4CEZA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cezA00
4F2RA 4F3TA 1KTQA 2OPPA 3TAQA 4E7IA 4CFCA 3P5JA 1QQCA 2IOCA 4RW7A 1VSMA 1ASWA 3NDKA 3NCIA 3SPZA 2WOMA 4KI6A 1UWBA 2OYQA 4F3OA 3ASMA 3VQ5A 4CIFA 3LWLA 3HVRA 4RW9A 3L8BA 2KW4A 4CEAA 1G15A 3DYAA 1ZBFA 2HHXA 3FFIA 3MEGA 4B9UA 4FJ7A 1HQEA 4FM0A 3KTQA 3DI6A 4C8LA 3VQ8A 4KHUA 3LP2A 4PY5A 4DTPA 5CY4A 1NJXA 3DOLA 2VWKA 3OJUA 4KI4A 4DSIA 3RMAA 4B3OA 1C1AA 4AHUA 3V9ZA 3NFAA 2PYJA 3VQ7A 1JLEA 2RKIA 4MQ3A 1LWEA 3SJJA 1RT2A 2OZSA 4PWDA 4L8RB 1LW0A 2EX3A 4J2AA 4FK4A 4J2BA 4W5QA 3LDSA 3HSTB 2OPSA 1GOBA 3KLIA 3QINA 3KLEA 2F8TA 1HPZA 2I5JA 3SQ0A 4E7HA 3THVA 3RMDA 1NKEA 1YTAA 3I0RA 3LP0A 4LH5A 3AVCA 4OKJA 2HHTA 1WSEA 1K6YA 2FC0A 1HYSA 1NK4A 4IG0A 2D0BA 1TK8A 1RBUA 4CECA 4TSXA 4BE1A 4B9TA 1FK9A 2VG6A 3HM9A 3V9WA 3M8SA 1NKCA 4LH4A 2E4LA 4BACA 4FCYA 4FLUA 3OS0A 3DMJA 2O4GA 1YT3A 3PX0A 1BL3A 3WNGA 4DF8A 2HW3A 5I3UA 1ZBHA 3ZSRA 4CIEA 3MAQA 4OJRA 3K59A 3SUNA 1KVBA 3TI0A 3EZ5A 4FJXA 4OKEA 2FBTA 3AO2A 1I39A 3KK1A 4KHWA 3VQQA 4B9SA 4FZZA 3CM6A 4FZYA 2Z1IA 1S1UA 4CK1A 3O4NA 4DSJA 3ZT0A 5HROA 1TAUA 1RDBA 3KK2A 3SI6A 3DLBA 4FJKA 1LAVA 4BWMA 1ZBIA 3TAFA 5J2NA 3OYEA 5KGXA 1S5JA 4HUEA 1KRPA 1ASUA 3AA5X 1SL1A 1W0HA 4ZHRA 1RTDA 4HCBA 2DTUA 4J2EA 4CJRA 4CIGA 3QNNA 4PUOA 4GW6A 1DTTA 4FJ8A 4PA1A 4DLGA 4QAGA 1VSDA 3AA3A 5JS1A 1RDCA 2P1JA 4MFBA 4KHNA 1GOCA 3O3FA 1T05A 3ITHA 3VA3A 1U04A 3DM2A 4M3ZA 2QK9A 3A2FA 3QNOA 3BGRA 3LZIA 4Z0UA 4DLEA 3SNNA 4B9MA 3CFOA 3KLGA 3AVBA 3HK2A 3SV4A 4EP4A 3OYIA 1VK0A 2HNYA 3OY9A 5J2QA 4DS4A 1WSFA 3M8RA 4NYFA 5J2MA 1UAXA 3M8PA 1LW2A 4E7JA 4O55A 3SZ2A 4DS5A 2HHUA 3ZSQA 3OYCA 1BISA 3E01A 4ICLA 5E41A 4CGIA 2B5JA 4E19A 3ZT1A 2OPRA 1CZBA 3AA4A 3OYLA 1TKDA 1NK0A 5J2PA 3HYFA 2ETJA 2HVIA 4CHNA 1NJYA 1TKTA 1REVA 4H4MA 1BCOA 1LWFA 2GBZA 3DOKA 3IRXA 1VSLA 1NK7A 2WONA 4DSLA 1RTIA 4KTWA 5DMRA 4CK3A 2HHQA 3AVHA 3QLHA 4I2QA 1Q8IA 4I7FA 4NCAA 2X6NA 3MXMA 3L2RA 1UA0A 3NF9A 4DTNA 3OYDA 3TANA 1WSIA 1QSSA 2B4JA 5CZ2A 2X6SA 4FLXA 1D8YA 3ZSWA 1VSHA 4IG3A 3SQ2A 1BCMA 3LAKA 1RBRA 1L5UA 1TKXA 2KQ2A 3KD5E 3ZSYA 3G0ZA 3VQDA 3L2WA 2ATQA 2ZD1A 1TGOA 3LP3A 2G8WA 3T1AA 2X78A 1DTQA 3VN5A 3V9SA 2HMIA 1CZ9A 4FLYA 3RMCA 4ZTFA 1IKYA 2YHBA 4CEQA 5I42A 4H8KA 3NGIA 2ITGA 2DFEA 2YKNA 3TAPA 4CJKA 2RPIA 1IH7A 2IAJA 3AVAA 5FDLA 4DFKA 5FRMA 3HL8A 1NK5A 1A5VA 4O0IA 2YKMA 3LPUA 3NF6A 4CJ4A 3U6FA 2G8VA 4FJGA 4KAZA 1CLQA 1YVUA 3LP1A 3LAMA 4CF2A 3O4QA 3VQAA 4CJLA 3O3HA 3QERA 3VQ4A 3AV9A 4C8KA 3DLKA 1Q9XA 5HRSA 1C1CA 2Y1JA 1KCFA 4KTQA 3S3MA 1ITGA 4CFDA 4RG8A 4ELTA 3RRGA 4Y1CA 4C8NA 3K5OA 4LSNA 2HHSA 1C0UA 3MECA 1FKPA 2XHBA 4M3UA 5D3GA 4YFUA 1KSPA 4M41A 1S9GA 4AHCA 1S9EA 4FW2A 3LWMA 3QEVA 4DQSA 5HRNA 3LANA 1RBSA 4DQRA 4E89A 3CYMA 3K5NA 3NE6A 1T7PA 3I8DA 2P51A 2X74A 4CF9A 3SQ1A 4RW4A 4OLAA 4CHPA 4Z4HA 3SUPA 4Q0BA 3KK3A 4Z4FA 4CJFA 3V81A 1B9DA 4LD0A 1UA1A 4E1NA 4FJ9A 3OYBA 1TV6A 1N5YA 1JLBA 2VWJA 4Z4IA 2JGUA 3NH2A 4DQQA 1KLMA 4Z4CA 4FLWA 3AO5A 4UQGA 3AVKA 4CGFA 3PUFA 2BDPA 4M3WA 1KFDA 2ZE2A 4CGDA 4JRQA 3LPTA 4CF1A 2DFHA 4N76A 5K14A 3NF8A 4DTRA 1QS4A 1QSLA 2RN2A 3O3GA 4DTOA 5T7BA 5CYQA 4OLBA 1HYZA 4DTUA 4CJ3A 3QEXA 4FLZA 1RT7A 1DLOA 3SYZA 1WAFA 3HT3A 4BDPA 4GMJB 4BDZA 4E7KA 1A5XA 2YNHA 4OGEA 1T8EA 4NCGA 1NOYA 2G8FA 2AJQA 2IC3A 3CG7A 3I0SA 5CZ1A 4CJVA 3QETA 4DWIA 3NGYA 3WNEA 5SWMA 3VQ6A 2Y1IA 4CHYA 2O4IA 3TAEA 1R0AA 1J54A 3D45A 3QEWA 4HVJA 3F73A 3CQ8A 3CFRA 1NK8A 1S1TA 4RW8A 3TWHA 1KLNA 3DLHA 4N5SA 1NJZA 3OYGA 4QOZB 1S6PA 4ID1A 1RTJA 3VQPA 4CJWA 3RWUA 2KTQA 1TVRA 1VSFA 1SL0A 1EX4A 3AO3A 4ID5A 2FBXA 3HVTA 4IFYA 4IDKA 1RT5A 4KFBA 1KVAA 3L3VA 3ZSOA 4JS5A 2XY7A 1NJWA 3NH0A 2FBYA 4DSEA 1O1WA 1L3SA 4IKFA 1HMVA 3KD1E 1S1XA 3S9HA 4KB1A 1VRUA 2D0CA 4CEBA 3OYNA 4BDYA 4DU1A 3QIOA 4F8RA 4DTSA 4FXDA 3K5LA 2F8SA 4KHSA 2DY4A 3MXJA 3HP6A 3AVIA 3NBPA 4N41A 3V4IA 1B92A 3MEEA 4CK2A 3TR8A 4OPKA 4KHQA 2BANA 2HNZA 4B9LA 4AHVA 4GVMA 1RNHA 3PV8A 3UIQA 1WLJA 1L3UA 4DSKA 1RCHA 5EU7A 1U45A 3AVJA 3HPHA 3ZSZA 4N56A 3HPOA 4E0DA 1HNIA 4CF0A 4CGGA 3K2PA 1TAQA 4JLHA 1TKZA 3V9XA 1C1BA 1XHZA 2PYLA 3PO4A 2RF2A 4AH9A 5SZTA 2YNFA 2W42A 1T03A 1SKSA 1NK9A 1RBTA 2A1SA 5KRTA 4FW1A 4FM1A 3RTVA 4FLVA 2YNIA 3RRHA 3JSMA 4ELUA 4I9QA 2E6MA 1WAJA 1S6QA 1S1VA 3M8QA 4G1QA 4CE9A 4K8ZA 3IS9A 3OYFA 2E6LA 3OS2A 1RILA 4O0JA 2G8UA 3OJSA 3ZT3A 4R5PA 4XIUA 4DTXA 2OPQA 4EZ6A 3NAEA 2ZQBA 3OS1A 4C8OA 5HRRA 4DF4A 4QCLA 5KRSA 4BE2A 5DK5A 4AHTA 2IGIA 4CEEA 4HCCA 1X1PA 4J2DA 4B9NA 4ELVA 2JLEA 1U48A 3HP9A 2BE2A 2LSNA 3U3YA 4O5BA 4B8AB 5HP1A 4DG1A 3QEIA 4DMNA 1VSIA 1RT6A 3VQ9A 4CESA 4FJMA 3ALYA 1LWCA 5KGWA 4KKOA 3SUQA 3PY8A 4FJJA 4CJSA 4YNQA 4CHQA 1Q9YA 1XHXA 4NCBA 1D9DA 1WN7A 3ISNC 2G8KA 4WE1A 1J9AA 2IS3A 2QXFA 3QO9A 4H4OA 4W5OA 1SV5A 3PX4A 5C42A 4B08A 5C24A 3K57A 3NF7A 3QIPA 4CEDA 3KKSA 1Z26A 1RT4A 1LAWA 3VQBA 2VG7A 3OYMA 1JL2A 3ZT4A 1RT3A 1N6QA 5FRNA 4IBNA 3ZT2A 2R7YA 1C6VA 1QE1A 3C6UA 3V6DA 3TARA 1QSYA 3PO5A 4OPJA 1TL3A 5C25A 1ZBUA 2Z1JA 4FJNA 1YTUA 1RT1A 2EHGA 5HLFA 3L3UA 3P1GA 4AILC 3MXIA 3S3NA 4DU4A 2NUBA 1BIZA 4N47A 4CGJA 2BGGA 5CYMA 2HHVA 2HVHA 4FVMA 4OKKA 3DRRA 1U4BA 4HUFA 3DRPA 1EP4A 2QKKA 3HPGA 2Z1GA 4HUGA 3QEPA 3B6OA 4KB0A 3AA2A 1EETA 3KLHA 3U3GA 5HBMA 2F96A 3OYJA 1C0MA 3AO1A 1Z25A 1L3TA 4CHZA 1JLQA 1A5WA 3AVLA 4CEFA 1TL1A 1ZBLA 2G8HA 4E3SA 3ZCMA 1VSKA 1I3AA 3L2VA 2KZZA 1BHLA 1JXEA 1NKBA 3LZJA 4DFMA 3AVNA 3OYKA 4FYDA 3OYAA 4CERA 2DFFA 1VRTA 3V1QA 4LSLA 3ZSVA 1QTMA 1IG9A 4CJEA 4CCHA 1S1WA 4Z4EA 4HTUA 3ZSXA 4KTZA 4M42A 1TK5A 1HJRA 1VSJA 4Y1DA 4AHRA 4KO0A 4I2PA 1NK6A 2P5GA 2XY6A 4KHYA 1IKVA 3NH1A 4DFJA 3OVNA 3AO4A 2KZMA 4JS4A 3WNHA 4ZTJA 4K8XA 4M3TA 2YHAA 4JRPA 3K58A 4FLTA 1RTHA 1SL2A 1LV5A 5KTQA 4EZ9A 1WNSA 4CEZA 3TAMA 4EP5A 4W5NA 1JLAA 1IKWA 4FJLA 2IDOA 4IFVA 1NOZA 4O44A 4CJUA 3NHGA 1IKXA 3JYTA 5JS2A 3DRSA 4I9LA 3AVFA 2VG5A 1VSEA 4OGCA 4W5RA 2B6AA 1WSJA 4BE0A 4RW6A 1KFSA 4M3XA 1KVCA 3TABA 3L2QA 1UOCA 2HNDA 4CJPA 2XO7A 2OZMA 4F4KA 4M3YA 1HQUA 2HB5A 2KFZA 2FBVA 1ASVA 1CXQA 3H08A 3DLGA 1X9MA 3TAGA 3BDPA 4DTJA 4CJTA 1U47A 4Z4GA 1BIUA 1IO2A 5J1EA 4DU3A 2OA8A 4DQPA 4FJHA 4CF8A 3C95A 3DLEA 3WNFA 4B8CA 3CM5A 1FXXA 3T3FA 1RBVA 3KIOA 3V1OA 3EY1A 3K5MA 1SKWA 4FK2A 2HHWA 1JKHA 3LALA 4KREA 3IAYA 1JL1A 3S3OA 4AHSA 1QHTA 3AVGA 1BQMA 3IG1A 1W9HA 1SUQA 1C0TA 4O4GA 5KI6A 1BGXT 1XC9A 1XWLA 4KRFA 5FROA 1WSHA 1L3VA 1BI4B 3DLRA 1B9FA 2YV0X 3VQCA 4FM2A 4DFPA 1JLFA 3SQ4A 2QKBA 3HO1A 1GOAA 1JLCA 1HYVA 2D0AA 3F9KA 4OVLA 3MEDA 1MU2A 4CFBA 1CXUA 1D5AA 5HRPA 1J53A 2YNGA 1BI4A 1BQNA 4DQIA 1Y97A 1F21A 1SKRA 2XRIA 3V1RA 2P5OA 3PX6A 4E7LA 4LY7A 4CJ5A 4HHTA 3RMBA 1RDAA 4CGHA 2PZSA 4KPYA 3HJFA 1J5OA 3P83D 4Q5VA 3KJVA 2XY5A 3B6PA 4NYNA 2GV9A 1D9FA 4M45A 3QESA 1X9WA 2Q3SA 1RDDA 1JLGA 1FKOA 4KV8A 4CEOA 3ULDA 1JXBA 2G8IA 3KLFA 4B9VA 2KFNA 3SCXA 3KKRA 3L2UA 1X9SA 4BWJA 3V9UA 3D0PA 4DTMA 1EKEA 2XY8A 3C6TA 3T19A 1HRHA 3G10A 3SUOA 3HXMA 2Z1HA 1EXQA 2GUIA 3EYZA 4DSFA 3SPYA 2A1RA 1XI1A 3VQEA 4FJIA 4FJ5A 4E1MA 3C94A 4CFAA 4C8MA 2D5RA 3SV3A 1ZYQA 3OYHA 1TK0A 1U49A 4PQUA 3RR7A 4CJQA 4CHOA 3NGZA 3VA0A 1HNVA 4M3RA 4W5TA 3RR8A 4F2SA 4FZXC 3CFPA 4FK0A 3AVMA 2PY5A 1WSGA
chains in the Genus database with same CATH superfamily
4F3TA 3WXKA 1QQCA 1VSMA 4K42A 1ASWA 3NCIA 4KI6A 4F3OA 3LWLA 3I33A 4K43A 1G15A 4EAHD 2GELA 5E26A 2HHXA 3MEGA 1HQEA 4FM0A 4KHUA 3LP2A 4DTPA 5CY4A 3OTOK 3R6MA 2D4WA 2VWKA 4HWIA 4DSIA 4B3OA 1HNZK 2PYJA 3NFAA 4IZ9A 2RKIA 3T69A 1RT2A 3SJJA 1QZ5A 3MX5A 4FK4A 4W5QA 3CXCM 3LDSA 3K9JA 3KLIA 4A2AA 2F8TA 4MO5A 4DV2K 1TUUA 1QQMA 3RMDA 3CCLN 1NKEA 1YTAA 3I0RA 4MO4A 3WXMB 1JJ2M 3AAPA 3H3NO 4LH5A 3AVCA 4OKJA 4OPAA 4BC2A 1NGJA 1TK8A 5M1OA 3CJ1A 4TSXA 4BE1A 2VG6A 5AQPA 1OVQA 2VGNA 2E4LA 4BACA 2O4GA 1TUYA 4CZIA 1BL3A 3WNGA 3ZSRA 3K59A 3SUNA 3EZ5A 4IOXA 5AQLA 3KK1A 2P9IA 2BH1A 4B9SA 3OBWA 4FZZA 4BR0A 5CE3A 4DUZK 2Z1IA 2ZWHA 3DLBA 4PKGA 1ZBIA 3Q7CA 3JXUA 3CMEN 1JCEA 5AQWA 1W0HA 4J2EA 4CIGA 3G25A 3QNNA 4X66K 2ITMA 3THXA 4DLGA 3UKUB 4QAGA 1RDCA 4KHNA 4MFBA 3ITHA 3VA3A 1U04A 1VHXA 3BGRA 3QNOA 3SNNA 1OVYA 2Q0UA 3KLGA 3AVBA 4EP4A 5BPNA 2RE2A 4DS4A 1U2VA 3M8RA 5J2MA 1NGAA 1LW2A 3M8PA 1BDGA 2YHXA 2B5JA 4E19A 1CZBA 3OYLA 1TKDA 1XUPO 5J2PA 3HYFA 2ETJA 5BPMA 3IRXA 3DOKA 3D2FB 4DSLA 3C7NB 4KBOA 5DMRA 1M90O 2HHQA 3AVHA 3CCQN 4NCAA 1VQ7N 2X6NA 3L2RA 5TKWA 1WSIA 4IOCL 4FLXA 4BRKA 4IG3A 3R1XA 3SQ2A 3KD5E 3VQDA 3MCAB 1TGOA 2Q36A 2X78A 5AQQA 2HMIA 2GTDA 4FLYA 4K0KK 1IKYA 4H8KA 3O80A 2IAJA 3AVAA 5FRMA 3J7ZO 1NK5A 1A5VA 3NF6A 4FJGA 1ZXOA 4JYAK 3O3HA 4ISFA 3VQ4A 4DCHA 3C65A 5HRSA 3H1QA 2Y1JA 3VF2A 4CFDA 5AQNA 4U7BA 3RRGA 5C2DA 2HF3A 1NGHA 1KSPA 3CCRN 3GDQA 1S9EA 2P9SB 1VQKN 3LDNA 4NO7A 2F9TA 1VQ9N 2BTFA 3CYMA 4CBXA 1EQYA 3I8DA 2E1YA 3BF3A 4CF9A 3SQ1A 4OLAA 5KPTA 4Z4HA 3CC4N 3VENA 3SUPA 4Q0BA 3KK3A 4H03B 4CJFA 1B9DA 4LD0A 1WBBA 5FPNA 4JKDA 2F7TA 2VWJA 5AZJB 2JGUA 1S3XA 1KLMA 4Z4CA 2BDPA 2P9NA 1KFDA 1N8RO 4H5RA 4JRQA 3LPTA 1S72N 2DFHA 2FSJA 3WEEA 4DV7K 3NF8A 4DTRA 2D1KA 4MLEA 3HT3A 4BDPA 1ZBSA 4GMJB 4BDZA 4E7KA 2QI2A 2AJQA 3EKUA 1E3MA 3WNEA 2UXCK 2YCHA 4HVJA 5GIOA 3CF5L 5CHIA 3TWHA 3DLHA 4B3SK 1S6PA 2O8DB 3GBTA 3OBYA 4A57A 4JKAA 4ID5A 4WF9L 3HVTA 4JS5A 4IDKA 2XY7A 3NH0A 4BREA 2FBYA 3VGMA 1RFQA 3S9HA 4PKHA 4DU1A 3MN9A 4F8RA 4KHSA 2DY4A 4GKKK 2EWSA 4QS9A 3NBPA 2O8EA 3VGLA 5HL7L 3TU5A 2VYPA 4M63C 4AHVA 4DUYK 4GVMA 4JI6K 4PL7A 3GE1A 4OX9K 3HPOA 2NLXA 4Y0WA 3UE5A 4CGGA 1TAQA 1TKZA 3QFPA 3CJAA 3QMLA 2W42A 2YNFA 4O8KA 4BY9C 3I8BA 2A1SA 4FM1A 4ELUA 3RRHA 4I9QA 1WAJA 4G1QA 1S1VA 2GWJA 4CE9A 1LCUA 3OS2A 1RILA 3OJSA 3O9QA 4C8OA 5KRSA 1J6ZA 5AQUA 2E88A 2IGIA 4EIAA 4CEEA 5BRFA 4J2DA 3RVCA 1NU0A 5FPEA 1U48A 3U3YA 4O5BA 1K73O 1ESVA 4DG1A 3QEIA 4BRQA 4DMNA 2QWNA 4FJMA 1GLAG 4WQ4C 2I7NA 1D9DA 3VF4A 1KQSM 4WE1A 4FPAA 1SV5A 2CGKA 3NF7A 4FO0A 1N33K 3QIPA 3AAQA 4JKGB 2O8CB 1LAWA 3VQBA 2VG7A 1N6QA 1RT3A 3ZT2A 2I7PA 4A59A 3PO5A 3V6DA 1NGIA 5AQHA 2OANA 3THYB 5C25A 5LMNK 1ZBUA 4PL8A 3BY5A 3L3UA 4DU4A 4JK8A 4CW7B 2PBDA 3DRRA 5AQMA 4BG8A 1U4BA 3P31A 4DB3A 4LFAK 3BF1A 3HPGA 4DR7K 3E9PA 4H5WA 3AA2A 4GVEA 2GX9A 1Z25A 1JLQA 2QWQA 1JXEA 1NKBA 4KH5A 2HBJA 1Z05A 2HOEA 5AQIA 1IJJA 3OYAA 4CERA 3RSEA 1VRTA 1QTMA 1IG9A 4IWVA 4EHUA 4HTUA 4KTZA 1T44A 2P5GA 2FSNA 4I2PA 2XY6A 2VWBA 3OVNA 3AO4A 4JKCA 4K8XA 2YHAA 1SL2A 3VEOA 4EZ9A 1HNWK 5BREA 3TAMA 1LOTB 2A41A 1IKWA 4FJLA 5AFUA 4O44A 1IKXA 3JYTA 3SBTA 3AVFA 2VG5A 4CZLA 1WSJA 3ULEA 4YY3K 3BEXA 4LF9K 2HMPA 3VPZA 3AGRA 2XO7A 4CZGA 1HR0K 1ASVA 3DLGA 1X9MA 1E4GT 4BQLA 3KHYA 5C10A 1XQSC 3CI5A 4JKHA 2VQFK 3O1WA 3TTCA 4FK2A 3IAYA 3AVGA 3LDOA 1W9HA 4WQ4A 1TYQA 5KI6A 1XC9A 5F2RA 4BR2A 1WB9A 1L3VA 2W6KA 3DLRA 4FM2A 3SQ4A 3TSQA 3R3LA 3F9KA 5EXWA 3MEDA 3H45C 3L0QA 5LMUK 1NMNA 1VQ8N 5HRPA 2YNGA 4DQIA 1F21A 2XRIA 3V1RA 2P5OA 3PX6A 3FR0A 4E7LA 3RMBA 5F1XA 2ZF5O 2P9UA 2VGMA 4CGHA 2PZSA 4Q5VA 3A5NC 3B6PA 3G71N 1X9WA 3ULDA 2G8IA 4YOTA 4BQZA 1CZAN 4BG9A 3L2UA 2BUPA 2XY8A 3C6TA 3U9ZA 2QWOA 3HXMA 5HOOA 3EYZA 5GADP 3C94A 4CFAA 3OA9A 3SAGA 3VA0A 2UU9K 4FK0A 2W6LA 4F2SA 4F2RA 4B3RK 3WQTA 4BC5A 4B1YB 4RW7A 2OCEA 4CZJA 2OYQA 3ASMA 4RW9A 1P90A 4CEAA 3DYAA 5GAHP 2IVNA 4B9UA 3C0BA 4PY5A 3DI6A 4C8LA 3VQ8A 2A5XA 4XH1A 3LDLA 1OH7A 1VQON 3HOSA 2HF4A 2UUCK 2OZSA 1V4TA 4L8RB 3ZEUA 5EX5A 5BR8K 3HSTB 4DR5K 1GOBA 3KLEA 3QINA 1HPZA 4E7HA 4X62K 3LP0A 4O8UA 2HHTA 1WSEA 2FC0A 1HYSA 1NK4A 4IG0A 4DV3K 4B1VA 4B9TA 3CJBA 1VQNN 4LH4A 3CHWA 2P9IB 2NRWA 3JS6A 3QBXA 4OJRA 1KVBA 4JD2A 4XH4A 1IBMK 2CGJA 4GNIA 4QS8A 3VQQA 4FZYA 5B8HA 2GWKA 1S1UA 5M1NA 3O4NA 3ZT0A 2ASPA 3THXB 1LAVA 2GEMA 2O8FB 3TAFA 3ENOA 3OYEA 4F9OA 5KGXA 1ASUA 3AA5X 2V7YA 4ZHRA 2KLAA 4PUOA 1T6CA 1C0FA 4PA1A 3G4SN 4FJ8A 2P1JA 1I94K 4BRPA 1GOCA 3O3FA 1T05A 3H3OB 4GV6A 3IUCA 3NVMA 3LZIA 3HK2A 4OPHA 2HNYA 2P9PA 1GLCG 2QWPA 5ADXA 4GKJK 3ZLJA 4E7JA 4O55A 3LDQA 3VF6A 3ZSQA 1BISA 1NGGA 3KVGA 1NK0A 5GAGP 2HVIA 5AQSA 2QWMA 4CHNA 2D0PA 1TKTA 1NJYA 1N34K 3BZCA 2WONA 3PSFA 4YDUC 3QLHA 1G99A 4I2QA 4CZFA 3WQUA 4DTNA 3OYDA 3TANA 1QSSA 2B4JA 4JI0K 3J7YP 4CVNE 2KQ2A 3L2WA 2ZD1A 3T1AA 3V9SA 1QQNA 1BG3A 4ZTFA 1JCGA 5I42A 4V19S 3NGIA 1EWRA 2DFEA 2ITGA 3TAPA 4CJKA 1OKJA 5FDLA 4O0IA 1CLQA 4I6MA 2UXBK 3VGKA 3DLKA 2WFBA 1Q9XA 1OH8A 3S3MA 2QW9A 1QVGM 1NBWA 3K9KA 2E20A 4JNEA 4M3UA 4YFUA 4AHCA 5AZIB 1KAXA 4JKFA 1T7PA 1NGFA 2P9NB 4DKWA 3T7ZA 3WEEB 1UA1A 1TV6A 1JLBA 4JI8K 2ASMA 4B1UB 3NH2A 3R8EA 3MK6A 1XC3A 1K8KB 3MWTA 4CF1A 1QS4A 2KHOA 1QSLA 3O3GA 3ID6A 4FLZA 1RT7A 1MWMA 1WAFA 5IT9O 3TTDA 2YNHA 1ZC6A 1NOYA 4FWLA 4NCGA 4NLBA 3VEZA 3VEWA 3CG7A 5CZ1A 4DWIA 5IWAK 2Q0RA 3H1VX 1QQOA 5JLFA 5DM6L 2Y1IA 2O4IA 2D0OA 3F73A 1VQ6N 1NK8A 4RW8A 1KLNA 3OYGA 1RTJA 1MDUB 1TVRA 1SL0A 3S41A 1EX4A 4EFHA 5M1KA 4X64K 1NJWA 1JCFA 2E2OA 4A5BA 2ZGYA 2O8EB 4DSEA 1O1WA 1L3SA 4YDUA 1S1XA 5JICA 3ZETB 3OYNA 4DTSA 1DEJA 3G6EN 2F8SA 4WFAL 4CBWA 3AVIA 3CCJN 3V4IA 1B92A 5AJ3K 4FVUA 4JKBA 2HNZA 4B9LA 3GL1A 2P9KA 1L3UA 1Q86O 2E8AA 2VCPA 5LL6Z 4DSKA 3HPHA 4UY8O 3V9XA 2W41A 1C1BA 1XMOK 3RTVA 4FLVA 3ZX2A 4BVOA 5JVHL 3OYFA 1BWFO 1HKCA 4R5PA 3H6EA 4H0TB 4XIUA 4DTXA 3NAEA 1EWQA 1KAZA 3VEYA 4WCEL 4B9NA 1T3VA 4LF5K 2JLEA 3AY9A 2E1ZA 2LSNA 4BRFA 4C23A 2E2PA 1RT6A 3ALYA 3SUQA 4KKOA 1U6ZA 3SBGA 3PY8A 4YNQA 1GLJO 1WN7A 4YOUA 3LL3A 3ZYYX 2G8KA 2NRVA 4FWQA 4IEIA 2IS3A 2ZJRL 2E2NA 5C24A 5LJVA 4U67L 4E1JA 5ELZA 1RT4A 3I55N 1JL2A 3ZT4A 2O8BA 5FRNA 4IBNA 1C6VA 4OPJA 1T6DA 1TL3A 4MDAA 4JHDB 4LF8K 2EHGA 5AQJA 3P1GA 3S3NA 1BIZA 3HSCA 3HBTA 2WC9A 2HHVA 4OKKA 2A3ZA 1HNXK 1EP4A 4C1NK 3QEPA 1SS6A 1FJGK 3AO1A 3RSEB 3AVLA 3A5LC 3VESA 3FZLA 4CEFA 1TL1A 1VSKA 3L2VA 3CQXA 1BHLA 2OTJN 4DFMA 3WT0A 3AVNA 4DHYA 4FYDA 4LSLA 5FLXO 4CCHA 5BPLA 4H0PA 1TK5A 1NK6A 4LF7K 4AHRA 4KHYA 1EO1A 3U4LA 1IKVA 3NH1A 4DR6K 4JS4A 1VQLN 4ZTJA 3P4IA 1VQ5N 3K58A 3ULEB 5KTQA 1WNSA 4J8FA 2YJFA 3DRSA 4W5RA 4RW6A 1KFSA 4M3XA 3M5RA 3FGUA 2OZMA 3MN7A 1HQUA 2HB5A 2KFZA 3QB0A 3CQYA 3ATUA 3BDPA 4BC4A 1YXQA 1Z6RA 4DTJA 1U47A 1IO2A 5J1EA 4DU3A 2OA8A 4JI4K 4CF8A 1TYQB 3WNFA 4B8CA 3CM5A 1FXXA 3T3FA 3KIOA 3V1OA 2HSTA 3K5MA 4M7XA 4JN4A 4LF6K 1BQMA 1C0TA 4GV3A 1WSHA 3FZHA 4FWNA 2YV0X 4NB4A 4IJAA 1X3NA 3HO1A 1JLCA 1HYVA 2D0AA 4AQYK 3THWB 5LJWA 4A62A 1D5AA 1J53A 5JMVA 3HZ6A 3O9RA 4CJ5A 1MWKA 1HKGA 2Q97A 4KPYA 1NJIO 3KJVA 4NYNA 2GV9A 1D9FA 4M45A 3MMVA 1RDDA 3HTVA 4YHHK 1GLLO 2KFNA 5C0YA 1X9SA 3FE1A 4DTMA 3MX2A 3T19A 3HOTA 3SUOA 1EXQA 4WFBL 2GUIA 1GLBG 1XI1A 2A1RA 4FJIA 4FJ5A 4PQUA 1TK0A 3OYHA 1GLEG 3RR7A 1HNVA 3AVMA 1WSGA 1SL1A 1KTQA 2OPPA 5KQDA 3TAQA 4E7IA 3M1FA 1WUAA 3NDKA 3SPZA 4FJXA 4CIFA 4H0VB 3L8BA 1NGDA 3MCPA 2UYTA 1ZBFA 3FFIA 1W97L 5AFUH 1NJXA 3ZEUB 2ASOA 3VTIA 4KI4A 3RMAA 1C1AA 4AHUA 3V9ZA 3VQ7A 4MQ3A 1LWEA 3M6GA 3C6AA 1Y64A 3P38A 4BR7A 5AQZA 4ILJA 5FPMA 4B1WB 2I5JA 3SQ0A 3BP8A 1YAGA 2QXLA 1K6YA 4CECA 4JD2B 2AA4A 4FCYA 2H3GX 4FLUA 1KC8O 3DMJA 3PX0A 4DF8A 2HW3A 3B8AX 3UB5A 3CPWM 5I3UA 3CCVN 4CIEA 1QVFM 4H5VA 2WBNA 4OKEA 3AO2A 3T1HK 2FSKA 3CIPA 3CM6A 5HROA 3KK2A 3ZX0A 4BWMA 4BGAA 5E84A 3FZKA 4DV0K 5J2NA 1S5JA 1M1KO 4HUEA 1KRPA 2PAVA 3PLAA 2WTUA 4CJRA 4GW6A 4LFCK 5BRHA 4HTLA 1DT9A 4FWKA 1BOTO 2P9PB 2NRHA 3CC7N 4RWTA 3FLCO 3A2FA 2HBKA 2P9LA 1XNQK 2F4VK 3SV4A 3OYIA 1VK0A 3OY9A 5J2QA 2NZTA 3H46O 3L6QA 4NYFA 1UAXA 5AQFA 3O9TA 3SZ2A 4ICLA 3ZT1A 2V51B 4H4MA 3M3ZA 1BCOA 1LWFA 1NK7A 1VSLA 1RTIA 3KWGA 3MXMA 1UA0A 2UXDK 5H1SQ 2JWKA 3LM2A 4BVPA 5CZ2A 2X6SA 1D8YA 3ZSWA 1BCMA 1N36K 1RBRA 1L5UA 1OH5A 3SAFA 3ZSYA 3G0ZA 2ATQA 3C6HA 4I6MB 3VN5A 1CZ9A 4YOYA 3RMCA 2J4RA 3W3DA 3IDHA 3LPUA 3U6FA 1YVUA 3LAMA 4CF2A 3O4QA 5AQOA 3VQAA 4CJLA 1E4FT 3AV9A 1R59O 2YX6A 4CZHA 4H0OA 1KCFA 1IBLK 1ITGA 4RG8A 4ELTA 4M7YA 2NRTA 4K25A 4Y1CA 4C8NA 5FPDA 3K5OA 4LSNA 2HHSA 1ILYA 3O9UA 1FKPA 5D3GA 3PIPL 1RDUA 4DR2K 4M41A 1S9GA 4FW2A 4JK7A 5BRDA 4CZKA 1RBSA 1NWKA 4DQRA 3THYA 3NE6A 3NVKA 1NM1A 5I9EB 4L3QA 2X74A 4RW4A 4FWMA 1VQMN 3EO3A 3V81A 4IJNA 3OYBA 1N5YA 4FLWA 3AO5A 4K41A 4QS7A 4BRDA 4N76A 5K14A 2RN2A 4DTOA 5T7BA 1SZ2A 5TKYA 1H1VA 3SYZA 3DXKA 4FOIA 4OGEA 1T8EA 2IC3A 4CJVA 3D2EA 4CHYA 3EZWA 1R0AA 3D45A 3QEWA 3CQ8A 3CFRA 5ADXH 1NMDA 2KTQA 3RWUA 3WXIA 5CYQA 3AO3A 4KFBA 3L3VA 1OH6A 1K8AO 1X3MA 1HKBA 5CR4A 1ATNA 2QEXN 3AGKA 2D0CA 4CEBA 4AF1A 4FXDA 1U2VB 5M1PA 3K5LA 4DR3K 3MXJA 3NMUA 3HP6A 1W2BM 3J7AP 4CK2A 3A5OC 3WXLA 2BANA 3PV8A 1WLJA 2CGLA 5EU7A 5EOYA 2FLOA 3AVJA 1BA0A 1D4XA 1U45A 1HNIA 3MDQA 4JLHA 1XHZA 2PYLA 4XH5A 3PO4A 3CETA 4BR9A 3O6WA 2F9WA 5SZTA 1T03A 2NRZA 4B3MK 4K8ZA 3DAWA 2G8UA 1MA9B 1YF5L 4BRCA 2OPQA 2ZQBA 4QCLA 4BE2A 5DK5A 4HCCA 1X1PA 3PSIA 4ELVA 2W40A 2ZM6K 4B8AB 5HP1A 1VSIA 2QWLA 4EHTA 2E5LK 1LWCA 5KGWA 4BRGA 4CHQA 1XHXA 4NCBA 3ISNC 3ID8A 1J9AA 2FF3B 2QXFA 1NGBA 3N4PA 4H4OA 4H0YB 4B08A 3K57A 1YIJN 4CEDA 4OO1J 3OYMA 4CZMA 4FOEA 3C6UA 1QSYA 4KH6A 3E66A 3GG4A 3SJHA 1RT1A 3TPQA 4N47A 4FVMA 4JV5K 4CZEA 4HUFA 3VTHA 4IEEA 2Z1GA 4HUGA 1YITN 3B6OA 4KB0A 3O4WA 1EETA 3KLHA 3U3GA 1C0MA 1L3TA 3U8XA 1ZBLA 4E3SA 3FZMA 1BUPA 3TSUA 2KZZA 4GV9A 4B1XB 3OYKA 3ZSVA 2HBMA 4CJEA 2FF6A 1S1WA 4GY2B 2V7ZA 3ZSXA 1HJRA 1VSJA 4FL9A 5AQYA 1IBKK 4FSVA 3EL2A 3J81O 2HBLA 1YJ9N 3WNHA 4M3TA 4FLTA 1LV5A 3R9PA 3AARA 4CEZA 5GAEP 4W5NA 2IDOA 3QFUA 4IFVA 1NOZA 4CJUA 3NHGA 1NLVA 5JS2A 1VSEA 4BE0A 3TABA 1UOCA 2HNDA 4F4KA 4M3YA 4DV5K 4KH4A 1CXQA 3QBWA 2E2QA 4CJTA 4A61A 4X65K 1BIUA 4KHPK 4DQPA 1NG9A 4FJHA 3C95A 3DLEA 3F5TA 4BRLA 3T1YK 1V4SA 3D7EO 4Z94A 5C2FA 3PIOL 3EY1A 1SKWA 4KREA 1JL1A 3S3OA 1QHTA 2O8FA 1XWLA 3HM8A 3K0SA 1B9FA 2PFUA 1JLFA 4JI5K 5GINA 4B3TK 1GOAA 4CFBA 1MU2A 1CXUA 1BI4A 1BQNA 4B9QA 1DGKN 2NRXA 2NNWA 4ISGA 4AM7A 4HHTA 1HLUA 1KXPA 2FXUA 5BN9A 4BR5A 1RDAA 3HJFA 1J5OA 1BO5O 3P83D 4JAXA 3EKSA 3SK3A 3QESA 3FFKB 2Q3SA 2YHYA 1JLGA 1FKOA 3KLFA 3DXMA 3ENBA 2Q1NA 2OTLN 1NNEA 2UUAK 3V9UA 4NXNK 3N4QA 4DSFA 3VQEA 4E1MA 4C8MA 2D5RA 1U49A 4H5NA 5EY4A 4CJQA 4IO8A 3NGZA 4FZXC 4M3RA 4W5TA 5BR9A 3RR8A 1ATRA 3CFPA 3SMSA 3DRPA 3UKRA 3KZBA 2PY5A 4YOWA 4CFCA 1RDWX 3P5JA 2IOCA 2WOMA 1UWBA 3KK7A 3O08A 3VQ5A 3HVRA 3EN9A 2KW4A 4JEPA 5LY3A 4FJ7A 5AQTA 3KTQA 3ATVA 3DOLA 3L4IA 3CCSN 3OJUA 4BGBA 3ZX3A 1Q81O 3KWIA 1JLEA 4PWDA 3CJCA 1QZ6A 4YOVA 1LW0A 3O9SA 2EX3A 4J2AA 1HUXA 4J2BA 1X9JA 3A8YA 2V52B 2OPSA 3THVA 5AZIA 3MWPA 4JK9A 3TSPA 1KD1O 3Q7BA 5BN8A 2D0BA 1RBUA 1FK9A 3V9WA 3HM9A 4B1ZA 3M8SA 1NKCA 3OS0A 1YT3A 1WOQA 3DLLL 1ZBHA 1K8KA 1RGIA 3MAQA 3IKMA 3L4QA 3TI0A 2FBTA 3A5MC 1I39A 4KHWA 4CK1A 1TAUA 4DSJA 3J8AA 1RDBA 3SI6A 4FJKA 1YHQN 1K9MO 2KKZA 3HI0A 4HCBA 2DTUA 1RTDA 2UUBK 4WFNL 3CCMN 1DTTA 2P9LB 4FWSA 5A2QO 1VSDA 3A0IX 3AA3A 5JS1A 3DM2A 2A6AA 3CCUN 4M3ZA 2QK9A 2A42A 4Z0UA 4DLEA 4B9MA 2RHKA 3CFOA 5M1QA 3UKUA 3ZETA 1Q7YO 3F2KA 2P9UB 1XMQK 1WSFA 3D6RA 5AQXA 4AM6A 4DV6K 1KAYA 4DS5A 2ZJQL 2HHUA 3OYCA 3E01A 5E41A 4CGIA 2OPRA 3AA4A 4PKIA 3CJ7A 1REVA 2GBZA 4KTWA 4CK3A 1Q8IA 4I7FA 3OW2M 2YI1A 3NF9A 3IFRA 1C0GA 3D2FA 1VSHA 3C7NA 3LAKA 1BA1A 1TKXA 3EE8A 3LP3A 3CERA 2G8WA 4BROA 1DTQA 2QM1A 2YHBA 4CEQA 2YKNA 2RPIA 1IH7A 4DFKA 3HL8A 3CC2N 4JI2K 2YKMA 3E9LA 4CJ4A 5JVGL 2G8VA 4KAZA 3LP1A 2CH5A 2HHHK 3QERA 4C8KA 1C1CA 4KTQA 4IOAL 4CD1A 4NLCA 1C0UA 1W7AA 3CJ9A 3MECA 2XHBA 3LWMA 3QEVA 4DQSA 5HRNA 3LANA 5C15A 2VQEK 4E89A 3VMFB 3K5NA 4JHDA 2P51A 4CHPA 2P9SA 3SAHA 4Z4FA 4E1NA 4FJ9A 4Z4IA 3E9OA 4DQQA 3DJCA 1HJOA 4UQGA 3AVKA 3DXKB 3PUFA 4BRNA 4CGFA 1VQ4N 1VQPN 4M3WA 2ZE2A 4CGDA 1NGEA 3F9MA 4OLBA 3WUHA 3GOIA 1HYZA 4DTUA 4CJ3A 5AZJA 3D2EB 4RCHA 3QEXA 1DLOA 4DQ8A 5KPZA 1A5XA 2G8FA 3QETA 3I0SA 3NGYA 5SWMA 3VQ6A 4WQ5C 3TAEA 4A5AA 1J54A 1S1TA 4IFEA 4N5SA 1NJZA 4QOZB 4ID1A 3VQPA 4CJWA 3VEXA 1IV0A 1VSFA 4BRAA 5KQ8A 4IFYA 2FBXA 1HPMA 1RT5A 1KVAA 3ZSOA 1N32K 4IKFA 1HMVA 3KD1E 2O8DA 1YUWA 3CCEN 4KB1A 1GLFO 1VRUA 4BDYA 4BR4A 3QIOA 1HX1A 2IIRA 3U9DA 2Q31A 4N41A 3MEEA 3TR8A 3QDKA 4OPKA 4KHQA 1BU6O 1RNHA 3UIQA 4RTFD 1RCHA 4N56A 3ZSZA 4E0DA 3O1BA 4CF0A 3K2PA 3W0LA 4JI7K 1GLDG 2RF2A 4AH9A 1O13A 5AR0A 1SKSA 2YJEA 1RBTA 5KRTA 1NK9A 4FW1A 3WXJA 2YNIA 3JSMA 2E6MA 3M8QA 1S6QA 3IS9A 4ILGB 2E6LA 3CPEA 1XNRK 4O0JA 3ZT3A 2Q2RA 3SMPA 4EZ6A 3OHRA 3I56N 3OS1A 5HRRA 4DF4A 4AHTA 4ILHA 3THWA 3HP9A 2BE2A 2IVOA 3CD6N 3TTFA 3VQ9A 4CESA 4FWOA 5DM7L 4FJJA 3O8MA 4CJSA 1Q9YA 3QO9A 4W5OA 3PX4A 5C42A 1QHAA 3KKSA 4JI1K 4MLHA 1Z26A 3BZKA 3MN5A 2QA4N 2R7YA 1QE1A 3TARA 4DR1K 5KPRA 4DR4K 4WYBA 2Z1JA 1YTUA 4FJNA 5HLFA 4CBUA 3HRGA 4JKGA 1NGCA 5AQRA 4AILC 3MXIA 2O8CA 1YJWN 2NUBA 5AQGA 4CGJA 2BGGA 5CYMA 2HVHA 4WQ5A 2QKKA 3DWLA 3VEVA 2IVPA 4H0XB 5HBMA 2F96A 3OYJA 3P39A 4CHZA 1A5WA 4CI6A 4BRHA 1YI2N 2G8HA 4BRMA 5F0XA 1I3AA 1VAZA 4DV4K 3LZJA 4O5FA 3O5BA 4IXCA 2DFFA 3V1QA 3FZFA 4Z4EA 4M42A 4DV1K 4Y1DA 4LF4K 3LDPA 4KO0A 3EE9A 4IDHA 3BUZB 1J5EK 4DFJA 1P8ZA 2KZMA 4IO9L 4BC3A 4LFBK 4BRIA 4JRPA 1RTHA 4ISEA 4EP5A 3E1YA 1DKGD 1JLAA 1SAZA 2CH6A 5AQKA 4R79A 4I9LA 4OGCA 2B6AA 3ENHA 3VERA 1KVCA 4H5TA 3L2QA 4MDBA 3SLCA 4CJPA 3J80O 5MLCQ 1SQKA 2FBVA 2QWRA 3H08A 2P9KB 4FWRA 3TAGA 1YJNN 4JI3K 4Z4GA 1ATSA 4C1NI 5M1FA 1Q18A 1IG8A 4LC9B 1RBVA 1S22A 4JKEA 2HHWA 2A40A 1JKHA 3LALA 3MN6A 4AHSA 3IG1A 1SUQA 4O4GA 1BGXT 3EEQA 1FW6A 4KRFA 5FROA 4XEIA 1BI4B 3LM9A 4YOXA 2YHWA 3VQCA 4DFPA 2QKBA 4OVLA 4G9ZA 3IMXA 4NXMK 5JLHA 1Y97A 1SKRA 2WUSA 4LY7A 3VOVA 3DXMB 4A2BA 5EVZA 2GUPA 4CD3A 2XY5A 5C12A 1YVNA 3JAMO 4KV8A 2ZJPL 4FPBA 2ZGZA 1JXBA 2JWLA 2QTDA 4CEOA 2DPNA 1WBDA 4B9VA 2O8BB 3VETA 3SCXA 3CMAN 3KKRA 4YORA 4BWJA 1Q82O 3D0PA 1EKEA 1HRHA 3G10A 5GIPA 3UKRB 4FWPA 2Z1HA 3SPYA 3QICA 2NRRA 4CJ7A 5AQVA 3SV3A 1ZYQA 4CHOA 2AP1A 4PHTX 3ZCMA
chains in the Genus database with same CATH topology
4F2RA 4F3TA 1KTQA 2OPPA 3TAQA 4E7IA 4CFCA 3P5JA 1QQCA 2IOCA 4RW7A 1VSMA 1ASWA 3NDKA 3NCIA 3SPZA 2WOMA 4KI6A 1UWBA 2OYQA 4F3OA 3ASMA 3VQ5A 4CIFA 3LWLA 3HVRA 4RW9A 3L8BA 2KW4A 4CEAA 1G15A 3DYAA 1ZBFA 2HHXA 3FFIA 3MEGA 4B9UA 4FJ7A 1HQEA 4FM0A 3KTQA 3DI6A 4C8LA 3VQ8A 4KHUA 3LP2A 4PY5A 4DTPA 5CY4A 1NJXA 3DOLA 2VWKA 3OJUA 4KI4A 4DSIA 3RMAA 4B3OA 1C1AA 4AHUA 3V9ZA 3NFAA 2PYJA 3VQ7A 1JLEA 2RKIA 4MQ3A 1LWEA 3SJJA 1RT2A 2OZSA 4PWDA 4L8RB 1LW0A 2EX3A 4J2AA 4FK4A 4J2BA 4W5QA 3LDSA 3HSTB 2OPSA 1GOBA 3KLIA 3QINA 3KLEA 2F8TA 1HPZA 2I5JA 3SQ0A 4E7HA 3THVA 3RMDA 1NKEA 1YTAA 3I0RA 3LP0A 4LH5A 3AVCA 4OKJA 2HHTA 1WSEA 1K6YA 2FC0A 1HYSA 1NK4A 4IG0A 2D0BA 1TK8A 1RBUA 4CECA 4TSXA 4BE1A 4B9TA 1FK9A 2VG6A 3HM9A 3V9WA 3M8SA 1NKCA 4LH4A 2E4LA 4BACA 4FCYA 4FLUA 3OS0A 3DMJA 2O4GA 1YT3A 3PX0A 1BL3A 3WNGA 4DF8A 2HW3A 5I3UA 1ZBHA 3ZSRA 4CIEA 3MAQA 4OJRA 3K59A 3SUNA 1KVBA 3TI0A 3EZ5A 4FJXA 4OKEA 2FBTA 3AO2A 1I39A 3KK1A 4KHWA 3VQQA 4B9SA 4FZZA 3CM6A 4FZYA 2Z1IA 1S1UA 4CK1A 3O4NA 4DSJA 3ZT0A 5HROA 1TAUA 1RDBA 3KK2A 3SI6A 3DLBA 4FJKA 1LAVA 4BWMA 1ZBIA 3TAFA 5J2NA 3OYEA 5KGXA 1S5JA 4HUEA 1KRPA 1ASUA 3AA5X 1SL1A 1W0HA 4ZHRA 1RTDA 4HCBA 2DTUA 4J2EA 4CJRA 4CIGA 3QNNA 4PUOA 4GW6A 1DTTA 4FJ8A 4PA1A 4DLGA 4QAGA 1VSDA 3AA3A 5JS1A 1RDCA 2P1JA 4MFBA 4KHNA 1GOCA 3O3FA 1T05A 3ITHA 3VA3A 1U04A 3DM2A 4M3ZA 2QK9A 3A2FA 3QNOA 3BGRA 3LZIA 4Z0UA 4DLEA 3SNNA 4B9MA 3CFOA 3KLGA 3AVBA 3HK2A 3SV4A 4EP4A 3OYIA 1VK0A 2HNYA 3OY9A 5J2QA 4DS4A 1WSFA 3M8RA 4NYFA 5J2MA 1UAXA 3M8PA 1LW2A 4E7JA 4O55A 3SZ2A 4DS5A 2HHUA 3ZSQA 3OYCA 1BISA 3E01A 4ICLA 5E41A 4CGIA 2B5JA 4E19A 3ZT1A 2OPRA 1CZBA 3AA4A 3OYLA 1TKDA 1NK0A 5J2PA 3HYFA 2ETJA 2HVIA 4CHNA 1NJYA 1TKTA 1REVA 4H4MA 1BCOA 1LWFA 2GBZA 3DOKA 3IRXA 1VSLA 1NK7A 2WONA 4DSLA 1RTIA 4KTWA 5DMRA 4CK3A 2HHQA 3AVHA 3QLHA 4I2QA 1Q8IA 4I7FA 4NCAA 2X6NA 3MXMA 3L2RA 1UA0A 3NF9A 4DTNA 3OYDA 3TANA 1WSIA 1QSSA 2B4JA 5CZ2A 2X6SA 4FLXA 1D8YA 3ZSWA 1VSHA 4IG3A 3SQ2A 1BCMA 3LAKA 1RBRA 1L5UA 1TKXA 2KQ2A 3KD5E 3ZSYA 3G0ZA 3VQDA 3L2WA 2ATQA 2ZD1A 1TGOA 3LP3A 2G8WA 3T1AA 2X78A 1DTQA 3VN5A 3V9SA 2HMIA 1CZ9A 4FLYA 3RMCA 4ZTFA 1IKYA 2YHBA 4CEQA 5I42A 4H8KA 3NGIA 2ITGA 2DFEA 2YKNA 3TAPA 4CJKA 2RPIA 1IH7A 2IAJA 3AVAA 5FDLA 4DFKA 5FRMA 3HL8A 1NK5A 1A5VA 4O0IA 2YKMA 3LPUA 3NF6A 4CJ4A 3U6FA 2G8VA 4FJGA 4KAZA 1CLQA 1YVUA 3LP1A 3LAMA 4CF2A 3O4QA 3VQAA 4CJLA 3O3HA 3QERA 3VQ4A 3AV9A 4C8KA 3DLKA 1Q9XA 5HRSA 1C1CA 2Y1JA 1KCFA 4KTQA 3S3MA 1ITGA 4CFDA 4RG8A 4ELTA 3RRGA 4Y1CA 4C8NA 3K5OA 4LSNA 2HHSA 1C0UA 3MECA 1FKPA 2XHBA 4M3UA 5D3GA 4YFUA 1KSPA 4M41A 1S9GA 4AHCA 1S9EA 4FW2A 3LWMA 3QEVA 4DQSA 5HRNA 3LANA 1RBSA 4DQRA 4E89A 3CYMA 3K5NA 3NE6A 1T7PA 3I8DA 2P51A 2X74A 4CF9A 3SQ1A 4RW4A 4OLAA 4CHPA 4Z4HA 3SUPA 4Q0BA 3KK3A 4Z4FA 4CJFA 3V81A 1B9DA 4LD0A 1UA1A 4E1NA 4FJ9A 3OYBA 1TV6A 1N5YA 1JLBA 2VWJA 4Z4IA 2JGUA 3NH2A 4DQQA 1KLMA 4Z4CA 4FLWA 3AO5A 4UQGA 3AVKA 4CGFA 3PUFA 2BDPA 4M3WA 1KFDA 2ZE2A 4CGDA 4JRQA 3LPTA 4CF1A 2DFHA 4N76A 5K14A 3NF8A 4DTRA 1QS4A 1QSLA 2RN2A 3O3GA 4DTOA 5T7BA 5CYQA 4OLBA 1HYZA 4DTUA 4CJ3A 3QEXA 4FLZA 1RT7A 1DLOA 3SYZA 1WAFA 3HT3A 4BDPA 4GMJB 4BDZA 4E7KA 1A5XA 2YNHA 4OGEA 1T8EA 4NCGA 1NOYA 2G8FA 2AJQA 2IC3A 3CG7A 3I0SA 5CZ1A 4CJVA 3QETA 4DWIA 3NGYA 3WNEA 5SWMA 3VQ6A 2Y1IA 4CHYA 2O4IA 3TAEA 1R0AA 1J54A 3D45A 3QEWA 4HVJA 3F73A 3CQ8A 3CFRA 1NK8A 1S1TA 4RW8A 3TWHA 1KLNA 3DLHA 4N5SA 1NJZA 3OYGA 4QOZB 1S6PA 4ID1A 1RTJA 3VQPA 4CJWA 3RWUA 2KTQA 1TVRA 1VSFA 1SL0A 1EX4A 3AO3A 4ID5A 2FBXA 3HVTA 4IFYA 4IDKA 1RT5A 4KFBA 1KVAA 3L3VA 3ZSOA 4JS5A 2XY7A 1NJWA 3NH0A 2FBYA 4DSEA 1O1WA 1L3SA 4IKFA 1HMVA 3KD1E 1S1XA 3S9HA 4KB1A 1VRUA 2D0CA 4CEBA 3OYNA 4BDYA 4DU1A 3QIOA 4F8RA 4DTSA 4FXDA 3K5LA 2F8SA 4KHSA 2DY4A 3MXJA 3HP6A 3AVIA 3NBPA 4N41A 3V4IA 1B92A 3MEEA 4CK2A 3TR8A 4OPKA 4KHQA 2BANA 2HNZA 4B9LA 4AHVA 4GVMA 1RNHA 3PV8A 3UIQA 1WLJA 1L3UA 4DSKA 1RCHA 5EU7A 1U45A 3AVJA 3HPHA 3ZSZA 4N56A 3HPOA 4E0DA 1HNIA 4CF0A 4CGGA 3K2PA 1TAQA 4JLHA 1TKZA 3V9XA 1C1BA 1XHZA 2PYLA 3PO4A 2RF2A 4AH9A 5SZTA 2YNFA 2W42A 1T03A 1SKSA 1NK9A 1RBTA 2A1SA 5KRTA 4FW1A 4FM1A 3RTVA 4FLVA 2YNIA 3RRHA 3JSMA 4ELUA 4I9QA 2E6MA 1WAJA 1S6QA 1S1VA 3M8QA 4G1QA 4CE9A 4K8ZA 3IS9A 3OYFA 2E6LA 3OS2A 1RILA 4O0JA 2G8UA 3OJSA 3ZT3A 4R5PA 4XIUA 4DTXA 2OPQA 4EZ6A 3NAEA 2ZQBA 3OS1A 4C8OA 5HRRA 4DF4A 4QCLA 5KRSA 4BE2A 5DK5A 4AHTA 2IGIA 4CEEA 4HCCA 1X1PA 4J2DA 4B9NA 4ELVA 2JLEA 1U48A 3HP9A 2BE2A 2LSNA 3U3YA 4O5BA 4B8AB 5HP1A 4DG1A 3QEIA 4DMNA 1VSIA 1RT6A 3VQ9A 4CESA 4FJMA 3ALYA 1LWCA 5KGWA 4KKOA 3SUQA 3PY8A 4FJJA 4CJSA 4YNQA 4CHQA 1Q9YA 1XHXA 4NCBA 1D9DA 1WN7A 3ISNC 2G8KA 4WE1A 1J9AA 2IS3A 2QXFA 3QO9A 4H4OA 4W5OA 1SV5A 3PX4A 5C42A 4B08A 5C24A 3K57A 3NF7A 3QIPA 4CEDA 3KKSA 1Z26A 1RT4A 1LAWA 3VQBA 2VG7A 3OYMA 1JL2A 3ZT4A 1RT3A 1N6QA 5FRNA 4IBNA 3ZT2A 2R7YA 1C6VA 1QE1A 3C6UA 3V6DA 3TARA 1QSYA 3PO5A 4OPJA 1TL3A 5C25A 1ZBUA 2Z1JA 4FJNA 1YTUA 1RT1A 2EHGA 5HLFA 3L3UA 3P1GA 4AILC 3MXIA 3S3NA 4DU4A 2NUBA 1BIZA 4N47A 4CGJA 2BGGA 5CYMA 2HHVA 2HVHA 4FVMA 4OKKA 3DRRA 1U4BA 4HUFA 3DRPA 1EP4A 2QKKA 3HPGA 2Z1GA 4HUGA 3QEPA 3B6OA 4KB0A 3AA2A 1EETA 3KLHA 3U3GA 5HBMA 2F96A 3OYJA 1C0MA 3AO1A 1Z25A 1L3TA 4CHZA 1JLQA 1A5WA 3AVLA 4CEFA 1TL1A 1ZBLA 2G8HA 4E3SA 3ZCMA 1VSKA 1I3AA 3L2VA 2KZZA 1BHLA 1JXEA 1NKBA 3LZJA 4DFMA 3AVNA 3OYKA 4FYDA 3OYAA 4CERA 2DFFA 1VRTA 3V1QA 4LSLA 3ZSVA 1QTMA 1IG9A 4CJEA 4CCHA 1S1WA 4Z4EA 4HTUA 3ZSXA 4KTZA 4M42A 1TK5A 1HJRA 1VSJA 4Y1DA 4AHRA 4KO0A 4I2PA 1NK6A 2P5GA 2XY6A 4KHYA 1IKVA 3NH1A 4DFJA 3OVNA 3AO4A 2KZMA 4JS4A 3WNHA 4ZTJA 4K8XA 4M3TA 2YHAA 4JRPA 3K58A 4FLTA 1RTHA 1SL2A 1LV5A 5KTQA 4EZ9A 1WNSA 4CEZA 3TAMA 4EP5A 4W5NA 1JLAA 1IKWA 4FJLA 2IDOA 4IFVA 1NOZA 4O44A 4CJUA 3NHGA 1IKXA 3JYTA 5JS2A 3DRSA 4I9LA 3AVFA 2VG5A 1VSEA 4OGCA 4W5RA 2B6AA 1WSJA 4BE0A 4RW6A 1KFSA 4M3XA 1KVCA 3TABA 3L2QA 1UOCA 2HNDA 4CJPA 2XO7A 2OZMA 4F4KA 4M3YA 1HQUA 2HB5A 2KFZA 2FBVA 1ASVA 1CXQA 3H08A 3DLGA 1X9MA 3TAGA 3BDPA 4DTJA 4CJTA 1U47A 4Z4GA 1BIUA 1IO2A 5J1EA 4DU3A 2OA8A 4DQPA 4FJHA 4CF8A 3C95A 3DLEA 3WNFA 4B8CA 3CM5A 1FXXA 3T3FA 1RBVA 3KIOA 3V1OA 3EY1A 3K5MA 1SKWA 4FK2A 2HHWA 1JKHA 3LALA 4KREA 3IAYA 1JL1A 3S3OA 4AHSA 1QHTA 3AVGA 1BQMA 3IG1A 1W9HA 1SUQA 1C0TA 4O4GA 5KI6A 1BGXT 1XC9A 1XWLA 4KRFA 5FROA 1WSHA 1L3VA 1BI4B 3DLRA 1B9FA 2YV0X 3VQCA 4FM2A 4DFPA 1JLFA 3SQ4A 2QKBA 3HO1A 1GOAA 1JLCA 1HYVA 2D0AA 3F9KA 4OVLA 3MEDA 1MU2A 4CFBA 1CXUA 1D5AA 5HRPA 1J53A 2YNGA 1BI4A 1BQNA 4DQIA 1Y97A 1F21A 1SKRA 2XRIA 3V1RA 2P5OA 3PX6A 4E7LA 4LY7A 4CJ5A 4HHTA 3RMBA 1RDAA 4CGHA 2PZSA 4KPYA 3HJFA 1J5OA 3P83D 4Q5VA 3KJVA 2XY5A 3B6PA 4NYNA 2GV9A 1D9FA 4M45A 3QESA 1X9WA 2Q3SA 1RDDA 1JLGA 1FKOA 4KV8A 4CEOA 3ULDA 1JXBA 2G8IA 3KLFA 4B9VA 2KFNA 3SCXA 3KKRA 3L2UA 1X9SA 4BWJA 3V9UA 3D0PA 4DTMA 1EKEA 2XY8A 3C6TA 3T19A 1HRHA 3G10A 3SUOA 3HXMA 2Z1HA 1EXQA 2GUIA 3EYZA 4DSFA 3SPYA 2A1RA 1XI1A 3VQEA 4FJIA 4FJ5A 4E1MA 3C94A 4CFAA 4C8MA 2D5RA 3SV3A 1ZYQA 3OYHA 1TK0A 1U49A 4PQUA 3RR7A 4CJQA 4CHOA 3NGZA 3VA0A 1HNVA 4M3RA 4W5TA 3RR8A 4F2SA 4FZXC 3CFPA 4FK0A 3AVMA 2PY5A 1WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2R A;  4F3T A;  1KTQ A;  2OPP A;  3TAQ A;  4E7I A;  4CFC A;  3P5J A;  1QQC A;  2IOC A;  4RW7 A;  1VSM A;  1ASW A;  3NDK A;  3NCI A;  3SPZ A;  2WOM A;  4KI6 A;  1UWB A;  2OYQ A;  4F3O A;  3ASM A;  3VQ5 A;  4CIF A;  3LWL A;  3HVR A;  4RW9 A;  3L8B A;  2KW4 A;  4CEA A;  1G15 A;  3DYA A;  1ZBF A;  2HHX A;  3FFI A;  3MEG A;  4B9U A;  4FJ7 A;  1HQE A;  4FM0 A;  3KTQ A;  3DI6 A;  4C8L A;  3VQ8 A;  4KHU A;  3LP2 A;  4PY5 A;  4DTP A;  5CY4 A;  1NJX A;  3DOL A;  2VWK A;  3OJU A;  4KI4 A;  4DSI A;  3RMA A;  4B3O A;  1C1A A;  4AHU A;  3V9Z A;  3NFA A;  2PYJ A;  3VQ7 A;  1JLE A;  2RKI A;  4MQ3 A;  1LWE A;  3SJJ A;  1RT2 A;  2OZS A;  4PWD A;  4L8R B;  1LW0 A;  2EX3 A;  4J2A A;  4FK4 A;  4J2B A;  4W5Q A;  3LDS A;  3HST B;  2OPS A;  1GOB A;  3KLI A;  3QIN A;  3KLE A;  2F8T A;  1HPZ A;  2I5J A;  3SQ0 A;  4E7H A;  3THV A;  3RMD A;  1NKE A;  1YTA A;  3I0R A;  3LP0 A;  4LH5 A;  3AVC A;  4OKJ A;  2HHT A;  1WSE A;  1K6Y A;  2FC0 A;  1HYS A;  1NK4 A;  4IG0 A;  2D0B A;  1TK8 A;  1RBU A;  4CEC A;  4TSX A;  4BE1 A;  4B9T A;  1FK9 A;  2VG6 A;  3HM9 A;  3V9W A;  3M8S A;  1NKC A;  4LH4 A;  2E4L A;  4BAC A;  4FCY A;  4FLU A;  3OS0 A;  3DMJ A;  2O4G A;  1YT3 A;  3PX0 A;  1BL3 A;  3WNG A;  4DF8 A;  2HW3 A;  5I3U A;  1ZBH A;  3ZSR A;  4CIE A;  3MAQ A;  4OJR A;  3K59 A;  3SUN A;  1KVB A;  3TI0 A;  3EZ5 A;  4FJX A;  4OKE A;  2FBT A;  3AO2 A;  1I39 A;  3KK1 A;  4KHW A;  3VQQ A;  4B9S A;  4FZZ A;  3CM6 A;  4FZY A;  2Z1I A;  1S1U A;  4CK1 A;  3O4N A;  4DSJ A;  3ZT0 A;  5HRO A;  1TAU A;  1RDB A;  3KK2 A;  3SI6 A;  3DLB A;  4FJK A;  1LAV A;  4BWM A;  1ZBI A;  3TAF A;  5J2N A;  3OYE A;  5KGX A;  1S5J A;  4HUE A;  1KRP A;  1ASU A;  3AA5 X;  1SL1 A;  1W0H A;  4ZHR A;  1RTD A;  4HCB A;  2DTU A;  4J2E A;  4CJR A;  4CIG A;  3QNN A;  4PUO A;  4GW6 A;  1DTT A;  4FJ8 A;  4PA1 A;  4DLG A;  4QAG A;  1VSD A;  3AA3 A;  5JS1 A;  1RDC A;  2P1J A;  4MFB A;  4KHN A;  1GOC A;  3O3F A;  1T05 A;  3ITH A;  3VA3 A;  1U04 A;  3DM2 A;  4M3Z A;  2QK9 A;  3A2F A;  3QNO A;  3BGR A;  3LZI A;  4Z0U A;  4DLE A;  3SNN A;  4B9M A;  3CFO A;  3KLG A;  3AVB A;  3HK2 A;  3SV4 A;  4EP4 A;  3OYI A;  1VK0 A;  2HNY A;  3OY9 A;  5J2Q A;  4DS4 A;  1WSF A;  3M8R A;  4NYF A;  5J2M A;  1UAX A;  3M8P A;  1LW2 A;  4E7J A;  4O55 A;  3SZ2 A;  4DS5 A;  2HHU A;  3ZSQ A;  3OYC A;  1BIS A;  3E01 A;  4ICL A;  5E41 A;  4CGI A;  2B5J A;  4E19 A;  3ZT1 A;  2OPR A;  1CZB A;  3AA4 A;  3OYL A;  1TKD A;  1NK0 A;  5J2P A;  3HYF A;  2ETJ A;  2HVI A;  4CHN A;  1NJY A;  1TKT A;  1REV A;  4H4M A;  1BCO A;  1LWF A;  2GBZ A;  3DOK A;  3IRX A;  1VSL A;  1NK7 A;  2WON A;  4DSL A;  1RTI A;  4KTW A;  5DMR A;  4CK3 A;  2HHQ A;  3AVH A;  3QLH A;  4I2Q A;  1Q8I A;  4I7F A;  4NCA A;  2X6N A;  3MXM A;  3L2R A;  1UA0 A;  3NF9 A;  4DTN A;  3OYD A;  3TAN A;  1WSI A;  1QSS A;  2B4J A;  5CZ2 A;  2X6S A;  4FLX A;  1D8Y A;  3ZSW A;  1VSH A;  4IG3 A;  3SQ2 A;  1BCM A;  3LAK A;  1RBR A;  1L5U A;  1TKX A;  2KQ2 A;  3KD5 E;  3ZSY A;  3G0Z A;  3VQD A;  3L2W A;  2ATQ A;  2ZD1 A;  1TGO A;  3LP3 A;  2G8W A;  3T1A A;  2X78 A;  1DTQ A;  3VN5 A;  3V9S A;  2HMI A;  1CZ9 A;  4FLY A;  3RMC A;  4ZTF A;  1IKY A;  2YHB A;  4CEQ A;  5I42 A;  4H8K A;  3NGI A;  2ITG A;  2DFE A;  2YKN A;  3TAP A;  4CJK A;  2RPI A;  1IH7 A;  2IAJ A;  3AVA A;  5FDL A;  4DFK A;  5FRM A;  3HL8 A;  1NK5 A;  1A5V A;  4O0I A;  2YKM A;  3LPU A;  3NF6 A;  4CJ4 A;  3U6F A;  2G8V A;  4FJG A;  4KAZ A;  1CLQ A;  1YVU A;  3LP1 A;  3LAM A;  4CF2 A;  3O4Q A;  3VQA A;  4CJL A;  3O3H A;  3QER A;  3VQ4 A;  3AV9 A;  4C8K A;  3DLK A;  1Q9X A;  5HRS A;  1C1C A;  2Y1J A;  1KCF A;  4KTQ A;  3S3M A;  1ITG A;  4CFD A;  4RG8 A;  4ELT A;  3RRG A;  4Y1C A;  4C8N A;  3K5O A;  4LSN A;  2HHS A;  1C0U A;  3MEC A;  1FKP A;  2XHB A;  4M3U A;  5D3G A;  4YFU A;  1KSP A;  4M41 A;  1S9G A;  4AHC A;  1S9E A;  4FW2 A;  3LWM A;  3QEV A;  4DQS A;  5HRN A;  3LAN A;  1RBS A;  4DQR A;  4E89 A;  3CYM A;  3K5N A;  3NE6 A;  1T7P A;  3I8D A;  2P51 A;  2X74 A;  4CF9 A;  3SQ1 A;  4RW4 A;  4OLA A;  4CHP A;  4Z4H A;  3SUP A;  4Q0B A;  3KK3 A;  4Z4F A;  4CJF A;  3V81 A;  1B9D A;  4LD0 A;  1UA1 A;  4E1N A;  4FJ9 A;  3OYB A;  1TV6 A;  1N5Y A;  1JLB A;  2VWJ A;  4Z4I A;  2JGU A;  3NH2 A;  4DQQ A;  1KLM A;  4Z4C A;  4FLW A;  3AO5 A;  4UQG A;  3AVK A;  4CGF A;  3PUF A;  2BDP A;  4M3W A;  1KFD A;  2ZE2 A;  4CGD A;  4JRQ A;  3LPT A;  4CF1 A;  2DFH A;  4N76 A;  5K14 A;  3NF8 A;  4DTR A;  1QS4 A;  1QSL A;  2RN2 A;  3O3G A;  4DTO A;  5T7B A;  5CYQ A;  4OLB A;  1HYZ A;  4DTU A;  4CJ3 A;  3QEX A;  4FLZ A;  1RT7 A;  1DLO A;  3SYZ A;  1WAF A;  3HT3 A;  4BDP A;  4GMJ B;  4BDZ A;  4E7K A;  1A5X A;  2YNH A;  4OGE A;  1T8E A;  4NCG A;  1NOY A;  2G8F A;  2AJQ A;  2IC3 A;  3CG7 A;  3I0S A;  5CZ1 A;  4CJV A;  3QET A;  4DWI A;  3NGY A;  3WNE A;  5SWM A;  3VQ6 A;  2Y1I A;  4CHY A;  2O4I A;  3TAE A;  1R0A A;  1J54 A;  3D45 A;  3QEW A;  4HVJ A;  3F73 A;  3CQ8 A;  3CFR A;  1NK8 A;  1S1T A;  4RW8 A;  3TWH A;  1KLN A;  3DLH A;  4N5S A;  1NJZ A;  3OYG A;  4QOZ B;  1S6P A;  4ID1 A;  1RTJ A;  3VQP A;  4CJW A;  3RWU A;  2KTQ A;  1TVR A;  1VSF A;  1SL0 A;  1EX4 A;  3AO3 A;  4ID5 A;  2FBX A;  3HVT A;  4IFY A;  4IDK A;  1RT5 A;  4KFB A;  1KVA A;  3L3V A;  3ZSO A;  4JS5 A;  2XY7 A;  1NJW A;  3NH0 A;  2FBY A;  4DSE A;  1O1W A;  1L3S A;  4IKF A;  1HMV A;  3KD1 E;  1S1X A;  3S9H A;  4KB1 A;  1VRU A;  2D0C A;  4CEB A;  3OYN A;  4BDY A;  4DU1 A;  3QIO A;  4F8R A;  4DTS A;  4FXD A;  3K5L A;  2F8S A;  4KHS A;  2DY4 A;  3MXJ A;  3HP6 A;  3AVI A;  3NBP A;  4N41 A;  3V4I A;  1B92 A;  3MEE A;  4CK2 A;  3TR8 A;  4OPK A;  4KHQ A;  2BAN A;  2HNZ A;  4B9L A;  4AHV A;  4GVM A;  1RNH A;  3PV8 A;  3UIQ A;  1WLJ A;  1L3U A;  4DSK A;  1RCH A;  5EU7 A;  1U45 A;  3AVJ A;  3HPH A;  3ZSZ A;  4N56 A;  3HPO A;  4E0D A;  1HNI A;  4CF0 A;  4CGG A;  3K2P A;  1TAQ A;  4JLH A;  1TKZ A;  3V9X A;  1C1B A;  1XHZ A;  2PYL A;  3PO4 A;  2RF2 A;  4AH9 A;  5SZT A;  2YNF A;  2W42 A;  1T03 A;  1SKS A;  1NK9 A;  1RBT A;  2A1S A;  5KRT A;  4FW1 A;  4FM1 A;  3RTV A;  4FLV A;  2YNI A;  3RRH A;  3JSM A;  4ELU A;  4I9Q A;  2E6M A;  1WAJ A;  1S6Q A;  1S1V A;  3M8Q A;  4G1Q A;  4CE9 A;  4K8Z A;  3IS9 A;  3OYF A;  2E6L A;  3OS2 A;  1RIL A;  4O0J A;  2G8U A;  3OJS A;  3ZT3 A;  4R5P A;  4XIU A;  4DTX A;  2OPQ A;  4EZ6 A;  3NAE A;  2ZQB A;  3OS1 A;  4C8O A;  5HRR A;  4DF4 A;  4QCL A;  5KRS A;  4BE2 A;  5DK5 A;  4AHT A;  2IGI A;  4CEE A;  4HCC A;  1X1P A;  4J2D A;  4B9N A;  4ELV A;  2JLE A;  1U48 A;  3HP9 A;  2BE2 A;  2LSN A;  3U3Y A;  4O5B A;  4B8A B;  5HP1 A;  4DG1 A;  3QEI A;  4DMN A;  1VSI A;  1RT6 A;  3VQ9 A;  4CES A;  4FJM A;  3ALY A;  1LWC A;  5KGW A;  4KKO A;  3SUQ A;  3PY8 A;  4FJJ A;  4CJS A;  4YNQ A;  4CHQ A;  1Q9Y A;  1XHX A;  4NCB A;  1D9D A;  1WN7 A;  3ISN C;  2G8K A;  4WE1 A;  1J9A A;  2IS3 A;  2QXF A;  3QO9 A;  4H4O A;  4W5O A;  1SV5 A;  3PX4 A;  5C42 A;  4B08 A;  5C24 A;  3K57 A;  3NF7 A;  3QIP A;  4CED A;  3KKS A;  1Z26 A;  1RT4 A;  1LAW A;  3VQB A;  2VG7 A;  3OYM A;  1JL2 A;  3ZT4 A;  1RT3 A;  1N6Q A;  5FRN A;  4IBN A;  3ZT2 A;  2R7Y A;  1C6V A;  1QE1 A;  3C6U A;  3V6D A;  3TAR A;  1QSY A;  3PO5 A;  4OPJ A;  1TL3 A;  5C25 A;  1ZBU A;  2Z1J A;  4FJN A;  1YTU A;  1RT1 A;  2EHG A;  5HLF A;  3L3U A;  3P1G A;  4AIL C;  3MXI A;  3S3N A;  4DU4 A;  2NUB A;  1BIZ A;  4N47 A;  4CGJ A;  2BGG A;  5CYM A;  2HHV A;  2HVH A;  4FVM A;  4OKK A;  3DRR A;  1U4B A;  4HUF A;  3DRP A;  1EP4 A;  2QKK A;  3HPG A;  2Z1G A;  4HUG A;  3QEP A;  3B6O A;  4KB0 A;  3AA2 A;  1EET A;  3KLH A;  3U3G A;  5HBM A;  2F96 A;  3OYJ A;  1C0M A;  3AO1 A;  1Z25 A;  1L3T A;  4CHZ A;  1JLQ A;  1A5W A;  3AVL A;  4CEF A;  1TL1 A;  1ZBL A;  2G8H A;  4E3S A;  3ZCM A;  1VSK A;  1I3A A;  3L2V A;  2KZZ A;  1BHL A;  1JXE A;  1NKB A;  3LZJ A;  4DFM A;  3AVN A;  3OYK A;  4FYD A;  3OYA A;  4CER A;  2DFF A;  1VRT A;  3V1Q A;  4LSL A;  3ZSV A;  1QTM A;  1IG9 A;  4CJE A;  4CCH A;  1S1W A;  4Z4E A;  4HTU A;  3ZSX A;  4KTZ A;  4M42 A;  1TK5 A;  1HJR A;  1VSJ A;  4Y1D A;  4AHR A;  4KO0 A;  4I2P A;  1NK6 A;  2P5G A;  2XY6 A;  4KHY A;  1IKV A;  3NH1 A;  4DFJ A;  3OVN A;  3AO4 A;  2KZM A;  4JS4 A;  3WNH A;  4ZTJ A;  4K8X A;  4M3T A;  2YHA A;  4JRP A;  3K58 A;  4FLT A;  1RTH A;  1SL2 A;  1LV5 A;  5KTQ A;  4EZ9 A;  1WNS A;  4CEZ A;  3TAM A;  4EP5 A;  4W5N A;  1JLA A;  1IKW A;  4FJL A;  2IDO A;  4IFV A;  1NOZ A;  4O44 A;  4CJU A;  3NHG A;  1IKX A;  3JYT A;  5JS2 A;  3DRS A;  4I9L A;  3AVF A;  2VG5 A;  1VSE A;  4OGC A;  4W5R A;  2B6A A;  1WSJ A;  4BE0 A;  4RW6 A;  1KFS A;  4M3X A;  1KVC A;  3TAB A;  3L2Q A;  1UOC A;  2HND A;  4CJP A;  2XO7 A;  2OZM A;  4F4K A;  4M3Y A;  1HQU A;  2HB5 A;  2KFZ A;  2FBV A;  1ASV A;  1CXQ A;  3H08 A;  3DLG A;  1X9M A;  3TAG A;  3BDP A;  4DTJ A;  4CJT A;  1U47 A;  4Z4G A;  1BIU A;  1IO2 A;  5J1E A;  4DU3 A;  2OA8 A;  4DQP A;  4FJH A;  4CF8 A;  3C95 A;  3DLE A;  3WNF A;  4B8C A;  3CM5 A;  1FXX A;  3T3F A;  1RBV A;  3KIO A;  3V1O A;  3EY1 A;  3K5M A;  1SKW A;  4FK2 A;  2HHW A;  1JKH A;  3LAL A;  4KRE A;  3IAY A;  1JL1 A;  3S3O A;  4AHS A;  1QHT A;  3AVG A;  1BQM A;  3IG1 A;  1W9H A;  1SUQ A;  1C0T A;  4O4G A;  5KI6 A;  1BGX T;  1XC9 A;  1XWL A;  4KRF A;  5FRO A;  1WSH A;  1L3V A;  1BI4 B;  3DLR A;  1B9F A;  2YV0 X;  3VQC A;  4FM2 A;  4DFP A;  1JLF A;  3SQ4 A;  2QKB A;  3HO1 A;  1GOA A;  1JLC A;  1HYV A;  2D0A A;  3F9K A;  4OVL A;  3MED A;  1MU2 A;  4CFB A;  1CXU A;  1D5A A;  5HRP A;  1J53 A;  2YNG A;  1BI4 A;  1BQN A;  4DQI A;  1Y97 A;  1F21 A;  1SKR A;  2XRI A;  3V1R A;  2P5O A;  3PX6 A;  4E7L A;  4LY7 A;  4CJ5 A;  4HHT A;  3RMB A;  1RDA A;  4CGH A;  2PZS A;  4KPY A;  3HJF A;  1J5O A;  3P83 D;  4Q5V A;  3KJV A;  2XY5 A;  3B6P A;  4NYN A;  2GV9 A;  1D9F A;  4M45 A;  3QES A;  1X9W A;  2Q3S A;  1RDD A;  1JLG A;  1FKO A;  4KV8 A;  4CEO A;  3ULD A;  1JXB A;  2G8I A;  3KLF A;  4B9V A;  2KFN A;  3SCX A;  3KKR A;  3L2U A;  1X9S A;  4BWJ A;  3V9U A;  3D0P A;  4DTM A;  1EKE A;  2XY8 A;  3C6T A;  3T19 A;  1HRH A;  3G10 A;  3SUO A;  3HXM A;  2Z1H A;  1EXQ A;  2GUI A;  3EYZ A;  4DSF A;  3SPY A;  2A1R A;  1XI1 A;  3VQE A;  4FJI A;  4FJ5 A;  4E1M A;  3C94 A;  4CFA A;  4C8M A;  2D5R A;  3SV3 A;  1ZYQ A;  3OYH A;  1TK0 A;  1U49 A;  4PQU A;  3RR7 A;  4CJQ A;  4CHO A;  3NGZ A;  3VA0 A;  1HNV A;  4M3R A;  4W5T A;  3RR8 A;  4F2S A;  4FZX C;  3CFP A;  4FK0 A;  3AVM A;  2PY5 A;  1WSG A; 
#chains in the Genus database with same CATH topology
 4F3T A;  3WXK A;  1QQC A;  1VSM A;  4K42 A;  1ASW A;  3NCI A;  4KI6 A;  4F3O A;  3LWL A;  3I33 A;  4K43 A;  1G15 A;  4EAH D;  2GEL A;  5E26 A;  2HHX A;  3MEG A;  1HQE A;  4FM0 A;  4KHU A;  3LP2 A;  4DTP A;  5CY4 A;  3OTO K;  3R6M A;  2D4W A;  2VWK A;  4HWI A;  4DSI A;  4B3O A;  1HNZ K;  2PYJ A;  3NFA A;  4IZ9 A;  2RKI A;  3T69 A;  1RT2 A;  3SJJ A;  1QZ5 A;  3MX5 A;  4FK4 A;  4W5Q A;  3CXC M;  3LDS A;  3K9J A;  3KLI A;  4A2A A;  2F8T A;  4MO5 A;  4DV2 K;  1TUU A;  1QQM A;  3RMD A;  3CCL N;  1NKE A;  1YTA A;  3I0R A;  4MO4 A;  3WXM B;  1JJ2 M;  3AAP A;  3H3N O;  4LH5 A;  3AVC A;  4OKJ A;  4OPA A;  4BC2 A;  1NGJ A;  1TK8 A;  5M1O A;  3CJ1 A;  4TSX A;  4BE1 A;  2VG6 A;  5AQP A;  1OVQ A;  2VGN A;  2E4L A;  4BAC A;  2O4G A;  1TUY A;  4CZI A;  1BL3 A;  3WNG A;  3ZSR A;  3K59 A;  3SUN A;  3EZ5 A;  4IOX A;  5AQL A;  3KK1 A;  2P9I A;  2BH1 A;  4B9S A;  3OBW A;  4FZZ A;  4BR0 A;  5CE3 A;  4DUZ K;  2Z1I A;  2ZWH A;  3DLB A;  4PKG A;  1ZBI A;  3Q7C A;  3JXU A;  3CME N;  1JCE A;  5AQW A;  1W0H A;  4J2E A;  4CIG A;  3G25 A;  3QNN A;  4X66 K;  2ITM A;  3THX A;  4DLG A;  3UKU B;  4QAG A;  1RDC A;  4KHN A;  4MFB A;  3ITH A;  3VA3 A;  1U04 A;  1VHX A;  3BGR A;  3QNO A;  3SNN A;  1OVY A;  2Q0U A;  3KLG A;  3AVB A;  4EP4 A;  5BPN A;  2RE2 A;  4DS4 A;  1U2V A;  3M8R A;  5J2M A;  1NGA A;  1LW2 A;  3M8P A;  1BDG A;  2YHX A;  2B5J A;  4E19 A;  1CZB A;  3OYL A;  1TKD A;  1XUP O;  5J2P A;  3HYF A;  2ETJ A;  5BPM A;  3IRX A;  3DOK A;  3D2F B;  4DSL A;  3C7N B;  4KBO A;  5DMR A;  1M90 O;  2HHQ A;  3AVH A;  3CCQ N;  4NCA A;  1VQ7 N;  2X6N A;  3L2R A;  5TKW A;  1WSI A;  4IOC L;  4FLX A;  4BRK A;  4IG3 A;  3R1X A;  3SQ2 A;  3KD5 E;  3VQD A;  3MCA B;  1TGO A;  2Q36 A;  2X78 A;  5AQQ A;  2HMI A;  2GTD A;  4FLY A;  4K0K K;  1IKY A;  4H8K A;  3O80 A;  2IAJ A;  3AVA A;  5FRM A;  3J7Z O;  1NK5 A;  1A5V A;  3NF6 A;  4FJG A;  1ZXO A;  4JYA K;  3O3H A;  4ISF A;  3VQ4 A;  4DCH A;  3C65 A;  5HRS A;  3H1Q A;  2Y1J A;  3VF2 A;  4CFD A;  5AQN A;  4U7B A;  3RRG A;  5C2D A;  2HF3 A;  1NGH A;  1KSP A;  3CCR N;  3GDQ A;  1S9E A;  2P9S B;  1VQK N;  3LDN A;  4NO7 A;  2F9T A;  1VQ9 N;  2BTF A;  3CYM A;  4CBX A;  1EQY A;  3I8D A;  2E1Y A;  3BF3 A;  4CF9 A;  3SQ1 A;  4OLA A;  5KPT A;  4Z4H A;  3CC4 N;  3VEN A;  3SUP A;  4Q0B A;  3KK3 A;  4H03 B;  4CJF A;  1B9D A;  4LD0 A;  1WBB A;  5FPN A;  4JKD A;  2F7T A;  2VWJ A;  5AZJ B;  2JGU A;  1S3X A;  1KLM A;  4Z4C A;  2BDP A;  2P9N A;  1KFD A;  1N8R O;  4H5R A;  4JRQ A;  3LPT A;  1S72 N;  2DFH A;  2FSJ A;  3WEE A;  4DV7 K;  3NF8 A;  4DTR A;  2D1K A;  4MLE A;  3HT3 A;  4BDP A;  1ZBS A;  4GMJ B;  4BDZ A;  4E7K A;  2QI2 A;  2AJQ A;  3EKU A;  1E3M A;  3WNE A;  2UXC K;  2YCH A;  4HVJ A;  5GIO A;  3CF5 L;  5CHI A;  3TWH A;  3DLH A;  4B3S K;  1S6P A;  2O8D B;  3GBT A;  3OBY A;  4A57 A;  4JKA A;  4ID5 A;  4WF9 L;  3HVT A;  4JS5 A;  4IDK A;  2XY7 A;  3NH0 A;  4BRE A;  2FBY A;  3VGM A;  1RFQ A;  3S9H A;  4PKH A;  4DU1 A;  3MN9 A;  4F8R A;  4KHS A;  2DY4 A;  4GKK K;  2EWS A;  4QS9 A;  3NBP A;  2O8E A;  3VGL A;  5HL7 L;  3TU5 A;  2VYP A;  4M63 C;  4AHV A;  4DUY K;  4GVM A;  4JI6 K;  4PL7 A;  3GE1 A;  4OX9 K;  3HPO A;  2NLX A;  4Y0W A;  3UE5 A;  4CGG A;  1TAQ A;  1TKZ A;  3QFP A;  3CJA A;  3QML A;  2W42 A;  2YNF A;  4O8K A;  4BY9 C;  3I8B A;  2A1S A;  4FM1 A;  4ELU A;  3RRH A;  4I9Q A;  1WAJ A;  4G1Q A;  1S1V A;  2GWJ A;  4CE9 A;  1LCU A;  3OS2 A;  1RIL A;  3OJS A;  3O9Q A;  4C8O A;  5KRS A;  1J6Z A;  5AQU A;  2E88 A;  2IGI A;  4EIA A;  4CEE A;  5BRF A;  4J2D A;  3RVC A;  1NU0 A;  5FPE A;  1U48 A;  3U3Y A;  4O5B A;  1K73 O;  1ESV A;  4DG1 A;  3QEI A;  4BRQ A;  4DMN A;  2QWN A;  4FJM A;  1GLA G;  4WQ4 C;  2I7N A;  1D9D A;  3VF4 A;  1KQS M;  4WE1 A;  4FPA A;  1SV5 A;  2CGK A;  3NF7 A;  4FO0 A;  1N33 K;  3QIP A;  3AAQ A;  4JKG B;  2O8C B;  1LAW A;  3VQB A;  2VG7 A;  1N6Q A;  1RT3 A;  3ZT2 A;  2I7P A;  4A59 A;  3PO5 A;  3V6D A;  1NGI A;  5AQH A;  2OAN A;  3THY B;  5C25 A;  5LMN K;  1ZBU A;  4PL8 A;  3BY5 A;  3L3U A;  4DU4 A;  4JK8 A;  4CW7 B;  2PBD A;  3DRR A;  5AQM A;  4BG8 A;  1U4B A;  3P31 A;  4DB3 A;  4LFA K;  3BF1 A;  3HPG A;  4DR7 K;  3E9P A;  4H5W A;  3AA2 A;  4GVE A;  2GX9 A;  1Z25 A;  1JLQ A;  2QWQ A;  1JXE A;  1NKB A;  4KH5 A;  2HBJ A;  1Z05 A;  2HOE A;  5AQI A;  1IJJ A;  3OYA A;  4CER A;  3RSE A;  1VRT A;  1QTM A;  1IG9 A;  4IWV A;  4EHU A;  4HTU A;  4KTZ A;  1T44 A;  2P5G A;  2FSN A;  4I2P A;  2XY6 A;  2VWB A;  3OVN A;  3AO4 A;  4JKC A;  4K8X A;  2YHA A;  1SL2 A;  3VEO A;  4EZ9 A;  1HNW K;  5BRE A;  3TAM A;  1LOT B;  2A41 A;  1IKW A;  4FJL A;  5AFU A;  4O44 A;  1IKX A;  3JYT A;  3SBT A;  3AVF A;  2VG5 A;  4CZL A;  1WSJ A;  3ULE A;  4YY3 K;  3BEX A;  4LF9 K;  2HMP A;  3VPZ A;  3AGR A;  2XO7 A;  4CZG A;  1HR0 K;  1ASV A;  3DLG A;  1X9M A;  1E4G T;  4BQL A;  3KHY A;  5C10 A;  1XQS C;  3CI5 A;  4JKH A;  2VQF K;  3O1W A;  3TTC A;  4FK2 A;  3IAY A;  3AVG A;  3LDO A;  1W9H A;  4WQ4 A;  1TYQ A;  5KI6 A;  1XC9 A;  5F2R A;  4BR2 A;  1WB9 A;  1L3V A;  2W6K A;  3DLR A;  4FM2 A;  3SQ4 A;  3TSQ A;  3R3L A;  3F9K A;  5EXW A;  3MED A;  3H45 C;  3L0Q A;  5LMU K;  1NMN A;  1VQ8 N;  5HRP A;  2YNG A;  4DQI A;  1F21 A;  2XRI A;  3V1R A;  2P5O A;  3PX6 A;  3FR0 A;  4E7L A;  3RMB A;  5F1X A;  2ZF5 O;  2P9U A;  2VGM A;  4CGH A;  2PZS A;  4Q5V A;  3A5N C;  3B6P A;  3G71 N;  1X9W A;  3ULD A;  2G8I A;  4YOT A;  4BQZ A;  1CZA N;  4BG9 A;  3L2U A;  2BUP A;  2XY8 A;  3C6T A;  3U9Z A;  2QWO A;  3HXM A;  5HOO A;  3EYZ A;  5GAD P;  3C94 A;  4CFA A;  3OA9 A;  3SAG A;  3VA0 A;  2UU9 K;  4FK0 A;  2W6L A;  4F2S A;  4F2R A;  4B3R K;  3WQT A;  4BC5 A;  4B1Y B;  4RW7 A;  2OCE A;  4CZJ A;  2OYQ A;  3ASM A;  4RW9 A;  1P90 A;  4CEA A;  3DYA A;  5GAH P;  2IVN A;  4B9U A;  3C0B A;  4PY5 A;  3DI6 A;  4C8L A;  3VQ8 A;  2A5X A;  4XH1 A;  3LDL A;  1OH7 A;  1VQO N;  3HOS A;  2HF4 A;  2UUC K;  2OZS A;  1V4T A;  4L8R B;  3ZEU A;  5EX5 A;  5BR8 K;  3HST B;  4DR5 K;  1GOB A;  3KLE A;  3QIN A;  1HPZ A;  4E7H A;  4X62 K;  3LP0 A;  4O8U A;  2HHT A;  1WSE A;  2FC0 A;  1HYS A;  1NK4 A;  4IG0 A;  4DV3 K;  4B1V A;  4B9T A;  3CJB A;  1VQN N;  4LH4 A;  3CHW A;  2P9I B;  2NRW A;  3JS6 A;  3QBX A;  4OJR A;  1KVB A;  4JD2 A;  4XH4 A;  1IBM K;  2CGJ A;  4GNI A;  4QS8 A;  3VQQ A;  4FZY A;  5B8H A;  2GWK A;  1S1U A;  5M1N A;  3O4N A;  3ZT0 A;  2ASP A;  3THX B;  1LAV A;  2GEM A;  2O8F B;  3TAF A;  3ENO A;  3OYE A;  4F9O A;  5KGX A;  1ASU A;  3AA5 X;  2V7Y A;  4ZHR A;  2KLA A;  4PUO A;  1T6C A;  1C0F A;  4PA1 A;  3G4S N;  4FJ8 A;  2P1J A;  1I94 K;  4BRP A;  1GOC A;  3O3F A;  1T05 A;  3H3O B;  4GV6 A;  3IUC A;  3NVM A;  3LZI A;  3HK2 A;  4OPH A;  2HNY A;  2P9P A;  1GLC G;  2QWP A;  5ADX A;  4GKJ K;  3ZLJ A;  4E7J A;  4O55 A;  3LDQ A;  3VF6 A;  3ZSQ A;  1BIS A;  1NGG A;  3KVG A;  1NK0 A;  5GAG P;  2HVI A;  5AQS A;  2QWM A;  4CHN A;  2D0P A;  1TKT A;  1NJY A;  1N34 K;  3BZC A;  2WON A;  3PSF A;  4YDU C;  3QLH A;  1G99 A;  4I2Q A;  4CZF A;  3WQU A;  4DTN A;  3OYD A;  3TAN A;  1QSS A;  2B4J A;  4JI0 K;  3J7Y P;  4CVN E;  2KQ2 A;  3L2W A;  2ZD1 A;  3T1A A;  3V9S A;  1QQN A;  1BG3 A;  4ZTF A;  1JCG A;  5I42 A;  4V19 S;  3NGI A;  1EWR A;  2DFE A;  2ITG A;  3TAP A;  4CJK A;  1OKJ A;  5FDL A;  4O0I A;  1CLQ A;  4I6M A;  2UXB K;  3VGK A;  3DLK A;  2WFB A;  1Q9X A;  1OH8 A;  3S3M A;  2QW9 A;  1QVG M;  1NBW A;  3K9K A;  2E20 A;  4JNE A;  4M3U A;  4YFU A;  4AHC A;  5AZI B;  1KAX A;  4JKF A;  1T7P A;  1NGF A;  2P9N B;  4DKW A;  3T7Z A;  3WEE B;  1UA1 A;  1TV6 A;  1JLB A;  4JI8 K;  2ASM A;  4B1U B;  3NH2 A;  3R8E A;  3MK6 A;  1XC3 A;  1K8K B;  3MWT A;  4CF1 A;  1QS4 A;  2KHO A;  1QSL A;  3O3G A;  3ID6 A;  4FLZ A;  1RT7 A;  1MWM A;  1WAF A;  5IT9 O;  3TTD A;  2YNH A;  1ZC6 A;  1NOY A;  4FWL A;  4NCG A;  4NLB A;  3VEZ A;  3VEW A;  3CG7 A;  5CZ1 A;  4DWI A;  5IWA K;  2Q0R A;  3H1V X;  1QQO A;  5JLF A;  5DM6 L;  2Y1I A;  2O4I A;  2D0O A;  3F73 A;  1VQ6 N;  1NK8 A;  4RW8 A;  1KLN A;  3OYG A;  1RTJ A;  1MDU B;  1TVR A;  1SL0 A;  3S41 A;  1EX4 A;  4EFH A;  5M1K A;  4X64 K;  1NJW A;  1JCF A;  2E2O A;  4A5B A;  2ZGY A;  2O8E B;  4DSE A;  1O1W A;  1L3S A;  4YDU A;  1S1X A;  5JIC A;  3ZET B;  3OYN A;  4DTS A;  1DEJ A;  3G6E N;  2F8S A;  4WFA L;  4CBW A;  3AVI A;  3CCJ N;  3V4I A;  1B92 A;  5AJ3 K;  4FVU A;  4JKB A;  2HNZ A;  4B9L A;  3GL1 A;  2P9K A;  1L3U A;  1Q86 O;  2E8A A;  2VCP A;  5LL6 Z;  4DSK A;  3HPH A;  4UY8 O;  3V9X A;  2W41 A;  1C1B A;  1XMO K;  3RTV A;  4FLV A;  3ZX2 A;  4BVO A;  5JVH L;  3OYF A;  1BWF O;  1HKC A;  4R5P A;  3H6E A;  4H0T B;  4XIU A;  4DTX A;  3NAE A;  1EWQ A;  1KAZ A;  3VEY A;  4WCE L;  4B9N A;  1T3V A;  4LF5 K;  2JLE A;  3AY9 A;  2E1Z A;  2LSN A;  4BRF A;  4C23 A;  2E2P A;  1RT6 A;  3ALY A;  3SUQ A;  4KKO A;  1U6Z A;  3SBG A;  3PY8 A;  4YNQ A;  1GLJ O;  1WN7 A;  4YOU A;  3LL3 A;  3ZYY X;  2G8K A;  2NRV A;  4FWQ A;  4IEI A;  2IS3 A;  2ZJR L;  2E2N A;  5C24 A;  5LJV A;  4U67 L;  4E1J A;  5ELZ A;  1RT4 A;  3I55 N;  1JL2 A;  3ZT4 A;  2O8B A;  5FRN A;  4IBN A;  1C6V A;  4OPJ A;  1T6D A;  1TL3 A;  4MDA A;  4JHD B;  4LF8 K;  2EHG A;  5AQJ A;  3P1G A;  3S3N A;  1BIZ A;  3HSC A;  3HBT A;  2WC9 A;  2HHV A;  4OKK A;  2A3Z A;  1HNX K;  1EP4 A;  4C1N K;  3QEP A;  1SS6 A;  1FJG K;  3AO1 A;  3RSE B;  3AVL A;  3A5L C;  3VES A;  3FZL A;  4CEF A;  1TL1 A;  1VSK A;  3L2V A;  3CQX A;  1BHL A;  2OTJ N;  4DFM A;  3WT0 A;  3AVN A;  4DHY A;  4FYD A;  4LSL A;  5FLX O;  4CCH A;  5BPL A;  4H0P A;  1TK5 A;  1NK6 A;  4LF7 K;  4AHR A;  4KHY A;  1EO1 A;  3U4L A;  1IKV A;  3NH1 A;  4DR6 K;  4JS4 A;  1VQL N;  4ZTJ A;  3P4I A;  1VQ5 N;  3K58 A;  3ULE B;  5KTQ A;  1WNS A;  4J8F A;  2YJF A;  3DRS A;  4W5R A;  4RW6 A;  1KFS A;  4M3X A;  3M5R A;  3FGU A;  2OZM A;  3MN7 A;  1HQU A;  2HB5 A;  2KFZ A;  3QB0 A;  3CQY A;  3ATU A;  3BDP A;  4BC4 A;  1YXQ A;  1Z6R A;  4DTJ A;  1U47 A;  1IO2 A;  5J1E A;  4DU3 A;  2OA8 A;  4JI4 K;  4CF8 A;  1TYQ B;  3WNF A;  4B8C A;  3CM5 A;  1FXX A;  3T3F A;  3KIO A;  3V1O A;  2HST A;  3K5M A;  4M7X A;  4JN4 A;  4LF6 K;  1BQM A;  1C0T A;  4GV3 A;  1WSH A;  3FZH A;  4FWN A;  2YV0 X;  4NB4 A;  4IJA A;  1X3N A;  3HO1 A;  1JLC A;  1HYV A;  2D0A A;  4AQY K;  3THW B;  5LJW A;  4A62 A;  1D5A A;  1J53 A;  5JMV A;  3HZ6 A;  3O9R A;  4CJ5 A;  1MWK A;  1HKG A;  2Q97 A;  4KPY A;  1NJI O;  3KJV A;  4NYN A;  2GV9 A;  1D9F A;  4M45 A;  3MMV A;  1RDD A;  3HTV A;  4YHH K;  1GLL O;  2KFN A;  5C0Y A;  1X9S A;  3FE1 A;  4DTM A;  3MX2 A;  3T19 A;  3HOT A;  3SUO A;  1EXQ A;  4WFB L;  2GUI A;  1GLB G;  1XI1 A;  2A1R A;  4FJI A;  4FJ5 A;  4PQU A;  1TK0 A;  3OYH A;  1GLE G;  3RR7 A;  1HNV A;  3AVM A;  1WSG A;  1SL1 A;  1KTQ A;  2OPP A;  5KQD A;  3TAQ A;  4E7I A;  3M1F A;  1WUA A;  3NDK A;  3SPZ A;  4FJX A;  4CIF A;  4H0V B;  3L8B A;  1NGD A;  3MCP A;  2UYT A;  1ZBF A;  3FFI A;  1W97 L;  5AFU H;  1NJX A;  3ZEU B;  2ASO A;  3VTI A;  4KI4 A;  3RMA A;  1C1A A;  4AHU A;  3V9Z A;  3VQ7 A;  4MQ3 A;  1LWE A;  3M6G A;  3C6A A;  1Y64 A;  3P38 A;  4BR7 A;  5AQZ A;  4ILJ A;  5FPM A;  4B1W B;  2I5J A;  3SQ0 A;  3BP8 A;  1YAG A;  2QXL A;  1K6Y A;  4CEC A;  4JD2 B;  2AA4 A;  4FCY A;  2H3G X;  4FLU A;  1KC8 O;  3DMJ A;  3PX0 A;  4DF8 A;  2HW3 A;  3B8A X;  3UB5 A;  3CPW M;  5I3U A;  3CCV N;  4CIE A;  1QVF M;  4H5V A;  2WBN A;  4OKE A;  3AO2 A;  3T1H K;  2FSK A;  3CIP A;  3CM6 A;  5HRO A;  3KK2 A;  3ZX0 A;  4BWM A;  4BGA A;  5E84 A;  3FZK A;  4DV0 K;  5J2N A;  1S5J A;  1M1K O;  4HUE A;  1KRP A;  2PAV A;  3PLA A;  2WTU A;  4CJR A;  4GW6 A;  4LFC K;  5BRH A;  4HTL A;  1DT9 A;  4FWK A;  1BOT O;  2P9P B;  2NRH A;  3CC7 N;  4RWT A;  3FLC O;  3A2F A;  2HBK A;  2P9L A;  1XNQ K;  2F4V K;  3SV4 A;  3OYI A;  1VK0 A;  3OY9 A;  5J2Q A;  2NZT A;  3H46 O;  3L6Q A;  4NYF A;  1UAX A;  5AQF A;  3O9T A;  3SZ2 A;  4ICL A;  3ZT1 A;  2V51 B;  4H4M A;  3M3Z A;  1BCO A;  1LWF A;  1NK7 A;  1VSL A;  1RTI A;  3KWG A;  3MXM A;  1UA0 A;  2UXD K;  5H1S Q;  2JWK A;  3LM2 A;  4BVP A;  5CZ2 A;  2X6S A;  1D8Y A;  3ZSW A;  1BCM A;  1N36 K;  1RBR A;  1L5U A;  1OH5 A;  3SAF A;  3ZSY A;  3G0Z A;  2ATQ A;  3C6H A;  4I6M B;  3VN5 A;  1CZ9 A;  4YOY A;  3RMC A;  2J4R A;  3W3D A;  3IDH A;  3LPU A;  3U6F A;  1YVU A;  3LAM A;  4CF2 A;  3O4Q A;  5AQO A;  3VQA A;  4CJL A;  1E4F T;  3AV9 A;  1R59 O;  2YX6 A;  4CZH A;  4H0O A;  1KCF A;  1IBL K;  1ITG A;  4RG8 A;  4ELT A;  4M7Y A;  2NRT A;  4K25 A;  4Y1C A;  4C8N A;  5FPD A;  3K5O A;  4LSN A;  2HHS A;  1ILY A;  3O9U A;  1FKP A;  5D3G A;  3PIP L;  1RDU A;  4DR2 K;  4M41 A;  1S9G A;  4FW2 A;  4JK7 A;  5BRD A;  4CZK A;  1RBS A;  1NWK A;  4DQR A;  3THY A;  3NE6 A;  3NVK A;  1NM1 A;  5I9E B;  4L3Q A;  2X74 A;  4RW4 A;  4FWM A;  1VQM N;  3EO3 A;  3V81 A;  4IJN A;  3OYB A;  1N5Y A;  4FLW A;  3AO5 A;  4K41 A;  4QS7 A;  4BRD A;  4N76 A;  5K14 A;  2RN2 A;  4DTO A;  5T7B A;  1SZ2 A;  5TKY A;  1H1V A;  3SYZ A;  3DXK A;  4FOI A;  4OGE A;  1T8E A;  2IC3 A;  4CJV A;  3D2E A;  4CHY A;  3EZW A;  1R0A A;  3D45 A;  3QEW A;  3CQ8 A;  3CFR A;  5ADX H;  1NMD A;  2KTQ A;  3RWU A;  3WXI A;  5CYQ A;  3AO3 A;  4KFB A;  3L3V A;  1OH6 A;  1K8A O;  1X3M A;  1HKB A;  5CR4 A;  1ATN A;  2QEX N;  3AGK A;  2D0C A;  4CEB A;  4AF1 A;  4FXD A;  1U2V B;  5M1P A;  3K5L A;  4DR3 K;  3MXJ A;  3NMU A;  3HP6 A;  1W2B M;  3J7A P;  4CK2 A;  3A5O C;  3WXL A;  2BAN A;  3PV8 A;  1WLJ A;  2CGL A;  5EU7 A;  5EOY A;  2FLO A;  3AVJ A;  1BA0 A;  1D4X A;  1U45 A;  1HNI A;  3MDQ A;  4JLH A;  1XHZ A;  2PYL A;  4XH5 A;  3PO4 A;  3CET A;  4BR9 A;  3O6W A;  2F9W A;  5SZT A;  1T03 A;  2NRZ A;  4B3M K;  4K8Z A;  3DAW A;  2G8U A;  1MA9 B;  1YF5 L;  4BRC A;  2OPQ A;  2ZQB A;  4QCL A;  4BE2 A;  5DK5 A;  4HCC A;  1X1P A;  3PSI A;  4ELV A;  2W40 A;  2ZM6 K;  4B8A B;  5HP1 A;  1VSI A;  2QWL A;  4EHT A;  2E5L K;  1LWC A;  5KGW A;  4BRG A;  4CHQ A;  1XHX A;  4NCB A;  3ISN C;  3ID8 A;  1J9A A;  2FF3 B;  2QXF A;  1NGB A;  3N4P A;  4H4O A;  4H0Y B;  4B08 A;  3K57 A;  1YIJ N;  4CED A;  4OO1 J;  3OYM A;  4CZM A;  4FOE A;  3C6U A;  1QSY A;  4KH6 A;  3E66 A;  3GG4 A;  3SJH A;  1RT1 A;  3TPQ A;  4N47 A;  4FVM A;  4JV5 K;  4CZE A;  4HUF A;  3VTH A;  4IEE A;  2Z1G A;  4HUG A;  1YIT N;  3B6O A;  4KB0 A;  3O4W A;  1EET A;  3KLH A;  3U3G A;  1C0M A;  1L3T A;  3U8X A;  1ZBL A;  4E3S A;  3FZM A;  1BUP A;  3TSU A;  2KZZ A;  4GV9 A;  4B1X B;  3OYK A;  3ZSV A;  2HBM A;  4CJE A;  2FF6 A;  1S1W A;  4GY2 B;  2V7Z A;  3ZSX A;  1HJR A;  1VSJ A;  4FL9 A;  5AQY A;  1IBK K;  4FSV A;  3EL2 A;  3J81 O;  2HBL A;  1YJ9 N;  3WNH A;  4M3T A;  4FLT A;  1LV5 A;  3R9P A;  3AAR A;  4CEZ A;  5GAE P;  4W5N A;  2IDO A;  3QFU A;  4IFV A;  1NOZ A;  4CJU A;  3NHG A;  1NLV A;  5JS2 A;  1VSE A;  4BE0 A;  3TAB A;  1UOC A;  2HND A;  4F4K A;  4M3Y A;  4DV5 K;  4KH4 A;  1CXQ A;  3QBW A;  2E2Q A;  4CJT A;  4A61 A;  4X65 K;  1BIU A;  4KHP K;  4DQP A;  1NG9 A;  4FJH A;  3C95 A;  3DLE A;  3F5T A;  4BRL A;  3T1Y K;  1V4S A;  3D7E O;  4Z94 A;  5C2F A;  3PIO L;  3EY1 A;  1SKW A;  4KRE A;  1JL1 A;  3S3O A;  1QHT A;  2O8F A;  1XWL A;  3HM8 A;  3K0S A;  1B9F A;  2PFU A;  1JLF A;  4JI5 K;  5GIN A;  4B3T K;  1GOA A;  4CFB A;  1MU2 A;  1CXU A;  1BI4 A;  1BQN A;  4B9Q A;  1DGK N;  2NRX A;  2NNW A;  4ISG A;  4AM7 A;  4HHT A;  1HLU A;  1KXP A;  2FXU A;  5BN9 A;  4BR5 A;  1RDA A;  3HJF A;  1J5O A;  1BO5 O;  3P83 D;  4JAX A;  3EKS A;  3SK3 A;  3QES A;  3FFK B;  2Q3S A;  2YHY A;  1JLG A;  1FKO A;  3KLF A;  3DXM A;  3ENB A;  2Q1N A;  2OTL N;  1NNE A;  2UUA K;  3V9U A;  4NXN K;  3N4Q A;  4DSF A;  3VQE A;  4E1M A;  4C8M A;  2D5R A;  1U49 A;  4H5N A;  5EY4 A;  4CJQ A;  4IO8 A;  3NGZ A;  4FZX C;  4M3R A;  4W5T A;  5BR9 A;  3RR8 A;  1ATR A;  3CFP A;  3SMS A;  3DRP A;  3UKR A;  3KZB A;  2PY5 A;  4YOW A;  4CFC A;  1RDW X;  3P5J A;  2IOC A;  2WOM A;  1UWB A;  3KK7 A;  3O08 A;  3VQ5 A;  3HVR A;  3EN9 A;  2KW4 A;  4JEP A;  5LY3 A;  4FJ7 A;  5AQT A;  3KTQ A;  3ATV A;  3DOL A;  3L4I A;  3CCS N;  3OJU A;  4BGB A;  3ZX3 A;  1Q81 O;  3KWI A;  1JLE A;  4PWD A;  3CJC A;  1QZ6 A;  4YOV A;  1LW0 A;  3O9S A;  2EX3 A;  4J2A A;  1HUX A;  4J2B A;  1X9J A;  3A8Y A;  2V52 B;  2OPS A;  3THV A;  5AZI A;  3MWP A;  4JK9 A;  3TSP A;  1KD1 O;  3Q7B A;  5BN8 A;  2D0B A;  1RBU A;  1FK9 A;  3V9W A;  3HM9 A;  4B1Z A;  3M8S A;  1NKC A;  3OS0 A;  1YT3 A;  1WOQ A;  3DLL L;  1ZBH A;  1K8K A;  1RGI A;  3MAQ A;  3IKM A;  3L4Q A;  3TI0 A;  2FBT A;  3A5M C;  1I39 A;  4KHW A;  4CK1 A;  1TAU A;  4DSJ A;  3J8A A;  1RDB A;  3SI6 A;  4FJK A;  1YHQ N;  1K9M O;  2KKZ A;  3HI0 A;  4HCB A;  2DTU A;  1RTD A;  2UUB K;  4WFN L;  3CCM N;  1DTT A;  2P9L B;  4FWS A;  5A2Q O;  1VSD A;  3A0I X;  3AA3 A;  5JS1 A;  3DM2 A;  2A6A A;  3CCU N;  4M3Z A;  2QK9 A;  2A42 A;  4Z0U A;  4DLE A;  4B9M A;  2RHK A;  3CFO A;  5M1Q A;  3UKU A;  3ZET A;  1Q7Y O;  3F2K A;  2P9U B;  1XMQ K;  1WSF A;  3D6R A;  5AQX A;  4AM6 A;  4DV6 K;  1KAY A;  4DS5 A;  2ZJQ L;  2HHU A;  3OYC A;  3E01 A;  5E41 A;  4CGI A;  2OPR A;  3AA4 A;  4PKI A;  3CJ7 A;  1REV A;  2GBZ A;  4KTW A;  4CK3 A;  1Q8I A;  4I7F A;  3OW2 M;  2YI1 A;  3NF9 A;  3IFR A;  1C0G A;  3D2F A;  1VSH A;  3C7N A;  3LAK A;  1BA1 A;  1TKX A;  3EE8 A;  3LP3 A;  3CER A;  2G8W A;  4BRO A;  1DTQ A;  2QM1 A;  2YHB A;  4CEQ A;  2YKN A;  2RPI A;  1IH7 A;  4DFK A;  3HL8 A;  3CC2 N;  4JI2 K;  2YKM A;  3E9L A;  4CJ4 A;  5JVG L;  2G8V A;  4KAZ A;  3LP1 A;  2CH5 A;  2HHH K;  3QER A;  4C8K A;  1C1C A;  4KTQ A;  4IOA L;  4CD1 A;  4NLC A;  1C0U A;  1W7A A;  3CJ9 A;  3MEC A;  2XHB A;  3LWM A;  3QEV A;  4DQS A;  5HRN A;  3LAN A;  5C15 A;  2VQE K;  4E89 A;  3VMF B;  3K5N A;  4JHD A;  2P51 A;  4CHP A;  2P9S A;  3SAH A;  4Z4F A;  4E1N A;  4FJ9 A;  4Z4I A;  3E9O A;  4DQQ A;  3DJC A;  1HJO A;  4UQG A;  3AVK A;  3DXK B;  3PUF A;  4BRN A;  4CGF A;  1VQ4 N;  1VQP N;  4M3W A;  2ZE2 A;  4CGD A;  1NGE A;  3F9M A;  4OLB A;  3WUH A;  3GOI A;  1HYZ A;  4DTU A;  4CJ3 A;  5AZJ A;  3D2E B;  4RCH A;  3QEX A;  1DLO A;  4DQ8 A;  5KPZ A;  1A5X A;  2G8F A;  3QET A;  3I0S A;  3NGY A;  5SWM A;  3VQ6 A;  4WQ5 C;  3TAE A;  4A5A A;  1J54 A;  1S1T A;  4IFE A;  4N5S A;  1NJZ A;  4QOZ B;  4ID1 A;  3VQP A;  4CJW A;  3VEX A;  1IV0 A;  1VSF A;  4BRA A;  5KQ8 A;  4IFY A;  2FBX A;  1HPM A;  1RT5 A;  1KVA A;  3ZSO A;  1N32 K;  4IKF A;  1HMV A;  3KD1 E;  2O8D A;  1YUW A;  3CCE N;  4KB1 A;  1GLF O;  1VRU A;  4BDY A;  4BR4 A;  3QIO A;  1HX1 A;  2IIR A;  3U9D A;  2Q31 A;  4N41 A;  3MEE A;  3TR8 A;  3QDK A;  4OPK A;  4KHQ A;  1BU6 O;  1RNH A;  3UIQ A;  4RTF D;  1RCH A;  4N56 A;  3ZSZ A;  4E0D A;  3O1B A;  4CF0 A;  3K2P A;  3W0L A;  4JI7 K;  1GLD G;  2RF2 A;  4AH9 A;  1O13 A;  5AR0 A;  1SKS A;  2YJE A;  1RBT A;  5KRT A;  1NK9 A;  4FW1 A;  3WXJ A;  2YNI A;  3JSM A;  2E6M A;  3M8Q A;  1S6Q A;  3IS9 A;  4ILG B;  2E6L A;  3CPE A;  1XNR K;  4O0J A;  3ZT3 A;  2Q2R A;  3SMP A;  4EZ6 A;  3OHR A;  3I56 N;  3OS1 A;  5HRR A;  4DF4 A;  4AHT A;  4ILH A;  3THW A;  3HP9 A;  2BE2 A;  2IVO A;  3CD6 N;  3TTF A;  3VQ9 A;  4CES A;  4FWO A;  5DM7 L;  4FJJ A;  3O8M A;  4CJS A;  1Q9Y A;  3QO9 A;  4W5O A;  3PX4 A;  5C42 A;  1QHA A;  3KKS A;  4JI1 K;  4MLH A;  1Z26 A;  3BZK A;  3MN5 A;  2QA4 N;  2R7Y A;  1QE1 A;  3TAR A;  4DR1 K;  5KPR A;  4DR4 K;  4WYB A;  2Z1J A;  1YTU A;  4FJN A;  5HLF A;  4CBU A;  3HRG A;  4JKG A;  1NGC A;  5AQR A;  4AIL C;  3MXI A;  2O8C A;  1YJW N;  2NUB A;  5AQG A;  4CGJ A;  2BGG A;  5CYM A;  2HVH A;  4WQ5 A;  2QKK A;  3DWL A;  3VEV A;  2IVP A;  4H0X B;  5HBM A;  2F96 A;  3OYJ A;  3P39 A;  4CHZ A;  1A5W A;  4CI6 A;  4BRH A;  1YI2 N;  2G8H A;  4BRM A;  5F0X A;  1I3A A;  1VAZ A;  4DV4 K;  3LZJ A;  4O5F A;  3O5B A;  4IXC A;  2DFF A;  3V1Q A;  3FZF A;  4Z4E A;  4M42 A;  4DV1 K;  4Y1D A;  4LF4 K;  3LDP A;  4KO0 A;  3EE9 A;  4IDH A;  3BUZ B;  1J5E K;  4DFJ A;  1P8Z A;  2KZM A;  4IO9 L;  4BC3 A;  4LFB K;  4BRI A;  4JRP A;  1RTH A;  4ISE A;  4EP5 A;  3E1Y A;  1DKG D;  1JLA A;  1SAZ A;  2CH6 A;  5AQK A;  4R79 A;  4I9L A;  4OGC A;  2B6A A;  3ENH A;  3VER A;  1KVC A;  4H5T A;  3L2Q A;  4MDB A;  3SLC A;  4CJP A;  3J80 O;  5MLC Q;  1SQK A;  2FBV A;  2QWR A;  3H08 A;  2P9K B;  4FWR A;  3TAG A;  1YJN N;  4JI3 K;  4Z4G A;  1ATS A;  4C1N I;  5M1F A;  1Q18 A;  1IG8 A;  4LC9 B;  1RBV A;  1S22 A;  4JKE A;  2HHW A;  2A40 A;  1JKH A;  3LAL A;  3MN6 A;  4AHS A;  3IG1 A;  1SUQ A;  4O4G A;  1BGX T;  3EEQ A;  1FW6 A;  4KRF A;  5FRO A;  4XEI A;  1BI4 B;  3LM9 A;  4YOX A;  2YHW A;  3VQC A;  4DFP A;  2QKB A;  4OVL A;  4G9Z A;  3IMX A;  4NXM K;  5JLH A;  1Y97 A;  1SKR A;  2WUS A;  4LY7 A;  3VOV A;  3DXM B;  4A2B A;  5EVZ A;  2GUP A;  4CD3 A;  2XY5 A;  5C12 A;  1YVN A;  3JAM O;  4KV8 A;  2ZJP L;  4FPB A;  2ZGZ A;  1JXB A;  2JWL A;  2QTD A;  4CEO A;  2DPN A;  1WBD A;  4B9V A;  2O8B B;  3VET A;  3SCX A;  3CMA N;  3KKR A;  4YOR A;  4BWJ A;  1Q82 O;  3D0P A;  1EKE A;  1HRH A;  3G10 A;  5GIP A;  3UKR B;  4FWP A;  2Z1H A;  3SPY A;  3QIC A;  2NRR A;  4CJ7 A;  5AQV A;  3SV3 A;  1ZYQ A;  4CHO A;  2AP1 A;  4PHT X;  3ZCM A; 
#chains in the Genus database with same CATH homology
 4F2R A;  4F3T A;  1KTQ A;  2OPP A;  3TAQ A;  4E7I A;  4CFC A;  3P5J A;  1QQC A;  2IOC A;  4RW7 A;  1VSM A;  1ASW A;  3NDK A;  3NCI A;  3SPZ A;  2WOM A;  4KI6 A;  1UWB A;  2OYQ A;  4F3O A;  3ASM A;  3VQ5 A;  4CIF A;  3LWL A;  3HVR A;  4RW9 A;  3L8B A;  2KW4 A;  4CEA A;  1G15 A;  3DYA A;  1ZBF A;  2HHX A;  3FFI A;  3MEG A;  4B9U A;  4FJ7 A;  1HQE A;  4FM0 A;  3KTQ A;  3DI6 A;  4C8L A;  3VQ8 A;  4KHU A;  3LP2 A;  4PY5 A;  4DTP A;  5CY4 A;  1NJX A;  3DOL A;  2VWK A;  3OJU A;  4KI4 A;  4DSI A;  3RMA A;  4B3O A;  1C1A A;  4AHU A;  3V9Z A;  3NFA A;  2PYJ A;  3VQ7 A;  1JLE A;  2RKI A;  4MQ3 A;  1LWE A;  3SJJ A;  1RT2 A;  2OZS A;  4PWD A;  4L8R B;  1LW0 A;  2EX3 A;  4J2A A;  4FK4 A;  4J2B A;  4W5Q A;  3LDS A;  3HST B;  2OPS A;  1GOB A;  3KLI A;  3QIN A;  3KLE A;  2F8T A;  1HPZ A;  2I5J A;  3SQ0 A;  4E7H A;  3THV A;  3RMD A;  1NKE A;  1YTA A;  3I0R A;  3LP0 A;  4LH5 A;  3AVC A;  4OKJ A;  2HHT A;  1WSE A;  1K6Y A;  2FC0 A;  1HYS A;  1NK4 A;  4IG0 A;  2D0B A;  1TK8 A;  1RBU A;  4CEC A;  4TSX A;  4BE1 A;  4B9T A;  1FK9 A;  2VG6 A;  3HM9 A;  3V9W A;  3M8S A;  1NKC A;  4LH4 A;  2E4L A;  4BAC A;  4FCY A;  4FLU A;  3OS0 A;  3DMJ A;  2O4G A;  1YT3 A;  3PX0 A;  1BL3 A;  3WNG A;  4DF8 A;  2HW3 A;  5I3U A;  1ZBH A;  3ZSR A;  4CIE A;  3MAQ A;  4OJR A;  3K59 A;  3SUN A;  1KVB A;  3TI0 A;  3EZ5 A;  4FJX A;  4OKE A;  2FBT A;  3AO2 A;  1I39 A;  3KK1 A;  4KHW A;  3VQQ A;  4B9S A;  4FZZ A;  3CM6 A;  4FZY A;  2Z1I A;  1S1U A;  4CK1 A;  3O4N A;  4DSJ A;  3ZT0 A;  5HRO A;  1TAU A;  1RDB A;  3KK2 A;  3SI6 A;  3DLB A;  4FJK A;  1LAV A;  4BWM A;  1ZBI A;  3TAF A;  5J2N A;  3OYE A;  5KGX A;  1S5J A;  4HUE A;  1KRP A;  1ASU A;  3AA5 X;  1SL1 A;  1W0H A;  4ZHR A;  1RTD A;  4HCB A;  2DTU A;  4J2E A;  4CJR A;  4CIG A;  3QNN A;  4PUO A;  4GW6 A;  1DTT A;  4FJ8 A;  4PA1 A;  4DLG A;  4QAG A;  1VSD A;  3AA3 A;  5JS1 A;  1RDC A;  2P1J A;  4MFB A;  4KHN A;  1GOC A;  3O3F A;  1T05 A;  3ITH A;  3VA3 A;  1U04 A;  3DM2 A;  4M3Z A;  2QK9 A;  3A2F A;  3QNO A;  3BGR A;  3LZI A;  4Z0U A;  4DLE A;  3SNN A;  4B9M A;  3CFO A;  3KLG A;  3AVB A;  3HK2 A;  3SV4 A;  4EP4 A;  3OYI A;  1VK0 A;  2HNY A;  3OY9 A;  5J2Q A;  4DS4 A;  1WSF A;  3M8R A;  4NYF A;  5J2M A;  1UAX A;  3M8P A;  1LW2 A;  4E7J A;  4O55 A;  3SZ2 A;  4DS5 A;  2HHU A;  3ZSQ A;  3OYC A;  1BIS A;  3E01 A;  4ICL A;  5E41 A;  4CGI A;  2B5J A;  4E19 A;  3ZT1 A;  2OPR A;  1CZB A;  3AA4 A;  3OYL A;  1TKD A;  1NK0 A;  5J2P A;  3HYF A;  2ETJ A;  2HVI A;  4CHN A;  1NJY A;  1TKT A;  1REV A;  4H4M A;  1BCO A;  1LWF A;  2GBZ A;  3DOK A;  3IRX A;  1VSL A;  1NK7 A;  2WON A;  4DSL A;  1RTI A;  4KTW A;  5DMR A;  4CK3 A;  2HHQ A;  3AVH A;  3QLH A;  4I2Q A;  1Q8I A;  4I7F A;  4NCA A;  2X6N A;  3MXM A;  3L2R A;  1UA0 A;  3NF9 A;  4DTN A;  3OYD A;  3TAN A;  1WSI A;  1QSS A;  2B4J A;  5CZ2 A;  2X6S A;  4FLX A;  1D8Y A;  3ZSW A;  1VSH A;  4IG3 A;  3SQ2 A;  1BCM A;  3LAK A;  1RBR A;  1L5U A;  1TKX A;  2KQ2 A;  3KD5 E;  3ZSY A;  3G0Z A;  3VQD A;  3L2W A;  2ATQ A;  2ZD1 A;  1TGO A;  3LP3 A;  2G8W A;  3T1A A;  2X78 A;  1DTQ A;  3VN5 A;  3V9S A;  2HMI A;  1CZ9 A;  4FLY A;  3RMC A;  4ZTF A;  1IKY A;  2YHB A;  4CEQ A;  5I42 A;  4H8K A;  3NGI A;  2ITG A;  2DFE A;  2YKN A;  3TAP A;  4CJK A;  2RPI A;  1IH7 A;  2IAJ A;  3AVA A;  5FDL A;  4DFK A;  5FRM A;  3HL8 A;  1NK5 A;  1A5V A;  4O0I A;  2YKM A;  3LPU A;  3NF6 A;  4CJ4 A;  3U6F A;  2G8V A;  4FJG A;  4KAZ A;  1CLQ A;  1YVU A;  3LP1 A;  3LAM A;  4CF2 A;  3O4Q A;  3VQA A;  4CJL A;  3O3H A;  3QER A;  3VQ4 A;  3AV9 A;  4C8K A;  3DLK A;  1Q9X A;  5HRS A;  1C1C A;  2Y1J A;  1KCF A;  4KTQ A;  3S3M A;  1ITG A;  4CFD A;  4RG8 A;  4ELT A;  3RRG A;  4Y1C A;  4C8N A;  3K5O A;  4LSN A;  2HHS A;  1C0U A;  3MEC A;  1FKP A;  2XHB A;  4M3U A;  5D3G A;  4YFU A;  1KSP A;  4M41 A;  1S9G A;  4AHC A;  1S9E A;  4FW2 A;  3LWM A;  3QEV A;  4DQS A;  5HRN A;  3LAN A;  1RBS A;  4DQR A;  4E89 A;  3CYM A;  3K5N A;  3NE6 A;  1T7P A;  3I8D A;  2P51 A;  2X74 A;  4CF9 A;  3SQ1 A;  4RW4 A;  4OLA A;  4CHP A;  4Z4H A;  3SUP A;  4Q0B A;  3KK3 A;  4Z4F A;  4CJF A;  3V81 A;  1B9D A;  4LD0 A;  1UA1 A;  4E1N A;  4FJ9 A;  3OYB A;  1TV6 A;  1N5Y A;  1JLB A;  2VWJ A;  4Z4I A;  2JGU A;  3NH2 A;  4DQQ A;  1KLM A;  4Z4C A;  4FLW A;  3AO5 A;  4UQG A;  3AVK A;  4CGF A;  3PUF A;  2BDP A;  4M3W A;  1KFD A;  2ZE2 A;  4CGD A;  4JRQ A;  3LPT A;  4CF1 A;  2DFH A;  4N76 A;  5K14 A;  3NF8 A;  4DTR A;  1QS4 A;  1QSL A;  2RN2 A;  3O3G A;  4DTO A;  5T7B A;  5CYQ A;  4OLB A;  1HYZ A;  4DTU A;  4CJ3 A;  3QEX A;  4FLZ A;  1RT7 A;  1DLO A;  3SYZ A;  1WAF A;  3HT3 A;  4BDP A;  4GMJ B;  4BDZ A;  4E7K A;  1A5X A;  2YNH A;  4OGE A;  1T8E A;  4NCG A;  1NOY A;  2G8F A;  2AJQ A;  2IC3 A;  3CG7 A;  3I0S A;  5CZ1 A;  4CJV A;  3QET A;  4DWI A;  3NGY A;  3WNE A;  5SWM A;  3VQ6 A;  2Y1I A;  4CHY A;  2O4I A;  3TAE A;  1R0A A;  1J54 A;  3D45 A;  3QEW A;  4HVJ A;  3F73 A;  3CQ8 A;  3CFR A;  1NK8 A;  1S1T A;  4RW8 A;  3TWH A;  1KLN A;  3DLH A;  4N5S A;  1NJZ A;  3OYG A;  4QOZ B;  1S6P A;  4ID1 A;  1RTJ A;  3VQP A;  4CJW A;  3RWU A;  2KTQ A;  1TVR A;  1VSF A;  1SL0 A;  1EX4 A;  3AO3 A;  4ID5 A;  2FBX A;  3HVT A;  4IFY A;  4IDK A;  1RT5 A;  4KFB A;  1KVA A;  3L3V A;  3ZSO A;  4JS5 A;  2XY7 A;  1NJW A;  3NH0 A;  2FBY A;  4DSE A;  1O1W A;  1L3S A;  4IKF A;  1HMV A;  3KD1 E;  1S1X A;  3S9H A;  4KB1 A;  1VRU A;  2D0C A;  4CEB A;  3OYN A;  4BDY A;  4DU1 A;  3QIO A;  4F8R A;  4DTS A;  4FXD A;  3K5L A;  2F8S A;  4KHS A;  2DY4 A;  3MXJ A;  3HP6 A;  3AVI A;  3NBP A;  4N41 A;  3V4I A;  1B92 A;  3MEE A;  4CK2 A;  3TR8 A;  4OPK A;  4KHQ A;  2BAN A;  2HNZ A;  4B9L A;  4AHV A;  4GVM A;  1RNH A;  3PV8 A;  3UIQ A;  1WLJ A;  1L3U A;  4DSK A;  1RCH A;  5EU7 A;  1U45 A;  3AVJ A;  3HPH A;  3ZSZ A;  4N56 A;  3HPO A;  4E0D A;  1HNI A;  4CF0 A;  4CGG A;  3K2P A;  1TAQ A;  4JLH A;  1TKZ A;  3V9X A;  1C1B A;  1XHZ A;  2PYL A;  3PO4 A;  2RF2 A;  4AH9 A;  5SZT A;  2YNF A;  2W42 A;  1T03 A;  1SKS A;  1NK9 A;  1RBT A;  2A1S A;  5KRT A;  4FW1 A;  4FM1 A;  3RTV A;  4FLV A;  2YNI A;  3RRH A;  3JSM A;  4ELU A;  4I9Q A;  2E6M A;  1WAJ A;  1S6Q A;  1S1V A;  3M8Q A;  4G1Q A;  4CE9 A;  4K8Z A;  3IS9 A;  3OYF A;  2E6L A;  3OS2 A;  1RIL A;  4O0J A;  2G8U A;  3OJS A;  3ZT3 A;  4R5P A;  4XIU A;  4DTX A;  2OPQ A;  4EZ6 A;  3NAE A;  2ZQB A;  3OS1 A;  4C8O A;  5HRR A;  4DF4 A;  4QCL A;  5KRS A;  4BE2 A;  5DK5 A;  4AHT A;  2IGI A;  4CEE A;  4HCC A;  1X1P A;  4J2D A;  4B9N A;  4ELV A;  2JLE A;  1U48 A;  3HP9 A;  2BE2 A;  2LSN A;  3U3Y A;  4O5B A;  4B8A B;  5HP1 A;  4DG1 A;  3QEI A;  4DMN A;  1VSI A;  1RT6 A;  3VQ9 A;  4CES A;  4FJM A;  3ALY A;  1LWC A;  5KGW A;  4KKO A;  3SUQ A;  3PY8 A;  4FJJ A;  4CJS A;  4YNQ A;  4CHQ A;  1Q9Y A;  1XHX A;  4NCB A;  1D9D A;  1WN7 A;  3ISN C;  2G8K A;  4WE1 A;  1J9A A;  2IS3 A;  2QXF A;  3QO9 A;  4H4O A;  4W5O A;  1SV5 A;  3PX4 A;  5C42 A;  4B08 A;  5C24 A;  3K57 A;  3NF7 A;  3QIP A;  4CED A;  3KKS A;  1Z26 A;  1RT4 A;  1LAW A;  3VQB A;  2VG7 A;  3OYM A;  1JL2 A;  3ZT4 A;  1RT3 A;  1N6Q A;  5FRN A;  4IBN A;  3ZT2 A;  2R7Y A;  1C6V A;  1QE1 A;  3C6U A;  3V6D A;  3TAR A;  1QSY A;  3PO5 A;  4OPJ A;  1TL3 A;  5C25 A;  1ZBU A;  2Z1J A;  4FJN A;  1YTU A;  1RT1 A;  2EHG A;  5HLF A;  3L3U A;  3P1G A;  4AIL C;  3MXI A;  3S3N A;  4DU4 A;  2NUB A;  1BIZ A;  4N47 A;  4CGJ A;  2BGG A;  5CYM A;  2HHV A;  2HVH A;  4FVM A;  4OKK A;  3DRR A;  1U4B A;  4HUF A;  3DRP A;  1EP4 A;  2QKK A;  3HPG A;  2Z1G A;  4HUG A;  3QEP A;  3B6O A;  4KB0 A;  3AA2 A;  1EET A;  3KLH A;  3U3G A;  5HBM A;  2F96 A;  3OYJ A;  1C0M A;  3AO1 A;  1Z25 A;  1L3T A;  4CHZ A;  1JLQ A;  1A5W A;  3AVL A;  4CEF A;  1TL1 A;  1ZBL A;  2G8H A;  4E3S A;  3ZCM A;  1VSK A;  1I3A A;  3L2V A;  2KZZ A;  1BHL A;  1JXE A;  1NKB A;  3LZJ A;  4DFM A;  3AVN A;  3OYK A;  4FYD A;  3OYA A;  4CER A;  2DFF A;  1VRT A;  3V1Q A;  4LSL A;  3ZSV A;  1QTM A;  1IG9 A;  4CJE A;  4CCH A;  1S1W A;  4Z4E A;  4HTU A;  3ZSX A;  4KTZ A;  4M42 A;  1TK5 A;  1HJR A;  1VSJ A;  4Y1D A;  4AHR A;  4KO0 A;  4I2P A;  1NK6 A;  2P5G A;  2XY6 A;  4KHY A;  1IKV A;  3NH1 A;  4DFJ A;  3OVN A;  3AO4 A;  2KZM A;  4JS4 A;  3WNH A;  4ZTJ A;  4K8X A;  4M3T A;  2YHA A;  4JRP A;  3K58 A;  4FLT A;  1RTH A;  1SL2 A;  1LV5 A;  5KTQ A;  4EZ9 A;  1WNS A;  4CEZ A;  3TAM A;  4EP5 A;  4W5N A;  1JLA A;  1IKW A;  4FJL A;  2IDO A;  4IFV A;  1NOZ A;  4O44 A;  4CJU A;  3NHG A;  1IKX A;  3JYT A;  5JS2 A;  3DRS A;  4I9L A;  3AVF A;  2VG5 A;  1VSE A;  4OGC A;  4W5R A;  2B6A A;  1WSJ A;  4BE0 A;  4RW6 A;  1KFS A;  4M3X A;  1KVC A;  3TAB A;  3L2Q A;  1UOC A;  2HND A;  4CJP A;  2XO7 A;  2OZM A;  4F4K A;  4M3Y A;  1HQU A;  2HB5 A;  2KFZ A;  2FBV A;  1ASV A;  1CXQ A;  3H08 A;  3DLG A;  1X9M A;  3TAG A;  3BDP A;  4DTJ A;  4CJT A;  1U47 A;  4Z4G A;  1BIU A;  1IO2 A;  5J1E A;  4DU3 A;  2OA8 A;  4DQP A;  4FJH A;  4CF8 A;  3C95 A;  3DLE A;  3WNF A;  4B8C A;  3CM5 A;  1FXX A;  3T3F A;  1RBV A;  3KIO A;  3V1O A;  3EY1 A;  3K5M A;  1SKW A;  4FK2 A;  2HHW A;  1JKH A;  3LAL A;  4KRE A;  3IAY A;  1JL1 A;  3S3O A;  4AHS A;  1QHT A;  3AVG A;  1BQM A;  3IG1 A;  1W9H A;  1SUQ A;  1C0T A;  4O4G A;  5KI6 A;  1BGX T;  1XC9 A;  1XWL A;  4KRF A;  5FRO A;  1WSH A;  1L3V A;  1BI4 B;  3DLR A;  1B9F A;  2YV0 X;  3VQC A;  4FM2 A;  4DFP A;  1JLF A;  3SQ4 A;  2QKB A;  3HO1 A;  1GOA A;  1JLC A;  1HYV A;  2D0A A;  3F9K A;  4OVL A;  3MED A;  1MU2 A;  4CFB A;  1CXU A;  1D5A A;  5HRP A;  1J53 A;  2YNG A;  1BI4 A;  1BQN A;  4DQI A;  1Y97 A;  1F21 A;  1SKR A;  2XRI A;  3V1R A;  2P5O A;  3PX6 A;  4E7L A;  4LY7 A;  4CJ5 A;  4HHT A;  3RMB A;  1RDA A;  4CGH A;  2PZS A;  4KPY A;  3HJF A;  1J5O A;  3P83 D;  4Q5V A;  3KJV A;  2XY5 A;  3B6P A;  4NYN A;  2GV9 A;  1D9F A;  4M45 A;  3QES A;  1X9W A;  2Q3S A;  1RDD A;  1JLG A;  1FKO A;  4KV8 A;  4CEO A;  3ULD A;  1JXB A;  2G8I A;  3KLF A;  4B9V A;  2KFN A;  3SCX A;  3KKR A;  3L2U A;  1X9S A;  4BWJ A;  3V9U A;  3D0P A;  4DTM A;  1EKE A;  2XY8 A;  3C6T A;  3T19 A;  1HRH A;  3G10 A;  3SUO A;  3HXM A;  2Z1H A;  1EXQ A;  2GUI A;  3EYZ A;  4DSF A;  3SPY A;  2A1R A;  1XI1 A;  3VQE A;  4FJI A;  4FJ5 A;  4E1M A;  3C94 A;  4CFA A;  4C8M A;  2D5R A;  3SV3 A;  1ZYQ A;  3OYH A;  1TK0 A;  1U49 A;  4PQU A;  3RR7 A;  4CJQ A;  4CHO A;  3NGZ A;  3VA0 A;  1HNV A;  4M3R A;  4W5T A;  3RR8 A;  4F2S A;  4FZX C;  3CFP A;  4FK0 A;  3AVM A;  2PY5 A;  1WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...