2R7YA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
b'EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*CP*GP*AP*CP*A)-3')
publication title Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2r7yA00
3OJUA 4RW4A 1X9WA 3ZSVA 4CF2A 3HP9A 3EYZA 3QERA 1Q9XA 3UIQA 4J2DA 4EZ9A 1T05A 2KZMA 3OYHA 5KRSA 1QTMA 2RKIA 4CK3A 1LAWA 1J54A 4FZYA 1BIUA 4FJNA 2X78A 1SUQA 4PA1A 3V9UA 3ZSQA 3PX6A 4B8CA 1NK8A 1IO2A 3DLBA 4RW8A 4O5BA 4KO0A 2YKNA 3RMDA 3MXMA 1NK7A 1NJZA 4FM2A 1ZBHA 2VG6A 2EHGA 4CFDA 3AA4A 4E1MA 5KTQA 4NCAA 1VSMA 1RT5A 1DTQA 3ZSYA 5HRPA 1KVBA 1YTAA 1D5AA 1D9FA 4B9VA 4CESA 4E89A 3SCXA 4ZTFA 3U6FA 1LV5A 2XO7A 4FLXA 2HNYA 4TSXA 4N76A 4CEEA 4CJKA 1BISA 4KHSA 1FXXA 2HHWA 4FJJA 4OKEA 4FJGA 4CF0A 3NF9A 3DOLA 1TAQA 1T7PA 1A5VA 3DM2A 5SWMA 3D45A 5EU7A 4DFKA 3QEWA 4BDPA 3PUFA 1TL1A 1J5OA 2EX3A 4E19A 1RTIA 3LP0A 5HRSA 1W9HA 3O4QA 3DLKA 1RBRA 1KVCA 3KKSA 5JS1A 2G8UA 1Z25A 1K6YA 4Z4CA 1RDCA 4I9LA 2P5OA 2HMIA 5FRNA 1JXEA 3OYDA 2E6LA 2YNGA 4DTJA 4B9SA 3K59A 4JS5A 1F21A 3KTQA 1FKOA 4JS4A 3IRXA 3HSTB 1WSIA 5HRNA 2YNIA 3ZT0A 3LWLA 3CFOA 1VSIA 4KKOA 4FK2A 3M8SA 1XHZA 3M8RA 4CEAA 3E01A 4Q5VA 3KLGA 1VSJA 1WSHA 5SZTA 2D0BA 3AVIA 1JL1A 4FJ8A 3HO1A 4E3SA 1RBVA 3QO9A 4M3ZA 4HUFA 4F8RA 1KCFA 3NGZA 5HRRA 3QLHA 1DLOA 3DLEA 3CFRA 4CEQA 1BHLA 4BACA 3O4NA 3ITHA 4CHPA 4CFCA 1NK0A 4K8XA 4JRPA 1LW2A 2IOCA 2RN2A 1C1CA 4E7IA 1JXBA 1T8EA 1S1XA 1VK0A 1Y97A 3SPZA 1QSSA 4C8LA 3L3VA 4RW7A 1RDBA 3I8DA 4LSNA 1C6VA 4FJLA 4CEFA 1BI4A 3HT3A 4Y1DA 1O1WA 3QNOA 3TABA 3QEPA 2X6NA 3S9HA 5I3UA 1N5YA 3PY8A 3OYBA 4DTXA 3OYKA 2BGGA 3OYNA 1RBTA 5C24A 3P1GA 4OPKA 3ZSOA 4C8KA 4I9QA 2ITGA 2HHQA 3V4IA 3WNEA 4CEOA 1S5JA 3LANA 4CEZA 3K57A 3V9WA 3VQ7A 3JSMA 3SNNA 4AHUA 4KPYA 3ISNC 1KVAA 3JYTA 1XHXA 3SUOA 4CE9A 2YV0X 4KRFA 4FW2A 3VQDA 2DFFA 1JLGA 4ELTA 3HVTA 4OGCA 2A1RA 3WNHA 4BDZA 1CXUA 4CEBA 2PYLA 3TAGA 2Z1GA 3VQ4A 3NF7A 1NK5A 4HUEA 4DFPA 1BCMA 4DQPA 4I7FA 1RCHA 4Z4HA 4CGGA 3AVBA 3KK2A 1UWBA 4C8OA 4CFAA 4DTSA 3ALYA 4GVMA 1TAUA 3AA5X 4ID5A 4CJ3A 3NFAA 1EP4A 4B9LA 3ZSRA 3AVGA 3M8PA 4AHRA 4CGDA 5D3GA 2P1JA 1TL3A 4IFVA 3VQPA 3SQ2A 2ZD1A 3AVFA 3IG1A 4FJ5A 2QKBA 5I42A 1SL1A 2KTQA 5HP1A 3SI6A 3L2VA 4O0IA 1D9DA 3HXMA 4AH9A 4ICLA 3F73A 5FDLA 2HB5A 4CJ5A 4CGHA 4N5SA 1KLMA 3VQAA 3KIOA 3VQ5A 1XWLA 4N56A 2XHBA 1BQNA 1RT2A 1WAJA 3B6PA 2QK9A 4FJHA 2HNDA 4FW1A 4CJPA 3ASMA 4M3RA 5J1EA 3SUNA 3MXIA 4OLBA 1ZBIA 3KKRA 1ZBLA 3SV3A 3SQ4A 1ZBFA 4HTUA 4CJTA 5CY4A 4JRQA 3T3FA 3U3YA 4DSLA 4FZXC 5J2PA 4Z4FA 1ASUA 1HPZA 3ZT3A 1NK9A 2KFZA 4W5NA 3K58A 4O0JA 4RW9A 2B5JA 2P51A 2E4LA 2KQ2A 4H4MA 3TAFA 4RW6A 4KHQA 2G8WA 1TK0A 3OYIA 5HLFA 1WSGA 4LY7A 3LPTA 1Z26A 3MXJA 3NGIA 4KI6A 1QSLA 1UA1A 2HHUA 4FM0A 1VSHA 2XY6A 4DF8A 4XIUA 3OS1A 2YHBA 4DTMA 2BE2A 4Q0BA 1X1PA 4Z4GA 1TGOA 3RMCA 1RDDA 4CJFA 1UA0A 1U49A 4I2PA 1J9AA 3V6DA 2RF2A 2KFNA 4CHOA 1RNHA 2D0AA 4MQ3A 3G0ZA 4BDYA 1HYVA 3RRHA 3ZT2A 3L8BA 2Y1IA 4CJEA 2Q3SA 4CHYA 4C8MA 1QS4A 4PQUA 3V9XA 3HM9A 4DS4A 4FLTA 1RDAA 4OJRA 1C0UA 1IKXA 2DFHA 1L3TA 1YVUA 3CG7A 1NJXA 3T1AA 2A1SA 1U47A 4F2RA 3SYZA 1KSPA 4J2AA 4KTQA 2FBTA 3RMAA 3VQQA 2HHVA 4OKKA 3NH2A 4BE2A 4FLUA 4B9TA 1TVRA 2VWKA 2W42A 4DU1A 3OS2A 3VQBA 4DSEA 2XY7A 4CECA 1S1WA 3OYLA 3LZJA 3NH0A 3AO2A 2GUIA 3HPHA 3OYJA 3TANA 4KREA 4IBNA 4W5OA 3K5MA 3QEIA 4QOZB 3KLFA 3NBPA 1JLEA 1UAXA 4CGJA 4CJWA 4ELUA 4W5QA 3DRRA 2D5RA 3G10A 3TAMA 4IG3A 1WSFA 1VSFA 1GOCA 3CM6A 4OGEA 4FLZA 3VQ9A 4CK1A 3HJFA 3SQ0A 4ID1A 3V1RA 1EX4A 3ZCMA 4DTUA 1S6PA 3OS0A 4PWDA 1BI4B 1HMVA 3QIOA 3K5OA 4R5PA 1SKRA 4LH4A 3QEXA 3A2FA 3LALA 1NJWA 3AA3A 3KLHA 3OYFA 1NOZA 2ZE2A 2ZQBA 3MEEA 5T7BA 3NGYA 4CF1A 3HP6A 3DLRA 1X9MA 4I2QA 3S3NA 4CIGA 3WNGA 1NKCA 3VN5A 2Z1JA 1C0MA 1REVA 1HQEA 3LAMA 3PO4A 2ATQA 4CGIA 3OYCA 1CLQA 2DFEA 1NOYA 4HCCA 3B6OA 4N41A 4O44A 2R7YA 1NKBA 1TKXA 2XY8A 3AVCA 1HYSA 4LSLA 3LDSA 4BE1A 4KTZA 4AHVA 2HNZA 3V9ZA 1A5XA 1ASVA 3TAQA 3KD1E 4E7LA 4B3OA 2YKMA 2HW3A 1WN7A 3TAPA 3C6TA 3ZSZA 1NKEA 3VQEA 4DFMA 3EZ5A 1NK6A 4F3OA 3DLGA 2IAJA 3KLIA 4GW6A 1QHTA 1JL2A 1JLAA 1TKZA 1LAVA 4B9MA 2Z1HA 4DSJA 4DQQA 5J2NA 2G8VA 1EXQA 1Q9YA 1C1BA 1JKHA 4BWJA 1EETA 3QEVA 3PV8A 2G8KA 3SPYA 1L3SA 4H4OA 1U04A 2OPQA 2HHTA 1S6QA 1L5UA 4KAZA 3M8QA 1KRPA 4CJQA 4FXDA 1KLNA 1R0AA 4N47A 1NK4A 4KHUA 1A5WA 4QCLA 5KGWA 5DMRA 3I0RA 4CHQA 3AA2A 4CF8A 4NYFA 4KHNA 3C6UA 4DSIA 2IS3A 4FYDA 3KJVA 3LZIA 5JS2A 4DS5A 1HNIA 3O3FA 1TKDA 2G8HA 4ZHRA 2AJQA 4B8AB 4DFJA 1TKTA 2I5JA 1KTQA 2F96A 1ZBUA 3L2QA 4WE1A 2VWJA 1SL0A 4PUOA 3CQ8A 3VQ8A 1BIZA 1LWFA 1VSLA 1RT1A 2IDOA 2QKKA 1U48A 4KI4A 5K14A 5J2QA 3QESA 4M3UA 2DY4A 5KGXA 4O4GA 1EKEA 3QINA 3ZT1A 3NF6A 1U45A 4HVJA 1D8YA 3HPOA 2X74A 4JLHA 3SUPA 4HCBA 3C95A 4NCBA 1VRTA 2B4JA 5CYQA 4ELVA 3MAQA 1SL2A 2PZSA 4FJ7A 4HUGA 1VSDA 2FBXA 4F3TA 4NYNA 3DLHA 2QXFA 4HHTA 1RT4A 3F9KA 5C42A 1JLBA 4M3TA 1SKWA 4FJIA 3FFIA 4DTRA 4CIEA 4OKJA 2KW4A 1HRHA 3KK1A 4FLYA 1ITGA 2YNFA 3ZSXA 1RILA 2HVHA 3QIPA 3D0PA 2RPIA 2IC3A 3BGRA 3I0SA 5CYMA 1I39A 4YFUA 3NH1A 1T03A 3SV4A 3TR8A 5FRMA 1RTHA 2IGIA 4W5TA 2Y1JA 3NAEA 2HHXA 2F8SA 3SJJA 4DF4A 4M3WA 1TK8A 1LWCA 3ZSWA 1IKWA 4YNQA 3NHGA 1ZYQA 5HBMA 2X6SA 1NJYA 3RWUA 3TI0A 4E7KA 3QETA 2JGUA 1S9EA 1HNVA 1J53A 2OZSA 1BL3A 3EY1A 3KD5E 3OY9A 1WSEA 4B9UA 4MFBA 2G8FA 3PX0A 3WNFA 3S3OA 1YTUA 2GBZA 4DQRA 3H08A 4CJUA 4IKFA 4LD0A 4OLAA 4GMJB 1XC9A 1X9SA 4CEDA 3C94A 1CZ9A 3RTVA 2XRIA 3SUQA 2JLEA 4FJMA 2YHAA 4KFBA 4Z0UA 3V1OA 4CJRA 4E7HA 1S1TA 3V1QA 3V81A 3RMBA 2F8TA 3AO4A 3O3GA 1RTDA 4BE0A 2WOMA 1QSYA 4NCGA 2OPPA 3DI6A 3BDPA 4KB1A 1C1AA 3LP1A 2FC0A 3KK3A 3HK2A 4M42A 1LW0A 3RRGA 3O3HA 4B9NA 3AVMA 4DTPA 1G15A 3L2WA 1JLFA 1W0HA 2VG5A 4G1QA 1JLCA 4DTNA 1RBSA 5J2MA 2BDPA 4F2SA 3CFPA 4CJVA 1CZBA 1BCOA 1I3AA 4O55A 3LWMA 3THVA 2OZMA 4PY5A 4ZTJA 4LH5A 2P5GA 1KFSA 4EP5A 1RT3A 4CHNA 2PYJA 3TAEA 2PY5A 3HPGA 1IKVA 3CYMA 3AVKA 4RG8A 3AO3A 4E7JA 4AHTA 4Z4EA 1CXQA 1YT3A 2E6MA 4DU3A 3RR7A 3DYAA 1IKYA 1WAFA 1L3VA 3VQ6A 4FJ9A 2DTUA 3QNNA 1S9GA 4Y1CA 4J2BA 3MEGA 1TV6A 4DLGA 3HL8A 5CZ1A 5CZ2A 1B92A 1RT7A 3K5LA 3TWHA 2O4GA 1HJRA 2GV9A 3U3GA 4CERA 1B9FA 4E1NA 4M3YA 3P5JA 1RTJA 3PO5A 1SV5A 3MEDA 3IS9A 4OVLA 3ZT4A 4FZZA 4IFYA 2OPSA 4CIFA 4DU4A 1QE1A 4B08A 1Q8IA 1LWEA 3OYAA 3AVAA 3OVNA 1DTTA 3T19A 3L2RA 4DSFA 5E41A 3K5NA 4DTOA 3VA0A 4DWIA 3NF8A 4Z4IA 4DLEA 3LP3A 4FLWA 4M45A 3AVHA 3L2UA 3LP2A 2D0CA 4KV8A 4CJLA 4CHZA 3NE6A 1ASWA 4AHSA 3DOKA 1L3UA 2KZZA 4EP4A 1BGXT 1HQUA 2XY5A 4DG1A 3OYMA 1IG9A 4OPJA 2HVIA 3KLEA 4FK4A 3LAKA 3PX4A 1RBUA 1RT6A 4CFBA 4IG0A 2O4IA 4KHWA 1FK9A 4FCYA 1UOCA 3P83D 4H8KA 2OPRA 1VSEA 2OYQA 4L8RB 4CJSA 1JLQA 4M3XA 4J2EA 3SZ2A 1KFDA 3OYGA 1U4BA 1SKSA 3IAYA 3AV9A 4EZ6A 2VG7A 4CK2A 4C8NA 3OYEA 2NUBA 3LPUA 3SQ1A 3MECA 2Z1IA 2YNHA 4FJKA 4DMNA 1VRUA 1WNSA 1HYZA 4FVMA 4KHYA 4QAGA 3S3MA 3NDKA 4CGFA 5DK5A 4CCHA 2BANA 3AVNA 5KRTA 4AILC 1WSJA 4DSKA 3AO5A 3RR8A 4BWMA 3V9SA 1C0TA 3AVJA 5KI6A 2G8IA 1BQMA 2HHSA 1MU2A 3L3UA 4IDKA 3AVLA 3DRPA 5FROA 5C25A 4FLVA 1FKPA 4AHCA 3TARA 4CJ4A 1B9DA 4DQSA 3DMJA 3AO1A 1GOBA 3K2PA 3OJSA 4M41A 4FM1A 2FBVA 4DQIA 2FBYA 4W5RA 4KB0A 3DRSA 4CF9A 2B6AA 4KTWA 1S1UA 2ETJA 3CM5A 5HROA 3ULDA 1VSKA 4FK0A 3HYFA 1TK5A 3HVRA 1QQCA 4UQGA 2LSNA 4K8ZA 4E0DA 2WONA 3NCIA 1N6QA 3VQCA 4F4KA 1WLJA 1S1VA 4FJXA 1IH7A 1XI1A 3VA3A 2OA8A 1GOAA
chains in the Genus database with same CATH superfamily
3AGKA 2UUBK 5KPTA 4IO8A 2H3GX 5KRSA 3OYHA 1QTMA 4H0PA 3R1XA 1SUQA 3ZX2A 4B8CA 3RMDA 1NK7A 1NJZA 1RT5A 3ZSYA 5AZIB 4C8OA 4B9VA 3SCXA 2I7NA 3IKMA 4QS9A 4CJKA 2HHWA 3NF9A 2Q2RA 3VERA 3HTVA 4DFKA 5EU7A 1TL1A 5AZIA 4E19A 4WFAL 2VQFK 3KKSA 3GL1A 2P5OA 2GTDA 3VF4A 1JXEA 3OYDA 2E6LA 4ILGB 1SQKA 3UE5A 4JS5A 4DQ8A 5C0YA 2W41A 2ZGZA 2P9UA 1WSIA 3EZWA 5HRNA 2YNIA 1HLUA 4FWNA 4Q5VA 1WSHA 3ATVA 2D0BA 3HO1A 1JL1A 2P9SB 3J8AA 4M3ZA 5AQLA 1HNWK 4BACA 4M7YA 2ITMA 4CFCA 4H0OA 3W0LA 1NK0A 2IOCA 2O8BB 4E7IA 2HBMA 4RW7A 4DV5K 1BI4A 4Y1DA 3QNOA 5I3UA 3QEPA 2NRZA 2O8BA 4DTXA 3OYKA 1YJ9N 3P1GA 3CETA 1NGCA 3ZSOA 4C8KA 2ITGA 4X62K 2HHQA 1K9MO 1S5JA 3K57A 3VGMA 3V9WA 4DV0K 3ZEUA 4CE9A 1X3MA 2P9LA 1QQMA 3R6MA 4GV3A 4OGCA 4BDZA 2P9PB 3QFPA 3NF7A 1GLAG 4DQPA 4I7FA 3KK2A 3OW2M 4GVMA 3AA5X 3H1VX 4CZHA 2P9KA 1EP4A 2P9PA 4WQ5A 5M1QA 3O1WA 4AHRA 1YHQN 1KAZA 3AVFA 3IG1A 2KTQA 5I42A 5HP1A 3SI6A 1D9DA 4ICLA 3E66A 1NM1A 3F73A 2QWQA 3EL2A 4ILHA 4B1XB 3J81O 4JV5K 2XHBA 1RT2A 2FF6A 3SBGA 4DKWA 5J1EA 5GAHP 4OLBA 3KKRA 3SV3A 3U3YA 4DSLA 4PKGA 1QVGM 3ZT3A 4W5NA 3WXIA 1NGDA 1HKGA 1NGJA 1TK0A 3MXJA 4DR3K 2V7ZA 3NGIA 2QK9A 4EHTA 1QSLA 2HHUA 4B1UB 1NBWA 4FM0A 3D6RA 4XIUA 2A42A 4V19S 2BE2A 2NRTA 3CQYA 4X66K 2Q0UA 3V6DA 2RF2A 5EY4A 2KFNA 4KH5A 4JI7K 4MQ3A 2ZJQL 3L8BA 3P4IA 4PQUA 1QS4A 3HM9A 1FW6A 3WXMB 3TU5A 1YVUA 2IVOA 3A5NC 1QQOA 3SYZA 3FZKA 3CCUN 4KTQA 1NGEA 4JI6K 3E1YA 3VQQA 1EO1A 3UKUA 3NH2A 4BE2A 2VWKA 5KQ8A 1G99A 5AFUH 1S1WA 2NRHA 4KREA 1IBKK 5FPEA 4QOZB 4ELUA 4CGJA 4JKFA 1GOCA 4FLZA 5AZJA 4YY3K 5AQUA 3VENA 1EX4A 4BR2A 3ZCMA 3OS0A 1HMVA 3K5OA 4DV2K 3L4QA 4YOUA 3K9KA 1JJ2M 1OH7A 5F1XA 3MEEA 2HF4A 1X9MA 4I2QA 4LFBK 1IV0A 3VN5A 1HQEA 2YHXA 4WQ4A 1CLQA 2DFEA 3AVCA 3MMVA 4JI1K 4YOYA 2HNZA 3KD1E 4B3OA 3FE1A 5ELZA 4M63C 1E4GT 3VF6A 3DLGA 1NK6A 4B9MA 1JLAA 1KXPA 3CERA 1HJOA 1EXQA 1YUWA 3QEVA 3TTDA 3PV8A 1WB9A 2OTLN 1L3SA 2HHTA 1L5UA 1KLNA 3HI0A 5DMRA 3I0RA 3CI5A 2QEXN 2IS3A 3L0QA 2UXCK 4H0TB 3DXMA 4FYDA 4BR7A 3JAMO 3O3FA 1TYQB 1TKTA 2I5JA 4WE1A 3JS6A 4PUOA 4BC2A 1M90O 1VQKN 5J2QA 3QESA 2WC9A 4BRQA 3ZT1A 1D8YA 4FWMA 2YI1A 3SUPA 5AJ3K 4NCBA 1VRTA 3OBWA 5CYQA 4HUGA 1VSDA 4IFEA 3B8AX 2YHYA 1RT4A 3CJ7A 2KW4A 4BREA 1ATRA 3KK1A 2RPIA 3BGRA 1I39A 2WFBA 4BRDA 1T03A 3SV4A 2F8SA 4JD2B 3NHGA 1NGBA 3GOIA 2GUPA 3RWUA 1J53A 3OY9A 4H5RA 2UU9K 2QWMA 3C65A 3PX0A 3S3OA 3O5BA 4BR4A 4IKFA 2IVPA 4LD0A 4OLAA 1X9SA 4CEDA 3O8MA 3C94A 3RTVA 1VQ5N 1S1TA 4YDUA 4BE0A 1YXQA 4JI5K 4CZJA 4LF4K 4PKHA 5HL7L 4B9NA 5AQWA 4DTPA 4LFCK 4ISFA 2ZJPL 1JLCA 2BDPA 1CZBA 1BCOA 3LWMA 4LH5A 3L4IA 3O9QA 3HPGA 1IKVA 1ILYA 1YT3A 3WXJA 4BR0A 1YAGA 3VQ6A 3E9PA 1S9GA 4GNIA 4Y1CA 4DLGA 3QNNA 5CZ1A 3K5LA 3D2EB 2O4GA 3HOTA 4M7XA 1B9FA 4E1NA 3VGKA 3D2FB 5JVHL 5DM6L 4IFYA 1QE1A 1Q8IA 1LWEA 3T19A 2NNWA 3I55N 3K5NA 4DTOA 4IJAA 3KWGA 4DWIA 4DLEA 3H45C 2Q0RA 3H6EA 5HOOA 1VQ9N 4CJLA 3ENOA 1M1KO 1R59O 2JWLA 5AQOA 4JKDA 3O6WA 1IG9A 2NRWA 2QWOA 4WCEL 1EWRA 2Q31A 3MK6A 2BTFA 3EE9A 3CCMN 4L8RB 4J2EA 3SZ2A 4MDAA 4J8FA 3GG4A 2YNHA 1WNSA 4IOXA 5DK5A 3PIOL 2D4WA 2I7PA 3AVNA 3W3DA 3VTHA 4DSKA 4BWMA 4WQ5C 5AQIA 3GBTA 4IWVA 2HHSA 1MU2A 3L3UA 3DRPA 5FROA 4FLVA 2YCHA 4CJ4A 4PHTX 3CMAN 2F9TA 4DQSA 1GOBA 3VOVA 3K2PA 4FM1A 2FBVA 3FZLA 2FBYA 3AY9A 4KB0A 4FVUA 3CM5A 2ETJA 1K8KB 3ULDA 3HYFA 4XEIA 3MWPA 3HVRA 4K8ZA 5JICA 4F4KA 4YHHK 4X64K 2OA8A 4FL9A 4RW4A 3EYZA 4J2DA 5IWAK 4FWRA 4RTFD 1J54A 4FJNA 5F0XA 1GLJO 4PA1A 3ZSQA 1C0GA 4NB4A 1NK8A 4IOCL 3DLBA 4BRAA 2YKNA 4A57A 4CFDA 3AA4A 3T69A 1KVBA 1YTAA 1OH8A 1JCFA 4E89A 2XO7A 2HNYA 4KHSA 1FXXA 4OKEA 2D0OA 4JK9A 4R79A 1T7PA 1A5VA 4FPBA 5SWMA 4BDPA 3QEWA 3AGRA 4NXMK 4A2BA 3LP0A 5HRSA 2ZJRL 1XQSC 1RBRA 5BN8A 3A5OC 3VTIA 3THXB 4Z4CA 1RDCA 4I9LA 2HMIA 3R8EA 4DTJA 2FF3B 3CJBA 3I33A 1FKOA 3IRXA 3P31A 3LWLA 4BRNA 3VPZA 3M8RA 4CEAA 3E01A 1VSJA 4E3SA 3QO9A 5HRRA 3QLHA 1HNXK 3DLEA 4C1NI 3ITHA 3A5LC 1LW2A 4GKJK 2HBJA 1S22A 3DJCA 2NRXA 1VK0A 1Y97A 3SPZA 4C8LA 3L3VA 4BRGA 3I8DA 2O8CA 3DWLA 4LSNA 1C6VA 4CEFA 1O1WA 3TABA 3S9HA 2YJFA 3SMSA 3TTFA 3OYNA 5C24A 4JNEA 2HBKA 3V4IA 3LANA 2QA4N 4AHUA 3ISNC 3SUOA 4KRFA 2DFFA 4ELTA 2A41A 4WYBA 3HVTA 4CW7B 4CEBA 2PYLA 3TAGA 1NK5A 4Z4HA 3AVBA 2E20A 5C10A 4DTSA 1TAUA 3JXUA 3ZSRA 3M8PA 3CPWM 5D3GA 2P1JA 1TL3A 4IFVA 3RSEB 3VQPA 4O0IA 3ZX0A 4XH1A 3ATUA 2UXDK 3HM8A 2HB5A 4CGHA 1XWLA 4JN4A 4CBWA 1GLCG 4JKCA 4CZGA 4DCHA 4N56A 1WAJA 2HBLA 1IBLK 3I56N 4FJHA 4CJPA 1ZBIA 1NNEA 3MXIA 2A3ZA 3SQ4A 4HTUA 2E5LK 4K25A 1YJWN 3T3FA 4Z4FA 2E2QA 5J2PA 1ASUA 3F2KA 2P51A 2E4LA 4H4MA 4C23A 5HLFA 3VETA 1YF5L 3LPTA 4KI6A 4PKIA 4JK7A 1UA1A 4DB3A 1LCUA 1VSHA 4X65K 1OH6A 4FPAA 3FR0A 5MLCQ 4LFAK 4CZEA 3LM9A 4Z4GA 3RMCA 1RDDA 4CJFA 4MLHA 3C6AA 2A40A 4DR2K 3G0ZA 3RRHA 2Y1IA 5AQFA 4CJEA 4O8UA 4C8MA 4CHYA 2P9UB 5AQSA 5TKWA 4DS4A 4FLTA 1C0UA 1IKXA 3FFKB 3N4QA 1J5EK 3CG7A 1NJXA 3T1AA 2A1SA 3RMAA 3QBWA 1DEJA 4B9TA 3F5TA 3U9DA 5C2FA 4H0VB 4YDUC 3OYLA 3NH0A 1OVYA 2GUIA 3AO2A 3HPHA 4IBNA 1YITN 1JLEA 4CJWA 4W5QA 4JI0K 2NRVA 3DRRA 2D5RA 4FJKA 4GVEA 3SAGA 3HJFA 4ID1A 4CJ7A 2V51B 1Q81O 3TTCA 1S6PA 1BI4B 3QIOA 1ATNA 3DXKA 3LALA 2ZGYA 3AA3A 3OYFA 4A5AA 1NGIA 3K0SA 1W7AA 3KK7A 1NKCA 3ZEUB 1C0MA 2P9LB 1GLBG 3LAMA 4RWTA 1N34K 2ATQA 2QTDA 4CGIA 1NOYA 3B6OA 4MDBA 3LDSA 5JVGL 5AFUA 4KTZA 3IUCA 3CJ1A 1LOTB 2HW3A 2YKMA 3TAPA 3C6TA 4JK8A 4DFMA 4B3MK 2P9KB 1P90A 4GW6A 2F9WA 5J2NA 4LF7K 4MO5A 1Q9YA 1JKHA 4BWJA 1EETA 2O8DA 2G8KA 2OPQA 4KAZA 4CJQA 4FXDA 2AP1A 1VQON 4N47A 5AQXA 5KGWA 1T3VA 3HRGA 5LJWA 3C6UA 4DSIA 3NVKA 2UUAK 5LY3A 4BQLA 3LZIA 1TKDA 3FZHA 1FJGK 2F96A 4BG8A 1SL0A 2VWJA 1BIZA 1LWFA 1NU0A 1VSLA 2IDOA 2QKKA 4M3UA 2DY4A 1U45A 3KZBA 3NF6A 4HVJA 1HX1A 3MCPA 3HPOA 3EO3A 2B4JA 3CF5L 1SL2A 4BQZA 2VWBA 2F7TA 3E9OA 4HHTA 3F9KA 4BR5A 1JLBA 3SBTA 4M3TA 4FLYA 2YNFA 3PLAA 4Z94A 1S72N 2IC3A 3NH1A 4PL7A 5FRMA 2HHXA 2CGLA 3Q7CA 4OPAA 4JHDA 1LWCA 3ZETA 1IKWA 3ZSWA 4YNQA 5HBMA 2X6SA 5LMUK 3QETA 1S9EA 1HNVA 2JGUA 3UKUB 2OZSA 3KD5E 1WSEA 3CMEN 2YJEA 4CZMA 1YTUA 4F9OA 1ZBSA 1X3NA 2P9NA 3SUQA 4KFBA 3AAPA 5AZJB 3V1QA 3V81A 1QSYA 1QZ5A 2WOMA 4NCGA 3OA9A 1NG9A 3SK3A 3KK3A 3HK2A 1EQYA 4M42A 3O3HA 1W0HA 2VG5A 5M1FA 2FSKA 5AQHA 2OZMA 3CCRN 1XNQK 4ZTJA 3M1FA 1KFSA 1T6DA 4EP5A 5CR4A 3ID6A 2PY5A 4DUYK 2VGMA 4H0YB 1DKGD 2E6MA 3DYAA 1U2VA 3FZMA 1IKYA 1WAFA 1L3VA 4J2BA 2OCEA 3LM2A 3MEGA 4B3RK 3J80O 4LF6K 5CZ2A 4MLEA 3TWHA 3SAHA 4CD3A 2GV9A 1RTJA 3MWTA 4FZZA 2E8AA 1XC3A 2OPSA 3QERA 1J6ZA 3L2RA 1DTTA 3BZCA 1ATSA 1C0FA 1V4TA 1ESVA 4M45A 4AF1A 3QB0A 5AQVA 3NE6A 3DOKA 1L3UA 4EP4A 4OO1J 2Q1NA 1BGXT 3UKRB 2XY5A 3DXMB 1TUUA 5LMNK 2HVIA 4FK4A 3LAKA 3PX4A 1RT6A 2D0PA 2O4IA 4FCYA 5IT9O 3DAWA 2YX6A 4H8KA 1DGKN 2OYQA 1JLQA 1U4BA 4A61A 3LDLA 1SKSA 3UKRA 4EZ6A 4CK2A 4C8NA 2NUBA 4FWQA 2NRRA 4CVNE 2Z1IA 2WBNA 4KHYA 1HYZA 4QS7A 4BC4A 3S3MA 2BANA 5KRTA 5BN9A 3AO5A 5M1PA 3RR8A 4Y0WA 3R9PA 1QZ6A 4AHCA 3TARA 3MCAB 3DMJA 1BWFO 3CJAA 4M41A 1VQ4N 4W5RA 2Q36A 4CF9A 2B6AA 4EIAA 1VSKA 3IDHA 1TK5A 1QQCA 1QQNA 2WONA 3NCIA 3VQCA 3OTOK 1WLJA 1XMQK 1IG8A 1D9FA 3VA3A 3OJUA 2HSTA 3UIQA 4CF2A 3HP9A 1XMOK 4EZ9A 1EWQA 1T05A 2KZMA 2RKIA 4YOVA 3ZLJA 1LAWA 2QWPA 1BIUA 2DPNA 1BOTO 3PX6A 1ZBHA 3MXMA 1RGIA 2EHGA 4NCAA 1VSMA 1DTQA 1K8AO 1D5AA 5BRHA 4FLXA 4EAHD 1BISA 3EEQA 4CF0A 3MN7A 1N8RO 3MN9A 4LC9B 5GIOA 1W9HA 3O4QA 3TSQA 3J7AP 5JS1A 4B1YB 2FXUA 2G8UA 1K6YA 4ISGA 1F21A 3KTQA 1VHXA 3MX5A 4BRIA 3ZT0A 3CFOA 1VSIA 2W6LA 4FK2A 5C15A 3M8SA 4I6MB 3KLGA 4H5VA 3WEEB 2NZTA 4FJ8A 1RBVA 4HUFA 4F8RA 2WUSA 3CFRA 4CEQA 1BHLA 4CHPA 4K8XA 4JRPA 4I6MA 3C7NA 2VGNA 1I94K 3WEEA 4FOEA 1QSSA 3KVGA 4FJLA 2BGGA 4IZ9A 1RBTA 5M1KA 4I9QA 3WNEA 1TUYA 4KPYA 1KVAA 4BVPA 1XHXA 2YV0X 1MWKA 4IOAL 3VQDA 1JLGA 2O8EA 1CXUA 3FGUA 4GV9A 3VQ4A 1U6ZA 2PBDA 4FWOA 1RCHA 1UWBA 4CFAA 4ID5A 3OHRA 4CJ3A 1HKCA 4A62A 3P39A 5BR9A 3AVGA 4HWIA 1KQSM 3SQ2A 2ZD1A 2E2PA 4FSVA 3L2VA 1GLLO 3HXMA 4AH9A 5FDLA 4CJ5A 3VQAA 3KIOA 3VQ5A 5M1NA 1BQNA 3SMPA 4JKEA 3QFUA 3B6PA 1NMNA 2BUPA 3A8YA 3SJHA 3T7ZA 2HNDA 4FW1A 2W40A 3ASMA 4M3RA 4BRMA 2QWLA 1ZBFA 3LDPA 3THYB 4JRQA 4FZXC 5EXWA 1HPZA 5EVZA 4RW6A 2G8WA 4BC5A 1WSGA 3OBYA 4UY8O 3VESA 3RVCA 3THYA 2E2NA 4CBXA 4DF8A 3SLCA 3CCEN 4JEPA 3AARA 4Q0BA 1X1PA 4L3QA 1TGOA 4JAXA 1WBDA 3CJ9A 1VQ6N 1E4FT 4DV4K 1Q86O 2P9IA 4JKHA 2D0AA 4WF9L 1X9JA 1HYVA 1GLFO 2Q3SA 1NLVA 2ZWHA 4JKBA 4J2AA 1KSPA 2FBTA 5ADXH 1GLDG 1TVRA 2W42A 4DU1A 1RFQA 2EWSA 1GLEG 3OS2A 4BGBA 3VQBA 2XY7A 4DUZK 1SZ2A 3TANA 4BVOA 2KLAA 1MDUB 3KLFA 3NBPA 1UAXA 4IXCA 3O9UA 4JI3K 3TAMA 4IG3A 1WSFA 3CM6A 3VQ9A 4KH6A 1XUPO 5AQYA 3V1RA 3VMFB 2WTUA 1IJJA 4DTUA 1SS6A 2O8CB 4R5PA 2A5XA 3D7EO 1SKRA 4LH4A 3MN6A 3QEXA 3WT0A 4GY2B 5GINA 4FO0A 4IEIA 1NJWA 3CC7N 2ZE2A 3NGYA 3HP6A 3DLRA 3S3NA 4CIGA 2Z1JA 1REVA 4H5NA 5AQGA 3C0BA 3LDNA 4HCCA 1NKBA 4LSLA 4BE1A 4AHVA 3V9ZA 1A5XA 4WFNL 2PFUA 3ZSZA 1NKEA 3EZ5A 5AQKA 1QHTA 2E1YA 4DSJA 3J7YP 5BR8K 3ENBA 1Q18A 4KH4A 2OTJN 4H4OA 1W2BM 3M8QA 3GE1A 1D4XA 1NK4A 4KHUA 1A5WA 4QCLA 4CHQA 3AA2A 4CF8A 1CZAN 4NYFA 1KC8O 5LL6Z 1P8ZA 3FLCO 3VEXA 3KJVA 3WXKA 1HNIA 4B8AB 1ZBUA 3CQXA 4O8KA 1BA0A 4FOIA 1RT1A 3H3NO 1BO5O 1U48A 4KI4A 3LDQA 3QDKA 3G71N 3HZ6A 5KGXA 3QINA 4JLHA 4CD1A 3C95A 1JCGA 3MAQA 2PZSA 3KWIA 2FBXA 1VQPN 4F3TA 2QXFA 4CBUA 1SKWA 4FJIA 3FFIA 1H1VA 1RDUA 4DTRA 3VEOA 2HVHA 3QIPA 3L6QA 4YOTA 3TR8A 1BA1A 1RTHA 4WFBL 4W5TA 1NGFA 2Y1JA 3HSCA 3SJJA 3QICA 4M3WA 2E2OA 3QMLA 1ZYQA 3VEWA 4DV1K 3H3OB 3TI0A 4E7KA 1ZXOA 4BRLA 1BL3A 3EY1A 4LF9K 2E88A 4BG9A 4K42A 3WNFA 2GBZA 3H08A 4GMJB 1XC9A 5E26A 2XRIA 3BZKA 2YHAA 4Z0UA 3V1OA 4CJRA 3O9RA 2F8TA 3CPEA 2OPPA 4CZFA 3EKUA 1C1AA 3LP1A 2FC0A 3DLLL 1LW0A 4FWLA 3DXKB 2W6KA 3AVMA 1G15A 1JLFA 3L2WA 4DTNA 4F2SA 1RBSA 3CFPA 4PY5A 1K73O 4O55A 1NGHA 2UXBK 3R3LA 3CIPA 2GX9A 4CHNA 2PYJA 3CYMA 4RG8A 3AO3A 4E7JA 4Z4EA 1CXQA 2V52B 4BRPA 1JCEA 5B8HA 2DTUA 1TV6A 3HL8A 1RT7A 1O13A 3HBTA 5BPNA 1S3XA 5JLHA 1HJRA 4HTLA 4AM6A 3PO5A 3IS9A 4OVLA 3ZT4A 3M3ZA 4DU4A 4YOXA 3OYAA 3AVAA 1WUAA 2O8DB 3ENHA 3Q7BA 2P9SA 3T1HK 2J4RA 3NF8A 3M6GA 4KBOA 3LP3A 2QW9A 5AQZA 4ILJA 4FLWA 3AVHA 5BRDA 3L2UA 4EHUA 4KV8A 5GIPA 4CHZA 1ASWA 4AHSA 3MN5A 3AAQA 3CD6N 3OYMA 4CI6A 3S41A 4OPJA 3G4SN 4KHWA 1FK9A 1UOCA 3CCJN 2OPRA 1VSEA 4JI8K 3VGLA 4H03B 4CJSA 1KFDA 3OYGA 3CCSN 5FLXO 3OYEA 3SQ1A 5GAEP 5CHIA 3BF1A 4QAGA 4CGFA 4DR7K 1BU6O 1VQ8N 4FWSA 1WSJA 3H46O 5CE3A 3V9SA 3BF3A 1C0TA 5KI6A 3N4PA 4PL8A 4IDKA 3AVLA 5C25A 4NO7A 1N33K 1B9DA 4BGAA 1BUPA 3AO1A 3OJSA 4JHDB 1N36K 1NGGA 3ZETB 1S1UA 5AQTA 4JI2K 5HROA 4FK0A 1HUXA 3KHYA 3WXLA 4E0DA 3T1YK 1N6QA 5KPZA 4AM7A 1S1VA 4FJXA 4NLBA 1GOAA 1Q7YO 1X9WA 3ZSVA 4BRHA 1Q9XA 4YOWA 5GADP 3M5RA 4CK3A 2P9NB 4FZYA 2X78A 3V9UA 1IO2A 4RW8A 4O5BA 4KO0A 3FZFA 4FM2A 1HPMA 2VG6A 3QBXA 5E84A 4E1MA 5KTQA 5HRPA 4CESA 3CJCA 4H0XB 4ZTFA 3U6FA 1LV5A 2F4VK 5AQRA 4TSXA 4N76A 4CEEA 4FJJA 4FJGA 2O8FB 3DOLA 1TAQA 3DM2A 3D45A 1NWKA 3PUFA 1J5OA 2EX3A 5GAGP 4B1VA 1RTIA 3DLKA 2ASMA 5AQNA 5FPMA 1KVCA 4A59A 4DV7K 1BDGA 3BEXA 5H1SQ 1U2VB 2JWKA 1Z25A 2O8FA 4RCHA 5FRNA 2YNGA 4B9SA 3K59A 1N32K 5JLFA 3EE8A 4JS4A 1KAXA 3HSTB 5AQMA 5FPNA 2ZF5O 4KKOA 1XHZA 4YORA 4DHYA 5SZTA 3AVIA 3O80A 1QHAA 1KCFA 3NGZA 1DLOA 5EX5A 2CGJA 3O4NA 2RN2A 4LF8K 1KD1O 1C1CA 3WUHA 5JMVA 1SAZA 1JXBA 1T8EA 1S1XA 1RDBA 3CCLN 1T44A 3HT3A 5KQDA 3PY8A 2X6NA 1N5YA 1ZC6A 3OYBA 4ISEA 4OPKA 4CEOA 3I8BA 4CEZA 3BP8A 4NLCA 3VQ7A 3JSMA 3SNNA 3JYTA 5I9EB 5BREA 4FW2A 3MDQA 4C1NK 4E1JA 2A1RA 3WNHA 2Z1GA 4HUEA 4DFPA 1BCMA 2Q97A 4CGGA 1NGAA 5FPDA 5C2DA 3ALYA 3ZYYX 4OX9K 3NFAA 1DT9A 4B9LA 4CGDA 4FJ5A 1W97L 2QKBA 4B1WB 1SL1A 1Z6RA 1HR0K 1YI2N 2PAVA 4N5SA 3O08A 2QWNA 1KLMA 4IO9L 3MX2A 4XH5A 3G25A 2VCPA 3SUNA 3O9SA 1ZBLA 1TYQA 4CJTA 5CY4A 1HNZK 2KFZA 1NK9A 3O1BA 3K58A 4O0JA 4RW9A 2B5JA 5LJVA 2KQ2A 4O5FA 3TAFA 4KHQA 2A6AA 3OYIA 4LY7A 3BY5A 1Z26A 3C6HA 1VQMN 2XY6A 5F2RA 2QXLA 2HF3A 3OS1A 2YHBA 4DTMA 4CZLA 4B9QA 3CCVN 1KAYA 3GDQA 2YHWA 1UA0A 1U49A 4I2PA 1J9AA 3CC2N 3ZX3A 4CHOA 1RNHA 4BDYA 4LF5K 3ZT2A 4BRFA 2UUCK 3EKSA 3V9XA 4XH4A 1VAZA 1RDAA 4OJRA 3VF2A 3NMUA 4JD2A 1Z05A 2DFHA 1L3TA 1Q82O 2CGKA 1U47A 4F2RA 2HHVA 4OKKA 4FLUA 1NJIO 4MO4A 4DSEA 4CECA 3VEZA 3LZJA 3OYJA 3ID8A 4W5OA 3K5MA 3QEIA 3TSUA 3C7NB 1VQNN 4BY9C 2CH6A 3G10A 4OGEA 1VSFA 4CK1A 3SQ0A 5BPLA 3THWB 1WBBA 4PWDA 4IEEA 3A2FA 4B3TK 4DR6K 3WQTA 2QWRA 3KLHA 4JKGB 1NOZA 4JKAA 2ZQBA 5AQJA 2VYPA 5T7BA 4CF1A 4H5WA 4AQYK 3VEYA 3THWA 3E9LA 3WNGA 3PO4A 3OYCA 5AR0A 1RDWX 5ADXA 2AA4A 4N41A 2O8EB 4O44A 2R7YA 1TKXA 4JKGA 3SAFA 2XY8A 1HYSA 4DV6K 3A5MC 1ASVA 3TAQA 4G9ZA 5AQQA 4E7LA 1WN7A 3D2EA 4FWPA 4U67L 3VQEA 4F3OA 2IAJA 3KLIA 1JL2A 1TKZA 2E1ZA 1LAVA 1YVNA 3D2FA 4KHPK 2Z1HA 4DQQA 4BROA 2G8VA 1C1BA 2GWKA 3SPYA 2FSJA 1U04A 1S6QA 1BG3A 3CXCM 1R0AA 2RHKA 4KHNA 4U7BA 2NLXA 4B1ZA 4BRKA 3CCQN 5JS2A 4DS5A 3PIPL 2G8HA 2AJQA 4ZHRA 4DFJA 1OVQA 1KTQA 3L2QA 3CQ8A 3VQ8A 3U8XA 5K14A 4O4GA 1EKEA 1WOQA 2X74A 4A2AA 4HCBA 2QM1A 1YIJN 4ELVA 4FJ7A 3PSFA 3F9MA 4NYNA 3DLHA 5C42A 3IMXA 4EFHA 4CIEA 4OKJA 1HRHA 1ITGA 3ZSXA 1RILA 2P9IB 3D0PA 3I0SA 5CYMA 4GKKK 4B3SK 5DM7L 4YFUA 5KPRA 4K43A 2IGIA 5TKYA 3NAEA 2QI2A 1HKBA 4K0KK 4DF4A 1TK8A 4OPHA 4BR9A 1K8KA 1NJYA 2V7YA 3IFRA 4IDHA 4B9UA 4MFBA 2G8FA 1MA9B 3EN9A 3ULEB 4QS8A 4DQRA 4CJUA 2CH5A 2IIRA 1CZ9A 4GV6A 2UYTA 2ASPA 2JLEA 4DR5K 4FJMA 3RMBA 4E7HA 1KRPA 1YJNN 2HMPA 1OKJA 3A0IX 3AO4A 3ULEA 5BPMA 3O3GA 1RTDA 3U9ZA 3DI6A 3BDPA 4KB1A 1Y64A 4CZIA 2ZM6K 1E3MA 3NVMA 3RRGA 3P38A 2BH1A 1IBMK 4DR4K 4G1QA 3VEVA 5J2MA 3K9JA 4CJVA 3THVA 1I3AA 4A5BA 3HOSA 4FWKA 3BUZB 2P5GA 3LDOA 1RT3A 2FSNA 3TAEA 5EOYA 3AVKA 2RE2A 4AHTA 4DU3A 2D1KA 3RR7A 4DV3K 3THXA 3CHWA 4FJ9A 5A2QO 2VQEK 1B92A 5M1OA 3U3GA 4CERA 4M3YA 3O9TA 4JI4K 1QVFM 3P5JA 2OANA 1VQ7N 1SV5A 3MEDA 3H1QA 3PSIA 2KKZA 2HOEA 4CIFA 4B08A 3OVNA 3TSPA 4DSFA 5E41A 1NMDA 3VA0A 3J7ZO 3U4LA 4Z4IA 3LP2A 2D0CA 3UB5A 2ASOA 4WQ4C 1V4SA 2KZZA 3O4WA 5AQPA 5BRFA 1HQUA 4DG1A 3KLEA 1RBUA 4CFBA 4IG0A 4H5TA 3P83D 5C12A 4M3XA 3IAYA 3AV9A 2VG7A 3LPUA 3TPQA 2KHOA 3MECA 4K41A 4DMNA 1VRUA 4FVMA 4NXNK 3NDKA 4CCHA 1T6CA 4AILC 3G6EN 1MWMA 1XNRK 3AVJA 2G8IA 1BQMA 1FKPA 4BRCA 2GELA 3CC4N 2IVNA 2GWJA 4BC3A 3WQUA 4DQIA 3LL3A 3DRSA 4KTWA 4IJNA 3RSEA 4DR1K 2HHHK 4JYAK 2GEMA 4UQGA 2LSNA 1OH5A 1VQLN 2FLOA 4CZKA 1IH7A 1XI1A
chains in the Genus database with same CATH topology
3OJUA 4RW4A 1X9WA 3ZSVA 4CF2A 3HP9A 3EYZA 3QERA 1Q9XA 3UIQA 4J2DA 4EZ9A 1T05A 2KZMA 3OYHA 5KRSA 1QTMA 2RKIA 4CK3A 1LAWA 1J54A 4FZYA 1BIUA 4FJNA 2X78A 1SUQA 4PA1A 3V9UA 3ZSQA 3PX6A 4B8CA 1NK8A 1IO2A 3DLBA 4RW8A 4O5BA 4KO0A 2YKNA 3RMDA 3MXMA 1NK7A 1NJZA 4FM2A 1ZBHA 2VG6A 2EHGA 4CFDA 3AA4A 4E1MA 5KTQA 4NCAA 1VSMA 1RT5A 1DTQA 3ZSYA 5HRPA 1KVBA 1YTAA 1D5AA 1D9FA 4B9VA 4CESA 4E89A 3SCXA 4ZTFA 3U6FA 1LV5A 2XO7A 4FLXA 2HNYA 4TSXA 4N76A 4CEEA 4CJKA 1BISA 4KHSA 1FXXA 2HHWA 4FJJA 4OKEA 4FJGA 4CF0A 3NF9A 3DOLA 1TAQA 1T7PA 1A5VA 3DM2A 5SWMA 3D45A 5EU7A 4DFKA 3QEWA 4BDPA 3PUFA 1TL1A 1J5OA 2EX3A 4E19A 1RTIA 3LP0A 5HRSA 1W9HA 3O4QA 3DLKA 1RBRA 1KVCA 3KKSA 5JS1A 2G8UA 1Z25A 1K6YA 4Z4CA 1RDCA 4I9LA 2P5OA 2HMIA 5FRNA 1JXEA 3OYDA 2E6LA 2YNGA 4DTJA 4B9SA 3K59A 4JS5A 1F21A 3KTQA 1FKOA 4JS4A 3IRXA 3HSTB 1WSIA 5HRNA 2YNIA 3ZT0A 3LWLA 3CFOA 1VSIA 4KKOA 4FK2A 3M8SA 1XHZA 3M8RA 4CEAA 3E01A 4Q5VA 3KLGA 1VSJA 1WSHA 5SZTA 2D0BA 3AVIA 1JL1A 4FJ8A 3HO1A 4E3SA 1RBVA 3QO9A 4M3ZA 4HUFA 4F8RA 1KCFA 3NGZA 5HRRA 3QLHA 1DLOA 3DLEA 3CFRA 4CEQA 1BHLA 4BACA 3O4NA 3ITHA 4CHPA 4CFCA 1NK0A 4K8XA 4JRPA 1LW2A 2IOCA 2RN2A 1C1CA 4E7IA 1JXBA 1T8EA 1S1XA 1VK0A 1Y97A 3SPZA 1QSSA 4C8LA 3L3VA 4RW7A 1RDBA 3I8DA 4LSNA 1C6VA 4FJLA 4CEFA 1BI4A 3HT3A 4Y1DA 1O1WA 3QNOA 3TABA 3QEPA 2X6NA 3S9HA 5I3UA 1N5YA 3PY8A 3OYBA 4DTXA 3OYKA 2BGGA 3OYNA 1RBTA 5C24A 3P1GA 4OPKA 3ZSOA 4C8KA 4I9QA 2ITGA 2HHQA 3V4IA 3WNEA 4CEOA 1S5JA 3LANA 4CEZA 3K57A 3V9WA 3VQ7A 3JSMA 3SNNA 4AHUA 4KPYA 3ISNC 1KVAA 3JYTA 1XHXA 3SUOA 4CE9A 2YV0X 4KRFA 4FW2A 3VQDA 2DFFA 1JLGA 4ELTA 3HVTA 4OGCA 2A1RA 3WNHA 4BDZA 1CXUA 4CEBA 2PYLA 3TAGA 2Z1GA 3VQ4A 3NF7A 1NK5A 4HUEA 4DFPA 1BCMA 4DQPA 4I7FA 1RCHA 4Z4HA 4CGGA 3AVBA 3KK2A 1UWBA 4C8OA 4CFAA 4DTSA 3ALYA 4GVMA 1TAUA 3AA5X 4ID5A 4CJ3A 3NFAA 1EP4A 4B9LA 3ZSRA 3AVGA 3M8PA 4AHRA 4CGDA 5D3GA 2P1JA 1TL3A 4IFVA 3VQPA 3SQ2A 2ZD1A 3AVFA 3IG1A 4FJ5A 2QKBA 5I42A 1SL1A 2KTQA 5HP1A 3SI6A 3L2VA 4O0IA 1D9DA 3HXMA 4AH9A 4ICLA 3F73A 5FDLA 2HB5A 4CJ5A 4CGHA 4N5SA 1KLMA 3VQAA 3KIOA 3VQ5A 1XWLA 4N56A 2XHBA 1BQNA 1RT2A 1WAJA 3B6PA 2QK9A 4FJHA 2HNDA 4FW1A 4CJPA 3ASMA 4M3RA 5J1EA 3SUNA 3MXIA 4OLBA 1ZBIA 3KKRA 1ZBLA 3SV3A 3SQ4A 1ZBFA 4HTUA 4CJTA 5CY4A 4JRQA 3T3FA 3U3YA 4DSLA 4FZXC 5J2PA 4Z4FA 1ASUA 1HPZA 3ZT3A 1NK9A 2KFZA 4W5NA 3K58A 4O0JA 4RW9A 2B5JA 2P51A 2E4LA 2KQ2A 4H4MA 3TAFA 4RW6A 4KHQA 2G8WA 1TK0A 3OYIA 5HLFA 1WSGA 4LY7A 3LPTA 1Z26A 3MXJA 3NGIA 4KI6A 1QSLA 1UA1A 2HHUA 4FM0A 1VSHA 2XY6A 4DF8A 4XIUA 3OS1A 2YHBA 4DTMA 2BE2A 4Q0BA 1X1PA 4Z4GA 1TGOA 3RMCA 1RDDA 4CJFA 1UA0A 1U49A 4I2PA 1J9AA 3V6DA 2RF2A 2KFNA 4CHOA 1RNHA 2D0AA 4MQ3A 3G0ZA 4BDYA 1HYVA 3RRHA 3ZT2A 3L8BA 2Y1IA 4CJEA 2Q3SA 4CHYA 4C8MA 1QS4A 4PQUA 3V9XA 3HM9A 4DS4A 4FLTA 1RDAA 4OJRA 1C0UA 1IKXA 2DFHA 1L3TA 1YVUA 3CG7A 1NJXA 3T1AA 2A1SA 1U47A 4F2RA 3SYZA 1KSPA 4J2AA 4KTQA 2FBTA 3RMAA 3VQQA 2HHVA 4OKKA 3NH2A 4BE2A 4FLUA 4B9TA 1TVRA 2VWKA 2W42A 4DU1A 3OS2A 3VQBA 4DSEA 2XY7A 4CECA 1S1WA 3OYLA 3LZJA 3NH0A 3AO2A 2GUIA 3HPHA 3OYJA 3TANA 4KREA 4IBNA 4W5OA 3K5MA 3QEIA 4QOZB 3KLFA 3NBPA 1JLEA 1UAXA 4CGJA 4CJWA 4ELUA 4W5QA 3DRRA 2D5RA 3G10A 3TAMA 4IG3A 1WSFA 1VSFA 1GOCA 3CM6A 4OGEA 4FLZA 3VQ9A 4CK1A 3HJFA 3SQ0A 4ID1A 3V1RA 1EX4A 3ZCMA 4DTUA 1S6PA 3OS0A 4PWDA 1BI4B 1HMVA 3QIOA 3K5OA 4R5PA 1SKRA 4LH4A 3QEXA 3A2FA 3LALA 1NJWA 3AA3A 3KLHA 3OYFA 1NOZA 2ZE2A 2ZQBA 3MEEA 5T7BA 3NGYA 4CF1A 3HP6A 3DLRA 1X9MA 4I2QA 3S3NA 4CIGA 3WNGA 1NKCA 3VN5A 2Z1JA 1C0MA 1REVA 1HQEA 3LAMA 3PO4A 2ATQA 4CGIA 3OYCA 1CLQA 2DFEA 1NOYA 4HCCA 3B6OA 4N41A 4O44A 2R7YA 1NKBA 1TKXA 2XY8A 3AVCA 1HYSA 4LSLA 3LDSA 4BE1A 4KTZA 4AHVA 2HNZA 3V9ZA 1A5XA 1ASVA 3TAQA 3KD1E 4E7LA 4B3OA 2YKMA 2HW3A 1WN7A 3TAPA 3C6TA 3ZSZA 1NKEA 3VQEA 4DFMA 3EZ5A 1NK6A 4F3OA 3DLGA 2IAJA 3KLIA 4GW6A 1QHTA 1JL2A 1JLAA 1TKZA 1LAVA 4B9MA 2Z1HA 4DSJA 4DQQA 5J2NA 2G8VA 1EXQA 1Q9YA 1C1BA 1JKHA 4BWJA 1EETA 3QEVA 3PV8A 2G8KA 3SPYA 1L3SA 4H4OA 1U04A 2OPQA 2HHTA 1S6QA 1L5UA 4KAZA 3M8QA 1KRPA 4CJQA 4FXDA 1KLNA 1R0AA 4N47A 1NK4A 4KHUA 1A5WA 4QCLA 5KGWA 5DMRA 3I0RA 4CHQA 3AA2A 4CF8A 4NYFA 4KHNA 3C6UA 4DSIA 2IS3A 4FYDA 3KJVA 3LZIA 5JS2A 4DS5A 1HNIA 3O3FA 1TKDA 2G8HA 4ZHRA 2AJQA 4B8AB 4DFJA 1TKTA 2I5JA 1KTQA 2F96A 1ZBUA 3L2QA 4WE1A 2VWJA 1SL0A 4PUOA 3CQ8A 3VQ8A 1BIZA 1LWFA 1VSLA 1RT1A 2IDOA 2QKKA 1U48A 4KI4A 5K14A 5J2QA 3QESA 4M3UA 2DY4A 5KGXA 4O4GA 1EKEA 3QINA 3ZT1A 3NF6A 1U45A 4HVJA 1D8YA 3HPOA 2X74A 4JLHA 3SUPA 4HCBA 3C95A 4NCBA 1VRTA 2B4JA 5CYQA 4ELVA 3MAQA 1SL2A 2PZSA 4FJ7A 4HUGA 1VSDA 2FBXA 4F3TA 4NYNA 3DLHA 2QXFA 4HHTA 1RT4A 3F9KA 5C42A 1JLBA 4M3TA 1SKWA 4FJIA 3FFIA 4DTRA 4CIEA 4OKJA 2KW4A 1HRHA 3KK1A 4FLYA 1ITGA 2YNFA 3ZSXA 1RILA 2HVHA 3QIPA 3D0PA 2RPIA 2IC3A 3BGRA 3I0SA 5CYMA 1I39A 4YFUA 3NH1A 1T03A 3SV4A 3TR8A 5FRMA 1RTHA 2IGIA 4W5TA 2Y1JA 3NAEA 2HHXA 2F8SA 3SJJA 4DF4A 4M3WA 1TK8A 1LWCA 3ZSWA 1IKWA 4YNQA 3NHGA 1ZYQA 5HBMA 2X6SA 1NJYA 3RWUA 3TI0A 4E7KA 3QETA 2JGUA 1S9EA 1HNVA 1J53A 2OZSA 1BL3A 3EY1A 3KD5E 3OY9A 1WSEA 4B9UA 4MFBA 2G8FA 3PX0A 3WNFA 3S3OA 1YTUA 2GBZA 4DQRA 3H08A 4CJUA 4IKFA 4LD0A 4OLAA 4GMJB 1XC9A 1X9SA 4CEDA 3C94A 1CZ9A 3RTVA 2XRIA 3SUQA 2JLEA 4FJMA 2YHAA 4KFBA 4Z0UA 3V1OA 4CJRA 4E7HA 1S1TA 3V1QA 3V81A 3RMBA 2F8TA 3AO4A 3O3GA 1RTDA 4BE0A 2WOMA 1QSYA 4NCGA 2OPPA 3DI6A 3BDPA 4KB1A 1C1AA 3LP1A 2FC0A 3KK3A 3HK2A 4M42A 1LW0A 3RRGA 3O3HA 4B9NA 3AVMA 4DTPA 1G15A 3L2WA 1JLFA 1W0HA 2VG5A 4G1QA 1JLCA 4DTNA 1RBSA 5J2MA 2BDPA 4F2SA 3CFPA 4CJVA 1CZBA 1BCOA 1I3AA 4O55A 3LWMA 3THVA 2OZMA 4PY5A 4ZTJA 4LH5A 2P5GA 1KFSA 4EP5A 1RT3A 4CHNA 2PYJA 3TAEA 2PY5A 3HPGA 1IKVA 3CYMA 3AVKA 4RG8A 3AO3A 4E7JA 4AHTA 4Z4EA 1CXQA 1YT3A 2E6MA 4DU3A 3RR7A 3DYAA 1IKYA 1WAFA 1L3VA 3VQ6A 4FJ9A 2DTUA 3QNNA 1S9GA 4Y1CA 4J2BA 3MEGA 1TV6A 4DLGA 3HL8A 5CZ1A 5CZ2A 1B92A 1RT7A 3K5LA 3TWHA 2O4GA 1HJRA 2GV9A 3U3GA 4CERA 1B9FA 4E1NA 4M3YA 3P5JA 1RTJA 3PO5A 1SV5A 3MEDA 3IS9A 4OVLA 3ZT4A 4FZZA 4IFYA 2OPSA 4CIFA 4DU4A 1QE1A 4B08A 1Q8IA 1LWEA 3OYAA 3AVAA 3OVNA 1DTTA 3T19A 3L2RA 4DSFA 5E41A 3K5NA 4DTOA 3VA0A 4DWIA 3NF8A 4Z4IA 4DLEA 3LP3A 4FLWA 4M45A 3AVHA 3L2UA 3LP2A 2D0CA 4KV8A 4CJLA 4CHZA 3NE6A 1ASWA 4AHSA 3DOKA 1L3UA 2KZZA 4EP4A 1BGXT 1HQUA 2XY5A 4DG1A 3OYMA 1IG9A 4OPJA 2HVIA 3KLEA 4FK4A 3LAKA 3PX4A 1RBUA 1RT6A 4CFBA 4IG0A 2O4IA 4KHWA 1FK9A 4FCYA 1UOCA 3P83D 4H8KA 2OPRA 1VSEA 2OYQA 4L8RB 4CJSA 1JLQA 4M3XA 4J2EA 3SZ2A 1KFDA 3OYGA 1U4BA 1SKSA 3IAYA 3AV9A 4EZ6A 2VG7A 4CK2A 4C8NA 3OYEA 2NUBA 3LPUA 3SQ1A 3MECA 2Z1IA 2YNHA 4FJKA 4DMNA 1VRUA 1WNSA 1HYZA 4FVMA 4KHYA 4QAGA 3S3MA 3NDKA 4CGFA 5DK5A 4CCHA 2BANA 3AVNA 5KRTA 4AILC 1WSJA 4DSKA 3AO5A 3RR8A 4BWMA 3V9SA 1C0TA 3AVJA 5KI6A 2G8IA 1BQMA 2HHSA 1MU2A 3L3UA 4IDKA 3AVLA 3DRPA 5FROA 5C25A 4FLVA 1FKPA 4AHCA 3TARA 4CJ4A 1B9DA 4DQSA 3DMJA 3AO1A 1GOBA 3K2PA 3OJSA 4M41A 4FM1A 2FBVA 4DQIA 2FBYA 4W5RA 4KB0A 3DRSA 4CF9A 2B6AA 4KTWA 1S1UA 2ETJA 3CM5A 5HROA 3ULDA 1VSKA 4FK0A 3HYFA 1TK5A 3HVRA 1QQCA 4UQGA 2LSNA 4K8ZA 4E0DA 2WONA 3NCIA 1N6QA 3VQCA 4F4KA 1WLJA 1S1VA 4FJXA 1IH7A 1XI1A 3VA3A 2OA8A 1GOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJU A;  4RW4 A;  1X9W A;  3ZSV A;  4CF2 A;  3HP9 A;  3EYZ A;  3QER A;  1Q9X A;  3UIQ A;  4J2D A;  4EZ9 A;  1T05 A;  2KZM A;  3OYH A;  5KRS A;  1QTM A;  2RKI A;  4CK3 A;  1LAW A;  1J54 A;  4FZY A;  1BIU A;  4FJN A;  2X78 A;  1SUQ A;  4PA1 A;  3V9U A;  3ZSQ A;  3PX6 A;  4B8C A;  1NK8 A;  1IO2 A;  3DLB A;  4RW8 A;  4O5B A;  4KO0 A;  2YKN A;  3RMD A;  3MXM A;  1NK7 A;  1NJZ A;  4FM2 A;  1ZBH A;  2VG6 A;  2EHG A;  4CFD A;  3AA4 A;  4E1M A;  5KTQ A;  4NCA A;  1VSM A;  1RT5 A;  1DTQ A;  3ZSY A;  5HRP A;  1KVB A;  1YTA A;  1D5A A;  1D9F A;  4B9V A;  4CES A;  4E89 A;  3SCX A;  4ZTF A;  3U6F A;  1LV5 A;  2XO7 A;  4FLX A;  2HNY A;  4TSX A;  4N76 A;  4CEE A;  4CJK A;  1BIS A;  4KHS A;  1FXX A;  2HHW A;  4FJJ A;  4OKE A;  4FJG A;  4CF0 A;  3NF9 A;  3DOL A;  1TAQ A;  1T7P A;  1A5V A;  3DM2 A;  5SWM A;  3D45 A;  5EU7 A;  4DFK A;  3QEW A;  4BDP A;  3PUF A;  1TL1 A;  1J5O A;  2EX3 A;  4E19 A;  1RTI A;  3LP0 A;  5HRS A;  1W9H A;  3O4Q A;  3DLK A;  1RBR A;  1KVC A;  3KKS A;  5JS1 A;  2G8U A;  1Z25 A;  1K6Y A;  4Z4C A;  1RDC A;  4I9L A;  2P5O A;  2HMI A;  5FRN A;  1JXE A;  3OYD A;  2E6L A;  2YNG A;  4DTJ A;  4B9S A;  3K59 A;  4JS5 A;  1F21 A;  3KTQ A;  1FKO A;  4JS4 A;  3IRX A;  3HST B;  1WSI A;  5HRN A;  2YNI A;  3ZT0 A;  3LWL A;  3CFO A;  1VSI A;  4KKO A;  4FK2 A;  3M8S A;  1XHZ A;  3M8R A;  4CEA A;  3E01 A;  4Q5V A;  3KLG A;  1VSJ A;  1WSH A;  5SZT A;  2D0B A;  3AVI A;  1JL1 A;  4FJ8 A;  3HO1 A;  4E3S A;  1RBV A;  3QO9 A;  4M3Z A;  4HUF A;  4F8R A;  1KCF A;  3NGZ A;  5HRR A;  3QLH A;  1DLO A;  3DLE A;  3CFR A;  4CEQ A;  1BHL A;  4BAC A;  3O4N A;  3ITH A;  4CHP A;  4CFC A;  1NK0 A;  4K8X A;  4JRP A;  1LW2 A;  2IOC A;  2RN2 A;  1C1C A;  4E7I A;  1JXB A;  1T8E A;  1S1X A;  1VK0 A;  1Y97 A;  3SPZ A;  1QSS A;  4C8L A;  3L3V A;  4RW7 A;  1RDB A;  3I8D A;  4LSN A;  1C6V A;  4FJL A;  4CEF A;  1BI4 A;  3HT3 A;  4Y1D A;  1O1W A;  3QNO A;  3TAB A;  3QEP A;  2X6N A;  3S9H A;  5I3U A;  1N5Y A;  3PY8 A;  3OYB A;  4DTX A;  3OYK A;  2BGG A;  3OYN A;  1RBT A;  5C24 A;  3P1G A;  4OPK A;  3ZSO A;  4C8K A;  4I9Q A;  2ITG A;  2HHQ A;  3V4I A;  3WNE A;  4CEO A;  1S5J A;  3LAN A;  4CEZ A;  3K57 A;  3V9W A;  3VQ7 A;  3JSM A;  3SNN A;  4AHU A;  4KPY A;  3ISN C;  1KVA A;  3JYT A;  1XHX A;  3SUO A;  4CE9 A;  2YV0 X;  4KRF A;  4FW2 A;  3VQD A;  2DFF A;  1JLG A;  4ELT A;  3HVT A;  4OGC A;  2A1R A;  3WNH A;  4BDZ A;  1CXU A;  4CEB A;  2PYL A;  3TAG A;  2Z1G A;  3VQ4 A;  3NF7 A;  1NK5 A;  4HUE A;  4DFP A;  1BCM A;  4DQP A;  4I7F A;  1RCH A;  4Z4H A;  4CGG A;  3AVB A;  3KK2 A;  1UWB A;  4C8O A;  4CFA A;  4DTS A;  3ALY A;  4GVM A;  1TAU A;  3AA5 X;  4ID5 A;  4CJ3 A;  3NFA A;  1EP4 A;  4B9L A;  3ZSR A;  3AVG A;  3M8P A;  4AHR A;  4CGD A;  5D3G A;  2P1J A;  1TL3 A;  4IFV A;  3VQP A;  3SQ2 A;  2ZD1 A;  3AVF A;  3IG1 A;  4FJ5 A;  2QKB A;  5I42 A;  1SL1 A;  2KTQ A;  5HP1 A;  3SI6 A;  3L2V A;  4O0I A;  1D9D A;  3HXM A;  4AH9 A;  4ICL A;  3F73 A;  5FDL A;  2HB5 A;  4CJ5 A;  4CGH A;  4N5S A;  1KLM A;  3VQA A;  3KIO A;  3VQ5 A;  1XWL A;  4N56 A;  2XHB A;  1BQN A;  1RT2 A;  1WAJ A;  3B6P A;  2QK9 A;  4FJH A;  2HND A;  4FW1 A;  4CJP A;  3ASM A;  4M3R A;  5J1E A;  3SUN A;  3MXI A;  4OLB A;  1ZBI A;  3KKR A;  1ZBL A;  3SV3 A;  3SQ4 A;  1ZBF A;  4HTU A;  4CJT A;  5CY4 A;  4JRQ A;  3T3F A;  3U3Y A;  4DSL A;  4FZX C;  5J2P A;  4Z4F A;  1ASU A;  1HPZ A;  3ZT3 A;  1NK9 A;  2KFZ A;  4W5N A;  3K58 A;  4O0J A;  4RW9 A;  2B5J A;  2P51 A;  2E4L A;  2KQ2 A;  4H4M A;  3TAF A;  4RW6 A;  4KHQ A;  2G8W A;  1TK0 A;  3OYI A;  5HLF A;  1WSG A;  4LY7 A;  3LPT A;  1Z26 A;  3MXJ A;  3NGI A;  4KI6 A;  1QSL A;  1UA1 A;  2HHU A;  4FM0 A;  1VSH A;  2XY6 A;  4DF8 A;  4XIU A;  3OS1 A;  2YHB A;  4DTM A;  2BE2 A;  4Q0B A;  1X1P A;  4Z4G A;  1TGO A;  3RMC A;  1RDD A;  4CJF A;  1UA0 A;  1U49 A;  4I2P A;  1J9A A;  3V6D A;  2RF2 A;  2KFN A;  4CHO A;  1RNH A;  2D0A A;  4MQ3 A;  3G0Z A;  4BDY A;  1HYV A;  3RRH A;  3ZT2 A;  3L8B A;  2Y1I A;  4CJE A;  2Q3S A;  4CHY A;  4C8M A;  1QS4 A;  4PQU A;  3V9X A;  3HM9 A;  4DS4 A;  4FLT A;  1RDA A;  4OJR A;  1C0U A;  1IKX A;  2DFH A;  1L3T A;  1YVU A;  3CG7 A;  1NJX A;  3T1A A;  2A1S A;  1U47 A;  4F2R A;  3SYZ A;  1KSP A;  4J2A A;  4KTQ A;  2FBT A;  3RMA A;  3VQQ A;  2HHV A;  4OKK A;  3NH2 A;  4BE2 A;  4FLU A;  4B9T A;  1TVR A;  2VWK A;  2W42 A;  4DU1 A;  3OS2 A;  3VQB A;  4DSE A;  2XY7 A;  4CEC A;  1S1W A;  3OYL A;  3LZJ A;  3NH0 A;  3AO2 A;  2GUI A;  3HPH A;  3OYJ A;  3TAN A;  4KRE A;  4IBN A;  4W5O A;  3K5M A;  3QEI A;  4QOZ B;  3KLF A;  3NBP A;  1JLE A;  1UAX A;  4CGJ A;  4CJW A;  4ELU A;  4W5Q A;  3DRR A;  2D5R A;  3G10 A;  3TAM A;  4IG3 A;  1WSF A;  1VSF A;  1GOC A;  3CM6 A;  4OGE A;  4FLZ A;  3VQ9 A;  4CK1 A;  3HJF A;  3SQ0 A;  4ID1 A;  3V1R A;  1EX4 A;  3ZCM A;  4DTU A;  1S6P A;  3OS0 A;  4PWD A;  1BI4 B;  1HMV A;  3QIO A;  3K5O A;  4R5P A;  1SKR A;  4LH4 A;  3QEX A;  3A2F A;  3LAL A;  1NJW A;  3AA3 A;  3KLH A;  3OYF A;  1NOZ A;  2ZE2 A;  2ZQB A;  3MEE A;  5T7B A;  3NGY A;  4CF1 A;  3HP6 A;  3DLR A;  1X9M A;  4I2Q A;  3S3N A;  4CIG A;  3WNG A;  1NKC A;  3VN5 A;  2Z1J A;  1C0M A;  1REV A;  1HQE A;  3LAM A;  3PO4 A;  2ATQ A;  4CGI A;  3OYC A;  1CLQ A;  2DFE A;  1NOY A;  4HCC A;  3B6O A;  4N41 A;  4O44 A;  2R7Y A;  1NKB A;  1TKX A;  2XY8 A;  3AVC A;  1HYS A;  4LSL A;  3LDS A;  4BE1 A;  4KTZ A;  4AHV A;  2HNZ A;  3V9Z A;  1A5X A;  1ASV A;  3TAQ A;  3KD1 E;  4E7L A;  4B3O A;  2YKM A;  2HW3 A;  1WN7 A;  3TAP A;  3C6T A;  3ZSZ A;  1NKE A;  3VQE A;  4DFM A;  3EZ5 A;  1NK6 A;  4F3O A;  3DLG A;  2IAJ A;  3KLI A;  4GW6 A;  1QHT A;  1JL2 A;  1JLA A;  1TKZ A;  1LAV A;  4B9M A;  2Z1H A;  4DSJ A;  4DQQ A;  5J2N A;  2G8V A;  1EXQ A;  1Q9Y A;  1C1B A;  1JKH A;  4BWJ A;  1EET A;  3QEV A;  3PV8 A;  2G8K A;  3SPY A;  1L3S A;  4H4O A;  1U04 A;  2OPQ A;  2HHT A;  1S6Q A;  1L5U A;  4KAZ A;  3M8Q A;  1KRP A;  4CJQ A;  4FXD A;  1KLN A;  1R0A A;  4N47 A;  1NK4 A;  4KHU A;  1A5W A;  4QCL A;  5KGW A;  5DMR A;  3I0R A;  4CHQ A;  3AA2 A;  4CF8 A;  4NYF A;  4KHN A;  3C6U A;  4DSI A;  2IS3 A;  4FYD A;  3KJV A;  3LZI A;  5JS2 A;  4DS5 A;  1HNI A;  3O3F A;  1TKD A;  2G8H A;  4ZHR A;  2AJQ A;  4B8A B;  4DFJ A;  1TKT A;  2I5J A;  1KTQ A;  2F96 A;  1ZBU A;  3L2Q A;  4WE1 A;  2VWJ A;  1SL0 A;  4PUO A;  3CQ8 A;  3VQ8 A;  1BIZ A;  1LWF A;  1VSL A;  1RT1 A;  2IDO A;  2QKK A;  1U48 A;  4KI4 A;  5K14 A;  5J2Q A;  3QES A;  4M3U A;  2DY4 A;  5KGX A;  4O4G A;  1EKE A;  3QIN A;  3ZT1 A;  3NF6 A;  1U45 A;  4HVJ A;  1D8Y A;  3HPO A;  2X74 A;  4JLH A;  3SUP A;  4HCB A;  3C95 A;  4NCB A;  1VRT A;  2B4J A;  5CYQ A;  4ELV A;  3MAQ A;  1SL2 A;  2PZS A;  4FJ7 A;  4HUG A;  1VSD A;  2FBX A;  4F3T A;  4NYN A;  3DLH A;  2QXF A;  4HHT A;  1RT4 A;  3F9K A;  5C42 A;  1JLB A;  4M3T A;  1SKW A;  4FJI A;  3FFI A;  4DTR A;  4CIE A;  4OKJ A;  2KW4 A;  1HRH A;  3KK1 A;  4FLY A;  1ITG A;  2YNF A;  3ZSX A;  1RIL A;  2HVH A;  3QIP A;  3D0P A;  2RPI A;  2IC3 A;  3BGR A;  3I0S A;  5CYM A;  1I39 A;  4YFU A;  3NH1 A;  1T03 A;  3SV4 A;  3TR8 A;  5FRM A;  1RTH A;  2IGI A;  4W5T A;  2Y1J A;  3NAE A;  2HHX A;  2F8S A;  3SJJ A;  4DF4 A;  4M3W A;  1TK8 A;  1LWC A;  3ZSW A;  1IKW A;  4YNQ A;  3NHG A;  1ZYQ A;  5HBM A;  2X6S A;  1NJY A;  3RWU A;  3TI0 A;  4E7K A;  3QET A;  2JGU A;  1S9E A;  1HNV A;  1J53 A;  2OZS A;  1BL3 A;  3EY1 A;  3KD5 E;  3OY9 A;  1WSE A;  4B9U A;  4MFB A;  2G8F A;  3PX0 A;  3WNF A;  3S3O A;  1YTU A;  2GBZ A;  4DQR A;  3H08 A;  4CJU A;  4IKF A;  4LD0 A;  4OLA A;  4GMJ B;  1XC9 A;  1X9S A;  4CED A;  3C94 A;  1CZ9 A;  3RTV A;  2XRI A;  3SUQ A;  2JLE A;  4FJM A;  2YHA A;  4KFB A;  4Z0U A;  3V1O A;  4CJR A;  4E7H A;  1S1T A;  3V1Q A;  3V81 A;  3RMB A;  2F8T A;  3AO4 A;  3O3G A;  1RTD A;  4BE0 A;  2WOM A;  1QSY A;  4NCG A;  2OPP A;  3DI6 A;  3BDP A;  4KB1 A;  1C1A A;  3LP1 A;  2FC0 A;  3KK3 A;  3HK2 A;  4M42 A;  1LW0 A;  3RRG A;  3O3H A;  4B9N A;  3AVM A;  4DTP A;  1G15 A;  3L2W A;  1JLF A;  1W0H A;  2VG5 A;  4G1Q A;  1JLC A;  4DTN A;  1RBS A;  5J2M A;  2BDP A;  4F2S A;  3CFP A;  4CJV A;  1CZB A;  1BCO A;  1I3A A;  4O55 A;  3LWM A;  3THV A;  2OZM A;  4PY5 A;  4ZTJ A;  4LH5 A;  2P5G A;  1KFS A;  4EP5 A;  1RT3 A;  4CHN A;  2PYJ A;  3TAE A;  2PY5 A;  3HPG A;  1IKV A;  3CYM A;  3AVK A;  4RG8 A;  3AO3 A;  4E7J A;  4AHT A;  4Z4E A;  1CXQ A;  1YT3 A;  2E6M A;  4DU3 A;  3RR7 A;  3DYA A;  1IKY A;  1WAF A;  1L3V A;  3VQ6 A;  4FJ9 A;  2DTU A;  3QNN A;  1S9G A;  4Y1C A;  4J2B A;  3MEG A;  1TV6 A;  4DLG A;  3HL8 A;  5CZ1 A;  5CZ2 A;  1B92 A;  1RT7 A;  3K5L A;  3TWH A;  2O4G A;  1HJR A;  2GV9 A;  3U3G A;  4CER A;  1B9F A;  4E1N A;  4M3Y A;  3P5J A;  1RTJ A;  3PO5 A;  1SV5 A;  3MED A;  3IS9 A;  4OVL A;  3ZT4 A;  4FZZ A;  4IFY A;  2OPS A;  4CIF A;  4DU4 A;  1QE1 A;  4B08 A;  1Q8I A;  1LWE A;  3OYA A;  3AVA A;  3OVN A;  1DTT A;  3T19 A;  3L2R A;  4DSF A;  5E41 A;  3K5N A;  4DTO A;  3VA0 A;  4DWI A;  3NF8 A;  4Z4I A;  4DLE A;  3LP3 A;  4FLW A;  4M45 A;  3AVH A;  3L2U A;  3LP2 A;  2D0C A;  4KV8 A;  4CJL A;  4CHZ A;  3NE6 A;  1ASW A;  4AHS A;  3DOK A;  1L3U A;  2KZZ A;  4EP4 A;  1BGX T;  1HQU A;  2XY5 A;  4DG1 A;  3OYM A;  1IG9 A;  4OPJ A;  2HVI A;  3KLE A;  4FK4 A;  3LAK A;  3PX4 A;  1RBU A;  1RT6 A;  4CFB A;  4IG0 A;  2O4I A;  4KHW A;  1FK9 A;  4FCY A;  1UOC A;  3P83 D;  4H8K A;  2OPR A;  1VSE A;  2OYQ A;  4L8R B;  4CJS A;  1JLQ A;  4M3X A;  4J2E A;  3SZ2 A;  1KFD A;  3OYG A;  1U4B A;  1SKS A;  3IAY A;  3AV9 A;  4EZ6 A;  2VG7 A;  4CK2 A;  4C8N A;  3OYE A;  2NUB A;  3LPU A;  3SQ1 A;  3MEC A;  2Z1I A;  2YNH A;  4FJK A;  4DMN A;  1VRU A;  1WNS A;  1HYZ A;  4FVM A;  4KHY A;  4QAG A;  3S3M A;  3NDK A;  4CGF A;  5DK5 A;  4CCH A;  2BAN A;  3AVN A;  5KRT A;  4AIL C;  1WSJ A;  4DSK A;  3AO5 A;  3RR8 A;  4BWM A;  3V9S A;  1C0T A;  3AVJ A;  5KI6 A;  2G8I A;  1BQM A;  2HHS A;  1MU2 A;  3L3U A;  4IDK A;  3AVL A;  3DRP A;  5FRO A;  5C25 A;  4FLV A;  1FKP A;  4AHC A;  3TAR A;  4CJ4 A;  1B9D A;  4DQS A;  3DMJ A;  3AO1 A;  1GOB A;  3K2P A;  3OJS A;  4M41 A;  4FM1 A;  2FBV A;  4DQI A;  2FBY A;  4W5R A;  4KB0 A;  3DRS A;  4CF9 A;  2B6A A;  4KTW A;  1S1U A;  2ETJ A;  3CM5 A;  5HRO A;  3ULD A;  1VSK A;  4FK0 A;  3HYF A;  1TK5 A;  3HVR A;  1QQC A;  4UQG A;  2LSN A;  4K8Z A;  4E0D A;  2WON A;  3NCI A;  1N6Q A;  3VQC A;  4F4K A;  1WLJ A;  1S1V A;  4FJX A;  1IH7 A;  1XI1 A;  3VA3 A;  2OA8 A;  1GOA A; 
#chains in the Genus database with same CATH topology
 3AGK A;  2UUB K;  5KPT A;  4IO8 A;  2H3G X;  5KRS A;  3OYH A;  1QTM A;  4H0P A;  3R1X A;  1SUQ A;  3ZX2 A;  4B8C A;  3RMD A;  1NK7 A;  1NJZ A;  1RT5 A;  3ZSY A;  5AZI B;  4C8O A;  4B9V A;  3SCX A;  2I7N A;  3IKM A;  4QS9 A;  4CJK A;  2HHW A;  3NF9 A;  2Q2R A;  3VER A;  3HTV A;  4DFK A;  5EU7 A;  1TL1 A;  5AZI A;  4E19 A;  4WFA L;  2VQF K;  3KKS A;  3GL1 A;  2P5O A;  2GTD A;  3VF4 A;  1JXE A;  3OYD A;  2E6L A;  4ILG B;  1SQK A;  3UE5 A;  4JS5 A;  4DQ8 A;  5C0Y A;  2W41 A;  2ZGZ A;  2P9U A;  1WSI A;  3EZW A;  5HRN A;  2YNI A;  1HLU A;  4FWN A;  4Q5V A;  1WSH A;  3ATV A;  2D0B A;  3HO1 A;  1JL1 A;  2P9S B;  3J8A A;  4M3Z A;  5AQL A;  1HNW K;  4BAC A;  4M7Y A;  2ITM A;  4CFC A;  4H0O A;  3W0L A;  1NK0 A;  2IOC A;  2O8B B;  4E7I A;  2HBM A;  4RW7 A;  4DV5 K;  1BI4 A;  4Y1D A;  3QNO A;  5I3U A;  3QEP A;  2NRZ A;  2O8B A;  4DTX A;  3OYK A;  1YJ9 N;  3P1G A;  3CET A;  1NGC A;  3ZSO A;  4C8K A;  2ITG A;  4X62 K;  2HHQ A;  1K9M O;  1S5J A;  3K57 A;  3VGM A;  3V9W A;  4DV0 K;  3ZEU A;  4CE9 A;  1X3M A;  2P9L A;  1QQM A;  3R6M A;  4GV3 A;  4OGC A;  4BDZ A;  2P9P B;  3QFP A;  3NF7 A;  1GLA G;  4DQP A;  4I7F A;  3KK2 A;  3OW2 M;  4GVM A;  3AA5 X;  3H1V X;  4CZH A;  2P9K A;  1EP4 A;  2P9P A;  4WQ5 A;  5M1Q A;  3O1W A;  4AHR A;  1YHQ N;  1KAZ A;  3AVF A;  3IG1 A;  2KTQ A;  5I42 A;  5HP1 A;  3SI6 A;  1D9D A;  4ICL A;  3E66 A;  1NM1 A;  3F73 A;  2QWQ A;  3EL2 A;  4ILH A;  4B1X B;  3J81 O;  4JV5 K;  2XHB A;  1RT2 A;  2FF6 A;  3SBG A;  4DKW A;  5J1E A;  5GAH P;  4OLB A;  3KKR A;  3SV3 A;  3U3Y A;  4DSL A;  4PKG A;  1QVG M;  3ZT3 A;  4W5N A;  3WXI A;  1NGD A;  1HKG A;  1NGJ A;  1TK0 A;  3MXJ A;  4DR3 K;  2V7Z A;  3NGI A;  2QK9 A;  4EHT A;  1QSL A;  2HHU A;  4B1U B;  1NBW A;  4FM0 A;  3D6R A;  4XIU A;  2A42 A;  4V19 S;  2BE2 A;  2NRT A;  3CQY A;  4X66 K;  2Q0U A;  3V6D A;  2RF2 A;  5EY4 A;  2KFN A;  4KH5 A;  4JI7 K;  4MQ3 A;  2ZJQ L;  3L8B A;  3P4I A;  4PQU A;  1QS4 A;  3HM9 A;  1FW6 A;  3WXM B;  3TU5 A;  1YVU A;  2IVO A;  3A5N C;  1QQO A;  3SYZ A;  3FZK A;  3CCU N;  4KTQ A;  1NGE A;  4JI6 K;  3E1Y A;  3VQQ A;  1EO1 A;  3UKU A;  3NH2 A;  4BE2 A;  2VWK A;  5KQ8 A;  1G99 A;  5AFU H;  1S1W A;  2NRH A;  4KRE A;  1IBK K;  5FPE A;  4QOZ B;  4ELU A;  4CGJ A;  4JKF A;  1GOC A;  4FLZ A;  5AZJ A;  4YY3 K;  5AQU A;  3VEN A;  1EX4 A;  4BR2 A;  3ZCM A;  3OS0 A;  1HMV A;  3K5O A;  4DV2 K;  3L4Q A;  4YOU A;  3K9K A;  1JJ2 M;  1OH7 A;  5F1X A;  3MEE A;  2HF4 A;  1X9M A;  4I2Q A;  4LFB K;  1IV0 A;  3VN5 A;  1HQE A;  2YHX A;  4WQ4 A;  1CLQ A;  2DFE A;  3AVC A;  3MMV A;  4JI1 K;  4YOY A;  2HNZ A;  3KD1 E;  4B3O A;  3FE1 A;  5ELZ A;  4M63 C;  1E4G T;  3VF6 A;  3DLG A;  1NK6 A;  4B9M A;  1JLA A;  1KXP A;  3CER A;  1HJO A;  1EXQ A;  1YUW A;  3QEV A;  3TTD A;  3PV8 A;  1WB9 A;  2OTL N;  1L3S A;  2HHT A;  1L5U A;  1KLN A;  3HI0 A;  5DMR A;  3I0R A;  3CI5 A;  2QEX N;  2IS3 A;  3L0Q A;  2UXC K;  4H0T B;  3DXM A;  4FYD A;  4BR7 A;  3JAM O;  3O3F A;  1TYQ B;  1TKT A;  2I5J A;  4WE1 A;  3JS6 A;  4PUO A;  4BC2 A;  1M90 O;  1VQK N;  5J2Q A;  3QES A;  2WC9 A;  4BRQ A;  3ZT1 A;  1D8Y A;  4FWM A;  2YI1 A;  3SUP A;  5AJ3 K;  4NCB A;  1VRT A;  3OBW A;  5CYQ A;  4HUG A;  1VSD A;  4IFE A;  3B8A X;  2YHY A;  1RT4 A;  3CJ7 A;  2KW4 A;  4BRE A;  1ATR A;  3KK1 A;  2RPI A;  3BGR A;  1I39 A;  2WFB A;  4BRD A;  1T03 A;  3SV4 A;  2F8S A;  4JD2 B;  3NHG A;  1NGB A;  3GOI A;  2GUP A;  3RWU A;  1J53 A;  3OY9 A;  4H5R A;  2UU9 K;  2QWM A;  3C65 A;  3PX0 A;  3S3O A;  3O5B A;  4BR4 A;  4IKF A;  2IVP A;  4LD0 A;  4OLA A;  1X9S A;  4CED A;  3O8M A;  3C94 A;  3RTV A;  1VQ5 N;  1S1T A;  4YDU A;  4BE0 A;  1YXQ A;  4JI5 K;  4CZJ A;  4LF4 K;  4PKH A;  5HL7 L;  4B9N A;  5AQW A;  4DTP A;  4LFC K;  4ISF A;  2ZJP L;  1JLC A;  2BDP A;  1CZB A;  1BCO A;  3LWM A;  4LH5 A;  3L4I A;  3O9Q A;  3HPG A;  1IKV A;  1ILY A;  1YT3 A;  3WXJ A;  4BR0 A;  1YAG A;  3VQ6 A;  3E9P A;  1S9G A;  4GNI A;  4Y1C A;  4DLG A;  3QNN A;  5CZ1 A;  3K5L A;  3D2E B;  2O4G A;  3HOT A;  4M7X A;  1B9F A;  4E1N A;  3VGK A;  3D2F B;  5JVH L;  5DM6 L;  4IFY A;  1QE1 A;  1Q8I A;  1LWE A;  3T19 A;  2NNW A;  3I55 N;  3K5N A;  4DTO A;  4IJA A;  3KWG A;  4DWI A;  4DLE A;  3H45 C;  2Q0R A;  3H6E A;  5HOO A;  1VQ9 N;  4CJL A;  3ENO A;  1M1K O;  1R59 O;  2JWL A;  5AQO A;  4JKD A;  3O6W A;  1IG9 A;  2NRW A;  2QWO A;  4WCE L;  1EWR A;  2Q31 A;  3MK6 A;  2BTF A;  3EE9 A;  3CCM N;  4L8R B;  4J2E A;  3SZ2 A;  4MDA A;  4J8F A;  3GG4 A;  2YNH A;  1WNS A;  4IOX A;  5DK5 A;  3PIO L;  2D4W A;  2I7P A;  3AVN A;  3W3D A;  3VTH A;  4DSK A;  4BWM A;  4WQ5 C;  5AQI A;  3GBT A;  4IWV A;  2HHS A;  1MU2 A;  3L3U A;  3DRP A;  5FRO A;  4FLV A;  2YCH A;  4CJ4 A;  4PHT X;  3CMA N;  2F9T A;  4DQS A;  1GOB A;  3VOV A;  3K2P A;  4FM1 A;  2FBV A;  3FZL A;  2FBY A;  3AY9 A;  4KB0 A;  4FVU A;  3CM5 A;  2ETJ A;  1K8K B;  3ULD A;  3HYF A;  4XEI A;  3MWP A;  3HVR A;  4K8Z A;  5JIC A;  4F4K A;  4YHH K;  4X64 K;  2OA8 A;  4FL9 A;  4RW4 A;  3EYZ A;  4J2D A;  5IWA K;  4FWR A;  4RTF D;  1J54 A;  4FJN A;  5F0X A;  1GLJ O;  4PA1 A;  3ZSQ A;  1C0G A;  4NB4 A;  1NK8 A;  4IOC L;  3DLB A;  4BRA A;  2YKN A;  4A57 A;  4CFD A;  3AA4 A;  3T69 A;  1KVB A;  1YTA A;  1OH8 A;  1JCF A;  4E89 A;  2XO7 A;  2HNY A;  4KHS A;  1FXX A;  4OKE A;  2D0O A;  4JK9 A;  4R79 A;  1T7P A;  1A5V A;  4FPB A;  5SWM A;  4BDP A;  3QEW A;  3AGR A;  4NXM K;  4A2B A;  3LP0 A;  5HRS A;  2ZJR L;  1XQS C;  1RBR A;  5BN8 A;  3A5O C;  3VTI A;  3THX B;  4Z4C A;  1RDC A;  4I9L A;  2HMI A;  3R8E A;  4DTJ A;  2FF3 B;  3CJB A;  3I33 A;  1FKO A;  3IRX A;  3P31 A;  3LWL A;  4BRN A;  3VPZ A;  3M8R A;  4CEA A;  3E01 A;  1VSJ A;  4E3S A;  3QO9 A;  5HRR A;  3QLH A;  1HNX K;  3DLE A;  4C1N I;  3ITH A;  3A5L C;  1LW2 A;  4GKJ K;  2HBJ A;  1S22 A;  3DJC A;  2NRX A;  1VK0 A;  1Y97 A;  3SPZ A;  4C8L A;  3L3V A;  4BRG A;  3I8D A;  2O8C A;  3DWL A;  4LSN A;  1C6V A;  4CEF A;  1O1W A;  3TAB A;  3S9H A;  2YJF A;  3SMS A;  3TTF A;  3OYN A;  5C24 A;  4JNE A;  2HBK A;  3V4I A;  3LAN A;  2QA4 N;  4AHU A;  3ISN C;  3SUO A;  4KRF A;  2DFF A;  4ELT A;  2A41 A;  4WYB A;  3HVT A;  4CW7 B;  4CEB A;  2PYL A;  3TAG A;  1NK5 A;  4Z4H A;  3AVB A;  2E20 A;  5C10 A;  4DTS A;  1TAU A;  3JXU A;  3ZSR A;  3M8P A;  3CPW M;  5D3G A;  2P1J A;  1TL3 A;  4IFV A;  3RSE B;  3VQP A;  4O0I A;  3ZX0 A;  4XH1 A;  3ATU A;  2UXD K;  3HM8 A;  2HB5 A;  4CGH A;  1XWL A;  4JN4 A;  4CBW A;  1GLC G;  4JKC A;  4CZG A;  4DCH A;  4N56 A;  1WAJ A;  2HBL A;  1IBL K;  3I56 N;  4FJH A;  4CJP A;  1ZBI A;  1NNE A;  3MXI A;  2A3Z A;  3SQ4 A;  4HTU A;  2E5L K;  4K25 A;  1YJW N;  3T3F A;  4Z4F A;  2E2Q A;  5J2P A;  1ASU A;  3F2K A;  2P51 A;  2E4L A;  4H4M A;  4C23 A;  5HLF A;  3VET A;  1YF5 L;  3LPT A;  4KI6 A;  4PKI A;  4JK7 A;  1UA1 A;  4DB3 A;  1LCU A;  1VSH A;  4X65 K;  1OH6 A;  4FPA A;  3FR0 A;  5MLC Q;  4LFA K;  4CZE A;  3LM9 A;  4Z4G A;  3RMC A;  1RDD A;  4CJF A;  4MLH A;  3C6A A;  2A40 A;  4DR2 K;  3G0Z A;  3RRH A;  2Y1I A;  5AQF A;  4CJE A;  4O8U A;  4C8M A;  4CHY A;  2P9U B;  5AQS A;  5TKW A;  4DS4 A;  4FLT A;  1C0U A;  1IKX A;  3FFK B;  3N4Q A;  1J5E K;  3CG7 A;  1NJX A;  3T1A A;  2A1S A;  3RMA A;  3QBW A;  1DEJ A;  4B9T A;  3F5T A;  3U9D A;  5C2F A;  4H0V B;  4YDU C;  3OYL A;  3NH0 A;  1OVY A;  2GUI A;  3AO2 A;  3HPH A;  4IBN A;  1YIT N;  1JLE A;  4CJW A;  4W5Q A;  4JI0 K;  2NRV A;  3DRR A;  2D5R A;  4FJK A;  4GVE A;  3SAG A;  3HJF A;  4ID1 A;  4CJ7 A;  2V51 B;  1Q81 O;  3TTC A;  1S6P A;  1BI4 B;  3QIO A;  1ATN A;  3DXK A;  3LAL A;  2ZGY A;  3AA3 A;  3OYF A;  4A5A A;  1NGI A;  3K0S A;  1W7A A;  3KK7 A;  1NKC A;  3ZEU B;  1C0M A;  2P9L B;  1GLB G;  3LAM A;  4RWT A;  1N34 K;  2ATQ A;  2QTD A;  4CGI A;  1NOY A;  3B6O A;  4MDB A;  3LDS A;  5JVG L;  5AFU A;  4KTZ A;  3IUC A;  3CJ1 A;  1LOT B;  2HW3 A;  2YKM A;  3TAP A;  3C6T A;  4JK8 A;  4DFM A;  4B3M K;  2P9K B;  1P90 A;  4GW6 A;  2F9W A;  5J2N A;  4LF7 K;  4MO5 A;  1Q9Y A;  1JKH A;  4BWJ A;  1EET A;  2O8D A;  2G8K A;  2OPQ A;  4KAZ A;  4CJQ A;  4FXD A;  2AP1 A;  1VQO N;  4N47 A;  5AQX A;  5KGW A;  1T3V A;  3HRG A;  5LJW A;  3C6U A;  4DSI A;  3NVK A;  2UUA K;  5LY3 A;  4BQL A;  3LZI A;  1TKD A;  3FZH A;  1FJG K;  2F96 A;  4BG8 A;  1SL0 A;  2VWJ A;  1BIZ A;  1LWF A;  1NU0 A;  1VSL A;  2IDO A;  2QKK A;  4M3U A;  2DY4 A;  1U45 A;  3KZB A;  3NF6 A;  4HVJ A;  1HX1 A;  3MCP A;  3HPO A;  3EO3 A;  2B4J A;  3CF5 L;  1SL2 A;  4BQZ A;  2VWB A;  2F7T A;  3E9O A;  4HHT A;  3F9K A;  4BR5 A;  1JLB A;  3SBT A;  4M3T A;  4FLY A;  2YNF A;  3PLA A;  4Z94 A;  1S72 N;  2IC3 A;  3NH1 A;  4PL7 A;  5FRM A;  2HHX A;  2CGL A;  3Q7C A;  4OPA A;  4JHD A;  1LWC A;  3ZET A;  1IKW A;  3ZSW A;  4YNQ A;  5HBM A;  2X6S A;  5LMU K;  3QET A;  1S9E A;  1HNV A;  2JGU A;  3UKU B;  2OZS A;  3KD5 E;  1WSE A;  3CME N;  2YJE A;  4CZM A;  1YTU A;  4F9O A;  1ZBS A;  1X3N A;  2P9N A;  3SUQ A;  4KFB A;  3AAP A;  5AZJ B;  3V1Q A;  3V81 A;  1QSY A;  1QZ5 A;  2WOM A;  4NCG A;  3OA9 A;  1NG9 A;  3SK3 A;  3KK3 A;  3HK2 A;  1EQY A;  4M42 A;  3O3H A;  1W0H A;  2VG5 A;  5M1F A;  2FSK A;  5AQH A;  2OZM A;  3CCR N;  1XNQ K;  4ZTJ A;  3M1F A;  1KFS A;  1T6D A;  4EP5 A;  5CR4 A;  3ID6 A;  2PY5 A;  4DUY K;  2VGM A;  4H0Y B;  1DKG D;  2E6M A;  3DYA A;  1U2V A;  3FZM A;  1IKY A;  1WAF A;  1L3V A;  4J2B A;  2OCE A;  3LM2 A;  3MEG A;  4B3R K;  3J80 O;  4LF6 K;  5CZ2 A;  4MLE A;  3TWH A;  3SAH A;  4CD3 A;  2GV9 A;  1RTJ A;  3MWT A;  4FZZ A;  2E8A A;  1XC3 A;  2OPS A;  3QER A;  1J6Z A;  3L2R A;  1DTT A;  3BZC A;  1ATS A;  1C0F A;  1V4T A;  1ESV A;  4M45 A;  4AF1 A;  3QB0 A;  5AQV A;  3NE6 A;  3DOK A;  1L3U A;  4EP4 A;  4OO1 J;  2Q1N A;  1BGX T;  3UKR B;  2XY5 A;  3DXM B;  1TUU A;  5LMN K;  2HVI A;  4FK4 A;  3LAK A;  3PX4 A;  1RT6 A;  2D0P A;  2O4I A;  4FCY A;  5IT9 O;  3DAW A;  2YX6 A;  4H8K A;  1DGK N;  2OYQ A;  1JLQ A;  1U4B A;  4A61 A;  3LDL A;  1SKS A;  3UKR A;  4EZ6 A;  4CK2 A;  4C8N A;  2NUB A;  4FWQ A;  2NRR A;  4CVN E;  2Z1I A;  2WBN A;  4KHY A;  1HYZ A;  4QS7 A;  4BC4 A;  3S3M A;  2BAN A;  5KRT A;  5BN9 A;  3AO5 A;  5M1P A;  3RR8 A;  4Y0W A;  3R9P A;  1QZ6 A;  4AHC A;  3TAR A;  3MCA B;  3DMJ A;  1BWF O;  3CJA A;  4M41 A;  1VQ4 N;  4W5R A;  2Q36 A;  4CF9 A;  2B6A A;  4EIA A;  1VSK A;  3IDH A;  1TK5 A;  1QQC A;  1QQN A;  2WON A;  3NCI A;  3VQC A;  3OTO K;  1WLJ A;  1XMQ K;  1IG8 A;  1D9F A;  3VA3 A;  3OJU A;  2HST A;  3UIQ A;  4CF2 A;  3HP9 A;  1XMO K;  4EZ9 A;  1EWQ A;  1T05 A;  2KZM A;  2RKI A;  4YOV A;  3ZLJ A;  1LAW A;  2QWP A;  1BIU A;  2DPN A;  1BOT O;  3PX6 A;  1ZBH A;  3MXM A;  1RGI A;  2EHG A;  4NCA A;  1VSM A;  1DTQ A;  1K8A O;  1D5A A;  5BRH A;  4FLX A;  4EAH D;  1BIS A;  3EEQ A;  4CF0 A;  3MN7 A;  1N8R O;  3MN9 A;  4LC9 B;  5GIO A;  1W9H A;  3O4Q A;  3TSQ A;  3J7A P;  5JS1 A;  4B1Y B;  2FXU A;  2G8U A;  1K6Y A;  4ISG A;  1F21 A;  3KTQ A;  1VHX A;  3MX5 A;  4BRI A;  3ZT0 A;  3CFO A;  1VSI A;  2W6L A;  4FK2 A;  5C15 A;  3M8S A;  4I6M B;  3KLG A;  4H5V A;  3WEE B;  2NZT A;  4FJ8 A;  1RBV A;  4HUF A;  4F8R A;  2WUS A;  3CFR A;  4CEQ A;  1BHL A;  4CHP A;  4K8X A;  4JRP A;  4I6M A;  3C7N A;  2VGN A;  1I94 K;  3WEE A;  4FOE A;  1QSS A;  3KVG A;  4FJL A;  2BGG A;  4IZ9 A;  1RBT A;  5M1K A;  4I9Q A;  3WNE A;  1TUY A;  4KPY A;  1KVA A;  4BVP A;  1XHX A;  2YV0 X;  1MWK A;  4IOA L;  3VQD A;  1JLG A;  2O8E A;  1CXU A;  3FGU A;  4GV9 A;  3VQ4 A;  1U6Z A;  2PBD A;  4FWO A;  1RCH A;  1UWB A;  4CFA A;  4ID5 A;  3OHR A;  4CJ3 A;  1HKC A;  4A62 A;  3P39 A;  5BR9 A;  3AVG A;  4HWI A;  1KQS M;  3SQ2 A;  2ZD1 A;  2E2P A;  4FSV A;  3L2V A;  1GLL O;  3HXM A;  4AH9 A;  5FDL A;  4CJ5 A;  3VQA A;  3KIO A;  3VQ5 A;  5M1N A;  1BQN A;  3SMP A;  4JKE A;  3QFU A;  3B6P A;  1NMN A;  2BUP A;  3A8Y A;  3SJH A;  3T7Z A;  2HND A;  4FW1 A;  2W40 A;  3ASM A;  4M3R A;  4BRM A;  2QWL A;  1ZBF A;  3LDP A;  3THY B;  4JRQ A;  4FZX C;  5EXW A;  1HPZ A;  5EVZ A;  4RW6 A;  2G8W A;  4BC5 A;  1WSG A;  3OBY A;  4UY8 O;  3VES A;  3RVC A;  3THY A;  2E2N A;  4CBX A;  4DF8 A;  3SLC A;  3CCE N;  4JEP A;  3AAR A;  4Q0B A;  1X1P A;  4L3Q A;  1TGO A;  4JAX A;  1WBD A;  3CJ9 A;  1VQ6 N;  1E4F T;  4DV4 K;  1Q86 O;  2P9I A;  4JKH A;  2D0A A;  4WF9 L;  1X9J A;  1HYV A;  1GLF O;  2Q3S A;  1NLV A;  2ZWH A;  4JKB A;  4J2A A;  1KSP A;  2FBT A;  5ADX H;  1GLD G;  1TVR A;  2W42 A;  4DU1 A;  1RFQ A;  2EWS A;  1GLE G;  3OS2 A;  4BGB A;  3VQB A;  2XY7 A;  4DUZ K;  1SZ2 A;  3TAN A;  4BVO A;  2KLA A;  1MDU B;  3KLF A;  3NBP A;  1UAX A;  4IXC A;  3O9U A;  4JI3 K;  3TAM A;  4IG3 A;  1WSF A;  3CM6 A;  3VQ9 A;  4KH6 A;  1XUP O;  5AQY A;  3V1R A;  3VMF B;  2WTU A;  1IJJ A;  4DTU A;  1SS6 A;  2O8C B;  4R5P A;  2A5X A;  3D7E O;  1SKR A;  4LH4 A;  3MN6 A;  3QEX A;  3WT0 A;  4GY2 B;  5GIN A;  4FO0 A;  4IEI A;  1NJW A;  3CC7 N;  2ZE2 A;  3NGY A;  3HP6 A;  3DLR A;  3S3N A;  4CIG A;  2Z1J A;  1REV A;  4H5N A;  5AQG A;  3C0B A;  3LDN A;  4HCC A;  1NKB A;  4LSL A;  4BE1 A;  4AHV A;  3V9Z A;  1A5X A;  4WFN L;  2PFU A;  3ZSZ A;  1NKE A;  3EZ5 A;  5AQK A;  1QHT A;  2E1Y A;  4DSJ A;  3J7Y P;  5BR8 K;  3ENB A;  1Q18 A;  4KH4 A;  2OTJ N;  4H4O A;  1W2B M;  3M8Q A;  3GE1 A;  1D4X A;  1NK4 A;  4KHU A;  1A5W A;  4QCL A;  4CHQ A;  3AA2 A;  4CF8 A;  1CZA N;  4NYF A;  1KC8 O;  5LL6 Z;  1P8Z A;  3FLC O;  3VEX A;  3KJV A;  3WXK A;  1HNI A;  4B8A B;  1ZBU A;  3CQX A;  4O8K A;  1BA0 A;  4FOI A;  1RT1 A;  3H3N O;  1BO5 O;  1U48 A;  4KI4 A;  3LDQ A;  3QDK A;  3G71 N;  3HZ6 A;  5KGX A;  3QIN A;  4JLH A;  4CD1 A;  3C95 A;  1JCG A;  3MAQ A;  2PZS A;  3KWI A;  2FBX A;  1VQP N;  4F3T A;  2QXF A;  4CBU A;  1SKW A;  4FJI A;  3FFI A;  1H1V A;  1RDU A;  4DTR A;  3VEO A;  2HVH A;  3QIP A;  3L6Q A;  4YOT A;  3TR8 A;  1BA1 A;  1RTH A;  4WFB L;  4W5T A;  1NGF A;  2Y1J A;  3HSC A;  3SJJ A;  3QIC A;  4M3W A;  2E2O A;  3QML A;  1ZYQ A;  3VEW A;  4DV1 K;  3H3O B;  3TI0 A;  4E7K A;  1ZXO A;  4BRL A;  1BL3 A;  3EY1 A;  4LF9 K;  2E88 A;  4BG9 A;  4K42 A;  3WNF A;  2GBZ A;  3H08 A;  4GMJ B;  1XC9 A;  5E26 A;  2XRI A;  3BZK A;  2YHA A;  4Z0U A;  3V1O A;  4CJR A;  3O9R A;  2F8T A;  3CPE A;  2OPP A;  4CZF A;  3EKU A;  1C1A A;  3LP1 A;  2FC0 A;  3DLL L;  1LW0 A;  4FWL A;  3DXK B;  2W6K A;  3AVM A;  1G15 A;  1JLF A;  3L2W A;  4DTN A;  4F2S A;  1RBS A;  3CFP A;  4PY5 A;  1K73 O;  4O55 A;  1NGH A;  2UXB K;  3R3L A;  3CIP A;  2GX9 A;  4CHN A;  2PYJ A;  3CYM A;  4RG8 A;  3AO3 A;  4E7J A;  4Z4E A;  1CXQ A;  2V52 B;  4BRP A;  1JCE A;  5B8H A;  2DTU A;  1TV6 A;  3HL8 A;  1RT7 A;  1O13 A;  3HBT A;  5BPN A;  1S3X A;  5JLH A;  1HJR A;  4HTL A;  4AM6 A;  3PO5 A;  3IS9 A;  4OVL A;  3ZT4 A;  3M3Z A;  4DU4 A;  4YOX A;  3OYA A;  3AVA A;  1WUA A;  2O8D B;  3ENH A;  3Q7B A;  2P9S A;  3T1H K;  2J4R A;  3NF8 A;  3M6G A;  4KBO A;  3LP3 A;  2QW9 A;  5AQZ A;  4ILJ A;  4FLW A;  3AVH A;  5BRD A;  3L2U A;  4EHU A;  4KV8 A;  5GIP A;  4CHZ A;  1ASW A;  4AHS A;  3MN5 A;  3AAQ A;  3CD6 N;  3OYM A;  4CI6 A;  3S41 A;  4OPJ A;  3G4S N;  4KHW A;  1FK9 A;  1UOC A;  3CCJ N;  2OPR A;  1VSE A;  4JI8 K;  3VGL A;  4H03 B;  4CJS A;  1KFD A;  3OYG A;  3CCS N;  5FLX O;  3OYE A;  3SQ1 A;  5GAE P;  5CHI A;  3BF1 A;  4QAG A;  4CGF A;  4DR7 K;  1BU6 O;  1VQ8 N;  4FWS A;  1WSJ A;  3H46 O;  5CE3 A;  3V9S A;  3BF3 A;  1C0T A;  5KI6 A;  3N4P A;  4PL8 A;  4IDK A;  3AVL A;  5C25 A;  4NO7 A;  1N33 K;  1B9D A;  4BGA A;  1BUP A;  3AO1 A;  3OJS A;  4JHD B;  1N36 K;  1NGG A;  3ZET B;  1S1U A;  5AQT A;  4JI2 K;  5HRO A;  4FK0 A;  1HUX A;  3KHY A;  3WXL A;  4E0D A;  3T1Y K;  1N6Q A;  5KPZ A;  4AM7 A;  1S1V A;  4FJX A;  4NLB A;  1GOA A;  1Q7Y O;  1X9W A;  3ZSV A;  4BRH A;  1Q9X A;  4YOW A;  5GAD P;  3M5R A;  4CK3 A;  2P9N B;  4FZY A;  2X78 A;  3V9U A;  1IO2 A;  4RW8 A;  4O5B A;  4KO0 A;  3FZF A;  4FM2 A;  1HPM A;  2VG6 A;  3QBX A;  5E84 A;  4E1M A;  5KTQ A;  5HRP A;  4CES A;  3CJC A;  4H0X B;  4ZTF A;  3U6F A;  1LV5 A;  2F4V K;  5AQR A;  4TSX A;  4N76 A;  4CEE A;  4FJJ A;  4FJG A;  2O8F B;  3DOL A;  1TAQ A;  3DM2 A;  3D45 A;  1NWK A;  3PUF A;  1J5O A;  2EX3 A;  5GAG P;  4B1V A;  1RTI A;  3DLK A;  2ASM A;  5AQN A;  5FPM A;  1KVC A;  4A59 A;  4DV7 K;  1BDG A;  3BEX A;  5H1S Q;  1U2V B;  2JWK A;  1Z25 A;  2O8F A;  4RCH A;  5FRN A;  2YNG A;  4B9S A;  3K59 A;  1N32 K;  5JLF A;  3EE8 A;  4JS4 A;  1KAX A;  3HST B;  5AQM A;  5FPN A;  2ZF5 O;  4KKO A;  1XHZ A;  4YOR A;  4DHY A;  5SZT A;  3AVI A;  3O80 A;  1QHA A;  1KCF A;  3NGZ A;  1DLO A;  5EX5 A;  2CGJ A;  3O4N A;  2RN2 A;  4LF8 K;  1KD1 O;  1C1C A;  3WUH A;  5JMV A;  1SAZ A;  1JXB A;  1T8E A;  1S1X A;  1RDB A;  3CCL N;  1T44 A;  3HT3 A;  5KQD A;  3PY8 A;  2X6N A;  1N5Y A;  1ZC6 A;  3OYB A;  4ISE A;  4OPK A;  4CEO A;  3I8B A;  4CEZ A;  3BP8 A;  4NLC A;  3VQ7 A;  3JSM A;  3SNN A;  3JYT A;  5I9E B;  5BRE A;  4FW2 A;  3MDQ A;  4C1N K;  4E1J A;  2A1R A;  3WNH A;  2Z1G A;  4HUE A;  4DFP A;  1BCM A;  2Q97 A;  4CGG A;  1NGA A;  5FPD A;  5C2D A;  3ALY A;  3ZYY X;  4OX9 K;  3NFA A;  1DT9 A;  4B9L A;  4CGD A;  4FJ5 A;  1W97 L;  2QKB A;  4B1W B;  1SL1 A;  1Z6R A;  1HR0 K;  1YI2 N;  2PAV A;  4N5S A;  3O08 A;  2QWN A;  1KLM A;  4IO9 L;  3MX2 A;  4XH5 A;  3G25 A;  2VCP A;  3SUN A;  3O9S A;  1ZBL A;  1TYQ A;  4CJT A;  5CY4 A;  1HNZ K;  2KFZ A;  1NK9 A;  3O1B A;  3K58 A;  4O0J A;  4RW9 A;  2B5J A;  5LJV A;  2KQ2 A;  4O5F A;  3TAF A;  4KHQ A;  2A6A A;  3OYI A;  4LY7 A;  3BY5 A;  1Z26 A;  3C6H A;  1VQM N;  2XY6 A;  5F2R A;  2QXL A;  2HF3 A;  3OS1 A;  2YHB A;  4DTM A;  4CZL A;  4B9Q A;  3CCV N;  1KAY A;  3GDQ A;  2YHW A;  1UA0 A;  1U49 A;  4I2P A;  1J9A A;  3CC2 N;  3ZX3 A;  4CHO A;  1RNH A;  4BDY A;  4LF5 K;  3ZT2 A;  4BRF A;  2UUC K;  3EKS A;  3V9X A;  4XH4 A;  1VAZ A;  1RDA A;  4OJR A;  3VF2 A;  3NMU A;  4JD2 A;  1Z05 A;  2DFH A;  1L3T A;  1Q82 O;  2CGK A;  1U47 A;  4F2R A;  2HHV A;  4OKK A;  4FLU A;  1NJI O;  4MO4 A;  4DSE A;  4CEC A;  3VEZ A;  3LZJ A;  3OYJ A;  3ID8 A;  4W5O A;  3K5M A;  3QEI A;  3TSU A;  3C7N B;  1VQN N;  4BY9 C;  2CH6 A;  3G10 A;  4OGE A;  1VSF A;  4CK1 A;  3SQ0 A;  5BPL A;  3THW B;  1WBB A;  4PWD A;  4IEE A;  3A2F A;  4B3T K;  4DR6 K;  3WQT A;  2QWR A;  3KLH A;  4JKG B;  1NOZ A;  4JKA A;  2ZQB A;  5AQJ A;  2VYP A;  5T7B A;  4CF1 A;  4H5W A;  4AQY K;  3VEY A;  3THW A;  3E9L A;  3WNG A;  3PO4 A;  3OYC A;  5AR0 A;  1RDW X;  5ADX A;  2AA4 A;  4N41 A;  2O8E B;  4O44 A;  2R7Y A;  1TKX A;  4JKG A;  3SAF A;  2XY8 A;  1HYS A;  4DV6 K;  3A5M C;  1ASV A;  3TAQ A;  4G9Z A;  5AQQ A;  4E7L A;  1WN7 A;  3D2E A;  4FWP A;  4U67 L;  3VQE A;  4F3O A;  2IAJ A;  3KLI A;  1JL2 A;  1TKZ A;  2E1Z A;  1LAV A;  1YVN A;  3D2F A;  4KHP K;  2Z1H A;  4DQQ A;  4BRO A;  2G8V A;  1C1B A;  2GWK A;  3SPY A;  2FSJ A;  1U04 A;  1S6Q A;  1BG3 A;  3CXC M;  1R0A A;  2RHK A;  4KHN A;  4U7B A;  2NLX A;  4B1Z A;  4BRK A;  3CCQ N;  5JS2 A;  4DS5 A;  3PIP L;  2G8H A;  2AJQ A;  4ZHR A;  4DFJ A;  1OVQ A;  1KTQ A;  3L2Q A;  3CQ8 A;  3VQ8 A;  3U8X A;  5K14 A;  4O4G A;  1EKE A;  1WOQ A;  2X74 A;  4A2A A;  4HCB A;  2QM1 A;  1YIJ N;  4ELV A;  4FJ7 A;  3PSF A;  3F9M A;  4NYN A;  3DLH A;  5C42 A;  3IMX A;  4EFH A;  4CIE A;  4OKJ A;  1HRH A;  1ITG A;  3ZSX A;  1RIL A;  2P9I B;  3D0P A;  3I0S A;  5CYM A;  4GKK K;  4B3S K;  5DM7 L;  4YFU A;  5KPR A;  4K43 A;  2IGI A;  5TKY A;  3NAE A;  2QI2 A;  1HKB A;  4K0K K;  4DF4 A;  1TK8 A;  4OPH A;  4BR9 A;  1K8K A;  1NJY A;  2V7Y A;  3IFR A;  4IDH A;  4B9U A;  4MFB A;  2G8F A;  1MA9 B;  3EN9 A;  3ULE B;  4QS8 A;  4DQR A;  4CJU A;  2CH5 A;  2IIR A;  1CZ9 A;  4GV6 A;  2UYT A;  2ASP A;  2JLE A;  4DR5 K;  4FJM A;  3RMB A;  4E7H A;  1KRP A;  1YJN N;  2HMP A;  1OKJ A;  3A0I X;  3AO4 A;  3ULE A;  5BPM A;  3O3G A;  1RTD A;  3U9Z A;  3DI6 A;  3BDP A;  4KB1 A;  1Y64 A;  4CZI A;  2ZM6 K;  1E3M A;  3NVM A;  3RRG A;  3P38 A;  2BH1 A;  1IBM K;  4DR4 K;  4G1Q A;  3VEV A;  5J2M A;  3K9J A;  4CJV A;  3THV A;  1I3A A;  4A5B A;  3HOS A;  4FWK A;  3BUZ B;  2P5G A;  3LDO A;  1RT3 A;  2FSN A;  3TAE A;  5EOY A;  3AVK A;  2RE2 A;  4AHT A;  4DU3 A;  2D1K A;  3RR7 A;  4DV3 K;  3THX A;  3CHW A;  4FJ9 A;  5A2Q O;  2VQE K;  1B92 A;  5M1O A;  3U3G A;  4CER A;  4M3Y A;  3O9T A;  4JI4 K;  1QVF M;  3P5J A;  2OAN A;  1VQ7 N;  1SV5 A;  3MED A;  3H1Q A;  3PSI A;  2KKZ A;  2HOE A;  4CIF A;  4B08 A;  3OVN A;  3TSP A;  4DSF A;  5E41 A;  1NMD A;  3VA0 A;  3J7Z O;  3U4L A;  4Z4I A;  3LP2 A;  2D0C A;  3UB5 A;  2ASO A;  4WQ4 C;  1V4S A;  2KZZ A;  3O4W A;  5AQP A;  5BRF A;  1HQU A;  4DG1 A;  3KLE A;  1RBU A;  4CFB A;  4IG0 A;  4H5T A;  3P83 D;  5C12 A;  4M3X A;  3IAY A;  3AV9 A;  2VG7 A;  3LPU A;  3TPQ A;  2KHO A;  3MEC A;  4K41 A;  4DMN A;  1VRU A;  4FVM A;  4NXN K;  3NDK A;  4CCH A;  1T6C A;  4AIL C;  3G6E N;  1MWM A;  1XNR K;  3AVJ A;  2G8I A;  1BQM A;  1FKP A;  4BRC A;  2GEL A;  3CC4 N;  2IVN A;  2GWJ A;  4BC3 A;  3WQU A;  4DQI A;  3LL3 A;  3DRS A;  4KTW A;  4IJN A;  3RSE A;  4DR1 K;  2HHH K;  4JYA K;  2GEM A;  4UQG A;  2LSN A;  1OH5 A;  1VQL N;  2FLO A;  4CZK A;  1IH7 A;  1XI1 A; 
#chains in the Genus database with same CATH homology
 3OJU A;  4RW4 A;  1X9W A;  3ZSV A;  4CF2 A;  3HP9 A;  3EYZ A;  3QER A;  1Q9X A;  3UIQ A;  4J2D A;  4EZ9 A;  1T05 A;  2KZM A;  3OYH A;  5KRS A;  1QTM A;  2RKI A;  4CK3 A;  1LAW A;  1J54 A;  4FZY A;  1BIU A;  4FJN A;  2X78 A;  1SUQ A;  4PA1 A;  3V9U A;  3ZSQ A;  3PX6 A;  4B8C A;  1NK8 A;  1IO2 A;  3DLB A;  4RW8 A;  4O5B A;  4KO0 A;  2YKN A;  3RMD A;  3MXM A;  1NK7 A;  1NJZ A;  4FM2 A;  1ZBH A;  2VG6 A;  2EHG A;  4CFD A;  3AA4 A;  4E1M A;  5KTQ A;  4NCA A;  1VSM A;  1RT5 A;  1DTQ A;  3ZSY A;  5HRP A;  1KVB A;  1YTA A;  1D5A A;  1D9F A;  4B9V A;  4CES A;  4E89 A;  3SCX A;  4ZTF A;  3U6F A;  1LV5 A;  2XO7 A;  4FLX A;  2HNY A;  4TSX A;  4N76 A;  4CEE A;  4CJK A;  1BIS A;  4KHS A;  1FXX A;  2HHW A;  4FJJ A;  4OKE A;  4FJG A;  4CF0 A;  3NF9 A;  3DOL A;  1TAQ A;  1T7P A;  1A5V A;  3DM2 A;  5SWM A;  3D45 A;  5EU7 A;  4DFK A;  3QEW A;  4BDP A;  3PUF A;  1TL1 A;  1J5O A;  2EX3 A;  4E19 A;  1RTI A;  3LP0 A;  5HRS A;  1W9H A;  3O4Q A;  3DLK A;  1RBR A;  1KVC A;  3KKS A;  5JS1 A;  2G8U A;  1Z25 A;  1K6Y A;  4Z4C A;  1RDC A;  4I9L A;  2P5O A;  2HMI A;  5FRN A;  1JXE A;  3OYD A;  2E6L A;  2YNG A;  4DTJ A;  4B9S A;  3K59 A;  4JS5 A;  1F21 A;  3KTQ A;  1FKO A;  4JS4 A;  3IRX A;  3HST B;  1WSI A;  5HRN A;  2YNI A;  3ZT0 A;  3LWL A;  3CFO A;  1VSI A;  4KKO A;  4FK2 A;  3M8S A;  1XHZ A;  3M8R A;  4CEA A;  3E01 A;  4Q5V A;  3KLG A;  1VSJ A;  1WSH A;  5SZT A;  2D0B A;  3AVI A;  1JL1 A;  4FJ8 A;  3HO1 A;  4E3S A;  1RBV A;  3QO9 A;  4M3Z A;  4HUF A;  4F8R A;  1KCF A;  3NGZ A;  5HRR A;  3QLH A;  1DLO A;  3DLE A;  3CFR A;  4CEQ A;  1BHL A;  4BAC A;  3O4N A;  3ITH A;  4CHP A;  4CFC A;  1NK0 A;  4K8X A;  4JRP A;  1LW2 A;  2IOC A;  2RN2 A;  1C1C A;  4E7I A;  1JXB A;  1T8E A;  1S1X A;  1VK0 A;  1Y97 A;  3SPZ A;  1QSS A;  4C8L A;  3L3V A;  4RW7 A;  1RDB A;  3I8D A;  4LSN A;  1C6V A;  4FJL A;  4CEF A;  1BI4 A;  3HT3 A;  4Y1D A;  1O1W A;  3QNO A;  3TAB A;  3QEP A;  2X6N A;  3S9H A;  5I3U A;  1N5Y A;  3PY8 A;  3OYB A;  4DTX A;  3OYK A;  2BGG A;  3OYN A;  1RBT A;  5C24 A;  3P1G A;  4OPK A;  3ZSO A;  4C8K A;  4I9Q A;  2ITG A;  2HHQ A;  3V4I A;  3WNE A;  4CEO A;  1S5J A;  3LAN A;  4CEZ A;  3K57 A;  3V9W A;  3VQ7 A;  3JSM A;  3SNN A;  4AHU A;  4KPY A;  3ISN C;  1KVA A;  3JYT A;  1XHX A;  3SUO A;  4CE9 A;  2YV0 X;  4KRF A;  4FW2 A;  3VQD A;  2DFF A;  1JLG A;  4ELT A;  3HVT A;  4OGC A;  2A1R A;  3WNH A;  4BDZ A;  1CXU A;  4CEB A;  2PYL A;  3TAG A;  2Z1G A;  3VQ4 A;  3NF7 A;  1NK5 A;  4HUE A;  4DFP A;  1BCM A;  4DQP A;  4I7F A;  1RCH A;  4Z4H A;  4CGG A;  3AVB A;  3KK2 A;  1UWB A;  4C8O A;  4CFA A;  4DTS A;  3ALY A;  4GVM A;  1TAU A;  3AA5 X;  4ID5 A;  4CJ3 A;  3NFA A;  1EP4 A;  4B9L A;  3ZSR A;  3AVG A;  3M8P A;  4AHR A;  4CGD A;  5D3G A;  2P1J A;  1TL3 A;  4IFV A;  3VQP A;  3SQ2 A;  2ZD1 A;  3AVF A;  3IG1 A;  4FJ5 A;  2QKB A;  5I42 A;  1SL1 A;  2KTQ A;  5HP1 A;  3SI6 A;  3L2V A;  4O0I A;  1D9D A;  3HXM A;  4AH9 A;  4ICL A;  3F73 A;  5FDL A;  2HB5 A;  4CJ5 A;  4CGH A;  4N5S A;  1KLM A;  3VQA A;  3KIO A;  3VQ5 A;  1XWL A;  4N56 A;  2XHB A;  1BQN A;  1RT2 A;  1WAJ A;  3B6P A;  2QK9 A;  4FJH A;  2HND A;  4FW1 A;  4CJP A;  3ASM A;  4M3R A;  5J1E A;  3SUN A;  3MXI A;  4OLB A;  1ZBI A;  3KKR A;  1ZBL A;  3SV3 A;  3SQ4 A;  1ZBF A;  4HTU A;  4CJT A;  5CY4 A;  4JRQ A;  3T3F A;  3U3Y A;  4DSL A;  4FZX C;  5J2P A;  4Z4F A;  1ASU A;  1HPZ A;  3ZT3 A;  1NK9 A;  2KFZ A;  4W5N A;  3K58 A;  4O0J A;  4RW9 A;  2B5J A;  2P51 A;  2E4L A;  2KQ2 A;  4H4M A;  3TAF A;  4RW6 A;  4KHQ A;  2G8W A;  1TK0 A;  3OYI A;  5HLF A;  1WSG A;  4LY7 A;  3LPT A;  1Z26 A;  3MXJ A;  3NGI A;  4KI6 A;  1QSL A;  1UA1 A;  2HHU A;  4FM0 A;  1VSH A;  2XY6 A;  4DF8 A;  4XIU A;  3OS1 A;  2YHB A;  4DTM A;  2BE2 A;  4Q0B A;  1X1P A;  4Z4G A;  1TGO A;  3RMC A;  1RDD A;  4CJF A;  1UA0 A;  1U49 A;  4I2P A;  1J9A A;  3V6D A;  2RF2 A;  2KFN A;  4CHO A;  1RNH A;  2D0A A;  4MQ3 A;  3G0Z A;  4BDY A;  1HYV A;  3RRH A;  3ZT2 A;  3L8B A;  2Y1I A;  4CJE A;  2Q3S A;  4CHY A;  4C8M A;  1QS4 A;  4PQU A;  3V9X A;  3HM9 A;  4DS4 A;  4FLT A;  1RDA A;  4OJR A;  1C0U A;  1IKX A;  2DFH A;  1L3T A;  1YVU A;  3CG7 A;  1NJX A;  3T1A A;  2A1S A;  1U47 A;  4F2R A;  3SYZ A;  1KSP A;  4J2A A;  4KTQ A;  2FBT A;  3RMA A;  3VQQ A;  2HHV A;  4OKK A;  3NH2 A;  4BE2 A;  4FLU A;  4B9T A;  1TVR A;  2VWK A;  2W42 A;  4DU1 A;  3OS2 A;  3VQB A;  4DSE A;  2XY7 A;  4CEC A;  1S1W A;  3OYL A;  3LZJ A;  3NH0 A;  3AO2 A;  2GUI A;  3HPH A;  3OYJ A;  3TAN A;  4KRE A;  4IBN A;  4W5O A;  3K5M A;  3QEI A;  4QOZ B;  3KLF A;  3NBP A;  1JLE A;  1UAX A;  4CGJ A;  4CJW A;  4ELU A;  4W5Q A;  3DRR A;  2D5R A;  3G10 A;  3TAM A;  4IG3 A;  1WSF A;  1VSF A;  1GOC A;  3CM6 A;  4OGE A;  4FLZ A;  3VQ9 A;  4CK1 A;  3HJF A;  3SQ0 A;  4ID1 A;  3V1R A;  1EX4 A;  3ZCM A;  4DTU A;  1S6P A;  3OS0 A;  4PWD A;  1BI4 B;  1HMV A;  3QIO A;  3K5O A;  4R5P A;  1SKR A;  4LH4 A;  3QEX A;  3A2F A;  3LAL A;  1NJW A;  3AA3 A;  3KLH A;  3OYF A;  1NOZ A;  2ZE2 A;  2ZQB A;  3MEE A;  5T7B A;  3NGY A;  4CF1 A;  3HP6 A;  3DLR A;  1X9M A;  4I2Q A;  3S3N A;  4CIG A;  3WNG A;  1NKC A;  3VN5 A;  2Z1J A;  1C0M A;  1REV A;  1HQE A;  3LAM A;  3PO4 A;  2ATQ A;  4CGI A;  3OYC A;  1CLQ A;  2DFE A;  1NOY A;  4HCC A;  3B6O A;  4N41 A;  4O44 A;  2R7Y A;  1NKB A;  1TKX A;  2XY8 A;  3AVC A;  1HYS A;  4LSL A;  3LDS A;  4BE1 A;  4KTZ A;  4AHV A;  2HNZ A;  3V9Z A;  1A5X A;  1ASV A;  3TAQ A;  3KD1 E;  4E7L A;  4B3O A;  2YKM A;  2HW3 A;  1WN7 A;  3TAP A;  3C6T A;  3ZSZ A;  1NKE A;  3VQE A;  4DFM A;  3EZ5 A;  1NK6 A;  4F3O A;  3DLG A;  2IAJ A;  3KLI A;  4GW6 A;  1QHT A;  1JL2 A;  1JLA A;  1TKZ A;  1LAV A;  4B9M A;  2Z1H A;  4DSJ A;  4DQQ A;  5J2N A;  2G8V A;  1EXQ A;  1Q9Y A;  1C1B A;  1JKH A;  4BWJ A;  1EET A;  3QEV A;  3PV8 A;  2G8K A;  3SPY A;  1L3S A;  4H4O A;  1U04 A;  2OPQ A;  2HHT A;  1S6Q A;  1L5U A;  4KAZ A;  3M8Q A;  1KRP A;  4CJQ A;  4FXD A;  1KLN A;  1R0A A;  4N47 A;  1NK4 A;  4KHU A;  1A5W A;  4QCL A;  5KGW A;  5DMR A;  3I0R A;  4CHQ A;  3AA2 A;  4CF8 A;  4NYF A;  4KHN A;  3C6U A;  4DSI A;  2IS3 A;  4FYD A;  3KJV A;  3LZI A;  5JS2 A;  4DS5 A;  1HNI A;  3O3F A;  1TKD A;  2G8H A;  4ZHR A;  2AJQ A;  4B8A B;  4DFJ A;  1TKT A;  2I5J A;  1KTQ A;  2F96 A;  1ZBU A;  3L2Q A;  4WE1 A;  2VWJ A;  1SL0 A;  4PUO A;  3CQ8 A;  3VQ8 A;  1BIZ A;  1LWF A;  1VSL A;  1RT1 A;  2IDO A;  2QKK A;  1U48 A;  4KI4 A;  5K14 A;  5J2Q A;  3QES A;  4M3U A;  2DY4 A;  5KGX A;  4O4G A;  1EKE A;  3QIN A;  3ZT1 A;  3NF6 A;  1U45 A;  4HVJ A;  1D8Y A;  3HPO A;  2X74 A;  4JLH A;  3SUP A;  4HCB A;  3C95 A;  4NCB A;  1VRT A;  2B4J A;  5CYQ A;  4ELV A;  3MAQ A;  1SL2 A;  2PZS A;  4FJ7 A;  4HUG A;  1VSD A;  2FBX A;  4F3T A;  4NYN A;  3DLH A;  2QXF A;  4HHT A;  1RT4 A;  3F9K A;  5C42 A;  1JLB A;  4M3T A;  1SKW A;  4FJI A;  3FFI A;  4DTR A;  4CIE A;  4OKJ A;  2KW4 A;  1HRH A;  3KK1 A;  4FLY A;  1ITG A;  2YNF A;  3ZSX A;  1RIL A;  2HVH A;  3QIP A;  3D0P A;  2RPI A;  2IC3 A;  3BGR A;  3I0S A;  5CYM A;  1I39 A;  4YFU A;  3NH1 A;  1T03 A;  3SV4 A;  3TR8 A;  5FRM A;  1RTH A;  2IGI A;  4W5T A;  2Y1J A;  3NAE A;  2HHX A;  2F8S A;  3SJJ A;  4DF4 A;  4M3W A;  1TK8 A;  1LWC A;  3ZSW A;  1IKW A;  4YNQ A;  3NHG A;  1ZYQ A;  5HBM A;  2X6S A;  1NJY A;  3RWU A;  3TI0 A;  4E7K A;  3QET A;  2JGU A;  1S9E A;  1HNV A;  1J53 A;  2OZS A;  1BL3 A;  3EY1 A;  3KD5 E;  3OY9 A;  1WSE A;  4B9U A;  4MFB A;  2G8F A;  3PX0 A;  3WNF A;  3S3O A;  1YTU A;  2GBZ A;  4DQR A;  3H08 A;  4CJU A;  4IKF A;  4LD0 A;  4OLA A;  4GMJ B;  1XC9 A;  1X9S A;  4CED A;  3C94 A;  1CZ9 A;  3RTV A;  2XRI A;  3SUQ A;  2JLE A;  4FJM A;  2YHA A;  4KFB A;  4Z0U A;  3V1O A;  4CJR A;  4E7H A;  1S1T A;  3V1Q A;  3V81 A;  3RMB A;  2F8T A;  3AO4 A;  3O3G A;  1RTD A;  4BE0 A;  2WOM A;  1QSY A;  4NCG A;  2OPP A;  3DI6 A;  3BDP A;  4KB1 A;  1C1A A;  3LP1 A;  2FC0 A;  3KK3 A;  3HK2 A;  4M42 A;  1LW0 A;  3RRG A;  3O3H A;  4B9N A;  3AVM A;  4DTP A;  1G15 A;  3L2W A;  1JLF A;  1W0H A;  2VG5 A;  4G1Q A;  1JLC A;  4DTN A;  1RBS A;  5J2M A;  2BDP A;  4F2S A;  3CFP A;  4CJV A;  1CZB A;  1BCO A;  1I3A A;  4O55 A;  3LWM A;  3THV A;  2OZM A;  4PY5 A;  4ZTJ A;  4LH5 A;  2P5G A;  1KFS A;  4EP5 A;  1RT3 A;  4CHN A;  2PYJ A;  3TAE A;  2PY5 A;  3HPG A;  1IKV A;  3CYM A;  3AVK A;  4RG8 A;  3AO3 A;  4E7J A;  4AHT A;  4Z4E A;  1CXQ A;  1YT3 A;  2E6M A;  4DU3 A;  3RR7 A;  3DYA A;  1IKY A;  1WAF A;  1L3V A;  3VQ6 A;  4FJ9 A;  2DTU A;  3QNN A;  1S9G A;  4Y1C A;  4J2B A;  3MEG A;  1TV6 A;  4DLG A;  3HL8 A;  5CZ1 A;  5CZ2 A;  1B92 A;  1RT7 A;  3K5L A;  3TWH A;  2O4G A;  1HJR A;  2GV9 A;  3U3G A;  4CER A;  1B9F A;  4E1N A;  4M3Y A;  3P5J A;  1RTJ A;  3PO5 A;  1SV5 A;  3MED A;  3IS9 A;  4OVL A;  3ZT4 A;  4FZZ A;  4IFY A;  2OPS A;  4CIF A;  4DU4 A;  1QE1 A;  4B08 A;  1Q8I A;  1LWE A;  3OYA A;  3AVA A;  3OVN A;  1DTT A;  3T19 A;  3L2R A;  4DSF A;  5E41 A;  3K5N A;  4DTO A;  3VA0 A;  4DWI A;  3NF8 A;  4Z4I A;  4DLE A;  3LP3 A;  4FLW A;  4M45 A;  3AVH A;  3L2U A;  3LP2 A;  2D0C A;  4KV8 A;  4CJL A;  4CHZ A;  3NE6 A;  1ASW A;  4AHS A;  3DOK A;  1L3U A;  2KZZ A;  4EP4 A;  1BGX T;  1HQU A;  2XY5 A;  4DG1 A;  3OYM A;  1IG9 A;  4OPJ A;  2HVI A;  3KLE A;  4FK4 A;  3LAK A;  3PX4 A;  1RBU A;  1RT6 A;  4CFB A;  4IG0 A;  2O4I A;  4KHW A;  1FK9 A;  4FCY A;  1UOC A;  3P83 D;  4H8K A;  2OPR A;  1VSE A;  2OYQ A;  4L8R B;  4CJS A;  1JLQ A;  4M3X A;  4J2E A;  3SZ2 A;  1KFD A;  3OYG A;  1U4B A;  1SKS A;  3IAY A;  3AV9 A;  4EZ6 A;  2VG7 A;  4CK2 A;  4C8N A;  3OYE A;  2NUB A;  3LPU A;  3SQ1 A;  3MEC A;  2Z1I A;  2YNH A;  4FJK A;  4DMN A;  1VRU A;  1WNS A;  1HYZ A;  4FVM A;  4KHY A;  4QAG A;  3S3M A;  3NDK A;  4CGF A;  5DK5 A;  4CCH A;  2BAN A;  3AVN A;  5KRT A;  4AIL C;  1WSJ A;  4DSK A;  3AO5 A;  3RR8 A;  4BWM A;  3V9S A;  1C0T A;  3AVJ A;  5KI6 A;  2G8I A;  1BQM A;  2HHS A;  1MU2 A;  3L3U A;  4IDK A;  3AVL A;  3DRP A;  5FRO A;  5C25 A;  4FLV A;  1FKP A;  4AHC A;  3TAR A;  4CJ4 A;  1B9D A;  4DQS A;  3DMJ A;  3AO1 A;  1GOB A;  3K2P A;  3OJS A;  4M41 A;  4FM1 A;  2FBV A;  4DQI A;  2FBY A;  4W5R A;  4KB0 A;  3DRS A;  4CF9 A;  2B6A A;  4KTW A;  1S1U A;  2ETJ A;  3CM5 A;  5HRO A;  3ULD A;  1VSK A;  4FK0 A;  3HYF A;  1TK5 A;  3HVR A;  1QQC A;  4UQG A;  2LSN A;  4K8Z A;  4E0D A;  2WON A;  3NCI A;  1N6Q A;  3VQC A;  4F4K A;  1WLJ A;  1S1V A;  4FJX A;  1IH7 A;  1XI1 A;  3VA3 A;  2OA8 A;  1GOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...