2G8UA

B. halodurans rnase h catalytic domain d132n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8uA00
3AA3A 3LPUA 4I9QA 3K5NA 4OGCA 4H8KA 2HB5A 1HNIA 4FW1A 3KLHA 1RBVA 4GW6A 4C8NA 1C6VA 1HNVA 1B9FA 1LAVA 4B8CA 1XI1A 3DM2A 4HTUA 3VQ6A 4ELTA 3PUFA 4JRQA 4FZXC 1JLAA 1SL0A 3QIOA 4IFVA 3T3FA 2RKIA 4Z4HA 4DQIA 4CGHA 1B9DA 4KI6A 3LWLA 4FJMA 4LH4A 1ZYQA 4BDPA 4CJFA 3PV8A 4CEAA 3ITHA 2F96A 3TI0A 3F9KA 1WLJA 3D45A 2OPSA 2A1RA 3LPTA 3NF9A 4F2SA 1ZBFA 3OJSA 4DFMA 3TAFA 1KVAA 3QESA 4AH9A 4AHTA 3DRRA 1IO2A 5CZ2A 5SWMA 3CFOA 3AO5A 3L2VA 3FFIA 1YVUA 4R5PA 2PZSA 1RT5A 3C95A 2VWJA 4RW9A 4CJPA 2XY8A 1HJRA 3DYAA 3TARA 2G8FA 2G8WA 4B9VA 3EZ5A 1DTTA 4HUGA 2HHUA 1TGOA 3V9ZA 5KGXA 1NKBA 1ITGA 2OZSA 3WNEA 4FM2A 4FJ7A 4OKKA 3QINA 3OVNA 4KTZA 2QK9A 4KPYA 2ATQA 2YKMA 5J2QA 4KAZA 3E01A 2JGUA 4F8RA 3M8PA 3ZCMA 5EU7A 3DLKA 4B08A 4FLVA 4DS4A 4M42A 2IGIA 3I0SA 5HRSA 1C0TA 1UAXA 1S1VA 2X6SA 3WNHA 4M45A 4CF9A 4NYFA 3T1AA 3V9XA 3K5LA 1X9SA 1NKCA 1NK6A 2HHSA 2GUIA 1LWFA 5KGWA 4DTRA 4CJKA 3SUNA 3QEVA 1VSMA 2D0AA 3AVJA 4WE1A 1LWEA 1T7PA 4O0JA 4UQGA 4J2BA 1ASUA 2HHQA 3HVTA 1JLBA 4ID1A 2QKKA 4EZ6A 2HNDA 4FJ9A 1EP4A 4CK1A 3HO1A 1NJYA 4DQSA 3ZT4A 2FC0A 3ZT0A 3L2RA 4JS5A 3SNNA 2KZMA 1C0UA 1RBTA 1RILA 3OYNA 1EKEA 3HXMA 1L5UA 4H4OA 1WSFA 4HVJA 1QSSA 3KK1A 3U3GA 4N76A 2I5JA 1EETA 3ZT3A 4JRPA 4FJJA 4CJWA 3RMBA 1BQNA 1VSFA 3L2WA 3HT3A 4DU1A 3S3OA 3RWUA 4FVMA 3S9HA 1XWLA 5KRTA 4FLXA 4K8ZA 2HVHA 3PX4A 1CXUA 5DMRA 1LAWA 3O3HA 3LWMA 1QSYA 2F8SA 1J9AA 4KTQA 3QEXA 3NH1A 3LP1A 2GV9A 1Q9YA 4E3SA 3SI6A 4B9NA 3VQPA 1WN7A 1W0HA 4DSEA 1S6QA 4FLUA 3ZSRA 3SV4A 3K57A 3B6PA 1WSEA 1TV6A 4LY7A 5J2MA 4E0DA 3DRPA 4F3OA 3HSTB 4LD0A 4Q5VA 4HCBA 4AILC 4CIGA 4ZTJA 4DSLA 2DFHA 5I3UA 4EZ9A 4FJKA 3BDPA 5FDLA 4B9UA 4CERA 4E7KA 5JS1A 1RBSA 4FLTA 3VQ7A 3THVA 1Q9XA 5C24A 1RTIA 3OYIA 1BCMA 4W5QA 5J2NA 2PYLA 3SZ2A 1CXQA 1LWCA 4FCYA 4QCLA 1KLNA 3KLIA 1T03A 4DTOA 3VQAA 4F2RA 1L3TA 4BDYA 2IOCA 2P51A 3OYEA 4BDZA 4PQUA 1VSHA 5HRPA 3MXIA 3OYMA 1JLFA 3QEIA 3NCIA 1T05A 1W9HA 4JS4A 4Z4FA 3LZJA 2Q3SA 4CJLA 2R7YA 3G10A 3RRGA 1BI4B 4OPKA 3OY9A 1NJZA 3V1OA 4CJVA 3NF8A 2QKBA 1YT3A 4DG1A 3K59A 1NK0A 1FKOA 5SZTA 3SPYA 4KTWA 3VQ8A 4CESA 5C42A 2Z1JA 3AV9A 3AVNA 4DFPA 4KHYA 1C0MA 1N6QA 2YNGA 1NK5A 1KVBA 3ISNC 3PO4A 4CHPA 3QETA 3NGIA 1TKTA 2OPPA 3DLGA 1VSDA 3AO3A 4RG8A 3VQ9A 1QSLA 2P5OA 3VN5A 4FK0A 1Q8IA 2KQ2A 3KK2A 4IG0A 3SUPA 3CM6A 3NF7A 5CZ1A 3AVIA 1ZBLA 2OYQA 4FZZA 4KI4A 5HBMA 3ZT1A 2PY5A 2ITGA 1RT6A 3NAEA 1BIUA 2O4GA 2G8UA 3HJFA 4FZYA 2FBXA 3AVHA 1I3AA 3TAPA 4G1QA 5FRMA 3EY1A 4FLWA 4LSLA 4DQPA 1C1CA 3V1RA 3NE6A 4FM1A 3DLHA 4O4GA 2OZMA 3VQBA 2G8HA 2HHTA 1BQMA 1DLOA 3DLBA 1QQCA 4CHQA 3SPZA 1JKHA 2YHAA 4FW2A 4J2EA 4B9SA 3OYBA 3TWHA 1XHXA 2LSNA 5KRSA 2FBVA 1D8YA 1J53A 3VA0A 3ALYA 4ELVA 1T8EA 2KFNA 1VSEA 1WNSA 4EP4A 3L2UA 1YTAA 4CJQA 4DTXA 1CZ9A 4CIEA 4E7IA 3LZIA 5FRNA 3AVFA 3OS0A 1HMVA 1HYZA 3OS2A 1WAFA 5KTQA 1VSLA 2EX3A 1SKWA 4CCHA 3PY8A 4CJRA 2HHXA 4C8MA 3MXMA 1LW0A 2G8KA 2DY4A 2BE2A 4DQQA 1KRPA 2DTUA 3T19A 4CJSA 1JLCA 1ASWA 1KFDA 1C1AA 4E1MA 4M3ZA 4I2QA 4IBNA 4CGGA 4DS5A 1RTDA 4DWIA 4CF8A 4M3XA 3NFAA 3NHGA 4DU3A 1VRUA 3AVGA 4E89A 1G15A 3ZSOA 1B92A 4KREA 3HP6A 2JLEA 1NOZA 4N47A 2G8VA 4NCAA 3K58A 2FBYA 3V4IA 3CFPA 1A5WA 1RDDA 4DMNA 3ASMA 4CECA 4BE0A 3JYTA 1S9GA 4CIFA 1QHTA 4QAGA 1U49A 3VQQA 1JL1A 4OGEA 5JS2A 3PX0A 4FJ8A 1R0AA 3NH0A 3VQ4A 2A1SA 4PWDA 1U04A 4AHSA 1I39A 1L3UA 1JLQA 1NK4A 4YNQA 1GOAA 4Z0UA 5J1EA 3O3GA 3OYGA 3TAGA 1SKSA 1S1UA 4PY5A 1TL3A 4OKJA 1RT4A 4KFBA 3RR8A 3C6TA 2XY6A 4OLAA 3L3UA 3V9WA 1BL3A 4RW7A 1ZBUA 1KLMA 2IS3A 1F21A 4OKEA 4OLBA 3DLRA 3MEGA 2GBZA 1VRTA 3DMJA 4CHZA 4O5BA 1XHZA 3KIOA 1X9MA 3WNGA 3SUOA 1RT7A 1TL1A 3C6UA 2WONA 2E6LA 2ZQBA 3DOLA 5KI6A 1ZBHA 4Z4CA 3OYCA 4DTSA 4HUFA 4LH5A 4DQRA 4FJGA 3K5OA 2YV0X 3VQ5A 3VA3A 3U3YA 3RMAA 2Z1GA 5HP1A 5CYQA 4DSIA 4KHNA 4M41A 4M3WA 3KLGA 3L3VA 4FK2A 3AA2A 4AHVA 4FK4A 1NKEA 1Y97A 1VSJA 2BANA 4FLYA 2G8IA 4W5NA 2XY5A 4W5RA 3KLEA 3KKSA 4CHYA 1RTJA 1RTHA 5K14A 5DK5A 4EP5A 4ZHRA 4NCBA 2HVIA 4DF4A 1FXXA 1EX4A 3LP3A 3CQ8A 4KKOA 4DF8A 3ZSVA 4I2PA 3CYMA 4CGDA 3AVKA 2P1JA 4AHRA 1TVRA 4FJNA 4Z4EA 4O44A 4HHTA 1RT3A 4CK3A 1S9EA 3BGRA 4KHWA 3LALA 4FYDA 2HW3A 3MECA 3LP0A 4MFBA 2OA8A 4DSJA 4DTJA 1VK0A 2NUBA 2ZD1A 1IKYA 1IKWA 1BIZA 4BE2A 4CEBA 1YTUA 2EHGA 4E1NA 5I42A 3MXJA 4B9MA 4ELUA 4F3TA 1XC9A 2F8TA 3VQDA 4CFDA 2O4IA 1J54A 3HVRA 3F73A 3KK3A 4KHSA 1ZBIA 1UWBA 2HNYA 4CHNA 3O3FA 4AHCA 4CEQA 4CJ4A 1C1BA 2FBTA 3AO1A 3RRHA 1J5OA 3SCXA 1RDBA 3KJVA 1REVA 4N41A 3KKRA 3PX6A 1HRHA 2VWKA 2XO7A 4PUOA 1VSIA 1BGXT 3IG1A 3SJJA 1JL2A 4FXDA 2YNIA 1NOYA 3KTQA 2RN2A 1SKRA 4B9LA 3MEEA 3P83D 4DSFA 5HROA 2ETJA 1N5YA 3SQ2A 1TKDA 3AVBA 4Z4IA 2OPQA 3L2QA 3U6FA 4RW8A 1WSIA 2D0CA 3MEDA 3SV3A 2ZE2A 1WSGA 1WAJA 1L3SA 2XHBA 2XRIA 4GMJB 4CJUA 1HYVA 3RTVA 3SYZA 4BWJA 3M8RA 3AVLA 4B9TA 2D5RA 3P1GA 4CFAA 3OYKA 3TAEA 3AA5X 3LDSA 4ICLA 1U48A 1RDAA 4CEFA 3H08A 4AHUA 1IKXA 4IG3A 1BI4A 2HNZA 3ZSWA 3EYZA 2RPIA 3LAMA 4ID5A 4Y1CA 1TAUA 3S3NA 1D5AA 2HMIA 3QO9A 4N5SA 3OS1A 1EXQA 3QERA 1TK0A 2BGGA 4CFCA 4FJ5A 4CJ3A 3RMCA 3DLEA 4KB1A 1SV5A 4M3UA 4BE1A 1Z25A 3ZT2A 3QIPA 2E6MA 3KD1E 5C25A 3WNFA 4IKFA 4E7LA 3M8SA 1GOCA 3O4NA 4E7HA 1S1WA 1RBUA 4NCGA 3ZSZA 2Y1IA 2BDPA 3V6DA 2AJQA 3V81A 1HQUA 3C94A 3NH2A 2DFEA 1FK9A 4CEZA 3S3MA 4FJHA 1UOCA 4F4KA 3A2FA 3NDKA 3K2PA 4FM0A 4KHUA 4DTPA 1TK5A 2YKNA 3HK2A 3TAMA 2VG5A 1L3VA 4E19A 3D0PA 5HRRA 2QXFA 1HQEA 4CE9A 3OYHA 1NJXA 3L8BA 3TR8A 3ZSYA 3DOKA 4CJ5A 1NK8A 3OYDA 1NK9A 1UA0A 1IG9A 5D3GA 4I7FA 1K6YA 1SL1A 4FJIA 1VSKA 4HCCA 3DRSA 2W42A 4CF2A 1TKZA 4B8AB 3G0ZA 4DLGA 3LANA 4DTNA 1TAQA 3JSMA 4DTMA 2OPRA 2RF2A 4TSXA 1JLGA 4RW4A 3NGYA 4YFUA 3HPOA 3V9SA 4DFKA 3SQ0A 1NK7A 2PYJA 3NF6A 4W5OA 4H4MA 4O0IA 4KB0A 4Z4GA 1DTQA 3V9UA 2HHVA 2HHWA 4CJEA 3MAQA 3IAYA 3DI6A 4CK2A 1BISA 2VG7A 4CGJA 4CF1A 3RR7A 3UIQA 2DFFA 1QE1A 2B4JA 4M3RA 1KCFA 3ULDA 4KHQA 3HL8A 1JLEA 4CF0A 5HLFA 4LSNA 1D9FA 3AO2A 5T7BA 2KW4A 3AVAA 4K8XA 1RCHA 1IKVA 3CM5A 4O55A 4OJRA 3IS9A 3QLHA 4CEDA 4I9LA 2Z1IA 4W5TA 1QS4A 3VQEA 3AO4A 3TANA 4GVMA 3P5JA 3HYFA 3OYJA 1S5JA 1KVCA 3K5MA 4PA1A 2YHBA 3VQCA 3OJUA 3HP9A 4ZTFA 1D9DA 2WOMA 1RT1A 1GOBA 1TK8A 3KD5E 3AVCA 4J2AA 4CGFA 4QOZB 4KRFA 1UA1A 2IDOA 1WSHA 3AA4A 4BACA 3TABA 1RDCA 1IH7A 2YNHA 4Q0BA 1BCOA 4CGIA 3KLFA 2VG6A 1LW2A 3ZSQA 3QEPA 1KFSA 1KTQA 3HPGA 2Z1HA 1CLQA 2B5JA 1NJWA 1U4BA 4N56A 1SL2A 4J2DA 4CHOA 2D0BA 1O1WA 4M3YA 4DFJA 1CZBA 2Y1JA 4CJTA 3I8DA 2KFZA 5CYMA 2KTQA 1HYSA 3OYLA 4HUEA 3B6OA 1MU2A 3O4QA 3OYFA 3AVMA 1JXBA 3HPHA 1U45A 1RBRA 4CEEA 4FLZA 3I0RA 4RW6A 1HPZA 3CFRA 4FJXA 1TKXA 1X9WA 3OYAA 2X6NA 3SQ1A 1WSJA 4DU4A 4C8LA 4L8RB 4JLHA 5J2PA 1KSPA 1ASVA 3QNOA 2X74A 4KO0A 4BWMA 3CG7A 4FJLA 4KV8A 2KZZA 2XY7A 4IDKA 5FROA 3V1QA 4XIUA 5CY4A 2IC3A 4E7JA 4NYNA 1U47A 2P5GA 4B3OA 4CEOA 3NGZA 4C8KA 4MQ3A 4OVLA 1X1PA 5HRNA 2YNFA 3SUQA 1S1XA 4C8OA 4M3TA 3SQ4A 1BHLA 4CFBA 3QEWA 4OPJA 1Z26A 2X78A 3LP2A 4Y1DA 1A5VA 2IAJA 3IRXA 1FKPA 1JXEA 1A5XA 2B6AA 1RT2A 3NBPA 4IFYA 4DTUA 3RMDA 3M8QA 3PO5A 1S1TA 1QTMA 4DLEA 2E4LA 1LV5A 3HM9A 3QNNA 3TAQA 4DSKA 3LAKA 5E41A 1SUQA 1S6PA 3ZSXA 1RNHA
chains in the Genus database with same CATH superfamily
4I9QA 4OGCA 2YJEA 2KKZA 1NGJA 4GW6A 1HNVA 4B8CA 3DM2A 4L3QA 3CCUN 1GLBG 5AQGA 5AQZA 4YOYA 4CGHA 2V7ZA 1OH5A 3LWLA 4FJMA 4LH4A 1ZYQA 1SAZA 3TI0A 3E9PA 5DM7L 5BREA 3LPTA 4OX9K 1ZBFA 3OJSA 3QESA 5CZ2A 3L2VA 1YVUA 5FPMA 1VQMN 2VWJA 3UKUA 2G8FA 5EVZA 3D7EO 4HUGA 2HHUA 1TGOA 5AFUA 3PSIA 5KGXA 3BF3A 2YKMA 4QS7A 4BVOA 3IMXA 3E01A 5J2QA 1XMQK 3M8PA 4KAZA 3CJ7A 3AGRA 3A5MC 4DS4A 5HRSA 1C0TA 4JKCA 3P4IA 3WNHA 1XC3A 4CF9A 1NK6A 3T1AA 3V9XA 4LFAK 5KGWA 3QEVA 4WE1A 1T7PA 2HBJA 4O0JA 2OTJN 3HBTA 4J2BA 2HHQA 4B3MK 4YORA 4H0TB 4IWVA 1QQNA 3SK3A 4JS5A 4RTFD 3I8BA 2WBNA 1RBTA 4NO7A 4YOWA 3BY5A 1WSFA 1MDUB 3E1YA 4BG9A 3MN5A 1VSFA 3RWUA 3S9HA 1OH6A 1XWLA 2HVHA 3LWMA 2F8SA 3NH1A 1YIJN 1BUPA 4GKKK 3H3NO 4B9NA 2E1ZA 1S6QA 4BRMA 3K57A 4C1NI 1TV6A 5J2MA 3R3LA 4F3OA 4LD0A 4HCBA 4AILC 4CIGA 3SBTA 5I3UA 2RHKA 5FDLA 5H1SQ 4E7KA 1RBSA 3VQ7A 3H46O 1RTIA 4W5QA 5J2NA 1LWCA 3KLIA 3TPQA 3L4QA 5KQ8A 4DTOA 3F9MA 4OPAA 3OYEA 4A5AA 3OYMA 3QEIA 2ZGZA 3J7AP 3OY9A 1NJZA 4DG1A 3VGKA 5C42A 4DFPA 4KHYA 2IVPA 4DR6K 4JHDA 3ISNC 4CHPA 5AQIA 1HJOA 4E1JA 1X3NA 3CPWM 1VSDA 1QSLA 2P5OA 3SUPA 4IG0A 2D4WA 3S41A 4FWPA 1NM1A 1BIUA 3HJFA 3WEEA 1YJ9N 4G1QA 5FRMA 3EY1A 4FLWA 2OTLN 3ULEA 2OZMA 4QS9A 5KPZA 4PKHA 1BQMA 2QXLA 3ATVA 1QQCA 4CHQA 3SPZA 2YHAA 3TWHA 4EFHA 2P9KA 3KZBA 3ALYA 4BRIA 4DV2K 2KFNA 1VSEA 1IBMK 3TSUA 3L2UA 2P9IA 1MWKA 3ZETA 3QMLA 3AVFA 1HYZA 3OS2A 3O9QA 1WAFA 2EX3A 4WQ5C 4JI2K 4CJRA 1IV0A 5TKWA 4JK8A 3T19A 1JLCA 4I2QA 4DS5A 4DWIA 4K0KK 2NRVA 3D2FB 3AVGA 3SAFA 1G15A 3ZSOA 3ATUA 3K58A 2P9UB 2FBYA 2UXBK 4LF7K 3CFPA 1A5WA 4FO0A 1NNEA 1LCUA 3VQ4A 1JLQA 1GOAA 4Z0UA 3O3GA 3TAGA 4PY5A 4OKJA 3C6TA 3V9WA 3EZWA 4RWTA 4CJ7A 4RW7A 1KLMA 1F21A 2CH6A 3THYA 3DMJA 4O5BA 1RT7A 2WONA 4Z4CA 1GLEG 4HUFA 3IKMA 4FWRA 5AQPA 1VQNN 4OO1J 2BH1A 4NXNK 4JD2A 4IOAL 3U3YA 5HP1A 5CYQA 4IJAA 4M41A 3P39A 3L3VA 3CC2N 3AA2A 1NKEA 1Y97A 3WUHA 2XY5A 2UUBK 4R79A 4CHYA 4EP5A 5M1FA 3D6RA 1EX4A 3ZSVA 1HNXK 4BR7A 3A5OC 2P9KB 4AHRA 4FJNA 4O44A 2DPNA 1IG8A 2Q2RA 1RT3A 4FWMA 4CK3A 2QWOA 3VF4A 4DSJA 5BPLA 3O4WA 4DTJA 3JS6A 2ZD1A 1YTUA 4KRFA 3GL1A 1VQLN 3HVRA 1ZBIA 4KHSA 3FZFA 3O3FA 5LMNK 2FBTA 3HOTA 1J5OA 3QBXA 2E2PA 3PX6A 2VWKA 4JI3K 2QW9A 3IG1A 3SJJA 3L0QA 1SKRA 3PIOL 4B9LA 3D2FA 4WF9L 3EE8A 2P9PA 2ETJA 1N5YA 1TKDA 3AVBA 1K8KB 3HSCA 1WSIA 4UY8O 1WSGA 2XHBA 1NGCA 1HYVA 3MX2A 3RTVA 1VHXA 3SYZA 4BWJA 2WC9A 5ADXH 2ZJRL 3TAEA 1U48A 4AHUA 1D5AA 1ZBSA 2HMIA 1T44A 1SV5A 4M3UA 4JNEA 4IKFA 3M8SA 4HWIA 3DLLL 1HQUA 3C94A 2FXUA 4AM6A 3NH2A 3MMVA 1CZAN 4FJHA 1ZXOA 4F4KA 2NLXA 4M7YA 4KHUA 3MN6A 4DTPA 4DQ8A 4JD2B 3HK2A 3TAMA 4E19A 4DV3K 3H45C 5HRRA 1HQEA 4CE9A 1NJXA 3L8BA 3ZSYA 3OYDA 1UA0A 2FF3B 3NMUA 1VSKA 3I33A 4C23A 2QWMA 1NBWA 4FWLA 2GWKA 5LJVA 4DTNA 5AQXA 4TSXA 1JLGA 5AQUA 2A5XA 3V9SA 1NK7A 3NF6A 4W5OA 4H4MA 1S22A 4KB0A 4GY2B 1DTQA 2HHVA 3DI6A 1BISA 2QEXN 1GLFO 1JLEA 5HLFA 4X64K 4BR0A 3MN7A 5T7BA 2W6KA 1RCHA 4O55A 4I9LA 2Z1IA 2BTFA 3VQEA 4GVMA 2CGJA 3OYJA 3T1YK 3OJUA 1D9DA 1RT1A 4O5FA 4QOZB 1UA1A 4BRAA 2F7TA 1LW2A 3ZSQA 4CZIA 1KFSA 4BRKA 1TUUA 4N56A 2D0BA 4DCHA 3MWTA 1WBDA 1CZBA 3UKRB 2KFZA 3OYLA 3B6OA 5M1PA 1P90A 1ILYA 3KHYA 3HPHA 3LM9A 2H3GX 5JVGL 1HPZA 5AZJA 3I55N 1KSPA 1ASVA 3C6HA 3QNOA 2X74A 4FJLA 1NGDA 2KZZA 2A3ZA 5HOOA 4CZFA 1HPMA 1X1PA 4C8OA 2A40A 1S1XA 3BF1A 3SQ4A 4LF5K 3QEWA 1BWFO 4BR5A 2X78A 4GKJK 3C7NB 1JXEA 4IFYA 2B6AA 3PO5A 1QTMA 1HUXA 2P9IB 3O5BA 5AQKA 4DLEA 2E4LA 1NU0A 1S6PA 5IWAK 5M1OA 1FW6A 3AA3A 1U2VA 2HB5A 3KLHA 5AQQA 1C6VA 1B9FA 3EEQA 3PUFA 4F9OA 3U9ZA 4IFVA 3T3FA 3I56N 4BRFA 4Z4HA 4KI6A 3M5RA 2Q0RA 4CJFA 3PV8A 4CEAA 4WQ5A 1N8RO 1KAYA 2UUCK 2OPSA 4F2SA 5BN8A 5BPMA 3DRRA 3LDLA 3OW2M 3AO5A 5FLXO 3Q7BA 3DYAA 1NGIA 3O9UA 5I9EB 4H5VA 3V9ZA 4DR1K 1ITGA 3OVNA 4KTZA 5JICA 4KPYA 3KK7A 2VQFK 1ESVA 4B08A 3ZCMA 3DLKA 3I0SA 4FYDA 1UAXA 3QNNA 5JS1A 4NYFA 3K5LA 2HHSA 4LF4K 4V19S 1N34K 3M6GA 5AFUH 4UQGA 1V4SA 2NRWA 1ASUA 1JLBA 4HTLA 3QDKA 1EP4A 2WUSA 3HO1A 5EOYA 4BVPA 3ZT0A 4WFBL 1NGHA 1TUYA 1RILA 4LFBK 3MCAB 4HVJA 2HBMA 3U3GA 4N76A 2I5JA 4LF9K 4FJJA 3RMBA 1BQNA 3WT0A 3HT3A 4DU1A 1KC8O 3PX4A 5DMRA 4JI5K 1QSYA 3VEOA 1J9AA 2F9TA 2NRRA 2D1KA 4ISFA 4PHTX 4E3SA 1WN7A 3Q7CA 4H0PA 3SV4A 4BRLA 2GELA 1E4FT 3HSTB 4JKGB 3TSPA 4I6MA 5GAHP 4ZTJA 4DSLA 5F0XA 1S3XA 1Z6RA 4FJKA 4FLTA 2Q36A 3GDQA 3RSEB 5C24A 2P9PB 3BZKA 3QFPA 2QWQA 2PYLA 1K8KA 4FCYA 4H03B 1L3TA 1RDUA 2IOCA 1VSHA 3A5LC 3MXIA 1Q7YO 4XH4A 3NCIA 1W9HA 4JS4A 1W7AA 2Q3SA 1HKBA 4JKDA 1D4XA 3G4SN 2I7PA 4CJVA 1YT3A 3K59A 1FKOA 3AY9A 1KAZA 5SZTA 2BGGA 3AVNA 3VMFB 4BG8A 3ENHA 1N6QA 2YNGA 3HM8A 5BPNA 4FOEA 2GWJA 3NVKA 1VAZA 1TKTA 4MLEA 4RG8A 4IXCA 4FK0A 5AQYA 2KQ2A 5EX5A 3ZT1A 4B1UB 1RT6A 4B3SK 2RE2A 4FZYA 3EL2A 3TAPA 5BR8K 4DQPA 4DR2K 3NE6A 4FM1A 1DGKN 3DLHA 3O1WA 3DJCA 3VQBA 3M3ZA 3K9KA 1GLJO 4FSVA 1DLOA 1BA0A 2E2OA 3C0BA 4J2EA 4DR7K 3ZX3A 5CE3A 1XHXA 1J53A 4EP4A 1J5EK 1CZ9A 3C65A 4E7IA 3VPZA 3JAMO 3THXB 1XMOK 1VQON 1HMVA 1VSLA 4XH1A 1SKWA 4CCHA 3PY8A 2Q0UA 3TU5A 4ISGA 2P9UA 3CHWA 4B3RK 3FLCO 4DQQA 1KRPA 2DTUA 1YJNN 4CJSA 1KFDA 3CJBA 4YDUA 4PKGA 4CGGA 4WQ4C 5F1XA 1MA9B 3NFAA 4DU3A 1B92A 1NOZA 3HTVA 3EKSA 3CXCM 4BC5A 5B8HA 1MWMA 4WCEL 4CECA 4CIFA 1JL1A 2A1SA 4AHSA 3ID8A 4JI0K 5J1EA 3OYGA 1SKSA 1S1UA 1RT4A 4KFBA 4OLAA 2XY6A 4H5NA 1ZBUA 2IS3A 4OLBA 3DLRA 3MEGA 5AZJB 4CZJA 1NGAA 3VEYA 1VRTA 4IEEA 1QQMA 3WNGA 3SUOA 5CR4A 1TL1A 2E6LA 4H5RA 1ZBHA 3CJ9A 4DB3A 3OYCA 4LH5A 4IDHA 3VA3A 3KWGA 5FPDA 4AHVA 4FK4A 1QVGM 3WQTA 3WXLA 4W5NA 4FLYA 1RTHA 2HVIA 1FXXA 3HRGA 3VERA 1U2VB 4DF8A 1KXPA 3VTIA 3AVKA 3VF6A 4A57A 2W41A 4BREA 3CC7N 3MECA 3MX5A 4KHPK 3CMAN 1VK0A 2NUBA 1BIZA 4BE2A 4CEBA 4F3TA 1QVFM 1YAGA 2O4IA 1U6ZA 3VQDA 3F73A 1RGIA 2JWKA 2UYTA 3QICA 4FOIA 4BROA 2HNYA 4CEQA 4CJ4A 1C1BA 2AA4A 3AO1A 3KJVA 1REVA 1HRHA 1BA1A 1VSIA 4EAHD 3G25A 1NLVA 1NOYA 2RN2A 3DXKA 3KTQA 3MEEA 2W6LA 3TTDA 1JJ2M 1NGEA 3WXIA 3L2QA 4FVUA 5KPRA 3SV3A 3G71N 2ZE2A 1WAJA 1P8ZA 4BRNA 4BC3A 2NRXA 3AVLA 3ENOA 3TSQA 3ULEB 4ICLA 4IJNA 4CEFA 3H08A 3EYZA 3R1XA 3S3NA 3LDQA 2Q31A 3QO9A 4N5SA 5AQTA 4GVEA 3RMCA 4BR2A 1Z25A 3KD1E 5C25A 4IO8A 4E7HA 1S1WA 4NCGA 2BDPA 2AJQA 4DHYA 3OHRA 3L4IA 3S3MA 1TK5A 2YKNA 1L3VA 2QWRA 2PZSA 4KTQA 1IG9A 4H0VB 4I7FA 4JI8K 1SL1A 5EXWA 4HCCA 3DRSA 4YHHK 2W42A 5AZIB 1TKZA 2O8CA 2O8EA 1TAQA 3TTCA 3T69A 2D0OA 4YFUA 3WXJA 3V9UA 3MCPA 2QA4N 1WBBA 5GADP 1E4GT 3UIQA 1QE1A 4KHQA 3E9LA 3CQYA 3HL8A 4CF0A 4LSNA 3AO2A 2KW4A 3AVAA 4K8XA 1IKVA 3O8MA 3A8YA 4LF6K 2A41A 3A5NC 3TANA 3P5JA 3T1HK 4BC2A 1S5JA 2YHBA 4Y0WA 3AAQA 2FSNA 1TK8A 3KD5E 4ILGB 3E66A 2E20A 4PL8A 1WSHA 3AA4A 4B1YB 4Q0BA 1BCOA 4CGIA 3O6WA 3VGMA 2HF4A 4X62K 3CI5A 5KPTA 2ASOA 3OA9A 1HNZK 1CLQA 4CHOA 2HMPA 3OTOK 1O1WA 4M3YA 4CJTA 1DT9A 4X66K 5CYMA 2KTQA 4HUEA 3BZCA 1WB9A 3OYFA 1JXBA 1U45A 1RBRA 4JKHA 3LM2A 1YHQN 3FZKA 4L8RB 2GTDA 3T7ZA 3IUCA 4XIUA 5FROA 4E7JA 1U47A 1Q86O 4DV7K 5F2RA 4OVLA 1N36K 4CVNE 4BR9A 4CFBA 2BUPA 3LP2A 2O8FB 2IAJA 2KHOA 3FE1A 3TTFA 4BRCA 3IRXA 3NBPA 4DTUA 4BC4A 1S1TA 1OVQA 4A59A 3HM9A 5E41A 1SUQA 2JWLA 1RNHA 3RVCA 3QBWA 2GEMA 4H8KA 1BDGA 4YOUA 4FW1A 1RBVA 1LAVA 1XI1A 3FZMA 4HTUA 4ELTA 4JRQA 4FZXC 3QIOA 2W40A 1ATSA 2RKIA 4DQIA 4H5TA 5JMVA 4BRDA 1B9DA 5ADXA 4BGBA 4FWOA 4BRHA 3L6QA 3FGUA 3D45A 4YOXA 3CCSN 1VQ6N 4DFMA 3TAFA 1KVAA 5MLCQ 4MO4A 4AH9A 2O8BA 3MN9A 3THWB 4CJPA 2XY8A 3TARA 2G8WA 1DEJA 3EZ5A 1DTTA 4FM2A 4FJ7A 4OKKA 2QK9A 2ATQA 2PFUA 1XNQK 4F8RA 4M42A 5EU7A 4FLVA 3VA0A 2Q1NA 1S1VA 4M45A 1NKCA 4Z94A 1LWFA 4CJKA 3SUNA 3CC4N 1J6ZA 2V51B 5M1QA 4CZKA 4EZ6A 2HNDA 4CK1A 3BEXA 1NJYA 2FC0A 3SNNA 4CW7B 5DM6L 2ZM6K 3UB5A 3LDOA 4CZGA 4BQLA 1QSSA 3KK1A 3J7ZO 4DR3K 1EETA 3ZT3A 5BRDA 3S3OA 4FVMA 4JK7A 4FLXA 2QI2A 1LAWA 1R59O 5JLHA 3RSEA 5LY3A 3C6AA 3H1VX 3VQPA 4DSEA 4FLUA 3B6PA 4LY7A 3DRPA 1YXQA 1JCEA 4EZ9A 3N4QA 3BDPA 3DXKB 2QWNA 1M1KO 5AQWA 1OKJA 1QZ5A 3OYIA 3P38A 3P31A 3SZ2A 4QS8A 4QCLA 2WFBA 4BY9C 3HZ6A 4EHTA 1KD1O 4BDYA 1VQ9N 5HRPA 4CBXA 4Z4FA 4JV5K 4ILJA 3G10A 3RRGA 2VCPA 2QKBA 3NF8A 4A5BA 2ZGYA 4GV6A 3SAHA 4KTWA 2GUPA 4CESA 1HKCA 2Z1JA 3C7NA 3VQ8A 5AQMA 4FWKA 2GX9A 3PO4A 1T6CA 3QETA 3NGIA 5TKYA 2OPPA 3DLGA 2OCEA 3VQ9A 3VN5A 4M63C 3KK2A 2OYQA 3NF7A 4FZZA 4KI4A 4CD3A 2PY5A 2G8UA 3AVHA 1I3AA 4K43A 4LSLA 4NXMK 4O4GA 2G8HA 3THXA 3SJHA 3PLAA 2HHTA 5AQOA 2UUAK 5AJ3K 1XNRK 1BO5O 1RDWX 4LF8K 3EN9A 3SAGA 1D8YA 2FBVA 4ELVA 2YI1A 2VGMA 3EKUA 5C2FA 4DTXA 4IZ9A 4B1WB 4CIEA 3LZIA 5FRNA 4WYBA 1IBLK 3CCLN 4U7BA 2YHWA 3CCJN 4C8MA 3MXMA 2G8KA 2DY4A 4RCHA 1ASWA 4E1MA 2HSTA 3H1QA 1YUWA 3CCRN 4CF8A 3NHGA 1VRUA 4E89A 2ZWHA 4KREA 3HP6A 1X3MA 2A6AA 2JLEA 4WFAL 2F4VK 3V4IA 4YOVA 1RDDA 3OBWA 3ASMA 3JYTA 1S9GA 3F5TA 4QAGA 1Y64A 4OGEA 3PX0A 1R0AA 3NH0A 4DV0K 4PWDA 2ZF5O 4B9QA 1L3UA 3SBGA 4YNQA 2E8AA 1GLLO 1TL3A 3RR8A 3L3UA 5GAGP 1TYQB 4EIAA 4OKEA 4A2AA 2GBZA 1XHZA 3CJ1A 3KIOA 3C6UA 3DOLA 5KI6A 4A61A 3DAWA 3CIPA 3J80O 4DTSA 1C0FA 3SMPA 4FJGA 3GBTA 3RMAA 3VQ5A 4M3WA 4KHNA 4FPAA 3QB0A 3KLGA 4FK2A 1VQKN 1VSJA 2BANA 4JYAK 4I6MB 4JKBA 4LC9B 5K14A 4NCBA 4ZHRA 3J81O 4DF4A 1DKGD 3LP3A 2D0PA 3CD6N 2HBKA 4IO9L 4U67L 3CYMA 4CGDA 2P1JA 1TVRA 4Z4EA 4DV5K 1NGBA 4KHWA 3LALA 3LP0A 2OA8A 4B9MA 3MXJA 1XC9A 4CFDA 1WUAA 4BQZA 1J54A 2E88A 1NWKA 4JI1K 5JVHL 1UWBA 3GE1A 4IEIA 4CI6A 3RRHA 1RDBA 1YF5L 1BG3A 3J7YP 2XO7A 5FPNA 4PUOA 1BGXT 1JL2A 2YNIA 3VF2A 3MDQA 2HBLA 5C0YA 2OPQA 3U6FA 3MEDA 3AARA 1FJGK 1L3SA 5ELZA 2D5RA 3OYKA 2E2NA 2YCHA 4A62A 3G6EN 3FFKB 3CJAA 4IG3A 1BI4A 1EQYA 3LAMA 4ID5A 4MDAA 4DKWA 3OS1A 1TK0A 1T3VA 4FJ5A 4KB1A 1TYQA 3ZT2A 3QIPA 2E6MA 2P9LA 3E9OA 4E7LA 3LL3A 1RBUA 2Y1IA 2DFEA 1FK9A 4CEZA 4BR4A 2Q97A 4B1XB 2HOEA 4FM0A 3K2PA 4H5WA 3O9RA 2VG5A 1Z05A 3D0PA 2QXFA 2VQEK 3DOKA 1NK8A 1NK9A 5D3GA 2O8DA 1K6YA 4IOXA 4JKEA 4KBOA 4CF2A 1SZ2A 3G0ZA 4DLGA 2UXCK 1NMDA 3JSMA 1O13A 4DTMA 4WFNL 2OPRA 2FF6A 4RW4A 3NGYA 3HPOA 2PYJA 2HHWA 1V4TA 5AQFA 3D2EA 4Z4GA 4CJEA 3IAYA 4M7XA 2VG7A 3B8AX 3RR7A 3CQXA 3N4PA 2DFFA 4YOTA 3ULDA 4JI7K 3FZLA 2QM1A 1D9FA 4M3TA 4OJRA 3IS9A 3QLHA 4W5TA 3U9DA 4JAXA 1QS4A 3A0IX 2YHYA 1N33K 2PAVA 3MK6A 3HP9A 3VQCA 4ZTFA 2WOMA 3QFUA 3AVCA 4CGFA 4DV4K 2IDOA 2FLOA 2J4RA 3TABA 3QEPA 3VENA 3HPGA 2Z1HA 1NJWA 4O8KA 5JLFA 3KWIA 4DFJA 4FPBA 3I8DA 2P9SA 4NLBA 1HYSA 3O4QA 4FL9A 4FWSA 4PL7A 3ZLJA 3CCVN 4DUYK 4FLZA 4RW6A 5CHIA 4K25A 1X9WA 3O9TA 2X6NA 3SQ1A 4DU4A 4C8LA 4JLHA 5E26A 4BWMA 3CG7A 4LFCK 4KV8A 1W2BM 3F2KA 4IDKA 2P9NA 5CY4A 4CEOA 3CJCA 3NGZA 2UU9K 4JKFA 4C8KA 5C10A 5C15A 4IOCL 5HRNA 1BHLA 4OPJA 3M1FA 4Y1DA 3RMDA 1RT2A 3M8QA 4YY3K 1LV5A 4DSKA 5GIPA 1Q81O 3LAKA 1XQSC 4YDUC 1G99A 1I94K 2O8DB 3LPUA 2EWSA 3K5NA 5BRFA 1HNIA 3K9JA 1JCFA 4C8NA 1OVYA 5AQSA 3VQ6A 1JLAA 1SL0A 4KH4A 3D2EB 4BRQA 1HX1A 5C12A 4MLHA 1VQPN 1S72N 2FSKA 3R9PA 4BDPA 3ITHA 2F96A 1XUPO 3F9KA 1WLJA 1SS6A 2CGKA 4EHUA 2A1RA 3NF9A 3NVMA 4AHTA 1IO2A 2VYPA 5SWMA 3CFOA 4MDBA 3FFIA 4R5PA 1RT5A 3C95A 4JKAA 4RW9A 4DV1K 1HJRA 5A2QO 4B9VA 3O08A 1NKBA 4DR5K 2OZSA 1QQOA 3WNEA 3O80A 3QINA 2E2QA 5BN9A 1N32K 4FWQA 2JGUA 2IGIA 3JXUA 2X6SA 1X9SA 4XEIA 1OH8A 3AGKA 1H1VA 1NMNA 2GUIA 4DTRA 1VSMA 2D0AA 3AVJA 5AQRA 1LWEA 1YVNA 3LDPA 5AZIA 4AF1A 2CGLA 2O8CB 5AQVA 2O8EB 3HVTA 4ID1A 2QKKA 5E84A 4B3TK 4FJ9A 1VQ7N 4DQSA 4BRPA 3ZT4A 3SMSA 3L2RA 2KZMA 1C0UA 3OYNA 1EKEA 3HXMA 1L5UA 4H4OA 1EO1A 2I7NA 4JRPA 3THYB 4CJWA 3L2WA 3ZYYX 2YX6A 5KRTA 4BGAA 4K8ZA 3GOIA 3CCEN 1NG9A 1CXUA 3O3HA 3QEXA 3LP1A 2PBDA 2GV9A 2V52B 1Q9YA 3SI6A 1W0HA 3ZSRA 4H0YB 3VEWA 3ZX0A 4A2BA 1WSEA 4E0DA 3ENBA 4Q5VA 1VQ4N 2DFHA 4B9UA 4CERA 4CZMA 3THVA 1Q9XA 4JI6K 1BCMA 2E5LK 3WXKA 1CXQA 1KLNA 1T03A 3WXMB 1K73O 3VQAA 4F2RA 2P51A 4BDZA 5AQJA 3IDHA 1JLFA 1EWQA 1T05A 3W0LA 3LZJA 4CJLA 2R7YA 1BI4B 2ITMA 4OPKA 4AM7A 3HI0A 3V1OA 1SQKA 3ID6A 1NK0A 1BU6O 4C1NK 3BP8A 3SPYA 4PQUA 2O8FA 3AV9A 5AQHA 5LJWA 1C0MA 1NK5A 1KVBA 1HKGA 3IFRA 3AO3A 1BOTO 1Q8IA 3CM6A 1QHAA 5CZ1A 3AVIA 1ZBLA 1YITN 3DXMB 5HBMA 2ITGA 3NAEA 2O4GA 1RFQA 5M1KA 1ZC6A 2FBXA 4JI4K 4JHDB 3LDNA 4H0OA 1C1CA 3V1RA 4CBUA 3R6MA 3VETA 1QZ6A 1NGFA 3DLBA 3CETA 1JKHA 4FW2A 2ASPA 4B9SA 3OYBA 2LSNA 5GAEP 5KRSA 2ZJQL 1T8EA 1K9MO 1M90O 1WNSA 4CZLA 1YTAA 4CJQA 5IT9O 3EO3A 2NRZA 2O8BB 3VGLA 3OS0A 5KTQA 3UE5A 3THWA 1VQ5N 2IVOA 3DWLA 2HHXA 1LW0A 2YHXA 2BE2A 1OH7A 1IJJA 4M3ZA 1C1AA 4IBNA 1RTDA 4M3XA 1W97L 4GV9A 4N47A 2G8VA 4NCAA 3BUZB 4DMNA 3SLCA 4BE0A 1QHTA 1E3MA 1U49A 3VQQA 4FJ8A 1GLCG 5JS2A 1NJIO 1U04A 2NRHA 4GNIA 1I39A 5KQDA 2P9SB 1NK4A 3UKUB 3CPEA 1BL3A 4PKIA 3FZHA 4OPHA 4CHZA 1X9MA 2V7YA 3VESA 3EE9A 4H0XB 4AQYK 4B1ZA 2QWLA 2ZQBA 4CZHA 5HL7L 3O1BA 3OBYA 4NB4A 1HNWK 5EY4A 1Q18A 2IVNA 4X65K 3R8EA 4CBWA 4DUZK 1C0GA 4DQRA 2F9WA 3K5OA 3DXMA 2YV0X 2Z1GA 4DSIA 2G8IA 3FR0A 2E1YA 2ZJPL 4W5RA 3KLEA 5AR0A 3KKSA 1RTJA 5DK5A 4FWNA 2KLAA 3HOSA 3CQ8A 1X9JA 4KKOA 3U4LA 2FSJA 3ZX2A 3VTHA 2QTDA 4I2PA 5M1NA 2HHHK 3CF5L 1NGGA 4HHTA 5BR9A 2CH5A 1S9EA 4CZEA 1IBKK 3BGRA 2HW3A 4MFBA 1IKYA 1IKWA 2AP1A 2EHGA 4J8FA 4E1NA 5I42A 4ELUA 2F8TA 3KK3A 4KH5A 2IIRA 4CHNA 4AHCA 1WOQA 2NRTA 1T6DA 4CD1A 3SCXA 1Q82O 4N41A 3KKRA 1HR0K 4FXDA 4KH6A 3P83D 4DSFA 3KVGA 4ISEA 5HROA 3SQ2A 4Z4IA 4RW8A 2D0CA 2XRIA 4GMJB 4CJUA 4GV3A 4JEPA 3M8RA 2P9LB 4B9TA 3P1GA 4CFAA 4ILHA 3AA5X 3LDSA 1RDAA 3H3OB 1IKXA 4K41A 2HNZA 3ZSWA 3O9SA 2RPIA 4Y1CA 1KAXA 1TAUA 3WQUA 5GIOA 3GG4A 3QERA 1EXQA 4CFCA 4CJ3A 3DLEA 1HLUA 1ATNA 4BE1A 4NLCA 2A42A 3WNFA 3PIPL 3CCQN 1GOCA 3O4NA 3ZSZA 3V6DA 3CMEN 5BRHA 3V81A 1K8AO 3U8XA 1UOCA 3A2FA 3ZEUB 3NDKA 5AQLA 3WEEB 2VWBA 3OYHA 3TR8A 4CJ5A 2NZTA 1JCGA 4O8UA 4FJIA 2QWPA 2HF3A 3K0SA 4B8AB 5LMUK 3LANA 2RF2A 3ZETB 2YJFA 3PSFA 4DFKA 3SQ0A 5GINA 4O0IA 1GLAG 3MAQA 4CK2A 4CGJA 4CF1A 2B4JA 4M3RA 1KCFA 4G9ZA 5FPEA 3AAPA 5AQNA 3CCMN 4DR4K 3CM5A 4CEDA 4JK9A 3AO4A 3HYFA 2VGNA 1KVCA 3K5MA 4PA1A 4DV6K 2OANA 1GOBA 4J2AA 2ASMA 2WTUA 3VOVA 4BACA 1RDCA 1IH7A 2YNHA 5LL6Z 3KLFA 2VG6A 4WQ4A 4B1VA 1KTQA 2UXDK 2B5JA 1U4BA 4JKGA 1SL2A 4J2DA 1ATRA 3H6EA 2Y1JA 3VEZA 4K42A 2P9NB 4IFEA 4XH5A 1MU2A 3J8AA 3AVMA 1VQ8N 3W3DA 4CEEA 3I0RA 3CFRA 4FJXA 1TKXA 1KQSM 3OYAA 1WSJA 5J2PA 4BRGA 4KO0A 3UKRA 2XY7A 3V1QA 2IC3A 2P5GA 4NYNA 4B3OA 2NNWA 4MQ3A 1EWRA 3SUQA 2YNFA 4MO5A 5C2DA 1Z26A 1YI2N 3ZEUA 1A5VA 4JN4A 1FKPA 1YJWN 1A5XA 3VEXA 3CERA 1LOTB 1GLDG 3MWPA 3TAQA 3VEVA 3ZSXA
chains in the Genus database with same CATH topology
3AA3A 3LPUA 4I9QA 3K5NA 4OGCA 4H8KA 2HB5A 1HNIA 4FW1A 3KLHA 1RBVA 4GW6A 4C8NA 1C6VA 1HNVA 1B9FA 1LAVA 4B8CA 1XI1A 3DM2A 4HTUA 3VQ6A 4ELTA 3PUFA 4JRQA 4FZXC 1JLAA 1SL0A 3QIOA 4IFVA 3T3FA 2RKIA 4Z4HA 4DQIA 4CGHA 1B9DA 4KI6A 3LWLA 4FJMA 4LH4A 1ZYQA 4BDPA 4CJFA 3PV8A 4CEAA 3ITHA 2F96A 3TI0A 3F9KA 1WLJA 3D45A 2OPSA 2A1RA 3LPTA 3NF9A 4F2SA 1ZBFA 3OJSA 4DFMA 3TAFA 1KVAA 3QESA 4AH9A 4AHTA 3DRRA 1IO2A 5CZ2A 5SWMA 3CFOA 3AO5A 3L2VA 3FFIA 1YVUA 4R5PA 2PZSA 1RT5A 3C95A 2VWJA 4RW9A 4CJPA 2XY8A 1HJRA 3DYAA 3TARA 2G8FA 2G8WA 4B9VA 3EZ5A 1DTTA 4HUGA 2HHUA 1TGOA 3V9ZA 5KGXA 1NKBA 1ITGA 2OZSA 3WNEA 4FM2A 4FJ7A 4OKKA 3QINA 3OVNA 4KTZA 2QK9A 4KPYA 2ATQA 2YKMA 5J2QA 4KAZA 3E01A 2JGUA 4F8RA 3M8PA 3ZCMA 5EU7A 3DLKA 4B08A 4FLVA 4DS4A 4M42A 2IGIA 3I0SA 5HRSA 1C0TA 1UAXA 1S1VA 2X6SA 3WNHA 4M45A 4CF9A 4NYFA 3T1AA 3V9XA 3K5LA 1X9SA 1NKCA 1NK6A 2HHSA 2GUIA 1LWFA 5KGWA 4DTRA 4CJKA 3SUNA 3QEVA 1VSMA 2D0AA 3AVJA 4WE1A 1LWEA 1T7PA 4O0JA 4UQGA 4J2BA 1ASUA 2HHQA 3HVTA 1JLBA 4ID1A 2QKKA 4EZ6A 2HNDA 4FJ9A 1EP4A 4CK1A 3HO1A 1NJYA 4DQSA 3ZT4A 2FC0A 3ZT0A 3L2RA 4JS5A 3SNNA 2KZMA 1C0UA 1RBTA 1RILA 3OYNA 1EKEA 3HXMA 1L5UA 4H4OA 1WSFA 4HVJA 1QSSA 3KK1A 3U3GA 4N76A 2I5JA 1EETA 3ZT3A 4JRPA 4FJJA 4CJWA 3RMBA 1BQNA 1VSFA 3L2WA 3HT3A 4DU1A 3S3OA 3RWUA 4FVMA 3S9HA 1XWLA 5KRTA 4FLXA 4K8ZA 2HVHA 3PX4A 1CXUA 5DMRA 1LAWA 3O3HA 3LWMA 1QSYA 2F8SA 1J9AA 4KTQA 3QEXA 3NH1A 3LP1A 2GV9A 1Q9YA 4E3SA 3SI6A 4B9NA 3VQPA 1WN7A 1W0HA 4DSEA 1S6QA 4FLUA 3ZSRA 3SV4A 3K57A 3B6PA 1WSEA 1TV6A 4LY7A 5J2MA 4E0DA 3DRPA 4F3OA 3HSTB 4LD0A 4Q5VA 4HCBA 4AILC 4CIGA 4ZTJA 4DSLA 2DFHA 5I3UA 4EZ9A 4FJKA 3BDPA 5FDLA 4B9UA 4CERA 4E7KA 5JS1A 1RBSA 4FLTA 3VQ7A 3THVA 1Q9XA 5C24A 1RTIA 3OYIA 1BCMA 4W5QA 5J2NA 2PYLA 3SZ2A 1CXQA 1LWCA 4FCYA 4QCLA 1KLNA 3KLIA 1T03A 4DTOA 3VQAA 4F2RA 1L3TA 4BDYA 2IOCA 2P51A 3OYEA 4BDZA 4PQUA 1VSHA 5HRPA 3MXIA 3OYMA 1JLFA 3QEIA 3NCIA 1T05A 1W9HA 4JS4A 4Z4FA 3LZJA 2Q3SA 4CJLA 2R7YA 3G10A 3RRGA 1BI4B 4OPKA 3OY9A 1NJZA 3V1OA 4CJVA 3NF8A 2QKBA 1YT3A 4DG1A 3K59A 1NK0A 1FKOA 5SZTA 3SPYA 4KTWA 3VQ8A 4CESA 5C42A 2Z1JA 3AV9A 3AVNA 4DFPA 4KHYA 1C0MA 1N6QA 2YNGA 1NK5A 1KVBA 3ISNC 3PO4A 4CHPA 3QETA 3NGIA 1TKTA 2OPPA 3DLGA 1VSDA 3AO3A 4RG8A 3VQ9A 1QSLA 2P5OA 3VN5A 4FK0A 1Q8IA 2KQ2A 3KK2A 4IG0A 3SUPA 3CM6A 3NF7A 5CZ1A 3AVIA 1ZBLA 2OYQA 4FZZA 4KI4A 5HBMA 3ZT1A 2PY5A 2ITGA 1RT6A 3NAEA 1BIUA 2O4GA 2G8UA 3HJFA 4FZYA 2FBXA 3AVHA 1I3AA 3TAPA 4G1QA 5FRMA 3EY1A 4FLWA 4LSLA 4DQPA 1C1CA 3V1RA 3NE6A 4FM1A 3DLHA 4O4GA 2OZMA 3VQBA 2G8HA 2HHTA 1BQMA 1DLOA 3DLBA 1QQCA 4CHQA 3SPZA 1JKHA 2YHAA 4FW2A 4J2EA 4B9SA 3OYBA 3TWHA 1XHXA 2LSNA 5KRSA 2FBVA 1D8YA 1J53A 3VA0A 3ALYA 4ELVA 1T8EA 2KFNA 1VSEA 1WNSA 4EP4A 3L2UA 1YTAA 4CJQA 4DTXA 1CZ9A 4CIEA 4E7IA 3LZIA 5FRNA 3AVFA 3OS0A 1HMVA 1HYZA 3OS2A 1WAFA 5KTQA 1VSLA 2EX3A 1SKWA 4CCHA 3PY8A 4CJRA 2HHXA 4C8MA 3MXMA 1LW0A 2G8KA 2DY4A 2BE2A 4DQQA 1KRPA 2DTUA 3T19A 4CJSA 1JLCA 1ASWA 1KFDA 1C1AA 4E1MA 4M3ZA 4I2QA 4IBNA 4CGGA 4DS5A 1RTDA 4DWIA 4CF8A 4M3XA 3NFAA 3NHGA 4DU3A 1VRUA 3AVGA 4E89A 1G15A 3ZSOA 1B92A 4KREA 3HP6A 2JLEA 1NOZA 4N47A 2G8VA 4NCAA 3K58A 2FBYA 3V4IA 3CFPA 1A5WA 1RDDA 4DMNA 3ASMA 4CECA 4BE0A 3JYTA 1S9GA 4CIFA 1QHTA 4QAGA 1U49A 3VQQA 1JL1A 4OGEA 5JS2A 3PX0A 4FJ8A 1R0AA 3NH0A 3VQ4A 2A1SA 4PWDA 1U04A 4AHSA 1I39A 1L3UA 1JLQA 1NK4A 4YNQA 1GOAA 4Z0UA 5J1EA 3O3GA 3OYGA 3TAGA 1SKSA 1S1UA 4PY5A 1TL3A 4OKJA 1RT4A 4KFBA 3RR8A 3C6TA 2XY6A 4OLAA 3L3UA 3V9WA 1BL3A 4RW7A 1ZBUA 1KLMA 2IS3A 1F21A 4OKEA 4OLBA 3DLRA 3MEGA 2GBZA 1VRTA 3DMJA 4CHZA 4O5BA 1XHZA 3KIOA 1X9MA 3WNGA 3SUOA 1RT7A 1TL1A 3C6UA 2WONA 2E6LA 2ZQBA 3DOLA 5KI6A 1ZBHA 4Z4CA 3OYCA 4DTSA 4HUFA 4LH5A 4DQRA 4FJGA 3K5OA 2YV0X 3VQ5A 3VA3A 3U3YA 3RMAA 2Z1GA 5HP1A 5CYQA 4DSIA 4KHNA 4M41A 4M3WA 3KLGA 3L3VA 4FK2A 3AA2A 4AHVA 4FK4A 1NKEA 1Y97A 1VSJA 2BANA 4FLYA 2G8IA 4W5NA 2XY5A 4W5RA 3KLEA 3KKSA 4CHYA 1RTJA 1RTHA 5K14A 5DK5A 4EP5A 4ZHRA 4NCBA 2HVIA 4DF4A 1FXXA 1EX4A 3LP3A 3CQ8A 4KKOA 4DF8A 3ZSVA 4I2PA 3CYMA 4CGDA 3AVKA 2P1JA 4AHRA 1TVRA 4FJNA 4Z4EA 4O44A 4HHTA 1RT3A 4CK3A 1S9EA 3BGRA 4KHWA 3LALA 4FYDA 2HW3A 3MECA 3LP0A 4MFBA 2OA8A 4DSJA 4DTJA 1VK0A 2NUBA 2ZD1A 1IKYA 1IKWA 1BIZA 4BE2A 4CEBA 1YTUA 2EHGA 4E1NA 5I42A 3MXJA 4B9MA 4ELUA 4F3TA 1XC9A 2F8TA 3VQDA 4CFDA 2O4IA 1J54A 3HVRA 3F73A 3KK3A 4KHSA 1ZBIA 1UWBA 2HNYA 4CHNA 3O3FA 4AHCA 4CEQA 4CJ4A 1C1BA 2FBTA 3AO1A 3RRHA 1J5OA 3SCXA 1RDBA 3KJVA 1REVA 4N41A 3KKRA 3PX6A 1HRHA 2VWKA 2XO7A 4PUOA 1VSIA 1BGXT 3IG1A 3SJJA 1JL2A 4FXDA 2YNIA 1NOYA 3KTQA 2RN2A 1SKRA 4B9LA 3MEEA 3P83D 4DSFA 5HROA 2ETJA 1N5YA 3SQ2A 1TKDA 3AVBA 4Z4IA 2OPQA 3L2QA 3U6FA 4RW8A 1WSIA 2D0CA 3MEDA 3SV3A 2ZE2A 1WSGA 1WAJA 1L3SA 2XHBA 2XRIA 4GMJB 4CJUA 1HYVA 3RTVA 3SYZA 4BWJA 3M8RA 3AVLA 4B9TA 2D5RA 3P1GA 4CFAA 3OYKA 3TAEA 3AA5X 3LDSA 4ICLA 1U48A 1RDAA 4CEFA 3H08A 4AHUA 1IKXA 4IG3A 1BI4A 2HNZA 3ZSWA 3EYZA 2RPIA 3LAMA 4ID5A 4Y1CA 1TAUA 3S3NA 1D5AA 2HMIA 3QO9A 4N5SA 3OS1A 1EXQA 3QERA 1TK0A 2BGGA 4CFCA 4FJ5A 4CJ3A 3RMCA 3DLEA 4KB1A 1SV5A 4M3UA 4BE1A 1Z25A 3ZT2A 3QIPA 2E6MA 3KD1E 5C25A 3WNFA 4IKFA 4E7LA 3M8SA 1GOCA 3O4NA 4E7HA 1S1WA 1RBUA 4NCGA 3ZSZA 2Y1IA 2BDPA 3V6DA 2AJQA 3V81A 1HQUA 3C94A 3NH2A 2DFEA 1FK9A 4CEZA 3S3MA 4FJHA 1UOCA 4F4KA 3A2FA 3NDKA 3K2PA 4FM0A 4KHUA 4DTPA 1TK5A 2YKNA 3HK2A 3TAMA 2VG5A 1L3VA 4E19A 3D0PA 5HRRA 2QXFA 1HQEA 4CE9A 3OYHA 1NJXA 3L8BA 3TR8A 3ZSYA 3DOKA 4CJ5A 1NK8A 3OYDA 1NK9A 1UA0A 1IG9A 5D3GA 4I7FA 1K6YA 1SL1A 4FJIA 1VSKA 4HCCA 3DRSA 2W42A 4CF2A 1TKZA 4B8AB 3G0ZA 4DLGA 3LANA 4DTNA 1TAQA 3JSMA 4DTMA 2OPRA 2RF2A 4TSXA 1JLGA 4RW4A 3NGYA 4YFUA 3HPOA 3V9SA 4DFKA 3SQ0A 1NK7A 2PYJA 3NF6A 4W5OA 4H4MA 4O0IA 4KB0A 4Z4GA 1DTQA 3V9UA 2HHVA 2HHWA 4CJEA 3MAQA 3IAYA 3DI6A 4CK2A 1BISA 2VG7A 4CGJA 4CF1A 3RR7A 3UIQA 2DFFA 1QE1A 2B4JA 4M3RA 1KCFA 3ULDA 4KHQA 3HL8A 1JLEA 4CF0A 5HLFA 4LSNA 1D9FA 3AO2A 5T7BA 2KW4A 3AVAA 4K8XA 1RCHA 1IKVA 3CM5A 4O55A 4OJRA 3IS9A 3QLHA 4CEDA 4I9LA 2Z1IA 4W5TA 1QS4A 3VQEA 3AO4A 3TANA 4GVMA 3P5JA 3HYFA 3OYJA 1S5JA 1KVCA 3K5MA 4PA1A 2YHBA 3VQCA 3OJUA 3HP9A 4ZTFA 1D9DA 2WOMA 1RT1A 1GOBA 1TK8A 3KD5E 3AVCA 4J2AA 4CGFA 4QOZB 4KRFA 1UA1A 2IDOA 1WSHA 3AA4A 4BACA 3TABA 1RDCA 1IH7A 2YNHA 4Q0BA 1BCOA 4CGIA 3KLFA 2VG6A 1LW2A 3ZSQA 3QEPA 1KFSA 1KTQA 3HPGA 2Z1HA 1CLQA 2B5JA 1NJWA 1U4BA 4N56A 1SL2A 4J2DA 4CHOA 2D0BA 1O1WA 4M3YA 4DFJA 1CZBA 2Y1JA 4CJTA 3I8DA 2KFZA 5CYMA 2KTQA 1HYSA 3OYLA 4HUEA 3B6OA 1MU2A 3O4QA 3OYFA 3AVMA 1JXBA 3HPHA 1U45A 1RBRA 4CEEA 4FLZA 3I0RA 4RW6A 1HPZA 3CFRA 4FJXA 1TKXA 1X9WA 3OYAA 2X6NA 3SQ1A 1WSJA 4DU4A 4C8LA 4L8RB 4JLHA 5J2PA 1KSPA 1ASVA 3QNOA 2X74A 4KO0A 4BWMA 3CG7A 4FJLA 4KV8A 2KZZA 2XY7A 4IDKA 5FROA 3V1QA 4XIUA 5CY4A 2IC3A 4E7JA 4NYNA 1U47A 2P5GA 4B3OA 4CEOA 3NGZA 4C8KA 4MQ3A 4OVLA 1X1PA 5HRNA 2YNFA 3SUQA 1S1XA 4C8OA 4M3TA 3SQ4A 1BHLA 4CFBA 3QEWA 4OPJA 1Z26A 2X78A 3LP2A 4Y1DA 1A5VA 2IAJA 3IRXA 1FKPA 1JXEA 1A5XA 2B6AA 1RT2A 3NBPA 4IFYA 4DTUA 3RMDA 3M8QA 3PO5A 1S1TA 1QTMA 4DLEA 2E4LA 1LV5A 3HM9A 3QNNA 3TAQA 4DSKA 3LAKA 5E41A 1SUQA 1S6PA 3ZSXA 1RNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA3 A;  3LPU A;  4I9Q A;  3K5N A;  4OGC A;  4H8K A;  2HB5 A;  1HNI A;  4FW1 A;  3KLH A;  1RBV A;  4GW6 A;  4C8N A;  1C6V A;  1HNV A;  1B9F A;  1LAV A;  4B8C A;  1XI1 A;  3DM2 A;  4HTU A;  3VQ6 A;  4ELT A;  3PUF A;  4JRQ A;  4FZX C;  1JLA A;  1SL0 A;  3QIO A;  4IFV A;  3T3F A;  2RKI A;  4Z4H A;  4DQI A;  4CGH A;  1B9D A;  4KI6 A;  3LWL A;  4FJM A;  4LH4 A;  1ZYQ A;  4BDP A;  4CJF A;  3PV8 A;  4CEA A;  3ITH A;  2F96 A;  3TI0 A;  3F9K A;  1WLJ A;  3D45 A;  2OPS A;  2A1R A;  3LPT A;  3NF9 A;  4F2S A;  1ZBF A;  3OJS A;  4DFM A;  3TAF A;  1KVA A;  3QES A;  4AH9 A;  4AHT A;  3DRR A;  1IO2 A;  5CZ2 A;  5SWM A;  3CFO A;  3AO5 A;  3L2V A;  3FFI A;  1YVU A;  4R5P A;  2PZS A;  1RT5 A;  3C95 A;  2VWJ A;  4RW9 A;  4CJP A;  2XY8 A;  1HJR A;  3DYA A;  3TAR A;  2G8F A;  2G8W A;  4B9V A;  3EZ5 A;  1DTT A;  4HUG A;  2HHU A;  1TGO A;  3V9Z A;  5KGX A;  1NKB A;  1ITG A;  2OZS A;  3WNE A;  4FM2 A;  4FJ7 A;  4OKK A;  3QIN A;  3OVN A;  4KTZ A;  2QK9 A;  4KPY A;  2ATQ A;  2YKM A;  5J2Q A;  4KAZ A;  3E01 A;  2JGU A;  4F8R A;  3M8P A;  3ZCM A;  5EU7 A;  3DLK A;  4B08 A;  4FLV A;  4DS4 A;  4M42 A;  2IGI A;  3I0S A;  5HRS A;  1C0T A;  1UAX A;  1S1V A;  2X6S A;  3WNH A;  4M45 A;  4CF9 A;  4NYF A;  3T1A A;  3V9X A;  3K5L A;  1X9S A;  1NKC A;  1NK6 A;  2HHS A;  2GUI A;  1LWF A;  5KGW A;  4DTR A;  4CJK A;  3SUN A;  3QEV A;  1VSM A;  2D0A A;  3AVJ A;  4WE1 A;  1LWE A;  1T7P A;  4O0J A;  4UQG A;  4J2B A;  1ASU A;  2HHQ A;  3HVT A;  1JLB A;  4ID1 A;  2QKK A;  4EZ6 A;  2HND A;  4FJ9 A;  1EP4 A;  4CK1 A;  3HO1 A;  1NJY A;  4DQS A;  3ZT4 A;  2FC0 A;  3ZT0 A;  3L2R A;  4JS5 A;  3SNN A;  2KZM A;  1C0U A;  1RBT A;  1RIL A;  3OYN A;  1EKE A;  3HXM A;  1L5U A;  4H4O A;  1WSF A;  4HVJ A;  1QSS A;  3KK1 A;  3U3G A;  4N76 A;  2I5J A;  1EET A;  3ZT3 A;  4JRP A;  4FJJ A;  4CJW A;  3RMB A;  1BQN A;  1VSF A;  3L2W A;  3HT3 A;  4DU1 A;  3S3O A;  3RWU A;  4FVM A;  3S9H A;  1XWL A;  5KRT A;  4FLX A;  4K8Z A;  2HVH A;  3PX4 A;  1CXU A;  5DMR A;  1LAW A;  3O3H A;  3LWM A;  1QSY A;  2F8S A;  1J9A A;  4KTQ A;  3QEX A;  3NH1 A;  3LP1 A;  2GV9 A;  1Q9Y A;  4E3S A;  3SI6 A;  4B9N A;  3VQP A;  1WN7 A;  1W0H A;  4DSE A;  1S6Q A;  4FLU A;  3ZSR A;  3SV4 A;  3K57 A;  3B6P A;  1WSE A;  1TV6 A;  4LY7 A;  5J2M A;  4E0D A;  3DRP A;  4F3O A;  3HST B;  4LD0 A;  4Q5V A;  4HCB A;  4AIL C;  4CIG A;  4ZTJ A;  4DSL A;  2DFH A;  5I3U A;  4EZ9 A;  4FJK A;  3BDP A;  5FDL A;  4B9U A;  4CER A;  4E7K A;  5JS1 A;  1RBS A;  4FLT A;  3VQ7 A;  3THV A;  1Q9X A;  5C24 A;  1RTI A;  3OYI A;  1BCM A;  4W5Q A;  5J2N A;  2PYL A;  3SZ2 A;  1CXQ A;  1LWC A;  4FCY A;  4QCL A;  1KLN A;  3KLI A;  1T03 A;  4DTO A;  3VQA A;  4F2R A;  1L3T A;  4BDY A;  2IOC A;  2P51 A;  3OYE A;  4BDZ A;  4PQU A;  1VSH A;  5HRP A;  3MXI A;  3OYM A;  1JLF A;  3QEI A;  3NCI A;  1T05 A;  1W9H A;  4JS4 A;  4Z4F A;  3LZJ A;  2Q3S A;  4CJL A;  2R7Y A;  3G10 A;  3RRG A;  1BI4 B;  4OPK A;  3OY9 A;  1NJZ A;  3V1O A;  4CJV A;  3NF8 A;  2QKB A;  1YT3 A;  4DG1 A;  3K59 A;  1NK0 A;  1FKO A;  5SZT A;  3SPY A;  4KTW A;  3VQ8 A;  4CES A;  5C42 A;  2Z1J A;  3AV9 A;  3AVN A;  4DFP A;  4KHY A;  1C0M A;  1N6Q A;  2YNG A;  1NK5 A;  1KVB A;  3ISN C;  3PO4 A;  4CHP A;  3QET A;  3NGI A;  1TKT A;  2OPP A;  3DLG A;  1VSD A;  3AO3 A;  4RG8 A;  3VQ9 A;  1QSL A;  2P5O A;  3VN5 A;  4FK0 A;  1Q8I A;  2KQ2 A;  3KK2 A;  4IG0 A;  3SUP A;  3CM6 A;  3NF7 A;  5CZ1 A;  3AVI A;  1ZBL A;  2OYQ A;  4FZZ A;  4KI4 A;  5HBM A;  3ZT1 A;  2PY5 A;  2ITG A;  1RT6 A;  3NAE A;  1BIU A;  2O4G A;  2G8U A;  3HJF A;  4FZY A;  2FBX A;  3AVH A;  1I3A A;  3TAP A;  4G1Q A;  5FRM A;  3EY1 A;  4FLW A;  4LSL A;  4DQP A;  1C1C A;  3V1R A;  3NE6 A;  4FM1 A;  3DLH A;  4O4G A;  2OZM A;  3VQB A;  2G8H A;  2HHT A;  1BQM A;  1DLO A;  3DLB A;  1QQC A;  4CHQ A;  3SPZ A;  1JKH A;  2YHA A;  4FW2 A;  4J2E A;  4B9S A;  3OYB A;  3TWH A;  1XHX A;  2LSN A;  5KRS A;  2FBV A;  1D8Y A;  1J53 A;  3VA0 A;  3ALY A;  4ELV A;  1T8E A;  2KFN A;  1VSE A;  1WNS A;  4EP4 A;  3L2U A;  1YTA A;  4CJQ A;  4DTX A;  1CZ9 A;  4CIE A;  4E7I A;  3LZI A;  5FRN A;  3AVF A;  3OS0 A;  1HMV A;  1HYZ A;  3OS2 A;  1WAF A;  5KTQ A;  1VSL A;  2EX3 A;  1SKW A;  4CCH A;  3PY8 A;  4CJR A;  2HHX A;  4C8M A;  3MXM A;  1LW0 A;  2G8K A;  2DY4 A;  2BE2 A;  4DQQ A;  1KRP A;  2DTU A;  3T19 A;  4CJS A;  1JLC A;  1ASW A;  1KFD A;  1C1A A;  4E1M A;  4M3Z A;  4I2Q A;  4IBN A;  4CGG A;  4DS5 A;  1RTD A;  4DWI A;  4CF8 A;  4M3X A;  3NFA A;  3NHG A;  4DU3 A;  1VRU A;  3AVG A;  4E89 A;  1G15 A;  3ZSO A;  1B92 A;  4KRE A;  3HP6 A;  2JLE A;  1NOZ A;  4N47 A;  2G8V A;  4NCA A;  3K58 A;  2FBY A;  3V4I A;  3CFP A;  1A5W A;  1RDD A;  4DMN A;  3ASM A;  4CEC A;  4BE0 A;  3JYT A;  1S9G A;  4CIF A;  1QHT A;  4QAG A;  1U49 A;  3VQQ A;  1JL1 A;  4OGE A;  5JS2 A;  3PX0 A;  4FJ8 A;  1R0A A;  3NH0 A;  3VQ4 A;  2A1S A;  4PWD A;  1U04 A;  4AHS A;  1I39 A;  1L3U A;  1JLQ A;  1NK4 A;  4YNQ A;  1GOA A;  4Z0U A;  5J1E A;  3O3G A;  3OYG A;  3TAG A;  1SKS A;  1S1U A;  4PY5 A;  1TL3 A;  4OKJ A;  1RT4 A;  4KFB A;  3RR8 A;  3C6T A;  2XY6 A;  4OLA A;  3L3U A;  3V9W A;  1BL3 A;  4RW7 A;  1ZBU A;  1KLM A;  2IS3 A;  1F21 A;  4OKE A;  4OLB A;  3DLR A;  3MEG A;  2GBZ A;  1VRT A;  3DMJ A;  4CHZ A;  4O5B A;  1XHZ A;  3KIO A;  1X9M A;  3WNG A;  3SUO A;  1RT7 A;  1TL1 A;  3C6U A;  2WON A;  2E6L A;  2ZQB A;  3DOL A;  5KI6 A;  1ZBH A;  4Z4C A;  3OYC A;  4DTS A;  4HUF A;  4LH5 A;  4DQR A;  4FJG A;  3K5O A;  2YV0 X;  3VQ5 A;  3VA3 A;  3U3Y A;  3RMA A;  2Z1G A;  5HP1 A;  5CYQ A;  4DSI A;  4KHN A;  4M41 A;  4M3W A;  3KLG A;  3L3V A;  4FK2 A;  3AA2 A;  4AHV A;  4FK4 A;  1NKE A;  1Y97 A;  1VSJ A;  2BAN A;  4FLY A;  2G8I A;  4W5N A;  2XY5 A;  4W5R A;  3KLE A;  3KKS A;  4CHY A;  1RTJ A;  1RTH A;  5K14 A;  5DK5 A;  4EP5 A;  4ZHR A;  4NCB A;  2HVI A;  4DF4 A;  1FXX A;  1EX4 A;  3LP3 A;  3CQ8 A;  4KKO A;  4DF8 A;  3ZSV A;  4I2P A;  3CYM A;  4CGD A;  3AVK A;  2P1J A;  4AHR A;  1TVR A;  4FJN A;  4Z4E A;  4O44 A;  4HHT A;  1RT3 A;  4CK3 A;  1S9E A;  3BGR A;  4KHW A;  3LAL A;  4FYD A;  2HW3 A;  3MEC A;  3LP0 A;  4MFB A;  2OA8 A;  4DSJ A;  4DTJ A;  1VK0 A;  2NUB A;  2ZD1 A;  1IKY A;  1IKW A;  1BIZ A;  4BE2 A;  4CEB A;  1YTU A;  2EHG A;  4E1N A;  5I42 A;  3MXJ A;  4B9M A;  4ELU A;  4F3T A;  1XC9 A;  2F8T A;  3VQD A;  4CFD A;  2O4I A;  1J54 A;  3HVR A;  3F73 A;  3KK3 A;  4KHS A;  1ZBI A;  1UWB A;  2HNY A;  4CHN A;  3O3F A;  4AHC A;  4CEQ A;  4CJ4 A;  1C1B A;  2FBT A;  3AO1 A;  3RRH A;  1J5O A;  3SCX A;  1RDB A;  3KJV A;  1REV A;  4N41 A;  3KKR A;  3PX6 A;  1HRH A;  2VWK A;  2XO7 A;  4PUO A;  1VSI A;  1BGX T;  3IG1 A;  3SJJ A;  1JL2 A;  4FXD A;  2YNI A;  1NOY A;  3KTQ A;  2RN2 A;  1SKR A;  4B9L A;  3MEE A;  3P83 D;  4DSF A;  5HRO A;  2ETJ A;  1N5Y A;  3SQ2 A;  1TKD A;  3AVB A;  4Z4I A;  2OPQ A;  3L2Q A;  3U6F A;  4RW8 A;  1WSI A;  2D0C A;  3MED A;  3SV3 A;  2ZE2 A;  1WSG A;  1WAJ A;  1L3S A;  2XHB A;  2XRI A;  4GMJ B;  4CJU A;  1HYV A;  3RTV A;  3SYZ A;  4BWJ A;  3M8R A;  3AVL A;  4B9T A;  2D5R A;  3P1G A;  4CFA A;  3OYK A;  3TAE A;  3AA5 X;  3LDS A;  4ICL A;  1U48 A;  1RDA A;  4CEF A;  3H08 A;  4AHU A;  1IKX A;  4IG3 A;  1BI4 A;  2HNZ A;  3ZSW A;  3EYZ A;  2RPI A;  3LAM A;  4ID5 A;  4Y1C A;  1TAU A;  3S3N A;  1D5A A;  2HMI A;  3QO9 A;  4N5S A;  3OS1 A;  1EXQ A;  3QER A;  1TK0 A;  2BGG A;  4CFC A;  4FJ5 A;  4CJ3 A;  3RMC A;  3DLE A;  4KB1 A;  1SV5 A;  4M3U A;  4BE1 A;  1Z25 A;  3ZT2 A;  3QIP A;  2E6M A;  3KD1 E;  5C25 A;  3WNF A;  4IKF A;  4E7L A;  3M8S A;  1GOC A;  3O4N A;  4E7H A;  1S1W A;  1RBU A;  4NCG A;  3ZSZ A;  2Y1I A;  2BDP A;  3V6D A;  2AJQ A;  3V81 A;  1HQU A;  3C94 A;  3NH2 A;  2DFE A;  1FK9 A;  4CEZ A;  3S3M A;  4FJH A;  1UOC A;  4F4K A;  3A2F A;  3NDK A;  3K2P A;  4FM0 A;  4KHU A;  4DTP A;  1TK5 A;  2YKN A;  3HK2 A;  3TAM A;  2VG5 A;  1L3V A;  4E19 A;  3D0P A;  5HRR A;  2QXF A;  1HQE A;  4CE9 A;  3OYH A;  1NJX A;  3L8B A;  3TR8 A;  3ZSY A;  3DOK A;  4CJ5 A;  1NK8 A;  3OYD A;  1NK9 A;  1UA0 A;  1IG9 A;  5D3G A;  4I7F A;  1K6Y A;  1SL1 A;  4FJI A;  1VSK A;  4HCC A;  3DRS A;  2W42 A;  4CF2 A;  1TKZ A;  4B8A B;  3G0Z A;  4DLG A;  3LAN A;  4DTN A;  1TAQ A;  3JSM A;  4DTM A;  2OPR A;  2RF2 A;  4TSX A;  1JLG A;  4RW4 A;  3NGY A;  4YFU A;  3HPO A;  3V9S A;  4DFK A;  3SQ0 A;  1NK7 A;  2PYJ A;  3NF6 A;  4W5O A;  4H4M A;  4O0I A;  4KB0 A;  4Z4G A;  1DTQ A;  3V9U A;  2HHV A;  2HHW A;  4CJE A;  3MAQ A;  3IAY A;  3DI6 A;  4CK2 A;  1BIS A;  2VG7 A;  4CGJ A;  4CF1 A;  3RR7 A;  3UIQ A;  2DFF A;  1QE1 A;  2B4J A;  4M3R A;  1KCF A;  3ULD A;  4KHQ A;  3HL8 A;  1JLE A;  4CF0 A;  5HLF A;  4LSN A;  1D9F A;  3AO2 A;  5T7B A;  2KW4 A;  3AVA A;  4K8X A;  1RCH A;  1IKV A;  3CM5 A;  4O55 A;  4OJR A;  3IS9 A;  3QLH A;  4CED A;  4I9L A;  2Z1I A;  4W5T A;  1QS4 A;  3VQE A;  3AO4 A;  3TAN A;  4GVM A;  3P5J A;  3HYF A;  3OYJ A;  1S5J A;  1KVC A;  3K5M A;  4PA1 A;  2YHB A;  3VQC A;  3OJU A;  3HP9 A;  4ZTF A;  1D9D A;  2WOM A;  1RT1 A;  1GOB A;  1TK8 A;  3KD5 E;  3AVC A;  4J2A A;  4CGF A;  4QOZ B;  4KRF A;  1UA1 A;  2IDO A;  1WSH A;  3AA4 A;  4BAC A;  3TAB A;  1RDC A;  1IH7 A;  2YNH A;  4Q0B A;  1BCO A;  4CGI A;  3KLF A;  2VG6 A;  1LW2 A;  3ZSQ A;  3QEP A;  1KFS A;  1KTQ A;  3HPG A;  2Z1H A;  1CLQ A;  2B5J A;  1NJW A;  1U4B A;  4N56 A;  1SL2 A;  4J2D A;  4CHO A;  2D0B A;  1O1W A;  4M3Y A;  4DFJ A;  1CZB A;  2Y1J A;  4CJT A;  3I8D A;  2KFZ A;  5CYM A;  2KTQ A;  1HYS A;  3OYL A;  4HUE A;  3B6O A;  1MU2 A;  3O4Q A;  3OYF A;  3AVM A;  1JXB A;  3HPH A;  1U45 A;  1RBR A;  4CEE A;  4FLZ A;  3I0R A;  4RW6 A;  1HPZ A;  3CFR A;  4FJX A;  1TKX A;  1X9W A;  3OYA A;  2X6N A;  3SQ1 A;  1WSJ A;  4DU4 A;  4C8L A;  4L8R B;  4JLH A;  5J2P A;  1KSP A;  1ASV A;  3QNO A;  2X74 A;  4KO0 A;  4BWM A;  3CG7 A;  4FJL A;  4KV8 A;  2KZZ A;  2XY7 A;  4IDK A;  5FRO A;  3V1Q A;  4XIU A;  5CY4 A;  2IC3 A;  4E7J A;  4NYN A;  1U47 A;  2P5G A;  4B3O A;  4CEO A;  3NGZ A;  4C8K A;  4MQ3 A;  4OVL A;  1X1P A;  5HRN A;  2YNF A;  3SUQ A;  1S1X A;  4C8O A;  4M3T A;  3SQ4 A;  1BHL A;  4CFB A;  3QEW A;  4OPJ A;  1Z26 A;  2X78 A;  3LP2 A;  4Y1D A;  1A5V A;  2IAJ A;  3IRX A;  1FKP A;  1JXE A;  1A5X A;  2B6A A;  1RT2 A;  3NBP A;  4IFY A;  4DTU A;  3RMD A;  3M8Q A;  3PO5 A;  1S1T A;  1QTM A;  4DLE A;  2E4L A;  1LV5 A;  3HM9 A;  3QNN A;  3TAQ A;  4DSK A;  3LAK A;  5E41 A;  1SUQ A;  1S6P A;  3ZSX A;  1RNH A; 
#chains in the Genus database with same CATH topology
 4I9Q A;  4OGC A;  2YJE A;  2KKZ A;  1NGJ A;  4GW6 A;  1HNV A;  4B8C A;  3DM2 A;  4L3Q A;  3CCU N;  1GLB G;  5AQG A;  5AQZ A;  4YOY A;  4CGH A;  2V7Z A;  1OH5 A;  3LWL A;  4FJM A;  4LH4 A;  1ZYQ A;  1SAZ A;  3TI0 A;  3E9P A;  5DM7 L;  5BRE A;  3LPT A;  4OX9 K;  1ZBF A;  3OJS A;  3QES A;  5CZ2 A;  3L2V A;  1YVU A;  5FPM A;  1VQM N;  2VWJ A;  3UKU A;  2G8F A;  5EVZ A;  3D7E O;  4HUG A;  2HHU A;  1TGO A;  5AFU A;  3PSI A;  5KGX A;  3BF3 A;  2YKM A;  4QS7 A;  4BVO A;  3IMX A;  3E01 A;  5J2Q A;  1XMQ K;  3M8P A;  4KAZ A;  3CJ7 A;  3AGR A;  3A5M C;  4DS4 A;  5HRS A;  1C0T A;  4JKC A;  3P4I A;  3WNH A;  1XC3 A;  4CF9 A;  1NK6 A;  3T1A A;  3V9X A;  4LFA K;  5KGW A;  3QEV A;  4WE1 A;  1T7P A;  2HBJ A;  4O0J A;  2OTJ N;  3HBT A;  4J2B A;  2HHQ A;  4B3M K;  4YOR A;  4H0T B;  4IWV A;  1QQN A;  3SK3 A;  4JS5 A;  4RTF D;  3I8B A;  2WBN A;  1RBT A;  4NO7 A;  4YOW A;  3BY5 A;  1WSF A;  1MDU B;  3E1Y A;  4BG9 A;  3MN5 A;  1VSF A;  3RWU A;  3S9H A;  1OH6 A;  1XWL A;  2HVH A;  3LWM A;  2F8S A;  3NH1 A;  1YIJ N;  1BUP A;  4GKK K;  3H3N O;  4B9N A;  2E1Z A;  1S6Q A;  4BRM A;  3K57 A;  4C1N I;  1TV6 A;  5J2M A;  3R3L A;  4F3O A;  4LD0 A;  4HCB A;  4AIL C;  4CIG A;  3SBT A;  5I3U A;  2RHK A;  5FDL A;  5H1S Q;  4E7K A;  1RBS A;  3VQ7 A;  3H46 O;  1RTI A;  4W5Q A;  5J2N A;  1LWC A;  3KLI A;  3TPQ A;  3L4Q A;  5KQ8 A;  4DTO A;  3F9M A;  4OPA A;  3OYE A;  4A5A A;  3OYM A;  3QEI A;  2ZGZ A;  3J7A P;  3OY9 A;  1NJZ A;  4DG1 A;  3VGK A;  5C42 A;  4DFP A;  4KHY A;  2IVP A;  4DR6 K;  4JHD A;  3ISN C;  4CHP A;  5AQI A;  1HJO A;  4E1J A;  1X3N A;  3CPW M;  1VSD A;  1QSL A;  2P5O A;  3SUP A;  4IG0 A;  2D4W A;  3S41 A;  4FWP A;  1NM1 A;  1BIU A;  3HJF A;  3WEE A;  1YJ9 N;  4G1Q A;  5FRM A;  3EY1 A;  4FLW A;  2OTL N;  3ULE A;  2OZM A;  4QS9 A;  5KPZ A;  4PKH A;  1BQM A;  2QXL A;  3ATV A;  1QQC A;  4CHQ A;  3SPZ A;  2YHA A;  3TWH A;  4EFH A;  2P9K A;  3KZB A;  3ALY A;  4BRI A;  4DV2 K;  2KFN A;  1VSE A;  1IBM K;  3TSU A;  3L2U A;  2P9I A;  1MWK A;  3ZET A;  3QML A;  3AVF A;  1HYZ A;  3OS2 A;  3O9Q A;  1WAF A;  2EX3 A;  4WQ5 C;  4JI2 K;  4CJR A;  1IV0 A;  5TKW A;  4JK8 A;  3T19 A;  1JLC A;  4I2Q A;  4DS5 A;  4DWI A;  4K0K K;  2NRV A;  3D2F B;  3AVG A;  3SAF A;  1G15 A;  3ZSO A;  3ATU A;  3K58 A;  2P9U B;  2FBY A;  2UXB K;  4LF7 K;  3CFP A;  1A5W A;  4FO0 A;  1NNE A;  1LCU A;  3VQ4 A;  1JLQ A;  1GOA A;  4Z0U A;  3O3G A;  3TAG A;  4PY5 A;  4OKJ A;  3C6T A;  3V9W A;  3EZW A;  4RWT A;  4CJ7 A;  4RW7 A;  1KLM A;  1F21 A;  2CH6 A;  3THY A;  3DMJ A;  4O5B A;  1RT7 A;  2WON A;  4Z4C A;  1GLE G;  4HUF A;  3IKM A;  4FWR A;  5AQP A;  1VQN N;  4OO1 J;  2BH1 A;  4NXN K;  4JD2 A;  4IOA L;  3U3Y A;  5HP1 A;  5CYQ A;  4IJA A;  4M41 A;  3P39 A;  3L3V A;  3CC2 N;  3AA2 A;  1NKE A;  1Y97 A;  3WUH A;  2XY5 A;  2UUB K;  4R79 A;  4CHY A;  4EP5 A;  5M1F A;  3D6R A;  1EX4 A;  3ZSV A;  1HNX K;  4BR7 A;  3A5O C;  2P9K B;  4AHR A;  4FJN A;  4O44 A;  2DPN A;  1IG8 A;  2Q2R A;  1RT3 A;  4FWM A;  4CK3 A;  2QWO A;  3VF4 A;  4DSJ A;  5BPL A;  3O4W A;  4DTJ A;  3JS6 A;  2ZD1 A;  1YTU A;  4KRF A;  3GL1 A;  1VQL N;  3HVR A;  1ZBI A;  4KHS A;  3FZF A;  3O3F A;  5LMN K;  2FBT A;  3HOT A;  1J5O A;  3QBX A;  2E2P A;  3PX6 A;  2VWK A;  4JI3 K;  2QW9 A;  3IG1 A;  3SJJ A;  3L0Q A;  1SKR A;  3PIO L;  4B9L A;  3D2F A;  4WF9 L;  3EE8 A;  2P9P A;  2ETJ A;  1N5Y A;  1TKD A;  3AVB A;  1K8K B;  3HSC A;  1WSI A;  4UY8 O;  1WSG A;  2XHB A;  1NGC A;  1HYV A;  3MX2 A;  3RTV A;  1VHX A;  3SYZ A;  4BWJ A;  2WC9 A;  5ADX H;  2ZJR L;  3TAE A;  1U48 A;  4AHU A;  1D5A A;  1ZBS A;  2HMI A;  1T44 A;  1SV5 A;  4M3U A;  4JNE A;  4IKF A;  3M8S A;  4HWI A;  3DLL L;  1HQU A;  3C94 A;  2FXU A;  4AM6 A;  3NH2 A;  3MMV A;  1CZA N;  4FJH A;  1ZXO A;  4F4K A;  2NLX A;  4M7Y A;  4KHU A;  3MN6 A;  4DTP A;  4DQ8 A;  4JD2 B;  3HK2 A;  3TAM A;  4E19 A;  4DV3 K;  3H45 C;  5HRR A;  1HQE A;  4CE9 A;  1NJX A;  3L8B A;  3ZSY A;  3OYD A;  1UA0 A;  2FF3 B;  3NMU A;  1VSK A;  3I33 A;  4C23 A;  2QWM A;  1NBW A;  4FWL A;  2GWK A;  5LJV A;  4DTN A;  5AQX A;  4TSX A;  1JLG A;  5AQU A;  2A5X A;  3V9S A;  1NK7 A;  3NF6 A;  4W5O A;  4H4M A;  1S22 A;  4KB0 A;  4GY2 B;  1DTQ A;  2HHV A;  3DI6 A;  1BIS A;  2QEX N;  1GLF O;  1JLE A;  5HLF A;  4X64 K;  4BR0 A;  3MN7 A;  5T7B A;  2W6K A;  1RCH A;  4O55 A;  4I9L A;  2Z1I A;  2BTF A;  3VQE A;  4GVM A;  2CGJ A;  3OYJ A;  3T1Y K;  3OJU A;  1D9D A;  1RT1 A;  4O5F A;  4QOZ B;  1UA1 A;  4BRA A;  2F7T A;  1LW2 A;  3ZSQ A;  4CZI A;  1KFS A;  4BRK A;  1TUU A;  4N56 A;  2D0B A;  4DCH A;  3MWT A;  1WBD A;  1CZB A;  3UKR B;  2KFZ A;  3OYL A;  3B6O A;  5M1P A;  1P90 A;  1ILY A;  3KHY A;  3HPH A;  3LM9 A;  2H3G X;  5JVG L;  1HPZ A;  5AZJ A;  3I55 N;  1KSP A;  1ASV A;  3C6H A;  3QNO A;  2X74 A;  4FJL A;  1NGD A;  2KZZ A;  2A3Z A;  5HOO A;  4CZF A;  1HPM A;  1X1P A;  4C8O A;  2A40 A;  1S1X A;  3BF1 A;  3SQ4 A;  4LF5 K;  3QEW A;  1BWF O;  4BR5 A;  2X78 A;  4GKJ K;  3C7N B;  1JXE A;  4IFY A;  2B6A A;  3PO5 A;  1QTM A;  1HUX A;  2P9I B;  3O5B A;  5AQK A;  4DLE A;  2E4L A;  1NU0 A;  1S6P A;  5IWA K;  5M1O A;  1FW6 A;  3AA3 A;  1U2V A;  2HB5 A;  3KLH A;  5AQQ A;  1C6V A;  1B9F A;  3EEQ A;  3PUF A;  4F9O A;  3U9Z A;  4IFV A;  3T3F A;  3I56 N;  4BRF A;  4Z4H A;  4KI6 A;  3M5R A;  2Q0R A;  4CJF A;  3PV8 A;  4CEA A;  4WQ5 A;  1N8R O;  1KAY A;  2UUC K;  2OPS A;  4F2S A;  5BN8 A;  5BPM A;  3DRR A;  3LDL A;  3OW2 M;  3AO5 A;  5FLX O;  3Q7B A;  3DYA A;  1NGI A;  3O9U A;  5I9E B;  4H5V A;  3V9Z A;  4DR1 K;  1ITG A;  3OVN A;  4KTZ A;  5JIC A;  4KPY A;  3KK7 A;  2VQF K;  1ESV A;  4B08 A;  3ZCM A;  3DLK A;  3I0S A;  4FYD A;  1UAX A;  3QNN A;  5JS1 A;  4NYF A;  3K5L A;  2HHS A;  4LF4 K;  4V19 S;  1N34 K;  3M6G A;  5AFU H;  4UQG A;  1V4S A;  2NRW A;  1ASU A;  1JLB A;  4HTL A;  3QDK A;  1EP4 A;  2WUS A;  3HO1 A;  5EOY A;  4BVP A;  3ZT0 A;  4WFB L;  1NGH A;  1TUY A;  1RIL A;  4LFB K;  3MCA B;  4HVJ A;  2HBM A;  3U3G A;  4N76 A;  2I5J A;  4LF9 K;  4FJJ A;  3RMB A;  1BQN A;  3WT0 A;  3HT3 A;  4DU1 A;  1KC8 O;  3PX4 A;  5DMR A;  4JI5 K;  1QSY A;  3VEO A;  1J9A A;  2F9T A;  2NRR A;  2D1K A;  4ISF A;  4PHT X;  4E3S A;  1WN7 A;  3Q7C A;  4H0P A;  3SV4 A;  4BRL A;  2GEL A;  1E4F T;  3HST B;  4JKG B;  3TSP A;  4I6M A;  5GAH P;  4ZTJ A;  4DSL A;  5F0X A;  1S3X A;  1Z6R A;  4FJK A;  4FLT A;  2Q36 A;  3GDQ A;  3RSE B;  5C24 A;  2P9P B;  3BZK A;  3QFP A;  2QWQ A;  2PYL A;  1K8K A;  4FCY A;  4H03 B;  1L3T A;  1RDU A;  2IOC A;  1VSH A;  3A5L C;  3MXI A;  1Q7Y O;  4XH4 A;  3NCI A;  1W9H A;  4JS4 A;  1W7A A;  2Q3S A;  1HKB A;  4JKD A;  1D4X A;  3G4S N;  2I7P A;  4CJV A;  1YT3 A;  3K59 A;  1FKO A;  3AY9 A;  1KAZ A;  5SZT A;  2BGG A;  3AVN A;  3VMF B;  4BG8 A;  3ENH A;  1N6Q A;  2YNG A;  3HM8 A;  5BPN A;  4FOE A;  2GWJ A;  3NVK A;  1VAZ A;  1TKT A;  4MLE A;  4RG8 A;  4IXC A;  4FK0 A;  5AQY A;  2KQ2 A;  5EX5 A;  3ZT1 A;  4B1U B;  1RT6 A;  4B3S K;  2RE2 A;  4FZY A;  3EL2 A;  3TAP A;  5BR8 K;  4DQP A;  4DR2 K;  3NE6 A;  4FM1 A;  1DGK N;  3DLH A;  3O1W A;  3DJC A;  3VQB A;  3M3Z A;  3K9K A;  1GLJ O;  4FSV A;  1DLO A;  1BA0 A;  2E2O A;  3C0B A;  4J2E A;  4DR7 K;  3ZX3 A;  5CE3 A;  1XHX A;  1J53 A;  4EP4 A;  1J5E K;  1CZ9 A;  3C65 A;  4E7I A;  3VPZ A;  3JAM O;  3THX B;  1XMO K;  1VQO N;  1HMV A;  1VSL A;  4XH1 A;  1SKW A;  4CCH A;  3PY8 A;  2Q0U A;  3TU5 A;  4ISG A;  2P9U A;  3CHW A;  4B3R K;  3FLC O;  4DQQ A;  1KRP A;  2DTU A;  1YJN N;  4CJS A;  1KFD A;  3CJB A;  4YDU A;  4PKG A;  4CGG A;  4WQ4 C;  5F1X A;  1MA9 B;  3NFA A;  4DU3 A;  1B92 A;  1NOZ A;  3HTV A;  3EKS A;  3CXC M;  4BC5 A;  5B8H A;  1MWM A;  4WCE L;  4CEC A;  4CIF A;  1JL1 A;  2A1S A;  4AHS A;  3ID8 A;  4JI0 K;  5J1E A;  3OYG A;  1SKS A;  1S1U A;  1RT4 A;  4KFB A;  4OLA A;  2XY6 A;  4H5N A;  1ZBU A;  2IS3 A;  4OLB A;  3DLR A;  3MEG A;  5AZJ B;  4CZJ A;  1NGA A;  3VEY A;  1VRT A;  4IEE A;  1QQM A;  3WNG A;  3SUO A;  5CR4 A;  1TL1 A;  2E6L A;  4H5R A;  1ZBH A;  3CJ9 A;  4DB3 A;  3OYC A;  4LH5 A;  4IDH A;  3VA3 A;  3KWG A;  5FPD A;  4AHV A;  4FK4 A;  1QVG M;  3WQT A;  3WXL A;  4W5N A;  4FLY A;  1RTH A;  2HVI A;  1FXX A;  3HRG A;  3VER A;  1U2V B;  4DF8 A;  1KXP A;  3VTI A;  3AVK A;  3VF6 A;  4A57 A;  2W41 A;  4BRE A;  3CC7 N;  3MEC A;  3MX5 A;  4KHP K;  3CMA N;  1VK0 A;  2NUB A;  1BIZ A;  4BE2 A;  4CEB A;  4F3T A;  1QVF M;  1YAG A;  2O4I A;  1U6Z A;  3VQD A;  3F73 A;  1RGI A;  2JWK A;  2UYT A;  3QIC A;  4FOI A;  4BRO A;  2HNY A;  4CEQ A;  4CJ4 A;  1C1B A;  2AA4 A;  3AO1 A;  3KJV A;  1REV A;  1HRH A;  1BA1 A;  1VSI A;  4EAH D;  3G25 A;  1NLV A;  1NOY A;  2RN2 A;  3DXK A;  3KTQ A;  3MEE A;  2W6L A;  3TTD A;  1JJ2 M;  1NGE A;  3WXI A;  3L2Q A;  4FVU A;  5KPR A;  3SV3 A;  3G71 N;  2ZE2 A;  1WAJ A;  1P8Z A;  4BRN A;  4BC3 A;  2NRX A;  3AVL A;  3ENO A;  3TSQ A;  3ULE B;  4ICL A;  4IJN A;  4CEF A;  3H08 A;  3EYZ A;  3R1X A;  3S3N A;  3LDQ A;  2Q31 A;  3QO9 A;  4N5S A;  5AQT A;  4GVE A;  3RMC A;  4BR2 A;  1Z25 A;  3KD1 E;  5C25 A;  4IO8 A;  4E7H A;  1S1W A;  4NCG A;  2BDP A;  2AJQ A;  4DHY A;  3OHR A;  3L4I A;  3S3M A;  1TK5 A;  2YKN A;  1L3V A;  2QWR A;  2PZS A;  4KTQ A;  1IG9 A;  4H0V B;  4I7F A;  4JI8 K;  1SL1 A;  5EXW A;  4HCC A;  3DRS A;  4YHH K;  2W42 A;  5AZI B;  1TKZ A;  2O8C A;  2O8E A;  1TAQ A;  3TTC A;  3T69 A;  2D0O A;  4YFU A;  3WXJ A;  3V9U A;  3MCP A;  2QA4 N;  1WBB A;  5GAD P;  1E4G T;  3UIQ A;  1QE1 A;  4KHQ A;  3E9L A;  3CQY A;  3HL8 A;  4CF0 A;  4LSN A;  3AO2 A;  2KW4 A;  3AVA A;  4K8X A;  1IKV A;  3O8M A;  3A8Y A;  4LF6 K;  2A41 A;  3A5N C;  3TAN A;  3P5J A;  3T1H K;  4BC2 A;  1S5J A;  2YHB A;  4Y0W A;  3AAQ A;  2FSN A;  1TK8 A;  3KD5 E;  4ILG B;  3E66 A;  2E20 A;  4PL8 A;  1WSH A;  3AA4 A;  4B1Y B;  4Q0B A;  1BCO A;  4CGI A;  3O6W A;  3VGM A;  2HF4 A;  4X62 K;  3CI5 A;  5KPT A;  2ASO A;  3OA9 A;  1HNZ K;  1CLQ A;  4CHO A;  2HMP A;  3OTO K;  1O1W A;  4M3Y A;  4CJT A;  1DT9 A;  4X66 K;  5CYM A;  2KTQ A;  4HUE A;  3BZC A;  1WB9 A;  3OYF A;  1JXB A;  1U45 A;  1RBR A;  4JKH A;  3LM2 A;  1YHQ N;  3FZK A;  4L8R B;  2GTD A;  3T7Z A;  3IUC A;  4XIU A;  5FRO A;  4E7J A;  1U47 A;  1Q86 O;  4DV7 K;  5F2R A;  4OVL A;  1N36 K;  4CVN E;  4BR9 A;  4CFB A;  2BUP A;  3LP2 A;  2O8F B;  2IAJ A;  2KHO A;  3FE1 A;  3TTF A;  4BRC A;  3IRX A;  3NBP A;  4DTU A;  4BC4 A;  1S1T A;  1OVQ A;  4A59 A;  3HM9 A;  5E41 A;  1SUQ A;  2JWL A;  1RNH A;  3RVC A;  3QBW A;  2GEM A;  4H8K A;  1BDG A;  4YOU A;  4FW1 A;  1RBV A;  1LAV A;  1XI1 A;  3FZM A;  4HTU A;  4ELT A;  4JRQ A;  4FZX C;  3QIO A;  2W40 A;  1ATS A;  2RKI A;  4DQI A;  4H5T A;  5JMV A;  4BRD A;  1B9D A;  5ADX A;  4BGB A;  4FWO A;  4BRH A;  3L6Q A;  3FGU A;  3D45 A;  4YOX A;  3CCS N;  1VQ6 N;  4DFM A;  3TAF A;  1KVA A;  5MLC Q;  4MO4 A;  4AH9 A;  2O8B A;  3MN9 A;  3THW B;  4CJP A;  2XY8 A;  3TAR A;  2G8W A;  1DEJ A;  3EZ5 A;  1DTT A;  4FM2 A;  4FJ7 A;  4OKK A;  2QK9 A;  2ATQ A;  2PFU A;  1XNQ K;  4F8R A;  4M42 A;  5EU7 A;  4FLV A;  3VA0 A;  2Q1N A;  1S1V A;  4M45 A;  1NKC A;  4Z94 A;  1LWF A;  4CJK A;  3SUN A;  3CC4 N;  1J6Z A;  2V51 B;  5M1Q A;  4CZK A;  4EZ6 A;  2HND A;  4CK1 A;  3BEX A;  1NJY A;  2FC0 A;  3SNN A;  4CW7 B;  5DM6 L;  2ZM6 K;  3UB5 A;  3LDO A;  4CZG A;  4BQL A;  1QSS A;  3KK1 A;  3J7Z O;  4DR3 K;  1EET A;  3ZT3 A;  5BRD A;  3S3O A;  4FVM A;  4JK7 A;  4FLX A;  2QI2 A;  1LAW A;  1R59 O;  5JLH A;  3RSE A;  5LY3 A;  3C6A A;  3H1V X;  3VQP A;  4DSE A;  4FLU A;  3B6P A;  4LY7 A;  3DRP A;  1YXQ A;  1JCE A;  4EZ9 A;  3N4Q A;  3BDP A;  3DXK B;  2QWN A;  1M1K O;  5AQW A;  1OKJ A;  1QZ5 A;  3OYI A;  3P38 A;  3P31 A;  3SZ2 A;  4QS8 A;  4QCL A;  2WFB A;  4BY9 C;  3HZ6 A;  4EHT A;  1KD1 O;  4BDY A;  1VQ9 N;  5HRP A;  4CBX A;  4Z4F A;  4JV5 K;  4ILJ A;  3G10 A;  3RRG A;  2VCP A;  2QKB A;  3NF8 A;  4A5B A;  2ZGY A;  4GV6 A;  3SAH A;  4KTW A;  2GUP A;  4CES A;  1HKC A;  2Z1J A;  3C7N A;  3VQ8 A;  5AQM A;  4FWK A;  2GX9 A;  3PO4 A;  1T6C A;  3QET A;  3NGI A;  5TKY A;  2OPP A;  3DLG A;  2OCE A;  3VQ9 A;  3VN5 A;  4M63 C;  3KK2 A;  2OYQ A;  3NF7 A;  4FZZ A;  4KI4 A;  4CD3 A;  2PY5 A;  2G8U A;  3AVH A;  1I3A A;  4K43 A;  4LSL A;  4NXM K;  4O4G A;  2G8H A;  3THX A;  3SJH A;  3PLA A;  2HHT A;  5AQO A;  2UUA K;  5AJ3 K;  1XNR K;  1BO5 O;  1RDW X;  4LF8 K;  3EN9 A;  3SAG A;  1D8Y A;  2FBV A;  4ELV A;  2YI1 A;  2VGM A;  3EKU A;  5C2F A;  4DTX A;  4IZ9 A;  4B1W B;  4CIE A;  3LZI A;  5FRN A;  4WYB A;  1IBL K;  3CCL N;  4U7B A;  2YHW A;  3CCJ N;  4C8M A;  3MXM A;  2G8K A;  2DY4 A;  4RCH A;  1ASW A;  4E1M A;  2HST A;  3H1Q A;  1YUW A;  3CCR N;  4CF8 A;  3NHG A;  1VRU A;  4E89 A;  2ZWH A;  4KRE A;  3HP6 A;  1X3M A;  2A6A A;  2JLE A;  4WFA L;  2F4V K;  3V4I A;  4YOV A;  1RDD A;  3OBW A;  3ASM A;  3JYT A;  1S9G A;  3F5T A;  4QAG A;  1Y64 A;  4OGE A;  3PX0 A;  1R0A A;  3NH0 A;  4DV0 K;  4PWD A;  2ZF5 O;  4B9Q A;  1L3U A;  3SBG A;  4YNQ A;  2E8A A;  1GLL O;  1TL3 A;  3RR8 A;  3L3U A;  5GAG P;  1TYQ B;  4EIA A;  4OKE A;  4A2A A;  2GBZ A;  1XHZ A;  3CJ1 A;  3KIO A;  3C6U A;  3DOL A;  5KI6 A;  4A61 A;  3DAW A;  3CIP A;  3J80 O;  4DTS A;  1C0F A;  3SMP A;  4FJG A;  3GBT A;  3RMA A;  3VQ5 A;  4M3W A;  4KHN A;  4FPA A;  3QB0 A;  3KLG A;  4FK2 A;  1VQK N;  1VSJ A;  2BAN A;  4JYA K;  4I6M B;  4JKB A;  4LC9 B;  5K14 A;  4NCB A;  4ZHR A;  3J81 O;  4DF4 A;  1DKG D;  3LP3 A;  2D0P A;  3CD6 N;  2HBK A;  4IO9 L;  4U67 L;  3CYM A;  4CGD A;  2P1J A;  1TVR A;  4Z4E A;  4DV5 K;  1NGB A;  4KHW A;  3LAL A;  3LP0 A;  2OA8 A;  4B9M A;  3MXJ A;  1XC9 A;  4CFD A;  1WUA A;  4BQZ A;  1J54 A;  2E88 A;  1NWK A;  4JI1 K;  5JVH L;  1UWB A;  3GE1 A;  4IEI A;  4CI6 A;  3RRH A;  1RDB A;  1YF5 L;  1BG3 A;  3J7Y P;  2XO7 A;  5FPN A;  4PUO A;  1BGX T;  1JL2 A;  2YNI A;  3VF2 A;  3MDQ A;  2HBL A;  5C0Y A;  2OPQ A;  3U6F A;  3MED A;  3AAR A;  1FJG K;  1L3S A;  5ELZ A;  2D5R A;  3OYK A;  2E2N A;  2YCH A;  4A62 A;  3G6E N;  3FFK B;  3CJA A;  4IG3 A;  1BI4 A;  1EQY A;  3LAM A;  4ID5 A;  4MDA A;  4DKW A;  3OS1 A;  1TK0 A;  1T3V A;  4FJ5 A;  4KB1 A;  1TYQ A;  3ZT2 A;  3QIP A;  2E6M A;  2P9L A;  3E9O A;  4E7L A;  3LL3 A;  1RBU A;  2Y1I A;  2DFE A;  1FK9 A;  4CEZ A;  4BR4 A;  2Q97 A;  4B1X B;  2HOE A;  4FM0 A;  3K2P A;  4H5W A;  3O9R A;  2VG5 A;  1Z05 A;  3D0P A;  2QXF A;  2VQE K;  3DOK A;  1NK8 A;  1NK9 A;  5D3G A;  2O8D A;  1K6Y A;  4IOX A;  4JKE A;  4KBO A;  4CF2 A;  1SZ2 A;  3G0Z A;  4DLG A;  2UXC K;  1NMD A;  3JSM A;  1O13 A;  4DTM A;  4WFN L;  2OPR A;  2FF6 A;  4RW4 A;  3NGY A;  3HPO A;  2PYJ A;  2HHW A;  1V4T A;  5AQF A;  3D2E A;  4Z4G A;  4CJE A;  3IAY A;  4M7X A;  2VG7 A;  3B8A X;  3RR7 A;  3CQX A;  3N4P A;  2DFF A;  4YOT A;  3ULD A;  4JI7 K;  3FZL A;  2QM1 A;  1D9F A;  4M3T A;  4OJR A;  3IS9 A;  3QLH A;  4W5T A;  3U9D A;  4JAX A;  1QS4 A;  3A0I X;  2YHY A;  1N33 K;  2PAV A;  3MK6 A;  3HP9 A;  3VQC A;  4ZTF A;  2WOM A;  3QFU A;  3AVC A;  4CGF A;  4DV4 K;  2IDO A;  2FLO A;  2J4R A;  3TAB A;  3QEP A;  3VEN A;  3HPG A;  2Z1H A;  1NJW A;  4O8K A;  5JLF A;  3KWI A;  4DFJ A;  4FPB A;  3I8D A;  2P9S A;  4NLB A;  1HYS A;  3O4Q A;  4FL9 A;  4FWS A;  4PL7 A;  3ZLJ A;  3CCV N;  4DUY K;  4FLZ A;  4RW6 A;  5CHI A;  4K25 A;  1X9W A;  3O9T A;  2X6N A;  3SQ1 A;  4DU4 A;  4C8L A;  4JLH A;  5E26 A;  4BWM A;  3CG7 A;  4LFC K;  4KV8 A;  1W2B M;  3F2K A;  4IDK A;  2P9N A;  5CY4 A;  4CEO A;  3CJC A;  3NGZ A;  2UU9 K;  4JKF A;  4C8K A;  5C10 A;  5C15 A;  4IOC L;  5HRN A;  1BHL A;  4OPJ A;  3M1F A;  4Y1D A;  3RMD A;  1RT2 A;  3M8Q A;  4YY3 K;  1LV5 A;  4DSK A;  5GIP A;  1Q81 O;  3LAK A;  1XQS C;  4YDU C;  1G99 A;  1I94 K;  2O8D B;  3LPU A;  2EWS A;  3K5N A;  5BRF A;  1HNI A;  3K9J A;  1JCF A;  4C8N A;  1OVY A;  5AQS A;  3VQ6 A;  1JLA A;  1SL0 A;  4KH4 A;  3D2E B;  4BRQ A;  1HX1 A;  5C12 A;  4MLH A;  1VQP N;  1S72 N;  2FSK A;  3R9P A;  4BDP A;  3ITH A;  2F96 A;  1XUP O;  3F9K A;  1WLJ A;  1SS6 A;  2CGK A;  4EHU A;  2A1R A;  3NF9 A;  3NVM A;  4AHT A;  1IO2 A;  2VYP A;  5SWM A;  3CFO A;  4MDB A;  3FFI A;  4R5P A;  1RT5 A;  3C95 A;  4JKA A;  4RW9 A;  4DV1 K;  1HJR A;  5A2Q O;  4B9V A;  3O08 A;  1NKB A;  4DR5 K;  2OZS A;  1QQO A;  3WNE A;  3O80 A;  3QIN A;  2E2Q A;  5BN9 A;  1N32 K;  4FWQ A;  2JGU A;  2IGI A;  3JXU A;  2X6S A;  1X9S A;  4XEI A;  1OH8 A;  3AGK A;  1H1V A;  1NMN A;  2GUI A;  4DTR A;  1VSM A;  2D0A A;  3AVJ A;  5AQR A;  1LWE A;  1YVN A;  3LDP A;  5AZI A;  4AF1 A;  2CGL A;  2O8C B;  5AQV A;  2O8E B;  3HVT A;  4ID1 A;  2QKK A;  5E84 A;  4B3T K;  4FJ9 A;  1VQ7 N;  4DQS A;  4BRP A;  3ZT4 A;  3SMS A;  3L2R A;  2KZM A;  1C0U A;  3OYN A;  1EKE A;  3HXM A;  1L5U A;  4H4O A;  1EO1 A;  2I7N A;  4JRP A;  3THY B;  4CJW A;  3L2W A;  3ZYY X;  2YX6 A;  5KRT A;  4BGA A;  4K8Z A;  3GOI A;  3CCE N;  1NG9 A;  1CXU A;  3O3H A;  3QEX A;  3LP1 A;  2PBD A;  2GV9 A;  2V52 B;  1Q9Y A;  3SI6 A;  1W0H A;  3ZSR A;  4H0Y B;  3VEW A;  3ZX0 A;  4A2B A;  1WSE A;  4E0D A;  3ENB A;  4Q5V A;  1VQ4 N;  2DFH A;  4B9U A;  4CER A;  4CZM A;  3THV A;  1Q9X A;  4JI6 K;  1BCM A;  2E5L K;  3WXK A;  1CXQ A;  1KLN A;  1T03 A;  3WXM B;  1K73 O;  3VQA A;  4F2R A;  2P51 A;  4BDZ A;  5AQJ A;  3IDH A;  1JLF A;  1EWQ A;  1T05 A;  3W0L A;  3LZJ A;  4CJL A;  2R7Y A;  1BI4 B;  2ITM A;  4OPK A;  4AM7 A;  3HI0 A;  3V1O A;  1SQK A;  3ID6 A;  1NK0 A;  1BU6 O;  4C1N K;  3BP8 A;  3SPY A;  4PQU A;  2O8F A;  3AV9 A;  5AQH A;  5LJW A;  1C0M A;  1NK5 A;  1KVB A;  1HKG A;  3IFR A;  3AO3 A;  1BOT O;  1Q8I A;  3CM6 A;  1QHA A;  5CZ1 A;  3AVI A;  1ZBL A;  1YIT N;  3DXM B;  5HBM A;  2ITG A;  3NAE A;  2O4G A;  1RFQ A;  5M1K A;  1ZC6 A;  2FBX A;  4JI4 K;  4JHD B;  3LDN A;  4H0O A;  1C1C A;  3V1R A;  4CBU A;  3R6M A;  3VET A;  1QZ6 A;  1NGF A;  3DLB A;  3CET A;  1JKH A;  4FW2 A;  2ASP A;  4B9S A;  3OYB A;  2LSN A;  5GAE P;  5KRS A;  2ZJQ L;  1T8E A;  1K9M O;  1M90 O;  1WNS A;  4CZL A;  1YTA A;  4CJQ A;  5IT9 O;  3EO3 A;  2NRZ A;  2O8B B;  3VGL A;  3OS0 A;  5KTQ A;  3UE5 A;  3THW A;  1VQ5 N;  2IVO A;  3DWL A;  2HHX A;  1LW0 A;  2YHX A;  2BE2 A;  1OH7 A;  1IJJ A;  4M3Z A;  1C1A A;  4IBN A;  1RTD A;  4M3X A;  1W97 L;  4GV9 A;  4N47 A;  2G8V A;  4NCA A;  3BUZ B;  4DMN A;  3SLC A;  4BE0 A;  1QHT A;  1E3M A;  1U49 A;  3VQQ A;  4FJ8 A;  1GLC G;  5JS2 A;  1NJI O;  1U04 A;  2NRH A;  4GNI A;  1I39 A;  5KQD A;  2P9S B;  1NK4 A;  3UKU B;  3CPE A;  1BL3 A;  4PKI A;  3FZH A;  4OPH A;  4CHZ A;  1X9M A;  2V7Y A;  3VES A;  3EE9 A;  4H0X B;  4AQY K;  4B1Z A;  2QWL A;  2ZQB A;  4CZH A;  5HL7 L;  3O1B A;  3OBY A;  4NB4 A;  1HNW K;  5EY4 A;  1Q18 A;  2IVN A;  4X65 K;  3R8E A;  4CBW A;  4DUZ K;  1C0G A;  4DQR A;  2F9W A;  3K5O A;  3DXM A;  2YV0 X;  2Z1G A;  4DSI A;  2G8I A;  3FR0 A;  2E1Y A;  2ZJP L;  4W5R A;  3KLE A;  5AR0 A;  3KKS A;  1RTJ A;  5DK5 A;  4FWN A;  2KLA A;  3HOS A;  3CQ8 A;  1X9J A;  4KKO A;  3U4L A;  2FSJ A;  3ZX2 A;  3VTH A;  2QTD A;  4I2P A;  5M1N A;  2HHH K;  3CF5 L;  1NGG A;  4HHT A;  5BR9 A;  2CH5 A;  1S9E A;  4CZE A;  1IBK K;  3BGR A;  2HW3 A;  4MFB A;  1IKY A;  1IKW A;  2AP1 A;  2EHG A;  4J8F A;  4E1N A;  5I42 A;  4ELU A;  2F8T A;  3KK3 A;  4KH5 A;  2IIR A;  4CHN A;  4AHC A;  1WOQ A;  2NRT A;  1T6D A;  4CD1 A;  3SCX A;  1Q82 O;  4N41 A;  3KKR A;  1HR0 K;  4FXD A;  4KH6 A;  3P83 D;  4DSF A;  3KVG A;  4ISE A;  5HRO A;  3SQ2 A;  4Z4I A;  4RW8 A;  2D0C A;  2XRI A;  4GMJ B;  4CJU A;  4GV3 A;  4JEP A;  3M8R A;  2P9L B;  4B9T A;  3P1G A;  4CFA A;  4ILH A;  3AA5 X;  3LDS A;  1RDA A;  3H3O B;  1IKX A;  4K41 A;  2HNZ A;  3ZSW A;  3O9S A;  2RPI A;  4Y1C A;  1KAX A;  1TAU A;  3WQU A;  5GIO A;  3GG4 A;  3QER A;  1EXQ A;  4CFC A;  4CJ3 A;  3DLE A;  1HLU A;  1ATN A;  4BE1 A;  4NLC A;  2A42 A;  3WNF A;  3PIP L;  3CCQ N;  1GOC A;  3O4N A;  3ZSZ A;  3V6D A;  3CME N;  5BRH A;  3V81 A;  1K8A O;  3U8X A;  1UOC A;  3A2F A;  3ZEU B;  3NDK A;  5AQL A;  3WEE B;  2VWB A;  3OYH A;  3TR8 A;  4CJ5 A;  2NZT A;  1JCG A;  4O8U A;  4FJI A;  2QWP A;  2HF3 A;  3K0S A;  4B8A B;  5LMU K;  3LAN A;  2RF2 A;  3ZET B;  2YJF A;  3PSF A;  4DFK A;  3SQ0 A;  5GIN A;  4O0I A;  1GLA G;  3MAQ A;  4CK2 A;  4CGJ A;  4CF1 A;  2B4J A;  4M3R A;  1KCF A;  4G9Z A;  5FPE A;  3AAP A;  5AQN A;  3CCM N;  4DR4 K;  3CM5 A;  4CED A;  4JK9 A;  3AO4 A;  3HYF A;  2VGN A;  1KVC A;  3K5M A;  4PA1 A;  4DV6 K;  2OAN A;  1GOB A;  4J2A A;  2ASM A;  2WTU A;  3VOV A;  4BAC A;  1RDC A;  1IH7 A;  2YNH A;  5LL6 Z;  3KLF A;  2VG6 A;  4WQ4 A;  4B1V A;  1KTQ A;  2UXD K;  2B5J A;  1U4B A;  4JKG A;  1SL2 A;  4J2D A;  1ATR A;  3H6E A;  2Y1J A;  3VEZ A;  4K42 A;  2P9N B;  4IFE A;  4XH5 A;  1MU2 A;  3J8A A;  3AVM A;  1VQ8 N;  3W3D A;  4CEE A;  3I0R A;  3CFR A;  4FJX A;  1TKX A;  1KQS M;  3OYA A;  1WSJ A;  5J2P A;  4BRG A;  4KO0 A;  3UKR A;  2XY7 A;  3V1Q A;  2IC3 A;  2P5G A;  4NYN A;  4B3O A;  2NNW A;  4MQ3 A;  1EWR A;  3SUQ A;  2YNF A;  4MO5 A;  5C2D A;  1Z26 A;  1YI2 N;  3ZEU A;  1A5V A;  4JN4 A;  1FKP A;  1YJW N;  1A5X A;  3VEX A;  3CER A;  1LOT B;  1GLD G;  3MWP A;  3TAQ A;  3VEV A;  3ZSX A; 
#chains in the Genus database with same CATH homology
 3AA3 A;  3LPU A;  4I9Q A;  3K5N A;  4OGC A;  4H8K A;  2HB5 A;  1HNI A;  4FW1 A;  3KLH A;  1RBV A;  4GW6 A;  4C8N A;  1C6V A;  1HNV A;  1B9F A;  1LAV A;  4B8C A;  1XI1 A;  3DM2 A;  4HTU A;  3VQ6 A;  4ELT A;  3PUF A;  4JRQ A;  4FZX C;  1JLA A;  1SL0 A;  3QIO A;  4IFV A;  3T3F A;  2RKI A;  4Z4H A;  4DQI A;  4CGH A;  1B9D A;  4KI6 A;  3LWL A;  4FJM A;  4LH4 A;  1ZYQ A;  4BDP A;  4CJF A;  3PV8 A;  4CEA A;  3ITH A;  2F96 A;  3TI0 A;  3F9K A;  1WLJ A;  3D45 A;  2OPS A;  2A1R A;  3LPT A;  3NF9 A;  4F2S A;  1ZBF A;  3OJS A;  4DFM A;  3TAF A;  1KVA A;  3QES A;  4AH9 A;  4AHT A;  3DRR A;  1IO2 A;  5CZ2 A;  5SWM A;  3CFO A;  3AO5 A;  3L2V A;  3FFI A;  1YVU A;  4R5P A;  2PZS A;  1RT5 A;  3C95 A;  2VWJ A;  4RW9 A;  4CJP A;  2XY8 A;  1HJR A;  3DYA A;  3TAR A;  2G8F A;  2G8W A;  4B9V A;  3EZ5 A;  1DTT A;  4HUG A;  2HHU A;  1TGO A;  3V9Z A;  5KGX A;  1NKB A;  1ITG A;  2OZS A;  3WNE A;  4FM2 A;  4FJ7 A;  4OKK A;  3QIN A;  3OVN A;  4KTZ A;  2QK9 A;  4KPY A;  2ATQ A;  2YKM A;  5J2Q A;  4KAZ A;  3E01 A;  2JGU A;  4F8R A;  3M8P A;  3ZCM A;  5EU7 A;  3DLK A;  4B08 A;  4FLV A;  4DS4 A;  4M42 A;  2IGI A;  3I0S A;  5HRS A;  1C0T A;  1UAX A;  1S1V A;  2X6S A;  3WNH A;  4M45 A;  4CF9 A;  4NYF A;  3T1A A;  3V9X A;  3K5L A;  1X9S A;  1NKC A;  1NK6 A;  2HHS A;  2GUI A;  1LWF A;  5KGW A;  4DTR A;  4CJK A;  3SUN A;  3QEV A;  1VSM A;  2D0A A;  3AVJ A;  4WE1 A;  1LWE A;  1T7P A;  4O0J A;  4UQG A;  4J2B A;  1ASU A;  2HHQ A;  3HVT A;  1JLB A;  4ID1 A;  2QKK A;  4EZ6 A;  2HND A;  4FJ9 A;  1EP4 A;  4CK1 A;  3HO1 A;  1NJY A;  4DQS A;  3ZT4 A;  2FC0 A;  3ZT0 A;  3L2R A;  4JS5 A;  3SNN A;  2KZM A;  1C0U A;  1RBT A;  1RIL A;  3OYN A;  1EKE A;  3HXM A;  1L5U A;  4H4O A;  1WSF A;  4HVJ A;  1QSS A;  3KK1 A;  3U3G A;  4N76 A;  2I5J A;  1EET A;  3ZT3 A;  4JRP A;  4FJJ A;  4CJW A;  3RMB A;  1BQN A;  1VSF A;  3L2W A;  3HT3 A;  4DU1 A;  3S3O A;  3RWU A;  4FVM A;  3S9H A;  1XWL A;  5KRT A;  4FLX A;  4K8Z A;  2HVH A;  3PX4 A;  1CXU A;  5DMR A;  1LAW A;  3O3H A;  3LWM A;  1QSY A;  2F8S A;  1J9A A;  4KTQ A;  3QEX A;  3NH1 A;  3LP1 A;  2GV9 A;  1Q9Y A;  4E3S A;  3SI6 A;  4B9N A;  3VQP A;  1WN7 A;  1W0H A;  4DSE A;  1S6Q A;  4FLU A;  3ZSR A;  3SV4 A;  3K57 A;  3B6P A;  1WSE A;  1TV6 A;  4LY7 A;  5J2M A;  4E0D A;  3DRP A;  4F3O A;  3HST B;  4LD0 A;  4Q5V A;  4HCB A;  4AIL C;  4CIG A;  4ZTJ A;  4DSL A;  2DFH A;  5I3U A;  4EZ9 A;  4FJK A;  3BDP A;  5FDL A;  4B9U A;  4CER A;  4E7K A;  5JS1 A;  1RBS A;  4FLT A;  3VQ7 A;  3THV A;  1Q9X A;  5C24 A;  1RTI A;  3OYI A;  1BCM A;  4W5Q A;  5J2N A;  2PYL A;  3SZ2 A;  1CXQ A;  1LWC A;  4FCY A;  4QCL A;  1KLN A;  3KLI A;  1T03 A;  4DTO A;  3VQA A;  4F2R A;  1L3T A;  4BDY A;  2IOC A;  2P51 A;  3OYE A;  4BDZ A;  4PQU A;  1VSH A;  5HRP A;  3MXI A;  3OYM A;  1JLF A;  3QEI A;  3NCI A;  1T05 A;  1W9H A;  4JS4 A;  4Z4F A;  3LZJ A;  2Q3S A;  4CJL A;  2R7Y A;  3G10 A;  3RRG A;  1BI4 B;  4OPK A;  3OY9 A;  1NJZ A;  3V1O A;  4CJV A;  3NF8 A;  2QKB A;  1YT3 A;  4DG1 A;  3K59 A;  1NK0 A;  1FKO A;  5SZT A;  3SPY A;  4KTW A;  3VQ8 A;  4CES A;  5C42 A;  2Z1J A;  3AV9 A;  3AVN A;  4DFP A;  4KHY A;  1C0M A;  1N6Q A;  2YNG A;  1NK5 A;  1KVB A;  3ISN C;  3PO4 A;  4CHP A;  3QET A;  3NGI A;  1TKT A;  2OPP A;  3DLG A;  1VSD A;  3AO3 A;  4RG8 A;  3VQ9 A;  1QSL A;  2P5O A;  3VN5 A;  4FK0 A;  1Q8I A;  2KQ2 A;  3KK2 A;  4IG0 A;  3SUP A;  3CM6 A;  3NF7 A;  5CZ1 A;  3AVI A;  1ZBL A;  2OYQ A;  4FZZ A;  4KI4 A;  5HBM A;  3ZT1 A;  2PY5 A;  2ITG A;  1RT6 A;  3NAE A;  1BIU A;  2O4G A;  2G8U A;  3HJF A;  4FZY A;  2FBX A;  3AVH A;  1I3A A;  3TAP A;  4G1Q A;  5FRM A;  3EY1 A;  4FLW A;  4LSL A;  4DQP A;  1C1C A;  3V1R A;  3NE6 A;  4FM1 A;  3DLH A;  4O4G A;  2OZM A;  3VQB A;  2G8H A;  2HHT A;  1BQM A;  1DLO A;  3DLB A;  1QQC A;  4CHQ A;  3SPZ A;  1JKH A;  2YHA A;  4FW2 A;  4J2E A;  4B9S A;  3OYB A;  3TWH A;  1XHX A;  2LSN A;  5KRS A;  2FBV A;  1D8Y A;  1J53 A;  3VA0 A;  3ALY A;  4ELV A;  1T8E A;  2KFN A;  1VSE A;  1WNS A;  4EP4 A;  3L2U A;  1YTA A;  4CJQ A;  4DTX A;  1CZ9 A;  4CIE A;  4E7I A;  3LZI A;  5FRN A;  3AVF A;  3OS0 A;  1HMV A;  1HYZ A;  3OS2 A;  1WAF A;  5KTQ A;  1VSL A;  2EX3 A;  1SKW A;  4CCH A;  3PY8 A;  4CJR A;  2HHX A;  4C8M A;  3MXM A;  1LW0 A;  2G8K A;  2DY4 A;  2BE2 A;  4DQQ A;  1KRP A;  2DTU A;  3T19 A;  4CJS A;  1JLC A;  1ASW A;  1KFD A;  1C1A A;  4E1M A;  4M3Z A;  4I2Q A;  4IBN A;  4CGG A;  4DS5 A;  1RTD A;  4DWI A;  4CF8 A;  4M3X A;  3NFA A;  3NHG A;  4DU3 A;  1VRU A;  3AVG A;  4E89 A;  1G15 A;  3ZSO A;  1B92 A;  4KRE A;  3HP6 A;  2JLE A;  1NOZ A;  4N47 A;  2G8V A;  4NCA A;  3K58 A;  2FBY A;  3V4I A;  3CFP A;  1A5W A;  1RDD A;  4DMN A;  3ASM A;  4CEC A;  4BE0 A;  3JYT A;  1S9G A;  4CIF A;  1QHT A;  4QAG A;  1U49 A;  3VQQ A;  1JL1 A;  4OGE A;  5JS2 A;  3PX0 A;  4FJ8 A;  1R0A A;  3NH0 A;  3VQ4 A;  2A1S A;  4PWD A;  1U04 A;  4AHS A;  1I39 A;  1L3U A;  1JLQ A;  1NK4 A;  4YNQ A;  1GOA A;  4Z0U A;  5J1E A;  3O3G A;  3OYG A;  3TAG A;  1SKS A;  1S1U A;  4PY5 A;  1TL3 A;  4OKJ A;  1RT4 A;  4KFB A;  3RR8 A;  3C6T A;  2XY6 A;  4OLA A;  3L3U A;  3V9W A;  1BL3 A;  4RW7 A;  1ZBU A;  1KLM A;  2IS3 A;  1F21 A;  4OKE A;  4OLB A;  3DLR A;  3MEG A;  2GBZ A;  1VRT A;  3DMJ A;  4CHZ A;  4O5B A;  1XHZ A;  3KIO A;  1X9M A;  3WNG A;  3SUO A;  1RT7 A;  1TL1 A;  3C6U A;  2WON A;  2E6L A;  2ZQB A;  3DOL A;  5KI6 A;  1ZBH A;  4Z4C A;  3OYC A;  4DTS A;  4HUF A;  4LH5 A;  4DQR A;  4FJG A;  3K5O A;  2YV0 X;  3VQ5 A;  3VA3 A;  3U3Y A;  3RMA A;  2Z1G A;  5HP1 A;  5CYQ A;  4DSI A;  4KHN A;  4M41 A;  4M3W A;  3KLG A;  3L3V A;  4FK2 A;  3AA2 A;  4AHV A;  4FK4 A;  1NKE A;  1Y97 A;  1VSJ A;  2BAN A;  4FLY A;  2G8I A;  4W5N A;  2XY5 A;  4W5R A;  3KLE A;  3KKS A;  4CHY A;  1RTJ A;  1RTH A;  5K14 A;  5DK5 A;  4EP5 A;  4ZHR A;  4NCB A;  2HVI A;  4DF4 A;  1FXX A;  1EX4 A;  3LP3 A;  3CQ8 A;  4KKO A;  4DF8 A;  3ZSV A;  4I2P A;  3CYM A;  4CGD A;  3AVK A;  2P1J A;  4AHR A;  1TVR A;  4FJN A;  4Z4E A;  4O44 A;  4HHT A;  1RT3 A;  4CK3 A;  1S9E A;  3BGR A;  4KHW A;  3LAL A;  4FYD A;  2HW3 A;  3MEC A;  3LP0 A;  4MFB A;  2OA8 A;  4DSJ A;  4DTJ A;  1VK0 A;  2NUB A;  2ZD1 A;  1IKY A;  1IKW A;  1BIZ A;  4BE2 A;  4CEB A;  1YTU A;  2EHG A;  4E1N A;  5I42 A;  3MXJ A;  4B9M A;  4ELU A;  4F3T A;  1XC9 A;  2F8T A;  3VQD A;  4CFD A;  2O4I A;  1J54 A;  3HVR A;  3F73 A;  3KK3 A;  4KHS A;  1ZBI A;  1UWB A;  2HNY A;  4CHN A;  3O3F A;  4AHC A;  4CEQ A;  4CJ4 A;  1C1B A;  2FBT A;  3AO1 A;  3RRH A;  1J5O A;  3SCX A;  1RDB A;  3KJV A;  1REV A;  4N41 A;  3KKR A;  3PX6 A;  1HRH A;  2VWK A;  2XO7 A;  4PUO A;  1VSI A;  1BGX T;  3IG1 A;  3SJJ A;  1JL2 A;  4FXD A;  2YNI A;  1NOY A;  3KTQ A;  2RN2 A;  1SKR A;  4B9L A;  3MEE A;  3P83 D;  4DSF A;  5HRO A;  2ETJ A;  1N5Y A;  3SQ2 A;  1TKD A;  3AVB A;  4Z4I A;  2OPQ A;  3L2Q A;  3U6F A;  4RW8 A;  1WSI A;  2D0C A;  3MED A;  3SV3 A;  2ZE2 A;  1WSG A;  1WAJ A;  1L3S A;  2XHB A;  2XRI A;  4GMJ B;  4CJU A;  1HYV A;  3RTV A;  3SYZ A;  4BWJ A;  3M8R A;  3AVL A;  4B9T A;  2D5R A;  3P1G A;  4CFA A;  3OYK A;  3TAE A;  3AA5 X;  3LDS A;  4ICL A;  1U48 A;  1RDA A;  4CEF A;  3H08 A;  4AHU A;  1IKX A;  4IG3 A;  1BI4 A;  2HNZ A;  3ZSW A;  3EYZ A;  2RPI A;  3LAM A;  4ID5 A;  4Y1C A;  1TAU A;  3S3N A;  1D5A A;  2HMI A;  3QO9 A;  4N5S A;  3OS1 A;  1EXQ A;  3QER A;  1TK0 A;  2BGG A;  4CFC A;  4FJ5 A;  4CJ3 A;  3RMC A;  3DLE A;  4KB1 A;  1SV5 A;  4M3U A;  4BE1 A;  1Z25 A;  3ZT2 A;  3QIP A;  2E6M A;  3KD1 E;  5C25 A;  3WNF A;  4IKF A;  4E7L A;  3M8S A;  1GOC A;  3O4N A;  4E7H A;  1S1W A;  1RBU A;  4NCG A;  3ZSZ A;  2Y1I A;  2BDP A;  3V6D A;  2AJQ A;  3V81 A;  1HQU A;  3C94 A;  3NH2 A;  2DFE A;  1FK9 A;  4CEZ A;  3S3M A;  4FJH A;  1UOC A;  4F4K A;  3A2F A;  3NDK A;  3K2P A;  4FM0 A;  4KHU A;  4DTP A;  1TK5 A;  2YKN A;  3HK2 A;  3TAM A;  2VG5 A;  1L3V A;  4E19 A;  3D0P A;  5HRR A;  2QXF A;  1HQE A;  4CE9 A;  3OYH A;  1NJX A;  3L8B A;  3TR8 A;  3ZSY A;  3DOK A;  4CJ5 A;  1NK8 A;  3OYD A;  1NK9 A;  1UA0 A;  1IG9 A;  5D3G A;  4I7F A;  1K6Y A;  1SL1 A;  4FJI A;  1VSK A;  4HCC A;  3DRS A;  2W42 A;  4CF2 A;  1TKZ A;  4B8A B;  3G0Z A;  4DLG A;  3LAN A;  4DTN A;  1TAQ A;  3JSM A;  4DTM A;  2OPR A;  2RF2 A;  4TSX A;  1JLG A;  4RW4 A;  3NGY A;  4YFU A;  3HPO A;  3V9S A;  4DFK A;  3SQ0 A;  1NK7 A;  2PYJ A;  3NF6 A;  4W5O A;  4H4M A;  4O0I A;  4KB0 A;  4Z4G A;  1DTQ A;  3V9U A;  2HHV A;  2HHW A;  4CJE A;  3MAQ A;  3IAY A;  3DI6 A;  4CK2 A;  1BIS A;  2VG7 A;  4CGJ A;  4CF1 A;  3RR7 A;  3UIQ A;  2DFF A;  1QE1 A;  2B4J A;  4M3R A;  1KCF A;  3ULD A;  4KHQ A;  3HL8 A;  1JLE A;  4CF0 A;  5HLF A;  4LSN A;  1D9F A;  3AO2 A;  5T7B A;  2KW4 A;  3AVA A;  4K8X A;  1RCH A;  1IKV A;  3CM5 A;  4O55 A;  4OJR A;  3IS9 A;  3QLH A;  4CED A;  4I9L A;  2Z1I A;  4W5T A;  1QS4 A;  3VQE A;  3AO4 A;  3TAN A;  4GVM A;  3P5J A;  3HYF A;  3OYJ A;  1S5J A;  1KVC A;  3K5M A;  4PA1 A;  2YHB A;  3VQC A;  3OJU A;  3HP9 A;  4ZTF A;  1D9D A;  2WOM A;  1RT1 A;  1GOB A;  1TK8 A;  3KD5 E;  3AVC A;  4J2A A;  4CGF A;  4QOZ B;  4KRF A;  1UA1 A;  2IDO A;  1WSH A;  3AA4 A;  4BAC A;  3TAB A;  1RDC A;  1IH7 A;  2YNH A;  4Q0B A;  1BCO A;  4CGI A;  3KLF A;  2VG6 A;  1LW2 A;  3ZSQ A;  3QEP A;  1KFS A;  1KTQ A;  3HPG A;  2Z1H A;  1CLQ A;  2B5J A;  1NJW A;  1U4B A;  4N56 A;  1SL2 A;  4J2D A;  4CHO A;  2D0B A;  1O1W A;  4M3Y A;  4DFJ A;  1CZB A;  2Y1J A;  4CJT A;  3I8D A;  2KFZ A;  5CYM A;  2KTQ A;  1HYS A;  3OYL A;  4HUE A;  3B6O A;  1MU2 A;  3O4Q A;  3OYF A;  3AVM A;  1JXB A;  3HPH A;  1U45 A;  1RBR A;  4CEE A;  4FLZ A;  3I0R A;  4RW6 A;  1HPZ A;  3CFR A;  4FJX A;  1TKX A;  1X9W A;  3OYA A;  2X6N A;  3SQ1 A;  1WSJ A;  4DU4 A;  4C8L A;  4L8R B;  4JLH A;  5J2P A;  1KSP A;  1ASV A;  3QNO A;  2X74 A;  4KO0 A;  4BWM A;  3CG7 A;  4FJL A;  4KV8 A;  2KZZ A;  2XY7 A;  4IDK A;  5FRO A;  3V1Q A;  4XIU A;  5CY4 A;  2IC3 A;  4E7J A;  4NYN A;  1U47 A;  2P5G A;  4B3O A;  4CEO A;  3NGZ A;  4C8K A;  4MQ3 A;  4OVL A;  1X1P A;  5HRN A;  2YNF A;  3SUQ A;  1S1X A;  4C8O A;  4M3T A;  3SQ4 A;  1BHL A;  4CFB A;  3QEW A;  4OPJ A;  1Z26 A;  2X78 A;  3LP2 A;  4Y1D A;  1A5V A;  2IAJ A;  3IRX A;  1FKP A;  1JXE A;  1A5X A;  2B6A A;  1RT2 A;  3NBP A;  4IFY A;  4DTU A;  3RMD A;  3M8Q A;  3PO5 A;  1S1T A;  1QTM A;  4DLE A;  2E4L A;  1LV5 A;  3HM9 A;  3QNN A;  3TAQ A;  4DSK A;  3LAK A;  5E41 A;  1SUQ A;  1S6P A;  3ZSX A;  1RNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...