1A5XA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
molecule keywords INTEGRASE
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5xA00
2QK9A 3HVTA 1MU2A 3AO2A 1N6QA 1ZBHA 3DLGA 5KTQA 4FVMA 1R0AA 4DSKA 3C6TA 2R7YA 2DTUA 1KTQA 1X9MA 3O4QA 4JLHA 4FJ8A 3ZT2A 1LAVA 3HT3A 1RTIA 4PA1A 5J2PA 4HUEA 1NJWA 1RBUA 2GV9A 2YNFA 4CEZA 4EP5A 2HMIA 4I9QA 4IG0A 2BDPA 4J2BA 1KVCA 1KLMA 4DFMA 1I3AA 1JL1A 4IKFA 3VQAA 4CEEA 3NE6A 2LSNA 3EZ5A 1QSLA 4AHCA 3O3FA 4DTUA 2Y1IA 4F3OA 2QKKA 4KHNA 4AHRA 4F8RA 1RNHA 2HHTA 3LZIA 4NYFA 1TK5A 4N41A 3FFIA 3I0SA 4FJLA 3PUFA 1NOZA 1TKXA 3ZCMA 3NGZA 3THVA 3CG7A 4AHTA 4N5SA 4DQQA 3LALA 4IG3A 2OPSA 4DMNA 1VSEA 1JLCA 4CEQA 3BDPA 4C8OA 2AJQA 4KHSA 4M3XA 3KLEA 1NKEA 3QETA 2OA8A 3MAQA 3SV3A 3SUPA 3OYBA 3SUQA 4B8CA 3RMDA 3HXMA 4DF4A 3RWUA 3SPZA 1FKPA 2XY6A 4G1QA 3TAEA 4TSXA 2BE2A 4MFBA 4Z4GA 3VQCA 2DFFA 4RW6A 4KV8A 3LAKA 5C25A 2YHBA 4M3UA 1RDAA 5I42A 4BWMA 3AVHA 4N56A 4KAZA 4FM2A 1GOCA 3ZSOA 4JRPA 1DTTA 1ASVA 2DFHA 3A2FA 4CCHA 3QIPA 4RW4A 4BWJA 3AO4A 4CF8A 3ITHA 1JL2A 2RKIA 4CECA 4CGGA 4Z4HA 4DFJA 4EZ6A 4DFKA 2HNDA 1RT7A 4AHVA 3AVGA 4QOZB 2EHGA 3L2WA 1TVRA 5KGXA 3L2QA 4E7HA 4NYNA 2Y1JA 4CJUA 3OYJA 4RG8A 3NF7A 3KK2A 2YKNA 3HPOA 3AA3A 1HYZA 4E89A 3MEGA 1QSYA 2XO7A 3QNNA 4OKJA 1SUQA 4I2PA 4KI4A 3TAQA 3NH0A 3TWHA 4DF8A 4UQGA 1S6PA 4GMJB 3CFRA 1BI4A 3AVJA 2X6SA 4DU3A 4K8ZA 1QSSA 2PY5A 2YNHA 4KI6A 4F3TA 4YNQA 3E01A 4W5QA 1KFSA 3I8DA 3K5MA 1NJYA 1O1WA 3OYEA 2D0AA 4KFBA 1JLEA 2B6AA 4JS5A 3PO4A 3OYDA 3KJVA 4DSFA 3QIOA 5SZTA 5J1EA 4H4OA 3NH1A 1S1XA 3LP0A 2KFNA 3SPYA 1LV5A 4HTUA 1QTMA 3TI0A 4NCBA 4JRQA 5K14A 1UOCA 5C42A 3QINA 4CE9A 1KFDA 5I3UA 4FK2A 4F2SA 4GW6A 3AA4A 5FDLA 2X78A 4LD0A 1VSJA 4DTSA 3TARA 4JS4A 3SYZA 4BDPA 1WSJA 1RT2A 2IS3A 4H8KA 3OYHA 1S9EA 1BHLA 3U6FA 2HHWA 4H4MA 3T19A 1WSIA 3VQ4A 5J2MA 3LZJA 2QKBA 1SL2A 3NDKA 3MXIA 1L5UA 3V1RA 1VSHA 2OZSA 4J2AA 3EY1A 3NAEA 4DTMA 4OLBA 3IS9A 1CXUA 5CYQA 2D0BA 4CJ5A 2DFEA 4Z4EA 1JLAA 2XHBA 4CEDA 2E6MA 3K2PA 3RMAA 4M3RA 2IGIA 1HNVA 3LPUA 3VN5A 1LW0A 3HK2A 2D5RA 2HW3A 3OYMA 1TK8A 1HYVA 4FJJA 2XY8A 1U49A 1TKTA 1LAWA 3SQ1A 3QO9A 4NCGA 4M45A 3D0PA 3AA2A 3VQ5A 4CIGA 1X9WA 1VRUA 3SI6A 3K5NA 4E7JA 5D3GA 1HQUA 1BQMA 3L3VA 1B92A 2IC3A 2G8VA 1WSGA 4HVJA 3OYAA 1NK4A 1D9FA 1XC9A 3PY8A 2B4JA 3ALYA 1Q9XA 1KRPA 1A5WA 1CZBA 1KVBA 2RN2A 4M41A 4FZYA 2YHAA 4FJIA 1RBTA 4CGJA 2E6LA 4ELUA 3VQQA 3KK1A 3WNFA 4PQUA 3V81A 2ETJA 4OGEA 4M3YA 1J5OA 1X1PA 1IH7A 1BI4B 3ZSRA 1HNIA 4ZHRA 3OY9A 3HJFA 2G8KA 4MQ3A 3IAYA 2P1JA 4RW9A 2HVHA 3QERA 3HPHA 5HROA 1RTJA 2YNGA 1G15A 3V9WA 1SV5A 3VQDA 4ELVA 3ZSVA 1Z25A 5HRNA 3SQ0A 4ZTFA 1RT5A 3LANA 1ZBIA 4CJ4A 1RBRA 1WN7A 1WNSA 2Z1GA 3ZT3A 4EZ9A 3K5OA 3VQBA 3HPGA 3SZ2A 1ASWA 4ID1A 3ZSXA 3ZT1A 2P5GA 2HHXA 2ZQBA 4B9UA 1C6VA 4FK0A 1KCFA 3SQ2A 3LWMA 1TK0A 1DLOA 2KQ2A 4E1MA 3AO1A 3L3UA 1HPZA 1JLQA 4CGHA 2Q3SA 4W5NA 2GBZA 2VWJA 4HUGA 3SCXA 4L8RB 4KHYA 1CLQA 2OPQA 3NGIA 3AVBA 3I0RA 4DG1A 4B9SA 1TV6A 3HSTB 4OKKA 2BANA 5HP1A 2NUBA 5HRSA 1U4BA 1YTAA 5CZ1A 1D9DA 1BCOA 1BISA 3KIOA 4FW2A 3DMJA 4CFCA 1BL3A 1S9GA 3KLIA 4W5RA 1IG9A 3VQPA 4J2EA 2A1SA 1HJRA 1HQEA 4W5OA 4GVMA 3OYGA 1S1TA 4ID5A 1C1CA 4ICLA 4B9VA 2EX3A 1U04A 3IRXA 4QAGA 4PUOA 4FK4A 4CJPA 1TAQA 3PX4A 4OGCA 4M3ZA 4Y1DA 1UWBA 2JGUA 3JYTA 3TAPA 4DLEA 1HMVA 1WSHA 2XRIA 4CF0A 3RMBA 3TANA 1NKBA 3L8BA 1WSEA 4W5TA 1JLBA 1S1WA 3LDSA 5FRMA 3RRGA 3C6UA 5J2NA 1NK5A 5DMRA 3OS0A 3KLHA 4FXDA 3TAMA 4BE1A 1XHZA 1KSPA 3DOKA 3V1OA 3VQ9A 4FLWA 4CJRA 2G8HA 1RDCA 1C0MA 1RDBA 4FJ5A 3TR8A 1FXXA 3MEEA 4QCLA 3F9KA 2YV0X 4DTXA 4FJXA 2G8FA 2KFZA 1RT6A 1Y97A 1C1AA 1NK9A 1BQNA 1XWLA 3F73A 4LH4A 1ZBFA 4OPKA 4HHTA 4O0IA 4ZTJA 5DK5A 1WAFA 3ZSQA 3SUNA 3RRHA 1NK0A 3KD5E 2W42A 2HHUA 4E7IA 2XY7A 4LSLA 3WNEA 3V9SA 4DSIA 4OJRA 2FBYA 1RTHA 4DTPA 3MECA 3VQ7A 1XI1A 3HP6A 1GOBA 3P1GA 1EP4A 3BGRA 4DFPA 3P83D 5CZ2A 4XIUA 3DLHA 4N76A 2KZMA 3SNNA 2OPRA 3OYIA 4YFUA 1YTUA 2ATQA 2FBXA 3CQ8A 1JXBA 4FM0A 4KPYA 3HO1A 4CF1A 4E19A 4KRFA 1LWCA 5KRTA 4DQSA 2ZD1A 4B8AB 4Z4CA 4OKEA 2GUIA 3K5LA 1L3UA 3TABA 4FJNA 1VRTA 3ISNC 4I2QA 2PZSA 3KKRA 2F8TA 4DTOA 1C0TA 1EETA 1BCMA 1REVA 4CIEA 3HVRA 3NHGA 2OYQA 4O44A 3T1AA 3OS1A 2F96A 3KKSA 5FROA 4BE2A 3IG1A 3V9XA 1S1UA 3ZSYA 3OJSA 4CJLA 5T7BA 3TAGA 3AVMA 4HCCA 3QEWA 4KB1A 1VSIA 4FLTA 4E3SA 4FJ7A 3B6OA 2E4LA 3WNGA 4CHPA 1GOAA 3VA0A 4DTNA 1RT4A 1DTQA 5J2QA 5HLFA 1NJXA 1L3TA 3OYNA 3AVFA 1W0HA 3MEDA 1ZBUA 2IAJA 4C8LA 1FK9A 5HBMA 3KTQA 3CFPA 1B9FA 2P51A 1NK8A 1WAJA 3TAFA 3NF6A 4CJKA 3LP1A 3T3FA 3QESA 4KTZA 2Z1HA 4Y1CA 3DLEA 4Z4IA 3AVKA 4AILC 3WNHA 1CXQA 2OPPA 1RCHA 2Z1JA 1RDDA 4CFBA 3ASMA 1NK6A 4OLAA 1WSFA 3QLHA 1XHXA 4CFDA 3H08A 2HHSA 4J2DA 3NF9A 1U45A 3UIQA 4KTQA 1VK0A 4KTWA 2VG5A 4FLYA 2I5JA 3RR7A 3L2RA 4O4GA 4K8XA 4KHWA 1JLFA 3LAMA 2DY4A 2X74A 4ELTA 3SUOA 4CF2A 4CJVA 5C24A 4CIFA 2FC0A 3OYFA 4B08A 4LH5A 5FRNA 4FLZA 1SL0A 2F8SA 3DM2A 1SKRA 4OVLA 1T8EA 3C95A 4FJ9A 5JS2A 1RT1A 3S3MA 4B9LA 3EYZA 1J53A 1QS4A 4DS4A 1L3SA 4DWIA 4DTRA 1VSDA 3AVAA 3DLKA 3RR8A 3LP3A 4CJWA 1Q8IA 3SQ4A 2O4GA 2HNYA 2IOCA 4C8MA 3U3YA 3L2UA 4B9TA 1RTDA 4FCYA 4CHZA 4CESA 1TAUA 1ZYQA 1ITGA 5SWMA 1LW2A 5KRSA 3D45A 3AVLA 2VG7A 5E41A 3AVCA 4IFYA 4CGDA 4DQIA 3OYCA 1RBVA 2HHQA 3CYMA 1QHTA 1UAXA 3B6PA 4LSNA 1HYSA 1TL3A 4CHYA 4DU1A 1J9AA 4O55A 3RMCA 3JSMA 1S1VA 2YNIA 3VQ8A 3V4IA 1LWEA 5CYMA 3OYLA 3DYAA 1S5JA 4FJGA 4WE1A 3OVNA 2PYLA 1B9DA 3AV9A 3DLRA 5HRPA 1C1BA 2O4IA 1RILA 4AHUA 4FJKA 3LWLA 1YVUA 2WOMA 1C0UA 3AVNA 4DQRA 3KD1E 5JS1A 4EP4A 4DQPA 3CM6A 1N5YA 3C94A 1X9SA 2P5OA 3AVIA 5HRRA 3NBPA 3U3GA 2KW4A 2YKMA 4CJEA 1BGXT 4CEAA 4CGIA 3OS2A 3QEIA 1JLGA 2X6NA 2PYJA 2G8IA 5EU7A 1NOYA 2B5JA 3SJJA 3VA3A 2D0CA 4FLXA 3PX6A 1SKSA 1T03A 4HCBA 4FZXC 3PV8A 4RW8A 4CEOA 4CJSA 3VQ6A 4AH9A 3O3GA 3L2VA 1L3VA 4M3WA 4CK3A 2HHVA 1VSLA 4KO0A 1JKHA 1BIUA 1TKZA 2HNZA 3NH2A 1NJZA 4F4KA 4PY5A 1A5VA 4HUFA 3P5JA 4DLGA 4CF9A 4FM1A 1T7PA 4CHQA 2BGGA 1EKEA 2ITGA 3ZSWA 3PO5A 1U47A 4O0JA 4FLVA 1IKWA 3O4NA 4CJ3A 1QQCA 3LPTA 4I7FA 4BDYA 1NKCA 4NCAA 3HM9A 3LP2A 2VWKA 1IKXA 1D5AA 4FW1A 3K57A 3ULDA 3V9UA 1D8YA 4E7KA 4AHSA 4OPJA 4FJMA 4CGFA 4DSEA 3M8PA 4B9NA 3MXMA 1UA1A 4KB0A 3HYFA 2G8UA 1Q9YA 4B9MA 3SV4A 1VSFA 4CERA 1NK7A 1LWFA 4DU4A 2WONA 3V1QA 4E0DA 3KK3A 3ZSZA 1I39A 1RT3A 2G8WA 3QEXA 3DLBA 2FBTA 3S3OA 2XY5A 4CJTA 2HB5A 1SKWA 3HL8A 4FZZA 1IKVA 3V9ZA 4KREA 3QNOA 3G0ZA 4DSJA 4CHOA 4CK2A 1BIZA 4IFVA 2RPIA 1TGOA 4Z0UA 3M8SA 4DSLA 1A5XA 2IDOA 4Q5VA 3M8RA 4M3TA 4IDKA 1Z26A 1EXQA 2ZE2A 3O3HA 1CZ9A 4LY7A 4FYDA 1FKOA 3PX0A 1J54A 4CK1A 4BE0A 1VSMA 1UA0A 3QEPA 4C8KA 1KVAA 4C8NA 3MXJA 2KZZA 3V6DA 1U48A 1ZBLA 3AA5X 4R5PA 4KHUA 4N47A 1JXEA 1QE1A 3DI6A 3QEVA 3S9HA 4RW7A 3K58A 4KHQA 5KI6A 4FLUA 3AO3A 3DRSA 4CFAA 4BACA 4DTJA 4IBNA 4I9LA 1HRHA 4E7LA 3CM5A 3DRPA 4O5BA 3VQEA 4F2RA 3ZT0A 3DOLA 4FJHA 4M42A 4B3OA 1IO2A 5KGWA 3G10A 3NF8A 1TKDA 4PWDA 3RTVA 1K6YA 4CHNA 1F21A 1W9HA 4Q0BA 1TL1A 4E1NA 4Z4FA 3OJUA 1VSKA 2OZMA 2QXFA 3ZT4A 3S3NA 2JLEA 1S6QA 4CJQA 1KLNA 5CY4A 1T05A 3M8QA 1YT3A 3DRRA 1SL1A 2Z1IA 2VG6A 4BDZA 2FBVA 1WLJA 1RBSA 1ASUA 4CEBA 3CFOA 4CJFA 3KLFA 3NGYA 3HP9A 2RF2A 1IKYA 2KTQA 3OYKA 4KKOA 4CEFA 3NCIA 3NFAA 4DS5A 2HVIA 1EX4A 2A1RA 3K59A 3KLGA 3AO5A
chains in the Genus database with same CATH superfamily
4XH5A 4ILJA 2QK9A 4JI2K 3I33A 4DSKA 4MO4A 3ZETA 4EHTA 2NRVA 3O4QA 4B3TK 1RTIA 4PA1A 1YHQN 2YNFA 4CEZA 2HMIA 2NRRA 4IG0A 4I9QA 2BDPA 4J2BA 4LFBK 4DFMA 4FSVA 4BQZA 4IOCL 3O3FA 2Y1IA 4LF4K 2ASMA 4WQ5A 3OBYA 3PUFA 1SQKA 1NOZA 3THVA 2UU9K 3CG7A 4FWPA 3O8MA 3FGUA 1S22A 4AHTA 4N5SA 2QEXN 5CR4A 3MWTA 4C8OA 4M3XA 2E2QA 3OYBA 4B8CA 3RMDA 4G1QA 3TAEA 4TSXA 4MFBA 3Q7CA 2F4VK 4KV8A 5C25A 1VQ8N 4M3UA 4N56A 4FM2A 4JRPA 4B3RK 2DFHA 4RW4A 1LCUA 3ITHA 1JL2A 1YJNN 4AHVA 1HLUA 4QOZB 2EHGA 4NO7A 3O08A 3L2WA 1TVRA 3KK7A 2VGNA 4IEEA 1HKCA 4QS9A 3OYJA 3KK2A 2YKNA 2KKZA 3A5NC 3W0LA 2JWKA 3MDQA 2QWLA 3F5TA 3QNNA 1SUQA 4I2PA 3NH0A 1S6PA 4GMJB 1BI4A 3VGLA 4K8ZA 1M1KO 4JHDA 1Q18A 3I8BA 3E01A 4YNQA 4IFEA 3I8DA 4IO9L 2B6AA 3OYDA 3KJVA 4DSFA 4CZIA 2CH6A 5J1EA 4WQ5C 1S1XA 4DV4K 5EY4A 1TUUA 3G25A 4GW6A 5FDLA 2X78A 1RT2A 4H8KA 4H4MA 1WSIA 5GIPA 4DV0K 4MDBA 1SL2A 4YOTA 3MXIA 3ATUA 3V1RA 1VSHA 2PFUA 1VQON 2UXCK 2D0BA 4Z94A 3GG4A 2ZF5O 1JLAA 4H5NA 3UKUA 1W97L 3RMAA 4JYAK 3OYMA 4MLEA 3SQ1A 3M3ZA 2A42A 1MWKA 4BR7A 4JI8K 3L3VA 2G8VA 3UKUB 3OYAA 3PY8A 1T44A 4NLBA 2B4JA 3ALYA 1KRPA 3TTCA 3ULEB 1KVBA 3LDNA 2YHAA 4CZFA 2ETJA 4OGEA 3J80O 4M3YA 3HJFA 1Q81O 1NGGA 4WFBL 3QERA 1X9JA 2YHWA 1VAZA 4FWMA 1Z25A 2Q36A 3FLCO 1ZBIA 4CJ4A 1WN7A 3N4PA 3HPGA 2ZQBA 3C0BA 3L3UA 4CGHA 5AZIB 4W5NA 2GBZA 1EQYA 4HUGA 4KHYA 5FPNA 4GKJK 4BRGA 2OPQA 4BRIA 3MN5A 2FXUA 4DG1A 1YITN 1TV6A 4DCHA 4WFAL 3FE1A 4BRMA 2BANA 2O8BA 3FZMA 5HRSA 1BA1A 4DUZK 2OCEA 2YI1A 3DMJA 3VQPA 1HJRA 3WXLA 4BRKA 1S1TA 4ID5A 4ICLA 5TKYA 2Q1NA 4PUOA 1QZ5A 4Y1DA 3JYTA 3H3OB 3THXA 4BR9A 4DLEA 1QVFM 3NMUA 1NKBA 5C12A 4DV2K 3LDSA 2P9UA 5FRMA 3O80A 4JI7K 1NGBA 3D2EA 5DMRA 2CGKA 1LOTB 4FXDA 3TAMA 4BGBA 4U67L 1C0MA 4FJ5A 3UKRA 3TR8A 5BN8A 3RSEB 4DTXA 1C1AA 3F73A 4LH4A 1ZBFA 4ZTJA 1TYQA 1YAGA 2QM1A 1J5EK 1NK0A 4K41A 5JLHA 4E7IA 3V9SA 4OJRA 1RTHA 3MECA 3VQ7A 4DFPA 2PBDA 3P83D 4JKHA 1HNXK 5BRDA 4YFUA 2ATQA 5IT9O 1JXBA 4KPYA 4FWNA 3HO1A 2OANA 5DM7L 1LWCA 4DQSA 4B8AB 4OKEA 3TABA 4DTOA 5LJWA 1BCMA 4CIEA 3OS1A 1S3XA 3T69A 3IG1A 1S1UA 4YDUA 5EXWA 4CJLA 1BDGA 2V52B 4AF1A 4HCCA 1VSIA 3B6OA 4CHPA 2KHOA 1DTQA 5HLFA 3A5OC 1W0HA 3DJCA 2H3GX 3P31A 1XC3A 4K0KK 3TAFA 4ISEA 3LP1A 3SAHA 4X64K 3CXCM 3AVKA 1HKBA 4GVEA 1CXQA 1Z6RA 1GLJO 3QLHA 1O13A 3EZWA 4CFDA 3T1HK 4J2DA 5GADP 3G6EN 4K8XA 2W6LA 3LM2A 1JLFA 3MCPA 3CCSN 5FRNA 4LH5A 3L4IA 4OVLA 1T8EA 3C95A 1FJGK 3S3MA 3EYZA 1YXQA 2Q0RA 3R6MA 4DTRA 3RR8A 1OH6A 1Q8IA 2O4GA 2HNYA 3U3YA 4B9TA 1K8KB 2P9SA 5SWMA 4CGDA 5EX5A 1JJ2M 1HYSA 1J9AA 2E20A 3RMCA 3V4IA 5JLFA 4KBOA 4FJGA 3H6EA 2ZM6K 1QQOA 1KC8O 3UE5A 4FJKA 4BVPA 1C0UA 1Y64A 4DQPA 3CM6A 1N5YA 3C94A 1X9SA 5HRRA 3U3GA 3NBPA 5BRFA 2KW4A 3P39A 3ID8A 3QEIA 2PYJA 4A5AA 4FWRA 2B5JA 4JKBA 3SJJA 5I9EB 1SKSA 2PAVA 1T03A 4RW8A 3R3LA 4AH9A 4CZEA 4DKWA 2HHVA 1JKHA 3TSUA 2HHHK 2HNZA 4JKGB 3WQUA 3JS6A 2VQEK 4F4KA 4PY5A 4X62K 4XEIA 2O8BB 3PO5A 4FLVA 5AQNA 3O4NA 3SAGA 2WTUA 1NKCA 4FW1A 1D8YA 5AFUH 1NM1A 4E7KA 4OPJA 4FJMA 4CGFA 3EE9A 3M8PA 4H5RA 4FL9A 2G8UA 1Q9YA 3GBTA 5BPNA 1NK7A 1LWFA 2WONA 3AGRA 1ATNA 1SZ2A 3DXMA 3LM9A 1RT3A 4HTLA 3ZSZA 4DR5K 2G8WA 4LF5K 1SKWA 3HL8A 3THXB 3MX5A 4CHOA 4CK2A 4Z0UA 3H1QA 2IDOA 4Q5VA 3M8RA 3HTVA 1EXQA 4H0TB 4ISGA 1CZ9A 2NRWA 3PX0A 1ATSA 1IG8A 3GDQA 1U48A 1ZBLA 3AA5X 4GKKK 4DR7K 4KHUA 1JXEA 2F9TA 3K58A 4KHQA 4F2RA 4M42A 1IO2A 5KGWA 2GTDA 1K6YA 4CHNA 5AR0A 4AM6A 3NVKA 4Z4FA 1BU6O 1XUPO 1KXPA 3DXKA 4Y0WA 1VSKA 3S3NA 2JLEA 4B1XB 3LDQA 3IKMA 1SL1A 1YJWN 1KAXA 2BH1A 4DS5A 3NCIA 3NFAA 1DEJA 3K59A 5JVHL 4DV6K 3P38A 1MU2A 3AO2A 1ZBHA 5KTQA 5HOOA 3EN9A 4FVMA 1FW6A 3C6TA 3HM8A 4AQYK 3FR0A 4FJ8A 2P9NB 3ZT2A 4YY3K 4BRQA 2ZJRL 5C0YA 1RBUA 4H03B 3K0SA 2D4WA 2IVOA 4IKFA 3VQAA 3EZ5A 1QSLA 4AHCA 1V4TA 2QKKA 2W6KA 4PHTX 2HHTA 5AQQA 1TK5A 4N41A 1WUAA 3FFIA 2UXBK 4FJLA 4QS8A 3H3NO 1XNQK 4DR2K 1NGJA 3THYB 4CEQA 2P9KA 2AJQA 4KHSA 3KLEA 3QETA 4JHDB 4RTFD 3SUQA 3WXKA 1VQNN 1JCFA 2WUSA 4BR2A 3LAKA 4BGAA 2YHBA 2E5LK 1ASVA 3QIPA 4CF8A 1V4SA 5AQJA 3CI5A 4DFKA 4IOXA 1VQ9N 3AVGA 4YOVA 3AAQA 1BUPA 5A2QO 2P9LA 3L2QA 4NYNA 2Y1JA 3U8XA 4CJUA 2V51B 3NF7A 4CZGA 4E89A 4PL7A 1QSYA 2XO7A 3R9PA 4KI4A 3TAQA 3TWHA 4DF8A 4UQGA 3CFRA 1NG9A 3AVJA 4KI6A 2X6SA 1QSSA 5AQZA 4JD2A 1O1WA 1NNEA 3PO4A 3R1XA 4HTUA 1E3MA 4H0YB 4JRQA 4BC4A 3MX2A 4FOIA 5I3UA 4FK2A 3AA4A 1VSJA 4JS4A 3SYZA 3O9QA 5FPEA 4RCHA 3VQ4A 4CZHA 1NGDA 3VF6A 4WF9L 3NAEA 1G99A 4DTMA 4B3SK 1RDWX 4ILHA 3VEVA 4CJ5A 1SAZA 4CEDA 3K2PA 2IGIA 1LW0A 4I6MB 1HYVA 3CPEA 3QO9A 1VQ6N 4CZMA 4CIGA 1VRUA 1K8AO 3K5NA 4E7JA 1HQUA 3IFRA 1B92A 1NK4A 3O6WA 1XC9A 1XMQK 4FZYA 1OVQA 5AQYA 4CGJA 2V7ZA 3ZETB 4BQLA 3VQQA 5EOYA 3SMPA 3WNFA 4PQUA 5BR8K 4IDHA 1IH7A 3OY9A 4ZHRA 4WQ4C 2G8KA 1P8ZA 4H0PA 3IAYA 2P1JA 3TSQA 5HROA 3V9WA 1SV5A 3ZSVA 5HRNA 3SQ0A 4ZTFA 3WQTA 3LANA 4I6MA 1WNSA 2E2OA 1BOTO 2Z1GA 3ZT3A 2NZTA 1VHXA 3K5OA 3SZ2A 3SJHA 4ID1A 3ZSXA 3ZT1A 3BF1A 1C6VA 2A41A 4DV7K 1KCFA 5AQUA 1TK0A 1DLOA 4EAHD 4E1MA 3AO1A 3BUZB 4CZJA 2Q3SA 3LDOA 4L8RB 1CLQA 3NGIA 3I0RA 4B1YB 3BZCA 3D2FB 4CZKA 4FPBA 1YTAA 1BCOA 1BISA 1X3NA 4KH5A 3KLIA 4J2EA 2A1SA 3BEXA 1C1CA 4B9VA 3B8AX 4DR4K 4OGCA 4M3ZA 1UWBA 2QWRA 3TAPA 2HOEA 4CF0A 4AM7A 5AQOA 1DGKN 4H0VB 4EHUA 3RRGA 4BR4A 2DPNA 3C6UA 5J2NA 3OS0A 3LDLA 1Q86O 1XHZA 1KSPA 5F2RA 3V1OA 3VQ9A 4CJRA 2G8HA 5GAHP 1RDCA 4LF8K 3SK3A 3CCJN 1BQNA 1XWLA 3LDPA 4OPKA 4H0XB 4O0IA 3QFPA 5DK5A 1WAFA 3VEYA 3ZSQA 4C1NK 1Q82O 3RRHA 3CJ9A 2HHUA 4OX9K 3DXKB 4LSLA 2GELA 4JAXA 3BGRA 1BWFO 3HSCA 4JKDA 2JWLA 4XIUA 4N76A 4GV6A 2KZMA 3SNNA 1HR0K 3DXMB 3CQ8A 4CF1A 4E19A 4KRFA 5KRTA 2ZD1A 2GUPA 1L3UA 4FJNA 2GUIA 3GL1A 1VRTA 3ISNC 4I2QA 3VEZA 3KKRA 2F8TA 1C0TA 1EETA 3FFKB 3T1AA 4BC5A 5FROA 3ZSYA 5T7BA 2FF3B 4FJ7A 4E3SA 3VENA 2E4LA 1D9DA 2O8CB 3P4IA 3AVFA 3MEDA 1FK9A 3KZBA 5KPRA 2NRHA 4GY2B 1WAJA 5BN9A 4KTZA 4Z4IA 4AILC 4E1JA 3ASMA 1NK6A 1K73O 4OLAA 4H0OA 1E4FT 3SAFA 1NGAA 4KTQA 1VK0A 3BY5A 1N33K 2I5JA 2HBLA 3L2RA 4YORA 3LAMA 3SUOA 4CJVA 2Q0UA 2FLOA 5C24A 4K25A 4BRDA 1QQMA 4FLZA 4MLHA 1QS4A 1L3SA 4DWIA 1NGFA 4FWOA 1VSDA 4XH4A 2P9LB 2YCHA 3SQ4A 4B1WB 1QZ6A 1TAUA 4CHZA 1CZAN 1U2VA 1E4GT 1HNWK 2VG7A 3MN6A 4DQIA 3CYMA 4LSNA 3ZEUA 1HJOA 3JSMA 4JD2B 1NMDA 4KHPK 4FOEA 3NVMA 3CMAN 4WE1A 3OVNA 4FWKA 3HOSA 4C1NI 1N32K 3O1WA 1OVYA 3R8EA 1RILA 3F2KA 3LWLA 3HOTA 4EP4A 2GWJA 1YI2N 1BGXT 3PIOL 3VF2A 5AQXA 2X6NA 2QA4N 5GAEP 1NOYA 3MN7A 3WXMB 2D0CA 4FLXA 3PX6A 3C6AA 4CEOA 4CJSA 4XH1A 3L2VA 3O3GA 4RWTA 1XNRK 4JN4A 1QHAA 1VSLA 3CJ7A 4KO0A 1TKZA 5HL7L 4HUFA 3G4SN 2FSNA 4FM1A 1T7PA 3T1YK 2O8FA 3J81O 2BGGA 1U47A 1OKJA 4BDYA 3PIPL 1OH5A 3HM9A 2A3ZA 5BRHA 2VWKA 3O9RA 3GE1A 4AHSA 3SBTA 4JNEA 4DSEA 4B9NA 4B9MA 3VEXA 4DU4A 3V1QA 2O8DA 4E0DA 2FBTA 3S3OA 2XY5A 1IKVA 1BIZA 2RPIA 3KVGA 1HPMA 5AZIA 4YOXA 1VSMA 1KVAA 4C8NA 3V6DA 1QE1A 3DI6A 4GNIA 3S9HA 5KI6A 5AFUA 3DRSA 4DTJA 4IBNA 4I9LA 1NWKA 2A40A 4E7LA 2CGJA 4O5BA 4FJHA 1WOQA 4UY8O 4A5BA 1W9HA 1NU0A 4BRHA 3CC4N 3O4WA 3AY9A 2QXFA 5GAGP 1S6QA 4BRPA 1T05A 1YT3A 3M5RA 3U9DA 4BDZA 4CEBA 3KLFA 4CJFA 3NGYA 2FSJA 2YJFA 4LC9B 2I7NA 2HVIA 2A1RA 3BF3A 1DKGD 3HVTA 3G71N 2DTUA 1KTQA 2VWBA 1C0GA 4JLHA 1LAVA 4IZ9A 3EKUA 4HUEA 3E1YA 2GV9A 4EP5A 3WUHA 1JL1A 4CEEA 3NE6A 2LSNA 3PSIA 4NXMK 4DTUA 5LJVA 4F3OA 1J6ZA 4AHRA 4QS7A 1U6ZA 2NNWA 2OTLN 3CC2N 2IVNA 5FPDA 3CQYA 3I0SA 1BO5O 5AZJA 3H45C 3ZCMA 4IXCA 2GEMA 5M1PA 2ZGZA 4DQQA 3LALA 4IG3A 3VETA 1VSEA 1JLCA 3BDPA 4O5FA 1NKEA 2WC9A 5FPMA 3SV3A 3SUPA 4DF4A 3IMXA 3SPZA 2XY6A 1GLDG 5GINA 2BE2A 3VQCA 4JKGA 4RW6A 1JCEA 2CH5A 1H1VA 1ESVA 4BWMA 3ATVA 4BG8A 4PKGA 3I56N 3ZSOA 1DTTA 4NB4A 2RHKA 3A2FA 4BWJA 3AO4A 2RKIA 4DFJA 2HNDA 1RT7A 4OPAA 3SLCA 2QWQA 4BROA 4CJ7A 1MWMA 4E7HA 4RG8A 3HPOA 1HYZA 3MEGA 4OO1J 3S41A 4DU3A 4BG9A 4W5QA 1KFSA 3E9PA 3K5MA 4HWIA 1NJYA 2D0AA 4KFBA 1JLEA 1NJIO 3QIOA 3A5MC 2RE2A 5AQFA 3SPYA 1LV5A 4NCBA 1UOCA 5BPMA 1YIJN 4DTSA 4JK7A 4DV5K 4LF7K 4BDPA 4CD1A 2IS3A 3OYHA 2HHWA 1S9EA 5AQIA 3T19A 2QKBA 3LZJA 4MO5A 4DR1K 3NDKA 1L5UA 2OZSA 5CYQA 4CBXA 2DFEA 2YJEA 4JKCA 4O8KA 3THWB 4M3RA 1HNVA 3LPUA 3VN5A 2D5RA 2HW3A 3ZEUB 1TK8A 3OHRA 4FJJA 2XY8A 1U49A 1TKTA 1LAWA 3CCMN 2NRXA 3MK6A 2HBJA 1X9WA 1R59O 3SI6A 4J8FA 3E9OA 5ELZA 3SMSA 4HVJA 1XQSC 1Q9XA 1A5WA 4M41A 4EIAA 5F0XA 2P9PB 3KK1A 3C65A 3V81A 1J5OA 1X1PA 3ZSRA 1HNIA 4DB3A 3CD6N 2HMPA 4MQ3A 3WXJA 2HVHA 3HPHA 1G15A 4ILGB 4IWVA 3JXUA 1ZC6A 1RT5A 3J7ZO 3ZX2A 4EZ9A 3ZX0A 2GX9A 2P5GA 4B9UA 4CI6A 4FO0A 4FK0A 3SQ2A 3LWMA 1HPZA 3C7NA 3WT0A 1JLQA 1TUYA 3SCXA 2FF6A 3QB0A 4M7XA 3EKSA 3CCUN 3WEEB 2E1YA 4OKKA 4H5VA 1U4BA 3KIOA 1MDUB 4CFCA 4W5RA 5LMNK 4A62A 4W5OA 4GVMA 4X66K 3A0IX 2EX3A 3VERA 1U04A 4FK4A 4BC2A 5BPLA 1TAQA 3VTHA 2QWOA 1WSHA 4BR5A 3RMBA 1N34K 1HNZK 3TPQA 4FVUA 1NGHA 4WYBA 3I55N 3DOKA 4DUYK 4FLWA 3IUCA 1RDBA 1YUWA 3MEEA 3VGKA 1NLVA 2YV0X 5E84A 2KFZA 1RT6A 1Y97A 3ULEA 1NK9A 2P9PA 1RDUA 3EL2A 2W42A 1NGEA 5JICA 2YHXA 1EWRA 1XI1A 3HP6A 3P1GA 1EP4A 5M1QA 3DLHA 3RSEA 3OYIA 3C6HA 1YTUA 2FBXA 3AARA 3D7EO 1GLBG 3HVRA 3NHGA 2OYQA 4O44A 5C10A 2F96A 5BR9A 4BE2A 4CD3A 1VQ5N 5TKWA 2D1KA 4FWLA 4KB1A 4FLTA 1NJXA 1GOAA 3VA0A 1RT4A 1L3TA 3OYNA 4B1VA 4C8LA 4K43A 3KTQA 3CFPA 1B9FA 2P51A 1NK8A 3O9TA 2P9NA 2HSTA 4CJKA 3T3FA 3QESA 2Z1HA 2QWNA 3DLEA 4BR0A 5AQWA 1VQMN 2OPPA 3VMFB 2Z1JA 1RDDA 2J4RA 3FZHA 1U45A 3UIQA 4JI5K 2VG5A 4FLYA 3ZYYX 3RR7A 4OPHA 4KHWA 2X74A 3VOVA 4CF2A 3OYFA 4B08A 3CPWM 1IJJA 2F8SA 1SKRA 2IIRA 4FJ9A 5JS2A 1RT1A 4L3QA 3L6QA 1K9MO 4YOUA 3DLKA 4A2BA 1WBDA 3RVCA 3LP3A 4DV1K 4CJWA 2IOCA 2E88A 1RTDA 2UYTA 4CESA 1ZYQA 1OH7A 2VGMA 3LL3A 5KRSA 5E41A 4IFYA 4CVNE 1RBVA 2HHQA 3B6PA 3MWPA 4JKEA 4KH6A 2QI2A 4O55A 1S1VA 2YNIA 3VQ8A 3OYLA 3DYAA 1NGCA 2PYLA 3CJAA 1B9DA 1IBMK 1C1BA 4DQ8A 3CETA 4AHUA 4H5WA 1YVUA 2WOMA 3AVNA 4JKFA 4DQRA 5AZJB 4FWSA 2P5OA 2YKMA 4KH4A 4CGIA 3OS2A 1JLGA 1W2BM 3CIPA 4IJAA 4HCBA 2ZJQL 3PV8A 2HF4A 3EEQA 2YX6A 1EO1A 4WCEL 5CHIA 2FSKA 4R79A 2E1ZA 1BIUA 5JVGL 5ADXH 1NJZA 3MN9A 2IVPA 3P5JA 4CF9A 3D6RA 4F9OA 4CHQA 1EKEA 2OTJN 2ITGA 4BRFA 3BP8A 3J7YP 1QQNA 2F7TA 1IKXA 3ULDA 3H1VX 5AQHA 3MXMA 1UA1A 3FZKA 1RGIA 1VSFA 4CERA 4LFAK 4CW7B 3QEXA 4CJTA 2HB5A 3V9ZA 4KREA 2O8DB 3KHYA 3D2EB 4IFVA 1ILYA 1BA0A 3O1BA 3WEEA 2P9UB 2WFBA 1I94K 1A5XA 5F1XA 4M3TA 2E2PA 1Z26A 2ZE2A 3O3HA 4A2AA 4CK1A 3QEPA 4C8KA 3MXJA 3SBGA 3QEVA 4M63C 4RW7A 1KQSM 4FLUA 3AO3A 4CFAA 4BACA 4IEIA 5AQVA 4BRCA 4V19S 1DT9A 3CM5A 3DRPA 1WB9A 4YOWA 3ZT0A 4MDAA 3QICA 3G10A 3NF8A 2YHYA 1TL1A 4E1NA 4DR3K 5CY4A 3QMLA 4JI3K 2FBVA 1RBSA 1ASUA 3CCQN 1IKYA 3OYKA 4KKOA 1EX4A 2AP1A 1N6QA 4B1ZA 3DLGA 1R0AA 2R7YA 1X9MA 5M1KA 1IBKK 5AQLA 3U4LA 3HT3A 5J2PA 4CBWA 4X65K 1NJWA 5EVZA 3M1FA 3K9JA 1KVCA 1KLMA 1I3AA 1SS6A 3VEWA 1M90O 4KHNA 2HBMA 3E9LA 4F8RA 4YHHK 1RNHA 3LZIA 4NYFA 1S72N 3VEOA 2W41A 1NMNA 1TKXA 3NGZA 2OPSA 4DMNA 5C2FA 4O8UA 2NRTA 1YVNA 2OA8A 1X3MA 3MAQA 3CHWA 3RWUA 3HXMA 1FKPA 1VQLN 4Z4GA 2DFFA 2W40A 1JCGA 2D0PA 4U7BA 2O8EB 5ADXA 1RDAA 5I42A 3AVHA 4KAZA 2UXDK 1GOCA 4CBUA 4CCHA 3CCRN 1VQ7N 4CGGA 2E2NA 4Z4HA 4CECA 4EZ6A 4BRAA 3DWLA 5C15A 3CQXA 3CF5L 1YJ9N 1ZXOA 5KGXA 4ISFA 3Q7BA 2P9KB 3AA3A 3ENOA 3QBXA 4OKJA 3UKRB 3MCAB 3PLAA 2QWPA 2P9IA 3QDKA 4BREA 3CCVN 3O5BA 2PY5A 2YNHA 4F3TA 2O8CA 3HRGA 4M7YA 3OBWA 5KQDA 3OYEA 4JS5A 4G9ZA 5SZTA 3THWA 4H4OA 3NH1A 3LP0A 2UUAK 2KFNA 5H1SQ 1Z05A 1QTMA 3TI0A 5K14A 5C42A 3A5LC 3QINA 1KFDA 4CE9A 4F2SA 4LD0A 3TARA 1WSJA 2ASOA 3U6FA 1BHLA 1OH8A 1IV0A 5J2MA 3F9MA 1XMOK 4J2AA 4JI1K 5AQGA 3EY1A 4OLBA 2ITMA 3UB5A 2VCPA 1CXUA 3IS9A 4Z4EA 2XHBA 2E6MA 5JMVA 4IJNA 5LMUK 3HK2A 3VTIA 4PKHA 4B3MK 4NCGA 4M45A 3D0PA 3AA2A 3TU5A 3VQ5A 1GLFO 5D3GA 1BQMA 2IC3A 1WSGA 1D9FA 1W7AA 1CZBA 2RN2A 4FJIA 1RBTA 3DLLL 2E6LA 4ELUA 2ZGYA 4JKAA 3CC7N 3CJBA 3J7AP 3VESA 1BI4B 3CCLN 4RW9A 3FZLA 1RTJA 2YNGA 3VQDA 4ELVA 3OA9A 1RBRA 1D4XA 5KPZA 1Q7YO 3CERA 3C7NB 1QVGM 3VQBA 2ASPA 1ASWA 2NRZA 5C2DA 2HHXA 2P9IB 3K9KA 2KQ2A 4LF9K 4BVOA 3VGMA 1GLCG 3QBWA 4YDUC 5AQMA 2VWJA 1C0FA 3O9SA 3AVBA 4B9SA 4GV3A 3HSTB 4WFNL 5HP1A 2NUBA 5CZ1A 2QXLA 4FW2A 2VQFK 1VQKN 1BL3A 1S9GA 2I7PA 3EO3A 1IG9A 1EWQA 4YOYA 1HQEA 2QWMA 3OYGA 4JK8A 1HX1A 4QAGA 3IRXA 4CJPA 3PX4A 1KD1O 2JGUA 5BREA 5AQRA 1HMVA 3TANA 2XRIA 2BUPA 3L8BA 2ZJPL 5LL6Z 3TSPA 1WSEA 4PL8A 4W5TA 1JLBA 1KAZA 1S1WA 3HZ6A 1NK5A 1GLLO 3KLHA 4BE1A 1HKGA 3IDHA 3HI0A 1FXXA 4QCLA 3F9KA 1T6CA 4FJXA 2G8FA 5KPTA 4LF6K 2CGLA 4HHTA 2Q97A 5AQKA 3SUNA 3KD5E 2EWSA 3WNEA 3WXIA 2XY7A 4DSIA 2FBYA 4DTPA 1TYQB 1NGIA 2AA4A 5E26A 1GOBA 5CZ2A 2OPRA 2A5XA 4FM0A 1VQ4N 3JAMO 4PKIA 4Z4CA 3K5LA 2PZSA 1REVA 4DV3K 2D0OA 5FLXO 3KKSA 2QTDA 1IBLK 4DHYA 3V9XA 3OJSA 3TAGA 3AVMA 3QEWA 3WNGA 4DTNA 1KAYA 5J2QA 1ZBSA 1ZBUA 2IAJA 5HBMA 3W3DA 2Q31A 3FZFA 3NF6A 3ENBA 5B8HA 3OW2M 4Y1CA 3N4QA 1U2VB 4JEPA 3WNHA 1GLEG 3DAWA 1RCHA 1K8KA 4CFBA 1WSFA 1XHXA 3H08A 2HHSA 3NF9A 4KTWA 3O9UA 3THYA 4O4GA 5M1FA 2Q2RA 2DY4A 5DM6L 4ELTA 4NXNK 3KWGA 4CIFA 2FC0A 1ATRA 4IO8A 1SL0A 3DM2A 4BRLA 3TTDA 3L4QA 4B9LA 4A57A 1J53A 4DS4A 1YF5L 4BC3A 5CE3A 3AVAA 3MMVA 4C8MA 3L2UA 4FCYA 4JI0K 1ITGA 4WQ4A 2E8AA 1LW2A 4A61A 3D45A 2NLXA 3AVLA 4C23A 3AVCA 3QFUA 3OYCA 1QHTA 1UAXA 1VQPN 1T3VA 5AQSA 1TL3A 4CZLA 4CHYA 4DU1A 4JI4K 1LWEA 3KWIA 5CYMA 1N8RO 3T7ZA 3EE8A 1S5JA 3AV9A 3DLRA 5HRPA 3OTOK 2O4IA 4DR6K 4H5TA 2HF3A 3E66A 3KD1E 3CCEN 5JS1A 2QW9A 1N36K 3AVIA 3PSFA 3AGKA 5AQTA 3L0QA 2O8EA 4CJEA 2G8IA 4CEAA 2UUCK 5EU7A 2F9WA 3VA3A 4FZXC 4JK9A 3A8YA 4B1UB 4B9QA 3VQ6A 1L3VA 4M3WA 3ZLJA 4CK3A 1T6DA 3ENHA 3NH2A 1A5VA 4DLGA 4IOAL 5MLCQ 1WBBA 1RFQA 2V7YA 3VPZA 3ZSWA 4O0JA 1IKWA 4CJ3A 1QQCA 2HBKA 3LPTA 4I7FA 4NCAA 3LP2A 3VF4A 3J8AA 1D5AA 3V9UA 4LFCK 3HBTA 3K57A 2P9SB 2ZWHA 4GV9A 2O8FB 3TTFA 4KB0A 5M1NA 3HYFA 3SV4A 2UUBK 4BRNA 3KK3A 1I39A 3DLBA 4A59A 4NLCA 3CMEN 4FZZA 3CJ1A 1MA9B 3QNOA 3G0ZA 4BY9C 4DSJA 5AJ3K 2VYPA 1NBWA 1TGOA 4FPAA 5KQ8A 3D2FA 3M8SA 4DSLA 4IDKA 3H46O 3ZX3A 4LY7A 4FYDA 1FKOA 1J54A 4BE0A 1UA0A 2KZZA 4R5PA 4N47A 2A6AA 3AAPA 4JI6K 3CJCA 1P90A 3U9ZA 1HRHA 4B3OA 3VQEA 5M1OA 3DOLA 1BG3A 2BTFA 5AQPA 1TKDA 3GOIA 4PWDA 3RTVA 1F21A 3BZKA 1HUXA 2KLAA 4Q0BA 3OJUA 2GWKA 2OZMA 2WBNA 3ZT4A 4EFHA 5IWAK 4JV5K 3M6GA 4CJQA 1KLNA 4K42A 3ID6A 3M8QA 4FWQA 3DRRA 5GIOA 2Z1IA 2VG6A 1GLAG 1WLJA 3CFOA 3HP9A 2RF2A 2KTQA 5LY3A 4CEFA 3KLGA 3AO5A
chains in the Genus database with same CATH topology
2QK9A 3HVTA 1MU2A 3AO2A 1N6QA 1ZBHA 3DLGA 5KTQA 4FVMA 1R0AA 4DSKA 3C6TA 2R7YA 2DTUA 1KTQA 1X9MA 3O4QA 4JLHA 4FJ8A 3ZT2A 1LAVA 3HT3A 1RTIA 4PA1A 5J2PA 4HUEA 1NJWA 1RBUA 2GV9A 2YNFA 4CEZA 4EP5A 2HMIA 4I9QA 4IG0A 2BDPA 4J2BA 1KVCA 1KLMA 4DFMA 1I3AA 1JL1A 4IKFA 3VQAA 4CEEA 3NE6A 2LSNA 3EZ5A 1QSLA 4AHCA 3O3FA 4DTUA 2Y1IA 4F3OA 2QKKA 4KHNA 4AHRA 4F8RA 1RNHA 2HHTA 3LZIA 4NYFA 1TK5A 4N41A 3FFIA 3I0SA 4FJLA 3PUFA 1NOZA 1TKXA 3ZCMA 3NGZA 3THVA 3CG7A 4AHTA 4N5SA 4DQQA 3LALA 4IG3A 2OPSA 4DMNA 1VSEA 1JLCA 4CEQA 3BDPA 4C8OA 2AJQA 4KHSA 4M3XA 3KLEA 1NKEA 3QETA 2OA8A 3MAQA 3SV3A 3SUPA 3OYBA 3SUQA 4B8CA 3RMDA 3HXMA 4DF4A 3RWUA 3SPZA 1FKPA 2XY6A 4G1QA 3TAEA 4TSXA 2BE2A 4MFBA 4Z4GA 3VQCA 2DFFA 4RW6A 4KV8A 3LAKA 5C25A 2YHBA 4M3UA 1RDAA 5I42A 4BWMA 3AVHA 4N56A 4KAZA 4FM2A 1GOCA 3ZSOA 4JRPA 1DTTA 1ASVA 2DFHA 3A2FA 4CCHA 3QIPA 4RW4A 4BWJA 3AO4A 4CF8A 3ITHA 1JL2A 2RKIA 4CECA 4CGGA 4Z4HA 4DFJA 4EZ6A 4DFKA 2HNDA 1RT7A 4AHVA 3AVGA 4QOZB 2EHGA 3L2WA 1TVRA 5KGXA 3L2QA 4E7HA 4NYNA 2Y1JA 4CJUA 3OYJA 4RG8A 3NF7A 3KK2A 2YKNA 3HPOA 3AA3A 1HYZA 4E89A 3MEGA 1QSYA 2XO7A 3QNNA 4OKJA 1SUQA 4I2PA 4KI4A 3TAQA 3NH0A 3TWHA 4DF8A 4UQGA 1S6PA 4GMJB 3CFRA 1BI4A 3AVJA 2X6SA 4DU3A 4K8ZA 1QSSA 2PY5A 2YNHA 4KI6A 4F3TA 4YNQA 3E01A 4W5QA 1KFSA 3I8DA 3K5MA 1NJYA 1O1WA 3OYEA 2D0AA 4KFBA 1JLEA 2B6AA 4JS5A 3PO4A 3OYDA 3KJVA 4DSFA 3QIOA 5SZTA 5J1EA 4H4OA 3NH1A 1S1XA 3LP0A 2KFNA 3SPYA 1LV5A 4HTUA 1QTMA 3TI0A 4NCBA 4JRQA 5K14A 1UOCA 5C42A 3QINA 4CE9A 1KFDA 5I3UA 4FK2A 4F2SA 4GW6A 3AA4A 5FDLA 2X78A 4LD0A 1VSJA 4DTSA 3TARA 4JS4A 3SYZA 4BDPA 1WSJA 1RT2A 2IS3A 4H8KA 3OYHA 1S9EA 1BHLA 3U6FA 2HHWA 4H4MA 3T19A 1WSIA 3VQ4A 5J2MA 3LZJA 2QKBA 1SL2A 3NDKA 3MXIA 1L5UA 3V1RA 1VSHA 2OZSA 4J2AA 3EY1A 3NAEA 4DTMA 4OLBA 3IS9A 1CXUA 5CYQA 2D0BA 4CJ5A 2DFEA 4Z4EA 1JLAA 2XHBA 4CEDA 2E6MA 3K2PA 3RMAA 4M3RA 2IGIA 1HNVA 3LPUA 3VN5A 1LW0A 3HK2A 2D5RA 2HW3A 3OYMA 1TK8A 1HYVA 4FJJA 2XY8A 1U49A 1TKTA 1LAWA 3SQ1A 3QO9A 4NCGA 4M45A 3D0PA 3AA2A 3VQ5A 4CIGA 1X9WA 1VRUA 3SI6A 3K5NA 4E7JA 5D3GA 1HQUA 1BQMA 3L3VA 1B92A 2IC3A 2G8VA 1WSGA 4HVJA 3OYAA 1NK4A 1D9FA 1XC9A 3PY8A 2B4JA 3ALYA 1Q9XA 1KRPA 1A5WA 1CZBA 1KVBA 2RN2A 4M41A 4FZYA 2YHAA 4FJIA 1RBTA 4CGJA 2E6LA 4ELUA 3VQQA 3KK1A 3WNFA 4PQUA 3V81A 2ETJA 4OGEA 4M3YA 1J5OA 1X1PA 1IH7A 1BI4B 3ZSRA 1HNIA 4ZHRA 3OY9A 3HJFA 2G8KA 4MQ3A 3IAYA 2P1JA 4RW9A 2HVHA 3QERA 3HPHA 5HROA 1RTJA 2YNGA 1G15A 3V9WA 1SV5A 3VQDA 4ELVA 3ZSVA 1Z25A 5HRNA 3SQ0A 4ZTFA 1RT5A 3LANA 1ZBIA 4CJ4A 1RBRA 1WN7A 1WNSA 2Z1GA 3ZT3A 4EZ9A 3K5OA 3VQBA 3HPGA 3SZ2A 1ASWA 4ID1A 3ZSXA 3ZT1A 2P5GA 2HHXA 2ZQBA 4B9UA 1C6VA 4FK0A 1KCFA 3SQ2A 3LWMA 1TK0A 1DLOA 2KQ2A 4E1MA 3AO1A 3L3UA 1HPZA 1JLQA 4CGHA 2Q3SA 4W5NA 2GBZA 2VWJA 4HUGA 3SCXA 4L8RB 4KHYA 1CLQA 2OPQA 3NGIA 3AVBA 3I0RA 4DG1A 4B9SA 1TV6A 3HSTB 4OKKA 2BANA 5HP1A 2NUBA 5HRSA 1U4BA 1YTAA 5CZ1A 1D9DA 1BCOA 1BISA 3KIOA 4FW2A 3DMJA 4CFCA 1BL3A 1S9GA 3KLIA 4W5RA 1IG9A 3VQPA 4J2EA 2A1SA 1HJRA 1HQEA 4W5OA 4GVMA 3OYGA 1S1TA 4ID5A 1C1CA 4ICLA 4B9VA 2EX3A 1U04A 3IRXA 4QAGA 4PUOA 4FK4A 4CJPA 1TAQA 3PX4A 4OGCA 4M3ZA 4Y1DA 1UWBA 2JGUA 3JYTA 3TAPA 4DLEA 1HMVA 1WSHA 2XRIA 4CF0A 3RMBA 3TANA 1NKBA 3L8BA 1WSEA 4W5TA 1JLBA 1S1WA 3LDSA 5FRMA 3RRGA 3C6UA 5J2NA 1NK5A 5DMRA 3OS0A 3KLHA 4FXDA 3TAMA 4BE1A 1XHZA 1KSPA 3DOKA 3V1OA 3VQ9A 4FLWA 4CJRA 2G8HA 1RDCA 1C0MA 1RDBA 4FJ5A 3TR8A 1FXXA 3MEEA 4QCLA 3F9KA 2YV0X 4DTXA 4FJXA 2G8FA 2KFZA 1RT6A 1Y97A 1C1AA 1NK9A 1BQNA 1XWLA 3F73A 4LH4A 1ZBFA 4OPKA 4HHTA 4O0IA 4ZTJA 5DK5A 1WAFA 3ZSQA 3SUNA 3RRHA 1NK0A 3KD5E 2W42A 2HHUA 4E7IA 2XY7A 4LSLA 3WNEA 3V9SA 4DSIA 4OJRA 2FBYA 1RTHA 4DTPA 3MECA 3VQ7A 1XI1A 3HP6A 1GOBA 3P1GA 1EP4A 3BGRA 4DFPA 3P83D 5CZ2A 4XIUA 3DLHA 4N76A 2KZMA 3SNNA 2OPRA 3OYIA 4YFUA 1YTUA 2ATQA 2FBXA 3CQ8A 1JXBA 4FM0A 4KPYA 3HO1A 4CF1A 4E19A 4KRFA 1LWCA 5KRTA 4DQSA 2ZD1A 4B8AB 4Z4CA 4OKEA 2GUIA 3K5LA 1L3UA 3TABA 4FJNA 1VRTA 3ISNC 4I2QA 2PZSA 3KKRA 2F8TA 4DTOA 1C0TA 1EETA 1BCMA 1REVA 4CIEA 3HVRA 3NHGA 2OYQA 4O44A 3T1AA 3OS1A 2F96A 3KKSA 5FROA 4BE2A 3IG1A 3V9XA 1S1UA 3ZSYA 3OJSA 4CJLA 5T7BA 3TAGA 3AVMA 4HCCA 3QEWA 4KB1A 1VSIA 4FLTA 4E3SA 4FJ7A 3B6OA 2E4LA 3WNGA 4CHPA 1GOAA 3VA0A 4DTNA 1RT4A 1DTQA 5J2QA 5HLFA 1NJXA 1L3TA 3OYNA 3AVFA 1W0HA 3MEDA 1ZBUA 2IAJA 4C8LA 1FK9A 5HBMA 3KTQA 3CFPA 1B9FA 2P51A 1NK8A 1WAJA 3TAFA 3NF6A 4CJKA 3LP1A 3T3FA 3QESA 4KTZA 2Z1HA 4Y1CA 3DLEA 4Z4IA 3AVKA 4AILC 3WNHA 1CXQA 2OPPA 1RCHA 2Z1JA 1RDDA 4CFBA 3ASMA 1NK6A 4OLAA 1WSFA 3QLHA 1XHXA 4CFDA 3H08A 2HHSA 4J2DA 3NF9A 1U45A 3UIQA 4KTQA 1VK0A 4KTWA 2VG5A 4FLYA 2I5JA 3RR7A 3L2RA 4O4GA 4K8XA 4KHWA 1JLFA 3LAMA 2DY4A 2X74A 4ELTA 3SUOA 4CF2A 4CJVA 5C24A 4CIFA 2FC0A 3OYFA 4B08A 4LH5A 5FRNA 4FLZA 1SL0A 2F8SA 3DM2A 1SKRA 4OVLA 1T8EA 3C95A 4FJ9A 5JS2A 1RT1A 3S3MA 4B9LA 3EYZA 1J53A 1QS4A 4DS4A 1L3SA 4DWIA 4DTRA 1VSDA 3AVAA 3DLKA 3RR8A 3LP3A 4CJWA 1Q8IA 3SQ4A 2O4GA 2HNYA 2IOCA 4C8MA 3U3YA 3L2UA 4B9TA 1RTDA 4FCYA 4CHZA 4CESA 1TAUA 1ZYQA 1ITGA 5SWMA 1LW2A 5KRSA 3D45A 3AVLA 2VG7A 5E41A 3AVCA 4IFYA 4CGDA 4DQIA 3OYCA 1RBVA 2HHQA 3CYMA 1QHTA 1UAXA 3B6PA 4LSNA 1HYSA 1TL3A 4CHYA 4DU1A 1J9AA 4O55A 3RMCA 3JSMA 1S1VA 2YNIA 3VQ8A 3V4IA 1LWEA 5CYMA 3OYLA 3DYAA 1S5JA 4FJGA 4WE1A 3OVNA 2PYLA 1B9DA 3AV9A 3DLRA 5HRPA 1C1BA 2O4IA 1RILA 4AHUA 4FJKA 3LWLA 1YVUA 2WOMA 1C0UA 3AVNA 4DQRA 3KD1E 5JS1A 4EP4A 4DQPA 3CM6A 1N5YA 3C94A 1X9SA 2P5OA 3AVIA 5HRRA 3NBPA 3U3GA 2KW4A 2YKMA 4CJEA 1BGXT 4CEAA 4CGIA 3OS2A 3QEIA 1JLGA 2X6NA 2PYJA 2G8IA 5EU7A 1NOYA 2B5JA 3SJJA 3VA3A 2D0CA 4FLXA 3PX6A 1SKSA 1T03A 4HCBA 4FZXC 3PV8A 4RW8A 4CEOA 4CJSA 3VQ6A 4AH9A 3O3GA 3L2VA 1L3VA 4M3WA 4CK3A 2HHVA 1VSLA 4KO0A 1JKHA 1BIUA 1TKZA 2HNZA 3NH2A 1NJZA 4F4KA 4PY5A 1A5VA 4HUFA 3P5JA 4DLGA 4CF9A 4FM1A 1T7PA 4CHQA 2BGGA 1EKEA 2ITGA 3ZSWA 3PO5A 1U47A 4O0JA 4FLVA 1IKWA 3O4NA 4CJ3A 1QQCA 3LPTA 4I7FA 4BDYA 1NKCA 4NCAA 3HM9A 3LP2A 2VWKA 1IKXA 1D5AA 4FW1A 3K57A 3ULDA 3V9UA 1D8YA 4E7KA 4AHSA 4OPJA 4FJMA 4CGFA 4DSEA 3M8PA 4B9NA 3MXMA 1UA1A 4KB0A 3HYFA 2G8UA 1Q9YA 4B9MA 3SV4A 1VSFA 4CERA 1NK7A 1LWFA 4DU4A 2WONA 3V1QA 4E0DA 3KK3A 3ZSZA 1I39A 1RT3A 2G8WA 3QEXA 3DLBA 2FBTA 3S3OA 2XY5A 4CJTA 2HB5A 1SKWA 3HL8A 4FZZA 1IKVA 3V9ZA 4KREA 3QNOA 3G0ZA 4DSJA 4CHOA 4CK2A 1BIZA 4IFVA 2RPIA 1TGOA 4Z0UA 3M8SA 4DSLA 1A5XA 2IDOA 4Q5VA 3M8RA 4M3TA 4IDKA 1Z26A 1EXQA 2ZE2A 3O3HA 1CZ9A 4LY7A 4FYDA 1FKOA 3PX0A 1J54A 4CK1A 4BE0A 1VSMA 1UA0A 3QEPA 4C8KA 1KVAA 4C8NA 3MXJA 2KZZA 3V6DA 1U48A 1ZBLA 3AA5X 4R5PA 4KHUA 4N47A 1JXEA 1QE1A 3DI6A 3QEVA 3S9HA 4RW7A 3K58A 4KHQA 5KI6A 4FLUA 3AO3A 3DRSA 4CFAA 4BACA 4DTJA 4IBNA 4I9LA 1HRHA 4E7LA 3CM5A 3DRPA 4O5BA 3VQEA 4F2RA 3ZT0A 3DOLA 4FJHA 4M42A 4B3OA 1IO2A 5KGWA 3G10A 3NF8A 1TKDA 4PWDA 3RTVA 1K6YA 4CHNA 1F21A 1W9HA 4Q0BA 1TL1A 4E1NA 4Z4FA 3OJUA 1VSKA 2OZMA 2QXFA 3ZT4A 3S3NA 2JLEA 1S6QA 4CJQA 1KLNA 5CY4A 1T05A 3M8QA 1YT3A 3DRRA 1SL1A 2Z1IA 2VG6A 4BDZA 2FBVA 1WLJA 1RBSA 1ASUA 4CEBA 3CFOA 4CJFA 3KLFA 3NGYA 3HP9A 2RF2A 1IKYA 2KTQA 3OYKA 4KKOA 4CEFA 3NCIA 3NFAA 4DS5A 2HVIA 1EX4A 2A1RA 3K59A 3KLGA 3AO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QK9 A;  3HVT A;  1MU2 A;  3AO2 A;  1N6Q A;  1ZBH A;  3DLG A;  5KTQ A;  4FVM A;  1R0A A;  4DSK A;  3C6T A;  2R7Y A;  2DTU A;  1KTQ A;  1X9M A;  3O4Q A;  4JLH A;  4FJ8 A;  3ZT2 A;  1LAV A;  3HT3 A;  1RTI A;  4PA1 A;  5J2P A;  4HUE A;  1NJW A;  1RBU A;  2GV9 A;  2YNF A;  4CEZ A;  4EP5 A;  2HMI A;  4I9Q A;  4IG0 A;  2BDP A;  4J2B A;  1KVC A;  1KLM A;  4DFM A;  1I3A A;  1JL1 A;  4IKF A;  3VQA A;  4CEE A;  3NE6 A;  2LSN A;  3EZ5 A;  1QSL A;  4AHC A;  3O3F A;  4DTU A;  2Y1I A;  4F3O A;  2QKK A;  4KHN A;  4AHR A;  4F8R A;  1RNH A;  2HHT A;  3LZI A;  4NYF A;  1TK5 A;  4N41 A;  3FFI A;  3I0S A;  4FJL A;  3PUF A;  1NOZ A;  1TKX A;  3ZCM A;  3NGZ A;  3THV A;  3CG7 A;  4AHT A;  4N5S A;  4DQQ A;  3LAL A;  4IG3 A;  2OPS A;  4DMN A;  1VSE A;  1JLC A;  4CEQ A;  3BDP A;  4C8O A;  2AJQ A;  4KHS A;  4M3X A;  3KLE A;  1NKE A;  3QET A;  2OA8 A;  3MAQ A;  3SV3 A;  3SUP A;  3OYB A;  3SUQ A;  4B8C A;  3RMD A;  3HXM A;  4DF4 A;  3RWU A;  3SPZ A;  1FKP A;  2XY6 A;  4G1Q A;  3TAE A;  4TSX A;  2BE2 A;  4MFB A;  4Z4G A;  3VQC A;  2DFF A;  4RW6 A;  4KV8 A;  3LAK A;  5C25 A;  2YHB A;  4M3U A;  1RDA A;  5I42 A;  4BWM A;  3AVH A;  4N56 A;  4KAZ A;  4FM2 A;  1GOC A;  3ZSO A;  4JRP A;  1DTT A;  1ASV A;  2DFH A;  3A2F A;  4CCH A;  3QIP A;  4RW4 A;  4BWJ A;  3AO4 A;  4CF8 A;  3ITH A;  1JL2 A;  2RKI A;  4CEC A;  4CGG A;  4Z4H A;  4DFJ A;  4EZ6 A;  4DFK A;  2HND A;  1RT7 A;  4AHV A;  3AVG A;  4QOZ B;  2EHG A;  3L2W A;  1TVR A;  5KGX A;  3L2Q A;  4E7H A;  4NYN A;  2Y1J A;  4CJU A;  3OYJ A;  4RG8 A;  3NF7 A;  3KK2 A;  2YKN A;  3HPO A;  3AA3 A;  1HYZ A;  4E89 A;  3MEG A;  1QSY A;  2XO7 A;  3QNN A;  4OKJ A;  1SUQ A;  4I2P A;  4KI4 A;  3TAQ A;  3NH0 A;  3TWH A;  4DF8 A;  4UQG A;  1S6P A;  4GMJ B;  3CFR A;  1BI4 A;  3AVJ A;  2X6S A;  4DU3 A;  4K8Z A;  1QSS A;  2PY5 A;  2YNH A;  4KI6 A;  4F3T A;  4YNQ A;  3E01 A;  4W5Q A;  1KFS A;  3I8D A;  3K5M A;  1NJY A;  1O1W A;  3OYE A;  2D0A A;  4KFB A;  1JLE A;  2B6A A;  4JS5 A;  3PO4 A;  3OYD A;  3KJV A;  4DSF A;  3QIO A;  5SZT A;  5J1E A;  4H4O A;  3NH1 A;  1S1X A;  3LP0 A;  2KFN A;  3SPY A;  1LV5 A;  4HTU A;  1QTM A;  3TI0 A;  4NCB A;  4JRQ A;  5K14 A;  1UOC A;  5C42 A;  3QIN A;  4CE9 A;  1KFD A;  5I3U A;  4FK2 A;  4F2S A;  4GW6 A;  3AA4 A;  5FDL A;  2X78 A;  4LD0 A;  1VSJ A;  4DTS A;  3TAR A;  4JS4 A;  3SYZ A;  4BDP A;  1WSJ A;  1RT2 A;  2IS3 A;  4H8K A;  3OYH A;  1S9E A;  1BHL A;  3U6F A;  2HHW A;  4H4M A;  3T19 A;  1WSI A;  3VQ4 A;  5J2M A;  3LZJ A;  2QKB A;  1SL2 A;  3NDK A;  3MXI A;  1L5U A;  3V1R A;  1VSH A;  2OZS A;  4J2A A;  3EY1 A;  3NAE A;  4DTM A;  4OLB A;  3IS9 A;  1CXU A;  5CYQ A;  2D0B A;  4CJ5 A;  2DFE A;  4Z4E A;  1JLA A;  2XHB A;  4CED A;  2E6M A;  3K2P A;  3RMA A;  4M3R A;  2IGI A;  1HNV A;  3LPU A;  3VN5 A;  1LW0 A;  3HK2 A;  2D5R A;  2HW3 A;  3OYM A;  1TK8 A;  1HYV A;  4FJJ A;  2XY8 A;  1U49 A;  1TKT A;  1LAW A;  3SQ1 A;  3QO9 A;  4NCG A;  4M45 A;  3D0P A;  3AA2 A;  3VQ5 A;  4CIG A;  1X9W A;  1VRU A;  3SI6 A;  3K5N A;  4E7J A;  5D3G A;  1HQU A;  1BQM A;  3L3V A;  1B92 A;  2IC3 A;  2G8V A;  1WSG A;  4HVJ A;  3OYA A;  1NK4 A;  1D9F A;  1XC9 A;  3PY8 A;  2B4J A;  3ALY A;  1Q9X A;  1KRP A;  1A5W A;  1CZB A;  1KVB A;  2RN2 A;  4M41 A;  4FZY A;  2YHA A;  4FJI A;  1RBT A;  4CGJ A;  2E6L A;  4ELU A;  3VQQ A;  3KK1 A;  3WNF A;  4PQU A;  3V81 A;  2ETJ A;  4OGE A;  4M3Y A;  1J5O A;  1X1P A;  1IH7 A;  1BI4 B;  3ZSR A;  1HNI A;  4ZHR A;  3OY9 A;  3HJF A;  2G8K A;  4MQ3 A;  3IAY A;  2P1J A;  4RW9 A;  2HVH A;  3QER A;  3HPH A;  5HRO A;  1RTJ A;  2YNG A;  1G15 A;  3V9W A;  1SV5 A;  3VQD A;  4ELV A;  3ZSV A;  1Z25 A;  5HRN A;  3SQ0 A;  4ZTF A;  1RT5 A;  3LAN A;  1ZBI A;  4CJ4 A;  1RBR A;  1WN7 A;  1WNS A;  2Z1G A;  3ZT3 A;  4EZ9 A;  3K5O A;  3VQB A;  3HPG A;  3SZ2 A;  1ASW A;  4ID1 A;  3ZSX A;  3ZT1 A;  2P5G A;  2HHX A;  2ZQB A;  4B9U A;  1C6V A;  4FK0 A;  1KCF A;  3SQ2 A;  3LWM A;  1TK0 A;  1DLO A;  2KQ2 A;  4E1M A;  3AO1 A;  3L3U A;  1HPZ A;  1JLQ A;  4CGH A;  2Q3S A;  4W5N A;  2GBZ A;  2VWJ A;  4HUG A;  3SCX A;  4L8R B;  4KHY A;  1CLQ A;  2OPQ A;  3NGI A;  3AVB A;  3I0R A;  4DG1 A;  4B9S A;  1TV6 A;  3HST B;  4OKK A;  2BAN A;  5HP1 A;  2NUB A;  5HRS A;  1U4B A;  1YTA A;  5CZ1 A;  1D9D A;  1BCO A;  1BIS A;  3KIO A;  4FW2 A;  3DMJ A;  4CFC A;  1BL3 A;  1S9G A;  3KLI A;  4W5R A;  1IG9 A;  3VQP A;  4J2E A;  2A1S A;  1HJR A;  1HQE A;  4W5O A;  4GVM A;  3OYG A;  1S1T A;  4ID5 A;  1C1C A;  4ICL A;  4B9V A;  2EX3 A;  1U04 A;  3IRX A;  4QAG A;  4PUO A;  4FK4 A;  4CJP A;  1TAQ A;  3PX4 A;  4OGC A;  4M3Z A;  4Y1D A;  1UWB A;  2JGU A;  3JYT A;  3TAP A;  4DLE A;  1HMV A;  1WSH A;  2XRI A;  4CF0 A;  3RMB A;  3TAN A;  1NKB A;  3L8B A;  1WSE A;  4W5T A;  1JLB A;  1S1W A;  3LDS A;  5FRM A;  3RRG A;  3C6U A;  5J2N A;  1NK5 A;  5DMR A;  3OS0 A;  3KLH A;  4FXD A;  3TAM A;  4BE1 A;  1XHZ A;  1KSP A;  3DOK A;  3V1O A;  3VQ9 A;  4FLW A;  4CJR A;  2G8H A;  1RDC A;  1C0M A;  1RDB A;  4FJ5 A;  3TR8 A;  1FXX A;  3MEE A;  4QCL A;  3F9K A;  2YV0 X;  4DTX A;  4FJX A;  2G8F A;  2KFZ A;  1RT6 A;  1Y97 A;  1C1A A;  1NK9 A;  1BQN A;  1XWL A;  3F73 A;  4LH4 A;  1ZBF A;  4OPK A;  4HHT A;  4O0I A;  4ZTJ A;  5DK5 A;  1WAF A;  3ZSQ A;  3SUN A;  3RRH A;  1NK0 A;  3KD5 E;  2W42 A;  2HHU A;  4E7I A;  2XY7 A;  4LSL A;  3WNE A;  3V9S A;  4DSI A;  4OJR A;  2FBY A;  1RTH A;  4DTP A;  3MEC A;  3VQ7 A;  1XI1 A;  3HP6 A;  1GOB A;  3P1G A;  1EP4 A;  3BGR A;  4DFP A;  3P83 D;  5CZ2 A;  4XIU A;  3DLH A;  4N76 A;  2KZM A;  3SNN A;  2OPR A;  3OYI A;  4YFU A;  1YTU A;  2ATQ A;  2FBX A;  3CQ8 A;  1JXB A;  4FM0 A;  4KPY A;  3HO1 A;  4CF1 A;  4E19 A;  4KRF A;  1LWC A;  5KRT A;  4DQS A;  2ZD1 A;  4B8A B;  4Z4C A;  4OKE A;  2GUI A;  3K5L A;  1L3U A;  3TAB A;  4FJN A;  1VRT A;  3ISN C;  4I2Q A;  2PZS A;  3KKR A;  2F8T A;  4DTO A;  1C0T A;  1EET A;  1BCM A;  1REV A;  4CIE A;  3HVR A;  3NHG A;  2OYQ A;  4O44 A;  3T1A A;  3OS1 A;  2F96 A;  3KKS A;  5FRO A;  4BE2 A;  3IG1 A;  3V9X A;  1S1U A;  3ZSY A;  3OJS A;  4CJL A;  5T7B A;  3TAG A;  3AVM A;  4HCC A;  3QEW A;  4KB1 A;  1VSI A;  4FLT A;  4E3S A;  4FJ7 A;  3B6O A;  2E4L A;  3WNG A;  4CHP A;  1GOA A;  3VA0 A;  4DTN A;  1RT4 A;  1DTQ A;  5J2Q A;  5HLF A;  1NJX A;  1L3T A;  3OYN A;  3AVF A;  1W0H A;  3MED A;  1ZBU A;  2IAJ A;  4C8L A;  1FK9 A;  5HBM A;  3KTQ A;  3CFP A;  1B9F A;  2P51 A;  1NK8 A;  1WAJ A;  3TAF A;  3NF6 A;  4CJK A;  3LP1 A;  3T3F A;  3QES A;  4KTZ A;  2Z1H A;  4Y1C A;  3DLE A;  4Z4I A;  3AVK A;  4AIL C;  3WNH A;  1CXQ A;  2OPP A;  1RCH A;  2Z1J A;  1RDD A;  4CFB A;  3ASM A;  1NK6 A;  4OLA A;  1WSF A;  3QLH A;  1XHX A;  4CFD A;  3H08 A;  2HHS A;  4J2D A;  3NF9 A;  1U45 A;  3UIQ A;  4KTQ A;  1VK0 A;  4KTW A;  2VG5 A;  4FLY A;  2I5J A;  3RR7 A;  3L2R A;  4O4G A;  4K8X A;  4KHW A;  1JLF A;  3LAM A;  2DY4 A;  2X74 A;  4ELT A;  3SUO A;  4CF2 A;  4CJV A;  5C24 A;  4CIF A;  2FC0 A;  3OYF A;  4B08 A;  4LH5 A;  5FRN A;  4FLZ A;  1SL0 A;  2F8S A;  3DM2 A;  1SKR A;  4OVL A;  1T8E A;  3C95 A;  4FJ9 A;  5JS2 A;  1RT1 A;  3S3M A;  4B9L A;  3EYZ A;  1J53 A;  1QS4 A;  4DS4 A;  1L3S A;  4DWI A;  4DTR A;  1VSD A;  3AVA A;  3DLK A;  3RR8 A;  3LP3 A;  4CJW A;  1Q8I A;  3SQ4 A;  2O4G A;  2HNY A;  2IOC A;  4C8M A;  3U3Y A;  3L2U A;  4B9T A;  1RTD A;  4FCY A;  4CHZ A;  4CES A;  1TAU A;  1ZYQ A;  1ITG A;  5SWM A;  1LW2 A;  5KRS A;  3D45 A;  3AVL A;  2VG7 A;  5E41 A;  3AVC A;  4IFY A;  4CGD A;  4DQI A;  3OYC A;  1RBV A;  2HHQ A;  3CYM A;  1QHT A;  1UAX A;  3B6P A;  4LSN A;  1HYS A;  1TL3 A;  4CHY A;  4DU1 A;  1J9A A;  4O55 A;  3RMC A;  3JSM A;  1S1V A;  2YNI A;  3VQ8 A;  3V4I A;  1LWE A;  5CYM A;  3OYL A;  3DYA A;  1S5J A;  4FJG A;  4WE1 A;  3OVN A;  2PYL A;  1B9D A;  3AV9 A;  3DLR A;  5HRP A;  1C1B A;  2O4I A;  1RIL A;  4AHU A;  4FJK A;  3LWL A;  1YVU A;  2WOM A;  1C0U A;  3AVN A;  4DQR A;  3KD1 E;  5JS1 A;  4EP4 A;  4DQP A;  3CM6 A;  1N5Y A;  3C94 A;  1X9S A;  2P5O A;  3AVI A;  5HRR A;  3NBP A;  3U3G A;  2KW4 A;  2YKM A;  4CJE A;  1BGX T;  4CEA A;  4CGI A;  3OS2 A;  3QEI A;  1JLG A;  2X6N A;  2PYJ A;  2G8I A;  5EU7 A;  1NOY A;  2B5J A;  3SJJ A;  3VA3 A;  2D0C A;  4FLX A;  3PX6 A;  1SKS A;  1T03 A;  4HCB A;  4FZX C;  3PV8 A;  4RW8 A;  4CEO A;  4CJS A;  3VQ6 A;  4AH9 A;  3O3G A;  3L2V A;  1L3V A;  4M3W A;  4CK3 A;  2HHV A;  1VSL A;  4KO0 A;  1JKH A;  1BIU A;  1TKZ A;  2HNZ A;  3NH2 A;  1NJZ A;  4F4K A;  4PY5 A;  1A5V A;  4HUF A;  3P5J A;  4DLG A;  4CF9 A;  4FM1 A;  1T7P A;  4CHQ A;  2BGG A;  1EKE A;  2ITG A;  3ZSW A;  3PO5 A;  1U47 A;  4O0J A;  4FLV A;  1IKW A;  3O4N A;  4CJ3 A;  1QQC A;  3LPT A;  4I7F A;  4BDY A;  1NKC A;  4NCA A;  3HM9 A;  3LP2 A;  2VWK A;  1IKX A;  1D5A A;  4FW1 A;  3K57 A;  3ULD A;  3V9U A;  1D8Y A;  4E7K A;  4AHS A;  4OPJ A;  4FJM A;  4CGF A;  4DSE A;  3M8P A;  4B9N A;  3MXM A;  1UA1 A;  4KB0 A;  3HYF A;  2G8U A;  1Q9Y A;  4B9M A;  3SV4 A;  1VSF A;  4CER A;  1NK7 A;  1LWF A;  4DU4 A;  2WON A;  3V1Q A;  4E0D A;  3KK3 A;  3ZSZ A;  1I39 A;  1RT3 A;  2G8W A;  3QEX A;  3DLB A;  2FBT A;  3S3O A;  2XY5 A;  4CJT A;  2HB5 A;  1SKW A;  3HL8 A;  4FZZ A;  1IKV A;  3V9Z A;  4KRE A;  3QNO A;  3G0Z A;  4DSJ A;  4CHO A;  4CK2 A;  1BIZ A;  4IFV A;  2RPI A;  1TGO A;  4Z0U A;  3M8S A;  4DSL A;  1A5X A;  2IDO A;  4Q5V A;  3M8R A;  4M3T A;  4IDK A;  1Z26 A;  1EXQ A;  2ZE2 A;  3O3H A;  1CZ9 A;  4LY7 A;  4FYD A;  1FKO A;  3PX0 A;  1J54 A;  4CK1 A;  4BE0 A;  1VSM A;  1UA0 A;  3QEP A;  4C8K A;  1KVA A;  4C8N A;  3MXJ A;  2KZZ A;  3V6D A;  1U48 A;  1ZBL A;  3AA5 X;  4R5P A;  4KHU A;  4N47 A;  1JXE A;  1QE1 A;  3DI6 A;  3QEV A;  3S9H A;  4RW7 A;  3K58 A;  4KHQ A;  5KI6 A;  4FLU A;  3AO3 A;  3DRS A;  4CFA A;  4BAC A;  4DTJ A;  4IBN A;  4I9L A;  1HRH A;  4E7L A;  3CM5 A;  3DRP A;  4O5B A;  3VQE A;  4F2R A;  3ZT0 A;  3DOL A;  4FJH A;  4M42 A;  4B3O A;  1IO2 A;  5KGW A;  3G10 A;  3NF8 A;  1TKD A;  4PWD A;  3RTV A;  1K6Y A;  4CHN A;  1F21 A;  1W9H A;  4Q0B A;  1TL1 A;  4E1N A;  4Z4F A;  3OJU A;  1VSK A;  2OZM A;  2QXF A;  3ZT4 A;  3S3N A;  2JLE A;  1S6Q A;  4CJQ A;  1KLN A;  5CY4 A;  1T05 A;  3M8Q A;  1YT3 A;  3DRR A;  1SL1 A;  2Z1I A;  2VG6 A;  4BDZ A;  2FBV A;  1WLJ A;  1RBS A;  1ASU A;  4CEB A;  3CFO A;  4CJF A;  3KLF A;  3NGY A;  3HP9 A;  2RF2 A;  1IKY A;  2KTQ A;  3OYK A;  4KKO A;  4CEF A;  3NCI A;  3NFA A;  4DS5 A;  2HVI A;  1EX4 A;  2A1R A;  3K59 A;  3KLG A;  3AO5 A; 
#chains in the Genus database with same CATH topology
 4XH5 A;  4ILJ A;  2QK9 A;  4JI2 K;  3I33 A;  4DSK A;  4MO4 A;  3ZET A;  4EHT A;  2NRV A;  3O4Q A;  4B3T K;  1RTI A;  4PA1 A;  1YHQ N;  2YNF A;  4CEZ A;  2HMI A;  2NRR A;  4IG0 A;  4I9Q A;  2BDP A;  4J2B A;  4LFB K;  4DFM A;  4FSV A;  4BQZ A;  4IOC L;  3O3F A;  2Y1I A;  4LF4 K;  2ASM A;  4WQ5 A;  3OBY A;  3PUF A;  1SQK A;  1NOZ A;  3THV A;  2UU9 K;  3CG7 A;  4FWP A;  3O8M A;  3FGU A;  1S22 A;  4AHT A;  4N5S A;  2QEX N;  5CR4 A;  3MWT A;  4C8O A;  4M3X A;  2E2Q A;  3OYB A;  4B8C A;  3RMD A;  4G1Q A;  3TAE A;  4TSX A;  4MFB A;  3Q7C A;  2F4V K;  4KV8 A;  5C25 A;  1VQ8 N;  4M3U A;  4N56 A;  4FM2 A;  4JRP A;  4B3R K;  2DFH A;  4RW4 A;  1LCU A;  3ITH A;  1JL2 A;  1YJN N;  4AHV A;  1HLU A;  4QOZ B;  2EHG A;  4NO7 A;  3O08 A;  3L2W A;  1TVR A;  3KK7 A;  2VGN A;  4IEE A;  1HKC A;  4QS9 A;  3OYJ A;  3KK2 A;  2YKN A;  2KKZ A;  3A5N C;  3W0L A;  2JWK A;  3MDQ A;  2QWL A;  3F5T A;  3QNN A;  1SUQ A;  4I2P A;  3NH0 A;  1S6P A;  4GMJ B;  1BI4 A;  3VGL A;  4K8Z A;  1M1K O;  4JHD A;  1Q18 A;  3I8B A;  3E01 A;  4YNQ A;  4IFE A;  3I8D A;  4IO9 L;  2B6A A;  3OYD A;  3KJV A;  4DSF A;  4CZI A;  2CH6 A;  5J1E A;  4WQ5 C;  1S1X A;  4DV4 K;  5EY4 A;  1TUU A;  3G25 A;  4GW6 A;  5FDL A;  2X78 A;  1RT2 A;  4H8K A;  4H4M A;  1WSI A;  5GIP A;  4DV0 K;  4MDB A;  1SL2 A;  4YOT A;  3MXI A;  3ATU A;  3V1R A;  1VSH A;  2PFU A;  1VQO N;  2UXC K;  2D0B A;  4Z94 A;  3GG4 A;  2ZF5 O;  1JLA A;  4H5N A;  3UKU A;  1W97 L;  3RMA A;  4JYA K;  3OYM A;  4MLE A;  3SQ1 A;  3M3Z A;  2A42 A;  1MWK A;  4BR7 A;  4JI8 K;  3L3V A;  2G8V A;  3UKU B;  3OYA A;  3PY8 A;  1T44 A;  4NLB A;  2B4J A;  3ALY A;  1KRP A;  3TTC A;  3ULE B;  1KVB A;  3LDN A;  2YHA A;  4CZF A;  2ETJ A;  4OGE A;  3J80 O;  4M3Y A;  3HJF A;  1Q81 O;  1NGG A;  4WFB L;  3QER A;  1X9J A;  2YHW A;  1VAZ A;  4FWM A;  1Z25 A;  2Q36 A;  3FLC O;  1ZBI A;  4CJ4 A;  1WN7 A;  3N4P A;  3HPG A;  2ZQB A;  3C0B A;  3L3U A;  4CGH A;  5AZI B;  4W5N A;  2GBZ A;  1EQY A;  4HUG A;  4KHY A;  5FPN A;  4GKJ K;  4BRG A;  2OPQ A;  4BRI A;  3MN5 A;  2FXU A;  4DG1 A;  1YIT N;  1TV6 A;  4DCH A;  4WFA L;  3FE1 A;  4BRM A;  2BAN A;  2O8B A;  3FZM A;  5HRS A;  1BA1 A;  4DUZ K;  2OCE A;  2YI1 A;  3DMJ A;  3VQP A;  1HJR A;  3WXL A;  4BRK A;  1S1T A;  4ID5 A;  4ICL A;  5TKY A;  2Q1N A;  4PUO A;  1QZ5 A;  4Y1D A;  3JYT A;  3H3O B;  3THX A;  4BR9 A;  4DLE A;  1QVF M;  3NMU A;  1NKB A;  5C12 A;  4DV2 K;  3LDS A;  2P9U A;  5FRM A;  3O80 A;  4JI7 K;  1NGB A;  3D2E A;  5DMR A;  2CGK A;  1LOT B;  4FXD A;  3TAM A;  4BGB A;  4U67 L;  1C0M A;  4FJ5 A;  3UKR A;  3TR8 A;  5BN8 A;  3RSE B;  4DTX A;  1C1A A;  3F73 A;  4LH4 A;  1ZBF A;  4ZTJ A;  1TYQ A;  1YAG A;  2QM1 A;  1J5E K;  1NK0 A;  4K41 A;  5JLH A;  4E7I A;  3V9S A;  4OJR A;  1RTH A;  3MEC A;  3VQ7 A;  4DFP A;  2PBD A;  3P83 D;  4JKH A;  1HNX K;  5BRD A;  4YFU A;  2ATQ A;  5IT9 O;  1JXB A;  4KPY A;  4FWN A;  3HO1 A;  2OAN A;  5DM7 L;  1LWC A;  4DQS A;  4B8A B;  4OKE A;  3TAB A;  4DTO A;  5LJW A;  1BCM A;  4CIE A;  3OS1 A;  1S3X A;  3T69 A;  3IG1 A;  1S1U A;  4YDU A;  5EXW A;  4CJL A;  1BDG A;  2V52 B;  4AF1 A;  4HCC A;  1VSI A;  3B6O A;  4CHP A;  2KHO A;  1DTQ A;  5HLF A;  3A5O C;  1W0H A;  3DJC A;  2H3G X;  3P31 A;  1XC3 A;  4K0K K;  3TAF A;  4ISE A;  3LP1 A;  3SAH A;  4X64 K;  3CXC M;  3AVK A;  1HKB A;  4GVE A;  1CXQ A;  1Z6R A;  1GLJ O;  3QLH A;  1O13 A;  3EZW A;  4CFD A;  3T1H K;  4J2D A;  5GAD P;  3G6E N;  4K8X A;  2W6L A;  3LM2 A;  1JLF A;  3MCP A;  3CCS N;  5FRN A;  4LH5 A;  3L4I A;  4OVL A;  1T8E A;  3C95 A;  1FJG K;  3S3M A;  3EYZ A;  1YXQ A;  2Q0R A;  3R6M A;  4DTR A;  3RR8 A;  1OH6 A;  1Q8I A;  2O4G A;  2HNY A;  3U3Y A;  4B9T A;  1K8K B;  2P9S A;  5SWM A;  4CGD A;  5EX5 A;  1JJ2 M;  1HYS A;  1J9A A;  2E20 A;  3RMC A;  3V4I A;  5JLF A;  4KBO A;  4FJG A;  3H6E A;  2ZM6 K;  1QQO A;  1KC8 O;  3UE5 A;  4FJK A;  4BVP A;  1C0U A;  1Y64 A;  4DQP A;  3CM6 A;  1N5Y A;  3C94 A;  1X9S A;  5HRR A;  3U3G A;  3NBP A;  5BRF A;  2KW4 A;  3P39 A;  3ID8 A;  3QEI A;  2PYJ A;  4A5A A;  4FWR A;  2B5J A;  4JKB A;  3SJJ A;  5I9E B;  1SKS A;  2PAV A;  1T03 A;  4RW8 A;  3R3L A;  4AH9 A;  4CZE A;  4DKW A;  2HHV A;  1JKH A;  3TSU A;  2HHH K;  2HNZ A;  4JKG B;  3WQU A;  3JS6 A;  2VQE K;  4F4K A;  4PY5 A;  4X62 K;  4XEI A;  2O8B B;  3PO5 A;  4FLV A;  5AQN A;  3O4N A;  3SAG A;  2WTU A;  1NKC A;  4FW1 A;  1D8Y A;  5AFU H;  1NM1 A;  4E7K A;  4OPJ A;  4FJM A;  4CGF A;  3EE9 A;  3M8P A;  4H5R A;  4FL9 A;  2G8U A;  1Q9Y A;  3GBT A;  5BPN A;  1NK7 A;  1LWF A;  2WON A;  3AGR A;  1ATN A;  1SZ2 A;  3DXM A;  3LM9 A;  1RT3 A;  4HTL A;  3ZSZ A;  4DR5 K;  2G8W A;  4LF5 K;  1SKW A;  3HL8 A;  3THX B;  3MX5 A;  4CHO A;  4CK2 A;  4Z0U A;  3H1Q A;  2IDO A;  4Q5V A;  3M8R A;  3HTV A;  1EXQ A;  4H0T B;  4ISG A;  1CZ9 A;  2NRW A;  3PX0 A;  1ATS A;  1IG8 A;  3GDQ A;  1U48 A;  1ZBL A;  3AA5 X;  4GKK K;  4DR7 K;  4KHU A;  1JXE A;  2F9T A;  3K58 A;  4KHQ A;  4F2R A;  4M42 A;  1IO2 A;  5KGW A;  2GTD A;  1K6Y A;  4CHN A;  5AR0 A;  4AM6 A;  3NVK A;  4Z4F A;  1BU6 O;  1XUP O;  1KXP A;  3DXK A;  4Y0W A;  1VSK A;  3S3N A;  2JLE A;  4B1X B;  3LDQ A;  3IKM A;  1SL1 A;  1YJW N;  1KAX A;  2BH1 A;  4DS5 A;  3NCI A;  3NFA A;  1DEJ A;  3K59 A;  5JVH L;  4DV6 K;  3P38 A;  1MU2 A;  3AO2 A;  1ZBH A;  5KTQ A;  5HOO A;  3EN9 A;  4FVM A;  1FW6 A;  3C6T A;  3HM8 A;  4AQY K;  3FR0 A;  4FJ8 A;  2P9N B;  3ZT2 A;  4YY3 K;  4BRQ A;  2ZJR L;  5C0Y A;  1RBU A;  4H03 B;  3K0S A;  2D4W A;  2IVO A;  4IKF A;  3VQA A;  3EZ5 A;  1QSL A;  4AHC A;  1V4T A;  2QKK A;  2W6K A;  4PHT X;  2HHT A;  5AQQ A;  1TK5 A;  4N41 A;  1WUA A;  3FFI A;  2UXB K;  4FJL A;  4QS8 A;  3H3N O;  1XNQ K;  4DR2 K;  1NGJ A;  3THY B;  4CEQ A;  2P9K A;  2AJQ A;  4KHS A;  3KLE A;  3QET A;  4JHD B;  4RTF D;  3SUQ A;  3WXK A;  1VQN N;  1JCF A;  2WUS A;  4BR2 A;  3LAK A;  4BGA A;  2YHB A;  2E5L K;  1ASV A;  3QIP A;  4CF8 A;  1V4S A;  5AQJ A;  3CI5 A;  4DFK A;  4IOX A;  1VQ9 N;  3AVG A;  4YOV A;  3AAQ A;  1BUP A;  5A2Q O;  2P9L A;  3L2Q A;  4NYN A;  2Y1J A;  3U8X A;  4CJU A;  2V51 B;  3NF7 A;  4CZG A;  4E89 A;  4PL7 A;  1QSY A;  2XO7 A;  3R9P A;  4KI4 A;  3TAQ A;  3TWH A;  4DF8 A;  4UQG A;  3CFR A;  1NG9 A;  3AVJ A;  4KI6 A;  2X6S A;  1QSS A;  5AQZ A;  4JD2 A;  1O1W A;  1NNE A;  3PO4 A;  3R1X A;  4HTU A;  1E3M A;  4H0Y B;  4JRQ A;  4BC4 A;  3MX2 A;  4FOI A;  5I3U A;  4FK2 A;  3AA4 A;  1VSJ A;  4JS4 A;  3SYZ A;  3O9Q A;  5FPE A;  4RCH A;  3VQ4 A;  4CZH A;  1NGD A;  3VF6 A;  4WF9 L;  3NAE A;  1G99 A;  4DTM A;  4B3S K;  1RDW X;  4ILH A;  3VEV A;  4CJ5 A;  1SAZ A;  4CED A;  3K2P A;  2IGI A;  1LW0 A;  4I6M B;  1HYV A;  3CPE A;  3QO9 A;  1VQ6 N;  4CZM A;  4CIG A;  1VRU A;  1K8A O;  3K5N A;  4E7J A;  1HQU A;  3IFR A;  1B92 A;  1NK4 A;  3O6W A;  1XC9 A;  1XMQ K;  4FZY A;  1OVQ A;  5AQY A;  4CGJ A;  2V7Z A;  3ZET B;  4BQL A;  3VQQ A;  5EOY A;  3SMP A;  3WNF A;  4PQU A;  5BR8 K;  4IDH A;  1IH7 A;  3OY9 A;  4ZHR A;  4WQ4 C;  2G8K A;  1P8Z A;  4H0P A;  3IAY A;  2P1J A;  3TSQ A;  5HRO A;  3V9W A;  1SV5 A;  3ZSV A;  5HRN A;  3SQ0 A;  4ZTF A;  3WQT A;  3LAN A;  4I6M A;  1WNS A;  2E2O A;  1BOT O;  2Z1G A;  3ZT3 A;  2NZT A;  1VHX A;  3K5O A;  3SZ2 A;  3SJH A;  4ID1 A;  3ZSX A;  3ZT1 A;  3BF1 A;  1C6V A;  2A41 A;  4DV7 K;  1KCF A;  5AQU A;  1TK0 A;  1DLO A;  4EAH D;  4E1M A;  3AO1 A;  3BUZ B;  4CZJ A;  2Q3S A;  3LDO A;  4L8R B;  1CLQ A;  3NGI A;  3I0R A;  4B1Y B;  3BZC A;  3D2F B;  4CZK A;  4FPB A;  1YTA A;  1BCO A;  1BIS A;  1X3N A;  4KH5 A;  3KLI A;  4J2E A;  2A1S A;  3BEX A;  1C1C A;  4B9V A;  3B8A X;  4DR4 K;  4OGC A;  4M3Z A;  1UWB A;  2QWR A;  3TAP A;  2HOE A;  4CF0 A;  4AM7 A;  5AQO A;  1DGK N;  4H0V B;  4EHU A;  3RRG A;  4BR4 A;  2DPN A;  3C6U A;  5J2N A;  3OS0 A;  3LDL A;  1Q86 O;  1XHZ A;  1KSP A;  5F2R A;  3V1O A;  3VQ9 A;  4CJR A;  2G8H A;  5GAH P;  1RDC A;  4LF8 K;  3SK3 A;  3CCJ N;  1BQN A;  1XWL A;  3LDP A;  4OPK A;  4H0X B;  4O0I A;  3QFP A;  5DK5 A;  1WAF A;  3VEY A;  3ZSQ A;  4C1N K;  1Q82 O;  3RRH A;  3CJ9 A;  2HHU A;  4OX9 K;  3DXK B;  4LSL A;  2GEL A;  4JAX A;  3BGR A;  1BWF O;  3HSC A;  4JKD A;  2JWL A;  4XIU A;  4N76 A;  4GV6 A;  2KZM A;  3SNN A;  1HR0 K;  3DXM B;  3CQ8 A;  4CF1 A;  4E19 A;  4KRF A;  5KRT A;  2ZD1 A;  2GUP A;  1L3U A;  4FJN A;  2GUI A;  3GL1 A;  1VRT A;  3ISN C;  4I2Q A;  3VEZ A;  3KKR A;  2F8T A;  1C0T A;  1EET A;  3FFK B;  3T1A A;  4BC5 A;  5FRO A;  3ZSY A;  5T7B A;  2FF3 B;  4FJ7 A;  4E3S A;  3VEN A;  2E4L A;  1D9D A;  2O8C B;  3P4I A;  3AVF A;  3MED A;  1FK9 A;  3KZB A;  5KPR A;  2NRH A;  4GY2 B;  1WAJ A;  5BN9 A;  4KTZ A;  4Z4I A;  4AIL C;  4E1J A;  3ASM A;  1NK6 A;  1K73 O;  4OLA A;  4H0O A;  1E4F T;  3SAF A;  1NGA A;  4KTQ A;  1VK0 A;  3BY5 A;  1N33 K;  2I5J A;  2HBL A;  3L2R A;  4YOR A;  3LAM A;  3SUO A;  4CJV A;  2Q0U A;  2FLO A;  5C24 A;  4K25 A;  4BRD A;  1QQM A;  4FLZ A;  4MLH A;  1QS4 A;  1L3S A;  4DWI A;  1NGF A;  4FWO A;  1VSD A;  4XH4 A;  2P9L B;  2YCH A;  3SQ4 A;  4B1W B;  1QZ6 A;  1TAU A;  4CHZ A;  1CZA N;  1U2V A;  1E4G T;  1HNW K;  2VG7 A;  3MN6 A;  4DQI A;  3CYM A;  4LSN A;  3ZEU A;  1HJO A;  3JSM A;  4JD2 B;  1NMD A;  4KHP K;  4FOE A;  3NVM A;  3CMA N;  4WE1 A;  3OVN A;  4FWK A;  3HOS A;  4C1N I;  1N32 K;  3O1W A;  1OVY A;  3R8E A;  1RIL A;  3F2K A;  3LWL A;  3HOT A;  4EP4 A;  2GWJ A;  1YI2 N;  1BGX T;  3PIO L;  3VF2 A;  5AQX A;  2X6N A;  2QA4 N;  5GAE P;  1NOY A;  3MN7 A;  3WXM B;  2D0C A;  4FLX A;  3PX6 A;  3C6A A;  4CEO A;  4CJS A;  4XH1 A;  3L2V A;  3O3G A;  4RWT A;  1XNR K;  4JN4 A;  1QHA A;  1VSL A;  3CJ7 A;  4KO0 A;  1TKZ A;  5HL7 L;  4HUF A;  3G4S N;  2FSN A;  4FM1 A;  1T7P A;  3T1Y K;  2O8F A;  3J81 O;  2BGG A;  1U47 A;  1OKJ A;  4BDY A;  3PIP L;  1OH5 A;  3HM9 A;  2A3Z A;  5BRH A;  2VWK A;  3O9R A;  3GE1 A;  4AHS A;  3SBT A;  4JNE A;  4DSE A;  4B9N A;  4B9M A;  3VEX A;  4DU4 A;  3V1Q A;  2O8D A;  4E0D A;  2FBT A;  3S3O A;  2XY5 A;  1IKV A;  1BIZ A;  2RPI A;  3KVG A;  1HPM A;  5AZI A;  4YOX A;  1VSM A;  1KVA A;  4C8N A;  3V6D A;  1QE1 A;  3DI6 A;  4GNI A;  3S9H A;  5KI6 A;  5AFU A;  3DRS A;  4DTJ A;  4IBN A;  4I9L A;  1NWK A;  2A40 A;  4E7L A;  2CGJ A;  4O5B A;  4FJH A;  1WOQ A;  4UY8 O;  4A5B A;  1W9H A;  1NU0 A;  4BRH A;  3CC4 N;  3O4W A;  3AY9 A;  2QXF A;  5GAG P;  1S6Q A;  4BRP A;  1T05 A;  1YT3 A;  3M5R A;  3U9D A;  4BDZ A;  4CEB A;  3KLF A;  4CJF A;  3NGY A;  2FSJ A;  2YJF A;  4LC9 B;  2I7N A;  2HVI A;  2A1R A;  3BF3 A;  1DKG D;  3HVT A;  3G71 N;  2DTU A;  1KTQ A;  2VWB A;  1C0G A;  4JLH A;  1LAV A;  4IZ9 A;  3EKU A;  4HUE A;  3E1Y A;  2GV9 A;  4EP5 A;  3WUH A;  1JL1 A;  4CEE A;  3NE6 A;  2LSN A;  3PSI A;  4NXM K;  4DTU A;  5LJV A;  4F3O A;  1J6Z A;  4AHR A;  4QS7 A;  1U6Z A;  2NNW A;  2OTL N;  3CC2 N;  2IVN A;  5FPD A;  3CQY A;  3I0S A;  1BO5 O;  5AZJ A;  3H45 C;  3ZCM A;  4IXC A;  2GEM A;  5M1P A;  2ZGZ A;  4DQQ A;  3LAL A;  4IG3 A;  3VET A;  1VSE A;  1JLC A;  3BDP A;  4O5F A;  1NKE A;  2WC9 A;  5FPM A;  3SV3 A;  3SUP A;  4DF4 A;  3IMX A;  3SPZ A;  2XY6 A;  1GLD G;  5GIN A;  2BE2 A;  3VQC A;  4JKG A;  4RW6 A;  1JCE A;  2CH5 A;  1H1V A;  1ESV A;  4BWM A;  3ATV A;  4BG8 A;  4PKG A;  3I56 N;  3ZSO A;  1DTT A;  4NB4 A;  2RHK A;  3A2F A;  4BWJ A;  3AO4 A;  2RKI A;  4DFJ A;  2HND A;  1RT7 A;  4OPA A;  3SLC A;  2QWQ A;  4BRO A;  4CJ7 A;  1MWM A;  4E7H A;  4RG8 A;  3HPO A;  1HYZ A;  3MEG A;  4OO1 J;  3S41 A;  4DU3 A;  4BG9 A;  4W5Q A;  1KFS A;  3E9P A;  3K5M A;  4HWI A;  1NJY A;  2D0A A;  4KFB A;  1JLE A;  1NJI O;  3QIO A;  3A5M C;  2RE2 A;  5AQF A;  3SPY A;  1LV5 A;  4NCB A;  1UOC A;  5BPM A;  1YIJ N;  4DTS A;  4JK7 A;  4DV5 K;  4LF7 K;  4BDP A;  4CD1 A;  2IS3 A;  3OYH A;  2HHW A;  1S9E A;  5AQI A;  3T19 A;  2QKB A;  3LZJ A;  4MO5 A;  4DR1 K;  3NDK A;  1L5U A;  2OZS A;  5CYQ A;  4CBX A;  2DFE A;  2YJE A;  4JKC A;  4O8K A;  3THW B;  4M3R A;  1HNV A;  3LPU A;  3VN5 A;  2D5R A;  2HW3 A;  3ZEU B;  1TK8 A;  3OHR A;  4FJJ A;  2XY8 A;  1U49 A;  1TKT A;  1LAW A;  3CCM N;  2NRX A;  3MK6 A;  2HBJ A;  1X9W A;  1R59 O;  3SI6 A;  4J8F A;  3E9O A;  5ELZ A;  3SMS A;  4HVJ A;  1XQS C;  1Q9X A;  1A5W A;  4M41 A;  4EIA A;  5F0X A;  2P9P B;  3KK1 A;  3C65 A;  3V81 A;  1J5O A;  1X1P A;  3ZSR A;  1HNI A;  4DB3 A;  3CD6 N;  2HMP A;  4MQ3 A;  3WXJ A;  2HVH A;  3HPH A;  1G15 A;  4ILG B;  4IWV A;  3JXU A;  1ZC6 A;  1RT5 A;  3J7Z O;  3ZX2 A;  4EZ9 A;  3ZX0 A;  2GX9 A;  2P5G A;  4B9U A;  4CI6 A;  4FO0 A;  4FK0 A;  3SQ2 A;  3LWM A;  1HPZ A;  3C7N A;  3WT0 A;  1JLQ A;  1TUY A;  3SCX A;  2FF6 A;  3QB0 A;  4M7X A;  3EKS A;  3CCU N;  3WEE B;  2E1Y A;  4OKK A;  4H5V A;  1U4B A;  3KIO A;  1MDU B;  4CFC A;  4W5R A;  5LMN K;  4A62 A;  4W5O A;  4GVM A;  4X66 K;  3A0I X;  2EX3 A;  3VER A;  1U04 A;  4FK4 A;  4BC2 A;  5BPL A;  1TAQ A;  3VTH A;  2QWO A;  1WSH A;  4BR5 A;  3RMB A;  1N34 K;  1HNZ K;  3TPQ A;  4FVU A;  1NGH A;  4WYB A;  3I55 N;  3DOK A;  4DUY K;  4FLW A;  3IUC A;  1RDB A;  1YUW A;  3MEE A;  3VGK A;  1NLV A;  2YV0 X;  5E84 A;  2KFZ A;  1RT6 A;  1Y97 A;  3ULE A;  1NK9 A;  2P9P A;  1RDU A;  3EL2 A;  2W42 A;  1NGE A;  5JIC A;  2YHX A;  1EWR A;  1XI1 A;  3HP6 A;  3P1G A;  1EP4 A;  5M1Q A;  3DLH A;  3RSE A;  3OYI A;  3C6H A;  1YTU A;  2FBX A;  3AAR A;  3D7E O;  1GLB G;  3HVR A;  3NHG A;  2OYQ A;  4O44 A;  5C10 A;  2F96 A;  5BR9 A;  4BE2 A;  4CD3 A;  1VQ5 N;  5TKW A;  2D1K A;  4FWL A;  4KB1 A;  4FLT A;  1NJX A;  1GOA A;  3VA0 A;  1RT4 A;  1L3T A;  3OYN A;  4B1V A;  4C8L A;  4K43 A;  3KTQ A;  3CFP A;  1B9F A;  2P51 A;  1NK8 A;  3O9T A;  2P9N A;  2HST A;  4CJK A;  3T3F A;  3QES A;  2Z1H A;  2QWN A;  3DLE A;  4BR0 A;  5AQW A;  1VQM N;  2OPP A;  3VMF B;  2Z1J A;  1RDD A;  2J4R A;  3FZH A;  1U45 A;  3UIQ A;  4JI5 K;  2VG5 A;  4FLY A;  3ZYY X;  3RR7 A;  4OPH A;  4KHW A;  2X74 A;  3VOV A;  4CF2 A;  3OYF A;  4B08 A;  3CPW M;  1IJJ A;  2F8S A;  1SKR A;  2IIR A;  4FJ9 A;  5JS2 A;  1RT1 A;  4L3Q A;  3L6Q A;  1K9M O;  4YOU A;  3DLK A;  4A2B A;  1WBD A;  3RVC A;  3LP3 A;  4DV1 K;  4CJW A;  2IOC A;  2E88 A;  1RTD A;  2UYT A;  4CES A;  1ZYQ A;  1OH7 A;  2VGM A;  3LL3 A;  5KRS A;  5E41 A;  4IFY A;  4CVN E;  1RBV A;  2HHQ A;  3B6P A;  3MWP A;  4JKE A;  4KH6 A;  2QI2 A;  4O55 A;  1S1V A;  2YNI A;  3VQ8 A;  3OYL A;  3DYA A;  1NGC A;  2PYL A;  3CJA A;  1B9D A;  1IBM K;  1C1B A;  4DQ8 A;  3CET A;  4AHU A;  4H5W A;  1YVU A;  2WOM A;  3AVN A;  4JKF A;  4DQR A;  5AZJ B;  4FWS A;  2P5O A;  2YKM A;  4KH4 A;  4CGI A;  3OS2 A;  1JLG A;  1W2B M;  3CIP A;  4IJA A;  4HCB A;  2ZJQ L;  3PV8 A;  2HF4 A;  3EEQ A;  2YX6 A;  1EO1 A;  4WCE L;  5CHI A;  2FSK A;  4R79 A;  2E1Z A;  1BIU A;  5JVG L;  5ADX H;  1NJZ A;  3MN9 A;  2IVP A;  3P5J A;  4CF9 A;  3D6R A;  4F9O A;  4CHQ A;  1EKE A;  2OTJ N;  2ITG A;  4BRF A;  3BP8 A;  3J7Y P;  1QQN A;  2F7T A;  1IKX A;  3ULD A;  3H1V X;  5AQH A;  3MXM A;  1UA1 A;  3FZK A;  1RGI A;  1VSF A;  4CER A;  4LFA K;  4CW7 B;  3QEX A;  4CJT A;  2HB5 A;  3V9Z A;  4KRE A;  2O8D B;  3KHY A;  3D2E B;  4IFV A;  1ILY A;  1BA0 A;  3O1B A;  3WEE A;  2P9U B;  2WFB A;  1I94 K;  1A5X A;  5F1X A;  4M3T A;  2E2P A;  1Z26 A;  2ZE2 A;  3O3H A;  4A2A A;  4CK1 A;  3QEP A;  4C8K A;  3MXJ A;  3SBG A;  3QEV A;  4M63 C;  4RW7 A;  1KQS M;  4FLU A;  3AO3 A;  4CFA A;  4BAC A;  4IEI A;  5AQV A;  4BRC A;  4V19 S;  1DT9 A;  3CM5 A;  3DRP A;  1WB9 A;  4YOW A;  3ZT0 A;  4MDA A;  3QIC A;  3G10 A;  3NF8 A;  2YHY A;  1TL1 A;  4E1N A;  4DR3 K;  5CY4 A;  3QML A;  4JI3 K;  2FBV A;  1RBS A;  1ASU A;  3CCQ N;  1IKY A;  3OYK A;  4KKO A;  1EX4 A;  2AP1 A;  1N6Q A;  4B1Z A;  3DLG A;  1R0A A;  2R7Y A;  1X9M A;  5M1K A;  1IBK K;  5AQL A;  3U4L A;  3HT3 A;  5J2P A;  4CBW A;  4X65 K;  1NJW A;  5EVZ A;  3M1F A;  3K9J A;  1KVC A;  1KLM A;  1I3A A;  1SS6 A;  3VEW A;  1M90 O;  4KHN A;  2HBM A;  3E9L A;  4F8R A;  4YHH K;  1RNH A;  3LZI A;  4NYF A;  1S72 N;  3VEO A;  2W41 A;  1NMN A;  1TKX A;  3NGZ A;  2OPS A;  4DMN A;  5C2F A;  4O8U A;  2NRT A;  1YVN A;  2OA8 A;  1X3M A;  3MAQ A;  3CHW A;  3RWU A;  3HXM A;  1FKP A;  1VQL N;  4Z4G A;  2DFF A;  2W40 A;  1JCG A;  2D0P A;  4U7B A;  2O8E B;  5ADX A;  1RDA A;  5I42 A;  3AVH A;  4KAZ A;  2UXD K;  1GOC A;  4CBU A;  4CCH A;  3CCR N;  1VQ7 N;  4CGG A;  2E2N A;  4Z4H A;  4CEC A;  4EZ6 A;  4BRA A;  3DWL A;  5C15 A;  3CQX A;  3CF5 L;  1YJ9 N;  1ZXO A;  5KGX A;  4ISF A;  3Q7B A;  2P9K B;  3AA3 A;  3ENO A;  3QBX A;  4OKJ A;  3UKR B;  3MCA B;  3PLA A;  2QWP A;  2P9I A;  3QDK A;  4BRE A;  3CCV N;  3O5B A;  2PY5 A;  2YNH A;  4F3T A;  2O8C A;  3HRG A;  4M7Y A;  3OBW A;  5KQD A;  3OYE A;  4JS5 A;  4G9Z A;  5SZT A;  3THW A;  4H4O A;  3NH1 A;  3LP0 A;  2UUA K;  2KFN A;  5H1S Q;  1Z05 A;  1QTM A;  3TI0 A;  5K14 A;  5C42 A;  3A5L C;  3QIN A;  1KFD A;  4CE9 A;  4F2S A;  4LD0 A;  3TAR A;  1WSJ A;  2ASO A;  3U6F A;  1BHL A;  1OH8 A;  1IV0 A;  5J2M A;  3F9M A;  1XMO K;  4J2A A;  4JI1 K;  5AQG A;  3EY1 A;  4OLB A;  2ITM A;  3UB5 A;  2VCP A;  1CXU A;  3IS9 A;  4Z4E A;  2XHB A;  2E6M A;  5JMV A;  4IJN A;  5LMU K;  3HK2 A;  3VTI A;  4PKH A;  4B3M K;  4NCG A;  4M45 A;  3D0P A;  3AA2 A;  3TU5 A;  3VQ5 A;  1GLF O;  5D3G A;  1BQM A;  2IC3 A;  1WSG A;  1D9F A;  1W7A A;  1CZB A;  2RN2 A;  4FJI A;  1RBT A;  3DLL L;  2E6L A;  4ELU A;  2ZGY A;  4JKA A;  3CC7 N;  3CJB A;  3J7A P;  3VES A;  1BI4 B;  3CCL N;  4RW9 A;  3FZL A;  1RTJ A;  2YNG A;  3VQD A;  4ELV A;  3OA9 A;  1RBR A;  1D4X A;  5KPZ A;  1Q7Y O;  3CER A;  3C7N B;  1QVG M;  3VQB A;  2ASP A;  1ASW A;  2NRZ A;  5C2D A;  2HHX A;  2P9I B;  3K9K A;  2KQ2 A;  4LF9 K;  4BVO A;  3VGM A;  1GLC G;  3QBW A;  4YDU C;  5AQM A;  2VWJ A;  1C0F A;  3O9S A;  3AVB A;  4B9S A;  4GV3 A;  3HST B;  4WFN L;  5HP1 A;  2NUB A;  5CZ1 A;  2QXL A;  4FW2 A;  2VQF K;  1VQK N;  1BL3 A;  1S9G A;  2I7P A;  3EO3 A;  1IG9 A;  1EWQ A;  4YOY A;  1HQE A;  2QWM A;  3OYG A;  4JK8 A;  1HX1 A;  4QAG A;  3IRX A;  4CJP A;  3PX4 A;  1KD1 O;  2JGU A;  5BRE A;  5AQR A;  1HMV A;  3TAN A;  2XRI A;  2BUP A;  3L8B A;  2ZJP L;  5LL6 Z;  3TSP A;  1WSE A;  4PL8 A;  4W5T A;  1JLB A;  1KAZ A;  1S1W A;  3HZ6 A;  1NK5 A;  1GLL O;  3KLH A;  4BE1 A;  1HKG A;  3IDH A;  3HI0 A;  1FXX A;  4QCL A;  3F9K A;  1T6C A;  4FJX A;  2G8F A;  5KPT A;  4LF6 K;  2CGL A;  4HHT A;  2Q97 A;  5AQK A;  3SUN A;  3KD5 E;  2EWS A;  3WNE A;  3WXI A;  2XY7 A;  4DSI A;  2FBY A;  4DTP A;  1TYQ B;  1NGI A;  2AA4 A;  5E26 A;  1GOB A;  5CZ2 A;  2OPR A;  2A5X A;  4FM0 A;  1VQ4 N;  3JAM O;  4PKI A;  4Z4C A;  3K5L A;  2PZS A;  1REV A;  4DV3 K;  2D0O A;  5FLX O;  3KKS A;  2QTD A;  1IBL K;  4DHY A;  3V9X A;  3OJS A;  3TAG A;  3AVM A;  3QEW A;  3WNG A;  4DTN A;  1KAY A;  5J2Q A;  1ZBS A;  1ZBU A;  2IAJ A;  5HBM A;  3W3D A;  2Q31 A;  3FZF A;  3NF6 A;  3ENB A;  5B8H A;  3OW2 M;  4Y1C A;  3N4Q A;  1U2V B;  4JEP A;  3WNH A;  1GLE G;  3DAW A;  1RCH A;  1K8K A;  4CFB A;  1WSF A;  1XHX A;  3H08 A;  2HHS A;  3NF9 A;  4KTW A;  3O9U A;  3THY A;  4O4G A;  5M1F A;  2Q2R A;  2DY4 A;  5DM6 L;  4ELT A;  4NXN K;  3KWG A;  4CIF A;  2FC0 A;  1ATR A;  4IO8 A;  1SL0 A;  3DM2 A;  4BRL A;  3TTD A;  3L4Q A;  4B9L A;  4A57 A;  1J53 A;  4DS4 A;  1YF5 L;  4BC3 A;  5CE3 A;  3AVA A;  3MMV A;  4C8M A;  3L2U A;  4FCY A;  4JI0 K;  1ITG A;  4WQ4 A;  2E8A A;  1LW2 A;  4A61 A;  3D45 A;  2NLX A;  3AVL A;  4C23 A;  3AVC A;  3QFU A;  3OYC A;  1QHT A;  1UAX A;  1VQP N;  1T3V A;  5AQS A;  1TL3 A;  4CZL A;  4CHY A;  4DU1 A;  4JI4 K;  1LWE A;  3KWI A;  5CYM A;  1N8R O;  3T7Z A;  3EE8 A;  1S5J A;  3AV9 A;  3DLR A;  5HRP A;  3OTO K;  2O4I A;  4DR6 K;  4H5T A;  2HF3 A;  3E66 A;  3KD1 E;  3CCE N;  5JS1 A;  2QW9 A;  1N36 K;  3AVI A;  3PSF A;  3AGK A;  5AQT A;  3L0Q A;  2O8E A;  4CJE A;  2G8I A;  4CEA A;  2UUC K;  5EU7 A;  2F9W A;  3VA3 A;  4FZX C;  4JK9 A;  3A8Y A;  4B1U B;  4B9Q A;  3VQ6 A;  1L3V A;  4M3W A;  3ZLJ A;  4CK3 A;  1T6D A;  3ENH A;  3NH2 A;  1A5V A;  4DLG A;  4IOA L;  5MLC Q;  1WBB A;  1RFQ A;  2V7Y A;  3VPZ A;  3ZSW A;  4O0J A;  1IKW A;  4CJ3 A;  1QQC A;  2HBK A;  3LPT A;  4I7F A;  4NCA A;  3LP2 A;  3VF4 A;  3J8A A;  1D5A A;  3V9U A;  4LFC K;  3HBT A;  3K57 A;  2P9S B;  2ZWH A;  4GV9 A;  2O8F B;  3TTF A;  4KB0 A;  5M1N A;  3HYF A;  3SV4 A;  2UUB K;  4BRN A;  3KK3 A;  1I39 A;  3DLB A;  4A59 A;  4NLC A;  3CME N;  4FZZ A;  3CJ1 A;  1MA9 B;  3QNO A;  3G0Z A;  4BY9 C;  4DSJ A;  5AJ3 K;  2VYP A;  1NBW A;  1TGO A;  4FPA A;  5KQ8 A;  3D2F A;  3M8S A;  4DSL A;  4IDK A;  3H46 O;  3ZX3 A;  4LY7 A;  4FYD A;  1FKO A;  1J54 A;  4BE0 A;  1UA0 A;  2KZZ A;  4R5P A;  4N47 A;  2A6A A;  3AAP A;  4JI6 K;  3CJC A;  1P90 A;  3U9Z A;  1HRH A;  4B3O A;  3VQE A;  5M1O A;  3DOL A;  1BG3 A;  2BTF A;  5AQP A;  1TKD A;  3GOI A;  4PWD A;  3RTV A;  1F21 A;  3BZK A;  1HUX A;  2KLA A;  4Q0B A;  3OJU A;  2GWK A;  2OZM A;  2WBN A;  3ZT4 A;  4EFH A;  5IWA K;  4JV5 K;  3M6G A;  4CJQ A;  1KLN A;  4K42 A;  3ID6 A;  3M8Q A;  4FWQ A;  3DRR A;  5GIO A;  2Z1I A;  2VG6 A;  1GLA G;  1WLJ A;  3CFO A;  3HP9 A;  2RF2 A;  2KTQ A;  5LY3 A;  4CEF A;  3KLG A;  3AO5 A; 
#chains in the Genus database with same CATH homology
 2QK9 A;  3HVT A;  1MU2 A;  3AO2 A;  1N6Q A;  1ZBH A;  3DLG A;  5KTQ A;  4FVM A;  1R0A A;  4DSK A;  3C6T A;  2R7Y A;  2DTU A;  1KTQ A;  1X9M A;  3O4Q A;  4JLH A;  4FJ8 A;  3ZT2 A;  1LAV A;  3HT3 A;  1RTI A;  4PA1 A;  5J2P A;  4HUE A;  1NJW A;  1RBU A;  2GV9 A;  2YNF A;  4CEZ A;  4EP5 A;  2HMI A;  4I9Q A;  4IG0 A;  2BDP A;  4J2B A;  1KVC A;  1KLM A;  4DFM A;  1I3A A;  1JL1 A;  4IKF A;  3VQA A;  4CEE A;  3NE6 A;  2LSN A;  3EZ5 A;  1QSL A;  4AHC A;  3O3F A;  4DTU A;  2Y1I A;  4F3O A;  2QKK A;  4KHN A;  4AHR A;  4F8R A;  1RNH A;  2HHT A;  3LZI A;  4NYF A;  1TK5 A;  4N41 A;  3FFI A;  3I0S A;  4FJL A;  3PUF A;  1NOZ A;  1TKX A;  3ZCM A;  3NGZ A;  3THV A;  3CG7 A;  4AHT A;  4N5S A;  4DQQ A;  3LAL A;  4IG3 A;  2OPS A;  4DMN A;  1VSE A;  1JLC A;  4CEQ A;  3BDP A;  4C8O A;  2AJQ A;  4KHS A;  4M3X A;  3KLE A;  1NKE A;  3QET A;  2OA8 A;  3MAQ A;  3SV3 A;  3SUP A;  3OYB A;  3SUQ A;  4B8C A;  3RMD A;  3HXM A;  4DF4 A;  3RWU A;  3SPZ A;  1FKP A;  2XY6 A;  4G1Q A;  3TAE A;  4TSX A;  2BE2 A;  4MFB A;  4Z4G A;  3VQC A;  2DFF A;  4RW6 A;  4KV8 A;  3LAK A;  5C25 A;  2YHB A;  4M3U A;  1RDA A;  5I42 A;  4BWM A;  3AVH A;  4N56 A;  4KAZ A;  4FM2 A;  1GOC A;  3ZSO A;  4JRP A;  1DTT A;  1ASV A;  2DFH A;  3A2F A;  4CCH A;  3QIP A;  4RW4 A;  4BWJ A;  3AO4 A;  4CF8 A;  3ITH A;  1JL2 A;  2RKI A;  4CEC A;  4CGG A;  4Z4H A;  4DFJ A;  4EZ6 A;  4DFK A;  2HND A;  1RT7 A;  4AHV A;  3AVG A;  4QOZ B;  2EHG A;  3L2W A;  1TVR A;  5KGX A;  3L2Q A;  4E7H A;  4NYN A;  2Y1J A;  4CJU A;  3OYJ A;  4RG8 A;  3NF7 A;  3KK2 A;  2YKN A;  3HPO A;  3AA3 A;  1HYZ A;  4E89 A;  3MEG A;  1QSY A;  2XO7 A;  3QNN A;  4OKJ A;  1SUQ A;  4I2P A;  4KI4 A;  3TAQ A;  3NH0 A;  3TWH A;  4DF8 A;  4UQG A;  1S6P A;  4GMJ B;  3CFR A;  1BI4 A;  3AVJ A;  2X6S A;  4DU3 A;  4K8Z A;  1QSS A;  2PY5 A;  2YNH A;  4KI6 A;  4F3T A;  4YNQ A;  3E01 A;  4W5Q A;  1KFS A;  3I8D A;  3K5M A;  1NJY A;  1O1W A;  3OYE A;  2D0A A;  4KFB A;  1JLE A;  2B6A A;  4JS5 A;  3PO4 A;  3OYD A;  3KJV A;  4DSF A;  3QIO A;  5SZT A;  5J1E A;  4H4O A;  3NH1 A;  1S1X A;  3LP0 A;  2KFN A;  3SPY A;  1LV5 A;  4HTU A;  1QTM A;  3TI0 A;  4NCB A;  4JRQ A;  5K14 A;  1UOC A;  5C42 A;  3QIN A;  4CE9 A;  1KFD A;  5I3U A;  4FK2 A;  4F2S A;  4GW6 A;  3AA4 A;  5FDL A;  2X78 A;  4LD0 A;  1VSJ A;  4DTS A;  3TAR A;  4JS4 A;  3SYZ A;  4BDP A;  1WSJ A;  1RT2 A;  2IS3 A;  4H8K A;  3OYH A;  1S9E A;  1BHL A;  3U6F A;  2HHW A;  4H4M A;  3T19 A;  1WSI A;  3VQ4 A;  5J2M A;  3LZJ A;  2QKB A;  1SL2 A;  3NDK A;  3MXI A;  1L5U A;  3V1R A;  1VSH A;  2OZS A;  4J2A A;  3EY1 A;  3NAE A;  4DTM A;  4OLB A;  3IS9 A;  1CXU A;  5CYQ A;  2D0B A;  4CJ5 A;  2DFE A;  4Z4E A;  1JLA A;  2XHB A;  4CED A;  2E6M A;  3K2P A;  3RMA A;  4M3R A;  2IGI A;  1HNV A;  3LPU A;  3VN5 A;  1LW0 A;  3HK2 A;  2D5R A;  2HW3 A;  3OYM A;  1TK8 A;  1HYV A;  4FJJ A;  2XY8 A;  1U49 A;  1TKT A;  1LAW A;  3SQ1 A;  3QO9 A;  4NCG A;  4M45 A;  3D0P A;  3AA2 A;  3VQ5 A;  4CIG A;  1X9W A;  1VRU A;  3SI6 A;  3K5N A;  4E7J A;  5D3G A;  1HQU A;  1BQM A;  3L3V A;  1B92 A;  2IC3 A;  2G8V A;  1WSG A;  4HVJ A;  3OYA A;  1NK4 A;  1D9F A;  1XC9 A;  3PY8 A;  2B4J A;  3ALY A;  1Q9X A;  1KRP A;  1A5W A;  1CZB A;  1KVB A;  2RN2 A;  4M41 A;  4FZY A;  2YHA A;  4FJI A;  1RBT A;  4CGJ A;  2E6L A;  4ELU A;  3VQQ A;  3KK1 A;  3WNF A;  4PQU A;  3V81 A;  2ETJ A;  4OGE A;  4M3Y A;  1J5O A;  1X1P A;  1IH7 A;  1BI4 B;  3ZSR A;  1HNI A;  4ZHR A;  3OY9 A;  3HJF A;  2G8K A;  4MQ3 A;  3IAY A;  2P1J A;  4RW9 A;  2HVH A;  3QER A;  3HPH A;  5HRO A;  1RTJ A;  2YNG A;  1G15 A;  3V9W A;  1SV5 A;  3VQD A;  4ELV A;  3ZSV A;  1Z25 A;  5HRN A;  3SQ0 A;  4ZTF A;  1RT5 A;  3LAN A;  1ZBI A;  4CJ4 A;  1RBR A;  1WN7 A;  1WNS A;  2Z1G A;  3ZT3 A;  4EZ9 A;  3K5O A;  3VQB A;  3HPG A;  3SZ2 A;  1ASW A;  4ID1 A;  3ZSX A;  3ZT1 A;  2P5G A;  2HHX A;  2ZQB A;  4B9U A;  1C6V A;  4FK0 A;  1KCF A;  3SQ2 A;  3LWM A;  1TK0 A;  1DLO A;  2KQ2 A;  4E1M A;  3AO1 A;  3L3U A;  1HPZ A;  1JLQ A;  4CGH A;  2Q3S A;  4W5N A;  2GBZ A;  2VWJ A;  4HUG A;  3SCX A;  4L8R B;  4KHY A;  1CLQ A;  2OPQ A;  3NGI A;  3AVB A;  3I0R A;  4DG1 A;  4B9S A;  1TV6 A;  3HST B;  4OKK A;  2BAN A;  5HP1 A;  2NUB A;  5HRS A;  1U4B A;  1YTA A;  5CZ1 A;  1D9D A;  1BCO A;  1BIS A;  3KIO A;  4FW2 A;  3DMJ A;  4CFC A;  1BL3 A;  1S9G A;  3KLI A;  4W5R A;  1IG9 A;  3VQP A;  4J2E A;  2A1S A;  1HJR A;  1HQE A;  4W5O A;  4GVM A;  3OYG A;  1S1T A;  4ID5 A;  1C1C A;  4ICL A;  4B9V A;  2EX3 A;  1U04 A;  3IRX A;  4QAG A;  4PUO A;  4FK4 A;  4CJP A;  1TAQ A;  3PX4 A;  4OGC A;  4M3Z A;  4Y1D A;  1UWB A;  2JGU A;  3JYT A;  3TAP A;  4DLE A;  1HMV A;  1WSH A;  2XRI A;  4CF0 A;  3RMB A;  3TAN A;  1NKB A;  3L8B A;  1WSE A;  4W5T A;  1JLB A;  1S1W A;  3LDS A;  5FRM A;  3RRG A;  3C6U A;  5J2N A;  1NK5 A;  5DMR A;  3OS0 A;  3KLH A;  4FXD A;  3TAM A;  4BE1 A;  1XHZ A;  1KSP A;  3DOK A;  3V1O A;  3VQ9 A;  4FLW A;  4CJR A;  2G8H A;  1RDC A;  1C0M A;  1RDB A;  4FJ5 A;  3TR8 A;  1FXX A;  3MEE A;  4QCL A;  3F9K A;  2YV0 X;  4DTX A;  4FJX A;  2G8F A;  2KFZ A;  1RT6 A;  1Y97 A;  1C1A A;  1NK9 A;  1BQN A;  1XWL A;  3F73 A;  4LH4 A;  1ZBF A;  4OPK A;  4HHT A;  4O0I A;  4ZTJ A;  5DK5 A;  1WAF A;  3ZSQ A;  3SUN A;  3RRH A;  1NK0 A;  3KD5 E;  2W42 A;  2HHU A;  4E7I A;  2XY7 A;  4LSL A;  3WNE A;  3V9S A;  4DSI A;  4OJR A;  2FBY A;  1RTH A;  4DTP A;  3MEC A;  3VQ7 A;  1XI1 A;  3HP6 A;  1GOB A;  3P1G A;  1EP4 A;  3BGR A;  4DFP A;  3P83 D;  5CZ2 A;  4XIU A;  3DLH A;  4N76 A;  2KZM A;  3SNN A;  2OPR A;  3OYI A;  4YFU A;  1YTU A;  2ATQ A;  2FBX A;  3CQ8 A;  1JXB A;  4FM0 A;  4KPY A;  3HO1 A;  4CF1 A;  4E19 A;  4KRF A;  1LWC A;  5KRT A;  4DQS A;  2ZD1 A;  4B8A B;  4Z4C A;  4OKE A;  2GUI A;  3K5L A;  1L3U A;  3TAB A;  4FJN A;  1VRT A;  3ISN C;  4I2Q A;  2PZS A;  3KKR A;  2F8T A;  4DTO A;  1C0T A;  1EET A;  1BCM A;  1REV A;  4CIE A;  3HVR A;  3NHG A;  2OYQ A;  4O44 A;  3T1A A;  3OS1 A;  2F96 A;  3KKS A;  5FRO A;  4BE2 A;  3IG1 A;  3V9X A;  1S1U A;  3ZSY A;  3OJS A;  4CJL A;  5T7B A;  3TAG A;  3AVM A;  4HCC A;  3QEW A;  4KB1 A;  1VSI A;  4FLT A;  4E3S A;  4FJ7 A;  3B6O A;  2E4L A;  3WNG A;  4CHP A;  1GOA A;  3VA0 A;  4DTN A;  1RT4 A;  1DTQ A;  5J2Q A;  5HLF A;  1NJX A;  1L3T A;  3OYN A;  3AVF A;  1W0H A;  3MED A;  1ZBU A;  2IAJ A;  4C8L A;  1FK9 A;  5HBM A;  3KTQ A;  3CFP A;  1B9F A;  2P51 A;  1NK8 A;  1WAJ A;  3TAF A;  3NF6 A;  4CJK A;  3LP1 A;  3T3F A;  3QES A;  4KTZ A;  2Z1H A;  4Y1C A;  3DLE A;  4Z4I A;  3AVK A;  4AIL C;  3WNH A;  1CXQ A;  2OPP A;  1RCH A;  2Z1J A;  1RDD A;  4CFB A;  3ASM A;  1NK6 A;  4OLA A;  1WSF A;  3QLH A;  1XHX A;  4CFD A;  3H08 A;  2HHS A;  4J2D A;  3NF9 A;  1U45 A;  3UIQ A;  4KTQ A;  1VK0 A;  4KTW A;  2VG5 A;  4FLY A;  2I5J A;  3RR7 A;  3L2R A;  4O4G A;  4K8X A;  4KHW A;  1JLF A;  3LAM A;  2DY4 A;  2X74 A;  4ELT A;  3SUO A;  4CF2 A;  4CJV A;  5C24 A;  4CIF A;  2FC0 A;  3OYF A;  4B08 A;  4LH5 A;  5FRN A;  4FLZ A;  1SL0 A;  2F8S A;  3DM2 A;  1SKR A;  4OVL A;  1T8E A;  3C95 A;  4FJ9 A;  5JS2 A;  1RT1 A;  3S3M A;  4B9L A;  3EYZ A;  1J53 A;  1QS4 A;  4DS4 A;  1L3S A;  4DWI A;  4DTR A;  1VSD A;  3AVA A;  3DLK A;  3RR8 A;  3LP3 A;  4CJW A;  1Q8I A;  3SQ4 A;  2O4G A;  2HNY A;  2IOC A;  4C8M A;  3U3Y A;  3L2U A;  4B9T A;  1RTD A;  4FCY A;  4CHZ A;  4CES A;  1TAU A;  1ZYQ A;  1ITG A;  5SWM A;  1LW2 A;  5KRS A;  3D45 A;  3AVL A;  2VG7 A;  5E41 A;  3AVC A;  4IFY A;  4CGD A;  4DQI A;  3OYC A;  1RBV A;  2HHQ A;  3CYM A;  1QHT A;  1UAX A;  3B6P A;  4LSN A;  1HYS A;  1TL3 A;  4CHY A;  4DU1 A;  1J9A A;  4O55 A;  3RMC A;  3JSM A;  1S1V A;  2YNI A;  3VQ8 A;  3V4I A;  1LWE A;  5CYM A;  3OYL A;  3DYA A;  1S5J A;  4FJG A;  4WE1 A;  3OVN A;  2PYL A;  1B9D A;  3AV9 A;  3DLR A;  5HRP A;  1C1B A;  2O4I A;  1RIL A;  4AHU A;  4FJK A;  3LWL A;  1YVU A;  2WOM A;  1C0U A;  3AVN A;  4DQR A;  3KD1 E;  5JS1 A;  4EP4 A;  4DQP A;  3CM6 A;  1N5Y A;  3C94 A;  1X9S A;  2P5O A;  3AVI A;  5HRR A;  3NBP A;  3U3G A;  2KW4 A;  2YKM A;  4CJE A;  1BGX T;  4CEA A;  4CGI A;  3OS2 A;  3QEI A;  1JLG A;  2X6N A;  2PYJ A;  2G8I A;  5EU7 A;  1NOY A;  2B5J A;  3SJJ A;  3VA3 A;  2D0C A;  4FLX A;  3PX6 A;  1SKS A;  1T03 A;  4HCB A;  4FZX C;  3PV8 A;  4RW8 A;  4CEO A;  4CJS A;  3VQ6 A;  4AH9 A;  3O3G A;  3L2V A;  1L3V A;  4M3W A;  4CK3 A;  2HHV A;  1VSL A;  4KO0 A;  1JKH A;  1BIU A;  1TKZ A;  2HNZ A;  3NH2 A;  1NJZ A;  4F4K A;  4PY5 A;  1A5V A;  4HUF A;  3P5J A;  4DLG A;  4CF9 A;  4FM1 A;  1T7P A;  4CHQ A;  2BGG A;  1EKE A;  2ITG A;  3ZSW A;  3PO5 A;  1U47 A;  4O0J A;  4FLV A;  1IKW A;  3O4N A;  4CJ3 A;  1QQC A;  3LPT A;  4I7F A;  4BDY A;  1NKC A;  4NCA A;  3HM9 A;  3LP2 A;  2VWK A;  1IKX A;  1D5A A;  4FW1 A;  3K57 A;  3ULD A;  3V9U A;  1D8Y A;  4E7K A;  4AHS A;  4OPJ A;  4FJM A;  4CGF A;  4DSE A;  3M8P A;  4B9N A;  3MXM A;  1UA1 A;  4KB0 A;  3HYF A;  2G8U A;  1Q9Y A;  4B9M A;  3SV4 A;  1VSF A;  4CER A;  1NK7 A;  1LWF A;  4DU4 A;  2WON A;  3V1Q A;  4E0D A;  3KK3 A;  3ZSZ A;  1I39 A;  1RT3 A;  2G8W A;  3QEX A;  3DLB A;  2FBT A;  3S3O A;  2XY5 A;  4CJT A;  2HB5 A;  1SKW A;  3HL8 A;  4FZZ A;  1IKV A;  3V9Z A;  4KRE A;  3QNO A;  3G0Z A;  4DSJ A;  4CHO A;  4CK2 A;  1BIZ A;  4IFV A;  2RPI A;  1TGO A;  4Z0U A;  3M8S A;  4DSL A;  1A5X A;  2IDO A;  4Q5V A;  3M8R A;  4M3T A;  4IDK A;  1Z26 A;  1EXQ A;  2ZE2 A;  3O3H A;  1CZ9 A;  4LY7 A;  4FYD A;  1FKO A;  3PX0 A;  1J54 A;  4CK1 A;  4BE0 A;  1VSM A;  1UA0 A;  3QEP A;  4C8K A;  1KVA A;  4C8N A;  3MXJ A;  2KZZ A;  3V6D A;  1U48 A;  1ZBL A;  3AA5 X;  4R5P A;  4KHU A;  4N47 A;  1JXE A;  1QE1 A;  3DI6 A;  3QEV A;  3S9H A;  4RW7 A;  3K58 A;  4KHQ A;  5KI6 A;  4FLU A;  3AO3 A;  3DRS A;  4CFA A;  4BAC A;  4DTJ A;  4IBN A;  4I9L A;  1HRH A;  4E7L A;  3CM5 A;  3DRP A;  4O5B A;  3VQE A;  4F2R A;  3ZT0 A;  3DOL A;  4FJH A;  4M42 A;  4B3O A;  1IO2 A;  5KGW A;  3G10 A;  3NF8 A;  1TKD A;  4PWD A;  3RTV A;  1K6Y A;  4CHN A;  1F21 A;  1W9H A;  4Q0B A;  1TL1 A;  4E1N A;  4Z4F A;  3OJU A;  1VSK A;  2OZM A;  2QXF A;  3ZT4 A;  3S3N A;  2JLE A;  1S6Q A;  4CJQ A;  1KLN A;  5CY4 A;  1T05 A;  3M8Q A;  1YT3 A;  3DRR A;  1SL1 A;  2Z1I A;  2VG6 A;  4BDZ A;  2FBV A;  1WLJ A;  1RBS A;  1ASU A;  4CEB A;  3CFO A;  4CJF A;  3KLF A;  3NGY A;  3HP9 A;  2RF2 A;  1IKY A;  2KTQ A;  3OYK A;  4KKO A;  4CEF A;  3NCI A;  3NFA A;  4DS5 A;  2HVI A;  1EX4 A;  2A1R A;  3K59 A;  3KLG A;  3AO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...