4CEZA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cezA00
1JLQA 4B8CA 3QO9A 1SKWA 4ELTA 1BQMA 3OVNA 4E1NA 2R7YA 1IO2A 1TKZA 1F21A 4WE1A 3LP2A 1RDCA 4NCGA 3KLHA 4CERA 4CGFA 3QEPA 5KI6A 2F8SA 4KV8A 5HRNA 3QNOA 1J54A 4Z4FA 4FVMA 4CHOA 3OJUA 4HUGA 3AVLA 3T3FA 4CGJA 1X9WA 2G8FA 3U3GA 4LH4A 3OS2A 1HQUA 4DF4A 3RR7A 4K8XA 1HNVA 4DQIA 3AVMA 4CJSA 4CHYA 1HNIA 1RDAA 3G0ZA 4DQSA 4RW8A 1RBVA 3ZCMA 4W5RA 3U3YA 1DLOA 4NYFA 1YVUA 4ID1A 3WNEA 3PO4A 1RT5A 4N47A 2DFEA 2HMIA 3RWUA 1B92A 5KGWA 4CJEA 1BQNA 1EP4A 2RPIA 4J2EA 4CGIA 5I42A 1JLGA 2HNZA 3LPTA 3VA3A 1X9SA 3NHGA 1KVCA 4CF0A 2X74A 4JLHA 3SYZA 1HQEA 3TARA 1ZBHA 4CK1A 1ZBLA 4RW4A 3HM9A 3AVHA 5CYMA 2I5JA 4EZ9A 3K58A 1BIZA 1VK0A 1T05A 4KHNA 4OPKA 1LAVA 4CJ3A 1QE1A 4DTNA 3NF6A 1XHXA 3SUQA 4CF8A 3AVIA 1VSLA 1W0HA 4CIGA 3SUPA 4B9SA 1TK0A 3ZSRA 4OKEA 1FKOA 2OPRA 3ZT3A 3KK2A 3K5MA 4KHSA 1LWCA 1YT3A 3SPZA 3AA4A 4Q0BA 1RBUA 2IOCA 4CGGA 3NH1A 5CZ1A 4FLTA 1D8YA 4IFVA 4KPYA 4FJ5A 4OGEA 2FC0A 4FYDA 4C8MA 2DFHA 4FM2A 3NDKA 4K8ZA 3ZSXA 1QSLA 4CJ5A 3ULDA 3OYCA 4BDYA 3AA2A 4FJLA 3OJSA 3B6OA 4JRQA 5KRTA 2LSNA 3SPYA 4TSXA 3VQDA 1MU2A 4DMNA 4B9TA 4FJHA 3S9HA 1ZBFA 1NOYA 4CHQA 1BI4A 3AVJA 3LP0A 2FBVA 4MFBA 3SQ0A 4C8OA 4Z4EA 4CGHA 2HHUA 4BWJA 1LAWA 4EP4A 4DTJA 4CIEA 3OY9A 2IC3A 1RTDA 1ZBUA 2P5OA 3AVFA 1Z25A 3KLIA 4EP5A 1HYZA 1A5XA 1EX4A 1VSDA 4CHNA 4RW9A 1HJRA 4CJFA 3O4NA 3K5LA 1XC9A 1BCMA 4RW6A 3PX4A 2QKKA 4I7FA 3E01A 1HPZA 2E6LA 3OYFA 1WSJA 3QIPA 1VSHA 1A5VA 3LAKA 3K57A 4HTUA 4PQUA 3MXJA 2G8WA 2HHXA 1YTUA 2ETJA 4O5BA 4CESA 4CJRA 3PX6A 4W5TA 4GW6A 3QEVA 3LALA 4FLZA 4DFPA 1NK4A 4O0IA 4DSIA 1BISA 4CFDA 2X6NA 3OS0A 3ISNC 1S6PA 2YNFA 4AHUA 3HVRA 4N76A 4Y1CA 4FK2A 3JYTA 1SL0A 1RBSA 2YKNA 3DOLA 5C25A 1ZYQA 4FK0A 5SZTA 1JKHA 4EZ6A 4F2SA 3KTQA 3RTVA 4KRFA 4FLYA 4KTWA 1NJYA 3HYFA 4JS4A 2B4JA 1S1UA 3PV8A 1NKBA 4OKKA 4OJRA 3V81A 3NH2A 1NJWA 1WSEA 4DSLA 4ELVA 4ELUA 4FXDA 2HHQA 2P51A 4OPJA 2QKBA 1RT7A 5CYQA 4Z4HA 4I9QA 3AO3A 1RBTA 2D0BA 2WOMA 3V9SA 3H08A 3OYAA 3TABA 5CY4A 1NK9A 5FRMA 2RN2A 5JS2A 2KFNA 1VSFA 1NK7A 1S9EA 3NFAA 2G8VA 3V9UA 3ZT2A 3S3MA 4KKOA 4F3OA 4GVMA 1VRUA 3HO1A 1J9AA 4I2QA 1TKTA 1JL1A 3VQ9A 3HT3A 1JLFA 3CG7A 4PA1A 3L8BA 2GV9A 3WNHA 3M8RA 4DU4A 1D9DA 1S6QA 5HP1A 3TANA 4MQ3A 4CJPA 1C0UA 4BWMA 2FBTA 4QAGA 4HUEA 3VN5A 1NK0A 1WAJA 2D0AA 3ZSWA 3DM2A 4BE2A 3ITHA 1LV5A 2XHBA 3K5NA 3THVA 3LANA 3LP1A 1TL1A 1IG9A 4CEDA 4FJGA 3S3NA 3AO5A 1S9GA 4DTRA 4B9UA 4NCBA 4AH9A 2KZMA 4DQQA 3FFIA 5E41A 1VRTA 2YNHA 4CJ4A 3ZT1A 3RMBA 1LW0A 4DTXA 1EKEA 3KK3A 4IFYA 3RMAA 1RCHA 1RTHA 2JLEA 1FK9A 1C0TA 4NYNA 4ZTFA 4AHSA 3I0RA 1L5UA 4C8LA 4B9LA 4FJJA 1UA1A 1QQCA 2RKIA 3TAEA 4E3SA 1NK5A 3PY8A 1HRHA 1ASUA 5FROA 3VQCA 3NE6A 3P1GA 3WNFA 1UWBA 3K2PA 4CK2A 2Z1JA 3NH0A 2GBZA 1IKXA 4E7LA 3AVBA 1IKWA 2YV0X 2XY5A 2XRIA 5J2NA 3ZSYA 4CIFA 3RRGA 3BGRA 4PWDA 1I3AA 2FBXA 3A2FA 4DSKA 5D3GA 2B6AA 5CZ2A 3HPGA 1KLMA 3TWHA 4FCYA 1WLJA 5SWMA 5J2MA 2BDPA 4DWIA 1W9HA 4M3YA 2VWJA 5C42A 4XIUA 1T7PA 3KD5E 3AA3A 3RR8A 3TAMA 4YFUA 3QEWA 2Z1IA 3LP3A 2HHWA 4CECA 4CF2A 3L2QA 3L2VA 3QNNA 1XHZA 4M3WA 1T03A 1KFSA 1CXQA 1GOCA 2OYQA 2EHGA 3C6TA 3QLHA 4KI6A 4FW2A 1UAXA 1L3TA 3C94A 5T7BA 4M3ZA 2AJQA 1L3VA 3OYEA 3IAYA 1JLCA 5HRPA 1JLAA 4J2DA 1BI4B 4FJXA 2QXFA 4FW1A 4Y1DA 1SKRA 1VSIA 2P1JA 1ASWA 3NF8A 3ZT4A 3V9WA 4W5OA 2KQ2A 3MEEA 4L8RB 4CE9A 4M3RA 4CFAA 5DK5A 2PZSA 4J2BA 4O55A 1YTAA 2X78A 3EY1A 3OYDA 3HJFA 1RDDA 3C6UA 4I2PA 4QOZB 1G15A 4KHQA 3EYZA 1O1WA 3OYMA 3SNNA 1S1WA 4C8NA 1TAQA 2VG7A 4DFJA 2IS3A 3OYHA 4FJNA 2Y1JA 4DU3A 4DTSA 3LWMA 1IKYA 2OPPA 3M8PA 3K59A 3MECA 3SUNA 3AVGA 1EETA 3TR8A 4Z4IA 3KK1A 1WSHA 4AHVA 1Q9YA 4O4GA 4HHTA 1WN7A 4BE1A 2BANA 3AVAA 4FJ9A 2BE2A 5HRRA 1NKCA 2XO7A 1U47A 4KFBA 1B9FA 4FLWA 2YNIA 4PY5A 4M45A 4E89A 3P5JA 4OVLA 1S1TA 2JGUA 3SJJA 4FJ7A 4CEAA 4NCAA 3MXIA 1RNHA 4CEEA 4DSEA 2D0CA 2PYJA 4DFMA 4FJ8A 3DLRA 3VQ8A 2Q3SA 4KHWA 2KZZA 3O3FA 1Q8IA 1WNSA 4KB0A 1SUQA 4FJIA 2O4IA 4B9VA 4H4MA 1VSEA 4CHPA 4F8RA 3EZ5A 4DS5A 2VWKA 3KIOA 5KTQA 1TK5A 3DLBA 3NGYA 3ZSZA 4I9LA 4AHTA 3OYKA 4F2RA 2Y1IA 1SKSA 2A1SA 5C24A 1REVA 2DTUA 1FXXA 1UOCA 2HNYA 2DY4A 2O4GA 1QS4A 2YHBA 3IS9A 1RTIA 2VG6A 3L2RA 1VSMA 3OYNA 2ZD1A 4CEFA 1BL3A 4FM1A 1JLBA 4IDKA 4UQGA 3KJVA 2E4LA 3SI6A 1KLNA 3IG1A 3PUFA 4BDPA 4OLBA 3OYIA 3SQ4A 3CM6A 1TK8A 1S1XA 1D5AA 3G10A 3RRHA 1XWLA 2FBYA 3KKSA 4IBNA 4DTOA 5I3UA 4CJWA 2YHAA 4F4KA 4FJKA 3VQ6A 3AVNA 2W42A 3LPUA 4RW7A 1Y97A 4DF8A 1RT1A 4E7JA 2ZQBA 4DSFA 4E0DA 3UIQA 1ITGA 4B08A 4GMJB 3LZJA 4FLXA 3QEXA 1NJZA 1KSPA 1SL1A 2YNGA 1WAFA 1C1BA 3V1QA 3VQEA 4E1MA 3HPHA 4H8KA 3I0SA 3V1RA 4BDZA 3VQAA 1D9FA 1QHTA 4YNQA 1R0AA 4W5QA 4G1QA 2G8KA 1TAUA 2VG5A 3LWLA 1J5OA 3L2UA 1K6YA 4AHRA 3JSMA 1BIUA 2D5RA 1L3UA 1LWEA 3AO2A 3T19A 4CCHA 2OPSA 1TVRA 4N5SA 3RMDA 2B5JA 1ASVA 1C1CA 4KI4A 4ZTJA 3V6DA 3ZSOA 4DQRA 3WNGA 4M3UA 1B9DA 3VQ5A 3KLEA 3NGZA 2BGGA 4C8KA 5FRNA 3AVCA 1C6VA 4FLVA 1NOZA 1VSKA 4QCLA 1U45A 1CZ9A 3NAEA 1RTJA 1A5WA 3MEDA 4HCBA 1U48A 3QEIA 4KREA 3AO4A 1RT4A 3O3HA 1RILA 3C95A 3CFRA 3CFPA 3CQ8A 2G8HA 4Z4CA 1HMVA 1GOBA 3SZ2A 1TL3A 3SCXA 1TKDA 4E19A 3HVTA 3QIOA 1WSGA 2HHSA 3DLKA 1T8EA 2E6MA 4DSJA 2IGIA 4FZXC 4IKFA 3P83D 3DLGA 4PUOA 1FKPA 3I8DA 3OYBA 4CEQA 3NCIA 2OPQA 3QINA 4DFKA 1GOAA 4KTQA 3DI6A 1DTQA 4ID5A 2Z1GA 4LH5A 1IH7A 4AHCA 1RBRA 4CFBA 3OS1A 3TAGA 1NKEA 3DRSA 3MXMA 1HYVA 4Q5VA 4BE0A 4HCCA 3S3OA 3HP9A 1DTTA 1LW2A 3SV4A 2G8UA 3BDPA 1Q9XA 3VA0A 2HVHA 2KFZA 3TI0A 3M8QA 4H4OA 4M41A 3MAQA 2G8IA 4OLAA 4CGDA 1KRPA 2OZSA 5J2PA 3TAPA 4KTZA 3QETA 5FDLA 3LDSA 4JRPA 4E7KA 1CXUA 3NBPA 1N5YA 4M42A 1SV5A 3ZSVA 2ITGA 4FZYA 3O4QA 3DRPA 3DRRA 3B6PA 1KFDA 3CFOA 3HPOA 3SUOA 4LSNA 3VQPA 3HL8A 2ZE2A 4B8AB 3HP6A 3PX0A 1SL2A 4LSLA 3KLFA 4CFCA 1RT6A 3VQQA 1NJXA 2P5GA 4DU1A 1VSJA 2EX3A 2OZMA 4DTMA 1C0MA 4CJUA 3SQ1A 1I39A 3VQ7A 4LY7A 4CK3A 4R5PA 4DLGA 3OYLA 1HYSA 2X6SA 3AV9A 3D45A 3QERA 5HRSA 4KHUA 3K5OA 2HW3A 1JXBA 1Z26A 1BGXT 3M8SA 4HUFA 2OA8A 4DQPA 3OYGA 4JS5A 2A1RA 3L3VA 3LZIA 3SQ2A 5KRSA 4CHZA 1WSFA 3VQ4A 1RT3A 1TKXA 2HNDA 3SV3A 1L3SA 4KHYA 1CLQA 1EXQA 4DTPA 3AO1A 3KLGA 4J2AA 3DLHA 3U6FA 5HROA 5HLFA 3KD1E 4FJMA 2XY6A 2Z1HA 1U04A 4Z0UA 1RDBA 4CJVA 3V4IA 4CEOA 4DG1A 4AILC 4KB1A 1KCFA 5KGXA 4DS4A 4ICLA 4IG3A 3AA5X 4E7IA 3NGIA 1QSSA 2HVIA 2ATQA 4N56A 4N41A 4CF1A 3HK2A 4KAZA 4B9MA 3MEGA 4E7HA 2F96A 3KKRA 4IG0A 2IAJA 2PYLA 5JS1A 3HXMA 4CJKA 3L2WA 3NF7A 4LD0A 1KVBA 4ZHRA 1JL2A 4DTUA 1NK8A 2PY5A 1C1AA 5DMRA 1UA0A 1S5JA 2DFFA 2YKMA 4KO0A 3VQBA 1TGOA 2HB5A 4B9NA 3ZSQA 1IKVA 3V9XA 4FLUA 1KVAA 3CM5A 3PO5A 4W5NA 3D0PA 4DLEA 3F73A 4CJQA 1LWFA 2QK9A 3T1AA 4RG8A 4BACA 5K14A 5J1EA 1XI1A 1S1VA 4FK4A 2WONA 3V9ZA 3DYAA 4HVJA 3QESA 1ZBIA 2GUIA 3F9KA 4O0JA 1QSYA 4M3XA 3NF9A 4F3TA 4FM0A 1QTMA 5HBMA 3DLEA 3RMCA 3O3GA 2XY7A 2IDOA 4Z4GA 3CYMA 5EU7A 2F8TA 1WSIA 1J53A 1KTQA 2NUBA 3DOKA 3ZT0A 3DMJA 4CJTA 1U4BA 1X9MA 2HHVA 5J2QA 4O44A 4CEBA 1NK6A 3HSTB 4M3TA 1BCOA 4B3OA 3V1OA 3TAQA 1RT2A 2KW4A 1TV6A 2RF2A 3LAMA 1BHLA 4CJLA 1JLEA 3AVKA 3L3UA 2HHTA 4CF9A 1JXEA 2KTQA 1N6QA 4FZZA 3TAFA 2XY8A 3OYJA 3ASMA 4OGCA 4OKJA 1U49A 1X1PA 3ALYA 3IRXA 1CZBA 4CEZA
chains in the Genus database with same CATH superfamily
1JLQA 3QO9A 1SKWA 1BQMA 3OVNA 2E2NA 1RDCA 4A2BA 4CGFA 4KV8A 2PAVA 1BUPA 1X9WA 4CGJA 3CERA 3U3GA 4DF4A 3RR7A 4K8XA 1HNVA 4CHYA 4CJSA 1HUXA 1DLOA 4NYFA 5BR9A 1JCEA 1VQNN 1RT5A 2DFEA 4B3MK 5KGWA 3GBTA 1YITN 5AZJA 2HNZA 3VA3A 1X9SA 2X74A 3VF6A 2CH5A 3ENHA 1O13A 4CK1A 1VQ8N 1ZBLA 3HM9A 2I5JA 4J8FA 4KHNA 4OPKA 4CJ3A 1W0HA 3BY5A 1YJ9N 4B9SA 1TK0A 1FKOA 2OPRA 4JI3K 4KHSA 4GNIA 1LWCA 4Q0BA 4DB3A 1TYQA 4WCEL 4GV3A 3LDNA 3OHRA 4FJ5A 4OGEA 2FC0A 5F1XA 4YDUC 3NDKA 4K8ZA 3ZSXA 2P9NB 4BROA 3ULDA 4BDYA 3AA2A 3MN5A 5AQWA 5KRTA 4DR3K 4TSXA 2CGLA 3C6HA 1ZBFA 1BI4A 3AVJA 3D6RA 4H5WA 4C8OA 5CHIA 4BWJA 4EP4A 3LM9A 3HSCA 2UXDK 4EP5A 3VERA 1EX4A 1VSDA 4CHNA 4RW9A 1IG9A 3O4NA 1XC9A 1GLLO 3VGKA 3PX4A 4I7FA 4M7YA 4WQ5C 3MWTA 3K57A 2P9NA 2G8WA 4O5BA 4CESA 4JNEA 4B1VA 1QHAA 4GW6A 4FLZA 4CFDA 2X6NA 2PFUA 3ISNC 4WQ4A 4Y1CA 2ZWHA 1RBSA 1N36K 5SZTA 1JKHA 2ZGYA 4F2SA 3KTQA 3CPWM 1MDUB 1NKBA 4YOTA 5GINA 1WSEA 2ZJPL 2E88A 1OVQA 2P51A 3IMXA 4YOXA 3TTFA 3A8YA 4Z4HA 4PHTX 1ATRA 3TABA 3H08A 5FRMA 5CY4A 2KFNA 2ASOA 3S3MA 2YCHA 1J9AA 4IDHA 1D9DA 1P90A 4FWKA 3FZLA 3LDPA 1WB9A 2QEXN 3J7AP 2D0AA 3DM2A 4IOAL 3A5LC 3K5NA 1W97L 1XNRK 3PSIA 1XNQK 3CQYA 3F2KA 4IWVA 2VYPA 4CEDA 4JI8K 3S3NA 1S9GA 3HOSA 4MLHA 2KZMA 4JI0K 5E41A 3D2FA 3SMPA 5AQIA 5AJ3K 4JKGB 3RMAA 1RTHA 3O9SA 3THWB 4B9LA 4FJJA 3TAEA 4E3SA 1NK5A 5FROA 3NE6A 4CK2A 1UWBA 3K2PA 2YV0X 4IEEA 2XY5A 2E1YA 3CJCA 2E2PA 3BGRA 1YIJN 1I3AA 3ZEUA 2ASPA 5CZ2A 1KLMA 3CCLN 2KZZA 1WLJA 4BC2A 5SWMA 5J2MA 2VWJA 1T7PA 4LFAK 2DPNA 3E66A 3OBYA 4FL9A 2HHWA 4LC9B 3SAHA 4EIAA 2W6KA 1KFSA 1CXQA 1OH7A 1DGKN 1BOTO 2EHGA 3C6TA 2QW9A 4A57A 1ZXOA 1Q82O 3C94A 1L3VA 1SS6A 3OYEA 3WEEB 3IAYA 5HRPA 1JLAA 4BR4A 1EQYA 1RDUA 3AAPA 5M1NA 1VSIA 2P1JA 1K8KB 4M3RA 2Q1NA 2W41A 5LMNK 3VEWA 1NGHA 3HJFA 1RDDA 3VESA 4I2PA 3O4WA 4FWMA 1S1WA 4DFJA 2VG7A 1VQON 1NGBA 4NB4A 4DU3A 3MECA 1EETA 3TR8A 3KK1A 2NRHA 4AHVA 3T1YK 2BE2A 1B9FA 3LL3A 1NWKA 1S1TA 2JGUA 3WXMB 1GLDG 3MXIA 1RNHA 4CEEA 5AQHA 2PYJA 3WXLA 4FJ8A 3VQ8A 2HBLA 2BTFA 3H46O 4F2RA 4BC3A 5C24A 2YHBA 1VQ4N 3DXKB 1HJOA 3L2RA 3H1QA 3O80A 2ZD1A 3K9JA 1BL3A 1JLBA 3KJVA 2E4LA 2CGJA 5C0YA 3IG1A 3PUFA 3E9LA 3D7EO 1TK8A 3O1WA 4IBNA 2GUPA 4DTOA 4FJKA 1VQ6N 4RW7A 2QWNA 1RT1A 4QS9A 3QEXA 4FLXA 1KSPA 1C0GA 4DR7K 4B1XB 2QWPA 1WAFA 3O8MA 4WFNL 4BDZA 1D9FA 1QHTA 1R0AA 3ZX2A 4BR2A 4JV5K 1TAUA 1K6YA 1M1KO 1BIUA 2D5RA 2ITMA 1BG3A 4JKDA 1GLBG 1LWEA 3T19A 4CZLA 4CCHA 3O9QA 5GIPA 3RMDA 3FFKB 4IEIA 1ASVA 4DV2K 3J80O 3V6DA 3ZSOA 1NU0A 3QFUA 4C8KA 5FRNA 4X64K 4QCLA 3AO4A 3CFRA 2G8HA 1HMVA 1TL3A 3AY9A 4FZXC 4DCHA 1TUUA 4PUOA 3I8DA 3FGUA 4KTQA 4NLCA 3VF2A 3G6EN 1DTQA 4AHCA 1IH7A 4HCCA 4Q5VA 3S3OA 4OX9K 3VA0A 4BRQA 2D0PA 4H4OA 1X3MA 4OLAA 1KRPA 2YHXA 3WXJA 2Q2RA 4H0YB 4KTZA 5FDLA 3LDSA 4E7KA 2Q36A 2A41A 3NBPA 1T6CA 1VAZA 5FPDA 3ZSVA 2ITGA 4IOCL 3L6QA 3SUOA 3VETA 4LSNA 2ZE2A 1X3NA 4B8AB 4C23A 4LSLA 3VQQA 2O8DB 4DU1A 1VSJA 3MCAB 2I7PA 5JVGL 4DTMA 4MDAA 4LY7A 4DLGA 1HYSA 3P31A 1HPMA 5BREA 1KAZA 2X6SA 2P9PB 4KHUA 3K5OA 4JK7A 3CC4N 4BVOA 1HKCA 3CHWA 3OTOK 3HI0A 3S41A 4WF9L 3LZIA 1NGDA 1WSFA 1GLAG 1RT3A 1TKXA 1L3SA 2QWLA 1FW6A 1Q81O 3KLGA 4J2AA 5HLFA 4EAHD 2P9UB 5BPMA 2Z1HA 1U04A 3GL1A 4H0VB 4CEOA 4DG1A 3N4QA 4G9ZA 4KB1A 5KGXA 4DUZK 2QXLA 4JKAA 3RSEA 4DS4A 4IG3A 3NGIA 2HVIA 4NLBA 2F96A 4PKIA 3KKRA 3GE1A 5JLFA 2PYLA 1LCUA 4PKGA 4Y0WA 3BZCA 1C1AA 5DMRA 1UA0A 3VQBA 2YKMA 4W5NA 4DLEA 1LWFA 5J1EA 3DYAA 4HVJA 3MN7A 2P9PA 5F2RA 3QESA 1ZBIA 3F9KA 4LFBK 1YVNA 1QSYA 2E5LK 2ZJRL 3RMCA 3SMSA 4MLEA 3ZT0A 1U4BA 1X9MA 5J2QA 5M1PA 3HSTB 2E2OA 3R6MA 5AFUH 1RT2A 2HHTA 3MX5A 3FZFA 1V4TA 1J5EK 2ZM6K 4WQ4C 3VF4A 4BGBA 4UY8O 4OGCA 4C1NK 1U49A 5ADXH 3OW2M 3P4IA 4H5NA 1TKZA 1F21A 4WE1A 3LP2A 4EHUA 2HHHK 2P9LA 4I6MA 3QEPA 1NMDA 5HRNA 1W7AA 1J54A 4Z4FA 4CHOA 3T3FA 4LH4A 3OS2A 1C0FA 1HQUA 4DQIA 3O08A 1HNIA 5EX5A 1RDAA 4DQSA 5GIOA 1RBVA 3ZCMA 3U3YA 1YVUA 4IFEA 4N47A 4BRPA 1B92A 1BQNA 1EP4A 2RPIA 4CGIA 2HOEA 3LPTA 1OVYA 1KVCA 4CF0A 5C12A 3EKSA 3T1HK 1ZBHA 3D2EB 4EZ9A 1BIZA 1Y64A 1LAVA 4DTNA 4A59A 3NF6A 3SUQA 4CF8A 3AA4A 3HRGA 2IOCA 5AQKA 4NXMK 1GLEG 3WUHA 2JWLA 2WBNA 4B1WB 2O8EA 4FYDA 3KK7A 4LF9K 5BN9A 4ISFA 3OJSA 4JRQA 2LSNA 5AZIB 1QVGM 4BRCA 3S9HA 4CHQA 4PKHA 2FBVA 4MFBA 3J81O 4CGHA 1IBLK 2HHUA 1KXPA 1V4SA 3VGLA 4CZJA 3CJAA 4IO8A 4CZGA 2P5OA 3KLIA 3FZHA 4FPAA 1HJRA 5KQDA 4KHPK 3NVMA 2QKKA 3E01A 4HTUA 3MXJA 2HHXA 2ETJA 3I33A 3ZX0A 4CJRA 3UKUA 4W5TA 3A0IX 4CD1A 1TYQB 2IVOA 2A3ZA 4O0IA 4CZMA 1BISA 4MO5A 4AHUA 3HVRA 4FK2A 3JYTA 5AR0A 3TPQA 3PIPL 1H1VA 2YKNA 3DOLA 1ZYQA 4EZ6A 4JD2A 4FLYA 3HYFA 2B4JA 1S1UA 3GG4A 2VWBA 3NH2A 4ELVA 4DSLA 4OPJA 2QKBA 1RT7A 1RBTA 4BRMA 3GDQA 3UKUB 5JS2A 1NK7A 2E20A 2V51B 1BWFO 3NFAA 4DV7K 2G8VA 4LF7K 5AQNA 2KKZA 3VQ9A 4I2QA 1TKTA 1JL1A 4PA1A 4BY9C 3M8RA 1S6QA 3TANA 3W0LA 4QAGA 5E84A 3VN5A 3ITHA 4JN4A 4ILHA 3NVKA 3LP1A 5AQVA 3DWLA 3O9UA 3AO5A 4DTRA 4DKWA 1NNEA 2F9TA 2NNWA 3FFIA 2NRTA 3ZT1A 1EWQA 3RMBA 1LW0A 5AQYA 3KK3A 4IFYA 1E3MA 3CCMN 1FK9A 4NYNA 4ZTFA 1W2BM 4C8LA 2O8FB 3NH0A 4E7LA 4DV4K 2GBZA 3AVBA 1VQ5N 1IKWA 3BF1A 2FSJA 2XRIA 3ZSYA 5D3GA 2B6AA 5AQZA 2BDPA 4DWIA 4H03B 3U9ZA 2Z1IA 4L3QA 3L2QA 5C15A 3L2VA 4JKBA 1T03A 2OYQA 4NO7A 1UAXA 2AJQA 3ZX3A 2GTDA 1JLCA 3FR0A 4JI4K 1HX1A 4A5AA 4CVNE 4DR6K 4W5OA 3MEEA 3R1XA 4CFAA 2O8CB 2X78A 3EY1A 4YY3K 1HR0K 3H6EA 1ESVA 1G15A 4C1NI 1ZC6A 3ATVA 2OTLN 4KHQA 3DXKA 3SNNA 1TAQA 2IS3A 3OYHA 1SQKA 3LWMA 2A42A 2OPPA 3H3OB 1XMQK 3CD6N 4CZKA 3AVGA 1SZ2A 2HSTA 4DR4K 1Q9YA 1IBKK 1WN7A 4HTLA 3QFPA 5FPEA 4FJ9A 5HRRA 5GAGP 1NKCA 2FSKA 4KFBA 4FLWA 2YNIA 4PY5A 1JCFA 4OVLA 3SJJA 4CEAA 3C7NA 2D0CA 3TU5A 3DLRA 4H0PA 4KB0A 4FJIA 4BRDA 1HNWK 4F8RA 1Q7YO 3OYKA 4I9LA 2Y1IA 1IG8A 3DAWA 3ENOA 1VQPN 3O5BA 2DY4A 1QS4A 1RTIA 4JI6K 3G25A 1N32K 2P9UA 4CBUA 4CEFA 3CCSN 5BN8A 3RSEB 1S22A 2CGKA 3RRHA 4CJWA 5C2DA 4F4KA 2QWMA 3LPUA 4CZFA 3AARA 3HOTA 5AQQA 4E7JA 2ZQBA 1ITGA 4FWPA 2YNGA 1C1BA 4E1MA 3TSPA 4FPBA 3I55N 2G8KA 3WQTA 3LWLA 2YHWA 3HM8A 2OCEA 4BRIA 4RWTA 2YJEA 1TVRA 5AQOA 3VGMA 3VMFB 2B5JA 4GY2B 3CCRN 3DJCA 5AQFA 3NGZA 2P9IB 3A5MC 2F4VK 3AVCA 1C6VA 4XH4A 1YF5L 3NAEA 1RTJA 4LFCK 4K25A 3QEIA 3O3HA 3CQ8A 1MWMA 2GWKA 2A6AA 3SCXA 3ZYYX 3WEEA 5ELZA 4BGAA 1WSGA 3DLKA 2FF3B 3EKUA 1XC3A 2IGIA 3TTDA 4EFHA 3DLGA 4DV5K 3NCIA 3O9TA 4DFKA 2WTUA 2Z1GA 1RBRA 2NRXA 3MXMA 1T44A 3MX2A 3BDPA 1D4XA 3U4LA 4LF5K 4JHDB 4CGDA 3QETA 3ATUA 1CXUA 1N5YA 1SV5A 2ZF5O 5KPRA 4FWLA 3AGKA 1Q86O 3DRRA 3CFOA 5EXWA 2VGMA 5EVZA 3O9RA 3PX0A 4DR2K 4JI1K 1NJXA 2P5GA 3LDLA 2IVPA 2NRZA 3VQ7A 4CK3A 4BVPA 4OO1J 3ZETA 1WBDA 3AV9A 3QERA 5KQ8A 1JXBA 1IBMK 4HUFA 5LL6Z 5KRSA 1DKGD 3VQ4A 3CXCM 3ENBA 4H5TA 4IO9L 3DLHA 1HLUA 5AQUA 4AILC 3SAGA 3UB5A 3AA5X 3G4SN 1QSSA 4N56A 1YUWA 4KAZA 3MEGA 4E7HA 2J4RA 3THXA 3M6GA 1E4FT 1T3VA 4CJKA 4ZHRA 4DTUA 1NBWA 2PY5A 4KO0A 2DFFA 2HB5A 4B9NA 1IKVA 1KVAA 4EHTA 2VCPA 3D0PA 3CC7N 1M90O 3ZETB 4U67L 3T1AA 1XI1A 2E8AA 1S1VA 2WONA 2P9SA 4M3XA 4K0KK 1XMOK 2BH1A 4F3TA 1QTMA 3VEVA 3DLEA 4Z4GA 2XY7A 1KD1O 1WSIA 1J53A 2NUBA 3KWIA 2HHVA 1BCOA 5M1KA 1MA9B 2KW4A 1TV6A 2RF2A 1BHLA 3AVKA 4CZIA 4BC5A 2UXBK 4K41A 3K0SA 4BQZA 3O1BA 2F7TA 5AZJB 1G99A 2D1KA 4IOXA 2NLXA 4XH5A 2F8SA 2VQFK 3QNOA 4B1YB 3OJUA 4HUGA 4B9QA 4JI7K 1YJNN 3WNEA 3M5RA 3RWUA 2HMIA 2KHOA 4J2EA 3TSUA 2UUCK 1N34K 4JLHA 2P9SB 3R9PA 2Q0UA 3F5TA 4B3SK 1DT9A 3AVHA 3SK3A 1BO5O 3K58A 2O8FA 1VK0A 4BR5A 5AFUA 1XHXA 3AVIA 1VSLA 4H5VA 5IT9O 3ZSRA 4OKEA 3VEXA 4CGGA 4YDUA 1D8YA 2HBMA 3QMLA 4C8MA 2DFHA 4FM2A 1QSLA 4CJ5A 3PSFA 2D0OA 3OYCA 3SPYA 5F0XA 5LY3A 2HF4A 3THYA 1DEJA 4B9TA 1NMNA 4FJHA 4JK8A 3E9PA 4Z4EA 3CJ1A 3NMUA 4FWQA 3OY9A 5C10A 2IC3A 4X66K 3CCVN 1RTDA 1ZBUA 3AVFA 1HYZA 1A5XA 4XEIA 4CJFA 1BCMA 2QTDA 2E6LA 3OYFA 3QIPA 3BZKA 1A5VA 1XUPO 5GAEP 3M3ZA 4PQUA 1NGFA 1YTUA 1QQOA 3THYB 3PX6A 5MLCQ 2O8BB 4GVEA 2F9WA 4DSIA 1NJIO 5LJWA 3OS0A 1S6PA 2YNFA 3T69A 3SBGA 2RHKA 4JAXA 1SL0A 1VQMN 4BR0A 3MK6A 3Q7BA 2CH6A 4KRFA 4BRLA 5AQGA 1QZ5A 4OKKA 4OJRA 3V81A 4FXDA 2HHQA 2WOMA 3V9SA 1NK9A 2RN2A 1YXQA 4KKOA 2FLOA 3HO1A 1WOQA 5B8HA 3HT3A 3L8BA 1JLFA 1BDGA 3CG7A 2GV9A 4DU4A 2QM1A 5HP1A 4MQ3A 3SAFA 4BWMA 2FBTA 1ZBSA 2HBKA 4I6MB 4JKGA 4PL8A 2GWJA 4BG9A 3THWA 1NK0A 4BE2A 1LV5A 3LANA 1TL1A 3L0QA 2YHYA 2H3GX 2E2QA 3CPEA 4B9UA 4AH9A 1KQSM 2BUPA 2YNHA 4CJ4A 3HZ6A 1E4GT 4R79A 3SLCA 1EKEA 5FLXO 2JLEA 2OANA 1C0TA 5BRFA 1YI2N 3CCEN 1Q18A 3I0RA 2HMPA 3D2EA 4V19S 1UA1A 4DR5K 1HRHA 1ASUA 3P1GA 3PV8A 1WBBA 3PLAA 2Z1JA 4PWDA 3RRGA 1K8KA 2FBXA 4DSKA 1VQ9N 5BR8K 4Z94A 1K9MO 4B3OA 4FCYA 4B1ZA 3QEWA 3LP3A 4CECA 1XHZA 4A61A 2Q0RA 3P38A 4H0TB 4FW2A 4A2AA 3QICA 1L3TA 5T7BA 3C7NB 3ID6A 5AZIA 3B8AX 4IXCA 3KHYA 2QXFA 2IVNA 3JXUA 4BR7A 4BRHA 4L8RB 4CE9A 5DK5A 4O55A 3OYDA 3C6UA 2Q97A 1OKJA 1S3XA 1P8ZA 1O1WA 3CC2N 4O8UA 2FF6A 4ILJA 4FJNA 2Y1JA 1IKYA 3C6AA 1EO1A 2W40A 5LJVA 3WXIA 4WFBL 1WSHA 4BE1A 3AVAA 3QBXA 2XO7A 2GEMA 3EL2A 4E89A 4DR1K 4FJ7A 2FSNA 3EZWA 4NCAA 1BU6O 1QQMA 4QS8A 4DFMA 2Q3SA 1WNSA 4A5BA 1SUQA 4B9VA 4MO4A 1VSEA 3J7ZO 3KIOA 5FPMA 3DLBA 3IFRA 4U7BA 4AHTA 2NZTA 4LF4K 2A1SA 4HWIA 3H45C 1FXXA 3MDQA 1UOCA 2AA4A 2HNYA 2O4GA 3Q7CA 3IS9A 2VG6A 4CZEA 4BR9A 3OYNA 4BRKA 2V52B 3UE5A 2W6LA 4UQGA 3SI6A 4OLBA 2UU9K 3CJBA 4YOWA 1S1XA 1D5AA 1CLQA 1XWLA 2FBYA 5I3UA 4GV9A 3LDQA 2YHAA 5TKWA 4JKEA 4DF8A 1RDWX 4OPAA 4FOEA 5EY4A 4E0DA 2UXCK 4B08A 3VEOA 3LZJA 4IJAA 2QA4N 1SL1A 4H8KA 3V1RA 3VQAA 4AF1A 4YNQA 3G71N 3L2UA 3A5NC 4ISGA 1L3UA 3AO2A 2OPSA 1JJ2M 2O8DA 3M1FA 1C1CA 3ULEB 2AP1A 1NGAA 3WNGA 1B9DA 3L4IA 4FLVA 1NOZA 1VSKA 2P9KB 1U45A 1CZ9A 1A5WA 2YI1A 1U48A 1RILA 3C95A 3CFPA 3SZ2A 1GOBA 4BRFA 2EWSA 4E19A 5JMVA 3VTHA 2HHSA 1T8EA 2E6MA 4IKFA 3P83D 1NLVA 1FKPA 2HBJA 1YAGA 4ILGB 3CJ7A 4LH5A 4K43A 3OS1A 4CFBA 1HYVA 2O8CA 1DTTA 1LW2A 3FE1A 2KFZA 3TI0A 3M8QA 4A62A 3MAQA 2G8IA 2OZSA 4JYAK 3CCJN 1EWRA 1I94K 2UUAK 3LDOA 4M42A 5BPNA 2QWQA 4FZYA 1LOTB 3PIOL 3O4QA 3DRPA 2GX9A 3HPOA 3VQPA 4JI2K 3HL8A 3KWGA 1SL2A 3KLFA 4QS7A 3N4PA 2EX3A 1C0MA 3SQ1A 2WUSA 5I9EB 1JCGA 3J7YP 4FWNA 4NXNK 5HRSA 3BP8A 2P9KA 1HNZK 1BGXT 3M8SA 1HNXK 2OA8A 2YJFA 3OYGA 4JS5A 2A1RA 3SQ2A 4CHZA 4YORA 3BUZB 3R3LA 2HNDA 2WFBA 3QBWA 1EXQA 5M1OA 4FOIA 4DTPA 1U2VA 4M7XA 5HROA 4CW7B 1N8RO 2XY6A 4Z0UA 1RDBA 4CJVA 3V4IA 2FXUA 5DM6L 3UKRB 1KCFA 4WFAL 3EN9A 2ATQA 4DHYA 4N41A 1HKBA 2QWRA 3OBWA 3U9DA 4B9MA 5LMUK 4LF6K 4IG0A 2IAJA 3HXMA 3L2WA 3NF7A 1KVBA 1JL2A 1NK8A 3EE8A 1S5JA 3CM5A 4CJQA 5K14A 4GKKK 3V9ZA 4H0XB 1ILYA 2KLAA 4O0JA 3ZLJA 3U8XA 3HBTA 4FM0A 1KTQA 4CJTA 2UYTA 1NK6A 3V1OA 3TAQA 1JLEA 4CF9A 3CETA 1JXEA 4JKFA 1N6QA 3TAFA 2XY8A 3OYJA 1NGIA 4RTFD 4OKJA 1X1PA 3IRXA 5CE3A 3WQUA 4B8CA 4ELTA 4E1NA 2R7YA 1IO2A 4YHHK 4BRAA 4NCGA 3KLHA 4CERA 1Z6RA 3CMAN 5KI6A 3QB0A 1BA1A 3TSQA 4FVMA 2NRVA 3LM2A 1VHXA 2G8FA 3AVLA 2ZJQL 1OH5A 3MN9A 3AVMA 4IZ9A 4JK9A 3G0ZA 4RW8A 4W5RA 1RGIA 3I8BA 4ID1A 3PO4A 1XQSC 4CJEA 5I42A 1JLGA 3I56N 3NHGA 4B3RK 3SYZA 1HQEA 3MCPA 4YOUA 3TARA 3L4QA 4RW4A 4KH4A 5CYMA 3E9OA 5BPLA 1T05A 3VENA 1QE1A 5H1SQ 4CIGA 1FJGK 3SUPA 3K5MA 4JD2B 5M1QA 3ZT3A 3KK2A 4KH5A 1YT3A 3SPZA 1RBUA 2E1ZA 1BA0A 3NH1A 5CZ1A 4FLTA 1CZAN 5HL7L 4KPYA 4IFVA 4FVUA 4FWRA 4JKHA 4FJLA 3B6OA 1HKGA 3C65A 4BRGA 3VQDA 1MU2A 4DMNA 4BC4A 3DLLL 4OPHA 1NOYA 3SJHA 3E1YA 3J8AA 3LP0A 3VTIA 3SQ0A 1IV0A 2WC9A 1LAWA 4DTJA 3GOIA 4CIEA 4CZHA 1Z25A 5EOYA 5AQSA 3K5LA 4RW6A 4H5RA 1SAZA 1HPZA 1WSJA 1VSHA 3LAKA 3QEVA 3LALA 1NK4A 4DFPA 4KREA 2YX6A 4N76A 4LF8K 4X62K 4FK0A 5C25A 3A5OC 4AM6A 3RTVA 4KTWA 1NJYA 4JS4A 1VQLN 1NJWA 4ELUA 1GLCG 4MDBA 5CYQA 5ADXA 2O8EB 4I9QA 3AO3A 1YJWN 2D0BA 3OYAA 4JI5K 1K73O 1VSFA 1S9EA 3ZT2A 4F3OA 4GVMA 4M63C 2VGNA 1VRUA 4ISEA 4DV6K 3WNHA 3K9KA 3WXKA 4CJPA 1C0UA 3W3DA 3ZEUB 2ASMA 4HUEA 1R59O 1WAJA 3ZSWA 2XHBA 3THVA 4DV3K 3CI5A 2JWKA 4FJGA 5AQMA 2A5XA 4NCBA 4WYBA 5E26A 4DQQA 1VRTA 3BEXA 3WT0A 3ID8A 4DTXA 3JAMO 1NGEA 1RCHA 2QI2A 1NG9A 1NM1A 4AHSA 1L5UA 4DV1K 1QQCA 2RKIA 3PY8A 1OH6A 3VQCA 2RE2A 3WNFA 5GAHP 3V9UA 1IKXA 1YHQN 2Q31A 1QZ6A 4H0OA 5J2NA 4CIFA 4DUYK 1MWKA 3A2FA 3TWHA 3HPGA 4Z4IA 4M3YA 1W9HA 3KD5E 3VPZA 5C42A 4XIUA 2I7NA 3AA3A 5JICA 1VQKN 3RR8A 3CJ9A 3TAMA 4YFUA 4CF2A 3EO3A 3QNNA 1S72N 4M3WA 1GOCA 4KI6A 3QLHA 3HTVA 4M3ZA 1T6DA 1OH8A 4WQ5A 4GV6A 1KAYA 4J2DA 1BI4B 4FJXA 4FW1A 3D2FB 4Y1DA 1SKRA 1ASWA 3NF8A 3ZT4A 3V9WA 1U6ZA 2KQ2A 4KBOA 3RVCA 4CJ7A 2V7YA 2PZSA 4J2BA 1YTAA 3BF3A 5C2FA 4QOZB 4O8KA 3EYZA 3OYMA 3T7ZA 5FPNA 4C8NA 4DTSA 3M8PA 3K59A 4FWSA 3SUNA 5JLHA 2O8BA 5KPZA 4O4GA 4HHTA 2BANA 1KC8O 1U47A 4M45A 3P5JA 4JEPA 5A2QO 1RFQA 4DSEA 4PL7A 4KHWA 4BREA 3O3FA 1Q8IA 2O4IA 3CQXA 4H4MA 4K42A 1NGGA 5BRDA 4CHPA 3EZ5A 4DS5A 1WUAA 2VWKA 5KTQA 1TK5A 3NGYA 3ZSZA 3IDHA 3H1VX 3EEQA 2P9IA 3CCUN 1SKSA 4X65K 4CBXA 1REVA 2NRWA 2DTUA 3P39A 1VSMA 3ULEA 4FM1A 5KPTA 3FZMA 4IDKA 1KLNA 4CBWA 4BDPA 2ZGZA 3OYIA 3SQ4A 3KZBA 3CM6A 4DQ8A 3F9MA 5CR4A 3G10A 3KKSA 3R8EA 1NGJA 5AQPA 3VQ6A 3AVNA 2W42A 1Y97A 4FSVA 4DSFA 2QWOA 4DV0K 3UIQA 4GMJB 3IKMA 1NJZA 3VEYA 3V1QA 3VQEA 3HPHA 4CI6A 3I0SA 1NGCA 4W5QA 4FO0A 4G1QA 2VG5A 2OTJN 3IUCA 1J5OA 3EE9A 4AHRA 3JSMA 5AQJA 3MN6A 4O5FA 4N5SA 5AQRA 2VQEK 1N33K 2IIRA 4KI4A 2D4WA 5M1FA 4ZTJA 5AQTA 3CMEN 4DQRA 2BGGA 4M3UA 2PBDA 3VQ5A 3KLEA 4XH1A 3AAQA 5DM7L 3MEDA 4CD3A 3MMVA 4HCBA 1RT4A 3O6WA 4Z4CA 1X9JA 2NRRA 1TKDA 3HVTA 3OA9A 3QIOA 4B3TK 3MWPA 2GELA 4DSJA 3OYBA 4CEQA 4BRNA 2OPQA 3QINA 1GOAA 3DI6A 4ID5A 3KVGA 3TAGA 1NKEA 5TKYA 1ATNA 3DRSA 4BE0A 4FWOA 1QQNA 3HP9A 3SV4A 2HVHA 2G8UA 1Q9XA 4M41A 4AQYK 1U2VB 5J2PA 5IWAK 3TAPA 4JRPA 4BQLA 3C0BA 1TUYA 3B6PA 1KFDA 4KH6A 3UKRA 2V7ZA 3HP6A 1IJJA 1QVFM 4CFCA 1RT6A 2OZMA 5GADP 4CJUA 1I39A 4YOYA 4R5PA 3OYLA 4JHDA 3D45A 1Z05A 2HW3A 1Z26A 4DQPA 3SBTA 4IJNA 3L3VA 4RCHA 3VEZA 4KHYA 3SV3A 3DXMB 3AGRA 3AO1A 1ATSA 3U6FA 2A40A 3KD1E 4FJMA 5AQLA 3TTCA 4ICLA 4E7IA 3CIPA 3FZKA 4CF1A 3HK2A 4GKJK 5JS1A 5AQXA 4B1UB 4LD0A 4BG8A 2UUBK 4E1JA 2P9LB 1K8AO 4YOVA 1TGOA 3ZSQA 3V9XA 3CCQN 4FLUA 3PO5A 3VOVA 1GLJO 4F9OA 3F73A 4JKCA 2QK9A 4BACA 4RG8A 4FK4A 2HF3A 2GUIA 1GLFO 3NF9A 3QDKA 1J6ZA 5HBMA 3O3GA 2IDOA 3THXB 3CYMA 5EU7A 2F8TA 3FLCO 3DOKA 3DMJA 4O44A 4CEBA 4M3TA 4AM7A 1VQ7N 3CF5L 1KAXA 3LAMA 3H3NO 4CJLA 5JVHL 3L3UA 3DXMA 2KTQA 3JS6A 4FZZA 3ASMA 5BRHA 5HOOA 3ALYA 1CZBA 4CEZA
chains in the Genus database with same CATH topology
1JLQA 4B8CA 3QO9A 1SKWA 4ELTA 1BQMA 3OVNA 4E1NA 2R7YA 1IO2A 1TKZA 1F21A 4WE1A 3LP2A 1RDCA 4NCGA 3KLHA 4CERA 4CGFA 3QEPA 5KI6A 2F8SA 4KV8A 5HRNA 3QNOA 1J54A 4Z4FA 4FVMA 4CHOA 3OJUA 4HUGA 3AVLA 3T3FA 4CGJA 1X9WA 2G8FA 3U3GA 4LH4A 3OS2A 1HQUA 4DF4A 3RR7A 4K8XA 1HNVA 4DQIA 3AVMA 4CJSA 4CHYA 1HNIA 1RDAA 3G0ZA 4DQSA 4RW8A 1RBVA 3ZCMA 4W5RA 3U3YA 1DLOA 4NYFA 1YVUA 4ID1A 3WNEA 3PO4A 1RT5A 4N47A 2DFEA 2HMIA 3RWUA 1B92A 5KGWA 4CJEA 1BQNA 1EP4A 2RPIA 4J2EA 4CGIA 5I42A 1JLGA 2HNZA 3LPTA 3VA3A 1X9SA 3NHGA 1KVCA 4CF0A 2X74A 4JLHA 3SYZA 1HQEA 3TARA 1ZBHA 4CK1A 1ZBLA 4RW4A 3HM9A 3AVHA 5CYMA 2I5JA 4EZ9A 3K58A 1BIZA 1VK0A 1T05A 4KHNA 4OPKA 1LAVA 4CJ3A 1QE1A 4DTNA 3NF6A 1XHXA 3SUQA 4CF8A 3AVIA 1VSLA 1W0HA 4CIGA 3SUPA 4B9SA 1TK0A 3ZSRA 4OKEA 1FKOA 2OPRA 3ZT3A 3KK2A 3K5MA 4KHSA 1LWCA 1YT3A 3SPZA 3AA4A 4Q0BA 1RBUA 2IOCA 4CGGA 3NH1A 5CZ1A 4FLTA 1D8YA 4IFVA 4KPYA 4FJ5A 4OGEA 2FC0A 4FYDA 4C8MA 2DFHA 4FM2A 3NDKA 4K8ZA 3ZSXA 1QSLA 4CJ5A 3ULDA 3OYCA 4BDYA 3AA2A 4FJLA 3OJSA 3B6OA 4JRQA 5KRTA 2LSNA 3SPYA 4TSXA 3VQDA 1MU2A 4DMNA 4B9TA 4FJHA 3S9HA 1ZBFA 1NOYA 4CHQA 1BI4A 3AVJA 3LP0A 2FBVA 4MFBA 3SQ0A 4C8OA 4Z4EA 4CGHA 2HHUA 4BWJA 1LAWA 4EP4A 4DTJA 4CIEA 3OY9A 2IC3A 1RTDA 1ZBUA 2P5OA 3AVFA 1Z25A 3KLIA 4EP5A 1HYZA 1A5XA 1EX4A 1VSDA 4CHNA 4RW9A 1HJRA 4CJFA 3O4NA 3K5LA 1XC9A 1BCMA 4RW6A 3PX4A 2QKKA 4I7FA 3E01A 1HPZA 2E6LA 3OYFA 1WSJA 3QIPA 1VSHA 1A5VA 3LAKA 3K57A 4HTUA 4PQUA 3MXJA 2G8WA 2HHXA 1YTUA 2ETJA 4O5BA 4CESA 4CJRA 3PX6A 4W5TA 4GW6A 3QEVA 3LALA 4FLZA 4DFPA 1NK4A 4O0IA 4DSIA 1BISA 4CFDA 2X6NA 3OS0A 3ISNC 1S6PA 2YNFA 4AHUA 3HVRA 4N76A 4Y1CA 4FK2A 3JYTA 1SL0A 1RBSA 2YKNA 3DOLA 5C25A 1ZYQA 4FK0A 5SZTA 1JKHA 4EZ6A 4F2SA 3KTQA 3RTVA 4KRFA 4FLYA 4KTWA 1NJYA 3HYFA 4JS4A 2B4JA 1S1UA 3PV8A 1NKBA 4OKKA 4OJRA 3V81A 3NH2A 1NJWA 1WSEA 4DSLA 4ELVA 4ELUA 4FXDA 2HHQA 2P51A 4OPJA 2QKBA 1RT7A 5CYQA 4Z4HA 4I9QA 3AO3A 1RBTA 2D0BA 2WOMA 3V9SA 3H08A 3OYAA 3TABA 5CY4A 1NK9A 5FRMA 2RN2A 5JS2A 2KFNA 1VSFA 1NK7A 1S9EA 3NFAA 2G8VA 3V9UA 3ZT2A 3S3MA 4KKOA 4F3OA 4GVMA 1VRUA 3HO1A 1J9AA 4I2QA 1TKTA 1JL1A 3VQ9A 3HT3A 1JLFA 3CG7A 4PA1A 3L8BA 2GV9A 3WNHA 3M8RA 4DU4A 1D9DA 1S6QA 5HP1A 3TANA 4MQ3A 4CJPA 1C0UA 4BWMA 2FBTA 4QAGA 4HUEA 3VN5A 1NK0A 1WAJA 2D0AA 3ZSWA 3DM2A 4BE2A 3ITHA 1LV5A 2XHBA 3K5NA 3THVA 3LANA 3LP1A 1TL1A 1IG9A 4CEDA 4FJGA 3S3NA 3AO5A 1S9GA 4DTRA 4B9UA 4NCBA 4AH9A 2KZMA 4DQQA 3FFIA 5E41A 1VRTA 2YNHA 4CJ4A 3ZT1A 3RMBA 1LW0A 4DTXA 1EKEA 3KK3A 4IFYA 3RMAA 1RCHA 1RTHA 2JLEA 1FK9A 1C0TA 4NYNA 4ZTFA 4AHSA 3I0RA 1L5UA 4C8LA 4B9LA 4FJJA 1UA1A 1QQCA 2RKIA 3TAEA 4E3SA 1NK5A 3PY8A 1HRHA 1ASUA 5FROA 3VQCA 3NE6A 3P1GA 3WNFA 1UWBA 3K2PA 4CK2A 2Z1JA 3NH0A 2GBZA 1IKXA 4E7LA 3AVBA 1IKWA 2YV0X 2XY5A 2XRIA 5J2NA 3ZSYA 4CIFA 3RRGA 3BGRA 4PWDA 1I3AA 2FBXA 3A2FA 4DSKA 5D3GA 2B6AA 5CZ2A 3HPGA 1KLMA 3TWHA 4FCYA 1WLJA 5SWMA 5J2MA 2BDPA 4DWIA 1W9HA 4M3YA 2VWJA 5C42A 4XIUA 1T7PA 3KD5E 3AA3A 3RR8A 3TAMA 4YFUA 3QEWA 2Z1IA 3LP3A 2HHWA 4CECA 4CF2A 3L2QA 3L2VA 3QNNA 1XHZA 4M3WA 1T03A 1KFSA 1CXQA 1GOCA 2OYQA 2EHGA 3C6TA 3QLHA 4KI6A 4FW2A 1UAXA 1L3TA 3C94A 5T7BA 4M3ZA 2AJQA 1L3VA 3OYEA 3IAYA 1JLCA 5HRPA 1JLAA 4J2DA 1BI4B 4FJXA 2QXFA 4FW1A 4Y1DA 1SKRA 1VSIA 2P1JA 1ASWA 3NF8A 3ZT4A 3V9WA 4W5OA 2KQ2A 3MEEA 4L8RB 4CE9A 4M3RA 4CFAA 5DK5A 2PZSA 4J2BA 4O55A 1YTAA 2X78A 3EY1A 3OYDA 3HJFA 1RDDA 3C6UA 4I2PA 4QOZB 1G15A 4KHQA 3EYZA 1O1WA 3OYMA 3SNNA 1S1WA 4C8NA 1TAQA 2VG7A 4DFJA 2IS3A 3OYHA 4FJNA 2Y1JA 4DU3A 4DTSA 3LWMA 1IKYA 2OPPA 3M8PA 3K59A 3MECA 3SUNA 3AVGA 1EETA 3TR8A 4Z4IA 3KK1A 1WSHA 4AHVA 1Q9YA 4O4GA 4HHTA 1WN7A 4BE1A 2BANA 3AVAA 4FJ9A 2BE2A 5HRRA 1NKCA 2XO7A 1U47A 4KFBA 1B9FA 4FLWA 2YNIA 4PY5A 4M45A 4E89A 3P5JA 4OVLA 1S1TA 2JGUA 3SJJA 4FJ7A 4CEAA 4NCAA 3MXIA 1RNHA 4CEEA 4DSEA 2D0CA 2PYJA 4DFMA 4FJ8A 3DLRA 3VQ8A 2Q3SA 4KHWA 2KZZA 3O3FA 1Q8IA 1WNSA 4KB0A 1SUQA 4FJIA 2O4IA 4B9VA 4H4MA 1VSEA 4CHPA 4F8RA 3EZ5A 4DS5A 2VWKA 3KIOA 5KTQA 1TK5A 3DLBA 3NGYA 3ZSZA 4I9LA 4AHTA 3OYKA 4F2RA 2Y1IA 1SKSA 2A1SA 5C24A 1REVA 2DTUA 1FXXA 1UOCA 2HNYA 2DY4A 2O4GA 1QS4A 2YHBA 3IS9A 1RTIA 2VG6A 3L2RA 1VSMA 3OYNA 2ZD1A 4CEFA 1BL3A 4FM1A 1JLBA 4IDKA 4UQGA 3KJVA 2E4LA 3SI6A 1KLNA 3IG1A 3PUFA 4BDPA 4OLBA 3OYIA 3SQ4A 3CM6A 1TK8A 1S1XA 1D5AA 3G10A 3RRHA 1XWLA 2FBYA 3KKSA 4IBNA 4DTOA 5I3UA 4CJWA 2YHAA 4F4KA 4FJKA 3VQ6A 3AVNA 2W42A 3LPUA 4RW7A 1Y97A 4DF8A 1RT1A 4E7JA 2ZQBA 4DSFA 4E0DA 3UIQA 1ITGA 4B08A 4GMJB 3LZJA 4FLXA 3QEXA 1NJZA 1KSPA 1SL1A 2YNGA 1WAFA 1C1BA 3V1QA 3VQEA 4E1MA 3HPHA 4H8KA 3I0SA 3V1RA 4BDZA 3VQAA 1D9FA 1QHTA 4YNQA 1R0AA 4W5QA 4G1QA 2G8KA 1TAUA 2VG5A 3LWLA 1J5OA 3L2UA 1K6YA 4AHRA 3JSMA 1BIUA 2D5RA 1L3UA 1LWEA 3AO2A 3T19A 4CCHA 2OPSA 1TVRA 4N5SA 3RMDA 2B5JA 1ASVA 1C1CA 4KI4A 4ZTJA 3V6DA 3ZSOA 4DQRA 3WNGA 4M3UA 1B9DA 3VQ5A 3KLEA 3NGZA 2BGGA 4C8KA 5FRNA 3AVCA 1C6VA 4FLVA 1NOZA 1VSKA 4QCLA 1U45A 1CZ9A 3NAEA 1RTJA 1A5WA 3MEDA 4HCBA 1U48A 3QEIA 4KREA 3AO4A 1RT4A 3O3HA 1RILA 3C95A 3CFRA 3CFPA 3CQ8A 2G8HA 4Z4CA 1HMVA 1GOBA 3SZ2A 1TL3A 3SCXA 1TKDA 4E19A 3HVTA 3QIOA 1WSGA 2HHSA 3DLKA 1T8EA 2E6MA 4DSJA 2IGIA 4FZXC 4IKFA 3P83D 3DLGA 4PUOA 1FKPA 3I8DA 3OYBA 4CEQA 3NCIA 2OPQA 3QINA 4DFKA 1GOAA 4KTQA 3DI6A 1DTQA 4ID5A 2Z1GA 4LH5A 1IH7A 4AHCA 1RBRA 4CFBA 3OS1A 3TAGA 1NKEA 3DRSA 3MXMA 1HYVA 4Q5VA 4BE0A 4HCCA 3S3OA 3HP9A 1DTTA 1LW2A 3SV4A 2G8UA 3BDPA 1Q9XA 3VA0A 2HVHA 2KFZA 3TI0A 3M8QA 4H4OA 4M41A 3MAQA 2G8IA 4OLAA 4CGDA 1KRPA 2OZSA 5J2PA 3TAPA 4KTZA 3QETA 5FDLA 3LDSA 4JRPA 4E7KA 1CXUA 3NBPA 1N5YA 4M42A 1SV5A 3ZSVA 2ITGA 4FZYA 3O4QA 3DRPA 3DRRA 3B6PA 1KFDA 3CFOA 3HPOA 3SUOA 4LSNA 3VQPA 3HL8A 2ZE2A 4B8AB 3HP6A 3PX0A 1SL2A 4LSLA 3KLFA 4CFCA 1RT6A 3VQQA 1NJXA 2P5GA 4DU1A 1VSJA 2EX3A 2OZMA 4DTMA 1C0MA 4CJUA 3SQ1A 1I39A 3VQ7A 4LY7A 4CK3A 4R5PA 4DLGA 3OYLA 1HYSA 2X6SA 3AV9A 3D45A 3QERA 5HRSA 4KHUA 3K5OA 2HW3A 1JXBA 1Z26A 1BGXT 3M8SA 4HUFA 2OA8A 4DQPA 3OYGA 4JS5A 2A1RA 3L3VA 3LZIA 3SQ2A 5KRSA 4CHZA 1WSFA 3VQ4A 1RT3A 1TKXA 2HNDA 3SV3A 1L3SA 4KHYA 1CLQA 1EXQA 4DTPA 3AO1A 3KLGA 4J2AA 3DLHA 3U6FA 5HROA 5HLFA 3KD1E 4FJMA 2XY6A 2Z1HA 1U04A 4Z0UA 1RDBA 4CJVA 3V4IA 4CEOA 4DG1A 4AILC 4KB1A 1KCFA 5KGXA 4DS4A 4ICLA 4IG3A 3AA5X 4E7IA 3NGIA 1QSSA 2HVIA 2ATQA 4N56A 4N41A 4CF1A 3HK2A 4KAZA 4B9MA 3MEGA 4E7HA 2F96A 3KKRA 4IG0A 2IAJA 2PYLA 5JS1A 3HXMA 4CJKA 3L2WA 3NF7A 4LD0A 1KVBA 4ZHRA 1JL2A 4DTUA 1NK8A 2PY5A 1C1AA 5DMRA 1UA0A 1S5JA 2DFFA 2YKMA 4KO0A 3VQBA 1TGOA 2HB5A 4B9NA 3ZSQA 1IKVA 3V9XA 4FLUA 1KVAA 3CM5A 3PO5A 4W5NA 3D0PA 4DLEA 3F73A 4CJQA 1LWFA 2QK9A 3T1AA 4RG8A 4BACA 5K14A 5J1EA 1XI1A 1S1VA 4FK4A 2WONA 3V9ZA 3DYAA 4HVJA 3QESA 1ZBIA 2GUIA 3F9KA 4O0JA 1QSYA 4M3XA 3NF9A 4F3TA 4FM0A 1QTMA 5HBMA 3DLEA 3RMCA 3O3GA 2XY7A 2IDOA 4Z4GA 3CYMA 5EU7A 2F8TA 1WSIA 1J53A 1KTQA 2NUBA 3DOKA 3ZT0A 3DMJA 4CJTA 1U4BA 1X9MA 2HHVA 5J2QA 4O44A 4CEBA 1NK6A 3HSTB 4M3TA 1BCOA 4B3OA 3V1OA 3TAQA 1RT2A 2KW4A 1TV6A 2RF2A 3LAMA 1BHLA 4CJLA 1JLEA 3AVKA 3L3UA 2HHTA 4CF9A 1JXEA 2KTQA 1N6QA 4FZZA 3TAFA 2XY8A 3OYJA 3ASMA 4OGCA 4OKJA 1U49A 1X1PA 3ALYA 3IRXA 1CZBA 4CEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLQ A;  4B8C A;  3QO9 A;  1SKW A;  4ELT A;  1BQM A;  3OVN A;  4E1N A;  2R7Y A;  1IO2 A;  1TKZ A;  1F21 A;  4WE1 A;  3LP2 A;  1RDC A;  4NCG A;  3KLH A;  4CER A;  4CGF A;  3QEP A;  5KI6 A;  2F8S A;  4KV8 A;  5HRN A;  3QNO A;  1J54 A;  4Z4F A;  4FVM A;  4CHO A;  3OJU A;  4HUG A;  3AVL A;  3T3F A;  4CGJ A;  1X9W A;  2G8F A;  3U3G A;  4LH4 A;  3OS2 A;  1HQU A;  4DF4 A;  3RR7 A;  4K8X A;  1HNV A;  4DQI A;  3AVM A;  4CJS A;  4CHY A;  1HNI A;  1RDA A;  3G0Z A;  4DQS A;  4RW8 A;  1RBV A;  3ZCM A;  4W5R A;  3U3Y A;  1DLO A;  4NYF A;  1YVU A;  4ID1 A;  3WNE A;  3PO4 A;  1RT5 A;  4N47 A;  2DFE A;  2HMI A;  3RWU A;  1B92 A;  5KGW A;  4CJE A;  1BQN A;  1EP4 A;  2RPI A;  4J2E A;  4CGI A;  5I42 A;  1JLG A;  2HNZ A;  3LPT A;  3VA3 A;  1X9S A;  3NHG A;  1KVC A;  4CF0 A;  2X74 A;  4JLH A;  3SYZ A;  1HQE A;  3TAR A;  1ZBH A;  4CK1 A;  1ZBL A;  4RW4 A;  3HM9 A;  3AVH A;  5CYM A;  2I5J A;  4EZ9 A;  3K58 A;  1BIZ A;  1VK0 A;  1T05 A;  4KHN A;  4OPK A;  1LAV A;  4CJ3 A;  1QE1 A;  4DTN A;  3NF6 A;  1XHX A;  3SUQ A;  4CF8 A;  3AVI A;  1VSL A;  1W0H A;  4CIG A;  3SUP A;  4B9S A;  1TK0 A;  3ZSR A;  4OKE A;  1FKO A;  2OPR A;  3ZT3 A;  3KK2 A;  3K5M A;  4KHS A;  1LWC A;  1YT3 A;  3SPZ A;  3AA4 A;  4Q0B A;  1RBU A;  2IOC A;  4CGG A;  3NH1 A;  5CZ1 A;  4FLT A;  1D8Y A;  4IFV A;  4KPY A;  4FJ5 A;  4OGE A;  2FC0 A;  4FYD A;  4C8M A;  2DFH A;  4FM2 A;  3NDK A;  4K8Z A;  3ZSX A;  1QSL A;  4CJ5 A;  3ULD A;  3OYC A;  4BDY A;  3AA2 A;  4FJL A;  3OJS A;  3B6O A;  4JRQ A;  5KRT A;  2LSN A;  3SPY A;  4TSX A;  3VQD A;  1MU2 A;  4DMN A;  4B9T A;  4FJH A;  3S9H A;  1ZBF A;  1NOY A;  4CHQ A;  1BI4 A;  3AVJ A;  3LP0 A;  2FBV A;  4MFB A;  3SQ0 A;  4C8O A;  4Z4E A;  4CGH A;  2HHU A;  4BWJ A;  1LAW A;  4EP4 A;  4DTJ A;  4CIE A;  3OY9 A;  2IC3 A;  1RTD A;  1ZBU A;  2P5O A;  3AVF A;  1Z25 A;  3KLI A;  4EP5 A;  1HYZ A;  1A5X A;  1EX4 A;  1VSD A;  4CHN A;  4RW9 A;  1HJR A;  4CJF A;  3O4N A;  3K5L A;  1XC9 A;  1BCM A;  4RW6 A;  3PX4 A;  2QKK A;  4I7F A;  3E01 A;  1HPZ A;  2E6L A;  3OYF A;  1WSJ A;  3QIP A;  1VSH A;  1A5V A;  3LAK A;  3K57 A;  4HTU A;  4PQU A;  3MXJ A;  2G8W A;  2HHX A;  1YTU A;  2ETJ A;  4O5B A;  4CES A;  4CJR A;  3PX6 A;  4W5T A;  4GW6 A;  3QEV A;  3LAL A;  4FLZ A;  4DFP A;  1NK4 A;  4O0I A;  4DSI A;  1BIS A;  4CFD A;  2X6N A;  3OS0 A;  3ISN C;  1S6P A;  2YNF A;  4AHU A;  3HVR A;  4N76 A;  4Y1C A;  4FK2 A;  3JYT A;  1SL0 A;  1RBS A;  2YKN A;  3DOL A;  5C25 A;  1ZYQ A;  4FK0 A;  5SZT A;  1JKH A;  4EZ6 A;  4F2S A;  3KTQ A;  3RTV A;  4KRF A;  4FLY A;  4KTW A;  1NJY A;  3HYF A;  4JS4 A;  2B4J A;  1S1U A;  3PV8 A;  1NKB A;  4OKK A;  4OJR A;  3V81 A;  3NH2 A;  1NJW A;  1WSE A;  4DSL A;  4ELV A;  4ELU A;  4FXD A;  2HHQ A;  2P51 A;  4OPJ A;  2QKB A;  1RT7 A;  5CYQ A;  4Z4H A;  4I9Q A;  3AO3 A;  1RBT A;  2D0B A;  2WOM A;  3V9S A;  3H08 A;  3OYA A;  3TAB A;  5CY4 A;  1NK9 A;  5FRM A;  2RN2 A;  5JS2 A;  2KFN A;  1VSF A;  1NK7 A;  1S9E A;  3NFA A;  2G8V A;  3V9U A;  3ZT2 A;  3S3M A;  4KKO A;  4F3O A;  4GVM A;  1VRU A;  3HO1 A;  1J9A A;  4I2Q A;  1TKT A;  1JL1 A;  3VQ9 A;  3HT3 A;  1JLF A;  3CG7 A;  4PA1 A;  3L8B A;  2GV9 A;  3WNH A;  3M8R A;  4DU4 A;  1D9D A;  1S6Q A;  5HP1 A;  3TAN A;  4MQ3 A;  4CJP A;  1C0U A;  4BWM A;  2FBT A;  4QAG A;  4HUE A;  3VN5 A;  1NK0 A;  1WAJ A;  2D0A A;  3ZSW A;  3DM2 A;  4BE2 A;  3ITH A;  1LV5 A;  2XHB A;  3K5N A;  3THV A;  3LAN A;  3LP1 A;  1TL1 A;  1IG9 A;  4CED A;  4FJG A;  3S3N A;  3AO5 A;  1S9G A;  4DTR A;  4B9U A;  4NCB A;  4AH9 A;  2KZM A;  4DQQ A;  3FFI A;  5E41 A;  1VRT A;  2YNH A;  4CJ4 A;  3ZT1 A;  3RMB A;  1LW0 A;  4DTX A;  1EKE A;  3KK3 A;  4IFY A;  3RMA A;  1RCH A;  1RTH A;  2JLE A;  1FK9 A;  1C0T A;  4NYN A;  4ZTF A;  4AHS A;  3I0R A;  1L5U A;  4C8L A;  4B9L A;  4FJJ A;  1UA1 A;  1QQC A;  2RKI A;  3TAE A;  4E3S A;  1NK5 A;  3PY8 A;  1HRH A;  1ASU A;  5FRO A;  3VQC A;  3NE6 A;  3P1G A;  3WNF A;  1UWB A;  3K2P A;  4CK2 A;  2Z1J A;  3NH0 A;  2GBZ A;  1IKX A;  4E7L A;  3AVB A;  1IKW A;  2YV0 X;  2XY5 A;  2XRI A;  5J2N A;  3ZSY A;  4CIF A;  3RRG A;  3BGR A;  4PWD A;  1I3A A;  2FBX A;  3A2F A;  4DSK A;  5D3G A;  2B6A A;  5CZ2 A;  3HPG A;  1KLM A;  3TWH A;  4FCY A;  1WLJ A;  5SWM A;  5J2M A;  2BDP A;  4DWI A;  1W9H A;  4M3Y A;  2VWJ A;  5C42 A;  4XIU A;  1T7P A;  3KD5 E;  3AA3 A;  3RR8 A;  3TAM A;  4YFU A;  3QEW A;  2Z1I A;  3LP3 A;  2HHW A;  4CEC A;  4CF2 A;  3L2Q A;  3L2V A;  3QNN A;  1XHZ A;  4M3W A;  1T03 A;  1KFS A;  1CXQ A;  1GOC A;  2OYQ A;  2EHG A;  3C6T A;  3QLH A;  4KI6 A;  4FW2 A;  1UAX A;  1L3T A;  3C94 A;  5T7B A;  4M3Z A;  2AJQ A;  1L3V A;  3OYE A;  3IAY A;  1JLC A;  5HRP A;  1JLA A;  4J2D A;  1BI4 B;  4FJX A;  2QXF A;  4FW1 A;  4Y1D A;  1SKR A;  1VSI A;  2P1J A;  1ASW A;  3NF8 A;  3ZT4 A;  3V9W A;  4W5O A;  2KQ2 A;  3MEE A;  4L8R B;  4CE9 A;  4M3R A;  4CFA A;  5DK5 A;  2PZS A;  4J2B A;  4O55 A;  1YTA A;  2X78 A;  3EY1 A;  3OYD A;  3HJF A;  1RDD A;  3C6U A;  4I2P A;  4QOZ B;  1G15 A;  4KHQ A;  3EYZ A;  1O1W A;  3OYM A;  3SNN A;  1S1W A;  4C8N A;  1TAQ A;  2VG7 A;  4DFJ A;  2IS3 A;  3OYH A;  4FJN A;  2Y1J A;  4DU3 A;  4DTS A;  3LWM A;  1IKY A;  2OPP A;  3M8P A;  3K59 A;  3MEC A;  3SUN A;  3AVG A;  1EET A;  3TR8 A;  4Z4I A;  3KK1 A;  1WSH A;  4AHV A;  1Q9Y A;  4O4G A;  4HHT A;  1WN7 A;  4BE1 A;  2BAN A;  3AVA A;  4FJ9 A;  2BE2 A;  5HRR A;  1NKC A;  2XO7 A;  1U47 A;  4KFB A;  1B9F A;  4FLW A;  2YNI A;  4PY5 A;  4M45 A;  4E89 A;  3P5J A;  4OVL A;  1S1T A;  2JGU A;  3SJJ A;  4FJ7 A;  4CEA A;  4NCA A;  3MXI A;  1RNH A;  4CEE A;  4DSE A;  2D0C A;  2PYJ A;  4DFM A;  4FJ8 A;  3DLR A;  3VQ8 A;  2Q3S A;  4KHW A;  2KZZ A;  3O3F A;  1Q8I A;  1WNS A;  4KB0 A;  1SUQ A;  4FJI A;  2O4I A;  4B9V A;  4H4M A;  1VSE A;  4CHP A;  4F8R A;  3EZ5 A;  4DS5 A;  2VWK A;  3KIO A;  5KTQ A;  1TK5 A;  3DLB A;  3NGY A;  3ZSZ A;  4I9L A;  4AHT A;  3OYK A;  4F2R A;  2Y1I A;  1SKS A;  2A1S A;  5C24 A;  1REV A;  2DTU A;  1FXX A;  1UOC A;  2HNY A;  2DY4 A;  2O4G A;  1QS4 A;  2YHB A;  3IS9 A;  1RTI A;  2VG6 A;  3L2R A;  1VSM A;  3OYN A;  2ZD1 A;  4CEF A;  1BL3 A;  4FM1 A;  1JLB A;  4IDK A;  4UQG A;  3KJV A;  2E4L A;  3SI6 A;  1KLN A;  3IG1 A;  3PUF A;  4BDP A;  4OLB A;  3OYI A;  3SQ4 A;  3CM6 A;  1TK8 A;  1S1X A;  1D5A A;  3G10 A;  3RRH A;  1XWL A;  2FBY A;  3KKS A;  4IBN A;  4DTO A;  5I3U A;  4CJW A;  2YHA A;  4F4K A;  4FJK A;  3VQ6 A;  3AVN A;  2W42 A;  3LPU A;  4RW7 A;  1Y97 A;  4DF8 A;  1RT1 A;  4E7J A;  2ZQB A;  4DSF A;  4E0D A;  3UIQ A;  1ITG A;  4B08 A;  4GMJ B;  3LZJ A;  4FLX A;  3QEX A;  1NJZ A;  1KSP A;  1SL1 A;  2YNG A;  1WAF A;  1C1B A;  3V1Q A;  3VQE A;  4E1M A;  3HPH A;  4H8K A;  3I0S A;  3V1R A;  4BDZ A;  3VQA A;  1D9F A;  1QHT A;  4YNQ A;  1R0A A;  4W5Q A;  4G1Q A;  2G8K A;  1TAU A;  2VG5 A;  3LWL A;  1J5O A;  3L2U A;  1K6Y A;  4AHR A;  3JSM A;  1BIU A;  2D5R A;  1L3U A;  1LWE A;  3AO2 A;  3T19 A;  4CCH A;  2OPS A;  1TVR A;  4N5S A;  3RMD A;  2B5J A;  1ASV A;  1C1C A;  4KI4 A;  4ZTJ A;  3V6D A;  3ZSO A;  4DQR A;  3WNG A;  4M3U A;  1B9D A;  3VQ5 A;  3KLE A;  3NGZ A;  2BGG A;  4C8K A;  5FRN A;  3AVC A;  1C6V A;  4FLV A;  1NOZ A;  1VSK A;  4QCL A;  1U45 A;  1CZ9 A;  3NAE A;  1RTJ A;  1A5W A;  3MED A;  4HCB A;  1U48 A;  3QEI A;  4KRE A;  3AO4 A;  1RT4 A;  3O3H A;  1RIL A;  3C95 A;  3CFR A;  3CFP A;  3CQ8 A;  2G8H A;  4Z4C A;  1HMV A;  1GOB A;  3SZ2 A;  1TL3 A;  3SCX A;  1TKD A;  4E19 A;  3HVT A;  3QIO A;  1WSG A;  2HHS A;  3DLK A;  1T8E A;  2E6M A;  4DSJ A;  2IGI A;  4FZX C;  4IKF A;  3P83 D;  3DLG A;  4PUO A;  1FKP A;  3I8D A;  3OYB A;  4CEQ A;  3NCI A;  2OPQ A;  3QIN A;  4DFK A;  1GOA A;  4KTQ A;  3DI6 A;  1DTQ A;  4ID5 A;  2Z1G A;  4LH5 A;  1IH7 A;  4AHC A;  1RBR A;  4CFB A;  3OS1 A;  3TAG A;  1NKE A;  3DRS A;  3MXM A;  1HYV A;  4Q5V A;  4BE0 A;  4HCC A;  3S3O A;  3HP9 A;  1DTT A;  1LW2 A;  3SV4 A;  2G8U A;  3BDP A;  1Q9X A;  3VA0 A;  2HVH A;  2KFZ A;  3TI0 A;  3M8Q A;  4H4O A;  4M41 A;  3MAQ A;  2G8I A;  4OLA A;  4CGD A;  1KRP A;  2OZS A;  5J2P A;  3TAP A;  4KTZ A;  3QET A;  5FDL A;  3LDS A;  4JRP A;  4E7K A;  1CXU A;  3NBP A;  1N5Y A;  4M42 A;  1SV5 A;  3ZSV A;  2ITG A;  4FZY A;  3O4Q A;  3DRP A;  3DRR A;  3B6P A;  1KFD A;  3CFO A;  3HPO A;  3SUO A;  4LSN A;  3VQP A;  3HL8 A;  2ZE2 A;  4B8A B;  3HP6 A;  3PX0 A;  1SL2 A;  4LSL A;  3KLF A;  4CFC A;  1RT6 A;  3VQQ A;  1NJX A;  2P5G A;  4DU1 A;  1VSJ A;  2EX3 A;  2OZM A;  4DTM A;  1C0M A;  4CJU A;  3SQ1 A;  1I39 A;  3VQ7 A;  4LY7 A;  4CK3 A;  4R5P A;  4DLG A;  3OYL A;  1HYS A;  2X6S A;  3AV9 A;  3D45 A;  3QER A;  5HRS A;  4KHU A;  3K5O A;  2HW3 A;  1JXB A;  1Z26 A;  1BGX T;  3M8S A;  4HUF A;  2OA8 A;  4DQP A;  3OYG A;  4JS5 A;  2A1R A;  3L3V A;  3LZI A;  3SQ2 A;  5KRS A;  4CHZ A;  1WSF A;  3VQ4 A;  1RT3 A;  1TKX A;  2HND A;  3SV3 A;  1L3S A;  4KHY A;  1CLQ A;  1EXQ A;  4DTP A;  3AO1 A;  3KLG A;  4J2A A;  3DLH A;  3U6F A;  5HRO A;  5HLF A;  3KD1 E;  4FJM A;  2XY6 A;  2Z1H A;  1U04 A;  4Z0U A;  1RDB A;  4CJV A;  3V4I A;  4CEO A;  4DG1 A;  4AIL C;  4KB1 A;  1KCF A;  5KGX A;  4DS4 A;  4ICL A;  4IG3 A;  3AA5 X;  4E7I A;  3NGI A;  1QSS A;  2HVI A;  2ATQ A;  4N56 A;  4N41 A;  4CF1 A;  3HK2 A;  4KAZ A;  4B9M A;  3MEG A;  4E7H A;  2F96 A;  3KKR A;  4IG0 A;  2IAJ A;  2PYL A;  5JS1 A;  3HXM A;  4CJK A;  3L2W A;  3NF7 A;  4LD0 A;  1KVB A;  4ZHR A;  1JL2 A;  4DTU A;  1NK8 A;  2PY5 A;  1C1A A;  5DMR A;  1UA0 A;  1S5J A;  2DFF A;  2YKM A;  4KO0 A;  3VQB A;  1TGO A;  2HB5 A;  4B9N A;  3ZSQ A;  1IKV A;  3V9X A;  4FLU A;  1KVA A;  3CM5 A;  3PO5 A;  4W5N A;  3D0P A;  4DLE A;  3F73 A;  4CJQ A;  1LWF A;  2QK9 A;  3T1A A;  4RG8 A;  4BAC A;  5K14 A;  5J1E A;  1XI1 A;  1S1V A;  4FK4 A;  2WON A;  3V9Z A;  3DYA A;  4HVJ A;  3QES A;  1ZBI A;  2GUI A;  3F9K A;  4O0J A;  1QSY A;  4M3X A;  3NF9 A;  4F3T A;  4FM0 A;  1QTM A;  5HBM A;  3DLE A;  3RMC A;  3O3G A;  2XY7 A;  2IDO A;  4Z4G A;  3CYM A;  5EU7 A;  2F8T A;  1WSI A;  1J53 A;  1KTQ A;  2NUB A;  3DOK A;  3ZT0 A;  3DMJ A;  4CJT A;  1U4B A;  1X9M A;  2HHV A;  5J2Q A;  4O44 A;  4CEB A;  1NK6 A;  3HST B;  4M3T A;  1BCO A;  4B3O A;  3V1O A;  3TAQ A;  1RT2 A;  2KW4 A;  1TV6 A;  2RF2 A;  3LAM A;  1BHL A;  4CJL A;  1JLE A;  3AVK A;  3L3U A;  2HHT A;  4CF9 A;  1JXE A;  2KTQ A;  1N6Q A;  4FZZ A;  3TAF A;  2XY8 A;  3OYJ A;  3ASM A;  4OGC A;  4OKJ A;  1U49 A;  1X1P A;  3ALY A;  3IRX A;  1CZB A;  4CEZ A; 
#chains in the Genus database with same CATH topology
 1JLQ A;  3QO9 A;  1SKW A;  1BQM A;  3OVN A;  2E2N A;  1RDC A;  4A2B A;  4CGF A;  4KV8 A;  2PAV A;  1BUP A;  1X9W A;  4CGJ A;  3CER A;  3U3G A;  4DF4 A;  3RR7 A;  4K8X A;  1HNV A;  4CHY A;  4CJS A;  1HUX A;  1DLO A;  4NYF A;  5BR9 A;  1JCE A;  1VQN N;  1RT5 A;  2DFE A;  4B3M K;  5KGW A;  3GBT A;  1YIT N;  5AZJ A;  2HNZ A;  3VA3 A;  1X9S A;  2X74 A;  3VF6 A;  2CH5 A;  3ENH A;  1O13 A;  4CK1 A;  1VQ8 N;  1ZBL A;  3HM9 A;  2I5J A;  4J8F A;  4KHN A;  4OPK A;  4CJ3 A;  1W0H A;  3BY5 A;  1YJ9 N;  4B9S A;  1TK0 A;  1FKO A;  2OPR A;  4JI3 K;  4KHS A;  4GNI A;  1LWC A;  4Q0B A;  4DB3 A;  1TYQ A;  4WCE L;  4GV3 A;  3LDN A;  3OHR A;  4FJ5 A;  4OGE A;  2FC0 A;  5F1X A;  4YDU C;  3NDK A;  4K8Z A;  3ZSX A;  2P9N B;  4BRO A;  3ULD A;  4BDY A;  3AA2 A;  3MN5 A;  5AQW A;  5KRT A;  4DR3 K;  4TSX A;  2CGL A;  3C6H A;  1ZBF A;  1BI4 A;  3AVJ A;  3D6R A;  4H5W A;  4C8O A;  5CHI A;  4BWJ A;  4EP4 A;  3LM9 A;  3HSC A;  2UXD K;  4EP5 A;  3VER A;  1EX4 A;  1VSD A;  4CHN A;  4RW9 A;  1IG9 A;  3O4N A;  1XC9 A;  1GLL O;  3VGK A;  3PX4 A;  4I7F A;  4M7Y A;  4WQ5 C;  3MWT A;  3K57 A;  2P9N A;  2G8W A;  4O5B A;  4CES A;  4JNE A;  4B1V A;  1QHA A;  4GW6 A;  4FLZ A;  4CFD A;  2X6N A;  2PFU A;  3ISN C;  4WQ4 A;  4Y1C A;  2ZWH A;  1RBS A;  1N36 K;  5SZT A;  1JKH A;  2ZGY A;  4F2S A;  3KTQ A;  3CPW M;  1MDU B;  1NKB A;  4YOT A;  5GIN A;  1WSE A;  2ZJP L;  2E88 A;  1OVQ A;  2P51 A;  3IMX A;  4YOX A;  3TTF A;  3A8Y A;  4Z4H A;  4PHT X;  1ATR A;  3TAB A;  3H08 A;  5FRM A;  5CY4 A;  2KFN A;  2ASO A;  3S3M A;  2YCH A;  1J9A A;  4IDH A;  1D9D A;  1P90 A;  4FWK A;  3FZL A;  3LDP A;  1WB9 A;  2QEX N;  3J7A P;  2D0A A;  3DM2 A;  4IOA L;  3A5L C;  3K5N A;  1W97 L;  1XNR K;  3PSI A;  1XNQ K;  3CQY A;  3F2K A;  4IWV A;  2VYP A;  4CED A;  4JI8 K;  3S3N A;  1S9G A;  3HOS A;  4MLH A;  2KZM A;  4JI0 K;  5E41 A;  3D2F A;  3SMP A;  5AQI A;  5AJ3 K;  4JKG B;  3RMA A;  1RTH A;  3O9S A;  3THW B;  4B9L A;  4FJJ A;  3TAE A;  4E3S A;  1NK5 A;  5FRO A;  3NE6 A;  4CK2 A;  1UWB A;  3K2P A;  2YV0 X;  4IEE A;  2XY5 A;  2E1Y A;  3CJC A;  2E2P A;  3BGR A;  1YIJ N;  1I3A A;  3ZEU A;  2ASP A;  5CZ2 A;  1KLM A;  3CCL N;  2KZZ A;  1WLJ A;  4BC2 A;  5SWM A;  5J2M A;  2VWJ A;  1T7P A;  4LFA K;  2DPN A;  3E66 A;  3OBY A;  4FL9 A;  2HHW A;  4LC9 B;  3SAH A;  4EIA A;  2W6K A;  1KFS A;  1CXQ A;  1OH7 A;  1DGK N;  1BOT O;  2EHG A;  3C6T A;  2QW9 A;  4A57 A;  1ZXO A;  1Q82 O;  3C94 A;  1L3V A;  1SS6 A;  3OYE A;  3WEE B;  3IAY A;  5HRP A;  1JLA A;  4BR4 A;  1EQY A;  1RDU A;  3AAP A;  5M1N A;  1VSI A;  2P1J A;  1K8K B;  4M3R A;  2Q1N A;  2W41 A;  5LMN K;  3VEW A;  1NGH A;  3HJF A;  1RDD A;  3VES A;  4I2P A;  3O4W A;  4FWM A;  1S1W A;  4DFJ A;  2VG7 A;  1VQO N;  1NGB A;  4NB4 A;  4DU3 A;  3MEC A;  1EET A;  3TR8 A;  3KK1 A;  2NRH A;  4AHV A;  3T1Y K;  2BE2 A;  1B9F A;  3LL3 A;  1NWK A;  1S1T A;  2JGU A;  3WXM B;  1GLD G;  3MXI A;  1RNH A;  4CEE A;  5AQH A;  2PYJ A;  3WXL A;  4FJ8 A;  3VQ8 A;  2HBL A;  2BTF A;  3H46 O;  4F2R A;  4BC3 A;  5C24 A;  2YHB A;  1VQ4 N;  3DXK B;  1HJO A;  3L2R A;  3H1Q A;  3O80 A;  2ZD1 A;  3K9J A;  1BL3 A;  1JLB A;  3KJV A;  2E4L A;  2CGJ A;  5C0Y A;  3IG1 A;  3PUF A;  3E9L A;  3D7E O;  1TK8 A;  3O1W A;  4IBN A;  2GUP A;  4DTO A;  4FJK A;  1VQ6 N;  4RW7 A;  2QWN A;  1RT1 A;  4QS9 A;  3QEX A;  4FLX A;  1KSP A;  1C0G A;  4DR7 K;  4B1X B;  2QWP A;  1WAF A;  3O8M A;  4WFN L;  4BDZ A;  1D9F A;  1QHT A;  1R0A A;  3ZX2 A;  4BR2 A;  4JV5 K;  1TAU A;  1K6Y A;  1M1K O;  1BIU A;  2D5R A;  2ITM A;  1BG3 A;  4JKD A;  1GLB G;  1LWE A;  3T19 A;  4CZL A;  4CCH A;  3O9Q A;  5GIP A;  3RMD A;  3FFK B;  4IEI A;  1ASV A;  4DV2 K;  3J80 O;  3V6D A;  3ZSO A;  1NU0 A;  3QFU A;  4C8K A;  5FRN A;  4X64 K;  4QCL A;  3AO4 A;  3CFR A;  2G8H A;  1HMV A;  1TL3 A;  3AY9 A;  4FZX C;  4DCH A;  1TUU A;  4PUO A;  3I8D A;  3FGU A;  4KTQ A;  4NLC A;  3VF2 A;  3G6E N;  1DTQ A;  4AHC A;  1IH7 A;  4HCC A;  4Q5V A;  3S3O A;  4OX9 K;  3VA0 A;  4BRQ A;  2D0P A;  4H4O A;  1X3M A;  4OLA A;  1KRP A;  2YHX A;  3WXJ A;  2Q2R A;  4H0Y B;  4KTZ A;  5FDL A;  3LDS A;  4E7K A;  2Q36 A;  2A41 A;  3NBP A;  1T6C A;  1VAZ A;  5FPD A;  3ZSV A;  2ITG A;  4IOC L;  3L6Q A;  3SUO A;  3VET A;  4LSN A;  2ZE2 A;  1X3N A;  4B8A B;  4C23 A;  4LSL A;  3VQQ A;  2O8D B;  4DU1 A;  1VSJ A;  3MCA B;  2I7P A;  5JVG L;  4DTM A;  4MDA A;  4LY7 A;  4DLG A;  1HYS A;  3P31 A;  1HPM A;  5BRE A;  1KAZ A;  2X6S A;  2P9P B;  4KHU A;  3K5O A;  4JK7 A;  3CC4 N;  4BVO A;  1HKC A;  3CHW A;  3OTO K;  3HI0 A;  3S41 A;  4WF9 L;  3LZI A;  1NGD A;  1WSF A;  1GLA G;  1RT3 A;  1TKX A;  1L3S A;  2QWL A;  1FW6 A;  1Q81 O;  3KLG A;  4J2A A;  5HLF A;  4EAH D;  2P9U B;  5BPM A;  2Z1H A;  1U04 A;  3GL1 A;  4H0V B;  4CEO A;  4DG1 A;  3N4Q A;  4G9Z A;  4KB1 A;  5KGX A;  4DUZ K;  2QXL A;  4JKA A;  3RSE A;  4DS4 A;  4IG3 A;  3NGI A;  2HVI A;  4NLB A;  2F96 A;  4PKI A;  3KKR A;  3GE1 A;  5JLF A;  2PYL A;  1LCU A;  4PKG A;  4Y0W A;  3BZC A;  1C1A A;  5DMR A;  1UA0 A;  3VQB A;  2YKM A;  4W5N A;  4DLE A;  1LWF A;  5J1E A;  3DYA A;  4HVJ A;  3MN7 A;  2P9P A;  5F2R A;  3QES A;  1ZBI A;  3F9K A;  4LFB K;  1YVN A;  1QSY A;  2E5L K;  2ZJR L;  3RMC A;  3SMS A;  4MLE A;  3ZT0 A;  1U4B A;  1X9M A;  5J2Q A;  5M1P A;  3HST B;  2E2O A;  3R6M A;  5AFU H;  1RT2 A;  2HHT A;  3MX5 A;  3FZF A;  1V4T A;  1J5E K;  2ZM6 K;  4WQ4 C;  3VF4 A;  4BGB A;  4UY8 O;  4OGC A;  4C1N K;  1U49 A;  5ADX H;  3OW2 M;  3P4I A;  4H5N A;  1TKZ A;  1F21 A;  4WE1 A;  3LP2 A;  4EHU A;  2HHH K;  2P9L A;  4I6M A;  3QEP A;  1NMD A;  5HRN A;  1W7A A;  1J54 A;  4Z4F A;  4CHO A;  3T3F A;  4LH4 A;  3OS2 A;  1C0F A;  1HQU A;  4DQI A;  3O08 A;  1HNI A;  5EX5 A;  1RDA A;  4DQS A;  5GIO A;  1RBV A;  3ZCM A;  3U3Y A;  1YVU A;  4IFE A;  4N47 A;  4BRP A;  1B92 A;  1BQN A;  1EP4 A;  2RPI A;  4CGI A;  2HOE A;  3LPT A;  1OVY A;  1KVC A;  4CF0 A;  5C12 A;  3EKS A;  3T1H K;  1ZBH A;  3D2E B;  4EZ9 A;  1BIZ A;  1Y64 A;  1LAV A;  4DTN A;  4A59 A;  3NF6 A;  3SUQ A;  4CF8 A;  3AA4 A;  3HRG A;  2IOC A;  5AQK A;  4NXM K;  1GLE G;  3WUH A;  2JWL A;  2WBN A;  4B1W B;  2O8E A;  4FYD A;  3KK7 A;  4LF9 K;  5BN9 A;  4ISF A;  3OJS A;  4JRQ A;  2LSN A;  5AZI B;  1QVG M;  4BRC A;  3S9H A;  4CHQ A;  4PKH A;  2FBV A;  4MFB A;  3J81 O;  4CGH A;  1IBL K;  2HHU A;  1KXP A;  1V4S A;  3VGL A;  4CZJ A;  3CJA A;  4IO8 A;  4CZG A;  2P5O A;  3KLI A;  3FZH A;  4FPA A;  1HJR A;  5KQD A;  4KHP K;  3NVM A;  2QKK A;  3E01 A;  4HTU A;  3MXJ A;  2HHX A;  2ETJ A;  3I33 A;  3ZX0 A;  4CJR A;  3UKU A;  4W5T A;  3A0I X;  4CD1 A;  1TYQ B;  2IVO A;  2A3Z A;  4O0I A;  4CZM A;  1BIS A;  4MO5 A;  4AHU A;  3HVR A;  4FK2 A;  3JYT A;  5AR0 A;  3TPQ A;  3PIP L;  1H1V A;  2YKN A;  3DOL A;  1ZYQ A;  4EZ6 A;  4JD2 A;  4FLY A;  3HYF A;  2B4J A;  1S1U A;  3GG4 A;  2VWB A;  3NH2 A;  4ELV A;  4DSL A;  4OPJ A;  2QKB A;  1RT7 A;  1RBT A;  4BRM A;  3GDQ A;  3UKU B;  5JS2 A;  1NK7 A;  2E20 A;  2V51 B;  1BWF O;  3NFA A;  4DV7 K;  2G8V A;  4LF7 K;  5AQN A;  2KKZ A;  3VQ9 A;  4I2Q A;  1TKT A;  1JL1 A;  4PA1 A;  4BY9 C;  3M8R A;  1S6Q A;  3TAN A;  3W0L A;  4QAG A;  5E84 A;  3VN5 A;  3ITH A;  4JN4 A;  4ILH A;  3NVK A;  3LP1 A;  5AQV A;  3DWL A;  3O9U A;  3AO5 A;  4DTR A;  4DKW A;  1NNE A;  2F9T A;  2NNW A;  3FFI A;  2NRT A;  3ZT1 A;  1EWQ A;  3RMB A;  1LW0 A;  5AQY A;  3KK3 A;  4IFY A;  1E3M A;  3CCM N;  1FK9 A;  4NYN A;  4ZTF A;  1W2B M;  4C8L A;  2O8F B;  3NH0 A;  4E7L A;  4DV4 K;  2GBZ A;  3AVB A;  1VQ5 N;  1IKW A;  3BF1 A;  2FSJ A;  2XRI A;  3ZSY A;  5D3G A;  2B6A A;  5AQZ A;  2BDP A;  4DWI A;  4H03 B;  3U9Z A;  2Z1I A;  4L3Q A;  3L2Q A;  5C15 A;  3L2V A;  4JKB A;  1T03 A;  2OYQ A;  4NO7 A;  1UAX A;  2AJQ A;  3ZX3 A;  2GTD A;  1JLC A;  3FR0 A;  4JI4 K;  1HX1 A;  4A5A A;  4CVN E;  4DR6 K;  4W5O A;  3MEE A;  3R1X A;  4CFA A;  2O8C B;  2X78 A;  3EY1 A;  4YY3 K;  1HR0 K;  3H6E A;  1ESV A;  1G15 A;  4C1N I;  1ZC6 A;  3ATV A;  2OTL N;  4KHQ A;  3DXK A;  3SNN A;  1TAQ A;  2IS3 A;  3OYH A;  1SQK A;  3LWM A;  2A42 A;  2OPP A;  3H3O B;  1XMQ K;  3CD6 N;  4CZK A;  3AVG A;  1SZ2 A;  2HST A;  4DR4 K;  1Q9Y A;  1IBK K;  1WN7 A;  4HTL A;  3QFP A;  5FPE A;  4FJ9 A;  5HRR A;  5GAG P;  1NKC A;  2FSK A;  4KFB A;  4FLW A;  2YNI A;  4PY5 A;  1JCF A;  4OVL A;  3SJJ A;  4CEA A;  3C7N A;  2D0C A;  3TU5 A;  3DLR A;  4H0P A;  4KB0 A;  4FJI A;  4BRD A;  1HNW K;  4F8R A;  1Q7Y O;  3OYK A;  4I9L A;  2Y1I A;  1IG8 A;  3DAW A;  3ENO A;  1VQP N;  3O5B A;  2DY4 A;  1QS4 A;  1RTI A;  4JI6 K;  3G25 A;  1N32 K;  2P9U A;  4CBU A;  4CEF A;  3CCS N;  5BN8 A;  3RSE B;  1S22 A;  2CGK A;  3RRH A;  4CJW A;  5C2D A;  4F4K A;  2QWM A;  3LPU A;  4CZF A;  3AAR A;  3HOT A;  5AQQ A;  4E7J A;  2ZQB A;  1ITG A;  4FWP A;  2YNG A;  1C1B A;  4E1M A;  3TSP A;  4FPB A;  3I55 N;  2G8K A;  3WQT A;  3LWL A;  2YHW A;  3HM8 A;  2OCE A;  4BRI A;  4RWT A;  2YJE A;  1TVR A;  5AQO A;  3VGM A;  3VMF B;  2B5J A;  4GY2 B;  3CCR N;  3DJC A;  5AQF A;  3NGZ A;  2P9I B;  3A5M C;  2F4V K;  3AVC A;  1C6V A;  4XH4 A;  1YF5 L;  3NAE A;  1RTJ A;  4LFC K;  4K25 A;  3QEI A;  3O3H A;  3CQ8 A;  1MWM A;  2GWK A;  2A6A A;  3SCX A;  3ZYY X;  3WEE A;  5ELZ A;  4BGA A;  1WSG A;  3DLK A;  2FF3 B;  3EKU A;  1XC3 A;  2IGI A;  3TTD A;  4EFH A;  3DLG A;  4DV5 K;  3NCI A;  3O9T A;  4DFK A;  2WTU A;  2Z1G A;  1RBR A;  2NRX A;  3MXM A;  1T44 A;  3MX2 A;  3BDP A;  1D4X A;  3U4L A;  4LF5 K;  4JHD B;  4CGD A;  3QET A;  3ATU A;  1CXU A;  1N5Y A;  1SV5 A;  2ZF5 O;  5KPR A;  4FWL A;  3AGK A;  1Q86 O;  3DRR A;  3CFO A;  5EXW A;  2VGM A;  5EVZ A;  3O9R A;  3PX0 A;  4DR2 K;  4JI1 K;  1NJX A;  2P5G A;  3LDL A;  2IVP A;  2NRZ A;  3VQ7 A;  4CK3 A;  4BVP A;  4OO1 J;  3ZET A;  1WBD A;  3AV9 A;  3QER A;  5KQ8 A;  1JXB A;  1IBM K;  4HUF A;  5LL6 Z;  5KRS A;  1DKG D;  3VQ4 A;  3CXC M;  3ENB A;  4H5T A;  4IO9 L;  3DLH A;  1HLU A;  5AQU A;  4AIL C;  3SAG A;  3UB5 A;  3AA5 X;  3G4S N;  1QSS A;  4N56 A;  1YUW A;  4KAZ A;  3MEG A;  4E7H A;  2J4R A;  3THX A;  3M6G A;  1E4F T;  1T3V A;  4CJK A;  4ZHR A;  4DTU A;  1NBW A;  2PY5 A;  4KO0 A;  2DFF A;  2HB5 A;  4B9N A;  1IKV A;  1KVA A;  4EHT A;  2VCP A;  3D0P A;  3CC7 N;  1M90 O;  3ZET B;  4U67 L;  3T1A A;  1XI1 A;  2E8A A;  1S1V A;  2WON A;  2P9S A;  4M3X A;  4K0K K;  1XMO K;  2BH1 A;  4F3T A;  1QTM A;  3VEV A;  3DLE A;  4Z4G A;  2XY7 A;  1KD1 O;  1WSI A;  1J53 A;  2NUB A;  3KWI A;  2HHV A;  1BCO A;  5M1K A;  1MA9 B;  2KW4 A;  1TV6 A;  2RF2 A;  1BHL A;  3AVK A;  4CZI A;  4BC5 A;  2UXB K;  4K41 A;  3K0S A;  4BQZ A;  3O1B A;  2F7T A;  5AZJ B;  1G99 A;  2D1K A;  4IOX A;  2NLX A;  4XH5 A;  2F8S A;  2VQF K;  3QNO A;  4B1Y B;  3OJU A;  4HUG A;  4B9Q A;  4JI7 K;  1YJN N;  3WNE A;  3M5R A;  3RWU A;  2HMI A;  2KHO A;  4J2E A;  3TSU A;  2UUC K;  1N34 K;  4JLH A;  2P9S B;  3R9P A;  2Q0U A;  3F5T A;  4B3S K;  1DT9 A;  3AVH A;  3SK3 A;  1BO5 O;  3K58 A;  2O8F A;  1VK0 A;  4BR5 A;  5AFU A;  1XHX A;  3AVI A;  1VSL A;  4H5V A;  5IT9 O;  3ZSR A;  4OKE A;  3VEX A;  4CGG A;  4YDU A;  1D8Y A;  2HBM A;  3QML A;  4C8M A;  2DFH A;  4FM2 A;  1QSL A;  4CJ5 A;  3PSF A;  2D0O A;  3OYC A;  3SPY A;  5F0X A;  5LY3 A;  2HF4 A;  3THY A;  1DEJ A;  4B9T A;  1NMN A;  4FJH A;  4JK8 A;  3E9P A;  4Z4E A;  3CJ1 A;  3NMU A;  4FWQ A;  3OY9 A;  5C10 A;  2IC3 A;  4X66 K;  3CCV N;  1RTD A;  1ZBU A;  3AVF A;  1HYZ A;  1A5X A;  4XEI A;  4CJF A;  1BCM A;  2QTD A;  2E6L A;  3OYF A;  3QIP A;  3BZK A;  1A5V A;  1XUP O;  5GAE P;  3M3Z A;  4PQU A;  1NGF A;  1YTU A;  1QQO A;  3THY B;  3PX6 A;  5MLC Q;  2O8B B;  4GVE A;  2F9W A;  4DSI A;  1NJI O;  5LJW A;  3OS0 A;  1S6P A;  2YNF A;  3T69 A;  3SBG A;  2RHK A;  4JAX A;  1SL0 A;  1VQM N;  4BR0 A;  3MK6 A;  3Q7B A;  2CH6 A;  4KRF A;  4BRL A;  5AQG A;  1QZ5 A;  4OKK A;  4OJR A;  3V81 A;  4FXD A;  2HHQ A;  2WOM A;  3V9S A;  1NK9 A;  2RN2 A;  1YXQ A;  4KKO A;  2FLO A;  3HO1 A;  1WOQ A;  5B8H A;  3HT3 A;  3L8B A;  1JLF A;  1BDG A;  3CG7 A;  2GV9 A;  4DU4 A;  2QM1 A;  5HP1 A;  4MQ3 A;  3SAF A;  4BWM A;  2FBT A;  1ZBS A;  2HBK A;  4I6M B;  4JKG A;  4PL8 A;  2GWJ A;  4BG9 A;  3THW A;  1NK0 A;  4BE2 A;  1LV5 A;  3LAN A;  1TL1 A;  3L0Q A;  2YHY A;  2H3G X;  2E2Q A;  3CPE A;  4B9U A;  4AH9 A;  1KQS M;  2BUP A;  2YNH A;  4CJ4 A;  3HZ6 A;  1E4G T;  4R79 A;  3SLC A;  1EKE A;  5FLX O;  2JLE A;  2OAN A;  1C0T A;  5BRF A;  1YI2 N;  3CCE N;  1Q18 A;  3I0R A;  2HMP A;  3D2E A;  4V19 S;  1UA1 A;  4DR5 K;  1HRH A;  1ASU A;  3P1G A;  3PV8 A;  1WBB A;  3PLA A;  2Z1J A;  4PWD A;  3RRG A;  1K8K A;  2FBX A;  4DSK A;  1VQ9 N;  5BR8 K;  4Z94 A;  1K9M O;  4B3O A;  4FCY A;  4B1Z A;  3QEW A;  3LP3 A;  4CEC A;  1XHZ A;  4A61 A;  2Q0R A;  3P38 A;  4H0T B;  4FW2 A;  4A2A A;  3QIC A;  1L3T A;  5T7B A;  3C7N B;  3ID6 A;  5AZI A;  3B8A X;  4IXC A;  3KHY A;  2QXF A;  2IVN A;  3JXU A;  4BR7 A;  4BRH A;  4L8R B;  4CE9 A;  5DK5 A;  4O55 A;  3OYD A;  3C6U A;  2Q97 A;  1OKJ A;  1S3X A;  1P8Z A;  1O1W A;  3CC2 N;  4O8U A;  2FF6 A;  4ILJ A;  4FJN A;  2Y1J A;  1IKY A;  3C6A A;  1EO1 A;  2W40 A;  5LJV A;  3WXI A;  4WFB L;  1WSH A;  4BE1 A;  3AVA A;  3QBX A;  2XO7 A;  2GEM A;  3EL2 A;  4E89 A;  4DR1 K;  4FJ7 A;  2FSN A;  3EZW A;  4NCA A;  1BU6 O;  1QQM A;  4QS8 A;  4DFM A;  2Q3S A;  1WNS A;  4A5B A;  1SUQ A;  4B9V A;  4MO4 A;  1VSE A;  3J7Z O;  3KIO A;  5FPM A;  3DLB A;  3IFR A;  4U7B A;  4AHT A;  2NZT A;  4LF4 K;  2A1S A;  4HWI A;  3H45 C;  1FXX A;  3MDQ A;  1UOC A;  2AA4 A;  2HNY A;  2O4G A;  3Q7C A;  3IS9 A;  2VG6 A;  4CZE A;  4BR9 A;  3OYN A;  4BRK A;  2V52 B;  3UE5 A;  2W6L A;  4UQG A;  3SI6 A;  4OLB A;  2UU9 K;  3CJB A;  4YOW A;  1S1X A;  1D5A A;  1CLQ A;  1XWL A;  2FBY A;  5I3U A;  4GV9 A;  3LDQ A;  2YHA A;  5TKW A;  4JKE A;  4DF8 A;  1RDW X;  4OPA A;  4FOE A;  5EY4 A;  4E0D A;  2UXC K;  4B08 A;  3VEO A;  3LZJ A;  4IJA A;  2QA4 N;  1SL1 A;  4H8K A;  3V1R A;  3VQA A;  4AF1 A;  4YNQ A;  3G71 N;  3L2U A;  3A5N C;  4ISG A;  1L3U A;  3AO2 A;  2OPS A;  1JJ2 M;  2O8D A;  3M1F A;  1C1C A;  3ULE B;  2AP1 A;  1NGA A;  3WNG A;  1B9D A;  3L4I A;  4FLV A;  1NOZ A;  1VSK A;  2P9K B;  1U45 A;  1CZ9 A;  1A5W A;  2YI1 A;  1U48 A;  1RIL A;  3C95 A;  3CFP A;  3SZ2 A;  1GOB A;  4BRF A;  2EWS A;  4E19 A;  5JMV A;  3VTH A;  2HHS A;  1T8E A;  2E6M A;  4IKF A;  3P83 D;  1NLV A;  1FKP A;  2HBJ A;  1YAG A;  4ILG B;  3CJ7 A;  4LH5 A;  4K43 A;  3OS1 A;  4CFB A;  1HYV A;  2O8C A;  1DTT A;  1LW2 A;  3FE1 A;  2KFZ A;  3TI0 A;  3M8Q A;  4A62 A;  3MAQ A;  2G8I A;  2OZS A;  4JYA K;  3CCJ N;  1EWR A;  1I94 K;  2UUA K;  3LDO A;  4M42 A;  5BPN A;  2QWQ A;  4FZY A;  1LOT B;  3PIO L;  3O4Q A;  3DRP A;  2GX9 A;  3HPO A;  3VQP A;  4JI2 K;  3HL8 A;  3KWG A;  1SL2 A;  3KLF A;  4QS7 A;  3N4P A;  2EX3 A;  1C0M A;  3SQ1 A;  2WUS A;  5I9E B;  1JCG A;  3J7Y P;  4FWN A;  4NXN K;  5HRS A;  3BP8 A;  2P9K A;  1HNZ K;  1BGX T;  3M8S A;  1HNX K;  2OA8 A;  2YJF A;  3OYG A;  4JS5 A;  2A1R A;  3SQ2 A;  4CHZ A;  4YOR A;  3BUZ B;  3R3L A;  2HND A;  2WFB A;  3QBW A;  1EXQ A;  5M1O A;  4FOI A;  4DTP A;  1U2V A;  4M7X A;  5HRO A;  4CW7 B;  1N8R O;  2XY6 A;  4Z0U A;  1RDB A;  4CJV A;  3V4I A;  2FXU A;  5DM6 L;  3UKR B;  1KCF A;  4WFA L;  3EN9 A;  2ATQ A;  4DHY A;  4N41 A;  1HKB A;  2QWR A;  3OBW A;  3U9D A;  4B9M A;  5LMU K;  4LF6 K;  4IG0 A;  2IAJ A;  3HXM A;  3L2W A;  3NF7 A;  1KVB A;  1JL2 A;  1NK8 A;  3EE8 A;  1S5J A;  3CM5 A;  4CJQ A;  5K14 A;  4GKK K;  3V9Z A;  4H0X B;  1ILY A;  2KLA A;  4O0J A;  3ZLJ A;  3U8X A;  3HBT A;  4FM0 A;  1KTQ A;  4CJT A;  2UYT A;  1NK6 A;  3V1O A;  3TAQ A;  1JLE A;  4CF9 A;  3CET A;  1JXE A;  4JKF A;  1N6Q A;  3TAF A;  2XY8 A;  3OYJ A;  1NGI A;  4RTF D;  4OKJ A;  1X1P A;  3IRX A;  5CE3 A;  3WQU A;  4B8C A;  4ELT A;  4E1N A;  2R7Y A;  1IO2 A;  4YHH K;  4BRA A;  4NCG A;  3KLH A;  4CER A;  1Z6R A;  3CMA N;  5KI6 A;  3QB0 A;  1BA1 A;  3TSQ A;  4FVM A;  2NRV A;  3LM2 A;  1VHX A;  2G8F A;  3AVL A;  2ZJQ L;  1OH5 A;  3MN9 A;  3AVM A;  4IZ9 A;  4JK9 A;  3G0Z A;  4RW8 A;  4W5R A;  1RGI A;  3I8B A;  4ID1 A;  3PO4 A;  1XQS C;  4CJE A;  5I42 A;  1JLG A;  3I56 N;  3NHG A;  4B3R K;  3SYZ A;  1HQE A;  3MCP A;  4YOU A;  3TAR A;  3L4Q A;  4RW4 A;  4KH4 A;  5CYM A;  3E9O A;  5BPL A;  1T05 A;  3VEN A;  1QE1 A;  5H1S Q;  4CIG A;  1FJG K;  3SUP A;  3K5M A;  4JD2 B;  5M1Q A;  3ZT3 A;  3KK2 A;  4KH5 A;  1YT3 A;  3SPZ A;  1RBU A;  2E1Z A;  1BA0 A;  3NH1 A;  5CZ1 A;  4FLT A;  1CZA N;  5HL7 L;  4KPY A;  4IFV A;  4FVU A;  4FWR A;  4JKH A;  4FJL A;  3B6O A;  1HKG A;  3C65 A;  4BRG A;  3VQD A;  1MU2 A;  4DMN A;  4BC4 A;  3DLL L;  4OPH A;  1NOY A;  3SJH A;  3E1Y A;  3J8A A;  3LP0 A;  3VTI A;  3SQ0 A;  1IV0 A;  2WC9 A;  1LAW A;  4DTJ A;  3GOI A;  4CIE A;  4CZH A;  1Z25 A;  5EOY A;  5AQS A;  3K5L A;  4RW6 A;  4H5R A;  1SAZ A;  1HPZ A;  1WSJ A;  1VSH A;  3LAK A;  3QEV A;  3LAL A;  1NK4 A;  4DFP A;  4KRE A;  2YX6 A;  4N76 A;  4LF8 K;  4X62 K;  4FK0 A;  5C25 A;  3A5O C;  4AM6 A;  3RTV A;  4KTW A;  1NJY A;  4JS4 A;  1VQL N;  1NJW A;  4ELU A;  1GLC G;  4MDB A;  5CYQ A;  5ADX A;  2O8E B;  4I9Q A;  3AO3 A;  1YJW N;  2D0B A;  3OYA A;  4JI5 K;  1K73 O;  1VSF A;  1S9E A;  3ZT2 A;  4F3O A;  4GVM A;  4M63 C;  2VGN A;  1VRU A;  4ISE A;  4DV6 K;  3WNH A;  3K9K A;  3WXK A;  4CJP A;  1C0U A;  3W3D A;  3ZEU B;  2ASM A;  4HUE A;  1R59 O;  1WAJ A;  3ZSW A;  2XHB A;  3THV A;  4DV3 K;  3CI5 A;  2JWK A;  4FJG A;  5AQM A;  2A5X A;  4NCB A;  4WYB A;  5E26 A;  4DQQ A;  1VRT A;  3BEX A;  3WT0 A;  3ID8 A;  4DTX A;  3JAM O;  1NGE A;  1RCH A;  2QI2 A;  1NG9 A;  1NM1 A;  4AHS A;  1L5U A;  4DV1 K;  1QQC A;  2RKI A;  3PY8 A;  1OH6 A;  3VQC A;  2RE2 A;  3WNF A;  5GAH P;  3V9U A;  1IKX A;  1YHQ N;  2Q31 A;  1QZ6 A;  4H0O A;  5J2N A;  4CIF A;  4DUY K;  1MWK A;  3A2F A;  3TWH A;  3HPG A;  4Z4I A;  4M3Y A;  1W9H A;  3KD5 E;  3VPZ A;  5C42 A;  4XIU A;  2I7N A;  3AA3 A;  5JIC A;  1VQK N;  3RR8 A;  3CJ9 A;  3TAM A;  4YFU A;  4CF2 A;  3EO3 A;  3QNN A;  1S72 N;  4M3W A;  1GOC A;  4KI6 A;  3QLH A;  3HTV A;  4M3Z A;  1T6D A;  1OH8 A;  4WQ5 A;  4GV6 A;  1KAY A;  4J2D A;  1BI4 B;  4FJX A;  4FW1 A;  3D2F B;  4Y1D A;  1SKR A;  1ASW A;  3NF8 A;  3ZT4 A;  3V9W A;  1U6Z A;  2KQ2 A;  4KBO A;  3RVC A;  4CJ7 A;  2V7Y A;  2PZS A;  4J2B A;  1YTA A;  3BF3 A;  5C2F A;  4QOZ B;  4O8K A;  3EYZ A;  3OYM A;  3T7Z A;  5FPN A;  4C8N A;  4DTS A;  3M8P A;  3K59 A;  4FWS A;  3SUN A;  5JLH A;  2O8B A;  5KPZ A;  4O4G A;  4HHT A;  2BAN A;  1KC8 O;  1U47 A;  4M45 A;  3P5J A;  4JEP A;  5A2Q O;  1RFQ A;  4DSE A;  4PL7 A;  4KHW A;  4BRE A;  3O3F A;  1Q8I A;  2O4I A;  3CQX A;  4H4M A;  4K42 A;  1NGG A;  5BRD A;  4CHP A;  3EZ5 A;  4DS5 A;  1WUA A;  2VWK A;  5KTQ A;  1TK5 A;  3NGY A;  3ZSZ A;  3IDH A;  3H1V X;  3EEQ A;  2P9I A;  3CCU N;  1SKS A;  4X65 K;  4CBX A;  1REV A;  2NRW A;  2DTU A;  3P39 A;  1VSM A;  3ULE A;  4FM1 A;  5KPT A;  3FZM A;  4IDK A;  1KLN A;  4CBW A;  4BDP A;  2ZGZ A;  3OYI A;  3SQ4 A;  3KZB A;  3CM6 A;  4DQ8 A;  3F9M A;  5CR4 A;  3G10 A;  3KKS A;  3R8E A;  1NGJ A;  5AQP A;  3VQ6 A;  3AVN A;  2W42 A;  1Y97 A;  4FSV A;  4DSF A;  2QWO A;  4DV0 K;  3UIQ A;  4GMJ B;  3IKM A;  1NJZ A;  3VEY A;  3V1Q A;  3VQE A;  3HPH A;  4CI6 A;  3I0S A;  1NGC A;  4W5Q A;  4FO0 A;  4G1Q A;  2VG5 A;  2OTJ N;  3IUC A;  1J5O A;  3EE9 A;  4AHR A;  3JSM A;  5AQJ A;  3MN6 A;  4O5F A;  4N5S A;  5AQR A;  2VQE K;  1N33 K;  2IIR A;  4KI4 A;  2D4W A;  5M1F A;  4ZTJ A;  5AQT A;  3CME N;  4DQR A;  2BGG A;  4M3U A;  2PBD A;  3VQ5 A;  3KLE A;  4XH1 A;  3AAQ A;  5DM7 L;  3MED A;  4CD3 A;  3MMV A;  4HCB A;  1RT4 A;  3O6W A;  4Z4C A;  1X9J A;  2NRR A;  1TKD A;  3HVT A;  3OA9 A;  3QIO A;  4B3T K;  3MWP A;  2GEL A;  4DSJ A;  3OYB A;  4CEQ A;  4BRN A;  2OPQ A;  3QIN A;  1GOA A;  3DI6 A;  4ID5 A;  3KVG A;  3TAG A;  1NKE A;  5TKY A;  1ATN A;  3DRS A;  4BE0 A;  4FWO A;  1QQN A;  3HP9 A;  3SV4 A;  2HVH A;  2G8U A;  1Q9X A;  4M41 A;  4AQY K;  1U2V B;  5J2P A;  5IWA K;  3TAP A;  4JRP A;  4BQL A;  3C0B A;  1TUY A;  3B6P A;  1KFD A;  4KH6 A;  3UKR A;  2V7Z A;  3HP6 A;  1IJJ A;  1QVF M;  4CFC A;  1RT6 A;  2OZM A;  5GAD P;  4CJU A;  1I39 A;  4YOY A;  4R5P A;  3OYL A;  4JHD A;  3D45 A;  1Z05 A;  2HW3 A;  1Z26 A;  4DQP A;  3SBT A;  4IJN A;  3L3V A;  4RCH A;  3VEZ A;  4KHY A;  3SV3 A;  3DXM B;  3AGR A;  3AO1 A;  1ATS A;  3U6F A;  2A40 A;  3KD1 E;  4FJM A;  5AQL A;  3TTC A;  4ICL A;  4E7I A;  3CIP A;  3FZK A;  4CF1 A;  3HK2 A;  4GKJ K;  5JS1 A;  5AQX A;  4B1U B;  4LD0 A;  4BG8 A;  2UUB K;  4E1J A;  2P9L B;  1K8A O;  4YOV A;  1TGO A;  3ZSQ A;  3V9X A;  3CCQ N;  4FLU A;  3PO5 A;  3VOV A;  1GLJ O;  4F9O A;  3F73 A;  4JKC A;  2QK9 A;  4BAC A;  4RG8 A;  4FK4 A;  2HF3 A;  2GUI A;  1GLF O;  3NF9 A;  3QDK A;  1J6Z A;  5HBM A;  3O3G A;  2IDO A;  3THX B;  3CYM A;  5EU7 A;  2F8T A;  3FLC O;  3DOK A;  3DMJ A;  4O44 A;  4CEB A;  4M3T A;  4AM7 A;  1VQ7 N;  3CF5 L;  1KAX A;  3LAM A;  3H3N O;  4CJL A;  5JVH L;  3L3U A;  3DXM A;  2KTQ A;  3JS6 A;  4FZZ A;  3ASM A;  5BRH A;  5HOO A;  3ALY A;  1CZB A;  4CEZ A; 
#chains in the Genus database with same CATH homology
 1JLQ A;  4B8C A;  3QO9 A;  1SKW A;  4ELT A;  1BQM A;  3OVN A;  4E1N A;  2R7Y A;  1IO2 A;  1TKZ A;  1F21 A;  4WE1 A;  3LP2 A;  1RDC A;  4NCG A;  3KLH A;  4CER A;  4CGF A;  3QEP A;  5KI6 A;  2F8S A;  4KV8 A;  5HRN A;  3QNO A;  1J54 A;  4Z4F A;  4FVM A;  4CHO A;  3OJU A;  4HUG A;  3AVL A;  3T3F A;  4CGJ A;  1X9W A;  2G8F A;  3U3G A;  4LH4 A;  3OS2 A;  1HQU A;  4DF4 A;  3RR7 A;  4K8X A;  1HNV A;  4DQI A;  3AVM A;  4CJS A;  4CHY A;  1HNI A;  1RDA A;  3G0Z A;  4DQS A;  4RW8 A;  1RBV A;  3ZCM A;  4W5R A;  3U3Y A;  1DLO A;  4NYF A;  1YVU A;  4ID1 A;  3WNE A;  3PO4 A;  1RT5 A;  4N47 A;  2DFE A;  2HMI A;  3RWU A;  1B92 A;  5KGW A;  4CJE A;  1BQN A;  1EP4 A;  2RPI A;  4J2E A;  4CGI A;  5I42 A;  1JLG A;  2HNZ A;  3LPT A;  3VA3 A;  1X9S A;  3NHG A;  1KVC A;  4CF0 A;  2X74 A;  4JLH A;  3SYZ A;  1HQE A;  3TAR A;  1ZBH A;  4CK1 A;  1ZBL A;  4RW4 A;  3HM9 A;  3AVH A;  5CYM A;  2I5J A;  4EZ9 A;  3K58 A;  1BIZ A;  1VK0 A;  1T05 A;  4KHN A;  4OPK A;  1LAV A;  4CJ3 A;  1QE1 A;  4DTN A;  3NF6 A;  1XHX A;  3SUQ A;  4CF8 A;  3AVI A;  1VSL A;  1W0H A;  4CIG A;  3SUP A;  4B9S A;  1TK0 A;  3ZSR A;  4OKE A;  1FKO A;  2OPR A;  3ZT3 A;  3KK2 A;  3K5M A;  4KHS A;  1LWC A;  1YT3 A;  3SPZ A;  3AA4 A;  4Q0B A;  1RBU A;  2IOC A;  4CGG A;  3NH1 A;  5CZ1 A;  4FLT A;  1D8Y A;  4IFV A;  4KPY A;  4FJ5 A;  4OGE A;  2FC0 A;  4FYD A;  4C8M A;  2DFH A;  4FM2 A;  3NDK A;  4K8Z A;  3ZSX A;  1QSL A;  4CJ5 A;  3ULD A;  3OYC A;  4BDY A;  3AA2 A;  4FJL A;  3OJS A;  3B6O A;  4JRQ A;  5KRT A;  2LSN A;  3SPY A;  4TSX A;  3VQD A;  1MU2 A;  4DMN A;  4B9T A;  4FJH A;  3S9H A;  1ZBF A;  1NOY A;  4CHQ A;  1BI4 A;  3AVJ A;  3LP0 A;  2FBV A;  4MFB A;  3SQ0 A;  4C8O A;  4Z4E A;  4CGH A;  2HHU A;  4BWJ A;  1LAW A;  4EP4 A;  4DTJ A;  4CIE A;  3OY9 A;  2IC3 A;  1RTD A;  1ZBU A;  2P5O A;  3AVF A;  1Z25 A;  3KLI A;  4EP5 A;  1HYZ A;  1A5X A;  1EX4 A;  1VSD A;  4CHN A;  4RW9 A;  1HJR A;  4CJF A;  3O4N A;  3K5L A;  1XC9 A;  1BCM A;  4RW6 A;  3PX4 A;  2QKK A;  4I7F A;  3E01 A;  1HPZ A;  2E6L A;  3OYF A;  1WSJ A;  3QIP A;  1VSH A;  1A5V A;  3LAK A;  3K57 A;  4HTU A;  4PQU A;  3MXJ A;  2G8W A;  2HHX A;  1YTU A;  2ETJ A;  4O5B A;  4CES A;  4CJR A;  3PX6 A;  4W5T A;  4GW6 A;  3QEV A;  3LAL A;  4FLZ A;  4DFP A;  1NK4 A;  4O0I A;  4DSI A;  1BIS A;  4CFD A;  2X6N A;  3OS0 A;  3ISN C;  1S6P A;  2YNF A;  4AHU A;  3HVR A;  4N76 A;  4Y1C A;  4FK2 A;  3JYT A;  1SL0 A;  1RBS A;  2YKN A;  3DOL A;  5C25 A;  1ZYQ A;  4FK0 A;  5SZT A;  1JKH A;  4EZ6 A;  4F2S A;  3KTQ A;  3RTV A;  4KRF A;  4FLY A;  4KTW A;  1NJY A;  3HYF A;  4JS4 A;  2B4J A;  1S1U A;  3PV8 A;  1NKB A;  4OKK A;  4OJR A;  3V81 A;  3NH2 A;  1NJW A;  1WSE A;  4DSL A;  4ELV A;  4ELU A;  4FXD A;  2HHQ A;  2P51 A;  4OPJ A;  2QKB A;  1RT7 A;  5CYQ A;  4Z4H A;  4I9Q A;  3AO3 A;  1RBT A;  2D0B A;  2WOM A;  3V9S A;  3H08 A;  3OYA A;  3TAB A;  5CY4 A;  1NK9 A;  5FRM A;  2RN2 A;  5JS2 A;  2KFN A;  1VSF A;  1NK7 A;  1S9E A;  3NFA A;  2G8V A;  3V9U A;  3ZT2 A;  3S3M A;  4KKO A;  4F3O A;  4GVM A;  1VRU A;  3HO1 A;  1J9A A;  4I2Q A;  1TKT A;  1JL1 A;  3VQ9 A;  3HT3 A;  1JLF A;  3CG7 A;  4PA1 A;  3L8B A;  2GV9 A;  3WNH A;  3M8R A;  4DU4 A;  1D9D A;  1S6Q A;  5HP1 A;  3TAN A;  4MQ3 A;  4CJP A;  1C0U A;  4BWM A;  2FBT A;  4QAG A;  4HUE A;  3VN5 A;  1NK0 A;  1WAJ A;  2D0A A;  3ZSW A;  3DM2 A;  4BE2 A;  3ITH A;  1LV5 A;  2XHB A;  3K5N A;  3THV A;  3LAN A;  3LP1 A;  1TL1 A;  1IG9 A;  4CED A;  4FJG A;  3S3N A;  3AO5 A;  1S9G A;  4DTR A;  4B9U A;  4NCB A;  4AH9 A;  2KZM A;  4DQQ A;  3FFI A;  5E41 A;  1VRT A;  2YNH A;  4CJ4 A;  3ZT1 A;  3RMB A;  1LW0 A;  4DTX A;  1EKE A;  3KK3 A;  4IFY A;  3RMA A;  1RCH A;  1RTH A;  2JLE A;  1FK9 A;  1C0T A;  4NYN A;  4ZTF A;  4AHS A;  3I0R A;  1L5U A;  4C8L A;  4B9L A;  4FJJ A;  1UA1 A;  1QQC A;  2RKI A;  3TAE A;  4E3S A;  1NK5 A;  3PY8 A;  1HRH A;  1ASU A;  5FRO A;  3VQC A;  3NE6 A;  3P1G A;  3WNF A;  1UWB A;  3K2P A;  4CK2 A;  2Z1J A;  3NH0 A;  2GBZ A;  1IKX A;  4E7L A;  3AVB A;  1IKW A;  2YV0 X;  2XY5 A;  2XRI A;  5J2N A;  3ZSY A;  4CIF A;  3RRG A;  3BGR A;  4PWD A;  1I3A A;  2FBX A;  3A2F A;  4DSK A;  5D3G A;  2B6A A;  5CZ2 A;  3HPG A;  1KLM A;  3TWH A;  4FCY A;  1WLJ A;  5SWM A;  5J2M A;  2BDP A;  4DWI A;  1W9H A;  4M3Y A;  2VWJ A;  5C42 A;  4XIU A;  1T7P A;  3KD5 E;  3AA3 A;  3RR8 A;  3TAM A;  4YFU A;  3QEW A;  2Z1I A;  3LP3 A;  2HHW A;  4CEC A;  4CF2 A;  3L2Q A;  3L2V A;  3QNN A;  1XHZ A;  4M3W A;  1T03 A;  1KFS A;  1CXQ A;  1GOC A;  2OYQ A;  2EHG A;  3C6T A;  3QLH A;  4KI6 A;  4FW2 A;  1UAX A;  1L3T A;  3C94 A;  5T7B A;  4M3Z A;  2AJQ A;  1L3V A;  3OYE A;  3IAY A;  1JLC A;  5HRP A;  1JLA A;  4J2D A;  1BI4 B;  4FJX A;  2QXF A;  4FW1 A;  4Y1D A;  1SKR A;  1VSI A;  2P1J A;  1ASW A;  3NF8 A;  3ZT4 A;  3V9W A;  4W5O A;  2KQ2 A;  3MEE A;  4L8R B;  4CE9 A;  4M3R A;  4CFA A;  5DK5 A;  2PZS A;  4J2B A;  4O55 A;  1YTA A;  2X78 A;  3EY1 A;  3OYD A;  3HJF A;  1RDD A;  3C6U A;  4I2P A;  4QOZ B;  1G15 A;  4KHQ A;  3EYZ A;  1O1W A;  3OYM A;  3SNN A;  1S1W A;  4C8N A;  1TAQ A;  2VG7 A;  4DFJ A;  2IS3 A;  3OYH A;  4FJN A;  2Y1J A;  4DU3 A;  4DTS A;  3LWM A;  1IKY A;  2OPP A;  3M8P A;  3K59 A;  3MEC A;  3SUN A;  3AVG A;  1EET A;  3TR8 A;  4Z4I A;  3KK1 A;  1WSH A;  4AHV A;  1Q9Y A;  4O4G A;  4HHT A;  1WN7 A;  4BE1 A;  2BAN A;  3AVA A;  4FJ9 A;  2BE2 A;  5HRR A;  1NKC A;  2XO7 A;  1U47 A;  4KFB A;  1B9F A;  4FLW A;  2YNI A;  4PY5 A;  4M45 A;  4E89 A;  3P5J A;  4OVL A;  1S1T A;  2JGU A;  3SJJ A;  4FJ7 A;  4CEA A;  4NCA A;  3MXI A;  1RNH A;  4CEE A;  4DSE A;  2D0C A;  2PYJ A;  4DFM A;  4FJ8 A;  3DLR A;  3VQ8 A;  2Q3S A;  4KHW A;  2KZZ A;  3O3F A;  1Q8I A;  1WNS A;  4KB0 A;  1SUQ A;  4FJI A;  2O4I A;  4B9V A;  4H4M A;  1VSE A;  4CHP A;  4F8R A;  3EZ5 A;  4DS5 A;  2VWK A;  3KIO A;  5KTQ A;  1TK5 A;  3DLB A;  3NGY A;  3ZSZ A;  4I9L A;  4AHT A;  3OYK A;  4F2R A;  2Y1I A;  1SKS A;  2A1S A;  5C24 A;  1REV A;  2DTU A;  1FXX A;  1UOC A;  2HNY A;  2DY4 A;  2O4G A;  1QS4 A;  2YHB A;  3IS9 A;  1RTI A;  2VG6 A;  3L2R A;  1VSM A;  3OYN A;  2ZD1 A;  4CEF A;  1BL3 A;  4FM1 A;  1JLB A;  4IDK A;  4UQG A;  3KJV A;  2E4L A;  3SI6 A;  1KLN A;  3IG1 A;  3PUF A;  4BDP A;  4OLB A;  3OYI A;  3SQ4 A;  3CM6 A;  1TK8 A;  1S1X A;  1D5A A;  3G10 A;  3RRH A;  1XWL A;  2FBY A;  3KKS A;  4IBN A;  4DTO A;  5I3U A;  4CJW A;  2YHA A;  4F4K A;  4FJK A;  3VQ6 A;  3AVN A;  2W42 A;  3LPU A;  4RW7 A;  1Y97 A;  4DF8 A;  1RT1 A;  4E7J A;  2ZQB A;  4DSF A;  4E0D A;  3UIQ A;  1ITG A;  4B08 A;  4GMJ B;  3LZJ A;  4FLX A;  3QEX A;  1NJZ A;  1KSP A;  1SL1 A;  2YNG A;  1WAF A;  1C1B A;  3V1Q A;  3VQE A;  4E1M A;  3HPH A;  4H8K A;  3I0S A;  3V1R A;  4BDZ A;  3VQA A;  1D9F A;  1QHT A;  4YNQ A;  1R0A A;  4W5Q A;  4G1Q A;  2G8K A;  1TAU A;  2VG5 A;  3LWL A;  1J5O A;  3L2U A;  1K6Y A;  4AHR A;  3JSM A;  1BIU A;  2D5R A;  1L3U A;  1LWE A;  3AO2 A;  3T19 A;  4CCH A;  2OPS A;  1TVR A;  4N5S A;  3RMD A;  2B5J A;  1ASV A;  1C1C A;  4KI4 A;  4ZTJ A;  3V6D A;  3ZSO A;  4DQR A;  3WNG A;  4M3U A;  1B9D A;  3VQ5 A;  3KLE A;  3NGZ A;  2BGG A;  4C8K A;  5FRN A;  3AVC A;  1C6V A;  4FLV A;  1NOZ A;  1VSK A;  4QCL A;  1U45 A;  1CZ9 A;  3NAE A;  1RTJ A;  1A5W A;  3MED A;  4HCB A;  1U48 A;  3QEI A;  4KRE A;  3AO4 A;  1RT4 A;  3O3H A;  1RIL A;  3C95 A;  3CFR A;  3CFP A;  3CQ8 A;  2G8H A;  4Z4C A;  1HMV A;  1GOB A;  3SZ2 A;  1TL3 A;  3SCX A;  1TKD A;  4E19 A;  3HVT A;  3QIO A;  1WSG A;  2HHS A;  3DLK A;  1T8E A;  2E6M A;  4DSJ A;  2IGI A;  4FZX C;  4IKF A;  3P83 D;  3DLG A;  4PUO A;  1FKP A;  3I8D A;  3OYB A;  4CEQ A;  3NCI A;  2OPQ A;  3QIN A;  4DFK A;  1GOA A;  4KTQ A;  3DI6 A;  1DTQ A;  4ID5 A;  2Z1G A;  4LH5 A;  1IH7 A;  4AHC A;  1RBR A;  4CFB A;  3OS1 A;  3TAG A;  1NKE A;  3DRS A;  3MXM A;  1HYV A;  4Q5V A;  4BE0 A;  4HCC A;  3S3O A;  3HP9 A;  1DTT A;  1LW2 A;  3SV4 A;  2G8U A;  3BDP A;  1Q9X A;  3VA0 A;  2HVH A;  2KFZ A;  3TI0 A;  3M8Q A;  4H4O A;  4M41 A;  3MAQ A;  2G8I A;  4OLA A;  4CGD A;  1KRP A;  2OZS A;  5J2P A;  3TAP A;  4KTZ A;  3QET A;  5FDL A;  3LDS A;  4JRP A;  4E7K A;  1CXU A;  3NBP A;  1N5Y A;  4M42 A;  1SV5 A;  3ZSV A;  2ITG A;  4FZY A;  3O4Q A;  3DRP A;  3DRR A;  3B6P A;  1KFD A;  3CFO A;  3HPO A;  3SUO A;  4LSN A;  3VQP A;  3HL8 A;  2ZE2 A;  4B8A B;  3HP6 A;  3PX0 A;  1SL2 A;  4LSL A;  3KLF A;  4CFC A;  1RT6 A;  3VQQ A;  1NJX A;  2P5G A;  4DU1 A;  1VSJ A;  2EX3 A;  2OZM A;  4DTM A;  1C0M A;  4CJU A;  3SQ1 A;  1I39 A;  3VQ7 A;  4LY7 A;  4CK3 A;  4R5P A;  4DLG A;  3OYL A;  1HYS A;  2X6S A;  3AV9 A;  3D45 A;  3QER A;  5HRS A;  4KHU A;  3K5O A;  2HW3 A;  1JXB A;  1Z26 A;  1BGX T;  3M8S A;  4HUF A;  2OA8 A;  4DQP A;  3OYG A;  4JS5 A;  2A1R A;  3L3V A;  3LZI A;  3SQ2 A;  5KRS A;  4CHZ A;  1WSF A;  3VQ4 A;  1RT3 A;  1TKX A;  2HND A;  3SV3 A;  1L3S A;  4KHY A;  1CLQ A;  1EXQ A;  4DTP A;  3AO1 A;  3KLG A;  4J2A A;  3DLH A;  3U6F A;  5HRO A;  5HLF A;  3KD1 E;  4FJM A;  2XY6 A;  2Z1H A;  1U04 A;  4Z0U A;  1RDB A;  4CJV A;  3V4I A;  4CEO A;  4DG1 A;  4AIL C;  4KB1 A;  1KCF A;  5KGX A;  4DS4 A;  4ICL A;  4IG3 A;  3AA5 X;  4E7I A;  3NGI A;  1QSS A;  2HVI A;  2ATQ A;  4N56 A;  4N41 A;  4CF1 A;  3HK2 A;  4KAZ A;  4B9M A;  3MEG A;  4E7H A;  2F96 A;  3KKR A;  4IG0 A;  2IAJ A;  2PYL A;  5JS1 A;  3HXM A;  4CJK A;  3L2W A;  3NF7 A;  4LD0 A;  1KVB A;  4ZHR A;  1JL2 A;  4DTU A;  1NK8 A;  2PY5 A;  1C1A A;  5DMR A;  1UA0 A;  1S5J A;  2DFF A;  2YKM A;  4KO0 A;  3VQB A;  1TGO A;  2HB5 A;  4B9N A;  3ZSQ A;  1IKV A;  3V9X A;  4FLU A;  1KVA A;  3CM5 A;  3PO5 A;  4W5N A;  3D0P A;  4DLE A;  3F73 A;  4CJQ A;  1LWF A;  2QK9 A;  3T1A A;  4RG8 A;  4BAC A;  5K14 A;  5J1E A;  1XI1 A;  1S1V A;  4FK4 A;  2WON A;  3V9Z A;  3DYA A;  4HVJ A;  3QES A;  1ZBI A;  2GUI A;  3F9K A;  4O0J A;  1QSY A;  4M3X A;  3NF9 A;  4F3T A;  4FM0 A;  1QTM A;  5HBM A;  3DLE A;  3RMC A;  3O3G A;  2XY7 A;  2IDO A;  4Z4G A;  3CYM A;  5EU7 A;  2F8T A;  1WSI A;  1J53 A;  1KTQ A;  2NUB A;  3DOK A;  3ZT0 A;  3DMJ A;  4CJT A;  1U4B A;  1X9M A;  2HHV A;  5J2Q A;  4O44 A;  4CEB A;  1NK6 A;  3HST B;  4M3T A;  1BCO A;  4B3O A;  3V1O A;  3TAQ A;  1RT2 A;  2KW4 A;  1TV6 A;  2RF2 A;  3LAM A;  1BHL A;  4CJL A;  1JLE A;  3AVK A;  3L3U A;  2HHT A;  4CF9 A;  1JXE A;  2KTQ A;  1N6Q A;  4FZZ A;  3TAF A;  2XY8 A;  3OYJ A;  3ASM A;  4OGC A;  4OKJ A;  1U49 A;  1X1P A;  3ALY A;  3IRX A;  1CZB A;  4CEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...