2G8UA

B. halodurans rnase h catalytic domain d132n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8uA00
2QXFA 4RW6A 3HPOA 3I0SA 1Z25A 4HUFA 4CGFA 3U3YA 4DU4A 2W42A 3JYTA 1HPZA 1S1WA 3M8PA 3RTVA 3KJVA 4BDYA 1SKWA 2DTUA 4PQUA 1JXEA 3T19A 1LWCA 1CZBA 3IRXA 5DK5A 3ZT2A 3TABA 2JGUA 3HM9A 1ITGA 1Q8IA 3HVRA 3EY1A 4C8KA 4FK0A 4DMNA 4CJ3A 1RT2A 2X6SA 5KI6A 3MECA 4CJFA 4CJSA 1K6YA 1KSPA 3L2RA 4Z4GA 3VQ6A 1R0AA 1JLCA 2OZMA 4F3TA 1B92A 2QKKA 4BWMA 3OYIA 2IC3A 3AVNA 2HW3A 2PYLA 1ZBHA 4JS5A 4OJRA 1RTDA 1JL1A 5SWMA 1BL3A 1JLAA 1T03A 2VG6A 1T05A 4PY5A 3KK2A 3TR8A 2YNFA 1HJRA 3SV3A 1VK0A 3HP9A 4CESA 3VQDA 3K5NA 4JRPA 4BDPA 1C1BA 1KFDA 1WSHA 4CJ5A 1Y97A 3L2VA 4FLYA 4FJKA 1C0TA 1S6QA 1UA1A 4Z4FA 4RW8A 3K57A 3TARA 4HCBA 3DLGA 4FJLA 2X6NA 2QK9A 1WNSA 4CJKA 3KLGA 4CJUA 2FBYA 4OKEA 3AVJA 3CM6A 1L3SA 3KD5E 1FXXA 4DQSA 1EETA 3LWMA 1IKXA 2XY5A 4B9MA 3AVIA 3DLBA 3DOKA 3AVFA 4NYFA 5EU7A 1YT3A 3ZSXA 4CFAA 5HRPA 3BDPA 3L2QA 2G8IA 4CHPA 2YKNA 1U45A 1KRPA 1S1TA 5C24A 4KHQA 1WSFA 4BWJA 1VRTA 4IFYA 3ZSOA 1X9WA 5KGXA 4KPYA 4CJRA 4DF8A 2JLEA 4CGDA 4CFCA 3VQBA 4YNQA 4FW2A 4N41A 4CHNA 3SPYA 2QKBA 3P1GA 1G15A 4O5BA 1C0MA 5HBMA 1C0UA 3WNHA 4CEOA 3OYFA 3EYZA 2G8HA 4FJNA 3SQ2A 1UOCA 2BANA 3V81A 1U47A 3MEEA 2KW4A 3C6UA 5CZ1A 4DU3A 3S9HA 4AHUA 4OKKA 3OYCA 4M3UA 4DQPA 4DFPA 3AVAA 1FKPA 1KVCA 3O4QA 4TSXA 3OYKA 1I39A 1WSGA 2IDOA 3ITHA 3KKRA 3NH1A 3O3FA 1J53A 4NCBA 1RT5A 3QO9A 2VG5A 3DM2A 3CG7A 3ZSYA 1I3AA 4CEBA 4DTRA 1NJYA 4B9UA 4RW7A 4QAGA 4FCYA 4CJEA 1SV5A 4Z0UA 3NH2A 1SL2A 3T1AA 1QSYA 4CEDA 3I8DA 1TGOA 3LAMA 1RBSA 3LZJA 5I42A 4B9SA 1IKWA 2NUBA 3SI6A 3RR8A 4FK2A 4FZXC 3C94A 1YTUA 5C25A 2KFZA 3OY9A 2RKIA 2VG7A 3OYAA 4W5NA 1W0HA 3ZT1A 3SUQA 4BDZA 4CJQA 4FJ8A 5SZTA 5C42A 4FLUA 4C8LA 4KI6A 1EX4A 1QS4A 5CZ2A 3S3NA 4IBNA 4EZ6A 1JKHA 4ID5A 4DS5A 4DWIA 4CEFA 1IKYA 3KD1E 1GOCA 4CF2A 4E1MA 3V4IA 1U49A 1LAVA 1S9GA 2ETJA 3NF9A 4W5TA 4DSJA 4J2EA 2OZSA 1RBRA 2F8TA 1RTHA 3TI0A 3THVA 3ZT4A 4E7HA 4CE9A 4B8AB 5KGWA 3BGRA 3PX6A 1TKDA 2PYJA 2HVIA 1L3TA 3WNGA 4LD0A 1UAXA 1RNHA 1D9FA 4I2PA 2PZSA 4FXDA 2GV9A 3LP1A 3MEDA 1XI1A 3QEPA 3LPUA 4Z4CA 2A1SA 1HQEA 3CYMA 1X9SA 1WLJA 2DFEA 3ASMA 3LZIA 4CJLA 3ZSRA 3MAQA 1TAQA 4CHZA 3V9ZA 3ULDA 1BCOA 1LAWA 4HHTA 2KFNA 4B9VA 3WNEA 4FM0A 3DI6A 2G8WA 3K2PA 3RMBA 2BGGA 3CM5A 1HNIA 3K5MA 1S1UA 3PY8A 1C1AA 4CK2A 4DS4A 1EXQA 1TAUA 4FJ9A 3TAFA 3PV8A 4KHYA 1BCMA 3KIOA 5K14A 4CEZA 4AILC 2Y1IA 1KFSA 4EP5A 3O3GA 1BIZA 3DLHA 3RMCA 3VQEA 1QTMA 4E0DA 3V1OA 3VQ4A 3AVGA 4CIFA 3OYMA 3KK3A 2XRIA 4KHUA 4Y1CA 1LW2A 4M3TA 1TK8A 1KCFA 3SV4A 4CIGA 1RDBA 3VQCA 4KTZA 4CK3A 5J2NA 4AHVA 1CLQA 4W5OA 1TKTA 1CXQA 1KTQA 2F96A 3WNFA 3ZT3A 1IO2A 3SNNA 2G8VA 3TWHA 4NCAA 3E01A 1O1WA 2ZD1A 3NH0A 4EZ9A 3DOLA 3D45A 3G0ZA 5KTQA 1GOAA 2FBTA 2HVHA 4CGIA 4KHWA 4RW9A 3A2FA 3HXMA 1CZ9A 3NBPA 5CYMA 3M8RA 2Z1JA 1BQNA 1ZBFA 1HYVA 3ISNC 4E19A 3OYNA 3B6OA 3SUNA 1L3UA 1IKVA 4O44A 4CK1A 2P5OA 3C95A 4PWDA 2WOMA 2ZQBA 3IS9A 1ASUA 1BI4B 2XO7A 1B9DA 3H08A 1NJWA 1NKCA 2HNYA 4E89A 1L3VA 2FBVA 2RF2A 3SJJA 4E7KA 1KLNA 3LP3A 4K8ZA 3L3VA 2PY5A 3OS0A 3TAMA 4HUEA 4DU1A 3NCIA 3MXIA 3IAYA 4F3OA 4CF1A 1NK8A 3VQAA 3CFOA 4W5QA 4CF0A 4DSLA 1ASWA 3QIPA 4CJPA 1QE1A 1RT3A 1VSDA 4DQIA 1JLBA 3DLEA 3HT3A 4OLBA 4B08A 4YFUA 4CIEA 4MQ3A 3VA3A 2VWJA 2OPPA 4GW6A 1N6QA 1J54A 4KTWA 1N5YA 4ID1A 4QOZB 1VSKA 1T7PA 1NOZA 2ITGA 1JLFA 4CCHA 3OS1A 4B9LA 4I9LA 1NKEA 3VQ9A 3RMDA 2FC0A 3S3OA 4OKJA 1RBVA 3TAEA 4CECA 4ZTJA 1JLGA 3MEGA 1WAFA 5JS2A 1U48A 4PA1A 1TVRA 2IOCA 3UIQA 1RT6A 1NK9A 3DRPA 4LH5A 4OPJA 4FJXA 2B5JA 1BISA 1Z26A 3PUFA 1TV6A 4CF9A 2YHAA 3OYDA 3OJUA 3KK1A 4IFVA 1EP4A 1JLEA 4OGEA 4CGJA 3KLHA 1C6VA 4GVMA 3ZSQA 2ATQA 2R7YA 4KAZA 1S1XA 4FW1A 4FZZA 3SUPA 3LWLA 4FM2A 4FLVA 2P51A 3NF7A 2HNDA 3K5OA 3QINA 4N56A 1SL1A 4IG3A 2KTQA 3AA2A 4ZTFA 2VWKA 3PX4A 1F21A 3NGYA 1HYZA 1TKZA 4B8CA 1RT1A 4J2BA 2GUIA 3L8BA 5I3UA 3LAKA 3DLRA 2XY6A 5JS1A 2DFFA 3AVBA 1T8EA 1BI4A 2RN2A 4O4GA 1A5VA 1KVAA 2O4GA 2OPRA 4FLTA 2OPQA 1VSMA 3VQQA 3DLKA 1HMVA 4DFMA 3TAQA 1D5AA 1WSJA 5J1EA 5T7BA 4M42A 2YV0X 3VN5A 4KFBA 3ZSWA 3V9UA 1Q9YA 3QNOA 1S9EA 4F2SA 2XHBA 4DTMA 4Z4EA 3AVKA 3TAPA 2IS3A 2DY4A 2P1JA 1Q9XA 4FM1A 1RCHA 2X74A 3ZT0A 1J5OA 3G10A 4LH4A 1JL2A 2O4IA 3AVHA 2YHBA 3F9KA 2Q3SA 2X78A 2E6LA 4KTQA 1RBUA 2LSNA 1XHZA 1WAJA 2B6AA 3NDKA 3F73A 3V9SA 1NJZA 3PO4A 4FJJA 5KRTA 4FJHA 2KZZA 4CF8A 1LW0A 1YTAA 4C8NA 3P5JA 4DSEA 1JXBA 2D0AA 4DSIA 4Y1DA 4AH9A 1VRUA 2A1RA 4NCGA 4CGGA 1A5WA 1U04A 4LY7A 4O0IA 4FLXA 1X9MA 4OLAA 1QQCA 3AA5X 1TL1A 3VQ8A 4OPKA 1B9FA 3U3GA 4ELUA 2FBXA 2G8UA 4LSNA 3LPTA 1ZBLA 4E7LA 4FK4A 2YKMA 5FDLA 4DFJA 1ASVA 4Z4HA 4FLZA 5FRNA 4J2DA 1RT4A 5E41A 1SUQA 1RT7A 4J2AA 1LWEA 4FJGA 3NAEA 4KHSA 3NGIA 5CYQA 1QSSA 3NF8A 2YNGA 4CGHA 2IGIA 4DTJA 5DMRA 4JRQA 4KV8A 4CFBA 4CJTA 4Q5VA 3OYHA 3DRRA 3HVTA 4HCCA 3NF6A 3CFPA 2E4LA 4OGCA 4I7FA 3D0PA 4DTUA 4KREA 1NK4A 2Y1JA 1FKOA 3AV9A 3MXJA 4AHRA 3TANA 1D8YA 4C8MA 3VQ7A 3QESA 2KZMA 3HPHA 4OVLA 4Q0BA 3EZ5A 1NK6A 2D0BA 3HJFA 3O3HA 1U4BA 4KI4A 2HHTA 4FZYA 4DLGA 3QNNA 1VSIA 2HHVA 1S5JA 4W5RA 4B3OA 4M3ZA 1REVA 3K59A 4CJVA 1WSIA 1UA0A 2HNZA 3QEVA 4CERA 3NGZA 3AVCA 4UQGA 3OYGA 4FVMA 4KB1A 4DTXA 2XY8A 3S3MA 3RWUA 2HHXA 3CFRA 4DQRA 2HHWA 4DFKA 3ALYA 4KO0A 2Z1GA 4I2QA 5CY4A 3FFIA 4B9NA 3SQ4A 4E7IA 1SKSA 1TK5A 4DTNA 4RG8A 3OYLA 3SYZA 2G8FA 4M3YA 3CQ8A 4C8OA 4DSFA 4RW4A 3SPZA 3IG1A 3SZ2A 4R5PA 1J9AA 1W9HA 2D5RA 3KKSA 4JLHA 3RRHA 2OYQA 1UWBA 2GBZA 3OS2A 4CJ4A 1RDCA 3ZCMA 4AHSA 3AVLA 3OYJA 4HUGA 3SQ0A 1SKRA 4KHNA 1VSJA 2OPSA 4H4OA 5FRMA 1BQMA 2WONA 3QERA 1S1VA 3VA0A 4K8XA 3HSTB 4KKOA 4JS4A 4QCLA 3QETA 4BE1A 2DFHA 3QEXA 3NFAA 2BE2A 4DF4A 4FLWA 2I5JA 3M8QA 4ZHRA 4CHYA 1RDAA 3M8SA 3V9XA 1LV5A 3AO1A 1GOBA 3LALA 2Z1IA 3C6TA 4E3SA 3SUOA 3SCXA 1QHTA 1ZBUA 3VQ5A 1TKXA 5J2QA 3RRGA 1JLQA 1VSFA 1SL0A 1MU2A 2E6MA 1DLOA 3QIOA 3K58A 3MXMA 4FJMA 3V1QA 1NK5A 4ELTA 3I0RA 3AO2A 5HLFA 4DTPA 4G1QA 4NYNA 1L5UA 2KQ2A 4FJ7A 3QEIA 2ZE2A 4CEAA 1ZBIA 3LANA 1D9DA 1BHLA 1XWLA 4N76A 2HB5A 1S6PA 4CEEA 4CFDA 3PX0A 3RMAA 2HHUA 3OJSA 1VSHA 2EHGA 3VQPA 3V1RA 3KLIA 1NOYA 4GMJB 3LP2A 3ZSVA 4PUOA 4H8KA 1KLMA 4HVJA 5J2PA 4DTOA 4CHOA 3HL8A 3QEWA 4ELVA 4FYDA 3DYAA 2HHQA 4CHQA 3L2UA 4E1NA 4ICLA 3AA3A 1RTIA 3KLFA 3B6PA 4O55A 1RTJA 4N5SA 2BDPA 4EP4A 2G8KA 4M45A 4BE0A 1TK0A 1RILA 4M3RA 4B9TA 1C1CA 4MFBA 3KLEA 2IAJA 4IDKA 3RR7A 4KRFA 5KRSA 1A5XA 2D0CA 1VSLA 1ZYQA 3OYBA 3V9WA 2RPIA 1HNVA 5HROA 2HMIA 4FJ5A 4M41A 4F2RA 4DSKA 4Z4IA 5HRNA 5HP1A 4F8RA 1WN7A 3QLHA 4LSLA 4DQQA 1IG9A 5FROA 5HRSA 1NKBA 4FJIA 3KTQA 5J2MA 3LDSA 4BE2A 1IH7A 5D3GA 3DRSA 4E7JA 4O0JA 3NE6A 1EKEA 1KVBA 1VSEA 4CEQA 1NK7A 4KB0A 4HTUA 3OYEA 4CJWA 1LWFA 4DTSA 4M3WA 3V6DA 2YNIA 1NJXA 2YNHA 4L8RB 2F8SA 3K5LA 3PO5A 1FK9A 2EX3A 3L2WA 1BGXT 3U6FA 3AVMA 3ZSZA 3AO5A 4WE1A 4BACA 4IKFA 3HP6A 1WSEA 3AO4A 1DTTA 3LP0A 3T3FA 1RDDA 2P5GA 2B4JA 3AA4A 1HQUA 1RBTA 3HPGA 1HRHA 3AO3A 4DLEA 1XC9A 4I9QA 4IG0A 1QSLA 1HYSA 3TAGA 1DTQA 4DG1A 4N47A 2XY7A 2OA8A 1NK0A 3OVNA 3HK2A 1BIUA 3P83D 3JSMA 2HHSA 3O4NA 3L3UA 5HRRA 1X1PA 1XHXA 4AHTA 3DMJA 3NHGA 3SQ1A 3HYFA 4F4KA 2AJQA 1CXUA 2Z1HA 4AHCA 4XIUA 3HO1A 1YVUA 4M3XA 1TL3A 4H4MA
chains in the Genus database with same CATH superfamily
4RW6A 2YHYA 4DU4A 3RTVA 1S1WA 4M7YA 1OKJA 3HZ6A 1JXEA 4BR7A 3VEVA 3HM9A 3HVRA 1QQMA 3WEEB 4FK0A 3EKSA 5KI6A 5AQMA 4Z4GA 3R1XA 3AGRA 3SBGA 4F3TA 3OYIA 3AVNA 1ZBHA 4JS5A 1RTDA 1T03A 1JLAA 3FZKA 3SMSA 1OH8A 2ZJPL 3DAWA 2YNFA 4JRPA 1C1BA 4CJ5A 1Y97A 1GLJO 1KQSM 3G25A 4J8FA 1UA1A 2E1YA 4RW8A 4Z4FA 3DLGA 2X6NA 2QK9A 3C7NB 3CI5A 2WBNA 3MCAB 5BR9A 4JAXA 3CM6A 3KD5E 4BRAA 3LWMA 1IKXA 1SQKA 3I56N 1GLEG 3DOKA 3AVFA 4FOEA 4CFAA 1YAGA 4CHPA 4LF5K 1GLBG 4DV4K 4BWJA 4A5AA 4LF4K 4IFYA 3ZSOA 1RDWX 4YOXA 2HBMA 4DF8A 1N36K 1Q86O 4N41A 3SPYA 1G15A 5HBMA 2G8HA 4H5TA 1U47A 3MEEA 1T44A 4DU3A 3S9HA 4OKKA 4WYBA 1NGIA 3AVAA 1KVCA 3OYKA 1WSGA 2IDOA 3O3FA 4CZJA 1RT5A 3ZSYA 1NJYA 2Q1NA 2P9IA 4FCYA 1SV5A 5DM7L 5M1KA 1QSYA 4FL9A 3L4IA 3UB5A 4B9SA 4FK2A 1IKWA 4QS9A 2KFZA 3OY9A 3MMVA 3VEWA 3C65A 4BRLA 3LL3A 2ZWHA 4FJ8A 3S3NA 4DV1K 4DWIA 4CEFA 4CF2A 1U49A 2O8EA 3NF9A 3CF5L 5BRHA 3ZX2A 1Q7YO 3CCLN 3IFRA 1W7AA 4B8AB 5KGWA 3PX6A 3VF6A 3CMAN 2QWNA 4BR9A 3I55N 2GV9A 4Z4CA 5JVGL 3VGKA 4JKFA 3FFKB 5HL7L 2DFEA 3BF3A 3MWPA 2BUPA 5JMVA 4CJLA 4JV5K 1LAWA 4A2BA 3D2EA 3J7ZO 1NGAA 1HNIA 3BY5A 4GKKK 1S1UA 4DS4A 2WUSA 2VWBA 1TAUA 1DGKN 4FJ9A 2P9SB 5K14A 4CEZA 3MN9A 1KFSA 3Q7CA 3VQ4A 3AVGA 3K9JA 4CIFA 2XRIA 2NRHA 1LW2A 1KCFA 3CC7N 5E84A 3VQCA 3L0QA 2A3ZA 3O9SA 2F96A 3ZT3A 3SNNA 1O1WA 2ZD1A 1JJ2M 1GOAA 2FBTA 1BUPA 1VQON 3A2FA 1XMOK 5CYMA 3M8RA 1ZBFA 2W41A 4K41A 3A5OC 2UUCK 2P9LB 4JI1K 4O44A 1ZBSA 4CK1A 4X65K 4DV5K 3QFPA 1YJ9N 1BI4B 5AQNA 4BC5A 1NJWA 1NKCA 2HNYA 4E89A 2ZJRL 4K42A 3C7NA 4E7KA 4CBXA 3IAYA 1NK8A 4GKJK 1N33K 3EL2A 5TKWA 4I6MA 3CCMN 3UKRB 4DCHA 4A62A 1RT3A 3DLEA 2E5LK 1FJGK 2HSTA 2Q0RA 1NGJA 4JK7A 1J54A 3NVKA 4Y0WA 4JEPA 1S22A 3K9KA 4CCHA 2Q97A 3RMDA 3KVGA 2FC0A 4OKJA 1RBVA 2YX6A 4ZTJA 3MEGA 1D4XA 2IOCA 3CCUN 1NK9A 1J6ZA 3DRPA 4LH5A 4OPJA 4DR5K 1BISA 2B5JA 1Z26A 2YHAA 4CGJA 3MN6A 4OGEA 2W6LA 1C6VA 3AY9A 3ZSQA 3SAFA 1S1XA 4FZZA 3SUPA 4FM2A 4FLVA 4IJNA 3K5OA 1VQMN 3PX4A 3CIPA 1F21A 4B8CA 2V7ZA 2GUIA 1ATNA 5C0YA 4KH6A 3RSEB 5AQRA 2XY6A 4JK8A 4CZMA 3NMUA 1BG3A 1BI4A 2HF3A 3E66A 2I7PA 5C2DA 1HMVA 4C1NK 2YV0X 3VN5A 4V19S 3QNOA 1EO1A 4DTMA 1NBWA 1EQYA 1W97L 2P1JA 4B9QA 3G10A 4LH4A 3CQYA 1JL2A 1IBKK 2YHBA 2E6LA 4KTQA 4IO9L 3KHYA 2B6AA 3NDKA 4FJJA 4FJHA 3O9TA 4CF8A 3D7EO 3TSPA 4Y1DA 3GBTA 2AP1A 1VRUA 1TYQB 3F2KA 4CGGA 4LY7A 3ZX0A 2P9PA 4OPKA 1B9FA 2G8UA 4LSNA 3LPTA 4WFBL 4E7LA 4FK4A 1P90A 5FDLA 4FLZA 5E41A 3VMFB 2IGIA 4DTJA 2D1KA 4B1UB 3CFPA 2E4LA 3VERA 3AV9A 3ID8A 3MXJA 4IO8A 4C8MA 3QESA 4OVLA 4Q0BA 3EZ5A 1NK6A 2ASMA 2EWSA 4G9ZA 4KI4A 2UXBK 3QNNA 4B3OA 4DV2K 3K59A 1UA0A 4WFAL 5AQIA 5ELZA 1HNZK 4AM6A 3LDLA 3CFRA 5AQSA 4KO0A 4I2QA 5CY4A 5AFUH 3OYLA 3J81O 4RW4A 2QI2A 3IG1A 2HHHK 1J9AA 3THYA 1UWBA 2O8DB 4BG8A 4DR1K 5AQPA 5LJVA 3ZCMA 3AVLA 3SQ0A 4KHNA 1GLAG 1VSJA 4MDAA 1BQMA 2WONA 1XQSC 3QERA 4KKOA 4QCLA 3QETA 4JKCA 2E2QA 3QEXA 2BE2A 3MX2A 4FLWA 4IJAA 2QWPA 4DV6K 2E20A 4CHYA 3M8SA 3LALA 1QSSA 2CGKA 3ENBA 5IWAK 1IG8A 4FWSA 3O9QA 1BU6O 4EHTA 4G1QA 2OTLN 4FVUA 4CEEA 4CFDA 4FO0A 3OJSA 2YHWA 2EHGA 4B3MK 3V1RA 1NOYA 2GTDA 4FSVA 4CZGA 4GNIA 4IXCA 1KLMA 1WB9A 3CJ1A 4DTOA 4ELVA 5DM6L 3A0IX 1GLDG 4BRQA 4PKGA 4E1NA 2NRVA 3AA3A 5BR8K 2A5XA 4PL8A 3KLFA 5GAGP 4JI8K 4EP4A 2G8KA 1HPMA 3WT0A 4JI6K 3D2FA 3CJCA 2A40A 4GY2B 2GEMA 3LDNA 3OYBA 1E3MA 2OANA 1HNVA 4MLHA 4Z4IA 5HP1A 1WN7A 4DQQA 4LSLA 5HRSA 1NKBA 3E9PA 4FJIA 3QICA 4PHTX 5D3GA 1IH7A 3DRSA 4O0JA 4JYAK 1YXQA 3R8EA 4CJWA 3THXB 3V6DA 3F5TA 3Q7BA 2F7TA 1FK9A 2EX3A 3AVMA 3PIOL 4IKFA 3D2FB 3AO4A 2P5GA 3T3FA 4JKEA 3GE1A 3VEZA 1XC9A 4I9QA 3TAGA 4N47A 3HTVA 5ADXH 1RGIA 3L3UA 1V4SA 3DMJA 2AJQA 4LF9K 5AQJA 1TK0A 1TL3A 4U67L 1EWRA 2YHXA 4CGFA 5AJ3K 5JICA 1HPZA 3JYTA 3WXLA 4DR7K 2HBJA 4K25A 4GVEA 4PQUA 4AF1A 3A5NC 3T19A 3TABA 3EY1A 3R3LA 2WTUA 4CJ3A 1RT2A 3KWGA 3MECA 4BC2A 4CJSA 1KSPA 3G4SN 3L2RA 3VQ6A 3PLAA 1JLCA 2Q31A 2OZMA 4BVOA 3H3NO 4BWMA 3DXKB 5KQ8A 1YJWN 2PYLA 4C23A 4OJRA 3FE1A 1BL3A 4RTFD 2VG6A 4PY5A 3TPQA 2NRXA 4CBWA 3TR8A 3KK2A 2O8FB 3FR0A 1WSHA 3L2VA 4FJKA 4BC4A 3WQTA 2UUAK 1S6QA 2F9WA 3K57A 1KC8O 4FWQA 2ITMA 4FJLA 4CJKA 3HBTA 4OKEA 3VTIA 4X64K 1ATRA 4RCHA 4DQSA 1EETA 1VAZA 2XY5A 4O5FA 4JI7K 4NYFA 5HRPA 4DR3K 3MX5A 2YKNA 1U45A 1KRPA 5C24A 5M1NA 5A2QO 1X9WA 3L4QA 4KPYA 4CJRA 3T7ZA 3AAQA 4CGDA 5AZJB 3O6WA 3OYFA 1QZ6A 4DUYK 3FGUA 1UOCA 4KBOA 5BPMA 3DLLL 5F1XA 5CZ1A 1Q81O 4JI5K 4DQPA 4FWRA 4CI6A 3ID6A 3O4QA 1VQLN 1J53A 4CZLA 4NCBA 4CEBA 2VG5A 3DM2A 5EY4A 4RW7A 3NH2A 4LFBK 1NGHA 1SL2A 4CEDA 3I8DA 3QBXA 3LAMA 3RR8A 4FZXC 4QS8A 3C94A 2RKIA 1Y64A 2VG7A 3OYAA 1W0HA 3SUQA 3AGKA 5SZTA 4FLUA 4BRCA 5FLXO 3U9DA 5TKYA 4E1MA 3V4IA 4BQLA 4YY3K 1LAVA 2ETJA 4JHDB 1MA9B 2OZSA 3H1QA 3TI0A 3THVA 4E7HA 1TKDA 2ZGYA 1I94K 1KD1O 4LD0A 1UAXA 1RNHA 3LP1A 2IVNA 3LPUA 4B1XB 2A1SA 3CYMA 1X9SA 1WLJA 4H0PA 4MO5A 3ASMA 5AQUA 5C2FA 1SAZA 3CCJN 4CHZA 3V9ZA 2ASOA 3ZX3A 3E9OA 4B9VA 2P9LA 3RSEA 3WNEA 4FM0A 3DI6A 2HMPA 3CM5A 1QZ5A 3PY8A 1BWFO 2VGMA 1VQPN 4DB3A 1XC3A 2Q0UA 4AILC 4BRFA 4EP5A 4E0DA 1QHAA 3V1OA 3PIPL 3SV4A 1RDBA 4CK3A 5AQZA 1KTQA 2G8VA 1ILYA 3E01A 4EZ9A 5KTQA 4DV7K 3EN9A 1CZ9A 2ZGZA 2Z1JA 1BQNA 3PSFA 4DUZK 2ZJQL 3B6OA 3SUNA 1L3UA 3LDPA 2P5OA 3C95A 4PWDA 1ASUA 3MN5A 5FPDA 1B9DA 3EO3A 2P9NA 4BC3A 2FBVA 3ZETA 3L3VA 1C0GA 2NRWA 4HUEA 4IDHA 2I7NA 3CC4N 5BRFA 3CFOA 3SBTA 4DSLA 3AARA 1VQ6N 3IDHA 4OLBA 4YFUA 2VYPA 1X3NA 2OPPA 2D0OA 3CQXA 4KTWA 1N5YA 4QOZB 2O8CA 1H1VA 1VSKA 1T7PA 1VQNN 1JLFA 4B9LA 2NRRA 3VQ9A 3CCSN 2O8BB 3JS6A 4E1JA 3TAEA 4PKHA 4ILHA 4M7XA 4PA1A 1TVRA 1N8RO 1OH6A 3OBYA 3UIQA 1TUUA 1YHQN 4CF9A 3KLHA 1JLEA 4KAZA 3O08A 2R7YA 5AR0A 4FW1A 2D0PA 5AQTA 2PFUA 4ILJA 3NF7A 1SL1A 3QINA 2KTQA 2WC9A 4ZTFA 2F9TA 4EIAA 3NGYA 1HYZA 3GDQA 2UU9K 3L8BA 5I3UA 5BPLA 3VGLA 2DFFA 3AVBA 1T8EA 4O4GA 1A5VA 1KVAA 2E2OA 4JKDA 2ASPA 5T7BA 1ZXOA 4KFBA 3ZSWA 3V9UA 3RVCA 5KPTA 1Q9YA 1NNEA 2IS3A 3IMXA 5EVZA 1RCHA 1J5OA 3WXKA 4H5NA 1MWKA 5GAEP 3G71N 5AZJA 2RE2A 4WQ5A 4XH1A 2KZZA 5JLFA 3TTCA 4C8NA 2D0AA 3C0BA 4PL7A 4R79A 1A5WA 4OLAA 3J7AP 5LMNK 4EFHA 1BA0A 4B3RK 2YKMA 4BR5A 4DFJA 4Z4HA 5AQLA 3HOTA 1RT4A 4J2AA 3CCRN 1LWEA 3NAEA 4BRDA 4O8UA 4JI4K 3G6EN 4H0YB 4O8KA 4CGHA 3P31A 5BPNA 3ATUA 4CJTA 4HCCA 3NF6A 4DTUA 1NK4A 1FKOA 4AHRA 4NO7A 3TANA 3IKMA 3VQ7A 1U4BA 1YVNA 4FZYA 1DEJA 1GLCG 4LFCK 1VQ7N 4M3ZA 4CJVA 3A8YA 2HNZA 2CGLA 3EE9A 4CERA 3NGZA 2D4WA 4UQGA 3MK6A 4DTXA 2XY8A 2A41A 3RWUA 4DFKA 2Z1GA 3LM9A 3FFIA 4X66K 3SQ4A 2QTDA 4E7IA 3CQ8A 4C8OA 4YOTA 4FWPA 3SPZA 3KK7A 2FSKA 3KKSA 3RRHA 3O8MA 5JVHL 1IBLK 3OS2A 2QXLA 1RDCA 1ATSA 5FPEA 5I9EB 5AFUA 2NRTA 2OPSA 2CH5A 3HSTB 4JS4A 1QQOA 4CZHA 1LOTB 4ZHRA 2HF4A 2HBLA 1WOQA 2VCPA 3EEQA 1D8YA 3VGMA 4E3SA 1ZBUA 3OA9A 3RRGA 1JLQA 1VSFA 1SL0A 3ATVA 1YJNN 3O1BA 3MWTA 5IT9O 1L5UA 4JKGB 5AZIA 1D9DA 1XWLA 4N76A 4H5RA 1VSHA 3VQPA 5LMUK 3KLIA 1NMNA 5ADXA 1Q82O 3ZSVA 4HWIA 4H8KA 4HVJA 3J8AA 1HNWK 3DYAA 4CHQA 4ICLA 2E1ZA 3O5BA 1NGCA 1RTJA 3BZKA 3VPZA 2JWLA 4XH5A 4M3RA 4B9TA 4MFBA 1C1CA 1KXPA 3KLEA 1T3VA 4KRFA 4H03B 1A5XA 1ZYQA 5AQWA 2V51B 3H45C 2RPIA 1VQ8N 2HMIA 3QLHA 1IG9A 3CCEN 1YITN 4JI0K 5FPNA 4BE2A 4E7JA 3NE6A 4KB0A 4HTUA 1NMDA 4DTSA 4M3WA 4JD2A 3CMEN 2YNHA 4L8RB 2F8SA 3PO5A 1BGXT 3ZSZA 4BACA 4HTLA 1XNQK 2UXCK 4LFAK 1HQUA 1RBTA 1HRHA 4DG1A 2UXDK 3M3ZA 3HK2A 1BIUA 1NGDA 3P83D 3O4NA 3ULEA 1X1PA 3VESA 4FWLA 4AHTA 4F4KA 1K9MO 4M3XA 3QB0A 2VQFK 2O8EB 2QXFA 1IBMK 4HUFA 3DJCA 2W42A 2NNWA 3M8PA 3U8XA 4MO4A 3KJVA 4BDYA 1SKWA 4H0VB 5DK5A 1XMQK 2JGUA 1Q8IA 4C8KA 2OCEA 4CJFA 2UUBK 4DV0K 5F2RA 3FZFA 4FWKA 1R0AA 4OX9K 2HW3A 1QVGM 1JL1A 1TUYA 1WBDA 5FPMA 3SV3A 1VK0A 3HP9A 4JKHA 3VQDA 4RWTA 1KFDA 4FLYA 2HOEA 3TARA 2BTFA 1WNSA 4KHPK 2FBYA 4ILGB 3AVJA 4GV6A 4B9MA 1T6DA 1YT3A 4B1ZA 1HUXA 1S1TA 3DXKA 1NGFA 1VRTA 4WQ4C 4BRGA 3JAMO 1YUWA 3THYB 4AM7A 4CFCA 3VQBA 4CZKA 1YI2N 4CHNA 3WNHA 4CEOA 4O5BA 4BDPA 4FJNA 1C0UA 3EYZA 3M1FA 2KW4A 3OYCA 3D6RA 4IWVA 4DFPA 1FKPA 3OTOK 1I39A 3KKRA 3ITHA 2HBKA 5AQVA 1X3MA 2YI1A 3CG7A 3N4PA 5M1PA 4B9UA 4QAGA 4CJEA 3T1AA 4CZEA 2YJEA 1TGOA 4BR0A 5I42A 5AQGA 2NUBA 3SMPA 3ZT1A 2KHOA 4BDZA 4CJQA 5E26A 5C42A 3ENHA 3TSUA 5CZ2A 3E9LA 4EZ6A 1JKHA 4ID5A 4DS5A 1IKYA 4H4MA 1GOCA 2PAVA 4DSJA 3THXA 2F8TA 1RTHA 3DXMA 2FXUA 2HVIA 3VF2A 5M1FA 3WNGA 4FPAA 1L3TA 4I2PA 4FXDA 5BRDA 3MEDA 3S41A 5GADP 4YDUC 3LZIA 3H46O 3MAQA 3ZSRA 1TAQA 5M1OA 1HLUA 1GLLO 2KFNA 1BA1A 2A6AA 2G8WA 1TYQA 2BGGA 3CJ7A 3K5MA 4CK2A 1KAZA 1EXQA 3TAFA 3PV8A 1BCMA 2Y1IA 3C6AA 3O3GA 1BIZA 3DLHA 3RMCA 3VQEA 4WF9L 1QTMA 5AQXA 4YHHK 4KHUA 4M3TA 1TK8A 1JCFA 1CLQA 5J2NA 1TKTA 3WNFA 2DY4A 4XEIA 1IO2A 3R6MA 3DOLA 3D45A 2HVHA 4CGIA 3SAGA 4KHWA 4RW9A 3HXMA 3NBPA 4CVNE 1HYVA 1Z6RA 4E19A 3P38A 4FOIA 2NRZA 1IKVA 3VEXA 2WOMA 3BZCA 3AAPA 3IS9A 3H08A 2P9KA 3VEYA 1L3VA 1FW6A 3O1WA 3O9UA 1KLNA 3LP3A 4ISFA 3JXUA 2PY5A 5EXWA 2GWKA 3MXIA 3H3OB 3NCIA 4F3OA 3QFUA 4CF1A 4NLCA 5M1QA 1YIJN 4H0OA 2RHKA 4W5QA 4CF0A 1ASWA 3CPEA 4CJPA 1E4GT 3WXIA 4DR6K 2YCHA 4DQIA 4BQZA 2CGJA 1IV0A 3FLCO 4B08A 4MQ3A 1N6QA 4F9OA 1NOZA 3W0LA 4B3SK 1NKEA 3S3OA 1K8KB 1WAFA 5JS2A 3FZLA 4FJXA 3KK1A 1TV6A 4DTPA 2OTJN 4K0KK 1EP4A 4A59A 2ATQA 2IVPA 1VQ5N 3LWLA 2P9UA 4IZ9A 3H6EA 2P51A 2HNDA 4N56A 3AA2A 1HR0K 2VWKA 4DKWA 2QA4N 4A57A 1HJOA 1TKZA 1RT1A 4J2BA 3LDOA 4B3TK 3DLRA 4UY8O 2GX9A 3C6HA 3TU5A 2OPRA 2OPQA 1VSMA 3DLKA 4JK9A 4DR2K 4DFMA 1WSJA 5KPRA 5J1EA 4M42A 2W40A 2QWOA 3CCQN 5CHIA 3AVKA 3ZEUA 1Q9XA 4FM1A 2X74A 2UYTA 1NM1A 5KQDA 2V7YA 3GG4A 2O4IA 4B1VA 3NVMA 3WXMB 1YF5L 2Q3SA 1RBUA 2LSNA 1XHZA 1WAJA 4LF6K 1G99A 3PO4A 3F73A 2KKZA 4OO1J 1XNRK 4YOYA 3P5JA 3BF1A 1JXBA 4DSIA 3CJBA 4AH9A 2A1RA 4NCGA 4NXNK 1U04A 4BGBA 4O0IA 1TL1A 1MWMA 3EKUA 3VQ8A 1N34K 2E88A 3ZLJA 4ELUA 2FBXA 1ZBLA 1V4TA 1ASVA 5FRNA 4J2DA 1SUQA 1RT7A 1ZC6A 1HKBA 1ESVA 4KHSA 3NGIA 2JWKA 3NF8A 2YNGA 4H5WA 4JRQA 3GL1A 3VF4A 3OYHA 3HVTA 4IOCL 1HNXK 4OGCA 3VOVA 4FPBA 4BRIA 1OH5A 2V52B 1R59O 5C10A 1NGBA 3HJFA 2HHTA 2IVOA 1VSIA 1QVFM 4QS7A 2HHVA 4W5RA 4DV3K 1NWKA 3QEVA 1HX1A 3T1YK 3WEEA 3AVCA 4BRMA 3OYGA 4FVMA 4I6MB 4KB1A 4LF8K 2HHXA 1OVYA 4DQRA 3UE5A 4YDUA 3ALYA 1M1KO 3A5LC 3HM8A 1TK5A 1DT9A 2FLOA 4M3YA 4DSFA 2H3GX 4R5PA 2FSNA 5BREA 2OYQA 2GUPA 2GBZA 3CERA 1SKRA 1SZ2A 4BG9A 3GOIA 3SAHA 1S1VA 4K8XA 2I5JA 3M8QA 3AO1A 1GOBA 3SCXA 1QHTA 4K43A 3VQ5A 1TKXA 5J2QA 4BREA 3MXMA 4FJMA 4JI3K 3V1QA 1NK5A 3I0RA 5HLFA 1JCGA 4NYNA 2KQ2A 2P9UB 4JKGA 3QEIA 2ZE2A 4CEAA 1MDUB 1BHLA 2HB5A 4CBUA 5JLHA 3RMAA 2HHUA 4PUOA 2P9SA 3HL8A 4FYDA 2HHQA 4LC9B 3L2UA 1O13A 1RTIA 4AQYK 4O55A 2ZM6K 1X9JA 2BDPA 4PKIA 1RFQA 1RILA 3T1HK 3RR7A 2IAJA 4IDKA 2GELA 4X62K 5LY3A 3V9WA 4LF7K 5EX5A 3VETA 5HROA 2E2NA 4M41A 3VENA 3N4QA 4DSKA 3CD6N 5HRNA 5AQHA 4F8RA 5FROA 2O8DA 5J2MA 2CH6A 1KAYA 3CXCM 4KHQA 1KVBA 1VSEA 3OYEA 4IEEA 4EAHD 3HI0A 3K5LA 3BP8A 2P9KB 3U6FA 3CJ9A 1RDDA 3LDQA 3AA4A 3HPGA 4DLEA 3AO3A 2QWRA 4U7BA 1QQNA 3O80A 1DTQA 2OA8A 3J7YP 1NK0A 3OVNA 3JSMA 5GAHP 1CXUA 2Z1HA 3OYMA 3HPOA 3I0SA 1Z25A 3U3YA 2DTUA 1HKGA 1LWCA 1CZBA 3IRXA 3ZT2A 1ITGA 4DMNA 2X6SA 4B1WB 2VGNA 1K6YA 5C12A 4BRPA 4CW7B 3CJAA 4CD3A 4A61A 2P9IB 1B92A 4WCEL 2QKKA 3THWB 2IC3A 5SWMA 1T05A 4JN4A 4IOAL 1HJRA 1VQ4N 4CESA 3K5NA 1NG9A 4NB4A 3ZYYX 5GINA 1C0TA 4A5BA 4JHDA 3KLGA 4CJUA 3FZHA 4L3QA 1L3SA 3O4WA 1FXXA 3ZEUB 1T6CA 1WBBA 3AVIA 2QWQA 3DLBA 1WUAA 5AQQA 5EU7A 3ZSXA 1S72N 3BDPA 2G8IA 3L2QA 5C15A 1WSFA 2WFBA 1DKGD 5KGXA 5KPZA 2JLEA 4YNQA 4FW2A 2Q36A 4IOXA 2QKBA 3P1GA 3S3MA 1C0MA 1E4FT 3SQ2A 3V81A 2BANA 3C6UA 4AHUA 1BDGA 4M3UA 1NJIO 1C0FA 2O8BA 3DXMB 4TSXA 1Z05A 3NH1A 3QO9A 4DTRA 1I3AA 4Z0UA 1RBSA 4FWOA 3LZJA 3I33A 3SI6A 3VEOA 5C25A 4YORA 4W5NA 3L6QA 4BVPA 4C8LA 4KI6A 4DHYA 1EX4A 1QS4A 4IBNA 4ISGA 3KD1E 1S9GA 4W5TA 4JD2B 4FWMA 4J2EA 1RBRA 5B8HA 4JI2K 2BH1A 3ZT4A 4CE9A 2F4VK 3BGRA 2PYJA 1D9FA 2PZSA 3MDQA 5F0XA 1XI1A 3QEPA 1U6ZA 3WUHA 1HQEA 4IEIA 3SLCA 4EHUA 3CPWM 4BROA 3U4LA 4H5VA 4GV9A 3ULDA 1BCOA 4HHTA 1CZAN 3K2PA 5H1SQ 3RMBA 4JKBA 1C1AA 1VQ9N 4KHYA 1N32K 3U9ZA 3KIOA 2ZF5O 3H1VX 4YOVA 3HRGA 3KK3A 4Y1CA 4CZFA 1KAXA 4CIGA 2VQEK 4KTZA 4AHVA 4W5OA 1CXQA 3VTHA 4NCAA 3TWHA 4CJ7A 3NH0A 3BEXA 3G0ZA 1LCUA 3ISNC 3OYNA 4MDBA 3ENOA 3D2EB 4YOWA 2O8CB 2A42A 3P4IA 2ZQBA 1U2VA 2QWLA 2XO7A 2QM1A 3TSQA 2RF2A 3SJJA 4K8ZA 3OS0A 3TAMA 4DU1A 3VQAA 3E1YA 4Z94A 5MLCQ 3W3DA 3QIPA 4KH5A 1QE1A 1S3XA 1VSDA 1JLBA 3THWA 3HT3A 5AQOA 3PSIA 3ULEB 4BRKA 1GLFO 4CIEA 3VA3A 1U2VB 2VWJA 4GW6A 4ID1A 5GIOA 5HOOA 3OHRA 2ITGA 5CR4A 3A5MC 3OS1A 4I9LA 3FZMA 4CECA 1JLGA 1RT6A 4BRHA 3PUFA 3OYDA 3OJUA 1OH7A 1HYSA 4IFVA 3UKRA 4GVMA 4YOUA 3B8AX 1J5EK 3F9MA 4IG3A 2GWJA 3LAKA 5BN9A 5JS1A 2RN2A 2QWMA 4FLTA 2O4GA 3VQQA 3K0SA 1XUPO 3TAQA 1D5AA 4GV3A 4JKAA 2QEXN 5LJWA 4F2SA 1S9EA 2XHBA 4Z4EA 1NLVA 3TAPA 5EOYA 3CHWA 3ZT0A 4FWNA 3AVHA 3UKUA 1HKCA 5AQKA 4DQ8A 3F9KA 2X78A 1K73O 3I8BA 3MCPA 5AZIB 3V9SA 1NJZA 2AA4A 5KRTA 1LW0A 1YTAA 2QW9A 4DSEA 3HSCA 5BN8A 4ISEA 4CD1A 4FLXA 3EE8A 1X9MA 4IFEA 1QQCA 3AA5X 3HOSA 3U3GA 1M90O 1BOTO 2J4RA 3M6GA 4FJGA 4NXMK 5CYQA 4A2AA 3J80O 5DMRA 1IJJA 4KV8A 4CFBA 4Q5VA 3DRRA 4I7FA 3D0PA 4KREA 2Y1JA 2KZMA 3HPHA 2D0BA 2P9NB 3O3HA 2KLAA 3KZBA 3O9RA 4DLGA 2IIRA 2YJFA 3QBWA 2P9PB 1S5JA 5LL6Z 1JCEA 1REVA 1WSIA 2E8AA 2HHWA 1W2BM 1P8ZA 4CZIA 4WQ4A 4B9NA 1SKSA 4DTNA 3TTFA 4RG8A 3SYZA 2G8FA 3UKUB 3P39A 3SZ2A 1W9HA 2D5RA 4JLHA 4MLEA 4OPAA 4OPHA 4CJ4A 4AHSA 3OYJA 4HUGA 1NU0A 2DPNA 4H4OA 5FRMA 1BO5O 3LM2A 3VA0A 4BE1A 2DFHA 3NFAA 4BRNA 4DF4A 1LV5A 3V9XA 1RDAA 1OVQA 3SUOA 2Z1IA 3C6TA 1MU2A 2E6MA 1DLOA 3QIOA 3K58A 3CCVN 4ELTA 3AO2A 4WQ5C 3KWIA 4BGAA 3M5RA 1VHXA 1VQKN 4FJ7A 1ZBIA 3LANA 3PX0A 1S6PA 4H0TB 2FF3B 4XH4A 2Q2RA 3BUZB 4GMJB 3LP2A 4BR4A 2PBDA 3EZWA 4M63C 5J2PA 3QMLA 4CHOA 3QEWA 1K8KA 2W6KA 1SS6A 2E2PA 3B6PA 2FSJA 4N5SA 3CETA 4M45A 4BE0A 3OW2M 3DWLA 2FF6A 5KRSA 2D0CA 1VSLA 1RDUA 5CE3A 1K8AO 3CC2N 4FJ5A 4F2RA 4BR2A 5AQYA 5GIPA 3WXJA 4C1NI 3KTQA 3LDSA 2O8FA 1EKEA 1NGEA 4CEQA 1NK7A 4H0XB 1LWFA 3ZETB 1Q18A 2YNIA 1NJXA 1EWQA 3MN7A 3OBWA 4WFNL 4HCBA 3L2WA 1YTUA 1NGGA 3AO5A 4WE1A 3R9PA 4NLBA 3HP6A 1WSEA 4B1YB 1DTTA 3LP0A 3WQUA 3SJHA 2B4JA 2NLXA 3QDKA 4KH4A 4IG0A 1QSLA 3T69A 4BY9C 2XY7A 2NZTA 3SK3A 4JNEA 3IUCA 4DR4K 2HHSA 5HRRA 1XHXA 3NHGA 3SQ1A 3HYFA 4AHCA 3TTDA 4XIUA 1YVUA 3HO1A 1U48A 5AQFA
chains in the Genus database with same CATH topology
2QXFA 4RW6A 3HPOA 3I0SA 1Z25A 4HUFA 4CGFA 3U3YA 4DU4A 2W42A 3JYTA 1HPZA 1S1WA 3M8PA 3RTVA 3KJVA 4BDYA 1SKWA 2DTUA 4PQUA 1JXEA 3T19A 1LWCA 1CZBA 3IRXA 5DK5A 3ZT2A 3TABA 2JGUA 3HM9A 1ITGA 1Q8IA 3HVRA 3EY1A 4C8KA 4FK0A 4DMNA 4CJ3A 1RT2A 2X6SA 5KI6A 3MECA 4CJFA 4CJSA 1K6YA 1KSPA 3L2RA 4Z4GA 3VQ6A 1R0AA 1JLCA 2OZMA 4F3TA 1B92A 2QKKA 4BWMA 3OYIA 2IC3A 3AVNA 2HW3A 2PYLA 1ZBHA 4JS5A 4OJRA 1RTDA 1JL1A 5SWMA 1BL3A 1JLAA 1T03A 2VG6A 1T05A 4PY5A 3KK2A 3TR8A 2YNFA 1HJRA 3SV3A 1VK0A 3HP9A 4CESA 3VQDA 3K5NA 4JRPA 4BDPA 1C1BA 1KFDA 1WSHA 4CJ5A 1Y97A 3L2VA 4FLYA 4FJKA 1C0TA 1S6QA 1UA1A 4Z4FA 4RW8A 3K57A 3TARA 4HCBA 3DLGA 4FJLA 2X6NA 2QK9A 1WNSA 4CJKA 3KLGA 4CJUA 2FBYA 4OKEA 3AVJA 3CM6A 1L3SA 3KD5E 1FXXA 4DQSA 1EETA 3LWMA 1IKXA 2XY5A 4B9MA 3AVIA 3DLBA 3DOKA 3AVFA 4NYFA 5EU7A 1YT3A 3ZSXA 4CFAA 5HRPA 3BDPA 3L2QA 2G8IA 4CHPA 2YKNA 1U45A 1KRPA 1S1TA 5C24A 4KHQA 1WSFA 4BWJA 1VRTA 4IFYA 3ZSOA 1X9WA 5KGXA 4KPYA 4CJRA 4DF8A 2JLEA 4CGDA 4CFCA 3VQBA 4YNQA 4FW2A 4N41A 4CHNA 3SPYA 2QKBA 3P1GA 1G15A 4O5BA 1C0MA 5HBMA 1C0UA 3WNHA 4CEOA 3OYFA 3EYZA 2G8HA 4FJNA 3SQ2A 1UOCA 2BANA 3V81A 1U47A 3MEEA 2KW4A 3C6UA 5CZ1A 4DU3A 3S9HA 4AHUA 4OKKA 3OYCA 4M3UA 4DQPA 4DFPA 3AVAA 1FKPA 1KVCA 3O4QA 4TSXA 3OYKA 1I39A 1WSGA 2IDOA 3ITHA 3KKRA 3NH1A 3O3FA 1J53A 4NCBA 1RT5A 3QO9A 2VG5A 3DM2A 3CG7A 3ZSYA 1I3AA 4CEBA 4DTRA 1NJYA 4B9UA 4RW7A 4QAGA 4FCYA 4CJEA 1SV5A 4Z0UA 3NH2A 1SL2A 3T1AA 1QSYA 4CEDA 3I8DA 1TGOA 3LAMA 1RBSA 3LZJA 5I42A 4B9SA 1IKWA 2NUBA 3SI6A 3RR8A 4FK2A 4FZXC 3C94A 1YTUA 5C25A 2KFZA 3OY9A 2RKIA 2VG7A 3OYAA 4W5NA 1W0HA 3ZT1A 3SUQA 4BDZA 4CJQA 4FJ8A 5SZTA 5C42A 4FLUA 4C8LA 4KI6A 1EX4A 1QS4A 5CZ2A 3S3NA 4IBNA 4EZ6A 1JKHA 4ID5A 4DS5A 4DWIA 4CEFA 1IKYA 3KD1E 1GOCA 4CF2A 4E1MA 3V4IA 1U49A 1LAVA 1S9GA 2ETJA 3NF9A 4W5TA 4DSJA 4J2EA 2OZSA 1RBRA 2F8TA 1RTHA 3TI0A 3THVA 3ZT4A 4E7HA 4CE9A 4B8AB 5KGWA 3BGRA 3PX6A 1TKDA 2PYJA 2HVIA 1L3TA 3WNGA 4LD0A 1UAXA 1RNHA 1D9FA 4I2PA 2PZSA 4FXDA 2GV9A 3LP1A 3MEDA 1XI1A 3QEPA 3LPUA 4Z4CA 2A1SA 1HQEA 3CYMA 1X9SA 1WLJA 2DFEA 3ASMA 3LZIA 4CJLA 3ZSRA 3MAQA 1TAQA 4CHZA 3V9ZA 3ULDA 1BCOA 1LAWA 4HHTA 2KFNA 4B9VA 3WNEA 4FM0A 3DI6A 2G8WA 3K2PA 3RMBA 2BGGA 3CM5A 1HNIA 3K5MA 1S1UA 3PY8A 1C1AA 4CK2A 4DS4A 1EXQA 1TAUA 4FJ9A 3TAFA 3PV8A 4KHYA 1BCMA 3KIOA 5K14A 4CEZA 4AILC 2Y1IA 1KFSA 4EP5A 3O3GA 1BIZA 3DLHA 3RMCA 3VQEA 1QTMA 4E0DA 3V1OA 3VQ4A 3AVGA 4CIFA 3OYMA 3KK3A 2XRIA 4KHUA 4Y1CA 1LW2A 4M3TA 1TK8A 1KCFA 3SV4A 4CIGA 1RDBA 3VQCA 4KTZA 4CK3A 5J2NA 4AHVA 1CLQA 4W5OA 1TKTA 1CXQA 1KTQA 2F96A 3WNFA 3ZT3A 1IO2A 3SNNA 2G8VA 3TWHA 4NCAA 3E01A 1O1WA 2ZD1A 3NH0A 4EZ9A 3DOLA 3D45A 3G0ZA 5KTQA 1GOAA 2FBTA 2HVHA 4CGIA 4KHWA 4RW9A 3A2FA 3HXMA 1CZ9A 3NBPA 5CYMA 3M8RA 2Z1JA 1BQNA 1ZBFA 1HYVA 3ISNC 4E19A 3OYNA 3B6OA 3SUNA 1L3UA 1IKVA 4O44A 4CK1A 2P5OA 3C95A 4PWDA 2WOMA 2ZQBA 3IS9A 1ASUA 1BI4B 2XO7A 1B9DA 3H08A 1NJWA 1NKCA 2HNYA 4E89A 1L3VA 2FBVA 2RF2A 3SJJA 4E7KA 1KLNA 3LP3A 4K8ZA 3L3VA 2PY5A 3OS0A 3TAMA 4HUEA 4DU1A 3NCIA 3MXIA 3IAYA 4F3OA 4CF1A 1NK8A 3VQAA 3CFOA 4W5QA 4CF0A 4DSLA 1ASWA 3QIPA 4CJPA 1QE1A 1RT3A 1VSDA 4DQIA 1JLBA 3DLEA 3HT3A 4OLBA 4B08A 4YFUA 4CIEA 4MQ3A 3VA3A 2VWJA 2OPPA 4GW6A 1N6QA 1J54A 4KTWA 1N5YA 4ID1A 4QOZB 1VSKA 1T7PA 1NOZA 2ITGA 1JLFA 4CCHA 3OS1A 4B9LA 4I9LA 1NKEA 3VQ9A 3RMDA 2FC0A 3S3OA 4OKJA 1RBVA 3TAEA 4CECA 4ZTJA 1JLGA 3MEGA 1WAFA 5JS2A 1U48A 4PA1A 1TVRA 2IOCA 3UIQA 1RT6A 1NK9A 3DRPA 4LH5A 4OPJA 4FJXA 2B5JA 1BISA 1Z26A 3PUFA 1TV6A 4CF9A 2YHAA 3OYDA 3OJUA 3KK1A 4IFVA 1EP4A 1JLEA 4OGEA 4CGJA 3KLHA 1C6VA 4GVMA 3ZSQA 2ATQA 2R7YA 4KAZA 1S1XA 4FW1A 4FZZA 3SUPA 3LWLA 4FM2A 4FLVA 2P51A 3NF7A 2HNDA 3K5OA 3QINA 4N56A 1SL1A 4IG3A 2KTQA 3AA2A 4ZTFA 2VWKA 3PX4A 1F21A 3NGYA 1HYZA 1TKZA 4B8CA 1RT1A 4J2BA 2GUIA 3L8BA 5I3UA 3LAKA 3DLRA 2XY6A 5JS1A 2DFFA 3AVBA 1T8EA 1BI4A 2RN2A 4O4GA 1A5VA 1KVAA 2O4GA 2OPRA 4FLTA 2OPQA 1VSMA 3VQQA 3DLKA 1HMVA 4DFMA 3TAQA 1D5AA 1WSJA 5J1EA 5T7BA 4M42A 2YV0X 3VN5A 4KFBA 3ZSWA 3V9UA 1Q9YA 3QNOA 1S9EA 4F2SA 2XHBA 4DTMA 4Z4EA 3AVKA 3TAPA 2IS3A 2DY4A 2P1JA 1Q9XA 4FM1A 1RCHA 2X74A 3ZT0A 1J5OA 3G10A 4LH4A 1JL2A 2O4IA 3AVHA 2YHBA 3F9KA 2Q3SA 2X78A 2E6LA 4KTQA 1RBUA 2LSNA 1XHZA 1WAJA 2B6AA 3NDKA 3F73A 3V9SA 1NJZA 3PO4A 4FJJA 5KRTA 4FJHA 2KZZA 4CF8A 1LW0A 1YTAA 4C8NA 3P5JA 4DSEA 1JXBA 2D0AA 4DSIA 4Y1DA 4AH9A 1VRUA 2A1RA 4NCGA 4CGGA 1A5WA 1U04A 4LY7A 4O0IA 4FLXA 1X9MA 4OLAA 1QQCA 3AA5X 1TL1A 3VQ8A 4OPKA 1B9FA 3U3GA 4ELUA 2FBXA 2G8UA 4LSNA 3LPTA 1ZBLA 4E7LA 4FK4A 2YKMA 5FDLA 4DFJA 1ASVA 4Z4HA 4FLZA 5FRNA 4J2DA 1RT4A 5E41A 1SUQA 1RT7A 4J2AA 1LWEA 4FJGA 3NAEA 4KHSA 3NGIA 5CYQA 1QSSA 3NF8A 2YNGA 4CGHA 2IGIA 4DTJA 5DMRA 4JRQA 4KV8A 4CFBA 4CJTA 4Q5VA 3OYHA 3DRRA 3HVTA 4HCCA 3NF6A 3CFPA 2E4LA 4OGCA 4I7FA 3D0PA 4DTUA 4KREA 1NK4A 2Y1JA 1FKOA 3AV9A 3MXJA 4AHRA 3TANA 1D8YA 4C8MA 3VQ7A 3QESA 2KZMA 3HPHA 4OVLA 4Q0BA 3EZ5A 1NK6A 2D0BA 3HJFA 3O3HA 1U4BA 4KI4A 2HHTA 4FZYA 4DLGA 3QNNA 1VSIA 2HHVA 1S5JA 4W5RA 4B3OA 4M3ZA 1REVA 3K59A 4CJVA 1WSIA 1UA0A 2HNZA 3QEVA 4CERA 3NGZA 3AVCA 4UQGA 3OYGA 4FVMA 4KB1A 4DTXA 2XY8A 3S3MA 3RWUA 2HHXA 3CFRA 4DQRA 2HHWA 4DFKA 3ALYA 4KO0A 2Z1GA 4I2QA 5CY4A 3FFIA 4B9NA 3SQ4A 4E7IA 1SKSA 1TK5A 4DTNA 4RG8A 3OYLA 3SYZA 2G8FA 4M3YA 3CQ8A 4C8OA 4DSFA 4RW4A 3SPZA 3IG1A 3SZ2A 4R5PA 1J9AA 1W9HA 2D5RA 3KKSA 4JLHA 3RRHA 2OYQA 1UWBA 2GBZA 3OS2A 4CJ4A 1RDCA 3ZCMA 4AHSA 3AVLA 3OYJA 4HUGA 3SQ0A 1SKRA 4KHNA 1VSJA 2OPSA 4H4OA 5FRMA 1BQMA 2WONA 3QERA 1S1VA 3VA0A 4K8XA 3HSTB 4KKOA 4JS4A 4QCLA 3QETA 4BE1A 2DFHA 3QEXA 3NFAA 2BE2A 4DF4A 4FLWA 2I5JA 3M8QA 4ZHRA 4CHYA 1RDAA 3M8SA 3V9XA 1LV5A 3AO1A 1GOBA 3LALA 2Z1IA 3C6TA 4E3SA 3SUOA 3SCXA 1QHTA 1ZBUA 3VQ5A 1TKXA 5J2QA 3RRGA 1JLQA 1VSFA 1SL0A 1MU2A 2E6MA 1DLOA 3QIOA 3K58A 3MXMA 4FJMA 3V1QA 1NK5A 4ELTA 3I0RA 3AO2A 5HLFA 4DTPA 4G1QA 4NYNA 1L5UA 2KQ2A 4FJ7A 3QEIA 2ZE2A 4CEAA 1ZBIA 3LANA 1D9DA 1BHLA 1XWLA 4N76A 2HB5A 1S6PA 4CEEA 4CFDA 3PX0A 3RMAA 2HHUA 3OJSA 1VSHA 2EHGA 3VQPA 3V1RA 3KLIA 1NOYA 4GMJB 3LP2A 3ZSVA 4PUOA 4H8KA 1KLMA 4HVJA 5J2PA 4DTOA 4CHOA 3HL8A 3QEWA 4ELVA 4FYDA 3DYAA 2HHQA 4CHQA 3L2UA 4E1NA 4ICLA 3AA3A 1RTIA 3KLFA 3B6PA 4O55A 1RTJA 4N5SA 2BDPA 4EP4A 2G8KA 4M45A 4BE0A 1TK0A 1RILA 4M3RA 4B9TA 1C1CA 4MFBA 3KLEA 2IAJA 4IDKA 3RR7A 4KRFA 5KRSA 1A5XA 2D0CA 1VSLA 1ZYQA 3OYBA 3V9WA 2RPIA 1HNVA 5HROA 2HMIA 4FJ5A 4M41A 4F2RA 4DSKA 4Z4IA 5HRNA 5HP1A 4F8RA 1WN7A 3QLHA 4LSLA 4DQQA 1IG9A 5FROA 5HRSA 1NKBA 4FJIA 3KTQA 5J2MA 3LDSA 4BE2A 1IH7A 5D3GA 3DRSA 4E7JA 4O0JA 3NE6A 1EKEA 1KVBA 1VSEA 4CEQA 1NK7A 4KB0A 4HTUA 3OYEA 4CJWA 1LWFA 4DTSA 4M3WA 3V6DA 2YNIA 1NJXA 2YNHA 4L8RB 2F8SA 3K5LA 3PO5A 1FK9A 2EX3A 3L2WA 1BGXT 3U6FA 3AVMA 3ZSZA 3AO5A 4WE1A 4BACA 4IKFA 3HP6A 1WSEA 3AO4A 1DTTA 3LP0A 3T3FA 1RDDA 2P5GA 2B4JA 3AA4A 1HQUA 1RBTA 3HPGA 1HRHA 3AO3A 4DLEA 1XC9A 4I9QA 4IG0A 1QSLA 1HYSA 3TAGA 1DTQA 4DG1A 4N47A 2XY7A 2OA8A 1NK0A 3OVNA 3HK2A 1BIUA 3P83D 3JSMA 2HHSA 3O4NA 3L3UA 5HRRA 1X1PA 1XHXA 4AHTA 3DMJA 3NHGA 3SQ1A 3HYFA 4F4KA 2AJQA 1CXUA 2Z1HA 4AHCA 4XIUA 3HO1A 1YVUA 4M3XA 1TL3A 4H4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXF A;  4RW6 A;  3HPO A;  3I0S A;  1Z25 A;  4HUF A;  4CGF A;  3U3Y A;  4DU4 A;  2W42 A;  3JYT A;  1HPZ A;  1S1W A;  3M8P A;  3RTV A;  3KJV A;  4BDY A;  1SKW A;  2DTU A;  4PQU A;  1JXE A;  3T19 A;  1LWC A;  1CZB A;  3IRX A;  5DK5 A;  3ZT2 A;  3TAB A;  2JGU A;  3HM9 A;  1ITG A;  1Q8I A;  3HVR A;  3EY1 A;  4C8K A;  4FK0 A;  4DMN A;  4CJ3 A;  1RT2 A;  2X6S A;  5KI6 A;  3MEC A;  4CJF A;  4CJS A;  1K6Y A;  1KSP A;  3L2R A;  4Z4G A;  3VQ6 A;  1R0A A;  1JLC A;  2OZM A;  4F3T A;  1B92 A;  2QKK A;  4BWM A;  3OYI A;  2IC3 A;  3AVN A;  2HW3 A;  2PYL A;  1ZBH A;  4JS5 A;  4OJR A;  1RTD A;  1JL1 A;  5SWM A;  1BL3 A;  1JLA A;  1T03 A;  2VG6 A;  1T05 A;  4PY5 A;  3KK2 A;  3TR8 A;  2YNF A;  1HJR A;  3SV3 A;  1VK0 A;  3HP9 A;  4CES A;  3VQD A;  3K5N A;  4JRP A;  4BDP A;  1C1B A;  1KFD A;  1WSH A;  4CJ5 A;  1Y97 A;  3L2V A;  4FLY A;  4FJK A;  1C0T A;  1S6Q A;  1UA1 A;  4Z4F A;  4RW8 A;  3K57 A;  3TAR A;  4HCB A;  3DLG A;  4FJL A;  2X6N A;  2QK9 A;  1WNS A;  4CJK A;  3KLG A;  4CJU A;  2FBY A;  4OKE A;  3AVJ A;  3CM6 A;  1L3S A;  3KD5 E;  1FXX A;  4DQS A;  1EET A;  3LWM A;  1IKX A;  2XY5 A;  4B9M A;  3AVI A;  3DLB A;  3DOK A;  3AVF A;  4NYF A;  5EU7 A;  1YT3 A;  3ZSX A;  4CFA A;  5HRP A;  3BDP A;  3L2Q A;  2G8I A;  4CHP A;  2YKN A;  1U45 A;  1KRP A;  1S1T A;  5C24 A;  4KHQ A;  1WSF A;  4BWJ A;  1VRT A;  4IFY A;  3ZSO A;  1X9W A;  5KGX A;  4KPY A;  4CJR A;  4DF8 A;  2JLE A;  4CGD A;  4CFC A;  3VQB A;  4YNQ A;  4FW2 A;  4N41 A;  4CHN A;  3SPY A;  2QKB A;  3P1G A;  1G15 A;  4O5B A;  1C0M A;  5HBM A;  1C0U A;  3WNH A;  4CEO A;  3OYF A;  3EYZ A;  2G8H A;  4FJN A;  3SQ2 A;  1UOC A;  2BAN A;  3V81 A;  1U47 A;  3MEE A;  2KW4 A;  3C6U A;  5CZ1 A;  4DU3 A;  3S9H A;  4AHU A;  4OKK A;  3OYC A;  4M3U A;  4DQP A;  4DFP A;  3AVA A;  1FKP A;  1KVC A;  3O4Q A;  4TSX A;  3OYK A;  1I39 A;  1WSG A;  2IDO A;  3ITH A;  3KKR A;  3NH1 A;  3O3F A;  1J53 A;  4NCB A;  1RT5 A;  3QO9 A;  2VG5 A;  3DM2 A;  3CG7 A;  3ZSY A;  1I3A A;  4CEB A;  4DTR A;  1NJY A;  4B9U A;  4RW7 A;  4QAG A;  4FCY A;  4CJE A;  1SV5 A;  4Z0U A;  3NH2 A;  1SL2 A;  3T1A A;  1QSY A;  4CED A;  3I8D A;  1TGO A;  3LAM A;  1RBS A;  3LZJ A;  5I42 A;  4B9S A;  1IKW A;  2NUB A;  3SI6 A;  3RR8 A;  4FK2 A;  4FZX C;  3C94 A;  1YTU A;  5C25 A;  2KFZ A;  3OY9 A;  2RKI A;  2VG7 A;  3OYA A;  4W5N A;  1W0H A;  3ZT1 A;  3SUQ A;  4BDZ A;  4CJQ A;  4FJ8 A;  5SZT A;  5C42 A;  4FLU A;  4C8L A;  4KI6 A;  1EX4 A;  1QS4 A;  5CZ2 A;  3S3N A;  4IBN A;  4EZ6 A;  1JKH A;  4ID5 A;  4DS5 A;  4DWI A;  4CEF A;  1IKY A;  3KD1 E;  1GOC A;  4CF2 A;  4E1M A;  3V4I A;  1U49 A;  1LAV A;  1S9G A;  2ETJ A;  3NF9 A;  4W5T A;  4DSJ A;  4J2E A;  2OZS A;  1RBR A;  2F8T A;  1RTH A;  3TI0 A;  3THV A;  3ZT4 A;  4E7H A;  4CE9 A;  4B8A B;  5KGW A;  3BGR A;  3PX6 A;  1TKD A;  2PYJ A;  2HVI A;  1L3T A;  3WNG A;  4LD0 A;  1UAX A;  1RNH A;  1D9F A;  4I2P A;  2PZS A;  4FXD A;  2GV9 A;  3LP1 A;  3MED A;  1XI1 A;  3QEP A;  3LPU A;  4Z4C A;  2A1S A;  1HQE A;  3CYM A;  1X9S A;  1WLJ A;  2DFE A;  3ASM A;  3LZI A;  4CJL A;  3ZSR A;  3MAQ A;  1TAQ A;  4CHZ A;  3V9Z A;  3ULD A;  1BCO A;  1LAW A;  4HHT A;  2KFN A;  4B9V A;  3WNE A;  4FM0 A;  3DI6 A;  2G8W A;  3K2P A;  3RMB A;  2BGG A;  3CM5 A;  1HNI A;  3K5M A;  1S1U A;  3PY8 A;  1C1A A;  4CK2 A;  4DS4 A;  1EXQ A;  1TAU A;  4FJ9 A;  3TAF A;  3PV8 A;  4KHY A;  1BCM A;  3KIO A;  5K14 A;  4CEZ A;  4AIL C;  2Y1I A;  1KFS A;  4EP5 A;  3O3G A;  1BIZ A;  3DLH A;  3RMC A;  3VQE A;  1QTM A;  4E0D A;  3V1O A;  3VQ4 A;  3AVG A;  4CIF A;  3OYM A;  3KK3 A;  2XRI A;  4KHU A;  4Y1C A;  1LW2 A;  4M3T A;  1TK8 A;  1KCF A;  3SV4 A;  4CIG A;  1RDB A;  3VQC A;  4KTZ A;  4CK3 A;  5J2N A;  4AHV A;  1CLQ A;  4W5O A;  1TKT A;  1CXQ A;  1KTQ A;  2F96 A;  3WNF A;  3ZT3 A;  1IO2 A;  3SNN A;  2G8V A;  3TWH A;  4NCA A;  3E01 A;  1O1W A;  2ZD1 A;  3NH0 A;  4EZ9 A;  3DOL A;  3D45 A;  3G0Z A;  5KTQ A;  1GOA A;  2FBT A;  2HVH A;  4CGI A;  4KHW A;  4RW9 A;  3A2F A;  3HXM A;  1CZ9 A;  3NBP A;  5CYM A;  3M8R A;  2Z1J A;  1BQN A;  1ZBF A;  1HYV A;  3ISN C;  4E19 A;  3OYN A;  3B6O A;  3SUN A;  1L3U A;  1IKV A;  4O44 A;  4CK1 A;  2P5O A;  3C95 A;  4PWD A;  2WOM A;  2ZQB A;  3IS9 A;  1ASU A;  1BI4 B;  2XO7 A;  1B9D A;  3H08 A;  1NJW A;  1NKC A;  2HNY A;  4E89 A;  1L3V A;  2FBV A;  2RF2 A;  3SJJ A;  4E7K A;  1KLN A;  3LP3 A;  4K8Z A;  3L3V A;  2PY5 A;  3OS0 A;  3TAM A;  4HUE A;  4DU1 A;  3NCI A;  3MXI A;  3IAY A;  4F3O A;  4CF1 A;  1NK8 A;  3VQA A;  3CFO A;  4W5Q A;  4CF0 A;  4DSL A;  1ASW A;  3QIP A;  4CJP A;  1QE1 A;  1RT3 A;  1VSD A;  4DQI A;  1JLB A;  3DLE A;  3HT3 A;  4OLB A;  4B08 A;  4YFU A;  4CIE A;  4MQ3 A;  3VA3 A;  2VWJ A;  2OPP A;  4GW6 A;  1N6Q A;  1J54 A;  4KTW A;  1N5Y A;  4ID1 A;  4QOZ B;  1VSK A;  1T7P A;  1NOZ A;  2ITG A;  1JLF A;  4CCH A;  3OS1 A;  4B9L A;  4I9L A;  1NKE A;  3VQ9 A;  3RMD A;  2FC0 A;  3S3O A;  4OKJ A;  1RBV A;  3TAE A;  4CEC A;  4ZTJ A;  1JLG A;  3MEG A;  1WAF A;  5JS2 A;  1U48 A;  4PA1 A;  1TVR A;  2IOC A;  3UIQ A;  1RT6 A;  1NK9 A;  3DRP A;  4LH5 A;  4OPJ A;  4FJX A;  2B5J A;  1BIS A;  1Z26 A;  3PUF A;  1TV6 A;  4CF9 A;  2YHA A;  3OYD A;  3OJU A;  3KK1 A;  4IFV A;  1EP4 A;  1JLE A;  4OGE A;  4CGJ A;  3KLH A;  1C6V A;  4GVM A;  3ZSQ A;  2ATQ A;  2R7Y A;  4KAZ A;  1S1X A;  4FW1 A;  4FZZ A;  3SUP A;  3LWL A;  4FM2 A;  4FLV A;  2P51 A;  3NF7 A;  2HND A;  3K5O A;  3QIN A;  4N56 A;  1SL1 A;  4IG3 A;  2KTQ A;  3AA2 A;  4ZTF A;  2VWK A;  3PX4 A;  1F21 A;  3NGY A;  1HYZ A;  1TKZ A;  4B8C A;  1RT1 A;  4J2B A;  2GUI A;  3L8B A;  5I3U A;  3LAK A;  3DLR A;  2XY6 A;  5JS1 A;  2DFF A;  3AVB A;  1T8E A;  1BI4 A;  2RN2 A;  4O4G A;  1A5V A;  1KVA A;  2O4G A;  2OPR A;  4FLT A;  2OPQ A;  1VSM A;  3VQQ A;  3DLK A;  1HMV A;  4DFM A;  3TAQ A;  1D5A A;  1WSJ A;  5J1E A;  5T7B A;  4M42 A;  2YV0 X;  3VN5 A;  4KFB A;  3ZSW A;  3V9U A;  1Q9Y A;  3QNO A;  1S9E A;  4F2S A;  2XHB A;  4DTM A;  4Z4E A;  3AVK A;  3TAP A;  2IS3 A;  2DY4 A;  2P1J A;  1Q9X A;  4FM1 A;  1RCH A;  2X74 A;  3ZT0 A;  1J5O A;  3G10 A;  4LH4 A;  1JL2 A;  2O4I A;  3AVH A;  2YHB A;  3F9K A;  2Q3S A;  2X78 A;  2E6L A;  4KTQ A;  1RBU A;  2LSN A;  1XHZ A;  1WAJ A;  2B6A A;  3NDK A;  3F73 A;  3V9S A;  1NJZ A;  3PO4 A;  4FJJ A;  5KRT A;  4FJH A;  2KZZ A;  4CF8 A;  1LW0 A;  1YTA A;  4C8N A;  3P5J A;  4DSE A;  1JXB A;  2D0A A;  4DSI A;  4Y1D A;  4AH9 A;  1VRU A;  2A1R A;  4NCG A;  4CGG A;  1A5W A;  1U04 A;  4LY7 A;  4O0I A;  4FLX A;  1X9M A;  4OLA A;  1QQC A;  3AA5 X;  1TL1 A;  3VQ8 A;  4OPK A;  1B9F A;  3U3G A;  4ELU A;  2FBX A;  2G8U A;  4LSN A;  3LPT A;  1ZBL A;  4E7L A;  4FK4 A;  2YKM A;  5FDL A;  4DFJ A;  1ASV A;  4Z4H A;  4FLZ A;  5FRN A;  4J2D A;  1RT4 A;  5E41 A;  1SUQ A;  1RT7 A;  4J2A A;  1LWE A;  4FJG A;  3NAE A;  4KHS A;  3NGI A;  5CYQ A;  1QSS A;  3NF8 A;  2YNG A;  4CGH A;  2IGI A;  4DTJ A;  5DMR A;  4JRQ A;  4KV8 A;  4CFB A;  4CJT A;  4Q5V A;  3OYH A;  3DRR A;  3HVT A;  4HCC A;  3NF6 A;  3CFP A;  2E4L A;  4OGC A;  4I7F A;  3D0P A;  4DTU A;  4KRE A;  1NK4 A;  2Y1J A;  1FKO A;  3AV9 A;  3MXJ A;  4AHR A;  3TAN A;  1D8Y A;  4C8M A;  3VQ7 A;  3QES A;  2KZM A;  3HPH A;  4OVL A;  4Q0B A;  3EZ5 A;  1NK6 A;  2D0B A;  3HJF A;  3O3H A;  1U4B A;  4KI4 A;  2HHT A;  4FZY A;  4DLG A;  3QNN A;  1VSI A;  2HHV A;  1S5J A;  4W5R A;  4B3O A;  4M3Z A;  1REV A;  3K59 A;  4CJV A;  1WSI A;  1UA0 A;  2HNZ A;  3QEV A;  4CER A;  3NGZ A;  3AVC A;  4UQG A;  3OYG A;  4FVM A;  4KB1 A;  4DTX A;  2XY8 A;  3S3M A;  3RWU A;  2HHX A;  3CFR A;  4DQR A;  2HHW A;  4DFK A;  3ALY A;  4KO0 A;  2Z1G A;  4I2Q A;  5CY4 A;  3FFI A;  4B9N A;  3SQ4 A;  4E7I A;  1SKS A;  1TK5 A;  4DTN A;  4RG8 A;  3OYL A;  3SYZ A;  2G8F A;  4M3Y A;  3CQ8 A;  4C8O A;  4DSF A;  4RW4 A;  3SPZ A;  3IG1 A;  3SZ2 A;  4R5P A;  1J9A A;  1W9H A;  2D5R A;  3KKS A;  4JLH A;  3RRH A;  2OYQ A;  1UWB A;  2GBZ A;  3OS2 A;  4CJ4 A;  1RDC A;  3ZCM A;  4AHS A;  3AVL A;  3OYJ A;  4HUG A;  3SQ0 A;  1SKR A;  4KHN A;  1VSJ A;  2OPS A;  4H4O A;  5FRM A;  1BQM A;  2WON A;  3QER A;  1S1V A;  3VA0 A;  4K8X A;  3HST B;  4KKO A;  4JS4 A;  4QCL A;  3QET A;  4BE1 A;  2DFH A;  3QEX A;  3NFA A;  2BE2 A;  4DF4 A;  4FLW A;  2I5J A;  3M8Q A;  4ZHR A;  4CHY A;  1RDA A;  3M8S A;  3V9X A;  1LV5 A;  3AO1 A;  1GOB A;  3LAL A;  2Z1I A;  3C6T A;  4E3S A;  3SUO A;  3SCX A;  1QHT A;  1ZBU A;  3VQ5 A;  1TKX A;  5J2Q A;  3RRG A;  1JLQ A;  1VSF A;  1SL0 A;  1MU2 A;  2E6M A;  1DLO A;  3QIO A;  3K58 A;  3MXM A;  4FJM A;  3V1Q A;  1NK5 A;  4ELT A;  3I0R A;  3AO2 A;  5HLF A;  4DTP A;  4G1Q A;  4NYN A;  1L5U A;  2KQ2 A;  4FJ7 A;  3QEI A;  2ZE2 A;  4CEA A;  1ZBI A;  3LAN A;  1D9D A;  1BHL A;  1XWL A;  4N76 A;  2HB5 A;  1S6P A;  4CEE A;  4CFD A;  3PX0 A;  3RMA A;  2HHU A;  3OJS A;  1VSH A;  2EHG A;  3VQP A;  3V1R A;  3KLI A;  1NOY A;  4GMJ B;  3LP2 A;  3ZSV A;  4PUO A;  4H8K A;  1KLM A;  4HVJ A;  5J2P A;  4DTO A;  4CHO A;  3HL8 A;  3QEW A;  4ELV A;  4FYD A;  3DYA A;  2HHQ A;  4CHQ A;  3L2U A;  4E1N A;  4ICL A;  3AA3 A;  1RTI A;  3KLF A;  3B6P A;  4O55 A;  1RTJ A;  4N5S A;  2BDP A;  4EP4 A;  2G8K A;  4M45 A;  4BE0 A;  1TK0 A;  1RIL A;  4M3R A;  4B9T A;  1C1C A;  4MFB A;  3KLE A;  2IAJ A;  4IDK A;  3RR7 A;  4KRF A;  5KRS A;  1A5X A;  2D0C A;  1VSL A;  1ZYQ A;  3OYB A;  3V9W A;  2RPI A;  1HNV A;  5HRO A;  2HMI A;  4FJ5 A;  4M41 A;  4F2R A;  4DSK A;  4Z4I A;  5HRN A;  5HP1 A;  4F8R A;  1WN7 A;  3QLH A;  4LSL A;  4DQQ A;  1IG9 A;  5FRO A;  5HRS A;  1NKB A;  4FJI A;  3KTQ A;  5J2M A;  3LDS A;  4BE2 A;  1IH7 A;  5D3G A;  3DRS A;  4E7J A;  4O0J A;  3NE6 A;  1EKE A;  1KVB A;  1VSE A;  4CEQ A;  1NK7 A;  4KB0 A;  4HTU A;  3OYE A;  4CJW A;  1LWF A;  4DTS A;  4M3W A;  3V6D A;  2YNI A;  1NJX A;  2YNH A;  4L8R B;  2F8S A;  3K5L A;  3PO5 A;  1FK9 A;  2EX3 A;  3L2W A;  1BGX T;  3U6F A;  3AVM A;  3ZSZ A;  3AO5 A;  4WE1 A;  4BAC A;  4IKF A;  3HP6 A;  1WSE A;  3AO4 A;  1DTT A;  3LP0 A;  3T3F A;  1RDD A;  2P5G A;  2B4J A;  3AA4 A;  1HQU A;  1RBT A;  3HPG A;  1HRH A;  3AO3 A;  4DLE A;  1XC9 A;  4I9Q A;  4IG0 A;  1QSL A;  1HYS A;  3TAG A;  1DTQ A;  4DG1 A;  4N47 A;  2XY7 A;  2OA8 A;  1NK0 A;  3OVN A;  3HK2 A;  1BIU A;  3P83 D;  3JSM A;  2HHS A;  3O4N A;  3L3U A;  5HRR A;  1X1P A;  1XHX A;  4AHT A;  3DMJ A;  3NHG A;  3SQ1 A;  3HYF A;  4F4K A;  2AJQ A;  1CXU A;  2Z1H A;  4AHC A;  4XIU A;  3HO1 A;  1YVU A;  4M3X A;  1TL3 A;  4H4M A; 
#chains in the Genus database with same CATH topology
 4RW6 A;  2YHY A;  4DU4 A;  3RTV A;  1S1W A;  4M7Y A;  1OKJ A;  3HZ6 A;  1JXE A;  4BR7 A;  3VEV A;  3HM9 A;  3HVR A;  1QQM A;  3WEE B;  4FK0 A;  3EKS A;  5KI6 A;  5AQM A;  4Z4G A;  3R1X A;  3AGR A;  3SBG A;  4F3T A;  3OYI A;  3AVN A;  1ZBH A;  4JS5 A;  1RTD A;  1T03 A;  1JLA A;  3FZK A;  3SMS A;  1OH8 A;  2ZJP L;  3DAW A;  2YNF A;  4JRP A;  1C1B A;  4CJ5 A;  1Y97 A;  1GLJ O;  1KQS M;  3G25 A;  4J8F A;  1UA1 A;  2E1Y A;  4RW8 A;  4Z4F A;  3DLG A;  2X6N A;  2QK9 A;  3C7N B;  3CI5 A;  2WBN A;  3MCA B;  5BR9 A;  4JAX A;  3CM6 A;  3KD5 E;  4BRA A;  3LWM A;  1IKX A;  1SQK A;  3I56 N;  1GLE G;  3DOK A;  3AVF A;  4FOE A;  4CFA A;  1YAG A;  4CHP A;  4LF5 K;  1GLB G;  4DV4 K;  4BWJ A;  4A5A A;  4LF4 K;  4IFY A;  3ZSO A;  1RDW X;  4YOX A;  2HBM A;  4DF8 A;  1N36 K;  1Q86 O;  4N41 A;  3SPY A;  1G15 A;  5HBM A;  2G8H A;  4H5T A;  1U47 A;  3MEE A;  1T44 A;  4DU3 A;  3S9H A;  4OKK A;  4WYB A;  1NGI A;  3AVA A;  1KVC A;  3OYK A;  1WSG A;  2IDO A;  3O3F A;  4CZJ A;  1RT5 A;  3ZSY A;  1NJY A;  2Q1N A;  2P9I A;  4FCY A;  1SV5 A;  5DM7 L;  5M1K A;  1QSY A;  4FL9 A;  3L4I A;  3UB5 A;  4B9S A;  4FK2 A;  1IKW A;  4QS9 A;  2KFZ A;  3OY9 A;  3MMV A;  3VEW A;  3C65 A;  4BRL A;  3LL3 A;  2ZWH A;  4FJ8 A;  3S3N A;  4DV1 K;  4DWI A;  4CEF A;  4CF2 A;  1U49 A;  2O8E A;  3NF9 A;  3CF5 L;  5BRH A;  3ZX2 A;  1Q7Y O;  3CCL N;  3IFR A;  1W7A A;  4B8A B;  5KGW A;  3PX6 A;  3VF6 A;  3CMA N;  2QWN A;  4BR9 A;  3I55 N;  2GV9 A;  4Z4C A;  5JVG L;  3VGK A;  4JKF A;  3FFK B;  5HL7 L;  2DFE A;  3BF3 A;  3MWP A;  2BUP A;  5JMV A;  4CJL A;  4JV5 K;  1LAW A;  4A2B A;  3D2E A;  3J7Z O;  1NGA A;  1HNI A;  3BY5 A;  4GKK K;  1S1U A;  4DS4 A;  2WUS A;  2VWB A;  1TAU A;  1DGK N;  4FJ9 A;  2P9S B;  5K14 A;  4CEZ A;  3MN9 A;  1KFS A;  3Q7C A;  3VQ4 A;  3AVG A;  3K9J A;  4CIF A;  2XRI A;  2NRH A;  1LW2 A;  1KCF A;  3CC7 N;  5E84 A;  3VQC A;  3L0Q A;  2A3Z A;  3O9S A;  2F96 A;  3ZT3 A;  3SNN A;  1O1W A;  2ZD1 A;  1JJ2 M;  1GOA A;  2FBT A;  1BUP A;  1VQO N;  3A2F A;  1XMO K;  5CYM A;  3M8R A;  1ZBF A;  2W41 A;  4K41 A;  3A5O C;  2UUC K;  2P9L B;  4JI1 K;  4O44 A;  1ZBS A;  4CK1 A;  4X65 K;  4DV5 K;  3QFP A;  1YJ9 N;  1BI4 B;  5AQN A;  4BC5 A;  1NJW A;  1NKC A;  2HNY A;  4E89 A;  2ZJR L;  4K42 A;  3C7N A;  4E7K A;  4CBX A;  3IAY A;  1NK8 A;  4GKJ K;  1N33 K;  3EL2 A;  5TKW A;  4I6M A;  3CCM N;  3UKR B;  4DCH A;  4A62 A;  1RT3 A;  3DLE A;  2E5L K;  1FJG K;  2HST A;  2Q0R A;  1NGJ A;  4JK7 A;  1J54 A;  3NVK A;  4Y0W A;  4JEP A;  1S22 A;  3K9K A;  4CCH A;  2Q97 A;  3RMD A;  3KVG A;  2FC0 A;  4OKJ A;  1RBV A;  2YX6 A;  4ZTJ A;  3MEG A;  1D4X A;  2IOC A;  3CCU N;  1NK9 A;  1J6Z A;  3DRP A;  4LH5 A;  4OPJ A;  4DR5 K;  1BIS A;  2B5J A;  1Z26 A;  2YHA A;  4CGJ A;  3MN6 A;  4OGE A;  2W6L A;  1C6V A;  3AY9 A;  3ZSQ A;  3SAF A;  1S1X A;  4FZZ A;  3SUP A;  4FM2 A;  4FLV A;  4IJN A;  3K5O A;  1VQM N;  3PX4 A;  3CIP A;  1F21 A;  4B8C A;  2V7Z A;  2GUI A;  1ATN A;  5C0Y A;  4KH6 A;  3RSE B;  5AQR A;  2XY6 A;  4JK8 A;  4CZM A;  3NMU A;  1BG3 A;  1BI4 A;  2HF3 A;  3E66 A;  2I7P A;  5C2D A;  1HMV A;  4C1N K;  2YV0 X;  3VN5 A;  4V19 S;  3QNO A;  1EO1 A;  4DTM A;  1NBW A;  1EQY A;  1W97 L;  2P1J A;  4B9Q A;  3G10 A;  4LH4 A;  3CQY A;  1JL2 A;  1IBK K;  2YHB A;  2E6L A;  4KTQ A;  4IO9 L;  3KHY A;  2B6A A;  3NDK A;  4FJJ A;  4FJH A;  3O9T A;  4CF8 A;  3D7E O;  3TSP A;  4Y1D A;  3GBT A;  2AP1 A;  1VRU A;  1TYQ B;  3F2K A;  4CGG A;  4LY7 A;  3ZX0 A;  2P9P A;  4OPK A;  1B9F A;  2G8U A;  4LSN A;  3LPT A;  4WFB L;  4E7L A;  4FK4 A;  1P90 A;  5FDL A;  4FLZ A;  5E41 A;  3VMF B;  2IGI A;  4DTJ A;  2D1K A;  4B1U B;  3CFP A;  2E4L A;  3VER A;  3AV9 A;  3ID8 A;  3MXJ A;  4IO8 A;  4C8M A;  3QES A;  4OVL A;  4Q0B A;  3EZ5 A;  1NK6 A;  2ASM A;  2EWS A;  4G9Z A;  4KI4 A;  2UXB K;  3QNN A;  4B3O A;  4DV2 K;  3K59 A;  1UA0 A;  4WFA L;  5AQI A;  5ELZ A;  1HNZ K;  4AM6 A;  3LDL A;  3CFR A;  5AQS A;  4KO0 A;  4I2Q A;  5CY4 A;  5AFU H;  3OYL A;  3J81 O;  4RW4 A;  2QI2 A;  3IG1 A;  2HHH K;  1J9A A;  3THY A;  1UWB A;  2O8D B;  4BG8 A;  4DR1 K;  5AQP A;  5LJV A;  3ZCM A;  3AVL A;  3SQ0 A;  4KHN A;  1GLA G;  1VSJ A;  4MDA A;  1BQM A;  2WON A;  1XQS C;  3QER A;  4KKO A;  4QCL A;  3QET A;  4JKC A;  2E2Q A;  3QEX A;  2BE2 A;  3MX2 A;  4FLW A;  4IJA A;  2QWP A;  4DV6 K;  2E20 A;  4CHY A;  3M8S A;  3LAL A;  1QSS A;  2CGK A;  3ENB A;  5IWA K;  1IG8 A;  4FWS A;  3O9Q A;  1BU6 O;  4EHT A;  4G1Q A;  2OTL N;  4FVU A;  4CEE A;  4CFD A;  4FO0 A;  3OJS A;  2YHW A;  2EHG A;  4B3M K;  3V1R A;  1NOY A;  2GTD A;  4FSV A;  4CZG A;  4GNI A;  4IXC A;  1KLM A;  1WB9 A;  3CJ1 A;  4DTO A;  4ELV A;  5DM6 L;  3A0I X;  1GLD G;  4BRQ A;  4PKG A;  4E1N A;  2NRV A;  3AA3 A;  5BR8 K;  2A5X A;  4PL8 A;  3KLF A;  5GAG P;  4JI8 K;  4EP4 A;  2G8K A;  1HPM A;  3WT0 A;  4JI6 K;  3D2F A;  3CJC A;  2A40 A;  4GY2 B;  2GEM A;  3LDN A;  3OYB A;  1E3M A;  2OAN A;  1HNV A;  4MLH A;  4Z4I A;  5HP1 A;  1WN7 A;  4DQQ A;  4LSL A;  5HRS A;  1NKB A;  3E9P A;  4FJI A;  3QIC A;  4PHT X;  5D3G A;  1IH7 A;  3DRS A;  4O0J A;  4JYA K;  1YXQ A;  3R8E A;  4CJW A;  3THX B;  3V6D A;  3F5T A;  3Q7B A;  2F7T A;  1FK9 A;  2EX3 A;  3AVM A;  3PIO L;  4IKF A;  3D2F B;  3AO4 A;  2P5G A;  3T3F A;  4JKE A;  3GE1 A;  3VEZ A;  1XC9 A;  4I9Q A;  3TAG A;  4N47 A;  3HTV A;  5ADX H;  1RGI A;  3L3U A;  1V4S A;  3DMJ A;  2AJQ A;  4LF9 K;  5AQJ A;  1TK0 A;  1TL3 A;  4U67 L;  1EWR A;  2YHX A;  4CGF A;  5AJ3 K;  5JIC A;  1HPZ A;  3JYT A;  3WXL A;  4DR7 K;  2HBJ A;  4K25 A;  4GVE A;  4PQU A;  4AF1 A;  3A5N C;  3T19 A;  3TAB A;  3EY1 A;  3R3L A;  2WTU A;  4CJ3 A;  1RT2 A;  3KWG A;  3MEC A;  4BC2 A;  4CJS A;  1KSP A;  3G4S N;  3L2R A;  3VQ6 A;  3PLA A;  1JLC A;  2Q31 A;  2OZM A;  4BVO A;  3H3N O;  4BWM A;  3DXK B;  5KQ8 A;  1YJW N;  2PYL A;  4C23 A;  4OJR A;  3FE1 A;  1BL3 A;  4RTF D;  2VG6 A;  4PY5 A;  3TPQ A;  2NRX A;  4CBW A;  3TR8 A;  3KK2 A;  2O8F B;  3FR0 A;  1WSH A;  3L2V A;  4FJK A;  4BC4 A;  3WQT A;  2UUA K;  1S6Q A;  2F9W A;  3K57 A;  1KC8 O;  4FWQ A;  2ITM A;  4FJL A;  4CJK A;  3HBT A;  4OKE A;  3VTI A;  4X64 K;  1ATR A;  4RCH A;  4DQS A;  1EET A;  1VAZ A;  2XY5 A;  4O5F A;  4JI7 K;  4NYF A;  5HRP A;  4DR3 K;  3MX5 A;  2YKN A;  1U45 A;  1KRP A;  5C24 A;  5M1N A;  5A2Q O;  1X9W A;  3L4Q A;  4KPY A;  4CJR A;  3T7Z A;  3AAQ A;  4CGD A;  5AZJ B;  3O6W A;  3OYF A;  1QZ6 A;  4DUY K;  3FGU A;  1UOC A;  4KBO A;  5BPM A;  3DLL L;  5F1X A;  5CZ1 A;  1Q81 O;  4JI5 K;  4DQP A;  4FWR A;  4CI6 A;  3ID6 A;  3O4Q A;  1VQL N;  1J53 A;  4CZL A;  4NCB A;  4CEB A;  2VG5 A;  3DM2 A;  5EY4 A;  4RW7 A;  3NH2 A;  4LFB K;  1NGH A;  1SL2 A;  4CED A;  3I8D A;  3QBX A;  3LAM A;  3RR8 A;  4FZX C;  4QS8 A;  3C94 A;  2RKI A;  1Y64 A;  2VG7 A;  3OYA A;  1W0H A;  3SUQ A;  3AGK A;  5SZT A;  4FLU A;  4BRC A;  5FLX O;  3U9D A;  5TKY A;  4E1M A;  3V4I A;  4BQL A;  4YY3 K;  1LAV A;  2ETJ A;  4JHD B;  1MA9 B;  2OZS A;  3H1Q A;  3TI0 A;  3THV A;  4E7H A;  1TKD A;  2ZGY A;  1I94 K;  1KD1 O;  4LD0 A;  1UAX A;  1RNH A;  3LP1 A;  2IVN A;  3LPU A;  4B1X B;  2A1S A;  3CYM A;  1X9S A;  1WLJ A;  4H0P A;  4MO5 A;  3ASM A;  5AQU A;  5C2F A;  1SAZ A;  3CCJ N;  4CHZ A;  3V9Z A;  2ASO A;  3ZX3 A;  3E9O A;  4B9V A;  2P9L A;  3RSE A;  3WNE A;  4FM0 A;  3DI6 A;  2HMP A;  3CM5 A;  1QZ5 A;  3PY8 A;  1BWF O;  2VGM A;  1VQP N;  4DB3 A;  1XC3 A;  2Q0U A;  4AIL C;  4BRF A;  4EP5 A;  4E0D A;  1QHA A;  3V1O A;  3PIP L;  3SV4 A;  1RDB A;  4CK3 A;  5AQZ A;  1KTQ A;  2G8V A;  1ILY A;  3E01 A;  4EZ9 A;  5KTQ A;  4DV7 K;  3EN9 A;  1CZ9 A;  2ZGZ A;  2Z1J A;  1BQN A;  3PSF A;  4DUZ K;  2ZJQ L;  3B6O A;  3SUN A;  1L3U A;  3LDP A;  2P5O A;  3C95 A;  4PWD A;  1ASU A;  3MN5 A;  5FPD A;  1B9D A;  3EO3 A;  2P9N A;  4BC3 A;  2FBV A;  3ZET A;  3L3V A;  1C0G A;  2NRW A;  4HUE A;  4IDH A;  2I7N A;  3CC4 N;  5BRF A;  3CFO A;  3SBT A;  4DSL A;  3AAR A;  1VQ6 N;  3IDH A;  4OLB A;  4YFU A;  2VYP A;  1X3N A;  2OPP A;  2D0O A;  3CQX A;  4KTW A;  1N5Y A;  4QOZ B;  2O8C A;  1H1V A;  1VSK A;  1T7P A;  1VQN N;  1JLF A;  4B9L A;  2NRR A;  3VQ9 A;  3CCS N;  2O8B B;  3JS6 A;  4E1J A;  3TAE A;  4PKH A;  4ILH A;  4M7X A;  4PA1 A;  1TVR A;  1N8R O;  1OH6 A;  3OBY A;  3UIQ A;  1TUU A;  1YHQ N;  4CF9 A;  3KLH A;  1JLE A;  4KAZ A;  3O08 A;  2R7Y A;  5AR0 A;  4FW1 A;  2D0P A;  5AQT A;  2PFU A;  4ILJ A;  3NF7 A;  1SL1 A;  3QIN A;  2KTQ A;  2WC9 A;  4ZTF A;  2F9T A;  4EIA A;  3NGY A;  1HYZ A;  3GDQ A;  2UU9 K;  3L8B A;  5I3U A;  5BPL A;  3VGL A;  2DFF A;  3AVB A;  1T8E A;  4O4G A;  1A5V A;  1KVA A;  2E2O A;  4JKD A;  2ASP A;  5T7B A;  1ZXO A;  4KFB A;  3ZSW A;  3V9U A;  3RVC A;  5KPT A;  1Q9Y A;  1NNE A;  2IS3 A;  3IMX A;  5EVZ A;  1RCH A;  1J5O A;  3WXK A;  4H5N A;  1MWK A;  5GAE P;  3G71 N;  5AZJ A;  2RE2 A;  4WQ5 A;  4XH1 A;  2KZZ A;  5JLF A;  3TTC A;  4C8N A;  2D0A A;  3C0B A;  4PL7 A;  4R79 A;  1A5W A;  4OLA A;  3J7A P;  5LMN K;  4EFH A;  1BA0 A;  4B3R K;  2YKM A;  4BR5 A;  4DFJ A;  4Z4H A;  5AQL A;  3HOT A;  1RT4 A;  4J2A A;  3CCR N;  1LWE A;  3NAE A;  4BRD A;  4O8U A;  4JI4 K;  3G6E N;  4H0Y B;  4O8K A;  4CGH A;  3P31 A;  5BPN A;  3ATU A;  4CJT A;  4HCC A;  3NF6 A;  4DTU A;  1NK4 A;  1FKO A;  4AHR A;  4NO7 A;  3TAN A;  3IKM A;  3VQ7 A;  1U4B A;  1YVN A;  4FZY A;  1DEJ A;  1GLC G;  4LFC K;  1VQ7 N;  4M3Z A;  4CJV A;  3A8Y A;  2HNZ A;  2CGL A;  3EE9 A;  4CER A;  3NGZ A;  2D4W A;  4UQG A;  3MK6 A;  4DTX A;  2XY8 A;  2A41 A;  3RWU A;  4DFK A;  2Z1G A;  3LM9 A;  3FFI A;  4X66 K;  3SQ4 A;  2QTD A;  4E7I A;  3CQ8 A;  4C8O A;  4YOT A;  4FWP A;  3SPZ A;  3KK7 A;  2FSK A;  3KKS A;  3RRH A;  3O8M A;  5JVH L;  1IBL K;  3OS2 A;  2QXL A;  1RDC A;  1ATS A;  5FPE A;  5I9E B;  5AFU A;  2NRT A;  2OPS A;  2CH5 A;  3HST B;  4JS4 A;  1QQO A;  4CZH A;  1LOT B;  4ZHR A;  2HF4 A;  2HBL A;  1WOQ A;  2VCP A;  3EEQ A;  1D8Y A;  3VGM A;  4E3S A;  1ZBU A;  3OA9 A;  3RRG A;  1JLQ A;  1VSF A;  1SL0 A;  3ATV A;  1YJN N;  3O1B A;  3MWT A;  5IT9 O;  1L5U A;  4JKG B;  5AZI A;  1D9D A;  1XWL A;  4N76 A;  4H5R A;  1VSH A;  3VQP A;  5LMU K;  3KLI A;  1NMN A;  5ADX A;  1Q82 O;  3ZSV A;  4HWI A;  4H8K A;  4HVJ A;  3J8A A;  1HNW K;  3DYA A;  4CHQ A;  4ICL A;  2E1Z A;  3O5B A;  1NGC A;  1RTJ A;  3BZK A;  3VPZ A;  2JWL A;  4XH5 A;  4M3R A;  4B9T A;  4MFB A;  1C1C A;  1KXP A;  3KLE A;  1T3V A;  4KRF A;  4H03 B;  1A5X A;  1ZYQ A;  5AQW A;  2V51 B;  3H45 C;  2RPI A;  1VQ8 N;  2HMI A;  3QLH A;  1IG9 A;  3CCE N;  1YIT N;  4JI0 K;  5FPN A;  4BE2 A;  4E7J A;  3NE6 A;  4KB0 A;  4HTU A;  1NMD A;  4DTS A;  4M3W A;  4JD2 A;  3CME N;  2YNH A;  4L8R B;  2F8S A;  3PO5 A;  1BGX T;  3ZSZ A;  4BAC A;  4HTL A;  1XNQ K;  2UXC K;  4LFA K;  1HQU A;  1RBT A;  1HRH A;  4DG1 A;  2UXD K;  3M3Z A;  3HK2 A;  1BIU A;  1NGD A;  3P83 D;  3O4N A;  3ULE A;  1X1P A;  3VES A;  4FWL A;  4AHT A;  4F4K A;  1K9M O;  4M3X A;  3QB0 A;  2VQF K;  2O8E B;  2QXF A;  1IBM K;  4HUF A;  3DJC A;  2W42 A;  2NNW A;  3M8P A;  3U8X A;  4MO4 A;  3KJV A;  4BDY A;  1SKW A;  4H0V B;  5DK5 A;  1XMQ K;  2JGU A;  1Q8I A;  4C8K A;  2OCE A;  4CJF A;  2UUB K;  4DV0 K;  5F2R A;  3FZF A;  4FWK A;  1R0A A;  4OX9 K;  2HW3 A;  1QVG M;  1JL1 A;  1TUY A;  1WBD A;  5FPM A;  3SV3 A;  1VK0 A;  3HP9 A;  4JKH A;  3VQD A;  4RWT A;  1KFD A;  4FLY A;  2HOE A;  3TAR A;  2BTF A;  1WNS A;  4KHP K;  2FBY A;  4ILG B;  3AVJ A;  4GV6 A;  4B9M A;  1T6D A;  1YT3 A;  4B1Z A;  1HUX A;  1S1T A;  3DXK A;  1NGF A;  1VRT A;  4WQ4 C;  4BRG A;  3JAM O;  1YUW A;  3THY B;  4AM7 A;  4CFC A;  3VQB A;  4CZK A;  1YI2 N;  4CHN A;  3WNH A;  4CEO A;  4O5B A;  4BDP A;  4FJN A;  1C0U A;  3EYZ A;  3M1F A;  2KW4 A;  3OYC A;  3D6R A;  4IWV A;  4DFP A;  1FKP A;  3OTO K;  1I39 A;  3KKR A;  3ITH A;  2HBK A;  5AQV A;  1X3M A;  2YI1 A;  3CG7 A;  3N4P A;  5M1P A;  4B9U A;  4QAG A;  4CJE A;  3T1A A;  4CZE A;  2YJE A;  1TGO A;  4BR0 A;  5I42 A;  5AQG A;  2NUB A;  3SMP A;  3ZT1 A;  2KHO A;  4BDZ A;  4CJQ A;  5E26 A;  5C42 A;  3ENH A;  3TSU A;  5CZ2 A;  3E9L A;  4EZ6 A;  1JKH A;  4ID5 A;  4DS5 A;  1IKY A;  4H4M A;  1GOC A;  2PAV A;  4DSJ A;  3THX A;  2F8T A;  1RTH A;  3DXM A;  2FXU A;  2HVI A;  3VF2 A;  5M1F A;  3WNG A;  4FPA A;  1L3T A;  4I2P A;  4FXD A;  5BRD A;  3MED A;  3S41 A;  5GAD P;  4YDU C;  3LZI A;  3H46 O;  3MAQ A;  3ZSR A;  1TAQ A;  5M1O A;  1HLU A;  1GLL O;  2KFN A;  1BA1 A;  2A6A A;  2G8W A;  1TYQ A;  2BGG A;  3CJ7 A;  3K5M A;  4CK2 A;  1KAZ A;  1EXQ A;  3TAF A;  3PV8 A;  1BCM A;  2Y1I A;  3C6A A;  3O3G A;  1BIZ A;  3DLH A;  3RMC A;  3VQE A;  4WF9 L;  1QTM A;  5AQX A;  4YHH K;  4KHU A;  4M3T A;  1TK8 A;  1JCF A;  1CLQ A;  5J2N A;  1TKT A;  3WNF A;  2DY4 A;  4XEI A;  1IO2 A;  3R6M A;  3DOL A;  3D45 A;  2HVH A;  4CGI A;  3SAG A;  4KHW A;  4RW9 A;  3HXM A;  3NBP A;  4CVN E;  1HYV A;  1Z6R A;  4E19 A;  3P38 A;  4FOI A;  2NRZ A;  1IKV A;  3VEX A;  2WOM A;  3BZC A;  3AAP A;  3IS9 A;  3H08 A;  2P9K A;  3VEY A;  1L3V A;  1FW6 A;  3O1W A;  3O9U A;  1KLN A;  3LP3 A;  4ISF A;  3JXU A;  2PY5 A;  5EXW A;  2GWK A;  3MXI A;  3H3O B;  3NCI A;  4F3O A;  3QFU A;  4CF1 A;  4NLC A;  5M1Q A;  1YIJ N;  4H0O A;  2RHK A;  4W5Q A;  4CF0 A;  1ASW A;  3CPE A;  4CJP A;  1E4G T;  3WXI A;  4DR6 K;  2YCH A;  4DQI A;  4BQZ A;  2CGJ A;  1IV0 A;  3FLC O;  4B08 A;  4MQ3 A;  1N6Q A;  4F9O A;  1NOZ A;  3W0L A;  4B3S K;  1NKE A;  3S3O A;  1K8K B;  1WAF A;  5JS2 A;  3FZL A;  4FJX A;  3KK1 A;  1TV6 A;  4DTP A;  2OTJ N;  4K0K K;  1EP4 A;  4A59 A;  2ATQ A;  2IVP A;  1VQ5 N;  3LWL A;  2P9U A;  4IZ9 A;  3H6E A;  2P51 A;  2HND A;  4N56 A;  3AA2 A;  1HR0 K;  2VWK A;  4DKW A;  2QA4 N;  4A57 A;  1HJO A;  1TKZ A;  1RT1 A;  4J2B A;  3LDO A;  4B3T K;  3DLR A;  4UY8 O;  2GX9 A;  3C6H A;  3TU5 A;  2OPR A;  2OPQ A;  1VSM A;  3DLK A;  4JK9 A;  4DR2 K;  4DFM A;  1WSJ A;  5KPR A;  5J1E A;  4M42 A;  2W40 A;  2QWO A;  3CCQ N;  5CHI A;  3AVK A;  3ZEU A;  1Q9X A;  4FM1 A;  2X74 A;  2UYT A;  1NM1 A;  5KQD A;  2V7Y A;  3GG4 A;  2O4I A;  4B1V A;  3NVM A;  3WXM B;  1YF5 L;  2Q3S A;  1RBU A;  2LSN A;  1XHZ A;  1WAJ A;  4LF6 K;  1G99 A;  3PO4 A;  3F73 A;  2KKZ A;  4OO1 J;  1XNR K;  4YOY A;  3P5J A;  3BF1 A;  1JXB A;  4DSI A;  3CJB A;  4AH9 A;  2A1R A;  4NCG A;  4NXN K;  1U04 A;  4BGB A;  4O0I A;  1TL1 A;  1MWM A;  3EKU A;  3VQ8 A;  1N34 K;  2E88 A;  3ZLJ A;  4ELU A;  2FBX A;  1ZBL A;  1V4T A;  1ASV A;  5FRN A;  4J2D A;  1SUQ A;  1RT7 A;  1ZC6 A;  1HKB A;  1ESV A;  4KHS A;  3NGI A;  2JWK A;  3NF8 A;  2YNG A;  4H5W A;  4JRQ A;  3GL1 A;  3VF4 A;  3OYH A;  3HVT A;  4IOC L;  1HNX K;  4OGC A;  3VOV A;  4FPB A;  4BRI A;  1OH5 A;  2V52 B;  1R59 O;  5C10 A;  1NGB A;  3HJF A;  2HHT A;  2IVO A;  1VSI A;  1QVF M;  4QS7 A;  2HHV A;  4W5R A;  4DV3 K;  1NWK A;  3QEV A;  1HX1 A;  3T1Y K;  3WEE A;  3AVC A;  4BRM A;  3OYG A;  4FVM A;  4I6M B;  4KB1 A;  4LF8 K;  2HHX A;  1OVY A;  4DQR A;  3UE5 A;  4YDU A;  3ALY A;  1M1K O;  3A5L C;  3HM8 A;  1TK5 A;  1DT9 A;  2FLO A;  4M3Y A;  4DSF A;  2H3G X;  4R5P A;  2FSN A;  5BRE A;  2OYQ A;  2GUP A;  2GBZ A;  3CER A;  1SKR A;  1SZ2 A;  4BG9 A;  3GOI A;  3SAH A;  1S1V A;  4K8X A;  2I5J A;  3M8Q A;  3AO1 A;  1GOB A;  3SCX A;  1QHT A;  4K43 A;  3VQ5 A;  1TKX A;  5J2Q A;  4BRE A;  3MXM A;  4FJM A;  4JI3 K;  3V1Q A;  1NK5 A;  3I0R A;  5HLF A;  1JCG A;  4NYN A;  2KQ2 A;  2P9U B;  4JKG A;  3QEI A;  2ZE2 A;  4CEA A;  1MDU B;  1BHL A;  2HB5 A;  4CBU A;  5JLH A;  3RMA A;  2HHU A;  4PUO A;  2P9S A;  3HL8 A;  4FYD A;  2HHQ A;  4LC9 B;  3L2U A;  1O13 A;  1RTI A;  4AQY K;  4O55 A;  2ZM6 K;  1X9J A;  2BDP A;  4PKI A;  1RFQ A;  1RIL A;  3T1H K;  3RR7 A;  2IAJ A;  4IDK A;  2GEL A;  4X62 K;  5LY3 A;  3V9W A;  4LF7 K;  5EX5 A;  3VET A;  5HRO A;  2E2N A;  4M41 A;  3VEN A;  3N4Q A;  4DSK A;  3CD6 N;  5HRN A;  5AQH A;  4F8R A;  5FRO A;  2O8D A;  5J2M A;  2CH6 A;  1KAY A;  3CXC M;  4KHQ A;  1KVB A;  1VSE A;  3OYE A;  4IEE A;  4EAH D;  3HI0 A;  3K5L A;  3BP8 A;  2P9K B;  3U6F A;  3CJ9 A;  1RDD A;  3LDQ A;  3AA4 A;  3HPG A;  4DLE A;  3AO3 A;  2QWR A;  4U7B A;  1QQN A;  3O80 A;  1DTQ A;  2OA8 A;  3J7Y P;  1NK0 A;  3OVN A;  3JSM A;  5GAH P;  1CXU A;  2Z1H A;  3OYM A;  3HPO A;  3I0S A;  1Z25 A;  3U3Y A;  2DTU A;  1HKG A;  1LWC A;  1CZB A;  3IRX A;  3ZT2 A;  1ITG A;  4DMN A;  2X6S A;  4B1W B;  2VGN A;  1K6Y A;  5C12 A;  4BRP A;  4CW7 B;  3CJA A;  4CD3 A;  4A61 A;  2P9I B;  1B92 A;  4WCE L;  2QKK A;  3THW B;  2IC3 A;  5SWM A;  1T05 A;  4JN4 A;  4IOA L;  1HJR A;  1VQ4 N;  4CES A;  3K5N A;  1NG9 A;  4NB4 A;  3ZYY X;  5GIN A;  1C0T A;  4A5B A;  4JHD A;  3KLG A;  4CJU A;  3FZH A;  4L3Q A;  1L3S A;  3O4W A;  1FXX A;  3ZEU B;  1T6C A;  1WBB A;  3AVI A;  2QWQ A;  3DLB A;  1WUA A;  5AQQ A;  5EU7 A;  3ZSX A;  1S72 N;  3BDP A;  2G8I A;  3L2Q A;  5C15 A;  1WSF A;  2WFB A;  1DKG D;  5KGX A;  5KPZ A;  2JLE A;  4YNQ A;  4FW2 A;  2Q36 A;  4IOX A;  2QKB A;  3P1G A;  3S3M A;  1C0M A;  1E4F T;  3SQ2 A;  3V81 A;  2BAN A;  3C6U A;  4AHU A;  1BDG A;  4M3U A;  1NJI O;  1C0F A;  2O8B A;  3DXM B;  4TSX A;  1Z05 A;  3NH1 A;  3QO9 A;  4DTR A;  1I3A A;  4Z0U A;  1RBS A;  4FWO A;  3LZJ A;  3I33 A;  3SI6 A;  3VEO A;  5C25 A;  4YOR A;  4W5N A;  3L6Q A;  4BVP A;  4C8L A;  4KI6 A;  4DHY A;  1EX4 A;  1QS4 A;  4IBN A;  4ISG A;  3KD1 E;  1S9G A;  4W5T A;  4JD2 B;  4FWM A;  4J2E A;  1RBR A;  5B8H A;  4JI2 K;  2BH1 A;  3ZT4 A;  4CE9 A;  2F4V K;  3BGR A;  2PYJ A;  1D9F A;  2PZS A;  3MDQ A;  5F0X A;  1XI1 A;  3QEP A;  1U6Z A;  3WUH A;  1HQE A;  4IEI A;  3SLC A;  4EHU A;  3CPW M;  4BRO A;  3U4L A;  4H5V A;  4GV9 A;  3ULD A;  1BCO A;  4HHT A;  1CZA N;  3K2P A;  5H1S Q;  3RMB A;  4JKB A;  1C1A A;  1VQ9 N;  4KHY A;  1N32 K;  3U9Z A;  3KIO A;  2ZF5 O;  3H1V X;  4YOV A;  3HRG A;  3KK3 A;  4Y1C A;  4CZF A;  1KAX A;  4CIG A;  2VQE K;  4KTZ A;  4AHV A;  4W5O A;  1CXQ A;  3VTH A;  4NCA A;  3TWH A;  4CJ7 A;  3NH0 A;  3BEX A;  3G0Z A;  1LCU A;  3ISN C;  3OYN A;  4MDB A;  3ENO A;  3D2E B;  4YOW A;  2O8C B;  2A42 A;  3P4I A;  2ZQB A;  1U2V A;  2QWL A;  2XO7 A;  2QM1 A;  3TSQ A;  2RF2 A;  3SJJ A;  4K8Z A;  3OS0 A;  3TAM A;  4DU1 A;  3VQA A;  3E1Y A;  4Z94 A;  5MLC Q;  3W3D A;  3QIP A;  4KH5 A;  1QE1 A;  1S3X A;  1VSD A;  1JLB A;  3THW A;  3HT3 A;  5AQO A;  3PSI A;  3ULE B;  4BRK A;  1GLF O;  4CIE A;  3VA3 A;  1U2V B;  2VWJ A;  4GW6 A;  4ID1 A;  5GIO A;  5HOO A;  3OHR A;  2ITG A;  5CR4 A;  3A5M C;  3OS1 A;  4I9L A;  3FZM A;  4CEC A;  1JLG A;  1RT6 A;  4BRH A;  3PUF A;  3OYD A;  3OJU A;  1OH7 A;  1HYS A;  4IFV A;  3UKR A;  4GVM A;  4YOU A;  3B8A X;  1J5E K;  3F9M A;  4IG3 A;  2GWJ A;  3LAK A;  5BN9 A;  5JS1 A;  2RN2 A;  2QWM A;  4FLT A;  2O4G A;  3VQQ A;  3K0S A;  1XUP O;  3TAQ A;  1D5A A;  4GV3 A;  4JKA A;  2QEX N;  5LJW A;  4F2S A;  1S9E A;  2XHB A;  4Z4E A;  1NLV A;  3TAP A;  5EOY A;  3CHW A;  3ZT0 A;  4FWN A;  3AVH A;  3UKU A;  1HKC A;  5AQK A;  4DQ8 A;  3F9K A;  2X78 A;  1K73 O;  3I8B A;  3MCP A;  5AZI B;  3V9S A;  1NJZ A;  2AA4 A;  5KRT A;  1LW0 A;  1YTA A;  2QW9 A;  4DSE A;  3HSC A;  5BN8 A;  4ISE A;  4CD1 A;  4FLX A;  3EE8 A;  1X9M A;  4IFE A;  1QQC A;  3AA5 X;  3HOS A;  3U3G A;  1M90 O;  1BOT O;  2J4R A;  3M6G A;  4FJG A;  4NXM K;  5CYQ A;  4A2A A;  3J80 O;  5DMR A;  1IJJ A;  4KV8 A;  4CFB A;  4Q5V A;  3DRR A;  4I7F A;  3D0P A;  4KRE A;  2Y1J A;  2KZM A;  3HPH A;  2D0B A;  2P9N B;  3O3H A;  2KLA A;  3KZB A;  3O9R A;  4DLG A;  2IIR A;  2YJF A;  3QBW A;  2P9P B;  1S5J A;  5LL6 Z;  1JCE A;  1REV A;  1WSI A;  2E8A A;  2HHW A;  1W2B M;  1P8Z A;  4CZI A;  4WQ4 A;  4B9N A;  1SKS A;  4DTN A;  3TTF A;  4RG8 A;  3SYZ A;  2G8F A;  3UKU B;  3P39 A;  3SZ2 A;  1W9H A;  2D5R A;  4JLH A;  4MLE A;  4OPA A;  4OPH A;  4CJ4 A;  4AHS A;  3OYJ A;  4HUG A;  1NU0 A;  2DPN A;  4H4O A;  5FRM A;  1BO5 O;  3LM2 A;  3VA0 A;  4BE1 A;  2DFH A;  3NFA A;  4BRN A;  4DF4 A;  1LV5 A;  3V9X A;  1RDA A;  1OVQ A;  3SUO A;  2Z1I A;  3C6T A;  1MU2 A;  2E6M A;  1DLO A;  3QIO A;  3K58 A;  3CCV N;  4ELT A;  3AO2 A;  4WQ5 C;  3KWI A;  4BGA A;  3M5R A;  1VHX A;  1VQK N;  4FJ7 A;  1ZBI A;  3LAN A;  3PX0 A;  1S6P A;  4H0T B;  2FF3 B;  4XH4 A;  2Q2R A;  3BUZ B;  4GMJ B;  3LP2 A;  4BR4 A;  2PBD A;  3EZW A;  4M63 C;  5J2P A;  3QML A;  4CHO A;  3QEW A;  1K8K A;  2W6K A;  1SS6 A;  2E2P A;  3B6P A;  2FSJ A;  4N5S A;  3CET A;  4M45 A;  4BE0 A;  3OW2 M;  3DWL A;  2FF6 A;  5KRS A;  2D0C A;  1VSL A;  1RDU A;  5CE3 A;  1K8A O;  3CC2 N;  4FJ5 A;  4F2R A;  4BR2 A;  5AQY A;  5GIP A;  3WXJ A;  4C1N I;  3KTQ A;  3LDS A;  2O8F A;  1EKE A;  1NGE A;  4CEQ A;  1NK7 A;  4H0X B;  1LWF A;  3ZET B;  1Q18 A;  2YNI A;  1NJX A;  1EWQ A;  3MN7 A;  3OBW A;  4WFN L;  4HCB A;  3L2W A;  1YTU A;  1NGG A;  3AO5 A;  4WE1 A;  3R9P A;  4NLB A;  3HP6 A;  1WSE A;  4B1Y B;  1DTT A;  3LP0 A;  3WQU A;  3SJH A;  2B4J A;  2NLX A;  3QDK A;  4KH4 A;  4IG0 A;  1QSL A;  3T69 A;  4BY9 C;  2XY7 A;  2NZT A;  3SK3 A;  4JNE A;  3IUC A;  4DR4 K;  2HHS A;  5HRR A;  1XHX A;  3NHG A;  3SQ1 A;  3HYF A;  4AHC A;  3TTD A;  4XIU A;  1YVU A;  3HO1 A;  1U48 A;  5AQF A; 
#chains in the Genus database with same CATH homology
 2QXF A;  4RW6 A;  3HPO A;  3I0S A;  1Z25 A;  4HUF A;  4CGF A;  3U3Y A;  4DU4 A;  2W42 A;  3JYT A;  1HPZ A;  1S1W A;  3M8P A;  3RTV A;  3KJV A;  4BDY A;  1SKW A;  2DTU A;  4PQU A;  1JXE A;  3T19 A;  1LWC A;  1CZB A;  3IRX A;  5DK5 A;  3ZT2 A;  3TAB A;  2JGU A;  3HM9 A;  1ITG A;  1Q8I A;  3HVR A;  3EY1 A;  4C8K A;  4FK0 A;  4DMN A;  4CJ3 A;  1RT2 A;  2X6S A;  5KI6 A;  3MEC A;  4CJF A;  4CJS A;  1K6Y A;  1KSP A;  3L2R A;  4Z4G A;  3VQ6 A;  1R0A A;  1JLC A;  2OZM A;  4F3T A;  1B92 A;  2QKK A;  4BWM A;  3OYI A;  2IC3 A;  3AVN A;  2HW3 A;  2PYL A;  1ZBH A;  4JS5 A;  4OJR A;  1RTD A;  1JL1 A;  5SWM A;  1BL3 A;  1JLA A;  1T03 A;  2VG6 A;  1T05 A;  4PY5 A;  3KK2 A;  3TR8 A;  2YNF A;  1HJR A;  3SV3 A;  1VK0 A;  3HP9 A;  4CES A;  3VQD A;  3K5N A;  4JRP A;  4BDP A;  1C1B A;  1KFD A;  1WSH A;  4CJ5 A;  1Y97 A;  3L2V A;  4FLY A;  4FJK A;  1C0T A;  1S6Q A;  1UA1 A;  4Z4F A;  4RW8 A;  3K57 A;  3TAR A;  4HCB A;  3DLG A;  4FJL A;  2X6N A;  2QK9 A;  1WNS A;  4CJK A;  3KLG A;  4CJU A;  2FBY A;  4OKE A;  3AVJ A;  3CM6 A;  1L3S A;  3KD5 E;  1FXX A;  4DQS A;  1EET A;  3LWM A;  1IKX A;  2XY5 A;  4B9M A;  3AVI A;  3DLB A;  3DOK A;  3AVF A;  4NYF A;  5EU7 A;  1YT3 A;  3ZSX A;  4CFA A;  5HRP A;  3BDP A;  3L2Q A;  2G8I A;  4CHP A;  2YKN A;  1U45 A;  1KRP A;  1S1T A;  5C24 A;  4KHQ A;  1WSF A;  4BWJ A;  1VRT A;  4IFY A;  3ZSO A;  1X9W A;  5KGX A;  4KPY A;  4CJR A;  4DF8 A;  2JLE A;  4CGD A;  4CFC A;  3VQB A;  4YNQ A;  4FW2 A;  4N41 A;  4CHN A;  3SPY A;  2QKB A;  3P1G A;  1G15 A;  4O5B A;  1C0M A;  5HBM A;  1C0U A;  3WNH A;  4CEO A;  3OYF A;  3EYZ A;  2G8H A;  4FJN A;  3SQ2 A;  1UOC A;  2BAN A;  3V81 A;  1U47 A;  3MEE A;  2KW4 A;  3C6U A;  5CZ1 A;  4DU3 A;  3S9H A;  4AHU A;  4OKK A;  3OYC A;  4M3U A;  4DQP A;  4DFP A;  3AVA A;  1FKP A;  1KVC A;  3O4Q A;  4TSX A;  3OYK A;  1I39 A;  1WSG A;  2IDO A;  3ITH A;  3KKR A;  3NH1 A;  3O3F A;  1J53 A;  4NCB A;  1RT5 A;  3QO9 A;  2VG5 A;  3DM2 A;  3CG7 A;  3ZSY A;  1I3A A;  4CEB A;  4DTR A;  1NJY A;  4B9U A;  4RW7 A;  4QAG A;  4FCY A;  4CJE A;  1SV5 A;  4Z0U A;  3NH2 A;  1SL2 A;  3T1A A;  1QSY A;  4CED A;  3I8D A;  1TGO A;  3LAM A;  1RBS A;  3LZJ A;  5I42 A;  4B9S A;  1IKW A;  2NUB A;  3SI6 A;  3RR8 A;  4FK2 A;  4FZX C;  3C94 A;  1YTU A;  5C25 A;  2KFZ A;  3OY9 A;  2RKI A;  2VG7 A;  3OYA A;  4W5N A;  1W0H A;  3ZT1 A;  3SUQ A;  4BDZ A;  4CJQ A;  4FJ8 A;  5SZT A;  5C42 A;  4FLU A;  4C8L A;  4KI6 A;  1EX4 A;  1QS4 A;  5CZ2 A;  3S3N A;  4IBN A;  4EZ6 A;  1JKH A;  4ID5 A;  4DS5 A;  4DWI A;  4CEF A;  1IKY A;  3KD1 E;  1GOC A;  4CF2 A;  4E1M A;  3V4I A;  1U49 A;  1LAV A;  1S9G A;  2ETJ A;  3NF9 A;  4W5T A;  4DSJ A;  4J2E A;  2OZS A;  1RBR A;  2F8T A;  1RTH A;  3TI0 A;  3THV A;  3ZT4 A;  4E7H A;  4CE9 A;  4B8A B;  5KGW A;  3BGR A;  3PX6 A;  1TKD A;  2PYJ A;  2HVI A;  1L3T A;  3WNG A;  4LD0 A;  1UAX A;  1RNH A;  1D9F A;  4I2P A;  2PZS A;  4FXD A;  2GV9 A;  3LP1 A;  3MED A;  1XI1 A;  3QEP A;  3LPU A;  4Z4C A;  2A1S A;  1HQE A;  3CYM A;  1X9S A;  1WLJ A;  2DFE A;  3ASM A;  3LZI A;  4CJL A;  3ZSR A;  3MAQ A;  1TAQ A;  4CHZ A;  3V9Z A;  3ULD A;  1BCO A;  1LAW A;  4HHT A;  2KFN A;  4B9V A;  3WNE A;  4FM0 A;  3DI6 A;  2G8W A;  3K2P A;  3RMB A;  2BGG A;  3CM5 A;  1HNI A;  3K5M A;  1S1U A;  3PY8 A;  1C1A A;  4CK2 A;  4DS4 A;  1EXQ A;  1TAU A;  4FJ9 A;  3TAF A;  3PV8 A;  4KHY A;  1BCM A;  3KIO A;  5K14 A;  4CEZ A;  4AIL C;  2Y1I A;  1KFS A;  4EP5 A;  3O3G A;  1BIZ A;  3DLH A;  3RMC A;  3VQE A;  1QTM A;  4E0D A;  3V1O A;  3VQ4 A;  3AVG A;  4CIF A;  3OYM A;  3KK3 A;  2XRI A;  4KHU A;  4Y1C A;  1LW2 A;  4M3T A;  1TK8 A;  1KCF A;  3SV4 A;  4CIG A;  1RDB A;  3VQC A;  4KTZ A;  4CK3 A;  5J2N A;  4AHV A;  1CLQ A;  4W5O A;  1TKT A;  1CXQ A;  1KTQ A;  2F96 A;  3WNF A;  3ZT3 A;  1IO2 A;  3SNN A;  2G8V A;  3TWH A;  4NCA A;  3E01 A;  1O1W A;  2ZD1 A;  3NH0 A;  4EZ9 A;  3DOL A;  3D45 A;  3G0Z A;  5KTQ A;  1GOA A;  2FBT A;  2HVH A;  4CGI A;  4KHW A;  4RW9 A;  3A2F A;  3HXM A;  1CZ9 A;  3NBP A;  5CYM A;  3M8R A;  2Z1J A;  1BQN A;  1ZBF A;  1HYV A;  3ISN C;  4E19 A;  3OYN A;  3B6O A;  3SUN A;  1L3U A;  1IKV A;  4O44 A;  4CK1 A;  2P5O A;  3C95 A;  4PWD A;  2WOM A;  2ZQB A;  3IS9 A;  1ASU A;  1BI4 B;  2XO7 A;  1B9D A;  3H08 A;  1NJW A;  1NKC A;  2HNY A;  4E89 A;  1L3V A;  2FBV A;  2RF2 A;  3SJJ A;  4E7K A;  1KLN A;  3LP3 A;  4K8Z A;  3L3V A;  2PY5 A;  3OS0 A;  3TAM A;  4HUE A;  4DU1 A;  3NCI A;  3MXI A;  3IAY A;  4F3O A;  4CF1 A;  1NK8 A;  3VQA A;  3CFO A;  4W5Q A;  4CF0 A;  4DSL A;  1ASW A;  3QIP A;  4CJP A;  1QE1 A;  1RT3 A;  1VSD A;  4DQI A;  1JLB A;  3DLE A;  3HT3 A;  4OLB A;  4B08 A;  4YFU A;  4CIE A;  4MQ3 A;  3VA3 A;  2VWJ A;  2OPP A;  4GW6 A;  1N6Q A;  1J54 A;  4KTW A;  1N5Y A;  4ID1 A;  4QOZ B;  1VSK A;  1T7P A;  1NOZ A;  2ITG A;  1JLF A;  4CCH A;  3OS1 A;  4B9L A;  4I9L A;  1NKE A;  3VQ9 A;  3RMD A;  2FC0 A;  3S3O A;  4OKJ A;  1RBV A;  3TAE A;  4CEC A;  4ZTJ A;  1JLG A;  3MEG A;  1WAF A;  5JS2 A;  1U48 A;  4PA1 A;  1TVR A;  2IOC A;  3UIQ A;  1RT6 A;  1NK9 A;  3DRP A;  4LH5 A;  4OPJ A;  4FJX A;  2B5J A;  1BIS A;  1Z26 A;  3PUF A;  1TV6 A;  4CF9 A;  2YHA A;  3OYD A;  3OJU A;  3KK1 A;  4IFV A;  1EP4 A;  1JLE A;  4OGE A;  4CGJ A;  3KLH A;  1C6V A;  4GVM A;  3ZSQ A;  2ATQ A;  2R7Y A;  4KAZ A;  1S1X A;  4FW1 A;  4FZZ A;  3SUP A;  3LWL A;  4FM2 A;  4FLV A;  2P51 A;  3NF7 A;  2HND A;  3K5O A;  3QIN A;  4N56 A;  1SL1 A;  4IG3 A;  2KTQ A;  3AA2 A;  4ZTF A;  2VWK A;  3PX4 A;  1F21 A;  3NGY A;  1HYZ A;  1TKZ A;  4B8C A;  1RT1 A;  4J2B A;  2GUI A;  3L8B A;  5I3U A;  3LAK A;  3DLR A;  2XY6 A;  5JS1 A;  2DFF A;  3AVB A;  1T8E A;  1BI4 A;  2RN2 A;  4O4G A;  1A5V A;  1KVA A;  2O4G A;  2OPR A;  4FLT A;  2OPQ A;  1VSM A;  3VQQ A;  3DLK A;  1HMV A;  4DFM A;  3TAQ A;  1D5A A;  1WSJ A;  5J1E A;  5T7B A;  4M42 A;  2YV0 X;  3VN5 A;  4KFB A;  3ZSW A;  3V9U A;  1Q9Y A;  3QNO A;  1S9E A;  4F2S A;  2XHB A;  4DTM A;  4Z4E A;  3AVK A;  3TAP A;  2IS3 A;  2DY4 A;  2P1J A;  1Q9X A;  4FM1 A;  1RCH A;  2X74 A;  3ZT0 A;  1J5O A;  3G10 A;  4LH4 A;  1JL2 A;  2O4I A;  3AVH A;  2YHB A;  3F9K A;  2Q3S A;  2X78 A;  2E6L A;  4KTQ A;  1RBU A;  2LSN A;  1XHZ A;  1WAJ A;  2B6A A;  3NDK A;  3F73 A;  3V9S A;  1NJZ A;  3PO4 A;  4FJJ A;  5KRT A;  4FJH A;  2KZZ A;  4CF8 A;  1LW0 A;  1YTA A;  4C8N A;  3P5J A;  4DSE A;  1JXB A;  2D0A A;  4DSI A;  4Y1D A;  4AH9 A;  1VRU A;  2A1R A;  4NCG A;  4CGG A;  1A5W A;  1U04 A;  4LY7 A;  4O0I A;  4FLX A;  1X9M A;  4OLA A;  1QQC A;  3AA5 X;  1TL1 A;  3VQ8 A;  4OPK A;  1B9F A;  3U3G A;  4ELU A;  2FBX A;  2G8U A;  4LSN A;  3LPT A;  1ZBL A;  4E7L A;  4FK4 A;  2YKM A;  5FDL A;  4DFJ A;  1ASV A;  4Z4H A;  4FLZ A;  5FRN A;  4J2D A;  1RT4 A;  5E41 A;  1SUQ A;  1RT7 A;  4J2A A;  1LWE A;  4FJG A;  3NAE A;  4KHS A;  3NGI A;  5CYQ A;  1QSS A;  3NF8 A;  2YNG A;  4CGH A;  2IGI A;  4DTJ A;  5DMR A;  4JRQ A;  4KV8 A;  4CFB A;  4CJT A;  4Q5V A;  3OYH A;  3DRR A;  3HVT A;  4HCC A;  3NF6 A;  3CFP A;  2E4L A;  4OGC A;  4I7F A;  3D0P A;  4DTU A;  4KRE A;  1NK4 A;  2Y1J A;  1FKO A;  3AV9 A;  3MXJ A;  4AHR A;  3TAN A;  1D8Y A;  4C8M A;  3VQ7 A;  3QES A;  2KZM A;  3HPH A;  4OVL A;  4Q0B A;  3EZ5 A;  1NK6 A;  2D0B A;  3HJF A;  3O3H A;  1U4B A;  4KI4 A;  2HHT A;  4FZY A;  4DLG A;  3QNN A;  1VSI A;  2HHV A;  1S5J A;  4W5R A;  4B3O A;  4M3Z A;  1REV A;  3K59 A;  4CJV A;  1WSI A;  1UA0 A;  2HNZ A;  3QEV A;  4CER A;  3NGZ A;  3AVC A;  4UQG A;  3OYG A;  4FVM A;  4KB1 A;  4DTX A;  2XY8 A;  3S3M A;  3RWU A;  2HHX A;  3CFR A;  4DQR A;  2HHW A;  4DFK A;  3ALY A;  4KO0 A;  2Z1G A;  4I2Q A;  5CY4 A;  3FFI A;  4B9N A;  3SQ4 A;  4E7I A;  1SKS A;  1TK5 A;  4DTN A;  4RG8 A;  3OYL A;  3SYZ A;  2G8F A;  4M3Y A;  3CQ8 A;  4C8O A;  4DSF A;  4RW4 A;  3SPZ A;  3IG1 A;  3SZ2 A;  4R5P A;  1J9A A;  1W9H A;  2D5R A;  3KKS A;  4JLH A;  3RRH A;  2OYQ A;  1UWB A;  2GBZ A;  3OS2 A;  4CJ4 A;  1RDC A;  3ZCM A;  4AHS A;  3AVL A;  3OYJ A;  4HUG A;  3SQ0 A;  1SKR A;  4KHN A;  1VSJ A;  2OPS A;  4H4O A;  5FRM A;  1BQM A;  2WON A;  3QER A;  1S1V A;  3VA0 A;  4K8X A;  3HST B;  4KKO A;  4JS4 A;  4QCL A;  3QET A;  4BE1 A;  2DFH A;  3QEX A;  3NFA A;  2BE2 A;  4DF4 A;  4FLW A;  2I5J A;  3M8Q A;  4ZHR A;  4CHY A;  1RDA A;  3M8S A;  3V9X A;  1LV5 A;  3AO1 A;  1GOB A;  3LAL A;  2Z1I A;  3C6T A;  4E3S A;  3SUO A;  3SCX A;  1QHT A;  1ZBU A;  3VQ5 A;  1TKX A;  5J2Q A;  3RRG A;  1JLQ A;  1VSF A;  1SL0 A;  1MU2 A;  2E6M A;  1DLO A;  3QIO A;  3K58 A;  3MXM A;  4FJM A;  3V1Q A;  1NK5 A;  4ELT A;  3I0R A;  3AO2 A;  5HLF A;  4DTP A;  4G1Q A;  4NYN A;  1L5U A;  2KQ2 A;  4FJ7 A;  3QEI A;  2ZE2 A;  4CEA A;  1ZBI A;  3LAN A;  1D9D A;  1BHL A;  1XWL A;  4N76 A;  2HB5 A;  1S6P A;  4CEE A;  4CFD A;  3PX0 A;  3RMA A;  2HHU A;  3OJS A;  1VSH A;  2EHG A;  3VQP A;  3V1R A;  3KLI A;  1NOY A;  4GMJ B;  3LP2 A;  3ZSV A;  4PUO A;  4H8K A;  1KLM A;  4HVJ A;  5J2P A;  4DTO A;  4CHO A;  3HL8 A;  3QEW A;  4ELV A;  4FYD A;  3DYA A;  2HHQ A;  4CHQ A;  3L2U A;  4E1N A;  4ICL A;  3AA3 A;  1RTI A;  3KLF A;  3B6P A;  4O55 A;  1RTJ A;  4N5S A;  2BDP A;  4EP4 A;  2G8K A;  4M45 A;  4BE0 A;  1TK0 A;  1RIL A;  4M3R A;  4B9T A;  1C1C A;  4MFB A;  3KLE A;  2IAJ A;  4IDK A;  3RR7 A;  4KRF A;  5KRS A;  1A5X A;  2D0C A;  1VSL A;  1ZYQ A;  3OYB A;  3V9W A;  2RPI A;  1HNV A;  5HRO A;  2HMI A;  4FJ5 A;  4M41 A;  4F2R A;  4DSK A;  4Z4I A;  5HRN A;  5HP1 A;  4F8R A;  1WN7 A;  3QLH A;  4LSL A;  4DQQ A;  1IG9 A;  5FRO A;  5HRS A;  1NKB A;  4FJI A;  3KTQ A;  5J2M A;  3LDS A;  4BE2 A;  1IH7 A;  5D3G A;  3DRS A;  4E7J A;  4O0J A;  3NE6 A;  1EKE A;  1KVB A;  1VSE A;  4CEQ A;  1NK7 A;  4KB0 A;  4HTU A;  3OYE A;  4CJW A;  1LWF A;  4DTS A;  4M3W A;  3V6D A;  2YNI A;  1NJX A;  2YNH A;  4L8R B;  2F8S A;  3K5L A;  3PO5 A;  1FK9 A;  2EX3 A;  3L2W A;  1BGX T;  3U6F A;  3AVM A;  3ZSZ A;  3AO5 A;  4WE1 A;  4BAC A;  4IKF A;  3HP6 A;  1WSE A;  3AO4 A;  1DTT A;  3LP0 A;  3T3F A;  1RDD A;  2P5G A;  2B4J A;  3AA4 A;  1HQU A;  1RBT A;  3HPG A;  1HRH A;  3AO3 A;  4DLE A;  1XC9 A;  4I9Q A;  4IG0 A;  1QSL A;  1HYS A;  3TAG A;  1DTQ A;  4DG1 A;  4N47 A;  2XY7 A;  2OA8 A;  1NK0 A;  3OVN A;  3HK2 A;  1BIU A;  3P83 D;  3JSM A;  2HHS A;  3O4N A;  3L3U A;  5HRR A;  1X1P A;  1XHX A;  4AHT A;  3DMJ A;  3NHG A;  3SQ1 A;  3HYF A;  4F4K A;  2AJQ A;  1CXU A;  2Z1H A;  4AHC A;  4XIU A;  3HO1 A;  1YVU A;  4M3X A;  1TL3 A;  4H4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...