2G8UA

B. halodurans rnase h catalytic domain d132n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8uA00
4FK0A 1FK9A 3KKRA 4HTUA 2VG6A 3K58A 1NKEA 2PZSA 3HSTB 4BE2A 3AVMA 1KRPA 4F2SA 4FK2A 2F8TA 4FYDA 3S3OA 5K14A 1TAUA 5T7BA 3AA2A 5DK5A 4KHNA 3LWLA 3SV4A 3VQDA 1LWCA 3DRPA 5KTQA 1SL0A 4FLTA 3HPOA 1QSSA 4LSNA 3QEXA 4J2AA 3DM2A 3OVNA 3L8BA 4BWMA 1BI4B 4CGHA 3LZJA 4KTZA 1KSPA 3KKSA 2PYLA 4FJ8A 3D45A 3ZSZA 1CLQA 5DMRA 4DSJA 4I9QA 3VQEA 3V1OA 4CK1A 3LP0A 4E1MA 3KIOA 1ZYQA 1VSKA 3ITHA 4HUGA 4OVLA 4WE1A 3L2VA 3TWHA 4EZ6A 1JLQA 1YTUA 4F4KA 1S5JA 4O0JA 4Y1CA 4DQRA 4CJUA 1ZBFA 3NH0A 4B3OA 5C42A 1KVAA 4CJKA 3FFIA 1EX4A 4DTMA 2HHVA 1RBTA 3L2UA 2B6AA 3F73A 2YKNA 4ZHRA 1ZBIA 1TGOA 3ZSYA 3AVAA 2OZMA 3QIPA 2I5JA 3V9ZA 1BCOA 2YNIA 2KQ2A 3ZSVA 3I0RA 3OJUA 4OLBA 2IGIA 1JLAA 3O4QA 4KI4A 3PX0A 3T3FA 2HW3A 3WNEA 3QESA 4CCHA 1RNHA 1TKDA 4CFDA 3HXMA 4DSEA 2W42A 1YVUA 1BQMA 4CK3A 4CFCA 4CHNA 3OYBA 1TK8A 4M3ZA 3DMJA 1JLEA 3VQ8A 1NJZA 1B9FA 3AVBA 4RW9A 3O3FA 1QQCA 1C1AA 1Z25A 3B6OA 4FJMA 3L3UA 4LSLA 4C8OA 3RRGA 3LZIA 4DF4A 4E0DA 3WNHA 4C8KA 2HNZA 4DFJA 1HJRA 1T05A 3G0ZA 3EZ5A 3PO5A 4I2PA 1VSIA 4RW7A 3V6DA 4FJKA 1GOBA 3DLRA 5CZ2A 4C8MA 4EP4A 4O5BA 5J2NA 4M3UA 5CYQA 3OY9A 5I42A 1X9WA 2D5RA 3VQ5A 3V4IA 3OYFA 3QNOA 3ZT0A 1X9MA 4F8RA 4OKEA 4CJFA 1I3AA 3DI6A 3IS9A 3NGYA 3TABA 4IG3A 3ZSOA 4N5SA 2G8IA 4KRFA 2HHWA 5KRSA 4CJRA 4M3TA 3ZSXA 3DRRA 4M41A 1IKXA 1U45A 4FJ7A 1CXUA 1U4BA 1BI4A 3ZCMA 3M8RA 4E7KA 2YHBA 1HQUA 4MFBA 4M3RA 4R5PA 3U3YA 4CF1A 4NYNA 3LP3A 1J53A 3M8SA 1N6QA 1LAWA 1X1PA 4CHZA 1XI1A 1N5YA 2HNYA 1W0HA 2IDOA 4HCBA 5JS2A 1RTJA 1RTIA 4HUFA 4DU4A 1TK5A 3KK2A 4HHTA 2P5OA 2XO7A 1BGXT 1I39A 2XY5A 1D8YA 4KHWA 3SZ2A 4DQPA 2G8KA 3NHGA 4FJ9A 4FJ5A 4Z4FA 1ASUA 3VQ9A 4CJWA 2HHXA 3SV3A 4CECA 4CESA 2G8VA 1EETA 2IAJA 1C0UA 4CJ4A 3MECA 3C6UA 4AH9A 2X6NA 2YNGA 3CG7A 4H4MA 4B08A 4CF2A 1J9AA 1U49A 2AJQA 4CJLA 2Q3SA 3KK3A 4KKOA 4PUOA 3AVLA 4CHYA 3EYZA 3BDPA 4DWIA 1JLBA 3NE6A 1UAXA 3KLFA 4KPYA 2HVIA 4DSKA 4OPJA 1FKOA 3NGIA 3SQ1A 1JLFA 4C8LA 3OYJA 3TAEA 1C0MA 1CXQA 3ZSWA 4ELVA 4DTOA 4E7JA 2YKMA 4AHCA 1RTHA 1RDBA 3LPTA 1F21A 4DLEA 4O4GA 4Z0UA 1C1BA 3TI0A 3DRSA 3SPYA 4O0IA 1JLGA 5J2QA 4OGCA 4FLWA 5FRNA 2B5JA 3VQBA 1EXQA 4DG1A 4DU1A 4FJNA 5CZ1A 3HT3A 1HYSA 5CYMA 4OKKA 1XC9A 2D0AA 1IG9A 4ELTA 4W5TA 2XHBA 1RILA 4N76A 1JL1A 1S6QA 3CFRA 3TAGA 2JGUA 2HHSA 4DQQA 4CEOA 3NBPA 2OPSA 4BE0A 2P1JA 3L3VA 4IFVA 2YNFA 1HRHA 3P5JA 4J2EA 2IC3A 3ISNC 2B4JA 4OJRA 1UWBA 1WSFA 2ETJA 4DU3A 3RMDA 3MAQA 1UA0A 1VSLA 2E4LA 1A5VA 4F3OA 4AHTA 3QETA 2FBXA 2FBYA 5HRSA 4DTUA 3RMAA 4B9NA 1NK0A 1VSFA 1WAJA 3ZSQA 1REVA 2D0CA 3K59A 2VG5A 3KTQA 4C8NA 4FM1A 4RW6A 4DQSA 4FLYA 4FM0A 4FJIA 1VRTA 4CHOA 4LH4A 3ALYA 5D3GA 3VQAA 4JS5A 5FRMA 1TVRA 2O4IA 1BIZA 4J2DA 5SZTA 1KLNA 3VQQA 4AHUA 3VQCA 1KTQA 4HUEA 2YV0X 3L2RA 3V9WA 3LDSA 3SUQA 1BQNA 1SL2A 3O3HA 2Z1JA 2FBVA 2OPQA 4DMNA 3O4NA 3T1AA 1TAQA 2A1SA 4CEQA 4CGJA 2WOMA 4CJTA 5KGXA 1S9EA 4DTSA 1RTDA 4KB1A 2G8FA 3AO1A 3SUPA 4FVMA 4FXDA 5FROA 3QEPA 4M3WA 3OYNA 1VRUA 2RPIA 1WSGA 1SKSA 4Q5VA 2X78A 3CFOA 3JSMA 1VSEA 2KW4A 3MXIA 2VWKA 3V9SA 1RBUA 2Y1IA 4ID5A 3CFPA 3ULDA 4MQ3A 1ZBHA 4K8XA 4RG8A 1UOCA 3CM6A 3CM5A 3G10A 4FCYA 1Q9XA 2XY7A 3NF7A 4CGGA 2ZE2A 4HVJA 2ATQA 4J2BA 4DS5A 1HQEA 1S1WA 4B9LA 3ZT4A 3RTVA 1NOYA 1RT3A 4EZ9A 3C95A 3DLKA 3VQPA 4DSIA 2HNDA 4CJ3A 4CHQA 4O44A 4B8CA 1JKHA 3HVTA 3IRXA 2OPRA 5J1EA 4CF8A 2X6SA 1GOCA 3WNFA 5SWMA 3VN5A 3DOKA 1HPZA 2E6LA 4CEBA 3KK1A 3K5MA 4RW4A 4BDZA 4FJJA 3HYFA 4KHUA 1W9HA 4CEDA 4W5NA 4DSLA 4EP5A 1VSMA 1HNIA 1D9DA 4CFBA 3OYHA 1RT1A 1BIUA 1SUQA 3DYAA 5HRNA 1T03A 2IS3A 3O3GA 3MEDA 2DFHA 4Z4EA 3OS2A 3QEVA 1SKWA 4Z4HA 4QAGA 2Z1GA 3PX4A 4KTQA 2F8SA 1SL1A 2BE2A 4KO0A 3CYMA 3LANA 4CGFA 4CF9A 4B9MA 2X74A 3SCXA 3OYGA 1T8EA 1S6PA 3KLIA 1RDDA 4B9TA 4FLXA 1IKVA 1NOZA 4L8RB 2BANA 2A1RA 5I3UA 1RDAA 4DS4A 1IH7A 4CGIA 1IKYA 4N47A 4IFYA 1S1VA 1U47A 3KLEA 1WSJA 3AO4A 4ICLA 4CEZA 4KHSA 1RBRA 3QLHA 3DLBA 2OZSA 3HP6A 3A2FA 1C1CA 1B9DA 1XHXA 2QK9A 4PQUA 4JRQA 3OS1A 1RCHA 3KD1E 1U48A 2P5GA 4FW2A 2KTQA 3TAQA 4CJ5A 3AVHA 4KFBA 4AILC 2XY8A 1CZBA 3V1RA 1BCMA 1CZ9A 3PO4A 4TSXA 1NJWA 1NKBA 1S1TA 3TAMA 4FZYA 4E7LA 3THVA 3SQ4A 3K5NA 1QS4A 4JS4A 4CIEA 4KB0A 3LPUA 4ZTFA 5E41A 4E89A 4FJLA 2OPPA 5J2PA 1ASWA 3KD5E 2KZZA 4FLVA 1IKWA 4CEFA 4CE9A 1L3VA 4B9UA 4CEAA 1S9GA 4AHRA 4M3YA 3U6FA 3LP1A 4CERA 4H4OA 3NFAA 4FLZA 4E3SA 1Y97A 2ZQBA 3LAKA 4DTNA 4I9LA 4PY5A 2RF2A 3K57A 1NJXA 1L3SA 2HVHA 4LY7A 4BDYA 4F3TA 2EHGA 3AVKA 4H8KA 4KTWA 3NH2A 3S9HA 5CY4A 1IO2A 3TARA 3QEWA 4F2RA 2QKKA 1JLCA 2DFEA 2NUBA 3ZT3A 3RR8A 4GW6A 4CJEA 3NAEA 1ASVA 1NK9A 3JYTA 3RWUA 2RKIA 1BISA 2R7YA 4ZTJA 3LALA 4KHYA 4FLUA 2HHUA 1FKPA 1LAVA 1L5UA 1O1WA 1NK5A 5EU7A 1R0AA 3IG1A 3WNGA 1VK0A 3AO2A 3H08A 3OYMA 2KFNA 3KJVA 3V9UA 2YNHA 1WSIA 4CJSA 1KVBA 1BHLA 1NK4A 1QSLA 4OPKA 3AVFA 5HP1A 4BACA 2LSNA 1DLOA 3SQ2A 3I0SA 4CEEA 2O4GA 1SV5A 3NF6A 3LAMA 2P51A 2Z1HA 4UQGA 4AHSA 3HM9A 1UA1A 4FZZA 4CJVA 3OYCA 3NCIA 2VWJA 3NF9A 4E7IA 4FZXC 2Y1JA 1RT6A 3VQ7A 1D5AA 2ITGA 3QIOA 1TL3A 1QHTA 1WNSA 1VSHA 4BWJA 3PY8A 4N41A 3B6PA 5C24A 4M42A 3AVGA 4LD0A 1NK7A 4O55A 3DOLA 3ASMA 2PYJA 4KREA 1DTTA 4IBNA 1EKEA 3AV9A 4G1QA 3PUFA 1RT7A 1TKTA 4RW8A 4CFAA 1RT4A 2Z1IA 3SPZA 3AA5X 3C6TA 1JXEA 2D0BA 4YNQA 1J54A 4FJXA 3K5LA 4DFPA 4B9VA 3OYIA 4JLHA 1D9FA 1HMVA 1RDCA 1HYZA 4M45A 4CJQA 3HPGA 1TKXA 3AA3A 4W5OA 3SJJA 4KI6A 4CGDA 4Z4IA 1QSYA 5KGWA 2ZD1A 4KAZA 3AVNA 3V1QA 1NK6A 2F96A 1TKZA 3OYEA 3HL8A 1KVCA 1WAFA 3RMCA 1KLMA 3AVCA 4I7FA 3SQ0A 3MXMA 4OKJA 2QKBA 4W5QA 1RT5A 3VQ6A 4IKFA 4DLGA 2JLEA 4Z4GA 4E19A 2HHQA 4FJHA 4M3XA 3TR8A 1RBSA 1KFDA 1RBVA 4IG0A 1LWFA 3VA3A 3SI6A 1ZBUA 1T7PA 1QTMA 1MU2A 3D0PA 4Z4CA 4CK2A 4B9SA 3S3NA 3HO1A 4QOZB 3IAYA 1HNVA 3HK2A 4NYFA 2G8HA 3OYLA 4LH5A 3V9XA 3QINA 4I2QA 1DTQA 2EX3A 1C6VA 4CHPA 3UIQA 5C25A 4YFUA 4W5RA 4DTPA 1HYVA 3RRHA 3U3GA 5HBMA 2YHAA 2XY6A 1WN7A 4FW1A 3AVJA 1ITGA 1A5WA 1QE1A 2WONA 3KLHA 1TL1A 4QCLA 3OYDA 2KFZA 3KLGA 1S1UA 4DQIA 1NK8A 3HP9A 2GUIA 3RR7A 4K8ZA 1B92A 1JL2A 4FK4A 3OS0A 3DLHA 2GBZA 1LV5A 3F9KA 3MEGA 4B8AB 1NJYA 4DTJA 2BDPA 4NCGA 3L2QA 1XWLA 1TV6A 3NDKA 1K6YA 2HB5A 3P83D 3P1GA 5FDLA 4NCBA 3ZT2A 3NF8A 3QERA 1WLJA 3SUOA 3E01A 2GV9A 3QO9A 3MXJA 1KCFA 1X9SA 3QNNA 4XIUA 3LP2A 3K5OA 4AHVA 4KV8A 1C0TA 3PX6A 2HMIA 3C94A 1JXBA 3SYZA 3SUNA 1S1XA 4NCAA 3AO3A 5HRPA 4DSFA 3AO5A 4DTXA 3NH1A 1U04A 3ZSRA 3TANA 3S3MA 1LW2A 3QEIA 3I8DA 4OGEA 2XRIA 3M8PA 3OYAA 3OJSA 4FM2A 3AVIA 3BGRA 5HRRA 4DF8A 3HJFA 1ZBLA 4PA1A 1YTAA 1L3UA 3LWMA 2KZMA 5JS1A 4GVMA 1Q9YA 5KRTA 2DTUA 3NGZA 2DFFA 1BL3A 2BGGA 3TAPA 2RN2A 3L2WA 3ZT1A 5KI6A 3PV8A 4HCCA 5J2MA 1LWEA 2OYQA 1A5XA 3SNNA 3AA4A 2HHTA 1KFSA 1VSJA 2QXFA 4BE1A 1J5OA 4GMJB 2FBTA 1RT2A 3T19A 1EP4A 3HVRA 4Y1DA 1NKCA 4CF0A 4CIGA 3VA0A 3V81A 3M8QA 1L3TA 1Z26A 4IDKA 3DLEA 1FXXA 2VG7A 3MEEA 4DFMA 4DTRA 4KHQA 3EY1A 1SKRA 3VQ4A 4JRPA 2DY4A 1VSDA 3TAFA 1WSHA 4CIFA 5HROA 2OA8A 1GOAA 2E6MA 4N56A 5HLFA 4FJGA 2G8WA 4ID1A 1WSEA 3OYKA 2PY5A 4PWDA 3K2PA 3RMBA 3CQ8A 1XHZA 1LW0A 1G15A 2G8UA 2FC0A 4CJPA 4E1NA 3DLGA 4BDPA 4ELUA 2IOCA 1Q8IA 4DFKA 4E7HA 4OLAA 1TK0A 3HPHA 1YT3A 4Q0BA
chains in the Genus database with same CATH superfamily
2HBJA 4KBOA 3JS6A 3VEOA 4HTUA 4FYDA 5K14A 3A0IX 3SV4A 3VQDA 4JI3K 1LWCA 2JWLA 4JKEA 3SAFA 2GWKA 3O6WA 4GY2B 3OVNA 3L8BA 4BWMA 1BI4B 3LZJA 4XH5A 2FSJA 2WUSA 3O8MA 4X66K 2ZM6K 3ZSZA 3O1BA 3V1OA 2P9PA 3ZLJA 1M90O 4HUGA 4OVLA 3ZETB 5BR9A 5EXWA 4DR5K 4LFCK 5HOOA 5FPNA 4K42A 4B3OA 1NMDA 4CJKA 2VQFK 1CZAN 1RBTA 3QIPA 2I5JA 3QBWA 2NRHA 1JLAA 1P8ZA 2YCHA 3PX0A 1JCGA 3VEVA 2HW3A 2IIRA 4CFDA 3E66A 3HXMA 2W42A 4CHNA 5AQUA 3C65A 3KHYA 4DFJA 3J81O 3CQXA 4JKGA 3UB5A 1K8KB 5AQFA 3TSQA 3V6DA 1X9WA 1ATNA 3ATUA 3SJHA 3ZT0A 3AGRA 5EX5A 4N5SA 3QFUA 4CJRA 4M3TA 1FJGK 4FJ7A 4FPBA 2J4RA 3MWPA 4M3RA 1NGAA 3LP3A 1J53A 5AQYA 1W0HA 4H0VB 1RTJA 5AQTA 4BRDA 1TK5A 2W41A 3IFRA 3KK2A 1NBWA 1BG3A 5CR4A 3SZ2A 4CJWA 2G8VA 4BRFA 3MECA 2YNGA 3CG7A 4H4MA 2BUPA 3HSCA 3TSUA 1U49A 4CJLA 2RHKA 2Q3SA 4PUOA 4B1XB 2HVIA 3NGIA 1JLFA 3F2KA 1C0MA 1CXQA 2QI2A 4FWPA 1RDBA 3LPTA 3RSEA 3TI0A 4YORA 3I56N 5J2QA 3CD6N 4DU1A 4JKAA 4W5TA 4YOUA 3UKUA 1RILA 4N76A 3NBPA 2P1JA 3OBWA 3L3VA 4BRQA 3H46O 2YNFA 5HL7L 3P5JA 4RCHA 4DU3A 4KREA 3HZ6A 5M1FA 4F3OA 3QETA 4B9NA 3S41A 1VSFA 1WAJA 5AQSA 2D0CA 3ZSQA 3SK3A 1K73O 4FJIA 4CHOA 4PHTX 3ALYA 4GNIA 4JS5A 2O4IA 4RTFD 2Q0RA 4WQ5A 3E9PA 4CBUA 3VF2A 3SUQA 3O3HA 1OH6A 5E41A 2OPQA 4DMNA 4EIAA 3T1AA 2PY5A 4CGJA 3SUPA 3G6EN 1JCFA 3ULEA 3OYNA 4BR0A 2HOEA 2FXUA 3O9SA 2VWKA 4ID5A 3AGKA 5AQVA 3CM5A 4DV5K 2VWBA 4MLEA 4CGGA 4HVJA 2ATQA 1S1WA 4R79A 2FF3B 4IDHA 3ZT4A 4A57A 3RTVA 1NOYA 3EEQA 1RT3A 4EZ9A 3C95A 2HNDA 3AAPA 4DR4K 3KWGA 4H5WA 1JKHA 3IRXA 4B8CA 2X6SA 3KK1A 3SLCA 1W9HA 4H5NA 3UKUB 1HNIA 1D9DA 2ZJRL 4CFBA 1SUQA 3BEXA 3MEDA 4JI1K 2DFHA 3B8AX 4YDUA 3J7AP 3MX2A 5AZJA 1SL1A 2VYPA 4B9MA 2X74A 4JHDB 1T8EA 1XC3A 4B9TA 5AR0A 2A1RA 1RDAA 2F4VK 4AF1A 4IFYA 4FL9A 1YJNN 3THYA 4ICLA 3QLHA 4NLBA 3HP6A 3N4PA 1XHXA 4JRQA 1VQ9N 4FW2A 3ID6A 4YY3K 3C7NB 5EVZA 3AVHA 4AILC 3V1RA 4FZYA 4JS4A 1QS4A 2OPPA 3O5BA 4QS8A 2KZZA 4CEAA 1S9GA 3CCRN 3LP1A 4H4OA 3NFAA 1Y97A 2ZQBA 3LAKA 2RF2A 4BQZA 1L3SA 3MN6A 2EHGA 1NJIO 3S9HA 1VAZA 3QEWA 4JI8K 4F2RA 4BG8A 1JLCA 4LF5K 4K25A 4NLCA 3PSIA 3EE8A 4JK7A 1NGCA 3FZFA 4ZTJA 3LALA 2NRZA 4FLUA 2HHUA 4JKBA 4DV2K 1VQ7N 3OYMA 2KFNA 1T3VA 2YNHA 1NK4A 1KAXA 3DXKA 5HP1A 4CCHA 1SV5A 3NF6A 4AHSA 4IEEA 4CJVA 3OYCA 3CC7N 4WQ4C 4ISGA 3FLCO 5KQ8A 2VWJA 4FZXC 1T6CA 1RT6A 1D5AA 2KKZA 1WNSA 5C24A 3DJCA 3CJ1A 1GLEG 1VQPN 1NK7A 4O55A 2FSNA 1Q86O 3VTIA 1DEJA 3VGLA 1GLFO 1TKTA 3SPZA 1NGEA 4I6MA 1HKGA 3K5LA 3TTCA 3OYIA 1FW6A 1HMVA 1RDCA 4IOCL 4M45A 4CJQA 4W5OA 3AA3A 3SBTA 4CGDA 1Y64A 3AVNA 3V1QA 1IBLK 3OYEA 2O8CB 3RMCA 1KLMA 2QKBA 2CGLA 5BPMA 2GEMA 4IKFA 3BY5A 5JLHA 3D2EA 2O8EA 4M3XA 4LC9B 1T7PA 1ZBUA 3D0PA 4QOZB 5BRHA 1GLDG 1V4SA 4NYFA 2DPNA 3V9XA 5LJVA 4I2QA 4M7XA 4YFUA 2NLXA 2XY6A 4FW1A 3AVJA 1A5WA 2WONA 2YHXA 3QDKA 1TL1A 3OYDA 5M1PA 2P9NB 5FPEA 5A2QO 1B92A 3OTOK 4WQ5C 2BDPA 1VQ5N 3MN7A 5TKYA 3L2QA 1XWLA 1TV6A 3P83D 4Z94A 3P1GA 5FDLA 3JXUA 4B1YB 3ZT2A 3NF8A 1QQOA 1WLJA 3E01A 2QWRA 3MXJA 1KCFA 1HKBA 3QNNA 4KV8A 4AM6A 3PX6A 2CGKA 4NCAA 3S3MA 3WXMB 3NH1A 4I6MB 3ZSRA 2I7NA 3CXCM 4OGEA 2XRIA 1YAGA 3AVIA 1I94K 2P9LA 3L4IA 4L3QA 2O8DA 5AQGA 1OH8A 4DV4K 4GVMA 1Q9YA 3O9QA 3NGZA 3CCSN 2BGGA 4LF6K 2GWJA 1LWEA 3AA4A 1VSJA 4BE1A 4DV6K 4MLHA 1RT2A 1EP4A 4CF0A 4CIGA 4MO5A 3VA0A 3QICA 3I55N 1ILYA 1QQNA 3TSPA 1WSHA 4FJGA 5HLFA 4PWDA 1U6ZA 3F9MA 4JD2A 1T6DA 4CJPA 4B3TK 1BU6O 5FLXO 3O4WA 2F8TA 4FK0A 2A3ZA 3KKRA 3K58A 1NKEA 4BE2A 1BUPA 1KRPA 4F2SA 1H1VA 1TAUA 2YI1A 5FPDA 3AA2A 5DK5A 4KHNA 2W6KA 1DKGD 3PLAA 3LWLA 5EY4A 5KTQA 1SL0A 3HPOA 3T7ZA 3QEXA 4KTZA 1YIJN 1KSPA 3KKSA 4YOYA 3HRGA 4EHUA 4DSJA 2O8DB 4IO8A 2HHHK 3BF3A 4E1MA 3KIOA 1ZYQA 1VSKA 3ITHA 4BR7A 4H03B 3G25A 3TWHA 4EZ6A 2IVOA 5AQQA 4O0JA 2RE2A 4CJUA 1ZBFA 1WUAA 5GIPA 5C42A 1KVAA 1EX4A 4DTMA 3MWTA 3QBXA 5AQJA 3F73A 2YKNA 4CZJA 4BC2A 1TGOA 3ZSYA 5DM7L 1BCOA 2KQ2A 3I0RA 4KI4A 1V4TA 3T3FA 3WNEA 3QESA 4GKJK 1RNHA 4LF9K 1BQMA 1TK8A 5AQKA 3VQ8A 4IZ9A 1QQCA 1C1AA 4JD2B 1Q82O 3B6OA 4FJMA 3L3UA 4BC4A 4DF4A 2HNZA 4O8UA 3G0ZA 3EZ5A 4C8MA 5J2NA 5CYQA 3WQTA 1OVQA 4BVOA 3OYFA 3QNOA 1X9MA 4OKEA 3NGYA 3IS9A 1OKJA 2G8IA 3ZSOA 4KRFA 3EE9A 2QWOA 3ZSXA 1U45A 1U4BA 1BI4A 2CGJA 5CHIA 4E7KA 3H1VX 1HQUA 1EWRA 4MFBA 4R5PA 4CF1A 4NYNA 1N6QA 4CHZA 2HNYA 4HUFA 2EWSA 4BRMA 1BGXT 4H5TA 1D8YA 2XY5A 3OA9A 2G8KA 5AQHA 5FPMA 4FJ5A 3VQ9A 4CESA 1EETA 3E9LA 4B08A 2P9UB 4CZIA 4MO4A 2I7PA 3AVLA 4CHYA 1VQ4N 3EYZA 3FGUA 2HF4A 3FZKA 4DSKA 4CZHA 4OPJA 1FKOA 1ZXOA 4C8LA 1KQSM 3J8AA 3THXB 4ELVA 4E7JA 2YKMA 4AHCA 3OBYA 4Z0UA 3WQUA 1C1BA 1JLGA 4FLWA 5FRNA 4B1UB 2UXBK 5CZ1A 3HT3A 1HYSA 1K8KA 4OKKA 1IG9A 5AQNA 3TAGA 2JGUA 4DQQA 4IJAA 4CEOA 4BE0A 4A2AA 5M1KA 4J2EA 2B4JA 1P90A 1WSFA 3RMDA 3TPQA 2E4LA 4AHTA 2FBYA 5M1OA 5HRSA 4DTUA 1DT9A 1SS6A 3Q7BA 1WBBA 4H0TB 4X64K 1NK0A 3K59A 5M1NA 2VG5A 5CE3A 3LL3A 4DQSA 4FLYA 1VRTA 5D3GA 1TVRA 4FWRA 2F9WA 1KTQA 5GIOA 1HUXA 2YV0X 2Z1JA 4NB4A 4J2DA 1TAQA 2A1SA 2WOMA 5KGXA 2P9IB 2E8AA 5FROA 4M3WA 1HLUA 1WSGA 5I9EB 3VERA 1XMQK 1YXQA 2GELA 4FVUA 3MXIA 3GG4A 3V9SA 2Y1IA 1N33K 4K8XA 3MX5A 4FCYA 5ADXA 1JJ2M 1HJOA 4J8FA 5JLFA 3H3NO 4DS5A 2PFUA 1HQEA 3H45C 3LDNA 4AM7A 3VQPA 1N8RO 4CHQA 4O44A 5J1EA 3HVTA 2HMIA 2OPRA 3VN5A 2E6LA 4FOEA 4H5RA 2V51B 4FJJA 1E4FT 5AQPA 4W5NA 4DSLA 4EP5A 1QHAA 1E4GT 1RT1A 5HRNA 1N32K 5GAEP 2IS3A 2QEXN 4Z4EA 3CJ9A 3OS2A 4Z4HA 1HNWK 3P39A 2YHYA 1XMOK 5KQDA 4CGFA 3LANA 3VPZA 3OYGA 3TTFA 1NOZA 5I3UA 4CZFA 1MDUB 3EZWA 3ZX0A 3U9ZA 4KHPK 3KLEA 4CEZA 1RBRA 3VGMA 2D0PA 1C1CA 5AJ3K 1RCHA 2FSKA 5KPZA 3TAQA 2Q1NA 4CJ5A 3ATVA 2W6LA 2XY8A 1CZBA 3PO4A 1NKBA 1S1TA 3THVA 3SQ4A 4CIEA 4KB0A 4FPAA 3ZEUB 2E2QA 1ASWA 1BA1A 4F9OA 3C6AA 1QVGM 3D7EO 3U6FA 4M63C 4E3SA 5AQIA 4DTNA 1NJXA 2HVHA 4DUYK 2P9KA 3AVKA 4H8KA 5CY4A 1IG8A 2DFEA 3ZT3A 2AP1A 3NAEA 1NK9A 3JYTA 3RWUA 1NWKA 2D4WA 3DXMA 3KWIA 4JAXA 4K41A 2WBNA 4BR4A 1O1WA 3I33A 1NK5A 1WBDA 1R0AA 4FOIA 3P31A 3VENA 4H0XB 1QSLA 2Q2RA 3BUZB 2YJFA 3AVFA 4BACA 2YX6A 3TU5A 3SQ2A 2NNWA 2O4GA 4JHDA 4UQGA 1UA1A 4E7IA 4X65K 5BN9A 1TL3A 2UUBK 1VSHA 4IXCA 1BA0A 1DGKN 4ISFA 3MMVA 3DOLA 3NMUA 2PYJA 3FZHA 4BQLA 3AV9A 4RW8A 4CFAA 1K8AO 3R9PA 1JXEA 3C7NA 2D0BA 4YNQA 2QWNA 1BOTO 1IBMK 4DFPA 1HYZA 2ZJQL 2A40A 3HPGA 1TKXA 4Z4IA 1QSYA 5KGWA 1NK6A 4BR9A 1KVCA 1WAFA 5LY3A 4JN4A 4OKJA 4W5QA 4HTLA 4E19A 5F1XA 4IG0A 3VA3A 4DV3K 2P9KB 1C0FA 3OHRA 4DR7K 4B9SA 3S3NA 3HO1A 5E84A 3OYLA 3QINA 1NGJA 4A61A 4CHPA 4KH4A 3DXMB 1NGIA 4DTPA 3VMFB 3RRHA 2UXDK 4B1VA 4DQ8A 3U3GA 5JICA 2YHAA 3R8EA 1WN7A 1YUWA 3WXIA 4WFAL 2E5LK 1NK8A 3RVCA 2GUIA 2VQEK 4FK4A 4BGAA 2W40A 4DTJA 4DUZK 1ZBSA 4IFEA 4CZLA 5BN8A 2FLOA 3CCMN 4FWNA 3QERA 1O13A 3TTDA 4JI4K 4WF9L 4JV5K 4WFNL 1C0TA 3CETA 3SUNA 3GOIA 3QEIA 3I8DA 3OJSA 2KHOA 4FWOA 3HJFA 1RGIA 5HRRA 4DF8A 1NNEA 2O8CA 1YTAA 2KZMA 2QXLA 3WXLA 2DFFA 2RN2A 1QQMA 4HCCA 2OYQA 3W0LA 1KFSA 1HKCA 2QXFA 4JKDA 4GMJB 1IBKK 4YOWA 3HVRA 1NKCA 1KAZA 1X3MA 2Q0UA 3CJ7A 3L4QA 1VQON 1L3TA 4KHQA 4DTRA 4JRPA 2E20A 2WC9A 4BRCA 4CIFA 4N56A 4V19S 3O9TA 4H0OA 3K2PA 3HOSA 3CQ8A 3L6QA 2P9NA 2IOCA 4DFKA 4E7HA 4OLAA 1OH7A 3HPHA 1NGFA 2PBDA 4ILJA 1KAYA 4U7BA 4DKWA 2PZSA 4LFAK 3HSTB 3AVMA 2IVPA 5JMVA 3S3OA 4OPAA 3DRPA 1QSSA 1M1KO 4LSNA 1TUUA 3EO3A 2UUAK 4CGHA 3FZLA 3D45A 4BVPA 3K0SA 4CD3A 4CK1A 3O80A 3LP0A 3L2VA 1JLQA 4F4KA 4Y1CA 4DQRA 3P38A 3VEXA 1NGHA 1GLAG 4BROA 2HHVA 4FWLA 3ID8A 5C2FA 3AVAA 2HBLA 4XEIA 3ZSVA 3V9ZA 3OJUA 4OLBA 2HHXA 3O4QA 2OCEA 1NM1A 5C10A 5E26A 1YVUA 4CK3A 3OYBA 4BRKA 3DMJA 1NJZA 1TYQA 3GDQA 4RW9A 4YHHK 4LSLA 4E0DA 1HJRA 1XQSC 5M1QA 4JK9A 3PO5A 3DLRA 3CHWA 4O5BA 3CF5L 5I42A 3V4IA 1J6ZA 4CJFA 1I3AA 3DI6A 2WFBA 2ASMA 4GV3A 3DRRA 4DCHA 1IKXA 4B1ZA 4KH6A 3M8RA 2NZTA 1BO5O 3U3YA 3M8SA 3VEWA 1LAWA 1X1PA 1XUPO 3MN9A 2IDOA 1RTIA 4KH5A 4C23A 1NG9A 3IKMA 2XO7A 1I39A 1R59O 3NHGA 4FJ9A 3GBTA 2IVNA 3SV3A 1C0UA 2IAJA 4CJ4A 4FWMA 2YHWA 1SQKA 2AJQA 4CF2A 4PL7A 1N36K 2QWPA 4Y0WA 3KK3A 4KKOA 1SZ2A 3T69A 3BDPA 4DWIA 4BY9C 3NE6A 1J5EK 1UAXA 3KLFA 3A5LC 1HNZK 4KPYA 4YDUC 3IMXA 1T44A 3OYJA 3TAEA 1TYQB 5AQWA 4O4GA 3DRSA 4QS7A 4OX9K 4OGCA 3VQBA 1EXQA 4FJNA 5CYMA 2O8BA 1K9MO 1XC9A 2D0AA 4ELTA 1S6QA 3CFRA 2O8FA 2ZGZA 3EKSA 2E1ZA 4CZGA 4OJRA 1UWBA 2ETJA 2PAVA 3CCJN 1VSLA 1A5VA 5IWAK 3RMAA 4LF8K 3WEEA 5BRFA 3ZX2A 1QZ6A 1REVA 4RW6A 5FRMA 2HF3A 3O08A 1KLNA 4AHUA 3VQCA 4BR5A 4U67L 1Z6RA 3CJAA 3CJCA 3SAGA 4HUEA 3L2RA 1SL2A 2FBVA 4CJTA 4DTSA 4KB1A 2G8FA 3AO1A 4FVMA 4FXDA 3VGKA 4CI6A 3CIPA 3J7ZO 2P9UA 2RPIA 1SKSA 4Q5VA 4LF7K 5JVGL 1VSEA 2KW4A 1RBUA 3CFPA 3ULDA 1ZBHA 4MQ3A 3WUHA 3CM6A 3VEYA 3G10A 2OTLN 1Q9XA 4EFHA 3THXA 2XY7A 3NF7A 4GV6A 3LDQA 5F2RA 4DR2K 3DLKA 4DSIA 4CJ3A 4BRLA 5SWMA 4CF8A 1GOCA 4YOXA 3DOKA 1HPZA 4BDZA 3K5MA 2O8BB 2NRXA 3MDQA 2O8FB 1NMNA 4EHTA 3H1QA 3QEVA 1SKWA 4EAHD 4BC5A 4QAGA 3WT0A 3PX4A 4XH4A 2VGMA 2F8SA 3THWB 2BE2A 3SCXA 3WEEB 1S6PA 1RDDA 4L8RB 2BANA 2KLAA 3CCQN 4N47A 3QMLA 3AO4A 2P9IA 3DLBA 1IJJA 3G71N 2GX9A 1B9DA 2QK9A 4PQUA 2KTQA 3KD1E 5H1SQ 4KFBA 1CZ9A 4B1WB 3VTHA 5KPTA 4ZTFA 3CCUN 4FJLA 1WOQA 4FLVA 1IKWA 4CEFA 3AY9A 4B9UA 2BH1A 1YITN 4M3YA 4FLZA 3U8XA 4I9LA 3CJBA 2A6AA 3K57A 1NGDA 4F3TA 3NH2A 3E9OA 4BRPA 2QKKA 2NUBA 1ASVA 1BISA 2BTFA 1FKPA 1LAVA 1L5UA 5F0XA 4WYBA 3IG1A 3WNGA 1VK0A 3H08A 3KJVA 1WSIA 4CJSA 1KVBA 1BHLA 4BREA 4PKGA 2LSNA 4FWQA 5C12A 1VQ8N 4A5BA 4JKCA 3E1YA 3UKRA 3O9UA 2QW9A 3SAHA 3BP8A 3NCIA 3PIOL 3VQ7A 1YVNA 3QIOA 3M6GA 5AQRA 3PY8A 4JI5K 3FZMA 4JYAK 3LDOA 3MCAB 4LD0A 2A41A 3QB0A 4C1NI 3ASMA 5MLCQ 1DTTA 4IBNA 1EKEA 3AARA 3FE1A 1RT7A 4YOVA 3AA5X 4BG9A 4B9QA 2P9SB 3KVGA 4OO1J 4BGBA 4FJXA 3IDHA 3P4IA 4JLHA 1HR0K 5AFUA 4HWIA 3ZEUA 4A2BA 4RWTA 2F96A 1TKZA 3HL8A 1EO1A 3O9RA 3AVCA 4I7FA 5C0YA 2E2NA 1RT5A 4Z4GA 4FJHA 1KFDA 1RBVA 1LWFA 4NXMK 3SI6A 1XNQK 1HNVA 4CBWA 1VHXA 3MN5A 2G8HA 4LH5A 1DTQA 1EQYA 1C6VA 2EX3A 4C1NK 3WXJA 4GV9A 3UIQA 5C25A 4W5RA 5C2DA 2ZWHA 3HOTA 4PKHA 1QE1A 1EWQA 3UKRB 4GKKK 3VESA 3C0BA 3HP9A 3RR7A 2QWMA 3OS0A 3CCEN 1LV5A 4LFBK 1K6YA 3DWLA 5GADP 3J7YP 3SUOA 2GV9A 1VQMN 4XIUA 3LP2A 3EL2A 3K5OA 4E1JA 4IO9L 2HMPA 3C94A 1U04A 3SMPA 5AQLA 3TANA 1LW2A 4O8KA 4WQ4A 1ZBLA 1L3UA 1MWKA 3LWMA 5JS1A 2P9PB 5KRTA 4BRHA 2DTUA 1MWMA 4JEPA 1BL3A 3CPWM 3L2WA 3QFPA 3ZT1A 3PV8A 4DR1K 3SNNA 1G99A 3ENHA 4QS9A 2HHTA 3A5MC 2FBTA 3CERA 4IWVA 4JI6K 1HNXK 5LL6Z 1Z26A 3DLEA 1FXXA 3MEEA 5BREA 4DFMA 3EY1A 5HROA 2OA8A 1GOAA 1BDGA 4ID1A 3VOVA 3OYKA 4B3RK 3RMBA 2E1YA 1G15A 2FC0A 3DLGA 4FO0A 4ELUA 1Q8IA 4JI7K 3F5TA 1TK0A 3U4LA 4Q0BA 5GAGP 3ENBA 1FK9A 3A5NC 4JKGB 2VG6A 5AQXA 5AFUH 4FK2A 4A5AA 3U9DA 1YJ9N 4LF4K 5T7BA 4IOAL 2H3GX 3ZX3A 5ADXH 4FLTA 3T1YK 1IV0A 4J2AA 3DM2A 3H6EA 1GLJO 2F9TA 3WXKA 1NGGA 2ZJPL 2PYLA 1ATSA 4FJ8A 3CI5A 3PSFA 4ILGB 3CC4N 2UU9K 1CLQA 5DMRA 2E2OA 3VQEA 1YF5L 3VEZA 4DB3A 4JNEA 4I9QA 4H0PA 4WE1A 5LMUK 1S5JA 3GE1A 3JAMO 3PIPL 4JI2K 3NH0A 1HPMA 3SBGA 3FFIA 2WTUA 2JWKA 1W97L 2CH6A 3L2UA 4WCEL 2B6AA 3R1XA 4ZHRA 1ZBIA 2D1KA 2OZMA 4H0YB 2YNIA 2IGIA 1TKDA 1YHQN 4ISEA 4DSEA 1MA9B 4CFCA 4M3ZA 3KK7A 3VF6A 2Q97A 1JLEA 1B9FA 3AVBA 3O3FA 1Z25A 4C8OA 3RRGA 3LZIA 4CD1A 5BPNA 3RSEB 3WNHA 4C8KA 1T05A 2ZGYA 4I2PA 3L0QA 1VSIA 4RW7A 4FJKA 3O1WA 1GOBA 5CZ2A 4EP4A 1X9JA 4M3UA 3OY9A 2D5RA 1S3XA 3VQ5A 4WFBL 3CCLN 4IEIA 3Q7CA 4F8RA 1QVFM 3EN9A 3TABA 4IG3A 2HHWA 5KRSA 4M41A 1CXUA 1LOTB 3ZCMA 1OH5A 1SAZA 2YHBA 4GVEA 2E2PA 1N5YA 1XI1A 4BRGA 4HCBA 5JS2A 4DU4A 4AQYK 4HHTA 2P5OA 4KHWA 4DQPA 4DR3K 4Z4FA 1ASUA 3BZKA 3M3ZA 4CECA 3M5RA 3C6UA 4AH9A 2X6NA 3ULEB 1J9AA 4A62A 1XNRK 1TUYA 1JLBA 4UY8O 2F7TA 2ZF5O 3SQ1A 2OANA 2HSTA 3G4SN 3ZSWA 4DTOA 5C15A 1RTHA 1F21A 4DLEA 1VQNN 3SPYA 4O0IA 1ATRA 2B5JA 4DG1A 2NRTA 3N4QA 3K9KA 1Z05A 1VQKN 3D2FA 2XHBA 1VQLN 1JL1A 2HHSA 2OPSA 4K0KK 4IFVA 1HRHA 4BRNA 2IC3A 3ISNC 3MK6A 3R6MA 4NXNK 1UA0A 4DV0K 3MAQA 3VF4A 2FBXA 4CZMA 5AZJB 1S22A 3KTQA 4X62K 4C8NA 4FM1A 4FM0A 1GLCG 1BWFO 4LH4A 4CW7B 4DR6K 3VQAA 1BIZA 5SZTA 3VQQA 1D4XA 2QTDA 3V9WA 3LDSA 1BQNA 2UYTA 1WB9A 3O4NA 4CEQA 3THYB 1RTDA 1S9EA 2HBMA 2ASPA 1KC8O 5LMNK 3QEPA 1GLBG 1VRUA 5ELZA 4M7YA 1Q81O 2X78A 3CPEA 3CFOA 3JSMA 2E88A 4CBXA 3BF1A 4RG8A 1UOCA 4FWKA 1S72N 4DV1K 2ZE2A 4J2BA 4B9LA 3FFKB 2CH5A 3DLLL 3WNFA 1YTUA 4CEBA 4RW4A 3CMAN 2AA4A 3HYFA 1W7AA 4KHUA 4CEDA 1KD1O 1VSMA 3D2FB 3K9JA 3OYHA 1BIUA 3DYAA 4PL8A 1T03A 3O3GA 1N34K 1ESVA 4CJ7A 4CVNE 3DXKB 2Z1GA 4DHYA 4KTQA 3A8YA 4KO0A 4CF9A 3CYMA 1NLVA 3KLIA 4FLXA 1IKVA 4FWSA 2OTJN 4G9ZA 1NGBA 4NO7A 4DS4A 1IH7A 2V7ZA 2QM1A 3MCPA 1IKYA 4CGIA 4B3SK 1S1VA 1U47A 2YJEA 5LJWA 1WSJA 4KHSA 3I8BA 2OZSA 3A2FA 4BRAA 3OS1A 1U48A 3FR0A 2P5GA 3HM8A 1BCMA 4TSXA 1NJWA 3TAMA 3IUCA 4E7LA 3K5NA 3LPUA 4E89A 5J2PA 3KD5E 3A5OC 4CE9A 1RDUA 3T1HK 4BRIA 4AHRA 4CERA 4PY5A 1JCEA 2GTDA 4LY7A 4BDYA 4IJNA 1RDWX 3D2EB 2O8EB 4KTWA 2ASOA 4JKHA 3LDLA 1IO2A 3C6HA 3TARA 3M1FA 3RR8A 4GW6A 4CJEA 2RKIA 2R7YA 4YOTA 3LM9A 4KHYA 3NVMA 3ENOA 5AQOA 5EU7A 3AO2A 3HI0A 5KPRA 3V9UA 4BR2A 3KZBA 4OPKA 3THWA 1DLOA 3I0SA 4CEEA 1L3VA 4MDBA 3LAMA 2P51A 2Z1HA 3HM9A 4FZZA 5DM6L 1HX1A 3NF9A 2Y1JA 3OW2M 2ITGA 2UXCK 1U2VA 2A42A 5AZIA 1QHTA 4BWJA 4XH1A 4N41A 4M42A 3B6PA 3AVGA 3VETA 1VQ6N 3J80O 1X3NA 5IT9O 1OVYA 2NRRA 4G1QA 1Q18A 3PUFA 5JVHL 1RT4A 2Q31A 2Z1IA 3H3OB 3C6TA 2GUPA 4DV7K 3EKUA 1J54A 4B9VA 1D9FA 3SJJA 3CQYA 4KI6A 2ZD1A 4KAZA 4OPHA 2P9LB 1Q7YO 3MXMA 3SQ0A 3GL1A 2VCPA 4BC3A 3VQ6A 4FSVA 4DLGA 2JLEA 1QZ5A 2HHQA 3TR8A 1RBSA 5BPLA 1QTMA 3R3LA 1MU2A 1NU0A 4Z4CA 4CK2A 3IAYA 3HK2A 4CZEA 2UUCK 3HTVA 3SMSA 4JKFA 4ILHA 1HYVA 3NVKA 5BR8K 3DAWA 5HBMA 1ITGA 3LM2A 4H5VA 2Q36A 4PKIA 3KLHA 2KFZA 4QCLA 3KLGA 5GINA 1S1UA 4DQIA 2QA4N 4K8ZA 1JL2A 3UE5A 2GBZA 3DLHA 3F9KA 3MEGA 2NRWA 4B8AB 1NJYA 4NCGA 3CC2N 3NDKA 1U2VB 2HB5A 5AZIB 1YI2N 5AQZA 4NCBA 5BRDA 2HBKA 3QO9A 1X9SA 3BZCA 4AHVA 5TKWA 2P9SA 3SYZA 1JXBA 1GLLO 5GAHP 1S1XA 3AO3A 5HRPA 4DSFA 3AO5A 4DTXA 4IOXA 1C0GA 1KXPA 3M8PA 3OYAA 4FM2A 1E3MA 4JI0K 3ZYYX 3BGRA 4PA1A 1W2BM 4JK8A 2ITMA 4CZKA 1ZC6A 2NRVA 4K43A 3ZETA 4A59A 3TAPA 3AAQA 5KI6A 5J2MA 1A5XA 4MDAA 1J5OA 1YJWN 3T19A 3W3DA 4Y1DA 3CMEN 3V81A 3M8QA 5AQMA 4IDKA 3D6RA 2VG7A 4O5FA 2QWQA 1SKRA 2A5XA 2QWLA 3HBTA 3VQ4A 1RFQA 4B3MK 1VSDA 2DY4A 3TAFA 3CCVN 2V52B 2V7YA 2E6MA 3LDPA 2G8WA 1WSEA 5B8HA 1XHZA 1LW0A 2G8UA 4E1NA 4BDPA 5EOYA 1LCUA 2FF6A 2VGNA 1YT3A 2D0OA
chains in the Genus database with same CATH topology
4FK0A 1FK9A 3KKRA 4HTUA 2VG6A 3K58A 1NKEA 2PZSA 3HSTB 4BE2A 3AVMA 1KRPA 4F2SA 4FK2A 2F8TA 4FYDA 3S3OA 5K14A 1TAUA 5T7BA 3AA2A 5DK5A 4KHNA 3LWLA 3SV4A 3VQDA 1LWCA 3DRPA 5KTQA 1SL0A 4FLTA 3HPOA 1QSSA 4LSNA 3QEXA 4J2AA 3DM2A 3OVNA 3L8BA 4BWMA 1BI4B 4CGHA 3LZJA 4KTZA 1KSPA 3KKSA 2PYLA 4FJ8A 3D45A 3ZSZA 1CLQA 5DMRA 4DSJA 4I9QA 3VQEA 3V1OA 4CK1A 3LP0A 4E1MA 3KIOA 1ZYQA 1VSKA 3ITHA 4HUGA 4OVLA 4WE1A 3L2VA 3TWHA 4EZ6A 1JLQA 1YTUA 4F4KA 1S5JA 4O0JA 4Y1CA 4DQRA 4CJUA 1ZBFA 3NH0A 4B3OA 5C42A 1KVAA 4CJKA 3FFIA 1EX4A 4DTMA 2HHVA 1RBTA 3L2UA 2B6AA 3F73A 2YKNA 4ZHRA 1ZBIA 1TGOA 3ZSYA 3AVAA 2OZMA 3QIPA 2I5JA 3V9ZA 1BCOA 2YNIA 2KQ2A 3ZSVA 3I0RA 3OJUA 4OLBA 2IGIA 1JLAA 3O4QA 4KI4A 3PX0A 3T3FA 2HW3A 3WNEA 3QESA 4CCHA 1RNHA 1TKDA 4CFDA 3HXMA 4DSEA 2W42A 1YVUA 1BQMA 4CK3A 4CFCA 4CHNA 3OYBA 1TK8A 4M3ZA 3DMJA 1JLEA 3VQ8A 1NJZA 1B9FA 3AVBA 4RW9A 3O3FA 1QQCA 1C1AA 1Z25A 3B6OA 4FJMA 3L3UA 4LSLA 4C8OA 3RRGA 3LZIA 4DF4A 4E0DA 3WNHA 4C8KA 2HNZA 4DFJA 1HJRA 1T05A 3G0ZA 3EZ5A 3PO5A 4I2PA 1VSIA 4RW7A 3V6DA 4FJKA 1GOBA 3DLRA 5CZ2A 4C8MA 4EP4A 4O5BA 5J2NA 4M3UA 5CYQA 3OY9A 5I42A 1X9WA 2D5RA 3VQ5A 3V4IA 3OYFA 3QNOA 3ZT0A 1X9MA 4F8RA 4OKEA 4CJFA 1I3AA 3DI6A 3IS9A 3NGYA 3TABA 4IG3A 3ZSOA 4N5SA 2G8IA 4KRFA 2HHWA 5KRSA 4CJRA 4M3TA 3ZSXA 3DRRA 4M41A 1IKXA 1U45A 4FJ7A 1CXUA 1U4BA 1BI4A 3ZCMA 3M8RA 4E7KA 2YHBA 1HQUA 4MFBA 4M3RA 4R5PA 3U3YA 4CF1A 4NYNA 3LP3A 1J53A 3M8SA 1N6QA 1LAWA 1X1PA 4CHZA 1XI1A 1N5YA 2HNYA 1W0HA 2IDOA 4HCBA 5JS2A 1RTJA 1RTIA 4HUFA 4DU4A 1TK5A 3KK2A 4HHTA 2P5OA 2XO7A 1BGXT 1I39A 2XY5A 1D8YA 4KHWA 3SZ2A 4DQPA 2G8KA 3NHGA 4FJ9A 4FJ5A 4Z4FA 1ASUA 3VQ9A 4CJWA 2HHXA 3SV3A 4CECA 4CESA 2G8VA 1EETA 2IAJA 1C0UA 4CJ4A 3MECA 3C6UA 4AH9A 2X6NA 2YNGA 3CG7A 4H4MA 4B08A 4CF2A 1J9AA 1U49A 2AJQA 4CJLA 2Q3SA 3KK3A 4KKOA 4PUOA 3AVLA 4CHYA 3EYZA 3BDPA 4DWIA 1JLBA 3NE6A 1UAXA 3KLFA 4KPYA 2HVIA 4DSKA 4OPJA 1FKOA 3NGIA 3SQ1A 1JLFA 4C8LA 3OYJA 3TAEA 1C0MA 1CXQA 3ZSWA 4ELVA 4DTOA 4E7JA 2YKMA 4AHCA 1RTHA 1RDBA 3LPTA 1F21A 4DLEA 4O4GA 4Z0UA 1C1BA 3TI0A 3DRSA 3SPYA 4O0IA 1JLGA 5J2QA 4OGCA 4FLWA 5FRNA 2B5JA 3VQBA 1EXQA 4DG1A 4DU1A 4FJNA 5CZ1A 3HT3A 1HYSA 5CYMA 4OKKA 1XC9A 2D0AA 1IG9A 4ELTA 4W5TA 2XHBA 1RILA 4N76A 1JL1A 1S6QA 3CFRA 3TAGA 2JGUA 2HHSA 4DQQA 4CEOA 3NBPA 2OPSA 4BE0A 2P1JA 3L3VA 4IFVA 2YNFA 1HRHA 3P5JA 4J2EA 2IC3A 3ISNC 2B4JA 4OJRA 1UWBA 1WSFA 2ETJA 4DU3A 3RMDA 3MAQA 1UA0A 1VSLA 2E4LA 1A5VA 4F3OA 4AHTA 3QETA 2FBXA 2FBYA 5HRSA 4DTUA 3RMAA 4B9NA 1NK0A 1VSFA 1WAJA 3ZSQA 1REVA 2D0CA 3K59A 2VG5A 3KTQA 4C8NA 4FM1A 4RW6A 4DQSA 4FLYA 4FM0A 4FJIA 1VRTA 4CHOA 4LH4A 3ALYA 5D3GA 3VQAA 4JS5A 5FRMA 1TVRA 2O4IA 1BIZA 4J2DA 5SZTA 1KLNA 3VQQA 4AHUA 3VQCA 1KTQA 4HUEA 2YV0X 3L2RA 3V9WA 3LDSA 3SUQA 1BQNA 1SL2A 3O3HA 2Z1JA 2FBVA 2OPQA 4DMNA 3O4NA 3T1AA 1TAQA 2A1SA 4CEQA 4CGJA 2WOMA 4CJTA 5KGXA 1S9EA 4DTSA 1RTDA 4KB1A 2G8FA 3AO1A 3SUPA 4FVMA 4FXDA 5FROA 3QEPA 4M3WA 3OYNA 1VRUA 2RPIA 1WSGA 1SKSA 4Q5VA 2X78A 3CFOA 3JSMA 1VSEA 2KW4A 3MXIA 2VWKA 3V9SA 1RBUA 2Y1IA 4ID5A 3CFPA 3ULDA 4MQ3A 1ZBHA 4K8XA 4RG8A 1UOCA 3CM6A 3CM5A 3G10A 4FCYA 1Q9XA 2XY7A 3NF7A 4CGGA 2ZE2A 4HVJA 2ATQA 4J2BA 4DS5A 1HQEA 1S1WA 4B9LA 3ZT4A 3RTVA 1NOYA 1RT3A 4EZ9A 3C95A 3DLKA 3VQPA 4DSIA 2HNDA 4CJ3A 4CHQA 4O44A 4B8CA 1JKHA 3HVTA 3IRXA 2OPRA 5J1EA 4CF8A 2X6SA 1GOCA 3WNFA 5SWMA 3VN5A 3DOKA 1HPZA 2E6LA 4CEBA 3KK1A 3K5MA 4RW4A 4BDZA 4FJJA 3HYFA 4KHUA 1W9HA 4CEDA 4W5NA 4DSLA 4EP5A 1VSMA 1HNIA 1D9DA 4CFBA 3OYHA 1RT1A 1BIUA 1SUQA 3DYAA 5HRNA 1T03A 2IS3A 3O3GA 3MEDA 2DFHA 4Z4EA 3OS2A 3QEVA 1SKWA 4Z4HA 4QAGA 2Z1GA 3PX4A 4KTQA 2F8SA 1SL1A 2BE2A 4KO0A 3CYMA 3LANA 4CGFA 4CF9A 4B9MA 2X74A 3SCXA 3OYGA 1T8EA 1S6PA 3KLIA 1RDDA 4B9TA 4FLXA 1IKVA 1NOZA 4L8RB 2BANA 2A1RA 5I3UA 1RDAA 4DS4A 1IH7A 4CGIA 1IKYA 4N47A 4IFYA 1S1VA 1U47A 3KLEA 1WSJA 3AO4A 4ICLA 4CEZA 4KHSA 1RBRA 3QLHA 3DLBA 2OZSA 3HP6A 3A2FA 1C1CA 1B9DA 1XHXA 2QK9A 4PQUA 4JRQA 3OS1A 1RCHA 3KD1E 1U48A 2P5GA 4FW2A 2KTQA 3TAQA 4CJ5A 3AVHA 4KFBA 4AILC 2XY8A 1CZBA 3V1RA 1BCMA 1CZ9A 3PO4A 4TSXA 1NJWA 1NKBA 1S1TA 3TAMA 4FZYA 4E7LA 3THVA 3SQ4A 3K5NA 1QS4A 4JS4A 4CIEA 4KB0A 3LPUA 4ZTFA 5E41A 4E89A 4FJLA 2OPPA 5J2PA 1ASWA 3KD5E 2KZZA 4FLVA 1IKWA 4CEFA 4CE9A 1L3VA 4B9UA 4CEAA 1S9GA 4AHRA 4M3YA 3U6FA 3LP1A 4CERA 4H4OA 3NFAA 4FLZA 4E3SA 1Y97A 2ZQBA 3LAKA 4DTNA 4I9LA 4PY5A 2RF2A 3K57A 1NJXA 1L3SA 2HVHA 4LY7A 4BDYA 4F3TA 2EHGA 3AVKA 4H8KA 4KTWA 3NH2A 3S9HA 5CY4A 1IO2A 3TARA 3QEWA 4F2RA 2QKKA 1JLCA 2DFEA 2NUBA 3ZT3A 3RR8A 4GW6A 4CJEA 3NAEA 1ASVA 1NK9A 3JYTA 3RWUA 2RKIA 1BISA 2R7YA 4ZTJA 3LALA 4KHYA 4FLUA 2HHUA 1FKPA 1LAVA 1L5UA 1O1WA 1NK5A 5EU7A 1R0AA 3IG1A 3WNGA 1VK0A 3AO2A 3H08A 3OYMA 2KFNA 3KJVA 3V9UA 2YNHA 1WSIA 4CJSA 1KVBA 1BHLA 1NK4A 1QSLA 4OPKA 3AVFA 5HP1A 4BACA 2LSNA 1DLOA 3SQ2A 3I0SA 4CEEA 2O4GA 1SV5A 3NF6A 3LAMA 2P51A 2Z1HA 4UQGA 4AHSA 3HM9A 1UA1A 4FZZA 4CJVA 3OYCA 3NCIA 2VWJA 3NF9A 4E7IA 4FZXC 2Y1JA 1RT6A 3VQ7A 1D5AA 2ITGA 3QIOA 1TL3A 1QHTA 1WNSA 1VSHA 4BWJA 3PY8A 4N41A 3B6PA 5C24A 4M42A 3AVGA 4LD0A 1NK7A 4O55A 3DOLA 3ASMA 2PYJA 4KREA 1DTTA 4IBNA 1EKEA 3AV9A 4G1QA 3PUFA 1RT7A 1TKTA 4RW8A 4CFAA 1RT4A 2Z1IA 3SPZA 3AA5X 3C6TA 1JXEA 2D0BA 4YNQA 1J54A 4FJXA 3K5LA 4DFPA 4B9VA 3OYIA 4JLHA 1D9FA 1HMVA 1RDCA 1HYZA 4M45A 4CJQA 3HPGA 1TKXA 3AA3A 4W5OA 3SJJA 4KI6A 4CGDA 4Z4IA 1QSYA 5KGWA 2ZD1A 4KAZA 3AVNA 3V1QA 1NK6A 2F96A 1TKZA 3OYEA 3HL8A 1KVCA 1WAFA 3RMCA 1KLMA 3AVCA 4I7FA 3SQ0A 3MXMA 4OKJA 2QKBA 4W5QA 1RT5A 3VQ6A 4IKFA 4DLGA 2JLEA 4Z4GA 4E19A 2HHQA 4FJHA 4M3XA 3TR8A 1RBSA 1KFDA 1RBVA 4IG0A 1LWFA 3VA3A 3SI6A 1ZBUA 1T7PA 1QTMA 1MU2A 3D0PA 4Z4CA 4CK2A 4B9SA 3S3NA 3HO1A 4QOZB 3IAYA 1HNVA 3HK2A 4NYFA 2G8HA 3OYLA 4LH5A 3V9XA 3QINA 4I2QA 1DTQA 2EX3A 1C6VA 4CHPA 3UIQA 5C25A 4YFUA 4W5RA 4DTPA 1HYVA 3RRHA 3U3GA 5HBMA 2YHAA 2XY6A 1WN7A 4FW1A 3AVJA 1ITGA 1A5WA 1QE1A 2WONA 3KLHA 1TL1A 4QCLA 3OYDA 2KFZA 3KLGA 1S1UA 4DQIA 1NK8A 3HP9A 2GUIA 3RR7A 4K8ZA 1B92A 1JL2A 4FK4A 3OS0A 3DLHA 2GBZA 1LV5A 3F9KA 3MEGA 4B8AB 1NJYA 4DTJA 2BDPA 4NCGA 3L2QA 1XWLA 1TV6A 3NDKA 1K6YA 2HB5A 3P83D 3P1GA 5FDLA 4NCBA 3ZT2A 3NF8A 3QERA 1WLJA 3SUOA 3E01A 2GV9A 3QO9A 3MXJA 1KCFA 1X9SA 3QNNA 4XIUA 3LP2A 3K5OA 4AHVA 4KV8A 1C0TA 3PX6A 2HMIA 3C94A 1JXBA 3SYZA 3SUNA 1S1XA 4NCAA 3AO3A 5HRPA 4DSFA 3AO5A 4DTXA 3NH1A 1U04A 3ZSRA 3TANA 3S3MA 1LW2A 3QEIA 3I8DA 4OGEA 2XRIA 3M8PA 3OYAA 3OJSA 4FM2A 3AVIA 3BGRA 5HRRA 4DF8A 3HJFA 1ZBLA 4PA1A 1YTAA 1L3UA 3LWMA 2KZMA 5JS1A 4GVMA 1Q9YA 5KRTA 2DTUA 3NGZA 2DFFA 1BL3A 2BGGA 3TAPA 2RN2A 3L2WA 3ZT1A 5KI6A 3PV8A 4HCCA 5J2MA 1LWEA 2OYQA 1A5XA 3SNNA 3AA4A 2HHTA 1KFSA 1VSJA 2QXFA 4BE1A 1J5OA 4GMJB 2FBTA 1RT2A 3T19A 1EP4A 3HVRA 4Y1DA 1NKCA 4CF0A 4CIGA 3VA0A 3V81A 3M8QA 1L3TA 1Z26A 4IDKA 3DLEA 1FXXA 2VG7A 3MEEA 4DFMA 4DTRA 4KHQA 3EY1A 1SKRA 3VQ4A 4JRPA 2DY4A 1VSDA 3TAFA 1WSHA 4CIFA 5HROA 2OA8A 1GOAA 2E6MA 4N56A 5HLFA 4FJGA 2G8WA 4ID1A 1WSEA 3OYKA 2PY5A 4PWDA 3K2PA 3RMBA 3CQ8A 1XHZA 1LW0A 1G15A 2G8UA 2FC0A 4CJPA 4E1NA 3DLGA 4BDPA 4ELUA 2IOCA 1Q8IA 4DFKA 4E7HA 4OLAA 1TK0A 3HPHA 1YT3A 4Q0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK0 A;  1FK9 A;  3KKR A;  4HTU A;  2VG6 A;  3K58 A;  1NKE A;  2PZS A;  3HST B;  4BE2 A;  3AVM A;  1KRP A;  4F2S A;  4FK2 A;  2F8T A;  4FYD A;  3S3O A;  5K14 A;  1TAU A;  5T7B A;  3AA2 A;  5DK5 A;  4KHN A;  3LWL A;  3SV4 A;  3VQD A;  1LWC A;  3DRP A;  5KTQ A;  1SL0 A;  4FLT A;  3HPO A;  1QSS A;  4LSN A;  3QEX A;  4J2A A;  3DM2 A;  3OVN A;  3L8B A;  4BWM A;  1BI4 B;  4CGH A;  3LZJ A;  4KTZ A;  1KSP A;  3KKS A;  2PYL A;  4FJ8 A;  3D45 A;  3ZSZ A;  1CLQ A;  5DMR A;  4DSJ A;  4I9Q A;  3VQE A;  3V1O A;  4CK1 A;  3LP0 A;  4E1M A;  3KIO A;  1ZYQ A;  1VSK A;  3ITH A;  4HUG A;  4OVL A;  4WE1 A;  3L2V A;  3TWH A;  4EZ6 A;  1JLQ A;  1YTU A;  4F4K A;  1S5J A;  4O0J A;  4Y1C A;  4DQR A;  4CJU A;  1ZBF A;  3NH0 A;  4B3O A;  5C42 A;  1KVA A;  4CJK A;  3FFI A;  1EX4 A;  4DTM A;  2HHV A;  1RBT A;  3L2U A;  2B6A A;  3F73 A;  2YKN A;  4ZHR A;  1ZBI A;  1TGO A;  3ZSY A;  3AVA A;  2OZM A;  3QIP A;  2I5J A;  3V9Z A;  1BCO A;  2YNI A;  2KQ2 A;  3ZSV A;  3I0R A;  3OJU A;  4OLB A;  2IGI A;  1JLA A;  3O4Q A;  4KI4 A;  3PX0 A;  3T3F A;  2HW3 A;  3WNE A;  3QES A;  4CCH A;  1RNH A;  1TKD A;  4CFD A;  3HXM A;  4DSE A;  2W42 A;  1YVU A;  1BQM A;  4CK3 A;  4CFC A;  4CHN A;  3OYB A;  1TK8 A;  4M3Z A;  3DMJ A;  1JLE A;  3VQ8 A;  1NJZ A;  1B9F A;  3AVB A;  4RW9 A;  3O3F A;  1QQC A;  1C1A A;  1Z25 A;  3B6O A;  4FJM A;  3L3U A;  4LSL A;  4C8O A;  3RRG A;  3LZI A;  4DF4 A;  4E0D A;  3WNH A;  4C8K A;  2HNZ A;  4DFJ A;  1HJR A;  1T05 A;  3G0Z A;  3EZ5 A;  3PO5 A;  4I2P A;  1VSI A;  4RW7 A;  3V6D A;  4FJK A;  1GOB A;  3DLR A;  5CZ2 A;  4C8M A;  4EP4 A;  4O5B A;  5J2N A;  4M3U A;  5CYQ A;  3OY9 A;  5I42 A;  1X9W A;  2D5R A;  3VQ5 A;  3V4I A;  3OYF A;  3QNO A;  3ZT0 A;  1X9M A;  4F8R A;  4OKE A;  4CJF A;  1I3A A;  3DI6 A;  3IS9 A;  3NGY A;  3TAB A;  4IG3 A;  3ZSO A;  4N5S A;  2G8I A;  4KRF A;  2HHW A;  5KRS A;  4CJR A;  4M3T A;  3ZSX A;  3DRR A;  4M41 A;  1IKX A;  1U45 A;  4FJ7 A;  1CXU A;  1U4B A;  1BI4 A;  3ZCM A;  3M8R A;  4E7K A;  2YHB A;  1HQU A;  4MFB A;  4M3R A;  4R5P A;  3U3Y A;  4CF1 A;  4NYN A;  3LP3 A;  1J53 A;  3M8S A;  1N6Q A;  1LAW A;  1X1P A;  4CHZ A;  1XI1 A;  1N5Y A;  2HNY A;  1W0H A;  2IDO A;  4HCB A;  5JS2 A;  1RTJ A;  1RTI A;  4HUF A;  4DU4 A;  1TK5 A;  3KK2 A;  4HHT A;  2P5O A;  2XO7 A;  1BGX T;  1I39 A;  2XY5 A;  1D8Y A;  4KHW A;  3SZ2 A;  4DQP A;  2G8K A;  3NHG A;  4FJ9 A;  4FJ5 A;  4Z4F A;  1ASU A;  3VQ9 A;  4CJW A;  2HHX A;  3SV3 A;  4CEC A;  4CES A;  2G8V A;  1EET A;  2IAJ A;  1C0U A;  4CJ4 A;  3MEC A;  3C6U A;  4AH9 A;  2X6N A;  2YNG A;  3CG7 A;  4H4M A;  4B08 A;  4CF2 A;  1J9A A;  1U49 A;  2AJQ A;  4CJL A;  2Q3S A;  3KK3 A;  4KKO A;  4PUO A;  3AVL A;  4CHY A;  3EYZ A;  3BDP A;  4DWI A;  1JLB A;  3NE6 A;  1UAX A;  3KLF A;  4KPY A;  2HVI A;  4DSK A;  4OPJ A;  1FKO A;  3NGI A;  3SQ1 A;  1JLF A;  4C8L A;  3OYJ A;  3TAE A;  1C0M A;  1CXQ A;  3ZSW A;  4ELV A;  4DTO A;  4E7J A;  2YKM A;  4AHC A;  1RTH A;  1RDB A;  3LPT A;  1F21 A;  4DLE A;  4O4G A;  4Z0U A;  1C1B A;  3TI0 A;  3DRS A;  3SPY A;  4O0I A;  1JLG A;  5J2Q A;  4OGC A;  4FLW A;  5FRN A;  2B5J A;  3VQB A;  1EXQ A;  4DG1 A;  4DU1 A;  4FJN A;  5CZ1 A;  3HT3 A;  1HYS A;  5CYM A;  4OKK A;  1XC9 A;  2D0A A;  1IG9 A;  4ELT A;  4W5T A;  2XHB A;  1RIL A;  4N76 A;  1JL1 A;  1S6Q A;  3CFR A;  3TAG A;  2JGU A;  2HHS A;  4DQQ A;  4CEO A;  3NBP A;  2OPS A;  4BE0 A;  2P1J A;  3L3V A;  4IFV A;  2YNF A;  1HRH A;  3P5J A;  4J2E A;  2IC3 A;  3ISN C;  2B4J A;  4OJR A;  1UWB A;  1WSF A;  2ETJ A;  4DU3 A;  3RMD A;  3MAQ A;  1UA0 A;  1VSL A;  2E4L A;  1A5V A;  4F3O A;  4AHT A;  3QET A;  2FBX A;  2FBY A;  5HRS A;  4DTU A;  3RMA A;  4B9N A;  1NK0 A;  1VSF A;  1WAJ A;  3ZSQ A;  1REV A;  2D0C A;  3K59 A;  2VG5 A;  3KTQ A;  4C8N A;  4FM1 A;  4RW6 A;  4DQS A;  4FLY A;  4FM0 A;  4FJI A;  1VRT A;  4CHO A;  4LH4 A;  3ALY A;  5D3G A;  3VQA A;  4JS5 A;  5FRM A;  1TVR A;  2O4I A;  1BIZ A;  4J2D A;  5SZT A;  1KLN A;  3VQQ A;  4AHU A;  3VQC A;  1KTQ A;  4HUE A;  2YV0 X;  3L2R A;  3V9W A;  3LDS A;  3SUQ A;  1BQN A;  1SL2 A;  3O3H A;  2Z1J A;  2FBV A;  2OPQ A;  4DMN A;  3O4N A;  3T1A A;  1TAQ A;  2A1S A;  4CEQ A;  4CGJ A;  2WOM A;  4CJT A;  5KGX A;  1S9E A;  4DTS A;  1RTD A;  4KB1 A;  2G8F A;  3AO1 A;  3SUP A;  4FVM A;  4FXD A;  5FRO A;  3QEP A;  4M3W A;  3OYN A;  1VRU A;  2RPI A;  1WSG A;  1SKS A;  4Q5V A;  2X78 A;  3CFO A;  3JSM A;  1VSE A;  2KW4 A;  3MXI A;  2VWK A;  3V9S A;  1RBU A;  2Y1I A;  4ID5 A;  3CFP A;  3ULD A;  4MQ3 A;  1ZBH A;  4K8X A;  4RG8 A;  1UOC A;  3CM6 A;  3CM5 A;  3G10 A;  4FCY A;  1Q9X A;  2XY7 A;  3NF7 A;  4CGG A;  2ZE2 A;  4HVJ A;  2ATQ A;  4J2B A;  4DS5 A;  1HQE A;  1S1W A;  4B9L A;  3ZT4 A;  3RTV A;  1NOY A;  1RT3 A;  4EZ9 A;  3C95 A;  3DLK A;  3VQP A;  4DSI A;  2HND A;  4CJ3 A;  4CHQ A;  4O44 A;  4B8C A;  1JKH A;  3HVT A;  3IRX A;  2OPR A;  5J1E A;  4CF8 A;  2X6S A;  1GOC A;  3WNF A;  5SWM A;  3VN5 A;  3DOK A;  1HPZ A;  2E6L A;  4CEB A;  3KK1 A;  3K5M A;  4RW4 A;  4BDZ A;  4FJJ A;  3HYF A;  4KHU A;  1W9H A;  4CED A;  4W5N A;  4DSL A;  4EP5 A;  1VSM A;  1HNI A;  1D9D A;  4CFB A;  3OYH A;  1RT1 A;  1BIU A;  1SUQ A;  3DYA A;  5HRN A;  1T03 A;  2IS3 A;  3O3G A;  3MED A;  2DFH A;  4Z4E A;  3OS2 A;  3QEV A;  1SKW A;  4Z4H A;  4QAG A;  2Z1G A;  3PX4 A;  4KTQ A;  2F8S A;  1SL1 A;  2BE2 A;  4KO0 A;  3CYM A;  3LAN A;  4CGF A;  4CF9 A;  4B9M A;  2X74 A;  3SCX A;  3OYG A;  1T8E A;  1S6P A;  3KLI A;  1RDD A;  4B9T A;  4FLX A;  1IKV A;  1NOZ A;  4L8R B;  2BAN A;  2A1R A;  5I3U A;  1RDA A;  4DS4 A;  1IH7 A;  4CGI A;  1IKY A;  4N47 A;  4IFY A;  1S1V A;  1U47 A;  3KLE A;  1WSJ A;  3AO4 A;  4ICL A;  4CEZ A;  4KHS A;  1RBR A;  3QLH A;  3DLB A;  2OZS A;  3HP6 A;  3A2F A;  1C1C A;  1B9D A;  1XHX A;  2QK9 A;  4PQU A;  4JRQ A;  3OS1 A;  1RCH A;  3KD1 E;  1U48 A;  2P5G A;  4FW2 A;  2KTQ A;  3TAQ A;  4CJ5 A;  3AVH A;  4KFB A;  4AIL C;  2XY8 A;  1CZB A;  3V1R A;  1BCM A;  1CZ9 A;  3PO4 A;  4TSX A;  1NJW A;  1NKB A;  1S1T A;  3TAM A;  4FZY A;  4E7L A;  3THV A;  3SQ4 A;  3K5N A;  1QS4 A;  4JS4 A;  4CIE A;  4KB0 A;  3LPU A;  4ZTF A;  5E41 A;  4E89 A;  4FJL A;  2OPP A;  5J2P A;  1ASW A;  3KD5 E;  2KZZ A;  4FLV A;  1IKW A;  4CEF A;  4CE9 A;  1L3V A;  4B9U A;  4CEA A;  1S9G A;  4AHR A;  4M3Y A;  3U6F A;  3LP1 A;  4CER A;  4H4O A;  3NFA A;  4FLZ A;  4E3S A;  1Y97 A;  2ZQB A;  3LAK A;  4DTN A;  4I9L A;  4PY5 A;  2RF2 A;  3K57 A;  1NJX A;  1L3S A;  2HVH A;  4LY7 A;  4BDY A;  4F3T A;  2EHG A;  3AVK A;  4H8K A;  4KTW A;  3NH2 A;  3S9H A;  5CY4 A;  1IO2 A;  3TAR A;  3QEW A;  4F2R A;  2QKK A;  1JLC A;  2DFE A;  2NUB A;  3ZT3 A;  3RR8 A;  4GW6 A;  4CJE A;  3NAE A;  1ASV A;  1NK9 A;  3JYT A;  3RWU A;  2RKI A;  1BIS A;  2R7Y A;  4ZTJ A;  3LAL A;  4KHY A;  4FLU A;  2HHU A;  1FKP A;  1LAV A;  1L5U A;  1O1W A;  1NK5 A;  5EU7 A;  1R0A A;  3IG1 A;  3WNG A;  1VK0 A;  3AO2 A;  3H08 A;  3OYM A;  2KFN A;  3KJV A;  3V9U A;  2YNH A;  1WSI A;  4CJS A;  1KVB A;  1BHL A;  1NK4 A;  1QSL A;  4OPK A;  3AVF A;  5HP1 A;  4BAC A;  2LSN A;  1DLO A;  3SQ2 A;  3I0S A;  4CEE A;  2O4G A;  1SV5 A;  3NF6 A;  3LAM A;  2P51 A;  2Z1H A;  4UQG A;  4AHS A;  3HM9 A;  1UA1 A;  4FZZ A;  4CJV A;  3OYC A;  3NCI A;  2VWJ A;  3NF9 A;  4E7I A;  4FZX C;  2Y1J A;  1RT6 A;  3VQ7 A;  1D5A A;  2ITG A;  3QIO A;  1TL3 A;  1QHT A;  1WNS A;  1VSH A;  4BWJ A;  3PY8 A;  4N41 A;  3B6P A;  5C24 A;  4M42 A;  3AVG A;  4LD0 A;  1NK7 A;  4O55 A;  3DOL A;  3ASM A;  2PYJ A;  4KRE A;  1DTT A;  4IBN A;  1EKE A;  3AV9 A;  4G1Q A;  3PUF A;  1RT7 A;  1TKT A;  4RW8 A;  4CFA A;  1RT4 A;  2Z1I A;  3SPZ A;  3AA5 X;  3C6T A;  1JXE A;  2D0B A;  4YNQ A;  1J54 A;  4FJX A;  3K5L A;  4DFP A;  4B9V A;  3OYI A;  4JLH A;  1D9F A;  1HMV A;  1RDC A;  1HYZ A;  4M45 A;  4CJQ A;  3HPG A;  1TKX A;  3AA3 A;  4W5O A;  3SJJ A;  4KI6 A;  4CGD A;  4Z4I A;  1QSY A;  5KGW A;  2ZD1 A;  4KAZ A;  3AVN A;  3V1Q A;  1NK6 A;  2F96 A;  1TKZ A;  3OYE A;  3HL8 A;  1KVC A;  1WAF A;  3RMC A;  1KLM A;  3AVC A;  4I7F A;  3SQ0 A;  3MXM A;  4OKJ A;  2QKB A;  4W5Q A;  1RT5 A;  3VQ6 A;  4IKF A;  4DLG A;  2JLE A;  4Z4G A;  4E19 A;  2HHQ A;  4FJH A;  4M3X A;  3TR8 A;  1RBS A;  1KFD A;  1RBV A;  4IG0 A;  1LWF A;  3VA3 A;  3SI6 A;  1ZBU A;  1T7P A;  1QTM A;  1MU2 A;  3D0P A;  4Z4C A;  4CK2 A;  4B9S A;  3S3N A;  3HO1 A;  4QOZ B;  3IAY A;  1HNV A;  3HK2 A;  4NYF A;  2G8H A;  3OYL A;  4LH5 A;  3V9X A;  3QIN A;  4I2Q A;  1DTQ A;  2EX3 A;  1C6V A;  4CHP A;  3UIQ A;  5C25 A;  4YFU A;  4W5R A;  4DTP A;  1HYV A;  3RRH A;  3U3G A;  5HBM A;  2YHA A;  2XY6 A;  1WN7 A;  4FW1 A;  3AVJ A;  1ITG A;  1A5W A;  1QE1 A;  2WON A;  3KLH A;  1TL1 A;  4QCL A;  3OYD A;  2KFZ A;  3KLG A;  1S1U A;  4DQI A;  1NK8 A;  3HP9 A;  2GUI A;  3RR7 A;  4K8Z A;  1B92 A;  1JL2 A;  4FK4 A;  3OS0 A;  3DLH A;  2GBZ A;  1LV5 A;  3F9K A;  3MEG A;  4B8A B;  1NJY A;  4DTJ A;  2BDP A;  4NCG A;  3L2Q A;  1XWL A;  1TV6 A;  3NDK A;  1K6Y A;  2HB5 A;  3P83 D;  3P1G A;  5FDL A;  4NCB A;  3ZT2 A;  3NF8 A;  3QER A;  1WLJ A;  3SUO A;  3E01 A;  2GV9 A;  3QO9 A;  3MXJ A;  1KCF A;  1X9S A;  3QNN A;  4XIU A;  3LP2 A;  3K5O A;  4AHV A;  4KV8 A;  1C0T A;  3PX6 A;  2HMI A;  3C94 A;  1JXB A;  3SYZ A;  3SUN A;  1S1X A;  4NCA A;  3AO3 A;  5HRP A;  4DSF A;  3AO5 A;  4DTX A;  3NH1 A;  1U04 A;  3ZSR A;  3TAN A;  3S3M A;  1LW2 A;  3QEI A;  3I8D A;  4OGE A;  2XRI A;  3M8P A;  3OYA A;  3OJS A;  4FM2 A;  3AVI A;  3BGR A;  5HRR A;  4DF8 A;  3HJF A;  1ZBL A;  4PA1 A;  1YTA A;  1L3U A;  3LWM A;  2KZM A;  5JS1 A;  4GVM A;  1Q9Y A;  5KRT A;  2DTU A;  3NGZ A;  2DFF A;  1BL3 A;  2BGG A;  3TAP A;  2RN2 A;  3L2W A;  3ZT1 A;  5KI6 A;  3PV8 A;  4HCC A;  5J2M A;  1LWE A;  2OYQ A;  1A5X A;  3SNN A;  3AA4 A;  2HHT A;  1KFS A;  1VSJ A;  2QXF A;  4BE1 A;  1J5O A;  4GMJ B;  2FBT A;  1RT2 A;  3T19 A;  1EP4 A;  3HVR A;  4Y1D A;  1NKC A;  4CF0 A;  4CIG A;  3VA0 A;  3V81 A;  3M8Q A;  1L3T A;  1Z26 A;  4IDK A;  3DLE A;  1FXX A;  2VG7 A;  3MEE A;  4DFM A;  4DTR A;  4KHQ A;  3EY1 A;  1SKR A;  3VQ4 A;  4JRP A;  2DY4 A;  1VSD A;  3TAF A;  1WSH A;  4CIF A;  5HRO A;  2OA8 A;  1GOA A;  2E6M A;  4N56 A;  5HLF A;  4FJG A;  2G8W A;  4ID1 A;  1WSE A;  3OYK A;  2PY5 A;  4PWD A;  3K2P A;  3RMB A;  3CQ8 A;  1XHZ A;  1LW0 A;  1G15 A;  2G8U A;  2FC0 A;  4CJP A;  4E1N A;  3DLG A;  4BDP A;  4ELU A;  2IOC A;  1Q8I A;  4DFK A;  4E7H A;  4OLA A;  1TK0 A;  3HPH A;  1YT3 A;  4Q0B A; 
#chains in the Genus database with same CATH topology
 2HBJ A;  4KBO A;  3JS6 A;  3VEO A;  4HTU A;  4FYD A;  5K14 A;  3A0I X;  3SV4 A;  3VQD A;  4JI3 K;  1LWC A;  2JWL A;  4JKE A;  3SAF A;  2GWK A;  3O6W A;  4GY2 B;  3OVN A;  3L8B A;  4BWM A;  1BI4 B;  3LZJ A;  4XH5 A;  2FSJ A;  2WUS A;  3O8M A;  4X66 K;  2ZM6 K;  3ZSZ A;  3O1B A;  3V1O A;  2P9P A;  3ZLJ A;  1M90 O;  4HUG A;  4OVL A;  3ZET B;  5BR9 A;  5EXW A;  4DR5 K;  4LFC K;  5HOO A;  5FPN A;  4K42 A;  4B3O A;  1NMD A;  4CJK A;  2VQF K;  1CZA N;  1RBT A;  3QIP A;  2I5J A;  3QBW A;  2NRH A;  1JLA A;  1P8Z A;  2YCH A;  3PX0 A;  1JCG A;  3VEV A;  2HW3 A;  2IIR A;  4CFD A;  3E66 A;  3HXM A;  2W42 A;  4CHN A;  5AQU A;  3C65 A;  3KHY A;  4DFJ A;  3J81 O;  3CQX A;  4JKG A;  3UB5 A;  1K8K B;  5AQF A;  3TSQ A;  3V6D A;  1X9W A;  1ATN A;  3ATU A;  3SJH A;  3ZT0 A;  3AGR A;  5EX5 A;  4N5S A;  3QFU A;  4CJR A;  4M3T A;  1FJG K;  4FJ7 A;  4FPB A;  2J4R A;  3MWP A;  4M3R A;  1NGA A;  3LP3 A;  1J53 A;  5AQY A;  1W0H A;  4H0V B;  1RTJ A;  5AQT A;  4BRD A;  1TK5 A;  2W41 A;  3IFR A;  3KK2 A;  1NBW A;  1BG3 A;  5CR4 A;  3SZ2 A;  4CJW A;  2G8V A;  4BRF A;  3MEC A;  2YNG A;  3CG7 A;  4H4M A;  2BUP A;  3HSC A;  3TSU A;  1U49 A;  4CJL A;  2RHK A;  2Q3S A;  4PUO A;  4B1X B;  2HVI A;  3NGI A;  1JLF A;  3F2K A;  1C0M A;  1CXQ A;  2QI2 A;  4FWP A;  1RDB A;  3LPT A;  3RSE A;  3TI0 A;  4YOR A;  3I56 N;  5J2Q A;  3CD6 N;  4DU1 A;  4JKA A;  4W5T A;  4YOU A;  3UKU A;  1RIL A;  4N76 A;  3NBP A;  2P1J A;  3OBW A;  3L3V A;  4BRQ A;  3H46 O;  2YNF A;  5HL7 L;  3P5J A;  4RCH A;  4DU3 A;  4KRE A;  3HZ6 A;  5M1F A;  4F3O A;  3QET A;  4B9N A;  3S41 A;  1VSF A;  1WAJ A;  5AQS A;  2D0C A;  3ZSQ A;  3SK3 A;  1K73 O;  4FJI A;  4CHO A;  4PHT X;  3ALY A;  4GNI A;  4JS5 A;  2O4I A;  4RTF D;  2Q0R A;  4WQ5 A;  3E9P A;  4CBU A;  3VF2 A;  3SUQ A;  3O3H A;  1OH6 A;  5E41 A;  2OPQ A;  4DMN A;  4EIA A;  3T1A A;  2PY5 A;  4CGJ A;  3SUP A;  3G6E N;  1JCF A;  3ULE A;  3OYN A;  4BR0 A;  2HOE A;  2FXU A;  3O9S A;  2VWK A;  4ID5 A;  3AGK A;  5AQV A;  3CM5 A;  4DV5 K;  2VWB A;  4MLE A;  4CGG A;  4HVJ A;  2ATQ A;  1S1W A;  4R79 A;  2FF3 B;  4IDH A;  3ZT4 A;  4A57 A;  3RTV A;  1NOY A;  3EEQ A;  1RT3 A;  4EZ9 A;  3C95 A;  2HND A;  3AAP A;  4DR4 K;  3KWG A;  4H5W A;  1JKH A;  3IRX A;  4B8C A;  2X6S A;  3KK1 A;  3SLC A;  1W9H A;  4H5N A;  3UKU B;  1HNI A;  1D9D A;  2ZJR L;  4CFB A;  1SUQ A;  3BEX A;  3MED A;  4JI1 K;  2DFH A;  3B8A X;  4YDU A;  3J7A P;  3MX2 A;  5AZJ A;  1SL1 A;  2VYP A;  4B9M A;  2X74 A;  4JHD B;  1T8E A;  1XC3 A;  4B9T A;  5AR0 A;  2A1R A;  1RDA A;  2F4V K;  4AF1 A;  4IFY A;  4FL9 A;  1YJN N;  3THY A;  4ICL A;  3QLH A;  4NLB A;  3HP6 A;  3N4P A;  1XHX A;  4JRQ A;  1VQ9 N;  4FW2 A;  3ID6 A;  4YY3 K;  3C7N B;  5EVZ A;  3AVH A;  4AIL C;  3V1R A;  4FZY A;  4JS4 A;  1QS4 A;  2OPP A;  3O5B A;  4QS8 A;  2KZZ A;  4CEA A;  1S9G A;  3CCR N;  3LP1 A;  4H4O A;  3NFA A;  1Y97 A;  2ZQB A;  3LAK A;  2RF2 A;  4BQZ A;  1L3S A;  3MN6 A;  2EHG A;  1NJI O;  3S9H A;  1VAZ A;  3QEW A;  4JI8 K;  4F2R A;  4BG8 A;  1JLC A;  4LF5 K;  4K25 A;  4NLC A;  3PSI A;  3EE8 A;  4JK7 A;  1NGC A;  3FZF A;  4ZTJ A;  3LAL A;  2NRZ A;  4FLU A;  2HHU A;  4JKB A;  4DV2 K;  1VQ7 N;  3OYM A;  2KFN A;  1T3V A;  2YNH A;  1NK4 A;  1KAX A;  3DXK A;  5HP1 A;  4CCH A;  1SV5 A;  3NF6 A;  4AHS A;  4IEE A;  4CJV A;  3OYC A;  3CC7 N;  4WQ4 C;  4ISG A;  3FLC O;  5KQ8 A;  2VWJ A;  4FZX C;  1T6C A;  1RT6 A;  1D5A A;  2KKZ A;  1WNS A;  5C24 A;  3DJC A;  3CJ1 A;  1GLE G;  1VQP N;  1NK7 A;  4O55 A;  2FSN A;  1Q86 O;  3VTI A;  1DEJ A;  3VGL A;  1GLF O;  1TKT A;  3SPZ A;  1NGE A;  4I6M A;  1HKG A;  3K5L A;  3TTC A;  3OYI A;  1FW6 A;  1HMV A;  1RDC A;  4IOC L;  4M45 A;  4CJQ A;  4W5O A;  3AA3 A;  3SBT A;  4CGD A;  1Y64 A;  3AVN A;  3V1Q A;  1IBL K;  3OYE A;  2O8C B;  3RMC A;  1KLM A;  2QKB A;  2CGL A;  5BPM A;  2GEM A;  4IKF A;  3BY5 A;  5JLH A;  3D2E A;  2O8E A;  4M3X A;  4LC9 B;  1T7P A;  1ZBU A;  3D0P A;  4QOZ B;  5BRH A;  1GLD G;  1V4S A;  4NYF A;  2DPN A;  3V9X A;  5LJV A;  4I2Q A;  4M7X A;  4YFU A;  2NLX A;  2XY6 A;  4FW1 A;  3AVJ A;  1A5W A;  2WON A;  2YHX A;  3QDK A;  1TL1 A;  3OYD A;  5M1P A;  2P9N B;  5FPE A;  5A2Q O;  1B92 A;  3OTO K;  4WQ5 C;  2BDP A;  1VQ5 N;  3MN7 A;  5TKY A;  3L2Q A;  1XWL A;  1TV6 A;  3P83 D;  4Z94 A;  3P1G A;  5FDL A;  3JXU A;  4B1Y B;  3ZT2 A;  3NF8 A;  1QQO A;  1WLJ A;  3E01 A;  2QWR A;  3MXJ A;  1KCF A;  1HKB A;  3QNN A;  4KV8 A;  4AM6 A;  3PX6 A;  2CGK A;  4NCA A;  3S3M A;  3WXM B;  3NH1 A;  4I6M B;  3ZSR A;  2I7N A;  3CXC M;  4OGE A;  2XRI A;  1YAG A;  3AVI A;  1I94 K;  2P9L A;  3L4I A;  4L3Q A;  2O8D A;  5AQG A;  1OH8 A;  4DV4 K;  4GVM A;  1Q9Y A;  3O9Q A;  3NGZ A;  3CCS N;  2BGG A;  4LF6 K;  2GWJ A;  1LWE A;  3AA4 A;  1VSJ A;  4BE1 A;  4DV6 K;  4MLH A;  1RT2 A;  1EP4 A;  4CF0 A;  4CIG A;  4MO5 A;  3VA0 A;  3QIC A;  3I55 N;  1ILY A;  1QQN A;  3TSP A;  1WSH A;  4FJG A;  5HLF A;  4PWD A;  1U6Z A;  3F9M A;  4JD2 A;  1T6D A;  4CJP A;  4B3T K;  1BU6 O;  5FLX O;  3O4W A;  2F8T A;  4FK0 A;  2A3Z A;  3KKR A;  3K58 A;  1NKE A;  4BE2 A;  1BUP A;  1KRP A;  4F2S A;  1H1V A;  1TAU A;  2YI1 A;  5FPD A;  3AA2 A;  5DK5 A;  4KHN A;  2W6K A;  1DKG D;  3PLA A;  3LWL A;  5EY4 A;  5KTQ A;  1SL0 A;  3HPO A;  3T7Z A;  3QEX A;  4KTZ A;  1YIJ N;  1KSP A;  3KKS A;  4YOY A;  3HRG A;  4EHU A;  4DSJ A;  2O8D B;  4IO8 A;  2HHH K;  3BF3 A;  4E1M A;  3KIO A;  1ZYQ A;  1VSK A;  3ITH A;  4BR7 A;  4H03 B;  3G25 A;  3TWH A;  4EZ6 A;  2IVO A;  5AQQ A;  4O0J A;  2RE2 A;  4CJU A;  1ZBF A;  1WUA A;  5GIP A;  5C42 A;  1KVA A;  1EX4 A;  4DTM A;  3MWT A;  3QBX A;  5AQJ A;  3F73 A;  2YKN A;  4CZJ A;  4BC2 A;  1TGO A;  3ZSY A;  5DM7 L;  1BCO A;  2KQ2 A;  3I0R A;  4KI4 A;  1V4T A;  3T3F A;  3WNE A;  3QES A;  4GKJ K;  1RNH A;  4LF9 K;  1BQM A;  1TK8 A;  5AQK A;  3VQ8 A;  4IZ9 A;  1QQC A;  1C1A A;  4JD2 B;  1Q82 O;  3B6O A;  4FJM A;  3L3U A;  4BC4 A;  4DF4 A;  2HNZ A;  4O8U A;  3G0Z A;  3EZ5 A;  4C8M A;  5J2N A;  5CYQ A;  3WQT A;  1OVQ A;  4BVO A;  3OYF A;  3QNO A;  1X9M A;  4OKE A;  3NGY A;  3IS9 A;  1OKJ A;  2G8I A;  3ZSO A;  4KRF A;  3EE9 A;  2QWO A;  3ZSX A;  1U45 A;  1U4B A;  1BI4 A;  2CGJ A;  5CHI A;  4E7K A;  3H1V X;  1HQU A;  1EWR A;  4MFB A;  4R5P A;  4CF1 A;  4NYN A;  1N6Q A;  4CHZ A;  2HNY A;  4HUF A;  2EWS A;  4BRM A;  1BGX T;  4H5T A;  1D8Y A;  2XY5 A;  3OA9 A;  2G8K A;  5AQH A;  5FPM A;  4FJ5 A;  3VQ9 A;  4CES A;  1EET A;  3E9L A;  4B08 A;  2P9U B;  4CZI A;  4MO4 A;  2I7P A;  3AVL A;  4CHY A;  1VQ4 N;  3EYZ A;  3FGU A;  2HF4 A;  3FZK A;  4DSK A;  4CZH A;  4OPJ A;  1FKO A;  1ZXO A;  4C8L A;  1KQS M;  3J8A A;  3THX B;  4ELV A;  4E7J A;  2YKM A;  4AHC A;  3OBY A;  4Z0U A;  3WQU A;  1C1B A;  1JLG A;  4FLW A;  5FRN A;  4B1U B;  2UXB K;  5CZ1 A;  3HT3 A;  1HYS A;  1K8K A;  4OKK A;  1IG9 A;  5AQN A;  3TAG A;  2JGU A;  4DQQ A;  4IJA A;  4CEO A;  4BE0 A;  4A2A A;  5M1K A;  4J2E A;  2B4J A;  1P90 A;  1WSF A;  3RMD A;  3TPQ A;  2E4L A;  4AHT A;  2FBY A;  5M1O A;  5HRS A;  4DTU A;  1DT9 A;  1SS6 A;  3Q7B A;  1WBB A;  4H0T B;  4X64 K;  1NK0 A;  3K59 A;  5M1N A;  2VG5 A;  5CE3 A;  3LL3 A;  4DQS A;  4FLY A;  1VRT A;  5D3G A;  1TVR A;  4FWR A;  2F9W A;  1KTQ A;  5GIO A;  1HUX A;  2YV0 X;  2Z1J A;  4NB4 A;  4J2D A;  1TAQ A;  2A1S A;  2WOM A;  5KGX A;  2P9I B;  2E8A A;  5FRO A;  4M3W A;  1HLU A;  1WSG A;  5I9E B;  3VER A;  1XMQ K;  1YXQ A;  2GEL A;  4FVU A;  3MXI A;  3GG4 A;  3V9S A;  2Y1I A;  1N33 K;  4K8X A;  3MX5 A;  4FCY A;  5ADX A;  1JJ2 M;  1HJO A;  4J8F A;  5JLF A;  3H3N O;  4DS5 A;  2PFU A;  1HQE A;  3H45 C;  3LDN A;  4AM7 A;  3VQP A;  1N8R O;  4CHQ A;  4O44 A;  5J1E A;  3HVT A;  2HMI A;  2OPR A;  3VN5 A;  2E6L A;  4FOE A;  4H5R A;  2V51 B;  4FJJ A;  1E4F T;  5AQP A;  4W5N A;  4DSL A;  4EP5 A;  1QHA A;  1E4G T;  1RT1 A;  5HRN A;  1N32 K;  5GAE P;  2IS3 A;  2QEX N;  4Z4E A;  3CJ9 A;  3OS2 A;  4Z4H A;  1HNW K;  3P39 A;  2YHY A;  1XMO K;  5KQD A;  4CGF A;  3LAN A;  3VPZ A;  3OYG A;  3TTF A;  1NOZ A;  5I3U A;  4CZF A;  1MDU B;  3EZW A;  3ZX0 A;  3U9Z A;  4KHP K;  3KLE A;  4CEZ A;  1RBR A;  3VGM A;  2D0P A;  1C1C A;  5AJ3 K;  1RCH A;  2FSK A;  5KPZ A;  3TAQ A;  2Q1N A;  4CJ5 A;  3ATV A;  2W6L A;  2XY8 A;  1CZB A;  3PO4 A;  1NKB A;  1S1T A;  3THV A;  3SQ4 A;  4CIE A;  4KB0 A;  4FPA A;  3ZEU B;  2E2Q A;  1ASW A;  1BA1 A;  4F9O A;  3C6A A;  1QVG M;  3D7E O;  3U6F A;  4M63 C;  4E3S A;  5AQI A;  4DTN A;  1NJX A;  2HVH A;  4DUY K;  2P9K A;  3AVK A;  4H8K A;  5CY4 A;  1IG8 A;  2DFE A;  3ZT3 A;  2AP1 A;  3NAE A;  1NK9 A;  3JYT A;  3RWU A;  1NWK A;  2D4W A;  3DXM A;  3KWI A;  4JAX A;  4K41 A;  2WBN A;  4BR4 A;  1O1W A;  3I33 A;  1NK5 A;  1WBD A;  1R0A A;  4FOI A;  3P31 A;  3VEN A;  4H0X B;  1QSL A;  2Q2R A;  3BUZ B;  2YJF A;  3AVF A;  4BAC A;  2YX6 A;  3TU5 A;  3SQ2 A;  2NNW A;  2O4G A;  4JHD A;  4UQG A;  1UA1 A;  4E7I A;  4X65 K;  5BN9 A;  1TL3 A;  2UUB K;  1VSH A;  4IXC A;  1BA0 A;  1DGK N;  4ISF A;  3MMV A;  3DOL A;  3NMU A;  2PYJ A;  3FZH A;  4BQL A;  3AV9 A;  4RW8 A;  4CFA A;  1K8A O;  3R9P A;  1JXE A;  3C7N A;  2D0B A;  4YNQ A;  2QWN A;  1BOT O;  1IBM K;  4DFP A;  1HYZ A;  2ZJQ L;  2A40 A;  3HPG A;  1TKX A;  4Z4I A;  1QSY A;  5KGW A;  1NK6 A;  4BR9 A;  1KVC A;  1WAF A;  5LY3 A;  4JN4 A;  4OKJ A;  4W5Q A;  4HTL A;  4E19 A;  5F1X A;  4IG0 A;  3VA3 A;  4DV3 K;  2P9K B;  1C0F A;  3OHR A;  4DR7 K;  4B9S A;  3S3N A;  3HO1 A;  5E84 A;  3OYL A;  3QIN A;  1NGJ A;  4A61 A;  4CHP A;  4KH4 A;  3DXM B;  1NGI A;  4DTP A;  3VMF B;  3RRH A;  2UXD K;  4B1V A;  4DQ8 A;  3U3G A;  5JIC A;  2YHA A;  3R8E A;  1WN7 A;  1YUW A;  3WXI A;  4WFA L;  2E5L K;  1NK8 A;  3RVC A;  2GUI A;  2VQE K;  4FK4 A;  4BGA A;  2W40 A;  4DTJ A;  4DUZ K;  1ZBS A;  4IFE A;  4CZL A;  5BN8 A;  2FLO A;  3CCM N;  4FWN A;  3QER A;  1O13 A;  3TTD A;  4JI4 K;  4WF9 L;  4JV5 K;  4WFN L;  1C0T A;  3CET A;  3SUN A;  3GOI A;  3QEI A;  3I8D A;  3OJS A;  2KHO A;  4FWO A;  3HJF A;  1RGI A;  5HRR A;  4DF8 A;  1NNE A;  2O8C A;  1YTA A;  2KZM A;  2QXL A;  3WXL A;  2DFF A;  2RN2 A;  1QQM A;  4HCC A;  2OYQ A;  3W0L A;  1KFS A;  1HKC A;  2QXF A;  4JKD A;  4GMJ B;  1IBK K;  4YOW A;  3HVR A;  1NKC A;  1KAZ A;  1X3M A;  2Q0U A;  3CJ7 A;  3L4Q A;  1VQO N;  1L3T A;  4KHQ A;  4DTR A;  4JRP A;  2E20 A;  2WC9 A;  4BRC A;  4CIF A;  4N56 A;  4V19 S;  3O9T A;  4H0O A;  3K2P A;  3HOS A;  3CQ8 A;  3L6Q A;  2P9N A;  2IOC A;  4DFK A;  4E7H A;  4OLA A;  1OH7 A;  3HPH A;  1NGF A;  2PBD A;  4ILJ A;  1KAY A;  4U7B A;  4DKW A;  2PZS A;  4LFA K;  3HST B;  3AVM A;  2IVP A;  5JMV A;  3S3O A;  4OPA A;  3DRP A;  1QSS A;  1M1K O;  4LSN A;  1TUU A;  3EO3 A;  2UUA K;  4CGH A;  3FZL A;  3D45 A;  4BVP A;  3K0S A;  4CD3 A;  4CK1 A;  3O80 A;  3LP0 A;  3L2V A;  1JLQ A;  4F4K A;  4Y1C A;  4DQR A;  3P38 A;  3VEX A;  1NGH A;  1GLA G;  4BRO A;  2HHV A;  4FWL A;  3ID8 A;  5C2F A;  3AVA A;  2HBL A;  4XEI A;  3ZSV A;  3V9Z A;  3OJU A;  4OLB A;  2HHX A;  3O4Q A;  2OCE A;  1NM1 A;  5C10 A;  5E26 A;  1YVU A;  4CK3 A;  3OYB A;  4BRK A;  3DMJ A;  1NJZ A;  1TYQ A;  3GDQ A;  4RW9 A;  4YHH K;  4LSL A;  4E0D A;  1HJR A;  1XQS C;  5M1Q A;  4JK9 A;  3PO5 A;  3DLR A;  3CHW A;  4O5B A;  3CF5 L;  5I42 A;  3V4I A;  1J6Z A;  4CJF A;  1I3A A;  3DI6 A;  2WFB A;  2ASM A;  4GV3 A;  3DRR A;  4DCH A;  1IKX A;  4B1Z A;  4KH6 A;  3M8R A;  2NZT A;  1BO5 O;  3U3Y A;  3M8S A;  3VEW A;  1LAW A;  1X1P A;  1XUP O;  3MN9 A;  2IDO A;  1RTI A;  4KH5 A;  4C23 A;  1NG9 A;  3IKM A;  2XO7 A;  1I39 A;  1R59 O;  3NHG A;  4FJ9 A;  3GBT A;  2IVN A;  3SV3 A;  1C0U A;  2IAJ A;  4CJ4 A;  4FWM A;  2YHW A;  1SQK A;  2AJQ A;  4CF2 A;  4PL7 A;  1N36 K;  2QWP A;  4Y0W A;  3KK3 A;  4KKO A;  1SZ2 A;  3T69 A;  3BDP A;  4DWI A;  4BY9 C;  3NE6 A;  1J5E K;  1UAX A;  3KLF A;  3A5L C;  1HNZ K;  4KPY A;  4YDU C;  3IMX A;  1T44 A;  3OYJ A;  3TAE A;  1TYQ B;  5AQW A;  4O4G A;  3DRS A;  4QS7 A;  4OX9 K;  4OGC A;  3VQB A;  1EXQ A;  4FJN A;  5CYM A;  2O8B A;  1K9M O;  1XC9 A;  2D0A A;  4ELT A;  1S6Q A;  3CFR A;  2O8F A;  2ZGZ A;  3EKS A;  2E1Z A;  4CZG A;  4OJR A;  1UWB A;  2ETJ A;  2PAV A;  3CCJ N;  1VSL A;  1A5V A;  5IWA K;  3RMA A;  4LF8 K;  3WEE A;  5BRF A;  3ZX2 A;  1QZ6 A;  1REV A;  4RW6 A;  5FRM A;  2HF3 A;  3O08 A;  1KLN A;  4AHU A;  3VQC A;  4BR5 A;  4U67 L;  1Z6R A;  3CJA A;  3CJC A;  3SAG A;  4HUE A;  3L2R A;  1SL2 A;  2FBV A;  4CJT A;  4DTS A;  4KB1 A;  2G8F A;  3AO1 A;  4FVM A;  4FXD A;  3VGK A;  4CI6 A;  3CIP A;  3J7Z O;  2P9U A;  2RPI A;  1SKS A;  4Q5V A;  4LF7 K;  5JVG L;  1VSE A;  2KW4 A;  1RBU A;  3CFP A;  3ULD A;  1ZBH A;  4MQ3 A;  3WUH A;  3CM6 A;  3VEY A;  3G10 A;  2OTL N;  1Q9X A;  4EFH A;  3THX A;  2XY7 A;  3NF7 A;  4GV6 A;  3LDQ A;  5F2R A;  4DR2 K;  3DLK A;  4DSI A;  4CJ3 A;  4BRL A;  5SWM A;  4CF8 A;  1GOC A;  4YOX A;  3DOK A;  1HPZ A;  4BDZ A;  3K5M A;  2O8B B;  2NRX A;  3MDQ A;  2O8F B;  1NMN A;  4EHT A;  3H1Q A;  3QEV A;  1SKW A;  4EAH D;  4BC5 A;  4QAG A;  3WT0 A;  3PX4 A;  4XH4 A;  2VGM A;  2F8S A;  3THW B;  2BE2 A;  3SCX A;  3WEE B;  1S6P A;  1RDD A;  4L8R B;  2BAN A;  2KLA A;  3CCQ N;  4N47 A;  3QML A;  3AO4 A;  2P9I A;  3DLB A;  1IJJ A;  3G71 N;  2GX9 A;  1B9D A;  2QK9 A;  4PQU A;  2KTQ A;  3KD1 E;  5H1S Q;  4KFB A;  1CZ9 A;  4B1W B;  3VTH A;  5KPT A;  4ZTF A;  3CCU N;  4FJL A;  1WOQ A;  4FLV A;  1IKW A;  4CEF A;  3AY9 A;  4B9U A;  2BH1 A;  1YIT N;  4M3Y A;  4FLZ A;  3U8X A;  4I9L A;  3CJB A;  2A6A A;  3K57 A;  1NGD A;  4F3T A;  3NH2 A;  3E9O A;  4BRP A;  2QKK A;  2NUB A;  1ASV A;  1BIS A;  2BTF A;  1FKP A;  1LAV A;  1L5U A;  5F0X A;  4WYB A;  3IG1 A;  3WNG A;  1VK0 A;  3H08 A;  3KJV A;  1WSI A;  4CJS A;  1KVB A;  1BHL A;  4BRE A;  4PKG A;  2LSN A;  4FWQ A;  5C12 A;  1VQ8 N;  4A5B A;  4JKC A;  3E1Y A;  3UKR A;  3O9U A;  2QW9 A;  3SAH A;  3BP8 A;  3NCI A;  3PIO L;  3VQ7 A;  1YVN A;  3QIO A;  3M6G A;  5AQR A;  3PY8 A;  4JI5 K;  3FZM A;  4JYA K;  3LDO A;  3MCA B;  4LD0 A;  2A41 A;  3QB0 A;  4C1N I;  3ASM A;  5MLC Q;  1DTT A;  4IBN A;  1EKE A;  3AAR A;  3FE1 A;  1RT7 A;  4YOV A;  3AA5 X;  4BG9 A;  4B9Q A;  2P9S B;  3KVG A;  4OO1 J;  4BGB A;  4FJX A;  3IDH A;  3P4I A;  4JLH A;  1HR0 K;  5AFU A;  4HWI A;  3ZEU A;  4A2B A;  4RWT A;  2F96 A;  1TKZ A;  3HL8 A;  1EO1 A;  3O9R A;  3AVC A;  4I7F A;  5C0Y A;  2E2N A;  1RT5 A;  4Z4G A;  4FJH A;  1KFD A;  1RBV A;  1LWF A;  4NXM K;  3SI6 A;  1XNQ K;  1HNV A;  4CBW A;  1VHX A;  3MN5 A;  2G8H A;  4LH5 A;  1DTQ A;  1EQY A;  1C6V A;  2EX3 A;  4C1N K;  3WXJ A;  4GV9 A;  3UIQ A;  5C25 A;  4W5R A;  5C2D A;  2ZWH A;  3HOT A;  4PKH A;  1QE1 A;  1EWQ A;  3UKR B;  4GKK K;  3VES A;  3C0B A;  3HP9 A;  3RR7 A;  2QWM A;  3OS0 A;  3CCE N;  1LV5 A;  4LFB K;  1K6Y A;  3DWL A;  5GAD P;  3J7Y P;  3SUO A;  2GV9 A;  1VQM N;  4XIU A;  3LP2 A;  3EL2 A;  3K5O A;  4E1J A;  4IO9 L;  2HMP A;  3C94 A;  1U04 A;  3SMP A;  5AQL A;  3TAN A;  1LW2 A;  4O8K A;  4WQ4 A;  1ZBL A;  1L3U A;  1MWK A;  3LWM A;  5JS1 A;  2P9P B;  5KRT A;  4BRH A;  2DTU A;  1MWM A;  4JEP A;  1BL3 A;  3CPW M;  3L2W A;  3QFP A;  3ZT1 A;  3PV8 A;  4DR1 K;  3SNN A;  1G99 A;  3ENH A;  4QS9 A;  2HHT A;  3A5M C;  2FBT A;  3CER A;  4IWV A;  4JI6 K;  1HNX K;  5LL6 Z;  1Z26 A;  3DLE A;  1FXX A;  3MEE A;  5BRE A;  4DFM A;  3EY1 A;  5HRO A;  2OA8 A;  1GOA A;  1BDG A;  4ID1 A;  3VOV A;  3OYK A;  4B3R K;  3RMB A;  2E1Y A;  1G15 A;  2FC0 A;  3DLG A;  4FO0 A;  4ELU A;  1Q8I A;  4JI7 K;  3F5T A;  1TK0 A;  3U4L A;  4Q0B A;  5GAG P;  3ENB A;  1FK9 A;  3A5N C;  4JKG B;  2VG6 A;  5AQX A;  5AFU H;  4FK2 A;  4A5A A;  3U9D A;  1YJ9 N;  4LF4 K;  5T7B A;  4IOA L;  2H3G X;  3ZX3 A;  5ADX H;  4FLT A;  3T1Y K;  1IV0 A;  4J2A A;  3DM2 A;  3H6E A;  1GLJ O;  2F9T A;  3WXK A;  1NGG A;  2ZJP L;  2PYL A;  1ATS A;  4FJ8 A;  3CI5 A;  3PSF A;  4ILG B;  3CC4 N;  2UU9 K;  1CLQ A;  5DMR A;  2E2O A;  3VQE A;  1YF5 L;  3VEZ A;  4DB3 A;  4JNE A;  4I9Q A;  4H0P A;  4WE1 A;  5LMU K;  1S5J A;  3GE1 A;  3JAM O;  3PIP L;  4JI2 K;  3NH0 A;  1HPM A;  3SBG A;  3FFI A;  2WTU A;  2JWK A;  1W97 L;  2CH6 A;  3L2U A;  4WCE L;  2B6A A;  3R1X A;  4ZHR A;  1ZBI A;  2D1K A;  2OZM A;  4H0Y B;  2YNI A;  2IGI A;  1TKD A;  1YHQ N;  4ISE A;  4DSE A;  1MA9 B;  4CFC A;  4M3Z A;  3KK7 A;  3VF6 A;  2Q97 A;  1JLE A;  1B9F A;  3AVB A;  3O3F A;  1Z25 A;  4C8O A;  3RRG A;  3LZI A;  4CD1 A;  5BPN A;  3RSE B;  3WNH A;  4C8K A;  1T05 A;  2ZGY A;  4I2P A;  3L0Q A;  1VSI A;  4RW7 A;  4FJK A;  3O1W A;  1GOB A;  5CZ2 A;  4EP4 A;  1X9J A;  4M3U A;  3OY9 A;  2D5R A;  1S3X A;  3VQ5 A;  4WFB L;  3CCL N;  4IEI A;  3Q7C A;  4F8R A;  1QVF M;  3EN9 A;  3TAB A;  4IG3 A;  2HHW A;  5KRS A;  4M41 A;  1CXU A;  1LOT B;  3ZCM A;  1OH5 A;  1SAZ A;  2YHB A;  4GVE A;  2E2P A;  1N5Y A;  1XI1 A;  4BRG A;  4HCB A;  5JS2 A;  4DU4 A;  4AQY K;  4HHT A;  2P5O A;  4KHW A;  4DQP A;  4DR3 K;  4Z4F A;  1ASU A;  3BZK A;  3M3Z A;  4CEC A;  3M5R A;  3C6U A;  4AH9 A;  2X6N A;  3ULE B;  1J9A A;  4A62 A;  1XNR K;  1TUY A;  1JLB A;  4UY8 O;  2F7T A;  2ZF5 O;  3SQ1 A;  2OAN A;  2HST A;  3G4S N;  3ZSW A;  4DTO A;  5C15 A;  1RTH A;  1F21 A;  4DLE A;  1VQN N;  3SPY A;  4O0I A;  1ATR A;  2B5J A;  4DG1 A;  2NRT A;  3N4Q A;  3K9K A;  1Z05 A;  1VQK N;  3D2F A;  2XHB A;  1VQL N;  1JL1 A;  2HHS A;  2OPS A;  4K0K K;  4IFV A;  1HRH A;  4BRN A;  2IC3 A;  3ISN C;  3MK6 A;  3R6M A;  4NXN K;  1UA0 A;  4DV0 K;  3MAQ A;  3VF4 A;  2FBX A;  4CZM A;  5AZJ B;  1S22 A;  3KTQ A;  4X62 K;  4C8N A;  4FM1 A;  4FM0 A;  1GLC G;  1BWF O;  4LH4 A;  4CW7 B;  4DR6 K;  3VQA A;  1BIZ A;  5SZT A;  3VQQ A;  1D4X A;  2QTD A;  3V9W A;  3LDS A;  1BQN A;  2UYT A;  1WB9 A;  3O4N A;  4CEQ A;  3THY B;  1RTD A;  1S9E A;  2HBM A;  2ASP A;  1KC8 O;  5LMN K;  3QEP A;  1GLB G;  1VRU A;  5ELZ A;  4M7Y A;  1Q81 O;  2X78 A;  3CPE A;  3CFO A;  3JSM A;  2E88 A;  4CBX A;  3BF1 A;  4RG8 A;  1UOC A;  4FWK A;  1S72 N;  4DV1 K;  2ZE2 A;  4J2B A;  4B9L A;  3FFK B;  2CH5 A;  3DLL L;  3WNF A;  1YTU A;  4CEB A;  4RW4 A;  3CMA N;  2AA4 A;  3HYF A;  1W7A A;  4KHU A;  4CED A;  1KD1 O;  1VSM A;  3D2F B;  3K9J A;  3OYH A;  1BIU A;  3DYA A;  4PL8 A;  1T03 A;  3O3G A;  1N34 K;  1ESV A;  4CJ7 A;  4CVN E;  3DXK B;  2Z1G A;  4DHY A;  4KTQ A;  3A8Y A;  4KO0 A;  4CF9 A;  3CYM A;  1NLV A;  3KLI A;  4FLX A;  1IKV A;  4FWS A;  2OTJ N;  4G9Z A;  1NGB A;  4NO7 A;  4DS4 A;  1IH7 A;  2V7Z A;  2QM1 A;  3MCP A;  1IKY A;  4CGI A;  4B3S K;  1S1V A;  1U47 A;  2YJE A;  5LJW A;  1WSJ A;  4KHS A;  3I8B A;  2OZS A;  3A2F A;  4BRA A;  3OS1 A;  1U48 A;  3FR0 A;  2P5G A;  3HM8 A;  1BCM A;  4TSX A;  1NJW A;  3TAM A;  3IUC A;  4E7L A;  3K5N A;  3LPU A;  4E89 A;  5J2P A;  3KD5 E;  3A5O C;  4CE9 A;  1RDU A;  3T1H K;  4BRI A;  4AHR A;  4CER A;  4PY5 A;  1JCE A;  2GTD A;  4LY7 A;  4BDY A;  4IJN A;  1RDW X;  3D2E B;  2O8E B;  4KTW A;  2ASO A;  4JKH A;  3LDL A;  1IO2 A;  3C6H A;  3TAR A;  3M1F A;  3RR8 A;  4GW6 A;  4CJE A;  2RKI A;  2R7Y A;  4YOT A;  3LM9 A;  4KHY A;  3NVM A;  3ENO A;  5AQO A;  5EU7 A;  3AO2 A;  3HI0 A;  5KPR A;  3V9U A;  4BR2 A;  3KZB A;  4OPK A;  3THW A;  1DLO A;  3I0S A;  4CEE A;  1L3V A;  4MDB A;  3LAM A;  2P51 A;  2Z1H A;  3HM9 A;  4FZZ A;  5DM6 L;  1HX1 A;  3NF9 A;  2Y1J A;  3OW2 M;  2ITG A;  2UXC K;  1U2V A;  2A42 A;  5AZI A;  1QHT A;  4BWJ A;  4XH1 A;  4N41 A;  4M42 A;  3B6P A;  3AVG A;  3VET A;  1VQ6 N;  3J80 O;  1X3N A;  5IT9 O;  1OVY A;  2NRR A;  4G1Q A;  1Q18 A;  3PUF A;  5JVH L;  1RT4 A;  2Q31 A;  2Z1I A;  3H3O B;  3C6T A;  2GUP A;  4DV7 K;  3EKU A;  1J54 A;  4B9V A;  1D9F A;  3SJJ A;  3CQY A;  4KI6 A;  2ZD1 A;  4KAZ A;  4OPH A;  2P9L B;  1Q7Y O;  3MXM A;  3SQ0 A;  3GL1 A;  2VCP A;  4BC3 A;  3VQ6 A;  4FSV A;  4DLG A;  2JLE A;  1QZ5 A;  2HHQ A;  3TR8 A;  1RBS A;  5BPL A;  1QTM A;  3R3L A;  1MU2 A;  1NU0 A;  4Z4C A;  4CK2 A;  3IAY A;  3HK2 A;  4CZE A;  2UUC K;  3HTV A;  3SMS A;  4JKF A;  4ILH A;  1HYV A;  3NVK A;  5BR8 K;  3DAW A;  5HBM A;  1ITG A;  3LM2 A;  4H5V A;  2Q36 A;  4PKI A;  3KLH A;  2KFZ A;  4QCL A;  3KLG A;  5GIN A;  1S1U A;  4DQI A;  2QA4 N;  4K8Z A;  1JL2 A;  3UE5 A;  2GBZ A;  3DLH A;  3F9K A;  3MEG A;  2NRW A;  4B8A B;  1NJY A;  4NCG A;  3CC2 N;  3NDK A;  1U2V B;  2HB5 A;  5AZI B;  1YI2 N;  5AQZ A;  4NCB A;  5BRD A;  2HBK A;  3QO9 A;  1X9S A;  3BZC A;  4AHV A;  5TKW A;  2P9S A;  3SYZ A;  1JXB A;  1GLL O;  5GAH P;  1S1X A;  3AO3 A;  5HRP A;  4DSF A;  3AO5 A;  4DTX A;  4IOX A;  1C0G A;  1KXP A;  3M8P A;  3OYA A;  4FM2 A;  1E3M A;  4JI0 K;  3ZYY X;  3BGR A;  4PA1 A;  1W2B M;  4JK8 A;  2ITM A;  4CZK A;  1ZC6 A;  2NRV A;  4K43 A;  3ZET A;  4A59 A;  3TAP A;  3AAQ A;  5KI6 A;  5J2M A;  1A5X A;  4MDA A;  1J5O A;  1YJW N;  3T19 A;  3W3D A;  4Y1D A;  3CME N;  3V81 A;  3M8Q A;  5AQM A;  4IDK A;  3D6R A;  2VG7 A;  4O5F A;  2QWQ A;  1SKR A;  2A5X A;  2QWL A;  3HBT A;  3VQ4 A;  1RFQ A;  4B3M K;  1VSD A;  2DY4 A;  3TAF A;  3CCV N;  2V52 B;  2V7Y A;  2E6M A;  3LDP A;  2G8W A;  1WSE A;  5B8H A;  1XHZ A;  1LW0 A;  2G8U A;  4E1N A;  4BDP A;  5EOY A;  1LCU A;  2FF6 A;  2VGN A;  1YT3 A;  2D0O A; 
#chains in the Genus database with same CATH homology
 4FK0 A;  1FK9 A;  3KKR A;  4HTU A;  2VG6 A;  3K58 A;  1NKE A;  2PZS A;  3HST B;  4BE2 A;  3AVM A;  1KRP A;  4F2S A;  4FK2 A;  2F8T A;  4FYD A;  3S3O A;  5K14 A;  1TAU A;  5T7B A;  3AA2 A;  5DK5 A;  4KHN A;  3LWL A;  3SV4 A;  3VQD A;  1LWC A;  3DRP A;  5KTQ A;  1SL0 A;  4FLT A;  3HPO A;  1QSS A;  4LSN A;  3QEX A;  4J2A A;  3DM2 A;  3OVN A;  3L8B A;  4BWM A;  1BI4 B;  4CGH A;  3LZJ A;  4KTZ A;  1KSP A;  3KKS A;  2PYL A;  4FJ8 A;  3D45 A;  3ZSZ A;  1CLQ A;  5DMR A;  4DSJ A;  4I9Q A;  3VQE A;  3V1O A;  4CK1 A;  3LP0 A;  4E1M A;  3KIO A;  1ZYQ A;  1VSK A;  3ITH A;  4HUG A;  4OVL A;  4WE1 A;  3L2V A;  3TWH A;  4EZ6 A;  1JLQ A;  1YTU A;  4F4K A;  1S5J A;  4O0J A;  4Y1C A;  4DQR A;  4CJU A;  1ZBF A;  3NH0 A;  4B3O A;  5C42 A;  1KVA A;  4CJK A;  3FFI A;  1EX4 A;  4DTM A;  2HHV A;  1RBT A;  3L2U A;  2B6A A;  3F73 A;  2YKN A;  4ZHR A;  1ZBI A;  1TGO A;  3ZSY A;  3AVA A;  2OZM A;  3QIP A;  2I5J A;  3V9Z A;  1BCO A;  2YNI A;  2KQ2 A;  3ZSV A;  3I0R A;  3OJU A;  4OLB A;  2IGI A;  1JLA A;  3O4Q A;  4KI4 A;  3PX0 A;  3T3F A;  2HW3 A;  3WNE A;  3QES A;  4CCH A;  1RNH A;  1TKD A;  4CFD A;  3HXM A;  4DSE A;  2W42 A;  1YVU A;  1BQM A;  4CK3 A;  4CFC A;  4CHN A;  3OYB A;  1TK8 A;  4M3Z A;  3DMJ A;  1JLE A;  3VQ8 A;  1NJZ A;  1B9F A;  3AVB A;  4RW9 A;  3O3F A;  1QQC A;  1C1A A;  1Z25 A;  3B6O A;  4FJM A;  3L3U A;  4LSL A;  4C8O A;  3RRG A;  3LZI A;  4DF4 A;  4E0D A;  3WNH A;  4C8K A;  2HNZ A;  4DFJ A;  1HJR A;  1T05 A;  3G0Z A;  3EZ5 A;  3PO5 A;  4I2P A;  1VSI A;  4RW7 A;  3V6D A;  4FJK A;  1GOB A;  3DLR A;  5CZ2 A;  4C8M A;  4EP4 A;  4O5B A;  5J2N A;  4M3U A;  5CYQ A;  3OY9 A;  5I42 A;  1X9W A;  2D5R A;  3VQ5 A;  3V4I A;  3OYF A;  3QNO A;  3ZT0 A;  1X9M A;  4F8R A;  4OKE A;  4CJF A;  1I3A A;  3DI6 A;  3IS9 A;  3NGY A;  3TAB A;  4IG3 A;  3ZSO A;  4N5S A;  2G8I A;  4KRF A;  2HHW A;  5KRS A;  4CJR A;  4M3T A;  3ZSX A;  3DRR A;  4M41 A;  1IKX A;  1U45 A;  4FJ7 A;  1CXU A;  1U4B A;  1BI4 A;  3ZCM A;  3M8R A;  4E7K A;  2YHB A;  1HQU A;  4MFB A;  4M3R A;  4R5P A;  3U3Y A;  4CF1 A;  4NYN A;  3LP3 A;  1J53 A;  3M8S A;  1N6Q A;  1LAW A;  1X1P A;  4CHZ A;  1XI1 A;  1N5Y A;  2HNY A;  1W0H A;  2IDO A;  4HCB A;  5JS2 A;  1RTJ A;  1RTI A;  4HUF A;  4DU4 A;  1TK5 A;  3KK2 A;  4HHT A;  2P5O A;  2XO7 A;  1BGX T;  1I39 A;  2XY5 A;  1D8Y A;  4KHW A;  3SZ2 A;  4DQP A;  2G8K A;  3NHG A;  4FJ9 A;  4FJ5 A;  4Z4F A;  1ASU A;  3VQ9 A;  4CJW A;  2HHX A;  3SV3 A;  4CEC A;  4CES A;  2G8V A;  1EET A;  2IAJ A;  1C0U A;  4CJ4 A;  3MEC A;  3C6U A;  4AH9 A;  2X6N A;  2YNG A;  3CG7 A;  4H4M A;  4B08 A;  4CF2 A;  1J9A A;  1U49 A;  2AJQ A;  4CJL A;  2Q3S A;  3KK3 A;  4KKO A;  4PUO A;  3AVL A;  4CHY A;  3EYZ A;  3BDP A;  4DWI A;  1JLB A;  3NE6 A;  1UAX A;  3KLF A;  4KPY A;  2HVI A;  4DSK A;  4OPJ A;  1FKO A;  3NGI A;  3SQ1 A;  1JLF A;  4C8L A;  3OYJ A;  3TAE A;  1C0M A;  1CXQ A;  3ZSW A;  4ELV A;  4DTO A;  4E7J A;  2YKM A;  4AHC A;  1RTH A;  1RDB A;  3LPT A;  1F21 A;  4DLE A;  4O4G A;  4Z0U A;  1C1B A;  3TI0 A;  3DRS A;  3SPY A;  4O0I A;  1JLG A;  5J2Q A;  4OGC A;  4FLW A;  5FRN A;  2B5J A;  3VQB A;  1EXQ A;  4DG1 A;  4DU1 A;  4FJN A;  5CZ1 A;  3HT3 A;  1HYS A;  5CYM A;  4OKK A;  1XC9 A;  2D0A A;  1IG9 A;  4ELT A;  4W5T A;  2XHB A;  1RIL A;  4N76 A;  1JL1 A;  1S6Q A;  3CFR A;  3TAG A;  2JGU A;  2HHS A;  4DQQ A;  4CEO A;  3NBP A;  2OPS A;  4BE0 A;  2P1J A;  3L3V A;  4IFV A;  2YNF A;  1HRH A;  3P5J A;  4J2E A;  2IC3 A;  3ISN C;  2B4J A;  4OJR A;  1UWB A;  1WSF A;  2ETJ A;  4DU3 A;  3RMD A;  3MAQ A;  1UA0 A;  1VSL A;  2E4L A;  1A5V A;  4F3O A;  4AHT A;  3QET A;  2FBX A;  2FBY A;  5HRS A;  4DTU A;  3RMA A;  4B9N A;  1NK0 A;  1VSF A;  1WAJ A;  3ZSQ A;  1REV A;  2D0C A;  3K59 A;  2VG5 A;  3KTQ A;  4C8N A;  4FM1 A;  4RW6 A;  4DQS A;  4FLY A;  4FM0 A;  4FJI A;  1VRT A;  4CHO A;  4LH4 A;  3ALY A;  5D3G A;  3VQA A;  4JS5 A;  5FRM A;  1TVR A;  2O4I A;  1BIZ A;  4J2D A;  5SZT A;  1KLN A;  3VQQ A;  4AHU A;  3VQC A;  1KTQ A;  4HUE A;  2YV0 X;  3L2R A;  3V9W A;  3LDS A;  3SUQ A;  1BQN A;  1SL2 A;  3O3H A;  2Z1J A;  2FBV A;  2OPQ A;  4DMN A;  3O4N A;  3T1A A;  1TAQ A;  2A1S A;  4CEQ A;  4CGJ A;  2WOM A;  4CJT A;  5KGX A;  1S9E A;  4DTS A;  1RTD A;  4KB1 A;  2G8F A;  3AO1 A;  3SUP A;  4FVM A;  4FXD A;  5FRO A;  3QEP A;  4M3W A;  3OYN A;  1VRU A;  2RPI A;  1WSG A;  1SKS A;  4Q5V A;  2X78 A;  3CFO A;  3JSM A;  1VSE A;  2KW4 A;  3MXI A;  2VWK A;  3V9S A;  1RBU A;  2Y1I A;  4ID5 A;  3CFP A;  3ULD A;  4MQ3 A;  1ZBH A;  4K8X A;  4RG8 A;  1UOC A;  3CM6 A;  3CM5 A;  3G10 A;  4FCY A;  1Q9X A;  2XY7 A;  3NF7 A;  4CGG A;  2ZE2 A;  4HVJ A;  2ATQ A;  4J2B A;  4DS5 A;  1HQE A;  1S1W A;  4B9L A;  3ZT4 A;  3RTV A;  1NOY A;  1RT3 A;  4EZ9 A;  3C95 A;  3DLK A;  3VQP A;  4DSI A;  2HND A;  4CJ3 A;  4CHQ A;  4O44 A;  4B8C A;  1JKH A;  3HVT A;  3IRX A;  2OPR A;  5J1E A;  4CF8 A;  2X6S A;  1GOC A;  3WNF A;  5SWM A;  3VN5 A;  3DOK A;  1HPZ A;  2E6L A;  4CEB A;  3KK1 A;  3K5M A;  4RW4 A;  4BDZ A;  4FJJ A;  3HYF A;  4KHU A;  1W9H A;  4CED A;  4W5N A;  4DSL A;  4EP5 A;  1VSM A;  1HNI A;  1D9D A;  4CFB A;  3OYH A;  1RT1 A;  1BIU A;  1SUQ A;  3DYA A;  5HRN A;  1T03 A;  2IS3 A;  3O3G A;  3MED A;  2DFH A;  4Z4E A;  3OS2 A;  3QEV A;  1SKW A;  4Z4H A;  4QAG A;  2Z1G A;  3PX4 A;  4KTQ A;  2F8S A;  1SL1 A;  2BE2 A;  4KO0 A;  3CYM A;  3LAN A;  4CGF A;  4CF9 A;  4B9M A;  2X74 A;  3SCX A;  3OYG A;  1T8E A;  1S6P A;  3KLI A;  1RDD A;  4B9T A;  4FLX A;  1IKV A;  1NOZ A;  4L8R B;  2BAN A;  2A1R A;  5I3U A;  1RDA A;  4DS4 A;  1IH7 A;  4CGI A;  1IKY A;  4N47 A;  4IFY A;  1S1V A;  1U47 A;  3KLE A;  1WSJ A;  3AO4 A;  4ICL A;  4CEZ A;  4KHS A;  1RBR A;  3QLH A;  3DLB A;  2OZS A;  3HP6 A;  3A2F A;  1C1C A;  1B9D A;  1XHX A;  2QK9 A;  4PQU A;  4JRQ A;  3OS1 A;  1RCH A;  3KD1 E;  1U48 A;  2P5G A;  4FW2 A;  2KTQ A;  3TAQ A;  4CJ5 A;  3AVH A;  4KFB A;  4AIL C;  2XY8 A;  1CZB A;  3V1R A;  1BCM A;  1CZ9 A;  3PO4 A;  4TSX A;  1NJW A;  1NKB A;  1S1T A;  3TAM A;  4FZY A;  4E7L A;  3THV A;  3SQ4 A;  3K5N A;  1QS4 A;  4JS4 A;  4CIE A;  4KB0 A;  3LPU A;  4ZTF A;  5E41 A;  4E89 A;  4FJL A;  2OPP A;  5J2P A;  1ASW A;  3KD5 E;  2KZZ A;  4FLV A;  1IKW A;  4CEF A;  4CE9 A;  1L3V A;  4B9U A;  4CEA A;  1S9G A;  4AHR A;  4M3Y A;  3U6F A;  3LP1 A;  4CER A;  4H4O A;  3NFA A;  4FLZ A;  4E3S A;  1Y97 A;  2ZQB A;  3LAK A;  4DTN A;  4I9L A;  4PY5 A;  2RF2 A;  3K57 A;  1NJX A;  1L3S A;  2HVH A;  4LY7 A;  4BDY A;  4F3T A;  2EHG A;  3AVK A;  4H8K A;  4KTW A;  3NH2 A;  3S9H A;  5CY4 A;  1IO2 A;  3TAR A;  3QEW A;  4F2R A;  2QKK A;  1JLC A;  2DFE A;  2NUB A;  3ZT3 A;  3RR8 A;  4GW6 A;  4CJE A;  3NAE A;  1ASV A;  1NK9 A;  3JYT A;  3RWU A;  2RKI A;  1BIS A;  2R7Y A;  4ZTJ A;  3LAL A;  4KHY A;  4FLU A;  2HHU A;  1FKP A;  1LAV A;  1L5U A;  1O1W A;  1NK5 A;  5EU7 A;  1R0A A;  3IG1 A;  3WNG A;  1VK0 A;  3AO2 A;  3H08 A;  3OYM A;  2KFN A;  3KJV A;  3V9U A;  2YNH A;  1WSI A;  4CJS A;  1KVB A;  1BHL A;  1NK4 A;  1QSL A;  4OPK A;  3AVF A;  5HP1 A;  4BAC A;  2LSN A;  1DLO A;  3SQ2 A;  3I0S A;  4CEE A;  2O4G A;  1SV5 A;  3NF6 A;  3LAM A;  2P51 A;  2Z1H A;  4UQG A;  4AHS A;  3HM9 A;  1UA1 A;  4FZZ A;  4CJV A;  3OYC A;  3NCI A;  2VWJ A;  3NF9 A;  4E7I A;  4FZX C;  2Y1J A;  1RT6 A;  3VQ7 A;  1D5A A;  2ITG A;  3QIO A;  1TL3 A;  1QHT A;  1WNS A;  1VSH A;  4BWJ A;  3PY8 A;  4N41 A;  3B6P A;  5C24 A;  4M42 A;  3AVG A;  4LD0 A;  1NK7 A;  4O55 A;  3DOL A;  3ASM A;  2PYJ A;  4KRE A;  1DTT A;  4IBN A;  1EKE A;  3AV9 A;  4G1Q A;  3PUF A;  1RT7 A;  1TKT A;  4RW8 A;  4CFA A;  1RT4 A;  2Z1I A;  3SPZ A;  3AA5 X;  3C6T A;  1JXE A;  2D0B A;  4YNQ A;  1J54 A;  4FJX A;  3K5L A;  4DFP A;  4B9V A;  3OYI A;  4JLH A;  1D9F A;  1HMV A;  1RDC A;  1HYZ A;  4M45 A;  4CJQ A;  3HPG A;  1TKX A;  3AA3 A;  4W5O A;  3SJJ A;  4KI6 A;  4CGD A;  4Z4I A;  1QSY A;  5KGW A;  2ZD1 A;  4KAZ A;  3AVN A;  3V1Q A;  1NK6 A;  2F96 A;  1TKZ A;  3OYE A;  3HL8 A;  1KVC A;  1WAF A;  3RMC A;  1KLM A;  3AVC A;  4I7F A;  3SQ0 A;  3MXM A;  4OKJ A;  2QKB A;  4W5Q A;  1RT5 A;  3VQ6 A;  4IKF A;  4DLG A;  2JLE A;  4Z4G A;  4E19 A;  2HHQ A;  4FJH A;  4M3X A;  3TR8 A;  1RBS A;  1KFD A;  1RBV A;  4IG0 A;  1LWF A;  3VA3 A;  3SI6 A;  1ZBU A;  1T7P A;  1QTM A;  1MU2 A;  3D0P A;  4Z4C A;  4CK2 A;  4B9S A;  3S3N A;  3HO1 A;  4QOZ B;  3IAY A;  1HNV A;  3HK2 A;  4NYF A;  2G8H A;  3OYL A;  4LH5 A;  3V9X A;  3QIN A;  4I2Q A;  1DTQ A;  2EX3 A;  1C6V A;  4CHP A;  3UIQ A;  5C25 A;  4YFU A;  4W5R A;  4DTP A;  1HYV A;  3RRH A;  3U3G A;  5HBM A;  2YHA A;  2XY6 A;  1WN7 A;  4FW1 A;  3AVJ A;  1ITG A;  1A5W A;  1QE1 A;  2WON A;  3KLH A;  1TL1 A;  4QCL A;  3OYD A;  2KFZ A;  3KLG A;  1S1U A;  4DQI A;  1NK8 A;  3HP9 A;  2GUI A;  3RR7 A;  4K8Z A;  1B92 A;  1JL2 A;  4FK4 A;  3OS0 A;  3DLH A;  2GBZ A;  1LV5 A;  3F9K A;  3MEG A;  4B8A B;  1NJY A;  4DTJ A;  2BDP A;  4NCG A;  3L2Q A;  1XWL A;  1TV6 A;  3NDK A;  1K6Y A;  2HB5 A;  3P83 D;  3P1G A;  5FDL A;  4NCB A;  3ZT2 A;  3NF8 A;  3QER A;  1WLJ A;  3SUO A;  3E01 A;  2GV9 A;  3QO9 A;  3MXJ A;  1KCF A;  1X9S A;  3QNN A;  4XIU A;  3LP2 A;  3K5O A;  4AHV A;  4KV8 A;  1C0T A;  3PX6 A;  2HMI A;  3C94 A;  1JXB A;  3SYZ A;  3SUN A;  1S1X A;  4NCA A;  3AO3 A;  5HRP A;  4DSF A;  3AO5 A;  4DTX A;  3NH1 A;  1U04 A;  3ZSR A;  3TAN A;  3S3M A;  1LW2 A;  3QEI A;  3I8D A;  4OGE A;  2XRI A;  3M8P A;  3OYA A;  3OJS A;  4FM2 A;  3AVI A;  3BGR A;  5HRR A;  4DF8 A;  3HJF A;  1ZBL A;  4PA1 A;  1YTA A;  1L3U A;  3LWM A;  2KZM A;  5JS1 A;  4GVM A;  1Q9Y A;  5KRT A;  2DTU A;  3NGZ A;  2DFF A;  1BL3 A;  2BGG A;  3TAP A;  2RN2 A;  3L2W A;  3ZT1 A;  5KI6 A;  3PV8 A;  4HCC A;  5J2M A;  1LWE A;  2OYQ A;  1A5X A;  3SNN A;  3AA4 A;  2HHT A;  1KFS A;  1VSJ A;  2QXF A;  4BE1 A;  1J5O A;  4GMJ B;  2FBT A;  1RT2 A;  3T19 A;  1EP4 A;  3HVR A;  4Y1D A;  1NKC A;  4CF0 A;  4CIG A;  3VA0 A;  3V81 A;  3M8Q A;  1L3T A;  1Z26 A;  4IDK A;  3DLE A;  1FXX A;  2VG7 A;  3MEE A;  4DFM A;  4DTR A;  4KHQ A;  3EY1 A;  1SKR A;  3VQ4 A;  4JRP A;  2DY4 A;  1VSD A;  3TAF A;  1WSH A;  4CIF A;  5HRO A;  2OA8 A;  1GOA A;  2E6M A;  4N56 A;  5HLF A;  4FJG A;  2G8W A;  4ID1 A;  1WSE A;  3OYK A;  2PY5 A;  4PWD A;  3K2P A;  3RMB A;  3CQ8 A;  1XHZ A;  1LW0 A;  1G15 A;  2G8U A;  2FC0 A;  4CJP A;  4E1N A;  3DLG A;  4BDP A;  4ELU A;  2IOC A;  1Q8I A;  4DFK A;  4E7H A;  4OLA A;  1TK0 A;  3HPH A;  1YT3 A;  4Q0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...