA 4W5NA 2RHKA 1NGHA 1BISA 2QWNA 3VEXA 5LJVA 3EEQA 5GINA 4DFMA 1ZBUA 4JS4A 1YF5L 3KVGA 1QZ5A 3ENHA 1D9FA 4B08A 1HNIA 2JWLA 2HBLA 1NKBA 4B9TA 3SV3A 3TANA 4CFDA 4DLEA 4KPYA 3VGMA 1RBUA 1VQ8N 2P9LA 4BVPA 4MFBA 1UA0A 1LOTB 3TR8A 1GLJO 1U2VB 3O3HA 2IAJA 1JCFA 3NH1A 3OYHA 1NOZA 2NRVA 2QWQA 5AQJA 4CJKA 3MECA 3J7AP 3HTVA 5BREA 2HW3A 3KKSA 3OYAA 3B8AX 3FR0A 2OYQA 3T7ZA 1Z05A 1BHLA 4DSIA 4E0DA 1I3AA 1NGFA 3MEDA 3VQCA 5LMUK 3RWUA 2NRTA 3CCSN 1JLCA 3NF8A 1UAXA 4DUZK 1RT1A 3AA3A 3SUPA 1S6QA 1N6QA 4JI4K 4M3ZA 1P8ZA 1HNWK 3L6QA 3U8XA 1JJ2M 5AQRA 3TTCA 2W6KA 2YV0X 4O0JA 4B9SA 4DU4A 1Q9XA 3KK7A 1U04A 3DLRA 1HNXK 2P9LB 2WFBA 3R9PA 4CIGA 1XI1A 5BN9A 1S1VA 4FWLA 4CFAA 3IAYA 1QS4A 3TPQA 4Z4GA 4FM1A 2HF4A 3HSCA 4ELVA 1N34K 4CEDA 4MLHA 1E3MA 3ZSXA 2NRZA 3RMCA 4CBUA 4DSJA 4YNQA 3GL1A 3L2QA 2F96A 3S9HA 1VQ6N 1IV0A 4LFCK 3E9LA 1MU2A 1T8EA 5FRNA 1IG9A 3ZX2A 4CEAA 2ASPA 1CLQA 2HBJA 1YITN 1RDAA 1VQON 4OKEA 5J2NA 3NGYA 1QQCA 3PX6A 4IOAL 2D1KA 3MMVA 3TARA 2QXLA 4CZJA 4KREA 3QDKA 2FBYA 2HMIA 4DV0K 1NU0A 4Q5VA 4CFCA 2UXCK 1K8KA 2QKKA 3JAMO 4FPBA 4B8CA 2BE2A 2BDPA 1NK4A 4DS4A 3VQ5A 5LMNK 3S3MA 3I56N 3J8AA 3NHGA 4F2RA 1YI2N 4IFVA 1XMQK 3AVHA 1HPMA 3L2UA 4N56A 3EO3A 4FLTA 1OH6A 1VQ7N 3SUQA 4B1XB 3ZLJA 4BRPA 5KI6A 1VSKA 5HRPA 3KK3A 1NGAA 2QXFA 3DXKA 3A0IX 1C6VA 3L2VA 1D9DA 4DQRA 4FM2A 4FLXA 1ATNA 1HQUA 3MCAB 1K8KB 3NDKA 2UU9K 4LFBK 5JVHL 3ZX0A 2G8UA 5DM6L 2QWLA 4DUYK 3U3YA 5K14A 3HPGA 1HRHA 3LP0A 4BRFA 1U48A 3BF1A 3H6EA 4CJEA 3O3GA 1ZBLA 4E1JA 2NRXA 2GWJA 3SPYA 1SL0A 3VF2A 3LWLA 5GAGP 3PIOL 2KZMA 4DU1A 4OKKA 4CHNA 1MWKA 1QQOA 3GDQA 4FLYA 3VQ4A 4DCHA 3CETA 4CGJA 3HYFA 4GVEA 3D0PA 3IKMA 2ZE2A 4FJJA 4JV5K 2VWKA 4JS5A 3DXKB 1VQMN 1S22A 4MDAA 3G6EN 3CFRA 4FL9A 3DLLL 2ZGZA 3ZT4A 3QEWA 1YJ9N 4BGAA 4RWTA 1JXBA 4B1YB 4DFJA 4LF6K 4CEFA 4DF8A 1RT7A 5M1FA 1GOAA 1XMOK 2OZMA 5C0YA 4DV7K 1RT2A 3OS2A 4GY2B 4DFKA 3RRHA 4GV6A 4A61A 3SV4A 4FWSA 4B1WB 1T03A 3D2FA 3V9WA 2YX6A 1CXUA 3CCUN 2P5OA 1GLDG 4CK3A 1RGIA 2UXBK 1Q9YA 3GOIA 4DR5K 1KVBA 3TU5A 5BRHA 1K8AO 1JLGA 1EX4A 2G8FA 3IUCA 4IZ9A 2E2OA 2P5GA 4JI6K 1CZ9A 4WFAL 2IIRA 1HUXA 3K2PA 4PKHA 3SQ1A 2IOCA 3B6PA 1T3VA 2HB5A 3K0SA 3SQ2A 4KB1A 2F7TA 2QKBA 4H0VB 5LY3A 4DFPA 3AVGA 4KV8A 5C24A 4KHYA 3KKRA 3AO4A 3ZT0A 1L3SA 1VQLN 1TKXA 3L4IA 5HROA 1SZ2A 2F9WA 1XC3A 3D2FB 3CXCM 3PO4A 5AFUA 3HBTA 2KTQA 2VYPA 2I7NA 3CCMN 3ZSQA 2PBDA 5AQQA 5EU7A 1BQNA 1TYQA 3A5OC 4JD2A 3M6GA 1VSIA 3T19A 4K42A 1ESVA 2HHTA 3L2RA 5JMVA 2P9PA 1NGGA 1NLVA 4O0IA 3G25A 1TV6A 3C6HA 3OYLA 4N41A 5B8HA 1RDBA 3MDQA 1BIZA 4B9QA 3IDHA 3T1AA 5HL7L 3VQ9A 1WBDA 2A1SA 2HMPA 3LAKA 4FJKA 1D8YA 1IKXA 3HRGA 5AQLA 4H0OA 4NB4A 3VQ7A 1TK8A 4OX9K 3A5LC 1X9SA 2HSTA 1RTHA 3DRPA 3OS1A 3NF9A 3SAGA 2VG6A 3RR7A 2IVPA 4K41A 1IBLK 4GV9A 1Q7YO 4DV2K 3F73A 4ZTJA 4JD2B 1TYQB 4FWRA 4E7KA 4CHZA 3DLBA 2YI1A 2RN2A 3EZWA 3THVA 2O8DA 3M1FA 2P9PB 4BDZA 1SL1A 4QS8A 4YHHK 4CJRA 4IJNA 1ZBFA 3O4NA 5KGWA 3P83D 3TAQA 1NMDA 1C0FA 3ENBA 4FOEA 1RT5A 4DV3K 4IEEA 3V9SA 4JI0K 3IG1A 3R8EA 3HK2A 3VMFB 4AF1A 1SL2A 3TAMA 4FJXA 3W3DA 4OLAA 4FJ7A 2NRWA 3OA9A 1NM1A 2E8AA 2IDOA 3D2EB 3S41A 2A41A 1KFDA 3U9DA 1W2BM 3SLCA 4AQYK 4CHQA 3ZT2A 4ICLA 1FK9A 3WXMB 3VQPA 1EP4A 3SUNA 4I9QA 2QA4N 4CBXA 3MWTA 3VEOA 3P38A 2O8DB 4YOWA 3LWMA 5MLCQ 1GLCG 4KHQA 4QAGA 3V9XA 3RMBA 3G10A 3PSIA 4IDHA 1BWFO 4CZGA 4M3XA 4NO7A 3OTOK 1S1TA 3OBWA 1RBVA 3OJUA 4KHUA 2X6SA 3BGRA 4ILJA 4I2QA 1Y97A 2FC0A 1TAUA 4RW8A 1OH5A 3H46O 2O8BB 2P9SA 3BZKA 5AQYA 4JK9A 4TSXA 1IG8A 1KLMA 1JL2A 2VG5A 4CJTA 3DWLA 3QB0A 3O9TA 1DLOA 3SI6A 2WONA 4RW7A 2ITGA 4CD3A 2XY6A 3NVMA 2GTDA 3K9KA 3LM9A 2OANA 4FM0A 3K5OA 5AQSA 4FW1A 4BE0A 4IOCL 4IG3A 1S9GA 1RT6A 2VG7A 1YJWN 5I42A 3BP8A 4U7BA 3L2WA 3ZSVA 2DFHA 5KQ8A 1WSHA 5BR8K 2Q1NA 4KO0A 2CGLA 1RBRA 2P9NA 3K5MA 4EZ6A 2P9SB 4DLGA 5JLHA 4W5QA 1NMNA 4BRQA 4LH5A 4MDBA 4JRQA 1JLFA 4CK1A 1EETA 2YNIA 4I6MA 4F3OA 2ZJPL 3BUZB 3CYMA 4BRAA 4H5VA 5EY4A 5AQHA 4O5BA 3F9MA 4DTSA 3KK2A 2KZZA 4FLZA 1L3VA 2FSNA 3WQUA 3MK6A 1HMVA 1T05A 1JXEA 3CQXA 4KAZA 3DLGA 3AAPA 3WXJA 1T6CA 3MEEA 1TVRA 3SNNA 4DV1K 4KTWA 4HTLA 4LF8K 4CHPA 3KZBA 1U49A 3HM9A 2P9NB 2Z1GA 1BDGA 2JWKA 1TKTA 3O4WA 5J1EA 3HL8A 1JLBA 2OPPA 4DSKA 2BGGA 3I8DA 2YHYA 3LP3A 4DB3A 4B8AB 4I6MB 5M1QA 2D0OA 3THXA 3L8BA 3OVNA 1NK8A 2ZJRL 3I8BA 3RMDA 3U4LA 1TUUA 2FF3B 1WAFA 1IBMK 1EQYA 3T1YK 3C0BA 3W0LA 1P90A 4JI1K 3VF4A 4PWDA 1SS6A 3DAWA 3KLEA 2JGUA 3HJFA 5EOYA 1DGKN 4N47A 5AQTA 2YHWA 2YJEA 4BRIA 3DRRA 4BR0A 3CFPA 2YHXA 4DF4A 4K0KK 1WSIA 3ALYA 4FWNA 5T7BA 4EHTA 4PHTX 4CIEA 4CI6A 2ZF5O 2UYTA 1JLAA 2OPSA 4NLBA 3BY5A 4JEPA 4JYAK 4GKKK 4EIAA 2QWRA 3THXB 3ZT1A 1YTAA 3AVNA 3O9RA 2HHXA 1SQKA 5AZIB 4BRNA 3D6RA 4H03B 5C12A 1TAQA 1HQEA 4C8MA 1XHZA 4OPAA 3PV8A 4ISEA 5CY4A 3CD6N 3CJAA 1WOQA 4KB0A 4F2SA 1WSGA 2A40A 1GLEG 3OJSA 4JKGA 1XWLA 4A2BA 4H0YB 4AHTA 4FJ8A 4CJ5A 2ZM6K 3E01A 5CHIA 3G4SN 2ETJA 3M8RA 3OYIA 3MX5A 4FCYA 1NKEA 5DM7L 4IBNA 1J53A 2NZTA 3VQDA 1R0AA 2RF2A 1OVYA 4CEOA 3P1GA 3U9ZA 1L5UA 3PY8A 3KD1E 1KQSM 2GELA 1JL1A 3AGKA 3HSTB 4CHOA 4K8XA 2UUBK 1YJNN 2KHOA 3ATVA 4CJPA 3MN6A 3SZ2A 4WYBA 4BRDA 3O5BA 1LW0A 4Z4IA 1RTJA 1LW2A 3AVBA 3KLHA 3KIOA 3HI0A 3RRGA 4YORA 1MDUB 2IGIA 1RTIA 1VHXA 4M3RA 2A1RA 2BH1A 4B1VA 4K8ZA 4Z4EA 4HHTA 3H1QA 5HBMA 3R3LA 4J8FA 3QMLA 2HF3A 3DYAA 2YNGA 4XH4A 1KLNA 4Y1DA 4JKGB 2BTFA 4WQ5C 4JKCA 3CM6A 1TL3A 3U3GA 2W6LA 1U45A 4FW2A 4DTXA 4DR6K 3J7ZO 4N76A 1QHAA 3DLEA 3SBGA 2A6AA 3HVTA 1X9JA 4JNEA 3E1YA 1XC9A 4H0PA 5M1NA 2KFNA 3VETA 3D7EO 4NYNA 1XUPO 2G8WA 3AVFA 5AQFA 4QS7A 4IJAA 1HNZK 2XY8A 4CVNE 2PYJA 4CZLA 1Q82O 3EKSA 2QWPA
chains in the Genus database with same CATH topology
4JYAK 4DV2K 4NXNK 4GKKK 5A2QO 4B3SK 1XMOK 5BR8K 4DV7K 4LF9K 2HHHK 2UUAK 1N32K 4YHHK 4DV0K 2UXCK 3JAMO 2UXDK 2E5LK 5AJ3K 4DV3K 4X62K 2UUCK 4JI0K 2UXBK 2VQEK 2VQFK 4DR5K 4X66K 4LF5K 4CW7B 5LMNK 4GKJK 3J81O 3J80O 4LFAK 3J7AP 1J5EK 4LF7K 4V19S 4DR2K 1IBKK 4JI5K 5IT9O 4JI6K 1XMQK 4B3TK 4AQYK 3T1HK 2ZM6K 5LMUK 4JI3K 4B3RK 4X64K 4DV1K 4DUZK 4DV5K 4LF8K 4NXMK 4JI4K 1HNWK 1N33K 2UUBK 4DR7K 3J7YP 2UU9K 4X65K 1HNXK 3OTOK 4LFBK 4DUYK 4DR4K 2F4VK 1XNQK 5FLXO 1IBMK 4JI7K 4DV6K 1N34K 3T1YK 1XNRK 4JI1K 4JI8K 4KHPK 4DR6K 4DR3K 4JV5K 5LL6Z 1HR0K 4LFCK 5IWAK 4OX9K 4B3MK 4K0KK 1I94K 4JI2K 4YY3K 1N36K 4LF4K 4DR1K 1HNZK 4CVNE 1FJGK 1IBLK 4LF6K 4DV4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA K;  4DV2 K;  4NXN K;  4GKK K;  5A2Q O;  4B3S K;  1XMO K;  5BR8 K;  4DV7 K;  4LF9 K;  2HHH K;  2UUA K;  1N32 K;  4YHH K;  4DV0 K;  2UXC K;  3JAM O;  2UXD K;  2E5L K;  5AJ3 K;  4DV3 K;  4X62 K;  2UUC K;  4JI0 K;  2UXB K;  2VQE K;  2VQF K;  4DR5 K;  4X66 K;  4LF5 K;  4CW7 B;  5LMN K;  4GKJ K;  3J81 O;  3J80 O;  4LFA K;  3J7A P;  1J5E K;  4LF7 K;  4V19 S;  4DR2 K;  1IBK K;  4JI5 K;  5IT9 O;  4JI6 K;  1XMQ K;  4B3T K;  4AQY K;  3T1H K;  2ZM6 K;  5LMU K;  4JI3 K;  4B3R K;  4X64 K;  4DV1 K;  4DUZ K;  4DV5 K;  4LF8 K;  4NXM K;  4JI4 K;  1HNW K;  1N33 K;  2UUB K;  4DR7 K;  3J7Y P;  2UU9 K;  4X65 K;  1HNX K;  3OTO K;  4LFB K;  4DUY K;  4DR4 K;  2F4V K;  1XNQ K;  5FLX O;  1IBM K;  4JI7 K;  4DV6 K;  1N34 K;  3T1Y K;  1XNR K;  4JI1 K;  4JI8 K;  4KHP K;  4DR6 K;  4DR3 K;  4JV5 K;  5LL6 Z;  1HR0 K;  4LFC K;  5IWA K;  4OX9 K;  4B3M K;  4K0K K;  1I94 K;  4JI2 K;  4YY3 K;  1N36 K;  4LF4 K;  4DR1 K;  1HNZ K;  4CVN E;  1FJG K;  1IBL K;  4LF6 K;  4DV4 K; 
#chains in the Genus database with same CATH topology
 2FXU A;  1FKP A;  4CJW A;  4YOV A;  4F4K A;  2GUI A;  2KW4 A;  3M3Z A;  4IXC A;  4ISG A;  4ID1 A;  4BRG A;  5GAE P;  1JCG A;  5CR4 A;  1EWR A;  2EHG A;  1RFQ A;  4OKJ A;  4NYF A;  3K5N A;  4DQI A;  5AQK A;  3PSF A;  4GW6 A;  3OYG A;  1HX1 A;  3O08 A;  4UY8 O;  1VQN N;  5BPM A;  2J4R A;  2D0C A;  1Q18 A;  3A5N C;  3A2F A;  4BRH A;  4IDK A;  3VPZ A;  3I0R A;  3N4P A;  4KH6 A;  3F2K A;  2QEX N;  4GMJ B;  5FRO A;  4OO1 J;  4CJU A;  3ITH A;  3LDL A;  4DHY A;  3ZSR A;  4BC2 A;  4H8K A;  4GKJ K;  2VWB A;  1O1W A;  3QO9 A;  5DK5 A;  4LF7 K;  1HYS A;  2OTJ N;  4E1M A;  5C25 A;  4B3T K;  3QES A;  3MN5 A;  3OS0 A;  3T1H K;  5CYQ A;  4ZHR A;  5SWM A;  1WSE A;  3DRS A;  4OPK A;  1HKG A;  1QE1 A;  4XH1 A;  2O8C A;  4WQ5 A;  4X64 K;  3Q7B A;  1NK9 A;  2YHB A;  3HPO A;  1RBS A;  1QVG M;  4CJ4 A;  5JS2 A;  1XQS C;  2HHV A;  5FPN A;  4HCB A;  3ASM A;  2WC9 A;  1VSE A;  1HKB A;  3NE6 A;  3WXI A;  2Z1H A;  2WBN A;  2D4W A;  3AGR A;  2F4V K;  5TKW A;  4DMN A;  1NGD A;  5DMR A;  1RTD A;  3VA3 A;  4H5N A;  2XY7 A;  3VGL A;  1T44 A;  2O4I A;  3K9J A;  3CQ8 A;  3TSU A;  4H4M A;  2E88 A;  4BQZ A;  5D3G A;  3V6D A;  1NKC A;  1ZYQ A;  2QM1 A;  3H1V X;  3UKU A;  3WXK A;  4BGB A;  3CPE A;  2O8C B;  4N5S A;  1HYZ A;  1HR0 K;  1B9F A;  3P5J A;  1S3X A;  3O4Q A;  4GV3 A;  4E19 A;  1LWF A;  3E66 A;  3CJ7 A;  1E4G T;  2P9I A;  4CGH A;  4CES A;  2HOE A;  3QEP A;  4BY9 C;  2FLO A;  3CMA N;  5C10 A;  4FJ9 A;  1VSF A;  4E7H A;  1S5J A;  1BG3 A;  4J2E A;  2YNF A;  3FZF A;  3ZSW A;  4ELT A;  2IVN A;  2E2N A;  2YKN A;  3EYZ A;  4AHU A;  4DSF A;  5EXW A;  3CFO A;  3MAQ A;  2DFF A;  3L4Q A;  3DLK A;  4A2A A;  4X62 K;  2UUC K;  1NGE A;  3JYT A;  2XO7 A;  1EKE A;  3TTF A;  3CHW A;  5ADX A;  4ILG B;  4Y0W A;  3EE9 A;  4L8R B;  1BL3 A;  4CW7 B;  1BI4 A;  1K6Y A;  2ZWH A;  4DTO A;  3OBY A;  3BDP A;  4H5W A;  3O3F A;  4NLC A;  4KHN A;  2Q0R A;  4V19 S;  4J2D A;  3LDN A;  2P9I B;  2QK9 A;  3QIN A;  1IKV A;  3THY A;  5F1X A;  1QSS A;  1EO1 A;  3LM2 A;  3NBP A;  3V1O A;  3NMU A;  1RT3 A;  3CME N;  2DY4 A;  4O4G A;  3UKR A;  2PY5 A;  3DJC A;  5KTQ A;  2CGJ A;  3AA2 A;  2KLA A;  3VQB A;  5FPM A;  4E1N A;  3MCP A;  1KXP A;  3QBW A;  3E9O A;  3LPT A;  4PQU A;  1DTQ A;  3QEI A;  1MWM A;  4FZZ A;  2ASM A;  1BI4 B;  1RDC A;  3SJH A;  3WEE A;  4FK4 A;  4AHS A;  4BR9 A;  2GUP A;  3FE1 A;  4H4O A;  4C1N I;  4FK0 A;  2ZGY A;  3MN9 A;  1W7A A;  5HRN A;  3WXL A;  4MQ3 A;  4JI8 K;  1BCO A;  1NGJ A;  3THY B;  1CXQ A;  3HP6 A;  5AFU H;  3FLC O;  1KAY A;  5BPL A;  3ZT3 A;  1VQ9 N;  2FBX A;  3HM8 A;  3TAF A;  3BZC A;  3GBT A;  1LV5 A;  2X74 A;  3UKR B;  5M1P A;  3AO2 A;  4ELU A;  5LJW A;  1ATS A;  4U67 L;  1TK0 A;  4H5T A;  4E7I A;  4C8L A;  4BDP A;  3AVC A;  4Z94 A;  3K57 A;  3CCR N;  1Q86 O;  2Z1I A;  3S3O A;  4E3S A;  3DOK A;  1NGI A;  2G8I A;  5A2Q O;  2VCP A;  4MO5 A;  3O1W A;  4JKE A;  4AH9 A;  5AQU A;  2HHH K;  4WE1 A;  3JSM A;  2HBM A;  4CGF A;  1S9E A;  1X3N A;  3FFI A;  3VEY A;  3SMP A;  5JS1 A;  1NJX A;  2PFU A;  3I33 A;  2E1Z A;  3BF3 A;  1Z6R A;  1IKW A;  3NAE A;  1VQP N;  1DEJ A;  4L3Q A;  1M1K O;  2AJQ A;  3AAQ A;  1X9M A;  2PYL A;  3RVC A;  4DR2 K;  3QFU A;  3R6M A;  1XHX A;  4H0T B;  3LZJ A;  4FWP A;  3CPW M;  4EFH A;  3A8Y A;  2Q36 A;  4FJH A;  4FJ5 A;  2G8V A;  4LY7 A;  4PL8 A;  4JI3 K;  5JIC A;  4BR2 A;  3ULE A;  3RTV A;  2GX9 A;  3KWG A;  2XY5 A;  1NJI O;  1NK5 A;  4BRC A;  3O80 A;  4BRO A;  3AVK A;  3CJB A;  4KFB A;  1N33 K;  1SKW A;  1V4S A;  2O8E A;  4O55 A;  1HYV A;  1JLE A;  1QQM A;  5GIO A;  3IRX A;  4QS9 A;  4Q0B A;  2DFE A;  4IOX A;  4RTF D;  3KTQ A;  4KH4 A;  4CK2 A;  2V7Y A;  3OYC A;  4RW4 A;  4AM7 A;  5BN8 A;  3AVJ A;  3LP2 A;  3H08 A;  1YHQ N;  1BUP A;  4BAC A;  3WQT A;  5HLF A;  1JLQ A;  1OH8 A;  2QTD A;  5BRF A;  3VEN A;  4CJQ A;  2HHQ A;  1S1U A;  4B9V A;  2Q2R A;  2E2P A;  4FJI A;  5CZ1 A;  3VEV A;  4AHV A;  1U4B A;  4FWQ A;  1ITG A;  3SCX A;  4KI4 A;  1YUW A;  5AQP A;  3FGU A;  1WNS A;  5C2D A;  2E6L A;  1ASV A;  2Q31 A;  1BA0 A;  2W42 A;  2GEM A;  3VES A;  5E26 A;  4R79 A;  5H1S Q;  1OH7 A;  4DSE A;  2O8E B;  3KK1 A;  2CH6 A;  3SUO A;  1GOC A;  3VQE A;  4KTZ A;  4JKF A;  3ZEU A;  2Q97 A;  4CEE A;  4XH5 A;  2ITM A;  5SZT A;  3TI0 A;  1C1C A;  4LF9 K;  3NF6 A;  1ZXO A;  2RKI A;  1NK6 A;  3CQY A;  4OPH A;  4FVM A;  1OVQ A;  3T69 A;  3QEX A;  3KLG A;  4IG0 A;  1VQK N;  5KPR A;  1RIL A;  3MX2 A;  3KD5 E;  3AV9 A;  3L3V A;  4B9L A;  4CD1 A;  3HT3 A;  4DSL A;  3TAB A;  1NJY A;  5AQN A;  3M8S A;  1S6P A;  2VQF K;  5GAD P;  4WQ4 C;  4CF8 A;  2GBZ A;  2OPQ A;  3O6W A;  3VQA A;  4LC9 B;  1IBK K;  4JI5 K;  5J2M A;  3CC2 N;  1K73 O;  2NRH A;  1SKR A;  4BRM A;  2AP1 A;  1T7P A;  3PX4 A;  5AQM A;  4EP5 A;  1H1V A;  1QTM A;  2W40 A;  4B3R K;  2OPR A;  1KAZ A;  3O9U A;  1NWK A;  1VSH A;  4IFY A;  3EL2 A;  2X78 A;  4BC5 A;  1Z25 A;  3VGK A;  4O44 A;  3AAR A;  5HRR A;  3V9U A;  2XHB A;  3FZK A;  3CJC A;  5M1O A;  5CZ2 A;  3HPH A;  1C0M A;  3AVI A;  2D0A A;  4XEI A;  3ZYY X;  4AIL C;  2ZJQ L;  2KQ2 A;  3PO5 A;  2PZS A;  1VAZ A;  4CF0 A;  3PIP L;  4AHC A;  1KVA A;  5AQX A;  1BQM A;  4DV6 K;  4DTU A;  1KD1 O;  4DS5 A;  1VQ5 N;  5E84 A;  1XNR K;  4FJM A;  1TGO A;  4O8K A;  2E20 A;  4O8U A;  2KKZ A;  1RNH A;  4G9Z A;  1WSF A;  4KTQ A;  4DR3 K;  4WF9 L;  3UB5 A;  1J5O A;  4M42 A;  1VQ4 N;  3LPU A;  1TK5 A;  5C42 A;  3G0Z A;  3ZET A;  1BIU A;  3QIO A;  3QIP A;  4WQ4 A;  5AR0 A;  1N36 K;  1C0G A;  4DR1 K;  2OTL N;  1A5W A;  1QQN A;  1MA9 B;  1YAG A;  1C0U A;  4FYD A;  3DMJ A;  3NH0 A;  1D4X A;  1ZC6 A;  4KHS A;  2OA8 A;  3WUH A;  2OCE A;  3RR8 A;  2D5R A;  2CH5 A;  5HP1 A;  5I3U A;  4PUO A;  3QET A;  4FZY A;  2UXD K;  1W0H A;  2FSJ A;  1WSJ A;  3AO1 A;  5AQO A;  4IKF A;  4MO4 A;  3VF6 A;  3OYN A;  3NFA A;  2YHA A;  4K43 A;  3GE1 A;  1YIJ N;  4Z4H A;  1FKO A;  1FW6 A;  1GLF O;  3CM5 A;  3M8P A;  3DI6 A;  2NRR A;  3SQ0 A;  2E4L A;  4IEI A;  4C8O A;  3QBX A;  3ZSO A;  5CE3 A;  3AO3 A;  5IT9 O;  3DOL A;  3FZM A;  1RDW X;  1QSL A;  2V52 B;  4A5B A;  1R59 O;  3DM2 A;  4DKW A;  3ZCM A;  2FSK A;  5KPT A;  3IS9 A;  4DQP A;  3RSE A;  2IVO A;  4FLU A;  2ZD1 A;  3QER A;  3LAM A;  1LAW A;  3MEG A;  1RCH A;  1G15 A;  4JKH A;  4CZE A;  3O9S A;  3Q7C A;  4AHR A;  3VER A;  4BDY A;  1WB9 A;  2E6M A;  2DPN A;  3HZ6 A;  3ZX3 A;  3SYZ A;  4E7L A;  1QZ6 A;  4HUE A;  4CF9 A;  2W41 A;  4JI7 K;  1M90 O;  1F21 A;  2IS3 A;  4FOI A;  4LH4 A;  3QNO A;  4BR5 A;  5KRT A;  3OYJ A;  1A5V A;  4BQL A;  3O1B A;  4Z4C A;  1WBB A;  4RG8 A;  3KLI A;  3MXM A;  4R5P A;  2Y1I A;  4DTM A;  2QWM A;  2I7P A;  5LL6 Z;  2Q0U A;  3G71 N;  3RSE B;  1I94 K;  4CBW A;  1HJR A;  2WOM A;  3E9P A;  4H0X B;  2NNW A;  4YY3 K;  4PL7 A;  4CEB A;  1FJG K;  1B92 A;  3C65 A;  4DV4 K;  4CGG A;  3H3N O;  2P1J A;  1DT9 A;  5AQI A;  3QIC A;  3WT0 A;  2EWS A;  3ISN C;  4I9L A;  2X6N A;  4CF2 A;  3CCJ N;  4ISF A;  3KHY A;  4FJN A;  4KRF A;  1VSJ A;  4CGD A;  1U6Z A;  1RDD A;  1A5X A;  4DWI A;  3PLA A;  4CEC A;  3VQ6 A;  2P51 A;  5E41 A;  5HRS A;  2E1Y A;  4LF5 K;  1C1B A;  5FDL A;  4OGC A;  1WLJ A;  3BEX A;  1J5E K;  1ASW A;  1NJZ A;  4DTP A;  2E2Q A;  2QI2 A;  5TKY A;  1I39 A;  3KJV A;  3TAE A;  4JK8 A;  3F5T A;  4JKA A;  4KI6 A;  2R7Y A;  4CHY A;  3UE5 A;  4A59 A;  3V9Z A;  3CIP A;  5FPD A;  3FFK B;  4BRK A;  4W5O A;  4FXD A;  3EZ5 A;  5AQG A;  3J7Y P;  3CI5 A;  4CFB A;  3F9K A;  1JKH A;  3LDO A;  1GLA G;  3N4Q A;  2LSN A;  3IMX A;  1NK7 A;  1EWQ A;  1C0T A;  1OKJ A;  3WNF A;  4CER A;  4BC4 A;  3MXI A;  2G8K A;  1YXQ A;  4XIU A;  4OPJ A;  3MWP A;  1QHT A;  5EVZ A;  3OW2 M;  1X9W A;  4Z4F A;  2HBK A;  3THW A;  2XRI A;  3I55 N;  4RCH A;  4EAH D;  4FWO A;  1CZA N;  4OLB A;  1RBT A;  3JXU A;  1SUQ A;  2HNZ A;  3GG4 A;  1WAJ A;  3SAF A;  2HNY A;  1KTQ A;  1W97 L;  4GNI A;  3SQ4 A;  2I5J A;  3KLF A;  4M7Y A;  2F8S A;  1BGX T;  3UIQ A;  1Y64 A;  4HUF A;  3NH2 A;  1TUY A;  4M7X A;  5AJ3 K;  3TSP A;  2FBT A;  4CEQ A;  2FBV A;  3FZL A;  3LAN A;  2F9T A;  3OYF A;  3THW B;  2ATQ A;  3ID8 A;  3CG7 A;  3J80 O;  3AO5 A;  4G1Q A;  3DLH A;  1X1P A;  3H45 C;  3OYK A;  3CF5 L;  4OVL A;  1HNV A;  2QW9 A;  3OYE A;  4BG9 A;  2B4J A;  5BPN A;  3OYB A;  4GVM A;  5ELZ A;  3LDS A;  5KGX A;  1SV5 A;  4YOY A;  4M3W A;  1J9A A;  3QFP A;  3LZI A;  2VGN A;  2GWK A;  5ADX H;  1IJJ A;  3UKU B;  4Z0U A;  1LCU A;  4BVO A;  4HCC A;  1RDU A;  4M45 A;  2HHU A;  2O4G A;  5HOO A;  1G99 A;  1L3T A;  1BOT O;  3P4I A;  2BAN A;  1U47 A;  5KPZ A;  3ZSZ A;  4M63 C;  3R1X A;  4YFU A;  4J2B A;  1KFS A;  4A57 A;  1NGB A;  5EX5 A;  4BC3 A;  4YDU C;  5FLX O;  3L3U A;  3EN9 A;  3NCI A;  1K9M O;  3NVK A;  3LL3 A;  3H3O B;  2RE2 A;  3MN7 A;  4ID5 A;  4NCG A;  3V1Q A;  4E89 A;  4DTJ A;  2YCH A;  4CZI A;  1N8R O;  4F8R A;  3SJJ A;  3C6U A;  3SK3 A;  1S72 N;  1ASU A;  2Z1J A;  2NUB A;  4BR7 A;  3TAP A;  4BE2 A;  4C8N A;  3ATU A;  4F9O A;  2VWJ A;  4FVU A;  1YVU A;  2YJF A;  1LAV A;  4BR4 A;  4B3M K;  4A5A A;  4FWM A;  1TKD A;  2RPI A;  5GIP A;  2O8F A;  4HTU A;  4CJ7 A;  4QCL A;  4NXN K;  1QVF M;  5BRD A;  4B3O A;  4HWI A;  4B3S K;  3WNH A;  3ID6 A;  3AY9 A;  3VQQ A;  3OYD A;  3L0Q A;  2UUA K;  1N32 K;  1REV A;  2BUP A;  4WFB L;  1YTU A;  1HKC A;  3VN5 A;  3IFR A;  3U6F A;  2B5J A;  3CCV N;  1UWB A;  2A3Z A;  3LAL A;  4EP4 A;  1NK0 A;  3SMS A;  1BA1 A;  4W5R A;  2VQE K;  3JS6 A;  4X66 K;  4JKD A;  1S1X A;  4CZM A;  4BE1 A;  1DTT A;  1X3M A;  1JCE A;  2P9U A;  3VTI A;  4LFA K;  3FZH A;  3QEV A;  4PY5 A;  3AA5 X;  2QWO A;  4YDU A;  2HVI A;  4EZ9 A;  4E7J A;  2V51 B;  4K25 A;  4BG8 A;  2O8F B;  3WEE B;  3VTH A;  3M8Q A;  5CYM A;  1GLB G;  2A42 A;  2F8T A;  3ENO A;  4JKB A;  4CIF A;  3HP9 A;  3VOV A;  1LWE A;  4NCA A;  3CC7 N;  3C7N A;  4C23 A;  2NLX A;  3HOS A;  4B9U A;  4DTR A;  4DR7 K;  5F2R A;  4X65 K;  3D2E A;  3M5R A;  3WNG A;  4DR4 K;  3D45 A;  4QOZ B;  2EX3 A;  1IO2 A;  4HVJ A;  3CCQ N;  3V1R A;  2P9U B;  4YOX A;  4M41 A;  2D0B A;  1GLL O;  4C8K A;  2HND A;  1SAZ A;  4FWK A;  4H5R A;  4AM6 A;  1ZBS A;  5JLF A;  2A5X A;  4O5F A;  1UOC A;  1BO5 O;  4KBO A;  4KHW A;  1KAX A;  1VK0 A;  3QNN A;  3C94 A;  5M1K A;  3C7N B;  2WUS A;  4JI2 K;  5C15 A;  3CJ1 A;  3QLH A;  3O9Q A;  3AVM A;  3CER A;  2Q3S A;  2P9K A;  4PKI A;  1W9H A;  2O8B A;  1NBW A;  4BWM A;  4CZK A;  2VGM A;  4CJ3 A;  1TL1 A;  4FPA A;  1D5A A;  4C1N K;  1YT3 A;  5GAH P;  1TKZ A;  3ULE B;  4NCB A;  4IFE A;  4DU3 A;  3OHR A;  1S1W A;  4DTN A;  4M3Y A;  3K59 A;  2DTU A;  3CCL N;  1EXQ A;  1VSD A;  2AA4 A;  1GOB A;  4I7F A;  4JHD A;  3CC4 N;  3SPZ A;  2B6A A;  1J54 A;  3J81 O;  3CJ9 A;  3LDQ A;  3AVL A;  2V7Z A;  2YNH A;  4BWJ A;  5F0X A;  4RW6 A;  1Q81 O;  3P39 A;  2D0P A;  1N5Y A;  4CZH A;  3HO1 A;  3ULD A;  2P9K B;  3OY9 A;  4LD0 A;  3HOT A;  3C6A A;  4DV5 K;  1L3U A;  3TAG A;  1BU6 O;  3LDP A;  3I0S A;  1C1A A;  4UQG A;  3V81 A;  4FJL A;  1RT4 A;  3PUF A;  4PKG A;  2PAV A;  1KRP A;  3B6O A;  4M3U A;  4ZTF A;  1XNQ K;  4BRE A;  3VEW A;  1KSP A;  1B9D A;  4JHD B;  1KC8 O;  1BCM A;  3AA4 A;  3KWI A;  3NF7 A;  2WTU A;  3ZEU B;  5J2Q A;  1FXX A;  4JRP A;  3SAH A;  3EY1 A;  4FLW A;  2G8H A;  4M3T A;  3HVR A;  1ZBI A;  4FK2 A;  5FRM A;  4DQS A;  2KFZ A;  4CEZ A;  2IC3 A;  1NG9 A;  1DKG D;  1VRT A;  1IH7 A;  5KRS A;  1Z26 A;  4OJR A;  4LSL A;  4CJS A;  4KH5 A;  1J6Z A;  5JVG L;  1NJW A;  3ZSY A;  1QSY A;  3S3N A;  2ASO A;  1T6D A;  4WFN L;  4FJG A;  4KKO A;  4BRL A;  1LWC A;  3EE8 A;  1WN7 A;  3AVA A;  5J2P A;  4LF4 K;  3DXM A;  3C6T A;  3NGI A;  1CZB A;  4CJL A;  4JK7 A;  1ATR A;  1HLU A;  4CCH A;  4LSN A;  4YOU A;  4CJV A;  4I2P A;  3NGZ A;  4J2A A;  2ZQB A;  2HHW A;  1ILY A;  4B1Z A;  4IO8 A;  5I9E B;  4JN4 A;  4JLH A;  5AQW A;  4CGI A;  2E5L K;  1O13 A;  4DQ8 A;  1SKS A;  2JLE A;  1HPZ A;  4FLV A;  2Y1J A;  4MLE A;  4OGE A;  3K58 A;  4IWV A;  4JAX A;  4HUG A;  3CCE N;  1VRU A;  4YOT A;  1NOY A;  5AZJ A;  2YKM A;  3MXJ A;  1HJO A;  4F3T A;  1KCF A;  2H3G X;  4CJF A;  1VSM A;  2CGK A;  3DXM B;  5AQV A;  5AZI A;  3LP1 A;  4NXM K;  1IKY A;  4PA1 A;  1UA1 A;  2HVH A;  3TTD A;  5FPE A;  3HXM A;  2GV9 A;  4CE9 A;  3P31 A;  2FF6 A;  3SBT A;  3VEZ A;  4RW9 A;  4B9M A;  1WUA A;  4FSV A;  5C2F A;  4IO9 L;  1VSL A;  4FZX C;  4W5T A;  3VA0 A;  3O8M A;  3ZET B;  4ILH A;  4CF1 A;  4WCE L;  4Y1C A;  3C95 A;  3T3F A;  4DG1 A;  2HHS A;  1E4F T;  3WNE A;  3A5M C;  4CZF A;  3OYM A;  3V4I A;  3EKU A;  1YVN A;  3TSQ A;  4B1U B;  5KQD A;  1ZBH A;  5AZJ B;  3PX0 A;  3TWH A;  3RMA A;  3K5L A;  4A62 A;  1NGC A;  1Q8I A;  4DQQ A;  5AQZ A;  4KHP K;  3VQ8 A;  1KVC A;  2OZS A;  4B9N A;  1U2V A;  5BR9 A;  4FO0 A;  1NNE A;  5IWA K;  1V4T A;  4EHU A;  4W5N A;  2RHK A;  1NGH A;  1BIS A;  2QWN A;  3VEX A;  5LJV A;  3EEQ A;  5GIN A;  4DFM A;  1ZBU A;  4JS4 A;  1YF5 L;  3KVG A;  1QZ5 A;  3ENH A;  1D9F A;  4B08 A;  1HNI A;  2JWL A;  2HBL A;  1NKB A;  4B9T A;  3SV3 A;  3TAN A;  4CFD A;  4DLE A;  4KPY A;  3VGM A;  1RBU A;  1VQ8 N;  2P9L A;  4BVP A;  4MFB A;  1UA0 A;  1LOT B;  3TR8 A;  1GLJ O;  1U2V B;  3O3H A;  2IAJ A;  1JCF A;  3NH1 A;  3OYH A;  1NOZ A;  2NRV A;  2QWQ A;  5AQJ A;  4CJK A;  3MEC A;  3J7A P;  3HTV A;  5BRE A;  2HW3 A;  3KKS A;  3OYA A;  3B8A X;  3FR0 A;  2OYQ A;  3T7Z A;  1Z05 A;  1BHL A;  4DSI A;  4E0D A;  1I3A A;  1NGF A;  3MED A;  3VQC A;  5LMU K;  3RWU A;  2NRT A;  3CCS N;  1JLC A;  3NF8 A;  1UAX A;  4DUZ K;  1RT1 A;  3AA3 A;  3SUP A;  1S6Q A;  1N6Q A;  4JI4 K;  4M3Z A;  1P8Z A;  1HNW K;  3L6Q A;  3U8X A;  1JJ2 M;  5AQR A;  3TTC A;  2W6K A;  2YV0 X;  4O0J A;  4B9S A;  4DU4 A;  1Q9X A;  3KK7 A;  1U04 A;  3DLR A;  1HNX K;  2P9L B;  2WFB A;  3R9P A;  4CIG A;  1XI1 A;  5BN9 A;  1S1V A;  4FWL A;  4CFA A;  3IAY A;  1QS4 A;  3TPQ A;  4Z4G A;  4FM1 A;  2HF4 A;  3HSC A;  4ELV A;  1N34 K;  4CED A;  4MLH A;  1E3M A;  3ZSX A;  2NRZ A;  3RMC A;  4CBU A;  4DSJ A;  4YNQ A;  3GL1 A;  3L2Q A;  2F96 A;  3S9H A;  1VQ6 N;  1IV0 A;  4LFC K;  3E9L A;  1MU2 A;  1T8E A;  5FRN A;  1IG9 A;  3ZX2 A;  4CEA A;  2ASP A;  1CLQ A;  2HBJ A;  1YIT N;  1RDA A;  1VQO N;  4OKE A;  5J2N A;  3NGY A;  1QQC A;  3PX6 A;  4IOA L;  2D1K A;  3MMV A;  3TAR A;  2QXL A;  4CZJ A;  4KRE A;  3QDK A;  2FBY A;  2HMI A;  4DV0 K;  1NU0 A;  4Q5V A;  4CFC A;  2UXC K;  1K8K A;  2QKK A;  3JAM O;  4FPB A;  4B8C A;  2BE2 A;  2BDP A;  1NK4 A;  4DS4 A;  3VQ5 A;  5LMN K;  3S3M A;  3I56 N;  3J8A A;  3NHG A;  4F2R A;  1YI2 N;  4IFV A;  1XMQ K;  3AVH A;  1HPM A;  3L2U A;  4N56 A;  3EO3 A;  4FLT A;  1OH6 A;  1VQ7 N;  3SUQ A;  4B1X B;  3ZLJ A;  4BRP A;  5KI6 A;  1VSK A;  5HRP A;  3KK3 A;  1NGA A;  2QXF A;  3DXK A;  3A0I X;  1C6V A;  3L2V A;  1D9D A;  4DQR A;  4FM2 A;  4FLX A;  1ATN A;  1HQU A;  3MCA B;  1K8K B;  3NDK A;  2UU9 K;  4LFB K;  5JVH L;  3ZX0 A;  2G8U A;  5DM6 L;  2QWL A;  4DUY K;  3U3Y A;  5K14 A;  3HPG A;  1HRH A;  3LP0 A;  4BRF A;  1U48 A;  3BF1 A;  3H6E A;  4CJE A;  3O3G A;  1ZBL A;  4E1J A;  2NRX A;  2GWJ A;  3SPY A;  1SL0 A;  3VF2 A;  3LWL A;  5GAG P;  3PIO L;  2KZM A;  4DU1 A;  4OKK A;  4CHN A;  1MWK A;  1QQO A;  3GDQ A;  4FLY A;  3VQ4 A;  4DCH A;  3CET A;  4CGJ A;  3HYF A;  4GVE A;  3D0P A;  3IKM A;  2ZE2 A;  4FJJ A;  4JV5 K;  2VWK A;  4JS5 A;  3DXK B;  1VQM N;  1S22 A;  4MDA A;  3G6E N;  3CFR A;  4FL9 A;  3DLL L;  2ZGZ A;  3ZT4 A;  3QEW A;  1YJ9 N;  4BGA A;  4RWT A;  1JXB A;  4B1Y B;  4DFJ A;  4LF6 K;  4CEF A;  4DF8 A;  1RT7 A;  5M1F A;  1GOA A;  1XMO K;  2OZM A;  5C0Y A;  4DV7 K;  1RT2 A;  3OS2 A;  4GY2 B;  4DFK A;  3RRH A;  4GV6 A;  4A61 A;  3SV4 A;  4FWS A;  4B1W B;  1T03 A;  3D2F A;  3V9W A;  2YX6 A;  1CXU A;  3CCU N;  2P5O A;  1GLD G;  4CK3 A;  1RGI A;  2UXB K;  1Q9Y A;  3GOI A;  4DR5 K;  1KVB A;  3TU5 A;  5BRH A;  1K8A O;  1JLG A;  1EX4 A;  2G8F A;  3IUC A;  4IZ9 A;  2E2O A;  2P5G A;  4JI6 K;  1CZ9 A;  4WFA L;  2IIR A;  1HUX A;  3K2P A;  4PKH A;  3SQ1 A;  2IOC A;  3B6P A;  1T3V A;  2HB5 A;  3K0S A;  3SQ2 A;  4KB1 A;  2F7T A;  2QKB A;  4H0V B;  5LY3 A;  4DFP A;  3AVG A;  4KV8 A;  5C24 A;  4KHY A;  3KKR A;  3AO4 A;  3ZT0 A;  1L3S A;  1VQL N;  1TKX A;  3L4I A;  5HRO A;  1SZ2 A;  2F9W A;  1XC3 A;  3D2F B;  3CXC M;  3PO4 A;  5AFU A;  3HBT A;  2KTQ A;  2VYP A;  2I7N A;  3CCM N;  3ZSQ A;  2PBD A;  5AQQ A;  5EU7 A;  1BQN A;  1TYQ A;  3A5O C;  4JD2 A;  3M6G A;  1VSI A;  3T19 A;  4K42 A;  1ESV A;  2HHT A;  3L2R A;  5JMV A;  2P9P A;  1NGG A;  1NLV A;  4O0I A;  3G25 A;  1TV6 A;  3C6H A;  3OYL A;  4N41 A;  5B8H A;  1RDB A;  3MDQ A;  1BIZ A;  4B9Q A;  3IDH A;  3T1A A;  5HL7 L;  3VQ9 A;  1WBD A;  2A1S A;  2HMP A;  3LAK A;  4FJK A;  1D8Y A;  1IKX A;  3HRG A;  5AQL A;  4H0O A;  4NB4 A;  3VQ7 A;  1TK8 A;  4OX9 K;  3A5L C;  1X9S A;  2HST A;  1RTH A;  3DRP A;  3OS1 A;  3NF9 A;  3SAG A;  2VG6 A;  3RR7 A;  2IVP A;  4K41 A;  1IBL K;  4GV9 A;  1Q7Y O;  4DV2 K;  3F73 A;  4ZTJ A;  4JD2 B;  1TYQ B;  4FWR A;  4E7K A;  4CHZ A;  3DLB A;  2YI1 A;  2RN2 A;  3EZW A;  3THV A;  2O8D A;  3M1F A;  2P9P B;  4BDZ A;  1SL1 A;  4QS8 A;  4YHH K;  4CJR A;  4IJN A;  1ZBF A;  3O4N A;  5KGW A;  3P83 D;  3TAQ A;  1NMD A;  1C0F A;  3ENB A;  4FOE A;  1RT5 A;  4DV3 K;  4IEE A;  3V9S A;  4JI0 K;  3IG1 A;  3R8E A;  3HK2 A;  3VMF B;  4AF1 A;  1SL2 A;  3TAM A;  4FJX A;  3W3D A;  4OLA A;  4FJ7 A;  2NRW A;  3OA9 A;  1NM1 A;  2E8A A;  2IDO A;  3D2E B;  3S41 A;  2A41 A;  1KFD A;  3U9D A;  1W2B M;  3SLC A;  4AQY K;  4CHQ A;  3ZT2 A;  4ICL A;  1FK9 A;  3WXM B;  3VQP A;  1EP4 A;  3SUN A;  4I9Q A;  2QA4 N;  4CBX A;  3MWT A;  3VEO A;  3P38 A;  2O8D B;  4YOW A;  3LWM A;  5MLC Q;  1GLC G;  4KHQ A;  4QAG A;  3V9X A;  3RMB A;  3G10 A;  3PSI A;  4IDH A;  1BWF O;  4CZG A;  4M3X A;  4NO7 A;  3OTO K;  1S1T A;  3OBW A;  1RBV A;  3OJU A;  4KHU A;  2X6S A;  3BGR A;  4ILJ A;  4I2Q A;  1Y97 A;  2FC0 A;  1TAU A;  4RW8 A;  1OH5 A;  3H46 O;  2O8B B;  2P9S A;  3BZK A;  5AQY A;  4JK9 A;  4TSX A;  1IG8 A;  1KLM A;  1JL2 A;  2VG5 A;  4CJT A;  3DWL A;  3QB0 A;  3O9T A;  1DLO A;  3SI6 A;  2WON A;  4RW7 A;  2ITG A;  4CD3 A;  2XY6 A;  3NVM A;  2GTD A;  3K9K A;  3LM9 A;  2OAN A;  4FM0 A;  3K5O A;  5AQS A;  4FW1 A;  4BE0 A;  4IOC L;  4IG3 A;  1S9G A;  1RT6 A;  2VG7 A;  1YJW N;  5I42 A;  3BP8 A;  4U7B A;  3L2W A;  3ZSV A;  2DFH A;  5KQ8 A;  1WSH A;  5BR8 K;  2Q1N A;  4KO0 A;  2CGL A;  1RBR A;  2P9N A;  3K5M A;  4EZ6 A;  2P9S B;  4DLG A;  5JLH A;  4W5Q A;  1NMN A;  4BRQ A;  4LH5 A;  4MDB A;  4JRQ A;  1JLF A;  4CK1 A;  1EET A;  2YNI A;  4I6M A;  4F3O A;  2ZJP L;  3BUZ B;  3CYM A;  4BRA A;  4H5V A;  5EY4 A;  5AQH A;  4O5B A;  3F9M A;  4DTS A;  3KK2 A;  2KZZ A;  4FLZ A;  1L3V A;  2FSN A;  3WQU A;  3MK6 A;  1HMV A;  1T05 A;  1JXE A;  3CQX A;  4KAZ A;  3DLG A;  3AAP A;  3WXJ A;  1T6C A;  3MEE A;  1TVR A;  3SNN A;  4DV1 K;  4KTW A;  4HTL A;  4LF8 K;  4CHP A;  3KZB A;  1U49 A;  3HM9 A;  2P9N B;  2Z1G A;  1BDG A;  2JWK A;  1TKT A;  3O4W A;  5J1E A;  3HL8 A;  1JLB A;  2OPP A;  4DSK A;  2BGG A;  3I8D A;  2YHY A;  3LP3 A;  4DB3 A;  4B8A B;  4I6M B;  5M1Q A;  2D0O A;  3THX A;  3L8B A;  3OVN A;  1NK8 A;  2ZJR L;  3I8B A;  3RMD A;  3U4L A;  1TUU A;  2FF3 B;  1WAF A;  1IBM K;  1EQY A;  3T1Y K;  3C0B A;  3W0L A;  1P90 A;  4JI1 K;  3VF4 A;  4PWD A;  1SS6 A;  3DAW A;  3KLE A;  2JGU A;  3HJF A;  5EOY A;  1DGK N;  4N47 A;  5AQT A;  2YHW A;  2YJE A;  4BRI A;  3DRR A;  4BR0 A;  3CFP A;  2YHX A;  4DF4 A;  4K0K K;  1WSI A;  3ALY A;  4FWN A;  5T7B A;  4EHT A;  4PHT X;  4CIE A;  4CI6 A;  2ZF5 O;  2UYT A;  1JLA A;  2OPS A;  4NLB A;  3BY5 A;  4JEP A;  4JYA K;  4GKK K;  4EIA A;  2QWR A;  3THX B;  3ZT1 A;  1YTA A;  3AVN A;  3O9R A;  2HHX A;  1SQK A;  5AZI B;  4BRN A;  3D6R A;  4H03 B;  5C12 A;  1TAQ A;  1HQE A;  4C8M A;  1XHZ A;  4OPA A;  3PV8 A;  4ISE A;  5CY4 A;  3CD6 N;  3CJA A;  1WOQ A;  4KB0 A;  4F2S A;  1WSG A;  2A40 A;  1GLE G;  3OJS A;  4JKG A;  1XWL A;  4A2B A;  4H0Y B;  4AHT A;  4FJ8 A;  4CJ5 A;  2ZM6 K;  3E01 A;  5CHI A;  3G4S N;  2ETJ A;  3M8R A;  3OYI A;  3MX5 A;  4FCY A;  1NKE A;  5DM7 L;  4IBN A;  1J53 A;  2NZT A;  3VQD A;  1R0A A;  2RF2 A;  1OVY A;  4CEO A;  3P1G A;  3U9Z A;  1L5U A;  3PY8 A;  3KD1 E;  1KQS M;  2GEL A;  1JL1 A;  3AGK A;  3HST B;  4CHO A;  4K8X A;  2UUB K;  1YJN N;  2KHO A;  3ATV A;  4CJP A;  3MN6 A;  3SZ2 A;  4WYB A;  4BRD A;  3O5B A;  1LW0 A;  4Z4I A;  1RTJ A;  1LW2 A;  3AVB A;  3KLH A;  3KIO A;  3HI0 A;  3RRG A;  4YOR A;  1MDU B;  2IGI A;  1RTI A;  1VHX A;  4M3R A;  2A1R A;  2BH1 A;  4B1V A;  4K8Z A;  4Z4E A;  4HHT A;  3H1Q A;  5HBM A;  3R3L A;  4J8F A;  3QML A;  2HF3 A;  3DYA A;  2YNG A;  4XH4 A;  1KLN A;  4Y1D A;  4JKG B;  2BTF A;  4WQ5 C;  4JKC A;  3CM6 A;  1TL3 A;  3U3G A;  2W6L A;  1U45 A;  4FW2 A;  4DTX A;  4DR6 K;  3J7Z O;  4N76 A;  1QHA A;  3DLE A;  3SBG A;  2A6A A;  3HVT A;  1X9J A;  4JNE A;  3E1Y A;  1XC9 A;  4H0P A;  5M1N A;  2KFN A;  3VET A;  3D7E O;  4NYN A;  1XUP O;  2G8W A;  3AVF A;  5AQF A;  4QS7 A;  4IJA A;  1HNZ K;  2XY8 A;  4CVN E;  2PYJ A;  4CZL A;  1Q82 O;  3EKS A;  2QWP A; 
#chains in the Genus database with same CATH homology
 4JYA K;  4DV2 K;  4NXN K;  4GKK K;  5A2Q O;  4B3S K;  1XMO K;  5BR8 K;  4DV7 K;  4LF9 K;  2HHH K;  2UUA K;  1N32 K;  4YHH K;  4DV0 K;  2UXC K;  3JAM O;  2UXD K;  2E5L K;  5AJ3 K;  4DV3 K;  4X62 K;  2UUC K;  4JI0 K;  2UXB K;  2VQE K;  2VQF K;  4DR5 K;  4X66 K;  4LF5 K;  4CW7 B;  5LMN K;  4GKJ K;  3J81 O;  3J80 O;  4LFA K;  3J7A P;  1J5E K;  4LF7 K;  4V19 S;  4DR2 K;  1IBK K;  4JI5 K;  5IT9 O;  4JI6 K;  1XMQ K;  4B3T K;  4AQY K;  3T1H K;  2ZM6 K;  5LMU K;  4JI3 K;  4B3R K;  4X64 K;  4DV1 K;  4DUZ K;  4DV5 K;  4LF8 K;  4NXM K;  4JI4 K;  1HNW K;  1N33 K;  2UUB K;  4DR7 K;  3J7Y P;  2UU9 K;  4X65 K;  1HNX K;  3OTO K;  4LFB K;  4DUY K;  4DR4 K;  2F4V K;  1XNQ K;  5FLX O;  1IBM K;  4JI7 K;  4DV6 K;  1N34 K;  3T1Y K;  1XNR K;  4JI1 K;  4JI8 K;  4KHP K;  4DR6 K;  4DR3 K;  4JV5 K;  5LL6 Z;  1HR0 K;  4LFC K;  5IWA K;  4OX9 K;  4B3M K;  4K0K K;  1I94 K;  4JI2 K;  4YY3 K;  1N36 K;  4LF4 K;  4DR1 K;  1HNZ K;  4CVN E;  1FJG K;  1IBL K;  4LF6 K;  4DV4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...