2G8UA

B. halodurans rnase h catalytic domain d132n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
b'EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8uA00
2WOMA 4CF8A 4DTJA 3S3OA 2PY5A 3ALYA 1RBRA 3ISNC 3JSMA 4NCBA 1WSJA 4DTOA 3DOKA 1TKXA 1TL1A 3AA5X 3VQ9A 4CIEA 2KW4A 4E19A 3V9XA 1NK0A 4KREA 5FROA 3WNFA 4FZXC 3ASMA 1EKEA 4KV8A 3F9KA 4C8LA 4MFBA 4EP4A 1YTAA 4DQIA 3DI6A 3T1AA 4FVMA 3LP0A 4E7LA 1JXEA 4FLWA 1IO2A 1RNHA 3QIOA 3V81A 1Z26A 1TAQA 5HRSA 5T7BA 4KI4A 1A5XA 1WN7A 4CJQA 1BIZA 4NYFA 1TKDA 1KLMA 3KK2A 4BWJA 4WE1A 4CEBA 4ELUA 3T19A 4M3WA 1ZYQA 3AVFA 3IS9A 2ZE2A 4DLGA 2D0AA 2HHWA 1VSDA 4GMJB 2FBYA 3SNNA 4Y1DA 1JLFA 4N47A 3I0RA 4MQ3A 1X9MA 5JS1A 3RRHA 3M8QA 3LPTA 5CZ2A 1NK5A 4DG1A 4BE2A 3KLEA 1QTMA 5CYQA 4CFBA 1BI4A 4AILC 3HXMA 1L3SA 4DQPA 3LDSA 2HHTA 5CZ1A 4O0IA 3VQBA 4B8AB 4JS5A 4OLBA 2DTUA 1WSHA 4RW6A 4Z4CA 3FFIA 4DF8A 4AH9A 4GVMA 1EP4A 3ZSWA 4Z4FA 1C6VA 1W0HA 3SUQA 1WNSA 3D45A 3I0SA 1ASVA 3DRPA 3QNOA 3TAMA 1VSKA 4DTRA 4OKKA 1LAVA 2FBTA 3QINA 4CJFA 4CK3A 4KO0A 2QK9A 1D5AA 4CK2A 4HCBA 1NKBA 1J9AA 1S1XA 1NK4A 4OKJA 3AVJA 4HUGA 4H8KA 1HQEA 1S1WA 1ZBFA 4KAZA 2HHQA 3OYEA 4DTMA 4CJUA 5J1EA 3SV3A 1NJXA 1SL0A 1RT2A 3S9HA 3RRGA 3HO1A 4M41A 4W5QA 3AO2A 1LAWA 4FM2A 4NYNA 2IDOA 1VRTA 4RW8A 2Y1JA 4FK2A 1RCHA 3K5OA 3RTVA 3PUFA 4ELTA 3AVHA 1TK8A 3OYHA 2KTQA 1UWBA 1HNVA 3NHGA 4M3UA 1Q9XA 2HW3A 4DMNA 2Z1GA 4M3RA 4DTXA 3DM2A 3WNGA 3ZT4A 3KLGA 2ZD1A 1X1PA 4KRFA 3SPZA 3K59A 1JLGA 4FLZA 2DY4A 4CECA 2I5JA 3LP2A 4CHNA 3QEPA 4DSIA 3HP9A 2QKBA 1NKCA 3RMAA 4IDKA 4M3ZA 3QEVA 4XIUA 3RR7A 1VSLA 4AHRA 3H08A 4DS5A 5SWMA 4FJIA 3TARA 3TAQA 4CGIA 1QSLA 1ITGA 4QAGA 4KHSA 2QXFA 4FLUA 4CFDA 2VG7A 2YKMA 4DQQA 1U48A 3KTQA 1LWEA 1BQMA 2YNHA 4ZTJA 3OVNA 1I39A 4DFJA 3SQ2A 3TAEA 4FW2A 2BANA 4K8XA 1DTTA 2E6LA 3O3GA 1HYZA 1WSGA 1F21A 3V1RA 3SI6A 3TAPA 3WNEA 3K2PA 4CEOA 2P5OA 3AA3A 4OVLA 1Z25A 3HVTA 2KFNA 1B92A 4C8OA 4FJ5A 4FJ7A 3KK1A 3KD5E 1K6YA 1U47A 4HUEA 4OGCA 2DFFA 4CEEA 3V9ZA 2HHVA 3DLKA 1RDBA 4KTWA 4KHNA 3CG7A 1ASWA 3OS2A 1N5YA 1Q9YA 1JLQA 1NK8A 3T3FA 1TKZA 4CJKA 3KIOA 4CHQA 2X78A 3K5LA 1RBSA 2FBVA 5KRSA 1JL1A 3HSTB 4F3OA 4E3SA 3L2VA 1XC9A 4BDPA 1JLCA 3G10A 3OJUA 3V9SA 4BDZA 1S6PA 4R5PA 3OYLA 3LZIA 3NBPA 1CXUA 4DWIA 2OYQA 3NGZA 1LWCA 4I9LA 2GUIA 3AVMA 3ZSZA 3V9WA 5HROA 3V1QA 2RPIA 3C6UA 2ATQA 2D5RA 4DTSA 1JLBA 3RMCA 3BDPA 1TVRA 3D0PA 3B6OA 4DTPA 3SUOA 2OZMA 4K8ZA 3EYZA 4C8KA 1BIUA 1VSEA 2RN2A 5SZTA 4DSKA 3UIQA 2FC0A 4QOZB 4B9SA 1YVUA 4C8MA 4HHTA 4CF0A 4DF4A 1S1UA 3RWUA 3HJFA 3MEDA 4BE0A 3RMBA 2G8VA 2F8TA 2KZMA 3TAFA 3MECA 3RR8A 4CEDA 2LSNA 4O55A 3CFPA 1BCMA 4FJNA 3TWHA 4TSXA 2XO7A 4Q0BA 3V4IA 1L3TA 4N41A 4KHQA 4IKFA 2O4GA 2HVIA 3VQ8A 3LAKA 4DSLA 3DLRA 2IAJA 5HBMA 4FJLA 4DFMA 3VN5A 3HYFA 2XRIA 3HM9A 1UA0A 4YFUA 4BWMA 1QHTA 2E6MA 2VWJA 3LP3A 4FJJA 3HPOA 4DTNA 1IKXA 2X6NA 5C25A 3E01A 1FKPA 3NCIA 3M8PA 1BL3A 5D3GA 4FW1A 5J2PA 3NF6A 4IBNA 1BCOA 1ZBUA 3O3FA 3SZ2A 3DOLA 4CJWA 1WSEA 1SKRA 1C0UA 3VQPA 1RBVA 1GOCA 1QQCA 3OY9A 3OYIA 4CJTA 2EX3A 4M3TA 1S1VA 3B6PA 3S3MA 4CJPA 2ETJA 5JS2A 4CEZA 4KI6A 4RW4A 3PV8A 4Z0UA 3MXJA 4HUFA 2F96A 5HRNA 1EXQA 4LD0A 3OYMA 3U3YA 3PX6A 3O4NA 3S3NA 1J5OA 3VQQA 1QSSA 3ZT2A 3PO4A 1C1AA 3NGYA 1WLJA 3HPGA 2RF2A 4CJ4A 4E7HA 2XY7A 4W5RA 1FKOA 1MU2A 3LALA 2R7YA 3CFOA 3OYFA 1VSJA 3I8DA 1LWFA 3DLGA 4FLYA 1D9DA 5I3UA 1U04A 4F2RA 4J2BA 4RG8A 3DMJA 3NF9A 5CY4A 4CF2A 3M8SA 4FJHA 3U3GA 4FJ9A 3QEXA 4DTUA 3MEGA 4RW9A 3IG1A 4CHZA 2F8SA 5I42A 4Y1CA 3AVCA 1KVCA 4NCGA 3AO3A 4IFVA 1T05A 1N6QA 3AVKA 2G8UA 2D0CA 4JRPA 5C24A 1HRHA 4M3YA 1G15A 1IH7A 1RILA 1SV5A 1ASUA 3DLBA 3NFAA 4CEFA 1U45A 2O4IA 4W5NA 1NK7A 2AJQA 4EZ6A 4H4OA 4CF9A 5HP1A 1S9GA 2B5JA 4N5SA 4E1MA 4FCYA 2KZZA 3AVAA 3ZSOA 4JS4A 4Z4HA 1RTDA 3NH2A 3K58A 4JRQA 3IRXA 1CZ9A 1UOCA 1VSIA 1Y97A 3CFRA 3CQ8A 1ZBLA 2X6SA 4GW6A 2RKIA 4PA1A 1RDCA 4CESA 4CHOA 2WONA 2IS3A 3L2UA 4BDYA 3SQ4A 4PUOA 3QIPA 2ZQBA 3AO1A 4DFPA 3NH1A 1O1WA 4I2PA 1RT5A 3LWMA 2G8IA 4LH5A 4E0DA 2ITGA 4OLAA 3AVLA 3QEWA 4CHPA 1QE1A 2P1JA 2JGUA 3QERA 4I9QA 4KPYA 1R0AA 4DQRA 1BQNA 4Q5VA 3SCXA 1X9WA 3EZ5A 1S5JA 4B8CA 2HB5A 1C0MA 2PYLA 3DLEA 4Z4EA 2Q3SA 4DQSA 4B3OA 3AA4A 4O0JA 3EY1A 3PX4A 1HQUA 1LV5A 3OS1A 4AHVA 4FJ8A 3C94A 3ZT3A 2NUBA 5DMRA 1IKWA 3KD1E 3AVNA 2KQ2A 4DSEA 4KHWA 3WNHA 3TI0A 2HNDA 2HHSA 1RBUA 4DLEA 4FLVA 4EP5A 2A1RA 1A5WA 2QKKA 4I2QA 2IC3A 2XY8A 3VQCA 3AA2A 3MEEA 4UQGA 4I7FA 3MAQA 3PX0A 3LANA 4IFYA 1XHZA 2HMIA 3IAYA 1BGXT 5K14A 2IOCA 1VSMA 2GBZA 3HL8A 3P83D 4J2DA 1KSPA 3SPYA 3DRSA 2G8KA 4CCHA 1L5UA 2XY5A 2VWKA 3ITHA 4OGEA 3LP1A 1KFDA 3AO4A 1RDDA 3KK3A 3DYAA 1S1TA 1KFSA 4CK1A 3QESA 1HYVA 3QLHA 2X74A 2OPSA 4CGHA 2G8FA 4QCLA 1HMVA 2P51A 1S9EA 2DFHA 2Z1JA 3C6TA 4M3XA 3K5NA 3CM6A 4IG0A 4BACA 4OJRA 1IG9A 2YV0X 2BDPA 2BGGA 1C0TA 1L3VA 1VK0A 3LWLA 3TANA 3THVA 1RT1A 3ZT1A 5FRNA 1HPZA 1NOZA 3QO9A 1BISA 1A5VA 4LH4A 4B9NA 4CGJA 5FRMA 1WAFA 4YNQA 1KLNA 2YKNA 4DU4A 3VA3A 4J2EA 4CHYA 2HHUA 3LAMA 3L2QA 1RDAA 2YHBA 1BHLA 1JXBA 1TV6A 4FLTA 4B9TA 4FJKA 4FZZA 1KTQA 3OJSA 4IG3A 4KHUA 1REVA 1Q8IA 4AHSA 2EHGA 3HT3A 4ZHRA 1NJYA 2JLEA 1DLOA 1QSYA 1BI4B 3AVGA 4RW7A 2A1SA 3KLFA 1IKVA 4F3TA 1HYSA 3HP6A 3A2FA 1NJWA 4E1NA 3SUNA 4N76A 1KRPA 3V9UA 4FM0A 4CFCA 2PZSA 1RT3A 4PY5A 3V1OA 4CJRA 3VQDA 4CEQA 3KLHA 5KTQA 3SQ0A 1KVAA 4AHCA 4OPJA 2KFZA 1NK9A 1T8EA 4HTUA 2OPRA 1WSIA 1S6QA 3KLIA 1B9FA 1RTHA 5J2MA 4CF1A 3RMDA 4CIFA 5C42A 2BE2A 1NKEA 3VQ5A 5FDLA 3JYTA 1LW0A 1WAJA 1WSFA 1JLEA 1J53A 3NDKA 3OYGA 2YNFA 3AO5A 1KVBA 2HNYA 3OYBA 4JLHA 4OKEA 3ZT0A 1ZBIA 1X9SA 4KTZA 1L3UA 3MXMA 3NH0A 1IKYA 2B4JA 4ICLA 3L3VA 4M42A 4LSLA 4L8RB 4FJXA 3KKSA 3OYDA 1C1BA 1EETA 3NGIA 3VA0A 2G8HA 3OYAA 3ZSVA 1TAUA 1HJRA 3K5MA 5HRRA 2YNGA 4PQUA 4F2SA 4FM1A 3HPHA 4CJ3A 4F8RA 3KKRA 2OPPA 4E7JA 4HCCA 3LPUA 3NE6A 4FJMA 1I3AA 5J2QA 1DTQA 1D8YA 4B9VA 4FLXA 3MXIA 1SKSA 3P1GA 5EU7A 3OYNA 2FBXA 4LY7A 2OA8A 3L3UA 4DSFA 3QEIA 3QETA 1T03A 4NCAA 3VQEA 2HNZA 2PYJA 3OYJA 3O4QA 5HRPA 3TABA 3ZSXA 4W5OA 4FJGA 5HLFA 2YNIA 5DK5A 4CE9A 1JKHA 5E41A 3TAGA 4B9UA 1TL3A 1VRUA 3DRRA 4KTQA 2Y1IA 3CYMA 4CJ5A 3O3HA 3PO5A 3LZJA 3AVBA 2B6AA 4N56A 2OPQA 1GOBA 3AV9A 4FXDA 1KCFA 3V6DA 2D0BA 4DSJA 3KJVA 1EX4A 1FK9A 2Z1IA 3NF7A 4G1QA 4C8NA 4CGGA 4CJVA 4BE1A 4FZYA 3F73A 1C1CA 1RT6A 3OS0A 1SKWA 3DLHA 1RTIA 3NF8A 2GV9A 3PY8A 4FK4A 3HK2A 1SL2A 3VQ7A 2W42A 4B9LA 1B9DA 1FXXA 4CJEA 1JL2A 4DS4A 5J2NA 1T7PA 4HVJA 4Z4GA 4CGFA 3QNNA 1RT4A 1YT3A 3P5JA 1RBTA 1W9HA 1XHXA 1GOAA 1JLAA 4Z4IA 3AVIA 3VQ6A 4E7KA 1VSFA 3SQ1A 2YHAA 3SJJA 5KGWA 4M45A 1LW2A 4AHUA 2IGIA 2G8WA 4FYDA 5KI6A 3BGRA 4KHYA 4DFKA 3M8RA 4ELVA 4CJLA 3ZSQA 2E4LA 4O5BA 3ZCMA 4ID5A 3OYCA 3NAEA 4F4KA 1TGOA 1XI1A 1UAXA 4AHTA 2VG5A 1XWLA 1VSHA 1SL1A 5CYMA 3VQ4A 3HVRA 4CEAA 1ZBHA 4E7IA 4OPKA 1TK0A 3U6FA 4FK0A 3G0ZA 3L8BA 3SYZA 3ULDA 1CLQA 4O44A 1UA1A 4CGDA 1RT7A 4B9MA 3K57A 1NJZA 4H4MA 2DFEA 3C95A 3L2RA 3TR8A 3ZSYA 3OYKA 4DU3A 1U4BA 4KFBA 4CJSA 1QS4A 3SV4A 2XY6A 1D9FA 2HHXA 4O4GA 1CXQA 1TK5A 2P5GA 2OZSA 5KGXA 3ZSRA 2HVHA 4W5TA 1NOYA 1SUQA 3VQAA 1RTJA 4KB1A 4PWDA 1TKTA 4CERA 1CZBA 1YTUA 4DU1A 4CIGA 3SUPA 2VG6A 5KRTA 4KB0A 4J2AA 3L2WA 1NK6A 4ZTFA 1U49A 4CFAA 4B08A 1HNIA 2XHBA 1J54A 2Z1HA 4ID1A 4KKOA 4E89A 4EZ9A 4LSNA 3CM5A
chains in the Genus database with same CATH superfamily
2WOMA 4DTJA 3ISNC 2YJEA 2UXCK 2O8FB 1J6ZA 4B3SK 3DOKA 1TL1A 4E19A 3V9XA 1NK0A 3EKUA 4C8LA 3DI6A 4FVMA 3LP0A 4K25A 3U8XA 4FLWA 3P4IA 1RNHA 3QIOA 1TAQA 1X3MA 1YVNA 4BC4A 1WN7A 1TKDA 1KLMA 3KK2A 4B1WB 4ELUA 5CE3A 3SNNA 4A2BA 1JLFA 1X9MA 4CBWA 4MQ3A 3KVGA 2QEXN 3M8QA 1RDUA 1NK5A 4FWSA 4GNIA 4BE2A 3KLEA 5CYQA 3HXMA 2HHTA 3T69A 3VQBA 2ZF5O 3VTHA 3FZHA 1VQNN 3C6AA 4B3RK 4Z4CA 4RW6A 4H5NA 3FFIA 4GVMA 1EP4A 5B8HA 1OVYA 3D45A 1ASVA 3DRPA 3TAMA 4DTRA 2FBTA 4CJFA 3C7NA 3PSFA 3FGUA 4KO0A 4CK2A 1NK4A 2F9TA 4H8KA 4G9ZA 5GIPA 4LF9K 4DR7K 1Q18A 3RRGA 3S9HA 3OHRA 4M41A 4W5QA 4JKGA 4DR1K 4RW8A 4EHTA 4FK2A 2QM1A 4ELTA 3OW2M 1BU6O 3PSIA 3TTCA 1Q9XA 4M3RA 4KHPK 4I6MB 3LM2A 1ATSA 1JLGA 3LP2A 4CHNA 4DSIA 3QEPA 3HP9A 4IDHA 4IDKA 3O1BA 1I94K 4XIUA 3RR7A 4AHRA 4WF9L 4DS5A 5SWMA 5AQUA 1ITGA 4QAGA 4XH5A 2VG7A 2QXLA 2YKMA 2GTDA 1IBKK 3QBXA 5FLXO 3CC4N 2BANA 3ZYYX 1DTTA 2E6LA 1HYZA 4H5TA 3ZX3A 1F21A 3V1RA 3HOSA 3M1FA 1SAZA 5KPZA 4DV4K 3AA3A 4NO7A 2E2OA 1YHQN 1XNQK 3K9KA 3KK1A 3CQYA 4CEEA 2DFFA 3VEVA 1DGKN 1RDBA 4KHNA 3WQTA 2P9KA 1NK8A 2A5XA 2F4VK 1SQKA 3CHWA 1HR0K 4CJKA 3K5LA 1RBSA 5KRSA 4F3OA 4BQLA 1N34K 4E3SA 4FWLA 3PLAA 4FWMA 3OJUA 4OX9K 4BDZA 1S6PA 4R5PA 4DWIA 3L6QA 2OYQA 4JKEA 4I9LA 2GUIA 5HROA 2RPIA 3RMCA 3SUOA 1NWKA 4K8ZA 1HNXK 3CERA 1YVUA 4C8MA 4FWNA 3J7AP 4KH5A 2G8VA 2KZMA 3H45C 2E1ZA 3RR8A 4CEDA 2LSNA 4O55A 1WBBA 4N41A 3GOIA 3VQ8A 4FJLA 5BPLA 4JNEA 2XRIA 4YFUA 3LP3A 4FJJA 4DTNA 3IUCA 1IKXA 2X6NA 1BL3A 2VGNA 3THYA 4K42A 5J2PA 5AQIA 1YI2N 1YJ9N 3UE5A 1QQCA 3WXKA 4M3TA 4CJTA 3B6PA 3S3MA 4CZFA 2ETJA 5MLCQ 4DV1K 3HI0A 1E4FT 3P38A 3CQXA 3FLCO 3OYMA 3S3NA 1OVQA 3CJ7A 3O4NA 1QSSA 1HKCA 4CJ4A 1WLJA 4E7HA 3ENHA 1QZ6A 4DV7K 4W5RA 4IJNA 3CCMN 4B1XB 2R7YA 3OYFA 1LWFA 1D9DA 4RG8A 4CF2A 4FJHA 2E2PA 4DTUA 3IG1A 3MN6A 3AVKA 5BPNA 4JRPA 4M3YA 1G15A 1RILA 4A5BA 4BRPA 4MO4A 1VQ8N 1SS6A 5BREA 1S9GA 2B5JA 4E1MA 4IOAL 4FWQA 2KZZA 2WBNA 3ZSOA 2H3GX 1DT9A 1N33K 4FSVA 3HRGA 1CZ9A 3VEWA 1ZBLA 4PA1A 1RDCA 2WONA 3EO3A 1K73O 4BGBA 5C15A 3QIPA 3AO1A 4BG8A 4BRFA 4I2PA 2G8IA 1RT5A 3VF4A 4LH5A 4QS8A 2ITGA 5GIOA 3AVLA 4GKKK 1QE1A 4C23A 3QERA 4DQRA 4M7YA 4Q5VA 3SCXA 3N4PA 4DR4K 2HB5A 1C0MA 2PYLA 4B3OA 3OS1A 2UUCK 1IKWA 2HBMA 2KQ2A 3WNHA 3T1HK 4DLEA 4JI4K 4H03B 2QKKA 5EY4A 2IC3A 3PIPL 3VQCA 1RFQA 3LANA 1X3NA 1ESVA 3VMFB 4B1YB 3N4QA 1VSMA 1W7AA 3P83D 4JI6K 3DRSA 3SMPA 4LF4K 2G8KA 1L5UA 4FOIA 3ITHA 3LP1A 1KFDA 4IXCA 2P9NB 1N36K 1M1KO 1K8KA 1ZBSA 4BC3A 3G6EN 4CZHA 3K5NA 1GLLO 3QFPA 3CM6A 4AQYK 2YV0X 2BDPA 2BGGA 1KD1O 4K41A 4A5AA 3LWLA 1RT1A 3ZT1A 1EQYA 1KQSM 3QO9A 3C0BA 4ILHA 1A5VA 4JI0K 2HHHK 1T3VA 4JK7A 1X9JA 3RSEB 1RDAA 1TV6A 3FE1A 4IOCL 4KHUA 1Q8IA 4AHSA 1E3MA 4BC5A 3D2EB 2QWPA 3MN5A 4DV5K 2A1SA 4JKCA 1HYSA 3HP6A 4IEEA 5AQLA 2HF4A 4IO9L 4N76A 2CGJA 5LJVA 4CFCA 3V1OA 4CJRA 1KVAA 4AHCA 3DWLA 5C12A 3VEOA 1S6QA 2IVNA 1B9FA 5J2MA 4YHHK 3HM8A 3VQ5A 3AGKA 3JYTA 1WAJA 2QI2A 3QICA 2YNFA 1KVBA 4OKEA 1X9SA 3ZLJA 3UKUB 1IKYA 4M42A 4WQ4C 4LF5K 4FJXA 5AQQA 3M5RA 3R3LA 1EETA 1HJRA 3ID8A 3IKMA 2YNGA 3TU5A 4FM1A 3HPHA 5C2FA 2D1KA 4E7JA 1QQMA 1I3AA 4B9VA 3OYNA 2FBXA 4LY7A 2OA8A 3E9LA 4DSFA 2VQEK 2PYJA 2HNZA 3O4QA 5HRPA 1XQSC 3ZSXA 4FJGA 3TAGA 1MWKA 3CYMA 1WBDA 2P9LA 3LZJA 5AQSA 2B6AA 2OPQA 3CI5A 4FXDA 3KJVA 1EX4A 1FK9A 1FW6A 4U7BA 4CD3A 1OKJA 1VQ6N 1RTIA 2O8EA 2HBJA 1QZ5A 2NRHA 3CJCA 4HVJA 4ISFA 1YT3A 3H46O 1JLAA 4E7KA 4PKGA 4DV0K 1GLCG 1KAYA 3WT0A 2VGMA 4BVPA 4CJLA 3ZSQA 3ZCMA 4O5BA 3O80A 3OYCA 3NAEA 4DR5K 5CR4A 4AHTA 3NMUA 4WFBL 4K0KK 1CLQA 3SYZA 1UA1A 3K57A 3A5OC 3RVCA 4GV6A 4DU3A 1U4BA 1QS4A 1TK5A 2YCHA 5KGXA 1NMDA 4W5TA 3MWTA 4KB1A 4PWDA 4DV3K 4PL8A 2XHBA 4NB4A 1J54A 2UYTA 2Q2RA 4CF8A 3S3OA 3HZ6A 3GDQA 4LF7K 3ALYA 4H0TB 1WSJA 1E4GT 2KHOA 3AA5X 2KW4A 4NXMK 4KREA 3WNFA 3CCVN 4EP4A 4DQIA 3CCJN 3T1AA 4E7LA 1HJOA 2D4WA 2GWJA 3CJ9A 4FWRA 1IO2A 3V81A 1Z26A 4KI4A 4CJQA 1BIZA 4NYFA 4M3WA 4CEBA 4WE1A 3THXB 3J81O 4DLGA 2D0AA 5E84A 2HHWA 4GMJB 4Y1DA 2E2QA 4N47A 3I0RA 3LPTA 2W6KA 3A5LC 3FZLA 4DV6K 1BI4A 3H3OB 1L3SA 3LDSA 4OLBA 1NGAA 4X64K 2NZTA 4DF8A 3D2FB 4JI1K 3ENBA 1C6VA 1W0HA 3I0SA 1VQ5N 1VSKA 1IV0A 3QINA 1KC8O 4A61A 3SAHA 1KXPA 3AVJA 5BRHA 5M1FA 3O5BA 5J1EA 2E8AA 2YHXA 1SL0A 1RT2A 3SBTA 3AAQA 3AO2A 4NYNA 2IDOA 3A5MC 5BRDA 4YOTA 1TK8A 2W6LA 4JKBA 4BC2A 1HNVA 3NHGA 4DMNA 4DTXA 2UXBK 3DM2A 3WNGA 4IWVA 1YXQA 1X1PA 2ZD1A 1Q86O 4KRFA 2DY4A 2QKBA 5AQZA 4X62K 1NKCA 2O8CB 1OH6A 4AM6A 1GLEG 5DM7L 4CGIA 5AQVA 4KHSA 1SZ2A 4FLUA 1MDUB 1U48A 2P9PA 3OVNA 4H0VB 4DFJA 5AZJA 1WSGA 1NGBA 3WNEA 3K2PA 2P5OA 1K6YA 5GAGP 3T7ZA 2HHVA 3DLKA 4KTWA 3ULEA 3CG7A 4BR4A 3OS2A 3CETA 4DUYK 1O13A 2VWBA 3KIOA 4CHQA 2X78A 1JCFA 3HSTB 4DUZK 3L2VA 1XC9A 1OH7A 1HX1A 3CJ1A 3ID6A 1GLAG 3GE1A 1CXUA 1LWCA 2CH5A 4H5RA 3ZSZA 3OBWA 1J5EK 3D0PA 4A59A 1BIUA 1VSEA 2RN2A 3C65A 5SZTA 4B9SA 3ZEUB 3TAFA 5AQGA 4TSXA 4IKFA 3UKRA 3T1YK 4DSLA 2IAJA 4JK8A 5HBMA 4DFMA 3A8YA 5IT9O 3QBWA 4BG9A 4FPAA 3E01A 3R1XA 4O5FA 5D3GA 3O9UA 1NU0A 4JD2B 4IBNA 3O3FA 3DOLA 1SKRA 5AFUA 1RBVA 3OY9A 1NM1A 4WCEL 4CJPA 5A2QO 5JS2A 2YJFA 1Q82O 1T44A 2F96A 5HRNA 1J5OA 3ZT2A 3HPGA 4Y0WA 5DM6L 1FKOA 1MU2A 1HNWK 4CVNE 1VSJA 4JKAA 4FLYA 4J2BA 5I3UA 3NF9A 5CY4A 5AZIB 4CD1A 4FJ9A 3QEXA 3ZETB 3DXMB 4L3QA 2V7YA 4CJ7A 3AY9A 3WEEA 2EWSA 4O8KA 2G8UA 2Q97A 4JHDB 1IH7A 4B1VA 3NFAA 1XMQK 1U45A 2O4IA 1NK7A 4H4OA 1R59O 5HP1A 5M1QA 2IIRA 4N5SA 4XEIA 3LL3A 4FCYA 5TKWA 4Z4HA 3VEXA 1RTDA 3NH2A 4JRQA 3A0IX 1TUUA 1TYQA 1UOCA 4NLBA 2X6SA 1NJIO 3F9MA 4CESA 3L4IA 5HL7L 3SQ4A 4PUOA 4PHTX 4DFPA 1BUPA 2IVPA 3LWMA 4CBUA 4BRLA 4OLAA 2OTJN 1VQ4N 1GLBG 3QEWA 2JGUA 3Q7CA 1R0AA 2O8DB 1S5JA 4YOYA 2Q3SA 4DQSA 3AA4A 4FJ8A 4FWOA 3FR0A 4XH4A 4AHVA 3C94A 1DKGD 5IWAK 1QVGM 2HNDA 1GLFO 2HHSA 1RDWX 4FLVA 4H0YB 2D0OA 2XY8A 3WXMB 3MEEA 3QMLA 4I7FA 3VEZA 4UQGA 3PX0A 2E5LK 2A40A 3IAYA 1BA0A 1BGXT 3CIPA 1GLDG 2GBZA 3HL8A 3MN9A 3SPYA 2YHWA 2O8BA 1KFSA 3KK3A 1YITN 1HYVA 1V4SA 2X74A 4FO0A 4QCLA 3CPEA 2Z1JA 5C2DA 4BACA 1K9MO 3KZBA 1IG9A 4CBXA 1L3VA 2QTDA 3THVA 1HPZA 4MLEA 1BISA 3LDOA 4B9NA 5FRMA 4YNQA 3ATUA 2HHUA 1NG9A 2YHBA 3LDPA 4FPBA 3IFRA 4NXNK 4FLTA 4B9TA 3CD6N 4A2AA 3NVKA 3OJSA 1REVA 2EHGA 3HT3A 4ZHRA 1NJYA 4CW7B 4RW7A 3KLFA 1IKVA 3VF2A 4F3TA 4H0XB 3E66A 1K8AO 4FM0A 4PY5A 3C7NB 5BR8K 3QB0A 1T8EA 2OPRA 1WSIA 4BRMA 2PBDA 5GINA 1BA1A 5C42A 1NKEA 1LW0A 3NDKA 2A3ZA 4JLHA 1ZBIA 1L3UA 4ICLA 3R8EA 5GADP 3KKSA 4BR7A 1C1BA 3VA0A 3NGIA 3ZSVA 1GLJO 4PQUA 4F2SA 1LCUA 1H1VA 2OPPA 2GWKA 1D8YA 1ZXOA 2RHKA 3P1GA 2F7TA 2I7PA 3ZX0A 4JI8K 3QETA 1T03A 4NCAA 5BN9A 4AM7A 4B9QA 5HLFA 5DK5A 4CE9A 1JKHA 2WUSA 5E41A 4KTQA 4CJ5A 3AVBA 4LFAK 1GOBA 4B1UB 3EZWA 4C8NA 3F73A 3OS0A 3DLHA 4FK4A 2P9UA 3O1WA 2QWNA 3VQ7A 1VQMN 2A42A 4B9LA 5J2NA 2QWMA 2P9KB 1RT4A 3P5JA 1W9HA 1XHXA 3CMEN 3SMSA 3SQ1A 2YHAA 2NRRA 5HOOA 1OH5A 4AHUA 1S3XA 1NGEA 3BZKA 2E4LA 4ID5A 1SL1A 1BWFO 1XWLA 5LY3A 3G71N 3HVRA 1HKBA 2PFUA 4CEAA 4LF6K 4OPKA 1TK0A 3VGLA 3ULDA 4JYAK 1RT7A 1U2VA 1Z05A 2DFEA 1HLUA 1QQNA 3TR8A 3ZSYA 3OYKA 1XUPO 3SV4A 2XY6A 1CXQA 3VGKA 2HVHA 3MCPA 1NOYA 1RTJA 4CERA 4ISGA 3MX5A 3SJHA 3WQUA 4CIGA 5KRTA 3L2WA 1NK6A 2AA4A 2F9WA 4CFAA 4B08A 2ZWHA 2Z1HA 4ID1A 4KKOA 4E89A 3ZX2A 2E1YA 4LSNA 3THYB 3CM5A 1N8RO 2PY5A 4NCBA 4DTOA 1TKXA 4CIEA 3CF5L 4ISEA 2P9IA 4FZXC 3F9KA 3SLCA 3CJBA 2ZM6K 3O9QA 5T7BA 1A5XA 2BUPA 4JV5K 5F2RA 5M1OA 3T19A 3AVFA 3IS9A 3DLLL 1NLVA 2FF3B 3WXIA 2FBYA 3RRHA 1T6CA 2NRZA 1NGFA 5EXWA 4CFBA 3F2KA 5CZ1A 4BRDA 4EAHD 4JS5A 4BR2A 2DTUA 4EHUA 3I8BA 4AH9A 3THWA 4A57A 3EN9A 4CK3A 2QK9A 5FPMA 3CCEN 1NKBA 1J9AA 4OKJA 2I7NA 1HQEA 1S1WA 2NNWA 5JVGL 2V51B 4KAZA 5CHIA 4FVUA 5KQDA 2HHQA 2ITMA 4YOUA 3SV3A 3VENA 3HBTA 1NGIA 4FM2A 1LAWA 1VRTA 2Y1JA 2VCPA 1RCHA 3PUFA 3D2FA 1C0FA 2Z1GA 3GBTA 3ZT4A 3KLGA 3LDNA 3BP8A 2CH6A 3CCSN 4FLZA 2I5JA 1HPMA 5AQTA 4OPAA 3U4LA 3O6WA 3VPZA 3H08A 4FJIA 1FJGK 3H1VX 3G25A 3TARA 1QSLA 4YY3K 3WXLA 2QXFA 3CCLN 2P9SA 4HWIA 4DQQA 4MLHA 1LWEA 1BQMA 2FLOA 4LFBK 3TAEA 4BVOA 4FW2A 4K8XA 5F0XA 4WQ5A 3TAPA 1TUYA 4CEOA 4OVLA 1Z25A 3HVTA 1K8KB 4B3MK 3O9RA 4FJ5A 4FJ7A 3KD5E 4CZKA 1U47A 3FZKA 3MWPA 1ASWA 4BRKA 1N5YA 1JLQA 3T3FA 2FBVA 4BROA 3OYLA 3O4WA 5AQOA 3V9WA 3V1QA 3BDPA 2ATQA 1JLBA 2AP1A 1VQKN 1TVRA 2OZMA 3UIQA 4QOZB 3MCAB 4LFCK 3RWUA 5JLFA 3RMBA 4BE0A 2F8TA 3PIOL 1BCMA 5GAEP 2XO7A 3CPWM 1XMOK 1L3TA 3B8AX 2O4GA 3LAKA 2V7ZA 3EL2A 3HYFA 4YOXA 1UA0A 3KHYA 1QHTA 2E6MA 3ENOA 2VWJA 3HPOA 2HSTA 4H0OA 3MDQA 2VYPA 5C25A 3NCIA 3M8PA 3O9TA 3L4QA 4FW1A 3NF6A 5AQHA 1RGIA 4C1NI 1BCOA 2O8FA 1IJJA 4CJWA 1WSEA 4DR6K 1GOCA 2QWOA 2FSKA 3HTVA 4Z0UA 4HUFA 3U3YA 1EXQA 2ZJRL 5AQJA 1C1AA 2RF2A 4BRHA 4FL9A 3CC2N 4OPHA 5AQFA 3EEQA 3O8MA 3I8DA 3DLGA 1U04A 3DMJA 2QWQA 3MEGA 4RW9A 2NRTA 2FSJA 2F8SA 5I42A 4Y1CA 1KVCA 2P9LB 1T05A 1N6QA 3BF3A 3VF6A 1XC3A 3O9SA 1VAZA 3W0LA 1SV5A 2HBLA 4JN4A 4W5NA 3BF1A 2FF6A 2O8EB 4CF9A 1BDGA 1V4TA 3WXJA 3A5NC 3IRXA 3CQ8A 4DR2K 1Y97A 2RKIA 4JI5K 3G4SN 4CHOA 1YF5L 3K9JA 4DR3K 1JCEA 1T6DA 2J4RA 2ZQBA 1O1WA 4E0DA 4I6MA 4LC9B 1WB9A 3FZFA 1G99A 1X9WA 3EZ5A 4B8CA 3DLEA 3MX2A 4YDUA 4YDUC 4O0JA 4BRIA 3PX4A 2BTFA 3ZT3A 2BH1A 4CZEA 3AVNA 4KHWA 5M1PA 1RBUA 2A1RA 1A5WA 2WFBA 4I2QA 3AA2A 4QS9A 3MAQA 2HMIA 5K14A 1VQLN 2GX9A 2IOCA 4J2DA 4CCHA 4RTFD 5ELZA 4OGEA 3AO4A 1YAGA 3DYAA 1S1TA 2OPSA 4CGHA 5FPDA 2G8FA 1HMVA 2P51A 3C6TA 4X65K 5M1NA 2JWLA 5BR9A 4OJRA 3EE9A 4FWKA 1C0TA 4DKWA 1VK0A 2RE2A 3SAFA 4CGJA 4CZGA 5BN8A 1BOTO 3TTDA 1KLNA 3VA3A 4J2EA 4CHYA 1U6ZA 3TSQA 3MK6A 3P39A 3EKSA 5AFUH 5AQPA 3KK7A 2JLEA 1QSYA 3H3NO 1BI4B 4JKHA 3A2FA 5TKYA 1NJWA 3SUNA 1KRPA 3CXCM 1RT3A 3CCRN 1NGJA 4CEQA 3WUHA 5KTQA 4OPJA 2ZJPL 3BUZB 1IBMK 5AJ3K 3QDKA 1RTHA 3AARA 4IZ9A 3J7ZO 2YI1A 2BE2A 3CMAN 4DB3A 3TTFA 1VQON 1JLEA 3J8AA 3OYBA 2HNYA 3ZT0A 2W40A 3LDQA 4KTZA 4WYBA 3NH0A 1N32K 4RCHA 4L8RB 5JVHL 3OYDA 2QA4N 1TAUA 3DXKB 4YOVA 5EX5A 3JAMO 4F8RA 3KKRA 4HCCA 3LPUA 3NE6A 5J2QA 4BR5A 4FLXA 1SKSA 5EU7A 3L3UA 2ZJQL 4JEPA 3TABA 3S41A 3H1QA 3H6EA 2P9PB 4GKJK 1TL3A 1VRUA 2HMPA 2JWKA 3O3HA 5LMNK 4N56A 5AZJB 1KCFA 3V6DA 2D0BA 4LF8K 4DSJA 4G1QA 4FZYA 2Z1IA 3NF7A 3TSUA 4CJVA 1RT6A 3DJCA 3PY8A 3HK2A 1SL2A 4WFNL 2PAVA 2A41A 2W42A 2CGLA 4BRCA 3JXUA 3DAWA 1IBLK 3ULEB 4Z4GA 3QNNA 1P8ZA 1RBTA 3AVIA 3VQ6A 1VSFA 3SJJA 4M45A 1LW2A 3U9DA 2IGIA 2G8WA 4FYDA 5KPRA 1JJ2M 5KI6A 2ASOA 3BGRA 4KHYA 3SAGA 3M8RA 4F4KA 4QS7A 1TGOA 1XI1A 1UAXA 1NK9A 2VG5A 1VSHA 5CYMA 4E7IA 3BZCA 4FK0A 3G0ZA 3L8BA 1QHAA 4B9MA 1VQPN 2OCEA 4IJAA 3C95A 2CGKA 4RWTA 4DV2K 1Q7YO 4KFBA 2ZGYA 4O4GA 2P5GA 2W41A 4Z94A 4FOEA 2OZSA 3ZSRA 3UKRB 3IMXA 1SUQA 2QW9A 3VQAA 1TKTA 1YIJN 2UUAK 1QQOA 3JS6A 1NBWA 4ZTFA 3D7EO 4GVEA 1HNIA 5BRFA 1VHXA 2P9NA 3Q7BA 4JK9A 2E20A 1RBRA 3MN7A 3JSMA 3E9OA 3IDHA 3VQ9A 3J7YP 2KKZA 5FROA 4CZLA 3ASMA 1EKEA 4KV8A 5JLHA 4MFBA 1YTAA 1JXEA 5E26A 5HRSA 3RSEA 4BWJA 5ADXH 1ZYQA 2ZE2A 1VSDA 4CZIA 4MDAA 3CC7N 3D6RA 1YJNN 3GG4A 5ADXA 5JS1A 4H5VA 3D2EA 5JICA 2UU9K 1W97L 5CZ2A 4DG1A 1QTMA 2Q36A 4DQPA 4AILC 4JKGB 4O0IA 2IVOA 4B8AB 3L0QA 1WSHA 4GV9A 4Z4FA 3ZSWA 3SUQA 3WEEB 1WNSA 4JKFA 3OA9A 3J80O 3QNOA 1ATNA 4OKKA 1LAVA 2WC9A 2OANA 4DQ8A 2YX6A 1W2BM 1D5AA 4HCBA 4BRAA 1S1XA 2NLXA 4HUGA 1ZBFA 5AQWA 4BRQA 2NRWA 3OYEA 1VQ7N 4DTMA 4CJUA 1NJXA 3EE8A 3HO1A 1Q81O 1TYQB 3K5OA 3RTVA 3AVHA 4YORA 3OYHA 2KTQA 1UWBA 4M3UA 3UB5A 3W3DA 2HW3A 2GUPA 3UKUA 4AF1A 3SPZA 3K59A 2FSNA 4CECA 4FWPA 1YUWA 3AAPA 3C6HA 3RMAA 4M3ZA 4UY8O 4F9OA 3QEVA 1MA9B 5AR0A 2D0PA 1VSLA 2QWRA 2ASPA 3TAQA 1NMNA 4CFDA 4O8UA 4BRGA 3KTQA 2YNHA 4ZTJA 1WOQA 1I39A 3SQ2A 3O3GA 2UXDK 3SI6A 2O8BB 4A62A 2KFNA 5AQMA 4H0PA 1B92A 1YJWN 4C8OA 5FPEA 4HUEA 4OGCA 3V9ZA 2UUBK 1Q9YA 3CCQN 1TKZA 1HKGA 2GEMA 4R79A 1JL1A 4BDPA 1JLCA 3G10A 3V9SA 2YHYA 3LZIA 1HUXA 3NBPA 3NGZA 3AVMA 4DHYA 2Q0RA 3KWGA 1NGGA 3C6UA 4DTSA 2D5RA 4JI2K 3TPQA 3B6OA 4DTPA 3EYZA 4C8KA 4MO5A 4DSKA 2FC0A 4JI7K 2E2NA 4HHTA 2E88A 4CF0A 4DF4A 1S1UA 3HJFA 3MEDA 3MECA 4BQZA 4FJNA 3CFPA 2NRVA 3TWHA 4Q0BA 3V4IA 4JAXA 1M90O 4KHQA 2HVIA 3DLRA 4BR9A 3VN5A 3HM9A 1S72N 4BWMA 4KBOA 4CI6A 1FKPA 2HOEA 4OO1J 4BRNA 1ZBUA 3VEYA 3FFKB 3SZ2A 1JCGA 1C0UA 3VQPA 5JMVA 1D4XA 3OYIA 2EX3A 3HOTA 1CZAN 1S1VA 3CCUN 5AQNA 4CEZA 4KI6A 4RW4A 3PV8A 2QWLA 3MXJA 1QVFM 3PX6A 5BPMA 4LD0A 3VQQA 3AGRA 3R9PA 3PO4A 3THXA 3NGYA 3TSPA 4IEIA 4HTLA 3I55N 2XY7A 4PL7A 3LALA 3CFOA 5I9EB 4IOXA 4F2RA 3M8SA 3U3GA 4CHZA 3AVCA 4NCGA 4WQ4A 3AO3A 4IFVA 4PKHA 1XNRK 2D0CA 1IG8A 5C24A 1HRHA 2ASMA 3F5TA 2Q31A 2V52B 3DLBA 1ASUA 1Z6RA 3ATVA 4JKDA 4CEFA 4GV3A 2AJQA 1HNZK 4EZ6A 4U67L 4BGAA 2P9UB 3M6GA 4CZJA 5GAHP 3OBYA 3AVAA 4JS4A 3K58A 1VSIA 3CFRA 1DEJA 4GW6A 1KAXA 4KH6A 3VOVA 1NNEA 3LDLA 2IS3A 3L2UA 4BDYA 4IO8A 3NH1A 3P31A 3NVMA 3CJAA 1LOTB 4WQ5C 4CHPA 2P1JA 4I9QA 4KPYA 1BQNA 2O8CA 4GY2B 4YOWA 4Z4EA 4JI3K 1LV5A 3SK3A 3EY1A 1HQUA 2Q0UA 2NUBA 5DMRA 1U2VB 4BR0A 4IFEA 4XH1A 4DSEA 5H1SQ 3KD1E 4CZMA 3TI0A 4M63C 2GELA 5M1KA 3KWIA 4EP5A 4KH4A 1XHZA 4IFYA 4K43A 4ILJA 1KSPA 3K0SA 2XY5A 2VWKA 1RDDA 3GL1A 2ZGZA 4CK1A 3QESA 3OTOK 3QLHA 4C1NK 4WFAL 3VTIA 1S9EA 2DFHA 2Q1NA 3FZMA 4M3XA 4IG0A 1ZC6A 2A6AA 3TANA 2P9IB 5FRNA 1NOZA 5F1XA 4LH4A 1WAFA 4J8FA 2YKNA 4DU4A 1EWRA 3LAMA 3L2QA 1KAZA 1BHLA 1JXBA 4FJKA 4FZZA 1KTQA 4IG3A 4EIAA 3ZEUA 4BY9C 5EVZA 5LJWA 1DLOA 2NRXA 5C0YA 3AVGA 1EWQA 3QFUA 4PKIA 4E1NA 3E9PA 3V9UA 3THWB 3SBGA 2PZSA 3HSCA 3VQDA 3KLHA 3I56N 3SQ0A 5C10A 2KFZA 5AQXA 4HTUA 3KLIA 4DCHA 4JD2A 4CF1A 3RMDA 4CIFA 1BG3A 5FDLA 1WSFA 4E1JA 1J53A 3OYGA 3AO5A 4M7XA 2KLAA 4X66K 3MXMA 2OTLN 2B4JA 3L3VA 4LSLA 3BEXA 4ILGB 3I33A 3OYAA 2G8HA 3K5MA 5HRRA 3U9ZA 2HF3A 4CJ3A 4B3TK 3VETA 4FJMA 1DTQA 2DPNA 3MXIA 5EOYA 3QEIA 3VQEA 3OYJA 5AZIA 4V19S 4B1ZA 4W5OA 1BO5O 2P9SB 3ZETA 1S22A 5AQYA 2YNIA 3DXMA 4B9UA 3DRRA 5FPNA 4BREA 2Y1IA 3PO5A 1MWMA 5KQ8A 3M3ZA 4JHDA 3AV9A 3DXKA 3LM9A 3VGMA 4BE1A 4CGGA 1OH8A 1C1CA 1P90A 1SKWA 3NF8A 2GV9A 5KPTA 1B9DA 1FXXA 4CJEA 1JL2A 4DS4A 1T7PA 2FXUA 4CGFA 1ILYA 3BY5A 4MDBA 1GOAA 5AQKA 4Z4IA 1VQ9N 1Y64A 5KGWA 5LL6Z 3VESA 4DFKA 4ELVA 2VQFK 5LMUK 4EFHA 3VERA 3R6MA 2O8DA 1ZBHA 5AQRA 3VQ4A 3U6FA 1NGHA 2WTUA 4H5WA 4O44A 1NGCA 4CGDA 1WUAA 1C0GA 1NJZA 4H4MA 3L2RA 4CJSA 2HHXA 1D9FA 4NLCA 3E1YA 1ATRA 1CZBA 1YTUA 4DU1A 3SUPA 2VG6A 4KB0A 1EO1A 2HBKA 1NGDA 4J2AA 3O08A 3MMVA 4EZ9A 1U49A
chains in the Genus database with same CATH topology
2WOMA 4CF8A 4DTJA 3S3OA 2PY5A 3ALYA 1RBRA 3ISNC 3JSMA 4NCBA 1WSJA 4DTOA 3DOKA 1TKXA 1TL1A 3AA5X 3VQ9A 4CIEA 2KW4A 4E19A 3V9XA 1NK0A 4KREA 5FROA 3WNFA 4FZXC 3ASMA 1EKEA 4KV8A 3F9KA 4C8LA 4MFBA 4EP4A 1YTAA 4DQIA 3DI6A 3T1AA 4FVMA 3LP0A 4E7LA 1JXEA 4FLWA 1IO2A 1RNHA 3QIOA 3V81A 1Z26A 1TAQA 5HRSA 5T7BA 4KI4A 1A5XA 1WN7A 4CJQA 1BIZA 4NYFA 1TKDA 1KLMA 3KK2A 4BWJA 4WE1A 4CEBA 4ELUA 3T19A 4M3WA 1ZYQA 3AVFA 3IS9A 2ZE2A 4DLGA 2D0AA 2HHWA 1VSDA 4GMJB 2FBYA 3SNNA 4Y1DA 1JLFA 4N47A 3I0RA 4MQ3A 1X9MA 5JS1A 3RRHA 3M8QA 3LPTA 5CZ2A 1NK5A 4DG1A 4BE2A 3KLEA 1QTMA 5CYQA 4CFBA 1BI4A 4AILC 3HXMA 1L3SA 4DQPA 3LDSA 2HHTA 5CZ1A 4O0IA 3VQBA 4B8AB 4JS5A 4OLBA 2DTUA 1WSHA 4RW6A 4Z4CA 3FFIA 4DF8A 4AH9A 4GVMA 1EP4A 3ZSWA 4Z4FA 1C6VA 1W0HA 3SUQA 1WNSA 3D45A 3I0SA 1ASVA 3DRPA 3QNOA 3TAMA 1VSKA 4DTRA 4OKKA 1LAVA 2FBTA 3QINA 4CJFA 4CK3A 4KO0A 2QK9A 1D5AA 4CK2A 4HCBA 1NKBA 1J9AA 1S1XA 1NK4A 4OKJA 3AVJA 4HUGA 4H8KA 1HQEA 1S1WA 1ZBFA 4KAZA 2HHQA 3OYEA 4DTMA 4CJUA 5J1EA 3SV3A 1NJXA 1SL0A 1RT2A 3S9HA 3RRGA 3HO1A 4M41A 4W5QA 3AO2A 1LAWA 4FM2A 4NYNA 2IDOA 1VRTA 4RW8A 2Y1JA 4FK2A 1RCHA 3K5OA 3RTVA 3PUFA 4ELTA 3AVHA 1TK8A 3OYHA 2KTQA 1UWBA 1HNVA 3NHGA 4M3UA 1Q9XA 2HW3A 4DMNA 2Z1GA 4M3RA 4DTXA 3DM2A 3WNGA 3ZT4A 3KLGA 2ZD1A 1X1PA 4KRFA 3SPZA 3K59A 1JLGA 4FLZA 2DY4A 4CECA 2I5JA 3LP2A 4CHNA 3QEPA 4DSIA 3HP9A 2QKBA 1NKCA 3RMAA 4IDKA 4M3ZA 3QEVA 4XIUA 3RR7A 1VSLA 4AHRA 3H08A 4DS5A 5SWMA 4FJIA 3TARA 3TAQA 4CGIA 1QSLA 1ITGA 4QAGA 4KHSA 2QXFA 4FLUA 4CFDA 2VG7A 2YKMA 4DQQA 1U48A 3KTQA 1LWEA 1BQMA 2YNHA 4ZTJA 3OVNA 1I39A 4DFJA 3SQ2A 3TAEA 4FW2A 2BANA 4K8XA 1DTTA 2E6LA 3O3GA 1HYZA 1WSGA 1F21A 3V1RA 3SI6A 3TAPA 3WNEA 3K2PA 4CEOA 2P5OA 3AA3A 4OVLA 1Z25A 3HVTA 2KFNA 1B92A 4C8OA 4FJ5A 4FJ7A 3KK1A 3KD5E 1K6YA 1U47A 4HUEA 4OGCA 2DFFA 4CEEA 3V9ZA 2HHVA 3DLKA 1RDBA 4KTWA 4KHNA 3CG7A 1ASWA 3OS2A 1N5YA 1Q9YA 1JLQA 1NK8A 3T3FA 1TKZA 4CJKA 3KIOA 4CHQA 2X78A 3K5LA 1RBSA 2FBVA 5KRSA 1JL1A 3HSTB 4F3OA 4E3SA 3L2VA 1XC9A 4BDPA 1JLCA 3G10A 3OJUA 3V9SA 4BDZA 1S6PA 4R5PA 3OYLA 3LZIA 3NBPA 1CXUA 4DWIA 2OYQA 3NGZA 1LWCA 4I9LA 2GUIA 3AVMA 3ZSZA 3V9WA 5HROA 3V1QA 2RPIA 3C6UA 2ATQA 2D5RA 4DTSA 1JLBA 3RMCA 3BDPA 1TVRA 3D0PA 3B6OA 4DTPA 3SUOA 2OZMA 4K8ZA 3EYZA 4C8KA 1BIUA 1VSEA 2RN2A 5SZTA 4DSKA 3UIQA 2FC0A 4QOZB 4B9SA 1YVUA 4C8MA 4HHTA 4CF0A 4DF4A 1S1UA 3RWUA 3HJFA 3MEDA 4BE0A 3RMBA 2G8VA 2F8TA 2KZMA 3TAFA 3MECA 3RR8A 4CEDA 2LSNA 4O55A 3CFPA 1BCMA 4FJNA 3TWHA 4TSXA 2XO7A 4Q0BA 3V4IA 1L3TA 4N41A 4KHQA 4IKFA 2O4GA 2HVIA 3VQ8A 3LAKA 4DSLA 3DLRA 2IAJA 5HBMA 4FJLA 4DFMA 3VN5A 3HYFA 2XRIA 3HM9A 1UA0A 4YFUA 4BWMA 1QHTA 2E6MA 2VWJA 3LP3A 4FJJA 3HPOA 4DTNA 1IKXA 2X6NA 5C25A 3E01A 1FKPA 3NCIA 3M8PA 1BL3A 5D3GA 4FW1A 5J2PA 3NF6A 4IBNA 1BCOA 1ZBUA 3O3FA 3SZ2A 3DOLA 4CJWA 1WSEA 1SKRA 1C0UA 3VQPA 1RBVA 1GOCA 1QQCA 3OY9A 3OYIA 4CJTA 2EX3A 4M3TA 1S1VA 3B6PA 3S3MA 4CJPA 2ETJA 5JS2A 4CEZA 4KI6A 4RW4A 3PV8A 4Z0UA 3MXJA 4HUFA 2F96A 5HRNA 1EXQA 4LD0A 3OYMA 3U3YA 3PX6A 3O4NA 3S3NA 1J5OA 3VQQA 1QSSA 3ZT2A 3PO4A 1C1AA 3NGYA 1WLJA 3HPGA 2RF2A 4CJ4A 4E7HA 2XY7A 4W5RA 1FKOA 1MU2A 3LALA 2R7YA 3CFOA 3OYFA 1VSJA 3I8DA 1LWFA 3DLGA 4FLYA 1D9DA 5I3UA 1U04A 4F2RA 4J2BA 4RG8A 3DMJA 3NF9A 5CY4A 4CF2A 3M8SA 4FJHA 3U3GA 4FJ9A 3QEXA 4DTUA 3MEGA 4RW9A 3IG1A 4CHZA 2F8SA 5I42A 4Y1CA 3AVCA 1KVCA 4NCGA 3AO3A 4IFVA 1T05A 1N6QA 3AVKA 2G8UA 2D0CA 4JRPA 5C24A 1HRHA 4M3YA 1G15A 1IH7A 1RILA 1SV5A 1ASUA 3DLBA 3NFAA 4CEFA 1U45A 2O4IA 4W5NA 1NK7A 2AJQA 4EZ6A 4H4OA 4CF9A 5HP1A 1S9GA 2B5JA 4N5SA 4E1MA 4FCYA 2KZZA 3AVAA 3ZSOA 4JS4A 4Z4HA 1RTDA 3NH2A 3K58A 4JRQA 3IRXA 1CZ9A 1UOCA 1VSIA 1Y97A 3CFRA 3CQ8A 1ZBLA 2X6SA 4GW6A 2RKIA 4PA1A 1RDCA 4CESA 4CHOA 2WONA 2IS3A 3L2UA 4BDYA 3SQ4A 4PUOA 3QIPA 2ZQBA 3AO1A 4DFPA 3NH1A 1O1WA 4I2PA 1RT5A 3LWMA 2G8IA 4LH5A 4E0DA 2ITGA 4OLAA 3AVLA 3QEWA 4CHPA 1QE1A 2P1JA 2JGUA 3QERA 4I9QA 4KPYA 1R0AA 4DQRA 1BQNA 4Q5VA 3SCXA 1X9WA 3EZ5A 1S5JA 4B8CA 2HB5A 1C0MA 2PYLA 3DLEA 4Z4EA 2Q3SA 4DQSA 4B3OA 3AA4A 4O0JA 3EY1A 3PX4A 1HQUA 1LV5A 3OS1A 4AHVA 4FJ8A 3C94A 3ZT3A 2NUBA 5DMRA 1IKWA 3KD1E 3AVNA 2KQ2A 4DSEA 4KHWA 3WNHA 3TI0A 2HNDA 2HHSA 1RBUA 4DLEA 4FLVA 4EP5A 2A1RA 1A5WA 2QKKA 4I2QA 2IC3A 2XY8A 3VQCA 3AA2A 3MEEA 4UQGA 4I7FA 3MAQA 3PX0A 3LANA 4IFYA 1XHZA 2HMIA 3IAYA 1BGXT 5K14A 2IOCA 1VSMA 2GBZA 3HL8A 3P83D 4J2DA 1KSPA 3SPYA 3DRSA 2G8KA 4CCHA 1L5UA 2XY5A 2VWKA 3ITHA 4OGEA 3LP1A 1KFDA 3AO4A 1RDDA 3KK3A 3DYAA 1S1TA 1KFSA 4CK1A 3QESA 1HYVA 3QLHA 2X74A 2OPSA 4CGHA 2G8FA 4QCLA 1HMVA 2P51A 1S9EA 2DFHA 2Z1JA 3C6TA 4M3XA 3K5NA 3CM6A 4IG0A 4BACA 4OJRA 1IG9A 2YV0X 2BDPA 2BGGA 1C0TA 1L3VA 1VK0A 3LWLA 3TANA 3THVA 1RT1A 3ZT1A 5FRNA 1HPZA 1NOZA 3QO9A 1BISA 1A5VA 4LH4A 4B9NA 4CGJA 5FRMA 1WAFA 4YNQA 1KLNA 2YKNA 4DU4A 3VA3A 4J2EA 4CHYA 2HHUA 3LAMA 3L2QA 1RDAA 2YHBA 1BHLA 1JXBA 1TV6A 4FLTA 4B9TA 4FJKA 4FZZA 1KTQA 3OJSA 4IG3A 4KHUA 1REVA 1Q8IA 4AHSA 2EHGA 3HT3A 4ZHRA 1NJYA 2JLEA 1DLOA 1QSYA 1BI4B 3AVGA 4RW7A 2A1SA 3KLFA 1IKVA 4F3TA 1HYSA 3HP6A 3A2FA 1NJWA 4E1NA 3SUNA 4N76A 1KRPA 3V9UA 4FM0A 4CFCA 2PZSA 1RT3A 4PY5A 3V1OA 4CJRA 3VQDA 4CEQA 3KLHA 5KTQA 3SQ0A 1KVAA 4AHCA 4OPJA 2KFZA 1NK9A 1T8EA 4HTUA 2OPRA 1WSIA 1S6QA 3KLIA 1B9FA 1RTHA 5J2MA 4CF1A 3RMDA 4CIFA 5C42A 2BE2A 1NKEA 3VQ5A 5FDLA 3JYTA 1LW0A 1WAJA 1WSFA 1JLEA 1J53A 3NDKA 3OYGA 2YNFA 3AO5A 1KVBA 2HNYA 3OYBA 4JLHA 4OKEA 3ZT0A 1ZBIA 1X9SA 4KTZA 1L3UA 3MXMA 3NH0A 1IKYA 2B4JA 4ICLA 3L3VA 4M42A 4LSLA 4L8RB 4FJXA 3KKSA 3OYDA 1C1BA 1EETA 3NGIA 3VA0A 2G8HA 3OYAA 3ZSVA 1TAUA 1HJRA 3K5MA 5HRRA 2YNGA 4PQUA 4F2SA 4FM1A 3HPHA 4CJ3A 4F8RA 3KKRA 2OPPA 4E7JA 4HCCA 3LPUA 3NE6A 4FJMA 1I3AA 5J2QA 1DTQA 1D8YA 4B9VA 4FLXA 3MXIA 1SKSA 3P1GA 5EU7A 3OYNA 2FBXA 4LY7A 2OA8A 3L3UA 4DSFA 3QEIA 3QETA 1T03A 4NCAA 3VQEA 2HNZA 2PYJA 3OYJA 3O4QA 5HRPA 3TABA 3ZSXA 4W5OA 4FJGA 5HLFA 2YNIA 5DK5A 4CE9A 1JKHA 5E41A 3TAGA 4B9UA 1TL3A 1VRUA 3DRRA 4KTQA 2Y1IA 3CYMA 4CJ5A 3O3HA 3PO5A 3LZJA 3AVBA 2B6AA 4N56A 2OPQA 1GOBA 3AV9A 4FXDA 1KCFA 3V6DA 2D0BA 4DSJA 3KJVA 1EX4A 1FK9A 2Z1IA 3NF7A 4G1QA 4C8NA 4CGGA 4CJVA 4BE1A 4FZYA 3F73A 1C1CA 1RT6A 3OS0A 1SKWA 3DLHA 1RTIA 3NF8A 2GV9A 3PY8A 4FK4A 3HK2A 1SL2A 3VQ7A 2W42A 4B9LA 1B9DA 1FXXA 4CJEA 1JL2A 4DS4A 5J2NA 1T7PA 4HVJA 4Z4GA 4CGFA 3QNNA 1RT4A 1YT3A 3P5JA 1RBTA 1W9HA 1XHXA 1GOAA 1JLAA 4Z4IA 3AVIA 3VQ6A 4E7KA 1VSFA 3SQ1A 2YHAA 3SJJA 5KGWA 4M45A 1LW2A 4AHUA 2IGIA 2G8WA 4FYDA 5KI6A 3BGRA 4KHYA 4DFKA 3M8RA 4ELVA 4CJLA 3ZSQA 2E4LA 4O5BA 3ZCMA 4ID5A 3OYCA 3NAEA 4F4KA 1TGOA 1XI1A 1UAXA 4AHTA 2VG5A 1XWLA 1VSHA 1SL1A 5CYMA 3VQ4A 3HVRA 4CEAA 1ZBHA 4E7IA 4OPKA 1TK0A 3U6FA 4FK0A 3G0ZA 3L8BA 3SYZA 3ULDA 1CLQA 4O44A 1UA1A 4CGDA 1RT7A 4B9MA 3K57A 1NJZA 4H4MA 2DFEA 3C95A 3L2RA 3TR8A 3ZSYA 3OYKA 4DU3A 1U4BA 4KFBA 4CJSA 1QS4A 3SV4A 2XY6A 1D9FA 2HHXA 4O4GA 1CXQA 1TK5A 2P5GA 2OZSA 5KGXA 3ZSRA 2HVHA 4W5TA 1NOYA 1SUQA 3VQAA 1RTJA 4KB1A 4PWDA 1TKTA 4CERA 1CZBA 1YTUA 4DU1A 4CIGA 3SUPA 2VG6A 5KRTA 4KB0A 4J2AA 3L2WA 1NK6A 4ZTFA 1U49A 4CFAA 4B08A 1HNIA 2XHBA 1J54A 2Z1HA 4ID1A 4KKOA 4E89A 4EZ9A 4LSNA 3CM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOM A;  4CF8 A;  4DTJ A;  3S3O A;  2PY5 A;  3ALY A;  1RBR A;  3ISN C;  3JSM A;  4NCB A;  1WSJ A;  4DTO A;  3DOK A;  1TKX A;  1TL1 A;  3AA5 X;  3VQ9 A;  4CIE A;  2KW4 A;  4E19 A;  3V9X A;  1NK0 A;  4KRE A;  5FRO A;  3WNF A;  4FZX C;  3ASM A;  1EKE A;  4KV8 A;  3F9K A;  4C8L A;  4MFB A;  4EP4 A;  1YTA A;  4DQI A;  3DI6 A;  3T1A A;  4FVM A;  3LP0 A;  4E7L A;  1JXE A;  4FLW A;  1IO2 A;  1RNH A;  3QIO A;  3V81 A;  1Z26 A;  1TAQ A;  5HRS A;  5T7B A;  4KI4 A;  1A5X A;  1WN7 A;  4CJQ A;  1BIZ A;  4NYF A;  1TKD A;  1KLM A;  3KK2 A;  4BWJ A;  4WE1 A;  4CEB A;  4ELU A;  3T19 A;  4M3W A;  1ZYQ A;  3AVF A;  3IS9 A;  2ZE2 A;  4DLG A;  2D0A A;  2HHW A;  1VSD A;  4GMJ B;  2FBY A;  3SNN A;  4Y1D A;  1JLF A;  4N47 A;  3I0R A;  4MQ3 A;  1X9M A;  5JS1 A;  3RRH A;  3M8Q A;  3LPT A;  5CZ2 A;  1NK5 A;  4DG1 A;  4BE2 A;  3KLE A;  1QTM A;  5CYQ A;  4CFB A;  1BI4 A;  4AIL C;  3HXM A;  1L3S A;  4DQP A;  3LDS A;  2HHT A;  5CZ1 A;  4O0I A;  3VQB A;  4B8A B;  4JS5 A;  4OLB A;  2DTU A;  1WSH A;  4RW6 A;  4Z4C A;  3FFI A;  4DF8 A;  4AH9 A;  4GVM A;  1EP4 A;  3ZSW A;  4Z4F A;  1C6V A;  1W0H A;  3SUQ A;  1WNS A;  3D45 A;  3I0S A;  1ASV A;  3DRP A;  3QNO A;  3TAM A;  1VSK A;  4DTR A;  4OKK A;  1LAV A;  2FBT A;  3QIN A;  4CJF A;  4CK3 A;  4KO0 A;  2QK9 A;  1D5A A;  4CK2 A;  4HCB A;  1NKB A;  1J9A A;  1S1X A;  1NK4 A;  4OKJ A;  3AVJ A;  4HUG A;  4H8K A;  1HQE A;  1S1W A;  1ZBF A;  4KAZ A;  2HHQ A;  3OYE A;  4DTM A;  4CJU A;  5J1E A;  3SV3 A;  1NJX A;  1SL0 A;  1RT2 A;  3S9H A;  3RRG A;  3HO1 A;  4M41 A;  4W5Q A;  3AO2 A;  1LAW A;  4FM2 A;  4NYN A;  2IDO A;  1VRT A;  4RW8 A;  2Y1J A;  4FK2 A;  1RCH A;  3K5O A;  3RTV A;  3PUF A;  4ELT A;  3AVH A;  1TK8 A;  3OYH A;  2KTQ A;  1UWB A;  1HNV A;  3NHG A;  4M3U A;  1Q9X A;  2HW3 A;  4DMN A;  2Z1G A;  4M3R A;  4DTX A;  3DM2 A;  3WNG A;  3ZT4 A;  3KLG A;  2ZD1 A;  1X1P A;  4KRF A;  3SPZ A;  3K59 A;  1JLG A;  4FLZ A;  2DY4 A;  4CEC A;  2I5J A;  3LP2 A;  4CHN A;  3QEP A;  4DSI A;  3HP9 A;  2QKB A;  1NKC A;  3RMA A;  4IDK A;  4M3Z A;  3QEV A;  4XIU A;  3RR7 A;  1VSL A;  4AHR A;  3H08 A;  4DS5 A;  5SWM A;  4FJI A;  3TAR A;  3TAQ A;  4CGI A;  1QSL A;  1ITG A;  4QAG A;  4KHS A;  2QXF A;  4FLU A;  4CFD A;  2VG7 A;  2YKM A;  4DQQ A;  1U48 A;  3KTQ A;  1LWE A;  1BQM A;  2YNH A;  4ZTJ A;  3OVN A;  1I39 A;  4DFJ A;  3SQ2 A;  3TAE A;  4FW2 A;  2BAN A;  4K8X A;  1DTT A;  2E6L A;  3O3G A;  1HYZ A;  1WSG A;  1F21 A;  3V1R A;  3SI6 A;  3TAP A;  3WNE A;  3K2P A;  4CEO A;  2P5O A;  3AA3 A;  4OVL A;  1Z25 A;  3HVT A;  2KFN A;  1B92 A;  4C8O A;  4FJ5 A;  4FJ7 A;  3KK1 A;  3KD5 E;  1K6Y A;  1U47 A;  4HUE A;  4OGC A;  2DFF A;  4CEE A;  3V9Z A;  2HHV A;  3DLK A;  1RDB A;  4KTW A;  4KHN A;  3CG7 A;  1ASW A;  3OS2 A;  1N5Y A;  1Q9Y A;  1JLQ A;  1NK8 A;  3T3F A;  1TKZ A;  4CJK A;  3KIO A;  4CHQ A;  2X78 A;  3K5L A;  1RBS A;  2FBV A;  5KRS A;  1JL1 A;  3HST B;  4F3O A;  4E3S A;  3L2V A;  1XC9 A;  4BDP A;  1JLC A;  3G10 A;  3OJU A;  3V9S A;  4BDZ A;  1S6P A;  4R5P A;  3OYL A;  3LZI A;  3NBP A;  1CXU A;  4DWI A;  2OYQ A;  3NGZ A;  1LWC A;  4I9L A;  2GUI A;  3AVM A;  3ZSZ A;  3V9W A;  5HRO A;  3V1Q A;  2RPI A;  3C6U A;  2ATQ A;  2D5R A;  4DTS A;  1JLB A;  3RMC A;  3BDP A;  1TVR A;  3D0P A;  3B6O A;  4DTP A;  3SUO A;  2OZM A;  4K8Z A;  3EYZ A;  4C8K A;  1BIU A;  1VSE A;  2RN2 A;  5SZT A;  4DSK A;  3UIQ A;  2FC0 A;  4QOZ B;  4B9S A;  1YVU A;  4C8M A;  4HHT A;  4CF0 A;  4DF4 A;  1S1U A;  3RWU A;  3HJF A;  3MED A;  4BE0 A;  3RMB A;  2G8V A;  2F8T A;  2KZM A;  3TAF A;  3MEC A;  3RR8 A;  4CED A;  2LSN A;  4O55 A;  3CFP A;  1BCM A;  4FJN A;  3TWH A;  4TSX A;  2XO7 A;  4Q0B A;  3V4I A;  1L3T A;  4N41 A;  4KHQ A;  4IKF A;  2O4G A;  2HVI A;  3VQ8 A;  3LAK A;  4DSL A;  3DLR A;  2IAJ A;  5HBM A;  4FJL A;  4DFM A;  3VN5 A;  3HYF A;  2XRI A;  3HM9 A;  1UA0 A;  4YFU A;  4BWM A;  1QHT A;  2E6M A;  2VWJ A;  3LP3 A;  4FJJ A;  3HPO A;  4DTN A;  1IKX A;  2X6N A;  5C25 A;  3E01 A;  1FKP A;  3NCI A;  3M8P A;  1BL3 A;  5D3G A;  4FW1 A;  5J2P A;  3NF6 A;  4IBN A;  1BCO A;  1ZBU A;  3O3F A;  3SZ2 A;  3DOL A;  4CJW A;  1WSE A;  1SKR A;  1C0U A;  3VQP A;  1RBV A;  1GOC A;  1QQC A;  3OY9 A;  3OYI A;  4CJT A;  2EX3 A;  4M3T A;  1S1V A;  3B6P A;  3S3M A;  4CJP A;  2ETJ A;  5JS2 A;  4CEZ A;  4KI6 A;  4RW4 A;  3PV8 A;  4Z0U A;  3MXJ A;  4HUF A;  2F96 A;  5HRN A;  1EXQ A;  4LD0 A;  3OYM A;  3U3Y A;  3PX6 A;  3O4N A;  3S3N A;  1J5O A;  3VQQ A;  1QSS A;  3ZT2 A;  3PO4 A;  1C1A A;  3NGY A;  1WLJ A;  3HPG A;  2RF2 A;  4CJ4 A;  4E7H A;  2XY7 A;  4W5R A;  1FKO A;  1MU2 A;  3LAL A;  2R7Y A;  3CFO A;  3OYF A;  1VSJ A;  3I8D A;  1LWF A;  3DLG A;  4FLY A;  1D9D A;  5I3U A;  1U04 A;  4F2R A;  4J2B A;  4RG8 A;  3DMJ A;  3NF9 A;  5CY4 A;  4CF2 A;  3M8S A;  4FJH A;  3U3G A;  4FJ9 A;  3QEX A;  4DTU A;  3MEG A;  4RW9 A;  3IG1 A;  4CHZ A;  2F8S A;  5I42 A;  4Y1C A;  3AVC A;  1KVC A;  4NCG A;  3AO3 A;  4IFV A;  1T05 A;  1N6Q A;  3AVK A;  2G8U A;  2D0C A;  4JRP A;  5C24 A;  1HRH A;  4M3Y A;  1G15 A;  1IH7 A;  1RIL A;  1SV5 A;  1ASU A;  3DLB A;  3NFA A;  4CEF A;  1U45 A;  2O4I A;  4W5N A;  1NK7 A;  2AJQ A;  4EZ6 A;  4H4O A;  4CF9 A;  5HP1 A;  1S9G A;  2B5J A;  4N5S A;  4E1M A;  4FCY A;  2KZZ A;  3AVA A;  3ZSO A;  4JS4 A;  4Z4H A;  1RTD A;  3NH2 A;  3K58 A;  4JRQ A;  3IRX A;  1CZ9 A;  1UOC A;  1VSI A;  1Y97 A;  3CFR A;  3CQ8 A;  1ZBL A;  2X6S A;  4GW6 A;  2RKI A;  4PA1 A;  1RDC A;  4CES A;  4CHO A;  2WON A;  2IS3 A;  3L2U A;  4BDY A;  3SQ4 A;  4PUO A;  3QIP A;  2ZQB A;  3AO1 A;  4DFP A;  3NH1 A;  1O1W A;  4I2P A;  1RT5 A;  3LWM A;  2G8I A;  4LH5 A;  4E0D A;  2ITG A;  4OLA A;  3AVL A;  3QEW A;  4CHP A;  1QE1 A;  2P1J A;  2JGU A;  3QER A;  4I9Q A;  4KPY A;  1R0A A;  4DQR A;  1BQN A;  4Q5V A;  3SCX A;  1X9W A;  3EZ5 A;  1S5J A;  4B8C A;  2HB5 A;  1C0M A;  2PYL A;  3DLE A;  4Z4E A;  2Q3S A;  4DQS A;  4B3O A;  3AA4 A;  4O0J A;  3EY1 A;  3PX4 A;  1HQU A;  1LV5 A;  3OS1 A;  4AHV A;  4FJ8 A;  3C94 A;  3ZT3 A;  2NUB A;  5DMR A;  1IKW A;  3KD1 E;  3AVN A;  2KQ2 A;  4DSE A;  4KHW A;  3WNH A;  3TI0 A;  2HND A;  2HHS A;  1RBU A;  4DLE A;  4FLV A;  4EP5 A;  2A1R A;  1A5W A;  2QKK A;  4I2Q A;  2IC3 A;  2XY8 A;  3VQC A;  3AA2 A;  3MEE A;  4UQG A;  4I7F A;  3MAQ A;  3PX0 A;  3LAN A;  4IFY A;  1XHZ A;  2HMI A;  3IAY A;  1BGX T;  5K14 A;  2IOC A;  1VSM A;  2GBZ A;  3HL8 A;  3P83 D;  4J2D A;  1KSP A;  3SPY A;  3DRS A;  2G8K A;  4CCH A;  1L5U A;  2XY5 A;  2VWK A;  3ITH A;  4OGE A;  3LP1 A;  1KFD A;  3AO4 A;  1RDD A;  3KK3 A;  3DYA A;  1S1T A;  1KFS A;  4CK1 A;  3QES A;  1HYV A;  3QLH A;  2X74 A;  2OPS A;  4CGH A;  2G8F A;  4QCL A;  1HMV A;  2P51 A;  1S9E A;  2DFH A;  2Z1J A;  3C6T A;  4M3X A;  3K5N A;  3CM6 A;  4IG0 A;  4BAC A;  4OJR A;  1IG9 A;  2YV0 X;  2BDP A;  2BGG A;  1C0T A;  1L3V A;  1VK0 A;  3LWL A;  3TAN A;  3THV A;  1RT1 A;  3ZT1 A;  5FRN A;  1HPZ A;  1NOZ A;  3QO9 A;  1BIS A;  1A5V A;  4LH4 A;  4B9N A;  4CGJ A;  5FRM A;  1WAF A;  4YNQ A;  1KLN A;  2YKN A;  4DU4 A;  3VA3 A;  4J2E A;  4CHY A;  2HHU A;  3LAM A;  3L2Q A;  1RDA A;  2YHB A;  1BHL A;  1JXB A;  1TV6 A;  4FLT A;  4B9T A;  4FJK A;  4FZZ A;  1KTQ A;  3OJS A;  4IG3 A;  4KHU A;  1REV A;  1Q8I A;  4AHS A;  2EHG A;  3HT3 A;  4ZHR A;  1NJY A;  2JLE A;  1DLO A;  1QSY A;  1BI4 B;  3AVG A;  4RW7 A;  2A1S A;  3KLF A;  1IKV A;  4F3T A;  1HYS A;  3HP6 A;  3A2F A;  1NJW A;  4E1N A;  3SUN A;  4N76 A;  1KRP A;  3V9U A;  4FM0 A;  4CFC A;  2PZS A;  1RT3 A;  4PY5 A;  3V1O A;  4CJR A;  3VQD A;  4CEQ A;  3KLH A;  5KTQ A;  3SQ0 A;  1KVA A;  4AHC A;  4OPJ A;  2KFZ A;  1NK9 A;  1T8E A;  4HTU A;  2OPR A;  1WSI A;  1S6Q A;  3KLI A;  1B9F A;  1RTH A;  5J2M A;  4CF1 A;  3RMD A;  4CIF A;  5C42 A;  2BE2 A;  1NKE A;  3VQ5 A;  5FDL A;  3JYT A;  1LW0 A;  1WAJ A;  1WSF A;  1JLE A;  1J53 A;  3NDK A;  3OYG A;  2YNF A;  3AO5 A;  1KVB A;  2HNY A;  3OYB A;  4JLH A;  4OKE A;  3ZT0 A;  1ZBI A;  1X9S A;  4KTZ A;  1L3U A;  3MXM A;  3NH0 A;  1IKY A;  2B4J A;  4ICL A;  3L3V A;  4M42 A;  4LSL A;  4L8R B;  4FJX A;  3KKS A;  3OYD A;  1C1B A;  1EET A;  3NGI A;  3VA0 A;  2G8H A;  3OYA A;  3ZSV A;  1TAU A;  1HJR A;  3K5M A;  5HRR A;  2YNG A;  4PQU A;  4F2S A;  4FM1 A;  3HPH A;  4CJ3 A;  4F8R A;  3KKR A;  2OPP A;  4E7J A;  4HCC A;  3LPU A;  3NE6 A;  4FJM A;  1I3A A;  5J2Q A;  1DTQ A;  1D8Y A;  4B9V A;  4FLX A;  3MXI A;  1SKS A;  3P1G A;  5EU7 A;  3OYN A;  2FBX A;  4LY7 A;  2OA8 A;  3L3U A;  4DSF A;  3QEI A;  3QET A;  1T03 A;  4NCA A;  3VQE A;  2HNZ A;  2PYJ A;  3OYJ A;  3O4Q A;  5HRP A;  3TAB A;  3ZSX A;  4W5O A;  4FJG A;  5HLF A;  2YNI A;  5DK5 A;  4CE9 A;  1JKH A;  5E41 A;  3TAG A;  4B9U A;  1TL3 A;  1VRU A;  3DRR A;  4KTQ A;  2Y1I A;  3CYM A;  4CJ5 A;  3O3H A;  3PO5 A;  3LZJ A;  3AVB A;  2B6A A;  4N56 A;  2OPQ A;  1GOB A;  3AV9 A;  4FXD A;  1KCF A;  3V6D A;  2D0B A;  4DSJ A;  3KJV A;  1EX4 A;  1FK9 A;  2Z1I A;  3NF7 A;  4G1Q A;  4C8N A;  4CGG A;  4CJV A;  4BE1 A;  4FZY A;  3F73 A;  1C1C A;  1RT6 A;  3OS0 A;  1SKW A;  3DLH A;  1RTI A;  3NF8 A;  2GV9 A;  3PY8 A;  4FK4 A;  3HK2 A;  1SL2 A;  3VQ7 A;  2W42 A;  4B9L A;  1B9D A;  1FXX A;  4CJE A;  1JL2 A;  4DS4 A;  5J2N A;  1T7P A;  4HVJ A;  4Z4G A;  4CGF A;  3QNN A;  1RT4 A;  1YT3 A;  3P5J A;  1RBT A;  1W9H A;  1XHX A;  1GOA A;  1JLA A;  4Z4I A;  3AVI A;  3VQ6 A;  4E7K A;  1VSF A;  3SQ1 A;  2YHA A;  3SJJ A;  5KGW A;  4M45 A;  1LW2 A;  4AHU A;  2IGI A;  2G8W A;  4FYD A;  5KI6 A;  3BGR A;  4KHY A;  4DFK A;  3M8R A;  4ELV A;  4CJL A;  3ZSQ A;  2E4L A;  4O5B A;  3ZCM A;  4ID5 A;  3OYC A;  3NAE A;  4F4K A;  1TGO A;  1XI1 A;  1UAX A;  4AHT A;  2VG5 A;  1XWL A;  1VSH A;  1SL1 A;  5CYM A;  3VQ4 A;  3HVR A;  4CEA A;  1ZBH A;  4E7I A;  4OPK A;  1TK0 A;  3U6F A;  4FK0 A;  3G0Z A;  3L8B A;  3SYZ A;  3ULD A;  1CLQ A;  4O44 A;  1UA1 A;  4CGD A;  1RT7 A;  4B9M A;  3K57 A;  1NJZ A;  4H4M A;  2DFE A;  3C95 A;  3L2R A;  3TR8 A;  3ZSY A;  3OYK A;  4DU3 A;  1U4B A;  4KFB A;  4CJS A;  1QS4 A;  3SV4 A;  2XY6 A;  1D9F A;  2HHX A;  4O4G A;  1CXQ A;  1TK5 A;  2P5G A;  2OZS A;  5KGX A;  3ZSR A;  2HVH A;  4W5T A;  1NOY A;  1SUQ A;  3VQA A;  1RTJ A;  4KB1 A;  4PWD A;  1TKT A;  4CER A;  1CZB A;  1YTU A;  4DU1 A;  4CIG A;  3SUP A;  2VG6 A;  5KRT A;  4KB0 A;  4J2A A;  3L2W A;  1NK6 A;  4ZTF A;  1U49 A;  4CFA A;  4B08 A;  1HNI A;  2XHB A;  1J54 A;  2Z1H A;  4ID1 A;  4KKO A;  4E89 A;  4EZ9 A;  4LSN A;  3CM5 A; 
#chains in the Genus database with same CATH topology
 2WOM A;  4DTJ A;  3ISN C;  2YJE A;  2UXC K;  2O8F B;  1J6Z A;  4B3S K;  3DOK A;  1TL1 A;  4E19 A;  3V9X A;  1NK0 A;  3EKU A;  4C8L A;  3DI6 A;  4FVM A;  3LP0 A;  4K25 A;  3U8X A;  4FLW A;  3P4I A;  1RNH A;  3QIO A;  1TAQ A;  1X3M A;  1YVN A;  4BC4 A;  1WN7 A;  1TKD A;  1KLM A;  3KK2 A;  4B1W B;  4ELU A;  5CE3 A;  3SNN A;  4A2B A;  1JLF A;  1X9M A;  4CBW A;  4MQ3 A;  3KVG A;  2QEX N;  3M8Q A;  1RDU A;  1NK5 A;  4FWS A;  4GNI A;  4BE2 A;  3KLE A;  5CYQ A;  3HXM A;  2HHT A;  3T69 A;  3VQB A;  2ZF5 O;  3VTH A;  3FZH A;  1VQN N;  3C6A A;  4B3R K;  4Z4C A;  4RW6 A;  4H5N A;  3FFI A;  4GVM A;  1EP4 A;  5B8H A;  1OVY A;  3D45 A;  1ASV A;  3DRP A;  3TAM A;  4DTR A;  2FBT A;  4CJF A;  3C7N A;  3PSF A;  3FGU A;  4KO0 A;  4CK2 A;  1NK4 A;  2F9T A;  4H8K A;  4G9Z A;  5GIP A;  4LF9 K;  4DR7 K;  1Q18 A;  3RRG A;  3S9H A;  3OHR A;  4M41 A;  4W5Q A;  4JKG A;  4DR1 K;  4RW8 A;  4EHT A;  4FK2 A;  2QM1 A;  4ELT A;  3OW2 M;  1BU6 O;  3PSI A;  3TTC A;  1Q9X A;  4M3R A;  4KHP K;  4I6M B;  3LM2 A;  1ATS A;  1JLG A;  3LP2 A;  4CHN A;  4DSI A;  3QEP A;  3HP9 A;  4IDH A;  4IDK A;  3O1B A;  1I94 K;  4XIU A;  3RR7 A;  4AHR A;  4WF9 L;  4DS5 A;  5SWM A;  5AQU A;  1ITG A;  4QAG A;  4XH5 A;  2VG7 A;  2QXL A;  2YKM A;  2GTD A;  1IBK K;  3QBX A;  5FLX O;  3CC4 N;  2BAN A;  3ZYY X;  1DTT A;  2E6L A;  1HYZ A;  4H5T A;  3ZX3 A;  1F21 A;  3V1R A;  3HOS A;  3M1F A;  1SAZ A;  5KPZ A;  4DV4 K;  3AA3 A;  4NO7 A;  2E2O A;  1YHQ N;  1XNQ K;  3K9K A;  3KK1 A;  3CQY A;  4CEE A;  2DFF A;  3VEV A;  1DGK N;  1RDB A;  4KHN A;  3WQT A;  2P9K A;  1NK8 A;  2A5X A;  2F4V K;  1SQK A;  3CHW A;  1HR0 K;  4CJK A;  3K5L A;  1RBS A;  5KRS A;  4F3O A;  4BQL A;  1N34 K;  4E3S A;  4FWL A;  3PLA A;  4FWM A;  3OJU A;  4OX9 K;  4BDZ A;  1S6P A;  4R5P A;  4DWI A;  3L6Q A;  2OYQ A;  4JKE A;  4I9L A;  2GUI A;  5HRO A;  2RPI A;  3RMC A;  3SUO A;  1NWK A;  4K8Z A;  1HNX K;  3CER A;  1YVU A;  4C8M A;  4FWN A;  3J7A P;  4KH5 A;  2G8V A;  2KZM A;  3H45 C;  2E1Z A;  3RR8 A;  4CED A;  2LSN A;  4O55 A;  1WBB A;  4N41 A;  3GOI A;  3VQ8 A;  4FJL A;  5BPL A;  4JNE A;  2XRI A;  4YFU A;  3LP3 A;  4FJJ A;  4DTN A;  3IUC A;  1IKX A;  2X6N A;  1BL3 A;  2VGN A;  3THY A;  4K42 A;  5J2P A;  5AQI A;  1YI2 N;  1YJ9 N;  3UE5 A;  1QQC A;  3WXK A;  4M3T A;  4CJT A;  3B6P A;  3S3M A;  4CZF A;  2ETJ A;  5MLC Q;  4DV1 K;  3HI0 A;  1E4F T;  3P38 A;  3CQX A;  3FLC O;  3OYM A;  3S3N A;  1OVQ A;  3CJ7 A;  3O4N A;  1QSS A;  1HKC A;  4CJ4 A;  1WLJ A;  4E7H A;  3ENH A;  1QZ6 A;  4DV7 K;  4W5R A;  4IJN A;  3CCM N;  4B1X B;  2R7Y A;  3OYF A;  1LWF A;  1D9D A;  4RG8 A;  4CF2 A;  4FJH A;  2E2P A;  4DTU A;  3IG1 A;  3MN6 A;  3AVK A;  5BPN A;  4JRP A;  4M3Y A;  1G15 A;  1RIL A;  4A5B A;  4BRP A;  4MO4 A;  1VQ8 N;  1SS6 A;  5BRE A;  1S9G A;  2B5J A;  4E1M A;  4IOA L;  4FWQ A;  2KZZ A;  2WBN A;  3ZSO A;  2H3G X;  1DT9 A;  1N33 K;  4FSV A;  3HRG A;  1CZ9 A;  3VEW A;  1ZBL A;  4PA1 A;  1RDC A;  2WON A;  3EO3 A;  1K73 O;  4BGB A;  5C15 A;  3QIP A;  3AO1 A;  4BG8 A;  4BRF A;  4I2P A;  2G8I A;  1RT5 A;  3VF4 A;  4LH5 A;  4QS8 A;  2ITG A;  5GIO A;  3AVL A;  4GKK K;  1QE1 A;  4C23 A;  3QER A;  4DQR A;  4M7Y A;  4Q5V A;  3SCX A;  3N4P A;  4DR4 K;  2HB5 A;  1C0M A;  2PYL A;  4B3O A;  3OS1 A;  2UUC K;  1IKW A;  2HBM A;  2KQ2 A;  3WNH A;  3T1H K;  4DLE A;  4JI4 K;  4H03 B;  2QKK A;  5EY4 A;  2IC3 A;  3PIP L;  3VQC A;  1RFQ A;  3LAN A;  1X3N A;  1ESV A;  3VMF B;  4B1Y B;  3N4Q A;  1VSM A;  1W7A A;  3P83 D;  4JI6 K;  3DRS A;  3SMP A;  4LF4 K;  2G8K A;  1L5U A;  4FOI A;  3ITH A;  3LP1 A;  1KFD A;  4IXC A;  2P9N B;  1N36 K;  1M1K O;  1K8K A;  1ZBS A;  4BC3 A;  3G6E N;  4CZH A;  3K5N A;  1GLL O;  3QFP A;  3CM6 A;  4AQY K;  2YV0 X;  2BDP A;  2BGG A;  1KD1 O;  4K41 A;  4A5A A;  3LWL A;  1RT1 A;  3ZT1 A;  1EQY A;  1KQS M;  3QO9 A;  3C0B A;  4ILH A;  1A5V A;  4JI0 K;  2HHH K;  1T3V A;  4JK7 A;  1X9J A;  3RSE B;  1RDA A;  1TV6 A;  3FE1 A;  4IOC L;  4KHU A;  1Q8I A;  4AHS A;  1E3M A;  4BC5 A;  3D2E B;  2QWP A;  3MN5 A;  4DV5 K;  2A1S A;  4JKC A;  1HYS A;  3HP6 A;  4IEE A;  5AQL A;  2HF4 A;  4IO9 L;  4N76 A;  2CGJ A;  5LJV A;  4CFC A;  3V1O A;  4CJR A;  1KVA A;  4AHC A;  3DWL A;  5C12 A;  3VEO A;  1S6Q A;  2IVN A;  1B9F A;  5J2M A;  4YHH K;  3HM8 A;  3VQ5 A;  3AGK A;  3JYT A;  1WAJ A;  2QI2 A;  3QIC A;  2YNF A;  1KVB A;  4OKE A;  1X9S A;  3ZLJ A;  3UKU B;  1IKY A;  4M42 A;  4WQ4 C;  4LF5 K;  4FJX A;  5AQQ A;  3M5R A;  3R3L A;  1EET A;  1HJR A;  3ID8 A;  3IKM A;  2YNG A;  3TU5 A;  4FM1 A;  3HPH A;  5C2F A;  2D1K A;  4E7J A;  1QQM A;  1I3A A;  4B9V A;  3OYN A;  2FBX A;  4LY7 A;  2OA8 A;  3E9L A;  4DSF A;  2VQE K;  2PYJ A;  2HNZ A;  3O4Q A;  5HRP A;  1XQS C;  3ZSX A;  4FJG A;  3TAG A;  1MWK A;  3CYM A;  1WBD A;  2P9L A;  3LZJ A;  5AQS A;  2B6A A;  2OPQ A;  3CI5 A;  4FXD A;  3KJV A;  1EX4 A;  1FK9 A;  1FW6 A;  4U7B A;  4CD3 A;  1OKJ A;  1VQ6 N;  1RTI A;  2O8E A;  2HBJ A;  1QZ5 A;  2NRH A;  3CJC A;  4HVJ A;  4ISF A;  1YT3 A;  3H46 O;  1JLA A;  4E7K A;  4PKG A;  4DV0 K;  1GLC G;  1KAY A;  3WT0 A;  2VGM A;  4BVP A;  4CJL A;  3ZSQ A;  3ZCM A;  4O5B A;  3O80 A;  3OYC A;  3NAE A;  4DR5 K;  5CR4 A;  4AHT A;  3NMU A;  4WFB L;  4K0K K;  1CLQ A;  3SYZ A;  1UA1 A;  3K57 A;  3A5O C;  3RVC A;  4GV6 A;  4DU3 A;  1U4B A;  1QS4 A;  1TK5 A;  2YCH A;  5KGX A;  1NMD A;  4W5T A;  3MWT A;  4KB1 A;  4PWD A;  4DV3 K;  4PL8 A;  2XHB A;  4NB4 A;  1J54 A;  2UYT A;  2Q2R A;  4CF8 A;  3S3O A;  3HZ6 A;  3GDQ A;  4LF7 K;  3ALY A;  4H0T B;  1WSJ A;  1E4G T;  2KHO A;  3AA5 X;  2KW4 A;  4NXM K;  4KRE A;  3WNF A;  3CCV N;  4EP4 A;  4DQI A;  3CCJ N;  3T1A A;  4E7L A;  1HJO A;  2D4W A;  2GWJ A;  3CJ9 A;  4FWR A;  1IO2 A;  3V81 A;  1Z26 A;  4KI4 A;  4CJQ A;  1BIZ A;  4NYF A;  4M3W A;  4CEB A;  4WE1 A;  3THX B;  3J81 O;  4DLG A;  2D0A A;  5E84 A;  2HHW A;  4GMJ B;  4Y1D A;  2E2Q A;  4N47 A;  3I0R A;  3LPT A;  2W6K A;  3A5L C;  3FZL A;  4DV6 K;  1BI4 A;  3H3O B;  1L3S A;  3LDS A;  4OLB A;  1NGA A;  4X64 K;  2NZT A;  4DF8 A;  3D2F B;  4JI1 K;  3ENB A;  1C6V A;  1W0H A;  3I0S A;  1VQ5 N;  1VSK A;  1IV0 A;  3QIN A;  1KC8 O;  4A61 A;  3SAH A;  1KXP A;  3AVJ A;  5BRH A;  5M1F A;  3O5B A;  5J1E A;  2E8A A;  2YHX A;  1SL0 A;  1RT2 A;  3SBT A;  3AAQ A;  3AO2 A;  4NYN A;  2IDO A;  3A5M C;  5BRD A;  4YOT A;  1TK8 A;  2W6L A;  4JKB A;  4BC2 A;  1HNV A;  3NHG A;  4DMN A;  4DTX A;  2UXB K;  3DM2 A;  3WNG A;  4IWV A;  1YXQ A;  1X1P A;  2ZD1 A;  1Q86 O;  4KRF A;  2DY4 A;  2QKB A;  5AQZ A;  4X62 K;  1NKC A;  2O8C B;  1OH6 A;  4AM6 A;  1GLE G;  5DM7 L;  4CGI A;  5AQV A;  4KHS A;  1SZ2 A;  4FLU A;  1MDU B;  1U48 A;  2P9P A;  3OVN A;  4H0V B;  4DFJ A;  5AZJ A;  1WSG A;  1NGB A;  3WNE A;  3K2P A;  2P5O A;  1K6Y A;  5GAG P;  3T7Z A;  2HHV A;  3DLK A;  4KTW A;  3ULE A;  3CG7 A;  4BR4 A;  3OS2 A;  3CET A;  4DUY K;  1O13 A;  2VWB A;  3KIO A;  4CHQ A;  2X78 A;  1JCF A;  3HST B;  4DUZ K;  3L2V A;  1XC9 A;  1OH7 A;  1HX1 A;  3CJ1 A;  3ID6 A;  1GLA G;  3GE1 A;  1CXU A;  1LWC A;  2CH5 A;  4H5R A;  3ZSZ A;  3OBW A;  1J5E K;  3D0P A;  4A59 A;  1BIU A;  1VSE A;  2RN2 A;  3C65 A;  5SZT A;  4B9S A;  3ZEU B;  3TAF A;  5AQG A;  4TSX A;  4IKF A;  3UKR A;  3T1Y K;  4DSL A;  2IAJ A;  4JK8 A;  5HBM A;  4DFM A;  3A8Y A;  5IT9 O;  3QBW A;  4BG9 A;  4FPA A;  3E01 A;  3R1X A;  4O5F A;  5D3G A;  3O9U A;  1NU0 A;  4JD2 B;  4IBN A;  3O3F A;  3DOL A;  1SKR A;  5AFU A;  1RBV A;  3OY9 A;  1NM1 A;  4WCE L;  4CJP A;  5A2Q O;  5JS2 A;  2YJF A;  1Q82 O;  1T44 A;  2F96 A;  5HRN A;  1J5O A;  3ZT2 A;  3HPG A;  4Y0W A;  5DM6 L;  1FKO A;  1MU2 A;  1HNW K;  4CVN E;  1VSJ A;  4JKA A;  4FLY A;  4J2B A;  5I3U A;  3NF9 A;  5CY4 A;  5AZI B;  4CD1 A;  4FJ9 A;  3QEX A;  3ZET B;  3DXM B;  4L3Q A;  2V7Y A;  4CJ7 A;  3AY9 A;  3WEE A;  2EWS A;  4O8K A;  2G8U A;  2Q97 A;  4JHD B;  1IH7 A;  4B1V A;  3NFA A;  1XMQ K;  1U45 A;  2O4I A;  1NK7 A;  4H4O A;  1R59 O;  5HP1 A;  5M1Q A;  2IIR A;  4N5S A;  4XEI A;  3LL3 A;  4FCY A;  5TKW A;  4Z4H A;  3VEX A;  1RTD A;  3NH2 A;  4JRQ A;  3A0I X;  1TUU A;  1TYQ A;  1UOC A;  4NLB A;  2X6S A;  1NJI O;  3F9M A;  4CES A;  3L4I A;  5HL7 L;  3SQ4 A;  4PUO A;  4PHT X;  4DFP A;  1BUP A;  2IVP A;  3LWM A;  4CBU A;  4BRL A;  4OLA A;  2OTJ N;  1VQ4 N;  1GLB G;  3QEW A;  2JGU A;  3Q7C A;  1R0A A;  2O8D B;  1S5J A;  4YOY A;  2Q3S A;  4DQS A;  3AA4 A;  4FJ8 A;  4FWO A;  3FR0 A;  4XH4 A;  4AHV A;  3C94 A;  1DKG D;  5IWA K;  1QVG M;  2HND A;  1GLF O;  2HHS A;  1RDW X;  4FLV A;  4H0Y B;  2D0O A;  2XY8 A;  3WXM B;  3MEE A;  3QML A;  4I7F A;  3VEZ A;  4UQG A;  3PX0 A;  2E5L K;  2A40 A;  3IAY A;  1BA0 A;  1BGX T;  3CIP A;  1GLD G;  2GBZ A;  3HL8 A;  3MN9 A;  3SPY A;  2YHW A;  2O8B A;  1KFS A;  3KK3 A;  1YIT N;  1HYV A;  1V4S A;  2X74 A;  4FO0 A;  4QCL A;  3CPE A;  2Z1J A;  5C2D A;  4BAC A;  1K9M O;  3KZB A;  1IG9 A;  4CBX A;  1L3V A;  2QTD A;  3THV A;  1HPZ A;  4MLE A;  1BIS A;  3LDO A;  4B9N A;  5FRM A;  4YNQ A;  3ATU A;  2HHU A;  1NG9 A;  2YHB A;  3LDP A;  4FPB A;  3IFR A;  4NXN K;  4FLT A;  4B9T A;  3CD6 N;  4A2A A;  3NVK A;  3OJS A;  1REV A;  2EHG A;  3HT3 A;  4ZHR A;  1NJY A;  4CW7 B;  4RW7 A;  3KLF A;  1IKV A;  3VF2 A;  4F3T A;  4H0X B;  3E66 A;  1K8A O;  4FM0 A;  4PY5 A;  3C7N B;  5BR8 K;  3QB0 A;  1T8E A;  2OPR A;  1WSI A;  4BRM A;  2PBD A;  5GIN A;  1BA1 A;  5C42 A;  1NKE A;  1LW0 A;  3NDK A;  2A3Z A;  4JLH A;  1ZBI A;  1L3U A;  4ICL A;  3R8E A;  5GAD P;  3KKS A;  4BR7 A;  1C1B A;  3VA0 A;  3NGI A;  3ZSV A;  1GLJ O;  4PQU A;  4F2S A;  1LCU A;  1H1V A;  2OPP A;  2GWK A;  1D8Y A;  1ZXO A;  2RHK A;  3P1G A;  2F7T A;  2I7P A;  3ZX0 A;  4JI8 K;  3QET A;  1T03 A;  4NCA A;  5BN9 A;  4AM7 A;  4B9Q A;  5HLF A;  5DK5 A;  4CE9 A;  1JKH A;  2WUS A;  5E41 A;  4KTQ A;  4CJ5 A;  3AVB A;  4LFA K;  1GOB A;  4B1U B;  3EZW A;  4C8N A;  3F73 A;  3OS0 A;  3DLH A;  4FK4 A;  2P9U A;  3O1W A;  2QWN A;  3VQ7 A;  1VQM N;  2A42 A;  4B9L A;  5J2N A;  2QWM A;  2P9K B;  1RT4 A;  3P5J A;  1W9H A;  1XHX A;  3CME N;  3SMS A;  3SQ1 A;  2YHA A;  2NRR A;  5HOO A;  1OH5 A;  4AHU A;  1S3X A;  1NGE A;  3BZK A;  2E4L A;  4ID5 A;  1SL1 A;  1BWF O;  1XWL A;  5LY3 A;  3G71 N;  3HVR A;  1HKB A;  2PFU A;  4CEA A;  4LF6 K;  4OPK A;  1TK0 A;  3VGL A;  3ULD A;  4JYA K;  1RT7 A;  1U2V A;  1Z05 A;  2DFE A;  1HLU A;  1QQN A;  3TR8 A;  3ZSY A;  3OYK A;  1XUP O;  3SV4 A;  2XY6 A;  1CXQ A;  3VGK A;  2HVH A;  3MCP A;  1NOY A;  1RTJ A;  4CER A;  4ISG A;  3MX5 A;  3SJH A;  3WQU A;  4CIG A;  5KRT A;  3L2W A;  1NK6 A;  2AA4 A;  2F9W A;  4CFA A;  4B08 A;  2ZWH A;  2Z1H A;  4ID1 A;  4KKO A;  4E89 A;  3ZX2 A;  2E1Y A;  4LSN A;  3THY B;  3CM5 A;  1N8R O;  2PY5 A;  4NCB A;  4DTO A;  1TKX A;  4CIE A;  3CF5 L;  4ISE A;  2P9I A;  4FZX C;  3F9K A;  3SLC A;  3CJB A;  2ZM6 K;  3O9Q A;  5T7B A;  1A5X A;  2BUP A;  4JV5 K;  5F2R A;  5M1O A;  3T19 A;  3AVF A;  3IS9 A;  3DLL L;  1NLV A;  2FF3 B;  3WXI A;  2FBY A;  3RRH A;  1T6C A;  2NRZ A;  1NGF A;  5EXW A;  4CFB A;  3F2K A;  5CZ1 A;  4BRD A;  4EAH D;  4JS5 A;  4BR2 A;  2DTU A;  4EHU A;  3I8B A;  4AH9 A;  3THW A;  4A57 A;  3EN9 A;  4CK3 A;  2QK9 A;  5FPM A;  3CCE N;  1NKB A;  1J9A A;  4OKJ A;  2I7N A;  1HQE A;  1S1W A;  2NNW A;  5JVG L;  2V51 B;  4KAZ A;  5CHI A;  4FVU A;  5KQD A;  2HHQ A;  2ITM A;  4YOU A;  3SV3 A;  3VEN A;  3HBT A;  1NGI A;  4FM2 A;  1LAW A;  1VRT A;  2Y1J A;  2VCP A;  1RCH A;  3PUF A;  3D2F A;  1C0F A;  2Z1G A;  3GBT A;  3ZT4 A;  3KLG A;  3LDN A;  3BP8 A;  2CH6 A;  3CCS N;  4FLZ A;  2I5J A;  1HPM A;  5AQT A;  4OPA A;  3U4L A;  3O6W A;  3VPZ A;  3H08 A;  4FJI A;  1FJG K;  3H1V X;  3G25 A;  3TAR A;  1QSL A;  4YY3 K;  3WXL A;  2QXF A;  3CCL N;  2P9S A;  4HWI A;  4DQQ A;  4MLH A;  1LWE A;  1BQM A;  2FLO A;  4LFB K;  3TAE A;  4BVO A;  4FW2 A;  4K8X A;  5F0X A;  4WQ5 A;  3TAP A;  1TUY A;  4CEO A;  4OVL A;  1Z25 A;  3HVT A;  1K8K B;  4B3M K;  3O9R A;  4FJ5 A;  4FJ7 A;  3KD5 E;  4CZK A;  1U47 A;  3FZK A;  3MWP A;  1ASW A;  4BRK A;  1N5Y A;  1JLQ A;  3T3F A;  2FBV A;  4BRO A;  3OYL A;  3O4W A;  5AQO A;  3V9W A;  3V1Q A;  3BDP A;  2ATQ A;  1JLB A;  2AP1 A;  1VQK N;  1TVR A;  2OZM A;  3UIQ A;  4QOZ B;  3MCA B;  4LFC K;  3RWU A;  5JLF A;  3RMB A;  4BE0 A;  2F8T A;  3PIO L;  1BCM A;  5GAE P;  2XO7 A;  3CPW M;  1XMO K;  1L3T A;  3B8A X;  2O4G A;  3LAK A;  2V7Z A;  3EL2 A;  3HYF A;  4YOX A;  1UA0 A;  3KHY A;  1QHT A;  2E6M A;  3ENO A;  2VWJ A;  3HPO A;  2HST A;  4H0O A;  3MDQ A;  2VYP A;  5C25 A;  3NCI A;  3M8P A;  3O9T A;  3L4Q A;  4FW1 A;  3NF6 A;  5AQH A;  1RGI A;  4C1N I;  1BCO A;  2O8F A;  1IJJ A;  4CJW A;  1WSE A;  4DR6 K;  1GOC A;  2QWO A;  2FSK A;  3HTV A;  4Z0U A;  4HUF A;  3U3Y A;  1EXQ A;  2ZJR L;  5AQJ A;  1C1A A;  2RF2 A;  4BRH A;  4FL9 A;  3CC2 N;  4OPH A;  5AQF A;  3EEQ A;  3O8M A;  3I8D A;  3DLG A;  1U04 A;  3DMJ A;  2QWQ A;  3MEG A;  4RW9 A;  2NRT A;  2FSJ A;  2F8S A;  5I42 A;  4Y1C A;  1KVC A;  2P9L B;  1T05 A;  1N6Q A;  3BF3 A;  3VF6 A;  1XC3 A;  3O9S A;  1VAZ A;  3W0L A;  1SV5 A;  2HBL A;  4JN4 A;  4W5N A;  3BF1 A;  2FF6 A;  2O8E B;  4CF9 A;  1BDG A;  1V4T A;  3WXJ A;  3A5N C;  3IRX A;  3CQ8 A;  4DR2 K;  1Y97 A;  2RKI A;  4JI5 K;  3G4S N;  4CHO A;  1YF5 L;  3K9J A;  4DR3 K;  1JCE A;  1T6D A;  2J4R A;  2ZQB A;  1O1W A;  4E0D A;  4I6M A;  4LC9 B;  1WB9 A;  3FZF A;  1G99 A;  1X9W A;  3EZ5 A;  4B8C A;  3DLE A;  3MX2 A;  4YDU A;  4YDU C;  4O0J A;  4BRI A;  3PX4 A;  2BTF A;  3ZT3 A;  2BH1 A;  4CZE A;  3AVN A;  4KHW A;  5M1P A;  1RBU A;  2A1R A;  1A5W A;  2WFB A;  4I2Q A;  3AA2 A;  4QS9 A;  3MAQ A;  2HMI A;  5K14 A;  1VQL N;  2GX9 A;  2IOC A;  4J2D A;  4CCH A;  4RTF D;  5ELZ A;  4OGE A;  3AO4 A;  1YAG A;  3DYA A;  1S1T A;  2OPS A;  4CGH A;  5FPD A;  2G8F A;  1HMV A;  2P51 A;  3C6T A;  4X65 K;  5M1N A;  2JWL A;  5BR9 A;  4OJR A;  3EE9 A;  4FWK A;  1C0T A;  4DKW A;  1VK0 A;  2RE2 A;  3SAF A;  4CGJ A;  4CZG A;  5BN8 A;  1BOT O;  3TTD A;  1KLN A;  3VA3 A;  4J2E A;  4CHY A;  1U6Z A;  3TSQ A;  3MK6 A;  3P39 A;  3EKS A;  5AFU H;  5AQP A;  3KK7 A;  2JLE A;  1QSY A;  3H3N O;  1BI4 B;  4JKH A;  3A2F A;  5TKY A;  1NJW A;  3SUN A;  1KRP A;  3CXC M;  1RT3 A;  3CCR N;  1NGJ A;  4CEQ A;  3WUH A;  5KTQ A;  4OPJ A;  2ZJP L;  3BUZ B;  1IBM K;  5AJ3 K;  3QDK A;  1RTH A;  3AAR A;  4IZ9 A;  3J7Z O;  2YI1 A;  2BE2 A;  3CMA N;  4DB3 A;  3TTF A;  1VQO N;  1JLE A;  3J8A A;  3OYB A;  2HNY A;  3ZT0 A;  2W40 A;  3LDQ A;  4KTZ A;  4WYB A;  3NH0 A;  1N32 K;  4RCH A;  4L8R B;  5JVH L;  3OYD A;  2QA4 N;  1TAU A;  3DXK B;  4YOV A;  5EX5 A;  3JAM O;  4F8R A;  3KKR A;  4HCC A;  3LPU A;  3NE6 A;  5J2Q A;  4BR5 A;  4FLX A;  1SKS A;  5EU7 A;  3L3U A;  2ZJQ L;  4JEP A;  3TAB A;  3S41 A;  3H1Q A;  3H6E A;  2P9P B;  4GKJ K;  1TL3 A;  1VRU A;  2HMP A;  2JWK A;  3O3H A;  5LMN K;  4N56 A;  5AZJ B;  1KCF A;  3V6D A;  2D0B A;  4LF8 K;  4DSJ A;  4G1Q A;  4FZY A;  2Z1I A;  3NF7 A;  3TSU A;  4CJV A;  1RT6 A;  3DJC A;  3PY8 A;  3HK2 A;  1SL2 A;  4WFN L;  2PAV A;  2A41 A;  2W42 A;  2CGL A;  4BRC A;  3JXU A;  3DAW A;  1IBL K;  3ULE B;  4Z4G A;  3QNN A;  1P8Z A;  1RBT A;  3AVI A;  3VQ6 A;  1VSF A;  3SJJ A;  4M45 A;  1LW2 A;  3U9D A;  2IGI A;  2G8W A;  4FYD A;  5KPR A;  1JJ2 M;  5KI6 A;  2ASO A;  3BGR A;  4KHY A;  3SAG A;  3M8R A;  4F4K A;  4QS7 A;  1TGO A;  1XI1 A;  1UAX A;  1NK9 A;  2VG5 A;  1VSH A;  5CYM A;  4E7I A;  3BZC A;  4FK0 A;  3G0Z A;  3L8B A;  1QHA A;  4B9M A;  1VQP N;  2OCE A;  4IJA A;  3C95 A;  2CGK A;  4RWT A;  4DV2 K;  1Q7Y O;  4KFB A;  2ZGY A;  4O4G A;  2P5G A;  2W41 A;  4Z94 A;  4FOE A;  2OZS A;  3ZSR A;  3UKR B;  3IMX A;  1SUQ A;  2QW9 A;  3VQA A;  1TKT A;  1YIJ N;  2UUA K;  1QQO A;  3JS6 A;  1NBW A;  4ZTF A;  3D7E O;  4GVE A;  1HNI A;  5BRF A;  1VHX A;  2P9N A;  3Q7B A;  4JK9 A;  2E20 A;  1RBR A;  3MN7 A;  3JSM A;  3E9O A;  3IDH A;  3VQ9 A;  3J7Y P;  2KKZ A;  5FRO A;  4CZL A;  3ASM A;  1EKE A;  4KV8 A;  5JLH A;  4MFB A;  1YTA A;  1JXE A;  5E26 A;  5HRS A;  3RSE A;  4BWJ A;  5ADX H;  1ZYQ A;  2ZE2 A;  1VSD A;  4CZI A;  4MDA A;  3CC7 N;  3D6R A;  1YJN N;  3GG4 A;  5ADX A;  5JS1 A;  4H5V A;  3D2E A;  5JIC A;  2UU9 K;  1W97 L;  5CZ2 A;  4DG1 A;  1QTM A;  2Q36 A;  4DQP A;  4AIL C;  4JKG B;  4O0I A;  2IVO A;  4B8A B;  3L0Q A;  1WSH A;  4GV9 A;  4Z4F A;  3ZSW A;  3SUQ A;  3WEE B;  1WNS A;  4JKF A;  3OA9 A;  3J80 O;  3QNO A;  1ATN A;  4OKK A;  1LAV A;  2WC9 A;  2OAN A;  4DQ8 A;  2YX6 A;  1W2B M;  1D5A A;  4HCB A;  4BRA A;  1S1X A;  2NLX A;  4HUG A;  1ZBF A;  5AQW A;  4BRQ A;  2NRW A;  3OYE A;  1VQ7 N;  4DTM A;  4CJU A;  1NJX A;  3EE8 A;  3HO1 A;  1Q81 O;  1TYQ B;  3K5O A;  3RTV A;  3AVH A;  4YOR A;  3OYH A;  2KTQ A;  1UWB A;  4M3U A;  3UB5 A;  3W3D A;  2HW3 A;  2GUP A;  3UKU A;  4AF1 A;  3SPZ A;  3K59 A;  2FSN A;  4CEC A;  4FWP A;  1YUW A;  3AAP A;  3C6H A;  3RMA A;  4M3Z A;  4UY8 O;  4F9O A;  3QEV A;  1MA9 B;  5AR0 A;  2D0P A;  1VSL A;  2QWR A;  2ASP A;  3TAQ A;  1NMN A;  4CFD A;  4O8U A;  4BRG A;  3KTQ A;  2YNH A;  4ZTJ A;  1WOQ A;  1I39 A;  3SQ2 A;  3O3G A;  2UXD K;  3SI6 A;  2O8B B;  4A62 A;  2KFN A;  5AQM A;  4H0P A;  1B92 A;  1YJW N;  4C8O A;  5FPE A;  4HUE A;  4OGC A;  3V9Z A;  2UUB K;  1Q9Y A;  3CCQ N;  1TKZ A;  1HKG A;  2GEM A;  4R79 A;  1JL1 A;  4BDP A;  1JLC A;  3G10 A;  3V9S A;  2YHY A;  3LZI A;  1HUX A;  3NBP A;  3NGZ A;  3AVM A;  4DHY A;  2Q0R A;  3KWG A;  1NGG A;  3C6U A;  4DTS A;  2D5R A;  4JI2 K;  3TPQ A;  3B6O A;  4DTP A;  3EYZ A;  4C8K A;  4MO5 A;  4DSK A;  2FC0 A;  4JI7 K;  2E2N A;  4HHT A;  2E88 A;  4CF0 A;  4DF4 A;  1S1U A;  3HJF A;  3MED A;  3MEC A;  4BQZ A;  4FJN A;  3CFP A;  2NRV A;  3TWH A;  4Q0B A;  3V4I A;  4JAX A;  1M90 O;  4KHQ A;  2HVI A;  3DLR A;  4BR9 A;  3VN5 A;  3HM9 A;  1S72 N;  4BWM A;  4KBO A;  4CI6 A;  1FKP A;  2HOE A;  4OO1 J;  4BRN A;  1ZBU A;  3VEY A;  3FFK B;  3SZ2 A;  1JCG A;  1C0U A;  3VQP A;  5JMV A;  1D4X A;  3OYI A;  2EX3 A;  3HOT A;  1CZA N;  1S1V A;  3CCU N;  5AQN A;  4CEZ A;  4KI6 A;  4RW4 A;  3PV8 A;  2QWL A;  3MXJ A;  1QVF M;  3PX6 A;  5BPM A;  4LD0 A;  3VQQ A;  3AGR A;  3R9P A;  3PO4 A;  3THX A;  3NGY A;  3TSP A;  4IEI A;  4HTL A;  3I55 N;  2XY7 A;  4PL7 A;  3LAL A;  3CFO A;  5I9E B;  4IOX A;  4F2R A;  3M8S A;  3U3G A;  4CHZ A;  3AVC A;  4NCG A;  4WQ4 A;  3AO3 A;  4IFV A;  4PKH A;  1XNR K;  2D0C A;  1IG8 A;  5C24 A;  1HRH A;  2ASM A;  3F5T A;  2Q31 A;  2V52 B;  3DLB A;  1ASU A;  1Z6R A;  3ATV A;  4JKD A;  4CEF A;  4GV3 A;  2AJQ A;  1HNZ K;  4EZ6 A;  4U67 L;  4BGA A;  2P9U B;  3M6G A;  4CZJ A;  5GAH P;  3OBY A;  3AVA A;  4JS4 A;  3K58 A;  1VSI A;  3CFR A;  1DEJ A;  4GW6 A;  1KAX A;  4KH6 A;  3VOV A;  1NNE A;  3LDL A;  2IS3 A;  3L2U A;  4BDY A;  4IO8 A;  3NH1 A;  3P31 A;  3NVM A;  3CJA A;  1LOT B;  4WQ5 C;  4CHP A;  2P1J A;  4I9Q A;  4KPY A;  1BQN A;  2O8C A;  4GY2 B;  4YOW A;  4Z4E A;  4JI3 K;  1LV5 A;  3SK3 A;  3EY1 A;  1HQU A;  2Q0U A;  2NUB A;  5DMR A;  1U2V B;  4BR0 A;  4IFE A;  4XH1 A;  4DSE A;  5H1S Q;  3KD1 E;  4CZM A;  3TI0 A;  4M63 C;  2GEL A;  5M1K A;  3KWI A;  4EP5 A;  4KH4 A;  1XHZ A;  4IFY A;  4K43 A;  4ILJ A;  1KSP A;  3K0S A;  2XY5 A;  2VWK A;  1RDD A;  3GL1 A;  2ZGZ A;  4CK1 A;  3QES A;  3OTO K;  3QLH A;  4C1N K;  4WFA L;  3VTI A;  1S9E A;  2DFH A;  2Q1N A;  3FZM A;  4M3X A;  4IG0 A;  1ZC6 A;  2A6A A;  3TAN A;  2P9I B;  5FRN A;  1NOZ A;  5F1X A;  4LH4 A;  1WAF A;  4J8F A;  2YKN A;  4DU4 A;  1EWR A;  3LAM A;  3L2Q A;  1KAZ A;  1BHL A;  1JXB A;  4FJK A;  4FZZ A;  1KTQ A;  4IG3 A;  4EIA A;  3ZEU A;  4BY9 C;  5EVZ A;  5LJW A;  1DLO A;  2NRX A;  5C0Y A;  3AVG A;  1EWQ A;  3QFU A;  4PKI A;  4E1N A;  3E9P A;  3V9U A;  3THW B;  3SBG A;  2PZS A;  3HSC A;  3VQD A;  3KLH A;  3I56 N;  3SQ0 A;  5C10 A;  2KFZ A;  5AQX A;  4HTU A;  3KLI A;  4DCH A;  4JD2 A;  4CF1 A;  3RMD A;  4CIF A;  1BG3 A;  5FDL A;  1WSF A;  4E1J A;  1J53 A;  3OYG A;  3AO5 A;  4M7X A;  2KLA A;  4X66 K;  3MXM A;  2OTL N;  2B4J A;  3L3V A;  4LSL A;  3BEX A;  4ILG B;  3I33 A;  3OYA A;  2G8H A;  3K5M A;  5HRR A;  3U9Z A;  2HF3 A;  4CJ3 A;  4B3T K;  3VET A;  4FJM A;  1DTQ A;  2DPN A;  3MXI A;  5EOY A;  3QEI A;  3VQE A;  3OYJ A;  5AZI A;  4V19 S;  4B1Z A;  4W5O A;  1BO5 O;  2P9S B;  3ZET A;  1S22 A;  5AQY A;  2YNI A;  3DXM A;  4B9U A;  3DRR A;  5FPN A;  4BRE A;  2Y1I A;  3PO5 A;  1MWM A;  5KQ8 A;  3M3Z A;  4JHD A;  3AV9 A;  3DXK A;  3LM9 A;  3VGM A;  4BE1 A;  4CGG A;  1OH8 A;  1C1C A;  1P90 A;  1SKW A;  3NF8 A;  2GV9 A;  5KPT A;  1B9D A;  1FXX A;  4CJE A;  1JL2 A;  4DS4 A;  1T7P A;  2FXU A;  4CGF A;  1ILY A;  3BY5 A;  4MDB A;  1GOA A;  5AQK A;  4Z4I A;  1VQ9 N;  1Y64 A;  5KGW A;  5LL6 Z;  3VES A;  4DFK A;  4ELV A;  2VQF K;  5LMU K;  4EFH A;  3VER A;  3R6M A;  2O8D A;  1ZBH A;  5AQR A;  3VQ4 A;  3U6F A;  1NGH A;  2WTU A;  4H5W A;  4O44 A;  1NGC A;  4CGD A;  1WUA A;  1C0G A;  1NJZ A;  4H4M A;  3L2R A;  4CJS A;  2HHX A;  1D9F A;  4NLC A;  3E1Y A;  1ATR A;  1CZB A;  1YTU A;  4DU1 A;  3SUP A;  2VG6 A;  4KB0 A;  1EO1 A;  2HBK A;  1NGD A;  4J2A A;  3O08 A;  3MMV A;  4EZ9 A;  1U49 A; 
#chains in the Genus database with same CATH homology
 2WOM A;  4CF8 A;  4DTJ A;  3S3O A;  2PY5 A;  3ALY A;  1RBR A;  3ISN C;  3JSM A;  4NCB A;  1WSJ A;  4DTO A;  3DOK A;  1TKX A;  1TL1 A;  3AA5 X;  3VQ9 A;  4CIE A;  2KW4 A;  4E19 A;  3V9X A;  1NK0 A;  4KRE A;  5FRO A;  3WNF A;  4FZX C;  3ASM A;  1EKE A;  4KV8 A;  3F9K A;  4C8L A;  4MFB A;  4EP4 A;  1YTA A;  4DQI A;  3DI6 A;  3T1A A;  4FVM A;  3LP0 A;  4E7L A;  1JXE A;  4FLW A;  1IO2 A;  1RNH A;  3QIO A;  3V81 A;  1Z26 A;  1TAQ A;  5HRS A;  5T7B A;  4KI4 A;  1A5X A;  1WN7 A;  4CJQ A;  1BIZ A;  4NYF A;  1TKD A;  1KLM A;  3KK2 A;  4BWJ A;  4WE1 A;  4CEB A;  4ELU A;  3T19 A;  4M3W A;  1ZYQ A;  3AVF A;  3IS9 A;  2ZE2 A;  4DLG A;  2D0A A;  2HHW A;  1VSD A;  4GMJ B;  2FBY A;  3SNN A;  4Y1D A;  1JLF A;  4N47 A;  3I0R A;  4MQ3 A;  1X9M A;  5JS1 A;  3RRH A;  3M8Q A;  3LPT A;  5CZ2 A;  1NK5 A;  4DG1 A;  4BE2 A;  3KLE A;  1QTM A;  5CYQ A;  4CFB A;  1BI4 A;  4AIL C;  3HXM A;  1L3S A;  4DQP A;  3LDS A;  2HHT A;  5CZ1 A;  4O0I A;  3VQB A;  4B8A B;  4JS5 A;  4OLB A;  2DTU A;  1WSH A;  4RW6 A;  4Z4C A;  3FFI A;  4DF8 A;  4AH9 A;  4GVM A;  1EP4 A;  3ZSW A;  4Z4F A;  1C6V A;  1W0H A;  3SUQ A;  1WNS A;  3D45 A;  3I0S A;  1ASV A;  3DRP A;  3QNO A;  3TAM A;  1VSK A;  4DTR A;  4OKK A;  1LAV A;  2FBT A;  3QIN A;  4CJF A;  4CK3 A;  4KO0 A;  2QK9 A;  1D5A A;  4CK2 A;  4HCB A;  1NKB A;  1J9A A;  1S1X A;  1NK4 A;  4OKJ A;  3AVJ A;  4HUG A;  4H8K A;  1HQE A;  1S1W A;  1ZBF A;  4KAZ A;  2HHQ A;  3OYE A;  4DTM A;  4CJU A;  5J1E A;  3SV3 A;  1NJX A;  1SL0 A;  1RT2 A;  3S9H A;  3RRG A;  3HO1 A;  4M41 A;  4W5Q A;  3AO2 A;  1LAW A;  4FM2 A;  4NYN A;  2IDO A;  1VRT A;  4RW8 A;  2Y1J A;  4FK2 A;  1RCH A;  3K5O A;  3RTV A;  3PUF A;  4ELT A;  3AVH A;  1TK8 A;  3OYH A;  2KTQ A;  1UWB A;  1HNV A;  3NHG A;  4M3U A;  1Q9X A;  2HW3 A;  4DMN A;  2Z1G A;  4M3R A;  4DTX A;  3DM2 A;  3WNG A;  3ZT4 A;  3KLG A;  2ZD1 A;  1X1P A;  4KRF A;  3SPZ A;  3K59 A;  1JLG A;  4FLZ A;  2DY4 A;  4CEC A;  2I5J A;  3LP2 A;  4CHN A;  3QEP A;  4DSI A;  3HP9 A;  2QKB A;  1NKC A;  3RMA A;  4IDK A;  4M3Z A;  3QEV A;  4XIU A;  3RR7 A;  1VSL A;  4AHR A;  3H08 A;  4DS5 A;  5SWM A;  4FJI A;  3TAR A;  3TAQ A;  4CGI A;  1QSL A;  1ITG A;  4QAG A;  4KHS A;  2QXF A;  4FLU A;  4CFD A;  2VG7 A;  2YKM A;  4DQQ A;  1U48 A;  3KTQ A;  1LWE A;  1BQM A;  2YNH A;  4ZTJ A;  3OVN A;  1I39 A;  4DFJ A;  3SQ2 A;  3TAE A;  4FW2 A;  2BAN A;  4K8X A;  1DTT A;  2E6L A;  3O3G A;  1HYZ A;  1WSG A;  1F21 A;  3V1R A;  3SI6 A;  3TAP A;  3WNE A;  3K2P A;  4CEO A;  2P5O A;  3AA3 A;  4OVL A;  1Z25 A;  3HVT A;  2KFN A;  1B92 A;  4C8O A;  4FJ5 A;  4FJ7 A;  3KK1 A;  3KD5 E;  1K6Y A;  1U47 A;  4HUE A;  4OGC A;  2DFF A;  4CEE A;  3V9Z A;  2HHV A;  3DLK A;  1RDB A;  4KTW A;  4KHN A;  3CG7 A;  1ASW A;  3OS2 A;  1N5Y A;  1Q9Y A;  1JLQ A;  1NK8 A;  3T3F A;  1TKZ A;  4CJK A;  3KIO A;  4CHQ A;  2X78 A;  3K5L A;  1RBS A;  2FBV A;  5KRS A;  1JL1 A;  3HST B;  4F3O A;  4E3S A;  3L2V A;  1XC9 A;  4BDP A;  1JLC A;  3G10 A;  3OJU A;  3V9S A;  4BDZ A;  1S6P A;  4R5P A;  3OYL A;  3LZI A;  3NBP A;  1CXU A;  4DWI A;  2OYQ A;  3NGZ A;  1LWC A;  4I9L A;  2GUI A;  3AVM A;  3ZSZ A;  3V9W A;  5HRO A;  3V1Q A;  2RPI A;  3C6U A;  2ATQ A;  2D5R A;  4DTS A;  1JLB A;  3RMC A;  3BDP A;  1TVR A;  3D0P A;  3B6O A;  4DTP A;  3SUO A;  2OZM A;  4K8Z A;  3EYZ A;  4C8K A;  1BIU A;  1VSE A;  2RN2 A;  5SZT A;  4DSK A;  3UIQ A;  2FC0 A;  4QOZ B;  4B9S A;  1YVU A;  4C8M A;  4HHT A;  4CF0 A;  4DF4 A;  1S1U A;  3RWU A;  3HJF A;  3MED A;  4BE0 A;  3RMB A;  2G8V A;  2F8T A;  2KZM A;  3TAF A;  3MEC A;  3RR8 A;  4CED A;  2LSN A;  4O55 A;  3CFP A;  1BCM A;  4FJN A;  3TWH A;  4TSX A;  2XO7 A;  4Q0B A;  3V4I A;  1L3T A;  4N41 A;  4KHQ A;  4IKF A;  2O4G A;  2HVI A;  3VQ8 A;  3LAK A;  4DSL A;  3DLR A;  2IAJ A;  5HBM A;  4FJL A;  4DFM A;  3VN5 A;  3HYF A;  2XRI A;  3HM9 A;  1UA0 A;  4YFU A;  4BWM A;  1QHT A;  2E6M A;  2VWJ A;  3LP3 A;  4FJJ A;  3HPO A;  4DTN A;  1IKX A;  2X6N A;  5C25 A;  3E01 A;  1FKP A;  3NCI A;  3M8P A;  1BL3 A;  5D3G A;  4FW1 A;  5J2P A;  3NF6 A;  4IBN A;  1BCO A;  1ZBU A;  3O3F A;  3SZ2 A;  3DOL A;  4CJW A;  1WSE A;  1SKR A;  1C0U A;  3VQP A;  1RBV A;  1GOC A;  1QQC A;  3OY9 A;  3OYI A;  4CJT A;  2EX3 A;  4M3T A;  1S1V A;  3B6P A;  3S3M A;  4CJP A;  2ETJ A;  5JS2 A;  4CEZ A;  4KI6 A;  4RW4 A;  3PV8 A;  4Z0U A;  3MXJ A;  4HUF A;  2F96 A;  5HRN A;  1EXQ A;  4LD0 A;  3OYM A;  3U3Y A;  3PX6 A;  3O4N A;  3S3N A;  1J5O A;  3VQQ A;  1QSS A;  3ZT2 A;  3PO4 A;  1C1A A;  3NGY A;  1WLJ A;  3HPG A;  2RF2 A;  4CJ4 A;  4E7H A;  2XY7 A;  4W5R A;  1FKO A;  1MU2 A;  3LAL A;  2R7Y A;  3CFO A;  3OYF A;  1VSJ A;  3I8D A;  1LWF A;  3DLG A;  4FLY A;  1D9D A;  5I3U A;  1U04 A;  4F2R A;  4J2B A;  4RG8 A;  3DMJ A;  3NF9 A;  5CY4 A;  4CF2 A;  3M8S A;  4FJH A;  3U3G A;  4FJ9 A;  3QEX A;  4DTU A;  3MEG A;  4RW9 A;  3IG1 A;  4CHZ A;  2F8S A;  5I42 A;  4Y1C A;  3AVC A;  1KVC A;  4NCG A;  3AO3 A;  4IFV A;  1T05 A;  1N6Q A;  3AVK A;  2G8U A;  2D0C A;  4JRP A;  5C24 A;  1HRH A;  4M3Y A;  1G15 A;  1IH7 A;  1RIL A;  1SV5 A;  1ASU A;  3DLB A;  3NFA A;  4CEF A;  1U45 A;  2O4I A;  4W5N A;  1NK7 A;  2AJQ A;  4EZ6 A;  4H4O A;  4CF9 A;  5HP1 A;  1S9G A;  2B5J A;  4N5S A;  4E1M A;  4FCY A;  2KZZ A;  3AVA A;  3ZSO A;  4JS4 A;  4Z4H A;  1RTD A;  3NH2 A;  3K58 A;  4JRQ A;  3IRX A;  1CZ9 A;  1UOC A;  1VSI A;  1Y97 A;  3CFR A;  3CQ8 A;  1ZBL A;  2X6S A;  4GW6 A;  2RKI A;  4PA1 A;  1RDC A;  4CES A;  4CHO A;  2WON A;  2IS3 A;  3L2U A;  4BDY A;  3SQ4 A;  4PUO A;  3QIP A;  2ZQB A;  3AO1 A;  4DFP A;  3NH1 A;  1O1W A;  4I2P A;  1RT5 A;  3LWM A;  2G8I A;  4LH5 A;  4E0D A;  2ITG A;  4OLA A;  3AVL A;  3QEW A;  4CHP A;  1QE1 A;  2P1J A;  2JGU A;  3QER A;  4I9Q A;  4KPY A;  1R0A A;  4DQR A;  1BQN A;  4Q5V A;  3SCX A;  1X9W A;  3EZ5 A;  1S5J A;  4B8C A;  2HB5 A;  1C0M A;  2PYL A;  3DLE A;  4Z4E A;  2Q3S A;  4DQS A;  4B3O A;  3AA4 A;  4O0J A;  3EY1 A;  3PX4 A;  1HQU A;  1LV5 A;  3OS1 A;  4AHV A;  4FJ8 A;  3C94 A;  3ZT3 A;  2NUB A;  5DMR A;  1IKW A;  3KD1 E;  3AVN A;  2KQ2 A;  4DSE A;  4KHW A;  3WNH A;  3TI0 A;  2HND A;  2HHS A;  1RBU A;  4DLE A;  4FLV A;  4EP5 A;  2A1R A;  1A5W A;  2QKK A;  4I2Q A;  2IC3 A;  2XY8 A;  3VQC A;  3AA2 A;  3MEE A;  4UQG A;  4I7F A;  3MAQ A;  3PX0 A;  3LAN A;  4IFY A;  1XHZ A;  2HMI A;  3IAY A;  1BGX T;  5K14 A;  2IOC A;  1VSM A;  2GBZ A;  3HL8 A;  3P83 D;  4J2D A;  1KSP A;  3SPY A;  3DRS A;  2G8K A;  4CCH A;  1L5U A;  2XY5 A;  2VWK A;  3ITH A;  4OGE A;  3LP1 A;  1KFD A;  3AO4 A;  1RDD A;  3KK3 A;  3DYA A;  1S1T A;  1KFS A;  4CK1 A;  3QES A;  1HYV A;  3QLH A;  2X74 A;  2OPS A;  4CGH A;  2G8F A;  4QCL A;  1HMV A;  2P51 A;  1S9E A;  2DFH A;  2Z1J A;  3C6T A;  4M3X A;  3K5N A;  3CM6 A;  4IG0 A;  4BAC A;  4OJR A;  1IG9 A;  2YV0 X;  2BDP A;  2BGG A;  1C0T A;  1L3V A;  1VK0 A;  3LWL A;  3TAN A;  3THV A;  1RT1 A;  3ZT1 A;  5FRN A;  1HPZ A;  1NOZ A;  3QO9 A;  1BIS A;  1A5V A;  4LH4 A;  4B9N A;  4CGJ A;  5FRM A;  1WAF A;  4YNQ A;  1KLN A;  2YKN A;  4DU4 A;  3VA3 A;  4J2E A;  4CHY A;  2HHU A;  3LAM A;  3L2Q A;  1RDA A;  2YHB A;  1BHL A;  1JXB A;  1TV6 A;  4FLT A;  4B9T A;  4FJK A;  4FZZ A;  1KTQ A;  3OJS A;  4IG3 A;  4KHU A;  1REV A;  1Q8I A;  4AHS A;  2EHG A;  3HT3 A;  4ZHR A;  1NJY A;  2JLE A;  1DLO A;  1QSY A;  1BI4 B;  3AVG A;  4RW7 A;  2A1S A;  3KLF A;  1IKV A;  4F3T A;  1HYS A;  3HP6 A;  3A2F A;  1NJW A;  4E1N A;  3SUN A;  4N76 A;  1KRP A;  3V9U A;  4FM0 A;  4CFC A;  2PZS A;  1RT3 A;  4PY5 A;  3V1O A;  4CJR A;  3VQD A;  4CEQ A;  3KLH A;  5KTQ A;  3SQ0 A;  1KVA A;  4AHC A;  4OPJ A;  2KFZ A;  1NK9 A;  1T8E A;  4HTU A;  2OPR A;  1WSI A;  1S6Q A;  3KLI A;  1B9F A;  1RTH A;  5J2M A;  4CF1 A;  3RMD A;  4CIF A;  5C42 A;  2BE2 A;  1NKE A;  3VQ5 A;  5FDL A;  3JYT A;  1LW0 A;  1WAJ A;  1WSF A;  1JLE A;  1J53 A;  3NDK A;  3OYG A;  2YNF A;  3AO5 A;  1KVB A;  2HNY A;  3OYB A;  4JLH A;  4OKE A;  3ZT0 A;  1ZBI A;  1X9S A;  4KTZ A;  1L3U A;  3MXM A;  3NH0 A;  1IKY A;  2B4J A;  4ICL A;  3L3V A;  4M42 A;  4LSL A;  4L8R B;  4FJX A;  3KKS A;  3OYD A;  1C1B A;  1EET A;  3NGI A;  3VA0 A;  2G8H A;  3OYA A;  3ZSV A;  1TAU A;  1HJR A;  3K5M A;  5HRR A;  2YNG A;  4PQU A;  4F2S A;  4FM1 A;  3HPH A;  4CJ3 A;  4F8R A;  3KKR A;  2OPP A;  4E7J A;  4HCC A;  3LPU A;  3NE6 A;  4FJM A;  1I3A A;  5J2Q A;  1DTQ A;  1D8Y A;  4B9V A;  4FLX A;  3MXI A;  1SKS A;  3P1G A;  5EU7 A;  3OYN A;  2FBX A;  4LY7 A;  2OA8 A;  3L3U A;  4DSF A;  3QEI A;  3QET A;  1T03 A;  4NCA A;  3VQE A;  2HNZ A;  2PYJ A;  3OYJ A;  3O4Q A;  5HRP A;  3TAB A;  3ZSX A;  4W5O A;  4FJG A;  5HLF A;  2YNI A;  5DK5 A;  4CE9 A;  1JKH A;  5E41 A;  3TAG A;  4B9U A;  1TL3 A;  1VRU A;  3DRR A;  4KTQ A;  2Y1I A;  3CYM A;  4CJ5 A;  3O3H A;  3PO5 A;  3LZJ A;  3AVB A;  2B6A A;  4N56 A;  2OPQ A;  1GOB A;  3AV9 A;  4FXD A;  1KCF A;  3V6D A;  2D0B A;  4DSJ A;  3KJV A;  1EX4 A;  1FK9 A;  2Z1I A;  3NF7 A;  4G1Q A;  4C8N A;  4CGG A;  4CJV A;  4BE1 A;  4FZY A;  3F73 A;  1C1C A;  1RT6 A;  3OS0 A;  1SKW A;  3DLH A;  1RTI A;  3NF8 A;  2GV9 A;  3PY8 A;  4FK4 A;  3HK2 A;  1SL2 A;  3VQ7 A;  2W42 A;  4B9L A;  1B9D A;  1FXX A;  4CJE A;  1JL2 A;  4DS4 A;  5J2N A;  1T7P A;  4HVJ A;  4Z4G A;  4CGF A;  3QNN A;  1RT4 A;  1YT3 A;  3P5J A;  1RBT A;  1W9H A;  1XHX A;  1GOA A;  1JLA A;  4Z4I A;  3AVI A;  3VQ6 A;  4E7K A;  1VSF A;  3SQ1 A;  2YHA A;  3SJJ A;  5KGW A;  4M45 A;  1LW2 A;  4AHU A;  2IGI A;  2G8W A;  4FYD A;  5KI6 A;  3BGR A;  4KHY A;  4DFK A;  3M8R A;  4ELV A;  4CJL A;  3ZSQ A;  2E4L A;  4O5B A;  3ZCM A;  4ID5 A;  3OYC A;  3NAE A;  4F4K A;  1TGO A;  1XI1 A;  1UAX A;  4AHT A;  2VG5 A;  1XWL A;  1VSH A;  1SL1 A;  5CYM A;  3VQ4 A;  3HVR A;  4CEA A;  1ZBH A;  4E7I A;  4OPK A;  1TK0 A;  3U6F A;  4FK0 A;  3G0Z A;  3L8B A;  3SYZ A;  3ULD A;  1CLQ A;  4O44 A;  1UA1 A;  4CGD A;  1RT7 A;  4B9M A;  3K57 A;  1NJZ A;  4H4M A;  2DFE A;  3C95 A;  3L2R A;  3TR8 A;  3ZSY A;  3OYK A;  4DU3 A;  1U4B A;  4KFB A;  4CJS A;  1QS4 A;  3SV4 A;  2XY6 A;  1D9F A;  2HHX A;  4O4G A;  1CXQ A;  1TK5 A;  2P5G A;  2OZS A;  5KGX A;  3ZSR A;  2HVH A;  4W5T A;  1NOY A;  1SUQ A;  3VQA A;  1RTJ A;  4KB1 A;  4PWD A;  1TKT A;  4CER A;  1CZB A;  1YTU A;  4DU1 A;  4CIG A;  3SUP A;  2VG6 A;  5KRT A;  4KB0 A;  4J2A A;  3L2W A;  1NK6 A;  4ZTF A;  1U49 A;  4CFA A;  4B08 A;  1HNI A;  2XHB A;  1J54 A;  2Z1H A;  4ID1 A;  4KKO A;  4E89 A;  4EZ9 A;  4LSN A;  3CM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...