3T1YK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3t1yK00
4DV5K 4AQYK 5LMNK 2HHHK 4DUYK 4DR6K 4LFBK 1XNQK 4NXNK 4DUZK 4K0KK 4GKJK 1N32K 4JI5K 2ZM6K 4DR1K 1HNXK 4LF4K 4B3SK 1IBMK 4JI8K 4JI6K 3J7YP 4LF6K 2UUAK 4KHPK 4CVNE 2UXBK 2VQEK 1IBKK 2UU9K 5LL6Z 4X65K 2F4VK 4DV1K 1FJGK 2UXDK 4LF9K 4JV5K 4B3TK 4DV7K 4X62K 1J5EK 5LMUK 4B3RK 3JAMO 1XMQK 4DR4K 4B3MK 1N36K 4GKKK 4DR2K 1I94K 4JYAK 4JI2K 5IT9O 2VQFK 2UXCK 4DV4K 4DV6K 5FLXO 1XMOK 1XNRK 1HR0K 3OTOK 4LF5K 3J80O 4X64K 4DV2K 4CW7B 5A2QO 3J81O 4LF7K 4JI0K 4DR7K 3J7AP 4LFAK 4JI3K 4DV0K 5BR8K 4DR3K 2E5LK 4JI4K 5AJ3K 1N34K 4LF8K 5IWAK 4YY3K 1N33K 4YHHK 4OX9K 4DV3K 1IBLK 2UUBK 4DR5K 4JI1K 4LFCK 4V19S 4X66K 3T1HK 4NXMK 4JI7K 2UUCK 1HNWK 3T1YK 1HNZK
chains in the Genus database with same CATH superfamily
3VQ6A 4FJ5A 1LWCA 1VSHA 5FPMA 1XNQK 2O8EB 3SQ0A 3HXMA 2DPNA 2VG7A 2NRHA 4O55A 3L6QA 3JS6A 3IDHA 4FM0A 1N5YA 3KZBA 3MMVA 4IEEA 2D5RA 4DMNA 4ELVA 1ATSA 3WQUA 4NB4A 3NH0A 4BDZA 4QS9A 4W5OA 3ZSZA 1I39A 2QWLA 4JHDA 3H6EA 4BC3A 3LDNA 1RT4A 1X3MA 1WSIA 1FKPA 2WFBA 1DT9A 3L2RA 3WXMB 1X9MA 2NRVA 2WC9A 2PYJA 3QESA 3WT0A 4J8FA 3SV4A 3QEPA 5ADXH 4DSEA 2OPSA 3D45A 2JGUA 4M3UA 4CZJA 3L8BA 3LDQA 4CHOA 3LZJA 4CF0A 2G8WA 3V9XA 1J54A 1U04A 3WNHA 5CYMA 4WFNL 3TAFA 4DTOA 2F8TA 3C95A 4WQ5C 1S9GA 3QIOA 3OY9A 3O9UA 4BRPA 4B1UB 3O4NA 4M3ZA 3MECA 2HVHA 4DHYA 4X64K 1E4GT 2V51B 4O5BA 4DQQA 3LP0A 3ID8A 5AQOA 4FLUA 1C0GA 2W40A 4JI0K 3CIPA 3OS0A 4BRNA 3D7EO 1NLVA 3ZSQA 4GW6A 3QETA 4B9TA 1K6YA 3OYGA 3BUZB 2HHUA 1ZBLA 3AO5A 3P5JA 1BOTO 4FJ8A 1TUYA 3U3YA 1BI4B 1TKZA 1IBLK 1Q9YA 2AJQA 3CQYA 3I55N 2OZSA 4Z94A 5SZTA 2QWPA 3CFPA 2BGGA 4DQSA 5C10A 1ATRA 4EP5A 1HNWK 4ILJA 2Q0UA 3RMDA 3BY5A 5FRMA 4IFEA 3ZX3A 3THXA 1WAJA 2YV0X 4IKFA 3K2PA 5C42A 4HVJA 1UWBA 4M3WA 3SMPA 4B1ZA 3T7ZA 3ZX0A 4JI5K 3W0LA 1WSGA 1WB9A 5DM7L 1TYQB 4I6MA 4KFBA 1NG9A 2FBXA 3SQ2A 3I56N 5I42A 3THYA 3S3MA 1JLAA 4OGEA 4IG0A 2HHQA 3C6UA 3QO9A 1CXQA 2QWOA 3O1BA 2V7ZA 4BE2A 3DLHA 3SAFA 3WNFA 1HQEA 4JV5K 5C0YA 4B9SA 5J2QA 2QI2A 1KCFA 1EX4A 3A5NC 2OZMA 4OPHA 3KIOA 3HBTA 4FSVA 4GY2B 2A42A 1C0FA 2E6LA 3KLIA 4M3RA 4BC2A 1XHXA 1KAXA 5IT9O 2HMIA 5BPLA 4IO8A 4FWQA 1A5VA 3VENA 5AQQA 4E7JA 2EWSA 3G25A 1BCMA 4JLHA 3UKUB 4LF5K 2QA4N 1U47A 1ASWA 4JKBA 1CLQA 1V4TA 2J4RA 4DFKA 4KH6A 2ZD1A 3CG7A 2QWQA 3VF4A 4FM1A 2O8BA 2RHKA 3CFRA 2VYPA 2E20A 2OPPA 2F96A 2DTUA 3RR8A 3AVJA 4Z4CA 4FJIA 3I8BA 1BG3A 3VGMA 5KTQA 4YOWA 3L2VA 5IWAK 2O8DA 5C2FA 2G8UA 4E1JA 4KTZA 1ZBUA 4PA1A 4KHYA 3OBYA 4YOUA 1T03A 3JYTA 4BRGA 3WNEA 3L4IA 4DTMA 3MCAB 1DEJA 3UIQA 4FPAA 3CD6N 1P90A 4TSXA 5AQKA 3WEEB 4BWJA 5HLFA 2ZWHA 1NU0A 2JLEA 4CESA 4M42A 2ASOA 1P8ZA 4PY5A 3RWUA 1T3VA 1Z25A 2P9LA 3VA3A 4CEZA 4BRDA 4CEBA 1HX1A 1RBTA 2IVNA 1EQYA 3PO5A 1ZXOA 1BI4A 3MAQA 5DK5A 4JI8K 1W9HA 3TTFA 1NM1A 3WXLA 2IC3A 4WE1A 1RT3A 3CCRN 3WXJA 2QXLA 3DXKA 3HL8A 5BPMA 4IOCL 4DWIA 3OYDA 4A2BA 3KVGA 4CZHA 1EKEA 2QWMA 5TKYA 2GELA 5H1SQ 1SUQA 4JHDB 3MCPA 1BWFO 4PQUA 5AR0A 2BE2A 4JD2A 2D0PA 3SMSA 4CBUA 3ZSVA 4FJLA 1A5XA 3SAHA 2HMPA 2Q1NA 1W0HA 1GLDG 2NRXA 3O08A 4RW8A 4CJ4A 5E26A 2VWJA 4HUGA 4C8KA 1W2BM 2FBTA 3TPQA 3PO4A 2XRIA 1NK8A 3NMUA 3EN9A 3DXKB 2W6KA 3PSIA 4FXDA 1S1UA 3L3UA 3NFAA 3QB0A 4Z4GA 1TGOA 1L5UA 3A8YA 4E19A 4CGDA 4DR7K 1VQPN 1U2VA 4B1WB 4BR2A 1RTIA 1VQ7N 2Y1IA 4OLAA 3VA0A 1JLEA 1KSPA 1NK4A 4JAXA 4YY3K 3KLEA 3CMAN 1NKCA 4XH1A 3EZWA 3DRPA 3U8XA 4WYBA 1VSFA 4FZYA 4BRKA 3FZMA 1KQSM 1XUPO 4GV3A 4BC5A 4NXMK 4CZEA 4JI7K 1IKXA 4I7FA 1IV0A 4BRHA 4CJEA 3S41A 4CJ5A 3B8AX 3VQDA 4FW2A 4OKEA 3VGKA 3I8DA 1BQNA 4WFBL 2O8FB 2HB5A 3G4SN 3LP3A 3VQBA 3TSUA 5KPZA 2RE2A 3AA4A 4O4GA 4DUZK 1Z26A 3K5LA 1TK8A 2YHAA 4YDUC 4CFAA 1Q81O 3VQEA 4KHWA 3UKRA 4JKDA 4FO0A 1O1WA 3A2FA 1M90O 3M6GA 3CCVN 4Q0BA 3THVA 4Z4EA 3OYMA 2BH1A 3M8QA 2A1RA 3OBWA 4LF6K 4DTJA 2QWRA 3VQPA 4ELUA 3F9KA 4JK7A 3ALYA 1L3TA 2VG5A 4FJMA 3VQ9A 4F3OA 4DF4A 2O4IA 1NJZA 4O8UA 4CJ7A 1JLBA 2ETJA 1ZBHA 3HJFA 1GOCA 2VGMA 5KPTA 1LOTB 2CGKA 4Y1CA 1B92A 2YKMA 4DQIA 3O6WA 1JCGA 1OH6A 1QVGM 4M41A 3NH1A 2YNHA 4CHYA 3GBTA 3TTCA 3LZIA 3B6PA 3TABA 1JLGA 1NJWA 3NHGA 1EWRA 3GDQA 5KQ8A 5FROA 1B9FA 4JYAK 5BN8A 2CGLA 1ZBSA 1X9WA 4N47A 4H0YB 2P9KA 4ZTFA 4H5VA 5DMRA 3CCUN 3TU5A 3N4PA 3VQ5A 2IDOA 4DU3A 3M1FA 2NLXA 4BRCA 2V52B 4CJUA 5M1PA 1YIJN 3TI0A 1KTQA 4E7IA 1FKOA 5EY4A 3C6HA 4A2AA 3R8EA 3SUPA 3MN7A 3QBXA 4FWPA 1HKCA 4BG8A 1SKRA 3MEEA 3AA3A 3SNNA 1Q86O 3M5RA 2HVIA 1UA1A 1NJIO 3KHYA 5AQTA 4N41A 1X3NA 4H0PA 4JS5A 4NLCA 1EXQA 3AARA 4CE9A 3L2QA 3T1HK 4FK4A 3QIPA 2HOEA 3SBGA 3G71N 1VQ9N 2A5XA 1S3XA 5CR4A 2HBKA 5AQYA 4BR9A 1HNZK 2OANA 3CFOA 3DLRA 3BGRA 4DG1A 3T3FA 4DU4A 1GOAA 2Q2RA 4KRFA 3HPGA 2D0OA 2HBLA 3LM9A 1VQNN 3BZCA 1N32K 3ENBA 3Q7CA 1SS6A 1QHAA 4YNQA 5BREA 3MWTA 4LF4K 4FPBA 3OA9A 3OW2M 4CFBA 3ZEUA 1D5AA 4KHPK 3UB5A 5AQHA 1T6DA 4F9OA 1U48A 3I0RA 4DB3A 3AAPA 5K14A 4CEEA 3V81A 2UU9K 4K25A 1NGHA 1NGJA 4BRQA 1NOYA 4DV1K 3I33A 4J2BA 2FF6A 2O4GA 4I2PA 2YX6A 1CZ9A 3HPHA 3AY9A 4FLTA 1SV5A 2HF3A 2IOCA 5DM6L 1HLUA 4GVEA 1GOBA 1SKWA 2ZGZA 2CH5A 3D2EA 5EU7A 2EX3A 2QEXN 4M3TA 3NF6A 1BDGA 2E2OA 4NCGA 3T19A 3MXJA 3THYB 1G15A 2YNFA 1W7AA 1XMOK 3HM9A 4M3XA 1QHTA 3JXUA 5B8HA 1HKBA 2NNWA 2ITGA 1SL1A 4B9UA 1U2VB 4CZLA 3RMAA 1YUWA 1LWEA 3TAQA 3H45C 1BA1A 1VHXA 4RW7A 5EX5A 3OYCA 1XQSC 3NVKA 1OKJA 1T6CA 3S3OA 3PX0A 2WUSA 4KH4A 2G8KA 3HTVA 3CF5L 5AFUA 4CGIA 1QZ6A 4MLEA 4OX9K 4DV3K 4BGAA 3BF1A 4BY9C 5AQMA 1QSYA 3T1AA 1Y97A 4FJ7A 1EO1A 4CD1A 2E2PA 3HRGA 1NK0A 1NKEA 3NE6A 4O8KA 1N8RO 3DRSA 1VQ5N 1J53A 4BROA 3TARA 2GUPA 5F0XA 1YAGA 1ASVA 2ASPA 4CERA 2FLOA 3O4WA 5BRDA 4FJHA 3ENOA 4BVOA 3SPYA 4H4OA 5AQXA 2P9LB 3FGUA 2Q97A 1KD1O 4CJLA 3E01A 5BR9A 4CHQA 2G8FA 3SI6A 1C1CA 3VEVA 1RT2A 3H1VX 3ATVA 3LAKA 4DTXA 1VQKN 1RT5A 2RPIA 1JLQA 4MO5A 2UXDK 2P9UB 4FWLA 1BO5O 1TL3A 3V9SA 3A5LC 2YNGA 1F21A 2KHOA 5EVZA 1C0MA 3CJ1A 2BANA 4ZHRA 3ZT0A 3V9UA 3DM2A 4I6MB 2P9PB 2Z1JA 5JVHL 1VSMA 4FM2A 4CJSA 2VQFK 2O8CA 3ZT1A 1Q9XA 1LV5A 3DXMB 1MDUB 1RDUA 4ID5A 5D3GA 2IGIA 3K5NA 1WLJA 1ILYA 4EFHA 1O13A 3PIOL 3K57A 4CIFA 1W97L 2E2QA 2NUBA 4CBWA 2XY6A 3DI6A 4KI6A 4R79A 1WBDA 1XHZA 3CXCM 2PFUA 4OGCA 3RSEA 4E89A 1JL1A 2P9IA 1S1XA 3SV3A 3FZKA 2F7TA 1T44A 4YOYA 2D0BA 4ELTA 2P9KB 5FRNA 2HNZA 3FZHA 3AO1A 4NO7A 3ZEUB 1T05A 1U6ZA 4CIGA 1UAXA 5C12A 5T7BA 3AVKA 4JKFA 3WXKA 4CD3A 1HNIA 3MWPA 3VEXA 1ATNA 4BRFA 2Y1JA 1FW6A 3SUOA 4CI6A 2NRWA 4W5TA 3SBTA 2ZJQL 4EZ6A 3J7ZO 3KKSA 1T8EA 2GBZA 4W5QA 1HPZA 3GOIA 4FYDA 1HNXK 4RWTA 1JCEA 5HRPA 4B3SK 2ZQBA 1ITGA 1QSSA 4KHQA 4HTLA 4JI6K 3CYMA 3P1GA 2D0CA 2PYLA 2Z1GA 2VQEK 5F1XA 3EZ5A 1C0TA 4CK2A 1KLNA 3FR0A 4PWDA 2X6NA 3ZT4A 1BGXT 1TK5A 2WONA 4AF1A 3NAEA 4KREA 4B3MK 2E4LA 4IWVA 3PV8A 4M45A 3ULEB 1GLAG 1TYQA 4WF9L 3K0SA 4GKKK 4CJRA 1I94K 3RR7A 1D4XA 2I7NA 3PX6A 3QLHA 1D8YA 1CZAN 4DV6K 2A6AA 3ZETA 2H3GX 1CXUA 2HNDA 1VSDA 2ZJPL 4IO9L 3KWIA 3EO3A 1NMNA 4O44A 4KAZA 3O3GA 2A1SA 1DGKN 4JI3K 1RFQA 1NK5A 4DSFA 3MEDA 3GG4A 2E5LK 1HJOA 4PL8A 4HWIA 3M3ZA 5AQVA 1HQUA 5KGXA 5AZJB 3CCEN 4AM7A 3AVFA 4YHHK 2YI1A 4CEQA 1VSIA 4CHZA 2HBJA 3LP2A 5KRTA 3CI5A 3ZETB 3D6RA 1S1TA 2V7YA 2P5OA 3THXB 2GV9A 3HYFA 4JKHA 1NGCA 2Z1HA 5ELZA 3TAMA 4R5PA 3FFKB 3C65A 4CJQA 1C6VA 2X6SA 4YOXA 4DTRA 2ZJRL 4C8LA 4DSLA 5C25A 4PL7A 4OLBA 4CZKA 3AVCA 3RMBA 2RN2A 3E9OA 4RG8A 4DTPA 3SYZA 4DR1K 4F8RA 1SKSA 1IBMK 1EETA 4EZ9A 3CCLN 3B6OA 1RCHA 2HBMA 3VEWA 2Q36A 3BDPA 4E1NA 2YJEA 4UY8O 1VQMN 1L3VA 2P1JA 3OJUA 1ZYQA 1DLOA 1FXXA 4J2AA 1QQNA 4I9LA 4C1NI 3AGRA 3QEXA 1KC8O 3VGLA 4DFMA 4F3TA 3CJ9A 1TVRA 5LMUK 4KTQA 3ZT3A 1NGDA 1MWMA 3HSTB 3P38A 2JWKA 4E7LA 4CF2A 3O9QA 4IFVA 4IDKA 4H0OA 4WQ4C 3TAGA 4C23A 5JLHA 2ZGYA 3AVHA 4JRPA 3DOLA 2X78A 3CERA 3DLEA 5CE3A 4CK3A 1K9MO 4FJNA 3DLKA 3C6AA 4H5WA 3QNNA 4CW7B 3O9TA 1VSJA 4J2DA 5AQGA 3VQAA 3AVNA 4PHTX 1C1BA 4B1YB 4DSJA 3F73A 4FWMA 5FPEA 5GAEP 3H3NO 2HHSA 4WFAL 2P5GA 3GL1A 4E7HA 3AA5X 1H1VA 2FSKA 2HNYA 5LJWA 3LP1A 2PZSA 2P9SA 1S1VA 3IKMA 3G10A 3RVCA 3K59A 4V19S 3OVNA 3HP9A 4MDAA 3CCJN 1SAZA 2YNIA 3OS2A 2LSNA 5HRRA 4RW9A 1RBSA 4N56A 1OVQA 3LDSA 5HP1A 4L3QA 1OH7A 4DTNA 1U4BA 1SQKA 4BR7A 4N5SA 4GKJK 5AQRA 2B6AA 3ENHA 1QQMA 2ZM6K 3IMXA 2O8EA 1BUPA 4FLYA 3ZSXA 4H5NA 1R59O 3MK6A 4CJFA 5HL7L 3TTDA 1HMVA 3VEZA 1NGGA 3ZX2A 3LDLA 3LWLA 3VQQA 4ILHA 4QCLA 4LD0A 3VERA 2G8IA 4IJAA 4Z4HA 2QXFA 5LL6Z 3DOKA 4X65K 1IKYA 1BQMA 1YITN 3HSCA 3W3DA 3DLLL 3V1RA 4DLEA 1LCUA 1LWFA 2QKKA 1JCFA 1LW0A 3OYHA 4KTWA 3E1YA 3K9JA 4F2SA 1J5EK 4FCYA 1TAQA 4MFBA 3EL2A 3UKRB 2W42A 2QM1A 2KW4A 4EIAA 2O8CB 1BCOA 4JI2K 3K9KA 5JVGL 2HHVA 1RDBA 5FLXO 1C1AA 3HPOA 3HM8A 2GX9A 4K42A 3J80O 3Q7BA 1JJ2M 1RNHA 2E88A 2HHTA 4CJ3A 5A2QO 4KB1A 1WAFA 1D9FA 1VSLA 2G8VA 3CCSN 1R0AA 2YHXA 1OVYA 1ASUA 4JK8A 2W6LA 4IEIA 4AILC 3MXIA 4LY7A 3V9ZA 5FPNA 2OTJN 3V1OA 1HRHA 4AHRA 4PUOA 2P9IB 2VCPA 4LFCK 3LALA 2Q0RA 4B9MA 3L4QA 4KV8A 4BR0A 1RDDA 1S5JA 2Z1IA 3VTIA 2QTDA 3VQ4A 1KVCA 1OH8A 4FL9A 2CH6A 3CPEA 1KLMA 5KGWA 5AQFA 3O1WA 4CECA 3KTQA 4I2QA 3D2FB 4WQ5A 3KK1A 3M8RA 4AH9A 3F5TA 1JLCA 3SJJA 3J7YP 3FE1A 5FDLA 2KZMA 4FJGA 1Q7YO 5HBMA 3CQXA 4YOVA 3VEYA 4DLGA 5E41A 2NRZA 3WEEA 2E8AA 4BQZA 5M1QA 1NKBA 4FLWA 1KXPA 4ICLA 1FJGK 4NLBA 3M8PA 1HKGA 3V4IA 4CZFA 1TK0A 3CM5A 3JAMO 2JWLA 3AGKA 1YJNN 3O9SA 1UOCA 4IOAL 4FWKA 4JKGB 1V4SA 4ZTJA 1YJ9N 4CGHA 4AHCA 2NZTA 2IVOA 3AV9A 2BDPA 5KI6A 1NMDA 3OTOK 4CHPA 4OVLA 3HZ6A 3ZLJA 3WXIA 4WQ4A 4BGBA 4KHSA 3SAGA 4W5RA 1RT6A 1VQ6N 3UE5A 4LF7K 4OKKA 2P51A 2W41A 3LWMA 1OH5A 3SQ1A 1RT1A 2R7YA 3NF9A 1RDWX 3OYEA 2DFFA 3ULDA 2OYQA 3OHRA 1RTJA 4CEAA 4JI4K 1BISA 3EE8A 4CJVA 1NGFA 3EEQA 4W5NA 3KK7A 1N33K 3PX4A 1NK6A 4NYFA 1WNSA 3MX5A 3LPUA 4H03B 3KD1E 3J8AA 4BRMA 2YKNA 3QNOA 3CJ7A 4A5BA 3U9ZA 4X66K 1TL1A 4PKHA 4KPYA 4GMJB 4AHVA 3T1YK 4MQ3A 1JLFA 2P9NB 3CC7N 3OJSA 4GV9A 1VQON 4H4MA 1YJWN 3DMJA 5AQUA 2HHHK 2HW3A 4DUYK 1HPMA 1XI1A 1X9SA 2ITMA 1NNEA 4L8RB 2GUIA 5AQLA 4ISGA 5GIPA 2WBNA 3EY1A 3K5MA 1QTMA 3PIPL 3LPTA 4F4KA 3VF6A 1X1PA 3OYLA 5ADXA 5AZIB 3U3GA 3AAQA 3I0SA 4JKEA 5MLCQ 3AVIA 3OYAA 3C7NB 4JEPA 1VK0A 3KKRA 1BIUA 4A59A 1RTDA 1XWLA 4FK0A 4J2EA 2KQ2A 2KZZA 3AVGA 3AVAA 4MDBA 4O0JA 4JNEA 5AQNA 4M7YA 1Y64A 3SJHA 4LC9B 3SCXA 1IKVA 3RSEB 3QEWA 1BL3A 2KLAA 4DR2K 5HOOA 1C0UA 5HRNA 4HCCA 1XC9A 3O9RA 3KD5E 4C8OA 1X9JA 3LL3A 1Q18A 3MEGA 4DS5A 1L3UA 2G8HA 3LDPA 4DSIA 2DY4A 2KFZA 3L3VA 3UKUA 4FZZA 2IVPA 4CJTA 1MU2A 3OYBA 4BDPA 4B8CA 5JS1A 3O8MA 3H3OB 3DRRA 3KJVA 1TUUA 4B3OA 1YTAA 1VQ4N 1QQOA 4CF1A 4CK1A 4BREA 1Z6RA 2F9WA 1ZBIA 2IAJA 2KKZA 2YHBA 1KAYA 2ZF5O 3F2KA 4AHSA 1JXBA 3EE9A 3NGZA 4H8KA 4CF9A 4DR5K 3KK2A 3S3NA 2OA8A 4JI1K 3BF3A 3MN6A 2HHXA 3SUNA 3V1QA 2KTQA 1HNVA 2Q31A 3MX2A 1SL0A 4KI4A 3CJBA 2IIRA 3K5OA 4B08A 1TKXA 3THWA 2RF2A 3CCMN 4AQYK 3E9LA 1NGBA 4CJKA 1NWKA 3RRHA 4H0TB 3D2FA 4BR4A 3NBPA 4JK9A 1BHLA 2YHYA 4RCHA 1S9EA 4CF8A 4YOTA 2FF3B 3LDOA 2QW9A 1LAWA 1QS4A 4BRIA 3CCQN 3S9HA 4DQRA 3DXMA 3ISNC 3ZCMA 3FFIA 2B5JA 5J2PA 4B9LA 3RTVA 4CZMA 2DFEA 3HK2A 3HVRA 4DU1A 2D1KA 3E66A 4IXCA 1VAZA 2NRTA 4G9ZA 3MN5A 1DTTA 4HUEA 4NYNA 5JS2A 4QAGA 3O3HA 3L2UA 3TSPA 4O0IA 4Y0WA 1IKWA 2UXCK 1CZBA 4JRQA 1XNRK 3VQCA 4OKJA 2X74A 3CMEN 3AO3A 4IG3A 1KFDA 2WTUA 5AQIA 4BRAA 4BRLA 4K8ZA 3TSQA 3A5MC 4JD2B 1RDAA 3KLFA 1KFSA 2FBVA 3WUHA 1E3MA 1QVFM 1VRTA 1UA0A 4OPAA 4FZXC 3R1XA 3DWLA 4IJNA 5AJ3K 2FC0A 1N34K 1S22A 1S6QA 4CCHA 4FJXA 3IS9A 3DJCA 4ISEA 4DF8A 4QS7A 4FJKA 2E1YA 5I9EB 4IZ9A 2FSNA 4FJJA 5EOYA 1NBWA 4H5RA 3QMLA 1KVBA 4K43A 3SQ4A 1WOQA 1T7PA 4DS4A 2UUCK 5M1OA 2A41A 3C6TA 3ZSWA 4UQGA 4AHUA 4DV5K 1XC3A 3U4LA 4M3YA 3EKUA 3A5OC 4LSNA 4DR6K 2XY7A 5F2RA 3M8SA 4MO4A 4KO0A 3LANA 1VQ8N 3AO2A 1M1KO 1RTHA 4C8MA 2E2NA 4U67L 3L2WA 5J1EA 4BACA 4FK2A 4FWRA 3EYZA 4EAHD 2XO7A 4CVNE 1J9AA 3C94A 3VETA 2F4VK 1GLBG 4ISFA 4OPKA 3CQ8A 4M7XA 3THWB 3O80A 2PAVA 1NJYA 3NF7A 4HCBA 5GAHP 4B3TK 5TKWA 3L0QA 3CM6A 3AVBA 3GE1A 2WOMA 1IJJA 2NRRA 1GLCG 5JLFA 1YTUA 4BQLA 5AQZA 4FW1A 3SK3A 5KPRA 4EP4A 3HOSA 3HVTA 3NCIA 4CHNA 4DFJA 4CGGA 5AZJA 2O8DB 1ZC6A 3QERA 4IDHA 2PY5A 4DV4K 1HYVA 3AA2A 4BDYA 1NOZA 4DKWA 3VESA 3TAPA 1EWQA 1RBRA 2BTFA 4H0XB 4PKIA 4CEOA 3CETA 3K58A 5BPNA 5SWMA 2P9NA 1QSLA 3D0PA 4NCBA 1ESVA 4LH5A 3FLCO 3VQ8A 3QEVA 3NGYA 3U9DA 4HTUA 1JL2A 2RKIA 2OPRA 1WN7A 3PLAA 1TKTA 4XIUA 1B9DA 1GLJO 4RW6A 4GNIA 4O5FA 1SZ2A 1HUXA 4A62A 4WCEL 4LH4A 1SL2A 3IFRA 2AA4A 5CYQA 3AVMA 5AQPA 4IBNA 3TANA 2D0AA 3N4QA 4FJ9A 2ASMA 3VTHA 2VWBA 5AQSA 1YVNA 1S1WA 4XEIA 4A5AA 3BP8A 4FVUA 2O8BB 4KHUA 4JKAA 5LMNK 2UYTA 1TAUA 3ZT2A 4K0KK 3VPZA 5KRSA 4AM6A 4B9NA 3R9PA 3T69A 3QFUA 1EP4A 1WBBA 3ULEA 4QS8A 3KLHA 3QEIA 4E1MA 1GLEG 4JKGA 5I3UA 3H08A 1HYSA 3G6EN 4YORA 4FWOA 2AP1A 4GV6A 1IG9A 2UXBK 2I5JA 4RTFD 1MWKA 3IRXA 4FLXA 4DFPA 2P9UA 4Z4IA 4CEFA 5C2DA 1RILA 3RRGA 5CHIA 3OYFA 4LF9K 5C24A 4Q5VA 1A5WA 4LSLA 3IUCA 4B9QA 5J2NA 1TKDA 4NCAA 4B3RK 1K73O 1RDCA 1GLFO 5JICA 3P4IA 4OO1J 4BE0A 3HO1A 3NDKA 1ZBFA 1K8AO 4EHUA 4KKOA 2Q3SA 3PUFA 2FSJA 4DSKA 3FZLA 5CZ1A 3WNGA 4B8AB 4DQPA 5GINA 4JKCA 5BRHA 1QE1A 4DV2K 3DAWA 1KAZA 4ID1A 5M1FA 1S6PA 4LFAK 2ATQA 3OYNA 2EHGA 2YJFA 2HF4A 5CY4A 3DYAA 1G99A 1JKHA 3P83D 3CC2N 4KBOA 3O4QA 2BUPA 4CZIA 1L3SA 1BA0A 3V9WA 1NGAA 4EHTA 2VG6A 2YCHA 4C1NK 5E84A 2UUBK 3HT3A 1K8KB 4IOXA 4B1VA 2P9SB 4CJWA 3QICA 5FPDA 4FOIA 1IH7A 3F9MA 3ID6A 3OYJA 2A40A 4Z0UA 1RT7A 3CPWM 3C0BA 1NK7A 2IS3A 3A0IX 1GLLO 1QQCA 3ZSRA 2XHBA 5GIOA 4LFBK 4CGJA 4NXNK 3BZKA 3VEOA 4BG9A 1U49A 1KVAA 5JMVA 1REVA 1TV6A 4E0DA 4N76A 5AQWA 4XH5A 1NGIA 3QBWA 4DQ8A 4Z4FA 3U6FA 4CBXA 4XH4A 3PY8A 2XY5A 2A3ZA 3VF2A 2GWJA 1Q8IA 1VQLN 2PBDA 3VOVA 1KRPA 2OPQA 5KQDA 3MXMA 4CJPA 3MDQA 3O5BA 4CFCA 4Y1DA 1LAVA 5BN9A 4DCHA 3IAYA 4DV7K 3SPZA 1DKGD 4GVMA 4BWMA 1XMQK 3WQTA 2P9PA 4BR5A 1I3AA 1YXQA 2GWKA 3R3LA 4A61A 1WUAA 3MN9A 1N6QA 3P39A 3LAMA 4PKGA 3QFPA 4CGFA 5M1KA 4AHTA 2HHWA 5AFUH 4B1XB 4E7KA 5GAGP 1VSEA 3BEXA 1IO2A 4C8NA 4BVPA 3J81O 1S72N 3SLCA 3J7AP 3ZYYX 1IG8A 4DV0K 3VMFB 3TR8A 2I7PA 5HROA 3ATUA 4DTSA 5BR8K 4CIEA 1LW2A 1VSKA 2YHWA 4H0VB 5BRFA 3OYKA 4I9QA 3P31A 3KK3A 1HYZA 4FLZA 1U45A 4G1QA 3QINA 2D4WA 4ILGB 4IFYA 3FZFA 2F8SA 1DTQA 3NH2A 3O3FA 3EKSA 3G0ZA 3R6MA 2GTDA 3DLGA 1MA9B 1K8KA 4CFDA 3OS1A 2GEMA 2OTLN 5GADP 3ZSYA 1WSHA 4H5TA 1YT3A 2HSTA 3KWGA 3AVLA 3OYIA 1JXEA 4JN4A 4CEDA 4MLHA 4FOEA 5C15A 4K8XA 4FWNA 4K41A 3H46O 3HP6A 4HHTA 1RBUA 4JS4A 5CZ2A 1NK9A 1YF5L 3SUQA 3AO4A 5EXWA 2DFHA 3TAEA 3QDKA 1E4FT 4FVMA 4OJRA 4KB0A 1BU6O 2UUAK 3IG1A 3C7NA 1HJRA 3V6DA 1NJXA 1J6ZA 3LM2A 1J5OA 1IBKK 3ASMA 2ZE2A 5AZIA 1WSEA 1NGEA 4DTUA 4U7BA 1WSJA 2QK9A 2O8FA 4KHNA 3HI0A 1RBVA 3E9PA 4RW4A 4BC4A 3CHWA 2XY8A 2FBYA 4X62K 3NVMA 2FXUA 4DR4K 2E6MA 5M1NA 4M63C 1N36K 3H1QA 3NF8A 3ZSOA 3CC4N 3TWHA 4BE1A 2B4JA 2QKBA 4FWSA 4CZGA 1RGIA 4YFUA 3JSMA 3SZ2A 3PSFA 2CGJA 4YDUA 1HR0K 3CJAA 4E3SA 1YVUA 3DLBA 2F9TA 3HOTA 3ITHA 5AQJA 1Q82O 1VRUA 1D9DA 1Z05A 3VN5A 2QWNA 5LJVA 4DR3K 3D2EB 5J2MA 4OPJA 4LF8K 2VGNA 4A57A 1QZ5A 4F2RA 2VWKA 1WSFA 2OCEA 3VQ7A 3KLGA 4B9VA 4QOZB 4KH5A 1BIZA 2KFNA 1FK9A 4HUFA 4FLVA 1YI2N 3NGIA 5HRSA 5LY3A 3RMCA 3CJCA 2E1ZA 1YHQN
chains in the Genus database with same CATH topology
4DV5K 4AQYK 5LMNK 2HHHK 4DUYK 4DR6K 4LFBK 1XNQK 4NXNK 4DUZK 4K0KK 4GKJK 1N32K 4JI5K 2ZM6K 4DR1K 1HNXK 4LF4K 4B3SK 1IBMK 4JI8K 4JI6K 3J7YP 4LF6K 2UUAK 4KHPK 4CVNE 2UXBK 2VQEK 1IBKK 2UU9K 5LL6Z 4X65K 2F4VK 4DV1K 1FJGK 2UXDK 4LF9K 4JV5K 4B3TK 4DV7K 4X62K 1J5EK 5LMUK 4B3RK 3JAMO 1XMQK 4DR4K 4B3MK 1N36K 4GKKK 4DR2K 1I94K 4JYAK 4JI2K 5IT9O 2VQFK 2UXCK 4DV4K 4DV6K 5FLXO 1XMOK 1XNRK 1HR0K 3OTOK 4LF5K 3J80O 4X64K 4DV2K 4CW7B 5A2QO 3J81O 4LF7K 4JI0K 4DR7K 3J7AP 4LFAK 4JI3K 4DV0K 5BR8K 4DR3K 2E5LK 4JI4K 5AJ3K 1N34K 4LF8K 5IWAK 4YY3K 1N33K 4YHHK 4OX9K 4DV3K 1IBLK 2UUBK 4DR5K 4JI1K 4LFCK 4V19S 4X66K 3T1HK 4NXMK 4JI7K 2UUCK 1HNWK 3T1YK 1HNZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 K;  4AQY K;  5LMN K;  2HHH K;  4DUY K;  4DR6 K;  4LFB K;  1XNQ K;  4NXN K;  4DUZ K;  4K0K K;  4GKJ K;  1N32 K;  4JI5 K;  2ZM6 K;  4DR1 K;  1HNX K;  4LF4 K;  4B3S K;  1IBM K;  4JI8 K;  4JI6 K;  3J7Y P;  4LF6 K;  2UUA K;  4KHP K;  4CVN E;  2UXB K;  2VQE K;  1IBK K;  2UU9 K;  5LL6 Z;  4X65 K;  2F4V K;  4DV1 K;  1FJG K;  2UXD K;  4LF9 K;  4JV5 K;  4B3T K;  4DV7 K;  4X62 K;  1J5E K;  5LMU K;  4B3R K;  3JAM O;  1XMQ K;  4DR4 K;  4B3M K;  1N36 K;  4GKK K;  4DR2 K;  1I94 K;  4JYA K;  4JI2 K;  5IT9 O;  2VQF K;  2UXC K;  4DV4 K;  4DV6 K;  5FLX O;  1XMO K;  1XNR K;  1HR0 K;  3OTO K;  4LF5 K;  3J80 O;  4X64 K;  4DV2 K;  4CW7 B;  5A2Q O;  3J81 O;  4LF7 K;  4JI0 K;  4DR7 K;  3J7A P;  4LFA K;  4JI3 K;  4DV0 K;  5BR8 K;  4DR3 K;  2E5L K;  4JI4 K;  5AJ3 K;  1N34 K;  4LF8 K;  5IWA K;  4YY3 K;  1N33 K;  4YHH K;  4OX9 K;  4DV3 K;  1IBL K;  2UUB K;  4DR5 K;  4JI1 K;  4LFC K;  4V19 S;  4X66 K;  3T1H K;  4NXM K;  4JI7 K;  2UUC K;  1HNW K;  3T1Y K;  1HNZ K; 
#chains in the Genus database with same CATH topology
 3VQ6 A;  4FJ5 A;  1LWC A;  1VSH A;  5FPM A;  1XNQ K;  2O8E B;  3SQ0 A;  3HXM A;  2DPN A;  2VG7 A;  2NRH A;  4O55 A;  3L6Q A;  3JS6 A;  3IDH A;  4FM0 A;  1N5Y A;  3KZB A;  3MMV A;  4IEE A;  2D5R A;  4DMN A;  4ELV A;  1ATS A;  3WQU A;  4NB4 A;  3NH0 A;  4BDZ A;  4QS9 A;  4W5O A;  3ZSZ A;  1I39 A;  2QWL A;  4JHD A;  3H6E A;  4BC3 A;  3LDN A;  1RT4 A;  1X3M A;  1WSI A;  1FKP A;  2WFB A;  1DT9 A;  3L2R A;  3WXM B;  1X9M A;  2NRV A;  2WC9 A;  2PYJ A;  3QES A;  3WT0 A;  4J8F A;  3SV4 A;  3QEP A;  5ADX H;  4DSE A;  2OPS A;  3D45 A;  2JGU A;  4M3U A;  4CZJ A;  3L8B A;  3LDQ A;  4CHO A;  3LZJ A;  4CF0 A;  2G8W A;  3V9X A;  1J54 A;  1U04 A;  3WNH A;  5CYM A;  4WFN L;  3TAF A;  4DTO A;  2F8T A;  3C95 A;  4WQ5 C;  1S9G A;  3QIO A;  3OY9 A;  3O9U A;  4BRP A;  4B1U B;  3O4N A;  4M3Z A;  3MEC A;  2HVH A;  4DHY A;  4X64 K;  1E4G T;  2V51 B;  4O5B A;  4DQQ A;  3LP0 A;  3ID8 A;  5AQO A;  4FLU A;  1C0G A;  2W40 A;  4JI0 K;  3CIP A;  3OS0 A;  4BRN A;  3D7E O;  1NLV A;  3ZSQ A;  4GW6 A;  3QET A;  4B9T A;  1K6Y A;  3OYG A;  3BUZ B;  2HHU A;  1ZBL A;  3AO5 A;  3P5J A;  1BOT O;  4FJ8 A;  1TUY A;  3U3Y A;  1BI4 B;  1TKZ A;  1IBL K;  1Q9Y A;  2AJQ A;  3CQY A;  3I55 N;  2OZS A;  4Z94 A;  5SZT A;  2QWP A;  3CFP A;  2BGG A;  4DQS A;  5C10 A;  1ATR A;  4EP5 A;  1HNW K;  4ILJ A;  2Q0U A;  3RMD A;  3BY5 A;  5FRM A;  4IFE A;  3ZX3 A;  3THX A;  1WAJ A;  2YV0 X;  4IKF A;  3K2P A;  5C42 A;  4HVJ A;  1UWB A;  4M3W A;  3SMP A;  4B1Z A;  3T7Z A;  3ZX0 A;  4JI5 K;  3W0L A;  1WSG A;  1WB9 A;  5DM7 L;  1TYQ B;  4I6M A;  4KFB A;  1NG9 A;  2FBX A;  3SQ2 A;  3I56 N;  5I42 A;  3THY A;  3S3M A;  1JLA A;  4OGE A;  4IG0 A;  2HHQ A;  3C6U A;  3QO9 A;  1CXQ A;  2QWO A;  3O1B A;  2V7Z A;  4BE2 A;  3DLH A;  3SAF A;  3WNF A;  1HQE A;  4JV5 K;  5C0Y A;  4B9S A;  5J2Q A;  2QI2 A;  1KCF A;  1EX4 A;  3A5N C;  2OZM A;  4OPH A;  3KIO A;  3HBT A;  4FSV A;  4GY2 B;  2A42 A;  1C0F A;  2E6L A;  3KLI A;  4M3R A;  4BC2 A;  1XHX A;  1KAX A;  5IT9 O;  2HMI A;  5BPL A;  4IO8 A;  4FWQ A;  1A5V A;  3VEN A;  5AQQ A;  4E7J A;  2EWS A;  3G25 A;  1BCM A;  4JLH A;  3UKU B;  4LF5 K;  2QA4 N;  1U47 A;  1ASW A;  4JKB A;  1CLQ A;  1V4T A;  2J4R A;  4DFK A;  4KH6 A;  2ZD1 A;  3CG7 A;  2QWQ A;  3VF4 A;  4FM1 A;  2O8B A;  2RHK A;  3CFR A;  2VYP A;  2E20 A;  2OPP A;  2F96 A;  2DTU A;  3RR8 A;  3AVJ A;  4Z4C A;  4FJI A;  3I8B A;  1BG3 A;  3VGM A;  5KTQ A;  4YOW A;  3L2V A;  5IWA K;  2O8D A;  5C2F A;  2G8U A;  4E1J A;  4KTZ A;  1ZBU A;  4PA1 A;  4KHY A;  3OBY A;  4YOU A;  1T03 A;  3JYT A;  4BRG A;  3WNE A;  3L4I A;  4DTM A;  3MCA B;  1DEJ A;  3UIQ A;  4FPA A;  3CD6 N;  1P90 A;  4TSX A;  5AQK A;  3WEE B;  4BWJ A;  5HLF A;  2ZWH A;  1NU0 A;  2JLE A;  4CES A;  4M42 A;  2ASO A;  1P8Z A;  4PY5 A;  3RWU A;  1T3V A;  1Z25 A;  2P9L A;  3VA3 A;  4CEZ A;  4BRD A;  4CEB A;  1HX1 A;  1RBT A;  2IVN A;  1EQY A;  3PO5 A;  1ZXO A;  1BI4 A;  3MAQ A;  5DK5 A;  4JI8 K;  1W9H A;  3TTF A;  1NM1 A;  3WXL A;  2IC3 A;  4WE1 A;  1RT3 A;  3CCR N;  3WXJ A;  2QXL A;  3DXK A;  3HL8 A;  5BPM A;  4IOC L;  4DWI A;  3OYD A;  4A2B A;  3KVG A;  4CZH A;  1EKE A;  2QWM A;  5TKY A;  2GEL A;  5H1S Q;  1SUQ A;  4JHD B;  3MCP A;  1BWF O;  4PQU A;  5AR0 A;  2BE2 A;  4JD2 A;  2D0P A;  3SMS A;  4CBU A;  3ZSV A;  4FJL A;  1A5X A;  3SAH A;  2HMP A;  2Q1N A;  1W0H A;  1GLD G;  2NRX A;  3O08 A;  4RW8 A;  4CJ4 A;  5E26 A;  2VWJ A;  4HUG A;  4C8K A;  1W2B M;  2FBT A;  3TPQ A;  3PO4 A;  2XRI A;  1NK8 A;  3NMU A;  3EN9 A;  3DXK B;  2W6K A;  3PSI A;  4FXD A;  1S1U A;  3L3U A;  3NFA A;  3QB0 A;  4Z4G A;  1TGO A;  1L5U A;  3A8Y A;  4E19 A;  4CGD A;  4DR7 K;  1VQP N;  1U2V A;  4B1W B;  4BR2 A;  1RTI A;  1VQ7 N;  2Y1I A;  4OLA A;  3VA0 A;  1JLE A;  1KSP A;  1NK4 A;  4JAX A;  4YY3 K;  3KLE A;  3CMA N;  1NKC A;  4XH1 A;  3EZW A;  3DRP A;  3U8X A;  4WYB A;  1VSF A;  4FZY A;  4BRK A;  3FZM A;  1KQS M;  1XUP O;  4GV3 A;  4BC5 A;  4NXM K;  4CZE A;  4JI7 K;  1IKX A;  4I7F A;  1IV0 A;  4BRH A;  4CJE A;  3S41 A;  4CJ5 A;  3B8A X;  3VQD A;  4FW2 A;  4OKE A;  3VGK A;  3I8D A;  1BQN A;  4WFB L;  2O8F B;  2HB5 A;  3G4S N;  3LP3 A;  3VQB A;  3TSU A;  5KPZ A;  2RE2 A;  3AA4 A;  4O4G A;  4DUZ K;  1Z26 A;  3K5L A;  1TK8 A;  2YHA A;  4YDU C;  4CFA A;  1Q81 O;  3VQE A;  4KHW A;  3UKR A;  4JKD A;  4FO0 A;  1O1W A;  3A2F A;  1M90 O;  3M6G A;  3CCV N;  4Q0B A;  3THV A;  4Z4E A;  3OYM A;  2BH1 A;  3M8Q A;  2A1R A;  3OBW A;  4LF6 K;  4DTJ A;  2QWR A;  3VQP A;  4ELU A;  3F9K A;  4JK7 A;  3ALY A;  1L3T A;  2VG5 A;  4FJM A;  3VQ9 A;  4F3O A;  4DF4 A;  2O4I A;  1NJZ A;  4O8U A;  4CJ7 A;  1JLB A;  2ETJ A;  1ZBH A;  3HJF A;  1GOC A;  2VGM A;  5KPT A;  1LOT B;  2CGK A;  4Y1C A;  1B92 A;  2YKM A;  4DQI A;  3O6W A;  1JCG A;  1OH6 A;  1QVG M;  4M41 A;  3NH1 A;  2YNH A;  4CHY A;  3GBT A;  3TTC A;  3LZI A;  3B6P A;  3TAB A;  1JLG A;  1NJW A;  3NHG A;  1EWR A;  3GDQ A;  5KQ8 A;  5FRO A;  1B9F A;  4JYA K;  5BN8 A;  2CGL A;  1ZBS A;  1X9W A;  4N47 A;  4H0Y B;  2P9K A;  4ZTF A;  4H5V A;  5DMR A;  3CCU N;  3TU5 A;  3N4P A;  3VQ5 A;  2IDO A;  4DU3 A;  3M1F A;  2NLX A;  4BRC A;  2V52 B;  4CJU A;  5M1P A;  1YIJ N;  3TI0 A;  1KTQ A;  4E7I A;  1FKO A;  5EY4 A;  3C6H A;  4A2A A;  3R8E A;  3SUP A;  3MN7 A;  3QBX A;  4FWP A;  1HKC A;  4BG8 A;  1SKR A;  3MEE A;  3AA3 A;  3SNN A;  1Q86 O;  3M5R A;  2HVI A;  1UA1 A;  1NJI O;  3KHY A;  5AQT A;  4N41 A;  1X3N A;  4H0P A;  4JS5 A;  4NLC A;  1EXQ A;  3AAR A;  4CE9 A;  3L2Q A;  3T1H K;  4FK4 A;  3QIP A;  2HOE A;  3SBG A;  3G71 N;  1VQ9 N;  2A5X A;  1S3X A;  5CR4 A;  2HBK A;  5AQY A;  4BR9 A;  1HNZ K;  2OAN A;  3CFO A;  3DLR A;  3BGR A;  4DG1 A;  3T3F A;  4DU4 A;  1GOA A;  2Q2R A;  4KRF A;  3HPG A;  2D0O A;  2HBL A;  3LM9 A;  1VQN N;  3BZC A;  1N32 K;  3ENB A;  3Q7C A;  1SS6 A;  1QHA A;  4YNQ A;  5BRE A;  3MWT A;  4LF4 K;  4FPB A;  3OA9 A;  3OW2 M;  4CFB A;  3ZEU A;  1D5A A;  4KHP K;  3UB5 A;  5AQH A;  1T6D A;  4F9O A;  1U48 A;  3I0R A;  4DB3 A;  3AAP A;  5K14 A;  4CEE A;  3V81 A;  2UU9 K;  4K25 A;  1NGH A;  1NGJ A;  4BRQ A;  1NOY A;  4DV1 K;  3I33 A;  4J2B A;  2FF6 A;  2O4G A;  4I2P A;  2YX6 A;  1CZ9 A;  3HPH A;  3AY9 A;  4FLT A;  1SV5 A;  2HF3 A;  2IOC A;  5DM6 L;  1HLU A;  4GVE A;  1GOB A;  1SKW A;  2ZGZ A;  2CH5 A;  3D2E A;  5EU7 A;  2EX3 A;  2QEX N;  4M3T A;  3NF6 A;  1BDG A;  2E2O A;  4NCG A;  3T19 A;  3MXJ A;  3THY B;  1G15 A;  2YNF A;  1W7A A;  1XMO K;  3HM9 A;  4M3X A;  1QHT A;  3JXU A;  5B8H A;  1HKB A;  2NNW A;  2ITG A;  1SL1 A;  4B9U A;  1U2V B;  4CZL A;  3RMA A;  1YUW A;  1LWE A;  3TAQ A;  3H45 C;  1BA1 A;  1VHX A;  4RW7 A;  5EX5 A;  3OYC A;  1XQS C;  3NVK A;  1OKJ A;  1T6C A;  3S3O A;  3PX0 A;  2WUS A;  4KH4 A;  2G8K A;  3HTV A;  3CF5 L;  5AFU A;  4CGI A;  1QZ6 A;  4MLE A;  4OX9 K;  4DV3 K;  4BGA A;  3BF1 A;  4BY9 C;  5AQM A;  1QSY A;  3T1A A;  1Y97 A;  4FJ7 A;  1EO1 A;  4CD1 A;  2E2P A;  3HRG A;  1NK0 A;  1NKE A;  3NE6 A;  4O8K A;  1N8R O;  3DRS A;  1VQ5 N;  1J53 A;  4BRO A;  3TAR A;  2GUP A;  5F0X A;  1YAG A;  1ASV A;  2ASP A;  4CER A;  2FLO A;  3O4W A;  5BRD A;  4FJH A;  3ENO A;  4BVO A;  3SPY A;  4H4O A;  5AQX A;  2P9L B;  3FGU A;  2Q97 A;  1KD1 O;  4CJL A;  3E01 A;  5BR9 A;  4CHQ A;  2G8F A;  3SI6 A;  1C1C A;  3VEV A;  1RT2 A;  3H1V X;  3ATV A;  3LAK A;  4DTX A;  1VQK N;  1RT5 A;  2RPI A;  1JLQ A;  4MO5 A;  2UXD K;  2P9U B;  4FWL A;  1BO5 O;  1TL3 A;  3V9S A;  3A5L C;  2YNG A;  1F21 A;  2KHO A;  5EVZ A;  1C0M A;  3CJ1 A;  2BAN A;  4ZHR A;  3ZT0 A;  3V9U A;  3DM2 A;  4I6M B;  2P9P B;  2Z1J A;  5JVH L;  1VSM A;  4FM2 A;  4CJS A;  2VQF K;  2O8C A;  3ZT1 A;  1Q9X A;  1LV5 A;  3DXM B;  1MDU B;  1RDU A;  4ID5 A;  5D3G A;  2IGI A;  3K5N A;  1WLJ A;  1ILY A;  4EFH A;  1O13 A;  3PIO L;  3K57 A;  4CIF A;  1W97 L;  2E2Q A;  2NUB A;  4CBW A;  2XY6 A;  3DI6 A;  4KI6 A;  4R79 A;  1WBD A;  1XHZ A;  3CXC M;  2PFU A;  4OGC A;  3RSE A;  4E89 A;  1JL1 A;  2P9I A;  1S1X A;  3SV3 A;  3FZK A;  2F7T A;  1T44 A;  4YOY A;  2D0B A;  4ELT A;  2P9K B;  5FRN A;  2HNZ A;  3FZH A;  3AO1 A;  4NO7 A;  3ZEU B;  1T05 A;  1U6Z A;  4CIG A;  1UAX A;  5C12 A;  5T7B A;  3AVK A;  4JKF A;  3WXK A;  4CD3 A;  1HNI A;  3MWP A;  3VEX A;  1ATN A;  4BRF A;  2Y1J A;  1FW6 A;  3SUO A;  4CI6 A;  2NRW A;  4W5T A;  3SBT A;  2ZJQ L;  4EZ6 A;  3J7Z O;  3KKS A;  1T8E A;  2GBZ A;  4W5Q A;  1HPZ A;  3GOI A;  4FYD A;  1HNX K;  4RWT A;  1JCE A;  5HRP A;  4B3S K;  2ZQB A;  1ITG A;  1QSS A;  4KHQ A;  4HTL A;  4JI6 K;  3CYM A;  3P1G A;  2D0C A;  2PYL A;  2Z1G A;  2VQE K;  5F1X A;  3EZ5 A;  1C0T A;  4CK2 A;  1KLN A;  3FR0 A;  4PWD A;  2X6N A;  3ZT4 A;  1BGX T;  1TK5 A;  2WON A;  4AF1 A;  3NAE A;  4KRE A;  4B3M K;  2E4L A;  4IWV A;  3PV8 A;  4M45 A;  3ULE B;  1GLA G;  1TYQ A;  4WF9 L;  3K0S A;  4GKK K;  4CJR A;  1I94 K;  3RR7 A;  1D4X A;  2I7N A;  3PX6 A;  3QLH A;  1D8Y A;  1CZA N;  4DV6 K;  2A6A A;  3ZET A;  2H3G X;  1CXU A;  2HND A;  1VSD A;  2ZJP L;  4IO9 L;  3KWI A;  3EO3 A;  1NMN A;  4O44 A;  4KAZ A;  3O3G A;  2A1S A;  1DGK N;  4JI3 K;  1RFQ A;  1NK5 A;  4DSF A;  3MED A;  3GG4 A;  2E5L K;  1HJO A;  4PL8 A;  4HWI A;  3M3Z A;  5AQV A;  1HQU A;  5KGX A;  5AZJ B;  3CCE N;  4AM7 A;  3AVF A;  4YHH K;  2YI1 A;  4CEQ A;  1VSI A;  4CHZ A;  2HBJ A;  3LP2 A;  5KRT A;  3CI5 A;  3ZET B;  3D6R A;  1S1T A;  2V7Y A;  2P5O A;  3THX B;  2GV9 A;  3HYF A;  4JKH A;  1NGC A;  2Z1H A;  5ELZ A;  3TAM A;  4R5P A;  3FFK B;  3C65 A;  4CJQ A;  1C6V A;  2X6S A;  4YOX A;  4DTR A;  2ZJR L;  4C8L A;  4DSL A;  5C25 A;  4PL7 A;  4OLB A;  4CZK A;  3AVC A;  3RMB A;  2RN2 A;  3E9O A;  4RG8 A;  4DTP A;  3SYZ A;  4DR1 K;  4F8R A;  1SKS A;  1IBM K;  1EET A;  4EZ9 A;  3CCL N;  3B6O A;  1RCH A;  2HBM A;  3VEW A;  2Q36 A;  3BDP A;  4E1N A;  2YJE A;  4UY8 O;  1VQM N;  1L3V A;  2P1J A;  3OJU A;  1ZYQ A;  1DLO A;  1FXX A;  4J2A A;  1QQN A;  4I9L A;  4C1N I;  3AGR A;  3QEX A;  1KC8 O;  3VGL A;  4DFM A;  4F3T A;  3CJ9 A;  1TVR A;  5LMU K;  4KTQ A;  3ZT3 A;  1NGD A;  1MWM A;  3HST B;  3P38 A;  2JWK A;  4E7L A;  4CF2 A;  3O9Q A;  4IFV A;  4IDK A;  4H0O A;  4WQ4 C;  3TAG A;  4C23 A;  5JLH A;  2ZGY A;  3AVH A;  4JRP A;  3DOL A;  2X78 A;  3CER A;  3DLE A;  5CE3 A;  4CK3 A;  1K9M O;  4FJN A;  3DLK A;  3C6A A;  4H5W A;  3QNN A;  4CW7 B;  3O9T A;  1VSJ A;  4J2D A;  5AQG A;  3VQA A;  3AVN A;  4PHT X;  1C1B A;  4B1Y B;  4DSJ A;  3F73 A;  4FWM A;  5FPE A;  5GAE P;  3H3N O;  2HHS A;  4WFA L;  2P5G A;  3GL1 A;  4E7H A;  3AA5 X;  1H1V A;  2FSK A;  2HNY A;  5LJW A;  3LP1 A;  2PZS A;  2P9S A;  1S1V A;  3IKM A;  3G10 A;  3RVC A;  3K59 A;  4V19 S;  3OVN A;  3HP9 A;  4MDA A;  3CCJ N;  1SAZ A;  2YNI A;  3OS2 A;  2LSN A;  5HRR A;  4RW9 A;  1RBS A;  4N56 A;  1OVQ A;  3LDS A;  5HP1 A;  4L3Q A;  1OH7 A;  4DTN A;  1U4B A;  1SQK A;  4BR7 A;  4N5S A;  4GKJ K;  5AQR A;  2B6A A;  3ENH A;  1QQM A;  2ZM6 K;  3IMX A;  2O8E A;  1BUP A;  4FLY A;  3ZSX A;  4H5N A;  1R59 O;  3MK6 A;  4CJF A;  5HL7 L;  3TTD A;  1HMV A;  3VEZ A;  1NGG A;  3ZX2 A;  3LDL A;  3LWL A;  3VQQ A;  4ILH A;  4QCL A;  4LD0 A;  3VER A;  2G8I A;  4IJA A;  4Z4H A;  2QXF A;  5LL6 Z;  3DOK A;  4X65 K;  1IKY A;  1BQM A;  1YIT N;  3HSC A;  3W3D A;  3DLL L;  3V1R A;  4DLE A;  1LCU A;  1LWF A;  2QKK A;  1JCF A;  1LW0 A;  3OYH A;  4KTW A;  3E1Y A;  3K9J A;  4F2S A;  1J5E K;  4FCY A;  1TAQ A;  4MFB A;  3EL2 A;  3UKR B;  2W42 A;  2QM1 A;  2KW4 A;  4EIA A;  2O8C B;  1BCO A;  4JI2 K;  3K9K A;  5JVG L;  2HHV A;  1RDB A;  5FLX O;  1C1A A;  3HPO A;  3HM8 A;  2GX9 A;  4K42 A;  3J80 O;  3Q7B A;  1JJ2 M;  1RNH A;  2E88 A;  2HHT A;  4CJ3 A;  5A2Q O;  4KB1 A;  1WAF A;  1D9F A;  1VSL A;  2G8V A;  3CCS N;  1R0A A;  2YHX A;  1OVY A;  1ASU A;  4JK8 A;  2W6L A;  4IEI A;  4AIL C;  3MXI A;  4LY7 A;  3V9Z A;  5FPN A;  2OTJ N;  3V1O A;  1HRH A;  4AHR A;  4PUO A;  2P9I B;  2VCP A;  4LFC K;  3LAL A;  2Q0R A;  4B9M A;  3L4Q A;  4KV8 A;  4BR0 A;  1RDD A;  1S5J A;  2Z1I A;  3VTI A;  2QTD A;  3VQ4 A;  1KVC A;  1OH8 A;  4FL9 A;  2CH6 A;  3CPE A;  1KLM A;  5KGW A;  5AQF A;  3O1W A;  4CEC A;  3KTQ A;  4I2Q A;  3D2F B;  4WQ5 A;  3KK1 A;  3M8R A;  4AH9 A;  3F5T A;  1JLC A;  3SJJ A;  3J7Y P;  3FE1 A;  5FDL A;  2KZM A;  4FJG A;  1Q7Y O;  5HBM A;  3CQX A;  4YOV A;  3VEY A;  4DLG A;  5E41 A;  2NRZ A;  3WEE A;  2E8A A;  4BQZ A;  5M1Q A;  1NKB A;  4FLW A;  1KXP A;  4ICL A;  1FJG K;  4NLB A;  3M8P A;  1HKG A;  3V4I A;  4CZF A;  1TK0 A;  3CM5 A;  3JAM O;  2JWL A;  3AGK A;  1YJN N;  3O9S A;  1UOC A;  4IOA L;  4FWK A;  4JKG B;  1V4S A;  4ZTJ A;  1YJ9 N;  4CGH A;  4AHC A;  2NZT A;  2IVO A;  3AV9 A;  2BDP A;  5KI6 A;  1NMD A;  3OTO K;  4CHP A;  4OVL A;  3HZ6 A;  3ZLJ A;  3WXI A;  4WQ4 A;  4BGB A;  4KHS A;  3SAG A;  4W5R A;  1RT6 A;  1VQ6 N;  3UE5 A;  4LF7 K;  4OKK A;  2P51 A;  2W41 A;  3LWM A;  1OH5 A;  3SQ1 A;  1RT1 A;  2R7Y A;  3NF9 A;  1RDW X;  3OYE A;  2DFF A;  3ULD A;  2OYQ A;  3OHR A;  1RTJ A;  4CEA A;  4JI4 K;  1BIS A;  3EE8 A;  4CJV A;  1NGF A;  3EEQ A;  4W5N A;  3KK7 A;  1N33 K;  3PX4 A;  1NK6 A;  4NYF A;  1WNS A;  3MX5 A;  3LPU A;  4H03 B;  3KD1 E;  3J8A A;  4BRM A;  2YKN A;  3QNO A;  3CJ7 A;  4A5B A;  3U9Z A;  4X66 K;  1TL1 A;  4PKH A;  4KPY A;  4GMJ B;  4AHV A;  3T1Y K;  4MQ3 A;  1JLF A;  2P9N B;  3CC7 N;  3OJS A;  4GV9 A;  1VQO N;  4H4M A;  1YJW N;  3DMJ A;  5AQU A;  2HHH K;  2HW3 A;  4DUY K;  1HPM A;  1XI1 A;  1X9S A;  2ITM A;  1NNE A;  4L8R B;  2GUI A;  5AQL A;  4ISG A;  5GIP A;  2WBN A;  3EY1 A;  3K5M A;  1QTM A;  3PIP L;  3LPT A;  4F4K A;  3VF6 A;  1X1P A;  3OYL A;  5ADX A;  5AZI B;  3U3G A;  3AAQ A;  3I0S A;  4JKE A;  5MLC Q;  3AVI A;  3OYA A;  3C7N B;  4JEP A;  1VK0 A;  3KKR A;  1BIU A;  4A59 A;  1RTD A;  1XWL A;  4FK0 A;  4J2E A;  2KQ2 A;  2KZZ A;  3AVG A;  3AVA A;  4MDB A;  4O0J A;  4JNE A;  5AQN A;  4M7Y A;  1Y64 A;  3SJH A;  4LC9 B;  3SCX A;  1IKV A;  3RSE B;  3QEW A;  1BL3 A;  2KLA A;  4DR2 K;  5HOO A;  1C0U A;  5HRN A;  4HCC A;  1XC9 A;  3O9R A;  3KD5 E;  4C8O A;  1X9J A;  3LL3 A;  1Q18 A;  3MEG A;  4DS5 A;  1L3U A;  2G8H A;  3LDP A;  4DSI A;  2DY4 A;  2KFZ A;  3L3V A;  3UKU A;  4FZZ A;  2IVP A;  4CJT A;  1MU2 A;  3OYB A;  4BDP A;  4B8C A;  5JS1 A;  3O8M A;  3H3O B;  3DRR A;  3KJV A;  1TUU A;  4B3O A;  1YTA A;  1VQ4 N;  1QQO A;  4CF1 A;  4CK1 A;  4BRE A;  1Z6R A;  2F9W A;  1ZBI A;  2IAJ A;  2KKZ A;  2YHB A;  1KAY A;  2ZF5 O;  3F2K A;  4AHS A;  1JXB A;  3EE9 A;  3NGZ A;  4H8K A;  4CF9 A;  4DR5 K;  3KK2 A;  3S3N A;  2OA8 A;  4JI1 K;  3BF3 A;  3MN6 A;  2HHX A;  3SUN A;  3V1Q A;  2KTQ A;  1HNV A;  2Q31 A;  3MX2 A;  1SL0 A;  4KI4 A;  3CJB A;  2IIR A;  3K5O A;  4B08 A;  1TKX A;  3THW A;  2RF2 A;  3CCM N;  4AQY K;  3E9L A;  1NGB A;  4CJK A;  1NWK A;  3RRH A;  4H0T B;  3D2F A;  4BR4 A;  3NBP A;  4JK9 A;  1BHL A;  2YHY A;  4RCH A;  1S9E A;  4CF8 A;  4YOT A;  2FF3 B;  3LDO A;  2QW9 A;  1LAW A;  1QS4 A;  4BRI A;  3CCQ N;  3S9H A;  4DQR A;  3DXM A;  3ISN C;  3ZCM A;  3FFI A;  2B5J A;  5J2P A;  4B9L A;  3RTV A;  4CZM A;  2DFE A;  3HK2 A;  3HVR A;  4DU1 A;  2D1K A;  3E66 A;  4IXC A;  1VAZ A;  2NRT A;  4G9Z A;  3MN5 A;  1DTT A;  4HUE A;  4NYN A;  5JS2 A;  4QAG A;  3O3H A;  3L2U A;  3TSP A;  4O0I A;  4Y0W A;  1IKW A;  2UXC K;  1CZB A;  4JRQ A;  1XNR K;  3VQC A;  4OKJ A;  2X74 A;  3CME N;  3AO3 A;  4IG3 A;  1KFD A;  2WTU A;  5AQI A;  4BRA A;  4BRL A;  4K8Z A;  3TSQ A;  3A5M C;  4JD2 B;  1RDA A;  3KLF A;  1KFS A;  2FBV A;  3WUH A;  1E3M A;  1QVF M;  1VRT A;  1UA0 A;  4OPA A;  4FZX C;  3R1X A;  3DWL A;  4IJN A;  5AJ3 K;  2FC0 A;  1N34 K;  1S22 A;  1S6Q A;  4CCH A;  4FJX A;  3IS9 A;  3DJC A;  4ISE A;  4DF8 A;  4QS7 A;  4FJK A;  2E1Y A;  5I9E B;  4IZ9 A;  2FSN A;  4FJJ A;  5EOY A;  1NBW A;  4H5R A;  3QML A;  1KVB A;  4K43 A;  3SQ4 A;  1WOQ A;  1T7P A;  4DS4 A;  2UUC K;  5M1O A;  2A41 A;  3C6T A;  3ZSW A;  4UQG A;  4AHU A;  4DV5 K;  1XC3 A;  3U4L A;  4M3Y A;  3EKU A;  3A5O C;  4LSN A;  4DR6 K;  2XY7 A;  5F2R A;  3M8S A;  4MO4 A;  4KO0 A;  3LAN A;  1VQ8 N;  3AO2 A;  1M1K O;  1RTH A;  4C8M A;  2E2N A;  4U67 L;  3L2W A;  5J1E A;  4BAC A;  4FK2 A;  4FWR A;  3EYZ A;  4EAH D;  2XO7 A;  4CVN E;  1J9A A;  3C94 A;  3VET A;  2F4V K;  1GLB G;  4ISF A;  4OPK A;  3CQ8 A;  4M7X A;  3THW B;  3O80 A;  2PAV A;  1NJY A;  3NF7 A;  4HCB A;  5GAH P;  4B3T K;  5TKW A;  3L0Q A;  3CM6 A;  3AVB A;  3GE1 A;  2WOM A;  1IJJ A;  2NRR A;  1GLC G;  5JLF A;  1YTU A;  4BQL A;  5AQZ A;  4FW1 A;  3SK3 A;  5KPR A;  4EP4 A;  3HOS A;  3HVT A;  3NCI A;  4CHN A;  4DFJ A;  4CGG A;  5AZJ A;  2O8D B;  1ZC6 A;  3QER A;  4IDH A;  2PY5 A;  4DV4 K;  1HYV A;  3AA2 A;  4BDY A;  1NOZ A;  4DKW A;  3VES A;  3TAP A;  1EWQ A;  1RBR A;  2BTF A;  4H0X B;  4PKI A;  4CEO A;  3CET A;  3K58 A;  5BPN A;  5SWM A;  2P9N A;  1QSL A;  3D0P A;  4NCB A;  1ESV A;  4LH5 A;  3FLC O;  3VQ8 A;  3QEV A;  3NGY A;  3U9D A;  4HTU A;  1JL2 A;  2RKI A;  2OPR A;  1WN7 A;  3PLA A;  1TKT A;  4XIU A;  1B9D A;  1GLJ O;  4RW6 A;  4GNI A;  4O5F A;  1SZ2 A;  1HUX A;  4A62 A;  4WCE L;  4LH4 A;  1SL2 A;  3IFR A;  2AA4 A;  5CYQ A;  3AVM A;  5AQP A;  4IBN A;  3TAN A;  2D0A A;  3N4Q A;  4FJ9 A;  2ASM A;  3VTH A;  2VWB A;  5AQS A;  1YVN A;  1S1W A;  4XEI A;  4A5A A;  3BP8 A;  4FVU A;  2O8B B;  4KHU A;  4JKA A;  5LMN K;  2UYT A;  1TAU A;  3ZT2 A;  4K0K K;  3VPZ A;  5KRS A;  4AM6 A;  4B9N A;  3R9P A;  3T69 A;  3QFU A;  1EP4 A;  1WBB A;  3ULE A;  4QS8 A;  3KLH A;  3QEI A;  4E1M A;  1GLE G;  4JKG A;  5I3U A;  3H08 A;  1HYS A;  3G6E N;  4YOR A;  4FWO A;  2AP1 A;  4GV6 A;  1IG9 A;  2UXB K;  2I5J A;  4RTF D;  1MWK A;  3IRX A;  4FLX A;  4DFP A;  2P9U A;  4Z4I A;  4CEF A;  5C2D A;  1RIL A;  3RRG A;  5CHI A;  3OYF A;  4LF9 K;  5C24 A;  4Q5V A;  1A5W A;  4LSL A;  3IUC A;  4B9Q A;  5J2N A;  1TKD A;  4NCA A;  4B3R K;  1K73 O;  1RDC A;  1GLF O;  5JIC A;  3P4I A;  4OO1 J;  4BE0 A;  3HO1 A;  3NDK A;  1ZBF A;  1K8A O;  4EHU A;  4KKO A;  2Q3S A;  3PUF A;  2FSJ A;  4DSK A;  3FZL A;  5CZ1 A;  3WNG A;  4B8A B;  4DQP A;  5GIN A;  4JKC A;  5BRH A;  1QE1 A;  4DV2 K;  3DAW A;  1KAZ A;  4ID1 A;  5M1F A;  1S6P A;  4LFA K;  2ATQ A;  3OYN A;  2EHG A;  2YJF A;  2HF4 A;  5CY4 A;  3DYA A;  1G99 A;  1JKH A;  3P83 D;  3CC2 N;  4KBO A;  3O4Q A;  2BUP A;  4CZI A;  1L3S A;  1BA0 A;  3V9W A;  1NGA A;  4EHT A;  2VG6 A;  2YCH A;  4C1N K;  5E84 A;  2UUB K;  3HT3 A;  1K8K B;  4IOX A;  4B1V A;  2P9S B;  4CJW A;  3QIC A;  5FPD A;  4FOI A;  1IH7 A;  3F9M A;  3ID6 A;  3OYJ A;  2A40 A;  4Z0U A;  1RT7 A;  3CPW M;  3C0B A;  1NK7 A;  2IS3 A;  3A0I X;  1GLL O;  1QQC A;  3ZSR A;  2XHB A;  5GIO A;  4LFB K;  4CGJ A;  4NXN K;  3BZK A;  3VEO A;  4BG9 A;  1U49 A;  1KVA A;  5JMV A;  1REV A;  1TV6 A;  4E0D A;  4N76 A;  5AQW A;  4XH5 A;  1NGI A;  3QBW A;  4DQ8 A;  4Z4F A;  3U6F A;  4CBX A;  4XH4 A;  3PY8 A;  2XY5 A;  2A3Z A;  3VF2 A;  2GWJ A;  1Q8I A;  1VQL N;  2PBD A;  3VOV A;  1KRP A;  2OPQ A;  5KQD A;  3MXM A;  4CJP A;  3MDQ A;  3O5B A;  4CFC A;  4Y1D A;  1LAV A;  5BN9 A;  4DCH A;  3IAY A;  4DV7 K;  3SPZ A;  1DKG D;  4GVM A;  4BWM A;  1XMQ K;  3WQT A;  2P9P A;  4BR5 A;  1I3A A;  1YXQ A;  2GWK A;  3R3L A;  4A61 A;  1WUA A;  3MN9 A;  1N6Q A;  3P39 A;  3LAM A;  4PKG A;  3QFP A;  4CGF A;  5M1K A;  4AHT A;  2HHW A;  5AFU H;  4B1X B;  4E7K A;  5GAG P;  1VSE A;  3BEX A;  1IO2 A;  4C8N A;  4BVP A;  3J81 O;  1S72 N;  3SLC A;  3J7A P;  3ZYY X;  1IG8 A;  4DV0 K;  3VMF B;  3TR8 A;  2I7P A;  5HRO A;  3ATU A;  4DTS A;  5BR8 K;  4CIE A;  1LW2 A;  1VSK A;  2YHW A;  4H0V B;  5BRF A;  3OYK A;  4I9Q A;  3P31 A;  3KK3 A;  1HYZ A;  4FLZ A;  1U45 A;  4G1Q A;  3QIN A;  2D4W A;  4ILG B;  4IFY A;  3FZF A;  2F8S A;  1DTQ A;  3NH2 A;  3O3F A;  3EKS A;  3G0Z A;  3R6M A;  2GTD A;  3DLG A;  1MA9 B;  1K8K A;  4CFD A;  3OS1 A;  2GEM A;  2OTL N;  5GAD P;  3ZSY A;  1WSH A;  4H5T A;  1YT3 A;  2HST A;  3KWG A;  3AVL A;  3OYI A;  1JXE A;  4JN4 A;  4CED A;  4MLH A;  4FOE A;  5C15 A;  4K8X A;  4FWN A;  4K41 A;  3H46 O;  3HP6 A;  4HHT A;  1RBU A;  4JS4 A;  5CZ2 A;  1NK9 A;  1YF5 L;  3SUQ A;  3AO4 A;  5EXW A;  2DFH A;  3TAE A;  3QDK A;  1E4F T;  4FVM A;  4OJR A;  4KB0 A;  1BU6 O;  2UUA K;  3IG1 A;  3C7N A;  1HJR A;  3V6D A;  1NJX A;  1J6Z A;  3LM2 A;  1J5O A;  1IBK K;  3ASM A;  2ZE2 A;  5AZI A;  1WSE A;  1NGE A;  4DTU A;  4U7B A;  1WSJ A;  2QK9 A;  2O8F A;  4KHN A;  3HI0 A;  1RBV A;  3E9P A;  4RW4 A;  4BC4 A;  3CHW A;  2XY8 A;  2FBY A;  4X62 K;  3NVM A;  2FXU A;  4DR4 K;  2E6M A;  5M1N A;  4M63 C;  1N36 K;  3H1Q A;  3NF8 A;  3ZSO A;  3CC4 N;  3TWH A;  4BE1 A;  2B4J A;  2QKB A;  4FWS A;  4CZG A;  1RGI A;  4YFU A;  3JSM A;  3SZ2 A;  3PSF A;  2CGJ A;  4YDU A;  1HR0 K;  3CJA A;  4E3S A;  1YVU A;  3DLB A;  2F9T A;  3HOT A;  3ITH A;  5AQJ A;  1Q82 O;  1VRU A;  1D9D A;  1Z05 A;  3VN5 A;  2QWN A;  5LJV A;  4DR3 K;  3D2E B;  5J2M A;  4OPJ A;  4LF8 K;  2VGN A;  4A57 A;  1QZ5 A;  4F2R A;  2VWK A;  1WSF A;  2OCE A;  3VQ7 A;  3KLG A;  4B9V A;  4QOZ B;  4KH5 A;  1BIZ A;  2KFN A;  1FK9 A;  4HUF A;  4FLV A;  1YI2 N;  3NGI A;  5HRS A;  5LY3 A;  3RMC A;  3CJC A;  2E1Z A;  1YHQ N; 
#chains in the Genus database with same CATH homology
 4DV5 K;  4AQY K;  5LMN K;  2HHH K;  4DUY K;  4DR6 K;  4LFB K;  1XNQ K;  4NXN K;  4DUZ K;  4K0K K;  4GKJ K;  1N32 K;  4JI5 K;  2ZM6 K;  4DR1 K;  1HNX K;  4LF4 K;  4B3S K;  1IBM K;  4JI8 K;  4JI6 K;  3J7Y P;  4LF6 K;  2UUA K;  4KHP K;  4CVN E;  2UXB K;  2VQE K;  1IBK K;  2UU9 K;  5LL6 Z;  4X65 K;  2F4V K;  4DV1 K;  1FJG K;  2UXD K;  4LF9 K;  4JV5 K;  4B3T K;  4DV7 K;  4X62 K;  1J5E K;  5LMU K;  4B3R K;  3JAM O;  1XMQ K;  4DR4 K;  4B3M K;  1N36 K;  4GKK K;  4DR2 K;  1I94 K;  4JYA K;  4JI2 K;  5IT9 O;  2VQF K;  2UXC K;  4DV4 K;  4DV6 K;  5FLX O;  1XMO K;  1XNR K;  1HR0 K;  3OTO K;  4LF5 K;  3J80 O;  4X64 K;  4DV2 K;  4CW7 B;  5A2Q O;  3J81 O;  4LF7 K;  4JI0 K;  4DR7 K;  3J7A P;  4LFA K;  4JI3 K;  4DV0 K;  5BR8 K;  4DR3 K;  2E5L K;  4JI4 K;  5AJ3 K;  1N34 K;  4LF8 K;  5IWA K;  4YY3 K;  1N33 K;  4YHH K;  4OX9 K;  4DV3 K;  1IBL K;  2UUB K;  4DR5 K;  4JI1 K;  4LFC K;  4V19 S;  4X66 K;  3T1H K;  4NXM K;  4JI7 K;  2UUC K;  1HNW K;  3T1Y K;  1HNZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...