2G8UA

B. halodurans rnase h catalytic domain d132n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8uA00
4F3OA 4CJUA 4E89A 3L2WA 4YNQA 1WSEA 3LWMA 1U04A 2HNDA 1EETA 3TWHA 1A5XA 3S3MA 1NK8A 2QK9A 1YVUA 4IBNA 1NK7A 4FJIA 4DQRA 4RW7A 1UA0A 1Y97A 3BGRA 1BIZA 1NOYA 2EX3A 2Z1JA 4KKOA 2D0AA 4W5QA 1LAWA 5C42A 4CK1A 3QERA 3RRHA 1JLGA 1TKDA 1HQEA 2B6AA 3P1GA 3PX6A 1S1VA 3PO5A 1W9HA 3NDKA 4CHYA 2NUBA 2RF2A 3K5LA 3LZJA 1L5UA 1SKWA 4CJRA 5FRMA 4NCGA 1X9MA 4ELVA 3FFIA 3VQCA 4FJHA 4FK4A 2HHVA 4E7LA 4DTPA 2FC0A 3MEGA 4DTNA 3NBPA 4FK0A 4FJJA 3AVCA 3PO4A 4LH4A 2P5GA 4J2DA 4FZZA 4M3WA 1JXEA 3V9UA 4FJLA 1UAXA 4KAZA 2DY4A 3AO4A 3SQ1A 1VRUA 4O55A 4B9MA 4EZ9A 3L2UA 3T3FA 4KPYA 1KVAA 2ZQBA 3AVLA 3IS9A 3VQ5A 3DRPA 3VN5A 3A2FA 3C6TA 4LD0A 1RCHA 4FW1A 3TR8A 3LAKA 3VQPA 1TK0A 3RR7A 1VSHA 3EZ5A 4AHCA 3CG7A 4KFBA 3HP9A 1NK5A 2I5JA 2KZMA 2X6SA 4H4OA 1XWLA 1FKPA 1L3TA 4RG8A 3L3VA 1NJYA 3MEEA 3THVA 1T05A 4HUEA 1WLJA 3MEDA 4EP4A 4KI6A 1NK0A 1QQCA 1J5OA 3NF7A 5J2QA 1KVBA 3V81A 3HK2A 4LSNA 1IKXA 3MXJA 4CJ3A 4M45A 3SUNA 3HYFA 2HNYA 3HT3A 3WNGA 3OYGA 4B9NA 2VWKA 2ATQA 2D0CA 1GOAA 2Z1HA 3KLGA 4OJRA 4CJLA 1NJZA 1KVCA 1GOCA 1HJRA 3OYDA 1QSYA 1U48A 4FXDA 2BE2A 4IKFA 3HVRA 3JSMA 4H4MA 3HPGA 3IAYA 2LSNA 4N76A 2KQ2A 4CK3A 4RW9A 4JLHA 1TKTA 3VA3A 3EY1A 1DTQA 4CHNA 4BACA 4FM0A 4KTZA 1NKCA 1JLBA 3QEPA 1G15A 3OYFA 4ICLA 4CJWA 3NHGA 1W0HA 4OPKA 1VSLA 2RN2A 1YTUA 1JL2A 4HUFA 2KW4A 2FBYA 4CF8A 3SI6A 4NCBA 4DTJA 3NF8A 3TABA 3SUQA 2BANA 3CFOA 3K5OA 2B5JA 1B9FA 3G10A 3NCIA 3LP1A 5FRNA 1QSSA 5I3UA 3HO1A 1RT1A 1YT3A 2GBZA 1RBSA 3L2QA 4NCAA 1UWBA 3HM9A 3T19A 4DQPA 4CJKA 4E19A 4FJ7A 3PUFA 3M8QA 3OYHA 2YKNA 1WSFA 1ZBFA 4DS4A 1O1WA 3NAEA 1VRTA 2YNIA 3RR8A 3SUOA 3SV4A 3LP0A 3U3GA 4E7KA 4DSLA 4WE1A 1QSLA 1IKWA 3L3UA 5SZTA 1KSPA 4M3UA 2Y1IA 3K2PA 2HVHA 4DFJA 3OYLA 3OYCA 3KLEA 1X9WA 2XO7A 3TAFA 1HYSA 5CY4A 3L2RA 4K8ZA 1RTJA 3AO2A 1IO2A 2X78A 4E1MA 4Z4CA 3DOLA 5EU7A 1HNIA 3E01A 4KHSA 3HL8A 1EXQA 3NE6A 3U3YA 2HHUA 3OJSA 4ZHRA 4I9QA 4IFVA 1F21A 4Q5VA 1S1WA 4CJTA 3SPZA 3MXIA 2A1RA 4Z4IA 3AVIA 2WOMA 4W5OA 4CHPA 3D0PA 4R5PA 2XY7A 3SPYA 1TK5A 1S6QA 4N5SA 1KLNA 1S9EA 2A1SA 4FLVA 2G8UA 3NGYA 2XRIA 4I9LA 4HVJA 3K5MA 4HUGA 3QEXA 2PYJA 2KFNA 4W5NA 5J2MA 2Y1JA 3VQ4A 2G8VA 4CJPA 4O0JA 4N41A 1DLOA 1BCMA 2IDOA 2XY6A 4AHUA 3OYEA 2BDPA 3MXMA 4N56A 3NGIA 1HYVA 1ASWA 4I2QA 3V9ZA 4DTOA 3HVTA 4CGDA 3TAPA 3KTQA 4HCCA 1TKXA 4BDPA 3AVFA 1MU2A 5K14A 4DQSA 4KHUA 3P5JA 1BGXT 3VQDA 4DMNA 1XC9A 5C25A 3CYMA 3AVAA 2D5RA 3AVNA 3HSTB 5CYQA 5DK5A 3AA3A 1NKEA 3CM6A 4LSLA 4FLYA 1B92A 1RDAA 3LAMA 4IFYA 4CJ4A 4QCLA 1KRPA 4Z4GA 2BGGA 2B4JA 3RMDA 1JL1A 2X6NA 1RT4A 3C94A 2VG5A 4I7FA 4CF0A 4JRPA 1JXBA 2JLEA 4I2PA 1WSJA 4ELUA 2Z1IA 1RT5A 1KTQA 1U49A 2G8KA 4FLXA 3M8SA 1DTTA 4ELTA 4MQ3A 3AO5A 4J2EA 1S1UA 4CJQA 4DSJA 1KFDA 4CEQA 4BDYA 1RTDA 3DRSA 3MECA 1Z26A 1YTAA 4KHNA 2O4IA 4GW6A 1RBRA 3PV8A 4DTXA 2YKMA 4DQQA 2R7YA 1Q9XA 1L3VA 4J2AA 3I0SA 4KB1A 2ZD1A 4M3XA 4CK2A 4OKKA 4QAGA 2YHBA 1JLCA 3KD5E 1NJXA 4M3RA 1RDDA 4MFBA 3VA0A 2OPPA 2YNFA 4CHQA 3KD1E 4FLTA 4DF8A 1RBUA 2G8HA 4NYFA 4CE9A 4CHZA 4KHYA 1BIUA 3SYZA 1RNHA 2HMIA 4FLWA 2E4LA 3RWUA 4M41A 3QO9A 3B6PA 3S3NA 4ZTFA 1XHXA 1ZBUA 2VG7A 1HQUA 2OZMA 3LZIA 3KK1A 2OA8A 2HHWA 4CF2A 3DLGA 4CFCA 1HMVA 3KLIA 2QXFA 2HHSA 3TANA 4GVMA 1NK4A 1S9GA 1BISA 3KIOA 1VSMA 4CJ5A 1IG9A 4FZXC 3KK2A 5HBMA 3ZSZA 3L2VA 1VSIA 1KFSA 4CCHA 3ALYA 3NF9A 3K5NA 5D3GA 3C6UA 4KTWA 4NYNA 2PY5A 4B9UA 3RMCA 1I39A 2G8IA 3V6DA 1KCFA 4CIGA 5SWMA 3D45A 4BDZA 1ZBLA 4FJNA 4BWJA 1C1BA 1CZ9A 1QHTA 4PWDA 4BE0A 2D0BA 3ITHA 5FROA 1LW0A 3IRXA 4DWIA 4IDKA 5C24A 1BI4A 2KZZA 2VG6A 4E1NA 3LPUA 3OYIA 1WSIA 4FCYA 4AHRA 1B9DA 4F2RA 5DMRA 3SNNA 4B8CA 1U45A 3QLHA 4O0IA 2X74A 4ID1A 1TKZA 4OLBA 5KI6A 4BE1A 1SL1A 3B6OA 1FK9A 3K57A 3IG1A 2P1JA 1WN7A 4DFKA 4CGJA 2ETJA 3OJUA 3SJJA 3PY8A 4KHQA 1Z25A 4CEFA 3U6FA 1WNSA 3ZSRA 3ZT4A 1IKVA 4Y1CA 2KFZA 4FJ8A 4E7JA 1BI4B 4OGEA 1ZBHA 4B08A 2YNHA 2HW3A 1C0MA 4LH5A 3UIQA 2E6LA 2FBXA 3VQQA 2IC3A 2GV9A 4DG1A 4EZ6A 4FW2A 5E41A 4FYDA 1RT6A 1X1PA 4HCBA 2P5OA 3OS1A 2PZSA 1SV5A 4CEAA 2HHXA 3SCXA 1S1XA 3RTVA 1CXQA 2DFHA 3SV3A 4E7HA 3TI0A 3QIPA 4DTMA 3OS0A 3VQ7A 4CEBA 1JLEA 1TVRA 2RPIA 5KRSA 3V9SA 3QEVA 4CJEA 1LWFA 3DLBA 4L8RB 3ISNC 4O4GA 4BWMA 3NH2A 3AA5X 3OYBA 3KLFA 1LAVA 4PA1A 4DU1A 4FLUA 1VSKA 4AHVA 3BDPA 1Q8IA 4ZTJA 3LDSA 3TAQA 1S6PA 3OYJA 1C1AA 3QEWA 2WONA 1TL3A 1ZBIA 3NFAA 3V9WA 3VQEA 3OS2A 3WNHA 5KTQA 1LV5A 1BCOA 5JS2A 1TAUA 1RDCA 1RTHA 5HLFA 1IH7A 1KLMA 4CEDA 1VSFA 3ZSQA 4CECA 4E3SA 1S5JA 4CEOA 3HP6A 1RBVA 3WNEA 2O4GA 3QIOA 1BL3A 3ZT1A 3ZSVA 3SQ0A 1XHZA 4M3TA 1T8EA 1JLFA 2GUIA 3OYMA 4FJKA 1VSEA 3CFRA 5J1EA 4F3TA 4RW8A 3K58A 3ULDA 2HNZA 3ZSYA 5J2PA 4CEZA 4F4KA 3RRGA 4CIEA 1D9FA 1J54A 4KRFA 3M8PA 1UOCA 4RW4A 1SKRA 1J53A 3KLHA 4YFUA 5J2NA 4OKEA 1LWEA 4DTUA 2OYQA 4KI4A 3AO1A 4CFBA 2OPRA 2Z1GA 4FM2A 5I42A 3L8BA 3ZSOA 4DU3A 1FXXA 3ZSWA 3QNNA 4BE2A 3AVKA 2F8TA 4PQUA 3NGZA 3RMAA 3I0RA 1T03A 1N6QA 4F8RA 3ZT2A 3VQBA 3VQAA 1RDBA 2FBTA 2W42A 1D5AA 4XIUA 3V1OA 3VQ6A 3SQ2A 4FJMA 3DRRA 4DQIA 5CZ1A 4F2SA 1A5WA 1JLAA 3DLKA 3LANA 4AH9A 4C8KA 3O4QA 1ITGA 4K8XA 3RMBA 5HP1A 4TSXA 1VK0A 3LP3A 4E7IA 5KRTA 1NK6A 4HHTA 2IAJA 3K59A 1QS4A 3DI6A 4FZYA 4PUOA 1D8YA 3VQ9A 3HPOA 3LWLA 1LW2A 2F96A 3V1RA 4DSKA 3TAGA 2OPQA 4B8AB 5HRRA 3OY9A 4KTQA 4KO0A 4E0DA 3KK3A 3KJVA 1CLQA 1ASUA 3DMJA 4Z0UA 1FKOA 4CFAA 4Z4HA 1C0TA 4Z4EA 3G0ZA 4DLGA 3P83D 1RBTA 1J9AA 2HHQA 1QTMA 3PX0A 3QEIA 1REVA 2JGUA 3M8RA 2PYLA 1ASVA 4FLZA 4Q0BA 4PY5A 1L3UA 2DTUA 3HXMA 1HRHA 2XY8A 1VSDA 4FVMA 3AA4A 4IG3A 1A5VA 1NOZA 2YNGA 3F73A 5HROA 2IOCA 4DLEA 3AVMA 2KTQA 3AO3A 3AVBA 4RW6A 5HRNA 2VWJA 3TARA 1RILA 3DLHA 3TAMA 3ZT0A 1HYZA 3ZCMA 3TAEA 3S3OA 4OGCA 1TK8A 4CGGA 1UA1A 3LPTA 4CGIA 4DTRA 3OYKA 2ZE2A 3MAQA 3NH1A 1S1TA 5KGXA 1D9DA 3AVGA 2RKIA 5T7BA 3QETA 5FDLA 1X9SA 2YV0X 4JS5A 1CXUA 1L3SA 1CZBA 2OZSA 4GMJB 3AVHA 4QOZB 1WAFA 5CZ2A 3SZ2A 1RTIA 3NF6A 1RT3A 4ID5A 5HRPA 4JRQA 1EKEA 4DS5A 1R0AA 2F8SA 4B9SA 3OVNA 3V9XA 4KHWA 1I3AA 4G1QA 3CFPA 4DF4A 3HJFA 4DTSA 1WSHA 4B3OA 3O4NA 2IGIA 4N47A 1RT2A 3H08A 1BQMA 4CERA 4CHOA 1NJWA 2IS3A 2YHAA 1TV6A 3AVJA 1K6YA 1BHLA 4B9VA 4B9LA 4M3ZA 3HPHA 4CGFA 3SUPA 1XI1A 5HRSA 1SUQA 4UQGA 1SL2A 4CEEA 4C8LA 2XHBA 3SQ4A 3AA2A 4OLAA 1C0UA 4W5RA 4EP5A 2QKKA 1WSGA 4DSFA 3QINA 3DLRA 4JS4A 2DFFA 4CJVA 1U47A 2DFEA 3O3GA 1RT7A 1NK9A 1WAJA 2HB5A 4O44A 1JKHA 4C8MA 4LY7A 3NH0A 3LALA 4CIFA 2XY5A 1SL0A 4M42A 1GOBA 4KB0A 4FJGA 1T7PA 3ZSXA 4DFPA 3DYAA 4M3YA 4B9TA 1TGOA 5CYMA 4CF1A 2ITGA 1VSJA 1ZYQA 1JLQA 4CF9A 2P51A 3PX4A 1SKSA 3DOKA 1C6VA 3O3FA 3S9HA 2HVIA 1LWCA 4FJ5A 4FM1A 4CFDA 1TAQA 4Y1DA 4O5BA 3QESA 3WNFA 4W5TA 2QKBA 4FJXA 3DM2A 1QE1A 3DLEA 4OKJA 4AHTA 4Z4FA 1Q9YA 3OYAA 4C8OA 3KKRA 1HNVA 3VQ8A 3OYNA 1TL1A 4AILC 4AHSA 4J2BA 3F9KA 5JS1A 1C1CA 3LP2A 3V1QA 4IG0A 3EYZA 4KREA 2HHTA 4DSEA 4DU4A 4CESA 1N5YA 3JYTA 4FK2A 2Q3SA 3I8DA 1IKYA 3V4IA 4CGHA 1BQNA 3QNOA 2AJQA 1EP4A 3CM5A 1EX4A 4OPJA 4DFMA 3T1AA 4CJSA 3ZT3A 3C95A 1U4BA 3AV9A 4OVLA 4KV8A 5KGWA 3CQ8A 3KKSA 4FJ9A 4C8NA 4CJFA 2EHGA 1NKBA 2OPSA 2G8FA 3O3HA 2E6MA 2FBVA 2G8WA 4DSIA 1HPZA 3ASMA 4H8KA 4HTUA
chains in the Genus database with same CATH superfamily
3SAGA 1NGFA 2HNDA 2PFUA 3TWHA 4JD2B 4IBNA 5AZIB 1Y97A 1CZAN 2NRXA 4YDUC 2EX3A 2Z1JA 1HNXK 1VQ8N 3CMEN 1LAWA 1X9JA 3RRHA 4GY2B 1HQEA 2QA4N 4KH6A 4BVOA 3LZJA 4NLBA 3B8AX 4JI1K 1VQ6N 3MX5A 2FC0A 4DTNA 4BR9A 3AVCA 3PO4A 3C6HA 3TTFA 3ULEB 3AO4A 4B9MA 2ZQBA 3OBWA 3A2FA 3NVMA 4LD0A 3LAKA 4CI6A 3O9QA 2X6SA 4H4OA 1XWLA 1FKPA 1L3TA 1NJYA 3MEEA 1WLJA 4H0VB 1QQCA 5AQIA 3JAMO 1KAXA 3VEVA 1IKXA 4DR3K 3QICA 1DKGD 5LJWA 4U7BA 3M6GA 3F5TA 3NMUA 5M1QA 3OYGA 4EIAA 3MWPA 3CCUN 3THWB 3HPGA 4CK3A 4RW9A 3VA3A 4CHNA 3SJHA 1JLBA 1W0HA 3ID6A 2RN2A 4OPKA 1YTUA 5I9EB 1K9MO 2KW4A 1XC3A 3NF8A 3QBXA 2BANA 3K5OA 4WQ5C 2B5JA 3G10A 3NCIA 3HO1A 2P9IB 5FRNA 1RT1A 4NCAA 1UWBA 4B1YB 5AQQA 1WSFA 1ZBFA 3NAEA 2YNIA 3U3GA 4DSLA 4WE1A 4CZGA 4M3UA 2Y1IA 3GBTA 3K2PA 4WFAL 3KLEA 3OBYA 4JKEA 5AQJA 3R8EA 2XO7A 3TAFA 3FE1A 3AO2A 4E1MA 5EU7A 4KHSA 3D2FB 3U3YA 4ZHRA 4DV4K 4ISGA 1QVFM 1TK5A 4W5OA 3SPYA 3JXUA 1KLNA 4R5PA 1Y64A 1S9EA 4DKWA 2PYJA 4BRPA 3QEXA 4HUGA 4W5NA 5J2MA 4DV7K 2IDOA 2A41A 4AHUA 4N56A 1OVYA 4I2QA 3WUHA 3V9ZA 4HCCA 4CGDA 3AGRA 2O8EB 4BDPA 2AA4A 4WQ4A 5K14A 3VPZA 1XC9A 3CYMA 5CYQA 3DXMA 4H5WA 4A5BA 4FLYA 1B92A 5CR4A 1RDAA 3LAMA 3ZX3A 4CJ4A 2BGGA 2B4JA 1JL1A 1RT4A 2VG5A 2JLEA 3FZFA 2QI2A 1KTQA 3M8SA 2P9SA 3AO5A 3MCAB 4CJQA 4DSJA 4CEQA 4KHNA 5LL6Z 1YAGA 4DTXA 2R7YA 3I0SA 3A5NC 3T69A 5ELZA 5BRFA 3VOVA 4CBWA 1VQKN 1NJXA 3U9ZA 1ATNA 3UE5A 2PAVA 3THYA 4DR5K 2GUPA 3D2EA 4IEEA 4CHZA 2QWRA 1EWQA 4ISEA 2HMIA 2E4LA 4L3QA 1ZBUA 2VG7A 1HQUA 3LZIA 3KK1A 4CF2A 2VCPA 5AQXA 3KLIA 2QXFA 1NK4A 1S9GA 3KIOA 4CJ5A 3ZSZA 3NF9A 5D3GA 2PY5A 3V6DA 1KCFA 4CIGA 2UUCK 3D45A 3D6RA 4FJNA 4PL7A 4BWJA 1C1BA 5AFUA 1E3MA 3ITHA 5KQDA 5AQKA 4FCYA 4AHRA 1GLFO 4K42A 4F2RA 3WT0A 1WBDA 4BE1A 2QWOA 3O1BA 2QWNA 1WBBA 2NLXA 1K8AO 1K73O 1GLEG 2ITMA 3R3LA 4E7JA 1ZBHA 4B08A 2YNHA 3VGMA 1C0MA 5C12A 3CCLN 2E6LA 3VQQA 2GV9A 4DG1A 2QW9A 4YOUA 5E41A 3KZBA 5JVHL 2P5OA 5BPLA 1N8RO 3TI0A 3QB0A 3SK3A 1VHXA 3VQ7A 2RPIA 3V9SA 3QEVA 3DLBA 3ISNC 3NH2A 3AA5X 2ZJPL 4WCEL 1IBLK 4NXNK 3OYJA 4LFCK 3QEWA 1ZBIA 3V9WA 3OS2A 2D0OA 4MLEA 5C2FA 3WNHA 5KTQA 2NNWA 3HBTA 3MCPA 1RBVA 3WNEA 3QIOA 3ZSVA 2FLOA 5LMUK 3C65A 2JWLA 4F3TA 1Q18A 2Q36A 3OHRA 4CZJA 3TSUA 4YFUA 4BRCA 1T6CA 4DV2K 3KWIA 3ZX0A 2Z1GA 5BREA 3CJ7A 4FWKA 3ZSOA 3QNNA 1FXXA 3ZSWA 2F8TA 3AVKA 4NXMK 1N6QA 1T03A 2CGJA 4FVUA 4CVNE 4CZLA 4XIUA 3VQ6A 4FJMA 4DQIA 4F2SA 3RMBA 5HP1A 1VK0A 3LP3A 3ATUA 4E7IA 3DI6A 3CCSN 1D8YA 3A5MC 1Q86O 1JCEA 2P9UA 5MLCQ 4JKAA 2Q0UA 5HRRA 4E0DA 3KJVA 1CLQA 3DMJA 3G0ZA 1RBTA 3MK6A 3PX0A 4AF1A 4YOWA 2NRRA 1VSDA 3AA4A 4IG3A 1RDUA 1KAZA 1KC8O 3E9PA 4DLEA 3AVMA 4MLHA 2KTQA 2YCHA 3MMVA 3S3OA 4X62K 1VQMN 2ASMA 2Q97A 3VETA 3OYKA 2ZE2A 3NH1A 3AVGA 5FDLA 2YV0X 1L3SA 4JYAK 4QOZB 1WAFA 2P9IA 4DS5A 1RT3A 4ID5A 2F8SA 3OVNA 3E9LA 3DLLL 4B3OA 4B3RK 1MWMA 4DTSA 3L6QA 2IGIA 4BC2A 4FWSA 3H3OB 4CERA 3TPQA 4CHOA 1YITN 5ADXA 2IS3A 2Q1NA 1K6YA 3CI5A 3HPHA 1YIJN 4KHPK 4UQGA 5AZJA 1SL2A 2GELA 3H6EA 4H5NA 3DLRA 3D2FA 2DFFA 3CPEA 1RT7A 1ILYA 4C8MA 3NH0A 2XY5A 1SL0A 3AGKA 4XH4A 4KB0A 1T7PA 5CYMA 1DT9A 4CF9A 3S9HA 2HVIA 4FJ5A 4GV6A 2D1KA 4O5BA 3WEEA 1NGHA 2HMPA 3PLAA 3P4IA 2CH5A 4CZHA 2VGNA 4LF8K 3GE1A 5JS1A 4DSEA 1N5YA 2NRVA 2V7YA 1NGEA 3LM2A 3GOIA 4DFMA 4CJSA 3ZT3A 3C95A 3ENBA 3KKSA 4BQLA 4CJFA 2OPSA 3VF6A 2CGLA 4FO0A 4H5RA 2FBVA 4DSIA 1Z05A 3PIOL 4E89A 4YNQA 3LWMA 1U04A 3S3MA 1EETA 1A5XA 1YVUA 1NK7A 4FJIA 4A62A 4LFBK 2FF3B 3BGRA 3QMLA 4Y0WA 1MDUB 4CK1A 1XUPO 1WOQA 3P1GA 3VEOA 1S1VA 4OPHA 1W9HA 4YORA 2NUBA 2RF2A 1L5UA 4BRFA 3NVKA 2CGKA 1SKWA 3IMXA 4ELVA 3FFIA 4FK4A 4FJHA 2HHVA 1WUAA 3A8YA 4X64K 4E1JA 4FJJA 1R59O 4J2DA 4LH4A 4F9OA 5AQLA 4LC9B 5BPMA 2DY4A 3SQ1A 3J7AP 1VQ5N 4IOXA 3T3FA 1KVAA 4I6MA 3VN5A 3AVLA 4FL9A 1GLDG 1TK0A 3TR8A 3VQPA 4FW1A 1M90O 1O13A 1FJGK 3HI0A 3EZ5A 4BRMA 1NGGA 4KFBA 4H0PA 2ZM6K 1NK5A 2I5JA 4A5AA 2GWJA 2QWMA 4RG8A 1N32K 3THVA 4HUEA 1HPMA 2QEXN 1U2VB 4DUYK 5J2QA 4CJ3A 3SUNA 2HF3A 1NM1A 3VEWA 3HT3A 1GLAG 5LMNK 3AY9A 1GOAA 4OJRA 4YOTA 1HJRA 1QSYA 4FXDA 4IKFA 3HVRA 3JSMA 4H4MA 3IAYA 2VWBA 2KQ2A 5BN8A 1IBKK 4N76A 1DTQA 3FZKA 3O9TA 1K8KA 1G15A 4JN4A 4ICLA 2O8CA 1JL2A 3SI6A 4NCBA 3O8MA 1B9FA 1QSSA 3I33A 4DQPA 3P39A 1OH5A 4E19A 3ZEUB 1OKJA 3PUFA 3OYHA 1OH8A 1EQYA 3RR8A 1VQLN 3SV4A 1QSLA 1IKWA 3L3UA 5SZTA 1BUPA 3M5RA 5AQOA 2HVHA 5BN9A 2O8FB 1E4FT 2E2QA 1HYSA 1RTJA 1IO2A 2ASOA 1HNIA 4CJTA 4Z4IA 3L4QA 4GVEA 1S6QA 1D4XA 5F2RA 4FLVA 2G8UA 4I9LA 4BRDA 4CW7B 2VQEK 4GKKK 1DLOA 1BCMA 2UXDK 3OYEA 1ASWA 2HOEA 3KTQA 1TKXA 2IIRA 1BGXT 1IG8A 3MN7A 2J4RA 5C25A 3AVNA 3J80O 4EAHD 1SAZA 5M1KA 4IO8A 4UY8O 3P31A 1KRPA 1RFQA 3RMDA 4JRPA 1JJ2M 4ELUA 4NO7A 4ELTA 1DTTA 4JKGB 4MQ3A 5A2QO 1KFDA 1Z26A 1YTAA 2O4IA 4GW6A 3PV8A 4J2AA 1Q9XA 1L3VA 3O9UA 2YJEA 3L0QA 4DUZK 1C0GA 4OKKA 3M3ZA 1JLCA 4JK9A 2QWLA 2P9KB 2P9PB 1ATRA 4JI2K 4QS8A 1NU0A 3E66A 3KD1E 4FLTA 4CE9A 4KHYA 1TUUA 4JI0K 1BIUA 5KPRA 1M1KO 4CZKA 3B6PA 3PSFA 4YDUA 4FPBA 1JCFA 1NGDA 2ZGZA 4FWQA 4QS7A 1YJ9N 4H5TA 3CIPA 1HNWK 4J8FA 2E8AA 3L2VA 4CCHA 3ALYA 3EE8A 4KTWA 4B9UA 3RMCA 1XNRK 4BDZA 1S22A 1ZBLA 3LDPA 1KAYA 4JK8A 4B9QA 3CMAN 3BZKA 2D0BA 5FROA 3VF2A 4DWIA 5C24A 3LPUA 3OYIA 1WSIA 4CBUA 1B9DA 5GINA 5DMRA 3R1XA 1T44A 3U9DA 4B8CA 5CHIA 1U45A 4ID1A 4OLBA 3K57A 2P1JA 4CGJA 3OJUA 4JI8K 3ZT4A 1TYQB 4Y1CA 2KFZA 4H0XB 4FSVA 1BI4B 1VQ4N 3VGLA 4JI6K 4IXCA 1BOTO 3M1FA 3UIQA 2FBXA 4C1NK 2W40A 4PHTX 2V7ZA 4FW2A 3CC4N 3HOSA 1X1PA 3OS1A 2PZSA 4CEAA 1IBMK 4Z94A 2YHWA 2O8DB 5AQFA 5CE3A 1JLEA 4O4GA 4BWMA 3KLFA 4PKIA 4DU1A 4WQ5A 1VSKA 4FLUA 1I94K 4WQ4C 4O5FA 1S6PA 3TAQA 4B3MK 3CJ1A 2WONA 1TL3A 1W7AA 3F9MA 3VEXA 3NFAA 3CCJN 3D7EO 4BR2A 3DXKB 4KBOA 1BCOA 5BRHA 1RTHA 1HJOA 4RCHA 4E3SA 4JEPA 3HP6A 3W0LA 1BL3A 3ZT1A 4M3TA 1YVNA 3ZETB 3MN9A 3W3DA 1JLFA 3OYMA 1BA0A 3CFRA 4GKJK 3ULDA 2HNZA 1WB9A 4CEZA 3VTIA 3RRGA 4CIEA 4KRFA 1J54A 1QQMA 4OKEA 3CQXA 3AO1A 4CFBA 2UXCK 2OPRA 5JVGL 1IJJA 3C7NB 4F8RA 5F1XA 3BY5A 3VQAA 3CF5L 3EO3A 2WFBA 3V1OA 4PL8A 5CZ1A 4EHTA 5AFUH 3LANA 3O4QA 1ITGA 4TSXA 1NK6A 2IAJA 3FGUA 3K59A 4PUOA 3A0IX 1NMDA 3VQ9A 3LWLA 1LW2A 3ATVA 3V1RA 3I56N 4DSKA 4B8AB 4C1NI 3T1YK 3OY9A 4Z4EA 1C0TA 1BA1A 4DLGA 3P83D 1J9AA 2HHQA 1U2VA 4NB4A 1IV0A 2Q0RA 3CJCA 2UU9K 3QEIA 1REVA 4Q0BA 1ASVA 4FLZA 1L3UA 3HXMA 2XY8A 4FVMA 2PBDA 2YNGA 1HKBA 5HRNA 2VWJA 5BR8K 2NRWA 1HYZA 1GLBG 3TAEA 3CHWA 1TK8A 4CGIA 3MAQA 3LL3A 5BR9A 3VERA 2RKIA 1X9SA 3AAQA 1CXUA 2OZSA 5CZ2A 4EZ6A 3UKRB 4H0OA 4JRQA 4YOVA 1EKEA 3ZLJA 3CFPA 3VEZA 2O8BA 5AQTA 1S72N 4JKHA 3H08A 1NJWA 1QQOA 3AVJA 1JCGA 4B9VA 4M3ZA 4CGFA 3SUPA 1HKGA 1SUQA 2XHBA 4AM6A 4W5RA 3QINA 3S41A 4CJVA 1U47A 1N34K 2DFEA 4O44A 2HB5A 1XNQK 4M42A 1VQNN 2KKZA 1N33K 3ZSXA 4DFPA 1Q7YO 1VSJA 5BRDA 4LF9K 4DCHA 1C6VA 4CFDA 4RTFD 3QESA 3WNFA 4W5TA 4FJXA 1BO5O 1QE1A 3DM2A 4AHTA 1ZC6A 2OCEA 4Z4FA 3KVGA 1VQ7N 1HNVA 4RWTA 3OYNA 1TL1A 4MDAA 4AILC 1NWKA 4J2BA 3F9KA 5DM6L 1C1CA 3V1QA 4IG0A 3EYZA 3HRGA 1S3XA 4DU4A 1GLCG 1KQSM 4FK2A 2Q3SA 3I8DA 1DEJA 3V4IA 4XH5A 4CGHA 3ENOA 5E84A 4JD2A 2ZWHA 5AZIA 3VTHA 3MDQA 1U4BA 5KGWA 4KV8A 3CQ8A 4FJ9A 4C8NA 5FPNA 1NKBA 2G8FA 5M1OA 3IUCA 4H8KA 2WUSA 4F3OA 4CJUA 4JK7A 3L2WA 4PKGA 2QK9A 2P9LB 5EY4A 2E5LK 2D4WA 3WXIA 4DQRA 4RW7A 2YHXA 4O8KA 4LF7K 1BIZA 1NOYA 3ULEA 3BF1A 5JMVA 3KHYA 4W5QA 3LDOA 5C42A 3QERA 1JLGA 2V52B 1TKDA 2B6AA 4JKCA 3NDKA 4CHYA 4NCGA 3RSEB 5M1FA 3VQCA 3Q7BA 4IOAL 1T3VA 1JXEA 3V9UA 4DR7K 4FJLA 5TKYA 2ZF5O 4O55A 3FZMA 1YJWN 3IS9A 3VQ5A 1LV5A 1RCHA 4AHCA 3CG7A 3A5LC 1VQPN 3THWA 1NG9A 3K9JA 3SMPA 2NRZA 3MEDA 1NK0A 1HR0K 3HK2A 4LSNA 3WXKA 4M45A 4DV5K 4DB3A 4B9NA 2VWKA 2ATQA 3KLGA 2Z1HA 4CJLA 1KVCA 2GWKA 1GOCA 4JKBA 4WF9L 2JWKA 1HX1A 1U48A 2BE2A 1ZXOA 3EE9A 4K0KK 4JLHA 4BGBA 4BACA 4FM0A 4KTZA 3ENHA 1NKCA 4CJWA 3NHGA 4KH5A 3O4WA 4CF8A 4IDHA 4BRLA 3TABA 3R9PA 3TTDA 1QVGM 2GBZA 3L2QA 1RBSA 3U8XA 4CJKA 3M8QA 3THXB 2YKNA 1OH6A 4BC3A 3K9KA 3BUZB 1MA9B 3SUOA 4E7KA 5JLHA 2QXLA 3CD6N 5M1NA 4DFJA 3OYCA 4EHUA 5CY4A 3E01A 1EXQA 2O8EA 4IFEA 3J8AA 4IFVA 3SPZA 3O9SA 3MXIA 5GAGP 3AVIA 2WOMA 3J81O 3D0PA 2XY7A 2G8KA 2A1SA 3NGYA 2XRIA 4HVJA 3VQ4A 2G8VA 4CJPA 3CC7N 4BG8A 5FPMA 5JICA 4O8UA 4DTOA 3TAPA 3SLCA 3AVFA 3SBTA 1N36K 2H3GX 3P5JA 2RE2A 3H1VX 3AVAA 3HSTB 5DK5A 3AA3A 1HKCA 4LSLA 4EFHA 4IFYA 4BR0A 5AR0A 4QCLA 4Z4GA 4CF0A 4I7FA 1JXBA 4I2PA 1WSJA 2Z1IA 4WYBA 5KPTA 4FLXA 4DHYA 4YY3K 1RTDA 3DRSA 2UUAK 1QZ6A 2YKMA 2HBJA 3KK7A 5EVZA 4XEIA 2ZD1A 4KB1A 4M3XA 4X66K 4CK2A 4FOEA 2IVNA 4QAGA 3BP8A 4OX9K 3H46O 3HZ6A 3J7ZO 2FSKA 4MFBA 3G6EN 2P9SB 2YNFA 4CHQA 2D0PA 4NYFA 1NGAA 5IT9O 1RNHA 1YHQN 4JAXA 4M41A 3QO9A 4ZTFA 4BRIA 2OZMA 1LCUA 5B8HA 2OA8A 2AP1A 4CFCA 4DR2K 2W41A 3CCRN 2CH6A 2YHYA 4FZXC 1X3MA 4BRHA 1VSIA 1KFSA 3Q7CA 5M1PA 3THYB 4NYNA 3C6AA 3D2EB 1I39A 2YX6A 4IJAA 2G8IA 1CZ9A 1QHTA 4BE0A 3BEXA 3QFUA 3IRXA 2IVPA 3I55N 4JI7K 3KWGA 4K41A 4JHDB 3N4QA 3QLHA 2YI1A 5AQYA 4O0IA 2GEMA 3OTOK 3IG1A 4FOIA 3CCQN 1WN7A 3WXMB 4DFKA 3EEQA 2ETJA 4BVPA 3SJJA 1YJNN 2E2NA 3PY8A 4KHQA 1Z25A 2A3ZA 3U6FA 1WNSA 1QHAA 4H03B 3ZSRA 4YHHK 1ATSA 1QZ5A 4CZEA 4FYDA 1RT6A 4HCBA 2HHXA 3O9RA 1S1XA 3VF4A 1CXQA 4E7HA 3CETA 3QIPA 4DTMA 3VESA 2E2OA 3OS0A 3L4IA 1DGKN 1LWFA 3TSQA 2NRHA 5IWAK 4A59A 3BDPA 1Q8IA 4ZTJA 5AQWA 4IEIA 2QWQA 5JS2A 1TAUA 5HLFA 1IH7A 2ZGYA 4CEDA 4CECA 3ZSQA 4YOYA 5GIPA 3SQ0A 2RHKA 2GUIA 5J1EA 4LFAK 3K58A 2VYPA 2FF6A 4F4KA 3WXJA 4HWIA 5KPZA 1D9FA 3AARA 3AAPA 1UOCA 3M8PA 4RW4A 1SKRA 1J53A 5J2NA 1BDGA 1LWEA 4CZMA 4DTUA 3HM8A 2OYQA 3CCMN 3CCEN 4FM2A 5I42A 2E88A 3L8BA 4DU3A 4PQUA 4BE2A 1C0FA 3ZT2A 3VQBA 2QTDA 3DRRA 1A5WA 3DLKA 4K8XA 4DQ8A 3LDLA 4FZYA 1QS4A 2OANA 1LOTB 3G4SN 3HPOA 3O1WA 3TAGA 2ZJQL 4KTQA 3UKUB 4DV3K 1EO1A 4CFAA 3U4LA 1NMNA 2GX9A 2PYLA 3M8RA 2JGUA 2DTUA 4BRNA 3O5BA 5AJ3K 1NOZA 5HROA 2IOCA 3AO3A 3AVBA 4RW6A 2P9UB 1RILA 3DLHA 3FZHA 4AM7A 3GG4A 4NLCA 4CGGA 3LPTA 5KGXA 2IVOA 5T7BA 3TU5A 3QETA 3E1YA 1VAZA 3HOTA 3AVHA 3SZ2A 1RTIA 4JI3K 4B9SA 1NBWA 3HJFA 1I3AA 5BPNA 1WSHA 3O4NA 3THXA 1RT2A 1NGBA 3GL1A 4V19S 3ZYYX 1NLVA 2YHAA 1TV6A 4KH4A 1GLLO 1SZ2A 4CEEA 5GAHP 3SQ4A 1X3NA 4EP5A 1U6ZA 2E1YA 1WSGA 4DSFA 2OTLN 1RDWX 3CJ9A 3TSPA 3O3GA 4A2BA 1WAJA 1NK9A 3LALA 4CIFA 2A5XA 4FJGA 3MN5A 1J5EK 1TGOA 4CF1A 2ITGA 4B1ZA 1ZYQA 1JLQA 1NGIA 2P51A 3PX4A 3DOKA 3E9OA 1SKSA 3O3FA 4FM1A 3QDKA 4BR4A 5AZJB 4Y1DA 2QKBA 3DLEA 1OVQA 1Q9YA 4C8OA 4BR7A 3KKRA 3CJBA 2E2PA 3LP2A 2HHTA 4KREA 4IJNA 3JYTA 1IKYA 2BUPA 3QNOA 4BY9C 1EP4A 5C2DA 3CM5A 4LF5K 1EX4A 2Q2RA 4DR6K 3WEEB 4OPJA 4OVLA 1HUXA 4U67L 3SMSA 3CCVN 4FWNA 2EHGA 3OW2M 3O3HA 1BG3A 4ILHA 2G8WA 1HPZA 4BC5A 4HTUA 1WSEA 2A42A 1NK8A 4ILGB 1H1VA 1UA0A 3CERA 4KKOA 2D0AA 2QM1A 3PX6A 3PO5A 4M63C 2UUBK 3K5LA 1SQKA 5FRMA 4CJRA 1P90A 2BTFA 1Q82O 1X9MA 4E7LA 4DTPA 3MEGA 3NBPA 5HL7L 4FK0A 1SS6A 2WTUA 4M3WA 2P5GA 4FZZA 1UAXA 3UB5A 3VENA 4KAZA 1VRUA 4EZ9A 4FWMA 3L2UA 4KPYA 2NZTA 4CEFA 3DRPA 3C6TA 1VQON 3RR7A 1VSHA 2VGMA 3HP9A 2KZMA 3L3VA 1T05A 4KI6A 2F9TA 4EP4A 4WFNL 1J5OA 3NF7A 3V81A 1KVBA 2P9NB 3MXJA 4GNIA 4JHDA 4CBXA 5HOOA 3HYFA 2HNYA 5C15A 3WNGA 4I6MB 2D0CA 4BRQA 1G99A 4MO5A 1NJZA 5AQZA 3OYDA 5JLFA 4YOXA 5LY3A 3ZEUA 5FLXO 3N4PA 2WBNA 2LSNA 5FPDA 1TKTA 4LF6K 3EY1A 3GDQA 3QEPA 3OYFA 1VSLA 2O8FA 4HUFA 3EL2A 2FBYA 5AQPA 4BGAA 4BG9A 4DTJA 3PIPL 3SUQA 3CFOA 4M7YA 1YXQA 2EWSA 3LP1A 5AQMA 5I3UA 1YI2N 1YT3A 4FPAA 4WFBL 3HM9A 3T19A 1NGJA 3T7ZA 4FJ7A 1YF5L 2OTJN 4DS4A 1O1WA 1VRTA 4DR1K 5GADP 5DM7L 1NJIO 3G25A 3LP0A 4IOCL 1KSPA 1K8KB 3OYLA 4JKFA 4JI4K 5H1SQ 1X9WA 3SBGA 1Q81O 1Z6RA 3ZX2A 2O8CB 3L2RA 2FSJA 4K8ZA 1KD1O 2X78A 4Z4CA 5C10A 3DOLA 3EKSA 2HHUA 2KHOA 3HL8A 5AQVA 3NE6A 2FSNA 3OJSA 4I9QA 1F21A 4Q5VA 1S1WA 2A1RA 3PSIA 4FWOA 1NGCA 4CHPA 4N5SA 3VEYA 3VGKA 3K5MA 4HTLA 5AQGA 2KFNA 2Y1JA 4X65K 1ESVA 4O0JA 4B1XB 4N41A 4B3TK 4A61A 2XY6A 2F9WA 3TTCA 2BDPA 3MXMA 3NGIA 1HYVA 3HVTA 1MU2A 4JKGA 4DQSA 4KHUA 3VQDA 4DMNA 2D5RA 5GIOA 4BR5A 1NKEA 3H1QA 3CM6A 3EZWA 4K43A 3MN6A 3C0BA 3FZLA 2X6NA 4BRGA 3C94A 4JI5K 2HBMA 1P8ZA 4MO4A 1RT5A 5E26A 1U49A 2P9KA 2P9PA 3SAFA 4J2EA 1S1UA 4BDYA 3MECA 1EWRA 3FLCO 4GV9A 3WQUA 1RBRA 2ZJRL 3IFRA 3UKUA 4ILJA 2YJFA 2YHBA 4FWLA 4CD1A 3CC2N 3KD5E 3K0SA 4M3RA 1RDDA 3VA0A 5AQNA 3WQTA 2OPPA 2HSTA 4MDBA 5EXWA 4DF8A 5ADXH 1RBUA 2G8HA 3SYZA 5GAEP 4FLWA 1XMOK 3RWUA 4CZIA 3S3NA 1XHXA 2HHWA 3DLGA 1HMVA 3SAHA 2HHSA 1HLUA 3TANA 4GVMA 1BISA 1VSMA 1IG9A 4DV6K 3KK2A 5HBMA 5AQRA 3FR0A 3K5NA 3C6UA 1GLJO 3G71N 1T6DA 5SWMA 5TKWA 2W6LA 4PWDA 1TYQA 1LW0A 2KZZA 2KLAA 4IDKA 1BI4A 2VG6A 4B1WB 4E1NA 1TUYA 1MWKA 4IO9L 4R79A 4A2AA 4BRKA 3SNNA 3CXCM 5EX5A 2X74A 1TKZA 5KI6A 1SL1A 2Q31A 2GTDA 1FK9A 3B6OA 2O8DA 2E20A 1IKVA 4FJ8A 4OGEA 4PKHA 2HW3A 4DV0K 1BWFO 4LH5A 4K25A 2IC3A 3LDNA 4BROA 1SV5A 3SCXA 3RTVA 2DFHA 3SV3A 3DXKA 3RVCA 4CEBA 5KRSA 1TVRA 4L8RB 3I8BA 2HBKA 4CJEA 4BC4A 3OYBA 4JV5K 1LAVA 3ZETA 4PA1A 1J6ZA 3J7YP 4AHVA 1FW6A 1XQSC 3LDSA 3IDHA 1C1AA 3WXLA 2I7PA 2ASPA 1RGIA 3VMFB 3VQEA 4FWRA 5EOYA 1RDCA 3A5OC 1KLMA 1VSFA 1S5JA 4CEOA 1YUWA 2O4GA 4JNEA 1XHZA 1T8EA 3C7NA 2DPNA 4FJKA 1VSEA 4RW8A 5J2PA 3ZSYA 2F4VK 4H0TB 3EKUA 2I7NA 4H5VA 1NNEA 3KLHA 4CZFA 2FXUA 4BRAA 4A57A 2E1ZA 1V4TA 3DWLA 2NRTA 4KI4A 5F0XA 3MWTA 3DXMB 2BH1A 3NGZA 3RMAA 3I0RA 4BQZA 1RDBA 2FBTA 4QS9A 2W42A 1D5AA 3SQ2A 1JLAA 2F7TA 3OA9A 4AH9A 4C8KA 3MX2A 1W97L 3JS6A 5KRTA 4HHTA 4JKDA 4B1UB 3P38A 4CD3A 3R6MA 1OH7A 4BREA 3T1HK 2F96A 4XH1A 1QQNA 2OPQA 3HTVA 4CJ7A 3CPWM 3LDQA 3O6WA 4KO0A 3KK3A 1ASUA 4Z0UA 1FKOA 4Z4HA 5C0YA 4IWVA 5AQHA 3F2KA 1QTMA 2P9NA 1E4GT 5LJVA 4PY5A 1HRHA 3FFKB 4H0YB 3UKRA 1A5VA 3F73A 5FPEA 3CQYA 1W2BM 3BZCA 3TARA 3TAMA 3ZT0A 3ZCMA 2QWPA 2UYTA 4OGCA 3QBWA 1UA1A 4DTRA 4G9ZA 1S1TA 1D9DA 4B1VA 4JS5A 1CZBA 4GMJB 2UXBK 3EN9A 2V51B 3NF6A 5HRPA 1R0AA 3V9XA 4KHWA 3ID8A 4G1QA 4DF4A 4N47A 4OO1J 4FWPA 4OPAA 4DV1K 1BQMA 4AQYK 4C23A 3H45C 1BHLA 4B9LA 3QFPA 1XI1A 5HRSA 4C8LA 3AA2A 4OLAA 2HBLA 4GV3A 1C0UA 2QKKA 2A40A 3O08A 3H3NO 4JS4A 2W6KA 1JKHA 4LY7A 5KQ8A 1V4SA 3BF3A 1GOBA 2O8BB 3DYAA 4M3YA 4B9TA 2HF4A 3IKMA 1KXPA 3DAWA 1LWCA 3CJAA 1TAQA 1ZBSA 1HNZK 4LF4K 3LM9A 2A6AA 2WC9A 4OKJA 1XMQK 3OYAA 1VQ9N 3VQ8A 4B3SK 1BU6O 4AHSA 4CESA 1BQNA 2AJQA 2P9LA 5AQUA 3T1AA 5AQSA 3AV9A 3DJCA 4ISFA 3HSCA 4M7XA 2HHHK 4DR4K 2E6MA 2VQFK 3O80A 3ASMA 3RSEA 4DQQA 4IZ9A
chains in the Genus database with same CATH topology
4F3OA 4CJUA 4E89A 3L2WA 4YNQA 1WSEA 3LWMA 1U04A 2HNDA 1EETA 3TWHA 1A5XA 3S3MA 1NK8A 2QK9A 1YVUA 4IBNA 1NK7A 4FJIA 4DQRA 4RW7A 1UA0A 1Y97A 3BGRA 1BIZA 1NOYA 2EX3A 2Z1JA 4KKOA 2D0AA 4W5QA 1LAWA 5C42A 4CK1A 3QERA 3RRHA 1JLGA 1TKDA 1HQEA 2B6AA 3P1GA 3PX6A 1S1VA 3PO5A 1W9HA 3NDKA 4CHYA 2NUBA 2RF2A 3K5LA 3LZJA 1L5UA 1SKWA 4CJRA 5FRMA 4NCGA 1X9MA 4ELVA 3FFIA 3VQCA 4FJHA 4FK4A 2HHVA 4E7LA 4DTPA 2FC0A 3MEGA 4DTNA 3NBPA 4FK0A 4FJJA 3AVCA 3PO4A 4LH4A 2P5GA 4J2DA 4FZZA 4M3WA 1JXEA 3V9UA 4FJLA 1UAXA 4KAZA 2DY4A 3AO4A 3SQ1A 1VRUA 4O55A 4B9MA 4EZ9A 3L2UA 3T3FA 4KPYA 1KVAA 2ZQBA 3AVLA 3IS9A 3VQ5A 3DRPA 3VN5A 3A2FA 3C6TA 4LD0A 1RCHA 4FW1A 3TR8A 3LAKA 3VQPA 1TK0A 3RR7A 1VSHA 3EZ5A 4AHCA 3CG7A 4KFBA 3HP9A 1NK5A 2I5JA 2KZMA 2X6SA 4H4OA 1XWLA 1FKPA 1L3TA 4RG8A 3L3VA 1NJYA 3MEEA 3THVA 1T05A 4HUEA 1WLJA 3MEDA 4EP4A 4KI6A 1NK0A 1QQCA 1J5OA 3NF7A 5J2QA 1KVBA 3V81A 3HK2A 4LSNA 1IKXA 3MXJA 4CJ3A 4M45A 3SUNA 3HYFA 2HNYA 3HT3A 3WNGA 3OYGA 4B9NA 2VWKA 2ATQA 2D0CA 1GOAA 2Z1HA 3KLGA 4OJRA 4CJLA 1NJZA 1KVCA 1GOCA 1HJRA 3OYDA 1QSYA 1U48A 4FXDA 2BE2A 4IKFA 3HVRA 3JSMA 4H4MA 3HPGA 3IAYA 2LSNA 4N76A 2KQ2A 4CK3A 4RW9A 4JLHA 1TKTA 3VA3A 3EY1A 1DTQA 4CHNA 4BACA 4FM0A 4KTZA 1NKCA 1JLBA 3QEPA 1G15A 3OYFA 4ICLA 4CJWA 3NHGA 1W0HA 4OPKA 1VSLA 2RN2A 1YTUA 1JL2A 4HUFA 2KW4A 2FBYA 4CF8A 3SI6A 4NCBA 4DTJA 3NF8A 3TABA 3SUQA 2BANA 3CFOA 3K5OA 2B5JA 1B9FA 3G10A 3NCIA 3LP1A 5FRNA 1QSSA 5I3UA 3HO1A 1RT1A 1YT3A 2GBZA 1RBSA 3L2QA 4NCAA 1UWBA 3HM9A 3T19A 4DQPA 4CJKA 4E19A 4FJ7A 3PUFA 3M8QA 3OYHA 2YKNA 1WSFA 1ZBFA 4DS4A 1O1WA 3NAEA 1VRTA 2YNIA 3RR8A 3SUOA 3SV4A 3LP0A 3U3GA 4E7KA 4DSLA 4WE1A 1QSLA 1IKWA 3L3UA 5SZTA 1KSPA 4M3UA 2Y1IA 3K2PA 2HVHA 4DFJA 3OYLA 3OYCA 3KLEA 1X9WA 2XO7A 3TAFA 1HYSA 5CY4A 3L2RA 4K8ZA 1RTJA 3AO2A 1IO2A 2X78A 4E1MA 4Z4CA 3DOLA 5EU7A 1HNIA 3E01A 4KHSA 3HL8A 1EXQA 3NE6A 3U3YA 2HHUA 3OJSA 4ZHRA 4I9QA 4IFVA 1F21A 4Q5VA 1S1WA 4CJTA 3SPZA 3MXIA 2A1RA 4Z4IA 3AVIA 2WOMA 4W5OA 4CHPA 3D0PA 4R5PA 2XY7A 3SPYA 1TK5A 1S6QA 4N5SA 1KLNA 1S9EA 2A1SA 4FLVA 2G8UA 3NGYA 2XRIA 4I9LA 4HVJA 3K5MA 4HUGA 3QEXA 2PYJA 2KFNA 4W5NA 5J2MA 2Y1JA 3VQ4A 2G8VA 4CJPA 4O0JA 4N41A 1DLOA 1BCMA 2IDOA 2XY6A 4AHUA 3OYEA 2BDPA 3MXMA 4N56A 3NGIA 1HYVA 1ASWA 4I2QA 3V9ZA 4DTOA 3HVTA 4CGDA 3TAPA 3KTQA 4HCCA 1TKXA 4BDPA 3AVFA 1MU2A 5K14A 4DQSA 4KHUA 3P5JA 1BGXT 3VQDA 4DMNA 1XC9A 5C25A 3CYMA 3AVAA 2D5RA 3AVNA 3HSTB 5CYQA 5DK5A 3AA3A 1NKEA 3CM6A 4LSLA 4FLYA 1B92A 1RDAA 3LAMA 4IFYA 4CJ4A 4QCLA 1KRPA 4Z4GA 2BGGA 2B4JA 3RMDA 1JL1A 2X6NA 1RT4A 3C94A 2VG5A 4I7FA 4CF0A 4JRPA 1JXBA 2JLEA 4I2PA 1WSJA 4ELUA 2Z1IA 1RT5A 1KTQA 1U49A 2G8KA 4FLXA 3M8SA 1DTTA 4ELTA 4MQ3A 3AO5A 4J2EA 1S1UA 4CJQA 4DSJA 1KFDA 4CEQA 4BDYA 1RTDA 3DRSA 3MECA 1Z26A 1YTAA 4KHNA 2O4IA 4GW6A 1RBRA 3PV8A 4DTXA 2YKMA 4DQQA 2R7YA 1Q9XA 1L3VA 4J2AA 3I0SA 4KB1A 2ZD1A 4M3XA 4CK2A 4OKKA 4QAGA 2YHBA 1JLCA 3KD5E 1NJXA 4M3RA 1RDDA 4MFBA 3VA0A 2OPPA 2YNFA 4CHQA 3KD1E 4FLTA 4DF8A 1RBUA 2G8HA 4NYFA 4CE9A 4CHZA 4KHYA 1BIUA 3SYZA 1RNHA 2HMIA 4FLWA 2E4LA 3RWUA 4M41A 3QO9A 3B6PA 3S3NA 4ZTFA 1XHXA 1ZBUA 2VG7A 1HQUA 2OZMA 3LZIA 3KK1A 2OA8A 2HHWA 4CF2A 3DLGA 4CFCA 1HMVA 3KLIA 2QXFA 2HHSA 3TANA 4GVMA 1NK4A 1S9GA 1BISA 3KIOA 1VSMA 4CJ5A 1IG9A 4FZXC 3KK2A 5HBMA 3ZSZA 3L2VA 1VSIA 1KFSA 4CCHA 3ALYA 3NF9A 3K5NA 5D3GA 3C6UA 4KTWA 4NYNA 2PY5A 4B9UA 3RMCA 1I39A 2G8IA 3V6DA 1KCFA 4CIGA 5SWMA 3D45A 4BDZA 1ZBLA 4FJNA 4BWJA 1C1BA 1CZ9A 1QHTA 4PWDA 4BE0A 2D0BA 3ITHA 5FROA 1LW0A 3IRXA 4DWIA 4IDKA 5C24A 1BI4A 2KZZA 2VG6A 4E1NA 3LPUA 3OYIA 1WSIA 4FCYA 4AHRA 1B9DA 4F2RA 5DMRA 3SNNA 4B8CA 1U45A 3QLHA 4O0IA 2X74A 4ID1A 1TKZA 4OLBA 5KI6A 4BE1A 1SL1A 3B6OA 1FK9A 3K57A 3IG1A 2P1JA 1WN7A 4DFKA 4CGJA 2ETJA 3OJUA 3SJJA 3PY8A 4KHQA 1Z25A 4CEFA 3U6FA 1WNSA 3ZSRA 3ZT4A 1IKVA 4Y1CA 2KFZA 4FJ8A 4E7JA 1BI4B 4OGEA 1ZBHA 4B08A 2YNHA 2HW3A 1C0MA 4LH5A 3UIQA 2E6LA 2FBXA 3VQQA 2IC3A 2GV9A 4DG1A 4EZ6A 4FW2A 5E41A 4FYDA 1RT6A 1X1PA 4HCBA 2P5OA 3OS1A 2PZSA 1SV5A 4CEAA 2HHXA 3SCXA 1S1XA 3RTVA 1CXQA 2DFHA 3SV3A 4E7HA 3TI0A 3QIPA 4DTMA 3OS0A 3VQ7A 4CEBA 1JLEA 1TVRA 2RPIA 5KRSA 3V9SA 3QEVA 4CJEA 1LWFA 3DLBA 4L8RB 3ISNC 4O4GA 4BWMA 3NH2A 3AA5X 3OYBA 3KLFA 1LAVA 4PA1A 4DU1A 4FLUA 1VSKA 4AHVA 3BDPA 1Q8IA 4ZTJA 3LDSA 3TAQA 1S6PA 3OYJA 1C1AA 3QEWA 2WONA 1TL3A 1ZBIA 3NFAA 3V9WA 3VQEA 3OS2A 3WNHA 5KTQA 1LV5A 1BCOA 5JS2A 1TAUA 1RDCA 1RTHA 5HLFA 1IH7A 1KLMA 4CEDA 1VSFA 3ZSQA 4CECA 4E3SA 1S5JA 4CEOA 3HP6A 1RBVA 3WNEA 2O4GA 3QIOA 1BL3A 3ZT1A 3ZSVA 3SQ0A 1XHZA 4M3TA 1T8EA 1JLFA 2GUIA 3OYMA 4FJKA 1VSEA 3CFRA 5J1EA 4F3TA 4RW8A 3K58A 3ULDA 2HNZA 3ZSYA 5J2PA 4CEZA 4F4KA 3RRGA 4CIEA 1D9FA 1J54A 4KRFA 3M8PA 1UOCA 4RW4A 1SKRA 1J53A 3KLHA 4YFUA 5J2NA 4OKEA 1LWEA 4DTUA 2OYQA 4KI4A 3AO1A 4CFBA 2OPRA 2Z1GA 4FM2A 5I42A 3L8BA 3ZSOA 4DU3A 1FXXA 3ZSWA 3QNNA 4BE2A 3AVKA 2F8TA 4PQUA 3NGZA 3RMAA 3I0RA 1T03A 1N6QA 4F8RA 3ZT2A 3VQBA 3VQAA 1RDBA 2FBTA 2W42A 1D5AA 4XIUA 3V1OA 3VQ6A 3SQ2A 4FJMA 3DRRA 4DQIA 5CZ1A 4F2SA 1A5WA 1JLAA 3DLKA 3LANA 4AH9A 4C8KA 3O4QA 1ITGA 4K8XA 3RMBA 5HP1A 4TSXA 1VK0A 3LP3A 4E7IA 5KRTA 1NK6A 4HHTA 2IAJA 3K59A 1QS4A 3DI6A 4FZYA 4PUOA 1D8YA 3VQ9A 3HPOA 3LWLA 1LW2A 2F96A 3V1RA 4DSKA 3TAGA 2OPQA 4B8AB 5HRRA 3OY9A 4KTQA 4KO0A 4E0DA 3KK3A 3KJVA 1CLQA 1ASUA 3DMJA 4Z0UA 1FKOA 4CFAA 4Z4HA 1C0TA 4Z4EA 3G0ZA 4DLGA 3P83D 1RBTA 1J9AA 2HHQA 1QTMA 3PX0A 3QEIA 1REVA 2JGUA 3M8RA 2PYLA 1ASVA 4FLZA 4Q0BA 4PY5A 1L3UA 2DTUA 3HXMA 1HRHA 2XY8A 1VSDA 4FVMA 3AA4A 4IG3A 1A5VA 1NOZA 2YNGA 3F73A 5HROA 2IOCA 4DLEA 3AVMA 2KTQA 3AO3A 3AVBA 4RW6A 5HRNA 2VWJA 3TARA 1RILA 3DLHA 3TAMA 3ZT0A 1HYZA 3ZCMA 3TAEA 3S3OA 4OGCA 1TK8A 4CGGA 1UA1A 3LPTA 4CGIA 4DTRA 3OYKA 2ZE2A 3MAQA 3NH1A 1S1TA 5KGXA 1D9DA 3AVGA 2RKIA 5T7BA 3QETA 5FDLA 1X9SA 2YV0X 4JS5A 1CXUA 1L3SA 1CZBA 2OZSA 4GMJB 3AVHA 4QOZB 1WAFA 5CZ2A 3SZ2A 1RTIA 3NF6A 1RT3A 4ID5A 5HRPA 4JRQA 1EKEA 4DS5A 1R0AA 2F8SA 4B9SA 3OVNA 3V9XA 4KHWA 1I3AA 4G1QA 3CFPA 4DF4A 3HJFA 4DTSA 1WSHA 4B3OA 3O4NA 2IGIA 4N47A 1RT2A 3H08A 1BQMA 4CERA 4CHOA 1NJWA 2IS3A 2YHAA 1TV6A 3AVJA 1K6YA 1BHLA 4B9VA 4B9LA 4M3ZA 3HPHA 4CGFA 3SUPA 1XI1A 5HRSA 1SUQA 4UQGA 1SL2A 4CEEA 4C8LA 2XHBA 3SQ4A 3AA2A 4OLAA 1C0UA 4W5RA 4EP5A 2QKKA 1WSGA 4DSFA 3QINA 3DLRA 4JS4A 2DFFA 4CJVA 1U47A 2DFEA 3O3GA 1RT7A 1NK9A 1WAJA 2HB5A 4O44A 1JKHA 4C8MA 4LY7A 3NH0A 3LALA 4CIFA 2XY5A 1SL0A 4M42A 1GOBA 4KB0A 4FJGA 1T7PA 3ZSXA 4DFPA 3DYAA 4M3YA 4B9TA 1TGOA 5CYMA 4CF1A 2ITGA 1VSJA 1ZYQA 1JLQA 4CF9A 2P51A 3PX4A 1SKSA 3DOKA 1C6VA 3O3FA 3S9HA 2HVIA 1LWCA 4FJ5A 4FM1A 4CFDA 1TAQA 4Y1DA 4O5BA 3QESA 3WNFA 4W5TA 2QKBA 4FJXA 3DM2A 1QE1A 3DLEA 4OKJA 4AHTA 4Z4FA 1Q9YA 3OYAA 4C8OA 3KKRA 1HNVA 3VQ8A 3OYNA 1TL1A 4AILC 4AHSA 4J2BA 3F9KA 5JS1A 1C1CA 3LP2A 3V1QA 4IG0A 3EYZA 4KREA 2HHTA 4DSEA 4DU4A 4CESA 1N5YA 3JYTA 4FK2A 2Q3SA 3I8DA 1IKYA 3V4IA 4CGHA 1BQNA 3QNOA 2AJQA 1EP4A 3CM5A 1EX4A 4OPJA 4DFMA 3T1AA 4CJSA 3ZT3A 3C95A 1U4BA 3AV9A 4OVLA 4KV8A 5KGWA 3CQ8A 3KKSA 4FJ9A 4C8NA 4CJFA 2EHGA 1NKBA 2OPSA 2G8FA 3O3HA 2E6MA 2FBVA 2G8WA 4DSIA 1HPZA 3ASMA 4H8KA 4HTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3O A;  4CJU A;  4E89 A;  3L2W A;  4YNQ A;  1WSE A;  3LWM A;  1U04 A;  2HND A;  1EET A;  3TWH A;  1A5X A;  3S3M A;  1NK8 A;  2QK9 A;  1YVU A;  4IBN A;  1NK7 A;  4FJI A;  4DQR A;  4RW7 A;  1UA0 A;  1Y97 A;  3BGR A;  1BIZ A;  1NOY A;  2EX3 A;  2Z1J A;  4KKO A;  2D0A A;  4W5Q A;  1LAW A;  5C42 A;  4CK1 A;  3QER A;  3RRH A;  1JLG A;  1TKD A;  1HQE A;  2B6A A;  3P1G A;  3PX6 A;  1S1V A;  3PO5 A;  1W9H A;  3NDK A;  4CHY A;  2NUB A;  2RF2 A;  3K5L A;  3LZJ A;  1L5U A;  1SKW A;  4CJR A;  5FRM A;  4NCG A;  1X9M A;  4ELV A;  3FFI A;  3VQC A;  4FJH A;  4FK4 A;  2HHV A;  4E7L A;  4DTP A;  2FC0 A;  3MEG A;  4DTN A;  3NBP A;  4FK0 A;  4FJJ A;  3AVC A;  3PO4 A;  4LH4 A;  2P5G A;  4J2D A;  4FZZ A;  4M3W A;  1JXE A;  3V9U A;  4FJL A;  1UAX A;  4KAZ A;  2DY4 A;  3AO4 A;  3SQ1 A;  1VRU A;  4O55 A;  4B9M A;  4EZ9 A;  3L2U A;  3T3F A;  4KPY A;  1KVA A;  2ZQB A;  3AVL A;  3IS9 A;  3VQ5 A;  3DRP A;  3VN5 A;  3A2F A;  3C6T A;  4LD0 A;  1RCH A;  4FW1 A;  3TR8 A;  3LAK A;  3VQP A;  1TK0 A;  3RR7 A;  1VSH A;  3EZ5 A;  4AHC A;  3CG7 A;  4KFB A;  3HP9 A;  1NK5 A;  2I5J A;  2KZM A;  2X6S A;  4H4O A;  1XWL A;  1FKP A;  1L3T A;  4RG8 A;  3L3V A;  1NJY A;  3MEE A;  3THV A;  1T05 A;  4HUE A;  1WLJ A;  3MED A;  4EP4 A;  4KI6 A;  1NK0 A;  1QQC A;  1J5O A;  3NF7 A;  5J2Q A;  1KVB A;  3V81 A;  3HK2 A;  4LSN A;  1IKX A;  3MXJ A;  4CJ3 A;  4M45 A;  3SUN A;  3HYF A;  2HNY A;  3HT3 A;  3WNG A;  3OYG A;  4B9N A;  2VWK A;  2ATQ A;  2D0C A;  1GOA A;  2Z1H A;  3KLG A;  4OJR A;  4CJL A;  1NJZ A;  1KVC A;  1GOC A;  1HJR A;  3OYD A;  1QSY A;  1U48 A;  4FXD A;  2BE2 A;  4IKF A;  3HVR A;  3JSM A;  4H4M A;  3HPG A;  3IAY A;  2LSN A;  4N76 A;  2KQ2 A;  4CK3 A;  4RW9 A;  4JLH A;  1TKT A;  3VA3 A;  3EY1 A;  1DTQ A;  4CHN A;  4BAC A;  4FM0 A;  4KTZ A;  1NKC A;  1JLB A;  3QEP A;  1G15 A;  3OYF A;  4ICL A;  4CJW A;  3NHG A;  1W0H A;  4OPK A;  1VSL A;  2RN2 A;  1YTU A;  1JL2 A;  4HUF A;  2KW4 A;  2FBY A;  4CF8 A;  3SI6 A;  4NCB A;  4DTJ A;  3NF8 A;  3TAB A;  3SUQ A;  2BAN A;  3CFO A;  3K5O A;  2B5J A;  1B9F A;  3G10 A;  3NCI A;  3LP1 A;  5FRN A;  1QSS A;  5I3U A;  3HO1 A;  1RT1 A;  1YT3 A;  2GBZ A;  1RBS A;  3L2Q A;  4NCA A;  1UWB A;  3HM9 A;  3T19 A;  4DQP A;  4CJK A;  4E19 A;  4FJ7 A;  3PUF A;  3M8Q A;  3OYH A;  2YKN A;  1WSF A;  1ZBF A;  4DS4 A;  1O1W A;  3NAE A;  1VRT A;  2YNI A;  3RR8 A;  3SUO A;  3SV4 A;  3LP0 A;  3U3G A;  4E7K A;  4DSL A;  4WE1 A;  1QSL A;  1IKW A;  3L3U A;  5SZT A;  1KSP A;  4M3U A;  2Y1I A;  3K2P A;  2HVH A;  4DFJ A;  3OYL A;  3OYC A;  3KLE A;  1X9W A;  2XO7 A;  3TAF A;  1HYS A;  5CY4 A;  3L2R A;  4K8Z A;  1RTJ A;  3AO2 A;  1IO2 A;  2X78 A;  4E1M A;  4Z4C A;  3DOL A;  5EU7 A;  1HNI A;  3E01 A;  4KHS A;  3HL8 A;  1EXQ A;  3NE6 A;  3U3Y A;  2HHU A;  3OJS A;  4ZHR A;  4I9Q A;  4IFV A;  1F21 A;  4Q5V A;  1S1W A;  4CJT A;  3SPZ A;  3MXI A;  2A1R A;  4Z4I A;  3AVI A;  2WOM A;  4W5O A;  4CHP A;  3D0P A;  4R5P A;  2XY7 A;  3SPY A;  1TK5 A;  1S6Q A;  4N5S A;  1KLN A;  1S9E A;  2A1S A;  4FLV A;  2G8U A;  3NGY A;  2XRI A;  4I9L A;  4HVJ A;  3K5M A;  4HUG A;  3QEX A;  2PYJ A;  2KFN A;  4W5N A;  5J2M A;  2Y1J A;  3VQ4 A;  2G8V A;  4CJP A;  4O0J A;  4N41 A;  1DLO A;  1BCM A;  2IDO A;  2XY6 A;  4AHU A;  3OYE A;  2BDP A;  3MXM A;  4N56 A;  3NGI A;  1HYV A;  1ASW A;  4I2Q A;  3V9Z A;  4DTO A;  3HVT A;  4CGD A;  3TAP A;  3KTQ A;  4HCC A;  1TKX A;  4BDP A;  3AVF A;  1MU2 A;  5K14 A;  4DQS A;  4KHU A;  3P5J A;  1BGX T;  3VQD A;  4DMN A;  1XC9 A;  5C25 A;  3CYM A;  3AVA A;  2D5R A;  3AVN A;  3HST B;  5CYQ A;  5DK5 A;  3AA3 A;  1NKE A;  3CM6 A;  4LSL A;  4FLY A;  1B92 A;  1RDA A;  3LAM A;  4IFY A;  4CJ4 A;  4QCL A;  1KRP A;  4Z4G A;  2BGG A;  2B4J A;  3RMD A;  1JL1 A;  2X6N A;  1RT4 A;  3C94 A;  2VG5 A;  4I7F A;  4CF0 A;  4JRP A;  1JXB A;  2JLE A;  4I2P A;  1WSJ A;  4ELU A;  2Z1I A;  1RT5 A;  1KTQ A;  1U49 A;  2G8K A;  4FLX A;  3M8S A;  1DTT A;  4ELT A;  4MQ3 A;  3AO5 A;  4J2E A;  1S1U A;  4CJQ A;  4DSJ A;  1KFD A;  4CEQ A;  4BDY A;  1RTD A;  3DRS A;  3MEC A;  1Z26 A;  1YTA A;  4KHN A;  2O4I A;  4GW6 A;  1RBR A;  3PV8 A;  4DTX A;  2YKM A;  4DQQ A;  2R7Y A;  1Q9X A;  1L3V A;  4J2A A;  3I0S A;  4KB1 A;  2ZD1 A;  4M3X A;  4CK2 A;  4OKK A;  4QAG A;  2YHB A;  1JLC A;  3KD5 E;  1NJX A;  4M3R A;  1RDD A;  4MFB A;  3VA0 A;  2OPP A;  2YNF A;  4CHQ A;  3KD1 E;  4FLT A;  4DF8 A;  1RBU A;  2G8H A;  4NYF A;  4CE9 A;  4CHZ A;  4KHY A;  1BIU A;  3SYZ A;  1RNH A;  2HMI A;  4FLW A;  2E4L A;  3RWU A;  4M41 A;  3QO9 A;  3B6P A;  3S3N A;  4ZTF A;  1XHX A;  1ZBU A;  2VG7 A;  1HQU A;  2OZM A;  3LZI A;  3KK1 A;  2OA8 A;  2HHW A;  4CF2 A;  3DLG A;  4CFC A;  1HMV A;  3KLI A;  2QXF A;  2HHS A;  3TAN A;  4GVM A;  1NK4 A;  1S9G A;  1BIS A;  3KIO A;  1VSM A;  4CJ5 A;  1IG9 A;  4FZX C;  3KK2 A;  5HBM A;  3ZSZ A;  3L2V A;  1VSI A;  1KFS A;  4CCH A;  3ALY A;  3NF9 A;  3K5N A;  5D3G A;  3C6U A;  4KTW A;  4NYN A;  2PY5 A;  4B9U A;  3RMC A;  1I39 A;  2G8I A;  3V6D A;  1KCF A;  4CIG A;  5SWM A;  3D45 A;  4BDZ A;  1ZBL A;  4FJN A;  4BWJ A;  1C1B A;  1CZ9 A;  1QHT A;  4PWD A;  4BE0 A;  2D0B A;  3ITH A;  5FRO A;  1LW0 A;  3IRX A;  4DWI A;  4IDK A;  5C24 A;  1BI4 A;  2KZZ A;  2VG6 A;  4E1N A;  3LPU A;  3OYI A;  1WSI A;  4FCY A;  4AHR A;  1B9D A;  4F2R A;  5DMR A;  3SNN A;  4B8C A;  1U45 A;  3QLH A;  4O0I A;  2X74 A;  4ID1 A;  1TKZ A;  4OLB A;  5KI6 A;  4BE1 A;  1SL1 A;  3B6O A;  1FK9 A;  3K57 A;  3IG1 A;  2P1J A;  1WN7 A;  4DFK A;  4CGJ A;  2ETJ A;  3OJU A;  3SJJ A;  3PY8 A;  4KHQ A;  1Z25 A;  4CEF A;  3U6F A;  1WNS A;  3ZSR A;  3ZT4 A;  1IKV A;  4Y1C A;  2KFZ A;  4FJ8 A;  4E7J A;  1BI4 B;  4OGE A;  1ZBH A;  4B08 A;  2YNH A;  2HW3 A;  1C0M A;  4LH5 A;  3UIQ A;  2E6L A;  2FBX A;  3VQQ A;  2IC3 A;  2GV9 A;  4DG1 A;  4EZ6 A;  4FW2 A;  5E41 A;  4FYD A;  1RT6 A;  1X1P A;  4HCB A;  2P5O A;  3OS1 A;  2PZS A;  1SV5 A;  4CEA A;  2HHX A;  3SCX A;  1S1X A;  3RTV A;  1CXQ A;  2DFH A;  3SV3 A;  4E7H A;  3TI0 A;  3QIP A;  4DTM A;  3OS0 A;  3VQ7 A;  4CEB A;  1JLE A;  1TVR A;  2RPI A;  5KRS A;  3V9S A;  3QEV A;  4CJE A;  1LWF A;  3DLB A;  4L8R B;  3ISN C;  4O4G A;  4BWM A;  3NH2 A;  3AA5 X;  3OYB A;  3KLF A;  1LAV A;  4PA1 A;  4DU1 A;  4FLU A;  1VSK A;  4AHV A;  3BDP A;  1Q8I A;  4ZTJ A;  3LDS A;  3TAQ A;  1S6P A;  3OYJ A;  1C1A A;  3QEW A;  2WON A;  1TL3 A;  1ZBI A;  3NFA A;  3V9W A;  3VQE A;  3OS2 A;  3WNH A;  5KTQ A;  1LV5 A;  1BCO A;  5JS2 A;  1TAU A;  1RDC A;  1RTH A;  5HLF A;  1IH7 A;  1KLM A;  4CED A;  1VSF A;  3ZSQ A;  4CEC A;  4E3S A;  1S5J A;  4CEO A;  3HP6 A;  1RBV A;  3WNE A;  2O4G A;  3QIO A;  1BL3 A;  3ZT1 A;  3ZSV A;  3SQ0 A;  1XHZ A;  4M3T A;  1T8E A;  1JLF A;  2GUI A;  3OYM A;  4FJK A;  1VSE A;  3CFR A;  5J1E A;  4F3T A;  4RW8 A;  3K58 A;  3ULD A;  2HNZ A;  3ZSY A;  5J2P A;  4CEZ A;  4F4K A;  3RRG A;  4CIE A;  1D9F A;  1J54 A;  4KRF A;  3M8P A;  1UOC A;  4RW4 A;  1SKR A;  1J53 A;  3KLH A;  4YFU A;  5J2N A;  4OKE A;  1LWE A;  4DTU A;  2OYQ A;  4KI4 A;  3AO1 A;  4CFB A;  2OPR A;  2Z1G A;  4FM2 A;  5I42 A;  3L8B A;  3ZSO A;  4DU3 A;  1FXX A;  3ZSW A;  3QNN A;  4BE2 A;  3AVK A;  2F8T A;  4PQU A;  3NGZ A;  3RMA A;  3I0R A;  1T03 A;  1N6Q A;  4F8R A;  3ZT2 A;  3VQB A;  3VQA A;  1RDB A;  2FBT A;  2W42 A;  1D5A A;  4XIU A;  3V1O A;  3VQ6 A;  3SQ2 A;  4FJM A;  3DRR A;  4DQI A;  5CZ1 A;  4F2S A;  1A5W A;  1JLA A;  3DLK A;  3LAN A;  4AH9 A;  4C8K A;  3O4Q A;  1ITG A;  4K8X A;  3RMB A;  5HP1 A;  4TSX A;  1VK0 A;  3LP3 A;  4E7I A;  5KRT A;  1NK6 A;  4HHT A;  2IAJ A;  3K59 A;  1QS4 A;  3DI6 A;  4FZY A;  4PUO A;  1D8Y A;  3VQ9 A;  3HPO A;  3LWL A;  1LW2 A;  2F96 A;  3V1R A;  4DSK A;  3TAG A;  2OPQ A;  4B8A B;  5HRR A;  3OY9 A;  4KTQ A;  4KO0 A;  4E0D A;  3KK3 A;  3KJV A;  1CLQ A;  1ASU A;  3DMJ A;  4Z0U A;  1FKO A;  4CFA A;  4Z4H A;  1C0T A;  4Z4E A;  3G0Z A;  4DLG A;  3P83 D;  1RBT A;  1J9A A;  2HHQ A;  1QTM A;  3PX0 A;  3QEI A;  1REV A;  2JGU A;  3M8R A;  2PYL A;  1ASV A;  4FLZ A;  4Q0B A;  4PY5 A;  1L3U A;  2DTU A;  3HXM A;  1HRH A;  2XY8 A;  1VSD A;  4FVM A;  3AA4 A;  4IG3 A;  1A5V A;  1NOZ A;  2YNG A;  3F73 A;  5HRO A;  2IOC A;  4DLE A;  3AVM A;  2KTQ A;  3AO3 A;  3AVB A;  4RW6 A;  5HRN A;  2VWJ A;  3TAR A;  1RIL A;  3DLH A;  3TAM A;  3ZT0 A;  1HYZ A;  3ZCM A;  3TAE A;  3S3O A;  4OGC A;  1TK8 A;  4CGG A;  1UA1 A;  3LPT A;  4CGI A;  4DTR A;  3OYK A;  2ZE2 A;  3MAQ A;  3NH1 A;  1S1T A;  5KGX A;  1D9D A;  3AVG A;  2RKI A;  5T7B A;  3QET A;  5FDL A;  1X9S A;  2YV0 X;  4JS5 A;  1CXU A;  1L3S A;  1CZB A;  2OZS A;  4GMJ B;  3AVH A;  4QOZ B;  1WAF A;  5CZ2 A;  3SZ2 A;  1RTI A;  3NF6 A;  1RT3 A;  4ID5 A;  5HRP A;  4JRQ A;  1EKE A;  4DS5 A;  1R0A A;  2F8S A;  4B9S A;  3OVN A;  3V9X A;  4KHW A;  1I3A A;  4G1Q A;  3CFP A;  4DF4 A;  3HJF A;  4DTS A;  1WSH A;  4B3O A;  3O4N A;  2IGI A;  4N47 A;  1RT2 A;  3H08 A;  1BQM A;  4CER A;  4CHO A;  1NJW A;  2IS3 A;  2YHA A;  1TV6 A;  3AVJ A;  1K6Y A;  1BHL A;  4B9V A;  4B9L A;  4M3Z A;  3HPH A;  4CGF A;  3SUP A;  1XI1 A;  5HRS A;  1SUQ A;  4UQG A;  1SL2 A;  4CEE A;  4C8L A;  2XHB A;  3SQ4 A;  3AA2 A;  4OLA A;  1C0U A;  4W5R A;  4EP5 A;  2QKK A;  1WSG A;  4DSF A;  3QIN A;  3DLR A;  4JS4 A;  2DFF A;  4CJV A;  1U47 A;  2DFE A;  3O3G A;  1RT7 A;  1NK9 A;  1WAJ A;  2HB5 A;  4O44 A;  1JKH A;  4C8M A;  4LY7 A;  3NH0 A;  3LAL A;  4CIF A;  2XY5 A;  1SL0 A;  4M42 A;  1GOB A;  4KB0 A;  4FJG A;  1T7P A;  3ZSX A;  4DFP A;  3DYA A;  4M3Y A;  4B9T A;  1TGO A;  5CYM A;  4CF1 A;  2ITG A;  1VSJ A;  1ZYQ A;  1JLQ A;  4CF9 A;  2P51 A;  3PX4 A;  1SKS A;  3DOK A;  1C6V A;  3O3F A;  3S9H A;  2HVI A;  1LWC A;  4FJ5 A;  4FM1 A;  4CFD A;  1TAQ A;  4Y1D A;  4O5B A;  3QES A;  3WNF A;  4W5T A;  2QKB A;  4FJX A;  3DM2 A;  1QE1 A;  3DLE A;  4OKJ A;  4AHT A;  4Z4F A;  1Q9Y A;  3OYA A;  4C8O A;  3KKR A;  1HNV A;  3VQ8 A;  3OYN A;  1TL1 A;  4AIL C;  4AHS A;  4J2B A;  3F9K A;  5JS1 A;  1C1C A;  3LP2 A;  3V1Q A;  4IG0 A;  3EYZ A;  4KRE A;  2HHT A;  4DSE A;  4DU4 A;  4CES A;  1N5Y A;  3JYT A;  4FK2 A;  2Q3S A;  3I8D A;  1IKY A;  3V4I A;  4CGH A;  1BQN A;  3QNO A;  2AJQ A;  1EP4 A;  3CM5 A;  1EX4 A;  4OPJ A;  4DFM A;  3T1A A;  4CJS A;  3ZT3 A;  3C95 A;  1U4B A;  3AV9 A;  4OVL A;  4KV8 A;  5KGW A;  3CQ8 A;  3KKS A;  4FJ9 A;  4C8N A;  4CJF A;  2EHG A;  1NKB A;  2OPS A;  2G8F A;  3O3H A;  2E6M A;  2FBV A;  2G8W A;  4DSI A;  1HPZ A;  3ASM A;  4H8K A;  4HTU A; 
#chains in the Genus database with same CATH topology
 3SAG A;  1NGF A;  2HND A;  2PFU A;  3TWH A;  4JD2 B;  4IBN A;  5AZI B;  1Y97 A;  1CZA N;  2NRX A;  4YDU C;  2EX3 A;  2Z1J A;  1HNX K;  1VQ8 N;  3CME N;  1LAW A;  1X9J A;  3RRH A;  4GY2 B;  1HQE A;  2QA4 N;  4KH6 A;  4BVO A;  3LZJ A;  4NLB A;  3B8A X;  4JI1 K;  1VQ6 N;  3MX5 A;  2FC0 A;  4DTN A;  4BR9 A;  3AVC A;  3PO4 A;  3C6H A;  3TTF A;  3ULE B;  3AO4 A;  4B9M A;  2ZQB A;  3OBW A;  3A2F A;  3NVM A;  4LD0 A;  3LAK A;  4CI6 A;  3O9Q A;  2X6S A;  4H4O A;  1XWL A;  1FKP A;  1L3T A;  1NJY A;  3MEE A;  1WLJ A;  4H0V B;  1QQC A;  5AQI A;  3JAM O;  1KAX A;  3VEV A;  1IKX A;  4DR3 K;  3QIC A;  1DKG D;  5LJW A;  4U7B A;  3M6G A;  3F5T A;  3NMU A;  5M1Q A;  3OYG A;  4EIA A;  3MWP A;  3CCU N;  3THW B;  3HPG A;  4CK3 A;  4RW9 A;  3VA3 A;  4CHN A;  3SJH A;  1JLB A;  1W0H A;  3ID6 A;  2RN2 A;  4OPK A;  1YTU A;  5I9E B;  1K9M O;  2KW4 A;  1XC3 A;  3NF8 A;  3QBX A;  2BAN A;  3K5O A;  4WQ5 C;  2B5J A;  3G10 A;  3NCI A;  3HO1 A;  2P9I B;  5FRN A;  1RT1 A;  4NCA A;  1UWB A;  4B1Y B;  5AQQ A;  1WSF A;  1ZBF A;  3NAE A;  2YNI A;  3U3G A;  4DSL A;  4WE1 A;  4CZG A;  4M3U A;  2Y1I A;  3GBT A;  3K2P A;  4WFA L;  3KLE A;  3OBY A;  4JKE A;  5AQJ A;  3R8E A;  2XO7 A;  3TAF A;  3FE1 A;  3AO2 A;  4E1M A;  5EU7 A;  4KHS A;  3D2F B;  3U3Y A;  4ZHR A;  4DV4 K;  4ISG A;  1QVF M;  1TK5 A;  4W5O A;  3SPY A;  3JXU A;  1KLN A;  4R5P A;  1Y64 A;  1S9E A;  4DKW A;  2PYJ A;  4BRP A;  3QEX A;  4HUG A;  4W5N A;  5J2M A;  4DV7 K;  2IDO A;  2A41 A;  4AHU A;  4N56 A;  1OVY A;  4I2Q A;  3WUH A;  3V9Z A;  4HCC A;  4CGD A;  3AGR A;  2O8E B;  4BDP A;  2AA4 A;  4WQ4 A;  5K14 A;  3VPZ A;  1XC9 A;  3CYM A;  5CYQ A;  3DXM A;  4H5W A;  4A5B A;  4FLY A;  1B92 A;  5CR4 A;  1RDA A;  3LAM A;  3ZX3 A;  4CJ4 A;  2BGG A;  2B4J A;  1JL1 A;  1RT4 A;  2VG5 A;  2JLE A;  3FZF A;  2QI2 A;  1KTQ A;  3M8S A;  2P9S A;  3AO5 A;  3MCA B;  4CJQ A;  4DSJ A;  4CEQ A;  4KHN A;  5LL6 Z;  1YAG A;  4DTX A;  2R7Y A;  3I0S A;  3A5N C;  3T69 A;  5ELZ A;  5BRF A;  3VOV A;  4CBW A;  1VQK N;  1NJX A;  3U9Z A;  1ATN A;  3UE5 A;  2PAV A;  3THY A;  4DR5 K;  2GUP A;  3D2E A;  4IEE A;  4CHZ A;  2QWR A;  1EWQ A;  4ISE A;  2HMI A;  2E4L A;  4L3Q A;  1ZBU A;  2VG7 A;  1HQU A;  3LZI A;  3KK1 A;  4CF2 A;  2VCP A;  5AQX A;  3KLI A;  2QXF A;  1NK4 A;  1S9G A;  3KIO A;  4CJ5 A;  3ZSZ A;  3NF9 A;  5D3G A;  2PY5 A;  3V6D A;  1KCF A;  4CIG A;  2UUC K;  3D45 A;  3D6R A;  4FJN A;  4PL7 A;  4BWJ A;  1C1B A;  5AFU A;  1E3M A;  3ITH A;  5KQD A;  5AQK A;  4FCY A;  4AHR A;  1GLF O;  4K42 A;  4F2R A;  3WT0 A;  1WBD A;  4BE1 A;  2QWO A;  3O1B A;  2QWN A;  1WBB A;  2NLX A;  1K8A O;  1K73 O;  1GLE G;  2ITM A;  3R3L A;  4E7J A;  1ZBH A;  4B08 A;  2YNH A;  3VGM A;  1C0M A;  5C12 A;  3CCL N;  2E6L A;  3VQQ A;  2GV9 A;  4DG1 A;  2QW9 A;  4YOU A;  5E41 A;  3KZB A;  5JVH L;  2P5O A;  5BPL A;  1N8R O;  3TI0 A;  3QB0 A;  3SK3 A;  1VHX A;  3VQ7 A;  2RPI A;  3V9S A;  3QEV A;  3DLB A;  3ISN C;  3NH2 A;  3AA5 X;  2ZJP L;  4WCE L;  1IBL K;  4NXN K;  3OYJ A;  4LFC K;  3QEW A;  1ZBI A;  3V9W A;  3OS2 A;  2D0O A;  4MLE A;  5C2F A;  3WNH A;  5KTQ A;  2NNW A;  3HBT A;  3MCP A;  1RBV A;  3WNE A;  3QIO A;  3ZSV A;  2FLO A;  5LMU K;  3C65 A;  2JWL A;  4F3T A;  1Q18 A;  2Q36 A;  3OHR A;  4CZJ A;  3TSU A;  4YFU A;  4BRC A;  1T6C A;  4DV2 K;  3KWI A;  3ZX0 A;  2Z1G A;  5BRE A;  3CJ7 A;  4FWK A;  3ZSO A;  3QNN A;  1FXX A;  3ZSW A;  2F8T A;  3AVK A;  4NXM K;  1N6Q A;  1T03 A;  2CGJ A;  4FVU A;  4CVN E;  4CZL A;  4XIU A;  3VQ6 A;  4FJM A;  4DQI A;  4F2S A;  3RMB A;  5HP1 A;  1VK0 A;  3LP3 A;  3ATU A;  4E7I A;  3DI6 A;  3CCS N;  1D8Y A;  3A5M C;  1Q86 O;  1JCE A;  2P9U A;  5MLC Q;  4JKA A;  2Q0U A;  5HRR A;  4E0D A;  3KJV A;  1CLQ A;  3DMJ A;  3G0Z A;  1RBT A;  3MK6 A;  3PX0 A;  4AF1 A;  4YOW A;  2NRR A;  1VSD A;  3AA4 A;  4IG3 A;  1RDU A;  1KAZ A;  1KC8 O;  3E9P A;  4DLE A;  3AVM A;  4MLH A;  2KTQ A;  2YCH A;  3MMV A;  3S3O A;  4X62 K;  1VQM N;  2ASM A;  2Q97 A;  3VET A;  3OYK A;  2ZE2 A;  3NH1 A;  3AVG A;  5FDL A;  2YV0 X;  1L3S A;  4JYA K;  4QOZ B;  1WAF A;  2P9I A;  4DS5 A;  1RT3 A;  4ID5 A;  2F8S A;  3OVN A;  3E9L A;  3DLL L;  4B3O A;  4B3R K;  1MWM A;  4DTS A;  3L6Q A;  2IGI A;  4BC2 A;  4FWS A;  3H3O B;  4CER A;  3TPQ A;  4CHO A;  1YIT N;  5ADX A;  2IS3 A;  2Q1N A;  1K6Y A;  3CI5 A;  3HPH A;  1YIJ N;  4KHP K;  4UQG A;  5AZJ A;  1SL2 A;  2GEL A;  3H6E A;  4H5N A;  3DLR A;  3D2F A;  2DFF A;  3CPE A;  1RT7 A;  1ILY A;  4C8M A;  3NH0 A;  2XY5 A;  1SL0 A;  3AGK A;  4XH4 A;  4KB0 A;  1T7P A;  5CYM A;  1DT9 A;  4CF9 A;  3S9H A;  2HVI A;  4FJ5 A;  4GV6 A;  2D1K A;  4O5B A;  3WEE A;  1NGH A;  2HMP A;  3PLA A;  3P4I A;  2CH5 A;  4CZH A;  2VGN A;  4LF8 K;  3GE1 A;  5JS1 A;  4DSE A;  1N5Y A;  2NRV A;  2V7Y A;  1NGE A;  3LM2 A;  3GOI A;  4DFM A;  4CJS A;  3ZT3 A;  3C95 A;  3ENB A;  3KKS A;  4BQL A;  4CJF A;  2OPS A;  3VF6 A;  2CGL A;  4FO0 A;  4H5R A;  2FBV A;  4DSI A;  1Z05 A;  3PIO L;  4E89 A;  4YNQ A;  3LWM A;  1U04 A;  3S3M A;  1EET A;  1A5X A;  1YVU A;  1NK7 A;  4FJI A;  4A62 A;  4LFB K;  2FF3 B;  3BGR A;  3QML A;  4Y0W A;  1MDU B;  4CK1 A;  1XUP O;  1WOQ A;  3P1G A;  3VEO A;  1S1V A;  4OPH A;  1W9H A;  4YOR A;  2NUB A;  2RF2 A;  1L5U A;  4BRF A;  3NVK A;  2CGK A;  1SKW A;  3IMX A;  4ELV A;  3FFI A;  4FK4 A;  4FJH A;  2HHV A;  1WUA A;  3A8Y A;  4X64 K;  4E1J A;  4FJJ A;  1R59 O;  4J2D A;  4LH4 A;  4F9O A;  5AQL A;  4LC9 B;  5BPM A;  2DY4 A;  3SQ1 A;  3J7A P;  1VQ5 N;  4IOX A;  3T3F A;  1KVA A;  4I6M A;  3VN5 A;  3AVL A;  4FL9 A;  1GLD G;  1TK0 A;  3TR8 A;  3VQP A;  4FW1 A;  1M90 O;  1O13 A;  1FJG K;  3HI0 A;  3EZ5 A;  4BRM A;  1NGG A;  4KFB A;  4H0P A;  2ZM6 K;  1NK5 A;  2I5J A;  4A5A A;  2GWJ A;  2QWM A;  4RG8 A;  1N32 K;  3THV A;  4HUE A;  1HPM A;  2QEX N;  1U2V B;  4DUY K;  5J2Q A;  4CJ3 A;  3SUN A;  2HF3 A;  1NM1 A;  3VEW A;  3HT3 A;  1GLA G;  5LMN K;  3AY9 A;  1GOA A;  4OJR A;  4YOT A;  1HJR A;  1QSY A;  4FXD A;  4IKF A;  3HVR A;  3JSM A;  4H4M A;  3IAY A;  2VWB A;  2KQ2 A;  5BN8 A;  1IBK K;  4N76 A;  1DTQ A;  3FZK A;  3O9T A;  1K8K A;  1G15 A;  4JN4 A;  4ICL A;  2O8C A;  1JL2 A;  3SI6 A;  4NCB A;  3O8M A;  1B9F A;  1QSS A;  3I33 A;  4DQP A;  3P39 A;  1OH5 A;  4E19 A;  3ZEU B;  1OKJ A;  3PUF A;  3OYH A;  1OH8 A;  1EQY A;  3RR8 A;  1VQL N;  3SV4 A;  1QSL A;  1IKW A;  3L3U A;  5SZT A;  1BUP A;  3M5R A;  5AQO A;  2HVH A;  5BN9 A;  2O8F B;  1E4F T;  2E2Q A;  1HYS A;  1RTJ A;  1IO2 A;  2ASO A;  1HNI A;  4CJT A;  4Z4I A;  3L4Q A;  4GVE A;  1S6Q A;  1D4X A;  5F2R A;  4FLV A;  2G8U A;  4I9L A;  4BRD A;  4CW7 B;  2VQE K;  4GKK K;  1DLO A;  1BCM A;  2UXD K;  3OYE A;  1ASW A;  2HOE A;  3KTQ A;  1TKX A;  2IIR A;  1BGX T;  1IG8 A;  3MN7 A;  2J4R A;  5C25 A;  3AVN A;  3J80 O;  4EAH D;  1SAZ A;  5M1K A;  4IO8 A;  4UY8 O;  3P31 A;  1KRP A;  1RFQ A;  3RMD A;  4JRP A;  1JJ2 M;  4ELU A;  4NO7 A;  4ELT A;  1DTT A;  4JKG B;  4MQ3 A;  5A2Q O;  1KFD A;  1Z26 A;  1YTA A;  2O4I A;  4GW6 A;  3PV8 A;  4J2A A;  1Q9X A;  1L3V A;  3O9U A;  2YJE A;  3L0Q A;  4DUZ K;  1C0G A;  4OKK A;  3M3Z A;  1JLC A;  4JK9 A;  2QWL A;  2P9K B;  2P9P B;  1ATR A;  4JI2 K;  4QS8 A;  1NU0 A;  3E66 A;  3KD1 E;  4FLT A;  4CE9 A;  4KHY A;  1TUU A;  4JI0 K;  1BIU A;  5KPR A;  1M1K O;  4CZK A;  3B6P A;  3PSF A;  4YDU A;  4FPB A;  1JCF A;  1NGD A;  2ZGZ A;  4FWQ A;  4QS7 A;  1YJ9 N;  4H5T A;  3CIP A;  1HNW K;  4J8F A;  2E8A A;  3L2V A;  4CCH A;  3ALY A;  3EE8 A;  4KTW A;  4B9U A;  3RMC A;  1XNR K;  4BDZ A;  1S22 A;  1ZBL A;  3LDP A;  1KAY A;  4JK8 A;  4B9Q A;  3CMA N;  3BZK A;  2D0B A;  5FRO A;  3VF2 A;  4DWI A;  5C24 A;  3LPU A;  3OYI A;  1WSI A;  4CBU A;  1B9D A;  5GIN A;  5DMR A;  3R1X A;  1T44 A;  3U9D A;  4B8C A;  5CHI A;  1U45 A;  4ID1 A;  4OLB A;  3K57 A;  2P1J A;  4CGJ A;  3OJU A;  4JI8 K;  3ZT4 A;  1TYQ B;  4Y1C A;  2KFZ A;  4H0X B;  4FSV A;  1BI4 B;  1VQ4 N;  3VGL A;  4JI6 K;  4IXC A;  1BOT O;  3M1F A;  3UIQ A;  2FBX A;  4C1N K;  2W40 A;  4PHT X;  2V7Z A;  4FW2 A;  3CC4 N;  3HOS A;  1X1P A;  3OS1 A;  2PZS A;  4CEA A;  1IBM K;  4Z94 A;  2YHW A;  2O8D B;  5AQF A;  5CE3 A;  1JLE A;  4O4G A;  4BWM A;  3KLF A;  4PKI A;  4DU1 A;  4WQ5 A;  1VSK A;  4FLU A;  1I94 K;  4WQ4 C;  4O5F A;  1S6P A;  3TAQ A;  4B3M K;  3CJ1 A;  2WON A;  1TL3 A;  1W7A A;  3F9M A;  3VEX A;  3NFA A;  3CCJ N;  3D7E O;  4BR2 A;  3DXK B;  4KBO A;  1BCO A;  5BRH A;  1RTH A;  1HJO A;  4RCH A;  4E3S A;  4JEP A;  3HP6 A;  3W0L A;  1BL3 A;  3ZT1 A;  4M3T A;  1YVN A;  3ZET B;  3MN9 A;  3W3D A;  1JLF A;  3OYM A;  1BA0 A;  3CFR A;  4GKJ K;  3ULD A;  2HNZ A;  1WB9 A;  4CEZ A;  3VTI A;  3RRG A;  4CIE A;  4KRF A;  1J54 A;  1QQM A;  4OKE A;  3CQX A;  3AO1 A;  4CFB A;  2UXC K;  2OPR A;  5JVG L;  1IJJ A;  3C7N B;  4F8R A;  5F1X A;  3BY5 A;  3VQA A;  3CF5 L;  3EO3 A;  2WFB A;  3V1O A;  4PL8 A;  5CZ1 A;  4EHT A;  5AFU H;  3LAN A;  3O4Q A;  1ITG A;  4TSX A;  1NK6 A;  2IAJ A;  3FGU A;  3K59 A;  4PUO A;  3A0I X;  1NMD A;  3VQ9 A;  3LWL A;  1LW2 A;  3ATV A;  3V1R A;  3I56 N;  4DSK A;  4B8A B;  4C1N I;  3T1Y K;  3OY9 A;  4Z4E A;  1C0T A;  1BA1 A;  4DLG A;  3P83 D;  1J9A A;  2HHQ A;  1U2V A;  4NB4 A;  1IV0 A;  2Q0R A;  3CJC A;  2UU9 K;  3QEI A;  1REV A;  4Q0B A;  1ASV A;  4FLZ A;  1L3U A;  3HXM A;  2XY8 A;  4FVM A;  2PBD A;  2YNG A;  1HKB A;  5HRN A;  2VWJ A;  5BR8 K;  2NRW A;  1HYZ A;  1GLB G;  3TAE A;  3CHW A;  1TK8 A;  4CGI A;  3MAQ A;  3LL3 A;  5BR9 A;  3VER A;  2RKI A;  1X9S A;  3AAQ A;  1CXU A;  2OZS A;  5CZ2 A;  4EZ6 A;  3UKR B;  4H0O A;  4JRQ A;  4YOV A;  1EKE A;  3ZLJ A;  3CFP A;  3VEZ A;  2O8B A;  5AQT A;  1S72 N;  4JKH A;  3H08 A;  1NJW A;  1QQO A;  3AVJ A;  1JCG A;  4B9V A;  4M3Z A;  4CGF A;  3SUP A;  1HKG A;  1SUQ A;  2XHB A;  4AM6 A;  4W5R A;  3QIN A;  3S41 A;  4CJV A;  1U47 A;  1N34 K;  2DFE A;  4O44 A;  2HB5 A;  1XNQ K;  4M42 A;  1VQN N;  2KKZ A;  1N33 K;  3ZSX A;  4DFP A;  1Q7Y O;  1VSJ A;  5BRD A;  4LF9 K;  4DCH A;  1C6V A;  4CFD A;  4RTF D;  3QES A;  3WNF A;  4W5T A;  4FJX A;  1BO5 O;  1QE1 A;  3DM2 A;  4AHT A;  1ZC6 A;  2OCE A;  4Z4F A;  3KVG A;  1VQ7 N;  1HNV A;  4RWT A;  3OYN A;  1TL1 A;  4MDA A;  4AIL C;  1NWK A;  4J2B A;  3F9K A;  5DM6 L;  1C1C A;  3V1Q A;  4IG0 A;  3EYZ A;  3HRG A;  1S3X A;  4DU4 A;  1GLC G;  1KQS M;  4FK2 A;  2Q3S A;  3I8D A;  1DEJ A;  3V4I A;  4XH5 A;  4CGH A;  3ENO A;  5E84 A;  4JD2 A;  2ZWH A;  5AZI A;  3VTH A;  3MDQ A;  1U4B A;  5KGW A;  4KV8 A;  3CQ8 A;  4FJ9 A;  4C8N A;  5FPN A;  1NKB A;  2G8F A;  5M1O A;  3IUC A;  4H8K A;  2WUS A;  4F3O A;  4CJU A;  4JK7 A;  3L2W A;  4PKG A;  2QK9 A;  2P9L B;  5EY4 A;  2E5L K;  2D4W A;  3WXI A;  4DQR A;  4RW7 A;  2YHX A;  4O8K A;  4LF7 K;  1BIZ A;  1NOY A;  3ULE A;  3BF1 A;  5JMV A;  3KHY A;  4W5Q A;  3LDO A;  5C42 A;  3QER A;  1JLG A;  2V52 B;  1TKD A;  2B6A A;  4JKC A;  3NDK A;  4CHY A;  4NCG A;  3RSE B;  5M1F A;  3VQC A;  3Q7B A;  4IOA L;  1T3V A;  1JXE A;  3V9U A;  4DR7 K;  4FJL A;  5TKY A;  2ZF5 O;  4O55 A;  3FZM A;  1YJW N;  3IS9 A;  3VQ5 A;  1LV5 A;  1RCH A;  4AHC A;  3CG7 A;  3A5L C;  1VQP N;  3THW A;  1NG9 A;  3K9J A;  3SMP A;  2NRZ A;  3MED A;  1NK0 A;  1HR0 K;  3HK2 A;  4LSN A;  3WXK A;  4M45 A;  4DV5 K;  4DB3 A;  4B9N A;  2VWK A;  2ATQ A;  3KLG A;  2Z1H A;  4CJL A;  1KVC A;  2GWK A;  1GOC A;  4JKB A;  4WF9 L;  2JWK A;  1HX1 A;  1U48 A;  2BE2 A;  1ZXO A;  3EE9 A;  4K0K K;  4JLH A;  4BGB A;  4BAC A;  4FM0 A;  4KTZ A;  3ENH A;  1NKC A;  4CJW A;  3NHG A;  4KH5 A;  3O4W A;  4CF8 A;  4IDH A;  4BRL A;  3TAB A;  3R9P A;  3TTD A;  1QVG M;  2GBZ A;  3L2Q A;  1RBS A;  3U8X A;  4CJK A;  3M8Q A;  3THX B;  2YKN A;  1OH6 A;  4BC3 A;  3K9K A;  3BUZ B;  1MA9 B;  3SUO A;  4E7K A;  5JLH A;  2QXL A;  3CD6 N;  5M1N A;  4DFJ A;  3OYC A;  4EHU A;  5CY4 A;  3E01 A;  1EXQ A;  2O8E A;  4IFE A;  3J8A A;  4IFV A;  3SPZ A;  3O9S A;  3MXI A;  5GAG P;  3AVI A;  2WOM A;  3J81 O;  3D0P A;  2XY7 A;  2G8K A;  2A1S A;  3NGY A;  2XRI A;  4HVJ A;  3VQ4 A;  2G8V A;  4CJP A;  3CC7 N;  4BG8 A;  5FPM A;  5JIC A;  4O8U A;  4DTO A;  3TAP A;  3SLC A;  3AVF A;  3SBT A;  1N36 K;  2H3G X;  3P5J A;  2RE2 A;  3H1V X;  3AVA A;  3HST B;  5DK5 A;  3AA3 A;  1HKC A;  4LSL A;  4EFH A;  4IFY A;  4BR0 A;  5AR0 A;  4QCL A;  4Z4G A;  4CF0 A;  4I7F A;  1JXB A;  4I2P A;  1WSJ A;  2Z1I A;  4WYB A;  5KPT A;  4FLX A;  4DHY A;  4YY3 K;  1RTD A;  3DRS A;  2UUA K;  1QZ6 A;  2YKM A;  2HBJ A;  3KK7 A;  5EVZ A;  4XEI A;  2ZD1 A;  4KB1 A;  4M3X A;  4X66 K;  4CK2 A;  4FOE A;  2IVN A;  4QAG A;  3BP8 A;  4OX9 K;  3H46 O;  3HZ6 A;  3J7Z O;  2FSK A;  4MFB A;  3G6E N;  2P9S B;  2YNF A;  4CHQ A;  2D0P A;  4NYF A;  1NGA A;  5IT9 O;  1RNH A;  1YHQ N;  4JAX A;  4M41 A;  3QO9 A;  4ZTF A;  4BRI A;  2OZM A;  1LCU A;  5B8H A;  2OA8 A;  2AP1 A;  4CFC A;  4DR2 K;  2W41 A;  3CCR N;  2CH6 A;  2YHY A;  4FZX C;  1X3M A;  4BRH A;  1VSI A;  1KFS A;  3Q7C A;  5M1P A;  3THY B;  4NYN A;  3C6A A;  3D2E B;  1I39 A;  2YX6 A;  4IJA A;  2G8I A;  1CZ9 A;  1QHT A;  4BE0 A;  3BEX A;  3QFU A;  3IRX A;  2IVP A;  3I55 N;  4JI7 K;  3KWG A;  4K41 A;  4JHD B;  3N4Q A;  3QLH A;  2YI1 A;  5AQY A;  4O0I A;  2GEM A;  3OTO K;  3IG1 A;  4FOI A;  3CCQ N;  1WN7 A;  3WXM B;  4DFK A;  3EEQ A;  2ETJ A;  4BVP A;  3SJJ A;  1YJN N;  2E2N A;  3PY8 A;  4KHQ A;  1Z25 A;  2A3Z A;  3U6F A;  1WNS A;  1QHA A;  4H03 B;  3ZSR A;  4YHH K;  1ATS A;  1QZ5 A;  4CZE A;  4FYD A;  1RT6 A;  4HCB A;  2HHX A;  3O9R A;  1S1X A;  3VF4 A;  1CXQ A;  4E7H A;  3CET A;  3QIP A;  4DTM A;  3VES A;  2E2O A;  3OS0 A;  3L4I A;  1DGK N;  1LWF A;  3TSQ A;  2NRH A;  5IWA K;  4A59 A;  3BDP A;  1Q8I A;  4ZTJ A;  5AQW A;  4IEI A;  2QWQ A;  5JS2 A;  1TAU A;  5HLF A;  1IH7 A;  2ZGY A;  4CED A;  4CEC A;  3ZSQ A;  4YOY A;  5GIP A;  3SQ0 A;  2RHK A;  2GUI A;  5J1E A;  4LFA K;  3K58 A;  2VYP A;  2FF6 A;  4F4K A;  3WXJ A;  4HWI A;  5KPZ A;  1D9F A;  3AAR A;  3AAP A;  1UOC A;  3M8P A;  4RW4 A;  1SKR A;  1J53 A;  5J2N A;  1BDG A;  1LWE A;  4CZM A;  4DTU A;  3HM8 A;  2OYQ A;  3CCM N;  3CCE N;  4FM2 A;  5I42 A;  2E88 A;  3L8B A;  4DU3 A;  4PQU A;  4BE2 A;  1C0F A;  3ZT2 A;  3VQB A;  2QTD A;  3DRR A;  1A5W A;  3DLK A;  4K8X A;  4DQ8 A;  3LDL A;  4FZY A;  1QS4 A;  2OAN A;  1LOT B;  3G4S N;  3HPO A;  3O1W A;  3TAG A;  2ZJQ L;  4KTQ A;  3UKU B;  4DV3 K;  1EO1 A;  4CFA A;  3U4L A;  1NMN A;  2GX9 A;  2PYL A;  3M8R A;  2JGU A;  2DTU A;  4BRN A;  3O5B A;  5AJ3 K;  1NOZ A;  5HRO A;  2IOC A;  3AO3 A;  3AVB A;  4RW6 A;  2P9U B;  1RIL A;  3DLH A;  3FZH A;  4AM7 A;  3GG4 A;  4NLC A;  4CGG A;  3LPT A;  5KGX A;  2IVO A;  5T7B A;  3TU5 A;  3QET A;  3E1Y A;  1VAZ A;  3HOT A;  3AVH A;  3SZ2 A;  1RTI A;  4JI3 K;  4B9S A;  1NBW A;  3HJF A;  1I3A A;  5BPN A;  1WSH A;  3O4N A;  3THX A;  1RT2 A;  1NGB A;  3GL1 A;  4V19 S;  3ZYY X;  1NLV A;  2YHA A;  1TV6 A;  4KH4 A;  1GLL O;  1SZ2 A;  4CEE A;  5GAH P;  3SQ4 A;  1X3N A;  4EP5 A;  1U6Z A;  2E1Y A;  1WSG A;  4DSF A;  2OTL N;  1RDW X;  3CJ9 A;  3TSP A;  3O3G A;  4A2B A;  1WAJ A;  1NK9 A;  3LAL A;  4CIF A;  2A5X A;  4FJG A;  3MN5 A;  1J5E K;  1TGO A;  4CF1 A;  2ITG A;  4B1Z A;  1ZYQ A;  1JLQ A;  1NGI A;  2P51 A;  3PX4 A;  3DOK A;  3E9O A;  1SKS A;  3O3F A;  4FM1 A;  3QDK A;  4BR4 A;  5AZJ B;  4Y1D A;  2QKB A;  3DLE A;  1OVQ A;  1Q9Y A;  4C8O A;  4BR7 A;  3KKR A;  3CJB A;  2E2P A;  3LP2 A;  2HHT A;  4KRE A;  4IJN A;  3JYT A;  1IKY A;  2BUP A;  3QNO A;  4BY9 C;  1EP4 A;  5C2D A;  3CM5 A;  4LF5 K;  1EX4 A;  2Q2R A;  4DR6 K;  3WEE B;  4OPJ A;  4OVL A;  1HUX A;  4U67 L;  3SMS A;  3CCV N;  4FWN A;  2EHG A;  3OW2 M;  3O3H A;  1BG3 A;  4ILH A;  2G8W A;  1HPZ A;  4BC5 A;  4HTU A;  1WSE A;  2A42 A;  1NK8 A;  4ILG B;  1H1V A;  1UA0 A;  3CER A;  4KKO A;  2D0A A;  2QM1 A;  3PX6 A;  3PO5 A;  4M63 C;  2UUB K;  3K5L A;  1SQK A;  5FRM A;  4CJR A;  1P90 A;  2BTF A;  1Q82 O;  1X9M A;  4E7L A;  4DTP A;  3MEG A;  3NBP A;  5HL7 L;  4FK0 A;  1SS6 A;  2WTU A;  4M3W A;  2P5G A;  4FZZ A;  1UAX A;  3UB5 A;  3VEN A;  4KAZ A;  1VRU A;  4EZ9 A;  4FWM A;  3L2U A;  4KPY A;  2NZT A;  4CEF A;  3DRP A;  3C6T A;  1VQO N;  3RR7 A;  1VSH A;  2VGM A;  3HP9 A;  2KZM A;  3L3V A;  1T05 A;  4KI6 A;  2F9T A;  4EP4 A;  4WFN L;  1J5O A;  3NF7 A;  3V81 A;  1KVB A;  2P9N B;  3MXJ A;  4GNI A;  4JHD A;  4CBX A;  5HOO A;  3HYF A;  2HNY A;  5C15 A;  3WNG A;  4I6M B;  2D0C A;  4BRQ A;  1G99 A;  4MO5 A;  1NJZ A;  5AQZ A;  3OYD A;  5JLF A;  4YOX A;  5LY3 A;  3ZEU A;  5FLX O;  3N4P A;  2WBN A;  2LSN A;  5FPD A;  1TKT A;  4LF6 K;  3EY1 A;  3GDQ A;  3QEP A;  3OYF A;  1VSL A;  2O8F A;  4HUF A;  3EL2 A;  2FBY A;  5AQP A;  4BGA A;  4BG9 A;  4DTJ A;  3PIP L;  3SUQ A;  3CFO A;  4M7Y A;  1YXQ A;  2EWS A;  3LP1 A;  5AQM A;  5I3U A;  1YI2 N;  1YT3 A;  4FPA A;  4WFB L;  3HM9 A;  3T19 A;  1NGJ A;  3T7Z A;  4FJ7 A;  1YF5 L;  2OTJ N;  4DS4 A;  1O1W A;  1VRT A;  4DR1 K;  5GAD P;  5DM7 L;  1NJI O;  3G25 A;  3LP0 A;  4IOC L;  1KSP A;  1K8K B;  3OYL A;  4JKF A;  4JI4 K;  5H1S Q;  1X9W A;  3SBG A;  1Q81 O;  1Z6R A;  3ZX2 A;  2O8C B;  3L2R A;  2FSJ A;  4K8Z A;  1KD1 O;  2X78 A;  4Z4C A;  5C10 A;  3DOL A;  3EKS A;  2HHU A;  2KHO A;  3HL8 A;  5AQV A;  3NE6 A;  2FSN A;  3OJS A;  4I9Q A;  1F21 A;  4Q5V A;  1S1W A;  2A1R A;  3PSI A;  4FWO A;  1NGC A;  4CHP A;  4N5S A;  3VEY A;  3VGK A;  3K5M A;  4HTL A;  5AQG A;  2KFN A;  2Y1J A;  4X65 K;  1ESV A;  4O0J A;  4B1X B;  4N41 A;  4B3T K;  4A61 A;  2XY6 A;  2F9W A;  3TTC A;  2BDP A;  3MXM A;  3NGI A;  1HYV A;  3HVT A;  1MU2 A;  4JKG A;  4DQS A;  4KHU A;  3VQD A;  4DMN A;  2D5R A;  5GIO A;  4BR5 A;  1NKE A;  3H1Q A;  3CM6 A;  3EZW A;  4K43 A;  3MN6 A;  3C0B A;  3FZL A;  2X6N A;  4BRG A;  3C94 A;  4JI5 K;  2HBM A;  1P8Z A;  4MO4 A;  1RT5 A;  5E26 A;  1U49 A;  2P9K A;  2P9P A;  3SAF A;  4J2E A;  1S1U A;  4BDY A;  3MEC A;  1EWR A;  3FLC O;  4GV9 A;  3WQU A;  1RBR A;  2ZJR L;  3IFR A;  3UKU A;  4ILJ A;  2YJF A;  2YHB A;  4FWL A;  4CD1 A;  3CC2 N;  3KD5 E;  3K0S A;  4M3R A;  1RDD A;  3VA0 A;  5AQN A;  3WQT A;  2OPP A;  2HST A;  4MDB A;  5EXW A;  4DF8 A;  5ADX H;  1RBU A;  2G8H A;  3SYZ A;  5GAE P;  4FLW A;  1XMO K;  3RWU A;  4CZI A;  3S3N A;  1XHX A;  2HHW A;  3DLG A;  1HMV A;  3SAH A;  2HHS A;  1HLU A;  3TAN A;  4GVM A;  1BIS A;  1VSM A;  1IG9 A;  4DV6 K;  3KK2 A;  5HBM A;  5AQR A;  3FR0 A;  3K5N A;  3C6U A;  1GLJ O;  3G71 N;  1T6D A;  5SWM A;  5TKW A;  2W6L A;  4PWD A;  1TYQ A;  1LW0 A;  2KZZ A;  2KLA A;  4IDK A;  1BI4 A;  2VG6 A;  4B1W B;  4E1N A;  1TUY A;  1MWK A;  4IO9 L;  4R79 A;  4A2A A;  4BRK A;  3SNN A;  3CXC M;  5EX5 A;  2X74 A;  1TKZ A;  5KI6 A;  1SL1 A;  2Q31 A;  2GTD A;  1FK9 A;  3B6O A;  2O8D A;  2E20 A;  1IKV A;  4FJ8 A;  4OGE A;  4PKH A;  2HW3 A;  4DV0 K;  1BWF O;  4LH5 A;  4K25 A;  2IC3 A;  3LDN A;  4BRO A;  1SV5 A;  3SCX A;  3RTV A;  2DFH A;  3SV3 A;  3DXK A;  3RVC A;  4CEB A;  5KRS A;  1TVR A;  4L8R B;  3I8B A;  2HBK A;  4CJE A;  4BC4 A;  3OYB A;  4JV5 K;  1LAV A;  3ZET A;  4PA1 A;  1J6Z A;  3J7Y P;  4AHV A;  1FW6 A;  1XQS C;  3LDS A;  3IDH A;  1C1A A;  3WXL A;  2I7P A;  2ASP A;  1RGI A;  3VMF B;  3VQE A;  4FWR A;  5EOY A;  1RDC A;  3A5O C;  1KLM A;  1VSF A;  1S5J A;  4CEO A;  1YUW A;  2O4G A;  4JNE A;  1XHZ A;  1T8E A;  3C7N A;  2DPN A;  4FJK A;  1VSE A;  4RW8 A;  5J2P A;  3ZSY A;  2F4V K;  4H0T B;  3EKU A;  2I7N A;  4H5V A;  1NNE A;  3KLH A;  4CZF A;  2FXU A;  4BRA A;  4A57 A;  2E1Z A;  1V4T A;  3DWL A;  2NRT A;  4KI4 A;  5F0X A;  3MWT A;  3DXM B;  2BH1 A;  3NGZ A;  3RMA A;  3I0R A;  4BQZ A;  1RDB A;  2FBT A;  4QS9 A;  2W42 A;  1D5A A;  3SQ2 A;  1JLA A;  2F7T A;  3OA9 A;  4AH9 A;  4C8K A;  3MX2 A;  1W97 L;  3JS6 A;  5KRT A;  4HHT A;  4JKD A;  4B1U B;  3P38 A;  4CD3 A;  3R6M A;  1OH7 A;  4BRE A;  3T1H K;  2F96 A;  4XH1 A;  1QQN A;  2OPQ A;  3HTV A;  4CJ7 A;  3CPW M;  3LDQ A;  3O6W A;  4KO0 A;  3KK3 A;  1ASU A;  4Z0U A;  1FKO A;  4Z4H A;  5C0Y A;  4IWV A;  5AQH A;  3F2K A;  1QTM A;  2P9N A;  1E4G T;  5LJV A;  4PY5 A;  1HRH A;  3FFK B;  4H0Y B;  3UKR A;  1A5V A;  3F73 A;  5FPE A;  3CQY A;  1W2B M;  3BZC A;  3TAR A;  3TAM A;  3ZT0 A;  3ZCM A;  2QWP A;  2UYT A;  4OGC A;  3QBW A;  1UA1 A;  4DTR A;  4G9Z A;  1S1T A;  1D9D A;  4B1V A;  4JS5 A;  1CZB A;  4GMJ B;  2UXB K;  3EN9 A;  2V51 B;  3NF6 A;  5HRP A;  1R0A A;  3V9X A;  4KHW A;  3ID8 A;  4G1Q A;  4DF4 A;  4N47 A;  4OO1 J;  4FWP A;  4OPA A;  4DV1 K;  1BQM A;  4AQY K;  4C23 A;  3H45 C;  1BHL A;  4B9L A;  3QFP A;  1XI1 A;  5HRS A;  4C8L A;  3AA2 A;  4OLA A;  2HBL A;  4GV3 A;  1C0U A;  2QKK A;  2A40 A;  3O08 A;  3H3N O;  4JS4 A;  2W6K A;  1JKH A;  4LY7 A;  5KQ8 A;  1V4S A;  3BF3 A;  1GOB A;  2O8B B;  3DYA A;  4M3Y A;  4B9T A;  2HF4 A;  3IKM A;  1KXP A;  3DAW A;  1LWC A;  3CJA A;  1TAQ A;  1ZBS A;  1HNZ K;  4LF4 K;  3LM9 A;  2A6A A;  2WC9 A;  4OKJ A;  1XMQ K;  3OYA A;  1VQ9 N;  3VQ8 A;  4B3S K;  1BU6 O;  4AHS A;  4CES A;  1BQN A;  2AJQ A;  2P9L A;  5AQU A;  3T1A A;  5AQS A;  3AV9 A;  3DJC A;  4ISF A;  3HSC A;  4M7X A;  2HHH K;  4DR4 K;  2E6M A;  2VQF K;  3O80 A;  3ASM A;  3RSE A;  4DQQ A;  4IZ9 A; 
#chains in the Genus database with same CATH homology
 4F3O A;  4CJU A;  4E89 A;  3L2W A;  4YNQ A;  1WSE A;  3LWM A;  1U04 A;  2HND A;  1EET A;  3TWH A;  1A5X A;  3S3M A;  1NK8 A;  2QK9 A;  1YVU A;  4IBN A;  1NK7 A;  4FJI A;  4DQR A;  4RW7 A;  1UA0 A;  1Y97 A;  3BGR A;  1BIZ A;  1NOY A;  2EX3 A;  2Z1J A;  4KKO A;  2D0A A;  4W5Q A;  1LAW A;  5C42 A;  4CK1 A;  3QER A;  3RRH A;  1JLG A;  1TKD A;  1HQE A;  2B6A A;  3P1G A;  3PX6 A;  1S1V A;  3PO5 A;  1W9H A;  3NDK A;  4CHY A;  2NUB A;  2RF2 A;  3K5L A;  3LZJ A;  1L5U A;  1SKW A;  4CJR A;  5FRM A;  4NCG A;  1X9M A;  4ELV A;  3FFI A;  3VQC A;  4FJH A;  4FK4 A;  2HHV A;  4E7L A;  4DTP A;  2FC0 A;  3MEG A;  4DTN A;  3NBP A;  4FK0 A;  4FJJ A;  3AVC A;  3PO4 A;  4LH4 A;  2P5G A;  4J2D A;  4FZZ A;  4M3W A;  1JXE A;  3V9U A;  4FJL A;  1UAX A;  4KAZ A;  2DY4 A;  3AO4 A;  3SQ1 A;  1VRU A;  4O55 A;  4B9M A;  4EZ9 A;  3L2U A;  3T3F A;  4KPY A;  1KVA A;  2ZQB A;  3AVL A;  3IS9 A;  3VQ5 A;  3DRP A;  3VN5 A;  3A2F A;  3C6T A;  4LD0 A;  1RCH A;  4FW1 A;  3TR8 A;  3LAK A;  3VQP A;  1TK0 A;  3RR7 A;  1VSH A;  3EZ5 A;  4AHC A;  3CG7 A;  4KFB A;  3HP9 A;  1NK5 A;  2I5J A;  2KZM A;  2X6S A;  4H4O A;  1XWL A;  1FKP A;  1L3T A;  4RG8 A;  3L3V A;  1NJY A;  3MEE A;  3THV A;  1T05 A;  4HUE A;  1WLJ A;  3MED A;  4EP4 A;  4KI6 A;  1NK0 A;  1QQC A;  1J5O A;  3NF7 A;  5J2Q A;  1KVB A;  3V81 A;  3HK2 A;  4LSN A;  1IKX A;  3MXJ A;  4CJ3 A;  4M45 A;  3SUN A;  3HYF A;  2HNY A;  3HT3 A;  3WNG A;  3OYG A;  4B9N A;  2VWK A;  2ATQ A;  2D0C A;  1GOA A;  2Z1H A;  3KLG A;  4OJR A;  4CJL A;  1NJZ A;  1KVC A;  1GOC A;  1HJR A;  3OYD A;  1QSY A;  1U48 A;  4FXD A;  2BE2 A;  4IKF A;  3HVR A;  3JSM A;  4H4M A;  3HPG A;  3IAY A;  2LSN A;  4N76 A;  2KQ2 A;  4CK3 A;  4RW9 A;  4JLH A;  1TKT A;  3VA3 A;  3EY1 A;  1DTQ A;  4CHN A;  4BAC A;  4FM0 A;  4KTZ A;  1NKC A;  1JLB A;  3QEP A;  1G15 A;  3OYF A;  4ICL A;  4CJW A;  3NHG A;  1W0H A;  4OPK A;  1VSL A;  2RN2 A;  1YTU A;  1JL2 A;  4HUF A;  2KW4 A;  2FBY A;  4CF8 A;  3SI6 A;  4NCB A;  4DTJ A;  3NF8 A;  3TAB A;  3SUQ A;  2BAN A;  3CFO A;  3K5O A;  2B5J A;  1B9F A;  3G10 A;  3NCI A;  3LP1 A;  5FRN A;  1QSS A;  5I3U A;  3HO1 A;  1RT1 A;  1YT3 A;  2GBZ A;  1RBS A;  3L2Q A;  4NCA A;  1UWB A;  3HM9 A;  3T19 A;  4DQP A;  4CJK A;  4E19 A;  4FJ7 A;  3PUF A;  3M8Q A;  3OYH A;  2YKN A;  1WSF A;  1ZBF A;  4DS4 A;  1O1W A;  3NAE A;  1VRT A;  2YNI A;  3RR8 A;  3SUO A;  3SV4 A;  3LP0 A;  3U3G A;  4E7K A;  4DSL A;  4WE1 A;  1QSL A;  1IKW A;  3L3U A;  5SZT A;  1KSP A;  4M3U A;  2Y1I A;  3K2P A;  2HVH A;  4DFJ A;  3OYL A;  3OYC A;  3KLE A;  1X9W A;  2XO7 A;  3TAF A;  1HYS A;  5CY4 A;  3L2R A;  4K8Z A;  1RTJ A;  3AO2 A;  1IO2 A;  2X78 A;  4E1M A;  4Z4C A;  3DOL A;  5EU7 A;  1HNI A;  3E01 A;  4KHS A;  3HL8 A;  1EXQ A;  3NE6 A;  3U3Y A;  2HHU A;  3OJS A;  4ZHR A;  4I9Q A;  4IFV A;  1F21 A;  4Q5V A;  1S1W A;  4CJT A;  3SPZ A;  3MXI A;  2A1R A;  4Z4I A;  3AVI A;  2WOM A;  4W5O A;  4CHP A;  3D0P A;  4R5P A;  2XY7 A;  3SPY A;  1TK5 A;  1S6Q A;  4N5S A;  1KLN A;  1S9E A;  2A1S A;  4FLV A;  2G8U A;  3NGY A;  2XRI A;  4I9L A;  4HVJ A;  3K5M A;  4HUG A;  3QEX A;  2PYJ A;  2KFN A;  4W5N A;  5J2M A;  2Y1J A;  3VQ4 A;  2G8V A;  4CJP A;  4O0J A;  4N41 A;  1DLO A;  1BCM A;  2IDO A;  2XY6 A;  4AHU A;  3OYE A;  2BDP A;  3MXM A;  4N56 A;  3NGI A;  1HYV A;  1ASW A;  4I2Q A;  3V9Z A;  4DTO A;  3HVT A;  4CGD A;  3TAP A;  3KTQ A;  4HCC A;  1TKX A;  4BDP A;  3AVF A;  1MU2 A;  5K14 A;  4DQS A;  4KHU A;  3P5J A;  1BGX T;  3VQD A;  4DMN A;  1XC9 A;  5C25 A;  3CYM A;  3AVA A;  2D5R A;  3AVN A;  3HST B;  5CYQ A;  5DK5 A;  3AA3 A;  1NKE A;  3CM6 A;  4LSL A;  4FLY A;  1B92 A;  1RDA A;  3LAM A;  4IFY A;  4CJ4 A;  4QCL A;  1KRP A;  4Z4G A;  2BGG A;  2B4J A;  3RMD A;  1JL1 A;  2X6N A;  1RT4 A;  3C94 A;  2VG5 A;  4I7F A;  4CF0 A;  4JRP A;  1JXB A;  2JLE A;  4I2P A;  1WSJ A;  4ELU A;  2Z1I A;  1RT5 A;  1KTQ A;  1U49 A;  2G8K A;  4FLX A;  3M8S A;  1DTT A;  4ELT A;  4MQ3 A;  3AO5 A;  4J2E A;  1S1U A;  4CJQ A;  4DSJ A;  1KFD A;  4CEQ A;  4BDY A;  1RTD A;  3DRS A;  3MEC A;  1Z26 A;  1YTA A;  4KHN A;  2O4I A;  4GW6 A;  1RBR A;  3PV8 A;  4DTX A;  2YKM A;  4DQQ A;  2R7Y A;  1Q9X A;  1L3V A;  4J2A A;  3I0S A;  4KB1 A;  2ZD1 A;  4M3X A;  4CK2 A;  4OKK A;  4QAG A;  2YHB A;  1JLC A;  3KD5 E;  1NJX A;  4M3R A;  1RDD A;  4MFB A;  3VA0 A;  2OPP A;  2YNF A;  4CHQ A;  3KD1 E;  4FLT A;  4DF8 A;  1RBU A;  2G8H A;  4NYF A;  4CE9 A;  4CHZ A;  4KHY A;  1BIU A;  3SYZ A;  1RNH A;  2HMI A;  4FLW A;  2E4L A;  3RWU A;  4M41 A;  3QO9 A;  3B6P A;  3S3N A;  4ZTF A;  1XHX A;  1ZBU A;  2VG7 A;  1HQU A;  2OZM A;  3LZI A;  3KK1 A;  2OA8 A;  2HHW A;  4CF2 A;  3DLG A;  4CFC A;  1HMV A;  3KLI A;  2QXF A;  2HHS A;  3TAN A;  4GVM A;  1NK4 A;  1S9G A;  1BIS A;  3KIO A;  1VSM A;  4CJ5 A;  1IG9 A;  4FZX C;  3KK2 A;  5HBM A;  3ZSZ A;  3L2V A;  1VSI A;  1KFS A;  4CCH A;  3ALY A;  3NF9 A;  3K5N A;  5D3G A;  3C6U A;  4KTW A;  4NYN A;  2PY5 A;  4B9U A;  3RMC A;  1I39 A;  2G8I A;  3V6D A;  1KCF A;  4CIG A;  5SWM A;  3D45 A;  4BDZ A;  1ZBL A;  4FJN A;  4BWJ A;  1C1B A;  1CZ9 A;  1QHT A;  4PWD A;  4BE0 A;  2D0B A;  3ITH A;  5FRO A;  1LW0 A;  3IRX A;  4DWI A;  4IDK A;  5C24 A;  1BI4 A;  2KZZ A;  2VG6 A;  4E1N A;  3LPU A;  3OYI A;  1WSI A;  4FCY A;  4AHR A;  1B9D A;  4F2R A;  5DMR A;  3SNN A;  4B8C A;  1U45 A;  3QLH A;  4O0I A;  2X74 A;  4ID1 A;  1TKZ A;  4OLB A;  5KI6 A;  4BE1 A;  1SL1 A;  3B6O A;  1FK9 A;  3K57 A;  3IG1 A;  2P1J A;  1WN7 A;  4DFK A;  4CGJ A;  2ETJ A;  3OJU A;  3SJJ A;  3PY8 A;  4KHQ A;  1Z25 A;  4CEF A;  3U6F A;  1WNS A;  3ZSR A;  3ZT4 A;  1IKV A;  4Y1C A;  2KFZ A;  4FJ8 A;  4E7J A;  1BI4 B;  4OGE A;  1ZBH A;  4B08 A;  2YNH A;  2HW3 A;  1C0M A;  4LH5 A;  3UIQ A;  2E6L A;  2FBX A;  3VQQ A;  2IC3 A;  2GV9 A;  4DG1 A;  4EZ6 A;  4FW2 A;  5E41 A;  4FYD A;  1RT6 A;  1X1P A;  4HCB A;  2P5O A;  3OS1 A;  2PZS A;  1SV5 A;  4CEA A;  2HHX A;  3SCX A;  1S1X A;  3RTV A;  1CXQ A;  2DFH A;  3SV3 A;  4E7H A;  3TI0 A;  3QIP A;  4DTM A;  3OS0 A;  3VQ7 A;  4CEB A;  1JLE A;  1TVR A;  2RPI A;  5KRS A;  3V9S A;  3QEV A;  4CJE A;  1LWF A;  3DLB A;  4L8R B;  3ISN C;  4O4G A;  4BWM A;  3NH2 A;  3AA5 X;  3OYB A;  3KLF A;  1LAV A;  4PA1 A;  4DU1 A;  4FLU A;  1VSK A;  4AHV A;  3BDP A;  1Q8I A;  4ZTJ A;  3LDS A;  3TAQ A;  1S6P A;  3OYJ A;  1C1A A;  3QEW A;  2WON A;  1TL3 A;  1ZBI A;  3NFA A;  3V9W A;  3VQE A;  3OS2 A;  3WNH A;  5KTQ A;  1LV5 A;  1BCO A;  5JS2 A;  1TAU A;  1RDC A;  1RTH A;  5HLF A;  1IH7 A;  1KLM A;  4CED A;  1VSF A;  3ZSQ A;  4CEC A;  4E3S A;  1S5J A;  4CEO A;  3HP6 A;  1RBV A;  3WNE A;  2O4G A;  3QIO A;  1BL3 A;  3ZT1 A;  3ZSV A;  3SQ0 A;  1XHZ A;  4M3T A;  1T8E A;  1JLF A;  2GUI A;  3OYM A;  4FJK A;  1VSE A;  3CFR A;  5J1E A;  4F3T A;  4RW8 A;  3K58 A;  3ULD A;  2HNZ A;  3ZSY A;  5J2P A;  4CEZ A;  4F4K A;  3RRG A;  4CIE A;  1D9F A;  1J54 A;  4KRF A;  3M8P A;  1UOC A;  4RW4 A;  1SKR A;  1J53 A;  3KLH A;  4YFU A;  5J2N A;  4OKE A;  1LWE A;  4DTU A;  2OYQ A;  4KI4 A;  3AO1 A;  4CFB A;  2OPR A;  2Z1G A;  4FM2 A;  5I42 A;  3L8B A;  3ZSO A;  4DU3 A;  1FXX A;  3ZSW A;  3QNN A;  4BE2 A;  3AVK A;  2F8T A;  4PQU A;  3NGZ A;  3RMA A;  3I0R A;  1T03 A;  1N6Q A;  4F8R A;  3ZT2 A;  3VQB A;  3VQA A;  1RDB A;  2FBT A;  2W42 A;  1D5A A;  4XIU A;  3V1O A;  3VQ6 A;  3SQ2 A;  4FJM A;  3DRR A;  4DQI A;  5CZ1 A;  4F2S A;  1A5W A;  1JLA A;  3DLK A;  3LAN A;  4AH9 A;  4C8K A;  3O4Q A;  1ITG A;  4K8X A;  3RMB A;  5HP1 A;  4TSX A;  1VK0 A;  3LP3 A;  4E7I A;  5KRT A;  1NK6 A;  4HHT A;  2IAJ A;  3K59 A;  1QS4 A;  3DI6 A;  4FZY A;  4PUO A;  1D8Y A;  3VQ9 A;  3HPO A;  3LWL A;  1LW2 A;  2F96 A;  3V1R A;  4DSK A;  3TAG A;  2OPQ A;  4B8A B;  5HRR A;  3OY9 A;  4KTQ A;  4KO0 A;  4E0D A;  3KK3 A;  3KJV A;  1CLQ A;  1ASU A;  3DMJ A;  4Z0U A;  1FKO A;  4CFA A;  4Z4H A;  1C0T A;  4Z4E A;  3G0Z A;  4DLG A;  3P83 D;  1RBT A;  1J9A A;  2HHQ A;  1QTM A;  3PX0 A;  3QEI A;  1REV A;  2JGU A;  3M8R A;  2PYL A;  1ASV A;  4FLZ A;  4Q0B A;  4PY5 A;  1L3U A;  2DTU A;  3HXM A;  1HRH A;  2XY8 A;  1VSD A;  4FVM A;  3AA4 A;  4IG3 A;  1A5V A;  1NOZ A;  2YNG A;  3F73 A;  5HRO A;  2IOC A;  4DLE A;  3AVM A;  2KTQ A;  3AO3 A;  3AVB A;  4RW6 A;  5HRN A;  2VWJ A;  3TAR A;  1RIL A;  3DLH A;  3TAM A;  3ZT0 A;  1HYZ A;  3ZCM A;  3TAE A;  3S3O A;  4OGC A;  1TK8 A;  4CGG A;  1UA1 A;  3LPT A;  4CGI A;  4DTR A;  3OYK A;  2ZE2 A;  3MAQ A;  3NH1 A;  1S1T A;  5KGX A;  1D9D A;  3AVG A;  2RKI A;  5T7B A;  3QET A;  5FDL A;  1X9S A;  2YV0 X;  4JS5 A;  1CXU A;  1L3S A;  1CZB A;  2OZS A;  4GMJ B;  3AVH A;  4QOZ B;  1WAF A;  5CZ2 A;  3SZ2 A;  1RTI A;  3NF6 A;  1RT3 A;  4ID5 A;  5HRP A;  4JRQ A;  1EKE A;  4DS5 A;  1R0A A;  2F8S A;  4B9S A;  3OVN A;  3V9X A;  4KHW A;  1I3A A;  4G1Q A;  3CFP A;  4DF4 A;  3HJF A;  4DTS A;  1WSH A;  4B3O A;  3O4N A;  2IGI A;  4N47 A;  1RT2 A;  3H08 A;  1BQM A;  4CER A;  4CHO A;  1NJW A;  2IS3 A;  2YHA A;  1TV6 A;  3AVJ A;  1K6Y A;  1BHL A;  4B9V A;  4B9L A;  4M3Z A;  3HPH A;  4CGF A;  3SUP A;  1XI1 A;  5HRS A;  1SUQ A;  4UQG A;  1SL2 A;  4CEE A;  4C8L A;  2XHB A;  3SQ4 A;  3AA2 A;  4OLA A;  1C0U A;  4W5R A;  4EP5 A;  2QKK A;  1WSG A;  4DSF A;  3QIN A;  3DLR A;  4JS4 A;  2DFF A;  4CJV A;  1U47 A;  2DFE A;  3O3G A;  1RT7 A;  1NK9 A;  1WAJ A;  2HB5 A;  4O44 A;  1JKH A;  4C8M A;  4LY7 A;  3NH0 A;  3LAL A;  4CIF A;  2XY5 A;  1SL0 A;  4M42 A;  1GOB A;  4KB0 A;  4FJG A;  1T7P A;  3ZSX A;  4DFP A;  3DYA A;  4M3Y A;  4B9T A;  1TGO A;  5CYM A;  4CF1 A;  2ITG A;  1VSJ A;  1ZYQ A;  1JLQ A;  4CF9 A;  2P51 A;  3PX4 A;  1SKS A;  3DOK A;  1C6V A;  3O3F A;  3S9H A;  2HVI A;  1LWC A;  4FJ5 A;  4FM1 A;  4CFD A;  1TAQ A;  4Y1D A;  4O5B A;  3QES A;  3WNF A;  4W5T A;  2QKB A;  4FJX A;  3DM2 A;  1QE1 A;  3DLE A;  4OKJ A;  4AHT A;  4Z4F A;  1Q9Y A;  3OYA A;  4C8O A;  3KKR A;  1HNV A;  3VQ8 A;  3OYN A;  1TL1 A;  4AIL C;  4AHS A;  4J2B A;  3F9K A;  5JS1 A;  1C1C A;  3LP2 A;  3V1Q A;  4IG0 A;  3EYZ A;  4KRE A;  2HHT A;  4DSE A;  4DU4 A;  4CES A;  1N5Y A;  3JYT A;  4FK2 A;  2Q3S A;  3I8D A;  1IKY A;  3V4I A;  4CGH A;  1BQN A;  3QNO A;  2AJQ A;  1EP4 A;  3CM5 A;  1EX4 A;  4OPJ A;  4DFM A;  3T1A A;  4CJS A;  3ZT3 A;  3C95 A;  1U4B A;  3AV9 A;  4OVL A;  4KV8 A;  5KGW A;  3CQ8 A;  3KKS A;  4FJ9 A;  4C8N A;  4CJF A;  2EHG A;  1NKB A;  2OPS A;  2G8F A;  3O3H A;  2E6M A;  2FBV A;  2G8W A;  4DSI A;  1HPZ A;  3ASM A;  4H8K A;  4HTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...