1EXQA

Crystal structure of the hiv-1 integrase catalytic core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
147
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPYVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords POL POLYPROTEIN
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 44
structure length 147
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1exqA00
2ZD1A 2D5RA 4BE0A 3U3GA 3KLGA 4FCYA 4AILC 1UA0A 4KRFA 4FW1A 4CGIA 2YNGA 3C94A 4B9LA 1TGOA 3CQ8A 4YNQA 3DLGA 1YTAA 3DLEA 1WN7A 1LWEA 1UWBA 3CM5A 4PY5A 3PY8A 1WSGA 5C42A 5KGWA 1UAXA 4IKFA 1RTHA 4OGCA 4N76A 1RNHA 4FLZA 2AJQA 4IG0A 4M3UA 3ZT0A 3ZT3A 3M8SA 4F2RA 4N41A 3OYDA 3K5OA 3V1OA 3NF9A 4WE1A 1BQMA 2YKNA 1LW2A 3DI6A 3KK2A 1LAWA 1UA1A 4FLXA 5KRTA 3SPYA 4B9SA 1TKDA 5KI6A 1CXUA 4QAGA 1HQEA 2FBVA 4DTSA 4FJJA 3CFPA 2IDOA 4KHNA 4CFAA 3I0SA 4KI6A 4FZZA 1TK5A 1TK0A 2OYQA 3AVMA 3I0RA 3P83D 4CF0A 1Z26A 1J5OA 1KTQA 1SL1A 1S9GA 2Z1HA 3RMDA 1L3TA 3L2QA 3OJUA 3SQ0A 2PYJA 1S1WA 4FJXA 3VA0A 1GOBA 4ICLA 2GUIA 4C8KA 3DOLA 1HYSA 3ZT4A 4OPKA 4BE2A 3SPZA 4CGGA 3SZ2A 4DSJA 3MAQA 4E1NA 1A5WA 3KLHA 2O4GA 3VQ6A 1RTJA 3LPTA 4CJRA 3V9ZA 2QKBA 2YNIA 3CM6A 4ELUA 3OYEA 3VQ7A 1RBRA 4AHCA 4FJIA 4W5QA 1HPZA 4CGHA 4JS4A 4CCHA 1ZBIA 5J1EA 1RDBA 4Z4FA 4BDYA 3QEWA 4ELTA 4AHUA 1FKPA 4J2DA 4I2PA 4CF9A 2G8FA 2F96A 5JS1A 2GV9A 3LALA 4OJRA 2BE2A 4OLBA 1QTMA 4HHTA 4BWJA 3NCIA 2VG6A 3V9UA 1ZBUA 1G15A 1U48A 3S3NA 4RG8A 3E01A 3PV8A 3HP9A 4CJWA 1U47A 1GOAA 4KTQA 1TKTA 4C8LA 3RWUA 4CESA 3LWLA 4F8RA 3AO3A 3P1GA 1SL2A 4CEDA 2RF2A 3AA4A 1VSFA 4IBNA 3VQEA 3S9HA 5DMRA 4Z4EA 1NJZA 3VQPA 2EHGA 3T1AA 4E89A 4HTUA 1RCHA 1S6QA 2OPPA 4KO0A 3WNEA 3SQ2A 1UOCA 1VK0A 3V9WA 3M8PA 3SJJA 1BCMA 3HO1A 1RDDA 1SUQA 2KFZA 1X1PA 3DMJA 2G8WA 2RN2A 3QEIA 1CLQA 4FW2A 3SUOA 4CECA 1NK5A 2YHAA 1N5YA 2PY5A 1CXQA 1JL2A 2OA8A 5HROA 3PX0A 1QS4A 4DQRA 1ASWA 3BDPA 3SUNA 1YT3A 1VSMA 4DFMA 2DTUA 1T05A 1J54A 3SQ4A 2OZSA 4FJMA 2HW3A 3MXMA 1WLJA 1QSLA 1XI1A 4ELVA 1T7PA 4G1QA 2X74A 4LY7A 4J2EA 3RRHA 4KAZA 2A1SA 4W5OA 4Q5VA 4NCGA 4CEBA 4R5PA 1LAVA 3DRRA 4CFCA 1O1WA 4CGFA 3NH0A 3SUPA 5CZ2A 3LAMA 4CJEA 1S1XA 3AO2A 3ALYA 3PO4A 2DFHA 4N47A 4RW7A 3THVA 1QE1A 1JLGA 2HVIA 1NK0A 1TK8A 4DTPA 2X6SA 3AVBA 4FM0A 2QK9A 4J2BA 4Z4CA 1WSJA 3HPHA 2G8VA 5K14A 3G0ZA 4CHYA 5KGXA 5J2QA 4NCAA 2D0BA 2W42A 4LH4A 3AVIA 5HP1A 3HP6A 4B9VA 4K8ZA 4W5TA 2HB5A 3IAYA 1S6PA 4O0JA 5HBMA 4KB0A 4MQ3A 3VQ9A 3QO9A 1W9HA 4IG3A 2Z1GA 4CEZA 1ZBFA 3QESA 1EX4A 3OYCA 3JYTA 4CJPA 4M3YA 4QCLA 4CHPA 3TR8A 4BDPA 1REVA 1KFSA 4HCCA 3QIPA 4DFPA 3AVKA 4B08A 3LP0A 1RILA 4C8OA 3F73A 4OKEA 4B9MA 3ZSZA 1FKOA 2ZE2A 1F21A 3OS0A 4FM2A 3O3GA 3T3FA 4Z0UA 4W5RA 4KREA 1NOZA 3NF6A 1JLAA 4CEQA 3OYHA 3DLBA 3ISNC 3ITHA 3D0PA 4DS4A 4CJKA 5I42A 3NBPA 3NF8A 4Z4HA 2KZZA 3FFIA 4CEAA 3L8BA 3L3VA 1SV5A 3AVCA 2X6NA 4EP5A 4CK3A 5HRPA 5CZ1A 3KTQA 1RT4A 1C6VA 3NAEA 1KSPA 4M45A 3ZCMA 1A5XA 2E6MA 2YNFA 3HVRA 4KPYA 3C6TA 5C25A 4O0IA 2HHSA 1HYVA 3B6PA 1Y97A 1WSIA 5FRMA 4DFKA 1RT1A 3KLIA 4M3WA 4AHRA 1EKEA 3AVJA 4JRPA 5DK5A 4EP4A 4KB1A 4CJ4A 4RW4A 3SI6A 1R0AA 2KW4A 2XY8A 3QINA 3V1QA 1EP4A 1RTIA 4DFJA 1XC9A 1YTUA 1SKWA 3AA2A 4B9UA 3TANA 1IKXA 1I3AA 4CF8A 4OPJA 4KI4A 2P51A 4KHSA 1U04A 4I2QA 4DSFA 3EZ5A 4Z4IA 4C8NA 1T03A 5JS2A 3ZSQA 4FJKA 1ZBHA 1ITGA 3SYZA 4B3OA 1B9FA 4LH5A 4HUEA 4FK4A 3OYLA 3A2FA 5D3GA 2IS3A 1C1BA 1RT7A 1HJRA 1X9MA 4CERA 5EU7A 1BIZA 4DF4A 1DTTA 1NK7A 4DU4A 1WAJA 1DTQA 3VQAA 1WAFA 2YNHA 3RMCA 1U49A 4DTUA 4FJ5A 5J2PA 4J2AA 1NK9A 1KCFA 1QQCA 1FK9A 1NKCA 2HHVA 4CIFA 2OPQA 3QIOA 1DLOA 2BANA 4FJLA 1Z25A 5FDLA 4BE1A 3V81A 4E19A 3OS2A 2B6AA 4AH9A 4AHSA 1NK8A 4CFBA 4MFBA 1RBSA 4DWIA 4E7KA 1VRUA 4KV8A 1VSJA 1SKRA 3M8QA 3NGZA 2VG7A 4W5NA 3V9SA 5KRSA 4F2SA 1JXBA 1QSSA 3RR7A 4O55A 3HVTA 1TL1A 4CHZA 1U4BA 3OJSA 1BISA 4K8XA 4CK2A 3OYBA 4IFVA 4AHVA 1EETA 2HHWA 1D9FA 3K2PA 4O4GA 4CEFA 4RW8A 3OYNA 3HL8A 4BACA 3SV4A 1Q9YA 2WOMA 3TAPA 4FK2A 2QXFA 3AVFA 3WNHA 1C0MA 2KFNA 3ZSXA 4FZXC 1LV5A 1GOCA 1BHLA 1D9DA 1CZBA 2XY5A 3IS9A 1VSIA 4BWMA 3ZSRA 4FM1A 1HQUA 3AO5A 1NKEA 3KK3A 1SL0A 4KFBA 3HPOA 1A5VA 1VSEA 2G8HA 2Y1JA 4M3TA 2G8UA 4E3SA 1LWCA 3RRGA 4ID1A 3RTVA 1YVUA 4OKJA 2IGIA 4FK0A 4F3TA 3B6OA 4RW9A 3NHGA 1U45A 3O4NA 3NH2A 4FXDA 4CJUA 2YHBA 4JLHA 2XY6A 1RBTA 3U3YA 3TAGA 3TAEA 3OYJA 4DQPA 1TV6A 4CJFA 3DLHA 5CYMA 4DF8A 1BGXT 3LWMA 4E7HA 3LP3A 4CHQA 1RDAA 3OYGA 2HHTA 4OGEA 1HNVA 4HUGA 4DU3A 3QETA 2Q3SA 4JS5A 3DLKA 4Y1CA 2D0AA 3KLEA 4HVJA 4F4KA 2O4IA 3DRSA 2I5JA 4M3ZA 4B9TA 3ZSYA 1TVRA 1I39A 4CJVA 3M8RA 4DQQA 1VRTA 3HXMA 3MXIA 1NJXA 4FJHA 3KD5E 3TAMA 4M3XA 1QHTA 3TI0A 3LP2A 2PZSA 3KIOA 4H4MA 1BCOA 2IC3A 3HM9A 2G8IA 3SQ1A 3K59A 4KHWA 3KK1A 4DTXA 1RT5A 5HRSA 2YV0X 3LZIA 2A1RA 1IKYA 4NYNA 2JGUA 3CYMA 3NH1A 3LANA 1NK4A 2Z1IA 1S1TA 2RKIA 5J2NA 3HYFA 4L8RB 1HRHA 4IFYA 3VQBA 3AVAA 4FJGA 1S5JA 1JXEA 3VN5A 3C95A 3VQ4A 1IH7A 4DSEA 3QERA 3S3MA 5E41A 1RBUA 3LP1A 4YFUA 3CG7A 1VSLA 2Z1JA 4I9LA 1C1AA 2OPSA 1CZ9A 4TSXA 4I9QA 3P5JA 1K6YA 1L5UA 1IKVA 4Y1DA 4N56A 4E7IA 3HSTB 4GW6A 3F9KA 3CFRA 4DTJA 3QEVA 3S3OA 3OYAA 1L3VA 3QLHA 3OYIA 4Q0BA 4E7JA 1JLCA 3MEEA 1C1CA 1VSHA 3TAFA 2BDPA 2HMIA 4FJNA 4E0DA 3AV9A 3HT3A 4LSLA 4DU1A 5HLFA 4FLTA 1L3SA 1TAUA 4OKKA 1JLQA 4PQUA 4KKOA 4KTZA 4CFDA 4DQSA 4FZYA 3MEDA 2IOCA 2NUBA 2VWKA 2PYLA 4FJ8A 3ZSVA 3EYZA 4DTNA 4DMNA 3PX4A 4Z4GA 2HHXA 2XO7A 1ZBLA 4DSLA 3K58A 4KHQA 5CYQA 5FRNA 3L2RA 3V4IA 2HNDA 3OVNA 4CGDA 3AO4A 2E4LA 1LW0A 1KVCA 4DLEA 4FLVA 2D0CA 4CF2A 3TABA 2QKKA 1NJYA 3ASMA 3OY9A 1J53A 1JLFA 3ULDA 2HNZA 3HJFA 3D45A 1ASVA 2Y1IA 3VQ5A 1BI4B 2EX3A 4IDKA 3TWHA 1Q9XA 4KHUA 2JLEA 5SZTA 2P1JA 1IO2A 1HMVA 2DFFA 4CK1A 3MECA 3NGYA 1HYZA 2XHBA 4I7FA 4H8KA 3LPUA 3SNNA 4DTOA 4PA1A 1XHZA 1NKBA 4PUOA 4M42A 1KVAA 2ATQA 3L3UA 3OYMA 3BGRA 3MXJA 2F8SA 2KZMA 3DM2A 4EZ6A 4F3OA 3SUQA 4B9NA 1Q8IA 4EZ9A 1RT3A 2WONA 3AVNA 3IRXA 4O44A 1S9EA 3K5MA 3KKRA 3HPGA 4B8CA 3AVGA 1BIUA 4GVMA 3K57A 2R7YA 1FXXA 3PX6A 4PWDA 1W0HA 3RMBA 1B9DA 3ZT2A 3CFOA 3NF7A 4AHTA 4FLWA 4FLYA 4DTMA 1WSEA 4CEEA 1VSDA 3NGIA 3DYAA 3AA5X 3AO1A 3WNFA 5KTQA 3WNGA 2DY4A 2BGGA 5I3UA 3MEGA 3UIQA 4FJ7A 1C0UA 3O4QA 5C24A 3LZJA 1B92A 3KKSA 3PUFA 3H08A 1KVBA 3L2VA 2ZQBA 1NJWA 5HRNA 4OLAA 4CHOA 1QSYA 1WSFA 1X9WA 3V6DA 1RT6A 2HVHA 3ZSOA 3SCXA 1XHXA 2HHQA 4QOZB 3VQCA 1J9AA 2F8TA 1ASUA 1TL3A 5T7BA 1JLBA 1TKZA 5J2MA 2G8KA 4CJLA 4CE9A 2FBXA 1N6QA 4DSKA 4KHYA 2B4JA 4FYDA 4DS5A 4ID5A 3QNOA 2ITGA 4ZHRA 4H4OA 2DFEA 3OYFA 4E1MA 2KQ2A 3LAKA 4CJ5A 3KD1E 1NOYA 3L2UA 4CJTA 4CHNA 4O5BA 2FBTA 4FVMA 2RPIA 2GBZA 4B8AB 3KJVA 4CF1A 1BL3A 4M3RA 3SV3A 1WNSA 3V1RA 2X78A 4CEOA 3U6FA 3HK2A 1KLNA 1C0TA 5HRRA 3PO5A 4DLGA 3DOKA 1JLEA 1T8EA 1SKSA 2YKMA 3IG1A 2IAJA 1LWFA 4DQIA 3ZT1A 4JRQA 3NE6A 4LSNA 3QNNA 4BDZA 1HNIA 3G10A 5SWMA 4XIUA 3NDKA 4DTRA 1NK6A 1KLMA 3AVHA 1EXQA 2B5JA 4E7LA 3I8DA 2VWJA 3OYKA 3QEPA 1RTDA 3VA3A 1S1VA 1IKWA 4CJQA 3EY1A 1BQNA 2ETJA 3RMAA 1RT2A 4M41A 3TARA 1D5AA 5CY4A 1L3UA 4LD0A 3VQDA 1JL1A 1TAQA 4CJ3A 4OVLA 1BI4A 4UQGA 3LDSA 4FJ9A 2LSNA 2FBYA 3TAQA 2P5OA 1S1UA 4RW6A 2HHUA 3OS1A 1RDCA 3DRPA 1TKXA 4KTWA 4N5SA 4FLUA 3ZSWA 1X9SA 2FC0A 2KTQA 3C6UA 4C8MA 3DLRA 3AA3A 3NFAA 4CJSA 5FROA 3T19A 2E6LA 3VQ8A 4CIGA 1KFDA 4DG1A 3O3FA 3V9XA 1VSKA 4NYFA 4CIEA 1D8YA 1JKHA 3RR8A 2OZMA 1KRPA 2XRIA 3O3HA 2VG5A 2XY7A 1MU2A 1ZYQA 1XWLA 3K5NA 2HNYA 3K5LA 1WSHA 3QEXA 4HUFA 2P5GA 3VQQA 1RBVA 4CGJA 4ZTJA 4DSIA 4HCBA 3JSMA 4ZTFA 4GMJB 3KLFA 4NCBA 1IG9A 3AVLA 3L2WA 2OPRA
chains in the Genus database with same CATH superfamily
4BE0A 3U3GA 3KLGA 2WTUA 2P9LB 1TGOA 3CQ8A 4YNQA 1ILYA 3OBWA 3VETA 4BRKA 3G6EN 1UAXA 2PFUA 3PIOL 5DM6L 5ADXH 4JI3K 5AQYA 4N76A 1RNHA 4LFBK 4X62K 1OH8A 5GADP 4FWMA 4M3UA 4N41A 4OX9K 1K8KB 3NF9A 4WE1A 5I9EB 1LW2A 3KK2A 1ATRA 4DCHA 3R3LA 2GTDA 4B9SA 3IDHA 5KI6A 4QAGA 3SK3A 4KHNA 4CFAA 4KI6A 4H03B 4B1YB 1GLFO 2P9KA 1L3TA 4H5RA 5AQMA 3SQ0A 1S1WA 1GOBA 4DR2K 3SPZA 4IWVA 4BE2A 4CGGA 3SZ2A 2A40A 4IEIA 3U9ZA 3LPTA 2VCPA 4CZEA 2YNIA 1BDGA 3PLAA 3OYEA 3JAMO 5AQKA 4AHCA 3I8BA 3GBTA 1HPZA 2V52B 4KH4A 4PL8A 1RDBA 2VGNA 4CF9A 2QWNA 2G8FA 3I55N 5JS1A 3AGKA 3QMLA 1HLUA 4B3RK 3CQYA 1RGIA 2WUSA 1U48A 3S3NA 4RG8A 3E01A 4KTQA 4C8LA 3RWUA 1S72N 3LWLA 3R9PA 1XC3A 3S9HA 4JEPA 3T1AA 1DKGD 4CVNE 3WNEA 2IVPA 1UOCA 4FWLA 3M8PA 1VQPN 4K42A 2KFZA 5HOOA 5AQHA 5AQIA 1ASWA 3BDPA 3SUNA 1VSMA 1J54A 3CJ7A 3E66A 3MXMA 2OTLN 4G1QA 2HF4A 3CCMN 4LY7A 4J2EA 3RRHA 2UU9K 1JCGA 3NH0A 4JI0K 3SUPA 4O5FA 4WQ5C 3LAMA 1GLLO 2O8CB 3AO2A 3PO4A 4WYBA 4RW7A 4GY2B 4YY3K 3VEOA 3TTFA 2X6SA 4Z4CA 5JICA 2G8VA 4NCAA 3AVIA 4B9VA 3S41A 1E3MA 2HB5A 3F5TA 3QO9A 1ZBFA 4JD2A 3JYTA 4CJPA 4K41A 1LCUA 4CHPA 3HM8A 3O6WA 4DFPA 1RILA 4BR9A 3GDQA 3ZSZA 2ZE2A 4Z0UA 4DV1K 3P4IA 1U6ZA 5M1PA 4CJKA 4H0TB 3NF8A 2KZZA 4YDUC 3FFIA 4BGAA 3L3VA 1S3XA 3AVCA 4LC9B 3NAEA 1A5XA 3HVRA 2QEXN 4IOCL 3WXIA 3ENHA 4DKWA 4EP4A 4CBXA 1BUPA 4V19S 2XY8A 3QINA 1Q86O 3AA2A 4BROA 4JI8K 4CF8A 1HJOA 4KI4A 4I2QA 4BQLA 5EOYA 1ITGA 4ILHA 4EAHD 2IS3A 1MDUB 4CERA 3THWA 2P9IA 5EU7A 2OCEA 2E5LK 4DF4A 2QXLA 1DTQA 1KQSM 3SJHA 4FJ5A 4J2AA 1KCFA 1FK9A 3MN5A 3EZWA 2O8FA 2BANA 4IZ9A 5FDLA 3CJAA 3CCVN 3P31A 3LM2A 4AHSA 4MFBA 3MX5A 2Q97A 4BVOA 2VG7A 4W5NA 3CXCM 4DUYK 1W2BM 3O08A 1DEJA 4FPBA 3AVFA 2CH6A 3WNHA 1C0MA 3CCJN 2KFNA 1LV5A 3FZFA 4BWMA 3AO5A 3FZKA 1XQSC 1SL0A 1NKEA 4KFBA 2G8HA 2Y1JA 1KC8O 4ID1A 3RTVA 1YVUA 4FK0A 4F3TA 1U45A 1VQMN 4FXDA 2XY6A 3TAEA 3OYJA 1TV6A 4CJFA 1VQON 3SBTA 1BGXT 4DF8A 1QHAA 2P9PB 3OYGA 2HHTA 1HNVA 3C0BA 4DU3A 2Q3SA 4JS5A 3DRSA 2E20A 4CBUA 1NJXA 2AA4A 2QW9A 4CZLA 3HXMA 2J4RA 3TI0A 2PZSA 3K59A 1RT5A 4A61A 5HRSA 2YV0X 4NYNA 3M5RA 3NH1A 3CYMA 3HYFA 2P9SA 4IFYA 1DGKN 4L8RB 3BF1A 4FJGA 3C95A 3VQ4A 1IH7A 3S3MA 1HKBA 2QA4N 4I9LA 1CZ9A 4TSXA 4I9QA 3P5JA 1NWKA 4N56A 1N33K 2GEMA 1YJ9N 3KWIA 4GW6A 3F9KA 3CFRA 3QEVA 3VTHA 4BRLA 3N4QA 4IEEA 3QICA 4E7JA 3K9KA 2BDPA 3O8MA 4E0DA 4LSLA 2YHXA 1JLQA 4NLCA 1YVNA 4CFDA 3ZETB 3MEDA 3VF2A 3R1XA 2A42A 1WUAA 2FLOA 1ZBSA 3H6EA 4DSLA 5E84A 4CGDA 4DLEA 2NLXA 4CF2A 2DPNA 1T6CA 3ULDA 1ASVA 4IDKA 1NGDA 4H0PA 2FSKA 4YOVA 4LFCK 2DFFA 2HMPA 3LPUA 3SNNA 1VQ9N 1BA1A 1NKBA 3EE8A 3OYMA 3MXJA 2KZMA 4JKAA 1RT3A 2WONA 3HPGA 4B8CA 3K57A 3PIPL 1FXXA 2P9NB 4AM7A 1J5EK 2Q36A 1B9DA 4FLWA 1VSDA 3AA5X 5KTQA 4WQ5A 2DY4A 2BGGA 3MEGA 1IBLK 5FPNA 1NGCA 4QS9A 1KVBA 2ZQBA 4BR5A 2IIRA 1X9WA 4UY8O 2HHQA 5IWAK 4YOXA 2F8TA 1ASUA 1TL3A 3FZHA 5J2MA 4GNIA 4DSKA 3CJ1A 1ATSA 4OPHA 4DS5A 4AM6A 3O80A 3OYFA 3G71N 4O5BA 2FBTA 2NRZA 2RPIA 4RTFD 3KJVA 4A5AA 4H0OA 4CEOA 2X78A 4YHHK 1KLNA 3M6GA 2YKMA 1HNXK 1JJ2M 1KLMA 3AVHA 4BG9A 2B5JA 4YDUA 3CMAN 1E4GT 3OYKA 2QI2A 3AY9A 4CZGA 1BQNA 4C1NK 1D5AA 1L3UA 3VQDA 1JL1A 4B3SK 1TAQA 5AQLA 4GKJK 4LF6K 2FBYA 3TAQA 4NLBA 1S1UA 4RW6A 4DV6K 4GV9A 2UXDK 4JKDA 3CHWA 3C6UA 2NNWA 3DWLA 1YJWN 4C8MA 3NFAA 2D0PA 4DG1A 5TKWA 2ZJPL 3V9XA 1KFDA 1U49A 2HHXA 4CIEA 5AFUA 2ASPA 1ESVA 1R59O 3D2FA 2XRIA 3HSCA 2XY7A 4MDAA 1OVYA 3L0QA 1XWLA 2HSTA 1W97L 1H1VA 1WSHA 4HUFA 4HCBA 3UKRA 5AQFA 5C25A 4EIAA 4R5PA 4O0IA 4DV2K 1YAGA 3D2EA 3A8YA 4FCYA 4F9OA 1UA0A 1X3NA 3ZX3A 4RWTA 4CGIA 3CCRN 2YNGA 3LDPA 3C6HA 3DLGA 4GV3A 4BRIA 4BRQA 4IKFA 5IT9O 1RTHA 3ULEB 4IG0A 4F2RA 2QWRA 3WQTA 3OHRA 1LAWA 3O9TA 1UA1A 3SPYA 3TSUA 1TKDA 1NU0A 3E1YA 3ID6A 2FBVA 1C0GA 2ITMA 3THYA 1TK0A 3P83D 1Z26A 1NGBA 1KTQA 2HBJA 4CBWA 1HKGA 2Z1HA 5AQXA 5JLFA 1GLEG 2FXUA 1LOTB 2OTJN 2NRXA 4A57A 4DV3K 2PYJA 3GL1A 1HKCA 2GUIA 2F7TA 4JI7K 2JWKA 3CC7N 4DR1K 1A5WA 3KLHA 2O4GA 4M7YA 4DQ8A 5C12A 4W5QA 1IG8A 4FWPA 4CGHA 4JS4A 5J1EA 3WXMB 4CW7B 3J7ZO 4BDYA 3CJBA 4AHUA 1FKPA 4C23A 3E9PA 4X65K 2GV9A 4OJRA 2BE2A 4OLBA 1QTMA 3V9UA 4BRPA 1G15A 3FZMA 3OTOK 3PV8A 1U47A 1GOAA 3ZX2A 3QFUA 1SQKA 1SL2A 1VSFA 3FE1A 3IUCA 3Q7CA 3VQEA 1VHXA 3H46O 3T69A 4HTUA 1K9MO 1RCHA 1S6QA 4FWQA 3VGKA 3SJJA 1BCMA 5AZJA 1XMOK 3O9SA 4H5WA 1X1PA 3QEIA 2VWBA 3SUOA 4CECA 1CXQA 3PX0A 1QS4A 4JKGA 4DFMA 2DTUA 1T05A 3SQ4A 3IKMA 4PKIA 3TPQA 2A1SA 4Q5VA 4NCGA 1LAVA 4CFCA 4CJEA 4IJAA 1S1XA 4YORA 2FF3B 5H1SQ 3ALYA 4N47A 2UUCK 3THVA 2HVIA 5M1KA 3THXA 1NK0A 3SMPA 4DTPA 2RE2A 3AVBA 4IOAL 3AGRA 3H1VX 5K14A 3G0ZA 4CHYA 3UKUA 5J2QA 2D0BA 4BQZA 4H5TA 4IFEA 3HP6A 4DR3K 3WEEB 4LF5K 5HBMA 4IG3A 4XH5A 3ENOA 4FOEA 1EX4A 4JK9A 4QCLA 3ZEUA 3TR8A 3VEYA 4X64K 4HCCA 4WQ4C 3H1QA 4B08A 5JVHL 4C8OA 4OKEA 3GE1A 2QWLA 3BP8A 3OS0A 4JK8A 5C0YA 3NF6A 4KH6A 5AQVA 3OYHA 4PL7A 3ITHA 3M1FA 5AZIB 4Z4HA 2YX6A 4U7BA 4CEAA 1SV5A 2E2OA 1NGAA 4YOTA 4EP5A 4KHPK 2GX9A 1OH7A 3KTQA 3E9OA 4M45A 5FLXO 3C6TA 5AQWA 3B6PA 4M3WA 3HZ6A 5LMNK 3ATUA 1VQLN 4JRPA 5DK5A 1VQ6N 3HOSA 3SI6A 4BR7A 2O8EA 2KW4A 3V1QA 1Q18A 1YTUA 3TANA 4BY9C 5C15A 4OPJA 4IXCA 4QS8A 3RVCA 4FJKA 3ZSQA 3SYZA 3I56N 3A2FA 1RT7A 1HJRA 2P9UB 3EKSA 4DU4A 3VQAA 3RMCA 2YNHA 1EO1A 2O8BB 5GIPA 1VQ7N 3CCLN 4FJLA 1Z25A 2YHWA 2YCHA 4PHTX 2O8DB 4NO7A 3EE9A 1RBSA 4E7KA 2H3GX 3M8QA 3NGZA 4O8KA 2BUPA 4JK7A 5KRSA 3Q7BA 2NRHA 1G99A 2VGMA 5AQZA 4QS7A 3RR7A 3KHYA 3HVTA 1TL1A 3OJSA 4K8XA 4DV4K 4AHVA 1EETA 4BACA 3VERA 3ZX0A 3SV4A 2HBMA 4FK2A 4DV5K 4BGBA 1BHLA 3FLCO 3IS9A 3ZSRA 4FM1A 3KK3A 1YITN 4M3TA 2G8UA 5E26A 3WT0A 3DXMB 4OKJA 2FF6A 2IGIA 3NHGA 4CJUA 4JLHA 5EVZA 1RBTA 5ADXA 3T7ZA 3MK6A 3LWMA 2ZGYA 4CJ7A 4Y1CA 3KLEA 3O1WA 2D1KA 4A2AA 4F4KA 4DR6K 4M3ZA 4B9TA 1QZ6A 3M8RA 3MXIA 1VRTA 4EFHA 2I7PA 3TAMA 4FOIA 3LP2A 2G8IA 1XNRK 1BCOA 4KHWA 3LZIA 3L6QA 5M1QA 1NK4A 1S1TA 2RKIA 5J2NA 5AQGA 1NGHA 2VQFK 1JXEA 4DSEA 3LP1A 4YFUA 2ASMA 2Z1JA 1C1AA 4I6MA 5JLHA 5JVGL 2GELA 1BWFO 3H3NO 4E7IA 3GG4A 5AQUA 3S3OA 4ISEA 3CD6N 2A41A 4A62A 3TAFA 2HMIA 5HLFA 1L3SA 4OKKA 2CH5A 4H0XB 4DB3A 4PQUA 4MO5A 2V7YA 3MX2A 3J7AP 2PYLA 4DUZK 3EYZA 3G4SN 2XO7A 4KHQA 1M1KO 5FRNA 4JKFA 3RSEA 3L2RA 3V4IA 1KVCA 4B1WB 2YJEA 2D0CA 3OY9A 3EEQA 3HJFA 3TSQA 2D4WA 3VQ5A 4KHUA 2P1JA 4I7FA 4H8KA 4M42A 1XHZA 3MCPA 3L3UA 2QM1A 4F3OA 3SUQA 1WBDA 4EZ9A 3IRXA 1U2VA 3AVGA 2R7YA 4C1NI 3HBTA 2QTDA 3CFOA 1M90O 4DTMA 1WSEA 1J6ZA 3DXKA 3DYAA 1KAZA 3AO1A 3PSFA 3UIQA 4JI5K 3O4QA 3LZJA 1OH5A 1B92A 1OH6A 3KKSA 1NBWA 3H08A 1NJWA 4CZJA 4LF8K 5TKYA 4OLAA 2NZTA 3J7YP 4CHOA 4BR0A 3MMVA 2HVHA 1NM1A 1RDWX 3C7NA 5LMUK 1J9AA 2G8KA 5GINA 2FBXA 3G25A 2B4JA 5AR0A 2ITGA 4ZHRA 5BPNA 2KQ2A 3LAKA 1NOYA 5AQJA 4CJTA 4CHNA 4WQ4A 4FVMA 4B8AB 1TYQA 3U6FA 4Z94A 3F9MA 5FPEA 4GVEA 5HRRA 3DOKA 1SKSA 2W6KA 1BG3A 4B1ZA 5M1NA 3O1BA 5KQ8A 3MN9A 3T1HK 1KAYA 3LDLA 4JRQA 1HNIA 5SWMA 4XIUA 3CMEN 3KK7A 2BTFA 2F9TA 5BN9A 2Q0RA 3ZLJA 1RTDA 1S1VA 4M63C 2P9KB 3EY1A 4CJQA 4M41A 5CY4A 3IFRA 4LD0A 3SMSA 5B8HA 4CJ3A 4JN4A 1BI4A 3LDSA 2LSNA 4IOXA 5AQTA 3OS1A 1X9SA 2FC0A 2FSJA 3N4PA 2E1ZA 3EO3A 3AA3A 3QB0A 3VQ8A 3T19A 4H5NA 3RR8A 1BO5O 4B3MK 2AP1A 2KKZA 2VG5A 3VF6A 4LF4K 1ZYQA 3WXKA 3K5LA 3QEXA 3VF4A 5AQNA 4CGJA 5F1XA 4ZTJA 3JSMA 4ZTFA 4GMJB 1QQOA 4NCBA 3L2WA 3HPHA 2OPRA 3HTVA 2ZD1A 2D5RA 4EHUA 4AILC 3LDOA 4JV5K 5AQOA 4B9LA 4PKGA 1YTAA 1WN7A 1LWEA 4BRNA 4PY5A 1WSGA 4BG8A 5KGWA 4OGCA 2AJQA 3ZT3A 5F2RA 1VQ5N 3OYDA 1BQMA 5F0XA 3DI6A 4FLXA 5KRTA 1CXUA 5LL6Z 4DTSA 4CZIA 4FZZA 3CPWM 2OYQA 3VEZA 1J5OA 5HL7L 1JCEA 2W6LA 3RMDA 3L2QA 3W3DA 3OJUA 4FJXA 1ATNA 4ICLA 4C8KA 3ZT4A 4OPKA 2HHHK 4JI2K 3MAQA 4LFAK 4E1NA 1RTJA 4CJRA 2UUAK 2QKBA 4LF7K 3CM6A 4JD2B 4ELUA 4JHDA 2I7NA 1RBRA 3VQ7A 4FJIA 3DLLL 4CCHA 1ZBIA 3M3ZA 1MWMA 4J2DA 4I2PA 2F96A 3LALA 4HHTA 3NCIA 4ILGB 1ZBUA 2V7ZA 3O4WA 3HOTA 4IO8A 3ATVA 3TTCA 4WFBL 3HP9A 4CJWA 2ASOA 3BZCA 1TKTA 3J8AA 4CESA 3AO3A 3P1GA 1HPMA 4CEDA 4IBNA 2P9LA 4JI1K 4Z4EA 1HUXA 1NJZA 4E89A 2EHGA 4FJ8A 4KO0A 4JKHA 1ZXOA 1TUUA 4WF9L 3HO1A 2W41A 3DMJA 2G8WA 1CLQA 4FW2A 3BZKA 4JI4K 1N5YA 1WBBA 2QWPA 1K8KA 5CR4A 4B1XB 2HW3A 4FJMA 1QSLA 1T7PA 2X74A 4CEBA 5MLCQ 2CGLA 2QWQA 1N32K 3DRRA 3THWB 2P9IB 3FGUA 4OPAA 3TSPA 1QE1A 3MWPA 1TK8A 1N34K 3A5LC 2QK9A 2O8FB 2E2QA 3AAPA 5KGXA 4LH4A 4K8ZA 3IAYA 2QWMA 4KB0A 2HBKA 3QESA 1REVA 3AVKA 3F73A 4B9MA 1FKOA 1SS6A 1F21A 5LY3A 3O3GA 4KREA 4A5BA 3SAGA 2E8AA 1NGEA 3DLBA 3CPEA 4DS4A 5I42A 3NBPA 4OO1J 4BR4A 5KPRA 3L8BA 5LJVA 1KSPA 3ZCMA 2YNFA 2CGJA 3U9DA 3NVMA 3MN7A 4B1UB 3SLCA 1WSIA 3FFKB 5FRMA 2IVOA 1RT1A 1YJNN 3KLIA 1KXPA 3AVJA 4KB1A 2VQEK 4CJ4A 1R0AA 1QZ5A 1XC9A 3PSIA 4MDBA 5BR9A 1IKXA 1I3AA 4K43A 2ZJQL 4GKKK 2P51A 4KHSA 4DSFA 4CD1A 4C8NA 1T03A 1B9FA 1NMDA 4LH5A 3C6AA 4BRHA 1C1BA 4ISFA 1X9MA 3VEWA 4AF1A 1E4FT 1BIZA 1IBMK 4CZHA 3J81O 1DTTA 2P9SB 1NGJA 1NK7A 1HR0K 5CHIA 1WAFA 2O8CA 5J2PA 4H5VA 3R8EA 4A59A 3W0LA 3OA9A 2HHVA 3QIOA 1KD1O 2E1YA 3EN9A 4CZKA 4BE1A 3V81A 1NGGA 4E19A 2B6AA 4DR4K 4FWSA 4JNEA 2BH1A 1VRUA 4KV8A 5AJ3K 1VSJA 4YOWA 3CETA 2ZF5O 1U4BA 4BRMA 1BISA 4CK2A 4IFVA 4XEIA 2HHWA 4CEFA 3HL8A 5BN8A 1SZ2A 3TAPA 2QXFA 3ZSXA 4FZXC 1GOCA 4FPAA 1D9DA 1X9JA 1VSIA 3VEVA 2QWOA 1XNQK 4ISGA 1VSEA 1LWCA 5KQDA 3RRGA 1Z6RA 3B6OA 1N8RO 4FWNA 2YHBA 3TU5A 3TAGA 4DQPA 5CYMA 2Q31A 1WOQA 4E7HA 3CCQN 4HUGA 5BPLA 3DLKA 2D0AA 1YIJN 2O4IA 3ZSYA 1I39A 4FJHA 2RHKA 3KD5E 1JCFA 1QHTA 3KIOA 3HM9A 3SQ1A 3KK1A 4DTXA 1RFQA 2CGKA 3K0SA 5ELZA 2A1RA 1IKYA 1Q7YO 2JGUA 5BRFA 3LANA 4JKBA 2Z1IA 4B1VA 2PAVA 4JI6K 1HRHA 3AVAA 3K9JA 5BREA 1RBUA 4NXMK 1L5UA 4XH4A 3QDKA 3HSTB 3TTDA 3OYAA 3BY5A 3QLHA 3OYIA 1DT9A 4Q0BA 3MEEA 1C1CA 1VSHA 3EKUA 4FJNA 3AV9A 4DU1A 1QVGM 1TAUA 4BRGA 4KKOA 3DJCA 3CC2N 2WFBA 1GLJO 4DQSA 1NMNA 3H3OB 2NUBA 2VWKA 3WXLA 4DTNA 3OBYA 1ZBLA 4KH5A 3K58A 3U8XA 2F4VK 2HNDA 3AO4A 4BC5A 4FLVA 3TABA 4WFNL 1J53A 1JLFA 3D45A 2Y1IA 3VTIA 3TWHA 1P90A 2JLEA 4CK1A 2XHBA 5FPMA 4DTOA 1KVAA 2P9PA 2F8SA 3VESA 1OKJA 1Q8IA 4DV0K 5C10A 3AVNA 4XH1A 1T44A 3D2FB 3QFPA 4BRCA 1W0HA 1IJJA 3ZT2A 4AHTA 3NF7A 3CCSN 4FLYA 4Y0WA 2E2PA 3UKRB 1NGFA 3WNGA 1TUYA 1QVFM 4H0VB 3CCUN 3WXJA 4FJ7A 1VQNN 1C0UA 3D2EB 3PUFA 4PKHA 1T3VA 2HBLA 1QSYA 1WSFA 1RT6A 1XHXA 4QOZB 5BPMA 3UE5A 3VQCA 2E2NA 4CJLA 5GAHP 1N6QA 4MO4A 3QNOA 2ZWHA 4H4OA 4E1MA 4CJ5A 2A5XA 3KD1E 2VYPA 3L2UA 2GBZA 4CF1A 5C2FA 4BRDA 3MCAB 4DLGA 1T8EA 4B9QA 3IG1A 1O13A 1LWFA 4DQIA 1EWQA 3ID8A 1QQNA 3ZT1A 3NE6A 3THYB 4BDZA 4IJNA 3ZETA 5DM7L 4DTRA 3QBXA 4E7LA 4WCEL 5C2DA 3VA3A 3L4IA 3TARA 1RT2A 2UXCK 4LF9K 4OVLA 5CE3A 4FJ9A 1RDCA 4KTWA 4FLUA 1K73O 4FVUA 2KLAA 4NXNK 5AQSA 3DLRA 2V51B 4CIGA 2Q2RA 1D9FA 3NMUA 1JKHA 2OZMA 1KRPA 4BVPA 3VPZA 1I94K 2P9NA 4A2BA 2HNYA 3O9QA 1WB9A 2P5GA 3VQQA 2NRTA 3B8AX 3VEXA 3LDNA 3C65A 3KLFA 1IG9A 4MLEA 1GLAG 4CD3A 4KRFA 4FW1A 3C94A 1K8AO 3DLEA 1UWBA 3CM5A 5AZJB 3PY8A 5C42A 1Y64A 2GUPA 4FLZA 4IO9L 3BUZB 3ZT0A 3M8SA 4JKGB 2NRVA 4O8UA 4DV7K 3K5OA 3V1OA 2YKNA 1HQEA 4FJJA 2ZM6K 3CFPA 2IDOA 3I0SA 1V4TA 1TK5A 3AVMA 3VGLA 3I0RA 4CF0A 4JKEA 1SL1A 3HI0A 3LM9A 1S9GA 5GIOA 3THXB 3WUHA 4NB4A 3CQXA 3HRGA 4FSVA 3VA0A 3E9LA 3CC4N 2UYTA 3DOLA 3SBGA 3UKUB 1HYSA 1HX1A 4DSJA 5BRDA 1NJIO 3F2KA 4CZFA 1V4SA 3VQ6A 1VAZA 3V9ZA 1FW6A 5AQPA 3D7EO 3ZEUB 3CJCA 3AARA 4Z4FA 3QEWA 4ELTA 1GLBG 1YI2N 3WQUA 4GV6A 3FZLA 5JMVA 5GAGP 4BWJA 2VG6A 3EL2A 3CIPA 5EX5A 1Z05A 4F8RA 2RF2A 3AA4A 1HNZK 5DMRA 3VQPA 4E1JA 4MLHA 2EWSA 2OPPA 4AQYK 3SQ2A 3V9WA 1VK0A 5KPTA 3CERA 1RDDA 1SUQA 4G9ZA 2RN2A 1NK5A 2PY5A 2YHAA 3ULEA 1JL2A 2OA8A 2O8EB 5HROA 4DQRA 3P38A 1BA0A 1YT3A 2YJFA 2OZSA 1WLJA 4ELVA 1XI1A 4J8FA 5A2QO 4KAZA 4W5OA 1N36K 1O1WA 4CGFA 5CZ2A 2W40A 3LDQA 4BRFA 2DFHA 1JLGA 2JWLA 1NG9A 2FSNA 3BF3A 4FM0A 4J2BA 4EHTA 1WSJA 4FWRA 3MWTA 4H0YB 1BOTO 1T6DA 4L3QA 2W42A 2UUBK 5HP1A 4W5TA 1S6PA 4O0JA 4MQ3A 3VQ9A 4B3TK 1W9HA 4CEZA 2Z1GA 4FO0A 4K25A 3OYCA 4M3YA 2F9WA 4BC4A 4BDPA 1KFSA 1D4XA 1XMQK 2NRWA 3QIPA 3CCEN 3LP0A 4FM2A 4R79A 3T3FA 4W5RA 1NOZA 4CEQA 1JLAA 3ISNC 3D0PA 3UB5A 3J80O 2YI1A 2A6AA 4JAXA 2X6NA 4CK3A 5HRPA 5CZ1A 1RT4A 1C6VA 2E6MA 4JYAK 1KAXA 4CI6A 1MA9B 4KPYA 2HHSA 4JKCA 1HYVA 1Y97A 4DFKA 4FL9A 4AHRA 2ZGZA 4U67L 1EKEA 4RW4A 4DFJA 2WC9A 1EP4A 1RTIA 1SKWA 4B9UA 4BC3A 2A3ZA 3MDQA 1XUPO 3CF5L 1U04A 1S22A 5AFUH 3EZ5A 4Z4IA 5JS2A 4B3OA 1ZBHA 1EQYA 4HUEA 4FK4A 5D3GA 3OYLA 3SAFA 3JXUA 3ENBA 1NNEA 1IV0A 1WAJA 4DTUA 1NK9A 1QQCA 4HTLA 5AQRA 1NKCA 4CIFA 4I6MB 2OPQA 3AAQA 1DLOA 1RDUA 3OS2A 4AH9A 1NK8A 4CFBA 4WFAL 4DWIA 3WEEA 1SKRA 1GLCG 1SAZA 3V9SA 4F2SA 1JXBA 1QSSA 1CZAN 4O55A 2UXBK 4CHZA 3OYBA 3K2PA 4O4GA 4RW8A 3OYNA 1Q9YA 1MWKA 2WOMA 5BR8K 1IBKK 3RSEB 1CZBA 3BEXA 5AZIA 2XY5A 1YUWA 1HQUA 4CZMA 3HPOA 1A5VA 4E3SA 2KHOA 5BRHA 3A0IX 4RW9A 3O4NA 3NH2A 3U3YA 3DLHA 3A5OC 3MN6A 3LP3A 4CHQA 1RDAA 2NRRA 4OGEA 3QETA 1EWRA 4YOUA 3A5NC 4HVJA 3T1YK 3A5MC 2I5JA 2OANA 4BR2A 1TVRA 4CJVA 1U2VB 3KVGA 4DQQA 4M3XA 3U4LA 2D0OA 4H4MA 2IC3A 5LJWA 3DXKB 2P9UA 4DR5K 2HF3A 2YHYA 3VQBA 5EXWA 2GWKA 1S5JA 3VN5A 3QERA 5E41A 3GOIA 3CG7A 3C7NB 1VSLA 3O5BA 2OPSA 2O8BA 1YHQN 1K6YA 1IKVA 4Y1DA 2O8DA 4DTJA 3O9UA 1L3VA 1Q82O 1YXQA 4IDHA 3D6RA 2E88A 1JLCA 1TYQB 1VQ4N 3R6MA 3QBWA 3HT3A 4FLTA 3I33A 4KTZA 4FZYA 2IOCA 3ZSVA 4Z4GA 3PX4A 4DMNA 4X66K 3CI5A 5CYQA 4M7XA 3OVNA 1OVQA 5FPDA 3KZBA 2E4LA 1LW0A 2QKKA 1NJYA 3ASMA 2Q1NA 3P39A 2HNZA 1Q9XA 1BI4B 2EX3A 3DXMA 1BU6O 5SZTA 1IO2A 4KBOA 3VENA 1HMVA 3KWGA 3MECA 3NGYA 1HYZA 4PA1A 4PUOA 2ATQA 3LL3A 3BGRA 3DM2A 4EZ6A 1P8ZA 2Q0UA 4B9NA 3K5MA 4O44A 1S9EA 5M1FA 3KKRA 3FR0A 1BIUA 4GVMA 1NLVA 3PX6A 4PWDA 3RMBA 4RCHA 3DAWA 4CEEA 3NGIA 3WNFA 1Q81O 4DHYA 4BREA 3JS6A 5I3UA 5C24A 3L2VA 5HRNA 5KPZA 3V6DA 3ZSOA 3SCXA 4BRAA 5AQQA 4YOYA 5T7BA 2ZJRL 1ZC6A 1JLBA 1TKZA 4FWOA 4KHYA 4CE9A 2HOEA 3O9RA 5M1OA 4FYDA 2IVNA 4ID5A 1VQKN 2DFEA 4BC2A 1VQ8N 4HWIA 3NVKA 1BL3A 4M3RA 3SV3A 1WNSA 3V1RA 3HK2A 1C0TA 1QQMA 3PO5A 1GLDG 1JLEA 3VGMA 2IAJA 4LSNA 3QNNA 3NDKA 3G10A 1W7AA 1NK6A 1X3MA 1NGIA 1EXQA 3IMXA 3I8DA 2VWJA 3QEPA 3VOVA 4FWKA 1IKWA 2ETJA 3RMAA 3CJ9A 3L4QA 3OW2M 4UQGA 4DR7K 1FJGK 2PBDA 2P5OA 2HHUA 5EY4A 1YF5L 3DRPA 1TKXA 4N5SA 3ZSWA 2KTQA 1C0FA 4JHDB 4CJSA 5FROA 3O3FA 2E6LA 1D8YA 5GAEP 1VSKA 4NYFA 3SAHA 3VMFB 2GWJA 3O3HA 2WBNA 1MU2A 3ZYYX 1HNWK 4K0KK 3K5NA 1RBVA 4DSIA 3H45C 3AVLA 4ILJA
chains in the Genus database with same CATH topology
2ZD1A 2D5RA 4BE0A 3U3GA 3KLGA 4FCYA 4AILC 1UA0A 4KRFA 4FW1A 4CGIA 2YNGA 3C94A 4B9LA 1TGOA 3CQ8A 4YNQA 3DLGA 1YTAA 3DLEA 1WN7A 1LWEA 1UWBA 3CM5A 4PY5A 3PY8A 1WSGA 5C42A 5KGWA 1UAXA 4IKFA 1RTHA 4OGCA 4N76A 1RNHA 4FLZA 2AJQA 4IG0A 4M3UA 3ZT0A 3ZT3A 3M8SA 4F2RA 4N41A 3OYDA 3K5OA 3V1OA 3NF9A 4WE1A 1BQMA 2YKNA 1LW2A 3DI6A 3KK2A 1LAWA 1UA1A 4FLXA 5KRTA 3SPYA 4B9SA 1TKDA 5KI6A 1CXUA 4QAGA 1HQEA 2FBVA 4DTSA 4FJJA 3CFPA 2IDOA 4KHNA 4CFAA 3I0SA 4KI6A 4FZZA 1TK5A 1TK0A 2OYQA 3AVMA 3I0RA 3P83D 4CF0A 1Z26A 1J5OA 1KTQA 1SL1A 1S9GA 2Z1HA 3RMDA 1L3TA 3L2QA 3OJUA 3SQ0A 2PYJA 1S1WA 4FJXA 3VA0A 1GOBA 4ICLA 2GUIA 4C8KA 3DOLA 1HYSA 3ZT4A 4OPKA 4BE2A 3SPZA 4CGGA 3SZ2A 4DSJA 3MAQA 4E1NA 1A5WA 3KLHA 2O4GA 3VQ6A 1RTJA 3LPTA 4CJRA 3V9ZA 2QKBA 2YNIA 3CM6A 4ELUA 3OYEA 3VQ7A 1RBRA 4AHCA 4FJIA 4W5QA 1HPZA 4CGHA 4JS4A 4CCHA 1ZBIA 5J1EA 1RDBA 4Z4FA 4BDYA 3QEWA 4ELTA 4AHUA 1FKPA 4J2DA 4I2PA 4CF9A 2G8FA 2F96A 5JS1A 2GV9A 3LALA 4OJRA 2BE2A 4OLBA 1QTMA 4HHTA 4BWJA 3NCIA 2VG6A 3V9UA 1ZBUA 1G15A 1U48A 3S3NA 4RG8A 3E01A 3PV8A 3HP9A 4CJWA 1U47A 1GOAA 4KTQA 1TKTA 4C8LA 3RWUA 4CESA 3LWLA 4F8RA 3AO3A 3P1GA 1SL2A 4CEDA 2RF2A 3AA4A 1VSFA 4IBNA 3VQEA 3S9HA 5DMRA 4Z4EA 1NJZA 3VQPA 2EHGA 3T1AA 4E89A 4HTUA 1RCHA 1S6QA 2OPPA 4KO0A 3WNEA 3SQ2A 1UOCA 1VK0A 3V9WA 3M8PA 3SJJA 1BCMA 3HO1A 1RDDA 1SUQA 2KFZA 1X1PA 3DMJA 2G8WA 2RN2A 3QEIA 1CLQA 4FW2A 3SUOA 4CECA 1NK5A 2YHAA 1N5YA 2PY5A 1CXQA 1JL2A 2OA8A 5HROA 3PX0A 1QS4A 4DQRA 1ASWA 3BDPA 3SUNA 1YT3A 1VSMA 4DFMA 2DTUA 1T05A 1J54A 3SQ4A 2OZSA 4FJMA 2HW3A 3MXMA 1WLJA 1QSLA 1XI1A 4ELVA 1T7PA 4G1QA 2X74A 4LY7A 4J2EA 3RRHA 4KAZA 2A1SA 4W5OA 4Q5VA 4NCGA 4CEBA 4R5PA 1LAVA 3DRRA 4CFCA 1O1WA 4CGFA 3NH0A 3SUPA 5CZ2A 3LAMA 4CJEA 1S1XA 3AO2A 3ALYA 3PO4A 2DFHA 4N47A 4RW7A 3THVA 1QE1A 1JLGA 2HVIA 1NK0A 1TK8A 4DTPA 2X6SA 3AVBA 4FM0A 2QK9A 4J2BA 4Z4CA 1WSJA 3HPHA 2G8VA 5K14A 3G0ZA 4CHYA 5KGXA 5J2QA 4NCAA 2D0BA 2W42A 4LH4A 3AVIA 5HP1A 3HP6A 4B9VA 4K8ZA 4W5TA 2HB5A 3IAYA 1S6PA 4O0JA 5HBMA 4KB0A 4MQ3A 3VQ9A 3QO9A 1W9HA 4IG3A 2Z1GA 4CEZA 1ZBFA 3QESA 1EX4A 3OYCA 3JYTA 4CJPA 4M3YA 4QCLA 4CHPA 3TR8A 4BDPA 1REVA 1KFSA 4HCCA 3QIPA 4DFPA 3AVKA 4B08A 3LP0A 1RILA 4C8OA 3F73A 4OKEA 4B9MA 3ZSZA 1FKOA 2ZE2A 1F21A 3OS0A 4FM2A 3O3GA 3T3FA 4Z0UA 4W5RA 4KREA 1NOZA 3NF6A 1JLAA 4CEQA 3OYHA 3DLBA 3ISNC 3ITHA 3D0PA 4DS4A 4CJKA 5I42A 3NBPA 3NF8A 4Z4HA 2KZZA 3FFIA 4CEAA 3L8BA 3L3VA 1SV5A 3AVCA 2X6NA 4EP5A 4CK3A 5HRPA 5CZ1A 3KTQA 1RT4A 1C6VA 3NAEA 1KSPA 4M45A 3ZCMA 1A5XA 2E6MA 2YNFA 3HVRA 4KPYA 3C6TA 5C25A 4O0IA 2HHSA 1HYVA 3B6PA 1Y97A 1WSIA 5FRMA 4DFKA 1RT1A 3KLIA 4M3WA 4AHRA 1EKEA 3AVJA 4JRPA 5DK5A 4EP4A 4KB1A 4CJ4A 4RW4A 3SI6A 1R0AA 2KW4A 2XY8A 3QINA 3V1QA 1EP4A 1RTIA 4DFJA 1XC9A 1YTUA 1SKWA 3AA2A 4B9UA 3TANA 1IKXA 1I3AA 4CF8A 4OPJA 4KI4A 2P51A 4KHSA 1U04A 4I2QA 4DSFA 3EZ5A 4Z4IA 4C8NA 1T03A 5JS2A 3ZSQA 4FJKA 1ZBHA 1ITGA 3SYZA 4B3OA 1B9FA 4LH5A 4HUEA 4FK4A 3OYLA 3A2FA 5D3GA 2IS3A 1C1BA 1RT7A 1HJRA 1X9MA 4CERA 5EU7A 1BIZA 4DF4A 1DTTA 1NK7A 4DU4A 1WAJA 1DTQA 3VQAA 1WAFA 2YNHA 3RMCA 1U49A 4DTUA 4FJ5A 5J2PA 4J2AA 1NK9A 1KCFA 1QQCA 1FK9A 1NKCA 2HHVA 4CIFA 2OPQA 3QIOA 1DLOA 2BANA 4FJLA 1Z25A 5FDLA 4BE1A 3V81A 4E19A 3OS2A 2B6AA 4AH9A 4AHSA 1NK8A 4CFBA 4MFBA 1RBSA 4DWIA 4E7KA 1VRUA 4KV8A 1VSJA 1SKRA 3M8QA 3NGZA 2VG7A 4W5NA 3V9SA 5KRSA 4F2SA 1JXBA 1QSSA 3RR7A 4O55A 3HVTA 1TL1A 4CHZA 1U4BA 3OJSA 1BISA 4K8XA 4CK2A 3OYBA 4IFVA 4AHVA 1EETA 2HHWA 1D9FA 3K2PA 4O4GA 4CEFA 4RW8A 3OYNA 3HL8A 4BACA 3SV4A 1Q9YA 2WOMA 3TAPA 4FK2A 2QXFA 3AVFA 3WNHA 1C0MA 2KFNA 3ZSXA 4FZXC 1LV5A 1GOCA 1BHLA 1D9DA 1CZBA 2XY5A 3IS9A 1VSIA 4BWMA 3ZSRA 4FM1A 1HQUA 3AO5A 1NKEA 3KK3A 1SL0A 4KFBA 3HPOA 1A5VA 1VSEA 2G8HA 2Y1JA 4M3TA 2G8UA 4E3SA 1LWCA 3RRGA 4ID1A 3RTVA 1YVUA 4OKJA 2IGIA 4FK0A 4F3TA 3B6OA 4RW9A 3NHGA 1U45A 3O4NA 3NH2A 4FXDA 4CJUA 2YHBA 4JLHA 2XY6A 1RBTA 3U3YA 3TAGA 3TAEA 3OYJA 4DQPA 1TV6A 4CJFA 3DLHA 5CYMA 4DF8A 1BGXT 3LWMA 4E7HA 3LP3A 4CHQA 1RDAA 3OYGA 2HHTA 4OGEA 1HNVA 4HUGA 4DU3A 3QETA 2Q3SA 4JS5A 3DLKA 4Y1CA 2D0AA 3KLEA 4HVJA 4F4KA 2O4IA 3DRSA 2I5JA 4M3ZA 4B9TA 3ZSYA 1TVRA 1I39A 4CJVA 3M8RA 4DQQA 1VRTA 3HXMA 3MXIA 1NJXA 4FJHA 3KD5E 3TAMA 4M3XA 1QHTA 3TI0A 3LP2A 2PZSA 3KIOA 4H4MA 1BCOA 2IC3A 3HM9A 2G8IA 3SQ1A 3K59A 4KHWA 3KK1A 4DTXA 1RT5A 5HRSA 2YV0X 3LZIA 2A1RA 1IKYA 4NYNA 2JGUA 3CYMA 3NH1A 3LANA 1NK4A 2Z1IA 1S1TA 2RKIA 5J2NA 3HYFA 4L8RB 1HRHA 4IFYA 3VQBA 3AVAA 4FJGA 1S5JA 1JXEA 3VN5A 3C95A 3VQ4A 1IH7A 4DSEA 3QERA 3S3MA 5E41A 1RBUA 3LP1A 4YFUA 3CG7A 1VSLA 2Z1JA 4I9LA 1C1AA 2OPSA 1CZ9A 4TSXA 4I9QA 3P5JA 1K6YA 1L5UA 1IKVA 4Y1DA 4N56A 4E7IA 3HSTB 4GW6A 3F9KA 3CFRA 4DTJA 3QEVA 3S3OA 3OYAA 1L3VA 3QLHA 3OYIA 4Q0BA 4E7JA 1JLCA 3MEEA 1C1CA 1VSHA 3TAFA 2BDPA 2HMIA 4FJNA 4E0DA 3AV9A 3HT3A 4LSLA 4DU1A 5HLFA 4FLTA 1L3SA 1TAUA 4OKKA 1JLQA 4PQUA 4KKOA 4KTZA 4CFDA 4DQSA 4FZYA 3MEDA 2IOCA 2NUBA 2VWKA 2PYLA 4FJ8A 3ZSVA 3EYZA 4DTNA 4DMNA 3PX4A 4Z4GA 2HHXA 2XO7A 1ZBLA 4DSLA 3K58A 4KHQA 5CYQA 5FRNA 3L2RA 3V4IA 2HNDA 3OVNA 4CGDA 3AO4A 2E4LA 1LW0A 1KVCA 4DLEA 4FLVA 2D0CA 4CF2A 3TABA 2QKKA 1NJYA 3ASMA 3OY9A 1J53A 1JLFA 3ULDA 2HNZA 3HJFA 3D45A 1ASVA 2Y1IA 3VQ5A 1BI4B 2EX3A 4IDKA 3TWHA 1Q9XA 4KHUA 2JLEA 5SZTA 2P1JA 1IO2A 1HMVA 2DFFA 4CK1A 3MECA 3NGYA 1HYZA 2XHBA 4I7FA 4H8KA 3LPUA 3SNNA 4DTOA 4PA1A 1XHZA 1NKBA 4PUOA 4M42A 1KVAA 2ATQA 3L3UA 3OYMA 3BGRA 3MXJA 2F8SA 2KZMA 3DM2A 4EZ6A 4F3OA 3SUQA 4B9NA 1Q8IA 4EZ9A 1RT3A 2WONA 3AVNA 3IRXA 4O44A 1S9EA 3K5MA 3KKRA 3HPGA 4B8CA 3AVGA 1BIUA 4GVMA 3K57A 2R7YA 1FXXA 3PX6A 4PWDA 1W0HA 3RMBA 1B9DA 3ZT2A 3CFOA 3NF7A 4AHTA 4FLWA 4FLYA 4DTMA 1WSEA 4CEEA 1VSDA 3NGIA 3DYAA 3AA5X 3AO1A 3WNFA 5KTQA 3WNGA 2DY4A 2BGGA 5I3UA 3MEGA 3UIQA 4FJ7A 1C0UA 3O4QA 5C24A 3LZJA 1B92A 3KKSA 3PUFA 3H08A 1KVBA 3L2VA 2ZQBA 1NJWA 5HRNA 4OLAA 4CHOA 1QSYA 1WSFA 1X9WA 3V6DA 1RT6A 2HVHA 3ZSOA 3SCXA 1XHXA 2HHQA 4QOZB 3VQCA 1J9AA 2F8TA 1ASUA 1TL3A 5T7BA 1JLBA 1TKZA 5J2MA 2G8KA 4CJLA 4CE9A 2FBXA 1N6QA 4DSKA 4KHYA 2B4JA 4FYDA 4DS5A 4ID5A 3QNOA 2ITGA 4ZHRA 4H4OA 2DFEA 3OYFA 4E1MA 2KQ2A 3LAKA 4CJ5A 3KD1E 1NOYA 3L2UA 4CJTA 4CHNA 4O5BA 2FBTA 4FVMA 2RPIA 2GBZA 4B8AB 3KJVA 4CF1A 1BL3A 4M3RA 3SV3A 1WNSA 3V1RA 2X78A 4CEOA 3U6FA 3HK2A 1KLNA 1C0TA 5HRRA 3PO5A 4DLGA 3DOKA 1JLEA 1T8EA 1SKSA 2YKMA 3IG1A 2IAJA 1LWFA 4DQIA 3ZT1A 4JRQA 3NE6A 4LSNA 3QNNA 4BDZA 1HNIA 3G10A 5SWMA 4XIUA 3NDKA 4DTRA 1NK6A 1KLMA 3AVHA 1EXQA 2B5JA 4E7LA 3I8DA 2VWJA 3OYKA 3QEPA 1RTDA 3VA3A 1S1VA 1IKWA 4CJQA 3EY1A 1BQNA 2ETJA 3RMAA 1RT2A 4M41A 3TARA 1D5AA 5CY4A 1L3UA 4LD0A 3VQDA 1JL1A 1TAQA 4CJ3A 4OVLA 1BI4A 4UQGA 3LDSA 4FJ9A 2LSNA 2FBYA 3TAQA 2P5OA 1S1UA 4RW6A 2HHUA 3OS1A 1RDCA 3DRPA 1TKXA 4KTWA 4N5SA 4FLUA 3ZSWA 1X9SA 2FC0A 2KTQA 3C6UA 4C8MA 3DLRA 3AA3A 3NFAA 4CJSA 5FROA 3T19A 2E6LA 3VQ8A 4CIGA 1KFDA 4DG1A 3O3FA 3V9XA 1VSKA 4NYFA 4CIEA 1D8YA 1JKHA 3RR8A 2OZMA 1KRPA 2XRIA 3O3HA 2VG5A 2XY7A 1MU2A 1ZYQA 1XWLA 3K5NA 2HNYA 3K5LA 1WSHA 3QEXA 4HUFA 2P5GA 3VQQA 1RBVA 4CGJA 4ZTJA 4DSIA 4HCBA 3JSMA 4ZTFA 4GMJB 3KLFA 4NCBA 1IG9A 3AVLA 3L2WA 2OPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZD1 A;  2D5R A;  4BE0 A;  3U3G A;  3KLG A;  4FCY A;  4AIL C;  1UA0 A;  4KRF A;  4FW1 A;  4CGI A;  2YNG A;  3C94 A;  4B9L A;  1TGO A;  3CQ8 A;  4YNQ A;  3DLG A;  1YTA A;  3DLE A;  1WN7 A;  1LWE A;  1UWB A;  3CM5 A;  4PY5 A;  3PY8 A;  1WSG A;  5C42 A;  5KGW A;  1UAX A;  4IKF A;  1RTH A;  4OGC A;  4N76 A;  1RNH A;  4FLZ A;  2AJQ A;  4IG0 A;  4M3U A;  3ZT0 A;  3ZT3 A;  3M8S A;  4F2R A;  4N41 A;  3OYD A;  3K5O A;  3V1O A;  3NF9 A;  4WE1 A;  1BQM A;  2YKN A;  1LW2 A;  3DI6 A;  3KK2 A;  1LAW A;  1UA1 A;  4FLX A;  5KRT A;  3SPY A;  4B9S A;  1TKD A;  5KI6 A;  1CXU A;  4QAG A;  1HQE A;  2FBV A;  4DTS A;  4FJJ A;  3CFP A;  2IDO A;  4KHN A;  4CFA A;  3I0S A;  4KI6 A;  4FZZ A;  1TK5 A;  1TK0 A;  2OYQ A;  3AVM A;  3I0R A;  3P83 D;  4CF0 A;  1Z26 A;  1J5O A;  1KTQ A;  1SL1 A;  1S9G A;  2Z1H A;  3RMD A;  1L3T A;  3L2Q A;  3OJU A;  3SQ0 A;  2PYJ A;  1S1W A;  4FJX A;  3VA0 A;  1GOB A;  4ICL A;  2GUI A;  4C8K A;  3DOL A;  1HYS A;  3ZT4 A;  4OPK A;  4BE2 A;  3SPZ A;  4CGG A;  3SZ2 A;  4DSJ A;  3MAQ A;  4E1N A;  1A5W A;  3KLH A;  2O4G A;  3VQ6 A;  1RTJ A;  3LPT A;  4CJR A;  3V9Z A;  2QKB A;  2YNI A;  3CM6 A;  4ELU A;  3OYE A;  3VQ7 A;  1RBR A;  4AHC A;  4FJI A;  4W5Q A;  1HPZ A;  4CGH A;  4JS4 A;  4CCH A;  1ZBI A;  5J1E A;  1RDB A;  4Z4F A;  4BDY A;  3QEW A;  4ELT A;  4AHU A;  1FKP A;  4J2D A;  4I2P A;  4CF9 A;  2G8F A;  2F96 A;  5JS1 A;  2GV9 A;  3LAL A;  4OJR A;  2BE2 A;  4OLB A;  1QTM A;  4HHT A;  4BWJ A;  3NCI A;  2VG6 A;  3V9U A;  1ZBU A;  1G15 A;  1U48 A;  3S3N A;  4RG8 A;  3E01 A;  3PV8 A;  3HP9 A;  4CJW A;  1U47 A;  1GOA A;  4KTQ A;  1TKT A;  4C8L A;  3RWU A;  4CES A;  3LWL A;  4F8R A;  3AO3 A;  3P1G A;  1SL2 A;  4CED A;  2RF2 A;  3AA4 A;  1VSF A;  4IBN A;  3VQE A;  3S9H A;  5DMR A;  4Z4E A;  1NJZ A;  3VQP A;  2EHG A;  3T1A A;  4E89 A;  4HTU A;  1RCH A;  1S6Q A;  2OPP A;  4KO0 A;  3WNE A;  3SQ2 A;  1UOC A;  1VK0 A;  3V9W A;  3M8P A;  3SJJ A;  1BCM A;  3HO1 A;  1RDD A;  1SUQ A;  2KFZ A;  1X1P A;  3DMJ A;  2G8W A;  2RN2 A;  3QEI A;  1CLQ A;  4FW2 A;  3SUO A;  4CEC A;  1NK5 A;  2YHA A;  1N5Y A;  2PY5 A;  1CXQ A;  1JL2 A;  2OA8 A;  5HRO A;  3PX0 A;  1QS4 A;  4DQR A;  1ASW A;  3BDP A;  3SUN A;  1YT3 A;  1VSM A;  4DFM A;  2DTU A;  1T05 A;  1J54 A;  3SQ4 A;  2OZS A;  4FJM A;  2HW3 A;  3MXM A;  1WLJ A;  1QSL A;  1XI1 A;  4ELV A;  1T7P A;  4G1Q A;  2X74 A;  4LY7 A;  4J2E A;  3RRH A;  4KAZ A;  2A1S A;  4W5O A;  4Q5V A;  4NCG A;  4CEB A;  4R5P A;  1LAV A;  3DRR A;  4CFC A;  1O1W A;  4CGF A;  3NH0 A;  3SUP A;  5CZ2 A;  3LAM A;  4CJE A;  1S1X A;  3AO2 A;  3ALY A;  3PO4 A;  2DFH A;  4N47 A;  4RW7 A;  3THV A;  1QE1 A;  1JLG A;  2HVI A;  1NK0 A;  1TK8 A;  4DTP A;  2X6S A;  3AVB A;  4FM0 A;  2QK9 A;  4J2B A;  4Z4C A;  1WSJ A;  3HPH A;  2G8V A;  5K14 A;  3G0Z A;  4CHY A;  5KGX A;  5J2Q A;  4NCA A;  2D0B A;  2W42 A;  4LH4 A;  3AVI A;  5HP1 A;  3HP6 A;  4B9V A;  4K8Z A;  4W5T A;  2HB5 A;  3IAY A;  1S6P A;  4O0J A;  5HBM A;  4KB0 A;  4MQ3 A;  3VQ9 A;  3QO9 A;  1W9H A;  4IG3 A;  2Z1G A;  4CEZ A;  1ZBF A;  3QES A;  1EX4 A;  3OYC A;  3JYT A;  4CJP A;  4M3Y A;  4QCL A;  4CHP A;  3TR8 A;  4BDP A;  1REV A;  1KFS A;  4HCC A;  3QIP A;  4DFP A;  3AVK A;  4B08 A;  3LP0 A;  1RIL A;  4C8O A;  3F73 A;  4OKE A;  4B9M A;  3ZSZ A;  1FKO A;  2ZE2 A;  1F21 A;  3OS0 A;  4FM2 A;  3O3G A;  3T3F A;  4Z0U A;  4W5R A;  4KRE A;  1NOZ A;  3NF6 A;  1JLA A;  4CEQ A;  3OYH A;  3DLB A;  3ISN C;  3ITH A;  3D0P A;  4DS4 A;  4CJK A;  5I42 A;  3NBP A;  3NF8 A;  4Z4H A;  2KZZ A;  3FFI A;  4CEA A;  3L8B A;  3L3V A;  1SV5 A;  3AVC A;  2X6N A;  4EP5 A;  4CK3 A;  5HRP A;  5CZ1 A;  3KTQ A;  1RT4 A;  1C6V A;  3NAE A;  1KSP A;  4M45 A;  3ZCM A;  1A5X A;  2E6M A;  2YNF A;  3HVR A;  4KPY A;  3C6T A;  5C25 A;  4O0I A;  2HHS A;  1HYV A;  3B6P A;  1Y97 A;  1WSI A;  5FRM A;  4DFK A;  1RT1 A;  3KLI A;  4M3W A;  4AHR A;  1EKE A;  3AVJ A;  4JRP A;  5DK5 A;  4EP4 A;  4KB1 A;  4CJ4 A;  4RW4 A;  3SI6 A;  1R0A A;  2KW4 A;  2XY8 A;  3QIN A;  3V1Q A;  1EP4 A;  1RTI A;  4DFJ A;  1XC9 A;  1YTU A;  1SKW A;  3AA2 A;  4B9U A;  3TAN A;  1IKX A;  1I3A A;  4CF8 A;  4OPJ A;  4KI4 A;  2P51 A;  4KHS A;  1U04 A;  4I2Q A;  4DSF A;  3EZ5 A;  4Z4I A;  4C8N A;  1T03 A;  5JS2 A;  3ZSQ A;  4FJK A;  1ZBH A;  1ITG A;  3SYZ A;  4B3O A;  1B9F A;  4LH5 A;  4HUE A;  4FK4 A;  3OYL A;  3A2F A;  5D3G A;  2IS3 A;  1C1B A;  1RT7 A;  1HJR A;  1X9M A;  4CER A;  5EU7 A;  1BIZ A;  4DF4 A;  1DTT A;  1NK7 A;  4DU4 A;  1WAJ A;  1DTQ A;  3VQA A;  1WAF A;  2YNH A;  3RMC A;  1U49 A;  4DTU A;  4FJ5 A;  5J2P A;  4J2A A;  1NK9 A;  1KCF A;  1QQC A;  1FK9 A;  1NKC A;  2HHV A;  4CIF A;  2OPQ A;  3QIO A;  1DLO A;  2BAN A;  4FJL A;  1Z25 A;  5FDL A;  4BE1 A;  3V81 A;  4E19 A;  3OS2 A;  2B6A A;  4AH9 A;  4AHS A;  1NK8 A;  4CFB A;  4MFB A;  1RBS A;  4DWI A;  4E7K A;  1VRU A;  4KV8 A;  1VSJ A;  1SKR A;  3M8Q A;  3NGZ A;  2VG7 A;  4W5N A;  3V9S A;  5KRS A;  4F2S A;  1JXB A;  1QSS A;  3RR7 A;  4O55 A;  3HVT A;  1TL1 A;  4CHZ A;  1U4B A;  3OJS A;  1BIS A;  4K8X A;  4CK2 A;  3OYB A;  4IFV A;  4AHV A;  1EET A;  2HHW A;  1D9F A;  3K2P A;  4O4G A;  4CEF A;  4RW8 A;  3OYN A;  3HL8 A;  4BAC A;  3SV4 A;  1Q9Y A;  2WOM A;  3TAP A;  4FK2 A;  2QXF A;  3AVF A;  3WNH A;  1C0M A;  2KFN A;  3ZSX A;  4FZX C;  1LV5 A;  1GOC A;  1BHL A;  1D9D A;  1CZB A;  2XY5 A;  3IS9 A;  1VSI A;  4BWM A;  3ZSR A;  4FM1 A;  1HQU A;  3AO5 A;  1NKE A;  3KK3 A;  1SL0 A;  4KFB A;  3HPO A;  1A5V A;  1VSE A;  2G8H A;  2Y1J A;  4M3T A;  2G8U A;  4E3S A;  1LWC A;  3RRG A;  4ID1 A;  3RTV A;  1YVU A;  4OKJ A;  2IGI A;  4FK0 A;  4F3T A;  3B6O A;  4RW9 A;  3NHG A;  1U45 A;  3O4N A;  3NH2 A;  4FXD A;  4CJU A;  2YHB A;  4JLH A;  2XY6 A;  1RBT A;  3U3Y A;  3TAG A;  3TAE A;  3OYJ A;  4DQP A;  1TV6 A;  4CJF A;  3DLH A;  5CYM A;  4DF8 A;  1BGX T;  3LWM A;  4E7H A;  3LP3 A;  4CHQ A;  1RDA A;  3OYG A;  2HHT A;  4OGE A;  1HNV A;  4HUG A;  4DU3 A;  3QET A;  2Q3S A;  4JS5 A;  3DLK A;  4Y1C A;  2D0A A;  3KLE A;  4HVJ A;  4F4K A;  2O4I A;  3DRS A;  2I5J A;  4M3Z A;  4B9T A;  3ZSY A;  1TVR A;  1I39 A;  4CJV A;  3M8R A;  4DQQ A;  1VRT A;  3HXM A;  3MXI A;  1NJX A;  4FJH A;  3KD5 E;  3TAM A;  4M3X A;  1QHT A;  3TI0 A;  3LP2 A;  2PZS A;  3KIO A;  4H4M A;  1BCO A;  2IC3 A;  3HM9 A;  2G8I A;  3SQ1 A;  3K59 A;  4KHW A;  3KK1 A;  4DTX A;  1RT5 A;  5HRS A;  2YV0 X;  3LZI A;  2A1R A;  1IKY A;  4NYN A;  2JGU A;  3CYM A;  3NH1 A;  3LAN A;  1NK4 A;  2Z1I A;  1S1T A;  2RKI A;  5J2N A;  3HYF A;  4L8R B;  1HRH A;  4IFY A;  3VQB A;  3AVA A;  4FJG A;  1S5J A;  1JXE A;  3VN5 A;  3C95 A;  3VQ4 A;  1IH7 A;  4DSE A;  3QER A;  3S3M A;  5E41 A;  1RBU A;  3LP1 A;  4YFU A;  3CG7 A;  1VSL A;  2Z1J A;  4I9L A;  1C1A A;  2OPS A;  1CZ9 A;  4TSX A;  4I9Q A;  3P5J A;  1K6Y A;  1L5U A;  1IKV A;  4Y1D A;  4N56 A;  4E7I A;  3HST B;  4GW6 A;  3F9K A;  3CFR A;  4DTJ A;  3QEV A;  3S3O A;  3OYA A;  1L3V A;  3QLH A;  3OYI A;  4Q0B A;  4E7J A;  1JLC A;  3MEE A;  1C1C A;  1VSH A;  3TAF A;  2BDP A;  2HMI A;  4FJN A;  4E0D A;  3AV9 A;  3HT3 A;  4LSL A;  4DU1 A;  5HLF A;  4FLT A;  1L3S A;  1TAU A;  4OKK A;  1JLQ A;  4PQU A;  4KKO A;  4KTZ A;  4CFD A;  4DQS A;  4FZY A;  3MED A;  2IOC A;  2NUB A;  2VWK A;  2PYL A;  4FJ8 A;  3ZSV A;  3EYZ A;  4DTN A;  4DMN A;  3PX4 A;  4Z4G A;  2HHX A;  2XO7 A;  1ZBL A;  4DSL A;  3K58 A;  4KHQ A;  5CYQ A;  5FRN A;  3L2R A;  3V4I A;  2HND A;  3OVN A;  4CGD A;  3AO4 A;  2E4L A;  1LW0 A;  1KVC A;  4DLE A;  4FLV A;  2D0C A;  4CF2 A;  3TAB A;  2QKK A;  1NJY A;  3ASM A;  3OY9 A;  1J53 A;  1JLF A;  3ULD A;  2HNZ A;  3HJF A;  3D45 A;  1ASV A;  2Y1I A;  3VQ5 A;  1BI4 B;  2EX3 A;  4IDK A;  3TWH A;  1Q9X A;  4KHU A;  2JLE A;  5SZT A;  2P1J A;  1IO2 A;  1HMV A;  2DFF A;  4CK1 A;  3MEC A;  3NGY A;  1HYZ A;  2XHB A;  4I7F A;  4H8K A;  3LPU A;  3SNN A;  4DTO A;  4PA1 A;  1XHZ A;  1NKB A;  4PUO A;  4M42 A;  1KVA A;  2ATQ A;  3L3U A;  3OYM A;  3BGR A;  3MXJ A;  2F8S A;  2KZM A;  3DM2 A;  4EZ6 A;  4F3O A;  3SUQ A;  4B9N A;  1Q8I A;  4EZ9 A;  1RT3 A;  2WON A;  3AVN A;  3IRX A;  4O44 A;  1S9E A;  3K5M A;  3KKR A;  3HPG A;  4B8C A;  3AVG A;  1BIU A;  4GVM A;  3K57 A;  2R7Y A;  1FXX A;  3PX6 A;  4PWD A;  1W0H A;  3RMB A;  1B9D A;  3ZT2 A;  3CFO A;  3NF7 A;  4AHT A;  4FLW A;  4FLY A;  4DTM A;  1WSE A;  4CEE A;  1VSD A;  3NGI A;  3DYA A;  3AA5 X;  3AO1 A;  3WNF A;  5KTQ A;  3WNG A;  2DY4 A;  2BGG A;  5I3U A;  3MEG A;  3UIQ A;  4FJ7 A;  1C0U A;  3O4Q A;  5C24 A;  3LZJ A;  1B92 A;  3KKS A;  3PUF A;  3H08 A;  1KVB A;  3L2V A;  2ZQB A;  1NJW A;  5HRN A;  4OLA A;  4CHO A;  1QSY A;  1WSF A;  1X9W A;  3V6D A;  1RT6 A;  2HVH A;  3ZSO A;  3SCX A;  1XHX A;  2HHQ A;  4QOZ B;  3VQC A;  1J9A A;  2F8T A;  1ASU A;  1TL3 A;  5T7B A;  1JLB A;  1TKZ A;  5J2M A;  2G8K A;  4CJL A;  4CE9 A;  2FBX A;  1N6Q A;  4DSK A;  4KHY A;  2B4J A;  4FYD A;  4DS5 A;  4ID5 A;  3QNO A;  2ITG A;  4ZHR A;  4H4O A;  2DFE A;  3OYF A;  4E1M A;  2KQ2 A;  3LAK A;  4CJ5 A;  3KD1 E;  1NOY A;  3L2U A;  4CJT A;  4CHN A;  4O5B A;  2FBT A;  4FVM A;  2RPI A;  2GBZ A;  4B8A B;  3KJV A;  4CF1 A;  1BL3 A;  4M3R A;  3SV3 A;  1WNS A;  3V1R A;  2X78 A;  4CEO A;  3U6F A;  3HK2 A;  1KLN A;  1C0T A;  5HRR A;  3PO5 A;  4DLG A;  3DOK A;  1JLE A;  1T8E A;  1SKS A;  2YKM A;  3IG1 A;  2IAJ A;  1LWF A;  4DQI A;  3ZT1 A;  4JRQ A;  3NE6 A;  4LSN A;  3QNN A;  4BDZ A;  1HNI A;  3G10 A;  5SWM A;  4XIU A;  3NDK A;  4DTR A;  1NK6 A;  1KLM A;  3AVH A;  1EXQ A;  2B5J A;  4E7L A;  3I8D A;  2VWJ A;  3OYK A;  3QEP A;  1RTD A;  3VA3 A;  1S1V A;  1IKW A;  4CJQ A;  3EY1 A;  1BQN A;  2ETJ A;  3RMA A;  1RT2 A;  4M41 A;  3TAR A;  1D5A A;  5CY4 A;  1L3U A;  4LD0 A;  3VQD A;  1JL1 A;  1TAQ A;  4CJ3 A;  4OVL A;  1BI4 A;  4UQG A;  3LDS A;  4FJ9 A;  2LSN A;  2FBY A;  3TAQ A;  2P5O A;  1S1U A;  4RW6 A;  2HHU A;  3OS1 A;  1RDC A;  3DRP A;  1TKX A;  4KTW A;  4N5S A;  4FLU A;  3ZSW A;  1X9S A;  2FC0 A;  2KTQ A;  3C6U A;  4C8M A;  3DLR A;  3AA3 A;  3NFA A;  4CJS A;  5FRO A;  3T19 A;  2E6L A;  3VQ8 A;  4CIG A;  1KFD A;  4DG1 A;  3O3F A;  3V9X A;  1VSK A;  4NYF A;  4CIE A;  1D8Y A;  1JKH A;  3RR8 A;  2OZM A;  1KRP A;  2XRI A;  3O3H A;  2VG5 A;  2XY7 A;  1MU2 A;  1ZYQ A;  1XWL A;  3K5N A;  2HNY A;  3K5L A;  1WSH A;  3QEX A;  4HUF A;  2P5G A;  3VQQ A;  1RBV A;  4CGJ A;  4ZTJ A;  4DSI A;  4HCB A;  3JSM A;  4ZTF A;  4GMJ B;  3KLF A;  4NCB A;  1IG9 A;  3AVL A;  3L2W A;  2OPR A; 
#chains in the Genus database with same CATH topology
 4BE0 A;  3U3G A;  3KLG A;  2WTU A;  2P9L B;  1TGO A;  3CQ8 A;  4YNQ A;  1ILY A;  3OBW A;  3VET A;  4BRK A;  3G6E N;  1UAX A;  2PFU A;  3PIO L;  5DM6 L;  5ADX H;  4JI3 K;  5AQY A;  4N76 A;  1RNH A;  4LFB K;  4X62 K;  1OH8 A;  5GAD P;  4FWM A;  4M3U A;  4N41 A;  4OX9 K;  1K8K B;  3NF9 A;  4WE1 A;  5I9E B;  1LW2 A;  3KK2 A;  1ATR A;  4DCH A;  3R3L A;  2GTD A;  4B9S A;  3IDH A;  5KI6 A;  4QAG A;  3SK3 A;  4KHN A;  4CFA A;  4KI6 A;  4H03 B;  4B1Y B;  1GLF O;  2P9K A;  1L3T A;  4H5R A;  5AQM A;  3SQ0 A;  1S1W A;  1GOB A;  4DR2 K;  3SPZ A;  4IWV A;  4BE2 A;  4CGG A;  3SZ2 A;  2A40 A;  4IEI A;  3U9Z A;  3LPT A;  2VCP A;  4CZE A;  2YNI A;  1BDG A;  3PLA A;  3OYE A;  3JAM O;  5AQK A;  4AHC A;  3I8B A;  3GBT A;  1HPZ A;  2V52 B;  4KH4 A;  4PL8 A;  1RDB A;  2VGN A;  4CF9 A;  2QWN A;  2G8F A;  3I55 N;  5JS1 A;  3AGK A;  3QML A;  1HLU A;  4B3R K;  3CQY A;  1RGI A;  2WUS A;  1U48 A;  3S3N A;  4RG8 A;  3E01 A;  4KTQ A;  4C8L A;  3RWU A;  1S72 N;  3LWL A;  3R9P A;  1XC3 A;  3S9H A;  4JEP A;  3T1A A;  1DKG D;  4CVN E;  3WNE A;  2IVP A;  1UOC A;  4FWL A;  3M8P A;  1VQP N;  4K42 A;  2KFZ A;  5HOO A;  5AQH A;  5AQI A;  1ASW A;  3BDP A;  3SUN A;  1VSM A;  1J54 A;  3CJ7 A;  3E66 A;  3MXM A;  2OTL N;  4G1Q A;  2HF4 A;  3CCM N;  4LY7 A;  4J2E A;  3RRH A;  2UU9 K;  1JCG A;  3NH0 A;  4JI0 K;  3SUP A;  4O5F A;  4WQ5 C;  3LAM A;  1GLL O;  2O8C B;  3AO2 A;  3PO4 A;  4WYB A;  4RW7 A;  4GY2 B;  4YY3 K;  3VEO A;  3TTF A;  2X6S A;  4Z4C A;  5JIC A;  2G8V A;  4NCA A;  3AVI A;  4B9V A;  3S41 A;  1E3M A;  2HB5 A;  3F5T A;  3QO9 A;  1ZBF A;  4JD2 A;  3JYT A;  4CJP A;  4K41 A;  1LCU A;  4CHP A;  3HM8 A;  3O6W A;  4DFP A;  1RIL A;  4BR9 A;  3GDQ A;  3ZSZ A;  2ZE2 A;  4Z0U A;  4DV1 K;  3P4I A;  1U6Z A;  5M1P A;  4CJK A;  4H0T B;  3NF8 A;  2KZZ A;  4YDU C;  3FFI A;  4BGA A;  3L3V A;  1S3X A;  3AVC A;  4LC9 B;  3NAE A;  1A5X A;  3HVR A;  2QEX N;  4IOC L;  3WXI A;  3ENH A;  4DKW A;  4EP4 A;  4CBX A;  1BUP A;  4V19 S;  2XY8 A;  3QIN A;  1Q86 O;  3AA2 A;  4BRO A;  4JI8 K;  4CF8 A;  1HJO A;  4KI4 A;  4I2Q A;  4BQL A;  5EOY A;  1ITG A;  4ILH A;  4EAH D;  2IS3 A;  1MDU B;  4CER A;  3THW A;  2P9I A;  5EU7 A;  2OCE A;  2E5L K;  4DF4 A;  2QXL A;  1DTQ A;  1KQS M;  3SJH A;  4FJ5 A;  4J2A A;  1KCF A;  1FK9 A;  3MN5 A;  3EZW A;  2O8F A;  2BAN A;  4IZ9 A;  5FDL A;  3CJA A;  3CCV N;  3P31 A;  3LM2 A;  4AHS A;  4MFB A;  3MX5 A;  2Q97 A;  4BVO A;  2VG7 A;  4W5N A;  3CXC M;  4DUY K;  1W2B M;  3O08 A;  1DEJ A;  4FPB A;  3AVF A;  2CH6 A;  3WNH A;  1C0M A;  3CCJ N;  2KFN A;  1LV5 A;  3FZF A;  4BWM A;  3AO5 A;  3FZK A;  1XQS C;  1SL0 A;  1NKE A;  4KFB A;  2G8H A;  2Y1J A;  1KC8 O;  4ID1 A;  3RTV A;  1YVU A;  4FK0 A;  4F3T A;  1U45 A;  1VQM N;  4FXD A;  2XY6 A;  3TAE A;  3OYJ A;  1TV6 A;  4CJF A;  1VQO N;  3SBT A;  1BGX T;  4DF8 A;  1QHA A;  2P9P B;  3OYG A;  2HHT A;  1HNV A;  3C0B A;  4DU3 A;  2Q3S A;  4JS5 A;  3DRS A;  2E20 A;  4CBU A;  1NJX A;  2AA4 A;  2QW9 A;  4CZL A;  3HXM A;  2J4R A;  3TI0 A;  2PZS A;  3K59 A;  1RT5 A;  4A61 A;  5HRS A;  2YV0 X;  4NYN A;  3M5R A;  3NH1 A;  3CYM A;  3HYF A;  2P9S A;  4IFY A;  1DGK N;  4L8R B;  3BF1 A;  4FJG A;  3C95 A;  3VQ4 A;  1IH7 A;  3S3M A;  1HKB A;  2QA4 N;  4I9L A;  1CZ9 A;  4TSX A;  4I9Q A;  3P5J A;  1NWK A;  4N56 A;  1N33 K;  2GEM A;  1YJ9 N;  3KWI A;  4GW6 A;  3F9K A;  3CFR A;  3QEV A;  3VTH A;  4BRL A;  3N4Q A;  4IEE A;  3QIC A;  4E7J A;  3K9K A;  2BDP A;  3O8M A;  4E0D A;  4LSL A;  2YHX A;  1JLQ A;  4NLC A;  1YVN A;  4CFD A;  3ZET B;  3MED A;  3VF2 A;  3R1X A;  2A42 A;  1WUA A;  2FLO A;  1ZBS A;  3H6E A;  4DSL A;  5E84 A;  4CGD A;  4DLE A;  2NLX A;  4CF2 A;  2DPN A;  1T6C A;  3ULD A;  1ASV A;  4IDK A;  1NGD A;  4H0P A;  2FSK A;  4YOV A;  4LFC K;  2DFF A;  2HMP A;  3LPU A;  3SNN A;  1VQ9 N;  1BA1 A;  1NKB A;  3EE8 A;  3OYM A;  3MXJ A;  2KZM A;  4JKA A;  1RT3 A;  2WON A;  3HPG A;  4B8C A;  3K57 A;  3PIP L;  1FXX A;  2P9N B;  4AM7 A;  1J5E K;  2Q36 A;  1B9D A;  4FLW A;  1VSD A;  3AA5 X;  5KTQ A;  4WQ5 A;  2DY4 A;  2BGG A;  3MEG A;  1IBL K;  5FPN A;  1NGC A;  4QS9 A;  1KVB A;  2ZQB A;  4BR5 A;  2IIR A;  1X9W A;  4UY8 O;  2HHQ A;  5IWA K;  4YOX A;  2F8T A;  1ASU A;  1TL3 A;  3FZH A;  5J2M A;  4GNI A;  4DSK A;  3CJ1 A;  1ATS A;  4OPH A;  4DS5 A;  4AM6 A;  3O80 A;  3OYF A;  3G71 N;  4O5B A;  2FBT A;  2NRZ A;  2RPI A;  4RTF D;  3KJV A;  4A5A A;  4H0O A;  4CEO A;  2X78 A;  4YHH K;  1KLN A;  3M6G A;  2YKM A;  1HNX K;  1JJ2 M;  1KLM A;  3AVH A;  4BG9 A;  2B5J A;  4YDU A;  3CMA N;  1E4G T;  3OYK A;  2QI2 A;  3AY9 A;  4CZG A;  1BQN A;  4C1N K;  1D5A A;  1L3U A;  3VQD A;  1JL1 A;  4B3S K;  1TAQ A;  5AQL A;  4GKJ K;  4LF6 K;  2FBY A;  3TAQ A;  4NLB A;  1S1U A;  4RW6 A;  4DV6 K;  4GV9 A;  2UXD K;  4JKD A;  3CHW A;  3C6U A;  2NNW A;  3DWL A;  1YJW N;  4C8M A;  3NFA A;  2D0P A;  4DG1 A;  5TKW A;  2ZJP L;  3V9X A;  1KFD A;  1U49 A;  2HHX A;  4CIE A;  5AFU A;  2ASP A;  1ESV A;  1R59 O;  3D2F A;  2XRI A;  3HSC A;  2XY7 A;  4MDA A;  1OVY A;  3L0Q A;  1XWL A;  2HST A;  1W97 L;  1H1V A;  1WSH A;  4HUF A;  4HCB A;  3UKR A;  5AQF A;  5C25 A;  4EIA A;  4R5P A;  4O0I A;  4DV2 K;  1YAG A;  3D2E A;  3A8Y A;  4FCY A;  4F9O A;  1UA0 A;  1X3N A;  3ZX3 A;  4RWT A;  4CGI A;  3CCR N;  2YNG A;  3LDP A;  3C6H A;  3DLG A;  4GV3 A;  4BRI A;  4BRQ A;  4IKF A;  5IT9 O;  1RTH A;  3ULE B;  4IG0 A;  4F2R A;  2QWR A;  3WQT A;  3OHR A;  1LAW A;  3O9T A;  1UA1 A;  3SPY A;  3TSU A;  1TKD A;  1NU0 A;  3E1Y A;  3ID6 A;  2FBV A;  1C0G A;  2ITM A;  3THY A;  1TK0 A;  3P83 D;  1Z26 A;  1NGB A;  1KTQ A;  2HBJ A;  4CBW A;  1HKG A;  2Z1H A;  5AQX A;  5JLF A;  1GLE G;  2FXU A;  1LOT B;  2OTJ N;  2NRX A;  4A57 A;  4DV3 K;  2PYJ A;  3GL1 A;  1HKC A;  2GUI A;  2F7T A;  4JI7 K;  2JWK A;  3CC7 N;  4DR1 K;  1A5W A;  3KLH A;  2O4G A;  4M7Y A;  4DQ8 A;  5C12 A;  4W5Q A;  1IG8 A;  4FWP A;  4CGH A;  4JS4 A;  5J1E A;  3WXM B;  4CW7 B;  3J7Z O;  4BDY A;  3CJB A;  4AHU A;  1FKP A;  4C23 A;  3E9P A;  4X65 K;  2GV9 A;  4OJR A;  2BE2 A;  4OLB A;  1QTM A;  3V9U A;  4BRP A;  1G15 A;  3FZM A;  3OTO K;  3PV8 A;  1U47 A;  1GOA A;  3ZX2 A;  3QFU A;  1SQK A;  1SL2 A;  1VSF A;  3FE1 A;  3IUC A;  3Q7C A;  3VQE A;  1VHX A;  3H46 O;  3T69 A;  4HTU A;  1K9M O;  1RCH A;  1S6Q A;  4FWQ A;  3VGK A;  3SJJ A;  1BCM A;  5AZJ A;  1XMO K;  3O9S A;  4H5W A;  1X1P A;  3QEI A;  2VWB A;  3SUO A;  4CEC A;  1CXQ A;  3PX0 A;  1QS4 A;  4JKG A;  4DFM A;  2DTU A;  1T05 A;  3SQ4 A;  3IKM A;  4PKI A;  3TPQ A;  2A1S A;  4Q5V A;  4NCG A;  1LAV A;  4CFC A;  4CJE A;  4IJA A;  1S1X A;  4YOR A;  2FF3 B;  5H1S Q;  3ALY A;  4N47 A;  2UUC K;  3THV A;  2HVI A;  5M1K A;  3THX A;  1NK0 A;  3SMP A;  4DTP A;  2RE2 A;  3AVB A;  4IOA L;  3AGR A;  3H1V X;  5K14 A;  3G0Z A;  4CHY A;  3UKU A;  5J2Q A;  2D0B A;  4BQZ A;  4H5T A;  4IFE A;  3HP6 A;  4DR3 K;  3WEE B;  4LF5 K;  5HBM A;  4IG3 A;  4XH5 A;  3ENO A;  4FOE A;  1EX4 A;  4JK9 A;  4QCL A;  3ZEU A;  3TR8 A;  3VEY A;  4X64 K;  4HCC A;  4WQ4 C;  3H1Q A;  4B08 A;  5JVH L;  4C8O A;  4OKE A;  3GE1 A;  2QWL A;  3BP8 A;  3OS0 A;  4JK8 A;  5C0Y A;  3NF6 A;  4KH6 A;  5AQV A;  3OYH A;  4PL7 A;  3ITH A;  3M1F A;  5AZI B;  4Z4H A;  2YX6 A;  4U7B A;  4CEA A;  1SV5 A;  2E2O A;  1NGA A;  4YOT A;  4EP5 A;  4KHP K;  2GX9 A;  1OH7 A;  3KTQ A;  3E9O A;  4M45 A;  5FLX O;  3C6T A;  5AQW A;  3B6P A;  4M3W A;  3HZ6 A;  5LMN K;  3ATU A;  1VQL N;  4JRP A;  5DK5 A;  1VQ6 N;  3HOS A;  3SI6 A;  4BR7 A;  2O8E A;  2KW4 A;  3V1Q A;  1Q18 A;  1YTU A;  3TAN A;  4BY9 C;  5C15 A;  4OPJ A;  4IXC A;  4QS8 A;  3RVC A;  4FJK A;  3ZSQ A;  3SYZ A;  3I56 N;  3A2F A;  1RT7 A;  1HJR A;  2P9U B;  3EKS A;  4DU4 A;  3VQA A;  3RMC A;  2YNH A;  1EO1 A;  2O8B B;  5GIP A;  1VQ7 N;  3CCL N;  4FJL A;  1Z25 A;  2YHW A;  2YCH A;  4PHT X;  2O8D B;  4NO7 A;  3EE9 A;  1RBS A;  4E7K A;  2H3G X;  3M8Q A;  3NGZ A;  4O8K A;  2BUP A;  4JK7 A;  5KRS A;  3Q7B A;  2NRH A;  1G99 A;  2VGM A;  5AQZ A;  4QS7 A;  3RR7 A;  3KHY A;  3HVT A;  1TL1 A;  3OJS A;  4K8X A;  4DV4 K;  4AHV A;  1EET A;  4BAC A;  3VER A;  3ZX0 A;  3SV4 A;  2HBM A;  4FK2 A;  4DV5 K;  4BGB A;  1BHL A;  3FLC O;  3IS9 A;  3ZSR A;  4FM1 A;  3KK3 A;  1YIT N;  4M3T A;  2G8U A;  5E26 A;  3WT0 A;  3DXM B;  4OKJ A;  2FF6 A;  2IGI A;  3NHG A;  4CJU A;  4JLH A;  5EVZ A;  1RBT A;  5ADX A;  3T7Z A;  3MK6 A;  3LWM A;  2ZGY A;  4CJ7 A;  4Y1C A;  3KLE A;  3O1W A;  2D1K A;  4A2A A;  4F4K A;  4DR6 K;  4M3Z A;  4B9T A;  1QZ6 A;  3M8R A;  3MXI A;  1VRT A;  4EFH A;  2I7P A;  3TAM A;  4FOI A;  3LP2 A;  2G8I A;  1XNR K;  1BCO A;  4KHW A;  3LZI A;  3L6Q A;  5M1Q A;  1NK4 A;  1S1T A;  2RKI A;  5J2N A;  5AQG A;  1NGH A;  2VQF K;  1JXE A;  4DSE A;  3LP1 A;  4YFU A;  2ASM A;  2Z1J A;  1C1A A;  4I6M A;  5JLH A;  5JVG L;  2GEL A;  1BWF O;  3H3N O;  4E7I A;  3GG4 A;  5AQU A;  3S3O A;  4ISE A;  3CD6 N;  2A41 A;  4A62 A;  3TAF A;  2HMI A;  5HLF A;  1L3S A;  4OKK A;  2CH5 A;  4H0X B;  4DB3 A;  4PQU A;  4MO5 A;  2V7Y A;  3MX2 A;  3J7A P;  2PYL A;  4DUZ K;  3EYZ A;  3G4S N;  2XO7 A;  4KHQ A;  1M1K O;  5FRN A;  4JKF A;  3RSE A;  3L2R A;  3V4I A;  1KVC A;  4B1W B;  2YJE A;  2D0C A;  3OY9 A;  3EEQ A;  3HJF A;  3TSQ A;  2D4W A;  3VQ5 A;  4KHU A;  2P1J A;  4I7F A;  4H8K A;  4M42 A;  1XHZ A;  3MCP A;  3L3U A;  2QM1 A;  4F3O A;  3SUQ A;  1WBD A;  4EZ9 A;  3IRX A;  1U2V A;  3AVG A;  2R7Y A;  4C1N I;  3HBT A;  2QTD A;  3CFO A;  1M90 O;  4DTM A;  1WSE A;  1J6Z A;  3DXK A;  3DYA A;  1KAZ A;  3AO1 A;  3PSF A;  3UIQ A;  4JI5 K;  3O4Q A;  3LZJ A;  1OH5 A;  1B92 A;  1OH6 A;  3KKS A;  1NBW A;  3H08 A;  1NJW A;  4CZJ A;  4LF8 K;  5TKY A;  4OLA A;  2NZT A;  3J7Y P;  4CHO A;  4BR0 A;  3MMV A;  2HVH A;  1NM1 A;  1RDW X;  3C7N A;  5LMU K;  1J9A A;  2G8K A;  5GIN A;  2FBX A;  3G25 A;  2B4J A;  5AR0 A;  2ITG A;  4ZHR A;  5BPN A;  2KQ2 A;  3LAK A;  1NOY A;  5AQJ A;  4CJT A;  4CHN A;  4WQ4 A;  4FVM A;  4B8A B;  1TYQ A;  3U6F A;  4Z94 A;  3F9M A;  5FPE A;  4GVE A;  5HRR A;  3DOK A;  1SKS A;  2W6K A;  1BG3 A;  4B1Z A;  5M1N A;  3O1B A;  5KQ8 A;  3MN9 A;  3T1H K;  1KAY A;  3LDL A;  4JRQ A;  1HNI A;  5SWM A;  4XIU A;  3CME N;  3KK7 A;  2BTF A;  2F9T A;  5BN9 A;  2Q0R A;  3ZLJ A;  1RTD A;  1S1V A;  4M63 C;  2P9K B;  3EY1 A;  4CJQ A;  4M41 A;  5CY4 A;  3IFR A;  4LD0 A;  3SMS A;  5B8H A;  4CJ3 A;  4JN4 A;  1BI4 A;  3LDS A;  2LSN A;  4IOX A;  5AQT A;  3OS1 A;  1X9S A;  2FC0 A;  2FSJ A;  3N4P A;  2E1Z A;  3EO3 A;  3AA3 A;  3QB0 A;  3VQ8 A;  3T19 A;  4H5N A;  3RR8 A;  1BO5 O;  4B3M K;  2AP1 A;  2KKZ A;  2VG5 A;  3VF6 A;  4LF4 K;  1ZYQ A;  3WXK A;  3K5L A;  3QEX A;  3VF4 A;  5AQN A;  4CGJ A;  5F1X A;  4ZTJ A;  3JSM A;  4ZTF A;  4GMJ B;  1QQO A;  4NCB A;  3L2W A;  3HPH A;  2OPR A;  3HTV A;  2ZD1 A;  2D5R A;  4EHU A;  4AIL C;  3LDO A;  4JV5 K;  5AQO A;  4B9L A;  4PKG A;  1YTA A;  1WN7 A;  1LWE A;  4BRN A;  4PY5 A;  1WSG A;  4BG8 A;  5KGW A;  4OGC A;  2AJQ A;  3ZT3 A;  5F2R A;  1VQ5 N;  3OYD A;  1BQM A;  5F0X A;  3DI6 A;  4FLX A;  5KRT A;  1CXU A;  5LL6 Z;  4DTS A;  4CZI A;  4FZZ A;  3CPW M;  2OYQ A;  3VEZ A;  1J5O A;  5HL7 L;  1JCE A;  2W6L A;  3RMD A;  3L2Q A;  3W3D A;  3OJU A;  4FJX A;  1ATN A;  4ICL A;  4C8K A;  3ZT4 A;  4OPK A;  2HHH K;  4JI2 K;  3MAQ A;  4LFA K;  4E1N A;  1RTJ A;  4CJR A;  2UUA K;  2QKB A;  4LF7 K;  3CM6 A;  4JD2 B;  4ELU A;  4JHD A;  2I7N A;  1RBR A;  3VQ7 A;  4FJI A;  3DLL L;  4CCH A;  1ZBI A;  3M3Z A;  1MWM A;  4J2D A;  4I2P A;  2F96 A;  3LAL A;  4HHT A;  3NCI A;  4ILG B;  1ZBU A;  2V7Z A;  3O4W A;  3HOT A;  4IO8 A;  3ATV A;  3TTC A;  4WFB L;  3HP9 A;  4CJW A;  2ASO A;  3BZC A;  1TKT A;  3J8A A;  4CES A;  3AO3 A;  3P1G A;  1HPM A;  4CED A;  4IBN A;  2P9L A;  4JI1 K;  4Z4E A;  1HUX A;  1NJZ A;  4E89 A;  2EHG A;  4FJ8 A;  4KO0 A;  4JKH A;  1ZXO A;  1TUU A;  4WF9 L;  3HO1 A;  2W41 A;  3DMJ A;  2G8W A;  1CLQ A;  4FW2 A;  3BZK A;  4JI4 K;  1N5Y A;  1WBB A;  2QWP A;  1K8K A;  5CR4 A;  4B1X B;  2HW3 A;  4FJM A;  1QSL A;  1T7P A;  2X74 A;  4CEB A;  5MLC Q;  2CGL A;  2QWQ A;  1N32 K;  3DRR A;  3THW B;  2P9I B;  3FGU A;  4OPA A;  3TSP A;  1QE1 A;  3MWP A;  1TK8 A;  1N34 K;  3A5L C;  2QK9 A;  2O8F B;  2E2Q A;  3AAP A;  5KGX A;  4LH4 A;  4K8Z A;  3IAY A;  2QWM A;  4KB0 A;  2HBK A;  3QES A;  1REV A;  3AVK A;  3F73 A;  4B9M A;  1FKO A;  1SS6 A;  1F21 A;  5LY3 A;  3O3G A;  4KRE A;  4A5B A;  3SAG A;  2E8A A;  1NGE A;  3DLB A;  3CPE A;  4DS4 A;  5I42 A;  3NBP A;  4OO1 J;  4BR4 A;  5KPR A;  3L8B A;  5LJV A;  1KSP A;  3ZCM A;  2YNF A;  2CGJ A;  3U9D A;  3NVM A;  3MN7 A;  4B1U B;  3SLC A;  1WSI A;  3FFK B;  5FRM A;  2IVO A;  1RT1 A;  1YJN N;  3KLI A;  1KXP A;  3AVJ A;  4KB1 A;  2VQE K;  4CJ4 A;  1R0A A;  1QZ5 A;  1XC9 A;  3PSI A;  4MDB A;  5BR9 A;  1IKX A;  1I3A A;  4K43 A;  2ZJQ L;  4GKK K;  2P51 A;  4KHS A;  4DSF A;  4CD1 A;  4C8N A;  1T03 A;  1B9F A;  1NMD A;  4LH5 A;  3C6A A;  4BRH A;  1C1B A;  4ISF A;  1X9M A;  3VEW A;  4AF1 A;  1E4F T;  1BIZ A;  1IBM K;  4CZH A;  3J81 O;  1DTT A;  2P9S B;  1NGJ A;  1NK7 A;  1HR0 K;  5CHI A;  1WAF A;  2O8C A;  5J2P A;  4H5V A;  3R8E A;  4A59 A;  3W0L A;  3OA9 A;  2HHV A;  3QIO A;  1KD1 O;  2E1Y A;  3EN9 A;  4CZK A;  4BE1 A;  3V81 A;  1NGG A;  4E19 A;  2B6A A;  4DR4 K;  4FWS A;  4JNE A;  2BH1 A;  1VRU A;  4KV8 A;  5AJ3 K;  1VSJ A;  4YOW A;  3CET A;  2ZF5 O;  1U4B A;  4BRM A;  1BIS A;  4CK2 A;  4IFV A;  4XEI A;  2HHW A;  4CEF A;  3HL8 A;  5BN8 A;  1SZ2 A;  3TAP A;  2QXF A;  3ZSX A;  4FZX C;  1GOC A;  4FPA A;  1D9D A;  1X9J A;  1VSI A;  3VEV A;  2QWO A;  1XNQ K;  4ISG A;  1VSE A;  1LWC A;  5KQD A;  3RRG A;  1Z6R A;  3B6O A;  1N8R O;  4FWN A;  2YHB A;  3TU5 A;  3TAG A;  4DQP A;  5CYM A;  2Q31 A;  1WOQ A;  4E7H A;  3CCQ N;  4HUG A;  5BPL A;  3DLK A;  2D0A A;  1YIJ N;  2O4I A;  3ZSY A;  1I39 A;  4FJH A;  2RHK A;  3KD5 E;  1JCF A;  1QHT A;  3KIO A;  3HM9 A;  3SQ1 A;  3KK1 A;  4DTX A;  1RFQ A;  2CGK A;  3K0S A;  5ELZ A;  2A1R A;  1IKY A;  1Q7Y O;  2JGU A;  5BRF A;  3LAN A;  4JKB A;  2Z1I A;  4B1V A;  2PAV A;  4JI6 K;  1HRH A;  3AVA A;  3K9J A;  5BRE A;  1RBU A;  4NXM K;  1L5U A;  4XH4 A;  3QDK A;  3HST B;  3TTD A;  3OYA A;  3BY5 A;  3QLH A;  3OYI A;  1DT9 A;  4Q0B A;  3MEE A;  1C1C A;  1VSH A;  3EKU A;  4FJN A;  3AV9 A;  4DU1 A;  1QVG M;  1TAU A;  4BRG A;  4KKO A;  3DJC A;  3CC2 N;  2WFB A;  1GLJ O;  4DQS A;  1NMN A;  3H3O B;  2NUB A;  2VWK A;  3WXL A;  4DTN A;  3OBY A;  1ZBL A;  4KH5 A;  3K58 A;  3U8X A;  2F4V K;  2HND A;  3AO4 A;  4BC5 A;  4FLV A;  3TAB A;  4WFN L;  1J53 A;  1JLF A;  3D45 A;  2Y1I A;  3VTI A;  3TWH A;  1P90 A;  2JLE A;  4CK1 A;  2XHB A;  5FPM A;  4DTO A;  1KVA A;  2P9P A;  2F8S A;  3VES A;  1OKJ A;  1Q8I A;  4DV0 K;  5C10 A;  3AVN A;  4XH1 A;  1T44 A;  3D2F B;  3QFP A;  4BRC A;  1W0H A;  1IJJ A;  3ZT2 A;  4AHT A;  3NF7 A;  3CCS N;  4FLY A;  4Y0W A;  2E2P A;  3UKR B;  1NGF A;  3WNG A;  1TUY A;  1QVF M;  4H0V B;  3CCU N;  3WXJ A;  4FJ7 A;  1VQN N;  1C0U A;  3D2E B;  3PUF A;  4PKH A;  1T3V A;  2HBL A;  1QSY A;  1WSF A;  1RT6 A;  1XHX A;  4QOZ B;  5BPM A;  3UE5 A;  3VQC A;  2E2N A;  4CJL A;  5GAH P;  1N6Q A;  4MO4 A;  3QNO A;  2ZWH A;  4H4O A;  4E1M A;  4CJ5 A;  2A5X A;  3KD1 E;  2VYP A;  3L2U A;  2GBZ A;  4CF1 A;  5C2F A;  4BRD A;  3MCA B;  4DLG A;  1T8E A;  4B9Q A;  3IG1 A;  1O13 A;  1LWF A;  4DQI A;  1EWQ A;  3ID8 A;  1QQN A;  3ZT1 A;  3NE6 A;  3THY B;  4BDZ A;  4IJN A;  3ZET A;  5DM7 L;  4DTR A;  3QBX A;  4E7L A;  4WCE L;  5C2D A;  3VA3 A;  3L4I A;  3TAR A;  1RT2 A;  2UXC K;  4LF9 K;  4OVL A;  5CE3 A;  4FJ9 A;  1RDC A;  4KTW A;  4FLU A;  1K73 O;  4FVU A;  2KLA A;  4NXN K;  5AQS A;  3DLR A;  2V51 B;  4CIG A;  2Q2R A;  1D9F A;  3NMU A;  1JKH A;  2OZM A;  1KRP A;  4BVP A;  3VPZ A;  1I94 K;  2P9N A;  4A2B A;  2HNY A;  3O9Q A;  1WB9 A;  2P5G A;  3VQQ A;  2NRT A;  3B8A X;  3VEX A;  3LDN A;  3C65 A;  3KLF A;  1IG9 A;  4MLE A;  1GLA G;  4CD3 A;  4KRF A;  4FW1 A;  3C94 A;  1K8A O;  3DLE A;  1UWB A;  3CM5 A;  5AZJ B;  3PY8 A;  5C42 A;  1Y64 A;  2GUP A;  4FLZ A;  4IO9 L;  3BUZ B;  3ZT0 A;  3M8S A;  4JKG B;  2NRV A;  4O8U A;  4DV7 K;  3K5O A;  3V1O A;  2YKN A;  1HQE A;  4FJJ A;  2ZM6 K;  3CFP A;  2IDO A;  3I0S A;  1V4T A;  1TK5 A;  3AVM A;  3VGL A;  3I0R A;  4CF0 A;  4JKE A;  1SL1 A;  3HI0 A;  3LM9 A;  1S9G A;  5GIO A;  3THX B;  3WUH A;  4NB4 A;  3CQX A;  3HRG A;  4FSV A;  3VA0 A;  3E9L A;  3CC4 N;  2UYT A;  3DOL A;  3SBG A;  3UKU B;  1HYS A;  1HX1 A;  4DSJ A;  5BRD A;  1NJI O;  3F2K A;  4CZF A;  1V4S A;  3VQ6 A;  1VAZ A;  3V9Z A;  1FW6 A;  5AQP A;  3D7E O;  3ZEU B;  3CJC A;  3AAR A;  4Z4F A;  3QEW A;  4ELT A;  1GLB G;  1YI2 N;  3WQU A;  4GV6 A;  3FZL A;  5JMV A;  5GAG P;  4BWJ A;  2VG6 A;  3EL2 A;  3CIP A;  5EX5 A;  1Z05 A;  4F8R A;  2RF2 A;  3AA4 A;  1HNZ K;  5DMR A;  3VQP A;  4E1J A;  4MLH A;  2EWS A;  2OPP A;  4AQY K;  3SQ2 A;  3V9W A;  1VK0 A;  5KPT A;  3CER A;  1RDD A;  1SUQ A;  4G9Z A;  2RN2 A;  1NK5 A;  2PY5 A;  2YHA A;  3ULE A;  1JL2 A;  2OA8 A;  2O8E B;  5HRO A;  4DQR A;  3P38 A;  1BA0 A;  1YT3 A;  2YJF A;  2OZS A;  1WLJ A;  4ELV A;  1XI1 A;  4J8F A;  5A2Q O;  4KAZ A;  4W5O A;  1N36 K;  1O1W A;  4CGF A;  5CZ2 A;  2W40 A;  3LDQ A;  4BRF A;  2DFH A;  1JLG A;  2JWL A;  1NG9 A;  2FSN A;  3BF3 A;  4FM0 A;  4J2B A;  4EHT A;  1WSJ A;  4FWR A;  3MWT A;  4H0Y B;  1BOT O;  1T6D A;  4L3Q A;  2W42 A;  2UUB K;  5HP1 A;  4W5T A;  1S6P A;  4O0J A;  4MQ3 A;  3VQ9 A;  4B3T K;  1W9H A;  4CEZ A;  2Z1G A;  4FO0 A;  4K25 A;  3OYC A;  4M3Y A;  2F9W A;  4BC4 A;  4BDP A;  1KFS A;  1D4X A;  1XMQ K;  2NRW A;  3QIP A;  3CCE N;  3LP0 A;  4FM2 A;  4R79 A;  3T3F A;  4W5R A;  1NOZ A;  4CEQ A;  1JLA A;  3ISN C;  3D0P A;  3UB5 A;  3J80 O;  2YI1 A;  2A6A A;  4JAX A;  2X6N A;  4CK3 A;  5HRP A;  5CZ1 A;  1RT4 A;  1C6V A;  2E6M A;  4JYA K;  1KAX A;  4CI6 A;  1MA9 B;  4KPY A;  2HHS A;  4JKC A;  1HYV A;  1Y97 A;  4DFK A;  4FL9 A;  4AHR A;  2ZGZ A;  4U67 L;  1EKE A;  4RW4 A;  4DFJ A;  2WC9 A;  1EP4 A;  1RTI A;  1SKW A;  4B9U A;  4BC3 A;  2A3Z A;  3MDQ A;  1XUP O;  3CF5 L;  1U04 A;  1S22 A;  5AFU H;  3EZ5 A;  4Z4I A;  5JS2 A;  4B3O A;  1ZBH A;  1EQY A;  4HUE A;  4FK4 A;  5D3G A;  3OYL A;  3SAF A;  3JXU A;  3ENB A;  1NNE A;  1IV0 A;  1WAJ A;  4DTU A;  1NK9 A;  1QQC A;  4HTL A;  5AQR A;  1NKC A;  4CIF A;  4I6M B;  2OPQ A;  3AAQ A;  1DLO A;  1RDU A;  3OS2 A;  4AH9 A;  1NK8 A;  4CFB A;  4WFA L;  4DWI A;  3WEE A;  1SKR A;  1GLC G;  1SAZ A;  3V9S A;  4F2S A;  1JXB A;  1QSS A;  1CZA N;  4O55 A;  2UXB K;  4CHZ A;  3OYB A;  3K2P A;  4O4G A;  4RW8 A;  3OYN A;  1Q9Y A;  1MWK A;  2WOM A;  5BR8 K;  1IBK K;  3RSE B;  1CZB A;  3BEX A;  5AZI A;  2XY5 A;  1YUW A;  1HQU A;  4CZM A;  3HPO A;  1A5V A;  4E3S A;  2KHO A;  5BRH A;  3A0I X;  4RW9 A;  3O4N A;  3NH2 A;  3U3Y A;  3DLH A;  3A5O C;  3MN6 A;  3LP3 A;  4CHQ A;  1RDA A;  2NRR A;  4OGE A;  3QET A;  1EWR A;  4YOU A;  3A5N C;  4HVJ A;  3T1Y K;  3A5M C;  2I5J A;  2OAN A;  4BR2 A;  1TVR A;  4CJV A;  1U2V B;  3KVG A;  4DQQ A;  4M3X A;  3U4L A;  2D0O A;  4H4M A;  2IC3 A;  5LJW A;  3DXK B;  2P9U A;  4DR5 K;  2HF3 A;  2YHY A;  3VQB A;  5EXW A;  2GWK A;  1S5J A;  3VN5 A;  3QER A;  5E41 A;  3GOI A;  3CG7 A;  3C7N B;  1VSL A;  3O5B A;  2OPS A;  2O8B A;  1YHQ N;  1K6Y A;  1IKV A;  4Y1D A;  2O8D A;  4DTJ A;  3O9U A;  1L3V A;  1Q82 O;  1YXQ A;  4IDH A;  3D6R A;  2E88 A;  1JLC A;  1TYQ B;  1VQ4 N;  3R6M A;  3QBW A;  3HT3 A;  4FLT A;  3I33 A;  4KTZ A;  4FZY A;  2IOC A;  3ZSV A;  4Z4G A;  3PX4 A;  4DMN A;  4X66 K;  3CI5 A;  5CYQ A;  4M7X A;  3OVN A;  1OVQ A;  5FPD A;  3KZB A;  2E4L A;  1LW0 A;  2QKK A;  1NJY A;  3ASM A;  2Q1N A;  3P39 A;  2HNZ A;  1Q9X A;  1BI4 B;  2EX3 A;  3DXM A;  1BU6 O;  5SZT A;  1IO2 A;  4KBO A;  3VEN A;  1HMV A;  3KWG A;  3MEC A;  3NGY A;  1HYZ A;  4PA1 A;  4PUO A;  2ATQ A;  3LL3 A;  3BGR A;  3DM2 A;  4EZ6 A;  1P8Z A;  2Q0U A;  4B9N A;  3K5M A;  4O44 A;  1S9E A;  5M1F A;  3KKR A;  3FR0 A;  1BIU A;  4GVM A;  1NLV A;  3PX6 A;  4PWD A;  3RMB A;  4RCH A;  3DAW A;  4CEE A;  3NGI A;  3WNF A;  1Q81 O;  4DHY A;  4BRE A;  3JS6 A;  5I3U A;  5C24 A;  3L2V A;  5HRN A;  5KPZ A;  3V6D A;  3ZSO A;  3SCX A;  4BRA A;  5AQQ A;  4YOY A;  5T7B A;  2ZJR L;  1ZC6 A;  1JLB A;  1TKZ A;  4FWO A;  4KHY A;  4CE9 A;  2HOE A;  3O9R A;  5M1O A;  4FYD A;  2IVN A;  4ID5 A;  1VQK N;  2DFE A;  4BC2 A;  1VQ8 N;  4HWI A;  3NVK A;  1BL3 A;  4M3R A;  3SV3 A;  1WNS A;  3V1R A;  3HK2 A;  1C0T A;  1QQM A;  3PO5 A;  1GLD G;  1JLE A;  3VGM A;  2IAJ A;  4LSN A;  3QNN A;  3NDK A;  3G10 A;  1W7A A;  1NK6 A;  1X3M A;  1NGI A;  1EXQ A;  3IMX A;  3I8D A;  2VWJ A;  3QEP A;  3VOV A;  4FWK A;  1IKW A;  2ETJ A;  3RMA A;  3CJ9 A;  3L4Q A;  3OW2 M;  4UQG A;  4DR7 K;  1FJG K;  2PBD A;  2P5O A;  2HHU A;  5EY4 A;  1YF5 L;  3DRP A;  1TKX A;  4N5S A;  3ZSW A;  2KTQ A;  1C0F A;  4JHD B;  4CJS A;  5FRO A;  3O3F A;  2E6L A;  1D8Y A;  5GAE P;  1VSK A;  4NYF A;  3SAH A;  3VMF B;  2GWJ A;  3O3H A;  2WBN A;  1MU2 A;  3ZYY X;  1HNW K;  4K0K K;  3K5N A;  1RBV A;  4DSI A;  3H45 C;  3AVL A;  4ILJ A; 
#chains in the Genus database with same CATH homology
 2ZD1 A;  2D5R A;  4BE0 A;  3U3G A;  3KLG A;  4FCY A;  4AIL C;  1UA0 A;  4KRF A;  4FW1 A;  4CGI A;  2YNG A;  3C94 A;  4B9L A;  1TGO A;  3CQ8 A;  4YNQ A;  3DLG A;  1YTA A;  3DLE A;  1WN7 A;  1LWE A;  1UWB A;  3CM5 A;  4PY5 A;  3PY8 A;  1WSG A;  5C42 A;  5KGW A;  1UAX A;  4IKF A;  1RTH A;  4OGC A;  4N76 A;  1RNH A;  4FLZ A;  2AJQ A;  4IG0 A;  4M3U A;  3ZT0 A;  3ZT3 A;  3M8S A;  4F2R A;  4N41 A;  3OYD A;  3K5O A;  3V1O A;  3NF9 A;  4WE1 A;  1BQM A;  2YKN A;  1LW2 A;  3DI6 A;  3KK2 A;  1LAW A;  1UA1 A;  4FLX A;  5KRT A;  3SPY A;  4B9S A;  1TKD A;  5KI6 A;  1CXU A;  4QAG A;  1HQE A;  2FBV A;  4DTS A;  4FJJ A;  3CFP A;  2IDO A;  4KHN A;  4CFA A;  3I0S A;  4KI6 A;  4FZZ A;  1TK5 A;  1TK0 A;  2OYQ A;  3AVM A;  3I0R A;  3P83 D;  4CF0 A;  1Z26 A;  1J5O A;  1KTQ A;  1SL1 A;  1S9G A;  2Z1H A;  3RMD A;  1L3T A;  3L2Q A;  3OJU A;  3SQ0 A;  2PYJ A;  1S1W A;  4FJX A;  3VA0 A;  1GOB A;  4ICL A;  2GUI A;  4C8K A;  3DOL A;  1HYS A;  3ZT4 A;  4OPK A;  4BE2 A;  3SPZ A;  4CGG A;  3SZ2 A;  4DSJ A;  3MAQ A;  4E1N A;  1A5W A;  3KLH A;  2O4G A;  3VQ6 A;  1RTJ A;  3LPT A;  4CJR A;  3V9Z A;  2QKB A;  2YNI A;  3CM6 A;  4ELU A;  3OYE A;  3VQ7 A;  1RBR A;  4AHC A;  4FJI A;  4W5Q A;  1HPZ A;  4CGH A;  4JS4 A;  4CCH A;  1ZBI A;  5J1E A;  1RDB A;  4Z4F A;  4BDY A;  3QEW A;  4ELT A;  4AHU A;  1FKP A;  4J2D A;  4I2P A;  4CF9 A;  2G8F A;  2F96 A;  5JS1 A;  2GV9 A;  3LAL A;  4OJR A;  2BE2 A;  4OLB A;  1QTM A;  4HHT A;  4BWJ A;  3NCI A;  2VG6 A;  3V9U A;  1ZBU A;  1G15 A;  1U48 A;  3S3N A;  4RG8 A;  3E01 A;  3PV8 A;  3HP9 A;  4CJW A;  1U47 A;  1GOA A;  4KTQ A;  1TKT A;  4C8L A;  3RWU A;  4CES A;  3LWL A;  4F8R A;  3AO3 A;  3P1G A;  1SL2 A;  4CED A;  2RF2 A;  3AA4 A;  1VSF A;  4IBN A;  3VQE A;  3S9H A;  5DMR A;  4Z4E A;  1NJZ A;  3VQP A;  2EHG A;  3T1A A;  4E89 A;  4HTU A;  1RCH A;  1S6Q A;  2OPP A;  4KO0 A;  3WNE A;  3SQ2 A;  1UOC A;  1VK0 A;  3V9W A;  3M8P A;  3SJJ A;  1BCM A;  3HO1 A;  1RDD A;  1SUQ A;  2KFZ A;  1X1P A;  3DMJ A;  2G8W A;  2RN2 A;  3QEI A;  1CLQ A;  4FW2 A;  3SUO A;  4CEC A;  1NK5 A;  2YHA A;  1N5Y A;  2PY5 A;  1CXQ A;  1JL2 A;  2OA8 A;  5HRO A;  3PX0 A;  1QS4 A;  4DQR A;  1ASW A;  3BDP A;  3SUN A;  1YT3 A;  1VSM A;  4DFM A;  2DTU A;  1T05 A;  1J54 A;  3SQ4 A;  2OZS A;  4FJM A;  2HW3 A;  3MXM A;  1WLJ A;  1QSL A;  1XI1 A;  4ELV A;  1T7P A;  4G1Q A;  2X74 A;  4LY7 A;  4J2E A;  3RRH A;  4KAZ A;  2A1S A;  4W5O A;  4Q5V A;  4NCG A;  4CEB A;  4R5P A;  1LAV A;  3DRR A;  4CFC A;  1O1W A;  4CGF A;  3NH0 A;  3SUP A;  5CZ2 A;  3LAM A;  4CJE A;  1S1X A;  3AO2 A;  3ALY A;  3PO4 A;  2DFH A;  4N47 A;  4RW7 A;  3THV A;  1QE1 A;  1JLG A;  2HVI A;  1NK0 A;  1TK8 A;  4DTP A;  2X6S A;  3AVB A;  4FM0 A;  2QK9 A;  4J2B A;  4Z4C A;  1WSJ A;  3HPH A;  2G8V A;  5K14 A;  3G0Z A;  4CHY A;  5KGX A;  5J2Q A;  4NCA A;  2D0B A;  2W42 A;  4LH4 A;  3AVI A;  5HP1 A;  3HP6 A;  4B9V A;  4K8Z A;  4W5T A;  2HB5 A;  3IAY A;  1S6P A;  4O0J A;  5HBM A;  4KB0 A;  4MQ3 A;  3VQ9 A;  3QO9 A;  1W9H A;  4IG3 A;  2Z1G A;  4CEZ A;  1ZBF A;  3QES A;  1EX4 A;  3OYC A;  3JYT A;  4CJP A;  4M3Y A;  4QCL A;  4CHP A;  3TR8 A;  4BDP A;  1REV A;  1KFS A;  4HCC A;  3QIP A;  4DFP A;  3AVK A;  4B08 A;  3LP0 A;  1RIL A;  4C8O A;  3F73 A;  4OKE A;  4B9M A;  3ZSZ A;  1FKO A;  2ZE2 A;  1F21 A;  3OS0 A;  4FM2 A;  3O3G A;  3T3F A;  4Z0U A;  4W5R A;  4KRE A;  1NOZ A;  3NF6 A;  1JLA A;  4CEQ A;  3OYH A;  3DLB A;  3ISN C;  3ITH A;  3D0P A;  4DS4 A;  4CJK A;  5I42 A;  3NBP A;  3NF8 A;  4Z4H A;  2KZZ A;  3FFI A;  4CEA A;  3L8B A;  3L3V A;  1SV5 A;  3AVC A;  2X6N A;  4EP5 A;  4CK3 A;  5HRP A;  5CZ1 A;  3KTQ A;  1RT4 A;  1C6V A;  3NAE A;  1KSP A;  4M45 A;  3ZCM A;  1A5X A;  2E6M A;  2YNF A;  3HVR A;  4KPY A;  3C6T A;  5C25 A;  4O0I A;  2HHS A;  1HYV A;  3B6P A;  1Y97 A;  1WSI A;  5FRM A;  4DFK A;  1RT1 A;  3KLI A;  4M3W A;  4AHR A;  1EKE A;  3AVJ A;  4JRP A;  5DK5 A;  4EP4 A;  4KB1 A;  4CJ4 A;  4RW4 A;  3SI6 A;  1R0A A;  2KW4 A;  2XY8 A;  3QIN A;  3V1Q A;  1EP4 A;  1RTI A;  4DFJ A;  1XC9 A;  1YTU A;  1SKW A;  3AA2 A;  4B9U A;  3TAN A;  1IKX A;  1I3A A;  4CF8 A;  4OPJ A;  4KI4 A;  2P51 A;  4KHS A;  1U04 A;  4I2Q A;  4DSF A;  3EZ5 A;  4Z4I A;  4C8N A;  1T03 A;  5JS2 A;  3ZSQ A;  4FJK A;  1ZBH A;  1ITG A;  3SYZ A;  4B3O A;  1B9F A;  4LH5 A;  4HUE A;  4FK4 A;  3OYL A;  3A2F A;  5D3G A;  2IS3 A;  1C1B A;  1RT7 A;  1HJR A;  1X9M A;  4CER A;  5EU7 A;  1BIZ A;  4DF4 A;  1DTT A;  1NK7 A;  4DU4 A;  1WAJ A;  1DTQ A;  3VQA A;  1WAF A;  2YNH A;  3RMC A;  1U49 A;  4DTU A;  4FJ5 A;  5J2P A;  4J2A A;  1NK9 A;  1KCF A;  1QQC A;  1FK9 A;  1NKC A;  2HHV A;  4CIF A;  2OPQ A;  3QIO A;  1DLO A;  2BAN A;  4FJL A;  1Z25 A;  5FDL A;  4BE1 A;  3V81 A;  4E19 A;  3OS2 A;  2B6A A;  4AH9 A;  4AHS A;  1NK8 A;  4CFB A;  4MFB A;  1RBS A;  4DWI A;  4E7K A;  1VRU A;  4KV8 A;  1VSJ A;  1SKR A;  3M8Q A;  3NGZ A;  2VG7 A;  4W5N A;  3V9S A;  5KRS A;  4F2S A;  1JXB A;  1QSS A;  3RR7 A;  4O55 A;  3HVT A;  1TL1 A;  4CHZ A;  1U4B A;  3OJS A;  1BIS A;  4K8X A;  4CK2 A;  3OYB A;  4IFV A;  4AHV A;  1EET A;  2HHW A;  1D9F A;  3K2P A;  4O4G A;  4CEF A;  4RW8 A;  3OYN A;  3HL8 A;  4BAC A;  3SV4 A;  1Q9Y A;  2WOM A;  3TAP A;  4FK2 A;  2QXF A;  3AVF A;  3WNH A;  1C0M A;  2KFN A;  3ZSX A;  4FZX C;  1LV5 A;  1GOC A;  1BHL A;  1D9D A;  1CZB A;  2XY5 A;  3IS9 A;  1VSI A;  4BWM A;  3ZSR A;  4FM1 A;  1HQU A;  3AO5 A;  1NKE A;  3KK3 A;  1SL0 A;  4KFB A;  3HPO A;  1A5V A;  1VSE A;  2G8H A;  2Y1J A;  4M3T A;  2G8U A;  4E3S A;  1LWC A;  3RRG A;  4ID1 A;  3RTV A;  1YVU A;  4OKJ A;  2IGI A;  4FK0 A;  4F3T A;  3B6O A;  4RW9 A;  3NHG A;  1U45 A;  3O4N A;  3NH2 A;  4FXD A;  4CJU A;  2YHB A;  4JLH A;  2XY6 A;  1RBT A;  3U3Y A;  3TAG A;  3TAE A;  3OYJ A;  4DQP A;  1TV6 A;  4CJF A;  3DLH A;  5CYM A;  4DF8 A;  1BGX T;  3LWM A;  4E7H A;  3LP3 A;  4CHQ A;  1RDA A;  3OYG A;  2HHT A;  4OGE A;  1HNV A;  4HUG A;  4DU3 A;  3QET A;  2Q3S A;  4JS5 A;  3DLK A;  4Y1C A;  2D0A A;  3KLE A;  4HVJ A;  4F4K A;  2O4I A;  3DRS A;  2I5J A;  4M3Z A;  4B9T A;  3ZSY A;  1TVR A;  1I39 A;  4CJV A;  3M8R A;  4DQQ A;  1VRT A;  3HXM A;  3MXI A;  1NJX A;  4FJH A;  3KD5 E;  3TAM A;  4M3X A;  1QHT A;  3TI0 A;  3LP2 A;  2PZS A;  3KIO A;  4H4M A;  1BCO A;  2IC3 A;  3HM9 A;  2G8I A;  3SQ1 A;  3K59 A;  4KHW A;  3KK1 A;  4DTX A;  1RT5 A;  5HRS A;  2YV0 X;  3LZI A;  2A1R A;  1IKY A;  4NYN A;  2JGU A;  3CYM A;  3NH1 A;  3LAN A;  1NK4 A;  2Z1I A;  1S1T A;  2RKI A;  5J2N A;  3HYF A;  4L8R B;  1HRH A;  4IFY A;  3VQB A;  3AVA A;  4FJG A;  1S5J A;  1JXE A;  3VN5 A;  3C95 A;  3VQ4 A;  1IH7 A;  4DSE A;  3QER A;  3S3M A;  5E41 A;  1RBU A;  3LP1 A;  4YFU A;  3CG7 A;  1VSL A;  2Z1J A;  4I9L A;  1C1A A;  2OPS A;  1CZ9 A;  4TSX A;  4I9Q A;  3P5J A;  1K6Y A;  1L5U A;  1IKV A;  4Y1D A;  4N56 A;  4E7I A;  3HST B;  4GW6 A;  3F9K A;  3CFR A;  4DTJ A;  3QEV A;  3S3O A;  3OYA A;  1L3V A;  3QLH A;  3OYI A;  4Q0B A;  4E7J A;  1JLC A;  3MEE A;  1C1C A;  1VSH A;  3TAF A;  2BDP A;  2HMI A;  4FJN A;  4E0D A;  3AV9 A;  3HT3 A;  4LSL A;  4DU1 A;  5HLF A;  4FLT A;  1L3S A;  1TAU A;  4OKK A;  1JLQ A;  4PQU A;  4KKO A;  4KTZ A;  4CFD A;  4DQS A;  4FZY A;  3MED A;  2IOC A;  2NUB A;  2VWK A;  2PYL A;  4FJ8 A;  3ZSV A;  3EYZ A;  4DTN A;  4DMN A;  3PX4 A;  4Z4G A;  2HHX A;  2XO7 A;  1ZBL A;  4DSL A;  3K58 A;  4KHQ A;  5CYQ A;  5FRN A;  3L2R A;  3V4I A;  2HND A;  3OVN A;  4CGD A;  3AO4 A;  2E4L A;  1LW0 A;  1KVC A;  4DLE A;  4FLV A;  2D0C A;  4CF2 A;  3TAB A;  2QKK A;  1NJY A;  3ASM A;  3OY9 A;  1J53 A;  1JLF A;  3ULD A;  2HNZ A;  3HJF A;  3D45 A;  1ASV A;  2Y1I A;  3VQ5 A;  1BI4 B;  2EX3 A;  4IDK A;  3TWH A;  1Q9X A;  4KHU A;  2JLE A;  5SZT A;  2P1J A;  1IO2 A;  1HMV A;  2DFF A;  4CK1 A;  3MEC A;  3NGY A;  1HYZ A;  2XHB A;  4I7F A;  4H8K A;  3LPU A;  3SNN A;  4DTO A;  4PA1 A;  1XHZ A;  1NKB A;  4PUO A;  4M42 A;  1KVA A;  2ATQ A;  3L3U A;  3OYM A;  3BGR A;  3MXJ A;  2F8S A;  2KZM A;  3DM2 A;  4EZ6 A;  4F3O A;  3SUQ A;  4B9N A;  1Q8I A;  4EZ9 A;  1RT3 A;  2WON A;  3AVN A;  3IRX A;  4O44 A;  1S9E A;  3K5M A;  3KKR A;  3HPG A;  4B8C A;  3AVG A;  1BIU A;  4GVM A;  3K57 A;  2R7Y A;  1FXX A;  3PX6 A;  4PWD A;  1W0H A;  3RMB A;  1B9D A;  3ZT2 A;  3CFO A;  3NF7 A;  4AHT A;  4FLW A;  4FLY A;  4DTM A;  1WSE A;  4CEE A;  1VSD A;  3NGI A;  3DYA A;  3AA5 X;  3AO1 A;  3WNF A;  5KTQ A;  3WNG A;  2DY4 A;  2BGG A;  5I3U A;  3MEG A;  3UIQ A;  4FJ7 A;  1C0U A;  3O4Q A;  5C24 A;  3LZJ A;  1B92 A;  3KKS A;  3PUF A;  3H08 A;  1KVB A;  3L2V A;  2ZQB A;  1NJW A;  5HRN A;  4OLA A;  4CHO A;  1QSY A;  1WSF A;  1X9W A;  3V6D A;  1RT6 A;  2HVH A;  3ZSO A;  3SCX A;  1XHX A;  2HHQ A;  4QOZ B;  3VQC A;  1J9A A;  2F8T A;  1ASU A;  1TL3 A;  5T7B A;  1JLB A;  1TKZ A;  5J2M A;  2G8K A;  4CJL A;  4CE9 A;  2FBX A;  1N6Q A;  4DSK A;  4KHY A;  2B4J A;  4FYD A;  4DS5 A;  4ID5 A;  3QNO A;  2ITG A;  4ZHR A;  4H4O A;  2DFE A;  3OYF A;  4E1M A;  2KQ2 A;  3LAK A;  4CJ5 A;  3KD1 E;  1NOY A;  3L2U A;  4CJT A;  4CHN A;  4O5B A;  2FBT A;  4FVM A;  2RPI A;  2GBZ A;  4B8A B;  3KJV A;  4CF1 A;  1BL3 A;  4M3R A;  3SV3 A;  1WNS A;  3V1R A;  2X78 A;  4CEO A;  3U6F A;  3HK2 A;  1KLN A;  1C0T A;  5HRR A;  3PO5 A;  4DLG A;  3DOK A;  1JLE A;  1T8E A;  1SKS A;  2YKM A;  3IG1 A;  2IAJ A;  1LWF A;  4DQI A;  3ZT1 A;  4JRQ A;  3NE6 A;  4LSN A;  3QNN A;  4BDZ A;  1HNI A;  3G10 A;  5SWM A;  4XIU A;  3NDK A;  4DTR A;  1NK6 A;  1KLM A;  3AVH A;  1EXQ A;  2B5J A;  4E7L A;  3I8D A;  2VWJ A;  3OYK A;  3QEP A;  1RTD A;  3VA3 A;  1S1V A;  1IKW A;  4CJQ A;  3EY1 A;  1BQN A;  2ETJ A;  3RMA A;  1RT2 A;  4M41 A;  3TAR A;  1D5A A;  5CY4 A;  1L3U A;  4LD0 A;  3VQD A;  1JL1 A;  1TAQ A;  4CJ3 A;  4OVL A;  1BI4 A;  4UQG A;  3LDS A;  4FJ9 A;  2LSN A;  2FBY A;  3TAQ A;  2P5O A;  1S1U A;  4RW6 A;  2HHU A;  3OS1 A;  1RDC A;  3DRP A;  1TKX A;  4KTW A;  4N5S A;  4FLU A;  3ZSW A;  1X9S A;  2FC0 A;  2KTQ A;  3C6U A;  4C8M A;  3DLR A;  3AA3 A;  3NFA A;  4CJS A;  5FRO A;  3T19 A;  2E6L A;  3VQ8 A;  4CIG A;  1KFD A;  4DG1 A;  3O3F A;  3V9X A;  1VSK A;  4NYF A;  4CIE A;  1D8Y A;  1JKH A;  3RR8 A;  2OZM A;  1KRP A;  2XRI A;  3O3H A;  2VG5 A;  2XY7 A;  1MU2 A;  1ZYQ A;  1XWL A;  3K5N A;  2HNY A;  3K5L A;  1WSH A;  3QEX A;  4HUF A;  2P5G A;  3VQQ A;  1RBV A;  4CGJ A;  4ZTJ A;  4DSI A;  4HCB A;  3JSM A;  4ZTF A;  4GMJ B;  3KLF A;  4NCB A;  1IG9 A;  3AVL A;  3L2W A;  2OPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...