4CEZA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cezA00
4CJFA 2GV9A 3K57A 2B5JA 3L8BA 4G1QA 2PYJA 4EP5A 4NCBA 4FM1A 5JS2A 2ZD1A 2QKKA 4FJ5A 2D0CA 4NYFA 4IBNA 2OPSA 3IRXA 5DK5A 4HHTA 1VSJA 1WSEA 4DLGA 3T3FA 2EHGA 4HUFA 1FXXA 3RRHA 2IDOA 4E7IA 3DLEA 4BWJA 3OYDA 3LP2A 4AHRA 4AHSA 3VQCA 4BE1A 1IKVA 3SYZA 1D9DA 1DTTA 1QQCA 5EU7A 3U3GA 4B9MA 3IAYA 2F8SA 1A5XA 3KD5E 3ZSZA 3KK2A 4HUGA 5KGWA 4C8OA 1DLOA 4CJTA 4M3XA 3AVBA 1REVA 3L2VA 1K6YA 2G8IA 4EP4A 1RCHA 3RR7A 2HHQA 4JLHA 3EZ5A 2HMIA 4H4MA 5HROA 3ZT3A 4HCBA 1LWEA 4B8AB 3VQ4A 5FRNA 4CK3A 3LP3A 1J53A 3NAEA 3O4NA 1WSHA 1WAJA 1TL3A 3A2FA 4DFKA 1NOYA 2AJQA 1HNVA 2LSNA 4B08A 3RRGA 4FZYA 1JLCA 2WONA 4JRQA 1LV5A 1HYVA 3OS0A 4HUEA 4N41A 1IH7A 4K8XA 4F4KA 4DTUA 3VN5A 4FLVA 4KREA 3L2RA 3DLBA 4J2DA 1I39A 1HYZA 4CGHA 1WSIA 3FFIA 4M3RA 3SCXA 4C8LA 4OKEA 3TAPA 4FJGA 1UWBA 4PUOA 3PX4A 4M3UA 3AVCA 2YHAA 3ISNC 3HP9A 5CY4A 4YNQA 2Y1JA 1WLJA 3HK2A 4KHWA 4FK2A 3V1RA 2HNYA 4RG8A 1TAUA 1VSFA 3WNFA 3B6PA 4DFMA 5J2MA 2A1SA 3V6DA 3O3FA 3OYLA 4E0DA 2E6MA 1ITGA 3IS9A 1SKRA 4CFBA 1JLBA 4AHTA 5FRMA 5FROA 1RDCA 2Q3SA 3P5JA 3L2QA 3SUQA 5D3GA 3TARA 1QSSA 4CJRA 4CJKA 1U45A 2OYQA 1TGOA 3NFAA 4CGIA 3SQ2A 4FJMA 1O1WA 2ETJA 1U04A 4DTRA 2G8FA 3O4QA 5J2NA 2Z1GA 1RBRA 3G0ZA 1S1XA 4KTWA 4CFDA 4Q0BA 1J9AA 1JLQA 4RW8A 4IFVA 4FXDA 2OA8A 4B9UA 4F2SA 4IFYA 3QEWA 1TK0A 3AVLA 1NK0A 3LP0A 4C8KA 3O3GA 1Q9YA 4IKFA 1ZBHA 2B4JA 4CF0A 4HCCA 3PX0A 4CJQA 3QEIA 1EETA 4OGCA 4CESA 4B9LA 3QEPA 3CYMA 2Z1HA 3OYEA 1T05A 1VSKA 1L3SA 3NH1A 1XHXA 3WNEA 1SKSA 3MXJA 1WSFA 2D0AA 3CQ8A 4CEBA 3K2PA 3KD1E 4O55A 3SUNA 2FBXA 3HO1A 3HSTB 4DQQA 3D45A 4XIUA 1KLMA 4OGEA 4KI4A 1NOZA 3TAGA 3OYJA 2DFHA 2VG6A 3K58A 1U48A 2HHTA 4M3TA 3KLIA 1TKTA 4NCAA 4AILC 2E4LA 4DS5A 3VA0A 1NKBA 1X9SA 1SV5A 4AH9A 5CYQA 4FYDA 4CERA 1A5WA 1SKWA 1ZBIA 4GW6A 4CCHA 3SQ4A 1IKYA 4QCLA 3ZSYA 3RMAA 3TR8A 1RT1A 1S6PA 3LZIA 4CE9A 3ZSRA 3DLKA 3M8QA 1NK8A 1JXEA 3TI0A 4E3SA 1FKPA 4J2BA 2X74A 4EZ6A 4FJKA 1JLFA 4BE2A 3OS2A 5JS1A 3QLHA 2RF2A 2YNFA 4KHNA 3H08A 4CFCA 2QXFA 4FZZA 3DYAA 3ZT2A 2E6LA 2XHBA 4DTNA 1NJZA 4CIGA 2HHSA 3LPUA 3ZT4A 2XRIA 3AVFA 2BGGA 1CLQA 2NUBA 1UOCA 4CF1A 3V9SA 4DSKA 2G8UA 4PWDA 3AVNA 2Z1IA 2VG7A 3MEEA 3KLHA 4GVMA 2BANA 3V9XA 3U6FA 1VSEA 5KRTA 4RW6A 4PQUA 3PV8A 4CEDA 3VQ6A 3OYHA 3DLHA 3I0RA 3MECA 5J2QA 1U49A 2Y1IA 4PY5A 3M8PA 5KI6A 4FLTA 1SL0A 4N76A 2F8TA 4E19A 3AVIA 3LAKA 3KIOA 5KTQA 4BDPA 3PUFA 3LP1A 1FKOA 1BCMA 4CEEA 1QHTA 1S1TA 2JLEA 4ID5A 4KAZA 3NF6A 4Z0UA 3PO5A 4UQGA 3VQ7A 3VQPA 2OPPA 1C1AA 3ITHA 2D5RA 3QO9A 1HQEA 2X6SA 3C6TA 2IOCA 1NJWA 4OPKA 2P5OA 3L3UA 2X78A 4CJ5A 3OYIA 3HXMA 1LWFA 2VG5A 1U47A 2XY7A 4CIFA 1NK9A 3WNHA 4FW2A 1EKEA 4FM0A 4FJHA 3C6UA 4Z4HA 2OPRA 3HM9A 4CIEA 3HPOA 3NHGA 3C94A 3SPYA 1IKWA 3OYBA 3OYAA 1KFSA 3K5NA 2OZSA 4I9QA 4FJ7A 4QOZB 3MEDA 3ASMA 3HVRA 5HP1A 1RTJA 1DTQA 1N6QA 4CJWA 1WAFA 3ALYA 3B6OA 4ZHRA 4CHYA 1Y97A 3ZSWA 1TV6A 3QETA 5CZ1A 4FJ9A 1GOCA 3L3VA 1BQMA 3RWUA 4M42A 1CZBA 2DFFA 3DOLA 3NGYA 3DRSA 3CG7A 3V81A 1XI1A 4F2RA 3C95A 1YTUA 1VRTA 4CEAA 3CFOA 1RDDA 2D0BA 3OYCA 4OPJA 4W5NA 4KHSA 4DWIA 3SQ0A 1LW0A 1Q8IA 4KTQA 2FBTA 4KHYA 1HPZA 4ZTFA 1S9EA 3TWHA 4HVJA 3HT3A 1LWCA 2HNZA 3AA4A 4W5TA 3QINA 4DSLA 1T7PA 3F9KA 4W5QA 1L3TA 3AO1A 1YTAA 4QAGA 5T7BA 3RR8A 1IO2A 3LPTA 4NCGA 4PA1A 3P1GA 1A5VA 1VRUA 3RMCA 1RT5A 2RPIA 3E01A 2QKBA 1XHZA 2R7YA 3VQBA 3SUPA 4O4GA 4DTOA 3CFRA 3MXIA 2HVIA 3RTVA 2O4IA 2FBYA 3QESA 4B9TA 1BL3A 3AO5A 2XY6A 1ZBFA 4I7FA 4RW4A 1KVBA 2HHWA 3OYGA 1T03A 3AVMA 4ICLA 4AHUA 4E89A 2YV0X 3S3MA 4F3OA 1D5AA 3EYZA 1JXBA 2A1RA 1C0TA 4BWMA 4DFPA 3P83D 5C24A 4AHVA 4CHPA 4CF2A 1ASVA 4KKOA 3KLFA 3I0SA 3UIQA 3KKSA 4IDKA 3TABA 3T19A 4CJVA 3BDPA 5HRNA 1QS4A 3DMJA 3LAMA 1F21A 3OYNA 3HL8A 4Q5VA 1QSYA 4CHNA 3NGIA 1BCOA 1GOAA 4NYNA 4H8KA 3VQQA 2ITGA 3V1OA 4B8CA 1UAXA 4CEOA 2DFEA 3AVAA 4O0JA 1SL2A 4CJ3A 4FW1A 3VQDA 2ATQA 3PY8A 4DQSA 3QIOA 1R0AA 2HB5A 3L2UA 1JL1A 3VQ8A 2XY5A 4KTZA 3DRPA 3SNNA 5HLFA 3SV4A 1B92A 3ZSOA 4JS4A 1RBSA 1KFDA 4FJXA 3ZSVA 1NK4A 3DRRA 4CEZA 3AO3A 3V9UA 2QK9A 3I8DA 4I9LA 4CF9A 4DS4A 4KHUA 4FLUA 2KFZA 4OJRA 4ZTJA 4FLWA 3NF9A 4FK0A 3VQ5A 1KLNA 3ZSXA 5C42A 4Y1DA 5KGXA 3LWLA 4MFBA 3CFPA 2WOMA 4Y1CA 2GBZA 4DTJA 1TVRA 1LAWA 1RT7A 4CJUA 2IS3A 2YKNA 3LDSA 3VA3A 3OVNA 1IKXA 4FJJA 1RBTA 4FLZA 3V9WA 1VSIA 5I42A 1NK6A 4FK4A 3HPHA 5HRPA 4KPYA 3KKRA 4DQRA 4DQPA 3NH0A 4M3YA 3KK1A 3ZCMA 1S1VA 5DMRA 4I2PA 2OZMA 3S3OA 1CZ9A 1T8EA 4CFAA 3S9HA 4KV8A 4L8RB 4KB1A 1CXUA 2JGUA 3M8SA 1BI4A 1MU2A 4R5PA 4CGJA 4Z4CA 2B6AA 3AVKA 3TAEA 2YNIA 3NCIA 4K8ZA 4C8MA 4LSNA 1RILA 3OYFA 1X9MA 3D0PA 1G15A 4Z4IA 3NE6A 2PY5A 4E7HA 1RT6A 1RTHA 4WE1A 1KVAA 4CGDA 1NJYA 1JLGA 1JLEA 4FJ8A 3O3HA 4OLBA 2FC0A 4CHZA 4DTSA 2P1JA 1RTIA 1HNIA 4C8NA 3VQAA 4LD0A 3ULDA 4B3OA 1YVUA 3SQ1A 4LH4A 2KW4A 4FVMA 4DSJA 5C25A 3DLRA 4GMJB 3TANA 1BIZA 4TSXA 4DG1A 3ZT0A 3L2WA 2XO7A 4CJLA 4CJPA 4B9VA 1TK8A 3AA3A 1NK7A 3NF8A 4H4OA 4OKJA 1WSGA 1Z26A 4BE0A 1S1UA 3KLEA 1B9FA 4Z4GA 3SV3A 1HMVA 3LANA 3SZ2A 4OVLA 1KRPA 3RMDA 4DQIA 4O44A 2GUIA 2ZQBA 3K59A 4B9SA 4M3WA 2I5JA 3DI6A 3OY9A 1X9WA 1KSPA 1D9FA 4BACA 1IG9A 1VSDA 1I3AA 2IC3A 4BDZA 4DTPA 1BIUA 1J5OA 4OKKA 3K5MA 1RBUA 3MAQA 3PO4A 4O0IA 2IAJA 1S6QA 2YHBA 5HRRA 1RBVA 3TAMA 3AVGA 3AA5X 1Z25A 4CJSA 4N56A 4CHOA 2EX3A 3QEVA 4ELTA 1CXQA 1BGXT 1ZBUA 5KRSA 4RW9A 2G8VA 2IGIA 3K5LA 3QEXA 1C1CA 3PX6A 1VSHA 3HJFA 4OLAA 4CEFA 4FCYA 3HPGA 4FJLA 4CGFA 4N5SA 3V4IA 3SPZA 1L3UA 4CK2A 2YNHA 3TAQA 4CK1A 1BQNA 4M45A 1NJXA 1L3VA 5E41A 1WSJA 1ZYQA 2VWJA 3QNNA 1Q9XA 4FJIA 3K5OA 2HHUA 1GOBA 4LH5A 1RDAA 4O5BA 3NH2A 3HP6A 3SJJA 1XC9A 2Z1JA 1U4BA 1BISA 3T1AA 1N5YA 1LW2A 4FM2A 4DU1A 4ELUA 3MXMA 1C6VA 1L5UA 3SUOA 1BHLA 4CF8A 4KB0A 3SI6A 4BDYA 5FDLA 3ZT1A 1VSLA 2O4GA 3OJSA 1EP4A 4J2EA 3IG1A 4FJNA 4EZ9A 2KZZA 3EY1A 1EXQA 5I3UA 3KLGA 2KZMA 4E7JA 4Z4FA 2DY4A 2HHXA 1LAVA 5SZTA 3DM2A 1QE1A 1HRHA 1TL1A 2YKMA 3M8RA 5CZ2A 4DSFA 1D8YA 4E7LA 1TKDA 3JSMA 4FLXA 1NKCA 3KTQA 1JKHA 3MEGA 4DSIA 4ID1A 1UA1A 4LSLA 2RN2A 3NDKA 3CM5A 4FLYA 1X1PA 1S1WA 4RW7A 4J2AA 1TK5A 3HYFA 1S9GA 4MQ3A 5K14A 2X6NA 3DOKA 5J2PA 3AVJA 1ASUA 3NBPA 2HHVA 2G8KA 1RTDA 4KHQA 1RT4A 1EX4A 4KO0A 4DFJA 1SUQA 4IG0A 2BE2A 1ZBLA 1KVCA 2YNGA 3G10A 4HTUA 2ZE2A 4KRFA 2PZSA 4DTXA 1TKZA 4E7KA 1TKXA 3F73A 1QSLA 4DMNA 1TAQA 4CGGA 4Z4EA 3JYTA 4CECA 3QNOA 1C0MA 5HRSA 4KI6A 4F3TA 1ASWA 1B9DA 2PYLA 1XWLA 2HVHA 2G8WA 3AO2A 4LY7A 1W0HA 4ELVA 1RNHA 1WN7A 4CJ4A 3BGRA 4YFUA 2FBVA 3LALA 1KTQA 4AHCA 4CHQA 1NKEA 4FZXC 1RDBA 3V1QA 4M41A 4DSEA 4IG3A 4DU4A 3OS1A 2KFNA 1HQUA 1S5JA 1VSMA 1BI4B 2XY8A 2KQ2A 3CM6A 3KK3A 3S3NA 1NK5A 5J1EA 2W42A 2RKIA 1RT3A 1C1BA 1W9HA 4DTMA 3QERA 3THVA 1HYSA 1HJRA 3LZJA 2OPQA 3LWMA 4JS5A 2HW3A 1RT2A 2P51A 4KFBA 3OYKA 1YT3A 3V9ZA 3AO4A 3KJVA 1FK9A 1VK0A 4DLEA 4DU3A 3VQEA 3VQ9A 4W5RA 2BDPA 2DTUA 1C0UA 3RMBA 3NGZA 3NF7A 4I2QA 3DLGA 1WNSA 5CYMA 1SL1A 4DF4A 3QIPA 4JRPA 2KTQA 3AV9A 3WNGA 3OJUA 4E1MA 2P5GA 3OYMA 3HVTA 5HBMA 2F96A 1UA0A 2G8HA 1J54A 4M3ZA 3AA2A 4CEQA 4CJEA 4N47A 3ZSQA 4DF8A 4B9NA 3TAFA 1KCFA 1JL2A 2HNDA 1JLAA 2VWKA 4F8RA 1QTMA 3AVHA 4W5OA 5SWMA 3U3YA 4E1NA
chains in the Genus database with same CATH superfamily
4CJFA 4A2AA 2CGKA 4FSVA 4FWLA 1HPMA 1YJNN 1VSJA 4JKEA 2E1YA 1FXXA 3GL1A 3DLEA 1DTTA 5EU7A 3IAYA 3IKMA 4HUGA 4CJTA 3AVBA 2ZJRL 4BRLA 2HBMA 5HROA 4HCBA 2WUSA 3LDPA 5FRNA 4CK3A 1J53A 4IJAA 3E9PA 1OH6A 4FZYA 2UXCK 4A2BA 4F4KA 1KD1O 4FLVA 3PSIA 3VEZA 4Y0WA 4J2DA 3RSEA 4BRIA 2NRXA 4OKEA 3TTDA 3PX4A 4M3UA 3AVCA 2YHAA 4JKDA 3CJ7A 1WLJA 3VEXA 4KHWA 3V1RA 1VSFA 5E84A 5J2MA 4AF1A 1NGHA 4E0DA 2E6MA 3FZKA 1SKRA 1K8KA 2A41A 3L2QA 3SUQA 5D3GA 3Q7CA 2OYQA 1TGOA 4CGIA 3SQ2A 2ETJA 3VEYA 4DTRA 1DT9A 4KTWA 2ZF5O 4BC5A 1JLQA 5AZJA 4FXDA 4F2SA 3QEWA 4C8KA 3PX0A 3QEIA 3QEPA 1L3SA 1VSKA 4FWMA 1SKSA 4NLCA 3CQ8A 4B9QA 3EZWA 3J8AA 4EIAA 1KLMA 1QQMA 3K58A 2HHTA 2ASPA 3KLIA 2E4LA 4DS5A 4YOUA 1SV5A 4CERA 1A5WA 4GW6A 4O8KA 4A5AA 3SQ4A 3UE5A 3ZSRA 4E1JA 3ID8A 4E3SA 3H1QA 4BE2A 5AQPA 1XMQK 4PKGA 4BREA 3QLHA 5F2RA 2RF2A 2A6AA 4CFCA 2QXFA 3THXB 5GAHP 4DTNA 4CIGA 2NUBA 3VTIA 4DR3K 4YORA 3QBWA 1VAZA 4BRKA 5J2QA 1YF5L 2Y1IA 1U49A 3M8PA 5KI6A 3LAKA 5CHIA 1OH8A 3FFKB 4BR7A 5BPNA 5F0XA 4UQGA 2E2OA 2OPPA 2UXBK 5FLXO 1NG9A 2D5RA 3QO9A 1HQEA 2X6SA 4KHPK 3L3UA 3TSQA 3VTHA 3C0BA 2P9LA 2XY7A 4MLEA 4U67L 1N32K 2IVPA 4Z4HA 1BU6O 4CIEA 4LFCK 3C94A 1XMOK 3MN5A 4FJ7A 3ASMA 4AQYK 1N6QA 4ZHRA 1Y97A 3QETA 1TV6A 3O8MA 5CZ1A 4FJ9A 3ZX3A 1BQMA 4CVNE 3NGYA 5LY3A 3V81A 1ATSA 4H0TB 2D0BA 4PL8A 3WT0A 4OPJA 3O9RA 4KH5A 4DWIA 3KVGA 1ILYA 4C1NI 5LJVA 1HPZA 4KHYA 5B8HA 4ZTFA 4HVJA 3HT3A 3AA4A 4W5TA 3UKUB 4FWOA 3M3ZA 4X64K 4K43A 1IO2A 1NLVA 2ITMA 3U8XA 1VRUA 2R7YA 3VQBA 3SUPA 1V4SA 3BEXA 4O4GA 3CFRA 3CIPA 3RTVA 3QESA 4B9TA 1ZBFA 4RW4A 5KPTA 3OYGA 3S3MA 2ZJPL 3S41A 2A1RA 4DFPA 1E3MA 3I0SA 3L4QA 3UIQA 3VETA 3BF1A 3TABA 3T19A 4DR4K 5HRNA 2GUPA 3OYNA 4CHNA 1DEJA 4WQ5C 2Q0RA 1NGAA 4DB3A 4FO0A 3W0LA 2CGJA 2HB5A 2O8FA 3CMEN 4MO5A 3DRPA 5KQ8A 1VHXA 1KFDA 1NK4A 4CEZA 3AO3A 3V9UA 3VENA 2QK9A 4I9LA 1ZBSA 4FLUA 1TUYA 5E26A 3ZSXA 2VGMA 4MFBA 4Y1CA 3CCLN 2ZM6K 3VA3A 1IKXA 3D7EO 4FJJA 5I42A 1S22A 4KPYA 2D4WA 2O8CA 4A61A 5DMRA 3R3LA 4ISFA 2CH5A 4CFAA 1T8EA 4KV8A 4L8RB 1NGEA 2JGUA 1MU2A 4BRPA 4K8ZA 4JHDA 4C8MA 1X9MA 3O1WA 4B1ZA 1VQ6N 4J8FA 3VF2A 1G15A 4BR2A 4WE1A 4CGDA 1JLGA 4OLBA 4B3OA 3MDQA 3VQAA 3SQ1A 4LH4A 3QICA 1N36K 3R9PA 2E2PA 2XO7A 2HMPA 4CJLA 4B9VA 3AA3A 3NF8A 1OH7A 1Z26A 1Z6RA 2D0OA 1HMVA 3CCRN 3SZ2A 4DQIA 4B9SA 2GUIA 3VMFB 4DV7K 3WXMB 4WCEL 1D9FA 1IG9A 4BDZA 1KAYA 4DTPA 1BIUA 3MCPA 4OKKA 5HRRA 2ZWHA 3AVGA 5EVZA 3AA5X 2E2QA 4CHOA 1CXQA 5KRSA 4RW9A 3QEXA 2NRTA 3SAHA 4OLAA 4FCYA 4FJLA 2D0PA 3SPZA 1VQPN 1L3UA 2HHHK 3TAQA 1NJXA 3BY5A 1WSJA 1ZYQA 2VWJA 1Q9XA 4LH5A 3HP6A 1RDAA 3SJJA 1BISA 1LW2A 3U9ZA 1C6VA 2GWJA 1VSLA 1EP4A 4FJNA 4EZ9A 2KZZA 3EY1A 5I3UA 2GEMA 2W6KA 1WOQA 2HHXA 5LMNK 5SZTA 1HRHA 3GG4A 2FSJA 4BRNA 1JKHA 1J5EK 4WF9L 4LSLA 3QFPA 3CM5A 2QA4N 1S1WA 1TK5A 1HR0K 1S9GA 3CXCM 2VWBA 2BTFA 4NXNK 1VQ8N 2A42A 4EFHA 1JCFA 1KAXA 4FWPA 1SUQA 5C0YA 1GLAG 2YNGA 4HTUA 2ZE2A 1QSLA 1TKXA 1T6CA 4FOIA 3F73A 1ESVA 4DMNA 1TAQA 1BWFO 3IFRA 1YUWA 4C1NK 4CGGA 3J7ZO 1Q7YO 3JYTA 3QNOA 4KI6A 2I7PA 3ID6A 1B9DA 4IOCL 1XWLA 4LY7A 1W0HA 4YFUA 4AHCA 1NKEA 3CJCA 3V1QA 4IG3A 1ATRA 4JKBA 1HQUA 1S5JA 1VSMA 2XY8A 1NK5A 4FJKA 1W9HA 1HUXA 1I94K 3LWMA 4JS5A 3BZKA 3ZX0A 3AO4A 4DU3A 4A62A 4JKGA 2P9SA 3J7YP 4CBWA 3OJUA 3F5TA 2NRHA 4FWSA 5HBMA 3AA2A 5FPMA 4F8RA 1KCFA 2QXLA 1VQMN 1NK8A 3U3YA 4KH4A 2GV9A 3K57A 2W6LA 5JS2A 3ULEA 1YJ9N 2QKKA 4IBNA 2OPSA 3IDHA 3IRXA 5DK5A 4HHTA 2W41A 2P9KB 2P9IB 5EX5A 3LP2A 4JI2K 4AHSA 1D9DA 2Q36A 4ILJA 1SAZA 4B9MA 1QQCA 1S72N 1A5XA 1EWRA 5HL7L 2QWMA 3KD5E 5KGWA 1REVA 1K6YA 4XH5A 1T6DA 1RCHA 3OBWA 2HHQA 4JI1K 1LWEA 4B8AB 3T69A 3NAEA 1X3MA 2LSNA 4B08A 1QHAA 4HUEA 4N41A 1IH7A 4K8XA 4KREA 2E1ZA 4DV2K 1WSIA 3FFIA 3SCXA 4C8LA 2YHXA 1UWBA 1JCEA 5CY4A 3O1BA 4FK2A 4RG8A 4DV1K 3R8EA 3VF4A 3WNFA 3B6PA 3EL2A 2A1SA 5AQGA 2QWNA 5JVHL 4DUYK 4JV5K 1ITGA 3QBXA 5DM7L 3C7NA 1TYQA 5FRMA 5FROA 2I7NA 4FL9A 2QWOA 4B3SK 3VEOA 4CJRA 2YJEA 4FJMA 1NGGA 3O4QA 2RE2A 2Z1GA 3GDQA 3G0ZA 1NMDA 1J9AA 1Q82O 4IFVA 4B9UA 3AVLA 1Q81O 1ZBHA 1NBWA 4K42A 4LF4K 1WSFA 2D0AA 3J80O 4CEBA 3KD1E 3SUNA 4L3QA 2FBXA 1SS6A 3HO1A 4XIUA 4OGEA 2DFHA 4CD3A 5KPZA 1N33K 1NKBA 1X9SA 1GLJO 5BRFA 4FYDA 1ZBIA 3HRGA 4QCLA 2NRZA 3ZSYA 3TR8A 3LZIA 3M8QA 1JXEA 3TI0A 4J2BA 4EZ6A 1IBMK 5M1OA 2YNFA 5AQIA 3ZT2A 3RVCA 1NJZA 2HHSA 1BG3A 3LPUA 3AVFA 2BGGA 5EOYA 4CF1A 3V9SA 1XUPO 2G8UA 3EO3A 3SLCA 3VEVA 3MEEA 3KLHA 5AQSA 3V9XA 2UUCK 3CHWA 4RW6A 4PQUA 3DLHA 3MX2A 3VQ6A 3I55N 1SL0A 2F8TA 2QWQA 3AGKA 4BDPA 1FKOA 2GTDA 2JLEA 4ID5A 3NF6A 4XEIA 3VQPA 1C1AA 1BDGA 4IJNA 2IOCA 4CJ5A 2X78A 4JI6K 2VG5A 3O80A 4CIFA 2QI2A 3CETA 3VESA 3WNHA 4FW2A 4FM0A 3A5MC 4FJHA 3C6UA 3SPYA 3NHGA 5AZIA 4I9QA 3K5NA 3O9SA 4BVOA 1YXQA 3QFUA 3HVRA 1DTQA 4CHYA 3ZSWA 2V51B 1GOCA 1CZBA 4F2RA 3DRSA 1XI1A 1WBBA 3C95A 1YTUA 1VRTA 1RDDA 1O13A 4RTFD 2ZGYA 3SQ0A 1Q8IA 4KTQA 4HTLA 1VQLN 3LDNA 4DV4K 4DSLA 3QINA 4BRHA 4ILGB 1L3TA 3AO1A 3ENHA 4QAGA 5T7BA 2A3ZA 1HKGA 1A5VA 3D2FB 3A5NC 1RT5A 4I6MA 1MA9B 5AQJA 3E01A 1HX1A 2KHOA 2Q2RA 4DTOA 2O4IA 4IEEA 3AVMA 4BRAA 5BPMA 3WXLA 3EYZA 1JXBA 1ASVA 3NVMA 3KKSA 3MN9A 3W3DA 2YI1A 1GLBG 3ZETA 1F21A 3SBTA 5CE3A 3NGIA 3H3NO 4M7XA 1BCOA 5AQMA 4H8KA 3VQQA 3V1OA 4CEOA 1SL2A 1WBDA 1MWKA 4DQSA 5JLFA 3L2UA 1SQKA 4DHYA 1JL1A 3VQ8A 1W2BM 3SV4A 1VQNN 2KLAA 1RBSA 4FJXA 3PIOL 1YJWN 4KHUA 4DS4A 1RGIA 4OJRA 4FLWA 3VQ5A 1KLNA 3BP8A 1SZ2A 4JKGB 5C42A 4Y1DA 4V19S 2P9SB 5KGXA 3LWLA 2A40A 5AFUH 1RT7A 2IS3A 2YKNA 3OVNA 1RBTA 3HZ6A 3PIPL 1W97L 1NK6A 4BRMA 4CJ7A 4X66K 4M3YA 4LC9B 2OZMA 2F4VK 1CZ9A 4KB1A 2BUPA 4CGJA 3ULEB 4PKIA 3TAEA 3TTCA 2F9TA 3WUHA 4YDUA 2GWKA 4MO4A 4Z4IA 4LF9K 3A0IX 4E7HA 1RTHA 4GNIA 1JLEA 4FJ8A 3O3HA 4LF8K 4JYAK 4CHZA 3AAQA 2QTDA 5ADXA 4DTSA 3WXKA 1YAGA 3ATUA 5IWAK 2P9NB 4DG1A 3L2WA 5DM6L 1ATNA 5IT9O 4OKJA 5AQZA 1WSGA 3ZYYX 3SAFA 1S1UA 3KLEA 4Z4GA 3LANA 4DV6K 4OVLA 1IBKK 4O44A 4M3WA 1X9WA 2IIRA 1KSPA 3DJCA 3TTFA 1G99A 3Q7BA 1RBUA 3MAQA 3PO4A 2YHBA 3EE9A 3EE8A 2P9KA 2P9IA 3KWGA 2FSKA 3O5BA 2EX3A 1GLFO 1ZBUA 3LM2A 5EXWA 3PX6A 1C1CA 1VSHA 4CEFA 3CCJN 4CK1A 1BQNA 3K9KA 4M45A 5E41A 2EWSA 3QNNA 3DXMA 3C7NB 1TYQB 1GOBA 3DWLA 4O5BA 1U4BA 1M90O 2YCHA 4DU1A 5FPDA 4ELUA 1NGIA 3SUOA 1BHLA 2NRWA 4CF8A 3CPEA 4BDYA 3IG1A 2D1KA 2KZMA 3L0QA 1XC3A 2DY4A 1LAVA 2V7YA 3E9OA 5AQTA 4DV5K 4DSFA 4GV6A 5CZ2A 1TKDA 3JSMA 4DSIA 1NKCA 3PSFA 4OPHA 3TSPA 5A2QO 2E2NA 4UY8O 1QZ6A 4MQ3A 1ASUA 3NBPA 4ILHA 5C2FA 4IO9L 3I56N 2BE2A 1ZBLA 2PZSA 1YI2N 3LM9A 1C0MA 2QWPA 2G8WA 4ELVA 4O8UA 2V7ZA 4CHQA 4GVEA 4BR0A 4FZXC 4DSEA 4M41A 2VQEK 4DU4A 3OS1A 3C6HA 1BI4B 5HOOA 2KQ2A 3KK3A 3CI5A 2W42A 5FPNA 1H1VA 4DTMA 3THVA 1HYSA 5AR0A 1HJRA 2E20A 1NWKA 3DLLL 2O8EB 3GOIA 1GLDG 3K9JA 1FK9A 2QW9A 1HLUA 3G4SN 4M7YA 1BO5O 4WFBL 1P90A 4WQ4C 3THWA 3CPWM 3NGZA 3NF7A 4I2QA 3DLGA 2KTQA 3WNGA 4NLBA 3OYMA 5AQHA 1UA0A 2G8HA 1J54A 1VQ9N 3CC7N 4PKHA 3ZX2A 4B9NA 4FJIA 1JL2A 3HSCA 1NMNA 1RDUA 4E1NA 4G1QA 5AZIB 4FM1A 2ZD1A 4FJ5A 4NYFA 2O8BB 4DLGA 1QZ5A 2EHGA 4B1UB 4GV9A 4HUFA 2IDOA 1U2VA 5LMUK 4BWJA 3OYDA 5C2DA 2HF4A 4AHRA 3SYZA 3PO5A 1IKVA 3OW2M 2F8SA 3U3GA 3MN7A 3D2EA 3D6RA 5KPRA 4BRQA 1K73O 3L2VA 3O9QA 2G8IA 2OTLN 4JLHA 3EZ5A 5M1PA 4IEIA 3ZT3A 1NGJA 3VQ4A 2FXUA 3O4NA 1WAJA 1GLEG 1TL3A 3A2FA 1NOYA 1K9MO 3RRGA 4EHUA 1JLCA 2WONA 4JRQA 1HYVA 2HF3A 4H5TA 3OS0A 5C10A 4I6MB 2NZTA 4DTUA 1QQNA 3VN5A 3L2RA 1BUPA 3DLBA 3LDQA 5GAEP 3KZBA 4CGHA 4M3RA 2O8DB 2E8AA 3C6AA 3O4WA 3TAPA 4PUOA 3ISNC 4YNQA 2Y1JA 4LF6K 5I9EB 3CCEN 2HNYA 5BN8A 3P31A 4WQ5A 4IZ9A 3O3FA 4FWKA 3ZETB 4JK9A 5AQUA 2RHKA 4CFBA 1RDCA 2Q3SA 2YHYA 5AQFA 2QM1A 1QSSA 3CMAN 4CJKA 3D2FA 3TU5A 4GV3A 2G8FA 2WFBA 4H5WA 5J2NA 3HOSA 1RBRA 1S1XA 4DV3K 4JI3K 4RW8A 4IFYA 3LP0A 3ZEUB 4JKFA 2B4JA 4BC3A 5MLCQ 1VQ7N 4JK7A 1EETA 4CESA 4B9LA 2Z1HA 4BC2A 3G25A 1BOTO 5AJ3K 3MXJA 4O55A 1GLLO 2FF3B 3CERA 3HSTB 3D45A 4DQQA 4KI4A 3OYJA 2VG6A 1K8AO 1NNEA 3MN6A 3VF6A 1U48A 4M3TA 1ZXOA 1TKTA 2DPNA 3CCSN 3VA0A 1XNRK 1U6ZA 5CYQA 1SKWA 1YHQN 1IKYA 3RMAA 3QMLA 3DLKA 4DUZK 3ATVA 1FKPA 2X74A 3H3OB 1JLFA 1Q86O 3OS2A 5JS1A 3CF5L 4X65K 2GELA 2VYPA 5BRHA 1XNQK 4GKKK 1WB9A 1CLQA 1UOCA 4PWDA 3QDKA 3AVNA 3KK7A 4NXMK 2VG7A 4GVMA 1HKBA 2F9WA 5JLHA 1XQSC 4YOXA 4BRFA 3PV8A 3G71N 3I0RA 3MECA 4PY5A 4N76A 4BY9C 4E19A 3KIOA 4DR5K 1BCMA 4CEEA 1QHTA 1S1TA 2Q31A 3AARA 4CZHA 4KAZA 3J7AP 4Z0UA 1BA1A 3SMPA 1E4FT 3U4LA 4CZMA 5LL6Z 3C6TA 3H46O 2P5OA 1RDWX 4FVUA 3L4IA 3HXMA 4JEPA 3HTVA 3NVKA 2P9NA 3EKUA 1FW6A 3DXMB 2CH6A 1N34K 4RCHA 3HPOA 1IKWA 3OYAA 4MLHA 3MEDA 1RTJA 4CJWA 3ALYA 3B6OA 4R79A 4M42A 4LF7K 3CG7A 1Y64A 4CEAA 4CW7B 4CD1A 4IFEA 2FBTA 3CCMN 1S9EA 1MDUB 5BPLA 3FZLA 1T7PA 3F9KA 4W5QA 3VOVA 1YTAA 4B3RK 4BG8A 3CD6N 4B1WB 4DQ8A 2VCPA 3CQYA 3ENOA 3MXIA 4JD2B 2FBYA 1BL3A 3AO5A 2XY6A 4I7FA 2V52B 4AHUA 4E89A 2YV0X 4B3TK 4BRDA 2PFUA 4BR9A 1C0TA 4JAXA 3P83D 4AHVA 4CHPA 4CF2A 4IDKA 4AM6A 1VQ4N 4CJVA 3BDPA 1QS4A 3LAMA 4CZJA 5AQRA 4K41A 3HL8A 4DV0K 1QSYA 3IUCA 1GOAA 4NYNA 4LF5K 4B8CA 1UAXA 2DFEA 4O0JA 4CJ3A 4FW1A 3VQDA 4B1VA 4IOXA 3QIOA 1R0AA 3ZLJA 3UKRB 1VQ5N 1C0GA 1B92A 2ZGZA 3ZSOA 4JS4A 3ZSVA 5M1KA 3DRRA 3NF9A 3HBTA 1QVGM 2PAVA 3THWB 5AQVA 1OH5A 3CJAA 2GBZA 1TVRA 1LAWA 2WTUA 3CJ9A 3LDSA 3NMUA 1HKCA 5GAGP 4FLZA 3HOTA 4O5FA 3HPHA 4DQRA 2HBLA 3FZMA 3S3OA 1HNWK 3DXKB 4JI7K 3M8SA 3T1YK 1BI4A 5M1QA 2B6AA 3AVKA 3JAMO 1HNZK 4LSNA 1S3XA 4GY2B 2O8EA 1U2VB 3NE6A 2PY5A 4IO8A 2UUBK 1KVAA 4BG9A 1X9JA 3J81O 1RTIA 1HNIA 2A5XA 3D2EB 4C8NA 4LD0A 5ADXH 1YVUA 3ULDA 2KW4A 4ISEA 1DKGD 5C25A 4GMJB 4JKAA 1BIZA 3EEQA 4X62K 2JWLA 1NK7A 4EHTA 4BE0A 1B9FA 3SV3A 2CGLA 1N8RO 3K59A 4QS9A 2FF6A 4H0PA 3MWPA 3K5MA 4YDUC 3A8YA 2O8BA 2IAJA 4CZLA 1DGKN 4AM7A 3TAMA 2NRVA 4ELTA 1BGXT 2G8VA 2VQFK 4YHHK 3HJFA 3HPGA 4CK2A 5KQDA 1L3VA 3K5OA 3MMVA 3NH2A 1W7AA 4NB4A 4FM2A 3KWIA 2ZJQL 1L5UA 5F1XA 4KB0A 3VGMA 5FDLA 3ZT1A 4H5NA 2O4GA 4BROA 3OJSA 1OVYA 4A57A 2W40A 2AP1A 2O8DA 2GX9A 1EXQA 1IJJA 3SMSA 4E7JA 4Z4FA 2QEXN 4BRGA 2ASMA 1QE1A 2YKMA 3A5OC 3M8RA 1D8YA 4WFAL 3KTQA 4PHTX 4ID1A 1UA1A 4J2AA 4PL7A 4RW7A 4BGBA 3HYFA 3DOKA 2BH1A 2HHVA 4KHQA 1NGCA 2VGNA 4DFJA 3N4PA 1KVCA 3G10A 1TKZA 4E7KA 3WEEB 4FWNA 1NJIO 4ISGA 3CQXA 3H6EA 4CECA 3ZEUA 5HRSA 1ASWA 1KXPA 2HVHA 3AO2A 3H1VX 5AQWA 4BR4A 3E1YA 4CJ4A 1KTQA 5AQXA 1V4TA 3IMXA 1IBLK 5GIOA 1IG8A 4FPBA 4H5RA 4QS7A 4CZGA 2F7TA 5GIPA 4LFAK 3S3NA 5J1EA 2RKIA 1C1BA 1Z05A 2OPQA 2HW3A 1RT2A 3O08A 5JMVA 4DCHA 3OYKA 1YT3A 3V9ZA 3KJVA 1VK0A 4DLEA 4W5RA 2BDPA 3KHYA 3THYB 1C0UA 3RMBA 1VQON 3M1FA 1WNSA 2OCEA 5CYMA 3L6QA 3QIPA 4JRPA 3AV9A 4E1MA 2P5GA 3HVTA 2F96A 1OVQA 2E88A 4M3ZA 4CJEA 4N47A 4GKJK 3TAFA 2E5LK 3AVHA 4W5OA 5SWMA 2P9PB 3L8BA 2PYJA 2B5JA 2QWLA 4DR6K 4EP5A 4NCBA 4BQLA 2D0CA 3FR0A 1WSEA 3T3FA 3RRHA 4E7IA 3TSUA 4BE1A 3VQCA 2HHUA 5ELZA 4OPAA 3ZSZA 3KK2A 4C8OA 1DLOA 4M3XA 3P39A 3R1XA 3JXUA 4EP4A 3RR7A 1X3NA 2HMIA 4H4MA 3FGUA 3BZCA 3LP3A 1WSHA 3JS6A 3PLAA 4DFKA 2AJQA 1HNVA 1LV5A 3M6GA 1QVFM 2YJFA 4MDAA 3VERA 1I39A 2NLXA 1HYZA 3HI0A 1FJGK 2P9UB 3MX5A 3K0SA 4BRCA 4FJGA 3HP9A 3HK2A 1YIJN 4CZEA 3CJ1A 1TAUA 4DFMA 3CC4N 3V6DA 3OYLA 5BN9A 3IS9A 1R59O 4WYBA 4FPAA 1JLBA 4AHTA 3P5JA 1RFQA 5GINA 3TARA 4YOYA 4DR1K 1U45A 3NFAA 1O1WA 1U04A 1WUAA 1P8ZA 2YHWA 5TKYA 4CFDA 4Q0BA 3WXIA 2OA8A 3M5RA 1NK0A 4JD2A 1TK0A 4LFBK 4IKFA 3O3GA 1Q9YA 1D4XA 4CF0A 1OKJA 4HCCA 1LCUA 4CJQA 4NO7A 4OGCA 4YOWA 5LJWA 3CYMA 3OYEA 1T05A 3NH1A 1EWQA 1XHXA 3UB5A 3WNEA 4G9ZA 3K2PA 1J6ZA 1E4GT 2H3GX 3FLCO 2OTJN 1NOZA 3TAGA 4XH1A 1VQKN 4IDHA 5GADP 4NCAA 4AILC 3UKRA 1TUUA 4FWRA 3G6EN 4CBXA 4AH9A 3MK6A 4CCHA 2PBDA 3AAPA 4U7BA 1RT1A 1S6PA 5BREA 4MDBA 4CE9A 3OA9A 4JKCA 5AFUA 4EAHD 2FLOA 2HSTA 1M1KO 4KHNA 3H08A 4FZZA 3O6WA 3LDOA 5AQOA 3DYAA 2E6LA 4JI4K 4A59A 2XHBA 3ZT4A 2XRIA 4DSKA 5AQQA 3ENBA 2Z1IA 2BANA 3CCQN 3U6FA 1VSEA 1Q18A 5KRTA 5AQLA 3DXKA 4CEDA 3OYHA 1T3VA 1LOTB 4FLTA 3FE1A 3AVIA 3FZFA 5KTQA 3PUFA 3LP1A 1QQOA 1NU0A 3VQ7A 3ITHA 4FOEA 2KKZA 2QWRA 1NJWA 4OPKA 3OYIA 1LWFA 1NGFA 4BR5A 1U47A 3OTOK 5C15A 4FWQA 1NK9A 1EKEA 4JI5K 3BUZB 3O9TA 4KH6A 4YY3K 2OPRA 3HM9A 4H0VB 5BR8K 1KFSA 2OZSA 3OYBA 3CCUN 5AQKA 5C12A 4QOZB 1NGBA 3MCAB 5HP1A 4JNEA 1WAFA 3RSEB 2UUAK 2OANA 3L3VA 3RWUA 1YITN 3DOLA 2DFFA 3FZHA 3OYCA 3CFOA 4W5NA 4H5VA 4KHSA 1LW0A 4H03B 2UXDK 3SBGA 3TWHA 1LWCA 2HNZA 1C0FA 4B1XB 1K8KB 4M63C 3RR8A 3LPTA 2Q0UA 4NCGA 4PA1A 3P1GA 3N4QA 1EO1A 3RMCA 2YX6A 2RPIA 3HM8A 3OHRA 3WXJA 2QKBA 1XHZA 3E9LA 5AZJB 4KBOA 2HVIA 2HHWA 1KVBA 4F3OA 1T03A 4BVPA 4ICLA 1D5AA 4BC4A 4BWMA 5C24A 4YOVA 4KKOA 3KLFA 4C23A 5M1NA 3DMJA 4Q5VA 2ITGA 4CBUA 3AVAA 3WQUA 2ATQA 3PY8A 2JWKA 2XY5A 4KTZA 3SNNA 5HLFA 4HWIA 2WBNA 5BR9A 3QB0A 1YVNA 3SK3A 3I8DA 4CF9A 4WQ4A 2KFZA 3WEEA 4ZTJA 4FK0A 5FPEA 4F9OA 3F9MA 4H0OA 3CFPA 2WOMA 4DTJA 4CJUA 3MWTA 4XH4A 1BA0A 1VSIA 3V9WA 4FK4A 1GLCG 5HRPA 3KKRA 4DQPA 3NH0A 3KK1A 3ZCMA 4IOAL 1S1VA 4I2PA 3S9HA 3H45C 1CXUA 4R5PA 4Z4CA 2YNIA 3NCIA 4CZFA 5JICA 1RILA 3OYFA 3D0PA 4H0YB 3VGKA 4OX9K 3AGRA 1RT6A 3B8AX 3THYA 1NJYA 1CZAN 2FC0A 1NM1A 2ASOA 2P1JA 3A5LC 1NGDA 4FVMA 4DSJA 2P9LB 3LDLA 3DLRA 2HBKA 3THXA 3TANA 4TSXA 3ZT0A 1KAZA 2NNWA 1JJ2M 4CJPA 1TK8A 2UU9K 4H4OA 4CI6A 5AQYA 4DKWA 3P38A 1KRPA 3RMDA 4JI8K 2ZQBA 2P9PA 5AQNA 2I5JA 2Q97A 3DI6A 3OY9A 3E66A 2UYTA 4BACA 1VSDA 1I3AA 2IC3A 3OBYA 3VEWA 3EN9A 2FSNA 1J5OA 4DR7K 4JN4A 3F2KA 4O0IA 1S6QA 4WFNL 1RBVA 4B3MK 1Z25A 4CJSA 4N56A 3QEVA 1HNXK 3AY9A 5M1FA 2IGIA 3K5LA 4RWTA 4IWVA 4H0XB 4CGFA 4N5SA 3V4IA 2YNHA 2G8KA 4K25A 4Z94A 4A5BA 2WC9A 4QS8A 3P4IA 1XC9A 2Z1JA 4CZKA 3T1AA 1N5YA 2J4RA 3MXMA 3WQTA 5TKWA 3SI6A 4J2EA 4K0KK 4YOTA 5CR4A 1T44A 2P9UA 4BQZA 3C65A 3KLGA 1KC8O 3GE1A 3DM2A 2HBJA 1TL1A 4DR2K 3VPZA 4E7LA 4FLXA 3UKUA 3MEGA 2NRRA 3VGLA 2RN2A 3T1HK 3I8BA 3CJBA 3NDKA 4FLYA 1X1PA 3CCVN 2HOEA 1ZC6A 5K14A 2X6NA 5J2PA 2O8FB 3AVJA 1RTDA 1RT4A 1EX4A 5H1SQ 4KO0A 4IG0A 4KRFA 4DTXA 2IVOA 4Z4EA 4JK8A 1KQSM 4F3TA 3EKSA 1JCGA 2PYLA 2Q1NA 4JKHA 1RNHA 5BRDA 1WN7A 2AA4A 4CZIA 3BGRA 3CC2N 2FBVA 3LALA 4B1YB 4BGAA 1EQYA 1RDBA 2O8CB 3GBTA 1IV0A 3U9DA 3LL3A 2KFNA 3CM6A 1RT3A 3TPQA 3QERA 4JHDB 5EY4A 3LZJA 2P51A 4KFBA 1HJOA 3SJHA 3VQEA 3VQ9A 2DTUA 2IVNA 3T7ZA 1SL1A 4DF4A 4JI0K 3I33A 3DAWA 3BF3A 3SAGA 4IXCA 4CEQA 4DF8A 3O9UA 3ZSQA 4OO1J 2HNDA 2VWKA 1JLAA 3R6MA 5JVGL 1QTMA 1MWMA
chains in the Genus database with same CATH topology
4CJFA 2GV9A 3K57A 2B5JA 3L8BA 4G1QA 2PYJA 4EP5A 4NCBA 4FM1A 5JS2A 2ZD1A 2QKKA 4FJ5A 2D0CA 4NYFA 4IBNA 2OPSA 3IRXA 5DK5A 4HHTA 1VSJA 1WSEA 4DLGA 3T3FA 2EHGA 4HUFA 1FXXA 3RRHA 2IDOA 4E7IA 3DLEA 4BWJA 3OYDA 3LP2A 4AHRA 4AHSA 3VQCA 4BE1A 1IKVA 3SYZA 1D9DA 1DTTA 1QQCA 5EU7A 3U3GA 4B9MA 3IAYA 2F8SA 1A5XA 3KD5E 3ZSZA 3KK2A 4HUGA 5KGWA 4C8OA 1DLOA 4CJTA 4M3XA 3AVBA 1REVA 3L2VA 1K6YA 2G8IA 4EP4A 1RCHA 3RR7A 2HHQA 4JLHA 3EZ5A 2HMIA 4H4MA 5HROA 3ZT3A 4HCBA 1LWEA 4B8AB 3VQ4A 5FRNA 4CK3A 3LP3A 1J53A 3NAEA 3O4NA 1WSHA 1WAJA 1TL3A 3A2FA 4DFKA 1NOYA 2AJQA 1HNVA 2LSNA 4B08A 3RRGA 4FZYA 1JLCA 2WONA 4JRQA 1LV5A 1HYVA 3OS0A 4HUEA 4N41A 1IH7A 4K8XA 4F4KA 4DTUA 3VN5A 4FLVA 4KREA 3L2RA 3DLBA 4J2DA 1I39A 1HYZA 4CGHA 1WSIA 3FFIA 4M3RA 3SCXA 4C8LA 4OKEA 3TAPA 4FJGA 1UWBA 4PUOA 3PX4A 4M3UA 3AVCA 2YHAA 3ISNC 3HP9A 5CY4A 4YNQA 2Y1JA 1WLJA 3HK2A 4KHWA 4FK2A 3V1RA 2HNYA 4RG8A 1TAUA 1VSFA 3WNFA 3B6PA 4DFMA 5J2MA 2A1SA 3V6DA 3O3FA 3OYLA 4E0DA 2E6MA 1ITGA 3IS9A 1SKRA 4CFBA 1JLBA 4AHTA 5FRMA 5FROA 1RDCA 2Q3SA 3P5JA 3L2QA 3SUQA 5D3GA 3TARA 1QSSA 4CJRA 4CJKA 1U45A 2OYQA 1TGOA 3NFAA 4CGIA 3SQ2A 4FJMA 1O1WA 2ETJA 1U04A 4DTRA 2G8FA 3O4QA 5J2NA 2Z1GA 1RBRA 3G0ZA 1S1XA 4KTWA 4CFDA 4Q0BA 1J9AA 1JLQA 4RW8A 4IFVA 4FXDA 2OA8A 4B9UA 4F2SA 4IFYA 3QEWA 1TK0A 3AVLA 1NK0A 3LP0A 4C8KA 3O3GA 1Q9YA 4IKFA 1ZBHA 2B4JA 4CF0A 4HCCA 3PX0A 4CJQA 3QEIA 1EETA 4OGCA 4CESA 4B9LA 3QEPA 3CYMA 2Z1HA 3OYEA 1T05A 1VSKA 1L3SA 3NH1A 1XHXA 3WNEA 1SKSA 3MXJA 1WSFA 2D0AA 3CQ8A 4CEBA 3K2PA 3KD1E 4O55A 3SUNA 2FBXA 3HO1A 3HSTB 4DQQA 3D45A 4XIUA 1KLMA 4OGEA 4KI4A 1NOZA 3TAGA 3OYJA 2DFHA 2VG6A 3K58A 1U48A 2HHTA 4M3TA 3KLIA 1TKTA 4NCAA 4AILC 2E4LA 4DS5A 3VA0A 1NKBA 1X9SA 1SV5A 4AH9A 5CYQA 4FYDA 4CERA 1A5WA 1SKWA 1ZBIA 4GW6A 4CCHA 3SQ4A 1IKYA 4QCLA 3ZSYA 3RMAA 3TR8A 1RT1A 1S6PA 3LZIA 4CE9A 3ZSRA 3DLKA 3M8QA 1NK8A 1JXEA 3TI0A 4E3SA 1FKPA 4J2BA 2X74A 4EZ6A 4FJKA 1JLFA 4BE2A 3OS2A 5JS1A 3QLHA 2RF2A 2YNFA 4KHNA 3H08A 4CFCA 2QXFA 4FZZA 3DYAA 3ZT2A 2E6LA 2XHBA 4DTNA 1NJZA 4CIGA 2HHSA 3LPUA 3ZT4A 2XRIA 3AVFA 2BGGA 1CLQA 2NUBA 1UOCA 4CF1A 3V9SA 4DSKA 2G8UA 4PWDA 3AVNA 2Z1IA 2VG7A 3MEEA 3KLHA 4GVMA 2BANA 3V9XA 3U6FA 1VSEA 5KRTA 4RW6A 4PQUA 3PV8A 4CEDA 3VQ6A 3OYHA 3DLHA 3I0RA 3MECA 5J2QA 1U49A 2Y1IA 4PY5A 3M8PA 5KI6A 4FLTA 1SL0A 4N76A 2F8TA 4E19A 3AVIA 3LAKA 3KIOA 5KTQA 4BDPA 3PUFA 3LP1A 1FKOA 1BCMA 4CEEA 1QHTA 1S1TA 2JLEA 4ID5A 4KAZA 3NF6A 4Z0UA 3PO5A 4UQGA 3VQ7A 3VQPA 2OPPA 1C1AA 3ITHA 2D5RA 3QO9A 1HQEA 2X6SA 3C6TA 2IOCA 1NJWA 4OPKA 2P5OA 3L3UA 2X78A 4CJ5A 3OYIA 3HXMA 1LWFA 2VG5A 1U47A 2XY7A 4CIFA 1NK9A 3WNHA 4FW2A 1EKEA 4FM0A 4FJHA 3C6UA 4Z4HA 2OPRA 3HM9A 4CIEA 3HPOA 3NHGA 3C94A 3SPYA 1IKWA 3OYBA 3OYAA 1KFSA 3K5NA 2OZSA 4I9QA 4FJ7A 4QOZB 3MEDA 3ASMA 3HVRA 5HP1A 1RTJA 1DTQA 1N6QA 4CJWA 1WAFA 3ALYA 3B6OA 4ZHRA 4CHYA 1Y97A 3ZSWA 1TV6A 3QETA 5CZ1A 4FJ9A 1GOCA 3L3VA 1BQMA 3RWUA 4M42A 1CZBA 2DFFA 3DOLA 3NGYA 3DRSA 3CG7A 3V81A 1XI1A 4F2RA 3C95A 1YTUA 1VRTA 4CEAA 3CFOA 1RDDA 2D0BA 3OYCA 4OPJA 4W5NA 4KHSA 4DWIA 3SQ0A 1LW0A 1Q8IA 4KTQA 2FBTA 4KHYA 1HPZA 4ZTFA 1S9EA 3TWHA 4HVJA 3HT3A 1LWCA 2HNZA 3AA4A 4W5TA 3QINA 4DSLA 1T7PA 3F9KA 4W5QA 1L3TA 3AO1A 1YTAA 4QAGA 5T7BA 3RR8A 1IO2A 3LPTA 4NCGA 4PA1A 3P1GA 1A5VA 1VRUA 3RMCA 1RT5A 2RPIA 3E01A 2QKBA 1XHZA 2R7YA 3VQBA 3SUPA 4O4GA 4DTOA 3CFRA 3MXIA 2HVIA 3RTVA 2O4IA 2FBYA 3QESA 4B9TA 1BL3A 3AO5A 2XY6A 1ZBFA 4I7FA 4RW4A 1KVBA 2HHWA 3OYGA 1T03A 3AVMA 4ICLA 4AHUA 4E89A 2YV0X 3S3MA 4F3OA 1D5AA 3EYZA 1JXBA 2A1RA 1C0TA 4BWMA 4DFPA 3P83D 5C24A 4AHVA 4CHPA 4CF2A 1ASVA 4KKOA 3KLFA 3I0SA 3UIQA 3KKSA 4IDKA 3TABA 3T19A 4CJVA 3BDPA 5HRNA 1QS4A 3DMJA 3LAMA 1F21A 3OYNA 3HL8A 4Q5VA 1QSYA 4CHNA 3NGIA 1BCOA 1GOAA 4NYNA 4H8KA 3VQQA 2ITGA 3V1OA 4B8CA 1UAXA 4CEOA 2DFEA 3AVAA 4O0JA 1SL2A 4CJ3A 4FW1A 3VQDA 2ATQA 3PY8A 4DQSA 3QIOA 1R0AA 2HB5A 3L2UA 1JL1A 3VQ8A 2XY5A 4KTZA 3DRPA 3SNNA 5HLFA 3SV4A 1B92A 3ZSOA 4JS4A 1RBSA 1KFDA 4FJXA 3ZSVA 1NK4A 3DRRA 4CEZA 3AO3A 3V9UA 2QK9A 3I8DA 4I9LA 4CF9A 4DS4A 4KHUA 4FLUA 2KFZA 4OJRA 4ZTJA 4FLWA 3NF9A 4FK0A 3VQ5A 1KLNA 3ZSXA 5C42A 4Y1DA 5KGXA 3LWLA 4MFBA 3CFPA 2WOMA 4Y1CA 2GBZA 4DTJA 1TVRA 1LAWA 1RT7A 4CJUA 2IS3A 2YKNA 3LDSA 3VA3A 3OVNA 1IKXA 4FJJA 1RBTA 4FLZA 3V9WA 1VSIA 5I42A 1NK6A 4FK4A 3HPHA 5HRPA 4KPYA 3KKRA 4DQRA 4DQPA 3NH0A 4M3YA 3KK1A 3ZCMA 1S1VA 5DMRA 4I2PA 2OZMA 3S3OA 1CZ9A 1T8EA 4CFAA 3S9HA 4KV8A 4L8RB 4KB1A 1CXUA 2JGUA 3M8SA 1BI4A 1MU2A 4R5PA 4CGJA 4Z4CA 2B6AA 3AVKA 3TAEA 2YNIA 3NCIA 4K8ZA 4C8MA 4LSNA 1RILA 3OYFA 1X9MA 3D0PA 1G15A 4Z4IA 3NE6A 2PY5A 4E7HA 1RT6A 1RTHA 4WE1A 1KVAA 4CGDA 1NJYA 1JLGA 1JLEA 4FJ8A 3O3HA 4OLBA 2FC0A 4CHZA 4DTSA 2P1JA 1RTIA 1HNIA 4C8NA 3VQAA 4LD0A 3ULDA 4B3OA 1YVUA 3SQ1A 4LH4A 2KW4A 4FVMA 4DSJA 5C25A 3DLRA 4GMJB 3TANA 1BIZA 4TSXA 4DG1A 3ZT0A 3L2WA 2XO7A 4CJLA 4CJPA 4B9VA 1TK8A 3AA3A 1NK7A 3NF8A 4H4OA 4OKJA 1WSGA 1Z26A 4BE0A 1S1UA 3KLEA 1B9FA 4Z4GA 3SV3A 1HMVA 3LANA 3SZ2A 4OVLA 1KRPA 3RMDA 4DQIA 4O44A 2GUIA 2ZQBA 3K59A 4B9SA 4M3WA 2I5JA 3DI6A 3OY9A 1X9WA 1KSPA 1D9FA 4BACA 1IG9A 1VSDA 1I3AA 2IC3A 4BDZA 4DTPA 1BIUA 1J5OA 4OKKA 3K5MA 1RBUA 3MAQA 3PO4A 4O0IA 2IAJA 1S6QA 2YHBA 5HRRA 1RBVA 3TAMA 3AVGA 3AA5X 1Z25A 4CJSA 4N56A 4CHOA 2EX3A 3QEVA 4ELTA 1CXQA 1BGXT 1ZBUA 5KRSA 4RW9A 2G8VA 2IGIA 3K5LA 3QEXA 1C1CA 3PX6A 1VSHA 3HJFA 4OLAA 4CEFA 4FCYA 3HPGA 4FJLA 4CGFA 4N5SA 3V4IA 3SPZA 1L3UA 4CK2A 2YNHA 3TAQA 4CK1A 1BQNA 4M45A 1NJXA 1L3VA 5E41A 1WSJA 1ZYQA 2VWJA 3QNNA 1Q9XA 4FJIA 3K5OA 2HHUA 1GOBA 4LH5A 1RDAA 4O5BA 3NH2A 3HP6A 3SJJA 1XC9A 2Z1JA 1U4BA 1BISA 3T1AA 1N5YA 1LW2A 4FM2A 4DU1A 4ELUA 3MXMA 1C6VA 1L5UA 3SUOA 1BHLA 4CF8A 4KB0A 3SI6A 4BDYA 5FDLA 3ZT1A 1VSLA 2O4GA 3OJSA 1EP4A 4J2EA 3IG1A 4FJNA 4EZ9A 2KZZA 3EY1A 1EXQA 5I3UA 3KLGA 2KZMA 4E7JA 4Z4FA 2DY4A 2HHXA 1LAVA 5SZTA 3DM2A 1QE1A 1HRHA 1TL1A 2YKMA 3M8RA 5CZ2A 4DSFA 1D8YA 4E7LA 1TKDA 3JSMA 4FLXA 1NKCA 3KTQA 1JKHA 3MEGA 4DSIA 4ID1A 1UA1A 4LSLA 2RN2A 3NDKA 3CM5A 4FLYA 1X1PA 1S1WA 4RW7A 4J2AA 1TK5A 3HYFA 1S9GA 4MQ3A 5K14A 2X6NA 3DOKA 5J2PA 3AVJA 1ASUA 3NBPA 2HHVA 2G8KA 1RTDA 4KHQA 1RT4A 1EX4A 4KO0A 4DFJA 1SUQA 4IG0A 2BE2A 1ZBLA 1KVCA 2YNGA 3G10A 4HTUA 2ZE2A 4KRFA 2PZSA 4DTXA 1TKZA 4E7KA 1TKXA 3F73A 1QSLA 4DMNA 1TAQA 4CGGA 4Z4EA 3JYTA 4CECA 3QNOA 1C0MA 5HRSA 4KI6A 4F3TA 1ASWA 1B9DA 2PYLA 1XWLA 2HVHA 2G8WA 3AO2A 4LY7A 1W0HA 4ELVA 1RNHA 1WN7A 4CJ4A 3BGRA 4YFUA 2FBVA 3LALA 1KTQA 4AHCA 4CHQA 1NKEA 4FZXC 1RDBA 3V1QA 4M41A 4DSEA 4IG3A 4DU4A 3OS1A 2KFNA 1HQUA 1S5JA 1VSMA 1BI4B 2XY8A 2KQ2A 3CM6A 3KK3A 3S3NA 1NK5A 5J1EA 2W42A 2RKIA 1RT3A 1C1BA 1W9HA 4DTMA 3QERA 3THVA 1HYSA 1HJRA 3LZJA 2OPQA 3LWMA 4JS5A 2HW3A 1RT2A 2P51A 4KFBA 3OYKA 1YT3A 3V9ZA 3AO4A 3KJVA 1FK9A 1VK0A 4DLEA 4DU3A 3VQEA 3VQ9A 4W5RA 2BDPA 2DTUA 1C0UA 3RMBA 3NGZA 3NF7A 4I2QA 3DLGA 1WNSA 5CYMA 1SL1A 4DF4A 3QIPA 4JRPA 2KTQA 3AV9A 3WNGA 3OJUA 4E1MA 2P5GA 3OYMA 3HVTA 5HBMA 2F96A 1UA0A 2G8HA 1J54A 4M3ZA 3AA2A 4CEQA 4CJEA 4N47A 3ZSQA 4DF8A 4B9NA 3TAFA 1KCFA 1JL2A 2HNDA 1JLAA 2VWKA 4F8RA 1QTMA 3AVHA 4W5OA 5SWMA 3U3YA 4E1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJF A;  2GV9 A;  3K57 A;  2B5J A;  3L8B A;  4G1Q A;  2PYJ A;  4EP5 A;  4NCB A;  4FM1 A;  5JS2 A;  2ZD1 A;  2QKK A;  4FJ5 A;  2D0C A;  4NYF A;  4IBN A;  2OPS A;  3IRX A;  5DK5 A;  4HHT A;  1VSJ A;  1WSE A;  4DLG A;  3T3F A;  2EHG A;  4HUF A;  1FXX A;  3RRH A;  2IDO A;  4E7I A;  3DLE A;  4BWJ A;  3OYD A;  3LP2 A;  4AHR A;  4AHS A;  3VQC A;  4BE1 A;  1IKV A;  3SYZ A;  1D9D A;  1DTT A;  1QQC A;  5EU7 A;  3U3G A;  4B9M A;  3IAY A;  2F8S A;  1A5X A;  3KD5 E;  3ZSZ A;  3KK2 A;  4HUG A;  5KGW A;  4C8O A;  1DLO A;  4CJT A;  4M3X A;  3AVB A;  1REV A;  3L2V A;  1K6Y A;  2G8I A;  4EP4 A;  1RCH A;  3RR7 A;  2HHQ A;  4JLH A;  3EZ5 A;  2HMI A;  4H4M A;  5HRO A;  3ZT3 A;  4HCB A;  1LWE A;  4B8A B;  3VQ4 A;  5FRN A;  4CK3 A;  3LP3 A;  1J53 A;  3NAE A;  3O4N A;  1WSH A;  1WAJ A;  1TL3 A;  3A2F A;  4DFK A;  1NOY A;  2AJQ A;  1HNV A;  2LSN A;  4B08 A;  3RRG A;  4FZY A;  1JLC A;  2WON A;  4JRQ A;  1LV5 A;  1HYV A;  3OS0 A;  4HUE A;  4N41 A;  1IH7 A;  4K8X A;  4F4K A;  4DTU A;  3VN5 A;  4FLV A;  4KRE A;  3L2R A;  3DLB A;  4J2D A;  1I39 A;  1HYZ A;  4CGH A;  1WSI A;  3FFI A;  4M3R A;  3SCX A;  4C8L A;  4OKE A;  3TAP A;  4FJG A;  1UWB A;  4PUO A;  3PX4 A;  4M3U A;  3AVC A;  2YHA A;  3ISN C;  3HP9 A;  5CY4 A;  4YNQ A;  2Y1J A;  1WLJ A;  3HK2 A;  4KHW A;  4FK2 A;  3V1R A;  2HNY A;  4RG8 A;  1TAU A;  1VSF A;  3WNF A;  3B6P A;  4DFM A;  5J2M A;  2A1S A;  3V6D A;  3O3F A;  3OYL A;  4E0D A;  2E6M A;  1ITG A;  3IS9 A;  1SKR A;  4CFB A;  1JLB A;  4AHT A;  5FRM A;  5FRO A;  1RDC A;  2Q3S A;  3P5J A;  3L2Q A;  3SUQ A;  5D3G A;  3TAR A;  1QSS A;  4CJR A;  4CJK A;  1U45 A;  2OYQ A;  1TGO A;  3NFA A;  4CGI A;  3SQ2 A;  4FJM A;  1O1W A;  2ETJ A;  1U04 A;  4DTR A;  2G8F A;  3O4Q A;  5J2N A;  2Z1G A;  1RBR A;  3G0Z A;  1S1X A;  4KTW A;  4CFD A;  4Q0B A;  1J9A A;  1JLQ A;  4RW8 A;  4IFV A;  4FXD A;  2OA8 A;  4B9U A;  4F2S A;  4IFY A;  3QEW A;  1TK0 A;  3AVL A;  1NK0 A;  3LP0 A;  4C8K A;  3O3G A;  1Q9Y A;  4IKF A;  1ZBH A;  2B4J A;  4CF0 A;  4HCC A;  3PX0 A;  4CJQ A;  3QEI A;  1EET A;  4OGC A;  4CES A;  4B9L A;  3QEP A;  3CYM A;  2Z1H A;  3OYE A;  1T05 A;  1VSK A;  1L3S A;  3NH1 A;  1XHX A;  3WNE A;  1SKS A;  3MXJ A;  1WSF A;  2D0A A;  3CQ8 A;  4CEB A;  3K2P A;  3KD1 E;  4O55 A;  3SUN A;  2FBX A;  3HO1 A;  3HST B;  4DQQ A;  3D45 A;  4XIU A;  1KLM A;  4OGE A;  4KI4 A;  1NOZ A;  3TAG A;  3OYJ A;  2DFH A;  2VG6 A;  3K58 A;  1U48 A;  2HHT A;  4M3T A;  3KLI A;  1TKT A;  4NCA A;  4AIL C;  2E4L A;  4DS5 A;  3VA0 A;  1NKB A;  1X9S A;  1SV5 A;  4AH9 A;  5CYQ A;  4FYD A;  4CER A;  1A5W A;  1SKW A;  1ZBI A;  4GW6 A;  4CCH A;  3SQ4 A;  1IKY A;  4QCL A;  3ZSY A;  3RMA A;  3TR8 A;  1RT1 A;  1S6P A;  3LZI A;  4CE9 A;  3ZSR A;  3DLK A;  3M8Q A;  1NK8 A;  1JXE A;  3TI0 A;  4E3S A;  1FKP A;  4J2B A;  2X74 A;  4EZ6 A;  4FJK A;  1JLF A;  4BE2 A;  3OS2 A;  5JS1 A;  3QLH A;  2RF2 A;  2YNF A;  4KHN A;  3H08 A;  4CFC A;  2QXF A;  4FZZ A;  3DYA A;  3ZT2 A;  2E6L A;  2XHB A;  4DTN A;  1NJZ A;  4CIG A;  2HHS A;  3LPU A;  3ZT4 A;  2XRI A;  3AVF A;  2BGG A;  1CLQ A;  2NUB A;  1UOC A;  4CF1 A;  3V9S A;  4DSK A;  2G8U A;  4PWD A;  3AVN A;  2Z1I A;  2VG7 A;  3MEE A;  3KLH A;  4GVM A;  2BAN A;  3V9X A;  3U6F A;  1VSE A;  5KRT A;  4RW6 A;  4PQU A;  3PV8 A;  4CED A;  3VQ6 A;  3OYH A;  3DLH A;  3I0R A;  3MEC A;  5J2Q A;  1U49 A;  2Y1I A;  4PY5 A;  3M8P A;  5KI6 A;  4FLT A;  1SL0 A;  4N76 A;  2F8T A;  4E19 A;  3AVI A;  3LAK A;  3KIO A;  5KTQ A;  4BDP A;  3PUF A;  3LP1 A;  1FKO A;  1BCM A;  4CEE A;  1QHT A;  1S1T A;  2JLE A;  4ID5 A;  4KAZ A;  3NF6 A;  4Z0U A;  3PO5 A;  4UQG A;  3VQ7 A;  3VQP A;  2OPP A;  1C1A A;  3ITH A;  2D5R A;  3QO9 A;  1HQE A;  2X6S A;  3C6T A;  2IOC A;  1NJW A;  4OPK A;  2P5O A;  3L3U A;  2X78 A;  4CJ5 A;  3OYI A;  3HXM A;  1LWF A;  2VG5 A;  1U47 A;  2XY7 A;  4CIF A;  1NK9 A;  3WNH A;  4FW2 A;  1EKE A;  4FM0 A;  4FJH A;  3C6U A;  4Z4H A;  2OPR A;  3HM9 A;  4CIE A;  3HPO A;  3NHG A;  3C94 A;  3SPY A;  1IKW A;  3OYB A;  3OYA A;  1KFS A;  3K5N A;  2OZS A;  4I9Q A;  4FJ7 A;  4QOZ B;  3MED A;  3ASM A;  3HVR A;  5HP1 A;  1RTJ A;  1DTQ A;  1N6Q A;  4CJW A;  1WAF A;  3ALY A;  3B6O A;  4ZHR A;  4CHY A;  1Y97 A;  3ZSW A;  1TV6 A;  3QET A;  5CZ1 A;  4FJ9 A;  1GOC A;  3L3V A;  1BQM A;  3RWU A;  4M42 A;  1CZB A;  2DFF A;  3DOL A;  3NGY A;  3DRS A;  3CG7 A;  3V81 A;  1XI1 A;  4F2R A;  3C95 A;  1YTU A;  1VRT A;  4CEA A;  3CFO A;  1RDD A;  2D0B A;  3OYC A;  4OPJ A;  4W5N A;  4KHS A;  4DWI A;  3SQ0 A;  1LW0 A;  1Q8I A;  4KTQ A;  2FBT A;  4KHY A;  1HPZ A;  4ZTF A;  1S9E A;  3TWH A;  4HVJ A;  3HT3 A;  1LWC A;  2HNZ A;  3AA4 A;  4W5T A;  3QIN A;  4DSL A;  1T7P A;  3F9K A;  4W5Q A;  1L3T A;  3AO1 A;  1YTA A;  4QAG A;  5T7B A;  3RR8 A;  1IO2 A;  3LPT A;  4NCG A;  4PA1 A;  3P1G A;  1A5V A;  1VRU A;  3RMC A;  1RT5 A;  2RPI A;  3E01 A;  2QKB A;  1XHZ A;  2R7Y A;  3VQB A;  3SUP A;  4O4G A;  4DTO A;  3CFR A;  3MXI A;  2HVI A;  3RTV A;  2O4I A;  2FBY A;  3QES A;  4B9T A;  1BL3 A;  3AO5 A;  2XY6 A;  1ZBF A;  4I7F A;  4RW4 A;  1KVB A;  2HHW A;  3OYG A;  1T03 A;  3AVM A;  4ICL A;  4AHU A;  4E89 A;  2YV0 X;  3S3M A;  4F3O A;  1D5A A;  3EYZ A;  1JXB A;  2A1R A;  1C0T A;  4BWM A;  4DFP A;  3P83 D;  5C24 A;  4AHV A;  4CHP A;  4CF2 A;  1ASV A;  4KKO A;  3KLF A;  3I0S A;  3UIQ A;  3KKS A;  4IDK A;  3TAB A;  3T19 A;  4CJV A;  3BDP A;  5HRN A;  1QS4 A;  3DMJ A;  3LAM A;  1F21 A;  3OYN A;  3HL8 A;  4Q5V A;  1QSY A;  4CHN A;  3NGI A;  1BCO A;  1GOA A;  4NYN A;  4H8K A;  3VQQ A;  2ITG A;  3V1O A;  4B8C A;  1UAX A;  4CEO A;  2DFE A;  3AVA A;  4O0J A;  1SL2 A;  4CJ3 A;  4FW1 A;  3VQD A;  2ATQ A;  3PY8 A;  4DQS A;  3QIO A;  1R0A A;  2HB5 A;  3L2U A;  1JL1 A;  3VQ8 A;  2XY5 A;  4KTZ A;  3DRP A;  3SNN A;  5HLF A;  3SV4 A;  1B92 A;  3ZSO A;  4JS4 A;  1RBS A;  1KFD A;  4FJX A;  3ZSV A;  1NK4 A;  3DRR A;  4CEZ A;  3AO3 A;  3V9U A;  2QK9 A;  3I8D A;  4I9L A;  4CF9 A;  4DS4 A;  4KHU A;  4FLU A;  2KFZ A;  4OJR A;  4ZTJ A;  4FLW A;  3NF9 A;  4FK0 A;  3VQ5 A;  1KLN A;  3ZSX A;  5C42 A;  4Y1D A;  5KGX A;  3LWL A;  4MFB A;  3CFP A;  2WOM A;  4Y1C A;  2GBZ A;  4DTJ A;  1TVR A;  1LAW A;  1RT7 A;  4CJU A;  2IS3 A;  2YKN A;  3LDS A;  3VA3 A;  3OVN A;  1IKX A;  4FJJ A;  1RBT A;  4FLZ A;  3V9W A;  1VSI A;  5I42 A;  1NK6 A;  4FK4 A;  3HPH A;  5HRP A;  4KPY A;  3KKR A;  4DQR A;  4DQP A;  3NH0 A;  4M3Y A;  3KK1 A;  3ZCM A;  1S1V A;  5DMR A;  4I2P A;  2OZM A;  3S3O A;  1CZ9 A;  1T8E A;  4CFA A;  3S9H A;  4KV8 A;  4L8R B;  4KB1 A;  1CXU A;  2JGU A;  3M8S A;  1BI4 A;  1MU2 A;  4R5P A;  4CGJ A;  4Z4C A;  2B6A A;  3AVK A;  3TAE A;  2YNI A;  3NCI A;  4K8Z A;  4C8M A;  4LSN A;  1RIL A;  3OYF A;  1X9M A;  3D0P A;  1G15 A;  4Z4I A;  3NE6 A;  2PY5 A;  4E7H A;  1RT6 A;  1RTH A;  4WE1 A;  1KVA A;  4CGD A;  1NJY A;  1JLG A;  1JLE A;  4FJ8 A;  3O3H A;  4OLB A;  2FC0 A;  4CHZ A;  4DTS A;  2P1J A;  1RTI A;  1HNI A;  4C8N A;  3VQA A;  4LD0 A;  3ULD A;  4B3O A;  1YVU A;  3SQ1 A;  4LH4 A;  2KW4 A;  4FVM A;  4DSJ A;  5C25 A;  3DLR A;  4GMJ B;  3TAN A;  1BIZ A;  4TSX A;  4DG1 A;  3ZT0 A;  3L2W A;  2XO7 A;  4CJL A;  4CJP A;  4B9V A;  1TK8 A;  3AA3 A;  1NK7 A;  3NF8 A;  4H4O A;  4OKJ A;  1WSG A;  1Z26 A;  4BE0 A;  1S1U A;  3KLE A;  1B9F A;  4Z4G A;  3SV3 A;  1HMV A;  3LAN A;  3SZ2 A;  4OVL A;  1KRP A;  3RMD A;  4DQI A;  4O44 A;  2GUI A;  2ZQB A;  3K59 A;  4B9S A;  4M3W A;  2I5J A;  3DI6 A;  3OY9 A;  1X9W A;  1KSP A;  1D9F A;  4BAC A;  1IG9 A;  1VSD A;  1I3A A;  2IC3 A;  4BDZ A;  4DTP A;  1BIU A;  1J5O A;  4OKK A;  3K5M A;  1RBU A;  3MAQ A;  3PO4 A;  4O0I A;  2IAJ A;  1S6Q A;  2YHB A;  5HRR A;  1RBV A;  3TAM A;  3AVG A;  3AA5 X;  1Z25 A;  4CJS A;  4N56 A;  4CHO A;  2EX3 A;  3QEV A;  4ELT A;  1CXQ A;  1BGX T;  1ZBU A;  5KRS A;  4RW9 A;  2G8V A;  2IGI A;  3K5L A;  3QEX A;  1C1C A;  3PX6 A;  1VSH A;  3HJF A;  4OLA A;  4CEF A;  4FCY A;  3HPG A;  4FJL A;  4CGF A;  4N5S A;  3V4I A;  3SPZ A;  1L3U A;  4CK2 A;  2YNH A;  3TAQ A;  4CK1 A;  1BQN A;  4M45 A;  1NJX A;  1L3V A;  5E41 A;  1WSJ A;  1ZYQ A;  2VWJ A;  3QNN A;  1Q9X A;  4FJI A;  3K5O A;  2HHU A;  1GOB A;  4LH5 A;  1RDA A;  4O5B A;  3NH2 A;  3HP6 A;  3SJJ A;  1XC9 A;  2Z1J A;  1U4B A;  1BIS A;  3T1A A;  1N5Y A;  1LW2 A;  4FM2 A;  4DU1 A;  4ELU A;  3MXM A;  1C6V A;  1L5U A;  3SUO A;  1BHL A;  4CF8 A;  4KB0 A;  3SI6 A;  4BDY A;  5FDL A;  3ZT1 A;  1VSL A;  2O4G A;  3OJS A;  1EP4 A;  4J2E A;  3IG1 A;  4FJN A;  4EZ9 A;  2KZZ A;  3EY1 A;  1EXQ A;  5I3U A;  3KLG A;  2KZM A;  4E7J A;  4Z4F A;  2DY4 A;  2HHX A;  1LAV A;  5SZT A;  3DM2 A;  1QE1 A;  1HRH A;  1TL1 A;  2YKM A;  3M8R A;  5CZ2 A;  4DSF A;  1D8Y A;  4E7L A;  1TKD A;  3JSM A;  4FLX A;  1NKC A;  3KTQ A;  1JKH A;  3MEG A;  4DSI A;  4ID1 A;  1UA1 A;  4LSL A;  2RN2 A;  3NDK A;  3CM5 A;  4FLY A;  1X1P A;  1S1W A;  4RW7 A;  4J2A A;  1TK5 A;  3HYF A;  1S9G A;  4MQ3 A;  5K14 A;  2X6N A;  3DOK A;  5J2P A;  3AVJ A;  1ASU A;  3NBP A;  2HHV A;  2G8K A;  1RTD A;  4KHQ A;  1RT4 A;  1EX4 A;  4KO0 A;  4DFJ A;  1SUQ A;  4IG0 A;  2BE2 A;  1ZBL A;  1KVC A;  2YNG A;  3G10 A;  4HTU A;  2ZE2 A;  4KRF A;  2PZS A;  4DTX A;  1TKZ A;  4E7K A;  1TKX A;  3F73 A;  1QSL A;  4DMN A;  1TAQ A;  4CGG A;  4Z4E A;  3JYT A;  4CEC A;  3QNO A;  1C0M A;  5HRS A;  4KI6 A;  4F3T A;  1ASW A;  1B9D A;  2PYL A;  1XWL A;  2HVH A;  2G8W A;  3AO2 A;  4LY7 A;  1W0H A;  4ELV A;  1RNH A;  1WN7 A;  4CJ4 A;  3BGR A;  4YFU A;  2FBV A;  3LAL A;  1KTQ A;  4AHC A;  4CHQ A;  1NKE A;  4FZX C;  1RDB A;  3V1Q A;  4M41 A;  4DSE A;  4IG3 A;  4DU4 A;  3OS1 A;  2KFN A;  1HQU A;  1S5J A;  1VSM A;  1BI4 B;  2XY8 A;  2KQ2 A;  3CM6 A;  3KK3 A;  3S3N A;  1NK5 A;  5J1E A;  2W42 A;  2RKI A;  1RT3 A;  1C1B A;  1W9H A;  4DTM A;  3QER A;  3THV A;  1HYS A;  1HJR A;  3LZJ A;  2OPQ A;  3LWM A;  4JS5 A;  2HW3 A;  1RT2 A;  2P51 A;  4KFB A;  3OYK A;  1YT3 A;  3V9Z A;  3AO4 A;  3KJV A;  1FK9 A;  1VK0 A;  4DLE A;  4DU3 A;  3VQE A;  3VQ9 A;  4W5R A;  2BDP A;  2DTU A;  1C0U A;  3RMB A;  3NGZ A;  3NF7 A;  4I2Q A;  3DLG A;  1WNS A;  5CYM A;  1SL1 A;  4DF4 A;  3QIP A;  4JRP A;  2KTQ A;  3AV9 A;  3WNG A;  3OJU A;  4E1M A;  2P5G A;  3OYM A;  3HVT A;  5HBM A;  2F96 A;  1UA0 A;  2G8H A;  1J54 A;  4M3Z A;  3AA2 A;  4CEQ A;  4CJE A;  4N47 A;  3ZSQ A;  4DF8 A;  4B9N A;  3TAF A;  1KCF A;  1JL2 A;  2HND A;  1JLA A;  2VWK A;  4F8R A;  1QTM A;  3AVH A;  4W5O A;  5SWM A;  3U3Y A;  4E1N A; 
#chains in the Genus database with same CATH topology
 4CJF A;  4A2A A;  2CGK A;  4FSV A;  4FWL A;  1HPM A;  1YJN N;  1VSJ A;  4JKE A;  2E1Y A;  1FXX A;  3GL1 A;  3DLE A;  1DTT A;  5EU7 A;  3IAY A;  3IKM A;  4HUG A;  4CJT A;  3AVB A;  2ZJR L;  4BRL A;  2HBM A;  5HRO A;  4HCB A;  2WUS A;  3LDP A;  5FRN A;  4CK3 A;  1J53 A;  4IJA A;  3E9P A;  1OH6 A;  4FZY A;  2UXC K;  4A2B A;  4F4K A;  1KD1 O;  4FLV A;  3PSI A;  3VEZ A;  4Y0W A;  4J2D A;  3RSE A;  4BRI A;  2NRX A;  4OKE A;  3TTD A;  3PX4 A;  4M3U A;  3AVC A;  2YHA A;  4JKD A;  3CJ7 A;  1WLJ A;  3VEX A;  4KHW A;  3V1R A;  1VSF A;  5E84 A;  5J2M A;  4AF1 A;  1NGH A;  4E0D A;  2E6M A;  3FZK A;  1SKR A;  1K8K A;  2A41 A;  3L2Q A;  3SUQ A;  5D3G A;  3Q7C A;  2OYQ A;  1TGO A;  4CGI A;  3SQ2 A;  2ETJ A;  3VEY A;  4DTR A;  1DT9 A;  4KTW A;  2ZF5 O;  4BC5 A;  1JLQ A;  5AZJ A;  4FXD A;  4F2S A;  3QEW A;  4C8K A;  3PX0 A;  3QEI A;  3QEP A;  1L3S A;  1VSK A;  4FWM A;  1SKS A;  4NLC A;  3CQ8 A;  4B9Q A;  3EZW A;  3J8A A;  4EIA A;  1KLM A;  1QQM A;  3K58 A;  2HHT A;  2ASP A;  3KLI A;  2E4L A;  4DS5 A;  4YOU A;  1SV5 A;  4CER A;  1A5W A;  4GW6 A;  4O8K A;  4A5A A;  3SQ4 A;  3UE5 A;  3ZSR A;  4E1J A;  3ID8 A;  4E3S A;  3H1Q A;  4BE2 A;  5AQP A;  1XMQ K;  4PKG A;  4BRE A;  3QLH A;  5F2R A;  2RF2 A;  2A6A A;  4CFC A;  2QXF A;  3THX B;  5GAH P;  4DTN A;  4CIG A;  2NUB A;  3VTI A;  4DR3 K;  4YOR A;  3QBW A;  1VAZ A;  4BRK A;  5J2Q A;  1YF5 L;  2Y1I A;  1U49 A;  3M8P A;  5KI6 A;  3LAK A;  5CHI A;  1OH8 A;  3FFK B;  4BR7 A;  5BPN A;  5F0X A;  4UQG A;  2E2O A;  2OPP A;  2UXB K;  5FLX O;  1NG9 A;  2D5R A;  3QO9 A;  1HQE A;  2X6S A;  4KHP K;  3L3U A;  3TSQ A;  3VTH A;  3C0B A;  2P9L A;  2XY7 A;  4MLE A;  4U67 L;  1N32 K;  2IVP A;  4Z4H A;  1BU6 O;  4CIE A;  4LFC K;  3C94 A;  1XMO K;  3MN5 A;  4FJ7 A;  3ASM A;  4AQY K;  1N6Q A;  4ZHR A;  1Y97 A;  3QET A;  1TV6 A;  3O8M A;  5CZ1 A;  4FJ9 A;  3ZX3 A;  1BQM A;  4CVN E;  3NGY A;  5LY3 A;  3V81 A;  1ATS A;  4H0T B;  2D0B A;  4PL8 A;  3WT0 A;  4OPJ A;  3O9R A;  4KH5 A;  4DWI A;  3KVG A;  1ILY A;  4C1N I;  5LJV A;  1HPZ A;  4KHY A;  5B8H A;  4ZTF A;  4HVJ A;  3HT3 A;  3AA4 A;  4W5T A;  3UKU B;  4FWO A;  3M3Z A;  4X64 K;  4K43 A;  1IO2 A;  1NLV A;  2ITM A;  3U8X A;  1VRU A;  2R7Y A;  3VQB A;  3SUP A;  1V4S A;  3BEX A;  4O4G A;  3CFR A;  3CIP A;  3RTV A;  3QES A;  4B9T A;  1ZBF A;  4RW4 A;  5KPT A;  3OYG A;  3S3M A;  2ZJP L;  3S41 A;  2A1R A;  4DFP A;  1E3M A;  3I0S A;  3L4Q A;  3UIQ A;  3VET A;  3BF1 A;  3TAB A;  3T19 A;  4DR4 K;  5HRN A;  2GUP A;  3OYN A;  4CHN A;  1DEJ A;  4WQ5 C;  2Q0R A;  1NGA A;  4DB3 A;  4FO0 A;  3W0L A;  2CGJ A;  2HB5 A;  2O8F A;  3CME N;  4MO5 A;  3DRP A;  5KQ8 A;  1VHX A;  1KFD A;  1NK4 A;  4CEZ A;  3AO3 A;  3V9U A;  3VEN A;  2QK9 A;  4I9L A;  1ZBS A;  4FLU A;  1TUY A;  5E26 A;  3ZSX A;  2VGM A;  4MFB A;  4Y1C A;  3CCL N;  2ZM6 K;  3VA3 A;  1IKX A;  3D7E O;  4FJJ A;  5I42 A;  1S22 A;  4KPY A;  2D4W A;  2O8C A;  4A61 A;  5DMR A;  3R3L A;  4ISF A;  2CH5 A;  4CFA A;  1T8E A;  4KV8 A;  4L8R B;  1NGE A;  2JGU A;  1MU2 A;  4BRP A;  4K8Z A;  4JHD A;  4C8M A;  1X9M A;  3O1W A;  4B1Z A;  1VQ6 N;  4J8F A;  3VF2 A;  1G15 A;  4BR2 A;  4WE1 A;  4CGD A;  1JLG A;  4OLB A;  4B3O A;  3MDQ A;  3VQA A;  3SQ1 A;  4LH4 A;  3QIC A;  1N36 K;  3R9P A;  2E2P A;  2XO7 A;  2HMP A;  4CJL A;  4B9V A;  3AA3 A;  3NF8 A;  1OH7 A;  1Z26 A;  1Z6R A;  2D0O A;  1HMV A;  3CCR N;  3SZ2 A;  4DQI A;  4B9S A;  2GUI A;  3VMF B;  4DV7 K;  3WXM B;  4WCE L;  1D9F A;  1IG9 A;  4BDZ A;  1KAY A;  4DTP A;  1BIU A;  3MCP A;  4OKK A;  5HRR A;  2ZWH A;  3AVG A;  5EVZ A;  3AA5 X;  2E2Q A;  4CHO A;  1CXQ A;  5KRS A;  4RW9 A;  3QEX A;  2NRT A;  3SAH A;  4OLA A;  4FCY A;  4FJL A;  2D0P A;  3SPZ A;  1VQP N;  1L3U A;  2HHH K;  3TAQ A;  1NJX A;  3BY5 A;  1WSJ A;  1ZYQ A;  2VWJ A;  1Q9X A;  4LH5 A;  3HP6 A;  1RDA A;  3SJJ A;  1BIS A;  1LW2 A;  3U9Z A;  1C6V A;  2GWJ A;  1VSL A;  1EP4 A;  4FJN A;  4EZ9 A;  2KZZ A;  3EY1 A;  5I3U A;  2GEM A;  2W6K A;  1WOQ A;  2HHX A;  5LMN K;  5SZT A;  1HRH A;  3GG4 A;  2FSJ A;  4BRN A;  1JKH A;  1J5E K;  4WF9 L;  4LSL A;  3QFP A;  3CM5 A;  2QA4 N;  1S1W A;  1TK5 A;  1HR0 K;  1S9G A;  3CXC M;  2VWB A;  2BTF A;  4NXN K;  1VQ8 N;  2A42 A;  4EFH A;  1JCF A;  1KAX A;  4FWP A;  1SUQ A;  5C0Y A;  1GLA G;  2YNG A;  4HTU A;  2ZE2 A;  1QSL A;  1TKX A;  1T6C A;  4FOI A;  3F73 A;  1ESV A;  4DMN A;  1TAQ A;  1BWF O;  3IFR A;  1YUW A;  4C1N K;  4CGG A;  3J7Z O;  1Q7Y O;  3JYT A;  3QNO A;  4KI6 A;  2I7P A;  3ID6 A;  1B9D A;  4IOC L;  1XWL A;  4LY7 A;  1W0H A;  4YFU A;  4AHC A;  1NKE A;  3CJC A;  3V1Q A;  4IG3 A;  1ATR A;  4JKB A;  1HQU A;  1S5J A;  1VSM A;  2XY8 A;  1NK5 A;  4FJK A;  1W9H A;  1HUX A;  1I94 K;  3LWM A;  4JS5 A;  3BZK A;  3ZX0 A;  3AO4 A;  4DU3 A;  4A62 A;  4JKG A;  2P9S A;  3J7Y P;  4CBW A;  3OJU A;  3F5T A;  2NRH A;  4FWS A;  5HBM A;  3AA2 A;  5FPM A;  4F8R A;  1KCF A;  2QXL A;  1VQM N;  1NK8 A;  3U3Y A;  4KH4 A;  2GV9 A;  3K57 A;  2W6L A;  5JS2 A;  3ULE A;  1YJ9 N;  2QKK A;  4IBN A;  2OPS A;  3IDH A;  3IRX A;  5DK5 A;  4HHT A;  2W41 A;  2P9K B;  2P9I B;  5EX5 A;  3LP2 A;  4JI2 K;  4AHS A;  1D9D A;  2Q36 A;  4ILJ A;  1SAZ A;  4B9M A;  1QQC A;  1S72 N;  1A5X A;  1EWR A;  5HL7 L;  2QWM A;  3KD5 E;  5KGW A;  1REV A;  1K6Y A;  4XH5 A;  1T6D A;  1RCH A;  3OBW A;  2HHQ A;  4JI1 K;  1LWE A;  4B8A B;  3T69 A;  3NAE A;  1X3M A;  2LSN A;  4B08 A;  1QHA A;  4HUE A;  4N41 A;  1IH7 A;  4K8X A;  4KRE A;  2E1Z A;  4DV2 K;  1WSI A;  3FFI A;  3SCX A;  4C8L A;  2YHX A;  1UWB A;  1JCE A;  5CY4 A;  3O1B A;  4FK2 A;  4RG8 A;  4DV1 K;  3R8E A;  3VF4 A;  3WNF A;  3B6P A;  3EL2 A;  2A1S A;  5AQG A;  2QWN A;  5JVH L;  4DUY K;  4JV5 K;  1ITG A;  3QBX A;  5DM7 L;  3C7N A;  1TYQ A;  5FRM A;  5FRO A;  2I7N A;  4FL9 A;  2QWO A;  4B3S K;  3VEO A;  4CJR A;  2YJE A;  4FJM A;  1NGG A;  3O4Q A;  2RE2 A;  2Z1G A;  3GDQ A;  3G0Z A;  1NMD A;  1J9A A;  1Q82 O;  4IFV A;  4B9U A;  3AVL A;  1Q81 O;  1ZBH A;  1NBW A;  4K42 A;  4LF4 K;  1WSF A;  2D0A A;  3J80 O;  4CEB A;  3KD1 E;  3SUN A;  4L3Q A;  2FBX A;  1SS6 A;  3HO1 A;  4XIU A;  4OGE A;  2DFH A;  4CD3 A;  5KPZ A;  1N33 K;  1NKB A;  1X9S A;  1GLJ O;  5BRF A;  4FYD A;  1ZBI A;  3HRG A;  4QCL A;  2NRZ A;  3ZSY A;  3TR8 A;  3LZI A;  3M8Q A;  1JXE A;  3TI0 A;  4J2B A;  4EZ6 A;  1IBM K;  5M1O A;  2YNF A;  5AQI A;  3ZT2 A;  3RVC A;  1NJZ A;  2HHS A;  1BG3 A;  3LPU A;  3AVF A;  2BGG A;  5EOY A;  4CF1 A;  3V9S A;  1XUP O;  2G8U A;  3EO3 A;  3SLC A;  3VEV A;  3MEE A;  3KLH A;  5AQS A;  3V9X A;  2UUC K;  3CHW A;  4RW6 A;  4PQU A;  3DLH A;  3MX2 A;  3VQ6 A;  3I55 N;  1SL0 A;  2F8T A;  2QWQ A;  3AGK A;  4BDP A;  1FKO A;  2GTD A;  2JLE A;  4ID5 A;  3NF6 A;  4XEI A;  3VQP A;  1C1A A;  1BDG A;  4IJN A;  2IOC A;  4CJ5 A;  2X78 A;  4JI6 K;  2VG5 A;  3O80 A;  4CIF A;  2QI2 A;  3CET A;  3VES A;  3WNH A;  4FW2 A;  4FM0 A;  3A5M C;  4FJH A;  3C6U A;  3SPY A;  3NHG A;  5AZI A;  4I9Q A;  3K5N A;  3O9S A;  4BVO A;  1YXQ A;  3QFU A;  3HVR A;  1DTQ A;  4CHY A;  3ZSW A;  2V51 B;  1GOC A;  1CZB A;  4F2R A;  3DRS A;  1XI1 A;  1WBB A;  3C95 A;  1YTU A;  1VRT A;  1RDD A;  1O13 A;  4RTF D;  2ZGY A;  3SQ0 A;  1Q8I A;  4KTQ A;  4HTL A;  1VQL N;  3LDN A;  4DV4 K;  4DSL A;  3QIN A;  4BRH A;  4ILG B;  1L3T A;  3AO1 A;  3ENH A;  4QAG A;  5T7B A;  2A3Z A;  1HKG A;  1A5V A;  3D2F B;  3A5N C;  1RT5 A;  4I6M A;  1MA9 B;  5AQJ A;  3E01 A;  1HX1 A;  2KHO A;  2Q2R A;  4DTO A;  2O4I A;  4IEE A;  3AVM A;  4BRA A;  5BPM A;  3WXL A;  3EYZ A;  1JXB A;  1ASV A;  3NVM A;  3KKS A;  3MN9 A;  3W3D A;  2YI1 A;  1GLB G;  3ZET A;  1F21 A;  3SBT A;  5CE3 A;  3NGI A;  3H3N O;  4M7X A;  1BCO A;  5AQM A;  4H8K A;  3VQQ A;  3V1O A;  4CEO A;  1SL2 A;  1WBD A;  1MWK A;  4DQS A;  5JLF A;  3L2U A;  1SQK A;  4DHY A;  1JL1 A;  3VQ8 A;  1W2B M;  3SV4 A;  1VQN N;  2KLA A;  1RBS A;  4FJX A;  3PIO L;  1YJW N;  4KHU A;  4DS4 A;  1RGI A;  4OJR A;  4FLW A;  3VQ5 A;  1KLN A;  3BP8 A;  1SZ2 A;  4JKG B;  5C42 A;  4Y1D A;  4V19 S;  2P9S B;  5KGX A;  3LWL A;  2A40 A;  5AFU H;  1RT7 A;  2IS3 A;  2YKN A;  3OVN A;  1RBT A;  3HZ6 A;  3PIP L;  1W97 L;  1NK6 A;  4BRM A;  4CJ7 A;  4X66 K;  4M3Y A;  4LC9 B;  2OZM A;  2F4V K;  1CZ9 A;  4KB1 A;  2BUP A;  4CGJ A;  3ULE B;  4PKI A;  3TAE A;  3TTC A;  2F9T A;  3WUH A;  4YDU A;  2GWK A;  4MO4 A;  4Z4I A;  4LF9 K;  3A0I X;  4E7H A;  1RTH A;  4GNI A;  1JLE A;  4FJ8 A;  3O3H A;  4LF8 K;  4JYA K;  4CHZ A;  3AAQ A;  2QTD A;  5ADX A;  4DTS A;  3WXK A;  1YAG A;  3ATU A;  5IWA K;  2P9N B;  4DG1 A;  3L2W A;  5DM6 L;  1ATN A;  5IT9 O;  4OKJ A;  5AQZ A;  1WSG A;  3ZYY X;  3SAF A;  1S1U A;  3KLE A;  4Z4G A;  3LAN A;  4DV6 K;  4OVL A;  1IBK K;  4O44 A;  4M3W A;  1X9W A;  2IIR A;  1KSP A;  3DJC A;  3TTF A;  1G99 A;  3Q7B A;  1RBU A;  3MAQ A;  3PO4 A;  2YHB A;  3EE9 A;  3EE8 A;  2P9K A;  2P9I A;  3KWG A;  2FSK A;  3O5B A;  2EX3 A;  1GLF O;  1ZBU A;  3LM2 A;  5EXW A;  3PX6 A;  1C1C A;  1VSH A;  4CEF A;  3CCJ N;  4CK1 A;  1BQN A;  3K9K A;  4M45 A;  5E41 A;  2EWS A;  3QNN A;  3DXM A;  3C7N B;  1TYQ B;  1GOB A;  3DWL A;  4O5B A;  1U4B A;  1M90 O;  2YCH A;  4DU1 A;  5FPD A;  4ELU A;  1NGI A;  3SUO A;  1BHL A;  2NRW A;  4CF8 A;  3CPE A;  4BDY A;  3IG1 A;  2D1K A;  2KZM A;  3L0Q A;  1XC3 A;  2DY4 A;  1LAV A;  2V7Y A;  3E9O A;  5AQT A;  4DV5 K;  4DSF A;  4GV6 A;  5CZ2 A;  1TKD A;  3JSM A;  4DSI A;  1NKC A;  3PSF A;  4OPH A;  3TSP A;  5A2Q O;  2E2N A;  4UY8 O;  1QZ6 A;  4MQ3 A;  1ASU A;  3NBP A;  4ILH A;  5C2F A;  4IO9 L;  3I56 N;  2BE2 A;  1ZBL A;  2PZS A;  1YI2 N;  3LM9 A;  1C0M A;  2QWP A;  2G8W A;  4ELV A;  4O8U A;  2V7Z A;  4CHQ A;  4GVE A;  4BR0 A;  4FZX C;  4DSE A;  4M41 A;  2VQE K;  4DU4 A;  3OS1 A;  3C6H A;  1BI4 B;  5HOO A;  2KQ2 A;  3KK3 A;  3CI5 A;  2W42 A;  5FPN A;  1H1V A;  4DTM A;  3THV A;  1HYS A;  5AR0 A;  1HJR A;  2E20 A;  1NWK A;  3DLL L;  2O8E B;  3GOI A;  1GLD G;  3K9J A;  1FK9 A;  2QW9 A;  1HLU A;  3G4S N;  4M7Y A;  1BO5 O;  4WFB L;  1P90 A;  4WQ4 C;  3THW A;  3CPW M;  3NGZ A;  3NF7 A;  4I2Q A;  3DLG A;  2KTQ A;  3WNG A;  4NLB A;  3OYM A;  5AQH A;  1UA0 A;  2G8H A;  1J54 A;  1VQ9 N;  3CC7 N;  4PKH A;  3ZX2 A;  4B9N A;  4FJI A;  1JL2 A;  3HSC A;  1NMN A;  1RDU A;  4E1N A;  4G1Q A;  5AZI B;  4FM1 A;  2ZD1 A;  4FJ5 A;  4NYF A;  2O8B B;  4DLG A;  1QZ5 A;  2EHG A;  4B1U B;  4GV9 A;  4HUF A;  2IDO A;  1U2V A;  5LMU K;  4BWJ A;  3OYD A;  5C2D A;  2HF4 A;  4AHR A;  3SYZ A;  3PO5 A;  1IKV A;  3OW2 M;  2F8S A;  3U3G A;  3MN7 A;  3D2E A;  3D6R A;  5KPR A;  4BRQ A;  1K73 O;  3L2V A;  3O9Q A;  2G8I A;  2OTL N;  4JLH A;  3EZ5 A;  5M1P A;  4IEI A;  3ZT3 A;  1NGJ A;  3VQ4 A;  2FXU A;  3O4N A;  1WAJ A;  1GLE G;  1TL3 A;  3A2F A;  1NOY A;  1K9M O;  3RRG A;  4EHU A;  1JLC A;  2WON A;  4JRQ A;  1HYV A;  2HF3 A;  4H5T A;  3OS0 A;  5C10 A;  4I6M B;  2NZT A;  4DTU A;  1QQN A;  3VN5 A;  3L2R A;  1BUP A;  3DLB A;  3LDQ A;  5GAE P;  3KZB A;  4CGH A;  4M3R A;  2O8D B;  2E8A A;  3C6A A;  3O4W A;  3TAP A;  4PUO A;  3ISN C;  4YNQ A;  2Y1J A;  4LF6 K;  5I9E B;  3CCE N;  2HNY A;  5BN8 A;  3P31 A;  4WQ5 A;  4IZ9 A;  3O3F A;  4FWK A;  3ZET B;  4JK9 A;  5AQU A;  2RHK A;  4CFB A;  1RDC A;  2Q3S A;  2YHY A;  5AQF A;  2QM1 A;  1QSS A;  3CMA N;  4CJK A;  3D2F A;  3TU5 A;  4GV3 A;  2G8F A;  2WFB A;  4H5W A;  5J2N A;  3HOS A;  1RBR A;  1S1X A;  4DV3 K;  4JI3 K;  4RW8 A;  4IFY A;  3LP0 A;  3ZEU B;  4JKF A;  2B4J A;  4BC3 A;  5MLC Q;  1VQ7 N;  4JK7 A;  1EET A;  4CES A;  4B9L A;  2Z1H A;  4BC2 A;  3G25 A;  1BOT O;  5AJ3 K;  3MXJ A;  4O55 A;  1GLL O;  2FF3 B;  3CER A;  3HST B;  3D45 A;  4DQQ A;  4KI4 A;  3OYJ A;  2VG6 A;  1K8A O;  1NNE A;  3MN6 A;  3VF6 A;  1U48 A;  4M3T A;  1ZXO A;  1TKT A;  2DPN A;  3CCS N;  3VA0 A;  1XNR K;  1U6Z A;  5CYQ A;  1SKW A;  1YHQ N;  1IKY A;  3RMA A;  3QML A;  3DLK A;  4DUZ K;  3ATV A;  1FKP A;  2X74 A;  3H3O B;  1JLF A;  1Q86 O;  3OS2 A;  5JS1 A;  3CF5 L;  4X65 K;  2GEL A;  2VYP A;  5BRH A;  1XNQ K;  4GKK K;  1WB9 A;  1CLQ A;  1UOC A;  4PWD A;  3QDK A;  3AVN A;  3KK7 A;  4NXM K;  2VG7 A;  4GVM A;  1HKB A;  2F9W A;  5JLH A;  1XQS C;  4YOX A;  4BRF A;  3PV8 A;  3G71 N;  3I0R A;  3MEC A;  4PY5 A;  4N76 A;  4BY9 C;  4E19 A;  3KIO A;  4DR5 K;  1BCM A;  4CEE A;  1QHT A;  1S1T A;  2Q31 A;  3AAR A;  4CZH A;  4KAZ A;  3J7A P;  4Z0U A;  1BA1 A;  3SMP A;  1E4F T;  3U4L A;  4CZM A;  5LL6 Z;  3C6T A;  3H46 O;  2P5O A;  1RDW X;  4FVU A;  3L4I A;  3HXM A;  4JEP A;  3HTV A;  3NVK A;  2P9N A;  3EKU A;  1FW6 A;  3DXM B;  2CH6 A;  1N34 K;  4RCH A;  3HPO A;  1IKW A;  3OYA A;  4MLH A;  3MED A;  1RTJ A;  4CJW A;  3ALY A;  3B6O A;  4R79 A;  4M42 A;  4LF7 K;  3CG7 A;  1Y64 A;  4CEA A;  4CW7 B;  4CD1 A;  4IFE A;  2FBT A;  3CCM N;  1S9E A;  1MDU B;  5BPL A;  3FZL A;  1T7P A;  3F9K A;  4W5Q A;  3VOV A;  1YTA A;  4B3R K;  4BG8 A;  3CD6 N;  4B1W B;  4DQ8 A;  2VCP A;  3CQY A;  3ENO A;  3MXI A;  4JD2 B;  2FBY A;  1BL3 A;  3AO5 A;  2XY6 A;  4I7F A;  2V52 B;  4AHU A;  4E89 A;  2YV0 X;  4B3T K;  4BRD A;  2PFU A;  4BR9 A;  1C0T A;  4JAX A;  3P83 D;  4AHV A;  4CHP A;  4CF2 A;  4IDK A;  4AM6 A;  1VQ4 N;  4CJV A;  3BDP A;  1QS4 A;  3LAM A;  4CZJ A;  5AQR A;  4K41 A;  3HL8 A;  4DV0 K;  1QSY A;  3IUC A;  1GOA A;  4NYN A;  4LF5 K;  4B8C A;  1UAX A;  2DFE A;  4O0J A;  4CJ3 A;  4FW1 A;  3VQD A;  4B1V A;  4IOX A;  3QIO A;  1R0A A;  3ZLJ A;  3UKR B;  1VQ5 N;  1C0G A;  1B92 A;  2ZGZ A;  3ZSO A;  4JS4 A;  3ZSV A;  5M1K A;  3DRR A;  3NF9 A;  3HBT A;  1QVG M;  2PAV A;  3THW B;  5AQV A;  1OH5 A;  3CJA A;  2GBZ A;  1TVR A;  1LAW A;  2WTU A;  3CJ9 A;  3LDS A;  3NMU A;  1HKC A;  5GAG P;  4FLZ A;  3HOT A;  4O5F A;  3HPH A;  4DQR A;  2HBL A;  3FZM A;  3S3O A;  1HNW K;  3DXK B;  4JI7 K;  3M8S A;  3T1Y K;  1BI4 A;  5M1Q A;  2B6A A;  3AVK A;  3JAM O;  1HNZ K;  4LSN A;  1S3X A;  4GY2 B;  2O8E A;  1U2V B;  3NE6 A;  2PY5 A;  4IO8 A;  2UUB K;  1KVA A;  4BG9 A;  1X9J A;  3J81 O;  1RTI A;  1HNI A;  2A5X A;  3D2E B;  4C8N A;  4LD0 A;  5ADX H;  1YVU A;  3ULD A;  2KW4 A;  4ISE A;  1DKG D;  5C25 A;  4GMJ B;  4JKA A;  1BIZ A;  3EEQ A;  4X62 K;  2JWL A;  1NK7 A;  4EHT A;  4BE0 A;  1B9F A;  3SV3 A;  2CGL A;  1N8R O;  3K59 A;  4QS9 A;  2FF6 A;  4H0P A;  3MWP A;  3K5M A;  4YDU C;  3A8Y A;  2O8B A;  2IAJ A;  4CZL A;  1DGK N;  4AM7 A;  3TAM A;  2NRV A;  4ELT A;  1BGX T;  2G8V A;  2VQF K;  4YHH K;  3HJF A;  3HPG A;  4CK2 A;  5KQD A;  1L3V A;  3K5O A;  3MMV A;  3NH2 A;  1W7A A;  4NB4 A;  4FM2 A;  3KWI A;  2ZJQ L;  1L5U A;  5F1X A;  4KB0 A;  3VGM A;  5FDL A;  3ZT1 A;  4H5N A;  2O4G A;  4BRO A;  3OJS A;  1OVY A;  4A57 A;  2W40 A;  2AP1 A;  2O8D A;  2GX9 A;  1EXQ A;  1IJJ A;  3SMS A;  4E7J A;  4Z4F A;  2QEX N;  4BRG A;  2ASM A;  1QE1 A;  2YKM A;  3A5O C;  3M8R A;  1D8Y A;  4WFA L;  3KTQ A;  4PHT X;  4ID1 A;  1UA1 A;  4J2A A;  4PL7 A;  4RW7 A;  4BGB A;  3HYF A;  3DOK A;  2BH1 A;  2HHV A;  4KHQ A;  1NGC A;  2VGN A;  4DFJ A;  3N4P A;  1KVC A;  3G10 A;  1TKZ A;  4E7K A;  3WEE B;  4FWN A;  1NJI O;  4ISG A;  3CQX A;  3H6E A;  4CEC A;  3ZEU A;  5HRS A;  1ASW A;  1KXP A;  2HVH A;  3AO2 A;  3H1V X;  5AQW A;  4BR4 A;  3E1Y A;  4CJ4 A;  1KTQ A;  5AQX A;  1V4T A;  3IMX A;  1IBL K;  5GIO A;  1IG8 A;  4FPB A;  4H5R A;  4QS7 A;  4CZG A;  2F7T A;  5GIP A;  4LFA K;  3S3N A;  5J1E A;  2RKI A;  1C1B A;  1Z05 A;  2OPQ A;  2HW3 A;  1RT2 A;  3O08 A;  5JMV A;  4DCH A;  3OYK A;  1YT3 A;  3V9Z A;  3KJV A;  1VK0 A;  4DLE A;  4W5R A;  2BDP A;  3KHY A;  3THY B;  1C0U A;  3RMB A;  1VQO N;  3M1F A;  1WNS A;  2OCE A;  5CYM A;  3L6Q A;  3QIP A;  4JRP A;  3AV9 A;  4E1M A;  2P5G A;  3HVT A;  2F96 A;  1OVQ A;  2E88 A;  4M3Z A;  4CJE A;  4N47 A;  4GKJ K;  3TAF A;  2E5L K;  3AVH A;  4W5O A;  5SWM A;  2P9P B;  3L8B A;  2PYJ A;  2B5J A;  2QWL A;  4DR6 K;  4EP5 A;  4NCB A;  4BQL A;  2D0C A;  3FR0 A;  1WSE A;  3T3F A;  3RRH A;  4E7I A;  3TSU A;  4BE1 A;  3VQC A;  2HHU A;  5ELZ A;  4OPA A;  3ZSZ A;  3KK2 A;  4C8O A;  1DLO A;  4M3X A;  3P39 A;  3R1X A;  3JXU A;  4EP4 A;  3RR7 A;  1X3N A;  2HMI A;  4H4M A;  3FGU A;  3BZC A;  3LP3 A;  1WSH A;  3JS6 A;  3PLA A;  4DFK A;  2AJQ A;  1HNV A;  1LV5 A;  3M6G A;  1QVF M;  2YJF A;  4MDA A;  3VER A;  1I39 A;  2NLX A;  1HYZ A;  3HI0 A;  1FJG K;  2P9U B;  3MX5 A;  3K0S A;  4BRC A;  4FJG A;  3HP9 A;  3HK2 A;  1YIJ N;  4CZE A;  3CJ1 A;  1TAU A;  4DFM A;  3CC4 N;  3V6D A;  3OYL A;  5BN9 A;  3IS9 A;  1R59 O;  4WYB A;  4FPA A;  1JLB A;  4AHT A;  3P5J A;  1RFQ A;  5GIN A;  3TAR A;  4YOY A;  4DR1 K;  1U45 A;  3NFA A;  1O1W A;  1U04 A;  1WUA A;  1P8Z A;  2YHW A;  5TKY A;  4CFD A;  4Q0B A;  3WXI A;  2OA8 A;  3M5R A;  1NK0 A;  4JD2 A;  1TK0 A;  4LFB K;  4IKF A;  3O3G A;  1Q9Y A;  1D4X A;  4CF0 A;  1OKJ A;  4HCC A;  1LCU A;  4CJQ A;  4NO7 A;  4OGC A;  4YOW A;  5LJW A;  3CYM A;  3OYE A;  1T05 A;  3NH1 A;  1EWQ A;  1XHX A;  3UB5 A;  3WNE A;  4G9Z A;  3K2P A;  1J6Z A;  1E4G T;  2H3G X;  3FLC O;  2OTJ N;  1NOZ A;  3TAG A;  4XH1 A;  1VQK N;  4IDH A;  5GAD P;  4NCA A;  4AIL C;  3UKR A;  1TUU A;  4FWR A;  3G6E N;  4CBX A;  4AH9 A;  3MK6 A;  4CCH A;  2PBD A;  3AAP A;  4U7B A;  1RT1 A;  1S6P A;  5BRE A;  4MDB A;  4CE9 A;  3OA9 A;  4JKC A;  5AFU A;  4EAH D;  2FLO A;  2HST A;  1M1K O;  4KHN A;  3H08 A;  4FZZ A;  3O6W A;  3LDO A;  5AQO A;  3DYA A;  2E6L A;  4JI4 K;  4A59 A;  2XHB A;  3ZT4 A;  2XRI A;  4DSK A;  5AQQ A;  3ENB A;  2Z1I A;  2BAN A;  3CCQ N;  3U6F A;  1VSE A;  1Q18 A;  5KRT A;  5AQL A;  3DXK A;  4CED A;  3OYH A;  1T3V A;  1LOT B;  4FLT A;  3FE1 A;  3AVI A;  3FZF A;  5KTQ A;  3PUF A;  3LP1 A;  1QQO A;  1NU0 A;  3VQ7 A;  3ITH A;  4FOE A;  2KKZ A;  2QWR A;  1NJW A;  4OPK A;  3OYI A;  1LWF A;  1NGF A;  4BR5 A;  1U47 A;  3OTO K;  5C15 A;  4FWQ A;  1NK9 A;  1EKE A;  4JI5 K;  3BUZ B;  3O9T A;  4KH6 A;  4YY3 K;  2OPR A;  3HM9 A;  4H0V B;  5BR8 K;  1KFS A;  2OZS A;  3OYB A;  3CCU N;  5AQK A;  5C12 A;  4QOZ B;  1NGB A;  3MCA B;  5HP1 A;  4JNE A;  1WAF A;  3RSE B;  2UUA K;  2OAN A;  3L3V A;  3RWU A;  1YIT N;  3DOL A;  2DFF A;  3FZH A;  3OYC A;  3CFO A;  4W5N A;  4H5V A;  4KHS A;  1LW0 A;  4H03 B;  2UXD K;  3SBG A;  3TWH A;  1LWC A;  2HNZ A;  1C0F A;  4B1X B;  1K8K B;  4M63 C;  3RR8 A;  3LPT A;  2Q0U A;  4NCG A;  4PA1 A;  3P1G A;  3N4Q A;  1EO1 A;  3RMC A;  2YX6 A;  2RPI A;  3HM8 A;  3OHR A;  3WXJ A;  2QKB A;  1XHZ A;  3E9L A;  5AZJ B;  4KBO A;  2HVI A;  2HHW A;  1KVB A;  4F3O A;  1T03 A;  4BVP A;  4ICL A;  1D5A A;  4BC4 A;  4BWM A;  5C24 A;  4YOV A;  4KKO A;  3KLF A;  4C23 A;  5M1N A;  3DMJ A;  4Q5V A;  2ITG A;  4CBU A;  3AVA A;  3WQU A;  2ATQ A;  3PY8 A;  2JWK A;  2XY5 A;  4KTZ A;  3SNN A;  5HLF A;  4HWI A;  2WBN A;  5BR9 A;  3QB0 A;  1YVN A;  3SK3 A;  3I8D A;  4CF9 A;  4WQ4 A;  2KFZ A;  3WEE A;  4ZTJ A;  4FK0 A;  5FPE A;  4F9O A;  3F9M A;  4H0O A;  3CFP A;  2WOM A;  4DTJ A;  4CJU A;  3MWT A;  4XH4 A;  1BA0 A;  1VSI A;  3V9W A;  4FK4 A;  1GLC G;  5HRP A;  3KKR A;  4DQP A;  3NH0 A;  3KK1 A;  3ZCM A;  4IOA L;  1S1V A;  4I2P A;  3S9H A;  3H45 C;  1CXU A;  4R5P A;  4Z4C A;  2YNI A;  3NCI A;  4CZF A;  5JIC A;  1RIL A;  3OYF A;  3D0P A;  4H0Y B;  3VGK A;  4OX9 K;  3AGR A;  1RT6 A;  3B8A X;  3THY A;  1NJY A;  1CZA N;  2FC0 A;  1NM1 A;  2ASO A;  2P1J A;  3A5L C;  1NGD A;  4FVM A;  4DSJ A;  2P9L B;  3LDL A;  3DLR A;  2HBK A;  3THX A;  3TAN A;  4TSX A;  3ZT0 A;  1KAZ A;  2NNW A;  1JJ2 M;  4CJP A;  1TK8 A;  2UU9 K;  4H4O A;  4CI6 A;  5AQY A;  4DKW A;  3P38 A;  1KRP A;  3RMD A;  4JI8 K;  2ZQB A;  2P9P A;  5AQN A;  2I5J A;  2Q97 A;  3DI6 A;  3OY9 A;  3E66 A;  2UYT A;  4BAC A;  1VSD A;  1I3A A;  2IC3 A;  3OBY A;  3VEW A;  3EN9 A;  2FSN A;  1J5O A;  4DR7 K;  4JN4 A;  3F2K A;  4O0I A;  1S6Q A;  4WFN L;  1RBV A;  4B3M K;  1Z25 A;  4CJS A;  4N56 A;  3QEV A;  1HNX K;  3AY9 A;  5M1F A;  2IGI A;  3K5L A;  4RWT A;  4IWV A;  4H0X B;  4CGF A;  4N5S A;  3V4I A;  2YNH A;  2G8K A;  4K25 A;  4Z94 A;  4A5B A;  2WC9 A;  4QS8 A;  3P4I A;  1XC9 A;  2Z1J A;  4CZK A;  3T1A A;  1N5Y A;  2J4R A;  3MXM A;  3WQT A;  5TKW A;  3SI6 A;  4J2E A;  4K0K K;  4YOT A;  5CR4 A;  1T44 A;  2P9U A;  4BQZ A;  3C65 A;  3KLG A;  1KC8 O;  3GE1 A;  3DM2 A;  2HBJ A;  1TL1 A;  4DR2 K;  3VPZ A;  4E7L A;  4FLX A;  3UKU A;  3MEG A;  2NRR A;  3VGL A;  2RN2 A;  3T1H K;  3I8B A;  3CJB A;  3NDK A;  4FLY A;  1X1P A;  3CCV N;  2HOE A;  1ZC6 A;  5K14 A;  2X6N A;  5J2P A;  2O8F B;  3AVJ A;  1RTD A;  1RT4 A;  1EX4 A;  5H1S Q;  4KO0 A;  4IG0 A;  4KRF A;  4DTX A;  2IVO A;  4Z4E A;  4JK8 A;  1KQS M;  4F3T A;  3EKS A;  1JCG A;  2PYL A;  2Q1N A;  4JKH A;  1RNH A;  5BRD A;  1WN7 A;  2AA4 A;  4CZI A;  3BGR A;  3CC2 N;  2FBV A;  3LAL A;  4B1Y B;  4BGA A;  1EQY A;  1RDB A;  2O8C B;  3GBT A;  1IV0 A;  3U9D A;  3LL3 A;  2KFN A;  3CM6 A;  1RT3 A;  3TPQ A;  3QER A;  4JHD B;  5EY4 A;  3LZJ A;  2P51 A;  4KFB A;  1HJO A;  3SJH A;  3VQE A;  3VQ9 A;  2DTU A;  2IVN A;  3T7Z A;  1SL1 A;  4DF4 A;  4JI0 K;  3I33 A;  3DAW A;  3BF3 A;  3SAG A;  4IXC A;  4CEQ A;  4DF8 A;  3O9U A;  3ZSQ A;  4OO1 J;  2HND A;  2VWK A;  1JLA A;  3R6M A;  5JVG L;  1QTM A;  1MWM A; 
#chains in the Genus database with same CATH homology
 4CJF A;  2GV9 A;  3K57 A;  2B5J A;  3L8B A;  4G1Q A;  2PYJ A;  4EP5 A;  4NCB A;  4FM1 A;  5JS2 A;  2ZD1 A;  2QKK A;  4FJ5 A;  2D0C A;  4NYF A;  4IBN A;  2OPS A;  3IRX A;  5DK5 A;  4HHT A;  1VSJ A;  1WSE A;  4DLG A;  3T3F A;  2EHG A;  4HUF A;  1FXX A;  3RRH A;  2IDO A;  4E7I A;  3DLE A;  4BWJ A;  3OYD A;  3LP2 A;  4AHR A;  4AHS A;  3VQC A;  4BE1 A;  1IKV A;  3SYZ A;  1D9D A;  1DTT A;  1QQC A;  5EU7 A;  3U3G A;  4B9M A;  3IAY A;  2F8S A;  1A5X A;  3KD5 E;  3ZSZ A;  3KK2 A;  4HUG A;  5KGW A;  4C8O A;  1DLO A;  4CJT A;  4M3X A;  3AVB A;  1REV A;  3L2V A;  1K6Y A;  2G8I A;  4EP4 A;  1RCH A;  3RR7 A;  2HHQ A;  4JLH A;  3EZ5 A;  2HMI A;  4H4M A;  5HRO A;  3ZT3 A;  4HCB A;  1LWE A;  4B8A B;  3VQ4 A;  5FRN A;  4CK3 A;  3LP3 A;  1J53 A;  3NAE A;  3O4N A;  1WSH A;  1WAJ A;  1TL3 A;  3A2F A;  4DFK A;  1NOY A;  2AJQ A;  1HNV A;  2LSN A;  4B08 A;  3RRG A;  4FZY A;  1JLC A;  2WON A;  4JRQ A;  1LV5 A;  1HYV A;  3OS0 A;  4HUE A;  4N41 A;  1IH7 A;  4K8X A;  4F4K A;  4DTU A;  3VN5 A;  4FLV A;  4KRE A;  3L2R A;  3DLB A;  4J2D A;  1I39 A;  1HYZ A;  4CGH A;  1WSI A;  3FFI A;  4M3R A;  3SCX A;  4C8L A;  4OKE A;  3TAP A;  4FJG A;  1UWB A;  4PUO A;  3PX4 A;  4M3U A;  3AVC A;  2YHA A;  3ISN C;  3HP9 A;  5CY4 A;  4YNQ A;  2Y1J A;  1WLJ A;  3HK2 A;  4KHW A;  4FK2 A;  3V1R A;  2HNY A;  4RG8 A;  1TAU A;  1VSF A;  3WNF A;  3B6P A;  4DFM A;  5J2M A;  2A1S A;  3V6D A;  3O3F A;  3OYL A;  4E0D A;  2E6M A;  1ITG A;  3IS9 A;  1SKR A;  4CFB A;  1JLB A;  4AHT A;  5FRM A;  5FRO A;  1RDC A;  2Q3S A;  3P5J A;  3L2Q A;  3SUQ A;  5D3G A;  3TAR A;  1QSS A;  4CJR A;  4CJK A;  1U45 A;  2OYQ A;  1TGO A;  3NFA A;  4CGI A;  3SQ2 A;  4FJM A;  1O1W A;  2ETJ A;  1U04 A;  4DTR A;  2G8F A;  3O4Q A;  5J2N A;  2Z1G A;  1RBR A;  3G0Z A;  1S1X A;  4KTW A;  4CFD A;  4Q0B A;  1J9A A;  1JLQ A;  4RW8 A;  4IFV A;  4FXD A;  2OA8 A;  4B9U A;  4F2S A;  4IFY A;  3QEW A;  1TK0 A;  3AVL A;  1NK0 A;  3LP0 A;  4C8K A;  3O3G A;  1Q9Y A;  4IKF A;  1ZBH A;  2B4J A;  4CF0 A;  4HCC A;  3PX0 A;  4CJQ A;  3QEI A;  1EET A;  4OGC A;  4CES A;  4B9L A;  3QEP A;  3CYM A;  2Z1H A;  3OYE A;  1T05 A;  1VSK A;  1L3S A;  3NH1 A;  1XHX A;  3WNE A;  1SKS A;  3MXJ A;  1WSF A;  2D0A A;  3CQ8 A;  4CEB A;  3K2P A;  3KD1 E;  4O55 A;  3SUN A;  2FBX A;  3HO1 A;  3HST B;  4DQQ A;  3D45 A;  4XIU A;  1KLM A;  4OGE A;  4KI4 A;  1NOZ A;  3TAG A;  3OYJ A;  2DFH A;  2VG6 A;  3K58 A;  1U48 A;  2HHT A;  4M3T A;  3KLI A;  1TKT A;  4NCA A;  4AIL C;  2E4L A;  4DS5 A;  3VA0 A;  1NKB A;  1X9S A;  1SV5 A;  4AH9 A;  5CYQ A;  4FYD A;  4CER A;  1A5W A;  1SKW A;  1ZBI A;  4GW6 A;  4CCH A;  3SQ4 A;  1IKY A;  4QCL A;  3ZSY A;  3RMA A;  3TR8 A;  1RT1 A;  1S6P A;  3LZI A;  4CE9 A;  3ZSR A;  3DLK A;  3M8Q A;  1NK8 A;  1JXE A;  3TI0 A;  4E3S A;  1FKP A;  4J2B A;  2X74 A;  4EZ6 A;  4FJK A;  1JLF A;  4BE2 A;  3OS2 A;  5JS1 A;  3QLH A;  2RF2 A;  2YNF A;  4KHN A;  3H08 A;  4CFC A;  2QXF A;  4FZZ A;  3DYA A;  3ZT2 A;  2E6L A;  2XHB A;  4DTN A;  1NJZ A;  4CIG A;  2HHS A;  3LPU A;  3ZT4 A;  2XRI A;  3AVF A;  2BGG A;  1CLQ A;  2NUB A;  1UOC A;  4CF1 A;  3V9S A;  4DSK A;  2G8U A;  4PWD A;  3AVN A;  2Z1I A;  2VG7 A;  3MEE A;  3KLH A;  4GVM A;  2BAN A;  3V9X A;  3U6F A;  1VSE A;  5KRT A;  4RW6 A;  4PQU A;  3PV8 A;  4CED A;  3VQ6 A;  3OYH A;  3DLH A;  3I0R A;  3MEC A;  5J2Q A;  1U49 A;  2Y1I A;  4PY5 A;  3M8P A;  5KI6 A;  4FLT A;  1SL0 A;  4N76 A;  2F8T A;  4E19 A;  3AVI A;  3LAK A;  3KIO A;  5KTQ A;  4BDP A;  3PUF A;  3LP1 A;  1FKO A;  1BCM A;  4CEE A;  1QHT A;  1S1T A;  2JLE A;  4ID5 A;  4KAZ A;  3NF6 A;  4Z0U A;  3PO5 A;  4UQG A;  3VQ7 A;  3VQP A;  2OPP A;  1C1A A;  3ITH A;  2D5R A;  3QO9 A;  1HQE A;  2X6S A;  3C6T A;  2IOC A;  1NJW A;  4OPK A;  2P5O A;  3L3U A;  2X78 A;  4CJ5 A;  3OYI A;  3HXM A;  1LWF A;  2VG5 A;  1U47 A;  2XY7 A;  4CIF A;  1NK9 A;  3WNH A;  4FW2 A;  1EKE A;  4FM0 A;  4FJH A;  3C6U A;  4Z4H A;  2OPR A;  3HM9 A;  4CIE A;  3HPO A;  3NHG A;  3C94 A;  3SPY A;  1IKW A;  3OYB A;  3OYA A;  1KFS A;  3K5N A;  2OZS A;  4I9Q A;  4FJ7 A;  4QOZ B;  3MED A;  3ASM A;  3HVR A;  5HP1 A;  1RTJ A;  1DTQ A;  1N6Q A;  4CJW A;  1WAF A;  3ALY A;  3B6O A;  4ZHR A;  4CHY A;  1Y97 A;  3ZSW A;  1TV6 A;  3QET A;  5CZ1 A;  4FJ9 A;  1GOC A;  3L3V A;  1BQM A;  3RWU A;  4M42 A;  1CZB A;  2DFF A;  3DOL A;  3NGY A;  3DRS A;  3CG7 A;  3V81 A;  1XI1 A;  4F2R A;  3C95 A;  1YTU A;  1VRT A;  4CEA A;  3CFO A;  1RDD A;  2D0B A;  3OYC A;  4OPJ A;  4W5N A;  4KHS A;  4DWI A;  3SQ0 A;  1LW0 A;  1Q8I A;  4KTQ A;  2FBT A;  4KHY A;  1HPZ A;  4ZTF A;  1S9E A;  3TWH A;  4HVJ A;  3HT3 A;  1LWC A;  2HNZ A;  3AA4 A;  4W5T A;  3QIN A;  4DSL A;  1T7P A;  3F9K A;  4W5Q A;  1L3T A;  3AO1 A;  1YTA A;  4QAG A;  5T7B A;  3RR8 A;  1IO2 A;  3LPT A;  4NCG A;  4PA1 A;  3P1G A;  1A5V A;  1VRU A;  3RMC A;  1RT5 A;  2RPI A;  3E01 A;  2QKB A;  1XHZ A;  2R7Y A;  3VQB A;  3SUP A;  4O4G A;  4DTO A;  3CFR A;  3MXI A;  2HVI A;  3RTV A;  2O4I A;  2FBY A;  3QES A;  4B9T A;  1BL3 A;  3AO5 A;  2XY6 A;  1ZBF A;  4I7F A;  4RW4 A;  1KVB A;  2HHW A;  3OYG A;  1T03 A;  3AVM A;  4ICL A;  4AHU A;  4E89 A;  2YV0 X;  3S3M A;  4F3O A;  1D5A A;  3EYZ A;  1JXB A;  2A1R A;  1C0T A;  4BWM A;  4DFP A;  3P83 D;  5C24 A;  4AHV A;  4CHP A;  4CF2 A;  1ASV A;  4KKO A;  3KLF A;  3I0S A;  3UIQ A;  3KKS A;  4IDK A;  3TAB A;  3T19 A;  4CJV A;  3BDP A;  5HRN A;  1QS4 A;  3DMJ A;  3LAM A;  1F21 A;  3OYN A;  3HL8 A;  4Q5V A;  1QSY A;  4CHN A;  3NGI A;  1BCO A;  1GOA A;  4NYN A;  4H8K A;  3VQQ A;  2ITG A;  3V1O A;  4B8C A;  1UAX A;  4CEO A;  2DFE A;  3AVA A;  4O0J A;  1SL2 A;  4CJ3 A;  4FW1 A;  3VQD A;  2ATQ A;  3PY8 A;  4DQS A;  3QIO A;  1R0A A;  2HB5 A;  3L2U A;  1JL1 A;  3VQ8 A;  2XY5 A;  4KTZ A;  3DRP A;  3SNN A;  5HLF A;  3SV4 A;  1B92 A;  3ZSO A;  4JS4 A;  1RBS A;  1KFD A;  4FJX A;  3ZSV A;  1NK4 A;  3DRR A;  4CEZ A;  3AO3 A;  3V9U A;  2QK9 A;  3I8D A;  4I9L A;  4CF9 A;  4DS4 A;  4KHU A;  4FLU A;  2KFZ A;  4OJR A;  4ZTJ A;  4FLW A;  3NF9 A;  4FK0 A;  3VQ5 A;  1KLN A;  3ZSX A;  5C42 A;  4Y1D A;  5KGX A;  3LWL A;  4MFB A;  3CFP A;  2WOM A;  4Y1C A;  2GBZ A;  4DTJ A;  1TVR A;  1LAW A;  1RT7 A;  4CJU A;  2IS3 A;  2YKN A;  3LDS A;  3VA3 A;  3OVN A;  1IKX A;  4FJJ A;  1RBT A;  4FLZ A;  3V9W A;  1VSI A;  5I42 A;  1NK6 A;  4FK4 A;  3HPH A;  5HRP A;  4KPY A;  3KKR A;  4DQR A;  4DQP A;  3NH0 A;  4M3Y A;  3KK1 A;  3ZCM A;  1S1V A;  5DMR A;  4I2P A;  2OZM A;  3S3O A;  1CZ9 A;  1T8E A;  4CFA A;  3S9H A;  4KV8 A;  4L8R B;  4KB1 A;  1CXU A;  2JGU A;  3M8S A;  1BI4 A;  1MU2 A;  4R5P A;  4CGJ A;  4Z4C A;  2B6A A;  3AVK A;  3TAE A;  2YNI A;  3NCI A;  4K8Z A;  4C8M A;  4LSN A;  1RIL A;  3OYF A;  1X9M A;  3D0P A;  1G15 A;  4Z4I A;  3NE6 A;  2PY5 A;  4E7H A;  1RT6 A;  1RTH A;  4WE1 A;  1KVA A;  4CGD A;  1NJY A;  1JLG A;  1JLE A;  4FJ8 A;  3O3H A;  4OLB A;  2FC0 A;  4CHZ A;  4DTS A;  2P1J A;  1RTI A;  1HNI A;  4C8N A;  3VQA A;  4LD0 A;  3ULD A;  4B3O A;  1YVU A;  3SQ1 A;  4LH4 A;  2KW4 A;  4FVM A;  4DSJ A;  5C25 A;  3DLR A;  4GMJ B;  3TAN A;  1BIZ A;  4TSX A;  4DG1 A;  3ZT0 A;  3L2W A;  2XO7 A;  4CJL A;  4CJP A;  4B9V A;  1TK8 A;  3AA3 A;  1NK7 A;  3NF8 A;  4H4O A;  4OKJ A;  1WSG A;  1Z26 A;  4BE0 A;  1S1U A;  3KLE A;  1B9F A;  4Z4G A;  3SV3 A;  1HMV A;  3LAN A;  3SZ2 A;  4OVL A;  1KRP A;  3RMD A;  4DQI A;  4O44 A;  2GUI A;  2ZQB A;  3K59 A;  4B9S A;  4M3W A;  2I5J A;  3DI6 A;  3OY9 A;  1X9W A;  1KSP A;  1D9F A;  4BAC A;  1IG9 A;  1VSD A;  1I3A A;  2IC3 A;  4BDZ A;  4DTP A;  1BIU A;  1J5O A;  4OKK A;  3K5M A;  1RBU A;  3MAQ A;  3PO4 A;  4O0I A;  2IAJ A;  1S6Q A;  2YHB A;  5HRR A;  1RBV A;  3TAM A;  3AVG A;  3AA5 X;  1Z25 A;  4CJS A;  4N56 A;  4CHO A;  2EX3 A;  3QEV A;  4ELT A;  1CXQ A;  1BGX T;  1ZBU A;  5KRS A;  4RW9 A;  2G8V A;  2IGI A;  3K5L A;  3QEX A;  1C1C A;  3PX6 A;  1VSH A;  3HJF A;  4OLA A;  4CEF A;  4FCY A;  3HPG A;  4FJL A;  4CGF A;  4N5S A;  3V4I A;  3SPZ A;  1L3U A;  4CK2 A;  2YNH A;  3TAQ A;  4CK1 A;  1BQN A;  4M45 A;  1NJX A;  1L3V A;  5E41 A;  1WSJ A;  1ZYQ A;  2VWJ A;  3QNN A;  1Q9X A;  4FJI A;  3K5O A;  2HHU A;  1GOB A;  4LH5 A;  1RDA A;  4O5B A;  3NH2 A;  3HP6 A;  3SJJ A;  1XC9 A;  2Z1J A;  1U4B A;  1BIS A;  3T1A A;  1N5Y A;  1LW2 A;  4FM2 A;  4DU1 A;  4ELU A;  3MXM A;  1C6V A;  1L5U A;  3SUO A;  1BHL A;  4CF8 A;  4KB0 A;  3SI6 A;  4BDY A;  5FDL A;  3ZT1 A;  1VSL A;  2O4G A;  3OJS A;  1EP4 A;  4J2E A;  3IG1 A;  4FJN A;  4EZ9 A;  2KZZ A;  3EY1 A;  1EXQ A;  5I3U A;  3KLG A;  2KZM A;  4E7J A;  4Z4F A;  2DY4 A;  2HHX A;  1LAV A;  5SZT A;  3DM2 A;  1QE1 A;  1HRH A;  1TL1 A;  2YKM A;  3M8R A;  5CZ2 A;  4DSF A;  1D8Y A;  4E7L A;  1TKD A;  3JSM A;  4FLX A;  1NKC A;  3KTQ A;  1JKH A;  3MEG A;  4DSI A;  4ID1 A;  1UA1 A;  4LSL A;  2RN2 A;  3NDK A;  3CM5 A;  4FLY A;  1X1P A;  1S1W A;  4RW7 A;  4J2A A;  1TK5 A;  3HYF A;  1S9G A;  4MQ3 A;  5K14 A;  2X6N A;  3DOK A;  5J2P A;  3AVJ A;  1ASU A;  3NBP A;  2HHV A;  2G8K A;  1RTD A;  4KHQ A;  1RT4 A;  1EX4 A;  4KO0 A;  4DFJ A;  1SUQ A;  4IG0 A;  2BE2 A;  1ZBL A;  1KVC A;  2YNG A;  3G10 A;  4HTU A;  2ZE2 A;  4KRF A;  2PZS A;  4DTX A;  1TKZ A;  4E7K A;  1TKX A;  3F73 A;  1QSL A;  4DMN A;  1TAQ A;  4CGG A;  4Z4E A;  3JYT A;  4CEC A;  3QNO A;  1C0M A;  5HRS A;  4KI6 A;  4F3T A;  1ASW A;  1B9D A;  2PYL A;  1XWL A;  2HVH A;  2G8W A;  3AO2 A;  4LY7 A;  1W0H A;  4ELV A;  1RNH A;  1WN7 A;  4CJ4 A;  3BGR A;  4YFU A;  2FBV A;  3LAL A;  1KTQ A;  4AHC A;  4CHQ A;  1NKE A;  4FZX C;  1RDB A;  3V1Q A;  4M41 A;  4DSE A;  4IG3 A;  4DU4 A;  3OS1 A;  2KFN A;  1HQU A;  1S5J A;  1VSM A;  1BI4 B;  2XY8 A;  2KQ2 A;  3CM6 A;  3KK3 A;  3S3N A;  1NK5 A;  5J1E A;  2W42 A;  2RKI A;  1RT3 A;  1C1B A;  1W9H A;  4DTM A;  3QER A;  3THV A;  1HYS A;  1HJR A;  3LZJ A;  2OPQ A;  3LWM A;  4JS5 A;  2HW3 A;  1RT2 A;  2P51 A;  4KFB A;  3OYK A;  1YT3 A;  3V9Z A;  3AO4 A;  3KJV A;  1FK9 A;  1VK0 A;  4DLE A;  4DU3 A;  3VQE A;  3VQ9 A;  4W5R A;  2BDP A;  2DTU A;  1C0U A;  3RMB A;  3NGZ A;  3NF7 A;  4I2Q A;  3DLG A;  1WNS A;  5CYM A;  1SL1 A;  4DF4 A;  3QIP A;  4JRP A;  2KTQ A;  3AV9 A;  3WNG A;  3OJU A;  4E1M A;  2P5G A;  3OYM A;  3HVT A;  5HBM A;  2F96 A;  1UA0 A;  2G8H A;  1J54 A;  4M3Z A;  3AA2 A;  4CEQ A;  4CJE A;  4N47 A;  3ZSQ A;  4DF8 A;  4B9N A;  3TAF A;  1KCF A;  1JL2 A;  2HND A;  1JLA A;  2VWK A;  4F8R A;  1QTM A;  3AVH A;  4W5O A;  5SWM A;  3U3Y A;  4E1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...