2R7YA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*CP*GP*AP*CP*A)-3')
publication title Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2r7yA00
4BACA 3EZ5A 2D5RA 4K8ZA 2VG6A 2VWKA 3CG7A 4O0JA 4HUFA 4F2SA 4N41A 2P5GA 3ZSYA 4HUGA 4B9UA 4DSFA 3OYKA 1RTJA 3KD5E 1JLCA 4HTUA 4RG8A 1KSPA 4CF2A 3THVA 1ASWA 3S3OA 4C8KA 4BE1A 3CYMA 4FJIA 3MECA 2HHSA 2D0CA 3HPOA 1SUQA 1Q9YA 4AH9A 4CEOA 4ZHRA 5SZTA 4FJ8A 4KHSA 3AVMA 1RT3A 3OYCA 3K5NA 3VA0A 4BDYA 1A5XA 3LAKA 4KHQA 1KCFA 4R5PA 2YNGA 1HJRA 3ZSWA 4N76A 1VSKA 4I7FA 1C0TA 4Z4EA 1D9DA 4OPJA 4DSLA 2YNFA 4CESA 4CERA 4M42A 3L2UA 4CJSA 1GOAA 1LW0A 1RT1A 3S3MA 4EZ6A 4KHWA 4QCLA 3OVNA 1O1WA 1BCMA 3NE6A 5HRNA 3O4NA 1L3SA 4DFMA 3DMJA 4JRPA 1S1WA 4ZTFA 3KK3A 1RNHA 3DLEA 2DY4A 2IAJA 2VG7A 3PV8A 1IKXA 2X74A 3CM5A 1BL3A 4CIEA 4M41A 4CFBA 1RT5A 3SUOA 2HHUA 2DFEA 2KFZA 3OS1A 3ZT4A 4DF4A 1SL1A 4E19A 4CGHA 3RR7A 3MEDA 3JYTA 4AHCA 4IG0A 3L2RA 1RBSA 1MU2A 4OKKA 4CHPA 1RBTA 1XHXA 4O0IA 1HNIA 3RMBA 3SQ4A 1L3UA 2BGGA 4DLGA 3AA4A 1NK8A 3NH2A 1C1CA 2XHBA 3NH1A 2RPIA 3CFOA 2KFNA 1TV6A 1RT4A 4CJ5A 4FLYA 2PYJA 4EP4A 3DOKA 3P1GA 3V9ZA 4N5SA 4KFBA 3QEPA 3TAQA 4CHNA 1WN7A 4FJXA 4F8RA 1ZBLA 3VQPA 3K57A 2VWJA 1UAXA 3IG1A 2HB5A 5KRTA 3HP6A 3EY1A 4RW7A 3V9SA 5J2MA 2Z1GA 3ZSXA 1A5WA 5KGXA 3KLGA 2O4IA 2GV9A 3NF7A 4DF8A 4FLTA 2IS3A 2IDOA 3KKRA 4CEEA 3KD1E 1J9AA 1GOBA 3KKSA 3ZCMA 3L2VA 2GUIA 1HPZA 5KI6A 3F73A 1QSYA 3V1RA 3HPGA 2G8UA 1WSHA 1C0MA 4OJRA 1CZBA 1TKTA 1G15A 3HP9A 1ZBFA 4ICLA 4YNQA 3CQ8A 3SQ0A 1U49A 4CIGA 4M3RA 3MEGA 1ZBUA 5J2PA 3IAYA 3A2FA 3V9UA 4LY7A 2OYQA 2FBYA 3IS9A 2XRIA 4DQQA 3DRRA 1JLGA 4H8KA 2BE2A 4NCGA 1LWCA 4EZ9A 4IDKA 4NCAA 1XHZA 4FK4A 2KZMA 1NK5A 1QQCA 2PYLA 4E7JA 1JLBA 3I8DA 3SV4A 3U3YA 4JS5A 2Z1JA 5FDLA 3ZT3A 1D8YA 4FJNA 3V1QA 4OKJA 3SQ1A 1TKDA 1RTDA 1KVAA 4DSJA 4IFYA 2RF2A 5T7BA 2FBXA 1BHLA 4KI4A 2G8FA 4Q0BA 1X9WA 1LAVA 4DFJA 4FZXC 3HVTA 4RW6A 3VQ7A 1KLNA 3TI0A 1TL3A 3VQBA 5I42A 4B9NA 1NOYA 4UQGA 1KTQA 3T19A 4GW6A 1WLJA 1W0HA 1JLQA 4QOZB 3QIOA 4CJKA 2IC3A 1QTMA 3LDSA 1VSDA 5C25A 2G8IA 1F21A 3LP3A 4I9LA 3OS2A 2XY5A 3SPZA 2YV0X 3MEEA 4KTZA 3AO2A 4KRFA 4E7IA 2O4GA 3KK1A 2HHWA 4KI6A 3ALYA 4PA1A 1TK0A 3K5LA 4FJLA 3O3GA 1JXBA 4NYFA 3AVCA 4CEDA 4B9MA 1SL0A 4M3XA 4KHYA 4FZYA 3WNHA 4DTSA 4ID5A 4FLZA 1VSJA 2R7YA 3VQ6A 1D5AA 4KTWA 1DTTA 1S6QA 4O5BA 1X9MA 1L5UA 3KTQA 2HW3A 2RN2A 3NGYA 1C6VA 4QAGA 3UIQA 4DTUA 3WNEA 3DLHA 4BDPA 2QXFA 3HVRA 4HHTA 4CFCA 3AO3A 2I5JA 4CJWA 1NKCA 3AVGA 1B92A 3P5JA 3KLIA 4CGDA 4B08A 1ZYQA 3RR8A 4FJ5A 3TAGA 3AV9A 4C8NA 1VSMA 4LD0A 3QESA 1KVBA 3VQCA 2OPPA 3H08A 1Q9XA 3SUQA 3HL8A 1SKSA 4G1QA 1K6YA 4AHRA 2Y1IA 2WONA 4F4KA 2E6MA 4IG3A 4CK3A 4DTNA 4CEQA 1XI1A 2G8KA 3VA3A 2ZD1A 4ELTA 3S9HA 1RDBA 5HROA 3ZSQA 3NDKA 3TR8A 1J53A 1I3AA 4JLHA 4PUOA 1BIZA 3VQEA 1WAFA 1LWEA 3TANA 3ASMA 4O4GA 1NJYA 2EHGA 4CEFA 2EX3A 2KW4A 4GVMA 4CEAA 3G0ZA 3O3FA 4DSEA 3QNNA 3V81A 4KAZA 1XWLA 1JLAA 3AA2A 4Y1CA 1T7PA 1YTUA 4LH4A 2OZMA 3DLKA 3VQ4A 3ZT1A 1NKBA 2PY5A 3LPUA 3SI6A 3NGZA 4KO0A 2HHXA 3M8QA 3LZIA 1RCHA 4CEZA 3C94A 1Q8IA 4B9TA 3RMCA 4M3ZA 1NOZA 4C8MA 3L2QA 3OYFA 2P5OA 1QS4A 2XY8A 3SYZA 1U04A 3B6PA 1VSHA 3M8SA 3SNNA 2OZSA 1CXUA 3K58A 1X1PA 1JXEA 1HNVA 2HHQA 1TKZA 4E1MA 3TARA 3CM6A 4FW2A 1TAUA 1HYSA 4W5TA 4KHNA 4B9VA 1HQEA 1WAJA 5CY4A 3EYZA 3QERA 1EXQA 4DLEA 3DOLA 4CGGA 1I39A 4Z4HA 1FXXA 4DFPA 1FKPA 3ZT2A 2YNIA 4EP5A 2DFFA 3DRSA 3AO1A 4CF1A 4JS4A 3NF6A 4RW8A 5EU7A 2P1JA 4BE0A 5C24A 1XC9A 4CCHA 1T8EA 3LP0A 4PY5A 4DG1A 4RW9A 4FK0A 4KB1A 4KTQA 3HO1A 5I3UA 4CGJA 4FLVA 4FJJA 4ELUA 3QEIA 3B6OA 4Z4FA 1S1XA 2X6SA 1NK6A 1HRHA 3LANA 4Z4CA 4B3OA 4CFDA 4FJGA 4FJ7A 4K8XA 3DRPA 2HHVA 5FRMA 4Y1DA 2HNZA 4FJHA 1LWFA 3ZSZA 3DLRA 2OPSA 5SWMA 4DMNA 3C6UA 1CXQA 3DYAA 4C8LA 3V4IA 3QNOA 1S1UA 5K14A 1KFSA 4NCBA 4Q5VA 3OYLA 4CJTA 2HVHA 4I9QA 4AHTA 1D9FA 3WNGA 3NF9A 3U3GA 3HXMA 3VQAA 2KQ2A 5DK5A 4FZZA 3ITHA 3FFIA 3WNFA 4FLUA 3I0RA 3OYHA 3AA5X 4DTMA 1FKOA 5CYQA 4FJMA 2B4JA 1RT6A 4WE1A 1RTHA 1S9EA 1TK5A 1C0UA 4FVMA 2HVIA 4YFUA 3BDPA 1SV5A 1QSLA 4OLAA 4B8CA 3NFAA 4MQ3A 3V6DA 3AVIA 1RDAA 4HCBA 2AJQA 3C6TA 3RTVA 4FJKA 1BI4A 1JLFA 3HSTB 1RDCA 3ZSVA 4CF8A 3OJSA 4BE2A 3HPHA 3I0SA 1LW2A 3L8BA 3KLEA 1NK0A 4J2EA 4ELVA 4E7KA 4OGCA 3PO5A 3JSMA 3PO4A 3QEXA 1N5YA 5J1EA 1L3TA 4J2BA 4FYDA 4CJ3A 4DTJA 3OYGA 5HRRA 2E6LA 1TGOA 1CLQA 3HM9A 3KJVA 2ETJA 3OS0A 3KK2A 1SL2A 3HYFA 2YNHA 4CJQA 1YTAA 3QEVA 5JS2A 2F8TA 1UOCA 3F9KA 1L3VA 4B9SA 5HRSA 4F2RA 1KFDA 4DU4A 1VSEA 4DU3A 1IH7A 2YKMA 3NF8A 1NJWA 2JGUA 1WSIA 3TAMA 3AVKA 1NKEA 4KREA 1B9DA 4DTXA 3ULDA 4KHUA 2Q3SA 2DTUA 1RT7A 1Z26A 4CF0A 2NUBA 4FM2A 4J2DA 4W5QA 3LPTA 3C95A 1FK9A 2GBZA 3IRXA 3DLBA 1LAWA 1NK7A 4E1NA 1A5VA 1S1VA 2BANA 2A1SA 1KLMA 5C42A 4OPKA 4FXDA 3MAQA 2IOCA 4Z0UA 4DQRA 4F3TA 1SKWA 1BCOA 1S5JA 5J2QA 1BGXT 3LZJA 2HHTA 4CHQA 3OY9A 4HUEA 3U6FA 4W5NA 3T3FA 3HJFA 4DTRA 5JS1A 4FLWA 1DLOA 4CJEA 1EKEA 2FBVA 4CJFA 3SPYA 5FRNA 2X6NA 5HLFA 1S9GA 4CGFA 3QEWA 3SUPA 3S3NA 4W5RA 4ID1A 2E4LA 1J54A 1SKRA 4DQPA 3V1OA 3G10A 1IKYA 3MXJA 4CHOA 1TL1A 1QHTA 5D3GA 2ZQBA 4CJRA 3SQ2A 4HVJA 4FCYA 4CGIA 1WSFA 1GOCA 1RILA 4XIUA 3RMAA 2OPRA 4CK1A 1ASUA 3L2WA 3TABA 1IG9A 4NYNA 4DWIA 1ZBIA 3TWHA 3SV3A 2WOMA 4TSXA 2XY6A 3LWMA 1EETA 1YVUA 4E7HA 1RBVA 4AHSA 5E41A 4IFVA 4DS4A 4M3TA 4DU1A 1S1TA 4CECA 1QSSA 2BDPA 3TAEA 1HQUA 1RBRA 3QINA 3NBPA 2Z1HA 3D45A 2JLEA 1S6PA 3O3HA 3RMDA 3ISNC 4AHUA 4FM1A 1HYZA 3SUNA 4BWMA 4L8RB 1VSIA 1HYVA 1KVCA 1Y97A 2D0BA 4CJPA 1N6QA 4OKEA 1HMVA 2YKNA 3K5MA 1EX4A 1NK4A 2KZZA 3NGIA 2IGIA 4OLBA 3QETA 2A1RA 1WSEA 3RWUA 1WSJA 3BGRA 3P83D 4CJVA 4PWDA 2FC0A 1ASVA 3QLHA 5CYMA 3VN5A 3AO5A 2Y1JA 3PX0A 1UA0A 2QK9A 2PZSA 3RRGA 1Z25A 2P51A 2ATQA 1U47A 2F96A 4JRQA 3VQ5A 3DM2A 1VRUA 1YT3A 3KLHA 3O4QA 5HBMA 4B8AB 3OYIA 3SZ2A 1BQMA 4DTOA 4Z4GA 4AILC 5KRSA 2B5JA 3AVHA 4M3WA 2VG5A 1JKHA 2HMIA 4N47A 5KTQA 4KPYA 1TAQA 3AVFA 1UWBA 4H4OA 4FLXA 4GMJB 2DFHA 4PQUA 1WNSA 3K2PA 3V9WA 3KLFA 1EP4A 4M45A 4J2AA 3TAFA 3D0PA 1VSLA 2X78A 1C1BA 3LALA 2YHBA 4N56A 2XO7A 3PX4A 4E89A 3HT3A 3L3VA 4M3UA 2HNYA 1WSGA 5CZ2A 4CEBA 3M8RA 3AVAA 1DTQA 2YHAA 3ZSOA 4DFKA 3NHGA 1LV5A 4W5OA 4CF9A 3PX6A 3QIPA 2D0AA 3LP2A 4CJLA 3MXMA 2FBTA 1IKVA 2HNDA 4IBNA 3K5OA 3VQQA 3DLGA 3OYAA 3TAPA 4OVLA 4LSNA 1RT2A 3AA3A 1JL1A 3NAEA 3T1AA 3AVBA 4DQSA 1U4BA 3OYEA 1JL2A 4BDZA 1W9HA 1JLEA 3LWLA 4CIFA 2OPQA 1VRTA 3CFPA 3SCXA 4LH5A 2B6AA 1IKWA 3OYNA 5HRPA 4FK2A 1BIUA 2F8SA 4RW4A 3RRHA 2OA8A 3VQ8A 3ZT0A 3LAMA 5J2NA 1BISA 5CZ1A 4KKOA 3VQDA 1BQNA 1RBUA 1U45A 1UA1A 4E0DA 3KIOA 2ITGA 1REVA 5KGWA 4I2QA 1VSFA 4H4MA 3AO4A 3VQ9A 4M3YA 4O44A 3L3UA 4I2PA 4DQIA 3NH0A 2Z1IA 2KTQA 1RDDA 3NCIA 4FM0A 3V9XA 5HP1A 1NJZA 1T05A 3LP1A 1TVRA 4KB0A 1C1AA 4F3OA 3OYBA 4MFBA 3PY8A 3AVLA 2W42A 1VK0A 4ZTJA 1X9SA 3OYMA 4CHZA 1R0AA 3AVJA 3OYDA 1J5OA 2ZE2A 1NJXA 1TK8A 3PUFA 4C8OA 1CZ9A 1ITGA 2G8WA 4CJ4A 3CFRA 4FJ9A 3OJUA 1T03A 2G8HA 1U48A 3K59A 2QKKA 1B9FA 4DS5A 4HCCA 4IKFA 4OGEA 1ZBHA 4Z4IA 4CE9A 4CFAA 4LSLA 3OYJA 5FROA 3M8PA 1TKXA 4CHYA 4E7LA 5DMRA 1KRPA 4BWJA 4B9LA 4DSIA 2QKBA 3MXIA 3HK2A 2LSNA 4AHVA 4DSKA 4O55A 4E3SA 1QE1A 4DTPA 2XY7A 1IO2A 4CJUA 3SJJA 3QO9A 3ZSRA 1BI4B 2RKIA 4CK2A 4FW1A 4KV8A 1NK9A 1RTIA 3DI6A 3E01A 2G8VA 3AVNA
chains in the Genus database with same CATH superfamily
4BACA 4K8ZA 2VG6A 4F2SA 2NRHA 1DKGD 2QWMA 4HUGA 3THXB 3ZX0A 1KSPA 3HPOA 1Q9YA 4KHSA 3EE9A 3AVMA 3OYCA 4BRQA 3LAKA 4FPAA 4KHQA 4R5PA 2YNGA 5M1FA 3KK7A 1C0TA 4OPJA 4EAHD 4M42A 1GOAA 2P9LA 5LL6Z 5HRNA 3O4NA 1ATNA 1IBKK 3DMJA 3PSIA 2IAJA 4FOIA 2D4WA 3PV8A 1IKXA 5H1SQ 1RT5A 2HHUA 4E19A 4CGHA 3RR7A 3MEDA 4AHCA 1RBSA 2FSJA 4EIAA 1RBTA 3RSEA 3R1XA 1GLDG 1HLUA 3R6MA 4DLGA 1NK8A 3NH2A 5M1KA 2XHBA 3NH1A 3B8AX 4BC4A 3QICA 4YORA 4FLYA 2GELA 4EP4A 3QEPA 3K0SA 3LDNA 3IG1A 4H0PA 3FZLA 5KRTA 2YI1A 3V9SA 2Z1GA 5KGXA 3CCLN 2CGJA 4DR5K 4DF8A 4FLTA 5EOYA 4B1WB 4CZMA 3L2VA 2GUIA 1WSHA 4OJRA 4CIGA 4H0VB 3IS9A 3CCEN 4LF4K 3MN6A 4DQQA 2HBMA 4NCGA 4WFBL 1EQYA 2KZMA 3MWTA 4UY8O 4E7JA 1JLBA 2NRVA 3SV4A 3U3YA 1D8YA 4DKWA 4DCHA 4OKJA 1T6CA 4IFYA 1BHLA 2G8FA 3MCAB 3U8XA 2OTJN 4DFJA 3WXIA 2RE2A 4UQGA 1WLJA 1JLQA 3QIOA 2IC3A 1VSDA 1ZXOA 4KRFA 3KK1A 2HHWA 3VEVA 3L4IA 4PA1A 4H5WA 2CGKA 3UKRA 2J4RA 3ULEB 3O3GA 3H6EA 3EZWA 4FZYA 4DTSA 2VQFK 4ID5A 4BC3A 3KTQA 3RVCA 1DTTA 1Z6RA 2H3GX 4FWSA 4JD2B 3DLHA 2QXFA 3HVRA 4HHTA 4CFCA 3CCSN 4PKHA 3AVGA 3RR8A 4CGDA 4B08A 4C8NA 1VSMA 2OCEA 3M6GA 5FPMA 2ITMA 5M1QA 1VQON 1SKSA 2HSTA 1ESVA 4IG3A 4PHTX 1XI1A 4EHTA 5HROA 2D0PA 1YITN 4JLHA 3L6QA 3TANA 4O4GA 1NJYA 3DLLL 3EL2A 3V81A 4YHHK 1U2VB 3AA2A 1GLJO 3WXJA 3DLKA 3ZT1A 3CJCA 3SI6A 5AQOA 4KO0A 5TKWA 3J7YP 2AA4A 1S3XA 4WCEL 3L2QA 2V7ZA 1EWRA 1VSHA 3SNNA 1OVQA 1CXUA 1HNVA 3MN5A 4E1MA 4FW2A 4DV3K 4W5TA 4B9VA 3QERA 4DLEA 3DOLA 4Z4HA 4EP5A 3ZT2A 1TUUA 2UXCK 4BE0A 5AQJA 3K9JA 3H1VX 5I3UA 3WXKA 5A2QO 5F1XA 3QEIA 1S1XA 1NK6A 1HRHA 4FJ7A 3DRPA 5EX5A 2HHVA 5FRMA 4Y1DA 2YHYA 1CXQA 4PL7A 3DYAA 4IFEA 1S1UA 2NRXA 1KFSA 2E2QA 3O8MA 3CJ9A 3NF9A 3SJHA 3O6WA 1WOQA 3C65A 3AA5X 3FZKA 5CYQA 4FJMA 1RT6A 1E4FT 1S9EA 4IOCL 1SV5A 5AQFA 1SQKA 2QI2A 1RDAA 4IO8A 3OJSA 4CF8A 4M63C 3KLEA 1NK0A 3TTFA 3JSMA 3CHWA 4FYDA 5C15A 3MN7A 3IFRA 4GV9A 1TGOA 3FR0A 3KJVA 5ADXA 3OS0A 4K0KK 2YJFA 4A5BA 5C2DA 3QEVA 3SK3A 4B9SA 4F2RA 1KFDA 4DU3A 1IH7A 1NJWA 5AQQA 2JGUA 3TAMA 3AVKA 4KREA 4YDUC 4KHUA 4GVEA 1RT7A 3A0IX 2KKZA 3C95A 3GG4A 1SZ2A 2EWSA 1EWQA 5C42A 4LFBK 2PBDA 2IOCA 5J2QA 1BGXT 4CHQA 3OY9A 3ID8A 4JKEA 3R3LA 2O8FB 4W5NA 5JS1A 3SPYA 5HLFA 4NLCA 1S9GA 2O8DA 4CGFA 3QEWA 4FWKA 1WUAA 4LF8K 3S3NA 3V1OA 3G10A 4ISFA 5D3GA 2KHOA 4FCYA 1IJJA 5GAGP 1QHAA 1HJOA 3GBTA 1RILA 3BY5A 3RMAA 1IG9A 1N33K 4BRAA 1Q82O 1EETA 1YVUA 4JKGB 4AHSA 4IFVA 2IVOA 1HQUA 1RBRA 3QINA 1O13A 2Z1HA 4JEPA 2JLEA 1OH5A 4FM1A 2D1KA 1VQ4N 1KVCA 2D0BA 3K5MA 4I6MA 3WXLA 4KH4A 3NGIA 2IGIA 5EXWA 2A1RA 3CCMN 1KQSM 3RWUA 1WSJA 2BTFA 2FC0A 4IEIA 3QLHA 3AO5A 2QK9A 3BZKA 3SBTA 1IV0A 1XMOK 1K73O 4Z4GA 1HNZK 4AILC 5AJ3K 2B5JA 1NGGA 3WQTA 1SAZA 1Q81O 2ZGYA 2VG5A 3HM8A 2HMIA 5KTQA 3AVFA 2O8BA 3V9WA 2UXDK 1EP4A 4M45A 4J2AA 2HBKA 1GLFO 1NMDA 2X78A 4N56A 3HT3A 4A62A 5ELZA 2VGNA 3AVAA 1DTQA 1LV5A 1G99A 2P9NB 4ILJA 4CF9A 1KD1O 2E8AA 3MXMA 4GNIA 2HNDA 1NNEA 3VQQA 3OYAA 3TAPA 3T69A 4BRKA 3NAEA 3T1AA 1U4BA 5GADP 1NU0A 4BG8A 3LWLA 3LDQA 2B6AA 5AQVA 5HRPA 4OPAA 1BIUA 4RW4A 3RRHA 1WB9A 5AR0A 5J2NA 4H5NA 1OH7A 4DHYA 1UA1A 4LC9B 1REVA 4X64K 4I2QA 4FWLA 3FLCO 2KTQA 3O1WA 4F3OA 3PY8A 3AVLA 1E3MA 3UKUB 1R0AA 2VQEK 1NJXA 4LFAK 3CFRA 5AQGA 4FJ9A 2Q0UA 3A5MC 5LJWA 2QKKA 5AQYA 2HOEA 2P9KA 4OGEA 2V52B 2NLXA 1FW6A 2P9IA 4U67L 5FROA 3G4SN 4E7LA 1TYQB 4BWJA 5AQNA 1QE1A 3SJJA 1JCFA 2QW9A 2RKIA 3W0LA 5AQWA 2G8VA 3AVNA 1NWKA 2D5RA 1K8KB 4KH5A 4O0JA 1N34K 1YHQN 5BPMA 4B9UA 3CJ7A 2ZJPL 1RDUA 4HTLA 4RG8A 1ASWA 1DGKN 3TPQA 2QA4N 3MCPA 4FJ8A 3IUCA 4BDYA 1GLAG 3BF1A 1HJRA 3ZSWA 4CZFA 4N76A 4DSLA 3VTIA 5KPRA 1HKGA 4EZ6A 1RT1A 5CE3A 4CZJA 2GTDA 3O9RA 4EHUA 3K9KA 4A5AA 4JRPA 4ZTFA 1FJGK 4BRGA 2OANA 4K42A 1BL3A 2A6AA 3T7ZA 2Q97A 2A40A 2DFEA 3GOIA 3KWIA 3ZT4A 4DF4A 1SL1A 4LF6K 3JYTA 4BR4A 4WF9L 1MU2A 1NGBA 4X66K 1P90A 3RMBA 1N8RO 1GLBG 1TV6A 5I9EB 3P1GA 4JKDA 4N5SA 5FPDA 4MLHA 1HX1A 3VQPA 2VWJA 4B9MA 2HB5A 1A5WA 2O4IA 4K25A 2IDOA 3KD1E 2UUCK 3LDOA 3C6HA 1HPZA 2G8UA 1C0MA 4H5TA 2P9LB 1CZBA 5JMVA 2Q2RA 3WEEB 1NM1A 3SQ0A 1GLLO 4B1ZA 4M3RA 2W40A 3CMAN 3J8AA 4FWNA 3EKUA 4YY3K 3DRRA 1LWCA 4IDKA 4BC2A 5AFUA 1Y64A 4FK4A 3DAWA 3I8DA 4JV5K 3N4PA 2F4VK 2Z1JA 4PKIA 3W3DA 3V1QA 4JI5K 3SQ1A 1RTDA 1KVAA 4DSJA 5T7BA 2RF2A 4KI4A 4Q0BA 3U4LA 3HVTA 4RW6A 1KLNA 3H3NO 5I42A 2RHKA 4B9NA 3DJCA 4BR0A 3G6EN 1W0HA 2CH6A 4CJKA 1QTMA 3LDSA 3SPZA 2XY5A 1TUYA 2VCPA 2YV0X 2O4GA 4JKHA 3CCUN 4FJLA 4KHYA 3AVCA 1SL0A 1VQMN 1VSJA 5GAEP 1YF5L 3VQ6A 4KTWA 4O5BA 1S6QA 2RN2A 1C6VA 4DTUA 1HKBA 3P31A 2QWOA 2GUPA 4HWIA 1NKCA 2YHXA 1B92A 4IDHA 1N36K 1J5EK 3D2EB 4H0YB 1KVBA 2ASMA 3FZHA 1Q9XA 4G1QA 1K6YA 2Y1IA 1CZAN 2WONA 4CK3A 2G8KA 3ZSQA 3TR8A 4PUOA 1I3AA 4YOTA 5JVGL 3VQEA 3ASMA 3IKMA 2EHGA 4CEFA 4DSEA 3G0ZA 4KAZA 4BVPA 4WFAL 4Y1CA 4LH4A 1NKBA 2PY5A 4CEZA 3J7AP 1M90O 2GX9A 3RMCA 2ZM6K 1NOZA 3D7EO 3OYFA 3BUZB 3SYZA 1U04A 3OW2M 2OZSA 3K58A 1X1PA 3TARA 3CM6A 3P38A 1HYSA 3TTCA 3N4QA 3DXKA 1HQEA 1NMNA 5CY4A 3EYZA 1NGIA 4DFPA 1I39A 1FXXA 4WFNL 4JKBA 4JS4A 4GKJK 3G25A 2UU9K 1XC9A 4PY5A 3LP0A 4DG1A 4RW9A 4KB1A 3SMPA 3HOSA 4KTQA 1M1KO 4A59A 1HR0K 1T6DA 4ELUA 2QWLA 3LANA 4B3OA 4CFDA 4MDBA 3ZSZA 2OPSA 4AF1A 5K14A 4WQ5C 3VESA 4Q5VA 1NGHA 4CJTA 2HVHA 2HF4A 4I9QA 1XNRK 3WNGA 3HXMA 5DK5A 3ITHA 2ZJRL 3WNFA 3I0RA 4WQ5A 3OYHA 4DTMA 1T3VA 1FKOA 2DPNA 2HVIA 1RTHA 3F9MA 1C0UA 4BQZA 4BRMA 3CCVN 1GLEG 4ILGB 1QSLA 2FF3B 3CD6N 1WBDA 3RTVA 1BI4A 4RCHA 3ZSVA 4BE2A 3I0SA 4A57A 4B9QA 4E7KA 4OGCA 1K9MO 3PO4A 5J1EA 4J2BA 5HRRA 2E6LA 3DXMA 4G9ZA 4H0XB 3C7NA 2YNHA 1L3VA 3F9KA 5HRSA 1VSEA 2YKMA 3NF8A 2W6KA 1NKEA 4JI6K 1B9DA 3M5RA 2Q3SA 4BRFA 1IBMK 3AAQA 1NK7A 4E1NA 1HNXK 2O8CB 1KLMA 4OPKA 1U6ZA 4IO9L 1KXPA 4Z0UA 1XQSC 4ILHA 1SKWA 1BCOA 3LZJA 1ATSA 4FLWA 1DLOA 4XH1A 2X6NA 4DR2K 3HRGA 1QQMA 3SUPA 3U9DA 4DV0K 4C1NK 5BN8A 1TL1A 1QHTA 4CJRA 3SQ2A 4HVJA 2QTDA 4CGIA 4CBXA 4XIUA 2OPRA 3TABA 4DWIA 2QEXN 4LF5K 4NYNA 2WOMA 3OA9A 2XY6A 1N32K 2P9PA 4DU1A 1S1TA 4MLEA 3BZCA 3NBPA 3D45A 1HYZA 4H5RA 4BWMA 3ZYYX 4CJPA 4OKEA 5AFUH 1EX4A 1NK4A 3CPWM 1XNQK 5AQXA 3NVKA 4CZGA 3FZMA 3CPEA 1YUWA 3BGRA 2A3ZA 5CYMA 2Y1JA 3PX0A 1UA0A 3RRGA 5DM6L 2P51A 2F96A 3TU5A 1K8AO 3DM2A 1YT3A 3KLHA 4GV6A 5HBMA 5KRSA 2VYPA 3PLAA 2I7PA 4DR3K 1JKHA 3TTDA 3VERA 4KH6A 4GMJB 2DFHA 3O08A 3R9PA 5GINA 3TAFA 1C1BA 4M3UA 1E4GT 1KAYA 5JLFA 4CEBA 1VQ5N 1P8ZA 3ZSOA 1OVYA 4JNEA 3QIPA 4H0OA 3LP2A 2WUSA 1IKVA 4IBNA 3ULEA 3VOVA 1JL1A 4I6MB 3CC4N 4DQSA 4FPBA 1X3MA 1LOTB 1W9HA 1W2BM 2OPQA 1VRTA 2JWLA 4LH5A 4JD2A 1HKCA 2OA8A 2QWNA 1NGEA 3ZETA 1RBUA 1U45A 2ITGA 5KGWA 3MN9A 3ZEUA 4O8UA 4I2PA 1RDDA 3V9XA 4FM0A 5HP1A 4GV3A 3LP1A 3AAPA 5KPTA 2W42A 3OBWA 3Q7BA 1TK8A 3PUFA 1CZ9A 4BRLA 4CD3A 1T03A 4IKFA 2NNWA 1NGAA 4CFAA 4LSLA 5AZJB 4YDUA 4FSVA 1TKXA 4CHYA 1KRPA 3UB5A 2LSNA 4O55A 1D4XA 4DTPA 2XY7A 3QO9A 4JAXA 3QBXA 2IVPA 4CK2A 5KQ8A 4BRDA 5AZIB 3P4IA 2VWKA 3CG7A 4N41A 2P5GA 3ZSYA 4QS8A 3WQUA 3OYKA 4DSFA 3KD5E 4BROA 4CF2A 3THVA 3S3OA 4R79A 4BE1A 3CYMA 4FJIA 4CD1A 1SUQA 2W41A 4NO7A 4CEOA 4ZHRA 5HOOA 1RT3A 3K5NA 5GIOA 4E1JA 1KCFA 4H0TB 1XUPO 4XH4A 3D2FA 1VSKA 4I7FA 4NXNK 4IOXA 3KZBA 2YNFA 4CESA 1BA1A 4CERA 3L2UA 3S3MA 1LW0A 3NE6A 3QB0A 5AQLA 1L3SA 1ILYA 1KAZA 3CQYA 4A2BA 4NB4A 1VQ6N 1RNHA 3LDLA 1T44A 2DY4A 4KBOA 2VG7A 5BR9A 3CM5A 2X74A 4CIEA 4M41A 4CFBA 5BRDA 3SUOA 2BH1A 2KFZA 3OS1A 4OX9K 4FWOA 4CHPA 1XHXA 4CBUA 3VMFB 2F9TA 3HSCA 2BGGA 2P9UA 1L3UA 3AA4A 1C1CA 4DV2K 4CJ5A 2PYJA 4PKGA 3OHRA 1YXQA 3QFUA 3V9ZA 1S72N 1WN7A 3CERA 1VQ8N 4JI2K 4F8RA 3K57A 4DV6K 3EY1A 4FL9A 4RW7A 3JXUA 5EY4A 3ZSXA 3KLGA 3NF7A 4B1YB 3KKRA 3M1FA 4BR7A 4CEEA 1GOBA 4NXMK 3KKSA 3ZCMA 1QSYA 5KI6A 1XMQK 1YJ9N 1BWFO 3PIOL 5AQPA 1QVFM 1TKTA 2YJEA 1YVNA 1ZBFA 4YNQA 3ENOA 1Q7YO 3MEGA 5J2PA 3IAYA 3A2FA 3V9UA 2XRIA 1OH8A 1ZBSA 4IOAL 2O8EA 4B3SK 1JLGA 4H8KA 4EZ9A 3AY9A 4NCAA 4FWRA 1XHZA 1NK5A 3A8YA 3VF6A 1BU6O 5LJVA 3ZT3A 4FJNA 1TKDA 3VTHA 1VQLN 3CCRN 5F2RA 1X9WA 4BRNA 4FZXC 3VQ7A 3TI0A 3H46O 1TL3A 3VQBA 2UUAK 1NOYA 4MO5A 1ATRA 3T19A 4GW6A 3TSUA 2G8IA 2Q36A 4I9LA 4ISEA 4BY9C 4KTZA 4E7IA 1NGJA 3K5LA 2ZWHA 4CEDA 1OH6A 3WNHA 2R7YA 1D5AA 5CR4A 1C0GA 5JICA 4CZHA 2HW3A 3NGYA 4QAGA 2YX6A 4Z94A 1MDUB 1DT9A 1C0FA 4CJWA 3CI5A 3QBWA 3TAGA 3QESA 3SUQA 4JHDB 4AHRA 4YOUA 4FO0A 4DTNA 4CEQA 5AQRA 3VA3A 2ZD1A 2IVNA 4DR1K 3SBGA 2I7NA 3NDKA 1BIZA 4BRCA 1LWEA 4B3RK 4B9LA 2EX3A 2KW4A 3CJBA 4GVMA 4CEAA 3O3FA 3QNNA 4AM6A 2P9SA 4DR7K 2ASPA 1YTUA 4NLBA 5AQKA 3HOTA 2OZMA 3LPUA 3L4QA 3J81O 3M8QA 4MO4A 1RCHA 3C94A 3LM2A 4YOWA 4M3ZA 4JI0K 2A41A 2P5OA 1NJIO 1QS4A 2XY8A 4X65K 3CF5L 3B6PA 2FSNA 3D6RA 3THYA 1TAUA 2QXLA 1EXQA 4ISGA 3VPZA 1FKPA 3DRSA 3O9TA 3NF6A 5EU7A 4CCHA 1T8EA 1BG3A 3HO1A 4CGJA 4FJJA 2AP1A 3A5OC 3IDHA 1KAXA 4Z4CA 2IIRA 4K8XA 4BRIA 3GDQA 2HNZA 4FJHA 3UKUA 4CVNE 5SWMA 4DMNA 4C8LA 3V4IA 3OYLA 2NRRA 3THWA 4JYAK 4AHTA 4BG9A 4BGAA 3L0QA 2KQ2A 4FZZA 3FFIA 5BRHA 4FLUA 2B4JA 1NGDA 4WE1A 1TK5A 5AQHA 4M7YA 4B8CA 3NFAA 4MQ3A 3V6DA 3RSEB 4HCBA 3DXKB 4YOVA 3C6TA 3HSTB 1RDCA 2FSKA 5DM7L 1LW2A 3I33A 4J2EA 4ELVA 1JCGA 3PO5A 3QEXA 1N5YA 3JS6A 1L3TA 3ENBA 4C1NI 4DTJA 2E20A 2Q0RA 1BUPA 2CGLA 5AQZA 3HM9A 4OPHA 2ZF5O 3KK2A 5JS2A 1VHXA 3LDPA 2PFUA 3CC7N 4DTXA 2DTUA 1RFQA 5GIPA 3IRXA 5IWAK 1KC8O 1A5VA 3ATVA 2BANA 3AARA 2A1SA 4FXDA 4CJ7A 4F3TA 1S5JA 2HHTA 1BDGA 4HUEA 3U6FA 4DTRA 4A2AA 4AM7A 4CJEA 1EKEA 2FBVA 4CJFA 1MWMA 2WBNA 2A5XA 1J54A 2ZQBA 2BUPA 5JLHA 1WSFA 1GOCA 4QS7A 3T1HK 3DXMB 1ASUA 3L2WA 1GLCG 3TWHA 3MWPA 3SV3A 1V4SA 4AQYK 3LWMA 3UKRB 1RBVA 4DS4A 5AQIA 3C7NB 4IJAA 2BDPA 3I55N 3HBTA 4B1UB 4DB3A 3CMEN 2NRWA 3O3HA 4AHUA 2UUBK 3SUNA 2YCHA 1HYVA 1R59O 3AGRA 2KZZA 3VEZA 3WEEA 3P83D 5AQMA 3SAHA 4PWDA 3VN5A 5F0XA 2PZSA 1Z25A 1U47A 2ASOA 4B8AB 1VQKN 3SZ2A 1BQMA 2HMPA 4PL8A 2F9WA 1Z05A 5M1PA 4M3WA 5FLXO 4N47A 1TAQA 1UWBA 1NBWA 3VEYA 4PQUA 1WNSA 3K2PA 3KLFA 5BRFA 3D0PA 3VGLA 3LALA 2XO7A 3PX4A 3L3VA 4BR5A 4Y0WA 2P9PB 3M8RA 2YHAA 4CZKA 3NHGA 4DFKA 4W5OA 2D0AA 3C0BA 4B1XB 3CC2N 3K5OA 3DLGA 4OVLA 3JAMO 4LSNA 1QZ5A 5C0YA 4CIFA 3SCXA 4FK2A 1HNWK 5C10A 4QS9A 3ZT0A 3LAMA 3VQDA 5CZ1A 4KKOA 4JI4K 3O9SA 4E0DA 3KIOA 5FPEA 3THXA 3D2EA 4J8FA 1NLVA 3VQ9A 4M3YA 4O44A 1JCEA 3L3UA 4DQIA 3NH0A 5E84A 1T05A 1C1AA 3OYBA 1VK0A 4ZTJA 1X9SA 3OYMA 5BREA 2Q31A 3AVJA 3OYDA 5IT9O 3J7ZO 2ZE2A 2E5LK 4DV4K 2G8WA 3OJUA 5LMUK 4DS5A 4HCCA 4LF9K 4CE9A 4JKFA 3VEOA 3OYJA 3M8PA 3H3OB 5B8HA 5DMRA 3SMSA 3TSQA 4H5VA 4B3TK 3HK2A 4AHVA 4E3SA 3CCQN 4F9OA 4O5FA 4B3MK 1X3NA 3VF2A 3VENA 4RWTA 4KV8A 1NK9A 1RTIA 3DI6A 3E01A 4X62K 2OYQA 3SAFA 4FWMA 3EZ5A 3ZETB 4HUFA 3OTOK 3ZEUB 1RTJA 1JLCA 4HTUA 4C8KA 3E66A 4DR4K 2WFBA 3MECA 2HHSA 2D0CA 3E9LA 4AH9A 5SZTA 3G71N 3VA0A 1A5XA 3S41A 4Z4EA 1V4TA 3KVGA 3UE5A 1D9DA 4CJSA 4KHWA 4QCLA 4BRPA 3OVNA 1O1WA 1BCMA 4JI7K 4H03B 4BRHA 4DFMA 4LF7K 1S1WA 4KHPK 3KK3A 4CBWA 3DLEA 3MMVA 4EFHA 2O8DB 3L2RA 4IG0A 1QVGM 4OKKA 4JKCA 3CQXA 4O0IA 1HNIA 3SQ4A 4YOYA 2VWBA 2PAVA 2KFNA 2RPIA 3CFOA 2E2OA 3VF4A 3H1QA 1RT4A 1I94K 3DOKA 4KFBA 2NRTA 3TAQA 4CHNA 2VGMA 4FJXA 1ZBLA 1UAXA 3TSPA 3ZX3A 3HP6A 5J2MA 4IJNA 2GV9A 2WC9A 3D2FB 2IS3A 3Q7CA 4LFCK 1J9AA 3ZX2A 3F73A 3V1RA 3HPGA 3KHYA 5KPZA 2WTUA 3VGKA 2NRZA 2QM1A 1G15A 3LL3A 3HP9A 4ICLA 3CQ8A 1U49A 4DR6K 3PIPL 3I56N 1ZBUA 4LY7A 2FBYA 4C23A 1S22A 2BE2A 1YJWN 2O8CA 1VAZA 1QQCA 2PYLA 4JS5A 5FDLA 3ENHA 2ZGZA 2FBXA 2O8BB 3KWGA 4M7XA 1LAVA 2P9UB 1BOTO 3SLCA 3F5TA 1YI2N 1KTQA 4QOZB 4IEEA 1VQPN 5C25A 1F21A 3LP3A 5BPNA 3OS2A 1U2VA 4IZ9A 3MEEA 3AO2A 3U9ZA 3ALYA 4KI6A 4BC5A 4CI6A 1TK0A 4M3XA 1JXBA 4NYFA 5FPNA 4K43A 3ID6A 3AGKA 3I8BA 4FLZA 1X9MA 1L5UA 2CH5A 3UIQA 3WNEA 4JI8K 3E1YA 4BDPA 4FOEA 1QZ6A 2I5JA 3AO3A 5LMNK 4FJ5A 3P5JA 3KLIA 2O8EB 1ZYQA 1BA0A 1YJNN 2GWKA 3AV9A 3O4WA 4LD0A 3MK6A 5JVHL 3VQCA 2E1YA 1VQNN 2OPPA 3H08A 3ATUA 5M1OA 4FVUA 3HL8A 4F4KA 2E6MA 3IMXA 4ELTA 3S9HA 1RDBA 3FGUA 1J53A 4DV7K 1WAFA 2P9KB 2ZJQL 2UXBK 2D0OA 4FWPA 1XWLA 1JLAA 2FLOA 1T7PA 2P9IB 3VQ4A 3NGZA 2HHXA 1ZC6A 3LZIA 4BR9A 1Q8IA 2YHWA 4B9TA 2HHHK 4XEIA 4C8MA 1VQ9N 4JK8A 3C6AA 3M8SA 1JXEA 3OBYA 2HHQA 1TKZA 4WQ4C 1HPMA 4KHNA 3MX5A 1RGIA 4BVOA 1WAJA 4CGGA 2GEMA 4JI3K 1OKJA 2YNIA 2DFFA 1YAGA 3AO1A 4CF1A 4CW7B 4RW8A 2P1JA 5C24A 4WQ4A 4FK0A 3O5BA 4FLVA 3B6OA 4Z4FA 3EKSA 2X6SA 4DUZK 4FJGA 5TKYA 3EN9A 3BEXA 2JWKA 5E26A 4BREA 1LWFA 1JJ2M 4IXCA 3DLRA 2Q1NA 3C6UA 2P9SB 3QNOA 4NCBA 4L3QA 2NZTA 5MLCQ 1D9FA 3U3GA 3GL1A 4CZLA 3VQAA 4DV5K 3CJ1A 4WYBA 1HUXA 1MWKA 3ZLJA 5AZJA 3A5NC 4RTFD 3H45C 3T1YK 3O9QA 4FVMA 4YFUA 3BDPA 3THYB 4OLAA 2O8FA 3AVIA 2AJQA 1DEJA 2QWRA 3M3ZA 1XC3A 4FJKA 1JLFA 4FWQA 3HPHA 5AZIA 3L8BA 1QQOA 3EO3A 5C2FA 1MA9B 2F7TA 4CJ3A 3OYGA 2HBJA 3O1BA 1CLQA 1QQNA 2ETJA 4JKGA 4DV1K 1SL2A 3HYFA 1NGCA 3HZ6A 5AQUA 4CJQA 1YTAA 2F8TA 1UOCA 5AQTA 4DU4A 1EO1A 1WSIA 4GKKK 3ULDA 4O8KA 1Z26A 4CF0A 2NUBA 4FM2A 1RDWX 3THWB 3WT0A 4W5QA 4J2DA 3LPTA 1FK9A 2GBZA 3DLBA 1LAWA 3CJAA 4JK7A 1S1VA 2A42A 2HF3A 3E9OA 2UYTA 3MAQA 4JK9A 4DQRA 2FXUA 2E2PA 3FZFA 3WXMB 4CZEA 4BGBA 3QFPA 3T3FA 3HJFA 3BP8A 2OTLN 5FRNA 1H1VA 4JKAA 2W6LA 3VETA 4W5RA 4ID1A 2E4LA 1SKRA 4DQPA 3MXJA 1IKYA 4CHOA 5KQDA 4YOXA 3HTVA 1LCUA 4CK1A 1ZBIA 3DWLA 3VGMA 4TSXA 4E7HA 5E41A 5BR8K 4M3TA 1Q18A 4BQLA 4CECA 1QSSA 3TAEA 2P9NA 1VQ7N 3O80A 1S6PA 3RMDA 3ISNC 3E9PA 4A61A 4L8RB 1VSIA 4IWVA 1Y97A 3NVMA 1N6QA 1HMVA 2YKNA 3PSFA 5HL7L 3QETA 4OLBA 1WSEA 5AQSA 2V51B 2QWQA 2HBLA 4CJVA 3NMUA 1ASVA 5BN9A 3P39A 2ATQA 2E2NA 4JRQA 3MX2A 3VQ5A 1VRUA 4DUYK 3O4QA 4DTOA 4B1VA 3OYIA 4JN4A 1NG9A 3AVHA 3HI0A 2E88A 3F2KA 4KPYA 4U7BA 3CCJN 4FLXA 4H4OA 1NGFA 5ADXH 5CHIA 3J80O 3R8EA 4CZIA 1VSLA 1YIJN 2YHBA 4OO1J 4E89A 1WBBA 4JI1K 2HNYA 1WSGA 5CZ2A 3CIPA 1W7AA 2V7YA 3EEQA 3BF3A 1Q86O 3PX6A 5C12A 4CJLA 2FBTA 3LM9A 3VEWA 1IG8A 1TYQA 1SS6A 1RT2A 3AA3A 3O9UA 3AVBA 3OYEA 1JL2A 4BDZA 1JLEA 3CFPA 4GY2B 3OYNA 1IKWA 5M1NA 3QMLA 2F8SA 1J6ZA 3VQ8A 3FFKB 1K8KA 1BISA 4DQ8A 3FE1A 1BQNA 4BR2A 1X9JA 1VSFA 4H4MA 3AO4A 3CETA 4XH5A 3GE1A 3A5LC 2Z1IA 2FF6A 4JHDA 3NCIA 1NJZA 4KB0A 1TVRA 4MFBA 2QWPA 3SAGA 4CHZA 1J5OA 2GWJA 4C8OA 1ITGA 4CJ4A 2E1ZA 5EVZA 1BO5O 2G8HA 1U48A 3K59A 1B9FA 3QDKA 3EE8A 3MDQA 1ZBHA 4Z4IA 1IBLK 3VEXA 4K41A 3CXCM 1W97L 4DSIA 2QKBA 5BPLA 3MXIA 2KLAA 5GAHP 4DSKA 5LY3A 1IO2A 4CJUA 3ZSRA 1BI4B 4FW1A 3WUHA 4V19S 4MDAA
chains in the Genus database with same CATH topology
4BACA 3EZ5A 2D5RA 4K8ZA 2VG6A 2VWKA 3CG7A 4O0JA 4HUFA 4F2SA 4N41A 2P5GA 3ZSYA 4HUGA 4B9UA 4DSFA 3OYKA 1RTJA 3KD5E 1JLCA 4HTUA 4RG8A 1KSPA 4CF2A 3THVA 1ASWA 3S3OA 4C8KA 4BE1A 3CYMA 4FJIA 3MECA 2HHSA 2D0CA 3HPOA 1SUQA 1Q9YA 4AH9A 4CEOA 4ZHRA 5SZTA 4FJ8A 4KHSA 3AVMA 1RT3A 3OYCA 3K5NA 3VA0A 4BDYA 1A5XA 3LAKA 4KHQA 1KCFA 4R5PA 2YNGA 1HJRA 3ZSWA 4N76A 1VSKA 4I7FA 1C0TA 4Z4EA 1D9DA 4OPJA 4DSLA 2YNFA 4CESA 4CERA 4M42A 3L2UA 4CJSA 1GOAA 1LW0A 1RT1A 3S3MA 4EZ6A 4KHWA 4QCLA 3OVNA 1O1WA 1BCMA 3NE6A 5HRNA 3O4NA 1L3SA 4DFMA 3DMJA 4JRPA 1S1WA 4ZTFA 3KK3A 1RNHA 3DLEA 2DY4A 2IAJA 2VG7A 3PV8A 1IKXA 2X74A 3CM5A 1BL3A 4CIEA 4M41A 4CFBA 1RT5A 3SUOA 2HHUA 2DFEA 2KFZA 3OS1A 3ZT4A 4DF4A 1SL1A 4E19A 4CGHA 3RR7A 3MEDA 3JYTA 4AHCA 4IG0A 3L2RA 1RBSA 1MU2A 4OKKA 4CHPA 1RBTA 1XHXA 4O0IA 1HNIA 3RMBA 3SQ4A 1L3UA 2BGGA 4DLGA 3AA4A 1NK8A 3NH2A 1C1CA 2XHBA 3NH1A 2RPIA 3CFOA 2KFNA 1TV6A 1RT4A 4CJ5A 4FLYA 2PYJA 4EP4A 3DOKA 3P1GA 3V9ZA 4N5SA 4KFBA 3QEPA 3TAQA 4CHNA 1WN7A 4FJXA 4F8RA 1ZBLA 3VQPA 3K57A 2VWJA 1UAXA 3IG1A 2HB5A 5KRTA 3HP6A 3EY1A 4RW7A 3V9SA 5J2MA 2Z1GA 3ZSXA 1A5WA 5KGXA 3KLGA 2O4IA 2GV9A 3NF7A 4DF8A 4FLTA 2IS3A 2IDOA 3KKRA 4CEEA 3KD1E 1J9AA 1GOBA 3KKSA 3ZCMA 3L2VA 2GUIA 1HPZA 5KI6A 3F73A 1QSYA 3V1RA 3HPGA 2G8UA 1WSHA 1C0MA 4OJRA 1CZBA 1TKTA 1G15A 3HP9A 1ZBFA 4ICLA 4YNQA 3CQ8A 3SQ0A 1U49A 4CIGA 4M3RA 3MEGA 1ZBUA 5J2PA 3IAYA 3A2FA 3V9UA 4LY7A 2OYQA 2FBYA 3IS9A 2XRIA 4DQQA 3DRRA 1JLGA 4H8KA 2BE2A 4NCGA 1LWCA 4EZ9A 4IDKA 4NCAA 1XHZA 4FK4A 2KZMA 1NK5A 1QQCA 2PYLA 4E7JA 1JLBA 3I8DA 3SV4A 3U3YA 4JS5A 2Z1JA 5FDLA 3ZT3A 1D8YA 4FJNA 3V1QA 4OKJA 3SQ1A 1TKDA 1RTDA 1KVAA 4DSJA 4IFYA 2RF2A 5T7BA 2FBXA 1BHLA 4KI4A 2G8FA 4Q0BA 1X9WA 1LAVA 4DFJA 4FZXC 3HVTA 4RW6A 3VQ7A 1KLNA 3TI0A 1TL3A 3VQBA 5I42A 4B9NA 1NOYA 4UQGA 1KTQA 3T19A 4GW6A 1WLJA 1W0HA 1JLQA 4QOZB 3QIOA 4CJKA 2IC3A 1QTMA 3LDSA 1VSDA 5C25A 2G8IA 1F21A 3LP3A 4I9LA 3OS2A 2XY5A 3SPZA 2YV0X 3MEEA 4KTZA 3AO2A 4KRFA 4E7IA 2O4GA 3KK1A 2HHWA 4KI6A 3ALYA 4PA1A 1TK0A 3K5LA 4FJLA 3O3GA 1JXBA 4NYFA 3AVCA 4CEDA 4B9MA 1SL0A 4M3XA 4KHYA 4FZYA 3WNHA 4DTSA 4ID5A 4FLZA 1VSJA 2R7YA 3VQ6A 1D5AA 4KTWA 1DTTA 1S6QA 4O5BA 1X9MA 1L5UA 3KTQA 2HW3A 2RN2A 3NGYA 1C6VA 4QAGA 3UIQA 4DTUA 3WNEA 3DLHA 4BDPA 2QXFA 3HVRA 4HHTA 4CFCA 3AO3A 2I5JA 4CJWA 1NKCA 3AVGA 1B92A 3P5JA 3KLIA 4CGDA 4B08A 1ZYQA 3RR8A 4FJ5A 3TAGA 3AV9A 4C8NA 1VSMA 4LD0A 3QESA 1KVBA 3VQCA 2OPPA 3H08A 1Q9XA 3SUQA 3HL8A 1SKSA 4G1QA 1K6YA 4AHRA 2Y1IA 2WONA 4F4KA 2E6MA 4IG3A 4CK3A 4DTNA 4CEQA 1XI1A 2G8KA 3VA3A 2ZD1A 4ELTA 3S9HA 1RDBA 5HROA 3ZSQA 3NDKA 3TR8A 1J53A 1I3AA 4JLHA 4PUOA 1BIZA 3VQEA 1WAFA 1LWEA 3TANA 3ASMA 4O4GA 1NJYA 2EHGA 4CEFA 2EX3A 2KW4A 4GVMA 4CEAA 3G0ZA 3O3FA 4DSEA 3QNNA 3V81A 4KAZA 1XWLA 1JLAA 3AA2A 4Y1CA 1T7PA 1YTUA 4LH4A 2OZMA 3DLKA 3VQ4A 3ZT1A 1NKBA 2PY5A 3LPUA 3SI6A 3NGZA 4KO0A 2HHXA 3M8QA 3LZIA 1RCHA 4CEZA 3C94A 1Q8IA 4B9TA 3RMCA 4M3ZA 1NOZA 4C8MA 3L2QA 3OYFA 2P5OA 1QS4A 2XY8A 3SYZA 1U04A 3B6PA 1VSHA 3M8SA 3SNNA 2OZSA 1CXUA 3K58A 1X1PA 1JXEA 1HNVA 2HHQA 1TKZA 4E1MA 3TARA 3CM6A 4FW2A 1TAUA 1HYSA 4W5TA 4KHNA 4B9VA 1HQEA 1WAJA 5CY4A 3EYZA 3QERA 1EXQA 4DLEA 3DOLA 4CGGA 1I39A 4Z4HA 1FXXA 4DFPA 1FKPA 3ZT2A 2YNIA 4EP5A 2DFFA 3DRSA 3AO1A 4CF1A 4JS4A 3NF6A 4RW8A 5EU7A 2P1JA 4BE0A 5C24A 1XC9A 4CCHA 1T8EA 3LP0A 4PY5A 4DG1A 4RW9A 4FK0A 4KB1A 4KTQA 3HO1A 5I3UA 4CGJA 4FLVA 4FJJA 4ELUA 3QEIA 3B6OA 4Z4FA 1S1XA 2X6SA 1NK6A 1HRHA 3LANA 4Z4CA 4B3OA 4CFDA 4FJGA 4FJ7A 4K8XA 3DRPA 2HHVA 5FRMA 4Y1DA 2HNZA 4FJHA 1LWFA 3ZSZA 3DLRA 2OPSA 5SWMA 4DMNA 3C6UA 1CXQA 3DYAA 4C8LA 3V4IA 3QNOA 1S1UA 5K14A 1KFSA 4NCBA 4Q5VA 3OYLA 4CJTA 2HVHA 4I9QA 4AHTA 1D9FA 3WNGA 3NF9A 3U3GA 3HXMA 3VQAA 2KQ2A 5DK5A 4FZZA 3ITHA 3FFIA 3WNFA 4FLUA 3I0RA 3OYHA 3AA5X 4DTMA 1FKOA 5CYQA 4FJMA 2B4JA 1RT6A 4WE1A 1RTHA 1S9EA 1TK5A 1C0UA 4FVMA 2HVIA 4YFUA 3BDPA 1SV5A 1QSLA 4OLAA 4B8CA 3NFAA 4MQ3A 3V6DA 3AVIA 1RDAA 4HCBA 2AJQA 3C6TA 3RTVA 4FJKA 1BI4A 1JLFA 3HSTB 1RDCA 3ZSVA 4CF8A 3OJSA 4BE2A 3HPHA 3I0SA 1LW2A 3L8BA 3KLEA 1NK0A 4J2EA 4ELVA 4E7KA 4OGCA 3PO5A 3JSMA 3PO4A 3QEXA 1N5YA 5J1EA 1L3TA 4J2BA 4FYDA 4CJ3A 4DTJA 3OYGA 5HRRA 2E6LA 1TGOA 1CLQA 3HM9A 3KJVA 2ETJA 3OS0A 3KK2A 1SL2A 3HYFA 2YNHA 4CJQA 1YTAA 3QEVA 5JS2A 2F8TA 1UOCA 3F9KA 1L3VA 4B9SA 5HRSA 4F2RA 1KFDA 4DU4A 1VSEA 4DU3A 1IH7A 2YKMA 3NF8A 1NJWA 2JGUA 1WSIA 3TAMA 3AVKA 1NKEA 4KREA 1B9DA 4DTXA 3ULDA 4KHUA 2Q3SA 2DTUA 1RT7A 1Z26A 4CF0A 2NUBA 4FM2A 4J2DA 4W5QA 3LPTA 3C95A 1FK9A 2GBZA 3IRXA 3DLBA 1LAWA 1NK7A 4E1NA 1A5VA 1S1VA 2BANA 2A1SA 1KLMA 5C42A 4OPKA 4FXDA 3MAQA 2IOCA 4Z0UA 4DQRA 4F3TA 1SKWA 1BCOA 1S5JA 5J2QA 1BGXT 3LZJA 2HHTA 4CHQA 3OY9A 4HUEA 3U6FA 4W5NA 3T3FA 3HJFA 4DTRA 5JS1A 4FLWA 1DLOA 4CJEA 1EKEA 2FBVA 4CJFA 3SPYA 5FRNA 2X6NA 5HLFA 1S9GA 4CGFA 3QEWA 3SUPA 3S3NA 4W5RA 4ID1A 2E4LA 1J54A 1SKRA 4DQPA 3V1OA 3G10A 1IKYA 3MXJA 4CHOA 1TL1A 1QHTA 5D3GA 2ZQBA 4CJRA 3SQ2A 4HVJA 4FCYA 4CGIA 1WSFA 1GOCA 1RILA 4XIUA 3RMAA 2OPRA 4CK1A 1ASUA 3L2WA 3TABA 1IG9A 4NYNA 4DWIA 1ZBIA 3TWHA 3SV3A 2WOMA 4TSXA 2XY6A 3LWMA 1EETA 1YVUA 4E7HA 1RBVA 4AHSA 5E41A 4IFVA 4DS4A 4M3TA 4DU1A 1S1TA 4CECA 1QSSA 2BDPA 3TAEA 1HQUA 1RBRA 3QINA 3NBPA 2Z1HA 3D45A 2JLEA 1S6PA 3O3HA 3RMDA 3ISNC 4AHUA 4FM1A 1HYZA 3SUNA 4BWMA 4L8RB 1VSIA 1HYVA 1KVCA 1Y97A 2D0BA 4CJPA 1N6QA 4OKEA 1HMVA 2YKNA 3K5MA 1EX4A 1NK4A 2KZZA 3NGIA 2IGIA 4OLBA 3QETA 2A1RA 1WSEA 3RWUA 1WSJA 3BGRA 3P83D 4CJVA 4PWDA 2FC0A 1ASVA 3QLHA 5CYMA 3VN5A 3AO5A 2Y1JA 3PX0A 1UA0A 2QK9A 2PZSA 3RRGA 1Z25A 2P51A 2ATQA 1U47A 2F96A 4JRQA 3VQ5A 3DM2A 1VRUA 1YT3A 3KLHA 3O4QA 5HBMA 4B8AB 3OYIA 3SZ2A 1BQMA 4DTOA 4Z4GA 4AILC 5KRSA 2B5JA 3AVHA 4M3WA 2VG5A 1JKHA 2HMIA 4N47A 5KTQA 4KPYA 1TAQA 3AVFA 1UWBA 4H4OA 4FLXA 4GMJB 2DFHA 4PQUA 1WNSA 3K2PA 3V9WA 3KLFA 1EP4A 4M45A 4J2AA 3TAFA 3D0PA 1VSLA 2X78A 1C1BA 3LALA 2YHBA 4N56A 2XO7A 3PX4A 4E89A 3HT3A 3L3VA 4M3UA 2HNYA 1WSGA 5CZ2A 4CEBA 3M8RA 3AVAA 1DTQA 2YHAA 3ZSOA 4DFKA 3NHGA 1LV5A 4W5OA 4CF9A 3PX6A 3QIPA 2D0AA 3LP2A 4CJLA 3MXMA 2FBTA 1IKVA 2HNDA 4IBNA 3K5OA 3VQQA 3DLGA 3OYAA 3TAPA 4OVLA 4LSNA 1RT2A 3AA3A 1JL1A 3NAEA 3T1AA 3AVBA 4DQSA 1U4BA 3OYEA 1JL2A 4BDZA 1W9HA 1JLEA 3LWLA 4CIFA 2OPQA 1VRTA 3CFPA 3SCXA 4LH5A 2B6AA 1IKWA 3OYNA 5HRPA 4FK2A 1BIUA 2F8SA 4RW4A 3RRHA 2OA8A 3VQ8A 3ZT0A 3LAMA 5J2NA 1BISA 5CZ1A 4KKOA 3VQDA 1BQNA 1RBUA 1U45A 1UA1A 4E0DA 3KIOA 2ITGA 1REVA 5KGWA 4I2QA 1VSFA 4H4MA 3AO4A 3VQ9A 4M3YA 4O44A 3L3UA 4I2PA 4DQIA 3NH0A 2Z1IA 2KTQA 1RDDA 3NCIA 4FM0A 3V9XA 5HP1A 1NJZA 1T05A 3LP1A 1TVRA 4KB0A 1C1AA 4F3OA 3OYBA 4MFBA 3PY8A 3AVLA 2W42A 1VK0A 4ZTJA 1X9SA 3OYMA 4CHZA 1R0AA 3AVJA 3OYDA 1J5OA 2ZE2A 1NJXA 1TK8A 3PUFA 4C8OA 1CZ9A 1ITGA 2G8WA 4CJ4A 3CFRA 4FJ9A 3OJUA 1T03A 2G8HA 1U48A 3K59A 2QKKA 1B9FA 4DS5A 4HCCA 4IKFA 4OGEA 1ZBHA 4Z4IA 4CE9A 4CFAA 4LSLA 3OYJA 5FROA 3M8PA 1TKXA 4CHYA 4E7LA 5DMRA 1KRPA 4BWJA 4B9LA 4DSIA 2QKBA 3MXIA 3HK2A 2LSNA 4AHVA 4DSKA 4O55A 4E3SA 1QE1A 4DTPA 2XY7A 1IO2A 4CJUA 3SJJA 3QO9A 3ZSRA 1BI4B 2RKIA 4CK2A 4FW1A 4KV8A 1NK9A 1RTIA 3DI6A 3E01A 2G8VA 3AVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAC A;  3EZ5 A;  2D5R A;  4K8Z A;  2VG6 A;  2VWK A;  3CG7 A;  4O0J A;  4HUF A;  4F2S A;  4N41 A;  2P5G A;  3ZSY A;  4HUG A;  4B9U A;  4DSF A;  3OYK A;  1RTJ A;  3KD5 E;  1JLC A;  4HTU A;  4RG8 A;  1KSP A;  4CF2 A;  3THV A;  1ASW A;  3S3O A;  4C8K A;  4BE1 A;  3CYM A;  4FJI A;  3MEC A;  2HHS A;  2D0C A;  3HPO A;  1SUQ A;  1Q9Y A;  4AH9 A;  4CEO A;  4ZHR A;  5SZT A;  4FJ8 A;  4KHS A;  3AVM A;  1RT3 A;  3OYC A;  3K5N A;  3VA0 A;  4BDY A;  1A5X A;  3LAK A;  4KHQ A;  1KCF A;  4R5P A;  2YNG A;  1HJR A;  3ZSW A;  4N76 A;  1VSK A;  4I7F A;  1C0T A;  4Z4E A;  1D9D A;  4OPJ A;  4DSL A;  2YNF A;  4CES A;  4CER A;  4M42 A;  3L2U A;  4CJS A;  1GOA A;  1LW0 A;  1RT1 A;  3S3M A;  4EZ6 A;  4KHW A;  4QCL A;  3OVN A;  1O1W A;  1BCM A;  3NE6 A;  5HRN A;  3O4N A;  1L3S A;  4DFM A;  3DMJ A;  4JRP A;  1S1W A;  4ZTF A;  3KK3 A;  1RNH A;  3DLE A;  2DY4 A;  2IAJ A;  2VG7 A;  3PV8 A;  1IKX A;  2X74 A;  3CM5 A;  1BL3 A;  4CIE A;  4M41 A;  4CFB A;  1RT5 A;  3SUO A;  2HHU A;  2DFE A;  2KFZ A;  3OS1 A;  3ZT4 A;  4DF4 A;  1SL1 A;  4E19 A;  4CGH A;  3RR7 A;  3MED A;  3JYT A;  4AHC A;  4IG0 A;  3L2R A;  1RBS A;  1MU2 A;  4OKK A;  4CHP A;  1RBT A;  1XHX A;  4O0I A;  1HNI A;  3RMB A;  3SQ4 A;  1L3U A;  2BGG A;  4DLG A;  3AA4 A;  1NK8 A;  3NH2 A;  1C1C A;  2XHB A;  3NH1 A;  2RPI A;  3CFO A;  2KFN A;  1TV6 A;  1RT4 A;  4CJ5 A;  4FLY A;  2PYJ A;  4EP4 A;  3DOK A;  3P1G A;  3V9Z A;  4N5S A;  4KFB A;  3QEP A;  3TAQ A;  4CHN A;  1WN7 A;  4FJX A;  4F8R A;  1ZBL A;  3VQP A;  3K57 A;  2VWJ A;  1UAX A;  3IG1 A;  2HB5 A;  5KRT A;  3HP6 A;  3EY1 A;  4RW7 A;  3V9S A;  5J2M A;  2Z1G A;  3ZSX A;  1A5W A;  5KGX A;  3KLG A;  2O4I A;  2GV9 A;  3NF7 A;  4DF8 A;  4FLT A;  2IS3 A;  2IDO A;  3KKR A;  4CEE A;  3KD1 E;  1J9A A;  1GOB A;  3KKS A;  3ZCM A;  3L2V A;  2GUI A;  1HPZ A;  5KI6 A;  3F73 A;  1QSY A;  3V1R A;  3HPG A;  2G8U A;  1WSH A;  1C0M A;  4OJR A;  1CZB A;  1TKT A;  1G15 A;  3HP9 A;  1ZBF A;  4ICL A;  4YNQ A;  3CQ8 A;  3SQ0 A;  1U49 A;  4CIG A;  4M3R A;  3MEG A;  1ZBU A;  5J2P A;  3IAY A;  3A2F A;  3V9U A;  4LY7 A;  2OYQ A;  2FBY A;  3IS9 A;  2XRI A;  4DQQ A;  3DRR A;  1JLG A;  4H8K A;  2BE2 A;  4NCG A;  1LWC A;  4EZ9 A;  4IDK A;  4NCA A;  1XHZ A;  4FK4 A;  2KZM A;  1NK5 A;  1QQC A;  2PYL A;  4E7J A;  1JLB A;  3I8D A;  3SV4 A;  3U3Y A;  4JS5 A;  2Z1J A;  5FDL A;  3ZT3 A;  1D8Y A;  4FJN A;  3V1Q A;  4OKJ A;  3SQ1 A;  1TKD A;  1RTD A;  1KVA A;  4DSJ A;  4IFY A;  2RF2 A;  5T7B A;  2FBX A;  1BHL A;  4KI4 A;  2G8F A;  4Q0B A;  1X9W A;  1LAV A;  4DFJ A;  4FZX C;  3HVT A;  4RW6 A;  3VQ7 A;  1KLN A;  3TI0 A;  1TL3 A;  3VQB A;  5I42 A;  4B9N A;  1NOY A;  4UQG A;  1KTQ A;  3T19 A;  4GW6 A;  1WLJ A;  1W0H A;  1JLQ A;  4QOZ B;  3QIO A;  4CJK A;  2IC3 A;  1QTM A;  3LDS A;  1VSD A;  5C25 A;  2G8I A;  1F21 A;  3LP3 A;  4I9L A;  3OS2 A;  2XY5 A;  3SPZ A;  2YV0 X;  3MEE A;  4KTZ A;  3AO2 A;  4KRF A;  4E7I A;  2O4G A;  3KK1 A;  2HHW A;  4KI6 A;  3ALY A;  4PA1 A;  1TK0 A;  3K5L A;  4FJL A;  3O3G A;  1JXB A;  4NYF A;  3AVC A;  4CED A;  4B9M A;  1SL0 A;  4M3X A;  4KHY A;  4FZY A;  3WNH A;  4DTS A;  4ID5 A;  4FLZ A;  1VSJ A;  2R7Y A;  3VQ6 A;  1D5A A;  4KTW A;  1DTT A;  1S6Q A;  4O5B A;  1X9M A;  1L5U A;  3KTQ A;  2HW3 A;  2RN2 A;  3NGY A;  1C6V A;  4QAG A;  3UIQ A;  4DTU A;  3WNE A;  3DLH A;  4BDP A;  2QXF A;  3HVR A;  4HHT A;  4CFC A;  3AO3 A;  2I5J A;  4CJW A;  1NKC A;  3AVG A;  1B92 A;  3P5J A;  3KLI A;  4CGD A;  4B08 A;  1ZYQ A;  3RR8 A;  4FJ5 A;  3TAG A;  3AV9 A;  4C8N A;  1VSM A;  4LD0 A;  3QES A;  1KVB A;  3VQC A;  2OPP A;  3H08 A;  1Q9X A;  3SUQ A;  3HL8 A;  1SKS A;  4G1Q A;  1K6Y A;  4AHR A;  2Y1I A;  2WON A;  4F4K A;  2E6M A;  4IG3 A;  4CK3 A;  4DTN A;  4CEQ A;  1XI1 A;  2G8K A;  3VA3 A;  2ZD1 A;  4ELT A;  3S9H A;  1RDB A;  5HRO A;  3ZSQ A;  3NDK A;  3TR8 A;  1J53 A;  1I3A A;  4JLH A;  4PUO A;  1BIZ A;  3VQE A;  1WAF A;  1LWE A;  3TAN A;  3ASM A;  4O4G A;  1NJY A;  2EHG A;  4CEF A;  2EX3 A;  2KW4 A;  4GVM A;  4CEA A;  3G0Z A;  3O3F A;  4DSE A;  3QNN A;  3V81 A;  4KAZ A;  1XWL A;  1JLA A;  3AA2 A;  4Y1C A;  1T7P A;  1YTU A;  4LH4 A;  2OZM A;  3DLK A;  3VQ4 A;  3ZT1 A;  1NKB A;  2PY5 A;  3LPU A;  3SI6 A;  3NGZ A;  4KO0 A;  2HHX A;  3M8Q A;  3LZI A;  1RCH A;  4CEZ A;  3C94 A;  1Q8I A;  4B9T A;  3RMC A;  4M3Z A;  1NOZ A;  4C8M A;  3L2Q A;  3OYF A;  2P5O A;  1QS4 A;  2XY8 A;  3SYZ A;  1U04 A;  3B6P A;  1VSH A;  3M8S A;  3SNN A;  2OZS A;  1CXU A;  3K58 A;  1X1P A;  1JXE A;  1HNV A;  2HHQ A;  1TKZ A;  4E1M A;  3TAR A;  3CM6 A;  4FW2 A;  1TAU A;  1HYS A;  4W5T A;  4KHN A;  4B9V A;  1HQE A;  1WAJ A;  5CY4 A;  3EYZ A;  3QER A;  1EXQ A;  4DLE A;  3DOL A;  4CGG A;  1I39 A;  4Z4H A;  1FXX A;  4DFP A;  1FKP A;  3ZT2 A;  2YNI A;  4EP5 A;  2DFF A;  3DRS A;  3AO1 A;  4CF1 A;  4JS4 A;  3NF6 A;  4RW8 A;  5EU7 A;  2P1J A;  4BE0 A;  5C24 A;  1XC9 A;  4CCH A;  1T8E A;  3LP0 A;  4PY5 A;  4DG1 A;  4RW9 A;  4FK0 A;  4KB1 A;  4KTQ A;  3HO1 A;  5I3U A;  4CGJ A;  4FLV A;  4FJJ A;  4ELU A;  3QEI A;  3B6O A;  4Z4F A;  1S1X A;  2X6S A;  1NK6 A;  1HRH A;  3LAN A;  4Z4C A;  4B3O A;  4CFD A;  4FJG A;  4FJ7 A;  4K8X A;  3DRP A;  2HHV A;  5FRM A;  4Y1D A;  2HNZ A;  4FJH A;  1LWF A;  3ZSZ A;  3DLR A;  2OPS A;  5SWM A;  4DMN A;  3C6U A;  1CXQ A;  3DYA A;  4C8L A;  3V4I A;  3QNO A;  1S1U A;  5K14 A;  1KFS A;  4NCB A;  4Q5V A;  3OYL A;  4CJT A;  2HVH A;  4I9Q A;  4AHT A;  1D9F A;  3WNG A;  3NF9 A;  3U3G A;  3HXM A;  3VQA A;  2KQ2 A;  5DK5 A;  4FZZ A;  3ITH A;  3FFI A;  3WNF A;  4FLU A;  3I0R A;  3OYH A;  3AA5 X;  4DTM A;  1FKO A;  5CYQ A;  4FJM A;  2B4J A;  1RT6 A;  4WE1 A;  1RTH A;  1S9E A;  1TK5 A;  1C0U A;  4FVM A;  2HVI A;  4YFU A;  3BDP A;  1SV5 A;  1QSL A;  4OLA A;  4B8C A;  3NFA A;  4MQ3 A;  3V6D A;  3AVI A;  1RDA A;  4HCB A;  2AJQ A;  3C6T A;  3RTV A;  4FJK A;  1BI4 A;  1JLF A;  3HST B;  1RDC A;  3ZSV A;  4CF8 A;  3OJS A;  4BE2 A;  3HPH A;  3I0S A;  1LW2 A;  3L8B A;  3KLE A;  1NK0 A;  4J2E A;  4ELV A;  4E7K A;  4OGC A;  3PO5 A;  3JSM A;  3PO4 A;  3QEX A;  1N5Y A;  5J1E A;  1L3T A;  4J2B A;  4FYD A;  4CJ3 A;  4DTJ A;  3OYG A;  5HRR A;  2E6L A;  1TGO A;  1CLQ A;  3HM9 A;  3KJV A;  2ETJ A;  3OS0 A;  3KK2 A;  1SL2 A;  3HYF A;  2YNH A;  4CJQ A;  1YTA A;  3QEV A;  5JS2 A;  2F8T A;  1UOC A;  3F9K A;  1L3V A;  4B9S A;  5HRS A;  4F2R A;  1KFD A;  4DU4 A;  1VSE A;  4DU3 A;  1IH7 A;  2YKM A;  3NF8 A;  1NJW A;  2JGU A;  1WSI A;  3TAM A;  3AVK A;  1NKE A;  4KRE A;  1B9D A;  4DTX A;  3ULD A;  4KHU A;  2Q3S A;  2DTU A;  1RT7 A;  1Z26 A;  4CF0 A;  2NUB A;  4FM2 A;  4J2D A;  4W5Q A;  3LPT A;  3C95 A;  1FK9 A;  2GBZ A;  3IRX A;  3DLB A;  1LAW A;  1NK7 A;  4E1N A;  1A5V A;  1S1V A;  2BAN A;  2A1S A;  1KLM A;  5C42 A;  4OPK A;  4FXD A;  3MAQ A;  2IOC A;  4Z0U A;  4DQR A;  4F3T A;  1SKW A;  1BCO A;  1S5J A;  5J2Q A;  1BGX T;  3LZJ A;  2HHT A;  4CHQ A;  3OY9 A;  4HUE A;  3U6F A;  4W5N A;  3T3F A;  3HJF A;  4DTR A;  5JS1 A;  4FLW A;  1DLO A;  4CJE A;  1EKE A;  2FBV A;  4CJF A;  3SPY A;  5FRN A;  2X6N A;  5HLF A;  1S9G A;  4CGF A;  3QEW A;  3SUP A;  3S3N A;  4W5R A;  4ID1 A;  2E4L A;  1J54 A;  1SKR A;  4DQP A;  3V1O A;  3G10 A;  1IKY A;  3MXJ A;  4CHO A;  1TL1 A;  1QHT A;  5D3G A;  2ZQB A;  4CJR A;  3SQ2 A;  4HVJ A;  4FCY A;  4CGI A;  1WSF A;  1GOC A;  1RIL A;  4XIU A;  3RMA A;  2OPR A;  4CK1 A;  1ASU A;  3L2W A;  3TAB A;  1IG9 A;  4NYN A;  4DWI A;  1ZBI A;  3TWH A;  3SV3 A;  2WOM A;  4TSX A;  2XY6 A;  3LWM A;  1EET A;  1YVU A;  4E7H A;  1RBV A;  4AHS A;  5E41 A;  4IFV A;  4DS4 A;  4M3T A;  4DU1 A;  1S1T A;  4CEC A;  1QSS A;  2BDP A;  3TAE A;  1HQU A;  1RBR A;  3QIN A;  3NBP A;  2Z1H A;  3D45 A;  2JLE A;  1S6P A;  3O3H A;  3RMD A;  3ISN C;  4AHU A;  4FM1 A;  1HYZ A;  3SUN A;  4BWM A;  4L8R B;  1VSI A;  1HYV A;  1KVC A;  1Y97 A;  2D0B A;  4CJP A;  1N6Q A;  4OKE A;  1HMV A;  2YKN A;  3K5M A;  1EX4 A;  1NK4 A;  2KZZ A;  3NGI A;  2IGI A;  4OLB A;  3QET A;  2A1R A;  1WSE A;  3RWU A;  1WSJ A;  3BGR A;  3P83 D;  4CJV A;  4PWD A;  2FC0 A;  1ASV A;  3QLH A;  5CYM A;  3VN5 A;  3AO5 A;  2Y1J A;  3PX0 A;  1UA0 A;  2QK9 A;  2PZS A;  3RRG A;  1Z25 A;  2P51 A;  2ATQ A;  1U47 A;  2F96 A;  4JRQ A;  3VQ5 A;  3DM2 A;  1VRU A;  1YT3 A;  3KLH A;  3O4Q A;  5HBM A;  4B8A B;  3OYI A;  3SZ2 A;  1BQM A;  4DTO A;  4Z4G A;  4AIL C;  5KRS A;  2B5J A;  3AVH A;  4M3W A;  2VG5 A;  1JKH A;  2HMI A;  4N47 A;  5KTQ A;  4KPY A;  1TAQ A;  3AVF A;  1UWB A;  4H4O A;  4FLX A;  4GMJ B;  2DFH A;  4PQU A;  1WNS A;  3K2P A;  3V9W A;  3KLF A;  1EP4 A;  4M45 A;  4J2A A;  3TAF A;  3D0P A;  1VSL A;  2X78 A;  1C1B A;  3LAL A;  2YHB A;  4N56 A;  2XO7 A;  3PX4 A;  4E89 A;  3HT3 A;  3L3V A;  4M3U A;  2HNY A;  1WSG A;  5CZ2 A;  4CEB A;  3M8R A;  3AVA A;  1DTQ A;  2YHA A;  3ZSO A;  4DFK A;  3NHG A;  1LV5 A;  4W5O A;  4CF9 A;  3PX6 A;  3QIP A;  2D0A A;  3LP2 A;  4CJL A;  3MXM A;  2FBT A;  1IKV A;  2HND A;  4IBN A;  3K5O A;  3VQQ A;  3DLG A;  3OYA A;  3TAP A;  4OVL A;  4LSN A;  1RT2 A;  3AA3 A;  1JL1 A;  3NAE A;  3T1A A;  3AVB A;  4DQS A;  1U4B A;  3OYE A;  1JL2 A;  4BDZ A;  1W9H A;  1JLE A;  3LWL A;  4CIF A;  2OPQ A;  1VRT A;  3CFP A;  3SCX A;  4LH5 A;  2B6A A;  1IKW A;  3OYN A;  5HRP A;  4FK2 A;  1BIU A;  2F8S A;  4RW4 A;  3RRH A;  2OA8 A;  3VQ8 A;  3ZT0 A;  3LAM A;  5J2N A;  1BIS A;  5CZ1 A;  4KKO A;  3VQD A;  1BQN A;  1RBU A;  1U45 A;  1UA1 A;  4E0D A;  3KIO A;  2ITG A;  1REV A;  5KGW A;  4I2Q A;  1VSF A;  4H4M A;  3AO4 A;  3VQ9 A;  4M3Y A;  4O44 A;  3L3U A;  4I2P A;  4DQI A;  3NH0 A;  2Z1I A;  2KTQ A;  1RDD A;  3NCI A;  4FM0 A;  3V9X A;  5HP1 A;  1NJZ A;  1T05 A;  3LP1 A;  1TVR A;  4KB0 A;  1C1A A;  4F3O A;  3OYB A;  4MFB A;  3PY8 A;  3AVL A;  2W42 A;  1VK0 A;  4ZTJ A;  1X9S A;  3OYM A;  4CHZ A;  1R0A A;  3AVJ A;  3OYD A;  1J5O A;  2ZE2 A;  1NJX A;  1TK8 A;  3PUF A;  4C8O A;  1CZ9 A;  1ITG A;  2G8W A;  4CJ4 A;  3CFR A;  4FJ9 A;  3OJU A;  1T03 A;  2G8H A;  1U48 A;  3K59 A;  2QKK A;  1B9F A;  4DS5 A;  4HCC A;  4IKF A;  4OGE A;  1ZBH A;  4Z4I A;  4CE9 A;  4CFA A;  4LSL A;  3OYJ A;  5FRO A;  3M8P A;  1TKX A;  4CHY A;  4E7L A;  5DMR A;  1KRP A;  4BWJ A;  4B9L A;  4DSI A;  2QKB A;  3MXI A;  3HK2 A;  2LSN A;  4AHV A;  4DSK A;  4O55 A;  4E3S A;  1QE1 A;  4DTP A;  2XY7 A;  1IO2 A;  4CJU A;  3SJJ A;  3QO9 A;  3ZSR A;  1BI4 B;  2RKI A;  4CK2 A;  4FW1 A;  4KV8 A;  1NK9 A;  1RTI A;  3DI6 A;  3E01 A;  2G8V A;  3AVN A; 
#chains in the Genus database with same CATH topology
 4BAC A;  4K8Z A;  2VG6 A;  4F2S A;  2NRH A;  1DKG D;  2QWM A;  4HUG A;  3THX B;  3ZX0 A;  1KSP A;  3HPO A;  1Q9Y A;  4KHS A;  3EE9 A;  3AVM A;  3OYC A;  4BRQ A;  3LAK A;  4FPA A;  4KHQ A;  4R5P A;  2YNG A;  5M1F A;  3KK7 A;  1C0T A;  4OPJ A;  4EAH D;  4M42 A;  1GOA A;  2P9L A;  5LL6 Z;  5HRN A;  3O4N A;  1ATN A;  1IBK K;  3DMJ A;  3PSI A;  2IAJ A;  4FOI A;  2D4W A;  3PV8 A;  1IKX A;  5H1S Q;  1RT5 A;  2HHU A;  4E19 A;  4CGH A;  3RR7 A;  3MED A;  4AHC A;  1RBS A;  2FSJ A;  4EIA A;  1RBT A;  3RSE A;  3R1X A;  1GLD G;  1HLU A;  3R6M A;  4DLG A;  1NK8 A;  3NH2 A;  5M1K A;  2XHB A;  3NH1 A;  3B8A X;  4BC4 A;  3QIC A;  4YOR A;  4FLY A;  2GEL A;  4EP4 A;  3QEP A;  3K0S A;  3LDN A;  3IG1 A;  4H0P A;  3FZL A;  5KRT A;  2YI1 A;  3V9S A;  2Z1G A;  5KGX A;  3CCL N;  2CGJ A;  4DR5 K;  4DF8 A;  4FLT A;  5EOY A;  4B1W B;  4CZM A;  3L2V A;  2GUI A;  1WSH A;  4OJR A;  4CIG A;  4H0V B;  3IS9 A;  3CCE N;  4LF4 K;  3MN6 A;  4DQQ A;  2HBM A;  4NCG A;  4WFB L;  1EQY A;  2KZM A;  3MWT A;  4UY8 O;  4E7J A;  1JLB A;  2NRV A;  3SV4 A;  3U3Y A;  1D8Y A;  4DKW A;  4DCH A;  4OKJ A;  1T6C A;  4IFY A;  1BHL A;  2G8F A;  3MCA B;  3U8X A;  2OTJ N;  4DFJ A;  3WXI A;  2RE2 A;  4UQG A;  1WLJ A;  1JLQ A;  3QIO A;  2IC3 A;  1VSD A;  1ZXO A;  4KRF A;  3KK1 A;  2HHW A;  3VEV A;  3L4I A;  4PA1 A;  4H5W A;  2CGK A;  3UKR A;  2J4R A;  3ULE B;  3O3G A;  3H6E A;  3EZW A;  4FZY A;  4DTS A;  2VQF K;  4ID5 A;  4BC3 A;  3KTQ A;  3RVC A;  1DTT A;  1Z6R A;  2H3G X;  4FWS A;  4JD2 B;  3DLH A;  2QXF A;  3HVR A;  4HHT A;  4CFC A;  3CCS N;  4PKH A;  3AVG A;  3RR8 A;  4CGD A;  4B08 A;  4C8N A;  1VSM A;  2OCE A;  3M6G A;  5FPM A;  2ITM A;  5M1Q A;  1VQO N;  1SKS A;  2HST A;  1ESV A;  4IG3 A;  4PHT X;  1XI1 A;  4EHT A;  5HRO A;  2D0P A;  1YIT N;  4JLH A;  3L6Q A;  3TAN A;  4O4G A;  1NJY A;  3DLL L;  3EL2 A;  3V81 A;  4YHH K;  1U2V B;  3AA2 A;  1GLJ O;  3WXJ A;  3DLK A;  3ZT1 A;  3CJC A;  3SI6 A;  5AQO A;  4KO0 A;  5TKW A;  3J7Y P;  2AA4 A;  1S3X A;  4WCE L;  3L2Q A;  2V7Z A;  1EWR A;  1VSH A;  3SNN A;  1OVQ A;  1CXU A;  1HNV A;  3MN5 A;  4E1M A;  4FW2 A;  4DV3 K;  4W5T A;  4B9V A;  3QER A;  4DLE A;  3DOL A;  4Z4H A;  4EP5 A;  3ZT2 A;  1TUU A;  2UXC K;  4BE0 A;  5AQJ A;  3K9J A;  3H1V X;  5I3U A;  3WXK A;  5A2Q O;  5F1X A;  3QEI A;  1S1X A;  1NK6 A;  1HRH A;  4FJ7 A;  3DRP A;  5EX5 A;  2HHV A;  5FRM A;  4Y1D A;  2YHY A;  1CXQ A;  4PL7 A;  3DYA A;  4IFE A;  1S1U A;  2NRX A;  1KFS A;  2E2Q A;  3O8M A;  3CJ9 A;  3NF9 A;  3SJH A;  3O6W A;  1WOQ A;  3C65 A;  3AA5 X;  3FZK A;  5CYQ A;  4FJM A;  1RT6 A;  1E4F T;  1S9E A;  4IOC L;  1SV5 A;  5AQF A;  1SQK A;  2QI2 A;  1RDA A;  4IO8 A;  3OJS A;  4CF8 A;  4M63 C;  3KLE A;  1NK0 A;  3TTF A;  3JSM A;  3CHW A;  4FYD A;  5C15 A;  3MN7 A;  3IFR A;  4GV9 A;  1TGO A;  3FR0 A;  3KJV A;  5ADX A;  3OS0 A;  4K0K K;  2YJF A;  4A5B A;  5C2D A;  3QEV A;  3SK3 A;  4B9S A;  4F2R A;  1KFD A;  4DU3 A;  1IH7 A;  1NJW A;  5AQQ A;  2JGU A;  3TAM A;  3AVK A;  4KRE A;  4YDU C;  4KHU A;  4GVE A;  1RT7 A;  3A0I X;  2KKZ A;  3C95 A;  3GG4 A;  1SZ2 A;  2EWS A;  1EWQ A;  5C42 A;  4LFB K;  2PBD A;  2IOC A;  5J2Q A;  1BGX T;  4CHQ A;  3OY9 A;  3ID8 A;  4JKE A;  3R3L A;  2O8F B;  4W5N A;  5JS1 A;  3SPY A;  5HLF A;  4NLC A;  1S9G A;  2O8D A;  4CGF A;  3QEW A;  4FWK A;  1WUA A;  4LF8 K;  3S3N A;  3V1O A;  3G10 A;  4ISF A;  5D3G A;  2KHO A;  4FCY A;  1IJJ A;  5GAG P;  1QHA A;  1HJO A;  3GBT A;  1RIL A;  3BY5 A;  3RMA A;  1IG9 A;  1N33 K;  4BRA A;  1Q82 O;  1EET A;  1YVU A;  4JKG B;  4AHS A;  4IFV A;  2IVO A;  1HQU A;  1RBR A;  3QIN A;  1O13 A;  2Z1H A;  4JEP A;  2JLE A;  1OH5 A;  4FM1 A;  2D1K A;  1VQ4 N;  1KVC A;  2D0B A;  3K5M A;  4I6M A;  3WXL A;  4KH4 A;  3NGI A;  2IGI A;  5EXW A;  2A1R A;  3CCM N;  1KQS M;  3RWU A;  1WSJ A;  2BTF A;  2FC0 A;  4IEI A;  3QLH A;  3AO5 A;  2QK9 A;  3BZK A;  3SBT A;  1IV0 A;  1XMO K;  1K73 O;  4Z4G A;  1HNZ K;  4AIL C;  5AJ3 K;  2B5J A;  1NGG A;  3WQT A;  1SAZ A;  1Q81 O;  2ZGY A;  2VG5 A;  3HM8 A;  2HMI A;  5KTQ A;  3AVF A;  2O8B A;  3V9W A;  2UXD K;  1EP4 A;  4M45 A;  4J2A A;  2HBK A;  1GLF O;  1NMD A;  2X78 A;  4N56 A;  3HT3 A;  4A62 A;  5ELZ A;  2VGN A;  3AVA A;  1DTQ A;  1LV5 A;  1G99 A;  2P9N B;  4ILJ A;  4CF9 A;  1KD1 O;  2E8A A;  3MXM A;  4GNI A;  2HND A;  1NNE A;  3VQQ A;  3OYA A;  3TAP A;  3T69 A;  4BRK A;  3NAE A;  3T1A A;  1U4B A;  5GAD P;  1NU0 A;  4BG8 A;  3LWL A;  3LDQ A;  2B6A A;  5AQV A;  5HRP A;  4OPA A;  1BIU A;  4RW4 A;  3RRH A;  1WB9 A;  5AR0 A;  5J2N A;  4H5N A;  1OH7 A;  4DHY A;  1UA1 A;  4LC9 B;  1REV A;  4X64 K;  4I2Q A;  4FWL A;  3FLC O;  2KTQ A;  3O1W A;  4F3O A;  3PY8 A;  3AVL A;  1E3M A;  3UKU B;  1R0A A;  2VQE K;  1NJX A;  4LFA K;  3CFR A;  5AQG A;  4FJ9 A;  2Q0U A;  3A5M C;  5LJW A;  2QKK A;  5AQY A;  2HOE A;  2P9K A;  4OGE A;  2V52 B;  2NLX A;  1FW6 A;  2P9I A;  4U67 L;  5FRO A;  3G4S N;  4E7L A;  1TYQ B;  4BWJ A;  5AQN A;  1QE1 A;  3SJJ A;  1JCF A;  2QW9 A;  2RKI A;  3W0L A;  5AQW A;  2G8V A;  3AVN A;  1NWK A;  2D5R A;  1K8K B;  4KH5 A;  4O0J A;  1N34 K;  1YHQ N;  5BPM A;  4B9U A;  3CJ7 A;  2ZJP L;  1RDU A;  4HTL A;  4RG8 A;  1ASW A;  1DGK N;  3TPQ A;  2QA4 N;  3MCP A;  4FJ8 A;  3IUC A;  4BDY A;  1GLA G;  3BF1 A;  1HJR A;  3ZSW A;  4CZF A;  4N76 A;  4DSL A;  3VTI A;  5KPR A;  1HKG A;  4EZ6 A;  1RT1 A;  5CE3 A;  4CZJ A;  2GTD A;  3O9R A;  4EHU A;  3K9K A;  4A5A A;  4JRP A;  4ZTF A;  1FJG K;  4BRG A;  2OAN A;  4K42 A;  1BL3 A;  2A6A A;  3T7Z A;  2Q97 A;  2A40 A;  2DFE A;  3GOI A;  3KWI A;  3ZT4 A;  4DF4 A;  1SL1 A;  4LF6 K;  3JYT A;  4BR4 A;  4WF9 L;  1MU2 A;  1NGB A;  4X66 K;  1P90 A;  3RMB A;  1N8R O;  1GLB G;  1TV6 A;  5I9E B;  3P1G A;  4JKD A;  4N5S A;  5FPD A;  4MLH A;  1HX1 A;  3VQP A;  2VWJ A;  4B9M A;  2HB5 A;  1A5W A;  2O4I A;  4K25 A;  2IDO A;  3KD1 E;  2UUC K;  3LDO A;  3C6H A;  1HPZ A;  2G8U A;  1C0M A;  4H5T A;  2P9L B;  1CZB A;  5JMV A;  2Q2R A;  3WEE B;  1NM1 A;  3SQ0 A;  1GLL O;  4B1Z A;  4M3R A;  2W40 A;  3CMA N;  3J8A A;  4FWN A;  3EKU A;  4YY3 K;  3DRR A;  1LWC A;  4IDK A;  4BC2 A;  5AFU A;  1Y64 A;  4FK4 A;  3DAW A;  3I8D A;  4JV5 K;  3N4P A;  2F4V K;  2Z1J A;  4PKI A;  3W3D A;  3V1Q A;  4JI5 K;  3SQ1 A;  1RTD A;  1KVA A;  4DSJ A;  5T7B A;  2RF2 A;  4KI4 A;  4Q0B A;  3U4L A;  3HVT A;  4RW6 A;  1KLN A;  3H3N O;  5I42 A;  2RHK A;  4B9N A;  3DJC A;  4BR0 A;  3G6E N;  1W0H A;  2CH6 A;  4CJK A;  1QTM A;  3LDS A;  3SPZ A;  2XY5 A;  1TUY A;  2VCP A;  2YV0 X;  2O4G A;  4JKH A;  3CCU N;  4FJL A;  4KHY A;  3AVC A;  1SL0 A;  1VQM N;  1VSJ A;  5GAE P;  1YF5 L;  3VQ6 A;  4KTW A;  4O5B A;  1S6Q A;  2RN2 A;  1C6V A;  4DTU A;  1HKB A;  3P31 A;  2QWO A;  2GUP A;  4HWI A;  1NKC A;  2YHX A;  1B92 A;  4IDH A;  1N36 K;  1J5E K;  3D2E B;  4H0Y B;  1KVB A;  2ASM A;  3FZH A;  1Q9X A;  4G1Q A;  1K6Y A;  2Y1I A;  1CZA N;  2WON A;  4CK3 A;  2G8K A;  3ZSQ A;  3TR8 A;  4PUO A;  1I3A A;  4YOT A;  5JVG L;  3VQE A;  3ASM A;  3IKM A;  2EHG A;  4CEF A;  4DSE A;  3G0Z A;  4KAZ A;  4BVP A;  4WFA L;  4Y1C A;  4LH4 A;  1NKB A;  2PY5 A;  4CEZ A;  3J7A P;  1M90 O;  2GX9 A;  3RMC A;  2ZM6 K;  1NOZ A;  3D7E O;  3OYF A;  3BUZ B;  3SYZ A;  1U04 A;  3OW2 M;  2OZS A;  3K58 A;  1X1P A;  3TAR A;  3CM6 A;  3P38 A;  1HYS A;  3TTC A;  3N4Q A;  3DXK A;  1HQE A;  1NMN A;  5CY4 A;  3EYZ A;  1NGI A;  4DFP A;  1I39 A;  1FXX A;  4WFN L;  4JKB A;  4JS4 A;  4GKJ K;  3G25 A;  2UU9 K;  1XC9 A;  4PY5 A;  3LP0 A;  4DG1 A;  4RW9 A;  4KB1 A;  3SMP A;  3HOS A;  4KTQ A;  1M1K O;  4A59 A;  1HR0 K;  1T6D A;  4ELU A;  2QWL A;  3LAN A;  4B3O A;  4CFD A;  4MDB A;  3ZSZ A;  2OPS A;  4AF1 A;  5K14 A;  4WQ5 C;  3VES A;  4Q5V A;  1NGH A;  4CJT A;  2HVH A;  2HF4 A;  4I9Q A;  1XNR K;  3WNG A;  3HXM A;  5DK5 A;  3ITH A;  2ZJR L;  3WNF A;  3I0R A;  4WQ5 A;  3OYH A;  4DTM A;  1T3V A;  1FKO A;  2DPN A;  2HVI A;  1RTH A;  3F9M A;  1C0U A;  4BQZ A;  4BRM A;  3CCV N;  1GLE G;  4ILG B;  1QSL A;  2FF3 B;  3CD6 N;  1WBD A;  3RTV A;  1BI4 A;  4RCH A;  3ZSV A;  4BE2 A;  3I0S A;  4A57 A;  4B9Q A;  4E7K A;  4OGC A;  1K9M O;  3PO4 A;  5J1E A;  4J2B A;  5HRR A;  2E6L A;  3DXM A;  4G9Z A;  4H0X B;  3C7N A;  2YNH A;  1L3V A;  3F9K A;  5HRS A;  1VSE A;  2YKM A;  3NF8 A;  2W6K A;  1NKE A;  4JI6 K;  1B9D A;  3M5R A;  2Q3S A;  4BRF A;  1IBM K;  3AAQ A;  1NK7 A;  4E1N A;  1HNX K;  2O8C B;  1KLM A;  4OPK A;  1U6Z A;  4IO9 L;  1KXP A;  4Z0U A;  1XQS C;  4ILH A;  1SKW A;  1BCO A;  3LZJ A;  1ATS A;  4FLW A;  1DLO A;  4XH1 A;  2X6N A;  4DR2 K;  3HRG A;  1QQM A;  3SUP A;  3U9D A;  4DV0 K;  4C1N K;  5BN8 A;  1TL1 A;  1QHT A;  4CJR A;  3SQ2 A;  4HVJ A;  2QTD A;  4CGI A;  4CBX A;  4XIU A;  2OPR A;  3TAB A;  4DWI A;  2QEX N;  4LF5 K;  4NYN A;  2WOM A;  3OA9 A;  2XY6 A;  1N32 K;  2P9P A;  4DU1 A;  1S1T A;  4MLE A;  3BZC A;  3NBP A;  3D45 A;  1HYZ A;  4H5R A;  4BWM A;  3ZYY X;  4CJP A;  4OKE A;  5AFU H;  1EX4 A;  1NK4 A;  3CPW M;  1XNQ K;  5AQX A;  3NVK A;  4CZG A;  3FZM A;  3CPE A;  1YUW A;  3BGR A;  2A3Z A;  5CYM A;  2Y1J A;  3PX0 A;  1UA0 A;  3RRG A;  5DM6 L;  2P51 A;  2F96 A;  3TU5 A;  1K8A O;  3DM2 A;  1YT3 A;  3KLH A;  4GV6 A;  5HBM A;  5KRS A;  2VYP A;  3PLA A;  2I7P A;  4DR3 K;  1JKH A;  3TTD A;  3VER A;  4KH6 A;  4GMJ B;  2DFH A;  3O08 A;  3R9P A;  5GIN A;  3TAF A;  1C1B A;  4M3U A;  1E4G T;  1KAY A;  5JLF A;  4CEB A;  1VQ5 N;  1P8Z A;  3ZSO A;  1OVY A;  4JNE A;  3QIP A;  4H0O A;  3LP2 A;  2WUS A;  1IKV A;  4IBN A;  3ULE A;  3VOV A;  1JL1 A;  4I6M B;  3CC4 N;  4DQS A;  4FPB A;  1X3M A;  1LOT B;  1W9H A;  1W2B M;  2OPQ A;  1VRT A;  2JWL A;  4LH5 A;  4JD2 A;  1HKC A;  2OA8 A;  2QWN A;  1NGE A;  3ZET A;  1RBU A;  1U45 A;  2ITG A;  5KGW A;  3MN9 A;  3ZEU A;  4O8U A;  4I2P A;  1RDD A;  3V9X A;  4FM0 A;  5HP1 A;  4GV3 A;  3LP1 A;  3AAP A;  5KPT A;  2W42 A;  3OBW A;  3Q7B A;  1TK8 A;  3PUF A;  1CZ9 A;  4BRL A;  4CD3 A;  1T03 A;  4IKF A;  2NNW A;  1NGA A;  4CFA A;  4LSL A;  5AZJ B;  4YDU A;  4FSV A;  1TKX A;  4CHY A;  1KRP A;  3UB5 A;  2LSN A;  4O55 A;  1D4X A;  4DTP A;  2XY7 A;  3QO9 A;  4JAX A;  3QBX A;  2IVP A;  4CK2 A;  5KQ8 A;  4BRD A;  5AZI B;  3P4I A;  2VWK A;  3CG7 A;  4N41 A;  2P5G A;  3ZSY A;  4QS8 A;  3WQU A;  3OYK A;  4DSF A;  3KD5 E;  4BRO A;  4CF2 A;  3THV A;  3S3O A;  4R79 A;  4BE1 A;  3CYM A;  4FJI A;  4CD1 A;  1SUQ A;  2W41 A;  4NO7 A;  4CEO A;  4ZHR A;  5HOO A;  1RT3 A;  3K5N A;  5GIO A;  4E1J A;  1KCF A;  4H0T B;  1XUP O;  4XH4 A;  3D2F A;  1VSK A;  4I7F A;  4NXN K;  4IOX A;  3KZB A;  2YNF A;  4CES A;  1BA1 A;  4CER A;  3L2U A;  3S3M A;  1LW0 A;  3NE6 A;  3QB0 A;  5AQL A;  1L3S A;  1ILY A;  1KAZ A;  3CQY A;  4A2B A;  4NB4 A;  1VQ6 N;  1RNH A;  3LDL A;  1T44 A;  2DY4 A;  4KBO A;  2VG7 A;  5BR9 A;  3CM5 A;  2X74 A;  4CIE A;  4M41 A;  4CFB A;  5BRD A;  3SUO A;  2BH1 A;  2KFZ A;  3OS1 A;  4OX9 K;  4FWO A;  4CHP A;  1XHX A;  4CBU A;  3VMF B;  2F9T A;  3HSC A;  2BGG A;  2P9U A;  1L3U A;  3AA4 A;  1C1C A;  4DV2 K;  4CJ5 A;  2PYJ A;  4PKG A;  3OHR A;  1YXQ A;  3QFU A;  3V9Z A;  1S72 N;  1WN7 A;  3CER A;  1VQ8 N;  4JI2 K;  4F8R A;  3K57 A;  4DV6 K;  3EY1 A;  4FL9 A;  4RW7 A;  3JXU A;  5EY4 A;  3ZSX A;  3KLG A;  3NF7 A;  4B1Y B;  3KKR A;  3M1F A;  4BR7 A;  4CEE A;  1GOB A;  4NXM K;  3KKS A;  3ZCM A;  1QSY A;  5KI6 A;  1XMQ K;  1YJ9 N;  1BWF O;  3PIO L;  5AQP A;  1QVF M;  1TKT A;  2YJE A;  1YVN A;  1ZBF A;  4YNQ A;  3ENO A;  1Q7Y O;  3MEG A;  5J2P A;  3IAY A;  3A2F A;  3V9U A;  2XRI A;  1OH8 A;  1ZBS A;  4IOA L;  2O8E A;  4B3S K;  1JLG A;  4H8K A;  4EZ9 A;  3AY9 A;  4NCA A;  4FWR A;  1XHZ A;  1NK5 A;  3A8Y A;  3VF6 A;  1BU6 O;  5LJV A;  3ZT3 A;  4FJN A;  1TKD A;  3VTH A;  1VQL N;  3CCR N;  5F2R A;  1X9W A;  4BRN A;  4FZX C;  3VQ7 A;  3TI0 A;  3H46 O;  1TL3 A;  3VQB A;  2UUA K;  1NOY A;  4MO5 A;  1ATR A;  3T19 A;  4GW6 A;  3TSU A;  2G8I A;  2Q36 A;  4I9L A;  4ISE A;  4BY9 C;  4KTZ A;  4E7I A;  1NGJ A;  3K5L A;  2ZWH A;  4CED A;  1OH6 A;  3WNH A;  2R7Y A;  1D5A A;  5CR4 A;  1C0G A;  5JIC A;  4CZH A;  2HW3 A;  3NGY A;  4QAG A;  2YX6 A;  4Z94 A;  1MDU B;  1DT9 A;  1C0F A;  4CJW A;  3CI5 A;  3QBW A;  3TAG A;  3QES A;  3SUQ A;  4JHD B;  4AHR A;  4YOU A;  4FO0 A;  4DTN A;  4CEQ A;  5AQR A;  3VA3 A;  2ZD1 A;  2IVN A;  4DR1 K;  3SBG A;  2I7N A;  3NDK A;  1BIZ A;  4BRC A;  1LWE A;  4B3R K;  4B9L A;  2EX3 A;  2KW4 A;  3CJB A;  4GVM A;  4CEA A;  3O3F A;  3QNN A;  4AM6 A;  2P9S A;  4DR7 K;  2ASP A;  1YTU A;  4NLB A;  5AQK A;  3HOT A;  2OZM A;  3LPU A;  3L4Q A;  3J81 O;  3M8Q A;  4MO4 A;  1RCH A;  3C94 A;  3LM2 A;  4YOW A;  4M3Z A;  4JI0 K;  2A41 A;  2P5O A;  1NJI O;  1QS4 A;  2XY8 A;  4X65 K;  3CF5 L;  3B6P A;  2FSN A;  3D6R A;  3THY A;  1TAU A;  2QXL A;  1EXQ A;  4ISG A;  3VPZ A;  1FKP A;  3DRS A;  3O9T A;  3NF6 A;  5EU7 A;  4CCH A;  1T8E A;  1BG3 A;  3HO1 A;  4CGJ A;  4FJJ A;  2AP1 A;  3A5O C;  3IDH A;  1KAX A;  4Z4C A;  2IIR A;  4K8X A;  4BRI A;  3GDQ A;  2HNZ A;  4FJH A;  3UKU A;  4CVN E;  5SWM A;  4DMN A;  4C8L A;  3V4I A;  3OYL A;  2NRR A;  3THW A;  4JYA K;  4AHT A;  4BG9 A;  4BGA A;  3L0Q A;  2KQ2 A;  4FZZ A;  3FFI A;  5BRH A;  4FLU A;  2B4J A;  1NGD A;  4WE1 A;  1TK5 A;  5AQH A;  4M7Y A;  4B8C A;  3NFA A;  4MQ3 A;  3V6D A;  3RSE B;  4HCB A;  3DXK B;  4YOV A;  3C6T A;  3HST B;  1RDC A;  2FSK A;  5DM7 L;  1LW2 A;  3I33 A;  4J2E A;  4ELV A;  1JCG A;  3PO5 A;  3QEX A;  1N5Y A;  3JS6 A;  1L3T A;  3ENB A;  4C1N I;  4DTJ A;  2E20 A;  2Q0R A;  1BUP A;  2CGL A;  5AQZ A;  3HM9 A;  4OPH A;  2ZF5 O;  3KK2 A;  5JS2 A;  1VHX A;  3LDP A;  2PFU A;  3CC7 N;  4DTX A;  2DTU A;  1RFQ A;  5GIP A;  3IRX A;  5IWA K;  1KC8 O;  1A5V A;  3ATV A;  2BAN A;  3AAR A;  2A1S A;  4FXD A;  4CJ7 A;  4F3T A;  1S5J A;  2HHT A;  1BDG A;  4HUE A;  3U6F A;  4DTR A;  4A2A A;  4AM7 A;  4CJE A;  1EKE A;  2FBV A;  4CJF A;  1MWM A;  2WBN A;  2A5X A;  1J54 A;  2ZQB A;  2BUP A;  5JLH A;  1WSF A;  1GOC A;  4QS7 A;  3T1H K;  3DXM B;  1ASU A;  3L2W A;  1GLC G;  3TWH A;  3MWP A;  3SV3 A;  1V4S A;  4AQY K;  3LWM A;  3UKR B;  1RBV A;  4DS4 A;  5AQI A;  3C7N B;  4IJA A;  2BDP A;  3I55 N;  3HBT A;  4B1U B;  4DB3 A;  3CME N;  2NRW A;  3O3H A;  4AHU A;  2UUB K;  3SUN A;  2YCH A;  1HYV A;  1R59 O;  3AGR A;  2KZZ A;  3VEZ A;  3WEE A;  3P83 D;  5AQM A;  3SAH A;  4PWD A;  3VN5 A;  5F0X A;  2PZS A;  1Z25 A;  1U47 A;  2ASO A;  4B8A B;  1VQK N;  3SZ2 A;  1BQM A;  2HMP A;  4PL8 A;  2F9W A;  1Z05 A;  5M1P A;  4M3W A;  5FLX O;  4N47 A;  1TAQ A;  1UWB A;  1NBW A;  3VEY A;  4PQU A;  1WNS A;  3K2P A;  3KLF A;  5BRF A;  3D0P A;  3VGL A;  3LAL A;  2XO7 A;  3PX4 A;  3L3V A;  4BR5 A;  4Y0W A;  2P9P B;  3M8R A;  2YHA A;  4CZK A;  3NHG A;  4DFK A;  4W5O A;  2D0A A;  3C0B A;  4B1X B;  3CC2 N;  3K5O A;  3DLG A;  4OVL A;  3JAM O;  4LSN A;  1QZ5 A;  5C0Y A;  4CIF A;  3SCX A;  4FK2 A;  1HNW K;  5C10 A;  4QS9 A;  3ZT0 A;  3LAM A;  3VQD A;  5CZ1 A;  4KKO A;  4JI4 K;  3O9S A;  4E0D A;  3KIO A;  5FPE A;  3THX A;  3D2E A;  4J8F A;  1NLV A;  3VQ9 A;  4M3Y A;  4O44 A;  1JCE A;  3L3U A;  4DQI A;  3NH0 A;  5E84 A;  1T05 A;  1C1A A;  3OYB A;  1VK0 A;  4ZTJ A;  1X9S A;  3OYM A;  5BRE A;  2Q31 A;  3AVJ A;  3OYD A;  5IT9 O;  3J7Z O;  2ZE2 A;  2E5L K;  4DV4 K;  2G8W A;  3OJU A;  5LMU K;  4DS5 A;  4HCC A;  4LF9 K;  4CE9 A;  4JKF A;  3VEO A;  3OYJ A;  3M8P A;  3H3O B;  5B8H A;  5DMR A;  3SMS A;  3TSQ A;  4H5V A;  4B3T K;  3HK2 A;  4AHV A;  4E3S A;  3CCQ N;  4F9O A;  4O5F A;  4B3M K;  1X3N A;  3VF2 A;  3VEN A;  4RWT A;  4KV8 A;  1NK9 A;  1RTI A;  3DI6 A;  3E01 A;  4X62 K;  2OYQ A;  3SAF A;  4FWM A;  3EZ5 A;  3ZET B;  4HUF A;  3OTO K;  3ZEU B;  1RTJ A;  1JLC A;  4HTU A;  4C8K A;  3E66 A;  4DR4 K;  2WFB A;  3MEC A;  2HHS A;  2D0C A;  3E9L A;  4AH9 A;  5SZT A;  3G71 N;  3VA0 A;  1A5X A;  3S41 A;  4Z4E A;  1V4T A;  3KVG A;  3UE5 A;  1D9D A;  4CJS A;  4KHW A;  4QCL A;  4BRP A;  3OVN A;  1O1W A;  1BCM A;  4JI7 K;  4H03 B;  4BRH A;  4DFM A;  4LF7 K;  1S1W A;  4KHP K;  3KK3 A;  4CBW A;  3DLE A;  3MMV A;  4EFH A;  2O8D B;  3L2R A;  4IG0 A;  1QVG M;  4OKK A;  4JKC A;  3CQX A;  4O0I A;  1HNI A;  3SQ4 A;  4YOY A;  2VWB A;  2PAV A;  2KFN A;  2RPI A;  3CFO A;  2E2O A;  3VF4 A;  3H1Q A;  1RT4 A;  1I94 K;  3DOK A;  4KFB A;  2NRT A;  3TAQ A;  4CHN A;  2VGM A;  4FJX A;  1ZBL A;  1UAX A;  3TSP A;  3ZX3 A;  3HP6 A;  5J2M A;  4IJN A;  2GV9 A;  2WC9 A;  3D2F B;  2IS3 A;  3Q7C A;  4LFC K;  1J9A A;  3ZX2 A;  3F73 A;  3V1R A;  3HPG A;  3KHY A;  5KPZ A;  2WTU A;  3VGK A;  2NRZ A;  2QM1 A;  1G15 A;  3LL3 A;  3HP9 A;  4ICL A;  3CQ8 A;  1U49 A;  4DR6 K;  3PIP L;  3I56 N;  1ZBU A;  4LY7 A;  2FBY A;  4C23 A;  1S22 A;  2BE2 A;  1YJW N;  2O8C A;  1VAZ A;  1QQC A;  2PYL A;  4JS5 A;  5FDL A;  3ENH A;  2ZGZ A;  2FBX A;  2O8B B;  3KWG A;  4M7X A;  1LAV A;  2P9U B;  1BOT O;  3SLC A;  3F5T A;  1YI2 N;  1KTQ A;  4QOZ B;  4IEE A;  1VQP N;  5C25 A;  1F21 A;  3LP3 A;  5BPN A;  3OS2 A;  1U2V A;  4IZ9 A;  3MEE A;  3AO2 A;  3U9Z A;  3ALY A;  4KI6 A;  4BC5 A;  4CI6 A;  1TK0 A;  4M3X A;  1JXB A;  4NYF A;  5FPN A;  4K43 A;  3ID6 A;  3AGK A;  3I8B A;  4FLZ A;  1X9M A;  1L5U A;  2CH5 A;  3UIQ A;  3WNE A;  4JI8 K;  3E1Y A;  4BDP A;  4FOE A;  1QZ6 A;  2I5J A;  3AO3 A;  5LMN K;  4FJ5 A;  3P5J A;  3KLI A;  2O8E B;  1ZYQ A;  1BA0 A;  1YJN N;  2GWK A;  3AV9 A;  3O4W A;  4LD0 A;  3MK6 A;  5JVH L;  3VQC A;  2E1Y A;  1VQN N;  2OPP A;  3H08 A;  3ATU A;  5M1O A;  4FVU A;  3HL8 A;  4F4K A;  2E6M A;  3IMX A;  4ELT A;  3S9H A;  1RDB A;  3FGU A;  1J53 A;  4DV7 K;  1WAF A;  2P9K B;  2ZJQ L;  2UXB K;  2D0O A;  4FWP A;  1XWL A;  1JLA A;  2FLO A;  1T7P A;  2P9I B;  3VQ4 A;  3NGZ A;  2HHX A;  1ZC6 A;  3LZI A;  4BR9 A;  1Q8I A;  2YHW A;  4B9T A;  2HHH K;  4XEI A;  4C8M A;  1VQ9 N;  4JK8 A;  3C6A A;  3M8S A;  1JXE A;  3OBY A;  2HHQ A;  1TKZ A;  4WQ4 C;  1HPM A;  4KHN A;  3MX5 A;  1RGI A;  4BVO A;  1WAJ A;  4CGG A;  2GEM A;  4JI3 K;  1OKJ A;  2YNI A;  2DFF A;  1YAG A;  3AO1 A;  4CF1 A;  4CW7 B;  4RW8 A;  2P1J A;  5C24 A;  4WQ4 A;  4FK0 A;  3O5B A;  4FLV A;  3B6O A;  4Z4F A;  3EKS A;  2X6S A;  4DUZ K;  4FJG A;  5TKY A;  3EN9 A;  3BEX A;  2JWK A;  5E26 A;  4BRE A;  1LWF A;  1JJ2 M;  4IXC A;  3DLR A;  2Q1N A;  3C6U A;  2P9S B;  3QNO A;  4NCB A;  4L3Q A;  2NZT A;  5MLC Q;  1D9F A;  3U3G A;  3GL1 A;  4CZL A;  3VQA A;  4DV5 K;  3CJ1 A;  4WYB A;  1HUX A;  1MWK A;  3ZLJ A;  5AZJ A;  3A5N C;  4RTF D;  3H45 C;  3T1Y K;  3O9Q A;  4FVM A;  4YFU A;  3BDP A;  3THY B;  4OLA A;  2O8F A;  3AVI A;  2AJQ A;  1DEJ A;  2QWR A;  3M3Z A;  1XC3 A;  4FJK A;  1JLF A;  4FWQ A;  3HPH A;  5AZI A;  3L8B A;  1QQO A;  3EO3 A;  5C2F A;  1MA9 B;  2F7T A;  4CJ3 A;  3OYG A;  2HBJ A;  3O1B A;  1CLQ A;  1QQN A;  2ETJ A;  4JKG A;  4DV1 K;  1SL2 A;  3HYF A;  1NGC A;  3HZ6 A;  5AQU A;  4CJQ A;  1YTA A;  2F8T A;  1UOC A;  5AQT A;  4DU4 A;  1EO1 A;  1WSI A;  4GKK K;  3ULD A;  4O8K A;  1Z26 A;  4CF0 A;  2NUB A;  4FM2 A;  1RDW X;  3THW B;  3WT0 A;  4W5Q A;  4J2D A;  3LPT A;  1FK9 A;  2GBZ A;  3DLB A;  1LAW A;  3CJA A;  4JK7 A;  1S1V A;  2A42 A;  2HF3 A;  3E9O A;  2UYT A;  3MAQ A;  4JK9 A;  4DQR A;  2FXU A;  2E2P A;  3FZF A;  3WXM B;  4CZE A;  4BGB A;  3QFP A;  3T3F A;  3HJF A;  3BP8 A;  2OTL N;  5FRN A;  1H1V A;  4JKA A;  2W6L A;  3VET A;  4W5R A;  4ID1 A;  2E4L A;  1SKR A;  4DQP A;  3MXJ A;  1IKY A;  4CHO A;  5KQD A;  4YOX A;  3HTV A;  1LCU A;  4CK1 A;  1ZBI A;  3DWL A;  3VGM A;  4TSX A;  4E7H A;  5E41 A;  5BR8 K;  4M3T A;  1Q18 A;  4BQL A;  4CEC A;  1QSS A;  3TAE A;  2P9N A;  1VQ7 N;  3O80 A;  1S6P A;  3RMD A;  3ISN C;  3E9P A;  4A61 A;  4L8R B;  1VSI A;  4IWV A;  1Y97 A;  3NVM A;  1N6Q A;  1HMV A;  2YKN A;  3PSF A;  5HL7 L;  3QET A;  4OLB A;  1WSE A;  5AQS A;  2V51 B;  2QWQ A;  2HBL A;  4CJV A;  3NMU A;  1ASV A;  5BN9 A;  3P39 A;  2ATQ A;  2E2N A;  4JRQ A;  3MX2 A;  3VQ5 A;  1VRU A;  4DUY K;  3O4Q A;  4DTO A;  4B1V A;  3OYI A;  4JN4 A;  1NG9 A;  3AVH A;  3HI0 A;  2E88 A;  3F2K A;  4KPY A;  4U7B A;  3CCJ N;  4FLX A;  4H4O A;  1NGF A;  5ADX H;  5CHI A;  3J80 O;  3R8E A;  4CZI A;  1VSL A;  1YIJ N;  2YHB A;  4OO1 J;  4E89 A;  1WBB A;  4JI1 K;  2HNY A;  1WSG A;  5CZ2 A;  3CIP A;  1W7A A;  2V7Y A;  3EEQ A;  3BF3 A;  1Q86 O;  3PX6 A;  5C12 A;  4CJL A;  2FBT A;  3LM9 A;  3VEW A;  1IG8 A;  1TYQ A;  1SS6 A;  1RT2 A;  3AA3 A;  3O9U A;  3AVB A;  3OYE A;  1JL2 A;  4BDZ A;  1JLE A;  3CFP A;  4GY2 B;  3OYN A;  1IKW A;  5M1N A;  3QML A;  2F8S A;  1J6Z A;  3VQ8 A;  3FFK B;  1K8K A;  1BIS A;  4DQ8 A;  3FE1 A;  1BQN A;  4BR2 A;  1X9J A;  1VSF A;  4H4M A;  3AO4 A;  3CET A;  4XH5 A;  3GE1 A;  3A5L C;  2Z1I A;  2FF6 A;  4JHD A;  3NCI A;  1NJZ A;  4KB0 A;  1TVR A;  4MFB A;  2QWP A;  3SAG A;  4CHZ A;  1J5O A;  2GWJ A;  4C8O A;  1ITG A;  4CJ4 A;  2E1Z A;  5EVZ A;  1BO5 O;  2G8H A;  1U48 A;  3K59 A;  1B9F A;  3QDK A;  3EE8 A;  3MDQ A;  1ZBH A;  4Z4I A;  1IBL K;  3VEX A;  4K41 A;  3CXC M;  1W97 L;  4DSI A;  2QKB A;  5BPL A;  3MXI A;  2KLA A;  5GAH P;  4DSK A;  5LY3 A;  1IO2 A;  4CJU A;  3ZSR A;  1BI4 B;  4FW1 A;  3WUH A;  4V19 S;  4MDA A; 
#chains in the Genus database with same CATH homology
 4BAC A;  3EZ5 A;  2D5R A;  4K8Z A;  2VG6 A;  2VWK A;  3CG7 A;  4O0J A;  4HUF A;  4F2S A;  4N41 A;  2P5G A;  3ZSY A;  4HUG A;  4B9U A;  4DSF A;  3OYK A;  1RTJ A;  3KD5 E;  1JLC A;  4HTU A;  4RG8 A;  1KSP A;  4CF2 A;  3THV A;  1ASW A;  3S3O A;  4C8K A;  4BE1 A;  3CYM A;  4FJI A;  3MEC A;  2HHS A;  2D0C A;  3HPO A;  1SUQ A;  1Q9Y A;  4AH9 A;  4CEO A;  4ZHR A;  5SZT A;  4FJ8 A;  4KHS A;  3AVM A;  1RT3 A;  3OYC A;  3K5N A;  3VA0 A;  4BDY A;  1A5X A;  3LAK A;  4KHQ A;  1KCF A;  4R5P A;  2YNG A;  1HJR A;  3ZSW A;  4N76 A;  1VSK A;  4I7F A;  1C0T A;  4Z4E A;  1D9D A;  4OPJ A;  4DSL A;  2YNF A;  4CES A;  4CER A;  4M42 A;  3L2U A;  4CJS A;  1GOA A;  1LW0 A;  1RT1 A;  3S3M A;  4EZ6 A;  4KHW A;  4QCL A;  3OVN A;  1O1W A;  1BCM A;  3NE6 A;  5HRN A;  3O4N A;  1L3S A;  4DFM A;  3DMJ A;  4JRP A;  1S1W A;  4ZTF A;  3KK3 A;  1RNH A;  3DLE A;  2DY4 A;  2IAJ A;  2VG7 A;  3PV8 A;  1IKX A;  2X74 A;  3CM5 A;  1BL3 A;  4CIE A;  4M41 A;  4CFB A;  1RT5 A;  3SUO A;  2HHU A;  2DFE A;  2KFZ A;  3OS1 A;  3ZT4 A;  4DF4 A;  1SL1 A;  4E19 A;  4CGH A;  3RR7 A;  3MED A;  3JYT A;  4AHC A;  4IG0 A;  3L2R A;  1RBS A;  1MU2 A;  4OKK A;  4CHP A;  1RBT A;  1XHX A;  4O0I A;  1HNI A;  3RMB A;  3SQ4 A;  1L3U A;  2BGG A;  4DLG A;  3AA4 A;  1NK8 A;  3NH2 A;  1C1C A;  2XHB A;  3NH1 A;  2RPI A;  3CFO A;  2KFN A;  1TV6 A;  1RT4 A;  4CJ5 A;  4FLY A;  2PYJ A;  4EP4 A;  3DOK A;  3P1G A;  3V9Z A;  4N5S A;  4KFB A;  3QEP A;  3TAQ A;  4CHN A;  1WN7 A;  4FJX A;  4F8R A;  1ZBL A;  3VQP A;  3K57 A;  2VWJ A;  1UAX A;  3IG1 A;  2HB5 A;  5KRT A;  3HP6 A;  3EY1 A;  4RW7 A;  3V9S A;  5J2M A;  2Z1G A;  3ZSX A;  1A5W A;  5KGX A;  3KLG A;  2O4I A;  2GV9 A;  3NF7 A;  4DF8 A;  4FLT A;  2IS3 A;  2IDO A;  3KKR A;  4CEE A;  3KD1 E;  1J9A A;  1GOB A;  3KKS A;  3ZCM A;  3L2V A;  2GUI A;  1HPZ A;  5KI6 A;  3F73 A;  1QSY A;  3V1R A;  3HPG A;  2G8U A;  1WSH A;  1C0M A;  4OJR A;  1CZB A;  1TKT A;  1G15 A;  3HP9 A;  1ZBF A;  4ICL A;  4YNQ A;  3CQ8 A;  3SQ0 A;  1U49 A;  4CIG A;  4M3R A;  3MEG A;  1ZBU A;  5J2P A;  3IAY A;  3A2F A;  3V9U A;  4LY7 A;  2OYQ A;  2FBY A;  3IS9 A;  2XRI A;  4DQQ A;  3DRR A;  1JLG A;  4H8K A;  2BE2 A;  4NCG A;  1LWC A;  4EZ9 A;  4IDK A;  4NCA A;  1XHZ A;  4FK4 A;  2KZM A;  1NK5 A;  1QQC A;  2PYL A;  4E7J A;  1JLB A;  3I8D A;  3SV4 A;  3U3Y A;  4JS5 A;  2Z1J A;  5FDL A;  3ZT3 A;  1D8Y A;  4FJN A;  3V1Q A;  4OKJ A;  3SQ1 A;  1TKD A;  1RTD A;  1KVA A;  4DSJ A;  4IFY A;  2RF2 A;  5T7B A;  2FBX A;  1BHL A;  4KI4 A;  2G8F A;  4Q0B A;  1X9W A;  1LAV A;  4DFJ A;  4FZX C;  3HVT A;  4RW6 A;  3VQ7 A;  1KLN A;  3TI0 A;  1TL3 A;  3VQB A;  5I42 A;  4B9N A;  1NOY A;  4UQG A;  1KTQ A;  3T19 A;  4GW6 A;  1WLJ A;  1W0H A;  1JLQ A;  4QOZ B;  3QIO A;  4CJK A;  2IC3 A;  1QTM A;  3LDS A;  1VSD A;  5C25 A;  2G8I A;  1F21 A;  3LP3 A;  4I9L A;  3OS2 A;  2XY5 A;  3SPZ A;  2YV0 X;  3MEE A;  4KTZ A;  3AO2 A;  4KRF A;  4E7I A;  2O4G A;  3KK1 A;  2HHW A;  4KI6 A;  3ALY A;  4PA1 A;  1TK0 A;  3K5L A;  4FJL A;  3O3G A;  1JXB A;  4NYF A;  3AVC A;  4CED A;  4B9M A;  1SL0 A;  4M3X A;  4KHY A;  4FZY A;  3WNH A;  4DTS A;  4ID5 A;  4FLZ A;  1VSJ A;  2R7Y A;  3VQ6 A;  1D5A A;  4KTW A;  1DTT A;  1S6Q A;  4O5B A;  1X9M A;  1L5U A;  3KTQ A;  2HW3 A;  2RN2 A;  3NGY A;  1C6V A;  4QAG A;  3UIQ A;  4DTU A;  3WNE A;  3DLH A;  4BDP A;  2QXF A;  3HVR A;  4HHT A;  4CFC A;  3AO3 A;  2I5J A;  4CJW A;  1NKC A;  3AVG A;  1B92 A;  3P5J A;  3KLI A;  4CGD A;  4B08 A;  1ZYQ A;  3RR8 A;  4FJ5 A;  3TAG A;  3AV9 A;  4C8N A;  1VSM A;  4LD0 A;  3QES A;  1KVB A;  3VQC A;  2OPP A;  3H08 A;  1Q9X A;  3SUQ A;  3HL8 A;  1SKS A;  4G1Q A;  1K6Y A;  4AHR A;  2Y1I A;  2WON A;  4F4K A;  2E6M A;  4IG3 A;  4CK3 A;  4DTN A;  4CEQ A;  1XI1 A;  2G8K A;  3VA3 A;  2ZD1 A;  4ELT A;  3S9H A;  1RDB A;  5HRO A;  3ZSQ A;  3NDK A;  3TR8 A;  1J53 A;  1I3A A;  4JLH A;  4PUO A;  1BIZ A;  3VQE A;  1WAF A;  1LWE A;  3TAN A;  3ASM A;  4O4G A;  1NJY A;  2EHG A;  4CEF A;  2EX3 A;  2KW4 A;  4GVM A;  4CEA A;  3G0Z A;  3O3F A;  4DSE A;  3QNN A;  3V81 A;  4KAZ A;  1XWL A;  1JLA A;  3AA2 A;  4Y1C A;  1T7P A;  1YTU A;  4LH4 A;  2OZM A;  3DLK A;  3VQ4 A;  3ZT1 A;  1NKB A;  2PY5 A;  3LPU A;  3SI6 A;  3NGZ A;  4KO0 A;  2HHX A;  3M8Q A;  3LZI A;  1RCH A;  4CEZ A;  3C94 A;  1Q8I A;  4B9T A;  3RMC A;  4M3Z A;  1NOZ A;  4C8M A;  3L2Q A;  3OYF A;  2P5O A;  1QS4 A;  2XY8 A;  3SYZ A;  1U04 A;  3B6P A;  1VSH A;  3M8S A;  3SNN A;  2OZS A;  1CXU A;  3K58 A;  1X1P A;  1JXE A;  1HNV A;  2HHQ A;  1TKZ A;  4E1M A;  3TAR A;  3CM6 A;  4FW2 A;  1TAU A;  1HYS A;  4W5T A;  4KHN A;  4B9V A;  1HQE A;  1WAJ A;  5CY4 A;  3EYZ A;  3QER A;  1EXQ A;  4DLE A;  3DOL A;  4CGG A;  1I39 A;  4Z4H A;  1FXX A;  4DFP A;  1FKP A;  3ZT2 A;  2YNI A;  4EP5 A;  2DFF A;  3DRS A;  3AO1 A;  4CF1 A;  4JS4 A;  3NF6 A;  4RW8 A;  5EU7 A;  2P1J A;  4BE0 A;  5C24 A;  1XC9 A;  4CCH A;  1T8E A;  3LP0 A;  4PY5 A;  4DG1 A;  4RW9 A;  4FK0 A;  4KB1 A;  4KTQ A;  3HO1 A;  5I3U A;  4CGJ A;  4FLV A;  4FJJ A;  4ELU A;  3QEI A;  3B6O A;  4Z4F A;  1S1X A;  2X6S A;  1NK6 A;  1HRH A;  3LAN A;  4Z4C A;  4B3O A;  4CFD A;  4FJG A;  4FJ7 A;  4K8X A;  3DRP A;  2HHV A;  5FRM A;  4Y1D A;  2HNZ A;  4FJH A;  1LWF A;  3ZSZ A;  3DLR A;  2OPS A;  5SWM A;  4DMN A;  3C6U A;  1CXQ A;  3DYA A;  4C8L A;  3V4I A;  3QNO A;  1S1U A;  5K14 A;  1KFS A;  4NCB A;  4Q5V A;  3OYL A;  4CJT A;  2HVH A;  4I9Q A;  4AHT A;  1D9F A;  3WNG A;  3NF9 A;  3U3G A;  3HXM A;  3VQA A;  2KQ2 A;  5DK5 A;  4FZZ A;  3ITH A;  3FFI A;  3WNF A;  4FLU A;  3I0R A;  3OYH A;  3AA5 X;  4DTM A;  1FKO A;  5CYQ A;  4FJM A;  2B4J A;  1RT6 A;  4WE1 A;  1RTH A;  1S9E A;  1TK5 A;  1C0U A;  4FVM A;  2HVI A;  4YFU A;  3BDP A;  1SV5 A;  1QSL A;  4OLA A;  4B8C A;  3NFA A;  4MQ3 A;  3V6D A;  3AVI A;  1RDA A;  4HCB A;  2AJQ A;  3C6T A;  3RTV A;  4FJK A;  1BI4 A;  1JLF A;  3HST B;  1RDC A;  3ZSV A;  4CF8 A;  3OJS A;  4BE2 A;  3HPH A;  3I0S A;  1LW2 A;  3L8B A;  3KLE A;  1NK0 A;  4J2E A;  4ELV A;  4E7K A;  4OGC A;  3PO5 A;  3JSM A;  3PO4 A;  3QEX A;  1N5Y A;  5J1E A;  1L3T A;  4J2B A;  4FYD A;  4CJ3 A;  4DTJ A;  3OYG A;  5HRR A;  2E6L A;  1TGO A;  1CLQ A;  3HM9 A;  3KJV A;  2ETJ A;  3OS0 A;  3KK2 A;  1SL2 A;  3HYF A;  2YNH A;  4CJQ A;  1YTA A;  3QEV A;  5JS2 A;  2F8T A;  1UOC A;  3F9K A;  1L3V A;  4B9S A;  5HRS A;  4F2R A;  1KFD A;  4DU4 A;  1VSE A;  4DU3 A;  1IH7 A;  2YKM A;  3NF8 A;  1NJW A;  2JGU A;  1WSI A;  3TAM A;  3AVK A;  1NKE A;  4KRE A;  1B9D A;  4DTX A;  3ULD A;  4KHU A;  2Q3S A;  2DTU A;  1RT7 A;  1Z26 A;  4CF0 A;  2NUB A;  4FM2 A;  4J2D A;  4W5Q A;  3LPT A;  3C95 A;  1FK9 A;  2GBZ A;  3IRX A;  3DLB A;  1LAW A;  1NK7 A;  4E1N A;  1A5V A;  1S1V A;  2BAN A;  2A1S A;  1KLM A;  5C42 A;  4OPK A;  4FXD A;  3MAQ A;  2IOC A;  4Z0U A;  4DQR A;  4F3T A;  1SKW A;  1BCO A;  1S5J A;  5J2Q A;  1BGX T;  3LZJ A;  2HHT A;  4CHQ A;  3OY9 A;  4HUE A;  3U6F A;  4W5N A;  3T3F A;  3HJF A;  4DTR A;  5JS1 A;  4FLW A;  1DLO A;  4CJE A;  1EKE A;  2FBV A;  4CJF A;  3SPY A;  5FRN A;  2X6N A;  5HLF A;  1S9G A;  4CGF A;  3QEW A;  3SUP A;  3S3N A;  4W5R A;  4ID1 A;  2E4L A;  1J54 A;  1SKR A;  4DQP A;  3V1O A;  3G10 A;  1IKY A;  3MXJ A;  4CHO A;  1TL1 A;  1QHT A;  5D3G A;  2ZQB A;  4CJR A;  3SQ2 A;  4HVJ A;  4FCY A;  4CGI A;  1WSF A;  1GOC A;  1RIL A;  4XIU A;  3RMA A;  2OPR A;  4CK1 A;  1ASU A;  3L2W A;  3TAB A;  1IG9 A;  4NYN A;  4DWI A;  1ZBI A;  3TWH A;  3SV3 A;  2WOM A;  4TSX A;  2XY6 A;  3LWM A;  1EET A;  1YVU A;  4E7H A;  1RBV A;  4AHS A;  5E41 A;  4IFV A;  4DS4 A;  4M3T A;  4DU1 A;  1S1T A;  4CEC A;  1QSS A;  2BDP A;  3TAE A;  1HQU A;  1RBR A;  3QIN A;  3NBP A;  2Z1H A;  3D45 A;  2JLE A;  1S6P A;  3O3H A;  3RMD A;  3ISN C;  4AHU A;  4FM1 A;  1HYZ A;  3SUN A;  4BWM A;  4L8R B;  1VSI A;  1HYV A;  1KVC A;  1Y97 A;  2D0B A;  4CJP A;  1N6Q A;  4OKE A;  1HMV A;  2YKN A;  3K5M A;  1EX4 A;  1NK4 A;  2KZZ A;  3NGI A;  2IGI A;  4OLB A;  3QET A;  2A1R A;  1WSE A;  3RWU A;  1WSJ A;  3BGR A;  3P83 D;  4CJV A;  4PWD A;  2FC0 A;  1ASV A;  3QLH A;  5CYM A;  3VN5 A;  3AO5 A;  2Y1J A;  3PX0 A;  1UA0 A;  2QK9 A;  2PZS A;  3RRG A;  1Z25 A;  2P51 A;  2ATQ A;  1U47 A;  2F96 A;  4JRQ A;  3VQ5 A;  3DM2 A;  1VRU A;  1YT3 A;  3KLH A;  3O4Q A;  5HBM A;  4B8A B;  3OYI A;  3SZ2 A;  1BQM A;  4DTO A;  4Z4G A;  4AIL C;  5KRS A;  2B5J A;  3AVH A;  4M3W A;  2VG5 A;  1JKH A;  2HMI A;  4N47 A;  5KTQ A;  4KPY A;  1TAQ A;  3AVF A;  1UWB A;  4H4O A;  4FLX A;  4GMJ B;  2DFH A;  4PQU A;  1WNS A;  3K2P A;  3V9W A;  3KLF A;  1EP4 A;  4M45 A;  4J2A A;  3TAF A;  3D0P A;  1VSL A;  2X78 A;  1C1B A;  3LAL A;  2YHB A;  4N56 A;  2XO7 A;  3PX4 A;  4E89 A;  3HT3 A;  3L3V A;  4M3U A;  2HNY A;  1WSG A;  5CZ2 A;  4CEB A;  3M8R A;  3AVA A;  1DTQ A;  2YHA A;  3ZSO A;  4DFK A;  3NHG A;  1LV5 A;  4W5O A;  4CF9 A;  3PX6 A;  3QIP A;  2D0A A;  3LP2 A;  4CJL A;  3MXM A;  2FBT A;  1IKV A;  2HND A;  4IBN A;  3K5O A;  3VQQ A;  3DLG A;  3OYA A;  3TAP A;  4OVL A;  4LSN A;  1RT2 A;  3AA3 A;  1JL1 A;  3NAE A;  3T1A A;  3AVB A;  4DQS A;  1U4B A;  3OYE A;  1JL2 A;  4BDZ A;  1W9H A;  1JLE A;  3LWL A;  4CIF A;  2OPQ A;  1VRT A;  3CFP A;  3SCX A;  4LH5 A;  2B6A A;  1IKW A;  3OYN A;  5HRP A;  4FK2 A;  1BIU A;  2F8S A;  4RW4 A;  3RRH A;  2OA8 A;  3VQ8 A;  3ZT0 A;  3LAM A;  5J2N A;  1BIS A;  5CZ1 A;  4KKO A;  3VQD A;  1BQN A;  1RBU A;  1U45 A;  1UA1 A;  4E0D A;  3KIO A;  2ITG A;  1REV A;  5KGW A;  4I2Q A;  1VSF A;  4H4M A;  3AO4 A;  3VQ9 A;  4M3Y A;  4O44 A;  3L3U A;  4I2P A;  4DQI A;  3NH0 A;  2Z1I A;  2KTQ A;  1RDD A;  3NCI A;  4FM0 A;  3V9X A;  5HP1 A;  1NJZ A;  1T05 A;  3LP1 A;  1TVR A;  4KB0 A;  1C1A A;  4F3O A;  3OYB A;  4MFB A;  3PY8 A;  3AVL A;  2W42 A;  1VK0 A;  4ZTJ A;  1X9S A;  3OYM A;  4CHZ A;  1R0A A;  3AVJ A;  3OYD A;  1J5O A;  2ZE2 A;  1NJX A;  1TK8 A;  3PUF A;  4C8O A;  1CZ9 A;  1ITG A;  2G8W A;  4CJ4 A;  3CFR A;  4FJ9 A;  3OJU A;  1T03 A;  2G8H A;  1U48 A;  3K59 A;  2QKK A;  1B9F A;  4DS5 A;  4HCC A;  4IKF A;  4OGE A;  1ZBH A;  4Z4I A;  4CE9 A;  4CFA A;  4LSL A;  3OYJ A;  5FRO A;  3M8P A;  1TKX A;  4CHY A;  4E7L A;  5DMR A;  1KRP A;  4BWJ A;  4B9L A;  4DSI A;  2QKB A;  3MXI A;  3HK2 A;  2LSN A;  4AHV A;  4DSK A;  4O55 A;  4E3S A;  1QE1 A;  4DTP A;  2XY7 A;  1IO2 A;  4CJU A;  3SJJ A;  3QO9 A;  3ZSR A;  1BI4 B;  2RKI A;  4CK2 A;  4FW1 A;  4KV8 A;  1NK9 A;  1RTI A;  3DI6 A;  3E01 A;  2G8V A;  3AVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...