3T1YK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3t1yK00
4B3TK 3OTOK 4LFAK 4LF6K 4DR6K 2VQEK 4X62K 4JI4K 4YY3K 4LF5K 5LL6Z 4GKKK 1XNRK 4B3SK 4DV5K 3JAMO 5AJ3K 4B3RK 4NXMK 4JI3K 2UU9K 4DV7K 1J5EK 4X64K 4LF4K 4JV5K 4LFBK 4DR2K 1HR0K 5A2QO 1I94K 4DR1K 4OX9K 4DV4K 4B3MK 4JI7K 2ZM6K 4AQYK 4LF7K 2F4VK 1IBMK 2UXBK 1IBKK 1XNQK 5FLXO 3J7AP 1HNWK 4GKJK 3T1HK 4DV2K 4JI1K 4X66K 4DV3K 4LF9K 2UXDK 4NXNK 4DR5K 4DR3K 3J81O 2UXCK 3J80O 1HNXK 2UUAK 4DUYK 4KHPK 5IT9O 2VQFK 4JI5K 3T1YK 4DV1K 4DUZK 2UUCK 4CW7B 4X65K 1HNZK 5IWAK 1N36K 1XMQK 5LMUK 4JI0K 4YHHK 3J7YP 1XMOK 4CVNE 4JI6K 4DV0K 2UUBK 2E5LK 1N32K 4LFCK 1N33K 4DR7K 2HHHK 4JI2K 4K0KK 4LF8K 4DR4K 1N34K 1IBLK 4DV6K 5BR8K 1FJGK 4V19S 4JYAK 5LMNK 4JI8K
chains in the Genus database with same CATH superfamily
1QSSA 3EN9A 4O55A 4BE1A 2IS3A 4FJ5A 3HM9A 2NNWA 3GE1A 3DRPA 1RBUA 3KIOA 4FOIA 3KLIA 3KK3A 4MFBA 5AR0A 4W5OA 1VRTA 2IDOA 3DAWA 1CZBA 3CCQN 2A40A 1RDAA 2UU9K 4E7LA 4Z4CA 2B5JA 1V4TA 3ZETA 4BRKA 3E1YA 3U8XA 1UOCA 4OX9K 4B8CA 4JI7K 4DFJA 2P9PB 3ENOA 4FJ8A 1HNWK 3KLFA 4LH4A 4CGHA 3TSPA 4Q0BA 1NJIO 2P9UB 5MLCQ 4KHQA 3QEPA 5EU7A 3ZCMA 4M41A 5CZ1A 3MDQA 3OJUA 4NB4A 4XH1A 5FRNA 3LZJA 2BH1A 2HBLA 3V1RA 5M1FA 3D2EB 1O13A 3MX5A 4J2EA 3AVFA 3T1YK 2CH5A 3AO2A 1ASWA 3LP3A 1IKVA 5JMVA 4IXCA 2I7PA 1T44A 4H0XB 2VG6A 3O08A 3SJJA 3IFRA 3MK6A 4DHYA 5ADXH 2B6AA 1C0MA 2EHGA 5EOYA 5M1PA 3OYIA 3THWA 1C1CA 3L4QA 1HX1A 4FPBA 3WXMB 3O5BA 4F3OA 1C1AA 2OPQA 3PIPL 1S22A 3ZT4A 3CJ7A 2OTJN 3ZX2A 4CJ4A 4ID5A 4FWQA 4DU4A 5E41A 3OYMA 3OYEA 4LSNA 4IOXA 2BUPA 3LALA 4BRDA 1HKBA 4IKFA 1SKWA 1Y97A 4ISGA 3VQQA 3TSQA 3MECA 1S6QA 3EY1A 4EFHA 1TYQB 3NF6A 4IBNA 3PSIA 3OYDA 3J7ZO 3HP6A 3CHWA 3V9SA 4BGAA 1TUUA 3TAEA 1L5UA 1RTHA 4TSXA 4CZGA 4DV5K 3HSCA 4OPJA 1ZYQA 4MO4A 3O4WA 1SKRA 1G99A 3M8SA 4MDAA 4CHQA 1SL2A 4BR4A 3DXMB 4OPHA 4EHUA 1DTTA 3HRGA 3ZSOA 1E4GT 4JKGA 4GNIA 1NK5A 1HR0K 3NGYA 1HPZA 3MXMA 1WN7A 4J2AA 3VERA 4FYDA 1H1VA 4RCHA 4WQ4A 4BRMA 3OJSA 4RWTA 3VTHA 3WQUA 2UXBK 1A5WA 1JLBA 5EY4A 3BZCA 4BVPA 5E84A 4JI1K 1IG9A 4DFKA 3JXUA 5AQLA 2G8WA 2KLAA 3MN6A 4NYNA 3D6RA 4DU1A 5KPTA 2VG7A 1VQMN 2D0AA 3TANA 1RBVA 4NLBA 3ZT0A 3DLGA 4C1NK 3CQYA 3O6WA 5CE3A 3T19A 1TGOA 3AA4A 5F0XA 2GELA 1S1UA 3VGMA 4U7BA 4HVJA 4DUZK 4EZ6A 3UKRB 2ZJQL 3KWIA 5F2RA 3NVKA 4H0YB 3P83D 3J7YP 4IO9L 3C7NB 1OVYA 3A2FA 2R7YA 4DTSA 4KHNA 2HHQA 4IDHA 2NLXA 4OPAA 1K8KB 3OYAA 3K5LA 4BRNA 4ISEA 3DM2A 1X9MA 1LWCA 4H4MA 4FM2A 3KK2A 2P9LA 3OY9A 4DR7K 3CPEA 4PA1A 1U2VA 2HHHK 2G8HA 4K0KK 4BVOA 5I3UA 4DCHA 3ALYA 1R59O 5GAGP 4A59A 2NZTA 5AZJA 1DKGD 1N8RO 4WCEL 3PLAA 3VQBA 4B3TK 1RFQA 1SAZA 4JHDB 2O8BB 1UAXA 2FSNA 3O9SA 4JLHA 4EP5A 4CK2A 2Z1GA 4FJLA 4KB1A 2JWKA 3V9ZA 3EO3A 5LJWA 1S6PA 4CD3A 5CYMA 3OYGA 4M7XA 2JLEA 1KTQA 5C42A 4DV7K 4GY2B 2A6AA 3R9PA 3OYBA 1YVUA 2P1JA 4LF4K 1ITGA 1SV5A 4FK2A 3ZX3A 3HBTA 3LDSA 3LANA 1SUQA 4JRQA 2AA4A 5JVHL 1X9WA 1FW6A 2A1RA 4PWDA 3PY8A 4XIUA 4W5NA 3H6EA 4PQUA 2ASOA 3VEYA 4I9LA 1R0AA 1ZBIA 1EQYA 1V4SA 4QS9A 1IBMK 1HYSA 4Z0UA 3OBWA 4GKJK 3T1HK 3A5OC 4AHUA 3HL8A 1BDGA 2QWQA 1WSFA 3OHRA 1XC3A 4ZTFA 3PX4A 4DSFA 4NXNK 3SQ2A 3E66A 2RKIA 4YOTA 1LWFA 3QMLA 1HNXK 3VF4A 4CI6A 2B4JA 3DLEA 2FSKA 4CZLA 3GBTA 1VQLN 1QSYA 4JI5K 1TUYA 1NBWA 3WEEB 2P9UA 3AY9A 2E88A 3THYB 4JKFA 4DQSA 2VG5A 3FFIA 5BR9A 4CECA 1NKCA 4J2DA 4OPKA 5CZ2A 3HO1A 4N76A 5H1SQ 2YHYA 2XHBA 4M42A 5C24A 1BI4B 3LDNA 1XMOK 4F2RA 3PO5A 3D2EA 1ESVA 4B3OA 2YX6A 5GADP 1VSLA 4L8RB 2E1YA 2W6LA 4FWLA 3SMPA 2QI2A 3MXIA 1NK7A 5HOOA 1NKEA 2HBMA 3KD5E 4IOAL 1QSLA 3KVGA 4IFVA 1L3TA 3FE1A 2JGUA 1RDWX 1XI1A 4JYAK 4AH9A 2HHWA 3NGZA 1YIJN 1FK9A 1IKXA 4M63C 3OYKA 2E6MA 3MEDA 4OKJA 2D1KA 4O8KA 3TTDA 1NGHA 4FJIA 3LP0A 4JI4K 4CIFA 4FWSA 1RNHA 1HYVA 1T8EA 4C23A 3M8PA 4Z94A 4DQQA 4YFUA 3K57A 3AAPA 1YAGA 2Z1HA 3O80A 3CJ9A 1TYQA 2PAVA 4FLUA 3NBPA 3CCJN 4K8XA 3MCAB 4YNQA 5A2QO 1I94K 1BISA 4UQGA 3NMUA 4XH4A 3ZETB 2E8AA 3THVA 5FLXO 3BUZB 4F4KA 2D0CA 5BRFA 4CJPA 4XH5A 1W2BM 3O3GA 3DXMA 3KWGA 1WAJA 2FF3B 4DTRA 3IMXA 4DV3K 4E3SA 4ELUA 3CCEN 3AVHA 3CC4N 2P51A 1C0TA 1SL1A 3RTVA 4J2BA 2QK9A 3M5RA 3CCSN 3VQ7A 5IT9O 1RBRA 5AQNA 3HSTB 3ITHA 1WSHA 1QZ6A 2O8CB 4CJ5A 5BRDA 2HHVA 1NK9A 2O4GA 5IWAK 4CEZA 3QESA 2OA8A 3HVTA 3OYLA 4DU3A 2GBZA 4LC9B 3AGRA 2HMPA 2NUBA 2WTUA 2X6NA 1SQKA 3LP1A 4CJLA 4CJ3A 1NK8A 2FXUA 1QZ5A 4FZZA 4C8MA 2A1SA 3WXLA 3VQCA 3OYHA 1HYZA 3THWB 3EEQA 1GLFO 3NH2A 4BRCA 3O9TA 4G9ZA 1HNIA 5J2QA 1F21A 3QEIA 5GAHP 1K8AO 2FSJA 3C65A 2HBJA 2X6SA 1HMVA 3LAKA 3KHYA 2GWJA 5LMNK 4HUEA 4H03B 3L3VA 4H0PA 3A5LC 4WFBL 2KFNA 4KH5A 1K8KA 2YJFA 5FPDA 3T7ZA 4CJFA 4PKGA 3BF3A 4DR6K 3S3MA 1BO5O 4CZHA 1IH7A 3S9HA 1WBDA 1RDCA 3ATVA 5AZIB 3QIOA 3O4QA 4B1WB 4E7HA 2E4LA 3SV4A 1T6CA 4H0OA 1K6YA 3AVNA 4CEQA 2E2QA 4H0TB 3D45A 1VQON 4OLBA 1TK8A 4KHSA 2E2NA 2ZGZA 1XHZA 1WBBA 4CEEA 4ILHA 3AAQA 1ZBSA 2KTQA 3V9UA 1TVRA 1D9DA 5C10A 3P4IA 3C94A 2GUIA 3QFPA 4R79A 2G8KA 1NOYA 4DTJA 4EZ9A 1CXQA 3FLCO 2ATQA 2F96A 4ILJA 4Y1DA 4HTLA 1NG9A 1P90A 3DYAA 1JCGA 4JKEA 4QAGA 4DR5K 4MDBA 3I0RA 4CHNA 4BRPA 1RTDA 2UXCK 1ASVA 3IS9A 4DTUA 4DMNA 1VQ9N 1NNEA 2V7ZA 4CHYA 3HI0A 3CG7A 2VWKA 3M8QA 3I0SA 1VSMA 5E26A 4LSLA 4GMJB 4FLZA 4A62A 4BRAA 1ZBFA 3ZSQA 1D9FA 1ZXOA 4H5WA 4H5VA 3K2PA 2DPNA 3A5NC 2XY5A 3TABA 2ZJRL 4CF8A 4CJVA 4M3ZA 1VK0A 3IKMA 2E5LK 1U6ZA 4IJNA 4W5TA 3M6GA 3SPZA 1TV6A 3THYA 1RT7A 2RE2A 4JAXA 4FWRA 4WE1A 1Q81O 4AHVA 3SCXA 1I39A 4FLXA 5AQOA 4NCBA 4BDYA 1JLCA 3AA3A 3R8EA 3EZ5A 4BC3A 1GOCA 4FJJA 4NCGA 2HW3A 1ATRA 1JLAA 5AZJB 2YCHA 2VQEK 1UA1A 1KAXA 3OYFA 1SS6A 4AHCA 4CHOA 1YHQN 4B1VA 5I42A 3OW2M 1WLJA 1YUWA 4PKIA 4CF0A 4BQZA 3O1BA 5CR4A 4HHTA 5ADXA 3F9MA 3CCVN 4B9VA 3HPHA 3NF9A 1XWLA 3WQTA 4ELTA 5C15A 4Z4EA 4BWJA 2V51B 3EKUA 4YOUA 1Q8IA 2QWMA 4YOYA 3MN7A 1XUPO 1NJYA 2WC9A 3O9UA 4CF2A 2BANA 1Z26A 4F9OA 3U9ZA 3NVMA 2BTFA 4BDPA 5HRSA 5AFUH 1TKTA 3L2WA 1TK5A 3H1QA 4AM6A 2NRHA 3UB5A 3EZWA 4B08A 2IVOA 3JS6A 3O1WA 5BPMA 4CGJA 3O3FA 3K5MA 4F2SA 4YDUA 2HSTA 4CBUA 4CFAA 5EXWA 5M1OA 3SJHA 3GG4A 1YVNA 3PUFA 3HPOA 5KTQA 4K8ZA 3K5NA 1S9EA 3C95A 2PYLA 1Q82O 3QINA 1N5YA 5FRMA 4H8KA 5FPEA 4H5TA 1S1WA 3T3FA 2F8TA 1EXQA 3I33A 1KVCA 3T69A 5AQPA 3OBYA 2ZQBA 3D0PA 5HRRA 3PIOL 1RDDA 3FR0A 3QBXA 2Q3SA 2ZWHA 4RTFD 2O8CA 4O44A 4FCYA 4CJQA 4CF1A 3G4SN 2PBDA 1D5AA 3E01A 1QQCA 3A5MC 1VQNN 3H46O 3SAFA 4CD1A 3SUNA 1VHXA 3VEZA 4EAHD 2DTUA 4JS4A 5BREA 4GV3A 1CZ9A 1W97L 4OO1J 4B1YB 3HPGA 3MN5A 4HUGA 5KGXA 4GV9A 3VQPA 1VQ6N 2DFFA 2E20A 4M45A 5LL6Z 3H3OB 3CETA 1EWRA 3CM6A 3MXJA 5AQSA 3RSEB 1WNSA 3K9KA 2ZE2A 1K9MO 1Z6RA 2OCEA 3FFKB 4A2BA 3R3LA 3CJBA 3LAMA 1LW0A 3CQXA 5AZIA 3AVLA 2BGGA 3IG1A 4BG8A 4Q5VA 2E2OA 2QKBA 2KZZA 3H08A 1A5VA 3CYMA 4ELVA 2YNIA 2VCPA 1IKWA 2WFBA 3VGKA 4EIAA 4FJNA 1IG8A 2YHBA 2EX3A 3G25A 2HB5A 2OZSA 2W42A 2PYJA 2W41A 4YORA 3MX2A 2QXFA 3AARA 1KRPA 4IO8A 4KB0A 2FBXA 5FPNA 3AV9A 4BC5A 1X3NA 2AJQA 3HTVA 1W9HA 3MMVA 3DRRA 3ZSYA 1KCFA 1BA1A 2VQFK 4FWMA 4ISFA 2CGLA 1NGCA 1RT6A 3AVGA 4B1XB 3F5TA 5AQYA 3C6UA 1LOTB 4CEAA 2O8FA 3LM9A 4CHPA 1YT3A 2XO7A 4ZTJA 1FKPA 2E1ZA 3I56N 1TAQA 1RT1A 4FLVA 3LWMA 1CZAN 2I5JA 1NK6A 1BU6O 2YNGA 1C0FA 2RN2A 3OS2A 4G1QA 4ILGB 3L8BA 4I9QA 2Q2RA 4OKKA 4E89A 1U48A 1IBLK 3AGKA 3TPQA 3OYNA 4N47A 3SNNA 2HF3A 3FGUA 3L3UA 4V19S 4CFDA 1MWMA 4IFYA 3ZSZA 3WNEA 3MEGA 4XEIA 1EP4A 4DSLA 3ZSVA 1QTMA 1VSIA 4U67L 1VSEA 3L4IA 2FC0A 1VQPN 1YTUA 1S1TA 2F9WA 1VSFA 1QVGM 4I2PA 2RF2A 1GLJO 3VEVA 5J1EA 3PX0A 4C8LA 5C0YA 1MU2A 2ITMA 4FJXA 4B3SK 5AJ3K 1KFSA 4NXMK 1ATNA 3U3GA 4HCBA 3QNNA 1LWEA 3KJVA 1KD1O 2Z1IA 2HNDA 5AQJA 5T7BA 2J4RA 1QVFM 3F2KA 1Q7YO 3VF2A 5J2MA 1ZBLA 3LM2A 3LDPA 2FBVA 2KZMA 3QFUA 1HNVA 2OTLN 2QWLA 4MLHA 3KZBA 2E2PA 4WFNL 1QHAA 3LP2A 3TU5A 1RTIA 3QLHA 3CCLN 2GEMA 4BRQA 4W5QA 4JKBA 3I55N 4BRGA 2ZGYA 3VF6A 4DB3A 4KKOA 4BROA 4E1JA 3FZFA 3SQ0A 1BCMA 1RT4A 2ZF5O 3VTIA 4A57A 4H0VB 1NK0A 1RGIA 3SQ4A 1J5OA 2NRXA 4L3QA 5C25A 1XMQK 3O9QA 1KAYA 1T03A 1BGXT 2PZSA 4FLYA 4QCLA 4FWOA 3G0ZA 4LY7A 2P5GA 4KTQA 1BOTO 2ZJPL 5GIPA 5FDLA 4CK3A 3THXA 3AVIA 1WSJA 5AQRA 3L2UA 1WB9A 4MO5A 1S1XA 4DQPA 3BY5A 2G8FA 5DMRA 3NH1A 3E9LA 3RR7A 3CI5A 3MWTA 4QOZB 1WSIA 4E19A 4FZYA 2O8DA 4CZKA 3CJCA 4ZHRA 3V9WA 2OYQA 1VSJA 2IOCA 3RRGA 3CD6N 1M1KO 3A0IX 4DFMA 3GL1A 5AQGA 1JLGA 4BRFA 3ZX0A 4IDKA 4BG9A 3CXCM 4LF5K 4N5SA 3KD1E 4CGGA 2HNZA 1T6DA 3VQ6A 4Y0WA 1RTJA 3NF8A 1RCHA 3B8AX 4WQ4C 3NH0A 3DLLL 1J5EK 1BIZA 1JJ2M 3DLRA 3O3HA 1DEJA 3VGLA 3U6FA 4DR2K 4KH4A 3S41A 1U4BA 1NU0A 4M7YA 4YOVA 1QQNA 2V7YA 2A41A 4WQ5A 2GTDA 4B3MK 4F8RA 3RSEA 4CE9A 3M1FA 1JL1A 4BGBA 1IBKK 3KTQA 2OANA 3WNFA 1G15A 3U9DA 2G8IA 2JWLA 3CM5A 5BPLA 1TL3A 3F9KA 3CJ1A 4FJ9A 3EE9A 3MWPA 1YITN 4FOEA 2VGNA 4DF4A 4CJWA 2A42A 2D5RA 1JXBA 5GAEP 3DLKA 1HJRA 3QETA 3PO4A 5KRTA 4HWIA 3SUOA 3P38A 2FF6A 3IDHA 3ZT2A 3SQ1A 1J54A 1UWBA 3V4IA 1DGKN 5C2DA 4AF1A 1S72N 4B9UA 1GLDG 1NGGA 4FVMA 3AO4A 3N4PA 2PY5A 4MQ3A 1NMDA 3K59A 3ID8A 1EKEA 4JKDA 1FXXA 4FM0A 2X74A 1VQ7N 4RW6A 3OS1A 4CK1A 4DV0K 2GWKA 2UUBK 2QW9A 3FZMA 3G71N 4B9MA 1IV0A 5KGWA 1N6QA 1VQKN 3IRXA 3KLGA 3I8DA 4DTOA 1LV5A 3G10A 4DSJA 4DG1A 4LF8K 4PKHA 5J2PA 2HVHA 2D0OA 4W5RA 1KC8O 4FJ7A 1OH7A 4RW4A 4CEBA 4B9TA 4O4GA 4DQIA 3L2VA 2OPRA 3UIQA 4X62K 2HHSA 2YHXA 3RMDA 4JEPA 1D4XA 1JLFA 5BPNA 3RWUA 2YHWA 4BR2A 3JAMO 1HKGA 4BE0A 5HL7L 1XQSC 2IVPA 2WBNA 2G8UA 1RT2A 4DFPA 4WYBA 4Z4GA 3SAGA 4JV5K 5BN8A 3SI6A 5J2NA 4I7FA 4RW8A 4PL8A 4JK8A 4AQYK 1DT9A 4RW7A 2GX9A 1JL2A 4WFAL 3HOSA 4AHSA 2O8EA 3ID6A 1YXQA 3TI0A 3CFPA 4O0IA 3NGIA 3VQ9A 3AVAA 1RBSA 3CJAA 2OPPA 3TSUA 1T3VA 3BZKA 3R6MA 4E7IA 2UXDK 3K5OA 3LWLA 4C8NA 5KRSA 3EL2A 2LSNA 3G6EN 1NGJA 5SWMA 4BRHA 1U47A 2F8SA 3WNHA 3ULEA 3A8YA 1ATSA 1YJNN 1E4FT 4BRLA 1BWFO 1RBTA 4IEEA 3DOKA 4CCHA 4OGEA 3VENA 5AQMA 3S3NA 2O8FB 4OJRA 3KK7A 2E6LA 4JI6K 4FJMA 3ENBA 1BA0A 1HKCA 1NGDA 1KVAA 3Q7BA 3QB0A 4LFCK 1VSDA 4H5RA 1RDUA 4BDZA 2HNYA 1NM1A 1A5XA 1YJWN 2ITGA 4WQ5C 3PX6A 2BDPA 4GV6A 1CXUA 5AFUA 3OA9A 2HHTA 4GVMA 4LF6K 5EX5A 3HP9A 4CF9A 4A2AA 4DLGA 4CJTA 2D4WA 4KHUA 2W40A 4DTMA 3VA0A 3V1OA 4K43A 4OKEA 3VEOA 4KTWA 4CERA 1NGAA 5FROA 1NOZA 1S5JA 3B6OA 3KLEA 2KHOA 3U3YA 3HM8A 5KPRA 3AA2A 3NDKA 1CLQA 2QKKA 1WUAA 2IGIA 5AQKA 3QIPA 4KBOA 4ICLA 3CMEN 5CYQA 5JLFA 3WT0A 2ZM6K 4LF7K 4NCAA 3L2QA 2I7NA 3DMJA 4OVLA 1C6VA 4CZFA 1LAWA 5AQQA 3H45C 3MAQA 3HT3A 4B1ZA 5JVGL 4JD2B 5C12A 1M90O 3Q7CA 4BR7A 4JK9A 2VWJA 1T7PA 3TTCA 3CF5L 2Q0RA 2KQ2A 4N41A 4IJAA 3ZT1A 4DTXA 3TAPA 3NF7A 1BQMA 4DV1K 4B9SA 3ATUA 3PV8A 1NLVA 4I6MA 4X65K 2QWPA 3ASMA 1HNZK 1MWKA 1ZC6A 1WSGA 1U49A 3VEWA 4JI0K 4IZ9A 2DY4A 4FK4A 1Q18A 1P8ZA 2EWSA 4FWNA 4NLCA 3CIPA 3GOIA 4Z4IA 1Q9XA 1QQOA 4FWPA 4E7JA 5HROA 2XRIA 1JLQA 5JLHA 4CJUA 1RT3A 2HVIA 2UYTA 3LPTA 3THXB 5D3GA 1NGBA 4FLWA 4M3XA 5BR8K 4AILC 1Z05A 4M3RA 1NGFA 4BC4A 4RG8A 4DQRA 4FJGA 3TAFA 4KI4A 2YV0X 4LFAK 2O8DB 2IAJA 4NO7A 2IVNA 4DS5A 3L0QA 2CGJA 1BG3A 2QTDA 3WXKA 4GW6A 3QEXA 1NJZA 1HUXA 3SBGA 1KSPA 1VSHA 4B3RK 4CEFA 4CGDA 3ZSXA 4CFBA 1QS4A 4JNEA 2P9NA 3DLHA 1NMNA 4QS8A 3SYZA 1DTQA 3DLBA 4FXDA 3P1GA 4JKCA 4O8UA 2HMIA 4KO0A 3VETA 5JS1A 4KAZA 2W6KA 4M3YA 3VMFB 4LH5A 1XNQK 4CJEA 3ZSRA 3QEVA 4FZXC 2QWRA 1GLCG 4AHRA 1KQSM 4I2QA 1BQNA 5M1QA 3IUCA 3V9XA 1OVQA 1KLNA 3MN9A 2HHXA 3DRSA 3J80O 4JK7A 1DLOA 4B9QA 3QDKA 2P9IA 4CJRA 4IEIA 3ZYYX 5AQTA 3TWHA 1X9JA 1TK0A 2UUCK 2VWBA 4Z4FA 1HPMA 1N36K 3HVRA 1JXEA 2X78A 2F7TA 5DM7L 1HQEA 4KRFA 4FSVA 1VRUA 2Q36A 5BN9A 2HBKA 3BDPA 5CHIA 3SAHA 1NGIA 1NWKA 3D2FA 4CHZA 3E9OA 1EETA 1L3VA 4CFCA 4DWIA 3VQ5A 2GUPA 1NJWA 4CZEA 4HUFA 3KK1A 3C0BA 1IKYA 3H3NO 1GOAA 4CIGA 1EWQA 3RMAA 1RDBA 3MEEA 3NCIA 3H1VX 4CGIA 4A5AA 5F1XA 3CCRN 1J53A 3VQDA 3RMBA 1T05A 3SZ2A 1WAFA 1LCUA 1NJXA 3LDLA 1RILA 4CZMA 4K41A 4GKKK 3ZLJA 3VQEA 4DS4A 2RPIA 5DM6L 5KPZA 4JI3K 1QHTA 3SV3A 3AO3A 4YOXA 3CQ8A 4BR9A 4LFBK 5LJVA 4KTZA 1GLEG 4KH6A 3R1XA 4DR1K 1GOBA 3UKUA 1VQ4N 4Z4HA 2F4VK 4O0JA 1I3AA 1B9FA 5AQFA 5AQHA 3CFOA 3OVNA 4X66K 4YDUC 4IWVA 1BUPA 2O8EB 4DTNA 2YKNA 4KHYA 5BRHA 1ASUA 1JKHA 3VPZA 1KLMA 1NK4A 3CC2N 4KI6A 2XY8A 3OS0A 3FZKA 4KHPK 1OKJA 4FWKA 3QO9A 5KI6A 3P39A 3QEWA 2GV9A 4BWMA 2P9SB 3HOTA 4JD2A 2P9KA 1W7AA 4CESA 1X9SA 3ULEB 3ZEUB 5LMUK 2YKMA 1K73O 4KV8A 3TR8A 3LPUA 5KQDA 4NYFA 4KREA 3W0LA 2QA4N 2Q31A 4FW1A 5JS2A 3CFRA 5K14A 3ZSWA 5M1NA 3O4NA 4LD0A 4BQLA 4B8AB 2DFHA 5AQZA 4JN4A 3P31A 1N33K 4E1NA 3V1QA 4BY9C 3BF1A 3LL3A 4JRPA 4HTUA 4F3TA 1QQMA 1GLLO 1KXPA 1NGEA 2A3ZA 4FJKA 1HRHA 3HYFA 5C2FA 2VGMA 3NE6A 4YY3K 3L2RA 4AM7A 2YI1A 1XNRK 2AP1A 2Q1NA 2O4IA 2RHKA 3AVBA 4IG3A 3WNGA 4KHWA 3AA5X 1VAZA 1U45A 3WXJA 3HJFA 3EYZA 5I9EB 1HQUA 3CMAN 4PY5A 4N56A 3TAQA 4J8FA 3CCUN 3V6DA 2Y1IA 4E1MA 2PFUA 3C6TA 3KKSA 1KAZA 3AVJA 3M3ZA 4M3TA 2P9PA 1BL3A 3E9PA 4E7KA 2YHAA 1GLAG 5AQIA 3D7EO 4IG0A 3I8BA 3N4QA 4CBXA 2QM1A 3MCPA 4E0DA 1WOQA 4RW9A 3VQAA 2NRRA 4LF9K 3GDQA 1TKDA 4DSKA 4A61A 3J81O 1TL1A 3TAMA 3VQ4A 3PSFA 4PL7A 3SMSA 3HZ6A 4CJSA 3K58A 4QS7A 1MDUB 3WUHA 2QWNA 2KKZA 4FPAA 1OH8A 2G8VA 4CW7B 3T1AA 5HBMA 3DI6A 1XHXA 4I6MB 4YHHK 1S1VA 3U4LA 2A5XA 4BACA 3DXKB 2Z1JA 4C8OA 4B1UB 2YNFA 5TKYA 5SZTA 3JYTA 3CCMN 2OPSA 3V81A 1J6ZA 4CJKA 3S3OA 3DJCA 3BEXA 3SBTA 4JKAA 2BE2A 4MLEA 1Y64A 4JI2K 4EP4A 3VOVA 4C1NI 1KFDA 2Q0UA 1FKOA 4B9NA 2XY6A 3ENHA 4EHTA 4Y1CA 4CZIA 4OLAA 4UY8O 3NHGA 3FZHA 2FBYA 4O5FA 3SK3A 4FM1A 2QWOA 1YF5L 4DSIA 4KPYA 4H5NA 4YOWA 1OH6A 2NRTA 2VYPA 3SLCA 1EX4A 1S3XA 1B9DA 1UA0A 2H3GX 2HOEA 4KFBA 5HRPA 1RT5A 2P9NB 4FVUA 1SL0A 3EKSA 1U04A 1BIUA 3AVKA 3ULDA 3TARA 4GVEA 5CY4A 1KVBA 3BP8A 2NRWA 1J9AA 1BHLA 4AHTA 2YNHA 3JSMA 4CZJA 1ZBUA 1C1BA 1WSEA 3EE8A 5TKWA 3ISNC 4DSEA 1YI2N 3C6HA 1SZ2A 3QICA 3TAGA 3B6PA 3CPWM 3J8AA 1L3UA 3LDQA 3RR8A 4DKWA 1XC9A 4DF8A 1VSKA 2NRVA 4JS5A 3UKRA 4OGCA 3RVCA 3VA3A 3LZIA 1Q86O 4FK0A 2P9IB 4CBWA 2WOMA 5ELZA 4ID1A 5FPMA 1ILYA 3OYJA 3NFAA 3FZLA 2DFEA 1D8YA 1GLBG 3ZT3A 3C7NA 3VN5A 4BR5A 4K25A 1TKXA 3VESA 5AQVA 4A5BA 2ETJA 1E3MA 5HP1A 4IFEA 3RRHA 4CVNE 1YTAA 4FL9A 4M3UA 2ZD1A 4CIEA 1X1PA 2ASMA 2P9SA 3BGRA 1VQ5N 1N32K 3WXIA 3HXMA 1IO2A 2WUSA 3SUPA 3SPYA 2IC3A 3D2FB 2ASPA 3TTFA 5AQWA 4K42A 3W3DA 3ZEUA 4PUOA 2KFZA 4H4OA 3DWLA 1MA9B 4DR4K 1N34K 1O1WA 3DOLA 4DV6K 1LAVA 4JHDA 2O8BA 4BE2A 1FJGK 1L3SA 3OYCA 3M8RA 4M3WA 1C0GA 3OTOK 1C0UA 3KLHA 4JKGB 2P5OA 3VQ8A 1TKZA 3QBWA 1VQ8N 1TAUA 2NRZA 2OZMA 5DK5A 5HRNA 1REVA 1JCFA 2WONA 1NKBA 4CEOA 1QE1A 4FLTA 1BCOA 3RMCA 4FO0A 1S9GA 3C6AA 4X64K 4CGFA 5KQ8A 5JICA 5LY3A 1SKSA 4HCCA 3LDOA 3CERA 3CC7N 4DV4K 1JCEA 4R5PA 1LW2A 2D0PA 3O8MA 5B8HA 2XY7A 3J7AP 2CH6A 4DV2K 2F9TA 5EVZA 3O9RA 3KKRA 3UKUB 2HF4A 2HHUA 3F73A 2QXLA 3AO1A 3L6QA 1ZBHA 1Q9YA 3SUQA 5AQXA 3K9JA 4DR3K 4O5BA 5M1KA 1B92A 1JLEA 5GIOA 3K0SA 4DUYK 3AVMA 2UUAK 3WEEA 3QNOA 1YJ9N 4DQ8A 2FBTA 2KW4A 4C8KA 2FLOA 2CGKA 4DTPA 4DLEA 4B9LA 4JKHA 1BI4A 2P9LB 5AQUA 4BC2A 2Q97A 4IOCL 2Y1JA 1U2VB 3HK2A 3AO5A 3AVCA 1IJJA 2P9KB 3VEXA 3IAYA 4BREA 1EO1A 4FW2A 3NAEA 4FJHA 1HJOA 1Z25A 2IIRA 4PHTX 3QERA 5HLFA 5GINA 2YJEA 1W0HA 4CEDA 4BR0A 4CJ7A 4BRIA 2V52B 3UE5A 2D0BA 3DXKA 4WF9L 3P5JA 1X3MA 2QEXN 1HLUA 1OH5A 4JI8K
chains in the Genus database with same CATH topology
4B3TK 3OTOK 4LFAK 4LF6K 4DR6K 2VQEK 4X62K 4JI4K 4YY3K 4LF5K 5LL6Z 4GKKK 1XNRK 4B3SK 4DV5K 3JAMO 5AJ3K 4B3RK 4NXMK 4JI3K 2UU9K 4DV7K 1J5EK 4X64K 4LF4K 4JV5K 4LFBK 4DR2K 1HR0K 5A2QO 1I94K 4DR1K 4OX9K 4DV4K 4B3MK 4JI7K 2ZM6K 4AQYK 4LF7K 2F4VK 1IBMK 2UXBK 1IBKK 1XNQK 5FLXO 3J7AP 1HNWK 4GKJK 3T1HK 4DV2K 4JI1K 4X66K 4DV3K 4LF9K 2UXDK 4NXNK 4DR5K 4DR3K 3J81O 2UXCK 3J80O 1HNXK 2UUAK 4DUYK 4KHPK 5IT9O 2VQFK 4JI5K 3T1YK 4DV1K 4DUZK 2UUCK 4CW7B 4X65K 1HNZK 5IWAK 1N36K 1XMQK 5LMUK 4JI0K 4YHHK 3J7YP 1XMOK 4CVNE 4JI6K 4DV0K 2UUBK 2E5LK 1N32K 4LFCK 1N33K 4DR7K 2HHHK 4JI2K 4K0KK 4LF8K 4DR4K 1N34K 1IBLK 4DV6K 5BR8K 1FJGK 4V19S 4JYAK 5LMNK 4JI8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T K;  3OTO K;  4LFA K;  4LF6 K;  4DR6 K;  2VQE K;  4X62 K;  4JI4 K;  4YY3 K;  4LF5 K;  5LL6 Z;  4GKK K;  1XNR K;  4B3S K;  4DV5 K;  3JAM O;  5AJ3 K;  4B3R K;  4NXM K;  4JI3 K;  2UU9 K;  4DV7 K;  1J5E K;  4X64 K;  4LF4 K;  4JV5 K;  4LFB K;  4DR2 K;  1HR0 K;  5A2Q O;  1I94 K;  4DR1 K;  4OX9 K;  4DV4 K;  4B3M K;  4JI7 K;  2ZM6 K;  4AQY K;  4LF7 K;  2F4V K;  1IBM K;  2UXB K;  1IBK K;  1XNQ K;  5FLX O;  3J7A P;  1HNW K;  4GKJ K;  3T1H K;  4DV2 K;  4JI1 K;  4X66 K;  4DV3 K;  4LF9 K;  2UXD K;  4NXN K;  4DR5 K;  4DR3 K;  3J81 O;  2UXC K;  3J80 O;  1HNX K;  2UUA K;  4DUY K;  4KHP K;  5IT9 O;  2VQF K;  4JI5 K;  3T1Y K;  4DV1 K;  4DUZ K;  2UUC K;  4CW7 B;  4X65 K;  1HNZ K;  5IWA K;  1N36 K;  1XMQ K;  5LMU K;  4JI0 K;  4YHH K;  3J7Y P;  1XMO K;  4CVN E;  4JI6 K;  4DV0 K;  2UUB K;  2E5L K;  1N32 K;  4LFC K;  1N33 K;  4DR7 K;  2HHH K;  4JI2 K;  4K0K K;  4LF8 K;  4DR4 K;  1N34 K;  1IBL K;  4DV6 K;  5BR8 K;  1FJG K;  4V19 S;  4JYA K;  5LMN K;  4JI8 K; 
#chains in the Genus database with same CATH topology
 1QSS A;  3EN9 A;  4O55 A;  4BE1 A;  2IS3 A;  4FJ5 A;  3HM9 A;  2NNW A;  3GE1 A;  3DRP A;  1RBU A;  3KIO A;  4FOI A;  3KLI A;  3KK3 A;  4MFB A;  5AR0 A;  4W5O A;  1VRT A;  2IDO A;  3DAW A;  1CZB A;  3CCQ N;  2A40 A;  1RDA A;  2UU9 K;  4E7L A;  4Z4C A;  2B5J A;  1V4T A;  3ZET A;  4BRK A;  3E1Y A;  3U8X A;  1UOC A;  4OX9 K;  4B8C A;  4JI7 K;  4DFJ A;  2P9P B;  3ENO A;  4FJ8 A;  1HNW K;  3KLF A;  4LH4 A;  4CGH A;  3TSP A;  4Q0B A;  1NJI O;  2P9U B;  5MLC Q;  4KHQ A;  3QEP A;  5EU7 A;  3ZCM A;  4M41 A;  5CZ1 A;  3MDQ A;  3OJU A;  4NB4 A;  4XH1 A;  5FRN A;  3LZJ A;  2BH1 A;  2HBL A;  3V1R A;  5M1F A;  3D2E B;  1O13 A;  3MX5 A;  4J2E A;  3AVF A;  3T1Y K;  2CH5 A;  3AO2 A;  1ASW A;  3LP3 A;  1IKV A;  5JMV A;  4IXC A;  2I7P A;  1T44 A;  4H0X B;  2VG6 A;  3O08 A;  3SJJ A;  3IFR A;  3MK6 A;  4DHY A;  5ADX H;  2B6A A;  1C0M A;  2EHG A;  5EOY A;  5M1P A;  3OYI A;  3THW A;  1C1C A;  3L4Q A;  1HX1 A;  4FPB A;  3WXM B;  3O5B A;  4F3O A;  1C1A A;  2OPQ A;  3PIP L;  1S22 A;  3ZT4 A;  3CJ7 A;  2OTJ N;  3ZX2 A;  4CJ4 A;  4ID5 A;  4FWQ A;  4DU4 A;  5E41 A;  3OYM A;  3OYE A;  4LSN A;  4IOX A;  2BUP A;  3LAL A;  4BRD A;  1HKB A;  4IKF A;  1SKW A;  1Y97 A;  4ISG A;  3VQQ A;  3TSQ A;  3MEC A;  1S6Q A;  3EY1 A;  4EFH A;  1TYQ B;  3NF6 A;  4IBN A;  3PSI A;  3OYD A;  3J7Z O;  3HP6 A;  3CHW A;  3V9S A;  4BGA A;  1TUU A;  3TAE A;  1L5U A;  1RTH A;  4TSX A;  4CZG A;  4DV5 K;  3HSC A;  4OPJ A;  1ZYQ A;  4MO4 A;  3O4W A;  1SKR A;  1G99 A;  3M8S A;  4MDA A;  4CHQ A;  1SL2 A;  4BR4 A;  3DXM B;  4OPH A;  4EHU A;  1DTT A;  3HRG A;  3ZSO A;  1E4G T;  4JKG A;  4GNI A;  1NK5 A;  1HR0 K;  3NGY A;  1HPZ A;  3MXM A;  1WN7 A;  4J2A A;  3VER A;  4FYD A;  1H1V A;  4RCH A;  4WQ4 A;  4BRM A;  3OJS A;  4RWT A;  3VTH A;  3WQU A;  2UXB K;  1A5W A;  1JLB A;  5EY4 A;  3BZC A;  4BVP A;  5E84 A;  4JI1 K;  1IG9 A;  4DFK A;  3JXU A;  5AQL A;  2G8W A;  2KLA A;  3MN6 A;  4NYN A;  3D6R A;  4DU1 A;  5KPT A;  2VG7 A;  1VQM N;  2D0A A;  3TAN A;  1RBV A;  4NLB A;  3ZT0 A;  3DLG A;  4C1N K;  3CQY A;  3O6W A;  5CE3 A;  3T19 A;  1TGO A;  3AA4 A;  5F0X A;  2GEL A;  1S1U A;  3VGM A;  4U7B A;  4HVJ A;  4DUZ K;  4EZ6 A;  3UKR B;  2ZJQ L;  3KWI A;  5F2R A;  3NVK A;  4H0Y B;  3P83 D;  3J7Y P;  4IO9 L;  3C7N B;  1OVY A;  3A2F A;  2R7Y A;  4DTS A;  4KHN A;  2HHQ A;  4IDH A;  2NLX A;  4OPA A;  1K8K B;  3OYA A;  3K5L A;  4BRN A;  4ISE A;  3DM2 A;  1X9M A;  1LWC A;  4H4M A;  4FM2 A;  3KK2 A;  2P9L A;  3OY9 A;  4DR7 K;  3CPE A;  4PA1 A;  1U2V A;  2HHH K;  2G8H A;  4K0K K;  4BVO A;  5I3U A;  4DCH A;  3ALY A;  1R59 O;  5GAG P;  4A59 A;  2NZT A;  5AZJ A;  1DKG D;  1N8R O;  4WCE L;  3PLA A;  3VQB A;  4B3T K;  1RFQ A;  1SAZ A;  4JHD B;  2O8B B;  1UAX A;  2FSN A;  3O9S A;  4JLH A;  4EP5 A;  4CK2 A;  2Z1G A;  4FJL A;  4KB1 A;  2JWK A;  3V9Z A;  3EO3 A;  5LJW A;  1S6P A;  4CD3 A;  5CYM A;  3OYG A;  4M7X A;  2JLE A;  1KTQ A;  5C42 A;  4DV7 K;  4GY2 B;  2A6A A;  3R9P A;  3OYB A;  1YVU A;  2P1J A;  4LF4 K;  1ITG A;  1SV5 A;  4FK2 A;  3ZX3 A;  3HBT A;  3LDS A;  3LAN A;  1SUQ A;  4JRQ A;  2AA4 A;  5JVH L;  1X9W A;  1FW6 A;  2A1R A;  4PWD A;  3PY8 A;  4XIU A;  4W5N A;  3H6E A;  4PQU A;  2ASO A;  3VEY A;  4I9L A;  1R0A A;  1ZBI A;  1EQY A;  1V4S A;  4QS9 A;  1IBM K;  1HYS A;  4Z0U A;  3OBW A;  4GKJ K;  3T1H K;  3A5O C;  4AHU A;  3HL8 A;  1BDG A;  2QWQ A;  1WSF A;  3OHR A;  1XC3 A;  4ZTF A;  3PX4 A;  4DSF A;  4NXN K;  3SQ2 A;  3E66 A;  2RKI A;  4YOT A;  1LWF A;  3QML A;  1HNX K;  3VF4 A;  4CI6 A;  2B4J A;  3DLE A;  2FSK A;  4CZL A;  3GBT A;  1VQL N;  1QSY A;  4JI5 K;  1TUY A;  1NBW A;  3WEE B;  2P9U A;  3AY9 A;  2E88 A;  3THY B;  4JKF A;  4DQS A;  2VG5 A;  3FFI A;  5BR9 A;  4CEC A;  1NKC A;  4J2D A;  4OPK A;  5CZ2 A;  3HO1 A;  4N76 A;  5H1S Q;  2YHY A;  2XHB A;  4M42 A;  5C24 A;  1BI4 B;  3LDN A;  1XMO K;  4F2R A;  3PO5 A;  3D2E A;  1ESV A;  4B3O A;  2YX6 A;  5GAD P;  1VSL A;  4L8R B;  2E1Y A;  2W6L A;  4FWL A;  3SMP A;  2QI2 A;  3MXI A;  1NK7 A;  5HOO A;  1NKE A;  2HBM A;  3KD5 E;  4IOA L;  1QSL A;  3KVG A;  4IFV A;  1L3T A;  3FE1 A;  2JGU A;  1RDW X;  1XI1 A;  4JYA K;  4AH9 A;  2HHW A;  3NGZ A;  1YIJ N;  1FK9 A;  1IKX A;  4M63 C;  3OYK A;  2E6M A;  3MED A;  4OKJ A;  2D1K A;  4O8K A;  3TTD A;  1NGH A;  4FJI A;  3LP0 A;  4JI4 K;  4CIF A;  4FWS A;  1RNH A;  1HYV A;  1T8E A;  4C23 A;  3M8P A;  4Z94 A;  4DQQ A;  4YFU A;  3K57 A;  3AAP A;  1YAG A;  2Z1H A;  3O80 A;  3CJ9 A;  1TYQ A;  2PAV A;  4FLU A;  3NBP A;  3CCJ N;  4K8X A;  3MCA B;  4YNQ A;  5A2Q O;  1I94 K;  1BIS A;  4UQG A;  3NMU A;  4XH4 A;  3ZET B;  2E8A A;  3THV A;  5FLX O;  3BUZ B;  4F4K A;  2D0C A;  5BRF A;  4CJP A;  4XH5 A;  1W2B M;  3O3G A;  3DXM A;  3KWG A;  1WAJ A;  2FF3 B;  4DTR A;  3IMX A;  4DV3 K;  4E3S A;  4ELU A;  3CCE N;  3AVH A;  3CC4 N;  2P51 A;  1C0T A;  1SL1 A;  3RTV A;  4J2B A;  2QK9 A;  3M5R A;  3CCS N;  3VQ7 A;  5IT9 O;  1RBR A;  5AQN A;  3HST B;  3ITH A;  1WSH A;  1QZ6 A;  2O8C B;  4CJ5 A;  5BRD A;  2HHV A;  1NK9 A;  2O4G A;  5IWA K;  4CEZ A;  3QES A;  2OA8 A;  3HVT A;  3OYL A;  4DU3 A;  2GBZ A;  4LC9 B;  3AGR A;  2HMP A;  2NUB A;  2WTU A;  2X6N A;  1SQK A;  3LP1 A;  4CJL A;  4CJ3 A;  1NK8 A;  2FXU A;  1QZ5 A;  4FZZ A;  4C8M A;  2A1S A;  3WXL A;  3VQC A;  3OYH A;  1HYZ A;  3THW B;  3EEQ A;  1GLF O;  3NH2 A;  4BRC A;  3O9T A;  4G9Z A;  1HNI A;  5J2Q A;  1F21 A;  3QEI A;  5GAH P;  1K8A O;  2FSJ A;  3C65 A;  2HBJ A;  2X6S A;  1HMV A;  3LAK A;  3KHY A;  2GWJ A;  5LMN K;  4HUE A;  4H03 B;  3L3V A;  4H0P A;  3A5L C;  4WFB L;  2KFN A;  4KH5 A;  1K8K A;  2YJF A;  5FPD A;  3T7Z A;  4CJF A;  4PKG A;  3BF3 A;  4DR6 K;  3S3M A;  1BO5 O;  4CZH A;  1IH7 A;  3S9H A;  1WBD A;  1RDC A;  3ATV A;  5AZI B;  3QIO A;  3O4Q A;  4B1W B;  4E7H A;  2E4L A;  3SV4 A;  1T6C A;  4H0O A;  1K6Y A;  3AVN A;  4CEQ A;  2E2Q A;  4H0T B;  3D45 A;  1VQO N;  4OLB A;  1TK8 A;  4KHS A;  2E2N A;  2ZGZ A;  1XHZ A;  1WBB A;  4CEE A;  4ILH A;  3AAQ A;  1ZBS A;  2KTQ A;  3V9U A;  1TVR A;  1D9D A;  5C10 A;  3P4I A;  3C94 A;  2GUI A;  3QFP A;  4R79 A;  2G8K A;  1NOY A;  4DTJ A;  4EZ9 A;  1CXQ A;  3FLC O;  2ATQ A;  2F96 A;  4ILJ A;  4Y1D A;  4HTL A;  1NG9 A;  1P90 A;  3DYA A;  1JCG A;  4JKE A;  4QAG A;  4DR5 K;  4MDB A;  3I0R A;  4CHN A;  4BRP A;  1RTD A;  2UXC K;  1ASV A;  3IS9 A;  4DTU A;  4DMN A;  1VQ9 N;  1NNE A;  2V7Z A;  4CHY A;  3HI0 A;  3CG7 A;  2VWK A;  3M8Q A;  3I0S A;  1VSM A;  5E26 A;  4LSL A;  4GMJ B;  4FLZ A;  4A62 A;  4BRA A;  1ZBF A;  3ZSQ A;  1D9F A;  1ZXO A;  4H5W A;  4H5V A;  3K2P A;  2DPN A;  3A5N C;  2XY5 A;  3TAB A;  2ZJR L;  4CF8 A;  4CJV A;  4M3Z A;  1VK0 A;  3IKM A;  2E5L K;  1U6Z A;  4IJN A;  4W5T A;  3M6G A;  3SPZ A;  1TV6 A;  3THY A;  1RT7 A;  2RE2 A;  4JAX A;  4FWR A;  4WE1 A;  1Q81 O;  4AHV A;  3SCX A;  1I39 A;  4FLX A;  5AQO A;  4NCB A;  4BDY A;  1JLC A;  3AA3 A;  3R8E A;  3EZ5 A;  4BC3 A;  1GOC A;  4FJJ A;  4NCG A;  2HW3 A;  1ATR A;  1JLA A;  5AZJ B;  2YCH A;  2VQE K;  1UA1 A;  1KAX A;  3OYF A;  1SS6 A;  4AHC A;  4CHO A;  1YHQ N;  4B1V A;  5I42 A;  3OW2 M;  1WLJ A;  1YUW A;  4PKI A;  4CF0 A;  4BQZ A;  3O1B A;  5CR4 A;  4HHT A;  5ADX A;  3F9M A;  3CCV N;  4B9V A;  3HPH A;  3NF9 A;  1XWL A;  3WQT A;  4ELT A;  5C15 A;  4Z4E A;  4BWJ A;  2V51 B;  3EKU A;  4YOU A;  1Q8I A;  2QWM A;  4YOY A;  3MN7 A;  1XUP O;  1NJY A;  2WC9 A;  3O9U A;  4CF2 A;  2BAN A;  1Z26 A;  4F9O A;  3U9Z A;  3NVM A;  2BTF A;  4BDP A;  5HRS A;  5AFU H;  1TKT A;  3L2W A;  1TK5 A;  3H1Q A;  4AM6 A;  2NRH A;  3UB5 A;  3EZW A;  4B08 A;  2IVO A;  3JS6 A;  3O1W A;  5BPM A;  4CGJ A;  3O3F A;  3K5M A;  4F2S A;  4YDU A;  2HST A;  4CBU A;  4CFA A;  5EXW A;  5M1O A;  3SJH A;  3GG4 A;  1YVN A;  3PUF A;  3HPO A;  5KTQ A;  4K8Z A;  3K5N A;  1S9E A;  3C95 A;  2PYL A;  1Q82 O;  3QIN A;  1N5Y A;  5FRM A;  4H8K A;  5FPE A;  4H5T A;  1S1W A;  3T3F A;  2F8T A;  1EXQ A;  3I33 A;  1KVC A;  3T69 A;  5AQP A;  3OBY A;  2ZQB A;  3D0P A;  5HRR A;  3PIO L;  1RDD A;  3FR0 A;  3QBX A;  2Q3S A;  2ZWH A;  4RTF D;  2O8C A;  4O44 A;  4FCY A;  4CJQ A;  4CF1 A;  3G4S N;  2PBD A;  1D5A A;  3E01 A;  1QQC A;  3A5M C;  1VQN N;  3H46 O;  3SAF A;  4CD1 A;  3SUN A;  1VHX A;  3VEZ A;  4EAH D;  2DTU A;  4JS4 A;  5BRE A;  4GV3 A;  1CZ9 A;  1W97 L;  4OO1 J;  4B1Y B;  3HPG A;  3MN5 A;  4HUG A;  5KGX A;  4GV9 A;  3VQP A;  1VQ6 N;  2DFF A;  2E20 A;  4M45 A;  5LL6 Z;  3H3O B;  3CET A;  1EWR A;  3CM6 A;  3MXJ A;  5AQS A;  3RSE B;  1WNS A;  3K9K A;  2ZE2 A;  1K9M O;  1Z6R A;  2OCE A;  3FFK B;  4A2B A;  3R3L A;  3CJB A;  3LAM A;  1LW0 A;  3CQX A;  5AZI A;  3AVL A;  2BGG A;  3IG1 A;  4BG8 A;  4Q5V A;  2E2O A;  2QKB A;  2KZZ A;  3H08 A;  1A5V A;  3CYM A;  4ELV A;  2YNI A;  2VCP A;  1IKW A;  2WFB A;  3VGK A;  4EIA A;  4FJN A;  1IG8 A;  2YHB A;  2EX3 A;  3G25 A;  2HB5 A;  2OZS A;  2W42 A;  2PYJ A;  2W41 A;  4YOR A;  3MX2 A;  2QXF A;  3AAR A;  1KRP A;  4IO8 A;  4KB0 A;  2FBX A;  5FPN A;  3AV9 A;  4BC5 A;  1X3N A;  2AJQ A;  3HTV A;  1W9H A;  3MMV A;  3DRR A;  3ZSY A;  1KCF A;  1BA1 A;  2VQF K;  4FWM A;  4ISF A;  2CGL A;  1NGC A;  1RT6 A;  3AVG A;  4B1X B;  3F5T A;  5AQY A;  3C6U A;  1LOT B;  4CEA A;  2O8F A;  3LM9 A;  4CHP A;  1YT3 A;  2XO7 A;  4ZTJ A;  1FKP A;  2E1Z A;  3I56 N;  1TAQ A;  1RT1 A;  4FLV A;  3LWM A;  1CZA N;  2I5J A;  1NK6 A;  1BU6 O;  2YNG A;  1C0F A;  2RN2 A;  3OS2 A;  4G1Q A;  4ILG B;  3L8B A;  4I9Q A;  2Q2R A;  4OKK A;  4E89 A;  1U48 A;  1IBL K;  3AGK A;  3TPQ A;  3OYN A;  4N47 A;  3SNN A;  2HF3 A;  3FGU A;  3L3U A;  4V19 S;  4CFD A;  1MWM A;  4IFY A;  3ZSZ A;  3WNE A;  3MEG A;  4XEI A;  1EP4 A;  4DSL A;  3ZSV A;  1QTM A;  1VSI A;  4U67 L;  1VSE A;  3L4I A;  2FC0 A;  1VQP N;  1YTU A;  1S1T A;  2F9W A;  1VSF A;  1QVG M;  4I2P A;  2RF2 A;  1GLJ O;  3VEV A;  5J1E A;  3PX0 A;  4C8L A;  5C0Y A;  1MU2 A;  2ITM A;  4FJX A;  4B3S K;  5AJ3 K;  1KFS A;  4NXM K;  1ATN A;  3U3G A;  4HCB A;  3QNN A;  1LWE A;  3KJV A;  1KD1 O;  2Z1I A;  2HND A;  5AQJ A;  5T7B A;  2J4R A;  1QVF M;  3F2K A;  1Q7Y O;  3VF2 A;  5J2M A;  1ZBL A;  3LM2 A;  3LDP A;  2FBV A;  2KZM A;  3QFU A;  1HNV A;  2OTL N;  2QWL A;  4MLH A;  3KZB A;  2E2P A;  4WFN L;  1QHA A;  3LP2 A;  3TU5 A;  1RTI A;  3QLH A;  3CCL N;  2GEM A;  4BRQ A;  4W5Q A;  4JKB A;  3I55 N;  4BRG A;  2ZGY A;  3VF6 A;  4DB3 A;  4KKO A;  4BRO A;  4E1J A;  3FZF A;  3SQ0 A;  1BCM A;  1RT4 A;  2ZF5 O;  3VTI A;  4A57 A;  4H0V B;  1NK0 A;  1RGI A;  3SQ4 A;  1J5O A;  2NRX A;  4L3Q A;  5C25 A;  1XMQ K;  3O9Q A;  1KAY A;  1T03 A;  1BGX T;  2PZS A;  4FLY A;  4QCL A;  4FWO A;  3G0Z A;  4LY7 A;  2P5G A;  4KTQ A;  1BOT O;  2ZJP L;  5GIP A;  5FDL A;  4CK3 A;  3THX A;  3AVI A;  1WSJ A;  5AQR A;  3L2U A;  1WB9 A;  4MO5 A;  1S1X A;  4DQP A;  3BY5 A;  2G8F A;  5DMR A;  3NH1 A;  3E9L A;  3RR7 A;  3CI5 A;  3MWT A;  4QOZ B;  1WSI A;  4E19 A;  4FZY A;  2O8D A;  4CZK A;  3CJC A;  4ZHR A;  3V9W A;  2OYQ A;  1VSJ A;  2IOC A;  3RRG A;  3CD6 N;  1M1K O;  3A0I X;  4DFM A;  3GL1 A;  5AQG A;  1JLG A;  4BRF A;  3ZX0 A;  4IDK A;  4BG9 A;  3CXC M;  4LF5 K;  4N5S A;  3KD1 E;  4CGG A;  2HNZ A;  1T6D A;  3VQ6 A;  4Y0W A;  1RTJ A;  3NF8 A;  1RCH A;  3B8A X;  4WQ4 C;  3NH0 A;  3DLL L;  1J5E K;  1BIZ A;  1JJ2 M;  3DLR A;  3O3H A;  1DEJ A;  3VGL A;  3U6F A;  4DR2 K;  4KH4 A;  3S41 A;  1U4B A;  1NU0 A;  4M7Y A;  4YOV A;  1QQN A;  2V7Y A;  2A41 A;  4WQ5 A;  2GTD A;  4B3M K;  4F8R A;  3RSE A;  4CE9 A;  3M1F A;  1JL1 A;  4BGB A;  1IBK K;  3KTQ A;  2OAN A;  3WNF A;  1G15 A;  3U9D A;  2G8I A;  2JWL A;  3CM5 A;  5BPL A;  1TL3 A;  3F9K A;  3CJ1 A;  4FJ9 A;  3EE9 A;  3MWP A;  1YIT N;  4FOE A;  2VGN A;  4DF4 A;  4CJW A;  2A42 A;  2D5R A;  1JXB A;  5GAE P;  3DLK A;  1HJR A;  3QET A;  3PO4 A;  5KRT A;  4HWI A;  3SUO A;  3P38 A;  2FF6 A;  3IDH A;  3ZT2 A;  3SQ1 A;  1J54 A;  1UWB A;  3V4I A;  1DGK N;  5C2D A;  4AF1 A;  1S72 N;  4B9U A;  1GLD G;  1NGG A;  4FVM A;  3AO4 A;  3N4P A;  2PY5 A;  4MQ3 A;  1NMD A;  3K59 A;  3ID8 A;  1EKE A;  4JKD A;  1FXX A;  4FM0 A;  2X74 A;  1VQ7 N;  4RW6 A;  3OS1 A;  4CK1 A;  4DV0 K;  2GWK A;  2UUB K;  2QW9 A;  3FZM A;  3G71 N;  4B9M A;  1IV0 A;  5KGW A;  1N6Q A;  1VQK N;  3IRX A;  3KLG A;  3I8D A;  4DTO A;  1LV5 A;  3G10 A;  4DSJ A;  4DG1 A;  4LF8 K;  4PKH A;  5J2P A;  2HVH A;  2D0O A;  4W5R A;  1KC8 O;  4FJ7 A;  1OH7 A;  4RW4 A;  4CEB A;  4B9T A;  4O4G A;  4DQI A;  3L2V A;  2OPR A;  3UIQ A;  4X62 K;  2HHS A;  2YHX A;  3RMD A;  4JEP A;  1D4X A;  1JLF A;  5BPN A;  3RWU A;  2YHW A;  4BR2 A;  3JAM O;  1HKG A;  4BE0 A;  5HL7 L;  1XQS C;  2IVP A;  2WBN A;  2G8U A;  1RT2 A;  4DFP A;  4WYB A;  4Z4G A;  3SAG A;  4JV5 K;  5BN8 A;  3SI6 A;  5J2N A;  4I7F A;  4RW8 A;  4PL8 A;  4JK8 A;  4AQY K;  1DT9 A;  4RW7 A;  2GX9 A;  1JL2 A;  4WFA L;  3HOS A;  4AHS A;  2O8E A;  3ID6 A;  1YXQ A;  3TI0 A;  3CFP A;  4O0I A;  3NGI A;  3VQ9 A;  3AVA A;  1RBS A;  3CJA A;  2OPP A;  3TSU A;  1T3V A;  3BZK A;  3R6M A;  4E7I A;  2UXD K;  3K5O A;  3LWL A;  4C8N A;  5KRS A;  3EL2 A;  2LSN A;  3G6E N;  1NGJ A;  5SWM A;  4BRH A;  1U47 A;  2F8S A;  3WNH A;  3ULE A;  3A8Y A;  1ATS A;  1YJN N;  1E4F T;  4BRL A;  1BWF O;  1RBT A;  4IEE A;  3DOK A;  4CCH A;  4OGE A;  3VEN A;  5AQM A;  3S3N A;  2O8F B;  4OJR A;  3KK7 A;  2E6L A;  4JI6 K;  4FJM A;  3ENB A;  1BA0 A;  1HKC A;  1NGD A;  1KVA A;  3Q7B A;  3QB0 A;  4LFC K;  1VSD A;  4H5R A;  1RDU A;  4BDZ A;  2HNY A;  1NM1 A;  1A5X A;  1YJW N;  2ITG A;  4WQ5 C;  3PX6 A;  2BDP A;  4GV6 A;  1CXU A;  5AFU A;  3OA9 A;  2HHT A;  4GVM A;  4LF6 K;  5EX5 A;  3HP9 A;  4CF9 A;  4A2A A;  4DLG A;  4CJT A;  2D4W A;  4KHU A;  2W40 A;  4DTM A;  3VA0 A;  3V1O A;  4K43 A;  4OKE A;  3VEO A;  4KTW A;  4CER A;  1NGA A;  5FRO A;  1NOZ A;  1S5J A;  3B6O A;  3KLE A;  2KHO A;  3U3Y A;  3HM8 A;  5KPR A;  3AA2 A;  3NDK A;  1CLQ A;  2QKK A;  1WUA A;  2IGI A;  5AQK A;  3QIP A;  4KBO A;  4ICL A;  3CME N;  5CYQ A;  5JLF A;  3WT0 A;  2ZM6 K;  4LF7 K;  4NCA A;  3L2Q A;  2I7N A;  3DMJ A;  4OVL A;  1C6V A;  4CZF A;  1LAW A;  5AQQ A;  3H45 C;  3MAQ A;  3HT3 A;  4B1Z A;  5JVG L;  4JD2 B;  5C12 A;  1M90 O;  3Q7C A;  4BR7 A;  4JK9 A;  2VWJ A;  1T7P A;  3TTC A;  3CF5 L;  2Q0R A;  2KQ2 A;  4N41 A;  4IJA A;  3ZT1 A;  4DTX A;  3TAP A;  3NF7 A;  1BQM A;  4DV1 K;  4B9S A;  3ATU A;  3PV8 A;  1NLV A;  4I6M A;  4X65 K;  2QWP A;  3ASM A;  1HNZ K;  1MWK A;  1ZC6 A;  1WSG A;  1U49 A;  3VEW A;  4JI0 K;  4IZ9 A;  2DY4 A;  4FK4 A;  1Q18 A;  1P8Z A;  2EWS A;  4FWN A;  4NLC A;  3CIP A;  3GOI A;  4Z4I A;  1Q9X A;  1QQO A;  4FWP A;  4E7J A;  5HRO A;  2XRI A;  1JLQ A;  5JLH A;  4CJU A;  1RT3 A;  2HVI A;  2UYT A;  3LPT A;  3THX B;  5D3G A;  1NGB A;  4FLW A;  4M3X A;  5BR8 K;  4AIL C;  1Z05 A;  4M3R A;  1NGF A;  4BC4 A;  4RG8 A;  4DQR A;  4FJG A;  3TAF A;  4KI4 A;  2YV0 X;  4LFA K;  2O8D B;  2IAJ A;  4NO7 A;  2IVN A;  4DS5 A;  3L0Q A;  2CGJ A;  1BG3 A;  2QTD A;  3WXK A;  4GW6 A;  3QEX A;  1NJZ A;  1HUX A;  3SBG A;  1KSP A;  1VSH A;  4B3R K;  4CEF A;  4CGD A;  3ZSX A;  4CFB A;  1QS4 A;  4JNE A;  2P9N A;  3DLH A;  1NMN A;  4QS8 A;  3SYZ A;  1DTQ A;  3DLB A;  4FXD A;  3P1G A;  4JKC A;  4O8U A;  2HMI A;  4KO0 A;  3VET A;  5JS1 A;  4KAZ A;  2W6K A;  4M3Y A;  3VMF B;  4LH5 A;  1XNQ K;  4CJE A;  3ZSR A;  3QEV A;  4FZX C;  2QWR A;  1GLC G;  4AHR A;  1KQS M;  4I2Q A;  1BQN A;  5M1Q A;  3IUC A;  3V9X A;  1OVQ A;  1KLN A;  3MN9 A;  2HHX A;  3DRS A;  3J80 O;  4JK7 A;  1DLO A;  4B9Q A;  3QDK A;  2P9I A;  4CJR A;  4IEI A;  3ZYY X;  5AQT A;  3TWH A;  1X9J A;  1TK0 A;  2UUC K;  2VWB A;  4Z4F A;  1HPM A;  1N36 K;  3HVR A;  1JXE A;  2X78 A;  2F7T A;  5DM7 L;  1HQE A;  4KRF A;  4FSV A;  1VRU A;  2Q36 A;  5BN9 A;  2HBK A;  3BDP A;  5CHI A;  3SAH A;  1NGI A;  1NWK A;  3D2F A;  4CHZ A;  3E9O A;  1EET A;  1L3V A;  4CFC A;  4DWI A;  3VQ5 A;  2GUP A;  1NJW A;  4CZE A;  4HUF A;  3KK1 A;  3C0B A;  1IKY A;  3H3N O;  1GOA A;  4CIG A;  1EWQ A;  3RMA A;  1RDB A;  3MEE A;  3NCI A;  3H1V X;  4CGI A;  4A5A A;  5F1X A;  3CCR N;  1J53 A;  3VQD A;  3RMB A;  1T05 A;  3SZ2 A;  1WAF A;  1LCU A;  1NJX A;  3LDL A;  1RIL A;  4CZM A;  4K41 A;  4GKK K;  3ZLJ A;  3VQE A;  4DS4 A;  2RPI A;  5DM6 L;  5KPZ A;  4JI3 K;  1QHT A;  3SV3 A;  3AO3 A;  4YOX A;  3CQ8 A;  4BR9 A;  4LFB K;  5LJV A;  4KTZ A;  1GLE G;  4KH6 A;  3R1X A;  4DR1 K;  1GOB A;  3UKU A;  1VQ4 N;  4Z4H A;  2F4V K;  4O0J A;  1I3A A;  1B9F A;  5AQF A;  5AQH A;  3CFO A;  3OVN A;  4X66 K;  4YDU C;  4IWV A;  1BUP A;  2O8E B;  4DTN A;  2YKN A;  4KHY A;  5BRH A;  1ASU A;  1JKH A;  3VPZ A;  1KLM A;  1NK4 A;  3CC2 N;  4KI6 A;  2XY8 A;  3OS0 A;  3FZK A;  4KHP K;  1OKJ A;  4FWK A;  3QO9 A;  5KI6 A;  3P39 A;  3QEW A;  2GV9 A;  4BWM A;  2P9S B;  3HOT A;  4JD2 A;  2P9K A;  1W7A A;  4CES A;  1X9S A;  3ULE B;  3ZEU B;  5LMU K;  2YKM A;  1K73 O;  4KV8 A;  3TR8 A;  3LPU A;  5KQD A;  4NYF A;  4KRE A;  3W0L A;  2QA4 N;  2Q31 A;  4FW1 A;  5JS2 A;  3CFR A;  5K14 A;  3ZSW A;  5M1N A;  3O4N A;  4LD0 A;  4BQL A;  4B8A B;  2DFH A;  5AQZ A;  4JN4 A;  3P31 A;  1N33 K;  4E1N A;  3V1Q A;  4BY9 C;  3BF1 A;  3LL3 A;  4JRP A;  4HTU A;  4F3T A;  1QQM A;  1GLL O;  1KXP A;  1NGE A;  2A3Z A;  4FJK A;  1HRH A;  3HYF A;  5C2F A;  2VGM A;  3NE6 A;  4YY3 K;  3L2R A;  4AM7 A;  2YI1 A;  1XNR K;  2AP1 A;  2Q1N A;  2O4I A;  2RHK A;  3AVB A;  4IG3 A;  3WNG A;  4KHW A;  3AA5 X;  1VAZ A;  1U45 A;  3WXJ A;  3HJF A;  3EYZ A;  5I9E B;  1HQU A;  3CMA N;  4PY5 A;  4N56 A;  3TAQ A;  4J8F A;  3CCU N;  3V6D A;  2Y1I A;  4E1M A;  2PFU A;  3C6T A;  3KKS A;  1KAZ A;  3AVJ A;  3M3Z A;  4M3T A;  2P9P A;  1BL3 A;  3E9P A;  4E7K A;  2YHA A;  1GLA G;  5AQI A;  3D7E O;  4IG0 A;  3I8B A;  3N4Q A;  4CBX A;  2QM1 A;  3MCP A;  4E0D A;  1WOQ A;  4RW9 A;  3VQA A;  2NRR A;  4LF9 K;  3GDQ A;  1TKD A;  4DSK A;  4A61 A;  3J81 O;  1TL1 A;  3TAM A;  3VQ4 A;  3PSF A;  4PL7 A;  3SMS A;  3HZ6 A;  4CJS A;  3K58 A;  4QS7 A;  1MDU B;  3WUH A;  2QWN A;  2KKZ A;  4FPA A;  1OH8 A;  2G8V A;  4CW7 B;  3T1A A;  5HBM A;  3DI6 A;  1XHX A;  4I6M B;  4YHH K;  1S1V A;  3U4L A;  2A5X A;  4BAC A;  3DXK B;  2Z1J A;  4C8O A;  4B1U B;  2YNF A;  5TKY A;  5SZT A;  3JYT A;  3CCM N;  2OPS A;  3V81 A;  1J6Z A;  4CJK A;  3S3O A;  3DJC A;  3BEX A;  3SBT A;  4JKA A;  2BE2 A;  4MLE A;  1Y64 A;  4JI2 K;  4EP4 A;  3VOV A;  4C1N I;  1KFD A;  2Q0U A;  1FKO A;  4B9N A;  2XY6 A;  3ENH A;  4EHT A;  4Y1C A;  4CZI A;  4OLA A;  4UY8 O;  3NHG A;  3FZH A;  2FBY A;  4O5F A;  3SK3 A;  4FM1 A;  2QWO A;  1YF5 L;  4DSI A;  4KPY A;  4H5N A;  4YOW A;  1OH6 A;  2NRT A;  2VYP A;  3SLC A;  1EX4 A;  1S3X A;  1B9D A;  1UA0 A;  2H3G X;  2HOE A;  4KFB A;  5HRP A;  1RT5 A;  2P9N B;  4FVU A;  1SL0 A;  3EKS A;  1U04 A;  1BIU A;  3AVK A;  3ULD A;  3TAR A;  4GVE A;  5CY4 A;  1KVB A;  3BP8 A;  2NRW A;  1J9A A;  1BHL A;  4AHT A;  2YNH A;  3JSM A;  4CZJ A;  1ZBU A;  1C1B A;  1WSE A;  3EE8 A;  5TKW A;  3ISN C;  4DSE A;  1YI2 N;  3C6H A;  1SZ2 A;  3QIC A;  3TAG A;  3B6P A;  3CPW M;  3J8A A;  1L3U A;  3LDQ A;  3RR8 A;  4DKW A;  1XC9 A;  4DF8 A;  1VSK A;  2NRV A;  4JS5 A;  3UKR A;  4OGC A;  3RVC A;  3VA3 A;  3LZI A;  1Q86 O;  4FK0 A;  2P9I B;  4CBW A;  2WOM A;  5ELZ A;  4ID1 A;  5FPM A;  1ILY A;  3OYJ A;  3NFA A;  3FZL A;  2DFE A;  1D8Y A;  1GLB G;  3ZT3 A;  3C7N A;  3VN5 A;  4BR5 A;  4K25 A;  1TKX A;  3VES A;  5AQV A;  4A5B A;  2ETJ A;  1E3M A;  5HP1 A;  4IFE A;  3RRH A;  4CVN E;  1YTA A;  4FL9 A;  4M3U A;  2ZD1 A;  4CIE A;  1X1P A;  2ASM A;  2P9S A;  3BGR A;  1VQ5 N;  1N32 K;  3WXI A;  3HXM A;  1IO2 A;  2WUS A;  3SUP A;  3SPY A;  2IC3 A;  3D2F B;  2ASP A;  3TTF A;  5AQW A;  4K42 A;  3W3D A;  3ZEU A;  4PUO A;  2KFZ A;  4H4O A;  3DWL A;  1MA9 B;  4DR4 K;  1N34 K;  1O1W A;  3DOL A;  4DV6 K;  1LAV A;  4JHD A;  2O8B A;  4BE2 A;  1FJG K;  1L3S A;  3OYC A;  3M8R A;  4M3W A;  1C0G A;  3OTO K;  1C0U A;  3KLH A;  4JKG B;  2P5O A;  3VQ8 A;  1TKZ A;  3QBW A;  1VQ8 N;  1TAU A;  2NRZ A;  2OZM A;  5DK5 A;  5HRN A;  1REV A;  1JCF A;  2WON A;  1NKB A;  4CEO A;  1QE1 A;  4FLT A;  1BCO A;  3RMC A;  4FO0 A;  1S9G A;  3C6A A;  4X64 K;  4CGF A;  5KQ8 A;  5JIC A;  5LY3 A;  1SKS A;  4HCC A;  3LDO A;  3CER A;  3CC7 N;  4DV4 K;  1JCE A;  4R5P A;  1LW2 A;  2D0P A;  3O8M A;  5B8H A;  2XY7 A;  3J7A P;  2CH6 A;  4DV2 K;  2F9T A;  5EVZ A;  3O9R A;  3KKR A;  3UKU B;  2HF4 A;  2HHU A;  3F73 A;  2QXL A;  3AO1 A;  3L6Q A;  1ZBH A;  1Q9Y A;  3SUQ A;  5AQX A;  3K9J A;  4DR3 K;  4O5B A;  5M1K A;  1B92 A;  1JLE A;  5GIO A;  3K0S A;  4DUY K;  3AVM A;  2UUA K;  3WEE A;  3QNO A;  1YJ9 N;  4DQ8 A;  2FBT A;  2KW4 A;  4C8K A;  2FLO A;  2CGK A;  4DTP A;  4DLE A;  4B9L A;  4JKH A;  1BI4 A;  2P9L B;  5AQU A;  4BC2 A;  2Q97 A;  4IOC L;  2Y1J A;  1U2V B;  3HK2 A;  3AO5 A;  3AVC A;  1IJJ A;  2P9K B;  3VEX A;  3IAY A;  4BRE A;  1EO1 A;  4FW2 A;  3NAE A;  4FJH A;  1HJO A;  1Z25 A;  2IIR A;  4PHT X;  3QER A;  5HLF A;  5GIN A;  2YJE A;  1W0H A;  4CED A;  4BR0 A;  4CJ7 A;  4BRI A;  2V52 B;  3UE5 A;  2D0B A;  3DXK A;  4WF9 L;  3P5J A;  1X3M A;  2QEX N;  1HLU A;  1OH5 A;  4JI8 K; 
#chains in the Genus database with same CATH homology
 4B3T K;  3OTO K;  4LFA K;  4LF6 K;  4DR6 K;  2VQE K;  4X62 K;  4JI4 K;  4YY3 K;  4LF5 K;  5LL6 Z;  4GKK K;  1XNR K;  4B3S K;  4DV5 K;  3JAM O;  5AJ3 K;  4B3R K;  4NXM K;  4JI3 K;  2UU9 K;  4DV7 K;  1J5E K;  4X64 K;  4LF4 K;  4JV5 K;  4LFB K;  4DR2 K;  1HR0 K;  5A2Q O;  1I94 K;  4DR1 K;  4OX9 K;  4DV4 K;  4B3M K;  4JI7 K;  2ZM6 K;  4AQY K;  4LF7 K;  2F4V K;  1IBM K;  2UXB K;  1IBK K;  1XNQ K;  5FLX O;  3J7A P;  1HNW K;  4GKJ K;  3T1H K;  4DV2 K;  4JI1 K;  4X66 K;  4DV3 K;  4LF9 K;  2UXD K;  4NXN K;  4DR5 K;  4DR3 K;  3J81 O;  2UXC K;  3J80 O;  1HNX K;  2UUA K;  4DUY K;  4KHP K;  5IT9 O;  2VQF K;  4JI5 K;  3T1Y K;  4DV1 K;  4DUZ K;  2UUC K;  4CW7 B;  4X65 K;  1HNZ K;  5IWA K;  1N36 K;  1XMQ K;  5LMU K;  4JI0 K;  4YHH K;  3J7Y P;  1XMO K;  4CVN E;  4JI6 K;  4DV0 K;  2UUB K;  2E5L K;  1N32 K;  4LFC K;  1N33 K;  4DR7 K;  2HHH K;  4JI2 K;  4K0K K;  4LF8 K;  4DR4 K;  1N34 K;  1IBL K;  4DV6 K;  5BR8 K;  1FJG K;  4V19 S;  4JYA K;  5LMN K;  4JI8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...