2R7YA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords RNA (5'-R(*UP*CP*GP*AP*CP*A)-3')
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2r7yA00
4H4OA 1HQEA 1HRHA 3AVAA 1S6QA 3L8BA 4DTOA 1KCFA 1BI4A 3O3GA 1LAWA 4CJ4A 3KK3A 4FJ9A 2IGIA 4LH4A 4C8OA 1RT5A 3DLRA 3NHGA 1JLFA 3AVMA 2YV0X 3L2VA 2D0AA 1YTAA 1NKCA 3V9UA 1RDAA 4OKKA 4TSXA 1J54A 1IO2A 3V9SA 3WNEA 1ZBIA 4O0JA 4CJEA 3RMAA 4KHQA 2YHAA 4C8MA 5E41A 1LW2A 2PZSA 3AO2A 3VQQA 2KZMA 4Z4IA 2Z1HA 3CFPA 1JLGA 4E7LA 4F2SA 3MECA 4DG1A 5CZ2A 4KPYA 4OPJA 4O55A 1TKZA 2DY4A 3ZSQA 4M3RA 3HO1A 3QNNA 4FJGA 1SV5A 3SUQA 3SNNA 1X9MA 3PX6A 1XWLA 3RR8A 3SQ0A 4RW7A 4OLAA 1HJRA 3KLHA 3ZSVA 3P1GA 5I3UA 4EZ9A 3OS1A 4AH9A 4KAZA 3OJUA 1A5XA 1Z26A 1U48A 3MEDA 4DQQA 1ZBFA 4FM0A 2G8VA 3HSTB 3OYBA 3SQ4A 4IG0A 4FLVA 2ZQBA 4CEDA 1TK0A 1Q8IA 3AVBA 3LZJA 4M3ZA 4IBNA 3NBPA 4FLWA 3V81A 3THVA 2VWJA 3V6DA 2B5JA 4FJHA 1NK9A 4BDZA 3DRPA 4FJMA 1LWFA 4LD0A 4KTWA 4F2RA 1QSYA 1VSDA 1WLJA 5JS1A 2X78A 3SV3A 4O0IA 4HUEA 1J53A 2OPRA 5FDLA 1GOBA 3T3FA 1D9FA 4B9UA 2DFHA 1WN7A 4CEAA 4W5TA 3VQEA 1RBSA 4CGFA 1TAUA 4CJVA 2G8UA 4KHWA 2EHGA 3ZSZA 1C0TA 4C8LA 2P51A 1TKXA 1UA1A 3QINA 3CM6A 1C6VA 3HP9A 3DOKA 4HCCA 4CJRA 3HVRA 4BE0A 2HB5A 3LP0A 4DTJA 1D8YA 1BISA 3I0RA 3AO5A 3CG7A 3NE6A 2XY5A 1NK5A 1DTTA 4FYDA 1EKEA 2F8SA 1TGOA 1BIZA 3NGYA 4CGIA 1SKWA 3M8RA 2VG6A 3HPHA 3G10A 3AA2A 3DM2A 4I2QA 3T19A 1U4BA 2BE2A 4CHQA 1TK8A 3IRXA 3NH2A 3KLGA 5C24A 4OJRA 1NKEA 3DRSA 1IH7A 3DLEA 3IS9A 2B4JA 4CFDA 4BDPA 1S6PA 3LPTA 3HXMA 1J5OA 4DSLA 1VSKA 4B9SA 1JLEA 1RTHA 4G1QA 4CGDA 3E01A 4PUOA 4CF1A 2ZE2A 3LALA 2Q3SA 3TARA 1VSJA 4J2BA 4CGJA 1HPZA 4UQGA 1HYVA 1KVBA 4NCGA 4LSNA 1G15A 2FBTA 1NKBA 4DTNA 3AA3A 4QAGA 1BGXT 5HBMA 1SL1A 1RDCA 1S5JA 1VSEA 3K57A 3ITHA 3RMBA 4FJKA 3OYHA 1SL0A 1VSIA 3TAEA 1RT7A 1RBUA 2RN2A 4KHNA 1KVCA 4PWDA 4N41A 4CEEA 4R5PA 3NDKA 3NGZA 5HROA 1IKYA 3MEEA 3G0ZA 1T7PA 1GOCA 1RBRA 4DFJA 3S3NA 1TL3A 4F3OA 3LWMA 3LZIA 3QNOA 4BWJA 3AV9A 3KLEA 4Z4HA 5KTQA 3LPUA 1S9GA 5T7BA 1KVAA 1RILA 3RRGA 4DS4A 5FROA 4RW8A 1C0MA 1CZ9A 1JL1A 2VG7A 1S9EA 4N47A 4E19A 4Q5VA 3KK2A 4KTZA 4FM1A 3OYEA 4DFMA 3SJJA 4B08A 4B3OA 3OYKA 2FBYA 4FLYA 4NYNA 2G8IA 3NFAA 4HUGA 1IG9A 1S1WA 3MXJA 3V9WA 3OYGA 4C8NA 2Z1IA 3VA0A 3P83D 3ULDA 3ZSXA 4CJQA 4FLUA 4DQRA 3M8PA 3I8DA 4DU3A 3SCXA 4EZ6A 2HHXA 1MU2A 5JS2A 1IKXA 1S1XA 2BGGA 4CIGA 3L3UA 3OYNA 4RW6A 3OYDA 4E1NA 5J1EA 4J2AA 2HHQA 2O4GA 1GOAA 3SUOA 5I42A 2Z1GA 2DFFA 3QIOA 3K5LA 3ASMA 4AHVA 3VQCA 3O3FA 2HVHA 1RT6A 2YNGA 3WNFA 3LANA 2OPQA 2HVIA 1HYZA 4CF2A 4HUFA 5J2PA 1TV6A 3VQ9A 4CJFA 4DSEA 5C42A 4ELVA 3OYCA 1NJXA 1NK0A 3ZSOA 4DQPA 4CIFA 4OVLA 4M3TA 4KRFA 1JLAA 3VQDA 2R7YA 1RNHA 2A1RA 3VQ7A 5EU7A 4DWIA 3VQ4A 3DI6A 5KGXA 2XHBA 4Y1DA 2XY6A 1KFSA 1LAVA 4B9TA 4E0DA 4K8XA 3ZT3A 2LSNA 3NF8A 3M8SA 3NF9A 2X74A 3NF7A 4PA1A 3EYZA 3LAKA 3AVFA 4Q0BA 4DF8A 2QK9A 1TK5A 4E3SA 3TAMA 4JLHA 3HM9A 1VRTA 3KKRA 1BIUA 4NCAA 2KFZA 1FKPA 3B6OA 4LH5A 1JLCA 3NGIA 4LSLA 4BDYA 4CHYA 2G8HA 1UOCA 4O44A 4ID5A 1WNSA 4DLEA 1U04A 2ATQA 4DFKA 3V1RA 2ZD1A 3ZT1A 4BE2A 4RW4A 3OY9A 4FZZA 1NJYA 4ZTFA 4FK2A 3VQPA 1XC9A 5FRMA 5KRTA 3NAEA 4GW6A 3QERA 1VSMA 4DQIA 1RTDA 2QKKA 4W5NA 4CEFA 3VA3A 3KK1A 4I9QA 2DTUA 3LAMA 3DYAA 4M3XA 1XHXA 4YFUA 3K5NA 3AA4A 2YKMA 2D0BA 4CFCA 4CFAA 1N6QA 1L3TA 4DU4A 5HLFA 3HJFA 1KLMA 2O4IA 2P1JA 3TR8A 3OJSA 1ZBLA 2B6AA 4N56A 4FLXA 4DSKA 4FJXA 2JGUA 4FJ5A 2HW3A 4DFPA 1HMVA 3RR7A 1JKHA 3UIQA 4KHSA 2IC3A 1TVRA 3AO4A 5KI6A 1QS4A 1DTQA 1BL3A 1RBTA 3KKSA 3ZT2A 5DMRA 1KSPA 1U45A 2RPIA 4FJIA 5HRPA 4DSIA 1IKWA 3KIOA 1S1UA 1I39A 1B9FA 5KRSA 3AO1A 4CERA 3DRRA 3PO4A 4FW2A 1CZBA 1WSFA 4PY5A 3CQ8A 3QO9A 1QE1A 1X9SA 1CLQA 3AVGA 4HCBA 2GUIA 1FK9A 4E7IA 2OA8A 4N76A 4CIEA 2XY7A 3OYFA 4CHNA 4M45A 4ELUA 4FZXC 4KTQA 2XY8A 2E6LA 3MAQA 1ZYQA 4NYFA 1ASUA 1O1WA 2XRIA 1BI4B 2P5GA 2YNHA 1REVA 1RT2A 4DTMA 3U6FA 2DFEA 1YTUA 3HPOA 1A5VA 1D5AA 5J2NA 3SUNA 4CJTA 2PY5A 4FZYA 4KB1A 1RT1A 3CFRA 1RCHA 1W0HA 3EZ5A 3V1QA 3SPYA 3C6TA 3IG1A 4FJNA 1TKTA 2F96A 1TAQA 1VSFA 4IKFA 2OZSA 4FK4A 1QSSA 2HNDA 2ITGA 3D45A 4O4GA 1EETA 2EX3A 4DS5A 4NCBA 1QTMA 1EX4A 4I2PA 3MXIA 1NJWA 4AHSA 4EP4A 4JS5A 4AILC 2OYQA 3T1AA 3VQBA 4J2DA 2NUBA 4BWMA 1YVUA 3AVCA 4JS4A 3TI0A 2IDOA 2GBZA 4FM2A 1T05A 4CK1A 1KRPA 3L2UA 1UWBA 2OZMA 4CECA 1WAFA 4B9VA 3I0SA 3DLGA 3VQAA 3OS2A 5DK5A 3OYJA 4OLBA 3AVNA 1JLBA 4BE1A 3RWUA 4DU1A 3KLFA 1YT3A 3ZSRA 4B8AB 4FLZA 4HTUA 1WAJA 3SQ1A 3K5OA 3HYFA 1KTQA 4IG3A 4ICLA 1WSJA 3U3GA 4JRPA 4DLGA 4DSJA 1X9WA 4CFBA 4CJLA 5HRRA 3SUPA 2KTQA 2JLEA 5KGWA 3DLBA 2ETJA 3KTQA 4M42A 5CY4A 4B9MA 4IFVA 4EP5A 3OYMA 4GVMA 4ELTA 1QHTA 4CK3A 4DTSA 2HHVA 4K8ZA 4CF8A 4F3TA 3P5JA 2IOCA 3VQ6A 3O4QA 4CF0A 3QEPA 2QXFA 3PY8A 3K2PA 1UAXA 4FK0A 3U3YA 4KHYA 1EP4A 5CZ1A 1WSHA 3M8QA 3AVJA 4W5QA 4QCLA 3LP1A 4CJ3A 1NK8A 1JL2A 4ZHRA 1SKSA 4OGEA 5SWMA 1DLOA 3CYMA 3CM5A 5K14A 1BQNA 4DTPA 3TAGA 4I9LA 3L2RA 1L3SA 1LV5A 4CEZA 1RT4A 4CEBA 1LWCA 3QEXA 3PV8A 4PQUA 4MFBA 2VWKA 3SI6A 1WSIA 3ZSWA 3C6UA 4N5SA 4CHZA 3RMCA 2BDPA 1FKOA 1C1BA 4OKJA 4DQSA 1NJZA 3OYAA 1LW0A 3F73A 4FVMA 4E7KA 1J9AA 1L3VA 3HPGA 1KLNA 3TAQA 3WNHA 3QEWA 5D3GA 4M3YA 1JLQA 1BQMA 3PX0A 1D9DA 1X1PA 1CXQA 3RMDA 1S1VA 4H8KA 4KFBA 4KI6A 1TKDA 4RW9A 5J2MA 1A5WA 2IAJA 4W5OA 1ZBUA 4OKEA 1Q9YA 3PX4A 4CJUA 2XO7A 5CYQA 3AVLA 3DOLA 1LWEA 3TAPA 3TANA 4E1MA 4AHTA 2Z1JA 1Z25A 2I5JA 3ALYA 4BACA 3D0PA 4FJLA 1Y97A 2FBXA 3ZSYA 3AVIA 4XIUA 1XHZA 3V1OA 3V4IA 3O4NA 2G8KA 3FFIA 3SV4A 3HVTA 1UA0A 1S1TA 1VK0A 3KLIA 1T8EA 3VQ5A 3LP2A 4JRQA 3QEVA 3RRHA 4J2EA 2VG5A 4RG8A 3ZT4A 1RDDA 2F8TA 4CEQA 1C0UA 2GV9A 3KD1E 3VQ8A 4FXDA 4E7HA 2D0CA 4AHCA 2KW4A 2HHTA 3MEGA 3HT3A 2YHBA 1XI1A 1RTJA 2E4LA 2RKIA 4Z0UA 3L3VA 1W9HA 1NOYA 3HL8A 3OS0A 4ID1A 5SZTA 4FJ7A 3OYLA 4DF4A 1JXEA 2OPSA 4M41A 4CEOA 1C1AA 3DMJA 3F9KA 4ZTJA 2W42A 4Z4EA 3S9HA 1ASWA 4YNQA 4O5BA 1R0AA 4CJ5A 4CE9A 1RBVA 1B9DA 3NH0A 3LDSA 1U49A 2PYLA 3AVHA 3BGRA 2KQ2A 3NH1A 3RTVA 2X6NA 1C1CA 1QSLA 3PO5A 3EY1A 3SPZA 4DTUA 3HP6A 2YKNA 2QKBA 1B92A 1BCOA 3LP3A 2A1SA 2FBVA 3QETA 4Y1CA 4HVJA 3TAFA 3MXMA 3C95A 3V9ZA 4M3UA 3JYTA 3BDPA 1RTIA 1NK7A 1FXXA 3LWLA 5FRNA 2YNIA 1RT3A 5C25A 4CHPA 4CGHA 1SKRA 4CJKA 4FW1A 1VRUA 4KV8A 1ZBHA 2G8FA 1K6YA 4GMJB 4QOZB 2KZZA 1VSHA 4F4KA 2E6MA 3DLHA 4M3WA 4H4MA 1IKVA 1KFDA 4KHUA 1WSGA 4MQ3A 5CYMA 2HHSA 4LY7A 1L5UA 3S3OA 1BCMA 3HK2A 3K5MA 3AA5X 4WE1A 4CHOA 2AJQA 4HHTA 1U47A 1EXQA 4CCHA 4L8RB 4E89A 1JXBA 3H08A 4AHUA 3ISNC 4CJPA 4B9LA 4CF9A 5J2QA 2IS3A 4CJWA 4I7FA 2X6SA 1VSLA 2BANA 4C8KA 4DMNA 3PUFA 2FC0A 3S3MA 4Z4GA 3O3HA 2WOMA 2OPPA 3IAYA 2KFNA 3L2QA 3CFOA 3QEIA 3AVKA 3QIPA 4KO0A 3KD5E 4Z4FA 3AO3A 2D5RA 1HNVA 4OGCA 3ZT0A 3VN5A 5HRSA 1HNIA 3DLKA 3B6PA 2HNZA 2RF2A 1RDBA 2PYJA 1F21A 4DTXA 4B9NA 4OPKA 1NOZA 2HNYA 3QLHA 4CJSA 3V9XA 3OYIA 4IDKA 3K58A 3ZCMA 1CXUA 3SZ2A 1SL2A 4CGGA 3JSMA 1NK6A 3C94A 4KKOA 3A2FA 4F8RA 2G8WA 1SUQA 4FJJA 1ITGA 1BHLA 3NCIA 3TWHA 1TL1A 1NK4A 4KI4A 3OVNA 2HHUA 4KREA 4KB0A 4AHRA 1L3UA 4FJ8A 3L2WA 4FLTA 2YNFA 4FCYA 3NF6A 4B8CA 3KJVA 4DTRA 3SQ2A 2WONA 5HP1A 4IFYA 2P5OA 2Y1JA 1T03A 1N5YA 5HRNA 1Q9XA 1ASVA 1I3AA 4W5RA 1HQUA 1WSEA 4DSFA 3QESA 4Z4CA 4CK2A 4E7JA 1HYSA 2HMIA 2Y1IA 2HHWA 1QQCA 4CESA 3K59A 3SYZA 3TABA 3WNGA
chains in the Genus database with same CATH superfamily
3TSUA 2YHWA 1S6QA 1NMDA 1LAWA 3CCMN 3CD6N 3A5LC 4HTLA 3L2VA 1T3VA 3V9UA 4OKKA 3H45C 1J54A 5GAGP 4O0JA 3QBWA 4CJEA 3RMAA 4KHQA 2PZSA 3J8AA 1JLGA 4F2SA 4DG1A 3KHYA 4O55A 1TKZA 2W6KA 5C12A 5GADP 3HO1A 3BZKA 3QNNA 3JS6A 5AQJA 4DV1K 3SUQA 4FWPA 5AQTA 3RR8A 2W6LA 3SQ0A 1HJRA 3ZSVA 2QWOA 4BRMA 1N34K 2PAVA 4JKAA 5I3UA 1KAXA 4KAZA 3OJUA 1U2VB 1U48A 4DQQA 3HSTB 4IG0A 4FLVA 2ZM6K 4Y0WA 4JKCA 1TK0A 2P9SA 3NBPA 4IBNA 3THVA 1NK9A 2Q0UA 2QWNA 2ASOA 5GIOA 1RDUA 3I55N 4F2RA 1QSYA 1VQPN 4NO7A 2X78A 5LMUK 1TYQA 1J53A 2BTFA 4CEAA 4JI3K 4CJVA 2G8UA 2EHGA 4JKHA 2P51A 4JHDB 5GAHP 1UA1A 4NLBA 4JKGB 1YJ9N 3CM6A 1V4TA 2GWJA 3DOKA 2W41A 1NLVA 4IO8A 3BY5A 4H0XB 1NK5A 4EAHD 5HL7L 3M8RA 3G10A 2I7PA 3T19A 5AQWA 1U4BA 2BE2A 1J6ZA 4FWKA 4BR7A 1HUXA 3DLEA 4IOCL 2B4JA 1S6PA 3LPTA 3HXMA 2YJEA 4CGDA 3LALA 2Q3SA 4DHYA 5I9EB 3S41A 4UQGA 1KVBA 4LSNA 3SAHA 3HI0A 4QAGA 3CCQN 3ITHA 3SK3A 3OYHA 1BOTO 3TAEA 3C7NA 1KVCA 2O8CB 3RSEA 3G0ZA 3L4QA 1VQ8N 4F3OA 1XMQK 4LFBK 1ZXOA 2P9NB 4KH5A 4Z4HA 5KTQA 1N33K 3VGLA 1C0MA 1CZ9A 1JL1A 5AQHA 1S9EA 3KK2A 1SL0A 4KTZA 3SJJA 3C0BA 2G8IA 1IG9A 3CXCM 3I33A 2UXDK 3V9WA 3ZX3A 1EO1A 2YHYA 4EFHA 3P83D 4PL7A 4FLUA 3M8PA 3I8DA 3SCXA 4H5RA 2D4WA 3HBTA 2QA4N 1N8RO 2JWKA 3MX5A 2BGGA 4H5WA 3OYDA 4C1NK 5J1EA 2O4GA 3SUOA 4K43A 4BRAA 4AHVA 1WBBA 4CF2A 2YI1A 3VQ9A 3OYCA 1NJXA 1NK0A 1IG8A 5FPDA 3WXMB 4CIFA 4BQZA 2WC9A 2R7YA 1HKGA 2EWSA 3VQ7A 1R59O 3FGUA 2XY6A 2ZJPL 4K8XA 3EYZA 4PA1A 3HM9A 3ULEA 4DV3K 1BIUA 4NCAA 1FKPA 3CHWA 4CJ7A 3A5MC 5EVZA 1K8AO 4V19S 4BE2A 3ZX0A 4FK2A 1KD1O 3R1XA 5KRTA 5C2DA 3NAEA 3ZETB 2Q0RA 4ILJA 2QKKA 4JKEA 2NNWA 3KK1A 4B3TK 4YFUA 1VHXA 4CFCA 4JI2K 1TYQB 2P1JA 1ZBLA 4N56A 4FJ5A 4JNEA 1HNWK 4BREA 1BL3A 2F7TA 1RBTA 2P9PA 1Z6RA 1KSPA 4H0YB 4DSIA 3ZYYX 2QM1A 3WXLA 1S1UA 3PO4A 1E3MA 3QO9A 1QE1A 1YI2N 4E7IA 2HBJA 1LCUA 4ELUA 3K9JA 2XY8A 2ZJRL 1NGAA 4B1YB 2E1YA 3QBXA 1ASUA 1O1WA 1MWMA 1BI4B 3MN9A 4M7XA 2D0OA 1REVA 3FR0A 5GINA 3HPOA 1A5VA 5J2NA 4FZYA 1RCHA 4DUZK 3C6TA 2IVOA 4FK4A 2OZSA 4L3QA 1IBKK 1QTMA 1EX4A 3TPQA 4EP4A 4JS5A 4J2DA 3T1AA 4LF5K 3DXKB 2NUBA 3CCSN 2GBZA 4E1JA 3I0SA 4B9VA 3RWUA 4GV6A 3HYFA 3U3GA 1VQMN 4H5VA 1VQON 4CFBA 1VQ5N 2KTQA 2ETJA 3KTQA 4M42A 2Q1NA 3ENOA 1VQLN 3OYMA 1P90A 2QEXN 4JI5K 4ELTA 4DTSA 4NXNK 4K8ZA 4CF8A 3QFPA 3O4QA 1QQOA 4FK0A 1NGDA 3I8BA 3U3YA 1EP4A 2ZGYA 3T1HK 1WSHA 3AVJA 1WUAA 1NK8A 4DR3K 1JL2A 5FPNA 1GLCG 2V52B 5SWMA 2Q36A 1DLOA 5AQUA 3CYMA 1BQNA 4DTPA 5BR9A 3TAGA 1D4XA 3C6HA 3L2RA 4YOXA 3PV8A 1L3SA 2GWKA 3SI6A 1WSIA 3C6UA 1FKOA 3UKRB 4DR5K 3OYAA 1LW0A 1WOQA 4FVMA 1J9AA 3WEEA 4E7KA 3TAQA 2QXLA 3WNHA 4B1UB 1D9DA 1CXQA 3T1YK 4KFBA 1Q86O 1N36K 4Z94A 3O9UA 2IAJA 1ZBUA 4OKEA 1EWRA 4B9QA 2NZTA 3LM2A 2XO7A 3DOLA 1LWEA 5AQIA 4IEIA 1Z25A 5BPNA 4FJLA 1Y97A 4XIUA 3A8YA 4M7YA 5A2QO 4A59A 3V4IA 5AQVA 3SV4A 1S1TA 5EX5A 1T8EA 5AQRA 3VQ5A 1QZ6A 4JRQA 4BRFA 3P31A 4BGBA 1RDDA 3WQUA 4DV7K 1O13A 1S22A 3J80O 3KD1E 4E7HA 5H1SQ 3HT3A 1RTJA 4MDAA 4GKJK 4Z0UA 5KPZA 1NBWA 2NRTA 3OS0A 5SZTA 3UB5A 1YJWN 2GUPA 3VERA 1JXEA 3F9KA 3BGRA 3WXJA 3VEOA 1E4FT 3RTVA 4JN4A 5AQLA 1SQKA 4GV9A 4O8UA 3HP6A 2QKBA 1BCOA 2FBVA 2OCEA 3JYTA 2DPNA 5F2RA 1NK7A 2YNIA 2I7NA 4RWTA 4CHPA 3MCPA 4MLEA 1VRUA 2A6AA 1VQ9N 4BC3A 3QMLA 1KAZA 2KZZA 1VSHA 2E6MA 3CC7N 1KFDA 5BREA 1WSGA 4MQ3A 3E66A 4LY7A 5M1FA 1BCMA 3K5MA 4BVOA 3HRGA 1YITN 3UKUB 4AHUA 4CJPA 3O8MA 5J2QA 1MWKA 1NMNA 2X6SA 4C8KA 4DMNA 2WOMA 3L2QA 1NJIO 4Z4FA 4CZKA 2IVPA 1QZ5A 3AO3A 2D5RA 4OGCA 3VN5A 1OH6A 3DLKA 2PYJA 1RDBA 1F21A 3GG4A 4B9NA 2HBLA 3EZWA 3SZ2A 2P9LB 4JI1K 2KHOA 3I56N 4KKOA 3MX2A 1TUYA 1SUQA 2CGKA 4FJJA 2Q31A 1NK4A 5EXWA 4LF8K 4FJ8A 4FLTA 2YNFA 4QS8A 3L4IA 1JCGA 4U67L 3CCLN 2P5OA 2Y1JA 3CI5A 1YHQN 4GKKK 3C65A 4W5RA 4DSFA 4E7JA 1QQCA 2VWBA 3OBYA 3JXUA 5GAEP 1KCFA 1BI4A 1WBDA 3AARA 4A57A 1RT5A 1JLFA 1YTAA 3VF2A 4TSXA 4HWIA 3V9SA 3WNEA 4U7BA 2YHAA 5E41A 1LW2A 4AM6A 4YHHK 2Z1HA 4FOEA 2O8DA 4KPYA 5CZ2A 3MK6A 1XUPO 4YOWA 3SNNA 3PX6A 1XWLA 3CCJN 3OHRA 4KH6A 4RW7A 4WF9L 2A41A 3KK7A 2HBKA 3OW2M 2G8VA 3SQ4A 3TSQA 3M6GA 4CEDA 4M3ZA 3V81A 4FJHA 3H1VX 3DRPA 1LWFA 4BC2A 4KH4A 2OPRA 5FDLA 4DKWA 3T3FA 4B9UA 2DFHA 4WQ5C 1RBSA 4C8LA 1C0TA 3QINA 3ULEB 4JK8A 4MDBA 4CJRA 1D8YA 3I0RA 3MWPA 3AO5A 3CC4N 2XY5A 1EKEA 3GL1A 1ZC6A 5BRDA 4A5AA 2VG6A 4WYBA 3OA9A 3AA2A 5JVHL 1RDWX 3AAPA 3IRXA 3VGKA 3NH2A 3KLGA 1BU6O 4OJRA 2VQEK 3DRSA 2UXCK 4BDPA 4AF1A 1J5OA 4LC9B 3CCEN 4ILGB 3E01A 4CF1A 4PL8A 1HYVA 4NCGA 4AM7A 3WQTA 1G15A 1RGIA 4OPHA 4DTNA 3AA3A 1BGXT 1S5JA 2O8FA 3RMBA 1RT7A 4R5PA 3NDKA 3NGZA 3MEEA 3TTDA 5LY3A 1RBRA 4DFJA 2P9PB 3LWMA 4JYAK 1YIJN 1S9GA 2IVNA 5T7BA 1T44A 2VG7A 4B3OA 2F9TA 3OYKA 4JKBA 4HUGA 1MDUB 2ZWHA 2QTDA 4C8NA 3TTFA 2O8CA 1XQSC 1NG9A 4I6MA 4EIAA 3VEZA 3THYB 2HSTA 3ENBA 1OH8A 1S1XA 4CIGA 4E1NA 2Z1GA 2DFFA 1T6CA 3E9OA 3ASMA 5M1PA 1NWKA 3VQCA 5KPRA 2YNGA 3LANA 2HVIA 3O4WA 4DR1K 5J2PA 1TV6A 4DSEA 4WFAL 4DV2K 4M3TA 3VQDA 3CERA 4DWIA 2XHBA 5ADXA 3H3OB 4FOIA 1VQ7N 4E0DA 2LSNA 5AQKA 3NF9A 2X74A 4FPBA 4Q0BA 4NXMK 4DF8A 3TAMA 4JLHA 3TTCA 5AQQA 2KFZA 3RSEB 3MN6A 2V7ZA 2G8HA 4DLEA 3V1RA 4OO1J 4RW4A 3OY9A 4ZTFA 3VEYA 4BRPA 1XC9A 1J5EK 1Y64A 2WFBA 1RTDA 4YDUC 2DTUA 4BRQA 1GLDG 1WB9A 3O9TA 1XHXA 3LL3A 1YVNA 4DR7K 3HJFA 1XC3A 4DSKA 4FJXA 1ATRA 1HMVA 2E2PA 1QS4A 3O1WA 3K0SA 4IO9L 1Q7YO 3DXMB 3K9KA 3N4QA 4JI4K 3SAGA 2FXUA 2UYTA 3TU5A 1BUPA 4CERA 4PY5A 4FW2A 1CZBA 4BG8A 2OANA 4X65K 4DV6K 1Q18A 4DV4K 2YHXA 1CLQA 1DT9A 2P9IB 2YX6A 1FK9A 3AVGA 3OYFA 4FZXC 2GELA 1GLLO 4NYFA 2P5GA 2YNHA 3CJBA 2H3GX 3VTHA 4JKDA 3U6FA 2HBMA 1D5AA 1KQSM 1RT1A 5KPTA 3DJCA 4LFAK 3EZ5A 4FWQA 4FJNA 2F96A 3H3NO 2ITGA 4I2PA 2A5XA 3H6EA 3VQBA 2E2NA 3AVCA 3TI0A 2IDOA 4KHPK 4FM2A 1KRPA 1UWBA 3W0LA 1FW6A 4CECA 1WAFA 3C7NB 1NM1A 4K42A 3AVNA 2CH6A 3U9ZA 4H5TA 1YT3A 2QWPA 4HTUA 2E88A 4JV5K 4CVNE 4ICLA 3BEXA 1X9WA 5HRRA 3SUPA 4FL9A 4C1NI 5C10A 4GVMA 4IFEA 2HHHK 3P38A 2HHVA 4F3TA 2IOCA 3VQ6A 1VQKN 3ZEUA 4CF0A 3PY8A 4KHYA 5DM6L 3M8QA 3NVMA 4CJ3A 4JK7A 4ZHRA 2QWLA 4J2BA 1LV5A 4OLBA 4CEZA 4IEEA 4PHTX 3QEXA 4B3MK 4YOYA 4MFBA 1K9MO 4JKGA 3ZSWA 4CHZA 3RMCA 1NGIA 3IFRA 3U4LA 3CMAN 4BR5A 1L3VA 1KLNA 5D3GA 4GVEA 3PX0A 1BG3A 5J2MA 1OVYA 4CJUA 3PX4A 3AVLA 4E1MA 4AHTA 2I5JA 4CBUA 1KC8O 2QI2A 1XHZA 3V1OA 3O4NA 3FE1A 1UA0A 3HTVA 5C15A 3QEVA 2ASPA 2VG5A 1HKCA 4CEQA 3VQ8A 4FXDA 3FLCO 4JI7K 4AHCA 2KW4A 2HHTA 5BPLA 1GLAG 4K0KK 1YUWA 4ID1A 4FJ7A 4C23A 2P9KB 4M41A 4CEOA 5AQOA 4B1ZA 2GX9A 4YNQA 4CE9A 1B9DA 2KQ2A 3NH1A 2X6NA 1QSLA 1NGFA 3SPZA 1NNEA 2YKNA 2VYPA 3QETA 3MXMA 1IJJA 1HNZK 4CGHA 4CJKA 5EOYA 1VQ4N 1ZBHA 5CHIA 3A5OC 2G8FA 4BROA 4GMJB 4QOZB 5AZJB 4M3WA 2E20A 3MDQA 4ISEA 1IKVA 3J7YP 3THXA 3J7AP 4H0VB 3S3OA 2QWMA 3AA5X 4CHOA 3OTOK 1T6DA 1U47A 2FF3B 3QICA 4E89A 1VAZA 2JWLA 2GTDA 2IS3A 4CJWA 4I7FA 2BANA 3D2FB 3PUFA 3IAYA 2KFNA 3QIPA 3KD5E 4KO0A 1RFQA 3CPWM 1HNVA 4DCHA 5HOOA 2RF2A 3QB0A 4DTXA 4OPKA 3G6EN 3V9XA 3OYIA 1HR0K 1CXUA 2D0PA 2FF6A 3SBTA 4CGGA 1NK6A 3C94A 3A2FA 4F8RA 3ZETA 1ITGA 3TWHA 1TL1A 1X3MA 4KI4A 3CF5L 4CZHA 3G4SN 3Q7BA 1L3UA 3H46O 4FCYA 2PBDA 3NF6A 4DTRA 4GV3A 2WONA 3O5BA 4IFYA 5HRNA 1Q9XA 5MLCQ 3WNGA 3CJ7A 1HQEA 3L8BA 5C0YA 4CJ4A 4LH4A 4C8OA 3DLRA 1NU0A 3NHGA 3AVMA 2YV0X 2D0AA 1NKCA 4BRLA 1HJOA 2AP1A 4H0PA 1ZBIA 4JI0K 1C0FA 2FLOA 3SJHA 4CZGA 5LJWA 4Z4IA 4E7LA 3MECA 3ZSQA 4M3RA 4YY3K 4FJGA 1X9MA 1MA9B 4OLAA 3KLHA 1X9JA 3CETA 3E9LA 4BRGA 3UKUA 4EZ9A 3OS1A 4AH9A 1A5XA 3MEDA 1ZBFA 1Q82O 5BN9A 3OYBA 4H03B 3PSIA 2UXBK 4WFNL 2J4RA 1SS6A 3AVBA 3G71N 3UKRA 3F9MA 4FLWA 3V6DA 2B5JA 4BDZA 3R8EA 3E1YA 4LD0A 1C0GA 3ID8A 1VSDA 5JS1A 4HUEA 2E5LK 2RE2A 5CE3A 3VQEA 3G25A 4KHWA 4JI8K 3TSPA 1TKXA 5BN8A 3SLCA 3HVRA 4BE0A 2HB5A 1BISA 4YOTA 4FYDA 4F9OA 1TGOA 1BIZA 3MN5A 4CGIA 5JMVA 3HOTA 4OPAA 1SKWA 3N4PA 3CQYA 1TK8A 5JVGL 5C24A 1NKEA 1IH7A 3UE5A 3IS9A 4CFDA 1ILYA 4DSLA 4B9SA 3VESA 5KQ8A 4PUOA 2ZE2A 3TARA 4LF4K 4CGJA 2VCPA 1IBMK 3NVKA 4CZMA 1YAGA 2FBTA 5HBMA 3LDOA 4A2AA 4PWDA 1ESVA 3IMXA 4JHDA 3D6RA 4N41A 1N32K 3D2EB 5AQYA 1GOCA 1TL3A 3L6QA 3LZIA 4BWJA 3KLEA 1KVAA 4CI6A 4DS4A 3O9QA 4RW8A 4N47A 4FM1A 5EY4A 4BRNA 3OYEA 4DFMA 4B08A 2FBYA 4FLYA 4NYNA 2HF4A 3NFAA 1V4SA 1YJNN 4CZJA 3MXJA 3WEEB 5JLFA 3FZMA 3VA0A 3AAQA 1U6ZA 4DQRA 3LDQA 1W97L 2HF3A 3L3UA 4J2AA 1GOAA 2P9IA 3QIOA 5B8HA 3K5LA 1RT6A 2OPQA 3M3ZA 4CJFA 5C42A 1H1VA 3DXMA 2V7YA 4ELVA 3ZSOA 4DQPA 5AR0A 5ADXH 5AQPA 4IJNA 2F4VK 1RNHA 2A1RA 2ITMA 3FZKA 5EU7A 3VQ4A 5KGXA 1QQMA 1LAVA 4B3SK 3AVFA 4E3SA 3KKRA 4BC4A 4LH5A 1JLCA 5M1OA 4CHYA 4O44A 1WNSA 3P4IA 2ZD1A 4JK9A 5BR8K 1FJGK 3VQPA 3QERA 4GW6A 4DQIA 3VA3A 4I9QA 3LAMA 3WT0A 2HOEA 4M63C 5E84A 4FWRA 4M3XA 4XH1A 1BDGA 1Z05A 3K5NA 2O8BA 3J7ZO 2YKMA 2D0BA 1N6QA 4IOXA 1L3TA 4DU4A 4X64K 3PLAA 1YXQA 1KLMA 5FPMA 3TR8A 2B6AA 4FLXA 2UUBK 4DFPA 2E8AA 1JKHA 4KHSA 2IC3A 1TVRA 5KI6A 5AFUA 3ZT2A 5DMRA 1U45A 4FJIA 4BRHA 5HRPA 4CD1A 1BA1A 1U2VA 5C2FA 5KRSA 2HMPA 1WSFA 3ENHA 5AFUH 3CQ8A 5AQZA 4FWLA 4HCBA 4N76A 1VQ6N 2OA8A 5E26A 2XY7A 5IWAK 4DR6K 4M45A 1NGHA 4KTQA 3KWIA 4X62K 2NRWA 3O9SA 4XH4A 4ISGA 4B1WB 1RT2A 2DFEA 2O8BB 4KB1A 2PY5A 1ATNA 1W0HA 1KXPA 3V1QA 1TAQA 1VSFA 3PIPL 4IKFA 1W7AA 2HNDA 3D45A 1G99A 3QFUA 1DEJA 4DS5A 1IBLK 4AILC 3BP8A 2CGJA 2OYQA 3THWB 3BZCA 4CK1A 3L2UA 3EKSA 3DLGA 3VQAA 3OS2A 5DK5A 5JICA 1JLBA 4BE1A 3EE8A 4DU1A 3KLFA 4B8AB 3ZSRA 3O9RA 4FLZA 4KBOA 3CJAA 1WAJA 3HSCA 3SQ1A 4M3YA 1WSJA 3P39A 4WCEL 3M5RA 2FSJA 5AQMA 2JLEA 2ZGZA 3KVGA 3IUCA 3VEWA 3EO3A 2WTUA 4EP5A 3W3DA 3P5JA 3QEPA 3T69A 4PKHA 4QCLA 3VOVA 1EWQA 3LP1A 1HPMA 3WXKA 4OGEA 3CM5A 4G9ZA 5K14A 3J81O 4I9LA 4CEBA 2RHKA 4DQ8A 4N5SA 2BDPA 2P9LA 4DQSA 1NJZA 3F73A 2KLAA 3HPGA 4BY9C 4EHTA 2E2QA 3QDKA 3QEWA 1JLQA 1X1PA 3RMDA 4H8KA 1TKDA 4RW9A 1A5WA 4W5OA 1Q9YA 4OX9K 4H0OA 3MN7A 5CYQA 2FSNA 2W40A 4BACA 2WBNA 5AQGA 3ZSYA 3AVIA 3JAMO 1YF5L 4BRDA 2G8KA 2NRHA 3HVTA 4CD3A 1NGEA 1VK0A 3CCVN 4JI6K 3RRHA 4J2EA 3ZT4A 3VPZA 3EEQA 2F8TA 3LDLA 2VGNA 5GIPA 2GV9A 4QS9A 4LFCK 2D0CA 2KKZA 3MEGA 1XI1A 2E4LA 1BWFO 2RKIA 4DUYK 5BPMA 3L3VA 1NOYA 3HL8A 3D7EO 5TKWA 4FWOA 2OTJN 4DF4A 3MCAB 3DMJA 4Z4EA 1ASWA 2P9KA 1R0AA 4CJ5A 3NH0A 2PYLA 3VMFB 3AVHA 3CIPA 2FSKA 3PO5A 5ELZA 2A1SA 1NGCA 4Y1CA 3VF6A 4HVJA 3V9ZA 4M3UA 1IV0A 1TUUA 2BH1A 5FRNA 1RT3A 5C25A 1SKRA 3DWLA 2Q97A 3VF4A 4FW1A 5AJ3K 3MMVA 4KV8A 3PSFA 1K6YA 1JCEA 2OTLN 1DGKN 3DLHA 2NRXA 4KHUA 2HHSA 3VTIA 3HK2A 4X66K 4JD2B 5AZIB 3CJCA 1EXQA 4CCHA 3ISNC 4PKIA 2E1ZA 4JAXA 4PKGA 1JCFA 2FC0A 4FWNA 5LL6Z 3S3MA 2O8EA 4Z4GA 5AQXA 3QEIA 4FWMA 1M1KO 1HNIA 2HNZA 3B6PA 3IDHA 2NRZA 3A5NC 1NOZA 2UU9K 3CMEN 4CJSA 1S3XA 4IDKA 3K58A 5BRFA 3JSMA 3U9DA 4J8FA 1NGBA 1OH7A 2ZF5O 3DXKA 1BHLA 4KREA 3ZLJA 4MO5A 4BR0A 5M1KA 1N5YA 1ASVA 1I3AA 3QESA 1HQUA 4Z4CA 2HMIA 2Y1IA 2HHWA 3K59A 3TABA 4H4OA 1HRHA 3AVAA 3O1BA 4DTOA 1EQYA 3O3GA 3F2KA 3KK3A 4FJ9A 2IGIA 5KQDA 3L0QA 1RDAA 1IO2A 3R9PA 4B1VA 3VEXA 1X3NA 3RVCA 4C8MA 4BGAA 3AO2A 3VQQA 2KZMA 4H0TB 3CFPA 4OPJA 3THWA 2DY4A 1SV5A 4BRIA 1QVFM 3P1GA 3VENA 4ISFA 3EKUA 1Z26A 4ILHA 3WXIA 2UUAK 4FM0A 2CH5A 2ZQBA 4BQLA 4K25A 1Q8IA 3LZJA 1NGGA 4IJAA 1KAYA 2VWJA 4FWSA 4FJMA 4KTWA 1WLJA 3SV3A 4O0IA 3AY9A 3E9PA 4EHUA 1GOBA 1D9FA 1WN7A 4W5TA 4CGFA 1TAUA 4IWVA 3ZSZA 3O08A 1C6VA 4BVPA 3HP9A 4HCCA 5FLXO 3LP0A 4DTJA 3EN9A 3VETA 4R79A 3CG7A 3NE6A 1DTTA 1OVQA 2F8SA 3NGYA 4LF9K 3HPHA 3H1QA 3DM2A 4I2QA 4CHQA 2QWQA 3FFKB 5FPEA 1VSKA 1JLEA 1RTHA 4G1QA 3AGKA 2E2OA 5CR4A 1VSJA 2VGMA 1HPZA 4CBWA 2P9UA 1XNQK 1XNRK 4YOUA 1NKBA 4BG9A 1SL1A 1RDCA 1VSEA 3K57A 4FJKA 1VSIA 2F9WA 4KHNA 1RBUA 2RN2A 1QHAA 4CEEA 5IT9O 5HROA 1IKYA 1T7PA 3O80A 2QW9A 2YJFA 3S3NA 3CCRN 3QNOA 3AV9A 3LPUA 1RILA 3RRGA 3GE1A 5FROA 4E19A 4Q5VA 1NJWA 3SMSA 4JEPA 2GEMA 4A5BA 1S1WA 3NMUA 3LDPA 4YOVA 3SMPA 3OYGA 3B8AX 3GDQA 2Z1IA 1ATSA 3D2EA 3EE9A 3ULDA 3ZSXA 4CJQA 4DU3A 4GY2B 4EZ6A 2HHXA 1MU2A 5JS2A 1IKXA 3OYNA 2HHQA 4RW6A 2A3ZA 3HOSA 4BRCA 5I42A 2D1KA 2VQFK 3O3FA 2HVHA 3WNFA 1HYZA 4HUFA 2NRVA 3C6AA 3BF3A 1BO5O 4OVLA 4KRFA 1JLAA 3T7ZA 3R3LA 1KFSA 3DI6A 4Y1DA 2AA4A 4BR9A 4B9TA 3F5TA 3DLLL 3ZT3A 3NF8A 3M8SA 3OBWA 3NF7A 3GBTA 3LAKA 5AQNA 1K8KA 4CW7B 4CZEA 1TK5A 2QK9A 1VRTA 4IDHA 3CJ9A 3B6OA 3NGIA 4LSLA 4BDYA 1UOCA 3CPEA 4ID5A 3WUHA 1U04A 2ATQA 4DFKA 1HKBA 3ZT1A 4FZZA 1NJYA 4FVUA 5FRMA 1VSMA 4W5NA 4FSVA 4XH5A 4CEFA 4LF7K 2P9SB 3DYAA 3CCUN 3AA4A 4CZIA 4CFAA 3BF1A 5AQFA 3CJ1A 2A40A 5HLFA 1W2BM 2O4IA 1E4GT 3OJSA 4CZFA 2ASMA 2JGUA 2HW3A 3RR7A 1QQNA 3UIQA 3AO4A 4WQ4C 1DTQA 3KKSA 1DKGD 4XEIA 2BUPA 4O5FA 2YCHA 2RPIA 1IKWA 3KIOA 3THYA 1I39A 1B9FA 4AQYK 3AO1A 3DRRA 1GLBG 1X9SA 2GUIA 5JLHA 3SBGA 5TKYA 4CIEA 4CHNA 4GNIA 2E6LA 3MAQA 2O8DB 1GLEG 1ZYQA 2XRIA 1OH5A 1HNXK 4DTMA 3EL2A 1YTUA 5F0XA 3SUNA 4CJTA 3CFRA 3SPYA 4A2BA 3LM9A 3IG1A 1JJ2M 1TKTA 4CZLA 1QSSA 1XMOK 4O4GA 2NRRA 1EETA 2EX3A 2P9NA 2O8FB 4NCBA 4DR4K 3MXIA 4AHSA 4BWMA 3VGMA 1YVUA 4JS4A 1K73O 1CZAN 1T05A 3Q7CA 2OZMA 3OYJA 1K8KB 3A0IX 3K5OA 4IG3A 1KTQA 4JRPA 4DLGA 4DSJA 3AGRA 4BRKA 4YORA 4MO4A 4CJLA 5KGWA 3DAWA 3DLBA 5CY4A 4B9MA 4IFVA 1QHTA 4CK3A 3HM8A 3GOIA 4K41A 4WQ4A 2QXFA 3K2PA 1UAXA 5CZ1A 4W5QA 3PIOL 5M1NA 4B3RK 1SKSA 2O8EB 4UY8O 5LMNK 3ID6A 1RT4A 1LWCA 4PQUA 3KWGA 3THXB 4A62A 2VWKA 4H5NA 2IIRA 4I6MB 4OKJA 1C1BA 3CQXA 3M1FA 4BC5A 1BQMA 2ZJQL 3MWTA 1S1VA 4BR4A 4KI6A 1GLJO 1HLUA 1LOTB 3KZBA 3TAPA 1OKJA 3TANA 4YDUA 2Z1JA 3ALYA 3D0PA 3ATVA 1ZBSA 3D2FA 4JKFA 2FBXA 2WUSA 5DM7L 2NLXA 3FFIA 3KLIA 3LP2A 3HZ6A 4RG8A 1C0UA 2P9UB 3LDNA 2YHBA 4A61A 4DR2K 1HX1A 1W9HA 1VQNN 1SAZA 3OYLA 3CC2N 2OPSA 1C1AA 4ZTJA 4QS7A 2W42A 3S9HA 4FPAA 4O5BA 4B1XB 4DV5K 4DB3A 1U49A 3LDSA 1RBVA 2V51B 2UUCK 1GLFO 5LJVA 1C1CA 4CBXA 4O8KA 3EY1A 4DTUA 5AQSA 4RTFD 4DV0K 1B92A 3LP3A 1M90O 2A42A 3TAFA 3C95A 3O6WA 3BDPA 1RTIA 1FXXA 3LWLA 3ATUA 4WFBL 1NGJA 1S72N 4FO0A 4F4KA 3U8XA 4H4MA 1Q81O 5CYMA 1L5UA 4BR2A 2PFUA 4WE1A 5BRHA 2AJQA 4HHTA 4L8RB 1JXBA 3R6MA 3H08A 4IZ9A 4B9LA 4CF9A 4JD2A 5AZIA 1VSLA 1SZ2A 3FZLA 3O3HA 2OPPA 5M1QA 3CFOA 3AVKA 2CGLA 3IKMA 3ZT0A 4NLCA 4MLHA 5HRSA 4IOAL 2QWRA 4RCHA 5F1XA 2HNYA 3QLHA 3ZCMA 4NB4A 1SL2A 1BA0A 2Q2RA 5AZJA 2G8WA 3NCIA 3BUZB 3OVNA 3VEVA 1I94K 2HHUA 4KB0A 4WQ5A 4AHRA 3SAFA 3L2WA 1QVGM 4B8CA 3KJVA 3ZX2A 3SQ2A 5HP1A 3FZFA 1T03A 4LF6K 1WSEA 3FZHA 4IXCA 4CK2A 3ZEUB 1HYSA 1P8ZA 4CESA 3SYZA
chains in the Genus database with same CATH topology
4H4OA 1HQEA 1HRHA 3AVAA 1S6QA 3L8BA 4DTOA 1KCFA 1BI4A 3O3GA 1LAWA 4CJ4A 3KK3A 4FJ9A 2IGIA 4LH4A 4C8OA 1RT5A 3DLRA 3NHGA 1JLFA 3AVMA 2YV0X 3L2VA 2D0AA 1YTAA 1NKCA 3V9UA 1RDAA 4OKKA 4TSXA 1J54A 1IO2A 3V9SA 3WNEA 1ZBIA 4O0JA 4CJEA 3RMAA 4KHQA 2YHAA 4C8MA 5E41A 1LW2A 2PZSA 3AO2A 3VQQA 2KZMA 4Z4IA 2Z1HA 3CFPA 1JLGA 4E7LA 4F2SA 3MECA 4DG1A 5CZ2A 4KPYA 4OPJA 4O55A 1TKZA 2DY4A 3ZSQA 4M3RA 3HO1A 3QNNA 4FJGA 1SV5A 3SUQA 3SNNA 1X9MA 3PX6A 1XWLA 3RR8A 3SQ0A 4RW7A 4OLAA 1HJRA 3KLHA 3ZSVA 3P1GA 5I3UA 4EZ9A 3OS1A 4AH9A 4KAZA 3OJUA 1A5XA 1Z26A 1U48A 3MEDA 4DQQA 1ZBFA 4FM0A 2G8VA 3HSTB 3OYBA 3SQ4A 4IG0A 4FLVA 2ZQBA 4CEDA 1TK0A 1Q8IA 3AVBA 3LZJA 4M3ZA 4IBNA 3NBPA 4FLWA 3V81A 3THVA 2VWJA 3V6DA 2B5JA 4FJHA 1NK9A 4BDZA 3DRPA 4FJMA 1LWFA 4LD0A 4KTWA 4F2RA 1QSYA 1VSDA 1WLJA 5JS1A 2X78A 3SV3A 4O0IA 4HUEA 1J53A 2OPRA 5FDLA 1GOBA 3T3FA 1D9FA 4B9UA 2DFHA 1WN7A 4CEAA 4W5TA 3VQEA 1RBSA 4CGFA 1TAUA 4CJVA 2G8UA 4KHWA 2EHGA 3ZSZA 1C0TA 4C8LA 2P51A 1TKXA 1UA1A 3QINA 3CM6A 1C6VA 3HP9A 3DOKA 4HCCA 4CJRA 3HVRA 4BE0A 2HB5A 3LP0A 4DTJA 1D8YA 1BISA 3I0RA 3AO5A 3CG7A 3NE6A 2XY5A 1NK5A 1DTTA 4FYDA 1EKEA 2F8SA 1TGOA 1BIZA 3NGYA 4CGIA 1SKWA 3M8RA 2VG6A 3HPHA 3G10A 3AA2A 3DM2A 4I2QA 3T19A 1U4BA 2BE2A 4CHQA 1TK8A 3IRXA 3NH2A 3KLGA 5C24A 4OJRA 1NKEA 3DRSA 1IH7A 3DLEA 3IS9A 2B4JA 4CFDA 4BDPA 1S6PA 3LPTA 3HXMA 1J5OA 4DSLA 1VSKA 4B9SA 1JLEA 1RTHA 4G1QA 4CGDA 3E01A 4PUOA 4CF1A 2ZE2A 3LALA 2Q3SA 3TARA 1VSJA 4J2BA 4CGJA 1HPZA 4UQGA 1HYVA 1KVBA 4NCGA 4LSNA 1G15A 2FBTA 1NKBA 4DTNA 3AA3A 4QAGA 1BGXT 5HBMA 1SL1A 1RDCA 1S5JA 1VSEA 3K57A 3ITHA 3RMBA 4FJKA 3OYHA 1SL0A 1VSIA 3TAEA 1RT7A 1RBUA 2RN2A 4KHNA 1KVCA 4PWDA 4N41A 4CEEA 4R5PA 3NDKA 3NGZA 5HROA 1IKYA 3MEEA 3G0ZA 1T7PA 1GOCA 1RBRA 4DFJA 3S3NA 1TL3A 4F3OA 3LWMA 3LZIA 3QNOA 4BWJA 3AV9A 3KLEA 4Z4HA 5KTQA 3LPUA 1S9GA 5T7BA 1KVAA 1RILA 3RRGA 4DS4A 5FROA 4RW8A 1C0MA 1CZ9A 1JL1A 2VG7A 1S9EA 4N47A 4E19A 4Q5VA 3KK2A 4KTZA 4FM1A 3OYEA 4DFMA 3SJJA 4B08A 4B3OA 3OYKA 2FBYA 4FLYA 4NYNA 2G8IA 3NFAA 4HUGA 1IG9A 1S1WA 3MXJA 3V9WA 3OYGA 4C8NA 2Z1IA 3VA0A 3P83D 3ULDA 3ZSXA 4CJQA 4FLUA 4DQRA 3M8PA 3I8DA 4DU3A 3SCXA 4EZ6A 2HHXA 1MU2A 5JS2A 1IKXA 1S1XA 2BGGA 4CIGA 3L3UA 3OYNA 4RW6A 3OYDA 4E1NA 5J1EA 4J2AA 2HHQA 2O4GA 1GOAA 3SUOA 5I42A 2Z1GA 2DFFA 3QIOA 3K5LA 3ASMA 4AHVA 3VQCA 3O3FA 2HVHA 1RT6A 2YNGA 3WNFA 3LANA 2OPQA 2HVIA 1HYZA 4CF2A 4HUFA 5J2PA 1TV6A 3VQ9A 4CJFA 4DSEA 5C42A 4ELVA 3OYCA 1NJXA 1NK0A 3ZSOA 4DQPA 4CIFA 4OVLA 4M3TA 4KRFA 1JLAA 3VQDA 2R7YA 1RNHA 2A1RA 3VQ7A 5EU7A 4DWIA 3VQ4A 3DI6A 5KGXA 2XHBA 4Y1DA 2XY6A 1KFSA 1LAVA 4B9TA 4E0DA 4K8XA 3ZT3A 2LSNA 3NF8A 3M8SA 3NF9A 2X74A 3NF7A 4PA1A 3EYZA 3LAKA 3AVFA 4Q0BA 4DF8A 2QK9A 1TK5A 4E3SA 3TAMA 4JLHA 3HM9A 1VRTA 3KKRA 1BIUA 4NCAA 2KFZA 1FKPA 3B6OA 4LH5A 1JLCA 3NGIA 4LSLA 4BDYA 4CHYA 2G8HA 1UOCA 4O44A 4ID5A 1WNSA 4DLEA 1U04A 2ATQA 4DFKA 3V1RA 2ZD1A 3ZT1A 4BE2A 4RW4A 3OY9A 4FZZA 1NJYA 4ZTFA 4FK2A 3VQPA 1XC9A 5FRMA 5KRTA 3NAEA 4GW6A 3QERA 1VSMA 4DQIA 1RTDA 2QKKA 4W5NA 4CEFA 3VA3A 3KK1A 4I9QA 2DTUA 3LAMA 3DYAA 4M3XA 1XHXA 4YFUA 3K5NA 3AA4A 2YKMA 2D0BA 4CFCA 4CFAA 1N6QA 1L3TA 4DU4A 5HLFA 3HJFA 1KLMA 2O4IA 2P1JA 3TR8A 3OJSA 1ZBLA 2B6AA 4N56A 4FLXA 4DSKA 4FJXA 2JGUA 4FJ5A 2HW3A 4DFPA 1HMVA 3RR7A 1JKHA 3UIQA 4KHSA 2IC3A 1TVRA 3AO4A 5KI6A 1QS4A 1DTQA 1BL3A 1RBTA 3KKSA 3ZT2A 5DMRA 1KSPA 1U45A 2RPIA 4FJIA 5HRPA 4DSIA 1IKWA 3KIOA 1S1UA 1I39A 1B9FA 5KRSA 3AO1A 4CERA 3DRRA 3PO4A 4FW2A 1CZBA 1WSFA 4PY5A 3CQ8A 3QO9A 1QE1A 1X9SA 1CLQA 3AVGA 4HCBA 2GUIA 1FK9A 4E7IA 2OA8A 4N76A 4CIEA 2XY7A 3OYFA 4CHNA 4M45A 4ELUA 4FZXC 4KTQA 2XY8A 2E6LA 3MAQA 1ZYQA 4NYFA 1ASUA 1O1WA 2XRIA 1BI4B 2P5GA 2YNHA 1REVA 1RT2A 4DTMA 3U6FA 2DFEA 1YTUA 3HPOA 1A5VA 1D5AA 5J2NA 3SUNA 4CJTA 2PY5A 4FZYA 4KB1A 1RT1A 3CFRA 1RCHA 1W0HA 3EZ5A 3V1QA 3SPYA 3C6TA 3IG1A 4FJNA 1TKTA 2F96A 1TAQA 1VSFA 4IKFA 2OZSA 4FK4A 1QSSA 2HNDA 2ITGA 3D45A 4O4GA 1EETA 2EX3A 4DS5A 4NCBA 1QTMA 1EX4A 4I2PA 3MXIA 1NJWA 4AHSA 4EP4A 4JS5A 4AILC 2OYQA 3T1AA 3VQBA 4J2DA 2NUBA 4BWMA 1YVUA 3AVCA 4JS4A 3TI0A 2IDOA 2GBZA 4FM2A 1T05A 4CK1A 1KRPA 3L2UA 1UWBA 2OZMA 4CECA 1WAFA 4B9VA 3I0SA 3DLGA 3VQAA 3OS2A 5DK5A 3OYJA 4OLBA 3AVNA 1JLBA 4BE1A 3RWUA 4DU1A 3KLFA 1YT3A 3ZSRA 4B8AB 4FLZA 4HTUA 1WAJA 3SQ1A 3K5OA 3HYFA 1KTQA 4IG3A 4ICLA 1WSJA 3U3GA 4JRPA 4DLGA 4DSJA 1X9WA 4CFBA 4CJLA 5HRRA 3SUPA 2KTQA 2JLEA 5KGWA 3DLBA 2ETJA 3KTQA 4M42A 5CY4A 4B9MA 4IFVA 4EP5A 3OYMA 4GVMA 4ELTA 1QHTA 4CK3A 4DTSA 2HHVA 4K8ZA 4CF8A 4F3TA 3P5JA 2IOCA 3VQ6A 3O4QA 4CF0A 3QEPA 2QXFA 3PY8A 3K2PA 1UAXA 4FK0A 3U3YA 4KHYA 1EP4A 5CZ1A 1WSHA 3M8QA 3AVJA 4W5QA 4QCLA 3LP1A 4CJ3A 1NK8A 1JL2A 4ZHRA 1SKSA 4OGEA 5SWMA 1DLOA 3CYMA 3CM5A 5K14A 1BQNA 4DTPA 3TAGA 4I9LA 3L2RA 1L3SA 1LV5A 4CEZA 1RT4A 4CEBA 1LWCA 3QEXA 3PV8A 4PQUA 4MFBA 2VWKA 3SI6A 1WSIA 3ZSWA 3C6UA 4N5SA 4CHZA 3RMCA 2BDPA 1FKOA 1C1BA 4OKJA 4DQSA 1NJZA 3OYAA 1LW0A 3F73A 4FVMA 4E7KA 1J9AA 1L3VA 3HPGA 1KLNA 3TAQA 3WNHA 3QEWA 5D3GA 4M3YA 1JLQA 1BQMA 3PX0A 1D9DA 1X1PA 1CXQA 3RMDA 1S1VA 4H8KA 4KFBA 4KI6A 1TKDA 4RW9A 5J2MA 1A5WA 2IAJA 4W5OA 1ZBUA 4OKEA 1Q9YA 3PX4A 4CJUA 2XO7A 5CYQA 3AVLA 3DOLA 1LWEA 3TAPA 3TANA 4E1MA 4AHTA 2Z1JA 1Z25A 2I5JA 3ALYA 4BACA 3D0PA 4FJLA 1Y97A 2FBXA 3ZSYA 3AVIA 4XIUA 1XHZA 3V1OA 3V4IA 3O4NA 2G8KA 3FFIA 3SV4A 3HVTA 1UA0A 1S1TA 1VK0A 3KLIA 1T8EA 3VQ5A 3LP2A 4JRQA 3QEVA 3RRHA 4J2EA 2VG5A 4RG8A 3ZT4A 1RDDA 2F8TA 4CEQA 1C0UA 2GV9A 3KD1E 3VQ8A 4FXDA 4E7HA 2D0CA 4AHCA 2KW4A 2HHTA 3MEGA 3HT3A 2YHBA 1XI1A 1RTJA 2E4LA 2RKIA 4Z0UA 3L3VA 1W9HA 1NOYA 3HL8A 3OS0A 4ID1A 5SZTA 4FJ7A 3OYLA 4DF4A 1JXEA 2OPSA 4M41A 4CEOA 1C1AA 3DMJA 3F9KA 4ZTJA 2W42A 4Z4EA 3S9HA 1ASWA 4YNQA 4O5BA 1R0AA 4CJ5A 4CE9A 1RBVA 1B9DA 3NH0A 3LDSA 1U49A 2PYLA 3AVHA 3BGRA 2KQ2A 3NH1A 3RTVA 2X6NA 1C1CA 1QSLA 3PO5A 3EY1A 3SPZA 4DTUA 3HP6A 2YKNA 2QKBA 1B92A 1BCOA 3LP3A 2A1SA 2FBVA 3QETA 4Y1CA 4HVJA 3TAFA 3MXMA 3C95A 3V9ZA 4M3UA 3JYTA 3BDPA 1RTIA 1NK7A 1FXXA 3LWLA 5FRNA 2YNIA 1RT3A 5C25A 4CHPA 4CGHA 1SKRA 4CJKA 4FW1A 1VRUA 4KV8A 1ZBHA 2G8FA 1K6YA 4GMJB 4QOZB 2KZZA 1VSHA 4F4KA 2E6MA 3DLHA 4M3WA 4H4MA 1IKVA 1KFDA 4KHUA 1WSGA 4MQ3A 5CYMA 2HHSA 4LY7A 1L5UA 3S3OA 1BCMA 3HK2A 3K5MA 3AA5X 4WE1A 4CHOA 2AJQA 4HHTA 1U47A 1EXQA 4CCHA 4L8RB 4E89A 1JXBA 3H08A 4AHUA 3ISNC 4CJPA 4B9LA 4CF9A 5J2QA 2IS3A 4CJWA 4I7FA 2X6SA 1VSLA 2BANA 4C8KA 4DMNA 3PUFA 2FC0A 3S3MA 4Z4GA 3O3HA 2WOMA 2OPPA 3IAYA 2KFNA 3L2QA 3CFOA 3QEIA 3AVKA 3QIPA 4KO0A 3KD5E 4Z4FA 3AO3A 2D5RA 1HNVA 4OGCA 3ZT0A 3VN5A 5HRSA 1HNIA 3DLKA 3B6PA 2HNZA 2RF2A 1RDBA 2PYJA 1F21A 4DTXA 4B9NA 4OPKA 1NOZA 2HNYA 3QLHA 4CJSA 3V9XA 3OYIA 4IDKA 3K58A 3ZCMA 1CXUA 3SZ2A 1SL2A 4CGGA 3JSMA 1NK6A 3C94A 4KKOA 3A2FA 4F8RA 2G8WA 1SUQA 4FJJA 1ITGA 1BHLA 3NCIA 3TWHA 1TL1A 1NK4A 4KI4A 3OVNA 2HHUA 4KREA 4KB0A 4AHRA 1L3UA 4FJ8A 3L2WA 4FLTA 2YNFA 4FCYA 3NF6A 4B8CA 3KJVA 4DTRA 3SQ2A 2WONA 5HP1A 4IFYA 2P5OA 2Y1JA 1T03A 1N5YA 5HRNA 1Q9XA 1ASVA 1I3AA 4W5RA 1HQUA 1WSEA 4DSFA 3QESA 4Z4CA 4CK2A 4E7JA 1HYSA 2HMIA 2Y1IA 2HHWA 1QQCA 4CESA 3K59A 3SYZA 3TABA 3WNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4O A;  1HQE A;  1HRH A;  3AVA A;  1S6Q A;  3L8B A;  4DTO A;  1KCF A;  1BI4 A;  3O3G A;  1LAW A;  4CJ4 A;  3KK3 A;  4FJ9 A;  2IGI A;  4LH4 A;  4C8O A;  1RT5 A;  3DLR A;  3NHG A;  1JLF A;  3AVM A;  2YV0 X;  3L2V A;  2D0A A;  1YTA A;  1NKC A;  3V9U A;  1RDA A;  4OKK A;  4TSX A;  1J54 A;  1IO2 A;  3V9S A;  3WNE A;  1ZBI A;  4O0J A;  4CJE A;  3RMA A;  4KHQ A;  2YHA A;  4C8M A;  5E41 A;  1LW2 A;  2PZS A;  3AO2 A;  3VQQ A;  2KZM A;  4Z4I A;  2Z1H A;  3CFP A;  1JLG A;  4E7L A;  4F2S A;  3MEC A;  4DG1 A;  5CZ2 A;  4KPY A;  4OPJ A;  4O55 A;  1TKZ A;  2DY4 A;  3ZSQ A;  4M3R A;  3HO1 A;  3QNN A;  4FJG A;  1SV5 A;  3SUQ A;  3SNN A;  1X9M A;  3PX6 A;  1XWL A;  3RR8 A;  3SQ0 A;  4RW7 A;  4OLA A;  1HJR A;  3KLH A;  3ZSV A;  3P1G A;  5I3U A;  4EZ9 A;  3OS1 A;  4AH9 A;  4KAZ A;  3OJU A;  1A5X A;  1Z26 A;  1U48 A;  3MED A;  4DQQ A;  1ZBF A;  4FM0 A;  2G8V A;  3HST B;  3OYB A;  3SQ4 A;  4IG0 A;  4FLV A;  2ZQB A;  4CED A;  1TK0 A;  1Q8I A;  3AVB A;  3LZJ A;  4M3Z A;  4IBN A;  3NBP A;  4FLW A;  3V81 A;  3THV A;  2VWJ A;  3V6D A;  2B5J A;  4FJH A;  1NK9 A;  4BDZ A;  3DRP A;  4FJM A;  1LWF A;  4LD0 A;  4KTW A;  4F2R A;  1QSY A;  1VSD A;  1WLJ A;  5JS1 A;  2X78 A;  3SV3 A;  4O0I A;  4HUE A;  1J53 A;  2OPR A;  5FDL A;  1GOB A;  3T3F A;  1D9F A;  4B9U A;  2DFH A;  1WN7 A;  4CEA A;  4W5T A;  3VQE A;  1RBS A;  4CGF A;  1TAU A;  4CJV A;  2G8U A;  4KHW A;  2EHG A;  3ZSZ A;  1C0T A;  4C8L A;  2P51 A;  1TKX A;  1UA1 A;  3QIN A;  3CM6 A;  1C6V A;  3HP9 A;  3DOK A;  4HCC A;  4CJR A;  3HVR A;  4BE0 A;  2HB5 A;  3LP0 A;  4DTJ A;  1D8Y A;  1BIS A;  3I0R A;  3AO5 A;  3CG7 A;  3NE6 A;  2XY5 A;  1NK5 A;  1DTT A;  4FYD A;  1EKE A;  2F8S A;  1TGO A;  1BIZ A;  3NGY A;  4CGI A;  1SKW A;  3M8R A;  2VG6 A;  3HPH A;  3G10 A;  3AA2 A;  3DM2 A;  4I2Q A;  3T19 A;  1U4B A;  2BE2 A;  4CHQ A;  1TK8 A;  3IRX A;  3NH2 A;  3KLG A;  5C24 A;  4OJR A;  1NKE A;  3DRS A;  1IH7 A;  3DLE A;  3IS9 A;  2B4J A;  4CFD A;  4BDP A;  1S6P A;  3LPT A;  3HXM A;  1J5O A;  4DSL A;  1VSK A;  4B9S A;  1JLE A;  1RTH A;  4G1Q A;  4CGD A;  3E01 A;  4PUO A;  4CF1 A;  2ZE2 A;  3LAL A;  2Q3S A;  3TAR A;  1VSJ A;  4J2B A;  4CGJ A;  1HPZ A;  4UQG A;  1HYV A;  1KVB A;  4NCG A;  4LSN A;  1G15 A;  2FBT A;  1NKB A;  4DTN A;  3AA3 A;  4QAG A;  1BGX T;  5HBM A;  1SL1 A;  1RDC A;  1S5J A;  1VSE A;  3K57 A;  3ITH A;  3RMB A;  4FJK A;  3OYH A;  1SL0 A;  1VSI A;  3TAE A;  1RT7 A;  1RBU A;  2RN2 A;  4KHN A;  1KVC A;  4PWD A;  4N41 A;  4CEE A;  4R5P A;  3NDK A;  3NGZ A;  5HRO A;  1IKY A;  3MEE A;  3G0Z A;  1T7P A;  1GOC A;  1RBR A;  4DFJ A;  3S3N A;  1TL3 A;  4F3O A;  3LWM A;  3LZI A;  3QNO A;  4BWJ A;  3AV9 A;  3KLE A;  4Z4H A;  5KTQ A;  3LPU A;  1S9G A;  5T7B A;  1KVA A;  1RIL A;  3RRG A;  4DS4 A;  5FRO A;  4RW8 A;  1C0M A;  1CZ9 A;  1JL1 A;  2VG7 A;  1S9E A;  4N47 A;  4E19 A;  4Q5V A;  3KK2 A;  4KTZ A;  4FM1 A;  3OYE A;  4DFM A;  3SJJ A;  4B08 A;  4B3O A;  3OYK A;  2FBY A;  4FLY A;  4NYN A;  2G8I A;  3NFA A;  4HUG A;  1IG9 A;  1S1W A;  3MXJ A;  3V9W A;  3OYG A;  4C8N A;  2Z1I A;  3VA0 A;  3P83 D;  3ULD A;  3ZSX A;  4CJQ A;  4FLU A;  4DQR A;  3M8P A;  3I8D A;  4DU3 A;  3SCX A;  4EZ6 A;  2HHX A;  1MU2 A;  5JS2 A;  1IKX A;  1S1X A;  2BGG A;  4CIG A;  3L3U A;  3OYN A;  4RW6 A;  3OYD A;  4E1N A;  5J1E A;  4J2A A;  2HHQ A;  2O4G A;  1GOA A;  3SUO A;  5I42 A;  2Z1G A;  2DFF A;  3QIO A;  3K5L A;  3ASM A;  4AHV A;  3VQC A;  3O3F A;  2HVH A;  1RT6 A;  2YNG A;  3WNF A;  3LAN A;  2OPQ A;  2HVI A;  1HYZ A;  4CF2 A;  4HUF A;  5J2P A;  1TV6 A;  3VQ9 A;  4CJF A;  4DSE A;  5C42 A;  4ELV A;  3OYC A;  1NJX A;  1NK0 A;  3ZSO A;  4DQP A;  4CIF A;  4OVL A;  4M3T A;  4KRF A;  1JLA A;  3VQD A;  2R7Y A;  1RNH A;  2A1R A;  3VQ7 A;  5EU7 A;  4DWI A;  3VQ4 A;  3DI6 A;  5KGX A;  2XHB A;  4Y1D A;  2XY6 A;  1KFS A;  1LAV A;  4B9T A;  4E0D A;  4K8X A;  3ZT3 A;  2LSN A;  3NF8 A;  3M8S A;  3NF9 A;  2X74 A;  3NF7 A;  4PA1 A;  3EYZ A;  3LAK A;  3AVF A;  4Q0B A;  4DF8 A;  2QK9 A;  1TK5 A;  4E3S A;  3TAM A;  4JLH A;  3HM9 A;  1VRT A;  3KKR A;  1BIU A;  4NCA A;  2KFZ A;  1FKP A;  3B6O A;  4LH5 A;  1JLC A;  3NGI A;  4LSL A;  4BDY A;  4CHY A;  2G8H A;  1UOC A;  4O44 A;  4ID5 A;  1WNS A;  4DLE A;  1U04 A;  2ATQ A;  4DFK A;  3V1R A;  2ZD1 A;  3ZT1 A;  4BE2 A;  4RW4 A;  3OY9 A;  4FZZ A;  1NJY A;  4ZTF A;  4FK2 A;  3VQP A;  1XC9 A;  5FRM A;  5KRT A;  3NAE A;  4GW6 A;  3QER A;  1VSM A;  4DQI A;  1RTD A;  2QKK A;  4W5N A;  4CEF A;  3VA3 A;  3KK1 A;  4I9Q A;  2DTU A;  3LAM A;  3DYA A;  4M3X A;  1XHX A;  4YFU A;  3K5N A;  3AA4 A;  2YKM A;  2D0B A;  4CFC A;  4CFA A;  1N6Q A;  1L3T A;  4DU4 A;  5HLF A;  3HJF A;  1KLM A;  2O4I A;  2P1J A;  3TR8 A;  3OJS A;  1ZBL A;  2B6A A;  4N56 A;  4FLX A;  4DSK A;  4FJX A;  2JGU A;  4FJ5 A;  2HW3 A;  4DFP A;  1HMV A;  3RR7 A;  1JKH A;  3UIQ A;  4KHS A;  2IC3 A;  1TVR A;  3AO4 A;  5KI6 A;  1QS4 A;  1DTQ A;  1BL3 A;  1RBT A;  3KKS A;  3ZT2 A;  5DMR A;  1KSP A;  1U45 A;  2RPI A;  4FJI A;  5HRP A;  4DSI A;  1IKW A;  3KIO A;  1S1U A;  1I39 A;  1B9F A;  5KRS A;  3AO1 A;  4CER A;  3DRR A;  3PO4 A;  4FW2 A;  1CZB A;  1WSF A;  4PY5 A;  3CQ8 A;  3QO9 A;  1QE1 A;  1X9S A;  1CLQ A;  3AVG A;  4HCB A;  2GUI A;  1FK9 A;  4E7I A;  2OA8 A;  4N76 A;  4CIE A;  2XY7 A;  3OYF A;  4CHN A;  4M45 A;  4ELU A;  4FZX C;  4KTQ A;  2XY8 A;  2E6L A;  3MAQ A;  1ZYQ A;  4NYF A;  1ASU A;  1O1W A;  2XRI A;  1BI4 B;  2P5G A;  2YNH A;  1REV A;  1RT2 A;  4DTM A;  3U6F A;  2DFE A;  1YTU A;  3HPO A;  1A5V A;  1D5A A;  5J2N A;  3SUN A;  4CJT A;  2PY5 A;  4FZY A;  4KB1 A;  1RT1 A;  3CFR A;  1RCH A;  1W0H A;  3EZ5 A;  3V1Q A;  3SPY A;  3C6T A;  3IG1 A;  4FJN A;  1TKT A;  2F96 A;  1TAQ A;  1VSF A;  4IKF A;  2OZS A;  4FK4 A;  1QSS A;  2HND A;  2ITG A;  3D45 A;  4O4G A;  1EET A;  2EX3 A;  4DS5 A;  4NCB A;  1QTM A;  1EX4 A;  4I2P A;  3MXI A;  1NJW A;  4AHS A;  4EP4 A;  4JS5 A;  4AIL C;  2OYQ A;  3T1A A;  3VQB A;  4J2D A;  2NUB A;  4BWM A;  1YVU A;  3AVC A;  4JS4 A;  3TI0 A;  2IDO A;  2GBZ A;  4FM2 A;  1T05 A;  4CK1 A;  1KRP A;  3L2U A;  1UWB A;  2OZM A;  4CEC A;  1WAF A;  4B9V A;  3I0S A;  3DLG A;  3VQA A;  3OS2 A;  5DK5 A;  3OYJ A;  4OLB A;  3AVN A;  1JLB A;  4BE1 A;  3RWU A;  4DU1 A;  3KLF A;  1YT3 A;  3ZSR A;  4B8A B;  4FLZ A;  4HTU A;  1WAJ A;  3SQ1 A;  3K5O A;  3HYF A;  1KTQ A;  4IG3 A;  4ICL A;  1WSJ A;  3U3G A;  4JRP A;  4DLG A;  4DSJ A;  1X9W A;  4CFB A;  4CJL A;  5HRR A;  3SUP A;  2KTQ A;  2JLE A;  5KGW A;  3DLB A;  2ETJ A;  3KTQ A;  4M42 A;  5CY4 A;  4B9M A;  4IFV A;  4EP5 A;  3OYM A;  4GVM A;  4ELT A;  1QHT A;  4CK3 A;  4DTS A;  2HHV A;  4K8Z A;  4CF8 A;  4F3T A;  3P5J A;  2IOC A;  3VQ6 A;  3O4Q A;  4CF0 A;  3QEP A;  2QXF A;  3PY8 A;  3K2P A;  1UAX A;  4FK0 A;  3U3Y A;  4KHY A;  1EP4 A;  5CZ1 A;  1WSH A;  3M8Q A;  3AVJ A;  4W5Q A;  4QCL A;  3LP1 A;  4CJ3 A;  1NK8 A;  1JL2 A;  4ZHR A;  1SKS A;  4OGE A;  5SWM A;  1DLO A;  3CYM A;  3CM5 A;  5K14 A;  1BQN A;  4DTP A;  3TAG A;  4I9L A;  3L2R A;  1L3S A;  1LV5 A;  4CEZ A;  1RT4 A;  4CEB A;  1LWC A;  3QEX A;  3PV8 A;  4PQU A;  4MFB A;  2VWK A;  3SI6 A;  1WSI A;  3ZSW A;  3C6U A;  4N5S A;  4CHZ A;  3RMC A;  2BDP A;  1FKO A;  1C1B A;  4OKJ A;  4DQS A;  1NJZ A;  3OYA A;  1LW0 A;  3F73 A;  4FVM A;  4E7K A;  1J9A A;  1L3V A;  3HPG A;  1KLN A;  3TAQ A;  3WNH A;  3QEW A;  5D3G A;  4M3Y A;  1JLQ A;  1BQM A;  3PX0 A;  1D9D A;  1X1P A;  1CXQ A;  3RMD A;  1S1V A;  4H8K A;  4KFB A;  4KI6 A;  1TKD A;  4RW9 A;  5J2M A;  1A5W A;  2IAJ A;  4W5O A;  1ZBU A;  4OKE A;  1Q9Y A;  3PX4 A;  4CJU A;  2XO7 A;  5CYQ A;  3AVL A;  3DOL A;  1LWE A;  3TAP A;  3TAN A;  4E1M A;  4AHT A;  2Z1J A;  1Z25 A;  2I5J A;  3ALY A;  4BAC A;  3D0P A;  4FJL A;  1Y97 A;  2FBX A;  3ZSY A;  3AVI A;  4XIU A;  1XHZ A;  3V1O A;  3V4I A;  3O4N A;  2G8K A;  3FFI A;  3SV4 A;  3HVT A;  1UA0 A;  1S1T A;  1VK0 A;  3KLI A;  1T8E A;  3VQ5 A;  3LP2 A;  4JRQ A;  3QEV A;  3RRH A;  4J2E A;  2VG5 A;  4RG8 A;  3ZT4 A;  1RDD A;  2F8T A;  4CEQ A;  1C0U A;  2GV9 A;  3KD1 E;  3VQ8 A;  4FXD A;  4E7H A;  2D0C A;  4AHC A;  2KW4 A;  2HHT A;  3MEG A;  3HT3 A;  2YHB A;  1XI1 A;  1RTJ A;  2E4L A;  2RKI A;  4Z0U A;  3L3V A;  1W9H A;  1NOY A;  3HL8 A;  3OS0 A;  4ID1 A;  5SZT A;  4FJ7 A;  3OYL A;  4DF4 A;  1JXE A;  2OPS A;  4M41 A;  4CEO A;  1C1A A;  3DMJ A;  3F9K A;  4ZTJ A;  2W42 A;  4Z4E A;  3S9H A;  1ASW A;  4YNQ A;  4O5B A;  1R0A A;  4CJ5 A;  4CE9 A;  1RBV A;  1B9D A;  3NH0 A;  3LDS A;  1U49 A;  2PYL A;  3AVH A;  3BGR A;  2KQ2 A;  3NH1 A;  3RTV A;  2X6N A;  1C1C A;  1QSL A;  3PO5 A;  3EY1 A;  3SPZ A;  4DTU A;  3HP6 A;  2YKN A;  2QKB A;  1B92 A;  1BCO A;  3LP3 A;  2A1S A;  2FBV A;  3QET A;  4Y1C A;  4HVJ A;  3TAF A;  3MXM A;  3C95 A;  3V9Z A;  4M3U A;  3JYT A;  3BDP A;  1RTI A;  1NK7 A;  1FXX A;  3LWL A;  5FRN A;  2YNI A;  1RT3 A;  5C25 A;  4CHP A;  4CGH A;  1SKR A;  4CJK A;  4FW1 A;  1VRU A;  4KV8 A;  1ZBH A;  2G8F A;  1K6Y A;  4GMJ B;  4QOZ B;  2KZZ A;  1VSH A;  4F4K A;  2E6M A;  3DLH A;  4M3W A;  4H4M A;  1IKV A;  1KFD A;  4KHU A;  1WSG A;  4MQ3 A;  5CYM A;  2HHS A;  4LY7 A;  1L5U A;  3S3O A;  1BCM A;  3HK2 A;  3K5M A;  3AA5 X;  4WE1 A;  4CHO A;  2AJQ A;  4HHT A;  1U47 A;  1EXQ A;  4CCH A;  4L8R B;  4E89 A;  1JXB A;  3H08 A;  4AHU A;  3ISN C;  4CJP A;  4B9L A;  4CF9 A;  5J2Q A;  2IS3 A;  4CJW A;  4I7F A;  2X6S A;  1VSL A;  2BAN A;  4C8K A;  4DMN A;  3PUF A;  2FC0 A;  3S3M A;  4Z4G A;  3O3H A;  2WOM A;  2OPP A;  3IAY A;  2KFN A;  3L2Q A;  3CFO A;  3QEI A;  3AVK A;  3QIP A;  4KO0 A;  3KD5 E;  4Z4F A;  3AO3 A;  2D5R A;  1HNV A;  4OGC A;  3ZT0 A;  3VN5 A;  5HRS A;  1HNI A;  3DLK A;  3B6P A;  2HNZ A;  2RF2 A;  1RDB A;  2PYJ A;  1F21 A;  4DTX A;  4B9N A;  4OPK A;  1NOZ A;  2HNY A;  3QLH A;  4CJS A;  3V9X A;  3OYI A;  4IDK A;  3K58 A;  3ZCM A;  1CXU A;  3SZ2 A;  1SL2 A;  4CGG A;  3JSM A;  1NK6 A;  3C94 A;  4KKO A;  3A2F A;  4F8R A;  2G8W A;  1SUQ A;  4FJJ A;  1ITG A;  1BHL A;  3NCI A;  3TWH A;  1TL1 A;  1NK4 A;  4KI4 A;  3OVN A;  2HHU A;  4KRE A;  4KB0 A;  4AHR A;  1L3U A;  4FJ8 A;  3L2W A;  4FLT A;  2YNF A;  4FCY A;  3NF6 A;  4B8C A;  3KJV A;  4DTR A;  3SQ2 A;  2WON A;  5HP1 A;  4IFY A;  2P5O A;  2Y1J A;  1T03 A;  1N5Y A;  5HRN A;  1Q9X A;  1ASV A;  1I3A A;  4W5R A;  1HQU A;  1WSE A;  4DSF A;  3QES A;  4Z4C A;  4CK2 A;  4E7J A;  1HYS A;  2HMI A;  2Y1I A;  2HHW A;  1QQC A;  4CES A;  3K59 A;  3SYZ A;  3TAB A;  3WNG A; 
#chains in the Genus database with same CATH topology
 3TSU A;  2YHW A;  1S6Q A;  1NMD A;  1LAW A;  3CCM N;  3CD6 N;  3A5L C;  4HTL A;  3L2V A;  1T3V A;  3V9U A;  4OKK A;  3H45 C;  1J54 A;  5GAG P;  4O0J A;  3QBW A;  4CJE A;  3RMA A;  4KHQ A;  2PZS A;  3J8A A;  1JLG A;  4F2S A;  4DG1 A;  3KHY A;  4O55 A;  1TKZ A;  2W6K A;  5C12 A;  5GAD P;  3HO1 A;  3BZK A;  3QNN A;  3JS6 A;  5AQJ A;  4DV1 K;  3SUQ A;  4FWP A;  5AQT A;  3RR8 A;  2W6L A;  3SQ0 A;  1HJR A;  3ZSV A;  2QWO A;  4BRM A;  1N34 K;  2PAV A;  4JKA A;  5I3U A;  1KAX A;  4KAZ A;  3OJU A;  1U2V B;  1U48 A;  4DQQ A;  3HST B;  4IG0 A;  4FLV A;  2ZM6 K;  4Y0W A;  4JKC A;  1TK0 A;  2P9S A;  3NBP A;  4IBN A;  3THV A;  1NK9 A;  2Q0U A;  2QWN A;  2ASO A;  5GIO A;  1RDU A;  3I55 N;  4F2R A;  1QSY A;  1VQP N;  4NO7 A;  2X78 A;  5LMU K;  1TYQ A;  1J53 A;  2BTF A;  4CEA A;  4JI3 K;  4CJV A;  2G8U A;  2EHG A;  4JKH A;  2P51 A;  4JHD B;  5GAH P;  1UA1 A;  4NLB A;  4JKG B;  1YJ9 N;  3CM6 A;  1V4T A;  2GWJ A;  3DOK A;  2W41 A;  1NLV A;  4IO8 A;  3BY5 A;  4H0X B;  1NK5 A;  4EAH D;  5HL7 L;  3M8R A;  3G10 A;  2I7P A;  3T19 A;  5AQW A;  1U4B A;  2BE2 A;  1J6Z A;  4FWK A;  4BR7 A;  1HUX A;  3DLE A;  4IOC L;  2B4J A;  1S6P A;  3LPT A;  3HXM A;  2YJE A;  4CGD A;  3LAL A;  2Q3S A;  4DHY A;  5I9E B;  3S41 A;  4UQG A;  1KVB A;  4LSN A;  3SAH A;  3HI0 A;  4QAG A;  3CCQ N;  3ITH A;  3SK3 A;  3OYH A;  1BOT O;  3TAE A;  3C7N A;  1KVC A;  2O8C B;  3RSE A;  3G0Z A;  3L4Q A;  1VQ8 N;  4F3O A;  1XMQ K;  4LFB K;  1ZXO A;  2P9N B;  4KH5 A;  4Z4H A;  5KTQ A;  1N33 K;  3VGL A;  1C0M A;  1CZ9 A;  1JL1 A;  5AQH A;  1S9E A;  3KK2 A;  1SL0 A;  4KTZ A;  3SJJ A;  3C0B A;  2G8I A;  1IG9 A;  3CXC M;  3I33 A;  2UXD K;  3V9W A;  3ZX3 A;  1EO1 A;  2YHY A;  4EFH A;  3P83 D;  4PL7 A;  4FLU A;  3M8P A;  3I8D A;  3SCX A;  4H5R A;  2D4W A;  3HBT A;  2QA4 N;  1N8R O;  2JWK A;  3MX5 A;  2BGG A;  4H5W A;  3OYD A;  4C1N K;  5J1E A;  2O4G A;  3SUO A;  4K43 A;  4BRA A;  4AHV A;  1WBB A;  4CF2 A;  2YI1 A;  3VQ9 A;  3OYC A;  1NJX A;  1NK0 A;  1IG8 A;  5FPD A;  3WXM B;  4CIF A;  4BQZ A;  2WC9 A;  2R7Y A;  1HKG A;  2EWS A;  3VQ7 A;  1R59 O;  3FGU A;  2XY6 A;  2ZJP L;  4K8X A;  3EYZ A;  4PA1 A;  3HM9 A;  3ULE A;  4DV3 K;  1BIU A;  4NCA A;  1FKP A;  3CHW A;  4CJ7 A;  3A5M C;  5EVZ A;  1K8A O;  4V19 S;  4BE2 A;  3ZX0 A;  4FK2 A;  1KD1 O;  3R1X A;  5KRT A;  5C2D A;  3NAE A;  3ZET B;  2Q0R A;  4ILJ A;  2QKK A;  4JKE A;  2NNW A;  3KK1 A;  4B3T K;  4YFU A;  1VHX A;  4CFC A;  4JI2 K;  1TYQ B;  2P1J A;  1ZBL A;  4N56 A;  4FJ5 A;  4JNE A;  1HNW K;  4BRE A;  1BL3 A;  2F7T A;  1RBT A;  2P9P A;  1Z6R A;  1KSP A;  4H0Y B;  4DSI A;  3ZYY X;  2QM1 A;  3WXL A;  1S1U A;  3PO4 A;  1E3M A;  3QO9 A;  1QE1 A;  1YI2 N;  4E7I A;  2HBJ A;  1LCU A;  4ELU A;  3K9J A;  2XY8 A;  2ZJR L;  1NGA A;  4B1Y B;  2E1Y A;  3QBX A;  1ASU A;  1O1W A;  1MWM A;  1BI4 B;  3MN9 A;  4M7X A;  2D0O A;  1REV A;  3FR0 A;  5GIN A;  3HPO A;  1A5V A;  5J2N A;  4FZY A;  1RCH A;  4DUZ K;  3C6T A;  2IVO A;  4FK4 A;  2OZS A;  4L3Q A;  1IBK K;  1QTM A;  1EX4 A;  3TPQ A;  4EP4 A;  4JS5 A;  4J2D A;  3T1A A;  4LF5 K;  3DXK B;  2NUB A;  3CCS N;  2GBZ A;  4E1J A;  3I0S A;  4B9V A;  3RWU A;  4GV6 A;  3HYF A;  3U3G A;  1VQM N;  4H5V A;  1VQO N;  4CFB A;  1VQ5 N;  2KTQ A;  2ETJ A;  3KTQ A;  4M42 A;  2Q1N A;  3ENO A;  1VQL N;  3OYM A;  1P90 A;  2QEX N;  4JI5 K;  4ELT A;  4DTS A;  4NXN K;  4K8Z A;  4CF8 A;  3QFP A;  3O4Q A;  1QQO A;  4FK0 A;  1NGD A;  3I8B A;  3U3Y A;  1EP4 A;  2ZGY A;  3T1H K;  1WSH A;  3AVJ A;  1WUA A;  1NK8 A;  4DR3 K;  1JL2 A;  5FPN A;  1GLC G;  2V52 B;  5SWM A;  2Q36 A;  1DLO A;  5AQU A;  3CYM A;  1BQN A;  4DTP A;  5BR9 A;  3TAG A;  1D4X A;  3C6H A;  3L2R A;  4YOX A;  3PV8 A;  1L3S A;  2GWK A;  3SI6 A;  1WSI A;  3C6U A;  1FKO A;  3UKR B;  4DR5 K;  3OYA A;  1LW0 A;  1WOQ A;  4FVM A;  1J9A A;  3WEE A;  4E7K A;  3TAQ A;  2QXL A;  3WNH A;  4B1U B;  1D9D A;  1CXQ A;  3T1Y K;  4KFB A;  1Q86 O;  1N36 K;  4Z94 A;  3O9U A;  2IAJ A;  1ZBU A;  4OKE A;  1EWR A;  4B9Q A;  2NZT A;  3LM2 A;  2XO7 A;  3DOL A;  1LWE A;  5AQI A;  4IEI A;  1Z25 A;  5BPN A;  4FJL A;  1Y97 A;  4XIU A;  3A8Y A;  4M7Y A;  5A2Q O;  4A59 A;  3V4I A;  5AQV A;  3SV4 A;  1S1T A;  5EX5 A;  1T8E A;  5AQR A;  3VQ5 A;  1QZ6 A;  4JRQ A;  4BRF A;  3P31 A;  4BGB A;  1RDD A;  3WQU A;  4DV7 K;  1O13 A;  1S22 A;  3J80 O;  3KD1 E;  4E7H A;  5H1S Q;  3HT3 A;  1RTJ A;  4MDA A;  4GKJ K;  4Z0U A;  5KPZ A;  1NBW A;  2NRT A;  3OS0 A;  5SZT A;  3UB5 A;  1YJW N;  2GUP A;  3VER A;  1JXE A;  3F9K A;  3BGR A;  3WXJ A;  3VEO A;  1E4F T;  3RTV A;  4JN4 A;  5AQL A;  1SQK A;  4GV9 A;  4O8U A;  3HP6 A;  2QKB A;  1BCO A;  2FBV A;  2OCE A;  3JYT A;  2DPN A;  5F2R A;  1NK7 A;  2YNI A;  2I7N A;  4RWT A;  4CHP A;  3MCP A;  4MLE A;  1VRU A;  2A6A A;  1VQ9 N;  4BC3 A;  3QML A;  1KAZ A;  2KZZ A;  1VSH A;  2E6M A;  3CC7 N;  1KFD A;  5BRE A;  1WSG A;  4MQ3 A;  3E66 A;  4LY7 A;  5M1F A;  1BCM A;  3K5M A;  4BVO A;  3HRG A;  1YIT N;  3UKU B;  4AHU A;  4CJP A;  3O8M A;  5J2Q A;  1MWK A;  1NMN A;  2X6S A;  4C8K A;  4DMN A;  2WOM A;  3L2Q A;  1NJI O;  4Z4F A;  4CZK A;  2IVP A;  1QZ5 A;  3AO3 A;  2D5R A;  4OGC A;  3VN5 A;  1OH6 A;  3DLK A;  2PYJ A;  1RDB A;  1F21 A;  3GG4 A;  4B9N A;  2HBL A;  3EZW A;  3SZ2 A;  2P9L B;  4JI1 K;  2KHO A;  3I56 N;  4KKO A;  3MX2 A;  1TUY A;  1SUQ A;  2CGK A;  4FJJ A;  2Q31 A;  1NK4 A;  5EXW A;  4LF8 K;  4FJ8 A;  4FLT A;  2YNF A;  4QS8 A;  3L4I A;  1JCG A;  4U67 L;  3CCL N;  2P5O A;  2Y1J A;  3CI5 A;  1YHQ N;  4GKK K;  3C65 A;  4W5R A;  4DSF A;  4E7J A;  1QQC A;  2VWB A;  3OBY A;  3JXU A;  5GAE P;  1KCF A;  1BI4 A;  1WBD A;  3AAR A;  4A57 A;  1RT5 A;  1JLF A;  1YTA A;  3VF2 A;  4TSX A;  4HWI A;  3V9S A;  3WNE A;  4U7B A;  2YHA A;  5E41 A;  1LW2 A;  4AM6 A;  4YHH K;  2Z1H A;  4FOE A;  2O8D A;  4KPY A;  5CZ2 A;  3MK6 A;  1XUP O;  4YOW A;  3SNN A;  3PX6 A;  1XWL A;  3CCJ N;  3OHR A;  4KH6 A;  4RW7 A;  4WF9 L;  2A41 A;  3KK7 A;  2HBK A;  3OW2 M;  2G8V A;  3SQ4 A;  3TSQ A;  3M6G A;  4CED A;  4M3Z A;  3V81 A;  4FJH A;  3H1V X;  3DRP A;  1LWF A;  4BC2 A;  4KH4 A;  2OPR A;  5FDL A;  4DKW A;  3T3F A;  4B9U A;  2DFH A;  4WQ5 C;  1RBS A;  4C8L A;  1C0T A;  3QIN A;  3ULE B;  4JK8 A;  4MDB A;  4CJR A;  1D8Y A;  3I0R A;  3MWP A;  3AO5 A;  3CC4 N;  2XY5 A;  1EKE A;  3GL1 A;  1ZC6 A;  5BRD A;  4A5A A;  2VG6 A;  4WYB A;  3OA9 A;  3AA2 A;  5JVH L;  1RDW X;  3AAP A;  3IRX A;  3VGK A;  3NH2 A;  3KLG A;  1BU6 O;  4OJR A;  2VQE K;  3DRS A;  2UXC K;  4BDP A;  4AF1 A;  1J5O A;  4LC9 B;  3CCE N;  4ILG B;  3E01 A;  4CF1 A;  4PL8 A;  1HYV A;  4NCG A;  4AM7 A;  3WQT A;  1G15 A;  1RGI A;  4OPH A;  4DTN A;  3AA3 A;  1BGX T;  1S5J A;  2O8F A;  3RMB A;  1RT7 A;  4R5P A;  3NDK A;  3NGZ A;  3MEE A;  3TTD A;  5LY3 A;  1RBR A;  4DFJ A;  2P9P B;  3LWM A;  4JYA K;  1YIJ N;  1S9G A;  2IVN A;  5T7B A;  1T44 A;  2VG7 A;  4B3O A;  2F9T A;  3OYK A;  4JKB A;  4HUG A;  1MDU B;  2ZWH A;  2QTD A;  4C8N A;  3TTF A;  2O8C A;  1XQS C;  1NG9 A;  4I6M A;  4EIA A;  3VEZ A;  3THY B;  2HST A;  3ENB A;  1OH8 A;  1S1X A;  4CIG A;  4E1N A;  2Z1G A;  2DFF A;  1T6C A;  3E9O A;  3ASM A;  5M1P A;  1NWK A;  3VQC A;  5KPR A;  2YNG A;  3LAN A;  2HVI A;  3O4W A;  4DR1 K;  5J2P A;  1TV6 A;  4DSE A;  4WFA L;  4DV2 K;  4M3T A;  3VQD A;  3CER A;  4DWI A;  2XHB A;  5ADX A;  3H3O B;  4FOI A;  1VQ7 N;  4E0D A;  2LSN A;  5AQK A;  3NF9 A;  2X74 A;  4FPB A;  4Q0B A;  4NXM K;  4DF8 A;  3TAM A;  4JLH A;  3TTC A;  5AQQ A;  2KFZ A;  3RSE B;  3MN6 A;  2V7Z A;  2G8H A;  4DLE A;  3V1R A;  4OO1 J;  4RW4 A;  3OY9 A;  4ZTF A;  3VEY A;  4BRP A;  1XC9 A;  1J5E K;  1Y64 A;  2WFB A;  1RTD A;  4YDU C;  2DTU A;  4BRQ A;  1GLD G;  1WB9 A;  3O9T A;  1XHX A;  3LL3 A;  1YVN A;  4DR7 K;  3HJF A;  1XC3 A;  4DSK A;  4FJX A;  1ATR A;  1HMV A;  2E2P A;  1QS4 A;  3O1W A;  3K0S A;  4IO9 L;  1Q7Y O;  3DXM B;  3K9K A;  3N4Q A;  4JI4 K;  3SAG A;  2FXU A;  2UYT A;  3TU5 A;  1BUP A;  4CER A;  4PY5 A;  4FW2 A;  1CZB A;  4BG8 A;  2OAN A;  4X65 K;  4DV6 K;  1Q18 A;  4DV4 K;  2YHX A;  1CLQ A;  1DT9 A;  2P9I B;  2YX6 A;  1FK9 A;  3AVG A;  3OYF A;  4FZX C;  2GEL A;  1GLL O;  4NYF A;  2P5G A;  2YNH A;  3CJB A;  2H3G X;  3VTH A;  4JKD A;  3U6F A;  2HBM A;  1D5A A;  1KQS M;  1RT1 A;  5KPT A;  3DJC A;  4LFA K;  3EZ5 A;  4FWQ A;  4FJN A;  2F96 A;  3H3N O;  2ITG A;  4I2P A;  2A5X A;  3H6E A;  3VQB A;  2E2N A;  3AVC A;  3TI0 A;  2IDO A;  4KHP K;  4FM2 A;  1KRP A;  1UWB A;  3W0L A;  1FW6 A;  4CEC A;  1WAF A;  3C7N B;  1NM1 A;  4K42 A;  3AVN A;  2CH6 A;  3U9Z A;  4H5T A;  1YT3 A;  2QWP A;  4HTU A;  2E88 A;  4JV5 K;  4CVN E;  4ICL A;  3BEX A;  1X9W A;  5HRR A;  3SUP A;  4FL9 A;  4C1N I;  5C10 A;  4GVM A;  4IFE A;  2HHH K;  3P38 A;  2HHV A;  4F3T A;  2IOC A;  3VQ6 A;  1VQK N;  3ZEU A;  4CF0 A;  3PY8 A;  4KHY A;  5DM6 L;  3M8Q A;  3NVM A;  4CJ3 A;  4JK7 A;  4ZHR A;  2QWL A;  4J2B A;  1LV5 A;  4OLB A;  4CEZ A;  4IEE A;  4PHT X;  3QEX A;  4B3M K;  4YOY A;  4MFB A;  1K9M O;  4JKG A;  3ZSW A;  4CHZ A;  3RMC A;  1NGI A;  3IFR A;  3U4L A;  3CMA N;  4BR5 A;  1L3V A;  1KLN A;  5D3G A;  4GVE A;  3PX0 A;  1BG3 A;  5J2M A;  1OVY A;  4CJU A;  3PX4 A;  3AVL A;  4E1M A;  4AHT A;  2I5J A;  4CBU A;  1KC8 O;  2QI2 A;  1XHZ A;  3V1O A;  3O4N A;  3FE1 A;  1UA0 A;  3HTV A;  5C15 A;  3QEV A;  2ASP A;  2VG5 A;  1HKC A;  4CEQ A;  3VQ8 A;  4FXD A;  3FLC O;  4JI7 K;  4AHC A;  2KW4 A;  2HHT A;  5BPL A;  1GLA G;  4K0K K;  1YUW A;  4ID1 A;  4FJ7 A;  4C23 A;  2P9K B;  4M41 A;  4CEO A;  5AQO A;  4B1Z A;  2GX9 A;  4YNQ A;  4CE9 A;  1B9D A;  2KQ2 A;  3NH1 A;  2X6N A;  1QSL A;  1NGF A;  3SPZ A;  1NNE A;  2YKN A;  2VYP A;  3QET A;  3MXM A;  1IJJ A;  1HNZ K;  4CGH A;  4CJK A;  5EOY A;  1VQ4 N;  1ZBH A;  5CHI A;  3A5O C;  2G8F A;  4BRO A;  4GMJ B;  4QOZ B;  5AZJ B;  4M3W A;  2E20 A;  3MDQ A;  4ISE A;  1IKV A;  3J7Y P;  3THX A;  3J7A P;  4H0V B;  3S3O A;  2QWM A;  3AA5 X;  4CHO A;  3OTO K;  1T6D A;  1U47 A;  2FF3 B;  3QIC A;  4E89 A;  1VAZ A;  2JWL A;  2GTD A;  2IS3 A;  4CJW A;  4I7F A;  2BAN A;  3D2F B;  3PUF A;  3IAY A;  2KFN A;  3QIP A;  3KD5 E;  4KO0 A;  1RFQ A;  3CPW M;  1HNV A;  4DCH A;  5HOO A;  2RF2 A;  3QB0 A;  4DTX A;  4OPK A;  3G6E N;  3V9X A;  3OYI A;  1HR0 K;  1CXU A;  2D0P A;  2FF6 A;  3SBT A;  4CGG A;  1NK6 A;  3C94 A;  3A2F A;  4F8R A;  3ZET A;  1ITG A;  3TWH A;  1TL1 A;  1X3M A;  4KI4 A;  3CF5 L;  4CZH A;  3G4S N;  3Q7B A;  1L3U A;  3H46 O;  4FCY A;  2PBD A;  3NF6 A;  4DTR A;  4GV3 A;  2WON A;  3O5B A;  4IFY A;  5HRN A;  1Q9X A;  5MLC Q;  3WNG A;  3CJ7 A;  1HQE A;  3L8B A;  5C0Y A;  4CJ4 A;  4LH4 A;  4C8O A;  3DLR A;  1NU0 A;  3NHG A;  3AVM A;  2YV0 X;  2D0A A;  1NKC A;  4BRL A;  1HJO A;  2AP1 A;  4H0P A;  1ZBI A;  4JI0 K;  1C0F A;  2FLO A;  3SJH A;  4CZG A;  5LJW A;  4Z4I A;  4E7L A;  3MEC A;  3ZSQ A;  4M3R A;  4YY3 K;  4FJG A;  1X9M A;  1MA9 B;  4OLA A;  3KLH A;  1X9J A;  3CET A;  3E9L A;  4BRG A;  3UKU A;  4EZ9 A;  3OS1 A;  4AH9 A;  1A5X A;  3MED A;  1ZBF A;  1Q82 O;  5BN9 A;  3OYB A;  4H03 B;  3PSI A;  2UXB K;  4WFN L;  2J4R A;  1SS6 A;  3AVB A;  3G71 N;  3UKR A;  3F9M A;  4FLW A;  3V6D A;  2B5J A;  4BDZ A;  3R8E A;  3E1Y A;  4LD0 A;  1C0G A;  3ID8 A;  1VSD A;  5JS1 A;  4HUE A;  2E5L K;  2RE2 A;  5CE3 A;  3VQE A;  3G25 A;  4KHW A;  4JI8 K;  3TSP A;  1TKX A;  5BN8 A;  3SLC A;  3HVR A;  4BE0 A;  2HB5 A;  1BIS A;  4YOT A;  4FYD A;  4F9O A;  1TGO A;  1BIZ A;  3MN5 A;  4CGI A;  5JMV A;  3HOT A;  4OPA A;  1SKW A;  3N4P A;  3CQY A;  1TK8 A;  5JVG L;  5C24 A;  1NKE A;  1IH7 A;  3UE5 A;  3IS9 A;  4CFD A;  1ILY A;  4DSL A;  4B9S A;  3VES A;  5KQ8 A;  4PUO A;  2ZE2 A;  3TAR A;  4LF4 K;  4CGJ A;  2VCP A;  1IBM K;  3NVK A;  4CZM A;  1YAG A;  2FBT A;  5HBM A;  3LDO A;  4A2A A;  4PWD A;  1ESV A;  3IMX A;  4JHD A;  3D6R A;  4N41 A;  1N32 K;  3D2E B;  5AQY A;  1GOC A;  1TL3 A;  3L6Q A;  3LZI A;  4BWJ A;  3KLE A;  1KVA A;  4CI6 A;  4DS4 A;  3O9Q A;  4RW8 A;  4N47 A;  4FM1 A;  5EY4 A;  4BRN A;  3OYE A;  4DFM A;  4B08 A;  2FBY A;  4FLY A;  4NYN A;  2HF4 A;  3NFA A;  1V4S A;  1YJN N;  4CZJ A;  3MXJ A;  3WEE B;  5JLF A;  3FZM A;  3VA0 A;  3AAQ A;  1U6Z A;  4DQR A;  3LDQ A;  1W97 L;  2HF3 A;  3L3U A;  4J2A A;  1GOA A;  2P9I A;  3QIO A;  5B8H A;  3K5L A;  1RT6 A;  2OPQ A;  3M3Z A;  4CJF A;  5C42 A;  1H1V A;  3DXM A;  2V7Y A;  4ELV A;  3ZSO A;  4DQP A;  5AR0 A;  5ADX H;  5AQP A;  4IJN A;  2F4V K;  1RNH A;  2A1R A;  2ITM A;  3FZK A;  5EU7 A;  3VQ4 A;  5KGX A;  1QQM A;  1LAV A;  4B3S K;  3AVF A;  4E3S A;  3KKR A;  4BC4 A;  4LH5 A;  1JLC A;  5M1O A;  4CHY A;  4O44 A;  1WNS A;  3P4I A;  2ZD1 A;  4JK9 A;  5BR8 K;  1FJG K;  3VQP A;  3QER A;  4GW6 A;  4DQI A;  3VA3 A;  4I9Q A;  3LAM A;  3WT0 A;  2HOE A;  4M63 C;  5E84 A;  4FWR A;  4M3X A;  4XH1 A;  1BDG A;  1Z05 A;  3K5N A;  2O8B A;  3J7Z O;  2YKM A;  2D0B A;  1N6Q A;  4IOX A;  1L3T A;  4DU4 A;  4X64 K;  3PLA A;  1YXQ A;  1KLM A;  5FPM A;  3TR8 A;  2B6A A;  4FLX A;  2UUB K;  4DFP A;  2E8A A;  1JKH A;  4KHS A;  2IC3 A;  1TVR A;  5KI6 A;  5AFU A;  3ZT2 A;  5DMR A;  1U45 A;  4FJI A;  4BRH A;  5HRP A;  4CD1 A;  1BA1 A;  1U2V A;  5C2F A;  5KRS A;  2HMP A;  1WSF A;  3ENH A;  5AFU H;  3CQ8 A;  5AQZ A;  4FWL A;  4HCB A;  4N76 A;  1VQ6 N;  2OA8 A;  5E26 A;  2XY7 A;  5IWA K;  4DR6 K;  4M45 A;  1NGH A;  4KTQ A;  3KWI A;  4X62 K;  2NRW A;  3O9S A;  4XH4 A;  4ISG A;  4B1W B;  1RT2 A;  2DFE A;  2O8B B;  4KB1 A;  2PY5 A;  1ATN A;  1W0H A;  1KXP A;  3V1Q A;  1TAQ A;  1VSF A;  3PIP L;  4IKF A;  1W7A A;  2HND A;  3D45 A;  1G99 A;  3QFU A;  1DEJ A;  4DS5 A;  1IBL K;  4AIL C;  3BP8 A;  2CGJ A;  2OYQ A;  3THW B;  3BZC A;  4CK1 A;  3L2U A;  3EKS A;  3DLG A;  3VQA A;  3OS2 A;  5DK5 A;  5JIC A;  1JLB A;  4BE1 A;  3EE8 A;  4DU1 A;  3KLF A;  4B8A B;  3ZSR A;  3O9R A;  4FLZ A;  4KBO A;  3CJA A;  1WAJ A;  3HSC A;  3SQ1 A;  4M3Y A;  1WSJ A;  3P39 A;  4WCE L;  3M5R A;  2FSJ A;  5AQM A;  2JLE A;  2ZGZ A;  3KVG A;  3IUC A;  3VEW A;  3EO3 A;  2WTU A;  4EP5 A;  3W3D A;  3P5J A;  3QEP A;  3T69 A;  4PKH A;  4QCL A;  3VOV A;  1EWQ A;  3LP1 A;  1HPM A;  3WXK A;  4OGE A;  3CM5 A;  4G9Z A;  5K14 A;  3J81 O;  4I9L A;  4CEB A;  2RHK A;  4DQ8 A;  4N5S A;  2BDP A;  2P9L A;  4DQS A;  1NJZ A;  3F73 A;  2KLA A;  3HPG A;  4BY9 C;  4EHT A;  2E2Q A;  3QDK A;  3QEW A;  1JLQ A;  1X1P A;  3RMD A;  4H8K A;  1TKD A;  4RW9 A;  1A5W A;  4W5O A;  1Q9Y A;  4OX9 K;  4H0O A;  3MN7 A;  5CYQ A;  2FSN A;  2W40 A;  4BAC A;  2WBN A;  5AQG A;  3ZSY A;  3AVI A;  3JAM O;  1YF5 L;  4BRD A;  2G8K A;  2NRH A;  3HVT A;  4CD3 A;  1NGE A;  1VK0 A;  3CCV N;  4JI6 K;  3RRH A;  4J2E A;  3ZT4 A;  3VPZ A;  3EEQ A;  2F8T A;  3LDL A;  2VGN A;  5GIP A;  2GV9 A;  4QS9 A;  4LFC K;  2D0C A;  2KKZ A;  3MEG A;  1XI1 A;  2E4L A;  1BWF O;  2RKI A;  4DUY K;  5BPM A;  3L3V A;  1NOY A;  3HL8 A;  3D7E O;  5TKW A;  4FWO A;  2OTJ N;  4DF4 A;  3MCA B;  3DMJ A;  4Z4E A;  1ASW A;  2P9K A;  1R0A A;  4CJ5 A;  3NH0 A;  2PYL A;  3VMF B;  3AVH A;  3CIP A;  2FSK A;  3PO5 A;  5ELZ A;  2A1S A;  1NGC A;  4Y1C A;  3VF6 A;  4HVJ A;  3V9Z A;  4M3U A;  1IV0 A;  1TUU A;  2BH1 A;  5FRN A;  1RT3 A;  5C25 A;  1SKR A;  3DWL A;  2Q97 A;  3VF4 A;  4FW1 A;  5AJ3 K;  3MMV A;  4KV8 A;  3PSF A;  1K6Y A;  1JCE A;  2OTL N;  1DGK N;  3DLH A;  2NRX A;  4KHU A;  2HHS A;  3VTI A;  3HK2 A;  4X66 K;  4JD2 B;  5AZI B;  3CJC A;  1EXQ A;  4CCH A;  3ISN C;  4PKI A;  2E1Z A;  4JAX A;  4PKG A;  1JCF A;  2FC0 A;  4FWN A;  5LL6 Z;  3S3M A;  2O8E A;  4Z4G A;  5AQX A;  3QEI A;  4FWM A;  1M1K O;  1HNI A;  2HNZ A;  3B6P A;  3IDH A;  2NRZ A;  3A5N C;  1NOZ A;  2UU9 K;  3CME N;  4CJS A;  1S3X A;  4IDK A;  3K58 A;  5BRF A;  3JSM A;  3U9D A;  4J8F A;  1NGB A;  1OH7 A;  2ZF5 O;  3DXK A;  1BHL A;  4KRE A;  3ZLJ A;  4MO5 A;  4BR0 A;  5M1K A;  1N5Y A;  1ASV A;  1I3A A;  3QES A;  1HQU A;  4Z4C A;  2HMI A;  2Y1I A;  2HHW A;  3K59 A;  3TAB A;  4H4O A;  1HRH A;  3AVA A;  3O1B A;  4DTO A;  1EQY A;  3O3G A;  3F2K A;  3KK3 A;  4FJ9 A;  2IGI A;  5KQD A;  3L0Q A;  1RDA A;  1IO2 A;  3R9P A;  4B1V A;  3VEX A;  1X3N A;  3RVC A;  4C8M A;  4BGA A;  3AO2 A;  3VQQ A;  2KZM A;  4H0T B;  3CFP A;  4OPJ A;  3THW A;  2DY4 A;  1SV5 A;  4BRI A;  1QVF M;  3P1G A;  3VEN A;  4ISF A;  3EKU A;  1Z26 A;  4ILH A;  3WXI A;  2UUA K;  4FM0 A;  2CH5 A;  2ZQB A;  4BQL A;  4K25 A;  1Q8I A;  3LZJ A;  1NGG A;  4IJA A;  1KAY A;  2VWJ A;  4FWS A;  4FJM A;  4KTW A;  1WLJ A;  3SV3 A;  4O0I A;  3AY9 A;  3E9P A;  4EHU A;  1GOB A;  1D9F A;  1WN7 A;  4W5T A;  4CGF A;  1TAU A;  4IWV A;  3ZSZ A;  3O08 A;  1C6V A;  4BVP A;  3HP9 A;  4HCC A;  5FLX O;  3LP0 A;  4DTJ A;  3EN9 A;  3VET A;  4R79 A;  3CG7 A;  3NE6 A;  1DTT A;  1OVQ A;  2F8S A;  3NGY A;  4LF9 K;  3HPH A;  3H1Q A;  3DM2 A;  4I2Q A;  4CHQ A;  2QWQ A;  3FFK B;  5FPE A;  1VSK A;  1JLE A;  1RTH A;  4G1Q A;  3AGK A;  2E2O A;  5CR4 A;  1VSJ A;  2VGM A;  1HPZ A;  4CBW A;  2P9U A;  1XNQ K;  1XNR K;  4YOU A;  1NKB A;  4BG9 A;  1SL1 A;  1RDC A;  1VSE A;  3K57 A;  4FJK A;  1VSI A;  2F9W A;  4KHN A;  1RBU A;  2RN2 A;  1QHA A;  4CEE A;  5IT9 O;  5HRO A;  1IKY A;  1T7P A;  3O80 A;  2QW9 A;  2YJF A;  3S3N A;  3CCR N;  3QNO A;  3AV9 A;  3LPU A;  1RIL A;  3RRG A;  3GE1 A;  5FRO A;  4E19 A;  4Q5V A;  1NJW A;  3SMS A;  4JEP A;  2GEM A;  4A5B A;  1S1W A;  3NMU A;  3LDP A;  4YOV A;  3SMP A;  3OYG A;  3B8A X;  3GDQ A;  2Z1I A;  1ATS A;  3D2E A;  3EE9 A;  3ULD A;  3ZSX A;  4CJQ A;  4DU3 A;  4GY2 B;  4EZ6 A;  2HHX A;  1MU2 A;  5JS2 A;  1IKX A;  3OYN A;  2HHQ A;  4RW6 A;  2A3Z A;  3HOS A;  4BRC A;  5I42 A;  2D1K A;  2VQF K;  3O3F A;  2HVH A;  3WNF A;  1HYZ A;  4HUF A;  2NRV A;  3C6A A;  3BF3 A;  1BO5 O;  4OVL A;  4KRF A;  1JLA A;  3T7Z A;  3R3L A;  1KFS A;  3DI6 A;  4Y1D A;  2AA4 A;  4BR9 A;  4B9T A;  3F5T A;  3DLL L;  3ZT3 A;  3NF8 A;  3M8S A;  3OBW A;  3NF7 A;  3GBT A;  3LAK A;  5AQN A;  1K8K A;  4CW7 B;  4CZE A;  1TK5 A;  2QK9 A;  1VRT A;  4IDH A;  3CJ9 A;  3B6O A;  3NGI A;  4LSL A;  4BDY A;  1UOC A;  3CPE A;  4ID5 A;  3WUH A;  1U04 A;  2ATQ A;  4DFK A;  1HKB A;  3ZT1 A;  4FZZ A;  1NJY A;  4FVU A;  5FRM A;  1VSM A;  4W5N A;  4FSV A;  4XH5 A;  4CEF A;  4LF7 K;  2P9S B;  3DYA A;  3CCU N;  3AA4 A;  4CZI A;  4CFA A;  3BF1 A;  5AQF A;  3CJ1 A;  2A40 A;  5HLF A;  1W2B M;  2O4I A;  1E4G T;  3OJS A;  4CZF A;  2ASM A;  2JGU A;  2HW3 A;  3RR7 A;  1QQN A;  3UIQ A;  3AO4 A;  4WQ4 C;  1DTQ A;  3KKS A;  1DKG D;  4XEI A;  2BUP A;  4O5F A;  2YCH A;  2RPI A;  1IKW A;  3KIO A;  3THY A;  1I39 A;  1B9F A;  4AQY K;  3AO1 A;  3DRR A;  1GLB G;  1X9S A;  2GUI A;  5JLH A;  3SBG A;  5TKY A;  4CIE A;  4CHN A;  4GNI A;  2E6L A;  3MAQ A;  2O8D B;  1GLE G;  1ZYQ A;  2XRI A;  1OH5 A;  1HNX K;  4DTM A;  3EL2 A;  1YTU A;  5F0X A;  3SUN A;  4CJT A;  3CFR A;  3SPY A;  4A2B A;  3LM9 A;  3IG1 A;  1JJ2 M;  1TKT A;  4CZL A;  1QSS A;  1XMO K;  4O4G A;  2NRR A;  1EET A;  2EX3 A;  2P9N A;  2O8F B;  4NCB A;  4DR4 K;  3MXI A;  4AHS A;  4BWM A;  3VGM A;  1YVU A;  4JS4 A;  1K73 O;  1CZA N;  1T05 A;  3Q7C A;  2OZM A;  3OYJ A;  1K8K B;  3A0I X;  3K5O A;  4IG3 A;  1KTQ A;  4JRP A;  4DLG A;  4DSJ A;  3AGR A;  4BRK A;  4YOR A;  4MO4 A;  4CJL A;  5KGW A;  3DAW A;  3DLB A;  5CY4 A;  4B9M A;  4IFV A;  1QHT A;  4CK3 A;  3HM8 A;  3GOI A;  4K41 A;  4WQ4 A;  2QXF A;  3K2P A;  1UAX A;  5CZ1 A;  4W5Q A;  3PIO L;  5M1N A;  4B3R K;  1SKS A;  2O8E B;  4UY8 O;  5LMN K;  3ID6 A;  1RT4 A;  1LWC A;  4PQU A;  3KWG A;  3THX B;  4A62 A;  2VWK A;  4H5N A;  2IIR A;  4I6M B;  4OKJ A;  1C1B A;  3CQX A;  3M1F A;  4BC5 A;  1BQM A;  2ZJQ L;  3MWT A;  1S1V A;  4BR4 A;  4KI6 A;  1GLJ O;  1HLU A;  1LOT B;  3KZB A;  3TAP A;  1OKJ A;  3TAN A;  4YDU A;  2Z1J A;  3ALY A;  3D0P A;  3ATV A;  1ZBS A;  3D2F A;  4JKF A;  2FBX A;  2WUS A;  5DM7 L;  2NLX A;  3FFI A;  3KLI A;  3LP2 A;  3HZ6 A;  4RG8 A;  1C0U A;  2P9U B;  3LDN A;  2YHB A;  4A61 A;  4DR2 K;  1HX1 A;  1W9H A;  1VQN N;  1SAZ A;  3OYL A;  3CC2 N;  2OPS A;  1C1A A;  4ZTJ A;  4QS7 A;  2W42 A;  3S9H A;  4FPA A;  4O5B A;  4B1X B;  4DV5 K;  4DB3 A;  1U49 A;  3LDS A;  1RBV A;  2V51 B;  2UUC K;  1GLF O;  5LJV A;  1C1C A;  4CBX A;  4O8K A;  3EY1 A;  4DTU A;  5AQS A;  4RTF D;  4DV0 K;  1B92 A;  3LP3 A;  1M90 O;  2A42 A;  3TAF A;  3C95 A;  3O6W A;  3BDP A;  1RTI A;  1FXX A;  3LWL A;  3ATU A;  4WFB L;  1NGJ A;  1S72 N;  4FO0 A;  4F4K A;  3U8X A;  4H4M A;  1Q81 O;  5CYM A;  1L5U A;  4BR2 A;  2PFU A;  4WE1 A;  5BRH A;  2AJQ A;  4HHT A;  4L8R B;  1JXB A;  3R6M A;  3H08 A;  4IZ9 A;  4B9L A;  4CF9 A;  4JD2 A;  5AZI A;  1VSL A;  1SZ2 A;  3FZL A;  3O3H A;  2OPP A;  5M1Q A;  3CFO A;  3AVK A;  2CGL A;  3IKM A;  3ZT0 A;  4NLC A;  4MLH A;  5HRS A;  4IOA L;  2QWR A;  4RCH A;  5F1X A;  2HNY A;  3QLH A;  3ZCM A;  4NB4 A;  1SL2 A;  1BA0 A;  2Q2R A;  5AZJ A;  2G8W A;  3NCI A;  3BUZ B;  3OVN A;  3VEV A;  1I94 K;  2HHU A;  4KB0 A;  4WQ5 A;  4AHR A;  3SAF A;  3L2W A;  1QVG M;  4B8C A;  3KJV A;  3ZX2 A;  3SQ2 A;  5HP1 A;  3FZF A;  1T03 A;  4LF6 K;  1WSE A;  3FZH A;  4IXC A;  4CK2 A;  3ZEU B;  1HYS A;  1P8Z A;  4CES A;  3SYZ A; 
#chains in the Genus database with same CATH homology
 4H4O A;  1HQE A;  1HRH A;  3AVA A;  1S6Q A;  3L8B A;  4DTO A;  1KCF A;  1BI4 A;  3O3G A;  1LAW A;  4CJ4 A;  3KK3 A;  4FJ9 A;  2IGI A;  4LH4 A;  4C8O A;  1RT5 A;  3DLR A;  3NHG A;  1JLF A;  3AVM A;  2YV0 X;  3L2V A;  2D0A A;  1YTA A;  1NKC A;  3V9U A;  1RDA A;  4OKK A;  4TSX A;  1J54 A;  1IO2 A;  3V9S A;  3WNE A;  1ZBI A;  4O0J A;  4CJE A;  3RMA A;  4KHQ A;  2YHA A;  4C8M A;  5E41 A;  1LW2 A;  2PZS A;  3AO2 A;  3VQQ A;  2KZM A;  4Z4I A;  2Z1H A;  3CFP A;  1JLG A;  4E7L A;  4F2S A;  3MEC A;  4DG1 A;  5CZ2 A;  4KPY A;  4OPJ A;  4O55 A;  1TKZ A;  2DY4 A;  3ZSQ A;  4M3R A;  3HO1 A;  3QNN A;  4FJG A;  1SV5 A;  3SUQ A;  3SNN A;  1X9M A;  3PX6 A;  1XWL A;  3RR8 A;  3SQ0 A;  4RW7 A;  4OLA A;  1HJR A;  3KLH A;  3ZSV A;  3P1G A;  5I3U A;  4EZ9 A;  3OS1 A;  4AH9 A;  4KAZ A;  3OJU A;  1A5X A;  1Z26 A;  1U48 A;  3MED A;  4DQQ A;  1ZBF A;  4FM0 A;  2G8V A;  3HST B;  3OYB A;  3SQ4 A;  4IG0 A;  4FLV A;  2ZQB A;  4CED A;  1TK0 A;  1Q8I A;  3AVB A;  3LZJ A;  4M3Z A;  4IBN A;  3NBP A;  4FLW A;  3V81 A;  3THV A;  2VWJ A;  3V6D A;  2B5J A;  4FJH A;  1NK9 A;  4BDZ A;  3DRP A;  4FJM A;  1LWF A;  4LD0 A;  4KTW A;  4F2R A;  1QSY A;  1VSD A;  1WLJ A;  5JS1 A;  2X78 A;  3SV3 A;  4O0I A;  4HUE A;  1J53 A;  2OPR A;  5FDL A;  1GOB A;  3T3F A;  1D9F A;  4B9U A;  2DFH A;  1WN7 A;  4CEA A;  4W5T A;  3VQE A;  1RBS A;  4CGF A;  1TAU A;  4CJV A;  2G8U A;  4KHW A;  2EHG A;  3ZSZ A;  1C0T A;  4C8L A;  2P51 A;  1TKX A;  1UA1 A;  3QIN A;  3CM6 A;  1C6V A;  3HP9 A;  3DOK A;  4HCC A;  4CJR A;  3HVR A;  4BE0 A;  2HB5 A;  3LP0 A;  4DTJ A;  1D8Y A;  1BIS A;  3I0R A;  3AO5 A;  3CG7 A;  3NE6 A;  2XY5 A;  1NK5 A;  1DTT A;  4FYD A;  1EKE A;  2F8S A;  1TGO A;  1BIZ A;  3NGY A;  4CGI A;  1SKW A;  3M8R A;  2VG6 A;  3HPH A;  3G10 A;  3AA2 A;  3DM2 A;  4I2Q A;  3T19 A;  1U4B A;  2BE2 A;  4CHQ A;  1TK8 A;  3IRX A;  3NH2 A;  3KLG A;  5C24 A;  4OJR A;  1NKE A;  3DRS A;  1IH7 A;  3DLE A;  3IS9 A;  2B4J A;  4CFD A;  4BDP A;  1S6P A;  3LPT A;  3HXM A;  1J5O A;  4DSL A;  1VSK A;  4B9S A;  1JLE A;  1RTH A;  4G1Q A;  4CGD A;  3E01 A;  4PUO A;  4CF1 A;  2ZE2 A;  3LAL A;  2Q3S A;  3TAR A;  1VSJ A;  4J2B A;  4CGJ A;  1HPZ A;  4UQG A;  1HYV A;  1KVB A;  4NCG A;  4LSN A;  1G15 A;  2FBT A;  1NKB A;  4DTN A;  3AA3 A;  4QAG A;  1BGX T;  5HBM A;  1SL1 A;  1RDC A;  1S5J A;  1VSE A;  3K57 A;  3ITH A;  3RMB A;  4FJK A;  3OYH A;  1SL0 A;  1VSI A;  3TAE A;  1RT7 A;  1RBU A;  2RN2 A;  4KHN A;  1KVC A;  4PWD A;  4N41 A;  4CEE A;  4R5P A;  3NDK A;  3NGZ A;  5HRO A;  1IKY A;  3MEE A;  3G0Z A;  1T7P A;  1GOC A;  1RBR A;  4DFJ A;  3S3N A;  1TL3 A;  4F3O A;  3LWM A;  3LZI A;  3QNO A;  4BWJ A;  3AV9 A;  3KLE A;  4Z4H A;  5KTQ A;  3LPU A;  1S9G A;  5T7B A;  1KVA A;  1RIL A;  3RRG A;  4DS4 A;  5FRO A;  4RW8 A;  1C0M A;  1CZ9 A;  1JL1 A;  2VG7 A;  1S9E A;  4N47 A;  4E19 A;  4Q5V A;  3KK2 A;  4KTZ A;  4FM1 A;  3OYE A;  4DFM A;  3SJJ A;  4B08 A;  4B3O A;  3OYK A;  2FBY A;  4FLY A;  4NYN A;  2G8I A;  3NFA A;  4HUG A;  1IG9 A;  1S1W A;  3MXJ A;  3V9W A;  3OYG A;  4C8N A;  2Z1I A;  3VA0 A;  3P83 D;  3ULD A;  3ZSX A;  4CJQ A;  4FLU A;  4DQR A;  3M8P A;  3I8D A;  4DU3 A;  3SCX A;  4EZ6 A;  2HHX A;  1MU2 A;  5JS2 A;  1IKX A;  1S1X A;  2BGG A;  4CIG A;  3L3U A;  3OYN A;  4RW6 A;  3OYD A;  4E1N A;  5J1E A;  4J2A A;  2HHQ A;  2O4G A;  1GOA A;  3SUO A;  5I42 A;  2Z1G A;  2DFF A;  3QIO A;  3K5L A;  3ASM A;  4AHV A;  3VQC A;  3O3F A;  2HVH A;  1RT6 A;  2YNG A;  3WNF A;  3LAN A;  2OPQ A;  2HVI A;  1HYZ A;  4CF2 A;  4HUF A;  5J2P A;  1TV6 A;  3VQ9 A;  4CJF A;  4DSE A;  5C42 A;  4ELV A;  3OYC A;  1NJX A;  1NK0 A;  3ZSO A;  4DQP A;  4CIF A;  4OVL A;  4M3T A;  4KRF A;  1JLA A;  3VQD A;  2R7Y A;  1RNH A;  2A1R A;  3VQ7 A;  5EU7 A;  4DWI A;  3VQ4 A;  3DI6 A;  5KGX A;  2XHB A;  4Y1D A;  2XY6 A;  1KFS A;  1LAV A;  4B9T A;  4E0D A;  4K8X A;  3ZT3 A;  2LSN A;  3NF8 A;  3M8S A;  3NF9 A;  2X74 A;  3NF7 A;  4PA1 A;  3EYZ A;  3LAK A;  3AVF A;  4Q0B A;  4DF8 A;  2QK9 A;  1TK5 A;  4E3S A;  3TAM A;  4JLH A;  3HM9 A;  1VRT A;  3KKR A;  1BIU A;  4NCA A;  2KFZ A;  1FKP A;  3B6O A;  4LH5 A;  1JLC A;  3NGI A;  4LSL A;  4BDY A;  4CHY A;  2G8H A;  1UOC A;  4O44 A;  4ID5 A;  1WNS A;  4DLE A;  1U04 A;  2ATQ A;  4DFK A;  3V1R A;  2ZD1 A;  3ZT1 A;  4BE2 A;  4RW4 A;  3OY9 A;  4FZZ A;  1NJY A;  4ZTF A;  4FK2 A;  3VQP A;  1XC9 A;  5FRM A;  5KRT A;  3NAE A;  4GW6 A;  3QER A;  1VSM A;  4DQI A;  1RTD A;  2QKK A;  4W5N A;  4CEF A;  3VA3 A;  3KK1 A;  4I9Q A;  2DTU A;  3LAM A;  3DYA A;  4M3X A;  1XHX A;  4YFU A;  3K5N A;  3AA4 A;  2YKM A;  2D0B A;  4CFC A;  4CFA A;  1N6Q A;  1L3T A;  4DU4 A;  5HLF A;  3HJF A;  1KLM A;  2O4I A;  2P1J A;  3TR8 A;  3OJS A;  1ZBL A;  2B6A A;  4N56 A;  4FLX A;  4DSK A;  4FJX A;  2JGU A;  4FJ5 A;  2HW3 A;  4DFP A;  1HMV A;  3RR7 A;  1JKH A;  3UIQ A;  4KHS A;  2IC3 A;  1TVR A;  3AO4 A;  5KI6 A;  1QS4 A;  1DTQ A;  1BL3 A;  1RBT A;  3KKS A;  3ZT2 A;  5DMR A;  1KSP A;  1U45 A;  2RPI A;  4FJI A;  5HRP A;  4DSI A;  1IKW A;  3KIO A;  1S1U A;  1I39 A;  1B9F A;  5KRS A;  3AO1 A;  4CER A;  3DRR A;  3PO4 A;  4FW2 A;  1CZB A;  1WSF A;  4PY5 A;  3CQ8 A;  3QO9 A;  1QE1 A;  1X9S A;  1CLQ A;  3AVG A;  4HCB A;  2GUI A;  1FK9 A;  4E7I A;  2OA8 A;  4N76 A;  4CIE A;  2XY7 A;  3OYF A;  4CHN A;  4M45 A;  4ELU A;  4FZX C;  4KTQ A;  2XY8 A;  2E6L A;  3MAQ A;  1ZYQ A;  4NYF A;  1ASU A;  1O1W A;  2XRI A;  1BI4 B;  2P5G A;  2YNH A;  1REV A;  1RT2 A;  4DTM A;  3U6F A;  2DFE A;  1YTU A;  3HPO A;  1A5V A;  1D5A A;  5J2N A;  3SUN A;  4CJT A;  2PY5 A;  4FZY A;  4KB1 A;  1RT1 A;  3CFR A;  1RCH A;  1W0H A;  3EZ5 A;  3V1Q A;  3SPY A;  3C6T A;  3IG1 A;  4FJN A;  1TKT A;  2F96 A;  1TAQ A;  1VSF A;  4IKF A;  2OZS A;  4FK4 A;  1QSS A;  2HND A;  2ITG A;  3D45 A;  4O4G A;  1EET A;  2EX3 A;  4DS5 A;  4NCB A;  1QTM A;  1EX4 A;  4I2P A;  3MXI A;  1NJW A;  4AHS A;  4EP4 A;  4JS5 A;  4AIL C;  2OYQ A;  3T1A A;  3VQB A;  4J2D A;  2NUB A;  4BWM A;  1YVU A;  3AVC A;  4JS4 A;  3TI0 A;  2IDO A;  2GBZ A;  4FM2 A;  1T05 A;  4CK1 A;  1KRP A;  3L2U A;  1UWB A;  2OZM A;  4CEC A;  1WAF A;  4B9V A;  3I0S A;  3DLG A;  3VQA A;  3OS2 A;  5DK5 A;  3OYJ A;  4OLB A;  3AVN A;  1JLB A;  4BE1 A;  3RWU A;  4DU1 A;  3KLF A;  1YT3 A;  3ZSR A;  4B8A B;  4FLZ A;  4HTU A;  1WAJ A;  3SQ1 A;  3K5O A;  3HYF A;  1KTQ A;  4IG3 A;  4ICL A;  1WSJ A;  3U3G A;  4JRP A;  4DLG A;  4DSJ A;  1X9W A;  4CFB A;  4CJL A;  5HRR A;  3SUP A;  2KTQ A;  2JLE A;  5KGW A;  3DLB A;  2ETJ A;  3KTQ A;  4M42 A;  5CY4 A;  4B9M A;  4IFV A;  4EP5 A;  3OYM A;  4GVM A;  4ELT A;  1QHT A;  4CK3 A;  4DTS A;  2HHV A;  4K8Z A;  4CF8 A;  4F3T A;  3P5J A;  2IOC A;  3VQ6 A;  3O4Q A;  4CF0 A;  3QEP A;  2QXF A;  3PY8 A;  3K2P A;  1UAX A;  4FK0 A;  3U3Y A;  4KHY A;  1EP4 A;  5CZ1 A;  1WSH A;  3M8Q A;  3AVJ A;  4W5Q A;  4QCL A;  3LP1 A;  4CJ3 A;  1NK8 A;  1JL2 A;  4ZHR A;  1SKS A;  4OGE A;  5SWM A;  1DLO A;  3CYM A;  3CM5 A;  5K14 A;  1BQN A;  4DTP A;  3TAG A;  4I9L A;  3L2R A;  1L3S A;  1LV5 A;  4CEZ A;  1RT4 A;  4CEB A;  1LWC A;  3QEX A;  3PV8 A;  4PQU A;  4MFB A;  2VWK A;  3SI6 A;  1WSI A;  3ZSW A;  3C6U A;  4N5S A;  4CHZ A;  3RMC A;  2BDP A;  1FKO A;  1C1B A;  4OKJ A;  4DQS A;  1NJZ A;  3OYA A;  1LW0 A;  3F73 A;  4FVM A;  4E7K A;  1J9A A;  1L3V A;  3HPG A;  1KLN A;  3TAQ A;  3WNH A;  3QEW A;  5D3G A;  4M3Y A;  1JLQ A;  1BQM A;  3PX0 A;  1D9D A;  1X1P A;  1CXQ A;  3RMD A;  1S1V A;  4H8K A;  4KFB A;  4KI6 A;  1TKD A;  4RW9 A;  5J2M A;  1A5W A;  2IAJ A;  4W5O A;  1ZBU A;  4OKE A;  1Q9Y A;  3PX4 A;  4CJU A;  2XO7 A;  5CYQ A;  3AVL A;  3DOL A;  1LWE A;  3TAP A;  3TAN A;  4E1M A;  4AHT A;  2Z1J A;  1Z25 A;  2I5J A;  3ALY A;  4BAC A;  3D0P A;  4FJL A;  1Y97 A;  2FBX A;  3ZSY A;  3AVI A;  4XIU A;  1XHZ A;  3V1O A;  3V4I A;  3O4N A;  2G8K A;  3FFI A;  3SV4 A;  3HVT A;  1UA0 A;  1S1T A;  1VK0 A;  3KLI A;  1T8E A;  3VQ5 A;  3LP2 A;  4JRQ A;  3QEV A;  3RRH A;  4J2E A;  2VG5 A;  4RG8 A;  3ZT4 A;  1RDD A;  2F8T A;  4CEQ A;  1C0U A;  2GV9 A;  3KD1 E;  3VQ8 A;  4FXD A;  4E7H A;  2D0C A;  4AHC A;  2KW4 A;  2HHT A;  3MEG A;  3HT3 A;  2YHB A;  1XI1 A;  1RTJ A;  2E4L A;  2RKI A;  4Z0U A;  3L3V A;  1W9H A;  1NOY A;  3HL8 A;  3OS0 A;  4ID1 A;  5SZT A;  4FJ7 A;  3OYL A;  4DF4 A;  1JXE A;  2OPS A;  4M41 A;  4CEO A;  1C1A A;  3DMJ A;  3F9K A;  4ZTJ A;  2W42 A;  4Z4E A;  3S9H A;  1ASW A;  4YNQ A;  4O5B A;  1R0A A;  4CJ5 A;  4CE9 A;  1RBV A;  1B9D A;  3NH0 A;  3LDS A;  1U49 A;  2PYL A;  3AVH A;  3BGR A;  2KQ2 A;  3NH1 A;  3RTV A;  2X6N A;  1C1C A;  1QSL A;  3PO5 A;  3EY1 A;  3SPZ A;  4DTU A;  3HP6 A;  2YKN A;  2QKB A;  1B92 A;  1BCO A;  3LP3 A;  2A1S A;  2FBV A;  3QET A;  4Y1C A;  4HVJ A;  3TAF A;  3MXM A;  3C95 A;  3V9Z A;  4M3U A;  3JYT A;  3BDP A;  1RTI A;  1NK7 A;  1FXX A;  3LWL A;  5FRN A;  2YNI A;  1RT3 A;  5C25 A;  4CHP A;  4CGH A;  1SKR A;  4CJK A;  4FW1 A;  1VRU A;  4KV8 A;  1ZBH A;  2G8F A;  1K6Y A;  4GMJ B;  4QOZ B;  2KZZ A;  1VSH A;  4F4K A;  2E6M A;  3DLH A;  4M3W A;  4H4M A;  1IKV A;  1KFD A;  4KHU A;  1WSG A;  4MQ3 A;  5CYM A;  2HHS A;  4LY7 A;  1L5U A;  3S3O A;  1BCM A;  3HK2 A;  3K5M A;  3AA5 X;  4WE1 A;  4CHO A;  2AJQ A;  4HHT A;  1U47 A;  1EXQ A;  4CCH A;  4L8R B;  4E89 A;  1JXB A;  3H08 A;  4AHU A;  3ISN C;  4CJP A;  4B9L A;  4CF9 A;  5J2Q A;  2IS3 A;  4CJW A;  4I7F A;  2X6S A;  1VSL A;  2BAN A;  4C8K A;  4DMN A;  3PUF A;  2FC0 A;  3S3M A;  4Z4G A;  3O3H A;  2WOM A;  2OPP A;  3IAY A;  2KFN A;  3L2Q A;  3CFO A;  3QEI A;  3AVK A;  3QIP A;  4KO0 A;  3KD5 E;  4Z4F A;  3AO3 A;  2D5R A;  1HNV A;  4OGC A;  3ZT0 A;  3VN5 A;  5HRS A;  1HNI A;  3DLK A;  3B6P A;  2HNZ A;  2RF2 A;  1RDB A;  2PYJ A;  1F21 A;  4DTX A;  4B9N A;  4OPK A;  1NOZ A;  2HNY A;  3QLH A;  4CJS A;  3V9X A;  3OYI A;  4IDK A;  3K58 A;  3ZCM A;  1CXU A;  3SZ2 A;  1SL2 A;  4CGG A;  3JSM A;  1NK6 A;  3C94 A;  4KKO A;  3A2F A;  4F8R A;  2G8W A;  1SUQ A;  4FJJ A;  1ITG A;  1BHL A;  3NCI A;  3TWH A;  1TL1 A;  1NK4 A;  4KI4 A;  3OVN A;  2HHU A;  4KRE A;  4KB0 A;  4AHR A;  1L3U A;  4FJ8 A;  3L2W A;  4FLT A;  2YNF A;  4FCY A;  3NF6 A;  4B8C A;  3KJV A;  4DTR A;  3SQ2 A;  2WON A;  5HP1 A;  4IFY A;  2P5O A;  2Y1J A;  1T03 A;  1N5Y A;  5HRN A;  1Q9X A;  1ASV A;  1I3A A;  4W5R A;  1HQU A;  1WSE A;  4DSF A;  3QES A;  4Z4C A;  4CK2 A;  4E7J A;  1HYS A;  2HMI A;  2Y1I A;  2HHW A;  1QQC A;  4CES A;  3K59 A;  3SYZ A;  3TAB A;  3WNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...