1A5XA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
b'GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Hydrolase
source organism Rous sarcoma virus (strain schmidt-ruppin)
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5xA00
3WNEA 3KLIA 1J54A 1JXBA 4E7IA 4HUEA 5T7BA 5KRSA 3AVJA 2AJQA 2YNIA 3NAEA 3MXJA 4DSFA 3HVRA 4NCGA 3HPGA 3ZSYA 1NKEA 4EP4A 4AHVA 1RCHA 3M8RA 4M3YA 1XWLA 1TL3A 3V81A 3NHGA 3NGZA 4ZTJA 2RPIA 2QKBA 4IG0A 4M41A 4ID5A 4EP5A 4I7FA 2Q3SA 4FM2A 2OPRA 3VQEA 3QETA 1NK0A 4IBNA 1HYZA 2PYLA 3BGRA 1U48A 3ISNC 4B9TA 3CG7A 3EYZA 3KK1A 3RWUA 4DTOA 3SQ1A 3RR8A 3OYLA 1HNIA 3F73A 3OY9A 3U3YA 1S1XA 1Q9XA 4M3TA 1TGOA 4DFMA 1C6VA 5SWMA 3SUQA 3JSMA 1R0AA 4FJGA 3M8PA 4FJLA 1RTJA 1J9AA 3ZCMA 3PX6A 1X9SA 1S9GA 1HJRA 4TSXA 1XI1A 4IKFA 5JS1A 1KCFA 2B5JA 4BE1A 1T03A 4FJJA 2PYJA 3SV4A 3VQCA 3V6DA 3VQ9A 1C1CA 5HRPA 5SZTA 4JRPA 3OYMA 1JL2A 3MXMA 1J5OA 2DFHA 4CJKA 3KLEA 3ZSOA 1RDAA 1TKXA 3ZT0A 2G8VA 2HHWA 2O4GA 3P5JA 4BE0A 3AV9A 4AHRA 4FYDA 2G8HA 2BGGA 1TVRA 3HSTB 4DSKA 1BI4A 5J2MA 4CHNA 4DTJA 1B9DA 1FK9A 1TKZA 1RT6A 1JLEA 5KI6A 2O4IA 3KLHA 1UA0A 1NJWA 2IS3A 4CJPA 3LZIA 3K2PA 3VQAA 3ZT1A 4YFUA 4AILC 4FXDA 4I2QA 3SZ2A 4KAZA 4NCBA 4N41A 3AA5X 4O0IA 3KK3A 1JLGA 2OZSA 2BDPA 4CJSA 3OYBA 2VG6A 4CF2A 1CXUA 4RW6A 3HO1A 2GV9A 2VWKA 3I0RA 4CK2A 4FK4A 1TV6A 1W0HA 4CJ5A 1HYVA 1BL3A 1BISA 5CYQA 4CECA 3HPOA 2ATQA 3THVA 4KTQA 1L3TA 2D0CA 4I9LA 1KFSA 2P51A 3ULDA 3V9ZA 3ASMA 1BCOA 3AVHA 2HNYA 4Q5VA 3HP6A 4DQQA 2OYQA 4CERA 2KZMA 3LAMA 3ZT2A 1NK9A 1QSSA 3LANA 2ETJA 1VSDA 1HNVA 3L3UA 3ZT3A 4DSJA 2Z1GA 4M3WA 4H4OA 2JLEA 4FLXA 4B9SA 3FFIA 1SKSA 2G8UA 3MAQA 3TANA 1D9FA 3SPYA 3NF7A 1NKCA 5HRRA 5J2NA 2P1JA 2XO7A 3DLKA 4CIFA 4FW1A 3OYHA 1VSKA 4OKEA 3O3FA 1BQNA 3DRSA 5C24A 1S1WA 3LPTA 3HPHA 2VWJA 3SQ4A 5HP1A 1RTHA 4ID1A 4CJWA 4J2EA 5EU7A 3AO5A 4CF8A 3KJVA 4E7JA 4CEEA 3SUNA 3T3FA 3VQPA 3C95A 4E1NA 1QTMA 1L3SA 1Z26A 1KVBA 4OLAA 1SUQA 1RBVA 3MEGA 3SQ2A 5D3GA 1NK8A 4PWDA 4KREA 1ZBFA 1S1UA 3KTQA 3OYIA 3QIPA 4CFDA 4BE2A 4FCYA 4O5BA 4CIEA 2EHGA 2OPPA 3K5OA 3TAMA 5FROA 3AVFA 4NYNA 5J1EA 3OS1A 3KLGA 3L2RA 2HHSA 3RRHA 1A5VA 4E1MA 1X9MA 4M42A 3D45A 5K14A 3OYJA 4DFKA 4M45A 1KLMA 1GOCA 3AO3A 3M8QA 4B08A 3SUPA 1LW0A 5C42A 4CFCA 1WLJA 4DU3A 3LWMA 3CYMA 2OPQA 4RW7A 1NJXA 4GMJB 2EX3A 4F2SA 4B8CA 4C8MA 4CJ3A 2F96A 1S6PA 4DU1A 1NK7A 1UA1A 4FJ8A 5E41A 1S1TA 1NJZA 3MXIA 4KRFA 4FK2A 1JLCA 1LAWA 3T19A 2YNFA 1EX4A 4LSNA 3ITHA 4O4GA 3OYNA 4HUGA 4BDPA 4KHUA 3SPZA 2A1RA 4DQPA 4B3OA 4JS5A 1RTIA 3HL8A 3LDSA 1JLFA 4LD0A 4DU4A 4KTZA 4E0DA 3OS0A 1BHLA 1ZYQA 3PX0A 5KTQA 2XHBA 3LP3A 4ELUA 1Z25A 2B6AA 3ZT4A 1C0MA 3CQ8A 1IKVA 1D9DA 4Y1DA 3K58A 2KFZA 1S9EA 3SCXA 5KRTA 3DYAA 3V1RA 4BDYA 4IG3A 4B9LA 1XC9A 3AVBA 4LSLA 1HQUA 1KVAA 4G1QA 3OS2A 3LPUA 1U4BA 4M3UA 5HROA 4CJRA 3SQ0A 1D5AA 3H08A 4FJIA 1DTQA 3SI6A 1I3AA 5JS2A 3S3OA 4KB1A 4QCLA 1O1WA 3QINA 4CESA 3IAYA 1ZBHA 4FJXA 2HVHA 4DTUA 3LP2A 1SL2A 3L2WA 4J2BA 3K59A 1TK5A 4B9MA 5CY4A 3OYAA 1JLBA 1BGXT 1IKWA 3DLEA 3VQ8A 4DTXA 1IO2A 1HRHA 3SV3A 1ASUA 4FJNA 4F4KA 3TAPA 1KRPA 3KD1E 3K57A 3NH1A 1NK4A 3VQQA 4CHOA 4RW9A 4GW6A 3KKRA 4CEZA 5KGXA 2YNGA 3ALYA 3AA2A 4M3RA 3CFRA 3SUOA 2F8SA 3WNGA 4FM1A 1YTUA 4HVJA 4FZXC 4CK3A 2KW4A 3DLGA 1IH7A 3NBPA 1L5UA 1NOZA 4F2RA 2JGUA 4FJKA 1U47A 4B9UA 2ZQBA 4KO0A 3B6PA 4IFYA 1LAVA 1IKXA 3QEXA 2G8FA 4KHWA 3VQDA 4C8KA 1K6YA 1ASWA 1C1BA 2NUBA 3CM5A 4CEBA 4K8XA 1B9FA 4KHNA 2FBTA 2HNDA 4CEQA 3LZJA 1LV5A 2HHQA 4IFVA 1U45A 4Z4EA 3NH0A 3OYFA 4DFJA 4FW2A 3OJUA 2G8WA 3OYDA 4Q0BA 2HHTA 1U04A 4DG1A 3NGIA 2YKNA 3QEPA 4I9QA 3O4NA 3I0SA 3TWHA 3SJJA 2HVIA 3TABA 4CEAA 4BACA 3HVTA 2X6NA 1UAXA 3L8BA 3HK2A 1VRTA 3PUFA 4C8LA 4LH5A 4ELTA 3ZSWA 3D0PA 1ZBUA 4JRQA 3V1OA 4QOZB 3CFPA 1N5YA 1KTQA 5J2PA 2YHAA 4Z4FA 4CGFA 4OKKA 3VN5A 1S5JA 3V9UA 4WE1A 4NCAA 3KIOA 1T8EA 3IRXA 4KHQA 3LAKA 1Q8IA 2E6LA 2FBVA 4CHPA 4J2DA 1JKHA 3HYFA 2KZZA 3AO1A 3TAGA 4DSLA 3TR8A 3O3GA 1BI4B 3V9XA 3S3NA 4IDKA 1BQMA 2OA8A 3CFOA 1RT2A 1VK0A 5CZ1A 4OPKA 2XY6A 3AO4A 3S3MA 4DSIA 2DY4A 2ZE2A 3AVGA 1SV5A 1JL1A 3NGYA 4CHQA 3U6FA 1LWCA 4OVLA 4FVMA 4I2PA 1LWEA 4DLEA 4AHCA 1X9WA 1NKBA 3AVNA 4FJ5A 2D0AA 4OKJA 2XY5A 3KD5E 4FK0A 5CYMA 1MU2A 4M3ZA 3AVKA 3G0ZA 3QEVA 1TK8A 1S6QA 3HT3A 2HHVA 4LY7A 3TI0A 4R5PA 3C6TA 4KB0A 1QSYA 4Z4IA 2OPSA 5DMRA 3KK2A 4AH9A 2P5GA 3VQ5A 3OYCA 3RTVA 1RDBA 4E7HA 3C6UA 3PY8A 1WN7A 4C8OA 3C94A 1SKWA 3QEWA 5C25A 4H8KA 2D5RA 3P1GA 2WONA 3CM6A 4DTMA 3QERA 2ITGA 4HUFA 4KKOA 4CGIA 1BIZA 3NDKA 3AA3A 1VSEA 1UOCA 5I42A 1KSPA 1CZ9A 3OYEA 4NYFA 1SL1A 3VQ6A 3NE6A 4DTPA 1CZBA 2G8KA 3MEDA 4EZ6A 1VSLA 4KPYA 1L3VA 3QESA 1ZBLA 4KI4A 4MFBA 2YKMA 4CFAA 4W5RA 1JLAA 3VQBA 1T05A 4JS4A 1NOYA 1T7PA 4FJ7A 4KHSA 3IG1A 4PA1A 1WSIA 4DS4A 1KLNA 4CJLA 1X1PA 1DTTA 1TL1A 3NH2A 2PZSA 4FJHA 4F8RA 1NJYA 4CGJA 1BCMA 2GUIA 2B4JA 3DMJA 1ZBIA 4FLVA 3PX4A 3KLFA 3QEIA 5DK5A 1YVUA 1WAJA 4CHZA 1RBSA 2RKIA 3V9SA 4RG8A 2BANA 3LP0A 3U3GA 1I39A 2HHUA 1G15A 5FRMA 3OVNA 4E7LA 2IC3A 4Y1CA 4E19A 3RRGA 4BWMA 4F3TA 1RBUA 3KKSA 3QNOA 4HCBA 4B8AB 1CXQA 4N5SA 4OLBA 4AHTA 4CJQA 4J2AA 4FJ9A 1RBTA 1TKTA 2R7YA 4MQ3A 1IG9A 4RW8A 1KFDA 2X6SA 1QQCA 1RDDA 3NF8A 4DQIA 3RR7A 4PUOA 4Z4GA 1QHTA 3DLRA 1FXXA 1HQEA 4YNQA 2A1SA 2FBXA 3G10A 2WOMA 4DWIA 2QK9A 3HM9A 3MEEA 2XY8A 3HXMA 2KQ2A 4DQRA 3PV8A 2ZD1A 4O0JA 3RMBA 1U49A 1ASVA 2RN2A 1TAQA 1W9HA 3NF6A 1Y97A 2QKKA 3HP9A 2Z1JA 1RILA 1WSFA 4FJMA 4DTSA 3VQ4A 1TK0A 4CJEA 5J2QA 3ZSXA 1HMVA 4Z4HA 3AVIA 1WSGA 3O4QA 2E6MA 1WSJA 1VSIA 3M8SA 3RMDA 1EKEA 1QSLA 1RBRA 1LWFA 4Z0UA 4FLWA 4KFBA 4W5TA 3OYGA 3L2QA 3EZ5A 2HMIA 3I8DA 5I3UA 1FKOA 3NFAA 3ZSZA 1A5XA 3ZSQA 4OPJA 1NK6A 1IKYA 1C0TA 5FRNA 4OJRA 2HHXA 4CFBA 4DQSA 1QS4A 3LP1A 4DTRA 4FZZA 3UIQA 2Z1IA 1JLQA 2DTUA 1UWBA 4HHTA 2HW3A 3IS9A 1RT7A 1TKDA 1GOBA 4C8NA 3AVCA 2Y1JA 2GBZA 2LSNA 2Y1IA 4RW4A 3E01A 4PY5A 3V4IA 1KVCA 3VA0A 3K5LA 3V9WA 4BWJA 3L2VA 2D0BA 3PO4A 2FBYA 3DM2A 3DOKA 3AVAA 3ZSRA 4KHYA 1B92A 2RF2A 3K5MA 1BIUA 4CF0A 4N56A 3WNHA 4FM0A 3RMCA 1SL0A 3OJSA 3ZSVA 3SNNA 1RDCA 3LALA 4ELVA 1ITGA 1LW2A 1WAFA 3MECA 4H4MA 3TAEA 4ZTFA 3V1QA 2YNHA 4OGCA 4DMNA 4HTUA 3K5NA 1REVA 2VG7A 4EZ9A 2XRIA 1VSFA 3P83D 1N6QA 4HCCA 4FLTA 5CZ2A 1F21A 4CEDA 4AHSA 4CCHA 4DSEA 4W5NA 3LWLA 3VA3A 3QLHA 3TAFA 3RMAA 3F9KA 1RT3A 4CE9A 4CJ4A 3TAQA 2PY5A 4Z4CA 3DRRA 1RT5A 4KTWA 4OGEA 4FLUA 4O44A 4DF8A 4CJVA 2FC0A 2IOCA 3AVLA 3HJFA 1XHZA 1NK5A 1RNHA 3A2FA 4BDZA 4FLZA 4CGGA 1D8YA 3B6OA 1GOAA 1VSHA 3L3VA 2KTQA 3BDPA 4JLHA 1YT3A 2OZMA 4LH4A 1WSEA 4CEFA 1HYSA 3DOLA 3QIOA 4CF1A 4L8RB 2DFEA 1RT4A 2I5JA 3NCIA 3WNFA 4DFPA 3O3HA 5HLFA 1VRUA 4N76A 5HRNA 3DLHA 4B9VA 2VG5A 4ICLA 2DFFA 1FKPA 4CGHA 5HRSA 3T1AA 4UQGA 2X78A 4ZHRA 2IAJA 1XHXA 2G8IA 2IGIA 1S1VA 3AA4A 3AVMA 3EY1A 4DTNA 3DLBA 1A5WA 4E89A 4CJTA 4DLGA 3SYZA 1RTDA 3PO5A 3JYTA 4FLYA 2P5OA 4CIGA 1JXEA 4B9NA 1YTAA 3DRPA 4CJUA 4M3XA 4W5QA 4K8ZA 4CK1A 2IDOA 4CGDA 1C1AA 2E4LA 1WSHA 2QXFA 5FDLA 4KV8A 2XY7A 2HB5A 2YV0X 3DI6A 1VSJA 4N47A 1SKRA 1J53A 4XIUA 2KFNA 3TARA 2BE2A 1CLQA 4O55A 4PQUA 1EXQA 5KGWA 2Z1HA 3NF9A 5HBMA 1HPZA 2W42A 3L2UA 1EP4A 4DS5A 2X74A 4AHUA 4E3SA 2F8TA 1RT1A 3QNNA 4KI6A 1EETA 1TAUA 4GVMA 3QO9A 4CHYA 4W5OA 4DF4A 1QE1A 1L3UA 3AO2A 1VSMA 4FZYA 4CEOA 4F3OA 1C0UA 2HNZA 4CJFA 1Q9YA 3VQ7A 2YHBA 4E7KA 1WNSA 3OYKA 1DLOA 4QAGA 3S9HA 4CF9A
chains in the Genus database with same CATH superfamily
3WNEA 5TKYA 4BG9A 1MDUB 2V51B 3MXJA 3MMVA 1XMQK 3DJCA 1YI2N 3HZ6A 1RCHA 1TL3A 3V81A 1ATNA 3U4LA 2RPIA 4ZTJA 3AAQA 4IG0A 3A0IX 5LY3A 4FM2A 2GELA 2OPRA 3ENHA 2PYLA 4B3RK 3BGRA 3TPQA 3KK1A 5LJWA 4DTOA 3RR8A 4R79A 2W6KA 4YOTA 4LF5K 5AFUH 3U3YA 3W3DA 4M3TA 4BG8A 1TGOA 1R0AA 3JSMA 4FJLA 1RTJA 1J9AA 3PX6A 1X9SA 1HJRA 4C1NK 4FWMA 2B5JA 1T03A 2ZWHA 3ZX3A 5BR9A 3V6DA 1C1CA 3MXMA 3R9PA 4BR2A 4CJ7A 2G8VA 2HHWA 3LM9A 3O80A 3MN7A 1BI4A 3TU5A 5KQ8A 4DTJA 3VGMA 1B9DA 2ZGYA 1TKZA 1RT6A 5J2MA 2GUPA 2YHYA 4CJPA 3LZIA 3R1XA 4AILC 4N41A 2P9NA 4O0IA 2HSTA 4CJSA 4CF2A 4RW6A 3HO1A 2PAVA 1BL3A 3HPOA 1ZXOA 2H3GX 2D0CA 4I9LA 1FJGK 5CR4A 4BRGA 1HR0K 1KFSA 3E66A 5AR0A 1IBLK 3AVHA 2OYQA 2HNYA 2KZMA 3UB5A 3ZT2A 2UXCK 2ETJA 4BC4A 4H0XB 3R3LA 2QWQA 2JLEA 4FLXA 4DKWA 3SPYA 5HRRA 5M1QA 3WQUA 4CZFA 2P1JA 3DLKA 4YDUC 1BQNA 3VEWA 4X64K 1S1WA 1U6ZA 4B1XB 1WOQA 4E7JA 3T3FA 1RDWX 4BY9C 3TSQA 4B1WB 1KVBA 4QS9A 3SQ2A 3WXKA 4KREA 3HBTA 3HI0A 3LDQA 4JI1K 3AGRA 3OYIA 1R59O 4J8FA 2QWRA 4AM7A 3K5OA 3TAMA 3KLGA 3L2RA 3CXCM 2GWKA 3T7ZA 4EFHA 4NB4A 1A5VA 4E1MA 4M42A 2E2OA 4DFKA 3D2EB 5FPNA 1GOCA 3AO3A 4B08A 3E1YA 3SUPA 1LW0A 4H0YB 1H1VA 2YCHA 4BRNA 4DU3A 3CYMA 4BRHA 2BUPA 3FE1A 1NJXA 4F2SA 4B8CA 1E4FT 4H0PA 5GINA 3TTDA 1UA1A 1JLCA 1LAWA 3CC2N 3T19A 1OH8A 1NMDA 4DUYK 3LDSA 4E0DA 3OS0A 1ZYQA 1DGKN 2XHBA 1Z25A 2P9KA 1YJ9N 3BEXA 3CQ8A 2CH6A 5JLFA 4B9LA 1J6ZA 4X62K 1BDGA 1KVAA 3QB0A 1U4BA 4Z4EA 5HROA 4CJRA 3IUCA 2QA4N 3SI6A 1I3AA 5LJVA 3CCRN 1GLFO 3GDQA 1SL2A 3A5NC 3EKSA 3DXKA 2P9UB 5CY4A 3OYAA 1BGXT 1IKWA 3DLEA 3UKUA 1ASUA 5LMNK 3TAPA 2Q0RA 4A59A 3VGLA 4CHOA 4GW6A 1X3NA 5I9EB 3AA2A 3THYB 2IVPA 4JK8A 3G6EN 1YTUA 2KW4A 4U7BA 3NBPA 1L5UA 2ZQBA 5M1PA 3B6PA 4IFYA 2O8BB 4C8KA 4DR7K 4RCHA 4CEBA 4KHNA 1B9FA 2HHQA 1LV5A 1U45A 2HBJA 3EE8A 4UY8O 4AQYK 4JI8K 4FW2A 5BRHA 3CHWA 3OYDA 3OJUA 2YKNA 3QEPA 3BY5A 4QS7A 4DR6K 1HLUA 4CBXA 4LH5A 3P4IA 3ZSWA 2CGLA 3D0PA 3V1OA 5J2PA 2YHAA 4O8KA 4Z4FA 5M1KA 4CGFA 1NG9A 4PKIA 2P9KB 2WUSA 4XH5A 1Q8IA 2FSKA 3TAGA 4U67L 5GAGP 3CFOA 5CZ1A 2XY6A 1NGGA 3AO4A 3HTVA 1X9WA 3A5OC 3L6QA 1NGCA 2D4WA 4IO8A 1QQMA 1MU2A 4BR7A 1TYQA 4JYAK 2QEXN 4K25A 5KQDA 3CPEA 1P8ZA 2P5GA 5DMRA 3VQ5A 1IBMK 1XNQK 3C94A 3D6RA 1SKWA 4YOVA 5AQHA 4HUFA 3AA3A 1UOCA 4IOAL 3VEOA 1NMNA 4NYFA 1FW6A 4ISFA 5EX5A 1ZBLA 4MFBA 2YKMA 4CFAA 4W5RA 1T7PA 4JS4A 3WXLA 1YJWN 4FJ7A 3IG1A 4DS4A 2E88A 3O9TA 1NM1A 2PFUA 3CJ1A 3NH2A 4K41A 4CGJA 1BCMA 3THWB 2AP1A 4CZHA 1VQ6N 1WB9A 3QEIA 5DK5A 4CHZA 1RBSA 3QMLA 1I39A 2HHUA 4A5BA 4B8AB 3QBXA 4AHTA 4DV7K 1HJOA 1RBTA 3D2FB 1QQCA 3NF8A 5KPRA 2P9SB 3S41A 1QHTA 3DLRA 5F2RA 1FXXA 4JK9A 3O9UA 3CPWM 3G10A 2QK9A 3HM9A 3I33A 3MEEA 4KBOA 3HXMA 2KQ2A 4DQRA 3RMBA 4GY2B 3FFKB 4JI4K 4AM6A 3A5LC 5BPMA 4DTSA 1HKCA 1K8KB 4Z4HA 4B1UB 3O4QA 3M8SA 3G71N 4LFCK 1LWFA 4Z0UA 4A2BA 2HMIA 5I3UA 4DR4K 1KC8O 2GX9A 3NFAA 3ZSZA 4OPJA 3CJ9A 2HHXA 1NLVA 4DTRA 3FZMA 2E1YA 3UIQA 4FZZA 3G4SN 1MWKA 3N4QA 1TKDA 4IO9L 3AVCA 5DM7L 3E01A 2V7ZA 4CZMA 1C0GA 3ZSRA 3AVAA 1BIUA 4FM0A 2CGKA 3ZSVA 1ITGA 1LW2A 1WAFA 1SS6A 1BOTO 3V1QA 2YNHA 4HTUA 2UUCK 3OHRA 2XRIA 1VSFA 2HF3A 4FLTA 3HSCA 4AHSA 4CCHA 3WEEA 4W5NA 4JHDB 3TAQA 5JVHL 4YOYA 4MDBA 2WBNA 3DRRA 5EVZA 3LDPA 1RT5A 4OPHA 4FOIA 5AQVA 2IOCA 3AVLA 1NK5A 4GNIA 4WYBA 4BC5A 1YT3A 2YI1A 4CF1A 4PKGA 4L8RB 4JI2K 4JKHA 2I5JA 1K8KA 3SLCA 2HMPA 3F2KA 4ZHRA 4DV4K 2IAJA 2IGIA 3EY1A 4DLGA 4FLYA 4B9NA 4B3SK 4K8ZA 2IDOA 2FSJA 5FDLA 3SAFA 1VSJA 2QM1A 3TARA 2BE2A 3O5BA 4O55A 1EWQA 3WXJA 2W42A 4A57A 4BR4A 4KI6A 3CIPA 1EETA 2A41A 1TAUA 4GVMA 3QO9A 4WFBL 2FF6A 1QE1A 4KH4A 1VSMA 1Q9YA 4CJFA 3VQ7A 4PL7A 1DLOA 2HVHA 3CCEN 2F9WA 4FO0A 5AQXA 2A6AA 3KLIA 1JXBA 3FLCO 5T7BA 5KRSA 4YHHK 3AVJA 2AJQA 3NAEA 4DSFA 3ZSYA 1NKEA 4OX9K 3MN6A 3ZLJA 3NHGA 3C7NB 1WBBA 4CBUA 2QKBA 4EP5A 1QHAA 3KWIA 2O8BA 2Q3SA 2UUAK 3VQEA 3THXB 2E20A 1Q82O 1U48A 3SQ1A 1HNIA 1Q9XA 4JI6K 4H0VB 2VQEK 4IKFA 4TSXA 3P31A 4MLEA 3SV4A 3VQCA 5AQLA 4JRPA 5HRPA 3N4PA 1JL2A 2DFHA 5C2DA 1RDAA 5IWAK 2CGJA 4FWLA 4FYDA 2G8HA 4DSKA 3C65A 5KI6A 2O4IA 1JLEA 3KLHA 4JKCA 4YFUA 4KAZA 1JLGA 2OZSA 3OYBA 3JS6A 3GE1A 4ISEA 2GV9A 2VWKA 4BR9A 1TV6A 3MN5A 2P9PB 1TYQB 1L3TA 4DR5K 4QS8A 2ASOA 3BZKA 3LAMA 3LANA 2E8AA 2ZJQL 1YITN 1HNVA 3O1WA 4XH1A 1JCFA 3ENBA 4H4OA 3FFIA 5M1FA 3GG4A 1SKSA 2G8UA 3NF7A 5J2NA 5AQSA 3OW2M 3A5MC 4CIFA 4IJAA 1VSKA 3DRSA 1RTHA 4CJWA 5EXWA 4CF8A 2UUBK 4CEEA 5M1NA 1JJ2M 3VQPA 5JICA 2F4VK 1SUQA 5D3GA 4PWDA 5LMUK 2O8EB 5TKWA 3QIPA 3T1YK 4O5BA 2UXDK 4YY3K 4HHTA 5FROA 3SAHA 3TTCA 3VF2A 3RRHA 3M6GA 1CZAN 3D45A 3OYJA 3W0LA 4WQ5A 4DR3K 5C42A 2NRZA 1KAZA 3VENA 2P9UA 4RW7A 3UKUB 4C8MA 4KRFA 4LSNA 5AQJA 4HUGA 4BDPA 4B3OA 4DQPA 2E1ZA 3EE9A 4LD0A 4KTZA 5AQWA 3VERA 3VEVA 2QWNA 2O8CB 3BP8A 3LP3A 3ZT4A 4BRKA 1Y64A 5CHIA 2KFZA 3BUZB 5KRTA 4BDYA 5C15A 1QZ6A 5AQZA 3OS2A 5CE3A 3SQ0A 3H08A 1DTQA 2O8EA 4QCLA 1O1WA 4CESA 3THWA 2Q31A 4YORA 1HNWK 2FSNA 4O5FA 4DTXA 2GWJA 2NRRA 1KRPA 1DT9A 3K57A 2V7YA 2VGNA 1NU0A 3C0BA 3RSEB 2YNGA 3NVKA 3WNGA 4FM1A 4FZXC 1W97L 3DLGA 1ILYA 1M1KO 1U47A 3TSPA 1K8AO 3EZWA 3KWGA 1IG8A 3CM5A 4CZLA 2HHTA 2G8WA 4CVNE 4DG1A 2HVIA 3SJJA 4V19S 3HVTA 4WFNL 2X6NA 3VEYA 4JHDA 1VRTA 4C8LA 1WBDA 4B1ZA 1IV0A 1VQ5N 4H5NA 4BRPA 2P9IB 4DV2K 1JCEA 3VN5A 3IRXA 3LAKA 1NGFA 2Q36A 3R6MA 3AO1A 1VQNN 3E9LA 5FPDA 3O3GA 4GVEA 2OA8A 3K0SA 3S3MA 4JI7K 5AQIA 4B9QA 1SV5A 1LWCA 4FVMA 4DLEA 4JKEA 3L4IA 3BF3A 2D0AA 1M90O 2XY5A 3KD5E 4FK0A 4M3ZA 3AVKA 3G0ZA 1S6QA 2HHVA 3TI0A 4WCEL 3C6TA 2OPSA 3KK2A 4AH9A 5HL7L 3RTVA 1RDBA 4E7HA 3C6UA 4L3QA 4GKJK 4JNEA 5C25A 4F9OA 2D5RA 4DTMA 2ITGA 3F5TA 5I42A 2NZTA 1CZ9A 3CJAA 2G8KA 4EZ6A 4DTPA 4KPYA 4KI4A 1L3VA 3MDQA 4B3MK 1NOYA 4PA1A 1WSIA 1X1PA 3SBTA 2HBMA 4F8RA 3EEQA 2B4JA 4IFEA 1ZBIA 1C0FA 3WEEB 2RKIA 3VMFB 1BU6O 4LF8K 4JKFA 1RFQA 4FWQA 1VQLN 3U3GA 1G15A 5E84A 4E7LA 2IC3A 4Y1CA 4E19A 3RRGA 3ZETB 1XUPO 4F3TA 1YVNA 1RBUA 3KKSA 2VQFK 3QNOA 2YJFA 3TTFA 4N5SA 4OLBA 3H3NO 2R7YA 4MQ3A 1IG9A 4BRDA 2X6SA 1RDDA 3Q7CA 1BO5O 1HQEA 1GLCG 4YNQA 4DV5K 2WOMA 3HM8A 1OH6A 3R8EA 1ASVA 2F7TA 4XH4A 3EL2A 1TAQA 3NF6A 1Y97A 2P9NB 3HP9A 2QKKA 1WSFA 3VF6A 4IDHA 5AQKA 5ADXA 3ZSXA 1SAZA 1EKEA 4CD3A 4FLWA 1E3MA 1A5XA 2NRWA 1BA0A 4IEIA 1C0TA 3LP1A 4DV1K 2DTUA 2HW3A 4BRQA 1RT7A 2Y1JA 1GLJO 4CZKA 3E9PA 2LSNA 4WQ4A 4RW4A 4LFAK 3D2EA 3V9WA 2D0BA 5C12A 4KHYA 4CI6A 1B92A 2RF2A 3BF1A 3OJSA 3SNNA 3LALA 4ZTFA 2ASMA 4WFAL 2QWPA 4DMNA 1BUPA 3K5NA 1WUAA 4EZ9A 4MO5A 1QQOA 5CZ2A 1TUYA 2FF3B 3T69A 2P9LA 4IXCA 3TAFA 3RMAA 1RT3A 4Z4CA 1K73O 3KHYA 4ILGB 4OGEA 3C6AA 4FLUA 4DF8A 3VESA 3CQYA 3O9SA 3HJFA 4FLZA 4CGGA 1VSHA 5AQUA 3BDPA 3CQXA 1WSEA 3DWLA 3G25A 3DOLA 3QFUA 4YDUA 4PL8A 3K9KA 3NCIA 4DV3K 3WNFA 4DFPA 1VRUA 2VG5A 4ICLA 1NGAA 4CGHA 3T1AA 3DXMB 4H5TA 3UKRB 4BRCA 4DCHA 3AA4A 3AVMA 3DLBA 4GKKK 4CJTA 3PO5A 3CCLN 4CIGA 1JXEA 4BRFA 3TSUA 2HF4A 3IKMA 1QQNA 4NLCA 3LDLA 4LC9B 2ASPA 4HTLA 3CCJN 2HBKA 3CMAN 1J5EK 5AZIA 2P9PA 4N47A 3QDKA 1J53A 3DXMA 3EN9A 3UKRA 1CLQA 2X74A 3EO3A 2QTDA 1ESVA 5AZJB 2HNZA 4BR0A 5FPMA 4BVOA 4MDAA 3OYKA 1IJJA 1NNEA 4FJKA 3EKUA 1ATRA 1J54A 4E7IA 2YNIA 5AQRA 3HVRA 3HPGA 2Q97A 4EP4A 4M3YA 1HKBA 3NGZA 1MWMA 3CC7N 4M41A 1HNXK 1NK0A 1HYZA 3CG7A 3RWUA 2NRTA 1HNZK 3OYLA 3F73A 3OY9A 1S1XA 3RSEA 3SUQA 5SWMA 3LL3A 4FJGA 1BWFO 3ZCMA 5JS1A 1XI1A 1KCFA 5JMVA 3OYMA 1VAZA 2IVOA 1TKXA 3ZT0A 2YX6A 5M1OA 4BE0A 1T6CA 4AHRA 2BGGA 5BR8K 4CHNA 3WUHA 4O8UA 3T1HK 4K0KK 4FWOA 2ZJPL 1XC3A 5KPTA 4CZEA 3VQAA 3SZ2A 1D4XA 3ID8A 2P9IA 3AA5X 3U9ZA 2BDPA 2VG6A 4CK2A 1EO1A 1W0HA 4CJ5A 1NGIA 5CYQA 1BISA 4EIAA 3THVA 2ATQA 4KTQA 1BG3A 4RWTA 2KHOA 1NGEA 3OBWA 2P51A 1BCOA 4Q5VA 4DQQA 2OTJN 4JEPA 1VSDA 1SZ2A 3ZEUA 4JD2B 4I6MB 1X9JA 3ZT3A 4DSJA 3VEXA 4M3WA 4B9SA 3MX2A 4LF4K 1MA9B 4Z94A 4IOXA 1NGDA 1NKCA 3WQTA 2XO7A 4GV6A 1VQON 3OYHA 4FW1A 4G9ZA 1NJIO 5KPZA 2VWJA 3LPTA 5BPLA 4ID1A 5EU7A 4DB3A 3PSIA 3SUNA 4A5AA 5IT9O 3C95A 4RTFD 1OVQA 1QTMA 5BPNA 1L3SA 3DXKB 1Z26A 1Q81O 1HKGA 4ILJA 4OLAA 3NMUA 3MEGA 4JAXA 4BE2A 3CMEN 4JN4A 5J1EA 3VEZA 4NYNA 3THYA 1TUUA 2E5LK 2WFBA 3MK6A 5K14A 4Y0WA 4JD2A 3CJ7A 4CFCA 3ZEUB 1WLJA 3MCPA 5EOYA 2ZGZA 1VQ4N 5EY4A 4FWNA 1Q86O 3CCVN 4DU1A 3MCAB 1NK7A 1S1TA 3MXIA 4FK2A 2YNFA 1EX4A 4O4GA 2Q2RA 4KHUA 3SPZA 4JS5A 1RTIA 1JLFA 4DU4A 3SK3A 1BHLA 3PX0A 5KTQA 4ELUA 1C0MA 1IKVA 4JK7A 4Y1DA 3K58A 4B3TK 5MLCQ 3DYAA 3V1RA 4IG3A 3AVBA 3I56N 1HQUA 1NGBA 1VHXA 4ILHA 3S3OA 4KB1A 4DTUA 5AQMA 1QZ5A 3FZKA 3K59A 3K9JA 1TK5A 4B9MA 4FSVA 2O8FA 3AAPA 3CF5L 3HRGA 1IO2A 4FJNA 4F4KA 4NXNK 3J7YP 1NK4A 4RW9A 4C1NI 5KGXA 4M3RA 3CFRA 3SUOA 4JKDA 2F8SA 1N34K 4HVJA 3CETA 3THXA 1IH7A 3E9OA 3WXMB 4B9UA 5BREA 1K6YA 3FZHA 1ASWA 1C1BA 2NUBA 2YHWA 2FBTA 4CEQA 3LZJA 4FWSA 3NH0A 1GLEG 4M7XA 3NGIA 4I9QA 2O8DA 4CEAA 2OCEA 1UAXA 3CCSN 3C6HA 4E1JA 4K42A 2QXLA 3AY9A 4JRQA 4QOZB 3CFPA 1KTQA 4KH5A 4H5RA 2VGMA 4JKGA 2JWKA 4OKKA 1S5JA 2D0OA 4CZGA 3O8MA 4CHPA 4J2DA 4NXMK 1VQ9N 4M7YA 1BI4B 2HOEA 4DV6K 4IDKA 1BQMA 1RT2A 1VK0A 3ATUA 4OPKA 4DSIA 2RE2A 2ZE2A 3AVGA 4CHQA 1JL1A 3U6FA 3PLAA 3GBTA 1S3XA 5AZIB 1NKBA 4AHCA 3AVNA 3LDNA 4LFBK 4FPAA 5CYMA 3QEVA 3A8YA 2WTUA 3QFPA 2J4RA 3OYCA 4FPBA 3PIPL 5C2FA 4GV9A 1WN7A 4C8OA 3QEWA 3VF4A 4H8KA 1V4SA 5FLXO 4FOEA 3QERA 4KKOA 4CGIA 1BIZA 3NDKA 1VSEA 4GV3A 3OYEA 3NE6A 1VSLA 4QAGA 1T05A 1YAGA 1JLAA 3VQBA 5AQQA 3ATVA 4KHSA 1S22A 1KLNA 2PZSA 1DTTA 1TL1A 4FJHA 2Q0UA 2P9LB 3DMJA 4FWRA 5AZJA 2A5XA 3QICA 3KLFA 1Z05A 3PX4A 4FWKA 1OVYA 3H1QA 3J8AA 3MWTA 5BRFA 2BANA 3LP0A 2BTFA 1YHQN 5AQYA 4NO7A 5FRMA 3H3OB 2V52B 2IIRA 1CXQA 4EAHD 1W7AA 4YOWA 4CJQA 4J2AA 4FJ9A 3VTHA 1TKTA 3I55N 3CERA 4Z4GA 2A1SA 4PKHA 3LM2A 2O8FB 5H1SQ 2ZD1A 1OH5A 1KAYA 1S72N 2RN2A 2IVNA 1T44A 3H46O 1W9HA 2EWSA 2Z1JA 3J7AP 4FJMA 1TK0A 4CJEA 5J2QA 1ZC6A 1HMVA 1WSGA 3AVIA 3RMDA 1QSLA 1RBRA 4BQLA 4KFBA 5A2QO 3OYGA 3EZ5A 3VOVA 1FKOA 4H0TB 1QVFM 5AQOA 2GEMA 3SMPA 1EQYA 1IKYA 5FRNA 4OJRA 1QS4A 2ZJRL 1JLQA 1Z6RA 3IS9A 4C8NA 3AARA 4KH6A 2WC9A 4IJNA 3V4IA 1KVCA 3VA0A 4BWJA 3L2VA 3PO4A 2RHKA 2FBYA 1SL0A 4BQZA 2ZM6K 1RDCA 4IOCL 4ELVA 3MECA 4OGCA 3P83D 4HCCA 3C7NA 1F21A 4CEDA 3HOTA 4DSEA 3VA3A 3QLHA 4OO1J 3F9KA 2FXUA 3FGUA 4KTWA 4C23A 4O44A 1NBWA 3ZYYX 2FC0A 3OBYA 5AQPA 1XHZA 1VQ8N 4BDZA 1U2VA 1D8YA 3L3VA 2KTQA 4CEFA 4H5VA 1HYSA 4X66K 3SJHA 2FLOA 1RT4A 2O8CA 3O3HA 5HLFA 1XMOK 5HRNA 3DLHA 2D1KA 2DFFA 1FKPA 4DQ8A 4ISGA 1VQPN 1XHXA 2G8IA 1S1VA 2W41A 3ZX0A 4E89A 4LF9K 3OTOK 1EWRA 1NWKA 3O4WA 4B1VA 2P5OA 1YTAA 3DRPA 4CJUA 4M3XA 1W2BM 3VGKA 1C1AA 2E4LA 4LF7K 4KV8A 2XY7A 2HB5A 4XIUA 1EXQA 2CH5A 3O9RA 4DS5A 1HPZA 5AQGA 2F8TA 1EP4A 4A61A 3QNNA 2HHHK 4BRLA 1O13A 2BH1A 4DF4A 1L3UA 3AO2A 4FZYA 1U2VB 3M1FA 1C0UA 4F3OA 1DEJA 3S9HA 4FWPA 4HUEA 2YJEA 4NCGA 4BC3A 4AHVA 3D2FA 3M8RA 1KD1O 1XWLA 1GLBG 3B8AX 3ENOA 4ID5A 3KK7A 1LCUA 4I7FA 3QETA 1QVGM 4IBNA 3ULEB 4BRIA 5AQTA 3ISNC 3VTIA 4B9TA 3EYZA 3SMSA 4H5WA 3JXUA 4DFMA 1C6VA 3M8PA 3CCMN 3MWPA 4IWVA 1S9GA 2NLXA 4BE1A 4FJJA 2PYJA 2HBLA 3VQ9A 5SZTA 1J5OA 3IFRA 1VQ7N 4CJKA 3KLEA 3ZSOA 3O9QA 2QWLA 2UU9K 2O4GA 3P5JA 3AV9A 1DKGD 1TVRA 3HSTB 1FK9A 3M5RA 3MX5A 1UA0A 3U9DA 1NJWA 2IS3A 1OH7A 3K2PA 3ZT1A 4I2QA 4NCBA 4I6MA 4JKGB 3KK3A 2D0PA 4BR5A 1CXUA 3I0RA 4FK4A 1HYVA 4CECA 3DLLL 3PIOL 2PBDA 4BROA 1Q7YO 3H45C 3ULDA 3V9ZA 1ATSA 3ASMA 3HP6A 5GAEP 1GLDG 4CERA 3JAMO 1NK9A 5F1XA 1QSSA 4X65K 4JI3K 3L3UA 1NGJA 3DAWA 2Z1GA 4BGAA 2F9TA 3MAQA 3TANA 3CC4N 1D9FA 4JKBA 3ULEA 3LDOA 2W6LA 4OKEA 3O3FA 5C24A 3J7ZO 3HPHA 3SQ4A 4CZIA 5HP1A 4J2EA 1GLLO 3AO5A 3KJVA 3O6WA 4MLHA 5AQFA 4E1NA 4A2AA 3RVCA 1T3VA 5BRDA 5JLHA 1RBVA 1KQSM 1NK8A 1ZBFA 1S1UA 3KTQA 4DUZK 4CFDA 4FCYA 3BZCA 4CIEA 2EHGA 2OPPA 3OS1A 3AVFA 5AJ3K 3GOIA 2HHSA 3P38A 3O08A 3UE5A 1X9MA 3CJCA 1X3MA 2VWBA 1KLMA 3L4QA 4M45A 2KLAA 3P39A 3M8QA 4DR1K 2I7PA 4XEIA 2E2QA 3LWMA 2OPQA 4GMJB 2EX3A 3L0QA 4AF1A 4CJ3A 2F96A 3KZBA 5BN8A 1S6PA 3H1VX 4FJ8A 5E41A 1NJZA 3ITHA 3OYNA 2A1RA 3HL8A 2W40A 2YHXA 2VYPA 4YOXA 2B6AA 3GL1A 1I94K 1D9DA 1S9EA 4OPAA 3SCXA 3QBWA 1XC9A 4LSLA 4M3UA 4G1QA 3LPUA 1D5AA 4FJIA 5JS2A 4EHUA 3D7EO 3QINA 3IAYA 2O8DB 1ZBHA 5JVGL 4FJXA 3HOSA 3LP2A 1YJNN 3VETA 3L2WA 4J2BA 4B1YB 5F0XA 1JLBA 3VQ8A 1HRHA 3SV3A 5AFUA 5C10A 3KD1E 3NH1A 3VQQA 4BVPA 3IDHA 1N8RO 4M63C 4CEZA 3KKRA 3ALYA 1Q18A 1IBKK 4CK3A 4F2RA 1NOZA 2JGUA 4KO0A 5BN9A 1LAVA 1IKXA 3QEXA 2G8FA 4KHWA 3VQDA 1YIJN 5GADP 4K8XA 2HNDA 4BGBA 4CD1A 4IFVA 2DPNA 4FVUA 3OYFA 4DFJA 4Q0BA 1U04A 3IMXA 4WQ4C 3O4NA 3I0SA 3TWHA 3TABA 4BACA 5AQNA 3CCQN 3HK2A 3L8BA 3J81O 1OKJA 3PUFA 4ELTA 1ZBUA 2I7NA 1XNRK 5ADXH 3U8XA 1N5YA 3ID6A 3CJBA 3V9UA 4WE1A 4NCAA 2A40A 3KIOA 1T8EA 4KHQA 2E6LA 2FBVA 4EHTA 1JKHA 2NRXA 3HYFA 2KZZA 3KVGA 4DSLA 3TR8A 3V9XA 3S3NA 2DY4A 3NGYA 3AGKA 3SBGA 4OVLA 4I2PA 1LWEA 4JI5K 4FJ5A 2JWLA 4OKJA 3NVMA 2E2PA 1TK8A 1ZBSA 3HT3A 1NGHA 4LY7A 4JI0K 4H0OA 4R5PA 1HX1A 4KB0A 1QSYA 4Z4IA 1HPMA 1G99A 5GAHP 2UYTA 1RGIA 3PY8A 4KHPK 5C0YA 3P1GA 2WONA 3CM6A 3CCUN 1XQSC 1KSPA 3VQ6A 4BREA 4FXDA 1CZBA 3MEDA 4JV5K 3QESA 4WQ5C 4CJLA 3CD6N 1NJYA 2GUIA 4FLVA 1YVUA 1WAJA 1V4TA 3V9SA 4RG8A 3FZLA 1RDUA 5LL6Z 3WT0A 3OVNA 5FPEA 1VQKN 1JCGA 4BWMA 5GIPA 4HCBA 3F9MA 5E26A 4RW8A 1KFDA 4H03B 3H6EA 2AA4A 4NLBA 4DQIA 4PUOA 3RR7A 2KKZA 3Q7BA 2NRHA 2FBXA 1N32K 4DWIA 4YOUA 2XY8A 3PV8A 4CW7B 4O0JA 1U49A 2QWOA 3WXIA 1YF5L 2QI2A 1RILA 3VQ4A 4DHYA 1K9MO 1WSJA 2E6MA 1VSIA 3L2QA 4W5TA 3I8DA 3I8BA 4CZJA 3ZSQA 4BRMA 1KAXA 1YXQA 1NK6A 4LF6K 4CFBA 4DQSA 1T6DA 2Z1IA 1UWBA 2GTDA 4FL9A 1GOBA 1LOTB 2P9SA 2GBZA 2Y1IA 4PY5A 3CI5A 3K5LA 2OANA 4JKAA 5GIOA 3DM2A 3DOKA 3ZETA 3K5MA 3RMCA 4CF0A 4N56A 3WNHA 4BC2A 4H4MA 3TAEA 4CBWA 1REVA 2VG7A 5DM6L 1N6QA 1N36K 3LWLA 2UXBK 4CE9A 2PY5A 4CJ4A 3FR0A 1BA1A 1HUXA 4MO4A 4CJVA 1GLAG 3PSFA 4HWIA 4K43A 1VQMN 1RNHA 3A2FA 3B6OA 1GOAA 4JLHA 2OZMA 1YUWA 4LH4A 3QIOA 4IZ9A 2DFEA 3FZFA 4N76A 4DV0K 4B9VA 5HRSA 4UQGA 2X78A 2ITMA 4DR2K 4WF9L 4DTNA 1A5WA 3MN9A 3SYZA 1RTDA 3JYTA 5B8HA 4W5QA 4CK1A 3O1BA 4CGDA 1WSHA 2QXFA 5ELZA 3J80O 1SQKA 2YV0X 3DI6A 2E2NA 1SKRA 2QWMA 2KFNA 4PQUA 1N33K 5KGWA 2Z1HA 3NF9A 4PHTX 1P90A 5HBMA 3L2UA 2OTLN 4AHUA 4E3SA 3SAGA 1RT1A 3VPZA 1E4GT 1KXPA 2A42A 3M3ZA 4CHYA 2NRVA 4W5OA 3OA9A 2A3ZA 2Q1NA 4IEEA 2VCPA 2ZF5O 4CEOA 4BRAA 3ZX2A 2QW9A 2YHBA 4E7KA 1WNSA 1SL1A 4A62A 5HOOA 2NNWA 4CF9A
chains in the Genus database with same CATH topology
3WNEA 3KLIA 1J54A 1JXBA 4E7IA 4HUEA 5T7BA 5KRSA 3AVJA 2AJQA 2YNIA 3NAEA 3MXJA 4DSFA 3HVRA 4NCGA 3HPGA 3ZSYA 1NKEA 4EP4A 4AHVA 1RCHA 3M8RA 4M3YA 1XWLA 1TL3A 3V81A 3NHGA 3NGZA 4ZTJA 2RPIA 2QKBA 4IG0A 4M41A 4ID5A 4EP5A 4I7FA 2Q3SA 4FM2A 2OPRA 3VQEA 3QETA 1NK0A 4IBNA 1HYZA 2PYLA 3BGRA 1U48A 3ISNC 4B9TA 3CG7A 3EYZA 3KK1A 3RWUA 4DTOA 3SQ1A 3RR8A 3OYLA 1HNIA 3F73A 3OY9A 3U3YA 1S1XA 1Q9XA 4M3TA 1TGOA 4DFMA 1C6VA 5SWMA 3SUQA 3JSMA 1R0AA 4FJGA 3M8PA 4FJLA 1RTJA 1J9AA 3ZCMA 3PX6A 1X9SA 1S9GA 1HJRA 4TSXA 1XI1A 4IKFA 5JS1A 1KCFA 2B5JA 4BE1A 1T03A 4FJJA 2PYJA 3SV4A 3VQCA 3V6DA 3VQ9A 1C1CA 5HRPA 5SZTA 4JRPA 3OYMA 1JL2A 3MXMA 1J5OA 2DFHA 4CJKA 3KLEA 3ZSOA 1RDAA 1TKXA 3ZT0A 2G8VA 2HHWA 2O4GA 3P5JA 4BE0A 3AV9A 4AHRA 4FYDA 2G8HA 2BGGA 1TVRA 3HSTB 4DSKA 1BI4A 5J2MA 4CHNA 4DTJA 1B9DA 1FK9A 1TKZA 1RT6A 1JLEA 5KI6A 2O4IA 3KLHA 1UA0A 1NJWA 2IS3A 4CJPA 3LZIA 3K2PA 3VQAA 3ZT1A 4YFUA 4AILC 4FXDA 4I2QA 3SZ2A 4KAZA 4NCBA 4N41A 3AA5X 4O0IA 3KK3A 1JLGA 2OZSA 2BDPA 4CJSA 3OYBA 2VG6A 4CF2A 1CXUA 4RW6A 3HO1A 2GV9A 2VWKA 3I0RA 4CK2A 4FK4A 1TV6A 1W0HA 4CJ5A 1HYVA 1BL3A 1BISA 5CYQA 4CECA 3HPOA 2ATQA 3THVA 4KTQA 1L3TA 2D0CA 4I9LA 1KFSA 2P51A 3ULDA 3V9ZA 3ASMA 1BCOA 3AVHA 2HNYA 4Q5VA 3HP6A 4DQQA 2OYQA 4CERA 2KZMA 3LAMA 3ZT2A 1NK9A 1QSSA 3LANA 2ETJA 1VSDA 1HNVA 3L3UA 3ZT3A 4DSJA 2Z1GA 4M3WA 4H4OA 2JLEA 4FLXA 4B9SA 3FFIA 1SKSA 2G8UA 3MAQA 3TANA 1D9FA 3SPYA 3NF7A 1NKCA 5HRRA 5J2NA 2P1JA 2XO7A 3DLKA 4CIFA 4FW1A 3OYHA 1VSKA 4OKEA 3O3FA 1BQNA 3DRSA 5C24A 1S1WA 3LPTA 3HPHA 2VWJA 3SQ4A 5HP1A 1RTHA 4ID1A 4CJWA 4J2EA 5EU7A 3AO5A 4CF8A 3KJVA 4E7JA 4CEEA 3SUNA 3T3FA 3VQPA 3C95A 4E1NA 1QTMA 1L3SA 1Z26A 1KVBA 4OLAA 1SUQA 1RBVA 3MEGA 3SQ2A 5D3GA 1NK8A 4PWDA 4KREA 1ZBFA 1S1UA 3KTQA 3OYIA 3QIPA 4CFDA 4BE2A 4FCYA 4O5BA 4CIEA 2EHGA 2OPPA 3K5OA 3TAMA 5FROA 3AVFA 4NYNA 5J1EA 3OS1A 3KLGA 3L2RA 2HHSA 3RRHA 1A5VA 4E1MA 1X9MA 4M42A 3D45A 5K14A 3OYJA 4DFKA 4M45A 1KLMA 1GOCA 3AO3A 3M8QA 4B08A 3SUPA 1LW0A 5C42A 4CFCA 1WLJA 4DU3A 3LWMA 3CYMA 2OPQA 4RW7A 1NJXA 4GMJB 2EX3A 4F2SA 4B8CA 4C8MA 4CJ3A 2F96A 1S6PA 4DU1A 1NK7A 1UA1A 4FJ8A 5E41A 1S1TA 1NJZA 3MXIA 4KRFA 4FK2A 1JLCA 1LAWA 3T19A 2YNFA 1EX4A 4LSNA 3ITHA 4O4GA 3OYNA 4HUGA 4BDPA 4KHUA 3SPZA 2A1RA 4DQPA 4B3OA 4JS5A 1RTIA 3HL8A 3LDSA 1JLFA 4LD0A 4DU4A 4KTZA 4E0DA 3OS0A 1BHLA 1ZYQA 3PX0A 5KTQA 2XHBA 3LP3A 4ELUA 1Z25A 2B6AA 3ZT4A 1C0MA 3CQ8A 1IKVA 1D9DA 4Y1DA 3K58A 2KFZA 1S9EA 3SCXA 5KRTA 3DYAA 3V1RA 4BDYA 4IG3A 4B9LA 1XC9A 3AVBA 4LSLA 1HQUA 1KVAA 4G1QA 3OS2A 3LPUA 1U4BA 4M3UA 5HROA 4CJRA 3SQ0A 1D5AA 3H08A 4FJIA 1DTQA 3SI6A 1I3AA 5JS2A 3S3OA 4KB1A 4QCLA 1O1WA 3QINA 4CESA 3IAYA 1ZBHA 4FJXA 2HVHA 4DTUA 3LP2A 1SL2A 3L2WA 4J2BA 3K59A 1TK5A 4B9MA 5CY4A 3OYAA 1JLBA 1BGXT 1IKWA 3DLEA 3VQ8A 4DTXA 1IO2A 1HRHA 3SV3A 1ASUA 4FJNA 4F4KA 3TAPA 1KRPA 3KD1E 3K57A 3NH1A 1NK4A 3VQQA 4CHOA 4RW9A 4GW6A 3KKRA 4CEZA 5KGXA 2YNGA 3ALYA 3AA2A 4M3RA 3CFRA 3SUOA 2F8SA 3WNGA 4FM1A 1YTUA 4HVJA 4FZXC 4CK3A 2KW4A 3DLGA 1IH7A 3NBPA 1L5UA 1NOZA 4F2RA 2JGUA 4FJKA 1U47A 4B9UA 2ZQBA 4KO0A 3B6PA 4IFYA 1LAVA 1IKXA 3QEXA 2G8FA 4KHWA 3VQDA 4C8KA 1K6YA 1ASWA 1C1BA 2NUBA 3CM5A 4CEBA 4K8XA 1B9FA 4KHNA 2FBTA 2HNDA 4CEQA 3LZJA 1LV5A 2HHQA 4IFVA 1U45A 4Z4EA 3NH0A 3OYFA 4DFJA 4FW2A 3OJUA 2G8WA 3OYDA 4Q0BA 2HHTA 1U04A 4DG1A 3NGIA 2YKNA 3QEPA 4I9QA 3O4NA 3I0SA 3TWHA 3SJJA 2HVIA 3TABA 4CEAA 4BACA 3HVTA 2X6NA 1UAXA 3L8BA 3HK2A 1VRTA 3PUFA 4C8LA 4LH5A 4ELTA 3ZSWA 3D0PA 1ZBUA 4JRQA 3V1OA 4QOZB 3CFPA 1N5YA 1KTQA 5J2PA 2YHAA 4Z4FA 4CGFA 4OKKA 3VN5A 1S5JA 3V9UA 4WE1A 4NCAA 3KIOA 1T8EA 3IRXA 4KHQA 3LAKA 1Q8IA 2E6LA 2FBVA 4CHPA 4J2DA 1JKHA 3HYFA 2KZZA 3AO1A 3TAGA 4DSLA 3TR8A 3O3GA 1BI4B 3V9XA 3S3NA 4IDKA 1BQMA 2OA8A 3CFOA 1RT2A 1VK0A 5CZ1A 4OPKA 2XY6A 3AO4A 3S3MA 4DSIA 2DY4A 2ZE2A 3AVGA 1SV5A 1JL1A 3NGYA 4CHQA 3U6FA 1LWCA 4OVLA 4FVMA 4I2PA 1LWEA 4DLEA 4AHCA 1X9WA 1NKBA 3AVNA 4FJ5A 2D0AA 4OKJA 2XY5A 3KD5E 4FK0A 5CYMA 1MU2A 4M3ZA 3AVKA 3G0ZA 3QEVA 1TK8A 1S6QA 3HT3A 2HHVA 4LY7A 3TI0A 4R5PA 3C6TA 4KB0A 1QSYA 4Z4IA 2OPSA 5DMRA 3KK2A 4AH9A 2P5GA 3VQ5A 3OYCA 3RTVA 1RDBA 4E7HA 3C6UA 3PY8A 1WN7A 4C8OA 3C94A 1SKWA 3QEWA 5C25A 4H8KA 2D5RA 3P1GA 2WONA 3CM6A 4DTMA 3QERA 2ITGA 4HUFA 4KKOA 4CGIA 1BIZA 3NDKA 3AA3A 1VSEA 1UOCA 5I42A 1KSPA 1CZ9A 3OYEA 4NYFA 1SL1A 3VQ6A 3NE6A 4DTPA 1CZBA 2G8KA 3MEDA 4EZ6A 1VSLA 4KPYA 1L3VA 3QESA 1ZBLA 4KI4A 4MFBA 2YKMA 4CFAA 4W5RA 1JLAA 3VQBA 1T05A 4JS4A 1NOYA 1T7PA 4FJ7A 4KHSA 3IG1A 4PA1A 1WSIA 4DS4A 1KLNA 4CJLA 1X1PA 1DTTA 1TL1A 3NH2A 2PZSA 4FJHA 4F8RA 1NJYA 4CGJA 1BCMA 2GUIA 2B4JA 3DMJA 1ZBIA 4FLVA 3PX4A 3KLFA 3QEIA 5DK5A 1YVUA 1WAJA 4CHZA 1RBSA 2RKIA 3V9SA 4RG8A 2BANA 3LP0A 3U3GA 1I39A 2HHUA 1G15A 5FRMA 3OVNA 4E7LA 2IC3A 4Y1CA 4E19A 3RRGA 4BWMA 4F3TA 1RBUA 3KKSA 3QNOA 4HCBA 4B8AB 1CXQA 4N5SA 4OLBA 4AHTA 4CJQA 4J2AA 4FJ9A 1RBTA 1TKTA 2R7YA 4MQ3A 1IG9A 4RW8A 1KFDA 2X6SA 1QQCA 1RDDA 3NF8A 4DQIA 3RR7A 4PUOA 4Z4GA 1QHTA 3DLRA 1FXXA 1HQEA 4YNQA 2A1SA 2FBXA 3G10A 2WOMA 4DWIA 2QK9A 3HM9A 3MEEA 2XY8A 3HXMA 2KQ2A 4DQRA 3PV8A 2ZD1A 4O0JA 3RMBA 1U49A 1ASVA 2RN2A 1TAQA 1W9HA 3NF6A 1Y97A 2QKKA 3HP9A 2Z1JA 1RILA 1WSFA 4FJMA 4DTSA 3VQ4A 1TK0A 4CJEA 5J2QA 3ZSXA 1HMVA 4Z4HA 3AVIA 1WSGA 3O4QA 2E6MA 1WSJA 1VSIA 3M8SA 3RMDA 1EKEA 1QSLA 1RBRA 1LWFA 4Z0UA 4FLWA 4KFBA 4W5TA 3OYGA 3L2QA 3EZ5A 2HMIA 3I8DA 5I3UA 1FKOA 3NFAA 3ZSZA 1A5XA 3ZSQA 4OPJA 1NK6A 1IKYA 1C0TA 5FRNA 4OJRA 2HHXA 4CFBA 4DQSA 1QS4A 3LP1A 4DTRA 4FZZA 3UIQA 2Z1IA 1JLQA 2DTUA 1UWBA 4HHTA 2HW3A 3IS9A 1RT7A 1TKDA 1GOBA 4C8NA 3AVCA 2Y1JA 2GBZA 2LSNA 2Y1IA 4RW4A 3E01A 4PY5A 3V4IA 1KVCA 3VA0A 3K5LA 3V9WA 4BWJA 3L2VA 2D0BA 3PO4A 2FBYA 3DM2A 3DOKA 3AVAA 3ZSRA 4KHYA 1B92A 2RF2A 3K5MA 1BIUA 4CF0A 4N56A 3WNHA 4FM0A 3RMCA 1SL0A 3OJSA 3ZSVA 3SNNA 1RDCA 3LALA 4ELVA 1ITGA 1LW2A 1WAFA 3MECA 4H4MA 3TAEA 4ZTFA 3V1QA 2YNHA 4OGCA 4DMNA 4HTUA 3K5NA 1REVA 2VG7A 4EZ9A 2XRIA 1VSFA 3P83D 1N6QA 4HCCA 4FLTA 5CZ2A 1F21A 4CEDA 4AHSA 4CCHA 4DSEA 4W5NA 3LWLA 3VA3A 3QLHA 3TAFA 3RMAA 3F9KA 1RT3A 4CE9A 4CJ4A 3TAQA 2PY5A 4Z4CA 3DRRA 1RT5A 4KTWA 4OGEA 4FLUA 4O44A 4DF8A 4CJVA 2FC0A 2IOCA 3AVLA 3HJFA 1XHZA 1NK5A 1RNHA 3A2FA 4BDZA 4FLZA 4CGGA 1D8YA 3B6OA 1GOAA 1VSHA 3L3VA 2KTQA 3BDPA 4JLHA 1YT3A 2OZMA 4LH4A 1WSEA 4CEFA 1HYSA 3DOLA 3QIOA 4CF1A 4L8RB 2DFEA 1RT4A 2I5JA 3NCIA 3WNFA 4DFPA 3O3HA 5HLFA 1VRUA 4N76A 5HRNA 3DLHA 4B9VA 2VG5A 4ICLA 2DFFA 1FKPA 4CGHA 5HRSA 3T1AA 4UQGA 2X78A 4ZHRA 2IAJA 1XHXA 2G8IA 2IGIA 1S1VA 3AA4A 3AVMA 3EY1A 4DTNA 3DLBA 1A5WA 4E89A 4CJTA 4DLGA 3SYZA 1RTDA 3PO5A 3JYTA 4FLYA 2P5OA 4CIGA 1JXEA 4B9NA 1YTAA 3DRPA 4CJUA 4M3XA 4W5QA 4K8ZA 4CK1A 2IDOA 4CGDA 1C1AA 2E4LA 1WSHA 2QXFA 5FDLA 4KV8A 2XY7A 2HB5A 2YV0X 3DI6A 1VSJA 4N47A 1SKRA 1J53A 4XIUA 2KFNA 3TARA 2BE2A 1CLQA 4O55A 4PQUA 1EXQA 5KGWA 2Z1HA 3NF9A 5HBMA 1HPZA 2W42A 3L2UA 1EP4A 4DS5A 2X74A 4AHUA 4E3SA 2F8TA 1RT1A 3QNNA 4KI6A 1EETA 1TAUA 4GVMA 3QO9A 4CHYA 4W5OA 4DF4A 1QE1A 1L3UA 3AO2A 1VSMA 4FZYA 4CEOA 4F3OA 1C0UA 2HNZA 4CJFA 1Q9YA 3VQ7A 2YHBA 4E7KA 1WNSA 3OYKA 1DLOA 4QAGA 3S9HA 4CF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNE A;  3KLI A;  1J54 A;  1JXB A;  4E7I A;  4HUE A;  5T7B A;  5KRS A;  3AVJ A;  2AJQ A;  2YNI A;  3NAE A;  3MXJ A;  4DSF A;  3HVR A;  4NCG A;  3HPG A;  3ZSY A;  1NKE A;  4EP4 A;  4AHV A;  1RCH A;  3M8R A;  4M3Y A;  1XWL A;  1TL3 A;  3V81 A;  3NHG A;  3NGZ A;  4ZTJ A;  2RPI A;  2QKB A;  4IG0 A;  4M41 A;  4ID5 A;  4EP5 A;  4I7F A;  2Q3S A;  4FM2 A;  2OPR A;  3VQE A;  3QET A;  1NK0 A;  4IBN A;  1HYZ A;  2PYL A;  3BGR A;  1U48 A;  3ISN C;  4B9T A;  3CG7 A;  3EYZ A;  3KK1 A;  3RWU A;  4DTO A;  3SQ1 A;  3RR8 A;  3OYL A;  1HNI A;  3F73 A;  3OY9 A;  3U3Y A;  1S1X A;  1Q9X A;  4M3T A;  1TGO A;  4DFM A;  1C6V A;  5SWM A;  3SUQ A;  3JSM A;  1R0A A;  4FJG A;  3M8P A;  4FJL A;  1RTJ A;  1J9A A;  3ZCM A;  3PX6 A;  1X9S A;  1S9G A;  1HJR A;  4TSX A;  1XI1 A;  4IKF A;  5JS1 A;  1KCF A;  2B5J A;  4BE1 A;  1T03 A;  4FJJ A;  2PYJ A;  3SV4 A;  3VQC A;  3V6D A;  3VQ9 A;  1C1C A;  5HRP A;  5SZT A;  4JRP A;  3OYM A;  1JL2 A;  3MXM A;  1J5O A;  2DFH A;  4CJK A;  3KLE A;  3ZSO A;  1RDA A;  1TKX A;  3ZT0 A;  2G8V A;  2HHW A;  2O4G A;  3P5J A;  4BE0 A;  3AV9 A;  4AHR A;  4FYD A;  2G8H A;  2BGG A;  1TVR A;  3HST B;  4DSK A;  1BI4 A;  5J2M A;  4CHN A;  4DTJ A;  1B9D A;  1FK9 A;  1TKZ A;  1RT6 A;  1JLE A;  5KI6 A;  2O4I A;  3KLH A;  1UA0 A;  1NJW A;  2IS3 A;  4CJP A;  3LZI A;  3K2P A;  3VQA A;  3ZT1 A;  4YFU A;  4AIL C;  4FXD A;  4I2Q A;  3SZ2 A;  4KAZ A;  4NCB A;  4N41 A;  3AA5 X;  4O0I A;  3KK3 A;  1JLG A;  2OZS A;  2BDP A;  4CJS A;  3OYB A;  2VG6 A;  4CF2 A;  1CXU A;  4RW6 A;  3HO1 A;  2GV9 A;  2VWK A;  3I0R A;  4CK2 A;  4FK4 A;  1TV6 A;  1W0H A;  4CJ5 A;  1HYV A;  1BL3 A;  1BIS A;  5CYQ A;  4CEC A;  3HPO A;  2ATQ A;  3THV A;  4KTQ A;  1L3T A;  2D0C A;  4I9L A;  1KFS A;  2P51 A;  3ULD A;  3V9Z A;  3ASM A;  1BCO A;  3AVH A;  2HNY A;  4Q5V A;  3HP6 A;  4DQQ A;  2OYQ A;  4CER A;  2KZM A;  3LAM A;  3ZT2 A;  1NK9 A;  1QSS A;  3LAN A;  2ETJ A;  1VSD A;  1HNV A;  3L3U A;  3ZT3 A;  4DSJ A;  2Z1G A;  4M3W A;  4H4O A;  2JLE A;  4FLX A;  4B9S A;  3FFI A;  1SKS A;  2G8U A;  3MAQ A;  3TAN A;  1D9F A;  3SPY A;  3NF7 A;  1NKC A;  5HRR A;  5J2N A;  2P1J A;  2XO7 A;  3DLK A;  4CIF A;  4FW1 A;  3OYH A;  1VSK A;  4OKE A;  3O3F A;  1BQN A;  3DRS A;  5C24 A;  1S1W A;  3LPT A;  3HPH A;  2VWJ A;  3SQ4 A;  5HP1 A;  1RTH A;  4ID1 A;  4CJW A;  4J2E A;  5EU7 A;  3AO5 A;  4CF8 A;  3KJV A;  4E7J A;  4CEE A;  3SUN A;  3T3F A;  3VQP A;  3C95 A;  4E1N A;  1QTM A;  1L3S A;  1Z26 A;  1KVB A;  4OLA A;  1SUQ A;  1RBV A;  3MEG A;  3SQ2 A;  5D3G A;  1NK8 A;  4PWD A;  4KRE A;  1ZBF A;  1S1U A;  3KTQ A;  3OYI A;  3QIP A;  4CFD A;  4BE2 A;  4FCY A;  4O5B A;  4CIE A;  2EHG A;  2OPP A;  3K5O A;  3TAM A;  5FRO A;  3AVF A;  4NYN A;  5J1E A;  3OS1 A;  3KLG A;  3L2R A;  2HHS A;  3RRH A;  1A5V A;  4E1M A;  1X9M A;  4M42 A;  3D45 A;  5K14 A;  3OYJ A;  4DFK A;  4M45 A;  1KLM A;  1GOC A;  3AO3 A;  3M8Q A;  4B08 A;  3SUP A;  1LW0 A;  5C42 A;  4CFC A;  1WLJ A;  4DU3 A;  3LWM A;  3CYM A;  2OPQ A;  4RW7 A;  1NJX A;  4GMJ B;  2EX3 A;  4F2S A;  4B8C A;  4C8M A;  4CJ3 A;  2F96 A;  1S6P A;  4DU1 A;  1NK7 A;  1UA1 A;  4FJ8 A;  5E41 A;  1S1T A;  1NJZ A;  3MXI A;  4KRF A;  4FK2 A;  1JLC A;  1LAW A;  3T19 A;  2YNF A;  1EX4 A;  4LSN A;  3ITH A;  4O4G A;  3OYN A;  4HUG A;  4BDP A;  4KHU A;  3SPZ A;  2A1R A;  4DQP A;  4B3O A;  4JS5 A;  1RTI A;  3HL8 A;  3LDS A;  1JLF A;  4LD0 A;  4DU4 A;  4KTZ A;  4E0D A;  3OS0 A;  1BHL A;  1ZYQ A;  3PX0 A;  5KTQ A;  2XHB A;  3LP3 A;  4ELU A;  1Z25 A;  2B6A A;  3ZT4 A;  1C0M A;  3CQ8 A;  1IKV A;  1D9D A;  4Y1D A;  3K58 A;  2KFZ A;  1S9E A;  3SCX A;  5KRT A;  3DYA A;  3V1R A;  4BDY A;  4IG3 A;  4B9L A;  1XC9 A;  3AVB A;  4LSL A;  1HQU A;  1KVA A;  4G1Q A;  3OS2 A;  3LPU A;  1U4B A;  4M3U A;  5HRO A;  4CJR A;  3SQ0 A;  1D5A A;  3H08 A;  4FJI A;  1DTQ A;  3SI6 A;  1I3A A;  5JS2 A;  3S3O A;  4KB1 A;  4QCL A;  1O1W A;  3QIN A;  4CES A;  3IAY A;  1ZBH A;  4FJX A;  2HVH A;  4DTU A;  3LP2 A;  1SL2 A;  3L2W A;  4J2B A;  3K59 A;  1TK5 A;  4B9M A;  5CY4 A;  3OYA A;  1JLB A;  1BGX T;  1IKW A;  3DLE A;  3VQ8 A;  4DTX A;  1IO2 A;  1HRH A;  3SV3 A;  1ASU A;  4FJN A;  4F4K A;  3TAP A;  1KRP A;  3KD1 E;  3K57 A;  3NH1 A;  1NK4 A;  3VQQ A;  4CHO A;  4RW9 A;  4GW6 A;  3KKR A;  4CEZ A;  5KGX A;  2YNG A;  3ALY A;  3AA2 A;  4M3R A;  3CFR A;  3SUO A;  2F8S A;  3WNG A;  4FM1 A;  1YTU A;  4HVJ A;  4FZX C;  4CK3 A;  2KW4 A;  3DLG A;  1IH7 A;  3NBP A;  1L5U A;  1NOZ A;  4F2R A;  2JGU A;  4FJK A;  1U47 A;  4B9U A;  2ZQB A;  4KO0 A;  3B6P A;  4IFY A;  1LAV A;  1IKX A;  3QEX A;  2G8F A;  4KHW A;  3VQD A;  4C8K A;  1K6Y A;  1ASW A;  1C1B A;  2NUB A;  3CM5 A;  4CEB A;  4K8X A;  1B9F A;  4KHN A;  2FBT A;  2HND A;  4CEQ A;  3LZJ A;  1LV5 A;  2HHQ A;  4IFV A;  1U45 A;  4Z4E A;  3NH0 A;  3OYF A;  4DFJ A;  4FW2 A;  3OJU A;  2G8W A;  3OYD A;  4Q0B A;  2HHT A;  1U04 A;  4DG1 A;  3NGI A;  2YKN A;  3QEP A;  4I9Q A;  3O4N A;  3I0S A;  3TWH A;  3SJJ A;  2HVI A;  3TAB A;  4CEA A;  4BAC A;  3HVT A;  2X6N A;  1UAX A;  3L8B A;  3HK2 A;  1VRT A;  3PUF A;  4C8L A;  4LH5 A;  4ELT A;  3ZSW A;  3D0P A;  1ZBU A;  4JRQ A;  3V1O A;  4QOZ B;  3CFP A;  1N5Y A;  1KTQ A;  5J2P A;  2YHA A;  4Z4F A;  4CGF A;  4OKK A;  3VN5 A;  1S5J A;  3V9U A;  4WE1 A;  4NCA A;  3KIO A;  1T8E A;  3IRX A;  4KHQ A;  3LAK A;  1Q8I A;  2E6L A;  2FBV A;  4CHP A;  4J2D A;  1JKH A;  3HYF A;  2KZZ A;  3AO1 A;  3TAG A;  4DSL A;  3TR8 A;  3O3G A;  1BI4 B;  3V9X A;  3S3N A;  4IDK A;  1BQM A;  2OA8 A;  3CFO A;  1RT2 A;  1VK0 A;  5CZ1 A;  4OPK A;  2XY6 A;  3AO4 A;  3S3M A;  4DSI A;  2DY4 A;  2ZE2 A;  3AVG A;  1SV5 A;  1JL1 A;  3NGY A;  4CHQ A;  3U6F A;  1LWC A;  4OVL A;  4FVM A;  4I2P A;  1LWE A;  4DLE A;  4AHC A;  1X9W A;  1NKB A;  3AVN A;  4FJ5 A;  2D0A A;  4OKJ A;  2XY5 A;  3KD5 E;  4FK0 A;  5CYM A;  1MU2 A;  4M3Z A;  3AVK A;  3G0Z A;  3QEV A;  1TK8 A;  1S6Q A;  3HT3 A;  2HHV A;  4LY7 A;  3TI0 A;  4R5P A;  3C6T A;  4KB0 A;  1QSY A;  4Z4I A;  2OPS A;  5DMR A;  3KK2 A;  4AH9 A;  2P5G A;  3VQ5 A;  3OYC A;  3RTV A;  1RDB A;  4E7H A;  3C6U A;  3PY8 A;  1WN7 A;  4C8O A;  3C94 A;  1SKW A;  3QEW A;  5C25 A;  4H8K A;  2D5R A;  3P1G A;  2WON A;  3CM6 A;  4DTM A;  3QER A;  2ITG A;  4HUF A;  4KKO A;  4CGI A;  1BIZ A;  3NDK A;  3AA3 A;  1VSE A;  1UOC A;  5I42 A;  1KSP A;  1CZ9 A;  3OYE A;  4NYF A;  1SL1 A;  3VQ6 A;  3NE6 A;  4DTP A;  1CZB A;  2G8K A;  3MED A;  4EZ6 A;  1VSL A;  4KPY A;  1L3V A;  3QES A;  1ZBL A;  4KI4 A;  4MFB A;  2YKM A;  4CFA A;  4W5R A;  1JLA A;  3VQB A;  1T05 A;  4JS4 A;  1NOY A;  1T7P A;  4FJ7 A;  4KHS A;  3IG1 A;  4PA1 A;  1WSI A;  4DS4 A;  1KLN A;  4CJL A;  1X1P A;  1DTT A;  1TL1 A;  3NH2 A;  2PZS A;  4FJH A;  4F8R A;  1NJY A;  4CGJ A;  1BCM A;  2GUI A;  2B4J A;  3DMJ A;  1ZBI A;  4FLV A;  3PX4 A;  3KLF A;  3QEI A;  5DK5 A;  1YVU A;  1WAJ A;  4CHZ A;  1RBS A;  2RKI A;  3V9S A;  4RG8 A;  2BAN A;  3LP0 A;  3U3G A;  1I39 A;  2HHU A;  1G15 A;  5FRM A;  3OVN A;  4E7L A;  2IC3 A;  4Y1C A;  4E19 A;  3RRG A;  4BWM A;  4F3T A;  1RBU A;  3KKS A;  3QNO A;  4HCB A;  4B8A B;  1CXQ A;  4N5S A;  4OLB A;  4AHT A;  4CJQ A;  4J2A A;  4FJ9 A;  1RBT A;  1TKT A;  2R7Y A;  4MQ3 A;  1IG9 A;  4RW8 A;  1KFD A;  2X6S A;  1QQC A;  1RDD A;  3NF8 A;  4DQI A;  3RR7 A;  4PUO A;  4Z4G A;  1QHT A;  3DLR A;  1FXX A;  1HQE A;  4YNQ A;  2A1S A;  2FBX A;  3G10 A;  2WOM A;  4DWI A;  2QK9 A;  3HM9 A;  3MEE A;  2XY8 A;  3HXM A;  2KQ2 A;  4DQR A;  3PV8 A;  2ZD1 A;  4O0J A;  3RMB A;  1U49 A;  1ASV A;  2RN2 A;  1TAQ A;  1W9H A;  3NF6 A;  1Y97 A;  2QKK A;  3HP9 A;  2Z1J A;  1RIL A;  1WSF A;  4FJM A;  4DTS A;  3VQ4 A;  1TK0 A;  4CJE A;  5J2Q A;  3ZSX A;  1HMV A;  4Z4H A;  3AVI A;  1WSG A;  3O4Q A;  2E6M A;  1WSJ A;  1VSI A;  3M8S A;  3RMD A;  1EKE A;  1QSL A;  1RBR A;  1LWF A;  4Z0U A;  4FLW A;  4KFB A;  4W5T A;  3OYG A;  3L2Q A;  3EZ5 A;  2HMI A;  3I8D A;  5I3U A;  1FKO A;  3NFA A;  3ZSZ A;  1A5X A;  3ZSQ A;  4OPJ A;  1NK6 A;  1IKY A;  1C0T A;  5FRN A;  4OJR A;  2HHX A;  4CFB A;  4DQS A;  1QS4 A;  3LP1 A;  4DTR A;  4FZZ A;  3UIQ A;  2Z1I A;  1JLQ A;  2DTU A;  1UWB A;  4HHT A;  2HW3 A;  3IS9 A;  1RT7 A;  1TKD A;  1GOB A;  4C8N A;  3AVC A;  2Y1J A;  2GBZ A;  2LSN A;  2Y1I A;  4RW4 A;  3E01 A;  4PY5 A;  3V4I A;  1KVC A;  3VA0 A;  3K5L A;  3V9W A;  4BWJ A;  3L2V A;  2D0B A;  3PO4 A;  2FBY A;  3DM2 A;  3DOK A;  3AVA A;  3ZSR A;  4KHY A;  1B92 A;  2RF2 A;  3K5M A;  1BIU A;  4CF0 A;  4N56 A;  3WNH A;  4FM0 A;  3RMC A;  1SL0 A;  3OJS A;  3ZSV A;  3SNN A;  1RDC A;  3LAL A;  4ELV A;  1ITG A;  1LW2 A;  1WAF A;  3MEC A;  4H4M A;  3TAE A;  4ZTF A;  3V1Q A;  2YNH A;  4OGC A;  4DMN A;  4HTU A;  3K5N A;  1REV A;  2VG7 A;  4EZ9 A;  2XRI A;  1VSF A;  3P83 D;  1N6Q A;  4HCC A;  4FLT A;  5CZ2 A;  1F21 A;  4CED A;  4AHS A;  4CCH A;  4DSE A;  4W5N A;  3LWL A;  3VA3 A;  3QLH A;  3TAF A;  3RMA A;  3F9K A;  1RT3 A;  4CE9 A;  4CJ4 A;  3TAQ A;  2PY5 A;  4Z4C A;  3DRR A;  1RT5 A;  4KTW A;  4OGE A;  4FLU A;  4O44 A;  4DF8 A;  4CJV A;  2FC0 A;  2IOC A;  3AVL A;  3HJF A;  1XHZ A;  1NK5 A;  1RNH A;  3A2F A;  4BDZ A;  4FLZ A;  4CGG A;  1D8Y A;  3B6O A;  1GOA A;  1VSH A;  3L3V A;  2KTQ A;  3BDP A;  4JLH A;  1YT3 A;  2OZM A;  4LH4 A;  1WSE A;  4CEF A;  1HYS A;  3DOL A;  3QIO A;  4CF1 A;  4L8R B;  2DFE A;  1RT4 A;  2I5J A;  3NCI A;  3WNF A;  4DFP A;  3O3H A;  5HLF A;  1VRU A;  4N76 A;  5HRN A;  3DLH A;  4B9V A;  2VG5 A;  4ICL A;  2DFF A;  1FKP A;  4CGH A;  5HRS A;  3T1A A;  4UQG A;  2X78 A;  4ZHR A;  2IAJ A;  1XHX A;  2G8I A;  2IGI A;  1S1V A;  3AA4 A;  3AVM A;  3EY1 A;  4DTN A;  3DLB A;  1A5W A;  4E89 A;  4CJT A;  4DLG A;  3SYZ A;  1RTD A;  3PO5 A;  3JYT A;  4FLY A;  2P5O A;  4CIG A;  1JXE A;  4B9N A;  1YTA A;  3DRP A;  4CJU A;  4M3X A;  4W5Q A;  4K8Z A;  4CK1 A;  2IDO A;  4CGD A;  1C1A A;  2E4L A;  1WSH A;  2QXF A;  5FDL A;  4KV8 A;  2XY7 A;  2HB5 A;  2YV0 X;  3DI6 A;  1VSJ A;  4N47 A;  1SKR A;  1J53 A;  4XIU A;  2KFN A;  3TAR A;  2BE2 A;  1CLQ A;  4O55 A;  4PQU A;  1EXQ A;  5KGW A;  2Z1H A;  3NF9 A;  5HBM A;  1HPZ A;  2W42 A;  3L2U A;  1EP4 A;  4DS5 A;  2X74 A;  4AHU A;  4E3S A;  2F8T A;  1RT1 A;  3QNN A;  4KI6 A;  1EET A;  1TAU A;  4GVM A;  3QO9 A;  4CHY A;  4W5O A;  4DF4 A;  1QE1 A;  1L3U A;  3AO2 A;  1VSM A;  4FZY A;  4CEO A;  4F3O A;  1C0U A;  2HNZ A;  4CJF A;  1Q9Y A;  3VQ7 A;  2YHB A;  4E7K A;  1WNS A;  3OYK A;  1DLO A;  4QAG A;  3S9H A;  4CF9 A; 
#chains in the Genus database with same CATH topology
 3WNE A;  5TKY A;  4BG9 A;  1MDU B;  2V51 B;  3MXJ A;  3MMV A;  1XMQ K;  3DJC A;  1YI2 N;  3HZ6 A;  1RCH A;  1TL3 A;  3V81 A;  1ATN A;  3U4L A;  2RPI A;  4ZTJ A;  3AAQ A;  4IG0 A;  3A0I X;  5LY3 A;  4FM2 A;  2GEL A;  2OPR A;  3ENH A;  2PYL A;  4B3R K;  3BGR A;  3TPQ A;  3KK1 A;  5LJW A;  4DTO A;  3RR8 A;  4R79 A;  2W6K A;  4YOT A;  4LF5 K;  5AFU H;  3U3Y A;  3W3D A;  4M3T A;  4BG8 A;  1TGO A;  1R0A A;  3JSM A;  4FJL A;  1RTJ A;  1J9A A;  3PX6 A;  1X9S A;  1HJR A;  4C1N K;  4FWM A;  2B5J A;  1T03 A;  2ZWH A;  3ZX3 A;  5BR9 A;  3V6D A;  1C1C A;  3MXM A;  3R9P A;  4BR2 A;  4CJ7 A;  2G8V A;  2HHW A;  3LM9 A;  3O80 A;  3MN7 A;  1BI4 A;  3TU5 A;  5KQ8 A;  4DTJ A;  3VGM A;  1B9D A;  2ZGY A;  1TKZ A;  1RT6 A;  5J2M A;  2GUP A;  2YHY A;  4CJP A;  3LZI A;  3R1X A;  4AIL C;  4N41 A;  2P9N A;  4O0I A;  2HST A;  4CJS A;  4CF2 A;  4RW6 A;  3HO1 A;  2PAV A;  1BL3 A;  3HPO A;  1ZXO A;  2H3G X;  2D0C A;  4I9L A;  1FJG K;  5CR4 A;  4BRG A;  1HR0 K;  1KFS A;  3E66 A;  5AR0 A;  1IBL K;  3AVH A;  2OYQ A;  2HNY A;  2KZM A;  3UB5 A;  3ZT2 A;  2UXC K;  2ETJ A;  4BC4 A;  4H0X B;  3R3L A;  2QWQ A;  2JLE A;  4FLX A;  4DKW A;  3SPY A;  5HRR A;  5M1Q A;  3WQU A;  4CZF A;  2P1J A;  3DLK A;  4YDU C;  1BQN A;  3VEW A;  4X64 K;  1S1W A;  1U6Z A;  4B1X B;  1WOQ A;  4E7J A;  3T3F A;  1RDW X;  4BY9 C;  3TSQ A;  4B1W B;  1KVB A;  4QS9 A;  3SQ2 A;  3WXK A;  4KRE A;  3HBT A;  3HI0 A;  3LDQ A;  4JI1 K;  3AGR A;  3OYI A;  1R59 O;  4J8F A;  2QWR A;  4AM7 A;  3K5O A;  3TAM A;  3KLG A;  3L2R A;  3CXC M;  2GWK A;  3T7Z A;  4EFH A;  4NB4 A;  1A5V A;  4E1M A;  4M42 A;  2E2O A;  4DFK A;  3D2E B;  5FPN A;  1GOC A;  3AO3 A;  4B08 A;  3E1Y A;  3SUP A;  1LW0 A;  4H0Y B;  1H1V A;  2YCH A;  4BRN A;  4DU3 A;  3CYM A;  4BRH A;  2BUP A;  3FE1 A;  1NJX A;  4F2S A;  4B8C A;  1E4F T;  4H0P A;  5GIN A;  3TTD A;  1UA1 A;  1JLC A;  1LAW A;  3CC2 N;  3T19 A;  1OH8 A;  1NMD A;  4DUY K;  3LDS A;  4E0D A;  3OS0 A;  1ZYQ A;  1DGK N;  2XHB A;  1Z25 A;  2P9K A;  1YJ9 N;  3BEX A;  3CQ8 A;  2CH6 A;  5JLF A;  4B9L A;  1J6Z A;  4X62 K;  1BDG A;  1KVA A;  3QB0 A;  1U4B A;  4Z4E A;  5HRO A;  4CJR A;  3IUC A;  2QA4 N;  3SI6 A;  1I3A A;  5LJV A;  3CCR N;  1GLF O;  3GDQ A;  1SL2 A;  3A5N C;  3EKS A;  3DXK A;  2P9U B;  5CY4 A;  3OYA A;  1BGX T;  1IKW A;  3DLE A;  3UKU A;  1ASU A;  5LMN K;  3TAP A;  2Q0R A;  4A59 A;  3VGL A;  4CHO A;  4GW6 A;  1X3N A;  5I9E B;  3AA2 A;  3THY B;  2IVP A;  4JK8 A;  3G6E N;  1YTU A;  2KW4 A;  4U7B A;  3NBP A;  1L5U A;  2ZQB A;  5M1P A;  3B6P A;  4IFY A;  2O8B B;  4C8K A;  4DR7 K;  4RCH A;  4CEB A;  4KHN A;  1B9F A;  2HHQ A;  1LV5 A;  1U45 A;  2HBJ A;  3EE8 A;  4UY8 O;  4AQY K;  4JI8 K;  4FW2 A;  5BRH A;  3CHW A;  3OYD A;  3OJU A;  2YKN A;  3QEP A;  3BY5 A;  4QS7 A;  4DR6 K;  1HLU A;  4CBX A;  4LH5 A;  3P4I A;  3ZSW A;  2CGL A;  3D0P A;  3V1O A;  5J2P A;  2YHA A;  4O8K A;  4Z4F A;  5M1K A;  4CGF A;  1NG9 A;  4PKI A;  2P9K B;  2WUS A;  4XH5 A;  1Q8I A;  2FSK A;  3TAG A;  4U67 L;  5GAG P;  3CFO A;  5CZ1 A;  2XY6 A;  1NGG A;  3AO4 A;  3HTV A;  1X9W A;  3A5O C;  3L6Q A;  1NGC A;  2D4W A;  4IO8 A;  1QQM A;  1MU2 A;  4BR7 A;  1TYQ A;  4JYA K;  2QEX N;  4K25 A;  5KQD A;  3CPE A;  1P8Z A;  2P5G A;  5DMR A;  3VQ5 A;  1IBM K;  1XNQ K;  3C94 A;  3D6R A;  1SKW A;  4YOV A;  5AQH A;  4HUF A;  3AA3 A;  1UOC A;  4IOA L;  3VEO A;  1NMN A;  4NYF A;  1FW6 A;  4ISF A;  5EX5 A;  1ZBL A;  4MFB A;  2YKM A;  4CFA A;  4W5R A;  1T7P A;  4JS4 A;  3WXL A;  1YJW N;  4FJ7 A;  3IG1 A;  4DS4 A;  2E88 A;  3O9T A;  1NM1 A;  2PFU A;  3CJ1 A;  3NH2 A;  4K41 A;  4CGJ A;  1BCM A;  3THW B;  2AP1 A;  4CZH A;  1VQ6 N;  1WB9 A;  3QEI A;  5DK5 A;  4CHZ A;  1RBS A;  3QML A;  1I39 A;  2HHU A;  4A5B A;  4B8A B;  3QBX A;  4AHT A;  4DV7 K;  1HJO A;  1RBT A;  3D2F B;  1QQC A;  3NF8 A;  5KPR A;  2P9S B;  3S41 A;  1QHT A;  3DLR A;  5F2R A;  1FXX A;  4JK9 A;  3O9U A;  3CPW M;  3G10 A;  2QK9 A;  3HM9 A;  3I33 A;  3MEE A;  4KBO A;  3HXM A;  2KQ2 A;  4DQR A;  3RMB A;  4GY2 B;  3FFK B;  4JI4 K;  4AM6 A;  3A5L C;  5BPM A;  4DTS A;  1HKC A;  1K8K B;  4Z4H A;  4B1U B;  3O4Q A;  3M8S A;  3G71 N;  4LFC K;  1LWF A;  4Z0U A;  4A2B A;  2HMI A;  5I3U A;  4DR4 K;  1KC8 O;  2GX9 A;  3NFA A;  3ZSZ A;  4OPJ A;  3CJ9 A;  2HHX A;  1NLV A;  4DTR A;  3FZM A;  2E1Y A;  3UIQ A;  4FZZ A;  3G4S N;  1MWK A;  3N4Q A;  1TKD A;  4IO9 L;  3AVC A;  5DM7 L;  3E01 A;  2V7Z A;  4CZM A;  1C0G A;  3ZSR A;  3AVA A;  1BIU A;  4FM0 A;  2CGK A;  3ZSV A;  1ITG A;  1LW2 A;  1WAF A;  1SS6 A;  1BOT O;  3V1Q A;  2YNH A;  4HTU A;  2UUC K;  3OHR A;  2XRI A;  1VSF A;  2HF3 A;  4FLT A;  3HSC A;  4AHS A;  4CCH A;  3WEE A;  4W5N A;  4JHD B;  3TAQ A;  5JVH L;  4YOY A;  4MDB A;  2WBN A;  3DRR A;  5EVZ A;  3LDP A;  1RT5 A;  4OPH A;  4FOI A;  5AQV A;  2IOC A;  3AVL A;  1NK5 A;  4GNI A;  4WYB A;  4BC5 A;  1YT3 A;  2YI1 A;  4CF1 A;  4PKG A;  4L8R B;  4JI2 K;  4JKH A;  2I5J A;  1K8K A;  3SLC A;  2HMP A;  3F2K A;  4ZHR A;  4DV4 K;  2IAJ A;  2IGI A;  3EY1 A;  4DLG A;  4FLY A;  4B9N A;  4B3S K;  4K8Z A;  2IDO A;  2FSJ A;  5FDL A;  3SAF A;  1VSJ A;  2QM1 A;  3TAR A;  2BE2 A;  3O5B A;  4O55 A;  1EWQ A;  3WXJ A;  2W42 A;  4A57 A;  4BR4 A;  4KI6 A;  3CIP A;  1EET A;  2A41 A;  1TAU A;  4GVM A;  3QO9 A;  4WFB L;  2FF6 A;  1QE1 A;  4KH4 A;  1VSM A;  1Q9Y A;  4CJF A;  3VQ7 A;  4PL7 A;  1DLO A;  2HVH A;  3CCE N;  2F9W A;  4FO0 A;  5AQX A;  2A6A A;  3KLI A;  1JXB A;  3FLC O;  5T7B A;  5KRS A;  4YHH K;  3AVJ A;  2AJQ A;  3NAE A;  4DSF A;  3ZSY A;  1NKE A;  4OX9 K;  3MN6 A;  3ZLJ A;  3NHG A;  3C7N B;  1WBB A;  4CBU A;  2QKB A;  4EP5 A;  1QHA A;  3KWI A;  2O8B A;  2Q3S A;  2UUA K;  3VQE A;  3THX B;  2E20 A;  1Q82 O;  1U48 A;  3SQ1 A;  1HNI A;  1Q9X A;  4JI6 K;  4H0V B;  2VQE K;  4IKF A;  4TSX A;  3P31 A;  4MLE A;  3SV4 A;  3VQC A;  5AQL A;  4JRP A;  5HRP A;  3N4P A;  1JL2 A;  2DFH A;  5C2D A;  1RDA A;  5IWA K;  2CGJ A;  4FWL A;  4FYD A;  2G8H A;  4DSK A;  3C65 A;  5KI6 A;  2O4I A;  1JLE A;  3KLH A;  4JKC A;  4YFU A;  4KAZ A;  1JLG A;  2OZS A;  3OYB A;  3JS6 A;  3GE1 A;  4ISE A;  2GV9 A;  2VWK A;  4BR9 A;  1TV6 A;  3MN5 A;  2P9P B;  1TYQ B;  1L3T A;  4DR5 K;  4QS8 A;  2ASO A;  3BZK A;  3LAM A;  3LAN A;  2E8A A;  2ZJQ L;  1YIT N;  1HNV A;  3O1W A;  4XH1 A;  1JCF A;  3ENB A;  4H4O A;  3FFI A;  5M1F A;  3GG4 A;  1SKS A;  2G8U A;  3NF7 A;  5J2N A;  5AQS A;  3OW2 M;  3A5M C;  4CIF A;  4IJA A;  1VSK A;  3DRS A;  1RTH A;  4CJW A;  5EXW A;  4CF8 A;  2UUB K;  4CEE A;  5M1N A;  1JJ2 M;  3VQP A;  5JIC A;  2F4V K;  1SUQ A;  5D3G A;  4PWD A;  5LMU K;  2O8E B;  5TKW A;  3QIP A;  3T1Y K;  4O5B A;  2UXD K;  4YY3 K;  4HHT A;  5FRO A;  3SAH A;  3TTC A;  3VF2 A;  3RRH A;  3M6G A;  1CZA N;  3D45 A;  3OYJ A;  3W0L A;  4WQ5 A;  4DR3 K;  5C42 A;  2NRZ A;  1KAZ A;  3VEN A;  2P9U A;  4RW7 A;  3UKU B;  4C8M A;  4KRF A;  4LSN A;  5AQJ A;  4HUG A;  4BDP A;  4B3O A;  4DQP A;  2E1Z A;  3EE9 A;  4LD0 A;  4KTZ A;  5AQW A;  3VER A;  3VEV A;  2QWN A;  2O8C B;  3BP8 A;  3LP3 A;  3ZT4 A;  4BRK A;  1Y64 A;  5CHI A;  2KFZ A;  3BUZ B;  5KRT A;  4BDY A;  5C15 A;  1QZ6 A;  5AQZ A;  3OS2 A;  5CE3 A;  3SQ0 A;  3H08 A;  1DTQ A;  2O8E A;  4QCL A;  1O1W A;  4CES A;  3THW A;  2Q31 A;  4YOR A;  1HNW K;  2FSN A;  4O5F A;  4DTX A;  2GWJ A;  2NRR A;  1KRP A;  1DT9 A;  3K57 A;  2V7Y A;  2VGN A;  1NU0 A;  3C0B A;  3RSE B;  2YNG A;  3NVK A;  3WNG A;  4FM1 A;  4FZX C;  1W97 L;  3DLG A;  1ILY A;  1M1K O;  1U47 A;  3TSP A;  1K8A O;  3EZW A;  3KWG A;  1IG8 A;  3CM5 A;  4CZL A;  2HHT A;  2G8W A;  4CVN E;  4DG1 A;  2HVI A;  3SJJ A;  4V19 S;  3HVT A;  4WFN L;  2X6N A;  3VEY A;  4JHD A;  1VRT A;  4C8L A;  1WBD A;  4B1Z A;  1IV0 A;  1VQ5 N;  4H5N A;  4BRP A;  2P9I B;  4DV2 K;  1JCE A;  3VN5 A;  3IRX A;  3LAK A;  1NGF A;  2Q36 A;  3R6M A;  3AO1 A;  1VQN N;  3E9L A;  5FPD A;  3O3G A;  4GVE A;  2OA8 A;  3K0S A;  3S3M A;  4JI7 K;  5AQI A;  4B9Q A;  1SV5 A;  1LWC A;  4FVM A;  4DLE A;  4JKE A;  3L4I A;  3BF3 A;  2D0A A;  1M90 O;  2XY5 A;  3KD5 E;  4FK0 A;  4M3Z A;  3AVK A;  3G0Z A;  1S6Q A;  2HHV A;  3TI0 A;  4WCE L;  3C6T A;  2OPS A;  3KK2 A;  4AH9 A;  5HL7 L;  3RTV A;  1RDB A;  4E7H A;  3C6U A;  4L3Q A;  4GKJ K;  4JNE A;  5C25 A;  4F9O A;  2D5R A;  4DTM A;  2ITG A;  3F5T A;  5I42 A;  2NZT A;  1CZ9 A;  3CJA A;  2G8K A;  4EZ6 A;  4DTP A;  4KPY A;  4KI4 A;  1L3V A;  3MDQ A;  4B3M K;  1NOY A;  4PA1 A;  1WSI A;  1X1P A;  3SBT A;  2HBM A;  4F8R A;  3EEQ A;  2B4J A;  4IFE A;  1ZBI A;  1C0F A;  3WEE B;  2RKI A;  3VMF B;  1BU6 O;  4LF8 K;  4JKF A;  1RFQ A;  4FWQ A;  1VQL N;  3U3G A;  1G15 A;  5E84 A;  4E7L A;  2IC3 A;  4Y1C A;  4E19 A;  3RRG A;  3ZET B;  1XUP O;  4F3T A;  1YVN A;  1RBU A;  3KKS A;  2VQF K;  3QNO A;  2YJF A;  3TTF A;  4N5S A;  4OLB A;  3H3N O;  2R7Y A;  4MQ3 A;  1IG9 A;  4BRD A;  2X6S A;  1RDD A;  3Q7C A;  1BO5 O;  1HQE A;  1GLC G;  4YNQ A;  4DV5 K;  2WOM A;  3HM8 A;  1OH6 A;  3R8E A;  1ASV A;  2F7T A;  4XH4 A;  3EL2 A;  1TAQ A;  3NF6 A;  1Y97 A;  2P9N B;  3HP9 A;  2QKK A;  1WSF A;  3VF6 A;  4IDH A;  5AQK A;  5ADX A;  3ZSX A;  1SAZ A;  1EKE A;  4CD3 A;  4FLW A;  1E3M A;  1A5X A;  2NRW A;  1BA0 A;  4IEI A;  1C0T A;  3LP1 A;  4DV1 K;  2DTU A;  2HW3 A;  4BRQ A;  1RT7 A;  2Y1J A;  1GLJ O;  4CZK A;  3E9P A;  2LSN A;  4WQ4 A;  4RW4 A;  4LFA K;  3D2E A;  3V9W A;  2D0B A;  5C12 A;  4KHY A;  4CI6 A;  1B92 A;  2RF2 A;  3BF1 A;  3OJS A;  3SNN A;  3LAL A;  4ZTF A;  2ASM A;  4WFA L;  2QWP A;  4DMN A;  1BUP A;  3K5N A;  1WUA A;  4EZ9 A;  4MO5 A;  1QQO A;  5CZ2 A;  1TUY A;  2FF3 B;  3T69 A;  2P9L A;  4IXC A;  3TAF A;  3RMA A;  1RT3 A;  4Z4C A;  1K73 O;  3KHY A;  4ILG B;  4OGE A;  3C6A A;  4FLU A;  4DF8 A;  3VES A;  3CQY A;  3O9S A;  3HJF A;  4FLZ A;  4CGG A;  1VSH A;  5AQU A;  3BDP A;  3CQX A;  1WSE A;  3DWL A;  3G25 A;  3DOL A;  3QFU A;  4YDU A;  4PL8 A;  3K9K A;  3NCI A;  4DV3 K;  3WNF A;  4DFP A;  1VRU A;  2VG5 A;  4ICL A;  1NGA A;  4CGH A;  3T1A A;  3DXM B;  4H5T A;  3UKR B;  4BRC A;  4DCH A;  3AA4 A;  3AVM A;  3DLB A;  4GKK K;  4CJT A;  3PO5 A;  3CCL N;  4CIG A;  1JXE A;  4BRF A;  3TSU A;  2HF4 A;  3IKM A;  1QQN A;  4NLC A;  3LDL A;  4LC9 B;  2ASP A;  4HTL A;  3CCJ N;  2HBK A;  3CMA N;  1J5E K;  5AZI A;  2P9P A;  4N47 A;  3QDK A;  1J53 A;  3DXM A;  3EN9 A;  3UKR A;  1CLQ A;  2X74 A;  3EO3 A;  2QTD A;  1ESV A;  5AZJ B;  2HNZ A;  4BR0 A;  5FPM A;  4BVO A;  4MDA A;  3OYK A;  1IJJ A;  1NNE A;  4FJK A;  3EKU A;  1ATR A;  1J54 A;  4E7I A;  2YNI A;  5AQR A;  3HVR A;  3HPG A;  2Q97 A;  4EP4 A;  4M3Y A;  1HKB A;  3NGZ A;  1MWM A;  3CC7 N;  4M41 A;  1HNX K;  1NK0 A;  1HYZ A;  3CG7 A;  3RWU A;  2NRT A;  1HNZ K;  3OYL A;  3F73 A;  3OY9 A;  1S1X A;  3RSE A;  3SUQ A;  5SWM A;  3LL3 A;  4FJG A;  1BWF O;  3ZCM A;  5JS1 A;  1XI1 A;  1KCF A;  5JMV A;  3OYM A;  1VAZ A;  2IVO A;  1TKX A;  3ZT0 A;  2YX6 A;  5M1O A;  4BE0 A;  1T6C A;  4AHR A;  2BGG A;  5BR8 K;  4CHN A;  3WUH A;  4O8U A;  3T1H K;  4K0K K;  4FWO A;  2ZJP L;  1XC3 A;  5KPT A;  4CZE A;  3VQA A;  3SZ2 A;  1D4X A;  3ID8 A;  2P9I A;  3AA5 X;  3U9Z A;  2BDP A;  2VG6 A;  4CK2 A;  1EO1 A;  1W0H A;  4CJ5 A;  1NGI A;  5CYQ A;  1BIS A;  4EIA A;  3THV A;  2ATQ A;  4KTQ A;  1BG3 A;  4RWT A;  2KHO A;  1NGE A;  3OBW A;  2P51 A;  1BCO A;  4Q5V A;  4DQQ A;  2OTJ N;  4JEP A;  1VSD A;  1SZ2 A;  3ZEU A;  4JD2 B;  4I6M B;  1X9J A;  3ZT3 A;  4DSJ A;  3VEX A;  4M3W A;  4B9S A;  3MX2 A;  4LF4 K;  1MA9 B;  4Z94 A;  4IOX A;  1NGD A;  1NKC A;  3WQT A;  2XO7 A;  4GV6 A;  1VQO N;  3OYH A;  4FW1 A;  4G9Z A;  1NJI O;  5KPZ A;  2VWJ A;  3LPT A;  5BPL A;  4ID1 A;  5EU7 A;  4DB3 A;  3PSI A;  3SUN A;  4A5A A;  5IT9 O;  3C95 A;  4RTF D;  1OVQ A;  1QTM A;  5BPN A;  1L3S A;  3DXK B;  1Z26 A;  1Q81 O;  1HKG A;  4ILJ A;  4OLA A;  3NMU A;  3MEG A;  4JAX A;  4BE2 A;  3CME N;  4JN4 A;  5J1E A;  3VEZ A;  4NYN A;  3THY A;  1TUU A;  2E5L K;  2WFB A;  3MK6 A;  5K14 A;  4Y0W A;  4JD2 A;  3CJ7 A;  4CFC A;  3ZEU B;  1WLJ A;  3MCP A;  5EOY A;  2ZGZ A;  1VQ4 N;  5EY4 A;  4FWN A;  1Q86 O;  3CCV N;  4DU1 A;  3MCA B;  1NK7 A;  1S1T A;  3MXI A;  4FK2 A;  2YNF A;  1EX4 A;  4O4G A;  2Q2R A;  4KHU A;  3SPZ A;  4JS5 A;  1RTI A;  1JLF A;  4DU4 A;  3SK3 A;  1BHL A;  3PX0 A;  5KTQ A;  4ELU A;  1C0M A;  1IKV A;  4JK7 A;  4Y1D A;  3K58 A;  4B3T K;  5MLC Q;  3DYA A;  3V1R A;  4IG3 A;  3AVB A;  3I56 N;  1HQU A;  1NGB A;  1VHX A;  4ILH A;  3S3O A;  4KB1 A;  4DTU A;  5AQM A;  1QZ5 A;  3FZK A;  3K59 A;  3K9J A;  1TK5 A;  4B9M A;  4FSV A;  2O8F A;  3AAP A;  3CF5 L;  3HRG A;  1IO2 A;  4FJN A;  4F4K A;  4NXN K;  3J7Y P;  1NK4 A;  4RW9 A;  4C1N I;  5KGX A;  4M3R A;  3CFR A;  3SUO A;  4JKD A;  2F8S A;  1N34 K;  4HVJ A;  3CET A;  3THX A;  1IH7 A;  3E9O A;  3WXM B;  4B9U A;  5BRE A;  1K6Y A;  3FZH A;  1ASW A;  1C1B A;  2NUB A;  2YHW A;  2FBT A;  4CEQ A;  3LZJ A;  4FWS A;  3NH0 A;  1GLE G;  4M7X A;  3NGI A;  4I9Q A;  2O8D A;  4CEA A;  2OCE A;  1UAX A;  3CCS N;  3C6H A;  4E1J A;  4K42 A;  2QXL A;  3AY9 A;  4JRQ A;  4QOZ B;  3CFP A;  1KTQ A;  4KH5 A;  4H5R A;  2VGM A;  4JKG A;  2JWK A;  4OKK A;  1S5J A;  2D0O A;  4CZG A;  3O8M A;  4CHP A;  4J2D A;  4NXM K;  1VQ9 N;  4M7Y A;  1BI4 B;  2HOE A;  4DV6 K;  4IDK A;  1BQM A;  1RT2 A;  1VK0 A;  3ATU A;  4OPK A;  4DSI A;  2RE2 A;  2ZE2 A;  3AVG A;  4CHQ A;  1JL1 A;  3U6F A;  3PLA A;  3GBT A;  1S3X A;  5AZI B;  1NKB A;  4AHC A;  3AVN A;  3LDN A;  4LFB K;  4FPA A;  5CYM A;  3QEV A;  3A8Y A;  2WTU A;  3QFP A;  2J4R A;  3OYC A;  4FPB A;  3PIP L;  5C2F A;  4GV9 A;  1WN7 A;  4C8O A;  3QEW A;  3VF4 A;  4H8K A;  1V4S A;  5FLX O;  4FOE A;  3QER A;  4KKO A;  4CGI A;  1BIZ A;  3NDK A;  1VSE A;  4GV3 A;  3OYE A;  3NE6 A;  1VSL A;  4QAG A;  1T05 A;  1YAG A;  1JLA A;  3VQB A;  5AQQ A;  3ATV A;  4KHS A;  1S22 A;  1KLN A;  2PZS A;  1DTT A;  1TL1 A;  4FJH A;  2Q0U A;  2P9L B;  3DMJ A;  4FWR A;  5AZJ A;  2A5X A;  3QIC A;  3KLF A;  1Z05 A;  3PX4 A;  4FWK A;  1OVY A;  3H1Q A;  3J8A A;  3MWT A;  5BRF A;  2BAN A;  3LP0 A;  2BTF A;  1YHQ N;  5AQY A;  4NO7 A;  5FRM A;  3H3O B;  2V52 B;  2IIR A;  1CXQ A;  4EAH D;  1W7A A;  4YOW A;  4CJQ A;  4J2A A;  4FJ9 A;  3VTH A;  1TKT A;  3I55 N;  3CER A;  4Z4G A;  2A1S A;  4PKH A;  3LM2 A;  2O8F B;  5H1S Q;  2ZD1 A;  1OH5 A;  1KAY A;  1S72 N;  2RN2 A;  2IVN A;  1T44 A;  3H46 O;  1W9H A;  2EWS A;  2Z1J A;  3J7A P;  4FJM A;  1TK0 A;  4CJE A;  5J2Q A;  1ZC6 A;  1HMV A;  1WSG A;  3AVI A;  3RMD A;  1QSL A;  1RBR A;  4BQL A;  4KFB A;  5A2Q O;  3OYG A;  3EZ5 A;  3VOV A;  1FKO A;  4H0T B;  1QVF M;  5AQO A;  2GEM A;  3SMP A;  1EQY A;  1IKY A;  5FRN A;  4OJR A;  1QS4 A;  2ZJR L;  1JLQ A;  1Z6R A;  3IS9 A;  4C8N A;  3AAR A;  4KH6 A;  2WC9 A;  4IJN A;  3V4I A;  1KVC A;  3VA0 A;  4BWJ A;  3L2V A;  3PO4 A;  2RHK A;  2FBY A;  1SL0 A;  4BQZ A;  2ZM6 K;  1RDC A;  4IOC L;  4ELV A;  3MEC A;  4OGC A;  3P83 D;  4HCC A;  3C7N A;  1F21 A;  4CED A;  3HOT A;  4DSE A;  3VA3 A;  3QLH A;  4OO1 J;  3F9K A;  2FXU A;  3FGU A;  4KTW A;  4C23 A;  4O44 A;  1NBW A;  3ZYY X;  2FC0 A;  3OBY A;  5AQP A;  1XHZ A;  1VQ8 N;  4BDZ A;  1U2V A;  1D8Y A;  3L3V A;  2KTQ A;  4CEF A;  4H5V A;  1HYS A;  4X66 K;  3SJH A;  2FLO A;  1RT4 A;  2O8C A;  3O3H A;  5HLF A;  1XMO K;  5HRN A;  3DLH A;  2D1K A;  2DFF A;  1FKP A;  4DQ8 A;  4ISG A;  1VQP N;  1XHX A;  2G8I A;  1S1V A;  2W41 A;  3ZX0 A;  4E89 A;  4LF9 K;  3OTO K;  1EWR A;  1NWK A;  3O4W A;  4B1V A;  2P5O A;  1YTA A;  3DRP A;  4CJU A;  4M3X A;  1W2B M;  3VGK A;  1C1A A;  2E4L A;  4LF7 K;  4KV8 A;  2XY7 A;  2HB5 A;  4XIU A;  1EXQ A;  2CH5 A;  3O9R A;  4DS5 A;  1HPZ A;  5AQG A;  2F8T A;  1EP4 A;  4A61 A;  3QNN A;  2HHH K;  4BRL A;  1O13 A;  2BH1 A;  4DF4 A;  1L3U A;  3AO2 A;  4FZY A;  1U2V B;  3M1F A;  1C0U A;  4F3O A;  1DEJ A;  3S9H A;  4FWP A;  4HUE A;  2YJE A;  4NCG A;  4BC3 A;  4AHV A;  3D2F A;  3M8R A;  1KD1 O;  1XWL A;  1GLB G;  3B8A X;  3ENO A;  4ID5 A;  3KK7 A;  1LCU A;  4I7F A;  3QET A;  1QVG M;  4IBN A;  3ULE B;  4BRI A;  5AQT A;  3ISN C;  3VTI A;  4B9T A;  3EYZ A;  3SMS A;  4H5W A;  3JXU A;  4DFM A;  1C6V A;  3M8P A;  3CCM N;  3MWP A;  4IWV A;  1S9G A;  2NLX A;  4BE1 A;  4FJJ A;  2PYJ A;  2HBL A;  3VQ9 A;  5SZT A;  1J5O A;  3IFR A;  1VQ7 N;  4CJK A;  3KLE A;  3ZSO A;  3O9Q A;  2QWL A;  2UU9 K;  2O4G A;  3P5J A;  3AV9 A;  1DKG D;  1TVR A;  3HST B;  1FK9 A;  3M5R A;  3MX5 A;  1UA0 A;  3U9D A;  1NJW A;  2IS3 A;  1OH7 A;  3K2P A;  3ZT1 A;  4I2Q A;  4NCB A;  4I6M A;  4JKG B;  3KK3 A;  2D0P A;  4BR5 A;  1CXU A;  3I0R A;  4FK4 A;  1HYV A;  4CEC A;  3DLL L;  3PIO L;  2PBD A;  4BRO A;  1Q7Y O;  3H45 C;  3ULD A;  3V9Z A;  1ATS A;  3ASM A;  3HP6 A;  5GAE P;  1GLD G;  4CER A;  3JAM O;  1NK9 A;  5F1X A;  1QSS A;  4X65 K;  4JI3 K;  3L3U A;  1NGJ A;  3DAW A;  2Z1G A;  4BGA A;  2F9T A;  3MAQ A;  3TAN A;  3CC4 N;  1D9F A;  4JKB A;  3ULE A;  3LDO A;  2W6L A;  4OKE A;  3O3F A;  5C24 A;  3J7Z O;  3HPH A;  3SQ4 A;  4CZI A;  5HP1 A;  4J2E A;  1GLL O;  3AO5 A;  3KJV A;  3O6W A;  4MLH A;  5AQF A;  4E1N A;  4A2A A;  3RVC A;  1T3V A;  5BRD A;  5JLH A;  1RBV A;  1KQS M;  1NK8 A;  1ZBF A;  1S1U A;  3KTQ A;  4DUZ K;  4CFD A;  4FCY A;  3BZC A;  4CIE A;  2EHG A;  2OPP A;  3OS1 A;  3AVF A;  5AJ3 K;  3GOI A;  2HHS A;  3P38 A;  3O08 A;  3UE5 A;  1X9M A;  3CJC A;  1X3M A;  2VWB A;  1KLM A;  3L4Q A;  4M45 A;  2KLA A;  3P39 A;  3M8Q A;  4DR1 K;  2I7P A;  4XEI A;  2E2Q A;  3LWM A;  2OPQ A;  4GMJ B;  2EX3 A;  3L0Q A;  4AF1 A;  4CJ3 A;  2F96 A;  3KZB A;  5BN8 A;  1S6P A;  3H1V X;  4FJ8 A;  5E41 A;  1NJZ A;  3ITH A;  3OYN A;  2A1R A;  3HL8 A;  2W40 A;  2YHX A;  2VYP A;  4YOX A;  2B6A A;  3GL1 A;  1I94 K;  1D9D A;  1S9E A;  4OPA A;  3SCX A;  3QBW A;  1XC9 A;  4LSL A;  4M3U A;  4G1Q A;  3LPU A;  1D5A A;  4FJI A;  5JS2 A;  4EHU A;  3D7E O;  3QIN A;  3IAY A;  2O8D B;  1ZBH A;  5JVG L;  4FJX A;  3HOS A;  3LP2 A;  1YJN N;  3VET A;  3L2W A;  4J2B A;  4B1Y B;  5F0X A;  1JLB A;  3VQ8 A;  1HRH A;  3SV3 A;  5AFU A;  5C10 A;  3KD1 E;  3NH1 A;  3VQQ A;  4BVP A;  3IDH A;  1N8R O;  4M63 C;  4CEZ A;  3KKR A;  3ALY A;  1Q18 A;  1IBK K;  4CK3 A;  4F2R A;  1NOZ A;  2JGU A;  4KO0 A;  5BN9 A;  1LAV A;  1IKX A;  3QEX A;  2G8F A;  4KHW A;  3VQD A;  1YIJ N;  5GAD P;  4K8X A;  2HND A;  4BGB A;  4CD1 A;  4IFV A;  2DPN A;  4FVU A;  3OYF A;  4DFJ A;  4Q0B A;  1U04 A;  3IMX A;  4WQ4 C;  3O4N A;  3I0S A;  3TWH A;  3TAB A;  4BAC A;  5AQN A;  3CCQ N;  3HK2 A;  3L8B A;  3J81 O;  1OKJ A;  3PUF A;  4ELT A;  1ZBU A;  2I7N A;  1XNR K;  5ADX H;  3U8X A;  1N5Y A;  3ID6 A;  3CJB A;  3V9U A;  4WE1 A;  4NCA A;  2A40 A;  3KIO A;  1T8E A;  4KHQ A;  2E6L A;  2FBV A;  4EHT A;  1JKH A;  2NRX A;  3HYF A;  2KZZ A;  3KVG A;  4DSL A;  3TR8 A;  3V9X A;  3S3N A;  2DY4 A;  3NGY A;  3AGK A;  3SBG A;  4OVL A;  4I2P A;  1LWE A;  4JI5 K;  4FJ5 A;  2JWL A;  4OKJ A;  3NVM A;  2E2P A;  1TK8 A;  1ZBS A;  3HT3 A;  1NGH A;  4LY7 A;  4JI0 K;  4H0O A;  4R5P A;  1HX1 A;  4KB0 A;  1QSY A;  4Z4I A;  1HPM A;  1G99 A;  5GAH P;  2UYT A;  1RGI A;  3PY8 A;  4KHP K;  5C0Y A;  3P1G A;  2WON A;  3CM6 A;  3CCU N;  1XQS C;  1KSP A;  3VQ6 A;  4BRE A;  4FXD A;  1CZB A;  3MED A;  4JV5 K;  3QES A;  4WQ5 C;  4CJL A;  3CD6 N;  1NJY A;  2GUI A;  4FLV A;  1YVU A;  1WAJ A;  1V4T A;  3V9S A;  4RG8 A;  3FZL A;  1RDU A;  5LL6 Z;  3WT0 A;  3OVN A;  5FPE A;  1VQK N;  1JCG A;  4BWM A;  5GIP A;  4HCB A;  3F9M A;  5E26 A;  4RW8 A;  1KFD A;  4H03 B;  3H6E A;  2AA4 A;  4NLB A;  4DQI A;  4PUO A;  3RR7 A;  2KKZ A;  3Q7B A;  2NRH A;  2FBX A;  1N32 K;  4DWI A;  4YOU A;  2XY8 A;  3PV8 A;  4CW7 B;  4O0J A;  1U49 A;  2QWO A;  3WXI A;  1YF5 L;  2QI2 A;  1RIL A;  3VQ4 A;  4DHY A;  1K9M O;  1WSJ A;  2E6M A;  1VSI A;  3L2Q A;  4W5T A;  3I8D A;  3I8B A;  4CZJ A;  3ZSQ A;  4BRM A;  1KAX A;  1YXQ A;  1NK6 A;  4LF6 K;  4CFB A;  4DQS A;  1T6D A;  2Z1I A;  1UWB A;  2GTD A;  4FL9 A;  1GOB A;  1LOT B;  2P9S A;  2GBZ A;  2Y1I A;  4PY5 A;  3CI5 A;  3K5L A;  2OAN A;  4JKA A;  5GIO A;  3DM2 A;  3DOK A;  3ZET A;  3K5M A;  3RMC A;  4CF0 A;  4N56 A;  3WNH A;  4BC2 A;  4H4M A;  3TAE A;  4CBW A;  1REV A;  2VG7 A;  5DM6 L;  1N6Q A;  1N36 K;  3LWL A;  2UXB K;  4CE9 A;  2PY5 A;  4CJ4 A;  3FR0 A;  1BA1 A;  1HUX A;  4MO4 A;  4CJV A;  1GLA G;  3PSF A;  4HWI A;  4K43 A;  1VQM N;  1RNH A;  3A2F A;  3B6O A;  1GOA A;  4JLH A;  2OZM A;  1YUW A;  4LH4 A;  3QIO A;  4IZ9 A;  2DFE A;  3FZF A;  4N76 A;  4DV0 K;  4B9V A;  5HRS A;  4UQG A;  2X78 A;  2ITM A;  4DR2 K;  4WF9 L;  4DTN A;  1A5W A;  3MN9 A;  3SYZ A;  1RTD A;  3JYT A;  5B8H A;  4W5Q A;  4CK1 A;  3O1B A;  4CGD A;  1WSH A;  2QXF A;  5ELZ A;  3J80 O;  1SQK A;  2YV0 X;  3DI6 A;  2E2N A;  1SKR A;  2QWM A;  2KFN A;  4PQU A;  1N33 K;  5KGW A;  2Z1H A;  3NF9 A;  4PHT X;  1P90 A;  5HBM A;  3L2U A;  2OTL N;  4AHU A;  4E3S A;  3SAG A;  1RT1 A;  3VPZ A;  1E4G T;  1KXP A;  2A42 A;  3M3Z A;  4CHY A;  2NRV A;  4W5O A;  3OA9 A;  2A3Z A;  2Q1N A;  4IEE A;  2VCP A;  2ZF5 O;  4CEO A;  4BRA A;  3ZX2 A;  2QW9 A;  2YHB A;  4E7K A;  1WNS A;  1SL1 A;  4A62 A;  5HOO A;  2NNW A;  4CF9 A; 
#chains in the Genus database with same CATH homology
 3WNE A;  3KLI A;  1J54 A;  1JXB A;  4E7I A;  4HUE A;  5T7B A;  5KRS A;  3AVJ A;  2AJQ A;  2YNI A;  3NAE A;  3MXJ A;  4DSF A;  3HVR A;  4NCG A;  3HPG A;  3ZSY A;  1NKE A;  4EP4 A;  4AHV A;  1RCH A;  3M8R A;  4M3Y A;  1XWL A;  1TL3 A;  3V81 A;  3NHG A;  3NGZ A;  4ZTJ A;  2RPI A;  2QKB A;  4IG0 A;  4M41 A;  4ID5 A;  4EP5 A;  4I7F A;  2Q3S A;  4FM2 A;  2OPR A;  3VQE A;  3QET A;  1NK0 A;  4IBN A;  1HYZ A;  2PYL A;  3BGR A;  1U48 A;  3ISN C;  4B9T A;  3CG7 A;  3EYZ A;  3KK1 A;  3RWU A;  4DTO A;  3SQ1 A;  3RR8 A;  3OYL A;  1HNI A;  3F73 A;  3OY9 A;  3U3Y A;  1S1X A;  1Q9X A;  4M3T A;  1TGO A;  4DFM A;  1C6V A;  5SWM A;  3SUQ A;  3JSM A;  1R0A A;  4FJG A;  3M8P A;  4FJL A;  1RTJ A;  1J9A A;  3ZCM A;  3PX6 A;  1X9S A;  1S9G A;  1HJR A;  4TSX A;  1XI1 A;  4IKF A;  5JS1 A;  1KCF A;  2B5J A;  4BE1 A;  1T03 A;  4FJJ A;  2PYJ A;  3SV4 A;  3VQC A;  3V6D A;  3VQ9 A;  1C1C A;  5HRP A;  5SZT A;  4JRP A;  3OYM A;  1JL2 A;  3MXM A;  1J5O A;  2DFH A;  4CJK A;  3KLE A;  3ZSO A;  1RDA A;  1TKX A;  3ZT0 A;  2G8V A;  2HHW A;  2O4G A;  3P5J A;  4BE0 A;  3AV9 A;  4AHR A;  4FYD A;  2G8H A;  2BGG A;  1TVR A;  3HST B;  4DSK A;  1BI4 A;  5J2M A;  4CHN A;  4DTJ A;  1B9D A;  1FK9 A;  1TKZ A;  1RT6 A;  1JLE A;  5KI6 A;  2O4I A;  3KLH A;  1UA0 A;  1NJW A;  2IS3 A;  4CJP A;  3LZI A;  3K2P A;  3VQA A;  3ZT1 A;  4YFU A;  4AIL C;  4FXD A;  4I2Q A;  3SZ2 A;  4KAZ A;  4NCB A;  4N41 A;  3AA5 X;  4O0I A;  3KK3 A;  1JLG A;  2OZS A;  2BDP A;  4CJS A;  3OYB A;  2VG6 A;  4CF2 A;  1CXU A;  4RW6 A;  3HO1 A;  2GV9 A;  2VWK A;  3I0R A;  4CK2 A;  4FK4 A;  1TV6 A;  1W0H A;  4CJ5 A;  1HYV A;  1BL3 A;  1BIS A;  5CYQ A;  4CEC A;  3HPO A;  2ATQ A;  3THV A;  4KTQ A;  1L3T A;  2D0C A;  4I9L A;  1KFS A;  2P51 A;  3ULD A;  3V9Z A;  3ASM A;  1BCO A;  3AVH A;  2HNY A;  4Q5V A;  3HP6 A;  4DQQ A;  2OYQ A;  4CER A;  2KZM A;  3LAM A;  3ZT2 A;  1NK9 A;  1QSS A;  3LAN A;  2ETJ A;  1VSD A;  1HNV A;  3L3U A;  3ZT3 A;  4DSJ A;  2Z1G A;  4M3W A;  4H4O A;  2JLE A;  4FLX A;  4B9S A;  3FFI A;  1SKS A;  2G8U A;  3MAQ A;  3TAN A;  1D9F A;  3SPY A;  3NF7 A;  1NKC A;  5HRR A;  5J2N A;  2P1J A;  2XO7 A;  3DLK A;  4CIF A;  4FW1 A;  3OYH A;  1VSK A;  4OKE A;  3O3F A;  1BQN A;  3DRS A;  5C24 A;  1S1W A;  3LPT A;  3HPH A;  2VWJ A;  3SQ4 A;  5HP1 A;  1RTH A;  4ID1 A;  4CJW A;  4J2E A;  5EU7 A;  3AO5 A;  4CF8 A;  3KJV A;  4E7J A;  4CEE A;  3SUN A;  3T3F A;  3VQP A;  3C95 A;  4E1N A;  1QTM A;  1L3S A;  1Z26 A;  1KVB A;  4OLA A;  1SUQ A;  1RBV A;  3MEG A;  3SQ2 A;  5D3G A;  1NK8 A;  4PWD A;  4KRE A;  1ZBF A;  1S1U A;  3KTQ A;  3OYI A;  3QIP A;  4CFD A;  4BE2 A;  4FCY A;  4O5B A;  4CIE A;  2EHG A;  2OPP A;  3K5O A;  3TAM A;  5FRO A;  3AVF A;  4NYN A;  5J1E A;  3OS1 A;  3KLG A;  3L2R A;  2HHS A;  3RRH A;  1A5V A;  4E1M A;  1X9M A;  4M42 A;  3D45 A;  5K14 A;  3OYJ A;  4DFK A;  4M45 A;  1KLM A;  1GOC A;  3AO3 A;  3M8Q A;  4B08 A;  3SUP A;  1LW0 A;  5C42 A;  4CFC A;  1WLJ A;  4DU3 A;  3LWM A;  3CYM A;  2OPQ A;  4RW7 A;  1NJX A;  4GMJ B;  2EX3 A;  4F2S A;  4B8C A;  4C8M A;  4CJ3 A;  2F96 A;  1S6P A;  4DU1 A;  1NK7 A;  1UA1 A;  4FJ8 A;  5E41 A;  1S1T A;  1NJZ A;  3MXI A;  4KRF A;  4FK2 A;  1JLC A;  1LAW A;  3T19 A;  2YNF A;  1EX4 A;  4LSN A;  3ITH A;  4O4G A;  3OYN A;  4HUG A;  4BDP A;  4KHU A;  3SPZ A;  2A1R A;  4DQP A;  4B3O A;  4JS5 A;  1RTI A;  3HL8 A;  3LDS A;  1JLF A;  4LD0 A;  4DU4 A;  4KTZ A;  4E0D A;  3OS0 A;  1BHL A;  1ZYQ A;  3PX0 A;  5KTQ A;  2XHB A;  3LP3 A;  4ELU A;  1Z25 A;  2B6A A;  3ZT4 A;  1C0M A;  3CQ8 A;  1IKV A;  1D9D A;  4Y1D A;  3K58 A;  2KFZ A;  1S9E A;  3SCX A;  5KRT A;  3DYA A;  3V1R A;  4BDY A;  4IG3 A;  4B9L A;  1XC9 A;  3AVB A;  4LSL A;  1HQU A;  1KVA A;  4G1Q A;  3OS2 A;  3LPU A;  1U4B A;  4M3U A;  5HRO A;  4CJR A;  3SQ0 A;  1D5A A;  3H08 A;  4FJI A;  1DTQ A;  3SI6 A;  1I3A A;  5JS2 A;  3S3O A;  4KB1 A;  4QCL A;  1O1W A;  3QIN A;  4CES A;  3IAY A;  1ZBH A;  4FJX A;  2HVH A;  4DTU A;  3LP2 A;  1SL2 A;  3L2W A;  4J2B A;  3K59 A;  1TK5 A;  4B9M A;  5CY4 A;  3OYA A;  1JLB A;  1BGX T;  1IKW A;  3DLE A;  3VQ8 A;  4DTX A;  1IO2 A;  1HRH A;  3SV3 A;  1ASU A;  4FJN A;  4F4K A;  3TAP A;  1KRP A;  3KD1 E;  3K57 A;  3NH1 A;  1NK4 A;  3VQQ A;  4CHO A;  4RW9 A;  4GW6 A;  3KKR A;  4CEZ A;  5KGX A;  2YNG A;  3ALY A;  3AA2 A;  4M3R A;  3CFR A;  3SUO A;  2F8S A;  3WNG A;  4FM1 A;  1YTU A;  4HVJ A;  4FZX C;  4CK3 A;  2KW4 A;  3DLG A;  1IH7 A;  3NBP A;  1L5U A;  1NOZ A;  4F2R A;  2JGU A;  4FJK A;  1U47 A;  4B9U A;  2ZQB A;  4KO0 A;  3B6P A;  4IFY A;  1LAV A;  1IKX A;  3QEX A;  2G8F A;  4KHW A;  3VQD A;  4C8K A;  1K6Y A;  1ASW A;  1C1B A;  2NUB A;  3CM5 A;  4CEB A;  4K8X A;  1B9F A;  4KHN A;  2FBT A;  2HND A;  4CEQ A;  3LZJ A;  1LV5 A;  2HHQ A;  4IFV A;  1U45 A;  4Z4E A;  3NH0 A;  3OYF A;  4DFJ A;  4FW2 A;  3OJU A;  2G8W A;  3OYD A;  4Q0B A;  2HHT A;  1U04 A;  4DG1 A;  3NGI A;  2YKN A;  3QEP A;  4I9Q A;  3O4N A;  3I0S A;  3TWH A;  3SJJ A;  2HVI A;  3TAB A;  4CEA A;  4BAC A;  3HVT A;  2X6N A;  1UAX A;  3L8B A;  3HK2 A;  1VRT A;  3PUF A;  4C8L A;  4LH5 A;  4ELT A;  3ZSW A;  3D0P A;  1ZBU A;  4JRQ A;  3V1O A;  4QOZ B;  3CFP A;  1N5Y A;  1KTQ A;  5J2P A;  2YHA A;  4Z4F A;  4CGF A;  4OKK A;  3VN5 A;  1S5J A;  3V9U A;  4WE1 A;  4NCA A;  3KIO A;  1T8E A;  3IRX A;  4KHQ A;  3LAK A;  1Q8I A;  2E6L A;  2FBV A;  4CHP A;  4J2D A;  1JKH A;  3HYF A;  2KZZ A;  3AO1 A;  3TAG A;  4DSL A;  3TR8 A;  3O3G A;  1BI4 B;  3V9X A;  3S3N A;  4IDK A;  1BQM A;  2OA8 A;  3CFO A;  1RT2 A;  1VK0 A;  5CZ1 A;  4OPK A;  2XY6 A;  3AO4 A;  3S3M A;  4DSI A;  2DY4 A;  2ZE2 A;  3AVG A;  1SV5 A;  1JL1 A;  3NGY A;  4CHQ A;  3U6F A;  1LWC A;  4OVL A;  4FVM A;  4I2P A;  1LWE A;  4DLE A;  4AHC A;  1X9W A;  1NKB A;  3AVN A;  4FJ5 A;  2D0A A;  4OKJ A;  2XY5 A;  3KD5 E;  4FK0 A;  5CYM A;  1MU2 A;  4M3Z A;  3AVK A;  3G0Z A;  3QEV A;  1TK8 A;  1S6Q A;  3HT3 A;  2HHV A;  4LY7 A;  3TI0 A;  4R5P A;  3C6T A;  4KB0 A;  1QSY A;  4Z4I A;  2OPS A;  5DMR A;  3KK2 A;  4AH9 A;  2P5G A;  3VQ5 A;  3OYC A;  3RTV A;  1RDB A;  4E7H A;  3C6U A;  3PY8 A;  1WN7 A;  4C8O A;  3C94 A;  1SKW A;  3QEW A;  5C25 A;  4H8K A;  2D5R A;  3P1G A;  2WON A;  3CM6 A;  4DTM A;  3QER A;  2ITG A;  4HUF A;  4KKO A;  4CGI A;  1BIZ A;  3NDK A;  3AA3 A;  1VSE A;  1UOC A;  5I42 A;  1KSP A;  1CZ9 A;  3OYE A;  4NYF A;  1SL1 A;  3VQ6 A;  3NE6 A;  4DTP A;  1CZB A;  2G8K A;  3MED A;  4EZ6 A;  1VSL A;  4KPY A;  1L3V A;  3QES A;  1ZBL A;  4KI4 A;  4MFB A;  2YKM A;  4CFA A;  4W5R A;  1JLA A;  3VQB A;  1T05 A;  4JS4 A;  1NOY A;  1T7P A;  4FJ7 A;  4KHS A;  3IG1 A;  4PA1 A;  1WSI A;  4DS4 A;  1KLN A;  4CJL A;  1X1P A;  1DTT A;  1TL1 A;  3NH2 A;  2PZS A;  4FJH A;  4F8R A;  1NJY A;  4CGJ A;  1BCM A;  2GUI A;  2B4J A;  3DMJ A;  1ZBI A;  4FLV A;  3PX4 A;  3KLF A;  3QEI A;  5DK5 A;  1YVU A;  1WAJ A;  4CHZ A;  1RBS A;  2RKI A;  3V9S A;  4RG8 A;  2BAN A;  3LP0 A;  3U3G A;  1I39 A;  2HHU A;  1G15 A;  5FRM A;  3OVN A;  4E7L A;  2IC3 A;  4Y1C A;  4E19 A;  3RRG A;  4BWM A;  4F3T A;  1RBU A;  3KKS A;  3QNO A;  4HCB A;  4B8A B;  1CXQ A;  4N5S A;  4OLB A;  4AHT A;  4CJQ A;  4J2A A;  4FJ9 A;  1RBT A;  1TKT A;  2R7Y A;  4MQ3 A;  1IG9 A;  4RW8 A;  1KFD A;  2X6S A;  1QQC A;  1RDD A;  3NF8 A;  4DQI A;  3RR7 A;  4PUO A;  4Z4G A;  1QHT A;  3DLR A;  1FXX A;  1HQE A;  4YNQ A;  2A1S A;  2FBX A;  3G10 A;  2WOM A;  4DWI A;  2QK9 A;  3HM9 A;  3MEE A;  2XY8 A;  3HXM A;  2KQ2 A;  4DQR A;  3PV8 A;  2ZD1 A;  4O0J A;  3RMB A;  1U49 A;  1ASV A;  2RN2 A;  1TAQ A;  1W9H A;  3NF6 A;  1Y97 A;  2QKK A;  3HP9 A;  2Z1J A;  1RIL A;  1WSF A;  4FJM A;  4DTS A;  3VQ4 A;  1TK0 A;  4CJE A;  5J2Q A;  3ZSX A;  1HMV A;  4Z4H A;  3AVI A;  1WSG A;  3O4Q A;  2E6M A;  1WSJ A;  1VSI A;  3M8S A;  3RMD A;  1EKE A;  1QSL A;  1RBR A;  1LWF A;  4Z0U A;  4FLW A;  4KFB A;  4W5T A;  3OYG A;  3L2Q A;  3EZ5 A;  2HMI A;  3I8D A;  5I3U A;  1FKO A;  3NFA A;  3ZSZ A;  1A5X A;  3ZSQ A;  4OPJ A;  1NK6 A;  1IKY A;  1C0T A;  5FRN A;  4OJR A;  2HHX A;  4CFB A;  4DQS A;  1QS4 A;  3LP1 A;  4DTR A;  4FZZ A;  3UIQ A;  2Z1I A;  1JLQ A;  2DTU A;  1UWB A;  4HHT A;  2HW3 A;  3IS9 A;  1RT7 A;  1TKD A;  1GOB A;  4C8N A;  3AVC A;  2Y1J A;  2GBZ A;  2LSN A;  2Y1I A;  4RW4 A;  3E01 A;  4PY5 A;  3V4I A;  1KVC A;  3VA0 A;  3K5L A;  3V9W A;  4BWJ A;  3L2V A;  2D0B A;  3PO4 A;  2FBY A;  3DM2 A;  3DOK A;  3AVA A;  3ZSR A;  4KHY A;  1B92 A;  2RF2 A;  3K5M A;  1BIU A;  4CF0 A;  4N56 A;  3WNH A;  4FM0 A;  3RMC A;  1SL0 A;  3OJS A;  3ZSV A;  3SNN A;  1RDC A;  3LAL A;  4ELV A;  1ITG A;  1LW2 A;  1WAF A;  3MEC A;  4H4M A;  3TAE A;  4ZTF A;  3V1Q A;  2YNH A;  4OGC A;  4DMN A;  4HTU A;  3K5N A;  1REV A;  2VG7 A;  4EZ9 A;  2XRI A;  1VSF A;  3P83 D;  1N6Q A;  4HCC A;  4FLT A;  5CZ2 A;  1F21 A;  4CED A;  4AHS A;  4CCH A;  4DSE A;  4W5N A;  3LWL A;  3VA3 A;  3QLH A;  3TAF A;  3RMA A;  3F9K A;  1RT3 A;  4CE9 A;  4CJ4 A;  3TAQ A;  2PY5 A;  4Z4C A;  3DRR A;  1RT5 A;  4KTW A;  4OGE A;  4FLU A;  4O44 A;  4DF8 A;  4CJV A;  2FC0 A;  2IOC A;  3AVL A;  3HJF A;  1XHZ A;  1NK5 A;  1RNH A;  3A2F A;  4BDZ A;  4FLZ A;  4CGG A;  1D8Y A;  3B6O A;  1GOA A;  1VSH A;  3L3V A;  2KTQ A;  3BDP A;  4JLH A;  1YT3 A;  2OZM A;  4LH4 A;  1WSE A;  4CEF A;  1HYS A;  3DOL A;  3QIO A;  4CF1 A;  4L8R B;  2DFE A;  1RT4 A;  2I5J A;  3NCI A;  3WNF A;  4DFP A;  3O3H A;  5HLF A;  1VRU A;  4N76 A;  5HRN A;  3DLH A;  4B9V A;  2VG5 A;  4ICL A;  2DFF A;  1FKP A;  4CGH A;  5HRS A;  3T1A A;  4UQG A;  2X78 A;  4ZHR A;  2IAJ A;  1XHX A;  2G8I A;  2IGI A;  1S1V A;  3AA4 A;  3AVM A;  3EY1 A;  4DTN A;  3DLB A;  1A5W A;  4E89 A;  4CJT A;  4DLG A;  3SYZ A;  1RTD A;  3PO5 A;  3JYT A;  4FLY A;  2P5O A;  4CIG A;  1JXE A;  4B9N A;  1YTA A;  3DRP A;  4CJU A;  4M3X A;  4W5Q A;  4K8Z A;  4CK1 A;  2IDO A;  4CGD A;  1C1A A;  2E4L A;  1WSH A;  2QXF A;  5FDL A;  4KV8 A;  2XY7 A;  2HB5 A;  2YV0 X;  3DI6 A;  1VSJ A;  4N47 A;  1SKR A;  1J53 A;  4XIU A;  2KFN A;  3TAR A;  2BE2 A;  1CLQ A;  4O55 A;  4PQU A;  1EXQ A;  5KGW A;  2Z1H A;  3NF9 A;  5HBM A;  1HPZ A;  2W42 A;  3L2U A;  1EP4 A;  4DS5 A;  2X74 A;  4AHU A;  4E3S A;  2F8T A;  1RT1 A;  3QNN A;  4KI6 A;  1EET A;  1TAU A;  4GVM A;  3QO9 A;  4CHY A;  4W5O A;  4DF4 A;  1QE1 A;  1L3U A;  3AO2 A;  1VSM A;  4FZY A;  4CEO A;  4F3O A;  1C0U A;  2HNZ A;  4CJF A;  1Q9Y A;  3VQ7 A;  2YHB A;  4E7K A;  1WNS A;  3OYK A;  1DLO A;  4QAG A;  3S9H A;  4CF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...