1A5XA

Asv integrase core domain with hiv-1 integrase inhibitor y3
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5xA00
4KTWA 2VWJA 4FM0A 2IC3A 1RDCA 4KPYA 1S1XA 2D0AA 3KKSA 1VSFA 3MXMA 5E41A 2KZZA 4J2AA 4O0JA 2X6SA 5HROA 2IDOA 2XO7A 5FROA 1TKTA 3OJUA 2HHUA 4E7JA 3DM2A 1R0AA 4CGFA 3L2WA 3OYBA 3SUPA 3D45A 3KLHA 1C0TA 3VQ7A 4KHYA 1NKCA 5CYMA 1L3SA 1JLCA 3LP2A 4CJVA 1YVUA 4OVLA 1N5YA 3L3VA 4I9LA 1JLGA 3ZT1A 1UA0A 5JS2A 1TK0A 2YV0X 3NHGA 2ZD1A 4CEDA 1D5AA 3HJFA 2OA8A 4DS4A 2Z1HA 2OZSA 4WE1A 4LSNA 1C1BA 4DF4A 3DRRA 4RG8A 2DTUA 3DLRA 4DTUA 1C1CA 1NJZA 1BI4B 4BE1A 1VSJA 1S1UA 4CECA 3KLIA 3NE6A 1TV6A 2G8KA 5I42A 4JRPA 3M8QA 2IS3A 2E6LA 3VQDA 4IFYA 2Z1JA 3NBPA 3U3GA 4FJKA 2HHTA 3TAEA 4N41A 1SKWA 4QAGA 4NCAA 3NH0A 3SZ2A 2B4JA 2HB5A 1XI1A 4B9MA 3NGIA 3OYLA 3VQ8A 2OPPA 3TAPA 5DK5A 1KFDA 1VSMA 5KGWA 3DLKA 4B9SA 2FC0A 4W5RA 3LDSA 3F9KA 4LH4A 4BE0A 4O5BA 3DI6A 3HYFA 4H8KA 3VQ5A 4DFJA 4UQGA 2EX3A 3SPZA 1KSPA 1TAUA 3AA5X 4KB1A 5FRMA 4OGEA 1WSGA 3NH2A 4KHWA 3AVJA 4DTRA 2HNZA 3THVA 4KHSA 1RBRA 3VA3A 3WNGA 3ZSOA 1NJXA 2YNIA 3ASMA 1HJRA 1QHTA 5KI6A 3NDKA 5KTQA 3D0PA 4DTJA 5J2PA 3KLFA 3SI6A 3K59A 2BE2A 1SKRA 1S1VA 1WLJA 4ELVA 4RW9A 3JSMA 4OKJA 3I0RA 4LSLA 4NYNA 2X74A 3CG7A 4CJWA 3ITHA 3WNFA 3K57A 3SQ0A 1NKBA 2G8UA 4OLAA 4H4MA 4HUEA 1C0UA 1ZBFA 3IS9A 3QNOA 3OYCA 3V1QA 4DTXA 3VQ4A 2Q3SA 1Q9XA 1IH7A 1LWCA 1NJWA 1T7PA 2IAJA 5KGXA 3H08A 2P5OA 4DU3A 2KFZA 2OYQA 1RBTA 4W5NA 3QO9A 4Y1DA 4W5OA 3V9SA 1EX4A 4CEZA 3SV4A 4K8XA 1RT5A 3PUFA 4O0IA 4FJGA 1A5XA 4TSXA 1J54A 3AVIA 4MFBA 4N5SA 2P5GA 2D0BA 1BQNA 1RCHA 3ZT0A 3PO4A 1L3VA 4FJMA 3AV9A 1QS4A 3QESA 3HL8A 4M3TA 1Q9YA 3SUNA 3V9UA 3HVTA 1X9WA 1QSSA 4DQQA 1NK7A 4F3TA 3KJVA 2HVIA 3CYMA 5KRTA 3DLGA 4JS4A 4J2EA 2B6AA 4CGJA 2O4IA 4ELTA 2IGIA 2HVHA 4M45A 1BGXT 4JLHA 1LV5A 4HHTA 4AILC 5JS1A 1T03A 3LPTA 3L8BA 3RR7A 3ZSQA 4DTOA 5J1EA 1VSLA 2YKMA 2X78A 3CM6A 3RRHA 4DWIA 1XHXA 1ZYQA 1JLFA 4RW4A 2IOCA 3I8DA 2YKNA 4CJ4A 3OYFA 4C8OA 4B9UA 3O4QA 3SNNA 4N76A 1HPZA 4RW7A 1S9EA 2RPIA 4BACA 1CXQA 2Y1JA 3DRSA 1KLMA 2P51A 4CGIA 4CJTA 4FM2A 4W5QA 4DSIA 4Z4IA 3DLHA 4CCHA 1IKXA 3ZSRA 1T8EA 2QKBA 5I3UA 3IRXA 3HVRA 3PX6A 1BIZA 4CEFA 4XIUA 1VSKA 4CJKA 1W9HA 3LP3A 3NGYA 2YNGA 1S1WA 3AVCA 4GW6A 4Q5VA 1HYVA 3SV3A 4KHQA 1KTQA 3LALA 4CJ5A 4CHYA 4CGGA 1CZ9A 3HP9A 3V9ZA 4GMJB 3BDPA 3C94A 4M3XA 1LW0A 2A1SA 1SKSA 4FZZA 1TVRA 4CHPA 1O1WA 1BISA 4CF8A 3MEEA 1RTIA 3P1GA 4IKFA 4E19A 4FK2A 3AO1A 3O3HA 3OYEA 1FKPA 2XHBA 1WN7A 3V1OA 3ZT3A 3DYAA 4DMNA 3NF9A 4FJHA 4AHTA 1HMVA 4JRQA 1TKXA 1GOAA 1TKDA 3M8PA 1KVBA 3CQ8A 3P5JA 4OPKA 4DSEA 3NCIA 1HNIA 3F73A 4CGDA 3HPOA 3DOLA 3QEIA 3LWLA 3PV8A 3SYZA 1CXUA 4ZTJA 4LH5A 5C42A 1RT2A 3OYIA 4BDPA 2KTQA 3KK1A 2E6MA 1F21A 3AA3A 4FCYA 4B9LA 4FK0A 3AA4A 4M3ZA 3OY9A 1RT6A 2FBTA 1VK0A 5HRSA 4F2RA 4M3WA 1WSJA 3LPUA 4FLUA 1KLNA 1RILA 2QK9A 3NAEA 3SCXA 4DSKA 1NOZA 4W5TA 3SJJA 1RT4A 4CF9A 4KHUA 4AH9A 4FJ8A 4KRFA 3L2VA 2F8TA 3O3FA 4LD0A 3AVHA 3LP1A 1XHZA 3QEPA 4AHCA 1TAQA 3V1RA 1WAJA 4NYFA 1FXXA 1CLQA 3ZSXA 1NKEA 1QTMA 2QXFA 3HM9A 2FBYA 2JGUA 4KAZA 1ZBHA 2OZMA 5DMRA 4IDKA 4I2QA 4AHSA 1BCOA 2G8HA 2YHAA 3NF7A 2ETJA 1RBUA 4FLYA 1B92A 1S6PA 4J2DA 3MECA 4G1QA 1TGOA 4DQSA 3PX0A 2RF2A 4DG1A 1T05A 1TK8A 4DQRA 1DLOA 4YNQA 4E7HA 3K5LA 3MEDA 2DY4A 1GOCA 3RRGA 2BGGA 2XY8A 3ISNC 1BHLA 3ZCMA 1YTUA 4IFVA 3TANA 1JLQA 2HNYA 4FLVA 2KQ2A 3AVAA 4CJEA 4JS5A 4RW8A 1KVAA 5HRPA 1X1PA 4E1MA 1IKWA 5C24A 3QEVA 4BWJA 3OS0A 1RT1A 4FJ9A 4Z4FA 4KTQA 1YT3A 3OJSA 2I5JA 2P1JA 3DMJA 3P83D 4ICLA 4CJLA 3VN5A 3KK3A 1VRUA 4I9QA 4DTNA 3OYAA 3CM5A 2BDPA 4B9NA 4B8CA 3TAFA 2HHSA 2LSNA 3EZ5A 4M3UA 4FLXA 4E7LA 4ID5A 2VWKA 4RW6A 1UAXA 2GV9A 4HUFA 4C8MA 3LAMA 2VG7A 1RNHA 2PYLA 3AO3A 4DLEA 4HTUA 1TL3A 3AO2A 1HYSA 4M3RA 4DSFA 2WONA 1TKZA 1BL3A 3NFAA 3DOKA 1VSEA 4CEAA 3OYNA 1RBSA 1RTHA 4ID1A 1XC9A 5K14A 1ZBLA 4K8ZA 3DRPA 4HUGA 4KFBA 2RKIA 4CJRA 1DTTA 3ZSWA 2KW4A 4AHVA 3S3NA 1LW2A 1C1AA 3MEGA 3V81A 4N47A 4E0DA 4N56A 2ZE2A 3AVFA 3AVLA 3DLEA 4M41A 3SQ2A 2O4GA 4CEEA 3RMCA 3RMDA 1D9DA 1JXEA 5KRSA 2R7YA 4CFCA 2FBVA 2KZMA 3QEWA 4DQIA 3HSTB 3TAMA 5CZ1A 4FLZA 4CFBA 3AA2A 3HP6A 1QE1A 4KKOA 4CEOA 4CFAA 3AVGA 5HBMA 1QSYA 4E89A 1UA1A 3KTQA 4FJJA 4KI4A 4FJ5A 1RDAA 4E1NA 3K58A 4DTSA 2WOMA 3EYZA 4LY7A 4CHQA 1X9MA 1LWFA 3AO5A 3WNEA 1IKYA 2EHGA 3MAQA 4ZTFA 4MQ3A 1UWBA 3K2PA 4CJQA 2HW3A 3QLHA 4DTMA 2QKKA 3NH1A 4FZXC 4AHUA 4CESA 4FLWA 4ZHRA 2HHXA 1JLEA 4CF2A 3V4IA 3EY1A 2NUBA 3TR8A 1NK8A 3OYKA 1IG9A 4FJ7A 3K5OA 2W42A 3MXJA 4KHNA 2GBZA 2XRIA 2RN2A 4KTZA 4OKEA 4OJRA 3KLGA 4DFPA 4CK2A 3ALYA 4Z4HA 3OS1A 4FW2A 1U4BA 1VRTA 3U3YA 4B3OA 4FM1A 3SUQA 1W0HA 4DF8A 4CJSA 4Z4CA 3FFIA 3NGZA 3KK2A 4Y1CA 2KFNA 4Z4EA 2XY7A 4J2BA 1NK4A 5D3GA 3VQBA 3SQ4A 1TK5A 4FYDA 3TAGA 3S3OA 3VQPA 4DLGA 3HXMA 3NF8A 1NOYA 3ZSVA 1KVCA 4E7IA 3PY8A 2YNHA 3MXIA 3IG1A 3UIQA 3V9XA 4DU1A 1LAVA 2GUIA 3K5NA 3ZSZA 1NK9A 4CK1A 2VG6A 4R5PA 1JXBA 2ITGA 4DS5A 1J5OA 4OGCA 4CGHA 1SL1A 1NJYA 3HO1A 5HP1A 4NCGA 3QETA 4PUOA 3QINA 5C25A 4FLTA 3RMBA 1N6QA 1RTDA 4PY5A 2OPQA 1NK5A 1WSIA 3OYMA 3LZIA 4FZYA 5FDLA 3IAYA 4KB0A 4Z4GA 2Z1IA 1B9FA 3KD5E 3AVKA 1YTAA 3QIPA 1U48A 3T1AA 4PQUA 3C6UA 3ZSYA 3SPYA 4O44A 4L8RB 1U04A 1WNSA 3O4NA 2G8IA 4IG3A 3QEXA 4O4GA 3AO4A 4DFKA 4CEQA 1HQEA 4CHZA 2OPSA 3WNHA 1L5UA 1L3UA 1JL2A 1C6VA 1LAWA 4CK3A 1EETA 2AJQA 3TAQA 1SL0A 4M3YA 4KI6A 3I0SA 1UOCA 2G8VA 3VQEA 1J9AA 1EXQA 4ELUA 3LWMA 3VA0A 1A5VA 3CFOA 2PZSA 2B5JA 1JL1A 3RWUA 1ASVA 1WSHA 2A1RA 1B9DA 3OS2A 3TI0A 3ZT4A 1KRPA 1IO2A 4AHRA 1L3TA 3B6OA 1VSIA 2VG5A 5HRRA 3ZT2A 4B08A 3SQ1A 1RDBA 2YHBA 4CJUA 1RT7A 3HT3A 4Q0BA 4B9VA 2HHQA 1REVA 4BDYA 2X6NA 3L3UA 1SUQA 4EZ9A 3QERA 1SL2A 2HNDA 3KD1E 3LANA 4FW1A 2G8FA 3OYHA 5T7BA 3CFRA 4EZ6A 1FKOA 3E01A 5CY4A 4CHNA 1HQUA 3K5MA 2Y1IA 3RTVA 4H4OA 1D9FA 1A5WA 2FBXA 2DFFA 1S9GA 2XY6A 3KLEA 1LWEA 4CJFA 4CFDA 4DQPA 4CJPA 5SZTA 4I7FA 1C0MA 4OPJA 4F2SA 1ZBUA 4FVMA 1EP4A 4IG0A 1WAFA 4FK4A 1WSFA 1VSHA 3M8RA 1Z26A 3QIOA 5HLFA 4DU4A 1EKEA 3OVNA 4EP5A 4KREA 2HHWA 1KFSA 3OYJA 4FJIA 1I39A 1I3AA 1S5JA 1Z25A 4KO0A 2PY5A 4GVMA 5CYQA 3A2FA 1Y97A 4E3SA 1Q8IA 1JKHA 4DTPA 4DSLA 4HCBA 1HRHA 1VSDA 4E7KA 2HMIA 2F96A 3SUOA 1SV5A 3V6DA 1BIUA 1RTJA 4HVJA 4F8RA 2ZQBA 3S3MA 3LZJA 2PYJA 4PWDA 4C8LA 4DFMA 3U6FA 2D0CA 3B6PA 4NCBA 3T19A 4FJNA 4FJXA 1ASWA 3G10A 3BGRA 3S9HA 3AVNA 3KKRA 4CEBA 4CHOA 1U45A 4OLBA 4FXDA 3L2QA 4KV8A 1ASUA 4OKKA 5EU7A 1K6YA 4QOZB 1U49A 4BE2A 4QCLA 4EP4A 4CE9A 1KCFA 1ZBIA 1JLAA 4B8AB 3L2RA 4BDZA 4C8KA 3CFPA 3O3GA 3PX4A 1D8YA 4CIGA 4CIEA 1NK6A 1IKVA 1GOBA 1FK9A 3T3FA 1RDDA 5CZ2A 3OYGA 1QSLA 4DSJA 1S1TA 1S6QA 3C95A 1J53A 1RT3A 3VQ9A 5HRNA 3KIOA 3VQ6A 3V9WA 5J2QA 2DFEA 4F3OA 1CZBA 1XWLA 2D5RA 1MU2A 1JLBA 4B9TA 3TWHA 3PO5A 4PA1A 3LAKA 5J2MA 1RBVA 4I2PA 3NF6A 3VQQA 3AVBA 1DTQA 2OPRA 4CF0A 1TL1A 4FJLA 1BQMA 2JLEA 5SWMA 3G0ZA 4Z0UA 4HCCA 5J2NA 3C6TA 4CJ3A 4BWMA 3TABA 2F8SA 2DFHA 1BI4A 4O55A 3VQAA 4F4KA 3OYDA 3RR8A 4M42A 2ATQA 1HYZA 1QQCA 3RMAA 2BANA 1G15A 3JYTA 3M8SA 1BCMA 3TARA 1X9SA 2G8WA 2HHVA 1ITGA 5FRNA 4IBNA 4CIFA 2YNFA 2XY5A 4CERA 4YFUA 1U47A 2Z1GA 4C8NA 3DLBA 3ULDA 3HK2A 3L2UA 1NK0A 2E4LA 1HNVA 3HPHA 1WSEA 3VQCA 4CF1A 3HPGA 3AVMA 3QNNA 3LP0A
chains in the Genus database with same CATH superfamily
4WQ4A 5FPEA 4KPYA 1S1XA 3LDOA 3MXMA 5E41A 2KZZA 4O0JA 1TKTA 4XH1A 3DM2A 1H1VA 1K9MO 1NKCA 1N5YA 3L3VA 3OA9A 3OBYA 1JLGA 3HJFA 4CEDA 4DV7K 4DS4A 2OA8A 2OZSA 4WE1A 4PHTX 3THXA 5AQQA 3EL2A 1VSJA 4BRDA 4H0TB 3KLIA 4H5VA 1TV6A 2WC9A 3M8QA 3VQDA 3EE9A 4IFYA 3TAEA 4JHDB 2HBMA 1KXPA 3NH0A 2AP1A 3NGIA 1HNWK 3D2EA 3D6RA 1KFDA 5AZIA 4IOXA 3CCUN 1J6ZA 3SMSA 4O5BA 3KWIA 2ZGZA 2CH5A 2ZWHA 1TAUA 3THVA 4KHSA 1KAZA 2HNZA 3WNGA 3ZSOA 4CVNE 4FWRA 5KTQA 3UE5A 2ZJQL 4ELVA 3JSMA 2CGKA 5LL6Z 1HJOA 4NYNA 2X74A 1Y64A 1NKBA 2F9WA 3BP8A 4K0KK 1BA0A 4H4MA 3QNOA 3SAFA 4DTXA 1IH7A 2HSTA 5KGXA 4IEIA 4OX9K 1TYQA 4DU3A 3CD6N 5LJWA 4W5NA 3QO9A 4DCHA 5CHIA 4K8XA 1E3MA 3PUFA 4O0IA 3AVIA 2JWKA 4N5SA 2P5GA 4FJMA 1L3VA 4M3TA 4DUYK 3HVTA 4PL8A 1QVGM 3T1HK 3H46O 3O1WA 1SQKA 4M45A 2QA4N 1LV5A 5BRFA 4HHTA 3E1YA 1T03A 3L6QA 3QBXA 3L8BA 3HBTA 1K8KB 3PSIA 2F9TA 1VSLA 2A42A 2X78A 3CM6A 3ZSQA 5J1EA 4NO7A 1ZYQA 2IOCA 3O9UA 3I8DA 4GKJK 3CJAA 4C8OA 2JWLA 3U9ZA 3DRSA 4JKEA 1KLMA 4FM2A 3KVGA 2NRVA 3DLHA 3SMPA 3ZEUB 5I3UA 3IRXA 5C12A 1XC3A 3K9KA 5C10A 2YNGA 1RGIA 1S1WA 2V7ZA 1DEJA 3SV3A 2FSJA 3BY5A 3V9ZA 4GMJB 3C94A 1LW0A 2ZJPL 1QZ6A 1O1WA 1BISA 4IKFA 3O3HA 3VEOA 1NM1A 1WN7A 3O9RA 3DYAA 1HMVA 4V19S 2BH1A 4FPBA 3NCIA 3PV8A 3HPOA 5C42A 3KK1A 1KQSM 3AA3A 4FCYA 3OY9A 1RT6A 4BRHA 3BZCA 3HZ6A 1KLNA 3E9OA 3BF3A 1NOZA 4W5TA 3FZLA 3TTFA 3VEVA 2F8TA 4JN4A 1G99A 1WAJA 1FXXA 3ZSXA 4JKGB 3HM9A 5EOYA 4H0PA 1ZBHA 5DMRA 3CMEN 4AM6A 2YHAA 1RBUA 2DPNA 3FGUA 5M1NA 3J7AP 1WUAA 3CETA 3MEDA 3OBWA 4WF9L 1KC8O 1GOCA 3RRGA 1VQNN 1YTUA 3VETA 3G71N 4IFVA 2W6LA 3VTIA 4CJEA 5LY3A 1X1PA 1RDWX 5FPMA 5HL7L 1RT1A 2OTJN 3OJSA 2P1JA 3DMJA 4CJLA 3VN5A 1DKGD 5AQMA 4R79A 2HHSA 3TSQA 2V52B 4FLXA 3P4IA 1KAXA 2VWKA 4RW6A 3QMLA 4H5TA 2KKZA 2GV9A 3ZX0A 1KD1O 3LAMA 1LOTB 3AO3A 4JI3K 1HLUA 1TL3A 4BR0A 5TKYA 4DSFA 2WONA 3WEEA 1VSEA 4CEAA 4B3TK 1RBSA 3I56N 3O5BA 1NBWA 3EEQA 4X65K 4PL7A 2RKIA 3ZLJA 3UKUA 2CH6A 3S3NA 4N56A 1NNEA 3RMCA 2O4GA 4CEEA 4RCHA 1P8ZA 5KRSA 2R7YA 4JI5K 4DKWA 2QWLA 1OH8A 4JI8K 5CZ1A 4CFBA 3AVGA 1UA1A 4B1YB 2WOMA 3GBTA 3IDHA 1X9MA 2WTUA 2O8EB 3WNEA 4MQ3A 2GTDA 3CI5A 4CJQA 1NGDA 2QKKA 4ZHRA 5BRHA 3EY1A 1IG9A 3OYKA 5C0YA 3K5OA 2RN2A 4KTZA 4DFPA 3GG4A 1QQOA 1VRTA 2VGNA 3SUQA 4CJSA 4DUZK 3NGZA 4IXCA 3GDQA 3S3OA 3VQPA 3NF8A 1HUXA 3I33A 3SAHA 3P31A 3IG1A 3UIQA 2P9UB 3V9XA 1LAVA 3K5NA 4PKHA 4FPAA 4DS5A 4CGHA 3CF5L 1NJYA 2Q0UA 3QINA 4XH5A 5E84A 3H6EA 1N6QA 4PY5A 4LFBK 4YDUA 2O8CB 4FZYA 2E2OA 5AQPA 4KB0A 4Z4GA 1U48A 3C6UA 3LM2A 1WNSA 4JI6K 2ASOA 3VTHA 4IG3A 4WQ4C 4O4GA 3AO4A 4DFKA 2OPSA 2QI2A 3WNHA 1L5UA 1L3UA 3E9PA 1EETA 2AJQA 3TAQA 1SL0A 1UOCA 4B1XB 2G8VA 3VQEA 1J9AA 2D0OA 3F5TA 4FWSA 1A5VA 3CFOA 2B5JA 2NRTA 4JKFA 2HMPA 3ZT4A 1KRPA 4CZHA 1V4SA 3B6OA 1VSIA 1HR0K 3SQ1A 4DR4K 4Q0BA 3ATVA 5CR4A 2X6NA 4Y0WA 4BQZA 4EZ9A 1SL2A 4JKHA 5IT9O 3THYB 3LANA 1FKOA 5CY4A 3RTVA 2O8BB 2FBXA 2DFFA 5LMNK 1LWEA 1YJ9N 1NGBA 4I7FA 1C0MA 3Q7CA 4C1NK 4IG0A 1EP4A 3WQTA 1VSHA 5DM7L 4YOXA 2V7YA 2HHWA 1XQSC 4KREA 3HSCA 1BO5O 3FLCO 3EZWA 1I39A 3SLCA 4KO0A 2PY5A 5CYQA 3A2FA 3LL3A 3G25A 5F2RA 3VPZA 3QBWA 4E7KA 2HMIA 4IDHA 1RTJA 2FXUA 1NGJA 2ASMA 5ADXA 3S3MA 3OHRA 4XEIA 2PYJA 4DFMA 5GINA 3AGRA 4FJNA 4FJXA 3J81O 3J7YP 4CEBA 4OLBA 3L2QA 4K43A 1HX1A 5M1OA 4CBUA 1Q86O 4JK9A 1KCFA 4C8KA 4O8KA 3O3GA 4CIEA 1FK9A 5GAGP 1RDDA 1QSLA 1VQ7N 5BPNA 1S6QA 3VEZA 1J53A 5BR8K 3V9WA 1CZBA 4DR6K 2D5RA 3HOSA 1MU2A 1JLBA 5C2DA 4PA1A 4MO5A 1RBVA 3NF6A 4C1NI 2FF3B 3IKMA 3P39A 2JLEA 3C6TA 1JCFA 2ATQA 5FRNA 4CIFA 1OVQA 3BF1A 4JHDA 1T44A 4CERA 3DLBA 4M7XA 3HK2A 1HNVA 3FE1A 4CF1A 3HPGA 4JYAK 5EXWA 4MLEA 2IDOA 4XH4A 2XO7A 3OJUA 1IBKK 4E7JA 4X64K 3L2WA 3D45A 3KLHA 4KHYA 3C0BA 1L3SA 1JLCA 1YVUA 4OVLA 1UA0A 2YV0X 2PFUA 1D5AA 4YOTA 4LSNA 2F7TA 3DRRA 4RG8A 4JK7A 4DTUA 1BI4B 1S1UA 4CBXA 1BG3A 1WBDA 1N32K 5I42A 1V4TA 4JRPA 4LF4K 1BOTO 2Z1JA 3U3GA 4FJKA 1W2BM 4N41A 4QAGA 3SZ2A 2B4JA 3ATUA 3VENA 2O8FB 2FC0A 2E1ZA 1KSPA 2NRWA 4RWTA 4KHWA 3AVJA 1X9JA 5KI6A 3O9QA 3LM9A 3SI6A 1K8KA 3MX5A 2BE2A 1GLFO 4OKJA 4DR7K 3I0RA 3VMFB 2E2NA 4CD3A 3CG7A 4OLAA 3ITHA 3N4PA 3WNFA 3SQ0A 2D4WA 3O9SA 3G6EN 1ZBFA 3IS9A 3OYCA 1D4XA 3VQ4A 1LWCA 1T7PA 5GAHP 2IAJA 2P5OA 3ZEUA 5B8HA 1EX4A 4CEZA 4DV6K 4BC5A 1A5XA 2E8AA 2HHHK 2UUCK 3ZT0A 1E4FT 3PO4A 3SUNA 4K41A 3V9UA 1X9WA 4QS8A 1NK7A 4F3TA 3CHWA 2HVIA 3DLGA 3H1QA 1IBMK 2HVHA 1NU0A 3JXUA 4DV2K 4AILC 2YI1A 3RR7A 4DTOA 4DWIA 1Q7YO 4RW4A 4CJ4A 4ISFA 4B9UA 3O4QA 3CCVN 4RW7A 1S9EA 2ITMA 3AAPA 4CGIA 4W5QA 5AQGA 2YJFA 3CJ9A 4Z4IA 4CCHA 3TTCA 4C23A 1IKXA 3VESA 3ENOA 2QKBA 3HVRA 3BZKA 4GW6A 3AVCA 5BR9A 1VQON 1HYVA 1KTQA 4CJ5A 4CGGA 4CZMA 3VEYA 3BDPA 2A1SA 4CHPA 4A5AA 5F0XA 3MEEA 4JKGA 3R9PA 3AO1A 1WBBA 1DT9A 2XHBA 4DMNA 4FJHA 5AQRA 1TKDA 3M8PA 3CQ8A 3P5JA 1HNIA 4CGDA 3QEIA 1CXUA 4ZTJA 3O80A 4LH5A 1VQ9N 3OYIA 4BDPA 2E6MA 1N34K 3AA4A 3TPQA 3HM8A 1QHAA 1VK0A 5HRSA 1BA1A 3TTDA 1WSJA 4FLUA 2QK9A 3NAEA 4CF9A 4DV1K 4HWIA 4YDUC 3O3FA 2VCPA 1ZC6A 3MMVA 1XHZA 3QEPA 3VF2A 1CLQA 3J8AA 1OH7A 5BREA 2FBYA 2E20A 1XMQK 2QW9A 3NF7A 2ETJA 4FLYA 1B92A 4EHUA 3R3LA 4G1QA 4DQSA 1T05A 4JEPA 1TK8A 4BVOA 3CQXA 3K5LA 3U4LA 1VQLN 2YCHA 3ISNC 1BHLA 1JLQA 2P9SB 2KQ2A 4JS5A 4RW8A 2NRHA 1QVFM 4FJ9A 3MN5A 4ILGB 4I9QA 3P83D 3M1FA 4DTNA 3CM5A 2HF3A 2O8EA 2QTDA 2VG7A 2PYLA 3AO2A 3O6WA 3W0LA 3DXMB 2QWMA 2QWRA 1VHXA 1XC9A 1YIJN 1ZBLA 4K8ZA 3EKSA 3HTVA 3C6HA 5AQJA 4CJRA 3ZSWA 5BRDA 3VERA 4N47A 3O8MA 3SQ2A 3DLEA 1D9DA 3RMDA 3VEXA 5BPMA 2P9UA 4DQIA 3HSTB 1NGHA 3TAMA 4FLZA 3AA2A 2E1YA 3EN9A 5AR0A 1QSYA 3CJ1A 4FZZA 5HBMA 1OH5A 4FJJA 4BRCA 4DTSA 2F4VK 3EYZA 2O8CA 2Q97A 1IKYA 2YHYA 3CPWM 3GL1A 4FZXC 4FLWA 4DR5K 4CF2A 4JV5K 2IVNA 4OPHA 4KHNA 3A5OC 2GBZA 2XRIA 3U8XA 2VQFK 1JCGA 3WXIA 4JKCA 4Z4HA 3U3YA 4B3OA 4FM1A 3FFIA 2QWNA 3KK2A 1T6DA 3VQBA 3BUZB 1T6CA 3A5LC 3UB5A 3EKUA 2D0PA 4HTLA 3ZSVA 4E7IA 4B3SK 3MXIA 4DV5K 1T3VA 2GUIA 3L4QA 3ZSZA 1NK9A 1BU6O 2VG6A 2VYPA 1XNRK 4G9ZA 1U6ZA 4BR7A 3ID6A 1BWFO 4BR4A 3CQYA 1NK5A 4ISGA 3LZIA 3THYA 1U2VB 5FDLA 4B1ZA 1N8RO 3AVKA 2EWSA 3ZSYA 4O44A 5ADXH 4WFBL 2O8BA 4H0OA 2G8IA 4DR1K 1HQEA 3VF6A 1SAZA 4CHZA 1JL2A 1LAWA 4IEEA 4JKAA 1ZXOA 4KI6A 3DJCA 4A5BA 1HNXK 3CCLN 4ELUA 2A40A 2GWJA 3VA0A 2PZSA 1JL1A 3RWUA 3CCJN 2NRZA 3TI0A 1VQKN 4AHRA 2OTLN 5HRRA 2VG5A 4B08A 4BREA 3ENHA 1REVA 4BDYA 4BRGA 3KD1E 1X3MA 4FW1A 3UKRB 5AZJA 3CFRA 4CHNA 3ULEB 4QS7A 5GADP 4H4OA 3L0QA 4CJFA 5F1XA 4DQPA 4LFCK 4OPJA 4FVMA 5AJ3K 2O8DB 3TSPA 3M8RA 1Z26A 4DU4A 2Q36A 2YHXA 4FJIA 1S5JA 1I3AA 3MN6A 4GVMA 3KZBA 1JKHA 4DSLA 4OPAA 1VSDA 3SUOA 3V6DA 1BIUA 2ZQBA 3LZJA 4PWDA 3U6FA 2D0CA 3B6PA 4NCBA 1ASWA 3S9HA 5KQDA 3KKRA 4FXDA 2W6KA 1K6YA 2GX9A 1C0GA 4I6MB 3AARA 1NGGA 4JI2K 4CE9A 1ZBIA 1JLAA 4BG9A 3PX4A 1D8YA 1IKVA 5AQUA 3QFPA 3OYGA 5CZ2A 1RT3A 2WBNA 5BPLA 1RFQA 2AA4A 2UU9K 4MO4A 4LFAK 3VQQA 4CF0A 1TL1A 1BQMA 5SWMA 4KH4A 3TABA 2A41A 3KHYA 1BI4A 2I7PA 3DXKB 4O55A 2A6AA 4ILHA 2P9PB 4H5RA 2UXDK 1HYZA 1QQCA 2QWOA 1X9SA 3TARA 1BCMA 2HHVA 3QB0A 1ITGA 2GWKA 3KK7A 1U47A 2Z1GA 4C8NA 3RSEA 3ULDA 4O5FA 1Z05A 3L2UA 3QNNA 4FSVA 1WSEA 4H03B 2O8FA 2VWJA 2IC3A 1VAZA 4DV4K 2D0AA 1VSFA 4J2AA 5HROA 4BRPA 2HHUA 2NNWA 3SUPA 5AQIA 4BRIA 5KPTA 3LP2A 4CJVA 5AFUH 1TK0A 1IG8A 2ZD1A 3CPEA 3MN7A 1NJIO 4CZKA 4DF4A 3WT0A 5H1SQ 3DLRA 1C1CA 1NJZA 4ISEA 3QICA 4IOCL 4FL9A 5GIPA 2E6LA 2HHTA 4O8UA 1SKWA 3P38A 3VGKA 4NCAA 2QXLA 1XI1A 4JD2B 5JVHL 1JCEA 2OPPA 5DK5A 5KGWA 4B3RK 3DLKA 3A8YA 2ZF5O 4W5RA 4BE0A 4H8KA 3DI6A 3HYFA 3ZYYX 4DFJA 1NGCA 4UQGA 3SPZA 4WFAL 5AQSA 5A2QO 4KB1A 1DGKN 4OGEA 3NH2A 4DV3K 4DTRA 4BY9C 1RBRA 3VA3A 3CC4N 2YNIA 3ASMA 1HJRA 1QHTA 3NDKA 4DTJA 2GELA 3KLFA 1SKRA 1WLJA 3R6MA 4LSLA 2W40A 4CJWA 4M63C 1C0UA 4KH5A 3M3ZA 5HOOA 3V1QA 2Q3SA 3LDLA 3R1XA 3H08A 4H0XB 1RBTA 4PKGA 3V9SA 4MDAA 1RT5A 4TSXA 1GLLO 4B1VA 1SS6A 1BQNA 3C7NB 3AV9A 3QESA 3HL8A 5AZJB 4DQQA 2BTFA 1NWKA 3ZETB 5KRTA 4JS4A 4CGJA 4LF7K 2O4IA 4ELTA 2IGIA 4JI0K 4JLHA 5C15A 1ILYA 4CZLA 3LPTA 4JI7K 3JS6A 1FJGK 2YKMA 4H0YB 3RRHA 1XHXA 1QZ5A 3CC7N 5TKWA 3EE8A 3CCRN 2VQEK 4N76A 4BC4A 1CXQA 4DV0K 2Y1JA 4CJTA 3SK3A 3IFRA 3AGKA 1YVNA 3PX6A 1BIZA 4CEFA 4XIUA 1VSKA 4CJKA 3LP3A 3NGYA 3O1BA 4KHQA 3SBGA 3LALA 4CHYA 1CZ9A 4M3XA 1SKSA 1NGFA 5EX5A 4FK2A 1EQYA 3OYEA 3PLAA 3ZT3A 4A62A 4NLCA 3TSUA 3NF9A 4AHTA 2P9IB 1TKXA 1GOAA 3OTOK 3E9LA 4OPKA 4DSEA 3F73A 3SYZA 2QM1A 1ATNA 1EWQA 3LDPA 2P9SA 4Z94A 2KTQA 4M3ZA 4B9LA 3MDQA 4BRMA 2FBTA 4KBOA 4F2RA 4M3WA 3LPUA 1YUWA 5MLCQ 4X62K 1RILA 3O08A 4DSKA 4FJ8A 3FR0A 4KRFA 3L2VA 4LD0A 3AVHA 3LP1A 3RSEB 1MA9B 4AHCA 1TAQA 3V1RA 2IVOA 3CIPA 5JLHA 1QTMA 2QXFA 1N33K 3CJCA 3I8BA 3DXMA 1LCUA 3WUHA 2PBDA 2G8HA 3IUCA 4L3QA 1X3NA 4J2DA 3MECA 3PX0A 1TGOA 4AM7A 5JLFA 2DY4A 4IO8A 2XY8A 1YITN 3ZCMA 3TANA 2HNYA 4FLVA 5AQOA 1KVAA 5HRPA 1HKCA 2I7NA 4FWPA 4BWJA 3QEVA 3MX2A 3CCEN 4CZIA 4JI4K 3J7ZO 4B8CA 3K0SA 2YHWA 3A5NC 3PIOL 2RHKA 1UAXA 3HI0A 3K9JA 1QQNA 4C8MA 4HUFA 5AFUA 1RNHA 2P9NB 4GKKK 4DLEA 4NLBA 5E26A 4YOVA 3J80O 5JICA 1TKZA 1BL3A 4CI6A 1M90O 3DOKA 3OYNA 1RTHA 5KPZA 3F9MA 2A3ZA 5K14A 5KPRA 3DRPA 4HUGA 1TUYA 2FSNA 4WCEL 2KW4A 4JNEA 4AHVA 3NMUA 3NVMA 1LW2A 3V81A 4E0DA 2ZE2A 5M1QA 3AVFA 3AVLA 1JXEA 2P9LB 4CFCA 2FBVA 4M7YA 2OANA 3QEWA 3G4SN 3L4IA 3HP6A 1QE1A 4KKOA 4CFAA 4E89A 4KI4A 1RDAA 3K58A 4F9OA 4GV3A 4CHQA 1U2VA 1LWFA 3AO5A 2ASPA 4ZTFA 3K2PA 5AQFA 2HHXA 3D2FB 4AHUA 4BGAA 1JLEA 3V4IA 2NUBA 5AQHA 3T7ZA 1P90A 4FWOA 2J4RA 4FJ7A 2W42A 4WQ5A 3THWB 4OKEA 4OJRA 3ALYA 3OS1A 4BG8A 1GLAG 3E66A 1NK4A 5AQXA 5D3GA 3TAGA 2NRXA 1MWKA 1NOYA 1KVCA 3PY8A 2YNHA 1WOQA 5AQYA 4A59A 3I55N 1HPMA 3DWLA 1J5OA 4NCGA 3QETA 3LDQA 3RMBA 5C25A 4FLTA 1RTDA 1IV0A 3B8AX 3UKRA 3MWPA 3IAYA 1B9FA 3QIPA 3T1AA 3ULEA 1WB9A 3SPYA 1U04A 3O4NA 4BRFA 3QEXA 1M1KO 4DQ8A 3W3DA 4CK3A 2O8DA 4M3YA 3I0SA 4DR2K 2IIRA 3LWMA 4BC2A 1ASVA 2A1RA 2VGMA 4BR2A 2QWQA 2Q0RA 3ZT2A 4YHHK 1GLBG 5JVGL 1RDBA 2YHBA 5EVZA 1OVYA 1RT7A 3WXJA 4JK8A 1VQ4N 3L3UA 3QERA 2HNDA 5AQLA 4CW7B 4FWQA 4U67L 3OYHA 4I6MA 1S72N 4EZ6A 3E01A 3H3NO 4K42A 4YY3K 1A5WA 1S9GA 2XY6A 3KLEA 4CFDA 2E2QA 4CJPA 5SZTA 4F2SA 1ZBUA 4FK4A 1WSFA 3DLLL 5HLFA 1EKEA 2P9KB 4EP5A 2UUAK 3OYJA 1Z25A 1Q18A 1Q81O 3CMAN 4BC3A 4DHYA 4DR3K 4E3SA 4HCBA 2IVPA 4OO1J 4CZGA 2F96A 1SV5A 4AF1A 3DXKA 1Q82O 2P9PA 3KWGA 1XUPO 3T19A 5AQNA 3BGRA 3AVNA 4H5NA 1ATSA 4KV8A 3QFUA 4OKKA 4FWMA 1YF5L 1GLCG 4BE2A 4H0VB 4EP4A 4B8AB 4IJNA 4GV9A 1VQPN 3T3FA 1VQ6N 4DSJA 3PIPL 3C95A 3KIOA 3VQ6A 4WFNL 1XWLA 5AQTA 3WXLA 3PO5A 1NGIA 2Q31A 3LAKA 4I2PA 3C65A 2UXBK 3AVBA 3FFKB 1DTQA 1KAYA 3VOVA 3O9TA 4BVPA 1CZAN 4QS9A 5ELZA 5J2NA 4BWMA 4FWLA 3VQAA 4F4KA 3VGLA 3M6GA 3RMAA 2BANA 1G15A 2G8WA 1NMNA 3M8SA 5BN8A 4NXNK 4IBNA 2YX6A 2XY5A 3MCPA 4FOIA 1NK0A 4JD2A 2E4LA 3HPHA 3VQCA 3ZX2A 4KTWA 4FM0A 1YJNN 1RDCA 3TU5A 3KKSA 2X6SA 3CCQN 5FROA 1R0AA 4CGFA 3LDNA 3OYBA 1C0TA 4RTFD 3VQ7A 5CYMA 4A61A 4I9LA 3ZT1A 5JS2A 4BGBA 3NHGA 1VQMN 2Z1HA 1TUUA 5LMUK 1C1BA 4CZEA 1HNZK 2DTUA 4U7BA 4KHPK 4BE1A 1OH6A 4CECA 3NE6A 2G8KA 2QEXN 3HOTA 1HKGA 2IS3A 1W7AA 3NBPA 2E2PA 1NGEA 2UYTA 2HB5A 1IBLK 4B9MA 4LC9B 3OYLA 3VQ8A 5AQZA 1GLDG 3TAPA 1VSMA 3FZHA 4B9SA 3LDSA 3C7NA 3F9KA 4LH4A 3VQ5A 2ZM6K 2EX3A 4GVEA 3FZMA 3AA5X 3ZETA 2UUBK 5FRMA 1QQMA 1WSGA 3OW2M 3A5MC 4FOEA 1NJXA 2FSKA 3D0PA 5J2PA 3H45C 3K59A 3SJHA 4NB4A 1S1VA 2RE2A 4GY2B 4RW9A 3THXB 1NLVA 3GE1A 3K57A 4IJAA 2G8UA 4A2BA 4HUEA 4LF8K 2NLXA 3VEWA 1Q9XA 4BROA 1NJWA 2KFZA 2OYQA 4Y1DA 4W5OA 4FO0A 3SV4A 4FJGA 1YI2N 1J54A 3D2EB 4MFBA 5FPNA 2D0BA 5AZIB 1BUPA 3RVCA 1RCHA 2KLAA 1ZBSA 1QS4A 4CZFA 1Q9YA 4DB3A 1QSSA 3SAGA 3KJVA 3CYMA 4J2EA 2B6AA 1BGXT 5JS1A 1ESVA 2P9IA 4EIAA 3H3OB 5M1FA 1JLFA 3IMXA 2YKNA 3OYFA 4LF6K 3SNNA 1NMDA 1HPZA 1YAGA 1FW6A 2RPIA 4BACA 2P51A 4DSIA 3ZSRA 4WYBA 1TYQB 2WFBA 2Q2RA 1T8EA 2GUPA 1W9HA 4Q5VA 3ID8A 3SBTA 1Z6RA 3HP9A 1J5EK 3MCAB 2FLOA 1TVRA 1YJWN 4UY8O 1NGAA 4CF8A 1RTIA 3P1GA 4E19A 4LF5K 4EFHA 1FKPA 3V1OA 4WQ5C 3AAQA 4AQYK 4CZJA 4JRQA 3M5RA 1KVBA 3CCSN 3DOLA 5EY4A 3LWLA 1NG9A 1RT2A 4BRAA 1F21A 1K8AO 4FK0A 1HKBA 4CBWA 1S3XA 5M1KA 4JI1K 2E88A 3VF4A 1MWMA 3SCXA 4KHUA 3SJJA 1RT4A 4AH9A 5GIOA 3H1VX 4BRLA 2E5LK 4GV6A 4NYFA 2P9NA 4BR5A 3CC2N 1NKEA 1GLJO 4BRKA 2H3GX 4A2AA 2QWPA 2JGUA 4KAZA 2OZMA 2BUPA 4IDKA 4FWNA 4I2QA 4AHSA 1BCOA 1S6PA 2RF2A 1GLEG 4DG1A 4DQRA 4K25A 1DLOA 4YNQA 4E7HA 2BGGA 1S22A 4B1WB 3ZX3A 2ZJRL 2P9LA 3AVAA 2HBLA 3A0IX 4E1MA 1IKWA 5C24A 1SZ2A 3OS0A 3T69A 4Z4FA 4KTQA 5I9EB 1YT3A 2I5JA 4FYDA 4ICLA 3KK3A 1VRUA 3OYAA 3DAWA 2BDPA 4B9NA 3TAFA 2LSNA 3EZ5A 4M3UA 4E7LA 4ID5A 1K73O 4B1UB 3D2FA 4IFEA 4GNIA 4A57A 4HTUA 3O4WA 2NZTA 1HYSA 2PAVA 4M3RA 5AQKA 3NFAA 3THWA 4ID1A 3C6AA 3JAMO 4JKDA 1XMOK 5FPDA 4YOUA 5C2FA 4CD1A 5FLXO 4KFBA 1DTTA 4BRQA 4CJ7A 5DM6L 1C1AA 3MEGA 4M41A 1VQ5N 2HBJA 2KZMA 4EHTA 5AQWA 1YHQN 1OKJA 4IOAL 4CEOA 3KTQA 2UXCK 4FJ5A 3WXMB 4E1NA 4LY7A 2HOEA 3MAQA 2EHGA 1UWBA 2HW3A 3QLHA 4DTMA 3NH1A 4CESA 1MDUB 3T1YK 4FVUA 3TR8A 1NK8A 4YOWA 3MXJA 3WEEB 1RDUA 3CJ7A 3KLGA 4CK2A 1IJJA 4ILJA 1U4BA 1XNQK 2Q1NA 4FW2A 1W0HA 4DF8A 4Z4CA 2KFNA 4Y1CA 3UKUB 1I94K 2XY7A 4Z4EA 4J2BA 2ZGYA 3SQ4A 1TK5A 5IWAK 1N36K 4DLGA 3N4QA 3HXMA 2GEMA 2OCEA 4NXMK 4DU1A 4CK1A 4R5PA 1JXBA 2ITGA 4OGCA 1SL1A 3HO1A 5HP1A 4PUOA 3D7EO 5BN9A 2OPQA 1WSIA 3OYMA 4YORA 3MN9A 2Z1IA 3CERA 3KD5E 1YTAA 4PQUA 4L8RB 4CEQA 3F2KA 1C6VA 3PSFA 1E4GT 3NVKA 5M1PA 4J8FA 3BEXA 5JMVA 2P9KA 3CJBA 1EXQA 4H5WA 2W41A 5KQ8A 1C0FA 1WSHA 1B9DA 4JKBA 3FZFA 3OS2A 2KHOA 3CCMN 1IO2A 1L3TA 3MWTA 3U9DA 4CJUA 2FF6A 3HT3A 4B9VA 2HHQA 4FWKA 2V51B 1SUQA 3AY9A 2G8FA 5T7BA 3HRGA 5CE3A 4EAHD 1HQUA 3K5MA 2A5XA 2Y1IA 2D1KA 1D9FA 3CXCM 1R59O 1O13A 1YXQA 4IO9L 1WAFA 2CGJA 3WXKA 3FZKA 3QIOA 4PKIA 3OVNA 2VWBA 1KFSA 4LF9K 3QDKA 4BRNA 1Y97A 1BDGA 1Q8IA 4DTPA 3EO3A 4IZ9A 1HRHA 4F8RA 4HVJA 4B9QA 4C8LA 4B3MK 2CGLA 1EWRA 5LJVA 3G10A 4BQLA 4CHOA 1U45A 2HF4A 1ASUA 1ATRA 5EU7A 4QOZB 3ENBA 5AQVA 1U49A 3VGMA 4QCLA 1W97L 3L2RA 4BDZA 3Q7BA 3CFPA 4CIGA 1NK6A 4MLHA 1VQ8N 1GOBA 1S1TA 3VQ9A 5HRNA 2HBKA 5J2QA 2DFEA 3R8EA 4F3OA 2WUSA 4B9TA 4E1JA 3TWHA 1JJ2M 5J2MA 3WQUA 2OPRA 3S41A 4FJLA 4KH6A 4HCCA 3G0ZA 4Z0UA 4X66K 4MDBA 4CJ3A 2F8SA 4IWVA 2DFHA 3OYDA 3RR8A 4M42A 2YJEA 3JYTA 1EO1A 2NRRA 2YNFA 4JAXA 5GAEP 4YOYA 4YFUA 4BR9A 3MK6A 3AVMA 3LP0A 3GOIA
chains in the Genus database with same CATH topology
4KTWA 2VWJA 4FM0A 2IC3A 1RDCA 4KPYA 1S1XA 2D0AA 3KKSA 1VSFA 3MXMA 5E41A 2KZZA 4J2AA 4O0JA 2X6SA 5HROA 2IDOA 2XO7A 5FROA 1TKTA 3OJUA 2HHUA 4E7JA 3DM2A 1R0AA 4CGFA 3L2WA 3OYBA 3SUPA 3D45A 3KLHA 1C0TA 3VQ7A 4KHYA 1NKCA 5CYMA 1L3SA 1JLCA 3LP2A 4CJVA 1YVUA 4OVLA 1N5YA 3L3VA 4I9LA 1JLGA 3ZT1A 1UA0A 5JS2A 1TK0A 2YV0X 3NHGA 2ZD1A 4CEDA 1D5AA 3HJFA 2OA8A 4DS4A 2Z1HA 2OZSA 4WE1A 4LSNA 1C1BA 4DF4A 3DRRA 4RG8A 2DTUA 3DLRA 4DTUA 1C1CA 1NJZA 1BI4B 4BE1A 1VSJA 1S1UA 4CECA 3KLIA 3NE6A 1TV6A 2G8KA 5I42A 4JRPA 3M8QA 2IS3A 2E6LA 3VQDA 4IFYA 2Z1JA 3NBPA 3U3GA 4FJKA 2HHTA 3TAEA 4N41A 1SKWA 4QAGA 4NCAA 3NH0A 3SZ2A 2B4JA 2HB5A 1XI1A 4B9MA 3NGIA 3OYLA 3VQ8A 2OPPA 3TAPA 5DK5A 1KFDA 1VSMA 5KGWA 3DLKA 4B9SA 2FC0A 4W5RA 3LDSA 3F9KA 4LH4A 4BE0A 4O5BA 3DI6A 3HYFA 4H8KA 3VQ5A 4DFJA 4UQGA 2EX3A 3SPZA 1KSPA 1TAUA 3AA5X 4KB1A 5FRMA 4OGEA 1WSGA 3NH2A 4KHWA 3AVJA 4DTRA 2HNZA 3THVA 4KHSA 1RBRA 3VA3A 3WNGA 3ZSOA 1NJXA 2YNIA 3ASMA 1HJRA 1QHTA 5KI6A 3NDKA 5KTQA 3D0PA 4DTJA 5J2PA 3KLFA 3SI6A 3K59A 2BE2A 1SKRA 1S1VA 1WLJA 4ELVA 4RW9A 3JSMA 4OKJA 3I0RA 4LSLA 4NYNA 2X74A 3CG7A 4CJWA 3ITHA 3WNFA 3K57A 3SQ0A 1NKBA 2G8UA 4OLAA 4H4MA 4HUEA 1C0UA 1ZBFA 3IS9A 3QNOA 3OYCA 3V1QA 4DTXA 3VQ4A 2Q3SA 1Q9XA 1IH7A 1LWCA 1NJWA 1T7PA 2IAJA 5KGXA 3H08A 2P5OA 4DU3A 2KFZA 2OYQA 1RBTA 4W5NA 3QO9A 4Y1DA 4W5OA 3V9SA 1EX4A 4CEZA 3SV4A 4K8XA 1RT5A 3PUFA 4O0IA 4FJGA 1A5XA 4TSXA 1J54A 3AVIA 4MFBA 4N5SA 2P5GA 2D0BA 1BQNA 1RCHA 3ZT0A 3PO4A 1L3VA 4FJMA 3AV9A 1QS4A 3QESA 3HL8A 4M3TA 1Q9YA 3SUNA 3V9UA 3HVTA 1X9WA 1QSSA 4DQQA 1NK7A 4F3TA 3KJVA 2HVIA 3CYMA 5KRTA 3DLGA 4JS4A 4J2EA 2B6AA 4CGJA 2O4IA 4ELTA 2IGIA 2HVHA 4M45A 1BGXT 4JLHA 1LV5A 4HHTA 4AILC 5JS1A 1T03A 3LPTA 3L8BA 3RR7A 3ZSQA 4DTOA 5J1EA 1VSLA 2YKMA 2X78A 3CM6A 3RRHA 4DWIA 1XHXA 1ZYQA 1JLFA 4RW4A 2IOCA 3I8DA 2YKNA 4CJ4A 3OYFA 4C8OA 4B9UA 3O4QA 3SNNA 4N76A 1HPZA 4RW7A 1S9EA 2RPIA 4BACA 1CXQA 2Y1JA 3DRSA 1KLMA 2P51A 4CGIA 4CJTA 4FM2A 4W5QA 4DSIA 4Z4IA 3DLHA 4CCHA 1IKXA 3ZSRA 1T8EA 2QKBA 5I3UA 3IRXA 3HVRA 3PX6A 1BIZA 4CEFA 4XIUA 1VSKA 4CJKA 1W9HA 3LP3A 3NGYA 2YNGA 1S1WA 3AVCA 4GW6A 4Q5VA 1HYVA 3SV3A 4KHQA 1KTQA 3LALA 4CJ5A 4CHYA 4CGGA 1CZ9A 3HP9A 3V9ZA 4GMJB 3BDPA 3C94A 4M3XA 1LW0A 2A1SA 1SKSA 4FZZA 1TVRA 4CHPA 1O1WA 1BISA 4CF8A 3MEEA 1RTIA 3P1GA 4IKFA 4E19A 4FK2A 3AO1A 3O3HA 3OYEA 1FKPA 2XHBA 1WN7A 3V1OA 3ZT3A 3DYAA 4DMNA 3NF9A 4FJHA 4AHTA 1HMVA 4JRQA 1TKXA 1GOAA 1TKDA 3M8PA 1KVBA 3CQ8A 3P5JA 4OPKA 4DSEA 3NCIA 1HNIA 3F73A 4CGDA 3HPOA 3DOLA 3QEIA 3LWLA 3PV8A 3SYZA 1CXUA 4ZTJA 4LH5A 5C42A 1RT2A 3OYIA 4BDPA 2KTQA 3KK1A 2E6MA 1F21A 3AA3A 4FCYA 4B9LA 4FK0A 3AA4A 4M3ZA 3OY9A 1RT6A 2FBTA 1VK0A 5HRSA 4F2RA 4M3WA 1WSJA 3LPUA 4FLUA 1KLNA 1RILA 2QK9A 3NAEA 3SCXA 4DSKA 1NOZA 4W5TA 3SJJA 1RT4A 4CF9A 4KHUA 4AH9A 4FJ8A 4KRFA 3L2VA 2F8TA 3O3FA 4LD0A 3AVHA 3LP1A 1XHZA 3QEPA 4AHCA 1TAQA 3V1RA 1WAJA 4NYFA 1FXXA 1CLQA 3ZSXA 1NKEA 1QTMA 2QXFA 3HM9A 2FBYA 2JGUA 4KAZA 1ZBHA 2OZMA 5DMRA 4IDKA 4I2QA 4AHSA 1BCOA 2G8HA 2YHAA 3NF7A 2ETJA 1RBUA 4FLYA 1B92A 1S6PA 4J2DA 3MECA 4G1QA 1TGOA 4DQSA 3PX0A 2RF2A 4DG1A 1T05A 1TK8A 4DQRA 1DLOA 4YNQA 4E7HA 3K5LA 3MEDA 2DY4A 1GOCA 3RRGA 2BGGA 2XY8A 3ISNC 1BHLA 3ZCMA 1YTUA 4IFVA 3TANA 1JLQA 2HNYA 4FLVA 2KQ2A 3AVAA 4CJEA 4JS5A 4RW8A 1KVAA 5HRPA 1X1PA 4E1MA 1IKWA 5C24A 3QEVA 4BWJA 3OS0A 1RT1A 4FJ9A 4Z4FA 4KTQA 1YT3A 3OJSA 2I5JA 2P1JA 3DMJA 3P83D 4ICLA 4CJLA 3VN5A 3KK3A 1VRUA 4I9QA 4DTNA 3OYAA 3CM5A 2BDPA 4B9NA 4B8CA 3TAFA 2HHSA 2LSNA 3EZ5A 4M3UA 4FLXA 4E7LA 4ID5A 2VWKA 4RW6A 1UAXA 2GV9A 4HUFA 4C8MA 3LAMA 2VG7A 1RNHA 2PYLA 3AO3A 4DLEA 4HTUA 1TL3A 3AO2A 1HYSA 4M3RA 4DSFA 2WONA 1TKZA 1BL3A 3NFAA 3DOKA 1VSEA 4CEAA 3OYNA 1RBSA 1RTHA 4ID1A 1XC9A 5K14A 1ZBLA 4K8ZA 3DRPA 4HUGA 4KFBA 2RKIA 4CJRA 1DTTA 3ZSWA 2KW4A 4AHVA 3S3NA 1LW2A 1C1AA 3MEGA 3V81A 4N47A 4E0DA 4N56A 2ZE2A 3AVFA 3AVLA 3DLEA 4M41A 3SQ2A 2O4GA 4CEEA 3RMCA 3RMDA 1D9DA 1JXEA 5KRSA 2R7YA 4CFCA 2FBVA 2KZMA 3QEWA 4DQIA 3HSTB 3TAMA 5CZ1A 4FLZA 4CFBA 3AA2A 3HP6A 1QE1A 4KKOA 4CEOA 4CFAA 3AVGA 5HBMA 1QSYA 4E89A 1UA1A 3KTQA 4FJJA 4KI4A 4FJ5A 1RDAA 4E1NA 3K58A 4DTSA 2WOMA 3EYZA 4LY7A 4CHQA 1X9MA 1LWFA 3AO5A 3WNEA 1IKYA 2EHGA 3MAQA 4ZTFA 4MQ3A 1UWBA 3K2PA 4CJQA 2HW3A 3QLHA 4DTMA 2QKKA 3NH1A 4FZXC 4AHUA 4CESA 4FLWA 4ZHRA 2HHXA 1JLEA 4CF2A 3V4IA 3EY1A 2NUBA 3TR8A 1NK8A 3OYKA 1IG9A 4FJ7A 3K5OA 2W42A 3MXJA 4KHNA 2GBZA 2XRIA 2RN2A 4KTZA 4OKEA 4OJRA 3KLGA 4DFPA 4CK2A 3ALYA 4Z4HA 3OS1A 4FW2A 1U4BA 1VRTA 3U3YA 4B3OA 4FM1A 3SUQA 1W0HA 4DF8A 4CJSA 4Z4CA 3FFIA 3NGZA 3KK2A 4Y1CA 2KFNA 4Z4EA 2XY7A 4J2BA 1NK4A 5D3GA 3VQBA 3SQ4A 1TK5A 4FYDA 3TAGA 3S3OA 3VQPA 4DLGA 3HXMA 3NF8A 1NOYA 3ZSVA 1KVCA 4E7IA 3PY8A 2YNHA 3MXIA 3IG1A 3UIQA 3V9XA 4DU1A 1LAVA 2GUIA 3K5NA 3ZSZA 1NK9A 4CK1A 2VG6A 4R5PA 1JXBA 2ITGA 4DS5A 1J5OA 4OGCA 4CGHA 1SL1A 1NJYA 3HO1A 5HP1A 4NCGA 3QETA 4PUOA 3QINA 5C25A 4FLTA 3RMBA 1N6QA 1RTDA 4PY5A 2OPQA 1NK5A 1WSIA 3OYMA 3LZIA 4FZYA 5FDLA 3IAYA 4KB0A 4Z4GA 2Z1IA 1B9FA 3KD5E 3AVKA 1YTAA 3QIPA 1U48A 3T1AA 4PQUA 3C6UA 3ZSYA 3SPYA 4O44A 4L8RB 1U04A 1WNSA 3O4NA 2G8IA 4IG3A 3QEXA 4O4GA 3AO4A 4DFKA 4CEQA 1HQEA 4CHZA 2OPSA 3WNHA 1L5UA 1L3UA 1JL2A 1C6VA 1LAWA 4CK3A 1EETA 2AJQA 3TAQA 1SL0A 4M3YA 4KI6A 3I0SA 1UOCA 2G8VA 3VQEA 1J9AA 1EXQA 4ELUA 3LWMA 3VA0A 1A5VA 3CFOA 2PZSA 2B5JA 1JL1A 3RWUA 1ASVA 1WSHA 2A1RA 1B9DA 3OS2A 3TI0A 3ZT4A 1KRPA 1IO2A 4AHRA 1L3TA 3B6OA 1VSIA 2VG5A 5HRRA 3ZT2A 4B08A 3SQ1A 1RDBA 2YHBA 4CJUA 1RT7A 3HT3A 4Q0BA 4B9VA 2HHQA 1REVA 4BDYA 2X6NA 3L3UA 1SUQA 4EZ9A 3QERA 1SL2A 2HNDA 3KD1E 3LANA 4FW1A 2G8FA 3OYHA 5T7BA 3CFRA 4EZ6A 1FKOA 3E01A 5CY4A 4CHNA 1HQUA 3K5MA 2Y1IA 3RTVA 4H4OA 1D9FA 1A5WA 2FBXA 2DFFA 1S9GA 2XY6A 3KLEA 1LWEA 4CJFA 4CFDA 4DQPA 4CJPA 5SZTA 4I7FA 1C0MA 4OPJA 4F2SA 1ZBUA 4FVMA 1EP4A 4IG0A 1WAFA 4FK4A 1WSFA 1VSHA 3M8RA 1Z26A 3QIOA 5HLFA 4DU4A 1EKEA 3OVNA 4EP5A 4KREA 2HHWA 1KFSA 3OYJA 4FJIA 1I39A 1I3AA 1S5JA 1Z25A 4KO0A 2PY5A 4GVMA 5CYQA 3A2FA 1Y97A 4E3SA 1Q8IA 1JKHA 4DTPA 4DSLA 4HCBA 1HRHA 1VSDA 4E7KA 2HMIA 2F96A 3SUOA 1SV5A 3V6DA 1BIUA 1RTJA 4HVJA 4F8RA 2ZQBA 3S3MA 3LZJA 2PYJA 4PWDA 4C8LA 4DFMA 3U6FA 2D0CA 3B6PA 4NCBA 3T19A 4FJNA 4FJXA 1ASWA 3G10A 3BGRA 3S9HA 3AVNA 3KKRA 4CEBA 4CHOA 1U45A 4OLBA 4FXDA 3L2QA 4KV8A 1ASUA 4OKKA 5EU7A 1K6YA 4QOZB 1U49A 4BE2A 4QCLA 4EP4A 4CE9A 1KCFA 1ZBIA 1JLAA 4B8AB 3L2RA 4BDZA 4C8KA 3CFPA 3O3GA 3PX4A 1D8YA 4CIGA 4CIEA 1NK6A 1IKVA 1GOBA 1FK9A 3T3FA 1RDDA 5CZ2A 3OYGA 1QSLA 4DSJA 1S1TA 1S6QA 3C95A 1J53A 1RT3A 3VQ9A 5HRNA 3KIOA 3VQ6A 3V9WA 5J2QA 2DFEA 4F3OA 1CZBA 1XWLA 2D5RA 1MU2A 1JLBA 4B9TA 3TWHA 3PO5A 4PA1A 3LAKA 5J2MA 1RBVA 4I2PA 3NF6A 3VQQA 3AVBA 1DTQA 2OPRA 4CF0A 1TL1A 4FJLA 1BQMA 2JLEA 5SWMA 3G0ZA 4Z0UA 4HCCA 5J2NA 3C6TA 4CJ3A 4BWMA 3TABA 2F8SA 2DFHA 1BI4A 4O55A 3VQAA 4F4KA 3OYDA 3RR8A 4M42A 2ATQA 1HYZA 1QQCA 3RMAA 2BANA 1G15A 3JYTA 3M8SA 1BCMA 3TARA 1X9SA 2G8WA 2HHVA 1ITGA 5FRNA 4IBNA 4CIFA 2YNFA 2XY5A 4CERA 4YFUA 1U47A 2Z1GA 4C8NA 3DLBA 3ULDA 3HK2A 3L2UA 1NK0A 2E4LA 1HNVA 3HPHA 1WSEA 3VQCA 4CF1A 3HPGA 3AVMA 3QNNA 3LP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTW A;  2VWJ A;  4FM0 A;  2IC3 A;  1RDC A;  4KPY A;  1S1X A;  2D0A A;  3KKS A;  1VSF A;  3MXM A;  5E41 A;  2KZZ A;  4J2A A;  4O0J A;  2X6S A;  5HRO A;  2IDO A;  2XO7 A;  5FRO A;  1TKT A;  3OJU A;  2HHU A;  4E7J A;  3DM2 A;  1R0A A;  4CGF A;  3L2W A;  3OYB A;  3SUP A;  3D45 A;  3KLH A;  1C0T A;  3VQ7 A;  4KHY A;  1NKC A;  5CYM A;  1L3S A;  1JLC A;  3LP2 A;  4CJV A;  1YVU A;  4OVL A;  1N5Y A;  3L3V A;  4I9L A;  1JLG A;  3ZT1 A;  1UA0 A;  5JS2 A;  1TK0 A;  2YV0 X;  3NHG A;  2ZD1 A;  4CED A;  1D5A A;  3HJF A;  2OA8 A;  4DS4 A;  2Z1H A;  2OZS A;  4WE1 A;  4LSN A;  1C1B A;  4DF4 A;  3DRR A;  4RG8 A;  2DTU A;  3DLR A;  4DTU A;  1C1C A;  1NJZ A;  1BI4 B;  4BE1 A;  1VSJ A;  1S1U A;  4CEC A;  3KLI A;  3NE6 A;  1TV6 A;  2G8K A;  5I42 A;  4JRP A;  3M8Q A;  2IS3 A;  2E6L A;  3VQD A;  4IFY A;  2Z1J A;  3NBP A;  3U3G A;  4FJK A;  2HHT A;  3TAE A;  4N41 A;  1SKW A;  4QAG A;  4NCA A;  3NH0 A;  3SZ2 A;  2B4J A;  2HB5 A;  1XI1 A;  4B9M A;  3NGI A;  3OYL A;  3VQ8 A;  2OPP A;  3TAP A;  5DK5 A;  1KFD A;  1VSM A;  5KGW A;  3DLK A;  4B9S A;  2FC0 A;  4W5R A;  3LDS A;  3F9K A;  4LH4 A;  4BE0 A;  4O5B A;  3DI6 A;  3HYF A;  4H8K A;  3VQ5 A;  4DFJ A;  4UQG A;  2EX3 A;  3SPZ A;  1KSP A;  1TAU A;  3AA5 X;  4KB1 A;  5FRM A;  4OGE A;  1WSG A;  3NH2 A;  4KHW A;  3AVJ A;  4DTR A;  2HNZ A;  3THV A;  4KHS A;  1RBR A;  3VA3 A;  3WNG A;  3ZSO A;  1NJX A;  2YNI A;  3ASM A;  1HJR A;  1QHT A;  5KI6 A;  3NDK A;  5KTQ A;  3D0P A;  4DTJ A;  5J2P A;  3KLF A;  3SI6 A;  3K59 A;  2BE2 A;  1SKR A;  1S1V A;  1WLJ A;  4ELV A;  4RW9 A;  3JSM A;  4OKJ A;  3I0R A;  4LSL A;  4NYN A;  2X74 A;  3CG7 A;  4CJW A;  3ITH A;  3WNF A;  3K57 A;  3SQ0 A;  1NKB A;  2G8U A;  4OLA A;  4H4M A;  4HUE A;  1C0U A;  1ZBF A;  3IS9 A;  3QNO A;  3OYC A;  3V1Q A;  4DTX A;  3VQ4 A;  2Q3S A;  1Q9X A;  1IH7 A;  1LWC A;  1NJW A;  1T7P A;  2IAJ A;  5KGX A;  3H08 A;  2P5O A;  4DU3 A;  2KFZ A;  2OYQ A;  1RBT A;  4W5N A;  3QO9 A;  4Y1D A;  4W5O A;  3V9S A;  1EX4 A;  4CEZ A;  3SV4 A;  4K8X A;  1RT5 A;  3PUF A;  4O0I A;  4FJG A;  1A5X A;  4TSX A;  1J54 A;  3AVI A;  4MFB A;  4N5S A;  2P5G A;  2D0B A;  1BQN A;  1RCH A;  3ZT0 A;  3PO4 A;  1L3V A;  4FJM A;  3AV9 A;  1QS4 A;  3QES A;  3HL8 A;  4M3T A;  1Q9Y A;  3SUN A;  3V9U A;  3HVT A;  1X9W A;  1QSS A;  4DQQ A;  1NK7 A;  4F3T A;  3KJV A;  2HVI A;  3CYM A;  5KRT A;  3DLG A;  4JS4 A;  4J2E A;  2B6A A;  4CGJ A;  2O4I A;  4ELT A;  2IGI A;  2HVH A;  4M45 A;  1BGX T;  4JLH A;  1LV5 A;  4HHT A;  4AIL C;  5JS1 A;  1T03 A;  3LPT A;  3L8B A;  3RR7 A;  3ZSQ A;  4DTO A;  5J1E A;  1VSL A;  2YKM A;  2X78 A;  3CM6 A;  3RRH A;  4DWI A;  1XHX A;  1ZYQ A;  1JLF A;  4RW4 A;  2IOC A;  3I8D A;  2YKN A;  4CJ4 A;  3OYF A;  4C8O A;  4B9U A;  3O4Q A;  3SNN A;  4N76 A;  1HPZ A;  4RW7 A;  1S9E A;  2RPI A;  4BAC A;  1CXQ A;  2Y1J A;  3DRS A;  1KLM A;  2P51 A;  4CGI A;  4CJT A;  4FM2 A;  4W5Q A;  4DSI A;  4Z4I A;  3DLH A;  4CCH A;  1IKX A;  3ZSR A;  1T8E A;  2QKB A;  5I3U A;  3IRX A;  3HVR A;  3PX6 A;  1BIZ A;  4CEF A;  4XIU A;  1VSK A;  4CJK A;  1W9H A;  3LP3 A;  3NGY A;  2YNG A;  1S1W A;  3AVC A;  4GW6 A;  4Q5V A;  1HYV A;  3SV3 A;  4KHQ A;  1KTQ A;  3LAL A;  4CJ5 A;  4CHY A;  4CGG A;  1CZ9 A;  3HP9 A;  3V9Z A;  4GMJ B;  3BDP A;  3C94 A;  4M3X A;  1LW0 A;  2A1S A;  1SKS A;  4FZZ A;  1TVR A;  4CHP A;  1O1W A;  1BIS A;  4CF8 A;  3MEE A;  1RTI A;  3P1G A;  4IKF A;  4E19 A;  4FK2 A;  3AO1 A;  3O3H A;  3OYE A;  1FKP A;  2XHB A;  1WN7 A;  3V1O A;  3ZT3 A;  3DYA A;  4DMN A;  3NF9 A;  4FJH A;  4AHT A;  1HMV A;  4JRQ A;  1TKX A;  1GOA A;  1TKD A;  3M8P A;  1KVB A;  3CQ8 A;  3P5J A;  4OPK A;  4DSE A;  3NCI A;  1HNI A;  3F73 A;  4CGD A;  3HPO A;  3DOL A;  3QEI A;  3LWL A;  3PV8 A;  3SYZ A;  1CXU A;  4ZTJ A;  4LH5 A;  5C42 A;  1RT2 A;  3OYI A;  4BDP A;  2KTQ A;  3KK1 A;  2E6M A;  1F21 A;  3AA3 A;  4FCY A;  4B9L A;  4FK0 A;  3AA4 A;  4M3Z A;  3OY9 A;  1RT6 A;  2FBT A;  1VK0 A;  5HRS A;  4F2R A;  4M3W A;  1WSJ A;  3LPU A;  4FLU A;  1KLN A;  1RIL A;  2QK9 A;  3NAE A;  3SCX A;  4DSK A;  1NOZ A;  4W5T A;  3SJJ A;  1RT4 A;  4CF9 A;  4KHU A;  4AH9 A;  4FJ8 A;  4KRF A;  3L2V A;  2F8T A;  3O3F A;  4LD0 A;  3AVH A;  3LP1 A;  1XHZ A;  3QEP A;  4AHC A;  1TAQ A;  3V1R A;  1WAJ A;  4NYF A;  1FXX A;  1CLQ A;  3ZSX A;  1NKE A;  1QTM A;  2QXF A;  3HM9 A;  2FBY A;  2JGU A;  4KAZ A;  1ZBH A;  2OZM A;  5DMR A;  4IDK A;  4I2Q A;  4AHS A;  1BCO A;  2G8H A;  2YHA A;  3NF7 A;  2ETJ A;  1RBU A;  4FLY A;  1B92 A;  1S6P A;  4J2D A;  3MEC A;  4G1Q A;  1TGO A;  4DQS A;  3PX0 A;  2RF2 A;  4DG1 A;  1T05 A;  1TK8 A;  4DQR A;  1DLO A;  4YNQ A;  4E7H A;  3K5L A;  3MED A;  2DY4 A;  1GOC A;  3RRG A;  2BGG A;  2XY8 A;  3ISN C;  1BHL A;  3ZCM A;  1YTU A;  4IFV A;  3TAN A;  1JLQ A;  2HNY A;  4FLV A;  2KQ2 A;  3AVA A;  4CJE A;  4JS5 A;  4RW8 A;  1KVA A;  5HRP A;  1X1P A;  4E1M A;  1IKW A;  5C24 A;  3QEV A;  4BWJ A;  3OS0 A;  1RT1 A;  4FJ9 A;  4Z4F A;  4KTQ A;  1YT3 A;  3OJS A;  2I5J A;  2P1J A;  3DMJ A;  3P83 D;  4ICL A;  4CJL A;  3VN5 A;  3KK3 A;  1VRU A;  4I9Q A;  4DTN A;  3OYA A;  3CM5 A;  2BDP A;  4B9N A;  4B8C A;  3TAF A;  2HHS A;  2LSN A;  3EZ5 A;  4M3U A;  4FLX A;  4E7L A;  4ID5 A;  2VWK A;  4RW6 A;  1UAX A;  2GV9 A;  4HUF A;  4C8M A;  3LAM A;  2VG7 A;  1RNH A;  2PYL A;  3AO3 A;  4DLE A;  4HTU A;  1TL3 A;  3AO2 A;  1HYS A;  4M3R A;  4DSF A;  2WON A;  1TKZ A;  1BL3 A;  3NFA A;  3DOK A;  1VSE A;  4CEA A;  3OYN A;  1RBS A;  1RTH A;  4ID1 A;  1XC9 A;  5K14 A;  1ZBL A;  4K8Z A;  3DRP A;  4HUG A;  4KFB A;  2RKI A;  4CJR A;  1DTT A;  3ZSW A;  2KW4 A;  4AHV A;  3S3N A;  1LW2 A;  1C1A A;  3MEG A;  3V81 A;  4N47 A;  4E0D A;  4N56 A;  2ZE2 A;  3AVF A;  3AVL A;  3DLE A;  4M41 A;  3SQ2 A;  2O4G A;  4CEE A;  3RMC A;  3RMD A;  1D9D A;  1JXE A;  5KRS A;  2R7Y A;  4CFC A;  2FBV A;  2KZM A;  3QEW A;  4DQI A;  3HST B;  3TAM A;  5CZ1 A;  4FLZ A;  4CFB A;  3AA2 A;  3HP6 A;  1QE1 A;  4KKO A;  4CEO A;  4CFA A;  3AVG A;  5HBM A;  1QSY A;  4E89 A;  1UA1 A;  3KTQ A;  4FJJ A;  4KI4 A;  4FJ5 A;  1RDA A;  4E1N A;  3K58 A;  4DTS A;  2WOM A;  3EYZ A;  4LY7 A;  4CHQ A;  1X9M A;  1LWF A;  3AO5 A;  3WNE A;  1IKY A;  2EHG A;  3MAQ A;  4ZTF A;  4MQ3 A;  1UWB A;  3K2P A;  4CJQ A;  2HW3 A;  3QLH A;  4DTM A;  2QKK A;  3NH1 A;  4FZX C;  4AHU A;  4CES A;  4FLW A;  4ZHR A;  2HHX A;  1JLE A;  4CF2 A;  3V4I A;  3EY1 A;  2NUB A;  3TR8 A;  1NK8 A;  3OYK A;  1IG9 A;  4FJ7 A;  3K5O A;  2W42 A;  3MXJ A;  4KHN A;  2GBZ A;  2XRI A;  2RN2 A;  4KTZ A;  4OKE A;  4OJR A;  3KLG A;  4DFP A;  4CK2 A;  3ALY A;  4Z4H A;  3OS1 A;  4FW2 A;  1U4B A;  1VRT A;  3U3Y A;  4B3O A;  4FM1 A;  3SUQ A;  1W0H A;  4DF8 A;  4CJS A;  4Z4C A;  3FFI A;  3NGZ A;  3KK2 A;  4Y1C A;  2KFN A;  4Z4E A;  2XY7 A;  4J2B A;  1NK4 A;  5D3G A;  3VQB A;  3SQ4 A;  1TK5 A;  4FYD A;  3TAG A;  3S3O A;  3VQP A;  4DLG A;  3HXM A;  3NF8 A;  1NOY A;  3ZSV A;  1KVC A;  4E7I A;  3PY8 A;  2YNH A;  3MXI A;  3IG1 A;  3UIQ A;  3V9X A;  4DU1 A;  1LAV A;  2GUI A;  3K5N A;  3ZSZ A;  1NK9 A;  4CK1 A;  2VG6 A;  4R5P A;  1JXB A;  2ITG A;  4DS5 A;  1J5O A;  4OGC A;  4CGH A;  1SL1 A;  1NJY A;  3HO1 A;  5HP1 A;  4NCG A;  3QET A;  4PUO A;  3QIN A;  5C25 A;  4FLT A;  3RMB A;  1N6Q A;  1RTD A;  4PY5 A;  2OPQ A;  1NK5 A;  1WSI A;  3OYM A;  3LZI A;  4FZY A;  5FDL A;  3IAY A;  4KB0 A;  4Z4G A;  2Z1I A;  1B9F A;  3KD5 E;  3AVK A;  1YTA A;  3QIP A;  1U48 A;  3T1A A;  4PQU A;  3C6U A;  3ZSY A;  3SPY A;  4O44 A;  4L8R B;  1U04 A;  1WNS A;  3O4N A;  2G8I A;  4IG3 A;  3QEX A;  4O4G A;  3AO4 A;  4DFK A;  4CEQ A;  1HQE A;  4CHZ A;  2OPS A;  3WNH A;  1L5U A;  1L3U A;  1JL2 A;  1C6V A;  1LAW A;  4CK3 A;  1EET A;  2AJQ A;  3TAQ A;  1SL0 A;  4M3Y A;  4KI6 A;  3I0S A;  1UOC A;  2G8V A;  3VQE A;  1J9A A;  1EXQ A;  4ELU A;  3LWM A;  3VA0 A;  1A5V A;  3CFO A;  2PZS A;  2B5J A;  1JL1 A;  3RWU A;  1ASV A;  1WSH A;  2A1R A;  1B9D A;  3OS2 A;  3TI0 A;  3ZT4 A;  1KRP A;  1IO2 A;  4AHR A;  1L3T A;  3B6O A;  1VSI A;  2VG5 A;  5HRR A;  3ZT2 A;  4B08 A;  3SQ1 A;  1RDB A;  2YHB A;  4CJU A;  1RT7 A;  3HT3 A;  4Q0B A;  4B9V A;  2HHQ A;  1REV A;  4BDY A;  2X6N A;  3L3U A;  1SUQ A;  4EZ9 A;  3QER A;  1SL2 A;  2HND A;  3KD1 E;  3LAN A;  4FW1 A;  2G8F A;  3OYH A;  5T7B A;  3CFR A;  4EZ6 A;  1FKO A;  3E01 A;  5CY4 A;  4CHN A;  1HQU A;  3K5M A;  2Y1I A;  3RTV A;  4H4O A;  1D9F A;  1A5W A;  2FBX A;  2DFF A;  1S9G A;  2XY6 A;  3KLE A;  1LWE A;  4CJF A;  4CFD A;  4DQP A;  4CJP A;  5SZT A;  4I7F A;  1C0M A;  4OPJ A;  4F2S A;  1ZBU A;  4FVM A;  1EP4 A;  4IG0 A;  1WAF A;  4FK4 A;  1WSF A;  1VSH A;  3M8R A;  1Z26 A;  3QIO A;  5HLF A;  4DU4 A;  1EKE A;  3OVN A;  4EP5 A;  4KRE A;  2HHW A;  1KFS A;  3OYJ A;  4FJI A;  1I39 A;  1I3A A;  1S5J A;  1Z25 A;  4KO0 A;  2PY5 A;  4GVM A;  5CYQ A;  3A2F A;  1Y97 A;  4E3S A;  1Q8I A;  1JKH A;  4DTP A;  4DSL A;  4HCB A;  1HRH A;  1VSD A;  4E7K A;  2HMI A;  2F96 A;  3SUO A;  1SV5 A;  3V6D A;  1BIU A;  1RTJ A;  4HVJ A;  4F8R A;  2ZQB A;  3S3M A;  3LZJ A;  2PYJ A;  4PWD A;  4C8L A;  4DFM A;  3U6F A;  2D0C A;  3B6P A;  4NCB A;  3T19 A;  4FJN A;  4FJX A;  1ASW A;  3G10 A;  3BGR A;  3S9H A;  3AVN A;  3KKR A;  4CEB A;  4CHO A;  1U45 A;  4OLB A;  4FXD A;  3L2Q A;  4KV8 A;  1ASU A;  4OKK A;  5EU7 A;  1K6Y A;  4QOZ B;  1U49 A;  4BE2 A;  4QCL A;  4EP4 A;  4CE9 A;  1KCF A;  1ZBI A;  1JLA A;  4B8A B;  3L2R A;  4BDZ A;  4C8K A;  3CFP A;  3O3G A;  3PX4 A;  1D8Y A;  4CIG A;  4CIE A;  1NK6 A;  1IKV A;  1GOB A;  1FK9 A;  3T3F A;  1RDD A;  5CZ2 A;  3OYG A;  1QSL A;  4DSJ A;  1S1T A;  1S6Q A;  3C95 A;  1J53 A;  1RT3 A;  3VQ9 A;  5HRN A;  3KIO A;  3VQ6 A;  3V9W A;  5J2Q A;  2DFE A;  4F3O A;  1CZB A;  1XWL A;  2D5R A;  1MU2 A;  1JLB A;  4B9T A;  3TWH A;  3PO5 A;  4PA1 A;  3LAK A;  5J2M A;  1RBV A;  4I2P A;  3NF6 A;  3VQQ A;  3AVB A;  1DTQ A;  2OPR A;  4CF0 A;  1TL1 A;  4FJL A;  1BQM A;  2JLE A;  5SWM A;  3G0Z A;  4Z0U A;  4HCC A;  5J2N A;  3C6T A;  4CJ3 A;  4BWM A;  3TAB A;  2F8S A;  2DFH A;  1BI4 A;  4O55 A;  3VQA A;  4F4K A;  3OYD A;  3RR8 A;  4M42 A;  2ATQ A;  1HYZ A;  1QQC A;  3RMA A;  2BAN A;  1G15 A;  3JYT A;  3M8S A;  1BCM A;  3TAR A;  1X9S A;  2G8W A;  2HHV A;  1ITG A;  5FRN A;  4IBN A;  4CIF A;  2YNF A;  2XY5 A;  4CER A;  4YFU A;  1U47 A;  2Z1G A;  4C8N A;  3DLB A;  3ULD A;  3HK2 A;  3L2U A;  1NK0 A;  2E4L A;  1HNV A;  3HPH A;  1WSE A;  3VQC A;  4CF1 A;  3HPG A;  3AVM A;  3QNN A;  3LP0 A; 
#chains in the Genus database with same CATH topology
 4WQ4 A;  5FPE A;  4KPY A;  1S1X A;  3LDO A;  3MXM A;  5E41 A;  2KZZ A;  4O0J A;  1TKT A;  4XH1 A;  3DM2 A;  1H1V A;  1K9M O;  1NKC A;  1N5Y A;  3L3V A;  3OA9 A;  3OBY A;  1JLG A;  3HJF A;  4CED A;  4DV7 K;  4DS4 A;  2OA8 A;  2OZS A;  4WE1 A;  4PHT X;  3THX A;  5AQQ A;  3EL2 A;  1VSJ A;  4BRD A;  4H0T B;  3KLI A;  4H5V A;  1TV6 A;  2WC9 A;  3M8Q A;  3VQD A;  3EE9 A;  4IFY A;  3TAE A;  4JHD B;  2HBM A;  1KXP A;  3NH0 A;  2AP1 A;  3NGI A;  1HNW K;  3D2E A;  3D6R A;  1KFD A;  5AZI A;  4IOX A;  3CCU N;  1J6Z A;  3SMS A;  4O5B A;  3KWI A;  2ZGZ A;  2CH5 A;  2ZWH A;  1TAU A;  3THV A;  4KHS A;  1KAZ A;  2HNZ A;  3WNG A;  3ZSO A;  4CVN E;  4FWR A;  5KTQ A;  3UE5 A;  2ZJQ L;  4ELV A;  3JSM A;  2CGK A;  5LL6 Z;  1HJO A;  4NYN A;  2X74 A;  1Y64 A;  1NKB A;  2F9W A;  3BP8 A;  4K0K K;  1BA0 A;  4H4M A;  3QNO A;  3SAF A;  4DTX A;  1IH7 A;  2HST A;  5KGX A;  4IEI A;  4OX9 K;  1TYQ A;  4DU3 A;  3CD6 N;  5LJW A;  4W5N A;  3QO9 A;  4DCH A;  5CHI A;  4K8X A;  1E3M A;  3PUF A;  4O0I A;  3AVI A;  2JWK A;  4N5S A;  2P5G A;  4FJM A;  1L3V A;  4M3T A;  4DUY K;  3HVT A;  4PL8 A;  1QVG M;  3T1H K;  3H46 O;  3O1W A;  1SQK A;  4M45 A;  2QA4 N;  1LV5 A;  5BRF A;  4HHT A;  3E1Y A;  1T03 A;  3L6Q A;  3QBX A;  3L8B A;  3HBT A;  1K8K B;  3PSI A;  2F9T A;  1VSL A;  2A42 A;  2X78 A;  3CM6 A;  3ZSQ A;  5J1E A;  4NO7 A;  1ZYQ A;  2IOC A;  3O9U A;  3I8D A;  4GKJ K;  3CJA A;  4C8O A;  2JWL A;  3U9Z A;  3DRS A;  4JKE A;  1KLM A;  4FM2 A;  3KVG A;  2NRV A;  3DLH A;  3SMP A;  3ZEU B;  5I3U A;  3IRX A;  5C12 A;  1XC3 A;  3K9K A;  5C10 A;  2YNG A;  1RGI A;  1S1W A;  2V7Z A;  1DEJ A;  3SV3 A;  2FSJ A;  3BY5 A;  3V9Z A;  4GMJ B;  3C94 A;  1LW0 A;  2ZJP L;  1QZ6 A;  1O1W A;  1BIS A;  4IKF A;  3O3H A;  3VEO A;  1NM1 A;  1WN7 A;  3O9R A;  3DYA A;  1HMV A;  4V19 S;  2BH1 A;  4FPB A;  3NCI A;  3PV8 A;  3HPO A;  5C42 A;  3KK1 A;  1KQS M;  3AA3 A;  4FCY A;  3OY9 A;  1RT6 A;  4BRH A;  3BZC A;  3HZ6 A;  1KLN A;  3E9O A;  3BF3 A;  1NOZ A;  4W5T A;  3FZL A;  3TTF A;  3VEV A;  2F8T A;  4JN4 A;  1G99 A;  1WAJ A;  1FXX A;  3ZSX A;  4JKG B;  3HM9 A;  5EOY A;  4H0P A;  1ZBH A;  5DMR A;  3CME N;  4AM6 A;  2YHA A;  1RBU A;  2DPN A;  3FGU A;  5M1N A;  3J7A P;  1WUA A;  3CET A;  3MED A;  3OBW A;  4WF9 L;  1KC8 O;  1GOC A;  3RRG A;  1VQN N;  1YTU A;  3VET A;  3G71 N;  4IFV A;  2W6L A;  3VTI A;  4CJE A;  5LY3 A;  1X1P A;  1RDW X;  5FPM A;  5HL7 L;  1RT1 A;  2OTJ N;  3OJS A;  2P1J A;  3DMJ A;  4CJL A;  3VN5 A;  1DKG D;  5AQM A;  4R79 A;  2HHS A;  3TSQ A;  2V52 B;  4FLX A;  3P4I A;  1KAX A;  2VWK A;  4RW6 A;  3QML A;  4H5T A;  2KKZ A;  2GV9 A;  3ZX0 A;  1KD1 O;  3LAM A;  1LOT B;  3AO3 A;  4JI3 K;  1HLU A;  1TL3 A;  4BR0 A;  5TKY A;  4DSF A;  2WON A;  3WEE A;  1VSE A;  4CEA A;  4B3T K;  1RBS A;  3I56 N;  3O5B A;  1NBW A;  3EEQ A;  4X65 K;  4PL7 A;  2RKI A;  3ZLJ A;  3UKU A;  2CH6 A;  3S3N A;  4N56 A;  1NNE A;  3RMC A;  2O4G A;  4CEE A;  4RCH A;  1P8Z A;  5KRS A;  2R7Y A;  4JI5 K;  4DKW A;  2QWL A;  1OH8 A;  4JI8 K;  5CZ1 A;  4CFB A;  3AVG A;  1UA1 A;  4B1Y B;  2WOM A;  3GBT A;  3IDH A;  1X9M A;  2WTU A;  2O8E B;  3WNE A;  4MQ3 A;  2GTD A;  3CI5 A;  4CJQ A;  1NGD A;  2QKK A;  4ZHR A;  5BRH A;  3EY1 A;  1IG9 A;  3OYK A;  5C0Y A;  3K5O A;  2RN2 A;  4KTZ A;  4DFP A;  3GG4 A;  1QQO A;  1VRT A;  2VGN A;  3SUQ A;  4CJS A;  4DUZ K;  3NGZ A;  4IXC A;  3GDQ A;  3S3O A;  3VQP A;  3NF8 A;  1HUX A;  3I33 A;  3SAH A;  3P31 A;  3IG1 A;  3UIQ A;  2P9U B;  3V9X A;  1LAV A;  3K5N A;  4PKH A;  4FPA A;  4DS5 A;  4CGH A;  3CF5 L;  1NJY A;  2Q0U A;  3QIN A;  4XH5 A;  5E84 A;  3H6E A;  1N6Q A;  4PY5 A;  4LFB K;  4YDU A;  2O8C B;  4FZY A;  2E2O A;  5AQP A;  4KB0 A;  4Z4G A;  1U48 A;  3C6U A;  3LM2 A;  1WNS A;  4JI6 K;  2ASO A;  3VTH A;  4IG3 A;  4WQ4 C;  4O4G A;  3AO4 A;  4DFK A;  2OPS A;  2QI2 A;  3WNH A;  1L5U A;  1L3U A;  3E9P A;  1EET A;  2AJQ A;  3TAQ A;  1SL0 A;  1UOC A;  4B1X B;  2G8V A;  3VQE A;  1J9A A;  2D0O A;  3F5T A;  4FWS A;  1A5V A;  3CFO A;  2B5J A;  2NRT A;  4JKF A;  2HMP A;  3ZT4 A;  1KRP A;  4CZH A;  1V4S A;  3B6O A;  1VSI A;  1HR0 K;  3SQ1 A;  4DR4 K;  4Q0B A;  3ATV A;  5CR4 A;  2X6N A;  4Y0W A;  4BQZ A;  4EZ9 A;  1SL2 A;  4JKH A;  5IT9 O;  3THY B;  3LAN A;  1FKO A;  5CY4 A;  3RTV A;  2O8B B;  2FBX A;  2DFF A;  5LMN K;  1LWE A;  1YJ9 N;  1NGB A;  4I7F A;  1C0M A;  3Q7C A;  4C1N K;  4IG0 A;  1EP4 A;  3WQT A;  1VSH A;  5DM7 L;  4YOX A;  2V7Y A;  2HHW A;  1XQS C;  4KRE A;  3HSC A;  1BO5 O;  3FLC O;  3EZW A;  1I39 A;  3SLC A;  4KO0 A;  2PY5 A;  5CYQ A;  3A2F A;  3LL3 A;  3G25 A;  5F2R A;  3VPZ A;  3QBW A;  4E7K A;  2HMI A;  4IDH A;  1RTJ A;  2FXU A;  1NGJ A;  2ASM A;  5ADX A;  3S3M A;  3OHR A;  4XEI A;  2PYJ A;  4DFM A;  5GIN A;  3AGR A;  4FJN A;  4FJX A;  3J81 O;  3J7Y P;  4CEB A;  4OLB A;  3L2Q A;  4K43 A;  1HX1 A;  5M1O A;  4CBU A;  1Q86 O;  4JK9 A;  1KCF A;  4C8K A;  4O8K A;  3O3G A;  4CIE A;  1FK9 A;  5GAG P;  1RDD A;  1QSL A;  1VQ7 N;  5BPN A;  1S6Q A;  3VEZ A;  1J53 A;  5BR8 K;  3V9W A;  1CZB A;  4DR6 K;  2D5R A;  3HOS A;  1MU2 A;  1JLB A;  5C2D A;  4PA1 A;  4MO5 A;  1RBV A;  3NF6 A;  4C1N I;  2FF3 B;  3IKM A;  3P39 A;  2JLE A;  3C6T A;  1JCF A;  2ATQ A;  5FRN A;  4CIF A;  1OVQ A;  3BF1 A;  4JHD A;  1T44 A;  4CER A;  3DLB A;  4M7X A;  3HK2 A;  1HNV A;  3FE1 A;  4CF1 A;  3HPG A;  4JYA K;  5EXW A;  4MLE A;  2IDO A;  4XH4 A;  2XO7 A;  3OJU A;  1IBK K;  4E7J A;  4X64 K;  3L2W A;  3D45 A;  3KLH A;  4KHY A;  3C0B A;  1L3S A;  1JLC A;  1YVU A;  4OVL A;  1UA0 A;  2YV0 X;  2PFU A;  1D5A A;  4YOT A;  4LSN A;  2F7T A;  3DRR A;  4RG8 A;  4JK7 A;  4DTU A;  1BI4 B;  1S1U A;  4CBX A;  1BG3 A;  1WBD A;  1N32 K;  5I42 A;  1V4T A;  4JRP A;  4LF4 K;  1BOT O;  2Z1J A;  3U3G A;  4FJK A;  1W2B M;  4N41 A;  4QAG A;  3SZ2 A;  2B4J A;  3ATU A;  3VEN A;  2O8F B;  2FC0 A;  2E1Z A;  1KSP A;  2NRW A;  4RWT A;  4KHW A;  3AVJ A;  1X9J A;  5KI6 A;  3O9Q A;  3LM9 A;  3SI6 A;  1K8K A;  3MX5 A;  2BE2 A;  1GLF O;  4OKJ A;  4DR7 K;  3I0R A;  3VMF B;  2E2N A;  4CD3 A;  3CG7 A;  4OLA A;  3ITH A;  3N4P A;  3WNF A;  3SQ0 A;  2D4W A;  3O9S A;  3G6E N;  1ZBF A;  3IS9 A;  3OYC A;  1D4X A;  3VQ4 A;  1LWC A;  1T7P A;  5GAH P;  2IAJ A;  2P5O A;  3ZEU A;  5B8H A;  1EX4 A;  4CEZ A;  4DV6 K;  4BC5 A;  1A5X A;  2E8A A;  2HHH K;  2UUC K;  3ZT0 A;  1E4F T;  3PO4 A;  3SUN A;  4K41 A;  3V9U A;  1X9W A;  4QS8 A;  1NK7 A;  4F3T A;  3CHW A;  2HVI A;  3DLG A;  3H1Q A;  1IBM K;  2HVH A;  1NU0 A;  3JXU A;  4DV2 K;  4AIL C;  2YI1 A;  3RR7 A;  4DTO A;  4DWI A;  1Q7Y O;  4RW4 A;  4CJ4 A;  4ISF A;  4B9U A;  3O4Q A;  3CCV N;  4RW7 A;  1S9E A;  2ITM A;  3AAP A;  4CGI A;  4W5Q A;  5AQG A;  2YJF A;  3CJ9 A;  4Z4I A;  4CCH A;  3TTC A;  4C23 A;  1IKX A;  3VES A;  3ENO A;  2QKB A;  3HVR A;  3BZK A;  4GW6 A;  3AVC A;  5BR9 A;  1VQO N;  1HYV A;  1KTQ A;  4CJ5 A;  4CGG A;  4CZM A;  3VEY A;  3BDP A;  2A1S A;  4CHP A;  4A5A A;  5F0X A;  3MEE A;  4JKG A;  3R9P A;  3AO1 A;  1WBB A;  1DT9 A;  2XHB A;  4DMN A;  4FJH A;  5AQR A;  1TKD A;  3M8P A;  3CQ8 A;  3P5J A;  1HNI A;  4CGD A;  3QEI A;  1CXU A;  4ZTJ A;  3O80 A;  4LH5 A;  1VQ9 N;  3OYI A;  4BDP A;  2E6M A;  1N34 K;  3AA4 A;  3TPQ A;  3HM8 A;  1QHA A;  1VK0 A;  5HRS A;  1BA1 A;  3TTD A;  1WSJ A;  4FLU A;  2QK9 A;  3NAE A;  4CF9 A;  4DV1 K;  4HWI A;  4YDU C;  3O3F A;  2VCP A;  1ZC6 A;  3MMV A;  1XHZ A;  3QEP A;  3VF2 A;  1CLQ A;  3J8A A;  1OH7 A;  5BRE A;  2FBY A;  2E20 A;  1XMQ K;  2QW9 A;  3NF7 A;  2ETJ A;  4FLY A;  1B92 A;  4EHU A;  3R3L A;  4G1Q A;  4DQS A;  1T05 A;  4JEP A;  1TK8 A;  4BVO A;  3CQX A;  3K5L A;  3U4L A;  1VQL N;  2YCH A;  3ISN C;  1BHL A;  1JLQ A;  2P9S B;  2KQ2 A;  4JS5 A;  4RW8 A;  2NRH A;  1QVF M;  4FJ9 A;  3MN5 A;  4ILG B;  4I9Q A;  3P83 D;  3M1F A;  4DTN A;  3CM5 A;  2HF3 A;  2O8E A;  2QTD A;  2VG7 A;  2PYL A;  3AO2 A;  3O6W A;  3W0L A;  3DXM B;  2QWM A;  2QWR A;  1VHX A;  1XC9 A;  1YIJ N;  1ZBL A;  4K8Z A;  3EKS A;  3HTV A;  3C6H A;  5AQJ A;  4CJR A;  3ZSW A;  5BRD A;  3VER A;  4N47 A;  3O8M A;  3SQ2 A;  3DLE A;  1D9D A;  3RMD A;  3VEX A;  5BPM A;  2P9U A;  4DQI A;  3HST B;  1NGH A;  3TAM A;  4FLZ A;  3AA2 A;  2E1Y A;  3EN9 A;  5AR0 A;  1QSY A;  3CJ1 A;  4FZZ A;  5HBM A;  1OH5 A;  4FJJ A;  4BRC A;  4DTS A;  2F4V K;  3EYZ A;  2O8C A;  2Q97 A;  1IKY A;  2YHY A;  3CPW M;  3GL1 A;  4FZX C;  4FLW A;  4DR5 K;  4CF2 A;  4JV5 K;  2IVN A;  4OPH A;  4KHN A;  3A5O C;  2GBZ A;  2XRI A;  3U8X A;  2VQF K;  1JCG A;  3WXI A;  4JKC A;  4Z4H A;  3U3Y A;  4B3O A;  4FM1 A;  3FFI A;  2QWN A;  3KK2 A;  1T6D A;  3VQB A;  3BUZ B;  1T6C A;  3A5L C;  3UB5 A;  3EKU A;  2D0P A;  4HTL A;  3ZSV A;  4E7I A;  4B3S K;  3MXI A;  4DV5 K;  1T3V A;  2GUI A;  3L4Q A;  3ZSZ A;  1NK9 A;  1BU6 O;  2VG6 A;  2VYP A;  1XNR K;  4G9Z A;  1U6Z A;  4BR7 A;  3ID6 A;  1BWF O;  4BR4 A;  3CQY A;  1NK5 A;  4ISG A;  3LZI A;  3THY A;  1U2V B;  5FDL A;  4B1Z A;  1N8R O;  3AVK A;  2EWS A;  3ZSY A;  4O44 A;  5ADX H;  4WFB L;  2O8B A;  4H0O A;  2G8I A;  4DR1 K;  1HQE A;  3VF6 A;  1SAZ A;  4CHZ A;  1JL2 A;  1LAW A;  4IEE A;  4JKA A;  1ZXO A;  4KI6 A;  3DJC A;  4A5B A;  1HNX K;  3CCL N;  4ELU A;  2A40 A;  2GWJ A;  3VA0 A;  2PZS A;  1JL1 A;  3RWU A;  3CCJ N;  2NRZ A;  3TI0 A;  1VQK N;  4AHR A;  2OTL N;  5HRR A;  2VG5 A;  4B08 A;  4BRE A;  3ENH A;  1REV A;  4BDY A;  4BRG A;  3KD1 E;  1X3M A;  4FW1 A;  3UKR B;  5AZJ A;  3CFR A;  4CHN A;  3ULE B;  4QS7 A;  5GAD P;  4H4O A;  3L0Q A;  4CJF A;  5F1X A;  4DQP A;  4LFC K;  4OPJ A;  4FVM A;  5AJ3 K;  2O8D B;  3TSP A;  3M8R A;  1Z26 A;  4DU4 A;  2Q36 A;  2YHX A;  4FJI A;  1S5J A;  1I3A A;  3MN6 A;  4GVM A;  3KZB A;  1JKH A;  4DSL A;  4OPA A;  1VSD A;  3SUO A;  3V6D A;  1BIU A;  2ZQB A;  3LZJ A;  4PWD A;  3U6F A;  2D0C A;  3B6P A;  4NCB A;  1ASW A;  3S9H A;  5KQD A;  3KKR A;  4FXD A;  2W6K A;  1K6Y A;  2GX9 A;  1C0G A;  4I6M B;  3AAR A;  1NGG A;  4JI2 K;  4CE9 A;  1ZBI A;  1JLA A;  4BG9 A;  3PX4 A;  1D8Y A;  1IKV A;  5AQU A;  3QFP A;  3OYG A;  5CZ2 A;  1RT3 A;  2WBN A;  5BPL A;  1RFQ A;  2AA4 A;  2UU9 K;  4MO4 A;  4LFA K;  3VQQ A;  4CF0 A;  1TL1 A;  1BQM A;  5SWM A;  4KH4 A;  3TAB A;  2A41 A;  3KHY A;  1BI4 A;  2I7P A;  3DXK B;  4O55 A;  2A6A A;  4ILH A;  2P9P B;  4H5R A;  2UXD K;  1HYZ A;  1QQC A;  2QWO A;  1X9S A;  3TAR A;  1BCM A;  2HHV A;  3QB0 A;  1ITG A;  2GWK A;  3KK7 A;  1U47 A;  2Z1G A;  4C8N A;  3RSE A;  3ULD A;  4O5F A;  1Z05 A;  3L2U A;  3QNN A;  4FSV A;  1WSE A;  4H03 B;  2O8F A;  2VWJ A;  2IC3 A;  1VAZ A;  4DV4 K;  2D0A A;  1VSF A;  4J2A A;  5HRO A;  4BRP A;  2HHU A;  2NNW A;  3SUP A;  5AQI A;  4BRI A;  5KPT A;  3LP2 A;  4CJV A;  5AFU H;  1TK0 A;  1IG8 A;  2ZD1 A;  3CPE A;  3MN7 A;  1NJI O;  4CZK A;  4DF4 A;  3WT0 A;  5H1S Q;  3DLR A;  1C1C A;  1NJZ A;  4ISE A;  3QIC A;  4IOC L;  4FL9 A;  5GIP A;  2E6L A;  2HHT A;  4O8U A;  1SKW A;  3P38 A;  3VGK A;  4NCA A;  2QXL A;  1XI1 A;  4JD2 B;  5JVH L;  1JCE A;  2OPP A;  5DK5 A;  5KGW A;  4B3R K;  3DLK A;  3A8Y A;  2ZF5 O;  4W5R A;  4BE0 A;  4H8K A;  3DI6 A;  3HYF A;  3ZYY X;  4DFJ A;  1NGC A;  4UQG A;  3SPZ A;  4WFA L;  5AQS A;  5A2Q O;  4KB1 A;  1DGK N;  4OGE A;  3NH2 A;  4DV3 K;  4DTR A;  4BY9 C;  1RBR A;  3VA3 A;  3CC4 N;  2YNI A;  3ASM A;  1HJR A;  1QHT A;  3NDK A;  4DTJ A;  2GEL A;  3KLF A;  1SKR A;  1WLJ A;  3R6M A;  4LSL A;  2W40 A;  4CJW A;  4M63 C;  1C0U A;  4KH5 A;  3M3Z A;  5HOO A;  3V1Q A;  2Q3S A;  3LDL A;  3R1X A;  3H08 A;  4H0X B;  1RBT A;  4PKG A;  3V9S A;  4MDA A;  1RT5 A;  4TSX A;  1GLL O;  4B1V A;  1SS6 A;  1BQN A;  3C7N B;  3AV9 A;  3QES A;  3HL8 A;  5AZJ B;  4DQQ A;  2BTF A;  1NWK A;  3ZET B;  5KRT A;  4JS4 A;  4CGJ A;  4LF7 K;  2O4I A;  4ELT A;  2IGI A;  4JI0 K;  4JLH A;  5C15 A;  1ILY A;  4CZL A;  3LPT A;  4JI7 K;  3JS6 A;  1FJG K;  2YKM A;  4H0Y B;  3RRH A;  1XHX A;  1QZ5 A;  3CC7 N;  5TKW A;  3EE8 A;  3CCR N;  2VQE K;  4N76 A;  4BC4 A;  1CXQ A;  4DV0 K;  2Y1J A;  4CJT A;  3SK3 A;  3IFR A;  3AGK A;  1YVN A;  3PX6 A;  1BIZ A;  4CEF A;  4XIU A;  1VSK A;  4CJK A;  3LP3 A;  3NGY A;  3O1B A;  4KHQ A;  3SBG A;  3LAL A;  4CHY A;  1CZ9 A;  4M3X A;  1SKS A;  1NGF A;  5EX5 A;  4FK2 A;  1EQY A;  3OYE A;  3PLA A;  3ZT3 A;  4A62 A;  4NLC A;  3TSU A;  3NF9 A;  4AHT A;  2P9I B;  1TKX A;  1GOA A;  3OTO K;  3E9L A;  4OPK A;  4DSE A;  3F73 A;  3SYZ A;  2QM1 A;  1ATN A;  1EWQ A;  3LDP A;  2P9S A;  4Z94 A;  2KTQ A;  4M3Z A;  4B9L A;  3MDQ A;  4BRM A;  2FBT A;  4KBO A;  4F2R A;  4M3W A;  3LPU A;  1YUW A;  5MLC Q;  4X62 K;  1RIL A;  3O08 A;  4DSK A;  4FJ8 A;  3FR0 A;  4KRF A;  3L2V A;  4LD0 A;  3AVH A;  3LP1 A;  3RSE B;  1MA9 B;  4AHC A;  1TAQ A;  3V1R A;  2IVO A;  3CIP A;  5JLH A;  1QTM A;  2QXF A;  1N33 K;  3CJC A;  3I8B A;  3DXM A;  1LCU A;  3WUH A;  2PBD A;  2G8H A;  3IUC A;  4L3Q A;  1X3N A;  4J2D A;  3MEC A;  3PX0 A;  1TGO A;  4AM7 A;  5JLF A;  2DY4 A;  4IO8 A;  2XY8 A;  1YIT N;  3ZCM A;  3TAN A;  2HNY A;  4FLV A;  5AQO A;  1KVA A;  5HRP A;  1HKC A;  2I7N A;  4FWP A;  4BWJ A;  3QEV A;  3MX2 A;  3CCE N;  4CZI A;  4JI4 K;  3J7Z O;  4B8C A;  3K0S A;  2YHW A;  3A5N C;  3PIO L;  2RHK A;  1UAX A;  3HI0 A;  3K9J A;  1QQN A;  4C8M A;  4HUF A;  5AFU A;  1RNH A;  2P9N B;  4GKK K;  4DLE A;  4NLB A;  5E26 A;  4YOV A;  3J80 O;  5JIC A;  1TKZ A;  1BL3 A;  4CI6 A;  1M90 O;  3DOK A;  3OYN A;  1RTH A;  5KPZ A;  3F9M A;  2A3Z A;  5K14 A;  5KPR A;  3DRP A;  4HUG A;  1TUY A;  2FSN A;  4WCE L;  2KW4 A;  4JNE A;  4AHV A;  3NMU A;  3NVM A;  1LW2 A;  3V81 A;  4E0D A;  2ZE2 A;  5M1Q A;  3AVF A;  3AVL A;  1JXE A;  2P9L B;  4CFC A;  2FBV A;  4M7Y A;  2OAN A;  3QEW A;  3G4S N;  3L4I A;  3HP6 A;  1QE1 A;  4KKO A;  4CFA A;  4E89 A;  4KI4 A;  1RDA A;  3K58 A;  4F9O A;  4GV3 A;  4CHQ A;  1U2V A;  1LWF A;  3AO5 A;  2ASP A;  4ZTF A;  3K2P A;  5AQF A;  2HHX A;  3D2F B;  4AHU A;  4BGA A;  1JLE A;  3V4I A;  2NUB A;  5AQH A;  3T7Z A;  1P90 A;  4FWO A;  2J4R A;  4FJ7 A;  2W42 A;  4WQ5 A;  3THW B;  4OKE A;  4OJR A;  3ALY A;  3OS1 A;  4BG8 A;  1GLA G;  3E66 A;  1NK4 A;  5AQX A;  5D3G A;  3TAG A;  2NRX A;  1MWK A;  1NOY A;  1KVC A;  3PY8 A;  2YNH A;  1WOQ A;  5AQY A;  4A59 A;  3I55 N;  1HPM A;  3DWL A;  1J5O A;  4NCG A;  3QET A;  3LDQ A;  3RMB A;  5C25 A;  4FLT A;  1RTD A;  1IV0 A;  3B8A X;  3UKR A;  3MWP A;  3IAY A;  1B9F A;  3QIP A;  3T1A A;  3ULE A;  1WB9 A;  3SPY A;  1U04 A;  3O4N A;  4BRF A;  3QEX A;  1M1K O;  4DQ8 A;  3W3D A;  4CK3 A;  2O8D A;  4M3Y A;  3I0S A;  4DR2 K;  2IIR A;  3LWM A;  4BC2 A;  1ASV A;  2A1R A;  2VGM A;  4BR2 A;  2QWQ A;  2Q0R A;  3ZT2 A;  4YHH K;  1GLB G;  5JVG L;  1RDB A;  2YHB A;  5EVZ A;  1OVY A;  1RT7 A;  3WXJ A;  4JK8 A;  1VQ4 N;  3L3U A;  3QER A;  2HND A;  5AQL A;  4CW7 B;  4FWQ A;  4U67 L;  3OYH A;  4I6M A;  1S72 N;  4EZ6 A;  3E01 A;  3H3N O;  4K42 A;  4YY3 K;  1A5W A;  1S9G A;  2XY6 A;  3KLE A;  4CFD A;  2E2Q A;  4CJP A;  5SZT A;  4F2S A;  1ZBU A;  4FK4 A;  1WSF A;  3DLL L;  5HLF A;  1EKE A;  2P9K B;  4EP5 A;  2UUA K;  3OYJ A;  1Z25 A;  1Q18 A;  1Q81 O;  3CMA N;  4BC3 A;  4DHY A;  4DR3 K;  4E3S A;  4HCB A;  2IVP A;  4OO1 J;  4CZG A;  2F96 A;  1SV5 A;  4AF1 A;  3DXK A;  1Q82 O;  2P9P A;  3KWG A;  1XUP O;  3T19 A;  5AQN A;  3BGR A;  3AVN A;  4H5N A;  1ATS A;  4KV8 A;  3QFU A;  4OKK A;  4FWM A;  1YF5 L;  1GLC G;  4BE2 A;  4H0V B;  4EP4 A;  4B8A B;  4IJN A;  4GV9 A;  1VQP N;  3T3F A;  1VQ6 N;  4DSJ A;  3PIP L;  3C95 A;  3KIO A;  3VQ6 A;  4WFN L;  1XWL A;  5AQT A;  3WXL A;  3PO5 A;  1NGI A;  2Q31 A;  3LAK A;  4I2P A;  3C65 A;  2UXB K;  3AVB A;  3FFK B;  1DTQ A;  1KAY A;  3VOV A;  3O9T A;  4BVP A;  1CZA N;  4QS9 A;  5ELZ A;  5J2N A;  4BWM A;  4FWL A;  3VQA A;  4F4K A;  3VGL A;  3M6G A;  3RMA A;  2BAN A;  1G15 A;  2G8W A;  1NMN A;  3M8S A;  5BN8 A;  4NXN K;  4IBN A;  2YX6 A;  2XY5 A;  3MCP A;  4FOI A;  1NK0 A;  4JD2 A;  2E4L A;  3HPH A;  3VQC A;  3ZX2 A;  4KTW A;  4FM0 A;  1YJN N;  1RDC A;  3TU5 A;  3KKS A;  2X6S A;  3CCQ N;  5FRO A;  1R0A A;  4CGF A;  3LDN A;  3OYB A;  1C0T A;  4RTF D;  3VQ7 A;  5CYM A;  4A61 A;  4I9L A;  3ZT1 A;  5JS2 A;  4BGB A;  3NHG A;  1VQM N;  2Z1H A;  1TUU A;  5LMU K;  1C1B A;  4CZE A;  1HNZ K;  2DTU A;  4U7B A;  4KHP K;  4BE1 A;  1OH6 A;  4CEC A;  3NE6 A;  2G8K A;  2QEX N;  3HOT A;  1HKG A;  2IS3 A;  1W7A A;  3NBP A;  2E2P A;  1NGE A;  2UYT A;  2HB5 A;  1IBL K;  4B9M A;  4LC9 B;  3OYL A;  3VQ8 A;  5AQZ A;  1GLD G;  3TAP A;  1VSM A;  3FZH A;  4B9S A;  3LDS A;  3C7N A;  3F9K A;  4LH4 A;  3VQ5 A;  2ZM6 K;  2EX3 A;  4GVE A;  3FZM A;  3AA5 X;  3ZET A;  2UUB K;  5FRM A;  1QQM A;  1WSG A;  3OW2 M;  3A5M C;  4FOE A;  1NJX A;  2FSK A;  3D0P A;  5J2P A;  3H45 C;  3K59 A;  3SJH A;  4NB4 A;  1S1V A;  2RE2 A;  4GY2 B;  4RW9 A;  3THX B;  1NLV A;  3GE1 A;  3K57 A;  4IJA A;  2G8U A;  4A2B A;  4HUE A;  4LF8 K;  2NLX A;  3VEW A;  1Q9X A;  4BRO A;  1NJW A;  2KFZ A;  2OYQ A;  4Y1D A;  4W5O A;  4FO0 A;  3SV4 A;  4FJG A;  1YI2 N;  1J54 A;  3D2E B;  4MFB A;  5FPN A;  2D0B A;  5AZI B;  1BUP A;  3RVC A;  1RCH A;  2KLA A;  1ZBS A;  1QS4 A;  4CZF A;  1Q9Y A;  4DB3 A;  1QSS A;  3SAG A;  3KJV A;  3CYM A;  4J2E A;  2B6A A;  1BGX T;  5JS1 A;  1ESV A;  2P9I A;  4EIA A;  3H3O B;  5M1F A;  1JLF A;  3IMX A;  2YKN A;  3OYF A;  4LF6 K;  3SNN A;  1NMD A;  1HPZ A;  1YAG A;  1FW6 A;  2RPI A;  4BAC A;  2P51 A;  4DSI A;  3ZSR A;  4WYB A;  1TYQ B;  2WFB A;  2Q2R A;  1T8E A;  2GUP A;  1W9H A;  4Q5V A;  3ID8 A;  3SBT A;  1Z6R A;  3HP9 A;  1J5E K;  3MCA B;  2FLO A;  1TVR A;  1YJW N;  4UY8 O;  1NGA A;  4CF8 A;  1RTI A;  3P1G A;  4E19 A;  4LF5 K;  4EFH A;  1FKP A;  3V1O A;  4WQ5 C;  3AAQ A;  4AQY K;  4CZJ A;  4JRQ A;  3M5R A;  1KVB A;  3CCS N;  3DOL A;  5EY4 A;  3LWL A;  1NG9 A;  1RT2 A;  4BRA A;  1F21 A;  1K8A O;  4FK0 A;  1HKB A;  4CBW A;  1S3X A;  5M1K A;  4JI1 K;  2E88 A;  3VF4 A;  1MWM A;  3SCX A;  4KHU A;  3SJJ A;  1RT4 A;  4AH9 A;  5GIO A;  3H1V X;  4BRL A;  2E5L K;  4GV6 A;  4NYF A;  2P9N A;  4BR5 A;  3CC2 N;  1NKE A;  1GLJ O;  4BRK A;  2H3G X;  4A2A A;  2QWP A;  2JGU A;  4KAZ A;  2OZM A;  2BUP A;  4IDK A;  4FWN A;  4I2Q A;  4AHS A;  1BCO A;  1S6P A;  2RF2 A;  1GLE G;  4DG1 A;  4DQR A;  4K25 A;  1DLO A;  4YNQ A;  4E7H A;  2BGG A;  1S22 A;  4B1W B;  3ZX3 A;  2ZJR L;  2P9L A;  3AVA A;  2HBL A;  3A0I X;  4E1M A;  1IKW A;  5C24 A;  1SZ2 A;  3OS0 A;  3T69 A;  4Z4F A;  4KTQ A;  5I9E B;  1YT3 A;  2I5J A;  4FYD A;  4ICL A;  3KK3 A;  1VRU A;  3OYA A;  3DAW A;  2BDP A;  4B9N A;  3TAF A;  2LSN A;  3EZ5 A;  4M3U A;  4E7L A;  4ID5 A;  1K73 O;  4B1U B;  3D2F A;  4IFE A;  4GNI A;  4A57 A;  4HTU A;  3O4W A;  2NZT A;  1HYS A;  2PAV A;  4M3R A;  5AQK A;  3NFA A;  3THW A;  4ID1 A;  3C6A A;  3JAM O;  4JKD A;  1XMO K;  5FPD A;  4YOU A;  5C2F A;  4CD1 A;  5FLX O;  4KFB A;  1DTT A;  4BRQ A;  4CJ7 A;  5DM6 L;  1C1A A;  3MEG A;  4M41 A;  1VQ5 N;  2HBJ A;  2KZM A;  4EHT A;  5AQW A;  1YHQ N;  1OKJ A;  4IOA L;  4CEO A;  3KTQ A;  2UXC K;  4FJ5 A;  3WXM B;  4E1N A;  4LY7 A;  2HOE A;  3MAQ A;  2EHG A;  1UWB A;  2HW3 A;  3QLH A;  4DTM A;  3NH1 A;  4CES A;  1MDU B;  3T1Y K;  4FVU A;  3TR8 A;  1NK8 A;  4YOW A;  3MXJ A;  3WEE B;  1RDU A;  3CJ7 A;  3KLG A;  4CK2 A;  1IJJ A;  4ILJ A;  1U4B A;  1XNQ K;  2Q1N A;  4FW2 A;  1W0H A;  4DF8 A;  4Z4C A;  2KFN A;  4Y1C A;  3UKU B;  1I94 K;  2XY7 A;  4Z4E A;  4J2B A;  2ZGY A;  3SQ4 A;  1TK5 A;  5IWA K;  1N36 K;  4DLG A;  3N4Q A;  3HXM A;  2GEM A;  2OCE A;  4NXM K;  4DU1 A;  4CK1 A;  4R5P A;  1JXB A;  2ITG A;  4OGC A;  1SL1 A;  3HO1 A;  5HP1 A;  4PUO A;  3D7E O;  5BN9 A;  2OPQ A;  1WSI A;  3OYM A;  4YOR A;  3MN9 A;  2Z1I A;  3CER A;  3KD5 E;  1YTA A;  4PQU A;  4L8R B;  4CEQ A;  3F2K A;  1C6V A;  3PSF A;  1E4G T;  3NVK A;  5M1P A;  4J8F A;  3BEX A;  5JMV A;  2P9K A;  3CJB A;  1EXQ A;  4H5W A;  2W41 A;  5KQ8 A;  1C0F A;  1WSH A;  1B9D A;  4JKB A;  3FZF A;  3OS2 A;  2KHO A;  3CCM N;  1IO2 A;  1L3T A;  3MWT A;  3U9D A;  4CJU A;  2FF6 A;  3HT3 A;  4B9V A;  2HHQ A;  4FWK A;  2V51 B;  1SUQ A;  3AY9 A;  2G8F A;  5T7B A;  3HRG A;  5CE3 A;  4EAH D;  1HQU A;  3K5M A;  2A5X A;  2Y1I A;  2D1K A;  1D9F A;  3CXC M;  1R59 O;  1O13 A;  1YXQ A;  4IO9 L;  1WAF A;  2CGJ A;  3WXK A;  3FZK A;  3QIO A;  4PKI A;  3OVN A;  2VWB A;  1KFS A;  4LF9 K;  3QDK A;  4BRN A;  1Y97 A;  1BDG A;  1Q8I A;  4DTP A;  3EO3 A;  4IZ9 A;  1HRH A;  4F8R A;  4HVJ A;  4B9Q A;  4C8L A;  4B3M K;  2CGL A;  1EWR A;  5LJV A;  3G10 A;  4BQL A;  4CHO A;  1U45 A;  2HF4 A;  1ASU A;  1ATR A;  5EU7 A;  4QOZ B;  3ENB A;  5AQV A;  1U49 A;  3VGM A;  4QCL A;  1W97 L;  3L2R A;  4BDZ A;  3Q7B A;  3CFP A;  4CIG A;  1NK6 A;  4MLH A;  1VQ8 N;  1GOB A;  1S1T A;  3VQ9 A;  5HRN A;  2HBK A;  5J2Q A;  2DFE A;  3R8E A;  4F3O A;  2WUS A;  4B9T A;  4E1J A;  3TWH A;  1JJ2 M;  5J2M A;  3WQU A;  2OPR A;  3S41 A;  4FJL A;  4KH6 A;  4HCC A;  3G0Z A;  4Z0U A;  4X66 K;  4MDB A;  4CJ3 A;  2F8S A;  4IWV A;  2DFH A;  3OYD A;  3RR8 A;  4M42 A;  2YJE A;  3JYT A;  1EO1 A;  2NRR A;  2YNF A;  4JAX A;  5GAE P;  4YOY A;  4YFU A;  4BR9 A;  3MK6 A;  3AVM A;  3LP0 A;  3GOI A; 
#chains in the Genus database with same CATH homology
 4KTW A;  2VWJ A;  4FM0 A;  2IC3 A;  1RDC A;  4KPY A;  1S1X A;  2D0A A;  3KKS A;  1VSF A;  3MXM A;  5E41 A;  2KZZ A;  4J2A A;  4O0J A;  2X6S A;  5HRO A;  2IDO A;  2XO7 A;  5FRO A;  1TKT A;  3OJU A;  2HHU A;  4E7J A;  3DM2 A;  1R0A A;  4CGF A;  3L2W A;  3OYB A;  3SUP A;  3D45 A;  3KLH A;  1C0T A;  3VQ7 A;  4KHY A;  1NKC A;  5CYM A;  1L3S A;  1JLC A;  3LP2 A;  4CJV A;  1YVU A;  4OVL A;  1N5Y A;  3L3V A;  4I9L A;  1JLG A;  3ZT1 A;  1UA0 A;  5JS2 A;  1TK0 A;  2YV0 X;  3NHG A;  2ZD1 A;  4CED A;  1D5A A;  3HJF A;  2OA8 A;  4DS4 A;  2Z1H A;  2OZS A;  4WE1 A;  4LSN A;  1C1B A;  4DF4 A;  3DRR A;  4RG8 A;  2DTU A;  3DLR A;  4DTU A;  1C1C A;  1NJZ A;  1BI4 B;  4BE1 A;  1VSJ A;  1S1U A;  4CEC A;  3KLI A;  3NE6 A;  1TV6 A;  2G8K A;  5I42 A;  4JRP A;  3M8Q A;  2IS3 A;  2E6L A;  3VQD A;  4IFY A;  2Z1J A;  3NBP A;  3U3G A;  4FJK A;  2HHT A;  3TAE A;  4N41 A;  1SKW A;  4QAG A;  4NCA A;  3NH0 A;  3SZ2 A;  2B4J A;  2HB5 A;  1XI1 A;  4B9M A;  3NGI A;  3OYL A;  3VQ8 A;  2OPP A;  3TAP A;  5DK5 A;  1KFD A;  1VSM A;  5KGW A;  3DLK A;  4B9S A;  2FC0 A;  4W5R A;  3LDS A;  3F9K A;  4LH4 A;  4BE0 A;  4O5B A;  3DI6 A;  3HYF A;  4H8K A;  3VQ5 A;  4DFJ A;  4UQG A;  2EX3 A;  3SPZ A;  1KSP A;  1TAU A;  3AA5 X;  4KB1 A;  5FRM A;  4OGE A;  1WSG A;  3NH2 A;  4KHW A;  3AVJ A;  4DTR A;  2HNZ A;  3THV A;  4KHS A;  1RBR A;  3VA3 A;  3WNG A;  3ZSO A;  1NJX A;  2YNI A;  3ASM A;  1HJR A;  1QHT A;  5KI6 A;  3NDK A;  5KTQ A;  3D0P A;  4DTJ A;  5J2P A;  3KLF A;  3SI6 A;  3K59 A;  2BE2 A;  1SKR A;  1S1V A;  1WLJ A;  4ELV A;  4RW9 A;  3JSM A;  4OKJ A;  3I0R A;  4LSL A;  4NYN A;  2X74 A;  3CG7 A;  4CJW A;  3ITH A;  3WNF A;  3K57 A;  3SQ0 A;  1NKB A;  2G8U A;  4OLA A;  4H4M A;  4HUE A;  1C0U A;  1ZBF A;  3IS9 A;  3QNO A;  3OYC A;  3V1Q A;  4DTX A;  3VQ4 A;  2Q3S A;  1Q9X A;  1IH7 A;  1LWC A;  1NJW A;  1T7P A;  2IAJ A;  5KGX A;  3H08 A;  2P5O A;  4DU3 A;  2KFZ A;  2OYQ A;  1RBT A;  4W5N A;  3QO9 A;  4Y1D A;  4W5O A;  3V9S A;  1EX4 A;  4CEZ A;  3SV4 A;  4K8X A;  1RT5 A;  3PUF A;  4O0I A;  4FJG A;  1A5X A;  4TSX A;  1J54 A;  3AVI A;  4MFB A;  4N5S A;  2P5G A;  2D0B A;  1BQN A;  1RCH A;  3ZT0 A;  3PO4 A;  1L3V A;  4FJM A;  3AV9 A;  1QS4 A;  3QES A;  3HL8 A;  4M3T A;  1Q9Y A;  3SUN A;  3V9U A;  3HVT A;  1X9W A;  1QSS A;  4DQQ A;  1NK7 A;  4F3T A;  3KJV A;  2HVI A;  3CYM A;  5KRT A;  3DLG A;  4JS4 A;  4J2E A;  2B6A A;  4CGJ A;  2O4I A;  4ELT A;  2IGI A;  2HVH A;  4M45 A;  1BGX T;  4JLH A;  1LV5 A;  4HHT A;  4AIL C;  5JS1 A;  1T03 A;  3LPT A;  3L8B A;  3RR7 A;  3ZSQ A;  4DTO A;  5J1E A;  1VSL A;  2YKM A;  2X78 A;  3CM6 A;  3RRH A;  4DWI A;  1XHX A;  1ZYQ A;  1JLF A;  4RW4 A;  2IOC A;  3I8D A;  2YKN A;  4CJ4 A;  3OYF A;  4C8O A;  4B9U A;  3O4Q A;  3SNN A;  4N76 A;  1HPZ A;  4RW7 A;  1S9E A;  2RPI A;  4BAC A;  1CXQ A;  2Y1J A;  3DRS A;  1KLM A;  2P51 A;  4CGI A;  4CJT A;  4FM2 A;  4W5Q A;  4DSI A;  4Z4I A;  3DLH A;  4CCH A;  1IKX A;  3ZSR A;  1T8E A;  2QKB A;  5I3U A;  3IRX A;  3HVR A;  3PX6 A;  1BIZ A;  4CEF A;  4XIU A;  1VSK A;  4CJK A;  1W9H A;  3LP3 A;  3NGY A;  2YNG A;  1S1W A;  3AVC A;  4GW6 A;  4Q5V A;  1HYV A;  3SV3 A;  4KHQ A;  1KTQ A;  3LAL A;  4CJ5 A;  4CHY A;  4CGG A;  1CZ9 A;  3HP9 A;  3V9Z A;  4GMJ B;  3BDP A;  3C94 A;  4M3X A;  1LW0 A;  2A1S A;  1SKS A;  4FZZ A;  1TVR A;  4CHP A;  1O1W A;  1BIS A;  4CF8 A;  3MEE A;  1RTI A;  3P1G A;  4IKF A;  4E19 A;  4FK2 A;  3AO1 A;  3O3H A;  3OYE A;  1FKP A;  2XHB A;  1WN7 A;  3V1O A;  3ZT3 A;  3DYA A;  4DMN A;  3NF9 A;  4FJH A;  4AHT A;  1HMV A;  4JRQ A;  1TKX A;  1GOA A;  1TKD A;  3M8P A;  1KVB A;  3CQ8 A;  3P5J A;  4OPK A;  4DSE A;  3NCI A;  1HNI A;  3F73 A;  4CGD A;  3HPO A;  3DOL A;  3QEI A;  3LWL A;  3PV8 A;  3SYZ A;  1CXU A;  4ZTJ A;  4LH5 A;  5C42 A;  1RT2 A;  3OYI A;  4BDP A;  2KTQ A;  3KK1 A;  2E6M A;  1F21 A;  3AA3 A;  4FCY A;  4B9L A;  4FK0 A;  3AA4 A;  4M3Z A;  3OY9 A;  1RT6 A;  2FBT A;  1VK0 A;  5HRS A;  4F2R A;  4M3W A;  1WSJ A;  3LPU A;  4FLU A;  1KLN A;  1RIL A;  2QK9 A;  3NAE A;  3SCX A;  4DSK A;  1NOZ A;  4W5T A;  3SJJ A;  1RT4 A;  4CF9 A;  4KHU A;  4AH9 A;  4FJ8 A;  4KRF A;  3L2V A;  2F8T A;  3O3F A;  4LD0 A;  3AVH A;  3LP1 A;  1XHZ A;  3QEP A;  4AHC A;  1TAQ A;  3V1R A;  1WAJ A;  4NYF A;  1FXX A;  1CLQ A;  3ZSX A;  1NKE A;  1QTM A;  2QXF A;  3HM9 A;  2FBY A;  2JGU A;  4KAZ A;  1ZBH A;  2OZM A;  5DMR A;  4IDK A;  4I2Q A;  4AHS A;  1BCO A;  2G8H A;  2YHA A;  3NF7 A;  2ETJ A;  1RBU A;  4FLY A;  1B92 A;  1S6P A;  4J2D A;  3MEC A;  4G1Q A;  1TGO A;  4DQS A;  3PX0 A;  2RF2 A;  4DG1 A;  1T05 A;  1TK8 A;  4DQR A;  1DLO A;  4YNQ A;  4E7H A;  3K5L A;  3MED A;  2DY4 A;  1GOC A;  3RRG A;  2BGG A;  2XY8 A;  3ISN C;  1BHL A;  3ZCM A;  1YTU A;  4IFV A;  3TAN A;  1JLQ A;  2HNY A;  4FLV A;  2KQ2 A;  3AVA A;  4CJE A;  4JS5 A;  4RW8 A;  1KVA A;  5HRP A;  1X1P A;  4E1M A;  1IKW A;  5C24 A;  3QEV A;  4BWJ A;  3OS0 A;  1RT1 A;  4FJ9 A;  4Z4F A;  4KTQ A;  1YT3 A;  3OJS A;  2I5J A;  2P1J A;  3DMJ A;  3P83 D;  4ICL A;  4CJL A;  3VN5 A;  3KK3 A;  1VRU A;  4I9Q A;  4DTN A;  3OYA A;  3CM5 A;  2BDP A;  4B9N A;  4B8C A;  3TAF A;  2HHS A;  2LSN A;  3EZ5 A;  4M3U A;  4FLX A;  4E7L A;  4ID5 A;  2VWK A;  4RW6 A;  1UAX A;  2GV9 A;  4HUF A;  4C8M A;  3LAM A;  2VG7 A;  1RNH A;  2PYL A;  3AO3 A;  4DLE A;  4HTU A;  1TL3 A;  3AO2 A;  1HYS A;  4M3R A;  4DSF A;  2WON A;  1TKZ A;  1BL3 A;  3NFA A;  3DOK A;  1VSE A;  4CEA A;  3OYN A;  1RBS A;  1RTH A;  4ID1 A;  1XC9 A;  5K14 A;  1ZBL A;  4K8Z A;  3DRP A;  4HUG A;  4KFB A;  2RKI A;  4CJR A;  1DTT A;  3ZSW A;  2KW4 A;  4AHV A;  3S3N A;  1LW2 A;  1C1A A;  3MEG A;  3V81 A;  4N47 A;  4E0D A;  4N56 A;  2ZE2 A;  3AVF A;  3AVL A;  3DLE A;  4M41 A;  3SQ2 A;  2O4G A;  4CEE A;  3RMC A;  3RMD A;  1D9D A;  1JXE A;  5KRS A;  2R7Y A;  4CFC A;  2FBV A;  2KZM A;  3QEW A;  4DQI A;  3HST B;  3TAM A;  5CZ1 A;  4FLZ A;  4CFB A;  3AA2 A;  3HP6 A;  1QE1 A;  4KKO A;  4CEO A;  4CFA A;  3AVG A;  5HBM A;  1QSY A;  4E89 A;  1UA1 A;  3KTQ A;  4FJJ A;  4KI4 A;  4FJ5 A;  1RDA A;  4E1N A;  3K58 A;  4DTS A;  2WOM A;  3EYZ A;  4LY7 A;  4CHQ A;  1X9M A;  1LWF A;  3AO5 A;  3WNE A;  1IKY A;  2EHG A;  3MAQ A;  4ZTF A;  4MQ3 A;  1UWB A;  3K2P A;  4CJQ A;  2HW3 A;  3QLH A;  4DTM A;  2QKK A;  3NH1 A;  4FZX C;  4AHU A;  4CES A;  4FLW A;  4ZHR A;  2HHX A;  1JLE A;  4CF2 A;  3V4I A;  3EY1 A;  2NUB A;  3TR8 A;  1NK8 A;  3OYK A;  1IG9 A;  4FJ7 A;  3K5O A;  2W42 A;  3MXJ A;  4KHN A;  2GBZ A;  2XRI A;  2RN2 A;  4KTZ A;  4OKE A;  4OJR A;  3KLG A;  4DFP A;  4CK2 A;  3ALY A;  4Z4H A;  3OS1 A;  4FW2 A;  1U4B A;  1VRT A;  3U3Y A;  4B3O A;  4FM1 A;  3SUQ A;  1W0H A;  4DF8 A;  4CJS A;  4Z4C A;  3FFI A;  3NGZ A;  3KK2 A;  4Y1C A;  2KFN A;  4Z4E A;  2XY7 A;  4J2B A;  1NK4 A;  5D3G A;  3VQB A;  3SQ4 A;  1TK5 A;  4FYD A;  3TAG A;  3S3O A;  3VQP A;  4DLG A;  3HXM A;  3NF8 A;  1NOY A;  3ZSV A;  1KVC A;  4E7I A;  3PY8 A;  2YNH A;  3MXI A;  3IG1 A;  3UIQ A;  3V9X A;  4DU1 A;  1LAV A;  2GUI A;  3K5N A;  3ZSZ A;  1NK9 A;  4CK1 A;  2VG6 A;  4R5P A;  1JXB A;  2ITG A;  4DS5 A;  1J5O A;  4OGC A;  4CGH A;  1SL1 A;  1NJY A;  3HO1 A;  5HP1 A;  4NCG A;  3QET A;  4PUO A;  3QIN A;  5C25 A;  4FLT A;  3RMB A;  1N6Q A;  1RTD A;  4PY5 A;  2OPQ A;  1NK5 A;  1WSI A;  3OYM A;  3LZI A;  4FZY A;  5FDL A;  3IAY A;  4KB0 A;  4Z4G A;  2Z1I A;  1B9F A;  3KD5 E;  3AVK A;  1YTA A;  3QIP A;  1U48 A;  3T1A A;  4PQU A;  3C6U A;  3ZSY A;  3SPY A;  4O44 A;  4L8R B;  1U04 A;  1WNS A;  3O4N A;  2G8I A;  4IG3 A;  3QEX A;  4O4G A;  3AO4 A;  4DFK A;  4CEQ A;  1HQE A;  4CHZ A;  2OPS A;  3WNH A;  1L5U A;  1L3U A;  1JL2 A;  1C6V A;  1LAW A;  4CK3 A;  1EET A;  2AJQ A;  3TAQ A;  1SL0 A;  4M3Y A;  4KI6 A;  3I0S A;  1UOC A;  2G8V A;  3VQE A;  1J9A A;  1EXQ A;  4ELU A;  3LWM A;  3VA0 A;  1A5V A;  3CFO A;  2PZS A;  2B5J A;  1JL1 A;  3RWU A;  1ASV A;  1WSH A;  2A1R A;  1B9D A;  3OS2 A;  3TI0 A;  3ZT4 A;  1KRP A;  1IO2 A;  4AHR A;  1L3T A;  3B6O A;  1VSI A;  2VG5 A;  5HRR A;  3ZT2 A;  4B08 A;  3SQ1 A;  1RDB A;  2YHB A;  4CJU A;  1RT7 A;  3HT3 A;  4Q0B A;  4B9V A;  2HHQ A;  1REV A;  4BDY A;  2X6N A;  3L3U A;  1SUQ A;  4EZ9 A;  3QER A;  1SL2 A;  2HND A;  3KD1 E;  3LAN A;  4FW1 A;  2G8F A;  3OYH A;  5T7B A;  3CFR A;  4EZ6 A;  1FKO A;  3E01 A;  5CY4 A;  4CHN A;  1HQU A;  3K5M A;  2Y1I A;  3RTV A;  4H4O A;  1D9F A;  1A5W A;  2FBX A;  2DFF A;  1S9G A;  2XY6 A;  3KLE A;  1LWE A;  4CJF A;  4CFD A;  4DQP A;  4CJP A;  5SZT A;  4I7F A;  1C0M A;  4OPJ A;  4F2S A;  1ZBU A;  4FVM A;  1EP4 A;  4IG0 A;  1WAF A;  4FK4 A;  1WSF A;  1VSH A;  3M8R A;  1Z26 A;  3QIO A;  5HLF A;  4DU4 A;  1EKE A;  3OVN A;  4EP5 A;  4KRE A;  2HHW A;  1KFS A;  3OYJ A;  4FJI A;  1I39 A;  1I3A A;  1S5J A;  1Z25 A;  4KO0 A;  2PY5 A;  4GVM A;  5CYQ A;  3A2F A;  1Y97 A;  4E3S A;  1Q8I A;  1JKH A;  4DTP A;  4DSL A;  4HCB A;  1HRH A;  1VSD A;  4E7K A;  2HMI A;  2F96 A;  3SUO A;  1SV5 A;  3V6D A;  1BIU A;  1RTJ A;  4HVJ A;  4F8R A;  2ZQB A;  3S3M A;  3LZJ A;  2PYJ A;  4PWD A;  4C8L A;  4DFM A;  3U6F A;  2D0C A;  3B6P A;  4NCB A;  3T19 A;  4FJN A;  4FJX A;  1ASW A;  3G10 A;  3BGR A;  3S9H A;  3AVN A;  3KKR A;  4CEB A;  4CHO A;  1U45 A;  4OLB A;  4FXD A;  3L2Q A;  4KV8 A;  1ASU A;  4OKK A;  5EU7 A;  1K6Y A;  4QOZ B;  1U49 A;  4BE2 A;  4QCL A;  4EP4 A;  4CE9 A;  1KCF A;  1ZBI A;  1JLA A;  4B8A B;  3L2R A;  4BDZ A;  4C8K A;  3CFP A;  3O3G A;  3PX4 A;  1D8Y A;  4CIG A;  4CIE A;  1NK6 A;  1IKV A;  1GOB A;  1FK9 A;  3T3F A;  1RDD A;  5CZ2 A;  3OYG A;  1QSL A;  4DSJ A;  1S1T A;  1S6Q A;  3C95 A;  1J53 A;  1RT3 A;  3VQ9 A;  5HRN A;  3KIO A;  3VQ6 A;  3V9W A;  5J2Q A;  2DFE A;  4F3O A;  1CZB A;  1XWL A;  2D5R A;  1MU2 A;  1JLB A;  4B9T A;  3TWH A;  3PO5 A;  4PA1 A;  3LAK A;  5J2M A;  1RBV A;  4I2P A;  3NF6 A;  3VQQ A;  3AVB A;  1DTQ A;  2OPR A;  4CF0 A;  1TL1 A;  4FJL A;  1BQM A;  2JLE A;  5SWM A;  3G0Z A;  4Z0U A;  4HCC A;  5J2N A;  3C6T A;  4CJ3 A;  4BWM A;  3TAB A;  2F8S A;  2DFH A;  1BI4 A;  4O55 A;  3VQA A;  4F4K A;  3OYD A;  3RR8 A;  4M42 A;  2ATQ A;  1HYZ A;  1QQC A;  3RMA A;  2BAN A;  1G15 A;  3JYT A;  3M8S A;  1BCM A;  3TAR A;  1X9S A;  2G8W A;  2HHV A;  1ITG A;  5FRN A;  4IBN A;  4CIF A;  2YNF A;  2XY5 A;  4CER A;  4YFU A;  1U47 A;  2Z1G A;  4C8N A;  3DLB A;  3ULD A;  3HK2 A;  3L2U A;  1NK0 A;  2E4L A;  1HNV A;  3HPH A;  1WSE A;  3VQC A;  4CF1 A;  3HPG A;  3AVM A;  3QNN A;  3LP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...