1A5XA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5xA00
4CJ3A 1ITGA 4N41A 1VSMA 4CF8A 4CEZA 5KRTA 1QHTA 2FBVA 4CHPA 3KJVA 3QEWA 1DLOA 1WNSA 3M8RA 3DYAA 4DSFA 1L3UA 1MU2A 1L3SA 4HUGA 4FK4A 2Q3SA 4PY5A 3TAEA 4KHWA 2HNYA 4IFYA 4M41A 3ZSYA 4CK3A 3JYTA 1VSDA 2HB5A 3DRPA 3RRHA 2VWJA 4Z4CA 3S3OA 4BWMA 3DI6A 2FBYA 3HL8A 1ASVA 4RW7A 3ULDA 4BDZA 4DQPA 2IAJA 1J5OA 4B9SA 1LW0A 4B9TA 5FRNA 2NUBA 1C0UA 4CHOA 3EY1A 3LP1A 1S1TA 3EYZA 4C8MA 3V9SA 4DFKA 2F96A 2FBTA 3SCXA 4N76A 3WNGA 4W5NA 4BDPA 1LWEA 3D45A 4N5SA 5J2NA 1QSSA 3KKRA 1JLGA 1D8YA 4DFPA 2HNDA 4CJSA 2IGIA 3V4IA 2G8KA 3AO5A 3O4QA 4KTWA 3ZSWA 1NJWA 1S1VA 2Z1JA 3M8QA 3M8SA 1YTAA 4FW2A 2IOCA 2WONA 4M3RA 3TARA 2HHUA 2BE2A 2FBXA 3LAKA 4NCGA 1RDCA 4CK1A 3QNNA 3LPUA 5DK5A 3SV3A 1T8EA 1ZBFA 4H4MA 1HJRA 4I2QA 3OYHA 1NJYA 1SKRA 2YNGA 4QCLA 1RBUA 5CY4A 3WNHA 4M45A 3PY8A 1S1XA 4JRQA 4E7JA 1B9FA 1NOZA 1HQUA 4EP5A 5DMRA 4AHVA 4CEBA 1HQEA 3HXMA 1C0TA 2YV0X 4RW9A 1DTQA 2D0CA 4I2PA 4E19A 1VSEA 4CJEA 3KLFA 4F2RA 2GBZA 3OS2A 5FRMA 1KSPA 4O55A 3QESA 1S1UA 1FKOA 4LD0A 2EHGA 4E7IA 3SQ1A 4IKFA 2G8FA 3AVIA 2KZZA 3NF8A 4O4GA 3AO1A 3V1QA 3HM9A 3RMCA 2P51A 5E41A 4J2DA 3V1OA 4CIFA 1ZYQA 3V9UA 4CJKA 4Z4EA 2GUIA 4Q0BA 3TAMA 4M3ZA 3CM5A 1X9MA 1J9AA 3HVRA 4FJHA 1UWBA 4MQ3A 4TSXA 4PUOA 1WN7A 3G10A 4CEAA 2HW3A 1Z26A 4ZHRA 2XO7A 1Q9XA 4F3OA 1S5JA 3L2VA 4DTXA 2KQ2A 3K2PA 4CE9A 1T05A 4KI6A 1BIZA 2HNZA 3V1RA 1HYZA 1D9DA 1TL1A 2BDPA 4DWIA 4FJ5A 3KLHA 3CG7A 2OPPA 3BDPA 3MEGA 3KLGA 2KW4A 2KZMA 3SPYA 1LAWA 3HPGA 3OS1A 2LSNA 3ZSXA 4WE1A 1ZBIA 2OPQA 3AA5X 4CJQA 4NYNA 3D0PA 4M3TA 1RDAA 1BGXT 3L2UA 3B6OA 3NAEA 2X6NA 4IFVA 4CF9A 5SWMA 1SL1A 1NKBA 4RG8A 3OYEA 4OLAA 3U3YA 3V9ZA 3TAGA 1U04A 1QSLA 1HYVA 4W5QA 5C42A 3V9WA 3QEPA 2X6SA 4AHUA 5EU7A 5J2QA 1L3VA 4Z4HA 3OYIA 4FJLA 3ZSRA 4CGGA 3C6TA 1VSFA 1TK8A 4AHTA 3QETA 2HHVA 3K5LA 4M3UA 3NGYA 4C8NA 3CFRA 1UAXA 4DTRA 3AO3A 2B6AA 3ZT3A 5HRSA 4KTZA 1TV6A 1NKCA 2Y1JA 4O5BA 3NCIA 1UA1A 4KKOA 4CJLA 4NCBA 3OYJA 1XHZA 4M3WA 3L3UA 4H4OA 3HK2A 1ZBLA 4DSLA 5HLFA 3C94A 4W5TA 4BE0A 4KAZA 4AHSA 4DLEA 3DRSA 4M3YA 2P5GA 4UQGA 1TKXA 1JLEA 3NF9A 3DLRA 4CEOA 4FLXA 3KD5E 1BI4A 4CEDA 2RKIA 1S6PA 1RBSA 1GOCA 3P5JA 4HTUA 3OYFA 4J2BA 1T7PA 1IG9A 1LAVA 1HPZA 4F8RA 5KGXA 1NK6A 3HPHA 3SI6A 3RWUA 1X9WA 2XRIA 4B8CA 2ZD1A 1C0MA 3K57A 1XC9A 4FJXA 3K5NA 3AV9A 3KLIA 5SZTA 3VQ4A 1XHXA 2G8UA 3G0ZA 3HVTA 4DMNA 3OYKA 1LW2A 2YHAA 1U47A 1Z25A 2Y1IA 4CJVA 4O44A 4FJNA 2VG7A 1VSKA 3VQ9A 3DRRA 4ICLA 2A1RA 1GOBA 3NHGA 3PO5A 4LH5A 3IG1A 3LWMA 3MXMA 1KFDA 3RR8A 4DFJA 1RDDA 2KFNA 1LWCA 3O3FA 2Z1GA 4M3XA 4FYDA 2HVHA 2PYJA 1KLMA 2YHBA 4KHSA 4FVMA 5HBMA 3IAYA 4CGFA 3S9HA 3PUFA 1YT3A 4PQUA 4OJRA 3RMDA 1RTIA 3QERA 3KKSA 4HUFA 4B9UA 4HCCA 1SL0A 1IKWA 3I8DA 4E3SA 3MXIA 4FZXC 1KVCA 4FLZA 4GMJB 1SV5A 1A5XA 3TANA 1J54A 1JKHA 1BIUA 4DF8A 4OLBA 1ASUA 4QOZB 3CFPA 2D0AA 1TKTA 3QNOA 2D5RA 3QEVA 4CJWA 1SUQA 3EZ5A 4PA1A 3WNFA 4DTPA 2OYQA 1IKVA 4OGEA 3K59A 4N47A 3A2FA 3V81A 4ZTFA 1U45A 1XI1A 1JLFA 2RN2A 3SJJA 3HJFA 4DQQA 1RT7A 1W0HA 1TK5A 1IKYA 2ZQBA 2I5JA 3DM2A 3SUQA 4OKEA 4C8OA 1C1AA 3VQ8A 1GOAA 3SUOA 1ZBHA 4KPYA 4OPJA 3OYGA 3SZ2A 1TK0A 4FM0A 1D5AA 4K8XA 3UIQA 4DQRA 3AVAA 3IRXA 5KI6A 3AVGA 4Z0UA 3LPTA 1NK0A 4K8ZA 1YTUA 3VQCA 3K5MA 2YNFA 2E6MA 3KK2A 4CIGA 5HRPA 3WNEA 4OGCA 1LWFA 1TGOA 1XWLA 2ETJA 2B5JA 4GW6A 4KV8A 4W5RA 2XY5A 4KHQA 2XY7A 2X74A 3AVMA 3VN5A 3K5OA 4DQSA 4DSIA 1ASWA 4FM1A 4CJ5A 4DSJA 2F8SA 2QKBA 5T7BA 4KB0A 4RW6A 2BANA 4O0JA 1KVBA 2IDOA 3O3HA 1FK9A 3OYAA 3KK3A 3DLKA 4BACA 4KI4A 1Y97A 2D0BA 3T1AA 3V9XA 1I3AA 4LSNA 4I9QA 1O1WA 4OKKA 3CYMA 1WSGA 1S6QA 1RDBA 4RW4A 1RTJA 2IS3A 2XY8A 1JL1A 1WAJA 4AHCA 4CECA 3U6FA 3AVCA 2KTQA 1JLBA 4B08A 4ELVA 2HHSA 1C1BA 1WSEA 4DSKA 3O4NA 2VG5A 3VQAA 2VG6A 3HYFA 3VQ7A 3SPZA 1Q9YA 3DOKA 4C8LA 4MFBA 4OPKA 3RR7A 3RRGA 4E89A 3ZSZA 3PX6A 4Y1DA 3PX0A 3TI0A 3PX4A 3SUNA 3QIOA 3P1GA 1NK7A 4E7LA 1BL3A 2HHTA 4FJ7A 3F73A 4BWJA 3T19A 3FFIA 1QE1A 3OYNA 2XHBA 1QTMA 3HP9A 3NF7A 1SKSA 1BQNA 1TAUA 3NH1A 3S3NA 1N5YA 4DF4A 4B3OA 1QSYA 3AA4A 3NFAA 3NH0A 1EETA 1SL2A 4KHYA 2BGGA 2EX3A 3SNNA 3BGRA 3LALA 3ASMA 3OYLA 1W9HA 3CQ8A 4FLTA 1R0AA 1KLNA 3L8BA 3V6DA 4L8RB 1QQCA 3ITHA 3CFOA 1DTTA 4RW8A 2OZMA 4CJTA 4LY7A 3NGZA 4QAGA 3LWLA 1F21A 2QK9A 1SKWA 3KLEA 3KK1A 3AVLA 3LZJA 2DTUA 4JRPA 3C95A 3ZT4A 4ID5A 4Y1CA 1N6QA 2HMIA 4AH9A 1HNVA 3CM6A 3QLHA 4CF0A 2YKNA 3VQBA 3QIPA 2HHQA 3P83D 3ZSVA 4BE1A 1JXEA 1VRTA 1VRUA 3RMAA 4DTMA 3AVKA 5CZ1A 3OYCA 5HP1A 1KVAA 4IDKA 2PYLA 1RT1A 2OPSA 3SUPA 4JS5A 1CZBA 3AO2A 1YVUA 4Z4GA 2X78A 4CGDA 3QINA 4DS4A 3TR8A 1RTDA 4CHYA 4DLGA 4BE2A 1WSFA 1BCMA 3NH2A 5I3UA 4CJ4A 2HHWA 1B92A 2O4IA 3DLGA 3OY9A 1RT2A 3ZSOA 3E01A 4PWDA 3KD1E 1EKEA 1IO2A 4FLVA 5HRNA 2QXFA 1QS4A 1NJXA 3DMJA 1BISA 4CFDA 4CEQA 5JS2A 1D9FA 4DTUA 4KHUA 3LANA 2PY5A 1TKDA 4B9MA 4E7HA 4ELTA 2DFFA 5I42A 3NGIA 1IKXA 1Q8IA 3ZCMA 4N56A 1RBRA 5FDLA 2DFHA 4CF2A 3MAQA 4CJRA 2XY6A 3SQ0A 1T03A 3OYMA 1C1CA 4CJFA 3KTQA 3LZIA 3RTVA 4I9LA 3VQPA 1KFSA 1RT4A 3DOLA 4DTSA 4FZZA 2ZE2A 1NK8A 3HSTB 4NCAA 4M42A 2OPRA 3AA3A 5KRSA 3TWHA 4FJMA 3VA3A 4B8AB 1VSLA 3HT3A 4FLUA 1L5UA 3HP6A 3MECA 3PO4A 4R5PA 4FM2A 3LP3A 5FROA 3TAPA 1WSHA 1TAQA 5C25A 4HCBA 4H8KA 2KFZA 3F9KA 1RBVA 3AVBA 3H08A 1HYSA 4LH4A 5CZ2A 3ZT0A 4CIEA 3AVHA 4DU1A 5HRRA 2WOMA 4FLYA 4DFMA 3M8PA 1VSJA 3MEDA 1KRPA 4XIUA 3ZT1A 3S3MA 1UA0A 2AJQA 2RPIA 4NYFA 3HO1A 4W5OA 5D3GA 4ID1A 5J2PA 4FW1A 1REVA 1LV5A 3PV8A 4B9NA 1CLQA 3JSMA 1JLQA 2GV9A 3NBPA 4CK2A 2W42A 3QEXA 1CZ9A 3QEIA 1WSJA 3SYZA 4DTJA 4HUEA 1IH7A 3AA2A 4ZTJA 2HVIA 4EP4A 2JGUA 4FK2A 1L3TA 1JL2A 4CFAA 1FXXA 1RT3A 4DU4A 4E1MA 5CYQA 3B6PA 2QKKA 1S9EA 1U4BA 2F8TA 5JS1A 1ZBUA 4FLWA 3T3FA 3TAQA 2HHXA 3KIOA 4CJUA 2ITGA 4CCHA 2G8IA 3OVNA 3HPOA 4ELUA 3THVA 3LP2A 3ISNC 1FKPA 4KFBA 1VSHA 4J2EA 4KREA 1EXQA 5C24A 3VQDA 1A5VA 1WAFA 1EP4A 4IG0A 2IC3A 4CHNA 3SQ4A 1K6YA 4CFCA 2G8WA 4CGHA 1CXQA 2DY4A 1KCFA 1RT5A 3RMBA 4F2SA 5J2MA 1S1WA 4YFUA 4I7FA 4BDYA 4CJPA 5K14A 1U48A 4FJGA 4B9LA 1WSIA 4Z4FA 3SQ2A 4FXDA 3OYDA 5KTQA 4DTOA 4IG3A 2O4GA 3VQEA 4F4KA 1JLAA 2E6LA 1TL3A 3IS9A 3NF6A 4FK0A 4CFBA 4F3TA 3AO4A 3DLEA 4AHRA 4CEEA 4J2AA 4EZ6A 3OS0A 2YNIA 2E4LA 2PZSA 1UOCA 3U3GA 4CGJA 1VSIA 3OJUA 3MXJA 3L2RA 1S9GA 2YNHA 4FJIA 3ALYA 3OJSA 4CHQA 3K58A 2OA8A 4KB1A 1HMVA 2P1JA 2RF2A 3LP0A 1RTHA 1U49A 5J1EA 4HVJA 2DFEA 4E1NA 4JLHA 1CXUA 2R7YA 1RCHA 1NKEA 4FJ8A 1HRHA 3AVNA 4CEFA 3TAFA 1RBTA 3I0SA 4DG1A 4CHZA 4CF1A 3C6UA 1J53A 1NK4A 4C8KA 3OYBA 3QO9A 4CGIA 4GVMA 3VQ5A 2ATQA 4B9VA 3L2QA 1C6VA 1BHLA 4JS4A 3VA0A 4DTNA 4KRFA 4FZYA 1JLCA 1JXBA 2FC0A 4HHTA 1BCOA 2P5OA 4DQIA 2VWKA 3AVJA 3NE6A 4Q5VA 4KTQA 4KHNA 2Z1HA 4KO0A 4LSLA 2G8HA 4FCYA 3MEEA 5CYMA 3LDSA 4DU3A 2G8VA 1X9SA 4DS5A 4FJKA 1RNHA 1NJZA 1TVRA 2YKMA 1BI4B 1RILA 1A5WA 1G15A 3L3VA 4G1QA 4DSEA 1RT6A 1TKZA 1EX4A 5HROA 4CERA 1HNIA 3O3GA 3DLBA 4YNQA 1WLJA 4E7KA 3TABA 1NK5A 4IBNA 2A1SA 3NDKA 3VQQA 5KGWA 1VK0A 4FJJA 3DLHA 3VQ6A 3I0RA 4CESA 4EZ9A 1KTQA 1X1PA 3LAMA 2OZSA 4O0IA 3AVFA 1BQMA 2JLEA 4AILC 4E0DA 1I39A 4OKJA 4OVLA 3ZSQA 4FJ9A 3SV4A 1NOYA 4Z4IA 3L2WA 2Z1IA 2B4JA 1B9DA 3ZT2A 1NK9A
chains in the Genus database with same CATH superfamily
3T69A 5KRTA 3QEWA 1L3UA 1MU2A 1L3SA 4CZLA 4KHWA 2HNYA 2HB5A 4JD2B 3RRHA 3CC4N 2FBYA 3HL8A 3ZLJA 2IAJA 4PL7A 5MLCQ 4IDHA 4ISGA 5FRNA 4CHOA 4EHTA 3EY1A 3C6AA 3EYZA 1S1TA 3H45C 4C8MA 4A2BA 2FBTA 4N76A 4I6MB 4W5NA 1DKGD 2IGIA 4IXCA 1KQSM 2G8KA 4KTWA 3ZSWA 3ENBA 2BH1A 1NGIA 3RSEB 3QNNA 1SKRA 1ZBFA 4QCLA 2YNGA 2QTDA 1RBUA 4GY2B 3THXA 4M45A 4JRQA 4B9QA 1Z6RA 4GKJK 1C0TA 1DTQA 2D0CA 2F9WA 4CJEA 1NGGA 3IDHA 3N4PA 2EHGA 2UXCK 4MDBA 5E26A 3AO1A 5GIPA 5E41A 4CIFA 3CHWA 1HJOA 4CJKA 4Z4EA 5CR4A 4BC3A 1X9MA 3A5MC 4DUYK 3D2EB 3BY5A 4DTXA 2HNZA 2BDPA 4FJ5A 5EX5A 2BUPA 3BDPA 4BRLA 1IV0A 4NLBA 4B1WB 4DV3K 2OPQA 4BRKA 1RDAA 1BGXT 3L2UA 4H0VB 4B3TK 1SL1A 1NKBA 5FPDA 3H1QA 1VQ7N 1U6ZA 3CI5A 3UKRA 4Z4HA 3JS6A 3DXKB 3O9QA 3C6TA 2KHOA 1X9JA 3QETA 2HHVA 1UAXA 4M7XA 1OH5A 3AO3A 1JCGA 5HRSA 3VMFB 4H4OA 3HK2A 3C94A 4DLEA 3DRSA 1TKXA 3DLRA 3VEWA 3KD5E 3OYFA 5BRFA 1T7PA 3CJ1A 4F8RA 1NK6A 3HPHA 3CJCA 1X9WA 2ZD1A 3CJ7A 4FJXA 3UB5A 3T1HK 3KLIA 2HBJA 1Z25A 3FLCO 4O44A 4H03B 2VG7A 4YORA 3DRRA 4BC5A 1GOBA 1QHAA 3J7ZO 3NHGA 4LH5A 3MXMA 1KFDA 5BRDA 2O8BB 4M3XA 2HVHA 2PYJA 3HSCA 4FVMA 4NXNK 2OTJN 3M6GA 4PQUA 4XH5A 4B9UA 1EQYA 1IKWA 4FZXC 4H5WA 4FLZA 3RVCA 1BIUA 4OLBA 3D2FB 3QNOA 4BROA 1TYQB 2HF3A 3CPWM 3QEVA 1OVQA 1SUQA 4FOEA 3EZ5A 4DHYA 3A2FA 3MX2A 1NGFA 3BZCA 2RN2A 3ENHA 1VQ6N 1W0HA 2I5JA 4C8OA 3R6MA 2OANA 2D1KA 3C65A 3SUOA 1HNXK 4KHPK 1TK0A 1E4GT 4FWQA 3LPTA 4H5VA 1T44A 1YTUA 4FWNA 2E6MA 3KK2A 1KXPA 5HRPA 5JVGL 4OGCA 2ETJA 2B5JA 3LDNA 4GW6A 1O13A 1TUUA 2HOEA 2Q0RA 5TKYA 3AVMA 4DSIA 4CJ5A 5T7BA 4KB0A 2BANA 4O0JA 1KVBA 1GLBG 2IDOA 3EKSA 3O3HA 4BACA 2O8FA 2D0BA 3T1AA 3V9XA 1I3AA 2QI2A 2HF4A 1SAZA 3MWTA 4OKKA 2XY8A 4DUZK 4CECA 3MN9A 3AVCA 4B08A 4ELVA 1C1BA 1BG3A 3VERA 1KC8O 2NRHA 4JEPA 2VG6A 2HMPA 3VQ7A 1Q9YA 2CH5A 4Y1DA 2ZJQL 3SUNA 3GG4A 1Y64A 4PL8A 4IOXA 5EXWA 4BWJA 3T19A 1IBMK 1QE1A 3OYNA 2XHBA 3HP9A 1BQNA 3NH1A 3AA4A 4DV5K 3NH0A 4KHYA 2EX3A 3R1XA 3OYLA 4LF5K 4FLTA 3V6DA 4L8RB 1N34K 3ITHA 4CJTA 4JI8K 4X65K 1F21A 3KLEA 1TUYA 3LZJA 4BVOA 4JRPA 4DV2K 3CM6A 3QLHA 2P9PB 2P9IA 4M63C 4DR6K 3ZSVA 1XNRK 1NGBA 1OH8A 4JI2K 2QWNA 4YOVA 4PKIA 3OYCA 1KVAA 3M1FA 4B1XB 4CZGA 5AQTA 2OPSA 3SUPA 1YVUA 1Q81O 4Z4GA 3C7NA 3QFUA 3QINA 1RTDA 2CGLA 3THYA 1E4FT 3HI0A 4K43A 1WSFA 1BCMA 5I3UA 2HHWA 2VQEK 4GNIA 3OY9A 1RT2A 1MWMA 4ISEA 1QZ5A 2QM1A 2P9KB 4JKAA 1W7AA 1HNWK 3DMJA 4CEQA 4A62A 3NGIA 2FF3B 3OBWA 3ZCMA 5FDLA 2DFHA 4OPAA 3Q7CA 3MAQA 2XY6A 5AQKA 2F7TA 1GLAG 4CJFA 1KFSA 5TKWA 4FZZA 4NCAA 1QQNA 2UU9K 3TWHA 4B1ZA 1L5UA 3LDLA 3HP6A 3LP3A 3TAPA 3QFPA 3LL3A 2E20A 4K41A 3H08A 2NLXA 3AVHA 4DU1A 5C0YA 4DFMA 3J8AA 3ZT1A 3S3MA 1UA0A 1K9MO 4V19S 2RPIA 1YJWN 4FW1A 2V7YA 1REVA 3THXB 2A5XA 1CLQA 1QQMA 3JSMA 2GV9A 3HRGA 4YOYA 1CZ9A 3QEIA 1WSJA 4BRDA 4DTJA 1IH7A 2JGUA 1L3TA 3LDQA 1RT3A 4CZKA 2QKKA 5JS1A 2VCPA 4FSVA 4JK9A 4CJUA 2ITGA 4CCHA 3I56N 3OTOK 1K73O 4U7BA 4ELUA 3LP2A 3ISNC 4KREA 2I7NA 3VQDA 1EP4A 4CZMA 2ZJRL 3QBXA 2QWQA 1OH7A 1CXQA 1RT5A 1SS6A 4DR2K 2IVPA 4B9LA 4Z4FA 1ZC6A 3VQEA 4F4KA 1JLAA 4LF4K 1TL3A 4BY9C 3NF6A 4LF7K 3MWPA 3AY9A 3H3NO 1DEJA 5M1KA 3DLEA 4BR7A 4CEEA 4J2AA 3S41A 3OS0A 2YNIA 4JAXA 5EY4A 2E2PA 3L2RA 3MXJA 3L4IA 4BR9A 4O8UA 3ALYA 1GLJO 2OA8A 5J1EA 4JLHA 3VF2A 4FJ8A 3ATVA 3AVNA 4DG1A 3UKRB 4CHZA 4L3QA 1BU6O 3CJAA 3QO9A 4GVMA 4CBXA 3L2QA 4WQ5C 2FC0A 3I55N 4GV9A 3IUCA 2P5OA 1CZAN 4KTQA 2OCEA 1Q7YO 5BN9A 3WXMB 3JXUA 4KBOA 1SQKA 1YJ9N 4CD1A 4DS5A 2GEMA 3CMAN 2Q0UA 1A5WA 5IWAK 1TKZA 4XEIA 3DLBA 3B8AX 4E7KA 3TSPA 4IWVA 4FWPA 4IBNA 1P8ZA 1VK0A 3I0RA 4CESA 4EZ9A 3DJCA 4K0KK 4AILC 4E0DA 1T6DA 4OKJA 5LMUK 2GUPA 1NOYA 4JI3K 5AQNA 3R9PA 2B4JA 1B9DA 3CCLN 4CJ3A 4N41A 3SLCA 3U4LA 4CF8A 2Q97A 3EO3A 3DYAA 3A0IX 5AQSA 4B1YB 3O4WA 3FZKA 3TAEA 1N33K 4IFYA 4M41A 3DRPA 5FPEA 5HL7L 3S3OA 4NXMK 4BDZA 1J5OA 4A59A 4CZHA 2NUBA 1C0UA 3V9SA 4LF9K 2F96A 3SCXA 2F4VK 3F9MA 1LWEA 1Q82O 1JLGA 1NJWA 1S1VA 1JCEA 1YTAA 4BC2A 2IOCA 2WONA 3TARA 2HHUA 2BE2A 1RDCA 4CK1A 3LPUA 5DK5A 4H4MA 4I2QA 4DR5K 4E1JA 1NOZA 2NRWA 2YV0X 5FRMA 1VSEA 4BRMA 4BVPA 2GBZA 1GLLO 1S1UA 2O8FB 4BG9A 3AVIA 2KZZA 3NF8A 2P51A 2O8EA 2ZWHA 4Q0BA 3TAMA 3CM5A 3VTHA 1BOTO 2HW3A 4KH4A 2E2NA 1Z26A 4ZHRA 2XO7A 1U2VA 1S5JA 1X3NA 3L2VA 2QWMA 3CPEA 5LMNK 4DWIA 5AZIA 1NNEA 3MEGA 2YHYA 2KW4A 3ULEA 2ZJPL 3OS1A 4KH6A 4JI5K 4CJQA 3D0PA 3E9OA 2X6NA 5BN8A 3NAEA 4IFVA 4JKCA 1QQOA 4NLCA 3QEPA 3VEXA 4AHUA 4BGAA 1L3VA 3H1VX 1ATRA 3TSUA 4JV5K 2VWBA 1TK8A 1YUWA 3K5LA 1RDWX 4JKGA 1TV6A 4KKOA 1J6ZA 4NCBA 3G4SN 4DSLA 2YJFA 3VESA 4WYBA 2P9IB 2P5GA 4UQGA 4CEDA 4DQ8A 1S6PA 3P5JA 1IG9A 5KGXA 4JKBA 2O8DA 3SI6A 3RWUA 3O8MA 2W40A 2XRIA 4B8CA 1C0MA 3C7NB 3K5NA 1ESVA 3VQ4A 1XHXA 3G0ZA 3HVTA 3THYB 4H5TA 2YHAA 4LFBK 4FWMA 3CCUN 4FJNA 1VSKA 5IT9O 4JK7A 3RR8A 4DFJA 1LWCA 3LDPA 1WBDA 5B8HA 4OPHA 5HBMA 3TPQA 3IAYA 3S9HA 3PUFA 4BR0A 1YT3A 1ILYA 4OJRA 3RMDA 4K25A 1RTIA 3QERA 1QVGM 2ASPA 3I8DA 4E3SA 5BR9A 1SV5A 4QOZB 2CGKA 1JKHA 1QVFM 5M1OA 1ASUA 3CFPA 1TKTA 2VYPA 4CJWA 2NRZA 4IFEA 3WNFA 4JI4K 4JI7K 3W3DA 3K59A 4AM7A 4HWIA 4ZTFA 3GBTA 1XI1A 1JLFA 1RT7A 1IKYA 2ZQBA 3SUQA 1GOAA 1NGHA 1HR0K 3GOIA 1D5AA 2YJEA 1BUPA 3EN9A 3AVAA 3IRXA 5KQDA 3AVGA 3BEXA 3C6HA 1EWRA 4Z0UA 1NK0A 3E66A 5C10A 3VQCA 3K5MA 3QB0A 3GL1A 4CIGA 3WNEA 1XWLA 4W5RA 1K8KA 2Q36A 5GINA 3OHRA 3K5OA 2QKBA 4DSJA 4RW6A 1ATNA 1FK9A 1GLEG 3DLKA 1Y97A 4LSNA 3R3LA 4I9QA 1S6QA 2IS3A 1GLCG 1WAJA 4AHCA 4MO5A 3NVKA 2KTQA 3ATUA 5ADXA 5AR0A 4M7YA 4DSKA 4CI6A 3O4NA 4DV6K 3VF4A 2GWKA 3SPZA 4DR1K 4C8LA 3RR7A 4E89A 1HPMA 2IIRA 3PX0A 3TI0A 3EL2A 3QIOA 1NK7A 4E7LA 3MCAB 5ELZA 5EVZA 2HHTA 4ILHA 2A6AA 2UUBK 3FFIA 2CGJA 5LJVA 3EE9A 1VQLN 3WUHA 1DT9A 4B3OA 1QSYA 3LM9A 3U9DA 4C1NI 4CD3A 4H0PA 3O6WA 3BGRA 2P9LA 2VGMA 4DV1K 1KLNA 3I8BA 2OZMA 4LY7A 4G9ZA 4EIAA 5C2DA 3A8YA 3C95A 1N6QA 3ID6A 3GDQA 3IFRA 4AH9A 4CF0A 2YKNA 4BR5A 4CBWA 3VQBA 4QS8A 1JJ2M 4BE1A 2A42A 1JXEA 1VQ5N 3RMAA 1S3XA 2W6LA 5CZ1A 5HP1A 2PFUA 1CZBA 2X78A 3TR8A 3QICA 4CHYA 4BE2A 3O08A 1NGEA 1XNQK 1B92A 4H0OA 2O4IA 3DLGA 4PWDA 3KD1E 2DPNA 2WBNA 4CZEA 1NJXA 3UKUA 5FLXO 5DM7L 4H0TB 5JS2A 4EHUA 3ZX2A 2JWKA 1FW6A 4B3MK 1RBRA 4OO1J 2D4WA 4CF2A 4CZJA 4B1VA 3LZIA 3DOLA 4DTSA 3E9PA 3HSTB 5H1SQ 1MDUB 3LM2A 1VSLA 4FLUA 4BR2A 3F5TA 4R5PA 5AFUH 4BC4A 4HCBA 4H8KA 4QS7A 1RBVA 5LL6Z 5CZ2A 2WOMA 3I33A 4WQ4C 1KRPA 3P39A 4FL9A 3H3OB 4NYFA 1V4SA 2E88A 1IBKK 5D3GA 4ID1A 5J2PA 1NMNA 1LV5A 3G25A 4JYAK 4CK2A 3QEXA 2W42A 3AA2A 1OH6A 4O8KA 1LCUA 1FXXA 4BRHA 3T1YK 5CYQA 4FWRA 2V7ZA 4A5BA 3T3FA 3TAQA 3CCMN 4Y0WA 1VQ9N 2O8EB 3THVA 5AQZA 1FKPA 4HTLA 4CBUA 4CHNA 4MLEA 2UUAK 1K6YA 5AFUA 3CD6N 1KCFA 1BO5O 4F2SA 5J2MA 4YFUA 2VQFK 4BDYA 4CJPA 5K14A 1U2VB 1WSIA 4FXDA 5M1PA 3OYDA 5AZIB 3IS9A 4EFHA 4FK0A 3ULEB 3AO4A 4A57A 4X64K 4EZ6A 1S9GA 4DV7K 3SAFA 1HMVA 1RTHA 2ASMA 4HVJA 1CXUA 1RCHA 3I0SA 1QZ6A 1NK4A 4C8KA 4CGIA 2W6KA 3VQ5A 2ATQA 4JKGB 1HUXA 1BCOA 3ZYYX 2VWKA 3NE6A 4KHNA 2Z1HA 4KO0A 2G8HA 5CYMA 3LDSA 4X62K 2A41A 2G8VA 1X9SA 1RNHA 2YKMA 3KZBA 1G15A 3SK3A 4CERA 1HNIA 3O3GA 2O8DB 1EWQA 2NRXA 5KGWA 3GE1A 2OZSA 3FR0A 2JLEA 3SV4A 4Z4IA 3ENOA 4CEZA 2FBVA 4CHPA 1DLOA 1WNSA 3M8RA 4DSFA 3UE5A 3Q7BA 3E9LA 4HUGA 5AQQA 4FK4A 4PY5A 2GTDA 2GWJA 3ZSYA 3A5LC 4H5RA 3KVGA 1VSDA 3JYTA 3BZKA 4Z4CA 2UYTA 4RW7A 2IVOA 3MMVA 1LW0A 1WBBA 4JN4A 3HOTA 4DFKA 3KKRA 4YOWA 1D8YA 4CJSA 3V4IA 4IJNA 4AQYK 1T03A 2Z1JA 3M8QA 4FW2A 1VQPN 4M3RA 2YHWA 2FBXA 3LAKA 5AQMA 1N36K 3QDKA 4NCGA 1HX1A 3CC2N 3SV3A 1T8EA 3OYHA 1NJYA 5CY4A 3WNHA 3PY8A 1B9FA 5GAGP 5KPTA 3KWIA 1K8KB 2WTUA 1HQUA 4EP5A 5DMRA 2HSTA 4AHVA 4CEBA 1HQEA 2CH6A 3HXMA 2D0OA 4FPAA 4E19A 1KSPA 3U9ZA 3QESA 1FKOA 4IKFA 3MN7A 3DXMA 3OA9A 3M3ZA 4O4GA 3V1QA 3VOVA 1XUPO 3V1OA 4J2DA 2GUIA 4M3ZA 3O9TA 5BRHA 3HVRA 3WQUA 1UWBA 4MQ3A 4RCHA 3TTCA 3CCRN 3G10A 4CEAA 1NWKA 4F3OA 3WXKA 2KQ2A 3K2PA 1BIZA 3CQXA 1D9DA 1TL1A 2FLOA 2OPPA 2QWPA 1YF5L 3KLGA 1LAWA 1Q86O 2LSNA 3ZSXA 4WE1A 1HKCA 3CQYA 3W0LA 4WQ5A 2Q1NA 4IEEA 1X3MA 4RG8A 3TAGA 3HBTA 1HYVA 3V9WA 1WOQA 3HZ6A 2GX9A 2P9LB 3OYIA 3ZSRA 3FZMA 1VSFA 4BRNA 3G71N 3NGYA 4C8NA 3CFRA 4DTRA 1W2BM 2B6AA 3ZT3A 3L4QA 4UY8O 4KTZA 1NKCA 2Y1JA 4O5BA 5AZJA 4BRFA 3KWGA 1D4XA 3L3UA 4KAZA 4W5TA 1NGDA 4JKEA 4AHSA 2O8CA 1JLEA 4O5FA 4CEOA 1BA1A 4FLXA 2RKIA 1RBSA 3BF1A 3AAQA 3NMUA 4CJ7A 4J2BA 1LAVA 2UUCK 5AQWA 3O5BA 3MDQA 3MK6A 3PIPL 3K57A 4IJAA 4LC9B 4JKDA 3O1BA 1U47A 3OW2M 3IG1A 1RDDA 3UKUB 2KFNA 3O3FA 2Z1GA 4IZ9A 4WF9L 4FYDA 1KLMA 3M5RA 2YHBA 3CCSN 2Q31A 4DV0K 5LY3A 3KKSA 4HUFA 4HCCA 1SL0A 5M1QA 4YOXA 1KVCA 4GMJB 3TANA 4DR3K 4DF8A 4CZIA 2D5RA 4PA1A 4DTPA 3TU5A 1IKVA 4OGEA 1U45A 3HJFA 3QBWA 3SJJA 4ISFA 1TK5A 1VQKN 4OKEA 1C1AA 2YHXA 3OYGA 2D0PA 4K8XA 3UIQA 4DQRA 5KI6A 4ILJA 4ILGB 5AQLA 3EZWA 3FZFA 2QA4N 2YNFA 2XY5A 4KHQA 2PBDA 4B1UB 2X74A 3VN5A 4DQSA 1ASWA 3U8XA 4FM1A 3BF3A 3KK3A 4KI4A 1Z05A 2UXDK 1RDBA 4RW4A 1RTJA 2YI1A 5KQ8A 3CMEN 4JKHA 3DLLL 4GV6A 1JLBA 4NB4A 2HHSA 1WSEA 3DWLA 1T3VA 1H1VA 2ZF5O 3O9SA 3HYFA 3P38A 4KH5A 1C0FA 5M1FA 3DOKA 4MFBA 4OPKA 5LJWA 4A2AA 3ZSZA 3PX6A 3L6QA 1GLFO 1XQSC 3P1GA 4EAHD 2YCHA 2NRRA 1WUAA 1XC3A 3VENA 1QTMA 5AQUA 3NF7A 3J7YP 4DV4K 1SKSA 1TAUA 4DF4A 1MWKA 3WEEA 1SL2A 1EETA 3DAWA 3ASMA 1LOTB 4C1NK 3L8BA 3CFOA 4RTFD 4RW8A 4CW7B 4QAGA 4YDUA 3LWLA 1RDUA 3SMSA 5A2QO 4MO4A 2QK9A 3KK1A 3AVLA 2DTUA 3LDOA 4ID5A 4Y1CA 1R59O 3D7EO 2HMIA 4BRAA 1HNVA 4YDUC 3BP8A 3QIPA 2HHQA 3P83D 3THWA 2ASOA 3HOSA 2PYLA 1XMOK 4IDKA 1IG8A 1RT1A 1YI2N 4NO7A 4DS4A 1MA9B 2QWOA 4CJ4A 1WB9A 3ZSOA 1N8RO 4GVEA 5BPLA 1IO2A 3FGUA 4FLVA 5HRNA 3SAGA 1BISA 1DGKN 3QMLA 5F0XA 4DTUA 4KHUA 4B9MA 4YOTA 2DFFA 4BREA 3SQ0A 3SJHA 1C1CA 2I7PA 5ADXH 3RTVA 1RT4A 2ZE2A 1NK8A 3O1WA 4M42A 4JNEA 1I94K 3AA3A 5KRSA 4FJMA 3VEVA 3VA3A 3VGLA 3MECA 3AGRA 4FM2A 4DKWA 2P9UA 4DR7K 1TAQA 5C25A 2KFZA 1NLVA 1HYSA 4CIEA 5HRRA 4MLHA 5JLHA 2KKZA 1VSJA 3MEDA 2EWSA 4XIUA 4B3SK 2V52B 2AJQA 2QW9A 3HO1A 4W5OA 4DCHA 1VQNN 1KAYA 3NBPA 2HVIA 1JL2A 1YXQA 4E1MA 3O9UA 3TTFA 1S9EA 1U4BA 2F8TA 3DXMB 2HHXA 2Q2RA 3OVNA 3AAPA 3HPOA 3CCJN 3F2KA 3HTVA 1YJNN 4KFBA 1VSHA 5AQVA 1EXQA 1A5VA 4IG0A 3SQ4A 5BPNA 4FWSA 1VQ8N 4CGHA 5C2FA 2DY4A 2P9NA 3SBGA 3RMBA 5KPRA 3TTDA 4JHDA 4FO0A 5KTQA 4IG3A 2E6LA 3CXCM 4BRGA 4YOUA 4J8FA 1RGIA 2E4LA 3U3GA 1FJGK 3ZETB 4FJIA 1NU0A 3OJSA 4CHQA 3K58A 3K9JA 2P1JA 2RF2A 1U49A 3WXJA 2YX6A 4E1NA 1NG9A 2R7YA 1HRHA 4CEFA 3TAFA 4BRPA 3C0BA 4CF1A 4DB3A 1J53A 1IJJA 3OYBA 1YVNA 2VGNA 2ZGZA 4JS4A 1C6VA 1BHLA 3VA0A 4DTNA 4FZYA 1JLCA 3PIOL 5AZJB 4HHTA 4DQIA 5F2RA 1C0GA 4Q5VA 5C12A 2OTLN 4IEIA 3EEQA 4CZFA 2O8CB 4FJKA 3BUZB 4PHTX 1RILA 4G1QA 4LFCK 1EX4A 2HBMA 2A1SA 2E2OA 2HBLA 4FJJA 1BDGA 3DLHA 3P4IA 4F9OA 1KTQA 1X1PA 3FFKB 3LAMA 4A61A 4O0IA 3OBYA 1GLDG 3ZSQA 4GKKK 4R79A 3L2WA 2Z1IA 2HBKA 3ZEUA 3ZT2A 1YIJN 1ITGA 1NK9A 1VSMA 1M90O 2ZM6K 3KJVA 1QHTA 3G6EN 1P90A 2Q3SA 3J7AP 4CK3A 2VWJA 1VAZA 5HOOA 4WQ4A 4BWMA 1NMDA 3DI6A 1ASVA 3ULDA 4DQPA 3IMXA 4B9SA 4B9TA 4FJ9A 1KAZA 3LP1A 3WNGA 4BDPA 3D45A 4N5SA 5J2NA 1QSSA 4DFPA 3KHYA 2HNDA 3AO5A 3O4QA 3M8SA 2GELA 3NVMA 2QEXN 2FSJA 1ZXOA 4FWLA 1HJRA 3A5OC 3VTIA 1S1XA 2E1YA 4E7JA 4B3RK 4XH1A 3JAMO 3KLFA 4F2RA 4RW9A 4I2PA 4IO8A 5AQYA 5M1NA 2FSKA 4LF6K 3OS2A 2WC9A 4O55A 4X66K 4MDAA 4LD0A 2RE2A 4E7IA 3SQ1A 2E8AA 2G8FA 3HM9A 1NGAA 2WFBA 3K0SA 3RMCA 3CCQN 1ZYQA 3V9UA 1KAXA 1Q18A 3E1YA 1J9AA 2E5LK 4FJHA 3MN6A 5BPMA 2NRVA 3CETA 4TSXA 4PUOA 1WN7A 1Q9XA 3SAHA 5JMVA 5JICA 2E2QA 4CE9A 1T05A 4KI6A 3V1RA 1HYZA 3KLHA 3CG7A 2KZMA 3SPYA 4FVUA 3HPGA 1ZBIA 2P9SA 3AA5X 4NYNA 4M3TA 4WFBL 3B6OA 5DM6L 1S72N 1XMQK 4CF9A 5SWMA 4OLAA 3OYEA 3FZLA 3V9ZA 3U3YA 3WEEB 1U04A 1QSLA 2A3ZA 4W5QA 4BRQA 5C42A 2X6SA 5J2QA 5EU7A 1NBWA 4FJLA 1YAGA 5AQFA 4CGGA 4AHTA 5AJ3K 4M3UA 5BREA 1S22A 5AQGA 5GAEP 3NCIA 1UA1A 4CJLA 3OYJA 1XHZA 4M3WA 2AP1A 1ZBLA 5HLFA 4BE0A 1ATSA 3AGKA 2QWLA 3A5NC 4M3YA 3NF9A 3THWB 1BI4A 4HTUA 1GOCA 5AQHA 1HPZA 3FE1A 2NRTA 4FWKA 3K9KA 2H3GX 1XC9A 3AV9A 3TSQA 5SZTA 2G8UA 4DMNA 3OYKA 1LW2A 2Y1IA 4CJVA 3VQ9A 4ICLA 2A1RA 3PO5A 2NNWA 3LWMA 1NM1A 3MX5A 5CE3A 1NGCA 1J5EK 4IOAL 1N32K 4KHSA 4CGFA 5C15A 4A5AA 5EOYA 4JI6K 3MXIA 3CJBA 4JD2A 5AQRA 4C23A 1A5XA 1J54A 2D0AA 4BRIA 4JK8A 2J4RA 2OYQA 3V81A 2P9UB 4N47A 4I6MA 5I9EB 4DQQA 3DM2A 4YY3K 3VQ8A 4AM6A 1ZBHA 4KPYA 4OPJA 3SZ2A 2UXBK 4FM0A 5JLFA 4WFAL 1OKJA 1SZ2A 3RSEA 4K8ZA 4GV3A 4DR4K 3VGMA 4LF8K 1LWFA 1TGOA 4KV8A 3ZX3A 3O9RA 2XY7A 2F8SA 4BRCA 3HM8A 3OYAA 4BQZA 4IOCL 2F9TA 1O1WA 3CYMA 1WSGA 1NJIO 1JL1A 1E3MA 3U6FA 2AA4A 1ZBSA 5AQOA 3MN5A 2P9NB 2VG5A 3VQAA 3D2EA 4JHDB 2IVNA 5JVHL 3PLAA 3RRGA 4LFAK 3ZETA 4K42A 3T7ZA 3PX4A 4BGBA 1BL3A 3R8EA 4FJ7A 3VGKA 3F73A 3AARA 4BG8A 3S3NA 1N5YA 1BA0A 3NFAA 5AQPA 2BGGA 3SNNA 2QWRA 3LALA 3CQ8A 1R0AA 1W9HA 3DXKA 1QQCA 1DTTA 4WFNL 3H46O 3CF5L 1V4TA 3NGZA 2RHKA 1VQ4N 1HKGA 1SKWA 3ZT4A 4OX9K 2V51B 1YHQN 4AF1A 5GAHP 4U67L 3J81O 4CVNE 1VRTA 1VRUA 4DTMA 3AVKA 3VF6A 3VETA 3VPZA 3J80O 3CERA 2FSNA 4JS5A 1HLUA 1RFQA 3AO2A 4CGDA 2JWLA 4DLGA 3CIPA 3NH2A 1IBLK 3E01A 5BR8K 4PKHA 1EKEA 2QXFA 1QS4A 2PAVA 2O8BA 2W41A 3P31A 4CFDA 3IKMA 3ZEUB 5KPZA 1D9FA 3LANA 3WQTA 1TKDA 2PY5A 4E7HA 4ELTA 4JKFA 1BWFO 5I42A 1IKXA 1Q8IA 4N56A 1M1KO 4H0YB 4BR4A 2ZGYA 4CJRA 5GADP 3OYMA 2BTFA 3KTQA 4I9LA 3VQPA 1NGJA 3D2FA 5E84A 2OPRA 1TYQA 4B8AB 3HT3A 3PO4A 5FROA 1WSHA 3D6RA 3N4QA 3F9KA 3AVBA 3PSIA 4LH4A 3ZT0A 1KD1O 3L0QA 4FLYA 3M8PA 1VHXA 5AQXA 4RWTA 1K8AO 2FF6A 3PV8A 4B9NA 2KLAA 1JLQA 1W97L 4IO9L 3SBTA 3WXLA 3EKUA 3SYZA 4HUEA 4ZTJA 5FPMA 4EP4A 4FK2A 3SMPA 4CFAA 2FXUA 4DU4A 3B6PA 5AQIA 1ZBUA 4FPBA 4FLWA 3MCPA 4Z94A 3KIOA 3CC7N 2G8IA 3KK7A 4J2EA 5C24A 1JCFA 1WAFA 3CCVN 2IC3A 4CFCA 2G8WA 3CCEN 1S1WA 4I7FA 1U48A 4FJGA 3SQ2A 5GIOA 1OVYA 5AQJA 4DTOA 2O4GA 4CFBA 4F3TA 4AHRA 1EO1A 4FWOA 3VEYA 3H6EA 2PZSA 1UOCA 2P9SB 1VSIA 4CGJA 3OJUA 2YNHA 3FZHA 4KB1A 3LP0A 4PKGA 2ITMA 3VEOA 2DFEA 1NKEA 3ID8A 4JI0K 4BQLA 1RBTA 3O80A 3C6UA 1VQMN 5F1XA 3PSFA 4B9VA 4KRFA 1JXBA 4WCEL 2NZTA 3AVJA 4XH4A 1G99A 4LSLA 3WXIA 4H0XB 5FPNA 3EE8A 2P9PA 3MEEA 4FOIA 4JI1K 4FCYA 4DU3A 2HHHK 1HKBA 1NJZA 1TVRA 1BI4B 3CJ9A 3ZX0A 3L3VA 1YITN 4H5NA 4DSEA 1RT6A 5CHIA 5HROA 4YNQA 1T6CA 1WLJA 3TABA 1NK5A 3NDKA 3VQQA 4YHHK 2E1ZA 3VQ6A 1VQON 3AVFA 1BQMA 2A40A 1I39A 4QS9A 4OVLA 1HNZK 3VEZA 2P9KA 2WUSA 3WT0A 2QXLA
chains in the Genus database with same CATH topology
4CJ3A 1ITGA 4N41A 1VSMA 4CF8A 4CEZA 5KRTA 1QHTA 2FBVA 4CHPA 3KJVA 3QEWA 1DLOA 1WNSA 3M8RA 3DYAA 4DSFA 1L3UA 1MU2A 1L3SA 4HUGA 4FK4A 2Q3SA 4PY5A 3TAEA 4KHWA 2HNYA 4IFYA 4M41A 3ZSYA 4CK3A 3JYTA 1VSDA 2HB5A 3DRPA 3RRHA 2VWJA 4Z4CA 3S3OA 4BWMA 3DI6A 2FBYA 3HL8A 1ASVA 4RW7A 3ULDA 4BDZA 4DQPA 2IAJA 1J5OA 4B9SA 1LW0A 4B9TA 5FRNA 2NUBA 1C0UA 4CHOA 3EY1A 3LP1A 1S1TA 3EYZA 4C8MA 3V9SA 4DFKA 2F96A 2FBTA 3SCXA 4N76A 3WNGA 4W5NA 4BDPA 1LWEA 3D45A 4N5SA 5J2NA 1QSSA 3KKRA 1JLGA 1D8YA 4DFPA 2HNDA 4CJSA 2IGIA 3V4IA 2G8KA 3AO5A 3O4QA 4KTWA 3ZSWA 1NJWA 1S1VA 2Z1JA 3M8QA 3M8SA 1YTAA 4FW2A 2IOCA 2WONA 4M3RA 3TARA 2HHUA 2BE2A 2FBXA 3LAKA 4NCGA 1RDCA 4CK1A 3QNNA 3LPUA 5DK5A 3SV3A 1T8EA 1ZBFA 4H4MA 1HJRA 4I2QA 3OYHA 1NJYA 1SKRA 2YNGA 4QCLA 1RBUA 5CY4A 3WNHA 4M45A 3PY8A 1S1XA 4JRQA 4E7JA 1B9FA 1NOZA 1HQUA 4EP5A 5DMRA 4AHVA 4CEBA 1HQEA 3HXMA 1C0TA 2YV0X 4RW9A 1DTQA 2D0CA 4I2PA 4E19A 1VSEA 4CJEA 3KLFA 4F2RA 2GBZA 3OS2A 5FRMA 1KSPA 4O55A 3QESA 1S1UA 1FKOA 4LD0A 2EHGA 4E7IA 3SQ1A 4IKFA 2G8FA 3AVIA 2KZZA 3NF8A 4O4GA 3AO1A 3V1QA 3HM9A 3RMCA 2P51A 5E41A 4J2DA 3V1OA 4CIFA 1ZYQA 3V9UA 4CJKA 4Z4EA 2GUIA 4Q0BA 3TAMA 4M3ZA 3CM5A 1X9MA 1J9AA 3HVRA 4FJHA 1UWBA 4MQ3A 4TSXA 4PUOA 1WN7A 3G10A 4CEAA 2HW3A 1Z26A 4ZHRA 2XO7A 1Q9XA 4F3OA 1S5JA 3L2VA 4DTXA 2KQ2A 3K2PA 4CE9A 1T05A 4KI6A 1BIZA 2HNZA 3V1RA 1HYZA 1D9DA 1TL1A 2BDPA 4DWIA 4FJ5A 3KLHA 3CG7A 2OPPA 3BDPA 3MEGA 3KLGA 2KW4A 2KZMA 3SPYA 1LAWA 3HPGA 3OS1A 2LSNA 3ZSXA 4WE1A 1ZBIA 2OPQA 3AA5X 4CJQA 4NYNA 3D0PA 4M3TA 1RDAA 1BGXT 3L2UA 3B6OA 3NAEA 2X6NA 4IFVA 4CF9A 5SWMA 1SL1A 1NKBA 4RG8A 3OYEA 4OLAA 3U3YA 3V9ZA 3TAGA 1U04A 1QSLA 1HYVA 4W5QA 5C42A 3V9WA 3QEPA 2X6SA 4AHUA 5EU7A 5J2QA 1L3VA 4Z4HA 3OYIA 4FJLA 3ZSRA 4CGGA 3C6TA 1VSFA 1TK8A 4AHTA 3QETA 2HHVA 3K5LA 4M3UA 3NGYA 4C8NA 3CFRA 1UAXA 4DTRA 3AO3A 2B6AA 3ZT3A 5HRSA 4KTZA 1TV6A 1NKCA 2Y1JA 4O5BA 3NCIA 1UA1A 4KKOA 4CJLA 4NCBA 3OYJA 1XHZA 4M3WA 3L3UA 4H4OA 3HK2A 1ZBLA 4DSLA 5HLFA 3C94A 4W5TA 4BE0A 4KAZA 4AHSA 4DLEA 3DRSA 4M3YA 2P5GA 4UQGA 1TKXA 1JLEA 3NF9A 3DLRA 4CEOA 4FLXA 3KD5E 1BI4A 4CEDA 2RKIA 1S6PA 1RBSA 1GOCA 3P5JA 4HTUA 3OYFA 4J2BA 1T7PA 1IG9A 1LAVA 1HPZA 4F8RA 5KGXA 1NK6A 3HPHA 3SI6A 3RWUA 1X9WA 2XRIA 4B8CA 2ZD1A 1C0MA 3K57A 1XC9A 4FJXA 3K5NA 3AV9A 3KLIA 5SZTA 3VQ4A 1XHXA 2G8UA 3G0ZA 3HVTA 4DMNA 3OYKA 1LW2A 2YHAA 1U47A 1Z25A 2Y1IA 4CJVA 4O44A 4FJNA 2VG7A 1VSKA 3VQ9A 3DRRA 4ICLA 2A1RA 1GOBA 3NHGA 3PO5A 4LH5A 3IG1A 3LWMA 3MXMA 1KFDA 3RR8A 4DFJA 1RDDA 2KFNA 1LWCA 3O3FA 2Z1GA 4M3XA 4FYDA 2HVHA 2PYJA 1KLMA 2YHBA 4KHSA 4FVMA 5HBMA 3IAYA 4CGFA 3S9HA 3PUFA 1YT3A 4PQUA 4OJRA 3RMDA 1RTIA 3QERA 3KKSA 4HUFA 4B9UA 4HCCA 1SL0A 1IKWA 3I8DA 4E3SA 3MXIA 4FZXC 1KVCA 4FLZA 4GMJB 1SV5A 1A5XA 3TANA 1J54A 1JKHA 1BIUA 4DF8A 4OLBA 1ASUA 4QOZB 3CFPA 2D0AA 1TKTA 3QNOA 2D5RA 3QEVA 4CJWA 1SUQA 3EZ5A 4PA1A 3WNFA 4DTPA 2OYQA 1IKVA 4OGEA 3K59A 4N47A 3A2FA 3V81A 4ZTFA 1U45A 1XI1A 1JLFA 2RN2A 3SJJA 3HJFA 4DQQA 1RT7A 1W0HA 1TK5A 1IKYA 2ZQBA 2I5JA 3DM2A 3SUQA 4OKEA 4C8OA 1C1AA 3VQ8A 1GOAA 3SUOA 1ZBHA 4KPYA 4OPJA 3OYGA 3SZ2A 1TK0A 4FM0A 1D5AA 4K8XA 3UIQA 4DQRA 3AVAA 3IRXA 5KI6A 3AVGA 4Z0UA 3LPTA 1NK0A 4K8ZA 1YTUA 3VQCA 3K5MA 2YNFA 2E6MA 3KK2A 4CIGA 5HRPA 3WNEA 4OGCA 1LWFA 1TGOA 1XWLA 2ETJA 2B5JA 4GW6A 4KV8A 4W5RA 2XY5A 4KHQA 2XY7A 2X74A 3AVMA 3VN5A 3K5OA 4DQSA 4DSIA 1ASWA 4FM1A 4CJ5A 4DSJA 2F8SA 2QKBA 5T7BA 4KB0A 4RW6A 2BANA 4O0JA 1KVBA 2IDOA 3O3HA 1FK9A 3OYAA 3KK3A 3DLKA 4BACA 4KI4A 1Y97A 2D0BA 3T1AA 3V9XA 1I3AA 4LSNA 4I9QA 1O1WA 4OKKA 3CYMA 1WSGA 1S6QA 1RDBA 4RW4A 1RTJA 2IS3A 2XY8A 1JL1A 1WAJA 4AHCA 4CECA 3U6FA 3AVCA 2KTQA 1JLBA 4B08A 4ELVA 2HHSA 1C1BA 1WSEA 4DSKA 3O4NA 2VG5A 3VQAA 2VG6A 3HYFA 3VQ7A 3SPZA 1Q9YA 3DOKA 4C8LA 4MFBA 4OPKA 3RR7A 3RRGA 4E89A 3ZSZA 3PX6A 4Y1DA 3PX0A 3TI0A 3PX4A 3SUNA 3QIOA 3P1GA 1NK7A 4E7LA 1BL3A 2HHTA 4FJ7A 3F73A 4BWJA 3T19A 3FFIA 1QE1A 3OYNA 2XHBA 1QTMA 3HP9A 3NF7A 1SKSA 1BQNA 1TAUA 3NH1A 3S3NA 1N5YA 4DF4A 4B3OA 1QSYA 3AA4A 3NFAA 3NH0A 1EETA 1SL2A 4KHYA 2BGGA 2EX3A 3SNNA 3BGRA 3LALA 3ASMA 3OYLA 1W9HA 3CQ8A 4FLTA 1R0AA 1KLNA 3L8BA 3V6DA 4L8RB 1QQCA 3ITHA 3CFOA 1DTTA 4RW8A 2OZMA 4CJTA 4LY7A 3NGZA 4QAGA 3LWLA 1F21A 2QK9A 1SKWA 3KLEA 3KK1A 3AVLA 3LZJA 2DTUA 4JRPA 3C95A 3ZT4A 4ID5A 4Y1CA 1N6QA 2HMIA 4AH9A 1HNVA 3CM6A 3QLHA 4CF0A 2YKNA 3VQBA 3QIPA 2HHQA 3P83D 3ZSVA 4BE1A 1JXEA 1VRTA 1VRUA 3RMAA 4DTMA 3AVKA 5CZ1A 3OYCA 5HP1A 1KVAA 4IDKA 2PYLA 1RT1A 2OPSA 3SUPA 4JS5A 1CZBA 3AO2A 1YVUA 4Z4GA 2X78A 4CGDA 3QINA 4DS4A 3TR8A 1RTDA 4CHYA 4DLGA 4BE2A 1WSFA 1BCMA 3NH2A 5I3UA 4CJ4A 2HHWA 1B92A 2O4IA 3DLGA 3OY9A 1RT2A 3ZSOA 3E01A 4PWDA 3KD1E 1EKEA 1IO2A 4FLVA 5HRNA 2QXFA 1QS4A 1NJXA 3DMJA 1BISA 4CFDA 4CEQA 5JS2A 1D9FA 4DTUA 4KHUA 3LANA 2PY5A 1TKDA 4B9MA 4E7HA 4ELTA 2DFFA 5I42A 3NGIA 1IKXA 1Q8IA 3ZCMA 4N56A 1RBRA 5FDLA 2DFHA 4CF2A 3MAQA 4CJRA 2XY6A 3SQ0A 1T03A 3OYMA 1C1CA 4CJFA 3KTQA 3LZIA 3RTVA 4I9LA 3VQPA 1KFSA 1RT4A 3DOLA 4DTSA 4FZZA 2ZE2A 1NK8A 3HSTB 4NCAA 4M42A 2OPRA 3AA3A 5KRSA 3TWHA 4FJMA 3VA3A 4B8AB 1VSLA 3HT3A 4FLUA 1L5UA 3HP6A 3MECA 3PO4A 4R5PA 4FM2A 3LP3A 5FROA 3TAPA 1WSHA 1TAQA 5C25A 4HCBA 4H8KA 2KFZA 3F9KA 1RBVA 3AVBA 3H08A 1HYSA 4LH4A 5CZ2A 3ZT0A 4CIEA 3AVHA 4DU1A 5HRRA 2WOMA 4FLYA 4DFMA 3M8PA 1VSJA 3MEDA 1KRPA 4XIUA 3ZT1A 3S3MA 1UA0A 2AJQA 2RPIA 4NYFA 3HO1A 4W5OA 5D3GA 4ID1A 5J2PA 4FW1A 1REVA 1LV5A 3PV8A 4B9NA 1CLQA 3JSMA 1JLQA 2GV9A 3NBPA 4CK2A 2W42A 3QEXA 1CZ9A 3QEIA 1WSJA 3SYZA 4DTJA 4HUEA 1IH7A 3AA2A 4ZTJA 2HVIA 4EP4A 2JGUA 4FK2A 1L3TA 1JL2A 4CFAA 1FXXA 1RT3A 4DU4A 4E1MA 5CYQA 3B6PA 2QKKA 1S9EA 1U4BA 2F8TA 5JS1A 1ZBUA 4FLWA 3T3FA 3TAQA 2HHXA 3KIOA 4CJUA 2ITGA 4CCHA 2G8IA 3OVNA 3HPOA 4ELUA 3THVA 3LP2A 3ISNC 1FKPA 4KFBA 1VSHA 4J2EA 4KREA 1EXQA 5C24A 3VQDA 1A5VA 1WAFA 1EP4A 4IG0A 2IC3A 4CHNA 3SQ4A 1K6YA 4CFCA 2G8WA 4CGHA 1CXQA 2DY4A 1KCFA 1RT5A 3RMBA 4F2SA 5J2MA 1S1WA 4YFUA 4I7FA 4BDYA 4CJPA 5K14A 1U48A 4FJGA 4B9LA 1WSIA 4Z4FA 3SQ2A 4FXDA 3OYDA 5KTQA 4DTOA 4IG3A 2O4GA 3VQEA 4F4KA 1JLAA 2E6LA 1TL3A 3IS9A 3NF6A 4FK0A 4CFBA 4F3TA 3AO4A 3DLEA 4AHRA 4CEEA 4J2AA 4EZ6A 3OS0A 2YNIA 2E4LA 2PZSA 1UOCA 3U3GA 4CGJA 1VSIA 3OJUA 3MXJA 3L2RA 1S9GA 2YNHA 4FJIA 3ALYA 3OJSA 4CHQA 3K58A 2OA8A 4KB1A 1HMVA 2P1JA 2RF2A 3LP0A 1RTHA 1U49A 5J1EA 4HVJA 2DFEA 4E1NA 4JLHA 1CXUA 2R7YA 1RCHA 1NKEA 4FJ8A 1HRHA 3AVNA 4CEFA 3TAFA 1RBTA 3I0SA 4DG1A 4CHZA 4CF1A 3C6UA 1J53A 1NK4A 4C8KA 3OYBA 3QO9A 4CGIA 4GVMA 3VQ5A 2ATQA 4B9VA 3L2QA 1C6VA 1BHLA 4JS4A 3VA0A 4DTNA 4KRFA 4FZYA 1JLCA 1JXBA 2FC0A 4HHTA 1BCOA 2P5OA 4DQIA 2VWKA 3AVJA 3NE6A 4Q5VA 4KTQA 4KHNA 2Z1HA 4KO0A 4LSLA 2G8HA 4FCYA 3MEEA 5CYMA 3LDSA 4DU3A 2G8VA 1X9SA 4DS5A 4FJKA 1RNHA 1NJZA 1TVRA 2YKMA 1BI4B 1RILA 1A5WA 1G15A 3L3VA 4G1QA 4DSEA 1RT6A 1TKZA 1EX4A 5HROA 4CERA 1HNIA 3O3GA 3DLBA 4YNQA 1WLJA 4E7KA 3TABA 1NK5A 4IBNA 2A1SA 3NDKA 3VQQA 5KGWA 1VK0A 4FJJA 3DLHA 3VQ6A 3I0RA 4CESA 4EZ9A 1KTQA 1X1PA 3LAMA 2OZSA 4O0IA 3AVFA 1BQMA 2JLEA 4AILC 4E0DA 1I39A 4OKJA 4OVLA 3ZSQA 4FJ9A 3SV4A 1NOYA 4Z4IA 3L2WA 2Z1IA 2B4JA 1B9DA 3ZT2A 1NK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ3 A;  1ITG A;  4N41 A;  1VSM A;  4CF8 A;  4CEZ A;  5KRT A;  1QHT A;  2FBV A;  4CHP A;  3KJV A;  3QEW A;  1DLO A;  1WNS A;  3M8R A;  3DYA A;  4DSF A;  1L3U A;  1MU2 A;  1L3S A;  4HUG A;  4FK4 A;  2Q3S A;  4PY5 A;  3TAE A;  4KHW A;  2HNY A;  4IFY A;  4M41 A;  3ZSY A;  4CK3 A;  3JYT A;  1VSD A;  2HB5 A;  3DRP A;  3RRH A;  2VWJ A;  4Z4C A;  3S3O A;  4BWM A;  3DI6 A;  2FBY A;  3HL8 A;  1ASV A;  4RW7 A;  3ULD A;  4BDZ A;  4DQP A;  2IAJ A;  1J5O A;  4B9S A;  1LW0 A;  4B9T A;  5FRN A;  2NUB A;  1C0U A;  4CHO A;  3EY1 A;  3LP1 A;  1S1T A;  3EYZ A;  4C8M A;  3V9S A;  4DFK A;  2F96 A;  2FBT A;  3SCX A;  4N76 A;  3WNG A;  4W5N A;  4BDP A;  1LWE A;  3D45 A;  4N5S A;  5J2N A;  1QSS A;  3KKR A;  1JLG A;  1D8Y A;  4DFP A;  2HND A;  4CJS A;  2IGI A;  3V4I A;  2G8K A;  3AO5 A;  3O4Q A;  4KTW A;  3ZSW A;  1NJW A;  1S1V A;  2Z1J A;  3M8Q A;  3M8S A;  1YTA A;  4FW2 A;  2IOC A;  2WON A;  4M3R A;  3TAR A;  2HHU A;  2BE2 A;  2FBX A;  3LAK A;  4NCG A;  1RDC A;  4CK1 A;  3QNN A;  3LPU A;  5DK5 A;  3SV3 A;  1T8E A;  1ZBF A;  4H4M A;  1HJR A;  4I2Q A;  3OYH A;  1NJY A;  1SKR A;  2YNG A;  4QCL A;  1RBU A;  5CY4 A;  3WNH A;  4M45 A;  3PY8 A;  1S1X A;  4JRQ A;  4E7J A;  1B9F A;  1NOZ A;  1HQU A;  4EP5 A;  5DMR A;  4AHV A;  4CEB A;  1HQE A;  3HXM A;  1C0T A;  2YV0 X;  4RW9 A;  1DTQ A;  2D0C A;  4I2P A;  4E19 A;  1VSE A;  4CJE A;  3KLF A;  4F2R A;  2GBZ A;  3OS2 A;  5FRM A;  1KSP A;  4O55 A;  3QES A;  1S1U A;  1FKO A;  4LD0 A;  2EHG A;  4E7I A;  3SQ1 A;  4IKF A;  2G8F A;  3AVI A;  2KZZ A;  3NF8 A;  4O4G A;  3AO1 A;  3V1Q A;  3HM9 A;  3RMC A;  2P51 A;  5E41 A;  4J2D A;  3V1O A;  4CIF A;  1ZYQ A;  3V9U A;  4CJK A;  4Z4E A;  2GUI A;  4Q0B A;  3TAM A;  4M3Z A;  3CM5 A;  1X9M A;  1J9A A;  3HVR A;  4FJH A;  1UWB A;  4MQ3 A;  4TSX A;  4PUO A;  1WN7 A;  3G10 A;  4CEA A;  2HW3 A;  1Z26 A;  4ZHR A;  2XO7 A;  1Q9X A;  4F3O A;  1S5J A;  3L2V A;  4DTX A;  2KQ2 A;  3K2P A;  4CE9 A;  1T05 A;  4KI6 A;  1BIZ A;  2HNZ A;  3V1R A;  1HYZ A;  1D9D A;  1TL1 A;  2BDP A;  4DWI A;  4FJ5 A;  3KLH A;  3CG7 A;  2OPP A;  3BDP A;  3MEG A;  3KLG A;  2KW4 A;  2KZM A;  3SPY A;  1LAW A;  3HPG A;  3OS1 A;  2LSN A;  3ZSX A;  4WE1 A;  1ZBI A;  2OPQ A;  3AA5 X;  4CJQ A;  4NYN A;  3D0P A;  4M3T A;  1RDA A;  1BGX T;  3L2U A;  3B6O A;  3NAE A;  2X6N A;  4IFV A;  4CF9 A;  5SWM A;  1SL1 A;  1NKB A;  4RG8 A;  3OYE A;  4OLA A;  3U3Y A;  3V9Z A;  3TAG A;  1U04 A;  1QSL A;  1HYV A;  4W5Q A;  5C42 A;  3V9W A;  3QEP A;  2X6S A;  4AHU A;  5EU7 A;  5J2Q A;  1L3V A;  4Z4H A;  3OYI A;  4FJL A;  3ZSR A;  4CGG A;  3C6T A;  1VSF A;  1TK8 A;  4AHT A;  3QET A;  2HHV A;  3K5L A;  4M3U A;  3NGY A;  4C8N A;  3CFR A;  1UAX A;  4DTR A;  3AO3 A;  2B6A A;  3ZT3 A;  5HRS A;  4KTZ A;  1TV6 A;  1NKC A;  2Y1J A;  4O5B A;  3NCI A;  1UA1 A;  4KKO A;  4CJL A;  4NCB A;  3OYJ A;  1XHZ A;  4M3W A;  3L3U A;  4H4O A;  3HK2 A;  1ZBL A;  4DSL A;  5HLF A;  3C94 A;  4W5T A;  4BE0 A;  4KAZ A;  4AHS A;  4DLE A;  3DRS A;  4M3Y A;  2P5G A;  4UQG A;  1TKX A;  1JLE A;  3NF9 A;  3DLR A;  4CEO A;  4FLX A;  3KD5 E;  1BI4 A;  4CED A;  2RKI A;  1S6P A;  1RBS A;  1GOC A;  3P5J A;  4HTU A;  3OYF A;  4J2B A;  1T7P A;  1IG9 A;  1LAV A;  1HPZ A;  4F8R A;  5KGX A;  1NK6 A;  3HPH A;  3SI6 A;  3RWU A;  1X9W A;  2XRI A;  4B8C A;  2ZD1 A;  1C0M A;  3K57 A;  1XC9 A;  4FJX A;  3K5N A;  3AV9 A;  3KLI A;  5SZT A;  3VQ4 A;  1XHX A;  2G8U A;  3G0Z A;  3HVT A;  4DMN A;  3OYK A;  1LW2 A;  2YHA A;  1U47 A;  1Z25 A;  2Y1I A;  4CJV A;  4O44 A;  4FJN A;  2VG7 A;  1VSK A;  3VQ9 A;  3DRR A;  4ICL A;  2A1R A;  1GOB A;  3NHG A;  3PO5 A;  4LH5 A;  3IG1 A;  3LWM A;  3MXM A;  1KFD A;  3RR8 A;  4DFJ A;  1RDD A;  2KFN A;  1LWC A;  3O3F A;  2Z1G A;  4M3X A;  4FYD A;  2HVH A;  2PYJ A;  1KLM A;  2YHB A;  4KHS A;  4FVM A;  5HBM A;  3IAY A;  4CGF A;  3S9H A;  3PUF A;  1YT3 A;  4PQU A;  4OJR A;  3RMD A;  1RTI A;  3QER A;  3KKS A;  4HUF A;  4B9U A;  4HCC A;  1SL0 A;  1IKW A;  3I8D A;  4E3S A;  3MXI A;  4FZX C;  1KVC A;  4FLZ A;  4GMJ B;  1SV5 A;  1A5X A;  3TAN A;  1J54 A;  1JKH A;  1BIU A;  4DF8 A;  4OLB A;  1ASU A;  4QOZ B;  3CFP A;  2D0A A;  1TKT A;  3QNO A;  2D5R A;  3QEV A;  4CJW A;  1SUQ A;  3EZ5 A;  4PA1 A;  3WNF A;  4DTP A;  2OYQ A;  1IKV A;  4OGE A;  3K59 A;  4N47 A;  3A2F A;  3V81 A;  4ZTF A;  1U45 A;  1XI1 A;  1JLF A;  2RN2 A;  3SJJ A;  3HJF A;  4DQQ A;  1RT7 A;  1W0H A;  1TK5 A;  1IKY A;  2ZQB A;  2I5J A;  3DM2 A;  3SUQ A;  4OKE A;  4C8O A;  1C1A A;  3VQ8 A;  1GOA A;  3SUO A;  1ZBH A;  4KPY A;  4OPJ A;  3OYG A;  3SZ2 A;  1TK0 A;  4FM0 A;  1D5A A;  4K8X A;  3UIQ A;  4DQR A;  3AVA A;  3IRX A;  5KI6 A;  3AVG A;  4Z0U A;  3LPT A;  1NK0 A;  4K8Z A;  1YTU A;  3VQC A;  3K5M A;  2YNF A;  2E6M A;  3KK2 A;  4CIG A;  5HRP A;  3WNE A;  4OGC A;  1LWF A;  1TGO A;  1XWL A;  2ETJ A;  2B5J A;  4GW6 A;  4KV8 A;  4W5R A;  2XY5 A;  4KHQ A;  2XY7 A;  2X74 A;  3AVM A;  3VN5 A;  3K5O A;  4DQS A;  4DSI A;  1ASW A;  4FM1 A;  4CJ5 A;  4DSJ A;  2F8S A;  2QKB A;  5T7B A;  4KB0 A;  4RW6 A;  2BAN A;  4O0J A;  1KVB A;  2IDO A;  3O3H A;  1FK9 A;  3OYA A;  3KK3 A;  3DLK A;  4BAC A;  4KI4 A;  1Y97 A;  2D0B A;  3T1A A;  3V9X A;  1I3A A;  4LSN A;  4I9Q A;  1O1W A;  4OKK A;  3CYM A;  1WSG A;  1S6Q A;  1RDB A;  4RW4 A;  1RTJ A;  2IS3 A;  2XY8 A;  1JL1 A;  1WAJ A;  4AHC A;  4CEC A;  3U6F A;  3AVC A;  2KTQ A;  1JLB A;  4B08 A;  4ELV A;  2HHS A;  1C1B A;  1WSE A;  4DSK A;  3O4N A;  2VG5 A;  3VQA A;  2VG6 A;  3HYF A;  3VQ7 A;  3SPZ A;  1Q9Y A;  3DOK A;  4C8L A;  4MFB A;  4OPK A;  3RR7 A;  3RRG A;  4E89 A;  3ZSZ A;  3PX6 A;  4Y1D A;  3PX0 A;  3TI0 A;  3PX4 A;  3SUN A;  3QIO A;  3P1G A;  1NK7 A;  4E7L A;  1BL3 A;  2HHT A;  4FJ7 A;  3F73 A;  4BWJ A;  3T19 A;  3FFI A;  1QE1 A;  3OYN A;  2XHB A;  1QTM A;  3HP9 A;  3NF7 A;  1SKS A;  1BQN A;  1TAU A;  3NH1 A;  3S3N A;  1N5Y A;  4DF4 A;  4B3O A;  1QSY A;  3AA4 A;  3NFA A;  3NH0 A;  1EET A;  1SL2 A;  4KHY A;  2BGG A;  2EX3 A;  3SNN A;  3BGR A;  3LAL A;  3ASM A;  3OYL A;  1W9H A;  3CQ8 A;  4FLT A;  1R0A A;  1KLN A;  3L8B A;  3V6D A;  4L8R B;  1QQC A;  3ITH A;  3CFO A;  1DTT A;  4RW8 A;  2OZM A;  4CJT A;  4LY7 A;  3NGZ A;  4QAG A;  3LWL A;  1F21 A;  2QK9 A;  1SKW A;  3KLE A;  3KK1 A;  3AVL A;  3LZJ A;  2DTU A;  4JRP A;  3C95 A;  3ZT4 A;  4ID5 A;  4Y1C A;  1N6Q A;  2HMI A;  4AH9 A;  1HNV A;  3CM6 A;  3QLH A;  4CF0 A;  2YKN A;  3VQB A;  3QIP A;  2HHQ A;  3P83 D;  3ZSV A;  4BE1 A;  1JXE A;  1VRT A;  1VRU A;  3RMA A;  4DTM A;  3AVK A;  5CZ1 A;  3OYC A;  5HP1 A;  1KVA A;  4IDK A;  2PYL A;  1RT1 A;  2OPS A;  3SUP A;  4JS5 A;  1CZB A;  3AO2 A;  1YVU A;  4Z4G A;  2X78 A;  4CGD A;  3QIN A;  4DS4 A;  3TR8 A;  1RTD A;  4CHY A;  4DLG A;  4BE2 A;  1WSF A;  1BCM A;  3NH2 A;  5I3U A;  4CJ4 A;  2HHW A;  1B92 A;  2O4I A;  3DLG A;  3OY9 A;  1RT2 A;  3ZSO A;  3E01 A;  4PWD A;  3KD1 E;  1EKE A;  1IO2 A;  4FLV A;  5HRN A;  2QXF A;  1QS4 A;  1NJX A;  3DMJ A;  1BIS A;  4CFD A;  4CEQ A;  5JS2 A;  1D9F A;  4DTU A;  4KHU A;  3LAN A;  2PY5 A;  1TKD A;  4B9M A;  4E7H A;  4ELT A;  2DFF A;  5I42 A;  3NGI A;  1IKX A;  1Q8I A;  3ZCM A;  4N56 A;  1RBR A;  5FDL A;  2DFH A;  4CF2 A;  3MAQ A;  4CJR A;  2XY6 A;  3SQ0 A;  1T03 A;  3OYM A;  1C1C A;  4CJF A;  3KTQ A;  3LZI A;  3RTV A;  4I9L A;  3VQP A;  1KFS A;  1RT4 A;  3DOL A;  4DTS A;  4FZZ A;  2ZE2 A;  1NK8 A;  3HST B;  4NCA A;  4M42 A;  2OPR A;  3AA3 A;  5KRS A;  3TWH A;  4FJM A;  3VA3 A;  4B8A B;  1VSL A;  3HT3 A;  4FLU A;  1L5U A;  3HP6 A;  3MEC A;  3PO4 A;  4R5P A;  4FM2 A;  3LP3 A;  5FRO A;  3TAP A;  1WSH A;  1TAQ A;  5C25 A;  4HCB A;  4H8K A;  2KFZ A;  3F9K A;  1RBV A;  3AVB A;  3H08 A;  1HYS A;  4LH4 A;  5CZ2 A;  3ZT0 A;  4CIE A;  3AVH A;  4DU1 A;  5HRR A;  2WOM A;  4FLY A;  4DFM A;  3M8P A;  1VSJ A;  3MED A;  1KRP A;  4XIU A;  3ZT1 A;  3S3M A;  1UA0 A;  2AJQ A;  2RPI A;  4NYF A;  3HO1 A;  4W5O A;  5D3G A;  4ID1 A;  5J2P A;  4FW1 A;  1REV A;  1LV5 A;  3PV8 A;  4B9N A;  1CLQ A;  3JSM A;  1JLQ A;  2GV9 A;  3NBP A;  4CK2 A;  2W42 A;  3QEX A;  1CZ9 A;  3QEI A;  1WSJ A;  3SYZ A;  4DTJ A;  4HUE A;  1IH7 A;  3AA2 A;  4ZTJ A;  2HVI A;  4EP4 A;  2JGU A;  4FK2 A;  1L3T A;  1JL2 A;  4CFA A;  1FXX A;  1RT3 A;  4DU4 A;  4E1M A;  5CYQ A;  3B6P A;  2QKK A;  1S9E A;  1U4B A;  2F8T A;  5JS1 A;  1ZBU A;  4FLW A;  3T3F A;  3TAQ A;  2HHX A;  3KIO A;  4CJU A;  2ITG A;  4CCH A;  2G8I A;  3OVN A;  3HPO A;  4ELU A;  3THV A;  3LP2 A;  3ISN C;  1FKP A;  4KFB A;  1VSH A;  4J2E A;  4KRE A;  1EXQ A;  5C24 A;  3VQD A;  1A5V A;  1WAF A;  1EP4 A;  4IG0 A;  2IC3 A;  4CHN A;  3SQ4 A;  1K6Y A;  4CFC A;  2G8W A;  4CGH A;  1CXQ A;  2DY4 A;  1KCF A;  1RT5 A;  3RMB A;  4F2S A;  5J2M A;  1S1W A;  4YFU A;  4I7F A;  4BDY A;  4CJP A;  5K14 A;  1U48 A;  4FJG A;  4B9L A;  1WSI A;  4Z4F A;  3SQ2 A;  4FXD A;  3OYD A;  5KTQ A;  4DTO A;  4IG3 A;  2O4G A;  3VQE A;  4F4K A;  1JLA A;  2E6L A;  1TL3 A;  3IS9 A;  3NF6 A;  4FK0 A;  4CFB A;  4F3T A;  3AO4 A;  3DLE A;  4AHR A;  4CEE A;  4J2A A;  4EZ6 A;  3OS0 A;  2YNI A;  2E4L A;  2PZS A;  1UOC A;  3U3G A;  4CGJ A;  1VSI A;  3OJU A;  3MXJ A;  3L2R A;  1S9G A;  2YNH A;  4FJI A;  3ALY A;  3OJS A;  4CHQ A;  3K58 A;  2OA8 A;  4KB1 A;  1HMV A;  2P1J A;  2RF2 A;  3LP0 A;  1RTH A;  1U49 A;  5J1E A;  4HVJ A;  2DFE A;  4E1N A;  4JLH A;  1CXU A;  2R7Y A;  1RCH A;  1NKE A;  4FJ8 A;  1HRH A;  3AVN A;  4CEF A;  3TAF A;  1RBT A;  3I0S A;  4DG1 A;  4CHZ A;  4CF1 A;  3C6U A;  1J53 A;  1NK4 A;  4C8K A;  3OYB A;  3QO9 A;  4CGI A;  4GVM A;  3VQ5 A;  2ATQ A;  4B9V A;  3L2Q A;  1C6V A;  1BHL A;  4JS4 A;  3VA0 A;  4DTN A;  4KRF A;  4FZY A;  1JLC A;  1JXB A;  2FC0 A;  4HHT A;  1BCO A;  2P5O A;  4DQI A;  2VWK A;  3AVJ A;  3NE6 A;  4Q5V A;  4KTQ A;  4KHN A;  2Z1H A;  4KO0 A;  4LSL A;  2G8H A;  4FCY A;  3MEE A;  5CYM A;  3LDS A;  4DU3 A;  2G8V A;  1X9S A;  4DS5 A;  4FJK A;  1RNH A;  1NJZ A;  1TVR A;  2YKM A;  1BI4 B;  1RIL A;  1A5W A;  1G15 A;  3L3V A;  4G1Q A;  4DSE A;  1RT6 A;  1TKZ A;  1EX4 A;  5HRO A;  4CER A;  1HNI A;  3O3G A;  3DLB A;  4YNQ A;  1WLJ A;  4E7K A;  3TAB A;  1NK5 A;  4IBN A;  2A1S A;  3NDK A;  3VQQ A;  5KGW A;  1VK0 A;  4FJJ A;  3DLH A;  3VQ6 A;  3I0R A;  4CES A;  4EZ9 A;  1KTQ A;  1X1P A;  3LAM A;  2OZS A;  4O0I A;  3AVF A;  1BQM A;  2JLE A;  4AIL C;  4E0D A;  1I39 A;  4OKJ A;  4OVL A;  3ZSQ A;  4FJ9 A;  3SV4 A;  1NOY A;  4Z4I A;  3L2W A;  2Z1I A;  2B4J A;  1B9D A;  3ZT2 A;  1NK9 A; 
#chains in the Genus database with same CATH topology
 3T69 A;  5KRT A;  3QEW A;  1L3U A;  1MU2 A;  1L3S A;  4CZL A;  4KHW A;  2HNY A;  2HB5 A;  4JD2 B;  3RRH A;  3CC4 N;  2FBY A;  3HL8 A;  3ZLJ A;  2IAJ A;  4PL7 A;  5MLC Q;  4IDH A;  4ISG A;  5FRN A;  4CHO A;  4EHT A;  3EY1 A;  3C6A A;  3EYZ A;  1S1T A;  3H45 C;  4C8M A;  4A2B A;  2FBT A;  4N76 A;  4I6M B;  4W5N A;  1DKG D;  2IGI A;  4IXC A;  1KQS M;  2G8K A;  4KTW A;  3ZSW A;  3ENB A;  2BH1 A;  1NGI A;  3RSE B;  3QNN A;  1SKR A;  1ZBF A;  4QCL A;  2YNG A;  2QTD A;  1RBU A;  4GY2 B;  3THX A;  4M45 A;  4JRQ A;  4B9Q A;  1Z6R A;  4GKJ K;  1C0T A;  1DTQ A;  2D0C A;  2F9W A;  4CJE A;  1NGG A;  3IDH A;  3N4P A;  2EHG A;  2UXC K;  4MDB A;  5E26 A;  3AO1 A;  5GIP A;  5E41 A;  4CIF A;  3CHW A;  1HJO A;  4CJK A;  4Z4E A;  5CR4 A;  4BC3 A;  1X9M A;  3A5M C;  4DUY K;  3D2E B;  3BY5 A;  4DTX A;  2HNZ A;  2BDP A;  4FJ5 A;  5EX5 A;  2BUP A;  3BDP A;  4BRL A;  1IV0 A;  4NLB A;  4B1W B;  4DV3 K;  2OPQ A;  4BRK A;  1RDA A;  1BGX T;  3L2U A;  4H0V B;  4B3T K;  1SL1 A;  1NKB A;  5FPD A;  3H1Q A;  1VQ7 N;  1U6Z A;  3CI5 A;  3UKR A;  4Z4H A;  3JS6 A;  3DXK B;  3O9Q A;  3C6T A;  2KHO A;  1X9J A;  3QET A;  2HHV A;  1UAX A;  4M7X A;  1OH5 A;  3AO3 A;  1JCG A;  5HRS A;  3VMF B;  4H4O A;  3HK2 A;  3C94 A;  4DLE A;  3DRS A;  1TKX A;  3DLR A;  3VEW A;  3KD5 E;  3OYF A;  5BRF A;  1T7P A;  3CJ1 A;  4F8R A;  1NK6 A;  3HPH A;  3CJC A;  1X9W A;  2ZD1 A;  3CJ7 A;  4FJX A;  3UB5 A;  3T1H K;  3KLI A;  2HBJ A;  1Z25 A;  3FLC O;  4O44 A;  4H03 B;  2VG7 A;  4YOR A;  3DRR A;  4BC5 A;  1GOB A;  1QHA A;  3J7Z O;  3NHG A;  4LH5 A;  3MXM A;  1KFD A;  5BRD A;  2O8B B;  4M3X A;  2HVH A;  2PYJ A;  3HSC A;  4FVM A;  4NXN K;  2OTJ N;  3M6G A;  4PQU A;  4XH5 A;  4B9U A;  1EQY A;  1IKW A;  4FZX C;  4H5W A;  4FLZ A;  3RVC A;  1BIU A;  4OLB A;  3D2F B;  3QNO A;  4BRO A;  1TYQ B;  2HF3 A;  3CPW M;  3QEV A;  1OVQ A;  1SUQ A;  4FOE A;  3EZ5 A;  4DHY A;  3A2F A;  3MX2 A;  1NGF A;  3BZC A;  2RN2 A;  3ENH A;  1VQ6 N;  1W0H A;  2I5J A;  4C8O A;  3R6M A;  2OAN A;  2D1K A;  3C65 A;  3SUO A;  1HNX K;  4KHP K;  1TK0 A;  1E4G T;  4FWQ A;  3LPT A;  4H5V A;  1T44 A;  1YTU A;  4FWN A;  2E6M A;  3KK2 A;  1KXP A;  5HRP A;  5JVG L;  4OGC A;  2ETJ A;  2B5J A;  3LDN A;  4GW6 A;  1O13 A;  1TUU A;  2HOE A;  2Q0R A;  5TKY A;  3AVM A;  4DSI A;  4CJ5 A;  5T7B A;  4KB0 A;  2BAN A;  4O0J A;  1KVB A;  1GLB G;  2IDO A;  3EKS A;  3O3H A;  4BAC A;  2O8F A;  2D0B A;  3T1A A;  3V9X A;  1I3A A;  2QI2 A;  2HF4 A;  1SAZ A;  3MWT A;  4OKK A;  2XY8 A;  4DUZ K;  4CEC A;  3MN9 A;  3AVC A;  4B08 A;  4ELV A;  1C1B A;  1BG3 A;  3VER A;  1KC8 O;  2NRH A;  4JEP A;  2VG6 A;  2HMP A;  3VQ7 A;  1Q9Y A;  2CH5 A;  4Y1D A;  2ZJQ L;  3SUN A;  3GG4 A;  1Y64 A;  4PL8 A;  4IOX A;  5EXW A;  4BWJ A;  3T19 A;  1IBM K;  1QE1 A;  3OYN A;  2XHB A;  3HP9 A;  1BQN A;  3NH1 A;  3AA4 A;  4DV5 K;  3NH0 A;  4KHY A;  2EX3 A;  3R1X A;  3OYL A;  4LF5 K;  4FLT A;  3V6D A;  4L8R B;  1N34 K;  3ITH A;  4CJT A;  4JI8 K;  4X65 K;  1F21 A;  3KLE A;  1TUY A;  3LZJ A;  4BVO A;  4JRP A;  4DV2 K;  3CM6 A;  3QLH A;  2P9P B;  2P9I A;  4M63 C;  4DR6 K;  3ZSV A;  1XNR K;  1NGB A;  1OH8 A;  4JI2 K;  2QWN A;  4YOV A;  4PKI A;  3OYC A;  1KVA A;  3M1F A;  4B1X B;  4CZG A;  5AQT A;  2OPS A;  3SUP A;  1YVU A;  1Q81 O;  4Z4G A;  3C7N A;  3QFU A;  3QIN A;  1RTD A;  2CGL A;  3THY A;  1E4F T;  3HI0 A;  4K43 A;  1WSF A;  1BCM A;  5I3U A;  2HHW A;  2VQE K;  4GNI A;  3OY9 A;  1RT2 A;  1MWM A;  4ISE A;  1QZ5 A;  2QM1 A;  2P9K B;  4JKA A;  1W7A A;  1HNW K;  3DMJ A;  4CEQ A;  4A62 A;  3NGI A;  2FF3 B;  3OBW A;  3ZCM A;  5FDL A;  2DFH A;  4OPA A;  3Q7C A;  3MAQ A;  2XY6 A;  5AQK A;  2F7T A;  1GLA G;  4CJF A;  1KFS A;  5TKW A;  4FZZ A;  4NCA A;  1QQN A;  2UU9 K;  3TWH A;  4B1Z A;  1L5U A;  3LDL A;  3HP6 A;  3LP3 A;  3TAP A;  3QFP A;  3LL3 A;  2E20 A;  4K41 A;  3H08 A;  2NLX A;  3AVH A;  4DU1 A;  5C0Y A;  4DFM A;  3J8A A;  3ZT1 A;  3S3M A;  1UA0 A;  1K9M O;  4V19 S;  2RPI A;  1YJW N;  4FW1 A;  2V7Y A;  1REV A;  3THX B;  2A5X A;  1CLQ A;  1QQM A;  3JSM A;  2GV9 A;  3HRG A;  4YOY A;  1CZ9 A;  3QEI A;  1WSJ A;  4BRD A;  4DTJ A;  1IH7 A;  2JGU A;  1L3T A;  3LDQ A;  1RT3 A;  4CZK A;  2QKK A;  5JS1 A;  2VCP A;  4FSV A;  4JK9 A;  4CJU A;  2ITG A;  4CCH A;  3I56 N;  3OTO K;  1K73 O;  4U7B A;  4ELU A;  3LP2 A;  3ISN C;  4KRE A;  2I7N A;  3VQD A;  1EP4 A;  4CZM A;  2ZJR L;  3QBX A;  2QWQ A;  1OH7 A;  1CXQ A;  1RT5 A;  1SS6 A;  4DR2 K;  2IVP A;  4B9L A;  4Z4F A;  1ZC6 A;  3VQE A;  4F4K A;  1JLA A;  4LF4 K;  1TL3 A;  4BY9 C;  3NF6 A;  4LF7 K;  3MWP A;  3AY9 A;  3H3N O;  1DEJ A;  5M1K A;  3DLE A;  4BR7 A;  4CEE A;  4J2A A;  3S41 A;  3OS0 A;  2YNI A;  4JAX A;  5EY4 A;  2E2P A;  3L2R A;  3MXJ A;  3L4I A;  4BR9 A;  4O8U A;  3ALY A;  1GLJ O;  2OA8 A;  5J1E A;  4JLH A;  3VF2 A;  4FJ8 A;  3ATV A;  3AVN A;  4DG1 A;  3UKR B;  4CHZ A;  4L3Q A;  1BU6 O;  3CJA A;  3QO9 A;  4GVM A;  4CBX A;  3L2Q A;  4WQ5 C;  2FC0 A;  3I55 N;  4GV9 A;  3IUC A;  2P5O A;  1CZA N;  4KTQ A;  2OCE A;  1Q7Y O;  5BN9 A;  3WXM B;  3JXU A;  4KBO A;  1SQK A;  1YJ9 N;  4CD1 A;  4DS5 A;  2GEM A;  3CMA N;  2Q0U A;  1A5W A;  5IWA K;  1TKZ A;  4XEI A;  3DLB A;  3B8A X;  4E7K A;  3TSP A;  4IWV A;  4FWP A;  4IBN A;  1P8Z A;  1VK0 A;  3I0R A;  4CES A;  4EZ9 A;  3DJC A;  4K0K K;  4AIL C;  4E0D A;  1T6D A;  4OKJ A;  5LMU K;  2GUP A;  1NOY A;  4JI3 K;  5AQN A;  3R9P A;  2B4J A;  1B9D A;  3CCL N;  4CJ3 A;  4N41 A;  3SLC A;  3U4L A;  4CF8 A;  2Q97 A;  3EO3 A;  3DYA A;  3A0I X;  5AQS A;  4B1Y B;  3O4W A;  3FZK A;  3TAE A;  1N33 K;  4IFY A;  4M41 A;  3DRP A;  5FPE A;  5HL7 L;  3S3O A;  4NXM K;  4BDZ A;  1J5O A;  4A59 A;  4CZH A;  2NUB A;  1C0U A;  3V9S A;  4LF9 K;  2F96 A;  3SCX A;  2F4V K;  3F9M A;  1LWE A;  1Q82 O;  1JLG A;  1NJW A;  1S1V A;  1JCE A;  1YTA A;  4BC2 A;  2IOC A;  2WON A;  3TAR A;  2HHU A;  2BE2 A;  1RDC A;  4CK1 A;  3LPU A;  5DK5 A;  4H4M A;  4I2Q A;  4DR5 K;  4E1J A;  1NOZ A;  2NRW A;  2YV0 X;  5FRM A;  1VSE A;  4BRM A;  4BVP A;  2GBZ A;  1GLL O;  1S1U A;  2O8F B;  4BG9 A;  3AVI A;  2KZZ A;  3NF8 A;  2P51 A;  2O8E A;  2ZWH A;  4Q0B A;  3TAM A;  3CM5 A;  3VTH A;  1BOT O;  2HW3 A;  4KH4 A;  2E2N A;  1Z26 A;  4ZHR A;  2XO7 A;  1U2V A;  1S5J A;  1X3N A;  3L2V A;  2QWM A;  3CPE A;  5LMN K;  4DWI A;  5AZI A;  1NNE A;  3MEG A;  2YHY A;  2KW4 A;  3ULE A;  2ZJP L;  3OS1 A;  4KH6 A;  4JI5 K;  4CJQ A;  3D0P A;  3E9O A;  2X6N A;  5BN8 A;  3NAE A;  4IFV A;  4JKC A;  1QQO A;  4NLC A;  3QEP A;  3VEX A;  4AHU A;  4BGA A;  1L3V A;  3H1V X;  1ATR A;  3TSU A;  4JV5 K;  2VWB A;  1TK8 A;  1YUW A;  3K5L A;  1RDW X;  4JKG A;  1TV6 A;  4KKO A;  1J6Z A;  4NCB A;  3G4S N;  4DSL A;  2YJF A;  3VES A;  4WYB A;  2P9I B;  2P5G A;  4UQG A;  4CED A;  4DQ8 A;  1S6P A;  3P5J A;  1IG9 A;  5KGX A;  4JKB A;  2O8D A;  3SI6 A;  3RWU A;  3O8M A;  2W40 A;  2XRI A;  4B8C A;  1C0M A;  3C7N B;  3K5N A;  1ESV A;  3VQ4 A;  1XHX A;  3G0Z A;  3HVT A;  3THY B;  4H5T A;  2YHA A;  4LFB K;  4FWM A;  3CCU N;  4FJN A;  1VSK A;  5IT9 O;  4JK7 A;  3RR8 A;  4DFJ A;  1LWC A;  3LDP A;  1WBD A;  5B8H A;  4OPH A;  5HBM A;  3TPQ A;  3IAY A;  3S9H A;  3PUF A;  4BR0 A;  1YT3 A;  1ILY A;  4OJR A;  3RMD A;  4K25 A;  1RTI A;  3QER A;  1QVG M;  2ASP A;  3I8D A;  4E3S A;  5BR9 A;  1SV5 A;  4QOZ B;  2CGK A;  1JKH A;  1QVF M;  5M1O A;  1ASU A;  3CFP A;  1TKT A;  2VYP A;  4CJW A;  2NRZ A;  4IFE A;  3WNF A;  4JI4 K;  4JI7 K;  3W3D A;  3K59 A;  4AM7 A;  4HWI A;  4ZTF A;  3GBT A;  1XI1 A;  1JLF A;  1RT7 A;  1IKY A;  2ZQB A;  3SUQ A;  1GOA A;  1NGH A;  1HR0 K;  3GOI A;  1D5A A;  2YJE A;  1BUP A;  3EN9 A;  3AVA A;  3IRX A;  5KQD A;  3AVG A;  3BEX A;  3C6H A;  1EWR A;  4Z0U A;  1NK0 A;  3E66 A;  5C10 A;  3VQC A;  3K5M A;  3QB0 A;  3GL1 A;  4CIG A;  3WNE A;  1XWL A;  4W5R A;  1K8K A;  2Q36 A;  5GIN A;  3OHR A;  3K5O A;  2QKB A;  4DSJ A;  4RW6 A;  1ATN A;  1FK9 A;  1GLE G;  3DLK A;  1Y97 A;  4LSN A;  3R3L A;  4I9Q A;  1S6Q A;  2IS3 A;  1GLC G;  1WAJ A;  4AHC A;  4MO5 A;  3NVK A;  2KTQ A;  3ATU A;  5ADX A;  5AR0 A;  4M7Y A;  4DSK A;  4CI6 A;  3O4N A;  4DV6 K;  3VF4 A;  2GWK A;  3SPZ A;  4DR1 K;  4C8L A;  3RR7 A;  4E89 A;  1HPM A;  2IIR A;  3PX0 A;  3TI0 A;  3EL2 A;  3QIO A;  1NK7 A;  4E7L A;  3MCA B;  5ELZ A;  5EVZ A;  2HHT A;  4ILH A;  2A6A A;  2UUB K;  3FFI A;  2CGJ A;  5LJV A;  3EE9 A;  1VQL N;  3WUH A;  1DT9 A;  4B3O A;  1QSY A;  3LM9 A;  3U9D A;  4C1N I;  4CD3 A;  4H0P A;  3O6W A;  3BGR A;  2P9L A;  2VGM A;  4DV1 K;  1KLN A;  3I8B A;  2OZM A;  4LY7 A;  4G9Z A;  4EIA A;  5C2D A;  3A8Y A;  3C95 A;  1N6Q A;  3ID6 A;  3GDQ A;  3IFR A;  4AH9 A;  4CF0 A;  2YKN A;  4BR5 A;  4CBW A;  3VQB A;  4QS8 A;  1JJ2 M;  4BE1 A;  2A42 A;  1JXE A;  1VQ5 N;  3RMA A;  1S3X A;  2W6L A;  5CZ1 A;  5HP1 A;  2PFU A;  1CZB A;  2X78 A;  3TR8 A;  3QIC A;  4CHY A;  4BE2 A;  3O08 A;  1NGE A;  1XNQ K;  1B92 A;  4H0O A;  2O4I A;  3DLG A;  4PWD A;  3KD1 E;  2DPN A;  2WBN A;  4CZE A;  1NJX A;  3UKU A;  5FLX O;  5DM7 L;  4H0T B;  5JS2 A;  4EHU A;  3ZX2 A;  2JWK A;  1FW6 A;  4B3M K;  1RBR A;  4OO1 J;  2D4W A;  4CF2 A;  4CZJ A;  4B1V A;  3LZI A;  3DOL A;  4DTS A;  3E9P A;  3HST B;  5H1S Q;  1MDU B;  3LM2 A;  1VSL A;  4FLU A;  4BR2 A;  3F5T A;  4R5P A;  5AFU H;  4BC4 A;  4HCB A;  4H8K A;  4QS7 A;  1RBV A;  5LL6 Z;  5CZ2 A;  2WOM A;  3I33 A;  4WQ4 C;  1KRP A;  3P39 A;  4FL9 A;  3H3O B;  4NYF A;  1V4S A;  2E88 A;  1IBK K;  5D3G A;  4ID1 A;  5J2P A;  1NMN A;  1LV5 A;  3G25 A;  4JYA K;  4CK2 A;  3QEX A;  2W42 A;  3AA2 A;  1OH6 A;  4O8K A;  1LCU A;  1FXX A;  4BRH A;  3T1Y K;  5CYQ A;  4FWR A;  2V7Z A;  4A5B A;  3T3F A;  3TAQ A;  3CCM N;  4Y0W A;  1VQ9 N;  2O8E B;  3THV A;  5AQZ A;  1FKP A;  4HTL A;  4CBU A;  4CHN A;  4MLE A;  2UUA K;  1K6Y A;  5AFU A;  3CD6 N;  1KCF A;  1BO5 O;  4F2S A;  5J2M A;  4YFU A;  2VQF K;  4BDY A;  4CJP A;  5K14 A;  1U2V B;  1WSI A;  4FXD A;  5M1P A;  3OYD A;  5AZI B;  3IS9 A;  4EFH A;  4FK0 A;  3ULE B;  3AO4 A;  4A57 A;  4X64 K;  4EZ6 A;  1S9G A;  4DV7 K;  3SAF A;  1HMV A;  1RTH A;  2ASM A;  4HVJ A;  1CXU A;  1RCH A;  3I0S A;  1QZ6 A;  1NK4 A;  4C8K A;  4CGI A;  2W6K A;  3VQ5 A;  2ATQ A;  4JKG B;  1HUX A;  1BCO A;  3ZYY X;  2VWK A;  3NE6 A;  4KHN A;  2Z1H A;  4KO0 A;  2G8H A;  5CYM A;  3LDS A;  4X62 K;  2A41 A;  2G8V A;  1X9S A;  1RNH A;  2YKM A;  3KZB A;  1G15 A;  3SK3 A;  4CER A;  1HNI A;  3O3G A;  2O8D B;  1EWQ A;  2NRX A;  5KGW A;  3GE1 A;  2OZS A;  3FR0 A;  2JLE A;  3SV4 A;  4Z4I A;  3ENO A;  4CEZ A;  2FBV A;  4CHP A;  1DLO A;  1WNS A;  3M8R A;  4DSF A;  3UE5 A;  3Q7B A;  3E9L A;  4HUG A;  5AQQ A;  4FK4 A;  4PY5 A;  2GTD A;  2GWJ A;  3ZSY A;  3A5L C;  4H5R A;  3KVG A;  1VSD A;  3JYT A;  3BZK A;  4Z4C A;  2UYT A;  4RW7 A;  2IVO A;  3MMV A;  1LW0 A;  1WBB A;  4JN4 A;  3HOT A;  4DFK A;  3KKR A;  4YOW A;  1D8Y A;  4CJS A;  3V4I A;  4IJN A;  4AQY K;  1T03 A;  2Z1J A;  3M8Q A;  4FW2 A;  1VQP N;  4M3R A;  2YHW A;  2FBX A;  3LAK A;  5AQM A;  1N36 K;  3QDK A;  4NCG A;  1HX1 A;  3CC2 N;  3SV3 A;  1T8E A;  3OYH A;  1NJY A;  5CY4 A;  3WNH A;  3PY8 A;  1B9F A;  5GAG P;  5KPT A;  3KWI A;  1K8K B;  2WTU A;  1HQU A;  4EP5 A;  5DMR A;  2HST A;  4AHV A;  4CEB A;  1HQE A;  2CH6 A;  3HXM A;  2D0O A;  4FPA A;  4E19 A;  1KSP A;  3U9Z A;  3QES A;  1FKO A;  4IKF A;  3MN7 A;  3DXM A;  3OA9 A;  3M3Z A;  4O4G A;  3V1Q A;  3VOV A;  1XUP O;  3V1O A;  4J2D A;  2GUI A;  4M3Z A;  3O9T A;  5BRH A;  3HVR A;  3WQU A;  1UWB A;  4MQ3 A;  4RCH A;  3TTC A;  3CCR N;  3G10 A;  4CEA A;  1NWK A;  4F3O A;  3WXK A;  2KQ2 A;  3K2P A;  1BIZ A;  3CQX A;  1D9D A;  1TL1 A;  2FLO A;  2OPP A;  2QWP A;  1YF5 L;  3KLG A;  1LAW A;  1Q86 O;  2LSN A;  3ZSX A;  4WE1 A;  1HKC A;  3CQY A;  3W0L A;  4WQ5 A;  2Q1N A;  4IEE A;  1X3M A;  4RG8 A;  3TAG A;  3HBT A;  1HYV A;  3V9W A;  1WOQ A;  3HZ6 A;  2GX9 A;  2P9L B;  3OYI A;  3ZSR A;  3FZM A;  1VSF A;  4BRN A;  3G71 N;  3NGY A;  4C8N A;  3CFR A;  4DTR A;  1W2B M;  2B6A A;  3ZT3 A;  3L4Q A;  4UY8 O;  4KTZ A;  1NKC A;  2Y1J A;  4O5B A;  5AZJ A;  4BRF A;  3KWG A;  1D4X A;  3L3U A;  4KAZ A;  4W5T A;  1NGD A;  4JKE A;  4AHS A;  2O8C A;  1JLE A;  4O5F A;  4CEO A;  1BA1 A;  4FLX A;  2RKI A;  1RBS A;  3BF1 A;  3AAQ A;  3NMU A;  4CJ7 A;  4J2B A;  1LAV A;  2UUC K;  5AQW A;  3O5B A;  3MDQ A;  3MK6 A;  3PIP L;  3K57 A;  4IJA A;  4LC9 B;  4JKD A;  3O1B A;  1U47 A;  3OW2 M;  3IG1 A;  1RDD A;  3UKU B;  2KFN A;  3O3F A;  2Z1G A;  4IZ9 A;  4WF9 L;  4FYD A;  1KLM A;  3M5R A;  2YHB A;  3CCS N;  2Q31 A;  4DV0 K;  5LY3 A;  3KKS A;  4HUF A;  4HCC A;  1SL0 A;  5M1Q A;  4YOX A;  1KVC A;  4GMJ B;  3TAN A;  4DR3 K;  4DF8 A;  4CZI A;  2D5R A;  4PA1 A;  4DTP A;  3TU5 A;  1IKV A;  4OGE A;  1U45 A;  3HJF A;  3QBW A;  3SJJ A;  4ISF A;  1TK5 A;  1VQK N;  4OKE A;  1C1A A;  2YHX A;  3OYG A;  2D0P A;  4K8X A;  3UIQ A;  4DQR A;  5KI6 A;  4ILJ A;  4ILG B;  5AQL A;  3EZW A;  3FZF A;  2QA4 N;  2YNF A;  2XY5 A;  4KHQ A;  2PBD A;  4B1U B;  2X74 A;  3VN5 A;  4DQS A;  1ASW A;  3U8X A;  4FM1 A;  3BF3 A;  3KK3 A;  4KI4 A;  1Z05 A;  2UXD K;  1RDB A;  4RW4 A;  1RTJ A;  2YI1 A;  5KQ8 A;  3CME N;  4JKH A;  3DLL L;  4GV6 A;  1JLB A;  4NB4 A;  2HHS A;  1WSE A;  3DWL A;  1T3V A;  1H1V A;  2ZF5 O;  3O9S A;  3HYF A;  3P38 A;  4KH5 A;  1C0F A;  5M1F A;  3DOK A;  4MFB A;  4OPK A;  5LJW A;  4A2A A;  3ZSZ A;  3PX6 A;  3L6Q A;  1GLF O;  1XQS C;  3P1G A;  4EAH D;  2YCH A;  2NRR A;  1WUA A;  1XC3 A;  3VEN A;  1QTM A;  5AQU A;  3NF7 A;  3J7Y P;  4DV4 K;  1SKS A;  1TAU A;  4DF4 A;  1MWK A;  3WEE A;  1SL2 A;  1EET A;  3DAW A;  3ASM A;  1LOT B;  4C1N K;  3L8B A;  3CFO A;  4RTF D;  4RW8 A;  4CW7 B;  4QAG A;  4YDU A;  3LWL A;  1RDU A;  3SMS A;  5A2Q O;  4MO4 A;  2QK9 A;  3KK1 A;  3AVL A;  2DTU A;  3LDO A;  4ID5 A;  4Y1C A;  1R59 O;  3D7E O;  2HMI A;  4BRA A;  1HNV A;  4YDU C;  3BP8 A;  3QIP A;  2HHQ A;  3P83 D;  3THW A;  2ASO A;  3HOS A;  2PYL A;  1XMO K;  4IDK A;  1IG8 A;  1RT1 A;  1YI2 N;  4NO7 A;  4DS4 A;  1MA9 B;  2QWO A;  4CJ4 A;  1WB9 A;  3ZSO A;  1N8R O;  4GVE A;  5BPL A;  1IO2 A;  3FGU A;  4FLV A;  5HRN A;  3SAG A;  1BIS A;  1DGK N;  3QML A;  5F0X A;  4DTU A;  4KHU A;  4B9M A;  4YOT A;  2DFF A;  4BRE A;  3SQ0 A;  3SJH A;  1C1C A;  2I7P A;  5ADX H;  3RTV A;  1RT4 A;  2ZE2 A;  1NK8 A;  3O1W A;  4M42 A;  4JNE A;  1I94 K;  3AA3 A;  5KRS A;  4FJM A;  3VEV A;  3VA3 A;  3VGL A;  3MEC A;  3AGR A;  4FM2 A;  4DKW A;  2P9U A;  4DR7 K;  1TAQ A;  5C25 A;  2KFZ A;  1NLV A;  1HYS A;  4CIE A;  5HRR A;  4MLH A;  5JLH A;  2KKZ A;  1VSJ A;  3MED A;  2EWS A;  4XIU A;  4B3S K;  2V52 B;  2AJQ A;  2QW9 A;  3HO1 A;  4W5O A;  4DCH A;  1VQN N;  1KAY A;  3NBP A;  2HVI A;  1JL2 A;  1YXQ A;  4E1M A;  3O9U A;  3TTF A;  1S9E A;  1U4B A;  2F8T A;  3DXM B;  2HHX A;  2Q2R A;  3OVN A;  3AAP A;  3HPO A;  3CCJ N;  3F2K A;  3HTV A;  1YJN N;  4KFB A;  1VSH A;  5AQV A;  1EXQ A;  1A5V A;  4IG0 A;  3SQ4 A;  5BPN A;  4FWS A;  1VQ8 N;  4CGH A;  5C2F A;  2DY4 A;  2P9N A;  3SBG A;  3RMB A;  5KPR A;  3TTD A;  4JHD A;  4FO0 A;  5KTQ A;  4IG3 A;  2E6L A;  3CXC M;  4BRG A;  4YOU A;  4J8F A;  1RGI A;  2E4L A;  3U3G A;  1FJG K;  3ZET B;  4FJI A;  1NU0 A;  3OJS A;  4CHQ A;  3K58 A;  3K9J A;  2P1J A;  2RF2 A;  1U49 A;  3WXJ A;  2YX6 A;  4E1N A;  1NG9 A;  2R7Y A;  1HRH A;  4CEF A;  3TAF A;  4BRP A;  3C0B A;  4CF1 A;  4DB3 A;  1J53 A;  1IJJ A;  3OYB A;  1YVN A;  2VGN A;  2ZGZ A;  4JS4 A;  1C6V A;  1BHL A;  3VA0 A;  4DTN A;  4FZY A;  1JLC A;  3PIO L;  5AZJ B;  4HHT A;  4DQI A;  5F2R A;  1C0G A;  4Q5V A;  5C12 A;  2OTL N;  4IEI A;  3EEQ A;  4CZF A;  2O8C B;  4FJK A;  3BUZ B;  4PHT X;  1RIL A;  4G1Q A;  4LFC K;  1EX4 A;  2HBM A;  2A1S A;  2E2O A;  2HBL A;  4FJJ A;  1BDG A;  3DLH A;  3P4I A;  4F9O A;  1KTQ A;  1X1P A;  3FFK B;  3LAM A;  4A61 A;  4O0I A;  3OBY A;  1GLD G;  3ZSQ A;  4GKK K;  4R79 A;  3L2W A;  2Z1I A;  2HBK A;  3ZEU A;  3ZT2 A;  1YIJ N;  1ITG A;  1NK9 A;  1VSM A;  1M90 O;  2ZM6 K;  3KJV A;  1QHT A;  3G6E N;  1P90 A;  2Q3S A;  3J7A P;  4CK3 A;  2VWJ A;  1VAZ A;  5HOO A;  4WQ4 A;  4BWM A;  1NMD A;  3DI6 A;  1ASV A;  3ULD A;  4DQP A;  3IMX A;  4B9S A;  4B9T A;  4FJ9 A;  1KAZ A;  3LP1 A;  3WNG A;  4BDP A;  3D45 A;  4N5S A;  5J2N A;  1QSS A;  4DFP A;  3KHY A;  2HND A;  3AO5 A;  3O4Q A;  3M8S A;  2GEL A;  3NVM A;  2QEX N;  2FSJ A;  1ZXO A;  4FWL A;  1HJR A;  3A5O C;  3VTI A;  1S1X A;  2E1Y A;  4E7J A;  4B3R K;  4XH1 A;  3JAM O;  3KLF A;  4F2R A;  4RW9 A;  4I2P A;  4IO8 A;  5AQY A;  5M1N A;  2FSK A;  4LF6 K;  3OS2 A;  2WC9 A;  4O55 A;  4X66 K;  4MDA A;  4LD0 A;  2RE2 A;  4E7I A;  3SQ1 A;  2E8A A;  2G8F A;  3HM9 A;  1NGA A;  2WFB A;  3K0S A;  3RMC A;  3CCQ N;  1ZYQ A;  3V9U A;  1KAX A;  1Q18 A;  3E1Y A;  1J9A A;  2E5L K;  4FJH A;  3MN6 A;  5BPM A;  2NRV A;  3CET A;  4TSX A;  4PUO A;  1WN7 A;  1Q9X A;  3SAH A;  5JMV A;  5JIC A;  2E2Q A;  4CE9 A;  1T05 A;  4KI6 A;  3V1R A;  1HYZ A;  3KLH A;  3CG7 A;  2KZM A;  3SPY A;  4FVU A;  3HPG A;  1ZBI A;  2P9S A;  3AA5 X;  4NYN A;  4M3T A;  4WFB L;  3B6O A;  5DM6 L;  1S72 N;  1XMQ K;  4CF9 A;  5SWM A;  4OLA A;  3OYE A;  3FZL A;  3V9Z A;  3U3Y A;  3WEE B;  1U04 A;  1QSL A;  2A3Z A;  4W5Q A;  4BRQ A;  5C42 A;  2X6S A;  5J2Q A;  5EU7 A;  1NBW A;  4FJL A;  1YAG A;  5AQF A;  4CGG A;  4AHT A;  5AJ3 K;  4M3U A;  5BRE A;  1S22 A;  5AQG A;  5GAE P;  3NCI A;  1UA1 A;  4CJL A;  3OYJ A;  1XHZ A;  4M3W A;  2AP1 A;  1ZBL A;  5HLF A;  4BE0 A;  1ATS A;  3AGK A;  2QWL A;  3A5N C;  4M3Y A;  3NF9 A;  3THW B;  1BI4 A;  4HTU A;  1GOC A;  5AQH A;  1HPZ A;  3FE1 A;  2NRT A;  4FWK A;  3K9K A;  2H3G X;  1XC9 A;  3AV9 A;  3TSQ A;  5SZT A;  2G8U A;  4DMN A;  3OYK A;  1LW2 A;  2Y1I A;  4CJV A;  3VQ9 A;  4ICL A;  2A1R A;  3PO5 A;  2NNW A;  3LWM A;  1NM1 A;  3MX5 A;  5CE3 A;  1NGC A;  1J5E K;  4IOA L;  1N32 K;  4KHS A;  4CGF A;  5C15 A;  4A5A A;  5EOY A;  4JI6 K;  3MXI A;  3CJB A;  4JD2 A;  5AQR A;  4C23 A;  1A5X A;  1J54 A;  2D0A A;  4BRI A;  4JK8 A;  2J4R A;  2OYQ A;  3V81 A;  2P9U B;  4N47 A;  4I6M A;  5I9E B;  4DQQ A;  3DM2 A;  4YY3 K;  3VQ8 A;  4AM6 A;  1ZBH A;  4KPY A;  4OPJ A;  3SZ2 A;  2UXB K;  4FM0 A;  5JLF A;  4WFA L;  1OKJ A;  1SZ2 A;  3RSE A;  4K8Z A;  4GV3 A;  4DR4 K;  3VGM A;  4LF8 K;  1LWF A;  1TGO A;  4KV8 A;  3ZX3 A;  3O9R A;  2XY7 A;  2F8S A;  4BRC A;  3HM8 A;  3OYA A;  4BQZ A;  4IOC L;  2F9T A;  1O1W A;  3CYM A;  1WSG A;  1NJI O;  1JL1 A;  1E3M A;  3U6F A;  2AA4 A;  1ZBS A;  5AQO A;  3MN5 A;  2P9N B;  2VG5 A;  3VQA A;  3D2E A;  4JHD B;  2IVN A;  5JVH L;  3PLA A;  3RRG A;  4LFA K;  3ZET A;  4K42 A;  3T7Z A;  3PX4 A;  4BGB A;  1BL3 A;  3R8E A;  4FJ7 A;  3VGK A;  3F73 A;  3AAR A;  4BG8 A;  3S3N A;  1N5Y A;  1BA0 A;  3NFA A;  5AQP A;  2BGG A;  3SNN A;  2QWR A;  3LAL A;  3CQ8 A;  1R0A A;  1W9H A;  3DXK A;  1QQC A;  1DTT A;  4WFN L;  3H46 O;  3CF5 L;  1V4T A;  3NGZ A;  2RHK A;  1VQ4 N;  1HKG A;  1SKW A;  3ZT4 A;  4OX9 K;  2V51 B;  1YHQ N;  4AF1 A;  5GAH P;  4U67 L;  3J81 O;  4CVN E;  1VRT A;  1VRU A;  4DTM A;  3AVK A;  3VF6 A;  3VET A;  3VPZ A;  3J80 O;  3CER A;  2FSN A;  4JS5 A;  1HLU A;  1RFQ A;  3AO2 A;  4CGD A;  2JWL A;  4DLG A;  3CIP A;  3NH2 A;  1IBL K;  3E01 A;  5BR8 K;  4PKH A;  1EKE A;  2QXF A;  1QS4 A;  2PAV A;  2O8B A;  2W41 A;  3P31 A;  4CFD A;  3IKM A;  3ZEU B;  5KPZ A;  1D9F A;  3LAN A;  3WQT A;  1TKD A;  2PY5 A;  4E7H A;  4ELT A;  4JKF A;  1BWF O;  5I42 A;  1IKX A;  1Q8I A;  4N56 A;  1M1K O;  4H0Y B;  4BR4 A;  2ZGY A;  4CJR A;  5GAD P;  3OYM A;  2BTF A;  3KTQ A;  4I9L A;  3VQP A;  1NGJ A;  3D2F A;  5E84 A;  2OPR A;  1TYQ A;  4B8A B;  3HT3 A;  3PO4 A;  5FRO A;  1WSH A;  3D6R A;  3N4Q A;  3F9K A;  3AVB A;  3PSI A;  4LH4 A;  3ZT0 A;  1KD1 O;  3L0Q A;  4FLY A;  3M8P A;  1VHX A;  5AQX A;  4RWT A;  1K8A O;  2FF6 A;  3PV8 A;  4B9N A;  2KLA A;  1JLQ A;  1W97 L;  4IO9 L;  3SBT A;  3WXL A;  3EKU A;  3SYZ A;  4HUE A;  4ZTJ A;  5FPM A;  4EP4 A;  4FK2 A;  3SMP A;  4CFA A;  2FXU A;  4DU4 A;  3B6P A;  5AQI A;  1ZBU A;  4FPB A;  4FLW A;  3MCP A;  4Z94 A;  3KIO A;  3CC7 N;  2G8I A;  3KK7 A;  4J2E A;  5C24 A;  1JCF A;  1WAF A;  3CCV N;  2IC3 A;  4CFC A;  2G8W A;  3CCE N;  1S1W A;  4I7F A;  1U48 A;  4FJG A;  3SQ2 A;  5GIO A;  1OVY A;  5AQJ A;  4DTO A;  2O4G A;  4CFB A;  4F3T A;  4AHR A;  1EO1 A;  4FWO A;  3VEY A;  3H6E A;  2PZS A;  1UOC A;  2P9S B;  1VSI A;  4CGJ A;  3OJU A;  2YNH A;  3FZH A;  4KB1 A;  3LP0 A;  4PKG A;  2ITM A;  3VEO A;  2DFE A;  1NKE A;  3ID8 A;  4JI0 K;  4BQL A;  1RBT A;  3O80 A;  3C6U A;  1VQM N;  5F1X A;  3PSF A;  4B9V A;  4KRF A;  1JXB A;  4WCE L;  2NZT A;  3AVJ A;  4XH4 A;  1G99 A;  4LSL A;  3WXI A;  4H0X B;  5FPN A;  3EE8 A;  2P9P A;  3MEE A;  4FOI A;  4JI1 K;  4FCY A;  4DU3 A;  2HHH K;  1HKB A;  1NJZ A;  1TVR A;  1BI4 B;  3CJ9 A;  3ZX0 A;  3L3V A;  1YIT N;  4H5N A;  4DSE A;  1RT6 A;  5CHI A;  5HRO A;  4YNQ A;  1T6C A;  1WLJ A;  3TAB A;  1NK5 A;  3NDK A;  3VQQ A;  4YHH K;  2E1Z A;  3VQ6 A;  1VQO N;  3AVF A;  1BQM A;  2A40 A;  1I39 A;  4QS9 A;  4OVL A;  1HNZ K;  3VEZ A;  2P9K A;  2WUS A;  3WT0 A;  2QXL A; 
#chains in the Genus database with same CATH homology
 4CJ3 A;  1ITG A;  4N41 A;  1VSM A;  4CF8 A;  4CEZ A;  5KRT A;  1QHT A;  2FBV A;  4CHP A;  3KJV A;  3QEW A;  1DLO A;  1WNS A;  3M8R A;  3DYA A;  4DSF A;  1L3U A;  1MU2 A;  1L3S A;  4HUG A;  4FK4 A;  2Q3S A;  4PY5 A;  3TAE A;  4KHW A;  2HNY A;  4IFY A;  4M41 A;  3ZSY A;  4CK3 A;  3JYT A;  1VSD A;  2HB5 A;  3DRP A;  3RRH A;  2VWJ A;  4Z4C A;  3S3O A;  4BWM A;  3DI6 A;  2FBY A;  3HL8 A;  1ASV A;  4RW7 A;  3ULD A;  4BDZ A;  4DQP A;  2IAJ A;  1J5O A;  4B9S A;  1LW0 A;  4B9T A;  5FRN A;  2NUB A;  1C0U A;  4CHO A;  3EY1 A;  3LP1 A;  1S1T A;  3EYZ A;  4C8M A;  3V9S A;  4DFK A;  2F96 A;  2FBT A;  3SCX A;  4N76 A;  3WNG A;  4W5N A;  4BDP A;  1LWE A;  3D45 A;  4N5S A;  5J2N A;  1QSS A;  3KKR A;  1JLG A;  1D8Y A;  4DFP A;  2HND A;  4CJS A;  2IGI A;  3V4I A;  2G8K A;  3AO5 A;  3O4Q A;  4KTW A;  3ZSW A;  1NJW A;  1S1V A;  2Z1J A;  3M8Q A;  3M8S A;  1YTA A;  4FW2 A;  2IOC A;  2WON A;  4M3R A;  3TAR A;  2HHU A;  2BE2 A;  2FBX A;  3LAK A;  4NCG A;  1RDC A;  4CK1 A;  3QNN A;  3LPU A;  5DK5 A;  3SV3 A;  1T8E A;  1ZBF A;  4H4M A;  1HJR A;  4I2Q A;  3OYH A;  1NJY A;  1SKR A;  2YNG A;  4QCL A;  1RBU A;  5CY4 A;  3WNH A;  4M45 A;  3PY8 A;  1S1X A;  4JRQ A;  4E7J A;  1B9F A;  1NOZ A;  1HQU A;  4EP5 A;  5DMR A;  4AHV A;  4CEB A;  1HQE A;  3HXM A;  1C0T A;  2YV0 X;  4RW9 A;  1DTQ A;  2D0C A;  4I2P A;  4E19 A;  1VSE A;  4CJE A;  3KLF A;  4F2R A;  2GBZ A;  3OS2 A;  5FRM A;  1KSP A;  4O55 A;  3QES A;  1S1U A;  1FKO A;  4LD0 A;  2EHG A;  4E7I A;  3SQ1 A;  4IKF A;  2G8F A;  3AVI A;  2KZZ A;  3NF8 A;  4O4G A;  3AO1 A;  3V1Q A;  3HM9 A;  3RMC A;  2P51 A;  5E41 A;  4J2D A;  3V1O A;  4CIF A;  1ZYQ A;  3V9U A;  4CJK A;  4Z4E A;  2GUI A;  4Q0B A;  3TAM A;  4M3Z A;  3CM5 A;  1X9M A;  1J9A A;  3HVR A;  4FJH A;  1UWB A;  4MQ3 A;  4TSX A;  4PUO A;  1WN7 A;  3G10 A;  4CEA A;  2HW3 A;  1Z26 A;  4ZHR A;  2XO7 A;  1Q9X A;  4F3O A;  1S5J A;  3L2V A;  4DTX A;  2KQ2 A;  3K2P A;  4CE9 A;  1T05 A;  4KI6 A;  1BIZ A;  2HNZ A;  3V1R A;  1HYZ A;  1D9D A;  1TL1 A;  2BDP A;  4DWI A;  4FJ5 A;  3KLH A;  3CG7 A;  2OPP A;  3BDP A;  3MEG A;  3KLG A;  2KW4 A;  2KZM A;  3SPY A;  1LAW A;  3HPG A;  3OS1 A;  2LSN A;  3ZSX A;  4WE1 A;  1ZBI A;  2OPQ A;  3AA5 X;  4CJQ A;  4NYN A;  3D0P A;  4M3T A;  1RDA A;  1BGX T;  3L2U A;  3B6O A;  3NAE A;  2X6N A;  4IFV A;  4CF9 A;  5SWM A;  1SL1 A;  1NKB A;  4RG8 A;  3OYE A;  4OLA A;  3U3Y A;  3V9Z A;  3TAG A;  1U04 A;  1QSL A;  1HYV A;  4W5Q A;  5C42 A;  3V9W A;  3QEP A;  2X6S A;  4AHU A;  5EU7 A;  5J2Q A;  1L3V A;  4Z4H A;  3OYI A;  4FJL A;  3ZSR A;  4CGG A;  3C6T A;  1VSF A;  1TK8 A;  4AHT A;  3QET A;  2HHV A;  3K5L A;  4M3U A;  3NGY A;  4C8N A;  3CFR A;  1UAX A;  4DTR A;  3AO3 A;  2B6A A;  3ZT3 A;  5HRS A;  4KTZ A;  1TV6 A;  1NKC A;  2Y1J A;  4O5B A;  3NCI A;  1UA1 A;  4KKO A;  4CJL A;  4NCB A;  3OYJ A;  1XHZ A;  4M3W A;  3L3U A;  4H4O A;  3HK2 A;  1ZBL A;  4DSL A;  5HLF A;  3C94 A;  4W5T A;  4BE0 A;  4KAZ A;  4AHS A;  4DLE A;  3DRS A;  4M3Y A;  2P5G A;  4UQG A;  1TKX A;  1JLE A;  3NF9 A;  3DLR A;  4CEO A;  4FLX A;  3KD5 E;  1BI4 A;  4CED A;  2RKI A;  1S6P A;  1RBS A;  1GOC A;  3P5J A;  4HTU A;  3OYF A;  4J2B A;  1T7P A;  1IG9 A;  1LAV A;  1HPZ A;  4F8R A;  5KGX A;  1NK6 A;  3HPH A;  3SI6 A;  3RWU A;  1X9W A;  2XRI A;  4B8C A;  2ZD1 A;  1C0M A;  3K57 A;  1XC9 A;  4FJX A;  3K5N A;  3AV9 A;  3KLI A;  5SZT A;  3VQ4 A;  1XHX A;  2G8U A;  3G0Z A;  3HVT A;  4DMN A;  3OYK A;  1LW2 A;  2YHA A;  1U47 A;  1Z25 A;  2Y1I A;  4CJV A;  4O44 A;  4FJN A;  2VG7 A;  1VSK A;  3VQ9 A;  3DRR A;  4ICL A;  2A1R A;  1GOB A;  3NHG A;  3PO5 A;  4LH5 A;  3IG1 A;  3LWM A;  3MXM A;  1KFD A;  3RR8 A;  4DFJ A;  1RDD A;  2KFN A;  1LWC A;  3O3F A;  2Z1G A;  4M3X A;  4FYD A;  2HVH A;  2PYJ A;  1KLM A;  2YHB A;  4KHS A;  4FVM A;  5HBM A;  3IAY A;  4CGF A;  3S9H A;  3PUF A;  1YT3 A;  4PQU A;  4OJR A;  3RMD A;  1RTI A;  3QER A;  3KKS A;  4HUF A;  4B9U A;  4HCC A;  1SL0 A;  1IKW A;  3I8D A;  4E3S A;  3MXI A;  4FZX C;  1KVC A;  4FLZ A;  4GMJ B;  1SV5 A;  1A5X A;  3TAN A;  1J54 A;  1JKH A;  1BIU A;  4DF8 A;  4OLB A;  1ASU A;  4QOZ B;  3CFP A;  2D0A A;  1TKT A;  3QNO A;  2D5R A;  3QEV A;  4CJW A;  1SUQ A;  3EZ5 A;  4PA1 A;  3WNF A;  4DTP A;  2OYQ A;  1IKV A;  4OGE A;  3K59 A;  4N47 A;  3A2F A;  3V81 A;  4ZTF A;  1U45 A;  1XI1 A;  1JLF A;  2RN2 A;  3SJJ A;  3HJF A;  4DQQ A;  1RT7 A;  1W0H A;  1TK5 A;  1IKY A;  2ZQB A;  2I5J A;  3DM2 A;  3SUQ A;  4OKE A;  4C8O A;  1C1A A;  3VQ8 A;  1GOA A;  3SUO A;  1ZBH A;  4KPY A;  4OPJ A;  3OYG A;  3SZ2 A;  1TK0 A;  4FM0 A;  1D5A A;  4K8X A;  3UIQ A;  4DQR A;  3AVA A;  3IRX A;  5KI6 A;  3AVG A;  4Z0U A;  3LPT A;  1NK0 A;  4K8Z A;  1YTU A;  3VQC A;  3K5M A;  2YNF A;  2E6M A;  3KK2 A;  4CIG A;  5HRP A;  3WNE A;  4OGC A;  1LWF A;  1TGO A;  1XWL A;  2ETJ A;  2B5J A;  4GW6 A;  4KV8 A;  4W5R A;  2XY5 A;  4KHQ A;  2XY7 A;  2X74 A;  3AVM A;  3VN5 A;  3K5O A;  4DQS A;  4DSI A;  1ASW A;  4FM1 A;  4CJ5 A;  4DSJ A;  2F8S A;  2QKB A;  5T7B A;  4KB0 A;  4RW6 A;  2BAN A;  4O0J A;  1KVB A;  2IDO A;  3O3H A;  1FK9 A;  3OYA A;  3KK3 A;  3DLK A;  4BAC A;  4KI4 A;  1Y97 A;  2D0B A;  3T1A A;  3V9X A;  1I3A A;  4LSN A;  4I9Q A;  1O1W A;  4OKK A;  3CYM A;  1WSG A;  1S6Q A;  1RDB A;  4RW4 A;  1RTJ A;  2IS3 A;  2XY8 A;  1JL1 A;  1WAJ A;  4AHC A;  4CEC A;  3U6F A;  3AVC A;  2KTQ A;  1JLB A;  4B08 A;  4ELV A;  2HHS A;  1C1B A;  1WSE A;  4DSK A;  3O4N A;  2VG5 A;  3VQA A;  2VG6 A;  3HYF A;  3VQ7 A;  3SPZ A;  1Q9Y A;  3DOK A;  4C8L A;  4MFB A;  4OPK A;  3RR7 A;  3RRG A;  4E89 A;  3ZSZ A;  3PX6 A;  4Y1D A;  3PX0 A;  3TI0 A;  3PX4 A;  3SUN A;  3QIO A;  3P1G A;  1NK7 A;  4E7L A;  1BL3 A;  2HHT A;  4FJ7 A;  3F73 A;  4BWJ A;  3T19 A;  3FFI A;  1QE1 A;  3OYN A;  2XHB A;  1QTM A;  3HP9 A;  3NF7 A;  1SKS A;  1BQN A;  1TAU A;  3NH1 A;  3S3N A;  1N5Y A;  4DF4 A;  4B3O A;  1QSY A;  3AA4 A;  3NFA A;  3NH0 A;  1EET A;  1SL2 A;  4KHY A;  2BGG A;  2EX3 A;  3SNN A;  3BGR A;  3LAL A;  3ASM A;  3OYL A;  1W9H A;  3CQ8 A;  4FLT A;  1R0A A;  1KLN A;  3L8B A;  3V6D A;  4L8R B;  1QQC A;  3ITH A;  3CFO A;  1DTT A;  4RW8 A;  2OZM A;  4CJT A;  4LY7 A;  3NGZ A;  4QAG A;  3LWL A;  1F21 A;  2QK9 A;  1SKW A;  3KLE A;  3KK1 A;  3AVL A;  3LZJ A;  2DTU A;  4JRP A;  3C95 A;  3ZT4 A;  4ID5 A;  4Y1C A;  1N6Q A;  2HMI A;  4AH9 A;  1HNV A;  3CM6 A;  3QLH A;  4CF0 A;  2YKN A;  3VQB A;  3QIP A;  2HHQ A;  3P83 D;  3ZSV A;  4BE1 A;  1JXE A;  1VRT A;  1VRU A;  3RMA A;  4DTM A;  3AVK A;  5CZ1 A;  3OYC A;  5HP1 A;  1KVA A;  4IDK A;  2PYL A;  1RT1 A;  2OPS A;  3SUP A;  4JS5 A;  1CZB A;  3AO2 A;  1YVU A;  4Z4G A;  2X78 A;  4CGD A;  3QIN A;  4DS4 A;  3TR8 A;  1RTD A;  4CHY A;  4DLG A;  4BE2 A;  1WSF A;  1BCM A;  3NH2 A;  5I3U A;  4CJ4 A;  2HHW A;  1B92 A;  2O4I A;  3DLG A;  3OY9 A;  1RT2 A;  3ZSO A;  3E01 A;  4PWD A;  3KD1 E;  1EKE A;  1IO2 A;  4FLV A;  5HRN A;  2QXF A;  1QS4 A;  1NJX A;  3DMJ A;  1BIS A;  4CFD A;  4CEQ A;  5JS2 A;  1D9F A;  4DTU A;  4KHU A;  3LAN A;  2PY5 A;  1TKD A;  4B9M A;  4E7H A;  4ELT A;  2DFF A;  5I42 A;  3NGI A;  1IKX A;  1Q8I A;  3ZCM A;  4N56 A;  1RBR A;  5FDL A;  2DFH A;  4CF2 A;  3MAQ A;  4CJR A;  2XY6 A;  3SQ0 A;  1T03 A;  3OYM A;  1C1C A;  4CJF A;  3KTQ A;  3LZI A;  3RTV A;  4I9L A;  3VQP A;  1KFS A;  1RT4 A;  3DOL A;  4DTS A;  4FZZ A;  2ZE2 A;  1NK8 A;  3HST B;  4NCA A;  4M42 A;  2OPR A;  3AA3 A;  5KRS A;  3TWH A;  4FJM A;  3VA3 A;  4B8A B;  1VSL A;  3HT3 A;  4FLU A;  1L5U A;  3HP6 A;  3MEC A;  3PO4 A;  4R5P A;  4FM2 A;  3LP3 A;  5FRO A;  3TAP A;  1WSH A;  1TAQ A;  5C25 A;  4HCB A;  4H8K A;  2KFZ A;  3F9K A;  1RBV A;  3AVB A;  3H08 A;  1HYS A;  4LH4 A;  5CZ2 A;  3ZT0 A;  4CIE A;  3AVH A;  4DU1 A;  5HRR A;  2WOM A;  4FLY A;  4DFM A;  3M8P A;  1VSJ A;  3MED A;  1KRP A;  4XIU A;  3ZT1 A;  3S3M A;  1UA0 A;  2AJQ A;  2RPI A;  4NYF A;  3HO1 A;  4W5O A;  5D3G A;  4ID1 A;  5J2P A;  4FW1 A;  1REV A;  1LV5 A;  3PV8 A;  4B9N A;  1CLQ A;  3JSM A;  1JLQ A;  2GV9 A;  3NBP A;  4CK2 A;  2W42 A;  3QEX A;  1CZ9 A;  3QEI A;  1WSJ A;  3SYZ A;  4DTJ A;  4HUE A;  1IH7 A;  3AA2 A;  4ZTJ A;  2HVI A;  4EP4 A;  2JGU A;  4FK2 A;  1L3T A;  1JL2 A;  4CFA A;  1FXX A;  1RT3 A;  4DU4 A;  4E1M A;  5CYQ A;  3B6P A;  2QKK A;  1S9E A;  1U4B A;  2F8T A;  5JS1 A;  1ZBU A;  4FLW A;  3T3F A;  3TAQ A;  2HHX A;  3KIO A;  4CJU A;  2ITG A;  4CCH A;  2G8I A;  3OVN A;  3HPO A;  4ELU A;  3THV A;  3LP2 A;  3ISN C;  1FKP A;  4KFB A;  1VSH A;  4J2E A;  4KRE A;  1EXQ A;  5C24 A;  3VQD A;  1A5V A;  1WAF A;  1EP4 A;  4IG0 A;  2IC3 A;  4CHN A;  3SQ4 A;  1K6Y A;  4CFC A;  2G8W A;  4CGH A;  1CXQ A;  2DY4 A;  1KCF A;  1RT5 A;  3RMB A;  4F2S A;  5J2M A;  1S1W A;  4YFU A;  4I7F A;  4BDY A;  4CJP A;  5K14 A;  1U48 A;  4FJG A;  4B9L A;  1WSI A;  4Z4F A;  3SQ2 A;  4FXD A;  3OYD A;  5KTQ A;  4DTO A;  4IG3 A;  2O4G A;  3VQE A;  4F4K A;  1JLA A;  2E6L A;  1TL3 A;  3IS9 A;  3NF6 A;  4FK0 A;  4CFB A;  4F3T A;  3AO4 A;  3DLE A;  4AHR A;  4CEE A;  4J2A A;  4EZ6 A;  3OS0 A;  2YNI A;  2E4L A;  2PZS A;  1UOC A;  3U3G A;  4CGJ A;  1VSI A;  3OJU A;  3MXJ A;  3L2R A;  1S9G A;  2YNH A;  4FJI A;  3ALY A;  3OJS A;  4CHQ A;  3K58 A;  2OA8 A;  4KB1 A;  1HMV A;  2P1J A;  2RF2 A;  3LP0 A;  1RTH A;  1U49 A;  5J1E A;  4HVJ A;  2DFE A;  4E1N A;  4JLH A;  1CXU A;  2R7Y A;  1RCH A;  1NKE A;  4FJ8 A;  1HRH A;  3AVN A;  4CEF A;  3TAF A;  1RBT A;  3I0S A;  4DG1 A;  4CHZ A;  4CF1 A;  3C6U A;  1J53 A;  1NK4 A;  4C8K A;  3OYB A;  3QO9 A;  4CGI A;  4GVM A;  3VQ5 A;  2ATQ A;  4B9V A;  3L2Q A;  1C6V A;  1BHL A;  4JS4 A;  3VA0 A;  4DTN A;  4KRF A;  4FZY A;  1JLC A;  1JXB A;  2FC0 A;  4HHT A;  1BCO A;  2P5O A;  4DQI A;  2VWK A;  3AVJ A;  3NE6 A;  4Q5V A;  4KTQ A;  4KHN A;  2Z1H A;  4KO0 A;  4LSL A;  2G8H A;  4FCY A;  3MEE A;  5CYM A;  3LDS A;  4DU3 A;  2G8V A;  1X9S A;  4DS5 A;  4FJK A;  1RNH A;  1NJZ A;  1TVR A;  2YKM A;  1BI4 B;  1RIL A;  1A5W A;  1G15 A;  3L3V A;  4G1Q A;  4DSE A;  1RT6 A;  1TKZ A;  1EX4 A;  5HRO A;  4CER A;  1HNI A;  3O3G A;  3DLB A;  4YNQ A;  1WLJ A;  4E7K A;  3TAB A;  1NK5 A;  4IBN A;  2A1S A;  3NDK A;  3VQQ A;  5KGW A;  1VK0 A;  4FJJ A;  3DLH A;  3VQ6 A;  3I0R A;  4CES A;  4EZ9 A;  1KTQ A;  1X1P A;  3LAM A;  2OZS A;  4O0I A;  3AVF A;  1BQM A;  2JLE A;  4AIL C;  4E0D A;  1I39 A;  4OKJ A;  4OVL A;  3ZSQ A;  4FJ9 A;  3SV4 A;  1NOY A;  4Z4I A;  3L2W A;  2Z1I A;  2B4J A;  1B9D A;  3ZT2 A;  1NK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...