4DV5K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv5K00
2UU9K 4DUZK 4JI3K 4YHHK 1IBKK 5BR8K 1N32K 3J81O 1HNWK 1HNZK 4DV6K 4JI5K 2UUCK 4JI7K 2F4VK 4JI0K 4LF4K 2UXCK 4LFBK 1I94K 4CW7B 5LMUK 4LFCK 1IBLK 5LMNK 1XNRK 4X62K 5AJ3K 1HR0K 4X65K 2E5LK 4LF9K 2UXDK 1N33K 4OX9K 4KHPK 4JYAK 4LF6K 4GKKK 4DR5K 4DV7K 4JI2K 3T1YK 4DR3K 4AQYK 3T1HK 3J80O 5IT9O 2VQEK 5LL6Z 1XNQK 1HNXK 1FJGK 4NXMK 2ZM6K 4V19S 1N34K 4K0KK 3J7AP 4X66K 2VQFK 4DV5K 4JI1K 4DR4K 4LF7K 5A2QO 4B3MK 4B3RK 1XMOK 1J5EK 4X64K 2UUAK 4GKJK 4JI6K 4DR6K 4LF8K 4JI8K 4CVNE 1XMQK 4DV1K 4DV0K 4DUYK 1N36K 2UUBK 4DR1K 4LFAK 4B3TK 4JV5K 4DR2K 5FLXO 4B3SK 2UXBK 4YY3K 4DV4K 4DV3K 3JAMO 4JI4K 5IWAK 3J7YP 4LF5K 4DR7K 2HHHK 1IBMK 4NXNK 4DV2K 3OTOK
chains in the Genus database with same CATH superfamily
4B9MA 3L2UA 1NGIA 1RFQA 3S3MA 4WFBL 4HTLA 3EZWA 3ID6A 3VGMA 3D45A 5FPMA 4H0YB 4CIGA 1LCUA 3H46O 4OGCA 1HYVA 1Q82O 3A0IX 4BC4A 4BC3A 4LFCK 4KB1A 5C12A 1VSEA 3DLLL 4DF8A 2HOEA 2YHAA 3VEWA 3PX4A 2NNWA 3BZCA 5EVZA 4LSNA 3DXMA 3VEVA 4CJ7A 5GIPA 3K5LA 3GDQA 3C95A 4CGDA 3E9PA 3P4IA 4HUEA 5EU7A 1RTJA 2LSNA 4I7FA 2D5RA 5D3GA 4CZFA 1WLJA 3T1HK 1TAUA 4WFAL 3V1QA 2O8EA 3KIOA 1OKJA 4B9LA 2RF2A 3NF8A 3NF6A 1YXQA 3I0RA 2UYTA 4JS5A 1RT7A 4KHSA 4KKOA 4YOXA 4WQ4A 4CD1A 2E6LA 1T05A 4B3MK 4DTOA 2ZD1A 1U2VB 1J5EK 1NGHA 4ZTJA 2OZMA 4O5BA 4KB0A 4N41A 4B1UB 4BVOA 3CQXA 3AY9A 4CBWA 2G8WA 1HQUA 3PIOL 3BDPA 4BE0A 4E7IA 4E7LA 4BDZA 3V9SA 1JXEA 3TU5A 3KD5E 4EZ6A 4JV5K 3K58A 4C8KA 4BRQA 4JKDA 1LWEA 1Z26A 3NDKA 3ID8A 1TL1A 5AZJB 1A5VA 2X6NA 2PY5A 2ATQA 1XI1A 3SUPA 2D4WA 4EFHA 4DS4A 4M7XA 2DY4A 3J7ZO 3V9XA 3O4NA 1Y64A 2YNIA 1HNZK 5AQTA 2UUCK 1NM1A 2KHOA 4FWKA 2KW4A 2YCHA 3G0ZA 4CFBA 2NUBA 1BCOA 3KWIA 4LF9K 2ZGYA 1C0TA 4MO5A 3ZSXA 1IO2A 2P5GA 1S1UA 4ZTFA 3L4IA 2G8IA 3LDLA 4B9NA 3AGKA 3HL8A 1KLMA 3OVNA 3G4SN 4DTJA 2X6SA 1D9DA 1CZAN 1NGDA 4IEEA 4JKEA 1WAFA 3DXMB 4KI4A 4G1QA 2PYLA 5BPLA 4QOZB 5FRNA 4B1ZA 1GLCG 2BUPA 4FJNA 2ZJQL 1QHTA 3CXCM 1DT9A 1SUQA 4AILC 4LH4A 5FROA 3LANA 3DOKA 3OJSA 5JVHL 4CF1A 4K43A 1WSFA 4BROA 4DR4K 3ULEA 3RRHA 2A41A 1QHAA 2QK9A 3MX2A 4IG0A 3G25A 3O4WA 1TUUA 4NYFA 4CGIA 1BA0A 4BG9A 3SCXA 1JLFA 1MWKA 2VCPA 2P1JA 1U2VA 2XHBA 1QVGM 2VYPA 3QB0A 4E7HA 1OVQA 3KKSA 4H0PA 2G8VA 1ZBUA 4MFBA 1RBVA 1HRHA 4U67L 4AH9A 3PSIA 3O9RA 4B8AB 4F4KA 4ILGB 4I2PA 4FZXC 1KFDA 2V51B 2IOCA 3VQ9A 1TL3A 3K9JA 4FWLA 3GG4A 3HOSA 2F9TA 1U47A 3K59A 4LF5K 1JL2A 1C6VA 3QIOA 4FJ7A 4FM0A 3CJAA 1OH8A 4WQ5A 4CEDA 2E2NA 4FLZA 3RMDA 2UU9K 2YKNA 5CZ2A 4PY5A 3JXUA 2E2PA 2CGLA 3J81O 3CFOA 4K8XA 3B6OA 4KHNA 3EE8A 2IDOA 2OANA 5LJVA 4LF4K 1KVCA 3TAEA 5CHIA 3DRRA 4CJRA 3SPYA 3E01A 3UKUA 4GV3A 4NCAA 1XNRK 1FXXA 2W6LA 1HQEA 1NMDA 1Q86O 1KSPA 3LP2A 4FJIA 2P9LA 1VHXA 4B9SA 1BIUA 2E2OA 1TV6A 4ELTA 2Q0UA 1D5AA 1T44A 1Y97A 3LP0A 2XY6A 3FFIA 4Z4HA 3ZSOA 2P9PA 3ZLJA 5AQHA 4JAXA 1FKOA 1GLJO 3SYZA 4QS9A 4M63C 4QS7A 3HK2A 4CECA 3OHRA 2OA8A 2AJQA 2VWBA 1RDWX 4DFKA 4YDUC 4Z4IA 3P31A 1BDGA 4ID1A 1VAZA 2HNYA 3H3NO 3M5RA 3ULDA 2HVHA 4LF7K 4JLHA 5AQPA 5A2QO 3WNFA 3PSFA 5AQNA 3O3HA 3TAGA 3T3FA 3OYLA 3TSQA 3B6PA 4CBXA 4A62A 5K14A 4OGEA 4CGFA 2E1YA 3MDQA 4BR2A 3SUQA 4JI8K 2B5JA 2IS3A 2E4LA 4NLCA 3J8AA 3HPGA 1EQYA 4OPHA 3I8DA 3VTIA 4C1NI 3AVLA 2Q2RA 1C1BA 3RR7A 3ZX2A 4B3SK 1HPMA 1BOTO 3QEXA 2KFNA 1QE1A 5C2DA 4JI4K 1S22A 3ZEUA 3VN5A 4Z4EA 1HJRA 3RMAA 3WXMB 1VSHA 5HRSA 2O8DB 5TKWA 2H3GX 3UKUB 4BR9A 3C0BA 2F9WA 3ZETB 3HI0A 3BY5A 1EKEA 2ASOA 3QLHA 1I94K 2OTJN 3I56N 1TKDA 4GNIA 4GW6A 2VGMA 4X65K 5BPMA 4CCHA 1BU6O 1XUPO 3WXLA 1LWCA 1N33K 2AA4A 1JKHA 5JVGL 2O4GA 3NF9A 4KHYA 3HPOA 4GVEA 2OYQA 3A5OC 4CJSA 3P1GA 4JI2K 1TKXA 3KK2A 4CF9A 3NH0A 5LJWA 3O9UA 4MDAA 5AQWA 2O8FB 2QWLA 1ZC6A 3P38A 3FZLA 3MXJA 1VSJA 3VEYA 1Z6RA 3HP6A 3UKRB 2A40A 1OH6A 5AZJA 3M8PA 4TSXA 3J7AP 3VF4A 3O1BA 5AQKA 1B92A 3MK6A 1J9AA 4C8LA 3ZT2A 3IS9A 3OYIA 4X64K 4CF2A 1YJWN 4YORA 4JK8A 4CHPA 1J6ZA 1YHQN 3LPUA 2F7TA 3V4IA 1P8ZA 1KD1O 2HSTA 4BRMA 4M3WA 4CK2A 2Z1IA 1VQON 4H5NA 3VGLA 4W5NA 4ICLA 1DTTA 5AFUA 3QIPA 3GL1A 2VGNA 1MWMA 1HLUA 3E66A 1QTMA 1Q8IA 1RTDA 3V81A 3HBTA 1DTQA 4EAHD 1Z25A 2Q97A 4JKFA 4FSVA 2DTUA 1HMVA 4Z94A 2HHQA 1I39A 1C0GA 3LAKA 4IOAL 4JI3K 1RT1A 3MCAB 3VQQA 5AQRA 3KK3A 4GV6A 3QFPA 3VA0A 4DSJA 5JMVA 2NRTA 3ZSRA 5CYQA 4BRFA 2O8CB 5CY4A 1N6QA 4LFBK 3T19A 1O13A 3B8AX 3G6EN 3KWGA 1HUXA 3HM9A 2QEXN 4HVJA 4B3OA 4BY9C 3O8MA 5EOYA 4XH5A 4Z4CA 1HX1A 3VQ8A 1NJWA 4JYAK 4I9LA 5E84A 2KQ2A 4ZHRA 4RW6A 4RW4A 3DOLA 2HVIA 4AHTA 5M1FA 3TAFA 4CJ5A 3NVKA 1Q18A 2P51A 3EEQA 2ZM6K 4FK4A 4HCBA 3OS2A 1ITGA 2D0AA 2CGKA 3HTVA 1JLBA 3TTDA 2D0BA 1YVNA 1A5XA 2D0PA 2FBVA 3FZFA 4MLHA 4JI1K 3Q7BA 1CXQA 4J2EA 4LSLA 4KHWA 1YVUA 5HL7L 3LPTA 1VQ7N 4FYDA 2OPPA 3UE5A 5AFUH 5I9EB 2WC9A 4AHCA 3FZKA 5DM6L 3L3UA 1BA1A 4IFYA 3CCVN 3VQEA 4BE2A 4KTQA 5AQJA 4PQUA 3P5JA 3QEVA 5FLXO 3OYHA 1JCGA 2A6AA 4DFJA 4CZHA 1SQKA 1UAXA 2KTQA 4A59A 3WEEB 3WQTA 5BREA 5FDLA 3F2KA 3WEEA 2R7YA 4IOCL 5AQFA 1SV5A 4NXNK 3QETA 1RNHA 3KJVA 3EY1A 3AO1A 2ZWHA 3AVCA 5B8HA 2Z1JA 4DUZK 4F3TA 3A5NC 4BVPA 3MX5A 4DHYA 4F2SA 3MEGA 4CEQA 2J4RA 4JHDB 1V4TA 2QWPA 3SAHA 4DWIA 2KZZA 3T7ZA 5DM7L 3OS1A 4NLBA 3R8EA 4H4OA 1WOQA 3DMJA 3SUOA 3OYAA 1HKGA 3V9ZA 4A2AA 1NKBA 1RDBA 4M45A 5JLFA 3MN6A 3RSEA 3K57A 1KQSM 1BI4A 1TYQA 3OJUA 2PFUA 3HVTA 4RCHA 1K9MO 4AQYK 4R5PA 5I3UA 2P9PB 2ETJA 3DXKB 4CIFA 4FZYA 5AQQA 4W5QA 1VQ8N 4CHQA 4FJHA 3JSMA 4MDBA 4DQRA 2IVPA 2VQFK 4CJ4A 2P5OA 4CFCA 1CXUA 3WXKA 4KHUA 3WUHA 1R59O 4AM6A 5EXWA 3VQ7A 4WE1A 3AA5X 1GLEG 1XC3A 4DR6K 4B08A 2YHWA 4B1XB 4CJPA 4HUFA 1XMQK 4FJ8A 3QEIA 3KLFA 4DV0K 3U3GA 4CZMA 3MEDA 4AHUA 1VQ4N 3O9QA 2BGGA 3FLCO 3GOIA 4CEBA 2QKBA 5EY4A 4FJLA 4DTUA 2X78A 2JGUA 3N4PA 5M1NA 3KK1A 4NCGA 4E7JA 4CESA 4FW2A 3CF5L 5M1OA 3ZX3A 4PHTX 3AA2A 3QNOA 4B1YB 4N76A 1IKWA 2GWJA 3PV8A 3C6UA 3CETA 2ZQBA 1ZBSA 1WB9A 1J5OA 4DCHA 3OA9A 1Q9YA 3JYTA 4ILJA 3LAMA 1BHLA 1HNWK 3MWTA 4ISEA 1S72N 4CEOA 5C42A 2F4VK 4WQ5C 1S1VA 1NGEA 5LMUK 4DFPA 2D0OA 4B9UA 1WBBA 2GV9A 5AQZA 4O5FA 1BISA 4UY8O 3AVBA 3V9WA 3THWB 1EXQA 4LF6K 5CYMA 3VQAA 3VQDA 1I3AA 3QBXA 5FRMA 4O0JA 3CPEA 1VSDA 1QZ6A 1K8AO 1KTQA 1BI4B 1FJGK 3R9PA 2QWQA 4IBNA 1K73O 3DRPA 4A61A 3W0LA 3LM2A 3OW2M 3KK7A 4UQGA 4NCBA 2WBNA 1DKGD 4NB4A 1JLAA 4GY2B 1WN7A 1YJ9N 1S1XA 4W5RA 3HVRA 4FL9A 4CZJA 1NK8A 2JLEA 3WNGA 4CJVA 2HNDA 1BWFO 3U6FA 4HCCA 3HYFA 1XQSC 2NZTA 2QWRA 4IFEA 4H5VA 3NHGA 4DSFA 2RE2A 1G15A 4H0XB 3THVA 4BRHA 4J2DA 1NGGA 3L2RA 4BC5A 3V6DA 4CEFA 3O3FA 1LOTB 3QESA 3SNNA 3AGRA 4ELVA 3F73A 1EX4A 4ID5A 5JS1A 3DLEA 3RSEB 3VTHA 3QNNA 1NLVA 5KPRA 3ZSQA 3AVMA 2HW3A 2ZJRL 2P9NB 2O8FA 1X1PA 3ZEUB 3ZETA 1IBMK 4PL7A 3OBWA 4BQZA 4FVMA 1WBDA 5KQ8A 3R6MA 4FM2A 1Q7YO 3CC2N 3WNEA 2QI2A 3L2QA 1C0FA 3MECA 2ASPA 4FJ9A 3QERA 1GLFO 1JJ2M 2DFFA 4FLWA 4JI7K 3VQ6A 4BRKA 3TABA 3LDSA 4JKAA 4FJMA 3F9MA 3I0SA 3H45C 4PA1A 2QTDA 5LMNK 1C1AA 4CGHA 4R79A 3SMSA 4ISGA 1ZYQA 5KGWA 1WNSA 4BG8A 5J2NA 2OZSA 1G99A 3SQ1A 3HSCA 4KREA 4KI6A 1NU0A 3S3NA 3SK3A 3PO5A 3SUNA 1C0MA 5M1QA 3Q7CA 3BF1A 1CZBA 3MAQA 2HBLA 1EP4A 3D2EB 4DFMA 3LWMA 1VQKN 1WSEA 1BGXT 1ASWA 4H5TA 1XHZA 4OPKA 4B9QA 3ZT3A 2GX9A 3CM6A 5AQMA 4IOXA 4FW1A 1GOAA 4K0KK 1VSKA 5MLCQ 4WQ4C 2P9SB 1NGFA 3V1OA 2HHVA 3BZKA 4FJKA 1JXBA 4J8FA 1X3NA 5M1PA 3E9OA 2NRWA 5AQGA 3WXJA 4BC2A 1NBWA 5KI6A 1QSYA 3G71N 4OLAA 3ASMA 3IDHA 3SPZA 4DLEA 4BGAA 2I7PA 3TTCA 4KPYA 1OVYA 4Z0UA 2HHTA 2YNGA 4LY7A 3LZIA 2YHBA 4ELUA 4F8RA 3CFPA 2NRHA 4BE1A 3CCSN 1M1KO 4CBUA 3WXIA 4CJTA 4JKHA 5C15A 1ILYA 3NFAA 3ZT1A 1JLQA 2RKIA 1VQ9N 3LZJA 4FJGA 5KRSA 4N5SA 4YOVA 2B4JA 5HRRA 3IRXA 5ELZA 2G8FA 4W5OA 3DRSA 2D0CA 3E9LA 4BWMA 4AHVA 3NH2A 5BR8K 1NKEA 3HP9A 3D0PA 3OBYA 4B9TA 3DI6A 3MCPA 1KC8O 5F1XA 1N8RO 3MXIA 2FF6A 3THWA 2PYJA 1NMNA 3AAQA 1NJZA 4O4GA 1F21A 1P90A 2YJEA 3LDQA 2KZMA 4FLTA 4DSLA 4BDPA 2ZE2A 2FBXA 3O4QA 1KLNA 4GKKK 1T3VA 4FOEA 4O8UA 1NKCA 3AVIA 2ZGZA 3R1XA 1K8KA 3VQ5A 3LP3A 1ATSA 2G8UA 3D2EA 1XNQK 4CJLA 1YITN 3V9UA 3FGUA 5FPDA 3PO4A 1J53A 1T6DA 2XRIA 2IGIA 1KVBA 4KO0A 1E3MA 4A2BA 4J2AA 3UB5A 3CJCA 2O8EB 3DYAA 4CHOA 1QVFM 1RT4A 3M8SA 3C6HA 3ZYYX 2NLXA 4GKJK 3RVCA 4AHSA 4CIEA 4BRPA 3SQ4A 1RDCA 4O8KA 4KTWA 3AO3A 3SQ0A 5HBMA 3SBGA 3SV3A 2KFZA 4IZ9A 4PUOA 3AO4A 3DLBA 5C10A 1RDAA 3NAEA 3AO5A 1S5JA 3HOTA 2ZJPL 3C7NB 3HZ6A 4K25A 4DU3A 4CE9A 5ADXH 4BRDA 1KVAA 3CD6N 4DU4A 1LWFA 3H3OB 2XO7A 4IDKA 3JAMO 4AM7A 5BRHA 3BF3A 5C0YA 4AHRA 3IAYA 4DR7K 1WAJA 3BP8A 3C94A 2AP1A 2EWSA 3RR8A 3DXKA 3SJHA 4OLBA 2FF3B 3VQBA 3FFKB 2ZF5O 4LD0A 1QSSA 3KD1E 4FWNA 4DTMA 1N32K 2EX3A 1SL2A 1M90O 2Q0RA 1W9HA 4JD2A 4CEAA 3PUFA 3TI0A 1YAGA 1X9JA 1BO5O 4ISFA 3D7EO 4CW7B 1DEJA 3OYEA 1IBLK 3O5BA 2RN2A 3ISNC 3TAPA 1K8KB 1DGKN 4OKJA 4CJ3A 4YOYA 3AV9A 4C8NA 1OH5A 3MXMA 3OYJA 3U3YA 1D9FA 1E4FT 4L3QA 3HO1A 1KCFA 1TVRA 5GAHP 3T1YK 3RMBA 4CFAA 1W0HA 4CJWA 4XH1A 3ZSZA 1S1WA 1VRTA 5IT9O 4M3RA 1V4SA 2P9UB 1HNXK 1Q9XA 4IG3A 1JLCA 4JS4A 4DMNA 3SJJA 1NJXA 2O8DA 2GELA 4CD3A 3O9TA 3PX0A 4KAZA 4BR0A 1W97L 4GMJB 2QWOA 3M8RA 2XY5A 4Y1CA 1RCHA 5AQOA 4KTZA 1QS4A 5HROA 2W6KA 1GLLO 3CCLN 2HBKA 1VQLN 4RWTA 5F2RA 2GUIA 1NG9A 3ZCMA 1RT6A 4BRGA 2GBZA 1ESVA 1BQMA 1ZBLA 1XWLA 1JLGA 1N36K 4DR1K 2A42A 4CGGA 4RW8A 4FJ5A 4H0OA 2FLOA 1HNVA 3HM8A 3EL2A 4DQ8A 5IWAK 2YHXA 4H5RA 3VF2A 4XH4A 2W40A 3O6WA 3LDPA 3QDKA 4KH6A 4A5BA 1JL1A 2YKMA 4CJFA 1ASVA 4CF0A 4FWOA 3OTOK 3OYNA 2HBMA 3TSPA 1KFSA 1IBKK 5AQYA 1QQCA 3MN9A 3O08A 4W5TA 2FSNA 4OKEA 4DV6K 2VWKA 2OTLN 4E19A 2GEMA 3H1VX 1YF5L 3DWLA 3IG1A 5C25A 1RT2A 3L2WA 1S6PA 1NWKA 3U8XA 4IJAA 4BR4A 2HHWA 1HR0K 5GAGP 4DTXA 4BWJA 4CK3A 1YTUA 3CJ9A 4N56A 1NGJA 4K42A 1VSFA 2XY7A 4OJRA 3BGRA 2V7ZA 4OKKA 4FWSA 1KXPA 1NK4A 5HRPA 1TUYA 2KKZA 4DV7K 1TAQA 1IH7A 3KLHA 4RW9A 2P9LB 3SBTA 1SS6A 2VQEK 4YOTA 5KQDA 5KTQA 4NXMK 4DQPA 1NJIO 3CMEN 4E7KA 2E88A 4JRQA 1NK6A 1T8EA 2PBDA 3NCIA 4CEZA 1UA0A 5TKYA 2V52B 5J2MA 1WUAA 3S3OA 5GIOA 4DV5K 1T7PA 3O80A 4JNEA 3A2FA 4L8RB 4B3RK 1HYSA 1LAWA 2FC0A 4PKHA 4IO9L 2UUAK 3PIPL 3VEXA 4CJQA 5AQIA 3AVNA 4FWPA 1EETA 3KLEA 3I33A 3CMAN 2F96A 4CVNE 4EP4A 4DV1K 3HPHA 2B6AA 4CZKA 3SAGA 4PKIA 1D8YA 3T69A 4JN4A 2W42A 1X9MA 4FLXA 2HBJA 1X9SA 4LFAK 4DSEA 1NGCA 4YDUA 3HXMA 1S6QA 1NK7A 4GVMA 3IKMA 4M7YA 5CE3A 1C0UA 4DTNA 5HRNA 3LWLA 1R0AA 1VQMN 3CPWM 3K9KA 5J1EA 1RILA 3KLIA 2D1KA 1S9EA 3OYDA 4FJXA 4Y0WA 4XIUA 4FK0A 3THXA 4MQ3A 1HNIA 4CZGA 3EKSA 4FPAA 2VG7A 4YHHK 3TTFA 2HHUA 3L0QA 2P9SA 4JI5K 3GE1A 2E6MA 4A5AA 2A1RA 4WCEL 5J2PA 2EHGA 1SKRA 3QEPA 3ZSYA 5F0XA 5AJ3K 1X3MA 1YIJN 2E5LK 4ILHA 4FCYA 3TAQA 4FJJA 4OX9K 3AA3A 3SAFA 2PZSA 2HHXA 2WONA 3EKUA 4BREA 4EHUA 5JICA 1C1CA 4IXCA 3VEOA 2Q31A 2YV0X 3ATUA 3VENA 3CCRN 4OVLA 2Q3SA 1BL3A 3SV4A 4JKGA 5DMRA 2Q36A 1RDDA 5HOOA 2E20A 2IC3A 3KTQA 3PX6A 1REVA 4Q0BA 4O55A 4Z4FA 2O8BA 2Z1HA 4X66K 2I5JA 2VG6A 1GLBG 4DLGA 2YI1A 4E0DA 4H4MA 2VG5A 1HKBA 1D4XA 5GADP 5DK5A 2GWKA 3CHWA 4CERA 3KKRA 3I8BA 3VGKA 2NRVA 1O1WA 1ATNA 3SLCA 4JI6K 1J54A 1FKPA 3CCJN 2VWJA 1S9GA 3VQPA 4DSKA 3CI5A 3NVMA 4PL8A 3V1RA 1QSLA 2BH1A 2HF4A 4BRCA 4C8OA 3EYZA 5BRFA 3E1YA 2OPRA 2QWMA 5FPNA 4NYNA 1WSGA 3CJ7A 1VQ6N 3HJFA 1RBUA 3C7NA 1HPZA 4B1WB 2RPIA 3CQYA 4DSIA 3QICA 2JWKA 3LM9A 1VQ5N 2OPSA 3CFRA 3DAWA 4YOUA 2WOMA 5BRDA 4FO0A 2P9KB 4IFVA 2HHHK 4C8MA 3ATVA 1RDUA 5HP1A 2Y1IA 4HWIA 4Y1DA 2BANA 1U45A 1YJNN 1NK0A 3M1FA 3AO2A 3GBTA 4M3TA 3CG7A 4WFNL 3OYKA 3A5MC 3EE9A 3AARA 3ZSWA 4YNQA 2NRRA 2YX6A 3P83D 3RRGA 4KH4A 4OO1J 4CZLA 1U49A 4CZIA 3BUZB 2QXFA 1RGIA 1BQNA 3AVFA 2UXDK 4CI6A 5BR9A 4FVUA 3HRGA 4FLUA 3MN5A 1RBTA 1NGAA 2KLAA 2X74A 1YI2N 2CH5A 4CHZA 3NE6A 2A5XA 4A57A 4CHYA 5FPEA 5AQSA 1VRUA 4CFDA 4FZZA 5AQVA 1RT3A 3M8QA 3J80O 5AQUA 4CGJA 1UWBA 2ASMA 2IIRA 4B1VA 1NK9A 2P9NA 1NOYA 2DFHA 1LAVA 3NF7A 2BTFA 3CCEN 2OPQA 3L8BA 4BR5A 1N34K 3H1QA 4QCLA 4BRNA 5E26A 4BACA 1U04A 3DJCA 1TGOA 3R3LA 3M3ZA 1N5YA 3UIQA 5AR0A 5BN8A 3AVKA 4RTFD 1X9WA 4DQIA 4HUGA 2YNFA 4Q5VA 3OYFA 3KHYA 4JD2B 1XC9A 3WT0A 3CIPA 5JLHA 1VSMA 3ALYA 1SKWA 3VESA 4MLEA 3K5MA 1RTIA 4E1MA 4RG8A 5CR4A 3M6GA 3ULEB 1KAXA 3U4LA 3BEXA 4IEIA 1L3VA 1B9DA 4U7BA 3AVGA 1ATRA 3L6QA 3TSUA 4O0IA 2UUBK 3TWHA 4K8ZA 4FOIA 3ZX0A 1RBSA 4FPBA 4M3UA 1JCEA 4DR2K 3VPZA 3MWPA 3P39A 4JRPA 4YY3K 5ADXA 3FR0A 3DLGA 5GAEP 3H08A 3NMUA 3DLKA 4CHNA 4H03B 2GTDA 3CM5A 3OYMA 3C65A 2QW9A 1TK0A 4E3SA 4BGBA 1VQNN 3ITHA 3TANA 3IFRA 2NRZA 3T1AA 3C6TA 4DV3K 3FZMA 2HF3A 3TPQA 2QXLA 1LW0A 4F2RA 3CERA 3KVGA 3F5TA 4FLYA 3K5NA 5E41A 4JI0K 3CJBA 2UXCK 5HLFA 5GINA 4RW7A 4DTPA 1T6CA 1HKCA 1YTAA 4IKFA 3KLGA 1NNEA 1FW6A 3LDNA 4JHDA 1TK8A 3K2PA 3QFUA 3O3GA 2IVOA 3JS6A 4JK9A 4DTRA 1ASUA 3D6RA 1VSLA 3ENBA 3PLAA 3I55N 4YOWA 1GLAG 1HJOA 3AVHA 5T7BA 5CZ1A 4LH5A 4DR3K 2P9KA 1BG3A 3SQ2A 4DU1A 1U6ZA 5LL6Z 3UKRA 4BR7A 4BRLA 3VETA 3WQUA 3DLHA 3O1WA 3EZ5A 4HHTA 3THYB 4H5WA 4FWRA 4V19S 2QWNA 1H1VA 4C1NK 3QMLA 3VA3A 1A5WA 3C6AA 5I42A 2FXUA 1BCMA 4B8CA 4C23A 3AA4A 1WSIA 4BQLA 4BDYA 5AQXA 3ZT0A 4BRIA 3H6EA 2G8HA 1VQPN 1XMOK 3VEZA 4H0VB 3CC7N 5KGXA 3FZHA 4KHQA 1EO1A 3WNHA 2HNZA 3L2VA 1VSIA 4PKGA 3QEWA 1UOCA 2HMPA 1S1TA 2NRXA 3K0SA 4DUYK 4O44A 5EX5A 4QS8A 5KPTA 4OPAA 2HB5A 1NOZA 2RHKA 1B9FA 3LP1A 4N47A 5J2QA 2QKKA 1YT3A 4DV4K 3OS0A 1TK5A 3VF6A 4BRAA 3TARA 1E4GT 1JCFA 3J7YP 2HHSA 3THYA 4FM1A 4KV8A 4I6MB 3FE1A 1YUWA 4DV2K 3VQCA 4CJUA 4I9QA 3A5LC 1NK5A 2P9IA 2BDPA 2XY8A 4M3XA 3K5OA 1Q81O 2G8KA 4LC9B 3CC4N 4DS5A 4KBOA 3IMXA 5JS2A 3QINA 5AZIA 3KZBA 3NGYA 3LL3A 2JWLA 1L3SA 4FLVA 5KRTA 3VOVA 4IWVA 3CCQN 4KFBA 4I2QA 4X62K 2FSKA 2BE2A 4K41A 1S3XA 1SAZA 4CF8A 4EZ9A 2Y1JA 2ITMA 4KHPK 2A1SA 1UA1A 1L3TA 1QQMA 3S9HA 3LDOA 4DR5K 2QM1A 1JLEA 4Z4GA 4CEEA 1SKSA 3OYBA 1L3UA 4JKBA 1GOBA 2F8TA 4GV9A 1CLQA 3L3VA 3DM2A 4XEIA 5LY3A 3NBPA 1GLDG 1IV0A 1QZ5A 3QBWA 2I7NA 2O8BB 1RT5A 4FWQA 1XHXA 4CZEA 1BIZA 4E1JA 4DKWA 4JK7A 5H1SQ 3MN7A 1VK0A 3CCMN 2ITGA 1WSHA 4QAGA 4LF8K 3MMVA 4FXDA 2YJFA 2O8CA 3MEEA 1ZBIA 1SL0A 4M3YA 2YHYA 2E2QA 4M41A 5AQLA 4FK2A 2DFEA 2IAJA 1U4BA 3ENOA 3EO3A 3EN9A 1KAZA 4E1NA 3VERA 4CJEA 2DPNA 4HTUA 4B3TK 3D2FB 5M1KA 1RBRA 3D2FA 3SI6A 2UXBK 3ENHA 3THXB 4DB3A 3AVAA 2P9IB 4DF4A 4JKGB 1IG8A 3HSTB 4KH5A 1EWRA 1TKZA 5SWMA 1NGBA 3OY9A 2Q1NA 3W3DA 4CK1A 1QQOA 1LW2A 3IUCA 3CJ1A 1RTHA 4DG1A 1KRPA 1KAYA 3U9ZA 1TKTA 3CCUN 4CJKA 3OYCA 4PWDA 3NH1A 3RWUA 4M42A 3NGIA 5BN9A 3OYGA 4DQQA 4J2BA 3ZSVA 4KRFA 4EHTA 4DQSA 4H0TB 4AF1A 5KPZA 5SZTA 3DLRA 1IJJA 5C2FA 4OPJA 1DLOA 1IKVA 5AZIB 1MU2A 1SL1A 2E8AA 3L4QA 3QO9A 4E89A 2O4IA 2FBYA 2W41A 1CZ9A 2WUSA 1TYQB 3U9DA 1GOCA 3O9SA 2F8SA 1U48A 2FBTA 3TR8A 4I6MA 3N4QA 2E1ZA 3G10A 1ZBHA 1W2BM 5C24A 1MDUB 3VQ4A 3PY8A 3ZT4A 3AAPA 1SZ2A 4EIAA 2CH6A 4IJNA 1IKYA 2YNHA 3CYMA 4G9ZA 3VMFB 4NO7A 4JEPA 4F3OA 3SZ2A 1WSJA 4DTSA 2HMIA 1HYZA 1T03A 3NGZA 1LV5A 1IG9A 2OCEA 1NJYA 4EP5A 2WFBA 3AVJA 3A8YA 3S41A 3SMPA 4M3ZA 1MA9B 2WTUA 1FK9A 1ZXOA 2FSJA 4WYBA 1QQNA 1EWQA 2GUPA 2QA4N 1K6YA 1BUPA 3F9KA 1Z05A 4JKCA 3TAMA 4YFUA 1OH7A 3HT3A 2A3ZA 3RTVA 5BPNA 2IVNA 4IDHA 2V7YA 2PAVA 4B9VA 1IKXA 3LALA 2Z1GA 2P9UA 4F9OA 4MO4A 3RMCA 4FWMA 1L5UA 4H8KA 4IO8A 2CGJA 1ZBFA 4WF9L 1W7AA 3CQ8A
chains in the Genus database with same CATH topology
2UU9K 4DUZK 4JI3K 4YHHK 1IBKK 5BR8K 1N32K 3J81O 1HNWK 1HNZK 4DV6K 4JI5K 2UUCK 4JI7K 2F4VK 4JI0K 4LF4K 2UXCK 4LFBK 1I94K 4CW7B 5LMUK 4LFCK 1IBLK 5LMNK 1XNRK 4X62K 5AJ3K 1HR0K 4X65K 2E5LK 4LF9K 2UXDK 1N33K 4OX9K 4KHPK 4JYAK 4LF6K 4GKKK 4DR5K 4DV7K 4JI2K 3T1YK 4DR3K 4AQYK 3T1HK 3J80O 5IT9O 2VQEK 5LL6Z 1XNQK 1HNXK 1FJGK 4NXMK 2ZM6K 4V19S 1N34K 4K0KK 3J7AP 4X66K 2VQFK 4DV5K 4JI1K 4DR4K 4LF7K 5A2QO 4B3MK 4B3RK 1XMOK 1J5EK 4X64K 2UUAK 4GKJK 4JI6K 4DR6K 4LF8K 4JI8K 4CVNE 1XMQK 4DV1K 4DV0K 4DUYK 1N36K 2UUBK 4DR1K 4LFAK 4B3TK 4JV5K 4DR2K 5FLXO 4B3SK 2UXBK 4YY3K 4DV4K 4DV3K 3JAMO 4JI4K 5IWAK 3J7YP 4LF5K 4DR7K 2HHHK 1IBMK 4NXNK 4DV2K 3OTOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 K;  4DUZ K;  4JI3 K;  4YHH K;  1IBK K;  5BR8 K;  1N32 K;  3J81 O;  1HNW K;  1HNZ K;  4DV6 K;  4JI5 K;  2UUC K;  4JI7 K;  2F4V K;  4JI0 K;  4LF4 K;  2UXC K;  4LFB K;  1I94 K;  4CW7 B;  5LMU K;  4LFC K;  1IBL K;  5LMN K;  1XNR K;  4X62 K;  5AJ3 K;  1HR0 K;  4X65 K;  2E5L K;  4LF9 K;  2UXD K;  1N33 K;  4OX9 K;  4KHP K;  4JYA K;  4LF6 K;  4GKK K;  4DR5 K;  4DV7 K;  4JI2 K;  3T1Y K;  4DR3 K;  4AQY K;  3T1H K;  3J80 O;  5IT9 O;  2VQE K;  5LL6 Z;  1XNQ K;  1HNX K;  1FJG K;  4NXM K;  2ZM6 K;  4V19 S;  1N34 K;  4K0K K;  3J7A P;  4X66 K;  2VQF K;  4DV5 K;  4JI1 K;  4DR4 K;  4LF7 K;  5A2Q O;  4B3M K;  4B3R K;  1XMO K;  1J5E K;  4X64 K;  2UUA K;  4GKJ K;  4JI6 K;  4DR6 K;  4LF8 K;  4JI8 K;  4CVN E;  1XMQ K;  4DV1 K;  4DV0 K;  4DUY K;  1N36 K;  2UUB K;  4DR1 K;  4LFA K;  4B3T K;  4JV5 K;  4DR2 K;  5FLX O;  4B3S K;  2UXB K;  4YY3 K;  4DV4 K;  4DV3 K;  3JAM O;  4JI4 K;  5IWA K;  3J7Y P;  4LF5 K;  4DR7 K;  2HHH K;  1IBM K;  4NXN K;  4DV2 K;  3OTO K; 
#chains in the Genus database with same CATH topology
 4B9M A;  3L2U A;  1NGI A;  1RFQ A;  3S3M A;  4WFB L;  4HTL A;  3EZW A;  3ID6 A;  3VGM A;  3D45 A;  5FPM A;  4H0Y B;  4CIG A;  1LCU A;  3H46 O;  4OGC A;  1HYV A;  1Q82 O;  3A0I X;  4BC4 A;  4BC3 A;  4LFC K;  4KB1 A;  5C12 A;  1VSE A;  3DLL L;  4DF8 A;  2HOE A;  2YHA A;  3VEW A;  3PX4 A;  2NNW A;  3BZC A;  5EVZ A;  4LSN A;  3DXM A;  3VEV A;  4CJ7 A;  5GIP A;  3K5L A;  3GDQ A;  3C95 A;  4CGD A;  3E9P A;  3P4I A;  4HUE A;  5EU7 A;  1RTJ A;  2LSN A;  4I7F A;  2D5R A;  5D3G A;  4CZF A;  1WLJ A;  3T1H K;  1TAU A;  4WFA L;  3V1Q A;  2O8E A;  3KIO A;  1OKJ A;  4B9L A;  2RF2 A;  3NF8 A;  3NF6 A;  1YXQ A;  3I0R A;  2UYT A;  4JS5 A;  1RT7 A;  4KHS A;  4KKO A;  4YOX A;  4WQ4 A;  4CD1 A;  2E6L A;  1T05 A;  4B3M K;  4DTO A;  2ZD1 A;  1U2V B;  1J5E K;  1NGH A;  4ZTJ A;  2OZM A;  4O5B A;  4KB0 A;  4N41 A;  4B1U B;  4BVO A;  3CQX A;  3AY9 A;  4CBW A;  2G8W A;  1HQU A;  3PIO L;  3BDP A;  4BE0 A;  4E7I A;  4E7L A;  4BDZ A;  3V9S A;  1JXE A;  3TU5 A;  3KD5 E;  4EZ6 A;  4JV5 K;  3K58 A;  4C8K A;  4BRQ A;  4JKD A;  1LWE A;  1Z26 A;  3NDK A;  3ID8 A;  1TL1 A;  5AZJ B;  1A5V A;  2X6N A;  2PY5 A;  2ATQ A;  1XI1 A;  3SUP A;  2D4W A;  4EFH A;  4DS4 A;  4M7X A;  2DY4 A;  3J7Z O;  3V9X A;  3O4N A;  1Y64 A;  2YNI A;  1HNZ K;  5AQT A;  2UUC K;  1NM1 A;  2KHO A;  4FWK A;  2KW4 A;  2YCH A;  3G0Z A;  4CFB A;  2NUB A;  1BCO A;  3KWI A;  4LF9 K;  2ZGY A;  1C0T A;  4MO5 A;  3ZSX A;  1IO2 A;  2P5G A;  1S1U A;  4ZTF A;  3L4I A;  2G8I A;  3LDL A;  4B9N A;  3AGK A;  3HL8 A;  1KLM A;  3OVN A;  3G4S N;  4DTJ A;  2X6S A;  1D9D A;  1CZA N;  1NGD A;  4IEE A;  4JKE A;  1WAF A;  3DXM B;  4KI4 A;  4G1Q A;  2PYL A;  5BPL A;  4QOZ B;  5FRN A;  4B1Z A;  1GLC G;  2BUP A;  4FJN A;  2ZJQ L;  1QHT A;  3CXC M;  1DT9 A;  1SUQ A;  4AIL C;  4LH4 A;  5FRO A;  3LAN A;  3DOK A;  3OJS A;  5JVH L;  4CF1 A;  4K43 A;  1WSF A;  4BRO A;  4DR4 K;  3ULE A;  3RRH A;  2A41 A;  1QHA A;  2QK9 A;  3MX2 A;  4IG0 A;  3G25 A;  3O4W A;  1TUU A;  4NYF A;  4CGI A;  1BA0 A;  4BG9 A;  3SCX A;  1JLF A;  1MWK A;  2VCP A;  2P1J A;  1U2V A;  2XHB A;  1QVG M;  2VYP A;  3QB0 A;  4E7H A;  1OVQ A;  3KKS A;  4H0P A;  2G8V A;  1ZBU A;  4MFB A;  1RBV A;  1HRH A;  4U67 L;  4AH9 A;  3PSI A;  3O9R A;  4B8A B;  4F4K A;  4ILG B;  4I2P A;  4FZX C;  1KFD A;  2V51 B;  2IOC A;  3VQ9 A;  1TL3 A;  3K9J A;  4FWL A;  3GG4 A;  3HOS A;  2F9T A;  1U47 A;  3K59 A;  4LF5 K;  1JL2 A;  1C6V A;  3QIO A;  4FJ7 A;  4FM0 A;  3CJA A;  1OH8 A;  4WQ5 A;  4CED A;  2E2N A;  4FLZ A;  3RMD A;  2UU9 K;  2YKN A;  5CZ2 A;  4PY5 A;  3JXU A;  2E2P A;  2CGL A;  3J81 O;  3CFO A;  4K8X A;  3B6O A;  4KHN A;  3EE8 A;  2IDO A;  2OAN A;  5LJV A;  4LF4 K;  1KVC A;  3TAE A;  5CHI A;  3DRR A;  4CJR A;  3SPY A;  3E01 A;  3UKU A;  4GV3 A;  4NCA A;  1XNR K;  1FXX A;  2W6L A;  1HQE A;  1NMD A;  1Q86 O;  1KSP A;  3LP2 A;  4FJI A;  2P9L A;  1VHX A;  4B9S A;  1BIU A;  2E2O A;  1TV6 A;  4ELT A;  2Q0U A;  1D5A A;  1T44 A;  1Y97 A;  3LP0 A;  2XY6 A;  3FFI A;  4Z4H A;  3ZSO A;  2P9P A;  3ZLJ A;  5AQH A;  4JAX A;  1FKO A;  1GLJ O;  3SYZ A;  4QS9 A;  4M63 C;  4QS7 A;  3HK2 A;  4CEC A;  3OHR A;  2OA8 A;  2AJQ A;  2VWB A;  1RDW X;  4DFK A;  4YDU C;  4Z4I A;  3P31 A;  1BDG A;  4ID1 A;  1VAZ A;  2HNY A;  3H3N O;  3M5R A;  3ULD A;  2HVH A;  4LF7 K;  4JLH A;  5AQP A;  5A2Q O;  3WNF A;  3PSF A;  5AQN A;  3O3H A;  3TAG A;  3T3F A;  3OYL A;  3TSQ A;  3B6P A;  4CBX A;  4A62 A;  5K14 A;  4OGE A;  4CGF A;  2E1Y A;  3MDQ A;  4BR2 A;  3SUQ A;  4JI8 K;  2B5J A;  2IS3 A;  2E4L A;  4NLC A;  3J8A A;  3HPG A;  1EQY A;  4OPH A;  3I8D A;  3VTI A;  4C1N I;  3AVL A;  2Q2R A;  1C1B A;  3RR7 A;  3ZX2 A;  4B3S K;  1HPM A;  1BOT O;  3QEX A;  2KFN A;  1QE1 A;  5C2D A;  4JI4 K;  1S22 A;  3ZEU A;  3VN5 A;  4Z4E A;  1HJR A;  3RMA A;  3WXM B;  1VSH A;  5HRS A;  2O8D B;  5TKW A;  2H3G X;  3UKU B;  4BR9 A;  3C0B A;  2F9W A;  3ZET B;  3HI0 A;  3BY5 A;  1EKE A;  2ASO A;  3QLH A;  1I94 K;  2OTJ N;  3I56 N;  1TKD A;  4GNI A;  4GW6 A;  2VGM A;  4X65 K;  5BPM A;  4CCH A;  1BU6 O;  1XUP O;  3WXL A;  1LWC A;  1N33 K;  2AA4 A;  1JKH A;  5JVG L;  2O4G A;  3NF9 A;  4KHY A;  3HPO A;  4GVE A;  2OYQ A;  3A5O C;  4CJS A;  3P1G A;  4JI2 K;  1TKX A;  3KK2 A;  4CF9 A;  3NH0 A;  5LJW A;  3O9U A;  4MDA A;  5AQW A;  2O8F B;  2QWL A;  1ZC6 A;  3P38 A;  3FZL A;  3MXJ A;  1VSJ A;  3VEY A;  1Z6R A;  3HP6 A;  3UKR B;  2A40 A;  1OH6 A;  5AZJ A;  3M8P A;  4TSX A;  3J7A P;  3VF4 A;  3O1B A;  5AQK A;  1B92 A;  3MK6 A;  1J9A A;  4C8L A;  3ZT2 A;  3IS9 A;  3OYI A;  4X64 K;  4CF2 A;  1YJW N;  4YOR A;  4JK8 A;  4CHP A;  1J6Z A;  1YHQ N;  3LPU A;  2F7T A;  3V4I A;  1P8Z A;  1KD1 O;  2HST A;  4BRM A;  4M3W A;  4CK2 A;  2Z1I A;  1VQO N;  4H5N A;  3VGL A;  4W5N A;  4ICL A;  1DTT A;  5AFU A;  3QIP A;  3GL1 A;  2VGN A;  1MWM A;  1HLU A;  3E66 A;  1QTM A;  1Q8I A;  1RTD A;  3V81 A;  3HBT A;  1DTQ A;  4EAH D;  1Z25 A;  2Q97 A;  4JKF A;  4FSV A;  2DTU A;  1HMV A;  4Z94 A;  2HHQ A;  1I39 A;  1C0G A;  3LAK A;  4IOA L;  4JI3 K;  1RT1 A;  3MCA B;  3VQQ A;  5AQR A;  3KK3 A;  4GV6 A;  3QFP A;  3VA0 A;  4DSJ A;  5JMV A;  2NRT A;  3ZSR A;  5CYQ A;  4BRF A;  2O8C B;  5CY4 A;  1N6Q A;  4LFB K;  3T19 A;  1O13 A;  3B8A X;  3G6E N;  3KWG A;  1HUX A;  3HM9 A;  2QEX N;  4HVJ A;  4B3O A;  4BY9 C;  3O8M A;  5EOY A;  4XH5 A;  4Z4C A;  1HX1 A;  3VQ8 A;  1NJW A;  4JYA K;  4I9L A;  5E84 A;  2KQ2 A;  4ZHR A;  4RW6 A;  4RW4 A;  3DOL A;  2HVI A;  4AHT A;  5M1F A;  3TAF A;  4CJ5 A;  3NVK A;  1Q18 A;  2P51 A;  3EEQ A;  2ZM6 K;  4FK4 A;  4HCB A;  3OS2 A;  1ITG A;  2D0A A;  2CGK A;  3HTV A;  1JLB A;  3TTD A;  2D0B A;  1YVN A;  1A5X A;  2D0P A;  2FBV A;  3FZF A;  4MLH A;  4JI1 K;  3Q7B A;  1CXQ A;  4J2E A;  4LSL A;  4KHW A;  1YVU A;  5HL7 L;  3LPT A;  1VQ7 N;  4FYD A;  2OPP A;  3UE5 A;  5AFU H;  5I9E B;  2WC9 A;  4AHC A;  3FZK A;  5DM6 L;  3L3U A;  1BA1 A;  4IFY A;  3CCV N;  3VQE A;  4BE2 A;  4KTQ A;  5AQJ A;  4PQU A;  3P5J A;  3QEV A;  5FLX O;  3OYH A;  1JCG A;  2A6A A;  4DFJ A;  4CZH A;  1SQK A;  1UAX A;  2KTQ A;  4A59 A;  3WEE B;  3WQT A;  5BRE A;  5FDL A;  3F2K A;  3WEE A;  2R7Y A;  4IOC L;  5AQF A;  1SV5 A;  4NXN K;  3QET A;  1RNH A;  3KJV A;  3EY1 A;  3AO1 A;  2ZWH A;  3AVC A;  5B8H A;  2Z1J A;  4DUZ K;  4F3T A;  3A5N C;  4BVP A;  3MX5 A;  4DHY A;  4F2S A;  3MEG A;  4CEQ A;  2J4R A;  4JHD B;  1V4T A;  2QWP A;  3SAH A;  4DWI A;  2KZZ A;  3T7Z A;  5DM7 L;  3OS1 A;  4NLB A;  3R8E A;  4H4O A;  1WOQ A;  3DMJ A;  3SUO A;  3OYA A;  1HKG A;  3V9Z A;  4A2A A;  1NKB A;  1RDB A;  4M45 A;  5JLF A;  3MN6 A;  3RSE A;  3K57 A;  1KQS M;  1BI4 A;  1TYQ A;  3OJU A;  2PFU A;  3HVT A;  4RCH A;  1K9M O;  4AQY K;  4R5P A;  5I3U A;  2P9P B;  2ETJ A;  3DXK B;  4CIF A;  4FZY A;  5AQQ A;  4W5Q A;  1VQ8 N;  4CHQ A;  4FJH A;  3JSM A;  4MDB A;  4DQR A;  2IVP A;  2VQF K;  4CJ4 A;  2P5O A;  4CFC A;  1CXU A;  3WXK A;  4KHU A;  3WUH A;  1R59 O;  4AM6 A;  5EXW A;  3VQ7 A;  4WE1 A;  3AA5 X;  1GLE G;  1XC3 A;  4DR6 K;  4B08 A;  2YHW A;  4B1X B;  4CJP A;  4HUF A;  1XMQ K;  4FJ8 A;  3QEI A;  3KLF A;  4DV0 K;  3U3G A;  4CZM A;  3MED A;  4AHU A;  1VQ4 N;  3O9Q A;  2BGG A;  3FLC O;  3GOI A;  4CEB A;  2QKB A;  5EY4 A;  4FJL A;  4DTU A;  2X78 A;  2JGU A;  3N4P A;  5M1N A;  3KK1 A;  4NCG A;  4E7J A;  4CES A;  4FW2 A;  3CF5 L;  5M1O A;  3ZX3 A;  4PHT X;  3AA2 A;  3QNO A;  4B1Y B;  4N76 A;  1IKW A;  2GWJ A;  3PV8 A;  3C6U A;  3CET A;  2ZQB A;  1ZBS A;  1WB9 A;  1J5O A;  4DCH A;  3OA9 A;  1Q9Y A;  3JYT A;  4ILJ A;  3LAM A;  1BHL A;  1HNW K;  3MWT A;  4ISE A;  1S72 N;  4CEO A;  5C42 A;  2F4V K;  4WQ5 C;  1S1V A;  1NGE A;  5LMU K;  4DFP A;  2D0O A;  4B9U A;  1WBB A;  2GV9 A;  5AQZ A;  4O5F A;  1BIS A;  4UY8 O;  3AVB A;  3V9W A;  3THW B;  1EXQ A;  4LF6 K;  5CYM A;  3VQA A;  3VQD A;  1I3A A;  3QBX A;  5FRM A;  4O0J A;  3CPE A;  1VSD A;  1QZ6 A;  1K8A O;  1KTQ A;  1BI4 B;  1FJG K;  3R9P A;  2QWQ A;  4IBN A;  1K73 O;  3DRP A;  4A61 A;  3W0L A;  3LM2 A;  3OW2 M;  3KK7 A;  4UQG A;  4NCB A;  2WBN A;  1DKG D;  4NB4 A;  1JLA A;  4GY2 B;  1WN7 A;  1YJ9 N;  1S1X A;  4W5R A;  3HVR A;  4FL9 A;  4CZJ A;  1NK8 A;  2JLE A;  3WNG A;  4CJV A;  2HND A;  1BWF O;  3U6F A;  4HCC A;  3HYF A;  1XQS C;  2NZT A;  2QWR A;  4IFE A;  4H5V A;  3NHG A;  4DSF A;  2RE2 A;  1G15 A;  4H0X B;  3THV A;  4BRH A;  4J2D A;  1NGG A;  3L2R A;  4BC5 A;  3V6D A;  4CEF A;  3O3F A;  1LOT B;  3QES A;  3SNN A;  3AGR A;  4ELV A;  3F73 A;  1EX4 A;  4ID5 A;  5JS1 A;  3DLE A;  3RSE B;  3VTH A;  3QNN A;  1NLV A;  5KPR A;  3ZSQ A;  3AVM A;  2HW3 A;  2ZJR L;  2P9N B;  2O8F A;  1X1P A;  3ZEU B;  3ZET A;  1IBM K;  4PL7 A;  3OBW A;  4BQZ A;  4FVM A;  1WBD A;  5KQ8 A;  3R6M A;  4FM2 A;  1Q7Y O;  3CC2 N;  3WNE A;  2QI2 A;  3L2Q A;  1C0F A;  3MEC A;  2ASP A;  4FJ9 A;  3QER A;  1GLF O;  1JJ2 M;  2DFF A;  4FLW A;  4JI7 K;  3VQ6 A;  4BRK A;  3TAB A;  3LDS A;  4JKA A;  4FJM A;  3F9M A;  3I0S A;  3H45 C;  4PA1 A;  2QTD A;  5LMN K;  1C1A A;  4CGH A;  4R79 A;  3SMS A;  4ISG A;  1ZYQ A;  5KGW A;  1WNS A;  4BG8 A;  5J2N A;  2OZS A;  1G99 A;  3SQ1 A;  3HSC A;  4KRE A;  4KI6 A;  1NU0 A;  3S3N A;  3SK3 A;  3PO5 A;  3SUN A;  1C0M A;  5M1Q A;  3Q7C A;  3BF1 A;  1CZB A;  3MAQ A;  2HBL A;  1EP4 A;  3D2E B;  4DFM A;  3LWM A;  1VQK N;  1WSE A;  1BGX T;  1ASW A;  4H5T A;  1XHZ A;  4OPK A;  4B9Q A;  3ZT3 A;  2GX9 A;  3CM6 A;  5AQM A;  4IOX A;  4FW1 A;  1GOA A;  4K0K K;  1VSK A;  5MLC Q;  4WQ4 C;  2P9S B;  1NGF A;  3V1O A;  2HHV A;  3BZK A;  4FJK A;  1JXB A;  4J8F A;  1X3N A;  5M1P A;  3E9O A;  2NRW A;  5AQG A;  3WXJ A;  4BC2 A;  1NBW A;  5KI6 A;  1QSY A;  3G71 N;  4OLA A;  3ASM A;  3IDH A;  3SPZ A;  4DLE A;  4BGA A;  2I7P A;  3TTC A;  4KPY A;  1OVY A;  4Z0U A;  2HHT A;  2YNG A;  4LY7 A;  3LZI A;  2YHB A;  4ELU A;  4F8R A;  3CFP A;  2NRH A;  4BE1 A;  3CCS N;  1M1K O;  4CBU A;  3WXI A;  4CJT A;  4JKH A;  5C15 A;  1ILY A;  3NFA A;  3ZT1 A;  1JLQ A;  2RKI A;  1VQ9 N;  3LZJ A;  4FJG A;  5KRS A;  4N5S A;  4YOV A;  2B4J A;  5HRR A;  3IRX A;  5ELZ A;  2G8F A;  4W5O A;  3DRS A;  2D0C A;  3E9L A;  4BWM A;  4AHV A;  3NH2 A;  5BR8 K;  1NKE A;  3HP9 A;  3D0P A;  3OBY A;  4B9T A;  3DI6 A;  3MCP A;  1KC8 O;  5F1X A;  1N8R O;  3MXI A;  2FF6 A;  3THW A;  2PYJ A;  1NMN A;  3AAQ A;  1NJZ A;  4O4G A;  1F21 A;  1P90 A;  2YJE A;  3LDQ A;  2KZM A;  4FLT A;  4DSL A;  4BDP A;  2ZE2 A;  2FBX A;  3O4Q A;  1KLN A;  4GKK K;  1T3V A;  4FOE A;  4O8U A;  1NKC A;  3AVI A;  2ZGZ A;  3R1X A;  1K8K A;  3VQ5 A;  3LP3 A;  1ATS A;  2G8U A;  3D2E A;  1XNQ K;  4CJL A;  1YIT N;  3V9U A;  3FGU A;  5FPD A;  3PO4 A;  1J53 A;  1T6D A;  2XRI A;  2IGI A;  1KVB A;  4KO0 A;  1E3M A;  4A2B A;  4J2A A;  3UB5 A;  3CJC A;  2O8E B;  3DYA A;  4CHO A;  1QVF M;  1RT4 A;  3M8S A;  3C6H A;  3ZYY X;  2NLX A;  4GKJ K;  3RVC A;  4AHS A;  4CIE A;  4BRP A;  3SQ4 A;  1RDC A;  4O8K A;  4KTW A;  3AO3 A;  3SQ0 A;  5HBM A;  3SBG A;  3SV3 A;  2KFZ A;  4IZ9 A;  4PUO A;  3AO4 A;  3DLB A;  5C10 A;  1RDA A;  3NAE A;  3AO5 A;  1S5J A;  3HOT A;  2ZJP L;  3C7N B;  3HZ6 A;  4K25 A;  4DU3 A;  4CE9 A;  5ADX H;  4BRD A;  1KVA A;  3CD6 N;  4DU4 A;  1LWF A;  3H3O B;  2XO7 A;  4IDK A;  3JAM O;  4AM7 A;  5BRH A;  3BF3 A;  5C0Y A;  4AHR A;  3IAY A;  4DR7 K;  1WAJ A;  3BP8 A;  3C94 A;  2AP1 A;  2EWS A;  3RR8 A;  3DXK A;  3SJH A;  4OLB A;  2FF3 B;  3VQB A;  3FFK B;  2ZF5 O;  4LD0 A;  1QSS A;  3KD1 E;  4FWN A;  4DTM A;  1N32 K;  2EX3 A;  1SL2 A;  1M90 O;  2Q0R A;  1W9H A;  4JD2 A;  4CEA A;  3PUF A;  3TI0 A;  1YAG A;  1X9J A;  1BO5 O;  4ISF A;  3D7E O;  4CW7 B;  1DEJ A;  3OYE A;  1IBL K;  3O5B A;  2RN2 A;  3ISN C;  3TAP A;  1K8K B;  1DGK N;  4OKJ A;  4CJ3 A;  4YOY A;  3AV9 A;  4C8N A;  1OH5 A;  3MXM A;  3OYJ A;  3U3Y A;  1D9F A;  1E4F T;  4L3Q A;  3HO1 A;  1KCF A;  1TVR A;  5GAH P;  3T1Y K;  3RMB A;  4CFA A;  1W0H A;  4CJW A;  4XH1 A;  3ZSZ A;  1S1W A;  1VRT A;  5IT9 O;  4M3R A;  1V4S A;  2P9U B;  1HNX K;  1Q9X A;  4IG3 A;  1JLC A;  4JS4 A;  4DMN A;  3SJJ A;  1NJX A;  2O8D A;  2GEL A;  4CD3 A;  3O9T A;  3PX0 A;  4KAZ A;  4BR0 A;  1W97 L;  4GMJ B;  2QWO A;  3M8R A;  2XY5 A;  4Y1C A;  1RCH A;  5AQO A;  4KTZ A;  1QS4 A;  5HRO A;  2W6K A;  1GLL O;  3CCL N;  2HBK A;  1VQL N;  4RWT A;  5F2R A;  2GUI A;  1NG9 A;  3ZCM A;  1RT6 A;  4BRG A;  2GBZ A;  1ESV A;  1BQM A;  1ZBL A;  1XWL A;  1JLG A;  1N36 K;  4DR1 K;  2A42 A;  4CGG A;  4RW8 A;  4FJ5 A;  4H0O A;  2FLO A;  1HNV A;  3HM8 A;  3EL2 A;  4DQ8 A;  5IWA K;  2YHX A;  4H5R A;  3VF2 A;  4XH4 A;  2W40 A;  3O6W A;  3LDP A;  3QDK A;  4KH6 A;  4A5B A;  1JL1 A;  2YKM A;  4CJF A;  1ASV A;  4CF0 A;  4FWO A;  3OTO K;  3OYN A;  2HBM A;  3TSP A;  1KFS A;  1IBK K;  5AQY A;  1QQC A;  3MN9 A;  3O08 A;  4W5T A;  2FSN A;  4OKE A;  4DV6 K;  2VWK A;  2OTL N;  4E19 A;  2GEM A;  3H1V X;  1YF5 L;  3DWL A;  3IG1 A;  5C25 A;  1RT2 A;  3L2W A;  1S6P A;  1NWK A;  3U8X A;  4IJA A;  4BR4 A;  2HHW A;  1HR0 K;  5GAG P;  4DTX A;  4BWJ A;  4CK3 A;  1YTU A;  3CJ9 A;  4N56 A;  1NGJ A;  4K42 A;  1VSF A;  2XY7 A;  4OJR A;  3BGR A;  2V7Z A;  4OKK A;  4FWS A;  1KXP A;  1NK4 A;  5HRP A;  1TUY A;  2KKZ A;  4DV7 K;  1TAQ A;  1IH7 A;  3KLH A;  4RW9 A;  2P9L B;  3SBT A;  1SS6 A;  2VQE K;  4YOT A;  5KQD A;  5KTQ A;  4NXM K;  4DQP A;  1NJI O;  3CME N;  4E7K A;  2E88 A;  4JRQ A;  1NK6 A;  1T8E A;  2PBD A;  3NCI A;  4CEZ A;  1UA0 A;  5TKY A;  2V52 B;  5J2M A;  1WUA A;  3S3O A;  5GIO A;  4DV5 K;  1T7P A;  3O80 A;  4JNE A;  3A2F A;  4L8R B;  4B3R K;  1HYS A;  1LAW A;  2FC0 A;  4PKH A;  4IO9 L;  2UUA K;  3PIP L;  3VEX A;  4CJQ A;  5AQI A;  3AVN A;  4FWP A;  1EET A;  3KLE A;  3I33 A;  3CMA N;  2F96 A;  4CVN E;  4EP4 A;  4DV1 K;  3HPH A;  2B6A A;  4CZK A;  3SAG A;  4PKI A;  1D8Y A;  3T69 A;  4JN4 A;  2W42 A;  1X9M A;  4FLX A;  2HBJ A;  1X9S A;  4LFA K;  4DSE A;  1NGC A;  4YDU A;  3HXM A;  1S6Q A;  1NK7 A;  4GVM A;  3IKM A;  4M7Y A;  5CE3 A;  1C0U A;  4DTN A;  5HRN A;  3LWL A;  1R0A A;  1VQM N;  3CPW M;  3K9K A;  5J1E A;  1RIL A;  3KLI A;  2D1K A;  1S9E A;  3OYD A;  4FJX A;  4Y0W A;  4XIU A;  4FK0 A;  3THX A;  4MQ3 A;  1HNI A;  4CZG A;  3EKS A;  4FPA A;  2VG7 A;  4YHH K;  3TTF A;  2HHU A;  3L0Q A;  2P9S A;  4JI5 K;  3GE1 A;  2E6M A;  4A5A A;  2A1R A;  4WCE L;  5J2P A;  2EHG A;  1SKR A;  3QEP A;  3ZSY A;  5F0X A;  5AJ3 K;  1X3M A;  1YIJ N;  2E5L K;  4ILH A;  4FCY A;  3TAQ A;  4FJJ A;  4OX9 K;  3AA3 A;  3SAF A;  2PZS A;  2HHX A;  2WON A;  3EKU A;  4BRE A;  4EHU A;  5JIC A;  1C1C A;  4IXC A;  3VEO A;  2Q31 A;  2YV0 X;  3ATU A;  3VEN A;  3CCR N;  4OVL A;  2Q3S A;  1BL3 A;  3SV4 A;  4JKG A;  5DMR A;  2Q36 A;  1RDD A;  5HOO A;  2E20 A;  2IC3 A;  3KTQ A;  3PX6 A;  1REV A;  4Q0B A;  4O55 A;  4Z4F A;  2O8B A;  2Z1H A;  4X66 K;  2I5J A;  2VG6 A;  1GLB G;  4DLG A;  2YI1 A;  4E0D A;  4H4M A;  2VG5 A;  1HKB A;  1D4X A;  5GAD P;  5DK5 A;  2GWK A;  3CHW A;  4CER A;  3KKR A;  3I8B A;  3VGK A;  2NRV A;  1O1W A;  1ATN A;  3SLC A;  4JI6 K;  1J54 A;  1FKP A;  3CCJ N;  2VWJ A;  1S9G A;  3VQP A;  4DSK A;  3CI5 A;  3NVM A;  4PL8 A;  3V1R A;  1QSL A;  2BH1 A;  2HF4 A;  4BRC A;  4C8O A;  3EYZ A;  5BRF A;  3E1Y A;  2OPR A;  2QWM A;  5FPN A;  4NYN A;  1WSG A;  3CJ7 A;  1VQ6 N;  3HJF A;  1RBU A;  3C7N A;  1HPZ A;  4B1W B;  2RPI A;  3CQY A;  4DSI A;  3QIC A;  2JWK A;  3LM9 A;  1VQ5 N;  2OPS A;  3CFR A;  3DAW A;  4YOU A;  2WOM A;  5BRD A;  4FO0 A;  2P9K B;  4IFV A;  2HHH K;  4C8M A;  3ATV A;  1RDU A;  5HP1 A;  2Y1I A;  4HWI A;  4Y1D A;  2BAN A;  1U45 A;  1YJN N;  1NK0 A;  3M1F A;  3AO2 A;  3GBT A;  4M3T A;  3CG7 A;  4WFN L;  3OYK A;  3A5M C;  3EE9 A;  3AAR A;  3ZSW A;  4YNQ A;  2NRR A;  2YX6 A;  3P83 D;  3RRG A;  4KH4 A;  4OO1 J;  4CZL A;  1U49 A;  4CZI A;  3BUZ B;  2QXF A;  1RGI A;  1BQN A;  3AVF A;  2UXD K;  4CI6 A;  5BR9 A;  4FVU A;  3HRG A;  4FLU A;  3MN5 A;  1RBT A;  1NGA A;  2KLA A;  2X74 A;  1YI2 N;  2CH5 A;  4CHZ A;  3NE6 A;  2A5X A;  4A57 A;  4CHY A;  5FPE A;  5AQS A;  1VRU A;  4CFD A;  4FZZ A;  5AQV A;  1RT3 A;  3M8Q A;  3J80 O;  5AQU A;  4CGJ A;  1UWB A;  2ASM A;  2IIR A;  4B1V A;  1NK9 A;  2P9N A;  1NOY A;  2DFH A;  1LAV A;  3NF7 A;  2BTF A;  3CCE N;  2OPQ A;  3L8B A;  4BR5 A;  1N34 K;  3H1Q A;  4QCL A;  4BRN A;  5E26 A;  4BAC A;  1U04 A;  3DJC A;  1TGO A;  3R3L A;  3M3Z A;  1N5Y A;  3UIQ A;  5AR0 A;  5BN8 A;  3AVK A;  4RTF D;  1X9W A;  4DQI A;  4HUG A;  2YNF A;  4Q5V A;  3OYF A;  3KHY A;  4JD2 B;  1XC9 A;  3WT0 A;  3CIP A;  5JLH A;  1VSM A;  3ALY A;  1SKW A;  3VES A;  4MLE A;  3K5M A;  1RTI A;  4E1M A;  4RG8 A;  5CR4 A;  3M6G A;  3ULE B;  1KAX A;  3U4L A;  3BEX A;  4IEI A;  1L3V A;  1B9D A;  4U7B A;  3AVG A;  1ATR A;  3L6Q A;  3TSU A;  4O0I A;  2UUB K;  3TWH A;  4K8Z A;  4FOI A;  3ZX0 A;  1RBS A;  4FPB A;  4M3U A;  1JCE A;  4DR2 K;  3VPZ A;  3MWP A;  3P39 A;  4JRP A;  4YY3 K;  5ADX A;  3FR0 A;  3DLG A;  5GAE P;  3H08 A;  3NMU A;  3DLK A;  4CHN A;  4H03 B;  2GTD A;  3CM5 A;  3OYM A;  3C65 A;  2QW9 A;  1TK0 A;  4E3S A;  4BGB A;  1VQN N;  3ITH A;  3TAN A;  3IFR A;  2NRZ A;  3T1A A;  3C6T A;  4DV3 K;  3FZM A;  2HF3 A;  3TPQ A;  2QXL A;  1LW0 A;  4F2R A;  3CER A;  3KVG A;  3F5T A;  4FLY A;  3K5N A;  5E41 A;  4JI0 K;  3CJB A;  2UXC K;  5HLF A;  5GIN A;  4RW7 A;  4DTP A;  1T6C A;  1HKC A;  1YTA A;  4IKF A;  3KLG A;  1NNE A;  1FW6 A;  3LDN A;  4JHD A;  1TK8 A;  3K2P A;  3QFU A;  3O3G A;  2IVO A;  3JS6 A;  4JK9 A;  4DTR A;  1ASU A;  3D6R A;  1VSL A;  3ENB A;  3PLA A;  3I55 N;  4YOW A;  1GLA G;  1HJO A;  3AVH A;  5T7B A;  5CZ1 A;  4LH5 A;  4DR3 K;  2P9K A;  1BG3 A;  3SQ2 A;  4DU1 A;  1U6Z A;  5LL6 Z;  3UKR A;  4BR7 A;  4BRL A;  3VET A;  3WQU A;  3DLH A;  3O1W A;  3EZ5 A;  4HHT A;  3THY B;  4H5W A;  4FWR A;  4V19 S;  2QWN A;  1H1V A;  4C1N K;  3QML A;  3VA3 A;  1A5W A;  3C6A A;  5I42 A;  2FXU A;  1BCM A;  4B8C A;  4C23 A;  3AA4 A;  1WSI A;  4BQL A;  4BDY A;  5AQX A;  3ZT0 A;  4BRI A;  3H6E A;  2G8H A;  1VQP N;  1XMO K;  3VEZ A;  4H0V B;  3CC7 N;  5KGX A;  3FZH A;  4KHQ A;  1EO1 A;  3WNH A;  2HNZ A;  3L2V A;  1VSI A;  4PKG A;  3QEW A;  1UOC A;  2HMP A;  1S1T A;  2NRX A;  3K0S A;  4DUY K;  4O44 A;  5EX5 A;  4QS8 A;  5KPT A;  4OPA A;  2HB5 A;  1NOZ A;  2RHK A;  1B9F A;  3LP1 A;  4N47 A;  5J2Q A;  2QKK A;  1YT3 A;  4DV4 K;  3OS0 A;  1TK5 A;  3VF6 A;  4BRA A;  3TAR A;  1E4G T;  1JCF A;  3J7Y P;  2HHS A;  3THY A;  4FM1 A;  4KV8 A;  4I6M B;  3FE1 A;  1YUW A;  4DV2 K;  3VQC A;  4CJU A;  4I9Q A;  3A5L C;  1NK5 A;  2P9I A;  2BDP A;  2XY8 A;  4M3X A;  3K5O A;  1Q81 O;  2G8K A;  4LC9 B;  3CC4 N;  4DS5 A;  4KBO A;  3IMX A;  5JS2 A;  3QIN A;  5AZI A;  3KZB A;  3NGY A;  3LL3 A;  2JWL A;  1L3S A;  4FLV A;  5KRT A;  3VOV A;  4IWV A;  3CCQ N;  4KFB A;  4I2Q A;  4X62 K;  2FSK A;  2BE2 A;  4K41 A;  1S3X A;  1SAZ A;  4CF8 A;  4EZ9 A;  2Y1J A;  2ITM A;  4KHP K;  2A1S A;  1UA1 A;  1L3T A;  1QQM A;  3S9H A;  3LDO A;  4DR5 K;  2QM1 A;  1JLE A;  4Z4G A;  4CEE A;  1SKS A;  3OYB A;  1L3U A;  4JKB A;  1GOB A;  2F8T A;  4GV9 A;  1CLQ A;  3L3V A;  3DM2 A;  4XEI A;  5LY3 A;  3NBP A;  1GLD G;  1IV0 A;  1QZ5 A;  3QBW A;  2I7N A;  2O8B B;  1RT5 A;  4FWQ A;  1XHX A;  4CZE A;  1BIZ A;  4E1J A;  4DKW A;  4JK7 A;  5H1S Q;  3MN7 A;  1VK0 A;  3CCM N;  2ITG A;  1WSH A;  4QAG A;  4LF8 K;  3MMV A;  4FXD A;  2YJF A;  2O8C A;  3MEE A;  1ZBI A;  1SL0 A;  4M3Y A;  2YHY A;  2E2Q A;  4M41 A;  5AQL A;  4FK2 A;  2DFE A;  2IAJ A;  1U4B A;  3ENO A;  3EO3 A;  3EN9 A;  1KAZ A;  4E1N A;  3VER A;  4CJE A;  2DPN A;  4HTU A;  4B3T K;  3D2F B;  5M1K A;  1RBR A;  3D2F A;  3SI6 A;  2UXB K;  3ENH A;  3THX B;  4DB3 A;  3AVA A;  2P9I B;  4DF4 A;  4JKG B;  1IG8 A;  3HST B;  4KH5 A;  1EWR A;  1TKZ A;  5SWM A;  1NGB A;  3OY9 A;  2Q1N A;  3W3D A;  4CK1 A;  1QQO A;  1LW2 A;  3IUC A;  3CJ1 A;  1RTH A;  4DG1 A;  1KRP A;  1KAY A;  3U9Z A;  1TKT A;  3CCU N;  4CJK A;  3OYC A;  4PWD A;  3NH1 A;  3RWU A;  4M42 A;  3NGI A;  5BN9 A;  3OYG A;  4DQQ A;  4J2B A;  3ZSV A;  4KRF A;  4EHT A;  4DQS A;  4H0T B;  4AF1 A;  5KPZ A;  5SZT A;  3DLR A;  1IJJ A;  5C2F A;  4OPJ A;  1DLO A;  1IKV A;  5AZI B;  1MU2 A;  1SL1 A;  2E8A A;  3L4Q A;  3QO9 A;  4E89 A;  2O4I A;  2FBY A;  2W41 A;  1CZ9 A;  2WUS A;  1TYQ B;  3U9D A;  1GOC A;  3O9S A;  2F8S A;  1U48 A;  2FBT A;  3TR8 A;  4I6M A;  3N4Q A;  2E1Z A;  3G10 A;  1ZBH A;  1W2B M;  5C24 A;  1MDU B;  3VQ4 A;  3PY8 A;  3ZT4 A;  3AAP A;  1SZ2 A;  4EIA A;  2CH6 A;  4IJN A;  1IKY A;  2YNH A;  3CYM A;  4G9Z A;  3VMF B;  4NO7 A;  4JEP A;  4F3O A;  3SZ2 A;  1WSJ A;  4DTS A;  2HMI A;  1HYZ A;  1T03 A;  3NGZ A;  1LV5 A;  1IG9 A;  2OCE A;  1NJY A;  4EP5 A;  2WFB A;  3AVJ A;  3A8Y A;  3S41 A;  3SMP A;  4M3Z A;  1MA9 B;  2WTU A;  1FK9 A;  1ZXO A;  2FSJ A;  4WYB A;  1QQN A;  1EWQ A;  2GUP A;  2QA4 N;  1K6Y A;  1BUP A;  3F9K A;  1Z05 A;  4JKC A;  3TAM A;  4YFU A;  1OH7 A;  3HT3 A;  2A3Z A;  3RTV A;  5BPN A;  2IVN A;  4IDH A;  2V7Y A;  2PAV A;  4B9V A;  1IKX A;  3LAL A;  2Z1G A;  2P9U A;  4F9O A;  4MO4 A;  3RMC A;  4FWM A;  1L5U A;  4H8K A;  4IO8 A;  2CGJ A;  1ZBF A;  4WF9 L;  1W7A A;  3CQ8 A; 
#chains in the Genus database with same CATH homology
 2UU9 K;  4DUZ K;  4JI3 K;  4YHH K;  1IBK K;  5BR8 K;  1N32 K;  3J81 O;  1HNW K;  1HNZ K;  4DV6 K;  4JI5 K;  2UUC K;  4JI7 K;  2F4V K;  4JI0 K;  4LF4 K;  2UXC K;  4LFB K;  1I94 K;  4CW7 B;  5LMU K;  4LFC K;  1IBL K;  5LMN K;  1XNR K;  4X62 K;  5AJ3 K;  1HR0 K;  4X65 K;  2E5L K;  4LF9 K;  2UXD K;  1N33 K;  4OX9 K;  4KHP K;  4JYA K;  4LF6 K;  4GKK K;  4DR5 K;  4DV7 K;  4JI2 K;  3T1Y K;  4DR3 K;  4AQY K;  3T1H K;  3J80 O;  5IT9 O;  2VQE K;  5LL6 Z;  1XNQ K;  1HNX K;  1FJG K;  4NXM K;  2ZM6 K;  4V19 S;  1N34 K;  4K0K K;  3J7A P;  4X66 K;  2VQF K;  4DV5 K;  4JI1 K;  4DR4 K;  4LF7 K;  5A2Q O;  4B3M K;  4B3R K;  1XMO K;  1J5E K;  4X64 K;  2UUA K;  4GKJ K;  4JI6 K;  4DR6 K;  4LF8 K;  4JI8 K;  4CVN E;  1XMQ K;  4DV1 K;  4DV0 K;  4DUY K;  1N36 K;  2UUB K;  4DR1 K;  4LFA K;  4B3T K;  4JV5 K;  4DR2 K;  5FLX O;  4B3S K;  2UXB K;  4YY3 K;  4DV4 K;  4DV3 K;  3JAM O;  4JI4 K;  5IWA K;  3J7Y P;  4LF5 K;  4DR7 K;  2HHH K;  1IBM K;  4NXN K;  4DV2 K;  3OTO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...