2R7YA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords RNA (5'-R(*UP*CP*GP*AP*CP*A)-3')
publication title Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N
rcsb
source organism Bacillus halodurans
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2r7yA00
3DLEA 4LY7A 3WNEA 3SQ0A 1X9SA 2Z1HA 4BE0A 2FBTA 4NCBA 1B9FA 1BL3A 1EXQA 2B6AA 4ZTJA 1Q9XA 3PY8A 2G8IA 2ZD1A 3FFIA 4AHSA 2ATQA 3AVBA 1TKZA 4QAGA 4CGGA 1MU2A 1WSIA 4CJWA 4C8LA 4Y1CA 4DTJA 4CFBA 3L8BA 3VQBA 1L3TA 1TKXA 1T7PA 1T8EA 4TSXA 1HYSA 1RDBA 1HMVA 2IDOA 3L2UA 4BE1A 3LP0A 1FK9A 1HNVA 3LDSA 4DTXA 3KKRA 3NF8A 4FVMA 4RW8A 3SPZA 1N5YA 4FJLA 3WNFA 1NK5A 4CGIA 3L2QA 1QHTA 3ISNC 5CYMA 3OYAA 4B9MA 4KRFA 1UOCA 1JLQA 4E1MA 4M3TA 3D45A 3IS9A 1G15A 3LP3A 3SUQA 2XY5A 4CEDA 1VSLA 3PX6A 3P1GA 2QKKA 1TKDA 3QIPA 3TABA 4AHVA 1KVBA 4J2EA 4PWDA 2G8HA 4PQUA 2IOCA 2IC3A 1C0TA 1S1UA 3ZSOA 1U47A 2DFHA 3NFAA 3MEGA 4JS5A 4DTOA 2F8SA 3AVFA 4CJRA 1VRTA 3DMJA 4ID1A 4Z4GA 3QIOA 5FRNA 4AILC 1VSEA 3DLRA 2OZSA 4KHYA 4OPJA 2F8TA 3CM5A 3KKSA 2Z1GA 2VG6A 2HNZA 4FM1A 1BQMA 1GOBA 2XY8A 3S3NA 1JLFA 3AA3A 2YHBA 3PO4A 2YHAA 3MXMA 3NH0A 3ZSZA 3NF6A 3T1AA 3NGIA 2XY6A 3LPUA 4O44A 4Z4CA 3MAQA 1SKSA 5FDLA 4FJKA 4R5PA 3WNGA 1JLGA 4CIFA 4IFYA 3HT3A 3VA0A 4EP5A 1VSIA 2HNDA 3K5LA 2P51A 1QSLA 4CCHA 1BI4B 4B9LA 1XHZA 3DLKA 3ALYA 4WE1A 3NF7A 4W5NA 3V1RA 5T7BA 3QESA 4F2RA 1N6QA 3KK3A 1WAJA 3NGYA 4I2PA 4B9VA 1KVCA 4FXDA 3V1QA 3HM9A 1JLAA 1WSGA 2YKMA 2VG7A 4CFDA 4H4MA 4W5OA 3O3HA 3KK2A 3CM6A 3F73A 3HVTA 5KGXA 2PYJA 5J2PA 2IGIA 4GW6A 3P5JA 3QEXA 4Z0UA 1EX4A 1NKBA 5D3GA 2KFNA 2FBYA 4OKEA 4DFPA 2OPRA 1NK9A 1WN7A 1U49A 1ZBLA 1BIUA 3C94A 3V1OA 4Q5VA 4M3YA 4K8XA 3HO1A 2B5JA 3S9HA 5CYQA 1UWBA 3TAQA 1ZBFA 4CJPA 3ULDA 1C1CA 5CY4A 3S3MA 3K5MA 3HK2A 1YVUA 2YNFA 4E7JA 4KHUA 3G10A 2HHTA 3AA5X 3CYMA 2XY7A 1RT6A 2YNIA 3AA4A 3ZSVA 1NOYA 4F2SA 1L3SA 1SL0A 4IKFA 4CEBA 3AA2A 3BDPA 4NCAA 1J9AA 1VSJA 3THVA 2HMIA 3VQQA 3L3VA 1TK8A 4DTPA 4DQPA 3V6DA 4C8NA 3CFPA 2PZSA 3BGRA 3P83D 2KQ2A 1HYZA 1SL2A 1KTQA 1HYVA 2FBXA 1SKRA 1BQNA 4JRPA 2QK9A 4GMJB 4M3UA 3ZT2A 1RILA 5KI6A 4CF2A 1ZBHA 1RBUA 4Z4IA 5KRTA 4DQIA 4CERA 2FBVA 4DSIA 3ZT3A 2JLEA 5FRMA 1XWLA 4AHCA 3SV3A 3OVNA 1RDCA 4BWMA 2ETJA 4YFUA 4CHQA 3KK1A 3L2WA 4K8ZA 3DI6A 1TAQA 1Q8IA 1RT7A 1HQUA 1BI4A 1WSHA 3OYKA 4DFMA 4CECA 1EP4A 4CJUA 4I9QA 2I5JA 2HB5A 2NUBA 4LD0A 3SYZA 4DLEA 1BIZA 3AVMA 3VQ7A 4O4GA 4B8CA 1RTDA 3SJJA 3RR7A 5J1EA 4BWJA 3DOKA 3VN5A 2KTQA 1RTHA 3OYDA 4DTSA 4N41A 3RMCA 1TK5A 1HQEA 1QE1A 1VSFA 4CIEA 4NYFA 2YNGA 4DU1A 3G0ZA 4KTWA 3AVHA 4F3OA 2HHSA 4CHNA 5HRRA 5KGWA 4DTMA 1UA1A 2YV0X 3HVRA 2G8FA 2PY5A 1W0HA 3OYMA 3SQ4A 4Q0BA 3KLHA 2G8KA 2DY4A 3OYGA 3DLHA 1U45A 2P5OA 4CEQA 1XC9A 1IKYA 3CG7A 2QKBA 1HPZA 3NBPA 1VSHA 2HHQA 4J2DA 4LH4A 4DG1A 2OPPA 3HYFA 1S6PA 2P5GA 5SZTA 2YNHA 3QO9A 3AVGA 4DS4A 1NK7A 1X9MA 4KKOA 2EHGA 4RW6A 3VQ6A 3HPOA 1TK0A 4E19A 1BGXT 1CZ9A 4CEOA 3KJVA 4FJMA 1IH7A 4G1QA 2YKNA 3LWMA 4FJGA 2KZMA 1GOAA 1C1BA 1GOCA 1ITGA 3NGZA 5E41A 2IAJA 1JXEA 4JLHA 4UQGA 1KRPA 2OPQA 1FKOA 1S6QA 2W42A 3LAKA 3MXJA 1R0AA 1SV5A 4IFVA 1B92A 1TGOA 4OGEA 4FJXA 1JXBA 3CFOA 3VQPA 4B8AB 4OLAA 2E4LA 4M3RA 4BDYA 2FC0A 3ZT1A 4CEZA 3UIQA 4KHWA 4FYDA 4YNQA 1NOZA 4KHNA 2RF2A 4FJJA 4CGFA 1TAUA 4DFKA 2HVIA 1S1XA 3AO3A 1BISA 2F96A 4JS4A 4DQSA 4H4OA 3EYZA 2G8WA 2A1SA 4RW4A 4N76A 1YTUA 1C0UA 1W9HA 3OYBA 1IO2A 1ASUA 4FCYA 1RBRA 3KIOA 4CHZA 3V9XA 3SUPA 3AVCA 3ZT0A 4CF1A 4DU4A 4B9SA 4KV8A 4EZ6A 4DF4A 4IDKA 3K2PA 5JS1A 3TAPA 3TR8A 1BCMA 2DFEA 3O4NA 1LAVA 1ZBUA 5K14A 3ZSRA 4KHSA 3QEIA 1T03A 3L2VA 3EY1A 2OA8A 4FJIA 3VQAA 3C95A 4M3XA 2HW3A 5HBMA 3K58A 1QQCA 3AVNA 3SV4A 1X1PA 4I9LA 1JL2A 4DQRA 1U4BA 2O4IA 4CFCA 5CZ1A 1XHXA 3QERA 5HROA 3MXIA 2HHXA 1U48A 4DSLA 3H08A 4NCGA 1BCOA 2EX3A 3SI6A 1SKWA 4CESA 3RRGA 1LV5A 4ZHRA 3QEWA 1TKTA 3KTQA 3TAMA 4N5SA 4E7KA 4IG3A 1F21A 4F3TA 1IKWA 2HHWA 4Z4FA 2B4JA 3VQ5A 3ZCMA 1RBVA 3F9KA 4KREA 2DFFA 1D9FA 3TWHA 3SUNA 3C6TA 3IRXA 4CGHA 1VRUA 4CJTA 4CJKA 4CEEA 4RG8A 3O3FA 3OYFA 4HUEA 4LSLA 4FLVA 4CHYA 4FJ9A 3I8DA 2LSNA 4CF0A 1VK0A 2IS3A 3RMBA 4OKKA 3TAEA 3LWLA 5HP1A 3K5NA 1WLJA 1REVA 3SPYA 1L3VA 1J5OA 3ZT4A 1VSMA 1TVRA 4AHTA 2ITGA 3TI0A 4KTZA 1DTQA 4FLTA 3T3FA 4FLXA 3LP2A 3QLHA 3AVLA 3LPTA 5I3UA 2BE2A 3U3GA 3V9SA 3WNHA 5J2NA 3QETA 1NJWA 4O55A 2Z1JA 4C8MA 4M41A 3PV8A 4L8RB 3KLIA 4AH9A 3U6FA 1D5AA 4CJSA 1KVAA 1DTTA 5C25A 4C8KA 4M3ZA 4QCLA 3TARA 3L3UA 4N56A 2GBZA 4EP4A 3NCIA 1S9EA 3B6OA 4W5QA 4E0DA 4CFAA 3OYJA 2HNYA 3RR8A 4DSEA 5I42A 1ZBIA 2OPSA 1WSEA 4DQQA 1NK6A 5CZ2A 3K59A 2BANA 4DS5A 3M8PA 2AJQA 2D5RA 4BACA 4I7FA 2VWJA 5J2MA 1TV6A 4OPKA 4DU3A 4ZTFA 2VWKA 2Y1IA 4CEAA 4KO0A 4B9TA 3DRPA 4J2BA 3DLBA 3MECA 1LW2A 1B9DA 4CF8A 1Z25A 1LWCA 4ELTA 1SL1A 4F4KA 1A5XA 4ELVA 1WNSA 4HHTA 1ASWA 3AO1A 3NHGA 1CLQA 5SWMA 4KAZA 1NJXA 4FLUA 1HRHA 3KD1E 3OYIA 1J53A 4CGDA 3OS2A 4HUFA 3SQ2A 2KFZA 3I0SA 1NJZA 1RBSA 4RW9A 4RW7A 5C42A 3OYHA 3NAEA 3DOLA 1RT3A 4IG0A 3VQ4A 2G8VA 4O0JA 3NF9A 4Z4HA 4MFBA 1K6YA 3T19A 4CGJA 3ASMA 3M8RA 1U04A 3O3GA 2E6MA 3HXMA 3V9UA 5KRSA 5KTQA 2KW4A 5HRPA 4ICLA 1XI1A 1NJYA 2DTUA 4FLWA 5JS2A 2G8UA 4KB1A 3HJFA 5FROA 2ZE2A 4CHPA 3K57A 5DMRA 3RMDA 4KTQA 4M42A 1RDAA 4DF8A 1IKVA 1C1AA 1JKHA 1KCFA 3LANA 2X6SA 4OVLA 5HRNA 3ZSQA 3ZSXA 3NH1A 3HP6A 3CQ8A 3RTVA 1X9WA 1C0MA 1J54A 1D9DA 3OYCA 1EKEA 3QEPA 3I0RA 1Z26A 4DSKA 4KHQA 4DMNA 2XHBA 3U3YA 1QS4A 3LP1A 4BDZA 1NK0A 4Z4EA 3NH2A 3QEVA 4EZ9A 4E7LA 2D0CA 1D8YA 4OKJA 1S1WA 1I3AA 4C8OA 4CK2A 3JYTA 4DTRA 3VQEA 3SNNA 1QSSA 2Y1JA 1L3UA 1SUQA 2QXFA 4XIUA 3OYNA 4HCCA 4FW1A 5DK5A 4FZXC 2HHUA 1LWEA 1KFDA 4DTNA 3IAYA 3AO5A 4DSFA 1YTAA 4HCBA 3HL8A 4Y1DA 4PY5A 4J2AA 1FKPA 1QTMA 4DLGA 2WONA 3AVJA 3TAFA 2PYLA 4ID5A 3OJUA 1A5WA 4HTUA 2Q3SA 4H8KA 4FZYA 4DWIA 4FJ7A 4W5TA 1RDDA 1EETA 1RT1A 1CZBA 2X78A 4FJ5A 4CJ3A 4MQ3A 5C24A 3PO5A 4AHUA 4FJHA 3VQDA 3B6PA 1UA0A 2HHVA 2E6LA 1RT4A 4HUGA 4FLZA 3VQCA 4FK4A 4B9NA 1JLCA 2RN2A 1A5VA 4FJNA 1RBTA 4OJRA 3AVKA 4FLYA 3VQ9A 4CJLA 4E7HA 4W5RA 1CXQA 2VG5A 4PA1A 3V81A 3SUOA 4IBNA 5HLFA 1S1TA 3OJSA 3VQ8A 1C6VA 4KFBA 4DFJA 3PX0A 3KLGA 4FK0A 3AO2A 3DYAA 3RWUA 4FZZA 1IKXA 1Q9YA 3CFRA 3S3OA 1LAWA 4NYNA 3AO4A 3DM2A 2HVHA 4N47A 3PX4A 4CK1A 1LW0A 3KLFA 2OYQA 4I2QA 1HJRA 3L2RA 1JLBA 4CK3A 3ZSWA 3LAMA 4OLBA 3OYLA 1I39A 4CIGA 1TL3A 4HVJA 4E7IA 4E3SA 1S5JA 2XRIA 4FM0A 1NKEA 3QNOA 2KZZA 1ASVA 4KI4A 1RTIA 2ZQBA 2O4GA 4BDPA 2JGUA 4QOZB 4PUOA 4E89A 3QINA 1T05A 4O5BA 1KFSA 2BGGA 3V9ZA 2D0AA 2X6NA 1FXXA 3OYEA 1CXUA 2GUIA 2XO7A 4B9UA 1S9GA 1TL1A 3SZ2A 1WSJA 4F8RA 3E01A 1NK8A 1RTJA 2GV9A 3OS0A 4CHOA 1RNHA 1LWFA 1YT3A 4E1NA 3M8QA 1RT5A 2X74A 1L5UA 3AV9A 2BDPA 1DLOA 1HNIA 3EZ5A 4CJVA 5HRSA 1JLEA 1BHLA 4CJQA 4B3OA 4M45A 3NDKA 4GVMA 3NE6A 4KI6A 1QSYA 3KD5E 1S1VA 1KLMA 2RKIA 4CJ4A 1WSFA 3QNNA 4OGCA 4AHRA 3ZSYA 3LALA 4B08A 3DRSA 2P1JA 1KSPA 2R7YA 3V9WA 3KLEA 3V4IA 3PUFA 4CE9A 1RCHA 4FK2A 3DRRA 3MEEA 4CJ5A 4BE2A 3K5OA 3MEDA 4LH5A 3SCXA 1JL1A 2OZMA 3ITHA 4CEFA 3RRHA 3LZIA 3SQ1A 2WOMA 3C6UA 4M3WA 4ELUA 1WAFA 4KPYA 3TAGA 3JSMA 1O1WA 1NK4A 3IG1A 2Z1IA 4LSNA 4FM2A 4KB0A 3AVAA 1KLNA 3M8SA 3AVIA 1VSDA 1UAXA 3OY9A 1ZYQA 3HP9A 3LZJA 4DTUA 3O4QA 1IG9A 4DSJA 1NKCA 3VA3A 4FW2A 1VSKA 3TANA 3HPHA 5J2QA 2A1RA 1Y97A 3D0PA 4CJEA 4CF9A 1RT2A 4JRQA 3RMAA 4FJ8A 3HPGA 3A2FA 5EU7A 3DLGA 4CJFA 4O0IA 3HSTB 2D0BA 2RPIA 3OS1A
chains in the Genus database with same CATH superfamily
4IDHA 3R6MA 4IJNA 4BE0A 2FBTA 1NGDA 2B6AA 2UYTA 4JI1K 3M3ZA 1QZ6A 2ZD1A 4JI4K 1NM1A 4QAGA 4CGGA 3UE5A 4X64K 3M5RA 4C8LA 1T3VA 4CFBA 1L3TA 1TKXA 4MDAA 3SPZA 1N5YA 1N33K 4JKBA 2NRTA 3D2FA 3L2QA 1QHTA 3ISNC 3CJ7A 4IEIA 3P4IA 3AY9A 4OX9K 4UY8O 3LP3A 2XY5A 4CEDA 1VSLA 4IOCL 1HX1A 2QKKA 1TKDA 2AP1A 1KVBA 4DCHA 2G8HA 1XNRK 2IOCA 2IC3A 1C0TA 3SAFA 4JS5A 1E3MA 4GV3A 1V4SA 4ID1A 3QIOA 4JNEA 4OPJA 2F8TA 4R79A 2VYPA 2Z1GA 2HNZA 4FM1A 3J7AP 1GOBA 4BRHA 3OTOK 1HLUA 3CIPA 3NH0A 3ZSZA 4Z4CA 3IDHA 4RCHA 4A2BA 1JLGA 4CIFA 3TSQA 1BG3A 2HBKA 3VA0A 4EP5A 3K5LA 4XH4A 5BREA 4CCHA 2J4RA 4W5NA 1BWFO 3N4PA 3ULEB 3KK3A 1WAJA 1KVCA 4B3MK 2FSKA 2PYJA 3GOIA 5J2PA 3KZBA 2IGIA 3CF5L 1NGGA 3WT0A 5D3GA 4OKEA 3K0SA 1U49A 3V1OA 4B1WB 4K8XA 4GV9A 1XNQK 2B5JA 2FF3B 3A5MC 4V19S 3ULDA 2QM1A 4DHYA 1YVUA 2YNFA 4E7JA 1OH6A 3HK2A 1OKJA 3G10A 3CYMA 2XY7A 3ZSVA 1YUWA 1HNXK 3THVA 3VQQA 3L3VA 4DQPA 4C8NA 3L6QA 1X3NA 3O6WA 3P83D 4O5FA 4XH5A 2BH1A 1BQNA 2ZGZA 4JRPA 2QWPA 3VEZA 1RILA 3ZT2A 4CF2A 1ZBHA 1WBDA 2NZTA 1QVGM 4O8UA 4CERA 2FBVA 4DSIA 2UXCK 2OCEA 1XWLA 3OVNA 1TYQA 5AZJB 3KK1A 1BUPA 3DI6A 5AQLA 1GLLO 4BG9A 4BGBA 3I55N 4CI6A 4CD3A 1RTDA 3SJJA 3DOKA 3VN5A 4IOAL 2GEMA 1HQEA 1MWKA 2P9LA 4A5AA 5BN8A 4KTWA 4DTMA 3HVRA 5JLHA 3OYMA 5AFUA 2E8AA 1XC9A 1IKYA 3CG7A 3NBPA 3BY5A 5JICA 4J2DA 1ATSA 4LH4A 3VGKA 4DG1A 3QO9A 4DS4A 1X9MA 3GDQA 3VQ6A 2BUPA 1BGXT 4BRMA 4PKIA 2KZMA 3I8BA 1ITGA 4JD2A 4C23A 3FFKB 3SMPA 4CZGA 1R0AA 4OGEA 4OLAA 4B8AB 5LY3A 4BRKA 1TAUA 4DFKA 2HVIA 2QA4N 3AO3A 1BISA 3IUCA 4DQSA 2G8WA 4H4OA 4CJ7A 2A1SA 4RW4A 2NRHA 1N32K 3AGKA 1ASUA 1MWMA 4CHZA 4WCEL 4PKGA 4EZ6A 3UKUB 3SBGA 5JS1A 1VHXA 1BCMA 2DFEA 3O4NA 3ZSRA 4E1JA 3CERA 3U8XA 3QEIA 1FJGK 2OA8A 4M3XA 5HBMA 3PSFA 1EQYA 1U4BA 2O4IA 5HROA 3MXIA 2QWRA 3H08A 3DAWA 1LV5A 3C65A 3QEWA 3TAMA 4X65K 2W6KA 3QFUA 3LDNA 4LFBK 1IKWA 1QQNA 1RBVA 2WUSA 5JVHL 3HM8A 4CJTA 4CEEA 3OYFA 4FLVA 4CHYA 4FJ9A 3I8DA 4DV4K 2LSNA 4CF0A 4WFNL 1VK0A 5AFUH 5BPMA 3CJCA 5HP1A 1L3VA 5AQXA 2P9KA 3ZT4A 1TVRA 5EVZA 1NG9A 4AHTA 2ITGA 2E2QA 2O8EB 3TI0A 1J6ZA 4KTZA 5E84A 1DTQA 3A5NC 4FLXA 5FLXO 5I3UA 3U3GA 5J2NA 1NJWA 4H5RA 4M41A 5AJ3K 1D4XA 2OTJN 1KVAA 1DTTA 5C25A 4M3ZA 1XMOK 3TARA 3L3UA 2GBZA 3O5BA 4EP4A 4EHUA 3G4SN 4E0DA 3LDOA 4JI8K 2HNYA 2OPSA 1NK6A 1NNEA 5CZ2A 3K59A 3M8PA 2AJQA 2D5RA 2ZWHA 5J2MA 3T69A 1U2VB 4KO0A 5DM6L 4XH1A 1KQSM 1B9DA 2UU9K 1A5XA 1T44A 4WQ4A 2PBDA 3KD1E 1J53A 4CGDA 1XC3A 1E4FT 3I0SA 4RW7A 3OYHA 4IG0A 2G8VA 3VQ4A 1SS6A 4MFBA 3T19A 3M8RA 3O3GA 3HXMA 5KTQA 5HRPA 4ICLA 3MCPA 4JKFA 4FLWA 5FROA 1VQKN 4DF8A 3NH1A 2X6SA 3RTVA 2QTDA 4DSKA 3QEPA 3I0RA 4I6MA 4DMNA 3DXMA 1QS4A 2YHWA 4BDZA 3NH2A 5KPZA 4EZ9A 2Q2RA 2D0CA 1KAXA 4OKJA 3HZ6A 1JJ2M 1L3UA 2QXFA 5AQPA 5JVGL 5DK5A 3CC2N 1N8RO 1YTAA 4HCBA 3VEOA 1FKPA 1ZXOA 2CGJA 4HTUA 3QFPA 2Q3SA 2QWQA 4W5TA 1CZBA 4KH4A 4CVNE 2FSNA 4YORA 4K42A 2E6LA 3VQCA 4FK4A 2RN2A 2NRZA 4FLYA 3VQ9A 4CJLA 4W5RA 4PA1A 3VF6A 3CXCM 2IVOA 3KLGA 3CFRA 4NYNA 4I2QA 5E26A 4DKWA 2P9UA 1I39A 3W0LA 4E3SA 2VGMA 2HF3A 2WBNA 5GADP 4KI4A 2Q0RA 2JGUA 4IZ9A 4MDBA 3QINA 3FR0A 5CHIA 5GIPA 3G6EN 3EZWA 1JCEA 2XO7A 1S9GA 1TL1A 3L4QA 3SZ2A 3A0IX 1W2BM 2E20A 2GV9A 2EWSA 4CHOA 1LWFA 4A62A 2X74A 3AV9A 1HNIA 2GELA 4B3OA 4BQLA 4CJQA 1VAZA 5GINA 2HOEA 2O8FB 1WSFA 3IFRA 4AHRA 4LFCK 3V4IA 2OZMA 4CD1A 3K5OA 4LH5A 3ITHA 2WOMA 2P9IA 4WF9L 1P90A 5LJWA 2GWJA 5M1FA 3CI5A 2YJEA 3CCVN 1KLNA 4ISFA 1VSDA 3O4QA 4DSJA 1WBBA 3VA3A 4JKCA 2E88A 5J2QA 3D0PA 4CJEA 3EKUA 3A2FA 4BRGA 4O0IA 4NLBA 3VMFB 5M1QA 4N5SA 3OS1A 3CMAN 3DLEA 3RSEA 2Z1HA 4H0VB 3O08A 1EXQA 4A5BA 4DR7K 1Q9XA 3PY8A 2ZF5O 1C0GA 2ATQA 3SAGA 4YHHK 4CJWA 2PFUA 2E2NA 4K43A 5AQIA 3BZKA 1RDBA 4DUYK 1HMVA 2V52B 2IDOA 3L2UA 4BE1A 3LP0A 1HNVA 3LDSA 3KKRA 4JI0K 1RFQA 1YF5L 3WNFA 1NK5A 5CYMA 3OYAA 1ATNA 4KRFA 1UOCA 3D45A 3MK6A 4KHPK 1G15A 1X3MA 1OVQA 3P1GA 3QIPA 1BDGA 3H1QA 4J2EA 4PWDA 5AZIA 1NMNA 3ZSOA 1S1UA 2OZSA 3T7ZA 3NFAA 2F8SA 4CJRA 3DMJA 3FZHA 5FRNA 3PSIA 4LFAK 3WXIA 2Q31A 2VG6A 1BQMA 1NJIO 2YHBA 1OH7A 3MXMA 4JI6K 3NGIA 3LPUA 4O44A 5AZJA 3FZFA 5FDLA 4R5PA 3THWA 4IFYA 3ZEUB 4B3TK 2KKZA 1TUUA 4B3SK 1QSLA 3C0BA 2W40A 4B9LA 4YOTA 1I94K 3ALYA 2H3GX 5T7BA 2OTLN 1N6QA 3VEXA 1OH8A 4B9VA 4I2PA 4FXDA 3V1QA 2YKMA 4NLCA 1M90O 4H4MA 5KGXA 2GWKA 4DB3A 2CH6A 5ELZA 2VCPA 3AGRA 3LDLA 4BREA 3THXA 1WN7A 1ZBLA 1HNWK 2WTUA 1UWBA 4CJPA 3O80A 5CY4A 3F5TA 1ESVA 4FWMA 4KHUA 3VPZA 4DV5K 1JCFA 1RT6A 2YHYA 3CC4N 3NMUA 4CEBA 3AA2A 3BDPA 4YDUA 1J9AA 1VSJA 4JKGB 4PHTX 4DTPA 3HTVA 5AQUA 3BGRA 2QEXN 2KQ2A 1SL2A 4BR7A 5KPRA 2Q36A 2YX6A 4GMJB 4WQ4C 3THYB 1O13A 4GY2B 1GLBG 4X66K 3BEXA 4AHCA 3L2WA 4YFUA 5C2FA 1VQ8N 1QHAA 4ILJA 1Q8IA 1BI4A 4DFMA 4JAXA 3SMSA 1EP4A 2P9NA 4B1XB 1JCGA 3F2KA 3TTDA 3VQ7A 4O4GA 1XMQK 3WXLA 4BWJA 4BY9C 4FVUA 1RTHA 2QWNA 3RMCA 4CIEA 4DU1A 3OA9A 3O9QA 4JK8A 3EE8A 3WXJA 4F3OA 3FZLA 2YV0X 2G8FA 4IEEA 2PY5A 2HF4A 4BRAA 4NO7A 3HRGA 3TPQA 4IXCA 3OYGA 3DLHA 1VQ7N 4CEQA 2QKBA 1HPZA 4JEPA 3BP8A 1NLVA 3UKRB 1S6PA 2ASMA 3CQYA 3R9PA 3AVGA 1NK7A 1KAYA 4LF8K 1IH7A 4G1QA 4JKDA 5KQDA 2IIRA 2HBMA 1GOCA 4BQZA 3BUZB 5E41A 1JXEA 1KRPA 1KD1O 1FKOA 1GLDG 2A41A 4IFVA 1B92A 1TGOA 4FJXA 1JXBA 3CFOA 4K25A 1GLJO 2RF2A 4KH5A 3OBWA 2W6LA 4JS4A 4N76A 4DR3K 3VENA 4QS8A 3CJ9A 1MA9B 4B9SA 4DU4A 2O8CA 4KV8A 3H45C 3ATUA 3GG4A 3CC7N 4IDKA 2F9TA 3TAPA 4GVEA 1Y64A 4BRLA 4WQ5A 4KHSA 3EY1A 3VQAA 3C95A 4AM7A 3K58A 3S41A 3AVNA 3ZETB 3SV4A 5FPNA 5AQQA 4JK9A 4DSLA 4CZKA 1BCOA 3RRGA 2P9SA 4ZHRA 3KTQA 4E7KA 1Q7YO 4F3TA 3MN6A 3VGMA 3VERA 3SUNA 4YOUA 5JLFA 4HUEA 2A3ZA 4LSLA 4BRDA 4OKKA 3TAEA 3K5NA 3SPYA 1VSMA 3H46O 4CBWA 3I33A 1WUAA 3T3FA 3U9ZA 3QLHA 2BE2A 2HBJA 3QETA 3BF1A 4AH9A 3U6FA 1D5AA 4QCLA 5GAHP 3O4WA 4C8KA 4N56A 4W5QA 3PIOL 4CFAA 3OYJA 3RR8A 3KHYA 3D2EB 1BA1A 2BANA 3EL2A 2VWJA 4DU3A 1TUYA 1W97L 2VWKA 2Y1IA 3DRPA 4J8FA 3MECA 3U9DA 4CF8A 4A57A 1LWCA 5KPTA 4ELVA 1WNSA 4BC4A 4HHTA 1BU6O 3AO1A 2QW9A 1NJXA 4FLUA 3O9SA 4DR2K 4K41A 2GX9A 4BVOA 3NAEA 4PKHA 1P8ZA 3SK3A 5AQKA 3C6AA 3DLLL 2KW4A 4DR4K 1XI1A 1NJYA 2O8DA 5TKYA 1K8AO 5JS2A 2G8UA 4KB1A 1XQSC 5GAEP 3EE9A 3HOSA 4KTQA 1RDAA 1IKVA 1JKHA 1KCFA 5HRNA 1J5EK 3ZSQA 3ZSXA 2D1KA 1X9WA 2CH5A 3OYCA 3CCQN 2ASPA 2XHBA 4KHQA 4Z4EA 3LP1A 4A61A 3QEVA 5AQYA 1S1WA 2IVNA 3CJ1A 3JYTA 4DTRA 4IOXA 3VQEA 1QSSA 2Y1JA 4AQYK 1SUQA 3OYNA 4FW1A 2O8FA 2HHUA 1LWEA 3WEEB 4JI7K 4DTNA 4FWSA 3AO5A 1OVYA 3C7NA 3ID6A 4Y1DA 3SAHA 2GTDA 2WONA 3TAFA 5FPEA 5TKWA 4H5TA 4FJ7A 1ATRA 2NRWA 2F4VK 4HTLA 2X78A 3ENBA 4CJ3A 3AAPA 1YIJN 4FLZA 3MWTA 1K8KB 1YAGA 3GL1A 5C12A 4E7HA 4L3QA 2VG5A 4IBNA 1S1TA 4H5VA 3OJSA 4M7XA 3B8AX 2ZGYA 3A5LC 1Q81O 4CK1A 1LW0A 4OLBA 1TL3A 4E7IA 3QMLA 2XRIA 3VF2A 4YDUC 4JKEA 1ASVA 1RTIA 2ZQBA 1R59O 2KHOA 3KWIA 4H0OA 2D0AA 1FXXA 1CXUA 3E9OA 1WSJA 1NK8A 4CZJA 3OS0A 4JI3K 1IV0A 1RNHA 4E1NA 3M8QA 1L5UA 5EXWA 3D2FB 2BDPA 1VQ4N 2O8BA 1JLEA 2NNWA 5AQOA 3HSCA 3M6GA 3NDKA 1QSYA 1S1VA 1KLMA 4CJ4A 5AR0A 4OGCA 3DRSA 5AQVA 3V9WA 4H03B 3KLEA 4CE9A 1EO1A 3MEEA 4CJ5A 4BE2A 4BVPA 3CCMN 2P9PA 4WYBA 4M3WA 4KPYA 3TAGA 2Z1IA 4FM2A 1YI2N 1HKBA 2F9WA 3M8SA 5AQWA 3OY9A 4BC2A 4BR0A 1ZYQA 4GKJK 1K9MO 3LZJA 4FW2A 1VSKA 2A1RA 2UUCK 1Y97A 3HBTA 4CF9A 4CJFA 5AQJA 3WNEA 4LY7A 3QB0A 3WQUA 4NCBA 1B9FA 4X62K 4ZTJA 5C10A 2PAVA 4JI5K 1MDUB 5AQGA 1IBLK 3AVBA 1TKZA 5AQFA 1MU2A 1WSIA 3GE1A 4FWLA 1IBKK 1ZC6A 1T7PA 1T8EA 4BROA 1FK9A 4FVMA 4RW8A 4FJLA 4JHDA 4AF1A 4FSVA 5H1SQ 3SUQA 4BRPA 3PX6A 3CCSN 2UUBK 3TABA 4DR5K 3VOVA 4PQUA 2DFHA 3MEGA 4WQ5C 3AVFA 1WB9A 1FW6A 1VRTA 4Z4GA 4IJAA 4Z94A 3KKSA 3S3NA 2XY8A 1JLFA 3AA3A 3P38A 3P31A 3R3LA 3NF6A 3T1AA 3MAQA 4FJKA 2QWLA 3WNGA 4CBUA 3KK7A 1VQNN 1TYQB 1VSIA 2HNDA 5JMVA 2P51A 4FWPA 2QI2A 1EWQA 3J7ZO 3DLKA 1HKCA 3I56N 4WE1A 3V1RA 2QXLA 3QESA 1JLAA 2VG7A 3F73A 4W5OA 3KK2A 3HVTA 4FPBA 2P9LB 4GW6A 4Z0UA 1EX4A 1NKBA 2KFNA 5C0YA 4DFPA 2OPRA 1NK9A 1M1KO 1BIUA 4M3YA 4DV3K 3S9HA 5CYQA 5A2QO 3BZCA 3MCAB 4BG8A 3S3MA 3K5MA 4DV2K 1NMDA 3O9UA 3AA5X 4CZEA 2RHKA 2CGKA 2YNIA 4DR1K 1NOYA 4F2SA 1L3SA 1SL0A 4IKFA 3R1XA 5LMNK 4NCAA 4G9ZA 1E4GT 1TK8A 4BRIA 2PZSA 3CFPA 1YITN 2E2OA 4JD2B 1HYVA 1SKRA 2QK9A 3L4IA 3A8YA 1RBUA 4Z4IA 5KRTA 4DQIA 2YI1A 2JLEA 5FRMA 1EWRA 4CHQA 3OHRA 4FPAA 1RT7A 3O9TA 4H0YB 3J8AA 2V7ZA 4I9QA 1DEJA 2I5JA 2HB5A 2NUBA 4LD0A 3FGUA 4DLEA 1BIZA 3ULEA 4B8CA 4EFHA 3RR7A 5J1EA 2KTQA 3OYDA 4DTSA 4N41A 1QE1A 5CE3A 2YNGA 4H0TB 4ISEA 5C15A 3AVHA 2HHSA 5KGWA 1W0HA 4MO4A 1QVFM 2DY4A 1VSHA 2D0OA 3W3DA 5M1PA 2HHQA 1NGAA 2OPPA 2P5GA 5SZTA 3T1YK 3NVKA 4LF9K 2EHGA 5AQSA 1TK0A 4CEOA 4FJMA 1NGHA 2RE2A 2YKNA 3QBXA 3KWGA 2IAJA 2OPQA 2P9KB 4B1UB 3LAKA 2FLOA 1SV5A 4B1ZA 4BDYA 2FC0A 3ZT1A 4CEZA 4KHWA 4FYDA 4YNQA 3VTIA 4DV7K 4CGFA 1LCUA 1S1XA 1W9HA 2Q1NA 1DKGD 3CPEA 3D2EA 1IO2A 5IT9O 4FCYA 3SUPA 1RBRA 1NGCA 3KIOA 4EIAA 3ZT0A 4FOEA 4LF6K 4DF4A 3K2PA 1KXPA 1LAVA 1ZBUA 1ZBSA 4MLHA 3L2VA 5LL6Z 4EAHD 4FJIA 4IO8A 4FO0A 1QQCA 3H3OB 3SLCA 4C1NK 5F1XA 4CFCA 5CZ1A 1XHXA 4WFBL 3QERA 2KLAA 3M1FA 3MX5A 4DUZK 1SKWA 1TKTA 4IG3A 3E66A 5AQMA 2I7PA 2HHWA 2B4JA 5M1OA 3ZCMA 2E2PA 2WFBA 1D9FA 4CGHA 4CJKA 4RG8A 4KBOA 4BC3A 5BRDA 2ITMA 2IS3A 3QDKA 4NXMK 2YJFA 3LWLA 1WLJA 4GV6A 4QS9A 4BRQA 4RTFD 3MMVA 4FLTA 4I6MB 3DXMB 3H1VX 1GLEG 4O55A 3PV8A 2WC9A 3KLIA 2I7NA 3AARA 3H3NO 1YVNA 3NCIA 3B6OA 3VTHA 2VQEK 1XUPO 2D4WA 3HOTA 2F7TA 1ZBIA 3UKUA 4CBXA 1H1VA 4BACA 4I7FA 4A2AA 4OPKA 2ZM6K 4BGAA 4CEAA 1HR0K 4J2BA 3DLBA 1Z25A 5EOYA 5BR8K 3NHGA 5SWMA 4KAZA 2A6AA 1HRHA 3OYIA 2KFZA 3VGLA 3D6RA 1NJZA 4RW9A 3CCLN 3V9UA 3J81O 5AQTA 2P9UB 1S72N 4CHPA 3K57A 3RMDA 2Q97A 4M42A 4H0XB 1C1AA 3VF4A 3LANA 4H5NA 4OVLA 3HP6A 2O8EA 1QQOA 2JWKA 1D9DA 3J80O 1EKEA 3G71N 4CZFA 3U3YA 4QOZB 1NK0A 1YJWN 4E7LA 3ZX0A 1OH5A 4ILGB 3VEVA 3SNNA 1GLFO 3ID8A 4XIUA 4FZXC 3MX2A 3CCRN 1KFDA 2BTFA 4PY5A 5F2RA 3FLCO 1QTMA 4DLGA 3AVJA 2Q0UA 1RDWX 4ID5A 3OJUA 4FZYA 1U2VA 4YOYA 1W7AA 4FJ5A 2P9IB 1S3XA 4MQ3A 5BN9A 5C24A 5F0XA 3OBYA 3VQDA 3B6PA 3Q7CA 4MLEA 1UA0A 4FJHA 1RT4A 3AAQA 4B9NA 1JLCA 1VQLN 2W41A 3ATVA 3AVKA 3SUOA 5HLFA 3P39A 4DFJA 3VQ8A 1C6VA 4QS7A 2FXUA 3PX0A 4FK0A 4M3UA 3AO2A 3DYAA 2G8IA 1IKXA 5KQ8A 1Q9YA 3S3OA 1LAWA 3FE1A 3DM2A 3PX4A 1Z05A 2OYQA 3RSEB 3L2RA 3WUHA 3ZSWA 3OYLA 4CIGA 1S5JA 1T6DA 4ILHA 3QNOA 4XEIA 2O4GA 4BDPA 4PUOA 2IVPA 4E89A 1T05A 4ISGA 1KFSA 2BGGA 3V9ZA 3K9KA 2X6NA 3OYEA 2GUIA 5AQRA 4EHTA 5B8HA 4F8RA 3J7YP 3E01A 1RTJA 5HL7L 2ZJPL 1YT3A 1RT5A 1DLOA 5HRSA 1BHLA 1S22A 3NE6A 4GVMA 3KD5E 4CZLA 3QNNA 1VQ6N 3ZSYA 3LALA 4B08A 3VEYA 2P1JA 2R7YA 5AZIB 4FK2A 3DRRA 4CEFA 3RRHA 3SQ1A 4ELUA 1WAFA 2OANA 1C0FA 4H5WA 3JSMA 3IG1A 5AQZA 4KB0A 1HUXA 3AVAA 2A40A 3WXMB 4LF4K 3HP9A 5DM7L 3PIPL 3ZLJA 1NKCA 3ZX2A 4NXNK 4OPHA 3THWB 3HPHA 4B9QA 1RT2A 3RMAA 3HPGA 4JV5K 5EU7A 3DLGA 2RPIA 3SQ0A 1HPMA 1X9SA 4IO9L 1KAZA 1IBMK 1BL3A 3DXKB 1WOQA 2QWMA 2A5XA 3CJAA 3FFIA 4AHSA 3LDQA 4LF7K 4DV1K 4FWOA 3O8MA 4Y1CA 5ADXA 4DTJA 3L8BA 3VQBA 4TSXA 4LF5K 1HYSA 4BR9A 4DTXA 3THXB 1IJJA 3NF8A 4GNIA 3TSUA 4CGIA 4JI2K 1Q86O 4B9MA 1JLQA 4E1MA 4M3TA 3IS9A 3DWLA 5BRFA 2HHHK 4AHVA 1LOTB 2E1ZA 3T1HK 2AA4A 1U47A 2FF6A 4DTOA 2D0PA 4FWQA 4JKHA 4CZHA 4AILC 1VSEA 3DLRA 4KHYA 1SZ2A 4IWVA 3VETA 3CM5A 3CCUN 3O1WA 3PO4A 2YHAA 2XY6A 1SKSA 3ENHA 4BRFA 3EO3A 3C6HA 3HT3A 3G25A 3CQXA 1N34K 1BI4B 1XHZA 4M63C 3O1BA 2P9NB 3NF7A 3SBTA 4F2RA 4U7BA 1NGIA 3NGYA 3HI0A 2YCHA 4FWKA 3HM9A 1WSGA 4CFDA 3O3HA 3LL3A 3CM6A 4YOXA 3P5JA 3QEXA 2FBYA 4FWNA 3C94A 4Q5VA 3HO1A 1HKGA 4BR5A 2NRRA 3TAQA 1ZBFA 4GKKK 1C1CA 4BRCA 1HNZK 3E1YA 2HHTA 3AA4A 5ADXH 2HMIA 2YHXA 3V6DA 1BOTO 1Z6RA 1HYZA 1DT9A 4BR2A 1KTQA 1YHQN 2FBXA 4DV6K 5KI6A 1IG8A 4B1YB 3DJCA 3QBWA 2QWOA 3ZEUA 3ZT3A 3SV3A 4K8ZA 1RDCA 4BWMA 2ETJA 5MLCQ 1TAQA 1HQUA 1WSHA 3OYKA 2ZJRL 4CECA 3WQTA 2O8CB 4CJUA 3TTFA 4OO1J 3SYZA 3AVMA 4DV0K 5FPDA 1NGEA 1TK5A 5AQNA 1VSFA 1T6CA 4H0PA 4NYFA 3G0ZA 4CHNA 5HRRA 3EKSA 1UA1A 1VQ9N 3SQ4A 4Q0BA 1NGJA 3KLHA 2G8KA 1CZAN 2P9SB 3WXKA 1U45A 2P5OA 3E9LA 4JKAA 2HMPA 5M1KA 3HYFA 3H6EA 2YNHA 1SQKA 4KKOA 4RW6A 3HPOA 4E19A 4FL9A 1CZ9A 3KJVA 4JKGA 4BRNA 2A42A 5BR9A 3LWMA 4FJGA 1GOAA 1C1BA 3MN9A 3NGZA 4UQGA 4JLHA 3EN9A 4O8KA 4AM6A 1S6QA 3LM2A 4JN4A 1RGIA 2W42A 1BO5O 3MXJA 3TTCA 3CMEN 4C1NI 3THYA 3VQPA 3BF3A 2E4LA 4M3RA 3UIQA 1NOZA 3CHWA 4KHNA 4FJJA 2UXBK 4K0KK 3MWPA 2F96A 3EYZA 1YTUA 1C0UA 3OYBA 2UUAK 3CPWM 4B9TA 3V9XA 4CZIA 3AVCA 4CF1A 1YJ9N 1RDUA 3CJBA 2ZJQL 4YOVA 2HSTA 3TR8A 5K14A 3RVCA 1T03A 2HW3A 1X1PA 3JS6A 4I9LA 1JL2A 2V7YA 4DQRA 2VQFK 5IWAK 4B3RK 2HHXA 1U48A 3KVGA 1U6ZA 3L0QA 4NCGA 2EX3A 3SI6A 4CESA 4BC5A 5AQHA 4A59A 1VQMN 1F21A 3UKRA 4RWTA 4Z4FA 3VQ5A 3UB5A 3F9KA 4KREA 2DFFA 4DQ8A 3TWHA 3C6TA 3IRXA 1VQ5N 1VRUA 2O8DB 3O3FA 1BA0A 3K9JA 2V51B 3JAMO 3RMBA 1REVA 4B1VA 1J5OA 1NWKA 3GBTA 1KC8O 5LJVA 3LP2A 3AVLA 3LPTA 3OW2M 4FWRA 3V9SA 3WNHA 4C8MA 2Z1JA 4L8RB 2ASOA 4JK7A 4OPAA 4CJSA 3MN7A 1YXQA 1S9EA 4NB4A 3C7NB 4DSEA 5I42A 3CCJN 1WSEA 4DQQA 4DR6K 4DS5A 2UXDK 3JXUA 3TSPA 1ILYA 1TV6A 4YY3K 4ZTFA 3ZETA 3VESA 1LW2A 1G99A 3Q7BA 4F4KA 4ELTA 1SL1A 3ZYYX 5EX5A 3MDQA 1ASWA 1CLQA 1QQMA 4WFAL 1K73O 3OS2A 4HUFA 3SQ2A 3D7EO 2HBLA 1RBSA 5C42A 3DOLA 1RT3A 4O0JA 5I9EB 3NF9A 4Z4HA 1K6YA 4CGJA 3ASMA 1U04A 2E6MA 4U67L 5HOOA 2E1YA 3A5OC 5KRSA 2VWBA 3E9PA 2DTUA 3HJFA 1NGBA 2ZE2A 5DMRA 2NRXA 1QZ5A 2DPNA 3CQ8A 1C0MA 1J54A 1Z26A 4MO5A 1D8YA 3EEQA 1I3AA 4C8OA 4CK2A 3IMXA 4HCCA 2O8BB 3O9RA 3IAYA 4DSFA 3TU5A 1NU0A 1V4TA 3HL8A 4J2AA 3ENOA 3U4LA 2PYLA 3NVMA 1A5WA 4H8KA 4DWIA 1RDDA 1EETA 1RT1A 2VGNA 4KH6A 4PL7A 2P9PB 3N4QA 3PLAA 3PO5A 4JYAK 4AHUA 2HHVA 4IFEA 4HUGA 3SJHA 4F9OA 1VQPN 1A5VA 4FJNA 1RBTA 3CETA 4OJRA 3V81A 1CXQA 3MN5A 1Q18A 3R8EA 4KFBA 3RWUA 4FZZA 5CR4A 2NLXA 3AO4A 4CZMA 4N47A 2HVHA 3KLFA 4Y0WA 1HJRA 1JLBA 2JWLA 3DXKA 3LAMA 4CK3A 4YOWA 4HVJA 1NGFA 4FM0A 1NKEA 5GAGP 2KZZA 5EY4A 3VEWA 5BPNA 4HWIA 4O5BA 5LMUK 4B9UA 1DGKN 5C2DA 3FZMA 1N36K 3QICA 1YJNN 4LC9B 3IKMA 3LDPA 3CD6N 3EZ5A 4CJVA 4JHDB 5BPLA 3CCEN 1VQON 3WEEA 3F9MA 4M45A 1GLCG 5FPMA 4KI6A 3FZKA 2RKIA 2E5LK 5M1NA 5BRHA 1KSPA 2GUPA 3PUFA 1RCHA 3SCXA 3MEDA 1JL1A 1SAZA 4FOIA 3LZIA 3C6UA 1O1WA 1NK4A 4BR4A 4CW7B 2CGLA 4LSNA 3ZX3A 4M7YA 1K8KA 1HJOA 3AVIA 1NBWA 1UAXA 1X9JA 4DTUA 4PL8A 1GLAG 1IG9A 1Q82O 2FSJA 5GIOA 3TANA 2NRVA 4JRQA 4FJ8A 3LM9A 3HSTB 2D0BA
chains in the Genus database with same CATH topology
3DLEA 4LY7A 3WNEA 3SQ0A 1X9SA 2Z1HA 4BE0A 2FBTA 4NCBA 1B9FA 1BL3A 1EXQA 2B6AA 4ZTJA 1Q9XA 3PY8A 2G8IA 2ZD1A 3FFIA 4AHSA 2ATQA 3AVBA 1TKZA 4QAGA 4CGGA 1MU2A 1WSIA 4CJWA 4C8LA 4Y1CA 4DTJA 4CFBA 3L8BA 3VQBA 1L3TA 1TKXA 1T7PA 1T8EA 4TSXA 1HYSA 1RDBA 1HMVA 2IDOA 3L2UA 4BE1A 3LP0A 1FK9A 1HNVA 3LDSA 4DTXA 3KKRA 3NF8A 4FVMA 4RW8A 3SPZA 1N5YA 4FJLA 3WNFA 1NK5A 4CGIA 3L2QA 1QHTA 3ISNC 5CYMA 3OYAA 4B9MA 4KRFA 1UOCA 1JLQA 4E1MA 4M3TA 3D45A 3IS9A 1G15A 3LP3A 3SUQA 2XY5A 4CEDA 1VSLA 3PX6A 3P1GA 2QKKA 1TKDA 3QIPA 3TABA 4AHVA 1KVBA 4J2EA 4PWDA 2G8HA 4PQUA 2IOCA 2IC3A 1C0TA 1S1UA 3ZSOA 1U47A 2DFHA 3NFAA 3MEGA 4JS5A 4DTOA 2F8SA 3AVFA 4CJRA 1VRTA 3DMJA 4ID1A 4Z4GA 3QIOA 5FRNA 4AILC 1VSEA 3DLRA 2OZSA 4KHYA 4OPJA 2F8TA 3CM5A 3KKSA 2Z1GA 2VG6A 2HNZA 4FM1A 1BQMA 1GOBA 2XY8A 3S3NA 1JLFA 3AA3A 2YHBA 3PO4A 2YHAA 3MXMA 3NH0A 3ZSZA 3NF6A 3T1AA 3NGIA 2XY6A 3LPUA 4O44A 4Z4CA 3MAQA 1SKSA 5FDLA 4FJKA 4R5PA 3WNGA 1JLGA 4CIFA 4IFYA 3HT3A 3VA0A 4EP5A 1VSIA 2HNDA 3K5LA 2P51A 1QSLA 4CCHA 1BI4B 4B9LA 1XHZA 3DLKA 3ALYA 4WE1A 3NF7A 4W5NA 3V1RA 5T7BA 3QESA 4F2RA 1N6QA 3KK3A 1WAJA 3NGYA 4I2PA 4B9VA 1KVCA 4FXDA 3V1QA 3HM9A 1JLAA 1WSGA 2YKMA 2VG7A 4CFDA 4H4MA 4W5OA 3O3HA 3KK2A 3CM6A 3F73A 3HVTA 5KGXA 2PYJA 5J2PA 2IGIA 4GW6A 3P5JA 3QEXA 4Z0UA 1EX4A 1NKBA 5D3GA 2KFNA 2FBYA 4OKEA 4DFPA 2OPRA 1NK9A 1WN7A 1U49A 1ZBLA 1BIUA 3C94A 3V1OA 4Q5VA 4M3YA 4K8XA 3HO1A 2B5JA 3S9HA 5CYQA 1UWBA 3TAQA 1ZBFA 4CJPA 3ULDA 1C1CA 5CY4A 3S3MA 3K5MA 3HK2A 1YVUA 2YNFA 4E7JA 4KHUA 3G10A 2HHTA 3AA5X 3CYMA 2XY7A 1RT6A 2YNIA 3AA4A 3ZSVA 1NOYA 4F2SA 1L3SA 1SL0A 4IKFA 4CEBA 3AA2A 3BDPA 4NCAA 1J9AA 1VSJA 3THVA 2HMIA 3VQQA 3L3VA 1TK8A 4DTPA 4DQPA 3V6DA 4C8NA 3CFPA 2PZSA 3BGRA 3P83D 2KQ2A 1HYZA 1SL2A 1KTQA 1HYVA 2FBXA 1SKRA 1BQNA 4JRPA 2QK9A 4GMJB 4M3UA 3ZT2A 1RILA 5KI6A 4CF2A 1ZBHA 1RBUA 4Z4IA 5KRTA 4DQIA 4CERA 2FBVA 4DSIA 3ZT3A 2JLEA 5FRMA 1XWLA 4AHCA 3SV3A 3OVNA 1RDCA 4BWMA 2ETJA 4YFUA 4CHQA 3KK1A 3L2WA 4K8ZA 3DI6A 1TAQA 1Q8IA 1RT7A 1HQUA 1BI4A 1WSHA 3OYKA 4DFMA 4CECA 1EP4A 4CJUA 4I9QA 2I5JA 2HB5A 2NUBA 4LD0A 3SYZA 4DLEA 1BIZA 3AVMA 3VQ7A 4O4GA 4B8CA 1RTDA 3SJJA 3RR7A 5J1EA 4BWJA 3DOKA 3VN5A 2KTQA 1RTHA 3OYDA 4DTSA 4N41A 3RMCA 1TK5A 1HQEA 1QE1A 1VSFA 4CIEA 4NYFA 2YNGA 4DU1A 3G0ZA 4KTWA 3AVHA 4F3OA 2HHSA 4CHNA 5HRRA 5KGWA 4DTMA 1UA1A 2YV0X 3HVRA 2G8FA 2PY5A 1W0HA 3OYMA 3SQ4A 4Q0BA 3KLHA 2G8KA 2DY4A 3OYGA 3DLHA 1U45A 2P5OA 4CEQA 1XC9A 1IKYA 3CG7A 2QKBA 1HPZA 3NBPA 1VSHA 2HHQA 4J2DA 4LH4A 4DG1A 2OPPA 3HYFA 1S6PA 2P5GA 5SZTA 2YNHA 3QO9A 3AVGA 4DS4A 1NK7A 1X9MA 4KKOA 2EHGA 4RW6A 3VQ6A 3HPOA 1TK0A 4E19A 1BGXT 1CZ9A 4CEOA 3KJVA 4FJMA 1IH7A 4G1QA 2YKNA 3LWMA 4FJGA 2KZMA 1GOAA 1C1BA 1GOCA 1ITGA 3NGZA 5E41A 2IAJA 1JXEA 4JLHA 4UQGA 1KRPA 2OPQA 1FKOA 1S6QA 2W42A 3LAKA 3MXJA 1R0AA 1SV5A 4IFVA 1B92A 1TGOA 4OGEA 4FJXA 1JXBA 3CFOA 3VQPA 4B8AB 4OLAA 2E4LA 4M3RA 4BDYA 2FC0A 3ZT1A 4CEZA 3UIQA 4KHWA 4FYDA 4YNQA 1NOZA 4KHNA 2RF2A 4FJJA 4CGFA 1TAUA 4DFKA 2HVIA 1S1XA 3AO3A 1BISA 2F96A 4JS4A 4DQSA 4H4OA 3EYZA 2G8WA 2A1SA 4RW4A 4N76A 1YTUA 1C0UA 1W9HA 3OYBA 1IO2A 1ASUA 4FCYA 1RBRA 3KIOA 4CHZA 3V9XA 3SUPA 3AVCA 3ZT0A 4CF1A 4DU4A 4B9SA 4KV8A 4EZ6A 4DF4A 4IDKA 3K2PA 5JS1A 3TAPA 3TR8A 1BCMA 2DFEA 3O4NA 1LAVA 1ZBUA 5K14A 3ZSRA 4KHSA 3QEIA 1T03A 3L2VA 3EY1A 2OA8A 4FJIA 3VQAA 3C95A 4M3XA 2HW3A 5HBMA 3K58A 1QQCA 3AVNA 3SV4A 1X1PA 4I9LA 1JL2A 4DQRA 1U4BA 2O4IA 4CFCA 5CZ1A 1XHXA 3QERA 5HROA 3MXIA 2HHXA 1U48A 4DSLA 3H08A 4NCGA 1BCOA 2EX3A 3SI6A 1SKWA 4CESA 3RRGA 1LV5A 4ZHRA 3QEWA 1TKTA 3KTQA 3TAMA 4N5SA 4E7KA 4IG3A 1F21A 4F3TA 1IKWA 2HHWA 4Z4FA 2B4JA 3VQ5A 3ZCMA 1RBVA 3F9KA 4KREA 2DFFA 1D9FA 3TWHA 3SUNA 3C6TA 3IRXA 4CGHA 1VRUA 4CJTA 4CJKA 4CEEA 4RG8A 3O3FA 3OYFA 4HUEA 4LSLA 4FLVA 4CHYA 4FJ9A 3I8DA 2LSNA 4CF0A 1VK0A 2IS3A 3RMBA 4OKKA 3TAEA 3LWLA 5HP1A 3K5NA 1WLJA 1REVA 3SPYA 1L3VA 1J5OA 3ZT4A 1VSMA 1TVRA 4AHTA 2ITGA 3TI0A 4KTZA 1DTQA 4FLTA 3T3FA 4FLXA 3LP2A 3QLHA 3AVLA 3LPTA 5I3UA 2BE2A 3U3GA 3V9SA 3WNHA 5J2NA 3QETA 1NJWA 4O55A 2Z1JA 4C8MA 4M41A 3PV8A 4L8RB 3KLIA 4AH9A 3U6FA 1D5AA 4CJSA 1KVAA 1DTTA 5C25A 4C8KA 4M3ZA 4QCLA 3TARA 3L3UA 4N56A 2GBZA 4EP4A 3NCIA 1S9EA 3B6OA 4W5QA 4E0DA 4CFAA 3OYJA 2HNYA 3RR8A 4DSEA 5I42A 1ZBIA 2OPSA 1WSEA 4DQQA 1NK6A 5CZ2A 3K59A 2BANA 4DS5A 3M8PA 2AJQA 2D5RA 4BACA 4I7FA 2VWJA 5J2MA 1TV6A 4OPKA 4DU3A 4ZTFA 2VWKA 2Y1IA 4CEAA 4KO0A 4B9TA 3DRPA 4J2BA 3DLBA 3MECA 1LW2A 1B9DA 4CF8A 1Z25A 1LWCA 4ELTA 1SL1A 4F4KA 1A5XA 4ELVA 1WNSA 4HHTA 1ASWA 3AO1A 3NHGA 1CLQA 5SWMA 4KAZA 1NJXA 4FLUA 1HRHA 3KD1E 3OYIA 1J53A 4CGDA 3OS2A 4HUFA 3SQ2A 2KFZA 3I0SA 1NJZA 1RBSA 4RW9A 4RW7A 5C42A 3OYHA 3NAEA 3DOLA 1RT3A 4IG0A 3VQ4A 2G8VA 4O0JA 3NF9A 4Z4HA 4MFBA 1K6YA 3T19A 4CGJA 3ASMA 3M8RA 1U04A 3O3GA 2E6MA 3HXMA 3V9UA 5KRSA 5KTQA 2KW4A 5HRPA 4ICLA 1XI1A 1NJYA 2DTUA 4FLWA 5JS2A 2G8UA 4KB1A 3HJFA 5FROA 2ZE2A 4CHPA 3K57A 5DMRA 3RMDA 4KTQA 4M42A 1RDAA 4DF8A 1IKVA 1C1AA 1JKHA 1KCFA 3LANA 2X6SA 4OVLA 5HRNA 3ZSQA 3ZSXA 3NH1A 3HP6A 3CQ8A 3RTVA 1X9WA 1C0MA 1J54A 1D9DA 3OYCA 1EKEA 3QEPA 3I0RA 1Z26A 4DSKA 4KHQA 4DMNA 2XHBA 3U3YA 1QS4A 3LP1A 4BDZA 1NK0A 4Z4EA 3NH2A 3QEVA 4EZ9A 4E7LA 2D0CA 1D8YA 4OKJA 1S1WA 1I3AA 4C8OA 4CK2A 3JYTA 4DTRA 3VQEA 3SNNA 1QSSA 2Y1JA 1L3UA 1SUQA 2QXFA 4XIUA 3OYNA 4HCCA 4FW1A 5DK5A 4FZXC 2HHUA 1LWEA 1KFDA 4DTNA 3IAYA 3AO5A 4DSFA 1YTAA 4HCBA 3HL8A 4Y1DA 4PY5A 4J2AA 1FKPA 1QTMA 4DLGA 2WONA 3AVJA 3TAFA 2PYLA 4ID5A 3OJUA 1A5WA 4HTUA 2Q3SA 4H8KA 4FZYA 4DWIA 4FJ7A 4W5TA 1RDDA 1EETA 1RT1A 1CZBA 2X78A 4FJ5A 4CJ3A 4MQ3A 5C24A 3PO5A 4AHUA 4FJHA 3VQDA 3B6PA 1UA0A 2HHVA 2E6LA 1RT4A 4HUGA 4FLZA 3VQCA 4FK4A 4B9NA 1JLCA 2RN2A 1A5VA 4FJNA 1RBTA 4OJRA 3AVKA 4FLYA 3VQ9A 4CJLA 4E7HA 4W5RA 1CXQA 2VG5A 4PA1A 3V81A 3SUOA 4IBNA 5HLFA 1S1TA 3OJSA 3VQ8A 1C6VA 4KFBA 4DFJA 3PX0A 3KLGA 4FK0A 3AO2A 3DYAA 3RWUA 4FZZA 1IKXA 1Q9YA 3CFRA 3S3OA 1LAWA 4NYNA 3AO4A 3DM2A 2HVHA 4N47A 3PX4A 4CK1A 1LW0A 3KLFA 2OYQA 4I2QA 1HJRA 3L2RA 1JLBA 4CK3A 3ZSWA 3LAMA 4OLBA 3OYLA 1I39A 4CIGA 1TL3A 4HVJA 4E7IA 4E3SA 1S5JA 2XRIA 4FM0A 1NKEA 3QNOA 2KZZA 1ASVA 4KI4A 1RTIA 2ZQBA 2O4GA 4BDPA 2JGUA 4QOZB 4PUOA 4E89A 3QINA 1T05A 4O5BA 1KFSA 2BGGA 3V9ZA 2D0AA 2X6NA 1FXXA 3OYEA 1CXUA 2GUIA 2XO7A 4B9UA 1S9GA 1TL1A 3SZ2A 1WSJA 4F8RA 3E01A 1NK8A 1RTJA 2GV9A 3OS0A 4CHOA 1RNHA 1LWFA 1YT3A 4E1NA 3M8QA 1RT5A 2X74A 1L5UA 3AV9A 2BDPA 1DLOA 1HNIA 3EZ5A 4CJVA 5HRSA 1JLEA 1BHLA 4CJQA 4B3OA 4M45A 3NDKA 4GVMA 3NE6A 4KI6A 1QSYA 3KD5E 1S1VA 1KLMA 2RKIA 4CJ4A 1WSFA 3QNNA 4OGCA 4AHRA 3ZSYA 3LALA 4B08A 3DRSA 2P1JA 1KSPA 2R7YA 3V9WA 3KLEA 3V4IA 3PUFA 4CE9A 1RCHA 4FK2A 3DRRA 3MEEA 4CJ5A 4BE2A 3K5OA 3MEDA 4LH5A 3SCXA 1JL1A 2OZMA 3ITHA 4CEFA 3RRHA 3LZIA 3SQ1A 2WOMA 3C6UA 4M3WA 4ELUA 1WAFA 4KPYA 3TAGA 3JSMA 1O1WA 1NK4A 3IG1A 2Z1IA 4LSNA 4FM2A 4KB0A 3AVAA 1KLNA 3M8SA 3AVIA 1VSDA 1UAXA 3OY9A 1ZYQA 3HP9A 3LZJA 4DTUA 3O4QA 1IG9A 4DSJA 1NKCA 3VA3A 4FW2A 1VSKA 3TANA 3HPHA 5J2QA 2A1RA 1Y97A 3D0PA 4CJEA 4CF9A 1RT2A 4JRQA 3RMAA 4FJ8A 3HPGA 3A2FA 5EU7A 3DLGA 4CJFA 4O0IA 3HSTB 2D0BA 2RPIA 3OS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLE A;  4LY7 A;  3WNE A;  3SQ0 A;  1X9S A;  2Z1H A;  4BE0 A;  2FBT A;  4NCB A;  1B9F A;  1BL3 A;  1EXQ A;  2B6A A;  4ZTJ A;  1Q9X A;  3PY8 A;  2G8I A;  2ZD1 A;  3FFI A;  4AHS A;  2ATQ A;  3AVB A;  1TKZ A;  4QAG A;  4CGG A;  1MU2 A;  1WSI A;  4CJW A;  4C8L A;  4Y1C A;  4DTJ A;  4CFB A;  3L8B A;  3VQB A;  1L3T A;  1TKX A;  1T7P A;  1T8E A;  4TSX A;  1HYS A;  1RDB A;  1HMV A;  2IDO A;  3L2U A;  4BE1 A;  3LP0 A;  1FK9 A;  1HNV A;  3LDS A;  4DTX A;  3KKR A;  3NF8 A;  4FVM A;  4RW8 A;  3SPZ A;  1N5Y A;  4FJL A;  3WNF A;  1NK5 A;  4CGI A;  3L2Q A;  1QHT A;  3ISN C;  5CYM A;  3OYA A;  4B9M A;  4KRF A;  1UOC A;  1JLQ A;  4E1M A;  4M3T A;  3D45 A;  3IS9 A;  1G15 A;  3LP3 A;  3SUQ A;  2XY5 A;  4CED A;  1VSL A;  3PX6 A;  3P1G A;  2QKK A;  1TKD A;  3QIP A;  3TAB A;  4AHV A;  1KVB A;  4J2E A;  4PWD A;  2G8H A;  4PQU A;  2IOC A;  2IC3 A;  1C0T A;  1S1U A;  3ZSO A;  1U47 A;  2DFH A;  3NFA A;  3MEG A;  4JS5 A;  4DTO A;  2F8S A;  3AVF A;  4CJR A;  1VRT A;  3DMJ A;  4ID1 A;  4Z4G A;  3QIO A;  5FRN A;  4AIL C;  1VSE A;  3DLR A;  2OZS A;  4KHY A;  4OPJ A;  2F8T A;  3CM5 A;  3KKS A;  2Z1G A;  2VG6 A;  2HNZ A;  4FM1 A;  1BQM A;  1GOB A;  2XY8 A;  3S3N A;  1JLF A;  3AA3 A;  2YHB A;  3PO4 A;  2YHA A;  3MXM A;  3NH0 A;  3ZSZ A;  3NF6 A;  3T1A A;  3NGI A;  2XY6 A;  3LPU A;  4O44 A;  4Z4C A;  3MAQ A;  1SKS A;  5FDL A;  4FJK A;  4R5P A;  3WNG A;  1JLG A;  4CIF A;  4IFY A;  3HT3 A;  3VA0 A;  4EP5 A;  1VSI A;  2HND A;  3K5L A;  2P51 A;  1QSL A;  4CCH A;  1BI4 B;  4B9L A;  1XHZ A;  3DLK A;  3ALY A;  4WE1 A;  3NF7 A;  4W5N A;  3V1R A;  5T7B A;  3QES A;  4F2R A;  1N6Q A;  3KK3 A;  1WAJ A;  3NGY A;  4I2P A;  4B9V A;  1KVC A;  4FXD A;  3V1Q A;  3HM9 A;  1JLA A;  1WSG A;  2YKM A;  2VG7 A;  4CFD A;  4H4M A;  4W5O A;  3O3H A;  3KK2 A;  3CM6 A;  3F73 A;  3HVT A;  5KGX A;  2PYJ A;  5J2P A;  2IGI A;  4GW6 A;  3P5J A;  3QEX A;  4Z0U A;  1EX4 A;  1NKB A;  5D3G A;  2KFN A;  2FBY A;  4OKE A;  4DFP A;  2OPR A;  1NK9 A;  1WN7 A;  1U49 A;  1ZBL A;  1BIU A;  3C94 A;  3V1O A;  4Q5V A;  4M3Y A;  4K8X A;  3HO1 A;  2B5J A;  3S9H A;  5CYQ A;  1UWB A;  3TAQ A;  1ZBF A;  4CJP A;  3ULD A;  1C1C A;  5CY4 A;  3S3M A;  3K5M A;  3HK2 A;  1YVU A;  2YNF A;  4E7J A;  4KHU A;  3G10 A;  2HHT A;  3AA5 X;  3CYM A;  2XY7 A;  1RT6 A;  2YNI A;  3AA4 A;  3ZSV A;  1NOY A;  4F2S A;  1L3S A;  1SL0 A;  4IKF A;  4CEB A;  3AA2 A;  3BDP A;  4NCA A;  1J9A A;  1VSJ A;  3THV A;  2HMI A;  3VQQ A;  3L3V A;  1TK8 A;  4DTP A;  4DQP A;  3V6D A;  4C8N A;  3CFP A;  2PZS A;  3BGR A;  3P83 D;  2KQ2 A;  1HYZ A;  1SL2 A;  1KTQ A;  1HYV A;  2FBX A;  1SKR A;  1BQN A;  4JRP A;  2QK9 A;  4GMJ B;  4M3U A;  3ZT2 A;  1RIL A;  5KI6 A;  4CF2 A;  1ZBH A;  1RBU A;  4Z4I A;  5KRT A;  4DQI A;  4CER A;  2FBV A;  4DSI A;  3ZT3 A;  2JLE A;  5FRM A;  1XWL A;  4AHC A;  3SV3 A;  3OVN A;  1RDC A;  4BWM A;  2ETJ A;  4YFU A;  4CHQ A;  3KK1 A;  3L2W A;  4K8Z A;  3DI6 A;  1TAQ A;  1Q8I A;  1RT7 A;  1HQU A;  1BI4 A;  1WSH A;  3OYK A;  4DFM A;  4CEC A;  1EP4 A;  4CJU A;  4I9Q A;  2I5J A;  2HB5 A;  2NUB A;  4LD0 A;  3SYZ A;  4DLE A;  1BIZ A;  3AVM A;  3VQ7 A;  4O4G A;  4B8C A;  1RTD A;  3SJJ A;  3RR7 A;  5J1E A;  4BWJ A;  3DOK A;  3VN5 A;  2KTQ A;  1RTH A;  3OYD A;  4DTS A;  4N41 A;  3RMC A;  1TK5 A;  1HQE A;  1QE1 A;  1VSF A;  4CIE A;  4NYF A;  2YNG A;  4DU1 A;  3G0Z A;  4KTW A;  3AVH A;  4F3O A;  2HHS A;  4CHN A;  5HRR A;  5KGW A;  4DTM A;  1UA1 A;  2YV0 X;  3HVR A;  2G8F A;  2PY5 A;  1W0H A;  3OYM A;  3SQ4 A;  4Q0B A;  3KLH A;  2G8K A;  2DY4 A;  3OYG A;  3DLH A;  1U45 A;  2P5O A;  4CEQ A;  1XC9 A;  1IKY A;  3CG7 A;  2QKB A;  1HPZ A;  3NBP A;  1VSH A;  2HHQ A;  4J2D A;  4LH4 A;  4DG1 A;  2OPP A;  3HYF A;  1S6P A;  2P5G A;  5SZT A;  2YNH A;  3QO9 A;  3AVG A;  4DS4 A;  1NK7 A;  1X9M A;  4KKO A;  2EHG A;  4RW6 A;  3VQ6 A;  3HPO A;  1TK0 A;  4E19 A;  1BGX T;  1CZ9 A;  4CEO A;  3KJV A;  4FJM A;  1IH7 A;  4G1Q A;  2YKN A;  3LWM A;  4FJG A;  2KZM A;  1GOA A;  1C1B A;  1GOC A;  1ITG A;  3NGZ A;  5E41 A;  2IAJ A;  1JXE A;  4JLH A;  4UQG A;  1KRP A;  2OPQ A;  1FKO A;  1S6Q A;  2W42 A;  3LAK A;  3MXJ A;  1R0A A;  1SV5 A;  4IFV A;  1B92 A;  1TGO A;  4OGE A;  4FJX A;  1JXB A;  3CFO A;  3VQP A;  4B8A B;  4OLA A;  2E4L A;  4M3R A;  4BDY A;  2FC0 A;  3ZT1 A;  4CEZ A;  3UIQ A;  4KHW A;  4FYD A;  4YNQ A;  1NOZ A;  4KHN A;  2RF2 A;  4FJJ A;  4CGF A;  1TAU A;  4DFK A;  2HVI A;  1S1X A;  3AO3 A;  1BIS A;  2F96 A;  4JS4 A;  4DQS A;  4H4O A;  3EYZ A;  2G8W A;  2A1S A;  4RW4 A;  4N76 A;  1YTU A;  1C0U A;  1W9H A;  3OYB A;  1IO2 A;  1ASU A;  4FCY A;  1RBR A;  3KIO A;  4CHZ A;  3V9X A;  3SUP A;  3AVC A;  3ZT0 A;  4CF1 A;  4DU4 A;  4B9S A;  4KV8 A;  4EZ6 A;  4DF4 A;  4IDK A;  3K2P A;  5JS1 A;  3TAP A;  3TR8 A;  1BCM A;  2DFE A;  3O4N A;  1LAV A;  1ZBU A;  5K14 A;  3ZSR A;  4KHS A;  3QEI A;  1T03 A;  3L2V A;  3EY1 A;  2OA8 A;  4FJI A;  3VQA A;  3C95 A;  4M3X A;  2HW3 A;  5HBM A;  3K58 A;  1QQC A;  3AVN A;  3SV4 A;  1X1P A;  4I9L A;  1JL2 A;  4DQR A;  1U4B A;  2O4I A;  4CFC A;  5CZ1 A;  1XHX A;  3QER A;  5HRO A;  3MXI A;  2HHX A;  1U48 A;  4DSL A;  3H08 A;  4NCG A;  1BCO A;  2EX3 A;  3SI6 A;  1SKW A;  4CES A;  3RRG A;  1LV5 A;  4ZHR A;  3QEW A;  1TKT A;  3KTQ A;  3TAM A;  4N5S A;  4E7K A;  4IG3 A;  1F21 A;  4F3T A;  1IKW A;  2HHW A;  4Z4F A;  2B4J A;  3VQ5 A;  3ZCM A;  1RBV A;  3F9K A;  4KRE A;  2DFF A;  1D9F A;  3TWH A;  3SUN A;  3C6T A;  3IRX A;  4CGH A;  1VRU A;  4CJT A;  4CJK A;  4CEE A;  4RG8 A;  3O3F A;  3OYF A;  4HUE A;  4LSL A;  4FLV A;  4CHY A;  4FJ9 A;  3I8D A;  2LSN A;  4CF0 A;  1VK0 A;  2IS3 A;  3RMB A;  4OKK A;  3TAE A;  3LWL A;  5HP1 A;  3K5N A;  1WLJ A;  1REV A;  3SPY A;  1L3V A;  1J5O A;  3ZT4 A;  1VSM A;  1TVR A;  4AHT A;  2ITG A;  3TI0 A;  4KTZ A;  1DTQ A;  4FLT A;  3T3F A;  4FLX A;  3LP2 A;  3QLH A;  3AVL A;  3LPT A;  5I3U A;  2BE2 A;  3U3G A;  3V9S A;  3WNH A;  5J2N A;  3QET A;  1NJW A;  4O55 A;  2Z1J A;  4C8M A;  4M41 A;  3PV8 A;  4L8R B;  3KLI A;  4AH9 A;  3U6F A;  1D5A A;  4CJS A;  1KVA A;  1DTT A;  5C25 A;  4C8K A;  4M3Z A;  4QCL A;  3TAR A;  3L3U A;  4N56 A;  2GBZ A;  4EP4 A;  3NCI A;  1S9E A;  3B6O A;  4W5Q A;  4E0D A;  4CFA A;  3OYJ A;  2HNY A;  3RR8 A;  4DSE A;  5I42 A;  1ZBI A;  2OPS A;  1WSE A;  4DQQ A;  1NK6 A;  5CZ2 A;  3K59 A;  2BAN A;  4DS5 A;  3M8P A;  2AJQ A;  2D5R A;  4BAC A;  4I7F A;  2VWJ A;  5J2M A;  1TV6 A;  4OPK A;  4DU3 A;  4ZTF A;  2VWK A;  2Y1I A;  4CEA A;  4KO0 A;  4B9T A;  3DRP A;  4J2B A;  3DLB A;  3MEC A;  1LW2 A;  1B9D A;  4CF8 A;  1Z25 A;  1LWC A;  4ELT A;  1SL1 A;  4F4K A;  1A5X A;  4ELV A;  1WNS A;  4HHT A;  1ASW A;  3AO1 A;  3NHG A;  1CLQ A;  5SWM A;  4KAZ A;  1NJX A;  4FLU A;  1HRH A;  3KD1 E;  3OYI A;  1J53 A;  4CGD A;  3OS2 A;  4HUF A;  3SQ2 A;  2KFZ A;  3I0S A;  1NJZ A;  1RBS A;  4RW9 A;  4RW7 A;  5C42 A;  3OYH A;  3NAE A;  3DOL A;  1RT3 A;  4IG0 A;  3VQ4 A;  2G8V A;  4O0J A;  3NF9 A;  4Z4H A;  4MFB A;  1K6Y A;  3T19 A;  4CGJ A;  3ASM A;  3M8R A;  1U04 A;  3O3G A;  2E6M A;  3HXM A;  3V9U A;  5KRS A;  5KTQ A;  2KW4 A;  5HRP A;  4ICL A;  1XI1 A;  1NJY A;  2DTU A;  4FLW A;  5JS2 A;  2G8U A;  4KB1 A;  3HJF A;  5FRO A;  2ZE2 A;  4CHP A;  3K57 A;  5DMR A;  3RMD A;  4KTQ A;  4M42 A;  1RDA A;  4DF8 A;  1IKV A;  1C1A A;  1JKH A;  1KCF A;  3LAN A;  2X6S A;  4OVL A;  5HRN A;  3ZSQ A;  3ZSX A;  3NH1 A;  3HP6 A;  3CQ8 A;  3RTV A;  1X9W A;  1C0M A;  1J54 A;  1D9D A;  3OYC A;  1EKE A;  3QEP A;  3I0R A;  1Z26 A;  4DSK A;  4KHQ A;  4DMN A;  2XHB A;  3U3Y A;  1QS4 A;  3LP1 A;  4BDZ A;  1NK0 A;  4Z4E A;  3NH2 A;  3QEV A;  4EZ9 A;  4E7L A;  2D0C A;  1D8Y A;  4OKJ A;  1S1W A;  1I3A A;  4C8O A;  4CK2 A;  3JYT A;  4DTR A;  3VQE A;  3SNN A;  1QSS A;  2Y1J A;  1L3U A;  1SUQ A;  2QXF A;  4XIU A;  3OYN A;  4HCC A;  4FW1 A;  5DK5 A;  4FZX C;  2HHU A;  1LWE A;  1KFD A;  4DTN A;  3IAY A;  3AO5 A;  4DSF A;  1YTA A;  4HCB A;  3HL8 A;  4Y1D A;  4PY5 A;  4J2A A;  1FKP A;  1QTM A;  4DLG A;  2WON A;  3AVJ A;  3TAF A;  2PYL A;  4ID5 A;  3OJU A;  1A5W A;  4HTU A;  2Q3S A;  4H8K A;  4FZY A;  4DWI A;  4FJ7 A;  4W5T A;  1RDD A;  1EET A;  1RT1 A;  1CZB A;  2X78 A;  4FJ5 A;  4CJ3 A;  4MQ3 A;  5C24 A;  3PO5 A;  4AHU A;  4FJH A;  3VQD A;  3B6P A;  1UA0 A;  2HHV A;  2E6L A;  1RT4 A;  4HUG A;  4FLZ A;  3VQC A;  4FK4 A;  4B9N A;  1JLC A;  2RN2 A;  1A5V A;  4FJN A;  1RBT A;  4OJR A;  3AVK A;  4FLY A;  3VQ9 A;  4CJL A;  4E7H A;  4W5R A;  1CXQ A;  2VG5 A;  4PA1 A;  3V81 A;  3SUO A;  4IBN A;  5HLF A;  1S1T A;  3OJS A;  3VQ8 A;  1C6V A;  4KFB A;  4DFJ A;  3PX0 A;  3KLG A;  4FK0 A;  3AO2 A;  3DYA A;  3RWU A;  4FZZ A;  1IKX A;  1Q9Y A;  3CFR A;  3S3O A;  1LAW A;  4NYN A;  3AO4 A;  3DM2 A;  2HVH A;  4N47 A;  3PX4 A;  4CK1 A;  1LW0 A;  3KLF A;  2OYQ A;  4I2Q A;  1HJR A;  3L2R A;  1JLB A;  4CK3 A;  3ZSW A;  3LAM A;  4OLB A;  3OYL A;  1I39 A;  4CIG A;  1TL3 A;  4HVJ A;  4E7I A;  4E3S A;  1S5J A;  2XRI A;  4FM0 A;  1NKE A;  3QNO A;  2KZZ A;  1ASV A;  4KI4 A;  1RTI A;  2ZQB A;  2O4G A;  4BDP A;  2JGU A;  4QOZ B;  4PUO A;  4E89 A;  3QIN A;  1T05 A;  4O5B A;  1KFS A;  2BGG A;  3V9Z A;  2D0A A;  2X6N A;  1FXX A;  3OYE A;  1CXU A;  2GUI A;  2XO7 A;  4B9U A;  1S9G A;  1TL1 A;  3SZ2 A;  1WSJ A;  4F8R A;  3E01 A;  1NK8 A;  1RTJ A;  2GV9 A;  3OS0 A;  4CHO A;  1RNH A;  1LWF A;  1YT3 A;  4E1N A;  3M8Q A;  1RT5 A;  2X74 A;  1L5U A;  3AV9 A;  2BDP A;  1DLO A;  1HNI A;  3EZ5 A;  4CJV A;  5HRS A;  1JLE A;  1BHL A;  4CJQ A;  4B3O A;  4M45 A;  3NDK A;  4GVM A;  3NE6 A;  4KI6 A;  1QSY A;  3KD5 E;  1S1V A;  1KLM A;  2RKI A;  4CJ4 A;  1WSF A;  3QNN A;  4OGC A;  4AHR A;  3ZSY A;  3LAL A;  4B08 A;  3DRS A;  2P1J A;  1KSP A;  2R7Y A;  3V9W A;  3KLE A;  3V4I A;  3PUF A;  4CE9 A;  1RCH A;  4FK2 A;  3DRR A;  3MEE A;  4CJ5 A;  4BE2 A;  3K5O A;  3MED A;  4LH5 A;  3SCX A;  1JL1 A;  2OZM A;  3ITH A;  4CEF A;  3RRH A;  3LZI A;  3SQ1 A;  2WOM A;  3C6U A;  4M3W A;  4ELU A;  1WAF A;  4KPY A;  3TAG A;  3JSM A;  1O1W A;  1NK4 A;  3IG1 A;  2Z1I A;  4LSN A;  4FM2 A;  4KB0 A;  3AVA A;  1KLN A;  3M8S A;  3AVI A;  1VSD A;  1UAX A;  3OY9 A;  1ZYQ A;  3HP9 A;  3LZJ A;  4DTU A;  3O4Q A;  1IG9 A;  4DSJ A;  1NKC A;  3VA3 A;  4FW2 A;  1VSK A;  3TAN A;  3HPH A;  5J2Q A;  2A1R A;  1Y97 A;  3D0P A;  4CJE A;  4CF9 A;  1RT2 A;  4JRQ A;  3RMA A;  4FJ8 A;  3HPG A;  3A2F A;  5EU7 A;  3DLG A;  4CJF A;  4O0I A;  3HST B;  2D0B A;  2RPI A;  3OS1 A; 
#chains in the Genus database with same CATH topology
 4IDH A;  3R6M A;  4IJN A;  4BE0 A;  2FBT A;  1NGD A;  2B6A A;  2UYT A;  4JI1 K;  3M3Z A;  1QZ6 A;  2ZD1 A;  4JI4 K;  1NM1 A;  4QAG A;  4CGG A;  3UE5 A;  4X64 K;  3M5R A;  4C8L A;  1T3V A;  4CFB A;  1L3T A;  1TKX A;  4MDA A;  3SPZ A;  1N5Y A;  1N33 K;  4JKB A;  2NRT A;  3D2F A;  3L2Q A;  1QHT A;  3ISN C;  3CJ7 A;  4IEI A;  3P4I A;  3AY9 A;  4OX9 K;  4UY8 O;  3LP3 A;  2XY5 A;  4CED A;  1VSL A;  4IOC L;  1HX1 A;  2QKK A;  1TKD A;  2AP1 A;  1KVB A;  4DCH A;  2G8H A;  1XNR K;  2IOC A;  2IC3 A;  1C0T A;  3SAF A;  4JS5 A;  1E3M A;  4GV3 A;  1V4S A;  4ID1 A;  3QIO A;  4JNE A;  4OPJ A;  2F8T A;  4R79 A;  2VYP A;  2Z1G A;  2HNZ A;  4FM1 A;  3J7A P;  1GOB A;  4BRH A;  3OTO K;  1HLU A;  3CIP A;  3NH0 A;  3ZSZ A;  4Z4C A;  3IDH A;  4RCH A;  4A2B A;  1JLG A;  4CIF A;  3TSQ A;  1BG3 A;  2HBK A;  3VA0 A;  4EP5 A;  3K5L A;  4XH4 A;  5BRE A;  4CCH A;  2J4R A;  4W5N A;  1BWF O;  3N4P A;  3ULE B;  3KK3 A;  1WAJ A;  1KVC A;  4B3M K;  2FSK A;  2PYJ A;  3GOI A;  5J2P A;  3KZB A;  2IGI A;  3CF5 L;  1NGG A;  3WT0 A;  5D3G A;  4OKE A;  3K0S A;  1U49 A;  3V1O A;  4B1W B;  4K8X A;  4GV9 A;  1XNQ K;  2B5J A;  2FF3 B;  3A5M C;  4V19 S;  3ULD A;  2QM1 A;  4DHY A;  1YVU A;  2YNF A;  4E7J A;  1OH6 A;  3HK2 A;  1OKJ A;  3G10 A;  3CYM A;  2XY7 A;  3ZSV A;  1YUW A;  1HNX K;  3THV A;  3VQQ A;  3L3V A;  4DQP A;  4C8N A;  3L6Q A;  1X3N A;  3O6W A;  3P83 D;  4O5F A;  4XH5 A;  2BH1 A;  1BQN A;  2ZGZ A;  4JRP A;  2QWP A;  3VEZ A;  1RIL A;  3ZT2 A;  4CF2 A;  1ZBH A;  1WBD A;  2NZT A;  1QVG M;  4O8U A;  4CER A;  2FBV A;  4DSI A;  2UXC K;  2OCE A;  1XWL A;  3OVN A;  1TYQ A;  5AZJ B;  3KK1 A;  1BUP A;  3DI6 A;  5AQL A;  1GLL O;  4BG9 A;  4BGB A;  3I55 N;  4CI6 A;  4CD3 A;  1RTD A;  3SJJ A;  3DOK A;  3VN5 A;  4IOA L;  2GEM A;  1HQE A;  1MWK A;  2P9L A;  4A5A A;  5BN8 A;  4KTW A;  4DTM A;  3HVR A;  5JLH A;  3OYM A;  5AFU A;  2E8A A;  1XC9 A;  1IKY A;  3CG7 A;  3NBP A;  3BY5 A;  5JIC A;  4J2D A;  1ATS A;  4LH4 A;  3VGK A;  4DG1 A;  3QO9 A;  4DS4 A;  1X9M A;  3GDQ A;  3VQ6 A;  2BUP A;  1BGX T;  4BRM A;  4PKI A;  2KZM A;  3I8B A;  1ITG A;  4JD2 A;  4C23 A;  3FFK B;  3SMP A;  4CZG A;  1R0A A;  4OGE A;  4OLA A;  4B8A B;  5LY3 A;  4BRK A;  1TAU A;  4DFK A;  2HVI A;  2QA4 N;  3AO3 A;  1BIS A;  3IUC A;  4DQS A;  2G8W A;  4H4O A;  4CJ7 A;  2A1S A;  4RW4 A;  2NRH A;  1N32 K;  3AGK A;  1ASU A;  1MWM A;  4CHZ A;  4WCE L;  4PKG A;  4EZ6 A;  3UKU B;  3SBG A;  5JS1 A;  1VHX A;  1BCM A;  2DFE A;  3O4N A;  3ZSR A;  4E1J A;  3CER A;  3U8X A;  3QEI A;  1FJG K;  2OA8 A;  4M3X A;  5HBM A;  3PSF A;  1EQY A;  1U4B A;  2O4I A;  5HRO A;  3MXI A;  2QWR A;  3H08 A;  3DAW A;  1LV5 A;  3C65 A;  3QEW A;  3TAM A;  4X65 K;  2W6K A;  3QFU A;  3LDN A;  4LFB K;  1IKW A;  1QQN A;  1RBV A;  2WUS A;  5JVH L;  3HM8 A;  4CJT A;  4CEE A;  3OYF A;  4FLV A;  4CHY A;  4FJ9 A;  3I8D A;  4DV4 K;  2LSN A;  4CF0 A;  4WFN L;  1VK0 A;  5AFU H;  5BPM A;  3CJC A;  5HP1 A;  1L3V A;  5AQX A;  2P9K A;  3ZT4 A;  1TVR A;  5EVZ A;  1NG9 A;  4AHT A;  2ITG A;  2E2Q A;  2O8E B;  3TI0 A;  1J6Z A;  4KTZ A;  5E84 A;  1DTQ A;  3A5N C;  4FLX A;  5FLX O;  5I3U A;  3U3G A;  5J2N A;  1NJW A;  4H5R A;  4M41 A;  5AJ3 K;  1D4X A;  2OTJ N;  1KVA A;  1DTT A;  5C25 A;  4M3Z A;  1XMO K;  3TAR A;  3L3U A;  2GBZ A;  3O5B A;  4EP4 A;  4EHU A;  3G4S N;  4E0D A;  3LDO A;  4JI8 K;  2HNY A;  2OPS A;  1NK6 A;  1NNE A;  5CZ2 A;  3K59 A;  3M8P A;  2AJQ A;  2D5R A;  2ZWH A;  5J2M A;  3T69 A;  1U2V B;  4KO0 A;  5DM6 L;  4XH1 A;  1KQS M;  1B9D A;  2UU9 K;  1A5X A;  1T44 A;  4WQ4 A;  2PBD A;  3KD1 E;  1J53 A;  4CGD A;  1XC3 A;  1E4F T;  3I0S A;  4RW7 A;  3OYH A;  4IG0 A;  2G8V A;  3VQ4 A;  1SS6 A;  4MFB A;  3T19 A;  3M8R A;  3O3G A;  3HXM A;  5KTQ A;  5HRP A;  4ICL A;  3MCP A;  4JKF A;  4FLW A;  5FRO A;  1VQK N;  4DF8 A;  3NH1 A;  2X6S A;  3RTV A;  2QTD A;  4DSK A;  3QEP A;  3I0R A;  4I6M A;  4DMN A;  3DXM A;  1QS4 A;  2YHW A;  4BDZ A;  3NH2 A;  5KPZ A;  4EZ9 A;  2Q2R A;  2D0C A;  1KAX A;  4OKJ A;  3HZ6 A;  1JJ2 M;  1L3U A;  2QXF A;  5AQP A;  5JVG L;  5DK5 A;  3CC2 N;  1N8R O;  1YTA A;  4HCB A;  3VEO A;  1FKP A;  1ZXO A;  2CGJ A;  4HTU A;  3QFP A;  2Q3S A;  2QWQ A;  4W5T A;  1CZB A;  4KH4 A;  4CVN E;  2FSN A;  4YOR A;  4K42 A;  2E6L A;  3VQC A;  4FK4 A;  2RN2 A;  2NRZ A;  4FLY A;  3VQ9 A;  4CJL A;  4W5R A;  4PA1 A;  3VF6 A;  3CXC M;  2IVO A;  3KLG A;  3CFR A;  4NYN A;  4I2Q A;  5E26 A;  4DKW A;  2P9U A;  1I39 A;  3W0L A;  4E3S A;  2VGM A;  2HF3 A;  2WBN A;  5GAD P;  4KI4 A;  2Q0R A;  2JGU A;  4IZ9 A;  4MDB A;  3QIN A;  3FR0 A;  5CHI A;  5GIP A;  3G6E N;  3EZW A;  1JCE A;  2XO7 A;  1S9G A;  1TL1 A;  3L4Q A;  3SZ2 A;  3A0I X;  1W2B M;  2E20 A;  2GV9 A;  2EWS A;  4CHO A;  1LWF A;  4A62 A;  2X74 A;  3AV9 A;  1HNI A;  2GEL A;  4B3O A;  4BQL A;  4CJQ A;  1VAZ A;  5GIN A;  2HOE A;  2O8F B;  1WSF A;  3IFR A;  4AHR A;  4LFC K;  3V4I A;  2OZM A;  4CD1 A;  3K5O A;  4LH5 A;  3ITH A;  2WOM A;  2P9I A;  4WF9 L;  1P90 A;  5LJW A;  2GWJ A;  5M1F A;  3CI5 A;  2YJE A;  3CCV N;  1KLN A;  4ISF A;  1VSD A;  3O4Q A;  4DSJ A;  1WBB A;  3VA3 A;  4JKC A;  2E88 A;  5J2Q A;  3D0P A;  4CJE A;  3EKU A;  3A2F A;  4BRG A;  4O0I A;  4NLB A;  3VMF B;  5M1Q A;  4N5S A;  3OS1 A;  3CMA N;  3DLE A;  3RSE A;  2Z1H A;  4H0V B;  3O08 A;  1EXQ A;  4A5B A;  4DR7 K;  1Q9X A;  3PY8 A;  2ZF5 O;  1C0G A;  2ATQ A;  3SAG A;  4YHH K;  4CJW A;  2PFU A;  2E2N A;  4K43 A;  5AQI A;  3BZK A;  1RDB A;  4DUY K;  1HMV A;  2V52 B;  2IDO A;  3L2U A;  4BE1 A;  3LP0 A;  1HNV A;  3LDS A;  3KKR A;  4JI0 K;  1RFQ A;  1YF5 L;  3WNF A;  1NK5 A;  5CYM A;  3OYA A;  1ATN A;  4KRF A;  1UOC A;  3D45 A;  3MK6 A;  4KHP K;  1G15 A;  1X3M A;  1OVQ A;  3P1G A;  3QIP A;  1BDG A;  3H1Q A;  4J2E A;  4PWD A;  5AZI A;  1NMN A;  3ZSO A;  1S1U A;  2OZS A;  3T7Z A;  3NFA A;  2F8S A;  4CJR A;  3DMJ A;  3FZH A;  5FRN A;  3PSI A;  4LFA K;  3WXI A;  2Q31 A;  2VG6 A;  1BQM A;  1NJI O;  2YHB A;  1OH7 A;  3MXM A;  4JI6 K;  3NGI A;  3LPU A;  4O44 A;  5AZJ A;  3FZF A;  5FDL A;  4R5P A;  3THW A;  4IFY A;  3ZEU B;  4B3T K;  2KKZ A;  1TUU A;  4B3S K;  1QSL A;  3C0B A;  2W40 A;  4B9L A;  4YOT A;  1I94 K;  3ALY A;  2H3G X;  5T7B A;  2OTL N;  1N6Q A;  3VEX A;  1OH8 A;  4B9V A;  4I2P A;  4FXD A;  3V1Q A;  2YKM A;  4NLC A;  1M90 O;  4H4M A;  5KGX A;  2GWK A;  4DB3 A;  2CH6 A;  5ELZ A;  2VCP A;  3AGR A;  3LDL A;  4BRE A;  3THX A;  1WN7 A;  1ZBL A;  1HNW K;  2WTU A;  1UWB A;  4CJP A;  3O80 A;  5CY4 A;  3F5T A;  1ESV A;  4FWM A;  4KHU A;  3VPZ A;  4DV5 K;  1JCF A;  1RT6 A;  2YHY A;  3CC4 N;  3NMU A;  4CEB A;  3AA2 A;  3BDP A;  4YDU A;  1J9A A;  1VSJ A;  4JKG B;  4PHT X;  4DTP A;  3HTV A;  5AQU A;  3BGR A;  2QEX N;  2KQ2 A;  1SL2 A;  4BR7 A;  5KPR A;  2Q36 A;  2YX6 A;  4GMJ B;  4WQ4 C;  3THY B;  1O13 A;  4GY2 B;  1GLB G;  4X66 K;  3BEX A;  4AHC A;  3L2W A;  4YFU A;  5C2F A;  1VQ8 N;  1QHA A;  4ILJ A;  1Q8I A;  1BI4 A;  4DFM A;  4JAX A;  3SMS A;  1EP4 A;  2P9N A;  4B1X B;  1JCG A;  3F2K A;  3TTD A;  3VQ7 A;  4O4G A;  1XMQ K;  3WXL A;  4BWJ A;  4BY9 C;  4FVU A;  1RTH A;  2QWN A;  3RMC A;  4CIE A;  4DU1 A;  3OA9 A;  3O9Q A;  4JK8 A;  3EE8 A;  3WXJ A;  4F3O A;  3FZL A;  2YV0 X;  2G8F A;  4IEE A;  2PY5 A;  2HF4 A;  4BRA A;  4NO7 A;  3HRG A;  3TPQ A;  4IXC A;  3OYG A;  3DLH A;  1VQ7 N;  4CEQ A;  2QKB A;  1HPZ A;  4JEP A;  3BP8 A;  1NLV A;  3UKR B;  1S6P A;  2ASM A;  3CQY A;  3R9P A;  3AVG A;  1NK7 A;  1KAY A;  4LF8 K;  1IH7 A;  4G1Q A;  4JKD A;  5KQD A;  2IIR A;  2HBM A;  1GOC A;  4BQZ A;  3BUZ B;  5E41 A;  1JXE A;  1KRP A;  1KD1 O;  1FKO A;  1GLD G;  2A41 A;  4IFV A;  1B92 A;  1TGO A;  4FJX A;  1JXB A;  3CFO A;  4K25 A;  1GLJ O;  2RF2 A;  4KH5 A;  3OBW A;  2W6L A;  4JS4 A;  4N76 A;  4DR3 K;  3VEN A;  4QS8 A;  3CJ9 A;  1MA9 B;  4B9S A;  4DU4 A;  2O8C A;  4KV8 A;  3H45 C;  3ATU A;  3GG4 A;  3CC7 N;  4IDK A;  2F9T A;  3TAP A;  4GVE A;  1Y64 A;  4BRL A;  4WQ5 A;  4KHS A;  3EY1 A;  3VQA A;  3C95 A;  4AM7 A;  3K58 A;  3S41 A;  3AVN A;  3ZET B;  3SV4 A;  5FPN A;  5AQQ A;  4JK9 A;  4DSL A;  4CZK A;  1BCO A;  3RRG A;  2P9S A;  4ZHR A;  3KTQ A;  4E7K A;  1Q7Y O;  4F3T A;  3MN6 A;  3VGM A;  3VER A;  3SUN A;  4YOU A;  5JLF A;  4HUE A;  2A3Z A;  4LSL A;  4BRD A;  4OKK A;  3TAE A;  3K5N A;  3SPY A;  1VSM A;  3H46 O;  4CBW A;  3I33 A;  1WUA A;  3T3F A;  3U9Z A;  3QLH A;  2BE2 A;  2HBJ A;  3QET A;  3BF1 A;  4AH9 A;  3U6F A;  1D5A A;  4QCL A;  5GAH P;  3O4W A;  4C8K A;  4N56 A;  4W5Q A;  3PIO L;  4CFA A;  3OYJ A;  3RR8 A;  3KHY A;  3D2E B;  1BA1 A;  2BAN A;  3EL2 A;  2VWJ A;  4DU3 A;  1TUY A;  1W97 L;  2VWK A;  2Y1I A;  3DRP A;  4J8F A;  3MEC A;  3U9D A;  4CF8 A;  4A57 A;  1LWC A;  5KPT A;  4ELV A;  1WNS A;  4BC4 A;  4HHT A;  1BU6 O;  3AO1 A;  2QW9 A;  1NJX A;  4FLU A;  3O9S A;  4DR2 K;  4K41 A;  2GX9 A;  4BVO A;  3NAE A;  4PKH A;  1P8Z A;  3SK3 A;  5AQK A;  3C6A A;  3DLL L;  2KW4 A;  4DR4 K;  1XI1 A;  1NJY A;  2O8D A;  5TKY A;  1K8A O;  5JS2 A;  2G8U A;  4KB1 A;  1XQS C;  5GAE P;  3EE9 A;  3HOS A;  4KTQ A;  1RDA A;  1IKV A;  1JKH A;  1KCF A;  5HRN A;  1J5E K;  3ZSQ A;  3ZSX A;  2D1K A;  1X9W A;  2CH5 A;  3OYC A;  3CCQ N;  2ASP A;  2XHB A;  4KHQ A;  4Z4E A;  3LP1 A;  4A61 A;  3QEV A;  5AQY A;  1S1W A;  2IVN A;  3CJ1 A;  3JYT A;  4DTR A;  4IOX A;  3VQE A;  1QSS A;  2Y1J A;  4AQY K;  1SUQ A;  3OYN A;  4FW1 A;  2O8F A;  2HHU A;  1LWE A;  3WEE B;  4JI7 K;  4DTN A;  4FWS A;  3AO5 A;  1OVY A;  3C7N A;  3ID6 A;  4Y1D A;  3SAH A;  2GTD A;  2WON A;  3TAF A;  5FPE A;  5TKW A;  4H5T A;  4FJ7 A;  1ATR A;  2NRW A;  2F4V K;  4HTL A;  2X78 A;  3ENB A;  4CJ3 A;  3AAP A;  1YIJ N;  4FLZ A;  3MWT A;  1K8K B;  1YAG A;  3GL1 A;  5C12 A;  4E7H A;  4L3Q A;  2VG5 A;  4IBN A;  1S1T A;  4H5V A;  3OJS A;  4M7X A;  3B8A X;  2ZGY A;  3A5L C;  1Q81 O;  4CK1 A;  1LW0 A;  4OLB A;  1TL3 A;  4E7I A;  3QML A;  2XRI A;  3VF2 A;  4YDU C;  4JKE A;  1ASV A;  1RTI A;  2ZQB A;  1R59 O;  2KHO A;  3KWI A;  4H0O A;  2D0A A;  1FXX A;  1CXU A;  3E9O A;  1WSJ A;  1NK8 A;  4CZJ A;  3OS0 A;  4JI3 K;  1IV0 A;  1RNH A;  4E1N A;  3M8Q A;  1L5U A;  5EXW A;  3D2F B;  2BDP A;  1VQ4 N;  2O8B A;  1JLE A;  2NNW A;  5AQO A;  3HSC A;  3M6G A;  3NDK A;  1QSY A;  1S1V A;  1KLM A;  4CJ4 A;  5AR0 A;  4OGC A;  3DRS A;  5AQV A;  3V9W A;  4H03 B;  3KLE A;  4CE9 A;  1EO1 A;  3MEE A;  4CJ5 A;  4BE2 A;  4BVP A;  3CCM N;  2P9P A;  4WYB A;  4M3W A;  4KPY A;  3TAG A;  2Z1I A;  4FM2 A;  1YI2 N;  1HKB A;  2F9W A;  3M8S A;  5AQW A;  3OY9 A;  4BC2 A;  4BR0 A;  1ZYQ A;  4GKJ K;  1K9M O;  3LZJ A;  4FW2 A;  1VSK A;  2A1R A;  2UUC K;  1Y97 A;  3HBT A;  4CF9 A;  4CJF A;  5AQJ A;  3WNE A;  4LY7 A;  3QB0 A;  3WQU A;  4NCB A;  1B9F A;  4X62 K;  4ZTJ A;  5C10 A;  2PAV A;  4JI5 K;  1MDU B;  5AQG A;  1IBL K;  3AVB A;  1TKZ A;  5AQF A;  1MU2 A;  1WSI A;  3GE1 A;  4FWL A;  1IBK K;  1ZC6 A;  1T7P A;  1T8E A;  4BRO A;  1FK9 A;  4FVM A;  4RW8 A;  4FJL A;  4JHD A;  4AF1 A;  4FSV A;  5H1S Q;  3SUQ A;  4BRP A;  3PX6 A;  3CCS N;  2UUB K;  3TAB A;  4DR5 K;  3VOV A;  4PQU A;  2DFH A;  3MEG A;  4WQ5 C;  3AVF A;  1WB9 A;  1FW6 A;  1VRT A;  4Z4G A;  4IJA A;  4Z94 A;  3KKS A;  3S3N A;  2XY8 A;  1JLF A;  3AA3 A;  3P38 A;  3P31 A;  3R3L A;  3NF6 A;  3T1A A;  3MAQ A;  4FJK A;  2QWL A;  3WNG A;  4CBU A;  3KK7 A;  1VQN N;  1TYQ B;  1VSI A;  2HND A;  5JMV A;  2P51 A;  4FWP A;  2QI2 A;  1EWQ A;  3J7Z O;  3DLK A;  1HKC A;  3I56 N;  4WE1 A;  3V1R A;  2QXL A;  3QES A;  1JLA A;  2VG7 A;  3F73 A;  4W5O A;  3KK2 A;  3HVT A;  4FPB A;  2P9L B;  4GW6 A;  4Z0U A;  1EX4 A;  1NKB A;  2KFN A;  5C0Y A;  4DFP A;  2OPR A;  1NK9 A;  1M1K O;  1BIU A;  4M3Y A;  4DV3 K;  3S9H A;  5CYQ A;  5A2Q O;  3BZC A;  3MCA B;  4BG8 A;  3S3M A;  3K5M A;  4DV2 K;  1NMD A;  3O9U A;  3AA5 X;  4CZE A;  2RHK A;  2CGK A;  2YNI A;  4DR1 K;  1NOY A;  4F2S A;  1L3S A;  1SL0 A;  4IKF A;  3R1X A;  5LMN K;  4NCA A;  4G9Z A;  1E4G T;  1TK8 A;  4BRI A;  2PZS A;  3CFP A;  1YIT N;  2E2O A;  4JD2 B;  1HYV A;  1SKR A;  2QK9 A;  3L4I A;  3A8Y A;  1RBU A;  4Z4I A;  5KRT A;  4DQI A;  2YI1 A;  2JLE A;  5FRM A;  1EWR A;  4CHQ A;  3OHR A;  4FPA A;  1RT7 A;  3O9T A;  4H0Y B;  3J8A A;  2V7Z A;  4I9Q A;  1DEJ A;  2I5J A;  2HB5 A;  2NUB A;  4LD0 A;  3FGU A;  4DLE A;  1BIZ A;  3ULE A;  4B8C A;  4EFH A;  3RR7 A;  5J1E A;  2KTQ A;  3OYD A;  4DTS A;  4N41 A;  1QE1 A;  5CE3 A;  2YNG A;  4H0T B;  4ISE A;  5C15 A;  3AVH A;  2HHS A;  5KGW A;  1W0H A;  4MO4 A;  1QVF M;  2DY4 A;  1VSH A;  2D0O A;  3W3D A;  5M1P A;  2HHQ A;  1NGA A;  2OPP A;  2P5G A;  5SZT A;  3T1Y K;  3NVK A;  4LF9 K;  2EHG A;  5AQS A;  1TK0 A;  4CEO A;  4FJM A;  1NGH A;  2RE2 A;  2YKN A;  3QBX A;  3KWG A;  2IAJ A;  2OPQ A;  2P9K B;  4B1U B;  3LAK A;  2FLO A;  1SV5 A;  4B1Z A;  4BDY A;  2FC0 A;  3ZT1 A;  4CEZ A;  4KHW A;  4FYD A;  4YNQ A;  3VTI A;  4DV7 K;  4CGF A;  1LCU A;  1S1X A;  1W9H A;  2Q1N A;  1DKG D;  3CPE A;  3D2E A;  1IO2 A;  5IT9 O;  4FCY A;  3SUP A;  1RBR A;  1NGC A;  3KIO A;  4EIA A;  3ZT0 A;  4FOE A;  4LF6 K;  4DF4 A;  3K2P A;  1KXP A;  1LAV A;  1ZBU A;  1ZBS A;  4MLH A;  3L2V A;  5LL6 Z;  4EAH D;  4FJI A;  4IO8 A;  4FO0 A;  1QQC A;  3H3O B;  3SLC A;  4C1N K;  5F1X A;  4CFC A;  5CZ1 A;  1XHX A;  4WFB L;  3QER A;  2KLA A;  3M1F A;  3MX5 A;  4DUZ K;  1SKW A;  1TKT A;  4IG3 A;  3E66 A;  5AQM A;  2I7P A;  2HHW A;  2B4J A;  5M1O A;  3ZCM A;  2E2P A;  2WFB A;  1D9F A;  4CGH A;  4CJK A;  4RG8 A;  4KBO A;  4BC3 A;  5BRD A;  2ITM A;  2IS3 A;  3QDK A;  4NXM K;  2YJF A;  3LWL A;  1WLJ A;  4GV6 A;  4QS9 A;  4BRQ A;  4RTF D;  3MMV A;  4FLT A;  4I6M B;  3DXM B;  3H1V X;  1GLE G;  4O55 A;  3PV8 A;  2WC9 A;  3KLI A;  2I7N A;  3AAR A;  3H3N O;  1YVN A;  3NCI A;  3B6O A;  3VTH A;  2VQE K;  1XUP O;  2D4W A;  3HOT A;  2F7T A;  1ZBI A;  3UKU A;  4CBX A;  1H1V A;  4BAC A;  4I7F A;  4A2A A;  4OPK A;  2ZM6 K;  4BGA A;  4CEA A;  1HR0 K;  4J2B A;  3DLB A;  1Z25 A;  5EOY A;  5BR8 K;  3NHG A;  5SWM A;  4KAZ A;  2A6A A;  1HRH A;  3OYI A;  2KFZ A;  3VGL A;  3D6R A;  1NJZ A;  4RW9 A;  3CCL N;  3V9U A;  3J81 O;  5AQT A;  2P9U B;  1S72 N;  4CHP A;  3K57 A;  3RMD A;  2Q97 A;  4M42 A;  4H0X B;  1C1A A;  3VF4 A;  3LAN A;  4H5N A;  4OVL A;  3HP6 A;  2O8E A;  1QQO A;  2JWK A;  1D9D A;  3J80 O;  1EKE A;  3G71 N;  4CZF A;  3U3Y A;  4QOZ B;  1NK0 A;  1YJW N;  4E7L A;  3ZX0 A;  1OH5 A;  4ILG B;  3VEV A;  3SNN A;  1GLF O;  3ID8 A;  4XIU A;  4FZX C;  3MX2 A;  3CCR N;  1KFD A;  2BTF A;  4PY5 A;  5F2R A;  3FLC O;  1QTM A;  4DLG A;  3AVJ A;  2Q0U A;  1RDW X;  4ID5 A;  3OJU A;  4FZY A;  1U2V A;  4YOY A;  1W7A A;  4FJ5 A;  2P9I B;  1S3X A;  4MQ3 A;  5BN9 A;  5C24 A;  5F0X A;  3OBY A;  3VQD A;  3B6P A;  3Q7C A;  4MLE A;  1UA0 A;  4FJH A;  1RT4 A;  3AAQ A;  4B9N A;  1JLC A;  1VQL N;  2W41 A;  3ATV A;  3AVK A;  3SUO A;  5HLF A;  3P39 A;  4DFJ A;  3VQ8 A;  1C6V A;  4QS7 A;  2FXU A;  3PX0 A;  4FK0 A;  4M3U A;  3AO2 A;  3DYA A;  2G8I A;  1IKX A;  5KQ8 A;  1Q9Y A;  3S3O A;  1LAW A;  3FE1 A;  3DM2 A;  3PX4 A;  1Z05 A;  2OYQ A;  3RSE B;  3L2R A;  3WUH A;  3ZSW A;  3OYL A;  4CIG A;  1S5J A;  1T6D A;  4ILH A;  3QNO A;  4XEI A;  2O4G A;  4BDP A;  4PUO A;  2IVP A;  4E89 A;  1T05 A;  4ISG A;  1KFS A;  2BGG A;  3V9Z A;  3K9K A;  2X6N A;  3OYE A;  2GUI A;  5AQR A;  4EHT A;  5B8H A;  4F8R A;  3J7Y P;  3E01 A;  1RTJ A;  5HL7 L;  2ZJP L;  1YT3 A;  1RT5 A;  1DLO A;  5HRS A;  1BHL A;  1S22 A;  3NE6 A;  4GVM A;  3KD5 E;  4CZL A;  3QNN A;  1VQ6 N;  3ZSY A;  3LAL A;  4B08 A;  3VEY A;  2P1J A;  2R7Y A;  5AZI B;  4FK2 A;  3DRR A;  4CEF A;  3RRH A;  3SQ1 A;  4ELU A;  1WAF A;  2OAN A;  1C0F A;  4H5W A;  3JSM A;  3IG1 A;  5AQZ A;  4KB0 A;  1HUX A;  3AVA A;  2A40 A;  3WXM B;  4LF4 K;  3HP9 A;  5DM7 L;  3PIP L;  3ZLJ A;  1NKC A;  3ZX2 A;  4NXN K;  4OPH A;  3THW B;  3HPH A;  4B9Q A;  1RT2 A;  3RMA A;  3HPG A;  4JV5 K;  5EU7 A;  3DLG A;  2RPI A;  3SQ0 A;  1HPM A;  1X9S A;  4IO9 L;  1KAZ A;  1IBM K;  1BL3 A;  3DXK B;  1WOQ A;  2QWM A;  2A5X A;  3CJA A;  3FFI A;  4AHS A;  3LDQ A;  4LF7 K;  4DV1 K;  4FWO A;  3O8M A;  4Y1C A;  5ADX A;  4DTJ A;  3L8B A;  3VQB A;  4TSX A;  4LF5 K;  1HYS A;  4BR9 A;  4DTX A;  3THX B;  1IJJ A;  3NF8 A;  4GNI A;  3TSU A;  4CGI A;  4JI2 K;  1Q86 O;  4B9M A;  1JLQ A;  4E1M A;  4M3T A;  3IS9 A;  3DWL A;  5BRF A;  2HHH K;  4AHV A;  1LOT B;  2E1Z A;  3T1H K;  2AA4 A;  1U47 A;  2FF6 A;  4DTO A;  2D0P A;  4FWQ A;  4JKH A;  4CZH A;  4AIL C;  1VSE A;  3DLR A;  4KHY A;  1SZ2 A;  4IWV A;  3VET A;  3CM5 A;  3CCU N;  3O1W A;  3PO4 A;  2YHA A;  2XY6 A;  1SKS A;  3ENH A;  4BRF A;  3EO3 A;  3C6H A;  3HT3 A;  3G25 A;  3CQX A;  1N34 K;  1BI4 B;  1XHZ A;  4M63 C;  3O1B A;  2P9N B;  3NF7 A;  3SBT A;  4F2R A;  4U7B A;  1NGI A;  3NGY A;  3HI0 A;  2YCH A;  4FWK A;  3HM9 A;  1WSG A;  4CFD A;  3O3H A;  3LL3 A;  3CM6 A;  4YOX A;  3P5J A;  3QEX A;  2FBY A;  4FWN A;  3C94 A;  4Q5V A;  3HO1 A;  1HKG A;  4BR5 A;  2NRR A;  3TAQ A;  1ZBF A;  4GKK K;  1C1C A;  4BRC A;  1HNZ K;  3E1Y A;  2HHT A;  3AA4 A;  5ADX H;  2HMI A;  2YHX A;  3V6D A;  1BOT O;  1Z6R A;  1HYZ A;  1DT9 A;  4BR2 A;  1KTQ A;  1YHQ N;  2FBX A;  4DV6 K;  5KI6 A;  1IG8 A;  4B1Y B;  3DJC A;  3QBW A;  2QWO A;  3ZEU A;  3ZT3 A;  3SV3 A;  4K8Z A;  1RDC A;  4BWM A;  2ETJ A;  5MLC Q;  1TAQ A;  1HQU A;  1WSH A;  3OYK A;  2ZJR L;  4CEC A;  3WQT A;  2O8C B;  4CJU A;  3TTF A;  4OO1 J;  3SYZ A;  3AVM A;  4DV0 K;  5FPD A;  1NGE A;  1TK5 A;  5AQN A;  1VSF A;  1T6C A;  4H0P A;  4NYF A;  3G0Z A;  4CHN A;  5HRR A;  3EKS A;  1UA1 A;  1VQ9 N;  3SQ4 A;  4Q0B A;  1NGJ A;  3KLH A;  2G8K A;  1CZA N;  2P9S B;  3WXK A;  1U45 A;  2P5O A;  3E9L A;  4JKA A;  2HMP A;  5M1K A;  3HYF A;  3H6E A;  2YNH A;  1SQK A;  4KKO A;  4RW6 A;  3HPO A;  4E19 A;  4FL9 A;  1CZ9 A;  3KJV A;  4JKG A;  4BRN A;  2A42 A;  5BR9 A;  3LWM A;  4FJG A;  1GOA A;  1C1B A;  3MN9 A;  3NGZ A;  4UQG A;  4JLH A;  3EN9 A;  4O8K A;  4AM6 A;  1S6Q A;  3LM2 A;  4JN4 A;  1RGI A;  2W42 A;  1BO5 O;  3MXJ A;  3TTC A;  3CME N;  4C1N I;  3THY A;  3VQP A;  3BF3 A;  2E4L A;  4M3R A;  3UIQ A;  1NOZ A;  3CHW A;  4KHN A;  4FJJ A;  2UXB K;  4K0K K;  3MWP A;  2F96 A;  3EYZ A;  1YTU A;  1C0U A;  3OYB A;  2UUA K;  3CPW M;  4B9T A;  3V9X A;  4CZI A;  3AVC A;  4CF1 A;  1YJ9 N;  1RDU A;  3CJB A;  2ZJQ L;  4YOV A;  2HST A;  3TR8 A;  5K14 A;  3RVC A;  1T03 A;  2HW3 A;  1X1P A;  3JS6 A;  4I9L A;  1JL2 A;  2V7Y A;  4DQR A;  2VQF K;  5IWA K;  4B3R K;  2HHX A;  1U48 A;  3KVG A;  1U6Z A;  3L0Q A;  4NCG A;  2EX3 A;  3SI6 A;  4CES A;  4BC5 A;  5AQH A;  4A59 A;  1VQM N;  1F21 A;  3UKR A;  4RWT A;  4Z4F A;  3VQ5 A;  3UB5 A;  3F9K A;  4KRE A;  2DFF A;  4DQ8 A;  3TWH A;  3C6T A;  3IRX A;  1VQ5 N;  1VRU A;  2O8D B;  3O3F A;  1BA0 A;  3K9J A;  2V51 B;  3JAM O;  3RMB A;  1REV A;  4B1V A;  1J5O A;  1NWK A;  3GBT A;  1KC8 O;  5LJV A;  3LP2 A;  3AVL A;  3LPT A;  3OW2 M;  4FWR A;  3V9S A;  3WNH A;  4C8M A;  2Z1J A;  4L8R B;  2ASO A;  4JK7 A;  4OPA A;  4CJS A;  3MN7 A;  1YXQ A;  1S9E A;  4NB4 A;  3C7N B;  4DSE A;  5I42 A;  3CCJ N;  1WSE A;  4DQQ A;  4DR6 K;  4DS5 A;  2UXD K;  3JXU A;  3TSP A;  1ILY A;  1TV6 A;  4YY3 K;  4ZTF A;  3ZET A;  3VES A;  1LW2 A;  1G99 A;  3Q7B A;  4F4K A;  4ELT A;  1SL1 A;  3ZYY X;  5EX5 A;  3MDQ A;  1ASW A;  1CLQ A;  1QQM A;  4WFA L;  1K73 O;  3OS2 A;  4HUF A;  3SQ2 A;  3D7E O;  2HBL A;  1RBS A;  5C42 A;  3DOL A;  1RT3 A;  4O0J A;  5I9E B;  3NF9 A;  4Z4H A;  1K6Y A;  4CGJ A;  3ASM A;  1U04 A;  2E6M A;  4U67 L;  5HOO A;  2E1Y A;  3A5O C;  5KRS A;  2VWB A;  3E9P A;  2DTU A;  3HJF A;  1NGB A;  2ZE2 A;  5DMR A;  2NRX A;  1QZ5 A;  2DPN A;  3CQ8 A;  1C0M A;  1J54 A;  1Z26 A;  4MO5 A;  1D8Y A;  3EEQ A;  1I3A A;  4C8O A;  4CK2 A;  3IMX A;  4HCC A;  2O8B B;  3O9R A;  3IAY A;  4DSF A;  3TU5 A;  1NU0 A;  1V4T A;  3HL8 A;  4J2A A;  3ENO A;  3U4L A;  2PYL A;  3NVM A;  1A5W A;  4H8K A;  4DWI A;  1RDD A;  1EET A;  1RT1 A;  2VGN A;  4KH6 A;  4PL7 A;  2P9P B;  3N4Q A;  3PLA A;  3PO5 A;  4JYA K;  4AHU A;  2HHV A;  4IFE A;  4HUG A;  3SJH A;  4F9O A;  1VQP N;  1A5V A;  4FJN A;  1RBT A;  3CET A;  4OJR A;  3V81 A;  1CXQ A;  3MN5 A;  1Q18 A;  3R8E A;  4KFB A;  3RWU A;  4FZZ A;  5CR4 A;  2NLX A;  3AO4 A;  4CZM A;  4N47 A;  2HVH A;  3KLF A;  4Y0W A;  1HJR A;  1JLB A;  2JWL A;  3DXK A;  3LAM A;  4CK3 A;  4YOW A;  4HVJ A;  1NGF A;  4FM0 A;  1NKE A;  5GAG P;  2KZZ A;  5EY4 A;  3VEW A;  5BPN A;  4HWI A;  4O5B A;  5LMU K;  4B9U A;  1DGK N;  5C2D A;  3FZM A;  1N36 K;  3QIC A;  1YJN N;  4LC9 B;  3IKM A;  3LDP A;  3CD6 N;  3EZ5 A;  4CJV A;  4JHD B;  5BPL A;  3CCE N;  1VQO N;  3WEE A;  3F9M A;  4M45 A;  1GLC G;  5FPM A;  4KI6 A;  3FZK A;  2RKI A;  2E5L K;  5M1N A;  5BRH A;  1KSP A;  2GUP A;  3PUF A;  1RCH A;  3SCX A;  3MED A;  1JL1 A;  1SAZ A;  4FOI A;  3LZI A;  3C6U A;  1O1W A;  1NK4 A;  4BR4 A;  4CW7 B;  2CGL A;  4LSN A;  3ZX3 A;  4M7Y A;  1K8K A;  1HJO A;  3AVI A;  1NBW A;  1UAX A;  1X9J A;  4DTU A;  4PL8 A;  1GLA G;  1IG9 A;  1Q82 O;  2FSJ A;  5GIO A;  3TAN A;  2NRV A;  4JRQ A;  4FJ8 A;  3LM9 A;  3HST B;  2D0B A; 
#chains in the Genus database with same CATH homology
 3DLE A;  4LY7 A;  3WNE A;  3SQ0 A;  1X9S A;  2Z1H A;  4BE0 A;  2FBT A;  4NCB A;  1B9F A;  1BL3 A;  1EXQ A;  2B6A A;  4ZTJ A;  1Q9X A;  3PY8 A;  2G8I A;  2ZD1 A;  3FFI A;  4AHS A;  2ATQ A;  3AVB A;  1TKZ A;  4QAG A;  4CGG A;  1MU2 A;  1WSI A;  4CJW A;  4C8L A;  4Y1C A;  4DTJ A;  4CFB A;  3L8B A;  3VQB A;  1L3T A;  1TKX A;  1T7P A;  1T8E A;  4TSX A;  1HYS A;  1RDB A;  1HMV A;  2IDO A;  3L2U A;  4BE1 A;  3LP0 A;  1FK9 A;  1HNV A;  3LDS A;  4DTX A;  3KKR A;  3NF8 A;  4FVM A;  4RW8 A;  3SPZ A;  1N5Y A;  4FJL A;  3WNF A;  1NK5 A;  4CGI A;  3L2Q A;  1QHT A;  3ISN C;  5CYM A;  3OYA A;  4B9M A;  4KRF A;  1UOC A;  1JLQ A;  4E1M A;  4M3T A;  3D45 A;  3IS9 A;  1G15 A;  3LP3 A;  3SUQ A;  2XY5 A;  4CED A;  1VSL A;  3PX6 A;  3P1G A;  2QKK A;  1TKD A;  3QIP A;  3TAB A;  4AHV A;  1KVB A;  4J2E A;  4PWD A;  2G8H A;  4PQU A;  2IOC A;  2IC3 A;  1C0T A;  1S1U A;  3ZSO A;  1U47 A;  2DFH A;  3NFA A;  3MEG A;  4JS5 A;  4DTO A;  2F8S A;  3AVF A;  4CJR A;  1VRT A;  3DMJ A;  4ID1 A;  4Z4G A;  3QIO A;  5FRN A;  4AIL C;  1VSE A;  3DLR A;  2OZS A;  4KHY A;  4OPJ A;  2F8T A;  3CM5 A;  3KKS A;  2Z1G A;  2VG6 A;  2HNZ A;  4FM1 A;  1BQM A;  1GOB A;  2XY8 A;  3S3N A;  1JLF A;  3AA3 A;  2YHB A;  3PO4 A;  2YHA A;  3MXM A;  3NH0 A;  3ZSZ A;  3NF6 A;  3T1A A;  3NGI A;  2XY6 A;  3LPU A;  4O44 A;  4Z4C A;  3MAQ A;  1SKS A;  5FDL A;  4FJK A;  4R5P A;  3WNG A;  1JLG A;  4CIF A;  4IFY A;  3HT3 A;  3VA0 A;  4EP5 A;  1VSI A;  2HND A;  3K5L A;  2P51 A;  1QSL A;  4CCH A;  1BI4 B;  4B9L A;  1XHZ A;  3DLK A;  3ALY A;  4WE1 A;  3NF7 A;  4W5N A;  3V1R A;  5T7B A;  3QES A;  4F2R A;  1N6Q A;  3KK3 A;  1WAJ A;  3NGY A;  4I2P A;  4B9V A;  1KVC A;  4FXD A;  3V1Q A;  3HM9 A;  1JLA A;  1WSG A;  2YKM A;  2VG7 A;  4CFD A;  4H4M A;  4W5O A;  3O3H A;  3KK2 A;  3CM6 A;  3F73 A;  3HVT A;  5KGX A;  2PYJ A;  5J2P A;  2IGI A;  4GW6 A;  3P5J A;  3QEX A;  4Z0U A;  1EX4 A;  1NKB A;  5D3G A;  2KFN A;  2FBY A;  4OKE A;  4DFP A;  2OPR A;  1NK9 A;  1WN7 A;  1U49 A;  1ZBL A;  1BIU A;  3C94 A;  3V1O A;  4Q5V A;  4M3Y A;  4K8X A;  3HO1 A;  2B5J A;  3S9H A;  5CYQ A;  1UWB A;  3TAQ A;  1ZBF A;  4CJP A;  3ULD A;  1C1C A;  5CY4 A;  3S3M A;  3K5M A;  3HK2 A;  1YVU A;  2YNF A;  4E7J A;  4KHU A;  3G10 A;  2HHT A;  3AA5 X;  3CYM A;  2XY7 A;  1RT6 A;  2YNI A;  3AA4 A;  3ZSV A;  1NOY A;  4F2S A;  1L3S A;  1SL0 A;  4IKF A;  4CEB A;  3AA2 A;  3BDP A;  4NCA A;  1J9A A;  1VSJ A;  3THV A;  2HMI A;  3VQQ A;  3L3V A;  1TK8 A;  4DTP A;  4DQP A;  3V6D A;  4C8N A;  3CFP A;  2PZS A;  3BGR A;  3P83 D;  2KQ2 A;  1HYZ A;  1SL2 A;  1KTQ A;  1HYV A;  2FBX A;  1SKR A;  1BQN A;  4JRP A;  2QK9 A;  4GMJ B;  4M3U A;  3ZT2 A;  1RIL A;  5KI6 A;  4CF2 A;  1ZBH A;  1RBU A;  4Z4I A;  5KRT A;  4DQI A;  4CER A;  2FBV A;  4DSI A;  3ZT3 A;  2JLE A;  5FRM A;  1XWL A;  4AHC A;  3SV3 A;  3OVN A;  1RDC A;  4BWM A;  2ETJ A;  4YFU A;  4CHQ A;  3KK1 A;  3L2W A;  4K8Z A;  3DI6 A;  1TAQ A;  1Q8I A;  1RT7 A;  1HQU A;  1BI4 A;  1WSH A;  3OYK A;  4DFM A;  4CEC A;  1EP4 A;  4CJU A;  4I9Q A;  2I5J A;  2HB5 A;  2NUB A;  4LD0 A;  3SYZ A;  4DLE A;  1BIZ A;  3AVM A;  3VQ7 A;  4O4G A;  4B8C A;  1RTD A;  3SJJ A;  3RR7 A;  5J1E A;  4BWJ A;  3DOK A;  3VN5 A;  2KTQ A;  1RTH A;  3OYD A;  4DTS A;  4N41 A;  3RMC A;  1TK5 A;  1HQE A;  1QE1 A;  1VSF A;  4CIE A;  4NYF A;  2YNG A;  4DU1 A;  3G0Z A;  4KTW A;  3AVH A;  4F3O A;  2HHS A;  4CHN A;  5HRR A;  5KGW A;  4DTM A;  1UA1 A;  2YV0 X;  3HVR A;  2G8F A;  2PY5 A;  1W0H A;  3OYM A;  3SQ4 A;  4Q0B A;  3KLH A;  2G8K A;  2DY4 A;  3OYG A;  3DLH A;  1U45 A;  2P5O A;  4CEQ A;  1XC9 A;  1IKY A;  3CG7 A;  2QKB A;  1HPZ A;  3NBP A;  1VSH A;  2HHQ A;  4J2D A;  4LH4 A;  4DG1 A;  2OPP A;  3HYF A;  1S6P A;  2P5G A;  5SZT A;  2YNH A;  3QO9 A;  3AVG A;  4DS4 A;  1NK7 A;  1X9M A;  4KKO A;  2EHG A;  4RW6 A;  3VQ6 A;  3HPO A;  1TK0 A;  4E19 A;  1BGX T;  1CZ9 A;  4CEO A;  3KJV A;  4FJM A;  1IH7 A;  4G1Q A;  2YKN A;  3LWM A;  4FJG A;  2KZM A;  1GOA A;  1C1B A;  1GOC A;  1ITG A;  3NGZ A;  5E41 A;  2IAJ A;  1JXE A;  4JLH A;  4UQG A;  1KRP A;  2OPQ A;  1FKO A;  1S6Q A;  2W42 A;  3LAK A;  3MXJ A;  1R0A A;  1SV5 A;  4IFV A;  1B92 A;  1TGO A;  4OGE A;  4FJX A;  1JXB A;  3CFO A;  3VQP A;  4B8A B;  4OLA A;  2E4L A;  4M3R A;  4BDY A;  2FC0 A;  3ZT1 A;  4CEZ A;  3UIQ A;  4KHW A;  4FYD A;  4YNQ A;  1NOZ A;  4KHN A;  2RF2 A;  4FJJ A;  4CGF A;  1TAU A;  4DFK A;  2HVI A;  1S1X A;  3AO3 A;  1BIS A;  2F96 A;  4JS4 A;  4DQS A;  4H4O A;  3EYZ A;  2G8W A;  2A1S A;  4RW4 A;  4N76 A;  1YTU A;  1C0U A;  1W9H A;  3OYB A;  1IO2 A;  1ASU A;  4FCY A;  1RBR A;  3KIO A;  4CHZ A;  3V9X A;  3SUP A;  3AVC A;  3ZT0 A;  4CF1 A;  4DU4 A;  4B9S A;  4KV8 A;  4EZ6 A;  4DF4 A;  4IDK A;  3K2P A;  5JS1 A;  3TAP A;  3TR8 A;  1BCM A;  2DFE A;  3O4N A;  1LAV A;  1ZBU A;  5K14 A;  3ZSR A;  4KHS A;  3QEI A;  1T03 A;  3L2V A;  3EY1 A;  2OA8 A;  4FJI A;  3VQA A;  3C95 A;  4M3X A;  2HW3 A;  5HBM A;  3K58 A;  1QQC A;  3AVN A;  3SV4 A;  1X1P A;  4I9L A;  1JL2 A;  4DQR A;  1U4B A;  2O4I A;  4CFC A;  5CZ1 A;  1XHX A;  3QER A;  5HRO A;  3MXI A;  2HHX A;  1U48 A;  4DSL A;  3H08 A;  4NCG A;  1BCO A;  2EX3 A;  3SI6 A;  1SKW A;  4CES A;  3RRG A;  1LV5 A;  4ZHR A;  3QEW A;  1TKT A;  3KTQ A;  3TAM A;  4N5S A;  4E7K A;  4IG3 A;  1F21 A;  4F3T A;  1IKW A;  2HHW A;  4Z4F A;  2B4J A;  3VQ5 A;  3ZCM A;  1RBV A;  3F9K A;  4KRE A;  2DFF A;  1D9F A;  3TWH A;  3SUN A;  3C6T A;  3IRX A;  4CGH A;  1VRU A;  4CJT A;  4CJK A;  4CEE A;  4RG8 A;  3O3F A;  3OYF A;  4HUE A;  4LSL A;  4FLV A;  4CHY A;  4FJ9 A;  3I8D A;  2LSN A;  4CF0 A;  1VK0 A;  2IS3 A;  3RMB A;  4OKK A;  3TAE A;  3LWL A;  5HP1 A;  3K5N A;  1WLJ A;  1REV A;  3SPY A;  1L3V A;  1J5O A;  3ZT4 A;  1VSM A;  1TVR A;  4AHT A;  2ITG A;  3TI0 A;  4KTZ A;  1DTQ A;  4FLT A;  3T3F A;  4FLX A;  3LP2 A;  3QLH A;  3AVL A;  3LPT A;  5I3U A;  2BE2 A;  3U3G A;  3V9S A;  3WNH A;  5J2N A;  3QET A;  1NJW A;  4O55 A;  2Z1J A;  4C8M A;  4M41 A;  3PV8 A;  4L8R B;  3KLI A;  4AH9 A;  3U6F A;  1D5A A;  4CJS A;  1KVA A;  1DTT A;  5C25 A;  4C8K A;  4M3Z A;  4QCL A;  3TAR A;  3L3U A;  4N56 A;  2GBZ A;  4EP4 A;  3NCI A;  1S9E A;  3B6O A;  4W5Q A;  4E0D A;  4CFA A;  3OYJ A;  2HNY A;  3RR8 A;  4DSE A;  5I42 A;  1ZBI A;  2OPS A;  1WSE A;  4DQQ A;  1NK6 A;  5CZ2 A;  3K59 A;  2BAN A;  4DS5 A;  3M8P A;  2AJQ A;  2D5R A;  4BAC A;  4I7F A;  2VWJ A;  5J2M A;  1TV6 A;  4OPK A;  4DU3 A;  4ZTF A;  2VWK A;  2Y1I A;  4CEA A;  4KO0 A;  4B9T A;  3DRP A;  4J2B A;  3DLB A;  3MEC A;  1LW2 A;  1B9D A;  4CF8 A;  1Z25 A;  1LWC A;  4ELT A;  1SL1 A;  4F4K A;  1A5X A;  4ELV A;  1WNS A;  4HHT A;  1ASW A;  3AO1 A;  3NHG A;  1CLQ A;  5SWM A;  4KAZ A;  1NJX A;  4FLU A;  1HRH A;  3KD1 E;  3OYI A;  1J53 A;  4CGD A;  3OS2 A;  4HUF A;  3SQ2 A;  2KFZ A;  3I0S A;  1NJZ A;  1RBS A;  4RW9 A;  4RW7 A;  5C42 A;  3OYH A;  3NAE A;  3DOL A;  1RT3 A;  4IG0 A;  3VQ4 A;  2G8V A;  4O0J A;  3NF9 A;  4Z4H A;  4MFB A;  1K6Y A;  3T19 A;  4CGJ A;  3ASM A;  3M8R A;  1U04 A;  3O3G A;  2E6M A;  3HXM A;  3V9U A;  5KRS A;  5KTQ A;  2KW4 A;  5HRP A;  4ICL A;  1XI1 A;  1NJY A;  2DTU A;  4FLW A;  5JS2 A;  2G8U A;  4KB1 A;  3HJF A;  5FRO A;  2ZE2 A;  4CHP A;  3K57 A;  5DMR A;  3RMD A;  4KTQ A;  4M42 A;  1RDA A;  4DF8 A;  1IKV A;  1C1A A;  1JKH A;  1KCF A;  3LAN A;  2X6S A;  4OVL A;  5HRN A;  3ZSQ A;  3ZSX A;  3NH1 A;  3HP6 A;  3CQ8 A;  3RTV A;  1X9W A;  1C0M A;  1J54 A;  1D9D A;  3OYC A;  1EKE A;  3QEP A;  3I0R A;  1Z26 A;  4DSK A;  4KHQ A;  4DMN A;  2XHB A;  3U3Y A;  1QS4 A;  3LP1 A;  4BDZ A;  1NK0 A;  4Z4E A;  3NH2 A;  3QEV A;  4EZ9 A;  4E7L A;  2D0C A;  1D8Y A;  4OKJ A;  1S1W A;  1I3A A;  4C8O A;  4CK2 A;  3JYT A;  4DTR A;  3VQE A;  3SNN A;  1QSS A;  2Y1J A;  1L3U A;  1SUQ A;  2QXF A;  4XIU A;  3OYN A;  4HCC A;  4FW1 A;  5DK5 A;  4FZX C;  2HHU A;  1LWE A;  1KFD A;  4DTN A;  3IAY A;  3AO5 A;  4DSF A;  1YTA A;  4HCB A;  3HL8 A;  4Y1D A;  4PY5 A;  4J2A A;  1FKP A;  1QTM A;  4DLG A;  2WON A;  3AVJ A;  3TAF A;  2PYL A;  4ID5 A;  3OJU A;  1A5W A;  4HTU A;  2Q3S A;  4H8K A;  4FZY A;  4DWI A;  4FJ7 A;  4W5T A;  1RDD A;  1EET A;  1RT1 A;  1CZB A;  2X78 A;  4FJ5 A;  4CJ3 A;  4MQ3 A;  5C24 A;  3PO5 A;  4AHU A;  4FJH A;  3VQD A;  3B6P A;  1UA0 A;  2HHV A;  2E6L A;  1RT4 A;  4HUG A;  4FLZ A;  3VQC A;  4FK4 A;  4B9N A;  1JLC A;  2RN2 A;  1A5V A;  4FJN A;  1RBT A;  4OJR A;  3AVK A;  4FLY A;  3VQ9 A;  4CJL A;  4E7H A;  4W5R A;  1CXQ A;  2VG5 A;  4PA1 A;  3V81 A;  3SUO A;  4IBN A;  5HLF A;  1S1T A;  3OJS A;  3VQ8 A;  1C6V A;  4KFB A;  4DFJ A;  3PX0 A;  3KLG A;  4FK0 A;  3AO2 A;  3DYA A;  3RWU A;  4FZZ A;  1IKX A;  1Q9Y A;  3CFR A;  3S3O A;  1LAW A;  4NYN A;  3AO4 A;  3DM2 A;  2HVH A;  4N47 A;  3PX4 A;  4CK1 A;  1LW0 A;  3KLF A;  2OYQ A;  4I2Q A;  1HJR A;  3L2R A;  1JLB A;  4CK3 A;  3ZSW A;  3LAM A;  4OLB A;  3OYL A;  1I39 A;  4CIG A;  1TL3 A;  4HVJ A;  4E7I A;  4E3S A;  1S5J A;  2XRI A;  4FM0 A;  1NKE A;  3QNO A;  2KZZ A;  1ASV A;  4KI4 A;  1RTI A;  2ZQB A;  2O4G A;  4BDP A;  2JGU A;  4QOZ B;  4PUO A;  4E89 A;  3QIN A;  1T05 A;  4O5B A;  1KFS A;  2BGG A;  3V9Z A;  2D0A A;  2X6N A;  1FXX A;  3OYE A;  1CXU A;  2GUI A;  2XO7 A;  4B9U A;  1S9G A;  1TL1 A;  3SZ2 A;  1WSJ A;  4F8R A;  3E01 A;  1NK8 A;  1RTJ A;  2GV9 A;  3OS0 A;  4CHO A;  1RNH A;  1LWF A;  1YT3 A;  4E1N A;  3M8Q A;  1RT5 A;  2X74 A;  1L5U A;  3AV9 A;  2BDP A;  1DLO A;  1HNI A;  3EZ5 A;  4CJV A;  5HRS A;  1JLE A;  1BHL A;  4CJQ A;  4B3O A;  4M45 A;  3NDK A;  4GVM A;  3NE6 A;  4KI6 A;  1QSY A;  3KD5 E;  1S1V A;  1KLM A;  2RKI A;  4CJ4 A;  1WSF A;  3QNN A;  4OGC A;  4AHR A;  3ZSY A;  3LAL A;  4B08 A;  3DRS A;  2P1J A;  1KSP A;  2R7Y A;  3V9W A;  3KLE A;  3V4I A;  3PUF A;  4CE9 A;  1RCH A;  4FK2 A;  3DRR A;  3MEE A;  4CJ5 A;  4BE2 A;  3K5O A;  3MED A;  4LH5 A;  3SCX A;  1JL1 A;  2OZM A;  3ITH A;  4CEF A;  3RRH A;  3LZI A;  3SQ1 A;  2WOM A;  3C6U A;  4M3W A;  4ELU A;  1WAF A;  4KPY A;  3TAG A;  3JSM A;  1O1W A;  1NK4 A;  3IG1 A;  2Z1I A;  4LSN A;  4FM2 A;  4KB0 A;  3AVA A;  1KLN A;  3M8S A;  3AVI A;  1VSD A;  1UAX A;  3OY9 A;  1ZYQ A;  3HP9 A;  3LZJ A;  4DTU A;  3O4Q A;  1IG9 A;  4DSJ A;  1NKC A;  3VA3 A;  4FW2 A;  1VSK A;  3TAN A;  3HPH A;  5J2Q A;  2A1R A;  1Y97 A;  3D0P A;  4CJE A;  4CF9 A;  1RT2 A;  4JRQ A;  3RMA A;  4FJ8 A;  3HPG A;  3A2F A;  5EU7 A;  3DLG A;  4CJF A;  4O0I A;  3HST B;  2D0B A;  2RPI A;  3OS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...