1A5XA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5xA00
1CLQA 1L3UA 4E19A 1ZBFA 4BDPA 4CJLA 3OYLA 4B9UA 1XI1A 4DSIA 4KTQA 2P51A 3K58A 4LY7A 4FLUA 3CFOA 4DU1A 1W9HA 3V9UA 1D5AA 4PA1A 3CM6A 3U6FA 3TAFA 4FJ8A 1YT3A 3WNEA 4C8NA 2GV9A 4XIUA 1Q8IA 3KKSA 3PY8A 2KZMA 1HYVA 1YTAA 4GVMA 1S6QA 1TKTA 5HRNA 3HP9A 3VQDA 3T3FA 4KHSA 3U3YA 2B6AA 1UWBA 1D8YA 4TSXA 3ZSRA 1EXQA 4FJHA 3AA5X 3OVNA 1RDCA 3O4QA 1CXQA 4CEDA 2Z1HA 4CF9A 3V9SA 2E6LA 4CEZA 2W42A 4BWMA 1TAUA 5HP1A 3HJFA 4AHRA 3HM9A 1RDAA 3HL8A 2HNDA 3OYAA 4DQSA 3SUOA 4HUGA 1FK9A 2F96A 1KVAA 4DQQA 4OLBA 2KTQA 4EP4A 4CFDA 4N41A 4F2RA 4KHUA 2ITGA 3A2FA 3M8PA 3PO5A 1SL1A 3AVCA 2RF2A 4OGEA 1HNVA 3ZSWA 4CF8A 3F73A 4DS5A 4B9TA 3CQ8A 3QEWA 4MFBA 3T19A 1VSLA 3S3NA 4M3XA 2X6SA 2DFFA 1WSIA 2ETJA 2ATQA 2YHAA 1C0MA 1WAFA 2Z1IA 3KIOA 4CF2A 3OJSA 2Y1IA 1HQUA 3HPGA 1JL1A 4J2BA 1HPZA 2OPRA 3OYBA 4DSEA 4CJFA 1SKWA 3S9HA 3ZSQA 1KVBA 2D5RA 5FDLA 3I0SA 4DTNA 2OYQA 4ELTA 3K5OA 2RPIA 4K8ZA 4M3TA 4CESA 4DSKA 2YHBA 3G0ZA 4DTPA 4CK2A 4Z4CA 1I39A 4CJQA 4F2SA 4DTXA 3LPUA 1RILA 4UQGA 3UIQA 4N56A 4ZTJA 4FJ7A 2P5GA 1RBRA 3NGZA 4KI4A 4PQUA 3OYGA 1UA0A 4DU4A 3B6OA 4JS5A 1CZ9A 1NK8A 3MECA 3TAGA 1LW0A 2HVIA 4E7HA 4QAGA 1WN7A 4H8KA 3ALYA 4CHPA 5KRTA 4E7IA 3KLGA 5DK5A 3RMAA 3QEVA 4FW1A 4O5BA 4FJNA 5FRMA 3ZT4A 3KD1E 3VQ4A 1KLNA 1REVA 1HRHA 2XY7A 3KTQA 1IH7A 1K6YA 2B5JA 4B9MA 1TKZA 3DLEA 2HB5A 1C6VA 3WNFA 4CGFA 4FW2A 3THVA 4CHNA 4Z4IA 2IS3A 4CJEA 4RW4A 3KK1A 2IAJA 2O4GA 1RBUA 2OPPA 3QO9A 4CJTA 4I2PA 3HSTB 3LP0A 3MXJA 1ZYQA 1T03A 4CEOA 1X9WA 1N6QA 4CJPA 4CHOA 1KRPA 1TKXA 4ELUA 3PX0A 4KPYA 3OS1A 2QKKA 2HHXA 1WAJA 1S1TA 4CEEA 1BQMA 1GOAA 1JLFA 4HHTA 3OYNA 1ASWA 4NYNA 4CHZA 3AVJA 4FLYA 5J2MA 1ZBIA 2R7YA 3HPOA 2VG6A 1WLJA 3KLHA 3M8RA 3VA3A 4DSLA 4KHQA 4AILC 3AVBA 4O4GA 2QK9A 3LZJA 4FZXC 4AHVA 4M45A 2ZE2A 3SV4A 3V9XA 1VSKA 2G8FA 4FLVA 3L2QA 4HVJA 2HHQA 4CGJA 3V1RA 3ZCMA 4W5OA 2HNYA 3C6UA 4RG8A 4CE9A 3VQ7A 4JRQA 1WSHA 2P5OA 3KLEA 3IAYA 3LANA 1KFSA 4KREA 4DG1A 1B9DA 3OYFA 1T7PA 1WSEA 3AO3A 4GW6A 3SQ2A 1O1WA 3CG7A 3PUFA 1VSJA 4B08A 1B92A 1QQCA 5EU7A 1L3TA 1S6PA 4AHTA 4CGDA 2G8KA 3DLBA 2GUIA 4FJJA 4J2DA 1NKCA 1HYSA 2Y1JA 1JXBA 5CZ1A 1BI4B 3AVNA 3HPHA 4B8AB 3QEIA 4HCCA 3TABA 4R5PA 4CJ3A 4B9LA 4PWDA 1RT3A 2G8HA 3MEGA 3RTVA 4DTSA 2VWKA 3QEXA 2FBYA 2OZSA 3DOKA 3DLGA 4H4OA 4CK1A 4DU3A 1J9AA 1JLBA 3SNNA 3TARA 5J2PA 1T8EA 1NKBA 2HHWA 3C95A 4OPJA 4JRPA 1J53A 4DFPA 3O4NA 5J2QA 3DI6A 3ITHA 1RT5A 4KI6A 4F8RA 2FC0A 1T05A 4FJIA 4DF4A 4B3OA 4B9SA 4FYDA 3HXMA 1TVRA 5JS2A 4FJ9A 1S1UA 1WSFA 3ZSOA 1VK0A 2EX3A 1L5UA 3MEDA 4DTRA 4KHNA 1IO2A 1B9FA 1KCFA 3AV9A 2KZZA 4O44A 4IFVA 2IC3A 4CERA 3OYKA 1L3SA 4EZ6A 4BDYA 3AVKA 4H4MA 4BE2A 1C0TA 2EHGA 4OJRA 3OYHA 1QSLA 1EKEA 5KI6A 4OLAA 3NFAA 3ZT3A 3OYMA 3D0PA 3QEPA 2PY5A 1QS4A 2BANA 3ZT1A 2RN2A 3PX6A 5K14A 3KK3A 4NYFA 4M3UA 1Z25A 2PYJA 1S9GA 4BACA 2YNFA 4NCAA 1HQEA 1BIZA 4CGIA 3DMJA 3K5NA 5CYQA 1NK0A 1D9DA 3M8QA 3ZT2A 4CJSA 3P1GA 1RT1A 1FXXA 5JS1A 4OKKA 1LWEA 4KHWA 4M3WA 3ULDA 1JLGA 2E6MA 1S1WA 2YV0X 3VQQA 1L3VA 2HVHA 2HW3A 1RNHA 1U49A 3HYFA 3ZSVA 4I2QA 4LD0A 3NCIA 1DLOA 3NE6A 1A5XA 3VQCA 3RMDA 1ZBLA 3IRXA 1HYZA 1QSSA 2OPQA 1VSMA 3M8SA 1TAQA 4ID5A 3O3FA 3TAMA 5J1EA 3DM2A 4FM0A 1NK9A 4FM1A 4IKFA 1QE1A 1IKWA 5J2NA 1A5WA 1S5JA 1TV6A 4FZYA 3LPTA 4RW7A 2IGIA 1U4BA 4FK4A 3TR8A 1CZBA 4CF1A 2DFHA 2XY5A 3LP2A 3KLFA 3K59A 3K2PA 3VA0A 2I5JA 4IDKA 3S3MA 1S1VA 5DMRA 3VQEA 4YFUA 1HMVA 5FROA 1U04A 1DTTA 3AO1A 5HRSA 4RW9A 4CEQA 3AVHA 2X78A 1NJXA 3LAKA 3SJJA 1WSGA 3C94A 2BGGA 2QXFA 4W5RA 3JSMA 1RT4A 2D0CA 3G10A 4Q0BA 3L3UA 1BCOA 4DTOA 1VSHA 4CIFA 5HRRA 4FVMA 4AH9A 5HROA 5D3GA 4EP5A 1QHTA 3OYCA 3V1OA 4WE1A 1U45A 1C1BA 2G8UA 3HK2A 3PO4A 3TANA 2D0BA 2RKIA 3DRRA 5HRPA 4E7KA 4E7LA 2A1RA 1X9MA 3ZSYA 3SZ2A 4DQIA 2KW4A 3L2WA 4E7JA 4RW8A 3KK2A 3QNOA 4Z4GA 1EETA 3SCXA 1GOCA 1XWLA 2X74A 4IG0A 4E89A 4CGHA 4FJXA 3V9WA 3KD5E 5CYMA 1X1PA 1TL3A 1ITGA 1KTQA 2YKNA 4CJ5A 4CK3A 3IS9A 4Y1DA 3EZ5A 4BDZA 1NJYA 4G1QA 4Z4EA 1RT7A 4FLWA 3NH0A 1NK6A 3WNHA 1TL1A 4C8MA 5I42A 5C42A 4B9VA 3NF6A 2JLEA 2QKBA 1TGOA 1HNIA 3CM5A 3KKRA 2VG7A 1SV5A 3S3OA 4B9NA 4N76A 3DRSA 4CJVA 4DFKA 4DQPA 3MXIA 3NH2A 4M42A 4KO0A 4LSLA 1J54A 4Y1CA 3VQ8A 1BQNA 5FRNA 3LALA 4MQ3A 1FKPA 1Z26A 3V81A 3MXMA 3DLRA 3L8BA 2BDPA 1BISA 5T7BA 4FJ5A 3SV3A 4M41A 2BE2A 1BHLA 4I9LA 4CFCA 3NDKA 1N5YA 4FJKA 3CYMA 4C8OA 3DYAA 3O3HA 1LW2A 2NUBA 5KTQA 4M3RA 2F8TA 1TK5A 2G8WA 1XHZA 1YTUA 1VSIA 1F21A 4C8KA 3QIPA 4O55A 3AVGA 1ZBUA 2XHBA 3ZSZA 4B8CA 3LAMA 4E1NA 3OYEA 3RRGA 3ZT0A 4OGCA 4DTJA 3RMBA 3SI6A 2KQ2A 4BE1A 4M3YA 2F8SA 2HMIA 4QCLA 1JLAA 1JLCA 3HVTA 1SKSA 4F3TA 4CIGA 4KKOA 1JLQA 4O0JA 3DLHA 4FZZA 1RDDA 4ZTFA 4CJRA 5KGXA 2HHTA 4HUEA 3QIOA 3QNNA 3SPZA 4KTWA 4K8XA 3QLHA 2YNHA 1TK8A 3V1QA 5I3UA 1UA1A 4Z4FA 3FFIA 1IKYA 2Z1JA 4N47A 4AHSA 4FJLA 4DTUA 3L3VA 1NJWA 1X9SA 3AA3A 3OYJA 3LWMA 3RR7A 1NK4A 4BE0A 3LZIA 2VG5A 3D45A 1IG9A 4W5NA 2DY4A 2X6NA 3AO4A 1WSJA 1HJRA 4DTMA 1A5VA 2OZMA 1S9EA 3DOLA 3P83D 2XO7A 3L2RA 4CFBA 3SUQA 4PUOA 3NF8A 3TAPA 2D0AA 4DLGA 4FM2A 3BGRA 1SL2A 2P1JA 3AA4A 4OVLA 2GBZA 1VSDA 3P5JA 5C25A 3VQAA 4CF0A 3LP1A 3QINA 1ZBHA 3IG1A 3NF9A 3VQPA 1Y97A 4CJWA 4CHYA 3K5LA 3TI0A 4I9QA 4HCBA 1RBVA 1ASUA 3ASMA 3MAQA 3SYZA 4I7FA 1LWFA 3SPYA 1TKDA 2IOCA 1C0UA 3F9KA 4CJUA 4FK2A 3HO1A 1LWCA 4NCBA 3VQ9A 4Q5VA 2PYLA 2HHVA 4CEAA 3OY9A 4FLXA 1LAVA 4FLZA 1SL0A 4F3OA 2OA8A 1C1CA 3CFPA 1JXEA 4NCGA 3WNGA 3OS2A 4CIEA 3LDSA 3OS0A 1NKEA 1KVCA 1RBSA 3AVLA 4KFBA 1RTIA 5CZ2A 4OKJA 2OPSA 1FKOA 4FXDA 4LSNA 4LH4A 3EY1A 3DRPA 4KAZA 1NOZA 1RT6A 5SZTA 1MU2A 1BGXT 1UOCA 1KFDA 4KTZA 4FLTA 2HHSA 2DTUA 1SUQA 4CEBA 1C1AA 2G8IA 3TWHA 3VQ6A 3NAEA 2HHUA 5SWMA 3RWUA 4CJKA 4J2EA 3V4IA 4GMJB 2XY8A 4CECA 2YKMA 3KJVA 1JL2A 5HLFA 4YNQA 1NK5A 3V9ZA 1I3AA 3PX4A 5CY4A 4E1MA 4AHUA 2ZD1A 2WOMA 1KSPA 3RRHA 1NOYA 1SKRA 3VQBA 4KB1A 3T1AA 4CJ4A 2PZSA 1RCHA 4JLHA 4KV8A 4OPKA 2IDOA 1JKHA 2A1SA 4PY5A 3NGYA 1UAXA 4OKEA 4FJGA 1Q9YA 1RTHA 1CXUA 1NJZA 4ICLA 3L2UA 1W0HA 1ASVA 1R0AA 3L2VA 4DS4A 4ZHRA 4IBNA 3ZSXA 1U47A 1TK0A 1RTDA 4ID1A 4FCYA 4CEFA 2AJQA 2JGUA 1G15A 2KFZA 5KRSA 1VRTA 4DLEA 4DFJA 5KGWA 3K5MA 1VRUA 3NGIA 2XRIA 1EX4A 3AVIA 3QESA 3E01A 1LAWA 3NHGA 1LV5A 4KHYA 4DMNA 1J5OA 4CHQA 3HVRA 1S1XA 2WONA 4DSFA 3HP6A 3RMCA 4DFMA 4KRFA 4BWJA 3OJUA 3TAEA 2FBTA 4M3ZA 1RDBA 4HTUA 1BI4A 1RT2A 3EYZA 4DWIA 4FK0A 4AHCA 2FBXA 4Z4HA 3MEEA 5HBMA 4RW6A 1BIUA 1VSEA 4LH5A 4W5QA 4DSJA 1XHXA 3AVFA 4ELVA 2HNZA 3JYTA 4E0DA 2FBVA 3ISNC 3KLIA 3HT3A 1Q9XA 4KB0A 2KFNA 3H08A 2DFEA 3V6DA 4N5SA 2Q3SA 1QSYA 3LP3A 2G8VA 3AO5A 3U3GA 3AO2A 3TAQA 4FJMA 1IKXA 4F4KA 3OYIA 2VWJA 3CFRA 3SQ4A 1RTJA 1QTMA 2ZQBA 1EP4A 5C24A 3LWLA 4HUFA 1NK7A 3AVMA 2YNGA 3K57A 4C8LA 1DTQA 1RBTA 4CGGA 3VQ5A 4W5TA 4JS4A 4CFAA 3DLKA 4IG3A 1WNSA 3VN5A 1VSFA 3SQ0A 3SQ1A 4J2AA 2XY6A 4QOZB 3AA2A 3NF7A 5E41A 3BDPA 3PV8A 3RR8A 3O3GA 4DF8A 2B4JA 4O0IA 3I0RA 3AVAA 3SUPA 4L8RB 4Z0UA 4CCHA 3B6PA 3C6TA 3QERA 4EZ9A 1JLEA 2Z1GA 4E3SA 1GOBA 2E4LA 3QETA 1KLMA 2O4IA 3NH1A 1IKVA 1XC9A 3I8DA 2LSNA 4IFYA 3OYDA 1D9FA 3SUNA 1YVUA 3NBPA 4DQRA 1BL3A 2YNIA 1U48A 1BCMA
chains in the Genus database with same CATH superfamily
4E19A 2ZWHA 1ZBFA 4CJLA 4DSIA 1P90A 4IEIA 4LY7A 3CFOA 4DU1A 1D5AA 3CM6A 1OH7A 4XIUA 3PY8A 2KZMA 4GV9A 1BA0A 3U3YA 3ZSRA 4DTRA 3V9SA 4CF9A 1CXQA 3O4WA 3CC4N 4AHRA 1RDAA 4JAXA 4IJNA 4A5AA 4DQSA 3SUOA 1KVAA 2KTQA 4DKWA 4EFHA 4WFAL 4F2RA 2ITGA 4KHUA 1XNQK 1QHAA 4DS5A 1NWKA 3H45C 4IO9L 3S3NA 1WSIA 2ETJA 2P9IA 2YHAA 3FGUA 3HPGA 4J2BA 4DSEA 4CJFA 1SKWA 5BREA 4LF8K 4DTNA 4ELTA 2RPIA 4K8ZA 4HTLA 2YHBA 3J7YP 4CK2A 1I39A 3CJ1A 4JKCA 3IUCA 5AQTA 4N56A 2P5GA 1RBRA 4KI4A 3OYGA 3B6OA 4JS5A 1CZ9A 2HVIA 4E7IA 3KLGA 3PIPL 5DK5A 3S41A 3F5TA 4NB4A 1REVA 3T1YK 3IKMA 3H1QA 1K6YA 2O8BA 2YX6A 3FZLA 4DV5K 4Z4IA 4CJEA 1Z6RA 4CZGA 3QO9A 1ZYQA 4I2PA 4NXMK 5BRDA 4XH5A 1IJJA 2O8FA 4CHOA 1KRPA 4KPYA 3WXIA 1JLFA 4HHTA 1ASWA 2R7YA 3VA3A 3MWTA 5TKWA 4DV1K 4AHVA 5KPTA 3SV4A 5LMNK 1YJ9N 1BDGA 1V4TA 4HVJA 2HHQA 4M7YA 1IV0A 2HNYA 4RG8A 4JRQA 4QS7A 3IAYA 3KLEA 3CHWA 3OYFA 1NGFA 4BR7A 4K0KK 3CG7A 3U8XA 1VSJA 4C1NK 1QQCA 1L3TA 4YOYA 2G8KA 4FJJA 4CGDA 2E5LK 2GUIA 1NKCA 2Y1JA 1BG3A 3SBTA 3QEIA 4B8AB 3UKUA 4A62A 1VQON 4R5PA 2WUSA 4CD3A 1NG9A 4DUZK 2ZGZA 3DLGA 5JMVA 4A59A 1XUPO 1J9AA 1T8EA 4JI0K 2W40A 2HHWA 4CZJA 5HL7L 1Q82O 4OPJA 4JRPA 1RT5A 1TUUA 1T05A 1XMQK 4B3OA 4FYDA 2EX3A 4JKBA 3MEDA 4DV4K 2KZZA 4O44A 4BY9C 2EHGA 1IG8A 4OJRA 1QSLA 3WXMB 3E66A 2BANA 3PX6A 3KK3A 4NYFA 1S9GA 1WUAA 5CYQA 3M8QA 4YOUA 4CJSA 5HOOA 4LF4K 4JKFA 4OKKA 4K41A 3IMXA 4BQLA 4KHWA 3VEOA 4AM7A 4M3WA 2YV0X 2HVHA 3EL2A 1U49A 3FZFA 4LD0A 3VERA 1VQLN 3WXLA 1HYZA 1QSSA 1VSMA 4FM0A 3PIOL 4IKFA 1GLJO 5J2NA 1S5JA 2OCEA 2O8CB 4QS8A 4BRHA 5AZJB 1U4BA 3TR8A 1NGIA 1CZBA 3CQYA 3O08A 3O8MA 3K59A 3K2PA 4DR4K 5AQIA 4DV0K 1DKGD 1U04A 5FROA 1RDWX 5HRSA 4RW9A 3NMUA 3KHYA 3AVHA 3SJJA 3C94A 3LDQA 4DTOA 4A5BA 4JK9A 4JD2B 4CIFA 4LF9K 4AH9A 3DLLL 5D3GA 1C1BA 3TANA 4E7KA 3MCPA 3SZ2A 3M1FA 4CZIA 4E7JA 2PBDA 3QNOA 4Z4GA 4YOWA 1GOCA 3QFUA 1XWLA 2X74A 3BUZB 4IG0A 4CGHA 5CYMA 4FOEA 1KC8O 4FVUA 1TL3A 4BDZA 4CJ5A 3IS9A 3I33A 5H1SQ 2UU9K 1S72N 2HBMA 2JLEA 1TGOA 3CM5A 3KKRA 2VG7A 4N76A 3TPQA 4ILHA 3DRSA 3WT0A 4GY2B 3NH2A 4M42A 4KO0A 4O8KA 4H5RA 4F9OA 1FKPA 5EOYA 2NRWA 3L8BA 2BDPA 3NVMA 2BE2A 4I9LA 4CFCA 3NDKA 1N5YA 3HRGA 4C8OA 3DYAA 1LW2A 2JWLA 2D0OA 5KTQA 1DEJA 1XHZA 4BRDA 3VEVA 4O55A 2P9UB 3LAMA 4E1NA 4JKEA 4DTJA 2F8SA 3HVTA 4JKGA 4KKOA 4O0JA 5KGXA 3VOVA 2QWMA 2Q0RA 1GLLO 1Y64A 3QLHA 4Z4FA 1GLFO 4AHSA 1NJWA 3AA3A 2GTDA 3RR7A 4BE0A 2GUPA 2VG5A 5ADXH 2X6NA 2P9KB 3FZMA 3ZEUB 2KKZA 1A5VA 3DWLA 2OZMA 5IT9O 1NNEA 4CFBA 1GLEG 3TAPA 4FM2A 3R9PA 2P1JA 5MLCQ 3AA4A 2GBZA 5AQVA 4GKKK 3IG1A 3VQPA 1TYQB 2WBNA 4CJWA 1RBVA 4I7FA 4YOVA 2OTJN 3F9KA 4YDUC 1OH8A 3EO3A 3A5MC 3OY9A 4FLZA 4BC5A 1K9MO 3CFPA 1JXEA 3OS2A 4CIEA 3I56N 3LDSA 1NKEA 1KVCA 1RBSA 1GLBG 5JVGL 2VYPA 1H1VA 1NOZA 5SZTA 3EE9A 5GAEP 2G8IA 3VQ6A 5LMUK 1TUYA 2HHUA 5SWMA 3PSFA 2PFUA 1JJ2M 2A5XA 4O5FA 3VF2A 5DM6L 1M90O 5DM7L 4JV5K 1KSPA 2ZD1A 1SKRA 2O8EB 4CJ4A 1RCHA 2IDOA 5KQDA 5BPNA 1YIJN 1EWRA 4BR0A 1NJZA 1NGGA 4DV2K 4ICLA 4DV3K 1ASVA 3L2VA 2QW9A 3MX2A 4IOAL 4BR9A 2JGUA 1G15A 4BRCA 1Q86O 4B1VA 4DLEA 4DFJA 3K5MA 2UYTA 4UY8O 3NHGA 3HVRA 4BROA 3RMCA 3OJUA 2E1YA 1RDBA 3O9TA 3EYZA 2P9PA 4FK0A 4Z4HA 3MEEA 2AA4A 1BIUA 2O8BB 3CCMN 2F4VK 3SAGA 3AVFA 5E84A 1J6ZA 2KFNA 1OH6A 4NXNK 2DFEA 2BUPA 4WYBA 1QSYA 2G8VA 3LP3A 4LFBK 2O8FB 4XEIA 5JLHA 4FJMA 1IKXA 3OYIA 2VWJA 4GNIA 2HBJA 2IIRA 3AVMA 2YNGA 3EKUA 4CGGA 1RBTA 3ATUA 4W5TA 3CCRN 3T7ZA 3VN5A 4WFBL 2D4WA 4QOZB 5FPEA 2W6LA 4DF8A 2BH1A 3UE5A 3SUPA 3QERA 4EZ9A 1JLEA 2Z1GA 1GOBA 2E4LA 4IJAA 3ZX0A 4X64K 3THYA 1HR0K 2KLAA 3O1BA 3MN5A 3SUNA 1YVUA 1MDUB 4WQ4C 3UKUB 2CH5A 5GADP 4BDPA 5C0YA 2QWLA 4KTQA 1W97L 4H5WA 4C8NA 2GV9A 4DR6K 1M1KO 5BR9A 1HYVA 1YTAA 5HRNA 4XH4A 1EXQA 4FJHA 3AA5X 3OVNA 1RDCA 4CEDA 1X9JA 2E6LA 4IXCA 2W42A 4E1JA 3E1YA 1VQ7N 2HNDA 2F96A 3O9UA 4CFDA 4N41A 2QI2A 5BRFA 2W6KA 4OGEA 4CF8A 3F73A 2NRHA 3QEWA 1VSLA 4FWRA 4M3XA 2X6SA 2ATQA 4CZHA 2Z1IA 3FR0A 2Y1IA 1JL1A 4PL7A 1HPZA 1HLUA 3O9RA 2A42A 2AP1A 2D5RA 3K5OA 4LFAK 4M3TA 4DSKA 3BP8A 3AAPA 3LPUA 1RILA 4PQUA 2FF6A 3BY5A 3MK6A 3NGZA 1W7AA 1NK8A 1WN7A 4MLHA 3ALYA 4H8KA 4CHPA 5BPLA 3VENA 3CCVN 4JK8A 3TTCA 4B1WB 1KLNA 4BRMA 1NMNA 1IH7A 2B5JA 5M1QA 1C6VA 3M5RA 1SZ2A 4JI6K 3A5LC 4PL8A 4BR4A 1RBUA 3CCJN 4AM6A 3MXJA 1T03A 4CEOA 1X9WA 3PX0A 4BGBA 2HHXA 4CEEA 4BRQA 4CHZA 4NYNA 3THXA 3AVJA 1ZBIA 3H1VX 3DXKB 3HPOA 3MN7A 3M8RA 3KVGA 4ILGB 2QK9A 3LZJA 4FZXC 2QWRA 4M45A 2V52B 3V9XA 1VSKA 4FOIA 1NMDA 1HKCA 3ZCMA 4W5OA 3C6UA 3KZBA 4MDBA 1WSHA 1KFSA 1QZ6A 4FWSA 4IOXA 1B9DA 3HBTA 3AO3A 1K8KB 4JI2K 4NLBA 2VCPA 3R8EA 4EIAA 1O1WA 2ZJPL 1YHQN 1B92A 1VQ5N 3DLBA 1S6PA 3HM8A 5GAGP 5CZ1A 3AVNA 3HPHA 2YCHA 5AQFA 1RT3A 2G8HA 3RTVA 4DTSA 3HOTA 4CZKA 2FBYA 2OZSA 3DOKA 4CK1A 1Z05A 4FWQA 3SNNA 3TARA 5J2PA 4NO7A 4BGAA 1J53A 5J2QA 4FWOA 4F8RA 4FJIA 4DF4A 4B9SA 4ISGA 3HXMA 1TVRA 1KAXA 1WSFA 3VGLA 1W2BM 4JKGB 4KHNA 1B9FA 1KCFA 3AV9A 5CR4A 4CERA 3TSPA 4OPHA 4H03B 3C6AA 3AVKA 1C0TA 2GX9A 1HNWK 3OYHA 3ZT3A 3QB0A 3OYMA 1JCEA 2PY5A 3E9OA 2ASMA 4JHDB 5C2DA 4M3UA 4JYAK 2OTLN 2NRZA 1HQEA 3DMJA 2I7NA 4FWLA 3P1GA 3SAFA 1RT1A 1YJNN 2O8EA 1LWEA 3JXUA 5AQJA 4BRKA 4DR7K 2ZM6K 2E2PA 3VQQA 3WXJA 1L3VA 2HW3A 3HYFA 4I2QA 3NCIA 1DLOA 3NE6A 1A5XA 3VQCA 3QDKA 3IRXA 2QWQA 5AQNA 3M8SA 1TAQA 3O3FA 1NK9A 4WQ5A 5GINA 3L0QA 5C12A 4JI3K 3SK3A 1A5WA 3LPTA 2IGIA 1T3VA 4FK4A 2XY5A 2DFHA 3LP2A 1DGKN 5DMRA 1GLAG 5KQ8A 1DTTA 2HBLA 4CEQA 2NRVA 2QWNA 3WQUA 3L3UA 2E2NA 5HRRA 5AQLA 5HROA 3OYCA 1QHTA 4WE1A 3LL3A 2G8UA 4X66K 3L6QA 3E9LA 2D0BA 3DRRA 3VEYA 5HRPA 4DQIA 3A5OC 2KW4A 4EAHD 5BN9A 4BRFA 5FLXO 1YXQA 1EETA 3SCXA 3OA9A 1N36K 4FJXA 1ATNA 3P4IA 3LDLA 1X1PA 1YITN 1NJYA 3EZ5A 1HNZK 3GE1A 3U4LA 3H46O 1TL1A 1HNIA 1SV5A 2P9SA 3QICA 3S3OA 3CCQN 2RHKA 1J54A 1BQNA 1VAZA 2E8AA 3H6EA 3ZX2A 4RCHA 4JEPA 4FJ5A 4BG9A 3O3HA 1MWKA 4M3RA 1VSIA 1F21A 2P9PB 1ZBUA 3RRGA 3OYEA 3SI6A 4B1YB 3RMBA 3CERA 4ILJA 2ZF5O 2HSTA 1SKSA 4F3TA 5LJVA 3O9SA 1KQSM 4BRIA 5LL6Z 3DLHA 4ZTFA 4CJRA 4HUEA 2I7PA 2VWBA 3SPZA 2IVPA 4KTWA 2YNHA 1TK8A 1OH5A 1K73O 3CI5A 4N47A 1IKYA 4B3SK 3CXCM 3N4PA 2VQEK 1OKJA 1N8RO 1X9SA 3LWMA 5JVHL 2QWOA 4CZLA 4YHHK 1IG9A 3MCAB 4FO0A 2CH6A 3Q7BA 2Q36A 3CQXA 3NF8A 2D0AA 4DLGA 1J5EK 4OVLA 1NBWA 3ZETB 3G71N 5C25A 4CF0A 3LP1A 3QINA 1ZBHA 3NF9A 3SJHA 3THYB 4I9QA 1ASUA 3MAQA 2J4RA 4FWKA 4H5VA 2IOCA 1C0UA 5ELZA 1LWCA 4NCBA 2HOEA 2WTUA 3O6WA 1C1CA 2GWJA 4OO1J 5AQXA 4KFBA 3AVLA 1RTIA 4OKJA 2OPSA 1FKOA 4KAZA 3LDOA 3AARA 1BGXT 4KH5A 1KFDA 4KTZA 3C7NA 2DTUA 2H3GX 3TWHA 3NAEA 5EXWA 4CJKA 3VGKA 4CVNE 3DJCA 4E1MA 3FZHA 5ADXA 3RRHA 1NJIO 3VQBA 3KWIA 4OPAA 4OPKA 4PY5A 4OKEA 1RTHA 1VQ9N 3DXKA 1W0HA 4IBNA 2ZJQL 1U47A 2ITMA 4ID1A 1NU0A 1YF5L 5AQQA 5BPMA 3ENOA 1VRUA 5AQPA 2XRIA 3NGIA 4JI8K 3E01A 1K8KA 1LAWA 1LV5A 4CHQA 1S1XA 5JICA 3HP6A 4DFMA 4KBOA 4BWJA 4B3RK 4EHTA 2FBXA 1N33K 3C65A 4RW6A 5C2FA 3QMLA 4ELVA 2HNZA 4E0DA 3KLIA 4K42A 3V6DA 2Q3SA 3F2KA 3AO2A 4F4KA 3TSQA 5KPRA 1QTMA 2ZQBA 2FSJA 2Q97A 1EP4A 4H5NA 3THXB 3CC7N 4GV3A 2V7ZA 1I94K 1NK7A 4JS4A 4CFAA 3DLKA 3T69A 3SQ0A 5AQZA 2UXDK 3O3GA 4JKAA 3BZKA 2E88A 5AQMA 4L8RB 3MN6A 4CCHA 4JHDA 3B6PA 4EHUA 1KLMA 3NH1A 1IKVA 1XC9A 4A2BA 3I8DA 2W41A 3BZCA 3NBPA 3EZWA 4DQRA 4ISEA 1BCMA 1L3UA 4M63C 3UB5A 4B9UA 1XI1A 3K58A 4FLUA 2HF3A 3VTIA 5GAHP 3V9UA 3TAFA 3U6FA 2D0PA 3WNEA 4DR5K 1WOQA 3KKSA 4GVMA 1S6QA 3CMAN 3HP9A 3T3FA 1D8YA 1UWBA 4LFCK 2GWKA 3R3LA 3ID8A 1JCGA 4DTUA 3O4QA 2Z1HA 1TAUA 3P31A 3HI0A 4CEZA 4BWMA 5HP1A 3HJFA 3HL8A 1E3MA 1HPMA 2GELA 3E9PA 1FK9A 4HUGA 4OLBA 1G99A 4EP4A 2UUBK 4YY3K 3A2FA 3O80A 3PO5A 1HNVA 3CQ8A 4IFEA 1HKBA 5JLFA 2F7TA 1C0MA 1WAFA 3KIOA 4Z94A 4CF2A 4AF1A 3P38A 3OYBA 4JI5K 2IVNA 3L4IA 4A2AA 1BO5O 3VPZA 3S9HA 2FSNA 4KHPK 3ZSQA 5F1XA 1KVBA 1QQNA 4BRGA 3CMEN 3G0ZA 1FW6A 3O9QA 4DTXA 3BEXA 4UQGA 4FJ7A 4Y0WA 4JI1K 1UA0A 3MECA 1LW0A 1MWMA 4E7HA 2NRRA 3ENBA 3ZYYX 3QEVA 4FW1A 1HRHA 2XY7A 4LF6K 3KTQA 2A40A 2HB5A 2KHOA 3WNFA 4CGFA 3THVA 5LJWA 2IS3A 3SAHA 1VQ4N 2OPPA 3HSTB 3SMSA 1N6QA 4CJPA 4JN4A 1TKXA 4ELUA 5AQWA 4MDAA 2QKKA 1S1TA 4PHTX 1BQMA 1GOAA 1WBBA 4FLYA 5J2MA 3VEWA 4AILC 5AQHA 4O4GA 3G25A 4WCEL 3HSCA 4FLVA 2HF4A 3L2QA 4CGJA 3V1RA 4H0VB 4CE9A 3VQ7A 3CPEA 1T7PA 3LM2A 1ILYA 3QBXA 2BTFA 4GW6A 4RWTA 2P9SB 3PUFA 3W0LA 4B08A 4AHTA 1C0GA 1LOTB 4HCCA 3ZETA 4JKDA 4CJ3A 2ASPA 1Q7YO 4J8FA 2P9NA 4WFNL 4B9LA 4PWDA 3MEGA 1YAGA 1RFQA 2VWKA 4DU3A 4H4OA 4BR5A 1LCUA 1NKBA 1R59O 1VQMN 4DFPA 3O4NA 3DI6A 1X3MA 3ITHA 1YI2N 4KI6A 2A6AA 5AZIA 4DHYA 4BR2A 2Q1NA 1BUPA 1ESVA 4FJ9A 5JS2A 1S1UA 3ZSOA 1VK0A 3J81O 4FSVA 1L5UA 3UKRA 1NGJA 4B3TK 1IO2A 3Q7CA 3ZLJA 5EY4A 2VQFK 2YHXA 1U2VB 4IFVA 4YDUA 1L3SA 4EZ6A 4H4MA 4BRPA 3J8AA 5KI6A 3J80O 4JKHA 3G4SN 2RN2A 3VGMA 1QVFM 3R6MA 2Q31A 5FPNA 2YNFA 4NCAA 1BIZA 3K5NA 2UXBK 3ZT2A 1FXXA 1GLCG 4CZMA 1JLGA 1S1WA 1RNHA 3VMFB 3ZSVA 5F0XA 1ZBLA 1QZ5A 3TAMA 5J1EA 3DM2A 5AQKA 1IKWA 1TV6A 5AFUH 4FZYA 2QEXN 3OBWA 3K9KA 3VF6A 3THWB 3KLFA 4IDKA 1SS6A 3ZX3A 3MWPA 3NVKA 3LDPA 3LAKA 4W5RA 3JSMA 1RT4A 1BCOA 3C7NB 3PSIA 2F9TA 4WQ5C 2Q2RA 4DR2K 1U45A 3HK2A 1BWFO 5B8HA 3PO4A 2RKIA 1X9MA 4E7LA 3D7EO 2O8DA 3ZSYA 3L2WA 2UXCK 3KK2A 3SMPA 3V9WA 1ITGA 4IOCL 4Z4EA 4G1QA 4FLWA 3A8YA 1NK6A 3WXKA 4B9VA 3G6EN 3M6GA 1VQKN 4K25A 4CJVA 5AJ3K 4DFKA 2QTDA 1OVYA 4LSLA 3VQ8A 2YHWA 4Y1CA 5FRNA 3SLCA 3D2EA 1Z26A 3V81A 2F9WA 4L3QA 3DLRA 1S3XA 3OTOK 3SV3A 1X3NA 3IDHA 1JCFA 1XNRK 5BRHA 4DUYK 2F8TA 1MA9B 1TK5A 3D2FA 2YJEA 4C8KA 4B9QA 2XHBA 3ZSZA 3LDNA 4A61A 4BC4A 2KQ2A 2JWKA 4FL9A 4QCLA 1JLAA 3TTDA 1JLCA 4FZZA 3QIOA 3QNNA 1GLDG 5AQGA 3V1QA 5I3UA 1KXPA 1UA1A 2QA4N 1N32K 1NK4A 3CJ7A 3D45A 4W5NA 2DY4A 1ZXOA 3AO4A 1HJRA 1WB9A 3GBTA 4CBWA 4PUOA 3L2RA 1ZC6A 5M1NA 1VQNN 3VQAA 5IWAK 2D1KA 3KK7A 2NZTA 1Y97A 4CHYA 4CBUA 4JI7K 4CJUA 4FK2A 2FLOA 1NLVA 3VQ9A 3ULEA 4CEAA 4BC2A 2CGKA 4F3OA 1QQMA 2OA8A 1FJGK 4BVPA 3AY9A 1EQYA 4NCGA 3WNGA 4R79A 5CZ2A 4FXDA 4LSNA 4LH4A 3EY1A 3DRPA 4CI6A 5C10A 1RT6A 4PKHA 1UOCA 5KPZA 4MO5A 2HHHK 2HHSA 1SUQA 4CEBA 1C1AA 5AQRA 3RWUA 5LY3A 4J2EA 4CECA 3KJVA 5HLFA 4YNQA 3V9ZA 1I3AA 1E4FT 4X65K 3LM9A 4KV8A 1JKHA 2A1SA 1UAXA 3ENHA 4I6MA 1R0AA 4DS4A 4PKGA 4ZHRA 4MLEA 3N4QA 3ZSXA 1TK0A 4YOTA 3FFKB 3R1XA 4CEFA 1WBDA 2KFZA 3MN9A 2V51B 1T6CA 1VRTA 4B3MK 3QESA 3VTHA 3C0BA 2GEMA 4DSFA 4KRFA 3TU5A 3TAEA 2FBTA 4M3ZA 4HTUA 1RT2A 4BQZA 4AHCA 4CJ7A 3SBGA 4LH5A 3AGKA 3HTVA 1XHXA 3JYTA 2E20A 1Q9XA 1RGIA 1ZBSA 5AQSA 3TTFA 3AO5A 3U3GA 3QFPA 1Q18A 4IWVA 1QQOA 4FPBA 1U2VA 5C24A 5BN8A 4NLCA 4C8LA 4BVOA 4MO4A 1WNSA 2XY6A 1NGBA 5E41A 3BDPA 1VHXA 4BREA 3RR8A 3ID6A 3J7ZO 1XMOK 2B4JA 4O0IA 3I0RA 4U67L 4Z0UA 5GIOA 3C6TA 3U9ZA 4E3SA 3QETA 2O4IA 2NRXA 2FXUA 3OYDA 3GOIA 1BL3A 3CD6N 2YNIA 2A41A 1U48A 1CLQA 2P9NB 3BF1A 3OYLA 3CCSN 2PAVA 2P51A 2V7YA 5E26A 1W9HA 3IFRA 4PA1A 4FJ8A 1YT3A 1Q8IA 2YHYA 4BRAA 1TKTA 3VQDA 4KHSA 2B6AA 4CD1A 4B1ZA 5AZIB 4TSXA 4BRNA 2IVOA 3RVCA 3F9MA 4U7BA 3THWA 3UKRB 3HM9A 3GL1A 4DV7K 4LF5K 3OYAA 4DQQA 4ISFA 3M8PA 3O1WA 1SL1A 3AVCA 2RF2A 3ZSWA 4B9TA 3VETA 4MFBA 3T19A 3P39A 2DFFA 2CGLA 4CW7B 3EKSA 3OJSA 1HQUA 2OPRA 2WFBA 3WQTA 2ZJRL 4DV6K 1XQSC 5FDLA 2OYQA 3I0SA 4CESA 4DTPA 4Z4CA 3DXMA 3CJ9A 4CJQA 4F2SA 1T6DA 4O8UA 4JK7A 4ZTJA 3UIQA 4DU4A 3TAGA 4QAGA 5KRTA 3RMAA 4O5BA 4FJNA 5FRMA 3ZT4A 3KD1E 3VQ4A 4B9MA 1TKZA 1DT9A 1HX1A 3DLEA 4G9ZA 2P9LA 4FW2A 4CHNA 4RW4A 3KK1A 2IAJA 2O4GA 4CJTA 1HUXA 3LP0A 3MDQA 3WEEA 3CCUN 4H0PA 4C23A 3OS1A 2E2QA 1WAJA 3OYNA 2O8DB 1YJWN 2VG6A 1WLJA 3KLHA 4DSLA 4KHQA 3EE8A 3AVBA 3VF4A 1N34K 2G8FA 2ZE2A 5AR0A 4BG8A 4X62K 1CZAN 4LC9B 2FF3B 1IBLK 1QVGM 5AQOA 2P5OA 3LANA 4KREA 4DG1A 1WSEA 1KD1O 1NGDA 3SQ2A 2FSKA 3FZKA 5EU7A 3RSEB 1KAYA 4J2DA 1HYSA 3O5BA 1JXBA 3D2EB 1BI4B 3TABA 2UUCK 3QEXA 1OVQA 1JLBA 3H3OB 1Q81O 3C95A 2QM1A 3D2FB 5AQYA 3OBYA 5M1FA 3H3NO 1NGCA 2UUAK 2FC0A 4KH6A 1NGEA 3PLAA 4FPAA 4PKIA 2IC3A 1YVNA 3OYKA 4BDYA 1HKGA 1V4SA 3FLCO 4BE2A 1RDUA 3KWGA 1SQKA 1EKEA 4OLAA 3NFAA 3D0PA 5I9EB 3QEPA 1QS4A 3ZT1A 5K14A 1Z25A 1VQ8N 2PYJA 4BACA 4CGIA 2E1ZA 4FWMA 1D9DA 1NK0A 3CJCA 5JS1A 2CGJA 4H0XB 4CZFA 3ULDA 2E6MA 1K8AO 3BF3A 3RMDA 2OPQA 4ID5A 2YI1A 4FM1A 1QE1A 3CJAA 4RW7A 3ULEB 3ATVA 4CF1A 3VA0A 3S3MA 3MMVA 2I5JA 3K0SA 1S1VA 3VQEA 4YFUA 5FPMA 1HMVA 5AQUA 3AO1A 1E4GT 2X78A 1NJXA 2BGGA 1WSGA 2DPNA 2QXFA 2D0CA 3A0IX 3G10A 4Q0BA 4GKJK 4FWNA 3U9DA 1VSHA 1SAZA 3OW2M 4FVMA 2P9IB 4EP5A 3V1OA 4YOXA 2A1RA 1P8ZA 4RW8A 5FPDA 1HNXK 4E89A 2ZGYA 3KD5E 1KTQA 2YKNA 4CK3A 4Y1DA 1RT7A 5BR8K 4GVEA 3NH0A 3WNHA 5CE3A 4C8MA 1NGHA 4IEEA 5I42A 2OANA 5C42A 3NF6A 2QKBA 4I6MB 5CHIA 4B9NA 4DQPA 4H0YB 3MXIA 3T1HK 3LALA 4MQ3A 3MXMA 1BISA 5T7BA 5AFUA 4M41A 3I55N 1BHLA 4FJKA 1O13A 2HMPA 5TKYA 3CYMA 3GDQA 1VQPN 2NUBA 2G8WA 1YTUA 3CCEN 1BOTO 3QIPA 4FWPA 3AVGA 4B8CA 1KAZA 3JAMO 4LF7K 3ZT0A 4OGCA 1EO1A 1YUWA 4BE1A 4M3YA 1S22A 3WUHA 2HMIA 4XH1A 1XC3A 1HJOA 4CIGA 1VQ6N 1JLQA 2ASOA 2VGMA 2VGNA 1RDDA 2HHTA 4K8XA 3QBWA 5EX5A 4M7XA 3FFIA 2Z1JA 3DAWA 4B1UB 4FJLA 3L3VA 1C0FA 1NGAA 3OYJA 3CJBA 3LZIA 3CIPA 1WSJA 4DTMA 4DQ8A 3CETA 1S9EA 3DOLA 3P83D 2XO7A 3SUQA 3D6RA 2RE2A 1SL2A 3BGRA 1IBMK 2EWSA 1VSDA 2NRTA 3P5JA 3AAQA 3JS6A 5M1KA 3K9JA 1ATRA 4A57A 3K5LA 3TI0A 4HCBA 4IDHA 3ASMA 5C15A 2HBKA 3SYZA 1LWFA 3SPYA 1TKDA 3VEXA 4RTFD 4B1XB 4DR1K 3HO1A 3TSUA 5GIPA 2O8CA 4Q5VA 3HZ6A 2PYLA 4YORA 5M1OA 2HHVA 5AZJA 4FLXA 1LAVA 1SL0A 2YJFA 3OS0A 4IZ9A 1ATSA 4H5TA 2NNWA 4GV6A 1MU2A 4BC3A 1D4XA 4FLTA 3CCLN 4JD2A 1EWQA 3VEZA 5EVZA 3V4IA 4GMJB 2XY8A 5F2RA 2YKMA 1JL2A 4IO8A 1NK5A 3L4QA 3PX4A 5CY4A 4AHUA 2WOMA 1NOYA 4KB1A 1BA1A 3T1AA 2PZSA 4JLHA 3C6HA 1NM1A 4DR3K 3NGYA 4FJGA 5A2QO 1Q9YA 1CXUA 2Q0UA 3I8BA 3W3DA 4DCHA 3L2UA 4CBXA 3FE1A 4WF9L 1RTDA 4FCYA 2AJQA 3DXMB 5KRSA 5KGWA 4OX9K 5M1PA 3OHRA 1EX4A 3AVIA 4KH4A 2A3ZA 1IBKK 4KHYA 4DMNA 1J5OA 2WONA 2WC9A 3M3ZA 3RSEA 3EEQA 1BI4A 3GG4A 4DWIA 2P9UA 4V19S 5HBMA 1VSEA 2QWPA 4W5QA 4DSJA 1U6ZA 2P9LB 2FBVA 3ISNC 3HT3A 4QS9A 4H0OA 4KB0A 3H08A 3CPWM 4N5SA 4K43A 3TAQA 3WEEB 3CC2N 4JNEA 3CFRA 3MX5A 3SQ4A 1RTJA 4HWIA 4DB3A 4WQ4A 3J7AP 4HUFA 3LWLA 1BU6O 3K57A 1DTQA 3VQ5A 2NLXA 2P9KA 4IG3A 3ZEUA 1VSFA 3SQ1A 4J2AA 3EN9A 4JI4K 3AA2A 3VESA 1T44A 3NF7A 4CZEA 3PV8A 4BRLA 4AQYK 4C1NI 3AVAA 3A5NC 2E2OA 3B8AX 3HOSA 3CF5L 1TYQA 2QXLA 2LSNA 3AGRA 4IFYA 1D9FA 4H0TB
chains in the Genus database with same CATH topology
1CLQA 1L3UA 4E19A 1ZBFA 4BDPA 4CJLA 3OYLA 4B9UA 1XI1A 4DSIA 4KTQA 2P51A 3K58A 4LY7A 4FLUA 3CFOA 4DU1A 1W9HA 3V9UA 1D5AA 4PA1A 3CM6A 3U6FA 3TAFA 4FJ8A 1YT3A 3WNEA 4C8NA 2GV9A 4XIUA 1Q8IA 3KKSA 3PY8A 2KZMA 1HYVA 1YTAA 4GVMA 1S6QA 1TKTA 5HRNA 3HP9A 3VQDA 3T3FA 4KHSA 3U3YA 2B6AA 1UWBA 1D8YA 4TSXA 3ZSRA 1EXQA 4FJHA 3AA5X 3OVNA 1RDCA 3O4QA 1CXQA 4CEDA 2Z1HA 4CF9A 3V9SA 2E6LA 4CEZA 2W42A 4BWMA 1TAUA 5HP1A 3HJFA 4AHRA 3HM9A 1RDAA 3HL8A 2HNDA 3OYAA 4DQSA 3SUOA 4HUGA 1FK9A 2F96A 1KVAA 4DQQA 4OLBA 2KTQA 4EP4A 4CFDA 4N41A 4F2RA 4KHUA 2ITGA 3A2FA 3M8PA 3PO5A 1SL1A 3AVCA 2RF2A 4OGEA 1HNVA 3ZSWA 4CF8A 3F73A 4DS5A 4B9TA 3CQ8A 3QEWA 4MFBA 3T19A 1VSLA 3S3NA 4M3XA 2X6SA 2DFFA 1WSIA 2ETJA 2ATQA 2YHAA 1C0MA 1WAFA 2Z1IA 3KIOA 4CF2A 3OJSA 2Y1IA 1HQUA 3HPGA 1JL1A 4J2BA 1HPZA 2OPRA 3OYBA 4DSEA 4CJFA 1SKWA 3S9HA 3ZSQA 1KVBA 2D5RA 5FDLA 3I0SA 4DTNA 2OYQA 4ELTA 3K5OA 2RPIA 4K8ZA 4M3TA 4CESA 4DSKA 2YHBA 3G0ZA 4DTPA 4CK2A 4Z4CA 1I39A 4CJQA 4F2SA 4DTXA 3LPUA 1RILA 4UQGA 3UIQA 4N56A 4ZTJA 4FJ7A 2P5GA 1RBRA 3NGZA 4KI4A 4PQUA 3OYGA 1UA0A 4DU4A 3B6OA 4JS5A 1CZ9A 1NK8A 3MECA 3TAGA 1LW0A 2HVIA 4E7HA 4QAGA 1WN7A 4H8KA 3ALYA 4CHPA 5KRTA 4E7IA 3KLGA 5DK5A 3RMAA 3QEVA 4FW1A 4O5BA 4FJNA 5FRMA 3ZT4A 3KD1E 3VQ4A 1KLNA 1REVA 1HRHA 2XY7A 3KTQA 1IH7A 1K6YA 2B5JA 4B9MA 1TKZA 3DLEA 2HB5A 1C6VA 3WNFA 4CGFA 4FW2A 3THVA 4CHNA 4Z4IA 2IS3A 4CJEA 4RW4A 3KK1A 2IAJA 2O4GA 1RBUA 2OPPA 3QO9A 4CJTA 4I2PA 3HSTB 3LP0A 3MXJA 1ZYQA 1T03A 4CEOA 1X9WA 1N6QA 4CJPA 4CHOA 1KRPA 1TKXA 4ELUA 3PX0A 4KPYA 3OS1A 2QKKA 2HHXA 1WAJA 1S1TA 4CEEA 1BQMA 1GOAA 1JLFA 4HHTA 3OYNA 1ASWA 4NYNA 4CHZA 3AVJA 4FLYA 5J2MA 1ZBIA 2R7YA 3HPOA 2VG6A 1WLJA 3KLHA 3M8RA 3VA3A 4DSLA 4KHQA 4AILC 3AVBA 4O4GA 2QK9A 3LZJA 4FZXC 4AHVA 4M45A 2ZE2A 3SV4A 3V9XA 1VSKA 2G8FA 4FLVA 3L2QA 4HVJA 2HHQA 4CGJA 3V1RA 3ZCMA 4W5OA 2HNYA 3C6UA 4RG8A 4CE9A 3VQ7A 4JRQA 1WSHA 2P5OA 3KLEA 3IAYA 3LANA 1KFSA 4KREA 4DG1A 1B9DA 3OYFA 1T7PA 1WSEA 3AO3A 4GW6A 3SQ2A 1O1WA 3CG7A 3PUFA 1VSJA 4B08A 1B92A 1QQCA 5EU7A 1L3TA 1S6PA 4AHTA 4CGDA 2G8KA 3DLBA 2GUIA 4FJJA 4J2DA 1NKCA 1HYSA 2Y1JA 1JXBA 5CZ1A 1BI4B 3AVNA 3HPHA 4B8AB 3QEIA 4HCCA 3TABA 4R5PA 4CJ3A 4B9LA 4PWDA 1RT3A 2G8HA 3MEGA 3RTVA 4DTSA 2VWKA 3QEXA 2FBYA 2OZSA 3DOKA 3DLGA 4H4OA 4CK1A 4DU3A 1J9AA 1JLBA 3SNNA 3TARA 5J2PA 1T8EA 1NKBA 2HHWA 3C95A 4OPJA 4JRPA 1J53A 4DFPA 3O4NA 5J2QA 3DI6A 3ITHA 1RT5A 4KI6A 4F8RA 2FC0A 1T05A 4FJIA 4DF4A 4B3OA 4B9SA 4FYDA 3HXMA 1TVRA 5JS2A 4FJ9A 1S1UA 1WSFA 3ZSOA 1VK0A 2EX3A 1L5UA 3MEDA 4DTRA 4KHNA 1IO2A 1B9FA 1KCFA 3AV9A 2KZZA 4O44A 4IFVA 2IC3A 4CERA 3OYKA 1L3SA 4EZ6A 4BDYA 3AVKA 4H4MA 4BE2A 1C0TA 2EHGA 4OJRA 3OYHA 1QSLA 1EKEA 5KI6A 4OLAA 3NFAA 3ZT3A 3OYMA 3D0PA 3QEPA 2PY5A 1QS4A 2BANA 3ZT1A 2RN2A 3PX6A 5K14A 3KK3A 4NYFA 4M3UA 1Z25A 2PYJA 1S9GA 4BACA 2YNFA 4NCAA 1HQEA 1BIZA 4CGIA 3DMJA 3K5NA 5CYQA 1NK0A 1D9DA 3M8QA 3ZT2A 4CJSA 3P1GA 1RT1A 1FXXA 5JS1A 4OKKA 1LWEA 4KHWA 4M3WA 3ULDA 1JLGA 2E6MA 1S1WA 2YV0X 3VQQA 1L3VA 2HVHA 2HW3A 1RNHA 1U49A 3HYFA 3ZSVA 4I2QA 4LD0A 3NCIA 1DLOA 3NE6A 1A5XA 3VQCA 3RMDA 1ZBLA 3IRXA 1HYZA 1QSSA 2OPQA 1VSMA 3M8SA 1TAQA 4ID5A 3O3FA 3TAMA 5J1EA 3DM2A 4FM0A 1NK9A 4FM1A 4IKFA 1QE1A 1IKWA 5J2NA 1A5WA 1S5JA 1TV6A 4FZYA 3LPTA 4RW7A 2IGIA 1U4BA 4FK4A 3TR8A 1CZBA 4CF1A 2DFHA 2XY5A 3LP2A 3KLFA 3K59A 3K2PA 3VA0A 2I5JA 4IDKA 3S3MA 1S1VA 5DMRA 3VQEA 4YFUA 1HMVA 5FROA 1U04A 1DTTA 3AO1A 5HRSA 4RW9A 4CEQA 3AVHA 2X78A 1NJXA 3LAKA 3SJJA 1WSGA 3C94A 2BGGA 2QXFA 4W5RA 3JSMA 1RT4A 2D0CA 3G10A 4Q0BA 3L3UA 1BCOA 4DTOA 1VSHA 4CIFA 5HRRA 4FVMA 4AH9A 5HROA 5D3GA 4EP5A 1QHTA 3OYCA 3V1OA 4WE1A 1U45A 1C1BA 2G8UA 3HK2A 3PO4A 3TANA 2D0BA 2RKIA 3DRRA 5HRPA 4E7KA 4E7LA 2A1RA 1X9MA 3ZSYA 3SZ2A 4DQIA 2KW4A 3L2WA 4E7JA 4RW8A 3KK2A 3QNOA 4Z4GA 1EETA 3SCXA 1GOCA 1XWLA 2X74A 4IG0A 4E89A 4CGHA 4FJXA 3V9WA 3KD5E 5CYMA 1X1PA 1TL3A 1ITGA 1KTQA 2YKNA 4CJ5A 4CK3A 3IS9A 4Y1DA 3EZ5A 4BDZA 1NJYA 4G1QA 4Z4EA 1RT7A 4FLWA 3NH0A 1NK6A 3WNHA 1TL1A 4C8MA 5I42A 5C42A 4B9VA 3NF6A 2JLEA 2QKBA 1TGOA 1HNIA 3CM5A 3KKRA 2VG7A 1SV5A 3S3OA 4B9NA 4N76A 3DRSA 4CJVA 4DFKA 4DQPA 3MXIA 3NH2A 4M42A 4KO0A 4LSLA 1J54A 4Y1CA 3VQ8A 1BQNA 5FRNA 3LALA 4MQ3A 1FKPA 1Z26A 3V81A 3MXMA 3DLRA 3L8BA 2BDPA 1BISA 5T7BA 4FJ5A 3SV3A 4M41A 2BE2A 1BHLA 4I9LA 4CFCA 3NDKA 1N5YA 4FJKA 3CYMA 4C8OA 3DYAA 3O3HA 1LW2A 2NUBA 5KTQA 4M3RA 2F8TA 1TK5A 2G8WA 1XHZA 1YTUA 1VSIA 1F21A 4C8KA 3QIPA 4O55A 3AVGA 1ZBUA 2XHBA 3ZSZA 4B8CA 3LAMA 4E1NA 3OYEA 3RRGA 3ZT0A 4OGCA 4DTJA 3RMBA 3SI6A 2KQ2A 4BE1A 4M3YA 2F8SA 2HMIA 4QCLA 1JLAA 1JLCA 3HVTA 1SKSA 4F3TA 4CIGA 4KKOA 1JLQA 4O0JA 3DLHA 4FZZA 1RDDA 4ZTFA 4CJRA 5KGXA 2HHTA 4HUEA 3QIOA 3QNNA 3SPZA 4KTWA 4K8XA 3QLHA 2YNHA 1TK8A 3V1QA 5I3UA 1UA1A 4Z4FA 3FFIA 1IKYA 2Z1JA 4N47A 4AHSA 4FJLA 4DTUA 3L3VA 1NJWA 1X9SA 3AA3A 3OYJA 3LWMA 3RR7A 1NK4A 4BE0A 3LZIA 2VG5A 3D45A 1IG9A 4W5NA 2DY4A 2X6NA 3AO4A 1WSJA 1HJRA 4DTMA 1A5VA 2OZMA 1S9EA 3DOLA 3P83D 2XO7A 3L2RA 4CFBA 3SUQA 4PUOA 3NF8A 3TAPA 2D0AA 4DLGA 4FM2A 3BGRA 1SL2A 2P1JA 3AA4A 4OVLA 2GBZA 1VSDA 3P5JA 5C25A 3VQAA 4CF0A 3LP1A 3QINA 1ZBHA 3IG1A 3NF9A 3VQPA 1Y97A 4CJWA 4CHYA 3K5LA 3TI0A 4I9QA 4HCBA 1RBVA 1ASUA 3ASMA 3MAQA 3SYZA 4I7FA 1LWFA 3SPYA 1TKDA 2IOCA 1C0UA 3F9KA 4CJUA 4FK2A 3HO1A 1LWCA 4NCBA 3VQ9A 4Q5VA 2PYLA 2HHVA 4CEAA 3OY9A 4FLXA 1LAVA 4FLZA 1SL0A 4F3OA 2OA8A 1C1CA 3CFPA 1JXEA 4NCGA 3WNGA 3OS2A 4CIEA 3LDSA 3OS0A 1NKEA 1KVCA 1RBSA 3AVLA 4KFBA 1RTIA 5CZ2A 4OKJA 2OPSA 1FKOA 4FXDA 4LSNA 4LH4A 3EY1A 3DRPA 4KAZA 1NOZA 1RT6A 5SZTA 1MU2A 1BGXT 1UOCA 1KFDA 4KTZA 4FLTA 2HHSA 2DTUA 1SUQA 4CEBA 1C1AA 2G8IA 3TWHA 3VQ6A 3NAEA 2HHUA 5SWMA 3RWUA 4CJKA 4J2EA 3V4IA 4GMJB 2XY8A 4CECA 2YKMA 3KJVA 1JL2A 5HLFA 4YNQA 1NK5A 3V9ZA 1I3AA 3PX4A 5CY4A 4E1MA 4AHUA 2ZD1A 2WOMA 1KSPA 3RRHA 1NOYA 1SKRA 3VQBA 4KB1A 3T1AA 4CJ4A 2PZSA 1RCHA 4JLHA 4KV8A 4OPKA 2IDOA 1JKHA 2A1SA 4PY5A 3NGYA 1UAXA 4OKEA 4FJGA 1Q9YA 1RTHA 1CXUA 1NJZA 4ICLA 3L2UA 1W0HA 1ASVA 1R0AA 3L2VA 4DS4A 4ZHRA 4IBNA 3ZSXA 1U47A 1TK0A 1RTDA 4ID1A 4FCYA 4CEFA 2AJQA 2JGUA 1G15A 2KFZA 5KRSA 1VRTA 4DLEA 4DFJA 5KGWA 3K5MA 1VRUA 3NGIA 2XRIA 1EX4A 3AVIA 3QESA 3E01A 1LAWA 3NHGA 1LV5A 4KHYA 4DMNA 1J5OA 4CHQA 3HVRA 1S1XA 2WONA 4DSFA 3HP6A 3RMCA 4DFMA 4KRFA 4BWJA 3OJUA 3TAEA 2FBTA 4M3ZA 1RDBA 4HTUA 1BI4A 1RT2A 3EYZA 4DWIA 4FK0A 4AHCA 2FBXA 4Z4HA 3MEEA 5HBMA 4RW6A 1BIUA 1VSEA 4LH5A 4W5QA 4DSJA 1XHXA 3AVFA 4ELVA 2HNZA 3JYTA 4E0DA 2FBVA 3ISNC 3KLIA 3HT3A 1Q9XA 4KB0A 2KFNA 3H08A 2DFEA 3V6DA 4N5SA 2Q3SA 1QSYA 3LP3A 2G8VA 3AO5A 3U3GA 3AO2A 3TAQA 4FJMA 1IKXA 4F4KA 3OYIA 2VWJA 3CFRA 3SQ4A 1RTJA 1QTMA 2ZQBA 1EP4A 5C24A 3LWLA 4HUFA 1NK7A 3AVMA 2YNGA 3K57A 4C8LA 1DTQA 1RBTA 4CGGA 3VQ5A 4W5TA 4JS4A 4CFAA 3DLKA 4IG3A 1WNSA 3VN5A 1VSFA 3SQ0A 3SQ1A 4J2AA 2XY6A 4QOZB 3AA2A 3NF7A 5E41A 3BDPA 3PV8A 3RR8A 3O3GA 4DF8A 2B4JA 4O0IA 3I0RA 3AVAA 3SUPA 4L8RB 4Z0UA 4CCHA 3B6PA 3C6TA 3QERA 4EZ9A 1JLEA 2Z1GA 4E3SA 1GOBA 2E4LA 3QETA 1KLMA 2O4IA 3NH1A 1IKVA 1XC9A 3I8DA 2LSNA 4IFYA 3OYDA 1D9FA 3SUNA 1YVUA 3NBPA 4DQRA 1BL3A 2YNIA 1U48A 1BCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLQ A;  1L3U A;  4E19 A;  1ZBF A;  4BDP A;  4CJL A;  3OYL A;  4B9U A;  1XI1 A;  4DSI A;  4KTQ A;  2P51 A;  3K58 A;  4LY7 A;  4FLU A;  3CFO A;  4DU1 A;  1W9H A;  3V9U A;  1D5A A;  4PA1 A;  3CM6 A;  3U6F A;  3TAF A;  4FJ8 A;  1YT3 A;  3WNE A;  4C8N A;  2GV9 A;  4XIU A;  1Q8I A;  3KKS A;  3PY8 A;  2KZM A;  1HYV A;  1YTA A;  4GVM A;  1S6Q A;  1TKT A;  5HRN A;  3HP9 A;  3VQD A;  3T3F A;  4KHS A;  3U3Y A;  2B6A A;  1UWB A;  1D8Y A;  4TSX A;  3ZSR A;  1EXQ A;  4FJH A;  3AA5 X;  3OVN A;  1RDC A;  3O4Q A;  1CXQ A;  4CED A;  2Z1H A;  4CF9 A;  3V9S A;  2E6L A;  4CEZ A;  2W42 A;  4BWM A;  1TAU A;  5HP1 A;  3HJF A;  4AHR A;  3HM9 A;  1RDA A;  3HL8 A;  2HND A;  3OYA A;  4DQS A;  3SUO A;  4HUG A;  1FK9 A;  2F96 A;  1KVA A;  4DQQ A;  4OLB A;  2KTQ A;  4EP4 A;  4CFD A;  4N41 A;  4F2R A;  4KHU A;  2ITG A;  3A2F A;  3M8P A;  3PO5 A;  1SL1 A;  3AVC A;  2RF2 A;  4OGE A;  1HNV A;  3ZSW A;  4CF8 A;  3F73 A;  4DS5 A;  4B9T A;  3CQ8 A;  3QEW A;  4MFB A;  3T19 A;  1VSL A;  3S3N A;  4M3X A;  2X6S A;  2DFF A;  1WSI A;  2ETJ A;  2ATQ A;  2YHA A;  1C0M A;  1WAF A;  2Z1I A;  3KIO A;  4CF2 A;  3OJS A;  2Y1I A;  1HQU A;  3HPG A;  1JL1 A;  4J2B A;  1HPZ A;  2OPR A;  3OYB A;  4DSE A;  4CJF A;  1SKW A;  3S9H A;  3ZSQ A;  1KVB A;  2D5R A;  5FDL A;  3I0S A;  4DTN A;  2OYQ A;  4ELT A;  3K5O A;  2RPI A;  4K8Z A;  4M3T A;  4CES A;  4DSK A;  2YHB A;  3G0Z A;  4DTP A;  4CK2 A;  4Z4C A;  1I39 A;  4CJQ A;  4F2S A;  4DTX A;  3LPU A;  1RIL A;  4UQG A;  3UIQ A;  4N56 A;  4ZTJ A;  4FJ7 A;  2P5G A;  1RBR A;  3NGZ A;  4KI4 A;  4PQU A;  3OYG A;  1UA0 A;  4DU4 A;  3B6O A;  4JS5 A;  1CZ9 A;  1NK8 A;  3MEC A;  3TAG A;  1LW0 A;  2HVI A;  4E7H A;  4QAG A;  1WN7 A;  4H8K A;  3ALY A;  4CHP A;  5KRT A;  4E7I A;  3KLG A;  5DK5 A;  3RMA A;  3QEV A;  4FW1 A;  4O5B A;  4FJN A;  5FRM A;  3ZT4 A;  3KD1 E;  3VQ4 A;  1KLN A;  1REV A;  1HRH A;  2XY7 A;  3KTQ A;  1IH7 A;  1K6Y A;  2B5J A;  4B9M A;  1TKZ A;  3DLE A;  2HB5 A;  1C6V A;  3WNF A;  4CGF A;  4FW2 A;  3THV A;  4CHN A;  4Z4I A;  2IS3 A;  4CJE A;  4RW4 A;  3KK1 A;  2IAJ A;  2O4G A;  1RBU A;  2OPP A;  3QO9 A;  4CJT A;  4I2P A;  3HST B;  3LP0 A;  3MXJ A;  1ZYQ A;  1T03 A;  4CEO A;  1X9W A;  1N6Q A;  4CJP A;  4CHO A;  1KRP A;  1TKX A;  4ELU A;  3PX0 A;  4KPY A;  3OS1 A;  2QKK A;  2HHX A;  1WAJ A;  1S1T A;  4CEE A;  1BQM A;  1GOA A;  1JLF A;  4HHT A;  3OYN A;  1ASW A;  4NYN A;  4CHZ A;  3AVJ A;  4FLY A;  5J2M A;  1ZBI A;  2R7Y A;  3HPO A;  2VG6 A;  1WLJ A;  3KLH A;  3M8R A;  3VA3 A;  4DSL A;  4KHQ A;  4AIL C;  3AVB A;  4O4G A;  2QK9 A;  3LZJ A;  4FZX C;  4AHV A;  4M45 A;  2ZE2 A;  3SV4 A;  3V9X A;  1VSK A;  2G8F A;  4FLV A;  3L2Q A;  4HVJ A;  2HHQ A;  4CGJ A;  3V1R A;  3ZCM A;  4W5O A;  2HNY A;  3C6U A;  4RG8 A;  4CE9 A;  3VQ7 A;  4JRQ A;  1WSH A;  2P5O A;  3KLE A;  3IAY A;  3LAN A;  1KFS A;  4KRE A;  4DG1 A;  1B9D A;  3OYF A;  1T7P A;  1WSE A;  3AO3 A;  4GW6 A;  3SQ2 A;  1O1W A;  3CG7 A;  3PUF A;  1VSJ A;  4B08 A;  1B92 A;  1QQC A;  5EU7 A;  1L3T A;  1S6P A;  4AHT A;  4CGD A;  2G8K A;  3DLB A;  2GUI A;  4FJJ A;  4J2D A;  1NKC A;  1HYS A;  2Y1J A;  1JXB A;  5CZ1 A;  1BI4 B;  3AVN A;  3HPH A;  4B8A B;  3QEI A;  4HCC A;  3TAB A;  4R5P A;  4CJ3 A;  4B9L A;  4PWD A;  1RT3 A;  2G8H A;  3MEG A;  3RTV A;  4DTS A;  2VWK A;  3QEX A;  2FBY A;  2OZS A;  3DOK A;  3DLG A;  4H4O A;  4CK1 A;  4DU3 A;  1J9A A;  1JLB A;  3SNN A;  3TAR A;  5J2P A;  1T8E A;  1NKB A;  2HHW A;  3C95 A;  4OPJ A;  4JRP A;  1J53 A;  4DFP A;  3O4N A;  5J2Q A;  3DI6 A;  3ITH A;  1RT5 A;  4KI6 A;  4F8R A;  2FC0 A;  1T05 A;  4FJI A;  4DF4 A;  4B3O A;  4B9S A;  4FYD A;  3HXM A;  1TVR A;  5JS2 A;  4FJ9 A;  1S1U A;  1WSF A;  3ZSO A;  1VK0 A;  2EX3 A;  1L5U A;  3MED A;  4DTR A;  4KHN A;  1IO2 A;  1B9F A;  1KCF A;  3AV9 A;  2KZZ A;  4O44 A;  4IFV A;  2IC3 A;  4CER A;  3OYK A;  1L3S A;  4EZ6 A;  4BDY A;  3AVK A;  4H4M A;  4BE2 A;  1C0T A;  2EHG A;  4OJR A;  3OYH A;  1QSL A;  1EKE A;  5KI6 A;  4OLA A;  3NFA A;  3ZT3 A;  3OYM A;  3D0P A;  3QEP A;  2PY5 A;  1QS4 A;  2BAN A;  3ZT1 A;  2RN2 A;  3PX6 A;  5K14 A;  3KK3 A;  4NYF A;  4M3U A;  1Z25 A;  2PYJ A;  1S9G A;  4BAC A;  2YNF A;  4NCA A;  1HQE A;  1BIZ A;  4CGI A;  3DMJ A;  3K5N A;  5CYQ A;  1NK0 A;  1D9D A;  3M8Q A;  3ZT2 A;  4CJS A;  3P1G A;  1RT1 A;  1FXX A;  5JS1 A;  4OKK A;  1LWE A;  4KHW A;  4M3W A;  3ULD A;  1JLG A;  2E6M A;  1S1W A;  2YV0 X;  3VQQ A;  1L3V A;  2HVH A;  2HW3 A;  1RNH A;  1U49 A;  3HYF A;  3ZSV A;  4I2Q A;  4LD0 A;  3NCI A;  1DLO A;  3NE6 A;  1A5X A;  3VQC A;  3RMD A;  1ZBL A;  3IRX A;  1HYZ A;  1QSS A;  2OPQ A;  1VSM A;  3M8S A;  1TAQ A;  4ID5 A;  3O3F A;  3TAM A;  5J1E A;  3DM2 A;  4FM0 A;  1NK9 A;  4FM1 A;  4IKF A;  1QE1 A;  1IKW A;  5J2N A;  1A5W A;  1S5J A;  1TV6 A;  4FZY A;  3LPT A;  4RW7 A;  2IGI A;  1U4B A;  4FK4 A;  3TR8 A;  1CZB A;  4CF1 A;  2DFH A;  2XY5 A;  3LP2 A;  3KLF A;  3K59 A;  3K2P A;  3VA0 A;  2I5J A;  4IDK A;  3S3M A;  1S1V A;  5DMR A;  3VQE A;  4YFU A;  1HMV A;  5FRO A;  1U04 A;  1DTT A;  3AO1 A;  5HRS A;  4RW9 A;  4CEQ A;  3AVH A;  2X78 A;  1NJX A;  3LAK A;  3SJJ A;  1WSG A;  3C94 A;  2BGG A;  2QXF A;  4W5R A;  3JSM A;  1RT4 A;  2D0C A;  3G10 A;  4Q0B A;  3L3U A;  1BCO A;  4DTO A;  1VSH A;  4CIF A;  5HRR A;  4FVM A;  4AH9 A;  5HRO A;  5D3G A;  4EP5 A;  1QHT A;  3OYC A;  3V1O A;  4WE1 A;  1U45 A;  1C1B A;  2G8U A;  3HK2 A;  3PO4 A;  3TAN A;  2D0B A;  2RKI A;  3DRR A;  5HRP A;  4E7K A;  4E7L A;  2A1R A;  1X9M A;  3ZSY A;  3SZ2 A;  4DQI A;  2KW4 A;  3L2W A;  4E7J A;  4RW8 A;  3KK2 A;  3QNO A;  4Z4G A;  1EET A;  3SCX A;  1GOC A;  1XWL A;  2X74 A;  4IG0 A;  4E89 A;  4CGH A;  4FJX A;  3V9W A;  3KD5 E;  5CYM A;  1X1P A;  1TL3 A;  1ITG A;  1KTQ A;  2YKN A;  4CJ5 A;  4CK3 A;  3IS9 A;  4Y1D A;  3EZ5 A;  4BDZ A;  1NJY A;  4G1Q A;  4Z4E A;  1RT7 A;  4FLW A;  3NH0 A;  1NK6 A;  3WNH A;  1TL1 A;  4C8M A;  5I42 A;  5C42 A;  4B9V A;  3NF6 A;  2JLE A;  2QKB A;  1TGO A;  1HNI A;  3CM5 A;  3KKR A;  2VG7 A;  1SV5 A;  3S3O A;  4B9N A;  4N76 A;  3DRS A;  4CJV A;  4DFK A;  4DQP A;  3MXI A;  3NH2 A;  4M42 A;  4KO0 A;  4LSL A;  1J54 A;  4Y1C A;  3VQ8 A;  1BQN A;  5FRN A;  3LAL A;  4MQ3 A;  1FKP A;  1Z26 A;  3V81 A;  3MXM A;  3DLR A;  3L8B A;  2BDP A;  1BIS A;  5T7B A;  4FJ5 A;  3SV3 A;  4M41 A;  2BE2 A;  1BHL A;  4I9L A;  4CFC A;  3NDK A;  1N5Y A;  4FJK A;  3CYM A;  4C8O A;  3DYA A;  3O3H A;  1LW2 A;  2NUB A;  5KTQ A;  4M3R A;  2F8T A;  1TK5 A;  2G8W A;  1XHZ A;  1YTU A;  1VSI A;  1F21 A;  4C8K A;  3QIP A;  4O55 A;  3AVG A;  1ZBU A;  2XHB A;  3ZSZ A;  4B8C A;  3LAM A;  4E1N A;  3OYE A;  3RRG A;  3ZT0 A;  4OGC A;  4DTJ A;  3RMB A;  3SI6 A;  2KQ2 A;  4BE1 A;  4M3Y A;  2F8S A;  2HMI A;  4QCL A;  1JLA A;  1JLC A;  3HVT A;  1SKS A;  4F3T A;  4CIG A;  4KKO A;  1JLQ A;  4O0J A;  3DLH A;  4FZZ A;  1RDD A;  4ZTF A;  4CJR A;  5KGX A;  2HHT A;  4HUE A;  3QIO A;  3QNN A;  3SPZ A;  4KTW A;  4K8X A;  3QLH A;  2YNH A;  1TK8 A;  3V1Q A;  5I3U A;  1UA1 A;  4Z4F A;  3FFI A;  1IKY A;  2Z1J A;  4N47 A;  4AHS A;  4FJL A;  4DTU A;  3L3V A;  1NJW A;  1X9S A;  3AA3 A;  3OYJ A;  3LWM A;  3RR7 A;  1NK4 A;  4BE0 A;  3LZI A;  2VG5 A;  3D45 A;  1IG9 A;  4W5N A;  2DY4 A;  2X6N A;  3AO4 A;  1WSJ A;  1HJR A;  4DTM A;  1A5V A;  2OZM A;  1S9E A;  3DOL A;  3P83 D;  2XO7 A;  3L2R A;  4CFB A;  3SUQ A;  4PUO A;  3NF8 A;  3TAP A;  2D0A A;  4DLG A;  4FM2 A;  3BGR A;  1SL2 A;  2P1J A;  3AA4 A;  4OVL A;  2GBZ A;  1VSD A;  3P5J A;  5C25 A;  3VQA A;  4CF0 A;  3LP1 A;  3QIN A;  1ZBH A;  3IG1 A;  3NF9 A;  3VQP A;  1Y97 A;  4CJW A;  4CHY A;  3K5L A;  3TI0 A;  4I9Q A;  4HCB A;  1RBV A;  1ASU A;  3ASM A;  3MAQ A;  3SYZ A;  4I7F A;  1LWF A;  3SPY A;  1TKD A;  2IOC A;  1C0U A;  3F9K A;  4CJU A;  4FK2 A;  3HO1 A;  1LWC A;  4NCB A;  3VQ9 A;  4Q5V A;  2PYL A;  2HHV A;  4CEA A;  3OY9 A;  4FLX A;  1LAV A;  4FLZ A;  1SL0 A;  4F3O A;  2OA8 A;  1C1C A;  3CFP A;  1JXE A;  4NCG A;  3WNG A;  3OS2 A;  4CIE A;  3LDS A;  3OS0 A;  1NKE A;  1KVC A;  1RBS A;  3AVL A;  4KFB A;  1RTI A;  5CZ2 A;  4OKJ A;  2OPS A;  1FKO A;  4FXD A;  4LSN A;  4LH4 A;  3EY1 A;  3DRP A;  4KAZ A;  1NOZ A;  1RT6 A;  5SZT A;  1MU2 A;  1BGX T;  1UOC A;  1KFD A;  4KTZ A;  4FLT A;  2HHS A;  2DTU A;  1SUQ A;  4CEB A;  1C1A A;  2G8I A;  3TWH A;  3VQ6 A;  3NAE A;  2HHU A;  5SWM A;  3RWU A;  4CJK A;  4J2E A;  3V4I A;  4GMJ B;  2XY8 A;  4CEC A;  2YKM A;  3KJV A;  1JL2 A;  5HLF A;  4YNQ A;  1NK5 A;  3V9Z A;  1I3A A;  3PX4 A;  5CY4 A;  4E1M A;  4AHU A;  2ZD1 A;  2WOM A;  1KSP A;  3RRH A;  1NOY A;  1SKR A;  3VQB A;  4KB1 A;  3T1A A;  4CJ4 A;  2PZS A;  1RCH A;  4JLH A;  4KV8 A;  4OPK A;  2IDO A;  1JKH A;  2A1S A;  4PY5 A;  3NGY A;  1UAX A;  4OKE A;  4FJG A;  1Q9Y A;  1RTH A;  1CXU A;  1NJZ A;  4ICL A;  3L2U A;  1W0H A;  1ASV A;  1R0A A;  3L2V A;  4DS4 A;  4ZHR A;  4IBN A;  3ZSX A;  1U47 A;  1TK0 A;  1RTD A;  4ID1 A;  4FCY A;  4CEF A;  2AJQ A;  2JGU A;  1G15 A;  2KFZ A;  5KRS A;  1VRT A;  4DLE A;  4DFJ A;  5KGW A;  3K5M A;  1VRU A;  3NGI A;  2XRI A;  1EX4 A;  3AVI A;  3QES A;  3E01 A;  1LAW A;  3NHG A;  1LV5 A;  4KHY A;  4DMN A;  1J5O A;  4CHQ A;  3HVR A;  1S1X A;  2WON A;  4DSF A;  3HP6 A;  3RMC A;  4DFM A;  4KRF A;  4BWJ A;  3OJU A;  3TAE A;  2FBT A;  4M3Z A;  1RDB A;  4HTU A;  1BI4 A;  1RT2 A;  3EYZ A;  4DWI A;  4FK0 A;  4AHC A;  2FBX A;  4Z4H A;  3MEE A;  5HBM A;  4RW6 A;  1BIU A;  1VSE A;  4LH5 A;  4W5Q A;  4DSJ A;  1XHX A;  3AVF A;  4ELV A;  2HNZ A;  3JYT A;  4E0D A;  2FBV A;  3ISN C;  3KLI A;  3HT3 A;  1Q9X A;  4KB0 A;  2KFN A;  3H08 A;  2DFE A;  3V6D A;  4N5S A;  2Q3S A;  1QSY A;  3LP3 A;  2G8V A;  3AO5 A;  3U3G A;  3AO2 A;  3TAQ A;  4FJM A;  1IKX A;  4F4K A;  3OYI A;  2VWJ A;  3CFR A;  3SQ4 A;  1RTJ A;  1QTM A;  2ZQB A;  1EP4 A;  5C24 A;  3LWL A;  4HUF A;  1NK7 A;  3AVM A;  2YNG A;  3K57 A;  4C8L A;  1DTQ A;  1RBT A;  4CGG A;  3VQ5 A;  4W5T A;  4JS4 A;  4CFA A;  3DLK A;  4IG3 A;  1WNS A;  3VN5 A;  1VSF A;  3SQ0 A;  3SQ1 A;  4J2A A;  2XY6 A;  4QOZ B;  3AA2 A;  3NF7 A;  5E41 A;  3BDP A;  3PV8 A;  3RR8 A;  3O3G A;  4DF8 A;  2B4J A;  4O0I A;  3I0R A;  3AVA A;  3SUP A;  4L8R B;  4Z0U A;  4CCH A;  3B6P A;  3C6T A;  3QER A;  4EZ9 A;  1JLE A;  2Z1G A;  4E3S A;  1GOB A;  2E4L A;  3QET A;  1KLM A;  2O4I A;  3NH1 A;  1IKV A;  1XC9 A;  3I8D A;  2LSN A;  4IFY A;  3OYD A;  1D9F A;  3SUN A;  1YVU A;  3NBP A;  4DQR A;  1BL3 A;  2YNI A;  1U48 A;  1BCM A; 
#chains in the Genus database with same CATH topology
 4E19 A;  2ZWH A;  1ZBF A;  4CJL A;  4DSI A;  1P90 A;  4IEI A;  4LY7 A;  3CFO A;  4DU1 A;  1D5A A;  3CM6 A;  1OH7 A;  4XIU A;  3PY8 A;  2KZM A;  4GV9 A;  1BA0 A;  3U3Y A;  3ZSR A;  4DTR A;  3V9S A;  4CF9 A;  1CXQ A;  3O4W A;  3CC4 N;  4AHR A;  1RDA A;  4JAX A;  4IJN A;  4A5A A;  4DQS A;  3SUO A;  1KVA A;  2KTQ A;  4DKW A;  4EFH A;  4WFA L;  4F2R A;  2ITG A;  4KHU A;  1XNQ K;  1QHA A;  4DS5 A;  1NWK A;  3H45 C;  4IO9 L;  3S3N A;  1WSI A;  2ETJ A;  2P9I A;  2YHA A;  3FGU A;  3HPG A;  4J2B A;  4DSE A;  4CJF A;  1SKW A;  5BRE A;  4LF8 K;  4DTN A;  4ELT A;  2RPI A;  4K8Z A;  4HTL A;  2YHB A;  3J7Y P;  4CK2 A;  1I39 A;  3CJ1 A;  4JKC A;  3IUC A;  5AQT A;  4N56 A;  2P5G A;  1RBR A;  4KI4 A;  3OYG A;  3B6O A;  4JS5 A;  1CZ9 A;  2HVI A;  4E7I A;  3KLG A;  3PIP L;  5DK5 A;  3S41 A;  3F5T A;  4NB4 A;  1REV A;  3T1Y K;  3IKM A;  3H1Q A;  1K6Y A;  2O8B A;  2YX6 A;  3FZL A;  4DV5 K;  4Z4I A;  4CJE A;  1Z6R A;  4CZG A;  3QO9 A;  1ZYQ A;  4I2P A;  4NXM K;  5BRD A;  4XH5 A;  1IJJ A;  2O8F A;  4CHO A;  1KRP A;  4KPY A;  3WXI A;  1JLF A;  4HHT A;  1ASW A;  2R7Y A;  3VA3 A;  3MWT A;  5TKW A;  4DV1 K;  4AHV A;  5KPT A;  3SV4 A;  5LMN K;  1YJ9 N;  1BDG A;  1V4T A;  4HVJ A;  2HHQ A;  4M7Y A;  1IV0 A;  2HNY A;  4RG8 A;  4JRQ A;  4QS7 A;  3IAY A;  3KLE A;  3CHW A;  3OYF A;  1NGF A;  4BR7 A;  4K0K K;  3CG7 A;  3U8X A;  1VSJ A;  4C1N K;  1QQC A;  1L3T A;  4YOY A;  2G8K A;  4FJJ A;  4CGD A;  2E5L K;  2GUI A;  1NKC A;  2Y1J A;  1BG3 A;  3SBT A;  3QEI A;  4B8A B;  3UKU A;  4A62 A;  1VQO N;  4R5P A;  2WUS A;  4CD3 A;  1NG9 A;  4DUZ K;  2ZGZ A;  3DLG A;  5JMV A;  4A59 A;  1XUP O;  1J9A A;  1T8E A;  4JI0 K;  2W40 A;  2HHW A;  4CZJ A;  5HL7 L;  1Q82 O;  4OPJ A;  4JRP A;  1RT5 A;  1TUU A;  1T05 A;  1XMQ K;  4B3O A;  4FYD A;  2EX3 A;  4JKB A;  3MED A;  4DV4 K;  2KZZ A;  4O44 A;  4BY9 C;  2EHG A;  1IG8 A;  4OJR A;  1QSL A;  3WXM B;  3E66 A;  2BAN A;  3PX6 A;  3KK3 A;  4NYF A;  1S9G A;  1WUA A;  5CYQ A;  3M8Q A;  4YOU A;  4CJS A;  5HOO A;  4LF4 K;  4JKF A;  4OKK A;  4K41 A;  3IMX A;  4BQL A;  4KHW A;  3VEO A;  4AM7 A;  4M3W A;  2YV0 X;  2HVH A;  3EL2 A;  1U49 A;  3FZF A;  4LD0 A;  3VER A;  1VQL N;  3WXL A;  1HYZ A;  1QSS A;  1VSM A;  4FM0 A;  3PIO L;  4IKF A;  1GLJ O;  5J2N A;  1S5J A;  2OCE A;  2O8C B;  4QS8 A;  4BRH A;  5AZJ B;  1U4B A;  3TR8 A;  1NGI A;  1CZB A;  3CQY A;  3O08 A;  3O8M A;  3K59 A;  3K2P A;  4DR4 K;  5AQI A;  4DV0 K;  1DKG D;  1U04 A;  5FRO A;  1RDW X;  5HRS A;  4RW9 A;  3NMU A;  3KHY A;  3AVH A;  3SJJ A;  3C94 A;  3LDQ A;  4DTO A;  4A5B A;  4JK9 A;  4JD2 B;  4CIF A;  4LF9 K;  4AH9 A;  3DLL L;  5D3G A;  1C1B A;  3TAN A;  4E7K A;  3MCP A;  3SZ2 A;  3M1F A;  4CZI A;  4E7J A;  2PBD A;  3QNO A;  4Z4G A;  4YOW A;  1GOC A;  3QFU A;  1XWL A;  2X74 A;  3BUZ B;  4IG0 A;  4CGH A;  5CYM A;  4FOE A;  1KC8 O;  4FVU A;  1TL3 A;  4BDZ A;  4CJ5 A;  3IS9 A;  3I33 A;  5H1S Q;  2UU9 K;  1S72 N;  2HBM A;  2JLE A;  1TGO A;  3CM5 A;  3KKR A;  2VG7 A;  4N76 A;  3TPQ A;  4ILH A;  3DRS A;  3WT0 A;  4GY2 B;  3NH2 A;  4M42 A;  4KO0 A;  4O8K A;  4H5R A;  4F9O A;  1FKP A;  5EOY A;  2NRW A;  3L8B A;  2BDP A;  3NVM A;  2BE2 A;  4I9L A;  4CFC A;  3NDK A;  1N5Y A;  3HRG A;  4C8O A;  3DYA A;  1LW2 A;  2JWL A;  2D0O A;  5KTQ A;  1DEJ A;  1XHZ A;  4BRD A;  3VEV A;  4O55 A;  2P9U B;  3LAM A;  4E1N A;  4JKE A;  4DTJ A;  2F8S A;  3HVT A;  4JKG A;  4KKO A;  4O0J A;  5KGX A;  3VOV A;  2QWM A;  2Q0R A;  1GLL O;  1Y64 A;  3QLH A;  4Z4F A;  1GLF O;  4AHS A;  1NJW A;  3AA3 A;  2GTD A;  3RR7 A;  4BE0 A;  2GUP A;  2VG5 A;  5ADX H;  2X6N A;  2P9K B;  3FZM A;  3ZEU B;  2KKZ A;  1A5V A;  3DWL A;  2OZM A;  5IT9 O;  1NNE A;  4CFB A;  1GLE G;  3TAP A;  4FM2 A;  3R9P A;  2P1J A;  5MLC Q;  3AA4 A;  2GBZ A;  5AQV A;  4GKK K;  3IG1 A;  3VQP A;  1TYQ B;  2WBN A;  4CJW A;  1RBV A;  4I7F A;  4YOV A;  2OTJ N;  3F9K A;  4YDU C;  1OH8 A;  3EO3 A;  3A5M C;  3OY9 A;  4FLZ A;  4BC5 A;  1K9M O;  3CFP A;  1JXE A;  3OS2 A;  4CIE A;  3I56 N;  3LDS A;  1NKE A;  1KVC A;  1RBS A;  1GLB G;  5JVG L;  2VYP A;  1H1V A;  1NOZ A;  5SZT A;  3EE9 A;  5GAE P;  2G8I A;  3VQ6 A;  5LMU K;  1TUY A;  2HHU A;  5SWM A;  3PSF A;  2PFU A;  1JJ2 M;  2A5X A;  4O5F A;  3VF2 A;  5DM6 L;  1M90 O;  5DM7 L;  4JV5 K;  1KSP A;  2ZD1 A;  1SKR A;  2O8E B;  4CJ4 A;  1RCH A;  2IDO A;  5KQD A;  5BPN A;  1YIJ N;  1EWR A;  4BR0 A;  1NJZ A;  1NGG A;  4DV2 K;  4ICL A;  4DV3 K;  1ASV A;  3L2V A;  2QW9 A;  3MX2 A;  4IOA L;  4BR9 A;  2JGU A;  1G15 A;  4BRC A;  1Q86 O;  4B1V A;  4DLE A;  4DFJ A;  3K5M A;  2UYT A;  4UY8 O;  3NHG A;  3HVR A;  4BRO A;  3RMC A;  3OJU A;  2E1Y A;  1RDB A;  3O9T A;  3EYZ A;  2P9P A;  4FK0 A;  4Z4H A;  3MEE A;  2AA4 A;  1BIU A;  2O8B B;  3CCM N;  2F4V K;  3SAG A;  3AVF A;  5E84 A;  1J6Z A;  2KFN A;  1OH6 A;  4NXN K;  2DFE A;  2BUP A;  4WYB A;  1QSY A;  2G8V A;  3LP3 A;  4LFB K;  2O8F B;  4XEI A;  5JLH A;  4FJM A;  1IKX A;  3OYI A;  2VWJ A;  4GNI A;  2HBJ A;  2IIR A;  3AVM A;  2YNG A;  3EKU A;  4CGG A;  1RBT A;  3ATU A;  4W5T A;  3CCR N;  3T7Z A;  3VN5 A;  4WFB L;  2D4W A;  4QOZ B;  5FPE A;  2W6L A;  4DF8 A;  2BH1 A;  3UE5 A;  3SUP A;  3QER A;  4EZ9 A;  1JLE A;  2Z1G A;  1GOB A;  2E4L A;  4IJA A;  3ZX0 A;  4X64 K;  3THY A;  1HR0 K;  2KLA A;  3O1B A;  3MN5 A;  3SUN A;  1YVU A;  1MDU B;  4WQ4 C;  3UKU B;  2CH5 A;  5GAD P;  4BDP A;  5C0Y A;  2QWL A;  4KTQ A;  1W97 L;  4H5W A;  4C8N A;  2GV9 A;  4DR6 K;  1M1K O;  5BR9 A;  1HYV A;  1YTA A;  5HRN A;  4XH4 A;  1EXQ A;  4FJH A;  3AA5 X;  3OVN A;  1RDC A;  4CED A;  1X9J A;  2E6L A;  4IXC A;  2W42 A;  4E1J A;  3E1Y A;  1VQ7 N;  2HND A;  2F96 A;  3O9U A;  4CFD A;  4N41 A;  2QI2 A;  5BRF A;  2W6K A;  4OGE A;  4CF8 A;  3F73 A;  2NRH A;  3QEW A;  1VSL A;  4FWR A;  4M3X A;  2X6S A;  2ATQ A;  4CZH A;  2Z1I A;  3FR0 A;  2Y1I A;  1JL1 A;  4PL7 A;  1HPZ A;  1HLU A;  3O9R A;  2A42 A;  2AP1 A;  2D5R A;  3K5O A;  4LFA K;  4M3T A;  4DSK A;  3BP8 A;  3AAP A;  3LPU A;  1RIL A;  4PQU A;  2FF6 A;  3BY5 A;  3MK6 A;  3NGZ A;  1W7A A;  1NK8 A;  1WN7 A;  4MLH A;  3ALY A;  4H8K A;  4CHP A;  5BPL A;  3VEN A;  3CCV N;  4JK8 A;  3TTC A;  4B1W B;  1KLN A;  4BRM A;  1NMN A;  1IH7 A;  2B5J A;  5M1Q A;  1C6V A;  3M5R A;  1SZ2 A;  4JI6 K;  3A5L C;  4PL8 A;  4BR4 A;  1RBU A;  3CCJ N;  4AM6 A;  3MXJ A;  1T03 A;  4CEO A;  1X9W A;  3PX0 A;  4BGB A;  2HHX A;  4CEE A;  4BRQ A;  4CHZ A;  4NYN A;  3THX A;  3AVJ A;  1ZBI A;  3H1V X;  3DXK B;  3HPO A;  3MN7 A;  3M8R A;  3KVG A;  4ILG B;  2QK9 A;  3LZJ A;  4FZX C;  2QWR A;  4M45 A;  2V52 B;  3V9X A;  1VSK A;  4FOI A;  1NMD A;  1HKC A;  3ZCM A;  4W5O A;  3C6U A;  3KZB A;  4MDB A;  1WSH A;  1KFS A;  1QZ6 A;  4FWS A;  4IOX A;  1B9D A;  3HBT A;  3AO3 A;  1K8K B;  4JI2 K;  4NLB A;  2VCP A;  3R8E A;  4EIA A;  1O1W A;  2ZJP L;  1YHQ N;  1B92 A;  1VQ5 N;  3DLB A;  1S6P A;  3HM8 A;  5GAG P;  5CZ1 A;  3AVN A;  3HPH A;  2YCH A;  5AQF A;  1RT3 A;  2G8H A;  3RTV A;  4DTS A;  3HOT A;  4CZK A;  2FBY A;  2OZS A;  3DOK A;  4CK1 A;  1Z05 A;  4FWQ A;  3SNN A;  3TAR A;  5J2P A;  4NO7 A;  4BGA A;  1J53 A;  5J2Q A;  4FWO A;  4F8R A;  4FJI A;  4DF4 A;  4B9S A;  4ISG A;  3HXM A;  1TVR A;  1KAX A;  1WSF A;  3VGL A;  1W2B M;  4JKG B;  4KHN A;  1B9F A;  1KCF A;  3AV9 A;  5CR4 A;  4CER A;  3TSP A;  4OPH A;  4H03 B;  3C6A A;  3AVK A;  1C0T A;  2GX9 A;  1HNW K;  3OYH A;  3ZT3 A;  3QB0 A;  3OYM A;  1JCE A;  2PY5 A;  3E9O A;  2ASM A;  4JHD B;  5C2D A;  4M3U A;  4JYA K;  2OTL N;  2NRZ A;  1HQE A;  3DMJ A;  2I7N A;  4FWL A;  3P1G A;  3SAF A;  1RT1 A;  1YJN N;  2O8E A;  1LWE A;  3JXU A;  5AQJ A;  4BRK A;  4DR7 K;  2ZM6 K;  2E2P A;  3VQQ A;  3WXJ A;  1L3V A;  2HW3 A;  3HYF A;  4I2Q A;  3NCI A;  1DLO A;  3NE6 A;  1A5X A;  3VQC A;  3QDK A;  3IRX A;  2QWQ A;  5AQN A;  3M8S A;  1TAQ A;  3O3F A;  1NK9 A;  4WQ5 A;  5GIN A;  3L0Q A;  5C12 A;  4JI3 K;  3SK3 A;  1A5W A;  3LPT A;  2IGI A;  1T3V A;  4FK4 A;  2XY5 A;  2DFH A;  3LP2 A;  1DGK N;  5DMR A;  1GLA G;  5KQ8 A;  1DTT A;  2HBL A;  4CEQ A;  2NRV A;  2QWN A;  3WQU A;  3L3U A;  2E2N A;  5HRR A;  5AQL A;  5HRO A;  3OYC A;  1QHT A;  4WE1 A;  3LL3 A;  2G8U A;  4X66 K;  3L6Q A;  3E9L A;  2D0B A;  3DRR A;  3VEY A;  5HRP A;  4DQI A;  3A5O C;  2KW4 A;  4EAH D;  5BN9 A;  4BRF A;  5FLX O;  1YXQ A;  1EET A;  3SCX A;  3OA9 A;  1N36 K;  4FJX A;  1ATN A;  3P4I A;  3LDL A;  1X1P A;  1YIT N;  1NJY A;  3EZ5 A;  1HNZ K;  3GE1 A;  3U4L A;  3H46 O;  1TL1 A;  1HNI A;  1SV5 A;  2P9S A;  3QIC A;  3S3O A;  3CCQ N;  2RHK A;  1J54 A;  1BQN A;  1VAZ A;  2E8A A;  3H6E A;  3ZX2 A;  4RCH A;  4JEP A;  4FJ5 A;  4BG9 A;  3O3H A;  1MWK A;  4M3R A;  1VSI A;  1F21 A;  2P9P B;  1ZBU A;  3RRG A;  3OYE A;  3SI6 A;  4B1Y B;  3RMB A;  3CER A;  4ILJ A;  2ZF5 O;  2HST A;  1SKS A;  4F3T A;  5LJV A;  3O9S A;  1KQS M;  4BRI A;  5LL6 Z;  3DLH A;  4ZTF A;  4CJR A;  4HUE A;  2I7P A;  2VWB A;  3SPZ A;  2IVP A;  4KTW A;  2YNH A;  1TK8 A;  1OH5 A;  1K73 O;  3CI5 A;  4N47 A;  1IKY A;  4B3S K;  3CXC M;  3N4P A;  2VQE K;  1OKJ A;  1N8R O;  1X9S A;  3LWM A;  5JVH L;  2QWO A;  4CZL A;  4YHH K;  1IG9 A;  3MCA B;  4FO0 A;  2CH6 A;  3Q7B A;  2Q36 A;  3CQX A;  3NF8 A;  2D0A A;  4DLG A;  1J5E K;  4OVL A;  1NBW A;  3ZET B;  3G71 N;  5C25 A;  4CF0 A;  3LP1 A;  3QIN A;  1ZBH A;  3NF9 A;  3SJH A;  3THY B;  4I9Q A;  1ASU A;  3MAQ A;  2J4R A;  4FWK A;  4H5V A;  2IOC A;  1C0U A;  5ELZ A;  1LWC A;  4NCB A;  2HOE A;  2WTU A;  3O6W A;  1C1C A;  2GWJ A;  4OO1 J;  5AQX A;  4KFB A;  3AVL A;  1RTI A;  4OKJ A;  2OPS A;  1FKO A;  4KAZ A;  3LDO A;  3AAR A;  1BGX T;  4KH5 A;  1KFD A;  4KTZ A;  3C7N A;  2DTU A;  2H3G X;  3TWH A;  3NAE A;  5EXW A;  4CJK A;  3VGK A;  4CVN E;  3DJC A;  4E1M A;  3FZH A;  5ADX A;  3RRH A;  1NJI O;  3VQB A;  3KWI A;  4OPA A;  4OPK A;  4PY5 A;  4OKE A;  1RTH A;  1VQ9 N;  3DXK A;  1W0H A;  4IBN A;  2ZJQ L;  1U47 A;  2ITM A;  4ID1 A;  1NU0 A;  1YF5 L;  5AQQ A;  5BPM A;  3ENO A;  1VRU A;  5AQP A;  2XRI A;  3NGI A;  4JI8 K;  3E01 A;  1K8K A;  1LAW A;  1LV5 A;  4CHQ A;  1S1X A;  5JIC A;  3HP6 A;  4DFM A;  4KBO A;  4BWJ A;  4B3R K;  4EHT A;  2FBX A;  1N33 K;  3C65 A;  4RW6 A;  5C2F A;  3QML A;  4ELV A;  2HNZ A;  4E0D A;  3KLI A;  4K42 A;  3V6D A;  2Q3S A;  3F2K A;  3AO2 A;  4F4K A;  3TSQ A;  5KPR A;  1QTM A;  2ZQB A;  2FSJ A;  2Q97 A;  1EP4 A;  4H5N A;  3THX B;  3CC7 N;  4GV3 A;  2V7Z A;  1I94 K;  1NK7 A;  4JS4 A;  4CFA A;  3DLK A;  3T69 A;  3SQ0 A;  5AQZ A;  2UXD K;  3O3G A;  4JKA A;  3BZK A;  2E88 A;  5AQM A;  4L8R B;  3MN6 A;  4CCH A;  4JHD A;  3B6P A;  4EHU A;  1KLM A;  3NH1 A;  1IKV A;  1XC9 A;  4A2B A;  3I8D A;  2W41 A;  3BZC A;  3NBP A;  3EZW A;  4DQR A;  4ISE A;  1BCM A;  1L3U A;  4M63 C;  3UB5 A;  4B9U A;  1XI1 A;  3K58 A;  4FLU A;  2HF3 A;  3VTI A;  5GAH P;  3V9U A;  3TAF A;  3U6F A;  2D0P A;  3WNE A;  4DR5 K;  1WOQ A;  3KKS A;  4GVM A;  1S6Q A;  3CMA N;  3HP9 A;  3T3F A;  1D8Y A;  1UWB A;  4LFC K;  2GWK A;  3R3L A;  3ID8 A;  1JCG A;  4DTU A;  3O4Q A;  2Z1H A;  1TAU A;  3P31 A;  3HI0 A;  4CEZ A;  4BWM A;  5HP1 A;  3HJF A;  3HL8 A;  1E3M A;  1HPM A;  2GEL A;  3E9P A;  1FK9 A;  4HUG A;  4OLB A;  1G99 A;  4EP4 A;  2UUB K;  4YY3 K;  3A2F A;  3O80 A;  3PO5 A;  1HNV A;  3CQ8 A;  4IFE A;  1HKB A;  5JLF A;  2F7T A;  1C0M A;  1WAF A;  3KIO A;  4Z94 A;  4CF2 A;  4AF1 A;  3P38 A;  3OYB A;  4JI5 K;  2IVN A;  3L4I A;  4A2A A;  1BO5 O;  3VPZ A;  3S9H A;  2FSN A;  4KHP K;  3ZSQ A;  5F1X A;  1KVB A;  1QQN A;  4BRG A;  3CME N;  3G0Z A;  1FW6 A;  3O9Q A;  4DTX A;  3BEX A;  4UQG A;  4FJ7 A;  4Y0W A;  4JI1 K;  1UA0 A;  3MEC A;  1LW0 A;  1MWM A;  4E7H A;  2NRR A;  3ENB A;  3ZYY X;  3QEV A;  4FW1 A;  1HRH A;  2XY7 A;  4LF6 K;  3KTQ A;  2A40 A;  2HB5 A;  2KHO A;  3WNF A;  4CGF A;  3THV A;  5LJW A;  2IS3 A;  3SAH A;  1VQ4 N;  2OPP A;  3HST B;  3SMS A;  1N6Q A;  4CJP A;  4JN4 A;  1TKX A;  4ELU A;  5AQW A;  4MDA A;  2QKK A;  1S1T A;  4PHT X;  1BQM A;  1GOA A;  1WBB A;  4FLY A;  5J2M A;  3VEW A;  4AIL C;  5AQH A;  4O4G A;  3G25 A;  4WCE L;  3HSC A;  4FLV A;  2HF4 A;  3L2Q A;  4CGJ A;  3V1R A;  4H0V B;  4CE9 A;  3VQ7 A;  3CPE A;  1T7P A;  3LM2 A;  1ILY A;  3QBX A;  2BTF A;  4GW6 A;  4RWT A;  2P9S B;  3PUF A;  3W0L A;  4B08 A;  4AHT A;  1C0G A;  1LOT B;  4HCC A;  3ZET A;  4JKD A;  4CJ3 A;  2ASP A;  1Q7Y O;  4J8F A;  2P9N A;  4WFN L;  4B9L A;  4PWD A;  3MEG A;  1YAG A;  1RFQ A;  2VWK A;  4DU3 A;  4H4O A;  4BR5 A;  1LCU A;  1NKB A;  1R59 O;  1VQM N;  4DFP A;  3O4N A;  3DI6 A;  1X3M A;  3ITH A;  1YI2 N;  4KI6 A;  2A6A A;  5AZI A;  4DHY A;  4BR2 A;  2Q1N A;  1BUP A;  1ESV A;  4FJ9 A;  5JS2 A;  1S1U A;  3ZSO A;  1VK0 A;  3J81 O;  4FSV A;  1L5U A;  3UKR A;  1NGJ A;  4B3T K;  1IO2 A;  3Q7C A;  3ZLJ A;  5EY4 A;  2VQF K;  2YHX A;  1U2V B;  4IFV A;  4YDU A;  1L3S A;  4EZ6 A;  4H4M A;  4BRP A;  3J8A A;  5KI6 A;  3J80 O;  4JKH A;  3G4S N;  2RN2 A;  3VGM A;  1QVF M;  3R6M A;  2Q31 A;  5FPN A;  2YNF A;  4NCA A;  1BIZ A;  3K5N A;  2UXB K;  3ZT2 A;  1FXX A;  1GLC G;  4CZM A;  1JLG A;  1S1W A;  1RNH A;  3VMF B;  3ZSV A;  5F0X A;  1ZBL A;  1QZ5 A;  3TAM A;  5J1E A;  3DM2 A;  5AQK A;  1IKW A;  1TV6 A;  5AFU H;  4FZY A;  2QEX N;  3OBW A;  3K9K A;  3VF6 A;  3THW B;  3KLF A;  4IDK A;  1SS6 A;  3ZX3 A;  3MWP A;  3NVK A;  3LDP A;  3LAK A;  4W5R A;  3JSM A;  1RT4 A;  1BCO A;  3C7N B;  3PSI A;  2F9T A;  4WQ5 C;  2Q2R A;  4DR2 K;  1U45 A;  3HK2 A;  1BWF O;  5B8H A;  3PO4 A;  2RKI A;  1X9M A;  4E7L A;  3D7E O;  2O8D A;  3ZSY A;  3L2W A;  2UXC K;  3KK2 A;  3SMP A;  3V9W A;  1ITG A;  4IOC L;  4Z4E A;  4G1Q A;  4FLW A;  3A8Y A;  1NK6 A;  3WXK A;  4B9V A;  3G6E N;  3M6G A;  1VQK N;  4K25 A;  4CJV A;  5AJ3 K;  4DFK A;  2QTD A;  1OVY A;  4LSL A;  3VQ8 A;  2YHW A;  4Y1C A;  5FRN A;  3SLC A;  3D2E A;  1Z26 A;  3V81 A;  2F9W A;  4L3Q A;  3DLR A;  1S3X A;  3OTO K;  3SV3 A;  1X3N A;  3IDH A;  1JCF A;  1XNR K;  5BRH A;  4DUY K;  2F8T A;  1MA9 B;  1TK5 A;  3D2F A;  2YJE A;  4C8K A;  4B9Q A;  2XHB A;  3ZSZ A;  3LDN A;  4A61 A;  4BC4 A;  2KQ2 A;  2JWK A;  4FL9 A;  4QCL A;  1JLA A;  3TTD A;  1JLC A;  4FZZ A;  3QIO A;  3QNN A;  1GLD G;  5AQG A;  3V1Q A;  5I3U A;  1KXP A;  1UA1 A;  2QA4 N;  1N32 K;  1NK4 A;  3CJ7 A;  3D45 A;  4W5N A;  2DY4 A;  1ZXO A;  3AO4 A;  1HJR A;  1WB9 A;  3GBT A;  4CBW A;  4PUO A;  3L2R A;  1ZC6 A;  5M1N A;  1VQN N;  3VQA A;  5IWA K;  2D1K A;  3KK7 A;  2NZT A;  1Y97 A;  4CHY A;  4CBU A;  4JI7 K;  4CJU A;  4FK2 A;  2FLO A;  1NLV A;  3VQ9 A;  3ULE A;  4CEA A;  4BC2 A;  2CGK A;  4F3O A;  1QQM A;  2OA8 A;  1FJG K;  4BVP A;  3AY9 A;  1EQY A;  4NCG A;  3WNG A;  4R79 A;  5CZ2 A;  4FXD A;  4LSN A;  4LH4 A;  3EY1 A;  3DRP A;  4CI6 A;  5C10 A;  1RT6 A;  4PKH A;  1UOC A;  5KPZ A;  4MO5 A;  2HHH K;  2HHS A;  1SUQ A;  4CEB A;  1C1A A;  5AQR A;  3RWU A;  5LY3 A;  4J2E A;  4CEC A;  3KJV A;  5HLF A;  4YNQ A;  3V9Z A;  1I3A A;  1E4F T;  4X65 K;  3LM9 A;  4KV8 A;  1JKH A;  2A1S A;  1UAX A;  3ENH A;  4I6M A;  1R0A A;  4DS4 A;  4PKG A;  4ZHR A;  4MLE A;  3N4Q A;  3ZSX A;  1TK0 A;  4YOT A;  3FFK B;  3R1X A;  4CEF A;  1WBD A;  2KFZ A;  3MN9 A;  2V51 B;  1T6C A;  1VRT A;  4B3M K;  3QES A;  3VTH A;  3C0B A;  2GEM A;  4DSF A;  4KRF A;  3TU5 A;  3TAE A;  2FBT A;  4M3Z A;  4HTU A;  1RT2 A;  4BQZ A;  4AHC A;  4CJ7 A;  3SBG A;  4LH5 A;  3AGK A;  3HTV A;  1XHX A;  3JYT A;  2E20 A;  1Q9X A;  1RGI A;  1ZBS A;  5AQS A;  3TTF A;  3AO5 A;  3U3G A;  3QFP A;  1Q18 A;  4IWV A;  1QQO A;  4FPB A;  1U2V A;  5C24 A;  5BN8 A;  4NLC A;  4C8L A;  4BVO A;  4MO4 A;  1WNS A;  2XY6 A;  1NGB A;  5E41 A;  3BDP A;  1VHX A;  4BRE A;  3RR8 A;  3ID6 A;  3J7Z O;  1XMO K;  2B4J A;  4O0I A;  3I0R A;  4U67 L;  4Z0U A;  5GIO A;  3C6T A;  3U9Z A;  4E3S A;  3QET A;  2O4I A;  2NRX A;  2FXU A;  3OYD A;  3GOI A;  1BL3 A;  3CD6 N;  2YNI A;  2A41 A;  1U48 A;  1CLQ A;  2P9N B;  3BF1 A;  3OYL A;  3CCS N;  2PAV A;  2P51 A;  2V7Y A;  5E26 A;  1W9H A;  3IFR A;  4PA1 A;  4FJ8 A;  1YT3 A;  1Q8I A;  2YHY A;  4BRA A;  1TKT A;  3VQD A;  4KHS A;  2B6A A;  4CD1 A;  4B1Z A;  5AZI B;  4TSX A;  4BRN A;  2IVO A;  3RVC A;  3F9M A;  4U7B A;  3THW A;  3UKR B;  3HM9 A;  3GL1 A;  4DV7 K;  4LF5 K;  3OYA A;  4DQQ A;  4ISF A;  3M8P A;  3O1W A;  1SL1 A;  3AVC A;  2RF2 A;  3ZSW A;  4B9T A;  3VET A;  4MFB A;  3T19 A;  3P39 A;  2DFF A;  2CGL A;  4CW7 B;  3EKS A;  3OJS A;  1HQU A;  2OPR A;  2WFB A;  3WQT A;  2ZJR L;  4DV6 K;  1XQS C;  5FDL A;  2OYQ A;  3I0S A;  4CES A;  4DTP A;  4Z4C A;  3DXM A;  3CJ9 A;  4CJQ A;  4F2S A;  1T6D A;  4O8U A;  4JK7 A;  4ZTJ A;  3UIQ A;  4DU4 A;  3TAG A;  4QAG A;  5KRT A;  3RMA A;  4O5B A;  4FJN A;  5FRM A;  3ZT4 A;  3KD1 E;  3VQ4 A;  4B9M A;  1TKZ A;  1DT9 A;  1HX1 A;  3DLE A;  4G9Z A;  2P9L A;  4FW2 A;  4CHN A;  4RW4 A;  3KK1 A;  2IAJ A;  2O4G A;  4CJT A;  1HUX A;  3LP0 A;  3MDQ A;  3WEE A;  3CCU N;  4H0P A;  4C23 A;  3OS1 A;  2E2Q A;  1WAJ A;  3OYN A;  2O8D B;  1YJW N;  2VG6 A;  1WLJ A;  3KLH A;  4DSL A;  4KHQ A;  3EE8 A;  3AVB A;  3VF4 A;  1N34 K;  2G8F A;  2ZE2 A;  5AR0 A;  4BG8 A;  4X62 K;  1CZA N;  4LC9 B;  2FF3 B;  1IBL K;  1QVG M;  5AQO A;  2P5O A;  3LAN A;  4KRE A;  4DG1 A;  1WSE A;  1KD1 O;  1NGD A;  3SQ2 A;  2FSK A;  3FZK A;  5EU7 A;  3RSE B;  1KAY A;  4J2D A;  1HYS A;  3O5B A;  1JXB A;  3D2E B;  1BI4 B;  3TAB A;  2UUC K;  3QEX A;  1OVQ A;  1JLB A;  3H3O B;  1Q81 O;  3C95 A;  2QM1 A;  3D2F B;  5AQY A;  3OBY A;  5M1F A;  3H3N O;  1NGC A;  2UUA K;  2FC0 A;  4KH6 A;  1NGE A;  3PLA A;  4FPA A;  4PKI A;  2IC3 A;  1YVN A;  3OYK A;  4BDY A;  1HKG A;  1V4S A;  3FLC O;  4BE2 A;  1RDU A;  3KWG A;  1SQK A;  1EKE A;  4OLA A;  3NFA A;  3D0P A;  5I9E B;  3QEP A;  1QS4 A;  3ZT1 A;  5K14 A;  1Z25 A;  1VQ8 N;  2PYJ A;  4BAC A;  4CGI A;  2E1Z A;  4FWM A;  1D9D A;  1NK0 A;  3CJC A;  5JS1 A;  2CGJ A;  4H0X B;  4CZF A;  3ULD A;  2E6M A;  1K8A O;  3BF3 A;  3RMD A;  2OPQ A;  4ID5 A;  2YI1 A;  4FM1 A;  1QE1 A;  3CJA A;  4RW7 A;  3ULE B;  3ATV A;  4CF1 A;  3VA0 A;  3S3M A;  3MMV A;  2I5J A;  3K0S A;  1S1V A;  3VQE A;  4YFU A;  5FPM A;  1HMV A;  5AQU A;  3AO1 A;  1E4G T;  2X78 A;  1NJX A;  2BGG A;  1WSG A;  2DPN A;  2QXF A;  2D0C A;  3A0I X;  3G10 A;  4Q0B A;  4GKJ K;  4FWN A;  3U9D A;  1VSH A;  1SAZ A;  3OW2 M;  4FVM A;  2P9I B;  4EP5 A;  3V1O A;  4YOX A;  2A1R A;  1P8Z A;  4RW8 A;  5FPD A;  1HNX K;  4E89 A;  2ZGY A;  3KD5 E;  1KTQ A;  2YKN A;  4CK3 A;  4Y1D A;  1RT7 A;  5BR8 K;  4GVE A;  3NH0 A;  3WNH A;  5CE3 A;  4C8M A;  1NGH A;  4IEE A;  5I42 A;  2OAN A;  5C42 A;  3NF6 A;  2QKB A;  4I6M B;  5CHI A;  4B9N A;  4DQP A;  4H0Y B;  3MXI A;  3T1H K;  3LAL A;  4MQ3 A;  3MXM A;  1BIS A;  5T7B A;  5AFU A;  4M41 A;  3I55 N;  1BHL A;  4FJK A;  1O13 A;  2HMP A;  5TKY A;  3CYM A;  3GDQ A;  1VQP N;  2NUB A;  2G8W A;  1YTU A;  3CCE N;  1BOT O;  3QIP A;  4FWP A;  3AVG A;  4B8C A;  1KAZ A;  3JAM O;  4LF7 K;  3ZT0 A;  4OGC A;  1EO1 A;  1YUW A;  4BE1 A;  4M3Y A;  1S22 A;  3WUH A;  2HMI A;  4XH1 A;  1XC3 A;  1HJO A;  4CIG A;  1VQ6 N;  1JLQ A;  2ASO A;  2VGM A;  2VGN A;  1RDD A;  2HHT A;  4K8X A;  3QBW A;  5EX5 A;  4M7X A;  3FFI A;  2Z1J A;  3DAW A;  4B1U B;  4FJL A;  3L3V A;  1C0F A;  1NGA A;  3OYJ A;  3CJB A;  3LZI A;  3CIP A;  1WSJ A;  4DTM A;  4DQ8 A;  3CET A;  1S9E A;  3DOL A;  3P83 D;  2XO7 A;  3SUQ A;  3D6R A;  2RE2 A;  1SL2 A;  3BGR A;  1IBM K;  2EWS A;  1VSD A;  2NRT A;  3P5J A;  3AAQ A;  3JS6 A;  5M1K A;  3K9J A;  1ATR A;  4A57 A;  3K5L A;  3TI0 A;  4HCB A;  4IDH A;  3ASM A;  5C15 A;  2HBK A;  3SYZ A;  1LWF A;  3SPY A;  1TKD A;  3VEX A;  4RTF D;  4B1X B;  4DR1 K;  3HO1 A;  3TSU A;  5GIP A;  2O8C A;  4Q5V A;  3HZ6 A;  2PYL A;  4YOR A;  5M1O A;  2HHV A;  5AZJ A;  4FLX A;  1LAV A;  1SL0 A;  2YJF A;  3OS0 A;  4IZ9 A;  1ATS A;  4H5T A;  2NNW A;  4GV6 A;  1MU2 A;  4BC3 A;  1D4X A;  4FLT A;  3CCL N;  4JD2 A;  1EWQ A;  3VEZ A;  5EVZ A;  3V4I A;  4GMJ B;  2XY8 A;  5F2R A;  2YKM A;  1JL2 A;  4IO8 A;  1NK5 A;  3L4Q A;  3PX4 A;  5CY4 A;  4AHU A;  2WOM A;  1NOY A;  4KB1 A;  1BA1 A;  3T1A A;  2PZS A;  4JLH A;  3C6H A;  1NM1 A;  4DR3 K;  3NGY A;  4FJG A;  5A2Q O;  1Q9Y A;  1CXU A;  2Q0U A;  3I8B A;  3W3D A;  4DCH A;  3L2U A;  4CBX A;  3FE1 A;  4WF9 L;  1RTD A;  4FCY A;  2AJQ A;  3DXM B;  5KRS A;  5KGW A;  4OX9 K;  5M1P A;  3OHR A;  1EX4 A;  3AVI A;  4KH4 A;  2A3Z A;  1IBK K;  4KHY A;  4DMN A;  1J5O A;  2WON A;  2WC9 A;  3M3Z A;  3RSE A;  3EEQ A;  1BI4 A;  3GG4 A;  4DWI A;  2P9U A;  4V19 S;  5HBM A;  1VSE A;  2QWP A;  4W5Q A;  4DSJ A;  1U6Z A;  2P9L B;  2FBV A;  3ISN C;  3HT3 A;  4QS9 A;  4H0O A;  4KB0 A;  3H08 A;  3CPW M;  4N5S A;  4K43 A;  3TAQ A;  3WEE B;  3CC2 N;  4JNE A;  3CFR A;  3MX5 A;  3SQ4 A;  1RTJ A;  4HWI A;  4DB3 A;  4WQ4 A;  3J7A P;  4HUF A;  3LWL A;  1BU6 O;  3K57 A;  1DTQ A;  3VQ5 A;  2NLX A;  2P9K A;  4IG3 A;  3ZEU A;  1VSF A;  3SQ1 A;  4J2A A;  3EN9 A;  4JI4 K;  3AA2 A;  3VES A;  1T44 A;  3NF7 A;  4CZE A;  3PV8 A;  4BRL A;  4AQY K;  4C1N I;  3AVA A;  3A5N C;  2E2O A;  3B8A X;  3HOS A;  3CF5 L;  1TYQ A;  2QXL A;  2LSN A;  3AGR A;  4IFY A;  1D9F A;  4H0T B; 
#chains in the Genus database with same CATH homology
 1CLQ A;  1L3U A;  4E19 A;  1ZBF A;  4BDP A;  4CJL A;  3OYL A;  4B9U A;  1XI1 A;  4DSI A;  4KTQ A;  2P51 A;  3K58 A;  4LY7 A;  4FLU A;  3CFO A;  4DU1 A;  1W9H A;  3V9U A;  1D5A A;  4PA1 A;  3CM6 A;  3U6F A;  3TAF A;  4FJ8 A;  1YT3 A;  3WNE A;  4C8N A;  2GV9 A;  4XIU A;  1Q8I A;  3KKS A;  3PY8 A;  2KZM A;  1HYV A;  1YTA A;  4GVM A;  1S6Q A;  1TKT A;  5HRN A;  3HP9 A;  3VQD A;  3T3F A;  4KHS A;  3U3Y A;  2B6A A;  1UWB A;  1D8Y A;  4TSX A;  3ZSR A;  1EXQ A;  4FJH A;  3AA5 X;  3OVN A;  1RDC A;  3O4Q A;  1CXQ A;  4CED A;  2Z1H A;  4CF9 A;  3V9S A;  2E6L A;  4CEZ A;  2W42 A;  4BWM A;  1TAU A;  5HP1 A;  3HJF A;  4AHR A;  3HM9 A;  1RDA A;  3HL8 A;  2HND A;  3OYA A;  4DQS A;  3SUO A;  4HUG A;  1FK9 A;  2F96 A;  1KVA A;  4DQQ A;  4OLB A;  2KTQ A;  4EP4 A;  4CFD A;  4N41 A;  4F2R A;  4KHU A;  2ITG A;  3A2F A;  3M8P A;  3PO5 A;  1SL1 A;  3AVC A;  2RF2 A;  4OGE A;  1HNV A;  3ZSW A;  4CF8 A;  3F73 A;  4DS5 A;  4B9T A;  3CQ8 A;  3QEW A;  4MFB A;  3T19 A;  1VSL A;  3S3N A;  4M3X A;  2X6S A;  2DFF A;  1WSI A;  2ETJ A;  2ATQ A;  2YHA A;  1C0M A;  1WAF A;  2Z1I A;  3KIO A;  4CF2 A;  3OJS A;  2Y1I A;  1HQU A;  3HPG A;  1JL1 A;  4J2B A;  1HPZ A;  2OPR A;  3OYB A;  4DSE A;  4CJF A;  1SKW A;  3S9H A;  3ZSQ A;  1KVB A;  2D5R A;  5FDL A;  3I0S A;  4DTN A;  2OYQ A;  4ELT A;  3K5O A;  2RPI A;  4K8Z A;  4M3T A;  4CES A;  4DSK A;  2YHB A;  3G0Z A;  4DTP A;  4CK2 A;  4Z4C A;  1I39 A;  4CJQ A;  4F2S A;  4DTX A;  3LPU A;  1RIL A;  4UQG A;  3UIQ A;  4N56 A;  4ZTJ A;  4FJ7 A;  2P5G A;  1RBR A;  3NGZ A;  4KI4 A;  4PQU A;  3OYG A;  1UA0 A;  4DU4 A;  3B6O A;  4JS5 A;  1CZ9 A;  1NK8 A;  3MEC A;  3TAG A;  1LW0 A;  2HVI A;  4E7H A;  4QAG A;  1WN7 A;  4H8K A;  3ALY A;  4CHP A;  5KRT A;  4E7I A;  3KLG A;  5DK5 A;  3RMA A;  3QEV A;  4FW1 A;  4O5B A;  4FJN A;  5FRM A;  3ZT4 A;  3KD1 E;  3VQ4 A;  1KLN A;  1REV A;  1HRH A;  2XY7 A;  3KTQ A;  1IH7 A;  1K6Y A;  2B5J A;  4B9M A;  1TKZ A;  3DLE A;  2HB5 A;  1C6V A;  3WNF A;  4CGF A;  4FW2 A;  3THV A;  4CHN A;  4Z4I A;  2IS3 A;  4CJE A;  4RW4 A;  3KK1 A;  2IAJ A;  2O4G A;  1RBU A;  2OPP A;  3QO9 A;  4CJT A;  4I2P A;  3HST B;  3LP0 A;  3MXJ A;  1ZYQ A;  1T03 A;  4CEO A;  1X9W A;  1N6Q A;  4CJP A;  4CHO A;  1KRP A;  1TKX A;  4ELU A;  3PX0 A;  4KPY A;  3OS1 A;  2QKK A;  2HHX A;  1WAJ A;  1S1T A;  4CEE A;  1BQM A;  1GOA A;  1JLF A;  4HHT A;  3OYN A;  1ASW A;  4NYN A;  4CHZ A;  3AVJ A;  4FLY A;  5J2M A;  1ZBI A;  2R7Y A;  3HPO A;  2VG6 A;  1WLJ A;  3KLH A;  3M8R A;  3VA3 A;  4DSL A;  4KHQ A;  4AIL C;  3AVB A;  4O4G A;  2QK9 A;  3LZJ A;  4FZX C;  4AHV A;  4M45 A;  2ZE2 A;  3SV4 A;  3V9X A;  1VSK A;  2G8F A;  4FLV A;  3L2Q A;  4HVJ A;  2HHQ A;  4CGJ A;  3V1R A;  3ZCM A;  4W5O A;  2HNY A;  3C6U A;  4RG8 A;  4CE9 A;  3VQ7 A;  4JRQ A;  1WSH A;  2P5O A;  3KLE A;  3IAY A;  3LAN A;  1KFS A;  4KRE A;  4DG1 A;  1B9D A;  3OYF A;  1T7P A;  1WSE A;  3AO3 A;  4GW6 A;  3SQ2 A;  1O1W A;  3CG7 A;  3PUF A;  1VSJ A;  4B08 A;  1B92 A;  1QQC A;  5EU7 A;  1L3T A;  1S6P A;  4AHT A;  4CGD A;  2G8K A;  3DLB A;  2GUI A;  4FJJ A;  4J2D A;  1NKC A;  1HYS A;  2Y1J A;  1JXB A;  5CZ1 A;  1BI4 B;  3AVN A;  3HPH A;  4B8A B;  3QEI A;  4HCC A;  3TAB A;  4R5P A;  4CJ3 A;  4B9L A;  4PWD A;  1RT3 A;  2G8H A;  3MEG A;  3RTV A;  4DTS A;  2VWK A;  3QEX A;  2FBY A;  2OZS A;  3DOK A;  3DLG A;  4H4O A;  4CK1 A;  4DU3 A;  1J9A A;  1JLB A;  3SNN A;  3TAR A;  5J2P A;  1T8E A;  1NKB A;  2HHW A;  3C95 A;  4OPJ A;  4JRP A;  1J53 A;  4DFP A;  3O4N A;  5J2Q A;  3DI6 A;  3ITH A;  1RT5 A;  4KI6 A;  4F8R A;  2FC0 A;  1T05 A;  4FJI A;  4DF4 A;  4B3O A;  4B9S A;  4FYD A;  3HXM A;  1TVR A;  5JS2 A;  4FJ9 A;  1S1U A;  1WSF A;  3ZSO A;  1VK0 A;  2EX3 A;  1L5U A;  3MED A;  4DTR A;  4KHN A;  1IO2 A;  1B9F A;  1KCF A;  3AV9 A;  2KZZ A;  4O44 A;  4IFV A;  2IC3 A;  4CER A;  3OYK A;  1L3S A;  4EZ6 A;  4BDY A;  3AVK A;  4H4M A;  4BE2 A;  1C0T A;  2EHG A;  4OJR A;  3OYH A;  1QSL A;  1EKE A;  5KI6 A;  4OLA A;  3NFA A;  3ZT3 A;  3OYM A;  3D0P A;  3QEP A;  2PY5 A;  1QS4 A;  2BAN A;  3ZT1 A;  2RN2 A;  3PX6 A;  5K14 A;  3KK3 A;  4NYF A;  4M3U A;  1Z25 A;  2PYJ A;  1S9G A;  4BAC A;  2YNF A;  4NCA A;  1HQE A;  1BIZ A;  4CGI A;  3DMJ A;  3K5N A;  5CYQ A;  1NK0 A;  1D9D A;  3M8Q A;  3ZT2 A;  4CJS A;  3P1G A;  1RT1 A;  1FXX A;  5JS1 A;  4OKK A;  1LWE A;  4KHW A;  4M3W A;  3ULD A;  1JLG A;  2E6M A;  1S1W A;  2YV0 X;  3VQQ A;  1L3V A;  2HVH A;  2HW3 A;  1RNH A;  1U49 A;  3HYF A;  3ZSV A;  4I2Q A;  4LD0 A;  3NCI A;  1DLO A;  3NE6 A;  1A5X A;  3VQC A;  3RMD A;  1ZBL A;  3IRX A;  1HYZ A;  1QSS A;  2OPQ A;  1VSM A;  3M8S A;  1TAQ A;  4ID5 A;  3O3F A;  3TAM A;  5J1E A;  3DM2 A;  4FM0 A;  1NK9 A;  4FM1 A;  4IKF A;  1QE1 A;  1IKW A;  5J2N A;  1A5W A;  1S5J A;  1TV6 A;  4FZY A;  3LPT A;  4RW7 A;  2IGI A;  1U4B A;  4FK4 A;  3TR8 A;  1CZB A;  4CF1 A;  2DFH A;  2XY5 A;  3LP2 A;  3KLF A;  3K59 A;  3K2P A;  3VA0 A;  2I5J A;  4IDK A;  3S3M A;  1S1V A;  5DMR A;  3VQE A;  4YFU A;  1HMV A;  5FRO A;  1U04 A;  1DTT A;  3AO1 A;  5HRS A;  4RW9 A;  4CEQ A;  3AVH A;  2X78 A;  1NJX A;  3LAK A;  3SJJ A;  1WSG A;  3C94 A;  2BGG A;  2QXF A;  4W5R A;  3JSM A;  1RT4 A;  2D0C A;  3G10 A;  4Q0B A;  3L3U A;  1BCO A;  4DTO A;  1VSH A;  4CIF A;  5HRR A;  4FVM A;  4AH9 A;  5HRO A;  5D3G A;  4EP5 A;  1QHT A;  3OYC A;  3V1O A;  4WE1 A;  1U45 A;  1C1B A;  2G8U A;  3HK2 A;  3PO4 A;  3TAN A;  2D0B A;  2RKI A;  3DRR A;  5HRP A;  4E7K A;  4E7L A;  2A1R A;  1X9M A;  3ZSY A;  3SZ2 A;  4DQI A;  2KW4 A;  3L2W A;  4E7J A;  4RW8 A;  3KK2 A;  3QNO A;  4Z4G A;  1EET A;  3SCX A;  1GOC A;  1XWL A;  2X74 A;  4IG0 A;  4E89 A;  4CGH A;  4FJX A;  3V9W A;  3KD5 E;  5CYM A;  1X1P A;  1TL3 A;  1ITG A;  1KTQ A;  2YKN A;  4CJ5 A;  4CK3 A;  3IS9 A;  4Y1D A;  3EZ5 A;  4BDZ A;  1NJY A;  4G1Q A;  4Z4E A;  1RT7 A;  4FLW A;  3NH0 A;  1NK6 A;  3WNH A;  1TL1 A;  4C8M A;  5I42 A;  5C42 A;  4B9V A;  3NF6 A;  2JLE A;  2QKB A;  1TGO A;  1HNI A;  3CM5 A;  3KKR A;  2VG7 A;  1SV5 A;  3S3O A;  4B9N A;  4N76 A;  3DRS A;  4CJV A;  4DFK A;  4DQP A;  3MXI A;  3NH2 A;  4M42 A;  4KO0 A;  4LSL A;  1J54 A;  4Y1C A;  3VQ8 A;  1BQN A;  5FRN A;  3LAL A;  4MQ3 A;  1FKP A;  1Z26 A;  3V81 A;  3MXM A;  3DLR A;  3L8B A;  2BDP A;  1BIS A;  5T7B A;  4FJ5 A;  3SV3 A;  4M41 A;  2BE2 A;  1BHL A;  4I9L A;  4CFC A;  3NDK A;  1N5Y A;  4FJK A;  3CYM A;  4C8O A;  3DYA A;  3O3H A;  1LW2 A;  2NUB A;  5KTQ A;  4M3R A;  2F8T A;  1TK5 A;  2G8W A;  1XHZ A;  1YTU A;  1VSI A;  1F21 A;  4C8K A;  3QIP A;  4O55 A;  3AVG A;  1ZBU A;  2XHB A;  3ZSZ A;  4B8C A;  3LAM A;  4E1N A;  3OYE A;  3RRG A;  3ZT0 A;  4OGC A;  4DTJ A;  3RMB A;  3SI6 A;  2KQ2 A;  4BE1 A;  4M3Y A;  2F8S A;  2HMI A;  4QCL A;  1JLA A;  1JLC A;  3HVT A;  1SKS A;  4F3T A;  4CIG A;  4KKO A;  1JLQ A;  4O0J A;  3DLH A;  4FZZ A;  1RDD A;  4ZTF A;  4CJR A;  5KGX A;  2HHT A;  4HUE A;  3QIO A;  3QNN A;  3SPZ A;  4KTW A;  4K8X A;  3QLH A;  2YNH A;  1TK8 A;  3V1Q A;  5I3U A;  1UA1 A;  4Z4F A;  3FFI A;  1IKY A;  2Z1J A;  4N47 A;  4AHS A;  4FJL A;  4DTU A;  3L3V A;  1NJW A;  1X9S A;  3AA3 A;  3OYJ A;  3LWM A;  3RR7 A;  1NK4 A;  4BE0 A;  3LZI A;  2VG5 A;  3D45 A;  1IG9 A;  4W5N A;  2DY4 A;  2X6N A;  3AO4 A;  1WSJ A;  1HJR A;  4DTM A;  1A5V A;  2OZM A;  1S9E A;  3DOL A;  3P83 D;  2XO7 A;  3L2R A;  4CFB A;  3SUQ A;  4PUO A;  3NF8 A;  3TAP A;  2D0A A;  4DLG A;  4FM2 A;  3BGR A;  1SL2 A;  2P1J A;  3AA4 A;  4OVL A;  2GBZ A;  1VSD A;  3P5J A;  5C25 A;  3VQA A;  4CF0 A;  3LP1 A;  3QIN A;  1ZBH A;  3IG1 A;  3NF9 A;  3VQP A;  1Y97 A;  4CJW A;  4CHY A;  3K5L A;  3TI0 A;  4I9Q A;  4HCB A;  1RBV A;  1ASU A;  3ASM A;  3MAQ A;  3SYZ A;  4I7F A;  1LWF A;  3SPY A;  1TKD A;  2IOC A;  1C0U A;  3F9K A;  4CJU A;  4FK2 A;  3HO1 A;  1LWC A;  4NCB A;  3VQ9 A;  4Q5V A;  2PYL A;  2HHV A;  4CEA A;  3OY9 A;  4FLX A;  1LAV A;  4FLZ A;  1SL0 A;  4F3O A;  2OA8 A;  1C1C A;  3CFP A;  1JXE A;  4NCG A;  3WNG A;  3OS2 A;  4CIE A;  3LDS A;  3OS0 A;  1NKE A;  1KVC A;  1RBS A;  3AVL A;  4KFB A;  1RTI A;  5CZ2 A;  4OKJ A;  2OPS A;  1FKO A;  4FXD A;  4LSN A;  4LH4 A;  3EY1 A;  3DRP A;  4KAZ A;  1NOZ A;  1RT6 A;  5SZT A;  1MU2 A;  1BGX T;  1UOC A;  1KFD A;  4KTZ A;  4FLT A;  2HHS A;  2DTU A;  1SUQ A;  4CEB A;  1C1A A;  2G8I A;  3TWH A;  3VQ6 A;  3NAE A;  2HHU A;  5SWM A;  3RWU A;  4CJK A;  4J2E A;  3V4I A;  4GMJ B;  2XY8 A;  4CEC A;  2YKM A;  3KJV A;  1JL2 A;  5HLF A;  4YNQ A;  1NK5 A;  3V9Z A;  1I3A A;  3PX4 A;  5CY4 A;  4E1M A;  4AHU A;  2ZD1 A;  2WOM A;  1KSP A;  3RRH A;  1NOY A;  1SKR A;  3VQB A;  4KB1 A;  3T1A A;  4CJ4 A;  2PZS A;  1RCH A;  4JLH A;  4KV8 A;  4OPK A;  2IDO A;  1JKH A;  2A1S A;  4PY5 A;  3NGY A;  1UAX A;  4OKE A;  4FJG A;  1Q9Y A;  1RTH A;  1CXU A;  1NJZ A;  4ICL A;  3L2U A;  1W0H A;  1ASV A;  1R0A A;  3L2V A;  4DS4 A;  4ZHR A;  4IBN A;  3ZSX A;  1U47 A;  1TK0 A;  1RTD A;  4ID1 A;  4FCY A;  4CEF A;  2AJQ A;  2JGU A;  1G15 A;  2KFZ A;  5KRS A;  1VRT A;  4DLE A;  4DFJ A;  5KGW A;  3K5M A;  1VRU A;  3NGI A;  2XRI A;  1EX4 A;  3AVI A;  3QES A;  3E01 A;  1LAW A;  3NHG A;  1LV5 A;  4KHY A;  4DMN A;  1J5O A;  4CHQ A;  3HVR A;  1S1X A;  2WON A;  4DSF A;  3HP6 A;  3RMC A;  4DFM A;  4KRF A;  4BWJ A;  3OJU A;  3TAE A;  2FBT A;  4M3Z A;  1RDB A;  4HTU A;  1BI4 A;  1RT2 A;  3EYZ A;  4DWI A;  4FK0 A;  4AHC A;  2FBX A;  4Z4H A;  3MEE A;  5HBM A;  4RW6 A;  1BIU A;  1VSE A;  4LH5 A;  4W5Q A;  4DSJ A;  1XHX A;  3AVF A;  4ELV A;  2HNZ A;  3JYT A;  4E0D A;  2FBV A;  3ISN C;  3KLI A;  3HT3 A;  1Q9X A;  4KB0 A;  2KFN A;  3H08 A;  2DFE A;  3V6D A;  4N5S A;  2Q3S A;  1QSY A;  3LP3 A;  2G8V A;  3AO5 A;  3U3G A;  3AO2 A;  3TAQ A;  4FJM A;  1IKX A;  4F4K A;  3OYI A;  2VWJ A;  3CFR A;  3SQ4 A;  1RTJ A;  1QTM A;  2ZQB A;  1EP4 A;  5C24 A;  3LWL A;  4HUF A;  1NK7 A;  3AVM A;  2YNG A;  3K57 A;  4C8L A;  1DTQ A;  1RBT A;  4CGG A;  3VQ5 A;  4W5T A;  4JS4 A;  4CFA A;  3DLK A;  4IG3 A;  1WNS A;  3VN5 A;  1VSF A;  3SQ0 A;  3SQ1 A;  4J2A A;  2XY6 A;  4QOZ B;  3AA2 A;  3NF7 A;  5E41 A;  3BDP A;  3PV8 A;  3RR8 A;  3O3G A;  4DF8 A;  2B4J A;  4O0I A;  3I0R A;  3AVA A;  3SUP A;  4L8R B;  4Z0U A;  4CCH A;  3B6P A;  3C6T A;  3QER A;  4EZ9 A;  1JLE A;  2Z1G A;  4E3S A;  1GOB A;  2E4L A;  3QET A;  1KLM A;  2O4I A;  3NH1 A;  1IKV A;  1XC9 A;  3I8D A;  2LSN A;  4IFY A;  3OYD A;  1D9F A;  3SUN A;  1YVU A;  3NBP A;  4DQR A;  1BL3 A;  2YNI A;  1U48 A;  1BCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...