3T1YK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3t1yK00
4DV5K 4NXMK 4JI1K 4DR6K 4DUYK 4X66K 3T1YK 1N32K 4CVNE 3J81O 1IBLK 4LFCK 4KHPK 4DR2K 5LMNK 3J7YP 4DV0K 4DR5K 4JI2K 1XNQK 4DR7K 3OTOK 4LF6K 4GKJK 3JAMO 5AJ3K 4DUZK 4GKKK 4V19S 5IT9O 5FLXO 3J80O 1XNRK 4B3TK 1I94K 2UXDK 1HNWK 4X62K 2F4VK 4LFBK 4X64K 1HR0K 4K0KK 1FJGK 5A2QO 3T1HK 4JI5K 4DR4K 4LF8K 4DV7K 4DV3K 2UXCK 4AQYK 4OX9K 4JI6K 1HNZK 2UXBK 4DV4K 4DV6K 4JV5K 4JI4K 4DV1K 4JI8K 1XMOK 5LMUK 4DR1K 4LF7K 5LL6Z 1N36K 4YHHK 1N34K 1N33K 4CW7B 5BR8K 4X65K 1HNXK 2UUCK 4JI3K 4JI0K 4B3RK 2E5LK 4LF4K 2HHHK 4YY3K 2UUBK 2ZM6K 2VQEK 4DV2K 2UUAK 2UU9K 4JI7K 4NXNK 4B3SK 4LF5K 4LFAK 4DR3K 2VQFK 4LF9K 1IBMK 1XMQK 4B3MK 3J7AP 5IWAK 1IBKK 1J5EK 4JYAK
chains in the Genus database with same CATH superfamily
2PAVA 4AM7A 1U04A 3CCSN 5E84A 3D45A 5HRRA 2HMPA 3TTFA 3OJUA 3QNOA 1RBSA 3BEXA 2E88A 4CHQA 1NWKA 5BN9A 1HQEA 3LM2A 1IBLK 4LFCK 3NH1A 3OS2A 1KC8O 3DLLL 5AQFA 4LD0A 1Z25A 3TSUA 4G9ZA 4BRFA 1NU0A 3T19A 3P4IA 4C1NK 3I8DA 3C7NA 5CYMA 3SUPA 4O8UA 4B1XB 4QS9A 4RTFD 4Q5VA 3VQ9A 3H08A 2ZGZA 4NLBA 5C15A 5FLXO 1CZ9A 4CESA 3HI0A 5E26A 2P9LB 3MCAB 3FFKB 3CCMN 5GADP 3O80A 3P1GA 1QSSA 2BUPA 4DF4A 3O4WA 4CECA 2O8BB 2CGLA 4I9LA 4DKWA 3WXJA 2OCEA 1C0TA 4E0DA 2F9TA 3VESA 4Z4HA 3BUZB 3HT3A 1VSIA 1IO2A 2YI1A 3CC7N 4MO5A 3F2KA 1C0FA 3DXMA 4IJNA 4IDHA 3VN5A 1EKEA 1NK8A 5CZ1A 3MWPA 4I6MB 4H5WA 2P9UB 3KK1A 3M8RA 1JKHA 1WSHA 4DQRA 4Z4FA 3AA4A 3MXJA 4DF8A 2KHOA 4W5QA 3OYLA 5C42A 3OYKA 1GOBA 3JYTA 4HUFA 1KRPA 4YOUA 4JHDB 4JI3K 3HOSA 2KZZA 4CFAA 2P9SA 4ZTFA 1Q8IA 4JD2B 4CJEA 2E6MA 2PYJA 1KAYA 1IG9A 2RHKA 3VTIA 3ULEA 2E8AA 2FLOA 1XI1A 1IBMK 3U9DA 3VF2A 1NK0A 2D0BA 4FSVA 4PKGA 3V9WA 4C1NI 3PUFA 1YJ9N 3PIPL 5KTQA 1NMDA 3C7NB 4AHUA 5BN8A 3IFRA 4F2SA 2B5JA 2CGKA 4KHYA 1TKZA 2P9NA 3V9ZA 2O8FB 4KH6A 3HL8A 4A61A 3AO5A 4B1UB 1VRTA 3KK2A 5C12A 3M8QA 2A6AA 3LWLA 3THXB 3EE9A 5KPTA 3VQDA 1J5OA 1WAFA 4CGJA 1FW6A 2JWLA 3M1FA 3OVNA 4O0IA 3HO1A 3HM8A 3CQXA 1Y97A 3M3ZA 1JJ2M 4E19A 3E9OA 4NYNA 2VWKA 3DXMB 3VQEA 1S1UA 2UYTA 1V4SA 1ZXOA 2NNWA 3DLEA 4YOWA 4FM1A 2D0OA 3CPEA 1KVBA 3L3VA 5GAGP 1JCGA 1YJNN 4M63C 3D2FA 3MN9A 4JKGB 2QWRA 1QSYA 3BF1A 1LWEA 2W6KA 3CFPA 4E7LA 1RBVA 4CJVA 4CJRA 4CHOA 3MECA 4CJTA 3E66A 4FYDA 3F73A 1JXEA 3FZKA 3UE5A 1C1CA 2OANA 5DMRA 4C8NA 3K5LA 4C8LA 2F9WA 2DTUA 3DMJA 2FSNA 4CJ3A 4DFMA 1L3TA 1MU2A 4CF0A 3UKUB 3IUCA 3AVIA 4BWJA 3CETA 3ZSRA 1RDDA 3EZWA 2E5LK 2O4GA 3NFAA 4L8RB 1VSEA 1NGEA 4CZGA 1NGBA 1SKRA 3QBXA 4XIUA 1TYQA 2D0CA 3DXKA 4BR5A 2UU9K 3LP2A 5BR9A 5SZTA 1NK6A 3AA5X 2OPPA 3RMCA 2D0AA 3LPUA 3DLGA 3DAWA 4CBXA 3BZKA 4A5BA 4IG0A 3O4QA 3PSIA 3WNGA 1NJYA 3AVGA 3THWA 3VMFB 4KB1A 3AY9A 2OZSA 3VEOA 4FW2A 3JS6A 2E6LA 5AQSA 4N56A 4PL8A 4AM6A 2VCPA 3RMBA 4FLTA 4M3XA 4CEBA 1ASUA 4QOZB 3E9PA 1XHXA 4BDPA 1LW0A 3OYNA 4BVOA 3G25A 1YJWN 3B6OA 4K8ZA 3AO2A 3MX5A 4JKDA 4FJJA 4IWVA 1ESVA 4JKFA 3S3NA 4WQ5C 2ZJQL 3K5OA 3QB0A 3H1QA 2UXDK 1BGXT 5EX5A 1VQNN 4B9TA 3AO1A 1VQ4N 4F4KA 2QWMA 4DTRA 4ZTJA 1OH6A 2KLAA 2Z1HA 3TTCA 4W5NA 1I3AA 1VQ8N 3ZEUA 2YNGA 3BGRA 1YVUA 3OY9A 2EHGA 2V7ZA 5M1FA 4BRAA 4IOXA 4DFPA 2XY6A 3O9UA 4CF9A 3LWMA 1TYQB 3DXKB 3I56N 4Y0WA 3SI6A 4CJLA 3DOKA 2FF6A 1JLCA 1S22A 1RTJA 3BZCA 1NK4A 2X6SA 2PFUA 3CF5L 1KAXA 4FXDA 3HSCA 3VA3A 1X9MA 4E7IA 3CCLN 3CQYA 2XY8A 2YX6A 2V52B 3TSQA 1JL1A 4YOXA 3V1QA 3HK2A 1CXQA 1TKXA 3NDKA 3R6MA 2W6LA 3TAGA 5M1KA 4BR2A 5F2RA 2WOMA 2EX3A 4B3SK 2VG6A 1U48A 5DK5A 1HNIA 1NJIO 4LF5K 1RILA 1ATSA 3O08A 4EZ9A 3L4IA 1C1BA 4IFEA 1RFQA 3B6PA 3CMAN 4IG3A 1FKPA 5JVHL 1Q9XA 3L2UA 4FJLA 1UWBA 4FWQA 3VGKA 1WSFA 3VETA 4YORA 2D1KA 2P9KA 4M7YA 3KD5E 1D9FA 4CEDA 2I7PA 4CK3A 4IO9L 1WB9A 3VOVA 4OPHA 3ZX2A 4Q0BA 1OVYA 5LJWA 3V4IA 3DJCA 4H0YB 4E7JA 5FRNA 1RDBA 3K58A 3LL3A 5HRPA 3O9RA 4DTNA 1GLCG 5I9EB 1E3MA 4G1QA 2FF3B 4W5RA 4V19S 3KLGA 5KPZA 3RR8A 3CCQN 5E41A 2OA8A 2QWOA 5AFUA 1NJXA 2DPNA 1HR0K 3EL2A 1T03A 1YXQA 1HLUA 3BF3A 4CZFA 1RCHA 4H0VB 3D0PA 4CHPA 4WQ4C 3QFUA 1SS6A 3RMDA 2P51A 2ASMA 5AQTA 4K8XA 1W0HA 2ZE2A 4AHSA 3ZSYA 1DTTA 1HQUA 2PYLA 4U7BA 1P8ZA 5C25A 3FZLA 4KHWA 3VEXA 2IOCA 3G6EN 1IH7A 2OPRA 5JLFA 4JK8A 3KIOA 3LZJA 3H46O 2HVIA 4I2PA 3GE1A 1EQYA 4BE2A 1SQKA 3CMEN 2FBVA 1J9AA 1NG9A 4F3OA 1Q81O 4FZYA 2ETJA 4CW7B 1SL1A 5HLFA 2NRZA 1R59O 5BPLA 2BDPA 2QI2A 5KQ8A 1O13A 2Y1IA 4EZ6A 3LDSA 2YNFA 4H0XB 1JCEA 4BRGA 2P9KB 4I2QA 1SKSA 1XWLA 4B3MK 1SL2A 4F2RA 1VQ6N 1VQ7N 5AQKA 1LAWA 1NMNA 1WSJA 5I42A 4IKFA 3CJ9A 3DOLA 4NXMK 5CYQA 3OYBA 3RMAA 1JLFA 3NBPA 2CH6A 4B8CA 3WNEA 1J53A 2YJEA 4CJ5A 3OW2M 2A1RA 3H1VX 2VGNA 5CY4A 3P39A 3U4LA 4FJ8A 1C1AA 1OKJA 1WUAA 1TK5A 3Q7BA 1GOCA 3O4NA 1GLFO 3OYIA 1WSIA 4N47A 4CERA 2QWLA 3A5MC 3O8MA 1U2VA 3SQ4A 4DUZK 2P5GA 4FPBA 2IS3A 2QWPA 4CGFA 4JAXA 4CZHA 4JEPA 1B9DA 3ULDA 4PUOA 3G4SN 1BI4B 3T69A 1UA1A 2ASOA 5C2FA 4CK1A 4N5SA 3SQ2A 3QERA 5M1OA 1BG3A 1A5XA 1RBRA 3SBTA 4BR0A 3LANA 4B9QA 4DR4K 3L2WA 1E4FT 2Q0UA 1BUPA 3LDQA 1BQNA 1XUPO 3MN5A 4IFYA 3RSEB 4FJHA 1EP4A 1SUQA 4GVEA 2G8VA 2BGGA 2UXBK 2E1ZA 4BRQA 4CEQA 2HHUA 3EKSA 1XMOK 3NH0A 3TTDA 1HNVA 3DLRA 3AGKA 3I8BA 2A3ZA 3M5RA 3A2FA 3QNNA 1EWRA 1TAUA 3QMLA 3I55N 4C8OA 1S9GA 1EXQA 4FO0A 3SK3A 4B9SA 1EWQA 4BGAA 2HHTA 1BWFO 3O3FA 4DS5A 1G99A 5JS2A 4FL9A 2O8BA 4JLHA 5AZIB 2QTDA 4E1JA 2Q31A 1K8AO 4FLWA 3DLBA 1IBKK 4GNIA 4I7FA 1U2VB 3LALA 1TUUA 3HBTA 1A5WA 1BCMA 4DCHA 2W42A 3MAQA 4E89A 4ID1A 4BQZA 4IOCL 4J2DA 4BRDA 1RBTA 4I6MA 3CD6N 1GLAG 2P9UA 4FJNA 4M3RA 5GINA 3O5BA 2OZMA 1GLBG 2NLXA 1W9HA 4CBWA 4H03B 4ISEA 3HSTB 1XNQK 3OTOK 1LAVA 4KH5A 4H0PA 2YHBA 4A2BA 2HBJA 3OBYA 1OVQA 4JHDA 3FLCO 4KHQA 3IDHA 4CJPA 4FWPA 3FGUA 3D2EA 4EHUA 5J2MA 1SKWA 4YDUC 4JD2A 4DU1A 3K59A 1X3MA 1HNWK 4QCLA 1HJRA 3U3YA 1MA9B 3VGLA 3V81A 4KTZA 3AA2A 3AVJA 4B1YB 2NRRA 2KZMA 3RTVA 2O8DA 4E7KA 1X9WA 3TANA 3CYMA 1IV0A 2IAJA 3SJHA 3GL1A 3VQ7A 3R3LA 4RCHA 4RG8A 3HZ6A 3W0LA 2O8FA 1JLBA 3DLKA 1O1WA 4O5BA 4PWDA 1BCOA 4CF2A 4CZMA 4FK4A 2QXFA 3THXA 1SAZA 1OH5A 1YUWA 3FZMA 1OH7A 4H5NA 4YHHK 3V9SA 5FPMA 2O4IA 4YDUA 1HNXK 4GV9A 2YNIA 4DU4A 2HF3A 3L0QA 2E2PA 3KWGA 4UQGA 1VQ9N 2QM1A 4O5FA 4BRLA 4FWMA 4JI7K 3AARA 5AQLA 2GTDA 4JKGA 3NVKA 1V4TA 4QS7A 2NRTA 4BRPA 1M90O 2F7TA 3A0IX 1HJOA 5AQUA 2OTLN 4E1NA 3K57A 4F9OA 4B9LA 2JLEA 3EN9A 4JI1K 3VGMA 2NZTA 1P90A 3D2EB 4FJIA 5AQYA 4DG1A 3NVMA 3T1AA 1FKOA 3QICA 3R9PA 5FDLA 3IAYA 5AFUH 4KHPK 2IGIA 3ZT0A 3TARA 4OKKA 3UKUA 1TKDA 3V1OA 4OPAA 3LZIA 2O8DB 4DS4A 2QWNA 3SQ1A 4H5RA 2WTUA 1BA1A 1X9SA 4DTOA 4I9QA 4IXCA 4CJWA 4B9UA 3V6DA 2GWJA 4FJ9A 1Q18A 3ASMA 2GUPA 3ZX3A 3TAFA 3ENOA 2HW3A 4BR9A 5T7BA 4WFNL 5M1QA 5AQPA 1REVA 3VEVA 1XC3A 1BU6O 3CXCM 3KTQA 3A5OC 5CZ2A 4CZEA 1RTIA 2X78A 1DKGD 1RDWX 3V9XA 4ILGB 4BC4A 3GG4A 1YTUA 4CZJA 3HPHA 1HKGA 2KTQA 1RDAA 3FZFA 4FJKA 4BREA 1VK0A 1IKVA 5GAHP 1MWMA 1IKXA 3C65A 4FWRA 4DQPA 4BRCA 1L5UA 4CEFA 1QQOA 3BP8A 2DY4A 2ZGYA 2HB5A 3VQ6A 3NCIA 3VTHA 1XQSC 3C6HA 3VQ8A 1JL2A 5BRHA 3A8YA 4RW8A 5BPMA 3ATUA 1KVAA 3I0SA 4DSFA 3RWUA 3M8SA 3THYA 1ASVA 3O1WA 3THVA 1NLVA 5MLCQ 3K2PA 3CJ1A 4CEAA 4H8KA 2HNZA 4BACA 3J7AP 3N4PA 4NYFA 3CCUN 2DFFA 1KFDA 3CQ8A 1VQPN 1U6ZA 4BROA 3O9TA 1BISA 4HWIA 4O8KA 3OYJA 3J81O 4KPYA 5GAEP 4IJAA 3OS1A 3NF6A 4DR2K 4Z4IA 5DM6L 1X3NA 2G8HA 4H4OA 5JVGL 3LP1A 4DR7K 3QESA 4DTXA 4JK7A 4PY5A 5C24A 4MO4A 1ASWA 5C10A 1S1VA 1T44A 3HPOA 3SAFA 2P9PB 3H45C 4FLZA 4ZHRA 4H5VA 3HYFA 3SCXA 1RT4A 1DLOA 5HRSA 2P1JA 4FLYA 1QE1A 2KFZA 4XH5A 4CGGA 2RN2A 4RW6A 5AZJA 4AILC 1YT3A 4IBNA 4M45A 4Z4CA 3L2QA 3KLHA 4XEIA 5AQOA 3O3HA 4KV8A 4JNEA 1NGIA 1ZYQA 3H3NO 3NF7A 3J8AA 1BDGA 3PO5A 2KFNA 4ICLA 3QEPA 1VQLN 4BC3A 3DRRA 3PY8A 1S1WA 3S3OA 3LAKA 3NE6A 4DV6K 4FVUA 3MXMA 3THYB 3VF4A 3WQUA 4DV1K 4JI8K 1HYZA 1T6CA 2NUBA 3F5TA 4HHTA 1RT2A 5K14A 1MDUB 4JKBA 1RDUA 4NO7A 1H1VA 3C95A 3AVNA 1BHLA 1QTMA 3VENA 4HTUA 4KKOA 1WN7A 3N4QA 2Z1JA 1K6YA 3I33A 4FVMA 3WQTA 2HBMA 2FSJA 4CZIA 1HYVA 1E4GT 3K9JA 3SNNA 4LH5A 4A2AA 2QA4N 4FJMA 4WQ5A 3OYFA 2QKKA 1NNEA 3ZT1A 1VQMN 2YHWA 3B8AX 4OPJA 3HOTA 3KLEA 3QEVA 3ZSOA 4A62A 4AF1A 3ZT2A 1TUYA 5H1SQ 1N32K 4H0OA 4A5AA 5CE3A 2HSTA 5AZJB 4BWMA 3LP3A 1RT3A 3KKRA 4OKEA 1NGHA 1VSFA 4IFVA 3TAEA 1T8EA 4NB4A 3JAMO 3WXLA 4BE1A 1J6ZA 3KD1E 4W5OA 2FXUA 4FWOA 1GLJO 2YCHA 4BRMA 5AQMA 2Q1NA 4PQUA 1VQ5N 3CG7A 3O1BA 4ELUA 2W40A 3U8XA 3JSMA 2EWSA 3G0ZA 4FK2A 1KXPA 4F3TA 2OTJN 2JGUA 3K9KA 4JI5K 3WXMB 4GY2B 4YNQA 2A40A 1I39A 1TAQA 2AJQA 1ATRA 3L2VA 2E2OA 4AQYK 1RT7A 3ATVA 4OX9K 1WAJA 2YHYA 3WXIA 1YF5L 2HMIA 3QIPA 1TV6A 4KHNA 3C94A 1QQMA 1N34K 1YVNA 4FZZA 3ISNC 4L3QA 4FPAA 3CC2N 1S6PA 4YFUA 3I0RA 3CPWM 4O4GA 4M3UA 4JN4A 4EIAA 5J2NA 4KI4A 3CCVN 1TGOA 2WFBA 4LF4K 3A5NC 2HHHK 3T7ZA 4GV3A 2QXLA 2HVHA 1BI4A 4J2BA 1B9FA 1CZAN 1HPMA 4B1ZA 4WFAL 4JRPA 3QDKA 4CHYA 5KGXA 3TPQA 3ZCMA 1NOZA 3S41A 4KB0A 4KHSA 3RVCA 4FWKA 2VG7A 4RW9A 2GWKA 1QZ5A 2E20A 4DV5K 1GOAA 2NRWA 5JMVA 2Y1JA 4MDAA 4XH4A 3CCRN 2GUIA 3TR8A 3VA0A 3RSEA 1VQON 4M41A 3FZHA 4CVNE 4BY9C 2D0PA 2QKBA 2A41A 3V1RA 4WQ4A 2IIRA 3ID6A 5FROA 3PO4A 3V9UA 3NGZA 4MLEA 4KTQA 3TU5A 1YITN 4CGDA 4DSIA 1ZBSA 1QHAA 4DTSA 4GKKK 4FCYA 3DM2A 1X9JA 1C0MA 5HRNA 4BGBA 4X64K 4M3YA 5AQXA 3CCJN 3GDQA 5AZIA 1ZC6A 4XH1A 3TI0A 1Q7YO 1RNHA 1CLQA 3WT0A 1VSJA 4BG8A 3ALYA 3SJJA 4E1MA 3AV9A 4YOVA 3AVAA 4J2EA 4LF8K 3U3GA 1DT9A 2V51B 2NRXA 3VQ5A 5BPNA 4O44A 2G8UA 4DFJA 1NJZA 3KLIA 1NGCA 2NRVA 3KLFA 5KRTA 3MN7A 4DV4K 3SMSA 2YKMA 2G8IA 3CJBA 2FSKA 4DTUA 4M42A 4LY7A 4HVJA 3UKRB 3HM9A 2O8EA 2Q97A 3NGIA 5KI6A 4JKEA 1L3UA 4LC9B 2KKZA 3OA9A 1S1TA 2B4JA 4WFBL 1W2BM 3SMPA 4CFCA 3PV8A 3SUOA 2HBLA 4PKHA 4HCCA 4NXNK 3IMXA 2ZF5O 4FOEA 5BRFA 1FXXA 4B1VA 5AQZA 2GEMA 3R8EA 4LSNA 4B9VA 4AHRA 3MEEA 2FC0A 4CZKA 3C6UA 2LSNA 4EAHD 4RW7A 2JWKA 3CFOA 2P5OA 3ZSQA 2IVNA 2YNHA 4ISFA 2HHSA 2HHXA 2PZSA 1IG8A 2BANA 3OYEA 1K8KB 3LDPA 4RW4A 4CCHA 4KTWA 4EP4A 5AQRA 1BA0A 2OPSA 2HBKA 1ZBFA 2WONA 4CZLA 4JKAA 4KRFA 3TWHA 1W7AA 1KQSM 4HCBA 1I94K 1K73O 4X62K 2B6AA 2F4VK 3KZBA 4H5TA 3VF6A 1QSLA 3QO9A 1B92A 3DI6A 3ZSXA 4HTLA 2DFEA 4OGCA 3L6QA 1QHTA 1M1KO 2O8EB 2A42A 4AH9A 4TSXA 3AVMA 3VQBA 2WBNA 3M6GA 3OHRA 4DMNA 4ELVA 3L4QA 4A57A 1G15A 4QAGA 1X1PA 3K5MA 3KK3A 4CHNA 2GBZA 4CK2A 3LM9A 3PX4A 1GLDG 2OPQA 3G10A 4Y1CA 3VPZA 1UOCA 1D9DA 4CIGA 1BIZA 4BC5A 1N33K 3CI5A 2F96A 3MCPA 2UUCK 2ITGA 3QFPA 4KBOA 4C8MA 3AO4A 5AQQA 2UUBK 2O8CB 1TVRA 3MXIA 3R1XA 3SAHA 2CGJA 2E2QA 1HUXA 4FWLA 2ITMA 1SZ2A 2RE2A 3WEEA 1WOQA 4PL7A 3C6TA 4DSLA 3WNHA 5GIOA 4Z4GA 2IVOA 5IWAK 3OYDA 2HOEA 4J8FA 4DFKA 1J5EK 5BRDA 3H6EA 1R0AA 4YOYA 3EEQA 5M1PA 3E01A 5CR4A 3HPGA 5HOOA 3KJVA 4DQSA 2FBYA 3L8BA 3G71N 3T1YK 4GV6A 1K9MO 2HHVA 3LP0A 3MDQA 1TK8A 5LY3A 5LMNK 1D4XA 4DR5K 5EU7A 1KTQA 2YKNA 4LH4A 4IZ9A 2RPIA 4FWNA 1T6DA 3AAQA 3OYAA 3AGRA 4WE1A 3NGYA 4HUEA 1TK0A 2F8SA 4CGHA 4PHTX 3HJFA 4OVLA 1RT6A 5GIPA 3MK6A 3SUNA 3AVLA 1ZBHA 4WCEL 4B3TK 4CE9A 4KAZA 1HMVA 3ZLJA 1S5JA 3DRPA 4IDKA 3RR7A 2BTFA 4DQ8A 5I3UA 4Z94A 4FJXA 5SWMA 3DWLA 4DU3A 1RGIA 5HBMA 3CC4N 4CI6A 4O55A 3A5LC 4O0JA 3MMVA 4JK9A 4B08A 2GV9A 1C0GA 2QEXN 1U47A 3FR0A 3AVHA 3TABA 1L3SA 4M7XA 2X6NA 3T3FA 3ZETA 4N41A 1ILYA 2QWQA 4DSJA 3CJ7A 3EKUA 5FPEA 4CJFA 4FJGA 1Z05A 5LMUK 1Z26A 4LF7K 1NGDA 3WEEB 4C8KA 3RRHA 2IDOA 1BQMA 3L2RA 3Q7CA 4ISGA 3CFRA 1KCFA 3NH2A 3CJAA 4BDYA 2P9PA 1KD1O 1LW2A 1HX1A 1W97L 2Z1IA 5HROA 4M3TA 1EO1A 2QK9A 3TAPA 4MDBA 1HPZA 3H3OB 4K25A 3TAQA 5FPNA 4DHYA 1C6VA 4N76A 3ZSVA 5HP1A 4IO8A 3KVGA 1NGAA 1TL1A 4H4MA 3MEGA 1L3VA 1S72N 4H0TB 4F8RA 1BOTO 3BDPA 1U4BA 1U49A 4DR6K 3PX0A 2HNYA 1T7PA 4NCAA 4AHTA 3SZ2A 3GOIA 4FM0A 4FJ7A 5AQIA 5C0YA 3HP9A 1JLAA 1OH8A 4CBUA 1LWCA 4MQ3A 4K42A 4FOIA 1QQCA 2KW4A 4DV0K 4JI2K 2Q36A 2H3GX 4BRIA 3IKMA 4GKJK 5AQHA 3UB5A 4OO1J 4OJRA 1UA0A 5AR0A 2V7YA 1UAXA 1WSGA 5IT9O 1NGFA 3BY5A 2P9SB 3WUHA 4GW6A 3HVRA 3AVCA 2XY5A 2QW9A 1RDCA 5C2DA 1HYSA 3ZETB 4BE0A 3O9SA 2VWJA 1RTDA 4PA1A 3ULEB 4AHCA 1FJGK 2YJFA 2G8FA 1D8YA 3OJSA 1HRHA 4JKHA 1KSPA 2R7YA 1FK9A 3HRGA 1IKYA 2HHWA 1JCFA 1Z6RA 1S9EA 3KK7A 4KH4A 5FRMA 2A5XA 4BVPA 2A1SA 4IEEA 4M3WA 3EZ5A 1RT1A 2P9NB 2BH1A 4FLUA 5D3GA 4ELTA 4DSKA 3DLHA 2D4WA 2YHXA 3FFIA 3E1YA 2ZJPL 4FLVA 1XC9A 1HKBA 4K43A 3F9MA 1KVCA 1NOYA 3HP6A 3SPZA 3QIOA 1A5VA 1NJWA 2VGMA 4CEEA 4R5PA 3AAPA 4B3RK 3CJCA 2VYPA 4CFDA 4YY3K 4R79A 2ZQBA 4DTJA 3QLHA 2ZM6K 4FWSA 3ZSZA 5ADXA 4M3ZA 3P83D 1LWFA 2ASPA 4J2AA 3GBTA 5CHIA 1WSEA 2WC9A 1Y64A 1BL3A 3D2FB 4DLGA 3ZSWA 2VG5A 2XHBA 1SL0A 2G8KA 5EXWA 1JLEA 3ZYYX 1VSKA 4BDZA 3DYAA 4KFBA 4FZXC 3QEXA 3SYZA 4X66K 1VAZA 3S9HA 3LPTA 4CGIA 3O9QA 3CM5A 4FLXA 5LJVA 1NK9A 4CJQA 5KGWA 4E7HA 4DWIA 3FE1A 5ELZA 5AQJA 4KREA 1VSMA 1QVFM 3J7YP 4IOAL 3SPYA 1C0UA 4NLCA 3NMUA 3KHYA 4Z0UA 4B8AB 3QBWA 2ZJRL 1QVGM 2XRIA 4CIFA 5DM7L 3P31A 2P9IA 4BRHA 3OYGA 5J2QA 4DQIA 2E1YA 2J4RA 1VQKN 1DGKN 3AO3A 1WBDA 1NM1A 4B9MA 1DTQA 4OLAA 4Y1DA 3D6RA 1RTHA 3SLCA 1Q86O 1NKCA 5A2QO 4KO0A 2NRHA 3THWB 1WNSA 4GMJB 2FBXA 1NKEA 4DV7K 2ZWHA 1S3XA 3VERA 1YTAA 1QQNA 3MEDA 3TSPA 4NCGA 4B9NA 3K0SA 3MWTA 2HHQA 3LDOA 4C23A 2Z1GA 1KLNA 3IG1A 4NCBA 4BQLA 1YI2N 1N36K 4CJ4A 1LV5A 4FK0A 4QS8A 3SUQA 4X65K 4JKCA 1MWKA 5EOYA 4EHTA 3S3MA 1JLQA 3C6AA 2Q0RA 4FJ5A 2I7NA 3PIOL 3NHGA 3KWIA 4OKJA 1CZBA 4YOTA 3IRXA 4DV2K 5HL7L 2UUAK 1NK7A 4JS4A 2E4LA 1ITGA 2AA4A 3OS0A 4DR3K 2VQFK 4LF9K 2IVPA 3EE8A 3LDLA 3VEZA 3VEYA 3QINA 1LOTB 4JYAK 5KRSA 3ZEUB 3O3GA 4OLBA 1N5YA 2P9IB 2I5JA 2D5RA 1CXUA 1RT5A 5F0XA 1NGJA 2DFHA 3SAGA 4DTPA 5AQVA 1TL3A 3UKRA 4K41A 4LF6K 3VQCA 4CEZA 3SV4A 4DB3A 1EX4A 2GELA 3HVTA 1YAGA 4HUGA 3ZT4A 5AJ3K 4JRQA 5AQWA 1IKWA 1Q82O 1XNRK 3OBWA 4CJ7A 3PLAA 3ITHA 3AVBA 5AQGA 2W41A 3CERA 2Q3SA 4AHVA 3RRGA 5F1XA 5JICA 3AA3A 4CF8A 3LAMA 4CJKA 3K5NA 3WNFA 2ATQA 3DRSA 3T1HK 4IEIA 2F8TA 3IS9A 3QEIA 2X74A 3M8PA 1DEJA 3VQ4A 3UIQA 1WLJA 3P5JA 3VEWA 3F9KA 1F21A 1RBUA 4BR7A 2PBDA 4CEOA 2HF4A 3NF9A 3LDNA 1VSLA 4CIEA 3ZT3A 3VQQA 4CD1A 1IJJA 4U67L 1YIJN 1BIUA 2GX9A 3QETA 4DR1K 1WBBA 5LL6Z 4CJSA 1K8KA 3EY1A 4CHZA 2AP1A 3VQAA 3U9ZA 3EYZA 2PY5A 5BR8K 4JS5A 2XO7A 5EVZA 3O6WA 3PX6A 1ZBLA 3NF8A 1JXBA 1TKTA 4DLEA 1EETA 4CJUA 5JS1A 1NBWA 4MFBA 2VQEK 3NAEA 1KLMA 4BC2A 2G8WA 3HTVA 4E3SA 4A59A 4B3OA 4RWTA 2Q2RA 5J2PA 1N8RO 3MX2A 1T3VA 3J7ZO 4EP5A 1ZBUA 4BRKA 1YHQN 4CFBA 1N6QA 3TAMA 3E9LA 1XHZA 2OYQA 3OYMA 3SV3A 2RF2A 1ATNA 2VWBA 4DUYK 2E2NA 2BE2A 3HXMA 5M1NA 3SQ0A 2WUSA 1GLLO 3OYCA 4WYBA 4WF9L 5TKWA 3D7EO 2HNDA 1GLEG 1QS4A 5TKYA 4DTMA 3QEWA 5EY4A 3WXKA 3P38A 3J80O 2O8CA 1BO5O 1VRUA 1J54A 4KI6A 4LFBK 4BRNA 1Q9YA 3U6FA 4B1WB 3ENBA 2ZD1A 4K0KK 3ID8A 1ZBIA 3W3DA 3VQPA 3PSFA 4DQQA 1VHXA 4OPKA 1QZ6A 1VSHA 3ZX0A 2IC3A 3EO3A 3L3UA 4FW1A 1T05A 2XY7A 4W5TA 2RKIA 1S1XA 4ID5A 2YV0X 4GVMA 4DV3K 1KFSA 3KKSA 2P9LA 3ENHA 4LSLA 2UXCK 4KHUA 3CHWA 3C0BA 1HKCA 4ILHA 5BREA 4Z4EA 4JI6K 1D5AA 4CF1A 3CCEN 1HNZK 5KQDA 4PKIA 1S6QA 4ILJA 4JV5K 4JI4K 5ADXH 2YHAA 3AVKA 1KAZA 5AQNA 4BG9A 3CIPA 3MN6A 4FM2A 2KQ2A 4MLHA 5B8HA 1VSDA 3OYHA 4DSEA 3SBGA 5JLHA 4JI0K 1U45A 5FPDA 1JLGA 4BR4A 1SV5A 3CM6A 1NGGA 4OGEA 4UY8O 2FBTA 1NKBA 3JXUA 1LCUA 4EFHA 4CD3A 4LFAK 1XMQK 2CH5A 5KPRA 1NK5A 5J1EA 3AVFA
chains in the Genus database with same CATH topology
4DV5K 4NXMK 4JI1K 4DR6K 4DUYK 4X66K 3T1YK 1N32K 4CVNE 3J81O 1IBLK 4LFCK 4KHPK 4DR2K 5LMNK 3J7YP 4DV0K 4DR5K 4JI2K 1XNQK 4DR7K 3OTOK 4LF6K 4GKJK 3JAMO 5AJ3K 4DUZK 4GKKK 4V19S 5IT9O 5FLXO 3J80O 1XNRK 4B3TK 1I94K 2UXDK 1HNWK 4X62K 2F4VK 4LFBK 4X64K 1HR0K 4K0KK 1FJGK 5A2QO 3T1HK 4JI5K 4DR4K 4LF8K 4DV7K 4DV3K 2UXCK 4AQYK 4OX9K 4JI6K 1HNZK 2UXBK 4DV4K 4DV6K 4JV5K 4JI4K 4DV1K 4JI8K 1XMOK 5LMUK 4DR1K 4LF7K 5LL6Z 1N36K 4YHHK 1N34K 1N33K 4CW7B 5BR8K 4X65K 1HNXK 2UUCK 4JI3K 4JI0K 4B3RK 2E5LK 4LF4K 2HHHK 4YY3K 2UUBK 2ZM6K 2VQEK 4DV2K 2UUAK 2UU9K 4JI7K 4NXNK 4B3SK 4LF5K 4LFAK 4DR3K 2VQFK 4LF9K 1IBMK 1XMQK 4B3MK 3J7AP 5IWAK 1IBKK 1J5EK 4JYAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 K;  4NXM K;  4JI1 K;  4DR6 K;  4DUY K;  4X66 K;  3T1Y K;  1N32 K;  4CVN E;  3J81 O;  1IBL K;  4LFC K;  4KHP K;  4DR2 K;  5LMN K;  3J7Y P;  4DV0 K;  4DR5 K;  4JI2 K;  1XNQ K;  4DR7 K;  3OTO K;  4LF6 K;  4GKJ K;  3JAM O;  5AJ3 K;  4DUZ K;  4GKK K;  4V19 S;  5IT9 O;  5FLX O;  3J80 O;  1XNR K;  4B3T K;  1I94 K;  2UXD K;  1HNW K;  4X62 K;  2F4V K;  4LFB K;  4X64 K;  1HR0 K;  4K0K K;  1FJG K;  5A2Q O;  3T1H K;  4JI5 K;  4DR4 K;  4LF8 K;  4DV7 K;  4DV3 K;  2UXC K;  4AQY K;  4OX9 K;  4JI6 K;  1HNZ K;  2UXB K;  4DV4 K;  4DV6 K;  4JV5 K;  4JI4 K;  4DV1 K;  4JI8 K;  1XMO K;  5LMU K;  4DR1 K;  4LF7 K;  5LL6 Z;  1N36 K;  4YHH K;  1N34 K;  1N33 K;  4CW7 B;  5BR8 K;  4X65 K;  1HNX K;  2UUC K;  4JI3 K;  4JI0 K;  4B3R K;  2E5L K;  4LF4 K;  2HHH K;  4YY3 K;  2UUB K;  2ZM6 K;  2VQE K;  4DV2 K;  2UUA K;  2UU9 K;  4JI7 K;  4NXN K;  4B3S K;  4LF5 K;  4LFA K;  4DR3 K;  2VQF K;  4LF9 K;  1IBM K;  1XMQ K;  4B3M K;  3J7A P;  5IWA K;  1IBK K;  1J5E K;  4JYA K; 
#chains in the Genus database with same CATH topology
 2PAV A;  4AM7 A;  1U04 A;  3CCS N;  5E84 A;  3D45 A;  5HRR A;  2HMP A;  3TTF A;  3OJU A;  3QNO A;  1RBS A;  3BEX A;  2E88 A;  4CHQ A;  1NWK A;  5BN9 A;  1HQE A;  3LM2 A;  1IBL K;  4LFC K;  3NH1 A;  3OS2 A;  1KC8 O;  3DLL L;  5AQF A;  4LD0 A;  1Z25 A;  3TSU A;  4G9Z A;  4BRF A;  1NU0 A;  3T19 A;  3P4I A;  4C1N K;  3I8D A;  3C7N A;  5CYM A;  3SUP A;  4O8U A;  4B1X B;  4QS9 A;  4RTF D;  4Q5V A;  3VQ9 A;  3H08 A;  2ZGZ A;  4NLB A;  5C15 A;  5FLX O;  1CZ9 A;  4CES A;  3HI0 A;  5E26 A;  2P9L B;  3MCA B;  3FFK B;  3CCM N;  5GAD P;  3O80 A;  3P1G A;  1QSS A;  2BUP A;  4DF4 A;  3O4W A;  4CEC A;  2O8B B;  2CGL A;  4I9L A;  4DKW A;  3WXJ A;  2OCE A;  1C0T A;  4E0D A;  2F9T A;  3VES A;  4Z4H A;  3BUZ B;  3HT3 A;  1VSI A;  1IO2 A;  2YI1 A;  3CC7 N;  4MO5 A;  3F2K A;  1C0F A;  3DXM A;  4IJN A;  4IDH A;  3VN5 A;  1EKE A;  1NK8 A;  5CZ1 A;  3MWP A;  4I6M B;  4H5W A;  2P9U B;  3KK1 A;  3M8R A;  1JKH A;  1WSH A;  4DQR A;  4Z4F A;  3AA4 A;  3MXJ A;  4DF8 A;  2KHO A;  4W5Q A;  3OYL A;  5C42 A;  3OYK A;  1GOB A;  3JYT A;  4HUF A;  1KRP A;  4YOU A;  4JHD B;  4JI3 K;  3HOS A;  2KZZ A;  4CFA A;  2P9S A;  4ZTF A;  1Q8I A;  4JD2 B;  4CJE A;  2E6M A;  2PYJ A;  1KAY A;  1IG9 A;  2RHK A;  3VTI A;  3ULE A;  2E8A A;  2FLO A;  1XI1 A;  1IBM K;  3U9D A;  3VF2 A;  1NK0 A;  2D0B A;  4FSV A;  4PKG A;  3V9W A;  4C1N I;  3PUF A;  1YJ9 N;  3PIP L;  5KTQ A;  1NMD A;  3C7N B;  4AHU A;  5BN8 A;  3IFR A;  4F2S A;  2B5J A;  2CGK A;  4KHY A;  1TKZ A;  2P9N A;  3V9Z A;  2O8F B;  4KH6 A;  3HL8 A;  4A61 A;  3AO5 A;  4B1U B;  1VRT A;  3KK2 A;  5C12 A;  3M8Q A;  2A6A A;  3LWL A;  3THX B;  3EE9 A;  5KPT A;  3VQD A;  1J5O A;  1WAF A;  4CGJ A;  1FW6 A;  2JWL A;  3M1F A;  3OVN A;  4O0I A;  3HO1 A;  3HM8 A;  3CQX A;  1Y97 A;  3M3Z A;  1JJ2 M;  4E19 A;  3E9O A;  4NYN A;  2VWK A;  3DXM B;  3VQE A;  1S1U A;  2UYT A;  1V4S A;  1ZXO A;  2NNW A;  3DLE A;  4YOW A;  4FM1 A;  2D0O A;  3CPE A;  1KVB A;  3L3V A;  5GAG P;  1JCG A;  1YJN N;  4M63 C;  3D2F A;  3MN9 A;  4JKG B;  2QWR A;  1QSY A;  3BF1 A;  1LWE A;  2W6K A;  3CFP A;  4E7L A;  1RBV A;  4CJV A;  4CJR A;  4CHO A;  3MEC A;  4CJT A;  3E66 A;  4FYD A;  3F73 A;  1JXE A;  3FZK A;  3UE5 A;  1C1C A;  2OAN A;  5DMR A;  4C8N A;  3K5L A;  4C8L A;  2F9W A;  2DTU A;  3DMJ A;  2FSN A;  4CJ3 A;  4DFM A;  1L3T A;  1MU2 A;  4CF0 A;  3UKU B;  3IUC A;  3AVI A;  4BWJ A;  3CET A;  3ZSR A;  1RDD A;  3EZW A;  2E5L K;  2O4G A;  3NFA A;  4L8R B;  1VSE A;  1NGE A;  4CZG A;  1NGB A;  1SKR A;  3QBX A;  4XIU A;  1TYQ A;  2D0C A;  3DXK A;  4BR5 A;  2UU9 K;  3LP2 A;  5BR9 A;  5SZT A;  1NK6 A;  3AA5 X;  2OPP A;  3RMC A;  2D0A A;  3LPU A;  3DLG A;  3DAW A;  4CBX A;  3BZK A;  4A5B A;  4IG0 A;  3O4Q A;  3PSI A;  3WNG A;  1NJY A;  3AVG A;  3THW A;  3VMF B;  4KB1 A;  3AY9 A;  2OZS A;  3VEO A;  4FW2 A;  3JS6 A;  2E6L A;  5AQS A;  4N56 A;  4PL8 A;  4AM6 A;  2VCP A;  3RMB A;  4FLT A;  4M3X A;  4CEB A;  1ASU A;  4QOZ B;  3E9P A;  1XHX A;  4BDP A;  1LW0 A;  3OYN A;  4BVO A;  3G25 A;  1YJW N;  3B6O A;  4K8Z A;  3AO2 A;  3MX5 A;  4JKD A;  4FJJ A;  4IWV A;  1ESV A;  4JKF A;  3S3N A;  4WQ5 C;  2ZJQ L;  3K5O A;  3QB0 A;  3H1Q A;  2UXD K;  1BGX T;  5EX5 A;  1VQN N;  4B9T A;  3AO1 A;  1VQ4 N;  4F4K A;  2QWM A;  4DTR A;  4ZTJ A;  1OH6 A;  2KLA A;  2Z1H A;  3TTC A;  4W5N A;  1I3A A;  1VQ8 N;  3ZEU A;  2YNG A;  3BGR A;  1YVU A;  3OY9 A;  2EHG A;  2V7Z A;  5M1F A;  4BRA A;  4IOX A;  4DFP A;  2XY6 A;  3O9U A;  4CF9 A;  3LWM A;  1TYQ B;  3DXK B;  3I56 N;  4Y0W A;  3SI6 A;  4CJL A;  3DOK A;  2FF6 A;  1JLC A;  1S22 A;  1RTJ A;  3BZC A;  1NK4 A;  2X6S A;  2PFU A;  3CF5 L;  1KAX A;  4FXD A;  3HSC A;  3VA3 A;  1X9M A;  4E7I A;  3CCL N;  3CQY A;  2XY8 A;  2YX6 A;  2V52 B;  3TSQ A;  1JL1 A;  4YOX A;  3V1Q A;  3HK2 A;  1CXQ A;  1TKX A;  3NDK A;  3R6M A;  2W6L A;  3TAG A;  5M1K A;  4BR2 A;  5F2R A;  2WOM A;  2EX3 A;  4B3S K;  2VG6 A;  1U48 A;  5DK5 A;  1HNI A;  1NJI O;  4LF5 K;  1RIL A;  1ATS A;  3O08 A;  4EZ9 A;  3L4I A;  1C1B A;  4IFE A;  1RFQ A;  3B6P A;  3CMA N;  4IG3 A;  1FKP A;  5JVH L;  1Q9X A;  3L2U A;  4FJL A;  1UWB A;  4FWQ A;  3VGK A;  1WSF A;  3VET A;  4YOR A;  2D1K A;  2P9K A;  4M7Y A;  3KD5 E;  1D9F A;  4CED A;  2I7P A;  4CK3 A;  4IO9 L;  1WB9 A;  3VOV A;  4OPH A;  3ZX2 A;  4Q0B A;  1OVY A;  5LJW A;  3V4I A;  3DJC A;  4H0Y B;  4E7J A;  5FRN A;  1RDB A;  3K58 A;  3LL3 A;  5HRP A;  3O9R A;  4DTN A;  1GLC G;  5I9E B;  1E3M A;  4G1Q A;  2FF3 B;  4W5R A;  4V19 S;  3KLG A;  5KPZ A;  3RR8 A;  3CCQ N;  5E41 A;  2OA8 A;  2QWO A;  5AFU A;  1NJX A;  2DPN A;  1HR0 K;  3EL2 A;  1T03 A;  1YXQ A;  1HLU A;  3BF3 A;  4CZF A;  1RCH A;  4H0V B;  3D0P A;  4CHP A;  4WQ4 C;  3QFU A;  1SS6 A;  3RMD A;  2P51 A;  2ASM A;  5AQT A;  4K8X A;  1W0H A;  2ZE2 A;  4AHS A;  3ZSY A;  1DTT A;  1HQU A;  2PYL A;  4U7B A;  1P8Z A;  5C25 A;  3FZL A;  4KHW A;  3VEX A;  2IOC A;  3G6E N;  1IH7 A;  2OPR A;  5JLF A;  4JK8 A;  3KIO A;  3LZJ A;  3H46 O;  2HVI A;  4I2P A;  3GE1 A;  1EQY A;  4BE2 A;  1SQK A;  3CME N;  2FBV A;  1J9A A;  1NG9 A;  4F3O A;  1Q81 O;  4FZY A;  2ETJ A;  4CW7 B;  1SL1 A;  5HLF A;  2NRZ A;  1R59 O;  5BPL A;  2BDP A;  2QI2 A;  5KQ8 A;  1O13 A;  2Y1I A;  4EZ6 A;  3LDS A;  2YNF A;  4H0X B;  1JCE A;  4BRG A;  2P9K B;  4I2Q A;  1SKS A;  1XWL A;  4B3M K;  1SL2 A;  4F2R A;  1VQ6 N;  1VQ7 N;  5AQK A;  1LAW A;  1NMN A;  1WSJ A;  5I42 A;  4IKF A;  3CJ9 A;  3DOL A;  4NXM K;  5CYQ A;  3OYB A;  3RMA A;  1JLF A;  3NBP A;  2CH6 A;  4B8C A;  3WNE A;  1J53 A;  2YJE A;  4CJ5 A;  3OW2 M;  2A1R A;  3H1V X;  2VGN A;  5CY4 A;  3P39 A;  3U4L A;  4FJ8 A;  1C1A A;  1OKJ A;  1WUA A;  1TK5 A;  3Q7B A;  1GOC A;  3O4N A;  1GLF O;  3OYI A;  1WSI A;  4N47 A;  4CER A;  2QWL A;  3A5M C;  3O8M A;  1U2V A;  3SQ4 A;  4DUZ K;  2P5G A;  4FPB A;  2IS3 A;  2QWP A;  4CGF A;  4JAX A;  4CZH A;  4JEP A;  1B9D A;  3ULD A;  4PUO A;  3G4S N;  1BI4 B;  3T69 A;  1UA1 A;  2ASO A;  5C2F A;  4CK1 A;  4N5S A;  3SQ2 A;  3QER A;  5M1O A;  1BG3 A;  1A5X A;  1RBR A;  3SBT A;  4BR0 A;  3LAN A;  4B9Q A;  4DR4 K;  3L2W A;  1E4F T;  2Q0U A;  1BUP A;  3LDQ A;  1BQN A;  1XUP O;  3MN5 A;  4IFY A;  3RSE B;  4FJH A;  1EP4 A;  1SUQ A;  4GVE A;  2G8V A;  2BGG A;  2UXB K;  2E1Z A;  4BRQ A;  4CEQ A;  2HHU A;  3EKS A;  1XMO K;  3NH0 A;  3TTD A;  1HNV A;  3DLR A;  3AGK A;  3I8B A;  2A3Z A;  3M5R A;  3A2F A;  3QNN A;  1EWR A;  1TAU A;  3QML A;  3I55 N;  4C8O A;  1S9G A;  1EXQ A;  4FO0 A;  3SK3 A;  4B9S A;  1EWQ A;  4BGA A;  2HHT A;  1BWF O;  3O3F A;  4DS5 A;  1G99 A;  5JS2 A;  4FL9 A;  2O8B A;  4JLH A;  5AZI B;  2QTD A;  4E1J A;  2Q31 A;  1K8A O;  4FLW A;  3DLB A;  1IBK K;  4GNI A;  4I7F A;  1U2V B;  3LAL A;  1TUU A;  3HBT A;  1A5W A;  1BCM A;  4DCH A;  2W42 A;  3MAQ A;  4E89 A;  4ID1 A;  4BQZ A;  4IOC L;  4J2D A;  4BRD A;  1RBT A;  4I6M A;  3CD6 N;  1GLA G;  2P9U A;  4FJN A;  4M3R A;  5GIN A;  3O5B A;  2OZM A;  1GLB G;  2NLX A;  1W9H A;  4CBW A;  4H03 B;  4ISE A;  3HST B;  1XNQ K;  3OTO K;  1LAV A;  4KH5 A;  4H0P A;  2YHB A;  4A2B A;  2HBJ A;  3OBY A;  1OVQ A;  4JHD A;  3FLC O;  4KHQ A;  3IDH A;  4CJP A;  4FWP A;  3FGU A;  3D2E A;  4EHU A;  5J2M A;  1SKW A;  4YDU C;  4JD2 A;  4DU1 A;  3K59 A;  1X3M A;  1HNW K;  4QCL A;  1HJR A;  3U3Y A;  1MA9 B;  3VGL A;  3V81 A;  4KTZ A;  3AA2 A;  3AVJ A;  4B1Y B;  2NRR A;  2KZM A;  3RTV A;  2O8D A;  4E7K A;  1X9W A;  3TAN A;  3CYM A;  1IV0 A;  2IAJ A;  3SJH A;  3GL1 A;  3VQ7 A;  3R3L A;  4RCH A;  4RG8 A;  3HZ6 A;  3W0L A;  2O8F A;  1JLB A;  3DLK A;  1O1W A;  4O5B A;  4PWD A;  1BCO A;  4CF2 A;  4CZM A;  4FK4 A;  2QXF A;  3THX A;  1SAZ A;  1OH5 A;  1YUW A;  3FZM A;  1OH7 A;  4H5N A;  4YHH K;  3V9S A;  5FPM A;  2O4I A;  4YDU A;  1HNX K;  4GV9 A;  2YNI A;  4DU4 A;  2HF3 A;  3L0Q A;  2E2P A;  3KWG A;  4UQG A;  1VQ9 N;  2QM1 A;  4O5F A;  4BRL A;  4FWM A;  4JI7 K;  3AAR A;  5AQL A;  2GTD A;  4JKG A;  3NVK A;  1V4T A;  4QS7 A;  2NRT A;  4BRP A;  1M90 O;  2F7T A;  3A0I X;  1HJO A;  5AQU A;  2OTL N;  4E1N A;  3K57 A;  4F9O A;  4B9L A;  2JLE A;  3EN9 A;  4JI1 K;  3VGM A;  2NZT A;  1P90 A;  3D2E B;  4FJI A;  5AQY A;  4DG1 A;  3NVM A;  3T1A A;  1FKO A;  3QIC A;  3R9P A;  5FDL A;  3IAY A;  5AFU H;  4KHP K;  2IGI A;  3ZT0 A;  3TAR A;  4OKK A;  3UKU A;  1TKD A;  3V1O A;  4OPA A;  3LZI A;  2O8D B;  4DS4 A;  2QWN A;  3SQ1 A;  4H5R A;  2WTU A;  1BA1 A;  1X9S A;  4DTO A;  4I9Q A;  4IXC A;  4CJW A;  4B9U A;  3V6D A;  2GWJ A;  4FJ9 A;  1Q18 A;  3ASM A;  2GUP A;  3ZX3 A;  3TAF A;  3ENO A;  2HW3 A;  4BR9 A;  5T7B A;  4WFN L;  5M1Q A;  5AQP A;  1REV A;  3VEV A;  1XC3 A;  1BU6 O;  3CXC M;  3KTQ A;  3A5O C;  5CZ2 A;  4CZE A;  1RTI A;  2X78 A;  1DKG D;  1RDW X;  3V9X A;  4ILG B;  4BC4 A;  3GG4 A;  1YTU A;  4CZJ A;  3HPH A;  1HKG A;  2KTQ A;  1RDA A;  3FZF A;  4FJK A;  4BRE A;  1VK0 A;  1IKV A;  5GAH P;  1MWM A;  1IKX A;  3C65 A;  4FWR A;  4DQP A;  4BRC A;  1L5U A;  4CEF A;  1QQO A;  3BP8 A;  2DY4 A;  2ZGY A;  2HB5 A;  3VQ6 A;  3NCI A;  3VTH A;  1XQS C;  3C6H A;  3VQ8 A;  1JL2 A;  5BRH A;  3A8Y A;  4RW8 A;  5BPM A;  3ATU A;  1KVA A;  3I0S A;  4DSF A;  3RWU A;  3M8S A;  3THY A;  1ASV A;  3O1W A;  3THV A;  1NLV A;  5MLC Q;  3K2P A;  3CJ1 A;  4CEA A;  4H8K A;  2HNZ A;  4BAC A;  3J7A P;  3N4P A;  4NYF A;  3CCU N;  2DFF A;  1KFD A;  3CQ8 A;  1VQP N;  1U6Z A;  4BRO A;  3O9T A;  1BIS A;  4HWI A;  4O8K A;  3OYJ A;  3J81 O;  4KPY A;  5GAE P;  4IJA A;  3OS1 A;  3NF6 A;  4DR2 K;  4Z4I A;  5DM6 L;  1X3N A;  2G8H A;  4H4O A;  5JVG L;  3LP1 A;  4DR7 K;  3QES A;  4DTX A;  4JK7 A;  4PY5 A;  5C24 A;  4MO4 A;  1ASW A;  5C10 A;  1S1V A;  1T44 A;  3HPO A;  3SAF A;  2P9P B;  3H45 C;  4FLZ A;  4ZHR A;  4H5V A;  3HYF A;  3SCX A;  1RT4 A;  1DLO A;  5HRS A;  2P1J A;  4FLY A;  1QE1 A;  2KFZ A;  4XH5 A;  4CGG A;  2RN2 A;  4RW6 A;  5AZJ A;  4AIL C;  1YT3 A;  4IBN A;  4M45 A;  4Z4C A;  3L2Q A;  3KLH A;  4XEI A;  5AQO A;  3O3H A;  4KV8 A;  4JNE A;  1NGI A;  1ZYQ A;  3H3N O;  3NF7 A;  3J8A A;  1BDG A;  3PO5 A;  2KFN A;  4ICL A;  3QEP A;  1VQL N;  4BC3 A;  3DRR A;  3PY8 A;  1S1W A;  3S3O A;  3LAK A;  3NE6 A;  4DV6 K;  4FVU A;  3MXM A;  3THY B;  3VF4 A;  3WQU A;  4DV1 K;  4JI8 K;  1HYZ A;  1T6C A;  2NUB A;  3F5T A;  4HHT A;  1RT2 A;  5K14 A;  1MDU B;  4JKB A;  1RDU A;  4NO7 A;  1H1V A;  3C95 A;  3AVN A;  1BHL A;  1QTM A;  3VEN A;  4HTU A;  4KKO A;  1WN7 A;  3N4Q A;  2Z1J A;  1K6Y A;  3I33 A;  4FVM A;  3WQT A;  2HBM A;  2FSJ A;  4CZI A;  1HYV A;  1E4G T;  3K9J A;  3SNN A;  4LH5 A;  4A2A A;  2QA4 N;  4FJM A;  4WQ5 A;  3OYF A;  2QKK A;  1NNE A;  3ZT1 A;  1VQM N;  2YHW A;  3B8A X;  4OPJ A;  3HOT A;  3KLE A;  3QEV A;  3ZSO A;  4A62 A;  4AF1 A;  3ZT2 A;  1TUY A;  5H1S Q;  1N32 K;  4H0O A;  4A5A A;  5CE3 A;  2HST A;  5AZJ B;  4BWM A;  3LP3 A;  1RT3 A;  3KKR A;  4OKE A;  1NGH A;  1VSF A;  4IFV A;  3TAE A;  1T8E A;  4NB4 A;  3JAM O;  3WXL A;  4BE1 A;  1J6Z A;  3KD1 E;  4W5O A;  2FXU A;  4FWO A;  1GLJ O;  2YCH A;  4BRM A;  5AQM A;  2Q1N A;  4PQU A;  1VQ5 N;  3CG7 A;  3O1B A;  4ELU A;  2W40 A;  3U8X A;  3JSM A;  2EWS A;  3G0Z A;  4FK2 A;  1KXP A;  4F3T A;  2OTJ N;  2JGU A;  3K9K A;  4JI5 K;  3WXM B;  4GY2 B;  4YNQ A;  2A40 A;  1I39 A;  1TAQ A;  2AJQ A;  1ATR A;  3L2V A;  2E2O A;  4AQY K;  1RT7 A;  3ATV A;  4OX9 K;  1WAJ A;  2YHY A;  3WXI A;  1YF5 L;  2HMI A;  3QIP A;  1TV6 A;  4KHN A;  3C94 A;  1QQM A;  1N34 K;  1YVN A;  4FZZ A;  3ISN C;  4L3Q A;  4FPA A;  3CC2 N;  1S6P A;  4YFU A;  3I0R A;  3CPW M;  4O4G A;  4M3U A;  4JN4 A;  4EIA A;  5J2N A;  4KI4 A;  3CCV N;  1TGO A;  2WFB A;  4LF4 K;  3A5N C;  2HHH K;  3T7Z A;  4GV3 A;  2QXL A;  2HVH A;  1BI4 A;  4J2B A;  1B9F A;  1CZA N;  1HPM A;  4B1Z A;  4WFA L;  4JRP A;  3QDK A;  4CHY A;  5KGX A;  3TPQ A;  3ZCM A;  1NOZ A;  3S41 A;  4KB0 A;  4KHS A;  3RVC A;  4FWK A;  2VG7 A;  4RW9 A;  2GWK A;  1QZ5 A;  2E20 A;  4DV5 K;  1GOA A;  2NRW A;  5JMV A;  2Y1J A;  4MDA A;  4XH4 A;  3CCR N;  2GUI A;  3TR8 A;  3VA0 A;  3RSE A;  1VQO N;  4M41 A;  3FZH A;  4CVN E;  4BY9 C;  2D0P A;  2QKB A;  2A41 A;  3V1R A;  4WQ4 A;  2IIR A;  3ID6 A;  5FRO A;  3PO4 A;  3V9U A;  3NGZ A;  4MLE A;  4KTQ A;  3TU5 A;  1YIT N;  4CGD A;  4DSI A;  1ZBS A;  1QHA A;  4DTS A;  4GKK K;  4FCY A;  3DM2 A;  1X9J A;  1C0M A;  5HRN A;  4BGB A;  4X64 K;  4M3Y A;  5AQX A;  3CCJ N;  3GDQ A;  5AZI A;  1ZC6 A;  4XH1 A;  3TI0 A;  1Q7Y O;  1RNH A;  1CLQ A;  3WT0 A;  1VSJ A;  4BG8 A;  3ALY A;  3SJJ A;  4E1M A;  3AV9 A;  4YOV A;  3AVA A;  4J2E A;  4LF8 K;  3U3G A;  1DT9 A;  2V51 B;  2NRX A;  3VQ5 A;  5BPN A;  4O44 A;  2G8U A;  4DFJ A;  1NJZ A;  3KLI A;  1NGC A;  2NRV A;  3KLF A;  5KRT A;  3MN7 A;  4DV4 K;  3SMS A;  2YKM A;  2G8I A;  3CJB A;  2FSK A;  4DTU A;  4M42 A;  4LY7 A;  4HVJ A;  3UKR B;  3HM9 A;  2O8E A;  2Q97 A;  3NGI A;  5KI6 A;  4JKE A;  1L3U A;  4LC9 B;  2KKZ A;  3OA9 A;  1S1T A;  2B4J A;  4WFB L;  1W2B M;  3SMP A;  4CFC A;  3PV8 A;  3SUO A;  2HBL A;  4PKH A;  4HCC A;  4NXN K;  3IMX A;  2ZF5 O;  4FOE A;  5BRF A;  1FXX A;  4B1V A;  5AQZ A;  2GEM A;  3R8E A;  4LSN A;  4B9V A;  4AHR A;  3MEE A;  2FC0 A;  4CZK A;  3C6U A;  2LSN A;  4EAH D;  4RW7 A;  2JWK A;  3CFO A;  2P5O A;  3ZSQ A;  2IVN A;  2YNH A;  4ISF A;  2HHS A;  2HHX A;  2PZS A;  1IG8 A;  2BAN A;  3OYE A;  1K8K B;  3LDP A;  4RW4 A;  4CCH A;  4KTW A;  4EP4 A;  5AQR A;  1BA0 A;  2OPS A;  2HBK A;  1ZBF A;  2WON A;  4CZL A;  4JKA A;  4KRF A;  3TWH A;  1W7A A;  1KQS M;  4HCB A;  1I94 K;  1K73 O;  4X62 K;  2B6A A;  2F4V K;  3KZB A;  4H5T A;  3VF6 A;  1QSL A;  3QO9 A;  1B92 A;  3DI6 A;  3ZSX A;  4HTL A;  2DFE A;  4OGC A;  3L6Q A;  1QHT A;  1M1K O;  2O8E B;  2A42 A;  4AH9 A;  4TSX A;  3AVM A;  3VQB A;  2WBN A;  3M6G A;  3OHR A;  4DMN A;  4ELV A;  3L4Q A;  4A57 A;  1G15 A;  4QAG A;  1X1P A;  3K5M A;  3KK3 A;  4CHN A;  2GBZ A;  4CK2 A;  3LM9 A;  3PX4 A;  1GLD G;  2OPQ A;  3G10 A;  4Y1C A;  3VPZ A;  1UOC A;  1D9D A;  4CIG A;  1BIZ A;  4BC5 A;  1N33 K;  3CI5 A;  2F96 A;  3MCP A;  2UUC K;  2ITG A;  3QFP A;  4KBO A;  4C8M A;  3AO4 A;  5AQQ A;  2UUB K;  2O8C B;  1TVR A;  3MXI A;  3R1X A;  3SAH A;  2CGJ A;  2E2Q A;  1HUX A;  4FWL A;  2ITM A;  1SZ2 A;  2RE2 A;  3WEE A;  1WOQ A;  4PL7 A;  3C6T A;  4DSL A;  3WNH A;  5GIO A;  4Z4G A;  2IVO A;  5IWA K;  3OYD A;  2HOE A;  4J8F A;  4DFK A;  1J5E K;  5BRD A;  3H6E A;  1R0A A;  4YOY A;  3EEQ A;  5M1P A;  3E01 A;  5CR4 A;  3HPG A;  5HOO A;  3KJV A;  4DQS A;  2FBY A;  3L8B A;  3G71 N;  3T1Y K;  4GV6 A;  1K9M O;  2HHV A;  3LP0 A;  3MDQ A;  1TK8 A;  5LY3 A;  5LMN K;  1D4X A;  4DR5 K;  5EU7 A;  1KTQ A;  2YKN A;  4LH4 A;  4IZ9 A;  2RPI A;  4FWN A;  1T6D A;  3AAQ A;  3OYA A;  3AGR A;  4WE1 A;  3NGY A;  4HUE A;  1TK0 A;  2F8S A;  4CGH A;  4PHT X;  3HJF A;  4OVL A;  1RT6 A;  5GIP A;  3MK6 A;  3SUN A;  3AVL A;  1ZBH A;  4WCE L;  4B3T K;  4CE9 A;  4KAZ A;  1HMV A;  3ZLJ A;  1S5J A;  3DRP A;  4IDK A;  3RR7 A;  2BTF A;  4DQ8 A;  5I3U A;  4Z94 A;  4FJX A;  5SWM A;  3DWL A;  4DU3 A;  1RGI A;  5HBM A;  3CC4 N;  4CI6 A;  4O55 A;  3A5L C;  4O0J A;  3MMV A;  4JK9 A;  4B08 A;  2GV9 A;  1C0G A;  2QEX N;  1U47 A;  3FR0 A;  3AVH A;  3TAB A;  1L3S A;  4M7X A;  2X6N A;  3T3F A;  3ZET A;  4N41 A;  1ILY A;  2QWQ A;  4DSJ A;  3CJ7 A;  3EKU A;  5FPE A;  4CJF A;  4FJG A;  1Z05 A;  5LMU K;  1Z26 A;  4LF7 K;  1NGD A;  3WEE B;  4C8K A;  3RRH A;  2IDO A;  1BQM A;  3L2R A;  3Q7C A;  4ISG A;  3CFR A;  1KCF A;  3NH2 A;  3CJA A;  4BDY A;  2P9P A;  1KD1 O;  1LW2 A;  1HX1 A;  1W97 L;  2Z1I A;  5HRO A;  4M3T A;  1EO1 A;  2QK9 A;  3TAP A;  4MDB A;  1HPZ A;  3H3O B;  4K25 A;  3TAQ A;  5FPN A;  4DHY A;  1C6V A;  4N76 A;  3ZSV A;  5HP1 A;  4IO8 A;  3KVG A;  1NGA A;  1TL1 A;  4H4M A;  3MEG A;  1L3V A;  1S72 N;  4H0T B;  4F8R A;  1BOT O;  3BDP A;  1U4B A;  1U49 A;  4DR6 K;  3PX0 A;  2HNY A;  1T7P A;  4NCA A;  4AHT A;  3SZ2 A;  3GOI A;  4FM0 A;  4FJ7 A;  5AQI A;  5C0Y A;  3HP9 A;  1JLA A;  1OH8 A;  4CBU A;  1LWC A;  4MQ3 A;  4K42 A;  4FOI A;  1QQC A;  2KW4 A;  4DV0 K;  4JI2 K;  2Q36 A;  2H3G X;  4BRI A;  3IKM A;  4GKJ K;  5AQH A;  3UB5 A;  4OO1 J;  4OJR A;  1UA0 A;  5AR0 A;  2V7Y A;  1UAX A;  1WSG A;  5IT9 O;  1NGF A;  3BY5 A;  2P9S B;  3WUH A;  4GW6 A;  3HVR A;  3AVC A;  2XY5 A;  2QW9 A;  1RDC A;  5C2D A;  1HYS A;  3ZET B;  4BE0 A;  3O9S A;  2VWJ A;  1RTD A;  4PA1 A;  3ULE B;  4AHC A;  1FJG K;  2YJF A;  2G8F A;  1D8Y A;  3OJS A;  1HRH A;  4JKH A;  1KSP A;  2R7Y A;  1FK9 A;  3HRG A;  1IKY A;  2HHW A;  1JCF A;  1Z6R A;  1S9E A;  3KK7 A;  4KH4 A;  5FRM A;  2A5X A;  4BVP A;  2A1S A;  4IEE A;  4M3W A;  3EZ5 A;  1RT1 A;  2P9N B;  2BH1 A;  4FLU A;  5D3G A;  4ELT A;  4DSK A;  3DLH A;  2D4W A;  2YHX A;  3FFI A;  3E1Y A;  2ZJP L;  4FLV A;  1XC9 A;  1HKB A;  4K43 A;  3F9M A;  1KVC A;  1NOY A;  3HP6 A;  3SPZ A;  3QIO A;  1A5V A;  1NJW A;  2VGM A;  4CEE A;  4R5P A;  3AAP A;  4B3R K;  3CJC A;  2VYP A;  4CFD A;  4YY3 K;  4R79 A;  2ZQB A;  4DTJ A;  3QLH A;  2ZM6 K;  4FWS A;  3ZSZ A;  5ADX A;  4M3Z A;  3P83 D;  1LWF A;  2ASP A;  4J2A A;  3GBT A;  5CHI A;  1WSE A;  2WC9 A;  1Y64 A;  1BL3 A;  3D2F B;  4DLG A;  3ZSW A;  2VG5 A;  2XHB A;  1SL0 A;  2G8K A;  5EXW A;  1JLE A;  3ZYY X;  1VSK A;  4BDZ A;  3DYA A;  4KFB A;  4FZX C;  3QEX A;  3SYZ A;  4X66 K;  1VAZ A;  3S9H A;  3LPT A;  4CGI A;  3O9Q A;  3CM5 A;  4FLX A;  5LJV A;  1NK9 A;  4CJQ A;  5KGW A;  4E7H A;  4DWI A;  3FE1 A;  5ELZ A;  5AQJ A;  4KRE A;  1VSM A;  1QVF M;  3J7Y P;  4IOA L;  3SPY A;  1C0U A;  4NLC A;  3NMU A;  3KHY A;  4Z0U A;  4B8A B;  3QBW A;  2ZJR L;  1QVG M;  2XRI A;  4CIF A;  5DM7 L;  3P31 A;  2P9I A;  4BRH A;  3OYG A;  5J2Q A;  4DQI A;  2E1Y A;  2J4R A;  1VQK N;  1DGK N;  3AO3 A;  1WBD A;  1NM1 A;  4B9M A;  1DTQ A;  4OLA A;  4Y1D A;  3D6R A;  1RTH A;  3SLC A;  1Q86 O;  1NKC A;  5A2Q O;  4KO0 A;  2NRH A;  3THW B;  1WNS A;  4GMJ B;  2FBX A;  1NKE A;  4DV7 K;  2ZWH A;  1S3X A;  3VER A;  1YTA A;  1QQN A;  3MED A;  3TSP A;  4NCG A;  4B9N A;  3K0S A;  3MWT A;  2HHQ A;  3LDO A;  4C23 A;  2Z1G A;  1KLN A;  3IG1 A;  4NCB A;  4BQL A;  1YI2 N;  1N36 K;  4CJ4 A;  1LV5 A;  4FK0 A;  4QS8 A;  3SUQ A;  4X65 K;  4JKC A;  1MWK A;  5EOY A;  4EHT A;  3S3M A;  1JLQ A;  3C6A A;  2Q0R A;  4FJ5 A;  2I7N A;  3PIO L;  3NHG A;  3KWI A;  4OKJ A;  1CZB A;  4YOT A;  3IRX A;  4DV2 K;  5HL7 L;  2UUA K;  1NK7 A;  4JS4 A;  2E4L A;  1ITG A;  2AA4 A;  3OS0 A;  4DR3 K;  2VQF K;  4LF9 K;  2IVP A;  3EE8 A;  3LDL A;  3VEZ A;  3VEY A;  3QIN A;  1LOT B;  4JYA K;  5KRS A;  3ZEU B;  3O3G A;  4OLB A;  1N5Y A;  2P9I B;  2I5J A;  2D5R A;  1CXU A;  1RT5 A;  5F0X A;  1NGJ A;  2DFH A;  3SAG A;  4DTP A;  5AQV A;  1TL3 A;  3UKR A;  4K41 A;  4LF6 K;  3VQC A;  4CEZ A;  3SV4 A;  4DB3 A;  1EX4 A;  2GEL A;  3HVT A;  1YAG A;  4HUG A;  3ZT4 A;  5AJ3 K;  4JRQ A;  5AQW A;  1IKW A;  1Q82 O;  1XNR K;  3OBW A;  4CJ7 A;  3PLA A;  3ITH A;  3AVB A;  5AQG A;  2W41 A;  3CER A;  2Q3S A;  4AHV A;  3RRG A;  5F1X A;  5JIC A;  3AA3 A;  4CF8 A;  3LAM A;  4CJK A;  3K5N A;  3WNF A;  2ATQ A;  3DRS A;  3T1H K;  4IEI A;  2F8T A;  3IS9 A;  3QEI A;  2X74 A;  3M8P A;  1DEJ A;  3VQ4 A;  3UIQ A;  1WLJ A;  3P5J A;  3VEW A;  3F9K A;  1F21 A;  1RBU A;  4BR7 A;  2PBD A;  4CEO A;  2HF4 A;  3NF9 A;  3LDN A;  1VSL A;  4CIE A;  3ZT3 A;  3VQQ A;  4CD1 A;  1IJJ A;  4U67 L;  1YIJ N;  1BIU A;  2GX9 A;  3QET A;  4DR1 K;  1WBB A;  5LL6 Z;  4CJS A;  1K8K A;  3EY1 A;  4CHZ A;  2AP1 A;  3VQA A;  3U9Z A;  3EYZ A;  2PY5 A;  5BR8 K;  4JS5 A;  2XO7 A;  5EVZ A;  3O6W A;  3PX6 A;  1ZBL A;  3NF8 A;  1JXB A;  1TKT A;  4DLE A;  1EET A;  4CJU A;  5JS1 A;  1NBW A;  4MFB A;  2VQE K;  3NAE A;  1KLM A;  4BC2 A;  2G8W A;  3HTV A;  4E3S A;  4A59 A;  4B3O A;  4RWT A;  2Q2R A;  5J2P A;  1N8R O;  3MX2 A;  1T3V A;  3J7Z O;  4EP5 A;  1ZBU A;  4BRK A;  1YHQ N;  4CFB A;  1N6Q A;  3TAM A;  3E9L A;  1XHZ A;  2OYQ A;  3OYM A;  3SV3 A;  2RF2 A;  1ATN A;  2VWB A;  4DUY K;  2E2N A;  2BE2 A;  3HXM A;  5M1N A;  3SQ0 A;  2WUS A;  1GLL O;  3OYC A;  4WYB A;  4WF9 L;  5TKW A;  3D7E O;  2HND A;  1GLE G;  1QS4 A;  5TKY A;  4DTM A;  3QEW A;  5EY4 A;  3WXK A;  3P38 A;  3J80 O;  2O8C A;  1BO5 O;  1VRU A;  1J54 A;  4KI6 A;  4LFB K;  4BRN A;  1Q9Y A;  3U6F A;  4B1W B;  3ENB A;  2ZD1 A;  4K0K K;  3ID8 A;  1ZBI A;  3W3D A;  3VQP A;  3PSF A;  4DQQ A;  1VHX A;  4OPK A;  1QZ6 A;  1VSH A;  3ZX0 A;  2IC3 A;  3EO3 A;  3L3U A;  4FW1 A;  1T05 A;  2XY7 A;  4W5T A;  2RKI A;  1S1X A;  4ID5 A;  2YV0 X;  4GVM A;  4DV3 K;  1KFS A;  3KKS A;  2P9L A;  3ENH A;  4LSL A;  2UXC K;  4KHU A;  3CHW A;  3C0B A;  1HKC A;  4ILH A;  5BRE A;  4Z4E A;  4JI6 K;  1D5A A;  4CF1 A;  3CCE N;  1HNZ K;  5KQD A;  4PKI A;  1S6Q A;  4ILJ A;  4JV5 K;  4JI4 K;  5ADX H;  2YHA A;  3AVK A;  1KAZ A;  5AQN A;  4BG9 A;  3CIP A;  3MN6 A;  4FM2 A;  2KQ2 A;  4MLH A;  5B8H A;  1VSD A;  3OYH A;  4DSE A;  3SBG A;  5JLH A;  4JI0 K;  1U45 A;  5FPD A;  1JLG A;  4BR4 A;  1SV5 A;  3CM6 A;  1NGG A;  4OGE A;  4UY8 O;  2FBT A;  1NKB A;  3JXU A;  1LCU A;  4EFH A;  4CD3 A;  4LFA K;  1XMQ K;  2CH5 A;  5KPR A;  1NK5 A;  5J1E A;  3AVF A; 
#chains in the Genus database with same CATH homology
 4DV5 K;  4NXM K;  4JI1 K;  4DR6 K;  4DUY K;  4X66 K;  3T1Y K;  1N32 K;  4CVN E;  3J81 O;  1IBL K;  4LFC K;  4KHP K;  4DR2 K;  5LMN K;  3J7Y P;  4DV0 K;  4DR5 K;  4JI2 K;  1XNQ K;  4DR7 K;  3OTO K;  4LF6 K;  4GKJ K;  3JAM O;  5AJ3 K;  4DUZ K;  4GKK K;  4V19 S;  5IT9 O;  5FLX O;  3J80 O;  1XNR K;  4B3T K;  1I94 K;  2UXD K;  1HNW K;  4X62 K;  2F4V K;  4LFB K;  4X64 K;  1HR0 K;  4K0K K;  1FJG K;  5A2Q O;  3T1H K;  4JI5 K;  4DR4 K;  4LF8 K;  4DV7 K;  4DV3 K;  2UXC K;  4AQY K;  4OX9 K;  4JI6 K;  1HNZ K;  2UXB K;  4DV4 K;  4DV6 K;  4JV5 K;  4JI4 K;  4DV1 K;  4JI8 K;  1XMO K;  5LMU K;  4DR1 K;  4LF7 K;  5LL6 Z;  1N36 K;  4YHH K;  1N34 K;  1N33 K;  4CW7 B;  5BR8 K;  4X65 K;  1HNX K;  2UUC K;  4JI3 K;  4JI0 K;  4B3R K;  2E5L K;  4LF4 K;  2HHH K;  4YY3 K;  2UUB K;  2ZM6 K;  2VQE K;  4DV2 K;  2UUA K;  2UU9 K;  4JI7 K;  4NXN K;  4B3S K;  4LF5 K;  4LFA K;  4DR3 K;  2VQF K;  4LF9 K;  1IBM K;  1XMQ K;  4B3M K;  3J7A P;  5IWA K;  1IBK K;  1J5E K;  4JYA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...