4DV5K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv5K00
4NXNK 4AQYK 4B3RK 5AJ3K 3J80O 5BR8K 4DR4K 4DV5K 4JI5K 5LL6Z 5LMUK 4JI4K 4YY3K 4JI6K 2E5LK 1J5EK 5IT9O 2UUAK 4JI2K 3T1YK 4OX9K 4LFCK 4JI0K 1N34K 4LF4K 4X62K 3J7YP 4DV3K 2VQEK 4DR2K 5LMNK 2F4VK 3J81O 4GKKK 1I94K 3JAMO 5IWAK 4DUYK 4X65K 4LF7K 4LFBK 4DR1K 1HR0K 4B3TK 4DR7K 4YHHK 4JI7K 1N33K 4LF9K 2UU9K 1XNQK 1XMOK 3J7AP 1HNWK 3OTOK 4DR5K 4X66K 4DR6K 4LF8K 2UXCK 4DV0K 4CW7B 1XMQK 1N32K 1N36K 4B3MK 4DV2K 2VQFK 1XNRK 1HNXK 2UXDK 2UUCK 4DV6K 5FLXO 2HHHK 4GKJK 4NXMK 1IBKK 4JI1K 4LF6K 4K0KK 4JYAK 2UUBK 4B3SK 4LF5K 4CVNE 4LFAK 5A2QO 4JI8K 1IBMK 4JV5K 4KHPK 4DV1K 4X64K 4DV4K 4DV7K 1IBLK 4JI3K 2ZM6K 4DUZK 3T1HK 4DR3K 4V19S 1FJGK 1HNZK 2UXBK
chains in the Genus database with same CATH superfamily
3EYZA 1MDUB 3MEDA 4C8NA 3K5NA 2OZMA 4JHDA 4N47A 4DR4K 3K5MA 4B9LA 1X9SA 4BVPA 3BY5A 2WUSA 1JLGA 2WOMA 3M1FA 4IG3A 2QWNA 2DPNA 3UB5A 1TV6A 3KIOA 3THXA 3DLEA 5AQYA 2OANA 3CJ7A 1JL1A 2QXFA 3T1YK 2Y1JA 4E7JA 1P90A 3BF1A 2YHWA 3A5MC 3AO2A 4H8KA 3QICA 4X62K 3O1WA 3H08A 1M1KO 4DR2K 4FJ7A 3C6HA 1UA1A 3ASMA 5D3GA 4GKKK 1S1TA 5F1XA 2YKMA 4AH9A 5FPEA 1RT7A 3MX5A 3G25A 1J6ZA 1N8RO 4ELUA 1X1PA 1NGAA 3MN7A 2E1YA 4LF9K 1U04A 3OBYA 3C6UA 1UOCA 2PBDA 5J1EA 3R8EA 3FZFA 2YHAA 2UXCK 1NOZA 1BQNA 3VQCA 4JRPA 4CHNA 2VCPA 4CJKA 3U6FA 3V1OA 1SKWA 2GTDA 3KLFA 2HHQA 3T19A 1GLJO 1NGDA 1HNXK 1YT3A 4ID5A 3QINA 1Q82O 1BWFO 3O1BA 3QDKA 3LZJA 2KFZA 4FL9A 4M3RA 4FJIA 2DFHA 1IG8A 4O44A 3SAHA 1B9FA 3SV4A 1IBMK 1DLOA 3QEPA 1TUYA 4DB3A 4OGEA 3IAYA 4CEDA 2YV0X 2KKZA 2PYJA 1RBTA 4AHVA 4PHTX 1RDUA 4O5FA 3ISNC 3FZMA 3TAPA 4JLHA 1GLCG 3THYB 3TAFA 3O80A 1YI2N 3AVBA 5J2MA 1GLFO 3RR7A 2E2OA 3OHRA 1ZXOA 3HRGA 4KH4A 5FRNA 4HTUA 4OLBA 4C1NI 5E26A 4DU3A 1JLAA 4ISGA 1VSMA 1L3UA 3SK3A 2Y1IA 1KLNA 1KFDA 3U4LA 4CZEA 4FOIA 4WQ5A 3KK3A 2IIRA 4B1WB 1KCFA 3B8AX 4LF4K 2F96A 2GWKA 3CJCA 2FSJA 3DI6A 3N4QA 4CI6A 2V7YA 3OBWA 1L3VA 3GL1A 3HL8A 1N5YA 1S1WA 4DR7K 4FO0A 3TTCA 2HSTA 1RBVA 3V1RA 4C8MA 5DMRA 2D0AA 2IVPA 3FZLA 2DTUA 1K6YA 3CFRA 4F2SA 2YHXA 4XH4A 3B6PA 1N36K 1VSJA 3A5LC 1C0FA 2BUPA 5FLXO 4JKAA 3HOSA 2FSNA 1YJNN 4H0PA 4O8UA 3NH2A 1HKBA 2EHGA 3KVGA 4CZKA 4EP5A 5CR4A 2NZTA 1NU0A 4WQ4A 1J9AA 4CEAA 5C10A 1JL2A 4X64K 4YOYA 3VEYA 5AQLA 2CGLA 1VSHA 1VQNN 2VG7A 1RT3A 1ZBSA 4FPAA 1VSFA 3A0IX 3PX6A 2O8DA 3UKUA 4CFCA 3CD6N 3VQQA 1S9GA 1OH5A 4DV5K 5FPNA 2P5OA 1RDAA 5KRSA 1GOCA 4CIEA 3BUZB 3ZSRA 4FLUA 2E8AA 2HVIA 3ZETA 3MXIA 3OYEA 3PY8A 4H0XB 1R59O 2VWBA 3HTVA 4E3SA 1WOQA 4DTMA 4W5TA 3OJSA 3GE1A 4DTSA 3LDNA 2G8WA 2Q0RA 4H5TA 3DWLA 4OPAA 2F4VK 2QK9A 1RT2A 3NFAA 4BE0A 4RCHA 3CFPA 4I9QA 1RBUA 1U49A 5HP1A 3ZYYX 2QKBA 4JNEA 3HVTA 4L3QA 4KO0A 3WXKA 3DRSA 1S5JA 1Q18A 4JI7K 4DTNA 3LDQA 4CZIA 5HOOA 1U6ZA 1FK9A 4PL7A 1IG9A 5FPMA 4I2PA 3A5NC 3GG4A 4O5BA 1NK7A 1VQ8N 4FK4A 2XY5A 3K5OA 4DSEA 4OVLA 4FJ8A 5BRHA 3K9KA 4FWPA 3NF7A 3K0SA 3AVGA 4DV2K 3E9PA 3HOTA 5H1SQ 3THWA 4GV9A 1A5XA 4CK1A 3O3HA 4JS5A 3HP6A 2O8BB 3ID6A 4Z4GA 3KJVA 5AQZA 4H5NA 3RVCA 1SAZA 3VF6A 5JLHA 3RTVA 2QWLA 3O08A 5GAEP 2RKIA 4DV1K 4JI3K 4MDBA 4CF9A 4NYNA 3DAWA 3WXJA 5HRPA 4C8LA 2P9UB 3P5JA 3L0QA 2HNYA 1GOAA 4E1JA 2RHKA 4N56A 3WT0A 1K9MO 4OO1J 4CJ3A 1VQMN 2CGKA 2QEXN 3C6TA 1T8EA 3GOIA 3OYFA 1W9HA 2Z1HA 3D7EO 3SPYA 3SUNA 3FFIA 2RE2A 1J5EK 4OGCA 4BDYA 4IG0A 5AZJB 3CM5A 4JI2K 3EZ5A 4DKWA 3FZKA 5M1PA 1NM1A 3NH0A 1YTUA 4CZMA 3WXIA 4NLBA 1SL0A 3NMUA 1T6CA 2XO7A 4FJHA 3TSUA 3ZT1A 4FWNA 4DTJA 4W5OA 1YUWA 3HK2A 4LFBK 5GIOA 2FSKA 2OCEA 1NBWA 4MDAA 4PKIA 1G99A 4KH6A 3T1AA 4DTUA 1MU2A 1YVUA 2HBJA 3L6QA 4H5VA 1HPZA 5KGXA 2KTQA 5JVGL 1EO1A 2ASOA 3JS6A 1KAYA 4DR6K 3VESA 4AHTA 3CM6A 4LC9B 2QW9A 4DV0K 1WSIA 3ZSZA 4A61A 3LANA 5TKWA 4QOZB 1BU6O 2WONA 5AQHA 3VEXA 3VOVA 4CZLA 2UUCK 1L5UA 4LY7A 4CHYA 3CQ8A 4M3ZA 5AQSA 1S1XA 1YXQA 3QO9A 3SMSA 3M8PA 2O8CB 4CJQA 1Y97A 2G8KA 1UA0A 2UUBK 4CK2A 3L2QA 5HL7L 2FF6A 4FZZA 3ZX3A 4B9NA 4Q0BA 2QM1A 3MDQA 2NRVA 4CGDA 3V4IA 1XI1A 1QSSA 5C2FA 4WFBL 5KTQA 2P51A 3T1HK 5DK5A 4B9SA 1OVYA 1C0GA 3LP1A 4B3OA 3AVHA 2F9WA 2IDOA 3L2WA 3AA5X 4CF8A 4CCHA 1MWKA 4PA1A 5EY4A 3SBTA 4ICLA 2DFEA 5BR9A 5GADP 5AQFA 1NJZA 2P9LA 1QE1A 4E0DA 4XEIA 5MLCQ 3ZT2A 1IKWA 3HZ6A 3NGYA 3OYAA 1HUXA 3VEWA 4FK2A 4JI0K 4C23A 4IJAA 4H0TB 3KKSA 3R3LA 5CYQA 3KD5E 1EP4A 5CZ1A 4DV3K 1BIUA 3M8RA 3CYMA 1X9MA 3QMLA 5AQWA 1HRHA 4DQ8A 4FLXA 4JKDA 3EE9A 4DUYK 2HMIA 3T3FA 3LDSA 2W41A 4M3WA 5BRFA 3M5RA 4IFEA 3CETA 3QB0A 4DTPA 4WCEL 3N4PA 4M45A 2G8VA 5JICA 2A3ZA 4A62A 3HYFA 4CJTA 4B1UB 4IXCA 4CW7B 3C94A 1XC9A 2PY5A 3SQ4A 2O8DB 3UKUB 3C95A 3VENA 4IOXA 1KVAA 1SL2A 2FF3B 3E9LA 5ADXA 3TARA 4LD0A 1GLAG 4YOTA 4FJLA 1NGIA 2KW4A 3ZETB 1FKPA 2A6AA 4CZGA 2ZJPL 3CMEN 2QI2A 4I6MA 4BRHA 4OPHA 2YHBA 2WTUA 4CZJA 3AA4A 4BDZA 3WNGA 2V51B 5AQJA 3QESA 4DWIA 3ATVA 2P9SB 4B9VA 2G8FA 4B1ZA 2D0BA 1KQSM 1KSPA 4KHSA 2QWOA 2EWSA 2NUBA 2PYLA 3Q7CA 3SBGA 2Q36A 4BR0A 1JCFA 4JAXA 5AFUH 2A5XA 3OYDA 4JKGA 5IT9O 2UUAK 2ATQA 2VGNA 4LSLA 2YNHA 3E66A 3TTDA 3VEVA 5C42A 4ELVA 1WSGA 4IO8A 4GNIA 5KGWA 5BN9A 4CF1A 4DF4A 4O55A 5AZIA 4BE1A 3THWB 1HJOA 2W6KA 3J81O 1CZ9A 4K8ZA 3E9OA 4BC3A 1U2VB 3PIPL 3QIOA 4NB4A 1D5AA 1RT4A 4FW1A 4DF8A 2O8BA 3KK1A 2NLXA 3E1YA 1Z05A 3OYCA 1S72N 5EX5A 2IS3A 4AM6A 4DQRA 4F2RA 3GBTA 4E7HA 3PSIA 5M1OA 3JYTA 1D8YA 5K14A 3D2EA 2HHVA 1LAWA 3NF8A 5HRSA 5BREA 3I0RA 4FW2A 3QLHA 1JLBA 2P1JA 1H1VA 5AQOA 2P9UA 1RT5A 3QEIA 4RW4A 2IVOA 3A8YA 1QVGM 1RTJA 5M1KA 4FCYA 3AY9A 4Z4FA 4ID1A 4F3OA 5DM7L 1IBKK 5AQIA 4IWVA 1HNIA 3C65A 4M41A 2YI1A 2YNGA 1V4SA 3BZKA 3AO5A 4H0VB 3H3OB 4YDUA 5AZJA 4BRIA 4CD1A 4GVEA 2BE2A 1P8ZA 2BDPA 3MCPA 3NHGA 1QHAA 4Z0UA 1IKYA 4JKHA 3SQ0A 4BRCA 5FRMA 4V19S 4KHUA 3MXJA 4DQSA 4BC2A 2ZQBA 3EZWA 4M63C 3LWMA 3VQEA 3LDLA 1VQKN 3PV8A 3PX0A 2OYQA 1RTHA 4J2DA 1BO5O 1NJYA 4Z4HA 1WSHA 3IS9A 5HRNA 4J8FA 5DM6L 4FJXA 3PLAA 5JLFA 3VF2A 1EQYA 3H46O 3P39A 1VQON 2YKNA 3CPWM 4A2AA 4A5BA 3S3OA 1I3AA 2ZGYA 4IDHA 2FXUA 3LDOA 4B8AB 3CQXA 3SAGA 4U67L 3HI0A 2FC0A 3NH1A 1ZC6A 4Q5VA 3ZX2A 3CCRN 4CJ7A 1IKXA 3DOKA 1WUAA 3QBXA 4IJNA 4Z4IA 1VSDA 3JAMO 1NK4A 1X9WA 4YOVA 3SAFA 2CGJA 2O8CA 1VQ5N 1QQNA 2PFUA 3CCUN 1XQSC 3LAKA 4DS4A 1KRPA 3CCMN 1NGEA 3KKRA 3S3NA 4AILC 1QTMA 3B6OA 3L3UA 3HPHA 4FVMA 2W6LA 3SCXA 4JS4A 2IVNA 3WUHA 4EZ6A 2QWQA 1XMQK 5BPNA 3SMPA 1Z6RA 3VF4A 4W5RA 4F8RA 3KZBA 5CHIA 4FYDA 2XY7A 5KPRA 2AA4A 1VQ4N 1BUPA 1T3VA 1ZBIA 3NF6A 3ZSOA 3DLGA 1JLCA 4E89A 2HMPA 2P9LB 2H3GX 1GLBG 2YCHA 2KZMA 1NGJA 3HVRA 3HSTB 4RW7A 3QEVA 2P5GA 4FLYA 4KTZA 2A41A 3IMXA 4WQ5C 4GMJB 4FJKA 3K9JA 5BN8A 1CZBA 3TR8A 4XH1A 3VN5A 5JMVA 1VQ7N 4DR3K 3RMBA 3TAGA 3P38A 3P1GA 3V9UA 3A2FA 3VETA 3J8AA 3OVNA 3NAEA 3K5LA 3OYJA 3SUOA 1L3SA 2OPPA 3TAEA 4B1VA 4KBOA 3ZT3A 3TSQA 3CCEN 4AF1A 1FKOA 1ASUA 5KPZA 4GY2B 2HBKA 1EKEA 2YNFA 3LL3A 3QFPA 4H5RA 4FWQA 4IBNA 2ZWHA 4DTOA 3AVKA 3CJAA 3WQTA 3CF5L 5E41A 3LPTA 4BQLA 2JGUA 2E88A 2P9PB 2NRHA 4E1NA 1N34K 5J2PA 3VGKA 1VQPN 4M3TA 2QWRA 2VWKA 3H1QA 4HUGA 3J7YP 4FXDA 4BR4A 3OJUA 4CJ5A 3AO1A 4CBUA 1VAZA 2DFFA 4JKEA 5C2DA 4O8KA 2F8TA 2IGIA 4HUEA 2B4JA 3TAQA 1KAXA 2FLOA 3CPEA 1HQEA 1TAUA 4I6MB 3U3YA 1CLQA 3U3GA 1BDGA 1NGCA 3ALYA 4WQ4C 5GAHP 4IEEA 4DSKA 1EXQA 4B1XB 4KTWA 1OH7A 3ENOA 1BIZA 3DLBA 3D45A 2QA4N 2RPIA 2Q1NA 4HTLA 2BGGA 3H1VX 2P9SA 3KLEA 1NWKA 1ITGA 2J4RA 2OPSA 1W7AA 4L8RB 3THVA 1TKDA 4NXMK 3CC7N 4JKGB 5AQNA 2HBLA 4DTXA 2HHWA 3W0LA 4I2QA 1RGIA 3HBTA 4CE9A 2GUPA 2AJQA 2PAVA 3BP8A 4K43A 4EFHA 3K59A 4FOEA 4DV4K 4KTQA 5AZIB 3A5OC 3OYIA 3R1XA 3ID8A 1Q9XA 3T69A 3PSFA 4CGHA 4FJ9A 3J7ZO 3CC2N 4NCAA 3IUCA 1T44A 1HYVA 2UXBK 1U2VA 1YVNA 4NXNK 5AJ3K 4CFAA 4FM0A 1IH7A 4QS7A 3CQYA 4Z4CA 2G8HA 4FJGA 3D2EB 3L2VA 3PO4A 5F2RA 1BCOA 3UIQA 1HLUA 3AVMA 3IRXA 3LM9A 3M8QA 1GLLO 3LALA 1ZBHA 4FPBA 3CHWA 3TPQA 4IOAL 1TAQA 4MQ3A 5EU7A 2NRRA 1VSLA 5AQUA 4XIUA 3KK2A 2D5RA 1HMVA 2VQEK 4CGJA 5LMNK 4KREA 3AA2A 2DY4A 1T03A 4MO4A 2O8EA 4X65K 1KC8O 3ITHA 2P9IB 1C0MA 5FROA 1J54A 2KQ2A 2XRIA 1TL3A 4BGAA 2Z1JA 3HXMA 1S22A 3O9UA 3O9RA 4ISEA 2E2QA 4H0OA 5LJWA 1HNVA 4IO9L 4DQQA 3IKMA 5C12A 4PQUA 3C7NB 3CI5A 1BISA 4YORA 3VQAA 4DSFA 3FR0A 1ZBFA 3EY1A 2GV9A 3R9PA 2I7PA 1UWBA 3S3MA 1ESVA 2O4GA 4RTFD 4C8KA 4KB1A 1C1CA 3VQBA 5SZTA 1NMNA 2E2NA 4FJMA 1RILA 4FZYA 3Q7BA 1K8AO 4Y1DA 3ATUA 4B3SK 2A1SA 2YHYA 4CHZA 1O13A 4LF5K 3DLKA 3DLRA 3O9QA 3BDPA 4KHYA 4OPKA 3IFRA 3ULEB 3AVLA 4EAHD 1NK9A 4FWSA 1XC3A 1SZ2A 4FJJA 2X6NA 3O4QA 3H6EA 3K57A 1RDCA 1FJGK 1WB9A 2FBYA 1HNZK 4JK8A 2KZZA 1GLEG 3J80O 1YAGA 3PO5A 1LWEA 2E1ZA 1VRTA 2Z1IA 1MWMA 4CIGA 4EHTA 3RMCA 3MMVA 5KI6A 4BRLA 3QEWA 3ZCMA 2G8IA 1Q9YA 1QQOA 1VQ9N 4JI6K 4DCHA 3L8BA 1N6QA 3WNHA 1DGKN 3MCAB 4E1MA 4JK9A 3O4NA 3I33A 3HJFA 4LFCK 4W5QA 2HF4A 3M8SA 4Z4EA 4EZ9A 3QBWA 4Y0WA 2ITGA 1S9EA 1S1VA 3C6AA 5FDLA 4CFDA 2P9NB 1Y64A 3S9HA 5GINA 1K73O 1JXEA 4BQZA 5TKYA 1NK0A 3T7ZA 2KHOA 3QETA 4CEQA 3CXCM 1IJJA 1HJRA 4M3YA 2A40A 3MX2A 4DTRA 2XY6A 4B3MK 2HVHA 4O0JA 4TSXA 4BY9C 5LJVA 3MAQA 4DQIA 4NLCA 4BRDA 1EWQA 5B8HA 3MWTA 4HWIA 4JD2B 3G4SN 3L4IA 1SQKA 1TUUA 3QFUA 3CCLN 4NYFA 4LF6K 3FGUA 1WSEA 1X9JA 2HB5A 3DXKA 1RNHA 5BPMA 3ENHA 2W40A 2HHSA 2E4LA 1CXQA 4CD3A 3I56N 2OZSA 4JV5K 3OYMA 3MWPA 2QWPA 4CFBA 2ZD1A 3QIPA 5GAGP 2P9PA 1MA9B 3TANA 3RWUA 2KFNA 4JK7A 4K41A 5HRRA 4BREA 3CERA 1NJXA 2HNDA 1A5WA 4BRGA 3ZEUB 1CZAN 4HCBA 3L2UA 1IV0A 2V7ZA 1Q7YO 4JKFA 1WBDA 1OVQA 4J2AA 4N76A 3O8MA 3EE8A 4BACA 3ZLJA 1LOTB 4DU1A 2NRWA 3OYHA 4CERA 1QS4A 5LL6Z 3F5TA 3OYKA 1ATNA 4IFVA 2ETJA 4I9LA 2OTLN 2VGMA 4U7BA 3NE6A 1VQLN 3IG1A 4CECA 2VYPA 3I8BA 4J2BA 3HM9A 3MXMA 4CF0A 3AAQA 1NGBA 4E19A 4B9MA 3O9TA 1OH8A 3HPOA 3BGRA 2Z1GA 1C0TA 3TSPA 3BEXA 2VWJA 4KAZA 3TI0A 5AR0A 3U9DA 4OKKA 4QS8A 2Q2RA 5KRTA 4YHHK 4NCBA 3WQUA 1OKJA 1XNQK 1XMOK 3MEGA 3VQ7A 1JLQA 2I5JA 2RN2A 4UQGA 4LH4A 5E84A 3MN5A 2HHTA 2NRXA 5AQRA 4EIAA 4A2BA 4AHSA 3SJHA 1TK8A 3KTQA 2P9KA 3LAMA 1NMDA 3VQ6A 3KLGA 2XY8A 4CJWA 3EO3A 3EKUA 1RTDA 2E6MA 1JLFA 1YIJN 4ILJA 3WEEA 3ZSXA 1O1WA 1JJ2M 2D4WA 3HO1A 5AQKA 3OYNA 3MN9A 1T05A 1FXXA 4JI1K 2CH6A 4BR2A 4BRNA 4UY8O 1ZBUA 4JYAK 3AVCA 3L2RA 4LFAK 5A2QO 1BQMA 1IBLK 2B6AA 3K2PA 5I3UA 4DFKA 4ZTJA 4MLEA 3VEZA 1C1AA 4KI6A 2O8EB 4AHRA 1Q86O 4OKEA 4CJFA 4M3UA 4CZHA 1NGHA 4O0IA 1NKBA 1D9FA 2P9IA 3CCQN 4KRFA 5BRDA 2E2PA 4JKCA 3SYZA 2B5JA 5J2NA 1S1UA 3DOLA 4IDKA 5AQVA 4H03B 4HUFA 2E5LK 3C7NA 1M90O 1DT9A 3KLIA 2HHUA 3CG7A 4DG1A 2ITMA 4YOUA 4CESA 1RDBA 3OS0A 5KQDA 1Z26A 4CEOA 2O8FA 4NO7A 1NGFA 3FE1A 1L3TA 3CJ9A 1I94K 4FSVA 1YJWN 4DR1K 3UKRA 3SI6A 1ASVA 3M3ZA 4PKGA 5I42A 3EKSA 1NNEA 4DFPA 4DHYA 4QS9A 2X6SA 1KTQA 4LSNA 1KVCA 3AARA 1NK8A 1WLJA 3V81A 4CHQA 1NJIO 5AQTA 4ILHA 4YDUC 1S3XA 1JXBA 4DSIA 4JEPA 3OTOK 1A5VA 1W97L 3ULEA 3BZCA 4HHTA 2V52B 3L3VA 5M1FA 2OPQA 1KXPA 3S41A 3HT3A 1VHXA 2QWMA 4RW6A 4CBXA 1WAFA 3LM2A 3DLLL 5CE3A 2HNZA 1IKVA 4FLWA 3I8DA 3TWHA 1BA0A 1GOBA 3G0ZA 5ELZA 3VQ5A 4BRQA 4CIFA 4FM1A 4ISFA 4FWMA 3NVMA 1YITN 3FZHA 1HKCA 3ZSQA 1DTTA 3AA3A 3CFOA 3HP9A 4RW8A 3U8XA 5HLFA 4ZTFA 1JCGA 1D9DA 2YX6A 4FJ5A 4CGFA 3P4IA 3LP3A 2FBXA 3P31A 4G1QA 2CH5A 4M7YA 4BG9A 4MFBA 1F21A 3AVIA 1W0HA 3AO4A 4B9QA 4M3XA 5EVZA 3AVJA 4AM7A 4YNQA 1J5OA 2P9NA 4PWDA 4AHCA 4DQPA 3SNNA 2VG5A 4N5SA 3NBPA 4CK3A 3MK6A 1EX4A 5LMUK 1KLMA 2LSNA 4JI4K 3G71N 3H45C 4NCGA 4PUOA 3VPZA 3LWLA 2AP1A 4QAGA 2Q0UA 4BGBA 1I39A 5CY4A 1TVRA 1HKGA 3CCSN 4YOXA 3PIOL 2E20A 2BH1A 3LZIA 2F8SA 1Q8IA 2FBVA 3ZT0A 5AQGA 3OYBA 3V6DA 1NG9A 4MO5A 3CMAN 4JD2A 3O5BA 4MLHA 2WC9A 1XUPO 3SUQA 1RFQA 1TGOA 4B3TK 3DXKB 4FM2A 2IC3A 1TK5A 3CC4N 3VTIA 3OA9A 2NRTA 2UU9K 3V9WA 2I7NA 1ZYQA 3J7AP 4EHUA 3JXUA 3QEXA 5AFUA 4PY5A 1ATRA 5AQXA 1VSIA 3ZT4A 1NLVA 2EX3A 1S6PA 3CJ1A 1RDDA 4IZ9A 3VQ8A 1HQUA 3ZEUA 2HW3A 1VSEA 2BANA 4N41A 5KQ8A 3JSMA 4CJVA 1KD1O 4FVUA 5AQMA 4BC4A 3ENBA 3WXMB 2F7TA 3M6GA 5JVHL 2ASMA 5C24A 3SQ1A 1LWCA 1TL1A 1RDWX 2D0OA 4BR7A 1RTIA 2X78A 2JLEA 4K0KK 2O4IA 1JCEA 3KK7A 3SZ2A 2F9TA 1HYSA 4HVJA 3OS1A 4CVNE 2HHXA 5JS2A 1D4XA 4ELTA 3DXMB 1BGXT 4RG8A 1B92A 5C15A 4KV8A 1KVBA 3CCJN 2ZM6K 3MEEA 4C1NK 3VQ4A 1BA1A 4B8CA 3VGLA 2QTDA 3VTHA 1TYQB 4BVOA 2OTJN 4BC5A 4ZHRA 3SUPA 1J53A 3O4WA 4CEEA 4B3RK 3D2FB 5BR8K 3IDHA 4F3TA 1K8KA 2QXLA 4JI5K 3KWGA 2A42A 3RSEA 5KPTA 4E7IA 1NOYA 1WN7A 1BI4A 3LP0A 1R0AA 1NJWA 3NVKA 4YY3K 2YJEA 3G10A 1KAZA 4KFBA 4CJSA 1WNSA 3I0SA 3VEOA 5LY3A 1QSLA 4KI4A 1REVA 1TKZA 4OX9K 2P9KB 3VQ9A 1BCMA 2QKKA 3SQ2A 4CJRA 4DU4A 1TK0A 4BWJA 4FWOA 3F9MA 3UE5A 3WEEB 2D0PA 1EETA 3VA3A 4FLZA 5ADXH 3KLHA 3KWIA 2R7YA 1UAXA 4K42A 4FWLA 3AGRA 4JHDB 3QNNA 4YOWA 1ATSA 4CBWA 5M1NA 3RR8A 3HSCA 3C0BA 4XH5A 4CGIA 2NNWA 2VG6A 3THXB 4B1YB 1TKTA 5J2QA 4DR5K 4X66K 3DRPA 4IFYA 3W3DA 4WFAL 3RMAA 4C8OA 4FWKA 5AQQA 1VQ6N 1C6VA 3CIPA 3FLCO 3NGIA 3LDPA 4CHOA 1E3MA 1Z25A 3AO3A 1NKCA 4BR9A 1CXUA 3O3FA 4DLGA 1IO2A 4I7FA 5SWMA 4ILGB 4BG8A 2Q31A 2GBZA 3OY9A 4B9TA 4FK0A 3MECA 1SUQA 1HPMA 1WSFA 1SKRA 3E01A 3NCIA 1YJ9N 3KHYA 4A59A 1EWRA 4JI8K 2GWJA 2UYTA 2YJFA 2G8UA 1NGGA 3ULDA 2O8FB 5HBMA 2WBNA 1X3NA 4CHPA 2GUIA 3VERA 3R6MA 2HF3A 4LH5A 4H4OA 4WF9L 3PUFA 1XWLA 3F2KA 3UKRB 3AVNA 4AQYK 4QCLA 3P83D 3SV3A 3VGMA 3FFKB 3F73A 4CJLA 4F4KA 3O9SA 4CGGA 3WNEA 1T6DA 4PKHA 2NRZA 3I55N 1C0UA 3V9ZA 2ZE2A 1SL1A 1T7PA 1S6QA 2ZF5O 4WFNL 4JN4A 5CZ2A 2HBMA 3QERA 4DFMA 4A57A 5FPDA 1VSKA 1YF5L 4E7LA 3RMDA 1BL3A 1DKGD 1RT6A 2JWKA 3KD1E 4CF2A 2ASPA 3L4QA 4OLAA 1QZ5A 3AAPA 3F9KA 1SV5A 4RW9A 1WAJA 5AQPA 1SKSA 3V9SA 2Q97A 3THYA 4LF7K 1C1BA 1HR0K 5I9EB 4CJEA 4CEZA 4CEBA 4IOCL 3H3NO 4B08A 5BPLA 2A1RA 1N33K 3VQDA 2IOCA 4IKFA 1SS6A 2GEMA 4EP4A 3V9XA 4GVMA 1HNWK 3ZX0A 3G6EN 1QVFM 1GLDG 3AVFA 1RBRA 2GX9A 4DFJA 4H4MA 3OW2M 1VK0A 4BR5A 4PL8A 1XNRK 2ZJQL 4OPJA 3DLHA 3VA0A 4K8XA 2UXDK 3TTFA 5JS1A 4AHUA 2HHHK 5GIPA 4J2EA 3WXLA 4F9OA 4DMNA 1QQMA 3EEQA 2JWLA 4BE2A 1NK6A 4FLVA 1ILYA 4FWRA 2XHBA 4WE1A 1HYZA 3AVAA 4HCCA 4KPYA 3LPUA 3CCVN 4DLEA 4KHPK 4KKOA 3ZSYA 1OH6A 3GDQA 3BF3A 4B9UA 1QZ6A 3SJJA 2D0CA 3D0PA 1B9DA 4G9ZA 3OYGA 4BWMA 4IEIA 2IAJA 4KHWA 4FJNA 4RWTA 1Q81O 3AV9A 4Y1CA 4JKBA 3DMJA 3TU5A 1X3MA 3TAMA 2KLAA 1V4TA 4KH5A 2PZSA 1HX1A 1LAVA 5F0XA 4CJUA 1WSJA 3RRGA 4BRKA 3V1QA 2W42A 4M7XA 1RT1A 2OPRA 3SLCA 1E4GT 3DJCA 2ZJRL 3O3GA 1U48A 3DRRA 3ZSVA 1NKEA 1TKXA 5T7BA 4DS5A 1E4FT 4R79A 3CJBA 1DTQA 4FZXC 4KHNA 3NDKA 1XHXA 1RBSA 4Z94A 4BRPA 4YFUA 4OJRA 4GW6A 4KHQA 2YNIA 1ZBLA 4BRFA 5EOYA 1WBBA 1U45A 2GELA 5C0YA 3MN6A 1G15A 3EL2A 1QHTA 1VRUA 4CEFA 1KFSA 5IWAK 2HOEA 3HPGA 4H0YB 3OS2A 4BRMA 2BTFA 4O4GA 1W2BM 4CZFA 3DYAA 5M1QA 1FW6A 4DSLA 4K25A 3LP2A 1BHLA 3VMFB 1RCHA 1YTAA 1BOTO 3DXMA 3RRHA 1LW2A 2RF2A 2X74A 2Q3SA 3QNOA 4BRAA 4LF8K 1JLEA 1ASWA 4BROA 4DSJA 3EN9A 4E7KA 1N32K 4CJ4A 1TYQA 2VQFK 1LV5A 1QSYA 4GV3A 1DEJA 1K8KB 1LW0A 3AGKA 3D2FA 4DV6K 4GV6A 3RSEB 4A5AA 1U4BA 3HM8A 4W5NA 4GKJK 1BI4B 1YHQN 3OYLA 4BDPA 4M42A 3U9ZA 3ZSWA 1U47A 4FLTA 3TABA 2WFBA 3VQPA 4H5WA 3WNFA 1NK5A 3SPZA 5CYMA 1JKHA 1LWFA 1QQCA 2E6LA 1BG3A 5EXWA 3O6WA 4CJPA 4DV7K 4JRQA 3K58A 3NF9A 3PX4A 2OA8A 4OKJA 1LCUA 5C25A 3NGZA 2D1KA 5HROA 4KB0A 4DUZK 3D6RA 2ZGZA 1XHZA 3DM2A 4R5PA 2FBTA 4WYBA
chains in the Genus database with same CATH topology
4NXNK 4AQYK 4B3RK 5AJ3K 3J80O 5BR8K 4DR4K 4DV5K 4JI5K 5LL6Z 5LMUK 4JI4K 4YY3K 4JI6K 2E5LK 1J5EK 5IT9O 2UUAK 4JI2K 3T1YK 4OX9K 4LFCK 4JI0K 1N34K 4LF4K 4X62K 3J7YP 4DV3K 2VQEK 4DR2K 5LMNK 2F4VK 3J81O 4GKKK 1I94K 3JAMO 5IWAK 4DUYK 4X65K 4LF7K 4LFBK 4DR1K 1HR0K 4B3TK 4DR7K 4YHHK 4JI7K 1N33K 4LF9K 2UU9K 1XNQK 1XMOK 3J7AP 1HNWK 3OTOK 4DR5K 4X66K 4DR6K 4LF8K 2UXCK 4DV0K 4CW7B 1XMQK 1N32K 1N36K 4B3MK 4DV2K 2VQFK 1XNRK 1HNXK 2UXDK 2UUCK 4DV6K 5FLXO 2HHHK 4GKJK 4NXMK 1IBKK 4JI1K 4LF6K 4K0KK 4JYAK 2UUBK 4B3SK 4LF5K 4CVNE 4LFAK 5A2QO 4JI8K 1IBMK 4JV5K 4KHPK 4DV1K 4X64K 4DV4K 4DV7K 1IBLK 4JI3K 2ZM6K 4DUZK 3T1HK 4DR3K 4V19S 1FJGK 1HNZK 2UXBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN K;  4AQY K;  4B3R K;  5AJ3 K;  3J80 O;  5BR8 K;  4DR4 K;  4DV5 K;  4JI5 K;  5LL6 Z;  5LMU K;  4JI4 K;  4YY3 K;  4JI6 K;  2E5L K;  1J5E K;  5IT9 O;  2UUA K;  4JI2 K;  3T1Y K;  4OX9 K;  4LFC K;  4JI0 K;  1N34 K;  4LF4 K;  4X62 K;  3J7Y P;  4DV3 K;  2VQE K;  4DR2 K;  5LMN K;  2F4V K;  3J81 O;  4GKK K;  1I94 K;  3JAM O;  5IWA K;  4DUY K;  4X65 K;  4LF7 K;  4LFB K;  4DR1 K;  1HR0 K;  4B3T K;  4DR7 K;  4YHH K;  4JI7 K;  1N33 K;  4LF9 K;  2UU9 K;  1XNQ K;  1XMO K;  3J7A P;  1HNW K;  3OTO K;  4DR5 K;  4X66 K;  4DR6 K;  4LF8 K;  2UXC K;  4DV0 K;  4CW7 B;  1XMQ K;  1N32 K;  1N36 K;  4B3M K;  4DV2 K;  2VQF K;  1XNR K;  1HNX K;  2UXD K;  2UUC K;  4DV6 K;  5FLX O;  2HHH K;  4GKJ K;  4NXM K;  1IBK K;  4JI1 K;  4LF6 K;  4K0K K;  4JYA K;  2UUB K;  4B3S K;  4LF5 K;  4CVN E;  4LFA K;  5A2Q O;  4JI8 K;  1IBM K;  4JV5 K;  4KHP K;  4DV1 K;  4X64 K;  4DV4 K;  4DV7 K;  1IBL K;  4JI3 K;  2ZM6 K;  4DUZ K;  3T1H K;  4DR3 K;  4V19 S;  1FJG K;  1HNZ K;  2UXB K; 
#chains in the Genus database with same CATH topology
 3EYZ A;  1MDU B;  3MED A;  4C8N A;  3K5N A;  2OZM A;  4JHD A;  4N47 A;  4DR4 K;  3K5M A;  4B9L A;  1X9S A;  4BVP A;  3BY5 A;  2WUS A;  1JLG A;  2WOM A;  3M1F A;  4IG3 A;  2QWN A;  2DPN A;  3UB5 A;  1TV6 A;  3KIO A;  3THX A;  3DLE A;  5AQY A;  2OAN A;  3CJ7 A;  1JL1 A;  2QXF A;  3T1Y K;  2Y1J A;  4E7J A;  1P90 A;  3BF1 A;  2YHW A;  3A5M C;  3AO2 A;  4H8K A;  3QIC A;  4X62 K;  3O1W A;  3H08 A;  1M1K O;  4DR2 K;  4FJ7 A;  3C6H A;  1UA1 A;  3ASM A;  5D3G A;  4GKK K;  1S1T A;  5F1X A;  2YKM A;  4AH9 A;  5FPE A;  1RT7 A;  3MX5 A;  3G25 A;  1J6Z A;  1N8R O;  4ELU A;  1X1P A;  1NGA A;  3MN7 A;  2E1Y A;  4LF9 K;  1U04 A;  3OBY A;  3C6U A;  1UOC A;  2PBD A;  5J1E A;  3R8E A;  3FZF A;  2YHA A;  2UXC K;  1NOZ A;  1BQN A;  3VQC A;  4JRP A;  4CHN A;  2VCP A;  4CJK A;  3U6F A;  3V1O A;  1SKW A;  2GTD A;  3KLF A;  2HHQ A;  3T19 A;  1GLJ O;  1NGD A;  1HNX K;  1YT3 A;  4ID5 A;  3QIN A;  1Q82 O;  1BWF O;  3O1B A;  3QDK A;  3LZJ A;  2KFZ A;  4FL9 A;  4M3R A;  4FJI A;  2DFH A;  1IG8 A;  4O44 A;  3SAH A;  1B9F A;  3SV4 A;  1IBM K;  1DLO A;  3QEP A;  1TUY A;  4DB3 A;  4OGE A;  3IAY A;  4CED A;  2YV0 X;  2KKZ A;  2PYJ A;  1RBT A;  4AHV A;  4PHT X;  1RDU A;  4O5F A;  3ISN C;  3FZM A;  3TAP A;  4JLH A;  1GLC G;  3THY B;  3TAF A;  3O80 A;  1YI2 N;  3AVB A;  5J2M A;  1GLF O;  3RR7 A;  2E2O A;  3OHR A;  1ZXO A;  3HRG A;  4KH4 A;  5FRN A;  4HTU A;  4OLB A;  4C1N I;  5E26 A;  4DU3 A;  1JLA A;  4ISG A;  1VSM A;  1L3U A;  3SK3 A;  2Y1I A;  1KLN A;  1KFD A;  3U4L A;  4CZE A;  4FOI A;  4WQ5 A;  3KK3 A;  2IIR A;  4B1W B;  1KCF A;  3B8A X;  4LF4 K;  2F96 A;  2GWK A;  3CJC A;  2FSJ A;  3DI6 A;  3N4Q A;  4CI6 A;  2V7Y A;  3OBW A;  1L3V A;  3GL1 A;  3HL8 A;  1N5Y A;  1S1W A;  4DR7 K;  4FO0 A;  3TTC A;  2HST A;  1RBV A;  3V1R A;  4C8M A;  5DMR A;  2D0A A;  2IVP A;  3FZL A;  2DTU A;  1K6Y A;  3CFR A;  4F2S A;  2YHX A;  4XH4 A;  3B6P A;  1N36 K;  1VSJ A;  3A5L C;  1C0F A;  2BUP A;  5FLX O;  4JKA A;  3HOS A;  2FSN A;  1YJN N;  4H0P A;  4O8U A;  3NH2 A;  1HKB A;  2EHG A;  3KVG A;  4CZK A;  4EP5 A;  5CR4 A;  2NZT A;  1NU0 A;  4WQ4 A;  1J9A A;  4CEA A;  5C10 A;  1JL2 A;  4X64 K;  4YOY A;  3VEY A;  5AQL A;  2CGL A;  1VSH A;  1VQN N;  2VG7 A;  1RT3 A;  1ZBS A;  4FPA A;  1VSF A;  3A0I X;  3PX6 A;  2O8D A;  3UKU A;  4CFC A;  3CD6 N;  3VQQ A;  1S9G A;  1OH5 A;  4DV5 K;  5FPN A;  2P5O A;  1RDA A;  5KRS A;  1GOC A;  4CIE A;  3BUZ B;  3ZSR A;  4FLU A;  2E8A A;  2HVI A;  3ZET A;  3MXI A;  3OYE A;  3PY8 A;  4H0X B;  1R59 O;  2VWB A;  3HTV A;  4E3S A;  1WOQ A;  4DTM A;  4W5T A;  3OJS A;  3GE1 A;  4DTS A;  3LDN A;  2G8W A;  2Q0R A;  4H5T A;  3DWL A;  4OPA A;  2F4V K;  2QK9 A;  1RT2 A;  3NFA A;  4BE0 A;  4RCH A;  3CFP A;  4I9Q A;  1RBU A;  1U49 A;  5HP1 A;  3ZYY X;  2QKB A;  4JNE A;  3HVT A;  4L3Q A;  4KO0 A;  3WXK A;  3DRS A;  1S5J A;  1Q18 A;  4JI7 K;  4DTN A;  3LDQ A;  4CZI A;  5HOO A;  1U6Z A;  1FK9 A;  4PL7 A;  1IG9 A;  5FPM A;  4I2P A;  3A5N C;  3GG4 A;  4O5B A;  1NK7 A;  1VQ8 N;  4FK4 A;  2XY5 A;  3K5O A;  4DSE A;  4OVL A;  4FJ8 A;  5BRH A;  3K9K A;  4FWP A;  3NF7 A;  3K0S A;  3AVG A;  4DV2 K;  3E9P A;  3HOT A;  5H1S Q;  3THW A;  4GV9 A;  1A5X A;  4CK1 A;  3O3H A;  4JS5 A;  3HP6 A;  2O8B B;  3ID6 A;  4Z4G A;  3KJV A;  5AQZ A;  4H5N A;  3RVC A;  1SAZ A;  3VF6 A;  5JLH A;  3RTV A;  2QWL A;  3O08 A;  5GAE P;  2RKI A;  4DV1 K;  4JI3 K;  4MDB A;  4CF9 A;  4NYN A;  3DAW A;  3WXJ A;  5HRP A;  4C8L A;  2P9U B;  3P5J A;  3L0Q A;  2HNY A;  1GOA A;  4E1J A;  2RHK A;  4N56 A;  3WT0 A;  1K9M O;  4OO1 J;  4CJ3 A;  1VQM N;  2CGK A;  2QEX N;  3C6T A;  1T8E A;  3GOI A;  3OYF A;  1W9H A;  2Z1H A;  3D7E O;  3SPY A;  3SUN A;  3FFI A;  2RE2 A;  1J5E K;  4OGC A;  4BDY A;  4IG0 A;  5AZJ B;  3CM5 A;  4JI2 K;  3EZ5 A;  4DKW A;  3FZK A;  5M1P A;  1NM1 A;  3NH0 A;  1YTU A;  4CZM A;  3WXI A;  4NLB A;  1SL0 A;  3NMU A;  1T6C A;  2XO7 A;  4FJH A;  3TSU A;  3ZT1 A;  4FWN A;  4DTJ A;  4W5O A;  1YUW A;  3HK2 A;  4LFB K;  5GIO A;  2FSK A;  2OCE A;  1NBW A;  4MDA A;  4PKI A;  1G99 A;  4KH6 A;  3T1A A;  4DTU A;  1MU2 A;  1YVU A;  2HBJ A;  3L6Q A;  4H5V A;  1HPZ A;  5KGX A;  2KTQ A;  5JVG L;  1EO1 A;  2ASO A;  3JS6 A;  1KAY A;  4DR6 K;  3VES A;  4AHT A;  3CM6 A;  4LC9 B;  2QW9 A;  4DV0 K;  1WSI A;  3ZSZ A;  4A61 A;  3LAN A;  5TKW A;  4QOZ B;  1BU6 O;  2WON A;  5AQH A;  3VEX A;  3VOV A;  4CZL A;  2UUC K;  1L5U A;  4LY7 A;  4CHY A;  3CQ8 A;  4M3Z A;  5AQS A;  1S1X A;  1YXQ A;  3QO9 A;  3SMS A;  3M8P A;  2O8C B;  4CJQ A;  1Y97 A;  2G8K A;  1UA0 A;  2UUB K;  4CK2 A;  3L2Q A;  5HL7 L;  2FF6 A;  4FZZ A;  3ZX3 A;  4B9N A;  4Q0B A;  2QM1 A;  3MDQ A;  2NRV A;  4CGD A;  3V4I A;  1XI1 A;  1QSS A;  5C2F A;  4WFB L;  5KTQ A;  2P51 A;  3T1H K;  5DK5 A;  4B9S A;  1OVY A;  1C0G A;  3LP1 A;  4B3O A;  3AVH A;  2F9W A;  2IDO A;  3L2W A;  3AA5 X;  4CF8 A;  4CCH A;  1MWK A;  4PA1 A;  5EY4 A;  3SBT A;  4ICL A;  2DFE A;  5BR9 A;  5GAD P;  5AQF A;  1NJZ A;  2P9L A;  1QE1 A;  4E0D A;  4XEI A;  5MLC Q;  3ZT2 A;  1IKW A;  3HZ6 A;  3NGY A;  3OYA A;  1HUX A;  3VEW A;  4FK2 A;  4JI0 K;  4C23 A;  4IJA A;  4H0T B;  3KKS A;  3R3L A;  5CYQ A;  3KD5 E;  1EP4 A;  5CZ1 A;  4DV3 K;  1BIU A;  3M8R A;  3CYM A;  1X9M A;  3QML A;  5AQW A;  1HRH A;  4DQ8 A;  4FLX A;  4JKD A;  3EE9 A;  4DUY K;  2HMI A;  3T3F A;  3LDS A;  2W41 A;  4M3W A;  5BRF A;  3M5R A;  4IFE A;  3CET A;  3QB0 A;  4DTP A;  4WCE L;  3N4P A;  4M45 A;  2G8V A;  5JIC A;  2A3Z A;  4A62 A;  3HYF A;  4CJT A;  4B1U B;  4IXC A;  4CW7 B;  3C94 A;  1XC9 A;  2PY5 A;  3SQ4 A;  2O8D B;  3UKU B;  3C95 A;  3VEN A;  4IOX A;  1KVA A;  1SL2 A;  2FF3 B;  3E9L A;  5ADX A;  3TAR A;  4LD0 A;  1GLA G;  4YOT A;  4FJL A;  1NGI A;  2KW4 A;  3ZET B;  1FKP A;  2A6A A;  4CZG A;  2ZJP L;  3CME N;  2QI2 A;  4I6M A;  4BRH A;  4OPH A;  2YHB A;  2WTU A;  4CZJ A;  3AA4 A;  4BDZ A;  3WNG A;  2V51 B;  5AQJ A;  3QES A;  4DWI A;  3ATV A;  2P9S B;  4B9V A;  2G8F A;  4B1Z A;  2D0B A;  1KQS M;  1KSP A;  4KHS A;  2QWO A;  2EWS A;  2NUB A;  2PYL A;  3Q7C A;  3SBG A;  2Q36 A;  4BR0 A;  1JCF A;  4JAX A;  5AFU H;  2A5X A;  3OYD A;  4JKG A;  5IT9 O;  2UUA K;  2ATQ A;  2VGN A;  4LSL A;  2YNH A;  3E66 A;  3TTD A;  3VEV A;  5C42 A;  4ELV A;  1WSG A;  4IO8 A;  4GNI A;  5KGW A;  5BN9 A;  4CF1 A;  4DF4 A;  4O55 A;  5AZI A;  4BE1 A;  3THW B;  1HJO A;  2W6K A;  3J81 O;  1CZ9 A;  4K8Z A;  3E9O A;  4BC3 A;  1U2V B;  3PIP L;  3QIO A;  4NB4 A;  1D5A A;  1RT4 A;  4FW1 A;  4DF8 A;  2O8B A;  3KK1 A;  2NLX A;  3E1Y A;  1Z05 A;  3OYC A;  1S72 N;  5EX5 A;  2IS3 A;  4AM6 A;  4DQR A;  4F2R A;  3GBT A;  4E7H A;  3PSI A;  5M1O A;  3JYT A;  1D8Y A;  5K14 A;  3D2E A;  2HHV A;  1LAW A;  3NF8 A;  5HRS A;  5BRE A;  3I0R A;  4FW2 A;  3QLH A;  1JLB A;  2P1J A;  1H1V A;  5AQO A;  2P9U A;  1RT5 A;  3QEI A;  4RW4 A;  2IVO A;  3A8Y A;  1QVG M;  1RTJ A;  5M1K A;  4FCY A;  3AY9 A;  4Z4F A;  4ID1 A;  4F3O A;  5DM7 L;  1IBK K;  5AQI A;  4IWV A;  1HNI A;  3C65 A;  4M41 A;  2YI1 A;  2YNG A;  1V4S A;  3BZK A;  3AO5 A;  4H0V B;  3H3O B;  4YDU A;  5AZJ A;  4BRI A;  4CD1 A;  4GVE A;  2BE2 A;  1P8Z A;  2BDP A;  3MCP A;  3NHG A;  1QHA A;  4Z0U A;  1IKY A;  4JKH A;  3SQ0 A;  4BRC A;  5FRM A;  4V19 S;  4KHU A;  3MXJ A;  4DQS A;  4BC2 A;  2ZQB A;  3EZW A;  4M63 C;  3LWM A;  3VQE A;  3LDL A;  1VQK N;  3PV8 A;  3PX0 A;  2OYQ A;  1RTH A;  4J2D A;  1BO5 O;  1NJY A;  4Z4H A;  1WSH A;  3IS9 A;  5HRN A;  4J8F A;  5DM6 L;  4FJX A;  3PLA A;  5JLF A;  3VF2 A;  1EQY A;  3H46 O;  3P39 A;  1VQO N;  2YKN A;  3CPW M;  4A2A A;  4A5B A;  3S3O A;  1I3A A;  2ZGY A;  4IDH A;  2FXU A;  3LDO A;  4B8A B;  3CQX A;  3SAG A;  4U67 L;  3HI0 A;  2FC0 A;  3NH1 A;  1ZC6 A;  4Q5V A;  3ZX2 A;  3CCR N;  4CJ7 A;  1IKX A;  3DOK A;  1WUA A;  3QBX A;  4IJN A;  4Z4I A;  1VSD A;  3JAM O;  1NK4 A;  1X9W A;  4YOV A;  3SAF A;  2CGJ A;  2O8C A;  1VQ5 N;  1QQN A;  2PFU A;  3CCU N;  1XQS C;  3LAK A;  4DS4 A;  1KRP A;  3CCM N;  1NGE A;  3KKR A;  3S3N A;  4AIL C;  1QTM A;  3B6O A;  3L3U A;  3HPH A;  4FVM A;  2W6L A;  3SCX A;  4JS4 A;  2IVN A;  3WUH A;  4EZ6 A;  2QWQ A;  1XMQ K;  5BPN A;  3SMP A;  1Z6R A;  3VF4 A;  4W5R A;  4F8R A;  3KZB A;  5CHI A;  4FYD A;  2XY7 A;  5KPR A;  2AA4 A;  1VQ4 N;  1BUP A;  1T3V A;  1ZBI A;  3NF6 A;  3ZSO A;  3DLG A;  1JLC A;  4E89 A;  2HMP A;  2P9L B;  2H3G X;  1GLB G;  2YCH A;  2KZM A;  1NGJ A;  3HVR A;  3HST B;  4RW7 A;  3QEV A;  2P5G A;  4FLY A;  4KTZ A;  2A41 A;  3IMX A;  4WQ5 C;  4GMJ B;  4FJK A;  3K9J A;  5BN8 A;  1CZB A;  3TR8 A;  4XH1 A;  3VN5 A;  5JMV A;  1VQ7 N;  4DR3 K;  3RMB A;  3TAG A;  3P38 A;  3P1G A;  3V9U A;  3A2F A;  3VET A;  3J8A A;  3OVN A;  3NAE A;  3K5L A;  3OYJ A;  3SUO A;  1L3S A;  2OPP A;  3TAE A;  4B1V A;  4KBO A;  3ZT3 A;  3TSQ A;  3CCE N;  4AF1 A;  1FKO A;  1ASU A;  5KPZ A;  4GY2 B;  2HBK A;  1EKE A;  2YNF A;  3LL3 A;  3QFP A;  4H5R A;  4FWQ A;  4IBN A;  2ZWH A;  4DTO A;  3AVK A;  3CJA A;  3WQT A;  3CF5 L;  5E41 A;  3LPT A;  4BQL A;  2JGU A;  2E88 A;  2P9P B;  2NRH A;  4E1N A;  1N34 K;  5J2P A;  3VGK A;  1VQP N;  4M3T A;  2QWR A;  2VWK A;  3H1Q A;  4HUG A;  3J7Y P;  4FXD A;  4BR4 A;  3OJU A;  4CJ5 A;  3AO1 A;  4CBU A;  1VAZ A;  2DFF A;  4JKE A;  5C2D A;  4O8K A;  2F8T A;  2IGI A;  4HUE A;  2B4J A;  3TAQ A;  1KAX A;  2FLO A;  3CPE A;  1HQE A;  1TAU A;  4I6M B;  3U3Y A;  1CLQ A;  3U3G A;  1BDG A;  1NGC A;  3ALY A;  4WQ4 C;  5GAH P;  4IEE A;  4DSK A;  1EXQ A;  4B1X B;  4KTW A;  1OH7 A;  3ENO A;  1BIZ A;  3DLB A;  3D45 A;  2QA4 N;  2RPI A;  2Q1N A;  4HTL A;  2BGG A;  3H1V X;  2P9S A;  3KLE A;  1NWK A;  1ITG A;  2J4R A;  2OPS A;  1W7A A;  4L8R B;  3THV A;  1TKD A;  4NXM K;  3CC7 N;  4JKG B;  5AQN A;  2HBL A;  4DTX A;  2HHW A;  3W0L A;  4I2Q A;  1RGI A;  3HBT A;  4CE9 A;  2GUP A;  2AJQ A;  2PAV A;  3BP8 A;  4K43 A;  4EFH A;  3K59 A;  4FOE A;  4DV4 K;  4KTQ A;  5AZI B;  3A5O C;  3OYI A;  3R1X A;  3ID8 A;  1Q9X A;  3T69 A;  3PSF A;  4CGH A;  4FJ9 A;  3J7Z O;  3CC2 N;  4NCA A;  3IUC A;  1T44 A;  1HYV A;  2UXB K;  1U2V A;  1YVN A;  4NXN K;  5AJ3 K;  4CFA A;  4FM0 A;  1IH7 A;  4QS7 A;  3CQY A;  4Z4C A;  2G8H A;  4FJG A;  3D2E B;  3L2V A;  3PO4 A;  5F2R A;  1BCO A;  3UIQ A;  1HLU A;  3AVM A;  3IRX A;  3LM9 A;  3M8Q A;  1GLL O;  3LAL A;  1ZBH A;  4FPB A;  3CHW A;  3TPQ A;  4IOA L;  1TAQ A;  4MQ3 A;  5EU7 A;  2NRR A;  1VSL A;  5AQU A;  4XIU A;  3KK2 A;  2D5R A;  1HMV A;  2VQE K;  4CGJ A;  5LMN K;  4KRE A;  3AA2 A;  2DY4 A;  1T03 A;  4MO4 A;  2O8E A;  4X65 K;  1KC8 O;  3ITH A;  2P9I B;  1C0M A;  5FRO A;  1J54 A;  2KQ2 A;  2XRI A;  1TL3 A;  4BGA A;  2Z1J A;  3HXM A;  1S22 A;  3O9U A;  3O9R A;  4ISE A;  2E2Q A;  4H0O A;  5LJW A;  1HNV A;  4IO9 L;  4DQQ A;  3IKM A;  5C12 A;  4PQU A;  3C7N B;  3CI5 A;  1BIS A;  4YOR A;  3VQA A;  4DSF A;  3FR0 A;  1ZBF A;  3EY1 A;  2GV9 A;  3R9P A;  2I7P A;  1UWB A;  3S3M A;  1ESV A;  2O4G A;  4RTF D;  4C8K A;  4KB1 A;  1C1C A;  3VQB A;  5SZT A;  1NMN A;  2E2N A;  4FJM A;  1RIL A;  4FZY A;  3Q7B A;  1K8A O;  4Y1D A;  3ATU A;  4B3S K;  2A1S A;  2YHY A;  4CHZ A;  1O13 A;  4LF5 K;  3DLK A;  3DLR A;  3O9Q A;  3BDP A;  4KHY A;  4OPK A;  3IFR A;  3ULE B;  3AVL A;  4EAH D;  1NK9 A;  4FWS A;  1XC3 A;  1SZ2 A;  4FJJ A;  2X6N A;  3O4Q A;  3H6E A;  3K57 A;  1RDC A;  1FJG K;  1WB9 A;  2FBY A;  1HNZ K;  4JK8 A;  2KZZ A;  1GLE G;  3J80 O;  1YAG A;  3PO5 A;  1LWE A;  2E1Z A;  1VRT A;  2Z1I A;  1MWM A;  4CIG A;  4EHT A;  3RMC A;  3MMV A;  5KI6 A;  4BRL A;  3QEW A;  3ZCM A;  2G8I A;  1Q9Y A;  1QQO A;  1VQ9 N;  4JI6 K;  4DCH A;  3L8B A;  1N6Q A;  3WNH A;  1DGK N;  3MCA B;  4E1M A;  4JK9 A;  3O4N A;  3I33 A;  3HJF A;  4LFC K;  4W5Q A;  2HF4 A;  3M8S A;  4Z4E A;  4EZ9 A;  3QBW A;  4Y0W A;  2ITG A;  1S9E A;  1S1V A;  3C6A A;  5FDL A;  4CFD A;  2P9N B;  1Y64 A;  3S9H A;  5GIN A;  1K73 O;  1JXE A;  4BQZ A;  5TKY A;  1NK0 A;  3T7Z A;  2KHO A;  3QET A;  4CEQ A;  3CXC M;  1IJJ A;  1HJR A;  4M3Y A;  2A40 A;  3MX2 A;  4DTR A;  2XY6 A;  4B3M K;  2HVH A;  4O0J A;  4TSX A;  4BY9 C;  5LJV A;  3MAQ A;  4DQI A;  4NLC A;  4BRD A;  1EWQ A;  5B8H A;  3MWT A;  4HWI A;  4JD2 B;  3G4S N;  3L4I A;  1SQK A;  1TUU A;  3QFU A;  3CCL N;  4NYF A;  4LF6 K;  3FGU A;  1WSE A;  1X9J A;  2HB5 A;  3DXK A;  1RNH A;  5BPM A;  3ENH A;  2W40 A;  2HHS A;  2E4L A;  1CXQ A;  4CD3 A;  3I56 N;  2OZS A;  4JV5 K;  3OYM A;  3MWP A;  2QWP A;  4CFB A;  2ZD1 A;  3QIP A;  5GAG P;  2P9P A;  1MA9 B;  3TAN A;  3RWU A;  2KFN A;  4JK7 A;  4K41 A;  5HRR A;  4BRE A;  3CER A;  1NJX A;  2HND A;  1A5W A;  4BRG A;  3ZEU B;  1CZA N;  4HCB A;  3L2U A;  1IV0 A;  2V7Z A;  1Q7Y O;  4JKF A;  1WBD A;  1OVQ A;  4J2A A;  4N76 A;  3O8M A;  3EE8 A;  4BAC A;  3ZLJ A;  1LOT B;  4DU1 A;  2NRW A;  3OYH A;  4CER A;  1QS4 A;  5LL6 Z;  3F5T A;  3OYK A;  1ATN A;  4IFV A;  2ETJ A;  4I9L A;  2OTL N;  2VGM A;  4U7B A;  3NE6 A;  1VQL N;  3IG1 A;  4CEC A;  2VYP A;  3I8B A;  4J2B A;  3HM9 A;  3MXM A;  4CF0 A;  3AAQ A;  1NGB A;  4E19 A;  4B9M A;  3O9T A;  1OH8 A;  3HPO A;  3BGR A;  2Z1G A;  1C0T A;  3TSP A;  3BEX A;  2VWJ A;  4KAZ A;  3TI0 A;  5AR0 A;  3U9D A;  4OKK A;  4QS8 A;  2Q2R A;  5KRT A;  4YHH K;  4NCB A;  3WQU A;  1OKJ A;  1XNQ K;  1XMO K;  3MEG A;  3VQ7 A;  1JLQ A;  2I5J A;  2RN2 A;  4UQG A;  4LH4 A;  5E84 A;  3MN5 A;  2HHT A;  2NRX A;  5AQR A;  4EIA A;  4A2B A;  4AHS A;  3SJH A;  1TK8 A;  3KTQ A;  2P9K A;  3LAM A;  1NMD A;  3VQ6 A;  3KLG A;  2XY8 A;  4CJW A;  3EO3 A;  3EKU A;  1RTD A;  2E6M A;  1JLF A;  1YIJ N;  4ILJ A;  3WEE A;  3ZSX A;  1O1W A;  1JJ2 M;  2D4W A;  3HO1 A;  5AQK A;  3OYN A;  3MN9 A;  1T05 A;  1FXX A;  4JI1 K;  2CH6 A;  4BR2 A;  4BRN A;  4UY8 O;  1ZBU A;  4JYA K;  3AVC A;  3L2R A;  4LFA K;  5A2Q O;  1BQM A;  1IBL K;  2B6A A;  3K2P A;  5I3U A;  4DFK A;  4ZTJ A;  4MLE A;  3VEZ A;  1C1A A;  4KI6 A;  2O8E B;  4AHR A;  1Q86 O;  4OKE A;  4CJF A;  4M3U A;  4CZH A;  1NGH A;  4O0I A;  1NKB A;  1D9F A;  2P9I A;  3CCQ N;  4KRF A;  5BRD A;  2E2P A;  4JKC A;  3SYZ A;  2B5J A;  5J2N A;  1S1U A;  3DOL A;  4IDK A;  5AQV A;  4H03 B;  4HUF A;  2E5L K;  3C7N A;  1M90 O;  1DT9 A;  3KLI A;  2HHU A;  3CG7 A;  4DG1 A;  2ITM A;  4YOU A;  4CES A;  1RDB A;  3OS0 A;  5KQD A;  1Z26 A;  4CEO A;  2O8F A;  4NO7 A;  1NGF A;  3FE1 A;  1L3T A;  3CJ9 A;  1I94 K;  4FSV A;  1YJW N;  4DR1 K;  3UKR A;  3SI6 A;  1ASV A;  3M3Z A;  4PKG A;  5I42 A;  3EKS A;  1NNE A;  4DFP A;  4DHY A;  4QS9 A;  2X6S A;  1KTQ A;  4LSN A;  1KVC A;  3AAR A;  1NK8 A;  1WLJ A;  3V81 A;  4CHQ A;  1NJI O;  5AQT A;  4ILH A;  4YDU C;  1S3X A;  1JXB A;  4DSI A;  4JEP A;  3OTO K;  1A5V A;  1W97 L;  3ULE A;  3BZC A;  4HHT A;  2V52 B;  3L3V A;  5M1F A;  2OPQ A;  1KXP A;  3S41 A;  3HT3 A;  1VHX A;  2QWM A;  4RW6 A;  4CBX A;  1WAF A;  3LM2 A;  3DLL L;  5CE3 A;  2HNZ A;  1IKV A;  4FLW A;  3I8D A;  3TWH A;  1BA0 A;  1GOB A;  3G0Z A;  5ELZ A;  3VQ5 A;  4BRQ A;  4CIF A;  4FM1 A;  4ISF A;  4FWM A;  3NVM A;  1YIT N;  3FZH A;  1HKC A;  3ZSQ A;  1DTT A;  3AA3 A;  3CFO A;  3HP9 A;  4RW8 A;  3U8X A;  5HLF A;  4ZTF A;  1JCG A;  1D9D A;  2YX6 A;  4FJ5 A;  4CGF A;  3P4I A;  3LP3 A;  2FBX A;  3P31 A;  4G1Q A;  2CH5 A;  4M7Y A;  4BG9 A;  4MFB A;  1F21 A;  3AVI A;  1W0H A;  3AO4 A;  4B9Q A;  4M3X A;  5EVZ A;  3AVJ A;  4AM7 A;  4YNQ A;  1J5O A;  2P9N A;  4PWD A;  4AHC A;  4DQP A;  3SNN A;  2VG5 A;  4N5S A;  3NBP A;  4CK3 A;  3MK6 A;  1EX4 A;  5LMU K;  1KLM A;  2LSN A;  4JI4 K;  3G71 N;  3H45 C;  4NCG A;  4PUO A;  3VPZ A;  3LWL A;  2AP1 A;  4QAG A;  2Q0U A;  4BGB A;  1I39 A;  5CY4 A;  1TVR A;  1HKG A;  3CCS N;  4YOX A;  3PIO L;  2E20 A;  2BH1 A;  3LZI A;  2F8S A;  1Q8I A;  2FBV A;  3ZT0 A;  5AQG A;  3OYB A;  3V6D A;  1NG9 A;  4MO5 A;  3CMA N;  4JD2 A;  3O5B A;  4MLH A;  2WC9 A;  1XUP O;  3SUQ A;  1RFQ A;  1TGO A;  4B3T K;  3DXK B;  4FM2 A;  2IC3 A;  1TK5 A;  3CC4 N;  3VTI A;  3OA9 A;  2NRT A;  2UU9 K;  3V9W A;  2I7N A;  1ZYQ A;  3J7A P;  4EHU A;  3JXU A;  3QEX A;  5AFU A;  4PY5 A;  1ATR A;  5AQX A;  1VSI A;  3ZT4 A;  1NLV A;  2EX3 A;  1S6P A;  3CJ1 A;  1RDD A;  4IZ9 A;  3VQ8 A;  1HQU A;  3ZEU A;  2HW3 A;  1VSE A;  2BAN A;  4N41 A;  5KQ8 A;  3JSM A;  4CJV A;  1KD1 O;  4FVU A;  5AQM A;  4BC4 A;  3ENB A;  3WXM B;  2F7T A;  3M6G A;  5JVH L;  2ASM A;  5C24 A;  3SQ1 A;  1LWC A;  1TL1 A;  1RDW X;  2D0O A;  4BR7 A;  1RTI A;  2X78 A;  2JLE A;  4K0K K;  2O4I A;  1JCE A;  3KK7 A;  3SZ2 A;  2F9T A;  1HYS A;  4HVJ A;  3OS1 A;  4CVN E;  2HHX A;  5JS2 A;  1D4X A;  4ELT A;  3DXM B;  1BGX T;  4RG8 A;  1B92 A;  5C15 A;  4KV8 A;  1KVB A;  3CCJ N;  2ZM6 K;  3MEE A;  4C1N K;  3VQ4 A;  1BA1 A;  4B8C A;  3VGL A;  2QTD A;  3VTH A;  1TYQ B;  4BVO A;  2OTJ N;  4BC5 A;  4ZHR A;  3SUP A;  1J53 A;  3O4W A;  4CEE A;  4B3R K;  3D2F B;  5BR8 K;  3IDH A;  4F3T A;  1K8K A;  2QXL A;  4JI5 K;  3KWG A;  2A42 A;  3RSE A;  5KPT A;  4E7I A;  1NOY A;  1WN7 A;  1BI4 A;  3LP0 A;  1R0A A;  1NJW A;  3NVK A;  4YY3 K;  2YJE A;  3G10 A;  1KAZ A;  4KFB A;  4CJS A;  1WNS A;  3I0S A;  3VEO A;  5LY3 A;  1QSL A;  4KI4 A;  1REV A;  1TKZ A;  4OX9 K;  2P9K B;  3VQ9 A;  1BCM A;  2QKK A;  3SQ2 A;  4CJR A;  4DU4 A;  1TK0 A;  4BWJ A;  4FWO A;  3F9M A;  3UE5 A;  3WEE B;  2D0P A;  1EET A;  3VA3 A;  4FLZ A;  5ADX H;  3KLH A;  3KWI A;  2R7Y A;  1UAX A;  4K42 A;  4FWL A;  3AGR A;  4JHD B;  3QNN A;  4YOW A;  1ATS A;  4CBW A;  5M1N A;  3RR8 A;  3HSC A;  3C0B A;  4XH5 A;  4CGI A;  2NNW A;  2VG6 A;  3THX B;  4B1Y B;  1TKT A;  5J2Q A;  4DR5 K;  4X66 K;  3DRP A;  4IFY A;  3W3D A;  4WFA L;  3RMA A;  4C8O A;  4FWK A;  5AQQ A;  1VQ6 N;  1C6V A;  3CIP A;  3FLC O;  3NGI A;  3LDP A;  4CHO A;  1E3M A;  1Z25 A;  3AO3 A;  1NKC A;  4BR9 A;  1CXU A;  3O3F A;  4DLG A;  1IO2 A;  4I7F A;  5SWM A;  4ILG B;  4BG8 A;  2Q31 A;  2GBZ A;  3OY9 A;  4B9T A;  4FK0 A;  3MEC A;  1SUQ A;  1HPM A;  1WSF A;  1SKR A;  3E01 A;  3NCI A;  1YJ9 N;  3KHY A;  4A59 A;  1EWR A;  4JI8 K;  2GWJ A;  2UYT A;  2YJF A;  2G8U A;  1NGG A;  3ULD A;  2O8F B;  5HBM A;  2WBN A;  1X3N A;  4CHP A;  2GUI A;  3VER A;  3R6M A;  2HF3 A;  4LH5 A;  4H4O A;  4WF9 L;  3PUF A;  1XWL A;  3F2K A;  3UKR B;  3AVN A;  4AQY K;  4QCL A;  3P83 D;  3SV3 A;  3VGM A;  3FFK B;  3F73 A;  4CJL A;  4F4K A;  3O9S A;  4CGG A;  3WNE A;  1T6D A;  4PKH A;  2NRZ A;  3I55 N;  1C0U A;  3V9Z A;  2ZE2 A;  1SL1 A;  1T7P A;  1S6Q A;  2ZF5 O;  4WFN L;  4JN4 A;  5CZ2 A;  2HBM A;  3QER A;  4DFM A;  4A57 A;  5FPD A;  1VSK A;  1YF5 L;  4E7L A;  3RMD A;  1BL3 A;  1DKG D;  1RT6 A;  2JWK A;  3KD1 E;  4CF2 A;  2ASP A;  3L4Q A;  4OLA A;  1QZ5 A;  3AAP A;  3F9K A;  1SV5 A;  4RW9 A;  1WAJ A;  5AQP A;  1SKS A;  3V9S A;  2Q97 A;  3THY A;  4LF7 K;  1C1B A;  1HR0 K;  5I9E B;  4CJE A;  4CEZ A;  4CEB A;  4IOC L;  3H3N O;  4B08 A;  5BPL A;  2A1R A;  1N33 K;  3VQD A;  2IOC A;  4IKF A;  1SS6 A;  2GEM A;  4EP4 A;  3V9X A;  4GVM A;  1HNW K;  3ZX0 A;  3G6E N;  1QVF M;  1GLD G;  3AVF A;  1RBR A;  2GX9 A;  4DFJ A;  4H4M A;  3OW2 M;  1VK0 A;  4BR5 A;  4PL8 A;  1XNR K;  2ZJQ L;  4OPJ A;  3DLH A;  3VA0 A;  4K8X A;  2UXD K;  3TTF A;  5JS1 A;  4AHU A;  2HHH K;  5GIP A;  4J2E A;  3WXL A;  4F9O A;  4DMN A;  1QQM A;  3EEQ A;  2JWL A;  4BE2 A;  1NK6 A;  4FLV A;  1ILY A;  4FWR A;  2XHB A;  4WE1 A;  1HYZ A;  3AVA A;  4HCC A;  4KPY A;  3LPU A;  3CCV N;  4DLE A;  4KHP K;  4KKO A;  3ZSY A;  1OH6 A;  3GDQ A;  3BF3 A;  4B9U A;  1QZ6 A;  3SJJ A;  2D0C A;  3D0P A;  1B9D A;  4G9Z A;  3OYG A;  4BWM A;  4IEI A;  2IAJ A;  4KHW A;  4FJN A;  4RWT A;  1Q81 O;  3AV9 A;  4Y1C A;  4JKB A;  3DMJ A;  3TU5 A;  1X3M A;  3TAM A;  2KLA A;  1V4T A;  4KH5 A;  2PZS A;  1HX1 A;  1LAV A;  5F0X A;  4CJU A;  1WSJ A;  3RRG A;  4BRK A;  3V1Q A;  2W42 A;  4M7X A;  1RT1 A;  2OPR A;  3SLC A;  1E4G T;  3DJC A;  2ZJR L;  3O3G A;  1U48 A;  3DRR A;  3ZSV A;  1NKE A;  1TKX A;  5T7B A;  4DS5 A;  1E4F T;  4R79 A;  3CJB A;  1DTQ A;  4FZX C;  4KHN A;  3NDK A;  1XHX A;  1RBS A;  4Z94 A;  4BRP A;  4YFU A;  4OJR A;  4GW6 A;  4KHQ A;  2YNI A;  1ZBL A;  4BRF A;  5EOY A;  1WBB A;  1U45 A;  2GEL A;  5C0Y A;  3MN6 A;  1G15 A;  3EL2 A;  1QHT A;  1VRU A;  4CEF A;  1KFS A;  5IWA K;  2HOE A;  3HPG A;  4H0Y B;  3OS2 A;  4BRM A;  2BTF A;  4O4G A;  1W2B M;  4CZF A;  3DYA A;  5M1Q A;  1FW6 A;  4DSL A;  4K25 A;  3LP2 A;  1BHL A;  3VMF B;  1RCH A;  1YTA A;  1BOT O;  3DXM A;  3RRH A;  1LW2 A;  2RF2 A;  2X74 A;  2Q3S A;  3QNO A;  4BRA A;  4LF8 K;  1JLE A;  1ASW A;  4BRO A;  4DSJ A;  3EN9 A;  4E7K A;  1N32 K;  4CJ4 A;  1TYQ A;  2VQF K;  1LV5 A;  1QSY A;  4GV3 A;  1DEJ A;  1K8K B;  1LW0 A;  3AGK A;  3D2F A;  4DV6 K;  4GV6 A;  3RSE B;  4A5A A;  1U4B A;  3HM8 A;  4W5N A;  4GKJ K;  1BI4 B;  1YHQ N;  3OYL A;  4BDP A;  4M42 A;  3U9Z A;  3ZSW A;  1U47 A;  4FLT A;  3TAB A;  2WFB A;  3VQP A;  4H5W A;  3WNF A;  1NK5 A;  3SPZ A;  5CYM A;  1JKH A;  1LWF A;  1QQC A;  2E6L A;  1BG3 A;  5EXW A;  3O6W A;  4CJP A;  4DV7 K;  4JRQ A;  3K58 A;  3NF9 A;  3PX4 A;  2OA8 A;  4OKJ A;  1LCU A;  5C25 A;  3NGZ A;  2D1K A;  5HRO A;  4KB0 A;  4DUZ K;  3D6R A;  2ZGZ A;  1XHZ A;  3DM2 A;  4R5P A;  2FBT A;  4WYB A; 
#chains in the Genus database with same CATH homology
 4NXN K;  4AQY K;  4B3R K;  5AJ3 K;  3J80 O;  5BR8 K;  4DR4 K;  4DV5 K;  4JI5 K;  5LL6 Z;  5LMU K;  4JI4 K;  4YY3 K;  4JI6 K;  2E5L K;  1J5E K;  5IT9 O;  2UUA K;  4JI2 K;  3T1Y K;  4OX9 K;  4LFC K;  4JI0 K;  1N34 K;  4LF4 K;  4X62 K;  3J7Y P;  4DV3 K;  2VQE K;  4DR2 K;  5LMN K;  2F4V K;  3J81 O;  4GKK K;  1I94 K;  3JAM O;  5IWA K;  4DUY K;  4X65 K;  4LF7 K;  4LFB K;  4DR1 K;  1HR0 K;  4B3T K;  4DR7 K;  4YHH K;  4JI7 K;  1N33 K;  4LF9 K;  2UU9 K;  1XNQ K;  1XMO K;  3J7A P;  1HNW K;  3OTO K;  4DR5 K;  4X66 K;  4DR6 K;  4LF8 K;  2UXC K;  4DV0 K;  4CW7 B;  1XMQ K;  1N32 K;  1N36 K;  4B3M K;  4DV2 K;  2VQF K;  1XNR K;  1HNX K;  2UXD K;  2UUC K;  4DV6 K;  5FLX O;  2HHH K;  4GKJ K;  4NXM K;  1IBK K;  4JI1 K;  4LF6 K;  4K0K K;  4JYA K;  2UUB K;  4B3S K;  4LF5 K;  4CVN E;  4LFA K;  5A2Q O;  4JI8 K;  1IBM K;  4JV5 K;  4KHP K;  4DV1 K;  4X64 K;  4DV4 K;  4DV7 K;  1IBL K;  4JI3 K;  2ZM6 K;  4DUZ K;  3T1H K;  4DR3 K;  4V19 S;  1FJG K;  1HNZ K;  2UXB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...