1EXQA

Crystal structure of the hiv-1 integrase catalytic core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
147
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPYVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 44
structure length 147
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1exqA00
2KW4A 1FKPA 1RDBA 1RT7A 1FKOA 2HMIA 3MXJA 1S9EA 5T7BA 4OPKA 4DU1A 1K6YA 2VG6A 4HVJA 1TL3A 3HP6A 1RDAA 4PQUA 3C6TA 2HNZA 1NJYA 1EP4A 4DU4A 4KAZA 4AHSA 4AHUA 4I7FA 3RMAA 4N41A 4CEAA 2P5GA 3SQ4A 1KLMA 4CFCA 2HNYA 2HHUA 4BDZA 1YTUA 1NK5A 1IG9A 1Q8IA 3DI6A 4RG8A 1WAJA 1GOAA 5CY4A 4CF8A 3LDSA 4FLTA 3U6FA 1XHZA 5HRSA 2IAJA 2X6SA 3SNNA 2G8KA 4FJ9A 4CK2A 3RMBA 3ITHA 4JRPA 3OVNA 3AA5X 3HPOA 3L2QA 3TAPA 4KB0A 3FFIA 4W5OA 3RMCA 1TKDA 3V9SA 3OS2A 2IGIA 1VSDA 3I0RA 4YFUA 4C8KA 4FZZA 3WNGA 3K5LA 3WNEA 4ZHRA 2ETJA 3OYLA 1RTJA 3S3OA 4B9TA 4M3UA 4W5TA 3KKRA 4CEBA 3VN5A 2QXFA 4N47A 1ZBHA 2VWJA 3O4QA 4UQGA 4IBNA 2F96A 3NAEA 4M3ZA 3AVHA 1ZBUA 1KCFA 3OYEA 1IKVA 3NH0A 4KHSA 4I2QA 4M41A 3VQ4A 3OJUA 5D3GA 4OVLA 3HXMA 1HMVA 1IKWA 1JKHA 4Q0BA 2HVHA 3QERA 4E7KA 1XI1A 1X9MA 3V1QA 2HHWA 4WE1A 2O4GA 2G8WA 3LZIA 3RR7A 2G8HA 4CEEA 4QOZB 4M3XA 3SQ1A 4EP5A 4FLYA 1LW2A 4CIFA 3QNNA 3VQDA 4B8CA 4H4MA 1T03A 3PX0A 3VA0A 3NDKA 4CJKA 3TAEA 2E6MA 2JLEA 3DM2A 4F3OA 4E0DA 4BWMA 3K59A 1VRUA 1C0MA 3A2FA 3PUFA 3WNHA 4KI6A 4FW1A 5CZ2A 3RRHA 2GBZA 2BGGA 1QQCA 3VQ8A 4IKFA 4FJ7A 1L5UA 4ZTFA 1N5YA 4DSIA 2HHXA 4CHZA 3CFPA 3KD1E 3SI6A 2QKBA 1S6QA 1RBVA 2LSNA 1L3UA 4DTOA 1RT3A 3CQ8A 4ICLA 4H8KA 3VQQA 4FLXA 1NK4A 4KHUA 1S1TA 1RT2A 4E89A 1RT4A 3HT3A 1U45A 5FRNA 2Y1IA 5KRSA 3NH1A 2G8UA 4CHOA 2RN2A 3RR8A 2KTQA 3KIOA 4ID5A 4E19A 4E7LA 3TAFA 4GW6A 3THVA 4QAGA 3ZT1A 1VK0A 2ZQBA 4RW6A 5HP1A 4C8OA 2BDPA 2HHQA 4M42A 2X78A 3V1RA 3O3FA 4DSKA 1RILA 3B6PA 3SPZA 1TVRA 3SUOA 1Q9XA 4GMJB 1UA1A 4JS4A 3MEDA 3LANA 3NHGA 3VQEA 1A5XA 2PY5A 2ITGA 3ZT2A 3HJFA 1EX4A 3ALYA 3QINA 4KHNA 2YHAA 1YT3A 2Z1HA 3G10A 4CHQA 2G8FA 3LP0A 3ZSVA 2IOCA 1HYZA 4Z4GA 3TR8A 3EZ5A 1RBRA 2FC0A 1X1PA 4KTZA 2Z1IA 4KB1A 4CJUA 1WSHA 4OKJA 1BCMA 4KV8A 4CIEA 1BGXT 3SQ0A 1VSFA 4PA1A 3K5NA 3VA3A 4DQSA 3K5MA 1GOBA 3NBPA 3DLBA 4KO0A 4DQIA 3L8BA 3QEIA 3KD5E 2FBYA 4K8ZA 3TI0A 2IC3A 3TARA 3C95A 2W42A 1QSLA 4OLAA 2P1JA 2D0AA 1JLAA 1RNHA 2HVIA 2XRIA 3MEEA 4IG3A 3OYDA 1IKYA 4OKEA 1BHLA 4IDKA 1QE1A 4DFMA 4BACA 4B8AB 3OYAA 2B5JA 1KFSA 1RDDA 3DOLA 1UWBA 3LWLA 3HM9A 4FJ5A 5FRMA 1EXQA 3KLGA 4CGGA 3SPYA 4E7HA 3JYTA 1S1UA 4OPJA 3RTVA 3AA4A 1RBTA 4DLEA 4ELVA 2OPPA 1HQEA 4C8NA 2VG7A 3AA3A 2E4LA 5CZ1A 4DS4A 3DRPA 1VSKA 5HRNA 3RRGA 4CEQA 4OLBA 1BQMA 2YKMA 4LSLA 1QHTA 4OKKA 4CJ3A 3LPUA 3QETA 4Y1DA 3MXMA 1WNSA 4NYFA 3L2RA 4CHPA 1RTIA 2DTUA 4BWJA 3V4IA 4FJIA 4DTMA 4DQPA 3DLGA 4CGFA 5HRRA 2WOMA 2DY4A 4CJEA 2D0BA 4CJPA 4CEZA 4E7IA 2HB5A 4Z4HA 3V6DA 4FJGA 1WLJA 2A1RA 3AVCA 1VRTA 3QEXA 1CZ9A 3KLIA 4FJLA 1WSFA 3DLRA 4AH9A 1CXQA 5CYQA 3KLHA 1NKCA 3L2VA 1C1CA 4W5QA 3T19A 1CZBA 4CJSA 3NGYA 2R7YA 4DTJA 1LAVA 2NUBA 1ASUA 4FW2A 3ZSQA 3SUPA 2OA8A 4J2DA 3NH2A 3OS0A 1EKEA 1XHXA 3AVLA 3QESA 3LP3A 1XWLA 3TAGA 3HL8A 2RF2A 1VSLA 4FCYA 1BISA 3HPGA 4IFYA 3T1AA 1HNVA 3HPHA 2GV9A 3VQBA 4N76A 3U3GA 4FXDA 2JGUA 1TKZA 4AHCA 3M8QA 2OPQA 1NOZA 4LH4A 4OGEA 3OYIA 3OJSA 2QKKA 4CFAA 4C8LA 4BE1A 3LALA 2BE2A 4DTNA 4I2PA 4K8XA 1Y97A 2OYQA 3K57A 5EU7A 1RDCA 1UAXA 3I0SA 4LSNA 3KKSA 3RWUA 4E3SA 3D45A 1NK6A 3LWMA 2Q3SA 5FROA 1L3SA 1TAUA 2OZMA 1REVA 3OYHA 4CJ5A 1TV6A 1JLEA 1UOCA 2YNHA 3CM6A 3QO9A 3VQ5A 3MAQA 3ULDA 1NK7A 1BL3A 4KTQA 2Z1JA 3NF6A 1DTQA 4MFBA 3ZSOA 3KLEA 1NOYA 3E01A 3L3UA 1RBUA 1A5WA 1Z25A 2FBVA 4CGHA 4FLWA 4DFKA 1X9WA 1SL0A 3HVTA 3TANA 1NJXA 4KTWA 2YNGA 3LP2A 2DFEA 4CJTA 4M45A 4Z4EA 4QCLA 1B9FA 2I5JA 2F8TA 1I39A 1RBSA 1WSGA 4EZ6A 1ASVA 3ZSRA 4M3TA 3IRXA 4O0JA 1HPZA 4Z4FA 3DRSA 3K58A 4H4OA 2KQ2A 1DLOA 3P5JA 3V81A 1RT6A 4CJWA 2YV0X 4DMNA 2EX3A 1BIZA 3K5OA 2YNFA 3OYJA 3DLEA 3NF7A 3TAQA 4O0IA 2RPIA 1TGOA 5DK5A 4BE0A 4FM2A 3DOKA 4Z0UA 3L3VA 3DYAA 1CLQA 3MECA 3MEGA 3S9HA 4DWIA 1B9DA 1S1XA 1VSIA 3AVFA 1A5VA 1J9AA 4GVMA 4KKOA 5KTQA 1RT1A 1UA0A 3KTQA 1FK9A 1S5JA 3DLKA 4F8RA 1BI4B 3TAMA 3CYMA 4FJKA 1LAWA 3AVAA 2P51A 3P1GA 1ASWA 3AVJA 4KFBA 4OGCA 4CGIA 4AILC 1RCHA 3NE6A 4RW8A 3AA2A 4CF0A 3O3GA 4HUGA 3OYKA 3PX4A 3F9KA 4KHYA 1JL1A 1EETA 4LY7A 4M3YA 2OPRA 4CERA 3G0ZA 3ZSZA 1S6PA 1WAFA 3VQAA 1KRPA 2PYJA 4CGJA 1ZBFA 2IS3A 1B92A 3L2WA 4L8RB 3S3NA 3LPTA 3SZ2A 3AV9A 2EHGA 3QEWA 2RKIA 4CCHA 4IG0A 4E1MA 5J2QA 1T7PA 4CE9A 4BE2A 4DQRA 5K14A 4DTXA 4N56A 3HVRA 1WSIA 4W5RA 4FZYA 2G8VA 4IFVA 4CJ4A 4NCGA 3SV3A 1W9HA 5JS2A 3ZCMA 1L3TA 2VWKA 4FK0A 1JXEA 2XHBA 3IAYA 1QTMA 4HUFA 1S1WA 2IDOA 1SV5A 1U4BA 4TSXA 3ZSXA 5KI6A 5KGXA 1N6QA 4B9UA 1JLGA 3EY1A 4PUOA 3QLHA 4DSJA 5HRPA 1NKBA 1TAQA 4AHVA 1XC9A 4B9MA 4HUEA 3SJJA 5C42A 2KFNA 3L2UA 2B4JA 2GUIA 4OJRA 1J5OA 3CFRA 4RW4A 3OYGA 3NF8A 1TKXA 3NFAA 1NK8A 3BDPA 1IH7A 2HHSA 4O44A 3SQ2A 4CEDA 4CIGA 3OYMA 4CK1A 4Z4CA 4DS5A 4LH5A 1LWEA 1NK0A 3C94A 3VQ9A 4ID1A 3AO3A 3QEVA 4JLHA 3VQ7A 1BQNA 4AHRA 1WN7A 5KRTA 5SWMA 4BDYA 3PO4A 2QK9A 1TK0A 4DTSA 4FJMA 2OPSA 4BDPA 1O1WA 3T3FA 1BCOA 1HJRA 4CK3A 3JSMA 2KZMA 1C1BA 1NK9A 4DF8A 4CF2A 4EP4A 4E1NA 1BIUA 3M8SA 1QS4A 4FJHA 1J53A 2YHBA 1KTQA 3AVIA 4FLZA 4DU3A 2O4IA 1TKTA 3D0PA 4O55A 2ZE2A 1BI4A 3KLFA 1D5AA 4DFJA 2A1SA 4MQ3A 4RW9A 4Q5VA 2Y1JA 1QSSA 1L3VA 3OYNA 3AVMA 3EYZA 1T8EA 4PY5A 4CF9A 3SV4A 1RTDA 3ZSYA 3NGIA 1HRHA 4R5PA 3QEPA 1KSPA 5FDLA 3QNOA 3AO5A 1HYSA 1LWFA 5I3UA 1D9DA 3M8PA 1HNIA 4CESA 4CEFA 4EZ9A 1TL1A 3SCXA 4CECA 3B6OA 1Z26A 1RT5A 2ATQA 4FM1A 2XY6A 3V9UA 3CG7A 3OYFA 1RTHA 3RMDA 4DLGA 1S9GA 2BANA 1IKXA 4DSFA 4DTPA 4FK4A 4CGDA 2HHVA 1X9SA 3V9XA 3HO1A 4FLVA 5I42A 1JXBA 1U47A 5CYMA 1HQUA 1CXUA 1I3AA 3ASMA 3NF9A 3V1OA 4XIUA 3DLHA 1IO2A 4B9LA 4HCBA 4FJXA 1D8YA 1YVUA 1SL1A 3LAKA 1VSEA 1J54A 4CF1A 3AO4A 3HYFA 2XO7A 3WNFA 3ZT4A 4DG1A 2PZSA 2XY8A 5SZTA 1SUQA 2OZSA 2HW3A 2DFHA 3F73A 4FJNA 3M8RA 2PYLA 4CJVA 3C6UA 5DMRA 2D5RA 4CJLA 4NYNA 2XY7A 4FK2A 2AJQA 4W5NA 3ZT0A 4J2EA 1VSJA 4DTUA 1NJWA 1WSJA 4B9SA 1ITGA 5KGWA 1JLQA 4M3RA 1HYVA 1U04A 1C0TA 5J2NA 1R0AA 4DFPA 3AO1A 3P83D 4ELUA 5HLFA 2X6NA 4O4GA 4N5SA 3PO5A 4I9QA 5C25A 3ZT3A 2VG5A 3DRRA 1LW0A 3TWHA 4E7JA 3AVNA 5JS1A 1G15A 1KVAA 4B9VA 2B6AA 2FBTA 3HSTB 3CM5A 3LAMA 1SKRA 2YKNA 3O4NA 4B9NA 3SYZA 1KVBA 1WSEA 4FJJA 3V9ZA 2F8SA 5HROA 1FXXA 1C6VA 3ISNC 3PX6A 5J1EA 4G1QA 3HP9A 2P5OA 4HCCA 4KHQA 1ZBLA 2YNIA 3KK2A 3OYCA 5C24A 4PWDA 3K2PA 1U48A 3KJVA 3SUNA 4FYDA 4M3WA 2XY5A 1S1VA 2WONA 1F21A 4CEOA 1ZBIA 4F2RA 2KFZA 2D0CA 4CJRA 3LP1A 3OYBA 4O5BA 3HK2A 1JLFA 2FBXA 3CFOA 1JLCA 1W0HA 4KRFA 3KK3A 3O3HA 3H08A 2Z1GA 1KVCA 4B3OA 3DMJA 4FVMA 2ZD1A 3NGZA 3TABA 4KHWA 4Z4IA 4DTRA 1DTTA 1YTAA 1VSMA 4NCBA 3KK1A 1Q9YA 4J2AA 4C8MA 3PV8A 2HHTA 4KI4A 4DQQA 4CJQA 1LWCA 3SUQA 4I9LA 1LV5A 4ZTJA 4CFBA 1QSYA 4YNQA 1SKSA 1GOCA 2DFFA 1MU2A 4JRQA 5J2PA 3S3MA 4DF4A 1D9FA 1JL2A 4NCAA 3QIPA 1NKEA 4DSEA 4FJ8A 4CFDA 3OY9A 3V9WA 2G8IA 2E6LA 3MXIA 3VQPA 3PY8A 5J2MA 4F3TA 4Y1CA 3QIOA 3ZSWA 4F2SA 3VQCA 3IG1A 4AHTA 4CJFA 4FZXC 5E41A 4JS5A 3OS1A 1ZYQA 3NCIA 2HNDA 3AVGA 5HBMA 3I8DA 1KLNA 2KZZA 4CHNA 4B08A 3AO2A 4FLUA 1U49A 4LD0A 4KREA 1NJZA 4ELTA 1T05A 1TK8A 1VSHA 3IS9A 3LZJA 4RW7A 1TK5A 1C0UA 3U3YA 2X74A 4J2BA 1KFDA 4FM0A 1JLBA 3UIQA 4KPYA 4F4KA 3AVKA 3AVBA 4HHTA 1SL2A 4HTUA 4CHYA 1SKWA 4DSLA 3VQ6A 1C1AA 3BGRA
chains in the Genus database with same CATH superfamily
1RDBA 3NVMA 5EY4A 2HMIA 3MXJA 1S9EA 3HOTA 1RDAA 3C6TA 2HNZA 4DU4A 4O8KA 4DR2K 4AHUA 4N41A 4CEAA 1EWRA 1KAZA 4CFCA 1FJGK 2HNYA 1NK5A 1Q8IA 4CZEA 1GOAA 1G99A 5HRSA 4FJ9A 4HTLA 3CPWM 2O8DA 4CK2A 3E9OA 4FWQA 3RMBA 4K41A 1VQ7N 2KHOA 3L2QA 4IEEA 3TU5A 3RMCA 4GKKK 2HF3A 1YIJN 1Z6RA 1W7AA 4ZHRA 5EOYA 1OH8A 3OYLA 1RTJA 4B9TA 4CEBA 3VN5A 3AVHA 4GV3A 4DV1K 1IKVA 2CGJA 4M41A 3O1WA 5D3GA 4J8FA 1IKWA 3QERA 4E7KA 2P9KB 2HHWA 4WE1A 2G8WA 3RR7A 5IWAK 4M3XA 3FE1A 5KPZA 4EP5A 4QS8A 3QNNA 3VQDA 4B8CA 3U9ZA 3PX0A 3DM2A 3CERA 5B8HA 3K9JA 4QS7A 3RRHA 1KAYA 2BGGA 4JKDA 5FPDA 1YVNA 3I56N 2P9LA 1T3VA 4ZTFA 1N5YA 2HHXA 3P38A 3KD1E 2QKBA 5C15A 2GTDA 4B9QA 1S1TA 5FPEA 1BO5O 1RT2A 1RT4A 3NH1A 4H5TA 3GDQA 2RN2A 3RR8A 2W41A 5C0YA 3AGKA 4E7LA 4GW6A 5F1XA 3THVA 2Q2RA 4M42A 2X78A 4DSKA 2E2OA 4ISFA 4GMJB 4JS4A 2GX9A 4FOEA 1XUPO 2P9IB 3J7AP 4IDHA 2BH1A 4YOUA 4BRIA 2G8FA 3B8AX 3QFUA 3QBWA 3TR8A 1RBRA 2FC0A 5IT9O 2ZF5O 4KH4A 2YCHA 4KV8A 4PA1A 3K5NA 4DQSA 3D2EA 1GOBA 3DLBA 3OBYA 2DPNA 4K8ZA 3TI0A 4LFBK 3ENBA 2IC3A 3AY9A 3TARA 2W42A 2P1JA 1K73O 5CE3A 2PAVA 4CJ7A 1BHLA 1X9JA 2B5JA 1KFSA 2HBMA 3DOLA 4FJ5A 3L4QA 1WB9A 3RTVA 4ELVA 5CHIA 4K43A 2E4LA 4DS4A 3RRGA 1VSKA 4JI3K 4CEQA 2YKMA 4LSLA 3MMVA 1QHTA 4OKKA 3LPUA 3L2RA 4BWJA 4FJIA 1XNRK 4DQPA 3EZWA 3KWIA 4DCHA 2DY4A 2D0BA 4FJGA 1NGEA 2YHXA 3ZEUB 4JI5K 5CYQA 4CBXA 2V51B 3L2VA 1C1CA 4CJSA 4YDUA 2R7YA 4DTJA 4OPAA 1ASUA 3SUPA 2YX6A 3E9PA 5LJWA 3AVLA 3LP3A 1XWLA 3TAGA 1VSLA 3HPGA 4JKGB 5AQKA 4BC2A 3HPHA 4N76A 3DXMA 2JGUA 3M8QA 2OPQA 1NOZA 3OJSA 4ISGA 5AQIA 4CFAA 2BE2A 3FZKA 3RWUA 1HKCA 1NK6A 5M1FA 4PL7A 4H5NA 2OZMA 1JLEA 1UOCA 2YNHA 3ID8A 4KTQA 4MFBA 1DTQA 1NBWA 3KLEA 4IJAA 1NOYA 3KWGA 2HHHK 3T1HK 2F4VK 5ADXA 1IG8A 3LP2A 2DFEA 4EHTA 5KPTA 3N4QA 4Z4EA 4QCLA 5E26A 2I5JA 4EZ6A 3K58A 4H4OA 5BR8K 2KQ2A 3CMAN 3P5JA 1RT6A 4DMNA 1D4XA 3NF7A 3TAQA 5DK5A 3FFKB 3AGRA 5LMUK 4DV5K 1CLQA 3MEGA 1S1XA 3AVFA 4KKOA 1XMOK 3O8MA 1RT1A 3TAMA 2WUSA 2P9NA 4BRPA 3AVJA 1WOQA 4KFBA 3IKMA 4CGIA 4DV3K 4AILC 4HUGA 4RW8A 3F9KA 3UB5A 1X3MA 1EETA 4CI6A 3I33A 1KRPA 1ZBFA 4L8RB 3GBTA 3SZ2A 4E1MA 1QQNA 3WUHA 4CE9A 3THYB 2NRVA 4BE2A 4DTXA 4N56A 3VMFB 5GINA 5BN9A 4NCGA 1GLEG 1JXEA 3IAYA 1C0FA 1V4SA 3H3NO 2QM1A 4TSXA 4L3QA 1RDWX 3ZSXA 5KGXA 4B1XB 4PUOA 2P9PA 3QLHA 5HRPA 1XC9A 5AQZA 4HUEA 4GV6A 3SJJA 3E66A 4CZLA 4NB4A 5C42A 3A0IX 2GUIA 1M90O 3NF8A 1VQPN 2HHSA 4JK8A 1C0GA 4CIGA 5H1SQ 1OH7A 3OYMA 1TUYA 4LH5A 1NK0A 3C94A 4ID1A 3DJCA 1VQ9N 4JLHA 5SWMA 1BQNA 5KRTA 1WN7A 3PO4A 2QK9A 2A3ZA 3RSEA 4BDPA 3SK3A 4BR4A 1C1BA 1NK9A 4FWMA 4U67L 4EP4A 4E1NA 4M7XA 3M8SA 1QS4A 4EAHD 3VTHA 5AZJA 4FLZA 1VQKN 1U49A 3KLFA 4MQ3A 4XEIA 4Q5VA 1QSSA 1L3VA 3OYNA 3AVMA 1EQYA 3EYZA 4BRNA 1VQ6N 3PSFA 3ZSYA 4MDBA 3KHYA 3SJHA 2UU9K 3VETA 4R5PA 5FDLA 3A5MC 2I7PA 3QNOA 1LWFA 4FM1A 3MN9A 1GLCG 1RTHA 2D4WA 3RMDA 1S9GA 4NLCA 4DSFA 2A5XA 3ATUA 2ASMA 3ASMA 4BRKA 1YITN 1I94K 4CF1A 3J7YP 2XO7A 5SZTA 2HW3A 3M8RA 2QWQA 4CJVA 2AJQA 2D5RA 5AFUH 4WYBA 3ZT0A 1NJWA 4B9SA 5JLHA 1Y64A 1ITGA 1ZBSA 1U04A 5J2NA 3P83D 3PO5A 1LW0A 3AVNA 3OTOK 4B9VA 3HSTB 3CM5A 3O4NA 3O80A 1U2VA 1KVBA 2O8FA 1FXXA 3PX6A 5C24A 3UKRA 1U48A 3BZCA 1F21A 3FZFA 4F2RA 2KFZA 2D0CA 3IFRA 4CJRA 5LJVA 4H0VB 3J7ZO 1HX1A 5BPLA 3O3HA 5C2FA 3DMJA 4FVMA 3EEQA 3NGZA 4KHWA 4Z4IA 3BY5A 4EHUA 4DTRA 1VSMA 4CJQA 4CW7B 4I9LA 4ZTJA 3LDNA 1SKSA 3OW2M 1MU2A 1QQMA 3VEVA 3G71N 4U7BA 4DF4A 2D1KA 4DSEA 5AZIA 1DEJA 3V9WA 4F3TA 4F2SA 2HOEA 2YHWA 4CJFA 3IG1A 4DR3K 2P9UB 4YDUC 4BRLA 3OS1A 5HBMA 1KLNA 3EL2A 4CHNA 1S3XA 4LD0A 4JK9A 3VGKA 3LZJA 3TTFA 3TTCA 1TK5A 3U3YA 1KFDA 1JLBA 2KKZA 4KPYA 4LFCK 2YI1A 1O13A 4F4KA 3THWB 4HHTA 1SL2A 1C1AA 5AQSA 4WQ5A 4B3RK 1RT7A 3W3DA 2E1YA 3EO3A 4OPKA 3J80O 3DXKB 1NJYA 4KAZA 2OTJN 4BQLA 4DR4K 2Q0UA 1BG3A 1JCGA 3EN9A 5FPNA 3DI6A 4XH5A 5CY4A 3U6FA 1XHZA 4ILGB 2G8KA 4CD3A 3IDHA 2CH6A 4JI4K 5GAGP 2J4RA 3CJ7A 3OVNA 3H1VX 1NLVA 3CQXA 5JMVA 1GLJO 5KPRA 3FZMA 4YFUA 4FZZA 3WNGA 3K5LA 4NXNK 2A40A 3S3OA 5AQQA 3G4SN 2VWJA 4UQGA 4M3ZA 1Z05A 1VQNN 1KCFA 4CZIA 2QWRA 4I2QA 4BR9A 4Q0BA 2HVHA 3HBTA 2V7YA 3LZIA 4CEEA 4K0KK 5KQ8A 4CIFA 4H4MA 4FL9A 1T03A 4YORA 1LOTB 3NDKA 4CJKA 3TAEA 2E6MA 2QTDA 3D2FA 3VF6A 4E0DA 4BWMA 1YJNN 4FVUA 1QQCA 4AM6A 3HZ6A 4DQ8A 3HM8A 4FPBA 4B3MK 4DSIA 2NRHA 2FSKA 4CHZA 3CFPA 1NGBA 3CCMN 2LSNA 4DTOA 2IVOA 1NK4A 5KRSA 2E20A 5C2DA 1T6DA 3EE9A 3VPZA 3VENA 3L6QA 1HR0K 4LF5K 3ZYYX 1YJWN 1M1KO 3HI0A 4RW6A 1Q7YO 4C8OA 2HHQA 3O9SA 1RILA 3B6PA 3SPZA 4DV7K 2OCEA 1UA1A 3MEDA 3LANA 1A5XA 3CPEA 3PSIA 5BRHA 4RCHA 3ALYA 2PBDA 3HSCA 2ZGYA 2Z1HA 3G10A 4CHQA 3F5TA 2IOCA 3EZ5A 4KB1A 4A62A 4CJUA 3R3LA 3SQ0A 1BGXT 3K5MA 4DQIA 3NBPA 3KD5E 4KO0A 3WEEB 4ILHA 3L8BA 4IO9L 3QEIA 4I6MA 2FBYA 2UUBK 3KVGA 3JAMO 2D0AA 1JLAA 2HVIA 2XRIA 2E2QA 2UYTA 3OYDA 2P9KA 4WFNL 1QE1A 1SS6A 4BACA 2WFBA 4B8AB 5LMNK 3LWLA 1P90A 3GOIA 1EXQA 3BF1A 5AQNA 3MN7A 3AA4A 1RBTA 4DLEA 2OPPA 1N33K 3AA3A 5HRNA 1BQMA 2A41A 4X66K 4Y1DA 3MXMA 5FLXO 4CHPA 5LY3A 4CEZA 4JKCA 3M5RA 4H5VA 4Z4HA 2A1RA 1VRTA 3QEXA 1CZ9A 4IO8A 4FWRA 4FJLA 1WSFA 1NG9A 5HOOA 1NKCA 2NUBA 2OA8A 4J2DA 1YF5L 4Z94A 3NH2A 3AAQA 1XHXA 3QESA 4BR0A 4FCYA 5EX5A 2QWLA 1HNVA 4JEPA 3O9UA 2QKKA 4OGEA 4JKHA 5ADXH 3EE8A 5MLCQ 4PKIA 2OYQA 3K57A 3I0SA 3VF2A 1SAZA 3KKSA 2P9IA 4BROA 5GIOA 3LWMA 1TAUA 1REVA 3OYHA 1TV6A 3VQ5A 1NK7A 2Z1JA 1DT9A 2PFUA 3L3UA 1NMNA 2FBVA 4BC4A 3TANA 4KTWA 2YNGA 4H0PA 4CJTA 4M45A 1RBSA 1ASVA 4FWOA 4M3TA 1HKGA 4O0JA 4B3TK 4Z4FA 1ZC6A 3DRSA 1T44A 1P8ZA 2GEMA 2EX3A 3K5OA 2YNFA 4DR1K 3U4LA 4UY8O 4C1NK 1XMQK 4BG9A 2HBJA 3DYAA 1MWMA 3S9HA 2ZWHA 3VGMA 1VSIA 1ATRA 1J9AA 1QHAA 1ATNA 1VHXA 2AP1A 1BI4B 3DLKA 5ELZA 2P51A 1ASWA 3C6HA 4OGCA 2A42A 2VYPA 4E1JA 3AA2A 4LF6K 1JL1A 4YOTA 4WQ5C 4M3YA 2OPRA 2O8EB 1HJOA 4NLBA 4BVOA 4CGJA 2QWNA 1B92A 3U9DA 3VGLA 4CCHA 4DQRA 5M1OA 3MCPA 4JKGA 4BRCA 1W9HA 3DLLL 3OBWA 4FK0A 2XHBA 4IWVA 2IVPA 3THXB 5AQYA 4DV0K 4HUFA 1S1WA 5KI6A 3CF5L 1NKBA 4B9MA 2QWOA 3L2UA 1J5OA 3FGUA 2FSNA 3OYGA 3BP8A 1TKXA 2ASPA 4YOYA 1OVYA 3A5NC 4JK7A 4CEDA 1WBDA 4Z4CA 1RDUA 3MWPA 3SBGA 4A57A 1KQSM 5AJ3K 3QEVA 2P9LB 3VQ7A 4AHRA 4BDYA 4LF7K 4WFAL 2RHKA 3OHRA 3MWTA 4DTSA 4BQZA 1HJRA 3NVKA 5AQVA 2KZMA 4DF8A 1BIUA 1NU0A 4KBOA 3D0PA 4O55A 3KZBA 4BRMA 4RW9A 4X65K 1SQKA 1T8EA 4R79A 3SV4A 4CZFA 2I7NA 1NWKA 1HRHA 2OTLN 3GE1A 3ZX0A 1KSPA 4AF1A 4CESA 1TL1A 2XY6A 4JYAK 2HHVA 5JICA 4CGDA 1X9SA 3V9XA 4MO4A 3MX5A 5I42A 2HBKA 5EVZA 1CXUA 3THYA 4WQ4A 4IOAL 2HSTA 2NRTA 3H46O 1SL1A 3D2EB 3AO4A 3WNFA 5TKWA 1SUQA 3C6UA 5DMRA 4W5NA 4FK2A 1WSJA 3QICA 5JVGL 4A5AA 1JLQA 1HYVA 2YHYA 5HLFA 1NGFA 4I9QA 2VG5A 4E7JA 2QI2A 2QW9A 1G15A 3O6WA 1SKRA 2YKNA 1HKBA 4B9NA 3V9ZA 4Y0WA 3ISNC 4JI1K 4M7YA 4G1QA 4OX9K 1N34K 2YNIA 3ZX2A 4PWDA 3FZHA 4B1ZA 3KJVA 4FYDA 4PKHA 2WONA 3LP1A 3OYBA 3CFOA 5BPNA 1W0HA 2Z1GA 2ASOA 5BR9A 4MLEA 5TKYA 1YTAA 3PIPL 3KK1A 4JKFA 3PV8A 4RWTA 3TSUA 4DQQA 3JS6A 3MCAB 4CFBA 3J81O 4C23A 2DFFA 2ZJQL 1CZAN 1JL2A 4NCAA 2YJFA 3QIPA 3FZLA 1Q82O 2G8IA 2E6LA 4CZGA 5AQPA 3QIOA 4AHTA 5E41A 1ZYQA 2HNDA 3P4IA 4B08A 3VERA 1NJZA 4ELTA 1T05A 3IS9A 5C12A 4RW7A 4FM0A 2D0PA 3UIQA 2CGKA 5M1NA 3S41A 4HTUA 1SKWA 3CI5A 3BGRA 3LM2A 1FKPA 1FKOA 1E4GT 4YOXA 4DU1A 2VG6A 4PQUA 2P5GA 2P9NB 3CJ1A 1KLMA 4LF4K 2HHUA 4BDZA 4WCEL 4CF8A 3LDSA 2IAJA 1RFQA 2FXUA 3WQTA 3ITHA 4JD2B 3LDLA 2ZJPL 3BZKA 4W5OA 4JKEA 3WXLA 1VSDA 4C8KA 3HRGA 2E1ZA 3WNEA 4M3UA 2H3GX 4W5TA 3CQYA 4HWIA 2O8BB 4H0YB 3C7NB 4N47A 3O4QA 4IBNA 3OYEA 3OJUA 2IVNA 1VQ5N 4OVLA 4FWKA 3HXMA 1JKHA 2P9PB 1X9MA 4JHDA 4BR7A 3SQ1A 4FLYA 1LW2A 2CH5A 4CVNE 2P9UA 3VA0A 2JLEA 3ZETA 4AQYK 2W6KA 3KK7A 1VRUA 4FW1A 5CZ2A 4IKFA 1DGKN 1T6CA 3GG4A 1S6QA 1RBVA 4ICLA 3R8EA 4H8KA 4FLXA 3DXKA 4KHUA 4H0XB 1J5EK 4E89A 3HT3A 3ID6A 1ZXOA 2KTQA 3MK6A 4ID5A 3TAFA 1IBLK 1Q81O 4BRHA 4QAGA 3ZT1A 1VK0A 2ZQBA 5HP1A 3UE5A 3SAHA 3VEYA 2BDPA 3O3FA 2FF3B 4YOWA 2ITGA 3CD6N 3ZT2A 1EX4A 2W40A 1YHQN 2YHAA 4IJNA 3LP0A 3ZSVA 1HYZA 4IEIA 1X1PA 3MDQA 4CIEA 3T7ZA 2UUCK 2P9SB 5AQXA 4B1UB 1U6ZA 3CETA 1QSLA 4A2BA 1RNHA 1J6ZA 3MEEA 3ULEA 4IG3A 2QXLA 4OKEA 3VOVA 4A2AA 4BR2A 3DAWA 3OYAA 1UWBA 2BUPA 3LDOA 1TYQB 5AQUA 3SPYA 1HNZK 3JYTA 4WQ4C 3NMUA 2O8CB 1EWQA 5FPMA 2AA4A 3AAPA 1MWKA 4DUYK 5BRDA 1NMDA 4CJ3A 4NYFA 3CJBA 1RTIA 3UKRB 2DTUA 5DM7L 3PIOL 4DTMA 3V4IA 3DLGA 4BG8A 4CGFA 2WOMA 4GVEA 3V6DA 2NRRA 2HB5A 2QA4N 3KLIA 4AH9A 1CXQA 1N32K 4RTFD 3T19A 1CZBA 4JNEA 3NGYA 2BTFA 1S22A 3OS0A 1EKEA 4WFBL 2JWKA 1XNQK 4EIAA 3T1AA 5F2RA 4FXDA 4FWLA 2GV9A 4BREA 3U3GA 3H45C 2VQFK 4LH4A 2F9TA 4C8LA 4K8XA 1Y97A 4FWNA 1UAXA 4AM7A 4DKWA 5AZIB 4E3SA 1L3SA 3CCRN 4DHYA 4CJ5A 5BN8A 3CM6A 3QO9A 1K9MO 1SZ2A 3P31A 3ZSOA 3A5LC 1RBUA 1Z25A 1X9WA 3O08A 3HVTA 3QMLA 3SMSA 4H5RA 1S72N 3CIPA 1NGDA 3LL3A 2F8TA 1I39A 1KXPA 2UXCK 1DLOA 3OYJA 2HMPA 2RPIA 4FM2A 4BE0A 3DOKA 3L3VA 4GV9A 3MECA 1B9DA 1A5VA 3HTVA 1FK9A 4XH1A 3TPQA 4DR5K 3CYMA 3O9RA 4FJKA 1LAWA 3AVAA 1E4FT 3P1GA 5M1KA 3WQUA 1KD1O 1RCHA 5JVHL 3O3GA 4LY7A 3CJCA 5AQWA 4CERA 3VTIA 5BRFA 5I9EB 1OH5A 1S6PA 1WAFA 3O1BA 3VQAA 1XC3A 1KAXA 2IS3A 3S3NA 3VEXA 2EHGA 3QEWA 2RKIA 1T7PA 5K14A 3HVRA 3WXMB 1WSIA 4W5RA 3CXCM 4FZYA 3SAGA 1K8KB 1IJJA 3SV3A 5JS2A 3L4IA 2ZM6K 1OH6A 2IDOA 1N6QA 1JJ2M 1QTMA 4B9UA 1BOTO 1NGIA 3A8YA 3CC2N 1TAQA 4JI0K 2QWPA 4LC9B 4OJRA 3CFRA 1NK8A 4BY9C 4JI6K 3CCLN 3CMEN 3SQ2A 3FR0A 4CK1A 4DS5A 1LWEA 4CZHA 4BRFA 4CBWA 3WXIA 4JI2K 2E2NA 4FJMA 2OPSA 1O1WA 3MX2A 1BCOA 4CK3A 3T3FA 1QQOA 3JSMA 3TSQA 4CF2A 2GELA 2Q36A 4FJHA 4FPAA 3CCJN 3AVIA 4DFJA 1BI4A 3UKUB 2E5LK 2WBNA 4OPHA 4CF9A 3H3OB 2ITMA 4IZ9A 1HYSA 5I3UA 1D9DA 1VQON 4EZ9A 2F7TA 3SCXA 3B6OA 2ATQA 2O8EA 3CG7A 2QEXN 3VESA 4DLGA 1MDUB 4DTPA 3A5OC 3HO1A 4XH4A 3WT0A 4FLVA 1EO1A 2GWJA 1HQUA 3NF9A 5AQOA 4HCBA 3RVCA 1IO2A 4A61A 1D8YA 1YVUA 3LAKA 3D7EO 3FLCO 2V7ZA 1ILYA 1J54A 3ZT4A 4DG1A 4I6MB 3K9KA 2DFHA 3F73A 4IFEA 4EFHA 2PYLA 3THXA 4FJNA 4CJLA 5CR4A 3T69A 1VSJA 5KGWA 4M3RA 1R0AA 1C0TA 4ELUA 4DFPA 4DR7K 3CHWA 3BEXA 2X6NA 4O4GA 5C25A 3ZT3A 3TWHA 1KVAA 2B6AA 4FOIA 3LAMA 3SYZA 4FJJA 2A6AA 3IUCA 2F8SA 5HROA 1DKGD 1JCEA 5J1EA 2P5OA 1ZBLA 3PLAA 3KK2A 3O5BA 2O8DB 3K2PA 3DWLA 4CZJA 4CEOA 3E1YA 1ZBIA 3ZX3A 3HK2A 2FBXA 3ZEUA 1JLCA 1BA1A 2QWMA 3H08A 1KVCA 4MO5A 1GLBG 4H0OA 3TABA 2UXDK 3G6EN 1GLDG 3L0QA 5M1QA 1DTTA 5BPMA 2WTUA 4NCBA 1QVGM 1Q9YA 4BRGA 4J2AA 2HHTA 2FLOA 4BGAA 1LWCA 3SUQA 1VQ8N 4YHHK 1WBBA 1QSYA 4YNQA 4JRQA 5GAHP 3O9QA 5J2PA 1D9FA 3R6MA 1NKEA 1HUXA 3MXIA 4WF9L 3VQPA 5J2MA 4Y1CA 3ZSWA 1ATSA 1RGIA 3AVGA 3I8DA 1W2BM 4FLUA 4KREA 5EXWA 1C0UA 2X74A 4YOVA 1VQ4N 3AVKA 4DSLA 4C1NI 4CHYA 5GAEP 2KW4A 4X62K 1IBKK 4G9ZA 2V52B 5T7BA 1QZ6A 2Q31A 3HOSA 1IV0A 4H0TB 1K6YA 4BRAA 4HVJA 1K8AO 1TL3A 5M1PA 3HP6A 3G25A 4B3SK 5KQDA 1EP4A 4AHSA 4I7FA 3QDKA 3RMAA 4LF8K 3SQ4A 1YTUA 1IG9A 4DR6K 4LFAK 4RG8A 1WAJA 4FLTA 1FW6A 4KH5A 3Q7CA 2X6SA 3SNNA 5AQGA 3SMPA 1N36K 1YAGA 4JRPA 3AA5X 3HPOA 3TAPA 4KB0A 1YJ9N 3I8BA 3FFIA 1TKDA 3OA9A 3V9SA 3OS2A 2IGIA 3I0RA 4JI7K 4FWSA 2VQEK 2ETJA 3KKRA 4IOXA 2JWLA 2QXFA 4JKAA 1ZBHA 3NAEA 2F96A 3Q7BA 4K25A 1ZBUA 3NH0A 4KHSA 3VQ4A 2F9WA 1HMVA 4BVPA 1XI1A 3V1QA 2O4GA 4QOZB 2G8HA 4BR5A 1OKJA 2VCPA 5AQLA 4CZMA 5A2QO 4F3OA 3ATVA 4IOCL 4FSVA 4A5BA 3K59A 3WNHA 1C0MA 3A2FA 3PUFA 4KI6A 2GBZA 3VQ8A 4FJ7A 2WC9A 4QS9A 1L5UA 3VEZA 2E88A 3SI6A 1V4TA 1HPMA 1L3UA 1RT3A 3CQ8A 3VQQA 3I55N 3C6AA 5FRNA 1U45A 2Y1IA 4JI8K 2G8UA 4CHOA 3KIOA 4E19A 1E3MA 1ESVA 1YXQA 3DXMB 2UUAK 3V1RA 2FSJA 1TVRA 3SUOA 1Q9XA 3NHGA 4JD2A 3VQEA 2OANA 2PY5A 3HJFA 5GIPA 3QINA 4KHNA 3O4WA 4ILJA 3GL1A 1YT3A 4Z4GA 1OVQA 2Z1IA 4KTZA 1QVFM 1WSHA 4OKJA 2O8BA 3C7NA 1BCMA 1Q86O 1VSFA 1HLUA 3VA3A 4IXCA 3C65A 3CCUN 3R9PA 3C95A 4OLAA 4H5WA 1BWFO 2HF4A 4CD1A 1IKYA 1HNWK 4H03B 4IDKA 4DFMA 3BF3A 3N4PA 1VQMN 1RDDA 5FRMA 3HM9A 4B1YB 3KLGA 4CGGA 1X3NA 4E7HA 1YUWA 1S1UA 4OPJA 3WXKA 1NGHA 1HQEA 4C8NA 2VG7A 1MA9B 5AQRA 2EWSA 5CZ1A 3DRPA 4OLBA 1TUUA 3P39A 5C10A 1GLAG 3QETA 5AR0A 1WNSA 2NRXA 2E2PA 5HRRA 4CJEA 4CJPA 4E7IA 4B1WB 1WLJA 3AVCA 3DLRA 1R59O 2NNWA 3KLHA 4K42A 4W5QA 1LAVA 4FW2A 3ZSQA 2E8AA 5AQFA 2CGLA 3HL8A 2RF2A 1BISA 4IFYA 5AQMA 3VQBA 1TKZA 4AHCA 3OYIA 2Q97A 4BE1A 3LALA 4DTNA 3J8AA 4I2PA 3WXJA 5EU7A 1RDCA 3CCEN 4LSNA 5AQHA 3D45A 4FWPA 4BGBA 2Q3SA 5FROA 3MAQA 1HNXK 1GLFO 3ULDA 3MN5A 1BL3A 3VF4A 3NF6A 4BRDA 2HBLA 3E01A 4X64K 1A5WA 3CC7N 4KHPK 4JKBA 4CGHA 4FLWA 4DFKA 1SL0A 4O5FA 3AARA 1NJXA 2P9SA 4MLHA 1B9FA 3IMXA 1WSGA 3K0SA 3ZSRA 3IRXA 1HPZA 1NGGA 3THWA 3V81A 3RSEB 2YV0X 4ISEA 4CJWA 1BIZA 3DLEA 4PHTX 4O0IA 1TGOA 2VWBA 4Z0UA 1TYQA 3SLCA 2GUPA 4DWIA 2O8CA 3KTQA 4GVMA 5KTQA 5AZJB 1UA0A 4F8RA 1S5JA 4F9OA 4JV5K 1NJIO 4MDAA 5HL7L 4PKGA 5E84A 5F0XA 4BC5A 3NE6A 4CF0A 3PX4A 3OYKA 4KHYA 3G0ZA 3ZSZA 2PYJA 3CJ9A 1BDGA 3L2WA 3LPTA 3AV9A 4IG0A 5J2QA 4DV2K 2G8VA 4IFVA 3M6GA 4CJ4A 1BA0A 5GADP 3ZCMA 1L3TA 2VWKA 3VEWA 2Q1NA 1U4BA 1SV5A 5JS1A 3E9LA 1NM1A 1JLGA 4JHDB 3EY1A 4DSJA 3D6RA 4AHVA 5BREA 2ZJRL 1VAZA 3LDPA 2KFNA 2B4JA 4RW4A 1QZ5A 3NFAA 3BDPA 1IH7A 2IIRA 3QBXA 4O44A 4BC3A 3ZETB 1IBMK 1U2VB 2O8FB 3CCVN 2ZGZA 5LL6Z 3VQ9A 3AO3A 2NZTA 4V19S 1TK0A 3U8XA 2Q0RA 4A59A 3SAFA 3H6EA 2NLXA 1YI2N 1BUPA 4DV6K 4GKJK 1J53A 2YHBA 1KTQA 4DU3A 2O4IA 1TKTA 2ZE2A 2W6LA 1D5AA 2A1SA 4YY3K 2Y1JA 3VEOA 2GWKA 4PL8A 1VQLN 4PY5A 3C0BA 1RTDA 3NGIA 3QFPA 2RE2A 3QEPA 4LF9K 3AO5A 1NGCA 3ENOA 1HNIA 3M8PA 4CEFA 2FF6A 4CECA 4CZKA 3F2KA 1Z26A 1RT5A 1Q18A 3V9UA 3OYFA 2UXBK 3LDQA 5AQJA 2BANA 1IKXA 3R1XA 4FK4A 1LCUA 1NNEA 1JXBA 3BUZB 5CYMA 1I3AA 4XIUA 1U47A 3V1OA 3DLHA 3LM9A 4B9LA 4NO7A 4FJXA 1VSEA 4OO1J 2NRZA 1K8KA 1N8RO 3HYFA 2PZSA 2XY8A 3WEEA 4B1VA 3CCQN 4DV4K 2OZSA 1BU6O 3TSPA 2XY7A 4NYNA 3ULEB 4DUZK 4J2EA 4DTUA 3W0LA 1JCFA 4DB3A 3AO1A 2KLAA 2VGNA 4O8UA 4BRQA 4N5SA 2YJEA 3DRRA 1NGAA 2NRWA 2FBTA 3M3ZA 1NGJA 1WSEA 4JAXA 1GLLO 5AFUA 1C6VA 3M1FA 4KHQA 3HP9A 4HCCA 3OYCA 3T1YK 3SUNA 4M3WA 2XY5A 1S1VA 4GY2B 4M63C 3ENHA 4O5BA 1JLFA 3EKUA 3F9MA 3CC4N 3KK3A 4KRFA 4B3OA 4JN4A 2ZD1A 4GNIA 4KH6A 3JXUA 3UKUA 3ZLJA 3H1QA 4C8MA 4KI4A 3TTDA 1LV5A 3CCSN 1W97L 3QB0A 1GOCA 5AQTA 3S3MA 4CBUA 5JLFA 4FJ8A 4CFDA 3OY9A 3PY8A 2VGMA 3MN6A 3VQCA 3EKSA 4FZXC 4JS5A 2D0OA 3NCIA 2KZZA 3AO2A 3D2FB 3SBTA 1TK8A 1VSHA 1WUAA 3O9TA 1KC8O 4J2BA 4FO0A 1H1VA 3CJAA 4NXMK 1XQSC 3AVBA 5DM6L 3VQ6A
chains in the Genus database with same CATH topology
2KW4A 1FKPA 1RDBA 1RT7A 1FKOA 2HMIA 3MXJA 1S9EA 5T7BA 4OPKA 4DU1A 1K6YA 2VG6A 4HVJA 1TL3A 3HP6A 1RDAA 4PQUA 3C6TA 2HNZA 1NJYA 1EP4A 4DU4A 4KAZA 4AHSA 4AHUA 4I7FA 3RMAA 4N41A 4CEAA 2P5GA 3SQ4A 1KLMA 4CFCA 2HNYA 2HHUA 4BDZA 1YTUA 1NK5A 1IG9A 1Q8IA 3DI6A 4RG8A 1WAJA 1GOAA 5CY4A 4CF8A 3LDSA 4FLTA 3U6FA 1XHZA 5HRSA 2IAJA 2X6SA 3SNNA 2G8KA 4FJ9A 4CK2A 3RMBA 3ITHA 4JRPA 3OVNA 3AA5X 3HPOA 3L2QA 3TAPA 4KB0A 3FFIA 4W5OA 3RMCA 1TKDA 3V9SA 3OS2A 2IGIA 1VSDA 3I0RA 4YFUA 4C8KA 4FZZA 3WNGA 3K5LA 3WNEA 4ZHRA 2ETJA 3OYLA 1RTJA 3S3OA 4B9TA 4M3UA 4W5TA 3KKRA 4CEBA 3VN5A 2QXFA 4N47A 1ZBHA 2VWJA 3O4QA 4UQGA 4IBNA 2F96A 3NAEA 4M3ZA 3AVHA 1ZBUA 1KCFA 3OYEA 1IKVA 3NH0A 4KHSA 4I2QA 4M41A 3VQ4A 3OJUA 5D3GA 4OVLA 3HXMA 1HMVA 1IKWA 1JKHA 4Q0BA 2HVHA 3QERA 4E7KA 1XI1A 1X9MA 3V1QA 2HHWA 4WE1A 2O4GA 2G8WA 3LZIA 3RR7A 2G8HA 4CEEA 4QOZB 4M3XA 3SQ1A 4EP5A 4FLYA 1LW2A 4CIFA 3QNNA 3VQDA 4B8CA 4H4MA 1T03A 3PX0A 3VA0A 3NDKA 4CJKA 3TAEA 2E6MA 2JLEA 3DM2A 4F3OA 4E0DA 4BWMA 3K59A 1VRUA 1C0MA 3A2FA 3PUFA 3WNHA 4KI6A 4FW1A 5CZ2A 3RRHA 2GBZA 2BGGA 1QQCA 3VQ8A 4IKFA 4FJ7A 1L5UA 4ZTFA 1N5YA 4DSIA 2HHXA 4CHZA 3CFPA 3KD1E 3SI6A 2QKBA 1S6QA 1RBVA 2LSNA 1L3UA 4DTOA 1RT3A 3CQ8A 4ICLA 4H8KA 3VQQA 4FLXA 1NK4A 4KHUA 1S1TA 1RT2A 4E89A 1RT4A 3HT3A 1U45A 5FRNA 2Y1IA 5KRSA 3NH1A 2G8UA 4CHOA 2RN2A 3RR8A 2KTQA 3KIOA 4ID5A 4E19A 4E7LA 3TAFA 4GW6A 3THVA 4QAGA 3ZT1A 1VK0A 2ZQBA 4RW6A 5HP1A 4C8OA 2BDPA 2HHQA 4M42A 2X78A 3V1RA 3O3FA 4DSKA 1RILA 3B6PA 3SPZA 1TVRA 3SUOA 1Q9XA 4GMJB 1UA1A 4JS4A 3MEDA 3LANA 3NHGA 3VQEA 1A5XA 2PY5A 2ITGA 3ZT2A 3HJFA 1EX4A 3ALYA 3QINA 4KHNA 2YHAA 1YT3A 2Z1HA 3G10A 4CHQA 2G8FA 3LP0A 3ZSVA 2IOCA 1HYZA 4Z4GA 3TR8A 3EZ5A 1RBRA 2FC0A 1X1PA 4KTZA 2Z1IA 4KB1A 4CJUA 1WSHA 4OKJA 1BCMA 4KV8A 4CIEA 1BGXT 3SQ0A 1VSFA 4PA1A 3K5NA 3VA3A 4DQSA 3K5MA 1GOBA 3NBPA 3DLBA 4KO0A 4DQIA 3L8BA 3QEIA 3KD5E 2FBYA 4K8ZA 3TI0A 2IC3A 3TARA 3C95A 2W42A 1QSLA 4OLAA 2P1JA 2D0AA 1JLAA 1RNHA 2HVIA 2XRIA 3MEEA 4IG3A 3OYDA 1IKYA 4OKEA 1BHLA 4IDKA 1QE1A 4DFMA 4BACA 4B8AB 3OYAA 2B5JA 1KFSA 1RDDA 3DOLA 1UWBA 3LWLA 3HM9A 4FJ5A 5FRMA 1EXQA 3KLGA 4CGGA 3SPYA 4E7HA 3JYTA 1S1UA 4OPJA 3RTVA 3AA4A 1RBTA 4DLEA 4ELVA 2OPPA 1HQEA 4C8NA 2VG7A 3AA3A 2E4LA 5CZ1A 4DS4A 3DRPA 1VSKA 5HRNA 3RRGA 4CEQA 4OLBA 1BQMA 2YKMA 4LSLA 1QHTA 4OKKA 4CJ3A 3LPUA 3QETA 4Y1DA 3MXMA 1WNSA 4NYFA 3L2RA 4CHPA 1RTIA 2DTUA 4BWJA 3V4IA 4FJIA 4DTMA 4DQPA 3DLGA 4CGFA 5HRRA 2WOMA 2DY4A 4CJEA 2D0BA 4CJPA 4CEZA 4E7IA 2HB5A 4Z4HA 3V6DA 4FJGA 1WLJA 2A1RA 3AVCA 1VRTA 3QEXA 1CZ9A 3KLIA 4FJLA 1WSFA 3DLRA 4AH9A 1CXQA 5CYQA 3KLHA 1NKCA 3L2VA 1C1CA 4W5QA 3T19A 1CZBA 4CJSA 3NGYA 2R7YA 4DTJA 1LAVA 2NUBA 1ASUA 4FW2A 3ZSQA 3SUPA 2OA8A 4J2DA 3NH2A 3OS0A 1EKEA 1XHXA 3AVLA 3QESA 3LP3A 1XWLA 3TAGA 3HL8A 2RF2A 1VSLA 4FCYA 1BISA 3HPGA 4IFYA 3T1AA 1HNVA 3HPHA 2GV9A 3VQBA 4N76A 3U3GA 4FXDA 2JGUA 1TKZA 4AHCA 3M8QA 2OPQA 1NOZA 4LH4A 4OGEA 3OYIA 3OJSA 2QKKA 4CFAA 4C8LA 4BE1A 3LALA 2BE2A 4DTNA 4I2PA 4K8XA 1Y97A 2OYQA 3K57A 5EU7A 1RDCA 1UAXA 3I0SA 4LSNA 3KKSA 3RWUA 4E3SA 3D45A 1NK6A 3LWMA 2Q3SA 5FROA 1L3SA 1TAUA 2OZMA 1REVA 3OYHA 4CJ5A 1TV6A 1JLEA 1UOCA 2YNHA 3CM6A 3QO9A 3VQ5A 3MAQA 3ULDA 1NK7A 1BL3A 4KTQA 2Z1JA 3NF6A 1DTQA 4MFBA 3ZSOA 3KLEA 1NOYA 3E01A 3L3UA 1RBUA 1A5WA 1Z25A 2FBVA 4CGHA 4FLWA 4DFKA 1X9WA 1SL0A 3HVTA 3TANA 1NJXA 4KTWA 2YNGA 3LP2A 2DFEA 4CJTA 4M45A 4Z4EA 4QCLA 1B9FA 2I5JA 2F8TA 1I39A 1RBSA 1WSGA 4EZ6A 1ASVA 3ZSRA 4M3TA 3IRXA 4O0JA 1HPZA 4Z4FA 3DRSA 3K58A 4H4OA 2KQ2A 1DLOA 3P5JA 3V81A 1RT6A 4CJWA 2YV0X 4DMNA 2EX3A 1BIZA 3K5OA 2YNFA 3OYJA 3DLEA 3NF7A 3TAQA 4O0IA 2RPIA 1TGOA 5DK5A 4BE0A 4FM2A 3DOKA 4Z0UA 3L3VA 3DYAA 1CLQA 3MECA 3MEGA 3S9HA 4DWIA 1B9DA 1S1XA 1VSIA 3AVFA 1A5VA 1J9AA 4GVMA 4KKOA 5KTQA 1RT1A 1UA0A 3KTQA 1FK9A 1S5JA 3DLKA 4F8RA 1BI4B 3TAMA 3CYMA 4FJKA 1LAWA 3AVAA 2P51A 3P1GA 1ASWA 3AVJA 4KFBA 4OGCA 4CGIA 4AILC 1RCHA 3NE6A 4RW8A 3AA2A 4CF0A 3O3GA 4HUGA 3OYKA 3PX4A 3F9KA 4KHYA 1JL1A 1EETA 4LY7A 4M3YA 2OPRA 4CERA 3G0ZA 3ZSZA 1S6PA 1WAFA 3VQAA 1KRPA 2PYJA 4CGJA 1ZBFA 2IS3A 1B92A 3L2WA 4L8RB 3S3NA 3LPTA 3SZ2A 3AV9A 2EHGA 3QEWA 2RKIA 4CCHA 4IG0A 4E1MA 5J2QA 1T7PA 4CE9A 4BE2A 4DQRA 5K14A 4DTXA 4N56A 3HVRA 1WSIA 4W5RA 4FZYA 2G8VA 4IFVA 4CJ4A 4NCGA 3SV3A 1W9HA 5JS2A 3ZCMA 1L3TA 2VWKA 4FK0A 1JXEA 2XHBA 3IAYA 1QTMA 4HUFA 1S1WA 2IDOA 1SV5A 1U4BA 4TSXA 3ZSXA 5KI6A 5KGXA 1N6QA 4B9UA 1JLGA 3EY1A 4PUOA 3QLHA 4DSJA 5HRPA 1NKBA 1TAQA 4AHVA 1XC9A 4B9MA 4HUEA 3SJJA 5C42A 2KFNA 3L2UA 2B4JA 2GUIA 4OJRA 1J5OA 3CFRA 4RW4A 3OYGA 3NF8A 1TKXA 3NFAA 1NK8A 3BDPA 1IH7A 2HHSA 4O44A 3SQ2A 4CEDA 4CIGA 3OYMA 4CK1A 4Z4CA 4DS5A 4LH5A 1LWEA 1NK0A 3C94A 3VQ9A 4ID1A 3AO3A 3QEVA 4JLHA 3VQ7A 1BQNA 4AHRA 1WN7A 5KRTA 5SWMA 4BDYA 3PO4A 2QK9A 1TK0A 4DTSA 4FJMA 2OPSA 4BDPA 1O1WA 3T3FA 1BCOA 1HJRA 4CK3A 3JSMA 2KZMA 1C1BA 1NK9A 4DF8A 4CF2A 4EP4A 4E1NA 1BIUA 3M8SA 1QS4A 4FJHA 1J53A 2YHBA 1KTQA 3AVIA 4FLZA 4DU3A 2O4IA 1TKTA 3D0PA 4O55A 2ZE2A 1BI4A 3KLFA 1D5AA 4DFJA 2A1SA 4MQ3A 4RW9A 4Q5VA 2Y1JA 1QSSA 1L3VA 3OYNA 3AVMA 3EYZA 1T8EA 4PY5A 4CF9A 3SV4A 1RTDA 3ZSYA 3NGIA 1HRHA 4R5PA 3QEPA 1KSPA 5FDLA 3QNOA 3AO5A 1HYSA 1LWFA 5I3UA 1D9DA 3M8PA 1HNIA 4CESA 4CEFA 4EZ9A 1TL1A 3SCXA 4CECA 3B6OA 1Z26A 1RT5A 2ATQA 4FM1A 2XY6A 3V9UA 3CG7A 3OYFA 1RTHA 3RMDA 4DLGA 1S9GA 2BANA 1IKXA 4DSFA 4DTPA 4FK4A 4CGDA 2HHVA 1X9SA 3V9XA 3HO1A 4FLVA 5I42A 1JXBA 1U47A 5CYMA 1HQUA 1CXUA 1I3AA 3ASMA 3NF9A 3V1OA 4XIUA 3DLHA 1IO2A 4B9LA 4HCBA 4FJXA 1D8YA 1YVUA 1SL1A 3LAKA 1VSEA 1J54A 4CF1A 3AO4A 3HYFA 2XO7A 3WNFA 3ZT4A 4DG1A 2PZSA 2XY8A 5SZTA 1SUQA 2OZSA 2HW3A 2DFHA 3F73A 4FJNA 3M8RA 2PYLA 4CJVA 3C6UA 5DMRA 2D5RA 4CJLA 4NYNA 2XY7A 4FK2A 2AJQA 4W5NA 3ZT0A 4J2EA 1VSJA 4DTUA 1NJWA 1WSJA 4B9SA 1ITGA 5KGWA 1JLQA 4M3RA 1HYVA 1U04A 1C0TA 5J2NA 1R0AA 4DFPA 3AO1A 3P83D 4ELUA 5HLFA 2X6NA 4O4GA 4N5SA 3PO5A 4I9QA 5C25A 3ZT3A 2VG5A 3DRRA 1LW0A 3TWHA 4E7JA 3AVNA 5JS1A 1G15A 1KVAA 4B9VA 2B6AA 2FBTA 3HSTB 3CM5A 3LAMA 1SKRA 2YKNA 3O4NA 4B9NA 3SYZA 1KVBA 1WSEA 4FJJA 3V9ZA 2F8SA 5HROA 1FXXA 1C6VA 3ISNC 3PX6A 5J1EA 4G1QA 3HP9A 2P5OA 4HCCA 4KHQA 1ZBLA 2YNIA 3KK2A 3OYCA 5C24A 4PWDA 3K2PA 1U48A 3KJVA 3SUNA 4FYDA 4M3WA 2XY5A 1S1VA 2WONA 1F21A 4CEOA 1ZBIA 4F2RA 2KFZA 2D0CA 4CJRA 3LP1A 3OYBA 4O5BA 3HK2A 1JLFA 2FBXA 3CFOA 1JLCA 1W0HA 4KRFA 3KK3A 3O3HA 3H08A 2Z1GA 1KVCA 4B3OA 3DMJA 4FVMA 2ZD1A 3NGZA 3TABA 4KHWA 4Z4IA 4DTRA 1DTTA 1YTAA 1VSMA 4NCBA 3KK1A 1Q9YA 4J2AA 4C8MA 3PV8A 2HHTA 4KI4A 4DQQA 4CJQA 1LWCA 3SUQA 4I9LA 1LV5A 4ZTJA 4CFBA 1QSYA 4YNQA 1SKSA 1GOCA 2DFFA 1MU2A 4JRQA 5J2PA 3S3MA 4DF4A 1D9FA 1JL2A 4NCAA 3QIPA 1NKEA 4DSEA 4FJ8A 4CFDA 3OY9A 3V9WA 2G8IA 2E6LA 3MXIA 3VQPA 3PY8A 5J2MA 4F3TA 4Y1CA 3QIOA 3ZSWA 4F2SA 3VQCA 3IG1A 4AHTA 4CJFA 4FZXC 5E41A 4JS5A 3OS1A 1ZYQA 3NCIA 2HNDA 3AVGA 5HBMA 3I8DA 1KLNA 2KZZA 4CHNA 4B08A 3AO2A 4FLUA 1U49A 4LD0A 4KREA 1NJZA 4ELTA 1T05A 1TK8A 1VSHA 3IS9A 3LZJA 4RW7A 1TK5A 1C0UA 3U3YA 2X74A 4J2BA 1KFDA 4FM0A 1JLBA 3UIQA 4KPYA 4F4KA 3AVKA 3AVBA 4HHTA 1SL2A 4HTUA 4CHYA 1SKWA 4DSLA 3VQ6A 1C1AA 3BGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW4 A;  1FKP A;  1RDB A;  1RT7 A;  1FKO A;  2HMI A;  3MXJ A;  1S9E A;  5T7B A;  4OPK A;  4DU1 A;  1K6Y A;  2VG6 A;  4HVJ A;  1TL3 A;  3HP6 A;  1RDA A;  4PQU A;  3C6T A;  2HNZ A;  1NJY A;  1EP4 A;  4DU4 A;  4KAZ A;  4AHS A;  4AHU A;  4I7F A;  3RMA A;  4N41 A;  4CEA A;  2P5G A;  3SQ4 A;  1KLM A;  4CFC A;  2HNY A;  2HHU A;  4BDZ A;  1YTU A;  1NK5 A;  1IG9 A;  1Q8I A;  3DI6 A;  4RG8 A;  1WAJ A;  1GOA A;  5CY4 A;  4CF8 A;  3LDS A;  4FLT A;  3U6F A;  1XHZ A;  5HRS A;  2IAJ A;  2X6S A;  3SNN A;  2G8K A;  4FJ9 A;  4CK2 A;  3RMB A;  3ITH A;  4JRP A;  3OVN A;  3AA5 X;  3HPO A;  3L2Q A;  3TAP A;  4KB0 A;  3FFI A;  4W5O A;  3RMC A;  1TKD A;  3V9S A;  3OS2 A;  2IGI A;  1VSD A;  3I0R A;  4YFU A;  4C8K A;  4FZZ A;  3WNG A;  3K5L A;  3WNE A;  4ZHR A;  2ETJ A;  3OYL A;  1RTJ A;  3S3O A;  4B9T A;  4M3U A;  4W5T A;  3KKR A;  4CEB A;  3VN5 A;  2QXF A;  4N47 A;  1ZBH A;  2VWJ A;  3O4Q A;  4UQG A;  4IBN A;  2F96 A;  3NAE A;  4M3Z A;  3AVH A;  1ZBU A;  1KCF A;  3OYE A;  1IKV A;  3NH0 A;  4KHS A;  4I2Q A;  4M41 A;  3VQ4 A;  3OJU A;  5D3G A;  4OVL A;  3HXM A;  1HMV A;  1IKW A;  1JKH A;  4Q0B A;  2HVH A;  3QER A;  4E7K A;  1XI1 A;  1X9M A;  3V1Q A;  2HHW A;  4WE1 A;  2O4G A;  2G8W A;  3LZI A;  3RR7 A;  2G8H A;  4CEE A;  4QOZ B;  4M3X A;  3SQ1 A;  4EP5 A;  4FLY A;  1LW2 A;  4CIF A;  3QNN A;  3VQD A;  4B8C A;  4H4M A;  1T03 A;  3PX0 A;  3VA0 A;  3NDK A;  4CJK A;  3TAE A;  2E6M A;  2JLE A;  3DM2 A;  4F3O A;  4E0D A;  4BWM A;  3K59 A;  1VRU A;  1C0M A;  3A2F A;  3PUF A;  3WNH A;  4KI6 A;  4FW1 A;  5CZ2 A;  3RRH A;  2GBZ A;  2BGG A;  1QQC A;  3VQ8 A;  4IKF A;  4FJ7 A;  1L5U A;  4ZTF A;  1N5Y A;  4DSI A;  2HHX A;  4CHZ A;  3CFP A;  3KD1 E;  3SI6 A;  2QKB A;  1S6Q A;  1RBV A;  2LSN A;  1L3U A;  4DTO A;  1RT3 A;  3CQ8 A;  4ICL A;  4H8K A;  3VQQ A;  4FLX A;  1NK4 A;  4KHU A;  1S1T A;  1RT2 A;  4E89 A;  1RT4 A;  3HT3 A;  1U45 A;  5FRN A;  2Y1I A;  5KRS A;  3NH1 A;  2G8U A;  4CHO A;  2RN2 A;  3RR8 A;  2KTQ A;  3KIO A;  4ID5 A;  4E19 A;  4E7L A;  3TAF A;  4GW6 A;  3THV A;  4QAG A;  3ZT1 A;  1VK0 A;  2ZQB A;  4RW6 A;  5HP1 A;  4C8O A;  2BDP A;  2HHQ A;  4M42 A;  2X78 A;  3V1R A;  3O3F A;  4DSK A;  1RIL A;  3B6P A;  3SPZ A;  1TVR A;  3SUO A;  1Q9X A;  4GMJ B;  1UA1 A;  4JS4 A;  3MED A;  3LAN A;  3NHG A;  3VQE A;  1A5X A;  2PY5 A;  2ITG A;  3ZT2 A;  3HJF A;  1EX4 A;  3ALY A;  3QIN A;  4KHN A;  2YHA A;  1YT3 A;  2Z1H A;  3G10 A;  4CHQ A;  2G8F A;  3LP0 A;  3ZSV A;  2IOC A;  1HYZ A;  4Z4G A;  3TR8 A;  3EZ5 A;  1RBR A;  2FC0 A;  1X1P A;  4KTZ A;  2Z1I A;  4KB1 A;  4CJU A;  1WSH A;  4OKJ A;  1BCM A;  4KV8 A;  4CIE A;  1BGX T;  3SQ0 A;  1VSF A;  4PA1 A;  3K5N A;  3VA3 A;  4DQS A;  3K5M A;  1GOB A;  3NBP A;  3DLB A;  4KO0 A;  4DQI A;  3L8B A;  3QEI A;  3KD5 E;  2FBY A;  4K8Z A;  3TI0 A;  2IC3 A;  3TAR A;  3C95 A;  2W42 A;  1QSL A;  4OLA A;  2P1J A;  2D0A A;  1JLA A;  1RNH A;  2HVI A;  2XRI A;  3MEE A;  4IG3 A;  3OYD A;  1IKY A;  4OKE A;  1BHL A;  4IDK A;  1QE1 A;  4DFM A;  4BAC A;  4B8A B;  3OYA A;  2B5J A;  1KFS A;  1RDD A;  3DOL A;  1UWB A;  3LWL A;  3HM9 A;  4FJ5 A;  5FRM A;  1EXQ A;  3KLG A;  4CGG A;  3SPY A;  4E7H A;  3JYT A;  1S1U A;  4OPJ A;  3RTV A;  3AA4 A;  1RBT A;  4DLE A;  4ELV A;  2OPP A;  1HQE A;  4C8N A;  2VG7 A;  3AA3 A;  2E4L A;  5CZ1 A;  4DS4 A;  3DRP A;  1VSK A;  5HRN A;  3RRG A;  4CEQ A;  4OLB A;  1BQM A;  2YKM A;  4LSL A;  1QHT A;  4OKK A;  4CJ3 A;  3LPU A;  3QET A;  4Y1D A;  3MXM A;  1WNS A;  4NYF A;  3L2R A;  4CHP A;  1RTI A;  2DTU A;  4BWJ A;  3V4I A;  4FJI A;  4DTM A;  4DQP A;  3DLG A;  4CGF A;  5HRR A;  2WOM A;  2DY4 A;  4CJE A;  2D0B A;  4CJP A;  4CEZ A;  4E7I A;  2HB5 A;  4Z4H A;  3V6D A;  4FJG A;  1WLJ A;  2A1R A;  3AVC A;  1VRT A;  3QEX A;  1CZ9 A;  3KLI A;  4FJL A;  1WSF A;  3DLR A;  4AH9 A;  1CXQ A;  5CYQ A;  3KLH A;  1NKC A;  3L2V A;  1C1C A;  4W5Q A;  3T19 A;  1CZB A;  4CJS A;  3NGY A;  2R7Y A;  4DTJ A;  1LAV A;  2NUB A;  1ASU A;  4FW2 A;  3ZSQ A;  3SUP A;  2OA8 A;  4J2D A;  3NH2 A;  3OS0 A;  1EKE A;  1XHX A;  3AVL A;  3QES A;  3LP3 A;  1XWL A;  3TAG A;  3HL8 A;  2RF2 A;  1VSL A;  4FCY A;  1BIS A;  3HPG A;  4IFY A;  3T1A A;  1HNV A;  3HPH A;  2GV9 A;  3VQB A;  4N76 A;  3U3G A;  4FXD A;  2JGU A;  1TKZ A;  4AHC A;  3M8Q A;  2OPQ A;  1NOZ A;  4LH4 A;  4OGE A;  3OYI A;  3OJS A;  2QKK A;  4CFA A;  4C8L A;  4BE1 A;  3LAL A;  2BE2 A;  4DTN A;  4I2P A;  4K8X A;  1Y97 A;  2OYQ A;  3K57 A;  5EU7 A;  1RDC A;  1UAX A;  3I0S A;  4LSN A;  3KKS A;  3RWU A;  4E3S A;  3D45 A;  1NK6 A;  3LWM A;  2Q3S A;  5FRO A;  1L3S A;  1TAU A;  2OZM A;  1REV A;  3OYH A;  4CJ5 A;  1TV6 A;  1JLE A;  1UOC A;  2YNH A;  3CM6 A;  3QO9 A;  3VQ5 A;  3MAQ A;  3ULD A;  1NK7 A;  1BL3 A;  4KTQ A;  2Z1J A;  3NF6 A;  1DTQ A;  4MFB A;  3ZSO A;  3KLE A;  1NOY A;  3E01 A;  3L3U A;  1RBU A;  1A5W A;  1Z25 A;  2FBV A;  4CGH A;  4FLW A;  4DFK A;  1X9W A;  1SL0 A;  3HVT A;  3TAN A;  1NJX A;  4KTW A;  2YNG A;  3LP2 A;  2DFE A;  4CJT A;  4M45 A;  4Z4E A;  4QCL A;  1B9F A;  2I5J A;  2F8T A;  1I39 A;  1RBS A;  1WSG A;  4EZ6 A;  1ASV A;  3ZSR A;  4M3T A;  3IRX A;  4O0J A;  1HPZ A;  4Z4F A;  3DRS A;  3K58 A;  4H4O A;  2KQ2 A;  1DLO A;  3P5J A;  3V81 A;  1RT6 A;  4CJW A;  2YV0 X;  4DMN A;  2EX3 A;  1BIZ A;  3K5O A;  2YNF A;  3OYJ A;  3DLE A;  3NF7 A;  3TAQ A;  4O0I A;  2RPI A;  1TGO A;  5DK5 A;  4BE0 A;  4FM2 A;  3DOK A;  4Z0U A;  3L3V A;  3DYA A;  1CLQ A;  3MEC A;  3MEG A;  3S9H A;  4DWI A;  1B9D A;  1S1X A;  1VSI A;  3AVF A;  1A5V A;  1J9A A;  4GVM A;  4KKO A;  5KTQ A;  1RT1 A;  1UA0 A;  3KTQ A;  1FK9 A;  1S5J A;  3DLK A;  4F8R A;  1BI4 B;  3TAM A;  3CYM A;  4FJK A;  1LAW A;  3AVA A;  2P51 A;  3P1G A;  1ASW A;  3AVJ A;  4KFB A;  4OGC A;  4CGI A;  4AIL C;  1RCH A;  3NE6 A;  4RW8 A;  3AA2 A;  4CF0 A;  3O3G A;  4HUG A;  3OYK A;  3PX4 A;  3F9K A;  4KHY A;  1JL1 A;  1EET A;  4LY7 A;  4M3Y A;  2OPR A;  4CER A;  3G0Z A;  3ZSZ A;  1S6P A;  1WAF A;  3VQA A;  1KRP A;  2PYJ A;  4CGJ A;  1ZBF A;  2IS3 A;  1B92 A;  3L2W A;  4L8R B;  3S3N A;  3LPT A;  3SZ2 A;  3AV9 A;  2EHG A;  3QEW A;  2RKI A;  4CCH A;  4IG0 A;  4E1M A;  5J2Q A;  1T7P A;  4CE9 A;  4BE2 A;  4DQR A;  5K14 A;  4DTX A;  4N56 A;  3HVR A;  1WSI A;  4W5R A;  4FZY A;  2G8V A;  4IFV A;  4CJ4 A;  4NCG A;  3SV3 A;  1W9H A;  5JS2 A;  3ZCM A;  1L3T A;  2VWK A;  4FK0 A;  1JXE A;  2XHB A;  3IAY A;  1QTM A;  4HUF A;  1S1W A;  2IDO A;  1SV5 A;  1U4B A;  4TSX A;  3ZSX A;  5KI6 A;  5KGX A;  1N6Q A;  4B9U A;  1JLG A;  3EY1 A;  4PUO A;  3QLH A;  4DSJ A;  5HRP A;  1NKB A;  1TAQ A;  4AHV A;  1XC9 A;  4B9M A;  4HUE A;  3SJJ A;  5C42 A;  2KFN A;  3L2U A;  2B4J A;  2GUI A;  4OJR A;  1J5O A;  3CFR A;  4RW4 A;  3OYG A;  3NF8 A;  1TKX A;  3NFA A;  1NK8 A;  3BDP A;  1IH7 A;  2HHS A;  4O44 A;  3SQ2 A;  4CED A;  4CIG A;  3OYM A;  4CK1 A;  4Z4C A;  4DS5 A;  4LH5 A;  1LWE A;  1NK0 A;  3C94 A;  3VQ9 A;  4ID1 A;  3AO3 A;  3QEV A;  4JLH A;  3VQ7 A;  1BQN A;  4AHR A;  1WN7 A;  5KRT A;  5SWM A;  4BDY A;  3PO4 A;  2QK9 A;  1TK0 A;  4DTS A;  4FJM A;  2OPS A;  4BDP A;  1O1W A;  3T3F A;  1BCO A;  1HJR A;  4CK3 A;  3JSM A;  2KZM A;  1C1B A;  1NK9 A;  4DF8 A;  4CF2 A;  4EP4 A;  4E1N A;  1BIU A;  3M8S A;  1QS4 A;  4FJH A;  1J53 A;  2YHB A;  1KTQ A;  3AVI A;  4FLZ A;  4DU3 A;  2O4I A;  1TKT A;  3D0P A;  4O55 A;  2ZE2 A;  1BI4 A;  3KLF A;  1D5A A;  4DFJ A;  2A1S A;  4MQ3 A;  4RW9 A;  4Q5V A;  2Y1J A;  1QSS A;  1L3V A;  3OYN A;  3AVM A;  3EYZ A;  1T8E A;  4PY5 A;  4CF9 A;  3SV4 A;  1RTD A;  3ZSY A;  3NGI A;  1HRH A;  4R5P A;  3QEP A;  1KSP A;  5FDL A;  3QNO A;  3AO5 A;  1HYS A;  1LWF A;  5I3U A;  1D9D A;  3M8P A;  1HNI A;  4CES A;  4CEF A;  4EZ9 A;  1TL1 A;  3SCX A;  4CEC A;  3B6O A;  1Z26 A;  1RT5 A;  2ATQ A;  4FM1 A;  2XY6 A;  3V9U A;  3CG7 A;  3OYF A;  1RTH A;  3RMD A;  4DLG A;  1S9G A;  2BAN A;  1IKX A;  4DSF A;  4DTP A;  4FK4 A;  4CGD A;  2HHV A;  1X9S A;  3V9X A;  3HO1 A;  4FLV A;  5I42 A;  1JXB A;  1U47 A;  5CYM A;  1HQU A;  1CXU A;  1I3A A;  3ASM A;  3NF9 A;  3V1O A;  4XIU A;  3DLH A;  1IO2 A;  4B9L A;  4HCB A;  4FJX A;  1D8Y A;  1YVU A;  1SL1 A;  3LAK A;  1VSE A;  1J54 A;  4CF1 A;  3AO4 A;  3HYF A;  2XO7 A;  3WNF A;  3ZT4 A;  4DG1 A;  2PZS A;  2XY8 A;  5SZT A;  1SUQ A;  2OZS A;  2HW3 A;  2DFH A;  3F73 A;  4FJN A;  3M8R A;  2PYL A;  4CJV A;  3C6U A;  5DMR A;  2D5R A;  4CJL A;  4NYN A;  2XY7 A;  4FK2 A;  2AJQ A;  4W5N A;  3ZT0 A;  4J2E A;  1VSJ A;  4DTU A;  1NJW A;  1WSJ A;  4B9S A;  1ITG A;  5KGW A;  1JLQ A;  4M3R A;  1HYV A;  1U04 A;  1C0T A;  5J2N A;  1R0A A;  4DFP A;  3AO1 A;  3P83 D;  4ELU A;  5HLF A;  2X6N A;  4O4G A;  4N5S A;  3PO5 A;  4I9Q A;  5C25 A;  3ZT3 A;  2VG5 A;  3DRR A;  1LW0 A;  3TWH A;  4E7J A;  3AVN A;  5JS1 A;  1G15 A;  1KVA A;  4B9V A;  2B6A A;  2FBT A;  3HST B;  3CM5 A;  3LAM A;  1SKR A;  2YKN A;  3O4N A;  4B9N A;  3SYZ A;  1KVB A;  1WSE A;  4FJJ A;  3V9Z A;  2F8S A;  5HRO A;  1FXX A;  1C6V A;  3ISN C;  3PX6 A;  5J1E A;  4G1Q A;  3HP9 A;  2P5O A;  4HCC A;  4KHQ A;  1ZBL A;  2YNI A;  3KK2 A;  3OYC A;  5C24 A;  4PWD A;  3K2P A;  1U48 A;  3KJV A;  3SUN A;  4FYD A;  4M3W A;  2XY5 A;  1S1V A;  2WON A;  1F21 A;  4CEO A;  1ZBI A;  4F2R A;  2KFZ A;  2D0C A;  4CJR A;  3LP1 A;  3OYB A;  4O5B A;  3HK2 A;  1JLF A;  2FBX A;  3CFO A;  1JLC A;  1W0H A;  4KRF A;  3KK3 A;  3O3H A;  3H08 A;  2Z1G A;  1KVC A;  4B3O A;  3DMJ A;  4FVM A;  2ZD1 A;  3NGZ A;  3TAB A;  4KHW A;  4Z4I A;  4DTR A;  1DTT A;  1YTA A;  1VSM A;  4NCB A;  3KK1 A;  1Q9Y A;  4J2A A;  4C8M A;  3PV8 A;  2HHT A;  4KI4 A;  4DQQ A;  4CJQ A;  1LWC A;  3SUQ A;  4I9L A;  1LV5 A;  4ZTJ A;  4CFB A;  1QSY A;  4YNQ A;  1SKS A;  1GOC A;  2DFF A;  1MU2 A;  4JRQ A;  5J2P A;  3S3M A;  4DF4 A;  1D9F A;  1JL2 A;  4NCA A;  3QIP A;  1NKE A;  4DSE A;  4FJ8 A;  4CFD A;  3OY9 A;  3V9W A;  2G8I A;  2E6L A;  3MXI A;  3VQP A;  3PY8 A;  5J2M A;  4F3T A;  4Y1C A;  3QIO A;  3ZSW A;  4F2S A;  3VQC A;  3IG1 A;  4AHT A;  4CJF A;  4FZX C;  5E41 A;  4JS5 A;  3OS1 A;  1ZYQ A;  3NCI A;  2HND A;  3AVG A;  5HBM A;  3I8D A;  1KLN A;  2KZZ A;  4CHN A;  4B08 A;  3AO2 A;  4FLU A;  1U49 A;  4LD0 A;  4KRE A;  1NJZ A;  4ELT A;  1T05 A;  1TK8 A;  1VSH A;  3IS9 A;  3LZJ A;  4RW7 A;  1TK5 A;  1C0U A;  3U3Y A;  2X74 A;  4J2B A;  1KFD A;  4FM0 A;  1JLB A;  3UIQ A;  4KPY A;  4F4K A;  3AVK A;  3AVB A;  4HHT A;  1SL2 A;  4HTU A;  4CHY A;  1SKW A;  4DSL A;  3VQ6 A;  1C1A A;  3BGR A; 
#chains in the Genus database with same CATH topology
 1RDB A;  3NVM A;  5EY4 A;  2HMI A;  3MXJ A;  1S9E A;  3HOT A;  1RDA A;  3C6T A;  2HNZ A;  4DU4 A;  4O8K A;  4DR2 K;  4AHU A;  4N41 A;  4CEA A;  1EWR A;  1KAZ A;  4CFC A;  1FJG K;  2HNY A;  1NK5 A;  1Q8I A;  4CZE A;  1GOA A;  1G99 A;  5HRS A;  4FJ9 A;  4HTL A;  3CPW M;  2O8D A;  4CK2 A;  3E9O A;  4FWQ A;  3RMB A;  4K41 A;  1VQ7 N;  2KHO A;  3L2Q A;  4IEE A;  3TU5 A;  3RMC A;  4GKK K;  2HF3 A;  1YIJ N;  1Z6R A;  1W7A A;  4ZHR A;  5EOY A;  1OH8 A;  3OYL A;  1RTJ A;  4B9T A;  4CEB A;  3VN5 A;  3AVH A;  4GV3 A;  4DV1 K;  1IKV A;  2CGJ A;  4M41 A;  3O1W A;  5D3G A;  4J8F A;  1IKW A;  3QER A;  4E7K A;  2P9K B;  2HHW A;  4WE1 A;  2G8W A;  3RR7 A;  5IWA K;  4M3X A;  3FE1 A;  5KPZ A;  4EP5 A;  4QS8 A;  3QNN A;  3VQD A;  4B8C A;  3U9Z A;  3PX0 A;  3DM2 A;  3CER A;  5B8H A;  3K9J A;  4QS7 A;  3RRH A;  1KAY A;  2BGG A;  4JKD A;  5FPD A;  1YVN A;  3I56 N;  2P9L A;  1T3V A;  4ZTF A;  1N5Y A;  2HHX A;  3P38 A;  3KD1 E;  2QKB A;  5C15 A;  2GTD A;  4B9Q A;  1S1T A;  5FPE A;  1BO5 O;  1RT2 A;  1RT4 A;  3NH1 A;  4H5T A;  3GDQ A;  2RN2 A;  3RR8 A;  2W41 A;  5C0Y A;  3AGK A;  4E7L A;  4GW6 A;  5F1X A;  3THV A;  2Q2R A;  4M42 A;  2X78 A;  4DSK A;  2E2O A;  4ISF A;  4GMJ B;  4JS4 A;  2GX9 A;  4FOE A;  1XUP O;  2P9I B;  3J7A P;  4IDH A;  2BH1 A;  4YOU A;  4BRI A;  2G8F A;  3B8A X;  3QFU A;  3QBW A;  3TR8 A;  1RBR A;  2FC0 A;  5IT9 O;  2ZF5 O;  4KH4 A;  2YCH A;  4KV8 A;  4PA1 A;  3K5N A;  4DQS A;  3D2E A;  1GOB A;  3DLB A;  3OBY A;  2DPN A;  4K8Z A;  3TI0 A;  4LFB K;  3ENB A;  2IC3 A;  3AY9 A;  3TAR A;  2W42 A;  2P1J A;  1K73 O;  5CE3 A;  2PAV A;  4CJ7 A;  1BHL A;  1X9J A;  2B5J A;  1KFS A;  2HBM A;  3DOL A;  4FJ5 A;  3L4Q A;  1WB9 A;  3RTV A;  4ELV A;  5CHI A;  4K43 A;  2E4L A;  4DS4 A;  3RRG A;  1VSK A;  4JI3 K;  4CEQ A;  2YKM A;  4LSL A;  3MMV A;  1QHT A;  4OKK A;  3LPU A;  3L2R A;  4BWJ A;  4FJI A;  1XNR K;  4DQP A;  3EZW A;  3KWI A;  4DCH A;  2DY4 A;  2D0B A;  4FJG A;  1NGE A;  2YHX A;  3ZEU B;  4JI5 K;  5CYQ A;  4CBX A;  2V51 B;  3L2V A;  1C1C A;  4CJS A;  4YDU A;  2R7Y A;  4DTJ A;  4OPA A;  1ASU A;  3SUP A;  2YX6 A;  3E9P A;  5LJW A;  3AVL A;  3LP3 A;  1XWL A;  3TAG A;  1VSL A;  3HPG A;  4JKG B;  5AQK A;  4BC2 A;  3HPH A;  4N76 A;  3DXM A;  2JGU A;  3M8Q A;  2OPQ A;  1NOZ A;  3OJS A;  4ISG A;  5AQI A;  4CFA A;  2BE2 A;  3FZK A;  3RWU A;  1HKC A;  1NK6 A;  5M1F A;  4PL7 A;  4H5N A;  2OZM A;  1JLE A;  1UOC A;  2YNH A;  3ID8 A;  4KTQ A;  4MFB A;  1DTQ A;  1NBW A;  3KLE A;  4IJA A;  1NOY A;  3KWG A;  2HHH K;  3T1H K;  2F4V K;  5ADX A;  1IG8 A;  3LP2 A;  2DFE A;  4EHT A;  5KPT A;  3N4Q A;  4Z4E A;  4QCL A;  5E26 A;  2I5J A;  4EZ6 A;  3K58 A;  4H4O A;  5BR8 K;  2KQ2 A;  3CMA N;  3P5J A;  1RT6 A;  4DMN A;  1D4X A;  3NF7 A;  3TAQ A;  5DK5 A;  3FFK B;  3AGR A;  5LMU K;  4DV5 K;  1CLQ A;  3MEG A;  1S1X A;  3AVF A;  4KKO A;  1XMO K;  3O8M A;  1RT1 A;  3TAM A;  2WUS A;  2P9N A;  4BRP A;  3AVJ A;  1WOQ A;  4KFB A;  3IKM A;  4CGI A;  4DV3 K;  4AIL C;  4HUG A;  4RW8 A;  3F9K A;  3UB5 A;  1X3M A;  1EET A;  4CI6 A;  3I33 A;  1KRP A;  1ZBF A;  4L8R B;  3GBT A;  3SZ2 A;  4E1M A;  1QQN A;  3WUH A;  4CE9 A;  3THY B;  2NRV A;  4BE2 A;  4DTX A;  4N56 A;  3VMF B;  5GIN A;  5BN9 A;  4NCG A;  1GLE G;  1JXE A;  3IAY A;  1C0F A;  1V4S A;  3H3N O;  2QM1 A;  4TSX A;  4L3Q A;  1RDW X;  3ZSX A;  5KGX A;  4B1X B;  4PUO A;  2P9P A;  3QLH A;  5HRP A;  1XC9 A;  5AQZ A;  4HUE A;  4GV6 A;  3SJJ A;  3E66 A;  4CZL A;  4NB4 A;  5C42 A;  3A0I X;  2GUI A;  1M90 O;  3NF8 A;  1VQP N;  2HHS A;  4JK8 A;  1C0G A;  4CIG A;  5H1S Q;  1OH7 A;  3OYM A;  1TUY A;  4LH5 A;  1NK0 A;  3C94 A;  4ID1 A;  3DJC A;  1VQ9 N;  4JLH A;  5SWM A;  1BQN A;  5KRT A;  1WN7 A;  3PO4 A;  2QK9 A;  2A3Z A;  3RSE A;  4BDP A;  3SK3 A;  4BR4 A;  1C1B A;  1NK9 A;  4FWM A;  4U67 L;  4EP4 A;  4E1N A;  4M7X A;  3M8S A;  1QS4 A;  4EAH D;  3VTH A;  5AZJ A;  4FLZ A;  1VQK N;  1U49 A;  3KLF A;  4MQ3 A;  4XEI A;  4Q5V A;  1QSS A;  1L3V A;  3OYN A;  3AVM A;  1EQY A;  3EYZ A;  4BRN A;  1VQ6 N;  3PSF A;  3ZSY A;  4MDB A;  3KHY A;  3SJH A;  2UU9 K;  3VET A;  4R5P A;  5FDL A;  3A5M C;  2I7P A;  3QNO A;  1LWF A;  4FM1 A;  3MN9 A;  1GLC G;  1RTH A;  2D4W A;  3RMD A;  1S9G A;  4NLC A;  4DSF A;  2A5X A;  3ATU A;  2ASM A;  3ASM A;  4BRK A;  1YIT N;  1I94 K;  4CF1 A;  3J7Y P;  2XO7 A;  5SZT A;  2HW3 A;  3M8R A;  2QWQ A;  4CJV A;  2AJQ A;  2D5R A;  5AFU H;  4WYB A;  3ZT0 A;  1NJW A;  4B9S A;  5JLH A;  1Y64 A;  1ITG A;  1ZBS A;  1U04 A;  5J2N A;  3P83 D;  3PO5 A;  1LW0 A;  3AVN A;  3OTO K;  4B9V A;  3HST B;  3CM5 A;  3O4N A;  3O80 A;  1U2V A;  1KVB A;  2O8F A;  1FXX A;  3PX6 A;  5C24 A;  3UKR A;  1U48 A;  3BZC A;  1F21 A;  3FZF A;  4F2R A;  2KFZ A;  2D0C A;  3IFR A;  4CJR A;  5LJV A;  4H0V B;  3J7Z O;  1HX1 A;  5BPL A;  3O3H A;  5C2F A;  3DMJ A;  4FVM A;  3EEQ A;  3NGZ A;  4KHW A;  4Z4I A;  3BY5 A;  4EHU A;  4DTR A;  1VSM A;  4CJQ A;  4CW7 B;  4I9L A;  4ZTJ A;  3LDN A;  1SKS A;  3OW2 M;  1MU2 A;  1QQM A;  3VEV A;  3G71 N;  4U7B A;  4DF4 A;  2D1K A;  4DSE A;  5AZI A;  1DEJ A;  3V9W A;  4F3T A;  4F2S A;  2HOE A;  2YHW A;  4CJF A;  3IG1 A;  4DR3 K;  2P9U B;  4YDU C;  4BRL A;  3OS1 A;  5HBM A;  1KLN A;  3EL2 A;  4CHN A;  1S3X A;  4LD0 A;  4JK9 A;  3VGK A;  3LZJ A;  3TTF A;  3TTC A;  1TK5 A;  3U3Y A;  1KFD A;  1JLB A;  2KKZ A;  4KPY A;  4LFC K;  2YI1 A;  1O13 A;  4F4K A;  3THW B;  4HHT A;  1SL2 A;  1C1A A;  5AQS A;  4WQ5 A;  4B3R K;  1RT7 A;  3W3D A;  2E1Y A;  3EO3 A;  4OPK A;  3J80 O;  3DXK B;  1NJY A;  4KAZ A;  2OTJ N;  4BQL A;  4DR4 K;  2Q0U A;  1BG3 A;  1JCG A;  3EN9 A;  5FPN A;  3DI6 A;  4XH5 A;  5CY4 A;  3U6F A;  1XHZ A;  4ILG B;  2G8K A;  4CD3 A;  3IDH A;  2CH6 A;  4JI4 K;  5GAG P;  2J4R A;  3CJ7 A;  3OVN A;  3H1V X;  1NLV A;  3CQX A;  5JMV A;  1GLJ O;  5KPR A;  3FZM A;  4YFU A;  4FZZ A;  3WNG A;  3K5L A;  4NXN K;  2A40 A;  3S3O A;  5AQQ A;  3G4S N;  2VWJ A;  4UQG A;  4M3Z A;  1Z05 A;  1VQN N;  1KCF A;  4CZI A;  2QWR A;  4I2Q A;  4BR9 A;  4Q0B A;  2HVH A;  3HBT A;  2V7Y A;  3LZI A;  4CEE A;  4K0K K;  5KQ8 A;  4CIF A;  4H4M A;  4FL9 A;  1T03 A;  4YOR A;  1LOT B;  3NDK A;  4CJK A;  3TAE A;  2E6M A;  2QTD A;  3D2F A;  3VF6 A;  4E0D A;  4BWM A;  1YJN N;  4FVU A;  1QQC A;  4AM6 A;  3HZ6 A;  4DQ8 A;  3HM8 A;  4FPB A;  4B3M K;  4DSI A;  2NRH A;  2FSK A;  4CHZ A;  3CFP A;  1NGB A;  3CCM N;  2LSN A;  4DTO A;  2IVO A;  1NK4 A;  5KRS A;  2E20 A;  5C2D A;  1T6D A;  3EE9 A;  3VPZ A;  3VEN A;  3L6Q A;  1HR0 K;  4LF5 K;  3ZYY X;  1YJW N;  1M1K O;  3HI0 A;  4RW6 A;  1Q7Y O;  4C8O A;  2HHQ A;  3O9S A;  1RIL A;  3B6P A;  3SPZ A;  4DV7 K;  2OCE A;  1UA1 A;  3MED A;  3LAN A;  1A5X A;  3CPE A;  3PSI A;  5BRH A;  4RCH A;  3ALY A;  2PBD A;  3HSC A;  2ZGY A;  2Z1H A;  3G10 A;  4CHQ A;  3F5T A;  2IOC A;  3EZ5 A;  4KB1 A;  4A62 A;  4CJU A;  3R3L A;  3SQ0 A;  1BGX T;  3K5M A;  4DQI A;  3NBP A;  3KD5 E;  4KO0 A;  3WEE B;  4ILH A;  3L8B A;  4IO9 L;  3QEI A;  4I6M A;  2FBY A;  2UUB K;  3KVG A;  3JAM O;  2D0A A;  1JLA A;  2HVI A;  2XRI A;  2E2Q A;  2UYT A;  3OYD A;  2P9K A;  4WFN L;  1QE1 A;  1SS6 A;  4BAC A;  2WFB A;  4B8A B;  5LMN K;  3LWL A;  1P90 A;  3GOI A;  1EXQ A;  3BF1 A;  5AQN A;  3MN7 A;  3AA4 A;  1RBT A;  4DLE A;  2OPP A;  1N33 K;  3AA3 A;  5HRN A;  1BQM A;  2A41 A;  4X66 K;  4Y1D A;  3MXM A;  5FLX O;  4CHP A;  5LY3 A;  4CEZ A;  4JKC A;  3M5R A;  4H5V A;  4Z4H A;  2A1R A;  1VRT A;  3QEX A;  1CZ9 A;  4IO8 A;  4FWR A;  4FJL A;  1WSF A;  1NG9 A;  5HOO A;  1NKC A;  2NUB A;  2OA8 A;  4J2D A;  1YF5 L;  4Z94 A;  3NH2 A;  3AAQ A;  1XHX A;  3QES A;  4BR0 A;  4FCY A;  5EX5 A;  2QWL A;  1HNV A;  4JEP A;  3O9U A;  2QKK A;  4OGE A;  4JKH A;  5ADX H;  3EE8 A;  5MLC Q;  4PKI A;  2OYQ A;  3K57 A;  3I0S A;  3VF2 A;  1SAZ A;  3KKS A;  2P9I A;  4BRO A;  5GIO A;  3LWM A;  1TAU A;  1REV A;  3OYH A;  1TV6 A;  3VQ5 A;  1NK7 A;  2Z1J A;  1DT9 A;  2PFU A;  3L3U A;  1NMN A;  2FBV A;  4BC4 A;  3TAN A;  4KTW A;  2YNG A;  4H0P A;  4CJT A;  4M45 A;  1RBS A;  1ASV A;  4FWO A;  4M3T A;  1HKG A;  4O0J A;  4B3T K;  4Z4F A;  1ZC6 A;  3DRS A;  1T44 A;  1P8Z A;  2GEM A;  2EX3 A;  3K5O A;  2YNF A;  4DR1 K;  3U4L A;  4UY8 O;  4C1N K;  1XMQ K;  4BG9 A;  2HBJ A;  3DYA A;  1MWM A;  3S9H A;  2ZWH A;  3VGM A;  1VSI A;  1ATR A;  1J9A A;  1QHA A;  1ATN A;  1VHX A;  2AP1 A;  1BI4 B;  3DLK A;  5ELZ A;  2P51 A;  1ASW A;  3C6H A;  4OGC A;  2A42 A;  2VYP A;  4E1J A;  3AA2 A;  4LF6 K;  1JL1 A;  4YOT A;  4WQ5 C;  4M3Y A;  2OPR A;  2O8E B;  1HJO A;  4NLB A;  4BVO A;  4CGJ A;  2QWN A;  1B92 A;  3U9D A;  3VGL A;  4CCH A;  4DQR A;  5M1O A;  3MCP A;  4JKG A;  4BRC A;  1W9H A;  3DLL L;  3OBW A;  4FK0 A;  2XHB A;  4IWV A;  2IVP A;  3THX B;  5AQY A;  4DV0 K;  4HUF A;  1S1W A;  5KI6 A;  3CF5 L;  1NKB A;  4B9M A;  2QWO A;  3L2U A;  1J5O A;  3FGU A;  2FSN A;  3OYG A;  3BP8 A;  1TKX A;  2ASP A;  4YOY A;  1OVY A;  3A5N C;  4JK7 A;  4CED A;  1WBD A;  4Z4C A;  1RDU A;  3MWP A;  3SBG A;  4A57 A;  1KQS M;  5AJ3 K;  3QEV A;  2P9L B;  3VQ7 A;  4AHR A;  4BDY A;  4LF7 K;  4WFA L;  2RHK A;  3OHR A;  3MWT A;  4DTS A;  4BQZ A;  1HJR A;  3NVK A;  5AQV A;  2KZM A;  4DF8 A;  1BIU A;  1NU0 A;  4KBO A;  3D0P A;  4O55 A;  3KZB A;  4BRM A;  4RW9 A;  4X65 K;  1SQK A;  1T8E A;  4R79 A;  3SV4 A;  4CZF A;  2I7N A;  1NWK A;  1HRH A;  2OTL N;  3GE1 A;  3ZX0 A;  1KSP A;  4AF1 A;  4CES A;  1TL1 A;  2XY6 A;  4JYA K;  2HHV A;  5JIC A;  4CGD A;  1X9S A;  3V9X A;  4MO4 A;  3MX5 A;  5I42 A;  2HBK A;  5EVZ A;  1CXU A;  3THY A;  4WQ4 A;  4IOA L;  2HST A;  2NRT A;  3H46 O;  1SL1 A;  3D2E B;  3AO4 A;  3WNF A;  5TKW A;  1SUQ A;  3C6U A;  5DMR A;  4W5N A;  4FK2 A;  1WSJ A;  3QIC A;  5JVG L;  4A5A A;  1JLQ A;  1HYV A;  2YHY A;  5HLF A;  1NGF A;  4I9Q A;  2VG5 A;  4E7J A;  2QI2 A;  2QW9 A;  1G15 A;  3O6W A;  1SKR A;  2YKN A;  1HKB A;  4B9N A;  3V9Z A;  4Y0W A;  3ISN C;  4JI1 K;  4M7Y A;  4G1Q A;  4OX9 K;  1N34 K;  2YNI A;  3ZX2 A;  4PWD A;  3FZH A;  4B1Z A;  3KJV A;  4FYD A;  4PKH A;  2WON A;  3LP1 A;  3OYB A;  3CFO A;  5BPN A;  1W0H A;  2Z1G A;  2ASO A;  5BR9 A;  4MLE A;  5TKY A;  1YTA A;  3PIP L;  3KK1 A;  4JKF A;  3PV8 A;  4RWT A;  3TSU A;  4DQQ A;  3JS6 A;  3MCA B;  4CFB A;  3J81 O;  4C23 A;  2DFF A;  2ZJQ L;  1CZA N;  1JL2 A;  4NCA A;  2YJF A;  3QIP A;  3FZL A;  1Q82 O;  2G8I A;  2E6L A;  4CZG A;  5AQP A;  3QIO A;  4AHT A;  5E41 A;  1ZYQ A;  2HND A;  3P4I A;  4B08 A;  3VER A;  1NJZ A;  4ELT A;  1T05 A;  3IS9 A;  5C12 A;  4RW7 A;  4FM0 A;  2D0P A;  3UIQ A;  2CGK A;  5M1N A;  3S41 A;  4HTU A;  1SKW A;  3CI5 A;  3BGR A;  3LM2 A;  1FKP A;  1FKO A;  1E4G T;  4YOX A;  4DU1 A;  2VG6 A;  4PQU A;  2P5G A;  2P9N B;  3CJ1 A;  1KLM A;  4LF4 K;  2HHU A;  4BDZ A;  4WCE L;  4CF8 A;  3LDS A;  2IAJ A;  1RFQ A;  2FXU A;  3WQT A;  3ITH A;  4JD2 B;  3LDL A;  2ZJP L;  3BZK A;  4W5O A;  4JKE A;  3WXL A;  1VSD A;  4C8K A;  3HRG A;  2E1Z A;  3WNE A;  4M3U A;  2H3G X;  4W5T A;  3CQY A;  4HWI A;  2O8B B;  4H0Y B;  3C7N B;  4N47 A;  3O4Q A;  4IBN A;  3OYE A;  3OJU A;  2IVN A;  1VQ5 N;  4OVL A;  4FWK A;  3HXM A;  1JKH A;  2P9P B;  1X9M A;  4JHD A;  4BR7 A;  3SQ1 A;  4FLY A;  1LW2 A;  2CH5 A;  4CVN E;  2P9U A;  3VA0 A;  2JLE A;  3ZET A;  4AQY K;  2W6K A;  3KK7 A;  1VRU A;  4FW1 A;  5CZ2 A;  4IKF A;  1DGK N;  1T6C A;  3GG4 A;  1S6Q A;  1RBV A;  4ICL A;  3R8E A;  4H8K A;  4FLX A;  3DXK A;  4KHU A;  4H0X B;  1J5E K;  4E89 A;  3HT3 A;  3ID6 A;  1ZXO A;  2KTQ A;  3MK6 A;  4ID5 A;  3TAF A;  1IBL K;  1Q81 O;  4BRH A;  4QAG A;  3ZT1 A;  1VK0 A;  2ZQB A;  5HP1 A;  3UE5 A;  3SAH A;  3VEY A;  2BDP A;  3O3F A;  2FF3 B;  4YOW A;  2ITG A;  3CD6 N;  3ZT2 A;  1EX4 A;  2W40 A;  1YHQ N;  2YHA A;  4IJN A;  3LP0 A;  3ZSV A;  1HYZ A;  4IEI A;  1X1P A;  3MDQ A;  4CIE A;  3T7Z A;  2UUC K;  2P9S B;  5AQX A;  4B1U B;  1U6Z A;  3CET A;  1QSL A;  4A2B A;  1RNH A;  1J6Z A;  3MEE A;  3ULE A;  4IG3 A;  2QXL A;  4OKE A;  3VOV A;  4A2A A;  4BR2 A;  3DAW A;  3OYA A;  1UWB A;  2BUP A;  3LDO A;  1TYQ B;  5AQU A;  3SPY A;  1HNZ K;  3JYT A;  4WQ4 C;  3NMU A;  2O8C B;  1EWQ A;  5FPM A;  2AA4 A;  3AAP A;  1MWK A;  4DUY K;  5BRD A;  1NMD A;  4CJ3 A;  4NYF A;  3CJB A;  1RTI A;  3UKR B;  2DTU A;  5DM7 L;  3PIO L;  4DTM A;  3V4I A;  3DLG A;  4BG8 A;  4CGF A;  2WOM A;  4GVE A;  3V6D A;  2NRR A;  2HB5 A;  2QA4 N;  3KLI A;  4AH9 A;  1CXQ A;  1N32 K;  4RTF D;  3T19 A;  1CZB A;  4JNE A;  3NGY A;  2BTF A;  1S22 A;  3OS0 A;  1EKE A;  4WFB L;  2JWK A;  1XNQ K;  4EIA A;  3T1A A;  5F2R A;  4FXD A;  4FWL A;  2GV9 A;  4BRE A;  3U3G A;  3H45 C;  2VQF K;  4LH4 A;  2F9T A;  4C8L A;  4K8X A;  1Y97 A;  4FWN A;  1UAX A;  4AM7 A;  4DKW A;  5AZI B;  4E3S A;  1L3S A;  3CCR N;  4DHY A;  4CJ5 A;  5BN8 A;  3CM6 A;  3QO9 A;  1K9M O;  1SZ2 A;  3P31 A;  3ZSO A;  3A5L C;  1RBU A;  1Z25 A;  1X9W A;  3O08 A;  3HVT A;  3QML A;  3SMS A;  4H5R A;  1S72 N;  3CIP A;  1NGD A;  3LL3 A;  2F8T A;  1I39 A;  1KXP A;  2UXC K;  1DLO A;  3OYJ A;  2HMP A;  2RPI A;  4FM2 A;  4BE0 A;  3DOK A;  3L3V A;  4GV9 A;  3MEC A;  1B9D A;  1A5V A;  3HTV A;  1FK9 A;  4XH1 A;  3TPQ A;  4DR5 K;  3CYM A;  3O9R A;  4FJK A;  1LAW A;  3AVA A;  1E4F T;  3P1G A;  5M1K A;  3WQU A;  1KD1 O;  1RCH A;  5JVH L;  3O3G A;  4LY7 A;  3CJC A;  5AQW A;  4CER A;  3VTI A;  5BRF A;  5I9E B;  1OH5 A;  1S6P A;  1WAF A;  3O1B A;  3VQA A;  1XC3 A;  1KAX A;  2IS3 A;  3S3N A;  3VEX A;  2EHG A;  3QEW A;  2RKI A;  1T7P A;  5K14 A;  3HVR A;  3WXM B;  1WSI A;  4W5R A;  3CXC M;  4FZY A;  3SAG A;  1K8K B;  1IJJ A;  3SV3 A;  5JS2 A;  3L4I A;  2ZM6 K;  1OH6 A;  2IDO A;  1N6Q A;  1JJ2 M;  1QTM A;  4B9U A;  1BOT O;  1NGI A;  3A8Y A;  3CC2 N;  1TAQ A;  4JI0 K;  2QWP A;  4LC9 B;  4OJR A;  3CFR A;  1NK8 A;  4BY9 C;  4JI6 K;  3CCL N;  3CME N;  3SQ2 A;  3FR0 A;  4CK1 A;  4DS5 A;  1LWE A;  4CZH A;  4BRF A;  4CBW A;  3WXI A;  4JI2 K;  2E2N A;  4FJM A;  2OPS A;  1O1W A;  3MX2 A;  1BCO A;  4CK3 A;  3T3F A;  1QQO A;  3JSM A;  3TSQ A;  4CF2 A;  2GEL A;  2Q36 A;  4FJH A;  4FPA A;  3CCJ N;  3AVI A;  4DFJ A;  1BI4 A;  3UKU B;  2E5L K;  2WBN A;  4OPH A;  4CF9 A;  3H3O B;  2ITM A;  4IZ9 A;  1HYS A;  5I3U A;  1D9D A;  1VQO N;  4EZ9 A;  2F7T A;  3SCX A;  3B6O A;  2ATQ A;  2O8E A;  3CG7 A;  2QEX N;  3VES A;  4DLG A;  1MDU B;  4DTP A;  3A5O C;  3HO1 A;  4XH4 A;  3WT0 A;  4FLV A;  1EO1 A;  2GWJ A;  1HQU A;  3NF9 A;  5AQO A;  4HCB A;  3RVC A;  1IO2 A;  4A61 A;  1D8Y A;  1YVU A;  3LAK A;  3D7E O;  3FLC O;  2V7Z A;  1ILY A;  1J54 A;  3ZT4 A;  4DG1 A;  4I6M B;  3K9K A;  2DFH A;  3F73 A;  4IFE A;  4EFH A;  2PYL A;  3THX A;  4FJN A;  4CJL A;  5CR4 A;  3T69 A;  1VSJ A;  5KGW A;  4M3R A;  1R0A A;  1C0T A;  4ELU A;  4DFP A;  4DR7 K;  3CHW A;  3BEX A;  2X6N A;  4O4G A;  5C25 A;  3ZT3 A;  3TWH A;  1KVA A;  2B6A A;  4FOI A;  3LAM A;  3SYZ A;  4FJJ A;  2A6A A;  3IUC A;  2F8S A;  5HRO A;  1DKG D;  1JCE A;  5J1E A;  2P5O A;  1ZBL A;  3PLA A;  3KK2 A;  3O5B A;  2O8D B;  3K2P A;  3DWL A;  4CZJ A;  4CEO A;  3E1Y A;  1ZBI A;  3ZX3 A;  3HK2 A;  2FBX A;  3ZEU A;  1JLC A;  1BA1 A;  2QWM A;  3H08 A;  1KVC A;  4MO5 A;  1GLB G;  4H0O A;  3TAB A;  2UXD K;  3G6E N;  1GLD G;  3L0Q A;  5M1Q A;  1DTT A;  5BPM A;  2WTU A;  4NCB A;  1QVG M;  1Q9Y A;  4BRG A;  4J2A A;  2HHT A;  2FLO A;  4BGA A;  1LWC A;  3SUQ A;  1VQ8 N;  4YHH K;  1WBB A;  1QSY A;  4YNQ A;  4JRQ A;  5GAH P;  3O9Q A;  5J2P A;  1D9F A;  3R6M A;  1NKE A;  1HUX A;  3MXI A;  4WF9 L;  3VQP A;  5J2M A;  4Y1C A;  3ZSW A;  1ATS A;  1RGI A;  3AVG A;  3I8D A;  1W2B M;  4FLU A;  4KRE A;  5EXW A;  1C0U A;  2X74 A;  4YOV A;  1VQ4 N;  3AVK A;  4DSL A;  4C1N I;  4CHY A;  5GAE P;  2KW4 A;  4X62 K;  1IBK K;  4G9Z A;  2V52 B;  5T7B A;  1QZ6 A;  2Q31 A;  3HOS A;  1IV0 A;  4H0T B;  1K6Y A;  4BRA A;  4HVJ A;  1K8A O;  1TL3 A;  5M1P A;  3HP6 A;  3G25 A;  4B3S K;  5KQD A;  1EP4 A;  4AHS A;  4I7F A;  3QDK A;  3RMA A;  4LF8 K;  3SQ4 A;  1YTU A;  1IG9 A;  4DR6 K;  4LFA K;  4RG8 A;  1WAJ A;  4FLT A;  1FW6 A;  4KH5 A;  3Q7C A;  2X6S A;  3SNN A;  5AQG A;  3SMP A;  1N36 K;  1YAG A;  4JRP A;  3AA5 X;  3HPO A;  3TAP A;  4KB0 A;  1YJ9 N;  3I8B A;  3FFI A;  1TKD A;  3OA9 A;  3V9S A;  3OS2 A;  2IGI A;  3I0R A;  4JI7 K;  4FWS A;  2VQE K;  2ETJ A;  3KKR A;  4IOX A;  2JWL A;  2QXF A;  4JKA A;  1ZBH A;  3NAE A;  2F96 A;  3Q7B A;  4K25 A;  1ZBU A;  3NH0 A;  4KHS A;  3VQ4 A;  2F9W A;  1HMV A;  4BVP A;  1XI1 A;  3V1Q A;  2O4G A;  4QOZ B;  2G8H A;  4BR5 A;  1OKJ A;  2VCP A;  5AQL A;  4CZM A;  5A2Q O;  4F3O A;  3ATV A;  4IOC L;  4FSV A;  4A5B A;  3K59 A;  3WNH A;  1C0M A;  3A2F A;  3PUF A;  4KI6 A;  2GBZ A;  3VQ8 A;  4FJ7 A;  2WC9 A;  4QS9 A;  1L5U A;  3VEZ A;  2E88 A;  3SI6 A;  1V4T A;  1HPM A;  1L3U A;  1RT3 A;  3CQ8 A;  3VQQ A;  3I55 N;  3C6A A;  5FRN A;  1U45 A;  2Y1I A;  4JI8 K;  2G8U A;  4CHO A;  3KIO A;  4E19 A;  1E3M A;  1ESV A;  1YXQ A;  3DXM B;  2UUA K;  3V1R A;  2FSJ A;  1TVR A;  3SUO A;  1Q9X A;  3NHG A;  4JD2 A;  3VQE A;  2OAN A;  2PY5 A;  3HJF A;  5GIP A;  3QIN A;  4KHN A;  3O4W A;  4ILJ A;  3GL1 A;  1YT3 A;  4Z4G A;  1OVQ A;  2Z1I A;  4KTZ A;  1QVF M;  1WSH A;  4OKJ A;  2O8B A;  3C7N A;  1BCM A;  1Q86 O;  1VSF A;  1HLU A;  3VA3 A;  4IXC A;  3C65 A;  3CCU N;  3R9P A;  3C95 A;  4OLA A;  4H5W A;  1BWF O;  2HF4 A;  4CD1 A;  1IKY A;  1HNW K;  4H03 B;  4IDK A;  4DFM A;  3BF3 A;  3N4P A;  1VQM N;  1RDD A;  5FRM A;  3HM9 A;  4B1Y B;  3KLG A;  4CGG A;  1X3N A;  4E7H A;  1YUW A;  1S1U A;  4OPJ A;  3WXK A;  1NGH A;  1HQE A;  4C8N A;  2VG7 A;  1MA9 B;  5AQR A;  2EWS A;  5CZ1 A;  3DRP A;  4OLB A;  1TUU A;  3P39 A;  5C10 A;  1GLA G;  3QET A;  5AR0 A;  1WNS A;  2NRX A;  2E2P A;  5HRR A;  4CJE A;  4CJP A;  4E7I A;  4B1W B;  1WLJ A;  3AVC A;  3DLR A;  1R59 O;  2NNW A;  3KLH A;  4K42 A;  4W5Q A;  1LAV A;  4FW2 A;  3ZSQ A;  2E8A A;  5AQF A;  2CGL A;  3HL8 A;  2RF2 A;  1BIS A;  4IFY A;  5AQM A;  3VQB A;  1TKZ A;  4AHC A;  3OYI A;  2Q97 A;  4BE1 A;  3LAL A;  4DTN A;  3J8A A;  4I2P A;  3WXJ A;  5EU7 A;  1RDC A;  3CCE N;  4LSN A;  5AQH A;  3D45 A;  4FWP A;  4BGB A;  2Q3S A;  5FRO A;  3MAQ A;  1HNX K;  1GLF O;  3ULD A;  3MN5 A;  1BL3 A;  3VF4 A;  3NF6 A;  4BRD A;  2HBL A;  3E01 A;  4X64 K;  1A5W A;  3CC7 N;  4KHP K;  4JKB A;  4CGH A;  4FLW A;  4DFK A;  1SL0 A;  4O5F A;  3AAR A;  1NJX A;  2P9S A;  4MLH A;  1B9F A;  3IMX A;  1WSG A;  3K0S A;  3ZSR A;  3IRX A;  1HPZ A;  1NGG A;  3THW A;  3V81 A;  3RSE B;  2YV0 X;  4ISE A;  4CJW A;  1BIZ A;  3DLE A;  4PHT X;  4O0I A;  1TGO A;  2VWB A;  4Z0U A;  1TYQ A;  3SLC A;  2GUP A;  4DWI A;  2O8C A;  3KTQ A;  4GVM A;  5KTQ A;  5AZJ B;  1UA0 A;  4F8R A;  1S5J A;  4F9O A;  4JV5 K;  1NJI O;  4MDA A;  5HL7 L;  4PKG A;  5E84 A;  5F0X A;  4BC5 A;  3NE6 A;  4CF0 A;  3PX4 A;  3OYK A;  4KHY A;  3G0Z A;  3ZSZ A;  2PYJ A;  3CJ9 A;  1BDG A;  3L2W A;  3LPT A;  3AV9 A;  4IG0 A;  5J2Q A;  4DV2 K;  2G8V A;  4IFV A;  3M6G A;  4CJ4 A;  1BA0 A;  5GAD P;  3ZCM A;  1L3T A;  2VWK A;  3VEW A;  2Q1N A;  1U4B A;  1SV5 A;  5JS1 A;  3E9L A;  1NM1 A;  1JLG A;  4JHD B;  3EY1 A;  4DSJ A;  3D6R A;  4AHV A;  5BRE A;  2ZJR L;  1VAZ A;  3LDP A;  2KFN A;  2B4J A;  4RW4 A;  1QZ5 A;  3NFA A;  3BDP A;  1IH7 A;  2IIR A;  3QBX A;  4O44 A;  4BC3 A;  3ZET B;  1IBM K;  1U2V B;  2O8F B;  3CCV N;  2ZGZ A;  5LL6 Z;  3VQ9 A;  3AO3 A;  2NZT A;  4V19 S;  1TK0 A;  3U8X A;  2Q0R A;  4A59 A;  3SAF A;  3H6E A;  2NLX A;  1YI2 N;  1BUP A;  4DV6 K;  4GKJ K;  1J53 A;  2YHB A;  1KTQ A;  4DU3 A;  2O4I A;  1TKT A;  2ZE2 A;  2W6L A;  1D5A A;  2A1S A;  4YY3 K;  2Y1J A;  3VEO A;  2GWK A;  4PL8 A;  1VQL N;  4PY5 A;  3C0B A;  1RTD A;  3NGI A;  3QFP A;  2RE2 A;  3QEP A;  4LF9 K;  3AO5 A;  1NGC A;  3ENO A;  1HNI A;  3M8P A;  4CEF A;  2FF6 A;  4CEC A;  4CZK A;  3F2K A;  1Z26 A;  1RT5 A;  1Q18 A;  3V9U A;  3OYF A;  2UXB K;  3LDQ A;  5AQJ A;  2BAN A;  1IKX A;  3R1X A;  4FK4 A;  1LCU A;  1NNE A;  1JXB A;  3BUZ B;  5CYM A;  1I3A A;  4XIU A;  1U47 A;  3V1O A;  3DLH A;  3LM9 A;  4B9L A;  4NO7 A;  4FJX A;  1VSE A;  4OO1 J;  2NRZ A;  1K8K A;  1N8R O;  3HYF A;  2PZS A;  2XY8 A;  3WEE A;  4B1V A;  3CCQ N;  4DV4 K;  2OZS A;  1BU6 O;  3TSP A;  2XY7 A;  4NYN A;  3ULE B;  4DUZ K;  4J2E A;  4DTU A;  3W0L A;  1JCF A;  4DB3 A;  3AO1 A;  2KLA A;  2VGN A;  4O8U A;  4BRQ A;  4N5S A;  2YJE A;  3DRR A;  1NGA A;  2NRW A;  2FBT A;  3M3Z A;  1NGJ A;  1WSE A;  4JAX A;  1GLL O;  5AFU A;  1C6V A;  3M1F A;  4KHQ A;  3HP9 A;  4HCC A;  3OYC A;  3T1Y K;  3SUN A;  4M3W A;  2XY5 A;  1S1V A;  4GY2 B;  4M63 C;  3ENH A;  4O5B A;  1JLF A;  3EKU A;  3F9M A;  3CC4 N;  3KK3 A;  4KRF A;  4B3O A;  4JN4 A;  2ZD1 A;  4GNI A;  4KH6 A;  3JXU A;  3UKU A;  3ZLJ A;  3H1Q A;  4C8M A;  4KI4 A;  3TTD A;  1LV5 A;  3CCS N;  1W97 L;  3QB0 A;  1GOC A;  5AQT A;  3S3M A;  4CBU A;  5JLF A;  4FJ8 A;  4CFD A;  3OY9 A;  3PY8 A;  2VGM A;  3MN6 A;  3VQC A;  3EKS A;  4FZX C;  4JS5 A;  2D0O A;  3NCI A;  2KZZ A;  3AO2 A;  3D2F B;  3SBT A;  1TK8 A;  1VSH A;  1WUA A;  3O9T A;  1KC8 O;  4J2B A;  4FO0 A;  1H1V A;  3CJA A;  4NXM K;  1XQS C;  3AVB A;  5DM6 L;  3VQ6 A; 
#chains in the Genus database with same CATH homology
 2KW4 A;  1FKP A;  1RDB A;  1RT7 A;  1FKO A;  2HMI A;  3MXJ A;  1S9E A;  5T7B A;  4OPK A;  4DU1 A;  1K6Y A;  2VG6 A;  4HVJ A;  1TL3 A;  3HP6 A;  1RDA A;  4PQU A;  3C6T A;  2HNZ A;  1NJY A;  1EP4 A;  4DU4 A;  4KAZ A;  4AHS A;  4AHU A;  4I7F A;  3RMA A;  4N41 A;  4CEA A;  2P5G A;  3SQ4 A;  1KLM A;  4CFC A;  2HNY A;  2HHU A;  4BDZ A;  1YTU A;  1NK5 A;  1IG9 A;  1Q8I A;  3DI6 A;  4RG8 A;  1WAJ A;  1GOA A;  5CY4 A;  4CF8 A;  3LDS A;  4FLT A;  3U6F A;  1XHZ A;  5HRS A;  2IAJ A;  2X6S A;  3SNN A;  2G8K A;  4FJ9 A;  4CK2 A;  3RMB A;  3ITH A;  4JRP A;  3OVN A;  3AA5 X;  3HPO A;  3L2Q A;  3TAP A;  4KB0 A;  3FFI A;  4W5O A;  3RMC A;  1TKD A;  3V9S A;  3OS2 A;  2IGI A;  1VSD A;  3I0R A;  4YFU A;  4C8K A;  4FZZ A;  3WNG A;  3K5L A;  3WNE A;  4ZHR A;  2ETJ A;  3OYL A;  1RTJ A;  3S3O A;  4B9T A;  4M3U A;  4W5T A;  3KKR A;  4CEB A;  3VN5 A;  2QXF A;  4N47 A;  1ZBH A;  2VWJ A;  3O4Q A;  4UQG A;  4IBN A;  2F96 A;  3NAE A;  4M3Z A;  3AVH A;  1ZBU A;  1KCF A;  3OYE A;  1IKV A;  3NH0 A;  4KHS A;  4I2Q A;  4M41 A;  3VQ4 A;  3OJU A;  5D3G A;  4OVL A;  3HXM A;  1HMV A;  1IKW A;  1JKH A;  4Q0B A;  2HVH A;  3QER A;  4E7K A;  1XI1 A;  1X9M A;  3V1Q A;  2HHW A;  4WE1 A;  2O4G A;  2G8W A;  3LZI A;  3RR7 A;  2G8H A;  4CEE A;  4QOZ B;  4M3X A;  3SQ1 A;  4EP5 A;  4FLY A;  1LW2 A;  4CIF A;  3QNN A;  3VQD A;  4B8C A;  4H4M A;  1T03 A;  3PX0 A;  3VA0 A;  3NDK A;  4CJK A;  3TAE A;  2E6M A;  2JLE A;  3DM2 A;  4F3O A;  4E0D A;  4BWM A;  3K59 A;  1VRU A;  1C0M A;  3A2F A;  3PUF A;  3WNH A;  4KI6 A;  4FW1 A;  5CZ2 A;  3RRH A;  2GBZ A;  2BGG A;  1QQC A;  3VQ8 A;  4IKF A;  4FJ7 A;  1L5U A;  4ZTF A;  1N5Y A;  4DSI A;  2HHX A;  4CHZ A;  3CFP A;  3KD1 E;  3SI6 A;  2QKB A;  1S6Q A;  1RBV A;  2LSN A;  1L3U A;  4DTO A;  1RT3 A;  3CQ8 A;  4ICL A;  4H8K A;  3VQQ A;  4FLX A;  1NK4 A;  4KHU A;  1S1T A;  1RT2 A;  4E89 A;  1RT4 A;  3HT3 A;  1U45 A;  5FRN A;  2Y1I A;  5KRS A;  3NH1 A;  2G8U A;  4CHO A;  2RN2 A;  3RR8 A;  2KTQ A;  3KIO A;  4ID5 A;  4E19 A;  4E7L A;  3TAF A;  4GW6 A;  3THV A;  4QAG A;  3ZT1 A;  1VK0 A;  2ZQB A;  4RW6 A;  5HP1 A;  4C8O A;  2BDP A;  2HHQ A;  4M42 A;  2X78 A;  3V1R A;  3O3F A;  4DSK A;  1RIL A;  3B6P A;  3SPZ A;  1TVR A;  3SUO A;  1Q9X A;  4GMJ B;  1UA1 A;  4JS4 A;  3MED A;  3LAN A;  3NHG A;  3VQE A;  1A5X A;  2PY5 A;  2ITG A;  3ZT2 A;  3HJF A;  1EX4 A;  3ALY A;  3QIN A;  4KHN A;  2YHA A;  1YT3 A;  2Z1H A;  3G10 A;  4CHQ A;  2G8F A;  3LP0 A;  3ZSV A;  2IOC A;  1HYZ A;  4Z4G A;  3TR8 A;  3EZ5 A;  1RBR A;  2FC0 A;  1X1P A;  4KTZ A;  2Z1I A;  4KB1 A;  4CJU A;  1WSH A;  4OKJ A;  1BCM A;  4KV8 A;  4CIE A;  1BGX T;  3SQ0 A;  1VSF A;  4PA1 A;  3K5N A;  3VA3 A;  4DQS A;  3K5M A;  1GOB A;  3NBP A;  3DLB A;  4KO0 A;  4DQI A;  3L8B A;  3QEI A;  3KD5 E;  2FBY A;  4K8Z A;  3TI0 A;  2IC3 A;  3TAR A;  3C95 A;  2W42 A;  1QSL A;  4OLA A;  2P1J A;  2D0A A;  1JLA A;  1RNH A;  2HVI A;  2XRI A;  3MEE A;  4IG3 A;  3OYD A;  1IKY A;  4OKE A;  1BHL A;  4IDK A;  1QE1 A;  4DFM A;  4BAC A;  4B8A B;  3OYA A;  2B5J A;  1KFS A;  1RDD A;  3DOL A;  1UWB A;  3LWL A;  3HM9 A;  4FJ5 A;  5FRM A;  1EXQ A;  3KLG A;  4CGG A;  3SPY A;  4E7H A;  3JYT A;  1S1U A;  4OPJ A;  3RTV A;  3AA4 A;  1RBT A;  4DLE A;  4ELV A;  2OPP A;  1HQE A;  4C8N A;  2VG7 A;  3AA3 A;  2E4L A;  5CZ1 A;  4DS4 A;  3DRP A;  1VSK A;  5HRN A;  3RRG A;  4CEQ A;  4OLB A;  1BQM A;  2YKM A;  4LSL A;  1QHT A;  4OKK A;  4CJ3 A;  3LPU A;  3QET A;  4Y1D A;  3MXM A;  1WNS A;  4NYF A;  3L2R A;  4CHP A;  1RTI A;  2DTU A;  4BWJ A;  3V4I A;  4FJI A;  4DTM A;  4DQP A;  3DLG A;  4CGF A;  5HRR A;  2WOM A;  2DY4 A;  4CJE A;  2D0B A;  4CJP A;  4CEZ A;  4E7I A;  2HB5 A;  4Z4H A;  3V6D A;  4FJG A;  1WLJ A;  2A1R A;  3AVC A;  1VRT A;  3QEX A;  1CZ9 A;  3KLI A;  4FJL A;  1WSF A;  3DLR A;  4AH9 A;  1CXQ A;  5CYQ A;  3KLH A;  1NKC A;  3L2V A;  1C1C A;  4W5Q A;  3T19 A;  1CZB A;  4CJS A;  3NGY A;  2R7Y A;  4DTJ A;  1LAV A;  2NUB A;  1ASU A;  4FW2 A;  3ZSQ A;  3SUP A;  2OA8 A;  4J2D A;  3NH2 A;  3OS0 A;  1EKE A;  1XHX A;  3AVL A;  3QES A;  3LP3 A;  1XWL A;  3TAG A;  3HL8 A;  2RF2 A;  1VSL A;  4FCY A;  1BIS A;  3HPG A;  4IFY A;  3T1A A;  1HNV A;  3HPH A;  2GV9 A;  3VQB A;  4N76 A;  3U3G A;  4FXD A;  2JGU A;  1TKZ A;  4AHC A;  3M8Q A;  2OPQ A;  1NOZ A;  4LH4 A;  4OGE A;  3OYI A;  3OJS A;  2QKK A;  4CFA A;  4C8L A;  4BE1 A;  3LAL A;  2BE2 A;  4DTN A;  4I2P A;  4K8X A;  1Y97 A;  2OYQ A;  3K57 A;  5EU7 A;  1RDC A;  1UAX A;  3I0S A;  4LSN A;  3KKS A;  3RWU A;  4E3S A;  3D45 A;  1NK6 A;  3LWM A;  2Q3S A;  5FRO A;  1L3S A;  1TAU A;  2OZM A;  1REV A;  3OYH A;  4CJ5 A;  1TV6 A;  1JLE A;  1UOC A;  2YNH A;  3CM6 A;  3QO9 A;  3VQ5 A;  3MAQ A;  3ULD A;  1NK7 A;  1BL3 A;  4KTQ A;  2Z1J A;  3NF6 A;  1DTQ A;  4MFB A;  3ZSO A;  3KLE A;  1NOY A;  3E01 A;  3L3U A;  1RBU A;  1A5W A;  1Z25 A;  2FBV A;  4CGH A;  4FLW A;  4DFK A;  1X9W A;  1SL0 A;  3HVT A;  3TAN A;  1NJX A;  4KTW A;  2YNG A;  3LP2 A;  2DFE A;  4CJT A;  4M45 A;  4Z4E A;  4QCL A;  1B9F A;  2I5J A;  2F8T A;  1I39 A;  1RBS A;  1WSG A;  4EZ6 A;  1ASV A;  3ZSR A;  4M3T A;  3IRX A;  4O0J A;  1HPZ A;  4Z4F A;  3DRS A;  3K58 A;  4H4O A;  2KQ2 A;  1DLO A;  3P5J A;  3V81 A;  1RT6 A;  4CJW A;  2YV0 X;  4DMN A;  2EX3 A;  1BIZ A;  3K5O A;  2YNF A;  3OYJ A;  3DLE A;  3NF7 A;  3TAQ A;  4O0I A;  2RPI A;  1TGO A;  5DK5 A;  4BE0 A;  4FM2 A;  3DOK A;  4Z0U A;  3L3V A;  3DYA A;  1CLQ A;  3MEC A;  3MEG A;  3S9H A;  4DWI A;  1B9D A;  1S1X A;  1VSI A;  3AVF A;  1A5V A;  1J9A A;  4GVM A;  4KKO A;  5KTQ A;  1RT1 A;  1UA0 A;  3KTQ A;  1FK9 A;  1S5J A;  3DLK A;  4F8R A;  1BI4 B;  3TAM A;  3CYM A;  4FJK A;  1LAW A;  3AVA A;  2P51 A;  3P1G A;  1ASW A;  3AVJ A;  4KFB A;  4OGC A;  4CGI A;  4AIL C;  1RCH A;  3NE6 A;  4RW8 A;  3AA2 A;  4CF0 A;  3O3G A;  4HUG A;  3OYK A;  3PX4 A;  3F9K A;  4KHY A;  1JL1 A;  1EET A;  4LY7 A;  4M3Y A;  2OPR A;  4CER A;  3G0Z A;  3ZSZ A;  1S6P A;  1WAF A;  3VQA A;  1KRP A;  2PYJ A;  4CGJ A;  1ZBF A;  2IS3 A;  1B92 A;  3L2W A;  4L8R B;  3S3N A;  3LPT A;  3SZ2 A;  3AV9 A;  2EHG A;  3QEW A;  2RKI A;  4CCH A;  4IG0 A;  4E1M A;  5J2Q A;  1T7P A;  4CE9 A;  4BE2 A;  4DQR A;  5K14 A;  4DTX A;  4N56 A;  3HVR A;  1WSI A;  4W5R A;  4FZY A;  2G8V A;  4IFV A;  4CJ4 A;  4NCG A;  3SV3 A;  1W9H A;  5JS2 A;  3ZCM A;  1L3T A;  2VWK A;  4FK0 A;  1JXE A;  2XHB A;  3IAY A;  1QTM A;  4HUF A;  1S1W A;  2IDO A;  1SV5 A;  1U4B A;  4TSX A;  3ZSX A;  5KI6 A;  5KGX A;  1N6Q A;  4B9U A;  1JLG A;  3EY1 A;  4PUO A;  3QLH A;  4DSJ A;  5HRP A;  1NKB A;  1TAQ A;  4AHV A;  1XC9 A;  4B9M A;  4HUE A;  3SJJ A;  5C42 A;  2KFN A;  3L2U A;  2B4J A;  2GUI A;  4OJR A;  1J5O A;  3CFR A;  4RW4 A;  3OYG A;  3NF8 A;  1TKX A;  3NFA A;  1NK8 A;  3BDP A;  1IH7 A;  2HHS A;  4O44 A;  3SQ2 A;  4CED A;  4CIG A;  3OYM A;  4CK1 A;  4Z4C A;  4DS5 A;  4LH5 A;  1LWE A;  1NK0 A;  3C94 A;  3VQ9 A;  4ID1 A;  3AO3 A;  3QEV A;  4JLH A;  3VQ7 A;  1BQN A;  4AHR A;  1WN7 A;  5KRT A;  5SWM A;  4BDY A;  3PO4 A;  2QK9 A;  1TK0 A;  4DTS A;  4FJM A;  2OPS A;  4BDP A;  1O1W A;  3T3F A;  1BCO A;  1HJR A;  4CK3 A;  3JSM A;  2KZM A;  1C1B A;  1NK9 A;  4DF8 A;  4CF2 A;  4EP4 A;  4E1N A;  1BIU A;  3M8S A;  1QS4 A;  4FJH A;  1J53 A;  2YHB A;  1KTQ A;  3AVI A;  4FLZ A;  4DU3 A;  2O4I A;  1TKT A;  3D0P A;  4O55 A;  2ZE2 A;  1BI4 A;  3KLF A;  1D5A A;  4DFJ A;  2A1S A;  4MQ3 A;  4RW9 A;  4Q5V A;  2Y1J A;  1QSS A;  1L3V A;  3OYN A;  3AVM A;  3EYZ A;  1T8E A;  4PY5 A;  4CF9 A;  3SV4 A;  1RTD A;  3ZSY A;  3NGI A;  1HRH A;  4R5P A;  3QEP A;  1KSP A;  5FDL A;  3QNO A;  3AO5 A;  1HYS A;  1LWF A;  5I3U A;  1D9D A;  3M8P A;  1HNI A;  4CES A;  4CEF A;  4EZ9 A;  1TL1 A;  3SCX A;  4CEC A;  3B6O A;  1Z26 A;  1RT5 A;  2ATQ A;  4FM1 A;  2XY6 A;  3V9U A;  3CG7 A;  3OYF A;  1RTH A;  3RMD A;  4DLG A;  1S9G A;  2BAN A;  1IKX A;  4DSF A;  4DTP A;  4FK4 A;  4CGD A;  2HHV A;  1X9S A;  3V9X A;  3HO1 A;  4FLV A;  5I42 A;  1JXB A;  1U47 A;  5CYM A;  1HQU A;  1CXU A;  1I3A A;  3ASM A;  3NF9 A;  3V1O A;  4XIU A;  3DLH A;  1IO2 A;  4B9L A;  4HCB A;  4FJX A;  1D8Y A;  1YVU A;  1SL1 A;  3LAK A;  1VSE A;  1J54 A;  4CF1 A;  3AO4 A;  3HYF A;  2XO7 A;  3WNF A;  3ZT4 A;  4DG1 A;  2PZS A;  2XY8 A;  5SZT A;  1SUQ A;  2OZS A;  2HW3 A;  2DFH A;  3F73 A;  4FJN A;  3M8R A;  2PYL A;  4CJV A;  3C6U A;  5DMR A;  2D5R A;  4CJL A;  4NYN A;  2XY7 A;  4FK2 A;  2AJQ A;  4W5N A;  3ZT0 A;  4J2E A;  1VSJ A;  4DTU A;  1NJW A;  1WSJ A;  4B9S A;  1ITG A;  5KGW A;  1JLQ A;  4M3R A;  1HYV A;  1U04 A;  1C0T A;  5J2N A;  1R0A A;  4DFP A;  3AO1 A;  3P83 D;  4ELU A;  5HLF A;  2X6N A;  4O4G A;  4N5S A;  3PO5 A;  4I9Q A;  5C25 A;  3ZT3 A;  2VG5 A;  3DRR A;  1LW0 A;  3TWH A;  4E7J A;  3AVN A;  5JS1 A;  1G15 A;  1KVA A;  4B9V A;  2B6A A;  2FBT A;  3HST B;  3CM5 A;  3LAM A;  1SKR A;  2YKN A;  3O4N A;  4B9N A;  3SYZ A;  1KVB A;  1WSE A;  4FJJ A;  3V9Z A;  2F8S A;  5HRO A;  1FXX A;  1C6V A;  3ISN C;  3PX6 A;  5J1E A;  4G1Q A;  3HP9 A;  2P5O A;  4HCC A;  4KHQ A;  1ZBL A;  2YNI A;  3KK2 A;  3OYC A;  5C24 A;  4PWD A;  3K2P A;  1U48 A;  3KJV A;  3SUN A;  4FYD A;  4M3W A;  2XY5 A;  1S1V A;  2WON A;  1F21 A;  4CEO A;  1ZBI A;  4F2R A;  2KFZ A;  2D0C A;  4CJR A;  3LP1 A;  3OYB A;  4O5B A;  3HK2 A;  1JLF A;  2FBX A;  3CFO A;  1JLC A;  1W0H A;  4KRF A;  3KK3 A;  3O3H A;  3H08 A;  2Z1G A;  1KVC A;  4B3O A;  3DMJ A;  4FVM A;  2ZD1 A;  3NGZ A;  3TAB A;  4KHW A;  4Z4I A;  4DTR A;  1DTT A;  1YTA A;  1VSM A;  4NCB A;  3KK1 A;  1Q9Y A;  4J2A A;  4C8M A;  3PV8 A;  2HHT A;  4KI4 A;  4DQQ A;  4CJQ A;  1LWC A;  3SUQ A;  4I9L A;  1LV5 A;  4ZTJ A;  4CFB A;  1QSY A;  4YNQ A;  1SKS A;  1GOC A;  2DFF A;  1MU2 A;  4JRQ A;  5J2P A;  3S3M A;  4DF4 A;  1D9F A;  1JL2 A;  4NCA A;  3QIP A;  1NKE A;  4DSE A;  4FJ8 A;  4CFD A;  3OY9 A;  3V9W A;  2G8I A;  2E6L A;  3MXI A;  3VQP A;  3PY8 A;  5J2M A;  4F3T A;  4Y1C A;  3QIO A;  3ZSW A;  4F2S A;  3VQC A;  3IG1 A;  4AHT A;  4CJF A;  4FZX C;  5E41 A;  4JS5 A;  3OS1 A;  1ZYQ A;  3NCI A;  2HND A;  3AVG A;  5HBM A;  3I8D A;  1KLN A;  2KZZ A;  4CHN A;  4B08 A;  3AO2 A;  4FLU A;  1U49 A;  4LD0 A;  4KRE A;  1NJZ A;  4ELT A;  1T05 A;  1TK8 A;  1VSH A;  3IS9 A;  3LZJ A;  4RW7 A;  1TK5 A;  1C0U A;  3U3Y A;  2X74 A;  4J2B A;  1KFD A;  4FM0 A;  1JLB A;  3UIQ A;  4KPY A;  4F4K A;  3AVK A;  3AVB A;  4HHT A;  1SL2 A;  4HTU A;  4CHY A;  1SKW A;  4DSL A;  3VQ6 A;  1C1A A;  3BGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...