4B8AB

Structure of yeast not1 mif4g domain co-crystallized with caf1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
278
structure length
252
Chain Sequence
MFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/hydrolase
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 81
structure length 252
sequence length 278
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b8aB00
1S5JA 1F21A 3L2QA 4HUFA 3CQ8A 4F2SA 4PA1A 2E6MA 3NH2A 4AHSA 2B5JA 4CF8A 3K5MA 3AVIA 3NF7A 4KTZA 3K58A 3VQEA 3PO4A 1HQUA 1QHTA 2JGUA 4Z4GA 4LSLA 1RBSA 3TAEA 3TAPA 5I3UA 1SL2A 3M8SA 1YVUA 1VSJA 4FJKA 4JS4A 5E41A 4FJLA 2D5RA 3QINA 4KPYA 3AVKA 1S1XA 1SV5A 4CHZA 3M8QA 4B9VA 4Z4EA 3V9ZA 1HNVA 3AO4A 3OS1A 3LPUA 3NFAA 4WE1A 4M45A 1IH7A 5CYMA 4CIGA 3SQ4A 1R0AA 2KZMA 4CFDA 2YHBA 4QOZB 1Y97A 2HVIA 4CJWA 3G10A 1JXEA 4OJRA 4CJ5A 4DS5A 3MEDA 1XWLA 4OKJA 3TI0A 3OYEA 3HT3A 2O4IA 2GBZA 4B9MA 3ASMA 3NGIA 1CZ9A 1S1TA 2O4GA 5C42A 1KVBA 5J2PA 4I2PA 5JS2A 2B4JA 1RTHA 3LWMA 1VSEA 1LW2A 4KI6A 4EP4A 4EZ9A 1BQMA 3RR7A 1RT2A 4B3OA 1RBTA 4FLZA 4PWDA 2HHXA 3DRRA 4OVLA 3ISNC 2ETJA 1BIZA 4M3RA 4AHCA 3OYBA 2BANA 3DLEA 3SV4A 2RPIA 3LP0A 3M8PA 4O0JA 4E7IA 4M3TA 4C8MA 3ZSOA 1SL1A 4DTMA 3K5NA 4CK2A 3K59A 3T19A 1LWEA 5CY4A 1NKCA 3KLFA 1YTAA 4AH9A 4M41A 3TARA 3G0ZA 4KB0A 2BE2A 1ASVA 4CHOA 1K6YA 4E19A 3OYCA 2OA8A 4CFBA 1ZBUA 5J1EA 1Z26A 3ZT0A 2A1SA 3HXMA 1YT3A 4O4GA 4CJUA 1S9GA 2ZE2A 3L2WA 2KZZA 3LZIA 4GMJB 2WONA 3HSTB 3DLRA 3ZSVA 1C0TA 3AVNA 4JLHA 1G15A 1EETA 5T7BA 4XIUA 4DWIA 2PY5A 3QIOA 2LSNA 3NHGA 4O5BA 5SWMA 2IAJA 4BACA 1IG9A 1TAQA 4DQPA 4CJEA 1TKZA 2YKNA 1JLQA 3PY8A 1T05A 2ATQA 5CYQA 4G1QA 3V1QA 3HO1A 4N76A 2FC0A 1DTQA 1B9FA 3SUQA 4CEAA 3RWUA 4Z4IA 1VSLA 3NE6A 3VQ6A 4CE9A 4M3UA 2X6SA 3NGYA 4E89A 1NJYA 4CGGA 3K5LA 3OYAA 1LWCA 1C6VA 1D9FA 3U6FA 4RG8A 3VA3A 4IG0A 3DOLA 2HHSA 4E1MA 4OKEA 3OS0A 4BE0A 4I7FA 5HROA 3WNHA 4DSEA 4JRQA 1QS4A 2F96A 4E0DA 4M3ZA 1D8YA 4H4MA 3HP9A 4CJFA 4DLGA 2BGGA 4W5TA 4HTUA 1C1CA 1KCFA 3HK2A 5FROA 3BDPA 1NK0A 4FJMA 4E7JA 3AVCA 1KVAA 3L2RA 2YHAA 4DQIA 2HHUA 4DS4A 1U47A 4CESA 3CFRA 3NF6A 3JYTA 2A1RA 1Q9XA 4ELTA 4PY5A 4GVMA 3S3MA 3DMJA 1RDBA 4LSNA 4AHRA 1T03A 4NCAA 2F8SA 3C95A 1U45A 4FYDA 2FBXA 1EP4A 4QCLA 2KFZA 3TAFA 4C8LA 4HVJA 3KK3A 3DI6A 2HB5A 3LZJA 3SV3A 1S6QA 1U4BA 2G8KA 3TAGA 5HP1A 4B9LA 5HBMA 4FW2A 4M3XA 2HNYA 1X1PA 2GUIA 3IAYA 3E01A 3ULDA 4FK4A 2DFEA 3DLBA 3SJJA 5K14A 2G8VA 3HJFA 4FVMA 1NK6A 5HRRA 4CHPA 3BGRA 2Z1JA 3ZSZA 3C6TA 3KLGA 3OYKA 2KW4A 1UA0A 2I5JA 4IDKA 1QE1A 1NKEA 3OYDA 1YTUA 1CLQA 4CJSA 3I0SA 1SKRA 3AO1A 3VQQA 1A5VA 3TABA 3NH0A 3ZSRA 3ZT3A 2OPRA 3TR8A 3QERA 2OPPA 4ID5A 1BGXT 3AO2A 4CJLA 4DFPA 1UAXA 4BE1A 4E3SA 4MQ3A 1BISA 4K8ZA 1B9DA 3QLHA 3OYLA 2IGIA 3OYMA 3QEPA 4LY7A 1S9EA 4I9QA 2VWJA 1ITGA 1L3SA 4FCYA 4CJVA 4BWMA 2YV0X 4W5NA 1I39A 3O3FA 4ZTJA 5FRNA 3AVBA 4DSFA 3LP3A 5HRSA 3A2FA 1NJXA 2IOCA 5HRPA 3CYMA 1JXBA 1J54A 4B8AB 5DK5A 1JLAA 3DRPA 3VQAA 2P5OA 4KHWA 3KLIA 4DTNA 4CFAA 4CK1A 3SI6A 5CZ1A 2VG7A 3AVAA 3OYIA 3V9UA 1KLNA 1U04A 3CM6A 4HUEA 1NJWA 3RMBA 3T3FA 1IO2A 3F9KA 2GV9A 2IS3A 4FJ8A 1JLFA 4CFCA 4DFKA 3PX0A 4B9TA 4Z0UA 1XHXA 3F73A 3P1GA 3AVGA 2X78A 3KTQA 4FJIA 4DSKA 1U48A 4CJTA 5J2MA 4O0IA 1BI4B 3OJUA 3L8BA 1KSPA 4CJQA 3P83D 1W9HA 3V1RA 5KTQA 5J2NA 1Q9YA 3DLGA 3O3HA 2B6AA 3I8DA 4CJRA 3PV8A 4OPJA 2XY6A 1XC9A 1O1WA 1TK8A 2VG6A 4FZXC 2XRIA 1JLEA 1HJRA 3AVJA 1BCOA 5KGXA 1EXQA 2G8UA 3SUOA 1ASUA 3WNEA 3PX6A 3IRXA 1QTMA 4LH4A 3OJSA 2HHTA 2KQ2A 1HYZA 3TAQA 1X9MA 1EKEA 3SNNA 3MECA 1GOBA 4FM1A 4FK2A 1VSMA 4OLBA 1VRUA 3HVTA 4CGHA 3QEWA 4I2QA 3SUPA 4K8XA 3WNFA 1J9AA 1RBVA 1RT4A 1A5XA 2E4LA 4DLEA 1J5OA 1HQEA 3TWHA 1NOZA 4FJNA 2QKKA 2YNHA 1IKYA 4JRPA 1TKDA 3CG7A 5KI6A 1ASWA 1RCHA 4ZHRA 5C25A 1IKVA 3OY9A 3IS9A 1ZBIA 4FLTA 4KTQA 2QK9A 4KI4A 1UOCA 1BQNA 1BCMA 4CEOA 1TV6A 4EP5A 3AVLA 3ZT4A 2XO7A 1A5WA 4Z4CA 2IC3A 4FM0A 4FLVA 2R7YA 4CEQA 1ZBHA 3HM9A 3SQ2A 2ZD1A 1FK9A 4O44A 1IKWA 2G8WA 3QEXA 3B6OA 3SUNA 1SKSA 1N5YA 1BI4A 1JLBA 4DG1A 4ICLA 4CF1A 3EZ5A 4FLXA 2YNFA 3LP2A 1QSSA 4GW6A 4PUOA 4NYNA 4AHTA 2PYLA 2QXFA 1RT3A 4HUGA 3SPZA 3K5OA 4YFUA 1SKWA 3CFOA 1WAFA 3ITHA 4B8CA 4DTUA 4OLAA 1WSFA 2E6LA 2IDOA 3H08A 4Y1CA 2D0CA 2PZSA 4CJKA 2X6NA 4CF2A 1TK5A 1KRPA 3ALYA 1S1VA 4CJPA 4UQGA 3OS2A 4DTJA 3QETA 4FJGA 5D3GA 3K2PA 1ZYQA 4ELVA 5CZ2A 1C0MA 1KFDA 1QSYA 5EU7A 3AV9A 3HPHA 3LPTA 4C8KA 4KV8A 4M3WA 5HRNA 3JSMA 3TANA 3NF8A 1NK7A 1T7PA 3AO5A 3OVNA 4AILC 4CEDA 4KREA 3DRSA 3LWLA 2HHQA 4OKKA 2G8IA 4H8KA 1NK4A 3LALA 4E7HA 2Z1GA 2G8HA 3NH1A 1ZBFA 4DF4A 1KLMA 1QQCA 3LANA 4E7KA 3VQ4A 4OPKA 4Z4HA 4NYFA 1D5AA 3AVFA 3PX4A 4B9NA 1RNHA 3LAKA 4CHNA 3O3GA 1WSGA 3CM5A 4PQUA 4Z4FA 1KTQA 3QESA 1X9WA 4CIFA 3AO3A 2OZSA 1IKXA 1VK0A 4DQQA 3RR8A 4DTRA 3EYZA 3SPYA 3DLHA 2BDPA 1RT5A 2D0BA 1C1BA 3VQ5A 2NUBA 2P1JA 4O55A 4DF8A 2AJQA 3ZCMA 4F3OA 1TKTA 3SQ1A 1GOCA 4B9UA 3QIPA 2XHBA 1QSLA 3PO5A 2ZQBA 3T1AA 4CGFA 4RW8A 3KIOA 4DFJA 1L5UA 3QNNA 1L3UA 4FZYA 4IKFA 3ZT1A 4CGIA 2XY7A 3S3NA 1NK9A 2YNGA 4Y1DA 2QKBA 3K57A 2Q3SA 1S6PA 4M3YA 4FW1A 4IFYA 4DFMA 1S1WA 1WSJA 3V9WA 1T8EA 2VWKA 5C24A 1UA1A 3C6UA 4FLUA 4KHNA 2EX3A 4RW7A 4F2RA 4FJ9A 4FJXA 4CIEA 1L3VA 2G8FA 4W5QA 4DQRA 4NCGA 2HHVA 4DSIA 1TGOA 4HCBA 4FLWA 4FK0A 1CXUA 3NAEA 5FRMA 4N56A 3QO9A 3AA3A 1FKPA 4CJ3A 3VQCA 3QEIA 3S3OA 1HPZA 3OYHA 1CZBA 1HNIA 3D45A 5DMRA 1WN7A 4CEBA 4BDPA 3VQDA 3ZT2A 2ITGA 2W42A 3MAQA 3MEEA 1RILA 4DTOA 3S9HA 2OZMA 3D0PA 1NK8A 1XHZA 2F8TA 3RMDA 4FZZA 1TK0A 1L3TA 1EX4A 3VA0A 1RT1A 4BDYA 3U3YA 4H4OA 2P51A 3AVMA 1ZBLA 1DLOA 4DTXA 4DSLA 4KB1A 4LH5A 3VQ7A 3RTVA 2EHGA 3L3UA 4L8RB 5KRTA 3V9SA 1GOAA 3C94A 4F4KA 4E7LA 3TAMA 4CF9A 2HHWA 1VSHA 3ZSWA 3NCIA 3DLKA 3RMCA 2HVHA 1BHLA 1HYVA 4CGDA 2XY5A 2FBVA 3V81A 4R5PA 4IG3A 3MXIA 4DSJA 1S1UA 4FJ5A 2RN2A 4KHYA 1WLJA 3HYFA 4FLYA 3VN5A 1RDCA 4YNQA 4DU4A 3L2VA 4C8OA 3UIQA 3OYJA 4KTWA 3O4QA 1RT6A 3VQ8A 4W5OA 3NGZA 3V6DA 1NKBA 1W0HA 3V1OA 4B08A 4AHVA 4LD0A 3OYNA 4MFBA 1HYSA 4HHTA 2KTQA 3PUFA 1RTDA 1N6QA 2JLEA 4FJ7A 1LWFA 4M42A 4CF0A 1WNSA 1VSKA 3VQ9A 2HNZA 1XI1A 3L3VA 3LP1A 3CFPA 3KK1A 4AHUA 3KKSA 4NCBA 1BIUA 4Q5VA 4RW6A 3LDSA 4CK3A 1JLCA 4DMNA 4KHUA 5HLFA 1VRTA 1LAWA 3EY1A 3HPGA 4DTSA 2P5GA 3WNGA 3HP6A 1D9DA 4ZTFA 4FJJA 5KGWA 1RT7A 1JKHA 2YNIA 1KFSA 3B6PA 1J53A 3ZSQA 3KD5E 4HCCA 4N41A 1TAUA 3U3GA 4KAZA 1HRHA 1FXXA 3RRHA 4CEEA 4CHYA 1SL0A 3AVHA 2VG5A 3KLEA 1REVA 4KRFA 4IBNA 2X74A 3KD1E 2Z1HA 3VQBA 1NJZA 4N47A 1LAVA 3SYZA 4CHQA 1HMVA 3LAMA 3NF9A 3O4NA 2HMIA 4DTPA 5JS1A 4BDZA 4QAGA 1RTJA 1RBRA 2FBTA 1JL1A 3NBPA 3QEVA 4KO0A 3HL8A 1KVCA 3OYGA 1NK5A 3RRGA 2HW3A 1Q8IA 1I3AA 3V9XA 1NOYA 2XY8A 5SZTA 4J2AA 4CGJA 1B92A 1C1AA 3MEGA 4EZ6A 4CECA 1WSEA 2FBYA 3AA4A 1JLGA 3IG1A 4DU1A 2DFHA 4W5RA 4B9SA 4JS5A 4J2BA 2WOMA 2DY4A 4ID1A 1CXQA 2RKIA 2OPQA 2OPSA 4CEFA 3KJVA 1U49A 2PYJA 4ELUA 1TL1A 1FKOA 1BL3A 1MU2A 1WSHA 5FDLA 1TL3A 3MXJA 4C8NA 4DU3A 3ZSXA 3SZ2A 1JL2A 4Q0BA 1TVRA 4IFVA 2OYQA 4RW4A 4KKOA 1WAJA 4OGCA 4KHSA 3AA2A 4J2EA 1SUQA 4CCHA 3RMAA 4CERA 4E1NA 4KFBA 1Z25A 4CJ4A 1UWBA 3I0RA 4FJHA 1WSIA 5KRSA 4BE2A 1RDAA 4TSXA 3VQPA 1RBUA 2YKMA 4CEZA 3NDKA 1RTIA 4FM2A 3SCXA 5I42A 3MXMA 3OYFA 3V4IA 4FXDA 2Y1IA 3HPOA 2DFFA 4RW9A 3KK2A 3SQ0A 1LW0A 1X9SA 3FFIA 3HVRA 3L2UA 3M8RA 4N5SA 1TKXA 3P5JA 1RDDA 1C0UA 1VSDA 3DOKA 4OGEA 3QNOA 5J2QA 2Y1JA 4F3TA 3AA5X 1DTTA 3ZSYA 3KLHA 3DYAA 1VSFA 2HNDA 4F8RA 4KHQA 2DTUA 4BWJA 4J2DA 2KFNA 1LV5A 4DQSA 3THVA 3KKRA 2Z1IA 4I9LA 2RF2A 2D0AA 3DM2A 1VSIA
chains in the Genus database with same CATH superfamily
3VTIA 4FWOA 2P9NB 3FGUA 1RGIA 3CERA 3BP8A 3NF7A 4KTZA 3PO4A 1HQUA 2UXCK 2O8EB 5I3UA 3M8SA 4IOXA 5E41A 3CJBA 4MDAA 4Z4EA 4WE1A 4M45A 1R0AA 3CD6N 4QOZB 1JCGA 4DS5A 2ASPA 3OYEA 1E3MA 2O4IA 3NGIA 1S1TA 3R1XA 3QBWA 4A2BA 5C10A 2P9IA 2FF3B 4EZ9A 5A2QO 1RT2A 3A0IX 3CHWA 4OVLA 3ISNC 1BIZA 3SV4A 2RPIA 4O0JA 4DR4K 5KPRA 1GLBG 4CI6A 3K59A 2E2NA 2DPNA 3BF1A 4BC3A 3H1QA 1NGBA 4AH9A 3G0ZA 2BE2A 3R9PA 2HBKA 4CHOA 3OYCA 1ZBUA 2WBNA 1Z26A 3SJHA 4PHTX 4O4GA 3VEXA 2ZE2A 2KZZA 5LMNK 2WONA 1D4XA 3DLRA 2VQFK 3ZSVA 4JLHA 4K43A 1EETA 2PY5A 3QIOA 2F9TA 5BR8K 2NRHA 1TAQA 3HO1A 2ATQA 2WC9A 3V1QA 2FC0A 1B9FA 4BGBA 4CE9A 4M3UA 3NGYA 1YI2N 1LWCA 4RG8A 2HHSA 3WNHA 4DSEA 5LMUK 4JRQA 4MO4A 1QS4A 1K9MO 4M3ZA 2V7ZA 3HP9A 3LDOA 4DLGA 3HBTA 3G71N 5FROA 1LOTB 3AVCA 3EEQA 1U47A 4CESA 3NF6A 1GLDG 3CETA 1RDBA 4LSNA 2F8SA 1U45A 1QZ5A 3QDKA 3DI6A 3LZJA 4M3XA 5HP1A 2HNYA 4FK4A 2GUIA 3E01A 3NMUA 3BZKA 3DXKB 1O13A 2G8VA 1X3MA 3HJFA 4FVMA 4CHPA 3AARA 2Z1JA 3ZSZA 2CGKA 4ILHA 1UA0A 2I5JA 2QWRA 3OYDA 3VENA 3P38A 1ZXOA 3AO1A 3VQQA 2GEMA 3ZT3A 2OPPA 5M1OA 4QS9A 5CHIA 4MQ3A 1N8RO 1B9DA 3EE8A 2IGIA 3QEPA 3ID6A 1S9EA 4I9QA 1L3SA 1HUXA 4GV3A 4EFHA 4ZTJA 5FRNA 3AVBA 5BR9A 4DSFA 3CYMA 4CZHA 1J54A 4WF9L 1OVYA 1JLAA 2YJFA 1KXPA 4DTNA 3SI6A 1V4TA 2VG7A 5CZ1A 3OYIA 3V9UA 1Q86O 1U04A 1KLNA 3TTDA 3T3FA 3LDPA 2QWOA 1XHXA 3AVGA 2X78A 4FJIA 1U48A 3K0SA 3LDNA 4CJQA 5J2NA 1W9HA 1Q9YA 3DLGA 3O3HA 3TTFA 1P8ZA 3PV8A 2XY6A 4I6MA 1JLEA 1U6ZA 4YDUA 2G8UA 3PX6A 2KQ2A 3TAQA 1KAYA 1X9MA 1EKEA 3IUCA 3SNNA 3MECA 3PSIA 4FK2A 1VRUA 2E1ZA 3HVTA 4I2QA 4R79A 4K8XA 1J9AA 1HQEA 3T7ZA 4JRPA 5KI6A 1T44A 4EHUA 5AQWA 5C25A 5JICA 1IKVA 5C15A 3ATUA 4FLTA 4KTQA 1BQNA 4CEOA 4EP5A 4A61A 3MMVA 3O6WA 3OBWA 1IBLK 3O4WA 4JKGB 3B6OA 3SUNA 4YOWA 1JLBA 2F9WA 2ZWHA 4HUGA 4YFUA 1WSFA 2E6LA 2IDOA 2PZSA 2PAVA 3VEYA 4CJPA 2AP1A 5AZJB 1BU6O 3ZEUA 3AAQA 1C0MA 1KFDA 4H0XB 2GTDA 1Z05A 4C8KA 5AQQA 4X62K 1NK7A 4GVEA 3AO5A 2D0PA 3LWLA 2HHQA 3OBYA 2Z1GA 4DUZK 1ZBFA 4DF4A 4E7KA 1QQCA 3VQ4A 4Z4HA 4BR4A 4BRAA 1RNHA 1EQYA 4Z4FA 2O8FA 2JWKA 3QESA 1X9WA 2OZSA 1BA1A 1IKXA 4IO8A 1EWRA 5F2RA 3SPYA 2NRTA 2BDPA 1RT5A 4B3RK 3EL2A 3NVMA 3VQ5A 5GIPA 3M6GA 3ZCMA 3C7NB 1KC8O 1QSLA 3PO5A 3QNNA 4GY2B 3ZT1A 1NK9A 4JI3K 2Q3SA 4FO0A 4FW1A 3TPQA 1HNXK 4DCHA 2VWKA 2EX3A 4FJ9A 4HWIA 2ITMA 4FJXA 1HX1A 2HF4A 2NRVA 5H1SQ 4RCHA 2WTUA 1TGOA 4FLWA 3QFUA 4M7XA 3OYHA 1HNIA 2NRZA 3VQDA 3SK3A 3R6MA 2GX9A 4DTOA 5EVZA 4FWSA 1X9JA 3RMDA 3VA0A 3U3YA 4H4OA 5BPLA 4DTXA 3SBGA 4LH5A 3VQ7A 2BUPA 2EHGA 3L3UA 5KRTA 3V9SA 1QQNA 2PBDA 4A59A 4YY3K 2HVHA 2FSJA 1NGFA 1BHLA 4OO1J 4CGDA 4FJLA 1QQMA 4R5PA 4DSJA 4FJ5A 4KHYA 1XMQK 1QVGM 3HYFA 3FZHA 5BRFA 2FF6A 3VN5A 4YNQA 4C8OA 1R59O 1RT6A 1NKBA 2WUSA 3VF6A 3WT0A 1RTDA 1N6QA 2A3ZA 4H0PA 5GIOA 1NJIO 3LP1A 4O8UA 4JN4A 4NCBA 2W41A 4WQ5C 4RW6A 4CK3A 4DMNA 3CC4N 4KHUA 5HLFA 1VRTA 2P5GA 2O8DA 1K8KA 3HP6A 4XH4A 4ZTFA 3G6EN 3CC7N 1RT7A 1KFSA 3KD5E 1SAZA 1J53A 3B6PA 5EOYA 1NLVA 4Y0WA 1HRHA 5AQTA 2VG5A 2GUPA 3QICA 3E9LA 2X74A 2HMIA 4BDZA 1RTJA 3HL8A 4BR5A 1K73O 5E84A 5KPTA 1I3AA 2XY8A 2ZF5O 1NBWA 1B92A 1WSEA 3IG1A 2DFHA 4JS5A 5AQLA 5GAGP 3JXUA 2RKIA 2PYJA 3PIPL 1FKOA 1WSHA 4BRNA 5M1NA 3VGKA 3MXJA 4IDHA 4C8NA 1VQ7N 4DU3A 1IJJA 3KK7A 3O9RA 1TVRA 3WEEA 4KKOA 1W7AA 1J5EK 4MLHA 3RMAA 3I0RA 4TSXA 1L3UA 3MXMA 1EO1A 4FXDA 4XEIA 3V4IA 3HPOA 3KK2A 2ZJRL 1LW0A 3A5OC 1U2VA 1WOQA 3M8RA 1TKXA 1ATNA 1YJ9N 3AA5X 1DTTA 3KWIA 3CCJN 1YAGA 4KHQA 4J2DA 3THVA 4I9LA 2GELA 1JLGA 3DM2A 1VSIA 4DU4A 1S5JA 4BR7A 4FPBA 3CCVN 4HUFA 2UXBK 2E6MA 3T69A 3NH2A 5TKWA 4GKJK 3K5MA 1BUPA 3IMXA 3AVIA 3D2FA 2JGUA 5BN9A 4LSLA 4BRQA 1YVUA 2A6AA 3CCMN 3VF2A 4DUYK 2P9PB 3PSFA 4WFAL 2VGMA 3TU5A 3M8QA 4B9VA 1HNVA 3NFAA 3SQ4A 3U9DA 1JXEA 4CJ5A 3MEDA 4IOCL 3TI0A 3HT3A 1WB9A 3SBTA 5JS2A 3LWMA 4OX9K 1BQMA 1RBTA 2ETJA 4M3RA 4AHCA 2BANA 3LP0A 3M8PA 3ZSOA 3Q7CA 4DTMA 3KLFA 1YTAA 4M41A 3LDLA 4JI1K 5EXWA 4YOYA 1NGEA 3ZT0A 2A1SA 3HXMA 4BQZA 1YT3A 4CJUA 3L2WA 1S9GA 4YDUC 3LZIA 4CZMA 2A40A 4JK9A 3CPWM 2A42A 4XIUA 5JLFA 3JAMO 3NHGA 2P9UA 4BACA 1YHQN 1TKZA 2YKNA 1JLQA 4A5BA 5LL6Z 1T05A 3PY8A 4G1QA 2O8BA 4N76A 1T3VA 3SUQA 4BRHA 2E2QA 4CBWA 4E89A 1Q82O 3QMLA 5GAHP 1D9FA 3U6FA 3DOLA 4OKEA 4BE0A 1QZ6A 1QQOA 4BR0A 1N33K 4CJFA 3O9QA 3WXMB 4HTUA 1C1CA 3EKSA 1NGDA 4CVNE 4BRFA 4FJMA 1KVAA 4AQYK 2HHUA 4DS4A 1Q9XA 3JYTA 1FJGK 4PY5A 2YX6A 3L6QA 3S3MA 4AHRA 3MWPA 3C6HA 3C0BA 2QWPA 1SZ2A 2IVPA 4BG9A 2KFZA 3TAFA 5AQOA 3P39A 1VQPN 2HB5A 2G8KA 1S6QA 1U4BA 4YHHK 3J7ZO 3ZX2A 5HBMA 1X1PA 3ULDA 5K14A 2QWLA 3CJ9A 5HRRA 3BGRA 4BRPA 3OYKA 4JI0K 3CJAA 1CLQA 4PKGA 2Q97A 3FE1A 5F0XA 3QERA 1BGXT 3AO2A 4CJLA 4DFPA 4BE1A 4K8ZA 4HTLA 2VWJA 4V19S 4JKEA 4W5NA 2CGJA 5AZIA 1OKJA 2GWKA 2VWBA 1N34K 3LP3A 2Q2RA 1ZC6A 1Y64A 2IOCA 4B8AB 3M5RA 3VQAA 4YOXA 3WXIA 2W6LA 3HTVA 1NJWA 3I33A 3RMBA 1IO2A 2GV9A 2IS3A 1DT9A 4DV5K 4DV0K 1JLFA 4NLBA 2Q0UA 3PX0A 1VQLN 1YUWA 3MN5A 1Z6RA 2P9SA 3CPEA 5GADP 4O0IA 2O8DB 2NRRA 3OJUA 3L8BA 1KSPA 4FPAA 5AQYA 5KTQA 1NNEA 2B6AA 4CJRA 3U4LA 1O1WA 2VG6A 3THWB 3AVJA 4BRIA 1MA9B 4H0YB 1ASUA 3SUOA 3IRXA 4JHDA 3CJ7A 1HYZA 3PLAA 1GOBA 4K0KK 4PKIA 4OLBA 5AQHA 4CGHA 2OCEA 5FPDA 3QEWA 3SUPA 2ZM6K 5TKYA 3Q7BA 1A5XA 4DLEA 4DV2K 4A5AA 1IKYA 1TKDA 3CG7A 2E20A 4ZHRA 1S22A 1ZBIA 3VEZA 3MK6A 5ELZA 1UOCA 4FOIA 2XO7A 2O8CA 2IC3A 4FM0A 2NRXA 4FLVA 4IEEA 3HM9A 2D4WA 2ZD1A 2G8WA 5MLCQ 1SKSA 1BI4A 4BVPA 5JVGL 2YNFA 4GV6A 3LP2A 1QSSA 4PUOA 2QTDA 4NYNA 1C0GA 2VCPA 1BOTO 1SKWA 1U2VB 4B8CA 4DTUA 4EIAA 4CJKA 1TK5A 4UQGA 4DTJA 4FJGA 3ENBA 5BN8A 1ZYQA 4CZLA 4ILJA 2ASOA 3AV9A 3LPTA 4H5NA 4E1JA 4AILC 4LC9B 4KREA 3VPZA 2G8IA 3ULEB 2P9LB 4L3QA 3NH1A 4B9NA 4OPKA 1D5AA 5FLXO 3D2FB 1V4SA 3CM5A 4YOVA 4BG8A 4BRDA 3AO3A 3GE1A 1HKCA 2ASMA 4BR9A 4DQQA 1NMNA 4KH6A 4IWVA 3CJCA 2D0BA 4DF8A 2P1JA 4O55A 1TKTA 4MDBA 4RW8A 1VQ9N 3J80O 2XY7A 4DR7K 3GDQA 3RSEB 3HOSA 4IFYA 3UKUA 2YJEA 5C24A 3C6UA 3CMAN 2CGLA 3OA9A 3CC2N 4CIEA 3VGMA 1NGJA 3O9TA 1VQKN 4NCGA 2HHVA 4FK0A 1CXUA 4N56A 3QO9A 3AA3A 1FKPA 4CJ3A 3VQCA 3D45A 3D2EA 4Z94A 4U7BA 1XUPO 2ITGA 3MEEA 4JD2A 1NGHA 3D0PA 3FZMA 2F8TA 1EX4A 2QWQA 3SAGA 2P51A 1VQNN 4DSLA 4KB1A 1GOAA 4E7LA 3WQTA 3AY9A 5M1FA 2NNWA 2NLXA 2EWSA 3V81A 1WLJA 4FLYA 5JMVA 2O8BB 2YHXA 3L2VA 3OYJA 3VQ8A 3NGZA 3V6DA 1W0HA 3V1OA 4B08A 2FSKA 1ILYA 5CE3A 3OYNA 4MFBA 2ZJPL 1X3NA 3THYA 3VEOA 3PUFA 4M42A 3LM9A 2JLEA 4FJ7A 1DGKN 4CF0A 1XI1A 2HNZA 1BIUA 4Q5VA 4YOUA 3SAHA 4CZFA 3BEXA 1YVNA 3U9ZA 4FJJA 5KGWA 4B3OA 4HCCA 4N41A 3U3GA 1FXXA 3AVHA 3HI0A 3KLEA 3KD1E 4IOAL 1RFQA 5ADXH 1NJZA 2NRWA 3SYZA 1LAVA 1T6DA 3NF9A 3LAMA 3O4NA 1DEJA 3CQYA 5FPNA 1RBRA 2FBTA 1GLFO 3NBPA 3UKRB 4KO0A 1KVCA 1HJOA 1NK5A 4X66K 5AR0A 4CD3A 3V9XA 5SZTA 5IT9O 4JI2K 3L4QA 2FBYA 4B9SA 4W5RA 4LFBK 4CEFA 1U49A 4WYBA 5AQUA 2CH6A 3U8XA 3THXA 1TL1A 4NXNK 4DV1K 1BL3A 2HSTA 5FDLA 4JKHA 1TL3A 4Q0BA 4IFVA 2H3GX 1WAJA 1SUQA 3EKUA 4CERA 4E1NA 4KFBA 3A8YA 1UWBA 4BE2A 1KRPA 3J7YP 5I42A 2RE2A 4ISFA 4DHYA 3OYFA 3E66A 2DFFA 2UUCK 3FFIA 4FWNA 3ZETA 3G4SN 4N5SA 5B8HA 4M3YA 3DOKA 1RDUA 2Y1JA 4H0TB 4F3TA 5KQDA 4JI8K 2ZGZA 3VEVA 2P9IB 1ATSA 4DV3K 2KFNA 5M1PA 4IJAA 4WQ4C 4BVOA 1F21A 3L2QA 5AQXA 2ZGYA 3FZLA 4PA1A 5LJWA 3OTOK 4FVUA 2P9KA 4JKAA 4CJ7A 1HNZK 2BH1A 3SAFA 4Z4GA 2I7NA 1RBSA 1SL2A 4FJKA 3GG4A 4JS4A 3O1BA 4B9QA 2D5RA 5C2FA 4JAXA 3AVKA 1S1XA 3H3NO 1SV5A 2NZTA 2QI2A 4MLEA 3J7AP 3OW2M 4FWRA 3OS1A 3LPUA 5CR4A 4CIGA 5CYMA 3CQXA 2YHBA 4CFDA 2HVIA 4RTFD 4CJWA 3N4QA 2E88A 1XWLA 4OKJA 2O4GA 1Q81O 1KVBA 1MDUB 4BRKA 1QVFM 4KI6A 4C1NK 4EP4A 1GLLO 3RR7A 3WXKA 4PWDA 3DRRA 3CCLN 1TUYA 1Q7YO 3CMEN 4E7IA 4M3TA 2P9NA 5JVHL 3MCPA 4CK2A 3K5NA 3T19A 2YHWA 3TARA 2O8EA 3BY5A 1ASVA 3A5NC 2OA8A 3AGRA 4GMJB 4BROA 3HSTB 3F5TA 3AVNA 3VESA 3ENOA 3DXMA 1IG9A 4CJEA 1JCEA 5CYQA 3RWUA 1VSLA 3NE6A 2JWLA 3VQ6A 2X6SA 1NJYA 4CGGA 3OYAA 3VA3A 2OANA 5BPNA 3FZKA 2BGGA 2I7PA 1HLUA 4H4MA 4FWQA 2V7YA 1KCFA 1HR0K 3H3OB 1NK0A 4LFAK 2FSNA 4E7JA 3L2RA 2YHAA 4DQIA 1HPMA 1KD1O 3DMJA 4NCAA 1M1KO 4FYDA 5JLHA 2FBXA 1EP4A 2QWMA 4QCLA 3KVGA 4C8LA 4HVJA 3KK3A 4PL7A 3SV3A 3MDQA 4B9LA 3IAYA 5AFUH 5AQFA 4JD2B 2DFEA 3DLBA 3SJJA 2VYPA 4RWTA 1RDWX 3C6TA 2KW4A 5HOOA 4IDKA 1NKEA 1QE1A 1SKRA 4CD1A 4I6MB 3TABA 1A5VA 3NH0A 4JEPA 3CIPA 4ID5A 3O9SA 3QLHA 3OYLA 1TYQA 2D1KA 3BZCA 3L4IA 4FCYA 1BA0A 1MWKA 3GOIA 4BWMA 4CJVA 2YV0X 1I39A 3O3FA 3M1FA 5HRSA 3A2FA 5AQVA 1NJXA 5HRPA 1JXBA 4JKDA 5DK5A 1BG3A 4KHWA 3KLIA 1WBDA 4CK1A 3OHRA 3AVAA 4F9OA 4O8KA 3CM6A 4HUEA 4LF4K 3H6EA 3F9KA 1VQ4N 4CFCA 4DFKA 4Z0UA 3ZYYX 3F73A 3P1GA 4K25A 4B3TK 3KTQA 4DSKA 4AF1A 3DXKA 5M1KA 4UY8O 4EAHD 3V1RA 1YJNN 3VOVA 1TK8A 3WXLA 2XRIA 1BCOA 1EXQA 2HHTA 3OJSA 3WXJA 4PKHA 4LF6K 1VSMA 3ZEUB 1IBKK 1E4FT 1RBVA 1J5OA 1NOZA 3TSQA 4FJNA 4G9ZA 4B1VA 1ASWA 2KHOA 3OY9A 2QK9A 4KI4A 3FZFA 1TV6A 1XQSC 1YJWN 3QFPA 2O8FB 2R7YA 4CEQA 1ZBSA 3D7EO 1ZBHA 3SQ2A 4O44A 1FK9A 1IKWA 4FWPA 3QEXA 1N5YA 1SQKA 4ICLA 4CF1A 4DG1A 3EZ5A 2PYLA 2QXFA 1N36K 5EX5A 3CFOA 4GV9A 3SLCA 3BF3A 4Y1CA 2D0CA 4CF2A 2UU9K 3ALYA 1S1VA 5D3GA 3K2PA 3M3ZA 1WUAA 1BDGA 2HBLA 2W40A 4ELVA 5CZ2A 2Q36A 5EU7A 2QWNA 3FFKB 4M3WA 4JKBA 3NF8A 4B1XB 1T7PA 3OVNA 3DRSA 3K9KA 5FPMA 5GAEP 4H8KA 1NK4A 3IFRA 4LFCK 3LALA 1OH6A 2G8HA 4B3SK 3LANA 4KH4A 3PX4A 3T1HK 4NYFA 1KTQA 2V52B 4CIFA 4DTRA 1NGAA 3DLHA 2AJQA 2NUBA 1HNWK 3VMFB 3SQ1A 2XHBA 3CI5A 4FZYA 1L5UA 4CGIA 3S3NA 2QKBA 2YNGA 4Y1DA 3MN9A 1VQMN 3K57A 1MWMA 1S6PA 3WQUA 1S1WA 2J4RA 4QS7A 3V9WA 5AQRA 3E9PA 1UA1A 2YCHA 2OTLN 2E2PA 4W5QA 5AQKA 4HCBA 4X65K 4JKFA 5M1QA 1VQ6N 5FRMA 2BTFA 1VQ5N 3C65A 2YHYA 1WN7A 4H5TA 4CEBA 3ZX0A 2W42A 3S9HA 1DKGD 4DR1K 4WFBL 4FZZA 1TK0A 1L3TA 3ENHA 1K8KB 2E8AA 3L0QA 5DM6L 3FR0A 3AVMA 2OTJN 1VAZA 3F9MA 3DLLL 3RTVA 4ISEA 4F4KA 4CF9A 3QBXA 1W2BM 3C7NA 1VSHA 3NCIA 3DLKA 3IDHA 2D0OA 3RMCA 1G99A 2XY5A 2FBVA 3DXMB 1S1UA 2RN2A 4WQ5A 2V51B 5C12A 3O80A 3UIQA 1NU0A 4MO5A 4B1YB 3O4QA 4W5OA 4AHVA 4LD0A 3PIOL 1ESVA 4C23A 3CXCM 1LWFA 2HOEA 1OH8A 1WNSA 1VSKA 4KBOA 3VQ9A 2F4VK 3CFPA 4AHUA 4BC2A 5BRDA 3LDSA 1W97L 1JLCA 3WEEB 1LAWA 4DTSA 3WNGA 1D9DA 4CBUA 1JKHA 2YNIA 2HF3A 4H5VA 1TAUA 3RRHA 3G25A 4CEEA 4CHYA 3SMPA 5I9EB 3VQBA 4N47A 4CHQA 1HMVA 5KPZA 1NGCA 4DTPA 5JS1A 2QM1A 4QAGA 3P31A 1JL1A 4BC5A 3QEVA 2F7TA 1WBBA 3AAPA 4JK7A 3EE9A 3RRGA 1Q8IA 4J2AA 4DV7K 5BRHA 4DR5K 3VF4A 3VEWA 4DU1A 3DAWA 4PL8A 5ADXA 4J2BA 2DY4A 3TTCA 1TYQB 2OPQA 2OPSA 3D6RA 5AQMA 3KZBA 1MU2A 1XNRK 4X64K 2IVNA 3EZWA 1YXQA 3A5MC 3CJ1A 1NMDA 2OYQA 3CCQN 4KHSA 1IV0A 4J2EA 3LL3A 5BPMA 1Z25A 4CJ4A 4FJHA 5KRSA 3S3OA 1RBUA 4CEZA 3NDKA 1NK8A 1RTIA 1T6CA 2Y1IA 3KWGA 4RW9A 3S41A 3HVRA 3L2UA 4A62A 3QNOA 1RDDA 4NB4A 5J2QA 4YOTA 3ZSYA 5FPEA 3KLHA 3DYAA 4NLCA 1LV5A 2Z1IA 2RF2A 2D0AA 2RHKA 3CQ8A 4F2SA 4FSVA 4AHSA 2B5JA 4CF8A 4CZKA 3K58A 3IKMA 3VQEA 1QHAA 1QHTA 1C0FA 1CZAN 3TAEA 3TAPA 4JI4K 1VSJA 3MX2A 2FLOA 3P4IA 3QINA 4KPYA 4CHZA 5AQZA 3V9ZA 3CCUN 3AO4A 4XH1A 4LF9K 1IH7A 2FXUA 4JV5K 2KZMA 4DR3K 1Y97A 3G10A 2P9UB 4OJRA 4LF5K 3T1YK 4H0VB 2GBZA 3O1WA 4B9MA 3ASMA 1CZ9A 4O5FA 4NXMK 5C42A 5J2PA 4I2PA 3DWLA 2B4JA 1RTHA 1VSEA 1LW2A 4FLZA 2HHXA 4LF8K 3OYBA 3DLEA 3RVCA 1N32K 2HMPA 3LM2A 4C8MA 1SL1A 2KKZA 3H45C 1LWEA 3H1VX 5CY4A 1NKCA 4C1NI 4KB0A 5AQGA 1K6YA 4E19A 4CFBA 5J1EA 3MCAB 2P9PA 3O9UA 4JK8A 1KAXA 4JI5K 5AQSA 1C0TA 4DWIA 1G15A 4A2AA 5AJ3K 5T7BA 4FWLA 2LSNA 4O5BA 5SWMA 2IAJA 3MN7A 4DQPA 2UYTA 2IVOA 4LF7K 4Z4IA 1DTQA 1XNQK 4CEAA 2PFUA 1TUUA 3K9JA 4BGAA 3K5LA 1C6VA 4IG0A 4E1MA 3OS0A 4I7FA 2VQEK 5HROA 3A5LC 3DJCA 4E0DA 1LCUA 1S3XA 2F96A 1D8YA 4BRMA 4W5TA 3GL1A 5AZIB 3HK2A 3BDPA 4FWKA 4IFEA 3LDQA 3CF5L 3CFRA 2A1RA 4ELTA 4GVMA 1T03A 5AQNA 2WFBA 3C95A 3F2KA 3TAGA 4FW2A 3MX5A 2W6KA 4DV4K 2P9SB 2UUBK 1NK6A 4CW7B 3KLGA 5IWAK 1YTUA 5LY3A 3I55N 4CJSA 3I0SA 3W3DA 4IJNA 3C6AA 3ZSRA 5AQJA 2OPRA 3TR8A 3KHYA 4JHDB 5C2DA 1EWQA 5AFUA 1UAXA 4E3SA 1BISA 4JYAK 3OYMA 4LY7A 1S72N 1M90O 4U67L 3ZLJA 1ITGA 2A5XA 1FW6A 3HM8A 4H5WA 1HKGA 5LJVA 1JCFA 2CH5A 3CCRN 3SMSA 3MWTA 4NO7A 4CZIA 3DRPA 2P5OA 1E4GT 3CCSN 5BREA 4CFAA 1SS6A 5AQIA 3HRGA 2O8CB 4FJ8A 4B9TA 3HOTA 2GWJA 4JI6K 4DR2K 3NVKA 1YIJN 4CJTA 5J2MA 1BI4B 4JI7K 3VTHA 3P83D 4IO9L 3I8DA 5AQPA 4OPJA 1XC9A 4ILGB 4FZXC 1I94K 1HJRA 1NWKA 5KGXA 2QA4N 3WNEA 1QTMA 2HHHK 4LH4A 4A57A 2Q1NA 4CZJA 4FM1A 4IZ9A 3O8MA 2QEXN 2E5LK 3WNFA 1RT4A 2E4LA 5DM7L 3TWHA 3FLCO 2QKKA 2YNHA 3TSUA 4BR2A 2ZJQL 1RCHA 4EHTA 3IS9A 1BCMA 4M7YA 3AVLA 3ZT4A 1VQON 1A5WA 4Z4CA 4KH5A 3O08A 4B3MK 3UB5A 4DV6K 4FLXA 2IIRA 4IEIA 4GW6A 4AHTA 1RT3A 3SPZA 3THWA 3K5OA 4B1ZA 2Q31A 1WAFA 4K41A 3ITHA 4CZGA 4OLAA 4JKCA 5C0YA 3H08A 2E1YA 2X6NA 3UKUB 3OS2A 4FWMA 3QETA 4BY9C 1OVQA 2HBMA 4K42A 4WFNL 1QSYA 1H1VA 3HPHA 5GINA 4KV8A 5HRNA 3JSMA 3TANA 4CEDA 1GLJO 3EN9A 4OKKA 1OH5A 5E26A 4E7HA 1KLMA 3D2EB 2AA4A 3AVFA 5EY4A 4PQUA 4CHNA 3LAKA 3O3GA 1WSGA 3EO3A 1BWFO 4OPAA 4CBXA 1VK0A 3RR8A 4JNEA 3EYZA 4XH5A 1C1BA 3VETA 4J8FA 4DQ8A 4QS8A 1XMOK 4F3OA 4BQLA 1GOCA 4B9UA 3QIPA 3B8AX 3J8AA 2ZQBA 3T1AA 4CGFA 4DFJA 3KIOA 4IKFA 1IG8A 3VERA 4DFMA 1WSJA 1T8EA 4KHNA 4FLUA 4RW7A 4F2RA 1L3VA 4B1UB 2G8FA 3VGLA 4DQRA 1OH7A 4DSIA 5HL7L 3THYB 4AM7A 3NAEA 1NG9A 4BRLA 1KQSM 4OPHA 3QEIA 1HPZA 4ISGA 1CZBA 5DMRA 3ULEA 2P9LA 4CZEA 4DKWA 4BDPA 3ZT2A 3E9OA 3MAQA 1RILA 2OZMA 4GNIA 1XHZA 3WUHA 5KQ8A 1RT1A 3HZ6A 4BDYA 1ZBLA 1DLOA 3R3LA 2UUAK 4L8RB 3C94A 2YI1A 3TAMA 3O5BA 2HHWA 3ZSWA 5F1XA 3UE5A 2HBJA 1HYVA 1KAZA 3MXIA 4IG3A 3BUZB 1ATRA 3RSEA 3HSCA 4M63C 1RDCA 1JJ2M 3ATVA 1BO5O 4KTWA 2QW9A 1K8AO 1VQ8N 4BRGA 1HYSA 4HHTA 2KTQA 1NGGA 4H0OA 3THXB 4FOEA 4BREA 3J81O 3L3VA 4DR6K 1YF5L 2QXLA 3KK1A 2A41A 3KKSA 3R8EA 3N4PA 3EY1A 4YORA 3HPGA 1NGIA 3ZSQA 2E2OA 4KAZA 4DB3A 1J6ZA 1SL0A 4KRFA 1REVA 1NM1A 3H46O 4IBNA 3MN6A 3ZETB 2Z1HA 4H5RA 3ID8A 4IXCA 1VHXA 3TSPA 4WCEL 3OYGA 4KHPK 2HW3A 3W0LA 1NOYA 3E1YA 4CGJA 1C1AA 4H03B 3MEGA 4EZ6A 4CECA 3AA4A 1YITN 2Q0RA 1XC3A 1P90A 2WOMA 1IBMK 4ID1A 2UXDK 1CXQA 3KJVA 1GLEG 3AGKA 4ELUA 2P9KB 3QB0A 1GLAG 4AM6A 1GLCG 3ZSXA 3SZ2A 1JL2A 4RW4A 4JKGA 4OGCA 3AA2A 3ZX3A 3CCEN 4CCHA 4GKKK 3I56N 1WSIA 1RDAA 3VQPA 2YKMA 4FM2A 4WQ4A 3SCXA 3I8BA 2VGNA 1X9SA 3SQ0A 4BC4A 3JS6A 4FL9A 1Q18A 3P5JA 1C0UA 1VSDA 4OGEA 1HKBA 2KLAA 3GBTA 5AZJA 1VSFA 3UKRA 2HNDA 4F8RA 2DTUA 4BWJA 4BRCA 4DQSA 3KKRA 4B1WB
chains in the Genus database with same CATH topology
1S5JA 1F21A 3L2QA 4HUFA 3CQ8A 4F2SA 4PA1A 2E6MA 3NH2A 4AHSA 2B5JA 4CF8A 3K5MA 3AVIA 3NF7A 4KTZA 3K58A 3VQEA 3PO4A 1HQUA 1QHTA 2JGUA 4Z4GA 4LSLA 1RBSA 3TAEA 3TAPA 5I3UA 1SL2A 3M8SA 1YVUA 1VSJA 4FJKA 4JS4A 5E41A 4FJLA 2D5RA 3QINA 4KPYA 3AVKA 1S1XA 1SV5A 4CHZA 3M8QA 4B9VA 4Z4EA 3V9ZA 1HNVA 3AO4A 3OS1A 3LPUA 3NFAA 4WE1A 4M45A 1IH7A 5CYMA 4CIGA 3SQ4A 1R0AA 2KZMA 4CFDA 2YHBA 4QOZB 1Y97A 2HVIA 4CJWA 3G10A 1JXEA 4OJRA 4CJ5A 4DS5A 3MEDA 1XWLA 4OKJA 3TI0A 3OYEA 3HT3A 2O4IA 2GBZA 4B9MA 3ASMA 3NGIA 1CZ9A 1S1TA 2O4GA 5C42A 1KVBA 5J2PA 4I2PA 5JS2A 2B4JA 1RTHA 3LWMA 1VSEA 1LW2A 4KI6A 4EP4A 4EZ9A 1BQMA 3RR7A 1RT2A 4B3OA 1RBTA 4FLZA 4PWDA 2HHXA 3DRRA 4OVLA 3ISNC 2ETJA 1BIZA 4M3RA 4AHCA 3OYBA 2BANA 3DLEA 3SV4A 2RPIA 3LP0A 3M8PA 4O0JA 4E7IA 4M3TA 4C8MA 3ZSOA 1SL1A 4DTMA 3K5NA 4CK2A 3K59A 3T19A 1LWEA 5CY4A 1NKCA 3KLFA 1YTAA 4AH9A 4M41A 3TARA 3G0ZA 4KB0A 2BE2A 1ASVA 4CHOA 1K6YA 4E19A 3OYCA 2OA8A 4CFBA 1ZBUA 5J1EA 1Z26A 3ZT0A 2A1SA 3HXMA 1YT3A 4O4GA 4CJUA 1S9GA 2ZE2A 3L2WA 2KZZA 3LZIA 4GMJB 2WONA 3HSTB 3DLRA 3ZSVA 1C0TA 3AVNA 4JLHA 1G15A 1EETA 5T7BA 4XIUA 4DWIA 2PY5A 3QIOA 2LSNA 3NHGA 4O5BA 5SWMA 2IAJA 4BACA 1IG9A 1TAQA 4DQPA 4CJEA 1TKZA 2YKNA 1JLQA 3PY8A 1T05A 2ATQA 5CYQA 4G1QA 3V1QA 3HO1A 4N76A 2FC0A 1DTQA 1B9FA 3SUQA 4CEAA 3RWUA 4Z4IA 1VSLA 3NE6A 3VQ6A 4CE9A 4M3UA 2X6SA 3NGYA 4E89A 1NJYA 4CGGA 3K5LA 3OYAA 1LWCA 1C6VA 1D9FA 3U6FA 4RG8A 3VA3A 4IG0A 3DOLA 2HHSA 4E1MA 4OKEA 3OS0A 4BE0A 4I7FA 5HROA 3WNHA 4DSEA 4JRQA 1QS4A 2F96A 4E0DA 4M3ZA 1D8YA 4H4MA 3HP9A 4CJFA 4DLGA 2BGGA 4W5TA 4HTUA 1C1CA 1KCFA 3HK2A 5FROA 3BDPA 1NK0A 4FJMA 4E7JA 3AVCA 1KVAA 3L2RA 2YHAA 4DQIA 2HHUA 4DS4A 1U47A 4CESA 3CFRA 3NF6A 3JYTA 2A1RA 1Q9XA 4ELTA 4PY5A 4GVMA 3S3MA 3DMJA 1RDBA 4LSNA 4AHRA 1T03A 4NCAA 2F8SA 3C95A 1U45A 4FYDA 2FBXA 1EP4A 4QCLA 2KFZA 3TAFA 4C8LA 4HVJA 3KK3A 3DI6A 2HB5A 3LZJA 3SV3A 1S6QA 1U4BA 2G8KA 3TAGA 5HP1A 4B9LA 5HBMA 4FW2A 4M3XA 2HNYA 1X1PA 2GUIA 3IAYA 3E01A 3ULDA 4FK4A 2DFEA 3DLBA 3SJJA 5K14A 2G8VA 3HJFA 4FVMA 1NK6A 5HRRA 4CHPA 3BGRA 2Z1JA 3ZSZA 3C6TA 3KLGA 3OYKA 2KW4A 1UA0A 2I5JA 4IDKA 1QE1A 1NKEA 3OYDA 1YTUA 1CLQA 4CJSA 3I0SA 1SKRA 3AO1A 3VQQA 1A5VA 3TABA 3NH0A 3ZSRA 3ZT3A 2OPRA 3TR8A 3QERA 2OPPA 4ID5A 1BGXT 3AO2A 4CJLA 4DFPA 1UAXA 4BE1A 4E3SA 4MQ3A 1BISA 4K8ZA 1B9DA 3QLHA 3OYLA 2IGIA 3OYMA 3QEPA 4LY7A 1S9EA 4I9QA 2VWJA 1ITGA 1L3SA 4FCYA 4CJVA 4BWMA 2YV0X 4W5NA 1I39A 3O3FA 4ZTJA 5FRNA 3AVBA 4DSFA 3LP3A 5HRSA 3A2FA 1NJXA 2IOCA 5HRPA 3CYMA 1JXBA 1J54A 4B8AB 5DK5A 1JLAA 3DRPA 3VQAA 2P5OA 4KHWA 3KLIA 4DTNA 4CFAA 4CK1A 3SI6A 5CZ1A 2VG7A 3AVAA 3OYIA 3V9UA 1KLNA 1U04A 3CM6A 4HUEA 1NJWA 3RMBA 3T3FA 1IO2A 3F9KA 2GV9A 2IS3A 4FJ8A 1JLFA 4CFCA 4DFKA 3PX0A 4B9TA 4Z0UA 1XHXA 3F73A 3P1GA 3AVGA 2X78A 3KTQA 4FJIA 4DSKA 1U48A 4CJTA 5J2MA 4O0IA 1BI4B 3OJUA 3L8BA 1KSPA 4CJQA 3P83D 1W9HA 3V1RA 5KTQA 5J2NA 1Q9YA 3DLGA 3O3HA 2B6AA 3I8DA 4CJRA 3PV8A 4OPJA 2XY6A 1XC9A 1O1WA 1TK8A 2VG6A 4FZXC 2XRIA 1JLEA 1HJRA 3AVJA 1BCOA 5KGXA 1EXQA 2G8UA 3SUOA 1ASUA 3WNEA 3PX6A 3IRXA 1QTMA 4LH4A 3OJSA 2HHTA 2KQ2A 1HYZA 3TAQA 1X9MA 1EKEA 3SNNA 3MECA 1GOBA 4FM1A 4FK2A 1VSMA 4OLBA 1VRUA 3HVTA 4CGHA 3QEWA 4I2QA 3SUPA 4K8XA 3WNFA 1J9AA 1RBVA 1RT4A 1A5XA 2E4LA 4DLEA 1J5OA 1HQEA 3TWHA 1NOZA 4FJNA 2QKKA 2YNHA 1IKYA 4JRPA 1TKDA 3CG7A 5KI6A 1ASWA 1RCHA 4ZHRA 5C25A 1IKVA 3OY9A 3IS9A 1ZBIA 4FLTA 4KTQA 2QK9A 4KI4A 1UOCA 1BQNA 1BCMA 4CEOA 1TV6A 4EP5A 3AVLA 3ZT4A 2XO7A 1A5WA 4Z4CA 2IC3A 4FM0A 4FLVA 2R7YA 4CEQA 1ZBHA 3HM9A 3SQ2A 2ZD1A 1FK9A 4O44A 1IKWA 2G8WA 3QEXA 3B6OA 3SUNA 1SKSA 1N5YA 1BI4A 1JLBA 4DG1A 4ICLA 4CF1A 3EZ5A 4FLXA 2YNFA 3LP2A 1QSSA 4GW6A 4PUOA 4NYNA 4AHTA 2PYLA 2QXFA 1RT3A 4HUGA 3SPZA 3K5OA 4YFUA 1SKWA 3CFOA 1WAFA 3ITHA 4B8CA 4DTUA 4OLAA 1WSFA 2E6LA 2IDOA 3H08A 4Y1CA 2D0CA 2PZSA 4CJKA 2X6NA 4CF2A 1TK5A 1KRPA 3ALYA 1S1VA 4CJPA 4UQGA 3OS2A 4DTJA 3QETA 4FJGA 5D3GA 3K2PA 1ZYQA 4ELVA 5CZ2A 1C0MA 1KFDA 1QSYA 5EU7A 3AV9A 3HPHA 3LPTA 4C8KA 4KV8A 4M3WA 5HRNA 3JSMA 3TANA 3NF8A 1NK7A 1T7PA 3AO5A 3OVNA 4AILC 4CEDA 4KREA 3DRSA 3LWLA 2HHQA 4OKKA 2G8IA 4H8KA 1NK4A 3LALA 4E7HA 2Z1GA 2G8HA 3NH1A 1ZBFA 4DF4A 1KLMA 1QQCA 3LANA 4E7KA 3VQ4A 4OPKA 4Z4HA 4NYFA 1D5AA 3AVFA 3PX4A 4B9NA 1RNHA 3LAKA 4CHNA 3O3GA 1WSGA 3CM5A 4PQUA 4Z4FA 1KTQA 3QESA 1X9WA 4CIFA 3AO3A 2OZSA 1IKXA 1VK0A 4DQQA 3RR8A 4DTRA 3EYZA 3SPYA 3DLHA 2BDPA 1RT5A 2D0BA 1C1BA 3VQ5A 2NUBA 2P1JA 4O55A 4DF8A 2AJQA 3ZCMA 4F3OA 1TKTA 3SQ1A 1GOCA 4B9UA 3QIPA 2XHBA 1QSLA 3PO5A 2ZQBA 3T1AA 4CGFA 4RW8A 3KIOA 4DFJA 1L5UA 3QNNA 1L3UA 4FZYA 4IKFA 3ZT1A 4CGIA 2XY7A 3S3NA 1NK9A 2YNGA 4Y1DA 2QKBA 3K57A 2Q3SA 1S6PA 4M3YA 4FW1A 4IFYA 4DFMA 1S1WA 1WSJA 3V9WA 1T8EA 2VWKA 5C24A 1UA1A 3C6UA 4FLUA 4KHNA 2EX3A 4RW7A 4F2RA 4FJ9A 4FJXA 4CIEA 1L3VA 2G8FA 4W5QA 4DQRA 4NCGA 2HHVA 4DSIA 1TGOA 4HCBA 4FLWA 4FK0A 1CXUA 3NAEA 5FRMA 4N56A 3QO9A 3AA3A 1FKPA 4CJ3A 3VQCA 3QEIA 3S3OA 1HPZA 3OYHA 1CZBA 1HNIA 3D45A 5DMRA 1WN7A 4CEBA 4BDPA 3VQDA 3ZT2A 2ITGA 2W42A 3MAQA 3MEEA 1RILA 4DTOA 3S9HA 2OZMA 3D0PA 1NK8A 1XHZA 2F8TA 3RMDA 4FZZA 1TK0A 1L3TA 1EX4A 3VA0A 1RT1A 4BDYA 3U3YA 4H4OA 2P51A 3AVMA 1ZBLA 1DLOA 4DTXA 4DSLA 4KB1A 4LH5A 3VQ7A 3RTVA 2EHGA 3L3UA 4L8RB 5KRTA 3V9SA 1GOAA 3C94A 4F4KA 4E7LA 3TAMA 4CF9A 2HHWA 1VSHA 3ZSWA 3NCIA 3DLKA 3RMCA 2HVHA 1BHLA 1HYVA 4CGDA 2XY5A 2FBVA 3V81A 4R5PA 4IG3A 3MXIA 4DSJA 1S1UA 4FJ5A 2RN2A 4KHYA 1WLJA 3HYFA 4FLYA 3VN5A 1RDCA 4YNQA 4DU4A 3L2VA 4C8OA 3UIQA 3OYJA 4KTWA 3O4QA 1RT6A 3VQ8A 4W5OA 3NGZA 3V6DA 1NKBA 1W0HA 3V1OA 4B08A 4AHVA 4LD0A 3OYNA 4MFBA 1HYSA 4HHTA 2KTQA 3PUFA 1RTDA 1N6QA 2JLEA 4FJ7A 1LWFA 4M42A 4CF0A 1WNSA 1VSKA 3VQ9A 2HNZA 1XI1A 3L3VA 3LP1A 3CFPA 3KK1A 4AHUA 3KKSA 4NCBA 1BIUA 4Q5VA 4RW6A 3LDSA 4CK3A 1JLCA 4DMNA 4KHUA 5HLFA 1VRTA 1LAWA 3EY1A 3HPGA 4DTSA 2P5GA 3WNGA 3HP6A 1D9DA 4ZTFA 4FJJA 5KGWA 1RT7A 1JKHA 2YNIA 1KFSA 3B6PA 1J53A 3ZSQA 3KD5E 4HCCA 4N41A 1TAUA 3U3GA 4KAZA 1HRHA 1FXXA 3RRHA 4CEEA 4CHYA 1SL0A 3AVHA 2VG5A 3KLEA 1REVA 4KRFA 4IBNA 2X74A 3KD1E 2Z1HA 3VQBA 1NJZA 4N47A 1LAVA 3SYZA 4CHQA 1HMVA 3LAMA 3NF9A 3O4NA 2HMIA 4DTPA 5JS1A 4BDZA 4QAGA 1RTJA 1RBRA 2FBTA 1JL1A 3NBPA 3QEVA 4KO0A 3HL8A 1KVCA 3OYGA 1NK5A 3RRGA 2HW3A 1Q8IA 1I3AA 3V9XA 1NOYA 2XY8A 5SZTA 4J2AA 4CGJA 1B92A 1C1AA 3MEGA 4EZ6A 4CECA 1WSEA 2FBYA 3AA4A 1JLGA 3IG1A 4DU1A 2DFHA 4W5RA 4B9SA 4JS5A 4J2BA 2WOMA 2DY4A 4ID1A 1CXQA 2RKIA 2OPQA 2OPSA 4CEFA 3KJVA 1U49A 2PYJA 4ELUA 1TL1A 1FKOA 1BL3A 1MU2A 1WSHA 5FDLA 1TL3A 3MXJA 4C8NA 4DU3A 3ZSXA 3SZ2A 1JL2A 4Q0BA 1TVRA 4IFVA 2OYQA 4RW4A 4KKOA 1WAJA 4OGCA 4KHSA 3AA2A 4J2EA 1SUQA 4CCHA 3RMAA 4CERA 4E1NA 4KFBA 1Z25A 4CJ4A 1UWBA 3I0RA 4FJHA 1WSIA 5KRSA 4BE2A 1RDAA 4TSXA 3VQPA 1RBUA 2YKMA 4CEZA 3NDKA 1RTIA 4FM2A 3SCXA 5I42A 3MXMA 3OYFA 3V4IA 4FXDA 2Y1IA 3HPOA 2DFFA 4RW9A 3KK2A 3SQ0A 1LW0A 1X9SA 3FFIA 3HVRA 3L2UA 3M8RA 4N5SA 1TKXA 3P5JA 1RDDA 1C0UA 1VSDA 3DOKA 4OGEA 3QNOA 5J2QA 2Y1JA 4F3TA 3AA5X 1DTTA 3ZSYA 3KLHA 3DYAA 1VSFA 2HNDA 4F8RA 4KHQA 2DTUA 4BWJA 4J2DA 2KFNA 1LV5A 4DQSA 3THVA 3KKRA 2Z1IA 4I9LA 2RF2A 2D0AA 3DM2A 1VSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5J A;  1F21 A;  3L2Q A;  4HUF A;  3CQ8 A;  4F2S A;  4PA1 A;  2E6M A;  3NH2 A;  4AHS A;  2B5J A;  4CF8 A;  3K5M A;  3AVI A;  3NF7 A;  4KTZ A;  3K58 A;  3VQE A;  3PO4 A;  1HQU A;  1QHT A;  2JGU A;  4Z4G A;  4LSL A;  1RBS A;  3TAE A;  3TAP A;  5I3U A;  1SL2 A;  3M8S A;  1YVU A;  1VSJ A;  4FJK A;  4JS4 A;  5E41 A;  4FJL A;  2D5R A;  3QIN A;  4KPY A;  3AVK A;  1S1X A;  1SV5 A;  4CHZ A;  3M8Q A;  4B9V A;  4Z4E A;  3V9Z A;  1HNV A;  3AO4 A;  3OS1 A;  3LPU A;  3NFA A;  4WE1 A;  4M45 A;  1IH7 A;  5CYM A;  4CIG A;  3SQ4 A;  1R0A A;  2KZM A;  4CFD A;  2YHB A;  4QOZ B;  1Y97 A;  2HVI A;  4CJW A;  3G10 A;  1JXE A;  4OJR A;  4CJ5 A;  4DS5 A;  3MED A;  1XWL A;  4OKJ A;  3TI0 A;  3OYE A;  3HT3 A;  2O4I A;  2GBZ A;  4B9M A;  3ASM A;  3NGI A;  1CZ9 A;  1S1T A;  2O4G A;  5C42 A;  1KVB A;  5J2P A;  4I2P A;  5JS2 A;  2B4J A;  1RTH A;  3LWM A;  1VSE A;  1LW2 A;  4KI6 A;  4EP4 A;  4EZ9 A;  1BQM A;  3RR7 A;  1RT2 A;  4B3O A;  1RBT A;  4FLZ A;  4PWD A;  2HHX A;  3DRR A;  4OVL A;  3ISN C;  2ETJ A;  1BIZ A;  4M3R A;  4AHC A;  3OYB A;  2BAN A;  3DLE A;  3SV4 A;  2RPI A;  3LP0 A;  3M8P A;  4O0J A;  4E7I A;  4M3T A;  4C8M A;  3ZSO A;  1SL1 A;  4DTM A;  3K5N A;  4CK2 A;  3K59 A;  3T19 A;  1LWE A;  5CY4 A;  1NKC A;  3KLF A;  1YTA A;  4AH9 A;  4M41 A;  3TAR A;  3G0Z A;  4KB0 A;  2BE2 A;  1ASV A;  4CHO A;  1K6Y A;  4E19 A;  3OYC A;  2OA8 A;  4CFB A;  1ZBU A;  5J1E A;  1Z26 A;  3ZT0 A;  2A1S A;  3HXM A;  1YT3 A;  4O4G A;  4CJU A;  1S9G A;  2ZE2 A;  3L2W A;  2KZZ A;  3LZI A;  4GMJ B;  2WON A;  3HST B;  3DLR A;  3ZSV A;  1C0T A;  3AVN A;  4JLH A;  1G15 A;  1EET A;  5T7B A;  4XIU A;  4DWI A;  2PY5 A;  3QIO A;  2LSN A;  3NHG A;  4O5B A;  5SWM A;  2IAJ A;  4BAC A;  1IG9 A;  1TAQ A;  4DQP A;  4CJE A;  1TKZ A;  2YKN A;  1JLQ A;  3PY8 A;  1T05 A;  2ATQ A;  5CYQ A;  4G1Q A;  3V1Q A;  3HO1 A;  4N76 A;  2FC0 A;  1DTQ A;  1B9F A;  3SUQ A;  4CEA A;  3RWU A;  4Z4I A;  1VSL A;  3NE6 A;  3VQ6 A;  4CE9 A;  4M3U A;  2X6S A;  3NGY A;  4E89 A;  1NJY A;  4CGG A;  3K5L A;  3OYA A;  1LWC A;  1C6V A;  1D9F A;  3U6F A;  4RG8 A;  3VA3 A;  4IG0 A;  3DOL A;  2HHS A;  4E1M A;  4OKE A;  3OS0 A;  4BE0 A;  4I7F A;  5HRO A;  3WNH A;  4DSE A;  4JRQ A;  1QS4 A;  2F96 A;  4E0D A;  4M3Z A;  1D8Y A;  4H4M A;  3HP9 A;  4CJF A;  4DLG A;  2BGG A;  4W5T A;  4HTU A;  1C1C A;  1KCF A;  3HK2 A;  5FRO A;  3BDP A;  1NK0 A;  4FJM A;  4E7J A;  3AVC A;  1KVA A;  3L2R A;  2YHA A;  4DQI A;  2HHU A;  4DS4 A;  1U47 A;  4CES A;  3CFR A;  3NF6 A;  3JYT A;  2A1R A;  1Q9X A;  4ELT A;  4PY5 A;  4GVM A;  3S3M A;  3DMJ A;  1RDB A;  4LSN A;  4AHR A;  1T03 A;  4NCA A;  2F8S A;  3C95 A;  1U45 A;  4FYD A;  2FBX A;  1EP4 A;  4QCL A;  2KFZ A;  3TAF A;  4C8L A;  4HVJ A;  3KK3 A;  3DI6 A;  2HB5 A;  3LZJ A;  3SV3 A;  1S6Q A;  1U4B A;  2G8K A;  3TAG A;  5HP1 A;  4B9L A;  5HBM A;  4FW2 A;  4M3X A;  2HNY A;  1X1P A;  2GUI A;  3IAY A;  3E01 A;  3ULD A;  4FK4 A;  2DFE A;  3DLB A;  3SJJ A;  5K14 A;  2G8V A;  3HJF A;  4FVM A;  1NK6 A;  5HRR A;  4CHP A;  3BGR A;  2Z1J A;  3ZSZ A;  3C6T A;  3KLG A;  3OYK A;  2KW4 A;  1UA0 A;  2I5J A;  4IDK A;  1QE1 A;  1NKE A;  3OYD A;  1YTU A;  1CLQ A;  4CJS A;  3I0S A;  1SKR A;  3AO1 A;  3VQQ A;  1A5V A;  3TAB A;  3NH0 A;  3ZSR A;  3ZT3 A;  2OPR A;  3TR8 A;  3QER A;  2OPP A;  4ID5 A;  1BGX T;  3AO2 A;  4CJL A;  4DFP A;  1UAX A;  4BE1 A;  4E3S A;  4MQ3 A;  1BIS A;  4K8Z A;  1B9D A;  3QLH A;  3OYL A;  2IGI A;  3OYM A;  3QEP A;  4LY7 A;  1S9E A;  4I9Q A;  2VWJ A;  1ITG A;  1L3S A;  4FCY A;  4CJV A;  4BWM A;  2YV0 X;  4W5N A;  1I39 A;  3O3F A;  4ZTJ A;  5FRN A;  3AVB A;  4DSF A;  3LP3 A;  5HRS A;  3A2F A;  1NJX A;  2IOC A;  5HRP A;  3CYM A;  1JXB A;  1J54 A;  4B8A B;  5DK5 A;  1JLA A;  3DRP A;  3VQA A;  2P5O A;  4KHW A;  3KLI A;  4DTN A;  4CFA A;  4CK1 A;  3SI6 A;  5CZ1 A;  2VG7 A;  3AVA A;  3OYI A;  3V9U A;  1KLN A;  1U04 A;  3CM6 A;  4HUE A;  1NJW A;  3RMB A;  3T3F A;  1IO2 A;  3F9K A;  2GV9 A;  2IS3 A;  4FJ8 A;  1JLF A;  4CFC A;  4DFK A;  3PX0 A;  4B9T A;  4Z0U A;  1XHX A;  3F73 A;  3P1G A;  3AVG A;  2X78 A;  3KTQ A;  4FJI A;  4DSK A;  1U48 A;  4CJT A;  5J2M A;  4O0I A;  1BI4 B;  3OJU A;  3L8B A;  1KSP A;  4CJQ A;  3P83 D;  1W9H A;  3V1R A;  5KTQ A;  5J2N A;  1Q9Y A;  3DLG A;  3O3H A;  2B6A A;  3I8D A;  4CJR A;  3PV8 A;  4OPJ A;  2XY6 A;  1XC9 A;  1O1W A;  1TK8 A;  2VG6 A;  4FZX C;  2XRI A;  1JLE A;  1HJR A;  3AVJ A;  1BCO A;  5KGX A;  1EXQ A;  2G8U A;  3SUO A;  1ASU A;  3WNE A;  3PX6 A;  3IRX A;  1QTM A;  4LH4 A;  3OJS A;  2HHT A;  2KQ2 A;  1HYZ A;  3TAQ A;  1X9M A;  1EKE A;  3SNN A;  3MEC A;  1GOB A;  4FM1 A;  4FK2 A;  1VSM A;  4OLB A;  1VRU A;  3HVT A;  4CGH A;  3QEW A;  4I2Q A;  3SUP A;  4K8X A;  3WNF A;  1J9A A;  1RBV A;  1RT4 A;  1A5X A;  2E4L A;  4DLE A;  1J5O A;  1HQE A;  3TWH A;  1NOZ A;  4FJN A;  2QKK A;  2YNH A;  1IKY A;  4JRP A;  1TKD A;  3CG7 A;  5KI6 A;  1ASW A;  1RCH A;  4ZHR A;  5C25 A;  1IKV A;  3OY9 A;  3IS9 A;  1ZBI A;  4FLT A;  4KTQ A;  2QK9 A;  4KI4 A;  1UOC A;  1BQN A;  1BCM A;  4CEO A;  1TV6 A;  4EP5 A;  3AVL A;  3ZT4 A;  2XO7 A;  1A5W A;  4Z4C A;  2IC3 A;  4FM0 A;  4FLV A;  2R7Y A;  4CEQ A;  1ZBH A;  3HM9 A;  3SQ2 A;  2ZD1 A;  1FK9 A;  4O44 A;  1IKW A;  2G8W A;  3QEX A;  3B6O A;  3SUN A;  1SKS A;  1N5Y A;  1BI4 A;  1JLB A;  4DG1 A;  4ICL A;  4CF1 A;  3EZ5 A;  4FLX A;  2YNF A;  3LP2 A;  1QSS A;  4GW6 A;  4PUO A;  4NYN A;  4AHT A;  2PYL A;  2QXF A;  1RT3 A;  4HUG A;  3SPZ A;  3K5O A;  4YFU A;  1SKW A;  3CFO A;  1WAF A;  3ITH A;  4B8C A;  4DTU A;  4OLA A;  1WSF A;  2E6L A;  2IDO A;  3H08 A;  4Y1C A;  2D0C A;  2PZS A;  4CJK A;  2X6N A;  4CF2 A;  1TK5 A;  1KRP A;  3ALY A;  1S1V A;  4CJP A;  4UQG A;  3OS2 A;  4DTJ A;  3QET A;  4FJG A;  5D3G A;  3K2P A;  1ZYQ A;  4ELV A;  5CZ2 A;  1C0M A;  1KFD A;  1QSY A;  5EU7 A;  3AV9 A;  3HPH A;  3LPT A;  4C8K A;  4KV8 A;  4M3W A;  5HRN A;  3JSM A;  3TAN A;  3NF8 A;  1NK7 A;  1T7P A;  3AO5 A;  3OVN A;  4AIL C;  4CED A;  4KRE A;  3DRS A;  3LWL A;  2HHQ A;  4OKK A;  2G8I A;  4H8K A;  1NK4 A;  3LAL A;  4E7H A;  2Z1G A;  2G8H A;  3NH1 A;  1ZBF A;  4DF4 A;  1KLM A;  1QQC A;  3LAN A;  4E7K A;  3VQ4 A;  4OPK A;  4Z4H A;  4NYF A;  1D5A A;  3AVF A;  3PX4 A;  4B9N A;  1RNH A;  3LAK A;  4CHN A;  3O3G A;  1WSG A;  3CM5 A;  4PQU A;  4Z4F A;  1KTQ A;  3QES A;  1X9W A;  4CIF A;  3AO3 A;  2OZS A;  1IKX A;  1VK0 A;  4DQQ A;  3RR8 A;  4DTR A;  3EYZ A;  3SPY A;  3DLH A;  2BDP A;  1RT5 A;  2D0B A;  1C1B A;  3VQ5 A;  2NUB A;  2P1J A;  4O55 A;  4DF8 A;  2AJQ A;  3ZCM A;  4F3O A;  1TKT A;  3SQ1 A;  1GOC A;  4B9U A;  3QIP A;  2XHB A;  1QSL A;  3PO5 A;  2ZQB A;  3T1A A;  4CGF A;  4RW8 A;  3KIO A;  4DFJ A;  1L5U A;  3QNN A;  1L3U A;  4FZY A;  4IKF A;  3ZT1 A;  4CGI A;  2XY7 A;  3S3N A;  1NK9 A;  2YNG A;  4Y1D A;  2QKB A;  3K57 A;  2Q3S A;  1S6P A;  4M3Y A;  4FW1 A;  4IFY A;  4DFM A;  1S1W A;  1WSJ A;  3V9W A;  1T8E A;  2VWK A;  5C24 A;  1UA1 A;  3C6U A;  4FLU A;  4KHN A;  2EX3 A;  4RW7 A;  4F2R A;  4FJ9 A;  4FJX A;  4CIE A;  1L3V A;  2G8F A;  4W5Q A;  4DQR A;  4NCG A;  2HHV A;  4DSI A;  1TGO A;  4HCB A;  4FLW A;  4FK0 A;  1CXU A;  3NAE A;  5FRM A;  4N56 A;  3QO9 A;  3AA3 A;  1FKP A;  4CJ3 A;  3VQC A;  3QEI A;  3S3O A;  1HPZ A;  3OYH A;  1CZB A;  1HNI A;  3D45 A;  5DMR A;  1WN7 A;  4CEB A;  4BDP A;  3VQD A;  3ZT2 A;  2ITG A;  2W42 A;  3MAQ A;  3MEE A;  1RIL A;  4DTO A;  3S9H A;  2OZM A;  3D0P A;  1NK8 A;  1XHZ A;  2F8T A;  3RMD A;  4FZZ A;  1TK0 A;  1L3T A;  1EX4 A;  3VA0 A;  1RT1 A;  4BDY A;  3U3Y A;  4H4O A;  2P51 A;  3AVM A;  1ZBL A;  1DLO A;  4DTX A;  4DSL A;  4KB1 A;  4LH5 A;  3VQ7 A;  3RTV A;  2EHG A;  3L3U A;  4L8R B;  5KRT A;  3V9S A;  1GOA A;  3C94 A;  4F4K A;  4E7L A;  3TAM A;  4CF9 A;  2HHW A;  1VSH A;  3ZSW A;  3NCI A;  3DLK A;  3RMC A;  2HVH A;  1BHL A;  1HYV A;  4CGD A;  2XY5 A;  2FBV A;  3V81 A;  4R5P A;  4IG3 A;  3MXI A;  4DSJ A;  1S1U A;  4FJ5 A;  2RN2 A;  4KHY A;  1WLJ A;  3HYF A;  4FLY A;  3VN5 A;  1RDC A;  4YNQ A;  4DU4 A;  3L2V A;  4C8O A;  3UIQ A;  3OYJ A;  4KTW A;  3O4Q A;  1RT6 A;  3VQ8 A;  4W5O A;  3NGZ A;  3V6D A;  1NKB A;  1W0H A;  3V1O A;  4B08 A;  4AHV A;  4LD0 A;  3OYN A;  4MFB A;  1HYS A;  4HHT A;  2KTQ A;  3PUF A;  1RTD A;  1N6Q A;  2JLE A;  4FJ7 A;  1LWF A;  4M42 A;  4CF0 A;  1WNS A;  1VSK A;  3VQ9 A;  2HNZ A;  1XI1 A;  3L3V A;  3LP1 A;  3CFP A;  3KK1 A;  4AHU A;  3KKS A;  4NCB A;  1BIU A;  4Q5V A;  4RW6 A;  3LDS A;  4CK3 A;  1JLC A;  4DMN A;  4KHU A;  5HLF A;  1VRT A;  1LAW A;  3EY1 A;  3HPG A;  4DTS A;  2P5G A;  3WNG A;  3HP6 A;  1D9D A;  4ZTF A;  4FJJ A;  5KGW A;  1RT7 A;  1JKH A;  2YNI A;  1KFS A;  3B6P A;  1J53 A;  3ZSQ A;  3KD5 E;  4HCC A;  4N41 A;  1TAU A;  3U3G A;  4KAZ A;  1HRH A;  1FXX A;  3RRH A;  4CEE A;  4CHY A;  1SL0 A;  3AVH A;  2VG5 A;  3KLE A;  1REV A;  4KRF A;  4IBN A;  2X74 A;  3KD1 E;  2Z1H A;  3VQB A;  1NJZ A;  4N47 A;  1LAV A;  3SYZ A;  4CHQ A;  1HMV A;  3LAM A;  3NF9 A;  3O4N A;  2HMI A;  4DTP A;  5JS1 A;  4BDZ A;  4QAG A;  1RTJ A;  1RBR A;  2FBT A;  1JL1 A;  3NBP A;  3QEV A;  4KO0 A;  3HL8 A;  1KVC A;  3OYG A;  1NK5 A;  3RRG A;  2HW3 A;  1Q8I A;  1I3A A;  3V9X A;  1NOY A;  2XY8 A;  5SZT A;  4J2A A;  4CGJ A;  1B92 A;  1C1A A;  3MEG A;  4EZ6 A;  4CEC A;  1WSE A;  2FBY A;  3AA4 A;  1JLG A;  3IG1 A;  4DU1 A;  2DFH A;  4W5R A;  4B9S A;  4JS5 A;  4J2B A;  2WOM A;  2DY4 A;  4ID1 A;  1CXQ A;  2RKI A;  2OPQ A;  2OPS A;  4CEF A;  3KJV A;  1U49 A;  2PYJ A;  4ELU A;  1TL1 A;  1FKO A;  1BL3 A;  1MU2 A;  1WSH A;  5FDL A;  1TL3 A;  3MXJ A;  4C8N A;  4DU3 A;  3ZSX A;  3SZ2 A;  1JL2 A;  4Q0B A;  1TVR A;  4IFV A;  2OYQ A;  4RW4 A;  4KKO A;  1WAJ A;  4OGC A;  4KHS A;  3AA2 A;  4J2E A;  1SUQ A;  4CCH A;  3RMA A;  4CER A;  4E1N A;  4KFB A;  1Z25 A;  4CJ4 A;  1UWB A;  3I0R A;  4FJH A;  1WSI A;  5KRS A;  4BE2 A;  1RDA A;  4TSX A;  3VQP A;  1RBU A;  2YKM A;  4CEZ A;  3NDK A;  1RTI A;  4FM2 A;  3SCX A;  5I42 A;  3MXM A;  3OYF A;  3V4I A;  4FXD A;  2Y1I A;  3HPO A;  2DFF A;  4RW9 A;  3KK2 A;  3SQ0 A;  1LW0 A;  1X9S A;  3FFI A;  3HVR A;  3L2U A;  3M8R A;  4N5S A;  1TKX A;  3P5J A;  1RDD A;  1C0U A;  1VSD A;  3DOK A;  4OGE A;  3QNO A;  5J2Q A;  2Y1J A;  4F3T A;  3AA5 X;  1DTT A;  3ZSY A;  3KLH A;  3DYA A;  1VSF A;  2HND A;  4F8R A;  4KHQ A;  2DTU A;  4BWJ A;  4J2D A;  2KFN A;  1LV5 A;  4DQS A;  3THV A;  3KKR A;  2Z1I A;  4I9L A;  2RF2 A;  2D0A A;  3DM2 A;  1VSI A; 
#chains in the Genus database with same CATH topology
 3VTI A;  4FWO A;  2P9N B;  3FGU A;  1RGI A;  3CER A;  3BP8 A;  3NF7 A;  4KTZ A;  3PO4 A;  1HQU A;  2UXC K;  2O8E B;  5I3U A;  3M8S A;  4IOX A;  5E41 A;  3CJB A;  4MDA A;  4Z4E A;  4WE1 A;  4M45 A;  1R0A A;  3CD6 N;  4QOZ B;  1JCG A;  4DS5 A;  2ASP A;  3OYE A;  1E3M A;  2O4I A;  3NGI A;  1S1T A;  3R1X A;  3QBW A;  4A2B A;  5C10 A;  2P9I A;  2FF3 B;  4EZ9 A;  5A2Q O;  1RT2 A;  3A0I X;  3CHW A;  4OVL A;  3ISN C;  1BIZ A;  3SV4 A;  2RPI A;  4O0J A;  4DR4 K;  5KPR A;  1GLB G;  4CI6 A;  3K59 A;  2E2N A;  2DPN A;  3BF1 A;  4BC3 A;  3H1Q A;  1NGB A;  4AH9 A;  3G0Z A;  2BE2 A;  3R9P A;  2HBK A;  4CHO A;  3OYC A;  1ZBU A;  2WBN A;  1Z26 A;  3SJH A;  4PHT X;  4O4G A;  3VEX A;  2ZE2 A;  2KZZ A;  5LMN K;  2WON A;  1D4X A;  3DLR A;  2VQF K;  3ZSV A;  4JLH A;  4K43 A;  1EET A;  2PY5 A;  3QIO A;  2F9T A;  5BR8 K;  2NRH A;  1TAQ A;  3HO1 A;  2ATQ A;  2WC9 A;  3V1Q A;  2FC0 A;  1B9F A;  4BGB A;  4CE9 A;  4M3U A;  3NGY A;  1YI2 N;  1LWC A;  4RG8 A;  2HHS A;  3WNH A;  4DSE A;  5LMU K;  4JRQ A;  4MO4 A;  1QS4 A;  1K9M O;  4M3Z A;  2V7Z A;  3HP9 A;  3LDO A;  4DLG A;  3HBT A;  3G71 N;  5FRO A;  1LOT B;  3AVC A;  3EEQ A;  1U47 A;  4CES A;  3NF6 A;  1GLD G;  3CET A;  1RDB A;  4LSN A;  2F8S A;  1U45 A;  1QZ5 A;  3QDK A;  3DI6 A;  3LZJ A;  4M3X A;  5HP1 A;  2HNY A;  4FK4 A;  2GUI A;  3E01 A;  3NMU A;  3BZK A;  3DXK B;  1O13 A;  2G8V A;  1X3M A;  3HJF A;  4FVM A;  4CHP A;  3AAR A;  2Z1J A;  3ZSZ A;  2CGK A;  4ILH A;  1UA0 A;  2I5J A;  2QWR A;  3OYD A;  3VEN A;  3P38 A;  1ZXO A;  3AO1 A;  3VQQ A;  2GEM A;  3ZT3 A;  2OPP A;  5M1O A;  4QS9 A;  5CHI A;  4MQ3 A;  1N8R O;  1B9D A;  3EE8 A;  2IGI A;  3QEP A;  3ID6 A;  1S9E A;  4I9Q A;  1L3S A;  1HUX A;  4GV3 A;  4EFH A;  4ZTJ A;  5FRN A;  3AVB A;  5BR9 A;  4DSF A;  3CYM A;  4CZH A;  1J54 A;  4WF9 L;  1OVY A;  1JLA A;  2YJF A;  1KXP A;  4DTN A;  3SI6 A;  1V4T A;  2VG7 A;  5CZ1 A;  3OYI A;  3V9U A;  1Q86 O;  1U04 A;  1KLN A;  3TTD A;  3T3F A;  3LDP A;  2QWO A;  1XHX A;  3AVG A;  2X78 A;  4FJI A;  1U48 A;  3K0S A;  3LDN A;  4CJQ A;  5J2N A;  1W9H A;  1Q9Y A;  3DLG A;  3O3H A;  3TTF A;  1P8Z A;  3PV8 A;  2XY6 A;  4I6M A;  1JLE A;  1U6Z A;  4YDU A;  2G8U A;  3PX6 A;  2KQ2 A;  3TAQ A;  1KAY A;  1X9M A;  1EKE A;  3IUC A;  3SNN A;  3MEC A;  3PSI A;  4FK2 A;  1VRU A;  2E1Z A;  3HVT A;  4I2Q A;  4R79 A;  4K8X A;  1J9A A;  1HQE A;  3T7Z A;  4JRP A;  5KI6 A;  1T44 A;  4EHU A;  5AQW A;  5C25 A;  5JIC A;  1IKV A;  5C15 A;  3ATU A;  4FLT A;  4KTQ A;  1BQN A;  4CEO A;  4EP5 A;  4A61 A;  3MMV A;  3O6W A;  3OBW A;  1IBL K;  3O4W A;  4JKG B;  3B6O A;  3SUN A;  4YOW A;  1JLB A;  2F9W A;  2ZWH A;  4HUG A;  4YFU A;  1WSF A;  2E6L A;  2IDO A;  2PZS A;  2PAV A;  3VEY A;  4CJP A;  2AP1 A;  5AZJ B;  1BU6 O;  3ZEU A;  3AAQ A;  1C0M A;  1KFD A;  4H0X B;  2GTD A;  1Z05 A;  4C8K A;  5AQQ A;  4X62 K;  1NK7 A;  4GVE A;  3AO5 A;  2D0P A;  3LWL A;  2HHQ A;  3OBY A;  2Z1G A;  4DUZ K;  1ZBF A;  4DF4 A;  4E7K A;  1QQC A;  3VQ4 A;  4Z4H A;  4BR4 A;  4BRA A;  1RNH A;  1EQY A;  4Z4F A;  2O8F A;  2JWK A;  3QES A;  1X9W A;  2OZS A;  1BA1 A;  1IKX A;  4IO8 A;  1EWR A;  5F2R A;  3SPY A;  2NRT A;  2BDP A;  1RT5 A;  4B3R K;  3EL2 A;  3NVM A;  3VQ5 A;  5GIP A;  3M6G A;  3ZCM A;  3C7N B;  1KC8 O;  1QSL A;  3PO5 A;  3QNN A;  4GY2 B;  3ZT1 A;  1NK9 A;  4JI3 K;  2Q3S A;  4FO0 A;  4FW1 A;  3TPQ A;  1HNX K;  4DCH A;  2VWK A;  2EX3 A;  4FJ9 A;  4HWI A;  2ITM A;  4FJX A;  1HX1 A;  2HF4 A;  2NRV A;  5H1S Q;  4RCH A;  2WTU A;  1TGO A;  4FLW A;  3QFU A;  4M7X A;  3OYH A;  1HNI A;  2NRZ A;  3VQD A;  3SK3 A;  3R6M A;  2GX9 A;  4DTO A;  5EVZ A;  4FWS A;  1X9J A;  3RMD A;  3VA0 A;  3U3Y A;  4H4O A;  5BPL A;  4DTX A;  3SBG A;  4LH5 A;  3VQ7 A;  2BUP A;  2EHG A;  3L3U A;  5KRT A;  3V9S A;  1QQN A;  2PBD A;  4A59 A;  4YY3 K;  2HVH A;  2FSJ A;  1NGF A;  1BHL A;  4OO1 J;  4CGD A;  4FJL A;  1QQM A;  4R5P A;  4DSJ A;  4FJ5 A;  4KHY A;  1XMQ K;  1QVG M;  3HYF A;  3FZH A;  5BRF A;  2FF6 A;  3VN5 A;  4YNQ A;  4C8O A;  1R59 O;  1RT6 A;  1NKB A;  2WUS A;  3VF6 A;  3WT0 A;  1RTD A;  1N6Q A;  2A3Z A;  4H0P A;  5GIO A;  1NJI O;  3LP1 A;  4O8U A;  4JN4 A;  4NCB A;  2W41 A;  4WQ5 C;  4RW6 A;  4CK3 A;  4DMN A;  3CC4 N;  4KHU A;  5HLF A;  1VRT A;  2P5G A;  2O8D A;  1K8K A;  3HP6 A;  4XH4 A;  4ZTF A;  3G6E N;  3CC7 N;  1RT7 A;  1KFS A;  3KD5 E;  1SAZ A;  1J53 A;  3B6P A;  5EOY A;  1NLV A;  4Y0W A;  1HRH A;  5AQT A;  2VG5 A;  2GUP A;  3QIC A;  3E9L A;  2X74 A;  2HMI A;  4BDZ A;  1RTJ A;  3HL8 A;  4BR5 A;  1K73 O;  5E84 A;  5KPT A;  1I3A A;  2XY8 A;  2ZF5 O;  1NBW A;  1B92 A;  1WSE A;  3IG1 A;  2DFH A;  4JS5 A;  5AQL A;  5GAG P;  3JXU A;  2RKI A;  2PYJ A;  3PIP L;  1FKO A;  1WSH A;  4BRN A;  5M1N A;  3VGK A;  3MXJ A;  4IDH A;  4C8N A;  1VQ7 N;  4DU3 A;  1IJJ A;  3KK7 A;  3O9R A;  1TVR A;  3WEE A;  4KKO A;  1W7A A;  1J5E K;  4MLH A;  3RMA A;  3I0R A;  4TSX A;  1L3U A;  3MXM A;  1EO1 A;  4FXD A;  4XEI A;  3V4I A;  3HPO A;  3KK2 A;  2ZJR L;  1LW0 A;  3A5O C;  1U2V A;  1WOQ A;  3M8R A;  1TKX A;  1ATN A;  1YJ9 N;  3AA5 X;  1DTT A;  3KWI A;  3CCJ N;  1YAG A;  4KHQ A;  4J2D A;  3THV A;  4I9L A;  2GEL A;  1JLG A;  3DM2 A;  1VSI A;  4DU4 A;  1S5J A;  4BR7 A;  4FPB A;  3CCV N;  4HUF A;  2UXB K;  2E6M A;  3T69 A;  3NH2 A;  5TKW A;  4GKJ K;  3K5M A;  1BUP A;  3IMX A;  3AVI A;  3D2F A;  2JGU A;  5BN9 A;  4LSL A;  4BRQ A;  1YVU A;  2A6A A;  3CCM N;  3VF2 A;  4DUY K;  2P9P B;  3PSF A;  4WFA L;  2VGM A;  3TU5 A;  3M8Q A;  4B9V A;  1HNV A;  3NFA A;  3SQ4 A;  3U9D A;  1JXE A;  4CJ5 A;  3MED A;  4IOC L;  3TI0 A;  3HT3 A;  1WB9 A;  3SBT A;  5JS2 A;  3LWM A;  4OX9 K;  1BQM A;  1RBT A;  2ETJ A;  4M3R A;  4AHC A;  2BAN A;  3LP0 A;  3M8P A;  3ZSO A;  3Q7C A;  4DTM A;  3KLF A;  1YTA A;  4M41 A;  3LDL A;  4JI1 K;  5EXW A;  4YOY A;  1NGE A;  3ZT0 A;  2A1S A;  3HXM A;  4BQZ A;  1YT3 A;  4CJU A;  3L2W A;  1S9G A;  4YDU C;  3LZI A;  4CZM A;  2A40 A;  4JK9 A;  3CPW M;  2A42 A;  4XIU A;  5JLF A;  3JAM O;  3NHG A;  2P9U A;  4BAC A;  1YHQ N;  1TKZ A;  2YKN A;  1JLQ A;  4A5B A;  5LL6 Z;  1T05 A;  3PY8 A;  4G1Q A;  2O8B A;  4N76 A;  1T3V A;  3SUQ A;  4BRH A;  2E2Q A;  4CBW A;  4E89 A;  1Q82 O;  3QML A;  5GAH P;  1D9F A;  3U6F A;  3DOL A;  4OKE A;  4BE0 A;  1QZ6 A;  1QQO A;  4BR0 A;  1N33 K;  4CJF A;  3O9Q A;  3WXM B;  4HTU A;  1C1C A;  3EKS A;  1NGD A;  4CVN E;  4BRF A;  4FJM A;  1KVA A;  4AQY K;  2HHU A;  4DS4 A;  1Q9X A;  3JYT A;  1FJG K;  4PY5 A;  2YX6 A;  3L6Q A;  3S3M A;  4AHR A;  3MWP A;  3C6H A;  3C0B A;  2QWP A;  1SZ2 A;  2IVP A;  4BG9 A;  2KFZ A;  3TAF A;  5AQO A;  3P39 A;  1VQP N;  2HB5 A;  2G8K A;  1S6Q A;  1U4B A;  4YHH K;  3J7Z O;  3ZX2 A;  5HBM A;  1X1P A;  3ULD A;  5K14 A;  2QWL A;  3CJ9 A;  5HRR A;  3BGR A;  4BRP A;  3OYK A;  4JI0 K;  3CJA A;  1CLQ A;  4PKG A;  2Q97 A;  3FE1 A;  5F0X A;  3QER A;  1BGX T;  3AO2 A;  4CJL A;  4DFP A;  4BE1 A;  4K8Z A;  4HTL A;  2VWJ A;  4V19 S;  4JKE A;  4W5N A;  2CGJ A;  5AZI A;  1OKJ A;  2GWK A;  2VWB A;  1N34 K;  3LP3 A;  2Q2R A;  1ZC6 A;  1Y64 A;  2IOC A;  4B8A B;  3M5R A;  3VQA A;  4YOX A;  3WXI A;  2W6L A;  3HTV A;  1NJW A;  3I33 A;  3RMB A;  1IO2 A;  2GV9 A;  2IS3 A;  1DT9 A;  4DV5 K;  4DV0 K;  1JLF A;  4NLB A;  2Q0U A;  3PX0 A;  1VQL N;  1YUW A;  3MN5 A;  1Z6R A;  2P9S A;  3CPE A;  5GAD P;  4O0I A;  2O8D B;  2NRR A;  3OJU A;  3L8B A;  1KSP A;  4FPA A;  5AQY A;  5KTQ A;  1NNE A;  2B6A A;  4CJR A;  3U4L A;  1O1W A;  2VG6 A;  3THW B;  3AVJ A;  4BRI A;  1MA9 B;  4H0Y B;  1ASU A;  3SUO A;  3IRX A;  4JHD A;  3CJ7 A;  1HYZ A;  3PLA A;  1GOB A;  4K0K K;  4PKI A;  4OLB A;  5AQH A;  4CGH A;  2OCE A;  5FPD A;  3QEW A;  3SUP A;  2ZM6 K;  5TKY A;  3Q7B A;  1A5X A;  4DLE A;  4DV2 K;  4A5A A;  1IKY A;  1TKD A;  3CG7 A;  2E20 A;  4ZHR A;  1S22 A;  1ZBI A;  3VEZ A;  3MK6 A;  5ELZ A;  1UOC A;  4FOI A;  2XO7 A;  2O8C A;  2IC3 A;  4FM0 A;  2NRX A;  4FLV A;  4IEE A;  3HM9 A;  2D4W A;  2ZD1 A;  2G8W A;  5MLC Q;  1SKS A;  1BI4 A;  4BVP A;  5JVG L;  2YNF A;  4GV6 A;  3LP2 A;  1QSS A;  4PUO A;  2QTD A;  4NYN A;  1C0G A;  2VCP A;  1BOT O;  1SKW A;  1U2V B;  4B8C A;  4DTU A;  4EIA A;  4CJK A;  1TK5 A;  4UQG A;  4DTJ A;  4FJG A;  3ENB A;  5BN8 A;  1ZYQ A;  4CZL A;  4ILJ A;  2ASO A;  3AV9 A;  3LPT A;  4H5N A;  4E1J A;  4AIL C;  4LC9 B;  4KRE A;  3VPZ A;  2G8I A;  3ULE B;  2P9L B;  4L3Q A;  3NH1 A;  4B9N A;  4OPK A;  1D5A A;  5FLX O;  3D2F B;  1V4S A;  3CM5 A;  4YOV A;  4BG8 A;  4BRD A;  3AO3 A;  3GE1 A;  1HKC A;  2ASM A;  4BR9 A;  4DQQ A;  1NMN A;  4KH6 A;  4IWV A;  3CJC A;  2D0B A;  4DF8 A;  2P1J A;  4O55 A;  1TKT A;  4MDB A;  4RW8 A;  1VQ9 N;  3J80 O;  2XY7 A;  4DR7 K;  3GDQ A;  3RSE B;  3HOS A;  4IFY A;  3UKU A;  2YJE A;  5C24 A;  3C6U A;  3CMA N;  2CGL A;  3OA9 A;  3CC2 N;  4CIE A;  3VGM A;  1NGJ A;  3O9T A;  1VQK N;  4NCG A;  2HHV A;  4FK0 A;  1CXU A;  4N56 A;  3QO9 A;  3AA3 A;  1FKP A;  4CJ3 A;  3VQC A;  3D45 A;  3D2E A;  4Z94 A;  4U7B A;  1XUP O;  2ITG A;  3MEE A;  4JD2 A;  1NGH A;  3D0P A;  3FZM A;  2F8T A;  1EX4 A;  2QWQ A;  3SAG A;  2P51 A;  1VQN N;  4DSL A;  4KB1 A;  1GOA A;  4E7L A;  3WQT A;  3AY9 A;  5M1F A;  2NNW A;  2NLX A;  2EWS A;  3V81 A;  1WLJ A;  4FLY A;  5JMV A;  2O8B B;  2YHX A;  3L2V A;  3OYJ A;  3VQ8 A;  3NGZ A;  3V6D A;  1W0H A;  3V1O A;  4B08 A;  2FSK A;  1ILY A;  5CE3 A;  3OYN A;  4MFB A;  2ZJP L;  1X3N A;  3THY A;  3VEO A;  3PUF A;  4M42 A;  3LM9 A;  2JLE A;  4FJ7 A;  1DGK N;  4CF0 A;  1XI1 A;  2HNZ A;  1BIU A;  4Q5V A;  4YOU A;  3SAH A;  4CZF A;  3BEX A;  1YVN A;  3U9Z A;  4FJJ A;  5KGW A;  4B3O A;  4HCC A;  4N41 A;  3U3G A;  1FXX A;  3AVH A;  3HI0 A;  3KLE A;  3KD1 E;  4IOA L;  1RFQ A;  5ADX H;  1NJZ A;  2NRW A;  3SYZ A;  1LAV A;  1T6D A;  3NF9 A;  3LAM A;  3O4N A;  1DEJ A;  3CQY A;  5FPN A;  1RBR A;  2FBT A;  1GLF O;  3NBP A;  3UKR B;  4KO0 A;  1KVC A;  1HJO A;  1NK5 A;  4X66 K;  5AR0 A;  4CD3 A;  3V9X A;  5SZT A;  5IT9 O;  4JI2 K;  3L4Q A;  2FBY A;  4B9S A;  4W5R A;  4LFB K;  4CEF A;  1U49 A;  4WYB A;  5AQU A;  2CH6 A;  3U8X A;  3THX A;  1TL1 A;  4NXN K;  4DV1 K;  1BL3 A;  2HST A;  5FDL A;  4JKH A;  1TL3 A;  4Q0B A;  4IFV A;  2H3G X;  1WAJ A;  1SUQ A;  3EKU A;  4CER A;  4E1N A;  4KFB A;  3A8Y A;  1UWB A;  4BE2 A;  1KRP A;  3J7Y P;  5I42 A;  2RE2 A;  4ISF A;  4DHY A;  3OYF A;  3E66 A;  2DFF A;  2UUC K;  3FFI A;  4FWN A;  3ZET A;  3G4S N;  4N5S A;  5B8H A;  4M3Y A;  3DOK A;  1RDU A;  2Y1J A;  4H0T B;  4F3T A;  5KQD A;  4JI8 K;  2ZGZ A;  3VEV A;  2P9I B;  1ATS A;  4DV3 K;  2KFN A;  5M1P A;  4IJA A;  4WQ4 C;  4BVO A;  1F21 A;  3L2Q A;  5AQX A;  2ZGY A;  3FZL A;  4PA1 A;  5LJW A;  3OTO K;  4FVU A;  2P9K A;  4JKA A;  4CJ7 A;  1HNZ K;  2BH1 A;  3SAF A;  4Z4G A;  2I7N A;  1RBS A;  1SL2 A;  4FJK A;  3GG4 A;  4JS4 A;  3O1B A;  4B9Q A;  2D5R A;  5C2F A;  4JAX A;  3AVK A;  1S1X A;  3H3N O;  1SV5 A;  2NZT A;  2QI2 A;  4MLE A;  3J7A P;  3OW2 M;  4FWR A;  3OS1 A;  3LPU A;  5CR4 A;  4CIG A;  5CYM A;  3CQX A;  2YHB A;  4CFD A;  2HVI A;  4RTF D;  4CJW A;  3N4Q A;  2E88 A;  1XWL A;  4OKJ A;  2O4G A;  1Q81 O;  1KVB A;  1MDU B;  4BRK A;  1QVF M;  4KI6 A;  4C1N K;  4EP4 A;  1GLL O;  3RR7 A;  3WXK A;  4PWD A;  3DRR A;  3CCL N;  1TUY A;  1Q7Y O;  3CME N;  4E7I A;  4M3T A;  2P9N A;  5JVH L;  3MCP A;  4CK2 A;  3K5N A;  3T19 A;  2YHW A;  3TAR A;  2O8E A;  3BY5 A;  1ASV A;  3A5N C;  2OA8 A;  3AGR A;  4GMJ B;  4BRO A;  3HST B;  3F5T A;  3AVN A;  3VES A;  3ENO A;  3DXM A;  1IG9 A;  4CJE A;  1JCE A;  5CYQ A;  3RWU A;  1VSL A;  3NE6 A;  2JWL A;  3VQ6 A;  2X6S A;  1NJY A;  4CGG A;  3OYA A;  3VA3 A;  2OAN A;  5BPN A;  3FZK A;  2BGG A;  2I7P A;  1HLU A;  4H4M A;  4FWQ A;  2V7Y A;  1KCF A;  1HR0 K;  3H3O B;  1NK0 A;  4LFA K;  2FSN A;  4E7J A;  3L2R A;  2YHA A;  4DQI A;  1HPM A;  1KD1 O;  3DMJ A;  4NCA A;  1M1K O;  4FYD A;  5JLH A;  2FBX A;  1EP4 A;  2QWM A;  4QCL A;  3KVG A;  4C8L A;  4HVJ A;  3KK3 A;  4PL7 A;  3SV3 A;  3MDQ A;  4B9L A;  3IAY A;  5AFU H;  5AQF A;  4JD2 B;  2DFE A;  3DLB A;  3SJJ A;  2VYP A;  4RWT A;  1RDW X;  3C6T A;  2KW4 A;  5HOO A;  4IDK A;  1NKE A;  1QE1 A;  1SKR A;  4CD1 A;  4I6M B;  3TAB A;  1A5V A;  3NH0 A;  4JEP A;  3CIP A;  4ID5 A;  3O9S A;  3QLH A;  3OYL A;  1TYQ A;  2D1K A;  3BZC A;  3L4I A;  4FCY A;  1BA0 A;  1MWK A;  3GOI A;  4BWM A;  4CJV A;  2YV0 X;  1I39 A;  3O3F A;  3M1F A;  5HRS A;  3A2F A;  5AQV A;  1NJX A;  5HRP A;  1JXB A;  4JKD A;  5DK5 A;  1BG3 A;  4KHW A;  3KLI A;  1WBD A;  4CK1 A;  3OHR A;  3AVA A;  4F9O A;  4O8K A;  3CM6 A;  4HUE A;  4LF4 K;  3H6E A;  3F9K A;  1VQ4 N;  4CFC A;  4DFK A;  4Z0U A;  3ZYY X;  3F73 A;  3P1G A;  4K25 A;  4B3T K;  3KTQ A;  4DSK A;  4AF1 A;  3DXK A;  5M1K A;  4UY8 O;  4EAH D;  3V1R A;  1YJN N;  3VOV A;  1TK8 A;  3WXL A;  2XRI A;  1BCO A;  1EXQ A;  2HHT A;  3OJS A;  3WXJ A;  4PKH A;  4LF6 K;  1VSM A;  3ZEU B;  1IBK K;  1E4F T;  1RBV A;  1J5O A;  1NOZ A;  3TSQ A;  4FJN A;  4G9Z A;  4B1V A;  1ASW A;  2KHO A;  3OY9 A;  2QK9 A;  4KI4 A;  3FZF A;  1TV6 A;  1XQS C;  1YJW N;  3QFP A;  2O8F B;  2R7Y A;  4CEQ A;  1ZBS A;  3D7E O;  1ZBH A;  3SQ2 A;  4O44 A;  1FK9 A;  1IKW A;  4FWP A;  3QEX A;  1N5Y A;  1SQK A;  4ICL A;  4CF1 A;  4DG1 A;  3EZ5 A;  2PYL A;  2QXF A;  1N36 K;  5EX5 A;  3CFO A;  4GV9 A;  3SLC A;  3BF3 A;  4Y1C A;  2D0C A;  4CF2 A;  2UU9 K;  3ALY A;  1S1V A;  5D3G A;  3K2P A;  3M3Z A;  1WUA A;  1BDG A;  2HBL A;  2W40 A;  4ELV A;  5CZ2 A;  2Q36 A;  5EU7 A;  2QWN A;  3FFK B;  4M3W A;  4JKB A;  3NF8 A;  4B1X B;  1T7P A;  3OVN A;  3DRS A;  3K9K A;  5FPM A;  5GAE P;  4H8K A;  1NK4 A;  3IFR A;  4LFC K;  3LAL A;  1OH6 A;  2G8H A;  4B3S K;  3LAN A;  4KH4 A;  3PX4 A;  3T1H K;  4NYF A;  1KTQ A;  2V52 B;  4CIF A;  4DTR A;  1NGA A;  3DLH A;  2AJQ A;  2NUB A;  1HNW K;  3VMF B;  3SQ1 A;  2XHB A;  3CI5 A;  4FZY A;  1L5U A;  4CGI A;  3S3N A;  2QKB A;  2YNG A;  4Y1D A;  3MN9 A;  1VQM N;  3K57 A;  1MWM A;  1S6P A;  3WQU A;  1S1W A;  2J4R A;  4QS7 A;  3V9W A;  5AQR A;  3E9P A;  1UA1 A;  2YCH A;  2OTL N;  2E2P A;  4W5Q A;  5AQK A;  4HCB A;  4X65 K;  4JKF A;  5M1Q A;  1VQ6 N;  5FRM A;  2BTF A;  1VQ5 N;  3C65 A;  2YHY A;  1WN7 A;  4H5T A;  4CEB A;  3ZX0 A;  2W42 A;  3S9H A;  1DKG D;  4DR1 K;  4WFB L;  4FZZ A;  1TK0 A;  1L3T A;  3ENH A;  1K8K B;  2E8A A;  3L0Q A;  5DM6 L;  3FR0 A;  3AVM A;  2OTJ N;  1VAZ A;  3F9M A;  3DLL L;  3RTV A;  4ISE A;  4F4K A;  4CF9 A;  3QBX A;  1W2B M;  3C7N A;  1VSH A;  3NCI A;  3DLK A;  3IDH A;  2D0O A;  3RMC A;  1G99 A;  2XY5 A;  2FBV A;  3DXM B;  1S1U A;  2RN2 A;  4WQ5 A;  2V51 B;  5C12 A;  3O80 A;  3UIQ A;  1NU0 A;  4MO5 A;  4B1Y B;  3O4Q A;  4W5O A;  4AHV A;  4LD0 A;  3PIO L;  1ESV A;  4C23 A;  3CXC M;  1LWF A;  2HOE A;  1OH8 A;  1WNS A;  1VSK A;  4KBO A;  3VQ9 A;  2F4V K;  3CFP A;  4AHU A;  4BC2 A;  5BRD A;  3LDS A;  1W97 L;  1JLC A;  3WEE B;  1LAW A;  4DTS A;  3WNG A;  1D9D A;  4CBU A;  1JKH A;  2YNI A;  2HF3 A;  4H5V A;  1TAU A;  3RRH A;  3G25 A;  4CEE A;  4CHY A;  3SMP A;  5I9E B;  3VQB A;  4N47 A;  4CHQ A;  1HMV A;  5KPZ A;  1NGC A;  4DTP A;  5JS1 A;  2QM1 A;  4QAG A;  3P31 A;  1JL1 A;  4BC5 A;  3QEV A;  2F7T A;  1WBB A;  3AAP A;  4JK7 A;  3EE9 A;  3RRG A;  1Q8I A;  4J2A A;  4DV7 K;  5BRH A;  4DR5 K;  3VF4 A;  3VEW A;  4DU1 A;  3DAW A;  4PL8 A;  5ADX A;  4J2B A;  2DY4 A;  3TTC A;  1TYQ B;  2OPQ A;  2OPS A;  3D6R A;  5AQM A;  3KZB A;  1MU2 A;  1XNR K;  4X64 K;  2IVN A;  3EZW A;  1YXQ A;  3A5M C;  3CJ1 A;  1NMD A;  2OYQ A;  3CCQ N;  4KHS A;  1IV0 A;  4J2E A;  3LL3 A;  5BPM A;  1Z25 A;  4CJ4 A;  4FJH A;  5KRS A;  3S3O A;  1RBU A;  4CEZ A;  3NDK A;  1NK8 A;  1RTI A;  1T6C A;  2Y1I A;  3KWG A;  4RW9 A;  3S41 A;  3HVR A;  3L2U A;  4A62 A;  3QNO A;  1RDD A;  4NB4 A;  5J2Q A;  4YOT A;  3ZSY A;  5FPE A;  3KLH A;  3DYA A;  4NLC A;  1LV5 A;  2Z1I A;  2RF2 A;  2D0A A;  2RHK A;  3CQ8 A;  4F2S A;  4FSV A;  4AHS A;  2B5J A;  4CF8 A;  4CZK A;  3K58 A;  3IKM A;  3VQE A;  1QHA A;  1QHT A;  1C0F A;  1CZA N;  3TAE A;  3TAP A;  4JI4 K;  1VSJ A;  3MX2 A;  2FLO A;  3P4I A;  3QIN A;  4KPY A;  4CHZ A;  5AQZ A;  3V9Z A;  3CCU N;  3AO4 A;  4XH1 A;  4LF9 K;  1IH7 A;  2FXU A;  4JV5 K;  2KZM A;  4DR3 K;  1Y97 A;  3G10 A;  2P9U B;  4OJR A;  4LF5 K;  3T1Y K;  4H0V B;  2GBZ A;  3O1W A;  4B9M A;  3ASM A;  1CZ9 A;  4O5F A;  4NXM K;  5C42 A;  5J2P A;  4I2P A;  3DWL A;  2B4J A;  1RTH A;  1VSE A;  1LW2 A;  4FLZ A;  2HHX A;  4LF8 K;  3OYB A;  3DLE A;  3RVC A;  1N32 K;  2HMP A;  3LM2 A;  4C8M A;  1SL1 A;  2KKZ A;  3H45 C;  1LWE A;  3H1V X;  5CY4 A;  1NKC A;  4C1N I;  4KB0 A;  5AQG A;  1K6Y A;  4E19 A;  4CFB A;  5J1E A;  3MCA B;  2P9P A;  3O9U A;  4JK8 A;  1KAX A;  4JI5 K;  5AQS A;  1C0T A;  4DWI A;  1G15 A;  4A2A A;  5AJ3 K;  5T7B A;  4FWL A;  2LSN A;  4O5B A;  5SWM A;  2IAJ A;  3MN7 A;  4DQP A;  2UYT A;  2IVO A;  4LF7 K;  4Z4I A;  1DTQ A;  1XNQ K;  4CEA A;  2PFU A;  1TUU A;  3K9J A;  4BGA A;  3K5L A;  1C6V A;  4IG0 A;  4E1M A;  3OS0 A;  4I7F A;  2VQE K;  5HRO A;  3A5L C;  3DJC A;  4E0D A;  1LCU A;  1S3X A;  2F96 A;  1D8Y A;  4BRM A;  4W5T A;  3GL1 A;  5AZI B;  3HK2 A;  3BDP A;  4FWK A;  4IFE A;  3LDQ A;  3CF5 L;  3CFR A;  2A1R A;  4ELT A;  4GVM A;  1T03 A;  5AQN A;  2WFB A;  3C95 A;  3F2K A;  3TAG A;  4FW2 A;  3MX5 A;  2W6K A;  4DV4 K;  2P9S B;  2UUB K;  1NK6 A;  4CW7 B;  3KLG A;  5IWA K;  1YTU A;  5LY3 A;  3I55 N;  4CJS A;  3I0S A;  3W3D A;  4IJN A;  3C6A A;  3ZSR A;  5AQJ A;  2OPR A;  3TR8 A;  3KHY A;  4JHD B;  5C2D A;  1EWQ A;  5AFU A;  1UAX A;  4E3S A;  1BIS A;  4JYA K;  3OYM A;  4LY7 A;  1S72 N;  1M90 O;  4U67 L;  3ZLJ A;  1ITG A;  2A5X A;  1FW6 A;  3HM8 A;  4H5W A;  1HKG A;  5LJV A;  1JCF A;  2CH5 A;  3CCR N;  3SMS A;  3MWT A;  4NO7 A;  4CZI A;  3DRP A;  2P5O A;  1E4G T;  3CCS N;  5BRE A;  4CFA A;  1SS6 A;  5AQI A;  3HRG A;  2O8C B;  4FJ8 A;  4B9T A;  3HOT A;  2GWJ A;  4JI6 K;  4DR2 K;  3NVK A;  1YIJ N;  4CJT A;  5J2M A;  1BI4 B;  4JI7 K;  3VTH A;  3P83 D;  4IO9 L;  3I8D A;  5AQP A;  4OPJ A;  1XC9 A;  4ILG B;  4FZX C;  1I94 K;  1HJR A;  1NWK A;  5KGX A;  2QA4 N;  3WNE A;  1QTM A;  2HHH K;  4LH4 A;  4A57 A;  2Q1N A;  4CZJ A;  4FM1 A;  4IZ9 A;  3O8M A;  2QEX N;  2E5L K;  3WNF A;  1RT4 A;  2E4L A;  5DM7 L;  3TWH A;  3FLC O;  2QKK A;  2YNH A;  3TSU A;  4BR2 A;  2ZJQ L;  1RCH A;  4EHT A;  3IS9 A;  1BCM A;  4M7Y A;  3AVL A;  3ZT4 A;  1VQO N;  1A5W A;  4Z4C A;  4KH5 A;  3O08 A;  4B3M K;  3UB5 A;  4DV6 K;  4FLX A;  2IIR A;  4IEI A;  4GW6 A;  4AHT A;  1RT3 A;  3SPZ A;  3THW A;  3K5O A;  4B1Z A;  2Q31 A;  1WAF A;  4K41 A;  3ITH A;  4CZG A;  4OLA A;  4JKC A;  5C0Y A;  3H08 A;  2E1Y A;  2X6N A;  3UKU B;  3OS2 A;  4FWM A;  3QET A;  4BY9 C;  1OVQ A;  2HBM A;  4K42 A;  4WFN L;  1QSY A;  1H1V A;  3HPH A;  5GIN A;  4KV8 A;  5HRN A;  3JSM A;  3TAN A;  4CED A;  1GLJ O;  3EN9 A;  4OKK A;  1OH5 A;  5E26 A;  4E7H A;  1KLM A;  3D2E B;  2AA4 A;  3AVF A;  5EY4 A;  4PQU A;  4CHN A;  3LAK A;  3O3G A;  1WSG A;  3EO3 A;  1BWF O;  4OPA A;  4CBX A;  1VK0 A;  3RR8 A;  4JNE A;  3EYZ A;  4XH5 A;  1C1B A;  3VET A;  4J8F A;  4DQ8 A;  4QS8 A;  1XMO K;  4F3O A;  4BQL A;  1GOC A;  4B9U A;  3QIP A;  3B8A X;  3J8A A;  2ZQB A;  3T1A A;  4CGF A;  4DFJ A;  3KIO A;  4IKF A;  1IG8 A;  3VER A;  4DFM A;  1WSJ A;  1T8E A;  4KHN A;  4FLU A;  4RW7 A;  4F2R A;  1L3V A;  4B1U B;  2G8F A;  3VGL A;  4DQR A;  1OH7 A;  4DSI A;  5HL7 L;  3THY B;  4AM7 A;  3NAE A;  1NG9 A;  4BRL A;  1KQS M;  4OPH A;  3QEI A;  1HPZ A;  4ISG A;  1CZB A;  5DMR A;  3ULE A;  2P9L A;  4CZE A;  4DKW A;  4BDP A;  3ZT2 A;  3E9O A;  3MAQ A;  1RIL A;  2OZM A;  4GNI A;  1XHZ A;  3WUH A;  5KQ8 A;  1RT1 A;  3HZ6 A;  4BDY A;  1ZBL A;  1DLO A;  3R3L A;  2UUA K;  4L8R B;  3C94 A;  2YI1 A;  3TAM A;  3O5B A;  2HHW A;  3ZSW A;  5F1X A;  3UE5 A;  2HBJ A;  1HYV A;  1KAZ A;  3MXI A;  4IG3 A;  3BUZ B;  1ATR A;  3RSE A;  3HSC A;  4M63 C;  1RDC A;  1JJ2 M;  3ATV A;  1BO5 O;  4KTW A;  2QW9 A;  1K8A O;  1VQ8 N;  4BRG A;  1HYS A;  4HHT A;  2KTQ A;  1NGG A;  4H0O A;  3THX B;  4FOE A;  4BRE A;  3J81 O;  3L3V A;  4DR6 K;  1YF5 L;  2QXL A;  3KK1 A;  2A41 A;  3KKS A;  3R8E A;  3N4P A;  3EY1 A;  4YOR A;  3HPG A;  1NGI A;  3ZSQ A;  2E2O A;  4KAZ A;  4DB3 A;  1J6Z A;  1SL0 A;  4KRF A;  1REV A;  1NM1 A;  3H46 O;  4IBN A;  3MN6 A;  3ZET B;  2Z1H A;  4H5R A;  3ID8 A;  4IXC A;  1VHX A;  3TSP A;  4WCE L;  3OYG A;  4KHP K;  2HW3 A;  3W0L A;  1NOY A;  3E1Y A;  4CGJ A;  1C1A A;  4H03 B;  3MEG A;  4EZ6 A;  4CEC A;  3AA4 A;  1YIT N;  2Q0R A;  1XC3 A;  1P90 A;  2WOM A;  1IBM K;  4ID1 A;  2UXD K;  1CXQ A;  3KJV A;  1GLE G;  3AGK A;  4ELU A;  2P9K B;  3QB0 A;  1GLA G;  4AM6 A;  1GLC G;  3ZSX A;  3SZ2 A;  1JL2 A;  4RW4 A;  4JKG A;  4OGC A;  3AA2 A;  3ZX3 A;  3CCE N;  4CCH A;  4GKK K;  3I56 N;  1WSI A;  1RDA A;  3VQP A;  2YKM A;  4FM2 A;  4WQ4 A;  3SCX A;  3I8B A;  2VGN A;  1X9S A;  3SQ0 A;  4BC4 A;  3JS6 A;  4FL9 A;  1Q18 A;  3P5J A;  1C0U A;  1VSD A;  4OGE A;  1HKB A;  2KLA A;  3GBT A;  5AZJ A;  1VSF A;  3UKR A;  2HND A;  4F8R A;  2DTU A;  4BWJ A;  4BRC A;  4DQS A;  3KKR A;  4B1W B; 
#chains in the Genus database with same CATH homology
 1S5J A;  1F21 A;  3L2Q A;  4HUF A;  3CQ8 A;  4F2S A;  4PA1 A;  2E6M A;  3NH2 A;  4AHS A;  2B5J A;  4CF8 A;  3K5M A;  3AVI A;  3NF7 A;  4KTZ A;  3K58 A;  3VQE A;  3PO4 A;  1HQU A;  1QHT A;  2JGU A;  4Z4G A;  4LSL A;  1RBS A;  3TAE A;  3TAP A;  5I3U A;  1SL2 A;  3M8S A;  1YVU A;  1VSJ A;  4FJK A;  4JS4 A;  5E41 A;  4FJL A;  2D5R A;  3QIN A;  4KPY A;  3AVK A;  1S1X A;  1SV5 A;  4CHZ A;  3M8Q A;  4B9V A;  4Z4E A;  3V9Z A;  1HNV A;  3AO4 A;  3OS1 A;  3LPU A;  3NFA A;  4WE1 A;  4M45 A;  1IH7 A;  5CYM A;  4CIG A;  3SQ4 A;  1R0A A;  2KZM A;  4CFD A;  2YHB A;  4QOZ B;  1Y97 A;  2HVI A;  4CJW A;  3G10 A;  1JXE A;  4OJR A;  4CJ5 A;  4DS5 A;  3MED A;  1XWL A;  4OKJ A;  3TI0 A;  3OYE A;  3HT3 A;  2O4I A;  2GBZ A;  4B9M A;  3ASM A;  3NGI A;  1CZ9 A;  1S1T A;  2O4G A;  5C42 A;  1KVB A;  5J2P A;  4I2P A;  5JS2 A;  2B4J A;  1RTH A;  3LWM A;  1VSE A;  1LW2 A;  4KI6 A;  4EP4 A;  4EZ9 A;  1BQM A;  3RR7 A;  1RT2 A;  4B3O A;  1RBT A;  4FLZ A;  4PWD A;  2HHX A;  3DRR A;  4OVL A;  3ISN C;  2ETJ A;  1BIZ A;  4M3R A;  4AHC A;  3OYB A;  2BAN A;  3DLE A;  3SV4 A;  2RPI A;  3LP0 A;  3M8P A;  4O0J A;  4E7I A;  4M3T A;  4C8M A;  3ZSO A;  1SL1 A;  4DTM A;  3K5N A;  4CK2 A;  3K59 A;  3T19 A;  1LWE A;  5CY4 A;  1NKC A;  3KLF A;  1YTA A;  4AH9 A;  4M41 A;  3TAR A;  3G0Z A;  4KB0 A;  2BE2 A;  1ASV A;  4CHO A;  1K6Y A;  4E19 A;  3OYC A;  2OA8 A;  4CFB A;  1ZBU A;  5J1E A;  1Z26 A;  3ZT0 A;  2A1S A;  3HXM A;  1YT3 A;  4O4G A;  4CJU A;  1S9G A;  2ZE2 A;  3L2W A;  2KZZ A;  3LZI A;  4GMJ B;  2WON A;  3HST B;  3DLR A;  3ZSV A;  1C0T A;  3AVN A;  4JLH A;  1G15 A;  1EET A;  5T7B A;  4XIU A;  4DWI A;  2PY5 A;  3QIO A;  2LSN A;  3NHG A;  4O5B A;  5SWM A;  2IAJ A;  4BAC A;  1IG9 A;  1TAQ A;  4DQP A;  4CJE A;  1TKZ A;  2YKN A;  1JLQ A;  3PY8 A;  1T05 A;  2ATQ A;  5CYQ A;  4G1Q A;  3V1Q A;  3HO1 A;  4N76 A;  2FC0 A;  1DTQ A;  1B9F A;  3SUQ A;  4CEA A;  3RWU A;  4Z4I A;  1VSL A;  3NE6 A;  3VQ6 A;  4CE9 A;  4M3U A;  2X6S A;  3NGY A;  4E89 A;  1NJY A;  4CGG A;  3K5L A;  3OYA A;  1LWC A;  1C6V A;  1D9F A;  3U6F A;  4RG8 A;  3VA3 A;  4IG0 A;  3DOL A;  2HHS A;  4E1M A;  4OKE A;  3OS0 A;  4BE0 A;  4I7F A;  5HRO A;  3WNH A;  4DSE A;  4JRQ A;  1QS4 A;  2F96 A;  4E0D A;  4M3Z A;  1D8Y A;  4H4M A;  3HP9 A;  4CJF A;  4DLG A;  2BGG A;  4W5T A;  4HTU A;  1C1C A;  1KCF A;  3HK2 A;  5FRO A;  3BDP A;  1NK0 A;  4FJM A;  4E7J A;  3AVC A;  1KVA A;  3L2R A;  2YHA A;  4DQI A;  2HHU A;  4DS4 A;  1U47 A;  4CES A;  3CFR A;  3NF6 A;  3JYT A;  2A1R A;  1Q9X A;  4ELT A;  4PY5 A;  4GVM A;  3S3M A;  3DMJ A;  1RDB A;  4LSN A;  4AHR A;  1T03 A;  4NCA A;  2F8S A;  3C95 A;  1U45 A;  4FYD A;  2FBX A;  1EP4 A;  4QCL A;  2KFZ A;  3TAF A;  4C8L A;  4HVJ A;  3KK3 A;  3DI6 A;  2HB5 A;  3LZJ A;  3SV3 A;  1S6Q A;  1U4B A;  2G8K A;  3TAG A;  5HP1 A;  4B9L A;  5HBM A;  4FW2 A;  4M3X A;  2HNY A;  1X1P A;  2GUI A;  3IAY A;  3E01 A;  3ULD A;  4FK4 A;  2DFE A;  3DLB A;  3SJJ A;  5K14 A;  2G8V A;  3HJF A;  4FVM A;  1NK6 A;  5HRR A;  4CHP A;  3BGR A;  2Z1J A;  3ZSZ A;  3C6T A;  3KLG A;  3OYK A;  2KW4 A;  1UA0 A;  2I5J A;  4IDK A;  1QE1 A;  1NKE A;  3OYD A;  1YTU A;  1CLQ A;  4CJS A;  3I0S A;  1SKR A;  3AO1 A;  3VQQ A;  1A5V A;  3TAB A;  3NH0 A;  3ZSR A;  3ZT3 A;  2OPR A;  3TR8 A;  3QER A;  2OPP A;  4ID5 A;  1BGX T;  3AO2 A;  4CJL A;  4DFP A;  1UAX A;  4BE1 A;  4E3S A;  4MQ3 A;  1BIS A;  4K8Z A;  1B9D A;  3QLH A;  3OYL A;  2IGI A;  3OYM A;  3QEP A;  4LY7 A;  1S9E A;  4I9Q A;  2VWJ A;  1ITG A;  1L3S A;  4FCY A;  4CJV A;  4BWM A;  2YV0 X;  4W5N A;  1I39 A;  3O3F A;  4ZTJ A;  5FRN A;  3AVB A;  4DSF A;  3LP3 A;  5HRS A;  3A2F A;  1NJX A;  2IOC A;  5HRP A;  3CYM A;  1JXB A;  1J54 A;  4B8A B;  5DK5 A;  1JLA A;  3DRP A;  3VQA A;  2P5O A;  4KHW A;  3KLI A;  4DTN A;  4CFA A;  4CK1 A;  3SI6 A;  5CZ1 A;  2VG7 A;  3AVA A;  3OYI A;  3V9U A;  1KLN A;  1U04 A;  3CM6 A;  4HUE A;  1NJW A;  3RMB A;  3T3F A;  1IO2 A;  3F9K A;  2GV9 A;  2IS3 A;  4FJ8 A;  1JLF A;  4CFC A;  4DFK A;  3PX0 A;  4B9T A;  4Z0U A;  1XHX A;  3F73 A;  3P1G A;  3AVG A;  2X78 A;  3KTQ A;  4FJI A;  4DSK A;  1U48 A;  4CJT A;  5J2M A;  4O0I A;  1BI4 B;  3OJU A;  3L8B A;  1KSP A;  4CJQ A;  3P83 D;  1W9H A;  3V1R A;  5KTQ A;  5J2N A;  1Q9Y A;  3DLG A;  3O3H A;  2B6A A;  3I8D A;  4CJR A;  3PV8 A;  4OPJ A;  2XY6 A;  1XC9 A;  1O1W A;  1TK8 A;  2VG6 A;  4FZX C;  2XRI A;  1JLE A;  1HJR A;  3AVJ A;  1BCO A;  5KGX A;  1EXQ A;  2G8U A;  3SUO A;  1ASU A;  3WNE A;  3PX6 A;  3IRX A;  1QTM A;  4LH4 A;  3OJS A;  2HHT A;  2KQ2 A;  1HYZ A;  3TAQ A;  1X9M A;  1EKE A;  3SNN A;  3MEC A;  1GOB A;  4FM1 A;  4FK2 A;  1VSM A;  4OLB A;  1VRU A;  3HVT A;  4CGH A;  3QEW A;  4I2Q A;  3SUP A;  4K8X A;  3WNF A;  1J9A A;  1RBV A;  1RT4 A;  1A5X A;  2E4L A;  4DLE A;  1J5O A;  1HQE A;  3TWH A;  1NOZ A;  4FJN A;  2QKK A;  2YNH A;  1IKY A;  4JRP A;  1TKD A;  3CG7 A;  5KI6 A;  1ASW A;  1RCH A;  4ZHR A;  5C25 A;  1IKV A;  3OY9 A;  3IS9 A;  1ZBI A;  4FLT A;  4KTQ A;  2QK9 A;  4KI4 A;  1UOC A;  1BQN A;  1BCM A;  4CEO A;  1TV6 A;  4EP5 A;  3AVL A;  3ZT4 A;  2XO7 A;  1A5W A;  4Z4C A;  2IC3 A;  4FM0 A;  4FLV A;  2R7Y A;  4CEQ A;  1ZBH A;  3HM9 A;  3SQ2 A;  2ZD1 A;  1FK9 A;  4O44 A;  1IKW A;  2G8W A;  3QEX A;  3B6O A;  3SUN A;  1SKS A;  1N5Y A;  1BI4 A;  1JLB A;  4DG1 A;  4ICL A;  4CF1 A;  3EZ5 A;  4FLX A;  2YNF A;  3LP2 A;  1QSS A;  4GW6 A;  4PUO A;  4NYN A;  4AHT A;  2PYL A;  2QXF A;  1RT3 A;  4HUG A;  3SPZ A;  3K5O A;  4YFU A;  1SKW A;  3CFO A;  1WAF A;  3ITH A;  4B8C A;  4DTU A;  4OLA A;  1WSF A;  2E6L A;  2IDO A;  3H08 A;  4Y1C A;  2D0C A;  2PZS A;  4CJK A;  2X6N A;  4CF2 A;  1TK5 A;  1KRP A;  3ALY A;  1S1V A;  4CJP A;  4UQG A;  3OS2 A;  4DTJ A;  3QET A;  4FJG A;  5D3G A;  3K2P A;  1ZYQ A;  4ELV A;  5CZ2 A;  1C0M A;  1KFD A;  1QSY A;  5EU7 A;  3AV9 A;  3HPH A;  3LPT A;  4C8K A;  4KV8 A;  4M3W A;  5HRN A;  3JSM A;  3TAN A;  3NF8 A;  1NK7 A;  1T7P A;  3AO5 A;  3OVN A;  4AIL C;  4CED A;  4KRE A;  3DRS A;  3LWL A;  2HHQ A;  4OKK A;  2G8I A;  4H8K A;  1NK4 A;  3LAL A;  4E7H A;  2Z1G A;  2G8H A;  3NH1 A;  1ZBF A;  4DF4 A;  1KLM A;  1QQC A;  3LAN A;  4E7K A;  3VQ4 A;  4OPK A;  4Z4H A;  4NYF A;  1D5A A;  3AVF A;  3PX4 A;  4B9N A;  1RNH A;  3LAK A;  4CHN A;  3O3G A;  1WSG A;  3CM5 A;  4PQU A;  4Z4F A;  1KTQ A;  3QES A;  1X9W A;  4CIF A;  3AO3 A;  2OZS A;  1IKX A;  1VK0 A;  4DQQ A;  3RR8 A;  4DTR A;  3EYZ A;  3SPY A;  3DLH A;  2BDP A;  1RT5 A;  2D0B A;  1C1B A;  3VQ5 A;  2NUB A;  2P1J A;  4O55 A;  4DF8 A;  2AJQ A;  3ZCM A;  4F3O A;  1TKT A;  3SQ1 A;  1GOC A;  4B9U A;  3QIP A;  2XHB A;  1QSL A;  3PO5 A;  2ZQB A;  3T1A A;  4CGF A;  4RW8 A;  3KIO A;  4DFJ A;  1L5U A;  3QNN A;  1L3U A;  4FZY A;  4IKF A;  3ZT1 A;  4CGI A;  2XY7 A;  3S3N A;  1NK9 A;  2YNG A;  4Y1D A;  2QKB A;  3K57 A;  2Q3S A;  1S6P A;  4M3Y A;  4FW1 A;  4IFY A;  4DFM A;  1S1W A;  1WSJ A;  3V9W A;  1T8E A;  2VWK A;  5C24 A;  1UA1 A;  3C6U A;  4FLU A;  4KHN A;  2EX3 A;  4RW7 A;  4F2R A;  4FJ9 A;  4FJX A;  4CIE A;  1L3V A;  2G8F A;  4W5Q A;  4DQR A;  4NCG A;  2HHV A;  4DSI A;  1TGO A;  4HCB A;  4FLW A;  4FK0 A;  1CXU A;  3NAE A;  5FRM A;  4N56 A;  3QO9 A;  3AA3 A;  1FKP A;  4CJ3 A;  3VQC A;  3QEI A;  3S3O A;  1HPZ A;  3OYH A;  1CZB A;  1HNI A;  3D45 A;  5DMR A;  1WN7 A;  4CEB A;  4BDP A;  3VQD A;  3ZT2 A;  2ITG A;  2W42 A;  3MAQ A;  3MEE A;  1RIL A;  4DTO A;  3S9H A;  2OZM A;  3D0P A;  1NK8 A;  1XHZ A;  2F8T A;  3RMD A;  4FZZ A;  1TK0 A;  1L3T A;  1EX4 A;  3VA0 A;  1RT1 A;  4BDY A;  3U3Y A;  4H4O A;  2P51 A;  3AVM A;  1ZBL A;  1DLO A;  4DTX A;  4DSL A;  4KB1 A;  4LH5 A;  3VQ7 A;  3RTV A;  2EHG A;  3L3U A;  4L8R B;  5KRT A;  3V9S A;  1GOA A;  3C94 A;  4F4K A;  4E7L A;  3TAM A;  4CF9 A;  2HHW A;  1VSH A;  3ZSW A;  3NCI A;  3DLK A;  3RMC A;  2HVH A;  1BHL A;  1HYV A;  4CGD A;  2XY5 A;  2FBV A;  3V81 A;  4R5P A;  4IG3 A;  3MXI A;  4DSJ A;  1S1U A;  4FJ5 A;  2RN2 A;  4KHY A;  1WLJ A;  3HYF A;  4FLY A;  3VN5 A;  1RDC A;  4YNQ A;  4DU4 A;  3L2V A;  4C8O A;  3UIQ A;  3OYJ A;  4KTW A;  3O4Q A;  1RT6 A;  3VQ8 A;  4W5O A;  3NGZ A;  3V6D A;  1NKB A;  1W0H A;  3V1O A;  4B08 A;  4AHV A;  4LD0 A;  3OYN A;  4MFB A;  1HYS A;  4HHT A;  2KTQ A;  3PUF A;  1RTD A;  1N6Q A;  2JLE A;  4FJ7 A;  1LWF A;  4M42 A;  4CF0 A;  1WNS A;  1VSK A;  3VQ9 A;  2HNZ A;  1XI1 A;  3L3V A;  3LP1 A;  3CFP A;  3KK1 A;  4AHU A;  3KKS A;  4NCB A;  1BIU A;  4Q5V A;  4RW6 A;  3LDS A;  4CK3 A;  1JLC A;  4DMN A;  4KHU A;  5HLF A;  1VRT A;  1LAW A;  3EY1 A;  3HPG A;  4DTS A;  2P5G A;  3WNG A;  3HP6 A;  1D9D A;  4ZTF A;  4FJJ A;  5KGW A;  1RT7 A;  1JKH A;  2YNI A;  1KFS A;  3B6P A;  1J53 A;  3ZSQ A;  3KD5 E;  4HCC A;  4N41 A;  1TAU A;  3U3G A;  4KAZ A;  1HRH A;  1FXX A;  3RRH A;  4CEE A;  4CHY A;  1SL0 A;  3AVH A;  2VG5 A;  3KLE A;  1REV A;  4KRF A;  4IBN A;  2X74 A;  3KD1 E;  2Z1H A;  3VQB A;  1NJZ A;  4N47 A;  1LAV A;  3SYZ A;  4CHQ A;  1HMV A;  3LAM A;  3NF9 A;  3O4N A;  2HMI A;  4DTP A;  5JS1 A;  4BDZ A;  4QAG A;  1RTJ A;  1RBR A;  2FBT A;  1JL1 A;  3NBP A;  3QEV A;  4KO0 A;  3HL8 A;  1KVC A;  3OYG A;  1NK5 A;  3RRG A;  2HW3 A;  1Q8I A;  1I3A A;  3V9X A;  1NOY A;  2XY8 A;  5SZT A;  4J2A A;  4CGJ A;  1B92 A;  1C1A A;  3MEG A;  4EZ6 A;  4CEC A;  1WSE A;  2FBY A;  3AA4 A;  1JLG A;  3IG1 A;  4DU1 A;  2DFH A;  4W5R A;  4B9S A;  4JS5 A;  4J2B A;  2WOM A;  2DY4 A;  4ID1 A;  1CXQ A;  2RKI A;  2OPQ A;  2OPS A;  4CEF A;  3KJV A;  1U49 A;  2PYJ A;  4ELU A;  1TL1 A;  1FKO A;  1BL3 A;  1MU2 A;  1WSH A;  5FDL A;  1TL3 A;  3MXJ A;  4C8N A;  4DU3 A;  3ZSX A;  3SZ2 A;  1JL2 A;  4Q0B A;  1TVR A;  4IFV A;  2OYQ A;  4RW4 A;  4KKO A;  1WAJ A;  4OGC A;  4KHS A;  3AA2 A;  4J2E A;  1SUQ A;  4CCH A;  3RMA A;  4CER A;  4E1N A;  4KFB A;  1Z25 A;  4CJ4 A;  1UWB A;  3I0R A;  4FJH A;  1WSI A;  5KRS A;  4BE2 A;  1RDA A;  4TSX A;  3VQP A;  1RBU A;  2YKM A;  4CEZ A;  3NDK A;  1RTI A;  4FM2 A;  3SCX A;  5I42 A;  3MXM A;  3OYF A;  3V4I A;  4FXD A;  2Y1I A;  3HPO A;  2DFF A;  4RW9 A;  3KK2 A;  3SQ0 A;  1LW0 A;  1X9S A;  3FFI A;  3HVR A;  3L2U A;  3M8R A;  4N5S A;  1TKX A;  3P5J A;  1RDD A;  1C0U A;  1VSD A;  3DOK A;  4OGE A;  3QNO A;  5J2Q A;  2Y1J A;  4F3T A;  3AA5 X;  1DTT A;  3ZSY A;  3KLH A;  3DYA A;  1VSF A;  2HND A;  4F8R A;  4KHQ A;  2DTU A;  4BWJ A;  4J2D A;  2KFN A;  1LV5 A;  4DQS A;  3THV A;  3KKR A;  2Z1I A;  4I9L A;  2RF2 A;  2D0A A;  3DM2 A;  1VSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...