5HRRA

Hiv integrase catalytic domain containing f185k + a124n + t125s mutations complexed with gsk0002
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
140
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNSVKAACWWAGIKQEGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 52
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrrA00
1EP4A 1QS4A 4W5OA 4B9TA 4FLZA 1L3VA 1IO2A 3HO1A 1A5VA 1U47A 1C1CA 3CQ8A 1IKXA 3PV8A 1X9MA 3LWLA 1W9HA 1QSSA 2XRIA 4E0DA 3AVMA 3TARA 3DLRA 3AVGA 3SPZA 4E7HA 2DTUA 4C8OA 1R0AA 3I0SA 3DLHA 4DFMA 1GOBA 3CG7A 4C8LA 1JXBA 4N5SA 4FJ5A 3S3MA 3L2UA 3QIPA 4FJ9A 3O4NA 4AHRA 4FJNA 5HROA 2X6SA 4AHVA 1HJRA 3KD1E 1KVAA 3S9HA 2DFFA 1Z25A 1RT7A 3PUFA 3QIOA 3U3GA 2Z1IA 4GVMA 3O3HA 1VSLA 1U45A 1LW2A 3LP3A 1ZYQA 4CJRA 4OGEA 4B08A 3KK3A 1XI1A 3VQ5A 1NK8A 3AO2A 3OYIA 4PY5A 4ID1A 1S1XA 4KREA 3AO1A 3AA4A 1S1VA 4GMJB 3O3GA 4J2DA 3SQ1A 4Y1DA 4H4MA 4W5QA 4HHTA 1FKPA 1RDDA 2A1RA 3LWMA 3TR8A 4Z4HA 2HVIA 2PY5A 1WNSA 4FK0A 3NF7A 5C24A 3DM2A 4N41A 4CK2A 1U49A 4F3OA 2BGGA 3V6DA 2O4IA 1HYZA 4CEEA 1KVBA 2OPRA 3KIOA 1RT3A 1IKVA 4CE9A 1RBSA 2Z1GA 4CIFA 4DF4A 3LP2A 4FZXC 4QCLA 3SPYA 1RILA 3OY9A 1NKCA 4E1NA 1DTTA 2VWKA 4E89A 1S9EA 1WSIA 2FC0A 4LD0A 3HP9A 5KGXA 2W42A 4B9SA 4M3XA 3LDSA 4CJ5A 2E6LA 4CJKA 2X74A 2XO7A 2XHBA 3OS1A 1RDBA 1U04A 3OS0A 3MEDA 4W5TA 3C95A 4F2RA 1NK0A 4EZ9A 4CGGA 5HBMA 3LP0A 3LZJA 1WSGA 2P5GA 5FRMA 3H08A 2NUBA 3ZSYA 2A1SA 4N56A 1QTMA 4RW8A 3TI0A 3DOLA 1HYSA 3C6TA 3O3FA 4CESA 2G8UA 1FKOA 2I5JA 5KTQA 3HM9A 1HQEA 4DTPA 3VQAA 3BDPA 3HPOA 1DLOA 5J2MA 3VN5A 4OPKA 1C0TA 1GOAA 4FCYA 1BI4A 4QOZB 1LWCA 4N47A 3V1OA 4CK3A 4M42A 1ASVA 3AVIA 4CJEA 3DMJA 2Q3SA 1SKWA 4O5BA 1RBTA 4DS5A 4Q0BA 3OYFA 3V4IA 3V1RA 1JLQA 4PWDA 3V9UA 5JS1A 4M45A 4FLXA 5KRSA 1WAFA 3SYZA 4EZ6A 4KHQA 1O1WA 5FRNA 3VQQA 1NJWA 2KFZA 3MXIA 3NAEA 4E7JA 3DRSA 4FJGA 1RBUA 4KB0A 4CJQA 4IBNA 1ASUA 4M3RA 3PY8A 1BQMA 1NK5A 2YKNA 2G8VA 3T19A 4FYDA 3ZSZA 4OPJA 4KB1A 3OYLA 1CLQA 1S6PA 4B3OA 2DFHA 2YKMA 3DLEA 3OYHA 4FZYA 1XHZA 1FK9A 1UA1A 4NYNA 3L2RA 3KJVA 3M8SA 1WSFA 1F21A 4R5PA 3KLFA 3PO5A 5CY4A 4BACA 1RBVA 4HTUA 1D8YA 1T7PA 1RTHA 2XY8A 5EU7A 3VQPA 3DI6A 1YT3A 4CGIA 4JRPA 4E1MA 1VSDA 3NCIA 3KTQA 4FLTA 4DS4A 3D45A 3IS9A 5KI6A 3QEVA 1TK0A 3OYCA 3PO4A 4DSFA 4CFCA 4E7LA 5HLFA 4FM2A 3NF8A 4HCCA 2HHSA 3ZSXA 4CEAA 2OZSA 3RMBA 3QNOA 1KLMA 4I9LA 4FJLA 3CM5A 4DLGA 4I2QA 1Q8IA 4B8AB 3VQ7A 3SNNA 1T8EA 3QINA 3OVNA 5HRRA 4J2AA 1JLGA 3D0PA 4F8RA 5DMRA 1RCHA 3K5NA 4M3UA 3TABA 3AVBA 3OYEA 1NJXA 1EKEA 2G8IA 1RT2A 1A5XA 2YNIA 3ZSVA 2JLEA 4PQUA 4AHCA 4NCAA 2D5RA 1TL3A 3KKSA 1CZBA 5CYMA 4CHOA 3EZ5A 4DTJA 3RWUA 3SV4A 2IGIA 3AV9A 2ETJA 3SCXA 5HP1A 3ZT0A 1UAXA 3V9SA 1KLNA 4OJRA 1LAWA 3ALYA 1U4BA 4F4KA 1J54A 3L3UA 3HVTA 3AA3A 3U3YA 1KCFA 1SUQA 4KKOA 4Z4EA 4PUOA 3NF9A 3VQ8A 4DSKA 4KHSA 3NFAA 4OVLA 3LAMA 3DLKA 4KHUA 1LAVA 4RW7A 4CJPA 4DSIA 3VA3A 4O44A 5J2PA 3NH2A 4CEQA 4KTWA 2OA8A 2VG6A 4AHSA 5HRPA 5HRNA 1VSKA 5I3UA 3T3FA 4JS5A 4JS4A 1JXEA 1TVRA 2D0BA 1KRPA 4IG0A 4Z4IA 3AO5A 1VSHA 2HB5A 4AILC 2B5JA 2IC3A 4BDPA 4IFVA 1KSPA 4KFBA 1BCOA 1X1PA 5CZ1A 3NDKA 4UQGA 4Q5VA 3L8BA 4N76A 2X78A 3OJUA 3OS2A 5J2QA 3MXMA 3THVA 3ZCMA 3LALA 1LWEA 3ZT1A 2DY4A 4B9UA 1JLCA 1UWBA 3DOKA 4OKEA 1UA0A 2GBZA 3KD5E 1NK6A 3NBPA 4Z4GA 1HPZA 1JLFA 4HUEA 4BWJA 3B6PA 4MQ3A 5E41A 3K5MA 4BE2A 1UOCA 4H4OA 3OYMA 2Z1JA 2IS3A 4ID5A 4I2PA 2QKBA 3SUOA 4LH4A 4CK1A 4ZTFA 1C0UA 1TKXA 3AVAA 3DLGA 1CXQA 3K57A 1SV5A 4BE0A 4FJHA 1VK0A 4I9QA 3HPGA 3ZT2A 3OYBA 4XIUA 4Z4CA 2F8SA 3QO9A 4DF8A 3V9WA 4L8RB 2RF2A 4FJIA 1QSYA 4ELVA 2DFEA 4CHQA 1RTJA 3RR8A 2KZZA 3ZSOA 4FJXA 2ATQA 4RG8A 1VRTA 1IG9A 4BDZA 1D5AA 3CFPA 4Y1CA 4DU1A 4E3SA 2RKIA 1SKSA 1HNIA 2WOMA 1Q9YA 2O4GA 1HYVA 5J2NA 1RNHA 4FJKA 3VQBA 1S1WA 3ZT3A 2HHXA 1TKDA 2RN2A 1VRUA 4CHNA 4LSNA 4DQSA 1NJZA 3ITHA 4HCBA 1VSJA 1NKEA 3P83D 1NOYA 3SUQA 1XHXA 1C6VA 3OYKA 1Y97A 3TAEA 4CJWA 4I7FA 3DLBA 3OJSA 2KFNA 4DFJA 1ASWA 4O0JA 4FJ7A 4KI6A 4M3WA 3PX6A 3NE6A 3TAFA 4BWMA 1QSLA 2GV9A 1VSFA 1IKYA 4DTUA 4YNQA 1Q9XA 4FK4A 2HHWA 4CGJA 1HRHA 3V1QA 2G8HA 2QKKA 3LANA 3AO3A 4W5RA 2HHTA 4M41A 4CERA 1RDAA 1TK5A 5C25A 3SUPA 1C1BA 2ZE2A 2VG5A 2RPIA 4CFAA 4FM0A 3TAQA 3BGRA 4ZTJA 1BGXT 4OLAA 3V81A 4CEFA 1T03A 4AHTA 3KKRA 3WNFA 1BI4B 3VQ9A 3M8QA 3WNHA 3L2QA 4CECA 1N5YA 4E19A 1TV6A 1S6QA 4E7KA 4KHYA 3SQ4A 4DMNA 2R7YA 4DQQA 5CZ2A 1HQUA 1KVCA 3ISNC 4DTRA 1ZBIA 2PYJA 2XY7A 4DQIA 4KTQA 5DK5A 4CEOA 4FK2A 3QETA 4DG1A 4RW9A 4QAGA 1FXXA 2HW3A 1IH7A 3CYMA 3EY1A 3SZ2A 2KQ2A 2KW4A 1C1AA 4BDYA 3MEEA 1LW0A 4CGHA 4ZHRA 2FBTA 3KLEA 2JGUA 5FROA 2E6MA 2D0CA 2HHQA 4OLBA 4DTMA 1YVUA 1JLEA 2HVHA 1S1TA 1EX4A 4CF9A 4DTSA 3DYAA 5I42A 4IKFA 4FJ8A 4Z0UA 3AVKA 3VQ6A 1B9FA 4CF8A 1EETA 3AVCA 2VWJA 1ITGA 4KI4A 2OPQA 2PYLA 3SQ2A 1XC9A 3K5LA 3NGYA 3KLIA 2HNDA 1QHTA 4EP5A 3PX4A 2P1JA 3CM6A 4CGDA 4DTOA 3MXJA 1TK8A 2IAJA 4DSEA 4DTNA 1RT6A 4KO0A 5KRTA 3LZIA 3LP1A 3HYFA 1RT4A 4GW6A 4IG3A 1WLJA 2IDOA 3K58A 3WNGA 3AVNA 3HVRA 1HMVA 3ZSWA 1U48A 4KHNA 3AVLA 1TAUA 1EXQA 4CFBA 4NCGA 1DTQA 3QESA 3OYGA 3E01A 3KLGA 1BISA 1MU2A 4RW4A 5SZTA 3KK2A 2Y1IA 3S3OA 3I0RA 3TAPA 3HJFA 2VG7A 3TAMA 4FW1A 1S9GA 4MFBA 3K5OA 2FBYA 4LSLA 4FLYA 1TGOA 3HT3A 3L2VA 1KTQA 5SWMA 1SL1A 4C8KA 1WN7A 4JLHA 1VSIA 4DSJA 3ZSQA 4K8ZA 4OGCA 4DLEA 2HHUA 3NGIA 3OYAA 3V9XA 1L3TA 2P51A 2XY6A 1SL2A 3SJJA 1BHLA 3MEGA 3KK1A 1GOCA 4FJMA 2B6AA 2YNFA 1JLBA 4E7IA 4FLVA 1QQCA 1B9DA 2YNGA 5J1EA 2HNZA 3AVHA 2Y1JA 4B9MA 2QK9A 4YFUA 4CJ4A 3OYJA 4OKJA 3KLHA 1W0HA 3CFRA 4DFKA 3NF6A 4DFPA 4JRQA 1VSEA 3QEIA 3SV3A 2IOCA 3SI6A 1NJYA 4IDKA 4H8KA 2HNYA 4CJLA 1D9DA 1NK4A 2KTQA 3TWHA 3WNEA 5JS2A 1WAJA 2G8WA 2BDPA 1NKBA 4IFYA 4DSLA 2F96A 4J2BA 1BQNA 1YTUA 3ULDA 2EX3A 4HUGA 3M8PA 3VA0A 4ICLA 4B9LA 3QNNA 4CCHA 2AJQA 3AA5X 2HMIA 3AVJA 1RT1A 1RTIA 3HP6A 2G8KA 3VQDA 3L3VA 2B4JA 1TL1A 5K14A 4O0IA 3QEPA 1KFDA 1VSMA 3C94A 1ZBUA 3NHGA 2OPPA 3OYDA 4NCBA 4FXDA 1NK9A 1LV5A 3C6UA 2PZSA 1L3SA 4M3YA 1J53A 3VQCA 1RT5A 1YTAA 2KZMA 2FBXA 2Z1HA 1I3AA 1WSEA 3SQ0A 4KAZA 1RDCA 1JKHA 2ZD1A 2E4LA 3RRHA 4M3TA 1A5WA 1XWLA 3RTVA 1NK7A 2P5OA 1S1UA 3AO4A 4KTZA 4CIGA 4OKKA 4HUFA 1JL2A 2ITGA 4DWIA 1SL0A 1ZBHA 3QEXA 3HSTB 3B6OA 4B9VA 1Z26A 4DU4A 4CJSA 1L3UA 3NH1A 1RBRA 3TAGA 1RTDA 3ZT4A 3TANA 1HNVA 2WONA 4CJVA 3S3NA 4FJJA 2YV0X 3AVFA 2OZMA 3DRPA 2XY5A 3T1AA 4CHYA 1QE1A 4EP4A 3G10A 2X6NA 1I39A 3O4QA 4FVMA 3F9KA 4CF1A 5D3GA 2EHGA 1CZ9A 3MAQA 4KRFA 3IG1A 4CEBA 4CF2A 3F73A 1C0MA 3VQ4A 3NH0A 4FLWA 3JYTA 5C42A 3ASMA 4CF0A 1L5UA 1KFSA 5CYQA 1IKWA 3HXMA 3P5JA 3IRXA 2YNHA 2LSNA 4AH9A 4DU3A 3HL8A 2F8TA 2HHVA 4WE1A 4K8XA 2ZQBA 3HK2A 4BE1A 3V9ZA 4M3ZA 3M8RA 1TKTA 3DRRA 3IAYA 4F3TA 1REVA 3RMAA 2G8FA 1BL3A 2BE2A 4J2EA 3QERA 4B9NA 1WSJA 3LAKA 3QLHA 4KPYA 2QXFA 3P1GA 3QEWA 1T05A 3OYNA 2OYQA 3EYZA 1BIZA 3VQEA 1JLAA 4C8NA 1SKRA 4NYFA 1CXUA 3MECA 3CFOA 4PA1A 1J9AA 4CHZA 4CJFA 3L2WA 3RMDA 1X9WA 4DQPA 3FFIA 4CGFA 4KHWA 4FW2A 3K59A 4FLUA 1X9SA 1NOZA 1B92A 4G1QA 1TKZA 4F2SA 4HVJA 3HPHA 4DTXA 2D0AA 4FM1A 1BIUA 5T7BA 4CJUA 4FZZA 5FDLA 5HRSA 4CJTA 4ELTA 4CJ3A 4ELUA 3U6FA 3PX0A 3RR7A 1ZBFA 3K2PA 1ZBLA 1D9FA 4TSXA 3RMCA 2YHAA 4CEZA 3G0ZA 4O55A 1K6YA 5KGWA 4LY7A 4CHPA 3I8DA 4CEDA 4O4GA 3ZSRA 4AHUA 4C8MA 2YHBA 1G15A 4B8CA 1BCMA 4CFDA 4Z4FA 1N6QA 1S5JA 3UIQA 4DQRA 1TAQA 2BANA 2FBVA 3NGZA 2OPSA 3SUNA 3LPTA 2GUIA 1WSHA 3JSMA 4KV8A 3A2FA 4RW6A 3RRGA 4CIEA 4W5NA 1J5OA 3AA2A 3LPUA 1LWFA 1JL1A 4LH5A
chains in the Genus database with same CATH superfamily
1EP4A 4LFAK 4OPHA 1IV0A 4YOUA 4BVPA 1X9MA 1HNWK 2O8EB 3AVGA 3MX2A 3TSQA 1GOBA 1NGGA 2P9LB 4N5SA 4FJ5A 3L2UA 4FJNA 1HLUA 2X6SA 4HWIA 4AHVA 4B9QA 4B3TK 4DV0K 2DFFA 1Z25A 3J80O 4DV3K 1RT7A 3C7NA 3U3GA 3O3HA 3LP3A 1XI1A 3ID6A 3THYB 3CC2N 4PY5A 4J2DA 3D2EA 1N36K 4HHTA 4MLEA 2E5LK 3PIOL 4JI4K 5C12A 4N41A 5C24A 3DM2A 4PKGA 3THWA 1E4FT 4CIFA 2Z1GA 4FZXC 3SPYA 3OBWA 4M7XA 1W2BM 1WSIA 4WQ5A 2W42A 5KGXA 4BR2A 3LDSA 2FXUA 4EFHA 1ESVA 4F2RA 3MEDA 4W5TA 3C95A 4WCEL 5HBMA 3B8AX 3LZJA 2P9IB 1SS6A 5FRMA 4XH1A 5LJVA 1QTMA 4RW8A 4LF8K 4JV5K 1HYSA 3O3FA 4MDBA 1T3VA 1YJNN 2I5JA 3HPOA 1DLOA 1BUPA 5J2MA 2CH6A 3WT0A 4FCYA 1XNRK 4M42A 1O13A 3AVIA 3DMJA 4FWLA 1RBTA 4DS5A 4Q0BA 3V1RA 1OH8A 4BRGA 4M45A 3VEZA 4KHQA 3VQQA 1V4SA 2WC9A 3CJ7A 4NB4A 4E7JA 4FJGA 1RBUA 4KB0A 1XMOK 3H45C 1NK5A 2G8VA 3T19A 4FYDA 4KB1A 4B3OA 5AQYA 3RSEA 2DFHA 3OYHA 3DLLL 1UA1A 3QBXA 3L2RA 5TKYA 1F21A 3KLFA 3PO5A 1RBVA 1D8YA 2GEMA 5EU7A 3VQPA 5AZIB 4FLTA 3KWIA 1YJWN 3PO4A 4CFCA 4HCCA 3IDHA 3BZKA 2OZSA 1KLMA 2YX6A 3JAMO 1WOQA 3E9LA 4J2AA 1JLGA 1TUYA 3OYEA 1A5XA 2YNIA 2JLEA 3CCRN 1J5EK 4PQUA 4AHCA 4BC5A 1CZBA 3RWUA 4JI2K 3SCXA 3ZT0A 1UAXA 3V9SA 1KLNA 4F4KA 4KKOA 4CW7B 3M3ZA 4OVLA 4KHUA 3SAGA 1LAVA 4RW7A 3VTHA 2NLXA 3FZMA 3LDOA 4IOCL 3DXKB 5HRPA 5I3UA 1JXEA 2D0BA 1QQOA 2FSJA 2ITMA 2IC3A 1IJJA 1IBMK 3AGRA 4UQGA 4HTLA 3GBTA 5FPDA 1JLCA 1HJOA 2FLOA 4GVEA 3CCSN 1NK6A 4KBOA 5GINA 4HUEA 3FZHA 5E41A 4H5TA 4FL9A 2P9UA 1GLDG 2QKBA 3SUOA 2ZGYA 4FO0A 4A2AA 4ZTFA 3DLGA 3CIPA 4BE0A 1TUUA 3C7NB 1VK0A 5KPZA 3U4LA 4DR6K 3ZT2A 4JAXA 4XIUA 3EZWA 1NGEA 3V9WA 4FJIA 2KHOA 4EIAA 3T1HK 5B8HA 3KVGA 1T44A 3D2EB 3CFPA 4Y1CA 2YCHA 2RKIA 5FPMA 5J2NA 1T6DA 4BR9A 3THWB 3VERA 4BG8A 1VRUA 4LSNA 5AQXA 5AQFA 1VQNN 1VAZA 1Y97A 4H0OA 4H0PA 4ISEA 4O0JA 3ENOA 2YHYA 4KI6A 3D2FA 1IKYA 4YNQA 1Q9XA 4BR0A 2RE2A 1HRHA 5KQ8A 4M41A 3U9ZA 4DQ8A 1QVGM 5C25A 2QXLA 1OVYA 4CFAA 4FM0A 3TAQA 3BGRA 4DUZK 3O9QA 1DKGD 4FVUA 3V81A 3KKRA 2NNWA 3WNHA 4JKCA 4CECA 4JKBA 4E7KA 1GLJO 3MN7A 2R7YA 3ISNC 1ZBIA 2IIRA 2PYJA 3EO3A 5BR9A 4JYAK 2HBMA 4H5NA 4YORA 3VMFB 3QETA 3P39A 3CXCM 4RW9A 3CYMA 4KH5A 3MEEA 4B1UB 5LMNK 2F9TA 2E6MA 1HUXA 1DEJA 1HKBA 5I42A 4FJ8A 4BR5A 3VQ6A 3AVCA 3RSEB 3K5LA 4DR1K 3VEOA 3CQXA 4DTOA 1TK8A 3MXJA 2Q0RA 3BP8A 4IEEA 3LZIA 4E1JA 3ZETB 3K58A 3HVRA 1TAUA 3WXLA 2O8BA 3AVLA 3K0SA 5M1PA 4IFEA 2D0PA 1BISA 1MU2A 3ENHA 3N4QA 4RW4A 3KK2A 2UU9K 2A3ZA 3O9RA 2GWKA 1S9GA 4MFBA 4LSLA 4FLYA 5FLXO 1YUWA 3HT3A 2GWJA 4JLHA 4DSJA 2O8DA 5DM7L 1U6ZA 4IZ9A 1L3TA 2P51A 1SL2A 4YDUA 2BTFA 3M6GA 4GNIA 3MEGA 4FWRA 2B6AA 3C6AA 2YNFA 2Y1JA 4E7IA 2D4WA 2O8CB 3TSUA 4YFUA 3KLHA 4DFPA 1W0HA 3CJCA 1SKRA 3SV3A 1NMNA 3K9JA 2E2NA 4J2BA 1NKBA 1BWFO 3ULDA 5EOYA 4HUGA 5AQSA 3CC7N 4B9LA 4WF9L 2Q1NA 4FWSA 2HMIA 1RTIA 3LDNA 2G8KA 3VQDA 4FWPA 1TL1A 1SQKA 4Z94A 3NHGA 1ZBUA 4NCBA 2OPPA 4XEIA 5BPMA 1L3SA 2WBNA 2Z1HA 1WSEA 3SQ0A 2IVOA 3RTVA 1S1UA 4FWKA 3QFUA 2NZTA 4OKKA 3O5BA 4AM6A 4JN4A 3HSTB 1FJGK 1Z26A 4DU4A 3CHWA 4O8KA 2P9UB 3BEXA 3VGLA 1L3UA 5CR4A 3G71N 3SK3A 3NH1A 2UUBK 1RTDA 3ZT4A 3TANA 2UUAK 2WONA 3O9SA 3DRPA 2XY5A 2W40A 4FVMA 3F9KA 1OH6A 4JK7A 2EHGA 1CZ9A 3MAQA 4CF2A 4FLWA 3FR0A 4IXCA 5AQTA 5C42A 3ASMA 1N33K 3SAFA 2QWMA 4WE1A 4K8XA 3UKRA 3ZX0A 1VQ5N 3H3OB 3M8RA 3ATUA 4M7YA 3LL3A 3PSIA 2ZJPL 4J2EA 1VQLN 4B9NA 1C0FA 1T05A 2QWPA 3EYZA 2HF3A 3I56N 4NYFA 4CHZA 3RMDA 3CFOA 3L2WA 1J9AA 2ZJQL 3L0QA 4DTXA 2D0AA 5FDLA 3QB0A 4ELTA 3U6FA 3WXMB 3VPZA 4FOEA 5LL6Z 4TSXA 3FE1A 2YHAA 4LF5K 3TTFA 1N32K 4BRFA 3D7EO 4AHUA 2YHBA 1G15A 3VF4A 4CFDA 1RDWX 3UIQA 3ZX2A 5JMVA 4YHHK 2GTDA 2FBVA 4A57A 3NGZA 1MDUB 2OPSA 3SUNA 2GUIA 3JSMA 1YJ9N 4RW6A 1JL1A 4MO5A 4B9TA 2JWKA 4DV7K 1C1CA 3CQ8A 3LWLA 1QSSA 4V19S 3TARA 2P9SA 3DLRA 3SPZA 3DLHA 4DFMA 4CJ7A 4BROA 3S3MA 1N34K 3O4NA 4AHRA 2ZF5O 3VOVA 5GIPA 2OTLN 3S9HA 1VQ6N 4BGAA 2Z1IA 5EX5A 1U45A 2O8BB 3TTCA 4OGEA 5AQOA 4B08A 3KK3A 3AO2A 4ID1A 1S1XA 4KREA 2YHXA 1S1VA 4GMJB 3O4WA 4L3QA 3SQ1A 4W5QA 1VQ9N 2E2OA 1RDDA 4BVOA 4CK2A 4F3OA 2O8DB 2E1YA 2V7ZA 1VQ4N 4CE9A 2OPRA 1IKVA 1RBSA 4DF4A 3H6EA 4QCLA 3LP2A 3WUHA 1RILA 1NKCA 3A5MC 4E89A 2FF3B 4CZJA 4B9SA 1YI2N 4A5AA 2X74A 5AQUA 1RDBA 3OS1A 4BRHA 4CGGA 3DXMB 3Q7BA 5AJ3K 5BRFA 3N4PA 4N56A 4FOIA 3C6TA 2IVPA 1NBWA 5KTQA 1YAGA 3HM9A 3VQAA 3BDPA 3VN5A 4QOZB 1C0TA 1DGKN 4CK3A 3CCLN 1ZC6A 3KZBA 1SKWA 4O5BA 3T69A 1QZ5A 4PWDA 2P9NA 1QVFM 3FZLA 4FLXA 1WAFA 3E9PA 1O1WA 3F2KA 5FPNA 1NJWA 3NAEA 3LDPA 3DRSA 4IBNA 3O80A 1ASUA 4M3RA 1YIJN 2YKNA 3VETA 3ZSZA 4OPJA 1S6PA 1KAXA 2YKMA 1VQKN 4NYNA 3WQTA 2CH5A 1ATSA 1RTHA 4CGIA 3MN5A 4E1MA 1VSDA 4H0VB 1ATNA 3D45A 3IS9A 5KI6A 3FLCO 2HHSA 3TTDA 3UKRB 1BDGA 1P8ZA 2A40A 4CEAA 5BRDA 3CCUN 4FJLA 3DXKA 4BR7A 4CZKA 4B8AB 3JXUA 3SNNA 3NVMA 3OVNA 5HRRA 3EE9A 1RCHA 1IBLK 4M3UA 3TABA 4GKKK 2G8IA 1RT2A 3ZSVA 4JKHA 5AQJA 3VGMA 4NCAA 1KAYA 3MN9A 4JKEA 3KKSA 4CHOA 3VEWA 2IGIA 3AV9A 5AQKA 2NRVA 1NMDA 5HP1A 4WYBA 4OJRA 1LAWA 1NM1A 1U4BA 4H5VA 3HVTA 4JD2A 2NRZA 4YY3K 3S41A 2A42A 4DSKA 3A5NC 3GDQA 3DLKA 3CCQN 3NH2A 4CEQA 2VG6A 4DCHA 3O08A 1VSKA 1KRPA 4JS5A 4LFBK 1TVRA 3KK7A 3AO5A 3RVCA 1VSHA 2HB5A 2I7PA 3MX5A 1VQON 4OO1J 4KFBA 5CZ1A 4N76A 2X78A 3MXMA 1XC3A 1LWEA 3ZT1A 2DY4A 3EL2A 2QWOA 3H46O 2VQFK 1UWBA 3ENBA 3DOKA 2P9SB 1UA0A 4BWJA 3B6PA 3K5MA 5KPTA 4ID5A 4LH4A 4CK1A 2AP1A 1CXQA 2ZGZA 3GE1A 1SV5A 2NRTA 3P31A 4B1VA 4GKJK 2HBLA 3J8AA 4I9QA 3HPGA 5F0XA 2GUPA 2F8SA 3QO9A 4DF8A 4L8RB 1QSYA 4ELVA 2ASMA 1HX1A 2DFEA 2KZZA 4RG8A 1VRTA 4NXMK 1D5AA 4DU1A 3R6MA 2O4GA 4FJKA 1RNHA 1S1WA 1V4TA 3ZT3A 2HHXA 4FSVA 2UYTA 2ZM6K 3ULEB 4WFBL 4DR3K 3TSPA 4YOXA 3NE6A 5M1OA 3TAFA 1HNZK 4DV5K 3V1QA 1DT9A 2G8HA 4LC9B 3LANA 3IFRA 4CERA 1TK5A 1M90O 3SUPA 1C1BA 2ZE2A 2RPIA 5AQLA 1BGXT 3FFKB 3MK6A 5AQVA 4CEFA 1T03A 3VQ9A 4XH5A 3SJHA 4E19A 1ILYA 1S6QA 4BY9C 3ZETA 3SQ4A 5CZ2A 3SMPA 1KVCA 2RHKA 1JCFA 5BR8K 2P9NB 3VENA 1CZAN 2E8AA 4DG1A 3WEEB 2HW3A 1IH7A 3EY1A 3SZ2A 2KQ2A 2KW4A 4CGHA 4ZHRA 4CVNE 5FROA 2D0CA 4DTMA 3F5TA 1S1TA 1EX4A 4ILGB 3AVKA 4CF8A 1B9FA 4KI4A 1ITGA 5AR0A 3BY5A 2PYLA 1XC9A 5AQGA 3CPWM 4JKGB 1JJ2M 4BGBA 4X65K 2HNDA 1QHTA 5AZJA 2VGNA 3PX4A 2O8CA 5JVGL 4X62K 4JI6K 1G99A 2ASPA 4GW6A 1OH5A 4IG3A 1WLJA 1HMVA 1U48A 2QEXN 3AARA 1EXQA 4NCGA 3QESA 3KLGA 5AFUH 3S3OA 4WQ4C 1GLAG 3TAMA 1Q18A 3D6RA 2FBYA 2E88A 1TGOA 1KTQA 1WN7A 3ZSQA 4OGCA 3NGIA 4FWNA 4H5WA 3OYAA 1NG9A 3SJJA 1BHLA 1TYQA 4A5BA 1JLBA 2PZSA 4B9MA 5J1EA 2QK9A 3VF2A 2QA4N 3C0BA 3NF6A 1KC8O 5M1QA 4IDKA 4JD2B 4H8KA 1JCEA 4CJLA 1NK4A 3WNEA 2BDPA 4AF1A 3M8PA 3VA0A 4EHUA 4CCHA 2AJQA 1BOTO 1ZBSA 1RT1A 1VQMN 4CBUA 5K14A 2HVHA 1KFDA 3C94A 2KKZA 3I55N 4YOYA 3J7AP 1LV5A 3ZYYX 2WTUA 4PKHA 4BRPA 1H1VA 3A8YA 3H1VX 2NRHA 2ZD1A 3HI0A 3TU5A 3RRHA 1A5WA 1XWLA 3HSCA 3JS6A 1HNXK 2A6AA 2ITGA 2FF6A 4JKFA 4BRKA 1C0GA 2Q2RA 3B6OA 1W7AA 1NJIO 3I8BA 4LF4K 1HNVA 4CJVA 4DB3A 3S3NA 2WFBA 4B3MK 3GOIA 2Q97A 4EP4A 2V51B 1OKJA 3SLCA 1NWKA 3CJ1A 3G4SN 4CF1A 4YOWA 2OANA 3CD6N 3F73A 4IO9L 1C0MA 3VQ4A 4Y0WA 3JYTA 1KFSA 3P5JA 1Q86O 3IRXA 2YNHA 3L4IA 3QMLA 2HHVA 3Q7CA 1GLBG 3O8MA 1REVA 4CBXA 3RMAA 1BL3A 3QERA 3LAKA 3QEWA 5FPEA 1XUPO 1JLAA 4C8NA 4DHYA 4NXNK 4U7BA 5LY3A 3FFIA 4KHWA 1VQ7N 1X9SA 3CMAN 1NOZA 1XNQK 3HPHA 4CZGA 4FM1A 4CJUA 4BRQA 4B1WB 3A5OC 4OX9K 3J81O 4ELUA 3J7YP 1ZBLA 1D9FA 1EWRA 3SBGA 3G0ZA 5KGWA 5AQQA 4CEDA 3IUCA 4C8MA 4Z4FA 3VEXA 4DQRA 3ZEUA 5M1FA 3GG4A 3AA2A 5EXWA 5AQPA 2VWBA 1QHAA 1QS4A 2HOEA 4FLZA 1L3VA 1IO2A 1A5VA 1IKXA 1W9HA 2QWQA 4E0DA 2DTUA 3I0SA 1JXBA 3O1WA 1NU0A 5AZJB 3MWPA 1HJRA 1KVAA 3QIOA 3DXMA 1LW2A 1NK8A 1NGIA 3AO1A 3AA4A 3O3GA 4Y1DA 3AY9A 4H4MA 5C10A 1MWKA 3LWMA 3TR8A 4JI1K 4BG9A 2HVIA 4FK0A 3HO1A 4IO8A 1U49A 2BGGA 2P9PA 4BC2A 3V6DA 2O4IA 4CEEA 1KVBA 1RT3A 5AQMA 3ZX3A 4QS9A 4NO7A 3SMSA 1TYQB 3OY9A 2VWKA 2NRRA 1S9EA 4LD0A 3HP9A 3M1FA 4M3XA 2UUCK 4DV6K 4CJ5A 2E6LA 2BH1A 3OS0A 4BRCA 1KD1O 1NK0A 1WSGA 4H0XB 1RDUA 2NUBA 3ZSYA 2A1SA 3DOLA 4MLHA 2G8UA 1FKOA 1QQMA 5BRHA 1BA0A 5AQIA 1N8RO 5ADXA 1GOAA 4XH4A 1BI4A 4N47A 3QICA 4CJEA 2Q3SA 4JK8A 1R59O 3OYFA 3V4IA 5JS1A 4NLCA 3SYZA 4EZ6A 1YITN 5FRNA 4BRIA 4CJQA 4CD3A 3QFPA 3UE5A 3PY8A 1BQMA 3OYLA 4FZYA 1NLVA 1XHZA 1YVNA 3KJVA 4FWOA 3M8SA 1WSFA 2H3GX 3CCMN 4BACA 4HTUA 1T7PA 2XY8A 3DI6A 4ISGA 4YOTA 4DS4A 3QEVA 4CI6A 1TK0A 3OYCA 4DSFA 4E7LA 4FM2A 3IKMA 3NF8A 5C2FA 3C6HA 3ZSXA 4GY2B 4JEPA 3RMBA 5ELZA 4CZMA 4DLGA 3CQYA 2UXDK 4I2QA 1GLCG 4KH6A 3VQ7A 1T8EA 3QINA 5DMRA 3K5NA 3SBTA 5IWAK 2F9WA 3AVBA 1NJXA 1EKEA 1MWMA 3IMXA 4C1NK 4JKDA 2NRWA 4X64K 2D5RA 5CYMA 4R79A 3EZ5A 3SV4A 1GLFO 3ALYA 5GADP 1J54A 3L3UA 1SUQA 5GAGP 1Y64A 4PUOA 4GV9A 3NF9A 3VQ8A 3NFAA 1WUAA 1NGCA 4O44A 4KTWA 4AHSA 1Z6RA 5HRNA 4JS4A 4JI7K 4IG0A 3ZEUB 3ZLJA 4Z4IA 4B3SK 4AILC 1QQNA 3HOSA 3VGKA 1KSPA 3TPQA 1BCOA 3NDKA 1YF5L 4Q5VA 3OJUA 4KH4A 3THVA 1LCUA 3LALA 3CJ9A 3MWTA 4B9UA 3BUZB 4OKEA 2EWSA 5E26A 2GBZA 3KD5E 4Z4GA 1JLFA 1KQSM 3ULEA 1RFQA 4BE2A 4H4OA 3OYMA 4WFAL 4PL8A 4I2PA 2Q36A 3AAQA 3K57A 3O9UA 2Q0UA 3OYBA 1QZ6A 5AQNA 1NNEA 4Z4CA 2RF2A 2IVNA 4CHQA 4BRLA 3ZSOA 4A59A 2ATQA 4FJXA 4JI0K 1SKSA 1HNIA 2WOMA 1E3MA 2P9PB 3MCPA 2A5XA 2PAVA 1XMQK 1HR0K 3UKUA 1NJZA 1U2VA 3ITHA 4HCBA 1VSJA 1NKEA 3OBYA 3SUQA 3OYKA 3VEYA 3TAEA 4CJWA 3DLBA 3OJSA 2KFNA 1HPMA 1ASWA 4B1ZA 4DFJA 4LF9K 3DWLA 3WEEA 3PX6A 4BWMA 2GV9A 3H3NO 1VSFA 3QBWA 4DTUA 3W3DA 3HM8A 2E2QA 4LF6K 3AO3A 2HHTA 1RDAA 5BN8A 3FGUA 2HF4A 4BR4A 5LMUK 4PHTX 4JKGA 5IT9O 1BI4B 3L2QA 2YHWA 4U67L 4JI3K 2BUPA 4DQQA 1HQUA 2XY7A 4KTQA 4CEOA 4FK2A 4QAGA 3WXJA 1FXXA 1C1AA 1KXPA 3KLEA 5F1XA 2CGLA 3MCAB 2HHQA 4OLBA 1Z05A 2FSKA 4JHDA 4CF9A 4DTSA 2QTDA 3DYAA 4IKFA 2VWJA 2OPQA 3EN9A 3U8XA 3KLIA 4CD1A 4EP5A 3R3LA 2P1JA 3CM6A 4CGDA 2I7NA 2IAJA 4DSEA 4KO0A 3HYFA 1RT4A 3WNGA 4KHNA 3HTVA 3O9TA 1DTQA 3OYGA 3THXA 2Y1IA 3HJFA 5SZTA 3I0RA 3TAPA 3BZCA 4FW1A 3CERA 4C8KA 5SWMA 2W6KA 1VSIA 5KPRA 2W41A 4NLBA 4DLEA 2HHUA 3V9XA 3CJBA 4FJMA 3KK1A 1GOCA 3EE8A 2HBJA 4JNEA 3UB5A 1B9DA 2HNZA 3AVHA 3EEQA 4WQ4A 4JK9A 3CFRA 2HBKA 3OYJA 4DFKA 1NJYA 1VSEA 3QEIA 2HNYA 2KTQA 3TWHA 2G8WA 1YTUA 2F96A 1BQNA 4CZIA 4ICLA 3AA5X 3CC4N 4GV3A 3HP6A 3L6QA 4O0IA 3QEPA 4A2BA 2A41A 1NK9A 4MO4A 4PL7A 4LFCK 1J53A 1K8KA 1RT5A 2KZMA 2FBXA 1I94K 1I3AA 4KAZA 1K9MO 2E4LA 1HKGA 4BC3A 4M3TA 2P5OA 3J7ZO 4F9OA 1P90A 3WXKA 4HUFA 1SL0A 2F7TA 3QEXA 3CF5L 2YJFA 4CZEA 3R1XA 4C23A 1RBRA 5EVZA 3TAGA 5JVHL 2YV0X 2OZMA 3BF3A 4CHYA 2X6NA 5BPNA 1WBBA 4CBWA 3NH0A 1L5UA 3ATVA 5CYQA 1IKWA 2LSNA 4K43A 4CZLA 2F8TA 2ZQBA 3V9ZA 4F3TA 3IAYA 1GLLO 3UKUB 4IOXA 1NGHA 3CETA 1U2VB 1WSJA 3VF6A 3P1GA 5GAEP 3OYNA 1K8AO 1BIZA 3VQEA 2OCEA 1X3MA 4PA1A 4CJFA 5E84A 4DQPA 4CGFA 2D0OA 3K59A 4FLUA 4G1QA 4HVJA 3CCVN 3OW2M 4FZZA 5HRSA 4CJTA 4CJ3A 3RR7A 2O8FA 3RMCA 1K6YA 4LY7A 4IDHA 3WQUA 2F4VK 3ZSRA 1BCMA 1N6QA 1S5JA 2WUSA 4DR5K 5H1SQ 5GAHP 4ISFA 1J6ZA 3LPTA 3A2FA 3RRGA 1J5OA 1LWFA 4RWTA 4QS7A 4W5OA 4JKAA 2YI1A 1U47A 2YJEA 4H0YB 3PV8A 3FZFA 2XRIA 4FPBA 3AVMA 4JHDB 3T1YK 1Q82O 1X9JA 4E7HA 4C8OA 1R0AA 4DR4K 4C8LA 3CG7A 3HRGA 5EY4A 3QIPA 4FJ9A 1VQPN 5HROA 3KD1E 2W6LA 3PUFA 3A0IX 4GVMA 1VSLA 3PLAA 1ZYQA 3LDLA 4CJRA 1SZ2A 4ILJA 3VQ5A 3THXB 3OYIA 2PFUA 4WQ5C 1FKPA 2A1RA 1IBKK 4Z4HA 2PY5A 1WNSA 3NF7A 4J8FA 5C15A 1W97L 4BRAA 1HYZA 5BPLA 3KIOA 4E1NA 1DTTA 2FC0A 2DPNA 5HL7L 1K73O 5JLHA 4CJKA 5CHIA 2XO7A 5AQHA 2XHBA 1U04A 1ZXOA 4IEIA 4EZ9A 4BQZA 3LP0A 3QDKA 4H0TB 2E1ZA 2P5GA 3H08A 1WBDA 3TI0A 4CESA 4RTFD 1HQEA 4DTPA 4OPKA 4DV4K 5BREA 1LWCA 3V1OA 1K8KB 1BU6O 1ASVA 3O6WA 4B3RK 3LM2A 4ILHA 2ZJRL 5JICA 1JLQA 4OPAA 3V9UA 2NRXA 1YHQN 2D1KA 5KRSA 2QI2A 1RGIA 4I6MA 3VEVA 2KFZA 3F9MA 3MXIA 5KQDA 3R9PA 4EAHD 4DV1K 1CLQA 3DLEA 1FK9A 4R5PA 5CY4A 4B1YB 3E9OA 3SAHA 2OTJN 4DV2K 1YT3A 3OA9A 4JI5K 4JRPA 3NCIA 3KTQA 4G9ZA 5AQWA 3AAPA 5HLFA 2E2PA 1EQYA 3GL1A 3CCJN 3QNOA 4I9LA 3CM5A 3T7ZA 2VQEK 1S22A 1IG8A 3G25A 1Q8IA 3OHRA 2VYPA 3D0PA 4IOAL 4F8RA 4IWVA 4A62A 3BF1A 4C1NI 3WXIA 3O1BA 5A2QO 4CZFA 4M63C 3L4QA 1BO5O 1TL3A 4DTJA 2VGMA 4O8UA 2QWNA 2ETJA 4BREA 4KHPK 3AA3A 3U3YA 1KCFA 1S72N 5I9EB 4Z4EA 2ZWHA 2O8FB 4KHSA 4LF7K 3LAMA 2HHHK 4BRMA 1JCGA 4CJPA 4DSIA 3VA3A 5J2PA 2OA8A 3R8EA 3T3FA 5M1KA 1BG3A 3NVKA 4MDAA 2B5JA 4BDPA 4IFVA 1BA1A 1X1PA 3L8BA 5J2QA 3OS2A 4O5FA 3ZCMA 4BQLA 1VHXA 4BC4A 1EWQA 4K25A 3LM9A 3NBPA 1HPZA 4K42A 4MQ3A 3H1QA 1UOCA 2Z1JA 5AQRA 2IS3A 1C0UA 1TKXA 3AVAA 5TKWA 4FJHA 2FSNA 5JLFA 3P38A 4EHTA 1RTJA 2QWLA 3RR8A 5M1NA 1IG9A 3EKUA 4BDZA 4E3SA 3HZ6A 1NGAA 1ATRA 1Q9YA 3CCEN 1NGDA 1HYVA 3VESA 3VQBA 4K41A 1TKDA 2RN2A 4CHNA 4DR7K 1SAZA 4DQSA 3I33A 3P83D 1NOYA 1MA9B 1C6VA 1XHXA 3C65A 4I7FA 4FJ7A 4M3WA 1QSLA 5F2RA 1OH7A 4FK4A 4RCHA 2HHWA 2V52B 4CGJA 3ID8A 2QKKA 4FWQA 4W5RA 3M5RA 2HMPA 3A5LC 3CMEN 5CE3A 2VG5A 2V7YA 4ZTJA 4OLAA 1D4XA 2QM1A 2P9KA 2UXCK 4AHTA 3WNFA 3M8QA 1N5YA 5MLCQ 1TV6A 4X66K 3E66A 1NGBA 4QS8A 4KHYA 4DMNA 1LOTB 5AQZA 3DAWA 4DTRA 5C0YA 4DQIA 3VTIA 5DK5A 5DM6L 2QW9A 4DUYK 3D2FB 4BRNA 4I6MB 2HSTA 4JI8K 4BDYA 1LW0A 5LJWA 2FBTA 2JGUA 3CJAA 1YVUA 1JLEA 2O8EA 4B1XB 3E1YA 4Z0UA 1EETA 3SQ2A 2E20A 2P9LA 3CI5A 5GIOA 3NGYA 3OTOK 4DTNA 4CZHA 4H03B 1RT6A 5KRTA 4A61A 3LP1A 2IDOA 1OVQA 3AVNA 3ZSWA 4IJAA 3HOTA 4YDUC 3DJCA 4CFBA 3THYA 3E01A 2GELA 4BRDA 3AGKA 2VG7A 3K5OA 1SL1A 3W0LA 3L2VA 1Q7YO 4K8ZA 1EO1A 1M1KO 4UY8O 1WB9A 1YXQA 2XY6A 4IJNA 4FLVA 1QQCA 2YNGA 4CJ4A 4OKJA 3CPEA 3HBTA 4JRQA 3SI6A 2IOCA 1D9DA 5JS2A 1WAJA 4DSLA 4IFYA 2P9IA 3PSFA 1VQ8N 2EX3A 3QNNA 2PBDA 3KWGA 2GX9A 3AVJA 2VCPA 4PKIA 3L3VA 2B4JA 1NGFA 1VSMA 3OYDA 4FXDA 1HKCA 4DR2K 3C6UA 4M3YA 3VQCA 1YTAA 4DKWA 1RDCA 1JKHA 1KAZA 3KHYA 3PIPL 1NK7A 3AO4A 4KTZA 4CIGA 1JL2A 4DWIA 1S3XA 1ZBHA 3NMUA 4B9VA 3G6EN 4CJSA 4AQYK 1NGJA 1E4GT 1FW6A 2CGJA 4FJJA 3LDQA 5BN9A 3AVFA 2UXBK 3T1AA 1QE1A 2JWLA 3G10A 1I39A 2QWRA 3O4QA 5AFUA 1T6CA 5D3GA 4KRFA 3IG1A 4CEBA 5AZIA 4CF0A 3HXMA 1Q81O 4AH9A 4YOVA 3HL8A 4DU3A 2KLAA 3HK2A 4K0KK 4BE1A 4M3ZA 1TKTA 3DRRA 4FPAA 2G8FA 2BE2A 3QLHA 4KPYA 2AA4A 2QXFA 3U9DA 2OYQA 4AM7A 4GV6A 1GLEG 3EKSA 1CXUA 3MDQA 3MECA 1X9WA 3MN6A 4FW2A 1XQSC 3K9KA 4FWMA 1B92A 4F2SA 1TKZA 4WFNL 5C2DA 1BIUA 5T7BA 2ASOA 1X3NA 2CGKA 3PX0A 1ZBFA 3K2PA 2P9KB 4CEZA 4O55A 2J4RA 4CHPA 5HOOA 3I8DA 4H5RA 3MMVA 4O4GA 2Q31A 3P4IA 4B8CA 1TAQA 2BANA 1WSHA 4KV8A 4W5NA 4CIEA 3FZKA 3LPUA 4LH5A 5ADXH
chains in the Genus database with same CATH topology
1EP4A 1QS4A 4W5OA 4B9TA 4FLZA 1L3VA 1IO2A 3HO1A 1A5VA 1U47A 1C1CA 3CQ8A 1IKXA 3PV8A 1X9MA 3LWLA 1W9HA 1QSSA 2XRIA 4E0DA 3AVMA 3TARA 3DLRA 3AVGA 3SPZA 4E7HA 2DTUA 4C8OA 1R0AA 3I0SA 3DLHA 4DFMA 1GOBA 3CG7A 4C8LA 1JXBA 4N5SA 4FJ5A 3S3MA 3L2UA 3QIPA 4FJ9A 3O4NA 4AHRA 4FJNA 5HROA 2X6SA 4AHVA 1HJRA 3KD1E 1KVAA 3S9HA 2DFFA 1Z25A 1RT7A 3PUFA 3QIOA 3U3GA 2Z1IA 4GVMA 3O3HA 1VSLA 1U45A 1LW2A 3LP3A 1ZYQA 4CJRA 4OGEA 4B08A 3KK3A 1XI1A 3VQ5A 1NK8A 3AO2A 3OYIA 4PY5A 4ID1A 1S1XA 4KREA 3AO1A 3AA4A 1S1VA 4GMJB 3O3GA 4J2DA 3SQ1A 4Y1DA 4H4MA 4W5QA 4HHTA 1FKPA 1RDDA 2A1RA 3LWMA 3TR8A 4Z4HA 2HVIA 2PY5A 1WNSA 4FK0A 3NF7A 5C24A 3DM2A 4N41A 4CK2A 1U49A 4F3OA 2BGGA 3V6DA 2O4IA 1HYZA 4CEEA 1KVBA 2OPRA 3KIOA 1RT3A 1IKVA 4CE9A 1RBSA 2Z1GA 4CIFA 4DF4A 3LP2A 4FZXC 4QCLA 3SPYA 1RILA 3OY9A 1NKCA 4E1NA 1DTTA 2VWKA 4E89A 1S9EA 1WSIA 2FC0A 4LD0A 3HP9A 5KGXA 2W42A 4B9SA 4M3XA 3LDSA 4CJ5A 2E6LA 4CJKA 2X74A 2XO7A 2XHBA 3OS1A 1RDBA 1U04A 3OS0A 3MEDA 4W5TA 3C95A 4F2RA 1NK0A 4EZ9A 4CGGA 5HBMA 3LP0A 3LZJA 1WSGA 2P5GA 5FRMA 3H08A 2NUBA 3ZSYA 2A1SA 4N56A 1QTMA 4RW8A 3TI0A 3DOLA 1HYSA 3C6TA 3O3FA 4CESA 2G8UA 1FKOA 2I5JA 5KTQA 3HM9A 1HQEA 4DTPA 3VQAA 3BDPA 3HPOA 1DLOA 5J2MA 3VN5A 4OPKA 1C0TA 1GOAA 4FCYA 1BI4A 4QOZB 1LWCA 4N47A 3V1OA 4CK3A 4M42A 1ASVA 3AVIA 4CJEA 3DMJA 2Q3SA 1SKWA 4O5BA 1RBTA 4DS5A 4Q0BA 3OYFA 3V4IA 3V1RA 1JLQA 4PWDA 3V9UA 5JS1A 4M45A 4FLXA 5KRSA 1WAFA 3SYZA 4EZ6A 4KHQA 1O1WA 5FRNA 3VQQA 1NJWA 2KFZA 3MXIA 3NAEA 4E7JA 3DRSA 4FJGA 1RBUA 4KB0A 4CJQA 4IBNA 1ASUA 4M3RA 3PY8A 1BQMA 1NK5A 2YKNA 2G8VA 3T19A 4FYDA 3ZSZA 4OPJA 4KB1A 3OYLA 1CLQA 1S6PA 4B3OA 2DFHA 2YKMA 3DLEA 3OYHA 4FZYA 1XHZA 1FK9A 1UA1A 4NYNA 3L2RA 3KJVA 3M8SA 1WSFA 1F21A 4R5PA 3KLFA 3PO5A 5CY4A 4BACA 1RBVA 4HTUA 1D8YA 1T7PA 1RTHA 2XY8A 5EU7A 3VQPA 3DI6A 1YT3A 4CGIA 4JRPA 4E1MA 1VSDA 3NCIA 3KTQA 4FLTA 4DS4A 3D45A 3IS9A 5KI6A 3QEVA 1TK0A 3OYCA 3PO4A 4DSFA 4CFCA 4E7LA 5HLFA 4FM2A 3NF8A 4HCCA 2HHSA 3ZSXA 4CEAA 2OZSA 3RMBA 3QNOA 1KLMA 4I9LA 4FJLA 3CM5A 4DLGA 4I2QA 1Q8IA 4B8AB 3VQ7A 3SNNA 1T8EA 3QINA 3OVNA 5HRRA 4J2AA 1JLGA 3D0PA 4F8RA 5DMRA 1RCHA 3K5NA 4M3UA 3TABA 3AVBA 3OYEA 1NJXA 1EKEA 2G8IA 1RT2A 1A5XA 2YNIA 3ZSVA 2JLEA 4PQUA 4AHCA 4NCAA 2D5RA 1TL3A 3KKSA 1CZBA 5CYMA 4CHOA 3EZ5A 4DTJA 3RWUA 3SV4A 2IGIA 3AV9A 2ETJA 3SCXA 5HP1A 3ZT0A 1UAXA 3V9SA 1KLNA 4OJRA 1LAWA 3ALYA 1U4BA 4F4KA 1J54A 3L3UA 3HVTA 3AA3A 3U3YA 1KCFA 1SUQA 4KKOA 4Z4EA 4PUOA 3NF9A 3VQ8A 4DSKA 4KHSA 3NFAA 4OVLA 3LAMA 3DLKA 4KHUA 1LAVA 4RW7A 4CJPA 4DSIA 3VA3A 4O44A 5J2PA 3NH2A 4CEQA 4KTWA 2OA8A 2VG6A 4AHSA 5HRPA 5HRNA 1VSKA 5I3UA 3T3FA 4JS5A 4JS4A 1JXEA 1TVRA 2D0BA 1KRPA 4IG0A 4Z4IA 3AO5A 1VSHA 2HB5A 4AILC 2B5JA 2IC3A 4BDPA 4IFVA 1KSPA 4KFBA 1BCOA 1X1PA 5CZ1A 3NDKA 4UQGA 4Q5VA 3L8BA 4N76A 2X78A 3OJUA 3OS2A 5J2QA 3MXMA 3THVA 3ZCMA 3LALA 1LWEA 3ZT1A 2DY4A 4B9UA 1JLCA 1UWBA 3DOKA 4OKEA 1UA0A 2GBZA 3KD5E 1NK6A 3NBPA 4Z4GA 1HPZA 1JLFA 4HUEA 4BWJA 3B6PA 4MQ3A 5E41A 3K5MA 4BE2A 1UOCA 4H4OA 3OYMA 2Z1JA 2IS3A 4ID5A 4I2PA 2QKBA 3SUOA 4LH4A 4CK1A 4ZTFA 1C0UA 1TKXA 3AVAA 3DLGA 1CXQA 3K57A 1SV5A 4BE0A 4FJHA 1VK0A 4I9QA 3HPGA 3ZT2A 3OYBA 4XIUA 4Z4CA 2F8SA 3QO9A 4DF8A 3V9WA 4L8RB 2RF2A 4FJIA 1QSYA 4ELVA 2DFEA 4CHQA 1RTJA 3RR8A 2KZZA 3ZSOA 4FJXA 2ATQA 4RG8A 1VRTA 1IG9A 4BDZA 1D5AA 3CFPA 4Y1CA 4DU1A 4E3SA 2RKIA 1SKSA 1HNIA 2WOMA 1Q9YA 2O4GA 1HYVA 5J2NA 1RNHA 4FJKA 3VQBA 1S1WA 3ZT3A 2HHXA 1TKDA 2RN2A 1VRUA 4CHNA 4LSNA 4DQSA 1NJZA 3ITHA 4HCBA 1VSJA 1NKEA 3P83D 1NOYA 3SUQA 1XHXA 1C6VA 3OYKA 1Y97A 3TAEA 4CJWA 4I7FA 3DLBA 3OJSA 2KFNA 4DFJA 1ASWA 4O0JA 4FJ7A 4KI6A 4M3WA 3PX6A 3NE6A 3TAFA 4BWMA 1QSLA 2GV9A 1VSFA 1IKYA 4DTUA 4YNQA 1Q9XA 4FK4A 2HHWA 4CGJA 1HRHA 3V1QA 2G8HA 2QKKA 3LANA 3AO3A 4W5RA 2HHTA 4M41A 4CERA 1RDAA 1TK5A 5C25A 3SUPA 1C1BA 2ZE2A 2VG5A 2RPIA 4CFAA 4FM0A 3TAQA 3BGRA 4ZTJA 1BGXT 4OLAA 3V81A 4CEFA 1T03A 4AHTA 3KKRA 3WNFA 1BI4B 3VQ9A 3M8QA 3WNHA 3L2QA 4CECA 1N5YA 4E19A 1TV6A 1S6QA 4E7KA 4KHYA 3SQ4A 4DMNA 2R7YA 4DQQA 5CZ2A 1HQUA 1KVCA 3ISNC 4DTRA 1ZBIA 2PYJA 2XY7A 4DQIA 4KTQA 5DK5A 4CEOA 4FK2A 3QETA 4DG1A 4RW9A 4QAGA 1FXXA 2HW3A 1IH7A 3CYMA 3EY1A 3SZ2A 2KQ2A 2KW4A 1C1AA 4BDYA 3MEEA 1LW0A 4CGHA 4ZHRA 2FBTA 3KLEA 2JGUA 5FROA 2E6MA 2D0CA 2HHQA 4OLBA 4DTMA 1YVUA 1JLEA 2HVHA 1S1TA 1EX4A 4CF9A 4DTSA 3DYAA 5I42A 4IKFA 4FJ8A 4Z0UA 3AVKA 3VQ6A 1B9FA 4CF8A 1EETA 3AVCA 2VWJA 1ITGA 4KI4A 2OPQA 2PYLA 3SQ2A 1XC9A 3K5LA 3NGYA 3KLIA 2HNDA 1QHTA 4EP5A 3PX4A 2P1JA 3CM6A 4CGDA 4DTOA 3MXJA 1TK8A 2IAJA 4DSEA 4DTNA 1RT6A 4KO0A 5KRTA 3LZIA 3LP1A 3HYFA 1RT4A 4GW6A 4IG3A 1WLJA 2IDOA 3K58A 3WNGA 3AVNA 3HVRA 1HMVA 3ZSWA 1U48A 4KHNA 3AVLA 1TAUA 1EXQA 4CFBA 4NCGA 1DTQA 3QESA 3OYGA 3E01A 3KLGA 1BISA 1MU2A 4RW4A 5SZTA 3KK2A 2Y1IA 3S3OA 3I0RA 3TAPA 3HJFA 2VG7A 3TAMA 4FW1A 1S9GA 4MFBA 3K5OA 2FBYA 4LSLA 4FLYA 1TGOA 3HT3A 3L2VA 1KTQA 5SWMA 1SL1A 4C8KA 1WN7A 4JLHA 1VSIA 4DSJA 3ZSQA 4K8ZA 4OGCA 4DLEA 2HHUA 3NGIA 3OYAA 3V9XA 1L3TA 2P51A 2XY6A 1SL2A 3SJJA 1BHLA 3MEGA 3KK1A 1GOCA 4FJMA 2B6AA 2YNFA 1JLBA 4E7IA 4FLVA 1QQCA 1B9DA 2YNGA 5J1EA 2HNZA 3AVHA 2Y1JA 4B9MA 2QK9A 4YFUA 4CJ4A 3OYJA 4OKJA 3KLHA 1W0HA 3CFRA 4DFKA 3NF6A 4DFPA 4JRQA 1VSEA 3QEIA 3SV3A 2IOCA 3SI6A 1NJYA 4IDKA 4H8KA 2HNYA 4CJLA 1D9DA 1NK4A 2KTQA 3TWHA 3WNEA 5JS2A 1WAJA 2G8WA 2BDPA 1NKBA 4IFYA 4DSLA 2F96A 4J2BA 1BQNA 1YTUA 3ULDA 2EX3A 4HUGA 3M8PA 3VA0A 4ICLA 4B9LA 3QNNA 4CCHA 2AJQA 3AA5X 2HMIA 3AVJA 1RT1A 1RTIA 3HP6A 2G8KA 3VQDA 3L3VA 2B4JA 1TL1A 5K14A 4O0IA 3QEPA 1KFDA 1VSMA 3C94A 1ZBUA 3NHGA 2OPPA 3OYDA 4NCBA 4FXDA 1NK9A 1LV5A 3C6UA 2PZSA 1L3SA 4M3YA 1J53A 3VQCA 1RT5A 1YTAA 2KZMA 2FBXA 2Z1HA 1I3AA 1WSEA 3SQ0A 4KAZA 1RDCA 1JKHA 2ZD1A 2E4LA 3RRHA 4M3TA 1A5WA 1XWLA 3RTVA 1NK7A 2P5OA 1S1UA 3AO4A 4KTZA 4CIGA 4OKKA 4HUFA 1JL2A 2ITGA 4DWIA 1SL0A 1ZBHA 3QEXA 3HSTB 3B6OA 4B9VA 1Z26A 4DU4A 4CJSA 1L3UA 3NH1A 1RBRA 3TAGA 1RTDA 3ZT4A 3TANA 1HNVA 2WONA 4CJVA 3S3NA 4FJJA 2YV0X 3AVFA 2OZMA 3DRPA 2XY5A 3T1AA 4CHYA 1QE1A 4EP4A 3G10A 2X6NA 1I39A 3O4QA 4FVMA 3F9KA 4CF1A 5D3GA 2EHGA 1CZ9A 3MAQA 4KRFA 3IG1A 4CEBA 4CF2A 3F73A 1C0MA 3VQ4A 3NH0A 4FLWA 3JYTA 5C42A 3ASMA 4CF0A 1L5UA 1KFSA 5CYQA 1IKWA 3HXMA 3P5JA 3IRXA 2YNHA 2LSNA 4AH9A 4DU3A 3HL8A 2F8TA 2HHVA 4WE1A 4K8XA 2ZQBA 3HK2A 4BE1A 3V9ZA 4M3ZA 3M8RA 1TKTA 3DRRA 3IAYA 4F3TA 1REVA 3RMAA 2G8FA 1BL3A 2BE2A 4J2EA 3QERA 4B9NA 1WSJA 3LAKA 3QLHA 4KPYA 2QXFA 3P1GA 3QEWA 1T05A 3OYNA 2OYQA 3EYZA 1BIZA 3VQEA 1JLAA 4C8NA 1SKRA 4NYFA 1CXUA 3MECA 3CFOA 4PA1A 1J9AA 4CHZA 4CJFA 3L2WA 3RMDA 1X9WA 4DQPA 3FFIA 4CGFA 4KHWA 4FW2A 3K59A 4FLUA 1X9SA 1NOZA 1B92A 4G1QA 1TKZA 4F2SA 4HVJA 3HPHA 4DTXA 2D0AA 4FM1A 1BIUA 5T7BA 4CJUA 4FZZA 5FDLA 5HRSA 4CJTA 4ELTA 4CJ3A 4ELUA 3U6FA 3PX0A 3RR7A 1ZBFA 3K2PA 1ZBLA 1D9FA 4TSXA 3RMCA 2YHAA 4CEZA 3G0ZA 4O55A 1K6YA 5KGWA 4LY7A 4CHPA 3I8DA 4CEDA 4O4GA 3ZSRA 4AHUA 4C8MA 2YHBA 1G15A 4B8CA 1BCMA 4CFDA 4Z4FA 1N6QA 1S5JA 3UIQA 4DQRA 1TAQA 2BANA 2FBVA 3NGZA 2OPSA 3SUNA 3LPTA 2GUIA 1WSHA 3JSMA 4KV8A 3A2FA 4RW6A 3RRGA 4CIEA 4W5NA 1J5OA 3AA2A 3LPUA 1LWFA 1JL1A 4LH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP4 A;  1QS4 A;  4W5O A;  4B9T A;  4FLZ A;  1L3V A;  1IO2 A;  3HO1 A;  1A5V A;  1U47 A;  1C1C A;  3CQ8 A;  1IKX A;  3PV8 A;  1X9M A;  3LWL A;  1W9H A;  1QSS A;  2XRI A;  4E0D A;  3AVM A;  3TAR A;  3DLR A;  3AVG A;  3SPZ A;  4E7H A;  2DTU A;  4C8O A;  1R0A A;  3I0S A;  3DLH A;  4DFM A;  1GOB A;  3CG7 A;  4C8L A;  1JXB A;  4N5S A;  4FJ5 A;  3S3M A;  3L2U A;  3QIP A;  4FJ9 A;  3O4N A;  4AHR A;  4FJN A;  5HRO A;  2X6S A;  4AHV A;  1HJR A;  3KD1 E;  1KVA A;  3S9H A;  2DFF A;  1Z25 A;  1RT7 A;  3PUF A;  3QIO A;  3U3G A;  2Z1I A;  4GVM A;  3O3H A;  1VSL A;  1U45 A;  1LW2 A;  3LP3 A;  1ZYQ A;  4CJR A;  4OGE A;  4B08 A;  3KK3 A;  1XI1 A;  3VQ5 A;  1NK8 A;  3AO2 A;  3OYI A;  4PY5 A;  4ID1 A;  1S1X A;  4KRE A;  3AO1 A;  3AA4 A;  1S1V A;  4GMJ B;  3O3G A;  4J2D A;  3SQ1 A;  4Y1D A;  4H4M A;  4W5Q A;  4HHT A;  1FKP A;  1RDD A;  2A1R A;  3LWM A;  3TR8 A;  4Z4H A;  2HVI A;  2PY5 A;  1WNS A;  4FK0 A;  3NF7 A;  5C24 A;  3DM2 A;  4N41 A;  4CK2 A;  1U49 A;  4F3O A;  2BGG A;  3V6D A;  2O4I A;  1HYZ A;  4CEE A;  1KVB A;  2OPR A;  3KIO A;  1RT3 A;  1IKV A;  4CE9 A;  1RBS A;  2Z1G A;  4CIF A;  4DF4 A;  3LP2 A;  4FZX C;  4QCL A;  3SPY A;  1RIL A;  3OY9 A;  1NKC A;  4E1N A;  1DTT A;  2VWK A;  4E89 A;  1S9E A;  1WSI A;  2FC0 A;  4LD0 A;  3HP9 A;  5KGX A;  2W42 A;  4B9S A;  4M3X A;  3LDS A;  4CJ5 A;  2E6L A;  4CJK A;  2X74 A;  2XO7 A;  2XHB A;  3OS1 A;  1RDB A;  1U04 A;  3OS0 A;  3MED A;  4W5T A;  3C95 A;  4F2R A;  1NK0 A;  4EZ9 A;  4CGG A;  5HBM A;  3LP0 A;  3LZJ A;  1WSG A;  2P5G A;  5FRM A;  3H08 A;  2NUB A;  3ZSY A;  2A1S A;  4N56 A;  1QTM A;  4RW8 A;  3TI0 A;  3DOL A;  1HYS A;  3C6T A;  3O3F A;  4CES A;  2G8U A;  1FKO A;  2I5J A;  5KTQ A;  3HM9 A;  1HQE A;  4DTP A;  3VQA A;  3BDP A;  3HPO A;  1DLO A;  5J2M A;  3VN5 A;  4OPK A;  1C0T A;  1GOA A;  4FCY A;  1BI4 A;  4QOZ B;  1LWC A;  4N47 A;  3V1O A;  4CK3 A;  4M42 A;  1ASV A;  3AVI A;  4CJE A;  3DMJ A;  2Q3S A;  1SKW A;  4O5B A;  1RBT A;  4DS5 A;  4Q0B A;  3OYF A;  3V4I A;  3V1R A;  1JLQ A;  4PWD A;  3V9U A;  5JS1 A;  4M45 A;  4FLX A;  5KRS A;  1WAF A;  3SYZ A;  4EZ6 A;  4KHQ A;  1O1W A;  5FRN A;  3VQQ A;  1NJW A;  2KFZ A;  3MXI A;  3NAE A;  4E7J A;  3DRS A;  4FJG A;  1RBU A;  4KB0 A;  4CJQ A;  4IBN A;  1ASU A;  4M3R A;  3PY8 A;  1BQM A;  1NK5 A;  2YKN A;  2G8V A;  3T19 A;  4FYD A;  3ZSZ A;  4OPJ A;  4KB1 A;  3OYL A;  1CLQ A;  1S6P A;  4B3O A;  2DFH A;  2YKM A;  3DLE A;  3OYH A;  4FZY A;  1XHZ A;  1FK9 A;  1UA1 A;  4NYN A;  3L2R A;  3KJV A;  3M8S A;  1WSF A;  1F21 A;  4R5P A;  3KLF A;  3PO5 A;  5CY4 A;  4BAC A;  1RBV A;  4HTU A;  1D8Y A;  1T7P A;  1RTH A;  2XY8 A;  5EU7 A;  3VQP A;  3DI6 A;  1YT3 A;  4CGI A;  4JRP A;  4E1M A;  1VSD A;  3NCI A;  3KTQ A;  4FLT A;  4DS4 A;  3D45 A;  3IS9 A;  5KI6 A;  3QEV A;  1TK0 A;  3OYC A;  3PO4 A;  4DSF A;  4CFC A;  4E7L A;  5HLF A;  4FM2 A;  3NF8 A;  4HCC A;  2HHS A;  3ZSX A;  4CEA A;  2OZS A;  3RMB A;  3QNO A;  1KLM A;  4I9L A;  4FJL A;  3CM5 A;  4DLG A;  4I2Q A;  1Q8I A;  4B8A B;  3VQ7 A;  3SNN A;  1T8E A;  3QIN A;  3OVN A;  5HRR A;  4J2A A;  1JLG A;  3D0P A;  4F8R A;  5DMR A;  1RCH A;  3K5N A;  4M3U A;  3TAB A;  3AVB A;  3OYE A;  1NJX A;  1EKE A;  2G8I A;  1RT2 A;  1A5X A;  2YNI A;  3ZSV A;  2JLE A;  4PQU A;  4AHC A;  4NCA A;  2D5R A;  1TL3 A;  3KKS A;  1CZB A;  5CYM A;  4CHO A;  3EZ5 A;  4DTJ A;  3RWU A;  3SV4 A;  2IGI A;  3AV9 A;  2ETJ A;  3SCX A;  5HP1 A;  3ZT0 A;  1UAX A;  3V9S A;  1KLN A;  4OJR A;  1LAW A;  3ALY A;  1U4B A;  4F4K A;  1J54 A;  3L3U A;  3HVT A;  3AA3 A;  3U3Y A;  1KCF A;  1SUQ A;  4KKO A;  4Z4E A;  4PUO A;  3NF9 A;  3VQ8 A;  4DSK A;  4KHS A;  3NFA A;  4OVL A;  3LAM A;  3DLK A;  4KHU A;  1LAV A;  4RW7 A;  4CJP A;  4DSI A;  3VA3 A;  4O44 A;  5J2P A;  3NH2 A;  4CEQ A;  4KTW A;  2OA8 A;  2VG6 A;  4AHS A;  5HRP A;  5HRN A;  1VSK A;  5I3U A;  3T3F A;  4JS5 A;  4JS4 A;  1JXE A;  1TVR A;  2D0B A;  1KRP A;  4IG0 A;  4Z4I A;  3AO5 A;  1VSH A;  2HB5 A;  4AIL C;  2B5J A;  2IC3 A;  4BDP A;  4IFV A;  1KSP A;  4KFB A;  1BCO A;  1X1P A;  5CZ1 A;  3NDK A;  4UQG A;  4Q5V A;  3L8B A;  4N76 A;  2X78 A;  3OJU A;  3OS2 A;  5J2Q A;  3MXM A;  3THV A;  3ZCM A;  3LAL A;  1LWE A;  3ZT1 A;  2DY4 A;  4B9U A;  1JLC A;  1UWB A;  3DOK A;  4OKE A;  1UA0 A;  2GBZ A;  3KD5 E;  1NK6 A;  3NBP A;  4Z4G A;  1HPZ A;  1JLF A;  4HUE A;  4BWJ A;  3B6P A;  4MQ3 A;  5E41 A;  3K5M A;  4BE2 A;  1UOC A;  4H4O A;  3OYM A;  2Z1J A;  2IS3 A;  4ID5 A;  4I2P A;  2QKB A;  3SUO A;  4LH4 A;  4CK1 A;  4ZTF A;  1C0U A;  1TKX A;  3AVA A;  3DLG A;  1CXQ A;  3K57 A;  1SV5 A;  4BE0 A;  4FJH A;  1VK0 A;  4I9Q A;  3HPG A;  3ZT2 A;  3OYB A;  4XIU A;  4Z4C A;  2F8S A;  3QO9 A;  4DF8 A;  3V9W A;  4L8R B;  2RF2 A;  4FJI A;  1QSY A;  4ELV A;  2DFE A;  4CHQ A;  1RTJ A;  3RR8 A;  2KZZ A;  3ZSO A;  4FJX A;  2ATQ A;  4RG8 A;  1VRT A;  1IG9 A;  4BDZ A;  1D5A A;  3CFP A;  4Y1C A;  4DU1 A;  4E3S A;  2RKI A;  1SKS A;  1HNI A;  2WOM A;  1Q9Y A;  2O4G A;  1HYV A;  5J2N A;  1RNH A;  4FJK A;  3VQB A;  1S1W A;  3ZT3 A;  2HHX A;  1TKD A;  2RN2 A;  1VRU A;  4CHN A;  4LSN A;  4DQS A;  1NJZ A;  3ITH A;  4HCB A;  1VSJ A;  1NKE A;  3P83 D;  1NOY A;  3SUQ A;  1XHX A;  1C6V A;  3OYK A;  1Y97 A;  3TAE A;  4CJW A;  4I7F A;  3DLB A;  3OJS A;  2KFN A;  4DFJ A;  1ASW A;  4O0J A;  4FJ7 A;  4KI6 A;  4M3W A;  3PX6 A;  3NE6 A;  3TAF A;  4BWM A;  1QSL A;  2GV9 A;  1VSF A;  1IKY A;  4DTU A;  4YNQ A;  1Q9X A;  4FK4 A;  2HHW A;  4CGJ A;  1HRH A;  3V1Q A;  2G8H A;  2QKK A;  3LAN A;  3AO3 A;  4W5R A;  2HHT A;  4M41 A;  4CER A;  1RDA A;  1TK5 A;  5C25 A;  3SUP A;  1C1B A;  2ZE2 A;  2VG5 A;  2RPI A;  4CFA A;  4FM0 A;  3TAQ A;  3BGR A;  4ZTJ A;  1BGX T;  4OLA A;  3V81 A;  4CEF A;  1T03 A;  4AHT A;  3KKR A;  3WNF A;  1BI4 B;  3VQ9 A;  3M8Q A;  3WNH A;  3L2Q A;  4CEC A;  1N5Y A;  4E19 A;  1TV6 A;  1S6Q A;  4E7K A;  4KHY A;  3SQ4 A;  4DMN A;  2R7Y A;  4DQQ A;  5CZ2 A;  1HQU A;  1KVC A;  3ISN C;  4DTR A;  1ZBI A;  2PYJ A;  2XY7 A;  4DQI A;  4KTQ A;  5DK5 A;  4CEO A;  4FK2 A;  3QET A;  4DG1 A;  4RW9 A;  4QAG A;  1FXX A;  2HW3 A;  1IH7 A;  3CYM A;  3EY1 A;  3SZ2 A;  2KQ2 A;  2KW4 A;  1C1A A;  4BDY A;  3MEE A;  1LW0 A;  4CGH A;  4ZHR A;  2FBT A;  3KLE A;  2JGU A;  5FRO A;  2E6M A;  2D0C A;  2HHQ A;  4OLB A;  4DTM A;  1YVU A;  1JLE A;  2HVH A;  1S1T A;  1EX4 A;  4CF9 A;  4DTS A;  3DYA A;  5I42 A;  4IKF A;  4FJ8 A;  4Z0U A;  3AVK A;  3VQ6 A;  1B9F A;  4CF8 A;  1EET A;  3AVC A;  2VWJ A;  1ITG A;  4KI4 A;  2OPQ A;  2PYL A;  3SQ2 A;  1XC9 A;  3K5L A;  3NGY A;  3KLI A;  2HND A;  1QHT A;  4EP5 A;  3PX4 A;  2P1J A;  3CM6 A;  4CGD A;  4DTO A;  3MXJ A;  1TK8 A;  2IAJ A;  4DSE A;  4DTN A;  1RT6 A;  4KO0 A;  5KRT A;  3LZI A;  3LP1 A;  3HYF A;  1RT4 A;  4GW6 A;  4IG3 A;  1WLJ A;  2IDO A;  3K58 A;  3WNG A;  3AVN A;  3HVR A;  1HMV A;  3ZSW A;  1U48 A;  4KHN A;  3AVL A;  1TAU A;  1EXQ A;  4CFB A;  4NCG A;  1DTQ A;  3QES A;  3OYG A;  3E01 A;  3KLG A;  1BIS A;  1MU2 A;  4RW4 A;  5SZT A;  3KK2 A;  2Y1I A;  3S3O A;  3I0R A;  3TAP A;  3HJF A;  2VG7 A;  3TAM A;  4FW1 A;  1S9G A;  4MFB A;  3K5O A;  2FBY A;  4LSL A;  4FLY A;  1TGO A;  3HT3 A;  3L2V A;  1KTQ A;  5SWM A;  1SL1 A;  4C8K A;  1WN7 A;  4JLH A;  1VSI A;  4DSJ A;  3ZSQ A;  4K8Z A;  4OGC A;  4DLE A;  2HHU A;  3NGI A;  3OYA A;  3V9X A;  1L3T A;  2P51 A;  2XY6 A;  1SL2 A;  3SJJ A;  1BHL A;  3MEG A;  3KK1 A;  1GOC A;  4FJM A;  2B6A A;  2YNF A;  1JLB A;  4E7I A;  4FLV A;  1QQC A;  1B9D A;  2YNG A;  5J1E A;  2HNZ A;  3AVH A;  2Y1J A;  4B9M A;  2QK9 A;  4YFU A;  4CJ4 A;  3OYJ A;  4OKJ A;  3KLH A;  1W0H A;  3CFR A;  4DFK A;  3NF6 A;  4DFP A;  4JRQ A;  1VSE A;  3QEI A;  3SV3 A;  2IOC A;  3SI6 A;  1NJY A;  4IDK A;  4H8K A;  2HNY A;  4CJL A;  1D9D A;  1NK4 A;  2KTQ A;  3TWH A;  3WNE A;  5JS2 A;  1WAJ A;  2G8W A;  2BDP A;  1NKB A;  4IFY A;  4DSL A;  2F96 A;  4J2B A;  1BQN A;  1YTU A;  3ULD A;  2EX3 A;  4HUG A;  3M8P A;  3VA0 A;  4ICL A;  4B9L A;  3QNN A;  4CCH A;  2AJQ A;  3AA5 X;  2HMI A;  3AVJ A;  1RT1 A;  1RTI A;  3HP6 A;  2G8K A;  3VQD A;  3L3V A;  2B4J A;  1TL1 A;  5K14 A;  4O0I A;  3QEP A;  1KFD A;  1VSM A;  3C94 A;  1ZBU A;  3NHG A;  2OPP A;  3OYD A;  4NCB A;  4FXD A;  1NK9 A;  1LV5 A;  3C6U A;  2PZS A;  1L3S A;  4M3Y A;  1J53 A;  3VQC A;  1RT5 A;  1YTA A;  2KZM A;  2FBX A;  2Z1H A;  1I3A A;  1WSE A;  3SQ0 A;  4KAZ A;  1RDC A;  1JKH A;  2ZD1 A;  2E4L A;  3RRH A;  4M3T A;  1A5W A;  1XWL A;  3RTV A;  1NK7 A;  2P5O A;  1S1U A;  3AO4 A;  4KTZ A;  4CIG A;  4OKK A;  4HUF A;  1JL2 A;  2ITG A;  4DWI A;  1SL0 A;  1ZBH A;  3QEX A;  3HST B;  3B6O A;  4B9V A;  1Z26 A;  4DU4 A;  4CJS A;  1L3U A;  3NH1 A;  1RBR A;  3TAG A;  1RTD A;  3ZT4 A;  3TAN A;  1HNV A;  2WON A;  4CJV A;  3S3N A;  4FJJ A;  2YV0 X;  3AVF A;  2OZM A;  3DRP A;  2XY5 A;  3T1A A;  4CHY A;  1QE1 A;  4EP4 A;  3G10 A;  2X6N A;  1I39 A;  3O4Q A;  4FVM A;  3F9K A;  4CF1 A;  5D3G A;  2EHG A;  1CZ9 A;  3MAQ A;  4KRF A;  3IG1 A;  4CEB A;  4CF2 A;  3F73 A;  1C0M A;  3VQ4 A;  3NH0 A;  4FLW A;  3JYT A;  5C42 A;  3ASM A;  4CF0 A;  1L5U A;  1KFS A;  5CYQ A;  1IKW A;  3HXM A;  3P5J A;  3IRX A;  2YNH A;  2LSN A;  4AH9 A;  4DU3 A;  3HL8 A;  2F8T A;  2HHV A;  4WE1 A;  4K8X A;  2ZQB A;  3HK2 A;  4BE1 A;  3V9Z A;  4M3Z A;  3M8R A;  1TKT A;  3DRR A;  3IAY A;  4F3T A;  1REV A;  3RMA A;  2G8F A;  1BL3 A;  2BE2 A;  4J2E A;  3QER A;  4B9N A;  1WSJ A;  3LAK A;  3QLH A;  4KPY A;  2QXF A;  3P1G A;  3QEW A;  1T05 A;  3OYN A;  2OYQ A;  3EYZ A;  1BIZ A;  3VQE A;  1JLA A;  4C8N A;  1SKR A;  4NYF A;  1CXU A;  3MEC A;  3CFO A;  4PA1 A;  1J9A A;  4CHZ A;  4CJF A;  3L2W A;  3RMD A;  1X9W A;  4DQP A;  3FFI A;  4CGF A;  4KHW A;  4FW2 A;  3K59 A;  4FLU A;  1X9S A;  1NOZ A;  1B92 A;  4G1Q A;  1TKZ A;  4F2S A;  4HVJ A;  3HPH A;  4DTX A;  2D0A A;  4FM1 A;  1BIU A;  5T7B A;  4CJU A;  4FZZ A;  5FDL A;  5HRS A;  4CJT A;  4ELT A;  4CJ3 A;  4ELU A;  3U6F A;  3PX0 A;  3RR7 A;  1ZBF A;  3K2P A;  1ZBL A;  1D9F A;  4TSX A;  3RMC A;  2YHA A;  4CEZ A;  3G0Z A;  4O55 A;  1K6Y A;  5KGW A;  4LY7 A;  4CHP A;  3I8D A;  4CED A;  4O4G A;  3ZSR A;  4AHU A;  4C8M A;  2YHB A;  1G15 A;  4B8C A;  1BCM A;  4CFD A;  4Z4F A;  1N6Q A;  1S5J A;  3UIQ A;  4DQR A;  1TAQ A;  2BAN A;  2FBV A;  3NGZ A;  2OPS A;  3SUN A;  3LPT A;  2GUI A;  1WSH A;  3JSM A;  4KV8 A;  3A2F A;  4RW6 A;  3RRG A;  4CIE A;  4W5N A;  1J5O A;  3AA2 A;  3LPU A;  1LWF A;  1JL1 A;  4LH5 A; 
#chains in the Genus database with same CATH topology
 1EP4 A;  4LFA K;  4OPH A;  1IV0 A;  4YOU A;  4BVP A;  1X9M A;  1HNW K;  2O8E B;  3AVG A;  3MX2 A;  3TSQ A;  1GOB A;  1NGG A;  2P9L B;  4N5S A;  4FJ5 A;  3L2U A;  4FJN A;  1HLU A;  2X6S A;  4HWI A;  4AHV A;  4B9Q A;  4B3T K;  4DV0 K;  2DFF A;  1Z25 A;  3J80 O;  4DV3 K;  1RT7 A;  3C7N A;  3U3G A;  3O3H A;  3LP3 A;  1XI1 A;  3ID6 A;  3THY B;  3CC2 N;  4PY5 A;  4J2D A;  3D2E A;  1N36 K;  4HHT A;  4MLE A;  2E5L K;  3PIO L;  4JI4 K;  5C12 A;  4N41 A;  5C24 A;  3DM2 A;  4PKG A;  3THW A;  1E4F T;  4CIF A;  2Z1G A;  4FZX C;  3SPY A;  3OBW A;  4M7X A;  1W2B M;  1WSI A;  4WQ5 A;  2W42 A;  5KGX A;  4BR2 A;  3LDS A;  2FXU A;  4EFH A;  1ESV A;  4F2R A;  3MED A;  4W5T A;  3C95 A;  4WCE L;  5HBM A;  3B8A X;  3LZJ A;  2P9I B;  1SS6 A;  5FRM A;  4XH1 A;  5LJV A;  1QTM A;  4RW8 A;  4LF8 K;  4JV5 K;  1HYS A;  3O3F A;  4MDB A;  1T3V A;  1YJN N;  2I5J A;  3HPO A;  1DLO A;  1BUP A;  5J2M A;  2CH6 A;  3WT0 A;  4FCY A;  1XNR K;  4M42 A;  1O13 A;  3AVI A;  3DMJ A;  4FWL A;  1RBT A;  4DS5 A;  4Q0B A;  3V1R A;  1OH8 A;  4BRG A;  4M45 A;  3VEZ A;  4KHQ A;  3VQQ A;  1V4S A;  2WC9 A;  3CJ7 A;  4NB4 A;  4E7J A;  4FJG A;  1RBU A;  4KB0 A;  1XMO K;  3H45 C;  1NK5 A;  2G8V A;  3T19 A;  4FYD A;  4KB1 A;  4B3O A;  5AQY A;  3RSE A;  2DFH A;  3OYH A;  3DLL L;  1UA1 A;  3QBX A;  3L2R A;  5TKY A;  1F21 A;  3KLF A;  3PO5 A;  1RBV A;  1D8Y A;  2GEM A;  5EU7 A;  3VQP A;  5AZI B;  4FLT A;  3KWI A;  1YJW N;  3PO4 A;  4CFC A;  4HCC A;  3IDH A;  3BZK A;  2OZS A;  1KLM A;  2YX6 A;  3JAM O;  1WOQ A;  3E9L A;  4J2A A;  1JLG A;  1TUY A;  3OYE A;  1A5X A;  2YNI A;  2JLE A;  3CCR N;  1J5E K;  4PQU A;  4AHC A;  4BC5 A;  1CZB A;  3RWU A;  4JI2 K;  3SCX A;  3ZT0 A;  1UAX A;  3V9S A;  1KLN A;  4F4K A;  4KKO A;  4CW7 B;  3M3Z A;  4OVL A;  4KHU A;  3SAG A;  1LAV A;  4RW7 A;  3VTH A;  2NLX A;  3FZM A;  3LDO A;  4IOC L;  3DXK B;  5HRP A;  5I3U A;  1JXE A;  2D0B A;  1QQO A;  2FSJ A;  2ITM A;  2IC3 A;  1IJJ A;  1IBM K;  3AGR A;  4UQG A;  4HTL A;  3GBT A;  5FPD A;  1JLC A;  1HJO A;  2FLO A;  4GVE A;  3CCS N;  1NK6 A;  4KBO A;  5GIN A;  4HUE A;  3FZH A;  5E41 A;  4H5T A;  4FL9 A;  2P9U A;  1GLD G;  2QKB A;  3SUO A;  2ZGY A;  4FO0 A;  4A2A A;  4ZTF A;  3DLG A;  3CIP A;  4BE0 A;  1TUU A;  3C7N B;  1VK0 A;  5KPZ A;  3U4L A;  4DR6 K;  3ZT2 A;  4JAX A;  4XIU A;  3EZW A;  1NGE A;  3V9W A;  4FJI A;  2KHO A;  4EIA A;  3T1H K;  5B8H A;  3KVG A;  1T44 A;  3D2E B;  3CFP A;  4Y1C A;  2YCH A;  2RKI A;  5FPM A;  5J2N A;  1T6D A;  4BR9 A;  3THW B;  3VER A;  4BG8 A;  1VRU A;  4LSN A;  5AQX A;  5AQF A;  1VQN N;  1VAZ A;  1Y97 A;  4H0O A;  4H0P A;  4ISE A;  4O0J A;  3ENO A;  2YHY A;  4KI6 A;  3D2F A;  1IKY A;  4YNQ A;  1Q9X A;  4BR0 A;  2RE2 A;  1HRH A;  5KQ8 A;  4M41 A;  3U9Z A;  4DQ8 A;  1QVG M;  5C25 A;  2QXL A;  1OVY A;  4CFA A;  4FM0 A;  3TAQ A;  3BGR A;  4DUZ K;  3O9Q A;  1DKG D;  4FVU A;  3V81 A;  3KKR A;  2NNW A;  3WNH A;  4JKC A;  4CEC A;  4JKB A;  4E7K A;  1GLJ O;  3MN7 A;  2R7Y A;  3ISN C;  1ZBI A;  2IIR A;  2PYJ A;  3EO3 A;  5BR9 A;  4JYA K;  2HBM A;  4H5N A;  4YOR A;  3VMF B;  3QET A;  3P39 A;  3CXC M;  4RW9 A;  3CYM A;  4KH5 A;  3MEE A;  4B1U B;  5LMN K;  2F9T A;  2E6M A;  1HUX A;  1DEJ A;  1HKB A;  5I42 A;  4FJ8 A;  4BR5 A;  3VQ6 A;  3AVC A;  3RSE B;  3K5L A;  4DR1 K;  3VEO A;  3CQX A;  4DTO A;  1TK8 A;  3MXJ A;  2Q0R A;  3BP8 A;  4IEE A;  3LZI A;  4E1J A;  3ZET B;  3K58 A;  3HVR A;  1TAU A;  3WXL A;  2O8B A;  3AVL A;  3K0S A;  5M1P A;  4IFE A;  2D0P A;  1BIS A;  1MU2 A;  3ENH A;  3N4Q A;  4RW4 A;  3KK2 A;  2UU9 K;  2A3Z A;  3O9R A;  2GWK A;  1S9G A;  4MFB A;  4LSL A;  4FLY A;  5FLX O;  1YUW A;  3HT3 A;  2GWJ A;  4JLH A;  4DSJ A;  2O8D A;  5DM7 L;  1U6Z A;  4IZ9 A;  1L3T A;  2P51 A;  1SL2 A;  4YDU A;  2BTF A;  3M6G A;  4GNI A;  3MEG A;  4FWR A;  2B6A A;  3C6A A;  2YNF A;  2Y1J A;  4E7I A;  2D4W A;  2O8C B;  3TSU A;  4YFU A;  3KLH A;  4DFP A;  1W0H A;  3CJC A;  1SKR A;  3SV3 A;  1NMN A;  3K9J A;  2E2N A;  4J2B A;  1NKB A;  1BWF O;  3ULD A;  5EOY A;  4HUG A;  5AQS A;  3CC7 N;  4B9L A;  4WF9 L;  2Q1N A;  4FWS A;  2HMI A;  1RTI A;  3LDN A;  2G8K A;  3VQD A;  4FWP A;  1TL1 A;  1SQK A;  4Z94 A;  3NHG A;  1ZBU A;  4NCB A;  2OPP A;  4XEI A;  5BPM A;  1L3S A;  2WBN A;  2Z1H A;  1WSE A;  3SQ0 A;  2IVO A;  3RTV A;  1S1U A;  4FWK A;  3QFU A;  2NZT A;  4OKK A;  3O5B A;  4AM6 A;  4JN4 A;  3HST B;  1FJG K;  1Z26 A;  4DU4 A;  3CHW A;  4O8K A;  2P9U B;  3BEX A;  3VGL A;  1L3U A;  5CR4 A;  3G71 N;  3SK3 A;  3NH1 A;  2UUB K;  1RTD A;  3ZT4 A;  3TAN A;  2UUA K;  2WON A;  3O9S A;  3DRP A;  2XY5 A;  2W40 A;  4FVM A;  3F9K A;  1OH6 A;  4JK7 A;  2EHG A;  1CZ9 A;  3MAQ A;  4CF2 A;  4FLW A;  3FR0 A;  4IXC A;  5AQT A;  5C42 A;  3ASM A;  1N33 K;  3SAF A;  2QWM A;  4WE1 A;  4K8X A;  3UKR A;  3ZX0 A;  1VQ5 N;  3H3O B;  3M8R A;  3ATU A;  4M7Y A;  3LL3 A;  3PSI A;  2ZJP L;  4J2E A;  1VQL N;  4B9N A;  1C0F A;  1T05 A;  2QWP A;  3EYZ A;  2HF3 A;  3I56 N;  4NYF A;  4CHZ A;  3RMD A;  3CFO A;  3L2W A;  1J9A A;  2ZJQ L;  3L0Q A;  4DTX A;  2D0A A;  5FDL A;  3QB0 A;  4ELT A;  3U6F A;  3WXM B;  3VPZ A;  4FOE A;  5LL6 Z;  4TSX A;  3FE1 A;  2YHA A;  4LF5 K;  3TTF A;  1N32 K;  4BRF A;  3D7E O;  4AHU A;  2YHB A;  1G15 A;  3VF4 A;  4CFD A;  1RDW X;  3UIQ A;  3ZX2 A;  5JMV A;  4YHH K;  2GTD A;  2FBV A;  4A57 A;  3NGZ A;  1MDU B;  2OPS A;  3SUN A;  2GUI A;  3JSM A;  1YJ9 N;  4RW6 A;  1JL1 A;  4MO5 A;  4B9T A;  2JWK A;  4DV7 K;  1C1C A;  3CQ8 A;  3LWL A;  1QSS A;  4V19 S;  3TAR A;  2P9S A;  3DLR A;  3SPZ A;  3DLH A;  4DFM A;  4CJ7 A;  4BRO A;  3S3M A;  1N34 K;  3O4N A;  4AHR A;  2ZF5 O;  3VOV A;  5GIP A;  2OTL N;  3S9H A;  1VQ6 N;  4BGA A;  2Z1I A;  5EX5 A;  1U45 A;  2O8B B;  3TTC A;  4OGE A;  5AQO A;  4B08 A;  3KK3 A;  3AO2 A;  4ID1 A;  1S1X A;  4KRE A;  2YHX A;  1S1V A;  4GMJ B;  3O4W A;  4L3Q A;  3SQ1 A;  4W5Q A;  1VQ9 N;  2E2O A;  1RDD A;  4BVO A;  4CK2 A;  4F3O A;  2O8D B;  2E1Y A;  2V7Z A;  1VQ4 N;  4CE9 A;  2OPR A;  1IKV A;  1RBS A;  4DF4 A;  3H6E A;  4QCL A;  3LP2 A;  3WUH A;  1RIL A;  1NKC A;  3A5M C;  4E89 A;  2FF3 B;  4CZJ A;  4B9S A;  1YI2 N;  4A5A A;  2X74 A;  5AQU A;  1RDB A;  3OS1 A;  4BRH A;  4CGG A;  3DXM B;  3Q7B A;  5AJ3 K;  5BRF A;  3N4P A;  4N56 A;  4FOI A;  3C6T A;  2IVP A;  1NBW A;  5KTQ A;  1YAG A;  3HM9 A;  3VQA A;  3BDP A;  3VN5 A;  4QOZ B;  1C0T A;  1DGK N;  4CK3 A;  3CCL N;  1ZC6 A;  3KZB A;  1SKW A;  4O5B A;  3T69 A;  1QZ5 A;  4PWD A;  2P9N A;  1QVF M;  3FZL A;  4FLX A;  1WAF A;  3E9P A;  1O1W A;  3F2K A;  5FPN A;  1NJW A;  3NAE A;  3LDP A;  3DRS A;  4IBN A;  3O80 A;  1ASU A;  4M3R A;  1YIJ N;  2YKN A;  3VET A;  3ZSZ A;  4OPJ A;  1S6P A;  1KAX A;  2YKM A;  1VQK N;  4NYN A;  3WQT A;  2CH5 A;  1ATS A;  1RTH A;  4CGI A;  3MN5 A;  4E1M A;  1VSD A;  4H0V B;  1ATN A;  3D45 A;  3IS9 A;  5KI6 A;  3FLC O;  2HHS A;  3TTD A;  3UKR B;  1BDG A;  1P8Z A;  2A40 A;  4CEA A;  5BRD A;  3CCU N;  4FJL A;  3DXK A;  4BR7 A;  4CZK A;  4B8A B;  3JXU A;  3SNN A;  3NVM A;  3OVN A;  5HRR A;  3EE9 A;  1RCH A;  1IBL K;  4M3U A;  3TAB A;  4GKK K;  2G8I A;  1RT2 A;  3ZSV A;  4JKH A;  5AQJ A;  3VGM A;  4NCA A;  1KAY A;  3MN9 A;  4JKE A;  3KKS A;  4CHO A;  3VEW A;  2IGI A;  3AV9 A;  5AQK A;  2NRV A;  1NMD A;  5HP1 A;  4WYB A;  4OJR A;  1LAW A;  1NM1 A;  1U4B A;  4H5V A;  3HVT A;  4JD2 A;  2NRZ A;  4YY3 K;  3S41 A;  2A42 A;  4DSK A;  3A5N C;  3GDQ A;  3DLK A;  3CCQ N;  3NH2 A;  4CEQ A;  2VG6 A;  4DCH A;  3O08 A;  1VSK A;  1KRP A;  4JS5 A;  4LFB K;  1TVR A;  3KK7 A;  3AO5 A;  3RVC A;  1VSH A;  2HB5 A;  2I7P A;  3MX5 A;  1VQO N;  4OO1 J;  4KFB A;  5CZ1 A;  4N76 A;  2X78 A;  3MXM A;  1XC3 A;  1LWE A;  3ZT1 A;  2DY4 A;  3EL2 A;  2QWO A;  3H46 O;  2VQF K;  1UWB A;  3ENB A;  3DOK A;  2P9S B;  1UA0 A;  4BWJ A;  3B6P A;  3K5M A;  5KPT A;  4ID5 A;  4LH4 A;  4CK1 A;  2AP1 A;  1CXQ A;  2ZGZ A;  3GE1 A;  1SV5 A;  2NRT A;  3P31 A;  4B1V A;  4GKJ K;  2HBL A;  3J8A A;  4I9Q A;  3HPG A;  5F0X A;  2GUP A;  2F8S A;  3QO9 A;  4DF8 A;  4L8R B;  1QSY A;  4ELV A;  2ASM A;  1HX1 A;  2DFE A;  2KZZ A;  4RG8 A;  1VRT A;  4NXM K;  1D5A A;  4DU1 A;  3R6M A;  2O4G A;  4FJK A;  1RNH A;  1S1W A;  1V4T A;  3ZT3 A;  2HHX A;  4FSV A;  2UYT A;  2ZM6 K;  3ULE B;  4WFB L;  4DR3 K;  3TSP A;  4YOX A;  3NE6 A;  5M1O A;  3TAF A;  1HNZ K;  4DV5 K;  3V1Q A;  1DT9 A;  2G8H A;  4LC9 B;  3LAN A;  3IFR A;  4CER A;  1TK5 A;  1M90 O;  3SUP A;  1C1B A;  2ZE2 A;  2RPI A;  5AQL A;  1BGX T;  3FFK B;  3MK6 A;  5AQV A;  4CEF A;  1T03 A;  3VQ9 A;  4XH5 A;  3SJH A;  4E19 A;  1ILY A;  1S6Q A;  4BY9 C;  3ZET A;  3SQ4 A;  5CZ2 A;  3SMP A;  1KVC A;  2RHK A;  1JCF A;  5BR8 K;  2P9N B;  3VEN A;  1CZA N;  2E8A A;  4DG1 A;  3WEE B;  2HW3 A;  1IH7 A;  3EY1 A;  3SZ2 A;  2KQ2 A;  2KW4 A;  4CGH A;  4ZHR A;  4CVN E;  5FRO A;  2D0C A;  4DTM A;  3F5T A;  1S1T A;  1EX4 A;  4ILG B;  3AVK A;  4CF8 A;  1B9F A;  4KI4 A;  1ITG A;  5AR0 A;  3BY5 A;  2PYL A;  1XC9 A;  5AQG A;  3CPW M;  4JKG B;  1JJ2 M;  4BGB A;  4X65 K;  2HND A;  1QHT A;  5AZJ A;  2VGN A;  3PX4 A;  2O8C A;  5JVG L;  4X62 K;  4JI6 K;  1G99 A;  2ASP A;  4GW6 A;  1OH5 A;  4IG3 A;  1WLJ A;  1HMV A;  1U48 A;  2QEX N;  3AAR A;  1EXQ A;  4NCG A;  3QES A;  3KLG A;  5AFU H;  3S3O A;  4WQ4 C;  1GLA G;  3TAM A;  1Q18 A;  3D6R A;  2FBY A;  2E88 A;  1TGO A;  1KTQ A;  1WN7 A;  3ZSQ A;  4OGC A;  3NGI A;  4FWN A;  4H5W A;  3OYA A;  1NG9 A;  3SJJ A;  1BHL A;  1TYQ A;  4A5B A;  1JLB A;  2PZS A;  4B9M A;  5J1E A;  2QK9 A;  3VF2 A;  2QA4 N;  3C0B A;  3NF6 A;  1KC8 O;  5M1Q A;  4IDK A;  4JD2 B;  4H8K A;  1JCE A;  4CJL A;  1NK4 A;  3WNE A;  2BDP A;  4AF1 A;  3M8P A;  3VA0 A;  4EHU A;  4CCH A;  2AJQ A;  1BOT O;  1ZBS A;  1RT1 A;  1VQM N;  4CBU A;  5K14 A;  2HVH A;  1KFD A;  3C94 A;  2KKZ A;  3I55 N;  4YOY A;  3J7A P;  1LV5 A;  3ZYY X;  2WTU A;  4PKH A;  4BRP A;  1H1V A;  3A8Y A;  3H1V X;  2NRH A;  2ZD1 A;  3HI0 A;  3TU5 A;  3RRH A;  1A5W A;  1XWL A;  3HSC A;  3JS6 A;  1HNX K;  2A6A A;  2ITG A;  2FF6 A;  4JKF A;  4BRK A;  1C0G A;  2Q2R A;  3B6O A;  1W7A A;  1NJI O;  3I8B A;  4LF4 K;  1HNV A;  4CJV A;  4DB3 A;  3S3N A;  2WFB A;  4B3M K;  3GOI A;  2Q97 A;  4EP4 A;  2V51 B;  1OKJ A;  3SLC A;  1NWK A;  3CJ1 A;  3G4S N;  4CF1 A;  4YOW A;  2OAN A;  3CD6 N;  3F73 A;  4IO9 L;  1C0M A;  3VQ4 A;  4Y0W A;  3JYT A;  1KFS A;  3P5J A;  1Q86 O;  3IRX A;  2YNH A;  3L4I A;  3QML A;  2HHV A;  3Q7C A;  1GLB G;  3O8M A;  1REV A;  4CBX A;  3RMA A;  1BL3 A;  3QER A;  3LAK A;  3QEW A;  5FPE A;  1XUP O;  1JLA A;  4C8N A;  4DHY A;  4NXN K;  4U7B A;  5LY3 A;  3FFI A;  4KHW A;  1VQ7 N;  1X9S A;  3CMA N;  1NOZ A;  1XNQ K;  3HPH A;  4CZG A;  4FM1 A;  4CJU A;  4BRQ A;  4B1W B;  3A5O C;  4OX9 K;  3J81 O;  4ELU A;  3J7Y P;  1ZBL A;  1D9F A;  1EWR A;  3SBG A;  3G0Z A;  5KGW A;  5AQQ A;  4CED A;  3IUC A;  4C8M A;  4Z4F A;  3VEX A;  4DQR A;  3ZEU A;  5M1F A;  3GG4 A;  3AA2 A;  5EXW A;  5AQP A;  2VWB A;  1QHA A;  1QS4 A;  2HOE A;  4FLZ A;  1L3V A;  1IO2 A;  1A5V A;  1IKX A;  1W9H A;  2QWQ A;  4E0D A;  2DTU A;  3I0S A;  1JXB A;  3O1W A;  1NU0 A;  5AZJ B;  3MWP A;  1HJR A;  1KVA A;  3QIO A;  3DXM A;  1LW2 A;  1NK8 A;  1NGI A;  3AO1 A;  3AA4 A;  3O3G A;  4Y1D A;  3AY9 A;  4H4M A;  5C10 A;  1MWK A;  3LWM A;  3TR8 A;  4JI1 K;  4BG9 A;  2HVI A;  4FK0 A;  3HO1 A;  4IO8 A;  1U49 A;  2BGG A;  2P9P A;  4BC2 A;  3V6D A;  2O4I A;  4CEE A;  1KVB A;  1RT3 A;  5AQM A;  3ZX3 A;  4QS9 A;  4NO7 A;  3SMS A;  1TYQ B;  3OY9 A;  2VWK A;  2NRR A;  1S9E A;  4LD0 A;  3HP9 A;  3M1F A;  4M3X A;  2UUC K;  4DV6 K;  4CJ5 A;  2E6L A;  2BH1 A;  3OS0 A;  4BRC A;  1KD1 O;  1NK0 A;  1WSG A;  4H0X B;  1RDU A;  2NUB A;  3ZSY A;  2A1S A;  3DOL A;  4MLH A;  2G8U A;  1FKO A;  1QQM A;  5BRH A;  1BA0 A;  5AQI A;  1N8R O;  5ADX A;  1GOA A;  4XH4 A;  1BI4 A;  4N47 A;  3QIC A;  4CJE A;  2Q3S A;  4JK8 A;  1R59 O;  3OYF A;  3V4I A;  5JS1 A;  4NLC A;  3SYZ A;  4EZ6 A;  1YIT N;  5FRN A;  4BRI A;  4CJQ A;  4CD3 A;  3QFP A;  3UE5 A;  3PY8 A;  1BQM A;  3OYL A;  4FZY A;  1NLV A;  1XHZ A;  1YVN A;  3KJV A;  4FWO A;  3M8S A;  1WSF A;  2H3G X;  3CCM N;  4BAC A;  4HTU A;  1T7P A;  2XY8 A;  3DI6 A;  4ISG A;  4YOT A;  4DS4 A;  3QEV A;  4CI6 A;  1TK0 A;  3OYC A;  4DSF A;  4E7L A;  4FM2 A;  3IKM A;  3NF8 A;  5C2F A;  3C6H A;  3ZSX A;  4GY2 B;  4JEP A;  3RMB A;  5ELZ A;  4CZM A;  4DLG A;  3CQY A;  2UXD K;  4I2Q A;  1GLC G;  4KH6 A;  3VQ7 A;  1T8E A;  3QIN A;  5DMR A;  3K5N A;  3SBT A;  5IWA K;  2F9W A;  3AVB A;  1NJX A;  1EKE A;  1MWM A;  3IMX A;  4C1N K;  4JKD A;  2NRW A;  4X64 K;  2D5R A;  5CYM A;  4R79 A;  3EZ5 A;  3SV4 A;  1GLF O;  3ALY A;  5GAD P;  1J54 A;  3L3U A;  1SUQ A;  5GAG P;  1Y64 A;  4PUO A;  4GV9 A;  3NF9 A;  3VQ8 A;  3NFA A;  1WUA A;  1NGC A;  4O44 A;  4KTW A;  4AHS A;  1Z6R A;  5HRN A;  4JS4 A;  4JI7 K;  4IG0 A;  3ZEU B;  3ZLJ A;  4Z4I A;  4B3S K;  4AIL C;  1QQN A;  3HOS A;  3VGK A;  1KSP A;  3TPQ A;  1BCO A;  3NDK A;  1YF5 L;  4Q5V A;  3OJU A;  4KH4 A;  3THV A;  1LCU A;  3LAL A;  3CJ9 A;  3MWT A;  4B9U A;  3BUZ B;  4OKE A;  2EWS A;  5E26 A;  2GBZ A;  3KD5 E;  4Z4G A;  1JLF A;  1KQS M;  3ULE A;  1RFQ A;  4BE2 A;  4H4O A;  3OYM A;  4WFA L;  4PL8 A;  4I2P A;  2Q36 A;  3AAQ A;  3K57 A;  3O9U A;  2Q0U A;  3OYB A;  1QZ6 A;  5AQN A;  1NNE A;  4Z4C A;  2RF2 A;  2IVN A;  4CHQ A;  4BRL A;  3ZSO A;  4A59 A;  2ATQ A;  4FJX A;  4JI0 K;  1SKS A;  1HNI A;  2WOM A;  1E3M A;  2P9P B;  3MCP A;  2A5X A;  2PAV A;  1XMQ K;  1HR0 K;  3UKU A;  1NJZ A;  1U2V A;  3ITH A;  4HCB A;  1VSJ A;  1NKE A;  3OBY A;  3SUQ A;  3OYK A;  3VEY A;  3TAE A;  4CJW A;  3DLB A;  3OJS A;  2KFN A;  1HPM A;  1ASW A;  4B1Z A;  4DFJ A;  4LF9 K;  3DWL A;  3WEE A;  3PX6 A;  4BWM A;  2GV9 A;  3H3N O;  1VSF A;  3QBW A;  4DTU A;  3W3D A;  3HM8 A;  2E2Q A;  4LF6 K;  3AO3 A;  2HHT A;  1RDA A;  5BN8 A;  3FGU A;  2HF4 A;  4BR4 A;  5LMU K;  4PHT X;  4JKG A;  5IT9 O;  1BI4 B;  3L2Q A;  2YHW A;  4U67 L;  4JI3 K;  2BUP A;  4DQQ A;  1HQU A;  2XY7 A;  4KTQ A;  4CEO A;  4FK2 A;  4QAG A;  3WXJ A;  1FXX A;  1C1A A;  1KXP A;  3KLE A;  5F1X A;  2CGL A;  3MCA B;  2HHQ A;  4OLB A;  1Z05 A;  2FSK A;  4JHD A;  4CF9 A;  4DTS A;  2QTD A;  3DYA A;  4IKF A;  2VWJ A;  2OPQ A;  3EN9 A;  3U8X A;  3KLI A;  4CD1 A;  4EP5 A;  3R3L A;  2P1J A;  3CM6 A;  4CGD A;  2I7N A;  2IAJ A;  4DSE A;  4KO0 A;  3HYF A;  1RT4 A;  3WNG A;  4KHN A;  3HTV A;  3O9T A;  1DTQ A;  3OYG A;  3THX A;  2Y1I A;  3HJF A;  5SZT A;  3I0R A;  3TAP A;  3BZC A;  4FW1 A;  3CER A;  4C8K A;  5SWM A;  2W6K A;  1VSI A;  5KPR A;  2W41 A;  4NLB A;  4DLE A;  2HHU A;  3V9X A;  3CJB A;  4FJM A;  3KK1 A;  1GOC A;  3EE8 A;  2HBJ A;  4JNE A;  3UB5 A;  1B9D A;  2HNZ A;  3AVH A;  3EEQ A;  4WQ4 A;  4JK9 A;  3CFR A;  2HBK A;  3OYJ A;  4DFK A;  1NJY A;  1VSE A;  3QEI A;  2HNY A;  2KTQ A;  3TWH A;  2G8W A;  1YTU A;  2F96 A;  1BQN A;  4CZI A;  4ICL A;  3AA5 X;  3CC4 N;  4GV3 A;  3HP6 A;  3L6Q A;  4O0I A;  3QEP A;  4A2B A;  2A41 A;  1NK9 A;  4MO4 A;  4PL7 A;  4LFC K;  1J53 A;  1K8K A;  1RT5 A;  2KZM A;  2FBX A;  1I94 K;  1I3A A;  4KAZ A;  1K9M O;  2E4L A;  1HKG A;  4BC3 A;  4M3T A;  2P5O A;  3J7Z O;  4F9O A;  1P90 A;  3WXK A;  4HUF A;  1SL0 A;  2F7T A;  3QEX A;  3CF5 L;  2YJF A;  4CZE A;  3R1X A;  4C23 A;  1RBR A;  5EVZ A;  3TAG A;  5JVH L;  2YV0 X;  2OZM A;  3BF3 A;  4CHY A;  2X6N A;  5BPN A;  1WBB A;  4CBW A;  3NH0 A;  1L5U A;  3ATV A;  5CYQ A;  1IKW A;  2LSN A;  4K43 A;  4CZL A;  2F8T A;  2ZQB A;  3V9Z A;  4F3T A;  3IAY A;  1GLL O;  3UKU B;  4IOX A;  1NGH A;  3CET A;  1U2V B;  1WSJ A;  3VF6 A;  3P1G A;  5GAE P;  3OYN A;  1K8A O;  1BIZ A;  3VQE A;  2OCE A;  1X3M A;  4PA1 A;  4CJF A;  5E84 A;  4DQP A;  4CGF A;  2D0O A;  3K59 A;  4FLU A;  4G1Q A;  4HVJ A;  3CCV N;  3OW2 M;  4FZZ A;  5HRS A;  4CJT A;  4CJ3 A;  3RR7 A;  2O8F A;  3RMC A;  1K6Y A;  4LY7 A;  4IDH A;  3WQU A;  2F4V K;  3ZSR A;  1BCM A;  1N6Q A;  1S5J A;  2WUS A;  4DR5 K;  5H1S Q;  5GAH P;  4ISF A;  1J6Z A;  3LPT A;  3A2F A;  3RRG A;  1J5O A;  1LWF A;  4RWT A;  4QS7 A;  4W5O A;  4JKA A;  2YI1 A;  1U47 A;  2YJE A;  4H0Y B;  3PV8 A;  3FZF A;  2XRI A;  4FPB A;  3AVM A;  4JHD B;  3T1Y K;  1Q82 O;  1X9J A;  4E7H A;  4C8O A;  1R0A A;  4DR4 K;  4C8L A;  3CG7 A;  3HRG A;  5EY4 A;  3QIP A;  4FJ9 A;  1VQP N;  5HRO A;  3KD1 E;  2W6L A;  3PUF A;  3A0I X;  4GVM A;  1VSL A;  3PLA A;  1ZYQ A;  3LDL A;  4CJR A;  1SZ2 A;  4ILJ A;  3VQ5 A;  3THX B;  3OYI A;  2PFU A;  4WQ5 C;  1FKP A;  2A1R A;  1IBK K;  4Z4H A;  2PY5 A;  1WNS A;  3NF7 A;  4J8F A;  5C15 A;  1W97 L;  4BRA A;  1HYZ A;  5BPL A;  3KIO A;  4E1N A;  1DTT A;  2FC0 A;  2DPN A;  5HL7 L;  1K73 O;  5JLH A;  4CJK A;  5CHI A;  2XO7 A;  5AQH A;  2XHB A;  1U04 A;  1ZXO A;  4IEI A;  4EZ9 A;  4BQZ A;  3LP0 A;  3QDK A;  4H0T B;  2E1Z A;  2P5G A;  3H08 A;  1WBD A;  3TI0 A;  4CES A;  4RTF D;  1HQE A;  4DTP A;  4OPK A;  4DV4 K;  5BRE A;  1LWC A;  3V1O A;  1K8K B;  1BU6 O;  1ASV A;  3O6W A;  4B3R K;  3LM2 A;  4ILH A;  2ZJR L;  5JIC A;  1JLQ A;  4OPA A;  3V9U A;  2NRX A;  1YHQ N;  2D1K A;  5KRS A;  2QI2 A;  1RGI A;  4I6M A;  3VEV A;  2KFZ A;  3F9M A;  3MXI A;  5KQD A;  3R9P A;  4EAH D;  4DV1 K;  1CLQ A;  3DLE A;  1FK9 A;  4R5P A;  5CY4 A;  4B1Y B;  3E9O A;  3SAH A;  2OTJ N;  4DV2 K;  1YT3 A;  3OA9 A;  4JI5 K;  4JRP A;  3NCI A;  3KTQ A;  4G9Z A;  5AQW A;  3AAP A;  5HLF A;  2E2P A;  1EQY A;  3GL1 A;  3CCJ N;  3QNO A;  4I9L A;  3CM5 A;  3T7Z A;  2VQE K;  1S22 A;  1IG8 A;  3G25 A;  1Q8I A;  3OHR A;  2VYP A;  3D0P A;  4IOA L;  4F8R A;  4IWV A;  4A62 A;  3BF1 A;  4C1N I;  3WXI A;  3O1B A;  5A2Q O;  4CZF A;  4M63 C;  3L4Q A;  1BO5 O;  1TL3 A;  4DTJ A;  2VGM A;  4O8U A;  2QWN A;  2ETJ A;  4BRE A;  4KHP K;  3AA3 A;  3U3Y A;  1KCF A;  1S72 N;  5I9E B;  4Z4E A;  2ZWH A;  2O8F B;  4KHS A;  4LF7 K;  3LAM A;  2HHH K;  4BRM A;  1JCG A;  4CJP A;  4DSI A;  3VA3 A;  5J2P A;  2OA8 A;  3R8E A;  3T3F A;  5M1K A;  1BG3 A;  3NVK A;  4MDA A;  2B5J A;  4BDP A;  4IFV A;  1BA1 A;  1X1P A;  3L8B A;  5J2Q A;  3OS2 A;  4O5F A;  3ZCM A;  4BQL A;  1VHX A;  4BC4 A;  1EWQ A;  4K25 A;  3LM9 A;  3NBP A;  1HPZ A;  4K42 A;  4MQ3 A;  3H1Q A;  1UOC A;  2Z1J A;  5AQR A;  2IS3 A;  1C0U A;  1TKX A;  3AVA A;  5TKW A;  4FJH A;  2FSN A;  5JLF A;  3P38 A;  4EHT A;  1RTJ A;  2QWL A;  3RR8 A;  5M1N A;  1IG9 A;  3EKU A;  4BDZ A;  4E3S A;  3HZ6 A;  1NGA A;  1ATR A;  1Q9Y A;  3CCE N;  1NGD A;  1HYV A;  3VES A;  3VQB A;  4K41 A;  1TKD A;  2RN2 A;  4CHN A;  4DR7 K;  1SAZ A;  4DQS A;  3I33 A;  3P83 D;  1NOY A;  1MA9 B;  1C6V A;  1XHX A;  3C65 A;  4I7F A;  4FJ7 A;  4M3W A;  1QSL A;  5F2R A;  1OH7 A;  4FK4 A;  4RCH A;  2HHW A;  2V52 B;  4CGJ A;  3ID8 A;  2QKK A;  4FWQ A;  4W5R A;  3M5R A;  2HMP A;  3A5L C;  3CME N;  5CE3 A;  2VG5 A;  2V7Y A;  4ZTJ A;  4OLA A;  1D4X A;  2QM1 A;  2P9K A;  2UXC K;  4AHT A;  3WNF A;  3M8Q A;  1N5Y A;  5MLC Q;  1TV6 A;  4X66 K;  3E66 A;  1NGB A;  4QS8 A;  4KHY A;  4DMN A;  1LOT B;  5AQZ A;  3DAW A;  4DTR A;  5C0Y A;  4DQI A;  3VTI A;  5DK5 A;  5DM6 L;  2QW9 A;  4DUY K;  3D2F B;  4BRN A;  4I6M B;  2HST A;  4JI8 K;  4BDY A;  1LW0 A;  5LJW A;  2FBT A;  2JGU A;  3CJA A;  1YVU A;  1JLE A;  2O8E A;  4B1X B;  3E1Y A;  4Z0U A;  1EET A;  3SQ2 A;  2E20 A;  2P9L A;  3CI5 A;  5GIO A;  3NGY A;  3OTO K;  4DTN A;  4CZH A;  4H03 B;  1RT6 A;  5KRT A;  4A61 A;  3LP1 A;  2IDO A;  1OVQ A;  3AVN A;  3ZSW A;  4IJA A;  3HOT A;  4YDU C;  3DJC A;  4CFB A;  3THY A;  3E01 A;  2GEL A;  4BRD A;  3AGK A;  2VG7 A;  3K5O A;  1SL1 A;  3W0L A;  3L2V A;  1Q7Y O;  4K8Z A;  1EO1 A;  1M1K O;  4UY8 O;  1WB9 A;  1YXQ A;  2XY6 A;  4IJN A;  4FLV A;  1QQC A;  2YNG A;  4CJ4 A;  4OKJ A;  3CPE A;  3HBT A;  4JRQ A;  3SI6 A;  2IOC A;  1D9D A;  5JS2 A;  1WAJ A;  4DSL A;  4IFY A;  2P9I A;  3PSF A;  1VQ8 N;  2EX3 A;  3QNN A;  2PBD A;  3KWG A;  2GX9 A;  3AVJ A;  2VCP A;  4PKI A;  3L3V A;  2B4J A;  1NGF A;  1VSM A;  3OYD A;  4FXD A;  1HKC A;  4DR2 K;  3C6U A;  4M3Y A;  3VQC A;  1YTA A;  4DKW A;  1RDC A;  1JKH A;  1KAZ A;  3KHY A;  3PIP L;  1NK7 A;  3AO4 A;  4KTZ A;  4CIG A;  1JL2 A;  4DWI A;  1S3X A;  1ZBH A;  3NMU A;  4B9V A;  3G6E N;  4CJS A;  4AQY K;  1NGJ A;  1E4G T;  1FW6 A;  2CGJ A;  4FJJ A;  3LDQ A;  5BN9 A;  3AVF A;  2UXB K;  3T1A A;  1QE1 A;  2JWL A;  3G10 A;  1I39 A;  2QWR A;  3O4Q A;  5AFU A;  1T6C A;  5D3G A;  4KRF A;  3IG1 A;  4CEB A;  5AZI A;  4CF0 A;  3HXM A;  1Q81 O;  4AH9 A;  4YOV A;  3HL8 A;  4DU3 A;  2KLA A;  3HK2 A;  4K0K K;  4BE1 A;  4M3Z A;  1TKT A;  3DRR A;  4FPA A;  2G8F A;  2BE2 A;  3QLH A;  4KPY A;  2AA4 A;  2QXF A;  3U9D A;  2OYQ A;  4AM7 A;  4GV6 A;  1GLE G;  3EKS A;  1CXU A;  3MDQ A;  3MEC A;  1X9W A;  3MN6 A;  4FW2 A;  1XQS C;  3K9K A;  4FWM A;  1B92 A;  4F2S A;  1TKZ A;  4WFN L;  5C2D A;  1BIU A;  5T7B A;  2ASO A;  1X3N A;  2CGK A;  3PX0 A;  1ZBF A;  3K2P A;  2P9K B;  4CEZ A;  4O55 A;  2J4R A;  4CHP A;  5HOO A;  3I8D A;  4H5R A;  3MMV A;  4O4G A;  2Q31 A;  3P4I A;  4B8C A;  1TAQ A;  2BAN A;  1WSH A;  4KV8 A;  4W5N A;  4CIE A;  3FZK A;  3LPU A;  4LH5 A;  5ADX H; 
#chains in the Genus database with same CATH homology
 1EP4 A;  1QS4 A;  4W5O A;  4B9T A;  4FLZ A;  1L3V A;  1IO2 A;  3HO1 A;  1A5V A;  1U47 A;  1C1C A;  3CQ8 A;  1IKX A;  3PV8 A;  1X9M A;  3LWL A;  1W9H A;  1QSS A;  2XRI A;  4E0D A;  3AVM A;  3TAR A;  3DLR A;  3AVG A;  3SPZ A;  4E7H A;  2DTU A;  4C8O A;  1R0A A;  3I0S A;  3DLH A;  4DFM A;  1GOB A;  3CG7 A;  4C8L A;  1JXB A;  4N5S A;  4FJ5 A;  3S3M A;  3L2U A;  3QIP A;  4FJ9 A;  3O4N A;  4AHR A;  4FJN A;  5HRO A;  2X6S A;  4AHV A;  1HJR A;  3KD1 E;  1KVA A;  3S9H A;  2DFF A;  1Z25 A;  1RT7 A;  3PUF A;  3QIO A;  3U3G A;  2Z1I A;  4GVM A;  3O3H A;  1VSL A;  1U45 A;  1LW2 A;  3LP3 A;  1ZYQ A;  4CJR A;  4OGE A;  4B08 A;  3KK3 A;  1XI1 A;  3VQ5 A;  1NK8 A;  3AO2 A;  3OYI A;  4PY5 A;  4ID1 A;  1S1X A;  4KRE A;  3AO1 A;  3AA4 A;  1S1V A;  4GMJ B;  3O3G A;  4J2D A;  3SQ1 A;  4Y1D A;  4H4M A;  4W5Q A;  4HHT A;  1FKP A;  1RDD A;  2A1R A;  3LWM A;  3TR8 A;  4Z4H A;  2HVI A;  2PY5 A;  1WNS A;  4FK0 A;  3NF7 A;  5C24 A;  3DM2 A;  4N41 A;  4CK2 A;  1U49 A;  4F3O A;  2BGG A;  3V6D A;  2O4I A;  1HYZ A;  4CEE A;  1KVB A;  2OPR A;  3KIO A;  1RT3 A;  1IKV A;  4CE9 A;  1RBS A;  2Z1G A;  4CIF A;  4DF4 A;  3LP2 A;  4FZX C;  4QCL A;  3SPY A;  1RIL A;  3OY9 A;  1NKC A;  4E1N A;  1DTT A;  2VWK A;  4E89 A;  1S9E A;  1WSI A;  2FC0 A;  4LD0 A;  3HP9 A;  5KGX A;  2W42 A;  4B9S A;  4M3X A;  3LDS A;  4CJ5 A;  2E6L A;  4CJK A;  2X74 A;  2XO7 A;  2XHB A;  3OS1 A;  1RDB A;  1U04 A;  3OS0 A;  3MED A;  4W5T A;  3C95 A;  4F2R A;  1NK0 A;  4EZ9 A;  4CGG A;  5HBM A;  3LP0 A;  3LZJ A;  1WSG A;  2P5G A;  5FRM A;  3H08 A;  2NUB A;  3ZSY A;  2A1S A;  4N56 A;  1QTM A;  4RW8 A;  3TI0 A;  3DOL A;  1HYS A;  3C6T A;  3O3F A;  4CES A;  2G8U A;  1FKO A;  2I5J A;  5KTQ A;  3HM9 A;  1HQE A;  4DTP A;  3VQA A;  3BDP A;  3HPO A;  1DLO A;  5J2M A;  3VN5 A;  4OPK A;  1C0T A;  1GOA A;  4FCY A;  1BI4 A;  4QOZ B;  1LWC A;  4N47 A;  3V1O A;  4CK3 A;  4M42 A;  1ASV A;  3AVI A;  4CJE A;  3DMJ A;  2Q3S A;  1SKW A;  4O5B A;  1RBT A;  4DS5 A;  4Q0B A;  3OYF A;  3V4I A;  3V1R A;  1JLQ A;  4PWD A;  3V9U A;  5JS1 A;  4M45 A;  4FLX A;  5KRS A;  1WAF A;  3SYZ A;  4EZ6 A;  4KHQ A;  1O1W A;  5FRN A;  3VQQ A;  1NJW A;  2KFZ A;  3MXI A;  3NAE A;  4E7J A;  3DRS A;  4FJG A;  1RBU A;  4KB0 A;  4CJQ A;  4IBN A;  1ASU A;  4M3R A;  3PY8 A;  1BQM A;  1NK5 A;  2YKN A;  2G8V A;  3T19 A;  4FYD A;  3ZSZ A;  4OPJ A;  4KB1 A;  3OYL A;  1CLQ A;  1S6P A;  4B3O A;  2DFH A;  2YKM A;  3DLE A;  3OYH A;  4FZY A;  1XHZ A;  1FK9 A;  1UA1 A;  4NYN A;  3L2R A;  3KJV A;  3M8S A;  1WSF A;  1F21 A;  4R5P A;  3KLF A;  3PO5 A;  5CY4 A;  4BAC A;  1RBV A;  4HTU A;  1D8Y A;  1T7P A;  1RTH A;  2XY8 A;  5EU7 A;  3VQP A;  3DI6 A;  1YT3 A;  4CGI A;  4JRP A;  4E1M A;  1VSD A;  3NCI A;  3KTQ A;  4FLT A;  4DS4 A;  3D45 A;  3IS9 A;  5KI6 A;  3QEV A;  1TK0 A;  3OYC A;  3PO4 A;  4DSF A;  4CFC A;  4E7L A;  5HLF A;  4FM2 A;  3NF8 A;  4HCC A;  2HHS A;  3ZSX A;  4CEA A;  2OZS A;  3RMB A;  3QNO A;  1KLM A;  4I9L A;  4FJL A;  3CM5 A;  4DLG A;  4I2Q A;  1Q8I A;  4B8A B;  3VQ7 A;  3SNN A;  1T8E A;  3QIN A;  3OVN A;  5HRR A;  4J2A A;  1JLG A;  3D0P A;  4F8R A;  5DMR A;  1RCH A;  3K5N A;  4M3U A;  3TAB A;  3AVB A;  3OYE A;  1NJX A;  1EKE A;  2G8I A;  1RT2 A;  1A5X A;  2YNI A;  3ZSV A;  2JLE A;  4PQU A;  4AHC A;  4NCA A;  2D5R A;  1TL3 A;  3KKS A;  1CZB A;  5CYM A;  4CHO A;  3EZ5 A;  4DTJ A;  3RWU A;  3SV4 A;  2IGI A;  3AV9 A;  2ETJ A;  3SCX A;  5HP1 A;  3ZT0 A;  1UAX A;  3V9S A;  1KLN A;  4OJR A;  1LAW A;  3ALY A;  1U4B A;  4F4K A;  1J54 A;  3L3U A;  3HVT A;  3AA3 A;  3U3Y A;  1KCF A;  1SUQ A;  4KKO A;  4Z4E A;  4PUO A;  3NF9 A;  3VQ8 A;  4DSK A;  4KHS A;  3NFA A;  4OVL A;  3LAM A;  3DLK A;  4KHU A;  1LAV A;  4RW7 A;  4CJP A;  4DSI A;  3VA3 A;  4O44 A;  5J2P A;  3NH2 A;  4CEQ A;  4KTW A;  2OA8 A;  2VG6 A;  4AHS A;  5HRP A;  5HRN A;  1VSK A;  5I3U A;  3T3F A;  4JS5 A;  4JS4 A;  1JXE A;  1TVR A;  2D0B A;  1KRP A;  4IG0 A;  4Z4I A;  3AO5 A;  1VSH A;  2HB5 A;  4AIL C;  2B5J A;  2IC3 A;  4BDP A;  4IFV A;  1KSP A;  4KFB A;  1BCO A;  1X1P A;  5CZ1 A;  3NDK A;  4UQG A;  4Q5V A;  3L8B A;  4N76 A;  2X78 A;  3OJU A;  3OS2 A;  5J2Q A;  3MXM A;  3THV A;  3ZCM A;  3LAL A;  1LWE A;  3ZT1 A;  2DY4 A;  4B9U A;  1JLC A;  1UWB A;  3DOK A;  4OKE A;  1UA0 A;  2GBZ A;  3KD5 E;  1NK6 A;  3NBP A;  4Z4G A;  1HPZ A;  1JLF A;  4HUE A;  4BWJ A;  3B6P A;  4MQ3 A;  5E41 A;  3K5M A;  4BE2 A;  1UOC A;  4H4O A;  3OYM A;  2Z1J A;  2IS3 A;  4ID5 A;  4I2P A;  2QKB A;  3SUO A;  4LH4 A;  4CK1 A;  4ZTF A;  1C0U A;  1TKX A;  3AVA A;  3DLG A;  1CXQ A;  3K57 A;  1SV5 A;  4BE0 A;  4FJH A;  1VK0 A;  4I9Q A;  3HPG A;  3ZT2 A;  3OYB A;  4XIU A;  4Z4C A;  2F8S A;  3QO9 A;  4DF8 A;  3V9W A;  4L8R B;  2RF2 A;  4FJI A;  1QSY A;  4ELV A;  2DFE A;  4CHQ A;  1RTJ A;  3RR8 A;  2KZZ A;  3ZSO A;  4FJX A;  2ATQ A;  4RG8 A;  1VRT A;  1IG9 A;  4BDZ A;  1D5A A;  3CFP A;  4Y1C A;  4DU1 A;  4E3S A;  2RKI A;  1SKS A;  1HNI A;  2WOM A;  1Q9Y A;  2O4G A;  1HYV A;  5J2N A;  1RNH A;  4FJK A;  3VQB A;  1S1W A;  3ZT3 A;  2HHX A;  1TKD A;  2RN2 A;  1VRU A;  4CHN A;  4LSN A;  4DQS A;  1NJZ A;  3ITH A;  4HCB A;  1VSJ A;  1NKE A;  3P83 D;  1NOY A;  3SUQ A;  1XHX A;  1C6V A;  3OYK A;  1Y97 A;  3TAE A;  4CJW A;  4I7F A;  3DLB A;  3OJS A;  2KFN A;  4DFJ A;  1ASW A;  4O0J A;  4FJ7 A;  4KI6 A;  4M3W A;  3PX6 A;  3NE6 A;  3TAF A;  4BWM A;  1QSL A;  2GV9 A;  1VSF A;  1IKY A;  4DTU A;  4YNQ A;  1Q9X A;  4FK4 A;  2HHW A;  4CGJ A;  1HRH A;  3V1Q A;  2G8H A;  2QKK A;  3LAN A;  3AO3 A;  4W5R A;  2HHT A;  4M41 A;  4CER A;  1RDA A;  1TK5 A;  5C25 A;  3SUP A;  1C1B A;  2ZE2 A;  2VG5 A;  2RPI A;  4CFA A;  4FM0 A;  3TAQ A;  3BGR A;  4ZTJ A;  1BGX T;  4OLA A;  3V81 A;  4CEF A;  1T03 A;  4AHT A;  3KKR A;  3WNF A;  1BI4 B;  3VQ9 A;  3M8Q A;  3WNH A;  3L2Q A;  4CEC A;  1N5Y A;  4E19 A;  1TV6 A;  1S6Q A;  4E7K A;  4KHY A;  3SQ4 A;  4DMN A;  2R7Y A;  4DQQ A;  5CZ2 A;  1HQU A;  1KVC A;  3ISN C;  4DTR A;  1ZBI A;  2PYJ A;  2XY7 A;  4DQI A;  4KTQ A;  5DK5 A;  4CEO A;  4FK2 A;  3QET A;  4DG1 A;  4RW9 A;  4QAG A;  1FXX A;  2HW3 A;  1IH7 A;  3CYM A;  3EY1 A;  3SZ2 A;  2KQ2 A;  2KW4 A;  1C1A A;  4BDY A;  3MEE A;  1LW0 A;  4CGH A;  4ZHR A;  2FBT A;  3KLE A;  2JGU A;  5FRO A;  2E6M A;  2D0C A;  2HHQ A;  4OLB A;  4DTM A;  1YVU A;  1JLE A;  2HVH A;  1S1T A;  1EX4 A;  4CF9 A;  4DTS A;  3DYA A;  5I42 A;  4IKF A;  4FJ8 A;  4Z0U A;  3AVK A;  3VQ6 A;  1B9F A;  4CF8 A;  1EET A;  3AVC A;  2VWJ A;  1ITG A;  4KI4 A;  2OPQ A;  2PYL A;  3SQ2 A;  1XC9 A;  3K5L A;  3NGY A;  3KLI A;  2HND A;  1QHT A;  4EP5 A;  3PX4 A;  2P1J A;  3CM6 A;  4CGD A;  4DTO A;  3MXJ A;  1TK8 A;  2IAJ A;  4DSE A;  4DTN A;  1RT6 A;  4KO0 A;  5KRT A;  3LZI A;  3LP1 A;  3HYF A;  1RT4 A;  4GW6 A;  4IG3 A;  1WLJ A;  2IDO A;  3K58 A;  3WNG A;  3AVN A;  3HVR A;  1HMV A;  3ZSW A;  1U48 A;  4KHN A;  3AVL A;  1TAU A;  1EXQ A;  4CFB A;  4NCG A;  1DTQ A;  3QES A;  3OYG A;  3E01 A;  3KLG A;  1BIS A;  1MU2 A;  4RW4 A;  5SZT A;  3KK2 A;  2Y1I A;  3S3O A;  3I0R A;  3TAP A;  3HJF A;  2VG7 A;  3TAM A;  4FW1 A;  1S9G A;  4MFB A;  3K5O A;  2FBY A;  4LSL A;  4FLY A;  1TGO A;  3HT3 A;  3L2V A;  1KTQ A;  5SWM A;  1SL1 A;  4C8K A;  1WN7 A;  4JLH A;  1VSI A;  4DSJ A;  3ZSQ A;  4K8Z A;  4OGC A;  4DLE A;  2HHU A;  3NGI A;  3OYA A;  3V9X A;  1L3T A;  2P51 A;  2XY6 A;  1SL2 A;  3SJJ A;  1BHL A;  3MEG A;  3KK1 A;  1GOC A;  4FJM A;  2B6A A;  2YNF A;  1JLB A;  4E7I A;  4FLV A;  1QQC A;  1B9D A;  2YNG A;  5J1E A;  2HNZ A;  3AVH A;  2Y1J A;  4B9M A;  2QK9 A;  4YFU A;  4CJ4 A;  3OYJ A;  4OKJ A;  3KLH A;  1W0H A;  3CFR A;  4DFK A;  3NF6 A;  4DFP A;  4JRQ A;  1VSE A;  3QEI A;  3SV3 A;  2IOC A;  3SI6 A;  1NJY A;  4IDK A;  4H8K A;  2HNY A;  4CJL A;  1D9D A;  1NK4 A;  2KTQ A;  3TWH A;  3WNE A;  5JS2 A;  1WAJ A;  2G8W A;  2BDP A;  1NKB A;  4IFY A;  4DSL A;  2F96 A;  4J2B A;  1BQN A;  1YTU A;  3ULD A;  2EX3 A;  4HUG A;  3M8P A;  3VA0 A;  4ICL A;  4B9L A;  3QNN A;  4CCH A;  2AJQ A;  3AA5 X;  2HMI A;  3AVJ A;  1RT1 A;  1RTI A;  3HP6 A;  2G8K A;  3VQD A;  3L3V A;  2B4J A;  1TL1 A;  5K14 A;  4O0I A;  3QEP A;  1KFD A;  1VSM A;  3C94 A;  1ZBU A;  3NHG A;  2OPP A;  3OYD A;  4NCB A;  4FXD A;  1NK9 A;  1LV5 A;  3C6U A;  2PZS A;  1L3S A;  4M3Y A;  1J53 A;  3VQC A;  1RT5 A;  1YTA A;  2KZM A;  2FBX A;  2Z1H A;  1I3A A;  1WSE A;  3SQ0 A;  4KAZ A;  1RDC A;  1JKH A;  2ZD1 A;  2E4L A;  3RRH A;  4M3T A;  1A5W A;  1XWL A;  3RTV A;  1NK7 A;  2P5O A;  1S1U A;  3AO4 A;  4KTZ A;  4CIG A;  4OKK A;  4HUF A;  1JL2 A;  2ITG A;  4DWI A;  1SL0 A;  1ZBH A;  3QEX A;  3HST B;  3B6O A;  4B9V A;  1Z26 A;  4DU4 A;  4CJS A;  1L3U A;  3NH1 A;  1RBR A;  3TAG A;  1RTD A;  3ZT4 A;  3TAN A;  1HNV A;  2WON A;  4CJV A;  3S3N A;  4FJJ A;  2YV0 X;  3AVF A;  2OZM A;  3DRP A;  2XY5 A;  3T1A A;  4CHY A;  1QE1 A;  4EP4 A;  3G10 A;  2X6N A;  1I39 A;  3O4Q A;  4FVM A;  3F9K A;  4CF1 A;  5D3G A;  2EHG A;  1CZ9 A;  3MAQ A;  4KRF A;  3IG1 A;  4CEB A;  4CF2 A;  3F73 A;  1C0M A;  3VQ4 A;  3NH0 A;  4FLW A;  3JYT A;  5C42 A;  3ASM A;  4CF0 A;  1L5U A;  1KFS A;  5CYQ A;  1IKW A;  3HXM A;  3P5J A;  3IRX A;  2YNH A;  2LSN A;  4AH9 A;  4DU3 A;  3HL8 A;  2F8T A;  2HHV A;  4WE1 A;  4K8X A;  2ZQB A;  3HK2 A;  4BE1 A;  3V9Z A;  4M3Z A;  3M8R A;  1TKT A;  3DRR A;  3IAY A;  4F3T A;  1REV A;  3RMA A;  2G8F A;  1BL3 A;  2BE2 A;  4J2E A;  3QER A;  4B9N A;  1WSJ A;  3LAK A;  3QLH A;  4KPY A;  2QXF A;  3P1G A;  3QEW A;  1T05 A;  3OYN A;  2OYQ A;  3EYZ A;  1BIZ A;  3VQE A;  1JLA A;  4C8N A;  1SKR A;  4NYF A;  1CXU A;  3MEC A;  3CFO A;  4PA1 A;  1J9A A;  4CHZ A;  4CJF A;  3L2W A;  3RMD A;  1X9W A;  4DQP A;  3FFI A;  4CGF A;  4KHW A;  4FW2 A;  3K59 A;  4FLU A;  1X9S A;  1NOZ A;  1B92 A;  4G1Q A;  1TKZ A;  4F2S A;  4HVJ A;  3HPH A;  4DTX A;  2D0A A;  4FM1 A;  1BIU A;  5T7B A;  4CJU A;  4FZZ A;  5FDL A;  5HRS A;  4CJT A;  4ELT A;  4CJ3 A;  4ELU A;  3U6F A;  3PX0 A;  3RR7 A;  1ZBF A;  3K2P A;  1ZBL A;  1D9F A;  4TSX A;  3RMC A;  2YHA A;  4CEZ A;  3G0Z A;  4O55 A;  1K6Y A;  5KGW A;  4LY7 A;  4CHP A;  3I8D A;  4CED A;  4O4G A;  3ZSR A;  4AHU A;  4C8M A;  2YHB A;  1G15 A;  4B8C A;  1BCM A;  4CFD A;  4Z4F A;  1N6Q A;  1S5J A;  3UIQ A;  4DQR A;  1TAQ A;  2BAN A;  2FBV A;  3NGZ A;  2OPS A;  3SUN A;  3LPT A;  2GUI A;  1WSH A;  3JSM A;  4KV8 A;  3A2F A;  4RW6 A;  3RRG A;  4CIE A;  4W5N A;  1J5O A;  3AA2 A;  3LPU A;  1LWF A;  1JL1 A;  4LH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...