4B8AB

Structure of yeast not1 mif4g domain co-crystallized with caf1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
278
structure length
252
Chain Sequence
MFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription/hydrolase
total genus 81
structure length 252
sequence length 278
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b8aB00
1GOAA 1S1XA 3CG7A 4CJEA 3HM9A 4OLAA 3PV8A 2HHQA 1CLQA 3U3YA 1BQNA 3TAEA 2PZSA 3LZJA 2G8VA 1WAFA 4DLGA 2YKNA 4KB1A 1QSYA 4FJXA 1RT4A 1RT3A 1REVA 1WLJA 4M41A 4CJKA 3OS2A 2QKKA 3K2PA 2BANA 3C6UA 4CEZA 5K14A 4B9SA 3IG1A 1RCHA 4CEDA 1LAVA 5HRSA 1WSEA 1IO2A 1TKTA 4DU3A 3ZT3A 3HJFA 1KSPA 4BACA 4KO0A 3ZT4A 3NGIA 4M3UA 4FM0A 4RW9A 2HNZA 1VSLA 1RBRA 1S1TA 4CFCA 4HHTA 4BE1A 1Q9YA 3BDPA 4TSXA 4DSIA 4ZTJA 5FRMA 3RTVA 2E4LA 4E1MA 2QK9A 1ZBFA 4B8CA 1KVCA 3AVAA 3LWMA 1N5YA 1RBUA 4DTXA 4FJKA 4CFAA 4KREA 3WNEA 4CHQA 3K58A 3WNGA 2YV0X 1C0MA 1WNSA 4AHTA 4OPJA 4DTJA 3SUQA 4CHYA 3S3NA 4PUOA 2XY6A 3QNOA 1NOYA 2YHBA 3CYMA 2G8IA 4FLVA 3A2FA 3RR7A 4ZHRA 3AVIA 5J1EA 3L2RA 3EYZA 4FLXA 2XRIA 4CJ5A 4DTNA 3MECA 4OKKA 1NJWA 1B9DA 4E0DA 3B6PA 4GW6A 5KTQA 1RTDA 1UA1A 1ITGA 1C6VA 4B9VA 4I2PA 1Z26A 4FW1A 1D9FA 4FJJA 1RTHA 2Z1JA 2KW4A 3M8PA 3V9WA 1CZ9A 1C1CA 3HVRA 3TANA 1Z25A 3ULDA 1X1PA 5FDLA 1VRTA 4N41A 3AVKA 4B9NA 4W5NA 4DF8A 1JLBA 2G8UA 3VQ6A 4KI6A 2YNIA 1HRHA 3RMBA 3SJJA 3KKRA 3SNNA 4OKEA 3ZSXA 1CXUA 3K57A 3RMCA 2OA8A 4NCAA 2X74A 3PUFA 1ZBHA 4CHOA 4M3XA 3D0PA 3IS9A 1WSFA 1WSGA 4IFYA 1NJZA 2JLEA 3DRPA 3OVNA 4NCGA 3VQ4A 1YT3A 3LPUA 1UA0A 4J2BA 3HO1A 2YNFA 3O4QA 4FM2A 1NK4A 3QESA 2G8HA 4K8XA 4KHQA 1TKZA 4AH9A 4RG8A 4FJMA 1BI4B 1HQUA 3JYTA 4CJLA 4KFBA 3O3FA 4DS4A 1NK0A 1L5UA 4KAZA 4FJGA 4CHNA 3HPOA 3ASMA 1IKXA 3NFAA 5HRNA 4O0IA 3SV3A 4PWDA 5KI6A 4I9LA 4FJNA 3AVGA 4H8KA 1JLAA 4CGIA 3ALYA 2GBZA 4CGFA 3ZSWA 4FLYA 1VSHA 3OJUA 2IC3A 3DI6A 3T19A 3NCIA 3PX0A 2D0AA 2VWKA 3L2VA 2ZD1A 5CZ1A 1EETA 2E6MA 2KTQA 4Z0UA 3L3UA 1TL3A 4IG3A 2HVHA 1N6QA 2GUIA 4AHVA 5FRNA 4W5RA 3TARA 3HPHA 3KD5E 2E6LA 3AVJA 4DTPA 1GOCA 2RPIA 1BISA 4DS5A 2HHXA 2ZQBA 1YTAA 4BDPA 4FJHA 3NF7A 4PY5A 1RBTA 1A5VA 3ZSQA 3ZSRA 4FJ7A 3K5MA 2YNGA 3QEXA 1HYZA 4ELTA 1TK0A 2W42A 1S1WA 5KGXA 1ZBLA 3ZCMA 1NK5A 1HYVA 4HTUA 4DSKA 3RWUA 2IGIA 1Q9XA 3LDSA 3AO3A 3AO2A 3QNNA 5KRTA 1TK5A 4QAGA 4EZ6A 1IKVA 4F3TA 1HNIA 3DLKA 3LALA 3SUPA 4AHUA 4B9MA 4CGGA 3KLHA 1LAWA 2HB5A 2OZMA 3OYHA 5JS2A 4E7LA 4CF8A 2ITGA 1L3TA 2HHTA 2KFZA 3CFPA 1NJYA 4CK1A 3OYDA 1Y97A 4KV8A 1IKWA 2F96A 1LW0A 1RT2A 1C1AA 4BDYA 4DFMA 2G8KA 2BGGA 1DLOA 4CJRA 3LAKA 3MEDA 2VG5A 1B92A 1BIZA 1VSFA 2B4JA 1J9AA 4CJ4A 1WSJA 4CF2A 5I42A 5HP1A 3K59A 1S9GA 5KRSA 3OJSA 3I8DA 3PY8A 3VA0A 3WNFA 2DTUA 4E3SA 2Z1IA 1SKWA 3DRRA 3P1GA 3RMAA 4OGEA 4M3RA 4DFPA 4KHYA 1VSIA 5DK5A 2D0BA 2I5JA 3IAYA 4CECA 1BL3A 3E01A 4CJ3A 4JS4A 3SI6A 3WNHA 2IS3A 4DLEA 1EKEA 3AA3A 1O1WA 5C24A 4DTOA 3TAGA 1CZBA 4CGDA 4DG1A 3KK3A 1D5AA 1QSSA 4CESA 4DMNA 2DFFA 4E7IA 1L3UA 4CJFA 3RR8A 4CHZA 4BWJA 2HNYA 1QS4A 3O3HA 2KFNA 2FBVA 1F21A 3SZ2A 1GOBA 4HUGA 1UWBA 3DRSA 4F8RA 1RTJA 2DFHA 4CJSA 3QEWA 4KB0A 4AHSA 1BCOA 3OY9A 3SPYA 3JSMA 4DSLA 4OVLA 5HBMA 4W5QA 3U6FA 1RT5A 2AJQA 3L8BA 3PX6A 1LWFA 4RW6A 3U3GA 3K5LA 1NK8A 1LV5A 1JLCA 4NYFA 2XHBA 4PA1A 3DLRA 4ZTFA 3C94A 1RDDA 3HSTB 3T3FA 4B3OA 1VSEA 1S1VA 4CF9A 1WSIA 3FFIA 3V9UA 1X9WA 3QO9A 4MFBA 3H08A 1J5OA 3AVBA 2FBYA 3NGYA 2X6SA 3HP6A 4IDKA 4GVMA 1XC9A 1EXQA 4CHPA 3KJVA 3SUOA 2BDPA 1LW2A 3VA3A 1WSHA 2YHAA 3VQDA 5HRRA 4ID1A 4BDZA 4FZZA 1NK6A 2X78A 5CY4A 4LH4A 4LY7A 1U45A 4W5TA 1L3VA 3RRHA 4KHWA 3TR8A 3CFOA 2WOMA 4FK0A 3SYZA 1ZYQA 1S6PA 4FYDA 1RT6A 4DSFA 2O4IA 3HP9A 3VQAA 4JS5A 4UQGA 3VQCA 2B5JA 3V9ZA 3CFRA 3TABA 3M8SA 4DTUA 1XHZA 4G1QA 3KLFA 2G8FA 4O4GA 1RBVA 3TAMA 4F3OA 1QTMA 3RRGA 3ZT1A 3F9KA 1IG9A 3AV9A 3O3GA 3G0ZA 1T05A 3KLEA 1KRPA 2ZE2A 1W0HA 3ZSYA 4CGHA 3SPZA 2RKIA 1VSDA 2R7YA 1BIUA 4CIGA 1EX4A 4C8LA 4DQPA 4CJUA 4KI4A 1SL2A 3CM6A 4Z4GA 4M3ZA 3ISNC 1NK7A 4FZXC 4EP4A 5J2NA 3VQQA 1S5JA 3OYMA 5T7BA 3MXMA 2B6AA 3L2QA 1RILA 3M8QA 4DFJA 3NH0A 3QETA 1NKCA 2Z1GA 3HXMA 3DLHA 1B9FA 4GMJB 2FC0A 4RW4A 1KLMA 1HJRA 4FLTA 3QEPA 1TKDA 4IKFA 3LPTA 4HCBA 4CE9A 3SV4A 3G10A 1LWEA 3M8RA 3KLGA 4DSJA 4B8AB 1LWCA 1R0AA 3KD1E 4K8ZA 2HW3A 2A1RA 2KZZA 3ITHA 3OS1A 1UOCA 4FK4A 4Y1CA 1EP4A 3KLIA 1D8YA 3SCXA 2OPSA 1KTQA 4Y1DA 3EZ5A 5SZTA 4NYNA 1KCFA 5HLFA 2XY5A 4ELVA 3LP2A 4H4OA 3VQEA 3DOKA 3AO5A 3NGZA 4DU1A 1XI1A 1JLGA 3P83D 4FM1A 1U4BA 4KPYA 4KHUA 4M3YA 2NUBA 3QLHA 2KZMA 4WE1A 2IDOA 1A5XA 1KLNA 2HVIA 3HYFA 4F2SA 1WAJA 2EX3A 3O4NA 1TV6A 4M3TA 1HNVA 3OYFA 3MAQA 4DF4A 4E1NA 5J2MA 3L3VA 3L2UA 2OZSA 3MXIA 1SL1A 4HVJA 3V9SA 2IOCA 4ELUA 2KQ2A 4C8NA 4E7KA 4AHRA 4DQIA 3ZSVA 4I7FA 5HRPA 3V1QA 1NKBA 4FJIA 1JXEA 2Q3SA 2Y1JA 3T1AA 2PYLA 2QXFA 4DTMA 5D3GA 2RN2A 3HL8A 2HHVA 3I0SA 4E89A 3AO1A 4N47A 4Z4FA 1JKHA 3NHGA 2XO7A 4OGCA 2VG6A 5J2QA 4LH5A 5JS1A 3MXJA 4CFDA 1VSMA 1XWLA 4HUFA 1JL2A 1SKRA 5C42A 3EY1A 1SL0A 1W9HA 3OYIA 4AILC 1TGOA 4I2QA 1SKSA 1S9EA 3HPGA 3LAMA 1D9DA 2OYQA 4CJVA 4O5BA 3QERA 4CEBA 4CJPA 4XIUA 4BE2A 1S6QA 4KHNA 3F73A 4CEFA 4KTWA 3NDKA 3S3MA 1JLQA 1U04A 3VQPA 4OJRA 4LD0A 1TVRA 4ICLA 4FJ5A 4LSNA 3NH2A 2BE2A 3MEEA 4L8RB 1U47A 3LANA 1TL1A 3HK2A 4E7JA 4F2RA 1C1BA 2JGUA 3AA4A 3QEIA 1G15A 1C0TA 3DM2A 3V1RA 4N5SA 3DLBA 5EU7A 4B9TA 1RDAA 4Z4EA 2X6NA 4C8MA 4CK2A 4E19A 4M42A 4KRFA 1ASVA 1J54A 3HT3A 4FLWA 3AVFA 3VQBA 5HROA 5KGWA 1QE1A 1XHXA 3SUNA 4CF1A 1BI4A 2FBTA 1NJXA 3MEGA 4R5PA 1TK8A 1BCMA 4HCCA 1MU2A 2D0CA 3QIOA 1U49A 5CZ2A 2A1SA 1TAQA 4CEOA 1TKXA 2WONA 3VN5A 1C0UA 4CERA 2F8TA 4DTRA 1BQMA 3S9HA 3B6OA 4AHCA 4LSLA 4OPKA 3OYKA 4FJ8A 1CXQA 1RDBA 1X9SA 1X9MA 2HHWA 3KK1A 4IG0A 2XY7A 3VQ8A 4B9LA 4JLHA 3ZT0A 4JRPA 2RF2A 4IFVA 4FCYA 5FROA 1RT1A 4OLBA 1FKPA 3AO4A 4CK3A 3I0RA 3K5NA 2XY8A 3QEVA 2HHSA 1DTTA 4BWMA 4DWIA 3OYJA 4PQUA 5J2PA 3LP1A 3KK2A 3KTQA 3TAFA 1ZBIA 3NE6A 1FKOA 3HVTA 3OYAA 1T03A 1L3SA 4H4MA 3P5JA 4E7HA 4B08A 1VK0A 1I3AA 4MQ3A 4KKOA 1BHLA 1NKEA 4DQQA 3IRXA 3LP0A 4B9UA 2P5OA 1SUQA 3OYCA 1T8EA 4J2DA 3L2WA 4DQSA 3VQ9A 4DU4A 5I3UA 4O55A 3DYAA 3ZSOA 3NBPA 3TWHA 1FK9A 3AVMA 4KTZA 4O0JA 1JLEA 2VG7A 1RT7A 5DMRA 4FVMA 2DFEA 4Z4CA 3SQ4A 1KFSA 4M3WA 4M45A 1HPZA 3DLEA 3OS0A 3OYEA 4KHSA 4FLUA 2DY4A 2P5GA 3AVCA 4NCBA 4CEQA 1ASUA 1KVBA 2OPPA 4CEEA 4FJ9A 2ATQA 3LP3A 2G8WA 4F4KA 4Z4IA 1BGXT 4W5OA 3AA2A 2Y1IA 2Z1HA 3V1OA 1RDCA 3KKSA 1A5WA 4FZYA 2QKBA 4CEAA 2D5RA 4CCHA 2LSNA 4FK2A 4QOZB 4RW8A 5CYQA 2O4GA 4DFKA 3THVA 1J53A 3AVNA 2HMIA 1ASWA 3SQ0A 3V4IA 4CJQA 4BE0A 3D45A 1U48A 4CIFA 4CGJA 4DQRA 3RMDA 4QCLA 2OPRA 1FXXA 3CM5A 3KIOA 4ID5A 1KVAA 4RW7A 4EP5A 2VWJA 1RTIA 1RBSA 3NAEA 1RNHA 5E41A 3CQ8A 5CYMA 3V6DA 4YFUA 3V9XA 2YKMA 3NF9A 1I39A 1S1UA 4CFBA 1VSKA 3OYGA 3SQ1A 4KTQA 1IH7A 3AA5X 3NF8A 1WN7A 3C95A 5C25A 1NK9A 4Q0BA 3TAQA 3DMJA 3VQ7A 3SQ2A 4EZ9A 1NOZA 1QSLA 3K5OA 3ZSZA 4HUEA 4C8OA 4OKJA 3PO4A 2OPQA 1YTUA 1KFDA 2P51A 4CJTA 3V81A 1Q8IA 3LWLA 3NF6A 4CF0A 4CIEA 4YNQA 4FXDA 2GV9A 3QIPA 3BGRA 1TAUA 3QINA 4O44A 3S3OA 3TAPA 2P1JA 3UIQA 4I9QA 2F8SA 5SWMA 1HQEA 1QHTA 1JXBA 4Z4HA 2PYJA 1SV5A 2IAJA 3NH1A 1T7PA 3DLGA 4C8KA 4CJWA 2YNHA 2ETJA 1K6YA 1YVUA 1QQCA 4DTSA 3AVHA 4Q5VA 4FW2A 3OYBA 4N56A 4JRQA 4J2EA 3C6TA 3TI0A 4FLZA 1HMVA 1JLFA 3ZT2A 4N76A 3LZIA 1HYSA 1UAXA 3VQ5A 1JL1A 1VSJA 4FJLA 2PY5A 3DOLA 2FBXA 2HNDA 1VRUA 3PX4A 1IKYA 2EHGA 1ZBUA 4DSEA 3AVLA 1DTQA 3OYNA 3PO5A 4J2AA 2HHUA 3OYLA 4IBNA
chains in the Genus database with same CATH superfamily
1S1XA 3HM9A 4LF9K 2HHQA 3TAEA 2G8VA 3ENOA 1V4TA 5AQZA 4DLGA 2YKNA 4KB1A 3BUZB 2D0OA 1QSYA 1RT3A 1REVA 2E2NA 4GY2B 1T6DA 3C6UA 5K14A 3ZX2A 2NZTA 1TKTA 3HJFA 1NGAA 4KO0A 3SAGA 4DV7K 3GOIA 3E9PA 3ZETA 4IWVA 3VF4A 1N5YA 1RBUA 5FPDA 4JI2K 1NK8A 3WNGA 3S3NA 2G8IA 4PHTX 3CMEN 2OCEA 4CJ5A 3M6GA 3MECA 4OKKA 3I55N 4E0DA 4GW6A 2J4RA 5AZJA 3D2FA 5KPTA 4B9VA 4FL9A 4EAHD 4CD3A 1NGGA 1RTHA 4JKHA 3CC4N 5AQXA 4FVUA 4DV5K 1X1PA 5FDLA 1VRTA 5GADP 5GAGP 4KI6A 2EWSA 4EIAA 1BU6O 4OKEA 3K57A 3SNNA 4GV9A 4NCAA 1ZBHA 3PUFA 3LDLA 3U9ZA 3TTDA 3CF5L 3E9LA 3D0PA 3CQXA 4IFYA 3HO1A 3LPUA 3O4QA 4CI6A 3QESA 4FJMA 4AH9A 4CJLA 4KFBA 4FJGA 1GLFO 1Q18A 3NFAA 5HRNA 5KI6A 4FJNA 4H8KA 4CGIA 4H5NA 4WYBA 3ZSWA 1R59O 2IC3A 1YF5L 4WF9L 1WB9A 3WEEB 2E6MA 3L3UA 1DKGD 4IG3A 2HVHA 2GUIA 3HBTA 3TARA 1VQ5N 3HPHA 3JAMO 4G9ZA 1GOCA 4WCEL 4DS5A 4JKCA 5BPNA 2RHKA 4FJHA 3NF7A 1RBTA 3ZSQA 3ZSRA 3K5MA 2YNGA 4OPHA 1C0FA 1RDUA 1P90A 1S1WA 1NK5A 2V7ZA 3SLCA 5AQMA 3VF6A 4EZ6A 3CPEA 4F3TA 3ZEUB 3O9UA 2HBKA 1MDUB 3BZKA 2ITGA 4BRCA 1HKGA 1VQ6N 3MWPA 4KV8A 3VOVA 4FOIA 5C10A 2ITMA 2VQEK 4CJRA 4DV2K 4BRAA 4FWKA 4ILJA 3I8DA 3VA0A 3WNFA 4E3SA 3THWA 2Z1IA 4M3RA 4KHYA 1VSIA 2D0BA 3SI6A 4DTOA 1IBKK 1CZBA 4CESA 1NGEA 3THXB 2CH5A 4YOYA 1L3UA 1SAZA 4H0VB 4CHZA 2KFNA 3EE9A 3DJCA 1UWBA 1LCUA 1RTJA 5TKWA 4KB0A 1BCOA 3HSCA 3WXLA 3OY9A 4DSLA 4OVLA 1U2VA 3BF3A 5HBMA 2AJQA 4MLHA 3EKUA 4EFHA 1MWKA 2P9NB 1X9JA 2XHBA 3ENHA 4PA1A 3DLRA 3H45C 1S1VA 3T7ZA 4NB4A 3UKUB 3M3ZA 4JEPA 3H08A 3AVBA 4U7BA 4IDKA 4GVMA 4IFEA 1EXQA 3TPQA 3KJVA 4K43A 1LW2A 3WEEA 2QWNA 4CZLA 4ID1A 1VQ4N 1HJOA 3PLAA 5CY4A 4LY7A 2E1ZA 3L4IA 1L3VA 4H0PA 4O8UA 4FK0A 1KAXA 3SYZA 4O8KA 1ZYQA 3K9KA 2O4IA 4JI1K 2NRHA 4JS5A 4UQGA 3M8SA 4DTUA 4YDUC 4G1QA 4B3RK 2G8FA 1RBVA 2WTUA 3F9KA 1IG9A 3AARA 1KRPA 2ZE2A 1W0HA 4IOCL 2RKIA 2R7YA 4CIGA 1EX4A 1XUPO 3GG4A 3CM6A 4M3ZA 2QWRA 5FPNA 5AQKA 4IDHA 5T7BA 3MXMA 2B6AA 1NKCA 4H5TA 2E88A 1N8RO 4RW4A 4GMJB 1KLMA 3C7NB 4IKFA 4HCBA 3G10A 1OH5A 1LWEA 5IWAK 3P39A 3M8RA 3VEVA 4K8ZA 3KD1E 2HW3A 4FWLA 2A1RA 3ITHA 4K41A 5EX5A 4B9QA 3EZ5A 4NYNA 1KCFA 5HLFA 4CBUA 4ELVA 4H4OA 1U4BA 4JAXA 4CZGA 1K73O 4WE1A 5AQFA 5EVZA 1A5XA 2UXDK 4KH4A 4A57A 4F2SA 3O4NA 4MO4A 4IEEA 2P9UB 4DF4A 1QVFM 5J2MA 3L3VA 3L2UA 3MXIA 3QFUA 1SL1A 2P9NA 3V9SA 4BVPA 4DQIA 4E7KA 3C6AA 3V1QA 1NKBA 4MDBA 3HL8A 3UKUA 3UB5A 4E89A 3NHGA 4ISFA 2RE2A 4JYAK 3MXJA 5AQTA 4CFDA 3VEYA 1VSMA 1XWLA 4HWIA 1K9MO 1JL2A 2UU9K 5C42A 3EY1A 3OYIA 4CVNE 4I2QA 3EO3A 1SKSA 1D9DA 3LAMA 1IBLK 2OYQA 2GWKA 3H3OB 5AQIA 1S6QA 1JLQA 1U04A 1D4XA 1TVRA 3CJBA 2ZJRL 2QA4N 3MEEA 1TL1A 3DXKA 4F2RA 1C1BA 3QEIA 1G15A 3DM2A 4B9TA 5E84A 3P38A 4E19A 1ASVA 4FOEA 4BR5A 3ID8A 2KHOA 1QE1A 1XHXA 2P9KB 3CCRN 3O9RA 3DXMA 1NJXA 3MEGA 1BCMA 1MU2A 5LJVA 1TAQA 3VN5A 1C0UA 3A5LC 4AHCA 2FSKA 4BVOA 3OYKA 2HBJA 1RDBA 1X9MA 4IG0A 3C7NA 3ZT0A 4JRPA 5AQJA 4OLBA 1FKPA 2HHSA 3ZX0A 3OYJA 4FWPA 3TAFA 3OYAA 1VK0A 4MQ3A 5M1OA 3IRXA 3LP0A 5TKYA 5BPMA 1ILYA 3L2WA 3AAPA 3VQ9A 3LM2A 4DU4A 4O55A 1IG8A 5AQOA 1GLDG 3DYAA 3AVMA 4O0JA 2VG7A 4M3WA 4FVMA 4Z4CA 3T69A 3OYEA 4FLUA 4NCBA 5KQDA 1ASUA 1KVBA 4IEIA 2ATQA 3LP3A 4J8FA 1BGXT 4LFCK 4E1JA 2E20A 3KKSA 4QS9A 4PL7A 2W6LA 4FK2A 1QHAA 2A6AA 2FF3B 1N33K 1J53A 1ASWA 1U48A 3D45A 4CIFA 3RMDA 2OPRA 1FXXA 4RW7A 1KVAA 2E5LK 4BC2A 4YOUA 5E41A 3CQ8A 3WXMB 1I39A 1VSKA 3SQ1A 3ZLJA 3NF8A 1WBDA 3VENA 1NK9A 4GV3A 3SQ2A 4EZ9A 3A5NC 3ZSZA 4WQ5A 3SK3A 3PO4A 1KFDA 2P9KA 2VCPA 4CIEA 5JLHA 3S3OA 4I9QA 2P9LB 1OVYA 5SWMA 1HQEA 1ATNA 4H5RA 1SV5A 4RCHA 2H3GX 4CJWA 2ETJA 4CD1A 1ZC6A 3O5BA 4WQ5C 4Q5VA 1YITN 2FXUA 4N56A 3O80A 3ZT2A 1KAZA 1HYSA 3I8BA 1VRUA 2YHXA 1IKYA 4DSEA 4NXMK 3VPZA 4J2AA 4BQZA 3OTOK 2HBLA 1GOAA 4JKBA 4CJEA 2GUPA 5M1QA 4OLAA 1CLQA 1BQNA 1WAFA 5AFUH 3PIOL 2Q0RA 4M41A 1W7AA 2QKKA 5LMUK 2D4WA 4CEZA 3U8XA 1RCHA 3QFPA 5F1XA 1NLVA 1WSEA 1IO2A 4A59A 1NGDA 1KSPA 5DM7L 3NGIA 2HNZA 1S1TA 3OHRA 4TSXA 4ZTJA 1K8KB 5FRMA 3EE8A 2E4LA 4E1MA 2QK9A 4B8CA 4DTXA 4DR4K 4L3QA 1GLAG 3LDQA 4B1UB 1C0MA 4AHTA 4PUOA 4JI3K 4BC5A 3MN9A 3A2FA 4ZHRA 4B3SK 5AQWA 5AQSA 1RTDA 1UA1A 1ITGA 4JK8A 5GAEP 4H0XB 3M8PA 1C1CA 3ATUA 3TANA 1NGHA 3ULDA 1WOQA 3CERA 1IJJA 1YVNA 3P31A 1JLBA 2G8UA 2YNIA 3SJJA 2P9LA 3ZSXA 1CXUA 1NWKA 3WQUA 4WQ4A 4CHOA 4M3XA 3IS9A 4J2BA 4BRGA 4NCGA 1YT3A 1N36K 4HTLA 1J5EK 1BI4B 1HQUA 4DS4A 1NK0A 4CHNA 4O0IA 2O8DB 3AVGA 3C6HA 3ALYA 2GBZA 3RSEB 4CGFA 4FLYA 2VWKA 3L2VA 2ZD1A 4JKDA 2KTQA 1TL3A 2NLXA 3WXIA 4AHVA 5FRNA 4W5RA 3J81O 1HNWK 2E6LA 3AVJA 3CCQN 2RPIA 4H5VA 2Q2RA 1YTAA 2IVNA 3QEXA 2W40A 1NM1A 3L6QA 1TK0A 3OBYA 1ZBLA 4DSKA 5AZIB 3AO3A 2UUAK 5KRTA 1TK5A 3NVMA 1HNIA 3DLKA 3LALA 4CZKA 4FWSA 4CF8A 3CFPA 1NJYA 3OYDA 1Y97A 5GIOA 2F96A 2YCHA 2AP1A 4BDYA 2G8KA 4DFMA 4OPAA 2QW9A 2IIRA 3LAKA 3HXMA 1B92A 1VSFA 2B4JA 5I42A 3K59A 1VAZA 1VQNN 5M1PA 4OGEA 4DFPA 4JHDB 4B1XB 2VYPA 4CECA 3E01A 5F2RA 3WNHA 2IS3A 3AA3A 1BOTO 4CGDA 1D5AA 4A2AA 1QSSA 2DFFA 4E7IA 3RR8A 4H0TB 1XNRK 4BWJA 5F0XA 5AQPA 1F21A 2P9PA 1GOBA 3DRSA 4F8RA 3ID6A 3SPYA 3JSMA 1BA1A 3CQYA 1LWFA 3QICA 3VEWA 2NRVA 4RW6A 3SBGA 3UKRB 3K5LA 3N4PA 1YUWA 1LV5A 4NYFA 3I56N 1VSEA 4CF9A 2O8DA 4FPBA 3T1YK 4BRFA 3QO9A 3BF1A 2YHYA 4MFBA 2FBYA 3NGYA 2X6SA 3RSEA 2W41A 4CHPA 1QZ6A 4H5WA 4DR1K 3VA3A 3CIPA 2Q1NA 5CHIA 1WBBA 1WSHA 3VQDA 3CCEN 4BDZA 4A61A 1NK6A 4BR2A 4IOXA 4PKHA 3A0IX 1S72N 1U45A 2YJFA 5HL7L 4PKGA 3ZX3A 3CFOA 2WOMA 2QWQA 4FYDA 1H1VA 3KK7A 1HX1A 4DB3A 3C0BA 2O8FA 4CZJA 3RRGA 3SMPA 3G0ZA 3M1FA 3R3LA 4XH1A 1VSDA 1BIUA 1EWRA 4DQPA 1CZAN 4CJUA 2A40A 3Q7BA 2VQFK 3ISNC 4FZXC 3MN7A 4YOXA 1NGIA 1S5JA 1C0GA 2ZJQL 5GAHP 3IMXA 3VEZA 5LJWA 3QBXA 4U67L 1X3NA 2FC0A 4B3TK 1HJRA 4YOTA 3QEPA 1ATSA 4JHDA 4QS8A 1EO1A 3MDQA 4Y1CA 1EP4A 3KLIA 2YHWA 1D8YA 3SCXA 2OPSA 1BO5O 3SBTA 4CZMA 2XY5A 3NGZA 3FFKB 1XI1A 1JLGA 3P83D 4KPYA 4KHUA 4JI5K 2NUBA 1BG3A 3QLHA 2KZMA 2IDOA 1KLNA 2OANA 3HYFA 1O13A 4DCHA 3WQTA 2CH6A 3ATVA 1VQ8N 3VGMA 5A2QO 2IOCA 1HKBA 1KXPA 4DR2K 3ZSVA 3T1AA 2QXFA 4B1VA 2HHVA 3E66A 3I0SA 5J2QA 5JS1A 1X3MA 2P9SB 5C2DA 1SL0A 2QEXN 3G25A 4CEBA 4XIUA 4BE2A 1VQKN 3S3MA 1E3MA 4ICLA 3NH2A 4L8RB 1U47A 3LANA 2ZF5O 2JGUA 3DLLL 4KBOA 1E4FT 2A42A 2HSTA 4ILHA 3ENBA 1NJIO 4M42A 3HT3A 3ULEB 3VQBA 5HROA 1GLJO 5KGWA 1TUYA 1KQSM 1K8AO 2FBTA 4R5PA 4HCCA 2D0CA 3O8MA 3IDHA 4DTRA 1BQMA 4DV6K 4ISGA 4LSLA 3CI5A 5AQVA 5BR8K 4B9LA 3VQ8A 3KZBA 4CK3A 3K5NA 2GWJA 1DTTA 3H1VX 4PQUA 4LFBK 1BA0A 4B1ZA 3P4IA 4JK9A 2UXBK 3DWLA 2E2PA 5AR0A 2Q97A 4JI7K 4H4MA 1I3AA 1NKEA 1BHLA 3VF2A 2P5OA 4J2DA 1T8EA 3ZEUA 4BRKA 4DHYA 4EHTA 5I3UA 2E2OA 1RT7A 1QQNA 3EZWA 2DFEA 5DMRA 3SQ4A 1KFSA 1HPZA 4KHSA 1YXQA 1Y64A 4CEEA 2NRZA 4Z4IA 4BQLA 3HI0A 1RDCA 1I94K 4I6MB 1QVGM 1BUPA 4FZYA 2QKBA 4CCHA 4RW8A 3MK6A 5CYQA 2O4GA 3O08A 4AM6A 3AVNA 2HMIA 3V4IA 4BE0A 4JKGB 4QCLA 3CM5A 3KIOA 4EP5A 3THXA 3NAEA 5CYMA 3OYGA 1S1UA 5M1NA 2W6KA 4KTQA 1IH7A 3TTCA 3C95A 4PL8A 5C25A 4H0YB 4CBWA 3DMJA 2NRTA 3K5OA 4WFAL 3ULEA 1QZ5A 4C8OA 2P51A 1Q8IA 2GV9A 3EL2A 1TAUA 3QINA 4O44A 2Q36A 3UIQA 1GLEG 4GVEA 1JJ2M 4YHHK 2PYJA 2F9WA 4C8KA 1J6ZA 2YNHA 1K6YA 1YVUA 2YX6A 3AVHA 4FW2A 4JRQA 3TI0A 4FLZA 1HMVA 4CZFA 1JLFA 1BDGA 4BR4A 3R6MA 2FBXA 4UY8O 2FLOA 5AFUA 2YI1A 1DGKN 1YHQN 4QS7A 2O8BB 4YORA 3OYNA 2HHUA 2E8AA 3WUHA 3MN6A 2O8EB 3PV8A 3CCUN 3Q7CA 2ZM6K 3U3YA 2PZSA 3JS6A 3LZJA 4MLEA 4FJXA 3E1YA 1WLJA 1W97L 4CJKA 3OS2A 1NGJA 3VTHA 3GDQA 4BACA 4JN4A 4RW9A 1XMOK 4CFCA 1VSLA 2UUCK 4BE1A 4DSIA 3O9QA 1Q9YA 3BDPA 3RTVA 4I6MA 3CETA 1ZBFA 1NU0A 3AVAA 5ADXH 4JKFA 3G71N 4KREA 3WNEA 2I7NA 4DUZK 4CHQA 1NGBA 3SUQA 1WNSA 3B8AX 4OPJA 4CHYA 1NOYA 2YHBA 1Z6RA 4FLVA 5J1EA 4DTNA 1NJWA 2XRIA 3B6PA 2AA4A 5KTQA 5BRFA 1VQ9N 4LFAK 1C6VA 3G6EN 1D9FA 2Z1JA 3BZCA 3V9WA 1CZ9A 1T3VA 3OBWA 4WFBL 4AQYK 2P9UA 2QM1A 4AF1A 3AVKA 4W5NA 4DF8A 1HRHA 3KKRA 4IJNA 3CCSN 4KH5A 3RMCA 3CC7N 2X74A 2PFUA 1WSFA 3DAWA 1UA0A 3VQ4A 1RGIA 1NK4A 4B3MK 1TKZA 3JYTA 3O3FA 4KAZA 3ASMA 1IKXA 3SV3A 4PWDA 1FW6A 4DQ8A 1JLAA 2NRRA 3AY9A 1RDWX 4C1NK 3G4SN 4R79A 4JI4K 2QI2A 3T19A 2D0AA 5CZ1A 1EETA 2O8BA 1N6QA 3JXUA 3KD5E 3H6EA 1FJGK 2O8EA 2ASPA 4ISEA 2HHXA 2CGLA 2ZQBA 4BDPA 3A5OC 1A5VA 3I33A 3IFRA 1HYZA 5ELZA 3IUCA 4ELTA 5GINA 1HYVA 3CMAN 3ZYYX 3RWUA 2BH1A 2IGIA 3FZFA 3LDSA 3AO2A 3QNNA 4QAGA 1IKVA 2D1KA 1DT9A 3LL3A 4B9MA 3KLHA 2HB5A 5C0YA 2HHTA 1LW0A 1C1AA 3MEDA 2VG5A 1J9AA 4CF2A 1WSJA 4DUYK 1QQOA 5HP1A 2O8CB 1S9GA 3K9JA 3OJSA 3PY8A 1HLUA 2DTUA 1SKWA 2KKZA 5I9EB 1BL3A 4JS4A 1Q81O 4C23A 4DLEA 1O1WA 3TAGA 4DG1A 2VGMA 1OVQA 4DMNA 2QWLA 1OKJA 4CJFA 3O9TA 3O3HA 3SZ2A 4HUGA 4BG9A 3H3NO 3MN5A 4BRQA 4W5QA 4GKJK 3PX6A 3F9MA 2HF3A 3U3GA 4B1WB 1JLCA 3KWGA 4ZTFA 3CHWA 1RDDA 5AQNA 1WSIA 3FFIA 2I7PA 4DV3K 1U6ZA 1J5OA 3HP6A 1XC9A 3SUOA 2BDPA 1HUXA 2YHAA 4LF5K 5HRRA 4JI0K 4FZZA 3TU5A 2X78A 4IO8A 3WXJA 4JV5K 5FPEA 4W5TA 1E4GT 3RRHA 4KHWA 4A62A 1S6PA 1HKCA 3HP9A 1SZ2A 3V9ZA 5C12A 1XHZA 3KLFA 4NLCA 1YJNN 3ZT1A 4RWTA 3O3GA 1T05A 3KLEA 3VERA 3C65A 4CGHA 4NLBA 4DR6K 4C8LA 5BR9A 4K42A 3KHYA 5J2NA 3VQQA 4WQ4C 2QXLA 3J80O 3OYMA 3L2QA 1RILA 3QETA 3H46O 3NH0A 2Z1GA 4A5AA 2IVPA 2O8CA 2D0PA 3CC2N 4FLTA 4EHUA 4CBXA 3BY5A 5BRHA 5JMVA 4B8AB 1LWCA 5IT9O 3OS1A 2WUSA 4FK4A 4X62K 3SMSA 4C1NI 3DOKA 1HNXK 3RVCA 3U4LA 4M3YA 2BUPA 3D2FB 2FF6A 2EX3A 3FE1A 3L4QA 1EWQA 1K8KA 1TYQB 4E1NA 4HVJA 2Q0UA 5KPRA 1XNQK 2KQ2A 1KD1O 4AHRA 4I7FA 3OW2M 1JXEA 2Y1JA 2PYLA 4B1YB 4DTMA 5D3GA 2RN2A 3AO1A 4N47A 1XQSC 1JKHA 4BR7A 3FZHA 4DR7K 3MMVA 4HUFA 1SKRA 3NVKA 3O4WA 3IKMA 3MWTA 4AILC 4FWOA 1S9EA 1SS6A 3QERA 2JWKA 4CJPA 4KHNA 3HM8A 3NDKA 4KTWA 3VQPA 4FJ5A 4OJRA 4LF6K 2CGJA 4LSNA 5LY3A 2ZJPL 4E7JA 4ILGB 3DLBA 3V1RA 4Z4EA 2X6NA 4CK2A 1J54A 3CJCA 4FLWA 3AVFA 3CJ1A 3SUNA 3PIPL 1BI4A 1TK8A 3QIOA 1U49A 4MO5A 5CZ2A 1NGFA 1MA9B 4CEOA 1TKXA 4CERA 4BC3A 3S9HA 3B6OA 3MX2A 3UE5A 4OPKA 5KQ8A 3KK1A 2XY7A 3VGKA 4JLHA 3HTVA 2RF2A 3FLCO 4IFVA 5FROA 1RT1A 3W3DA 3AO4A 3QEVA 3I0RA 4BWMA 5J2PA 3EEQA 3VTIA 2QWMA 1M1KO 3KK2A 3KTQA 1ZBIA 4WFNL 1FKOA 3HVTA 1OH7A 3THWB 4B08A 5AZIA 4DQQA 3E9OA 1SUQA 4M7YA 3OYCA 4GV6A 1VQPN 3ZSOA 3TWHA 3NBPA 1FK9A 5MLCQ 4KTZA 5LL6Z 1VQ7N 1JLEA 1TYQA 5JVHL 1Z05A 3AVCA 1V4SA 4F4KA 3AA2A 3FZMA 2F9TA 1U2VB 2Y1IA 5E26A 3V1OA 4YOVA 2A3ZA 1A5WA 4BREA 4CEAA 2D5RA 1NG9A 2LSNA 2IVOA 1N32K 2UYTA 4CJQA 4CGJA 5FLXO 3A5MC 5AQQA 3AGRA 5H1SQ 1RBSA 1RNHA 1Q86O 4YFUA 5DM6L 3V9XA 3NF9A 4CFBA 4JNEA 4IO9L 3AA5X 4XH5A 3BEXA 4FO0A 3GL1A 3MCAB 4Q0BA 3TAQA 1LOTB 2FSJA 4GNIA 1RFQA 3VEOA 4HUEA 4OKJA 2Q31A 2OPQA 1YTUA 3UKRA 3CD6N 3NF6A 4FXDA 3QIPA 1QHTA 1JXBA 4K25A 2GEMA 2NRXA 4IOAL 2IAJA 1T7PA 3DLGA 3WXKA 2GTDA 3CCMN 1QQCA 4LF7K 3OYBA 4N76A 1UAXA 3A8YA 3VQ5A 4CZIA 1VSJA 4FJLA 2HNDA 1N34K 2EHGA 1ZBUA 4JKEA 4JI6K 1SQKA 1VQLN 5JLFA 4GKKK 3CPWM 4KH6A 3OYLA 4BG8A 3CG7A 5EY4A 3H1QA 5AQRA 3PSIA 1RT4A 4DV1K 3K2PA 2BANA 3O1BA 2ZGYA 3IG1A 4CEDA 1LAVA 5ADXA 4B9SA 3MX5A 5HRSA 4O5FA 4DU3A 3MCPA 1NBWA 3ZT3A 1ESVA 4A2BA 4M3UA 3ZT4A 5AQUA 5BN8A 4FM0A 4DV0K 1Q7YO 1RBRA 4HHTA 1HR0K 1YAGA 4IZ9A 1IV0A 1KVCA 4RTFD 2P9IB 3LWMA 3CCJN 4CFAA 4FJKA 3CJ7A 3K58A 2YV0X 4DTJA 2XY6A 3QNOA 3CYMA 4BROA 4YY3K 4KHPK 3RR7A 3L2RA 3AVIA 3EYZA 4FLXA 2UUBK 1B9DA 3HOTA 4I2PA 1Z26A 4FW1A 4YDUA 1W2BM 4BRPA 4FJJA 4X66K 2KW4A 3FGUA 3HVRA 3LM9A 5CR4A 1Z25A 4F9OA 1NGCA 2NNWA 2WFBA 4N41A 4B9NA 1YJWN 1JCGA 5AQGA 3VQ6A 4PKIA 4DKWA 3DXKB 3RMBA 5CE3A 2OA8A 2YJEA 1OH6A 3F5TA 4BC4A 1WSGA 3AGKA 3SAHA 2JLEA 3DRPA 3OVNA 4DV4K 4AM7A 1YJ9N 5BREA 1NJZA 2YNFA 4K8XA 4FM2A 2G8HA 4KHQA 1GLCG 4RG8A 2P9SA 3WT0A 1L5UA 3DXMB 3HPOA 4I9LA 3O1WA 1NMNA 1VSHA 3U9DA 3OJUA 1Q82O 3DI6A 3NCIA 3PX0A 4JI8K 1GLBG 4Z0UA 3SJHA 1QQMA 4DTPA 2ASOA 1BISA 4PY5A 2V52B 4Y0WA 1GLLO 3CJAA 2HHHK 4FJ7A 5EOYA 3QB0A 2QWPA 2W42A 5KGXA 3J8AA 3ZCMA 4HTUA 1Q9XA 2VGNA 5C2FA 1HNZK 5JICA 3SUPA 1JCEA 4AHUA 4CGGA 1LAWA 2OZMA 3OYHA 5JS2A 4E7LA 1L3TA 2KFZA 1KC8O 4CK1A 2P9IA 1IKWA 3KVGA 5LMNK 1RT2A 2QWOA 2BGGA 1DLOA 4DSFA 1BIZA 4BR9A 4CJ4A 3N4QA 3K0SA 5AQYA 4Z94A 3LDNA 5KRSA 4K0KK 3DRRA 3P1GA 3RMAA 2OTLN 4BRIA 5DK5A 2I5JA 3IAYA 4CJ3A 1EKEA 5C24A 3D2EB 4FPAA 3KK3A 5GIPA 5AJ3K 2HNYA 1QS4A 2FBVA 3M5RA 3O9SA 4CJSA 2DFHA 3QEWA 3VGLA 4AHSA 3J7ZO 2HMPA 3U6FA 1RT5A 4FWNA 3L8BA 4OO1J 4NXNK 3C94A 3HSTB 3T3FA 3GBTA 4B3OA 2WC9A 3V9UA 3CJ9A 4M63C 1X9WA 2JWLA 4JKGA 2V7YA 4BR0A 4NO7A 3HZ6A 1OH8A 4DR5K 4JD2B 1ZBSA 4IXCA 5M1FA 3D6RA 2OTJN 4LH4A 4BRHA 1S22A 3TR8A 3VEXA 1YI2N 1RT6A 3VQAA 4JKAA 3VQCA 2B5JA 3TABA 3CFRA 3LDOA 4O4GA 3TAMA 4F3OA 1QTMA 3AV9A 1BWFO 3ZSYA 3SPZA 3J7YP 4KI4A 1ZXOA 1SL2A 4Z4GA 1NK7A 2E2QA 1NMDA 4EP4A 3T1HK 4MDAA 4IJAA 1VQON 3R8EA 4DFJA 3M8QA 3DLHA 3BP8A 1B9FA 4X65K 1M90O 1YIJN 1TKDA 3LPTA 4CE9A 3SAFA 3SV4A 2WBNA 3J7AP 3OA9A 3KLGA 4DSJA 3VMFB 1R0AA 1NNEA 2DPNA 3D7EO 2ASMA 2KZZA 4BGBA 1UOCA 3D2EA 1KTQA 4Y1DA 5SZTA 3LP2A 3VQEA 4DU1A 3AO5A 3FZLA 3KWIA 4FM1A 2KLAA 2HVIA 1WAJA 4M3TA 1TV6A 3QDKA 1HNVA 2PBDA 3OYFA 3MAQA 4H0OA 5FPMA 2OZSA 4ELUA 4C8NA 4FJIA 5HRPA 2UXCK 2Q3SA 4FWRA 4BRNA 5BRDA 3FZKA 4Z4FA 3LDPA 2XO7A 4OGCA 2GX9A 2VG6A 4LH5A 3THYB 3VETA 4JD2A 1G99A 5M1KA 3CCLN 3W0LA 1XC3A 3VESA 3AAQA 4V19S 1W9HA 4FWQA 1TGOA 4FWMA 3HPGA 4CJVA 1EQYA 4O5BA 4BRLA 4H03B 3F73A 4CEFA 3S41A 2A5XA 4LD0A 3R9PA 2BE2A 1KAYA 2A41A 4BY9C 2QTDA 3QMLA 3HK2A 4A5BA 3TSPA 2FSNA 3AA4A 2F7TA 1C0TA 4N5SA 5EU7A 4OX9K 1RDAA 5JVGL 4C8MA 4KRFA 4CF1A 1ATRA 2A1SA 4CZEA 2WONA 2F8TA 2ZGZA 2BTFA 4XEIA 4FJ8A 1CXQA 1X9SA 2HHWA 3NMUA 2V51B 4FCYA 2HBMA 5BN9A 2XY8A 4DWIA 4YOWA 3LP1A 3CXCM 1HPMA 3TTFA 2PAVA 3NE6A 1T03A 2ZWHA 4LF4K 1L3SA 3P5JA 4E7HA 4KKOA 4B9UA 4FSVA 4DQSA 1IBMK 4JK7A 1T6CA 2GELA 3EN9A 4BGAA 3QBWA 4M45A 3DLEA 4X64K 3OS0A 2DY4A 2P5GA 2P9PB 2CGKA 4CEQA 4M7XA 2OPPA 4FJ9A 2G8WA 4W5OA 1P8ZA 2Z1HA 5HOOA 1T44A 3ZETB 3HOSA 5AQHA 3PSFA 4LC9B 4BRDA 3HRGA 3THYA 2E1YA 4QOZB 4DFKA 3THVA 5C15A 4BRMA 5AQLA 3GE1A 3SQ0A 5B8HA 2VWBA 4DQRA 3CCVN 4ID5A 5BPLA 2VWJA 1MWMA 1RTIA 3V6DA 2YKMA 3L0QA 5AZJB 1WUAA 1WN7A 4XH4A 1DEJA 3VQ7A 1NOZA 1QSLA 4CW7B 2HF4A 4CJTA 3V81A 3LWLA 4CF0A 4YNQA 1TUUA 3BGRA 3TAPA 2P1JA 1VHXA 2F8SA 2HOEA 3EKSA 4Z4HA 3NH1A 2O8FB 3FR0A 1VQMN 4DTSA 3R1XA 1XMQK 4J2EA 2NRWA 3C6TA 3TSQA 5EXWA 3LZIA 2F4VK 3F2KA 1JL1A 4CZHA 3O6WA 2PY5A 3DOLA 4LF8K 1S3XA 3PX4A 3TSUA 3AVLA 1JCFA 5KPZA 4DR3K 1DTQA 3PO5A 4CJ7A 4IBNA
chains in the Genus database with same CATH topology
1GOAA 1S1XA 3CG7A 4CJEA 3HM9A 4OLAA 3PV8A 2HHQA 1CLQA 3U3YA 1BQNA 3TAEA 2PZSA 3LZJA 2G8VA 1WAFA 4DLGA 2YKNA 4KB1A 1QSYA 4FJXA 1RT4A 1RT3A 1REVA 1WLJA 4M41A 4CJKA 3OS2A 2QKKA 3K2PA 2BANA 3C6UA 4CEZA 5K14A 4B9SA 3IG1A 1RCHA 4CEDA 1LAVA 5HRSA 1WSEA 1IO2A 1TKTA 4DU3A 3ZT3A 3HJFA 1KSPA 4BACA 4KO0A 3ZT4A 3NGIA 4M3UA 4FM0A 4RW9A 2HNZA 1VSLA 1RBRA 1S1TA 4CFCA 4HHTA 4BE1A 1Q9YA 3BDPA 4TSXA 4DSIA 4ZTJA 5FRMA 3RTVA 2E4LA 4E1MA 2QK9A 1ZBFA 4B8CA 1KVCA 3AVAA 3LWMA 1N5YA 1RBUA 4DTXA 4FJKA 4CFAA 4KREA 3WNEA 4CHQA 3K58A 3WNGA 2YV0X 1C0MA 1WNSA 4AHTA 4OPJA 4DTJA 3SUQA 4CHYA 3S3NA 4PUOA 2XY6A 3QNOA 1NOYA 2YHBA 3CYMA 2G8IA 4FLVA 3A2FA 3RR7A 4ZHRA 3AVIA 5J1EA 3L2RA 3EYZA 4FLXA 2XRIA 4CJ5A 4DTNA 3MECA 4OKKA 1NJWA 1B9DA 4E0DA 3B6PA 4GW6A 5KTQA 1RTDA 1UA1A 1ITGA 1C6VA 4B9VA 4I2PA 1Z26A 4FW1A 1D9FA 4FJJA 1RTHA 2Z1JA 2KW4A 3M8PA 3V9WA 1CZ9A 1C1CA 3HVRA 3TANA 1Z25A 3ULDA 1X1PA 5FDLA 1VRTA 4N41A 3AVKA 4B9NA 4W5NA 4DF8A 1JLBA 2G8UA 3VQ6A 4KI6A 2YNIA 1HRHA 3RMBA 3SJJA 3KKRA 3SNNA 4OKEA 3ZSXA 1CXUA 3K57A 3RMCA 2OA8A 4NCAA 2X74A 3PUFA 1ZBHA 4CHOA 4M3XA 3D0PA 3IS9A 1WSFA 1WSGA 4IFYA 1NJZA 2JLEA 3DRPA 3OVNA 4NCGA 3VQ4A 1YT3A 3LPUA 1UA0A 4J2BA 3HO1A 2YNFA 3O4QA 4FM2A 1NK4A 3QESA 2G8HA 4K8XA 4KHQA 1TKZA 4AH9A 4RG8A 4FJMA 1BI4B 1HQUA 3JYTA 4CJLA 4KFBA 3O3FA 4DS4A 1NK0A 1L5UA 4KAZA 4FJGA 4CHNA 3HPOA 3ASMA 1IKXA 3NFAA 5HRNA 4O0IA 3SV3A 4PWDA 5KI6A 4I9LA 4FJNA 3AVGA 4H8KA 1JLAA 4CGIA 3ALYA 2GBZA 4CGFA 3ZSWA 4FLYA 1VSHA 3OJUA 2IC3A 3DI6A 3T19A 3NCIA 3PX0A 2D0AA 2VWKA 3L2VA 2ZD1A 5CZ1A 1EETA 2E6MA 2KTQA 4Z0UA 3L3UA 1TL3A 4IG3A 2HVHA 1N6QA 2GUIA 4AHVA 5FRNA 4W5RA 3TARA 3HPHA 3KD5E 2E6LA 3AVJA 4DTPA 1GOCA 2RPIA 1BISA 4DS5A 2HHXA 2ZQBA 1YTAA 4BDPA 4FJHA 3NF7A 4PY5A 1RBTA 1A5VA 3ZSQA 3ZSRA 4FJ7A 3K5MA 2YNGA 3QEXA 1HYZA 4ELTA 1TK0A 2W42A 1S1WA 5KGXA 1ZBLA 3ZCMA 1NK5A 1HYVA 4HTUA 4DSKA 3RWUA 2IGIA 1Q9XA 3LDSA 3AO3A 3AO2A 3QNNA 5KRTA 1TK5A 4QAGA 4EZ6A 1IKVA 4F3TA 1HNIA 3DLKA 3LALA 3SUPA 4AHUA 4B9MA 4CGGA 3KLHA 1LAWA 2HB5A 2OZMA 3OYHA 5JS2A 4E7LA 4CF8A 2ITGA 1L3TA 2HHTA 2KFZA 3CFPA 1NJYA 4CK1A 3OYDA 1Y97A 4KV8A 1IKWA 2F96A 1LW0A 1RT2A 1C1AA 4BDYA 4DFMA 2G8KA 2BGGA 1DLOA 4CJRA 3LAKA 3MEDA 2VG5A 1B92A 1BIZA 1VSFA 2B4JA 1J9AA 4CJ4A 1WSJA 4CF2A 5I42A 5HP1A 3K59A 1S9GA 5KRSA 3OJSA 3I8DA 3PY8A 3VA0A 3WNFA 2DTUA 4E3SA 2Z1IA 1SKWA 3DRRA 3P1GA 3RMAA 4OGEA 4M3RA 4DFPA 4KHYA 1VSIA 5DK5A 2D0BA 2I5JA 3IAYA 4CECA 1BL3A 3E01A 4CJ3A 4JS4A 3SI6A 3WNHA 2IS3A 4DLEA 1EKEA 3AA3A 1O1WA 5C24A 4DTOA 3TAGA 1CZBA 4CGDA 4DG1A 3KK3A 1D5AA 1QSSA 4CESA 4DMNA 2DFFA 4E7IA 1L3UA 4CJFA 3RR8A 4CHZA 4BWJA 2HNYA 1QS4A 3O3HA 2KFNA 2FBVA 1F21A 3SZ2A 1GOBA 4HUGA 1UWBA 3DRSA 4F8RA 1RTJA 2DFHA 4CJSA 3QEWA 4KB0A 4AHSA 1BCOA 3OY9A 3SPYA 3JSMA 4DSLA 4OVLA 5HBMA 4W5QA 3U6FA 1RT5A 2AJQA 3L8BA 3PX6A 1LWFA 4RW6A 3U3GA 3K5LA 1NK8A 1LV5A 1JLCA 4NYFA 2XHBA 4PA1A 3DLRA 4ZTFA 3C94A 1RDDA 3HSTB 3T3FA 4B3OA 1VSEA 1S1VA 4CF9A 1WSIA 3FFIA 3V9UA 1X9WA 3QO9A 4MFBA 3H08A 1J5OA 3AVBA 2FBYA 3NGYA 2X6SA 3HP6A 4IDKA 4GVMA 1XC9A 1EXQA 4CHPA 3KJVA 3SUOA 2BDPA 1LW2A 3VA3A 1WSHA 2YHAA 3VQDA 5HRRA 4ID1A 4BDZA 4FZZA 1NK6A 2X78A 5CY4A 4LH4A 4LY7A 1U45A 4W5TA 1L3VA 3RRHA 4KHWA 3TR8A 3CFOA 2WOMA 4FK0A 3SYZA 1ZYQA 1S6PA 4FYDA 1RT6A 4DSFA 2O4IA 3HP9A 3VQAA 4JS5A 4UQGA 3VQCA 2B5JA 3V9ZA 3CFRA 3TABA 3M8SA 4DTUA 1XHZA 4G1QA 3KLFA 2G8FA 4O4GA 1RBVA 3TAMA 4F3OA 1QTMA 3RRGA 3ZT1A 3F9KA 1IG9A 3AV9A 3O3GA 3G0ZA 1T05A 3KLEA 1KRPA 2ZE2A 1W0HA 3ZSYA 4CGHA 3SPZA 2RKIA 1VSDA 2R7YA 1BIUA 4CIGA 1EX4A 4C8LA 4DQPA 4CJUA 4KI4A 1SL2A 3CM6A 4Z4GA 4M3ZA 3ISNC 1NK7A 4FZXC 4EP4A 5J2NA 3VQQA 1S5JA 3OYMA 5T7BA 3MXMA 2B6AA 3L2QA 1RILA 3M8QA 4DFJA 3NH0A 3QETA 1NKCA 2Z1GA 3HXMA 3DLHA 1B9FA 4GMJB 2FC0A 4RW4A 1KLMA 1HJRA 4FLTA 3QEPA 1TKDA 4IKFA 3LPTA 4HCBA 4CE9A 3SV4A 3G10A 1LWEA 3M8RA 3KLGA 4DSJA 4B8AB 1LWCA 1R0AA 3KD1E 4K8ZA 2HW3A 2A1RA 2KZZA 3ITHA 3OS1A 1UOCA 4FK4A 4Y1CA 1EP4A 3KLIA 1D8YA 3SCXA 2OPSA 1KTQA 4Y1DA 3EZ5A 5SZTA 4NYNA 1KCFA 5HLFA 2XY5A 4ELVA 3LP2A 4H4OA 3VQEA 3DOKA 3AO5A 3NGZA 4DU1A 1XI1A 1JLGA 3P83D 4FM1A 1U4BA 4KPYA 4KHUA 4M3YA 2NUBA 3QLHA 2KZMA 4WE1A 2IDOA 1A5XA 1KLNA 2HVIA 3HYFA 4F2SA 1WAJA 2EX3A 3O4NA 1TV6A 4M3TA 1HNVA 3OYFA 3MAQA 4DF4A 4E1NA 5J2MA 3L3VA 3L2UA 2OZSA 3MXIA 1SL1A 4HVJA 3V9SA 2IOCA 4ELUA 2KQ2A 4C8NA 4E7KA 4AHRA 4DQIA 3ZSVA 4I7FA 5HRPA 3V1QA 1NKBA 4FJIA 1JXEA 2Q3SA 2Y1JA 3T1AA 2PYLA 2QXFA 4DTMA 5D3GA 2RN2A 3HL8A 2HHVA 3I0SA 4E89A 3AO1A 4N47A 4Z4FA 1JKHA 3NHGA 2XO7A 4OGCA 2VG6A 5J2QA 4LH5A 5JS1A 3MXJA 4CFDA 1VSMA 1XWLA 4HUFA 1JL2A 1SKRA 5C42A 3EY1A 1SL0A 1W9HA 3OYIA 4AILC 1TGOA 4I2QA 1SKSA 1S9EA 3HPGA 3LAMA 1D9DA 2OYQA 4CJVA 4O5BA 3QERA 4CEBA 4CJPA 4XIUA 4BE2A 1S6QA 4KHNA 3F73A 4CEFA 4KTWA 3NDKA 3S3MA 1JLQA 1U04A 3VQPA 4OJRA 4LD0A 1TVRA 4ICLA 4FJ5A 4LSNA 3NH2A 2BE2A 3MEEA 4L8RB 1U47A 3LANA 1TL1A 3HK2A 4E7JA 4F2RA 1C1BA 2JGUA 3AA4A 3QEIA 1G15A 1C0TA 3DM2A 3V1RA 4N5SA 3DLBA 5EU7A 4B9TA 1RDAA 4Z4EA 2X6NA 4C8MA 4CK2A 4E19A 4M42A 4KRFA 1ASVA 1J54A 3HT3A 4FLWA 3AVFA 3VQBA 5HROA 5KGWA 1QE1A 1XHXA 3SUNA 4CF1A 1BI4A 2FBTA 1NJXA 3MEGA 4R5PA 1TK8A 1BCMA 4HCCA 1MU2A 2D0CA 3QIOA 1U49A 5CZ2A 2A1SA 1TAQA 4CEOA 1TKXA 2WONA 3VN5A 1C0UA 4CERA 2F8TA 4DTRA 1BQMA 3S9HA 3B6OA 4AHCA 4LSLA 4OPKA 3OYKA 4FJ8A 1CXQA 1RDBA 1X9SA 1X9MA 2HHWA 3KK1A 4IG0A 2XY7A 3VQ8A 4B9LA 4JLHA 3ZT0A 4JRPA 2RF2A 4IFVA 4FCYA 5FROA 1RT1A 4OLBA 1FKPA 3AO4A 4CK3A 3I0RA 3K5NA 2XY8A 3QEVA 2HHSA 1DTTA 4BWMA 4DWIA 3OYJA 4PQUA 5J2PA 3LP1A 3KK2A 3KTQA 3TAFA 1ZBIA 3NE6A 1FKOA 3HVTA 3OYAA 1T03A 1L3SA 4H4MA 3P5JA 4E7HA 4B08A 1VK0A 1I3AA 4MQ3A 4KKOA 1BHLA 1NKEA 4DQQA 3IRXA 3LP0A 4B9UA 2P5OA 1SUQA 3OYCA 1T8EA 4J2DA 3L2WA 4DQSA 3VQ9A 4DU4A 5I3UA 4O55A 3DYAA 3ZSOA 3NBPA 3TWHA 1FK9A 3AVMA 4KTZA 4O0JA 1JLEA 2VG7A 1RT7A 5DMRA 4FVMA 2DFEA 4Z4CA 3SQ4A 1KFSA 4M3WA 4M45A 1HPZA 3DLEA 3OS0A 3OYEA 4KHSA 4FLUA 2DY4A 2P5GA 3AVCA 4NCBA 4CEQA 1ASUA 1KVBA 2OPPA 4CEEA 4FJ9A 2ATQA 3LP3A 2G8WA 4F4KA 4Z4IA 1BGXT 4W5OA 3AA2A 2Y1IA 2Z1HA 3V1OA 1RDCA 3KKSA 1A5WA 4FZYA 2QKBA 4CEAA 2D5RA 4CCHA 2LSNA 4FK2A 4QOZB 4RW8A 5CYQA 2O4GA 4DFKA 3THVA 1J53A 3AVNA 2HMIA 1ASWA 3SQ0A 3V4IA 4CJQA 4BE0A 3D45A 1U48A 4CIFA 4CGJA 4DQRA 3RMDA 4QCLA 2OPRA 1FXXA 3CM5A 3KIOA 4ID5A 1KVAA 4RW7A 4EP5A 2VWJA 1RTIA 1RBSA 3NAEA 1RNHA 5E41A 3CQ8A 5CYMA 3V6DA 4YFUA 3V9XA 2YKMA 3NF9A 1I39A 1S1UA 4CFBA 1VSKA 3OYGA 3SQ1A 4KTQA 1IH7A 3AA5X 3NF8A 1WN7A 3C95A 5C25A 1NK9A 4Q0BA 3TAQA 3DMJA 3VQ7A 3SQ2A 4EZ9A 1NOZA 1QSLA 3K5OA 3ZSZA 4HUEA 4C8OA 4OKJA 3PO4A 2OPQA 1YTUA 1KFDA 2P51A 4CJTA 3V81A 1Q8IA 3LWLA 3NF6A 4CF0A 4CIEA 4YNQA 4FXDA 2GV9A 3QIPA 3BGRA 1TAUA 3QINA 4O44A 3S3OA 3TAPA 2P1JA 3UIQA 4I9QA 2F8SA 5SWMA 1HQEA 1QHTA 1JXBA 4Z4HA 2PYJA 1SV5A 2IAJA 3NH1A 1T7PA 3DLGA 4C8KA 4CJWA 2YNHA 2ETJA 1K6YA 1YVUA 1QQCA 4DTSA 3AVHA 4Q5VA 4FW2A 3OYBA 4N56A 4JRQA 4J2EA 3C6TA 3TI0A 4FLZA 1HMVA 1JLFA 3ZT2A 4N76A 3LZIA 1HYSA 1UAXA 3VQ5A 1JL1A 1VSJA 4FJLA 2PY5A 3DOLA 2FBXA 2HNDA 1VRUA 3PX4A 1IKYA 2EHGA 1ZBUA 4DSEA 3AVLA 1DTQA 3OYNA 3PO5A 4J2AA 2HHUA 3OYLA 4IBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOA A;  1S1X A;  3CG7 A;  4CJE A;  3HM9 A;  4OLA A;  3PV8 A;  2HHQ A;  1CLQ A;  3U3Y A;  1BQN A;  3TAE A;  2PZS A;  3LZJ A;  2G8V A;  1WAF A;  4DLG A;  2YKN A;  4KB1 A;  1QSY A;  4FJX A;  1RT4 A;  1RT3 A;  1REV A;  1WLJ A;  4M41 A;  4CJK A;  3OS2 A;  2QKK A;  3K2P A;  2BAN A;  3C6U A;  4CEZ A;  5K14 A;  4B9S A;  3IG1 A;  1RCH A;  4CED A;  1LAV A;  5HRS A;  1WSE A;  1IO2 A;  1TKT A;  4DU3 A;  3ZT3 A;  3HJF A;  1KSP A;  4BAC A;  4KO0 A;  3ZT4 A;  3NGI A;  4M3U A;  4FM0 A;  4RW9 A;  2HNZ A;  1VSL A;  1RBR A;  1S1T A;  4CFC A;  4HHT A;  4BE1 A;  1Q9Y A;  3BDP A;  4TSX A;  4DSI A;  4ZTJ A;  5FRM A;  3RTV A;  2E4L A;  4E1M A;  2QK9 A;  1ZBF A;  4B8C A;  1KVC A;  3AVA A;  3LWM A;  1N5Y A;  1RBU A;  4DTX A;  4FJK A;  4CFA A;  4KRE A;  3WNE A;  4CHQ A;  3K58 A;  3WNG A;  2YV0 X;  1C0M A;  1WNS A;  4AHT A;  4OPJ A;  4DTJ A;  3SUQ A;  4CHY A;  3S3N A;  4PUO A;  2XY6 A;  3QNO A;  1NOY A;  2YHB A;  3CYM A;  2G8I A;  4FLV A;  3A2F A;  3RR7 A;  4ZHR A;  3AVI A;  5J1E A;  3L2R A;  3EYZ A;  4FLX A;  2XRI A;  4CJ5 A;  4DTN A;  3MEC A;  4OKK A;  1NJW A;  1B9D A;  4E0D A;  3B6P A;  4GW6 A;  5KTQ A;  1RTD A;  1UA1 A;  1ITG A;  1C6V A;  4B9V A;  4I2P A;  1Z26 A;  4FW1 A;  1D9F A;  4FJJ A;  1RTH A;  2Z1J A;  2KW4 A;  3M8P A;  3V9W A;  1CZ9 A;  1C1C A;  3HVR A;  3TAN A;  1Z25 A;  3ULD A;  1X1P A;  5FDL A;  1VRT A;  4N41 A;  3AVK A;  4B9N A;  4W5N A;  4DF8 A;  1JLB A;  2G8U A;  3VQ6 A;  4KI6 A;  2YNI A;  1HRH A;  3RMB A;  3SJJ A;  3KKR A;  3SNN A;  4OKE A;  3ZSX A;  1CXU A;  3K57 A;  3RMC A;  2OA8 A;  4NCA A;  2X74 A;  3PUF A;  1ZBH A;  4CHO A;  4M3X A;  3D0P A;  3IS9 A;  1WSF A;  1WSG A;  4IFY A;  1NJZ A;  2JLE A;  3DRP A;  3OVN A;  4NCG A;  3VQ4 A;  1YT3 A;  3LPU A;  1UA0 A;  4J2B A;  3HO1 A;  2YNF A;  3O4Q A;  4FM2 A;  1NK4 A;  3QES A;  2G8H A;  4K8X A;  4KHQ A;  1TKZ A;  4AH9 A;  4RG8 A;  4FJM A;  1BI4 B;  1HQU A;  3JYT A;  4CJL A;  4KFB A;  3O3F A;  4DS4 A;  1NK0 A;  1L5U A;  4KAZ A;  4FJG A;  4CHN A;  3HPO A;  3ASM A;  1IKX A;  3NFA A;  5HRN A;  4O0I A;  3SV3 A;  4PWD A;  5KI6 A;  4I9L A;  4FJN A;  3AVG A;  4H8K A;  1JLA A;  4CGI A;  3ALY A;  2GBZ A;  4CGF A;  3ZSW A;  4FLY A;  1VSH A;  3OJU A;  2IC3 A;  3DI6 A;  3T19 A;  3NCI A;  3PX0 A;  2D0A A;  2VWK A;  3L2V A;  2ZD1 A;  5CZ1 A;  1EET A;  2E6M A;  2KTQ A;  4Z0U A;  3L3U A;  1TL3 A;  4IG3 A;  2HVH A;  1N6Q A;  2GUI A;  4AHV A;  5FRN A;  4W5R A;  3TAR A;  3HPH A;  3KD5 E;  2E6L A;  3AVJ A;  4DTP A;  1GOC A;  2RPI A;  1BIS A;  4DS5 A;  2HHX A;  2ZQB A;  1YTA A;  4BDP A;  4FJH A;  3NF7 A;  4PY5 A;  1RBT A;  1A5V A;  3ZSQ A;  3ZSR A;  4FJ7 A;  3K5M A;  2YNG A;  3QEX A;  1HYZ A;  4ELT A;  1TK0 A;  2W42 A;  1S1W A;  5KGX A;  1ZBL A;  3ZCM A;  1NK5 A;  1HYV A;  4HTU A;  4DSK A;  3RWU A;  2IGI A;  1Q9X A;  3LDS A;  3AO3 A;  3AO2 A;  3QNN A;  5KRT A;  1TK5 A;  4QAG A;  4EZ6 A;  1IKV A;  4F3T A;  1HNI A;  3DLK A;  3LAL A;  3SUP A;  4AHU A;  4B9M A;  4CGG A;  3KLH A;  1LAW A;  2HB5 A;  2OZM A;  3OYH A;  5JS2 A;  4E7L A;  4CF8 A;  2ITG A;  1L3T A;  2HHT A;  2KFZ A;  3CFP A;  1NJY A;  4CK1 A;  3OYD A;  1Y97 A;  4KV8 A;  1IKW A;  2F96 A;  1LW0 A;  1RT2 A;  1C1A A;  4BDY A;  4DFM A;  2G8K A;  2BGG A;  1DLO A;  4CJR A;  3LAK A;  3MED A;  2VG5 A;  1B92 A;  1BIZ A;  1VSF A;  2B4J A;  1J9A A;  4CJ4 A;  1WSJ A;  4CF2 A;  5I42 A;  5HP1 A;  3K59 A;  1S9G A;  5KRS A;  3OJS A;  3I8D A;  3PY8 A;  3VA0 A;  3WNF A;  2DTU A;  4E3S A;  2Z1I A;  1SKW A;  3DRR A;  3P1G A;  3RMA A;  4OGE A;  4M3R A;  4DFP A;  4KHY A;  1VSI A;  5DK5 A;  2D0B A;  2I5J A;  3IAY A;  4CEC A;  1BL3 A;  3E01 A;  4CJ3 A;  4JS4 A;  3SI6 A;  3WNH A;  2IS3 A;  4DLE A;  1EKE A;  3AA3 A;  1O1W A;  5C24 A;  4DTO A;  3TAG A;  1CZB A;  4CGD A;  4DG1 A;  3KK3 A;  1D5A A;  1QSS A;  4CES A;  4DMN A;  2DFF A;  4E7I A;  1L3U A;  4CJF A;  3RR8 A;  4CHZ A;  4BWJ A;  2HNY A;  1QS4 A;  3O3H A;  2KFN A;  2FBV A;  1F21 A;  3SZ2 A;  1GOB A;  4HUG A;  1UWB A;  3DRS A;  4F8R A;  1RTJ A;  2DFH A;  4CJS A;  3QEW A;  4KB0 A;  4AHS A;  1BCO A;  3OY9 A;  3SPY A;  3JSM A;  4DSL A;  4OVL A;  5HBM A;  4W5Q A;  3U6F A;  1RT5 A;  2AJQ A;  3L8B A;  3PX6 A;  1LWF A;  4RW6 A;  3U3G A;  3K5L A;  1NK8 A;  1LV5 A;  1JLC A;  4NYF A;  2XHB A;  4PA1 A;  3DLR A;  4ZTF A;  3C94 A;  1RDD A;  3HST B;  3T3F A;  4B3O A;  1VSE A;  1S1V A;  4CF9 A;  1WSI A;  3FFI A;  3V9U A;  1X9W A;  3QO9 A;  4MFB A;  3H08 A;  1J5O A;  3AVB A;  2FBY A;  3NGY A;  2X6S A;  3HP6 A;  4IDK A;  4GVM A;  1XC9 A;  1EXQ A;  4CHP A;  3KJV A;  3SUO A;  2BDP A;  1LW2 A;  3VA3 A;  1WSH A;  2YHA A;  3VQD A;  5HRR A;  4ID1 A;  4BDZ A;  4FZZ A;  1NK6 A;  2X78 A;  5CY4 A;  4LH4 A;  4LY7 A;  1U45 A;  4W5T A;  1L3V A;  3RRH A;  4KHW A;  3TR8 A;  3CFO A;  2WOM A;  4FK0 A;  3SYZ A;  1ZYQ A;  1S6P A;  4FYD A;  1RT6 A;  4DSF A;  2O4I A;  3HP9 A;  3VQA A;  4JS5 A;  4UQG A;  3VQC A;  2B5J A;  3V9Z A;  3CFR A;  3TAB A;  3M8S A;  4DTU A;  1XHZ A;  4G1Q A;  3KLF A;  2G8F A;  4O4G A;  1RBV A;  3TAM A;  4F3O A;  1QTM A;  3RRG A;  3ZT1 A;  3F9K A;  1IG9 A;  3AV9 A;  3O3G A;  3G0Z A;  1T05 A;  3KLE A;  1KRP A;  2ZE2 A;  1W0H A;  3ZSY A;  4CGH A;  3SPZ A;  2RKI A;  1VSD A;  2R7Y A;  1BIU A;  4CIG A;  1EX4 A;  4C8L A;  4DQP A;  4CJU A;  4KI4 A;  1SL2 A;  3CM6 A;  4Z4G A;  4M3Z A;  3ISN C;  1NK7 A;  4FZX C;  4EP4 A;  5J2N A;  3VQQ A;  1S5J A;  3OYM A;  5T7B A;  3MXM A;  2B6A A;  3L2Q A;  1RIL A;  3M8Q A;  4DFJ A;  3NH0 A;  3QET A;  1NKC A;  2Z1G A;  3HXM A;  3DLH A;  1B9F A;  4GMJ B;  2FC0 A;  4RW4 A;  1KLM A;  1HJR A;  4FLT A;  3QEP A;  1TKD A;  4IKF A;  3LPT A;  4HCB A;  4CE9 A;  3SV4 A;  3G10 A;  1LWE A;  3M8R A;  3KLG A;  4DSJ A;  4B8A B;  1LWC A;  1R0A A;  3KD1 E;  4K8Z A;  2HW3 A;  2A1R A;  2KZZ A;  3ITH A;  3OS1 A;  1UOC A;  4FK4 A;  4Y1C A;  1EP4 A;  3KLI A;  1D8Y A;  3SCX A;  2OPS A;  1KTQ A;  4Y1D A;  3EZ5 A;  5SZT A;  4NYN A;  1KCF A;  5HLF A;  2XY5 A;  4ELV A;  3LP2 A;  4H4O A;  3VQE A;  3DOK A;  3AO5 A;  3NGZ A;  4DU1 A;  1XI1 A;  1JLG A;  3P83 D;  4FM1 A;  1U4B A;  4KPY A;  4KHU A;  4M3Y A;  2NUB A;  3QLH A;  2KZM A;  4WE1 A;  2IDO A;  1A5X A;  1KLN A;  2HVI A;  3HYF A;  4F2S A;  1WAJ A;  2EX3 A;  3O4N A;  1TV6 A;  4M3T A;  1HNV A;  3OYF A;  3MAQ A;  4DF4 A;  4E1N A;  5J2M A;  3L3V A;  3L2U A;  2OZS A;  3MXI A;  1SL1 A;  4HVJ A;  3V9S A;  2IOC A;  4ELU A;  2KQ2 A;  4C8N A;  4E7K A;  4AHR A;  4DQI A;  3ZSV A;  4I7F A;  5HRP A;  3V1Q A;  1NKB A;  4FJI A;  1JXE A;  2Q3S A;  2Y1J A;  3T1A A;  2PYL A;  2QXF A;  4DTM A;  5D3G A;  2RN2 A;  3HL8 A;  2HHV A;  3I0S A;  4E89 A;  3AO1 A;  4N47 A;  4Z4F A;  1JKH A;  3NHG A;  2XO7 A;  4OGC A;  2VG6 A;  5J2Q A;  4LH5 A;  5JS1 A;  3MXJ A;  4CFD A;  1VSM A;  1XWL A;  4HUF A;  1JL2 A;  1SKR A;  5C42 A;  3EY1 A;  1SL0 A;  1W9H A;  3OYI A;  4AIL C;  1TGO A;  4I2Q A;  1SKS A;  1S9E A;  3HPG A;  3LAM A;  1D9D A;  2OYQ A;  4CJV A;  4O5B A;  3QER A;  4CEB A;  4CJP A;  4XIU A;  4BE2 A;  1S6Q A;  4KHN A;  3F73 A;  4CEF A;  4KTW A;  3NDK A;  3S3M A;  1JLQ A;  1U04 A;  3VQP A;  4OJR A;  4LD0 A;  1TVR A;  4ICL A;  4FJ5 A;  4LSN A;  3NH2 A;  2BE2 A;  3MEE A;  4L8R B;  1U47 A;  3LAN A;  1TL1 A;  3HK2 A;  4E7J A;  4F2R A;  1C1B A;  2JGU A;  3AA4 A;  3QEI A;  1G15 A;  1C0T A;  3DM2 A;  3V1R A;  4N5S A;  3DLB A;  5EU7 A;  4B9T A;  1RDA A;  4Z4E A;  2X6N A;  4C8M A;  4CK2 A;  4E19 A;  4M42 A;  4KRF A;  1ASV A;  1J54 A;  3HT3 A;  4FLW A;  3AVF A;  3VQB A;  5HRO A;  5KGW A;  1QE1 A;  1XHX A;  3SUN A;  4CF1 A;  1BI4 A;  2FBT A;  1NJX A;  3MEG A;  4R5P A;  1TK8 A;  1BCM A;  4HCC A;  1MU2 A;  2D0C A;  3QIO A;  1U49 A;  5CZ2 A;  2A1S A;  1TAQ A;  4CEO A;  1TKX A;  2WON A;  3VN5 A;  1C0U A;  4CER A;  2F8T A;  4DTR A;  1BQM A;  3S9H A;  3B6O A;  4AHC A;  4LSL A;  4OPK A;  3OYK A;  4FJ8 A;  1CXQ A;  1RDB A;  1X9S A;  1X9M A;  2HHW A;  3KK1 A;  4IG0 A;  2XY7 A;  3VQ8 A;  4B9L A;  4JLH A;  3ZT0 A;  4JRP A;  2RF2 A;  4IFV A;  4FCY A;  5FRO A;  1RT1 A;  4OLB A;  1FKP A;  3AO4 A;  4CK3 A;  3I0R A;  3K5N A;  2XY8 A;  3QEV A;  2HHS A;  1DTT A;  4BWM A;  4DWI A;  3OYJ A;  4PQU A;  5J2P A;  3LP1 A;  3KK2 A;  3KTQ A;  3TAF A;  1ZBI A;  3NE6 A;  1FKO A;  3HVT A;  3OYA A;  1T03 A;  1L3S A;  4H4M A;  3P5J A;  4E7H A;  4B08 A;  1VK0 A;  1I3A A;  4MQ3 A;  4KKO A;  1BHL A;  1NKE A;  4DQQ A;  3IRX A;  3LP0 A;  4B9U A;  2P5O A;  1SUQ A;  3OYC A;  1T8E A;  4J2D A;  3L2W A;  4DQS A;  3VQ9 A;  4DU4 A;  5I3U A;  4O55 A;  3DYA A;  3ZSO A;  3NBP A;  3TWH A;  1FK9 A;  3AVM A;  4KTZ A;  4O0J A;  1JLE A;  2VG7 A;  1RT7 A;  5DMR A;  4FVM A;  2DFE A;  4Z4C A;  3SQ4 A;  1KFS A;  4M3W A;  4M45 A;  1HPZ A;  3DLE A;  3OS0 A;  3OYE A;  4KHS A;  4FLU A;  2DY4 A;  2P5G A;  3AVC A;  4NCB A;  4CEQ A;  1ASU A;  1KVB A;  2OPP A;  4CEE A;  4FJ9 A;  2ATQ A;  3LP3 A;  2G8W A;  4F4K A;  4Z4I A;  1BGX T;  4W5O A;  3AA2 A;  2Y1I A;  2Z1H A;  3V1O A;  1RDC A;  3KKS A;  1A5W A;  4FZY A;  2QKB A;  4CEA A;  2D5R A;  4CCH A;  2LSN A;  4FK2 A;  4QOZ B;  4RW8 A;  5CYQ A;  2O4G A;  4DFK A;  3THV A;  1J53 A;  3AVN A;  2HMI A;  1ASW A;  3SQ0 A;  3V4I A;  4CJQ A;  4BE0 A;  3D45 A;  1U48 A;  4CIF A;  4CGJ A;  4DQR A;  3RMD A;  4QCL A;  2OPR A;  1FXX A;  3CM5 A;  3KIO A;  4ID5 A;  1KVA A;  4RW7 A;  4EP5 A;  2VWJ A;  1RTI A;  1RBS A;  3NAE A;  1RNH A;  5E41 A;  3CQ8 A;  5CYM A;  3V6D A;  4YFU A;  3V9X A;  2YKM A;  3NF9 A;  1I39 A;  1S1U A;  4CFB A;  1VSK A;  3OYG A;  3SQ1 A;  4KTQ A;  1IH7 A;  3AA5 X;  3NF8 A;  1WN7 A;  3C95 A;  5C25 A;  1NK9 A;  4Q0B A;  3TAQ A;  3DMJ A;  3VQ7 A;  3SQ2 A;  4EZ9 A;  1NOZ A;  1QSL A;  3K5O A;  3ZSZ A;  4HUE A;  4C8O A;  4OKJ A;  3PO4 A;  2OPQ A;  1YTU A;  1KFD A;  2P51 A;  4CJT A;  3V81 A;  1Q8I A;  3LWL A;  3NF6 A;  4CF0 A;  4CIE A;  4YNQ A;  4FXD A;  2GV9 A;  3QIP A;  3BGR A;  1TAU A;  3QIN A;  4O44 A;  3S3O A;  3TAP A;  2P1J A;  3UIQ A;  4I9Q A;  2F8S A;  5SWM A;  1HQE A;  1QHT A;  1JXB A;  4Z4H A;  2PYJ A;  1SV5 A;  2IAJ A;  3NH1 A;  1T7P A;  3DLG A;  4C8K A;  4CJW A;  2YNH A;  2ETJ A;  1K6Y A;  1YVU A;  1QQC A;  4DTS A;  3AVH A;  4Q5V A;  4FW2 A;  3OYB A;  4N56 A;  4JRQ A;  4J2E A;  3C6T A;  3TI0 A;  4FLZ A;  1HMV A;  1JLF A;  3ZT2 A;  4N76 A;  3LZI A;  1HYS A;  1UAX A;  3VQ5 A;  1JL1 A;  1VSJ A;  4FJL A;  2PY5 A;  3DOL A;  2FBX A;  2HND A;  1VRU A;  3PX4 A;  1IKY A;  2EHG A;  1ZBU A;  4DSE A;  3AVL A;  1DTQ A;  3OYN A;  3PO5 A;  4J2A A;  2HHU A;  3OYL A;  4IBN A; 
#chains in the Genus database with same CATH topology
 1S1X A;  3HM9 A;  4LF9 K;  2HHQ A;  3TAE A;  2G8V A;  3ENO A;  1V4T A;  5AQZ A;  4DLG A;  2YKN A;  4KB1 A;  3BUZ B;  2D0O A;  1QSY A;  1RT3 A;  1REV A;  2E2N A;  4GY2 B;  1T6D A;  3C6U A;  5K14 A;  3ZX2 A;  2NZT A;  1TKT A;  3HJF A;  1NGA A;  4KO0 A;  3SAG A;  4DV7 K;  3GOI A;  3E9P A;  3ZET A;  4IWV A;  3VF4 A;  1N5Y A;  1RBU A;  5FPD A;  4JI2 K;  1NK8 A;  3WNG A;  3S3N A;  2G8I A;  4PHT X;  3CME N;  2OCE A;  4CJ5 A;  3M6G A;  3MEC A;  4OKK A;  3I55 N;  4E0D A;  4GW6 A;  2J4R A;  5AZJ A;  3D2F A;  5KPT A;  4B9V A;  4FL9 A;  4EAH D;  4CD3 A;  1NGG A;  1RTH A;  4JKH A;  3CC4 N;  5AQX A;  4FVU A;  4DV5 K;  1X1P A;  5FDL A;  1VRT A;  5GAD P;  5GAG P;  4KI6 A;  2EWS A;  4EIA A;  1BU6 O;  4OKE A;  3K57 A;  3SNN A;  4GV9 A;  4NCA A;  1ZBH A;  3PUF A;  3LDL A;  3U9Z A;  3TTD A;  3CF5 L;  3E9L A;  3D0P A;  3CQX A;  4IFY A;  3HO1 A;  3LPU A;  3O4Q A;  4CI6 A;  3QES A;  4FJM A;  4AH9 A;  4CJL A;  4KFB A;  4FJG A;  1GLF O;  1Q18 A;  3NFA A;  5HRN A;  5KI6 A;  4FJN A;  4H8K A;  4CGI A;  4H5N A;  4WYB A;  3ZSW A;  1R59 O;  2IC3 A;  1YF5 L;  4WF9 L;  1WB9 A;  3WEE B;  2E6M A;  3L3U A;  1DKG D;  4IG3 A;  2HVH A;  2GUI A;  3HBT A;  3TAR A;  1VQ5 N;  3HPH A;  3JAM O;  4G9Z A;  1GOC A;  4WCE L;  4DS5 A;  4JKC A;  5BPN A;  2RHK A;  4FJH A;  3NF7 A;  1RBT A;  3ZSQ A;  3ZSR A;  3K5M A;  2YNG A;  4OPH A;  1C0F A;  1RDU A;  1P90 A;  1S1W A;  1NK5 A;  2V7Z A;  3SLC A;  5AQM A;  3VF6 A;  4EZ6 A;  3CPE A;  4F3T A;  3ZEU B;  3O9U A;  2HBK A;  1MDU B;  3BZK A;  2ITG A;  4BRC A;  1HKG A;  1VQ6 N;  3MWP A;  4KV8 A;  3VOV A;  4FOI A;  5C10 A;  2ITM A;  2VQE K;  4CJR A;  4DV2 K;  4BRA A;  4FWK A;  4ILJ A;  3I8D A;  3VA0 A;  3WNF A;  4E3S A;  3THW A;  2Z1I A;  4M3R A;  4KHY A;  1VSI A;  2D0B A;  3SI6 A;  4DTO A;  1IBK K;  1CZB A;  4CES A;  1NGE A;  3THX B;  2CH5 A;  4YOY A;  1L3U A;  1SAZ A;  4H0V B;  4CHZ A;  2KFN A;  3EE9 A;  3DJC A;  1UWB A;  1LCU A;  1RTJ A;  5TKW A;  4KB0 A;  1BCO A;  3HSC A;  3WXL A;  3OY9 A;  4DSL A;  4OVL A;  1U2V A;  3BF3 A;  5HBM A;  2AJQ A;  4MLH A;  3EKU A;  4EFH A;  1MWK A;  2P9N B;  1X9J A;  2XHB A;  3ENH A;  4PA1 A;  3DLR A;  3H45 C;  1S1V A;  3T7Z A;  4NB4 A;  3UKU B;  3M3Z A;  4JEP A;  3H08 A;  3AVB A;  4U7B A;  4IDK A;  4GVM A;  4IFE A;  1EXQ A;  3TPQ A;  3KJV A;  4K43 A;  1LW2 A;  3WEE A;  2QWN A;  4CZL A;  4ID1 A;  1VQ4 N;  1HJO A;  3PLA A;  5CY4 A;  4LY7 A;  2E1Z A;  3L4I A;  1L3V A;  4H0P A;  4O8U A;  4FK0 A;  1KAX A;  3SYZ A;  4O8K A;  1ZYQ A;  3K9K A;  2O4I A;  4JI1 K;  2NRH A;  4JS5 A;  4UQG A;  3M8S A;  4DTU A;  4YDU C;  4G1Q A;  4B3R K;  2G8F A;  1RBV A;  2WTU A;  3F9K A;  1IG9 A;  3AAR A;  1KRP A;  2ZE2 A;  1W0H A;  4IOC L;  2RKI A;  2R7Y A;  4CIG A;  1EX4 A;  1XUP O;  3GG4 A;  3CM6 A;  4M3Z A;  2QWR A;  5FPN A;  5AQK A;  4IDH A;  5T7B A;  3MXM A;  2B6A A;  1NKC A;  4H5T A;  2E88 A;  1N8R O;  4RW4 A;  4GMJ B;  1KLM A;  3C7N B;  4IKF A;  4HCB A;  3G10 A;  1OH5 A;  1LWE A;  5IWA K;  3P39 A;  3M8R A;  3VEV A;  4K8Z A;  3KD1 E;  2HW3 A;  4FWL A;  2A1R A;  3ITH A;  4K41 A;  5EX5 A;  4B9Q A;  3EZ5 A;  4NYN A;  1KCF A;  5HLF A;  4CBU A;  4ELV A;  4H4O A;  1U4B A;  4JAX A;  4CZG A;  1K73 O;  4WE1 A;  5AQF A;  5EVZ A;  1A5X A;  2UXD K;  4KH4 A;  4A57 A;  4F2S A;  3O4N A;  4MO4 A;  4IEE A;  2P9U B;  4DF4 A;  1QVF M;  5J2M A;  3L3V A;  3L2U A;  3MXI A;  3QFU A;  1SL1 A;  2P9N A;  3V9S A;  4BVP A;  4DQI A;  4E7K A;  3C6A A;  3V1Q A;  1NKB A;  4MDB A;  3HL8 A;  3UKU A;  3UB5 A;  4E89 A;  3NHG A;  4ISF A;  2RE2 A;  4JYA K;  3MXJ A;  5AQT A;  4CFD A;  3VEY A;  1VSM A;  1XWL A;  4HWI A;  1K9M O;  1JL2 A;  2UU9 K;  5C42 A;  3EY1 A;  3OYI A;  4CVN E;  4I2Q A;  3EO3 A;  1SKS A;  1D9D A;  3LAM A;  1IBL K;  2OYQ A;  2GWK A;  3H3O B;  5AQI A;  1S6Q A;  1JLQ A;  1U04 A;  1D4X A;  1TVR A;  3CJB A;  2ZJR L;  2QA4 N;  3MEE A;  1TL1 A;  3DXK A;  4F2R A;  1C1B A;  3QEI A;  1G15 A;  3DM2 A;  4B9T A;  5E84 A;  3P38 A;  4E19 A;  1ASV A;  4FOE A;  4BR5 A;  3ID8 A;  2KHO A;  1QE1 A;  1XHX A;  2P9K B;  3CCR N;  3O9R A;  3DXM A;  1NJX A;  3MEG A;  1BCM A;  1MU2 A;  5LJV A;  1TAQ A;  3VN5 A;  1C0U A;  3A5L C;  4AHC A;  2FSK A;  4BVO A;  3OYK A;  2HBJ A;  1RDB A;  1X9M A;  4IG0 A;  3C7N A;  3ZT0 A;  4JRP A;  5AQJ A;  4OLB A;  1FKP A;  2HHS A;  3ZX0 A;  3OYJ A;  4FWP A;  3TAF A;  3OYA A;  1VK0 A;  4MQ3 A;  5M1O A;  3IRX A;  3LP0 A;  5TKY A;  5BPM A;  1ILY A;  3L2W A;  3AAP A;  3VQ9 A;  3LM2 A;  4DU4 A;  4O55 A;  1IG8 A;  5AQO A;  1GLD G;  3DYA A;  3AVM A;  4O0J A;  2VG7 A;  4M3W A;  4FVM A;  4Z4C A;  3T69 A;  3OYE A;  4FLU A;  4NCB A;  5KQD A;  1ASU A;  1KVB A;  4IEI A;  2ATQ A;  3LP3 A;  4J8F A;  1BGX T;  4LFC K;  4E1J A;  2E20 A;  3KKS A;  4QS9 A;  4PL7 A;  2W6L A;  4FK2 A;  1QHA A;  2A6A A;  2FF3 B;  1N33 K;  1J53 A;  1ASW A;  1U48 A;  3D45 A;  4CIF A;  3RMD A;  2OPR A;  1FXX A;  4RW7 A;  1KVA A;  2E5L K;  4BC2 A;  4YOU A;  5E41 A;  3CQ8 A;  3WXM B;  1I39 A;  1VSK A;  3SQ1 A;  3ZLJ A;  3NF8 A;  1WBD A;  3VEN A;  1NK9 A;  4GV3 A;  3SQ2 A;  4EZ9 A;  3A5N C;  3ZSZ A;  4WQ5 A;  3SK3 A;  3PO4 A;  1KFD A;  2P9K A;  2VCP A;  4CIE A;  5JLH A;  3S3O A;  4I9Q A;  2P9L B;  1OVY A;  5SWM A;  1HQE A;  1ATN A;  4H5R A;  1SV5 A;  4RCH A;  2H3G X;  4CJW A;  2ETJ A;  4CD1 A;  1ZC6 A;  3O5B A;  4WQ5 C;  4Q5V A;  1YIT N;  2FXU A;  4N56 A;  3O80 A;  3ZT2 A;  1KAZ A;  1HYS A;  3I8B A;  1VRU A;  2YHX A;  1IKY A;  4DSE A;  4NXM K;  3VPZ A;  4J2A A;  4BQZ A;  3OTO K;  2HBL A;  1GOA A;  4JKB A;  4CJE A;  2GUP A;  5M1Q A;  4OLA A;  1CLQ A;  1BQN A;  1WAF A;  5AFU H;  3PIO L;  2Q0R A;  4M41 A;  1W7A A;  2QKK A;  5LMU K;  2D4W A;  4CEZ A;  3U8X A;  1RCH A;  3QFP A;  5F1X A;  1NLV A;  1WSE A;  1IO2 A;  4A59 A;  1NGD A;  1KSP A;  5DM7 L;  3NGI A;  2HNZ A;  1S1T A;  3OHR A;  4TSX A;  4ZTJ A;  1K8K B;  5FRM A;  3EE8 A;  2E4L A;  4E1M A;  2QK9 A;  4B8C A;  4DTX A;  4DR4 K;  4L3Q A;  1GLA G;  3LDQ A;  4B1U B;  1C0M A;  4AHT A;  4PUO A;  4JI3 K;  4BC5 A;  3MN9 A;  3A2F A;  4ZHR A;  4B3S K;  5AQW A;  5AQS A;  1RTD A;  1UA1 A;  1ITG A;  4JK8 A;  5GAE P;  4H0X B;  3M8P A;  1C1C A;  3ATU A;  3TAN A;  1NGH A;  3ULD A;  1WOQ A;  3CER A;  1IJJ A;  1YVN A;  3P31 A;  1JLB A;  2G8U A;  2YNI A;  3SJJ A;  2P9L A;  3ZSX A;  1CXU A;  1NWK A;  3WQU A;  4WQ4 A;  4CHO A;  4M3X A;  3IS9 A;  4J2B A;  4BRG A;  4NCG A;  1YT3 A;  1N36 K;  4HTL A;  1J5E K;  1BI4 B;  1HQU A;  4DS4 A;  1NK0 A;  4CHN A;  4O0I A;  2O8D B;  3AVG A;  3C6H A;  3ALY A;  2GBZ A;  3RSE B;  4CGF A;  4FLY A;  2VWK A;  3L2V A;  2ZD1 A;  4JKD A;  2KTQ A;  1TL3 A;  2NLX A;  3WXI A;  4AHV A;  5FRN A;  4W5R A;  3J81 O;  1HNW K;  2E6L A;  3AVJ A;  3CCQ N;  2RPI A;  4H5V A;  2Q2R A;  1YTA A;  2IVN A;  3QEX A;  2W40 A;  1NM1 A;  3L6Q A;  1TK0 A;  3OBY A;  1ZBL A;  4DSK A;  5AZI B;  3AO3 A;  2UUA K;  5KRT A;  1TK5 A;  3NVM A;  1HNI A;  3DLK A;  3LAL A;  4CZK A;  4FWS A;  4CF8 A;  3CFP A;  1NJY A;  3OYD A;  1Y97 A;  5GIO A;  2F96 A;  2YCH A;  2AP1 A;  4BDY A;  2G8K A;  4DFM A;  4OPA A;  2QW9 A;  2IIR A;  3LAK A;  3HXM A;  1B92 A;  1VSF A;  2B4J A;  5I42 A;  3K59 A;  1VAZ A;  1VQN N;  5M1P A;  4OGE A;  4DFP A;  4JHD B;  4B1X B;  2VYP A;  4CEC A;  3E01 A;  5F2R A;  3WNH A;  2IS3 A;  3AA3 A;  1BOT O;  4CGD A;  1D5A A;  4A2A A;  1QSS A;  2DFF A;  4E7I A;  3RR8 A;  4H0T B;  1XNR K;  4BWJ A;  5F0X A;  5AQP A;  1F21 A;  2P9P A;  1GOB A;  3DRS A;  4F8R A;  3ID6 A;  3SPY A;  3JSM A;  1BA1 A;  3CQY A;  1LWF A;  3QIC A;  3VEW A;  2NRV A;  4RW6 A;  3SBG A;  3UKR B;  3K5L A;  3N4P A;  1YUW A;  1LV5 A;  4NYF A;  3I56 N;  1VSE A;  4CF9 A;  2O8D A;  4FPB A;  3T1Y K;  4BRF A;  3QO9 A;  3BF1 A;  2YHY A;  4MFB A;  2FBY A;  3NGY A;  2X6S A;  3RSE A;  2W41 A;  4CHP A;  1QZ6 A;  4H5W A;  4DR1 K;  3VA3 A;  3CIP A;  2Q1N A;  5CHI A;  1WBB A;  1WSH A;  3VQD A;  3CCE N;  4BDZ A;  4A61 A;  1NK6 A;  4BR2 A;  4IOX A;  4PKH A;  3A0I X;  1S72 N;  1U45 A;  2YJF A;  5HL7 L;  4PKG A;  3ZX3 A;  3CFO A;  2WOM A;  2QWQ A;  4FYD A;  1H1V A;  3KK7 A;  1HX1 A;  4DB3 A;  3C0B A;  2O8F A;  4CZJ A;  3RRG A;  3SMP A;  3G0Z A;  3M1F A;  3R3L A;  4XH1 A;  1VSD A;  1BIU A;  1EWR A;  4DQP A;  1CZA N;  4CJU A;  2A40 A;  3Q7B A;  2VQF K;  3ISN C;  4FZX C;  3MN7 A;  4YOX A;  1NGI A;  1S5J A;  1C0G A;  2ZJQ L;  5GAH P;  3IMX A;  3VEZ A;  5LJW A;  3QBX A;  4U67 L;  1X3N A;  2FC0 A;  4B3T K;  1HJR A;  4YOT A;  3QEP A;  1ATS A;  4JHD A;  4QS8 A;  1EO1 A;  3MDQ A;  4Y1C A;  1EP4 A;  3KLI A;  2YHW A;  1D8Y A;  3SCX A;  2OPS A;  1BO5 O;  3SBT A;  4CZM A;  2XY5 A;  3NGZ A;  3FFK B;  1XI1 A;  1JLG A;  3P83 D;  4KPY A;  4KHU A;  4JI5 K;  2NUB A;  1BG3 A;  3QLH A;  2KZM A;  2IDO A;  1KLN A;  2OAN A;  3HYF A;  1O13 A;  4DCH A;  3WQT A;  2CH6 A;  3ATV A;  1VQ8 N;  3VGM A;  5A2Q O;  2IOC A;  1HKB A;  1KXP A;  4DR2 K;  3ZSV A;  3T1A A;  2QXF A;  4B1V A;  2HHV A;  3E66 A;  3I0S A;  5J2Q A;  5JS1 A;  1X3M A;  2P9S B;  5C2D A;  1SL0 A;  2QEX N;  3G25 A;  4CEB A;  4XIU A;  4BE2 A;  1VQK N;  3S3M A;  1E3M A;  4ICL A;  3NH2 A;  4L8R B;  1U47 A;  3LAN A;  2ZF5 O;  2JGU A;  3DLL L;  4KBO A;  1E4F T;  2A42 A;  2HST A;  4ILH A;  3ENB A;  1NJI O;  4M42 A;  3HT3 A;  3ULE B;  3VQB A;  5HRO A;  1GLJ O;  5KGW A;  1TUY A;  1KQS M;  1K8A O;  2FBT A;  4R5P A;  4HCC A;  2D0C A;  3O8M A;  3IDH A;  4DTR A;  1BQM A;  4DV6 K;  4ISG A;  4LSL A;  3CI5 A;  5AQV A;  5BR8 K;  4B9L A;  3VQ8 A;  3KZB A;  4CK3 A;  3K5N A;  2GWJ A;  1DTT A;  3H1V X;  4PQU A;  4LFB K;  1BA0 A;  4B1Z A;  3P4I A;  4JK9 A;  2UXB K;  3DWL A;  2E2P A;  5AR0 A;  2Q97 A;  4JI7 K;  4H4M A;  1I3A A;  1NKE A;  1BHL A;  3VF2 A;  2P5O A;  4J2D A;  1T8E A;  3ZEU A;  4BRK A;  4DHY A;  4EHT A;  5I3U A;  2E2O A;  1RT7 A;  1QQN A;  3EZW A;  2DFE A;  5DMR A;  3SQ4 A;  1KFS A;  1HPZ A;  4KHS A;  1YXQ A;  1Y64 A;  4CEE A;  2NRZ A;  4Z4I A;  4BQL A;  3HI0 A;  1RDC A;  1I94 K;  4I6M B;  1QVG M;  1BUP A;  4FZY A;  2QKB A;  4CCH A;  4RW8 A;  3MK6 A;  5CYQ A;  2O4G A;  3O08 A;  4AM6 A;  3AVN A;  2HMI A;  3V4I A;  4BE0 A;  4JKG B;  4QCL A;  3CM5 A;  3KIO A;  4EP5 A;  3THX A;  3NAE A;  5CYM A;  3OYG A;  1S1U A;  5M1N A;  2W6K A;  4KTQ A;  1IH7 A;  3TTC A;  3C95 A;  4PL8 A;  5C25 A;  4H0Y B;  4CBW A;  3DMJ A;  2NRT A;  3K5O A;  4WFA L;  3ULE A;  1QZ5 A;  4C8O A;  2P51 A;  1Q8I A;  2GV9 A;  3EL2 A;  1TAU A;  3QIN A;  4O44 A;  2Q36 A;  3UIQ A;  1GLE G;  4GVE A;  1JJ2 M;  4YHH K;  2PYJ A;  2F9W A;  4C8K A;  1J6Z A;  2YNH A;  1K6Y A;  1YVU A;  2YX6 A;  3AVH A;  4FW2 A;  4JRQ A;  3TI0 A;  4FLZ A;  1HMV A;  4CZF A;  1JLF A;  1BDG A;  4BR4 A;  3R6M A;  2FBX A;  4UY8 O;  2FLO A;  5AFU A;  2YI1 A;  1DGK N;  1YHQ N;  4QS7 A;  2O8B B;  4YOR A;  3OYN A;  2HHU A;  2E8A A;  3WUH A;  3MN6 A;  2O8E B;  3PV8 A;  3CCU N;  3Q7C A;  2ZM6 K;  3U3Y A;  2PZS A;  3JS6 A;  3LZJ A;  4MLE A;  4FJX A;  3E1Y A;  1WLJ A;  1W97 L;  4CJK A;  3OS2 A;  1NGJ A;  3VTH A;  3GDQ A;  4BAC A;  4JN4 A;  4RW9 A;  1XMO K;  4CFC A;  1VSL A;  2UUC K;  4BE1 A;  4DSI A;  3O9Q A;  1Q9Y A;  3BDP A;  3RTV A;  4I6M A;  3CET A;  1ZBF A;  1NU0 A;  3AVA A;  5ADX H;  4JKF A;  3G71 N;  4KRE A;  3WNE A;  2I7N A;  4DUZ K;  4CHQ A;  1NGB A;  3SUQ A;  1WNS A;  3B8A X;  4OPJ A;  4CHY A;  1NOY A;  2YHB A;  1Z6R A;  4FLV A;  5J1E A;  4DTN A;  1NJW A;  2XRI A;  3B6P A;  2AA4 A;  5KTQ A;  5BRF A;  1VQ9 N;  4LFA K;  1C6V A;  3G6E N;  1D9F A;  2Z1J A;  3BZC A;  3V9W A;  1CZ9 A;  1T3V A;  3OBW A;  4WFB L;  4AQY K;  2P9U A;  2QM1 A;  4AF1 A;  3AVK A;  4W5N A;  4DF8 A;  1HRH A;  3KKR A;  4IJN A;  3CCS N;  4KH5 A;  3RMC A;  3CC7 N;  2X74 A;  2PFU A;  1WSF A;  3DAW A;  1UA0 A;  3VQ4 A;  1RGI A;  1NK4 A;  4B3M K;  1TKZ A;  3JYT A;  3O3F A;  4KAZ A;  3ASM A;  1IKX A;  3SV3 A;  4PWD A;  1FW6 A;  4DQ8 A;  1JLA A;  2NRR A;  3AY9 A;  1RDW X;  4C1N K;  3G4S N;  4R79 A;  4JI4 K;  2QI2 A;  3T19 A;  2D0A A;  5CZ1 A;  1EET A;  2O8B A;  1N6Q A;  3JXU A;  3KD5 E;  3H6E A;  1FJG K;  2O8E A;  2ASP A;  4ISE A;  2HHX A;  2CGL A;  2ZQB A;  4BDP A;  3A5O C;  1A5V A;  3I33 A;  3IFR A;  1HYZ A;  5ELZ A;  3IUC A;  4ELT A;  5GIN A;  1HYV A;  3CMA N;  3ZYY X;  3RWU A;  2BH1 A;  2IGI A;  3FZF A;  3LDS A;  3AO2 A;  3QNN A;  4QAG A;  1IKV A;  2D1K A;  1DT9 A;  3LL3 A;  4B9M A;  3KLH A;  2HB5 A;  5C0Y A;  2HHT A;  1LW0 A;  1C1A A;  3MED A;  2VG5 A;  1J9A A;  4CF2 A;  1WSJ A;  4DUY K;  1QQO A;  5HP1 A;  2O8C B;  1S9G A;  3K9J A;  3OJS A;  3PY8 A;  1HLU A;  2DTU A;  1SKW A;  2KKZ A;  5I9E B;  1BL3 A;  4JS4 A;  1Q81 O;  4C23 A;  4DLE A;  1O1W A;  3TAG A;  4DG1 A;  2VGM A;  1OVQ A;  4DMN A;  2QWL A;  1OKJ A;  4CJF A;  3O9T A;  3O3H A;  3SZ2 A;  4HUG A;  4BG9 A;  3H3N O;  3MN5 A;  4BRQ A;  4W5Q A;  4GKJ K;  3PX6 A;  3F9M A;  2HF3 A;  3U3G A;  4B1W B;  1JLC A;  3KWG A;  4ZTF A;  3CHW A;  1RDD A;  5AQN A;  1WSI A;  3FFI A;  2I7P A;  4DV3 K;  1U6Z A;  1J5O A;  3HP6 A;  1XC9 A;  3SUO A;  2BDP A;  1HUX A;  2YHA A;  4LF5 K;  5HRR A;  4JI0 K;  4FZZ A;  3TU5 A;  2X78 A;  4IO8 A;  3WXJ A;  4JV5 K;  5FPE A;  4W5T A;  1E4G T;  3RRH A;  4KHW A;  4A62 A;  1S6P A;  1HKC A;  3HP9 A;  1SZ2 A;  3V9Z A;  5C12 A;  1XHZ A;  3KLF A;  4NLC A;  1YJN N;  3ZT1 A;  4RWT A;  3O3G A;  1T05 A;  3KLE A;  3VER A;  3C65 A;  4CGH A;  4NLB A;  4DR6 K;  4C8L A;  5BR9 A;  4K42 A;  3KHY A;  5J2N A;  3VQQ A;  4WQ4 C;  2QXL A;  3J80 O;  3OYM A;  3L2Q A;  1RIL A;  3QET A;  3H46 O;  3NH0 A;  2Z1G A;  4A5A A;  2IVP A;  2O8C A;  2D0P A;  3CC2 N;  4FLT A;  4EHU A;  4CBX A;  3BY5 A;  5BRH A;  5JMV A;  4B8A B;  1LWC A;  5IT9 O;  3OS1 A;  2WUS A;  4FK4 A;  4X62 K;  3SMS A;  4C1N I;  3DOK A;  1HNX K;  3RVC A;  3U4L A;  4M3Y A;  2BUP A;  3D2F B;  2FF6 A;  2EX3 A;  3FE1 A;  3L4Q A;  1EWQ A;  1K8K A;  1TYQ B;  4E1N A;  4HVJ A;  2Q0U A;  5KPR A;  1XNQ K;  2KQ2 A;  1KD1 O;  4AHR A;  4I7F A;  3OW2 M;  1JXE A;  2Y1J A;  2PYL A;  4B1Y B;  4DTM A;  5D3G A;  2RN2 A;  3AO1 A;  4N47 A;  1XQS C;  1JKH A;  4BR7 A;  3FZH A;  4DR7 K;  3MMV A;  4HUF A;  1SKR A;  3NVK A;  3O4W A;  3IKM A;  3MWT A;  4AIL C;  4FWO A;  1S9E A;  1SS6 A;  3QER A;  2JWK A;  4CJP A;  4KHN A;  3HM8 A;  3NDK A;  4KTW A;  3VQP A;  4FJ5 A;  4OJR A;  4LF6 K;  2CGJ A;  4LSN A;  5LY3 A;  2ZJP L;  4E7J A;  4ILG B;  3DLB A;  3V1R A;  4Z4E A;  2X6N A;  4CK2 A;  1J54 A;  3CJC A;  4FLW A;  3AVF A;  3CJ1 A;  3SUN A;  3PIP L;  1BI4 A;  1TK8 A;  3QIO A;  1U49 A;  4MO5 A;  5CZ2 A;  1NGF A;  1MA9 B;  4CEO A;  1TKX A;  4CER A;  4BC3 A;  3S9H A;  3B6O A;  3MX2 A;  3UE5 A;  4OPK A;  5KQ8 A;  3KK1 A;  2XY7 A;  3VGK A;  4JLH A;  3HTV A;  2RF2 A;  3FLC O;  4IFV A;  5FRO A;  1RT1 A;  3W3D A;  3AO4 A;  3QEV A;  3I0R A;  4BWM A;  5J2P A;  3EEQ A;  3VTI A;  2QWM A;  1M1K O;  3KK2 A;  3KTQ A;  1ZBI A;  4WFN L;  1FKO A;  3HVT A;  1OH7 A;  3THW B;  4B08 A;  5AZI A;  4DQQ A;  3E9O A;  1SUQ A;  4M7Y A;  3OYC A;  4GV6 A;  1VQP N;  3ZSO A;  3TWH A;  3NBP A;  1FK9 A;  5MLC Q;  4KTZ A;  5LL6 Z;  1VQ7 N;  1JLE A;  1TYQ A;  5JVH L;  1Z05 A;  3AVC A;  1V4S A;  4F4K A;  3AA2 A;  3FZM A;  2F9T A;  1U2V B;  2Y1I A;  5E26 A;  3V1O A;  4YOV A;  2A3Z A;  1A5W A;  4BRE A;  4CEA A;  2D5R A;  1NG9 A;  2LSN A;  2IVO A;  1N32 K;  2UYT A;  4CJQ A;  4CGJ A;  5FLX O;  3A5M C;  5AQQ A;  3AGR A;  5H1S Q;  1RBS A;  1RNH A;  1Q86 O;  4YFU A;  5DM6 L;  3V9X A;  3NF9 A;  4CFB A;  4JNE A;  4IO9 L;  3AA5 X;  4XH5 A;  3BEX A;  4FO0 A;  3GL1 A;  3MCA B;  4Q0B A;  3TAQ A;  1LOT B;  2FSJ A;  4GNI A;  1RFQ A;  3VEO A;  4HUE A;  4OKJ A;  2Q31 A;  2OPQ A;  1YTU A;  3UKR A;  3CD6 N;  3NF6 A;  4FXD A;  3QIP A;  1QHT A;  1JXB A;  4K25 A;  2GEM A;  2NRX A;  4IOA L;  2IAJ A;  1T7P A;  3DLG A;  3WXK A;  2GTD A;  3CCM N;  1QQC A;  4LF7 K;  3OYB A;  4N76 A;  1UAX A;  3A8Y A;  3VQ5 A;  4CZI A;  1VSJ A;  4FJL A;  2HND A;  1N34 K;  2EHG A;  1ZBU A;  4JKE A;  4JI6 K;  1SQK A;  1VQL N;  5JLF A;  4GKK K;  3CPW M;  4KH6 A;  3OYL A;  4BG8 A;  3CG7 A;  5EY4 A;  3H1Q A;  5AQR A;  3PSI A;  1RT4 A;  4DV1 K;  3K2P A;  2BAN A;  3O1B A;  2ZGY A;  3IG1 A;  4CED A;  1LAV A;  5ADX A;  4B9S A;  3MX5 A;  5HRS A;  4O5F A;  4DU3 A;  3MCP A;  1NBW A;  3ZT3 A;  1ESV A;  4A2B A;  4M3U A;  3ZT4 A;  5AQU A;  5BN8 A;  4FM0 A;  4DV0 K;  1Q7Y O;  1RBR A;  4HHT A;  1HR0 K;  1YAG A;  4IZ9 A;  1IV0 A;  1KVC A;  4RTF D;  2P9I B;  3LWM A;  3CCJ N;  4CFA A;  4FJK A;  3CJ7 A;  3K58 A;  2YV0 X;  4DTJ A;  2XY6 A;  3QNO A;  3CYM A;  4BRO A;  4YY3 K;  4KHP K;  3RR7 A;  3L2R A;  3AVI A;  3EYZ A;  4FLX A;  2UUB K;  1B9D A;  3HOT A;  4I2P A;  1Z26 A;  4FW1 A;  4YDU A;  1W2B M;  4BRP A;  4FJJ A;  4X66 K;  2KW4 A;  3FGU A;  3HVR A;  3LM9 A;  5CR4 A;  1Z25 A;  4F9O A;  1NGC A;  2NNW A;  2WFB A;  4N41 A;  4B9N A;  1YJW N;  1JCG A;  5AQG A;  3VQ6 A;  4PKI A;  4DKW A;  3DXK B;  3RMB A;  5CE3 A;  2OA8 A;  2YJE A;  1OH6 A;  3F5T A;  4BC4 A;  1WSG A;  3AGK A;  3SAH A;  2JLE A;  3DRP A;  3OVN A;  4DV4 K;  4AM7 A;  1YJ9 N;  5BRE A;  1NJZ A;  2YNF A;  4K8X A;  4FM2 A;  2G8H A;  4KHQ A;  1GLC G;  4RG8 A;  2P9S A;  3WT0 A;  1L5U A;  3DXM B;  3HPO A;  4I9L A;  3O1W A;  1NMN A;  1VSH A;  3U9D A;  3OJU A;  1Q82 O;  3DI6 A;  3NCI A;  3PX0 A;  4JI8 K;  1GLB G;  4Z0U A;  3SJH A;  1QQM A;  4DTP A;  2ASO A;  1BIS A;  4PY5 A;  2V52 B;  4Y0W A;  1GLL O;  3CJA A;  2HHH K;  4FJ7 A;  5EOY A;  3QB0 A;  2QWP A;  2W42 A;  5KGX A;  3J8A A;  3ZCM A;  4HTU A;  1Q9X A;  2VGN A;  5C2F A;  1HNZ K;  5JIC A;  3SUP A;  1JCE A;  4AHU A;  4CGG A;  1LAW A;  2OZM A;  3OYH A;  5JS2 A;  4E7L A;  1L3T A;  2KFZ A;  1KC8 O;  4CK1 A;  2P9I A;  1IKW A;  3KVG A;  5LMN K;  1RT2 A;  2QWO A;  2BGG A;  1DLO A;  4DSF A;  1BIZ A;  4BR9 A;  4CJ4 A;  3N4Q A;  3K0S A;  5AQY A;  4Z94 A;  3LDN A;  5KRS A;  4K0K K;  3DRR A;  3P1G A;  3RMA A;  2OTL N;  4BRI A;  5DK5 A;  2I5J A;  3IAY A;  4CJ3 A;  1EKE A;  5C24 A;  3D2E B;  4FPA A;  3KK3 A;  5GIP A;  5AJ3 K;  2HNY A;  1QS4 A;  2FBV A;  3M5R A;  3O9S A;  4CJS A;  2DFH A;  3QEW A;  3VGL A;  4AHS A;  3J7Z O;  2HMP A;  3U6F A;  1RT5 A;  4FWN A;  3L8B A;  4OO1 J;  4NXN K;  3C94 A;  3HST B;  3T3F A;  3GBT A;  4B3O A;  2WC9 A;  3V9U A;  3CJ9 A;  4M63 C;  1X9W A;  2JWL A;  4JKG A;  2V7Y A;  4BR0 A;  4NO7 A;  3HZ6 A;  1OH8 A;  4DR5 K;  4JD2 B;  1ZBS A;  4IXC A;  5M1F A;  3D6R A;  2OTJ N;  4LH4 A;  4BRH A;  1S22 A;  3TR8 A;  3VEX A;  1YI2 N;  1RT6 A;  3VQA A;  4JKA A;  3VQC A;  2B5J A;  3TAB A;  3CFR A;  3LDO A;  4O4G A;  3TAM A;  4F3O A;  1QTM A;  3AV9 A;  1BWF O;  3ZSY A;  3SPZ A;  3J7Y P;  4KI4 A;  1ZXO A;  1SL2 A;  4Z4G A;  1NK7 A;  2E2Q A;  1NMD A;  4EP4 A;  3T1H K;  4MDA A;  4IJA A;  1VQO N;  3R8E A;  4DFJ A;  3M8Q A;  3DLH A;  3BP8 A;  1B9F A;  4X65 K;  1M90 O;  1YIJ N;  1TKD A;  3LPT A;  4CE9 A;  3SAF A;  3SV4 A;  2WBN A;  3J7A P;  3OA9 A;  3KLG A;  4DSJ A;  3VMF B;  1R0A A;  1NNE A;  2DPN A;  3D7E O;  2ASM A;  2KZZ A;  4BGB A;  1UOC A;  3D2E A;  1KTQ A;  4Y1D A;  5SZT A;  3LP2 A;  3VQE A;  4DU1 A;  3AO5 A;  3FZL A;  3KWI A;  4FM1 A;  2KLA A;  2HVI A;  1WAJ A;  4M3T A;  1TV6 A;  3QDK A;  1HNV A;  2PBD A;  3OYF A;  3MAQ A;  4H0O A;  5FPM A;  2OZS A;  4ELU A;  4C8N A;  4FJI A;  5HRP A;  2UXC K;  2Q3S A;  4FWR A;  4BRN A;  5BRD A;  3FZK A;  4Z4F A;  3LDP A;  2XO7 A;  4OGC A;  2GX9 A;  2VG6 A;  4LH5 A;  3THY B;  3VET A;  4JD2 A;  1G99 A;  5M1K A;  3CCL N;  3W0L A;  1XC3 A;  3VES A;  3AAQ A;  4V19 S;  1W9H A;  4FWQ A;  1TGO A;  4FWM A;  3HPG A;  4CJV A;  1EQY A;  4O5B A;  4BRL A;  4H03 B;  3F73 A;  4CEF A;  3S41 A;  2A5X A;  4LD0 A;  3R9P A;  2BE2 A;  1KAY A;  2A41 A;  4BY9 C;  2QTD A;  3QML A;  3HK2 A;  4A5B A;  3TSP A;  2FSN A;  3AA4 A;  2F7T A;  1C0T A;  4N5S A;  5EU7 A;  4OX9 K;  1RDA A;  5JVG L;  4C8M A;  4KRF A;  4CF1 A;  1ATR A;  2A1S A;  4CZE A;  2WON A;  2F8T A;  2ZGZ A;  2BTF A;  4XEI A;  4FJ8 A;  1CXQ A;  1X9S A;  2HHW A;  3NMU A;  2V51 B;  4FCY A;  2HBM A;  5BN9 A;  2XY8 A;  4DWI A;  4YOW A;  3LP1 A;  3CXC M;  1HPM A;  3TTF A;  2PAV A;  3NE6 A;  1T03 A;  2ZWH A;  4LF4 K;  1L3S A;  3P5J A;  4E7H A;  4KKO A;  4B9U A;  4FSV A;  4DQS A;  1IBM K;  4JK7 A;  1T6C A;  2GEL A;  3EN9 A;  4BGA A;  3QBW A;  4M45 A;  3DLE A;  4X64 K;  3OS0 A;  2DY4 A;  2P5G A;  2P9P B;  2CGK A;  4CEQ A;  4M7X A;  2OPP A;  4FJ9 A;  2G8W A;  4W5O A;  1P8Z A;  2Z1H A;  5HOO A;  1T44 A;  3ZET B;  3HOS A;  5AQH A;  3PSF A;  4LC9 B;  4BRD A;  3HRG A;  3THY A;  2E1Y A;  4QOZ B;  4DFK A;  3THV A;  5C15 A;  4BRM A;  5AQL A;  3GE1 A;  3SQ0 A;  5B8H A;  2VWB A;  4DQR A;  3CCV N;  4ID5 A;  5BPL A;  2VWJ A;  1MWM A;  1RTI A;  3V6D A;  2YKM A;  3L0Q A;  5AZJ B;  1WUA A;  1WN7 A;  4XH4 A;  1DEJ A;  3VQ7 A;  1NOZ A;  1QSL A;  4CW7 B;  2HF4 A;  4CJT A;  3V81 A;  3LWL A;  4CF0 A;  4YNQ A;  1TUU A;  3BGR A;  3TAP A;  2P1J A;  1VHX A;  2F8S A;  2HOE A;  3EKS A;  4Z4H A;  3NH1 A;  2O8F B;  3FR0 A;  1VQM N;  4DTS A;  3R1X A;  1XMQ K;  4J2E A;  2NRW A;  3C6T A;  3TSQ A;  5EXW A;  3LZI A;  2F4V K;  3F2K A;  1JL1 A;  4CZH A;  3O6W A;  2PY5 A;  3DOL A;  4LF8 K;  1S3X A;  3PX4 A;  3TSU A;  3AVL A;  1JCF A;  5KPZ A;  4DR3 K;  1DTQ A;  3PO5 A;  4CJ7 A;  4IBN A; 
#chains in the Genus database with same CATH homology
 1GOA A;  1S1X A;  3CG7 A;  4CJE A;  3HM9 A;  4OLA A;  3PV8 A;  2HHQ A;  1CLQ A;  3U3Y A;  1BQN A;  3TAE A;  2PZS A;  3LZJ A;  2G8V A;  1WAF A;  4DLG A;  2YKN A;  4KB1 A;  1QSY A;  4FJX A;  1RT4 A;  1RT3 A;  1REV A;  1WLJ A;  4M41 A;  4CJK A;  3OS2 A;  2QKK A;  3K2P A;  2BAN A;  3C6U A;  4CEZ A;  5K14 A;  4B9S A;  3IG1 A;  1RCH A;  4CED A;  1LAV A;  5HRS A;  1WSE A;  1IO2 A;  1TKT A;  4DU3 A;  3ZT3 A;  3HJF A;  1KSP A;  4BAC A;  4KO0 A;  3ZT4 A;  3NGI A;  4M3U A;  4FM0 A;  4RW9 A;  2HNZ A;  1VSL A;  1RBR A;  1S1T A;  4CFC A;  4HHT A;  4BE1 A;  1Q9Y A;  3BDP A;  4TSX A;  4DSI A;  4ZTJ A;  5FRM A;  3RTV A;  2E4L A;  4E1M A;  2QK9 A;  1ZBF A;  4B8C A;  1KVC A;  3AVA A;  3LWM A;  1N5Y A;  1RBU A;  4DTX A;  4FJK A;  4CFA A;  4KRE A;  3WNE A;  4CHQ A;  3K58 A;  3WNG A;  2YV0 X;  1C0M A;  1WNS A;  4AHT A;  4OPJ A;  4DTJ A;  3SUQ A;  4CHY A;  3S3N A;  4PUO A;  2XY6 A;  3QNO A;  1NOY A;  2YHB A;  3CYM A;  2G8I A;  4FLV A;  3A2F A;  3RR7 A;  4ZHR A;  3AVI A;  5J1E A;  3L2R A;  3EYZ A;  4FLX A;  2XRI A;  4CJ5 A;  4DTN A;  3MEC A;  4OKK A;  1NJW A;  1B9D A;  4E0D A;  3B6P A;  4GW6 A;  5KTQ A;  1RTD A;  1UA1 A;  1ITG A;  1C6V A;  4B9V A;  4I2P A;  1Z26 A;  4FW1 A;  1D9F A;  4FJJ A;  1RTH A;  2Z1J A;  2KW4 A;  3M8P A;  3V9W A;  1CZ9 A;  1C1C A;  3HVR A;  3TAN A;  1Z25 A;  3ULD A;  1X1P A;  5FDL A;  1VRT A;  4N41 A;  3AVK A;  4B9N A;  4W5N A;  4DF8 A;  1JLB A;  2G8U A;  3VQ6 A;  4KI6 A;  2YNI A;  1HRH A;  3RMB A;  3SJJ A;  3KKR A;  3SNN A;  4OKE A;  3ZSX A;  1CXU A;  3K57 A;  3RMC A;  2OA8 A;  4NCA A;  2X74 A;  3PUF A;  1ZBH A;  4CHO A;  4M3X A;  3D0P A;  3IS9 A;  1WSF A;  1WSG A;  4IFY A;  1NJZ A;  2JLE A;  3DRP A;  3OVN A;  4NCG A;  3VQ4 A;  1YT3 A;  3LPU A;  1UA0 A;  4J2B A;  3HO1 A;  2YNF A;  3O4Q A;  4FM2 A;  1NK4 A;  3QES A;  2G8H A;  4K8X A;  4KHQ A;  1TKZ A;  4AH9 A;  4RG8 A;  4FJM A;  1BI4 B;  1HQU A;  3JYT A;  4CJL A;  4KFB A;  3O3F A;  4DS4 A;  1NK0 A;  1L5U A;  4KAZ A;  4FJG A;  4CHN A;  3HPO A;  3ASM A;  1IKX A;  3NFA A;  5HRN A;  4O0I A;  3SV3 A;  4PWD A;  5KI6 A;  4I9L A;  4FJN A;  3AVG A;  4H8K A;  1JLA A;  4CGI A;  3ALY A;  2GBZ A;  4CGF A;  3ZSW A;  4FLY A;  1VSH A;  3OJU A;  2IC3 A;  3DI6 A;  3T19 A;  3NCI A;  3PX0 A;  2D0A A;  2VWK A;  3L2V A;  2ZD1 A;  5CZ1 A;  1EET A;  2E6M A;  2KTQ A;  4Z0U A;  3L3U A;  1TL3 A;  4IG3 A;  2HVH A;  1N6Q A;  2GUI A;  4AHV A;  5FRN A;  4W5R A;  3TAR A;  3HPH A;  3KD5 E;  2E6L A;  3AVJ A;  4DTP A;  1GOC A;  2RPI A;  1BIS A;  4DS5 A;  2HHX A;  2ZQB A;  1YTA A;  4BDP A;  4FJH A;  3NF7 A;  4PY5 A;  1RBT A;  1A5V A;  3ZSQ A;  3ZSR A;  4FJ7 A;  3K5M A;  2YNG A;  3QEX A;  1HYZ A;  4ELT A;  1TK0 A;  2W42 A;  1S1W A;  5KGX A;  1ZBL A;  3ZCM A;  1NK5 A;  1HYV A;  4HTU A;  4DSK A;  3RWU A;  2IGI A;  1Q9X A;  3LDS A;  3AO3 A;  3AO2 A;  3QNN A;  5KRT A;  1TK5 A;  4QAG A;  4EZ6 A;  1IKV A;  4F3T A;  1HNI A;  3DLK A;  3LAL A;  3SUP A;  4AHU A;  4B9M A;  4CGG A;  3KLH A;  1LAW A;  2HB5 A;  2OZM A;  3OYH A;  5JS2 A;  4E7L A;  4CF8 A;  2ITG A;  1L3T A;  2HHT A;  2KFZ A;  3CFP A;  1NJY A;  4CK1 A;  3OYD A;  1Y97 A;  4KV8 A;  1IKW A;  2F96 A;  1LW0 A;  1RT2 A;  1C1A A;  4BDY A;  4DFM A;  2G8K A;  2BGG A;  1DLO A;  4CJR A;  3LAK A;  3MED A;  2VG5 A;  1B92 A;  1BIZ A;  1VSF A;  2B4J A;  1J9A A;  4CJ4 A;  1WSJ A;  4CF2 A;  5I42 A;  5HP1 A;  3K59 A;  1S9G A;  5KRS A;  3OJS A;  3I8D A;  3PY8 A;  3VA0 A;  3WNF A;  2DTU A;  4E3S A;  2Z1I A;  1SKW A;  3DRR A;  3P1G A;  3RMA A;  4OGE A;  4M3R A;  4DFP A;  4KHY A;  1VSI A;  5DK5 A;  2D0B A;  2I5J A;  3IAY A;  4CEC A;  1BL3 A;  3E01 A;  4CJ3 A;  4JS4 A;  3SI6 A;  3WNH A;  2IS3 A;  4DLE A;  1EKE A;  3AA3 A;  1O1W A;  5C24 A;  4DTO A;  3TAG A;  1CZB A;  4CGD A;  4DG1 A;  3KK3 A;  1D5A A;  1QSS A;  4CES A;  4DMN A;  2DFF A;  4E7I A;  1L3U A;  4CJF A;  3RR8 A;  4CHZ A;  4BWJ A;  2HNY A;  1QS4 A;  3O3H A;  2KFN A;  2FBV A;  1F21 A;  3SZ2 A;  1GOB A;  4HUG A;  1UWB A;  3DRS A;  4F8R A;  1RTJ A;  2DFH A;  4CJS A;  3QEW A;  4KB0 A;  4AHS A;  1BCO A;  3OY9 A;  3SPY A;  3JSM A;  4DSL A;  4OVL A;  5HBM A;  4W5Q A;  3U6F A;  1RT5 A;  2AJQ A;  3L8B A;  3PX6 A;  1LWF A;  4RW6 A;  3U3G A;  3K5L A;  1NK8 A;  1LV5 A;  1JLC A;  4NYF A;  2XHB A;  4PA1 A;  3DLR A;  4ZTF A;  3C94 A;  1RDD A;  3HST B;  3T3F A;  4B3O A;  1VSE A;  1S1V A;  4CF9 A;  1WSI A;  3FFI A;  3V9U A;  1X9W A;  3QO9 A;  4MFB A;  3H08 A;  1J5O A;  3AVB A;  2FBY A;  3NGY A;  2X6S A;  3HP6 A;  4IDK A;  4GVM A;  1XC9 A;  1EXQ A;  4CHP A;  3KJV A;  3SUO A;  2BDP A;  1LW2 A;  3VA3 A;  1WSH A;  2YHA A;  3VQD A;  5HRR A;  4ID1 A;  4BDZ A;  4FZZ A;  1NK6 A;  2X78 A;  5CY4 A;  4LH4 A;  4LY7 A;  1U45 A;  4W5T A;  1L3V A;  3RRH A;  4KHW A;  3TR8 A;  3CFO A;  2WOM A;  4FK0 A;  3SYZ A;  1ZYQ A;  1S6P A;  4FYD A;  1RT6 A;  4DSF A;  2O4I A;  3HP9 A;  3VQA A;  4JS5 A;  4UQG A;  3VQC A;  2B5J A;  3V9Z A;  3CFR A;  3TAB A;  3M8S A;  4DTU A;  1XHZ A;  4G1Q A;  3KLF A;  2G8F A;  4O4G A;  1RBV A;  3TAM A;  4F3O A;  1QTM A;  3RRG A;  3ZT1 A;  3F9K A;  1IG9 A;  3AV9 A;  3O3G A;  3G0Z A;  1T05 A;  3KLE A;  1KRP A;  2ZE2 A;  1W0H A;  3ZSY A;  4CGH A;  3SPZ A;  2RKI A;  1VSD A;  2R7Y A;  1BIU A;  4CIG A;  1EX4 A;  4C8L A;  4DQP A;  4CJU A;  4KI4 A;  1SL2 A;  3CM6 A;  4Z4G A;  4M3Z A;  3ISN C;  1NK7 A;  4FZX C;  4EP4 A;  5J2N A;  3VQQ A;  1S5J A;  3OYM A;  5T7B A;  3MXM A;  2B6A A;  3L2Q A;  1RIL A;  3M8Q A;  4DFJ A;  3NH0 A;  3QET A;  1NKC A;  2Z1G A;  3HXM A;  3DLH A;  1B9F A;  4GMJ B;  2FC0 A;  4RW4 A;  1KLM A;  1HJR A;  4FLT A;  3QEP A;  1TKD A;  4IKF A;  3LPT A;  4HCB A;  4CE9 A;  3SV4 A;  3G10 A;  1LWE A;  3M8R A;  3KLG A;  4DSJ A;  4B8A B;  1LWC A;  1R0A A;  3KD1 E;  4K8Z A;  2HW3 A;  2A1R A;  2KZZ A;  3ITH A;  3OS1 A;  1UOC A;  4FK4 A;  4Y1C A;  1EP4 A;  3KLI A;  1D8Y A;  3SCX A;  2OPS A;  1KTQ A;  4Y1D A;  3EZ5 A;  5SZT A;  4NYN A;  1KCF A;  5HLF A;  2XY5 A;  4ELV A;  3LP2 A;  4H4O A;  3VQE A;  3DOK A;  3AO5 A;  3NGZ A;  4DU1 A;  1XI1 A;  1JLG A;  3P83 D;  4FM1 A;  1U4B A;  4KPY A;  4KHU A;  4M3Y A;  2NUB A;  3QLH A;  2KZM A;  4WE1 A;  2IDO A;  1A5X A;  1KLN A;  2HVI A;  3HYF A;  4F2S A;  1WAJ A;  2EX3 A;  3O4N A;  1TV6 A;  4M3T A;  1HNV A;  3OYF A;  3MAQ A;  4DF4 A;  4E1N A;  5J2M A;  3L3V A;  3L2U A;  2OZS A;  3MXI A;  1SL1 A;  4HVJ A;  3V9S A;  2IOC A;  4ELU A;  2KQ2 A;  4C8N A;  4E7K A;  4AHR A;  4DQI A;  3ZSV A;  4I7F A;  5HRP A;  3V1Q A;  1NKB A;  4FJI A;  1JXE A;  2Q3S A;  2Y1J A;  3T1A A;  2PYL A;  2QXF A;  4DTM A;  5D3G A;  2RN2 A;  3HL8 A;  2HHV A;  3I0S A;  4E89 A;  3AO1 A;  4N47 A;  4Z4F A;  1JKH A;  3NHG A;  2XO7 A;  4OGC A;  2VG6 A;  5J2Q A;  4LH5 A;  5JS1 A;  3MXJ A;  4CFD A;  1VSM A;  1XWL A;  4HUF A;  1JL2 A;  1SKR A;  5C42 A;  3EY1 A;  1SL0 A;  1W9H A;  3OYI A;  4AIL C;  1TGO A;  4I2Q A;  1SKS A;  1S9E A;  3HPG A;  3LAM A;  1D9D A;  2OYQ A;  4CJV A;  4O5B A;  3QER A;  4CEB A;  4CJP A;  4XIU A;  4BE2 A;  1S6Q A;  4KHN A;  3F73 A;  4CEF A;  4KTW A;  3NDK A;  3S3M A;  1JLQ A;  1U04 A;  3VQP A;  4OJR A;  4LD0 A;  1TVR A;  4ICL A;  4FJ5 A;  4LSN A;  3NH2 A;  2BE2 A;  3MEE A;  4L8R B;  1U47 A;  3LAN A;  1TL1 A;  3HK2 A;  4E7J A;  4F2R A;  1C1B A;  2JGU A;  3AA4 A;  3QEI A;  1G15 A;  1C0T A;  3DM2 A;  3V1R A;  4N5S A;  3DLB A;  5EU7 A;  4B9T A;  1RDA A;  4Z4E A;  2X6N A;  4C8M A;  4CK2 A;  4E19 A;  4M42 A;  4KRF A;  1ASV A;  1J54 A;  3HT3 A;  4FLW A;  3AVF A;  3VQB A;  5HRO A;  5KGW A;  1QE1 A;  1XHX A;  3SUN A;  4CF1 A;  1BI4 A;  2FBT A;  1NJX A;  3MEG A;  4R5P A;  1TK8 A;  1BCM A;  4HCC A;  1MU2 A;  2D0C A;  3QIO A;  1U49 A;  5CZ2 A;  2A1S A;  1TAQ A;  4CEO A;  1TKX A;  2WON A;  3VN5 A;  1C0U A;  4CER A;  2F8T A;  4DTR A;  1BQM A;  3S9H A;  3B6O A;  4AHC A;  4LSL A;  4OPK A;  3OYK A;  4FJ8 A;  1CXQ A;  1RDB A;  1X9S A;  1X9M A;  2HHW A;  3KK1 A;  4IG0 A;  2XY7 A;  3VQ8 A;  4B9L A;  4JLH A;  3ZT0 A;  4JRP A;  2RF2 A;  4IFV A;  4FCY A;  5FRO A;  1RT1 A;  4OLB A;  1FKP A;  3AO4 A;  4CK3 A;  3I0R A;  3K5N A;  2XY8 A;  3QEV A;  2HHS A;  1DTT A;  4BWM A;  4DWI A;  3OYJ A;  4PQU A;  5J2P A;  3LP1 A;  3KK2 A;  3KTQ A;  3TAF A;  1ZBI A;  3NE6 A;  1FKO A;  3HVT A;  3OYA A;  1T03 A;  1L3S A;  4H4M A;  3P5J A;  4E7H A;  4B08 A;  1VK0 A;  1I3A A;  4MQ3 A;  4KKO A;  1BHL A;  1NKE A;  4DQQ A;  3IRX A;  3LP0 A;  4B9U A;  2P5O A;  1SUQ A;  3OYC A;  1T8E A;  4J2D A;  3L2W A;  4DQS A;  3VQ9 A;  4DU4 A;  5I3U A;  4O55 A;  3DYA A;  3ZSO A;  3NBP A;  3TWH A;  1FK9 A;  3AVM A;  4KTZ A;  4O0J A;  1JLE A;  2VG7 A;  1RT7 A;  5DMR A;  4FVM A;  2DFE A;  4Z4C A;  3SQ4 A;  1KFS A;  4M3W A;  4M45 A;  1HPZ A;  3DLE A;  3OS0 A;  3OYE A;  4KHS A;  4FLU A;  2DY4 A;  2P5G A;  3AVC A;  4NCB A;  4CEQ A;  1ASU A;  1KVB A;  2OPP A;  4CEE A;  4FJ9 A;  2ATQ A;  3LP3 A;  2G8W A;  4F4K A;  4Z4I A;  1BGX T;  4W5O A;  3AA2 A;  2Y1I A;  2Z1H A;  3V1O A;  1RDC A;  3KKS A;  1A5W A;  4FZY A;  2QKB A;  4CEA A;  2D5R A;  4CCH A;  2LSN A;  4FK2 A;  4QOZ B;  4RW8 A;  5CYQ A;  2O4G A;  4DFK A;  3THV A;  1J53 A;  3AVN A;  2HMI A;  1ASW A;  3SQ0 A;  3V4I A;  4CJQ A;  4BE0 A;  3D45 A;  1U48 A;  4CIF A;  4CGJ A;  4DQR A;  3RMD A;  4QCL A;  2OPR A;  1FXX A;  3CM5 A;  3KIO A;  4ID5 A;  1KVA A;  4RW7 A;  4EP5 A;  2VWJ A;  1RTI A;  1RBS A;  3NAE A;  1RNH A;  5E41 A;  3CQ8 A;  5CYM A;  3V6D A;  4YFU A;  3V9X A;  2YKM A;  3NF9 A;  1I39 A;  1S1U A;  4CFB A;  1VSK A;  3OYG A;  3SQ1 A;  4KTQ A;  1IH7 A;  3AA5 X;  3NF8 A;  1WN7 A;  3C95 A;  5C25 A;  1NK9 A;  4Q0B A;  3TAQ A;  3DMJ A;  3VQ7 A;  3SQ2 A;  4EZ9 A;  1NOZ A;  1QSL A;  3K5O A;  3ZSZ A;  4HUE A;  4C8O A;  4OKJ A;  3PO4 A;  2OPQ A;  1YTU A;  1KFD A;  2P51 A;  4CJT A;  3V81 A;  1Q8I A;  3LWL A;  3NF6 A;  4CF0 A;  4CIE A;  4YNQ A;  4FXD A;  2GV9 A;  3QIP A;  3BGR A;  1TAU A;  3QIN A;  4O44 A;  3S3O A;  3TAP A;  2P1J A;  3UIQ A;  4I9Q A;  2F8S A;  5SWM A;  1HQE A;  1QHT A;  1JXB A;  4Z4H A;  2PYJ A;  1SV5 A;  2IAJ A;  3NH1 A;  1T7P A;  3DLG A;  4C8K A;  4CJW A;  2YNH A;  2ETJ A;  1K6Y A;  1YVU A;  1QQC A;  4DTS A;  3AVH A;  4Q5V A;  4FW2 A;  3OYB A;  4N56 A;  4JRQ A;  4J2E A;  3C6T A;  3TI0 A;  4FLZ A;  1HMV A;  1JLF A;  3ZT2 A;  4N76 A;  3LZI A;  1HYS A;  1UAX A;  3VQ5 A;  1JL1 A;  1VSJ A;  4FJL A;  2PY5 A;  3DOL A;  2FBX A;  2HND A;  1VRU A;  3PX4 A;  1IKY A;  2EHG A;  1ZBU A;  4DSE A;  3AVL A;  1DTQ A;  3OYN A;  3PO5 A;  4J2A A;  2HHU A;  3OYL A;  4IBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...