5HRRA

Hiv integrase catalytic domain containing f185k + a124n + t125s mutations complexed with gsk0002
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
140
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNSVKAACWWAGIKQEGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 52
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrrA00
1TL1A 4B9SA 4DFPA 1QS4A 3M8RA 4N47A 3OS2A 3MECA 1UWBA 3OYIA 1GOCA 2IAJA 3VQAA 1KTQA 3HT3A 3OYAA 3M8PA 4OPKA 2VG5A 5DMRA 3QNNA 1QE1A 3QIPA 2G8VA 5JS1A 3DLHA 1JKHA 3KTQA 3D0PA 3L3VA 2FC0A 4KV8A 1WLJA 3SPZA 4CGGA 3RR8A 4AH9A 1NK6A 1J9AA 4QCLA 3TAPA 4O0JA 1S1WA 1IH7A 4DQPA 5FDLA 3LZJA 3U3YA 4M3UA 2PYLA 3AVFA 1IO2A 4M3TA 1KRPA 3AO2A 1TK8A 4CJKA 1TVRA 3MAQA 4GMJB 1RDCA 1WSEA 3LALA 1L3UA 2ETJA 4PWDA 1VRUA 3DRPA 3RMBA 1T7PA 4JRPA 2HHXA 4UQGA 2KZZA 1ZYQA 4CHZA 1TK0A 2OZSA 4O4GA 5KTQA 4BWJA 4HHTA 4DFJA 3EZ5A 2HHUA 3VQQA 4FXDA 3QEIA 1RT1A 4F3OA 3QERA 3E01A 2F8SA 4W5TA 4B9TA 2HNDA 2DFHA 3NFAA 3L2WA 4KTQA 1CLQA 3OJSA 1IKYA 3D45A 3AVBA 3G0ZA 3LAKA 3O3HA 2R7YA 2OPRA 4OJRA 3KK3A 3RMCA 1KFSA 2P1JA 4CGIA 1TAQA 3F9KA 3P83D 5CZ1A 4CF8A 3QESA 3S3MA 2Z1GA 1ZBFA 4M3XA 4IG3A 4CJEA 2GV9A 4CEEA 4CGJA 3VA0A 2G8HA 1CZ9A 4KFBA 3EYZA 3SQ4A 4CJ3A 3OYLA 1C0UA 1B9DA 4RW4A 4FLYA 2ZE2A 4C8OA 3JYTA 3DOKA 1RBVA 5I42A 2Z1HA 3V9WA 3KKSA 4H4OA 4MFBA 4CJVA 1WSHA 4CFBA 1J5OA 1S1XA 1JLEA 4Z4HA 3DI6A 1JLGA 4HUFA 2A1RA 5HBMA 4NYFA 1ZBHA 1BCOA 1N5YA 4NYNA 1BIZA 3NGYA 2XO7A 2RF2A 2HVIA 1C1BA 1JL2A 1YTUA 4M3WA 2DFEA 3ZT3A 1HYZA 4Y1DA 2Q3SA 1U04A 1WSFA 4EZ9A 4OPJA 3SYZA 4FK0A 1RTJA 3K2PA 2XY7A 3I0SA 1WN7A 1EETA 1RNHA 4KI4A 2G8IA 3K5OA 1SV5A 1S6QA 1S5JA 4PA1A 3NCIA 2A1SA 3VQEA 1CXQA 1RT6A 1TV6A 3AO4A 3ZSRA 3ZSXA 3SV3A 2OPQA 4DTXA 3TAGA 1DTTA 1T03A 2OPSA 4AHCA 4E1MA 4QOZB 3L2RA 1C6VA 3DRRA 2I5JA 4CHOA 4J2AA 1HRHA 1D5AA 3M8QA 1NJZA 2IC3A 3KKRA 4CEFA 4RG8A 3T3FA 3K59A 4KHSA 3SQ2A 5FROA 3VN5A 3NHGA 1NKEA 1G15A 1ZBIA 1WSGA 3TABA 2G8FA 3O4QA 3LPTA 1F21A 4DLEA 3OYCA 3VQ6A 4G1QA 1XWLA 4DFKA 1W0HA 3KLHA 1VSHA 4XIUA 2BDPA 3V1QA 1BCMA 1FXXA 4IKFA 3C94A 4DSLA 4RW8A 3SJJA 4CK1A 2B4JA 1QHTA 3CQ8A 4DU4A 2VG6A 3WNFA 3NGIA 4FJLA 3AA2A 1X9SA 4FZXC 1EP4A 3ZSQA 1S1TA 3CM6A 3OYKA 3DRSA 4DLGA 1UOCA 4I2QA 3TWHA 1C1AA 2Y1JA 4FJJA 2DTUA 3ZSZA 4DMNA 3M8SA 3VQ4A 1I3AA 5C42A 5J2NA 4KRFA 3O4NA 4E7HA 4B08A 1LWFA 4CJQA 1HQEA 4HVJA 2DY4A 1HNIA 4CIGA 1MU2A 4KTZA 2KTQA 2HVHA 1HNVA 1UA1A 3UIQA 2E6MA 4HCBA 2D0AA 1JXEA 4M41A 1NK5A 3ZSYA 4DTNA 3B6OA 4FW1A 3ALYA 3WNGA 4ZTFA 1LAVA 2QKBA 4KHNA 3KJVA 3VQ5A 3NAEA 1REVA 4E3SA 1C0TA 4KHQA 1JLCA 2XHBA 2FBXA 5CZ2A 4FJ9A 5CYMA 3AVGA 3QINA 3V4IA 1NKBA 4B3OA 4AILC 3RTVA 3VA3A 1IG9A 1O1WA 3V9UA 2HB5A 4CGHA 3HJFA 2WONA 3P1GA 5HRNA 4BACA 2HMIA 4OGEA 2YHAA 3P5JA 2OYQA 4OKEA 1Q9XA 4LD0A 4CESA 4Z4IA 2IS3A 1NK8A 2D5RA 3B6PA 4AHTA 1ASVA 4HUGA 4FM0A 3LP1A 1NOZA 4B9LA 1D9FA 3MEDA 3OYBA 4JLHA 3LWMA 1L3TA 4E0DA 1KLNA 1NJWA 3PX0A 1W9HA 4DQSA 1SKSA 3AVAA 4YNQA 2P5OA 4KI6A 4CHNA 4KHYA 4DTMA 1NJYA 1SUQA 3L3UA 2NUBA 3DLRA 3C6TA 4BE0A 2GUIA 1Z26A 3SUNA 3I0RA 4E7IA 3WNEA 1RBRA 4EZ6A 1TGOA 1K6YA 4I9LA 4E7JA 3AO5A 4ID1A 1NK0A 4NCGA 4J2EA 4ID5A 3TR8A 4I7FA 3EY1A 3DLGA 3S9HA 5JS2A 1S1VA 1T8EA 4M3RA 3IRXA 2ATQA 2RN2A 2IGIA 4AHSA 3NE6A 4F4KA 4ZHRA 1KSPA 4W5OA 2HHVA 3AVCA 3QO9A 1VRTA 4LY7A 3VQBA 1D8YA 4Z4CA 4BDZA 3K5MA 1DLOA 3TAQA 1WSIA 3ZSWA 4AHUA 4CF2A 4DU1A 4DF8A 4YFUA 3HPGA 1FKPA 3MEEA 3HSTB 3LPUA 3BGRA 4BE2A 4CERA 2KFZA 3I8DA 1RBUA 1RT4A 3LDSA 5J1EA 3AA3A 2LSNA 3OS0A 2KQ2A 2OA8A 4FJ8A 1KVBA 3NDKA 4CJRA 3V9ZA 3AA5X 1QSSA 4B8AB 4W5NA 2B5JA 1D9DA 1LAWA 4N5SA 1RTHA 3VQDA 3OYMA 3OYFA 3PUFA 2YNHA 3CFOA 3DLKA 4FJKA 1TL3A 3RMAA 3U3GA 1Y97A 3KLEA 1EKEA 4DFMA 2ZQBA 1UA0A 4M45A 4FJMA 4C8MA 5K14A 4CFDA 4DTOA 4Z4GA 1NKCA 4WE1A 4DQRA 1KVCA 3A2FA 3HYFA 3MEGA 4B9NA 1BIUA 3HL8A 4FM1A 3RWUA 3QIOA 2HW3A 3VQ7A 3AO3A 3NGZA 1U47A 1U49A 5I3UA 4CJWA 3NF7A 4CHPA 2G8KA 4FLTA 3LZIA 4NCAA 1QSYA 1RTDA 1FKOA 4CEQA 1WSJA 1XHZA 2X6SA 3HPHA 4I9QA 3OYNA 3IS9A 3VQPA 4FJIA 3AVNA 1Q8IA 1HYVA 4Z4FA 4NCBA 4CEDA 3LP2A 1ASWA 5HRPA 5T7BA 2KW4A 3O3GA 3LWLA 3RR7A 4HUEA 2PY5A 3S3NA 1XHXA 3RRGA 3C95A 3SPYA 1TKTA 5KRTA 3TAEA 3WNHA 3OJUA 4FVMA 2G8UA 4FJHA 1S9GA 1A5XA 5KGXA 4FM2A 5J2PA 5CY4A 1BGXT 4LSNA 2ZD1A 1BL3A 4RW7A 4B9UA 3SZ2A 3HPOA 1XI1A 1RBSA 3ZSOA 4FYDA 4KPYA 3ZT4A 4OGCA 3PX6A 1JLBA 1X9MA 4OLBA 3BDPA 1VSJA 3QEPA 1JLAA 2AJQA 3MXIA 4IG0A 2HHWA 1LV5A 1RDAA 1VSKA 1VSEA 3L2VA 4L8RB 3HK2A 4K8ZA 1BQNA 4CHYA 1QQCA 2YHBA 4FW2A 3LAMA 3ZCMA 1UAXA 3OY9A 4DTJA 1R0AA 1XC9A 3QNOA 3DLBA 3LANA 4J2BA 3QLHA 1TKZA 4R5PA 3AA4A 4CEOA 1JL1A 4O44A 3IG1A 4OVLA 2VWJA 2HNZA 3V81A 5DK5A 3NBPA 4J2DA 3L2QA 4GVMA 4CIFA 5KRSA 5J2MA 3S3OA 2HHTA 4IDKA 1T05A 4OKJA 3LP0A 3HM9A 4BDPA 4CIEA 4FCYA 3SUPA 4FJ5A 1VSIA 1ZBLA 1A5WA 1RILA 4CF1A 3V9XA 4DTUA 3AVJA 1TK5A 2G8WA 3QEXA 4PQUA 4E7LA 1SL2A 3HP6A 4DG1A 4C8KA 4FK2A 1RCHA 1L3SA 3SI6A 4GW6A 3QEWA 4F8RA 4KREA 5C25A 3AVMA 1YVUA 1C1CA 4CJLA 2Y1IA 1QTMA 2OZMA 3NF9A 4PY5A 2YNFA 4N76A 4CJTA 1LWEA 1NK4A 3TAFA 2BANA 1ZBUA 2KZMA 4EP5A 1BQMA 5KGWA 2P5GA 1RDBA 3OS1A 3JSMA 2BE2A 1SKWA 3OYHA 4DTRA 4CECA 4DSJA 2IOCA 2VWKA 2O4IA 1JLQA 1SL1A 4QAGA 3V6DA 3PO4A 4KHWA 3RRHA 1RT2A 2HNYA 5FRNA 4CFCA 4TSXA 4DTPA 4AHRA 1NK9A 1ASUA 3AVKA 5C24A 4PUOA 1VSDA 2F8TA 1Z25A 3ASMA 3V1RA 4FZYA 1B92A 3HVRA 3CFPA 4CJ5A 3KLFA 3K57A 4RW9A 3HXMA 4M3YA 4BE1A 1HPZA 1C0MA 1U4BA 1BI4A 4HCCA 1X9WA 1HYSA 1KCFA 3LP3A 1S9EA 4CEZA 4LSLA 3K5NA 4DSIA 3KD1E 1BISA 4Q0BA 5HRRA 3AVIA 2FBVA 5HROA 4DQIA 3HP9A 3OYDA 2QKKA 2HHSA 2X78A 4H8KA 1U48A 1RDDA 4O0IA 5FRMA 5HLFA 2RKIA 4DS4A 5SZTA 4FLZA 3QEVA 4FJGA 3KK1A 2FBYA 3DLEA 5CYQA 3K5LA 4KAZA 2JGUA 4N41A 1I39A 3RMDA 3TAMA 2QK9A 3FFIA 3KK2A 3NH2A 5SWMA 3V9SA 1B9FA 2FBTA 2F96A 4DS5A 5J2QA 3KIOA 1GOAA 1L5UA 2Z1IA 3O3FA 3ZT2A 5HP1A 4FLWA 4E7KA 4CGDA 4ZTJA 2PYJA 3NH0A 4BDYA 3SV4A 4ELTA 1J54A 3DOLA 4DF4A 2OPPA 2QXFA 3NF8A 1S6PA 3CG7A 2EX3A 4OLAA 2YKNA 3OVNA 3CYMA 3PO5A 4CJ4A 4DWIA 1JLFA 1FK9A 1KLMA 3DM2A 4DU3A 2IDOA 3CM5A 4CK2A 4FJXA 4KTWA 5EU7A 4H4MA 4Y1CA 2GBZA 4AHVA 1S1UA 4ELUA 1EXQA 3PV8A 4C8LA 1VSFA 3ZT0A 3SQ0A 2X6NA 3VQ9A 1VK0A 1X1PA 4CJUA 4FJ7A 3ISNC 2D0BA 2YV0X 3KLIA 1CXUA 2ITGA 4CEAA 3TARA 4CEBA 4ELVA 4KB1A 1A5VA 1QSLA 3T19A 2PZSA 3SUOA 4F2SA 4FLXA 4ICLA 1L3VA 3ITHA 3TANA 3G10A 2O4GA 4W5RA 1HMVA 3AO1A 4IBNA 3K58A 3DYAA 1Q9YA 4M42A 4I2PA 5D3GA 3ZSVA 2YNGA 1KFDA 2E4LA 4JS4A 2XY6A 4JS5A 1RTIA 3KLGA 3TI0A 1TKDA 2YKMA 4KKOA 3QETA 3V1OA 4O5BA 4FLVA 4DSEA 3NH1A 2KFNA 1GOBA 4HTUA 1U45A 4KO0A 1TKXA 3ZT1A 2XRIA 1LW2A 4CFAA 2XY8A 4E89A 4EP4A 4FLUA 4KHUA 2Z1JA 4BWMA 1WAJA 4N56A 4Z4EA 3NF6A 3VQCA 4W5QA 1HQUA 1YT3A 3MXMA 4CK3A 1VSMA 4E19A 4K8XA 5E41A 1WNSA 3AV9A 4LH4A 4B8CA 3KD5E 2DFFA 3F73A 4CHQA 4LH5A 3OYEA 3U6FA 1N6QA 4O55A 2D0CA 4Z0UA 2VG7A 3ULDA 4CJFA 4DSKA 4CGFA 1SL0A 2E6LA 1BI4B 5HRSA 1KVAA 4CE9A 4B9VA 1RT7A 4OKKA 1EX4A 3DMJA 1HJRA 1VSLA 4M3ZA 3SCXA 2B6AA 4FZZA 3CFRA 3THVA 2RPIA 3HO1A 4IFYA 1WAFA 2W42A 3H08A 4FJNA 3OYJA 4CJPA 3L8BA 1IKXA 3OYGA 3IAYA 4CCHA 4F2RA 2HHQA 3AVHA 4Q5VA 2JLEA 1NJXA 3SNNA 1RT3A 4RW6A 4F3TA 5KI6A 4DSFA 1NOYA 4JRQA 1BHLA 4KB0A 1LW0A 3L2UA 2EHGA 2P51A 3VQ8A 4CF9A 3SUQA 1CZBA 1LWCA 2BGGA 2X74A 1YTAA 1J53A 2YNIA 2XY5A 4DQQA 1IKVA 4E1NA 3PY8A 4FK4A 1TAUA 1ITGA 3AVLA 4IFVA 4C8NA 1JXBA 1RBTA 4CF0A 4DTSA 3PX4A 1NK7A 1SKRA 3C6UA 3HVTA 4CJSA 1RT5A 3MXJA 2WOMA 3T1AA 4MQ3A 1DTQA 4B9MA 1IKWA 3SQ1A
chains in the Genus database with same CATH superfamily
4DFPA 4YDUA 4CD3A 4U7BA 3M8RA 3OS2A 1UWBA 2VGNA 4JV5K 3M8PA 3CJBA 4DV3K 1QE1A 1JKHA 3D0PA 4OPAA 4KV8A 1LOTB 1QQMA 3TPQA 3RR8A 2PAVA 1J9AA 2UUCK 3TAPA 1S1WA 4JKDA 5FDLA 4CBWA 4H5RA 3VENA 3AVFA 4BRPA 1TK8A 1TVRA 1L3UA 4GMJB 2E1ZA 5BRHA 2E1YA 2HHXA 3BEXA 2KZZA 4IO9L 2OZSA 5AQQA 4HHTA 4DFJA 4CZJA 5E84A 5LMNK 3R9PA 2IIRA 3L2WA 1CLQA 4KTQA 3OJSA 3G0ZA 1GLJO 3EL2A 1KFSA 2P1JA 3QESA 3F9KA 3P83D 3OTOK 1S3XA 1ZBFA 4X65K 3WEEB 4IG3A 2E8AA 1N32K 4KH4A 4CEEA 1CZ9A 3VOVA 4CJ3A 1C0UA 4NXNK 4FLYA 3O6WA 3JYTA 3DOKA 5AFUH 1NGCA 2GWKA 4CFBA 1WSHA 4BRFA 2F4VK 4Z4HA 3DI6A 4HUFA 2A1RA 3H3NO 1ZBHA 1N5YA 4FWQA 4BRLA 2UYTA 4GNIA 4JK9A 3CCJN 3ZX3A 3CJAA 3WXIA 4OPJA 2G8IA 3K5OA 1S6QA 2P9UA 3G6EN 3JAMO 1RT6A 1IBLK 2CH5A 4DTXA 3U8XA 2KLAA 4E1MA 1C6VA 3PIOL 2I5JA 1NJZA 3M8QA 2IC3A 3W3DA 3SQ2A 1NKEA 1WSGA 4JHDB 3TABA 4JN4A 2G8FA 1F21A 5AQPA 4O8UA 4BREA 4CZIA 4DFKA 4B3TK 1IJJA 4XIUA 3O9RA 3V1QA 1VQKN 1BCMA 1FXXA 1BU6O 4IKFA 3MMVA 1NGHA 2WC9A 4CK1A 4DU4A 1X9SA 3ZSQA 4WFAL 3SMSA 3TWHA 4FJJA 2P9SB 3DLLL 2QWMA 1QHAA 3K0SA 4CJQA 1HQEA 1ATRA 2DY4A 4BRGA 3EE8A 2GELA 1HNIA 3E9OA 1QQNA 4X62K 5BR8K 1UA1A 4HCBA 3IKMA 2D0AA 3U9DA 1JXEA 5LY3A 4ZTFA 1N8RO 1BO5O 3VQ5A 1W2BM 1C0TA 3EZWA 4KHQA 4A59A 3QINA 4QS8A 4B1YB 1NKBA 2O8DA 4AILC 3KZBA 1O1WA 1JCEA 3LDLA 3V9UA 3HJFA 1MA9B 5C15A 5GAEP 3OW2M 2P9LA 4AM6A 4Z4IA 5AQWA 2P9NA 5EY4A 1D9FA 3MEDA 3QBWA 4B1ZA 4EAHD 4JLHA 1L3TA 4DQSA 1SKSA 3AVAA 2P5OA 1NG9A 5GIPA 2ASPA 4FSVA 1NJYA 3IUCA 3L3UA 3DLRA 3O4WA 4BE0A 1Z26A 3A0IX 4I9LA 4ID1A 4NCGA 4ID5A 3ULEB 4CVNE 3S9HA 1T8EA 3IRXA 2ATQA 4ILHA 3THWB 1ZC6A 4F4KA 1KSPA 4W5OA 4K42A 4JI2K 3D2FB 1VRTA 3CF5L 4Z4CA 4BDZA 4BQLA 4AHUA 3B8AX 3TSUA 2A41A 1FKPA 3MEEA 2A3ZA 1V4TA 3BGRA 4BE2A 2KFZA 3LDOA 4WQ5C 2LSNA 3T7ZA 3NMUA 4GY2B 4CJRA 4W5NA 3AA5X 1IG8A 2VYPA 3ZYYX 2GX9A 5IT9O 3OYFA 2YNHA 3HZ6A 3A8YA 1Y97A 3KLEA 4DFMA 4LFAK 4FJMA 3I33A 4Z4GA 4DQRA 1KVCA 3HL8A 3NGZA 5BN9A 3C65A 4JI4K 1R59O 1WUAA 5I3UA 4CHPA 3LZIA 2O8EA 1FKOA 2X6SA 3HPHA 3VQPA 3G25A 3SBGA 4YOTA 3AVNA 4Z4FA 5T7BA 3LWLA 2KW4A 2QA4N 2PBDA 2PY5A 4Z94A 3RRGA 4KBOA 5AQIA 1TKTA 1WOQA 5KRTA 3WNHA 3OJUA 5KQDA 2G8UA 4FJHA 5KGXA 1A5XA 3UKRA 1T6DA 1VQPN 4B9UA 3SZ2A 1NMDA 4DUZK 1RBSA 4MO4A 4ISGA 3ZT4A 4DV2K 2UUBK 3QEPA 1JLAA 1LV5A 3I56N 4L8RB 1X9JA 2YHBA 3LAMA 4YOWA 1UAXA 1SAZA 3LDQA 3OHRA 1TKZA 3AA4A 4JKAA 4B9QA 4CEOA 1NGIA 4J2DA 3V81A 3NBPA 3L2QA 2HHTA 4OKJA 4I6MB 1X3NA 4FWNA 1NWKA 4BDPA 2QWOA 4FJ5A 3T1YK 1NGGA 3H45C 5I9EB 3QEXA 3HP6A 3SAHA 4JKEA 1WBDA 4N76A 1LWEA 3KVGA 2BANA 1DKGD 2BTFA 4EP5A 4WFBL 5KGWA 1XUPO 3JSMA 3OS1A 2FSNA 3VGLA 5ELZA 1JLQA 1SL1A 4E1JA 4H0OA 3PO4A 1J6ZA 3SBTA 4CFCA 4PUOA 1VSDA 4FZYA 3SAFA 4RW9A 1BI4A 2HBLA 5LMUK 3OBWA 3SJHA 1QZ6A 4Q0BA 2FBVA 4DQIA 3CD6N 1M90O 4IWVA 3O08A 2NLXA 4CZHA 2W6LA 4V19S 1SQKA 4J8FA 5ADXA 1U48A 1RDDA 4O0IA 4RCHA 1QVFM 2JGUA 4BRNA 3RMDA 5FPEA 3FFIA 3NH2A 1B9FA 2FBTA 3H3OB 4DS5A 3KIOA 3CJ9A 4JKFA 3O3FA 4FLWA 4RWTA 4E7KA 2PYJA 3NH0A 5GIOA 4PHTX 2QXFA 1S6PA 2EX3A 2YKNA 3VEWA 4BG9A 1FK9A 1P90A 2IDOA 4CK2A 3CCLN 5AQUA 5C2FA 4ELUA 1EXQA 3VQ9A 3TARA 4CEAA 4KB1A 2FSJA 2PZSA 3SUOA 4ICLA 3J80O 4K25A 1HMVA 5MLCQ 3K58A 1OH5A 4I2PA 4HWIA 2E4LA 2IVNA 5GADP 2XY6A 2QEXN 4BRMA 4MO5A 3TI0A 4IFEA 3QETA 5BPMA 1JCGA 1M1KO 2F7TA 2NZTA 3NH1A 4QS9A 1GLCG 4HTUA 4EP4A 3P31A 3WQUA 4KHUA 3O80A 2Z1JA 4N56A 4H0XB 1YJNN 3MXMA 4CK3A 1WNSA 1ATNA 5LL6Z 1U2VA 5H1SQ 1TYQB 4LH4A 2F9TA 3F73A 1N6QA 4O55A 2D0CA 3NVKA 4UY8O 2HMPA 2E6LA 5HRSA 5AQVA 2A5XA 1X3MA 4IZ9A 4OKKA 5HL7L 4B9VA 1EX4A 3VPZA 3WUHA 4FZZA 3CFRA 2RPIA 4IFYA 4CZKA 2W42A 4FJNA 3NVMA 3TU5A 2HHQA 2YHYA 2JLEA 3SNNA 2CGKA 1YF5L 4RW6A 4BC4A 1E3MA 3VEVA 3SUQA 1LWCA 1YTAA 3CCUN 1J53A 2YNIA 5GAHP 1IKVA 3PY8A 2NNWA 5B8HA 1TAUA 4IFVA 4CF0A 1JXBA 4DTSA 4H03B 4GV6A 3HVTA 4CJSA 1RT5A 3MN5A 4B9MA 1OVYA 1OKJA 1VQ6N 4WQ4A 2QWRA 2IAJA 2J4RA 3HT3A 3OYAA 1EO1A 1Q7YO 4OPKA 1WB9A 2A6AA 2G8VA 3KTQA 3L3VA 1NLVA 3SK3A 3D2EB 3THXB 4QCLA 1IH7A 4DQPA 2PYLA 1IO2A 3VERA 4CJKA 3MAQA 1WSEA 1T7PA 4JRPA 4UQGA 3C6HA 4M63C 3QFUA 4AQYK 1SS6A 1BUPA 3QERA 3E01A 4W5TA 5JVHL 1YIJN 3O9QA 2OPRA 4OJRA 3ZX2A 4CBUA 2Q36A 4M3XA 3CCVN 3VA0A 1NGAA 4C8OA 1B9DA 1RBVA 3VESA 3V9WA 4LF5K 4MFBA 1NM1A 1S1XA 3RSEB 1BCOA 4NYNA 3NGYA 2Q0RA 1C1BA 3O8MA 1MWMA 3ZT3A 1HYZA 2D0PA 4IEIA 2Q3SA 4Y1DA 2OTJN 1U04A 4EZ9A 4FK0A 2XY7A 4FWMA 3UKUB 1SV5A 1S5JA 4G9ZA 2UXBK 2NRXA 1CXQA 3TAGA 4XH4A 4CD1A 3DRRA 1D5AA 2QXLA 3KKRA 1BWFO 2O8CA 3K59A 4FWOA 1ZBIA 1HNXK 5BPNA 4FWRA 1RFQA 2Q0UA 2F9WA 3C94A 1XC3A 1QHTA 3CQ8A 3WNFA 3WXMB 1DT9A 4PL8A 3G4SN 3EKSA 4JK7A 3VQ4A 1I3AA 3CJCA 3CMAN 4E7HA 4B08A 4K41A 1LWFA 5AQOA 4HVJA 2E88A 5TKWA 4CIGA 2VWBA 1MU2A 2KTQA 1Q81O 2HVHA 1G99A 3UIQA 4M41A 4GKJK 3ZSYA 4JI6K 3B6OA 4FW1A 4JKBA 1MWKA 1REVA 2XHBA 5M1NA 1QVGM 1BA0A 3O5BA 3N4PA 3VA3A 2HB5A 2VGMA 1IBMK 4EFHA 2YJFA 2YHAA 3U9ZA 2OYQA 1VHXA 2D5RA 4HUGA 3F9MA 3LWMA 4E0DA 3W0LA 2O8FA 1NJWA 1W9HA 4YNQA 4LF6K 2P9UB 1V4SA 2DPNA 4CHNA 5JLFA 4DTMA 5BR9A 3SUNA 3I0RA 4YOXA 1RBRA 3J81O 4JD2A 3AO5A 2ASOA 3HOTA 4I7FA 3CCRN 3DLGA 4GV9A 3T1HK 4DR4K 2UXDK 4AHSA 1NGDA 3VQBA 1XQSC 3P39A 3K5MA 4BVPA 1DLOA 2IVOA 3O9UA 3ZSWA 3TAQA 2V7YA 4K43A 4BRAA 3I8DA 1RT4A 3OA9A 3LDSA 2IVPA 5J1EA 4FJ8A 1KVBA 3ZETA 3NDKA 3V9ZA 4B8AB 2B5JA 1BA1A 1VQLN 3VQDA 3PUFA 3DLKA 1TL3A 5KPRA 2AP1A 2P9IA 3O1BA 4C8MA 3HI0A 2FF6A 5C2DA 3O1WA 3HYFA 3MEGA 4B9NA 4GKKK 2HW3A 1VQ9N 3VQ7A 3NF7A 2G8KA 1KAYA 3DXKA 4FLTA 2O8DB 4JKHA 1QSYA 1RTDA 4CEQA 5CE3A 2ITMA 5AZIA 2W6KA 3MWTA 5F2RA 3WQTA 5BRFA 4YDUC 2NRHA 4NCBA 3FZMA 2P9LB 4HUEA 3E9PA 2P9NB 2JWKA 5J2PA 4LSNA 2ZD1A 4ISFA 3HPOA 1YHQN 3J7YP 3E1YA 4KPYA 1WBBA 4FPBA 2A42A 3MCPA 1X9MA 3BDPA 5HOOA 3ENOA 2HHWA 1E4FT 3HK2A 4CHYA 2RE2A 3MDQA 2WTUA 3OY9A 1R0AA 4DTJA 3DLBA 4J2BA 5DK5A 5KRSA 3S3OA 5F1XA 1GLDG 4FWSA 3HM9A 4CBXA 1MDUB 4DHYA 3CETA 2YI1A 1VSIA 1ZBLA 1A5WA 4NXMK 3PIPL 1BG3A 3V9XA 4DTUA 2FXUA 2YHWA 2G8WA 4FVUA 1SL2A 4H0YB 4DG1A 1RCHA 1L3SA 3SI6A 4F8RA 3QEWA 3KWIA 3JXUA 4PY5A 3G71N 3TAFA 1NK4A 3CCEN 1XMOK 2KZMA 1BQMA 3OYHA 3QB0A 2O4IA 1T44A 4BRQA 4QAGA 3CCSN 4KHWA 3RRHA 4EHTA 4TSXA 4DTPA 1ASUA 3AVKA 4YHHK 2F8TA 1NMNA 4M7YA 3CFPA 4WYBA 1I94K 4CJ5A 2O8EB 5C0YA 3CC2N 5JMVA 1HYSA 1VQNN 4CEZA 1EWQA 2I7NA 1BISA 2RHKA 5HRRA 5HROA 3HP9A 3OYDA 3VETA 2QKKA 2HHSA 2X78A 3SLCA 3UKRB 4H8KA 5FRMA 4DS4A 3QEVA 4FJGA 4BR5A 1FJGK 3KK1A 4H5NA 2QK9A 4BVOA 4OX9K 5SWMA 3ZEUA 5J2QA 5EXWA 1L5UA 4JI0K 3RVCA 4CGDA 5KPTA 4DV7K 4DQ8A 4BDYA 2GTDA 3DOLA 4DF4A 3NF8A 5BREA 2OANA 4DWIA 4DU3A 3DM2A 4LF9K 5EU7A 4AHVA 2GBZA 1S1UA 5E26A 4C8LA 3ZT0A 3SQ0A 2X6NA 1KAZA 4CJUA 3ISNC 2KKZA 1OVQA 3R1XA 5M1KA 3GDQA 5AQGA 3T19A 4F2SA 4FLXA 5AQHA 3ITHA 5CHIA 1YJWN 3DYAA 4M42A 2GUPA 3ZSVA 4JS5A 3KLGA 3CMEN 2YKMA 4KKOA 3V1OA 3IFRA 3M5RA 1U45A 2V51B 1TKXA 3ZT1A 2XRIA 3GOIA 4E89A 3DXMA 2HBJA 4BWMA 3VQCA 1YT3A 4MDBA 4E19A 3E66A 3AV9A 2DFFA 1GLAG 3EO3A 3MX2A 4DKWA 4JI3K 3FFKB 2I7PA 1ZXOA 3ULDA 4IOAL 4CGFA 5F0XA 1BI4B 1K73O 1RT7A 2CGJA 2QTDA 4DV4K 3DMJA 4M3ZA 4FWLA 3THVA 1WAFA 3FLCO 1IKXA 3IAYA 4F2RA 1C0GA 1NJXA 4F3TA 1RT3A 3VTHA 4PKGA 5KI6A 1NOYA 3D6RA 3ENBA 2P51A 5EOYA 2VQEK 4DQQA 4E1NA 1ITGA 4C8NA 1SKRA 4MQ3A 1IKWA 4CZGA 4B9SA 3MECA 1GOCA 2CGLA 3VQAA 1KTQA 2VG5A 5JS1A 3DLHA 4LF8K 3FZLA 1WLJA 3CC4N 4AH9A 4C1NK 4OO1J 1XNRK 3A5NC 3KK7A 4O0JA 1GLLO 3LZJA 3ATUA 4M3UA 2P9PA 4M3TA 3AO2A 1HKBA 4A5BA 1NGJA 3LALA 2ETJA 3RMBA 1GLEG 1VQ8N 4O4GA 4BWJA 3EZ5A 4FXDA 1RT1A 4IO8A 3BZKA 2HNDA 1IKYA 3D45A 2R7YA 3RMCA 3M6GA 1KQSM 4PL7A 1U2VB 1DEJA 1TAQA 2Q2RA 2Z1GA 4ILJA 2E2QA 3BF1A 3WXKA 4DR1K 4CJEA 2GV9A 5AQFA 3EYZA 4RW4A 3R3LA 5CR4A 3KKSA 1JLEA 3H46O 5FLXO 5HBMA 2XO7A 2RF2A 1Y64A 2GEMA 4M3WA 2QWNA 4DUYK 4YOUA 3SYZA 2PFUA 1RTJA 3I0SA 1WN7A 4B1VA 2E2PA 1EETA 4JKGA 4KI4A 3ZLJA 4EIAA 4PA1A 2E20A 3VQEA 1TV6A 4CI6A 1T03A 4AHCA 2BUPA 3L2RA 2UU9K 2D1KA 3TTCA 4CHOA 4FWPA 3VMFB 4CEFA 4KHSA 4RG8A 2QWLA 5FROA 3VN5A 1G15A 3EKUA 3IDHA 3ATVA 1HJOA 1XWLA 1W0HA 3KLHA 2BDPA 1NNEA 1HX1A 3O9TA 3VF4A 4GVEA 3NGIA 2NRVA 2BH1A 4BRKA 4FZXC 3OYKA 5AQSA 4I2QA 3GL1A 2DTUA 3WXJA 3EE9A 4XH1A 5C42A 5J2NA 3CJ1A 3O4NA 4KRFA 3CI5A 3PSIA 1KAXA 4JK8A 5AQKA 4KTZA 1HNVA 3H1VX 3M1FA 1NK5A 4DTNA 3CJ7A 4B1XB 3WNGA 1LAVA 1W7AA 3MCAB 4DR5K 4KHNA 3KJVA 3NAEA 2W40A 1JLCA 4JNEA 1OH6A 3F5TA 3AVGA 4A5AA 4IJNA 4YOVA 1K8AO 2WONA 3DJCA 3P1GA 3C7NA 4BACA 2WBNA 3L4QA 1K8KA 3S41A 4O5FA 5AQTA 1Q9XA 3U4LA 3B6PA 4AHTA 1ASVA 1NOZA 1Q18A 3DAWA 3OYBA 4LFCK 5BN8A 4KI6A 3GBTA 4IOCL 3P38A 1BDGA 4KHYA 1SUQA 2NUBA 3A5OC 3I55N 2GUIA 3MN6A 2E2NA 3CQYA 2O8BA 3WNEA 3HRGA 2O8CB 4E7JA 3TR8A 3VF6A 2IGIA 3NE6A 5AQYA 3AVCA 3QO9A 2FSKA 5AQRA 1XMQK 1HNWK 3GE1A 5FPMA 1RDUA 4DU1A 3HSTB 4CERA 3H6EA 2V52B 4U67L 3OS0A 2KQ2A 3QMLA 2P9KA 1LAWA 4N5SA 3A5LC 1NU0A 4FJKA 3U3GA 3N4QA 5AQJA 1EKEA 2ZQBA 3K9JA 1UA0A 4M45A 5K14A 4BROA 5AQZA 4DTOA 1NKCA 3I8BA 4WE1A 3A2FA 1BIUA 3RWUA 3QIOA 3AO3A 1U47A 5AQMA 5JLHA 1XHZA 1GLFO 3OYNA 3IS9A 4NLBA 4FJIA 4WQ4C 1Q8IA 5HRPA 1ASWA 3RR7A 3THYA 3S3NA 1TUUA 1XHXA 4FVMA 1S9GA 4ILGB 2HF4A 5CY4A 1BL3A 4RW7A 4BR7A 2O8FB 3ZSOA 2W41A 4OGCA 3PX6A 1JLBA 2YJEA 4H0TB 3CQXA 2AJQA 2KHOA 5AJ3K 3MXIA 4YY3K 1RDAA 1VSEA 1BQNA 3ID6A 5DM6L 3ZCMA 4JD2B 2ZF5O 2VWJA 1JL1A 4OVLA 3IG1A 2HNZA 4GVMA 3LP0A 3AAPA 4A62A 3VEOA 3DWLA 4FCYA 1H1VA 3FZFA 2Q1NA 3O9SA 1RILA 2V7ZA 2ZJRL 3AVJA 4FL9A 1TK5A 2FLOA 1J5EK 4PQUA 4E7LA 3LM9A 3VEYA 4FK2A 5AZJA 5C25A 3AVMA 1YVUA 1C1CA 2OZMA 3NF9A 3QDKA 3ZETB 2YNFA 3QBXA 4CJTA 1TUYA 1EWRA 1D4XA 1ZBUA 3EN9A 4BR0A 4CZFA 2P5GA 1RDBA 5GAGP 2BE2A 2QW9A 4DTRA 1SKWA 2P9IB 4CECA 2IOCA 2VWKA 2OCEA 3AY9A 1NGEA 2HNYA 5FRNA 3C6AA 5C24A 3ASMA 2YCHA 3DXKB 1B92A 3KLFA 3K57A 3TSQA 1KD1O 4M3YA 4HCCA 1X9WA 5AZIB 3HOSA 5BRDA 3F2KA 4L3QA 1VAZA 4WCEL 2QWQA 2QWPA 3AVIA 4IJAA 1RDWX 4H0PA 4BQZA 5HLFA 2FBYA 4N41A 1I39A 3KK2A 2FF3B 1HUXA 1GOAA 5HP1A 3SV4A 1J54A 2OPPA 3CG7A 2E5LK 3CYMA 1JLFA 3CM5A 1C0FA 4H4MA 4Y1CA 2HBMA 3LM2A 3QFPA 4FJ7A 2D0BA 2YV0X 3KLIA 1CXUA 2EWSA 1VQON 4ELVA 1QSLA 4B3SK 3AGRA 1XNQK 1L3VA 3TANA 3SMPA 3T69A 3AO1A 3CCMN 4IBNA 2E2OA 3MX5A 4O5BA 3CC7N 4C1NI 4KO0A 1Z6RA 4FLUA 2HBKA 4Y0WA 4Z4EA 3NF6A 4BC2A 4M7XA 1VSMA 4K8XA 5E41A 4B8CA 3KD5E 3CPEA 4MLEA 4CHQA 3OYEA 3U6FA 3LL3A 3WEEA 4B1WB 2VG7A 2WUSA 4CJFA 3WXLA 1KVAA 4CE9A 2WFBA 4WQ5A 1HJRA 3HBTA 1VQ4N 3VGMA 5AFUA 3HM8A 1YVNA 3HO1A 3SAGA 2ZWHA 3OYJA 4CJPA 3L8BA 1T3VA 4CCHA 3AVHA 1VQ5N 3BF3A 4JRQA 1BHLA 4DCHA 3D7EO 2EHGA 1CZBA 2X74A 3ZEUB 2H3GX 3AVLA 3CHWA 1RBTA 4DR7K 2HF3A 3FE1A 1S22A 3MXJA 1NJIO 2WOMA 1FW6A 3VQQA 3SQ1A 1TL1A 3BP8A 1QS4A 4MLHA 4N47A 3VGKA 3OYIA 2ZGYA 1JJ2M 4CZMA 5TKYA 5DMRA 4CZLA 1YUWA 3QIPA 4JHDA 3QNNA 1VQMN 2FC0A 3SPZA 4CGGA 4PKHA 1NK6A 4JEPA 1KXPA 4DB3A 3U3YA 3Q7BA 1ZBSA 1KRPA 1BOTO 4PWDA 3L4IA 1RDCA 1VRUA 3DRPA 4A2BA 3LDNA 4OPHA 4CHZA 1ZYQA 1TK0A 2P9SA 3CPWM 5KTQA 4NB4A 3GG4A 4GV3A 3J7AP 2HHUA 3FGUA 4X66K 3QEIA 4F3OA 2F8SA 4B9TA 2DFHA 3DXMB 3NFAA 3LAKA 3AVBA 3O3HA 3A5MC 2AA4A 3KK3A 3HTVA 4CGIA 5CZ1A 4CF8A 3S3MA 1YI2N 1ATSA 4NLCA 4FOIA 4KH5A 4CGJA 2G8HA 4KFBA 3JS6A 2ZGZA 3SQ4A 3OYLA 4BGAA 2ZE2A 5I42A 2Z1HA 1RGIA 2NRRA 4CJVA 4H4OA 1J5OA 1JLGA 4NYFA 4CZEA 1BIZA 2HVIA 1JL2A 1YTUA 2DFEA 3VTIA 1WSFA 3K2PA 4B1UB 3CIPA 3CCQN 1RNHA 4BC3A 1OH7A 4LFBK 4DR3K 4LC9B 3NCIA 4A57A 2A1SA 3ZSRA 3SV3A 3ZSXA 3AO4A 2OPQA 4JKCA 4PKIA 2QI2A 3AAQA 1DTTA 2OPSA 1NBWA 3Q7CA 4QOZB 1CZAN 3IMXA 4J2AA 1HRHA 2HSTA 4KHPK 3T3FA 4AM7A 3TSPA 3NHGA 3ULEA 1T6CA 3O4QA 1E4GT 3LPTA 1S72N 4DLEA 3OYCA 3VQ6A 4G1QA 3THWA 5JICA 1HKCA 1VSHA 4KH6A 3D2FA 4DSLA 4RW8A 3SJJA 2B4JA 2P9PB 4XH5A 2VG6A 4FJLA 3AA2A 1EP4A 1S1TA 3CM6A 4WF9L 3DRSA 4DLGA 1UOCA 4DV6K 3FZKA 1C1AA 2Y1JA 3ZSZA 4DMNA 3M8SA 4HTLA 5ADXH 5KQ8A 4FWKA 4AF1A 4IOXA 4A2AA 3CERA 5BPLA 2E6MA 1JCFA 3L0QA 3ALYA 3KWGA 2QKBA 5M1FA 4E3SA 1QQOA 2GWJA 2FBXA 3BY5A 5CZ2A 4FJ9A 5M1OA 5CYMA 3V4IA 2NRWA 1KC8O 5AQLA 4B3OA 4BRIA 2HHHK 4WFNL 3RTVA 1IG9A 4FO0A 2Q97A 1HNZK 4CGHA 2YX6A 5HRNA 4BGBA 2HMIA 4DV0K 4OGEA 3P5JA 4OKEA 4BRHA 5C10A 1Z05A 4LD0A 4CESA 2IS3A 1NK8A 4MDAA 5LJVA 4FM0A 3LP1A 2QM1A 4B9LA 2VQFK 1IV0A 1KLNA 3PX0A 4JKGB 5IWAK 3M3ZA 4CJ7A 3LDPA 3C6TA 2A40A 1K9MO 4E7IA 4B3MK 4EZ6A 1TGOA 1K6YA 1NK0A 4J2EA 1U6ZA 3EY1A 5JS2A 1S1VA 3VEZA 3ZX0A 4M3RA 2RN2A 4I6MA 4JI7K 4ZHRA 2HHVA 4LY7A 4QS7A 1D8YA 1N36K 1GLBG 4LF4K 1WSIA 4CF2A 4DF8A 4YFUA 3HPGA 3LPUA 4R79A 1RBUA 2JWLA 3AA3A 2OA8A 1QSSA 4O8KA 2D4WA 3CXCM 4DV5K 1D9DA 1RTHA 3OYMA 1W97L 3CFOA 3J7ZO 3RMAA 5GINA 4BR4A 3KHYA 1Q82O 4CFDA 5DM7L 4EHUA 4H5VA 4FM1A 1ILYA 2ZJQL 4JI8K 1U49A 4CJWA 1HKGA 4NCAA 4K0KK 1WSJA 2UXCK 4I9QA 3C7NB 1HYVA 4CEDA 3LP2A 3O3GA 1K8KB 4A61A 5EX5A 3C95A 5JVGL 1VQ7N 3SPYA 3TAEA 3OBYA 3H1QA 1DGKN 4FM2A 1BGXT 5A2QO 4BC5A 1XI1A 4FYDA 4BR9A 4FPAA 4OLBA 1VSJA 2OTLN 4JYAK 4BRCA 4IG0A 1VSKA 3L2VA 4DV1K 4K8ZA 2ASMA 2O8BB 2VCPA 1QQCA 4FW2A 5AR0A 4BG8A 3C0BA 1XC9A 3QNOA 3LANA 4IEEA 3QLHA 3UB5A 4R5PA 4O44A 4F9OA 4CIFA 5J2MA 4IDKA 1T05A 2HOEA 4CIEA 3SUPA 4B3RK 3WT0A 3AGKA 4CF1A 4C23A 1LCUA 4X64K 4LF7K 4KREA 4C8KA 1HPMA 4GW6A 4CJLA 2Y1IA 5FPDA 1QTMA 4H0VB 2P9KB 2NRZA 1NGBA 3QICA 4DSJA 1N34K 3ENHA 4BRDA 2CH6A 5C12A 1HLUA 3V6DA 1RT2A 1TYQA 1NK9A 4AHRA 3K9KA 1SZ2A 5FPNA 3L6QA 1Z25A 3MK6A 3V1RA 3HVRA 1P8ZA 3HXMA 4BE1A 1HPZA 1C0MA 1U4BA 4XEIA 4YOYA 1KCFA 3LP3A 1S9EA 4LSLA 3K5NA 4DSIA 4JAXA 3KD1E 3VF2A 3THYB 1HR0K 3TTFA 4IXCA 3HSCA 5AQNA 2RKIA 5SZTA 4FLZA 4KAZA 3DLEA 5CYQA 3K5LA 3PLAA 3TAMA 1QZ5A 2UUAK 3V9SA 2F96A 3TTDA 2Z1IA 4BY9C 3VEXA 5KPZA 3ZT2A 4ZTJA 4JI5K 2D0OA 4H5TA 4ELTA 1IBKK 4OLAA 2ZJPL 3OVNA 3PO5A 4CJ4A 4H5WA 1KLMA 2YHXA 3J8AA 4FJXA 5M1QA 4KTWA 5M1PA 3PV8A 1VSFA 1VK0A 1X1PA 3D2EA 4DR2K 2ITGA 3THXA 4CEBA 1A5VA 4CW7B 5AQXA 3G10A 2O4GA 5AZJB 1Q86O 4W5RA 3E9LA 4RTFD 1Q9YA 1OH8A 5D3GA 2YNGA 1KFDA 4JS4A 1RTIA 2NRTA 1TKDA 4FLVA 4DSEA 5LJWA 2KFNA 1N33K 1GOBA 3BUZB 4JI1K 1LW2A 5EVZA 2XY8A 4CFAA 1YAGA 1WAJA 4W5QA 1HQUA 1O13A 4FOEA 4ISEA 3MWPA 3MN9A 3EEQA 4LH5A 3FR0A 1YJ9N 4Z0UA 3FZHA 3ID8A 4DSKA 3P4IA 3UE5A 1SL0A 1EQYA 1YITN 1VSLA 3SCXA 2ZM6K 3R8EA 2B6AA 3BZCA 4BR2A 4YORA 4NO7A 3RSEA 3H08A 1NGFA 3R6MA 3OYGA 1YXQA 4Q5VA 1ESVA 4DSFA 4KB0A 1LW0A 3L2UA 3VQ8A 4CF9A 2Q31A 2BGGA 3UKUA 4IDHA 2XY5A 3MN7A 4FK4A 3AARA 3PSFA 3PX4A 1NK7A 3C6UA 3T1AA 4DR6K 1DTQA
chains in the Genus database with same CATH topology
1TL1A 4B9SA 4DFPA 1QS4A 3M8RA 4N47A 3OS2A 3MECA 1UWBA 3OYIA 1GOCA 2IAJA 3VQAA 1KTQA 3HT3A 3OYAA 3M8PA 4OPKA 2VG5A 5DMRA 3QNNA 1QE1A 3QIPA 2G8VA 5JS1A 3DLHA 1JKHA 3KTQA 3D0PA 3L3VA 2FC0A 4KV8A 1WLJA 3SPZA 4CGGA 3RR8A 4AH9A 1NK6A 1J9AA 4QCLA 3TAPA 4O0JA 1S1WA 1IH7A 4DQPA 5FDLA 3LZJA 3U3YA 4M3UA 2PYLA 3AVFA 1IO2A 4M3TA 1KRPA 3AO2A 1TK8A 4CJKA 1TVRA 3MAQA 4GMJB 1RDCA 1WSEA 3LALA 1L3UA 2ETJA 4PWDA 1VRUA 3DRPA 3RMBA 1T7PA 4JRPA 2HHXA 4UQGA 2KZZA 1ZYQA 4CHZA 1TK0A 2OZSA 4O4GA 5KTQA 4BWJA 4HHTA 4DFJA 3EZ5A 2HHUA 3VQQA 4FXDA 3QEIA 1RT1A 4F3OA 3QERA 3E01A 2F8SA 4W5TA 4B9TA 2HNDA 2DFHA 3NFAA 3L2WA 4KTQA 1CLQA 3OJSA 1IKYA 3D45A 3AVBA 3G0ZA 3LAKA 3O3HA 2R7YA 2OPRA 4OJRA 3KK3A 3RMCA 1KFSA 2P1JA 4CGIA 1TAQA 3F9KA 3P83D 5CZ1A 4CF8A 3QESA 3S3MA 2Z1GA 1ZBFA 4M3XA 4IG3A 4CJEA 2GV9A 4CEEA 4CGJA 3VA0A 2G8HA 1CZ9A 4KFBA 3EYZA 3SQ4A 4CJ3A 3OYLA 1C0UA 1B9DA 4RW4A 4FLYA 2ZE2A 4C8OA 3JYTA 3DOKA 1RBVA 5I42A 2Z1HA 3V9WA 3KKSA 4H4OA 4MFBA 4CJVA 1WSHA 4CFBA 1J5OA 1S1XA 1JLEA 4Z4HA 3DI6A 1JLGA 4HUFA 2A1RA 5HBMA 4NYFA 1ZBHA 1BCOA 1N5YA 4NYNA 1BIZA 3NGYA 2XO7A 2RF2A 2HVIA 1C1BA 1JL2A 1YTUA 4M3WA 2DFEA 3ZT3A 1HYZA 4Y1DA 2Q3SA 1U04A 1WSFA 4EZ9A 4OPJA 3SYZA 4FK0A 1RTJA 3K2PA 2XY7A 3I0SA 1WN7A 1EETA 1RNHA 4KI4A 2G8IA 3K5OA 1SV5A 1S6QA 1S5JA 4PA1A 3NCIA 2A1SA 3VQEA 1CXQA 1RT6A 1TV6A 3AO4A 3ZSRA 3ZSXA 3SV3A 2OPQA 4DTXA 3TAGA 1DTTA 1T03A 2OPSA 4AHCA 4E1MA 4QOZB 3L2RA 1C6VA 3DRRA 2I5JA 4CHOA 4J2AA 1HRHA 1D5AA 3M8QA 1NJZA 2IC3A 3KKRA 4CEFA 4RG8A 3T3FA 3K59A 4KHSA 3SQ2A 5FROA 3VN5A 3NHGA 1NKEA 1G15A 1ZBIA 1WSGA 3TABA 2G8FA 3O4QA 3LPTA 1F21A 4DLEA 3OYCA 3VQ6A 4G1QA 1XWLA 4DFKA 1W0HA 3KLHA 1VSHA 4XIUA 2BDPA 3V1QA 1BCMA 1FXXA 4IKFA 3C94A 4DSLA 4RW8A 3SJJA 4CK1A 2B4JA 1QHTA 3CQ8A 4DU4A 2VG6A 3WNFA 3NGIA 4FJLA 3AA2A 1X9SA 4FZXC 1EP4A 3ZSQA 1S1TA 3CM6A 3OYKA 3DRSA 4DLGA 1UOCA 4I2QA 3TWHA 1C1AA 2Y1JA 4FJJA 2DTUA 3ZSZA 4DMNA 3M8SA 3VQ4A 1I3AA 5C42A 5J2NA 4KRFA 3O4NA 4E7HA 4B08A 1LWFA 4CJQA 1HQEA 4HVJA 2DY4A 1HNIA 4CIGA 1MU2A 4KTZA 2KTQA 2HVHA 1HNVA 1UA1A 3UIQA 2E6MA 4HCBA 2D0AA 1JXEA 4M41A 1NK5A 3ZSYA 4DTNA 3B6OA 4FW1A 3ALYA 3WNGA 4ZTFA 1LAVA 2QKBA 4KHNA 3KJVA 3VQ5A 3NAEA 1REVA 4E3SA 1C0TA 4KHQA 1JLCA 2XHBA 2FBXA 5CZ2A 4FJ9A 5CYMA 3AVGA 3QINA 3V4IA 1NKBA 4B3OA 4AILC 3RTVA 3VA3A 1IG9A 1O1WA 3V9UA 2HB5A 4CGHA 3HJFA 2WONA 3P1GA 5HRNA 4BACA 2HMIA 4OGEA 2YHAA 3P5JA 2OYQA 4OKEA 1Q9XA 4LD0A 4CESA 4Z4IA 2IS3A 1NK8A 2D5RA 3B6PA 4AHTA 1ASVA 4HUGA 4FM0A 3LP1A 1NOZA 4B9LA 1D9FA 3MEDA 3OYBA 4JLHA 3LWMA 1L3TA 4E0DA 1KLNA 1NJWA 3PX0A 1W9HA 4DQSA 1SKSA 3AVAA 4YNQA 2P5OA 4KI6A 4CHNA 4KHYA 4DTMA 1NJYA 1SUQA 3L3UA 2NUBA 3DLRA 3C6TA 4BE0A 2GUIA 1Z26A 3SUNA 3I0RA 4E7IA 3WNEA 1RBRA 4EZ6A 1TGOA 1K6YA 4I9LA 4E7JA 3AO5A 4ID1A 1NK0A 4NCGA 4J2EA 4ID5A 3TR8A 4I7FA 3EY1A 3DLGA 3S9HA 5JS2A 1S1VA 1T8EA 4M3RA 3IRXA 2ATQA 2RN2A 2IGIA 4AHSA 3NE6A 4F4KA 4ZHRA 1KSPA 4W5OA 2HHVA 3AVCA 3QO9A 1VRTA 4LY7A 3VQBA 1D8YA 4Z4CA 4BDZA 3K5MA 1DLOA 3TAQA 1WSIA 3ZSWA 4AHUA 4CF2A 4DU1A 4DF8A 4YFUA 3HPGA 1FKPA 3MEEA 3HSTB 3LPUA 3BGRA 4BE2A 4CERA 2KFZA 3I8DA 1RBUA 1RT4A 3LDSA 5J1EA 3AA3A 2LSNA 3OS0A 2KQ2A 2OA8A 4FJ8A 1KVBA 3NDKA 4CJRA 3V9ZA 3AA5X 1QSSA 4B8AB 4W5NA 2B5JA 1D9DA 1LAWA 4N5SA 1RTHA 3VQDA 3OYMA 3OYFA 3PUFA 2YNHA 3CFOA 3DLKA 4FJKA 1TL3A 3RMAA 3U3GA 1Y97A 3KLEA 1EKEA 4DFMA 2ZQBA 1UA0A 4M45A 4FJMA 4C8MA 5K14A 4CFDA 4DTOA 4Z4GA 1NKCA 4WE1A 4DQRA 1KVCA 3A2FA 3HYFA 3MEGA 4B9NA 1BIUA 3HL8A 4FM1A 3RWUA 3QIOA 2HW3A 3VQ7A 3AO3A 3NGZA 1U47A 1U49A 5I3UA 4CJWA 3NF7A 4CHPA 2G8KA 4FLTA 3LZIA 4NCAA 1QSYA 1RTDA 1FKOA 4CEQA 1WSJA 1XHZA 2X6SA 3HPHA 4I9QA 3OYNA 3IS9A 3VQPA 4FJIA 3AVNA 1Q8IA 1HYVA 4Z4FA 4NCBA 4CEDA 3LP2A 1ASWA 5HRPA 5T7BA 2KW4A 3O3GA 3LWLA 3RR7A 4HUEA 2PY5A 3S3NA 1XHXA 3RRGA 3C95A 3SPYA 1TKTA 5KRTA 3TAEA 3WNHA 3OJUA 4FVMA 2G8UA 4FJHA 1S9GA 1A5XA 5KGXA 4FM2A 5J2PA 5CY4A 1BGXT 4LSNA 2ZD1A 1BL3A 4RW7A 4B9UA 3SZ2A 3HPOA 1XI1A 1RBSA 3ZSOA 4FYDA 4KPYA 3ZT4A 4OGCA 3PX6A 1JLBA 1X9MA 4OLBA 3BDPA 1VSJA 3QEPA 1JLAA 2AJQA 3MXIA 4IG0A 2HHWA 1LV5A 1RDAA 1VSKA 1VSEA 3L2VA 4L8RB 3HK2A 4K8ZA 1BQNA 4CHYA 1QQCA 2YHBA 4FW2A 3LAMA 3ZCMA 1UAXA 3OY9A 4DTJA 1R0AA 1XC9A 3QNOA 3DLBA 3LANA 4J2BA 3QLHA 1TKZA 4R5PA 3AA4A 4CEOA 1JL1A 4O44A 3IG1A 4OVLA 2VWJA 2HNZA 3V81A 5DK5A 3NBPA 4J2DA 3L2QA 4GVMA 4CIFA 5KRSA 5J2MA 3S3OA 2HHTA 4IDKA 1T05A 4OKJA 3LP0A 3HM9A 4BDPA 4CIEA 4FCYA 3SUPA 4FJ5A 1VSIA 1ZBLA 1A5WA 1RILA 4CF1A 3V9XA 4DTUA 3AVJA 1TK5A 2G8WA 3QEXA 4PQUA 4E7LA 1SL2A 3HP6A 4DG1A 4C8KA 4FK2A 1RCHA 1L3SA 3SI6A 4GW6A 3QEWA 4F8RA 4KREA 5C25A 3AVMA 1YVUA 1C1CA 4CJLA 2Y1IA 1QTMA 2OZMA 3NF9A 4PY5A 2YNFA 4N76A 4CJTA 1LWEA 1NK4A 3TAFA 2BANA 1ZBUA 2KZMA 4EP5A 1BQMA 5KGWA 2P5GA 1RDBA 3OS1A 3JSMA 2BE2A 1SKWA 3OYHA 4DTRA 4CECA 4DSJA 2IOCA 2VWKA 2O4IA 1JLQA 1SL1A 4QAGA 3V6DA 3PO4A 4KHWA 3RRHA 1RT2A 2HNYA 5FRNA 4CFCA 4TSXA 4DTPA 4AHRA 1NK9A 1ASUA 3AVKA 5C24A 4PUOA 1VSDA 2F8TA 1Z25A 3ASMA 3V1RA 4FZYA 1B92A 3HVRA 3CFPA 4CJ5A 3KLFA 3K57A 4RW9A 3HXMA 4M3YA 4BE1A 1HPZA 1C0MA 1U4BA 1BI4A 4HCCA 1X9WA 1HYSA 1KCFA 3LP3A 1S9EA 4CEZA 4LSLA 3K5NA 4DSIA 3KD1E 1BISA 4Q0BA 5HRRA 3AVIA 2FBVA 5HROA 4DQIA 3HP9A 3OYDA 2QKKA 2HHSA 2X78A 4H8KA 1U48A 1RDDA 4O0IA 5FRMA 5HLFA 2RKIA 4DS4A 5SZTA 4FLZA 3QEVA 4FJGA 3KK1A 2FBYA 3DLEA 5CYQA 3K5LA 4KAZA 2JGUA 4N41A 1I39A 3RMDA 3TAMA 2QK9A 3FFIA 3KK2A 3NH2A 5SWMA 3V9SA 1B9FA 2FBTA 2F96A 4DS5A 5J2QA 3KIOA 1GOAA 1L5UA 2Z1IA 3O3FA 3ZT2A 5HP1A 4FLWA 4E7KA 4CGDA 4ZTJA 2PYJA 3NH0A 4BDYA 3SV4A 4ELTA 1J54A 3DOLA 4DF4A 2OPPA 2QXFA 3NF8A 1S6PA 3CG7A 2EX3A 4OLAA 2YKNA 3OVNA 3CYMA 3PO5A 4CJ4A 4DWIA 1JLFA 1FK9A 1KLMA 3DM2A 4DU3A 2IDOA 3CM5A 4CK2A 4FJXA 4KTWA 5EU7A 4H4MA 4Y1CA 2GBZA 4AHVA 1S1UA 4ELUA 1EXQA 3PV8A 4C8LA 1VSFA 3ZT0A 3SQ0A 2X6NA 3VQ9A 1VK0A 1X1PA 4CJUA 4FJ7A 3ISNC 2D0BA 2YV0X 3KLIA 1CXUA 2ITGA 4CEAA 3TARA 4CEBA 4ELVA 4KB1A 1A5VA 1QSLA 3T19A 2PZSA 3SUOA 4F2SA 4FLXA 4ICLA 1L3VA 3ITHA 3TANA 3G10A 2O4GA 4W5RA 1HMVA 3AO1A 4IBNA 3K58A 3DYAA 1Q9YA 4M42A 4I2PA 5D3GA 3ZSVA 2YNGA 1KFDA 2E4LA 4JS4A 2XY6A 4JS5A 1RTIA 3KLGA 3TI0A 1TKDA 2YKMA 4KKOA 3QETA 3V1OA 4O5BA 4FLVA 4DSEA 3NH1A 2KFNA 1GOBA 4HTUA 1U45A 4KO0A 1TKXA 3ZT1A 2XRIA 1LW2A 4CFAA 2XY8A 4E89A 4EP4A 4FLUA 4KHUA 2Z1JA 4BWMA 1WAJA 4N56A 4Z4EA 3NF6A 3VQCA 4W5QA 1HQUA 1YT3A 3MXMA 4CK3A 1VSMA 4E19A 4K8XA 5E41A 1WNSA 3AV9A 4LH4A 4B8CA 3KD5E 2DFFA 3F73A 4CHQA 4LH5A 3OYEA 3U6FA 1N6QA 4O55A 2D0CA 4Z0UA 2VG7A 3ULDA 4CJFA 4DSKA 4CGFA 1SL0A 2E6LA 1BI4B 5HRSA 1KVAA 4CE9A 4B9VA 1RT7A 4OKKA 1EX4A 3DMJA 1HJRA 1VSLA 4M3ZA 3SCXA 2B6AA 4FZZA 3CFRA 3THVA 2RPIA 3HO1A 4IFYA 1WAFA 2W42A 3H08A 4FJNA 3OYJA 4CJPA 3L8BA 1IKXA 3OYGA 3IAYA 4CCHA 4F2RA 2HHQA 3AVHA 4Q5VA 2JLEA 1NJXA 3SNNA 1RT3A 4RW6A 4F3TA 5KI6A 4DSFA 1NOYA 4JRQA 1BHLA 4KB0A 1LW0A 3L2UA 2EHGA 2P51A 3VQ8A 4CF9A 3SUQA 1CZBA 1LWCA 2BGGA 2X74A 1YTAA 1J53A 2YNIA 2XY5A 4DQQA 1IKVA 4E1NA 3PY8A 4FK4A 1TAUA 1ITGA 3AVLA 4IFVA 4C8NA 1JXBA 1RBTA 4CF0A 4DTSA 3PX4A 1NK7A 1SKRA 3C6UA 3HVTA 4CJSA 1RT5A 3MXJA 2WOMA 3T1AA 4MQ3A 1DTQA 4B9MA 1IKWA 3SQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL1 A;  4B9S A;  4DFP A;  1QS4 A;  3M8R A;  4N47 A;  3OS2 A;  3MEC A;  1UWB A;  3OYI A;  1GOC A;  2IAJ A;  3VQA A;  1KTQ A;  3HT3 A;  3OYA A;  3M8P A;  4OPK A;  2VG5 A;  5DMR A;  3QNN A;  1QE1 A;  3QIP A;  2G8V A;  5JS1 A;  3DLH A;  1JKH A;  3KTQ A;  3D0P A;  3L3V A;  2FC0 A;  4KV8 A;  1WLJ A;  3SPZ A;  4CGG A;  3RR8 A;  4AH9 A;  1NK6 A;  1J9A A;  4QCL A;  3TAP A;  4O0J A;  1S1W A;  1IH7 A;  4DQP A;  5FDL A;  3LZJ A;  3U3Y A;  4M3U A;  2PYL A;  3AVF A;  1IO2 A;  4M3T A;  1KRP A;  3AO2 A;  1TK8 A;  4CJK A;  1TVR A;  3MAQ A;  4GMJ B;  1RDC A;  1WSE A;  3LAL A;  1L3U A;  2ETJ A;  4PWD A;  1VRU A;  3DRP A;  3RMB A;  1T7P A;  4JRP A;  2HHX A;  4UQG A;  2KZZ A;  1ZYQ A;  4CHZ A;  1TK0 A;  2OZS A;  4O4G A;  5KTQ A;  4BWJ A;  4HHT A;  4DFJ A;  3EZ5 A;  2HHU A;  3VQQ A;  4FXD A;  3QEI A;  1RT1 A;  4F3O A;  3QER A;  3E01 A;  2F8S A;  4W5T A;  4B9T A;  2HND A;  2DFH A;  3NFA A;  3L2W A;  4KTQ A;  1CLQ A;  3OJS A;  1IKY A;  3D45 A;  3AVB A;  3G0Z A;  3LAK A;  3O3H A;  2R7Y A;  2OPR A;  4OJR A;  3KK3 A;  3RMC A;  1KFS A;  2P1J A;  4CGI A;  1TAQ A;  3F9K A;  3P83 D;  5CZ1 A;  4CF8 A;  3QES A;  3S3M A;  2Z1G A;  1ZBF A;  4M3X A;  4IG3 A;  4CJE A;  2GV9 A;  4CEE A;  4CGJ A;  3VA0 A;  2G8H A;  1CZ9 A;  4KFB A;  3EYZ A;  3SQ4 A;  4CJ3 A;  3OYL A;  1C0U A;  1B9D A;  4RW4 A;  4FLY A;  2ZE2 A;  4C8O A;  3JYT A;  3DOK A;  1RBV A;  5I42 A;  2Z1H A;  3V9W A;  3KKS A;  4H4O A;  4MFB A;  4CJV A;  1WSH A;  4CFB A;  1J5O A;  1S1X A;  1JLE A;  4Z4H A;  3DI6 A;  1JLG A;  4HUF A;  2A1R A;  5HBM A;  4NYF A;  1ZBH A;  1BCO A;  1N5Y A;  4NYN A;  1BIZ A;  3NGY A;  2XO7 A;  2RF2 A;  2HVI A;  1C1B A;  1JL2 A;  1YTU A;  4M3W A;  2DFE A;  3ZT3 A;  1HYZ A;  4Y1D A;  2Q3S A;  1U04 A;  1WSF A;  4EZ9 A;  4OPJ A;  3SYZ A;  4FK0 A;  1RTJ A;  3K2P A;  2XY7 A;  3I0S A;  1WN7 A;  1EET A;  1RNH A;  4KI4 A;  2G8I A;  3K5O A;  1SV5 A;  1S6Q A;  1S5J A;  4PA1 A;  3NCI A;  2A1S A;  3VQE A;  1CXQ A;  1RT6 A;  1TV6 A;  3AO4 A;  3ZSR A;  3ZSX A;  3SV3 A;  2OPQ A;  4DTX A;  3TAG A;  1DTT A;  1T03 A;  2OPS A;  4AHC A;  4E1M A;  4QOZ B;  3L2R A;  1C6V A;  3DRR A;  2I5J A;  4CHO A;  4J2A A;  1HRH A;  1D5A A;  3M8Q A;  1NJZ A;  2IC3 A;  3KKR A;  4CEF A;  4RG8 A;  3T3F A;  3K59 A;  4KHS A;  3SQ2 A;  5FRO A;  3VN5 A;  3NHG A;  1NKE A;  1G15 A;  1ZBI A;  1WSG A;  3TAB A;  2G8F A;  3O4Q A;  3LPT A;  1F21 A;  4DLE A;  3OYC A;  3VQ6 A;  4G1Q A;  1XWL A;  4DFK A;  1W0H A;  3KLH A;  1VSH A;  4XIU A;  2BDP A;  3V1Q A;  1BCM A;  1FXX A;  4IKF A;  3C94 A;  4DSL A;  4RW8 A;  3SJJ A;  4CK1 A;  2B4J A;  1QHT A;  3CQ8 A;  4DU4 A;  2VG6 A;  3WNF A;  3NGI A;  4FJL A;  3AA2 A;  1X9S A;  4FZX C;  1EP4 A;  3ZSQ A;  1S1T A;  3CM6 A;  3OYK A;  3DRS A;  4DLG A;  1UOC A;  4I2Q A;  3TWH A;  1C1A A;  2Y1J A;  4FJJ A;  2DTU A;  3ZSZ A;  4DMN A;  3M8S A;  3VQ4 A;  1I3A A;  5C42 A;  5J2N A;  4KRF A;  3O4N A;  4E7H A;  4B08 A;  1LWF A;  4CJQ A;  1HQE A;  4HVJ A;  2DY4 A;  1HNI A;  4CIG A;  1MU2 A;  4KTZ A;  2KTQ A;  2HVH A;  1HNV A;  1UA1 A;  3UIQ A;  2E6M A;  4HCB A;  2D0A A;  1JXE A;  4M41 A;  1NK5 A;  3ZSY A;  4DTN A;  3B6O A;  4FW1 A;  3ALY A;  3WNG A;  4ZTF A;  1LAV A;  2QKB A;  4KHN A;  3KJV A;  3VQ5 A;  3NAE A;  1REV A;  4E3S A;  1C0T A;  4KHQ A;  1JLC A;  2XHB A;  2FBX A;  5CZ2 A;  4FJ9 A;  5CYM A;  3AVG A;  3QIN A;  3V4I A;  1NKB A;  4B3O A;  4AIL C;  3RTV A;  3VA3 A;  1IG9 A;  1O1W A;  3V9U A;  2HB5 A;  4CGH A;  3HJF A;  2WON A;  3P1G A;  5HRN A;  4BAC A;  2HMI A;  4OGE A;  2YHA A;  3P5J A;  2OYQ A;  4OKE A;  1Q9X A;  4LD0 A;  4CES A;  4Z4I A;  2IS3 A;  1NK8 A;  2D5R A;  3B6P A;  4AHT A;  1ASV A;  4HUG A;  4FM0 A;  3LP1 A;  1NOZ A;  4B9L A;  1D9F A;  3MED A;  3OYB A;  4JLH A;  3LWM A;  1L3T A;  4E0D A;  1KLN A;  1NJW A;  3PX0 A;  1W9H A;  4DQS A;  1SKS A;  3AVA A;  4YNQ A;  2P5O A;  4KI6 A;  4CHN A;  4KHY A;  4DTM A;  1NJY A;  1SUQ A;  3L3U A;  2NUB A;  3DLR A;  3C6T A;  4BE0 A;  2GUI A;  1Z26 A;  3SUN A;  3I0R A;  4E7I A;  3WNE A;  1RBR A;  4EZ6 A;  1TGO A;  1K6Y A;  4I9L A;  4E7J A;  3AO5 A;  4ID1 A;  1NK0 A;  4NCG A;  4J2E A;  4ID5 A;  3TR8 A;  4I7F A;  3EY1 A;  3DLG A;  3S9H A;  5JS2 A;  1S1V A;  1T8E A;  4M3R A;  3IRX A;  2ATQ A;  2RN2 A;  2IGI A;  4AHS A;  3NE6 A;  4F4K A;  4ZHR A;  1KSP A;  4W5O A;  2HHV A;  3AVC A;  3QO9 A;  1VRT A;  4LY7 A;  3VQB A;  1D8Y A;  4Z4C A;  4BDZ A;  3K5M A;  1DLO A;  3TAQ A;  1WSI A;  3ZSW A;  4AHU A;  4CF2 A;  4DU1 A;  4DF8 A;  4YFU A;  3HPG A;  1FKP A;  3MEE A;  3HST B;  3LPU A;  3BGR A;  4BE2 A;  4CER A;  2KFZ A;  3I8D A;  1RBU A;  1RT4 A;  3LDS A;  5J1E A;  3AA3 A;  2LSN A;  3OS0 A;  2KQ2 A;  2OA8 A;  4FJ8 A;  1KVB A;  3NDK A;  4CJR A;  3V9Z A;  3AA5 X;  1QSS A;  4B8A B;  4W5N A;  2B5J A;  1D9D A;  1LAW A;  4N5S A;  1RTH A;  3VQD A;  3OYM A;  3OYF A;  3PUF A;  2YNH A;  3CFO A;  3DLK A;  4FJK A;  1TL3 A;  3RMA A;  3U3G A;  1Y97 A;  3KLE A;  1EKE A;  4DFM A;  2ZQB A;  1UA0 A;  4M45 A;  4FJM A;  4C8M A;  5K14 A;  4CFD A;  4DTO A;  4Z4G A;  1NKC A;  4WE1 A;  4DQR A;  1KVC A;  3A2F A;  3HYF A;  3MEG A;  4B9N A;  1BIU A;  3HL8 A;  4FM1 A;  3RWU A;  3QIO A;  2HW3 A;  3VQ7 A;  3AO3 A;  3NGZ A;  1U47 A;  1U49 A;  5I3U A;  4CJW A;  3NF7 A;  4CHP A;  2G8K A;  4FLT A;  3LZI A;  4NCA A;  1QSY A;  1RTD A;  1FKO A;  4CEQ A;  1WSJ A;  1XHZ A;  2X6S A;  3HPH A;  4I9Q A;  3OYN A;  3IS9 A;  3VQP A;  4FJI A;  3AVN A;  1Q8I A;  1HYV A;  4Z4F A;  4NCB A;  4CED A;  3LP2 A;  1ASW A;  5HRP A;  5T7B A;  2KW4 A;  3O3G A;  3LWL A;  3RR7 A;  4HUE A;  2PY5 A;  3S3N A;  1XHX A;  3RRG A;  3C95 A;  3SPY A;  1TKT A;  5KRT A;  3TAE A;  3WNH A;  3OJU A;  4FVM A;  2G8U A;  4FJH A;  1S9G A;  1A5X A;  5KGX A;  4FM2 A;  5J2P A;  5CY4 A;  1BGX T;  4LSN A;  2ZD1 A;  1BL3 A;  4RW7 A;  4B9U A;  3SZ2 A;  3HPO A;  1XI1 A;  1RBS A;  3ZSO A;  4FYD A;  4KPY A;  3ZT4 A;  4OGC A;  3PX6 A;  1JLB A;  1X9M A;  4OLB A;  3BDP A;  1VSJ A;  3QEP A;  1JLA A;  2AJQ A;  3MXI A;  4IG0 A;  2HHW A;  1LV5 A;  1RDA A;  1VSK A;  1VSE A;  3L2V A;  4L8R B;  3HK2 A;  4K8Z A;  1BQN A;  4CHY A;  1QQC A;  2YHB A;  4FW2 A;  3LAM A;  3ZCM A;  1UAX A;  3OY9 A;  4DTJ A;  1R0A A;  1XC9 A;  3QNO A;  3DLB A;  3LAN A;  4J2B A;  3QLH A;  1TKZ A;  4R5P A;  3AA4 A;  4CEO A;  1JL1 A;  4O44 A;  3IG1 A;  4OVL A;  2VWJ A;  2HNZ A;  3V81 A;  5DK5 A;  3NBP A;  4J2D A;  3L2Q A;  4GVM A;  4CIF A;  5KRS A;  5J2M A;  3S3O A;  2HHT A;  4IDK A;  1T05 A;  4OKJ A;  3LP0 A;  3HM9 A;  4BDP A;  4CIE A;  4FCY A;  3SUP A;  4FJ5 A;  1VSI A;  1ZBL A;  1A5W A;  1RIL A;  4CF1 A;  3V9X A;  4DTU A;  3AVJ A;  1TK5 A;  2G8W A;  3QEX A;  4PQU A;  4E7L A;  1SL2 A;  3HP6 A;  4DG1 A;  4C8K A;  4FK2 A;  1RCH A;  1L3S A;  3SI6 A;  4GW6 A;  3QEW A;  4F8R A;  4KRE A;  5C25 A;  3AVM A;  1YVU A;  1C1C A;  4CJL A;  2Y1I A;  1QTM A;  2OZM A;  3NF9 A;  4PY5 A;  2YNF A;  4N76 A;  4CJT A;  1LWE A;  1NK4 A;  3TAF A;  2BAN A;  1ZBU A;  2KZM A;  4EP5 A;  1BQM A;  5KGW A;  2P5G A;  1RDB A;  3OS1 A;  3JSM A;  2BE2 A;  1SKW A;  3OYH A;  4DTR A;  4CEC A;  4DSJ A;  2IOC A;  2VWK A;  2O4I A;  1JLQ A;  1SL1 A;  4QAG A;  3V6D A;  3PO4 A;  4KHW A;  3RRH A;  1RT2 A;  2HNY A;  5FRN A;  4CFC A;  4TSX A;  4DTP A;  4AHR A;  1NK9 A;  1ASU A;  3AVK A;  5C24 A;  4PUO A;  1VSD A;  2F8T A;  1Z25 A;  3ASM A;  3V1R A;  4FZY A;  1B92 A;  3HVR A;  3CFP A;  4CJ5 A;  3KLF A;  3K57 A;  4RW9 A;  3HXM A;  4M3Y A;  4BE1 A;  1HPZ A;  1C0M A;  1U4B A;  1BI4 A;  4HCC A;  1X9W A;  1HYS A;  1KCF A;  3LP3 A;  1S9E A;  4CEZ A;  4LSL A;  3K5N A;  4DSI A;  3KD1 E;  1BIS A;  4Q0B A;  5HRR A;  3AVI A;  2FBV A;  5HRO A;  4DQI A;  3HP9 A;  3OYD A;  2QKK A;  2HHS A;  2X78 A;  4H8K A;  1U48 A;  1RDD A;  4O0I A;  5FRM A;  5HLF A;  2RKI A;  4DS4 A;  5SZT A;  4FLZ A;  3QEV A;  4FJG A;  3KK1 A;  2FBY A;  3DLE A;  5CYQ A;  3K5L A;  4KAZ A;  2JGU A;  4N41 A;  1I39 A;  3RMD A;  3TAM A;  2QK9 A;  3FFI A;  3KK2 A;  3NH2 A;  5SWM A;  3V9S A;  1B9F A;  2FBT A;  2F96 A;  4DS5 A;  5J2Q A;  3KIO A;  1GOA A;  1L5U A;  2Z1I A;  3O3F A;  3ZT2 A;  5HP1 A;  4FLW A;  4E7K A;  4CGD A;  4ZTJ A;  2PYJ A;  3NH0 A;  4BDY A;  3SV4 A;  4ELT A;  1J54 A;  3DOL A;  4DF4 A;  2OPP A;  2QXF A;  3NF8 A;  1S6P A;  3CG7 A;  2EX3 A;  4OLA A;  2YKN A;  3OVN A;  3CYM A;  3PO5 A;  4CJ4 A;  4DWI A;  1JLF A;  1FK9 A;  1KLM A;  3DM2 A;  4DU3 A;  2IDO A;  3CM5 A;  4CK2 A;  4FJX A;  4KTW A;  5EU7 A;  4H4M A;  4Y1C A;  2GBZ A;  4AHV A;  1S1U A;  4ELU A;  1EXQ A;  3PV8 A;  4C8L A;  1VSF A;  3ZT0 A;  3SQ0 A;  2X6N A;  3VQ9 A;  1VK0 A;  1X1P A;  4CJU A;  4FJ7 A;  3ISN C;  2D0B A;  2YV0 X;  3KLI A;  1CXU A;  2ITG A;  4CEA A;  3TAR A;  4CEB A;  4ELV A;  4KB1 A;  1A5V A;  1QSL A;  3T19 A;  2PZS A;  3SUO A;  4F2S A;  4FLX A;  4ICL A;  1L3V A;  3ITH A;  3TAN A;  3G10 A;  2O4G A;  4W5R A;  1HMV A;  3AO1 A;  4IBN A;  3K58 A;  3DYA A;  1Q9Y A;  4M42 A;  4I2P A;  5D3G A;  3ZSV A;  2YNG A;  1KFD A;  2E4L A;  4JS4 A;  2XY6 A;  4JS5 A;  1RTI A;  3KLG A;  3TI0 A;  1TKD A;  2YKM A;  4KKO A;  3QET A;  3V1O A;  4O5B A;  4FLV A;  4DSE A;  3NH1 A;  2KFN A;  1GOB A;  4HTU A;  1U45 A;  4KO0 A;  1TKX A;  3ZT1 A;  2XRI A;  1LW2 A;  4CFA A;  2XY8 A;  4E89 A;  4EP4 A;  4FLU A;  4KHU A;  2Z1J A;  4BWM A;  1WAJ A;  4N56 A;  4Z4E A;  3NF6 A;  3VQC A;  4W5Q A;  1HQU A;  1YT3 A;  3MXM A;  4CK3 A;  1VSM A;  4E19 A;  4K8X A;  5E41 A;  1WNS A;  3AV9 A;  4LH4 A;  4B8C A;  3KD5 E;  2DFF A;  3F73 A;  4CHQ A;  4LH5 A;  3OYE A;  3U6F A;  1N6Q A;  4O55 A;  2D0C A;  4Z0U A;  2VG7 A;  3ULD A;  4CJF A;  4DSK A;  4CGF A;  1SL0 A;  2E6L A;  1BI4 B;  5HRS A;  1KVA A;  4CE9 A;  4B9V A;  1RT7 A;  4OKK A;  1EX4 A;  3DMJ A;  1HJR A;  1VSL A;  4M3Z A;  3SCX A;  2B6A A;  4FZZ A;  3CFR A;  3THV A;  2RPI A;  3HO1 A;  4IFY A;  1WAF A;  2W42 A;  3H08 A;  4FJN A;  3OYJ A;  4CJP A;  3L8B A;  1IKX A;  3OYG A;  3IAY A;  4CCH A;  4F2R A;  2HHQ A;  3AVH A;  4Q5V A;  2JLE A;  1NJX A;  3SNN A;  1RT3 A;  4RW6 A;  4F3T A;  5KI6 A;  4DSF A;  1NOY A;  4JRQ A;  1BHL A;  4KB0 A;  1LW0 A;  3L2U A;  2EHG A;  2P51 A;  3VQ8 A;  4CF9 A;  3SUQ A;  1CZB A;  1LWC A;  2BGG A;  2X74 A;  1YTA A;  1J53 A;  2YNI A;  2XY5 A;  4DQQ A;  1IKV A;  4E1N A;  3PY8 A;  4FK4 A;  1TAU A;  1ITG A;  3AVL A;  4IFV A;  4C8N A;  1JXB A;  1RBT A;  4CF0 A;  4DTS A;  3PX4 A;  1NK7 A;  1SKR A;  3C6U A;  3HVT A;  4CJS A;  1RT5 A;  3MXJ A;  2WOM A;  3T1A A;  4MQ3 A;  1DTQ A;  4B9M A;  1IKW A;  3SQ1 A; 
#chains in the Genus database with same CATH topology
 4DFP A;  4YDU A;  4CD3 A;  4U7B A;  3M8R A;  3OS2 A;  1UWB A;  2VGN A;  4JV5 K;  3M8P A;  3CJB A;  4DV3 K;  1QE1 A;  1JKH A;  3D0P A;  4OPA A;  4KV8 A;  1LOT B;  1QQM A;  3TPQ A;  3RR8 A;  2PAV A;  1J9A A;  2UUC K;  3TAP A;  1S1W A;  4JKD A;  5FDL A;  4CBW A;  4H5R A;  3VEN A;  3AVF A;  4BRP A;  1TK8 A;  1TVR A;  1L3U A;  4GMJ B;  2E1Z A;  5BRH A;  2E1Y A;  2HHX A;  3BEX A;  2KZZ A;  4IO9 L;  2OZS A;  5AQQ A;  4HHT A;  4DFJ A;  4CZJ A;  5E84 A;  5LMN K;  3R9P A;  2IIR A;  3L2W A;  1CLQ A;  4KTQ A;  3OJS A;  3G0Z A;  1GLJ O;  3EL2 A;  1KFS A;  2P1J A;  3QES A;  3F9K A;  3P83 D;  3OTO K;  1S3X A;  1ZBF A;  4X65 K;  3WEE B;  4IG3 A;  2E8A A;  1N32 K;  4KH4 A;  4CEE A;  1CZ9 A;  3VOV A;  4CJ3 A;  1C0U A;  4NXN K;  4FLY A;  3O6W A;  3JYT A;  3DOK A;  5AFU H;  1NGC A;  2GWK A;  4CFB A;  1WSH A;  4BRF A;  2F4V K;  4Z4H A;  3DI6 A;  4HUF A;  2A1R A;  3H3N O;  1ZBH A;  1N5Y A;  4FWQ A;  4BRL A;  2UYT A;  4GNI A;  4JK9 A;  3CCJ N;  3ZX3 A;  3CJA A;  3WXI A;  4OPJ A;  2G8I A;  3K5O A;  1S6Q A;  2P9U A;  3G6E N;  3JAM O;  1RT6 A;  1IBL K;  2CH5 A;  4DTX A;  3U8X A;  2KLA A;  4E1M A;  1C6V A;  3PIO L;  2I5J A;  1NJZ A;  3M8Q A;  2IC3 A;  3W3D A;  3SQ2 A;  1NKE A;  1WSG A;  4JHD B;  3TAB A;  4JN4 A;  2G8F A;  1F21 A;  5AQP A;  4O8U A;  4BRE A;  4CZI A;  4DFK A;  4B3T K;  1IJJ A;  4XIU A;  3O9R A;  3V1Q A;  1VQK N;  1BCM A;  1FXX A;  1BU6 O;  4IKF A;  3MMV A;  1NGH A;  2WC9 A;  4CK1 A;  4DU4 A;  1X9S A;  3ZSQ A;  4WFA L;  3SMS A;  3TWH A;  4FJJ A;  2P9S B;  3DLL L;  2QWM A;  1QHA A;  3K0S A;  4CJQ A;  1HQE A;  1ATR A;  2DY4 A;  4BRG A;  3EE8 A;  2GEL A;  1HNI A;  3E9O A;  1QQN A;  4X62 K;  5BR8 K;  1UA1 A;  4HCB A;  3IKM A;  2D0A A;  3U9D A;  1JXE A;  5LY3 A;  4ZTF A;  1N8R O;  1BO5 O;  3VQ5 A;  1W2B M;  1C0T A;  3EZW A;  4KHQ A;  4A59 A;  3QIN A;  4QS8 A;  4B1Y B;  1NKB A;  2O8D A;  4AIL C;  3KZB A;  1O1W A;  1JCE A;  3LDL A;  3V9U A;  3HJF A;  1MA9 B;  5C15 A;  5GAE P;  3OW2 M;  2P9L A;  4AM6 A;  4Z4I A;  5AQW A;  2P9N A;  5EY4 A;  1D9F A;  3MED A;  3QBW A;  4B1Z A;  4EAH D;  4JLH A;  1L3T A;  4DQS A;  1SKS A;  3AVA A;  2P5O A;  1NG9 A;  5GIP A;  2ASP A;  4FSV A;  1NJY A;  3IUC A;  3L3U A;  3DLR A;  3O4W A;  4BE0 A;  1Z26 A;  3A0I X;  4I9L A;  4ID1 A;  4NCG A;  4ID5 A;  3ULE B;  4CVN E;  3S9H A;  1T8E A;  3IRX A;  2ATQ A;  4ILH A;  3THW B;  1ZC6 A;  4F4K A;  1KSP A;  4W5O A;  4K42 A;  4JI2 K;  3D2F B;  1VRT A;  3CF5 L;  4Z4C A;  4BDZ A;  4BQL A;  4AHU A;  3B8A X;  3TSU A;  2A41 A;  1FKP A;  3MEE A;  2A3Z A;  1V4T A;  3BGR A;  4BE2 A;  2KFZ A;  3LDO A;  4WQ5 C;  2LSN A;  3T7Z A;  3NMU A;  4GY2 B;  4CJR A;  4W5N A;  3AA5 X;  1IG8 A;  2VYP A;  3ZYY X;  2GX9 A;  5IT9 O;  3OYF A;  2YNH A;  3HZ6 A;  3A8Y A;  1Y97 A;  3KLE A;  4DFM A;  4LFA K;  4FJM A;  3I33 A;  4Z4G A;  4DQR A;  1KVC A;  3HL8 A;  3NGZ A;  5BN9 A;  3C65 A;  4JI4 K;  1R59 O;  1WUA A;  5I3U A;  4CHP A;  3LZI A;  2O8E A;  1FKO A;  2X6S A;  3HPH A;  3VQP A;  3G25 A;  3SBG A;  4YOT A;  3AVN A;  4Z4F A;  5T7B A;  3LWL A;  2KW4 A;  2QA4 N;  2PBD A;  2PY5 A;  4Z94 A;  3RRG A;  4KBO A;  5AQI A;  1TKT A;  1WOQ A;  5KRT A;  3WNH A;  3OJU A;  5KQD A;  2G8U A;  4FJH A;  5KGX A;  1A5X A;  3UKR A;  1T6D A;  1VQP N;  4B9U A;  3SZ2 A;  1NMD A;  4DUZ K;  1RBS A;  4MO4 A;  4ISG A;  3ZT4 A;  4DV2 K;  2UUB K;  3QEP A;  1JLA A;  1LV5 A;  3I56 N;  4L8R B;  1X9J A;  2YHB A;  3LAM A;  4YOW A;  1UAX A;  1SAZ A;  3LDQ A;  3OHR A;  1TKZ A;  3AA4 A;  4JKA A;  4B9Q A;  4CEO A;  1NGI A;  4J2D A;  3V81 A;  3NBP A;  3L2Q A;  2HHT A;  4OKJ A;  4I6M B;  1X3N A;  4FWN A;  1NWK A;  4BDP A;  2QWO A;  4FJ5 A;  3T1Y K;  1NGG A;  3H45 C;  5I9E B;  3QEX A;  3HP6 A;  3SAH A;  4JKE A;  1WBD A;  4N76 A;  1LWE A;  3KVG A;  2BAN A;  1DKG D;  2BTF A;  4EP5 A;  4WFB L;  5KGW A;  1XUP O;  3JSM A;  3OS1 A;  2FSN A;  3VGL A;  5ELZ A;  1JLQ A;  1SL1 A;  4E1J A;  4H0O A;  3PO4 A;  1J6Z A;  3SBT A;  4CFC A;  4PUO A;  1VSD A;  4FZY A;  3SAF A;  4RW9 A;  1BI4 A;  2HBL A;  5LMU K;  3OBW A;  3SJH A;  1QZ6 A;  4Q0B A;  2FBV A;  4DQI A;  3CD6 N;  1M90 O;  4IWV A;  3O08 A;  2NLX A;  4CZH A;  2W6L A;  4V19 S;  1SQK A;  4J8F A;  5ADX A;  1U48 A;  1RDD A;  4O0I A;  4RCH A;  1QVF M;  2JGU A;  4BRN A;  3RMD A;  5FPE A;  3FFI A;  3NH2 A;  1B9F A;  2FBT A;  3H3O B;  4DS5 A;  3KIO A;  3CJ9 A;  4JKF A;  3O3F A;  4FLW A;  4RWT A;  4E7K A;  2PYJ A;  3NH0 A;  5GIO A;  4PHT X;  2QXF A;  1S6P A;  2EX3 A;  2YKN A;  3VEW A;  4BG9 A;  1FK9 A;  1P90 A;  2IDO A;  4CK2 A;  3CCL N;  5AQU A;  5C2F A;  4ELU A;  1EXQ A;  3VQ9 A;  3TAR A;  4CEA A;  4KB1 A;  2FSJ A;  2PZS A;  3SUO A;  4ICL A;  3J80 O;  4K25 A;  1HMV A;  5MLC Q;  3K58 A;  1OH5 A;  4I2P A;  4HWI A;  2E4L A;  2IVN A;  5GAD P;  2XY6 A;  2QEX N;  4BRM A;  4MO5 A;  3TI0 A;  4IFE A;  3QET A;  5BPM A;  1JCG A;  1M1K O;  2F7T A;  2NZT A;  3NH1 A;  4QS9 A;  1GLC G;  4HTU A;  4EP4 A;  3P31 A;  3WQU A;  4KHU A;  3O80 A;  2Z1J A;  4N56 A;  4H0X B;  1YJN N;  3MXM A;  4CK3 A;  1WNS A;  1ATN A;  5LL6 Z;  1U2V A;  5H1S Q;  1TYQ B;  4LH4 A;  2F9T A;  3F73 A;  1N6Q A;  4O55 A;  2D0C A;  3NVK A;  4UY8 O;  2HMP A;  2E6L A;  5HRS A;  5AQV A;  2A5X A;  1X3M A;  4IZ9 A;  4OKK A;  5HL7 L;  4B9V A;  1EX4 A;  3VPZ A;  3WUH A;  4FZZ A;  3CFR A;  2RPI A;  4IFY A;  4CZK A;  2W42 A;  4FJN A;  3NVM A;  3TU5 A;  2HHQ A;  2YHY A;  2JLE A;  3SNN A;  2CGK A;  1YF5 L;  4RW6 A;  4BC4 A;  1E3M A;  3VEV A;  3SUQ A;  1LWC A;  1YTA A;  3CCU N;  1J53 A;  2YNI A;  5GAH P;  1IKV A;  3PY8 A;  2NNW A;  5B8H A;  1TAU A;  4IFV A;  4CF0 A;  1JXB A;  4DTS A;  4H03 B;  4GV6 A;  3HVT A;  4CJS A;  1RT5 A;  3MN5 A;  4B9M A;  1OVY A;  1OKJ A;  1VQ6 N;  4WQ4 A;  2QWR A;  2IAJ A;  2J4R A;  3HT3 A;  3OYA A;  1EO1 A;  1Q7Y O;  4OPK A;  1WB9 A;  2A6A A;  2G8V A;  3KTQ A;  3L3V A;  1NLV A;  3SK3 A;  3D2E B;  3THX B;  4QCL A;  1IH7 A;  4DQP A;  2PYL A;  1IO2 A;  3VER A;  4CJK A;  3MAQ A;  1WSE A;  1T7P A;  4JRP A;  4UQG A;  3C6H A;  4M63 C;  3QFU A;  4AQY K;  1SS6 A;  1BUP A;  3QER A;  3E01 A;  4W5T A;  5JVH L;  1YIJ N;  3O9Q A;  2OPR A;  4OJR A;  3ZX2 A;  4CBU A;  2Q36 A;  4M3X A;  3CCV N;  3VA0 A;  1NGA A;  4C8O A;  1B9D A;  1RBV A;  3VES A;  3V9W A;  4LF5 K;  4MFB A;  1NM1 A;  1S1X A;  3RSE B;  1BCO A;  4NYN A;  3NGY A;  2Q0R A;  1C1B A;  3O8M A;  1MWM A;  3ZT3 A;  1HYZ A;  2D0P A;  4IEI A;  2Q3S A;  4Y1D A;  2OTJ N;  1U04 A;  4EZ9 A;  4FK0 A;  2XY7 A;  4FWM A;  3UKU B;  1SV5 A;  1S5J A;  4G9Z A;  2UXB K;  2NRX A;  1CXQ A;  3TAG A;  4XH4 A;  4CD1 A;  3DRR A;  1D5A A;  2QXL A;  3KKR A;  1BWF O;  2O8C A;  3K59 A;  4FWO A;  1ZBI A;  1HNX K;  5BPN A;  4FWR A;  1RFQ A;  2Q0U A;  2F9W A;  3C94 A;  1XC3 A;  1QHT A;  3CQ8 A;  3WNF A;  3WXM B;  1DT9 A;  4PL8 A;  3G4S N;  3EKS A;  4JK7 A;  3VQ4 A;  1I3A A;  3CJC A;  3CMA N;  4E7H A;  4B08 A;  4K41 A;  1LWF A;  5AQO A;  4HVJ A;  2E88 A;  5TKW A;  4CIG A;  2VWB A;  1MU2 A;  2KTQ A;  1Q81 O;  2HVH A;  1G99 A;  3UIQ A;  4M41 A;  4GKJ K;  3ZSY A;  4JI6 K;  3B6O A;  4FW1 A;  4JKB A;  1MWK A;  1REV A;  2XHB A;  5M1N A;  1QVG M;  1BA0 A;  3O5B A;  3N4P A;  3VA3 A;  2HB5 A;  2VGM A;  1IBM K;  4EFH A;  2YJF A;  2YHA A;  3U9Z A;  2OYQ A;  1VHX A;  2D5R A;  4HUG A;  3F9M A;  3LWM A;  4E0D A;  3W0L A;  2O8F A;  1NJW A;  1W9H A;  4YNQ A;  4LF6 K;  2P9U B;  1V4S A;  2DPN A;  4CHN A;  5JLF A;  4DTM A;  5BR9 A;  3SUN A;  3I0R A;  4YOX A;  1RBR A;  3J81 O;  4JD2 A;  3AO5 A;  2ASO A;  3HOT A;  4I7F A;  3CCR N;  3DLG A;  4GV9 A;  3T1H K;  4DR4 K;  2UXD K;  4AHS A;  1NGD A;  3VQB A;  1XQS C;  3P39 A;  3K5M A;  4BVP A;  1DLO A;  2IVO A;  3O9U A;  3ZSW A;  3TAQ A;  2V7Y A;  4K43 A;  4BRA A;  3I8D A;  1RT4 A;  3OA9 A;  3LDS A;  2IVP A;  5J1E A;  4FJ8 A;  1KVB A;  3ZET A;  3NDK A;  3V9Z A;  4B8A B;  2B5J A;  1BA1 A;  1VQL N;  3VQD A;  3PUF A;  3DLK A;  1TL3 A;  5KPR A;  2AP1 A;  2P9I A;  3O1B A;  4C8M A;  3HI0 A;  2FF6 A;  5C2D A;  3O1W A;  3HYF A;  3MEG A;  4B9N A;  4GKK K;  2HW3 A;  1VQ9 N;  3VQ7 A;  3NF7 A;  2G8K A;  1KAY A;  3DXK A;  4FLT A;  2O8D B;  4JKH A;  1QSY A;  1RTD A;  4CEQ A;  5CE3 A;  2ITM A;  5AZI A;  2W6K A;  3MWT A;  5F2R A;  3WQT A;  5BRF A;  4YDU C;  2NRH A;  4NCB A;  3FZM A;  2P9L B;  4HUE A;  3E9P A;  2P9N B;  2JWK A;  5J2P A;  4LSN A;  2ZD1 A;  4ISF A;  3HPO A;  1YHQ N;  3J7Y P;  3E1Y A;  4KPY A;  1WBB A;  4FPB A;  2A42 A;  3MCP A;  1X9M A;  3BDP A;  5HOO A;  3ENO A;  2HHW A;  1E4F T;  3HK2 A;  4CHY A;  2RE2 A;  3MDQ A;  2WTU A;  3OY9 A;  1R0A A;  4DTJ A;  3DLB A;  4J2B A;  5DK5 A;  5KRS A;  3S3O A;  5F1X A;  1GLD G;  4FWS A;  3HM9 A;  4CBX A;  1MDU B;  4DHY A;  3CET A;  2YI1 A;  1VSI A;  1ZBL A;  1A5W A;  4NXM K;  3PIP L;  1BG3 A;  3V9X A;  4DTU A;  2FXU A;  2YHW A;  2G8W A;  4FVU A;  1SL2 A;  4H0Y B;  4DG1 A;  1RCH A;  1L3S A;  3SI6 A;  4F8R A;  3QEW A;  3KWI A;  3JXU A;  4PY5 A;  3G71 N;  3TAF A;  1NK4 A;  3CCE N;  1XMO K;  2KZM A;  1BQM A;  3OYH A;  3QB0 A;  2O4I A;  1T44 A;  4BRQ A;  4QAG A;  3CCS N;  4KHW A;  3RRH A;  4EHT A;  4TSX A;  4DTP A;  1ASU A;  3AVK A;  4YHH K;  2F8T A;  1NMN A;  4M7Y A;  3CFP A;  4WYB A;  1I94 K;  4CJ5 A;  2O8E B;  5C0Y A;  3CC2 N;  5JMV A;  1HYS A;  1VQN N;  4CEZ A;  1EWQ A;  2I7N A;  1BIS A;  2RHK A;  5HRR A;  5HRO A;  3HP9 A;  3OYD A;  3VET A;  2QKK A;  2HHS A;  2X78 A;  3SLC A;  3UKR B;  4H8K A;  5FRM A;  4DS4 A;  3QEV A;  4FJG A;  4BR5 A;  1FJG K;  3KK1 A;  4H5N A;  2QK9 A;  4BVO A;  4OX9 K;  5SWM A;  3ZEU A;  5J2Q A;  5EXW A;  1L5U A;  4JI0 K;  3RVC A;  4CGD A;  5KPT A;  4DV7 K;  4DQ8 A;  4BDY A;  2GTD A;  3DOL A;  4DF4 A;  3NF8 A;  5BRE A;  2OAN A;  4DWI A;  4DU3 A;  3DM2 A;  4LF9 K;  5EU7 A;  4AHV A;  2GBZ A;  1S1U A;  5E26 A;  4C8L A;  3ZT0 A;  3SQ0 A;  2X6N A;  1KAZ A;  4CJU A;  3ISN C;  2KKZ A;  1OVQ A;  3R1X A;  5M1K A;  3GDQ A;  5AQG A;  3T19 A;  4F2S A;  4FLX A;  5AQH A;  3ITH A;  5CHI A;  1YJW N;  3DYA A;  4M42 A;  2GUP A;  3ZSV A;  4JS5 A;  3KLG A;  3CME N;  2YKM A;  4KKO A;  3V1O A;  3IFR A;  3M5R A;  1U45 A;  2V51 B;  1TKX A;  3ZT1 A;  2XRI A;  3GOI A;  4E89 A;  3DXM A;  2HBJ A;  4BWM A;  3VQC A;  1YT3 A;  4MDB A;  4E19 A;  3E66 A;  3AV9 A;  2DFF A;  1GLA G;  3EO3 A;  3MX2 A;  4DKW A;  4JI3 K;  3FFK B;  2I7P A;  1ZXO A;  3ULD A;  4IOA L;  4CGF A;  5F0X A;  1BI4 B;  1K73 O;  1RT7 A;  2CGJ A;  2QTD A;  4DV4 K;  3DMJ A;  4M3Z A;  4FWL A;  3THV A;  1WAF A;  3FLC O;  1IKX A;  3IAY A;  4F2R A;  1C0G A;  1NJX A;  4F3T A;  1RT3 A;  3VTH A;  4PKG A;  5KI6 A;  1NOY A;  3D6R A;  3ENB A;  2P51 A;  5EOY A;  2VQE K;  4DQQ A;  4E1N A;  1ITG A;  4C8N A;  1SKR A;  4MQ3 A;  1IKW A;  4CZG A;  4B9S A;  3MEC A;  1GOC A;  2CGL A;  3VQA A;  1KTQ A;  2VG5 A;  5JS1 A;  3DLH A;  4LF8 K;  3FZL A;  1WLJ A;  3CC4 N;  4AH9 A;  4C1N K;  4OO1 J;  1XNR K;  3A5N C;  3KK7 A;  4O0J A;  1GLL O;  3LZJ A;  3ATU A;  4M3U A;  2P9P A;  4M3T A;  3AO2 A;  1HKB A;  4A5B A;  1NGJ A;  3LAL A;  2ETJ A;  3RMB A;  1GLE G;  1VQ8 N;  4O4G A;  4BWJ A;  3EZ5 A;  4FXD A;  1RT1 A;  4IO8 A;  3BZK A;  2HND A;  1IKY A;  3D45 A;  2R7Y A;  3RMC A;  3M6G A;  1KQS M;  4PL7 A;  1U2V B;  1DEJ A;  1TAQ A;  2Q2R A;  2Z1G A;  4ILJ A;  2E2Q A;  3BF1 A;  3WXK A;  4DR1 K;  4CJE A;  2GV9 A;  5AQF A;  3EYZ A;  4RW4 A;  3R3L A;  5CR4 A;  3KKS A;  1JLE A;  3H46 O;  5FLX O;  5HBM A;  2XO7 A;  2RF2 A;  1Y64 A;  2GEM A;  4M3W A;  2QWN A;  4DUY K;  4YOU A;  3SYZ A;  2PFU A;  1RTJ A;  3I0S A;  1WN7 A;  4B1V A;  2E2P A;  1EET A;  4JKG A;  4KI4 A;  3ZLJ A;  4EIA A;  4PA1 A;  2E20 A;  3VQE A;  1TV6 A;  4CI6 A;  1T03 A;  4AHC A;  2BUP A;  3L2R A;  2UU9 K;  2D1K A;  3TTC A;  4CHO A;  4FWP A;  3VMF B;  4CEF A;  4KHS A;  4RG8 A;  2QWL A;  5FRO A;  3VN5 A;  1G15 A;  3EKU A;  3IDH A;  3ATV A;  1HJO A;  1XWL A;  1W0H A;  3KLH A;  2BDP A;  1NNE A;  1HX1 A;  3O9T A;  3VF4 A;  4GVE A;  3NGI A;  2NRV A;  2BH1 A;  4BRK A;  4FZX C;  3OYK A;  5AQS A;  4I2Q A;  3GL1 A;  2DTU A;  3WXJ A;  3EE9 A;  4XH1 A;  5C42 A;  5J2N A;  3CJ1 A;  3O4N A;  4KRF A;  3CI5 A;  3PSI A;  1KAX A;  4JK8 A;  5AQK A;  4KTZ A;  1HNV A;  3H1V X;  3M1F A;  1NK5 A;  4DTN A;  3CJ7 A;  4B1X B;  3WNG A;  1LAV A;  1W7A A;  3MCA B;  4DR5 K;  4KHN A;  3KJV A;  3NAE A;  2W40 A;  1JLC A;  4JNE A;  1OH6 A;  3F5T A;  3AVG A;  4A5A A;  4IJN A;  4YOV A;  1K8A O;  2WON A;  3DJC A;  3P1G A;  3C7N A;  4BAC A;  2WBN A;  3L4Q A;  1K8K A;  3S41 A;  4O5F A;  5AQT A;  1Q9X A;  3U4L A;  3B6P A;  4AHT A;  1ASV A;  1NOZ A;  1Q18 A;  3DAW A;  3OYB A;  4LFC K;  5BN8 A;  4KI6 A;  3GBT A;  4IOC L;  3P38 A;  1BDG A;  4KHY A;  1SUQ A;  2NUB A;  3A5O C;  3I55 N;  2GUI A;  3MN6 A;  2E2N A;  3CQY A;  2O8B A;  3WNE A;  3HRG A;  2O8C B;  4E7J A;  3TR8 A;  3VF6 A;  2IGI A;  3NE6 A;  5AQY A;  3AVC A;  3QO9 A;  2FSK A;  5AQR A;  1XMQ K;  1HNW K;  3GE1 A;  5FPM A;  1RDU A;  4DU1 A;  3HST B;  4CER A;  3H6E A;  2V52 B;  4U67 L;  3OS0 A;  2KQ2 A;  3QML A;  2P9K A;  1LAW A;  4N5S A;  3A5L C;  1NU0 A;  4FJK A;  3U3G A;  3N4Q A;  5AQJ A;  1EKE A;  2ZQB A;  3K9J A;  1UA0 A;  4M45 A;  5K14 A;  4BRO A;  5AQZ A;  4DTO A;  1NKC A;  3I8B A;  4WE1 A;  3A2F A;  1BIU A;  3RWU A;  3QIO A;  3AO3 A;  1U47 A;  5AQM A;  5JLH A;  1XHZ A;  1GLF O;  3OYN A;  3IS9 A;  4NLB A;  4FJI A;  4WQ4 C;  1Q8I A;  5HRP A;  1ASW A;  3RR7 A;  3THY A;  3S3N A;  1TUU A;  1XHX A;  4FVM A;  1S9G A;  4ILG B;  2HF4 A;  5CY4 A;  1BL3 A;  4RW7 A;  4BR7 A;  2O8F B;  3ZSO A;  2W41 A;  4OGC A;  3PX6 A;  1JLB A;  2YJE A;  4H0T B;  3CQX A;  2AJQ A;  2KHO A;  5AJ3 K;  3MXI A;  4YY3 K;  1RDA A;  1VSE A;  1BQN A;  3ID6 A;  5DM6 L;  3ZCM A;  4JD2 B;  2ZF5 O;  2VWJ A;  1JL1 A;  4OVL A;  3IG1 A;  2HNZ A;  4GVM A;  3LP0 A;  3AAP A;  4A62 A;  3VEO A;  3DWL A;  4FCY A;  1H1V A;  3FZF A;  2Q1N A;  3O9S A;  1RIL A;  2V7Z A;  2ZJR L;  3AVJ A;  4FL9 A;  1TK5 A;  2FLO A;  1J5E K;  4PQU A;  4E7L A;  3LM9 A;  3VEY A;  4FK2 A;  5AZJ A;  5C25 A;  3AVM A;  1YVU A;  1C1C A;  2OZM A;  3NF9 A;  3QDK A;  3ZET B;  2YNF A;  3QBX A;  4CJT A;  1TUY A;  1EWR A;  1D4X A;  1ZBU A;  3EN9 A;  4BR0 A;  4CZF A;  2P5G A;  1RDB A;  5GAG P;  2BE2 A;  2QW9 A;  4DTR A;  1SKW A;  2P9I B;  4CEC A;  2IOC A;  2VWK A;  2OCE A;  3AY9 A;  1NGE A;  2HNY A;  5FRN A;  3C6A A;  5C24 A;  3ASM A;  2YCH A;  3DXK B;  1B92 A;  3KLF A;  3K57 A;  3TSQ A;  1KD1 O;  4M3Y A;  4HCC A;  1X9W A;  5AZI B;  3HOS A;  5BRD A;  3F2K A;  4L3Q A;  1VAZ A;  4WCE L;  2QWQ A;  2QWP A;  3AVI A;  4IJA A;  1RDW X;  4H0P A;  4BQZ A;  5HLF A;  2FBY A;  4N41 A;  1I39 A;  3KK2 A;  2FF3 B;  1HUX A;  1GOA A;  5HP1 A;  3SV4 A;  1J54 A;  2OPP A;  3CG7 A;  2E5L K;  3CYM A;  1JLF A;  3CM5 A;  1C0F A;  4H4M A;  4Y1C A;  2HBM A;  3LM2 A;  3QFP A;  4FJ7 A;  2D0B A;  2YV0 X;  3KLI A;  1CXU A;  2EWS A;  1VQO N;  4ELV A;  1QSL A;  4B3S K;  3AGR A;  1XNQ K;  1L3V A;  3TAN A;  3SMP A;  3T69 A;  3AO1 A;  3CCM N;  4IBN A;  2E2O A;  3MX5 A;  4O5B A;  3CC7 N;  4C1N I;  4KO0 A;  1Z6R A;  4FLU A;  2HBK A;  4Y0W A;  4Z4E A;  3NF6 A;  4BC2 A;  4M7X A;  1VSM A;  4K8X A;  5E41 A;  4B8C A;  3KD5 E;  3CPE A;  4MLE A;  4CHQ A;  3OYE A;  3U6F A;  3LL3 A;  3WEE A;  4B1W B;  2VG7 A;  2WUS A;  4CJF A;  3WXL A;  1KVA A;  4CE9 A;  2WFB A;  4WQ5 A;  1HJR A;  3HBT A;  1VQ4 N;  3VGM A;  5AFU A;  3HM8 A;  1YVN A;  3HO1 A;  3SAG A;  2ZWH A;  3OYJ A;  4CJP A;  3L8B A;  1T3V A;  4CCH A;  3AVH A;  1VQ5 N;  3BF3 A;  4JRQ A;  1BHL A;  4DCH A;  3D7E O;  2EHG A;  1CZB A;  2X74 A;  3ZEU B;  2H3G X;  3AVL A;  3CHW A;  1RBT A;  4DR7 K;  2HF3 A;  3FE1 A;  1S22 A;  3MXJ A;  1NJI O;  2WOM A;  1FW6 A;  3VQQ A;  3SQ1 A;  1TL1 A;  3BP8 A;  1QS4 A;  4MLH A;  4N47 A;  3VGK A;  3OYI A;  2ZGY A;  1JJ2 M;  4CZM A;  5TKY A;  5DMR A;  4CZL A;  1YUW A;  3QIP A;  4JHD A;  3QNN A;  1VQM N;  2FC0 A;  3SPZ A;  4CGG A;  4PKH A;  1NK6 A;  4JEP A;  1KXP A;  4DB3 A;  3U3Y A;  3Q7B A;  1ZBS A;  1KRP A;  1BOT O;  4PWD A;  3L4I A;  1RDC A;  1VRU A;  3DRP A;  4A2B A;  3LDN A;  4OPH A;  4CHZ A;  1ZYQ A;  1TK0 A;  2P9S A;  3CPW M;  5KTQ A;  4NB4 A;  3GG4 A;  4GV3 A;  3J7A P;  2HHU A;  3FGU A;  4X66 K;  3QEI A;  4F3O A;  2F8S A;  4B9T A;  2DFH A;  3DXM B;  3NFA A;  3LAK A;  3AVB A;  3O3H A;  3A5M C;  2AA4 A;  3KK3 A;  3HTV A;  4CGI A;  5CZ1 A;  4CF8 A;  3S3M A;  1YI2 N;  1ATS A;  4NLC A;  4FOI A;  4KH5 A;  4CGJ A;  2G8H A;  4KFB A;  3JS6 A;  2ZGZ A;  3SQ4 A;  3OYL A;  4BGA A;  2ZE2 A;  5I42 A;  2Z1H A;  1RGI A;  2NRR A;  4CJV A;  4H4O A;  1J5O A;  1JLG A;  4NYF A;  4CZE A;  1BIZ A;  2HVI A;  1JL2 A;  1YTU A;  2DFE A;  3VTI A;  1WSF A;  3K2P A;  4B1U B;  3CIP A;  3CCQ N;  1RNH A;  4BC3 A;  1OH7 A;  4LFB K;  4DR3 K;  4LC9 B;  3NCI A;  4A57 A;  2A1S A;  3ZSR A;  3SV3 A;  3ZSX A;  3AO4 A;  2OPQ A;  4JKC A;  4PKI A;  2QI2 A;  3AAQ A;  1DTT A;  2OPS A;  1NBW A;  3Q7C A;  4QOZ B;  1CZA N;  3IMX A;  4J2A A;  1HRH A;  2HST A;  4KHP K;  3T3F A;  4AM7 A;  3TSP A;  3NHG A;  3ULE A;  1T6C A;  3O4Q A;  1E4G T;  3LPT A;  1S72 N;  4DLE A;  3OYC A;  3VQ6 A;  4G1Q A;  3THW A;  5JIC A;  1HKC A;  1VSH A;  4KH6 A;  3D2F A;  4DSL A;  4RW8 A;  3SJJ A;  2B4J A;  2P9P B;  4XH5 A;  2VG6 A;  4FJL A;  3AA2 A;  1EP4 A;  1S1T A;  3CM6 A;  4WF9 L;  3DRS A;  4DLG A;  1UOC A;  4DV6 K;  3FZK A;  1C1A A;  2Y1J A;  3ZSZ A;  4DMN A;  3M8S A;  4HTL A;  5ADX H;  5KQ8 A;  4FWK A;  4AF1 A;  4IOX A;  4A2A A;  3CER A;  5BPL A;  2E6M A;  1JCF A;  3L0Q A;  3ALY A;  3KWG A;  2QKB A;  5M1F A;  4E3S A;  1QQO A;  2GWJ A;  2FBX A;  3BY5 A;  5CZ2 A;  4FJ9 A;  5M1O A;  5CYM A;  3V4I A;  2NRW A;  1KC8 O;  5AQL A;  4B3O A;  4BRI A;  2HHH K;  4WFN L;  3RTV A;  1IG9 A;  4FO0 A;  2Q97 A;  1HNZ K;  4CGH A;  2YX6 A;  5HRN A;  4BGB A;  2HMI A;  4DV0 K;  4OGE A;  3P5J A;  4OKE A;  4BRH A;  5C10 A;  1Z05 A;  4LD0 A;  4CES A;  2IS3 A;  1NK8 A;  4MDA A;  5LJV A;  4FM0 A;  3LP1 A;  2QM1 A;  4B9L A;  2VQF K;  1IV0 A;  1KLN A;  3PX0 A;  4JKG B;  5IWA K;  3M3Z A;  4CJ7 A;  3LDP A;  3C6T A;  2A40 A;  1K9M O;  4E7I A;  4B3M K;  4EZ6 A;  1TGO A;  1K6Y A;  1NK0 A;  4J2E A;  1U6Z A;  3EY1 A;  5JS2 A;  1S1V A;  3VEZ A;  3ZX0 A;  4M3R A;  2RN2 A;  4I6M A;  4JI7 K;  4ZHR A;  2HHV A;  4LY7 A;  4QS7 A;  1D8Y A;  1N36 K;  1GLB G;  4LF4 K;  1WSI A;  4CF2 A;  4DF8 A;  4YFU A;  3HPG A;  3LPU A;  4R79 A;  1RBU A;  2JWL A;  3AA3 A;  2OA8 A;  1QSS A;  4O8K A;  2D4W A;  3CXC M;  4DV5 K;  1D9D A;  1RTH A;  3OYM A;  1W97 L;  3CFO A;  3J7Z O;  3RMA A;  5GIN A;  4BR4 A;  3KHY A;  1Q82 O;  4CFD A;  5DM7 L;  4EHU A;  4H5V A;  4FM1 A;  1ILY A;  2ZJQ L;  4JI8 K;  1U49 A;  4CJW A;  1HKG A;  4NCA A;  4K0K K;  1WSJ A;  2UXC K;  4I9Q A;  3C7N B;  1HYV A;  4CED A;  3LP2 A;  3O3G A;  1K8K B;  4A61 A;  5EX5 A;  3C95 A;  5JVG L;  1VQ7 N;  3SPY A;  3TAE A;  3OBY A;  3H1Q A;  1DGK N;  4FM2 A;  1BGX T;  5A2Q O;  4BC5 A;  1XI1 A;  4FYD A;  4BR9 A;  4FPA A;  4OLB A;  1VSJ A;  2OTL N;  4JYA K;  4BRC A;  4IG0 A;  1VSK A;  3L2V A;  4DV1 K;  4K8Z A;  2ASM A;  2O8B B;  2VCP A;  1QQC A;  4FW2 A;  5AR0 A;  4BG8 A;  3C0B A;  1XC9 A;  3QNO A;  3LAN A;  4IEE A;  3QLH A;  3UB5 A;  4R5P A;  4O44 A;  4F9O A;  4CIF A;  5J2M A;  4IDK A;  1T05 A;  2HOE A;  4CIE A;  3SUP A;  4B3R K;  3WT0 A;  3AGK A;  4CF1 A;  4C23 A;  1LCU A;  4X64 K;  4LF7 K;  4KRE A;  4C8K A;  1HPM A;  4GW6 A;  4CJL A;  2Y1I A;  5FPD A;  1QTM A;  4H0V B;  2P9K B;  2NRZ A;  1NGB A;  3QIC A;  4DSJ A;  1N34 K;  3ENH A;  4BRD A;  2CH6 A;  5C12 A;  1HLU A;  3V6D A;  1RT2 A;  1TYQ A;  1NK9 A;  4AHR A;  3K9K A;  1SZ2 A;  5FPN A;  3L6Q A;  1Z25 A;  3MK6 A;  3V1R A;  3HVR A;  1P8Z A;  3HXM A;  4BE1 A;  1HPZ A;  1C0M A;  1U4B A;  4XEI A;  4YOY A;  1KCF A;  3LP3 A;  1S9E A;  4LSL A;  3K5N A;  4DSI A;  4JAX A;  3KD1 E;  3VF2 A;  3THY B;  1HR0 K;  3TTF A;  4IXC A;  3HSC A;  5AQN A;  2RKI A;  5SZT A;  4FLZ A;  4KAZ A;  3DLE A;  5CYQ A;  3K5L A;  3PLA A;  3TAM A;  1QZ5 A;  2UUA K;  3V9S A;  2F96 A;  3TTD A;  2Z1I A;  4BY9 C;  3VEX A;  5KPZ A;  3ZT2 A;  4ZTJ A;  4JI5 K;  2D0O A;  4H5T A;  4ELT A;  1IBK K;  4OLA A;  2ZJP L;  3OVN A;  3PO5 A;  4CJ4 A;  4H5W A;  1KLM A;  2YHX A;  3J8A A;  4FJX A;  5M1Q A;  4KTW A;  5M1P A;  3PV8 A;  1VSF A;  1VK0 A;  1X1P A;  3D2E A;  4DR2 K;  2ITG A;  3THX A;  4CEB A;  1A5V A;  4CW7 B;  5AQX A;  3G10 A;  2O4G A;  5AZJ B;  1Q86 O;  4W5R A;  3E9L A;  4RTF D;  1Q9Y A;  1OH8 A;  5D3G A;  2YNG A;  1KFD A;  4JS4 A;  1RTI A;  2NRT A;  1TKD A;  4FLV A;  4DSE A;  5LJW A;  2KFN A;  1N33 K;  1GOB A;  3BUZ B;  4JI1 K;  1LW2 A;  5EVZ A;  2XY8 A;  4CFA A;  1YAG A;  1WAJ A;  4W5Q A;  1HQU A;  1O13 A;  4FOE A;  4ISE A;  3MWP A;  3MN9 A;  3EEQ A;  4LH5 A;  3FR0 A;  1YJ9 N;  4Z0U A;  3FZH A;  3ID8 A;  4DSK A;  3P4I A;  3UE5 A;  1SL0 A;  1EQY A;  1YIT N;  1VSL A;  3SCX A;  2ZM6 K;  3R8E A;  2B6A A;  3BZC A;  4BR2 A;  4YOR A;  4NO7 A;  3RSE A;  3H08 A;  1NGF A;  3R6M A;  3OYG A;  1YXQ A;  4Q5V A;  1ESV A;  4DSF A;  4KB0 A;  1LW0 A;  3L2U A;  3VQ8 A;  4CF9 A;  2Q31 A;  2BGG A;  3UKU A;  4IDH A;  2XY5 A;  3MN7 A;  4FK4 A;  3AAR A;  3PSF A;  3PX4 A;  1NK7 A;  3C6U A;  3T1A A;  4DR6 K;  1DTQ A; 
#chains in the Genus database with same CATH homology
 1TL1 A;  4B9S A;  4DFP A;  1QS4 A;  3M8R A;  4N47 A;  3OS2 A;  3MEC A;  1UWB A;  3OYI A;  1GOC A;  2IAJ A;  3VQA A;  1KTQ A;  3HT3 A;  3OYA A;  3M8P A;  4OPK A;  2VG5 A;  5DMR A;  3QNN A;  1QE1 A;  3QIP A;  2G8V A;  5JS1 A;  3DLH A;  1JKH A;  3KTQ A;  3D0P A;  3L3V A;  2FC0 A;  4KV8 A;  1WLJ A;  3SPZ A;  4CGG A;  3RR8 A;  4AH9 A;  1NK6 A;  1J9A A;  4QCL A;  3TAP A;  4O0J A;  1S1W A;  1IH7 A;  4DQP A;  5FDL A;  3LZJ A;  3U3Y A;  4M3U A;  2PYL A;  3AVF A;  1IO2 A;  4M3T A;  1KRP A;  3AO2 A;  1TK8 A;  4CJK A;  1TVR A;  3MAQ A;  4GMJ B;  1RDC A;  1WSE A;  3LAL A;  1L3U A;  2ETJ A;  4PWD A;  1VRU A;  3DRP A;  3RMB A;  1T7P A;  4JRP A;  2HHX A;  4UQG A;  2KZZ A;  1ZYQ A;  4CHZ A;  1TK0 A;  2OZS A;  4O4G A;  5KTQ A;  4BWJ A;  4HHT A;  4DFJ A;  3EZ5 A;  2HHU A;  3VQQ A;  4FXD A;  3QEI A;  1RT1 A;  4F3O A;  3QER A;  3E01 A;  2F8S A;  4W5T A;  4B9T A;  2HND A;  2DFH A;  3NFA A;  3L2W A;  4KTQ A;  1CLQ A;  3OJS A;  1IKY A;  3D45 A;  3AVB A;  3G0Z A;  3LAK A;  3O3H A;  2R7Y A;  2OPR A;  4OJR A;  3KK3 A;  3RMC A;  1KFS A;  2P1J A;  4CGI A;  1TAQ A;  3F9K A;  3P83 D;  5CZ1 A;  4CF8 A;  3QES A;  3S3M A;  2Z1G A;  1ZBF A;  4M3X A;  4IG3 A;  4CJE A;  2GV9 A;  4CEE A;  4CGJ A;  3VA0 A;  2G8H A;  1CZ9 A;  4KFB A;  3EYZ A;  3SQ4 A;  4CJ3 A;  3OYL A;  1C0U A;  1B9D A;  4RW4 A;  4FLY A;  2ZE2 A;  4C8O A;  3JYT A;  3DOK A;  1RBV A;  5I42 A;  2Z1H A;  3V9W A;  3KKS A;  4H4O A;  4MFB A;  4CJV A;  1WSH A;  4CFB A;  1J5O A;  1S1X A;  1JLE A;  4Z4H A;  3DI6 A;  1JLG A;  4HUF A;  2A1R A;  5HBM A;  4NYF A;  1ZBH A;  1BCO A;  1N5Y A;  4NYN A;  1BIZ A;  3NGY A;  2XO7 A;  2RF2 A;  2HVI A;  1C1B A;  1JL2 A;  1YTU A;  4M3W A;  2DFE A;  3ZT3 A;  1HYZ A;  4Y1D A;  2Q3S A;  1U04 A;  1WSF A;  4EZ9 A;  4OPJ A;  3SYZ A;  4FK0 A;  1RTJ A;  3K2P A;  2XY7 A;  3I0S A;  1WN7 A;  1EET A;  1RNH A;  4KI4 A;  2G8I A;  3K5O A;  1SV5 A;  1S6Q A;  1S5J A;  4PA1 A;  3NCI A;  2A1S A;  3VQE A;  1CXQ A;  1RT6 A;  1TV6 A;  3AO4 A;  3ZSR A;  3ZSX A;  3SV3 A;  2OPQ A;  4DTX A;  3TAG A;  1DTT A;  1T03 A;  2OPS A;  4AHC A;  4E1M A;  4QOZ B;  3L2R A;  1C6V A;  3DRR A;  2I5J A;  4CHO A;  4J2A A;  1HRH A;  1D5A A;  3M8Q A;  1NJZ A;  2IC3 A;  3KKR A;  4CEF A;  4RG8 A;  3T3F A;  3K59 A;  4KHS A;  3SQ2 A;  5FRO A;  3VN5 A;  3NHG A;  1NKE A;  1G15 A;  1ZBI A;  1WSG A;  3TAB A;  2G8F A;  3O4Q A;  3LPT A;  1F21 A;  4DLE A;  3OYC A;  3VQ6 A;  4G1Q A;  1XWL A;  4DFK A;  1W0H A;  3KLH A;  1VSH A;  4XIU A;  2BDP A;  3V1Q A;  1BCM A;  1FXX A;  4IKF A;  3C94 A;  4DSL A;  4RW8 A;  3SJJ A;  4CK1 A;  2B4J A;  1QHT A;  3CQ8 A;  4DU4 A;  2VG6 A;  3WNF A;  3NGI A;  4FJL A;  3AA2 A;  1X9S A;  4FZX C;  1EP4 A;  3ZSQ A;  1S1T A;  3CM6 A;  3OYK A;  3DRS A;  4DLG A;  1UOC A;  4I2Q A;  3TWH A;  1C1A A;  2Y1J A;  4FJJ A;  2DTU A;  3ZSZ A;  4DMN A;  3M8S A;  3VQ4 A;  1I3A A;  5C42 A;  5J2N A;  4KRF A;  3O4N A;  4E7H A;  4B08 A;  1LWF A;  4CJQ A;  1HQE A;  4HVJ A;  2DY4 A;  1HNI A;  4CIG A;  1MU2 A;  4KTZ A;  2KTQ A;  2HVH A;  1HNV A;  1UA1 A;  3UIQ A;  2E6M A;  4HCB A;  2D0A A;  1JXE A;  4M41 A;  1NK5 A;  3ZSY A;  4DTN A;  3B6O A;  4FW1 A;  3ALY A;  3WNG A;  4ZTF A;  1LAV A;  2QKB A;  4KHN A;  3KJV A;  3VQ5 A;  3NAE A;  1REV A;  4E3S A;  1C0T A;  4KHQ A;  1JLC A;  2XHB A;  2FBX A;  5CZ2 A;  4FJ9 A;  5CYM A;  3AVG A;  3QIN A;  3V4I A;  1NKB A;  4B3O A;  4AIL C;  3RTV A;  3VA3 A;  1IG9 A;  1O1W A;  3V9U A;  2HB5 A;  4CGH A;  3HJF A;  2WON A;  3P1G A;  5HRN A;  4BAC A;  2HMI A;  4OGE A;  2YHA A;  3P5J A;  2OYQ A;  4OKE A;  1Q9X A;  4LD0 A;  4CES A;  4Z4I A;  2IS3 A;  1NK8 A;  2D5R A;  3B6P A;  4AHT A;  1ASV A;  4HUG A;  4FM0 A;  3LP1 A;  1NOZ A;  4B9L A;  1D9F A;  3MED A;  3OYB A;  4JLH A;  3LWM A;  1L3T A;  4E0D A;  1KLN A;  1NJW A;  3PX0 A;  1W9H A;  4DQS A;  1SKS A;  3AVA A;  4YNQ A;  2P5O A;  4KI6 A;  4CHN A;  4KHY A;  4DTM A;  1NJY A;  1SUQ A;  3L3U A;  2NUB A;  3DLR A;  3C6T A;  4BE0 A;  2GUI A;  1Z26 A;  3SUN A;  3I0R A;  4E7I A;  3WNE A;  1RBR A;  4EZ6 A;  1TGO A;  1K6Y A;  4I9L A;  4E7J A;  3AO5 A;  4ID1 A;  1NK0 A;  4NCG A;  4J2E A;  4ID5 A;  3TR8 A;  4I7F A;  3EY1 A;  3DLG A;  3S9H A;  5JS2 A;  1S1V A;  1T8E A;  4M3R A;  3IRX A;  2ATQ A;  2RN2 A;  2IGI A;  4AHS A;  3NE6 A;  4F4K A;  4ZHR A;  1KSP A;  4W5O A;  2HHV A;  3AVC A;  3QO9 A;  1VRT A;  4LY7 A;  3VQB A;  1D8Y A;  4Z4C A;  4BDZ A;  3K5M A;  1DLO A;  3TAQ A;  1WSI A;  3ZSW A;  4AHU A;  4CF2 A;  4DU1 A;  4DF8 A;  4YFU A;  3HPG A;  1FKP A;  3MEE A;  3HST B;  3LPU A;  3BGR A;  4BE2 A;  4CER A;  2KFZ A;  3I8D A;  1RBU A;  1RT4 A;  3LDS A;  5J1E A;  3AA3 A;  2LSN A;  3OS0 A;  2KQ2 A;  2OA8 A;  4FJ8 A;  1KVB A;  3NDK A;  4CJR A;  3V9Z A;  3AA5 X;  1QSS A;  4B8A B;  4W5N A;  2B5J A;  1D9D A;  1LAW A;  4N5S A;  1RTH A;  3VQD A;  3OYM A;  3OYF A;  3PUF A;  2YNH A;  3CFO A;  3DLK A;  4FJK A;  1TL3 A;  3RMA A;  3U3G A;  1Y97 A;  3KLE A;  1EKE A;  4DFM A;  2ZQB A;  1UA0 A;  4M45 A;  4FJM A;  4C8M A;  5K14 A;  4CFD A;  4DTO A;  4Z4G A;  1NKC A;  4WE1 A;  4DQR A;  1KVC A;  3A2F A;  3HYF A;  3MEG A;  4B9N A;  1BIU A;  3HL8 A;  4FM1 A;  3RWU A;  3QIO A;  2HW3 A;  3VQ7 A;  3AO3 A;  3NGZ A;  1U47 A;  1U49 A;  5I3U A;  4CJW A;  3NF7 A;  4CHP A;  2G8K A;  4FLT A;  3LZI A;  4NCA A;  1QSY A;  1RTD A;  1FKO A;  4CEQ A;  1WSJ A;  1XHZ A;  2X6S A;  3HPH A;  4I9Q A;  3OYN A;  3IS9 A;  3VQP A;  4FJI A;  3AVN A;  1Q8I A;  1HYV A;  4Z4F A;  4NCB A;  4CED A;  3LP2 A;  1ASW A;  5HRP A;  5T7B A;  2KW4 A;  3O3G A;  3LWL A;  3RR7 A;  4HUE A;  2PY5 A;  3S3N A;  1XHX A;  3RRG A;  3C95 A;  3SPY A;  1TKT A;  5KRT A;  3TAE A;  3WNH A;  3OJU A;  4FVM A;  2G8U A;  4FJH A;  1S9G A;  1A5X A;  5KGX A;  4FM2 A;  5J2P A;  5CY4 A;  1BGX T;  4LSN A;  2ZD1 A;  1BL3 A;  4RW7 A;  4B9U A;  3SZ2 A;  3HPO A;  1XI1 A;  1RBS A;  3ZSO A;  4FYD A;  4KPY A;  3ZT4 A;  4OGC A;  3PX6 A;  1JLB A;  1X9M A;  4OLB A;  3BDP A;  1VSJ A;  3QEP A;  1JLA A;  2AJQ A;  3MXI A;  4IG0 A;  2HHW A;  1LV5 A;  1RDA A;  1VSK A;  1VSE A;  3L2V A;  4L8R B;  3HK2 A;  4K8Z A;  1BQN A;  4CHY A;  1QQC A;  2YHB A;  4FW2 A;  3LAM A;  3ZCM A;  1UAX A;  3OY9 A;  4DTJ A;  1R0A A;  1XC9 A;  3QNO A;  3DLB A;  3LAN A;  4J2B A;  3QLH A;  1TKZ A;  4R5P A;  3AA4 A;  4CEO A;  1JL1 A;  4O44 A;  3IG1 A;  4OVL A;  2VWJ A;  2HNZ A;  3V81 A;  5DK5 A;  3NBP A;  4J2D A;  3L2Q A;  4GVM A;  4CIF A;  5KRS A;  5J2M A;  3S3O A;  2HHT A;  4IDK A;  1T05 A;  4OKJ A;  3LP0 A;  3HM9 A;  4BDP A;  4CIE A;  4FCY A;  3SUP A;  4FJ5 A;  1VSI A;  1ZBL A;  1A5W A;  1RIL A;  4CF1 A;  3V9X A;  4DTU A;  3AVJ A;  1TK5 A;  2G8W A;  3QEX A;  4PQU A;  4E7L A;  1SL2 A;  3HP6 A;  4DG1 A;  4C8K A;  4FK2 A;  1RCH A;  1L3S A;  3SI6 A;  4GW6 A;  3QEW A;  4F8R A;  4KRE A;  5C25 A;  3AVM A;  1YVU A;  1C1C A;  4CJL A;  2Y1I A;  1QTM A;  2OZM A;  3NF9 A;  4PY5 A;  2YNF A;  4N76 A;  4CJT A;  1LWE A;  1NK4 A;  3TAF A;  2BAN A;  1ZBU A;  2KZM A;  4EP5 A;  1BQM A;  5KGW A;  2P5G A;  1RDB A;  3OS1 A;  3JSM A;  2BE2 A;  1SKW A;  3OYH A;  4DTR A;  4CEC A;  4DSJ A;  2IOC A;  2VWK A;  2O4I A;  1JLQ A;  1SL1 A;  4QAG A;  3V6D A;  3PO4 A;  4KHW A;  3RRH A;  1RT2 A;  2HNY A;  5FRN A;  4CFC A;  4TSX A;  4DTP A;  4AHR A;  1NK9 A;  1ASU A;  3AVK A;  5C24 A;  4PUO A;  1VSD A;  2F8T A;  1Z25 A;  3ASM A;  3V1R A;  4FZY A;  1B92 A;  3HVR A;  3CFP A;  4CJ5 A;  3KLF A;  3K57 A;  4RW9 A;  3HXM A;  4M3Y A;  4BE1 A;  1HPZ A;  1C0M A;  1U4B A;  1BI4 A;  4HCC A;  1X9W A;  1HYS A;  1KCF A;  3LP3 A;  1S9E A;  4CEZ A;  4LSL A;  3K5N A;  4DSI A;  3KD1 E;  1BIS A;  4Q0B A;  5HRR A;  3AVI A;  2FBV A;  5HRO A;  4DQI A;  3HP9 A;  3OYD A;  2QKK A;  2HHS A;  2X78 A;  4H8K A;  1U48 A;  1RDD A;  4O0I A;  5FRM A;  5HLF A;  2RKI A;  4DS4 A;  5SZT A;  4FLZ A;  3QEV A;  4FJG A;  3KK1 A;  2FBY A;  3DLE A;  5CYQ A;  3K5L A;  4KAZ A;  2JGU A;  4N41 A;  1I39 A;  3RMD A;  3TAM A;  2QK9 A;  3FFI A;  3KK2 A;  3NH2 A;  5SWM A;  3V9S A;  1B9F A;  2FBT A;  2F96 A;  4DS5 A;  5J2Q A;  3KIO A;  1GOA A;  1L5U A;  2Z1I A;  3O3F A;  3ZT2 A;  5HP1 A;  4FLW A;  4E7K A;  4CGD A;  4ZTJ A;  2PYJ A;  3NH0 A;  4BDY A;  3SV4 A;  4ELT A;  1J54 A;  3DOL A;  4DF4 A;  2OPP A;  2QXF A;  3NF8 A;  1S6P A;  3CG7 A;  2EX3 A;  4OLA A;  2YKN A;  3OVN A;  3CYM A;  3PO5 A;  4CJ4 A;  4DWI A;  1JLF A;  1FK9 A;  1KLM A;  3DM2 A;  4DU3 A;  2IDO A;  3CM5 A;  4CK2 A;  4FJX A;  4KTW A;  5EU7 A;  4H4M A;  4Y1C A;  2GBZ A;  4AHV A;  1S1U A;  4ELU A;  1EXQ A;  3PV8 A;  4C8L A;  1VSF A;  3ZT0 A;  3SQ0 A;  2X6N A;  3VQ9 A;  1VK0 A;  1X1P A;  4CJU A;  4FJ7 A;  3ISN C;  2D0B A;  2YV0 X;  3KLI A;  1CXU A;  2ITG A;  4CEA A;  3TAR A;  4CEB A;  4ELV A;  4KB1 A;  1A5V A;  1QSL A;  3T19 A;  2PZS A;  3SUO A;  4F2S A;  4FLX A;  4ICL A;  1L3V A;  3ITH A;  3TAN A;  3G10 A;  2O4G A;  4W5R A;  1HMV A;  3AO1 A;  4IBN A;  3K58 A;  3DYA A;  1Q9Y A;  4M42 A;  4I2P A;  5D3G A;  3ZSV A;  2YNG A;  1KFD A;  2E4L A;  4JS4 A;  2XY6 A;  4JS5 A;  1RTI A;  3KLG A;  3TI0 A;  1TKD A;  2YKM A;  4KKO A;  3QET A;  3V1O A;  4O5B A;  4FLV A;  4DSE A;  3NH1 A;  2KFN A;  1GOB A;  4HTU A;  1U45 A;  4KO0 A;  1TKX A;  3ZT1 A;  2XRI A;  1LW2 A;  4CFA A;  2XY8 A;  4E89 A;  4EP4 A;  4FLU A;  4KHU A;  2Z1J A;  4BWM A;  1WAJ A;  4N56 A;  4Z4E A;  3NF6 A;  3VQC A;  4W5Q A;  1HQU A;  1YT3 A;  3MXM A;  4CK3 A;  1VSM A;  4E19 A;  4K8X A;  5E41 A;  1WNS A;  3AV9 A;  4LH4 A;  4B8C A;  3KD5 E;  2DFF A;  3F73 A;  4CHQ A;  4LH5 A;  3OYE A;  3U6F A;  1N6Q A;  4O55 A;  2D0C A;  4Z0U A;  2VG7 A;  3ULD A;  4CJF A;  4DSK A;  4CGF A;  1SL0 A;  2E6L A;  1BI4 B;  5HRS A;  1KVA A;  4CE9 A;  4B9V A;  1RT7 A;  4OKK A;  1EX4 A;  3DMJ A;  1HJR A;  1VSL A;  4M3Z A;  3SCX A;  2B6A A;  4FZZ A;  3CFR A;  3THV A;  2RPI A;  3HO1 A;  4IFY A;  1WAF A;  2W42 A;  3H08 A;  4FJN A;  3OYJ A;  4CJP A;  3L8B A;  1IKX A;  3OYG A;  3IAY A;  4CCH A;  4F2R A;  2HHQ A;  3AVH A;  4Q5V A;  2JLE A;  1NJX A;  3SNN A;  1RT3 A;  4RW6 A;  4F3T A;  5KI6 A;  4DSF A;  1NOY A;  4JRQ A;  1BHL A;  4KB0 A;  1LW0 A;  3L2U A;  2EHG A;  2P51 A;  3VQ8 A;  4CF9 A;  3SUQ A;  1CZB A;  1LWC A;  2BGG A;  2X74 A;  1YTA A;  1J53 A;  2YNI A;  2XY5 A;  4DQQ A;  1IKV A;  4E1N A;  3PY8 A;  4FK4 A;  1TAU A;  1ITG A;  3AVL A;  4IFV A;  4C8N A;  1JXB A;  1RBT A;  4CF0 A;  4DTS A;  3PX4 A;  1NK7 A;  1SKR A;  3C6U A;  3HVT A;  4CJS A;  1RT5 A;  3MXJ A;  2WOM A;  3T1A A;  4MQ3 A;  1DTQ A;  4B9M A;  1IKW A;  3SQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...