1EXQA

Crystal structure of the hiv-1 integrase catalytic core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
147
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPYVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 44
structure length 147
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1exqA00
1SL2A 3WNGA 4CGIA 3AA3A 3AO1A 1ZYQA 4M3XA 1QE1A 1NK8A 3PX0A 4LSLA 1NKEA 4I9LA 3C6UA 3WNHA 4CJRA 4FK4A 3L3VA 3H08A 2ZQBA 3AVFA 4LH4A 3QEVA 1NJZA 3HJFA 4JS5A 3IS9A 4BWJA 3SUNA 3NH2A 1Z25A 4CIGA 1RCHA 3AA2A 2Q3SA 3ZSYA 3ZT2A 1ZBLA 2Z1GA 3AVHA 3QO9A 4OKEA 4PQUA 1CXUA 4F3OA 3QEWA 3OS0A 4RW9A 4DTJA 3DRRA 1GOCA 3OY9A 1HQEA 4DQSA 4ZTFA 1N5YA 2DFHA 5J2MA 2D0CA 2IS3A 3ISNC 2HHQA 1TAQA 3MEGA 4DG1A 3CQ8A 3EY1A 2VG5A 5DK5A 1T7PA 2BANA 4B8CA 4M3UA 3VQBA 2AJQA 1LWFA 1CZBA 3OYAA 4F2SA 3AA4A 3DLKA 1JLFA 4JLHA 1X9MA 3ASMA 4KTWA 2WOMA 4KV8A 2QXFA 3VQ4A 4FCYA 5J2PA 3S3NA 4FJ5A 4W5RA 3CYMA 1JLQA 1S1WA 1ASUA 1NK4A 4KHNA 3AVGA 3DMJA 4IFYA 4CFAA 3V9WA 3MXMA 3RWUA 3O3FA 3QLHA 3VQ8A 4AHSA 4M42A 1S6PA 3TI0A 3L8BA 5FRNA 3L2WA 3NDKA 3NCIA 3KTQA 5D3GA 2KQ2A 1VSHA 2F96A 1RBUA 4CHQA 2QKKA 4N47A 2X6NA 4F3TA 2OPRA 3L2RA 2PYJA 1BIUA 2OPPA 3OYFA 1CLQA 4O55A 4FLZA 3TAEA 3AV9A 3SQ0A 1Z26A 3ZT4A 4CJ4A 4PWDA 4DU4A 3DLRA 4BACA 1JXBA 4AHRA 4FLWA 3SUPA 1XI1A 1HYSA 4CJWA 2VG7A 4CJPA 3V9XA 3SYZA 1RTHA 2D0BA 1RILA 3BGRA 2B6AA 4C8MA 3MAQA 1NK5A 1KVAA 2EHGA 3RMAA 3ZT3A 3HK2A 2PY5A 3VQQA 3KLGA 2I5JA 1J9AA 1RDDA 3M8QA 1NJWA 3D45A 3DM2A 4J2AA 1VSJA 3OYCA 1YVUA 3TR8A 3F73A 1NOYA 4HUEA 2G8WA 1ZBIA 2Z1HA 1TK8A 4RG8A 2B4JA 3U3GA 1I3AA 3QNOA 4CEZA 1A5VA 1RT3A 1BQNA 4BE1A 2Y1IA 4KB0A 4CESA 4XIUA 1L5UA 4B08A 3I0RA 4MQ3A 1HYZA 2ZE2A 4O0IA 1EKEA 3SUOA 4WE1A 1DTQA 4AHVA 3I0SA 1WSEA 1TVRA 3AVLA 3HXMA 1SL0A 3KLHA 1ASVA 3AVKA 3SV3A 4FLXA 1VRTA 2A1RA 4F8RA 4J2DA 4FJXA 4OLAA 4C8LA 4W5OA 3KLEA 3ITHA 1JLBA 4OLBA 4OGEA 4DFMA 4CF0A 3CM5A 3SPYA 1FK9A 4CJVA 4FJNA 2NUBA 1KCFA 3EZ5A 1LWEA 5KI6A 4M3WA 3O4QA 1RT7A 4IG0A 3T19A 2OA8A 3V1OA 4DSFA 4FJHA 3LWLA 2GV9A 4FM2A 4EZ6A 4CJLA 1IG9A 3JSMA 4CJFA 4Z4FA 4DSLA 3NF8A 3VA0A 4E7HA 3VQDA 3QEXA 2XY5A 3HYFA 4HCBA 4DSEA 2IDOA 4N41A 1TKXA 4FW1A 2RN2A 4EP4A 1RTIA 2PZSA 1TK0A 4KO0A 4BWMA 4FZZA 3QNNA 3AVMA 1DLOA 1TKZA 4CK1A 4JS4A 4Z4HA 3U6FA 3LP3A 5HLFA 4GMJB 3DLBA 1RDAA 1HPZA 4LY7A 4W5QA 3KIOA 1VSMA 2VG6A 1D8YA 4DTXA 4FJMA 3NH0A 2YHBA 4OPJA 1VSFA 4CIEA 3SCXA 4M3RA 3NGIA 5CZ2A 3HSTB 3PV8A 4MFBA 3KKRA 4O44A 4CHNA 3RMCA 1QQCA 1TKDA 4FYDA 4W5TA 3DI6A 3E01A 2HVIA 2WONA 1GOBA 3LZJA 3TABA 1VRUA 2FBTA 4OKKA 1BGXT 4CK3A 4DS5A 2P5GA 3OYDA 1FXXA 5C24A 4CFBA 4CEQA 1JLEA 1D9DA 3KKSA 1KTQA 1S1VA 4RW6A 3IRXA 3QIPA 1LWCA 5KGWA 4CHZA 4CEDA 1RBSA 4UQGA 4F4KA 5FDLA 1D9FA 3KLFA 4KTQA 1WSIA 2P1JA 4FM0A 4AHTA 3NHGA 1I39A 3HPOA 1SV5A 3DOKA 4E7KA 3NF7A 3TARA 4DF4A 4ELTA 2F8SA 4RW4A 1BI4B 3D0PA 4B9TA 2OYQA 3F9KA 3T1AA 1VSDA 2Y1JA 2G8UA 3DLHA 2HNDA 3OYBA 4HVJA 1B9FA 5HRPA 1QS4A 3K5MA 4DU3A 4HCCA 4FJLA 1KVCA 2HHTA 4ELVA 4Y1CA 1JLGA 1KSPA 4YFUA 1QSLA 4M45A 3HO1A 2XY8A 1J54A 2IC3A 1RT4A 4LH5A 4CEOA 1S1XA 1VK0A 3LAKA 1DTTA 1TKTA 5HROA 4CEEA 3OYEA 3AVCA 3LP0A 1QHTA 1UWBA 3TAPA 4ZTJA 4BE2A 1L3VA 2FBVA 3LP2A 4FJ8A 1A5XA 1U48A 2QK9A 4CJ5A 3MXIA 2G8KA 2ITGA 4M41A 2KFNA 3RTVA 4KHWA 1WAJA 5KRSA 3TAGA 2OZMA 2RPIA 3HT3A 3TAFA 4KHUA 1BI4A 3G10A 1TL3A 3V81A 3SPZA 3AO2A 4Z0UA 4CGDA 4CHOA 3S3MA 4FK2A 5KTQA 2O4IA 3KLIA 2YNGA 4CEBA 1CZ9A 2YHAA 4E1NA 1S9EA 1NJXA 4CGHA 1TAUA 4AH9A 1U04A 2ETJA 1VSLA 4FLVA 4K8XA 3V4IA 3WNEA 3OS2A 3NF6A 1Q9XA 1REVA 2YV0X 3HVTA 1SL1A 1L3SA 4CF9A 3ALYA 1U47A 2G8IA 2D5RA 3OJSA 2X78A 2DFFA 4E19A 2HNYA 3KK1A 3NBPA 2JLEA 1T03A 1ASWA 1WNSA 2KW4A 3PUFA 4ID1A 5C25A 4FZYA 1ZBFA 4GW6A 3M8PA 4TSXA 5DMRA 5JS1A 1IKXA 1VSKA 1WSGA 3NFAA 4JRQA 3QERA 3AO5A 3TAQA 4J2EA 1WN7A 5KRTA 4FLYA 5EU7A 5SWMA 2KTQA 1O1WA 3V6DA 4H8KA 1JL1A 4B9NA 4FZXC 4FLTA 4E7LA 1C0TA 5FRMA 4N76A 1W0HA 4B9MA 3IG1A 1NOZA 3OVNA 1LW2A 4CE9A 4F2RA 4CF2A 4BDZA 4FJ7A 4DTOA 4O4GA 4CJSA 1T8EA 4RW7A 1WSFA 3TAMA 4CECA 2HHWA 4DSKA 4KI4A 4J2BA 3RRHA 4FJKA 1JL2A 3LZIA 3TWHA 5I42A 4H4MA 3ZSRA 1IO2A 3VQCA 1HMVA 4E0DA 2BGGA 2BDPA 4QAGA 4CF8A 4AILC 3HPGA 5E41A 2Z1JA 3NH1A 1JKHA 1UA0A 3PX4A 3NE6A 3P5JA 3KD1E 1L3TA 4CJQA 4CEAA 4FJIA 5J2QA 2KZMA 1WSJA 1XWLA 3VQ9A 3I8DA 1J53A 1TL1A 2GUIA 3CM6A 3K2PA 3HP6A 3CFPA 1LV5A 4HUFA 1KRPA 3KD5E 4PA1A 4CF1A 4CHPA 4PUOA 4KRFA 3PY8A 1C1CA 3G0ZA 3O3GA 1KLNA 4KAZA 3HPHA 4ID5A 1SKRA 5KGXA 1TK5A 1SKWA 1FKPA 1WAFA 5C42A 1RTDA 4CCHA 3QEPA 2PYLA 5J2NA 3SI6A 2OPQA 1RT1A 4ICLA 1XC9A 1U4BA 2YNIA 4CGJA 4B9LA 4FJGA 3C6TA 4YNQA 1HRHA 4FW2A 4KTZA 1XHXA 2KFZA 2KZZA 2LSNA 2HHVA 2EX3A 3O4NA 3PO5A 1N6QA 3OS1A 2FBYA 5FROA 1BHLA 4ZHRA 1Q8IA 4Y1DA 5J1EA 3PX6A 4M3TA 2F8TA 3LP1A 1EETA 1NK6A 1U45A 3SUQA 1X9WA 2HHXA 1LAWA 4FXDA 4CHYA 2FC0A 4DU1A 1RDBA 4DFPA 5HRRA 4DTRA 4I9QA 4AHUA 3V9ZA 1RBTA 3V9SA 3VQEA 1FKOA 4DMNA 3UIQA 2HNZA 1ZBHA 2HW3A 1BIZA 5SZTA 2DFEA 2O4GA 5CY4A 4DTMA 2P51A 2YNHA 1KVBA 3MXJA 4LD0A 4E3SA 2DY4A 4DSIA 4DLEA 2HB5A 1IKVA 3DRPA 5I3UA 4O0JA 4B8AB 1C0MA 3LANA 1LW0A 3NGYA 5CYQA 5HBMA 3SJJA 3ZCMA 2E4LA 4IKFA 2BE2A 4N5SA 1BL3A 5JS2A 3SQ2A 3MECA 4EP5A 1R0AA 2XY6A 3MEEA 4IDKA 1BQMA 2GBZA 4NCGA 4FJJA 5HP1A 1C0UA 3P83D 3M8SA 3K58A 1NKCA 4EZ9A 3V1QA 3QETA 1QTMA 2OZSA 4KFBA 4OPKA 2XY7A 2G8VA 1Q9YA 4DF8A 1VSIA 3ULDA 4DQQA 4Z4EA 3AVAA 1BCOA 3LPTA 2DTUA 1HNIA 4E89A 3ZSVA 3TANA 1B92A 1HNVA 1TGOA 4CJ3A 4HHTA 4OVLA 4KHQA 3C95A 5T7BA 4KI6A 4CK2A 4IG3A 3V9UA 3LWMA 4DTPA 3MEDA 1U49A 1BCMA 4NCBA 2RKIA 4OGCA 3RR8A 3VQ6A 4CJTA 4KB1A 2HHUA 3NF9A 3OYGA 1MU2A 3L2QA 3QIOA 4RW8A 3K5LA 2QKBA 3K57A 4E7IA 1QSYA 3RMDA 4QCLA 1WLJA 3QINA 1G15A 1YTAA 3LPUA 4KHSA 3AVBA 3HP9A 4CJKA 3AVIA 3FFIA 4Z4GA 3L3UA 2ATQA 3ZT1A 4R5PA 4C8OA 4FK0A 1S1UA 3AO4A 1W9HA 3K5OA 3M8RA 4E7JA 2G8HA 4C8KA 4FJ9A 1SKSA 3DYAA 3RRGA 3L2UA 3PO4A 1QSSA 4DSJA 3SQ4A 3OJUA 1ITGA 4KKOA 2RF2A 3HL8A 4I7FA 1HQUA 3DLGA 3RR7A 1KFSA 2X6SA 5HRSA 4BDPA 1EXQA 3JYTA 3OYMA 3KJVA 1HJRA 1C6VA 2D0AA 4DLGA 4DQIA 1YT3A 4N56A 3LDSA 3ZSQA 4Q0BA 1S1TA 3EYZA 4L8RB 4B9SA 3B6PA 2R7YA 3OYHA 3ZSOA 3SQ1A 1X9SA 1RT6A 4I2QA 2YKMA 4H4OA 4CEFA 2B5JA 4BDYA 1EP4A 3DRSA 3O3HA 1WSHA 1NK7A 4NCAA 4HUGA 3VQPA 4IBNA 2IGIA 5CZ1A 3C94A 3OYIA 1KLMA 2IOCA 3AVNA 4Q5VA 4B9UA 4AHCA 1X1PA 4NYNA 4I2PA 1RBRA 1CXQA 1Y97A 1GOAA 2W42A 1IKWA 4B3OA 3NGZA 3CFRA 3K59A 1JLAA 1T05A 1NK9A 3B6OA 1BISA 1RT2A 2X74A 1C1BA 4CJEA 4DQRA 1UA1A 3AO3A 4ELUA 1C1AA 4HTUA 3THVA 1K6YA 1A5WA 3OYJA 3IAYA 4KHYA 1B9DA 2A1SA 1VSEA 2YNFA 3WNFA 4CERA 1S6QA 5HRNA 3ZT0A 2YKNA 2VWJA 3T3FA 3RMBA 3CFOA 4KREA 3VQ5A 1S9GA 2IAJA 4DTNA 1S5JA 3LALA 3HVRA 2JGUA 5K14A 1L3UA 4GVMA 4BE0A 3VQAA 3HM9A 3SZ2A 1RDCA 3SV4A 4Z4IA 1TV6A 4KPYA 4OJRA 4CFDA 3VA3A 2ZD1A 4CJUA 2Z1IA 3S9HA 3V1RA 3L2VA 3DOLA 4CGGA 1F21A 2VWKA 4W5NA 1SUQA 3OYLA 1XHZA 4DFJA 2G8FA 4Z4CA 3AA5X 4G1QA 4FLUA 4OKJA 1UOCA 2HHSA 2E6LA 4DS4A 4B9VA 1NKBA 3KK3A 1IKYA 4LSNA 4IFVA 4FVMA 2XRIA 3ZSZA 4K8ZA 1NK0A 3NAEA 3P1GA 1JXEA 1IH7A 3BDPA 5CYMA 3OYNA 3QESA 3SNNA 4E1MA 2HMIA 4JRPA 3VQ7A 4FM1A 1RNHA 3VN5A 4CGFA 3OYKA 4DTSA 3U3YA 4DTUA 1J5OA 4CFCA 1RBVA 2OPSA 3KK2A 3CG7A 4NYFA 1UAXA 4C8NA 4QOZB 2XHBA 1LAVA 1YTUA 4O5BA 1RT5A 4CIFA 2XO7A 4DFKA 1HYVA 3DLEA 1KFDA 1JLCA 3ZSXA 1NJYA 4DQPA 3AVJA 3S3OA 1RTJA 3K5NA 1EX4A 1ZBUA 3A2FA 2HVHA 4M3YA 1D5AA 2E6MA 3ZSWA 3QEIA 4PY5A 2P5OA 4DWIA 3LAMA 2FBXA 4M3ZA
chains in the Genus database with same CATH superfamily
1G99A 5GIPA 5EOYA 4JEPA 3D6RA 1NKEA 3G4SN 1BWFO 3CCRN 2ZQBA 3AVFA 4LH4A 2VQEK 2W6KA 1NJZA 3SUNA 4DV7K 4WYBA 3QDKA 1KC8O 4CIGA 1ZBLA 1HR0K 2Q3SA 4XH4A 2Z1GA 4OKEA 4BC5A 3I56N 3OW2M 4RW9A 4DTJA 1VAZA 2V7YA 3DRRA 4KH4A 3OY9A 2E5LK 4K25A 3U4LA 1SS6A 1TAQA 3MEGA 4JKHA 5M1OA 3AARA 3GOIA 5AQSA 3O1BA 5M1KA 5GAEP 4F2SA 4JLHA 1JLFA 4KTWA 2WOMA 3H46O 3ENHA 1S3XA 3CYMA 1S1WA 1ASUA 1NK4A 4KHNA 4IFYA 2UUBK 1HKBA 1S6PA 3VEWA 3QICA 3NCIA 3KTQA 5D3GA 2KQ2A 1VSHA 4GVEA 1RBUA 2UU9K 4BG9A 1WUAA 2X6NA 4F3TA 3GDQA 4BC3A 3VEYA 4O55A 3TAEA 2JWLA 3SQ0A 1Z26A 3D2EA 1S72N 4DU4A 3C7NA 3SUPA 4AHRA 3VENA 1HX1A 2D0BA 2V51B 4O5FA 1KQSM 3MAQA 1NK5A 1KVAA 1NBWA 2HBMA 2WBNA 3HK2A 3PLAA 2I5JA 1NJWA 3D45A 3DM2A 5JLFA 3OYCA 1YVUA 1YJNN 4JN4A 4RG8A 4BRGA 2D1KA 2Y1IA 2QWQA 4LFCK 3Q7BA 1W2BM 4MQ3A 1DTQA 4JKAA 1WSEA 3AVLA 3WUHA 1SL0A 3AVKA 4M7YA 4JYAK 1OH6A 4W5OA 3KLEA 3ITHA 2HOEA 4DFMA 4CJVA 4FJNA 2D0PA 1H1VA 2KHOA 2YHXA 1LWEA 3O4QA 5AFUA 3LWLA 3BF3A 4EZ6A 4CJLA 3F2KA 3P38A 4CJFA 5B8HA 2UUAK 4Z4FA 3O1WA 4E7HA 1OH5A 2XY5A 2IDOA 4EP4A 4KO0A 2O8FB 1WBBA 4Z4HA 3THWA 1RDAA 3KIOA 1VSMA 3J7ZO 3LL3A 2YHBA 4OPJA 1VSFA 3HSTB 2FF3B 3VF6A 4MFBA 5FPDA 3KKRA 5LMUK 5AQWA 4BRDA 1QQCA 3J7YP 4W5TA 2HVIA 2E8AA 1Q86O 3A8YA 3O9TA 2ZGYA 2P5GA 5AZJB 4AF1A 1GLCG 1D9DA 3KKSA 3WEEB 1NGAA 5EXWA 4JI4K 2ZJRL 5KGWA 2O8BB 3TU5A 4CEDA 4BG8A 3CPWM 5FDLA 4CZGA 1D9FA 2ZWHA 2P1JA 3CPEA 1I39A 3TARA 4E7KA 1QHAA 3DAWA 4RW4A 1NWKA 1VSDA 3EKSA 2HNDA 4DU3A 1CZAN 4Y1CA 2XY8A 1HPMA 1J54A 1S1XA 3AVCA 4ZTJA 4O8UA 3LP2A 2Q31A 5AQMA 1WAJA 1BI4A 1N32K 3AO2A 4CGDA 4IFEA 4JD2B 4DUYK 2RE2A 1S9EA 1NJXA 1OVYA 2YV0X 1TUUA 4FWOA 4CF9A 2X78A 2HNYA 4BR5A 3KK1A 2QEXN 1T03A 1ASWA 4FWRA 2HBJA 3NFAA 1WSGA 5AQVA 3TAQA 2P9SA 5KRTA 4FLYA 2KTQA 3OA9A 2W41A 4B9MA 3ID8A 1NOZA 4CE9A 4JKCA 5C10A 4QS9A 1T8EA 4YOTA 3QBWA 3TAMA 1JL2A 2E2NA 3AAPA 4E0DA 1HMVA 4QAGA 4KB0A 4CZKA 3HP6A 4EHUA 1XNQK 4RCHA 5C12A 3I55N 3JS6A 1K8KA 4CBXA 4JKGB 4H0VB 5KGXA 5C42A 1ATRA 4CCHA 1E4GT 1Q82O 5J2NA 3SI6A 2VWBA 3SAHA 4FJGA 4FW2A 4FSVA 4FWSA 2KZZA 3LDLA 3ATVA 1QQNA 5FROA 4M3TA 1Q8IA 4Y1DA 2J4RA 2F8TA 3LP1A 5CE3A 5I9EB 4OPAA 4H0XB 5GAHP 4DMNA 2HNZA 1XNRK 4DTMA 2YNHA 4RTFD 2HBKA 3VGLA 5AQQA 5I3UA 3P31A 3LANA 3ENBA 5CYQA 3M5RA 5F2RA 2E4LA 4IKFA 5JS2A 3VEVA 4H5WA 3MECA 4M7XA 3JXUA 1RDUA 5BREA 4MDAA 3NVMA 4NCGA 3V1QA 2OZSA 4KFBA 1GLLO 5BR8K 5M1FA 1Q9YA 1VSIA 1BCOA 1B92A 3AGKA 4OVLA 5AQZA 3C95A 5AQRA 5T7BA 4KI6A 5IT9O 2KLAA 2RKIA 2YHYA 3VQ6A 3UKUB 3W3DA 4DV1K 3NF9A 3MX5A 1MU2A 3L2QA 3SLCA 3QIOA 3K57A 2V7ZA 1G15A 3CJAA 2V52B 3AVIA 5TKYA 3FFIA 3TTFA 4RWTA 4Z4GA 4PL7A 1HUXA 2Q2RA 4PL8A 4DKWA 2G8HA 2WFBA 4ILGB 5HOOA 5JICA 1ITGA 2A6AA 2HMPA 3C65A 4YOUA 3HL8A 1HQUA 3DLGA 3T1YK 2X6SA 4OO1J 3JYTA 3KJVA 1HJRA 2D0AA 4DQIA 4Y0WA 3CCSN 3ZSQA 1S1TA 1N33K 3EYZA 2DPNA 4B9SA 2R7YA 4FWPA 3SQ1A 3ZSOA 2B5JA 3H45C 1EP4A 3U8XA 3O3HA 3MCPA 4JI1K 4IBNA 2IGIA 5CZ1A 2WTUA 3SMSA 3IFRA 1IKWA 2P9UB 1JLAA 4FPAA 3B6OA 2X74A 1SAZA 4ELUA 3AO3A 1C1AA 4HTUA 1B9DA 2NLXA 2YNFA 3WNFA 4CERA 1S6QA 3K0SA 1YJWN 1FJGK 3CFOA 3M3ZA 4CZHA 3HVRA 4ILHA 4IZ9A 3MK6A 1RDCA 1EO1A 4KPYA 4CFDA 3VA3A 3ZETA 2Z1IA 4X66K 1SUQA 4G1QA 4ILJA 1UOCA 2E6LA 4DS4A 1QZ5A 4B9VA 1VQ7N 5A2QO 4H5TA 4LSNA 3GE1A 3CETA 3ZSZA 1NK0A 1JXEA 3BDPA 5AQKA 3OYNA 4JRPA 3OYKA 3CCVN 3A5NC 4DV3K 1VQPN 4LF5K 4CFCA 4C8NA 4QOZB 1E4FT 5M1PA 2BUPA 1RT5A 4DR4K 1HYVA 3DLEA 1JLCA 4GV6A 4DQPA 2P9IA 4F9OA 1RTJA 1M1KO 2IVOA 3VF2A 2I7PA 1YUWA 4G9ZA 1TK0A 1FW6A 4M3ZA 3AO1A 2UUCK 4M3XA 4LSLA 4WFAL 4IOCL 3KVGA 4YOVA 3C6UA 3WNHA 1KXPA 5LY3A 3L3VA 4DV2K 4BWJA 1Z25A 2UXDK 4GV9A 2UXCK 4X64K 4BR0A 4GY2B 3QEWA 4ISFA 1GOCA 2BTFA 1NLVA 4FWNA 1N5YA 5AZIA 1ESVA 3HTVA 4DG1A 3BUZB 4JKBA 5DK5A 4M3UA 2AJQA 3O8MA 1VQNN 3VEOA 1CZBA 1NGJA 3DLKA 3VEZA 1KD1O 3ASMA 4WFNL 4KV8A 3MN7A 2E20A 3S3NA 5JMVA 3D2EB 3CHWA 3C7NB 4W5RA 3V9WA 4CFAA 1NGGA 3O3FA 3QLHA 3VQ8A 3TI0A 1EQYA 3L8BA 3L2WA 3NDKA 4OPHA 4CHQA 2OPRA 3ZX2A 2PYJA 1SZ2A 4CW7B 2HSTA 1XI1A 2VCPA 1HYSA 1W97L 4CJWA 3CC7N 1T6DA 2CGLA 2P9KB 1RTHA 4C8MA 2B6AA 2HHHK 3RMAA 4B3RK 5BRFA 3KLGA 1J9AA 1RDDA 4JI8K 1GLJO 2O8DB 2GELA 1ATSA 3F73A 5BN8A 4DV6K 3CCUN 1RT3A 1BQNA 2P9PA 3CCQN 1TUYA 3I0RA 4A2BA 4BRNA 1HYZA 5CR4A 2ZE2A 3PIPL 3SV3A 2YJEA 4FLXA 4J2DA 4C8LA 2YI1A 1JLBA 3MCAB 4CF0A 3ZX3A 1FK9A 1KCFA 5BPLA 3VMFB 3W0LA 3OBYA 3V1OA 4FJHA 4FM2A 2QWRA 3CMAN 3NF8A 2QXLA 3QEXA 3SJHA 5ADXH 4DSEA 5JVGL 3RSEA 1N8RO 1RTIA 4KH6A 3C6HA 2PZSA 2IVPA 4BWMA 4NXMK 3QNNA 1K73O 3AVMA 1DLOA 4CK1A 3WXLA 3DLBA 2D0OA 1HPZA 3LDQA 4LY7A 4JK8A 2VG6A 4DV5K 1NU0A 3HZ6A 3RMCA 3TSUA 2WONA 1YHQN 3CJCA 3TABA 2FBTA 4OKKA 4FPBA 4CK3A 3OYDA 3SMPA 1FXXA 4LF6K 4CFBA 4CEQA 5BR9A 4H0OA 1KTQA 4CHZA 2UXBK 4F4KA 3KLFA 1C0FA 3KZBA 1JCEA 3HPOA 4ELTA 1BI4B 4B9TA 3F9KA 2Y1JA 3DLHA 4HVJA 2ASPA 5HRPA 1QS4A 4C1NK 2HHTA 3KWGA 2BH1A 1JLGA 1QSLA 4CEOA 2IC3A 1VK0A 1U4BA 3LAKA 5HROA 3OYEA 1JCFA 3LP0A 1UWBA 4ISEA 2VYPA 4BE2A 2FBVA 1IV0A 3L4QA 2QK9A 2G8KA 2ITGA 4KHWA 5KRSA 4X62K 4IEEA 5BN9A 3G10A 4FK2A 4Z0UA 3S3MA 5KTQA 1RDWX 2P9SB 2YHAA 3R9PA 3V4IA 3WNEA 3BZCA 1SL1A 2G8IA 3OJSA 2JLEA 1WNSA 3PUFA 5AQJA 4FZYA 1ZBFA 3ZX0A 1DKGD 4TSXA 5JS1A 1VSKA 3QERA 3V6DA 4H8KA 4B9NA 4FZXC 4E7LA 5FRMA 1W0HA 3MWPA 3OVNA 4BRLA 3CIPA 3PSIA 3DWLA 4J2BA 1K8KB 3RRHA 1IO2A 2BGGA 3GG4A 2Z1JA 4BC2A 3PX4A 3NE6A 3P5JA 4JKFA 4CEAA 1WSJA 1XWLA 3VQ9A 3I8DA 1J53A 3CM6A 4IJAA 1KRPA 3CFPA 3P4IA 4CHPA 3CERA 4GV3A 2E2PA 3O3GA 4KAZA 3HPHA 3CCEN 5C0YA 4WF9L 2HBLA 1RTDA 1YJ9N 2F9TA 2OPQA 1RT1A 4E1JA 1XC9A 1HRHA 3G6EN 1XHXA 4IO8A 4A62A 3PO5A 2FLOA 1V4TA 4ZHRA 5J1EA 1NK6A 1EETA 1RGIA 3SUQA 2FC0A 1Q18A 1X9JA 4BRHA 4C1NI 4YOWA 4KH5A 4DTRA 4I9QA 3QB0A 4IDHA 3V9ZA 3UIQA 5E26A 3T7ZA 3H6EA 1QQOA 3A0IX 3AGRA 4B1XB 5HBMA 3DXKA 4N5SA 3SQ2A 5ADXA 3O80A 1VHXA 4IDKA 1BQMA 2GBZA 4A57A 3SK3A 1VQ8N 1C0UA 2IIRA 5E84A 3QETA 3WT0A 4Z4EA 4O8KA 4DF8A 1BUPA 1T44A 1VQMN 4A5BA 1S22A 4IG3A 4LF8K 3DJCA 1WB9A 1NMNA 4B1VA 3R3LA 1K8AO 2QKBA 3RMDA 1WLJA 3QINA 1YTAA 3LPUA 3AVBA 3HP9A 4CD3A 1YI2N 3LM2A 3ZT1A 4R5PA 1YITN 4C8KA 2O8EA 3DYAA 3L2UA 3PO4A 1QSSA 4DCHA 1RFQA 3T1HK 4KKOA 4B1YB 1X3NA 4I6MA 4GKKK 2KKZA 4I7FA 3RR7A 2OANA 1EXQA 3CI5A 5JVHL 3SBTA 1VQ5N 5C2DA 4JKEA 3B6PA 4DR3K 3D7EO 4I2QA 2YKMA 2ZF5O 4BDYA 4CI6A 1K9MO 1KLMA 4K43A 1OH7A 4Q5VA 1TYQA 4B9UA 1Y97A 1GOAA 3ZETB 4JI3K 1J6ZA 3ID6A 5GADP 4BQLA 3CFRA 1NK9A 1BISA 1P8ZA 1RT2A 4XH1A 3THVA 4IOXA 3OYJA 1VQ9N 2A1SA 3IKMA 5HRNA 5LJWA 3ZT0A 2YKNA 2Q36A 3RMBA 1ZC6A 3VQ5A 4KREA 2QI2A 3FZMA 4JI5K 3CJ9A 2IAJA 4DTNA 1S5JA 4HTLA 3CD6N 4GVMA 2ZD1A 3L2VA 2FSNA 1XUPO 3C6AA 4LFAK 3HRGA 2G8FA 4Z4CA 4BRQA 3KK3A 1BDGA 2P9IB 2QW9A 3NAEA 1IH7A 3MN5A 3QESA 4E1MA 3VQ7A 4CGFA 1U2VA 4DTUA 3FZFA 1N36K 3CG7A 4NYFA 4XEIA 2I7NA 1YTUA 3G71N 4O5BA 4CIFA 2XO7A 2NRXA 1KFDA 5DM6L 4EAHD 1NJYA 3AVJA 3S3OA 3K5NA 1EX4A 5GAGP 4OX9K 3H3NO 3QEIA 3THXA 5AZIB 3LAMA 3DXMB 3AA3A 1ZYQA 3I33A 1QE1A 5LJVA 2NRWA 3EL2A 2O8FA 4I9LA 4CJRA 4FK4A 4YOXA 3QEVA 3HJFA 3EN9A 4JS5A 3IS9A 2E2OA 3ZSYA 3AVHA 1CXUA 3OS0A 2Q0UA 1HQEA 4DQSA 3FFKB 5J2MA 1MWMA 2HHQA 3K9KA 5AQHA 3EY1A 2VG5A 1T7PA 2BANA 4B8CA 1OH8A 4WQ5A 4FCYA 4IOAL 5EX5A 4FJ5A 1JLQA 2NRRA 3KK7A 3CCMN 4LC9B 3RWUA 3MXMA 4FL9A 4M42A 4AHSA 2O8CA 2ASOA 4DR6K 2F9WA 2AA4A 2QKKA 4NLBA 4JI6K 3CXCM 4KBOA 2OPPA 4JKDA 5C2FA 3OYFA 4QS7A 2P9PB 3AV9A 3R1XA 4CZJA 3ZT4A 1GLBG 4LF4K 4FLWA 4BGBA 1NGBA 2VG7A 3O9RA 4BRPA 4CJPA 3V9XA 3N4PA 4MO4A 1RILA 3BGRA 3TPQA 4X65K 2EHGA 3O08A 2PY5A 3TSPA 3VQQA 3TR8A 4A5AA 2G8WA 4HUEA 4QS8A 3UE5A 1ZBIA 2OTJN 2B4JA 4DQ8A 3U3GA 1I3AA 3QNOA 4CEZA 4K42A 3ZLJA 4CESA 1L5UA 4B08A 4WFBL 3EE8A 4A2AA 3L0QA 4U7BA 1EKEA 4WE1A 4AHVA 3I0SA 1TVRA 3HXMA 4BY9C 3KLHA 3E9LA 2FXUA 4F8RA 4FJXA 4OLAA 1HNWK 1C0GA 1NGIA 4DUZK 3RSEB 4CD1A 1GLAG 3CM5A 3J81O 1JCGA 5AQTA 3EZ5A 5KI6A 4M3WA 1RT7A 4IG0A 3T19A 2CGKA 4DSFA 3H1QA 2QA4N 1IG9A 3JSMA 3VTIA 4YHHK 4BRCA 3VA0A 3VQDA 4LF9K 4FW1A 2JWKA 2RN2A 1ILYA 2ITMA 4FZZA 1TKZA 3U6FA 4GMJB 4M63C 1D8YA 4FJMA 2FF6A 3NH0A 4CIEA 3SCXA 3PV8A 5CZ2A 4MLHA 1JJ2M 4BC4A 2QWLA 3BF1A 4FYDA 3DI6A 1GOBA 3LZJA 4BRKA 3LDOA 5LL6Z 3VTHA 5F0XA 3MX2A 2HF3A 2Q1NA 4UQGA 3O4WA 4YOYA 4WQ5C 4B3TK 2QWNA 5DM7L 4FM0A 3FGUA 3NHGA 1XC3A 3WXMB 1SV5A 3DOKA 4B1UB 3NF7A 2OTLN 4DR2K 3VEXA 3D0PA 2G8UA 5C15A 3OYBA 4BRFA 1DGKN 2P9NA 3K5MA 1KVCA 3FZKA 1KAYA 4YFUA 4M45A 3ENOA 1T3VA 3UB5A 1VQLN 4LH5A 4EIAA 3OBWA 2OYQA 1TKTA 4CEEA 1XMOK 1L3VA 4HWIA 3TAPA 4FJ8A 4B3SK 4JI0K 4CJ5A 3J7AP 4M41A 2KFNA 3RTVA 3MDQA 4KHUA 2OZMA 3HT3A 3TAFA 3V81A 1TL3A 3SPZA 4CHOA 1NGDA 2O4IA 4CEBA 1CZ9A 3OTOK 1M90O 3UKRA 3ZYYX 4CGHA 1U04A 2ETJA 4FLVA 1HNXK 3ZEUA 3NF6A 1Q9XA 3D2FA 3HVTA 1L3SA 3ALYA 1U47A 4UY8O 1HJOA 2YCHA 3UKUA 4E19A 2YHWA 2KW4A 5C25A 1NM1A 1NMDA 5DMRA 3M8PA 5AQYA 1IKXA 4XH5A 4EFHA 4JRQA 4IJNA 2E2QA 5AJ3K 4FLTA 1C0TA 4BRIA 4F2RA 1Y64A 2Q97A 3KHYA 4CF2A 3VETA 4DTOA 4PKHA 3EEQA 4O4GA 4CJSA 4RW7A 2WC9A 1WSFA 2HHWA 4DSKA 2A41A 4FJKA 3LZIA 3TWHA 3CF5L 3VQCA 3QFPA 2BDPA 1YVNA 2F7TA 4AILC 4B9QA 5E41A 3NH1A 1JKHA 4PKGA 4BROA 4FJIA 5J2QA 2NRZA 3THWB 1TL1A 3K2PA 1N34K 1ZBSA 1LV5A 3KD5E 4BVPA 4PA1A 4FVUA 4PUOA 4GNIA 3PY8A 2CH6A 4Z94A 1YXQA 4ID5A 1WAFA 3MMVA 3QEPA 4DV0K 2PYLA 4YDUA 2YNIA 4CGJA 4YNQA 2LSNA 3O4NA 2NZTA 1N6QA 2FBYA 1BHLA 3PX6A 3QBXA 3DXKB 2W6LA 3WQUA 4FXDA 4CHYA 4DU1A 4NXNK 5FPMA 4C23A 3F5TA 1XQSC 3GL1A 5HRRA 4AHUA 1RBTA 2VGMA 3QFUA 4WCEL 3V9SA 2HW3A 3U9ZA 2QWOA 2DFEA 2O4GA 5EVZA 1J5EK 4H03B 4LF7K 3AY9A 4DSIA 2HB5A 1IKVA 3DRPA 1LW0A 1QQMA 3NGYA 3SJJA 3ZCMA 1V4SA 2BE2A 1BL3A 3LDNA 1DEJA 1NGHA 1R0AA 2XY6A 3MEEA 1W7AA 3WXJA 3CC4N 5LMNK 3P83D 3M8SA 1NKCA 4EZ9A 1MWKA 1QTMA 1MA9B 4BR2A 4OPKA 3LM9A 3CJ1A 2G8VA 3LPTA 4E89A 3ZSVA 1NGCA 1HNVA 1TGOA 4CJ3A 4KHQA 3O5BA 3VERA 3VOVA 2O8EB 4CK2A 4NCBA 1U49A 3MEDA 3ATUA 3RR8A 4CJTA 4KB1A 2HHUA 3OYGA 3F9MA 4I6MB 4RW8A 4MO5A 3E66A 1OVQA 1IBLK 1QSYA 4KHSA 2ZJPL 2ATQA 1LCUA 4FK0A 3AO4A 3K5OA 1BO5O 4NLCA 4E7JA 1SKSA 2PAVA 3DLLL 3RRGA 2FSKA 3SQ4A 3OJUA 2E1YA 3CC2N 4CBWA 1NGFA 1TYQB 5HRSA 4CZMA 3OYMA 3GBTA 1C6VA 3IUCA 3LDSA 3OYHA 5M1QA 1RT6A 4H4OA 4CEFA 1X3MA 3DRSA 1WSHA 1NK7A 3T69A 4HUGA 5F1XA 4AHCA 1X1PA 1RBRA 2GX9A 4B3OA 3K59A 4CJEA 1C1BA 1T6CA 5KQ8A 4DQRA 3BY5A 1A5WA 1VSEA 3MN6A 3T3FA 2P9KA 3O9QA 3LDPA 4YDUC 5KQDA 2JGUA 5K14A 3VQAA 3HM9A 2O8DA 1U2VB 3SV4A 1TV6A 4OJRA 1VQKN 3DOLA 1F21A 4BR4A 2IVNA 4DFJA 3AA5X 3THYA 1IKYA 4YORA 3CQXA 1XMQK 1HNZK 4CZFA 2XRIA 2A42A 3P1GA 4BQZA 4AM7A 2HMIA 3THXB 3A5LC 4FM1A 3U3YA 1RNHA 3VN5A 2HF4A 1RBVA 3KK2A 5TKWA 1UAXA 3ULEA 4BR7A 2XHBA 1NJIO 1LAVA 2AP1A 4CBUA 4DFKA 3M6GA 4DHYA 3ZSXA 4CZEA 4BGAA 1BA1A 4K41A 3A2FA 4JAXA 2A5XA 2E6MA 3ZSWA 4PY5A 2P5OA 4DWIA 1SL2A 3WNGA 2P9LA 4CGIA 4YY3K 1NK8A 3PX0A 2ASMA 5FLXO 3H08A 4JHDA 3NH2A 1RCHA 3AA2A 3ZT2A 2A40A 3QO9A 4PQUA 4F3OA 2QM1A 4ZTFA 2DFHA 4JI7K 2D0CA 2IS3A 3ISNC 2O8CB 3CQ8A 3O9SA 3VQBA 1LWFA 3I8BA 3OYAA 1NNEA 3AA4A 1X9MA 4FWLA 2QTDA 1BG3A 2QXFA 3VQ4A 5J2PA 5KPZA 5M1NA 2F4VK 3SAGA 3AVGA 3DMJA 3FE1A 5GIOA 4H5VA 1KAZA 3FLCO 5FRNA 2F96A 3HI0A 4N47A 3L2RA 1BIUA 1CLQA 3BEXA 3EE9A 2GWKA 4FLZA 3N4QA 4CJ4A 4PWDA 3DLRA 4BACA 1JXBA 3SYZA 3VESA 4A61A 2QWMA 1QZ6A 3ZT3A 3M8QA 4J2AA 1VSJA 5HL7L 1NOYA 1MDUB 4DV4K 2Z1HA 1TK8A 2CGJA 1A5VA 3MN9A 4BE1A 4H5NA 4XIUA 1OKJA 5AQUA 4O0IA 3SUOA 3VPZA 4A59A 3CQYA 1ASVA 3FR0A 1VRTA 2W40A 2A1RA 1EWQA 2WUSA 4ISGA 3CJ7A 4OLBA 1R59O 3CCLN 4OGEA 3SPYA 3QMLA 4FOEA 5GINA 1KAXA 2NUBA 3HSCA 1BU6O 4JI2K 2OA8A 3NMUA 3CMEN 4GKJK 2GV9A 1D4XA 3TTCA 4FWMA 2CH5A 4JV5K 5AQGA 4DSLA 2QWPA 3WXIA 3HYFA 4FWQA 4HCBA 4N41A 1TKXA 2UYTA 4MDBA 4JNEA 3B8AX 1O13A 4JS4A 5HLFA 3LP3A 3VGMA 5KPTA 4W5QA 3FZLA 4DTXA 4V19S 3CJBA 3MWTA 4M3RA 3U9DA 3NGIA 4BREA 4O44A 4CHNA 2Q0RA 3CCJN 3TTDA 1TKDA 3E01A 4CJ7A 4J8FA 5FPEA 3S41A 1VRUA 5JLHA 3VGKA 3KWIA 4DS5A 1BGXT 2GEMA 2P9NB 5C24A 3VF4A 1JLEA 4L3QA 3TSQA 1S1VA 4IEIA 4RW6A 3IRXA 3QIPA 1LWCA 1RBSA 5AQIA 2VGNA 1ATNA 4KTQA 1WSIA 5MLCQ 4AHTA 2F8SA 1GLEG 4DF4A 2NRVA 3T1AA 1B9FA 4HCCA 4FJLA 5AZJA 3UKRB 4BRMA 4ELVA 3WEEA 1KSPA 3HO1A 1HKCA 2NNWA 3ZEUB 2O8BA 1RT4A 2DY4A 3PIOL 3D2FB 1DTTA 3BZKA 5AQOA 1QHTA 4MLEA 1NGEA 1A5XA 1U48A 3MXIA 3P39A 1VQON 3TAGA 4BVOA 2RPIA 3KLIA 5H1SQ 2YNGA 4U67L 5BRHA 1HLUA 4E1NA 4KHPK 1TAUA 4AH9A 3FZHA 4H0PA 1VSLA 4K8XA 1I94K 3OS2A 2YX6A 3Q7CA 1REVA 2ZGZA 5AR0A 2D5RA 2DFFA 3NBPA 4ID1A 3WQTA 4GW6A 4IWVA 4J2EA 3AO5A 4JD2A 1WN7A 5EU7A 5SWMA 1O1WA 1JL1A 4N76A 3IG1A 3J80O 2PBDA 1LW2A 4BDZA 2PFUA 4FJ7A 4BRAA 4WQ4A 3HOTA 4CECA 4KI4A 3WXKA 3SAFA 2GUPA 3L4IA 5I42A 4H4MA 3ZSRA 1P90A 4CF8A 1IJJA 3HPGA 3O6WA 1UA0A 3KD1E 1EWRA 4R79A 1L3TA 4CJQA 2KZMA 3L6QA 4B3MK 3E9OA 2GUIA 4H0TB 4HUFA 4CF1A 5KPRA 2GTDA 4KRFA 1C1CA 3G0ZA 1KLNA 1SKRA 1TK5A 1SKWA 1FKPA 3O9UA 3EKUA 4ICLA 3NVKA 4B9LA 3R8EA 3C6TA 3AAQA 2KFZA 4KTZA 2HHVA 2EX3A 3OS1A 1BOTO 1U45A 1X9WA 2HHXA 4CVNE 1LAWA 4K0KK 1RDBA 4JKGA 4DFPA 3VQEA 1FKOA 1VQ4N 3EZWA 1ZBHA 1BIZA 5SZTA 5CY4A 2P51A 3MXJA 1KVBA 4E3SA 4LD0A 5FPNA 3OHRA 2OCEA 4AM6A 4B1WB 4DLEA 4B1ZA 1LOTB 4O0JA 4B8AB 1C0MA 1SQKA 4H0YB 3RVCA 1Q81O 4EP5A 1IG8A 5EY4A 4FJJA 5HP1A 4NB4A 4FOIA 3K58A 1HKGA 2FSJA 4PHTX 2XY7A 3A5OC 3ULDA 4DQQA 3AVAA 4BR9A 2DTUA 1HNIA 3TANA 3E9PA 3PSFA 2RHKA 4HHTA 2GWJA 1YAGA 3V9UA 3LWMA 4DTPA 1BCMA 4OGCA 5AQFA 5ELZA 3DXMA 3A5MC 3J8AA 3K5LA 4E7IA 3EO3A 4FWKA 4QCLA 4CJKA 1QVFM 1VQ6N 3L3UA 1NG9A 1YF5L 1ZXOA 4C8OA 4EHTA 1S1UA 1W9HA 1Z6RA 3M8RA 4JK9A 4FJ9A 3G25A 1Z05A 2E88A 1BA0A 2ZJQL 4DSJA 2E1ZA 2D4WA 2ZM6K 1E3MA 4PKIA 2RF2A 1KFSA 4BDPA 4FO0A 4DLGA 1YT3A 4N56A 4WQ4C 4Q0BA 4L8RB 2A3ZA 1X9SA 3IDHA 3HM8A 5AFUH 4NCAA 1WOQA 3VQPA 4AQYK 5AQLA 3C94A 3OYIA 2IOCA 3AVNA 5BRDA 3H3OB 4NYNA 4I2PA 5AQPA 1CXQA 3HBTA 2W42A 2H3GX 3NGZA 1IBMK 1T05A 2EWSA 4LFBK 1UA1A 4H5RA 2YJFA 3THYB 1K6YA 3IAYA 4DR5K 4KHYA 2NRHA 2VWJA 4DB3A 1S9GA 1DT9A 5CHIA 3LALA 5AQNA 4CZIA 4CZLA 1L3UA 5AQXA 4BE0A 3SZ2A 4Z4IA 4DR1K 4CJUA 4IXCA 2P9UA 3S9HA 3V1RA 3ULEB 4CGGA 2VWKA 3K9JA 1Q7YO 4W5NA 3OYLA 1XHZA 3R6MA 2HHSA 4FLUA 4OKJA 1GLDG 5IWAK 1NKBA 5BPNA 4DR7K 3E1YA 4IFVA 1WBDA 4FVMA 4K8ZA 3HOSA 1YIJN 5CYMA 3SNNA 1U6ZA 4DTSA 2P9LB 1GLFO 1J5OA 2OPSA 3JAMO 4JK7A 3H1VX 3C0BA 4IO9L 1IBKK 5BPMA 4JHDB 2NRTA 4NO7A 1ZBUA 3SBGA 2VQFK 2HVHA 3IMXA 4M3YA 3M1FA 1D5AA 1QVGM 3BP8A 2FBXA
chains in the Genus database with same CATH topology
1SL2A 3WNGA 4CGIA 3AA3A 3AO1A 1ZYQA 4M3XA 1QE1A 1NK8A 3PX0A 4LSLA 1NKEA 4I9LA 3C6UA 3WNHA 4CJRA 4FK4A 3L3VA 3H08A 2ZQBA 3AVFA 4LH4A 3QEVA 1NJZA 3HJFA 4JS5A 3IS9A 4BWJA 3SUNA 3NH2A 1Z25A 4CIGA 1RCHA 3AA2A 2Q3SA 3ZSYA 3ZT2A 1ZBLA 2Z1GA 3AVHA 3QO9A 4OKEA 4PQUA 1CXUA 4F3OA 3QEWA 3OS0A 4RW9A 4DTJA 3DRRA 1GOCA 3OY9A 1HQEA 4DQSA 4ZTFA 1N5YA 2DFHA 5J2MA 2D0CA 2IS3A 3ISNC 2HHQA 1TAQA 3MEGA 4DG1A 3CQ8A 3EY1A 2VG5A 5DK5A 1T7PA 2BANA 4B8CA 4M3UA 3VQBA 2AJQA 1LWFA 1CZBA 3OYAA 4F2SA 3AA4A 3DLKA 1JLFA 4JLHA 1X9MA 3ASMA 4KTWA 2WOMA 4KV8A 2QXFA 3VQ4A 4FCYA 5J2PA 3S3NA 4FJ5A 4W5RA 3CYMA 1JLQA 1S1WA 1ASUA 1NK4A 4KHNA 3AVGA 3DMJA 4IFYA 4CFAA 3V9WA 3MXMA 3RWUA 3O3FA 3QLHA 3VQ8A 4AHSA 4M42A 1S6PA 3TI0A 3L8BA 5FRNA 3L2WA 3NDKA 3NCIA 3KTQA 5D3GA 2KQ2A 1VSHA 2F96A 1RBUA 4CHQA 2QKKA 4N47A 2X6NA 4F3TA 2OPRA 3L2RA 2PYJA 1BIUA 2OPPA 3OYFA 1CLQA 4O55A 4FLZA 3TAEA 3AV9A 3SQ0A 1Z26A 3ZT4A 4CJ4A 4PWDA 4DU4A 3DLRA 4BACA 1JXBA 4AHRA 4FLWA 3SUPA 1XI1A 1HYSA 4CJWA 2VG7A 4CJPA 3V9XA 3SYZA 1RTHA 2D0BA 1RILA 3BGRA 2B6AA 4C8MA 3MAQA 1NK5A 1KVAA 2EHGA 3RMAA 3ZT3A 3HK2A 2PY5A 3VQQA 3KLGA 2I5JA 1J9AA 1RDDA 3M8QA 1NJWA 3D45A 3DM2A 4J2AA 1VSJA 3OYCA 1YVUA 3TR8A 3F73A 1NOYA 4HUEA 2G8WA 1ZBIA 2Z1HA 1TK8A 4RG8A 2B4JA 3U3GA 1I3AA 3QNOA 4CEZA 1A5VA 1RT3A 1BQNA 4BE1A 2Y1IA 4KB0A 4CESA 4XIUA 1L5UA 4B08A 3I0RA 4MQ3A 1HYZA 2ZE2A 4O0IA 1EKEA 3SUOA 4WE1A 1DTQA 4AHVA 3I0SA 1WSEA 1TVRA 3AVLA 3HXMA 1SL0A 3KLHA 1ASVA 3AVKA 3SV3A 4FLXA 1VRTA 2A1RA 4F8RA 4J2DA 4FJXA 4OLAA 4C8LA 4W5OA 3KLEA 3ITHA 1JLBA 4OLBA 4OGEA 4DFMA 4CF0A 3CM5A 3SPYA 1FK9A 4CJVA 4FJNA 2NUBA 1KCFA 3EZ5A 1LWEA 5KI6A 4M3WA 3O4QA 1RT7A 4IG0A 3T19A 2OA8A 3V1OA 4DSFA 4FJHA 3LWLA 2GV9A 4FM2A 4EZ6A 4CJLA 1IG9A 3JSMA 4CJFA 4Z4FA 4DSLA 3NF8A 3VA0A 4E7HA 3VQDA 3QEXA 2XY5A 3HYFA 4HCBA 4DSEA 2IDOA 4N41A 1TKXA 4FW1A 2RN2A 4EP4A 1RTIA 2PZSA 1TK0A 4KO0A 4BWMA 4FZZA 3QNNA 3AVMA 1DLOA 1TKZA 4CK1A 4JS4A 4Z4HA 3U6FA 3LP3A 5HLFA 4GMJB 3DLBA 1RDAA 1HPZA 4LY7A 4W5QA 3KIOA 1VSMA 2VG6A 1D8YA 4DTXA 4FJMA 3NH0A 2YHBA 4OPJA 1VSFA 4CIEA 3SCXA 4M3RA 3NGIA 5CZ2A 3HSTB 3PV8A 4MFBA 3KKRA 4O44A 4CHNA 3RMCA 1QQCA 1TKDA 4FYDA 4W5TA 3DI6A 3E01A 2HVIA 2WONA 1GOBA 3LZJA 3TABA 1VRUA 2FBTA 4OKKA 1BGXT 4CK3A 4DS5A 2P5GA 3OYDA 1FXXA 5C24A 4CFBA 4CEQA 1JLEA 1D9DA 3KKSA 1KTQA 1S1VA 4RW6A 3IRXA 3QIPA 1LWCA 5KGWA 4CHZA 4CEDA 1RBSA 4UQGA 4F4KA 5FDLA 1D9FA 3KLFA 4KTQA 1WSIA 2P1JA 4FM0A 4AHTA 3NHGA 1I39A 3HPOA 1SV5A 3DOKA 4E7KA 3NF7A 3TARA 4DF4A 4ELTA 2F8SA 4RW4A 1BI4B 3D0PA 4B9TA 2OYQA 3F9KA 3T1AA 1VSDA 2Y1JA 2G8UA 3DLHA 2HNDA 3OYBA 4HVJA 1B9FA 5HRPA 1QS4A 3K5MA 4DU3A 4HCCA 4FJLA 1KVCA 2HHTA 4ELVA 4Y1CA 1JLGA 1KSPA 4YFUA 1QSLA 4M45A 3HO1A 2XY8A 1J54A 2IC3A 1RT4A 4LH5A 4CEOA 1S1XA 1VK0A 3LAKA 1DTTA 1TKTA 5HROA 4CEEA 3OYEA 3AVCA 3LP0A 1QHTA 1UWBA 3TAPA 4ZTJA 4BE2A 1L3VA 2FBVA 3LP2A 4FJ8A 1A5XA 1U48A 2QK9A 4CJ5A 3MXIA 2G8KA 2ITGA 4M41A 2KFNA 3RTVA 4KHWA 1WAJA 5KRSA 3TAGA 2OZMA 2RPIA 3HT3A 3TAFA 4KHUA 1BI4A 3G10A 1TL3A 3V81A 3SPZA 3AO2A 4Z0UA 4CGDA 4CHOA 3S3MA 4FK2A 5KTQA 2O4IA 3KLIA 2YNGA 4CEBA 1CZ9A 2YHAA 4E1NA 1S9EA 1NJXA 4CGHA 1TAUA 4AH9A 1U04A 2ETJA 1VSLA 4FLVA 4K8XA 3V4IA 3WNEA 3OS2A 3NF6A 1Q9XA 1REVA 2YV0X 3HVTA 1SL1A 1L3SA 4CF9A 3ALYA 1U47A 2G8IA 2D5RA 3OJSA 2X78A 2DFFA 4E19A 2HNYA 3KK1A 3NBPA 2JLEA 1T03A 1ASWA 1WNSA 2KW4A 3PUFA 4ID1A 5C25A 4FZYA 1ZBFA 4GW6A 3M8PA 4TSXA 5DMRA 5JS1A 1IKXA 1VSKA 1WSGA 3NFAA 4JRQA 3QERA 3AO5A 3TAQA 4J2EA 1WN7A 5KRTA 4FLYA 5EU7A 5SWMA 2KTQA 1O1WA 3V6DA 4H8KA 1JL1A 4B9NA 4FZXC 4FLTA 4E7LA 1C0TA 5FRMA 4N76A 1W0HA 4B9MA 3IG1A 1NOZA 3OVNA 1LW2A 4CE9A 4F2RA 4CF2A 4BDZA 4FJ7A 4DTOA 4O4GA 4CJSA 1T8EA 4RW7A 1WSFA 3TAMA 4CECA 2HHWA 4DSKA 4KI4A 4J2BA 3RRHA 4FJKA 1JL2A 3LZIA 3TWHA 5I42A 4H4MA 3ZSRA 1IO2A 3VQCA 1HMVA 4E0DA 2BGGA 2BDPA 4QAGA 4CF8A 4AILC 3HPGA 5E41A 2Z1JA 3NH1A 1JKHA 1UA0A 3PX4A 3NE6A 3P5JA 3KD1E 1L3TA 4CJQA 4CEAA 4FJIA 5J2QA 2KZMA 1WSJA 1XWLA 3VQ9A 3I8DA 1J53A 1TL1A 2GUIA 3CM6A 3K2PA 3HP6A 3CFPA 1LV5A 4HUFA 1KRPA 3KD5E 4PA1A 4CF1A 4CHPA 4PUOA 4KRFA 3PY8A 1C1CA 3G0ZA 3O3GA 1KLNA 4KAZA 3HPHA 4ID5A 1SKRA 5KGXA 1TK5A 1SKWA 1FKPA 1WAFA 5C42A 1RTDA 4CCHA 3QEPA 2PYLA 5J2NA 3SI6A 2OPQA 1RT1A 4ICLA 1XC9A 1U4BA 2YNIA 4CGJA 4B9LA 4FJGA 3C6TA 4YNQA 1HRHA 4FW2A 4KTZA 1XHXA 2KFZA 2KZZA 2LSNA 2HHVA 2EX3A 3O4NA 3PO5A 1N6QA 3OS1A 2FBYA 5FROA 1BHLA 4ZHRA 1Q8IA 4Y1DA 5J1EA 3PX6A 4M3TA 2F8TA 3LP1A 1EETA 1NK6A 1U45A 3SUQA 1X9WA 2HHXA 1LAWA 4FXDA 4CHYA 2FC0A 4DU1A 1RDBA 4DFPA 5HRRA 4DTRA 4I9QA 4AHUA 3V9ZA 1RBTA 3V9SA 3VQEA 1FKOA 4DMNA 3UIQA 2HNZA 1ZBHA 2HW3A 1BIZA 5SZTA 2DFEA 2O4GA 5CY4A 4DTMA 2P51A 2YNHA 1KVBA 3MXJA 4LD0A 4E3SA 2DY4A 4DSIA 4DLEA 2HB5A 1IKVA 3DRPA 5I3UA 4O0JA 4B8AB 1C0MA 3LANA 1LW0A 3NGYA 5CYQA 5HBMA 3SJJA 3ZCMA 2E4LA 4IKFA 2BE2A 4N5SA 1BL3A 5JS2A 3SQ2A 3MECA 4EP5A 1R0AA 2XY6A 3MEEA 4IDKA 1BQMA 2GBZA 4NCGA 4FJJA 5HP1A 1C0UA 3P83D 3M8SA 3K58A 1NKCA 4EZ9A 3V1QA 3QETA 1QTMA 2OZSA 4KFBA 4OPKA 2XY7A 2G8VA 1Q9YA 4DF8A 1VSIA 3ULDA 4DQQA 4Z4EA 3AVAA 1BCOA 3LPTA 2DTUA 1HNIA 4E89A 3ZSVA 3TANA 1B92A 1HNVA 1TGOA 4CJ3A 4HHTA 4OVLA 4KHQA 3C95A 5T7BA 4KI6A 4CK2A 4IG3A 3V9UA 3LWMA 4DTPA 3MEDA 1U49A 1BCMA 4NCBA 2RKIA 4OGCA 3RR8A 3VQ6A 4CJTA 4KB1A 2HHUA 3NF9A 3OYGA 1MU2A 3L2QA 3QIOA 4RW8A 3K5LA 2QKBA 3K57A 4E7IA 1QSYA 3RMDA 4QCLA 1WLJA 3QINA 1G15A 1YTAA 3LPUA 4KHSA 3AVBA 3HP9A 4CJKA 3AVIA 3FFIA 4Z4GA 3L3UA 2ATQA 3ZT1A 4R5PA 4C8OA 4FK0A 1S1UA 3AO4A 1W9HA 3K5OA 3M8RA 4E7JA 2G8HA 4C8KA 4FJ9A 1SKSA 3DYAA 3RRGA 3L2UA 3PO4A 1QSSA 4DSJA 3SQ4A 3OJUA 1ITGA 4KKOA 2RF2A 3HL8A 4I7FA 1HQUA 3DLGA 3RR7A 1KFSA 2X6SA 5HRSA 4BDPA 1EXQA 3JYTA 3OYMA 3KJVA 1HJRA 1C6VA 2D0AA 4DLGA 4DQIA 1YT3A 4N56A 3LDSA 3ZSQA 4Q0BA 1S1TA 3EYZA 4L8RB 4B9SA 3B6PA 2R7YA 3OYHA 3ZSOA 3SQ1A 1X9SA 1RT6A 4I2QA 2YKMA 4H4OA 4CEFA 2B5JA 4BDYA 1EP4A 3DRSA 3O3HA 1WSHA 1NK7A 4NCAA 4HUGA 3VQPA 4IBNA 2IGIA 5CZ1A 3C94A 3OYIA 1KLMA 2IOCA 3AVNA 4Q5VA 4B9UA 4AHCA 1X1PA 4NYNA 4I2PA 1RBRA 1CXQA 1Y97A 1GOAA 2W42A 1IKWA 4B3OA 3NGZA 3CFRA 3K59A 1JLAA 1T05A 1NK9A 3B6OA 1BISA 1RT2A 2X74A 1C1BA 4CJEA 4DQRA 1UA1A 3AO3A 4ELUA 1C1AA 4HTUA 3THVA 1K6YA 1A5WA 3OYJA 3IAYA 4KHYA 1B9DA 2A1SA 1VSEA 2YNFA 3WNFA 4CERA 1S6QA 5HRNA 3ZT0A 2YKNA 2VWJA 3T3FA 3RMBA 3CFOA 4KREA 3VQ5A 1S9GA 2IAJA 4DTNA 1S5JA 3LALA 3HVRA 2JGUA 5K14A 1L3UA 4GVMA 4BE0A 3VQAA 3HM9A 3SZ2A 1RDCA 3SV4A 4Z4IA 1TV6A 4KPYA 4OJRA 4CFDA 3VA3A 2ZD1A 4CJUA 2Z1IA 3S9HA 3V1RA 3L2VA 3DOLA 4CGGA 1F21A 2VWKA 4W5NA 1SUQA 3OYLA 1XHZA 4DFJA 2G8FA 4Z4CA 3AA5X 4G1QA 4FLUA 4OKJA 1UOCA 2HHSA 2E6LA 4DS4A 4B9VA 1NKBA 3KK3A 1IKYA 4LSNA 4IFVA 4FVMA 2XRIA 3ZSZA 4K8ZA 1NK0A 3NAEA 3P1GA 1JXEA 1IH7A 3BDPA 5CYMA 3OYNA 3QESA 3SNNA 4E1MA 2HMIA 4JRPA 3VQ7A 4FM1A 1RNHA 3VN5A 4CGFA 3OYKA 4DTSA 3U3YA 4DTUA 1J5OA 4CFCA 1RBVA 2OPSA 3KK2A 3CG7A 4NYFA 1UAXA 4C8NA 4QOZB 2XHBA 1LAVA 1YTUA 4O5BA 1RT5A 4CIFA 2XO7A 4DFKA 1HYVA 3DLEA 1KFDA 1JLCA 3ZSXA 1NJYA 4DQPA 3AVJA 3S3OA 1RTJA 3K5NA 1EX4A 1ZBUA 3A2FA 2HVHA 4M3YA 1D5AA 2E6MA 3ZSWA 3QEIA 4PY5A 2P5OA 4DWIA 3LAMA 2FBXA 4M3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL2 A;  3WNG A;  4CGI A;  3AA3 A;  3AO1 A;  1ZYQ A;  4M3X A;  1QE1 A;  1NK8 A;  3PX0 A;  4LSL A;  1NKE A;  4I9L A;  3C6U A;  3WNH A;  4CJR A;  4FK4 A;  3L3V A;  3H08 A;  2ZQB A;  3AVF A;  4LH4 A;  3QEV A;  1NJZ A;  3HJF A;  4JS5 A;  3IS9 A;  4BWJ A;  3SUN A;  3NH2 A;  1Z25 A;  4CIG A;  1RCH A;  3AA2 A;  2Q3S A;  3ZSY A;  3ZT2 A;  1ZBL A;  2Z1G A;  3AVH A;  3QO9 A;  4OKE A;  4PQU A;  1CXU A;  4F3O A;  3QEW A;  3OS0 A;  4RW9 A;  4DTJ A;  3DRR A;  1GOC A;  3OY9 A;  1HQE A;  4DQS A;  4ZTF A;  1N5Y A;  2DFH A;  5J2M A;  2D0C A;  2IS3 A;  3ISN C;  2HHQ A;  1TAQ A;  3MEG A;  4DG1 A;  3CQ8 A;  3EY1 A;  2VG5 A;  5DK5 A;  1T7P A;  2BAN A;  4B8C A;  4M3U A;  3VQB A;  2AJQ A;  1LWF A;  1CZB A;  3OYA A;  4F2S A;  3AA4 A;  3DLK A;  1JLF A;  4JLH A;  1X9M A;  3ASM A;  4KTW A;  2WOM A;  4KV8 A;  2QXF A;  3VQ4 A;  4FCY A;  5J2P A;  3S3N A;  4FJ5 A;  4W5R A;  3CYM A;  1JLQ A;  1S1W A;  1ASU A;  1NK4 A;  4KHN A;  3AVG A;  3DMJ A;  4IFY A;  4CFA A;  3V9W A;  3MXM A;  3RWU A;  3O3F A;  3QLH A;  3VQ8 A;  4AHS A;  4M42 A;  1S6P A;  3TI0 A;  3L8B A;  5FRN A;  3L2W A;  3NDK A;  3NCI A;  3KTQ A;  5D3G A;  2KQ2 A;  1VSH A;  2F96 A;  1RBU A;  4CHQ A;  2QKK A;  4N47 A;  2X6N A;  4F3T A;  2OPR A;  3L2R A;  2PYJ A;  1BIU A;  2OPP A;  3OYF A;  1CLQ A;  4O55 A;  4FLZ A;  3TAE A;  3AV9 A;  3SQ0 A;  1Z26 A;  3ZT4 A;  4CJ4 A;  4PWD A;  4DU4 A;  3DLR A;  4BAC A;  1JXB A;  4AHR A;  4FLW A;  3SUP A;  1XI1 A;  1HYS A;  4CJW A;  2VG7 A;  4CJP A;  3V9X A;  3SYZ A;  1RTH A;  2D0B A;  1RIL A;  3BGR A;  2B6A A;  4C8M A;  3MAQ A;  1NK5 A;  1KVA A;  2EHG A;  3RMA A;  3ZT3 A;  3HK2 A;  2PY5 A;  3VQQ A;  3KLG A;  2I5J A;  1J9A A;  1RDD A;  3M8Q A;  1NJW A;  3D45 A;  3DM2 A;  4J2A A;  1VSJ A;  3OYC A;  1YVU A;  3TR8 A;  3F73 A;  1NOY A;  4HUE A;  2G8W A;  1ZBI A;  2Z1H A;  1TK8 A;  4RG8 A;  2B4J A;  3U3G A;  1I3A A;  3QNO A;  4CEZ A;  1A5V A;  1RT3 A;  1BQN A;  4BE1 A;  2Y1I A;  4KB0 A;  4CES A;  4XIU A;  1L5U A;  4B08 A;  3I0R A;  4MQ3 A;  1HYZ A;  2ZE2 A;  4O0I A;  1EKE A;  3SUO A;  4WE1 A;  1DTQ A;  4AHV A;  3I0S A;  1WSE A;  1TVR A;  3AVL A;  3HXM A;  1SL0 A;  3KLH A;  1ASV A;  3AVK A;  3SV3 A;  4FLX A;  1VRT A;  2A1R A;  4F8R A;  4J2D A;  4FJX A;  4OLA A;  4C8L A;  4W5O A;  3KLE A;  3ITH A;  1JLB A;  4OLB A;  4OGE A;  4DFM A;  4CF0 A;  3CM5 A;  3SPY A;  1FK9 A;  4CJV A;  4FJN A;  2NUB A;  1KCF A;  3EZ5 A;  1LWE A;  5KI6 A;  4M3W A;  3O4Q A;  1RT7 A;  4IG0 A;  3T19 A;  2OA8 A;  3V1O A;  4DSF A;  4FJH A;  3LWL A;  2GV9 A;  4FM2 A;  4EZ6 A;  4CJL A;  1IG9 A;  3JSM A;  4CJF A;  4Z4F A;  4DSL A;  3NF8 A;  3VA0 A;  4E7H A;  3VQD A;  3QEX A;  2XY5 A;  3HYF A;  4HCB A;  4DSE A;  2IDO A;  4N41 A;  1TKX A;  4FW1 A;  2RN2 A;  4EP4 A;  1RTI A;  2PZS A;  1TK0 A;  4KO0 A;  4BWM A;  4FZZ A;  3QNN A;  3AVM A;  1DLO A;  1TKZ A;  4CK1 A;  4JS4 A;  4Z4H A;  3U6F A;  3LP3 A;  5HLF A;  4GMJ B;  3DLB A;  1RDA A;  1HPZ A;  4LY7 A;  4W5Q A;  3KIO A;  1VSM A;  2VG6 A;  1D8Y A;  4DTX A;  4FJM A;  3NH0 A;  2YHB A;  4OPJ A;  1VSF A;  4CIE A;  3SCX A;  4M3R A;  3NGI A;  5CZ2 A;  3HST B;  3PV8 A;  4MFB A;  3KKR A;  4O44 A;  4CHN A;  3RMC A;  1QQC A;  1TKD A;  4FYD A;  4W5T A;  3DI6 A;  3E01 A;  2HVI A;  2WON A;  1GOB A;  3LZJ A;  3TAB A;  1VRU A;  2FBT A;  4OKK A;  1BGX T;  4CK3 A;  4DS5 A;  2P5G A;  3OYD A;  1FXX A;  5C24 A;  4CFB A;  4CEQ A;  1JLE A;  1D9D A;  3KKS A;  1KTQ A;  1S1V A;  4RW6 A;  3IRX A;  3QIP A;  1LWC A;  5KGW A;  4CHZ A;  4CED A;  1RBS A;  4UQG A;  4F4K A;  5FDL A;  1D9F A;  3KLF A;  4KTQ A;  1WSI A;  2P1J A;  4FM0 A;  4AHT A;  3NHG A;  1I39 A;  3HPO A;  1SV5 A;  3DOK A;  4E7K A;  3NF7 A;  3TAR A;  4DF4 A;  4ELT A;  2F8S A;  4RW4 A;  1BI4 B;  3D0P A;  4B9T A;  2OYQ A;  3F9K A;  3T1A A;  1VSD A;  2Y1J A;  2G8U A;  3DLH A;  2HND A;  3OYB A;  4HVJ A;  1B9F A;  5HRP A;  1QS4 A;  3K5M A;  4DU3 A;  4HCC A;  4FJL A;  1KVC A;  2HHT A;  4ELV A;  4Y1C A;  1JLG A;  1KSP A;  4YFU A;  1QSL A;  4M45 A;  3HO1 A;  2XY8 A;  1J54 A;  2IC3 A;  1RT4 A;  4LH5 A;  4CEO A;  1S1X A;  1VK0 A;  3LAK A;  1DTT A;  1TKT A;  5HRO A;  4CEE A;  3OYE A;  3AVC A;  3LP0 A;  1QHT A;  1UWB A;  3TAP A;  4ZTJ A;  4BE2 A;  1L3V A;  2FBV A;  3LP2 A;  4FJ8 A;  1A5X A;  1U48 A;  2QK9 A;  4CJ5 A;  3MXI A;  2G8K A;  2ITG A;  4M41 A;  2KFN A;  3RTV A;  4KHW A;  1WAJ A;  5KRS A;  3TAG A;  2OZM A;  2RPI A;  3HT3 A;  3TAF A;  4KHU A;  1BI4 A;  3G10 A;  1TL3 A;  3V81 A;  3SPZ A;  3AO2 A;  4Z0U A;  4CGD A;  4CHO A;  3S3M A;  4FK2 A;  5KTQ A;  2O4I A;  3KLI A;  2YNG A;  4CEB A;  1CZ9 A;  2YHA A;  4E1N A;  1S9E A;  1NJX A;  4CGH A;  1TAU A;  4AH9 A;  1U04 A;  2ETJ A;  1VSL A;  4FLV A;  4K8X A;  3V4I A;  3WNE A;  3OS2 A;  3NF6 A;  1Q9X A;  1REV A;  2YV0 X;  3HVT A;  1SL1 A;  1L3S A;  4CF9 A;  3ALY A;  1U47 A;  2G8I A;  2D5R A;  3OJS A;  2X78 A;  2DFF A;  4E19 A;  2HNY A;  3KK1 A;  3NBP A;  2JLE A;  1T03 A;  1ASW A;  1WNS A;  2KW4 A;  3PUF A;  4ID1 A;  5C25 A;  4FZY A;  1ZBF A;  4GW6 A;  3M8P A;  4TSX A;  5DMR A;  5JS1 A;  1IKX A;  1VSK A;  1WSG A;  3NFA A;  4JRQ A;  3QER A;  3AO5 A;  3TAQ A;  4J2E A;  1WN7 A;  5KRT A;  4FLY A;  5EU7 A;  5SWM A;  2KTQ A;  1O1W A;  3V6D A;  4H8K A;  1JL1 A;  4B9N A;  4FZX C;  4FLT A;  4E7L A;  1C0T A;  5FRM A;  4N76 A;  1W0H A;  4B9M A;  3IG1 A;  1NOZ A;  3OVN A;  1LW2 A;  4CE9 A;  4F2R A;  4CF2 A;  4BDZ A;  4FJ7 A;  4DTO A;  4O4G A;  4CJS A;  1T8E A;  4RW7 A;  1WSF A;  3TAM A;  4CEC A;  2HHW A;  4DSK A;  4KI4 A;  4J2B A;  3RRH A;  4FJK A;  1JL2 A;  3LZI A;  3TWH A;  5I42 A;  4H4M A;  3ZSR A;  1IO2 A;  3VQC A;  1HMV A;  4E0D A;  2BGG A;  2BDP A;  4QAG A;  4CF8 A;  4AIL C;  3HPG A;  5E41 A;  2Z1J A;  3NH1 A;  1JKH A;  1UA0 A;  3PX4 A;  3NE6 A;  3P5J A;  3KD1 E;  1L3T A;  4CJQ A;  4CEA A;  4FJI A;  5J2Q A;  2KZM A;  1WSJ A;  1XWL A;  3VQ9 A;  3I8D A;  1J53 A;  1TL1 A;  2GUI A;  3CM6 A;  3K2P A;  3HP6 A;  3CFP A;  1LV5 A;  4HUF A;  1KRP A;  3KD5 E;  4PA1 A;  4CF1 A;  4CHP A;  4PUO A;  4KRF A;  3PY8 A;  1C1C A;  3G0Z A;  3O3G A;  1KLN A;  4KAZ A;  3HPH A;  4ID5 A;  1SKR A;  5KGX A;  1TK5 A;  1SKW A;  1FKP A;  1WAF A;  5C42 A;  1RTD A;  4CCH A;  3QEP A;  2PYL A;  5J2N A;  3SI6 A;  2OPQ A;  1RT1 A;  4ICL A;  1XC9 A;  1U4B A;  2YNI A;  4CGJ A;  4B9L A;  4FJG A;  3C6T A;  4YNQ A;  1HRH A;  4FW2 A;  4KTZ A;  1XHX A;  2KFZ A;  2KZZ A;  2LSN A;  2HHV A;  2EX3 A;  3O4N A;  3PO5 A;  1N6Q A;  3OS1 A;  2FBY A;  5FRO A;  1BHL A;  4ZHR A;  1Q8I A;  4Y1D A;  5J1E A;  3PX6 A;  4M3T A;  2F8T A;  3LP1 A;  1EET A;  1NK6 A;  1U45 A;  3SUQ A;  1X9W A;  2HHX A;  1LAW A;  4FXD A;  4CHY A;  2FC0 A;  4DU1 A;  1RDB A;  4DFP A;  5HRR A;  4DTR A;  4I9Q A;  4AHU A;  3V9Z A;  1RBT A;  3V9S A;  3VQE A;  1FKO A;  4DMN A;  3UIQ A;  2HNZ A;  1ZBH A;  2HW3 A;  1BIZ A;  5SZT A;  2DFE A;  2O4G A;  5CY4 A;  4DTM A;  2P51 A;  2YNH A;  1KVB A;  3MXJ A;  4LD0 A;  4E3S A;  2DY4 A;  4DSI A;  4DLE A;  2HB5 A;  1IKV A;  3DRP A;  5I3U A;  4O0J A;  4B8A B;  1C0M A;  3LAN A;  1LW0 A;  3NGY A;  5CYQ A;  5HBM A;  3SJJ A;  3ZCM A;  2E4L A;  4IKF A;  2BE2 A;  4N5S A;  1BL3 A;  5JS2 A;  3SQ2 A;  3MEC A;  4EP5 A;  1R0A A;  2XY6 A;  3MEE A;  4IDK A;  1BQM A;  2GBZ A;  4NCG A;  4FJJ A;  5HP1 A;  1C0U A;  3P83 D;  3M8S A;  3K58 A;  1NKC A;  4EZ9 A;  3V1Q A;  3QET A;  1QTM A;  2OZS A;  4KFB A;  4OPK A;  2XY7 A;  2G8V A;  1Q9Y A;  4DF8 A;  1VSI A;  3ULD A;  4DQQ A;  4Z4E A;  3AVA A;  1BCO A;  3LPT A;  2DTU A;  1HNI A;  4E89 A;  3ZSV A;  3TAN A;  1B92 A;  1HNV A;  1TGO A;  4CJ3 A;  4HHT A;  4OVL A;  4KHQ A;  3C95 A;  5T7B A;  4KI6 A;  4CK2 A;  4IG3 A;  3V9U A;  3LWM A;  4DTP A;  3MED A;  1U49 A;  1BCM A;  4NCB A;  2RKI A;  4OGC A;  3RR8 A;  3VQ6 A;  4CJT A;  4KB1 A;  2HHU A;  3NF9 A;  3OYG A;  1MU2 A;  3L2Q A;  3QIO A;  4RW8 A;  3K5L A;  2QKB A;  3K57 A;  4E7I A;  1QSY A;  3RMD A;  4QCL A;  1WLJ A;  3QIN A;  1G15 A;  1YTA A;  3LPU A;  4KHS A;  3AVB A;  3HP9 A;  4CJK A;  3AVI A;  3FFI A;  4Z4G A;  3L3U A;  2ATQ A;  3ZT1 A;  4R5P A;  4C8O A;  4FK0 A;  1S1U A;  3AO4 A;  1W9H A;  3K5O A;  3M8R A;  4E7J A;  2G8H A;  4C8K A;  4FJ9 A;  1SKS A;  3DYA A;  3RRG A;  3L2U A;  3PO4 A;  1QSS A;  4DSJ A;  3SQ4 A;  3OJU A;  1ITG A;  4KKO A;  2RF2 A;  3HL8 A;  4I7F A;  1HQU A;  3DLG A;  3RR7 A;  1KFS A;  2X6S A;  5HRS A;  4BDP A;  1EXQ A;  3JYT A;  3OYM A;  3KJV A;  1HJR A;  1C6V A;  2D0A A;  4DLG A;  4DQI A;  1YT3 A;  4N56 A;  3LDS A;  3ZSQ A;  4Q0B A;  1S1T A;  3EYZ A;  4L8R B;  4B9S A;  3B6P A;  2R7Y A;  3OYH A;  3ZSO A;  3SQ1 A;  1X9S A;  1RT6 A;  4I2Q A;  2YKM A;  4H4O A;  4CEF A;  2B5J A;  4BDY A;  1EP4 A;  3DRS A;  3O3H A;  1WSH A;  1NK7 A;  4NCA A;  4HUG A;  3VQP A;  4IBN A;  2IGI A;  5CZ1 A;  3C94 A;  3OYI A;  1KLM A;  2IOC A;  3AVN A;  4Q5V A;  4B9U A;  4AHC A;  1X1P A;  4NYN A;  4I2P A;  1RBR A;  1CXQ A;  1Y97 A;  1GOA A;  2W42 A;  1IKW A;  4B3O A;  3NGZ A;  3CFR A;  3K59 A;  1JLA A;  1T05 A;  1NK9 A;  3B6O A;  1BIS A;  1RT2 A;  2X74 A;  1C1B A;  4CJE A;  4DQR A;  1UA1 A;  3AO3 A;  4ELU A;  1C1A A;  4HTU A;  3THV A;  1K6Y A;  1A5W A;  3OYJ A;  3IAY A;  4KHY A;  1B9D A;  2A1S A;  1VSE A;  2YNF A;  3WNF A;  4CER A;  1S6Q A;  5HRN A;  3ZT0 A;  2YKN A;  2VWJ A;  3T3F A;  3RMB A;  3CFO A;  4KRE A;  3VQ5 A;  1S9G A;  2IAJ A;  4DTN A;  1S5J A;  3LAL A;  3HVR A;  2JGU A;  5K14 A;  1L3U A;  4GVM A;  4BE0 A;  3VQA A;  3HM9 A;  3SZ2 A;  1RDC A;  3SV4 A;  4Z4I A;  1TV6 A;  4KPY A;  4OJR A;  4CFD A;  3VA3 A;  2ZD1 A;  4CJU A;  2Z1I A;  3S9H A;  3V1R A;  3L2V A;  3DOL A;  4CGG A;  1F21 A;  2VWK A;  4W5N A;  1SUQ A;  3OYL A;  1XHZ A;  4DFJ A;  2G8F A;  4Z4C A;  3AA5 X;  4G1Q A;  4FLU A;  4OKJ A;  1UOC A;  2HHS A;  2E6L A;  4DS4 A;  4B9V A;  1NKB A;  3KK3 A;  1IKY A;  4LSN A;  4IFV A;  4FVM A;  2XRI A;  3ZSZ A;  4K8Z A;  1NK0 A;  3NAE A;  3P1G A;  1JXE A;  1IH7 A;  3BDP A;  5CYM A;  3OYN A;  3QES A;  3SNN A;  4E1M A;  2HMI A;  4JRP A;  3VQ7 A;  4FM1 A;  1RNH A;  3VN5 A;  4CGF A;  3OYK A;  4DTS A;  3U3Y A;  4DTU A;  1J5O A;  4CFC A;  1RBV A;  2OPS A;  3KK2 A;  3CG7 A;  4NYF A;  1UAX A;  4C8N A;  4QOZ B;  2XHB A;  1LAV A;  1YTU A;  4O5B A;  1RT5 A;  4CIF A;  2XO7 A;  4DFK A;  1HYV A;  3DLE A;  1KFD A;  1JLC A;  3ZSX A;  1NJY A;  4DQP A;  3AVJ A;  3S3O A;  1RTJ A;  3K5N A;  1EX4 A;  1ZBU A;  3A2F A;  2HVH A;  4M3Y A;  1D5A A;  2E6M A;  3ZSW A;  3QEI A;  4PY5 A;  2P5O A;  4DWI A;  3LAM A;  2FBX A;  4M3Z A; 
#chains in the Genus database with same CATH topology
 1G99 A;  5GIP A;  5EOY A;  4JEP A;  3D6R A;  1NKE A;  3G4S N;  1BWF O;  3CCR N;  2ZQB A;  3AVF A;  4LH4 A;  2VQE K;  2W6K A;  1NJZ A;  3SUN A;  4DV7 K;  4WYB A;  3QDK A;  1KC8 O;  4CIG A;  1ZBL A;  1HR0 K;  2Q3S A;  4XH4 A;  2Z1G A;  4OKE A;  4BC5 A;  3I56 N;  3OW2 M;  4RW9 A;  4DTJ A;  1VAZ A;  2V7Y A;  3DRR A;  4KH4 A;  3OY9 A;  2E5L K;  4K25 A;  3U4L A;  1SS6 A;  1TAQ A;  3MEG A;  4JKH A;  5M1O A;  3AAR A;  3GOI A;  5AQS A;  3O1B A;  5M1K A;  5GAE P;  4F2S A;  4JLH A;  1JLF A;  4KTW A;  2WOM A;  3H46 O;  3ENH A;  1S3X A;  3CYM A;  1S1W A;  1ASU A;  1NK4 A;  4KHN A;  4IFY A;  2UUB K;  1HKB A;  1S6P A;  3VEW A;  3QIC A;  3NCI A;  3KTQ A;  5D3G A;  2KQ2 A;  1VSH A;  4GVE A;  1RBU A;  2UU9 K;  4BG9 A;  1WUA A;  2X6N A;  4F3T A;  3GDQ A;  4BC3 A;  3VEY A;  4O55 A;  3TAE A;  2JWL A;  3SQ0 A;  1Z26 A;  3D2E A;  1S72 N;  4DU4 A;  3C7N A;  3SUP A;  4AHR A;  3VEN A;  1HX1 A;  2D0B A;  2V51 B;  4O5F A;  1KQS M;  3MAQ A;  1NK5 A;  1KVA A;  1NBW A;  2HBM A;  2WBN A;  3HK2 A;  3PLA A;  2I5J A;  1NJW A;  3D45 A;  3DM2 A;  5JLF A;  3OYC A;  1YVU A;  1YJN N;  4JN4 A;  4RG8 A;  4BRG A;  2D1K A;  2Y1I A;  2QWQ A;  4LFC K;  3Q7B A;  1W2B M;  4MQ3 A;  1DTQ A;  4JKA A;  1WSE A;  3AVL A;  3WUH A;  1SL0 A;  3AVK A;  4M7Y A;  4JYA K;  1OH6 A;  4W5O A;  3KLE A;  3ITH A;  2HOE A;  4DFM A;  4CJV A;  4FJN A;  2D0P A;  1H1V A;  2KHO A;  2YHX A;  1LWE A;  3O4Q A;  5AFU A;  3LWL A;  3BF3 A;  4EZ6 A;  4CJL A;  3F2K A;  3P38 A;  4CJF A;  5B8H A;  2UUA K;  4Z4F A;  3O1W A;  4E7H A;  1OH5 A;  2XY5 A;  2IDO A;  4EP4 A;  4KO0 A;  2O8F B;  1WBB A;  4Z4H A;  3THW A;  1RDA A;  3KIO A;  1VSM A;  3J7Z O;  3LL3 A;  2YHB A;  4OPJ A;  1VSF A;  3HST B;  2FF3 B;  3VF6 A;  4MFB A;  5FPD A;  3KKR A;  5LMU K;  5AQW A;  4BRD A;  1QQC A;  3J7Y P;  4W5T A;  2HVI A;  2E8A A;  1Q86 O;  3A8Y A;  3O9T A;  2ZGY A;  2P5G A;  5AZJ B;  4AF1 A;  1GLC G;  1D9D A;  3KKS A;  3WEE B;  1NGA A;  5EXW A;  4JI4 K;  2ZJR L;  5KGW A;  2O8B B;  3TU5 A;  4CED A;  4BG8 A;  3CPW M;  5FDL A;  4CZG A;  1D9F A;  2ZWH A;  2P1J A;  3CPE A;  1I39 A;  3TAR A;  4E7K A;  1QHA A;  3DAW A;  4RW4 A;  1NWK A;  1VSD A;  3EKS A;  2HND A;  4DU3 A;  1CZA N;  4Y1C A;  2XY8 A;  1HPM A;  1J54 A;  1S1X A;  3AVC A;  4ZTJ A;  4O8U A;  3LP2 A;  2Q31 A;  5AQM A;  1WAJ A;  1BI4 A;  1N32 K;  3AO2 A;  4CGD A;  4IFE A;  4JD2 B;  4DUY K;  2RE2 A;  1S9E A;  1NJX A;  1OVY A;  2YV0 X;  1TUU A;  4FWO A;  4CF9 A;  2X78 A;  2HNY A;  4BR5 A;  3KK1 A;  2QEX N;  1T03 A;  1ASW A;  4FWR A;  2HBJ A;  3NFA A;  1WSG A;  5AQV A;  3TAQ A;  2P9S A;  5KRT A;  4FLY A;  2KTQ A;  3OA9 A;  2W41 A;  4B9M A;  3ID8 A;  1NOZ A;  4CE9 A;  4JKC A;  5C10 A;  4QS9 A;  1T8E A;  4YOT A;  3QBW A;  3TAM A;  1JL2 A;  2E2N A;  3AAP A;  4E0D A;  1HMV A;  4QAG A;  4KB0 A;  4CZK A;  3HP6 A;  4EHU A;  1XNQ K;  4RCH A;  5C12 A;  3I55 N;  3JS6 A;  1K8K A;  4CBX A;  4JKG B;  4H0V B;  5KGX A;  5C42 A;  1ATR A;  4CCH A;  1E4G T;  1Q82 O;  5J2N A;  3SI6 A;  2VWB A;  3SAH A;  4FJG A;  4FW2 A;  4FSV A;  4FWS A;  2KZZ A;  3LDL A;  3ATV A;  1QQN A;  5FRO A;  4M3T A;  1Q8I A;  4Y1D A;  2J4R A;  2F8T A;  3LP1 A;  5CE3 A;  5I9E B;  4OPA A;  4H0X B;  5GAH P;  4DMN A;  2HNZ A;  1XNR K;  4DTM A;  2YNH A;  4RTF D;  2HBK A;  3VGL A;  5AQQ A;  5I3U A;  3P31 A;  3LAN A;  3ENB A;  5CYQ A;  3M5R A;  5F2R A;  2E4L A;  4IKF A;  5JS2 A;  3VEV A;  4H5W A;  3MEC A;  4M7X A;  3JXU A;  1RDU A;  5BRE A;  4MDA A;  3NVM A;  4NCG A;  3V1Q A;  2OZS A;  4KFB A;  1GLL O;  5BR8 K;  5M1F A;  1Q9Y A;  1VSI A;  1BCO A;  1B92 A;  3AGK A;  4OVL A;  5AQZ A;  3C95 A;  5AQR A;  5T7B A;  4KI6 A;  5IT9 O;  2KLA A;  2RKI A;  2YHY A;  3VQ6 A;  3UKU B;  3W3D A;  4DV1 K;  3NF9 A;  3MX5 A;  1MU2 A;  3L2Q A;  3SLC A;  3QIO A;  3K57 A;  2V7Z A;  1G15 A;  3CJA A;  2V52 B;  3AVI A;  5TKY A;  3FFI A;  3TTF A;  4RWT A;  4Z4G A;  4PL7 A;  1HUX A;  2Q2R A;  4PL8 A;  4DKW A;  2G8H A;  2WFB A;  4ILG B;  5HOO A;  5JIC A;  1ITG A;  2A6A A;  2HMP A;  3C65 A;  4YOU A;  3HL8 A;  1HQU A;  3DLG A;  3T1Y K;  2X6S A;  4OO1 J;  3JYT A;  3KJV A;  1HJR A;  2D0A A;  4DQI A;  4Y0W A;  3CCS N;  3ZSQ A;  1S1T A;  1N33 K;  3EYZ A;  2DPN A;  4B9S A;  2R7Y A;  4FWP A;  3SQ1 A;  3ZSO A;  2B5J A;  3H45 C;  1EP4 A;  3U8X A;  3O3H A;  3MCP A;  4JI1 K;  4IBN A;  2IGI A;  5CZ1 A;  2WTU A;  3SMS A;  3IFR A;  1IKW A;  2P9U B;  1JLA A;  4FPA A;  3B6O A;  2X74 A;  1SAZ A;  4ELU A;  3AO3 A;  1C1A A;  4HTU A;  1B9D A;  2NLX A;  2YNF A;  3WNF A;  4CER A;  1S6Q A;  3K0S A;  1YJW N;  1FJG K;  3CFO A;  3M3Z A;  4CZH A;  3HVR A;  4ILH A;  4IZ9 A;  3MK6 A;  1RDC A;  1EO1 A;  4KPY A;  4CFD A;  3VA3 A;  3ZET A;  2Z1I A;  4X66 K;  1SUQ A;  4G1Q A;  4ILJ A;  1UOC A;  2E6L A;  4DS4 A;  1QZ5 A;  4B9V A;  1VQ7 N;  5A2Q O;  4H5T A;  4LSN A;  3GE1 A;  3CET A;  3ZSZ A;  1NK0 A;  1JXE A;  3BDP A;  5AQK A;  3OYN A;  4JRP A;  3OYK A;  3CCV N;  3A5N C;  4DV3 K;  1VQP N;  4LF5 K;  4CFC A;  4C8N A;  4QOZ B;  1E4F T;  5M1P A;  2BUP A;  1RT5 A;  4DR4 K;  1HYV A;  3DLE A;  1JLC A;  4GV6 A;  4DQP A;  2P9I A;  4F9O A;  1RTJ A;  1M1K O;  2IVO A;  3VF2 A;  2I7P A;  1YUW A;  4G9Z A;  1TK0 A;  1FW6 A;  4M3Z A;  3AO1 A;  2UUC K;  4M3X A;  4LSL A;  4WFA L;  4IOC L;  3KVG A;  4YOV A;  3C6U A;  3WNH A;  1KXP A;  5LY3 A;  3L3V A;  4DV2 K;  4BWJ A;  1Z25 A;  2UXD K;  4GV9 A;  2UXC K;  4X64 K;  4BR0 A;  4GY2 B;  3QEW A;  4ISF A;  1GOC A;  2BTF A;  1NLV A;  4FWN A;  1N5Y A;  5AZI A;  1ESV A;  3HTV A;  4DG1 A;  3BUZ B;  4JKB A;  5DK5 A;  4M3U A;  2AJQ A;  3O8M A;  1VQN N;  3VEO A;  1CZB A;  1NGJ A;  3DLK A;  3VEZ A;  1KD1 O;  3ASM A;  4WFN L;  4KV8 A;  3MN7 A;  2E20 A;  3S3N A;  5JMV A;  3D2E B;  3CHW A;  3C7N B;  4W5R A;  3V9W A;  4CFA A;  1NGG A;  3O3F A;  3QLH A;  3VQ8 A;  3TI0 A;  1EQY A;  3L8B A;  3L2W A;  3NDK A;  4OPH A;  4CHQ A;  2OPR A;  3ZX2 A;  2PYJ A;  1SZ2 A;  4CW7 B;  2HST A;  1XI1 A;  2VCP A;  1HYS A;  1W97 L;  4CJW A;  3CC7 N;  1T6D A;  2CGL A;  2P9K B;  1RTH A;  4C8M A;  2B6A A;  2HHH K;  3RMA A;  4B3R K;  5BRF A;  3KLG A;  1J9A A;  1RDD A;  4JI8 K;  1GLJ O;  2O8D B;  2GEL A;  1ATS A;  3F73 A;  5BN8 A;  4DV6 K;  3CCU N;  1RT3 A;  1BQN A;  2P9P A;  3CCQ N;  1TUY A;  3I0R A;  4A2B A;  4BRN A;  1HYZ A;  5CR4 A;  2ZE2 A;  3PIP L;  3SV3 A;  2YJE A;  4FLX A;  4J2D A;  4C8L A;  2YI1 A;  1JLB A;  3MCA B;  4CF0 A;  3ZX3 A;  1FK9 A;  1KCF A;  5BPL A;  3VMF B;  3W0L A;  3OBY A;  3V1O A;  4FJH A;  4FM2 A;  2QWR A;  3CMA N;  3NF8 A;  2QXL A;  3QEX A;  3SJH A;  5ADX H;  4DSE A;  5JVG L;  3RSE A;  1N8R O;  1RTI A;  4KH6 A;  3C6H A;  2PZS A;  2IVP A;  4BWM A;  4NXM K;  3QNN A;  1K73 O;  3AVM A;  1DLO A;  4CK1 A;  3WXL A;  3DLB A;  2D0O A;  1HPZ A;  3LDQ A;  4LY7 A;  4JK8 A;  2VG6 A;  4DV5 K;  1NU0 A;  3HZ6 A;  3RMC A;  3TSU A;  2WON A;  1YHQ N;  3CJC A;  3TAB A;  2FBT A;  4OKK A;  4FPB A;  4CK3 A;  3OYD A;  3SMP A;  1FXX A;  4LF6 K;  4CFB A;  4CEQ A;  5BR9 A;  4H0O A;  1KTQ A;  4CHZ A;  2UXB K;  4F4K A;  3KLF A;  1C0F A;  3KZB A;  1JCE A;  3HPO A;  4ELT A;  1BI4 B;  4B9T A;  3F9K A;  2Y1J A;  3DLH A;  4HVJ A;  2ASP A;  5HRP A;  1QS4 A;  4C1N K;  2HHT A;  3KWG A;  2BH1 A;  1JLG A;  1QSL A;  4CEO A;  2IC3 A;  1VK0 A;  1U4B A;  3LAK A;  5HRO A;  3OYE A;  1JCF A;  3LP0 A;  1UWB A;  4ISE A;  2VYP A;  4BE2 A;  2FBV A;  1IV0 A;  3L4Q A;  2QK9 A;  2G8K A;  2ITG A;  4KHW A;  5KRS A;  4X62 K;  4IEE A;  5BN9 A;  3G10 A;  4FK2 A;  4Z0U A;  3S3M A;  5KTQ A;  1RDW X;  2P9S B;  2YHA A;  3R9P A;  3V4I A;  3WNE A;  3BZC A;  1SL1 A;  2G8I A;  3OJS A;  2JLE A;  1WNS A;  3PUF A;  5AQJ A;  4FZY A;  1ZBF A;  3ZX0 A;  1DKG D;  4TSX A;  5JS1 A;  1VSK A;  3QER A;  3V6D A;  4H8K A;  4B9N A;  4FZX C;  4E7L A;  5FRM A;  1W0H A;  3MWP A;  3OVN A;  4BRL A;  3CIP A;  3PSI A;  3DWL A;  4J2B A;  1K8K B;  3RRH A;  1IO2 A;  2BGG A;  3GG4 A;  2Z1J A;  4BC2 A;  3PX4 A;  3NE6 A;  3P5J A;  4JKF A;  4CEA A;  1WSJ A;  1XWL A;  3VQ9 A;  3I8D A;  1J53 A;  3CM6 A;  4IJA A;  1KRP A;  3CFP A;  3P4I A;  4CHP A;  3CER A;  4GV3 A;  2E2P A;  3O3G A;  4KAZ A;  3HPH A;  3CCE N;  5C0Y A;  4WF9 L;  2HBL A;  1RTD A;  1YJ9 N;  2F9T A;  2OPQ A;  1RT1 A;  4E1J A;  1XC9 A;  1HRH A;  3G6E N;  1XHX A;  4IO8 A;  4A62 A;  3PO5 A;  2FLO A;  1V4T A;  4ZHR A;  5J1E A;  1NK6 A;  1EET A;  1RGI A;  3SUQ A;  2FC0 A;  1Q18 A;  1X9J A;  4BRH A;  4C1N I;  4YOW A;  4KH5 A;  4DTR A;  4I9Q A;  3QB0 A;  4IDH A;  3V9Z A;  3UIQ A;  5E26 A;  3T7Z A;  3H6E A;  1QQO A;  3A0I X;  3AGR A;  4B1X B;  5HBM A;  3DXK A;  4N5S A;  3SQ2 A;  5ADX A;  3O80 A;  1VHX A;  4IDK A;  1BQM A;  2GBZ A;  4A57 A;  3SK3 A;  1VQ8 N;  1C0U A;  2IIR A;  5E84 A;  3QET A;  3WT0 A;  4Z4E A;  4O8K A;  4DF8 A;  1BUP A;  1T44 A;  1VQM N;  4A5B A;  1S22 A;  4IG3 A;  4LF8 K;  3DJC A;  1WB9 A;  1NMN A;  4B1V A;  3R3L A;  1K8A O;  2QKB A;  3RMD A;  1WLJ A;  3QIN A;  1YTA A;  3LPU A;  3AVB A;  3HP9 A;  4CD3 A;  1YI2 N;  3LM2 A;  3ZT1 A;  4R5P A;  1YIT N;  4C8K A;  2O8E A;  3DYA A;  3L2U A;  3PO4 A;  1QSS A;  4DCH A;  1RFQ A;  3T1H K;  4KKO A;  4B1Y B;  1X3N A;  4I6M A;  4GKK K;  2KKZ A;  4I7F A;  3RR7 A;  2OAN A;  1EXQ A;  3CI5 A;  5JVH L;  3SBT A;  1VQ5 N;  5C2D A;  4JKE A;  3B6P A;  4DR3 K;  3D7E O;  4I2Q A;  2YKM A;  2ZF5 O;  4BDY A;  4CI6 A;  1K9M O;  1KLM A;  4K43 A;  1OH7 A;  4Q5V A;  1TYQ A;  4B9U A;  1Y97 A;  1GOA A;  3ZET B;  4JI3 K;  1J6Z A;  3ID6 A;  5GAD P;  4BQL A;  3CFR A;  1NK9 A;  1BIS A;  1P8Z A;  1RT2 A;  4XH1 A;  3THV A;  4IOX A;  3OYJ A;  1VQ9 N;  2A1S A;  3IKM A;  5HRN A;  5LJW A;  3ZT0 A;  2YKN A;  2Q36 A;  3RMB A;  1ZC6 A;  3VQ5 A;  4KRE A;  2QI2 A;  3FZM A;  4JI5 K;  3CJ9 A;  2IAJ A;  4DTN A;  1S5J A;  4HTL A;  3CD6 N;  4GVM A;  2ZD1 A;  3L2V A;  2FSN A;  1XUP O;  3C6A A;  4LFA K;  3HRG A;  2G8F A;  4Z4C A;  4BRQ A;  3KK3 A;  1BDG A;  2P9I B;  2QW9 A;  3NAE A;  1IH7 A;  3MN5 A;  3QES A;  4E1M A;  3VQ7 A;  4CGF A;  1U2V A;  4DTU A;  3FZF A;  1N36 K;  3CG7 A;  4NYF A;  4XEI A;  2I7N A;  1YTU A;  3G71 N;  4O5B A;  4CIF A;  2XO7 A;  2NRX A;  1KFD A;  5DM6 L;  4EAH D;  1NJY A;  3AVJ A;  3S3O A;  3K5N A;  1EX4 A;  5GAG P;  4OX9 K;  3H3N O;  3QEI A;  3THX A;  5AZI B;  3LAM A;  3DXM B;  3AA3 A;  1ZYQ A;  3I33 A;  1QE1 A;  5LJV A;  2NRW A;  3EL2 A;  2O8F A;  4I9L A;  4CJR A;  4FK4 A;  4YOX A;  3QEV A;  3HJF A;  3EN9 A;  4JS5 A;  3IS9 A;  2E2O A;  3ZSY A;  3AVH A;  1CXU A;  3OS0 A;  2Q0U A;  1HQE A;  4DQS A;  3FFK B;  5J2M A;  1MWM A;  2HHQ A;  3K9K A;  5AQH A;  3EY1 A;  2VG5 A;  1T7P A;  2BAN A;  4B8C A;  1OH8 A;  4WQ5 A;  4FCY A;  4IOA L;  5EX5 A;  4FJ5 A;  1JLQ A;  2NRR A;  3KK7 A;  3CCM N;  4LC9 B;  3RWU A;  3MXM A;  4FL9 A;  4M42 A;  4AHS A;  2O8C A;  2ASO A;  4DR6 K;  2F9W A;  2AA4 A;  2QKK A;  4NLB A;  4JI6 K;  3CXC M;  4KBO A;  2OPP A;  4JKD A;  5C2F A;  3OYF A;  4QS7 A;  2P9P B;  3AV9 A;  3R1X A;  4CZJ A;  3ZT4 A;  1GLB G;  4LF4 K;  4FLW A;  4BGB A;  1NGB A;  2VG7 A;  3O9R A;  4BRP A;  4CJP A;  3V9X A;  3N4P A;  4MO4 A;  1RIL A;  3BGR A;  3TPQ A;  4X65 K;  2EHG A;  3O08 A;  2PY5 A;  3TSP A;  3VQQ A;  3TR8 A;  4A5A A;  2G8W A;  4HUE A;  4QS8 A;  3UE5 A;  1ZBI A;  2OTJ N;  2B4J A;  4DQ8 A;  3U3G A;  1I3A A;  3QNO A;  4CEZ A;  4K42 A;  3ZLJ A;  4CES A;  1L5U A;  4B08 A;  4WFB L;  3EE8 A;  4A2A A;  3L0Q A;  4U7B A;  1EKE A;  4WE1 A;  4AHV A;  3I0S A;  1TVR A;  3HXM A;  4BY9 C;  3KLH A;  3E9L A;  2FXU A;  4F8R A;  4FJX A;  4OLA A;  1HNW K;  1C0G A;  1NGI A;  4DUZ K;  3RSE B;  4CD1 A;  1GLA G;  3CM5 A;  3J81 O;  1JCG A;  5AQT A;  3EZ5 A;  5KI6 A;  4M3W A;  1RT7 A;  4IG0 A;  3T19 A;  2CGK A;  4DSF A;  3H1Q A;  2QA4 N;  1IG9 A;  3JSM A;  3VTI A;  4YHH K;  4BRC A;  3VA0 A;  3VQD A;  4LF9 K;  4FW1 A;  2JWK A;  2RN2 A;  1ILY A;  2ITM A;  4FZZ A;  1TKZ A;  3U6F A;  4GMJ B;  4M63 C;  1D8Y A;  4FJM A;  2FF6 A;  3NH0 A;  4CIE A;  3SCX A;  3PV8 A;  5CZ2 A;  4MLH A;  1JJ2 M;  4BC4 A;  2QWL A;  3BF1 A;  4FYD A;  3DI6 A;  1GOB A;  3LZJ A;  4BRK A;  3LDO A;  5LL6 Z;  3VTH A;  5F0X A;  3MX2 A;  2HF3 A;  2Q1N A;  4UQG A;  3O4W A;  4YOY A;  4WQ5 C;  4B3T K;  2QWN A;  5DM7 L;  4FM0 A;  3FGU A;  3NHG A;  1XC3 A;  3WXM B;  1SV5 A;  3DOK A;  4B1U B;  3NF7 A;  2OTL N;  4DR2 K;  3VEX A;  3D0P A;  2G8U A;  5C15 A;  3OYB A;  4BRF A;  1DGK N;  2P9N A;  3K5M A;  1KVC A;  3FZK A;  1KAY A;  4YFU A;  4M45 A;  3ENO A;  1T3V A;  3UB5 A;  1VQL N;  4LH5 A;  4EIA A;  3OBW A;  2OYQ A;  1TKT A;  4CEE A;  1XMO K;  1L3V A;  4HWI A;  3TAP A;  4FJ8 A;  4B3S K;  4JI0 K;  4CJ5 A;  3J7A P;  4M41 A;  2KFN A;  3RTV A;  3MDQ A;  4KHU A;  2OZM A;  3HT3 A;  3TAF A;  3V81 A;  1TL3 A;  3SPZ A;  4CHO A;  1NGD A;  2O4I A;  4CEB A;  1CZ9 A;  3OTO K;  1M90 O;  3UKR A;  3ZYY X;  4CGH A;  1U04 A;  2ETJ A;  4FLV A;  1HNX K;  3ZEU A;  3NF6 A;  1Q9X A;  3D2F A;  3HVT A;  1L3S A;  3ALY A;  1U47 A;  4UY8 O;  1HJO A;  2YCH A;  3UKU A;  4E19 A;  2YHW A;  2KW4 A;  5C25 A;  1NM1 A;  1NMD A;  5DMR A;  3M8P A;  5AQY A;  1IKX A;  4XH5 A;  4EFH A;  4JRQ A;  4IJN A;  2E2Q A;  5AJ3 K;  4FLT A;  1C0T A;  4BRI A;  4F2R A;  1Y64 A;  2Q97 A;  3KHY A;  4CF2 A;  3VET A;  4DTO A;  4PKH A;  3EEQ A;  4O4G A;  4CJS A;  4RW7 A;  2WC9 A;  1WSF A;  2HHW A;  4DSK A;  2A41 A;  4FJK A;  3LZI A;  3TWH A;  3CF5 L;  3VQC A;  3QFP A;  2BDP A;  1YVN A;  2F7T A;  4AIL C;  4B9Q A;  5E41 A;  3NH1 A;  1JKH A;  4PKG A;  4BRO A;  4FJI A;  5J2Q A;  2NRZ A;  3THW B;  1TL1 A;  3K2P A;  1N34 K;  1ZBS A;  1LV5 A;  3KD5 E;  4BVP A;  4PA1 A;  4FVU A;  4PUO A;  4GNI A;  3PY8 A;  2CH6 A;  4Z94 A;  1YXQ A;  4ID5 A;  1WAF A;  3MMV A;  3QEP A;  4DV0 K;  2PYL A;  4YDU A;  2YNI A;  4CGJ A;  4YNQ A;  2LSN A;  3O4N A;  2NZT A;  1N6Q A;  2FBY A;  1BHL A;  3PX6 A;  3QBX A;  3DXK B;  2W6L A;  3WQU A;  4FXD A;  4CHY A;  4DU1 A;  4NXN K;  5FPM A;  4C23 A;  3F5T A;  1XQS C;  3GL1 A;  5HRR A;  4AHU A;  1RBT A;  2VGM A;  3QFU A;  4WCE L;  3V9S A;  2HW3 A;  3U9Z A;  2QWO A;  2DFE A;  2O4G A;  5EVZ A;  1J5E K;  4H03 B;  4LF7 K;  3AY9 A;  4DSI A;  2HB5 A;  1IKV A;  3DRP A;  1LW0 A;  1QQM A;  3NGY A;  3SJJ A;  3ZCM A;  1V4S A;  2BE2 A;  1BL3 A;  3LDN A;  1DEJ A;  1NGH A;  1R0A A;  2XY6 A;  3MEE A;  1W7A A;  3WXJ A;  3CC4 N;  5LMN K;  3P83 D;  3M8S A;  1NKC A;  4EZ9 A;  1MWK A;  1QTM A;  1MA9 B;  4BR2 A;  4OPK A;  3LM9 A;  3CJ1 A;  2G8V A;  3LPT A;  4E89 A;  3ZSV A;  1NGC A;  1HNV A;  1TGO A;  4CJ3 A;  4KHQ A;  3O5B A;  3VER A;  3VOV A;  2O8E B;  4CK2 A;  4NCB A;  1U49 A;  3MED A;  3ATU A;  3RR8 A;  4CJT A;  4KB1 A;  2HHU A;  3OYG A;  3F9M A;  4I6M B;  4RW8 A;  4MO5 A;  3E66 A;  1OVQ A;  1IBL K;  1QSY A;  4KHS A;  2ZJP L;  2ATQ A;  1LCU A;  4FK0 A;  3AO4 A;  3K5O A;  1BO5 O;  4NLC A;  4E7J A;  1SKS A;  2PAV A;  3DLL L;  3RRG A;  2FSK A;  3SQ4 A;  3OJU A;  2E1Y A;  3CC2 N;  4CBW A;  1NGF A;  1TYQ B;  5HRS A;  4CZM A;  3OYM A;  3GBT A;  1C6V A;  3IUC A;  3LDS A;  3OYH A;  5M1Q A;  1RT6 A;  4H4O A;  4CEF A;  1X3M A;  3DRS A;  1WSH A;  1NK7 A;  3T69 A;  4HUG A;  5F1X A;  4AHC A;  1X1P A;  1RBR A;  2GX9 A;  4B3O A;  3K59 A;  4CJE A;  1C1B A;  1T6C A;  5KQ8 A;  4DQR A;  3BY5 A;  1A5W A;  1VSE A;  3MN6 A;  3T3F A;  2P9K A;  3O9Q A;  3LDP A;  4YDU C;  5KQD A;  2JGU A;  5K14 A;  3VQA A;  3HM9 A;  2O8D A;  1U2V B;  3SV4 A;  1TV6 A;  4OJR A;  1VQK N;  3DOL A;  1F21 A;  4BR4 A;  2IVN A;  4DFJ A;  3AA5 X;  3THY A;  1IKY A;  4YOR A;  3CQX A;  1XMQ K;  1HNZ K;  4CZF A;  2XRI A;  2A42 A;  3P1G A;  4BQZ A;  4AM7 A;  2HMI A;  3THX B;  3A5L C;  4FM1 A;  3U3Y A;  1RNH A;  3VN5 A;  2HF4 A;  1RBV A;  3KK2 A;  5TKW A;  1UAX A;  3ULE A;  4BR7 A;  2XHB A;  1NJI O;  1LAV A;  2AP1 A;  4CBU A;  4DFK A;  3M6G A;  4DHY A;  3ZSX A;  4CZE A;  4BGA A;  1BA1 A;  4K41 A;  3A2F A;  4JAX A;  2A5X A;  2E6M A;  3ZSW A;  4PY5 A;  2P5O A;  4DWI A;  1SL2 A;  3WNG A;  2P9L A;  4CGI A;  4YY3 K;  1NK8 A;  3PX0 A;  2ASM A;  5FLX O;  3H08 A;  4JHD A;  3NH2 A;  1RCH A;  3AA2 A;  3ZT2 A;  2A40 A;  3QO9 A;  4PQU A;  4F3O A;  2QM1 A;  4ZTF A;  2DFH A;  4JI7 K;  2D0C A;  2IS3 A;  3ISN C;  2O8C B;  3CQ8 A;  3O9S A;  3VQB A;  1LWF A;  3I8B A;  3OYA A;  1NNE A;  3AA4 A;  1X9M A;  4FWL A;  2QTD A;  1BG3 A;  2QXF A;  3VQ4 A;  5J2P A;  5KPZ A;  5M1N A;  2F4V K;  3SAG A;  3AVG A;  3DMJ A;  3FE1 A;  5GIO A;  4H5V A;  1KAZ A;  3FLC O;  5FRN A;  2F96 A;  3HI0 A;  4N47 A;  3L2R A;  1BIU A;  1CLQ A;  3BEX A;  3EE9 A;  2GWK A;  4FLZ A;  3N4Q A;  4CJ4 A;  4PWD A;  3DLR A;  4BAC A;  1JXB A;  3SYZ A;  3VES A;  4A61 A;  2QWM A;  1QZ6 A;  3ZT3 A;  3M8Q A;  4J2A A;  1VSJ A;  5HL7 L;  1NOY A;  1MDU B;  4DV4 K;  2Z1H A;  1TK8 A;  2CGJ A;  1A5V A;  3MN9 A;  4BE1 A;  4H5N A;  4XIU A;  1OKJ A;  5AQU A;  4O0I A;  3SUO A;  3VPZ A;  4A59 A;  3CQY A;  1ASV A;  3FR0 A;  1VRT A;  2W40 A;  2A1R A;  1EWQ A;  2WUS A;  4ISG A;  3CJ7 A;  4OLB A;  1R59 O;  3CCL N;  4OGE A;  3SPY A;  3QML A;  4FOE A;  5GIN A;  1KAX A;  2NUB A;  3HSC A;  1BU6 O;  4JI2 K;  2OA8 A;  3NMU A;  3CME N;  4GKJ K;  2GV9 A;  1D4X A;  3TTC A;  4FWM A;  2CH5 A;  4JV5 K;  5AQG A;  4DSL A;  2QWP A;  3WXI A;  3HYF A;  4FWQ A;  4HCB A;  4N41 A;  1TKX A;  2UYT A;  4MDB A;  4JNE A;  3B8A X;  1O13 A;  4JS4 A;  5HLF A;  3LP3 A;  3VGM A;  5KPT A;  4W5Q A;  3FZL A;  4DTX A;  4V19 S;  3CJB A;  3MWT A;  4M3R A;  3U9D A;  3NGI A;  4BRE A;  4O44 A;  4CHN A;  2Q0R A;  3CCJ N;  3TTD A;  1TKD A;  3E01 A;  4CJ7 A;  4J8F A;  5FPE A;  3S41 A;  1VRU A;  5JLH A;  3VGK A;  3KWI A;  4DS5 A;  1BGX T;  2GEM A;  2P9N B;  5C24 A;  3VF4 A;  1JLE A;  4L3Q A;  3TSQ A;  1S1V A;  4IEI A;  4RW6 A;  3IRX A;  3QIP A;  1LWC A;  1RBS A;  5AQI A;  2VGN A;  1ATN A;  4KTQ A;  1WSI A;  5MLC Q;  4AHT A;  2F8S A;  1GLE G;  4DF4 A;  2NRV A;  3T1A A;  1B9F A;  4HCC A;  4FJL A;  5AZJ A;  3UKR B;  4BRM A;  4ELV A;  3WEE A;  1KSP A;  3HO1 A;  1HKC A;  2NNW A;  3ZEU B;  2O8B A;  1RT4 A;  2DY4 A;  3PIO L;  3D2F B;  1DTT A;  3BZK A;  5AQO A;  1QHT A;  4MLE A;  1NGE A;  1A5X A;  1U48 A;  3MXI A;  3P39 A;  1VQO N;  3TAG A;  4BVO A;  2RPI A;  3KLI A;  5H1S Q;  2YNG A;  4U67 L;  5BRH A;  1HLU A;  4E1N A;  4KHP K;  1TAU A;  4AH9 A;  3FZH A;  4H0P A;  1VSL A;  4K8X A;  1I94 K;  3OS2 A;  2YX6 A;  3Q7C A;  1REV A;  2ZGZ A;  5AR0 A;  2D5R A;  2DFF A;  3NBP A;  4ID1 A;  3WQT A;  4GW6 A;  4IWV A;  4J2E A;  3AO5 A;  4JD2 A;  1WN7 A;  5EU7 A;  5SWM A;  1O1W A;  1JL1 A;  4N76 A;  3IG1 A;  3J80 O;  2PBD A;  1LW2 A;  4BDZ A;  2PFU A;  4FJ7 A;  4BRA A;  4WQ4 A;  3HOT A;  4CEC A;  4KI4 A;  3WXK A;  3SAF A;  2GUP A;  3L4I A;  5I42 A;  4H4M A;  3ZSR A;  1P90 A;  4CF8 A;  1IJJ A;  3HPG A;  3O6W A;  1UA0 A;  3KD1 E;  1EWR A;  4R79 A;  1L3T A;  4CJQ A;  2KZM A;  3L6Q A;  4B3M K;  3E9O A;  2GUI A;  4H0T B;  4HUF A;  4CF1 A;  5KPR A;  2GTD A;  4KRF A;  1C1C A;  3G0Z A;  1KLN A;  1SKR A;  1TK5 A;  1SKW A;  1FKP A;  3O9U A;  3EKU A;  4ICL A;  3NVK A;  4B9L A;  3R8E A;  3C6T A;  3AAQ A;  2KFZ A;  4KTZ A;  2HHV A;  2EX3 A;  3OS1 A;  1BOT O;  1U45 A;  1X9W A;  2HHX A;  4CVN E;  1LAW A;  4K0K K;  1RDB A;  4JKG A;  4DFP A;  3VQE A;  1FKO A;  1VQ4 N;  3EZW A;  1ZBH A;  1BIZ A;  5SZT A;  5CY4 A;  2P51 A;  3MXJ A;  1KVB A;  4E3S A;  4LD0 A;  5FPN A;  3OHR A;  2OCE A;  4AM6 A;  4B1W B;  4DLE A;  4B1Z A;  1LOT B;  4O0J A;  4B8A B;  1C0M A;  1SQK A;  4H0Y B;  3RVC A;  1Q81 O;  4EP5 A;  1IG8 A;  5EY4 A;  4FJJ A;  5HP1 A;  4NB4 A;  4FOI A;  3K58 A;  1HKG A;  2FSJ A;  4PHT X;  2XY7 A;  3A5O C;  3ULD A;  4DQQ A;  3AVA A;  4BR9 A;  2DTU A;  1HNI A;  3TAN A;  3E9P A;  3PSF A;  2RHK A;  4HHT A;  2GWJ A;  1YAG A;  3V9U A;  3LWM A;  4DTP A;  1BCM A;  4OGC A;  5AQF A;  5ELZ A;  3DXM A;  3A5M C;  3J8A A;  3K5L A;  4E7I A;  3EO3 A;  4FWK A;  4QCL A;  4CJK A;  1QVF M;  1VQ6 N;  3L3U A;  1NG9 A;  1YF5 L;  1ZXO A;  4C8O A;  4EHT A;  1S1U A;  1W9H A;  1Z6R A;  3M8R A;  4JK9 A;  4FJ9 A;  3G25 A;  1Z05 A;  2E88 A;  1BA0 A;  2ZJQ L;  4DSJ A;  2E1Z A;  2D4W A;  2ZM6 K;  1E3M A;  4PKI A;  2RF2 A;  1KFS A;  4BDP A;  4FO0 A;  4DLG A;  1YT3 A;  4N56 A;  4WQ4 C;  4Q0B A;  4L8R B;  2A3Z A;  1X9S A;  3IDH A;  3HM8 A;  5AFU H;  4NCA A;  1WOQ A;  3VQP A;  4AQY K;  5AQL A;  3C94 A;  3OYI A;  2IOC A;  3AVN A;  5BRD A;  3H3O B;  4NYN A;  4I2P A;  5AQP A;  1CXQ A;  3HBT A;  2W42 A;  2H3G X;  3NGZ A;  1IBM K;  1T05 A;  2EWS A;  4LFB K;  1UA1 A;  4H5R A;  2YJF A;  3THY B;  1K6Y A;  3IAY A;  4DR5 K;  4KHY A;  2NRH A;  2VWJ A;  4DB3 A;  1S9G A;  1DT9 A;  5CHI A;  3LAL A;  5AQN A;  4CZI A;  4CZL A;  1L3U A;  5AQX A;  4BE0 A;  3SZ2 A;  4Z4I A;  4DR1 K;  4CJU A;  4IXC A;  2P9U A;  3S9H A;  3V1R A;  3ULE B;  4CGG A;  2VWK A;  3K9J A;  1Q7Y O;  4W5N A;  3OYL A;  1XHZ A;  3R6M A;  2HHS A;  4FLU A;  4OKJ A;  1GLD G;  5IWA K;  1NKB A;  5BPN A;  4DR7 K;  3E1Y A;  4IFV A;  1WBD A;  4FVM A;  4K8Z A;  3HOS A;  1YIJ N;  5CYM A;  3SNN A;  1U6Z A;  4DTS A;  2P9L B;  1GLF O;  1J5O A;  2OPS A;  3JAM O;  4JK7 A;  3H1V X;  3C0B A;  4IO9 L;  1IBK K;  5BPM A;  4JHD B;  2NRT A;  4NO7 A;  1ZBU A;  3SBG A;  2VQF K;  2HVH A;  3IMX A;  4M3Y A;  3M1F A;  1D5A A;  1QVG M;  3BP8 A;  2FBX A; 
#chains in the Genus database with same CATH homology
 1SL2 A;  3WNG A;  4CGI A;  3AA3 A;  3AO1 A;  1ZYQ A;  4M3X A;  1QE1 A;  1NK8 A;  3PX0 A;  4LSL A;  1NKE A;  4I9L A;  3C6U A;  3WNH A;  4CJR A;  4FK4 A;  3L3V A;  3H08 A;  2ZQB A;  3AVF A;  4LH4 A;  3QEV A;  1NJZ A;  3HJF A;  4JS5 A;  3IS9 A;  4BWJ A;  3SUN A;  3NH2 A;  1Z25 A;  4CIG A;  1RCH A;  3AA2 A;  2Q3S A;  3ZSY A;  3ZT2 A;  1ZBL A;  2Z1G A;  3AVH A;  3QO9 A;  4OKE A;  4PQU A;  1CXU A;  4F3O A;  3QEW A;  3OS0 A;  4RW9 A;  4DTJ A;  3DRR A;  1GOC A;  3OY9 A;  1HQE A;  4DQS A;  4ZTF A;  1N5Y A;  2DFH A;  5J2M A;  2D0C A;  2IS3 A;  3ISN C;  2HHQ A;  1TAQ A;  3MEG A;  4DG1 A;  3CQ8 A;  3EY1 A;  2VG5 A;  5DK5 A;  1T7P A;  2BAN A;  4B8C A;  4M3U A;  3VQB A;  2AJQ A;  1LWF A;  1CZB A;  3OYA A;  4F2S A;  3AA4 A;  3DLK A;  1JLF A;  4JLH A;  1X9M A;  3ASM A;  4KTW A;  2WOM A;  4KV8 A;  2QXF A;  3VQ4 A;  4FCY A;  5J2P A;  3S3N A;  4FJ5 A;  4W5R A;  3CYM A;  1JLQ A;  1S1W A;  1ASU A;  1NK4 A;  4KHN A;  3AVG A;  3DMJ A;  4IFY A;  4CFA A;  3V9W A;  3MXM A;  3RWU A;  3O3F A;  3QLH A;  3VQ8 A;  4AHS A;  4M42 A;  1S6P A;  3TI0 A;  3L8B A;  5FRN A;  3L2W A;  3NDK A;  3NCI A;  3KTQ A;  5D3G A;  2KQ2 A;  1VSH A;  2F96 A;  1RBU A;  4CHQ A;  2QKK A;  4N47 A;  2X6N A;  4F3T A;  2OPR A;  3L2R A;  2PYJ A;  1BIU A;  2OPP A;  3OYF A;  1CLQ A;  4O55 A;  4FLZ A;  3TAE A;  3AV9 A;  3SQ0 A;  1Z26 A;  3ZT4 A;  4CJ4 A;  4PWD A;  4DU4 A;  3DLR A;  4BAC A;  1JXB A;  4AHR A;  4FLW A;  3SUP A;  1XI1 A;  1HYS A;  4CJW A;  2VG7 A;  4CJP A;  3V9X A;  3SYZ A;  1RTH A;  2D0B A;  1RIL A;  3BGR A;  2B6A A;  4C8M A;  3MAQ A;  1NK5 A;  1KVA A;  2EHG A;  3RMA A;  3ZT3 A;  3HK2 A;  2PY5 A;  3VQQ A;  3KLG A;  2I5J A;  1J9A A;  1RDD A;  3M8Q A;  1NJW A;  3D45 A;  3DM2 A;  4J2A A;  1VSJ A;  3OYC A;  1YVU A;  3TR8 A;  3F73 A;  1NOY A;  4HUE A;  2G8W A;  1ZBI A;  2Z1H A;  1TK8 A;  4RG8 A;  2B4J A;  3U3G A;  1I3A A;  3QNO A;  4CEZ A;  1A5V A;  1RT3 A;  1BQN A;  4BE1 A;  2Y1I A;  4KB0 A;  4CES A;  4XIU A;  1L5U A;  4B08 A;  3I0R A;  4MQ3 A;  1HYZ A;  2ZE2 A;  4O0I A;  1EKE A;  3SUO A;  4WE1 A;  1DTQ A;  4AHV A;  3I0S A;  1WSE A;  1TVR A;  3AVL A;  3HXM A;  1SL0 A;  3KLH A;  1ASV A;  3AVK A;  3SV3 A;  4FLX A;  1VRT A;  2A1R A;  4F8R A;  4J2D A;  4FJX A;  4OLA A;  4C8L A;  4W5O A;  3KLE A;  3ITH A;  1JLB A;  4OLB A;  4OGE A;  4DFM A;  4CF0 A;  3CM5 A;  3SPY A;  1FK9 A;  4CJV A;  4FJN A;  2NUB A;  1KCF A;  3EZ5 A;  1LWE A;  5KI6 A;  4M3W A;  3O4Q A;  1RT7 A;  4IG0 A;  3T19 A;  2OA8 A;  3V1O A;  4DSF A;  4FJH A;  3LWL A;  2GV9 A;  4FM2 A;  4EZ6 A;  4CJL A;  1IG9 A;  3JSM A;  4CJF A;  4Z4F A;  4DSL A;  3NF8 A;  3VA0 A;  4E7H A;  3VQD A;  3QEX A;  2XY5 A;  3HYF A;  4HCB A;  4DSE A;  2IDO A;  4N41 A;  1TKX A;  4FW1 A;  2RN2 A;  4EP4 A;  1RTI A;  2PZS A;  1TK0 A;  4KO0 A;  4BWM A;  4FZZ A;  3QNN A;  3AVM A;  1DLO A;  1TKZ A;  4CK1 A;  4JS4 A;  4Z4H A;  3U6F A;  3LP3 A;  5HLF A;  4GMJ B;  3DLB A;  1RDA A;  1HPZ A;  4LY7 A;  4W5Q A;  3KIO A;  1VSM A;  2VG6 A;  1D8Y A;  4DTX A;  4FJM A;  3NH0 A;  2YHB A;  4OPJ A;  1VSF A;  4CIE A;  3SCX A;  4M3R A;  3NGI A;  5CZ2 A;  3HST B;  3PV8 A;  4MFB A;  3KKR A;  4O44 A;  4CHN A;  3RMC A;  1QQC A;  1TKD A;  4FYD A;  4W5T A;  3DI6 A;  3E01 A;  2HVI A;  2WON A;  1GOB A;  3LZJ A;  3TAB A;  1VRU A;  2FBT A;  4OKK A;  1BGX T;  4CK3 A;  4DS5 A;  2P5G A;  3OYD A;  1FXX A;  5C24 A;  4CFB A;  4CEQ A;  1JLE A;  1D9D A;  3KKS A;  1KTQ A;  1S1V A;  4RW6 A;  3IRX A;  3QIP A;  1LWC A;  5KGW A;  4CHZ A;  4CED A;  1RBS A;  4UQG A;  4F4K A;  5FDL A;  1D9F A;  3KLF A;  4KTQ A;  1WSI A;  2P1J A;  4FM0 A;  4AHT A;  3NHG A;  1I39 A;  3HPO A;  1SV5 A;  3DOK A;  4E7K A;  3NF7 A;  3TAR A;  4DF4 A;  4ELT A;  2F8S A;  4RW4 A;  1BI4 B;  3D0P A;  4B9T A;  2OYQ A;  3F9K A;  3T1A A;  1VSD A;  2Y1J A;  2G8U A;  3DLH A;  2HND A;  3OYB A;  4HVJ A;  1B9F A;  5HRP A;  1QS4 A;  3K5M A;  4DU3 A;  4HCC A;  4FJL A;  1KVC A;  2HHT A;  4ELV A;  4Y1C A;  1JLG A;  1KSP A;  4YFU A;  1QSL A;  4M45 A;  3HO1 A;  2XY8 A;  1J54 A;  2IC3 A;  1RT4 A;  4LH5 A;  4CEO A;  1S1X A;  1VK0 A;  3LAK A;  1DTT A;  1TKT A;  5HRO A;  4CEE A;  3OYE A;  3AVC A;  3LP0 A;  1QHT A;  1UWB A;  3TAP A;  4ZTJ A;  4BE2 A;  1L3V A;  2FBV A;  3LP2 A;  4FJ8 A;  1A5X A;  1U48 A;  2QK9 A;  4CJ5 A;  3MXI A;  2G8K A;  2ITG A;  4M41 A;  2KFN A;  3RTV A;  4KHW A;  1WAJ A;  5KRS A;  3TAG A;  2OZM A;  2RPI A;  3HT3 A;  3TAF A;  4KHU A;  1BI4 A;  3G10 A;  1TL3 A;  3V81 A;  3SPZ A;  3AO2 A;  4Z0U A;  4CGD A;  4CHO A;  3S3M A;  4FK2 A;  5KTQ A;  2O4I A;  3KLI A;  2YNG A;  4CEB A;  1CZ9 A;  2YHA A;  4E1N A;  1S9E A;  1NJX A;  4CGH A;  1TAU A;  4AH9 A;  1U04 A;  2ETJ A;  1VSL A;  4FLV A;  4K8X A;  3V4I A;  3WNE A;  3OS2 A;  3NF6 A;  1Q9X A;  1REV A;  2YV0 X;  3HVT A;  1SL1 A;  1L3S A;  4CF9 A;  3ALY A;  1U47 A;  2G8I A;  2D5R A;  3OJS A;  2X78 A;  2DFF A;  4E19 A;  2HNY A;  3KK1 A;  3NBP A;  2JLE A;  1T03 A;  1ASW A;  1WNS A;  2KW4 A;  3PUF A;  4ID1 A;  5C25 A;  4FZY A;  1ZBF A;  4GW6 A;  3M8P A;  4TSX A;  5DMR A;  5JS1 A;  1IKX A;  1VSK A;  1WSG A;  3NFA A;  4JRQ A;  3QER A;  3AO5 A;  3TAQ A;  4J2E A;  1WN7 A;  5KRT A;  4FLY A;  5EU7 A;  5SWM A;  2KTQ A;  1O1W A;  3V6D A;  4H8K A;  1JL1 A;  4B9N A;  4FZX C;  4FLT A;  4E7L A;  1C0T A;  5FRM A;  4N76 A;  1W0H A;  4B9M A;  3IG1 A;  1NOZ A;  3OVN A;  1LW2 A;  4CE9 A;  4F2R A;  4CF2 A;  4BDZ A;  4FJ7 A;  4DTO A;  4O4G A;  4CJS A;  1T8E A;  4RW7 A;  1WSF A;  3TAM A;  4CEC A;  2HHW A;  4DSK A;  4KI4 A;  4J2B A;  3RRH A;  4FJK A;  1JL2 A;  3LZI A;  3TWH A;  5I42 A;  4H4M A;  3ZSR A;  1IO2 A;  3VQC A;  1HMV A;  4E0D A;  2BGG A;  2BDP A;  4QAG A;  4CF8 A;  4AIL C;  3HPG A;  5E41 A;  2Z1J A;  3NH1 A;  1JKH A;  1UA0 A;  3PX4 A;  3NE6 A;  3P5J A;  3KD1 E;  1L3T A;  4CJQ A;  4CEA A;  4FJI A;  5J2Q A;  2KZM A;  1WSJ A;  1XWL A;  3VQ9 A;  3I8D A;  1J53 A;  1TL1 A;  2GUI A;  3CM6 A;  3K2P A;  3HP6 A;  3CFP A;  1LV5 A;  4HUF A;  1KRP A;  3KD5 E;  4PA1 A;  4CF1 A;  4CHP A;  4PUO A;  4KRF A;  3PY8 A;  1C1C A;  3G0Z A;  3O3G A;  1KLN A;  4KAZ A;  3HPH A;  4ID5 A;  1SKR A;  5KGX A;  1TK5 A;  1SKW A;  1FKP A;  1WAF A;  5C42 A;  1RTD A;  4CCH A;  3QEP A;  2PYL A;  5J2N A;  3SI6 A;  2OPQ A;  1RT1 A;  4ICL A;  1XC9 A;  1U4B A;  2YNI A;  4CGJ A;  4B9L A;  4FJG A;  3C6T A;  4YNQ A;  1HRH A;  4FW2 A;  4KTZ A;  1XHX A;  2KFZ A;  2KZZ A;  2LSN A;  2HHV A;  2EX3 A;  3O4N A;  3PO5 A;  1N6Q A;  3OS1 A;  2FBY A;  5FRO A;  1BHL A;  4ZHR A;  1Q8I A;  4Y1D A;  5J1E A;  3PX6 A;  4M3T A;  2F8T A;  3LP1 A;  1EET A;  1NK6 A;  1U45 A;  3SUQ A;  1X9W A;  2HHX A;  1LAW A;  4FXD A;  4CHY A;  2FC0 A;  4DU1 A;  1RDB A;  4DFP A;  5HRR A;  4DTR A;  4I9Q A;  4AHU A;  3V9Z A;  1RBT A;  3V9S A;  3VQE A;  1FKO A;  4DMN A;  3UIQ A;  2HNZ A;  1ZBH A;  2HW3 A;  1BIZ A;  5SZT A;  2DFE A;  2O4G A;  5CY4 A;  4DTM A;  2P51 A;  2YNH A;  1KVB A;  3MXJ A;  4LD0 A;  4E3S A;  2DY4 A;  4DSI A;  4DLE A;  2HB5 A;  1IKV A;  3DRP A;  5I3U A;  4O0J A;  4B8A B;  1C0M A;  3LAN A;  1LW0 A;  3NGY A;  5CYQ A;  5HBM A;  3SJJ A;  3ZCM A;  2E4L A;  4IKF A;  2BE2 A;  4N5S A;  1BL3 A;  5JS2 A;  3SQ2 A;  3MEC A;  4EP5 A;  1R0A A;  2XY6 A;  3MEE A;  4IDK A;  1BQM A;  2GBZ A;  4NCG A;  4FJJ A;  5HP1 A;  1C0U A;  3P83 D;  3M8S A;  3K58 A;  1NKC A;  4EZ9 A;  3V1Q A;  3QET A;  1QTM A;  2OZS A;  4KFB A;  4OPK A;  2XY7 A;  2G8V A;  1Q9Y A;  4DF8 A;  1VSI A;  3ULD A;  4DQQ A;  4Z4E A;  3AVA A;  1BCO A;  3LPT A;  2DTU A;  1HNI A;  4E89 A;  3ZSV A;  3TAN A;  1B92 A;  1HNV A;  1TGO A;  4CJ3 A;  4HHT A;  4OVL A;  4KHQ A;  3C95 A;  5T7B A;  4KI6 A;  4CK2 A;  4IG3 A;  3V9U A;  3LWM A;  4DTP A;  3MED A;  1U49 A;  1BCM A;  4NCB A;  2RKI A;  4OGC A;  3RR8 A;  3VQ6 A;  4CJT A;  4KB1 A;  2HHU A;  3NF9 A;  3OYG A;  1MU2 A;  3L2Q A;  3QIO A;  4RW8 A;  3K5L A;  2QKB A;  3K57 A;  4E7I A;  1QSY A;  3RMD A;  4QCL A;  1WLJ A;  3QIN A;  1G15 A;  1YTA A;  3LPU A;  4KHS A;  3AVB A;  3HP9 A;  4CJK A;  3AVI A;  3FFI A;  4Z4G A;  3L3U A;  2ATQ A;  3ZT1 A;  4R5P A;  4C8O A;  4FK0 A;  1S1U A;  3AO4 A;  1W9H A;  3K5O A;  3M8R A;  4E7J A;  2G8H A;  4C8K A;  4FJ9 A;  1SKS A;  3DYA A;  3RRG A;  3L2U A;  3PO4 A;  1QSS A;  4DSJ A;  3SQ4 A;  3OJU A;  1ITG A;  4KKO A;  2RF2 A;  3HL8 A;  4I7F A;  1HQU A;  3DLG A;  3RR7 A;  1KFS A;  2X6S A;  5HRS A;  4BDP A;  1EXQ A;  3JYT A;  3OYM A;  3KJV A;  1HJR A;  1C6V A;  2D0A A;  4DLG A;  4DQI A;  1YT3 A;  4N56 A;  3LDS A;  3ZSQ A;  4Q0B A;  1S1T A;  3EYZ A;  4L8R B;  4B9S A;  3B6P A;  2R7Y A;  3OYH A;  3ZSO A;  3SQ1 A;  1X9S A;  1RT6 A;  4I2Q A;  2YKM A;  4H4O A;  4CEF A;  2B5J A;  4BDY A;  1EP4 A;  3DRS A;  3O3H A;  1WSH A;  1NK7 A;  4NCA A;  4HUG A;  3VQP A;  4IBN A;  2IGI A;  5CZ1 A;  3C94 A;  3OYI A;  1KLM A;  2IOC A;  3AVN A;  4Q5V A;  4B9U A;  4AHC A;  1X1P A;  4NYN A;  4I2P A;  1RBR A;  1CXQ A;  1Y97 A;  1GOA A;  2W42 A;  1IKW A;  4B3O A;  3NGZ A;  3CFR A;  3K59 A;  1JLA A;  1T05 A;  1NK9 A;  3B6O A;  1BIS A;  1RT2 A;  2X74 A;  1C1B A;  4CJE A;  4DQR A;  1UA1 A;  3AO3 A;  4ELU A;  1C1A A;  4HTU A;  3THV A;  1K6Y A;  1A5W A;  3OYJ A;  3IAY A;  4KHY A;  1B9D A;  2A1S A;  1VSE A;  2YNF A;  3WNF A;  4CER A;  1S6Q A;  5HRN A;  3ZT0 A;  2YKN A;  2VWJ A;  3T3F A;  3RMB A;  3CFO A;  4KRE A;  3VQ5 A;  1S9G A;  2IAJ A;  4DTN A;  1S5J A;  3LAL A;  3HVR A;  2JGU A;  5K14 A;  1L3U A;  4GVM A;  4BE0 A;  3VQA A;  3HM9 A;  3SZ2 A;  1RDC A;  3SV4 A;  4Z4I A;  1TV6 A;  4KPY A;  4OJR A;  4CFD A;  3VA3 A;  2ZD1 A;  4CJU A;  2Z1I A;  3S9H A;  3V1R A;  3L2V A;  3DOL A;  4CGG A;  1F21 A;  2VWK A;  4W5N A;  1SUQ A;  3OYL A;  1XHZ A;  4DFJ A;  2G8F A;  4Z4C A;  3AA5 X;  4G1Q A;  4FLU A;  4OKJ A;  1UOC A;  2HHS A;  2E6L A;  4DS4 A;  4B9V A;  1NKB A;  3KK3 A;  1IKY A;  4LSN A;  4IFV A;  4FVM A;  2XRI A;  3ZSZ A;  4K8Z A;  1NK0 A;  3NAE A;  3P1G A;  1JXE A;  1IH7 A;  3BDP A;  5CYM A;  3OYN A;  3QES A;  3SNN A;  4E1M A;  2HMI A;  4JRP A;  3VQ7 A;  4FM1 A;  1RNH A;  3VN5 A;  4CGF A;  3OYK A;  4DTS A;  3U3Y A;  4DTU A;  1J5O A;  4CFC A;  1RBV A;  2OPS A;  3KK2 A;  3CG7 A;  4NYF A;  1UAX A;  4C8N A;  4QOZ B;  2XHB A;  1LAV A;  1YTU A;  4O5B A;  1RT5 A;  4CIF A;  2XO7 A;  4DFK A;  1HYV A;  3DLE A;  1KFD A;  1JLC A;  3ZSX A;  1NJY A;  4DQP A;  3AVJ A;  3S3O A;  1RTJ A;  3K5N A;  1EX4 A;  1ZBU A;  3A2F A;  2HVH A;  4M3Y A;  1D5A A;  2E6M A;  3ZSW A;  3QEI A;  4PY5 A;  2P5O A;  4DWI A;  3LAM A;  2FBX A;  4M3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...