2R7YA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords RNA (5'-R(*UP*CP*GP*AP*CP*A)-3')
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2r7yA00
4KKOA 4B8AB 4OVLA 4FJNA 1FXXA 3SQ1A 5C24A 1DLOA 1S5JA 2X78A 3U3YA 5CZ1A 3M8PA 4OGCA 1SL2A 2ATQA 4CHYA 1KLNA 3PO4A 1QE1A 2YNGA 4CEQA 4BACA 1W0HA 3TANA 4CCHA 4HVJA 4RW6A 3NH1A 5J2QA 3ZT4A 1D9FA 4BWJA 3M8RA 2P5GA 5KRSA 4KHWA 4FW1A 1XC9A 2KFZA 4DG1A 3HJFA 2A1RA 1Q8IA 4N56A 3AA4A 4FK0A 4DSKA 2RN2A 4IKFA 1A5XA 2E4LA 3V9WA 4DSEA 3M8QA 1NK8A 4OKEA 4CFBA 1KFSA 1BIUA 2G8UA 1C0UA 3VQ6A 2X6NA 1KFDA 1ASUA 4B8CA 2HB5A 3BDPA 1QHTA 2KZZA 2Y1JA 3LWLA 3AO1A 1BCOA 1VK0A 4XIUA 4J2EA 4BDZA 2XHBA 4KAZA 4FJIA 4HCBA 4FXDA 1HQEA 1N6QA 3QLHA 4E7JA 3TARA 3ZT0A 4AHVA 2W42A 4CK3A 3NF8A 2HW3A 3VA3A 2OYQA 3NH0A 1ZBHA 1GOAA 1RDCA 4CF8A 5J1EA 1WN7A 3K5MA 3V9XA 3PV8A 1TL3A 4IFYA 3KTQA 2NUBA 1BL3A 4Q5VA 3AVJA 4O44A 3NCIA 4JRPA 3V1RA 4ZHRA 4Z4IA 1ZBIA 5JS1A 4AHCA 3TABA 3K57A 1NK5A 2HHQA 1IG9A 2ZE2A 1Q9YA 4FJJA 3TAQA 1B92A 1RT4A 4FJHA 4CJ4A 1TL1A 1QTMA 4C8NA 3CYMA 2I5JA 3CFOA 3DLKA 3L8BA 4DQRA 1IKWA 3K5OA 1S9EA 3NGYA 1EX4A 3RMDA 4FJMA 3QESA 1U04A 2GUIA 3OJUA 5SWMA 3KLIA 3MEDA 4CHOA 4ZTJA 3AVBA 3AVGA 1C0TA 1JXBA 2YV0X 4NCGA 4E1NA 3HPHA 1RT1A 4E3SA 3QERA 3L2VA 4ID1A 3OYBA 3C94A 1VSMA 4KTWA 3L3UA 4DS4A 4DSJA 3L3VA 4DTJA 3RR8A 1S6QA 3AVKA 1WLJA 1TKDA 4I2QA 1J53A 4GW6A 4EP5A 2XY8A 4CFDA 3QEWA 4UQGA 4PA1A 2HNYA 4CJFA 4W5RA 5DK5A 3EY1A 4FLZA 4LY7A 2OPPA 3I8DA 2QKBA 4E7KA 4FLTA 4B9UA 4Z0UA 2OPQA 3AO5A 3OYKA 3L2RA 2YKMA 2IS3A 4RW4A 3V9ZA 1RCHA 1S1TA 2A1SA 4DLEA 3LALA 4FM0A 1S1WA 1ZBUA 2BDPA 4EZ6A 1ZBFA 1LWEA 2G8IA 1TAUA 4E7IA 2DFEA 3OY9A 3V9SA 1NK4A 1FKOA 1QS4A 2FBTA 1WSJA 1EXQA 1KLMA 3E01A 3WNGA 4CEFA 4CJWA 3OYEA 3KD1E 1LV5A 3P5JA 4DLGA 4W5QA 2O4IA 5KGWA 4CHPA 2D0AA 3HVTA 4FJLA 4AHTA 3SV4A 3KK2A 1HJRA 3OYMA 3VQ9A 4AILC 1VRTA 3KKRA 3VQQA 4DTOA 1SL0A 4B9TA 4F3OA 3AA2A 3IS9A 1NJZA 4Q0BA 2KZMA 4B9SA 2R7YA 4NYFA 4DTPA 3S3MA 2FBVA 4CK1A 4E0DA 1JKHA 4B9NA 3LDSA 3CG7A 4CEBA 1QSLA 4B9VA 1NJXA 3PO5A 3THVA 2E6LA 3SUPA 1QSSA 1RTIA 1U49A 2LSNA 4RG8A 4BE1A 3T3FA 3QIPA 3TAEA 1SKWA 4DFJA 1KSPA 4NCAA 3CM5A 3K5LA 4M3WA 5I42A 1YTAA 1QQCA 1BQNA 1U45A 2Z1GA 3OYCA 1RDAA 4FK2A 2Z1HA 4I2PA 3OVNA 5K14A 3ZT2A 1YTUA 4O5BA 4FLXA 1QSYA 3LPUA 1ITGA 1YVUA 4CJKA 4EP4A 4KTZA 4WE1A 4FJGA 3C6UA 4CECA 5C42A 2QKKA 1JLCA 3ZT3A 3SPZA 4CIFA 4M42A 1S1UA 3B6PA 4AHSA 1C1BA 1I3AA 1VSHA 3O3HA 4E89A 3OYHA 1RT6A 3QEVA 1KCFA 3B6OA 1WSEA 3HYFA 3PUFA 5SZTA 3TI0A 1JLGA 1XWLA 1BCMA 1UWBA 1NKCA 1RBVA 1L3SA 1ASWA 2D5RA 3ZSVA 4OKKA 3ASMA 3FFIA 3IRXA 3V1OA 4W5NA 3LP0A 4JLHA 2XY7A 4OKJA 4F2RA 1NK9A 1U48A 4OPJA 3OYNA 1FKPA 2D0BA 3ZSXA 4FLVA 4DS5A 4YFUA 3K5NA 3VQAA 4W5OA 4DTRA 1ZBLA 4OLBA 2FBXA 2OPSA 5EU7A 4LSNA 1WSIA 2PYLA 4CEAA 3DLBA 2F96A 1WSFA 2IGIA 1RT5A 3DM2A 3HT3A 1HQUA 4KHSA 4KTQA 5FRNA 4CJRA 4AH9A 2VWJA 3ZSZA 2IAJA 1LWCA 1BI4B 3O3GA 4H4OA 4N47A 3WNHA 4CE9A 1X9WA 1RTHA 4O0JA 3ISNC 1NK7A 3RRGA 3MXMA 2HHSA 4Y1DA 3KLEA 3TAGA 4KHNA 2WONA 2YNFA 1SV5A 3EZ5A 1D8YA 3AVFA 1U47A 4CHNA 1DTQA 3SPYA 1S1VA 1TKXA 3HL8A 2G8VA 1EKEA 1HNIA 3KLFA 3O4NA 4IG0A 2YNIA 1TVRA 1WAJA 2B6AA 4FK4A 3CFPA 2P5OA 3VN5A 3V6DA 3DLHA 2P1JA 4O4GA 3LANA 3PX4A 1SKRA 1X9MA 4KI4A 5T7BA 2JLEA 3RRHA 4F3TA 1TKTA 2F8SA 1C6VA 4N41A 1BISA 3NF9A 4CF1A 3WNEA 3QETA 2Y1IA 1X9SA 1RILA 4DTUA 4BWMA 4C8KA 1CXQA 4DF8A 3K59A 4QOZB 3TR8A 5E41A 1YT3A 5CZ2A 4OPKA 3PX6A 4IBNA 3HSTB 3VQPA 3L2WA 5CYQA 2HHUA 1ZYQA 3AVHA 2BE2A 3ZCMA 3VQDA 3S9HA 4ID5A 3TAFA 4DF4A 3TWHA 1LAVA 4KB0A 5HBMA 4DFMA 2HHXA 3NHGA 1NK6A 3OS2A 2HVHA 4E19A 4DQPA 5C25A 1JLFA 3NGIA 4FCYA 4CJPA 2KW4A 1LW0A 4CF9A 2HNZA 4KO0A 2B5JA 1JLBA 2P51A 2YHBA 4CIEA 3RTVA 3SQ0A 2HHTA 1RT2A 3KK1A 3DYAA 4J2BA 4Z4GA 1C1CA 2Z1IA 3NDKA 4DQQA 2FBYA 2G8HA 3DLRA 4CGHA 4KHUA 1A5VA 3S3NA 2HHVA 1EP4A 1I39A 3AO4A 3CQ8A 3OJSA 4CGJA 4CJLA 3OYLA 3ULDA 4Z4FA 3P83D 1ASVA 3HP9A 4JRQA 1UA1A 1NOYA 2JGUA 5D3GA 1DTTA 3AVNA 1J9AA 4ZTFA 5J2MA 4CEOA 3SZ2A 1T03A 3MEGA 1NJWA 3LPTA 4KB1A 3DI6A 3RWUA 5CY4A 1CLQA 3NF7A 1SKSA 4ELVA 4Y1CA 4CF2A 4GMJB 3C95A 4YNQA 1B9FA 5FROA 3LWMA 1LWFA 3PY8A 4FJ5A 4PWDA 1Z26A 3IG1A 4LH4A 4CGFA 3L2QA 3L2UA 1EETA 3SQ4A 3C6TA 3RMBA 1FK9A 4CEEA 1IKVA 1HPZA 3QINA 4CIGA 2VG6A 2XY6A 1Z25A 3RMAA 4I7FA 3VQ7A 3I0SA 4DTSA 4DTNA 4DFPA 1TKZA 3NBPA 4QAGA 3EYZA 1RBRA 2G8WA 1RDBA 3VQ4A 1L5UA 4M3UA 1L3TA 4M3ZA 1BGXT 1VRUA 3NE6A 4HUEA 4DQSA 4PUOA 4OJRA 3V9UA 3VQCA 4DSFA 2OPRA 4CFCA 2ZD1A 1C1AA 1RTDA 4FJ8A 1K6YA 1LW2A 1WSGA 3DRSA 4DQIA 3AA3A 3NFAA 1HYZA 3T19A 3LZJA 4DSLA 3AVMA 4CGGA 4C8OA 4HTUA 4C8MA 1BHLA 1JLQA 3SCXA 1VSDA 3DRRA 3K2PA 1MU2A 4B9LA 2G8KA 2BANA 3SYZA 3LP3A 2HHWA 3LP1A 3T1AA 5HRPA 1TK0A 3ITHA 3HM9A 3QEPA 3G0ZA 3AVLA 2KFNA 3QO9A 4I9QA 1RBUA 2KTQA 3MECA 1D9DA 3SNNA 4G1QA 3HVRA 2ITGA 4DU3A 2ETJA 4AHRA 1RDDA 2DY4A 3AA5X 4BE0A 1HNVA 3KLGA 2XY5A 1XI1A 3DLGA 4FJ9A 3TAMA 4BDYA 2YHAA 2DFHA 3D0PA 3LZIA 4I9LA 3S3OA 1L3VA 3OYJA 3QIOA 2X74A 4DFKA 4KHQA 4KHYA 5DMRA 5I3UA 1RBTA 3KJVA 4M3XA 3NH2A 3IAYA 3QNOA 4PY5A 1KVAA 2PZSA 3VQ5A 3HP6A 5JS2A 3DOLA 4N5SA 3RMCA 1D5AA 4F2SA 4TSXA 1TK8A 2AJQA 4FJXA 3VQBA 3CM6A 2YKNA 1RT3A 5HROA 1IKXA 2X6SA 3TAPA 4NCBA 1CZBA 5KGXA 1J5OA 3ZSWA 2IDOA 4NYNA 1O1WA 3K58A 1IH7A 2VG5A 4F8RA 4DWIA 3RR7A 2RF2A 4C8LA 3DLEA 2D0CA 1CXUA 2XO7A 3JYTA 1JXEA 3NF6A 1UA0A 4J2AA 2G8FA 1RBSA 1XHXA 5FDLA 3SUOA 3F9KA 1NKBA 3OYDA 4DTXA 4JS5A 3O4QA 1S6PA 4Z4CA 1KVCA 2BGGA 3QEXA 1KVBA 1J54A 3M8SA 4FLWA 3V81A 4GVMA 2ZQBA 5KTQA 3ZSOA 4ELTA 4O0IA 3U3GA 1GOCA 4CEDA 3ZSQA 4DU4A 4QCLA 2B4JA 3KKSA 3SQ2A 4CK2A 3JSMA 4M41A 4RW8A 1KTQA 1WNSA 5J2PA 3BGRA 5HP1A 1VSFA 4Z4HA 4W5TA 4FLUA 4CJ3A 4CJSA 1T8EA 4KPYA 4CJEA 4CESA 1HMVA 3OS1A 2XRIA 3QNNA 3NGZA 4CERA 4BDPA 4H8KA 4F4KA 1NKEA 3I0RA 1N5YA 3AVIA 1R0AA 1IKYA 4JS4A 4FZYA 3SV3A 2IC3A 3HO1A 1HYVA 1A5WA 5FRMA 4LD0A 3ZT1A 1BI4A 1NJYA 1TV6A 1SL1A 3SI6A 3HK2A 1IO2A 1F21A 4LH5A 4M3YA 3AVAA 4OLAA 4KI6A 2YNHA 4HCCA 4L8RB 1UAXA 1KRPA 3VA0A 2HMIA 3P1GA 4DU1A 3HXMA 3AO2A 2RPIA 1JL1A 4H4MA 3KIOA 4E1MA 2Z1JA 4B08A 1X1PA 4HHTA 5HRNA 4R5PA 4OGEA 3LP2A 3OYFA 1BQMA 4Z4EA 2E6MA 4E7LA 3HPGA 3MXJA 1UOCA 4M3TA 4IG3A 4CJQA 1NK0A 4FLYA 1T7PA 1Q9XA 3SUNA 3F73A 1JLAA 1G15A 4FVMA 4FYDA 3A2FA 4B3OA 4CJUA 4ICLA 2HNDA 4MFBA 1LAWA 3QEIA 4FZXC 3DRPA 1JLEA 2EHGA 2QK9A 1JL2A 3V4IA 2O4GA 1L3UA 1SUQA 4DTMA 1HYSA 4KV8A 1Y97A 1TAQA 3WNFA 4KREA 1WSHA 3O3FA 3LAMA 3VQEA 3VQ8A 4DMNA 2OZMA 1B9DA 1CZ9A 4J2DA 5HRRA 4ELUA 4FJ7A 1HRHA 2RKIA 3OS0A 4K8ZA 3KK3A 4CEZA 1VSEA 3MAQA 5HLFA 4B9MA 1XHZA 2OZSA 2VG7A 3D45A 3SJJA 3MXIA 4DSIA 2WOMA 3DMJA 1GOBA 1VSIA 1RTJA 3G10A 3AO3A 3ZSRA 4CJ5A 3OYIA 3MEEA 4O55A 1C0MA 4CHQA 4FZZA 2VWKA 2FC0A 3CFRA 2DTUA 1VSKA 1BIZA 2GBZA 3DOKA 2GV9A 4CGIA 4M3RA 4CGDA 1WAFA 3OYGA 3NAEA 5J2NA 1TGOA 3SUQA 1T05A 1RNHA 5KI6A 4E7HA 3UIQA 4FJKA 2F8TA 4AHUA 4FM2A 2DFFA 2KQ2A 2PY5A 3KD5E 2QXFA 2EX3A 3LAKA 3HPOA 3PX0A 1NOZA 4RW7A 3KLHA 1U4BA 1REVA 2IOCA 4BE2A 1TK5A 1RT7A 4EZ9A 3AV9A 4KFBA 2HVIA 3H08A 4FM1A 3ALYA 5HRSA 5KRTA 4PQUA 3V1QA 1S9GA 2Q3SA 4HUGA 1W9HA 4CJTA 4CJVA 3U6FA 4M45A 4RW9A 3OYAA 3ZSYA 4FW2A 1VSLA 4CF0A 4K8XA 1VSJA 5CYMA 1S1XA 4IDKA 2PYJA 4N76A 4MQ3A 2OA8A 4LSLA 4HUFA 4CFAA 4KRFA 4CHZA 4IFVA 3AVCA
chains in the Genus database with same CATH superfamily
4KKOA 3VGLA 4OGCA 3ULEB 4CZLA 1NGBA 4CEQA 3QICA 5AQTA 3O80A 3ZT4A 3M8RA 4X66K 2P5GA 4BR2A 1XC9A 1K73O 4LF4K 4N56A 3AA4A 2P9SB 4CZKA 3V9WA 3M8QA 1C0UA 1ASUA 3LWLA 3AO1A 3EEQA 4HCBA 4JN4A 1OH7A 1HQEA 2A6AA 2YJFA 3WXJA 4E7JA 3TARA 3QDKA 4CK3A 3PSIA 5AQZA 3BZCA 3V9XA 3PV8A 3BY5A 4CZFA 3OHRA 3AVJA 4CVNE 4GNIA 1ZBIA 4K0KK 4AHCA 5M1OA 2VCPA 4QS9A 4KHPK 3CYMA 3CFOA 3U9ZA 4CW7B 3L8BA 4GKJK 4FJMA 1S9EA 4DR5K 3QESA 1U04A 2GUIA 5SWMA 2QA4N 3MEDA 3WUHA 3AVGA 1JXBA 3HPHA 3CCUN 1RT1A 4E3SA 2O8FB 3L2VA 4ID1A 3VF2A 3OYBA 4BRPA 2ZF5O 1CZAN 4DS4A 3IDHA 3WQTA 1WLJA 4EP5A 2XY8A 2A3ZA 4PA1A 4W5RA 5DK5A 1YI2N 4Z0UA 2OPQA 3OYKA 3TSQA 5BPMA 2VQFK 2QW9A 3DXKB 1S1TA 4OO1J 3O6WA 3LALA 1TAUA 5TKWA 3OY9A 1VQ5N 3E66A 1NK4A 1FKOA 2GX9A 2PAVA 4I6MB 3P5JA 5KGWA 4CHPA 5GIOA 5EXWA 3G4SN 4WQ4C 4ISFA 3VQ9A 1VRTA 2KZMA 3S3MA 1JKHA 4CEBA 3VPZA 2O8EA 1U49A 4RG8A 5KPTA 4BE1A 3ZLJA 3MN9A 3TAEA 1KSPA 3K5LA 3MWPA 5I42A 1YTAA 1U45A 1RDAA 4FK2A 2YCHA 3ZT2A 4V19S 1YTUA 4FLXA 1YVUA 1W2BM 4H0PA 4CJKA 4WE1A 4CECA 3U9DA 5C42A 3ZT3A 2KKZA 4BRKA 1IV0A 4JD2B 4E89A 5CHIA 5SZTA 3PUFA 4BR5A 4B3TK 1NKCA 2CGLA 2QWLA 1L3SA 4GKKK 1J5EK 1TYQA 1U48A 4OPJA 3I8BA 2D0BA 3ZSXA 3OYNA 3LM9A 3K5NA 4W5OA 4DTRA 4DKWA 2OPSA 3J7ZO 4LSNA 5GAGP 1YAGA 2IGIA 4H5WA 2F7TA 4BC5A 2CGKA 4LC9B 2VWJA 4H5VA 3T1HK 1T6CA 4FO0A 4CE9A 1RTHA 5C12A 2BH1A 3ISNC 3RRGA 4KHNA 3BEXA 1SV5A 3EE8A 1QQOA 3BF1A 2G8VA 1TVRA 1VQNN 3VN5A 3PX4A 2Q1NA 4EIAA 3GG4A 2J4RA 4QS7A 2QXLA 1TKTA 1BISA 4C8KA 4FWSA 1N33K 4DV5K 4DF8A 4QOZB 5E41A 5CZ2A 3ZETA 3FLCO 4IBNA 5AFUH 3L2WA 5CYQA 1DEJA 2BE2A 4FWRA 3VQDA 2HBLA 4F9OA 4WFAL 5HBMA 1NK6A 3KK7A 4BROA 5DM6L 3ENOA 4CBUA 2HNZA 4CIEA 3RTVA 3SQ0A 2HHTA 1BU6O 5GADP 2HSTA 3CXCM 3AARA 2FBYA 1XNRK 1A5VA 3K0SA 3AO4A 4CJLA 3MN5A 1UA1A 1NOYA 4A59A 4PKHA 3AVNA 1J9AA 4R79A 5J2MA 1T03A 3MEGA 3LPTA 3RWUA 4AM6A 5CY4A 1CLQA 2ZJRL 2F9TA 1V4SA 2UXBK 4LFAK 3C95A 3LWMA 1B9FA 4YDUC 1Z26A 3L2UA 1FK9A 2VQEK 1HPZA 3QINA 3A5LC 1BOTO 4H0XB 3JS6A 4BREA 4YOYA 1D4XA 4DTSA 1TKZA 4QAGA 4DFPA 3EYZA 4JK8A 1L5UA 4X62K 3NE6A 1K8KB 5HL7L 2O8CB 4CZIA 1DGKN 4IOAL 1VQMN 3VQCA 4CFCA 1RTDA 4FJ8A 3ZEUB 3NFAA 3LZJA 1NU0A 4DSLA 4CGGA 5H1SQ 4C8MA 1BHLA 1VSDA 3K2PA 5AQIA 1MU2A 3CCMN 5M1KA 3LP3A 3WXLA 4IO9L 3ITHA 3S41A 2KFNA 2NRZA 1RBUA 3O4WA 3HVRA 2ITGA 3QFUA 3AA5X 4BE0A 1HNVA 3O9RA 5AQKA 3LZIA 1GLDG 1L3VA 3M3ZA 3ATUA 4PY5A 1KVAA 2P9IA 2PZSA 4C1NK 5JS2A 3TTDA 2ZGZA 1D5AA 1XMOK 4F2SA 5KQDA 3CCLN 1RT3A 1IKXA 3M6GA 1HPMA 3ZSWA 1O1WA 2RE2A 1SS6A 1WUAA 4DHYA 3WXKA 1CXUA 2XO7A 5IWAK 2G8FA 1RBSA 1XHXA 3OYDA 4DTXA 1S6PA 1NWKA 5MLCQ 4EHTA 3V81A 4YOXA 2ZQBA 3ZSOA 3U3GA 3ZSQA 4QCLA 3SQ2A 3JSMA 4RW8A 3BF3A 5HP1A 1U2VA 4KPYA 2BTFA 1HMVA 1YJNN 3LDNA 2E20A 3L6QA 5B8HA 4IDHA 4LFBK 1N5YA 4C23A 1IKYA 3I33A 2IC3A 1GLAG 1S72N 1VQON 1HYVA 1A5WA 4LD0A 3HK2A 1IO2A 1YF5L 3CCRN 4BRFA 4HCCA 1KRPA 3VA0A 1XUPO 4DU1A 2F4VK 2RPIA 5A2QO 3KIOA 5HOOA 1X1PA 5HRNA 4OGEA 2VGMA 3LP2A 4CD3A 4O8UA 1Q86O 2AA4A 4JV5K 3CJCA 1VQ7N 4IG3A 2A40A 4FLYA 3CJ9A 3JAMO 4FYDA 4B3OA 3MWTA 3VEVA 2HNDA 2FF6A 4FSVA 5AQWA 4BR9A 4LF8K 1OKJA 1HYSA 1Y97A 3WNFA 4DR4K 3O08A 1WSHA 3EO3A 2QWPA 1CZ9A 2Q2RA 3ULEA 4B1WB 3TTFA 3OS0A 1VSEA 4DCHA 5AQHA 3MAQA 4B9MA 1QHAA 1Q18A 2OZSA 3SJJA 2FSKA 2P9NA 3N4QA 3A8YA 2P9SA 3ZSRA 1VSIA 4DV3K 2A41A 4LF5K 1VAZA 1NGAA 4DR1K 2FC0A 3ZEUA 1OH5A 2QWOA 5ADXH 4GV3A 4CGIA 4CGDA 3SUQA 1WAFA 3OYGA 3J7YP 1TGOA 4FJKA 4E7HA 1NGFA 2O8FA 4AHUA 2EX3A 3LAKA 3CETA 1X9JA 3SMPA 3ALYA 1S9GA 2Q3SA 4JI4K 1W9HA 3VEYA 4CJTA 3U6FA 2ZGYA 4CF0A 2D0OA 2OA8A 5CR4A 1GLFO 3RSEB 4JHDB 4XH5A 4CFAA 3D2FA 4HUFA 4CHZA 4IFVA 4YOVA 4BRNA 4B8AB 1FXXA 5AQNA 5C24A 1S5JA 1X3NA 2X78A 3U3YA 5CZ1A 3M8PA 4PKGA 2UUCK 4CHYA 3MX2A 1KLNA 2YNGA 4CCHA 3TANA 3O1WA 1D9FA 4BWJA 5KRSA 1HKGA 2KFZA 4DG1A 3HJFA 3O5BA 1Q8IA 4FK0A 3M5RA 1A5XA 4OKEA 4CFBA 1BIUA 1KFDA 2KZZA 1QHTA 2Y1JA 4J2EA 4BDZA 4JKEA 3H1VX 4FJIA 4IWVA 1N6QA 1KD1O 3QLHA 4KH4A 2W42A 3NF8A 2HW3A 3VA3A 4CF8A 1TL3A 3CIPA 4IFYA 2NUBA 1DT9A 3H3OB 1BL3A 3ZX2A 4NXMK 3NCIA 3V1RA 4ZHRA 4H0TB 1NK5A 2HHQA 2ZE2A 2O8BB 2Q31A 3TAQA 1TL1A 4C8NA 1ZXOA 3NGYA 3UKUA 4JD2A 3VETA 4BRIA 3KLIA 4ZTJA 4ILJA 3AVBA 2YV0X 3PSFA 3THYB 4E1NA 4YY3K 4DSJA 4KTWA 3L3UA 3E9LA 4B1VA 4CFDA 3QEWA 4UQGA 2HNYA 4XH4A 4YOUA 5C10A 3R9PA 5AZJA 3I8DA 4E7KA 3P39A 3L2RA 3AO5A 3R3LA 2D4WA 4RW4A 5AR0A 2WTUA 4EZ6A 2G8IA 4E7IA 1HNZK 3L4QA 2DFEA 3J81O 1WSJA 1KLMA 3E01A 3WNGA 4CJWA 2ZJQL 3H1QA 4DLGA 1OH8A 1HNWK 4PHTX 1HJRA 3OYMA 4B9TA 3VQQA 4JK9A 4DTOA 2UXDK 3AA2A 1FJGK 2R7YA 4E0DA 3LDSA 3UKRB 4B9VA 3SUPA 5IT9O 4CD1A 2O8DB 4K25A 3P4IA 1SKWA 2ZM6K 3CM5A 4NCAA 4M3WA 4BR0A 3OYCA 2Z1HA 4I2PA 3OVNA 5K14A 1OH6A 3C65A 3OA9A 4CBXA 1XQSC 1ITGA 5JLHA 3C6UA 4GVEA 2QKKA 3NVMA 1C1BA 3O3HA 3OYHA 1RT6A 3WQUA 3HYFA 1WBDA 2WUSA 1ASWA 3KWGA 4OKKA 3FFIA 4JLHA 2XY7A 4F2RA 2ITMA 3RSEA 4LF6K 4DS5A 4YFUA 3VEZA 3G71N 2FBXA 4IJAA 1WSIA 1DKGD 2F96A 4BRQA 1U6ZA 1C0GA 2E2PA 4AH9A 3ZSZA 1N8RO 3O3GA 4H4OA 1X9WA 3F2KA 4O0JA 3MXMA 3KLEA 2WONA 2YNFA 3EZ5A 1U47A 4CHNA 1S1VA 1TKXA 4WQ4A 4RWTA 1WB9A 3HL8A 1EKEA 3GL1A 4IG0A 4B3RK 3CFPA 4ILGB 2P1JA 3TTCA 1VQLN 1QQMA 3RRHA 2GWJA 1C6VA 2F8SA 1LCUA 4CF1A 3QETA 3K9JA 1CXQA 3I56N 1VQPN 3HSTB 1OVQA 3AVHA 3S9HA 4ID5A 3TAFA 1BO5O 1NMDA 1K8KA 4KB0A 3DXMA 4CJ7A 5AQYA 3OS2A 2HVHA 2UXCK 1LOTB 2P9KB 2VWBA 4FCYA 4LFCK 4CJPA 3L0QA 4CF9A 2P51A 1JLBA 2YHBA 4MLHA 3J80O 4DV6K 4DQQA 4BG8A 4CGHA 4KHUA 1EP4A 1I39A 4Z4FA 1WBBA 4JI8K 1ASVA 3HP9A 4NO7A 5AQRA 3AY9A 5D3GA 3SZ2A 4KB1A 1XNQK 1NGHA 3A5OC 2Q97A 5FROA 4DV2K 3L2QA 3SQ4A 1EETA 3AAQA 3AGRA 2D1KA 2XY6A 1YHQN 3WEEB 5AJ3K 2Q36A 1RDBA 4FPAA 2P9LB 4DQSA 3MMVA 2I7PA 1HLUA 5AQMA 1C1AA 3EKUA 1K6YA 5JLFA 1LW2A 4B9QA 4DQIA 1HYZA 4JNEA 1JLQA 3VEXA 3FE1A 3HBTA 2G8KA 3D6RA 2HHWA 3LP1A 1ATSA 3CJ1A 5HRPA 2HOEA 3G0ZA 3KZBA 4G1QA 4BVPA 1RDDA 3CI5A 3KLGA 1GLEG 4H0VB 3DLGA 1XI1A 3TAMA 3VTHA 3S3OA 2DFHA 3D0PA 2I7NA 2X74A 3QIOA 4DFKA 4KHQA 1RBTA 1N32K 3AAPA 4IFEA 3NH2A 5FPEA 4RTFD 3VQ5A 4N5SA 4TSXA 3VESA 2AJQA 2O8EB 5AQGA 1JCEA 1YXQA 4WQ5C 1MWKA 4NCBA 1CZBA 2ASPA 1J5OA 2NRXA 1TUUA 4J8FA 2IDOA 3FZMA 4NYNA 3K58A 3W0LA 4DWIA 4C8LA 3CPEA 2D0CA 1UA0A 3SUOA 1NKBA 3MX5A 1KVCA 4BVOA 3QEXA 1KVBA 1IBLK 1J54A 4FLWA 4BC4A 4DR2K 2QI2A 3G25A 4BRLA 2UYTA 4CEDA 4NLCA 3PIPL 2B4JA 3CC7N 3KKSA 5J2PA 5BRDA 5AQOA 1TYQB 4Z4HA 5E26A 1V4TA 1IBMK 2H3GX 2XRIA 3OS1A 3NGZA 4BDPA 1ZC6A 4FL9A 5EX5A 1HR0K 3MDQA 3AVIA 1R0AA 3SV3A 4JKCA 3EL2A 4JI5K 4B1UB 2E5LK 1E4GT 1NJYA 1TV6A 4DV7K 3UB5A 4LH5A 4KBOA 4M3YA 3HOTA 4JHDA 3P31A 4K43A 2HMIA 3P1GA 5JVGL 4WCEL 3C6HA 2QTDA 4E1MA 2Z1JA 5AQLA 5BR9A 1YIJN 4R5PA 5EY4A 4JKBA 5GAHP 2E6MA 4DV1K 4M3TA 1UOCA 1YJWN 3SAHA 4CJQA 4EHUA 1NK0A 1T7PA 1Q9XA 4YOTA 3F73A 3QBWA 1G15A 3O9QA 3QEIA 1LAWA 3DRPA 3EZWA 2QK9A 3V4IA 2E2QA 4KV8A 4KREA 1SAZA 4BQZA 3LAMA 4MLEA 3VQ8A 1B9DA 4MO5A 3OTOK 4J2DA 4FJ7A 1HUXA 2RKIA 5HLFA 5BR8K 4FWOA 3O9TA 3EKSA 3DLLL 2E2NA 2WOMA 3DMJA 3OYIA 4JKFA 4BGBA 2GBZA 4M3RA 1IJJA 3TPQA 2F8TA 4CZMA 1NGJA 2DFFA 2P9UA 3HPOA 3PX0A 3HRGA 1NOZA 3LDOA 1U4BA 2IOCA 3EE9A 2NNWA 5HRSA 3M1FA 3D2EA 3V1QA 2GEMA 3CCJN 4CJVA 4IEIA 2ASMA 4RW9A 3IFRA 3ZSYA 4BC3A 1BG3A 3CPWM 1VSJA 4K8XA 4IDKA 4MQ3A 1KQSM 3AVCA 1VQ4N 4FJNA 4FOEA 4OVLA 2OTJN 4DV4K 2FLOA 2ATQA 5AFUA 1QE1A 1XMQK 2FF3B 4RW6A 3NH1A 3CCVN 4KHWA 2A1RA 2W6LA 4IKFA 2E4LA 2JWKA 3T69A 1NK8A 4FJ5A 2G8UA 3JXUA 3CCSN 1BCOA 1VK0A 4YHHK 4PKIA 4FXDA 2XHBA 4DR6K 4JAXA 4CZJA 2OYQA 3IMXA 4IXCA 1ZBHA 1GOAA 1WN7A 5I9EB 3KTQA 3PLAA 3CQYA 4O44A 2P9IB 3R6MA 4JRPA 4WYBA 5JMVA 4Z4IA 3TABA 1IG9A 4CJ4A 1QTMA 4H5NA 1GLJO 2I5JA 3CERA 3K5OA 2BUPA 4H03B 1EX4A 2HF3A 3C6AA 3ZX3A 4OX9K 4NCGA 2NRHA 3IKMA 4JKAA 4OPAA 3QERA 3C94A 3H6EA 4A2AA 1VSMA 3L3VA 3RR8A 1TKDA 4I2QA 5AQVA 4XEIA 2P9PA 4CJFA 4FLZA 2QKBA 4FLTA 4B9UA 3R1XA 3A0IX 5BPNA 3CQXA 2IS3A 3C7NA 1U2VB 4RCHA 4JI6K 2A1SA 2QWRA 3SAGA 1QVFM 1ZBUA 1YVNA 4KH6A 4FWNA 4B1XB 3N4PA 1QS4A 1EXQA 5C0YA 2DPNA 4LF9K 4BY9C 5C15A 5JVHL 4FJLA 3DXKA 4IJNA 3KK2A 4AILC 4F3OA 3KKRA 4ILHA 2NLXA 5KQ8A 1Y64A 3BUZB 1NJZA 1BWFO 1SQKA 2NRTA 4B9SA 1NJIO 2FBVA 5EOYA 4CK1A 2A5XA 4B9NA 2NRRA 4DQ8A 3PO5A 3THVA 2E6LA 5ELZA 1QSSA 1RTIA 3VEWA 2LSNA 4X65K 3DXMB 3QIPA 1QZ6A 1NGIA 5FPMA 4O5BA 5FPDA 4BRAA 4KTZA 4FJGA 1KAYA 1JLCA 3U8XA 3O9UA 5KPRA 3B6PA 4AHSA 4KTQA 3E9OA 3EN9A 4WFNL 3ENHA 3QEVA 1WSEA 3D2EB 3OW2M 2GTDA 1XWLA 1BCMA 1RBVA 5EVZA 2W40A 3ASMA 3V1OA 4W5NA 3LP0A 4OKJA 3VTIA 4FLVA 1P90A 4OLBA 5FLXO 3DLBA 1T44A 1RT5A 3DM2A 1HQUA 3SMSA 1BI4B 2FXUA 4N47A 3WNHA 4DUZK 1NK7A 3ZX0A 2HHSA 4Y1DA 3D7EO 3GOIA 3AVFA 2GELA 3FGUA 1MDUB 3KLFA 3T1YK 3GDQA 2B6AA 2P5OA 3HOSA 3V6DA 3VMFB 3LANA 4KI4A 2P9NB 5TKYA 2JLEA 4F3TA 3CD6N 1ILYA 4N41A 1X9SA 3THXA 1RILA 5M1QA 4DTUA 1GLBG 4MO4A 3TR8A 1YT3A 3PX6A 4FWQA 4BRGA 3FFKB 1ZYQA 3ZCMA 2EWSA 4DF4A 2O8BA 1LAVA 4H0YB 3NHGA 5DM7L 2CGJA 4E19A 3L4IA 4DQPA 5C25A 3NGIA 2KW4A 1LW0A 4KO0A 4BR4A 1RT2A 3KK1A 4J2BA 4Z4GA 1C1CA 2Z1IA 3NDKA 3D2FB 4E1JA 3B8AX 1Q7YO 3CQ8A 3OYLA 2P9PB 3P83D 4JRQA 5AQXA 5KPZA 2JGUA 4ZTFA 3SAFA 3BZKA 1SKSA 4DV0K 3C7NB 4ELVA 1O13A 4YNQA 4DB3A 4PWDA 1LWFA 2FSNA 4CGFA 4LH4A 3C0BA 1ATNA 4JI2K 2IVOA 3C6TA 3THWB 3RMBA 4CEEA 4CIGA 1IKVA 4ISEA 3VF6A 3RMAA 3CC4N 3OBYA 4I7FA 4O8KA 3I0SA 4DTNA 3NBPA 5BRFA 2G8WA 1S22A 2CH6A 4MDAA 2AP1A 4YOWA 4DSFA 2YX6A 1X3MA 2OPRA 1HNXK 2ZD1A 4PL7A 1WSGA 3DRSA 3AA3A 3T19A 2HBKA 3FZHA 3HTVA 1SZ2A 3QMLA 4FPBA 4A5BA 2BANA 5LJWA 3SYZA 1I94K 2O8DA 5FPNA 1TK0A 3SK3A 3AVLA 3TSPA 1NG9A 2ETJA 2XY5A 4UY8O 4A57A 4FJ9A 3VOVA 2YHAA 4HTLA 4I9LA 3O8MA 3OYJA 4FVUA 5DMRA 5I3UA 2WFBA 1RDUA 3IAYA 3QNOA 5AQPA 5CE3A 2IIRA 3HP6A 2FSJA 3FZFA 1YUWA 3RMCA 1RGIA 1TK8A 1G99A 4JKGA 4NLBA 3VQBA 4BGAA 5AQQA 4JI3K 1Q82O 3BP8A 3TAPA 5KGXA 3CHWA 1IH7A 2QEXN 4F8RA 1Z05A 3RR7A 4B1ZA 4CZGA 2RF2A 3ID8A 1OVYA 4I6MA 3JYTA 1JXEA 3NF6A 4J2AA 1NGCA 2OCEA 4Z4CA 2BGGA 4GVMA 5KTQA 4WF9L 3DWLA 1GOCA 4DU4A 2JWLA 2QWQA 3GBTA 3J7AP 1XC3A 1BA0A 4CK2A 4JEPA 4M41A 1KTQA 3WXMB 3BGRA 3DAWA 3OBWA 2UU9K 2E88A 1HKBA 1T8EA 4CESA 4CERA 4H8KA 1QVGM 3I0RA 1N36K 4JS4A 4YDUA 4JKDA 3HO1A 3MCPA 3R8EA 5FRMA 1SL1A 1HKCA 3AVAA 4FWMA 3RVCA 1UAXA 3ENBA 4PL8A 1YJ9N 4Y0WA 1Z6RA 1VQ6N 3ATVA 4B08A 2HHHK 4Z4EA 5BREA 2RHKA 3HPGA 5LL6Z 3CF5L 5BN8A 4FVMA 1RFQA 4L3QA 4CJUA 4ICLA 4OPHA 4FZXC 4FWKA 1JLEA 2EHGA 4NB4A 3VF4A 3VQEA 1RDWX 4DMNA 3KWIA 2OZMA 5HRRA 3LL3A 4ELUA 1HRHA 4HWIA 4K8ZA 3WEEA 4CEZA 3KK3A 4GV6A 1IG8A 1XHZA 4AM7A 2VG7A 4BG9A 3MXIA 3DJCA 2P9LA 1GOBA 1Q81O 1RTJA 4CJ5A 3AO3A 4FZZA 1NBWA 2VWKA 5AZIB 3CFRA 2DTUA 1VSKA 3HM8A 3ZETB 1T05A 1RNHA 3LM2A 2HHUA 2KQ2A 2PY5A 4JKGB 3KD5E 2QXFA 1JCGA 4BE2A 1TK5A 1RT7A 4EZ9A 3QBXA 2HVIA 3H08A 4FM1A 1BUPA 5KRTA 1N34K 3FR0A 1KC8O 4PQUA 4HUGA 1P8ZA 2YJEA 4GV9A 4B3SK 3HZ6A 2WC9A 4FW2A 1VSLA 5CYMA 3UE5A 4LSLA 4KRFA 3SQ1A 1DLOA 4CZEA 2YHWA 1SL2A 3CC2N 4IO8A 5AQJA 4K42A 3PO4A 4IOCL 4BACA 1W0HA 4QS8A 3U4LA 4HVJA 3TU5A 5J2QA 4FW1A 3CCEN 4C1NI 2OTLN 1T3VA 5LMNK 1WOQA 4DSKA 4NXNK 1S3XA 2RN2A 4DSEA 1KFSA 1TUYA 3VQ6A 2X6NA 3BDPA 4B8CA 2HB5A 1IBKK 4XIUA 3CJAA 4KAZA 2QWNA 3ZT0A 4AHVA 3NH0A 1RDCA 5J1EA 2O8CA 3K5MA 5LJVA 5GIPA 4Q5VA 5BPLA 5JS1A 1QZ5A 3HSCA 1M90O 1NLVA 3O1BA 3K57A 3ID6A 1Q9YA 4XH1A 4FJJA 1B92A 1RT4A 4FJHA 2E1ZA 1W97L 3DLKA 4DQRA 1IKWA 5AQFA 3RMDA 2YHYA 3PIOL 3OJUA 4CHOA 1C0TA 1ESVA 4H0OA 4DTJA 1S6QA 3AVKA 3H46O 1J53A 4GW6A 3NVKA 3E9PA 3EY1A 4LY7A 2OPPA 1JCFA 4B3MK 2OANA 4JKHA 2YKMA 3V9ZA 5GINA 3LDQA 4M7YA 1RCHA 3E1YA 4DLEA 4FM0A 1S1WA 3Q7CA 2BDPA 1ZBFA 1LWEA 5GAEP 2IVPA 3V9SA 2FBTA 3KD1E 4CEFA 3OYEA 4BRCA 1LV5A 3IUCA 3UKRA 4W5QA 2O4IA 2NZTA 2D0AA 3HVTA 2V7ZA 2ASOA 4AHTA 2IVNA 3SV4A 2Q0UA 1SL0A 3CCQN 3IS9A 4JYAK 4Q0BA 1M1KO 1VQ8N 4NYFA 4MDBA 4DTPA 3CG7A 1QSLA 1EO1A 1NJXA 1ATRA 1EWQA 2YHXA 4O5FA 2HBJA 2GWKA 4EFHA 3T3FA 4GY2B 4DFJA 4DUYK 5AZIA 1QQCA 1BQNA 2Z1GA 2UUAK 1QSYA 3LPUA 3VGKA 4BC2A 4U67L 4EP4A 3K9KA 3SPZA 2P9UB 3TSUA 4CIFA 4M42A 1S1UA 1VSHA 1I3AA 2W41A 3TI0A 1KCFA 3B6OA 4A62A 1JLGA 1UWBA 1MA9B 3ZSVA 2D5RA 4AF1A 3SBTA 2PBDA 2ZJPL 3IRXA 1GLLO 2QWMA 1NK9A 4IEEA 1FKPA 3VQAA 1ZBLA 4KH5A 5EU7A 1T6DA 2PYLA 2KHOA 4CEAA 3VENA 1WSFA 2V52B 1H1VA 2YI1A 3HT3A 4KHSA 5FRNA 4CJRA 1NGEA 2IAJA 1LWCA 3GE1A 1BDGA 3TAGA 3WXIA 1D8YA 5AQUA 3SPYA 1DTQA 4M7XA 1HNIA 3O4NA 2YNIA 1WAJA 4FK4A 5M1FA 4IOXA 4O4GA 3DLHA 1SKRA 1X9MA 5T7BA 4M63C 5ADXA 3KVGA 3NF9A 2Y1IA 3WNEA 4BWMA 3K59A 4WQ5A 2F9WA 1JJ2M 3CMEN 4OPKA 1VQ9N 3VQPA 2ZWHA 3ZYYX 3TWHA 2HHXA 4DFMA 1HX1A 4X64K 2HMPA 1JLFA 3I55N 1BA1A 3FZLA 2NRWA 2CH5A 2B5JA 3DYAA 2W6KA 2G8HA 3DLRA 2HHVA 3S3NA 5JICA 3OJSA 4CGJA 3ULDA 2P9KA 1DTTA 4FWPA 4CEOA 1NJWA 3DI6A 3NMUA 2HBMA 3NF7A 1QQNA 4Y1CA 4CF2A 1E4FT 4GMJB 5F0XA 3PY8A 3IG1A 2E1YA 3O9SA 3VEOA 5LY3A 2VG6A 1FW6A 1Z25A 3F9MA 4BR7A 5C2DA 4H5TA 3A5NC 3VQ7A 1NGGA 5C2FA 5F1XA 1RBRA 4M3UA 3VQ4A 1L3TA 4M3ZA 1BGXT 1VRUA 4HUEA 3CJ7A 4PUOA 4OJRA 3V9UA 4CZHA 4YORA 4LF7K 2NRVA 4DR7K 3AVMA 4C8OA 4HTUA 3SCXA 3DRRA 3H45C 1K9MO 4CBWA 4B9LA 5BRHA 3CMAN 3T1AA 2V7YA 3UKUB 3HM9A 3QEPA 4AQYK 3QO9A 4I9QA 2KTQA 3MECA 1D9DA 3SNNA 4DU3A 4Z94A 4AHRA 4A61A 1NM1A 3P38A 2DY4A 2UUBK 4JI1K 3CJBA 4BDYA 4KHYA 1NGDA 3KJVA 4M3XA 3H3NO 2D0PA 2A42A 2QM1A 5AZJB 3DOLA 4FJXA 3CM6A 3LDLA 4FWLA 2YKNA 4FOIA 5HROA 2X6SA 3HI0A 1NNEA 1YITN 3KHYA 4JK7A 3G6EN 2VG5A 4A2BA 3DLEA 5FDLA 3F9KA 4JS5A 3O4QA 1J6ZA 5M1NA 4JI7K 3M8SA 4ELTA 4O0IA 1EQYA 1WNSA 5F2RA 1VSFA 4W5TA 4FLUA 1GLCG 4CJ3A 3T7ZA 4CJSA 4CJEA 3QB0A 3QNNA 4K41A 4EAHD 4F4KA 2V51B 1NKEA 1NMNA 4IZ9A 2VGNA 3THYA 4FZYA 3VGMA 3ZT1A 1VHXA 1BI4A 1VQKN 3SI6A 1F21A 5LMUK 3QFPA 4OLAA 4KI6A 2YNHA 4BRMA 4L8RB 1KXPA 4U7BA 3HXMA 3AO2A 3WT0A 1JL1A 4H5RA 4H4MA 4CI6A 4HHTA 3SJHA 1KAXA 3OYFA 1BQMA 1ZBSA 4DR3K 4E7LA 3MXJA 1R59O 1W7AA 3LDPA 3MN6A 4ISGA 3THXB 2Q0RA 3Q7BA 3SUNA 2PFUA 1JLAA 5AQSA 3A2FA 2KLAA 4BRDA 4MFBA 1HJOA 4BQLA 5BN9A 1JL2A 5M1PA 2O4GA 2VYPA 3MN7A 1L3UA 1SUQA 4DTMA 1TAQA 3O3FA 3FZKA 3MCAB 3VERA 2WBNA 3SLCA 3D45A 3AGKA 4DSIA 3A5MC 4B1YB 3G10A 4G9ZA 1E3MA 3MEEA 4O55A 1C0MA 4CHQA 2E2OA 1KAZA 1BIZA 3DOKA 3SBGA 2GV9A 3NAEA 5J2NA 4BRHA 5KI6A 3UIQA 4FM2A 2E8AA 1K8AO 4RW7A 3KLHA 1REVA 2HF4A 4JI0K 4WFBL 3AV9A 3THWA 4KFBA 2GUPA 1MWMA 1EWRA 1C0FA 3J8AA 3W3DA 5E84A 4M45A 4A5AA 3OYAA 3F5TA 3MK6A 1S1XA 2PYJA 4N76A
chains in the Genus database with same CATH topology
4KKOA 4B8AB 4OVLA 4FJNA 1FXXA 3SQ1A 5C24A 1DLOA 1S5JA 2X78A 3U3YA 5CZ1A 3M8PA 4OGCA 1SL2A 2ATQA 4CHYA 1KLNA 3PO4A 1QE1A 2YNGA 4CEQA 4BACA 1W0HA 3TANA 4CCHA 4HVJA 4RW6A 3NH1A 5J2QA 3ZT4A 1D9FA 4BWJA 3M8RA 2P5GA 5KRSA 4KHWA 4FW1A 1XC9A 2KFZA 4DG1A 3HJFA 2A1RA 1Q8IA 4N56A 3AA4A 4FK0A 4DSKA 2RN2A 4IKFA 1A5XA 2E4LA 3V9WA 4DSEA 3M8QA 1NK8A 4OKEA 4CFBA 1KFSA 1BIUA 2G8UA 1C0UA 3VQ6A 2X6NA 1KFDA 1ASUA 4B8CA 2HB5A 3BDPA 1QHTA 2KZZA 2Y1JA 3LWLA 3AO1A 1BCOA 1VK0A 4XIUA 4J2EA 4BDZA 2XHBA 4KAZA 4FJIA 4HCBA 4FXDA 1HQEA 1N6QA 3QLHA 4E7JA 3TARA 3ZT0A 4AHVA 2W42A 4CK3A 3NF8A 2HW3A 3VA3A 2OYQA 3NH0A 1ZBHA 1GOAA 1RDCA 4CF8A 5J1EA 1WN7A 3K5MA 3V9XA 3PV8A 1TL3A 4IFYA 3KTQA 2NUBA 1BL3A 4Q5VA 3AVJA 4O44A 3NCIA 4JRPA 3V1RA 4ZHRA 4Z4IA 1ZBIA 5JS1A 4AHCA 3TABA 3K57A 1NK5A 2HHQA 1IG9A 2ZE2A 1Q9YA 4FJJA 3TAQA 1B92A 1RT4A 4FJHA 4CJ4A 1TL1A 1QTMA 4C8NA 3CYMA 2I5JA 3CFOA 3DLKA 3L8BA 4DQRA 1IKWA 3K5OA 1S9EA 3NGYA 1EX4A 3RMDA 4FJMA 3QESA 1U04A 2GUIA 3OJUA 5SWMA 3KLIA 3MEDA 4CHOA 4ZTJA 3AVBA 3AVGA 1C0TA 1JXBA 2YV0X 4NCGA 4E1NA 3HPHA 1RT1A 4E3SA 3QERA 3L2VA 4ID1A 3OYBA 3C94A 1VSMA 4KTWA 3L3UA 4DS4A 4DSJA 3L3VA 4DTJA 3RR8A 1S6QA 3AVKA 1WLJA 1TKDA 4I2QA 1J53A 4GW6A 4EP5A 2XY8A 4CFDA 3QEWA 4UQGA 4PA1A 2HNYA 4CJFA 4W5RA 5DK5A 3EY1A 4FLZA 4LY7A 2OPPA 3I8DA 2QKBA 4E7KA 4FLTA 4B9UA 4Z0UA 2OPQA 3AO5A 3OYKA 3L2RA 2YKMA 2IS3A 4RW4A 3V9ZA 1RCHA 1S1TA 2A1SA 4DLEA 3LALA 4FM0A 1S1WA 1ZBUA 2BDPA 4EZ6A 1ZBFA 1LWEA 2G8IA 1TAUA 4E7IA 2DFEA 3OY9A 3V9SA 1NK4A 1FKOA 1QS4A 2FBTA 1WSJA 1EXQA 1KLMA 3E01A 3WNGA 4CEFA 4CJWA 3OYEA 3KD1E 1LV5A 3P5JA 4DLGA 4W5QA 2O4IA 5KGWA 4CHPA 2D0AA 3HVTA 4FJLA 4AHTA 3SV4A 3KK2A 1HJRA 3OYMA 3VQ9A 4AILC 1VRTA 3KKRA 3VQQA 4DTOA 1SL0A 4B9TA 4F3OA 3AA2A 3IS9A 1NJZA 4Q0BA 2KZMA 4B9SA 2R7YA 4NYFA 4DTPA 3S3MA 2FBVA 4CK1A 4E0DA 1JKHA 4B9NA 3LDSA 3CG7A 4CEBA 1QSLA 4B9VA 1NJXA 3PO5A 3THVA 2E6LA 3SUPA 1QSSA 1RTIA 1U49A 2LSNA 4RG8A 4BE1A 3T3FA 3QIPA 3TAEA 1SKWA 4DFJA 1KSPA 4NCAA 3CM5A 3K5LA 4M3WA 5I42A 1YTAA 1QQCA 1BQNA 1U45A 2Z1GA 3OYCA 1RDAA 4FK2A 2Z1HA 4I2PA 3OVNA 5K14A 3ZT2A 1YTUA 4O5BA 4FLXA 1QSYA 3LPUA 1ITGA 1YVUA 4CJKA 4EP4A 4KTZA 4WE1A 4FJGA 3C6UA 4CECA 5C42A 2QKKA 1JLCA 3ZT3A 3SPZA 4CIFA 4M42A 1S1UA 3B6PA 4AHSA 1C1BA 1I3AA 1VSHA 3O3HA 4E89A 3OYHA 1RT6A 3QEVA 1KCFA 3B6OA 1WSEA 3HYFA 3PUFA 5SZTA 3TI0A 1JLGA 1XWLA 1BCMA 1UWBA 1NKCA 1RBVA 1L3SA 1ASWA 2D5RA 3ZSVA 4OKKA 3ASMA 3FFIA 3IRXA 3V1OA 4W5NA 3LP0A 4JLHA 2XY7A 4OKJA 4F2RA 1NK9A 1U48A 4OPJA 3OYNA 1FKPA 2D0BA 3ZSXA 4FLVA 4DS5A 4YFUA 3K5NA 3VQAA 4W5OA 4DTRA 1ZBLA 4OLBA 2FBXA 2OPSA 5EU7A 4LSNA 1WSIA 2PYLA 4CEAA 3DLBA 2F96A 1WSFA 2IGIA 1RT5A 3DM2A 3HT3A 1HQUA 4KHSA 4KTQA 5FRNA 4CJRA 4AH9A 2VWJA 3ZSZA 2IAJA 1LWCA 1BI4B 3O3GA 4H4OA 4N47A 3WNHA 4CE9A 1X9WA 1RTHA 4O0JA 3ISNC 1NK7A 3RRGA 3MXMA 2HHSA 4Y1DA 3KLEA 3TAGA 4KHNA 2WONA 2YNFA 1SV5A 3EZ5A 1D8YA 3AVFA 1U47A 4CHNA 1DTQA 3SPYA 1S1VA 1TKXA 3HL8A 2G8VA 1EKEA 1HNIA 3KLFA 3O4NA 4IG0A 2YNIA 1TVRA 1WAJA 2B6AA 4FK4A 3CFPA 2P5OA 3VN5A 3V6DA 3DLHA 2P1JA 4O4GA 3LANA 3PX4A 1SKRA 1X9MA 4KI4A 5T7BA 2JLEA 3RRHA 4F3TA 1TKTA 2F8SA 1C6VA 4N41A 1BISA 3NF9A 4CF1A 3WNEA 3QETA 2Y1IA 1X9SA 1RILA 4DTUA 4BWMA 4C8KA 1CXQA 4DF8A 3K59A 4QOZB 3TR8A 5E41A 1YT3A 5CZ2A 4OPKA 3PX6A 4IBNA 3HSTB 3VQPA 3L2WA 5CYQA 2HHUA 1ZYQA 3AVHA 2BE2A 3ZCMA 3VQDA 3S9HA 4ID5A 3TAFA 4DF4A 3TWHA 1LAVA 4KB0A 5HBMA 4DFMA 2HHXA 3NHGA 1NK6A 3OS2A 2HVHA 4E19A 4DQPA 5C25A 1JLFA 3NGIA 4FCYA 4CJPA 2KW4A 1LW0A 4CF9A 2HNZA 4KO0A 2B5JA 1JLBA 2P51A 2YHBA 4CIEA 3RTVA 3SQ0A 2HHTA 1RT2A 3KK1A 3DYAA 4J2BA 4Z4GA 1C1CA 2Z1IA 3NDKA 4DQQA 2FBYA 2G8HA 3DLRA 4CGHA 4KHUA 1A5VA 3S3NA 2HHVA 1EP4A 1I39A 3AO4A 3CQ8A 3OJSA 4CGJA 4CJLA 3OYLA 3ULDA 4Z4FA 3P83D 1ASVA 3HP9A 4JRQA 1UA1A 1NOYA 2JGUA 5D3GA 1DTTA 3AVNA 1J9AA 4ZTFA 5J2MA 4CEOA 3SZ2A 1T03A 3MEGA 1NJWA 3LPTA 4KB1A 3DI6A 3RWUA 5CY4A 1CLQA 3NF7A 1SKSA 4ELVA 4Y1CA 4CF2A 4GMJB 3C95A 4YNQA 1B9FA 5FROA 3LWMA 1LWFA 3PY8A 4FJ5A 4PWDA 1Z26A 3IG1A 4LH4A 4CGFA 3L2QA 3L2UA 1EETA 3SQ4A 3C6TA 3RMBA 1FK9A 4CEEA 1IKVA 1HPZA 3QINA 4CIGA 2VG6A 2XY6A 1Z25A 3RMAA 4I7FA 3VQ7A 3I0SA 4DTSA 4DTNA 4DFPA 1TKZA 3NBPA 4QAGA 3EYZA 1RBRA 2G8WA 1RDBA 3VQ4A 1L5UA 4M3UA 1L3TA 4M3ZA 1BGXT 1VRUA 3NE6A 4HUEA 4DQSA 4PUOA 4OJRA 3V9UA 3VQCA 4DSFA 2OPRA 4CFCA 2ZD1A 1C1AA 1RTDA 4FJ8A 1K6YA 1LW2A 1WSGA 3DRSA 4DQIA 3AA3A 3NFAA 1HYZA 3T19A 3LZJA 4DSLA 3AVMA 4CGGA 4C8OA 4HTUA 4C8MA 1BHLA 1JLQA 3SCXA 1VSDA 3DRRA 3K2PA 1MU2A 4B9LA 2G8KA 2BANA 3SYZA 3LP3A 2HHWA 3LP1A 3T1AA 5HRPA 1TK0A 3ITHA 3HM9A 3QEPA 3G0ZA 3AVLA 2KFNA 3QO9A 4I9QA 1RBUA 2KTQA 3MECA 1D9DA 3SNNA 4G1QA 3HVRA 2ITGA 4DU3A 2ETJA 4AHRA 1RDDA 2DY4A 3AA5X 4BE0A 1HNVA 3KLGA 2XY5A 1XI1A 3DLGA 4FJ9A 3TAMA 4BDYA 2YHAA 2DFHA 3D0PA 3LZIA 4I9LA 3S3OA 1L3VA 3OYJA 3QIOA 2X74A 4DFKA 4KHQA 4KHYA 5DMRA 5I3UA 1RBTA 3KJVA 4M3XA 3NH2A 3IAYA 3QNOA 4PY5A 1KVAA 2PZSA 3VQ5A 3HP6A 5JS2A 3DOLA 4N5SA 3RMCA 1D5AA 4F2SA 4TSXA 1TK8A 2AJQA 4FJXA 3VQBA 3CM6A 2YKNA 1RT3A 5HROA 1IKXA 2X6SA 3TAPA 4NCBA 1CZBA 5KGXA 1J5OA 3ZSWA 2IDOA 4NYNA 1O1WA 3K58A 1IH7A 2VG5A 4F8RA 4DWIA 3RR7A 2RF2A 4C8LA 3DLEA 2D0CA 1CXUA 2XO7A 3JYTA 1JXEA 3NF6A 1UA0A 4J2AA 2G8FA 1RBSA 1XHXA 5FDLA 3SUOA 3F9KA 1NKBA 3OYDA 4DTXA 4JS5A 3O4QA 1S6PA 4Z4CA 1KVCA 2BGGA 3QEXA 1KVBA 1J54A 3M8SA 4FLWA 3V81A 4GVMA 2ZQBA 5KTQA 3ZSOA 4ELTA 4O0IA 3U3GA 1GOCA 4CEDA 3ZSQA 4DU4A 4QCLA 2B4JA 3KKSA 3SQ2A 4CK2A 3JSMA 4M41A 4RW8A 1KTQA 1WNSA 5J2PA 3BGRA 5HP1A 1VSFA 4Z4HA 4W5TA 4FLUA 4CJ3A 4CJSA 1T8EA 4KPYA 4CJEA 4CESA 1HMVA 3OS1A 2XRIA 3QNNA 3NGZA 4CERA 4BDPA 4H8KA 4F4KA 1NKEA 3I0RA 1N5YA 3AVIA 1R0AA 1IKYA 4JS4A 4FZYA 3SV3A 2IC3A 3HO1A 1HYVA 1A5WA 5FRMA 4LD0A 3ZT1A 1BI4A 1NJYA 1TV6A 1SL1A 3SI6A 3HK2A 1IO2A 1F21A 4LH5A 4M3YA 3AVAA 4OLAA 4KI6A 2YNHA 4HCCA 4L8RB 1UAXA 1KRPA 3VA0A 2HMIA 3P1GA 4DU1A 3HXMA 3AO2A 2RPIA 1JL1A 4H4MA 3KIOA 4E1MA 2Z1JA 4B08A 1X1PA 4HHTA 5HRNA 4R5PA 4OGEA 3LP2A 3OYFA 1BQMA 4Z4EA 2E6MA 4E7LA 3HPGA 3MXJA 1UOCA 4M3TA 4IG3A 4CJQA 1NK0A 4FLYA 1T7PA 1Q9XA 3SUNA 3F73A 1JLAA 1G15A 4FVMA 4FYDA 3A2FA 4B3OA 4CJUA 4ICLA 2HNDA 4MFBA 1LAWA 3QEIA 4FZXC 3DRPA 1JLEA 2EHGA 2QK9A 1JL2A 3V4IA 2O4GA 1L3UA 1SUQA 4DTMA 1HYSA 4KV8A 1Y97A 1TAQA 3WNFA 4KREA 1WSHA 3O3FA 3LAMA 3VQEA 3VQ8A 4DMNA 2OZMA 1B9DA 1CZ9A 4J2DA 5HRRA 4ELUA 4FJ7A 1HRHA 2RKIA 3OS0A 4K8ZA 3KK3A 4CEZA 1VSEA 3MAQA 5HLFA 4B9MA 1XHZA 2OZSA 2VG7A 3D45A 3SJJA 3MXIA 4DSIA 2WOMA 3DMJA 1GOBA 1VSIA 1RTJA 3G10A 3AO3A 3ZSRA 4CJ5A 3OYIA 3MEEA 4O55A 1C0MA 4CHQA 4FZZA 2VWKA 2FC0A 3CFRA 2DTUA 1VSKA 1BIZA 2GBZA 3DOKA 2GV9A 4CGIA 4M3RA 4CGDA 1WAFA 3OYGA 3NAEA 5J2NA 1TGOA 3SUQA 1T05A 1RNHA 5KI6A 4E7HA 3UIQA 4FJKA 2F8TA 4AHUA 4FM2A 2DFFA 2KQ2A 2PY5A 3KD5E 2QXFA 2EX3A 3LAKA 3HPOA 3PX0A 1NOZA 4RW7A 3KLHA 1U4BA 1REVA 2IOCA 4BE2A 1TK5A 1RT7A 4EZ9A 3AV9A 4KFBA 2HVIA 3H08A 4FM1A 3ALYA 5HRSA 5KRTA 4PQUA 3V1QA 1S9GA 2Q3SA 4HUGA 1W9HA 4CJTA 4CJVA 3U6FA 4M45A 4RW9A 3OYAA 3ZSYA 4FW2A 1VSLA 4CF0A 4K8XA 1VSJA 5CYMA 1S1XA 4IDKA 2PYJA 4N76A 4MQ3A 2OA8A 4LSLA 4HUFA 4CFAA 4KRFA 4CHZA 4IFVA 3AVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKO A;  4B8A B;  4OVL A;  4FJN A;  1FXX A;  3SQ1 A;  5C24 A;  1DLO A;  1S5J A;  2X78 A;  3U3Y A;  5CZ1 A;  3M8P A;  4OGC A;  1SL2 A;  2ATQ A;  4CHY A;  1KLN A;  3PO4 A;  1QE1 A;  2YNG A;  4CEQ A;  4BAC A;  1W0H A;  3TAN A;  4CCH A;  4HVJ A;  4RW6 A;  3NH1 A;  5J2Q A;  3ZT4 A;  1D9F A;  4BWJ A;  3M8R A;  2P5G A;  5KRS A;  4KHW A;  4FW1 A;  1XC9 A;  2KFZ A;  4DG1 A;  3HJF A;  2A1R A;  1Q8I A;  4N56 A;  3AA4 A;  4FK0 A;  4DSK A;  2RN2 A;  4IKF A;  1A5X A;  2E4L A;  3V9W A;  4DSE A;  3M8Q A;  1NK8 A;  4OKE A;  4CFB A;  1KFS A;  1BIU A;  2G8U A;  1C0U A;  3VQ6 A;  2X6N A;  1KFD A;  1ASU A;  4B8C A;  2HB5 A;  3BDP A;  1QHT A;  2KZZ A;  2Y1J A;  3LWL A;  3AO1 A;  1BCO A;  1VK0 A;  4XIU A;  4J2E A;  4BDZ A;  2XHB A;  4KAZ A;  4FJI A;  4HCB A;  4FXD A;  1HQE A;  1N6Q A;  3QLH A;  4E7J A;  3TAR A;  3ZT0 A;  4AHV A;  2W42 A;  4CK3 A;  3NF8 A;  2HW3 A;  3VA3 A;  2OYQ A;  3NH0 A;  1ZBH A;  1GOA A;  1RDC A;  4CF8 A;  5J1E A;  1WN7 A;  3K5M A;  3V9X A;  3PV8 A;  1TL3 A;  4IFY A;  3KTQ A;  2NUB A;  1BL3 A;  4Q5V A;  3AVJ A;  4O44 A;  3NCI A;  4JRP A;  3V1R A;  4ZHR A;  4Z4I A;  1ZBI A;  5JS1 A;  4AHC A;  3TAB A;  3K57 A;  1NK5 A;  2HHQ A;  1IG9 A;  2ZE2 A;  1Q9Y A;  4FJJ A;  3TAQ A;  1B92 A;  1RT4 A;  4FJH A;  4CJ4 A;  1TL1 A;  1QTM A;  4C8N A;  3CYM A;  2I5J A;  3CFO A;  3DLK A;  3L8B A;  4DQR A;  1IKW A;  3K5O A;  1S9E A;  3NGY A;  1EX4 A;  3RMD A;  4FJM A;  3QES A;  1U04 A;  2GUI A;  3OJU A;  5SWM A;  3KLI A;  3MED A;  4CHO A;  4ZTJ A;  3AVB A;  3AVG A;  1C0T A;  1JXB A;  2YV0 X;  4NCG A;  4E1N A;  3HPH A;  1RT1 A;  4E3S A;  3QER A;  3L2V A;  4ID1 A;  3OYB A;  3C94 A;  1VSM A;  4KTW A;  3L3U A;  4DS4 A;  4DSJ A;  3L3V A;  4DTJ A;  3RR8 A;  1S6Q A;  3AVK A;  1WLJ A;  1TKD A;  4I2Q A;  1J53 A;  4GW6 A;  4EP5 A;  2XY8 A;  4CFD A;  3QEW A;  4UQG A;  4PA1 A;  2HNY A;  4CJF A;  4W5R A;  5DK5 A;  3EY1 A;  4FLZ A;  4LY7 A;  2OPP A;  3I8D A;  2QKB A;  4E7K A;  4FLT A;  4B9U A;  4Z0U A;  2OPQ A;  3AO5 A;  3OYK A;  3L2R A;  2YKM A;  2IS3 A;  4RW4 A;  3V9Z A;  1RCH A;  1S1T A;  2A1S A;  4DLE A;  3LAL A;  4FM0 A;  1S1W A;  1ZBU A;  2BDP A;  4EZ6 A;  1ZBF A;  1LWE A;  2G8I A;  1TAU A;  4E7I A;  2DFE A;  3OY9 A;  3V9S A;  1NK4 A;  1FKO A;  1QS4 A;  2FBT A;  1WSJ A;  1EXQ A;  1KLM A;  3E01 A;  3WNG A;  4CEF A;  4CJW A;  3OYE A;  3KD1 E;  1LV5 A;  3P5J A;  4DLG A;  4W5Q A;  2O4I A;  5KGW A;  4CHP A;  2D0A A;  3HVT A;  4FJL A;  4AHT A;  3SV4 A;  3KK2 A;  1HJR A;  3OYM A;  3VQ9 A;  4AIL C;  1VRT A;  3KKR A;  3VQQ A;  4DTO A;  1SL0 A;  4B9T A;  4F3O A;  3AA2 A;  3IS9 A;  1NJZ A;  4Q0B A;  2KZM A;  4B9S A;  2R7Y A;  4NYF A;  4DTP A;  3S3M A;  2FBV A;  4CK1 A;  4E0D A;  1JKH A;  4B9N A;  3LDS A;  3CG7 A;  4CEB A;  1QSL A;  4B9V A;  1NJX A;  3PO5 A;  3THV A;  2E6L A;  3SUP A;  1QSS A;  1RTI A;  1U49 A;  2LSN A;  4RG8 A;  4BE1 A;  3T3F A;  3QIP A;  3TAE A;  1SKW A;  4DFJ A;  1KSP A;  4NCA A;  3CM5 A;  3K5L A;  4M3W A;  5I42 A;  1YTA A;  1QQC A;  1BQN A;  1U45 A;  2Z1G A;  3OYC A;  1RDA A;  4FK2 A;  2Z1H A;  4I2P A;  3OVN A;  5K14 A;  3ZT2 A;  1YTU A;  4O5B A;  4FLX A;  1QSY A;  3LPU A;  1ITG A;  1YVU A;  4CJK A;  4EP4 A;  4KTZ A;  4WE1 A;  4FJG A;  3C6U A;  4CEC A;  5C42 A;  2QKK A;  1JLC A;  3ZT3 A;  3SPZ A;  4CIF A;  4M42 A;  1S1U A;  3B6P A;  4AHS A;  1C1B A;  1I3A A;  1VSH A;  3O3H A;  4E89 A;  3OYH A;  1RT6 A;  3QEV A;  1KCF A;  3B6O A;  1WSE A;  3HYF A;  3PUF A;  5SZT A;  3TI0 A;  1JLG A;  1XWL A;  1BCM A;  1UWB A;  1NKC A;  1RBV A;  1L3S A;  1ASW A;  2D5R A;  3ZSV A;  4OKK A;  3ASM A;  3FFI A;  3IRX A;  3V1O A;  4W5N A;  3LP0 A;  4JLH A;  2XY7 A;  4OKJ A;  4F2R A;  1NK9 A;  1U48 A;  4OPJ A;  3OYN A;  1FKP A;  2D0B A;  3ZSX A;  4FLV A;  4DS5 A;  4YFU A;  3K5N A;  3VQA A;  4W5O A;  4DTR A;  1ZBL A;  4OLB A;  2FBX A;  2OPS A;  5EU7 A;  4LSN A;  1WSI A;  2PYL A;  4CEA A;  3DLB A;  2F96 A;  1WSF A;  2IGI A;  1RT5 A;  3DM2 A;  3HT3 A;  1HQU A;  4KHS A;  4KTQ A;  5FRN A;  4CJR A;  4AH9 A;  2VWJ A;  3ZSZ A;  2IAJ A;  1LWC A;  1BI4 B;  3O3G A;  4H4O A;  4N47 A;  3WNH A;  4CE9 A;  1X9W A;  1RTH A;  4O0J A;  3ISN C;  1NK7 A;  3RRG A;  3MXM A;  2HHS A;  4Y1D A;  3KLE A;  3TAG A;  4KHN A;  2WON A;  2YNF A;  1SV5 A;  3EZ5 A;  1D8Y A;  3AVF A;  1U47 A;  4CHN A;  1DTQ A;  3SPY A;  1S1V A;  1TKX A;  3HL8 A;  2G8V A;  1EKE A;  1HNI A;  3KLF A;  3O4N A;  4IG0 A;  2YNI A;  1TVR A;  1WAJ A;  2B6A A;  4FK4 A;  3CFP A;  2P5O A;  3VN5 A;  3V6D A;  3DLH A;  2P1J A;  4O4G A;  3LAN A;  3PX4 A;  1SKR A;  1X9M A;  4KI4 A;  5T7B A;  2JLE A;  3RRH A;  4F3T A;  1TKT A;  2F8S A;  1C6V A;  4N41 A;  1BIS A;  3NF9 A;  4CF1 A;  3WNE A;  3QET A;  2Y1I A;  1X9S A;  1RIL A;  4DTU A;  4BWM A;  4C8K A;  1CXQ A;  4DF8 A;  3K59 A;  4QOZ B;  3TR8 A;  5E41 A;  1YT3 A;  5CZ2 A;  4OPK A;  3PX6 A;  4IBN A;  3HST B;  3VQP A;  3L2W A;  5CYQ A;  2HHU A;  1ZYQ A;  3AVH A;  2BE2 A;  3ZCM A;  3VQD A;  3S9H A;  4ID5 A;  3TAF A;  4DF4 A;  3TWH A;  1LAV A;  4KB0 A;  5HBM A;  4DFM A;  2HHX A;  3NHG A;  1NK6 A;  3OS2 A;  2HVH A;  4E19 A;  4DQP A;  5C25 A;  1JLF A;  3NGI A;  4FCY A;  4CJP A;  2KW4 A;  1LW0 A;  4CF9 A;  2HNZ A;  4KO0 A;  2B5J A;  1JLB A;  2P51 A;  2YHB A;  4CIE A;  3RTV A;  3SQ0 A;  2HHT A;  1RT2 A;  3KK1 A;  3DYA A;  4J2B A;  4Z4G A;  1C1C A;  2Z1I A;  3NDK A;  4DQQ A;  2FBY A;  2G8H A;  3DLR A;  4CGH A;  4KHU A;  1A5V A;  3S3N A;  2HHV A;  1EP4 A;  1I39 A;  3AO4 A;  3CQ8 A;  3OJS A;  4CGJ A;  4CJL A;  3OYL A;  3ULD A;  4Z4F A;  3P83 D;  1ASV A;  3HP9 A;  4JRQ A;  1UA1 A;  1NOY A;  2JGU A;  5D3G A;  1DTT A;  3AVN A;  1J9A A;  4ZTF A;  5J2M A;  4CEO A;  3SZ2 A;  1T03 A;  3MEG A;  1NJW A;  3LPT A;  4KB1 A;  3DI6 A;  3RWU A;  5CY4 A;  1CLQ A;  3NF7 A;  1SKS A;  4ELV A;  4Y1C A;  4CF2 A;  4GMJ B;  3C95 A;  4YNQ A;  1B9F A;  5FRO A;  3LWM A;  1LWF A;  3PY8 A;  4FJ5 A;  4PWD A;  1Z26 A;  3IG1 A;  4LH4 A;  4CGF A;  3L2Q A;  3L2U A;  1EET A;  3SQ4 A;  3C6T A;  3RMB A;  1FK9 A;  4CEE A;  1IKV A;  1HPZ A;  3QIN A;  4CIG A;  2VG6 A;  2XY6 A;  1Z25 A;  3RMA A;  4I7F A;  3VQ7 A;  3I0S A;  4DTS A;  4DTN A;  4DFP A;  1TKZ A;  3NBP A;  4QAG A;  3EYZ A;  1RBR A;  2G8W A;  1RDB A;  3VQ4 A;  1L5U A;  4M3U A;  1L3T A;  4M3Z A;  1BGX T;  1VRU A;  3NE6 A;  4HUE A;  4DQS A;  4PUO A;  4OJR A;  3V9U A;  3VQC A;  4DSF A;  2OPR A;  4CFC A;  2ZD1 A;  1C1A A;  1RTD A;  4FJ8 A;  1K6Y A;  1LW2 A;  1WSG A;  3DRS A;  4DQI A;  3AA3 A;  3NFA A;  1HYZ A;  3T19 A;  3LZJ A;  4DSL A;  3AVM A;  4CGG A;  4C8O A;  4HTU A;  4C8M A;  1BHL A;  1JLQ A;  3SCX A;  1VSD A;  3DRR A;  3K2P A;  1MU2 A;  4B9L A;  2G8K A;  2BAN A;  3SYZ A;  3LP3 A;  2HHW A;  3LP1 A;  3T1A A;  5HRP A;  1TK0 A;  3ITH A;  3HM9 A;  3QEP A;  3G0Z A;  3AVL A;  2KFN A;  3QO9 A;  4I9Q A;  1RBU A;  2KTQ A;  3MEC A;  1D9D A;  3SNN A;  4G1Q A;  3HVR A;  2ITG A;  4DU3 A;  2ETJ A;  4AHR A;  1RDD A;  2DY4 A;  3AA5 X;  4BE0 A;  1HNV A;  3KLG A;  2XY5 A;  1XI1 A;  3DLG A;  4FJ9 A;  3TAM A;  4BDY A;  2YHA A;  2DFH A;  3D0P A;  3LZI A;  4I9L A;  3S3O A;  1L3V A;  3OYJ A;  3QIO A;  2X74 A;  4DFK A;  4KHQ A;  4KHY A;  5DMR A;  5I3U A;  1RBT A;  3KJV A;  4M3X A;  3NH2 A;  3IAY A;  3QNO A;  4PY5 A;  1KVA A;  2PZS A;  3VQ5 A;  3HP6 A;  5JS2 A;  3DOL A;  4N5S A;  3RMC A;  1D5A A;  4F2S A;  4TSX A;  1TK8 A;  2AJQ A;  4FJX A;  3VQB A;  3CM6 A;  2YKN A;  1RT3 A;  5HRO A;  1IKX A;  2X6S A;  3TAP A;  4NCB A;  1CZB A;  5KGX A;  1J5O A;  3ZSW A;  2IDO A;  4NYN A;  1O1W A;  3K58 A;  1IH7 A;  2VG5 A;  4F8R A;  4DWI A;  3RR7 A;  2RF2 A;  4C8L A;  3DLE A;  2D0C A;  1CXU A;  2XO7 A;  3JYT A;  1JXE A;  3NF6 A;  1UA0 A;  4J2A A;  2G8F A;  1RBS A;  1XHX A;  5FDL A;  3SUO A;  3F9K A;  1NKB A;  3OYD A;  4DTX A;  4JS5 A;  3O4Q A;  1S6P A;  4Z4C A;  1KVC A;  2BGG A;  3QEX A;  1KVB A;  1J54 A;  3M8S A;  4FLW A;  3V81 A;  4GVM A;  2ZQB A;  5KTQ A;  3ZSO A;  4ELT A;  4O0I A;  3U3G A;  1GOC A;  4CED A;  3ZSQ A;  4DU4 A;  4QCL A;  2B4J A;  3KKS A;  3SQ2 A;  4CK2 A;  3JSM A;  4M41 A;  4RW8 A;  1KTQ A;  1WNS A;  5J2P A;  3BGR A;  5HP1 A;  1VSF A;  4Z4H A;  4W5T A;  4FLU A;  4CJ3 A;  4CJS A;  1T8E A;  4KPY A;  4CJE A;  4CES A;  1HMV A;  3OS1 A;  2XRI A;  3QNN A;  3NGZ A;  4CER A;  4BDP A;  4H8K A;  4F4K A;  1NKE A;  3I0R A;  1N5Y A;  3AVI A;  1R0A A;  1IKY A;  4JS4 A;  4FZY A;  3SV3 A;  2IC3 A;  3HO1 A;  1HYV A;  1A5W A;  5FRM A;  4LD0 A;  3ZT1 A;  1BI4 A;  1NJY A;  1TV6 A;  1SL1 A;  3SI6 A;  3HK2 A;  1IO2 A;  1F21 A;  4LH5 A;  4M3Y A;  3AVA A;  4OLA A;  4KI6 A;  2YNH A;  4HCC A;  4L8R B;  1UAX A;  1KRP A;  3VA0 A;  2HMI A;  3P1G A;  4DU1 A;  3HXM A;  3AO2 A;  2RPI A;  1JL1 A;  4H4M A;  3KIO A;  4E1M A;  2Z1J A;  4B08 A;  1X1P A;  4HHT A;  5HRN A;  4R5P A;  4OGE A;  3LP2 A;  3OYF A;  1BQM A;  4Z4E A;  2E6M A;  4E7L A;  3HPG A;  3MXJ A;  1UOC A;  4M3T A;  4IG3 A;  4CJQ A;  1NK0 A;  4FLY A;  1T7P A;  1Q9X A;  3SUN A;  3F73 A;  1JLA A;  1G15 A;  4FVM A;  4FYD A;  3A2F A;  4B3O A;  4CJU A;  4ICL A;  2HND A;  4MFB A;  1LAW A;  3QEI A;  4FZX C;  3DRP A;  1JLE A;  2EHG A;  2QK9 A;  1JL2 A;  3V4I A;  2O4G A;  1L3U A;  1SUQ A;  4DTM A;  1HYS A;  4KV8 A;  1Y97 A;  1TAQ A;  3WNF A;  4KRE A;  1WSH A;  3O3F A;  3LAM A;  3VQE A;  3VQ8 A;  4DMN A;  2OZM A;  1B9D A;  1CZ9 A;  4J2D A;  5HRR A;  4ELU A;  4FJ7 A;  1HRH A;  2RKI A;  3OS0 A;  4K8Z A;  3KK3 A;  4CEZ A;  1VSE A;  3MAQ A;  5HLF A;  4B9M A;  1XHZ A;  2OZS A;  2VG7 A;  3D45 A;  3SJJ A;  3MXI A;  4DSI A;  2WOM A;  3DMJ A;  1GOB A;  1VSI A;  1RTJ A;  3G10 A;  3AO3 A;  3ZSR A;  4CJ5 A;  3OYI A;  3MEE A;  4O55 A;  1C0M A;  4CHQ A;  4FZZ A;  2VWK A;  2FC0 A;  3CFR A;  2DTU A;  1VSK A;  1BIZ A;  2GBZ A;  3DOK A;  2GV9 A;  4CGI A;  4M3R A;  4CGD A;  1WAF A;  3OYG A;  3NAE A;  5J2N A;  1TGO A;  3SUQ A;  1T05 A;  1RNH A;  5KI6 A;  4E7H A;  3UIQ A;  4FJK A;  2F8T A;  4AHU A;  4FM2 A;  2DFF A;  2KQ2 A;  2PY5 A;  3KD5 E;  2QXF A;  2EX3 A;  3LAK A;  3HPO A;  3PX0 A;  1NOZ A;  4RW7 A;  3KLH A;  1U4B A;  1REV A;  2IOC A;  4BE2 A;  1TK5 A;  1RT7 A;  4EZ9 A;  3AV9 A;  4KFB A;  2HVI A;  3H08 A;  4FM1 A;  3ALY A;  5HRS A;  5KRT A;  4PQU A;  3V1Q A;  1S9G A;  2Q3S A;  4HUG A;  1W9H A;  4CJT A;  4CJV A;  3U6F A;  4M45 A;  4RW9 A;  3OYA A;  3ZSY A;  4FW2 A;  1VSL A;  4CF0 A;  4K8X A;  1VSJ A;  5CYM A;  1S1X A;  4IDK A;  2PYJ A;  4N76 A;  4MQ3 A;  2OA8 A;  4LSL A;  4HUF A;  4CFA A;  4KRF A;  4CHZ A;  4IFV A;  3AVC A; 
#chains in the Genus database with same CATH topology
 4KKO A;  3VGL A;  4OGC A;  3ULE B;  4CZL A;  1NGB A;  4CEQ A;  3QIC A;  5AQT A;  3O80 A;  3ZT4 A;  3M8R A;  4X66 K;  2P5G A;  4BR2 A;  1XC9 A;  1K73 O;  4LF4 K;  4N56 A;  3AA4 A;  2P9S B;  4CZK A;  3V9W A;  3M8Q A;  1C0U A;  1ASU A;  3LWL A;  3AO1 A;  3EEQ A;  4HCB A;  4JN4 A;  1OH7 A;  1HQE A;  2A6A A;  2YJF A;  3WXJ A;  4E7J A;  3TAR A;  3QDK A;  4CK3 A;  3PSI A;  5AQZ A;  3BZC A;  3V9X A;  3PV8 A;  3BY5 A;  4CZF A;  3OHR A;  3AVJ A;  4CVN E;  4GNI A;  1ZBI A;  4K0K K;  4AHC A;  5M1O A;  2VCP A;  4QS9 A;  4KHP K;  3CYM A;  3CFO A;  3U9Z A;  4CW7 B;  3L8B A;  4GKJ K;  4FJM A;  1S9E A;  4DR5 K;  3QES A;  1U04 A;  2GUI A;  5SWM A;  2QA4 N;  3MED A;  3WUH A;  3AVG A;  1JXB A;  3HPH A;  3CCU N;  1RT1 A;  4E3S A;  2O8F B;  3L2V A;  4ID1 A;  3VF2 A;  3OYB A;  4BRP A;  2ZF5 O;  1CZA N;  4DS4 A;  3IDH A;  3WQT A;  1WLJ A;  4EP5 A;  2XY8 A;  2A3Z A;  4PA1 A;  4W5R A;  5DK5 A;  1YI2 N;  4Z0U A;  2OPQ A;  3OYK A;  3TSQ A;  5BPM A;  2VQF K;  2QW9 A;  3DXK B;  1S1T A;  4OO1 J;  3O6W A;  3LAL A;  1TAU A;  5TKW A;  3OY9 A;  1VQ5 N;  3E66 A;  1NK4 A;  1FKO A;  2GX9 A;  2PAV A;  4I6M B;  3P5J A;  5KGW A;  4CHP A;  5GIO A;  5EXW A;  3G4S N;  4WQ4 C;  4ISF A;  3VQ9 A;  1VRT A;  2KZM A;  3S3M A;  1JKH A;  4CEB A;  3VPZ A;  2O8E A;  1U49 A;  4RG8 A;  5KPT A;  4BE1 A;  3ZLJ A;  3MN9 A;  3TAE A;  1KSP A;  3K5L A;  3MWP A;  5I42 A;  1YTA A;  1U45 A;  1RDA A;  4FK2 A;  2YCH A;  3ZT2 A;  4V19 S;  1YTU A;  4FLX A;  1YVU A;  1W2B M;  4H0P A;  4CJK A;  4WE1 A;  4CEC A;  3U9D A;  5C42 A;  3ZT3 A;  2KKZ A;  4BRK A;  1IV0 A;  4JD2 B;  4E89 A;  5CHI A;  5SZT A;  3PUF A;  4BR5 A;  4B3T K;  1NKC A;  2CGL A;  2QWL A;  1L3S A;  4GKK K;  1J5E K;  1TYQ A;  1U48 A;  4OPJ A;  3I8B A;  2D0B A;  3ZSX A;  3OYN A;  3LM9 A;  3K5N A;  4W5O A;  4DTR A;  4DKW A;  2OPS A;  3J7Z O;  4LSN A;  5GAG P;  1YAG A;  2IGI A;  4H5W A;  2F7T A;  4BC5 A;  2CGK A;  4LC9 B;  2VWJ A;  4H5V A;  3T1H K;  1T6C A;  4FO0 A;  4CE9 A;  1RTH A;  5C12 A;  2BH1 A;  3ISN C;  3RRG A;  4KHN A;  3BEX A;  1SV5 A;  3EE8 A;  1QQO A;  3BF1 A;  2G8V A;  1TVR A;  1VQN N;  3VN5 A;  3PX4 A;  2Q1N A;  4EIA A;  3GG4 A;  2J4R A;  4QS7 A;  2QXL A;  1TKT A;  1BIS A;  4C8K A;  4FWS A;  1N33 K;  4DV5 K;  4DF8 A;  4QOZ B;  5E41 A;  5CZ2 A;  3ZET A;  3FLC O;  4IBN A;  5AFU H;  3L2W A;  5CYQ A;  1DEJ A;  2BE2 A;  4FWR A;  3VQD A;  2HBL A;  4F9O A;  4WFA L;  5HBM A;  1NK6 A;  3KK7 A;  4BRO A;  5DM6 L;  3ENO A;  4CBU A;  2HNZ A;  4CIE A;  3RTV A;  3SQ0 A;  2HHT A;  1BU6 O;  5GAD P;  2HST A;  3CXC M;  3AAR A;  2FBY A;  1XNR K;  1A5V A;  3K0S A;  3AO4 A;  4CJL A;  3MN5 A;  1UA1 A;  1NOY A;  4A59 A;  4PKH A;  3AVN A;  1J9A A;  4R79 A;  5J2M A;  1T03 A;  3MEG A;  3LPT A;  3RWU A;  4AM6 A;  5CY4 A;  1CLQ A;  2ZJR L;  2F9T A;  1V4S A;  2UXB K;  4LFA K;  3C95 A;  3LWM A;  1B9F A;  4YDU C;  1Z26 A;  3L2U A;  1FK9 A;  2VQE K;  1HPZ A;  3QIN A;  3A5L C;  1BOT O;  4H0X B;  3JS6 A;  4BRE A;  4YOY A;  1D4X A;  4DTS A;  1TKZ A;  4QAG A;  4DFP A;  3EYZ A;  4JK8 A;  1L5U A;  4X62 K;  3NE6 A;  1K8K B;  5HL7 L;  2O8C B;  4CZI A;  1DGK N;  4IOA L;  1VQM N;  3VQC A;  4CFC A;  1RTD A;  4FJ8 A;  3ZEU B;  3NFA A;  3LZJ A;  1NU0 A;  4DSL A;  4CGG A;  5H1S Q;  4C8M A;  1BHL A;  1VSD A;  3K2P A;  5AQI A;  1MU2 A;  3CCM N;  5M1K A;  3LP3 A;  3WXL A;  4IO9 L;  3ITH A;  3S41 A;  2KFN A;  2NRZ A;  1RBU A;  3O4W A;  3HVR A;  2ITG A;  3QFU A;  3AA5 X;  4BE0 A;  1HNV A;  3O9R A;  5AQK A;  3LZI A;  1GLD G;  1L3V A;  3M3Z A;  3ATU A;  4PY5 A;  1KVA A;  2P9I A;  2PZS A;  4C1N K;  5JS2 A;  3TTD A;  2ZGZ A;  1D5A A;  1XMO K;  4F2S A;  5KQD A;  3CCL N;  1RT3 A;  1IKX A;  3M6G A;  1HPM A;  3ZSW A;  1O1W A;  2RE2 A;  1SS6 A;  1WUA A;  4DHY A;  3WXK A;  1CXU A;  2XO7 A;  5IWA K;  2G8F A;  1RBS A;  1XHX A;  3OYD A;  4DTX A;  1S6P A;  1NWK A;  5MLC Q;  4EHT A;  3V81 A;  4YOX A;  2ZQB A;  3ZSO A;  3U3G A;  3ZSQ A;  4QCL A;  3SQ2 A;  3JSM A;  4RW8 A;  3BF3 A;  5HP1 A;  1U2V A;  4KPY A;  2BTF A;  1HMV A;  1YJN N;  3LDN A;  2E20 A;  3L6Q A;  5B8H A;  4IDH A;  4LFB K;  1N5Y A;  4C23 A;  1IKY A;  3I33 A;  2IC3 A;  1GLA G;  1S72 N;  1VQO N;  1HYV A;  1A5W A;  4LD0 A;  3HK2 A;  1IO2 A;  1YF5 L;  3CCR N;  4BRF A;  4HCC A;  1KRP A;  3VA0 A;  1XUP O;  4DU1 A;  2F4V K;  2RPI A;  5A2Q O;  3KIO A;  5HOO A;  1X1P A;  5HRN A;  4OGE A;  2VGM A;  3LP2 A;  4CD3 A;  4O8U A;  1Q86 O;  2AA4 A;  4JV5 K;  3CJC A;  1VQ7 N;  4IG3 A;  2A40 A;  4FLY A;  3CJ9 A;  3JAM O;  4FYD A;  4B3O A;  3MWT A;  3VEV A;  2HND A;  2FF6 A;  4FSV A;  5AQW A;  4BR9 A;  4LF8 K;  1OKJ A;  1HYS A;  1Y97 A;  3WNF A;  4DR4 K;  3O08 A;  1WSH A;  3EO3 A;  2QWP A;  1CZ9 A;  2Q2R A;  3ULE A;  4B1W B;  3TTF A;  3OS0 A;  1VSE A;  4DCH A;  5AQH A;  3MAQ A;  4B9M A;  1QHA A;  1Q18 A;  2OZS A;  3SJJ A;  2FSK A;  2P9N A;  3N4Q A;  3A8Y A;  2P9S A;  3ZSR A;  1VSI A;  4DV3 K;  2A41 A;  4LF5 K;  1VAZ A;  1NGA A;  4DR1 K;  2FC0 A;  3ZEU A;  1OH5 A;  2QWO A;  5ADX H;  4GV3 A;  4CGI A;  4CGD A;  3SUQ A;  1WAF A;  3OYG A;  3J7Y P;  1TGO A;  4FJK A;  4E7H A;  1NGF A;  2O8F A;  4AHU A;  2EX3 A;  3LAK A;  3CET A;  1X9J A;  3SMP A;  3ALY A;  1S9G A;  2Q3S A;  4JI4 K;  1W9H A;  3VEY A;  4CJT A;  3U6F A;  2ZGY A;  4CF0 A;  2D0O A;  2OA8 A;  5CR4 A;  1GLF O;  3RSE B;  4JHD B;  4XH5 A;  4CFA A;  3D2F A;  4HUF A;  4CHZ A;  4IFV A;  4YOV A;  4BRN A;  4B8A B;  1FXX A;  5AQN A;  5C24 A;  1S5J A;  1X3N A;  2X78 A;  3U3Y A;  5CZ1 A;  3M8P A;  4PKG A;  2UUC K;  4CHY A;  3MX2 A;  1KLN A;  2YNG A;  4CCH A;  3TAN A;  3O1W A;  1D9F A;  4BWJ A;  5KRS A;  1HKG A;  2KFZ A;  4DG1 A;  3HJF A;  3O5B A;  1Q8I A;  4FK0 A;  3M5R A;  1A5X A;  4OKE A;  4CFB A;  1BIU A;  1KFD A;  2KZZ A;  1QHT A;  2Y1J A;  4J2E A;  4BDZ A;  4JKE A;  3H1V X;  4FJI A;  4IWV A;  1N6Q A;  1KD1 O;  3QLH A;  4KH4 A;  2W42 A;  3NF8 A;  2HW3 A;  3VA3 A;  4CF8 A;  1TL3 A;  3CIP A;  4IFY A;  2NUB A;  1DT9 A;  3H3O B;  1BL3 A;  3ZX2 A;  4NXM K;  3NCI A;  3V1R A;  4ZHR A;  4H0T B;  1NK5 A;  2HHQ A;  2ZE2 A;  2O8B B;  2Q31 A;  3TAQ A;  1TL1 A;  4C8N A;  1ZXO A;  3NGY A;  3UKU A;  4JD2 A;  3VET A;  4BRI A;  3KLI A;  4ZTJ A;  4ILJ A;  3AVB A;  2YV0 X;  3PSF A;  3THY B;  4E1N A;  4YY3 K;  4DSJ A;  4KTW A;  3L3U A;  3E9L A;  4B1V A;  4CFD A;  3QEW A;  4UQG A;  2HNY A;  4XH4 A;  4YOU A;  5C10 A;  3R9P A;  5AZJ A;  3I8D A;  4E7K A;  3P39 A;  3L2R A;  3AO5 A;  3R3L A;  2D4W A;  4RW4 A;  5AR0 A;  2WTU A;  4EZ6 A;  2G8I A;  4E7I A;  1HNZ K;  3L4Q A;  2DFE A;  3J81 O;  1WSJ A;  1KLM A;  3E01 A;  3WNG A;  4CJW A;  2ZJQ L;  3H1Q A;  4DLG A;  1OH8 A;  1HNW K;  4PHT X;  1HJR A;  3OYM A;  4B9T A;  3VQQ A;  4JK9 A;  4DTO A;  2UXD K;  3AA2 A;  1FJG K;  2R7Y A;  4E0D A;  3LDS A;  3UKR B;  4B9V A;  3SUP A;  5IT9 O;  4CD1 A;  2O8D B;  4K25 A;  3P4I A;  1SKW A;  2ZM6 K;  3CM5 A;  4NCA A;  4M3W A;  4BR0 A;  3OYC A;  2Z1H A;  4I2P A;  3OVN A;  5K14 A;  1OH6 A;  3C65 A;  3OA9 A;  4CBX A;  1XQS C;  1ITG A;  5JLH A;  3C6U A;  4GVE A;  2QKK A;  3NVM A;  1C1B A;  3O3H A;  3OYH A;  1RT6 A;  3WQU A;  3HYF A;  1WBD A;  2WUS A;  1ASW A;  3KWG A;  4OKK A;  3FFI A;  4JLH A;  2XY7 A;  4F2R A;  2ITM A;  3RSE A;  4LF6 K;  4DS5 A;  4YFU A;  3VEZ A;  3G71 N;  2FBX A;  4IJA A;  1WSI A;  1DKG D;  2F96 A;  4BRQ A;  1U6Z A;  1C0G A;  2E2P A;  4AH9 A;  3ZSZ A;  1N8R O;  3O3G A;  4H4O A;  1X9W A;  3F2K A;  4O0J A;  3MXM A;  3KLE A;  2WON A;  2YNF A;  3EZ5 A;  1U47 A;  4CHN A;  1S1V A;  1TKX A;  4WQ4 A;  4RWT A;  1WB9 A;  3HL8 A;  1EKE A;  3GL1 A;  4IG0 A;  4B3R K;  3CFP A;  4ILG B;  2P1J A;  3TTC A;  1VQL N;  1QQM A;  3RRH A;  2GWJ A;  1C6V A;  2F8S A;  1LCU A;  4CF1 A;  3QET A;  3K9J A;  1CXQ A;  3I56 N;  1VQP N;  3HST B;  1OVQ A;  3AVH A;  3S9H A;  4ID5 A;  3TAF A;  1BO5 O;  1NMD A;  1K8K A;  4KB0 A;  3DXM A;  4CJ7 A;  5AQY A;  3OS2 A;  2HVH A;  2UXC K;  1LOT B;  2P9K B;  2VWB A;  4FCY A;  4LFC K;  4CJP A;  3L0Q A;  4CF9 A;  2P51 A;  1JLB A;  2YHB A;  4MLH A;  3J80 O;  4DV6 K;  4DQQ A;  4BG8 A;  4CGH A;  4KHU A;  1EP4 A;  1I39 A;  4Z4F A;  1WBB A;  4JI8 K;  1ASV A;  3HP9 A;  4NO7 A;  5AQR A;  3AY9 A;  5D3G A;  3SZ2 A;  4KB1 A;  1XNQ K;  1NGH A;  3A5O C;  2Q97 A;  5FRO A;  4DV2 K;  3L2Q A;  3SQ4 A;  1EET A;  3AAQ A;  3AGR A;  2D1K A;  2XY6 A;  1YHQ N;  3WEE B;  5AJ3 K;  2Q36 A;  1RDB A;  4FPA A;  2P9L B;  4DQS A;  3MMV A;  2I7P A;  1HLU A;  5AQM A;  1C1A A;  3EKU A;  1K6Y A;  5JLF A;  1LW2 A;  4B9Q A;  4DQI A;  1HYZ A;  4JNE A;  1JLQ A;  3VEX A;  3FE1 A;  3HBT A;  2G8K A;  3D6R A;  2HHW A;  3LP1 A;  1ATS A;  3CJ1 A;  5HRP A;  2HOE A;  3G0Z A;  3KZB A;  4G1Q A;  4BVP A;  1RDD A;  3CI5 A;  3KLG A;  1GLE G;  4H0V B;  3DLG A;  1XI1 A;  3TAM A;  3VTH A;  3S3O A;  2DFH A;  3D0P A;  2I7N A;  2X74 A;  3QIO A;  4DFK A;  4KHQ A;  1RBT A;  1N32 K;  3AAP A;  4IFE A;  3NH2 A;  5FPE A;  4RTF D;  3VQ5 A;  4N5S A;  4TSX A;  3VES A;  2AJQ A;  2O8E B;  5AQG A;  1JCE A;  1YXQ A;  4WQ5 C;  1MWK A;  4NCB A;  1CZB A;  2ASP A;  1J5O A;  2NRX A;  1TUU A;  4J8F A;  2IDO A;  3FZM A;  4NYN A;  3K58 A;  3W0L A;  4DWI A;  4C8L A;  3CPE A;  2D0C A;  1UA0 A;  3SUO A;  1NKB A;  3MX5 A;  1KVC A;  4BVO A;  3QEX A;  1KVB A;  1IBL K;  1J54 A;  4FLW A;  4BC4 A;  4DR2 K;  2QI2 A;  3G25 A;  4BRL A;  2UYT A;  4CED A;  4NLC A;  3PIP L;  2B4J A;  3CC7 N;  3KKS A;  5J2P A;  5BRD A;  5AQO A;  1TYQ B;  4Z4H A;  5E26 A;  1V4T A;  1IBM K;  2H3G X;  2XRI A;  3OS1 A;  3NGZ A;  4BDP A;  1ZC6 A;  4FL9 A;  5EX5 A;  1HR0 K;  3MDQ A;  3AVI A;  1R0A A;  3SV3 A;  4JKC A;  3EL2 A;  4JI5 K;  4B1U B;  2E5L K;  1E4G T;  1NJY A;  1TV6 A;  4DV7 K;  3UB5 A;  4LH5 A;  4KBO A;  4M3Y A;  3HOT A;  4JHD A;  3P31 A;  4K43 A;  2HMI A;  3P1G A;  5JVG L;  4WCE L;  3C6H A;  2QTD A;  4E1M A;  2Z1J A;  5AQL A;  5BR9 A;  1YIJ N;  4R5P A;  5EY4 A;  4JKB A;  5GAH P;  2E6M A;  4DV1 K;  4M3T A;  1UOC A;  1YJW N;  3SAH A;  4CJQ A;  4EHU A;  1NK0 A;  1T7P A;  1Q9X A;  4YOT A;  3F73 A;  3QBW A;  1G15 A;  3O9Q A;  3QEI A;  1LAW A;  3DRP A;  3EZW A;  2QK9 A;  3V4I A;  2E2Q A;  4KV8 A;  4KRE A;  1SAZ A;  4BQZ A;  3LAM A;  4MLE A;  3VQ8 A;  1B9D A;  4MO5 A;  3OTO K;  4J2D A;  4FJ7 A;  1HUX A;  2RKI A;  5HLF A;  5BR8 K;  4FWO A;  3O9T A;  3EKS A;  3DLL L;  2E2N A;  2WOM A;  3DMJ A;  3OYI A;  4JKF A;  4BGB A;  2GBZ A;  4M3R A;  1IJJ A;  3TPQ A;  2F8T A;  4CZM A;  1NGJ A;  2DFF A;  2P9U A;  3HPO A;  3PX0 A;  3HRG A;  1NOZ A;  3LDO A;  1U4B A;  2IOC A;  3EE9 A;  2NNW A;  5HRS A;  3M1F A;  3D2E A;  3V1Q A;  2GEM A;  3CCJ N;  4CJV A;  4IEI A;  2ASM A;  4RW9 A;  3IFR A;  3ZSY A;  4BC3 A;  1BG3 A;  3CPW M;  1VSJ A;  4K8X A;  4IDK A;  4MQ3 A;  1KQS M;  3AVC A;  1VQ4 N;  4FJN A;  4FOE A;  4OVL A;  2OTJ N;  4DV4 K;  2FLO A;  2ATQ A;  5AFU A;  1QE1 A;  1XMQ K;  2FF3 B;  4RW6 A;  3NH1 A;  3CCV N;  4KHW A;  2A1R A;  2W6L A;  4IKF A;  2E4L A;  2JWK A;  3T69 A;  1NK8 A;  4FJ5 A;  2G8U A;  3JXU A;  3CCS N;  1BCO A;  1VK0 A;  4YHH K;  4PKI A;  4FXD A;  2XHB A;  4DR6 K;  4JAX A;  4CZJ A;  2OYQ A;  3IMX A;  4IXC A;  1ZBH A;  1GOA A;  1WN7 A;  5I9E B;  3KTQ A;  3PLA A;  3CQY A;  4O44 A;  2P9I B;  3R6M A;  4JRP A;  4WYB A;  5JMV A;  4Z4I A;  3TAB A;  1IG9 A;  4CJ4 A;  1QTM A;  4H5N A;  1GLJ O;  2I5J A;  3CER A;  3K5O A;  2BUP A;  4H03 B;  1EX4 A;  2HF3 A;  3C6A A;  3ZX3 A;  4OX9 K;  4NCG A;  2NRH A;  3IKM A;  4JKA A;  4OPA A;  3QER A;  3C94 A;  3H6E A;  4A2A A;  1VSM A;  3L3V A;  3RR8 A;  1TKD A;  4I2Q A;  5AQV A;  4XEI A;  2P9P A;  4CJF A;  4FLZ A;  2QKB A;  4FLT A;  4B9U A;  3R1X A;  3A0I X;  5BPN A;  3CQX A;  2IS3 A;  3C7N A;  1U2V B;  4RCH A;  4JI6 K;  2A1S A;  2QWR A;  3SAG A;  1QVF M;  1ZBU A;  1YVN A;  4KH6 A;  4FWN A;  4B1X B;  3N4P A;  1QS4 A;  1EXQ A;  5C0Y A;  2DPN A;  4LF9 K;  4BY9 C;  5C15 A;  5JVH L;  4FJL A;  3DXK A;  4IJN A;  3KK2 A;  4AIL C;  4F3O A;  3KKR A;  4ILH A;  2NLX A;  5KQ8 A;  1Y64 A;  3BUZ B;  1NJZ A;  1BWF O;  1SQK A;  2NRT A;  4B9S A;  1NJI O;  2FBV A;  5EOY A;  4CK1 A;  2A5X A;  4B9N A;  2NRR A;  4DQ8 A;  3PO5 A;  3THV A;  2E6L A;  5ELZ A;  1QSS A;  1RTI A;  3VEW A;  2LSN A;  4X65 K;  3DXM B;  3QIP A;  1QZ6 A;  1NGI A;  5FPM A;  4O5B A;  5FPD A;  4BRA A;  4KTZ A;  4FJG A;  1KAY A;  1JLC A;  3U8X A;  3O9U A;  5KPR A;  3B6P A;  4AHS A;  4KTQ A;  3E9O A;  3EN9 A;  4WFN L;  3ENH A;  3QEV A;  1WSE A;  3D2E B;  3OW2 M;  2GTD A;  1XWL A;  1BCM A;  1RBV A;  5EVZ A;  2W40 A;  3ASM A;  3V1O A;  4W5N A;  3LP0 A;  4OKJ A;  3VTI A;  4FLV A;  1P90 A;  4OLB A;  5FLX O;  3DLB A;  1T44 A;  1RT5 A;  3DM2 A;  1HQU A;  3SMS A;  1BI4 B;  2FXU A;  4N47 A;  3WNH A;  4DUZ K;  1NK7 A;  3ZX0 A;  2HHS A;  4Y1D A;  3D7E O;  3GOI A;  3AVF A;  2GEL A;  3FGU A;  1MDU B;  3KLF A;  3T1Y K;  3GDQ A;  2B6A A;  2P5O A;  3HOS A;  3V6D A;  3VMF B;  3LAN A;  4KI4 A;  2P9N B;  5TKY A;  2JLE A;  4F3T A;  3CD6 N;  1ILY A;  4N41 A;  1X9S A;  3THX A;  1RIL A;  5M1Q A;  4DTU A;  1GLB G;  4MO4 A;  3TR8 A;  1YT3 A;  3PX6 A;  4FWQ A;  4BRG A;  3FFK B;  1ZYQ A;  3ZCM A;  2EWS A;  4DF4 A;  2O8B A;  1LAV A;  4H0Y B;  3NHG A;  5DM7 L;  2CGJ A;  4E19 A;  3L4I A;  4DQP A;  5C25 A;  3NGI A;  2KW4 A;  1LW0 A;  4KO0 A;  4BR4 A;  1RT2 A;  3KK1 A;  4J2B A;  4Z4G A;  1C1C A;  2Z1I A;  3NDK A;  3D2F B;  4E1J A;  3B8A X;  1Q7Y O;  3CQ8 A;  3OYL A;  2P9P B;  3P83 D;  4JRQ A;  5AQX A;  5KPZ A;  2JGU A;  4ZTF A;  3SAF A;  3BZK A;  1SKS A;  4DV0 K;  3C7N B;  4ELV A;  1O13 A;  4YNQ A;  4DB3 A;  4PWD A;  1LWF A;  2FSN A;  4CGF A;  4LH4 A;  3C0B A;  1ATN A;  4JI2 K;  2IVO A;  3C6T A;  3THW B;  3RMB A;  4CEE A;  4CIG A;  1IKV A;  4ISE A;  3VF6 A;  3RMA A;  3CC4 N;  3OBY A;  4I7F A;  4O8K A;  3I0S A;  4DTN A;  3NBP A;  5BRF A;  2G8W A;  1S22 A;  2CH6 A;  4MDA A;  2AP1 A;  4YOW A;  4DSF A;  2YX6 A;  1X3M A;  2OPR A;  1HNX K;  2ZD1 A;  4PL7 A;  1WSG A;  3DRS A;  3AA3 A;  3T19 A;  2HBK A;  3FZH A;  3HTV A;  1SZ2 A;  3QML A;  4FPB A;  4A5B A;  2BAN A;  5LJW A;  3SYZ A;  1I94 K;  2O8D A;  5FPN A;  1TK0 A;  3SK3 A;  3AVL A;  3TSP A;  1NG9 A;  2ETJ A;  2XY5 A;  4UY8 O;  4A57 A;  4FJ9 A;  3VOV A;  2YHA A;  4HTL A;  4I9L A;  3O8M A;  3OYJ A;  4FVU A;  5DMR A;  5I3U A;  2WFB A;  1RDU A;  3IAY A;  3QNO A;  5AQP A;  5CE3 A;  2IIR A;  3HP6 A;  2FSJ A;  3FZF A;  1YUW A;  3RMC A;  1RGI A;  1TK8 A;  1G99 A;  4JKG A;  4NLB A;  3VQB A;  4BGA A;  5AQQ A;  4JI3 K;  1Q82 O;  3BP8 A;  3TAP A;  5KGX A;  3CHW A;  1IH7 A;  2QEX N;  4F8R A;  1Z05 A;  3RR7 A;  4B1Z A;  4CZG A;  2RF2 A;  3ID8 A;  1OVY A;  4I6M A;  3JYT A;  1JXE A;  3NF6 A;  4J2A A;  1NGC A;  2OCE A;  4Z4C A;  2BGG A;  4GVM A;  5KTQ A;  4WF9 L;  3DWL A;  1GOC A;  4DU4 A;  2JWL A;  2QWQ A;  3GBT A;  3J7A P;  1XC3 A;  1BA0 A;  4CK2 A;  4JEP A;  4M41 A;  1KTQ A;  3WXM B;  3BGR A;  3DAW A;  3OBW A;  2UU9 K;  2E88 A;  1HKB A;  1T8E A;  4CES A;  4CER A;  4H8K A;  1QVG M;  3I0R A;  1N36 K;  4JS4 A;  4YDU A;  4JKD A;  3HO1 A;  3MCP A;  3R8E A;  5FRM A;  1SL1 A;  1HKC A;  3AVA A;  4FWM A;  3RVC A;  1UAX A;  3ENB A;  4PL8 A;  1YJ9 N;  4Y0W A;  1Z6R A;  1VQ6 N;  3ATV A;  4B08 A;  2HHH K;  4Z4E A;  5BRE A;  2RHK A;  3HPG A;  5LL6 Z;  3CF5 L;  5BN8 A;  4FVM A;  1RFQ A;  4L3Q A;  4CJU A;  4ICL A;  4OPH A;  4FZX C;  4FWK A;  1JLE A;  2EHG A;  4NB4 A;  3VF4 A;  3VQE A;  1RDW X;  4DMN A;  3KWI A;  2OZM A;  5HRR A;  3LL3 A;  4ELU A;  1HRH A;  4HWI A;  4K8Z A;  3WEE A;  4CEZ A;  3KK3 A;  4GV6 A;  1IG8 A;  1XHZ A;  4AM7 A;  2VG7 A;  4BG9 A;  3MXI A;  3DJC A;  2P9L A;  1GOB A;  1Q81 O;  1RTJ A;  4CJ5 A;  3AO3 A;  4FZZ A;  1NBW A;  2VWK A;  5AZI B;  3CFR A;  2DTU A;  1VSK A;  3HM8 A;  3ZET B;  1T05 A;  1RNH A;  3LM2 A;  2HHU A;  2KQ2 A;  2PY5 A;  4JKG B;  3KD5 E;  2QXF A;  1JCG A;  4BE2 A;  1TK5 A;  1RT7 A;  4EZ9 A;  3QBX A;  2HVI A;  3H08 A;  4FM1 A;  1BUP A;  5KRT A;  1N34 K;  3FR0 A;  1KC8 O;  4PQU A;  4HUG A;  1P8Z A;  2YJE A;  4GV9 A;  4B3S K;  3HZ6 A;  2WC9 A;  4FW2 A;  1VSL A;  5CYM A;  3UE5 A;  4LSL A;  4KRF A;  3SQ1 A;  1DLO A;  4CZE A;  2YHW A;  1SL2 A;  3CC2 N;  4IO8 A;  5AQJ A;  4K42 A;  3PO4 A;  4IOC L;  4BAC A;  1W0H A;  4QS8 A;  3U4L A;  4HVJ A;  3TU5 A;  5J2Q A;  4FW1 A;  3CCE N;  4C1N I;  2OTL N;  1T3V A;  5LMN K;  1WOQ A;  4DSK A;  4NXN K;  1S3X A;  2RN2 A;  4DSE A;  1KFS A;  1TUY A;  3VQ6 A;  2X6N A;  3BDP A;  4B8C A;  2HB5 A;  1IBK K;  4XIU A;  3CJA A;  4KAZ A;  2QWN A;  3ZT0 A;  4AHV A;  3NH0 A;  1RDC A;  5J1E A;  2O8C A;  3K5M A;  5LJV A;  5GIP A;  4Q5V A;  5BPL A;  5JS1 A;  1QZ5 A;  3HSC A;  1M90 O;  1NLV A;  3O1B A;  3K57 A;  3ID6 A;  1Q9Y A;  4XH1 A;  4FJJ A;  1B92 A;  1RT4 A;  4FJH A;  2E1Z A;  1W97 L;  3DLK A;  4DQR A;  1IKW A;  5AQF A;  3RMD A;  2YHY A;  3PIO L;  3OJU A;  4CHO A;  1C0T A;  1ESV A;  4H0O A;  4DTJ A;  1S6Q A;  3AVK A;  3H46 O;  1J53 A;  4GW6 A;  3NVK A;  3E9P A;  3EY1 A;  4LY7 A;  2OPP A;  1JCF A;  4B3M K;  2OAN A;  4JKH A;  2YKM A;  3V9Z A;  5GIN A;  3LDQ A;  4M7Y A;  1RCH A;  3E1Y A;  4DLE A;  4FM0 A;  1S1W A;  3Q7C A;  2BDP A;  1ZBF A;  1LWE A;  5GAE P;  2IVP A;  3V9S A;  2FBT A;  3KD1 E;  4CEF A;  3OYE A;  4BRC A;  1LV5 A;  3IUC A;  3UKR A;  4W5Q A;  2O4I A;  2NZT A;  2D0A A;  3HVT A;  2V7Z A;  2ASO A;  4AHT A;  2IVN A;  3SV4 A;  2Q0U A;  1SL0 A;  3CCQ N;  3IS9 A;  4JYA K;  4Q0B A;  1M1K O;  1VQ8 N;  4NYF A;  4MDB A;  4DTP A;  3CG7 A;  1QSL A;  1EO1 A;  1NJX A;  1ATR A;  1EWQ A;  2YHX A;  4O5F A;  2HBJ A;  2GWK A;  4EFH A;  3T3F A;  4GY2 B;  4DFJ A;  4DUY K;  5AZI A;  1QQC A;  1BQN A;  2Z1G A;  2UUA K;  1QSY A;  3LPU A;  3VGK A;  4BC2 A;  4U67 L;  4EP4 A;  3K9K A;  3SPZ A;  2P9U B;  3TSU A;  4CIF A;  4M42 A;  1S1U A;  1VSH A;  1I3A A;  2W41 A;  3TI0 A;  1KCF A;  3B6O A;  4A62 A;  1JLG A;  1UWB A;  1MA9 B;  3ZSV A;  2D5R A;  4AF1 A;  3SBT A;  2PBD A;  2ZJP L;  3IRX A;  1GLL O;  2QWM A;  1NK9 A;  4IEE A;  1FKP A;  3VQA A;  1ZBL A;  4KH5 A;  5EU7 A;  1T6D A;  2PYL A;  2KHO A;  4CEA A;  3VEN A;  1WSF A;  2V52 B;  1H1V A;  2YI1 A;  3HT3 A;  4KHS A;  5FRN A;  4CJR A;  1NGE A;  2IAJ A;  1LWC A;  3GE1 A;  1BDG A;  3TAG A;  3WXI A;  1D8Y A;  5AQU A;  3SPY A;  1DTQ A;  4M7X A;  1HNI A;  3O4N A;  2YNI A;  1WAJ A;  4FK4 A;  5M1F A;  4IOX A;  4O4G A;  3DLH A;  1SKR A;  1X9M A;  5T7B A;  4M63 C;  5ADX A;  3KVG A;  3NF9 A;  2Y1I A;  3WNE A;  4BWM A;  3K59 A;  4WQ5 A;  2F9W A;  1JJ2 M;  3CME N;  4OPK A;  1VQ9 N;  3VQP A;  2ZWH A;  3ZYY X;  3TWH A;  2HHX A;  4DFM A;  1HX1 A;  4X64 K;  2HMP A;  1JLF A;  3I55 N;  1BA1 A;  3FZL A;  2NRW A;  2CH5 A;  2B5J A;  3DYA A;  2W6K A;  2G8H A;  3DLR A;  2HHV A;  3S3N A;  5JIC A;  3OJS A;  4CGJ A;  3ULD A;  2P9K A;  1DTT A;  4FWP A;  4CEO A;  1NJW A;  3DI6 A;  3NMU A;  2HBM A;  3NF7 A;  1QQN A;  4Y1C A;  4CF2 A;  1E4F T;  4GMJ B;  5F0X A;  3PY8 A;  3IG1 A;  2E1Y A;  3O9S A;  3VEO A;  5LY3 A;  2VG6 A;  1FW6 A;  1Z25 A;  3F9M A;  4BR7 A;  5C2D A;  4H5T A;  3A5N C;  3VQ7 A;  1NGG A;  5C2F A;  5F1X A;  1RBR A;  4M3U A;  3VQ4 A;  1L3T A;  4M3Z A;  1BGX T;  1VRU A;  4HUE A;  3CJ7 A;  4PUO A;  4OJR A;  3V9U A;  4CZH A;  4YOR A;  4LF7 K;  2NRV A;  4DR7 K;  3AVM A;  4C8O A;  4HTU A;  3SCX A;  3DRR A;  3H45 C;  1K9M O;  4CBW A;  4B9L A;  5BRH A;  3CMA N;  3T1A A;  2V7Y A;  3UKU B;  3HM9 A;  3QEP A;  4AQY K;  3QO9 A;  4I9Q A;  2KTQ A;  3MEC A;  1D9D A;  3SNN A;  4DU3 A;  4Z94 A;  4AHR A;  4A61 A;  1NM1 A;  3P38 A;  2DY4 A;  2UUB K;  4JI1 K;  3CJB A;  4BDY A;  4KHY A;  1NGD A;  3KJV A;  4M3X A;  3H3N O;  2D0P A;  2A42 A;  2QM1 A;  5AZJ B;  3DOL A;  4FJX A;  3CM6 A;  3LDL A;  4FWL A;  2YKN A;  4FOI A;  5HRO A;  2X6S A;  3HI0 A;  1NNE A;  1YIT N;  3KHY A;  4JK7 A;  3G6E N;  2VG5 A;  4A2B A;  3DLE A;  5FDL A;  3F9K A;  4JS5 A;  3O4Q A;  1J6Z A;  5M1N A;  4JI7 K;  3M8S A;  4ELT A;  4O0I A;  1EQY A;  1WNS A;  5F2R A;  1VSF A;  4W5T A;  4FLU A;  1GLC G;  4CJ3 A;  3T7Z A;  4CJS A;  4CJE A;  3QB0 A;  3QNN A;  4K41 A;  4EAH D;  4F4K A;  2V51 B;  1NKE A;  1NMN A;  4IZ9 A;  2VGN A;  3THY A;  4FZY A;  3VGM A;  3ZT1 A;  1VHX A;  1BI4 A;  1VQK N;  3SI6 A;  1F21 A;  5LMU K;  3QFP A;  4OLA A;  4KI6 A;  2YNH A;  4BRM A;  4L8R B;  1KXP A;  4U7B A;  3HXM A;  3AO2 A;  3WT0 A;  1JL1 A;  4H5R A;  4H4M A;  4CI6 A;  4HHT A;  3SJH A;  1KAX A;  3OYF A;  1BQM A;  1ZBS A;  4DR3 K;  4E7L A;  3MXJ A;  1R59 O;  1W7A A;  3LDP A;  3MN6 A;  4ISG A;  3THX B;  2Q0R A;  3Q7B A;  3SUN A;  2PFU A;  1JLA A;  5AQS A;  3A2F A;  2KLA A;  4BRD A;  4MFB A;  1HJO A;  4BQL A;  5BN9 A;  1JL2 A;  5M1P A;  2O4G A;  2VYP A;  3MN7 A;  1L3U A;  1SUQ A;  4DTM A;  1TAQ A;  3O3F A;  3FZK A;  3MCA B;  3VER A;  2WBN A;  3SLC A;  3D45 A;  3AGK A;  4DSI A;  3A5M C;  4B1Y B;  3G10 A;  4G9Z A;  1E3M A;  3MEE A;  4O55 A;  1C0M A;  4CHQ A;  2E2O A;  1KAZ A;  1BIZ A;  3DOK A;  3SBG A;  2GV9 A;  3NAE A;  5J2N A;  4BRH A;  5KI6 A;  3UIQ A;  4FM2 A;  2E8A A;  1K8A O;  4RW7 A;  3KLH A;  1REV A;  2HF4 A;  4JI0 K;  4WFB L;  3AV9 A;  3THW A;  4KFB A;  2GUP A;  1MWM A;  1EWR A;  1C0F A;  3J8A A;  3W3D A;  5E84 A;  4M45 A;  4A5A A;  3OYA A;  3F5T A;  3MK6 A;  1S1X A;  2PYJ A;  4N76 A; 
#chains in the Genus database with same CATH homology
 4KKO A;  4B8A B;  4OVL A;  4FJN A;  1FXX A;  3SQ1 A;  5C24 A;  1DLO A;  1S5J A;  2X78 A;  3U3Y A;  5CZ1 A;  3M8P A;  4OGC A;  1SL2 A;  2ATQ A;  4CHY A;  1KLN A;  3PO4 A;  1QE1 A;  2YNG A;  4CEQ A;  4BAC A;  1W0H A;  3TAN A;  4CCH A;  4HVJ A;  4RW6 A;  3NH1 A;  5J2Q A;  3ZT4 A;  1D9F A;  4BWJ A;  3M8R A;  2P5G A;  5KRS A;  4KHW A;  4FW1 A;  1XC9 A;  2KFZ A;  4DG1 A;  3HJF A;  2A1R A;  1Q8I A;  4N56 A;  3AA4 A;  4FK0 A;  4DSK A;  2RN2 A;  4IKF A;  1A5X A;  2E4L A;  3V9W A;  4DSE A;  3M8Q A;  1NK8 A;  4OKE A;  4CFB A;  1KFS A;  1BIU A;  2G8U A;  1C0U A;  3VQ6 A;  2X6N A;  1KFD A;  1ASU A;  4B8C A;  2HB5 A;  3BDP A;  1QHT A;  2KZZ A;  2Y1J A;  3LWL A;  3AO1 A;  1BCO A;  1VK0 A;  4XIU A;  4J2E A;  4BDZ A;  2XHB A;  4KAZ A;  4FJI A;  4HCB A;  4FXD A;  1HQE A;  1N6Q A;  3QLH A;  4E7J A;  3TAR A;  3ZT0 A;  4AHV A;  2W42 A;  4CK3 A;  3NF8 A;  2HW3 A;  3VA3 A;  2OYQ A;  3NH0 A;  1ZBH A;  1GOA A;  1RDC A;  4CF8 A;  5J1E A;  1WN7 A;  3K5M A;  3V9X A;  3PV8 A;  1TL3 A;  4IFY A;  3KTQ A;  2NUB A;  1BL3 A;  4Q5V A;  3AVJ A;  4O44 A;  3NCI A;  4JRP A;  3V1R A;  4ZHR A;  4Z4I A;  1ZBI A;  5JS1 A;  4AHC A;  3TAB A;  3K57 A;  1NK5 A;  2HHQ A;  1IG9 A;  2ZE2 A;  1Q9Y A;  4FJJ A;  3TAQ A;  1B92 A;  1RT4 A;  4FJH A;  4CJ4 A;  1TL1 A;  1QTM A;  4C8N A;  3CYM A;  2I5J A;  3CFO A;  3DLK A;  3L8B A;  4DQR A;  1IKW A;  3K5O A;  1S9E A;  3NGY A;  1EX4 A;  3RMD A;  4FJM A;  3QES A;  1U04 A;  2GUI A;  3OJU A;  5SWM A;  3KLI A;  3MED A;  4CHO A;  4ZTJ A;  3AVB A;  3AVG A;  1C0T A;  1JXB A;  2YV0 X;  4NCG A;  4E1N A;  3HPH A;  1RT1 A;  4E3S A;  3QER A;  3L2V A;  4ID1 A;  3OYB A;  3C94 A;  1VSM A;  4KTW A;  3L3U A;  4DS4 A;  4DSJ A;  3L3V A;  4DTJ A;  3RR8 A;  1S6Q A;  3AVK A;  1WLJ A;  1TKD A;  4I2Q A;  1J53 A;  4GW6 A;  4EP5 A;  2XY8 A;  4CFD A;  3QEW A;  4UQG A;  4PA1 A;  2HNY A;  4CJF A;  4W5R A;  5DK5 A;  3EY1 A;  4FLZ A;  4LY7 A;  2OPP A;  3I8D A;  2QKB A;  4E7K A;  4FLT A;  4B9U A;  4Z0U A;  2OPQ A;  3AO5 A;  3OYK A;  3L2R A;  2YKM A;  2IS3 A;  4RW4 A;  3V9Z A;  1RCH A;  1S1T A;  2A1S A;  4DLE A;  3LAL A;  4FM0 A;  1S1W A;  1ZBU A;  2BDP A;  4EZ6 A;  1ZBF A;  1LWE A;  2G8I A;  1TAU A;  4E7I A;  2DFE A;  3OY9 A;  3V9S A;  1NK4 A;  1FKO A;  1QS4 A;  2FBT A;  1WSJ A;  1EXQ A;  1KLM A;  3E01 A;  3WNG A;  4CEF A;  4CJW A;  3OYE A;  3KD1 E;  1LV5 A;  3P5J A;  4DLG A;  4W5Q A;  2O4I A;  5KGW A;  4CHP A;  2D0A A;  3HVT A;  4FJL A;  4AHT A;  3SV4 A;  3KK2 A;  1HJR A;  3OYM A;  3VQ9 A;  4AIL C;  1VRT A;  3KKR A;  3VQQ A;  4DTO A;  1SL0 A;  4B9T A;  4F3O A;  3AA2 A;  3IS9 A;  1NJZ A;  4Q0B A;  2KZM A;  4B9S A;  2R7Y A;  4NYF A;  4DTP A;  3S3M A;  2FBV A;  4CK1 A;  4E0D A;  1JKH A;  4B9N A;  3LDS A;  3CG7 A;  4CEB A;  1QSL A;  4B9V A;  1NJX A;  3PO5 A;  3THV A;  2E6L A;  3SUP A;  1QSS A;  1RTI A;  1U49 A;  2LSN A;  4RG8 A;  4BE1 A;  3T3F A;  3QIP A;  3TAE A;  1SKW A;  4DFJ A;  1KSP A;  4NCA A;  3CM5 A;  3K5L A;  4M3W A;  5I42 A;  1YTA A;  1QQC A;  1BQN A;  1U45 A;  2Z1G A;  3OYC A;  1RDA A;  4FK2 A;  2Z1H A;  4I2P A;  3OVN A;  5K14 A;  3ZT2 A;  1YTU A;  4O5B A;  4FLX A;  1QSY A;  3LPU A;  1ITG A;  1YVU A;  4CJK A;  4EP4 A;  4KTZ A;  4WE1 A;  4FJG A;  3C6U A;  4CEC A;  5C42 A;  2QKK A;  1JLC A;  3ZT3 A;  3SPZ A;  4CIF A;  4M42 A;  1S1U A;  3B6P A;  4AHS A;  1C1B A;  1I3A A;  1VSH A;  3O3H A;  4E89 A;  3OYH A;  1RT6 A;  3QEV A;  1KCF A;  3B6O A;  1WSE A;  3HYF A;  3PUF A;  5SZT A;  3TI0 A;  1JLG A;  1XWL A;  1BCM A;  1UWB A;  1NKC A;  1RBV A;  1L3S A;  1ASW A;  2D5R A;  3ZSV A;  4OKK A;  3ASM A;  3FFI A;  3IRX A;  3V1O A;  4W5N A;  3LP0 A;  4JLH A;  2XY7 A;  4OKJ A;  4F2R A;  1NK9 A;  1U48 A;  4OPJ A;  3OYN A;  1FKP A;  2D0B A;  3ZSX A;  4FLV A;  4DS5 A;  4YFU A;  3K5N A;  3VQA A;  4W5O A;  4DTR A;  1ZBL A;  4OLB A;  2FBX A;  2OPS A;  5EU7 A;  4LSN A;  1WSI A;  2PYL A;  4CEA A;  3DLB A;  2F96 A;  1WSF A;  2IGI A;  1RT5 A;  3DM2 A;  3HT3 A;  1HQU A;  4KHS A;  4KTQ A;  5FRN A;  4CJR A;  4AH9 A;  2VWJ A;  3ZSZ A;  2IAJ A;  1LWC A;  1BI4 B;  3O3G A;  4H4O A;  4N47 A;  3WNH A;  4CE9 A;  1X9W A;  1RTH A;  4O0J A;  3ISN C;  1NK7 A;  3RRG A;  3MXM A;  2HHS A;  4Y1D A;  3KLE A;  3TAG A;  4KHN A;  2WON A;  2YNF A;  1SV5 A;  3EZ5 A;  1D8Y A;  3AVF A;  1U47 A;  4CHN A;  1DTQ A;  3SPY A;  1S1V A;  1TKX A;  3HL8 A;  2G8V A;  1EKE A;  1HNI A;  3KLF A;  3O4N A;  4IG0 A;  2YNI A;  1TVR A;  1WAJ A;  2B6A A;  4FK4 A;  3CFP A;  2P5O A;  3VN5 A;  3V6D A;  3DLH A;  2P1J A;  4O4G A;  3LAN A;  3PX4 A;  1SKR A;  1X9M A;  4KI4 A;  5T7B A;  2JLE A;  3RRH A;  4F3T A;  1TKT A;  2F8S A;  1C6V A;  4N41 A;  1BIS A;  3NF9 A;  4CF1 A;  3WNE A;  3QET A;  2Y1I A;  1X9S A;  1RIL A;  4DTU A;  4BWM A;  4C8K A;  1CXQ A;  4DF8 A;  3K59 A;  4QOZ B;  3TR8 A;  5E41 A;  1YT3 A;  5CZ2 A;  4OPK A;  3PX6 A;  4IBN A;  3HST B;  3VQP A;  3L2W A;  5CYQ A;  2HHU A;  1ZYQ A;  3AVH A;  2BE2 A;  3ZCM A;  3VQD A;  3S9H A;  4ID5 A;  3TAF A;  4DF4 A;  3TWH A;  1LAV A;  4KB0 A;  5HBM A;  4DFM A;  2HHX A;  3NHG A;  1NK6 A;  3OS2 A;  2HVH A;  4E19 A;  4DQP A;  5C25 A;  1JLF A;  3NGI A;  4FCY A;  4CJP A;  2KW4 A;  1LW0 A;  4CF9 A;  2HNZ A;  4KO0 A;  2B5J A;  1JLB A;  2P51 A;  2YHB A;  4CIE A;  3RTV A;  3SQ0 A;  2HHT A;  1RT2 A;  3KK1 A;  3DYA A;  4J2B A;  4Z4G A;  1C1C A;  2Z1I A;  3NDK A;  4DQQ A;  2FBY A;  2G8H A;  3DLR A;  4CGH A;  4KHU A;  1A5V A;  3S3N A;  2HHV A;  1EP4 A;  1I39 A;  3AO4 A;  3CQ8 A;  3OJS A;  4CGJ A;  4CJL A;  3OYL A;  3ULD A;  4Z4F A;  3P83 D;  1ASV A;  3HP9 A;  4JRQ A;  1UA1 A;  1NOY A;  2JGU A;  5D3G A;  1DTT A;  3AVN A;  1J9A A;  4ZTF A;  5J2M A;  4CEO A;  3SZ2 A;  1T03 A;  3MEG A;  1NJW A;  3LPT A;  4KB1 A;  3DI6 A;  3RWU A;  5CY4 A;  1CLQ A;  3NF7 A;  1SKS A;  4ELV A;  4Y1C A;  4CF2 A;  4GMJ B;  3C95 A;  4YNQ A;  1B9F A;  5FRO A;  3LWM A;  1LWF A;  3PY8 A;  4FJ5 A;  4PWD A;  1Z26 A;  3IG1 A;  4LH4 A;  4CGF A;  3L2Q A;  3L2U A;  1EET A;  3SQ4 A;  3C6T A;  3RMB A;  1FK9 A;  4CEE A;  1IKV A;  1HPZ A;  3QIN A;  4CIG A;  2VG6 A;  2XY6 A;  1Z25 A;  3RMA A;  4I7F A;  3VQ7 A;  3I0S A;  4DTS A;  4DTN A;  4DFP A;  1TKZ A;  3NBP A;  4QAG A;  3EYZ A;  1RBR A;  2G8W A;  1RDB A;  3VQ4 A;  1L5U A;  4M3U A;  1L3T A;  4M3Z A;  1BGX T;  1VRU A;  3NE6 A;  4HUE A;  4DQS A;  4PUO A;  4OJR A;  3V9U A;  3VQC A;  4DSF A;  2OPR A;  4CFC A;  2ZD1 A;  1C1A A;  1RTD A;  4FJ8 A;  1K6Y A;  1LW2 A;  1WSG A;  3DRS A;  4DQI A;  3AA3 A;  3NFA A;  1HYZ A;  3T19 A;  3LZJ A;  4DSL A;  3AVM A;  4CGG A;  4C8O A;  4HTU A;  4C8M A;  1BHL A;  1JLQ A;  3SCX A;  1VSD A;  3DRR A;  3K2P A;  1MU2 A;  4B9L A;  2G8K A;  2BAN A;  3SYZ A;  3LP3 A;  2HHW A;  3LP1 A;  3T1A A;  5HRP A;  1TK0 A;  3ITH A;  3HM9 A;  3QEP A;  3G0Z A;  3AVL A;  2KFN A;  3QO9 A;  4I9Q A;  1RBU A;  2KTQ A;  3MEC A;  1D9D A;  3SNN A;  4G1Q A;  3HVR A;  2ITG A;  4DU3 A;  2ETJ A;  4AHR A;  1RDD A;  2DY4 A;  3AA5 X;  4BE0 A;  1HNV A;  3KLG A;  2XY5 A;  1XI1 A;  3DLG A;  4FJ9 A;  3TAM A;  4BDY A;  2YHA A;  2DFH A;  3D0P A;  3LZI A;  4I9L A;  3S3O A;  1L3V A;  3OYJ A;  3QIO A;  2X74 A;  4DFK A;  4KHQ A;  4KHY A;  5DMR A;  5I3U A;  1RBT A;  3KJV A;  4M3X A;  3NH2 A;  3IAY A;  3QNO A;  4PY5 A;  1KVA A;  2PZS A;  3VQ5 A;  3HP6 A;  5JS2 A;  3DOL A;  4N5S A;  3RMC A;  1D5A A;  4F2S A;  4TSX A;  1TK8 A;  2AJQ A;  4FJX A;  3VQB A;  3CM6 A;  2YKN A;  1RT3 A;  5HRO A;  1IKX A;  2X6S A;  3TAP A;  4NCB A;  1CZB A;  5KGX A;  1J5O A;  3ZSW A;  2IDO A;  4NYN A;  1O1W A;  3K58 A;  1IH7 A;  2VG5 A;  4F8R A;  4DWI A;  3RR7 A;  2RF2 A;  4C8L A;  3DLE A;  2D0C A;  1CXU A;  2XO7 A;  3JYT A;  1JXE A;  3NF6 A;  1UA0 A;  4J2A A;  2G8F A;  1RBS A;  1XHX A;  5FDL A;  3SUO A;  3F9K A;  1NKB A;  3OYD A;  4DTX A;  4JS5 A;  3O4Q A;  1S6P A;  4Z4C A;  1KVC A;  2BGG A;  3QEX A;  1KVB A;  1J54 A;  3M8S A;  4FLW A;  3V81 A;  4GVM A;  2ZQB A;  5KTQ A;  3ZSO A;  4ELT A;  4O0I A;  3U3G A;  1GOC A;  4CED A;  3ZSQ A;  4DU4 A;  4QCL A;  2B4J A;  3KKS A;  3SQ2 A;  4CK2 A;  3JSM A;  4M41 A;  4RW8 A;  1KTQ A;  1WNS A;  5J2P A;  3BGR A;  5HP1 A;  1VSF A;  4Z4H A;  4W5T A;  4FLU A;  4CJ3 A;  4CJS A;  1T8E A;  4KPY A;  4CJE A;  4CES A;  1HMV A;  3OS1 A;  2XRI A;  3QNN A;  3NGZ A;  4CER A;  4BDP A;  4H8K A;  4F4K A;  1NKE A;  3I0R A;  1N5Y A;  3AVI A;  1R0A A;  1IKY A;  4JS4 A;  4FZY A;  3SV3 A;  2IC3 A;  3HO1 A;  1HYV A;  1A5W A;  5FRM A;  4LD0 A;  3ZT1 A;  1BI4 A;  1NJY A;  1TV6 A;  1SL1 A;  3SI6 A;  3HK2 A;  1IO2 A;  1F21 A;  4LH5 A;  4M3Y A;  3AVA A;  4OLA A;  4KI6 A;  2YNH A;  4HCC A;  4L8R B;  1UAX A;  1KRP A;  3VA0 A;  2HMI A;  3P1G A;  4DU1 A;  3HXM A;  3AO2 A;  2RPI A;  1JL1 A;  4H4M A;  3KIO A;  4E1M A;  2Z1J A;  4B08 A;  1X1P A;  4HHT A;  5HRN A;  4R5P A;  4OGE A;  3LP2 A;  3OYF A;  1BQM A;  4Z4E A;  2E6M A;  4E7L A;  3HPG A;  3MXJ A;  1UOC A;  4M3T A;  4IG3 A;  4CJQ A;  1NK0 A;  4FLY A;  1T7P A;  1Q9X A;  3SUN A;  3F73 A;  1JLA A;  1G15 A;  4FVM A;  4FYD A;  3A2F A;  4B3O A;  4CJU A;  4ICL A;  2HND A;  4MFB A;  1LAW A;  3QEI A;  4FZX C;  3DRP A;  1JLE A;  2EHG A;  2QK9 A;  1JL2 A;  3V4I A;  2O4G A;  1L3U A;  1SUQ A;  4DTM A;  1HYS A;  4KV8 A;  1Y97 A;  1TAQ A;  3WNF A;  4KRE A;  1WSH A;  3O3F A;  3LAM A;  3VQE A;  3VQ8 A;  4DMN A;  2OZM A;  1B9D A;  1CZ9 A;  4J2D A;  5HRR A;  4ELU A;  4FJ7 A;  1HRH A;  2RKI A;  3OS0 A;  4K8Z A;  3KK3 A;  4CEZ A;  1VSE A;  3MAQ A;  5HLF A;  4B9M A;  1XHZ A;  2OZS A;  2VG7 A;  3D45 A;  3SJJ A;  3MXI A;  4DSI A;  2WOM A;  3DMJ A;  1GOB A;  1VSI A;  1RTJ A;  3G10 A;  3AO3 A;  3ZSR A;  4CJ5 A;  3OYI A;  3MEE A;  4O55 A;  1C0M A;  4CHQ A;  4FZZ A;  2VWK A;  2FC0 A;  3CFR A;  2DTU A;  1VSK A;  1BIZ A;  2GBZ A;  3DOK A;  2GV9 A;  4CGI A;  4M3R A;  4CGD A;  1WAF A;  3OYG A;  3NAE A;  5J2N A;  1TGO A;  3SUQ A;  1T05 A;  1RNH A;  5KI6 A;  4E7H A;  3UIQ A;  4FJK A;  2F8T A;  4AHU A;  4FM2 A;  2DFF A;  2KQ2 A;  2PY5 A;  3KD5 E;  2QXF A;  2EX3 A;  3LAK A;  3HPO A;  3PX0 A;  1NOZ A;  4RW7 A;  3KLH A;  1U4B A;  1REV A;  2IOC A;  4BE2 A;  1TK5 A;  1RT7 A;  4EZ9 A;  3AV9 A;  4KFB A;  2HVI A;  3H08 A;  4FM1 A;  3ALY A;  5HRS A;  5KRT A;  4PQU A;  3V1Q A;  1S9G A;  2Q3S A;  4HUG A;  1W9H A;  4CJT A;  4CJV A;  3U6F A;  4M45 A;  4RW9 A;  3OYA A;  3ZSY A;  4FW2 A;  1VSL A;  4CF0 A;  4K8X A;  1VSJ A;  5CYM A;  1S1X A;  4IDK A;  2PYJ A;  4N76 A;  4MQ3 A;  2OA8 A;  4LSL A;  4HUF A;  4CFA A;  4KRF A;  4CHZ A;  4IFV A;  3AVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...