1EXQA

Crystal structure of the hiv-1 integrase catalytic core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
147
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPYVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 44
structure length 147
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1exqA00
4KREA 3PX0A 1IO2A 1O1WA 3PX4A 4G1QA 4CF1A 1WN7A 2RN2A 4DQRA 3S3NA 2G8UA 1HQUA 3QNOA 4I2QA 4YFUA 3TAEA 4BE0A 4J2EA 3SPYA 3OVNA 1HQEA 3AVLA 4K8XA 3OYEA 1F21A 2KW4A 4Z4FA 4DF4A 1TK0A 1WAJA 4PUOA 1VSFA 2O4IA 1NOZA 4O0IA 2ETJA 3LPUA 1BIZA 1ASWA 1CZBA 1LW2A 1WSEA 1GOAA 3H08A 1C6VA 2P51A 1TV6A 4LH5A 1BISA 1JLCA 2KFZA 2ZE2A 4FK0A 4DFPA 3AVFA 3O4QA 4LY7A 3TR8A 1W9HA 4M42A 4CEBA 4FZYA 2FC0A 3KKRA 4KTWA 3HM9A 2XRIA 3L3VA 4DTUA 1S9GA 1WSIA 3DMJA 4KHYA 2KFNA 3O3GA 3FFIA 4R5PA 4OLAA 5I42A 2FBYA 1EX4A 3SQ2A 3LP0A 4DTPA 1JXEA 3D0PA 3RMBA 3AA5X 1HMVA 2Z1HA 4O4GA 5I3UA 4CEDA 3IRXA 2YNFA 3O3FA 3OS2A 5D3GA 4CJFA 5FDLA 1DTQA 4AILC 2OPSA 2OZSA 2HHSA 4BDZA 2HNZA 1B9DA 3TAQA 3LANA 2OPQA 3V1RA 2HMIA 5CYMA 1KVAA 1JL1A 1LW0A 3VQAA 4CEQA 4HCCA 1BL3A 3NGZA 3LP2A 3QETA 1SKRA 3CQ8A 1KFSA 1U4BA 4K8ZA 4CF8A 3K5MA 3ZT2A 2BGGA 4PY5A 3HP6A 1L5UA 1Z25A 4IDKA 3SI6A 4DQPA 3OYCA 1UWBA 5CYQA 2XY8A 3ZSQA 1RDBA 4Z0UA 3CFOA 3O4NA 3M8RA 1XHZA 1JKHA 4CIFA 4KHNA 2KTQA 4IBNA 4DQQA 2IOCA 3I0RA 4CGDA 3HXMA 5JS1A 1WSJA 2IC3A 4NYFA 1RTHA 4OGEA 3JSMA 1S1TA 1HJRA 1VSKA 1Q9YA 2I5JA 5CZ2A 5KTQA 3PO4A 3RRGA 4FJ7A 2PYLA 4DSJA 1C1CA 2VWKA 4AHUA 4M3WA 3CG7A 3NF7A 4O0JA 1XC9A 3SCXA 4IFVA 1Q8IA 4E89A 3VA3A 5KRSA 1HNVA 3NGIA 3AVHA 4DTNA 1SUQA 3PX6A 3AVBA 3K5OA 4BDYA 1ZBLA 3NH2A 4HCBA 1ASVA 1X9WA 2ATQA 5HROA 3V9UA 3DRRA 5KRTA 2GV9A 4ICLA 5DK5A 3VQBA 3VQDA 2DTUA 4ELTA 1RILA 1NJZA 1LAWA 4NYNA 5K14A 4C8LA 1QS4A 3OYIA 4C8MA 2BANA 4GVMA 3C95A 4ID1A 3V9ZA 4DU3A 4F8RA 1VRUA 1QTMA 4BWJA 3VQ6A 5HRPA 4ELVA 1VSDA 1YT3A 4CJVA 3K5NA 4DSIA 3QINA 4E19A 3V1OA 4AHCA 1C1AA 4KKOA 4FCYA 1NKEA 3NF9A 1XWLA 4KHUA 3KLGA 3SQ0A 4ZTFA 3RR8A 2YHBA 4RW8A 2HVHA 3CYMA 2FBXA 3DLRA 1RDCA 4DTSA 1WSHA 3VQQA 1L3TA 1TKXA 3DLKA 4FVMA 4O5BA 4RW6A 4CEAA 1NK6A 1HYSA 3AVIA 3OYHA 4KFBA 5HRNA 4PA1A 3L2WA 3AVJA 4CFBA 3LAKA 4CERA 1S9EA 3K5LA 1IG9A 2G8HA 1RBRA 2LSNA 1QSYA 1B9FA 4CHNA 5JS2A 4KAZA 4B9LA 4ELUA 4BE1A 1L3SA 1SV5A 3L2VA 4FJXA 1IKVA 4FK4A 4KB1A 3AVAA 4KV8A 2F96A 4AHSA 4IFYA 3AA4A 3S3OA 1NK5A 1VSEA 4GW6A 4KI4A 1UAXA 1DTTA 4KHWA 4FYDA 4EP5A 1L3VA 4FLVA 4C8NA 3CFPA 2DFHA 2A1RA 2Z1JA 3KD5E 1QE1A 4DMNA 3OYDA 1N6QA 3NGYA 2G8FA 3ZSVA 3OYAA 4M45A 1NKBA 1A5WA 5CY4A 5HBMA 3KLIA 1N5YA 3AVGA 3HL8A 3RWUA 1KLMA 3WNEA 4E1MA 3E01A 1I39A 5KGWA 2OYQA 2EHGA 4FLZA 3ASMA 1IKWA 2VG7A 2G8IA 2RF2A 4NCAA 1VSLA 3MECA 4J2AA 4DSKA 2XHBA 1JXBA 3KD1E 4FW1A 3QLHA 3KKSA 1FKPA 2JLEA 1DLOA 1W0HA 3T1AA 5C25A 3AO4A 1SL2A 4NCBA 4M3ZA 3QO9A 3ZT0A 1JLFA 1IKXA 2YKNA 3MEEA 4W5RA 3QERA 2EX3A 3V6DA 4CFCA 4M3RA 4QAGA 1D8YA 1S1WA 3OY9A 1VRTA 3SV4A 1HYVA 3LP3A 4B8AB 3SUQA 2DY4A 3AO3A 1EP4A 3QIOA 1RBVA 2Z1IA 4H8KA 4HUEA 3TAGA 1NK8A 1RDDA 4FK2A 3VQ4A 5J1EA 5J2NA 2X6NA 4OKKA 3TAMA 4FJ9A 4B9VA 3AVKA 4RW9A 1NK0A 2HNYA 4KTQA 1S1XA 1QSLA 3VQ5A 2DFFA 1HRHA 3WNFA 1JL2A 2E6MA 4JLHA 3SQ1A 4KPYA 1KVBA 4CEZA 3VN5A 2F8SA 1WSGA 3HT3A 4CEEA 4FLXA 3ISNC 4HUGA 4FM0A 4KRFA 2G8WA 4DFMA 1ZBIA 3NBPA 3LAMA 4RW7A 3JYTA 4DU4A 3SJJA 2NUBA 2ZQBA 4CHPA 3AVNA 3K57A 4CJ3A 2ITGA 4DSLA 2OZMA 4CF2A 1L3UA 4BDPA 4FJJA 1CLQA 2DFEA 4E3SA 3HK2A 4TSXA 1KLNA 2QKKA 1NOYA 4QCLA 1Q9XA 1EKEA 1T8EA 2Y1IA 4W5QA 4B9SA 3OYJA 3F73A 2HW3A 2IGIA 3LZJA 4LD0A 4CE9A 3HSTB 1HYZA 3ITHA 5J2MA 4E0DA 3HPOA 1ASUA 1X9SA 1SL0A 1S6QA 1RTIA 3HPHA 4E1NA 1NJWA 1D5AA 1RBTA 4OKEA 4FJ5A 4KB0A 1LWCA 2JGUA 4WE1A 3IG1A 1WLJA 1RT6A 5SWMA 4Z4HA 3I8DA 3MEGA 3QEXA 1R0AA 2P1JA 3AO5A 3OYKA 2YV0X 4B8CA 3LWLA 2KZMA 1U04A 4OJRA 3DOLA 4CJ5A 4C8KA 1VSIA 1TKZA 1T05A 3UIQA 4HVJA 2R7YA 2D5RA 2YNIA 3KIOA 3VQ8A 4AHTA 3NDKA 3U6FA 2BDPA 3KTQA 4DU1A 4FW2A 3SQ4A 3M8PA 4CGJA 3P5JA 4CGFA 3KK1A 4CIGA 2XY6A 1UOCA 4B9UA 3DLGA 4DSEA 1LAVA 3C6UA 3KLFA 5HRRA 2Y1JA 1TK8A 2RPIA 1YVUA 4KHQA 4EZ9A 1J54A 3RMDA 1JLEA 3SYZA 2X74A 4OVLA 4CJLA 4Z4CA 3V81A 4BE2A 2YNHA 4W5OA 3QEWA 1TK5A 2X6SA 4DTXA 2OPRA 3AA3A 3WNGA 3AVCA 1C0TA 3WNHA 4DSFA 1I3AA 1RT3A 3KJVA 4CJEA 1C0MA 1SKWA 3P83D 4J2BA 1JLQA 1BGXT 3TI0A 3QEVA 1NJXA 3TWHA 4CF0A 4IKFA 4CK3A 2BE2A 4FJHA 1S1UA 1J5OA 4W5NA 3SPZA 4KHSA 1C0UA 2YKMA 4N5SA 4CJWA 4B08A 3OYFA 2AJQA 4AHVA 4DTRA 3L8BA 3PV8A 3ZT1A 4N41A 2HHWA 3OYBA 4H4MA 1X1PA 4FJKA 5EU7A 4F4KA 1JLGA 3NHGA 3VA0A 2IAJA 3DM2A 3L2RA 3QNNA 3LWMA 2PY5A 1ITGA 1REVA 3RRHA 4CEFA 3PO5A 2HNDA 3A2FA 1T7PA 3BGRA 1VK0A 4MQ3A 3ALYA 4FLTA 4PQUA 2G8KA 4CK1A 3ULDA 3S9HA 3ZCMA 3F9KA 4M3UA 1J53A 3AA2A 1G15A 5T7BA 4AHRA 4DTMA 4EP4A 4FZZA 4CK2A 4DQSA 1J9AA 3HP9A 5DMRA 4CESA 4FZXC 1GOCA 3AO2A 1D9DA 4F2SA 2OPPA 1RCHA 3S3MA 1S5JA 4OPJA 4B9TA 1BI4B 1NJYA 4CFAA 3KK3A 1XI1A 4CF9A 4UQGA 2E4LA 3MEDA 1TAQA 4IG0A 3ZSRA 1QQCA 4CGHA 5SZTA 3SV3A 4ZTJA 2QXFA 2X78A 5KI6A 3EYZA 4FM2A 3KK2A 1VSJA 3M8QA 4O44A 4H4OA 1HPZA 1EXQA 4Q5VA 1S1VA 3EZ5A 1TGOA 4FJNA 1ZYQA 3VQ7A 4BWMA 4N76A 4DTJA 1RNHA 4N56A 4E7JA 1D9FA 1ZBUA 1RDAA 3M8SA 4OGCA 1ZBFA 4CGGA 4HTUA 5HP1A 2B4JA 2HB5A 4GMJB 3CFRA 4I2PA 4FLWA 1BI4A 1U48A 3V1QA 1HNIA 1RT2A 2HHVA 1CZ9A 2HHTA 4KI6A 3HO1A 4CHQA 1VSMA 1WSFA 3I0SA 2B6AA 2PZSA 3OJUA 4Z4IA 4EZ6A 3P1GA 4Y1DA 3ZT4A 2IS3A 2FBVA 5CZ1A 1TVRA 3HVTA 3V9XA 4FJGA 3QIPA 1A5XA 4DF8A 1X9MA 1FKOA 3VQEA 3SNNA 1BQMA 3L2QA 1EETA 2D0BA 1NK4A 4Y1CA 1WAFA 3LPTA 2HHXA 3TANA 3CM5A 3DRPA 1UA0A 4C8OA 3T3FA 2F8TA 1KSPA 1RT1A 3OS0A 3RR7A 4HUFA 3OJSA 3ZSYA 1QSSA 2YNGA 4ZHRA 1MU2A 3V4IA 1LV5A 3OYMA 4O55A 3NF6A 1IKYA 1TL3A 4B9NA 3NH1A 3TAFA 1TKDA 3LZIA 3KLHA 4CHOA 3G0ZA 3IAYA 2VG6A 2O4GA 4CJSA 3DLBA 2A1SA 1RBSA 3HYFA 4RW4A 3ZSOA 1LWEA 4FXDA 3V9SA 2VG5A 3QEPA 3B6PA 4CJTA 5HLFA 3LALA 3V9WA 4CJUA 1K6YA 2Z1GA 4DLGA 4OLBA 3NF8A 2Q3SA 4E7LA 3OS1A 4I7FA 3NAEA 3SUOA 1Z26A 1CXUA 2XO7A 2P5GA 3NFAA 3T19A 3TAPA 4F3OA 1KCFA 3AVMA 3NCIA 5KGXA 4Q0BA 2GUIA 1TKTA 4I9LA 4YNQA 4XIUA 3MXIA 4E7HA 4L8RB 2ZD1A 4CHZA 4CJKA 3D45A 1U49A 3AV9A 1C1BA 3SZ2A 2GBZA 1WNSA 4F2RA 3HPGA 4JS4A 1TL1A 4CJPA 3ZSZA 3SUPA 2OA8A 4DG1A 4M3YA 4JRPA 2G8VA 1Y97A 1BCOA 4OKJA 4N47A 1KRPA 1GOBA 4CJ4A 4BACA 1NK7A 4DLEA 4NCGA 3TABA 1IH7A 4ID5A 3L3UA 4FJIA 4E7IA 4F3TA 2D0CA 3DYAA 3LP1A 1RTJA 2B5JA 4CECA 4LSNA 3MAQA 4FM1A 4DS5A 4M3XA 4I9QA 1ZBHA 4B3OA 2KZZA 4FJ8A 2QKBA 2HHUA 3VQPA 1UA1A 3CM6A 2HVIA 3O3HA 1LWFA 5FROA 1FXXA 3HVRA 1RT4A 4CEOA 3THVA 4M41A 3RTVA 4FJMA 4OPKA 3U3YA 4CJQA 1QHTA 1SL1A 1RBUA 4CGIA 1RT5A 2WONA 1TAUA 4M3TA 3B6OA 1NK9A 3VQCA 1YTUA 3QESA 1BIUA 3RMAA 1YTAA 3NE6A 4DQIA 2RKIA 3OYGA 1KVCA 3U3GA 3ZSXA 1U45A 5E41A 1T03A 4Z4EA 1CXQA 2FBTA 3K2PA 3C94A 1BHLA 1XHXA 3IS9A 2XY5A 4FJLA 1SKSA 4J2DA 4JRQA 5J2QA 5C42A 4QOZB 1BQNA 3BDPA 1S6PA 3K59A 5FRMA 3DLEA 4HHTA 3MXJA 4FLUA 4CJRA 2XY7A 3QEIA 4B9MA 3DI6A 4DFJA 3HJFA 4CHYA 4DTOA 4LSLA 1JLBA 2W42A 4W5TA 4E7KA 1JLAA 3G10A 4AH9A 4Z4GA 2QK9A 5HRSA 3L2UA 4MFBA 2PYJA 2D0AA 4CFDA 1FK9A 4RG8A 3ZT3A 3SUNA 1B92A 4IG3A 4FLYA 3KLEA 4LH4A 3DLHA 2KQ2A 3PUFA 1VSHA 5C24A 3VQ9A 3ZSWA 3OYLA 3K58A 5J2PA 4DFKA 3PY8A 4PWDA 3AO1A 4KO0A 2HHQA 2E6LA 4CCHA 3RMCA 1RTDA 1BCMA 4DWIA 3MXMA 1KTQA 2P5OA 3C6TA 2WOMA 4JS5A 1KFDA 1NKCA 5FRNA 4DS4A 4KTZA 1A5VA 2IDOA 3TARA 3NH0A 3OYNA 3EY1A 1RT7A 3DOKA 3DRSA 4CIEA 3LDSA 2VWJA 1U47A 2YHAA
chains in the Genus database with same CATH superfamily
3IMXA 3WXKA 3VF4A 1XMOK 4G1QA 3S3NA 2RN2A 3FE1A 3TAEA 4J2EA 4O5FA 2ZJRL 4LFCK 4K8XA 1VSFA 3LPUA 3WUHA 1GOAA 4YDUA 1BISA 1JLCA 2ZE2A 4FK0A 3AVFA 3TR8A 2Q0RA 4A2BA 4G9ZA 4ISEA 4IOXA 3J7AP 1S9GA 3FR0A 4OLAA 5BPMA 1WOQA 1X3NA 3CQYA 2UUCK 3ENBA 1T6CA 1NGEA 3GG4A 5I3UA 2V51B 3IRXA 2YNFA 2OPSA 2HNZA 1B9DA 5BREA 1LOTB 5CYMA 1BO5O 1LW0A 3UKRB 3VQAA 4CEQA 4YOYA 1KFSA 4Y0WA 1YJNN 3FZFA 4BRHA 3CMAN 4IDKA 2F7TA 1RDBA 3CFOA 4BC4A 2KTQA 2VYPA 3CD6N 5JS1A 4GV3A 3HXMA 2Q31A 4OGEA 3JSMA 1Q9YA 3PO4A 2I5JA 5CZ2A 3C6AA 2VWKA 3CG7A 1XC9A 2O8EB 2P9PA 3QB0A 4E89A 3AVHA 4YOUA 1SUQA 4BDYA 3QFPA 1JCEA 4NXNK 2CGJA 2F9WA 2I7NA 2ZWHA 2GV9A 3VQBA 2DTUA 2BH1A 3J80O 1NNEA 1NJZA 1LAWA 1IG8A 4C8MA 4MO4A 4YOWA 4IOAL 1YAGA 1K73O 1XWLA 2OANA 3RR8A 3VQQA 4RW6A 5AQNA 4CZFA 1HYSA 2O8CB 4LF6K 4PA1A 1C0GA 3U9DA 1IG9A 1S9EA 3K5LA 2PFUA 5AQYA 1B9FA 3UE5A 4JKCA 1NGJA 5C2FA 1MDUB 2F9TA 1NK5A 3S3OA 4JKAA 3CCVN 1U6ZA 4FYDA 1DGKN 4EP5A 1L3VA 2UXBK 1XNQK 1VQ6N 4DMNA 5GIOA 3OYDA 3QDKA 4BRGA 4HWIA 1NKBA 4CBWA 5AQKA 1A5WA 5CY4A 4GV6A 3FZHA 3RWUA 1KLMA 3VGMA 1I39A 1HUXA 4FLZA 1IKWA 4DQ8A 3VGKA 2VG7A 2RF2A 4JKBA 4JHDA 4FOIA 1YI2N 1W0HA 4DV3K 4M3ZA 3ZT0A 1NU0A 1M1KO 1VQPN 4W5RA 3U9ZA 3SV4A 2DY4A 4IEIA 1HYVA 2A41A 1NK8A 5FPMA 4HUEA 3TAGA 3VQ4A 5BRHA 1Q81O 5KPTA 4C1NI 1GLAG 3WXJA 1JCGA 4I6MB 3AVKA 3CCQN 1Q82O 4FWOA 1S1XA 3TSQA 1QSLA 2DFFA 3WNFA 1HRHA 1JL2A 4JLHA 3ISNC 4HUGA 4KRFA 2UU9K 3G4SN 3JYTA 3KWGA 3LAMA 4DU4A 4CJ3A 2ITGA 4DSLA 1L3UA 2DFEA 3HK2A 1GLDG 3SMPA 2O8DB 1T8EA 2Y1IA 1WBBA 2HMPA 1VQON 3HOTA 4DR1K 3T1HK 3DXMB 4LD0A 5C10A 3HSTB 2QA4N 4E0DA 1SL0A 3HPHA 1IBMK 4DV5K 4IFEA 1RT6A 3WEEA 4J8FA 4C8KA 1VSIA 3CF5L 1T05A 4HVJA 3S41A 3BF3A 4DU1A 4M63C 3LDNA 2YHWA 4E1JA 3DLGA 5HRRA 4JI8K 3O1WA 1TK8A 4WYBA 4DR5K 5JVGL 3SYZA 4CJLA 5AFUA 1NBWA 2Q2RA 2YNHA 3AA3A 3WNGA 5BRDA 4DSFA 4CJEA 1SKWA 3P83D 2ASPA 3H45C 5TKWA 1BGXT 1NJXA 3TWHA 1J5OA 1TYQB 4NLCA 3OYFA 2AJQA 4AHVA 3L8BA 3ZT1A 2GUPA 3OYBA 5EU7A 4F4KA 4KHPK 1NJIO 4H5NA 3QNNA 4BQZA 1JJ2M 2V7YA 3RRHA 4CEFA 2HNDA 3A2FA 1Y64A 5AQIA 4A5AA 5CR4A 4MQ3A 4FLTA 3IUCA 4H0TB 4CK1A 4WF9L 2ZGYA 4M3UA 1S22A 2ITMA 2FF6A 5LMNK 1BUPA 4DR3K 2IVPA 1QZ5A 4B9TA 1BI4B 3I8BA 3KK3A 4BGAA 4BR2A 2E4LA 5SZTA 3JAMO 2X78A 5AQSA 1VSJA 4O44A 4Q5VA 3EZ5A 1N34K 3VQ7A 4IXCA 3C6HA 4E7JA 1D9FA 1ZBUA 1VQ8N 4OGCA 4CGGA 4HTUA 3D2EA 3AARA 4FO0A 1CZ9A 2HHTA 1HKCA 4UY8O 5AR0A 3I0SA 4BROA 2PZSA 2PBDA 3ZT4A 5CZ1A 2D0BA 3TANA 2F8TA 1UA0A 4QS7A 3T3FA 1RT1A 3HBTA 3OS0A 1Q86O 1WUAA 2YNGA 1QSSA 1LV5A 3OYMA 4O55A 4CD1A 2UUBK 4B9NA 5AQUA 2FF3B 5BN9A 2UXCK 4WQ5A 2P9LB 3AGRA 1KAZA 3SAFA 1BA0A 3VTHA 1RBSA 4DV2K 4LF7K 3V9SA 2CGKA 4B3TK 1GLBG 4CJUA 4IJNA 4XH1A 4I7FA 3LM9A 4JKHA 2XO7A 4JI2K 3F9MA 4IOCL 5AZIB 3MXIA 4E7HA 4CHZA 2QWMA 4JD2B 2A40A 3AV9A 1WNSA 1QVGM 4M3YA 2QWRA 2G8VA 1QHAA 3SLCA 4B1VA 1GOBA 4JKGA 4CBXA 4FJIA 3DYAA 1RTJA 1LCUA 4M3XA 3THWB 1ZBHA 3DWLA 2HHUA 2QKBA 2FSKA 2IIRA 5AFUH 3THVA 4YDUC 2NZTA 3KZBA 3MWTA 1RT5A 2WONA 4AM7A 1S72N 3O5BA 3VQCA 4IO8A 1HNZK 3QESA 4DQIA 2AA4A 3ULEA 2RKIA 3L6QA 5BRFA 5E41A 4YY3K 5F0XA 3E66A 4CVNE 3PLAA 3R3LA 1XHXA 3ENOA 4JRQA 5C42A 4QOZB 4BRQA 3MX5A 3DI6A 4DFJA 3HJFA 4CHYA 4X65K 1JLBA 4FPBA 1NGHA 2AP1A 4W5TA 4Z4GA 3KHYA 5HRSA 4CFDA 3A0IX 5BR8K 4LH4A 3G25A 3K58A 3EZWA 2W40A 4JI1K 4FVUA 2E6LA 2HHQA 1RTDA 1KFDA 3O9RA 2IDOA 2E2QA 4CIEA 2VWJA 1OH6A 4NB4A 4DHYA 3KLHA 3J8AA 4KREA 3AGKA 1IO2A 3FZLA 3VEZA 4DQRA 4L3QA 2KKZA 3QNOA 4I2QA 4BE0A 4JI6K 3OVNA 3M6GA 4FWLA 3CJCA 1F21A 4IZ9A 4DF4A 1VQ7N 1QVFM 2O4IA 4O0IA 1WSEA 1ASWA 1CZBA 1C6VA 2P51A 4AM6A 3RVCA 3HI0A 4ISGA 4FWQA 1W9HA 1XUPO 2XRIA 3CMEN 4KHYA 1WSIA 3ID6A 3DMJA 2HOEA 1GLFO 4R5PA 5I42A 2FBYA 5EX5A 2O8BB 2FSJA 3DXKB 1HMVA 4O4GA 3T1YK 3CJ7A 1V4SA 4CJFA 4GVEA 1VQMN 1RDWX 3TAQA 3WXIA 1N32K 1BL3A 3DLLL 1SKRA 3CQ8A 3O80A 3Q7CA 3K5MA 3ZT2A 4DQPA 3OYCA 2XY8A 3MN6A 1XHZA 3O4NA 4KHNA 4IBNA 2VCPA 4DQQA 1K9MO 3I0RA 4YORA 1HJRA 3UKRA 3RRGA 4LF4K 2QW9A 4M3WA 1C1CA 1XC3A 3NF7A 4O0JA 4BRKA 4IFVA 5KRSA 3QBWA 3CHWA 5IWAK 4WCEL 3AVBA 1ZBLA 3NH2A 1IJJA 2NLXA 2ATQA 3BP8A 3VF6A 1KQSM 4ICLA 4JKEA 5DK5A 4DV6K 4C8LA 4U7BA 3OYIA 2O8EA 1VQNN 4CZKA 3V9ZA 4M7XA 5FPEA 4CJ7A 5HRPA 4X64K 1YT3A 3K5NA 4OO1J 4MO5A 3V1OA 3W0LA 1C1AA 3CETA 3MX2A 5C15A 3KLGA 3VENA 4RW8A 2FBXA 5E84A 3DLKA 4H0XB 4A5BA 1NK6A 1E4GT 3OYHA 3WXLA 3NMUA 4BQLA 2A6AA 4KFBA 3L2WA 3AVJA 2VGMA 4CFBA 3A5OC 1RBRA 1EWQA 1QSYA 5JS2A 4JEPA 1W97L 4ELUA 1NGAA 5JLHA 3VEWA 1YHQN 1VSEA 3A5LC 4GW6A 3M3ZA 1CZAN 1E3MA 2P9UB 4B9QA 3CCLN 2O8CA 2P9NB 2DFHA 2G8FA 3OYAA 4GNIA 5HBMA 3KLIA 1N5YA 5B8HA 5KGWA 3QBXA 2OTLN 5M1OA 4NCAA 1VSLA 3MECA 4DSKA 1WB9A 3BZCA 3QLHA 5F1XA 4K0KK 1FKPA 1DLOA 3TSPA 1SL2A 4FWKA 2BUPA 5M1KA 1JLFA 2YKNA 3MEEA 3QERA 3V6DA 1S1WA 3OY9A 3LP3A 1R59O 3OA9A 4FK2A 5J2NA 2X6NA 2HNYA 4CEZA 1H1VA 2F8SA 3HT3A 4CEEA 4FLXA 3CCRN 4DFMA 3CQXA 4GKKK 3SJJA 4CHPA 3AVNA 3H6EA 5EOYA 3H1QA 4BDPA 4FJJA 1CLQA 3K9JA 2A3ZA 1NMDA 3O1BA 4QCLA 1Q9XA 4B9SA 4W5QA 4I6MA 3OYJA 3F73A 3ZX2A 3LZJA 1OH5A 3J7YP 1HYZA 3ITHA 3HPOA 2O8FB 1S6QA 4BC2A 4JI5K 1NJWA 4WQ4C 1GLEG 4OKEA 4B1XB 1RGIA 2JGUA 4DR4K 4WE1A 4BVOA 1J6ZA 5HL7L 5SWMA 4F9OA 2YV0X 4B8CA 3DOLA 3EEQA 3VEXA 4CJ5A 2O8DA 2D5RA 1JCFA 2ZJPL 3DXMA 3KK1A 4CIGA 1HR0K 1SAZA 3WXMB 1YVUA 1J54A 3RMDA 3EL2A 2X74A 1W7AA 4BE2A 1TK5A 3TU5A 3T69A 5BPNA 3KJVA 2F4VK 4FSVA 3TI0A 3ZLJA 4CZHA 4B1YB 4CF0A 3G71N 4FJHA 1S1UA 2YJFA 3PSFA 3SPZA 2YKMA 4O8KA 2VWBA 4BG9A 4DTRA 3PV8A 3MCAB 4N41A 5EY4A 1E4FT 4BG8A 3DJCA 3L2RA 4DR2K 2PY5A 1ITGA 1REVA 3QFUA 1VAZA 1KAYA 1TYQA 1Z6RA 5JVHL 3S9HA 3ZCMA 1J53A 5T7BA 1J9AA 5DMRA 3VEOA 4B1UB 1W2BM 2NRHA 4CESA 4FZXC 1D9DA 4XH5A 1K8AO 3KVGA 3TTDA 4BRFA 1NJYA 1XI1A 4DUZK 3ZSRA 1QQCA 3SJHA 4CGHA 4KH4A 5KI6A 3JS6A 4H4OA 1EXQA 4C23A 4DKWA 3IFRA 4BRLA 2E20A 2B4JA 4R79A 3CFRA 4FLWA 1BI4A 2HHVA 1HNIA 1RT2A 5C2DA 4YOXA 5AQOA 3H3NO 4PL8A 1BG3A 1WSFA 4Z4IA 4EZ6A 1XQSC 4Y1DA 1NGFA 2Q36A 3GE1A 2IS3A 4AF1A 1RDUA 3BUZB 3HVTA 1O13A 1A5XA 1RFQA 4DF8A 1X9MA 5LMUK 1EETA 1HPMA 1WAFA 1P8ZA 3CM5A 3DRPA 4C8OA 4KH6A 3OJSA 4BRIA 3ZSYA 4ZHRA 1MU2A 2HF3A 5AQGA 1IKYA 3BY5A 3W3DA 2ZGZA 3C7NB 1TKDA 3R8EA 5A2QO 4DV7K 2D1KA 4BREA 2OTJN 1EO1A 1LWEA 3H3OB 4FWPA 3QEPA 2P9SB 3B6PA 5HLFA 2ASOA 3LALA 1K6YA 2CH5A 2Z1GA 3O6WA 4OPAA 3SUOA 1SS6A 3NAEA 1Z26A 1CXUA 5AQJA 3THXB 1VQ9N 1N33K 2P5GA 3NFAA 3DAWA 1KCFA 5AQHA 2GUIA 5FLXO 2P9LA 2ASMA 1U49A 3J81O 2GBZA 4JI3K 3HPGA 1TL1A 3SUPA 5AQFA 3P38A 4N47A 4BACA 3L4QA 4NCGA 4E7IA 2D0CA 3L4IA 2B5JA 4LSNA 5AZIA 1K8KB 1N36K 4I9QA 4B3OA 3LDPA 2QWLA 1VHXA 4JD2A 4BC3A 2QXLA 2HVIA 3FFKB 3HVRA 1RT4A 3RTVA 4JKFA 3GBTA 3CCEN 1SL1A 4DCHA 1VQ4N 4GKJK 3E9OA 3CI5A 1BIUA 3RMAA 1YTAA 3O08A 3NE6A 3OYGA 2IVOA 3THWA 4Z4EA 5KQ8A 1CXQA 2FBTA 3SAGA 4NXMK 4K25A 3IS9A 1ZXOA 4LC9B 5J2QA 4DB3A 1S6PA 3IDHA 3K59A 5FRMA 4FLUA 5AQPA 3TTFA 2NNWA 4BR5A 5HOOA 4H5WA 3THYB 4LFBK 2PYJA 1FK9A 1OH7A 3ZT3A 1B92A 4FLYA 2QEXN 2W41A 3O8MA 3TTCA 3DLHA 3PUFA 1NGIA 1YIJN 4DWIA 3MXMA 2P5OA 1YJ9N 2WOMA 5FRNA 3UB5A 1NKCA 4X62K 1KD1O 3CCUN 3OYNA 3EY1A 3DRSA 3I55N 4PKIA 3GL1A 1WN7A 3SBTA 5AQRA 3AVLA 3PSIA 4EAHD 3SK3A 1TK0A 4FOEA 4MDBA 2ETJA 5F2RA 1LW2A 3H08A 3QICA 1TV6A 4LH5A 5ADXH 5AQQA 4B3SK 3O4QA 4LY7A 4FWNA 3WQUA 3J7ZO 4YOVA 4JYAK 3CC2N 4FZYA 2FC0A 1T6DA 4KTWA 2YX6A 3L3VA 2GTDA 3HM8A 2KFNA 3O3GA 2E88A 2QWPA 3VF2A 5GIPA 3LP0A 1JXEA 3D0PA 4B1ZA 3H1VX 4GV9A 3AA5X 2Z1HA 4DUYK 3O3FA 3OS2A 5D3GA 2GEMA 2YHYA 3MCPA 1DTQA 2OZSA 4BDZA 3P4IA 1SQKA 3ATUA 3LANA 4LF5K 3C65A 3V1RA 2HMIA 3EN9A 1KVAA 1NWKA 4BR4A 3KWIA 3CPWM 3QETA 1GLCG 3IKMA 1U4BA 4K8ZA 4CF8A 2BGGA 2O8BA 3OTOK 3DXKA 3HP6A 2GELA 1Z25A 1IBKK 1UWBA 5CYQA 3ZSQA 2QWOA 4FL9A 4M7YA 4CGDA 1WSJA 4NYFA 1RTHA 4YHHK 1S1TA 4FWRA 1VSKA 4HTLA 5KTQA 3ZETB 2QTDA 3F5TA 1HX1A 4FJ7A 2NRZA 2PYLA 2NRXA 2A42A 3SCXA 1Q8IA 2QM1A 1GLLO 3EKUA 2ZM6K 1VQLN 4Z94A 3ZEUB 4DTNA 3K5OA 1DT9A 4HCBA 3DRRA 2VGNA 4BRCA 1NMNA 1RILA 4NYNA 2BANA 4GVMA 3C95A 4DU3A 1WBDA 5DM6L 1VRUA 3VQ6A 4ELVA 4DSIA 1TUUA 4LF8K 5JMVA 4E19A 4OX9K 3CXCM 4KKOA 4FCYA 3NF9A 2E2OA 2HVHA 4BRMA 3DLRA 1RDCA 4DTSA 1WSHA 4O5BA 4CEAA 3AVIA 1BA1A 5HRNA 4CERA 4RTFD 4PKGA 2FXUA 4CHNA 5FPDA 4KAZA 4JI4K 3ID8A 4B9LA 4BE1A 4FJXA 1SV5A 3FGUA 3L2VA 1HJOA 2E1YA 4FK4A 3AVAA 4KV8A 2F96A 1UAXA 5GINA 2NRWA 3I33A 4KHWA 2YI1A 1YJWN 4FLVA 3CFPA 1NLVA 2A1RA 4BC5A 2Z1JA 3KD5E 1TUYA 1QE1A 4BRNA 4FPAA 2DPNA 3NGYA 3VOVA 1DEJA 4CZLA 3AVGA 1X3MA 3HL8A 3WNEA 4E1MA 3E01A 3ASMA 2G8IA 3GDQA 2P9UA 4J2AA 2P9NA 4FW1A 2J4RA 2JLEA 1ATRA 5C25A 3AO4A 5BR9A 2EX3A 5GAEP 4QAGA 4A2AA 4JI7K 1VRTA 3AO3A 1EP4A 3QIOA 2Z1IA 5J1EA 3P39A 2W6KA 2CH6A 1NK0A 4KTQA 3RSEB 3CC4N 4KPYA 2YHXA 4PL7A 1KVBA 3JXUA 1KAXA 1WSGA 2JWLA 4NLBA 3R9PA 1ZBIA 1Q7YO 4RW7A 4JI0K 3CERA 2ZQBA 3VGLA 2OZMA 4E3SA 2QKKA 1EKEA 1ILYA 2IGIA 3EE9A 4CE9A 1G99A 1ASUA 3HTVA 2WTUA 5AQTA 1D5AA 1RBTA 1LWCA 4A62A 3CJ1A 1WLJA 3QEXA 3I8DA 2P1JA 2PAVA 3AO5A 3OYKA 4OJRA 1QQOA 5E26A 3UIQA 5FPNA 2R7YA 3KIOA 3CJBA 3VQ8A 4AHTA 3U6FA 2BDPA 2BTFA 3KTQA 3CIPA 3SQ4A 4CGFA 3P5JA 2O8FA 2XY6A 4BR7A 4C1NK 4B9UA 1LAVA 3KLFA 1GLJO 2QI2A 4K42A 2RPIA 2Y1JA 3HZ6A 4EZ9A 4CZEA 4OVLA 4Z4CA 3T7ZA 2E2PA 4W5OA 3LDLA 2P9IB 4YOTA 4DR7K 3D2FB 1YUWA 2OPRA 3WNHA 2Q97A 1I3AA 1EQYA 1NGCA 1JLQA 3QEVA 4IKFA 3O9UA 4CK3A 4A59A 2GWKA 3FLCO 4CD3A 4N5SA 2VQEK 4CJWA 2HHWA 4H4MA 1X1PA 5M1FA 3NHGA 4ILJA 2IAJA 1NGBA 3LWMA 1HKGA 1T7PA 2HBLA 2D4WA 3BGRA 4BY9C 3ALYA 3O4WA 3PIOL 2G8KA 5DM7L 5IT9O 3AA2A 4DTMA 4AHRA 4FZZA 4CK2A 1QZ6A 1N8RO 1GOCA 3AO2A 2OPPA 1BWFO 1KXPA 3S3MA 4OPJA 2CGLA 1EWRA 2UYTA 5AQMA 4CF9A 2P9KB 4UQGA 1P90A 3MEDA 2ZF5O 3LL3A 3SV3A 2QXFA 3EYZA 4RWTA 1BDGA 4FWMA 3KK2A 3OW2M 1HPZA 1QQNA 4FJNA 1ZYQA 4BWMA 4N76A 4DTJA 1RNHA 5JLFA 1RDAA 1ZBFA 4GMJB 3BEXA 4I2PA 1U48A 3V1QA 5AZJB 4BGBA 4EHTA 4CHQA 3OJUA 3P1GA 4DV1K 1Z05A 2FBVA 4FJGA 1TVRA 3V9XA 1FKOA 5EVZA 3SNNA 3VEYA 3L2QA 4Y1CA 2HHXA 5GAGP 3UKUB 4KH5A 3LDOA 3RR7A 4QS8A 4B1WB 2FLOA 1TL3A 3NH1A 3G0ZA 3IAYA 3K9KA 2VG6A 2KLAA 3DLBA 3HYFA 3ZSOA 4FXDA 2A5XA 3V9WA 4DLGA 5LL6Z 1KC8O 4QS9A 4E7LA 2E2NA 3AAQA 4DR6K 4F3OA 1OVQA 3C7NA 3NCIA 4Q0BA 5KGXA 3O9TA 1TKTA 4I9LA 4L8RB 3BZKA 2ZD1A 3D45A 1C1BA 3SZ2A 4F2RA 4JS4A 1XMQK 2OA8A 4DG1A 1J5EK 2P9SA 3AAPA 1Y97A 1BCOA 4DV0K 3LDQA 4CJ4A 4DLEA 3TABA 4ID5A 4U67L 3L3UA 3THXA 5AQLA 4FM1A 3LM2A 4FJ8A 4JK9A 3VQPA 3O3HA 1FXXA 4M41A 4OPKA 3O9QA 1QHTA 5LJVA 4CGIA 3B6OA 1NK9A 3AY9A 1YTUA 1K8KA 1NG9A 1KVCA 3U3GA 3ZSXA 1U45A 1T03A 1U2VB 3SAHA 3K2PA 1BHLA 5LJWA 3DLEA 3FZKA 3MXJA 4H5RA 4CJRA 3ATVA 1OVYA 3QEIA 4B9MA 2W42A 4E7KA 2QK9A 1JLAA 3G10A 4WQ5C 4AH9A 1MWKA 3ENHA 2E8AA 3SUNA 4IG3A 1NM1A 3MMVA 3KLEA 1C0FA 2KQ2A 3VQ9A 5J2PA 4PHTX 4CCHA 3RMCA 1BCMA 3U8XA 4JS5A 4DS4A 4KTZA 1A5VA 3TARA 1SZ2A 3THYA 3LDSA 3EO3A 4LF9K 2YHAA 5ADXA 3CCJN 3PX0A 1O1WA 3PX4A 4CF1A 3A5NC 2G8UA 1HQUA 4YFUA 3SPYA 1HQEA 5LY3A 3OYEA 2KW4A 4Z4FA 3HSCA 5JICA 4PUOA 1WAJA 4JK8A 1NOZA 1BIZA 4H03B 2KFZA 4DFPA 3OHRA 4CEBA 4B3RK 3KKRA 1FW6A 5EXWA 3HM9A 4DTUA 3FFIA 3MK6A 1EX4A 3SQ2A 4DTPA 3E1YA 5BN8A 3RMBA 3OBWA 4CEDA 5FDLA 4AILC 4O8UA 4H0YB 2HHSA 4JK7A 2OPQA 3VERA 1JL1A 4HCCA 3NGZA 3LP2A 2H3GX 3M5RA 2WC9A 5AQVA 3U4LA 3SMSA 4PY5A 2P9PB 1M90O 1L5UA 3SI6A 3VTIA 1XNRK 3M8RA 5AJ3K 4Z0UA 1JKHA 4CIFA 2IOCA 3H46O 2IC3A 3GOIA 3B8AX 4NO7A 3SBGA 4DSJA 4AHUA 2HF4A 3I56N 3D6RA 3Q7BA 3VA3A 1HNVA 3NGIA 3PX6A 1IBLK 1ASVA 1X9WA 5HROA 3V9UA 1T44A 5KRTA 3VQDA 3ZETA 4ELTA 2NRRA 5K14A 1QS4A 3VESA 4ID1A 2IVNA 3ZEUA 4F8RA 1QTMA 4BWJA 1HNXK 1VSDA 4CJVA 3QINA 2FSNA 4AHCA 3CJ9A 1NKEA 4B3MK 4KHUA 3SQ0A 4ZTFA 2YHBA 4CI6A 5GADP 3EKSA 3HOSA 3CYMA 4IDHA 4KBOA 1L3TA 2ZJQL 1TKXA 4FVMA 4WFBL 3MN9A 2G8HA 3LAKA 4ILGB 3VMFB 4ILHA 2LSNA 2YJEA 5KPRA 1L3SA 2HBKA 1IKVA 1MA9B 4KB1A 4AHSA 4IFYA 3AA4A 4KI4A 3ZYYX 4JN4A 4WQ4A 1DTTA 5AQZA 4JHDB 4PKHA 4H0VB 1VQKN 4C8NA 1HNWK 1N6QA 3ZSVA 4M45A 3A8YA 3MN5A 5BPLA 2OYQA 4BVPA 2EHGA 1T3VA 1YF5L 2Q1NA 2XHBA 1JXBA 3R1XA 4JKDA 3KD1E 3CCMN 3KKSA 2QWNA 2HSTA 3T1AA 4NCBA 3QO9A 5M1QA 1IKXA 1YVNA 4CZMA 4CFCA 4M3RA 1D8YA 3SUQA 4B8AB 4DV4K 1RBVA 4H8KA 1RDDA 4FWSA 4MDAA 1ATSA 2E5LK 4JV5K 2KHOA 3P31A 4OKKA 3TAMA 4FJ9A 4B9VA 4ISFA 4XH4A 4RW9A 1VQ5N 3BF1A 4M42A 3VQ5A 3M1FA 3SQ1A 2E6MA 5GAHP 3VN5A 1HKBA 3TSUA 4EFHA 5KPZA 4X66K 4FM0A 2G8WA 3NBPA 2V7ZA 4CBUA 3KK7A 5C12A 2JWKA 2NUBA 3WEEB 3K57A 3CPEA 4CF2A 4TSXA 1KLNA 3ZX0A 1NOYA 3E9PA 2OCEA 3RSEA 2HW3A 4K41A 5J2MA 3FZMA 1X9SA 4H5VA 1D4XA 1RTIA 4E1NA 3EE8A 4AQYK 4FJ5A 4KB0A 4A61A 2W6LA 3IG1A 4Z4HA 1R0AA 3MEGA 3LWLA 2KZMA 1U04A 1TKZA 2YNIA 3NDKA 1NGDA 1HLUA 3WQTA 4FW2A 3M8PA 4CGJA 1UOCA 4DSEA 3C6UA 1IV0A 3ZX3A 4KHQA 5MLCQ 1JLEA 2EWSA 1BU6O 2HBJA 3QMLA 3V81A 3QEWA 2X6SA 4DTXA 2I7PA 3AVCA 1C0TA 1RT3A 3O9SA 1YXQA 1C0MA 4BRPA 4EIAA 4J2BA 4A57A 4IO9L 2BE2A 4W5NA 4KHSA 1C0UA 4B08A 5AQWA 4CZGA 4RCHA 2P9IA 4FJKA 3D2FA 1JLGA 2WFBA 3HRGA 4WFNL 3VA0A 3DM2A 4K43A 2HHHK 3CJAA 1FJGK 3PO5A 4CW7B 1S3XA 1BOTO 1VK0A 1Q18A 4PQUA 5CHIA 3ULDA 3F9KA 1G15A 4EP4A 4DQSA 5AQXA 3HP9A 4F2SA 1OH8A 3D2EB 1RCHA 1S5JA 2QWQA 4CFAA 4IJAA 4IG0A 1TAQA 4ZTJA 5H1SQ 4FM2A 3M8QA 3VPZA 1S1VA 1TGOA 3PIPL 3MWPA 4N56A 1YITN 4H0PA 3M8SA 5HP1A 1NGGA 2HB5A 2E1ZA 4JAXA 4KI6A 2P9KA 4OPHA 3HO1A 5C0YA 1VSMA 1QQMA 3MN7A 2B6AA 3NVKA 1ZC6A 3QIPA 3VQEA 3NVMA 1BQMA 1NK4A 3LPTA 3VEVA 1I94K 1KSPA 2NRTA 2WBNA 2YCHA 4HUFA 5AZJA 3A5MC 4CZJA 3K0SA 3V4IA 3CCSN 3NF6A 3TAFA 3LZIA 2Q0UA 4CHOA 2O4GA 4BR0A 1V4TA 4MLEA 4CJSA 2A1SA 2RHKA 4V19S 2D0OA 4RW4A 2GWJA 3D7EO 2VG5A 4CJTA 3MDQA 3UKUA 3L0QA 4H0OA 1ZBSA 4OLBA 4JKGB 3NF8A 2Q3SA 3OS1A 3F2KA 5KQDA 3T19A 4GY2B 3TAPA 3AVMA 2GX9A 1ESVA 1MWMA 5ELZA 4YNQA 4XIUA 4CJKA 1OKJA 4EHUA 3C0BA 4CJPA 3ZSZA 4JRPA 4OKJA 1KRPA 1NK7A 2D0PA 1IH7A 4F3TA 3LP1A 2VQFK 4CECA 3ULEB 3MAQA 1DKGD 4IEEA 4DS5A 3CC7N 2KZZA 4JNEA 4IWVA 1UA1A 3CM6A 4BRAA 1LWFA 4BRDA 5FROA 5CE3A 2V52B 4CEOA 4FJMA 5M1PA 3U3YA 3N4QA 4CJQA 1RBUA 2NRVA 1X9JA 1TAUA 4M3TA 3TPQA 3N4PA 4H5TA 5M1NA 3G6EN 3C94A 2HBMA 2XY5A 3OBYA 4FJLA 1SKSA 4J2DA 1BQNA 3BDPA 4HHTA 2XY7A 4CZIA 2UUAK 2WUSA 4DTOA 4LSLA 4WFAL 3L2UA 4MFBA 2D0AA 4RG8A 4XEIA 4BR9A 1U2VA 3OYLA 1VSHA 5C24A 3ZSWA 2RE2A 3PY8A 4PWDA 2UXDK 4DFKA 3AO1A 4KO0A 5I9EB 1KTQA 3C6TA 3VETA 1ATNA 5TKYA 4MLHA 4LFAK 3NH0A 3WT0A 3R6MA 1RT7A 3DOKA 3E9LA 1U47A
chains in the Genus database with same CATH topology
4KREA 3PX0A 1IO2A 1O1WA 3PX4A 4G1QA 4CF1A 1WN7A 2RN2A 4DQRA 3S3NA 2G8UA 1HQUA 3QNOA 4I2QA 4YFUA 3TAEA 4BE0A 4J2EA 3SPYA 3OVNA 1HQEA 3AVLA 4K8XA 3OYEA 1F21A 2KW4A 4Z4FA 4DF4A 1TK0A 1WAJA 4PUOA 1VSFA 2O4IA 1NOZA 4O0IA 2ETJA 3LPUA 1BIZA 1ASWA 1CZBA 1LW2A 1WSEA 1GOAA 3H08A 1C6VA 2P51A 1TV6A 4LH5A 1BISA 1JLCA 2KFZA 2ZE2A 4FK0A 4DFPA 3AVFA 3O4QA 4LY7A 3TR8A 1W9HA 4M42A 4CEBA 4FZYA 2FC0A 3KKRA 4KTWA 3HM9A 2XRIA 3L3VA 4DTUA 1S9GA 1WSIA 3DMJA 4KHYA 2KFNA 3O3GA 3FFIA 4R5PA 4OLAA 5I42A 2FBYA 1EX4A 3SQ2A 3LP0A 4DTPA 1JXEA 3D0PA 3RMBA 3AA5X 1HMVA 2Z1HA 4O4GA 5I3UA 4CEDA 3IRXA 2YNFA 3O3FA 3OS2A 5D3GA 4CJFA 5FDLA 1DTQA 4AILC 2OPSA 2OZSA 2HHSA 4BDZA 2HNZA 1B9DA 3TAQA 3LANA 2OPQA 3V1RA 2HMIA 5CYMA 1KVAA 1JL1A 1LW0A 3VQAA 4CEQA 4HCCA 1BL3A 3NGZA 3LP2A 3QETA 1SKRA 3CQ8A 1KFSA 1U4BA 4K8ZA 4CF8A 3K5MA 3ZT2A 2BGGA 4PY5A 3HP6A 1L5UA 1Z25A 4IDKA 3SI6A 4DQPA 3OYCA 1UWBA 5CYQA 2XY8A 3ZSQA 1RDBA 4Z0UA 3CFOA 3O4NA 3M8RA 1XHZA 1JKHA 4CIFA 4KHNA 2KTQA 4IBNA 4DQQA 2IOCA 3I0RA 4CGDA 3HXMA 5JS1A 1WSJA 2IC3A 4NYFA 1RTHA 4OGEA 3JSMA 1S1TA 1HJRA 1VSKA 1Q9YA 2I5JA 5CZ2A 5KTQA 3PO4A 3RRGA 4FJ7A 2PYLA 4DSJA 1C1CA 2VWKA 4AHUA 4M3WA 3CG7A 3NF7A 4O0JA 1XC9A 3SCXA 4IFVA 1Q8IA 4E89A 3VA3A 5KRSA 1HNVA 3NGIA 3AVHA 4DTNA 1SUQA 3PX6A 3AVBA 3K5OA 4BDYA 1ZBLA 3NH2A 4HCBA 1ASVA 1X9WA 2ATQA 5HROA 3V9UA 3DRRA 5KRTA 2GV9A 4ICLA 5DK5A 3VQBA 3VQDA 2DTUA 4ELTA 1RILA 1NJZA 1LAWA 4NYNA 5K14A 4C8LA 1QS4A 3OYIA 4C8MA 2BANA 4GVMA 3C95A 4ID1A 3V9ZA 4DU3A 4F8RA 1VRUA 1QTMA 4BWJA 3VQ6A 5HRPA 4ELVA 1VSDA 1YT3A 4CJVA 3K5NA 4DSIA 3QINA 4E19A 3V1OA 4AHCA 1C1AA 4KKOA 4FCYA 1NKEA 3NF9A 1XWLA 4KHUA 3KLGA 3SQ0A 4ZTFA 3RR8A 2YHBA 4RW8A 2HVHA 3CYMA 2FBXA 3DLRA 1RDCA 4DTSA 1WSHA 3VQQA 1L3TA 1TKXA 3DLKA 4FVMA 4O5BA 4RW6A 4CEAA 1NK6A 1HYSA 3AVIA 3OYHA 4KFBA 5HRNA 4PA1A 3L2WA 3AVJA 4CFBA 3LAKA 4CERA 1S9EA 3K5LA 1IG9A 2G8HA 1RBRA 2LSNA 1QSYA 1B9FA 4CHNA 5JS2A 4KAZA 4B9LA 4ELUA 4BE1A 1L3SA 1SV5A 3L2VA 4FJXA 1IKVA 4FK4A 4KB1A 3AVAA 4KV8A 2F96A 4AHSA 4IFYA 3AA4A 3S3OA 1NK5A 1VSEA 4GW6A 4KI4A 1UAXA 1DTTA 4KHWA 4FYDA 4EP5A 1L3VA 4FLVA 4C8NA 3CFPA 2DFHA 2A1RA 2Z1JA 3KD5E 1QE1A 4DMNA 3OYDA 1N6QA 3NGYA 2G8FA 3ZSVA 3OYAA 4M45A 1NKBA 1A5WA 5CY4A 5HBMA 3KLIA 1N5YA 3AVGA 3HL8A 3RWUA 1KLMA 3WNEA 4E1MA 3E01A 1I39A 5KGWA 2OYQA 2EHGA 4FLZA 3ASMA 1IKWA 2VG7A 2G8IA 2RF2A 4NCAA 1VSLA 3MECA 4J2AA 4DSKA 2XHBA 1JXBA 3KD1E 4FW1A 3QLHA 3KKSA 1FKPA 2JLEA 1DLOA 1W0HA 3T1AA 5C25A 3AO4A 1SL2A 4NCBA 4M3ZA 3QO9A 3ZT0A 1JLFA 1IKXA 2YKNA 3MEEA 4W5RA 3QERA 2EX3A 3V6DA 4CFCA 4M3RA 4QAGA 1D8YA 1S1WA 3OY9A 1VRTA 3SV4A 1HYVA 3LP3A 4B8AB 3SUQA 2DY4A 3AO3A 1EP4A 3QIOA 1RBVA 2Z1IA 4H8KA 4HUEA 3TAGA 1NK8A 1RDDA 4FK2A 3VQ4A 5J1EA 5J2NA 2X6NA 4OKKA 3TAMA 4FJ9A 4B9VA 3AVKA 4RW9A 1NK0A 2HNYA 4KTQA 1S1XA 1QSLA 3VQ5A 2DFFA 1HRHA 3WNFA 1JL2A 2E6MA 4JLHA 3SQ1A 4KPYA 1KVBA 4CEZA 3VN5A 2F8SA 1WSGA 3HT3A 4CEEA 4FLXA 3ISNC 4HUGA 4FM0A 4KRFA 2G8WA 4DFMA 1ZBIA 3NBPA 3LAMA 4RW7A 3JYTA 4DU4A 3SJJA 2NUBA 2ZQBA 4CHPA 3AVNA 3K57A 4CJ3A 2ITGA 4DSLA 2OZMA 4CF2A 1L3UA 4BDPA 4FJJA 1CLQA 2DFEA 4E3SA 3HK2A 4TSXA 1KLNA 2QKKA 1NOYA 4QCLA 1Q9XA 1EKEA 1T8EA 2Y1IA 4W5QA 4B9SA 3OYJA 3F73A 2HW3A 2IGIA 3LZJA 4LD0A 4CE9A 3HSTB 1HYZA 3ITHA 5J2MA 4E0DA 3HPOA 1ASUA 1X9SA 1SL0A 1S6QA 1RTIA 3HPHA 4E1NA 1NJWA 1D5AA 1RBTA 4OKEA 4FJ5A 4KB0A 1LWCA 2JGUA 4WE1A 3IG1A 1WLJA 1RT6A 5SWMA 4Z4HA 3I8DA 3MEGA 3QEXA 1R0AA 2P1JA 3AO5A 3OYKA 2YV0X 4B8CA 3LWLA 2KZMA 1U04A 4OJRA 3DOLA 4CJ5A 4C8KA 1VSIA 1TKZA 1T05A 3UIQA 4HVJA 2R7YA 2D5RA 2YNIA 3KIOA 3VQ8A 4AHTA 3NDKA 3U6FA 2BDPA 3KTQA 4DU1A 4FW2A 3SQ4A 3M8PA 4CGJA 3P5JA 4CGFA 3KK1A 4CIGA 2XY6A 1UOCA 4B9UA 3DLGA 4DSEA 1LAVA 3C6UA 3KLFA 5HRRA 2Y1JA 1TK8A 2RPIA 1YVUA 4KHQA 4EZ9A 1J54A 3RMDA 1JLEA 3SYZA 2X74A 4OVLA 4CJLA 4Z4CA 3V81A 4BE2A 2YNHA 4W5OA 3QEWA 1TK5A 2X6SA 4DTXA 2OPRA 3AA3A 3WNGA 3AVCA 1C0TA 3WNHA 4DSFA 1I3AA 1RT3A 3KJVA 4CJEA 1C0MA 1SKWA 3P83D 4J2BA 1JLQA 1BGXT 3TI0A 3QEVA 1NJXA 3TWHA 4CF0A 4IKFA 4CK3A 2BE2A 4FJHA 1S1UA 1J5OA 4W5NA 3SPZA 4KHSA 1C0UA 2YKMA 4N5SA 4CJWA 4B08A 3OYFA 2AJQA 4AHVA 4DTRA 3L8BA 3PV8A 3ZT1A 4N41A 2HHWA 3OYBA 4H4MA 1X1PA 4FJKA 5EU7A 4F4KA 1JLGA 3NHGA 3VA0A 2IAJA 3DM2A 3L2RA 3QNNA 3LWMA 2PY5A 1ITGA 1REVA 3RRHA 4CEFA 3PO5A 2HNDA 3A2FA 1T7PA 3BGRA 1VK0A 4MQ3A 3ALYA 4FLTA 4PQUA 2G8KA 4CK1A 3ULDA 3S9HA 3ZCMA 3F9KA 4M3UA 1J53A 3AA2A 1G15A 5T7BA 4AHRA 4DTMA 4EP4A 4FZZA 4CK2A 4DQSA 1J9AA 3HP9A 5DMRA 4CESA 4FZXC 1GOCA 3AO2A 1D9DA 4F2SA 2OPPA 1RCHA 3S3MA 1S5JA 4OPJA 4B9TA 1BI4B 1NJYA 4CFAA 3KK3A 1XI1A 4CF9A 4UQGA 2E4LA 3MEDA 1TAQA 4IG0A 3ZSRA 1QQCA 4CGHA 5SZTA 3SV3A 4ZTJA 2QXFA 2X78A 5KI6A 3EYZA 4FM2A 3KK2A 1VSJA 3M8QA 4O44A 4H4OA 1HPZA 1EXQA 4Q5VA 1S1VA 3EZ5A 1TGOA 4FJNA 1ZYQA 3VQ7A 4BWMA 4N76A 4DTJA 1RNHA 4N56A 4E7JA 1D9FA 1ZBUA 1RDAA 3M8SA 4OGCA 1ZBFA 4CGGA 4HTUA 5HP1A 2B4JA 2HB5A 4GMJB 3CFRA 4I2PA 4FLWA 1BI4A 1U48A 3V1QA 1HNIA 1RT2A 2HHVA 1CZ9A 2HHTA 4KI6A 3HO1A 4CHQA 1VSMA 1WSFA 3I0SA 2B6AA 2PZSA 3OJUA 4Z4IA 4EZ6A 3P1GA 4Y1DA 3ZT4A 2IS3A 2FBVA 5CZ1A 1TVRA 3HVTA 3V9XA 4FJGA 3QIPA 1A5XA 4DF8A 1X9MA 1FKOA 3VQEA 3SNNA 1BQMA 3L2QA 1EETA 2D0BA 1NK4A 4Y1CA 1WAFA 3LPTA 2HHXA 3TANA 3CM5A 3DRPA 1UA0A 4C8OA 3T3FA 2F8TA 1KSPA 1RT1A 3OS0A 3RR7A 4HUFA 3OJSA 3ZSYA 1QSSA 2YNGA 4ZHRA 1MU2A 3V4IA 1LV5A 3OYMA 4O55A 3NF6A 1IKYA 1TL3A 4B9NA 3NH1A 3TAFA 1TKDA 3LZIA 3KLHA 4CHOA 3G0ZA 3IAYA 2VG6A 2O4GA 4CJSA 3DLBA 2A1SA 1RBSA 3HYFA 4RW4A 3ZSOA 1LWEA 4FXDA 3V9SA 2VG5A 3QEPA 3B6PA 4CJTA 5HLFA 3LALA 3V9WA 4CJUA 1K6YA 2Z1GA 4DLGA 4OLBA 3NF8A 2Q3SA 4E7LA 3OS1A 4I7FA 3NAEA 3SUOA 1Z26A 1CXUA 2XO7A 2P5GA 3NFAA 3T19A 3TAPA 4F3OA 1KCFA 3AVMA 3NCIA 5KGXA 4Q0BA 2GUIA 1TKTA 4I9LA 4YNQA 4XIUA 3MXIA 4E7HA 4L8RB 2ZD1A 4CHZA 4CJKA 3D45A 1U49A 3AV9A 1C1BA 3SZ2A 2GBZA 1WNSA 4F2RA 3HPGA 4JS4A 1TL1A 4CJPA 3ZSZA 3SUPA 2OA8A 4DG1A 4M3YA 4JRPA 2G8VA 1Y97A 1BCOA 4OKJA 4N47A 1KRPA 1GOBA 4CJ4A 4BACA 1NK7A 4DLEA 4NCGA 3TABA 1IH7A 4ID5A 3L3UA 4FJIA 4E7IA 4F3TA 2D0CA 3DYAA 3LP1A 1RTJA 2B5JA 4CECA 4LSNA 3MAQA 4FM1A 4DS5A 4M3XA 4I9QA 1ZBHA 4B3OA 2KZZA 4FJ8A 2QKBA 2HHUA 3VQPA 1UA1A 3CM6A 2HVIA 3O3HA 1LWFA 5FROA 1FXXA 3HVRA 1RT4A 4CEOA 3THVA 4M41A 3RTVA 4FJMA 4OPKA 3U3YA 4CJQA 1QHTA 1SL1A 1RBUA 4CGIA 1RT5A 2WONA 1TAUA 4M3TA 3B6OA 1NK9A 3VQCA 1YTUA 3QESA 1BIUA 3RMAA 1YTAA 3NE6A 4DQIA 2RKIA 3OYGA 1KVCA 3U3GA 3ZSXA 1U45A 5E41A 1T03A 4Z4EA 1CXQA 2FBTA 3K2PA 3C94A 1BHLA 1XHXA 3IS9A 2XY5A 4FJLA 1SKSA 4J2DA 4JRQA 5J2QA 5C42A 4QOZB 1BQNA 3BDPA 1S6PA 3K59A 5FRMA 3DLEA 4HHTA 3MXJA 4FLUA 4CJRA 2XY7A 3QEIA 4B9MA 3DI6A 4DFJA 3HJFA 4CHYA 4DTOA 4LSLA 1JLBA 2W42A 4W5TA 4E7KA 1JLAA 3G10A 4AH9A 4Z4GA 2QK9A 5HRSA 3L2UA 4MFBA 2PYJA 2D0AA 4CFDA 1FK9A 4RG8A 3ZT3A 3SUNA 1B92A 4IG3A 4FLYA 3KLEA 4LH4A 3DLHA 2KQ2A 3PUFA 1VSHA 5C24A 3VQ9A 3ZSWA 3OYLA 3K58A 5J2PA 4DFKA 3PY8A 4PWDA 3AO1A 4KO0A 2HHQA 2E6LA 4CCHA 3RMCA 1RTDA 1BCMA 4DWIA 3MXMA 1KTQA 2P5OA 3C6TA 2WOMA 4JS5A 1KFDA 1NKCA 5FRNA 4DS4A 4KTZA 1A5VA 2IDOA 3TARA 3NH0A 3OYNA 3EY1A 1RT7A 3DOKA 3DRSA 4CIEA 3LDSA 2VWJA 1U47A 2YHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRE A;  3PX0 A;  1IO2 A;  1O1W A;  3PX4 A;  4G1Q A;  4CF1 A;  1WN7 A;  2RN2 A;  4DQR A;  3S3N A;  2G8U A;  1HQU A;  3QNO A;  4I2Q A;  4YFU A;  3TAE A;  4BE0 A;  4J2E A;  3SPY A;  3OVN A;  1HQE A;  3AVL A;  4K8X A;  3OYE A;  1F21 A;  2KW4 A;  4Z4F A;  4DF4 A;  1TK0 A;  1WAJ A;  4PUO A;  1VSF A;  2O4I A;  1NOZ A;  4O0I A;  2ETJ A;  3LPU A;  1BIZ A;  1ASW A;  1CZB A;  1LW2 A;  1WSE A;  1GOA A;  3H08 A;  1C6V A;  2P51 A;  1TV6 A;  4LH5 A;  1BIS A;  1JLC A;  2KFZ A;  2ZE2 A;  4FK0 A;  4DFP A;  3AVF A;  3O4Q A;  4LY7 A;  3TR8 A;  1W9H A;  4M42 A;  4CEB A;  4FZY A;  2FC0 A;  3KKR A;  4KTW A;  3HM9 A;  2XRI A;  3L3V A;  4DTU A;  1S9G A;  1WSI A;  3DMJ A;  4KHY A;  2KFN A;  3O3G A;  3FFI A;  4R5P A;  4OLA A;  5I42 A;  2FBY A;  1EX4 A;  3SQ2 A;  3LP0 A;  4DTP A;  1JXE A;  3D0P A;  3RMB A;  3AA5 X;  1HMV A;  2Z1H A;  4O4G A;  5I3U A;  4CED A;  3IRX A;  2YNF A;  3O3F A;  3OS2 A;  5D3G A;  4CJF A;  5FDL A;  1DTQ A;  4AIL C;  2OPS A;  2OZS A;  2HHS A;  4BDZ A;  2HNZ A;  1B9D A;  3TAQ A;  3LAN A;  2OPQ A;  3V1R A;  2HMI A;  5CYM A;  1KVA A;  1JL1 A;  1LW0 A;  3VQA A;  4CEQ A;  4HCC A;  1BL3 A;  3NGZ A;  3LP2 A;  3QET A;  1SKR A;  3CQ8 A;  1KFS A;  1U4B A;  4K8Z A;  4CF8 A;  3K5M A;  3ZT2 A;  2BGG A;  4PY5 A;  3HP6 A;  1L5U A;  1Z25 A;  4IDK A;  3SI6 A;  4DQP A;  3OYC A;  1UWB A;  5CYQ A;  2XY8 A;  3ZSQ A;  1RDB A;  4Z0U A;  3CFO A;  3O4N A;  3M8R A;  1XHZ A;  1JKH A;  4CIF A;  4KHN A;  2KTQ A;  4IBN A;  4DQQ A;  2IOC A;  3I0R A;  4CGD A;  3HXM A;  5JS1 A;  1WSJ A;  2IC3 A;  4NYF A;  1RTH A;  4OGE A;  3JSM A;  1S1T A;  1HJR A;  1VSK A;  1Q9Y A;  2I5J A;  5CZ2 A;  5KTQ A;  3PO4 A;  3RRG A;  4FJ7 A;  2PYL A;  4DSJ A;  1C1C A;  2VWK A;  4AHU A;  4M3W A;  3CG7 A;  3NF7 A;  4O0J A;  1XC9 A;  3SCX A;  4IFV A;  1Q8I A;  4E89 A;  3VA3 A;  5KRS A;  1HNV A;  3NGI A;  3AVH A;  4DTN A;  1SUQ A;  3PX6 A;  3AVB A;  3K5O A;  4BDY A;  1ZBL A;  3NH2 A;  4HCB A;  1ASV A;  1X9W A;  2ATQ A;  5HRO A;  3V9U A;  3DRR A;  5KRT A;  2GV9 A;  4ICL A;  5DK5 A;  3VQB A;  3VQD A;  2DTU A;  4ELT A;  1RIL A;  1NJZ A;  1LAW A;  4NYN A;  5K14 A;  4C8L A;  1QS4 A;  3OYI A;  4C8M A;  2BAN A;  4GVM A;  3C95 A;  4ID1 A;  3V9Z A;  4DU3 A;  4F8R A;  1VRU A;  1QTM A;  4BWJ A;  3VQ6 A;  5HRP A;  4ELV A;  1VSD A;  1YT3 A;  4CJV A;  3K5N A;  4DSI A;  3QIN A;  4E19 A;  3V1O A;  4AHC A;  1C1A A;  4KKO A;  4FCY A;  1NKE A;  3NF9 A;  1XWL A;  4KHU A;  3KLG A;  3SQ0 A;  4ZTF A;  3RR8 A;  2YHB A;  4RW8 A;  2HVH A;  3CYM A;  2FBX A;  3DLR A;  1RDC A;  4DTS A;  1WSH A;  3VQQ A;  1L3T A;  1TKX A;  3DLK A;  4FVM A;  4O5B A;  4RW6 A;  4CEA A;  1NK6 A;  1HYS A;  3AVI A;  3OYH A;  4KFB A;  5HRN A;  4PA1 A;  3L2W A;  3AVJ A;  4CFB A;  3LAK A;  4CER A;  1S9E A;  3K5L A;  1IG9 A;  2G8H A;  1RBR A;  2LSN A;  1QSY A;  1B9F A;  4CHN A;  5JS2 A;  4KAZ A;  4B9L A;  4ELU A;  4BE1 A;  1L3S A;  1SV5 A;  3L2V A;  4FJX A;  1IKV A;  4FK4 A;  4KB1 A;  3AVA A;  4KV8 A;  2F96 A;  4AHS A;  4IFY A;  3AA4 A;  3S3O A;  1NK5 A;  1VSE A;  4GW6 A;  4KI4 A;  1UAX A;  1DTT A;  4KHW A;  4FYD A;  4EP5 A;  1L3V A;  4FLV A;  4C8N A;  3CFP A;  2DFH A;  2A1R A;  2Z1J A;  3KD5 E;  1QE1 A;  4DMN A;  3OYD A;  1N6Q A;  3NGY A;  2G8F A;  3ZSV A;  3OYA A;  4M45 A;  1NKB A;  1A5W A;  5CY4 A;  5HBM A;  3KLI A;  1N5Y A;  3AVG A;  3HL8 A;  3RWU A;  1KLM A;  3WNE A;  4E1M A;  3E01 A;  1I39 A;  5KGW A;  2OYQ A;  2EHG A;  4FLZ A;  3ASM A;  1IKW A;  2VG7 A;  2G8I A;  2RF2 A;  4NCA A;  1VSL A;  3MEC A;  4J2A A;  4DSK A;  2XHB A;  1JXB A;  3KD1 E;  4FW1 A;  3QLH A;  3KKS A;  1FKP A;  2JLE A;  1DLO A;  1W0H A;  3T1A A;  5C25 A;  3AO4 A;  1SL2 A;  4NCB A;  4M3Z A;  3QO9 A;  3ZT0 A;  1JLF A;  1IKX A;  2YKN A;  3MEE A;  4W5R A;  3QER A;  2EX3 A;  3V6D A;  4CFC A;  4M3R A;  4QAG A;  1D8Y A;  1S1W A;  3OY9 A;  1VRT A;  3SV4 A;  1HYV A;  3LP3 A;  4B8A B;  3SUQ A;  2DY4 A;  3AO3 A;  1EP4 A;  3QIO A;  1RBV A;  2Z1I A;  4H8K A;  4HUE A;  3TAG A;  1NK8 A;  1RDD A;  4FK2 A;  3VQ4 A;  5J1E A;  5J2N A;  2X6N A;  4OKK A;  3TAM A;  4FJ9 A;  4B9V A;  3AVK A;  4RW9 A;  1NK0 A;  2HNY A;  4KTQ A;  1S1X A;  1QSL A;  3VQ5 A;  2DFF A;  1HRH A;  3WNF A;  1JL2 A;  2E6M A;  4JLH A;  3SQ1 A;  4KPY A;  1KVB A;  4CEZ A;  3VN5 A;  2F8S A;  1WSG A;  3HT3 A;  4CEE A;  4FLX A;  3ISN C;  4HUG A;  4FM0 A;  4KRF A;  2G8W A;  4DFM A;  1ZBI A;  3NBP A;  3LAM A;  4RW7 A;  3JYT A;  4DU4 A;  3SJJ A;  2NUB A;  2ZQB A;  4CHP A;  3AVN A;  3K57 A;  4CJ3 A;  2ITG A;  4DSL A;  2OZM A;  4CF2 A;  1L3U A;  4BDP A;  4FJJ A;  1CLQ A;  2DFE A;  4E3S A;  3HK2 A;  4TSX A;  1KLN A;  2QKK A;  1NOY A;  4QCL A;  1Q9X A;  1EKE A;  1T8E A;  2Y1I A;  4W5Q A;  4B9S A;  3OYJ A;  3F73 A;  2HW3 A;  2IGI A;  3LZJ A;  4LD0 A;  4CE9 A;  3HST B;  1HYZ A;  3ITH A;  5J2M A;  4E0D A;  3HPO A;  1ASU A;  1X9S A;  1SL0 A;  1S6Q A;  1RTI A;  3HPH A;  4E1N A;  1NJW A;  1D5A A;  1RBT A;  4OKE A;  4FJ5 A;  4KB0 A;  1LWC A;  2JGU A;  4WE1 A;  3IG1 A;  1WLJ A;  1RT6 A;  5SWM A;  4Z4H A;  3I8D A;  3MEG A;  3QEX A;  1R0A A;  2P1J A;  3AO5 A;  3OYK A;  2YV0 X;  4B8C A;  3LWL A;  2KZM A;  1U04 A;  4OJR A;  3DOL A;  4CJ5 A;  4C8K A;  1VSI A;  1TKZ A;  1T05 A;  3UIQ A;  4HVJ A;  2R7Y A;  2D5R A;  2YNI A;  3KIO A;  3VQ8 A;  4AHT A;  3NDK A;  3U6F A;  2BDP A;  3KTQ A;  4DU1 A;  4FW2 A;  3SQ4 A;  3M8P A;  4CGJ A;  3P5J A;  4CGF A;  3KK1 A;  4CIG A;  2XY6 A;  1UOC A;  4B9U A;  3DLG A;  4DSE A;  1LAV A;  3C6U A;  3KLF A;  5HRR A;  2Y1J A;  1TK8 A;  2RPI A;  1YVU A;  4KHQ A;  4EZ9 A;  1J54 A;  3RMD A;  1JLE A;  3SYZ A;  2X74 A;  4OVL A;  4CJL A;  4Z4C A;  3V81 A;  4BE2 A;  2YNH A;  4W5O A;  3QEW A;  1TK5 A;  2X6S A;  4DTX A;  2OPR A;  3AA3 A;  3WNG A;  3AVC A;  1C0T A;  3WNH A;  4DSF A;  1I3A A;  1RT3 A;  3KJV A;  4CJE A;  1C0M A;  1SKW A;  3P83 D;  4J2B A;  1JLQ A;  1BGX T;  3TI0 A;  3QEV A;  1NJX A;  3TWH A;  4CF0 A;  4IKF A;  4CK3 A;  2BE2 A;  4FJH A;  1S1U A;  1J5O A;  4W5N A;  3SPZ A;  4KHS A;  1C0U A;  2YKM A;  4N5S A;  4CJW A;  4B08 A;  3OYF A;  2AJQ A;  4AHV A;  4DTR A;  3L8B A;  3PV8 A;  3ZT1 A;  4N41 A;  2HHW A;  3OYB A;  4H4M A;  1X1P A;  4FJK A;  5EU7 A;  4F4K A;  1JLG A;  3NHG A;  3VA0 A;  2IAJ A;  3DM2 A;  3L2R A;  3QNN A;  3LWM A;  2PY5 A;  1ITG A;  1REV A;  3RRH A;  4CEF A;  3PO5 A;  2HND A;  3A2F A;  1T7P A;  3BGR A;  1VK0 A;  4MQ3 A;  3ALY A;  4FLT A;  4PQU A;  2G8K A;  4CK1 A;  3ULD A;  3S9H A;  3ZCM A;  3F9K A;  4M3U A;  1J53 A;  3AA2 A;  1G15 A;  5T7B A;  4AHR A;  4DTM A;  4EP4 A;  4FZZ A;  4CK2 A;  4DQS A;  1J9A A;  3HP9 A;  5DMR A;  4CES A;  4FZX C;  1GOC A;  3AO2 A;  1D9D A;  4F2S A;  2OPP A;  1RCH A;  3S3M A;  1S5J A;  4OPJ A;  4B9T A;  1BI4 B;  1NJY A;  4CFA A;  3KK3 A;  1XI1 A;  4CF9 A;  4UQG A;  2E4L A;  3MED A;  1TAQ A;  4IG0 A;  3ZSR A;  1QQC A;  4CGH A;  5SZT A;  3SV3 A;  4ZTJ A;  2QXF A;  2X78 A;  5KI6 A;  3EYZ A;  4FM2 A;  3KK2 A;  1VSJ A;  3M8Q A;  4O44 A;  4H4O A;  1HPZ A;  1EXQ A;  4Q5V A;  1S1V A;  3EZ5 A;  1TGO A;  4FJN A;  1ZYQ A;  3VQ7 A;  4BWM A;  4N76 A;  4DTJ A;  1RNH A;  4N56 A;  4E7J A;  1D9F A;  1ZBU A;  1RDA A;  3M8S A;  4OGC A;  1ZBF A;  4CGG A;  4HTU A;  5HP1 A;  2B4J A;  2HB5 A;  4GMJ B;  3CFR A;  4I2P A;  4FLW A;  1BI4 A;  1U48 A;  3V1Q A;  1HNI A;  1RT2 A;  2HHV A;  1CZ9 A;  2HHT A;  4KI6 A;  3HO1 A;  4CHQ A;  1VSM A;  1WSF A;  3I0S A;  2B6A A;  2PZS A;  3OJU A;  4Z4I A;  4EZ6 A;  3P1G A;  4Y1D A;  3ZT4 A;  2IS3 A;  2FBV A;  5CZ1 A;  1TVR A;  3HVT A;  3V9X A;  4FJG A;  3QIP A;  1A5X A;  4DF8 A;  1X9M A;  1FKO A;  3VQE A;  3SNN A;  1BQM A;  3L2Q A;  1EET A;  2D0B A;  1NK4 A;  4Y1C A;  1WAF A;  3LPT A;  2HHX A;  3TAN A;  3CM5 A;  3DRP A;  1UA0 A;  4C8O A;  3T3F A;  2F8T A;  1KSP A;  1RT1 A;  3OS0 A;  3RR7 A;  4HUF A;  3OJS A;  3ZSY A;  1QSS A;  2YNG A;  4ZHR A;  1MU2 A;  3V4I A;  1LV5 A;  3OYM A;  4O55 A;  3NF6 A;  1IKY A;  1TL3 A;  4B9N A;  3NH1 A;  3TAF A;  1TKD A;  3LZI A;  3KLH A;  4CHO A;  3G0Z A;  3IAY A;  2VG6 A;  2O4G A;  4CJS A;  3DLB A;  2A1S A;  1RBS A;  3HYF A;  4RW4 A;  3ZSO A;  1LWE A;  4FXD A;  3V9S A;  2VG5 A;  3QEP A;  3B6P A;  4CJT A;  5HLF A;  3LAL A;  3V9W A;  4CJU A;  1K6Y A;  2Z1G A;  4DLG A;  4OLB A;  3NF8 A;  2Q3S A;  4E7L A;  3OS1 A;  4I7F A;  3NAE A;  3SUO A;  1Z26 A;  1CXU A;  2XO7 A;  2P5G A;  3NFA A;  3T19 A;  3TAP A;  4F3O A;  1KCF A;  3AVM A;  3NCI A;  5KGX A;  4Q0B A;  2GUI A;  1TKT A;  4I9L A;  4YNQ A;  4XIU A;  3MXI A;  4E7H A;  4L8R B;  2ZD1 A;  4CHZ A;  4CJK A;  3D45 A;  1U49 A;  3AV9 A;  1C1B A;  3SZ2 A;  2GBZ A;  1WNS A;  4F2R A;  3HPG A;  4JS4 A;  1TL1 A;  4CJP A;  3ZSZ A;  3SUP A;  2OA8 A;  4DG1 A;  4M3Y A;  4JRP A;  2G8V A;  1Y97 A;  1BCO A;  4OKJ A;  4N47 A;  1KRP A;  1GOB A;  4CJ4 A;  4BAC A;  1NK7 A;  4DLE A;  4NCG A;  3TAB A;  1IH7 A;  4ID5 A;  3L3U A;  4FJI A;  4E7I A;  4F3T A;  2D0C A;  3DYA A;  3LP1 A;  1RTJ A;  2B5J A;  4CEC A;  4LSN A;  3MAQ A;  4FM1 A;  4DS5 A;  4M3X A;  4I9Q A;  1ZBH A;  4B3O A;  2KZZ A;  4FJ8 A;  2QKB A;  2HHU A;  3VQP A;  1UA1 A;  3CM6 A;  2HVI A;  3O3H A;  1LWF A;  5FRO A;  1FXX A;  3HVR A;  1RT4 A;  4CEO A;  3THV A;  4M41 A;  3RTV A;  4FJM A;  4OPK A;  3U3Y A;  4CJQ A;  1QHT A;  1SL1 A;  1RBU A;  4CGI A;  1RT5 A;  2WON A;  1TAU A;  4M3T A;  3B6O A;  1NK9 A;  3VQC A;  1YTU A;  3QES A;  1BIU A;  3RMA A;  1YTA A;  3NE6 A;  4DQI A;  2RKI A;  3OYG A;  1KVC A;  3U3G A;  3ZSX A;  1U45 A;  5E41 A;  1T03 A;  4Z4E A;  1CXQ A;  2FBT A;  3K2P A;  3C94 A;  1BHL A;  1XHX A;  3IS9 A;  2XY5 A;  4FJL A;  1SKS A;  4J2D A;  4JRQ A;  5J2Q A;  5C42 A;  4QOZ B;  1BQN A;  3BDP A;  1S6P A;  3K59 A;  5FRM A;  3DLE A;  4HHT A;  3MXJ A;  4FLU A;  4CJR A;  2XY7 A;  3QEI A;  4B9M A;  3DI6 A;  4DFJ A;  3HJF A;  4CHY A;  4DTO A;  4LSL A;  1JLB A;  2W42 A;  4W5T A;  4E7K A;  1JLA A;  3G10 A;  4AH9 A;  4Z4G A;  2QK9 A;  5HRS A;  3L2U A;  4MFB A;  2PYJ A;  2D0A A;  4CFD A;  1FK9 A;  4RG8 A;  3ZT3 A;  3SUN A;  1B92 A;  4IG3 A;  4FLY A;  3KLE A;  4LH4 A;  3DLH A;  2KQ2 A;  3PUF A;  1VSH A;  5C24 A;  3VQ9 A;  3ZSW A;  3OYL A;  3K58 A;  5J2P A;  4DFK A;  3PY8 A;  4PWD A;  3AO1 A;  4KO0 A;  2HHQ A;  2E6L A;  4CCH A;  3RMC A;  1RTD A;  1BCM A;  4DWI A;  3MXM A;  1KTQ A;  2P5O A;  3C6T A;  2WOM A;  4JS5 A;  1KFD A;  1NKC A;  5FRN A;  4DS4 A;  4KTZ A;  1A5V A;  2IDO A;  3TAR A;  3NH0 A;  3OYN A;  3EY1 A;  1RT7 A;  3DOK A;  3DRS A;  4CIE A;  3LDS A;  2VWJ A;  1U47 A;  2YHA A; 
#chains in the Genus database with same CATH topology
 3IMX A;  3WXK A;  3VF4 A;  1XMO K;  4G1Q A;  3S3N A;  2RN2 A;  3FE1 A;  3TAE A;  4J2E A;  4O5F A;  2ZJR L;  4LFC K;  4K8X A;  1VSF A;  3LPU A;  3WUH A;  1GOA A;  4YDU A;  1BIS A;  1JLC A;  2ZE2 A;  4FK0 A;  3AVF A;  3TR8 A;  2Q0R A;  4A2B A;  4G9Z A;  4ISE A;  4IOX A;  3J7A P;  1S9G A;  3FR0 A;  4OLA A;  5BPM A;  1WOQ A;  1X3N A;  3CQY A;  2UUC K;  3ENB A;  1T6C A;  1NGE A;  3GG4 A;  5I3U A;  2V51 B;  3IRX A;  2YNF A;  2OPS A;  2HNZ A;  1B9D A;  5BRE A;  1LOT B;  5CYM A;  1BO5 O;  1LW0 A;  3UKR B;  3VQA A;  4CEQ A;  4YOY A;  1KFS A;  4Y0W A;  1YJN N;  3FZF A;  4BRH A;  3CMA N;  4IDK A;  2F7T A;  1RDB A;  3CFO A;  4BC4 A;  2KTQ A;  2VYP A;  3CD6 N;  5JS1 A;  4GV3 A;  3HXM A;  2Q31 A;  4OGE A;  3JSM A;  1Q9Y A;  3PO4 A;  2I5J A;  5CZ2 A;  3C6A A;  2VWK A;  3CG7 A;  1XC9 A;  2O8E B;  2P9P A;  3QB0 A;  4E89 A;  3AVH A;  4YOU A;  1SUQ A;  4BDY A;  3QFP A;  1JCE A;  4NXN K;  2CGJ A;  2F9W A;  2I7N A;  2ZWH A;  2GV9 A;  3VQB A;  2DTU A;  2BH1 A;  3J80 O;  1NNE A;  1NJZ A;  1LAW A;  1IG8 A;  4C8M A;  4MO4 A;  4YOW A;  4IOA L;  1YAG A;  1K73 O;  1XWL A;  2OAN A;  3RR8 A;  3VQQ A;  4RW6 A;  5AQN A;  4CZF A;  1HYS A;  2O8C B;  4LF6 K;  4PA1 A;  1C0G A;  3U9D A;  1IG9 A;  1S9E A;  3K5L A;  2PFU A;  5AQY A;  1B9F A;  3UE5 A;  4JKC A;  1NGJ A;  5C2F A;  1MDU B;  2F9T A;  1NK5 A;  3S3O A;  4JKA A;  3CCV N;  1U6Z A;  4FYD A;  1DGK N;  4EP5 A;  1L3V A;  2UXB K;  1XNQ K;  1VQ6 N;  4DMN A;  5GIO A;  3OYD A;  3QDK A;  4BRG A;  4HWI A;  1NKB A;  4CBW A;  5AQK A;  1A5W A;  5CY4 A;  4GV6 A;  3FZH A;  3RWU A;  1KLM A;  3VGM A;  1I39 A;  1HUX A;  4FLZ A;  1IKW A;  4DQ8 A;  3VGK A;  2VG7 A;  2RF2 A;  4JKB A;  4JHD A;  4FOI A;  1YI2 N;  1W0H A;  4DV3 K;  4M3Z A;  3ZT0 A;  1NU0 A;  1M1K O;  1VQP N;  4W5R A;  3U9Z A;  3SV4 A;  2DY4 A;  4IEI A;  1HYV A;  2A41 A;  1NK8 A;  5FPM A;  4HUE A;  3TAG A;  3VQ4 A;  5BRH A;  1Q81 O;  5KPT A;  4C1N I;  1GLA G;  3WXJ A;  1JCG A;  4I6M B;  3AVK A;  3CCQ N;  1Q82 O;  4FWO A;  1S1X A;  3TSQ A;  1QSL A;  2DFF A;  3WNF A;  1HRH A;  1JL2 A;  4JLH A;  3ISN C;  4HUG A;  4KRF A;  2UU9 K;  3G4S N;  3JYT A;  3KWG A;  3LAM A;  4DU4 A;  4CJ3 A;  2ITG A;  4DSL A;  1L3U A;  2DFE A;  3HK2 A;  1GLD G;  3SMP A;  2O8D B;  1T8E A;  2Y1I A;  1WBB A;  2HMP A;  1VQO N;  3HOT A;  4DR1 K;  3T1H K;  3DXM B;  4LD0 A;  5C10 A;  3HST B;  2QA4 N;  4E0D A;  1SL0 A;  3HPH A;  1IBM K;  4DV5 K;  4IFE A;  1RT6 A;  3WEE A;  4J8F A;  4C8K A;  1VSI A;  3CF5 L;  1T05 A;  4HVJ A;  3S41 A;  3BF3 A;  4DU1 A;  4M63 C;  3LDN A;  2YHW A;  4E1J A;  3DLG A;  5HRR A;  4JI8 K;  3O1W A;  1TK8 A;  4WYB A;  4DR5 K;  5JVG L;  3SYZ A;  4CJL A;  5AFU A;  1NBW A;  2Q2R A;  2YNH A;  3AA3 A;  3WNG A;  5BRD A;  4DSF A;  4CJE A;  1SKW A;  3P83 D;  2ASP A;  3H45 C;  5TKW A;  1BGX T;  1NJX A;  3TWH A;  1J5O A;  1TYQ B;  4NLC A;  3OYF A;  2AJQ A;  4AHV A;  3L8B A;  3ZT1 A;  2GUP A;  3OYB A;  5EU7 A;  4F4K A;  4KHP K;  1NJI O;  4H5N A;  3QNN A;  4BQZ A;  1JJ2 M;  2V7Y A;  3RRH A;  4CEF A;  2HND A;  3A2F A;  1Y64 A;  5AQI A;  4A5A A;  5CR4 A;  4MQ3 A;  4FLT A;  3IUC A;  4H0T B;  4CK1 A;  4WF9 L;  2ZGY A;  4M3U A;  1S22 A;  2ITM A;  2FF6 A;  5LMN K;  1BUP A;  4DR3 K;  2IVP A;  1QZ5 A;  4B9T A;  1BI4 B;  3I8B A;  3KK3 A;  4BGA A;  4BR2 A;  2E4L A;  5SZT A;  3JAM O;  2X78 A;  5AQS A;  1VSJ A;  4O44 A;  4Q5V A;  3EZ5 A;  1N34 K;  3VQ7 A;  4IXC A;  3C6H A;  4E7J A;  1D9F A;  1ZBU A;  1VQ8 N;  4OGC A;  4CGG A;  4HTU A;  3D2E A;  3AAR A;  4FO0 A;  1CZ9 A;  2HHT A;  1HKC A;  4UY8 O;  5AR0 A;  3I0S A;  4BRO A;  2PZS A;  2PBD A;  3ZT4 A;  5CZ1 A;  2D0B A;  3TAN A;  2F8T A;  1UA0 A;  4QS7 A;  3T3F A;  1RT1 A;  3HBT A;  3OS0 A;  1Q86 O;  1WUA A;  2YNG A;  1QSS A;  1LV5 A;  3OYM A;  4O55 A;  4CD1 A;  2UUB K;  4B9N A;  5AQU A;  2FF3 B;  5BN9 A;  2UXC K;  4WQ5 A;  2P9L B;  3AGR A;  1KAZ A;  3SAF A;  1BA0 A;  3VTH A;  1RBS A;  4DV2 K;  4LF7 K;  3V9S A;  2CGK A;  4B3T K;  1GLB G;  4CJU A;  4IJN A;  4XH1 A;  4I7F A;  3LM9 A;  4JKH A;  2XO7 A;  4JI2 K;  3F9M A;  4IOC L;  5AZI B;  3MXI A;  4E7H A;  4CHZ A;  2QWM A;  4JD2 B;  2A40 A;  3AV9 A;  1WNS A;  1QVG M;  4M3Y A;  2QWR A;  2G8V A;  1QHA A;  3SLC A;  4B1V A;  1GOB A;  4JKG A;  4CBX A;  4FJI A;  3DYA A;  1RTJ A;  1LCU A;  4M3X A;  3THW B;  1ZBH A;  3DWL A;  2HHU A;  2QKB A;  2FSK A;  2IIR A;  5AFU H;  3THV A;  4YDU C;  2NZT A;  3KZB A;  3MWT A;  1RT5 A;  2WON A;  4AM7 A;  1S72 N;  3O5B A;  3VQC A;  4IO8 A;  1HNZ K;  3QES A;  4DQI A;  2AA4 A;  3ULE A;  2RKI A;  3L6Q A;  5BRF A;  5E41 A;  4YY3 K;  5F0X A;  3E66 A;  4CVN E;  3PLA A;  3R3L A;  1XHX A;  3ENO A;  4JRQ A;  5C42 A;  4QOZ B;  4BRQ A;  3MX5 A;  3DI6 A;  4DFJ A;  3HJF A;  4CHY A;  4X65 K;  1JLB A;  4FPB A;  1NGH A;  2AP1 A;  4W5T A;  4Z4G A;  3KHY A;  5HRS A;  4CFD A;  3A0I X;  5BR8 K;  4LH4 A;  3G25 A;  3K58 A;  3EZW A;  2W40 A;  4JI1 K;  4FVU A;  2E6L A;  2HHQ A;  1RTD A;  1KFD A;  3O9R A;  2IDO A;  2E2Q A;  4CIE A;  2VWJ A;  1OH6 A;  4NB4 A;  4DHY A;  3KLH A;  3J8A A;  4KRE A;  3AGK A;  1IO2 A;  3FZL A;  3VEZ A;  4DQR A;  4L3Q A;  2KKZ A;  3QNO A;  4I2Q A;  4BE0 A;  4JI6 K;  3OVN A;  3M6G A;  4FWL A;  3CJC A;  1F21 A;  4IZ9 A;  4DF4 A;  1VQ7 N;  1QVF M;  2O4I A;  4O0I A;  1WSE A;  1ASW A;  1CZB A;  1C6V A;  2P51 A;  4AM6 A;  3RVC A;  3HI0 A;  4ISG A;  4FWQ A;  1W9H A;  1XUP O;  2XRI A;  3CME N;  4KHY A;  1WSI A;  3ID6 A;  3DMJ A;  2HOE A;  1GLF O;  4R5P A;  5I42 A;  2FBY A;  5EX5 A;  2O8B B;  2FSJ A;  3DXK B;  1HMV A;  4O4G A;  3T1Y K;  3CJ7 A;  1V4S A;  4CJF A;  4GVE A;  1VQM N;  1RDW X;  3TAQ A;  3WXI A;  1N32 K;  1BL3 A;  3DLL L;  1SKR A;  3CQ8 A;  3O80 A;  3Q7C A;  3K5M A;  3ZT2 A;  4DQP A;  3OYC A;  2XY8 A;  3MN6 A;  1XHZ A;  3O4N A;  4KHN A;  4IBN A;  2VCP A;  4DQQ A;  1K9M O;  3I0R A;  4YOR A;  1HJR A;  3UKR A;  3RRG A;  4LF4 K;  2QW9 A;  4M3W A;  1C1C A;  1XC3 A;  3NF7 A;  4O0J A;  4BRK A;  4IFV A;  5KRS A;  3QBW A;  3CHW A;  5IWA K;  4WCE L;  3AVB A;  1ZBL A;  3NH2 A;  1IJJ A;  2NLX A;  2ATQ A;  3BP8 A;  3VF6 A;  1KQS M;  4ICL A;  4JKE A;  5DK5 A;  4DV6 K;  4C8L A;  4U7B A;  3OYI A;  2O8E A;  1VQN N;  4CZK A;  3V9Z A;  4M7X A;  5FPE A;  4CJ7 A;  5HRP A;  4X64 K;  1YT3 A;  3K5N A;  4OO1 J;  4MO5 A;  3V1O A;  3W0L A;  1C1A A;  3CET A;  3MX2 A;  5C15 A;  3KLG A;  3VEN A;  4RW8 A;  2FBX A;  5E84 A;  3DLK A;  4H0X B;  4A5B A;  1NK6 A;  1E4G T;  3OYH A;  3WXL A;  3NMU A;  4BQL A;  2A6A A;  4KFB A;  3L2W A;  3AVJ A;  2VGM A;  4CFB A;  3A5O C;  1RBR A;  1EWQ A;  1QSY A;  5JS2 A;  4JEP A;  1W97 L;  4ELU A;  1NGA A;  5JLH A;  3VEW A;  1YHQ N;  1VSE A;  3A5L C;  4GW6 A;  3M3Z A;  1CZA N;  1E3M A;  2P9U B;  4B9Q A;  3CCL N;  2O8C A;  2P9N B;  2DFH A;  2G8F A;  3OYA A;  4GNI A;  5HBM A;  3KLI A;  1N5Y A;  5B8H A;  5KGW A;  3QBX A;  2OTL N;  5M1O A;  4NCA A;  1VSL A;  3MEC A;  4DSK A;  1WB9 A;  3BZC A;  3QLH A;  5F1X A;  4K0K K;  1FKP A;  1DLO A;  3TSP A;  1SL2 A;  4FWK A;  2BUP A;  5M1K A;  1JLF A;  2YKN A;  3MEE A;  3QER A;  3V6D A;  1S1W A;  3OY9 A;  3LP3 A;  1R59 O;  3OA9 A;  4FK2 A;  5J2N A;  2X6N A;  2HNY A;  4CEZ A;  1H1V A;  2F8S A;  3HT3 A;  4CEE A;  4FLX A;  3CCR N;  4DFM A;  3CQX A;  4GKK K;  3SJJ A;  4CHP A;  3AVN A;  3H6E A;  5EOY A;  3H1Q A;  4BDP A;  4FJJ A;  1CLQ A;  3K9J A;  2A3Z A;  1NMD A;  3O1B A;  4QCL A;  1Q9X A;  4B9S A;  4W5Q A;  4I6M A;  3OYJ A;  3F73 A;  3ZX2 A;  3LZJ A;  1OH5 A;  3J7Y P;  1HYZ A;  3ITH A;  3HPO A;  2O8F B;  1S6Q A;  4BC2 A;  4JI5 K;  1NJW A;  4WQ4 C;  1GLE G;  4OKE A;  4B1X B;  1RGI A;  2JGU A;  4DR4 K;  4WE1 A;  4BVO A;  1J6Z A;  5HL7 L;  5SWM A;  4F9O A;  2YV0 X;  4B8C A;  3DOL A;  3EEQ A;  3VEX A;  4CJ5 A;  2O8D A;  2D5R A;  1JCF A;  2ZJP L;  3DXM A;  3KK1 A;  4CIG A;  1HR0 K;  1SAZ A;  3WXM B;  1YVU A;  1J54 A;  3RMD A;  3EL2 A;  2X74 A;  1W7A A;  4BE2 A;  1TK5 A;  3TU5 A;  3T69 A;  5BPN A;  3KJV A;  2F4V K;  4FSV A;  3TI0 A;  3ZLJ A;  4CZH A;  4B1Y B;  4CF0 A;  3G71 N;  4FJH A;  1S1U A;  2YJF A;  3PSF A;  3SPZ A;  2YKM A;  4O8K A;  2VWB A;  4BG9 A;  4DTR A;  3PV8 A;  3MCA B;  4N41 A;  5EY4 A;  1E4F T;  4BG8 A;  3DJC A;  3L2R A;  4DR2 K;  2PY5 A;  1ITG A;  1REV A;  3QFU A;  1VAZ A;  1KAY A;  1TYQ A;  1Z6R A;  5JVH L;  3S9H A;  3ZCM A;  1J53 A;  5T7B A;  1J9A A;  5DMR A;  3VEO A;  4B1U B;  1W2B M;  2NRH A;  4CES A;  4FZX C;  1D9D A;  4XH5 A;  1K8A O;  3KVG A;  3TTD A;  4BRF A;  1NJY A;  1XI1 A;  4DUZ K;  3ZSR A;  1QQC A;  3SJH A;  4CGH A;  4KH4 A;  5KI6 A;  3JS6 A;  4H4O A;  1EXQ A;  4C23 A;  4DKW A;  3IFR A;  4BRL A;  2E20 A;  2B4J A;  4R79 A;  3CFR A;  4FLW A;  1BI4 A;  2HHV A;  1HNI A;  1RT2 A;  5C2D A;  4YOX A;  5AQO A;  3H3N O;  4PL8 A;  1BG3 A;  1WSF A;  4Z4I A;  4EZ6 A;  1XQS C;  4Y1D A;  1NGF A;  2Q36 A;  3GE1 A;  2IS3 A;  4AF1 A;  1RDU A;  3BUZ B;  3HVT A;  1O13 A;  1A5X A;  1RFQ A;  4DF8 A;  1X9M A;  5LMU K;  1EET A;  1HPM A;  1WAF A;  1P8Z A;  3CM5 A;  3DRP A;  4C8O A;  4KH6 A;  3OJS A;  4BRI A;  3ZSY A;  4ZHR A;  1MU2 A;  2HF3 A;  5AQG A;  1IKY A;  3BY5 A;  3W3D A;  2ZGZ A;  3C7N B;  1TKD A;  3R8E A;  5A2Q O;  4DV7 K;  2D1K A;  4BRE A;  2OTJ N;  1EO1 A;  1LWE A;  3H3O B;  4FWP A;  3QEP A;  2P9S B;  3B6P A;  5HLF A;  2ASO A;  3LAL A;  1K6Y A;  2CH5 A;  2Z1G A;  3O6W A;  4OPA A;  3SUO A;  1SS6 A;  3NAE A;  1Z26 A;  1CXU A;  5AQJ A;  3THX B;  1VQ9 N;  1N33 K;  2P5G A;  3NFA A;  3DAW A;  1KCF A;  5AQH A;  2GUI A;  5FLX O;  2P9L A;  2ASM A;  1U49 A;  3J81 O;  2GBZ A;  4JI3 K;  3HPG A;  1TL1 A;  3SUP A;  5AQF A;  3P38 A;  4N47 A;  4BAC A;  3L4Q A;  4NCG A;  4E7I A;  2D0C A;  3L4I A;  2B5J A;  4LSN A;  5AZI A;  1K8K B;  1N36 K;  4I9Q A;  4B3O A;  3LDP A;  2QWL A;  1VHX A;  4JD2 A;  4BC3 A;  2QXL A;  2HVI A;  3FFK B;  3HVR A;  1RT4 A;  3RTV A;  4JKF A;  3GBT A;  3CCE N;  1SL1 A;  4DCH A;  1VQ4 N;  4GKJ K;  3E9O A;  3CI5 A;  1BIU A;  3RMA A;  1YTA A;  3O08 A;  3NE6 A;  3OYG A;  2IVO A;  3THW A;  4Z4E A;  5KQ8 A;  1CXQ A;  2FBT A;  3SAG A;  4NXM K;  4K25 A;  3IS9 A;  1ZXO A;  4LC9 B;  5J2Q A;  4DB3 A;  1S6P A;  3IDH A;  3K59 A;  5FRM A;  4FLU A;  5AQP A;  3TTF A;  2NNW A;  4BR5 A;  5HOO A;  4H5W A;  3THY B;  4LFB K;  2PYJ A;  1FK9 A;  1OH7 A;  3ZT3 A;  1B92 A;  4FLY A;  2QEX N;  2W41 A;  3O8M A;  3TTC A;  3DLH A;  3PUF A;  1NGI A;  1YIJ N;  4DWI A;  3MXM A;  2P5O A;  1YJ9 N;  2WOM A;  5FRN A;  3UB5 A;  1NKC A;  4X62 K;  1KD1 O;  3CCU N;  3OYN A;  3EY1 A;  3DRS A;  3I55 N;  4PKI A;  3GL1 A;  1WN7 A;  3SBT A;  5AQR A;  3AVL A;  3PSI A;  4EAH D;  3SK3 A;  1TK0 A;  4FOE A;  4MDB A;  2ETJ A;  5F2R A;  1LW2 A;  3H08 A;  3QIC A;  1TV6 A;  4LH5 A;  5ADX H;  5AQQ A;  4B3S K;  3O4Q A;  4LY7 A;  4FWN A;  3WQU A;  3J7Z O;  4YOV A;  4JYA K;  3CC2 N;  4FZY A;  2FC0 A;  1T6D A;  4KTW A;  2YX6 A;  3L3V A;  2GTD A;  3HM8 A;  2KFN A;  3O3G A;  2E88 A;  2QWP A;  3VF2 A;  5GIP A;  3LP0 A;  1JXE A;  3D0P A;  4B1Z A;  3H1V X;  4GV9 A;  3AA5 X;  2Z1H A;  4DUY K;  3O3F A;  3OS2 A;  5D3G A;  2GEM A;  2YHY A;  3MCP A;  1DTQ A;  2OZS A;  4BDZ A;  3P4I A;  1SQK A;  3ATU A;  3LAN A;  4LF5 K;  3C65 A;  3V1R A;  2HMI A;  3EN9 A;  1KVA A;  1NWK A;  4BR4 A;  3KWI A;  3CPW M;  3QET A;  1GLC G;  3IKM A;  1U4B A;  4K8Z A;  4CF8 A;  2BGG A;  2O8B A;  3OTO K;  3DXK A;  3HP6 A;  2GEL A;  1Z25 A;  1IBK K;  1UWB A;  5CYQ A;  3ZSQ A;  2QWO A;  4FL9 A;  4M7Y A;  4CGD A;  1WSJ A;  4NYF A;  1RTH A;  4YHH K;  1S1T A;  4FWR A;  1VSK A;  4HTL A;  5KTQ A;  3ZET B;  2QTD A;  3F5T A;  1HX1 A;  4FJ7 A;  2NRZ A;  2PYL A;  2NRX A;  2A42 A;  3SCX A;  1Q8I A;  2QM1 A;  1GLL O;  3EKU A;  2ZM6 K;  1VQL N;  4Z94 A;  3ZEU B;  4DTN A;  3K5O A;  1DT9 A;  4HCB A;  3DRR A;  2VGN A;  4BRC A;  1NMN A;  1RIL A;  4NYN A;  2BAN A;  4GVM A;  3C95 A;  4DU3 A;  1WBD A;  5DM6 L;  1VRU A;  3VQ6 A;  4ELV A;  4DSI A;  1TUU A;  4LF8 K;  5JMV A;  4E19 A;  4OX9 K;  3CXC M;  4KKO A;  4FCY A;  3NF9 A;  2E2O A;  2HVH A;  4BRM A;  3DLR A;  1RDC A;  4DTS A;  1WSH A;  4O5B A;  4CEA A;  3AVI A;  1BA1 A;  5HRN A;  4CER A;  4RTF D;  4PKG A;  2FXU A;  4CHN A;  5FPD A;  4KAZ A;  4JI4 K;  3ID8 A;  4B9L A;  4BE1 A;  4FJX A;  1SV5 A;  3FGU A;  3L2V A;  1HJO A;  2E1Y A;  4FK4 A;  3AVA A;  4KV8 A;  2F96 A;  1UAX A;  5GIN A;  2NRW A;  3I33 A;  4KHW A;  2YI1 A;  1YJW N;  4FLV A;  3CFP A;  1NLV A;  2A1R A;  4BC5 A;  2Z1J A;  3KD5 E;  1TUY A;  1QE1 A;  4BRN A;  4FPA A;  2DPN A;  3NGY A;  3VOV A;  1DEJ A;  4CZL A;  3AVG A;  1X3M A;  3HL8 A;  3WNE A;  4E1M A;  3E01 A;  3ASM A;  2G8I A;  3GDQ A;  2P9U A;  4J2A A;  2P9N A;  4FW1 A;  2J4R A;  2JLE A;  1ATR A;  5C25 A;  3AO4 A;  5BR9 A;  2EX3 A;  5GAE P;  4QAG A;  4A2A A;  4JI7 K;  1VRT A;  3AO3 A;  1EP4 A;  3QIO A;  2Z1I A;  5J1E A;  3P39 A;  2W6K A;  2CH6 A;  1NK0 A;  4KTQ A;  3RSE B;  3CC4 N;  4KPY A;  2YHX A;  4PL7 A;  1KVB A;  3JXU A;  1KAX A;  1WSG A;  2JWL A;  4NLB A;  3R9P A;  1ZBI A;  1Q7Y O;  4RW7 A;  4JI0 K;  3CER A;  2ZQB A;  3VGL A;  2OZM A;  4E3S A;  2QKK A;  1EKE A;  1ILY A;  2IGI A;  3EE9 A;  4CE9 A;  1G99 A;  1ASU A;  3HTV A;  2WTU A;  5AQT A;  1D5A A;  1RBT A;  1LWC A;  4A62 A;  3CJ1 A;  1WLJ A;  3QEX A;  3I8D A;  2P1J A;  2PAV A;  3AO5 A;  3OYK A;  4OJR A;  1QQO A;  5E26 A;  3UIQ A;  5FPN A;  2R7Y A;  3KIO A;  3CJB A;  3VQ8 A;  4AHT A;  3U6F A;  2BDP A;  2BTF A;  3KTQ A;  3CIP A;  3SQ4 A;  4CGF A;  3P5J A;  2O8F A;  2XY6 A;  4BR7 A;  4C1N K;  4B9U A;  1LAV A;  3KLF A;  1GLJ O;  2QI2 A;  4K42 A;  2RPI A;  2Y1J A;  3HZ6 A;  4EZ9 A;  4CZE A;  4OVL A;  4Z4C A;  3T7Z A;  2E2P A;  4W5O A;  3LDL A;  2P9I B;  4YOT A;  4DR7 K;  3D2F B;  1YUW A;  2OPR A;  3WNH A;  2Q97 A;  1I3A A;  1EQY A;  1NGC A;  1JLQ A;  3QEV A;  4IKF A;  3O9U A;  4CK3 A;  4A59 A;  2GWK A;  3FLC O;  4CD3 A;  4N5S A;  2VQE K;  4CJW A;  2HHW A;  4H4M A;  1X1P A;  5M1F A;  3NHG A;  4ILJ A;  2IAJ A;  1NGB A;  3LWM A;  1HKG A;  1T7P A;  2HBL A;  2D4W A;  3BGR A;  4BY9 C;  3ALY A;  3O4W A;  3PIO L;  2G8K A;  5DM7 L;  5IT9 O;  3AA2 A;  4DTM A;  4AHR A;  4FZZ A;  4CK2 A;  1QZ6 A;  1N8R O;  1GOC A;  3AO2 A;  2OPP A;  1BWF O;  1KXP A;  3S3M A;  4OPJ A;  2CGL A;  1EWR A;  2UYT A;  5AQM A;  4CF9 A;  2P9K B;  4UQG A;  1P90 A;  3MED A;  2ZF5 O;  3LL3 A;  3SV3 A;  2QXF A;  3EYZ A;  4RWT A;  1BDG A;  4FWM A;  3KK2 A;  3OW2 M;  1HPZ A;  1QQN A;  4FJN A;  1ZYQ A;  4BWM A;  4N76 A;  4DTJ A;  1RNH A;  5JLF A;  1RDA A;  1ZBF A;  4GMJ B;  3BEX A;  4I2P A;  1U48 A;  3V1Q A;  5AZJ B;  4BGB A;  4EHT A;  4CHQ A;  3OJU A;  3P1G A;  4DV1 K;  1Z05 A;  2FBV A;  4FJG A;  1TVR A;  3V9X A;  1FKO A;  5EVZ A;  3SNN A;  3VEY A;  3L2Q A;  4Y1C A;  2HHX A;  5GAG P;  3UKU B;  4KH5 A;  3LDO A;  3RR7 A;  4QS8 A;  4B1W B;  2FLO A;  1TL3 A;  3NH1 A;  3G0Z A;  3IAY A;  3K9K A;  2VG6 A;  2KLA A;  3DLB A;  3HYF A;  3ZSO A;  4FXD A;  2A5X A;  3V9W A;  4DLG A;  5LL6 Z;  1KC8 O;  4QS9 A;  4E7L A;  2E2N A;  3AAQ A;  4DR6 K;  4F3O A;  1OVQ A;  3C7N A;  3NCI A;  4Q0B A;  5KGX A;  3O9T A;  1TKT A;  4I9L A;  4L8R B;  3BZK A;  2ZD1 A;  3D45 A;  1C1B A;  3SZ2 A;  4F2R A;  4JS4 A;  1XMQ K;  2OA8 A;  4DG1 A;  1J5E K;  2P9S A;  3AAP A;  1Y97 A;  1BCO A;  4DV0 K;  3LDQ A;  4CJ4 A;  4DLE A;  3TAB A;  4ID5 A;  4U67 L;  3L3U A;  3THX A;  5AQL A;  4FM1 A;  3LM2 A;  4FJ8 A;  4JK9 A;  3VQP A;  3O3H A;  1FXX A;  4M41 A;  4OPK A;  3O9Q A;  1QHT A;  5LJV A;  4CGI A;  3B6O A;  1NK9 A;  3AY9 A;  1YTU A;  1K8K A;  1NG9 A;  1KVC A;  3U3G A;  3ZSX A;  1U45 A;  1T03 A;  1U2V B;  3SAH A;  3K2P A;  1BHL A;  5LJW A;  3DLE A;  3FZK A;  3MXJ A;  4H5R A;  4CJR A;  3ATV A;  1OVY A;  3QEI A;  4B9M A;  2W42 A;  4E7K A;  2QK9 A;  1JLA A;  3G10 A;  4WQ5 C;  4AH9 A;  1MWK A;  3ENH A;  2E8A A;  3SUN A;  4IG3 A;  1NM1 A;  3MMV A;  3KLE A;  1C0F A;  2KQ2 A;  3VQ9 A;  5J2P A;  4PHT X;  4CCH A;  3RMC A;  1BCM A;  3U8X A;  4JS5 A;  4DS4 A;  4KTZ A;  1A5V A;  3TAR A;  1SZ2 A;  3THY A;  3LDS A;  3EO3 A;  4LF9 K;  2YHA A;  5ADX A;  3CCJ N;  3PX0 A;  1O1W A;  3PX4 A;  4CF1 A;  3A5N C;  2G8U A;  1HQU A;  4YFU A;  3SPY A;  1HQE A;  5LY3 A;  3OYE A;  2KW4 A;  4Z4F A;  3HSC A;  5JIC A;  4PUO A;  1WAJ A;  4JK8 A;  1NOZ A;  1BIZ A;  4H03 B;  2KFZ A;  4DFP A;  3OHR A;  4CEB A;  4B3R K;  3KKR A;  1FW6 A;  5EXW A;  3HM9 A;  4DTU A;  3FFI A;  3MK6 A;  1EX4 A;  3SQ2 A;  4DTP A;  3E1Y A;  5BN8 A;  3RMB A;  3OBW A;  4CED A;  5FDL A;  4AIL C;  4O8U A;  4H0Y B;  2HHS A;  4JK7 A;  2OPQ A;  3VER A;  1JL1 A;  4HCC A;  3NGZ A;  3LP2 A;  2H3G X;  3M5R A;  2WC9 A;  5AQV A;  3U4L A;  3SMS A;  4PY5 A;  2P9P B;  1M90 O;  1L5U A;  3SI6 A;  3VTI A;  1XNR K;  3M8R A;  5AJ3 K;  4Z0U A;  1JKH A;  4CIF A;  2IOC A;  3H46 O;  2IC3 A;  3GOI A;  3B8A X;  4NO7 A;  3SBG A;  4DSJ A;  4AHU A;  2HF4 A;  3I56 N;  3D6R A;  3Q7B A;  3VA3 A;  1HNV A;  3NGI A;  3PX6 A;  1IBL K;  1ASV A;  1X9W A;  5HRO A;  3V9U A;  1T44 A;  5KRT A;  3VQD A;  3ZET A;  4ELT A;  2NRR A;  5K14 A;  1QS4 A;  3VES A;  4ID1 A;  2IVN A;  3ZEU A;  4F8R A;  1QTM A;  4BWJ A;  1HNX K;  1VSD A;  4CJV A;  3QIN A;  2FSN A;  4AHC A;  3CJ9 A;  1NKE A;  4B3M K;  4KHU A;  3SQ0 A;  4ZTF A;  2YHB A;  4CI6 A;  5GAD P;  3EKS A;  3HOS A;  3CYM A;  4IDH A;  4KBO A;  1L3T A;  2ZJQ L;  1TKX A;  4FVM A;  4WFB L;  3MN9 A;  2G8H A;  3LAK A;  4ILG B;  3VMF B;  4ILH A;  2LSN A;  2YJE A;  5KPR A;  1L3S A;  2HBK A;  1IKV A;  1MA9 B;  4KB1 A;  4AHS A;  4IFY A;  3AA4 A;  4KI4 A;  3ZYY X;  4JN4 A;  4WQ4 A;  1DTT A;  5AQZ A;  4JHD B;  4PKH A;  4H0V B;  1VQK N;  4C8N A;  1HNW K;  1N6Q A;  3ZSV A;  4M45 A;  3A8Y A;  3MN5 A;  5BPL A;  2OYQ A;  4BVP A;  2EHG A;  1T3V A;  1YF5 L;  2Q1N A;  2XHB A;  1JXB A;  3R1X A;  4JKD A;  3KD1 E;  3CCM N;  3KKS A;  2QWN A;  2HST A;  3T1A A;  4NCB A;  3QO9 A;  5M1Q A;  1IKX A;  1YVN A;  4CZM A;  4CFC A;  4M3R A;  1D8Y A;  3SUQ A;  4B8A B;  4DV4 K;  1RBV A;  4H8K A;  1RDD A;  4FWS A;  4MDA A;  1ATS A;  2E5L K;  4JV5 K;  2KHO A;  3P31 A;  4OKK A;  3TAM A;  4FJ9 A;  4B9V A;  4ISF A;  4XH4 A;  4RW9 A;  1VQ5 N;  3BF1 A;  4M42 A;  3VQ5 A;  3M1F A;  3SQ1 A;  2E6M A;  5GAH P;  3VN5 A;  1HKB A;  3TSU A;  4EFH A;  5KPZ A;  4X66 K;  4FM0 A;  2G8W A;  3NBP A;  2V7Z A;  4CBU A;  3KK7 A;  5C12 A;  2JWK A;  2NUB A;  3WEE B;  3K57 A;  3CPE A;  4CF2 A;  4TSX A;  1KLN A;  3ZX0 A;  1NOY A;  3E9P A;  2OCE A;  3RSE A;  2HW3 A;  4K41 A;  5J2M A;  3FZM A;  1X9S A;  4H5V A;  1D4X A;  1RTI A;  4E1N A;  3EE8 A;  4AQY K;  4FJ5 A;  4KB0 A;  4A61 A;  2W6L A;  3IG1 A;  4Z4H A;  1R0A A;  3MEG A;  3LWL A;  2KZM A;  1U04 A;  1TKZ A;  2YNI A;  3NDK A;  1NGD A;  1HLU A;  3WQT A;  4FW2 A;  3M8P A;  4CGJ A;  1UOC A;  4DSE A;  3C6U A;  1IV0 A;  3ZX3 A;  4KHQ A;  5MLC Q;  1JLE A;  2EWS A;  1BU6 O;  2HBJ A;  3QML A;  3V81 A;  3QEW A;  2X6S A;  4DTX A;  2I7P A;  3AVC A;  1C0T A;  1RT3 A;  3O9S A;  1YXQ A;  1C0M A;  4BRP A;  4EIA A;  4J2B A;  4A57 A;  4IO9 L;  2BE2 A;  4W5N A;  4KHS A;  1C0U A;  4B08 A;  5AQW A;  4CZG A;  4RCH A;  2P9I A;  4FJK A;  3D2F A;  1JLG A;  2WFB A;  3HRG A;  4WFN L;  3VA0 A;  3DM2 A;  4K43 A;  2HHH K;  3CJA A;  1FJG K;  3PO5 A;  4CW7 B;  1S3X A;  1BOT O;  1VK0 A;  1Q18 A;  4PQU A;  5CHI A;  3ULD A;  3F9K A;  1G15 A;  4EP4 A;  4DQS A;  5AQX A;  3HP9 A;  4F2S A;  1OH8 A;  3D2E B;  1RCH A;  1S5J A;  2QWQ A;  4CFA A;  4IJA A;  4IG0 A;  1TAQ A;  4ZTJ A;  5H1S Q;  4FM2 A;  3M8Q A;  3VPZ A;  1S1V A;  1TGO A;  3PIP L;  3MWP A;  4N56 A;  1YIT N;  4H0P A;  3M8S A;  5HP1 A;  1NGG A;  2HB5 A;  2E1Z A;  4JAX A;  4KI6 A;  2P9K A;  4OPH A;  3HO1 A;  5C0Y A;  1VSM A;  1QQM A;  3MN7 A;  2B6A A;  3NVK A;  1ZC6 A;  3QIP A;  3VQE A;  3NVM A;  1BQM A;  1NK4 A;  3LPT A;  3VEV A;  1I94 K;  1KSP A;  2NRT A;  2WBN A;  2YCH A;  4HUF A;  5AZJ A;  3A5M C;  4CZJ A;  3K0S A;  3V4I A;  3CCS N;  3NF6 A;  3TAF A;  3LZI A;  2Q0U A;  4CHO A;  2O4G A;  4BR0 A;  1V4T A;  4MLE A;  4CJS A;  2A1S A;  2RHK A;  4V19 S;  2D0O A;  4RW4 A;  2GWJ A;  3D7E O;  2VG5 A;  4CJT A;  3MDQ A;  3UKU A;  3L0Q A;  4H0O A;  1ZBS A;  4OLB A;  4JKG B;  3NF8 A;  2Q3S A;  3OS1 A;  3F2K A;  5KQD A;  3T19 A;  4GY2 B;  3TAP A;  3AVM A;  2GX9 A;  1ESV A;  1MWM A;  5ELZ A;  4YNQ A;  4XIU A;  4CJK A;  1OKJ A;  4EHU A;  3C0B A;  4CJP A;  3ZSZ A;  4JRP A;  4OKJ A;  1KRP A;  1NK7 A;  2D0P A;  1IH7 A;  4F3T A;  3LP1 A;  2VQF K;  4CEC A;  3ULE B;  3MAQ A;  1DKG D;  4IEE A;  4DS5 A;  3CC7 N;  2KZZ A;  4JNE A;  4IWV A;  1UA1 A;  3CM6 A;  4BRA A;  1LWF A;  4BRD A;  5FRO A;  5CE3 A;  2V52 B;  4CEO A;  4FJM A;  5M1P A;  3U3Y A;  3N4Q A;  4CJQ A;  1RBU A;  2NRV A;  1X9J A;  1TAU A;  4M3T A;  3TPQ A;  3N4P A;  4H5T A;  5M1N A;  3G6E N;  3C94 A;  2HBM A;  2XY5 A;  3OBY A;  4FJL A;  1SKS A;  4J2D A;  1BQN A;  3BDP A;  4HHT A;  2XY7 A;  4CZI A;  2UUA K;  2WUS A;  4DTO A;  4LSL A;  4WFA L;  3L2U A;  4MFB A;  2D0A A;  4RG8 A;  4XEI A;  4BR9 A;  1U2V A;  3OYL A;  1VSH A;  5C24 A;  3ZSW A;  2RE2 A;  3PY8 A;  4PWD A;  2UXD K;  4DFK A;  3AO1 A;  4KO0 A;  5I9E B;  1KTQ A;  3C6T A;  3VET A;  1ATN A;  5TKY A;  4MLH A;  4LFA K;  3NH0 A;  3WT0 A;  3R6M A;  1RT7 A;  3DOK A;  3E9L A;  1U47 A; 
#chains in the Genus database with same CATH homology
 4KRE A;  3PX0 A;  1IO2 A;  1O1W A;  3PX4 A;  4G1Q A;  4CF1 A;  1WN7 A;  2RN2 A;  4DQR A;  3S3N A;  2G8U A;  1HQU A;  3QNO A;  4I2Q A;  4YFU A;  3TAE A;  4BE0 A;  4J2E A;  3SPY A;  3OVN A;  1HQE A;  3AVL A;  4K8X A;  3OYE A;  1F21 A;  2KW4 A;  4Z4F A;  4DF4 A;  1TK0 A;  1WAJ A;  4PUO A;  1VSF A;  2O4I A;  1NOZ A;  4O0I A;  2ETJ A;  3LPU A;  1BIZ A;  1ASW A;  1CZB A;  1LW2 A;  1WSE A;  1GOA A;  3H08 A;  1C6V A;  2P51 A;  1TV6 A;  4LH5 A;  1BIS A;  1JLC A;  2KFZ A;  2ZE2 A;  4FK0 A;  4DFP A;  3AVF A;  3O4Q A;  4LY7 A;  3TR8 A;  1W9H A;  4M42 A;  4CEB A;  4FZY A;  2FC0 A;  3KKR A;  4KTW A;  3HM9 A;  2XRI A;  3L3V A;  4DTU A;  1S9G A;  1WSI A;  3DMJ A;  4KHY A;  2KFN A;  3O3G A;  3FFI A;  4R5P A;  4OLA A;  5I42 A;  2FBY A;  1EX4 A;  3SQ2 A;  3LP0 A;  4DTP A;  1JXE A;  3D0P A;  3RMB A;  3AA5 X;  1HMV A;  2Z1H A;  4O4G A;  5I3U A;  4CED A;  3IRX A;  2YNF A;  3O3F A;  3OS2 A;  5D3G A;  4CJF A;  5FDL A;  1DTQ A;  4AIL C;  2OPS A;  2OZS A;  2HHS A;  4BDZ A;  2HNZ A;  1B9D A;  3TAQ A;  3LAN A;  2OPQ A;  3V1R A;  2HMI A;  5CYM A;  1KVA A;  1JL1 A;  1LW0 A;  3VQA A;  4CEQ A;  4HCC A;  1BL3 A;  3NGZ A;  3LP2 A;  3QET A;  1SKR A;  3CQ8 A;  1KFS A;  1U4B A;  4K8Z A;  4CF8 A;  3K5M A;  3ZT2 A;  2BGG A;  4PY5 A;  3HP6 A;  1L5U A;  1Z25 A;  4IDK A;  3SI6 A;  4DQP A;  3OYC A;  1UWB A;  5CYQ A;  2XY8 A;  3ZSQ A;  1RDB A;  4Z0U A;  3CFO A;  3O4N A;  3M8R A;  1XHZ A;  1JKH A;  4CIF A;  4KHN A;  2KTQ A;  4IBN A;  4DQQ A;  2IOC A;  3I0R A;  4CGD A;  3HXM A;  5JS1 A;  1WSJ A;  2IC3 A;  4NYF A;  1RTH A;  4OGE A;  3JSM A;  1S1T A;  1HJR A;  1VSK A;  1Q9Y A;  2I5J A;  5CZ2 A;  5KTQ A;  3PO4 A;  3RRG A;  4FJ7 A;  2PYL A;  4DSJ A;  1C1C A;  2VWK A;  4AHU A;  4M3W A;  3CG7 A;  3NF7 A;  4O0J A;  1XC9 A;  3SCX A;  4IFV A;  1Q8I A;  4E89 A;  3VA3 A;  5KRS A;  1HNV A;  3NGI A;  3AVH A;  4DTN A;  1SUQ A;  3PX6 A;  3AVB A;  3K5O A;  4BDY A;  1ZBL A;  3NH2 A;  4HCB A;  1ASV A;  1X9W A;  2ATQ A;  5HRO A;  3V9U A;  3DRR A;  5KRT A;  2GV9 A;  4ICL A;  5DK5 A;  3VQB A;  3VQD A;  2DTU A;  4ELT A;  1RIL A;  1NJZ A;  1LAW A;  4NYN A;  5K14 A;  4C8L A;  1QS4 A;  3OYI A;  4C8M A;  2BAN A;  4GVM A;  3C95 A;  4ID1 A;  3V9Z A;  4DU3 A;  4F8R A;  1VRU A;  1QTM A;  4BWJ A;  3VQ6 A;  5HRP A;  4ELV A;  1VSD A;  1YT3 A;  4CJV A;  3K5N A;  4DSI A;  3QIN A;  4E19 A;  3V1O A;  4AHC A;  1C1A A;  4KKO A;  4FCY A;  1NKE A;  3NF9 A;  1XWL A;  4KHU A;  3KLG A;  3SQ0 A;  4ZTF A;  3RR8 A;  2YHB A;  4RW8 A;  2HVH A;  3CYM A;  2FBX A;  3DLR A;  1RDC A;  4DTS A;  1WSH A;  3VQQ A;  1L3T A;  1TKX A;  3DLK A;  4FVM A;  4O5B A;  4RW6 A;  4CEA A;  1NK6 A;  1HYS A;  3AVI A;  3OYH A;  4KFB A;  5HRN A;  4PA1 A;  3L2W A;  3AVJ A;  4CFB A;  3LAK A;  4CER A;  1S9E A;  3K5L A;  1IG9 A;  2G8H A;  1RBR A;  2LSN A;  1QSY A;  1B9F A;  4CHN A;  5JS2 A;  4KAZ A;  4B9L A;  4ELU A;  4BE1 A;  1L3S A;  1SV5 A;  3L2V A;  4FJX A;  1IKV A;  4FK4 A;  4KB1 A;  3AVA A;  4KV8 A;  2F96 A;  4AHS A;  4IFY A;  3AA4 A;  3S3O A;  1NK5 A;  1VSE A;  4GW6 A;  4KI4 A;  1UAX A;  1DTT A;  4KHW A;  4FYD A;  4EP5 A;  1L3V A;  4FLV A;  4C8N A;  3CFP A;  2DFH A;  2A1R A;  2Z1J A;  3KD5 E;  1QE1 A;  4DMN A;  3OYD A;  1N6Q A;  3NGY A;  2G8F A;  3ZSV A;  3OYA A;  4M45 A;  1NKB A;  1A5W A;  5CY4 A;  5HBM A;  3KLI A;  1N5Y A;  3AVG A;  3HL8 A;  3RWU A;  1KLM A;  3WNE A;  4E1M A;  3E01 A;  1I39 A;  5KGW A;  2OYQ A;  2EHG A;  4FLZ A;  3ASM A;  1IKW A;  2VG7 A;  2G8I A;  2RF2 A;  4NCA A;  1VSL A;  3MEC A;  4J2A A;  4DSK A;  2XHB A;  1JXB A;  3KD1 E;  4FW1 A;  3QLH A;  3KKS A;  1FKP A;  2JLE A;  1DLO A;  1W0H A;  3T1A A;  5C25 A;  3AO4 A;  1SL2 A;  4NCB A;  4M3Z A;  3QO9 A;  3ZT0 A;  1JLF A;  1IKX A;  2YKN A;  3MEE A;  4W5R A;  3QER A;  2EX3 A;  3V6D A;  4CFC A;  4M3R A;  4QAG A;  1D8Y A;  1S1W A;  3OY9 A;  1VRT A;  3SV4 A;  1HYV A;  3LP3 A;  4B8A B;  3SUQ A;  2DY4 A;  3AO3 A;  1EP4 A;  3QIO A;  1RBV A;  2Z1I A;  4H8K A;  4HUE A;  3TAG A;  1NK8 A;  1RDD A;  4FK2 A;  3VQ4 A;  5J1E A;  5J2N A;  2X6N A;  4OKK A;  3TAM A;  4FJ9 A;  4B9V A;  3AVK A;  4RW9 A;  1NK0 A;  2HNY A;  4KTQ A;  1S1X A;  1QSL A;  3VQ5 A;  2DFF A;  1HRH A;  3WNF A;  1JL2 A;  2E6M A;  4JLH A;  3SQ1 A;  4KPY A;  1KVB A;  4CEZ A;  3VN5 A;  2F8S A;  1WSG A;  3HT3 A;  4CEE A;  4FLX A;  3ISN C;  4HUG A;  4FM0 A;  4KRF A;  2G8W A;  4DFM A;  1ZBI A;  3NBP A;  3LAM A;  4RW7 A;  3JYT A;  4DU4 A;  3SJJ A;  2NUB A;  2ZQB A;  4CHP A;  3AVN A;  3K57 A;  4CJ3 A;  2ITG A;  4DSL A;  2OZM A;  4CF2 A;  1L3U A;  4BDP A;  4FJJ A;  1CLQ A;  2DFE A;  4E3S A;  3HK2 A;  4TSX A;  1KLN A;  2QKK A;  1NOY A;  4QCL A;  1Q9X A;  1EKE A;  1T8E A;  2Y1I A;  4W5Q A;  4B9S A;  3OYJ A;  3F73 A;  2HW3 A;  2IGI A;  3LZJ A;  4LD0 A;  4CE9 A;  3HST B;  1HYZ A;  3ITH A;  5J2M A;  4E0D A;  3HPO A;  1ASU A;  1X9S A;  1SL0 A;  1S6Q A;  1RTI A;  3HPH A;  4E1N A;  1NJW A;  1D5A A;  1RBT A;  4OKE A;  4FJ5 A;  4KB0 A;  1LWC A;  2JGU A;  4WE1 A;  3IG1 A;  1WLJ A;  1RT6 A;  5SWM A;  4Z4H A;  3I8D A;  3MEG A;  3QEX A;  1R0A A;  2P1J A;  3AO5 A;  3OYK A;  2YV0 X;  4B8C A;  3LWL A;  2KZM A;  1U04 A;  4OJR A;  3DOL A;  4CJ5 A;  4C8K A;  1VSI A;  1TKZ A;  1T05 A;  3UIQ A;  4HVJ A;  2R7Y A;  2D5R A;  2YNI A;  3KIO A;  3VQ8 A;  4AHT A;  3NDK A;  3U6F A;  2BDP A;  3KTQ A;  4DU1 A;  4FW2 A;  3SQ4 A;  3M8P A;  4CGJ A;  3P5J A;  4CGF A;  3KK1 A;  4CIG A;  2XY6 A;  1UOC A;  4B9U A;  3DLG A;  4DSE A;  1LAV A;  3C6U A;  3KLF A;  5HRR A;  2Y1J A;  1TK8 A;  2RPI A;  1YVU A;  4KHQ A;  4EZ9 A;  1J54 A;  3RMD A;  1JLE A;  3SYZ A;  2X74 A;  4OVL A;  4CJL A;  4Z4C A;  3V81 A;  4BE2 A;  2YNH A;  4W5O A;  3QEW A;  1TK5 A;  2X6S A;  4DTX A;  2OPR A;  3AA3 A;  3WNG A;  3AVC A;  1C0T A;  3WNH A;  4DSF A;  1I3A A;  1RT3 A;  3KJV A;  4CJE A;  1C0M A;  1SKW A;  3P83 D;  4J2B A;  1JLQ A;  1BGX T;  3TI0 A;  3QEV A;  1NJX A;  3TWH A;  4CF0 A;  4IKF A;  4CK3 A;  2BE2 A;  4FJH A;  1S1U A;  1J5O A;  4W5N A;  3SPZ A;  4KHS A;  1C0U A;  2YKM A;  4N5S A;  4CJW A;  4B08 A;  3OYF A;  2AJQ A;  4AHV A;  4DTR A;  3L8B A;  3PV8 A;  3ZT1 A;  4N41 A;  2HHW A;  3OYB A;  4H4M A;  1X1P A;  4FJK A;  5EU7 A;  4F4K A;  1JLG A;  3NHG A;  3VA0 A;  2IAJ A;  3DM2 A;  3L2R A;  3QNN A;  3LWM A;  2PY5 A;  1ITG A;  1REV A;  3RRH A;  4CEF A;  3PO5 A;  2HND A;  3A2F A;  1T7P A;  3BGR A;  1VK0 A;  4MQ3 A;  3ALY A;  4FLT A;  4PQU A;  2G8K A;  4CK1 A;  3ULD A;  3S9H A;  3ZCM A;  3F9K A;  4M3U A;  1J53 A;  3AA2 A;  1G15 A;  5T7B A;  4AHR A;  4DTM A;  4EP4 A;  4FZZ A;  4CK2 A;  4DQS A;  1J9A A;  3HP9 A;  5DMR A;  4CES A;  4FZX C;  1GOC A;  3AO2 A;  1D9D A;  4F2S A;  2OPP A;  1RCH A;  3S3M A;  1S5J A;  4OPJ A;  4B9T A;  1BI4 B;  1NJY A;  4CFA A;  3KK3 A;  1XI1 A;  4CF9 A;  4UQG A;  2E4L A;  3MED A;  1TAQ A;  4IG0 A;  3ZSR A;  1QQC A;  4CGH A;  5SZT A;  3SV3 A;  4ZTJ A;  2QXF A;  2X78 A;  5KI6 A;  3EYZ A;  4FM2 A;  3KK2 A;  1VSJ A;  3M8Q A;  4O44 A;  4H4O A;  1HPZ A;  1EXQ A;  4Q5V A;  1S1V A;  3EZ5 A;  1TGO A;  4FJN A;  1ZYQ A;  3VQ7 A;  4BWM A;  4N76 A;  4DTJ A;  1RNH A;  4N56 A;  4E7J A;  1D9F A;  1ZBU A;  1RDA A;  3M8S A;  4OGC A;  1ZBF A;  4CGG A;  4HTU A;  5HP1 A;  2B4J A;  2HB5 A;  4GMJ B;  3CFR A;  4I2P A;  4FLW A;  1BI4 A;  1U48 A;  3V1Q A;  1HNI A;  1RT2 A;  2HHV A;  1CZ9 A;  2HHT A;  4KI6 A;  3HO1 A;  4CHQ A;  1VSM A;  1WSF A;  3I0S A;  2B6A A;  2PZS A;  3OJU A;  4Z4I A;  4EZ6 A;  3P1G A;  4Y1D A;  3ZT4 A;  2IS3 A;  2FBV A;  5CZ1 A;  1TVR A;  3HVT A;  3V9X A;  4FJG A;  3QIP A;  1A5X A;  4DF8 A;  1X9M A;  1FKO A;  3VQE A;  3SNN A;  1BQM A;  3L2Q A;  1EET A;  2D0B A;  1NK4 A;  4Y1C A;  1WAF A;  3LPT A;  2HHX A;  3TAN A;  3CM5 A;  3DRP A;  1UA0 A;  4C8O A;  3T3F A;  2F8T A;  1KSP A;  1RT1 A;  3OS0 A;  3RR7 A;  4HUF A;  3OJS A;  3ZSY A;  1QSS A;  2YNG A;  4ZHR A;  1MU2 A;  3V4I A;  1LV5 A;  3OYM A;  4O55 A;  3NF6 A;  1IKY A;  1TL3 A;  4B9N A;  3NH1 A;  3TAF A;  1TKD A;  3LZI A;  3KLH A;  4CHO A;  3G0Z A;  3IAY A;  2VG6 A;  2O4G A;  4CJS A;  3DLB A;  2A1S A;  1RBS A;  3HYF A;  4RW4 A;  3ZSO A;  1LWE A;  4FXD A;  3V9S A;  2VG5 A;  3QEP A;  3B6P A;  4CJT A;  5HLF A;  3LAL A;  3V9W A;  4CJU A;  1K6Y A;  2Z1G A;  4DLG A;  4OLB A;  3NF8 A;  2Q3S A;  4E7L A;  3OS1 A;  4I7F A;  3NAE A;  3SUO A;  1Z26 A;  1CXU A;  2XO7 A;  2P5G A;  3NFA A;  3T19 A;  3TAP A;  4F3O A;  1KCF A;  3AVM A;  3NCI A;  5KGX A;  4Q0B A;  2GUI A;  1TKT A;  4I9L A;  4YNQ A;  4XIU A;  3MXI A;  4E7H A;  4L8R B;  2ZD1 A;  4CHZ A;  4CJK A;  3D45 A;  1U49 A;  3AV9 A;  1C1B A;  3SZ2 A;  2GBZ A;  1WNS A;  4F2R A;  3HPG A;  4JS4 A;  1TL1 A;  4CJP A;  3ZSZ A;  3SUP A;  2OA8 A;  4DG1 A;  4M3Y A;  4JRP A;  2G8V A;  1Y97 A;  1BCO A;  4OKJ A;  4N47 A;  1KRP A;  1GOB A;  4CJ4 A;  4BAC A;  1NK7 A;  4DLE A;  4NCG A;  3TAB A;  1IH7 A;  4ID5 A;  3L3U A;  4FJI A;  4E7I A;  4F3T A;  2D0C A;  3DYA A;  3LP1 A;  1RTJ A;  2B5J A;  4CEC A;  4LSN A;  3MAQ A;  4FM1 A;  4DS5 A;  4M3X A;  4I9Q A;  1ZBH A;  4B3O A;  2KZZ A;  4FJ8 A;  2QKB A;  2HHU A;  3VQP A;  1UA1 A;  3CM6 A;  2HVI A;  3O3H A;  1LWF A;  5FRO A;  1FXX A;  3HVR A;  1RT4 A;  4CEO A;  3THV A;  4M41 A;  3RTV A;  4FJM A;  4OPK A;  3U3Y A;  4CJQ A;  1QHT A;  1SL1 A;  1RBU A;  4CGI A;  1RT5 A;  2WON A;  1TAU A;  4M3T A;  3B6O A;  1NK9 A;  3VQC A;  1YTU A;  3QES A;  1BIU A;  3RMA A;  1YTA A;  3NE6 A;  4DQI A;  2RKI A;  3OYG A;  1KVC A;  3U3G A;  3ZSX A;  1U45 A;  5E41 A;  1T03 A;  4Z4E A;  1CXQ A;  2FBT A;  3K2P A;  3C94 A;  1BHL A;  1XHX A;  3IS9 A;  2XY5 A;  4FJL A;  1SKS A;  4J2D A;  4JRQ A;  5J2Q A;  5C42 A;  4QOZ B;  1BQN A;  3BDP A;  1S6P A;  3K59 A;  5FRM A;  3DLE A;  4HHT A;  3MXJ A;  4FLU A;  4CJR A;  2XY7 A;  3QEI A;  4B9M A;  3DI6 A;  4DFJ A;  3HJF A;  4CHY A;  4DTO A;  4LSL A;  1JLB A;  2W42 A;  4W5T A;  4E7K A;  1JLA A;  3G10 A;  4AH9 A;  4Z4G A;  2QK9 A;  5HRS A;  3L2U A;  4MFB A;  2PYJ A;  2D0A A;  4CFD A;  1FK9 A;  4RG8 A;  3ZT3 A;  3SUN A;  1B92 A;  4IG3 A;  4FLY A;  3KLE A;  4LH4 A;  3DLH A;  2KQ2 A;  3PUF A;  1VSH A;  5C24 A;  3VQ9 A;  3ZSW A;  3OYL A;  3K58 A;  5J2P A;  4DFK A;  3PY8 A;  4PWD A;  3AO1 A;  4KO0 A;  2HHQ A;  2E6L A;  4CCH A;  3RMC A;  1RTD A;  1BCM A;  4DWI A;  3MXM A;  1KTQ A;  2P5O A;  3C6T A;  2WOM A;  4JS5 A;  1KFD A;  1NKC A;  5FRN A;  4DS4 A;  4KTZ A;  1A5V A;  2IDO A;  3TAR A;  3NH0 A;  3OYN A;  3EY1 A;  1RT7 A;  3DOK A;  3DRS A;  4CIE A;  3LDS A;  2VWJ A;  1U47 A;  2YHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...