2XY8A

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 53
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy8A00
1B92A 3NCIA 2FC0A 2BDPA 3CYMA 4DS4A 4CJ4A 4AHSA 3OYEA 4F2RA 4B9UA 4XIUA 2YNFA 1RTHA 4FZXC 3V81A 3K5NA 4KAZA 4CJFA 2JGUA 5D3GA 4DFPA 4JLHA 4CJ5A 3KKSA 1U49A 3G10A 1QQCA 2HMIA 4DFJA 4B9VA 1GOBA 3AVGA 4CF1A 4C8LA 4FJGA 3K57A 3LZIA 3TANA 4FZZA 2ETJA 2QXFA 3L2RA 3SPZA 2XO7A 4DMNA 4DS5A 4DTXA 4DWIA 4N56A 3L3UA 1VSIA 1HQUA 2OA8A 1BL3A 1HNIA 3M8QA 3BGRA 2B4JA 5HP1A 2NUBA 3P5JA 4QOZB 3OYDA 4CJTA 1A5VA 4AHVA 1SL2A 4NYFA 3S3NA 3SZ2A 4CJKA 3L3VA 3HM9A 3TAEA 1HQEA 1WSHA 4M3YA 1C6VA 4M3TA 1F21A 1VSMA 3TAQA 1IKXA 2VG5A 3P1GA 4QAGA 2KZZA 3OYNA 3JSMA 3RMBA 1SKRA 2G8VA 5C25A 3T1AA 4CJVA 5SZTA 4DQQA 2KFNA 1RTDA 2GBZA 2YV0X 2B5JA 4OGEA 4ELTA 3MEDA 3NGYA 2KW4A 4AILC 3QO9A 3ZT4A 1L3UA 4OLBA 3K2PA 3THVA 3VQQA 3PX4A 1TGOA 4W5TA 1TVRA 4CJSA 4E7IA 2IAJA 4FW1A 3A2FA 4K8XA 2FBVA 1WLJA 1NJXA 1RNHA 4FJ9A 1BI4B 4CK3A 3VQ6A 3SUNA 2IOCA 1MU2A 2YKNA 1VRTA 3ZSQA 4KRFA 3L2VA 3M8RA 3QEIA 1DLOA 3QNNA 3RMDA 1RBTA 1VSLA 4DFKA 2P51A 2FBXA 1EXQA 3OJUA 3NHGA 4F2SA 3AVJA 2OZMA 2WOMA 4O0IA 4CJ3A 4DTOA 3TAFA 3SUQA 1NK9A 4W5RA 1S9GA 3M8SA 4CEEA 1S1TA 3ZSZA 1UA1A 3NF9A 1NKEA 1HYVA 4FJJA 2X78A 3DYAA 3TARA 4YNQA 1YVUA 3VQ5A 1WSEA 3OS0A 4KV8A 1ZYQA 3MXJA 4AHTA 4Z4EA 2I5JA 1C0UA 1RBVA 4CGHA 3HPHA 1HJRA 3IS9A 4CGJA 1J5OA 4DSJA 3HYFA 3HSTB 4DTNA 4OKKA 1NK4A 1QS4A 3LAKA 1JLBA 4AHUA 3AO4A 1S6QA 4DU4A 4GVMA 2F8TA 4CGDA 4I7FA 2BGGA 4FYDA 4O4GA 3AO3A 3C94A 1S1XA 4L8RB 1KVCA 1CZBA 3KLHA 3U6FA 1NK8A 2HVHA 1JLCA 4Y1CA 5E41A 1CLQA 4OPJA 2JLEA 4RW9A 4F4KA 3AVMA 3SPYA 5JS1A 1RBUA 3KD5E 3QINA 3V9UA 3K59A 3D45A 1QTMA 1ZBHA 2VG7A 3ZCMA 3DLRA 4YFUA 1HNVA 3HPGA 4DQIA 2E4LA 4E7KA 1D8YA 2Z1IA 4FJXA 4KHNA 4OJRA 1RT4A 1Q9XA 4FJ5A 1JLQA 5KI6A 4DSEA 1IKWA 4FK4A 4B3OA 4CE9A 1TL3A 4KI6A 1HYSA 3V1RA 1NK0A 1X9WA 2HHUA 4Y1DA 1RTJA 4CHNA 1SKSA 3AA5X 3ZSWA 1U47A 1WAJA 5FDLA 1IKVA 1I39A 1D5AA 3OYJA 2PY5A 3CM5A 3VA3A 2YKMA 3OYMA 3DLBA 2D0AA 4MQ3A 3NH2A 3KK3A 2IC3A 1J53A 1LWFA 3QESA 3NH1A 3QEPA 3OYBA 4NCAA 1NJZA 4FLWA 1L3SA 1Z25A 3HP9A 4I2QA 4M45A 1L3TA 4CJUA 3AO5A 5J2QA 5J2MA 3DMJA 4EP5A 1IKYA 3LP0A 1ITGA 3SYZA 4DTSA 3OYLA 3RMCA 1ASVA 1FKPA 4OKEA 4ICLA 4CERA 2OPPA 4FK2A 4I2PA 3NGIA 4CJLA 3V1OA 3QIOA 1DTQA 4KHUA 2RF2A 2HHTA 5JS2A 4M41A 4GMJB 3VQBA 4BWMA 3TI0A 4KTZA 5CY4A 4KREA 3LP1A 2P5GA 2WONA 1UAXA 3AVIA 1ASWA 4LY7A 1IO2A 5KGWA 3VA0A 3E01A 3CFPA 4KHSA 3QEVA 4JS5A 1ZBIA 1VSEA 3TAGA 1TK8A 4RW6A 1B9FA 1KFDA 3LP3A 4M3RA 3AA4A 2Q3SA 4TSXA 5HROA 4DSKA 4CHOA 4HUFA 4IFYA 1WAFA 2KTQA 3T3FA 1RDDA 2BE2A 3PUFA 3HT3A 3TAPA 2Y1IA 3S3OA 1NJYA 4W5QA 1SL0A 1IG9A 3T19A 4CEDA 5SWMA 3O3HA 1DTTA 4CFBA 4DSIA 3UIQA 3S9HA 2PZSA 2G8IA 1XHZA 4FK0A 2IGIA 4CF9A 1YTUA 4KPYA 2ZD1A 1Q9YA 4LD0A 3DM2A 4BDPA 1LWCA 2KQ2A 4C8OA 1TAUA 3LWLA 1L3VA 4KB1A 3QEXA 2AJQA 4DFMA 3PY8A 2ATQA 3AVFA 1WNSA 5HRNA 1D9DA 4R5PA 3IAYA 1BGXT 3DOKA 4HCBA 4KTWA 1KCFA 4DF4A 1LV5A 1HMVA 4F3TA 4UQGA 1U4BA 1NK5A 3ZT1A 4RG8A 1J54A 3ZSYA 3AVKA 2ITGA 1QHTA 4M3ZA 1RDBA 4HVJA 3WNHA 1LAVA 1TKTA 1QE1A 3AO1A 4HTUA 4Z4FA 4G1QA 1Q8IA 4E7JA 4ID1A 2YHAA 4CECA 3QIPA 5I3UA 4BDYA 4PY5A 1CZ9A 3QEWA 2G8HA 1LAWA 3LP2A 2HHVA 3VQ9A 4DQSA 4E19A 4AH9A 1EETA 1FK9A 1N5YA 1N6QA 4DTMA 1KFSA 3LAMA 4J2EA 4ZTJA 4FM0A 3BDPA 2OYQA 5KRSA 4CIGA 4CIEA 3KLIA 1UOCA 4NYNA 4JS4A 4BE1A 4FM2A 2HHWA 5J2PA 4IFVA 3SQ4A 4DSLA 3OJSA 1BQMA 3OY9A 3PV8A 3I0RA 2RPIA 1NKCA 1KRPA 4HUEA 2HHQA 3D0PA 3SNNA 1XI1A 1XWLA 1TK0A 3KJVA 1QSSA 1TL1A 2A1SA 3KLFA 3LPTA 3RRHA 2Y1JA 4CEBA 2P5OA 4KHWA 3QLHA 3OYFA 3O3GA 3VQ8A 4C8KA 1C1AA 5T7BA 2DFFA 4W5OA 3O4NA 5I42A 3PO4A 2OPSA 4FZYA 3OYIA 2DFHA 3AVHA 3PX0A 3V9WA 3AVAA 2D5RA 2VWKA 1YT3A 4AHCA 4AHRA 4E3SA 3V4IA 4FJLA 1C0TA 3ZT3A 1WSJA 4B08A 3VQEA 4N5SA 3CG7A 5HLFA 4KTQA 1VSDA 3DLKA 3L2UA 3OS2A 3EYZA 3F73A 3H08A 4O55A 3NF6A 4E7HA 2HB5A 2E6MA 4PA1A 3C6TA 2QK9A 3HPOA 1X9SA 1Y97A 1ZBUA 1UA0A 5KRTA 1NK6A 1SKWA 4LH4A 4BE2A 4CF0A 4FCYA 3QETA 1NKBA 1RTIA 2XY6A 3LPUA 1WSIA 4IG0A 4FVMA 5FRMA 3NE6A 4FJ7A 1UWBA 4B9SA 5CZ1A 5KGXA 4E1MA 1KVBA 1WSFA 3AVLA 4KHQA 2DY4A 1BQNA 4JRQA 4CEAA 2XY7A 4B8AB 3SJJA 1LW2A 1G15A 1A5WA 4B9MA 2VWJA 1JLGA 3ZSRA 4FJKA 4O5BA 3OYGA 3K58A 4BE0A 4HCCA 3HJFA 2DFEA 3I8DA 4DU1A 3PX6A 3SI6A 1RDAA 3TABA 1KSPA 4ELVA 1VRUA 3I0SA 3CQ8A 3L2QA 2HNZA 3VQ4A 3KLGA 3VN5A 4KKOA 3ISNC 4CGIA 4B9LA 1TK5A 1BCMA 4CEQA 3ZT0A 3TAMA 4DQRA 2EHGA 4OGCA 1D9FA 1RT7A 1JLFA 3V9ZA 4CFCA 1BCOA 1S9EA 3AO2A 3DRRA 4CF8A 4LSNA 4DF8A 1RT2A 1VSKA 4IBNA 1GOAA 3VQAA 2LSNA 1SUQA 2KZMA 1FXXA 1RT3A 3SQ1A 4C8MA 2A1RA 2GUIA 3KKRA 4CJWA 4DTJA 4CHQA 4NCGA 2OPRA 2QKBA 2IS3A 5J2NA 1HYZA 3FFIA 3DLEA 4K8ZA 1RBRA 3NF7A 4ELUA 1BI4A 3K5LA 2O4GA 2XRIA 3TWHA 1BISA 3SV3A 1JL2A 1JKHA 1ZBFA 4EZ9A 4FJNA 1JLAA 1TKZA 3NH0A 4DLGA 1T7PA 3PO5A 1A5XA 3DRSA 4DQPA 4M42A 4E1NA 4DTRA 1J9AA 4CK1A 3KLEA 3RMAA 4RW7A 1RILA 4C8NA 3NGZA 1ZBLA 4DSFA 1JLEA 1EP4A 1BIZA 2B6AA 3RRGA 3MEEA 4ZHRA 2GV9A 1T8EA 3QNOA 3CFRA 3NBPA 1S1UA 1RDCA 3P83D 5HRRA 2FBTA 3NF8A 4H4MA 3VQCA 3C95A 4H8KA 4FLZA 4E0DA 1WN7A 3AVBA 2RKIA 5CYMA 4E89A 4LH5A 1C1CA 1R0AA 3KD1E 2HHSA 1KVAA 3KIOA 4F8RA 4J2BA 4N41A 3MECA 3RTVA 4IKFA 1RT6A 2HNYA 3V6DA 3EY1A 4CJEA 1ASUA 4O44A 4M3UA 1U04A 2X6NA 4KO0A 5C42A 3KK2A 1C1BA 3RWUA 1KLMA 1KTQA 4OLAA 2E6LA 3DI6A 3NFAA 4FLYA 1VK0A 2Z1GA 3DOLA 5KTQA 3ZSXA 4KI4A 3F9KA 1NJWA 3VQDA 4B8CA 3G0ZA 4Q0BA 3NAEA 3MXMA 3HO1A 1W9HA 3MAQA 1NOZA 5K14A 2PYLA 4B9TA 3ALYA 3SCXA 3HXMA 2KFZA 2O4IA 3EZ5A 3S3MA 3IG1A 4F3OA 1LW0A 2G8WA 3V1QA 4WE1A 2HHXA 2IDOA 4CEFA 2XY8A 3KK1A 1S1WA 1VSJA 5HBMA 3SUOA 2D0CA 1JXBA 1XHXA 2OPQA 4RW4A 3MXIA 4FW2A 1T03A 3DLHA 1XC9A 2ZQBA 3ITHA 4CJPA 4Q5VA 4M3WA 4O0JA 3V9XA 2BANA 1U48A 2EX3A 4BWJA 4CEOA 4EP4A 1GOCA 1RBSA 4FJ8A 3LZJA 4IG3A 1JXEA 2QKKA 1RCHA 4QCLA 4KFBA 5CYQA 4CHYA 4KHYA 4MFBA 4PQUA 1TV6A 1HRHA 2FBYA 4CJRA 4B9NA 5FRNA 4DG1A 4CEZA 1W0HA 1B9DA 4Z4CA 3OYCA 1BIUA 1YTAA 4ZTFA 3SV4A 4N47A 2R7YA 1CXQA 4CFAA 5C24A 1K6YA 4CHZA 1EKEA 1JL1A 4CHPA 4CIFA 4FJIA 3ZT2A 3ZSVA 3WNGA 2F8SA 2HVIA 4HHTA 1O1WA 2YNIA 3B6OA 3OVNA 4CGGA 3OYAA 3JYTA 4E7LA 2G8KA 4Z4IA 4Z4HA 4FJMA 4I9LA 2XHBA 4CCHA 2OZSA 4I9QA 3O3FA 4CESA 4FLXA 3HL8A 3K5OA 4FLVA 2YNGA 2YHBA 2PYJA 3M8PA 3CM6A 5CZ2A 3NDKA 5EU7A 4Z4GA 1LWEA 3L2WA 4CK2A 3LDSA 3HK2A 3AV9A 1SL1A 4Z0UA 1TKXA 2X6SA 4RW8A 5FROA 2YNHA 3AA2A 4OKJA 3AVNA 3DRPA 3VQ7A 4CF2A 4DTPA 2DTUA 1I3AA 2Z1HA 2G8FA 3OS1A 4PWDA 1SV5A 4FJHA 2D0BA 3WNEA 1NK7A 4IDKA 4JRPA 1TAQA 2F96A 3SUPA 3KTQA 4GW6A 4PUOA 3B6PA 5HRSA 3LANA 1Z26A 2P1JA 4DU3A 1TKDA 1FKOA 4CJQA 3ASMA 4HUGA 3U3YA 2ZE2A 4BACA 4FM1A 1IH7A 3MEGA 3TR8A 3AA3A 5J1EA 4NCBA 2XY5A 1QSLA 1VSFA 4H4OA 5DMRA 3VQPA 1CXUA 3CFOA 4ID5A 3AVCA 4FLUA 1BHLA 1VSHA 3HP6A 3C6UA 3WNFA 1S5JA 1T05A 2W42A 4OVLA 1REVA 4FXDA 2VG6A 3ULDA 3LALA 2X74A 1X9MA 1S1VA 3LWMA 4LSLA 3SQ0A 4DLEA 5HRPA 5DK5A 3OYHA 3SQ2A 1U45A 3OYKA 3QERA 2RN2A 1NOYA 4CFDA 4CGFA 2HW3A 4J2DA 3ZSOA 1EX4A 3K5MA 1KLNA 2HNDA 3IRXA 4J2AA 4FLTA 1X1PA 3RR7A 1RT5A 1L5UA 3V9SA 4W5NA 1WSGA 2G8UA 1S6PA 4KB0A 4OPKA 3O4QA 4DTUA 3HVRA 3RR8A 3L8BA 3HVTA 4EZ6A 4BDZA 1QSYA 2Z1JA 3DLGA 3U3GA 1RT1A 1C0MA 4N76A 1HPZA 4M3XA
chains in the Genus database with same CATH superfamily
4BRAA 4IOAL 2FC0A 3WEEB 3H1VX 5AQPA 2WBNA 2P9KB 4AHSA 4F2RA 2H3GX 4B9UA 2QWRA 4FZXC 3UKUB 4GKKK 4KAZA 3WXJA 3CETA 5D3GA 4CJ5A 3G10A 1QQCA 4DFJA 4C8LA 1FJGK 3O9QA 5AQUA 3K57A 2UXCK 3EL2A 4N56A 4JI3K 1VSIA 1HQUA 5KQDA 3WXMB 5HP1A 2B4JA 4MO5A 2NUBA 3OYDA 1A5VA 4AHVA 1LOTB 1SL2A 1NGAA 4CJKA 3HM9A 5H1SQ 1HNWK 1K8AO 4M3TA 1F21A 4A2BA 3P1GA 3OYNA 3RMBA 4BROA 1SKRA 2G8VA 4CJVA 2GBZA 2YV0X 3GL1A 3O5BA 4NO7A 3QO9A 3ZT4A 1L3UA 3A5NC 5F2RA 1TVRA 4E7IA 2A42A 4K8XA 2FBVA 2VGMA 4FJ9A 1NGDA 1YJ9N 1BI4B 3VQ6A 4EFHA 2VQEK 1VRTA 3HM8A 4FWRA 5BPNA 4KRFA 3DLLL 3I33A 4FOEA 1RBTA 2W40A 2FBXA 3CCQN 4F2SA 2E5LK 4W5RA 1NKEA 1XUPO 1UA1A 2X78A 3TARA 3OS0A 4BQLA 3BZKA 3IMXA 3MXJA 2UU9K 3HPHA 4HWIA 1HJRA 4DTNA 1NK4A 4DU4A 4AHUA 4CGDA 4I7FA 2IIRA 2QWMA 4K43A 4O4GA 3C94A 1S1XA 1NMNA 4OPJA 4DV6K 2E2QA 4YFUA 3HPGA 2E4LA 1JCFA 1RDUA 2A3ZA 4CE9A 1TL3A 3DAWA 1NK0A 1VQNN 1SKSA 4CZHA 2PY5A 2E20A 3VA3A 2YKMA 3OYMA 1OH5A 2YCHA 4ISFA 4MQ3A 3EN9A 3NH2A 3KK3A 1J53A 2O8DA 5JMVA 1NJZA 1ITGA 4OKEA 2OPPA 2P9LB 3VGLA 2YI1A 4FK2A 3V1OA 5JS2A 3ULEB 4GMJB 4FSVA 4KTZA 3WT0A 2P5GA 2EWSA 3AVIA 3SBGA 5KGWA 1IO2A 1RGIA 3E01A 4JS5A 1TK8A 3EO3A 4CBXA 5BN8A 3LP3A 4M3RA 4DSKA 4QS8A 3NVKA 4FL9A 1WAFA 4OO1J 3PUFA 2BE2A 3S3OA 3T19A 5SWMA 5AQIA 5MLCQ 4FK0A 2J4RA 1YTUA 2WUSA 4H5VA 4LF8K 4BDPA 4C8OA 1Y64A 3SK3A 2AJQA 1D4XA 1SS6A 2ATQA 3FZFA 2GTDA 1SQKA 5C2DA 5HRNA 4PL8A 4DB3A 3IAYA 2ZM6K 1XC3A 4DF4A 4F3TA 1U4BA 1NK5A 2O8CA 1J54A 2ITGA 3AVKA 4EHTA 4HVJA 1TKTA 1QE1A 3AO1A 5JLHA 4Z4FA 1Q8IA 1NGCA 2QW9A 4H0XB 2G8HA 4H0PA 4AM6A 2HHVA 3J7AP 4DQSA 4J2EA 3RSEA 3BDPA 4CIEA 4NYNA 5J2PA 4B3RK 4DSLA 4LF5K 3LDLA 3R9PA 3VENA 5EY4A 1TK0A 3KJVA 2A1SA 4DR3K 2Y1JA 3RRHA 1BA1A 5KQ8A 2ZGYA 3DXKA 4DV1K 4U7BA 1GLFO 3OYIA 5KPRA 2QTDA 3AVHA 4KH4A 4WCEL 4AHCA 3KWGA 3V4IA 4FJLA 1C0TA 1WSJA 4N5SA 5HLFA 4NXMK 3ZETA 1ILYA 2Q97A 1OKJA 5AQQA 1X9SA 1Y97A 2GELA 1UA0A 4LH4A 4CF0A 1J6ZA 3SLCA 4LC9B 5GAGP 1VQPN 3LPUA 1WSIA 4IG0A 5FRMA 1UWBA 1YIJN 4E1MA 1KVBA 4KHQA 3RVCA 1ATRA 2DY4A 1BQNA 4B8AB 1G15A 2HF3A 3CCRN 1JLGA 3OYGA 3I8DA 1U6ZA 3SI6A 3TABA 1Z6RA 4ELVA 3M1FA 4CGIA 4M63C 5ADXH 1BCMA 4CEQA 3ZT0A 4DQRA 5KPZA 4OGCA 4CZLA 3V9ZA 4CFCA 3AO2A 5M1QA 4LSNA 4CZIA 1RT2A 3VQAA 1WUAA 2KZMA 3FR0A 1FXXA 1RT3A 3SQ1A 2A6AA 4CJWA 4DTJA 2HBKA 4XEIA 3FFIA 1RBRA 1BISA 4HTLA 1JL2A 4FJNA 3A5OC 3Q7BA 4JD2A 1OH6A 4DQPA 3KLEA 1ZBLA 5BPLA 5JICA 3KHYA 4DV0K 4RTFD 5AZIB 3MEEA 4EHUA 3CFRA 1S1UA 1RDCA 2NNWA 4JI1K 4FLZA 3VQCA 3AVBA 4E89A 1KAYA 3ID8A 3K0SA 3PLAA 4IEEA 3EY1A 4V19S 5AQHA 1M90O 4M3UA 3KK2A 3U8XA 2E2OA 3RWUA 4H5NA 1GLDG 1KTQA 2E6LA 3DI6A 3NFAA 4KI4A 1NNEA 4B9QA 3LM9A 3OHRA 1NJWA 3VQDA 4A57A 2PYLA 4JKGB 5K14A 3SCXA 3EZ5A 4F3OA 1FW6A 2G8WA 3ENOA 2YHWA 2XY8A 3KK1A 3SUOA 2ZWHA 4RW4A 3EKUA 3DLHA 2QWQA 4IOCL 4B3MK 3V9XA 3VERA 1RBSA 2UXDK 3TTDA 1JXEA 2QKKA 1RCHA 2E2PA 4BGAA 4KFBA 1M1KO 4PQUA 2VWBA 1HRHA 2GEMA 4CJRA 5FRNA 1ESVA 2F9WA 4Z4CA 2OTLN 4ZTFA 3D2FB 4N47A 3VF2A 3IFRA 4CFAA 5C24A 1EKEA 1OVQA 3A8YA 3WNGA 2PAVA 3CI5A 2YNIA 4CGGA 3OVNA 3VEOA 2G8KA 2V51B 4Z4HA 2XHBA 2D0OA 2OZSA 3CM6A 4Z4GA 4CK2A 1HPMA 4FWPA 4Z0UA 3LL3A 3AVNA 3DRPA 1BDGA 2Z1HA 3AY9A 4PWDA 3ATUA 1SV5A 1NK7A 2W41A 4IDKA 4JRPA 1TAQA 3SUPA 1GLLO 5AQLA 4DU3A 4CJQA 3ASMA 2JWLA 3VQPA 3D6RA 1CXUA 4ID5A 1ZBSA 5ADXA 3HP6A 4DCHA 3C6UA 1S5JA 5CE3A 4JK9A 4OVLA 5LMUK 4NXNK 3LALA 2X74A 4BR0A 3UE5A 3HZ6A 5JLFA 3QERA 2RN2A 1NBWA 4CFDA 2HW3A 4LF7K 1KLNA 2HNDA 5AZJB 2Q31A 3O1WA 2OCEA 4O8UA 4H0TB 4DTUA 4XH4A 4EZ6A 2Z1JA 1KC8O 4U67L 5AQWA 5GIOA 1S3XA 3NCIA 3CPWM 4YOVA 4DS4A 4CJ4A 2YNFA 3V81A 4M7YA 3K5NA 1WBBA 4CJFA 2JGUA 3F9MA 3C7NA 3SJHA 3U9ZA 3AVGA 3MN9A 4FJGA 2HHHK 1NGIA 4DMNA 4DS5A 3BGRA 4DR5K 2HBJA 5FPEA 2FXUA 4I6MA 4K42A 2P9NB 3SZ2A 3TAEA 4M3YA 1VSMA 1IV0A 1IKXA 3G4SN 3CHWA 5C25A 5SZTA 2PBDA 4AILC 1V4SA 1X9JA 4R79A 4XH1A 2QWLA 4EAHD 1TGOA 3N4QA 4CJSA 2IAJA 4FW1A 1W2BM 1WLJA 1RNHA 3SUNA 3ZSQA 3THXB 3IDHA 3QEIA 4BRGA 3OJUA 3NHGA 2CGLA 1XQSC 3TAFA 3O08A 2Q36A 1NK9A 3IKMA 1S1TA 3NF9A 2V52B 4YNQA 4BRDA 4L3QA 3P4IA 1WSEA 3CXCM 1ZYQA 3C7NB 2I5JA 1QVFM 4BRHA 4CGHA 4CD3A 4CGJA 3HYFA 3HSTB 1JLBA 2F8TA 1S6QA 1IBKK 2ASMA 3KLHA 1X3MA 5LL6Z 4I6MB 3CJ9A 4GKJK 4ILJA 3D2EB 5JS1A 1RBUA 3V9UA 3B8AX 3T1HK 2VG7A 3DLRA 1HNVA 4FWKA 4E7KA 1D8YA 4FJXA 2Z1IA 4KHNA 5GIPA 1Q9XA 1JLQA 5GAHP 3V1RA 1RTJA 4OPAA 4CHNA 3AA5X 1U47A 4H03B 1WAJA 5BN9A 1I39A 4FWNA 1R59O 2VQFK 3OYBA 4NCAA 3O80A 4FLWA 4I2QA 4M45A 2BH1A 1KAZA 2OTJN 5DM6L 4EP5A 3LP0A 3SYZA 3UB5A 3CMEN 4H0YB 3OYLA 1ASVA 4ICLA 5BR9A 4CJLA 4AF1A 3GG4A 1DTQA 3VQBA 3C6HA 3TI0A 1KQSM 2UUBK 2F7TA 5CY4A 4KREA 3WQTA 1UAXA 4LY7A 4FVUA 3WXIA 1C0GA 1ZBIA 1VSEA 1VQ7N 4RW6A 1B9FA 3AA4A 3E9LA 4TSXA 2NRRA 1RDDA 1IG9A 3TAPA 4W5QA 1NU0A 1DTTA 4BC4A 3WUHA 1O13A 1XHZA 4DV4K 4KPYA 4IXCA 4YOYA 1NGBA 4LD0A 2KQ2A 5M1OA 4KB1A 4DFMA 3HOTA 3TU5A 3G71N 3R6MA 5TKYA 1BGXT 3DOKA 1SAZA 2F9TA 4KTWA 4RG8A 3ZSYA 3T69A 1EO1A 1JJ2M 2CGKA 3HI0A 3KVGA 4G1QA 2VGNA 4E7JA 2YHAA 4CECA 3QIPA 3W0LA 3LP2A 2VYPA 3VQ9A 4AH9A 1FK9A 3QFPA 1N5YA 3LAMA 1QZ5A 4FM0A 5KRSA 4BE1A 1UOCA 3N4PA 2RPIA 4DV7K 2IVPA 3D0PA 1XI1A 1VHXA 3FZHA 3KLFA 3QLHA 1X3NA 3VQ8A 1C1AA 2DFFA 2OPSA 2DFHA 3V9WA 1NGHA 3AVAA 3H1QA 3CD6N 3AGKA 2D5RA 2VWKA 5AR0A 4B08A 3I8BA 4BRKA 3VQEA 3DLKA 3L2UA 3EYZA 2E6MA 3HPOA 1ZBUA 2DPNA 4BE2A 3BF1A 4GV6A 4BC5A 1NKBA 2XY6A 3SAGA 3PSFA 1OH8A 4JKDA 4CZMA 5CZ1A 2KKZA 5KGXA 1N34K 1HNZK 4CEAA 1QHAA 4B9MA 4DR4K 4BE0A 4HCCA 3MX2A 2FSNA 3L2QA 1BG3A 4KKOA 1TK5A 3H46O 4LF4K 4JAXA 3TAMA 2BUPA 1S9EA 2P9UA 4CF8A 3W3DA 4JNEA 4PHTX 2Q0UA 3C0BA 1GOAA 1YAGA 4BC3A 2LSNA 4DF8A 2GUIA 3KKRA 2O8EA 4NCGA 3FE1A 2QKBA 2IS3A 1BA0A 3GOIA 4QS7A 2ZGZA 2O4GA 3TWHA 3SV3A 1S72N 1JLAA 1T7PA 1A5XA 1K73O 1RILA 2KHOA 3NGZA 4DSFA 2B6AA 3L4IA 3RRGA 1NJIO 4BVPA 4ZHRA 2GV9A 1RDWX 4GNIA 1P90A 3NF8A 4H8KA 1WN7A 5AQKA 4O8KA 1Z05A 4LH5A 1C1CA 5CYMA 1R0AA 4BQZA 1KVAA 3AGRA 4F8RA 4J2BA 3RTVA 4DQ8A 2E1ZA 3V6DA 3VGMA 4CZGA 4KBOA 4CJEA 1LCUA 4O44A 2X6NA 4KO0A 5C42A 3E9OA 2O8DB 1ATSA 1KLMA 1EWRA 4FLYA 3I55N 3F9KA 2P9IA 3G0ZA 1W9HA 3ALYA 2KFZA 3HXMA 3VOVA 3SAFA 5AFUH 1IBLK 4WE1A 5ELZA 1N33K 3MN6A 1S1WA 5HBMA 2D0CA 3SMSA 1XC9A 3Q7CA 1YJNN 3H45C 2BANA 3FGUA 4BWJA 4EP4A 1GOCA 3A5MC 3QMLA 1NMDA 4QCLA 5CYQA 4KHYA 1GLBG 4CEZA 1YTAA 3SV4A 2R7YA 1CXQA 3EE8A 1KXPA 3ZX2A 1K6YA 1JL1A 3ZT2A 4MO4A 3ZSVA 2HVIA 5BPMA 4HHTA 3B6OA 2GWKA 2A5XA 3ZX3A 4FJMA 1CZAN 3ZEUA 2ASOA 2PYJA 2YHBA 4JK7A 3M8PA 3L2WA 4OPHA 3LDSA 3H3OB 2O8CB 1SL1A 5AJ3K 2X6SA 2YNHA 4OKJA 3DJCA 4WQ4A 5M1FA 4FJHA 2D0BA 3VEWA 2YHYA 1QQMA 3KTQA 4GW6A 4FPAA 3F2KA 4FWOA 3RSEB 3U3YA 4B1XB 4BACA 3CF5L 3J81O 5J1EA 1QSLA 4QS9A 3CFOA 4FLUA 1VSHA 3WNFA 1REVA 4FXDA 4B1WB 2VG6A 1S1VA 3DXKB 4LSLA 3AAQA 1HKGA 5DK5A 3OYHA 1U45A 1NOYA 4JKAA 2HF4A 2QWPA 5CHIA 3J80O 4J2AA 4FLTA 1X1PA 3FFKB 3V9SA 4DHYA 1H1VA 2G8UA 2FSJA 3ZETB 1GLEG 3HVRA 3VGKA 1IG8A 3RR8A 4BDZA 1QSYA 1ZC6A 3DLGA 3TSUA 1RT1A 3OA9A 4WFNL 2BDPA 3VEZA 3CCMN 3OYEA 1W97L 5TKWA 4C1NI 3BZCA 4YOUA 2UYTA 1XMOK 4JLHA 2HMIA 3M3ZA 4BG9A 4B9VA 1GOBA 4CF1A 2FF6A 3SPZA 2QXFA 3SMPA 3L2RA 1Q7YO 2XO7A 2E1YA 2O8FA 4DTXA 3H6EA 1BL3A 2P9SA 3M8QA 2Q0RA 4MDBA 1KD1O 5AQJA 4QOZB 4H0VB 2Q1NA 3EEQA 5E84A 3L3VA 1WSHA 5HOOA 1S22A 3TAQA 2KZZA 2VG5A 4QAGA 4DR2K 2BTFA 4DQQA 1RTDA 4ELTA 4OGEA 4DKWA 3NGYA 4CD1A 5AFUA 3EE9A 2NRVA 3A2FA 2CGJA 3MN7A 5FLXO 4GY2B 1QZ6A 2IOCA 1MWMA 1MU2A 3F5TA 4ISEA 3M8RA 3BY5A 4JD2B 4IZ9A 3QNNA 3RMDA 1HKBA 3LDNA 2P51A 1EXQA 4M7XA 2HMPA 3AVJA 2WOMA 4YOXA 4DV2K 4WQ4C 4WQ5A 4BRNA 1S9GA 3O9RA 3M8SA 4FJJA 2D0PA 4BRCA 4BR2A 4BGBA 2V7YA 4KV8A 1YUWA 4JYAK 3TPQA 3IS9A 4O5FA 1J5OA 4DSJA 4OKKA 3LAKA 2JWKA 4FYDA 3R1XA 4GVMA 4NLCA 2BGGA 2P9SB 3DWLA 1BUPA 1KVCA 1CZBA 3U6FA 1NK8A 2HVHA 3E66A 1JLCA 1HKCA 3LDPA 4Y0WA 3TSQA 5E41A 2JLEA 4RW9A 3AVMA 3SPYA 3D45A 1QTMA 3R8EA 1ZBHA 3ZCMA 3KK7A 1BU6O 4OJRA 2NRHA 5KI6A 3CCVN 1IKWA 4DUZK 4DSEA 4B3OA 3T7ZA 1HYSA 2HHUA 4JI5K 3ZSWA 3CM5A 4C1NK 5BREA 2IC3A 1LWFA 2NLXA 1L3SA 2GUPA 3HP9A 4IDHA 4CJUA 4B3SK 3DMJA 1XNRK 1IKYA 3E9PA 3RMCA 4C23A 5LJWA 3NGIA 3P38A 3QIOA 2A41A 4KHUA 2HHTA 2AA4A 4JKFA 4M41A 1BO5O 3O9TA 3CJBA 5F0XA 2O8BA 2HOEA 1ASWA 3VA0A 4KH6A 3CFPA 2Q2RA 3QEVA 4KHSA 4B1UB 4PKHA 2F4VK 1KFDA 5HROA 2D1KA 1RFQA 4CHOA 1QQNA 2KTQA 3T3FA 3HT3A 1SL0A 5LY3A 1NJYA 2Y1IA 5AQXA 5I9EB 4CEDA 2NRZA 1XMQK 4BRFA 4BY9C 4CFBA 3S9HA 2IGIA 4CF9A 2ZD1A 3P39A 1Q9YA 3DM2A 3CC2N 1TAUA 4WYBA 1L3VA 3MDQA 4IOXA 1WNSA 3AVFA 1D9DA 5DM7L 3DXMA 5A2QO 3HRGA 1I94K 1QHTA 2YX6A 1RDBA 1LAVA 3P31A 4HTUA 4JEPA 1CZ9A 3QEWA 4CVNE 3VETA 1GLCG 1KFSA 4BG8A 4LFBK 4CZKA 3MCAB 4IFEA 4FM2A 3OJSA 1GLJO 3GDQA 1BQMA 3OY9A 3PV8A 3I0RA 3QICA 3SBTA 4HUEA 1XWLA 1NM1A 1TL1A 3CQYA 3LPTA 3ENBA 4CEBA 3OYFA 5AQYA 3O3GA 1N36K 5T7BA 3J7YP 3O4NA 5I42A 1T44A 3PX0A 3WXLA 1NGEA 4AHRA 4E3SA 3CCSN 4LFAK 1U2VA 1N32K 3CMAN 4KTQA 3CG7A 1HX1A 4JI4K 1VSDA 3VF6A 3F73A 4O55A 3NF6A 4JI6K 1K8KA 4PL7A 4KH5A 3CCLN 4H5RA 3C6TA 4PA1A 3UKRA 4X62K 1VQKN 5KRTA 1NK6A 4FWSA 3WEEA 4MLEA 4FCYA 2P9KA 1RTIA 2P9PA 1MDUB 3UKUA 1WB9A 1T3VA 4FJ7A 2QA4N 1WSFA 3AVLA 4H5TA 4JRQA 2XY7A 1LW2A 4DV5K 2VWJA 3ZSRA 2QXLA 4O5BA 4FWMA 2DFEA 5M1PA 3HOSA 4JN4A 4DU1A 4PKGA 4J8FA 3OBYA 1KSPA 1VRUA 3I0SA 3L0QA 3CQ8A 1OVYA 3ISNC 5AQNA 4UY8O 2A40A 1HJOA 5FPNA 1JCEA 1D9FA 2WFBA 1BCOA 4IBNA 1SUQA 2A1RA 4C8MA 5JVHL 2QWOA 1Q82O 1HYZA 3DLEA 4K8ZA 4ELUA 2E2NA 1BI4A 3K5LA 2XRIA 4CW7B 5AQRA 3NH0A 4NLBA 4BR4A 2QWNA 3PO5A 1Q81O 4M42A 4DTRA 4DUYK 1J9AA 4AM7A 4C8NA 3UKRB 4JKBA 1BIZA 1EP4A 1JLEA 4BRIA 1NG9A 1T8EA 3QNOA 5AQZA 2ZJPL 1K9MO 2P9PB 5HRRA 2ASPA 4H4MA 4ILHA 2RKIA 3VEVA 4CZFA 1G99A 3KD1E 2HHSA 3CIPA 3KIOA 2HNYA 5E26A 4OLAA 2HBLA 3IUCA 1VK0A 5KTQA 3ZSXA 3OW2M 1C0FA 3ZX0A 4B8CA 4Q0BA 4JKCA 3NAEA 4FOIA 3MXMA 3HO1A 1NOZA 3S3MA 5AQMA 1LW0A 3C6AA 2IDOA 4CEFA 3O4WA 4IWVA 1VSJA 3LDOA 4A61A 1VQLN 1XHXA 2OPQA 1T03A 5C0YA 3HTVA 4FW2A 3L6QA 2WTUA 2ZQBA 4Q5VA 4M3WA 4JI2K 4NB4A 3LZJA 3THWA 4IG3A 5GADP 4B1ZA 3E1YA 1NLVA 4A59A 3VEXA 2FBYA 1NGJA 4B9NA 4DG1A 1W0HA 3OYCA 2P9LA 4JI8K 4CHZA 3ULEA 4CHPA 4FJIA 1P8ZA 3J7ZO 4E7LA 3OYAA 2KLAA 2HBMA 4WFAL 3FZKA 4Z4IA 1YXQA 1TUUA 3O3FA 3HL8A 3K5OA 2YNGA 3CJ1A 3NDKA 3AV9A 3O6WA 3A5LC 4GV9A 4FPBA 3VQ7A 3WXKA 1I3AA 2FLOA 2G8FA 3OS1A 3BUZB 5BRDA 1E4GT 5C15A 5M1KA 4PUOA 3B6PA 5HRSA 1Z26A 4YOTA 2P1JA 5BR8K 1T6CA 1TKDA 2RHKA 2ZE2A 3MEGA 3AA3A 4BRMA 3CC4N 4WF9L 3AAPA 1VSFA 4H4OA 3LM2A 3AVCA 1BHLA 4PKIA 5IT9O 4K41A 4FWQA 2ZJQL 1QQOA 4WFBL 3SQ0A 1YITN 4DLEA 3PSIA 3THWB 4J2DA 1EX4A 1NGGA 3RR7A 4W5NA 1WSGA 4KB0A 4GV3A 3O4QA 3U3GA 3QB0A 1HPZA 4M3XA 1B92A 4YOWA 3CYMA 4DV3K 4BRQA 1ATNA 3BF3A 4XIUA 1KAXA 1RTHA 1VQ8N 1DGKN 3JXUA 4X65K 4DFPA 3KKSA 2HSTA 4JKHA 1U49A 4H5WA 5AQOA 3LZIA 3TANA 4FZZA 2ETJA 2NRTA 2ITMA 4YORA 1DKGD 4DWIA 3L3UA 3O9SA 2OA8A 1HNIA 3LDQA 4JK8A 3O9UA 3O8MA 3P5JA 4CJTA 5KPTA 4NYFA 5AQSA 3S3NA 2NRWA 5FPDA 1HQEA 1C6VA 1VAZA 5HL7L 3JSMA 4A5AA 3T1AA 2KFNA 2B5JA 3GBTA 5LJVA 3MEDA 3JAMO 2P9UB 2KW4A 1SZ2A 1HUXA 3QBXA 5C10A 3FZMA 3CERA 4MLHA 4OLBA 3K2PA 3THVA 3VQQA 5JVGL 3PX4A 2O8EB 4W5TA 4A5BA 1N8RO 1NJXA 2YJEA 4CK3A 2YKNA 4RWTA 3L2VA 1DLOA 3AARA 1VSLA 3FZLA 4DFKA 4BVOA 2OZMA 4BREA 4CJ3A 4O0IA 4DTOA 3SUQA 3OBWA 4CEEA 3ZSZA 4XH5A 4GVEA 1HYVA 3CCEN 3DYAA 1YVUA 3VQ5A 3VESA 2W6LA 3VTHA 1JCGA 4AHTA 1E4FT 4Z4EA 1C0UA 1RBVA 5CR4A 1EWQA 1QS4A 2NRXA 3K9JA 3AO4A 3AO3A 1NWKA 1E3MA 4Y1CA 5IWAK 3THYA 2P9IB 1CLQA 4F4KA 5AZIA 2AP1A 3KD5E 3QINA 3K59A 2UXBK 3T1YK 4JHDA 1EQYA 1OH7A 4DQIA 5AQGA 2YHXA 1RT4A 4FJ5A 4CZJA 4FK4A 4KI6A 5B8HA 1X9WA 4Y1DA 5F1XA 3CQXA 5FDLA 1IKVA 3OYJA 1D5AA 3DLBA 2UUAK 2D0AA 3QESA 3NH1A 3CJ7A 3J8AA 3QEPA 1L3TA 1Z25A 1VQON 3AO5A 3KZBA 4YHHK 5J2MA 3HBTA 5J2QA 4YDUA 4DTSA 4JKGA 1FKPA 4CERA 4I2PA 3HSCA 3D7EO 1DT9A 1Q86O 2RF2A 4ILGB 4BWMA 3EZWA 3LP1A 4X66K 3L4QA 2WONA 4OX9K 3JS6A 1HR0K 3ZEUB 4FWLA 3ZLJA 2I7NA 3TAGA 3M6GA 1QVGM 2GWJA 2Q3SA 3CCJN 4HUFA 4IFYA 1J5EK 3FLCO 3QBWA 1T6DA 2W6KA 3O3HA 3CCUN 4DSIA 3UIQA 3D2FA 3CPEA 3THYB 2PZSA 2G8IA 2V7ZA 3S41A 3TTFA 4X64K 1LWCA 4BRPA 1MA9B 3ATVA 4JHDB 3LWLA 5EX5A 3QEXA 5BRFA 3PY8A 5GINA 4R5PA 1VQ4N 4HCBA 1KCFA 1LV5A 1HMVA 1WOQA 4UQGA 3ZT1A 3EKSA 4IJAA 4M3ZA 2IVOA 3WNHA 2E88A 1DEJA 4YY3K 4ID1A 5C12A 5I3UA 1HLUA 4BDYA 4PY5A 1LAWA 1VQ5N 4FJKA 4E19A 4L8RB 1EETA 1W7AA 1N6QA 4DTMA 4ZTJA 2OYQA 4CIGA 2HHWA 3KLIA 5AQTA 4JS4A 4IFVA 4CZEA 3SQ4A 3MX5A 3MK6A 3VEYA 3ZYYX 1NKCA 1KRPA 2D4WA 2HHQA 3C65A 3SNNA 1TYQA 1QSSA 1MWKA 2P5OA 4KHWA 4IEIA 3A0IX 4C8KA 4RCHA 4W5OA 5C2FA 3CJCA 3PO4A 4FZYA 4JI0K 5AZJA 4JI7K 3CJAA 3TSPA 1YT3A 1HNXK 2O8FB 3ZT3A 3MCPA 4BC2A 1BWFO 4E7HA 3OS2A 3H08A 4EIAA 2HB5A 5EXWA 4IO8A 1YF5L 2QK9A 2OANA 1SKWA 4B1YB 1TUYA 3QETA 4IO9L 1VQMN 2GX9A 4FVMA 4YDUC 3NE6A 4B9SA 4K0KK 4CBUA 1WBDA 3SJJA 1GLAG 4A62A 1A5WA 3MWPA 3HJFA 2E8AA 3K58A 1BOTO 3PX6A 4JV5K 1RDAA 3SAHA 2P9NA 4DR1K 2HNZA 3G25A 3VQ4A 4CBWA 3O1BA 3KLGA 3VN5A 4B9LA 5BRHA 3M5RA 3ID6A 3I56N 2EHGA 4LF6K 2UUCK 1VQ9N 1RT7A 1JLFA 3DRRA 1TYQB 1VSKA 2CH6A 4B3TK 3OTOK 2NZTA 4BRLA 4CHQA 3NMUA 2OPRA 5J2NA 3TTCA 3NF7A 1ZBFA 1JKHA 4EZ9A 4DR6K 1TKZA 3THXA 3BP8A 4FO0A 4DLGA 4G9ZA 3DRSA 4E1NA 2QEXN 3VF4A 4CK1A 3RMAA 4RW7A 3VMFB 5FPMA 4ISGA 3PIOL 3NBPA 3WQUA 3P83D 5GAEP 2FBTA 1YHQN 3C95A 4E0DA 3U4LA 4DR7K 1YI2N 2ZJRL 4N41A 4BR5A 3MECA 4IKFA 1RT6A 3G6EN 1IJJA 3VPZA 3MWTA 1ASUA 1U04A 4WQ5C 3H3NO 4AQYK 1C1BA 3QDKA 4JKEA 3PIPL 2Z1GA 3DOLA 1ZXOA 1XNQK 2PFUA 3D2EA 4CJ7A 3K9KA 3MAQA 4B9TA 2O4IA 3ENHA 3IG1A 3V1QA 2HHXA 3MN5A 2O8BB 1JXBA 3MXIA 2IVNA 3ITHA 4CJPA 2RE2A 3CC7N 4O0JA 1U48A 2CH5A 2EX3A 5EVZA 4CEOA 3GE1A 4FJ8A 3R3LA 4CHYA 4MFBA 1TV6A 1V4TA 4MDAA 3U9DA 4LF9K 1B9DA 1BIUA 3QFUA 4CIFA 3KWIA 2F8SA 5AQVA 1O1WA 4LFCK 3JYTA 5EOYA 2FSKA 4I9LA 4CCHA 4I9QA 4A2AA 4CESA 4FLXA 4FLVA 4KHPK 5CZ2A 3DXMB 5EU7A 1LWEA 2YJFA 3MMVA 3HK2A 4F9OA 5LMNK 1TKXA 4BR9A 4RW8A 5FROA 1Q18A 3AA2A 2DTUA 4Z94A 4DTPA 4CF2A 2VCPA 5M1NA 1NGFA 4E1JA 3WNEA 3NVMA 4IJNA 2F96A 3LANA 1YJWN 1FKOA 4HUGA 4FM1A 1IH7A 2FF3B 3TR8A 4NCBA 2XY5A 2QI2A 2WC9A 5DMRA 1IBMK 3VTIA 4CI6A 1T05A 2W42A 3ULDA 5AQFA 1X9MA 3LWMA 1VQ6N 5HRPA 3BEXA 3SQ2A 1YVNA 3OYKA 4CGFA 3ZSOA 2ZF5O 3K5MA 2I7PA 3IRXA 1RT5A 4K25A 1L5UA 1U2VB 4H0OA 1S6PA 4OPKA 4B1VA 3L8BA 2QM1A 3HVTA 4BR7A 1K8KB 1C0MA 4N76A
chains in the Genus database with same CATH topology
1B92A 3NCIA 2FC0A 2BDPA 3CYMA 4DS4A 4CJ4A 4AHSA 3OYEA 4F2RA 4B9UA 4XIUA 2YNFA 1RTHA 4FZXC 3V81A 3K5NA 4KAZA 4CJFA 2JGUA 5D3GA 4DFPA 4JLHA 4CJ5A 3KKSA 1U49A 3G10A 1QQCA 2HMIA 4DFJA 4B9VA 1GOBA 3AVGA 4CF1A 4C8LA 4FJGA 3K57A 3LZIA 3TANA 4FZZA 2ETJA 2QXFA 3L2RA 3SPZA 2XO7A 4DMNA 4DS5A 4DTXA 4DWIA 4N56A 3L3UA 1VSIA 1HQUA 2OA8A 1BL3A 1HNIA 3M8QA 3BGRA 2B4JA 5HP1A 2NUBA 3P5JA 4QOZB 3OYDA 4CJTA 1A5VA 4AHVA 1SL2A 4NYFA 3S3NA 3SZ2A 4CJKA 3L3VA 3HM9A 3TAEA 1HQEA 1WSHA 4M3YA 1C6VA 4M3TA 1F21A 1VSMA 3TAQA 1IKXA 2VG5A 3P1GA 4QAGA 2KZZA 3OYNA 3JSMA 3RMBA 1SKRA 2G8VA 5C25A 3T1AA 4CJVA 5SZTA 4DQQA 2KFNA 1RTDA 2GBZA 2YV0X 2B5JA 4OGEA 4ELTA 3MEDA 3NGYA 2KW4A 4AILC 3QO9A 3ZT4A 1L3UA 4OLBA 3K2PA 3THVA 3VQQA 3PX4A 1TGOA 4W5TA 1TVRA 4CJSA 4E7IA 2IAJA 4FW1A 3A2FA 4K8XA 2FBVA 1WLJA 1NJXA 1RNHA 4FJ9A 1BI4B 4CK3A 3VQ6A 3SUNA 2IOCA 1MU2A 2YKNA 1VRTA 3ZSQA 4KRFA 3L2VA 3M8RA 3QEIA 1DLOA 3QNNA 3RMDA 1RBTA 1VSLA 4DFKA 2P51A 2FBXA 1EXQA 3OJUA 3NHGA 4F2SA 3AVJA 2OZMA 2WOMA 4O0IA 4CJ3A 4DTOA 3TAFA 3SUQA 1NK9A 4W5RA 1S9GA 3M8SA 4CEEA 1S1TA 3ZSZA 1UA1A 3NF9A 1NKEA 1HYVA 4FJJA 2X78A 3DYAA 3TARA 4YNQA 1YVUA 3VQ5A 1WSEA 3OS0A 4KV8A 1ZYQA 3MXJA 4AHTA 4Z4EA 2I5JA 1C0UA 1RBVA 4CGHA 3HPHA 1HJRA 3IS9A 4CGJA 1J5OA 4DSJA 3HYFA 3HSTB 4DTNA 4OKKA 1NK4A 1QS4A 3LAKA 1JLBA 4AHUA 3AO4A 1S6QA 4DU4A 4GVMA 2F8TA 4CGDA 4I7FA 2BGGA 4FYDA 4O4GA 3AO3A 3C94A 1S1XA 4L8RB 1KVCA 1CZBA 3KLHA 3U6FA 1NK8A 2HVHA 1JLCA 4Y1CA 5E41A 1CLQA 4OPJA 2JLEA 4RW9A 4F4KA 3AVMA 3SPYA 5JS1A 1RBUA 3KD5E 3QINA 3V9UA 3K59A 3D45A 1QTMA 1ZBHA 2VG7A 3ZCMA 3DLRA 4YFUA 1HNVA 3HPGA 4DQIA 2E4LA 4E7KA 1D8YA 2Z1IA 4FJXA 4KHNA 4OJRA 1RT4A 1Q9XA 4FJ5A 1JLQA 5KI6A 4DSEA 1IKWA 4FK4A 4B3OA 4CE9A 1TL3A 4KI6A 1HYSA 3V1RA 1NK0A 1X9WA 2HHUA 4Y1DA 1RTJA 4CHNA 1SKSA 3AA5X 3ZSWA 1U47A 1WAJA 5FDLA 1IKVA 1I39A 1D5AA 3OYJA 2PY5A 3CM5A 3VA3A 2YKMA 3OYMA 3DLBA 2D0AA 4MQ3A 3NH2A 3KK3A 2IC3A 1J53A 1LWFA 3QESA 3NH1A 3QEPA 3OYBA 4NCAA 1NJZA 4FLWA 1L3SA 1Z25A 3HP9A 4I2QA 4M45A 1L3TA 4CJUA 3AO5A 5J2QA 5J2MA 3DMJA 4EP5A 1IKYA 3LP0A 1ITGA 3SYZA 4DTSA 3OYLA 3RMCA 1ASVA 1FKPA 4OKEA 4ICLA 4CERA 2OPPA 4FK2A 4I2PA 3NGIA 4CJLA 3V1OA 3QIOA 1DTQA 4KHUA 2RF2A 2HHTA 5JS2A 4M41A 4GMJB 3VQBA 4BWMA 3TI0A 4KTZA 5CY4A 4KREA 3LP1A 2P5GA 2WONA 1UAXA 3AVIA 1ASWA 4LY7A 1IO2A 5KGWA 3VA0A 3E01A 3CFPA 4KHSA 3QEVA 4JS5A 1ZBIA 1VSEA 3TAGA 1TK8A 4RW6A 1B9FA 1KFDA 3LP3A 4M3RA 3AA4A 2Q3SA 4TSXA 5HROA 4DSKA 4CHOA 4HUFA 4IFYA 1WAFA 2KTQA 3T3FA 1RDDA 2BE2A 3PUFA 3HT3A 3TAPA 2Y1IA 3S3OA 1NJYA 4W5QA 1SL0A 1IG9A 3T19A 4CEDA 5SWMA 3O3HA 1DTTA 4CFBA 4DSIA 3UIQA 3S9HA 2PZSA 2G8IA 1XHZA 4FK0A 2IGIA 4CF9A 1YTUA 4KPYA 2ZD1A 1Q9YA 4LD0A 3DM2A 4BDPA 1LWCA 2KQ2A 4C8OA 1TAUA 3LWLA 1L3VA 4KB1A 3QEXA 2AJQA 4DFMA 3PY8A 2ATQA 3AVFA 1WNSA 5HRNA 1D9DA 4R5PA 3IAYA 1BGXT 3DOKA 4HCBA 4KTWA 1KCFA 4DF4A 1LV5A 1HMVA 4F3TA 4UQGA 1U4BA 1NK5A 3ZT1A 4RG8A 1J54A 3ZSYA 3AVKA 2ITGA 1QHTA 4M3ZA 1RDBA 4HVJA 3WNHA 1LAVA 1TKTA 1QE1A 3AO1A 4HTUA 4Z4FA 4G1QA 1Q8IA 4E7JA 4ID1A 2YHAA 4CECA 3QIPA 5I3UA 4BDYA 4PY5A 1CZ9A 3QEWA 2G8HA 1LAWA 3LP2A 2HHVA 3VQ9A 4DQSA 4E19A 4AH9A 1EETA 1FK9A 1N5YA 1N6QA 4DTMA 1KFSA 3LAMA 4J2EA 4ZTJA 4FM0A 3BDPA 2OYQA 5KRSA 4CIGA 4CIEA 3KLIA 1UOCA 4NYNA 4JS4A 4BE1A 4FM2A 2HHWA 5J2PA 4IFVA 3SQ4A 4DSLA 3OJSA 1BQMA 3OY9A 3PV8A 3I0RA 2RPIA 1NKCA 1KRPA 4HUEA 2HHQA 3D0PA 3SNNA 1XI1A 1XWLA 1TK0A 3KJVA 1QSSA 1TL1A 2A1SA 3KLFA 3LPTA 3RRHA 2Y1JA 4CEBA 2P5OA 4KHWA 3QLHA 3OYFA 3O3GA 3VQ8A 4C8KA 1C1AA 5T7BA 2DFFA 4W5OA 3O4NA 5I42A 3PO4A 2OPSA 4FZYA 3OYIA 2DFHA 3AVHA 3PX0A 3V9WA 3AVAA 2D5RA 2VWKA 1YT3A 4AHCA 4AHRA 4E3SA 3V4IA 4FJLA 1C0TA 3ZT3A 1WSJA 4B08A 3VQEA 4N5SA 3CG7A 5HLFA 4KTQA 1VSDA 3DLKA 3L2UA 3OS2A 3EYZA 3F73A 3H08A 4O55A 3NF6A 4E7HA 2HB5A 2E6MA 4PA1A 3C6TA 2QK9A 3HPOA 1X9SA 1Y97A 1ZBUA 1UA0A 5KRTA 1NK6A 1SKWA 4LH4A 4BE2A 4CF0A 4FCYA 3QETA 1NKBA 1RTIA 2XY6A 3LPUA 1WSIA 4IG0A 4FVMA 5FRMA 3NE6A 4FJ7A 1UWBA 4B9SA 5CZ1A 5KGXA 4E1MA 1KVBA 1WSFA 3AVLA 4KHQA 2DY4A 1BQNA 4JRQA 4CEAA 2XY7A 4B8AB 3SJJA 1LW2A 1G15A 1A5WA 4B9MA 2VWJA 1JLGA 3ZSRA 4FJKA 4O5BA 3OYGA 3K58A 4BE0A 4HCCA 3HJFA 2DFEA 3I8DA 4DU1A 3PX6A 3SI6A 1RDAA 3TABA 1KSPA 4ELVA 1VRUA 3I0SA 3CQ8A 3L2QA 2HNZA 3VQ4A 3KLGA 3VN5A 4KKOA 3ISNC 4CGIA 4B9LA 1TK5A 1BCMA 4CEQA 3ZT0A 3TAMA 4DQRA 2EHGA 4OGCA 1D9FA 1RT7A 1JLFA 3V9ZA 4CFCA 1BCOA 1S9EA 3AO2A 3DRRA 4CF8A 4LSNA 4DF8A 1RT2A 1VSKA 4IBNA 1GOAA 3VQAA 2LSNA 1SUQA 2KZMA 1FXXA 1RT3A 3SQ1A 4C8MA 2A1RA 2GUIA 3KKRA 4CJWA 4DTJA 4CHQA 4NCGA 2OPRA 2QKBA 2IS3A 5J2NA 1HYZA 3FFIA 3DLEA 4K8ZA 1RBRA 3NF7A 4ELUA 1BI4A 3K5LA 2O4GA 2XRIA 3TWHA 1BISA 3SV3A 1JL2A 1JKHA 1ZBFA 4EZ9A 4FJNA 1JLAA 1TKZA 3NH0A 4DLGA 1T7PA 3PO5A 1A5XA 3DRSA 4DQPA 4M42A 4E1NA 4DTRA 1J9AA 4CK1A 3KLEA 3RMAA 4RW7A 1RILA 4C8NA 3NGZA 1ZBLA 4DSFA 1JLEA 1EP4A 1BIZA 2B6AA 3RRGA 3MEEA 4ZHRA 2GV9A 1T8EA 3QNOA 3CFRA 3NBPA 1S1UA 1RDCA 3P83D 5HRRA 2FBTA 3NF8A 4H4MA 3VQCA 3C95A 4H8KA 4FLZA 4E0DA 1WN7A 3AVBA 2RKIA 5CYMA 4E89A 4LH5A 1C1CA 1R0AA 3KD1E 2HHSA 1KVAA 3KIOA 4F8RA 4J2BA 4N41A 3MECA 3RTVA 4IKFA 1RT6A 2HNYA 3V6DA 3EY1A 4CJEA 1ASUA 4O44A 4M3UA 1U04A 2X6NA 4KO0A 5C42A 3KK2A 1C1BA 3RWUA 1KLMA 1KTQA 4OLAA 2E6LA 3DI6A 3NFAA 4FLYA 1VK0A 2Z1GA 3DOLA 5KTQA 3ZSXA 4KI4A 3F9KA 1NJWA 3VQDA 4B8CA 3G0ZA 4Q0BA 3NAEA 3MXMA 3HO1A 1W9HA 3MAQA 1NOZA 5K14A 2PYLA 4B9TA 3ALYA 3SCXA 3HXMA 2KFZA 2O4IA 3EZ5A 3S3MA 3IG1A 4F3OA 1LW0A 2G8WA 3V1QA 4WE1A 2HHXA 2IDOA 4CEFA 2XY8A 3KK1A 1S1WA 1VSJA 5HBMA 3SUOA 2D0CA 1JXBA 1XHXA 2OPQA 4RW4A 3MXIA 4FW2A 1T03A 3DLHA 1XC9A 2ZQBA 3ITHA 4CJPA 4Q5VA 4M3WA 4O0JA 3V9XA 2BANA 1U48A 2EX3A 4BWJA 4CEOA 4EP4A 1GOCA 1RBSA 4FJ8A 3LZJA 4IG3A 1JXEA 2QKKA 1RCHA 4QCLA 4KFBA 5CYQA 4CHYA 4KHYA 4MFBA 4PQUA 1TV6A 1HRHA 2FBYA 4CJRA 4B9NA 5FRNA 4DG1A 4CEZA 1W0HA 1B9DA 4Z4CA 3OYCA 1BIUA 1YTAA 4ZTFA 3SV4A 4N47A 2R7YA 1CXQA 4CFAA 5C24A 1K6YA 4CHZA 1EKEA 1JL1A 4CHPA 4CIFA 4FJIA 3ZT2A 3ZSVA 3WNGA 2F8SA 2HVIA 4HHTA 1O1WA 2YNIA 3B6OA 3OVNA 4CGGA 3OYAA 3JYTA 4E7LA 2G8KA 4Z4IA 4Z4HA 4FJMA 4I9LA 2XHBA 4CCHA 2OZSA 4I9QA 3O3FA 4CESA 4FLXA 3HL8A 3K5OA 4FLVA 2YNGA 2YHBA 2PYJA 3M8PA 3CM6A 5CZ2A 3NDKA 5EU7A 4Z4GA 1LWEA 3L2WA 4CK2A 3LDSA 3HK2A 3AV9A 1SL1A 4Z0UA 1TKXA 2X6SA 4RW8A 5FROA 2YNHA 3AA2A 4OKJA 3AVNA 3DRPA 3VQ7A 4CF2A 4DTPA 2DTUA 1I3AA 2Z1HA 2G8FA 3OS1A 4PWDA 1SV5A 4FJHA 2D0BA 3WNEA 1NK7A 4IDKA 4JRPA 1TAQA 2F96A 3SUPA 3KTQA 4GW6A 4PUOA 3B6PA 5HRSA 3LANA 1Z26A 2P1JA 4DU3A 1TKDA 1FKOA 4CJQA 3ASMA 4HUGA 3U3YA 2ZE2A 4BACA 4FM1A 1IH7A 3MEGA 3TR8A 3AA3A 5J1EA 4NCBA 2XY5A 1QSLA 1VSFA 4H4OA 5DMRA 3VQPA 1CXUA 3CFOA 4ID5A 3AVCA 4FLUA 1BHLA 1VSHA 3HP6A 3C6UA 3WNFA 1S5JA 1T05A 2W42A 4OVLA 1REVA 4FXDA 2VG6A 3ULDA 3LALA 2X74A 1X9MA 1S1VA 3LWMA 4LSLA 3SQ0A 4DLEA 5HRPA 5DK5A 3OYHA 3SQ2A 1U45A 3OYKA 3QERA 2RN2A 1NOYA 4CFDA 4CGFA 2HW3A 4J2DA 3ZSOA 1EX4A 3K5MA 1KLNA 2HNDA 3IRXA 4J2AA 4FLTA 1X1PA 3RR7A 1RT5A 1L5UA 3V9SA 4W5NA 1WSGA 2G8UA 1S6PA 4KB0A 4OPKA 3O4QA 4DTUA 3HVRA 3RR8A 3L8BA 3HVTA 4EZ6A 4BDZA 1QSYA 2Z1JA 3DLGA 3U3GA 1RT1A 1C0MA 4N76A 1HPZA 4M3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B92 A;  3NCI A;  2FC0 A;  2BDP A;  3CYM A;  4DS4 A;  4CJ4 A;  4AHS A;  3OYE A;  4F2R A;  4B9U A;  4XIU A;  2YNF A;  1RTH A;  4FZX C;  3V81 A;  3K5N A;  4KAZ A;  4CJF A;  2JGU A;  5D3G A;  4DFP A;  4JLH A;  4CJ5 A;  3KKS A;  1U49 A;  3G10 A;  1QQC A;  2HMI A;  4DFJ A;  4B9V A;  1GOB A;  3AVG A;  4CF1 A;  4C8L A;  4FJG A;  3K57 A;  3LZI A;  3TAN A;  4FZZ A;  2ETJ A;  2QXF A;  3L2R A;  3SPZ A;  2XO7 A;  4DMN A;  4DS5 A;  4DTX A;  4DWI A;  4N56 A;  3L3U A;  1VSI A;  1HQU A;  2OA8 A;  1BL3 A;  1HNI A;  3M8Q A;  3BGR A;  2B4J A;  5HP1 A;  2NUB A;  3P5J A;  4QOZ B;  3OYD A;  4CJT A;  1A5V A;  4AHV A;  1SL2 A;  4NYF A;  3S3N A;  3SZ2 A;  4CJK A;  3L3V A;  3HM9 A;  3TAE A;  1HQE A;  1WSH A;  4M3Y A;  1C6V A;  4M3T A;  1F21 A;  1VSM A;  3TAQ A;  1IKX A;  2VG5 A;  3P1G A;  4QAG A;  2KZZ A;  3OYN A;  3JSM A;  3RMB A;  1SKR A;  2G8V A;  5C25 A;  3T1A A;  4CJV A;  5SZT A;  4DQQ A;  2KFN A;  1RTD A;  2GBZ A;  2YV0 X;  2B5J A;  4OGE A;  4ELT A;  3MED A;  3NGY A;  2KW4 A;  4AIL C;  3QO9 A;  3ZT4 A;  1L3U A;  4OLB A;  3K2P A;  3THV A;  3VQQ A;  3PX4 A;  1TGO A;  4W5T A;  1TVR A;  4CJS A;  4E7I A;  2IAJ A;  4FW1 A;  3A2F A;  4K8X A;  2FBV A;  1WLJ A;  1NJX A;  1RNH A;  4FJ9 A;  1BI4 B;  4CK3 A;  3VQ6 A;  3SUN A;  2IOC A;  1MU2 A;  2YKN A;  1VRT A;  3ZSQ A;  4KRF A;  3L2V A;  3M8R A;  3QEI A;  1DLO A;  3QNN A;  3RMD A;  1RBT A;  1VSL A;  4DFK A;  2P51 A;  2FBX A;  1EXQ A;  3OJU A;  3NHG A;  4F2S A;  3AVJ A;  2OZM A;  2WOM A;  4O0I A;  4CJ3 A;  4DTO A;  3TAF A;  3SUQ A;  1NK9 A;  4W5R A;  1S9G A;  3M8S A;  4CEE A;  1S1T A;  3ZSZ A;  1UA1 A;  3NF9 A;  1NKE A;  1HYV A;  4FJJ A;  2X78 A;  3DYA A;  3TAR A;  4YNQ A;  1YVU A;  3VQ5 A;  1WSE A;  3OS0 A;  4KV8 A;  1ZYQ A;  3MXJ A;  4AHT A;  4Z4E A;  2I5J A;  1C0U A;  1RBV A;  4CGH A;  3HPH A;  1HJR A;  3IS9 A;  4CGJ A;  1J5O A;  4DSJ A;  3HYF A;  3HST B;  4DTN A;  4OKK A;  1NK4 A;  1QS4 A;  3LAK A;  1JLB A;  4AHU A;  3AO4 A;  1S6Q A;  4DU4 A;  4GVM A;  2F8T A;  4CGD A;  4I7F A;  2BGG A;  4FYD A;  4O4G A;  3AO3 A;  3C94 A;  1S1X A;  4L8R B;  1KVC A;  1CZB A;  3KLH A;  3U6F A;  1NK8 A;  2HVH A;  1JLC A;  4Y1C A;  5E41 A;  1CLQ A;  4OPJ A;  2JLE A;  4RW9 A;  4F4K A;  3AVM A;  3SPY A;  5JS1 A;  1RBU A;  3KD5 E;  3QIN A;  3V9U A;  3K59 A;  3D45 A;  1QTM A;  1ZBH A;  2VG7 A;  3ZCM A;  3DLR A;  4YFU A;  1HNV A;  3HPG A;  4DQI A;  2E4L A;  4E7K A;  1D8Y A;  2Z1I A;  4FJX A;  4KHN A;  4OJR A;  1RT4 A;  1Q9X A;  4FJ5 A;  1JLQ A;  5KI6 A;  4DSE A;  1IKW A;  4FK4 A;  4B3O A;  4CE9 A;  1TL3 A;  4KI6 A;  1HYS A;  3V1R A;  1NK0 A;  1X9W A;  2HHU A;  4Y1D A;  1RTJ A;  4CHN A;  1SKS A;  3AA5 X;  3ZSW A;  1U47 A;  1WAJ A;  5FDL A;  1IKV A;  1I39 A;  1D5A A;  3OYJ A;  2PY5 A;  3CM5 A;  3VA3 A;  2YKM A;  3OYM A;  3DLB A;  2D0A A;  4MQ3 A;  3NH2 A;  3KK3 A;  2IC3 A;  1J53 A;  1LWF A;  3QES A;  3NH1 A;  3QEP A;  3OYB A;  4NCA A;  1NJZ A;  4FLW A;  1L3S A;  1Z25 A;  3HP9 A;  4I2Q A;  4M45 A;  1L3T A;  4CJU A;  3AO5 A;  5J2Q A;  5J2M A;  3DMJ A;  4EP5 A;  1IKY A;  3LP0 A;  1ITG A;  3SYZ A;  4DTS A;  3OYL A;  3RMC A;  1ASV A;  1FKP A;  4OKE A;  4ICL A;  4CER A;  2OPP A;  4FK2 A;  4I2P A;  3NGI A;  4CJL A;  3V1O A;  3QIO A;  1DTQ A;  4KHU A;  2RF2 A;  2HHT A;  5JS2 A;  4M41 A;  4GMJ B;  3VQB A;  4BWM A;  3TI0 A;  4KTZ A;  5CY4 A;  4KRE A;  3LP1 A;  2P5G A;  2WON A;  1UAX A;  3AVI A;  1ASW A;  4LY7 A;  1IO2 A;  5KGW A;  3VA0 A;  3E01 A;  3CFP A;  4KHS A;  3QEV A;  4JS5 A;  1ZBI A;  1VSE A;  3TAG A;  1TK8 A;  4RW6 A;  1B9F A;  1KFD A;  3LP3 A;  4M3R A;  3AA4 A;  2Q3S A;  4TSX A;  5HRO A;  4DSK A;  4CHO A;  4HUF A;  4IFY A;  1WAF A;  2KTQ A;  3T3F A;  1RDD A;  2BE2 A;  3PUF A;  3HT3 A;  3TAP A;  2Y1I A;  3S3O A;  1NJY A;  4W5Q A;  1SL0 A;  1IG9 A;  3T19 A;  4CED A;  5SWM A;  3O3H A;  1DTT A;  4CFB A;  4DSI A;  3UIQ A;  3S9H A;  2PZS A;  2G8I A;  1XHZ A;  4FK0 A;  2IGI A;  4CF9 A;  1YTU A;  4KPY A;  2ZD1 A;  1Q9Y A;  4LD0 A;  3DM2 A;  4BDP A;  1LWC A;  2KQ2 A;  4C8O A;  1TAU A;  3LWL A;  1L3V A;  4KB1 A;  3QEX A;  2AJQ A;  4DFM A;  3PY8 A;  2ATQ A;  3AVF A;  1WNS A;  5HRN A;  1D9D A;  4R5P A;  3IAY A;  1BGX T;  3DOK A;  4HCB A;  4KTW A;  1KCF A;  4DF4 A;  1LV5 A;  1HMV A;  4F3T A;  4UQG A;  1U4B A;  1NK5 A;  3ZT1 A;  4RG8 A;  1J54 A;  3ZSY A;  3AVK A;  2ITG A;  1QHT A;  4M3Z A;  1RDB A;  4HVJ A;  3WNH A;  1LAV A;  1TKT A;  1QE1 A;  3AO1 A;  4HTU A;  4Z4F A;  4G1Q A;  1Q8I A;  4E7J A;  4ID1 A;  2YHA A;  4CEC A;  3QIP A;  5I3U A;  4BDY A;  4PY5 A;  1CZ9 A;  3QEW A;  2G8H A;  1LAW A;  3LP2 A;  2HHV A;  3VQ9 A;  4DQS A;  4E19 A;  4AH9 A;  1EET A;  1FK9 A;  1N5Y A;  1N6Q A;  4DTM A;  1KFS A;  3LAM A;  4J2E A;  4ZTJ A;  4FM0 A;  3BDP A;  2OYQ A;  5KRS A;  4CIG A;  4CIE A;  3KLI A;  1UOC A;  4NYN A;  4JS4 A;  4BE1 A;  4FM2 A;  2HHW A;  5J2P A;  4IFV A;  3SQ4 A;  4DSL A;  3OJS A;  1BQM A;  3OY9 A;  3PV8 A;  3I0R A;  2RPI A;  1NKC A;  1KRP A;  4HUE A;  2HHQ A;  3D0P A;  3SNN A;  1XI1 A;  1XWL A;  1TK0 A;  3KJV A;  1QSS A;  1TL1 A;  2A1S A;  3KLF A;  3LPT A;  3RRH A;  2Y1J A;  4CEB A;  2P5O A;  4KHW A;  3QLH A;  3OYF A;  3O3G A;  3VQ8 A;  4C8K A;  1C1A A;  5T7B A;  2DFF A;  4W5O A;  3O4N A;  5I42 A;  3PO4 A;  2OPS A;  4FZY A;  3OYI A;  2DFH A;  3AVH A;  3PX0 A;  3V9W A;  3AVA A;  2D5R A;  2VWK A;  1YT3 A;  4AHC A;  4AHR A;  4E3S A;  3V4I A;  4FJL A;  1C0T A;  3ZT3 A;  1WSJ A;  4B08 A;  3VQE A;  4N5S A;  3CG7 A;  5HLF A;  4KTQ A;  1VSD A;  3DLK A;  3L2U A;  3OS2 A;  3EYZ A;  3F73 A;  3H08 A;  4O55 A;  3NF6 A;  4E7H A;  2HB5 A;  2E6M A;  4PA1 A;  3C6T A;  2QK9 A;  3HPO A;  1X9S A;  1Y97 A;  1ZBU A;  1UA0 A;  5KRT A;  1NK6 A;  1SKW A;  4LH4 A;  4BE2 A;  4CF0 A;  4FCY A;  3QET A;  1NKB A;  1RTI A;  2XY6 A;  3LPU A;  1WSI A;  4IG0 A;  4FVM A;  5FRM A;  3NE6 A;  4FJ7 A;  1UWB A;  4B9S A;  5CZ1 A;  5KGX A;  4E1M A;  1KVB A;  1WSF A;  3AVL A;  4KHQ A;  2DY4 A;  1BQN A;  4JRQ A;  4CEA A;  2XY7 A;  4B8A B;  3SJJ A;  1LW2 A;  1G15 A;  1A5W A;  4B9M A;  2VWJ A;  1JLG A;  3ZSR A;  4FJK A;  4O5B A;  3OYG A;  3K58 A;  4BE0 A;  4HCC A;  3HJF A;  2DFE A;  3I8D A;  4DU1 A;  3PX6 A;  3SI6 A;  1RDA A;  3TAB A;  1KSP A;  4ELV A;  1VRU A;  3I0S A;  3CQ8 A;  3L2Q A;  2HNZ A;  3VQ4 A;  3KLG A;  3VN5 A;  4KKO A;  3ISN C;  4CGI A;  4B9L A;  1TK5 A;  1BCM A;  4CEQ A;  3ZT0 A;  3TAM A;  4DQR A;  2EHG A;  4OGC A;  1D9F A;  1RT7 A;  1JLF A;  3V9Z A;  4CFC A;  1BCO A;  1S9E A;  3AO2 A;  3DRR A;  4CF8 A;  4LSN A;  4DF8 A;  1RT2 A;  1VSK A;  4IBN A;  1GOA A;  3VQA A;  2LSN A;  1SUQ A;  2KZM A;  1FXX A;  1RT3 A;  3SQ1 A;  4C8M A;  2A1R A;  2GUI A;  3KKR A;  4CJW A;  4DTJ A;  4CHQ A;  4NCG A;  2OPR A;  2QKB A;  2IS3 A;  5J2N A;  1HYZ A;  3FFI A;  3DLE A;  4K8Z A;  1RBR A;  3NF7 A;  4ELU A;  1BI4 A;  3K5L A;  2O4G A;  2XRI A;  3TWH A;  1BIS A;  3SV3 A;  1JL2 A;  1JKH A;  1ZBF A;  4EZ9 A;  4FJN A;  1JLA A;  1TKZ A;  3NH0 A;  4DLG A;  1T7P A;  3PO5 A;  1A5X A;  3DRS A;  4DQP A;  4M42 A;  4E1N A;  4DTR A;  1J9A A;  4CK1 A;  3KLE A;  3RMA A;  4RW7 A;  1RIL A;  4C8N A;  3NGZ A;  1ZBL A;  4DSF A;  1JLE A;  1EP4 A;  1BIZ A;  2B6A A;  3RRG A;  3MEE A;  4ZHR A;  2GV9 A;  1T8E A;  3QNO A;  3CFR A;  3NBP A;  1S1U A;  1RDC A;  3P83 D;  5HRR A;  2FBT A;  3NF8 A;  4H4M A;  3VQC A;  3C95 A;  4H8K A;  4FLZ A;  4E0D A;  1WN7 A;  3AVB A;  2RKI A;  5CYM A;  4E89 A;  4LH5 A;  1C1C A;  1R0A A;  3KD1 E;  2HHS A;  1KVA A;  3KIO A;  4F8R A;  4J2B A;  4N41 A;  3MEC A;  3RTV A;  4IKF A;  1RT6 A;  2HNY A;  3V6D A;  3EY1 A;  4CJE A;  1ASU A;  4O44 A;  4M3U A;  1U04 A;  2X6N A;  4KO0 A;  5C42 A;  3KK2 A;  1C1B A;  3RWU A;  1KLM A;  1KTQ A;  4OLA A;  2E6L A;  3DI6 A;  3NFA A;  4FLY A;  1VK0 A;  2Z1G A;  3DOL A;  5KTQ A;  3ZSX A;  4KI4 A;  3F9K A;  1NJW A;  3VQD A;  4B8C A;  3G0Z A;  4Q0B A;  3NAE A;  3MXM A;  3HO1 A;  1W9H A;  3MAQ A;  1NOZ A;  5K14 A;  2PYL A;  4B9T A;  3ALY A;  3SCX A;  3HXM A;  2KFZ A;  2O4I A;  3EZ5 A;  3S3M A;  3IG1 A;  4F3O A;  1LW0 A;  2G8W A;  3V1Q A;  4WE1 A;  2HHX A;  2IDO A;  4CEF A;  2XY8 A;  3KK1 A;  1S1W A;  1VSJ A;  5HBM A;  3SUO A;  2D0C A;  1JXB A;  1XHX A;  2OPQ A;  4RW4 A;  3MXI A;  4FW2 A;  1T03 A;  3DLH A;  1XC9 A;  2ZQB A;  3ITH A;  4CJP A;  4Q5V A;  4M3W A;  4O0J A;  3V9X A;  2BAN A;  1U48 A;  2EX3 A;  4BWJ A;  4CEO A;  4EP4 A;  1GOC A;  1RBS A;  4FJ8 A;  3LZJ A;  4IG3 A;  1JXE A;  2QKK A;  1RCH A;  4QCL A;  4KFB A;  5CYQ A;  4CHY A;  4KHY A;  4MFB A;  4PQU A;  1TV6 A;  1HRH A;  2FBY A;  4CJR A;  4B9N A;  5FRN A;  4DG1 A;  4CEZ A;  1W0H A;  1B9D A;  4Z4C A;  3OYC A;  1BIU A;  1YTA A;  4ZTF A;  3SV4 A;  4N47 A;  2R7Y A;  1CXQ A;  4CFA A;  5C24 A;  1K6Y A;  4CHZ A;  1EKE A;  1JL1 A;  4CHP A;  4CIF A;  4FJI A;  3ZT2 A;  3ZSV A;  3WNG A;  2F8S A;  2HVI A;  4HHT A;  1O1W A;  2YNI A;  3B6O A;  3OVN A;  4CGG A;  3OYA A;  3JYT A;  4E7L A;  2G8K A;  4Z4I A;  4Z4H A;  4FJM A;  4I9L A;  2XHB A;  4CCH A;  2OZS A;  4I9Q A;  3O3F A;  4CES A;  4FLX A;  3HL8 A;  3K5O A;  4FLV A;  2YNG A;  2YHB A;  2PYJ A;  3M8P A;  3CM6 A;  5CZ2 A;  3NDK A;  5EU7 A;  4Z4G A;  1LWE A;  3L2W A;  4CK2 A;  3LDS A;  3HK2 A;  3AV9 A;  1SL1 A;  4Z0U A;  1TKX A;  2X6S A;  4RW8 A;  5FRO A;  2YNH A;  3AA2 A;  4OKJ A;  3AVN A;  3DRP A;  3VQ7 A;  4CF2 A;  4DTP A;  2DTU A;  1I3A A;  2Z1H A;  2G8F A;  3OS1 A;  4PWD A;  1SV5 A;  4FJH A;  2D0B A;  3WNE A;  1NK7 A;  4IDK A;  4JRP A;  1TAQ A;  2F96 A;  3SUP A;  3KTQ A;  4GW6 A;  4PUO A;  3B6P A;  5HRS A;  3LAN A;  1Z26 A;  2P1J A;  4DU3 A;  1TKD A;  1FKO A;  4CJQ A;  3ASM A;  4HUG A;  3U3Y A;  2ZE2 A;  4BAC A;  4FM1 A;  1IH7 A;  3MEG A;  3TR8 A;  3AA3 A;  5J1E A;  4NCB A;  2XY5 A;  1QSL A;  1VSF A;  4H4O A;  5DMR A;  3VQP A;  1CXU A;  3CFO A;  4ID5 A;  3AVC A;  4FLU A;  1BHL A;  1VSH A;  3HP6 A;  3C6U A;  3WNF A;  1S5J A;  1T05 A;  2W42 A;  4OVL A;  1REV A;  4FXD A;  2VG6 A;  3ULD A;  3LAL A;  2X74 A;  1X9M A;  1S1V A;  3LWM A;  4LSL A;  3SQ0 A;  4DLE A;  5HRP A;  5DK5 A;  3OYH A;  3SQ2 A;  1U45 A;  3OYK A;  3QER A;  2RN2 A;  1NOY A;  4CFD A;  4CGF A;  2HW3 A;  4J2D A;  3ZSO A;  1EX4 A;  3K5M A;  1KLN A;  2HND A;  3IRX A;  4J2A A;  4FLT A;  1X1P A;  3RR7 A;  1RT5 A;  1L5U A;  3V9S A;  4W5N A;  1WSG A;  2G8U A;  1S6P A;  4KB0 A;  4OPK A;  3O4Q A;  4DTU A;  3HVR A;  3RR8 A;  3L8B A;  3HVT A;  4EZ6 A;  4BDZ A;  1QSY A;  2Z1J A;  3DLG A;  3U3G A;  1RT1 A;  1C0M A;  4N76 A;  1HPZ A;  4M3X A; 
#chains in the Genus database with same CATH topology
 4BRA A;  4IOA L;  2FC0 A;  3WEE B;  3H1V X;  5AQP A;  2WBN A;  2P9K B;  4AHS A;  4F2R A;  2H3G X;  4B9U A;  2QWR A;  4FZX C;  3UKU B;  4GKK K;  4KAZ A;  3WXJ A;  3CET A;  5D3G A;  4CJ5 A;  3G10 A;  1QQC A;  4DFJ A;  4C8L A;  1FJG K;  3O9Q A;  5AQU A;  3K57 A;  2UXC K;  3EL2 A;  4N56 A;  4JI3 K;  1VSI A;  1HQU A;  5KQD A;  3WXM B;  5HP1 A;  2B4J A;  4MO5 A;  2NUB A;  3OYD A;  1A5V A;  4AHV A;  1LOT B;  1SL2 A;  1NGA A;  4CJK A;  3HM9 A;  5H1S Q;  1HNW K;  1K8A O;  4M3T A;  1F21 A;  4A2B A;  3P1G A;  3OYN A;  3RMB A;  4BRO A;  1SKR A;  2G8V A;  4CJV A;  2GBZ A;  2YV0 X;  3GL1 A;  3O5B A;  4NO7 A;  3QO9 A;  3ZT4 A;  1L3U A;  3A5N C;  5F2R A;  1TVR A;  4E7I A;  2A42 A;  4K8X A;  2FBV A;  2VGM A;  4FJ9 A;  1NGD A;  1YJ9 N;  1BI4 B;  3VQ6 A;  4EFH A;  2VQE K;  1VRT A;  3HM8 A;  4FWR A;  5BPN A;  4KRF A;  3DLL L;  3I33 A;  4FOE A;  1RBT A;  2W40 A;  2FBX A;  3CCQ N;  4F2S A;  2E5L K;  4W5R A;  1NKE A;  1XUP O;  1UA1 A;  2X78 A;  3TAR A;  3OS0 A;  4BQL A;  3BZK A;  3IMX A;  3MXJ A;  2UU9 K;  3HPH A;  4HWI A;  1HJR A;  4DTN A;  1NK4 A;  4DU4 A;  4AHU A;  4CGD A;  4I7F A;  2IIR A;  2QWM A;  4K43 A;  4O4G A;  3C94 A;  1S1X A;  1NMN A;  4OPJ A;  4DV6 K;  2E2Q A;  4YFU A;  3HPG A;  2E4L A;  1JCF A;  1RDU A;  2A3Z A;  4CE9 A;  1TL3 A;  3DAW A;  1NK0 A;  1VQN N;  1SKS A;  4CZH A;  2PY5 A;  2E20 A;  3VA3 A;  2YKM A;  3OYM A;  1OH5 A;  2YCH A;  4ISF A;  4MQ3 A;  3EN9 A;  3NH2 A;  3KK3 A;  1J53 A;  2O8D A;  5JMV A;  1NJZ A;  1ITG A;  4OKE A;  2OPP A;  2P9L B;  3VGL A;  2YI1 A;  4FK2 A;  3V1O A;  5JS2 A;  3ULE B;  4GMJ B;  4FSV A;  4KTZ A;  3WT0 A;  2P5G A;  2EWS A;  3AVI A;  3SBG A;  5KGW A;  1IO2 A;  1RGI A;  3E01 A;  4JS5 A;  1TK8 A;  3EO3 A;  4CBX A;  5BN8 A;  3LP3 A;  4M3R A;  4DSK A;  4QS8 A;  3NVK A;  4FL9 A;  1WAF A;  4OO1 J;  3PUF A;  2BE2 A;  3S3O A;  3T19 A;  5SWM A;  5AQI A;  5MLC Q;  4FK0 A;  2J4R A;  1YTU A;  2WUS A;  4H5V A;  4LF8 K;  4BDP A;  4C8O A;  1Y64 A;  3SK3 A;  2AJQ A;  1D4X A;  1SS6 A;  2ATQ A;  3FZF A;  2GTD A;  1SQK A;  5C2D A;  5HRN A;  4PL8 A;  4DB3 A;  3IAY A;  2ZM6 K;  1XC3 A;  4DF4 A;  4F3T A;  1U4B A;  1NK5 A;  2O8C A;  1J54 A;  2ITG A;  3AVK A;  4EHT A;  4HVJ A;  1TKT A;  1QE1 A;  3AO1 A;  5JLH A;  4Z4F A;  1Q8I A;  1NGC A;  2QW9 A;  4H0X B;  2G8H A;  4H0P A;  4AM6 A;  2HHV A;  3J7A P;  4DQS A;  4J2E A;  3RSE A;  3BDP A;  4CIE A;  4NYN A;  5J2P A;  4B3R K;  4DSL A;  4LF5 K;  3LDL A;  3R9P A;  3VEN A;  5EY4 A;  1TK0 A;  3KJV A;  2A1S A;  4DR3 K;  2Y1J A;  3RRH A;  1BA1 A;  5KQ8 A;  2ZGY A;  3DXK A;  4DV1 K;  4U7B A;  1GLF O;  3OYI A;  5KPR A;  2QTD A;  3AVH A;  4KH4 A;  4WCE L;  4AHC A;  3KWG A;  3V4I A;  4FJL A;  1C0T A;  1WSJ A;  4N5S A;  5HLF A;  4NXM K;  3ZET A;  1ILY A;  2Q97 A;  1OKJ A;  5AQQ A;  1X9S A;  1Y97 A;  2GEL A;  1UA0 A;  4LH4 A;  4CF0 A;  1J6Z A;  3SLC A;  4LC9 B;  5GAG P;  1VQP N;  3LPU A;  1WSI A;  4IG0 A;  5FRM A;  1UWB A;  1YIJ N;  4E1M A;  1KVB A;  4KHQ A;  3RVC A;  1ATR A;  2DY4 A;  1BQN A;  4B8A B;  1G15 A;  2HF3 A;  3CCR N;  1JLG A;  3OYG A;  3I8D A;  1U6Z A;  3SI6 A;  3TAB A;  1Z6R A;  4ELV A;  3M1F A;  4CGI A;  4M63 C;  5ADX H;  1BCM A;  4CEQ A;  3ZT0 A;  4DQR A;  5KPZ A;  4OGC A;  4CZL A;  3V9Z A;  4CFC A;  3AO2 A;  5M1Q A;  4LSN A;  4CZI A;  1RT2 A;  3VQA A;  1WUA A;  2KZM A;  3FR0 A;  1FXX A;  1RT3 A;  3SQ1 A;  2A6A A;  4CJW A;  4DTJ A;  2HBK A;  4XEI A;  3FFI A;  1RBR A;  1BIS A;  4HTL A;  1JL2 A;  4FJN A;  3A5O C;  3Q7B A;  4JD2 A;  1OH6 A;  4DQP A;  3KLE A;  1ZBL A;  5BPL A;  5JIC A;  3KHY A;  4DV0 K;  4RTF D;  5AZI B;  3MEE A;  4EHU A;  3CFR A;  1S1U A;  1RDC A;  2NNW A;  4JI1 K;  4FLZ A;  3VQC A;  3AVB A;  4E89 A;  1KAY A;  3ID8 A;  3K0S A;  3PLA A;  4IEE A;  3EY1 A;  4V19 S;  5AQH A;  1M90 O;  4M3U A;  3KK2 A;  3U8X A;  2E2O A;  3RWU A;  4H5N A;  1GLD G;  1KTQ A;  2E6L A;  3DI6 A;  3NFA A;  4KI4 A;  1NNE A;  4B9Q A;  3LM9 A;  3OHR A;  1NJW A;  3VQD A;  4A57 A;  2PYL A;  4JKG B;  5K14 A;  3SCX A;  3EZ5 A;  4F3O A;  1FW6 A;  2G8W A;  3ENO A;  2YHW A;  2XY8 A;  3KK1 A;  3SUO A;  2ZWH A;  4RW4 A;  3EKU A;  3DLH A;  2QWQ A;  4IOC L;  4B3M K;  3V9X A;  3VER A;  1RBS A;  2UXD K;  3TTD A;  1JXE A;  2QKK A;  1RCH A;  2E2P A;  4BGA A;  4KFB A;  1M1K O;  4PQU A;  2VWB A;  1HRH A;  2GEM A;  4CJR A;  5FRN A;  1ESV A;  2F9W A;  4Z4C A;  2OTL N;  4ZTF A;  3D2F B;  4N47 A;  3VF2 A;  3IFR A;  4CFA A;  5C24 A;  1EKE A;  1OVQ A;  3A8Y A;  3WNG A;  2PAV A;  3CI5 A;  2YNI A;  4CGG A;  3OVN A;  3VEO A;  2G8K A;  2V51 B;  4Z4H A;  2XHB A;  2D0O A;  2OZS A;  3CM6 A;  4Z4G A;  4CK2 A;  1HPM A;  4FWP A;  4Z0U A;  3LL3 A;  3AVN A;  3DRP A;  1BDG A;  2Z1H A;  3AY9 A;  4PWD A;  3ATU A;  1SV5 A;  1NK7 A;  2W41 A;  4IDK A;  4JRP A;  1TAQ A;  3SUP A;  1GLL O;  5AQL A;  4DU3 A;  4CJQ A;  3ASM A;  2JWL A;  3VQP A;  3D6R A;  1CXU A;  4ID5 A;  1ZBS A;  5ADX A;  3HP6 A;  4DCH A;  3C6U A;  1S5J A;  5CE3 A;  4JK9 A;  4OVL A;  5LMU K;  4NXN K;  3LAL A;  2X74 A;  4BR0 A;  3UE5 A;  3HZ6 A;  5JLF A;  3QER A;  2RN2 A;  1NBW A;  4CFD A;  2HW3 A;  4LF7 K;  1KLN A;  2HND A;  5AZJ B;  2Q31 A;  3O1W A;  2OCE A;  4O8U A;  4H0T B;  4DTU A;  4XH4 A;  4EZ6 A;  2Z1J A;  1KC8 O;  4U67 L;  5AQW A;  5GIO A;  1S3X A;  3NCI A;  3CPW M;  4YOV A;  4DS4 A;  4CJ4 A;  2YNF A;  3V81 A;  4M7Y A;  3K5N A;  1WBB A;  4CJF A;  2JGU A;  3F9M A;  3C7N A;  3SJH A;  3U9Z A;  3AVG A;  3MN9 A;  4FJG A;  2HHH K;  1NGI A;  4DMN A;  4DS5 A;  3BGR A;  4DR5 K;  2HBJ A;  5FPE A;  2FXU A;  4I6M A;  4K42 A;  2P9N B;  3SZ2 A;  3TAE A;  4M3Y A;  1VSM A;  1IV0 A;  1IKX A;  3G4S N;  3CHW A;  5C25 A;  5SZT A;  2PBD A;  4AIL C;  1V4S A;  1X9J A;  4R79 A;  4XH1 A;  2QWL A;  4EAH D;  1TGO A;  3N4Q A;  4CJS A;  2IAJ A;  4FW1 A;  1W2B M;  1WLJ A;  1RNH A;  3SUN A;  3ZSQ A;  3THX B;  3IDH A;  3QEI A;  4BRG A;  3OJU A;  3NHG A;  2CGL A;  1XQS C;  3TAF A;  3O08 A;  2Q36 A;  1NK9 A;  3IKM A;  1S1T A;  3NF9 A;  2V52 B;  4YNQ A;  4BRD A;  4L3Q A;  3P4I A;  1WSE A;  3CXC M;  1ZYQ A;  3C7N B;  2I5J A;  1QVF M;  4BRH A;  4CGH A;  4CD3 A;  4CGJ A;  3HYF A;  3HST B;  1JLB A;  2F8T A;  1S6Q A;  1IBK K;  2ASM A;  3KLH A;  1X3M A;  5LL6 Z;  4I6M B;  3CJ9 A;  4GKJ K;  4ILJ A;  3D2E B;  5JS1 A;  1RBU A;  3V9U A;  3B8A X;  3T1H K;  2VG7 A;  3DLR A;  1HNV A;  4FWK A;  4E7K A;  1D8Y A;  4FJX A;  2Z1I A;  4KHN A;  5GIP A;  1Q9X A;  1JLQ A;  5GAH P;  3V1R A;  1RTJ A;  4OPA A;  4CHN A;  3AA5 X;  1U47 A;  4H03 B;  1WAJ A;  5BN9 A;  1I39 A;  4FWN A;  1R59 O;  2VQF K;  3OYB A;  4NCA A;  3O80 A;  4FLW A;  4I2Q A;  4M45 A;  2BH1 A;  1KAZ A;  2OTJ N;  5DM6 L;  4EP5 A;  3LP0 A;  3SYZ A;  3UB5 A;  3CME N;  4H0Y B;  3OYL A;  1ASV A;  4ICL A;  5BR9 A;  4CJL A;  4AF1 A;  3GG4 A;  1DTQ A;  3VQB A;  3C6H A;  3TI0 A;  1KQS M;  2UUB K;  2F7T A;  5CY4 A;  4KRE A;  3WQT A;  1UAX A;  4LY7 A;  4FVU A;  3WXI A;  1C0G A;  1ZBI A;  1VSE A;  1VQ7 N;  4RW6 A;  1B9F A;  3AA4 A;  3E9L A;  4TSX A;  2NRR A;  1RDD A;  1IG9 A;  3TAP A;  4W5Q A;  1NU0 A;  1DTT A;  4BC4 A;  3WUH A;  1O13 A;  1XHZ A;  4DV4 K;  4KPY A;  4IXC A;  4YOY A;  1NGB A;  4LD0 A;  2KQ2 A;  5M1O A;  4KB1 A;  4DFM A;  3HOT A;  3TU5 A;  3G71 N;  3R6M A;  5TKY A;  1BGX T;  3DOK A;  1SAZ A;  2F9T A;  4KTW A;  4RG8 A;  3ZSY A;  3T69 A;  1EO1 A;  1JJ2 M;  2CGK A;  3HI0 A;  3KVG A;  4G1Q A;  2VGN A;  4E7J A;  2YHA A;  4CEC A;  3QIP A;  3W0L A;  3LP2 A;  2VYP A;  3VQ9 A;  4AH9 A;  1FK9 A;  3QFP A;  1N5Y A;  3LAM A;  1QZ5 A;  4FM0 A;  5KRS A;  4BE1 A;  1UOC A;  3N4P A;  2RPI A;  4DV7 K;  2IVP A;  3D0P A;  1XI1 A;  1VHX A;  3FZH A;  3KLF A;  3QLH A;  1X3N A;  3VQ8 A;  1C1A A;  2DFF A;  2OPS A;  2DFH A;  3V9W A;  1NGH A;  3AVA A;  3H1Q A;  3CD6 N;  3AGK A;  2D5R A;  2VWK A;  5AR0 A;  4B08 A;  3I8B A;  4BRK A;  3VQE A;  3DLK A;  3L2U A;  3EYZ A;  2E6M A;  3HPO A;  1ZBU A;  2DPN A;  4BE2 A;  3BF1 A;  4GV6 A;  4BC5 A;  1NKB A;  2XY6 A;  3SAG A;  3PSF A;  1OH8 A;  4JKD A;  4CZM A;  5CZ1 A;  2KKZ A;  5KGX A;  1N34 K;  1HNZ K;  4CEA A;  1QHA A;  4B9M A;  4DR4 K;  4BE0 A;  4HCC A;  3MX2 A;  2FSN A;  3L2Q A;  1BG3 A;  4KKO A;  1TK5 A;  3H46 O;  4LF4 K;  4JAX A;  3TAM A;  2BUP A;  1S9E A;  2P9U A;  4CF8 A;  3W3D A;  4JNE A;  4PHT X;  2Q0U A;  3C0B A;  1GOA A;  1YAG A;  4BC3 A;  2LSN A;  4DF8 A;  2GUI A;  3KKR A;  2O8E A;  4NCG A;  3FE1 A;  2QKB A;  2IS3 A;  1BA0 A;  3GOI A;  4QS7 A;  2ZGZ A;  2O4G A;  3TWH A;  3SV3 A;  1S72 N;  1JLA A;  1T7P A;  1A5X A;  1K73 O;  1RIL A;  2KHO A;  3NGZ A;  4DSF A;  2B6A A;  3L4I A;  3RRG A;  1NJI O;  4BVP A;  4ZHR A;  2GV9 A;  1RDW X;  4GNI A;  1P90 A;  3NF8 A;  4H8K A;  1WN7 A;  5AQK A;  4O8K A;  1Z05 A;  4LH5 A;  1C1C A;  5CYM A;  1R0A A;  4BQZ A;  1KVA A;  3AGR A;  4F8R A;  4J2B A;  3RTV A;  4DQ8 A;  2E1Z A;  3V6D A;  3VGM A;  4CZG A;  4KBO A;  4CJE A;  1LCU A;  4O44 A;  2X6N A;  4KO0 A;  5C42 A;  3E9O A;  2O8D B;  1ATS A;  1KLM A;  1EWR A;  4FLY A;  3I55 N;  3F9K A;  2P9I A;  3G0Z A;  1W9H A;  3ALY A;  2KFZ A;  3HXM A;  3VOV A;  3SAF A;  5AFU H;  1IBL K;  4WE1 A;  5ELZ A;  1N33 K;  3MN6 A;  1S1W A;  5HBM A;  2D0C A;  3SMS A;  1XC9 A;  3Q7C A;  1YJN N;  3H45 C;  2BAN A;  3FGU A;  4BWJ A;  4EP4 A;  1GOC A;  3A5M C;  3QML A;  1NMD A;  4QCL A;  5CYQ A;  4KHY A;  1GLB G;  4CEZ A;  1YTA A;  3SV4 A;  2R7Y A;  1CXQ A;  3EE8 A;  1KXP A;  3ZX2 A;  1K6Y A;  1JL1 A;  3ZT2 A;  4MO4 A;  3ZSV A;  2HVI A;  5BPM A;  4HHT A;  3B6O A;  2GWK A;  2A5X A;  3ZX3 A;  4FJM A;  1CZA N;  3ZEU A;  2ASO A;  2PYJ A;  2YHB A;  4JK7 A;  3M8P A;  3L2W A;  4OPH A;  3LDS A;  3H3O B;  2O8C B;  1SL1 A;  5AJ3 K;  2X6S A;  2YNH A;  4OKJ A;  3DJC A;  4WQ4 A;  5M1F A;  4FJH A;  2D0B A;  3VEW A;  2YHY A;  1QQM A;  3KTQ A;  4GW6 A;  4FPA A;  3F2K A;  4FWO A;  3RSE B;  3U3Y A;  4B1X B;  4BAC A;  3CF5 L;  3J81 O;  5J1E A;  1QSL A;  4QS9 A;  3CFO A;  4FLU A;  1VSH A;  3WNF A;  1REV A;  4FXD A;  4B1W B;  2VG6 A;  1S1V A;  3DXK B;  4LSL A;  3AAQ A;  1HKG A;  5DK5 A;  3OYH A;  1U45 A;  1NOY A;  4JKA A;  2HF4 A;  2QWP A;  5CHI A;  3J80 O;  4J2A A;  4FLT A;  1X1P A;  3FFK B;  3V9S A;  4DHY A;  1H1V A;  2G8U A;  2FSJ A;  3ZET B;  1GLE G;  3HVR A;  3VGK A;  1IG8 A;  3RR8 A;  4BDZ A;  1QSY A;  1ZC6 A;  3DLG A;  3TSU A;  1RT1 A;  3OA9 A;  4WFN L;  2BDP A;  3VEZ A;  3CCM N;  3OYE A;  1W97 L;  5TKW A;  4C1N I;  3BZC A;  4YOU A;  2UYT A;  1XMO K;  4JLH A;  2HMI A;  3M3Z A;  4BG9 A;  4B9V A;  1GOB A;  4CF1 A;  2FF6 A;  3SPZ A;  2QXF A;  3SMP A;  3L2R A;  1Q7Y O;  2XO7 A;  2E1Y A;  2O8F A;  4DTX A;  3H6E A;  1BL3 A;  2P9S A;  3M8Q A;  2Q0R A;  4MDB A;  1KD1 O;  5AQJ A;  4QOZ B;  4H0V B;  2Q1N A;  3EEQ A;  5E84 A;  3L3V A;  1WSH A;  5HOO A;  1S22 A;  3TAQ A;  2KZZ A;  2VG5 A;  4QAG A;  4DR2 K;  2BTF A;  4DQQ A;  1RTD A;  4ELT A;  4OGE A;  4DKW A;  3NGY A;  4CD1 A;  5AFU A;  3EE9 A;  2NRV A;  3A2F A;  2CGJ A;  3MN7 A;  5FLX O;  4GY2 B;  1QZ6 A;  2IOC A;  1MWM A;  1MU2 A;  3F5T A;  4ISE A;  3M8R A;  3BY5 A;  4JD2 B;  4IZ9 A;  3QNN A;  3RMD A;  1HKB A;  3LDN A;  2P51 A;  1EXQ A;  4M7X A;  2HMP A;  3AVJ A;  2WOM A;  4YOX A;  4DV2 K;  4WQ4 C;  4WQ5 A;  4BRN A;  1S9G A;  3O9R A;  3M8S A;  4FJJ A;  2D0P A;  4BRC A;  4BR2 A;  4BGB A;  2V7Y A;  4KV8 A;  1YUW A;  4JYA K;  3TPQ A;  3IS9 A;  4O5F A;  1J5O A;  4DSJ A;  4OKK A;  3LAK A;  2JWK A;  4FYD A;  3R1X A;  4GVM A;  4NLC A;  2BGG A;  2P9S B;  3DWL A;  1BUP A;  1KVC A;  1CZB A;  3U6F A;  1NK8 A;  2HVH A;  3E66 A;  1JLC A;  1HKC A;  3LDP A;  4Y0W A;  3TSQ A;  5E41 A;  2JLE A;  4RW9 A;  3AVM A;  3SPY A;  3D45 A;  1QTM A;  3R8E A;  1ZBH A;  3ZCM A;  3KK7 A;  1BU6 O;  4OJR A;  2NRH A;  5KI6 A;  3CCV N;  1IKW A;  4DUZ K;  4DSE A;  4B3O A;  3T7Z A;  1HYS A;  2HHU A;  4JI5 K;  3ZSW A;  3CM5 A;  4C1N K;  5BRE A;  2IC3 A;  1LWF A;  2NLX A;  1L3S A;  2GUP A;  3HP9 A;  4IDH A;  4CJU A;  4B3S K;  3DMJ A;  1XNR K;  1IKY A;  3E9P A;  3RMC A;  4C23 A;  5LJW A;  3NGI A;  3P38 A;  3QIO A;  2A41 A;  4KHU A;  2HHT A;  2AA4 A;  4JKF A;  4M41 A;  1BO5 O;  3O9T A;  3CJB A;  5F0X A;  2O8B A;  2HOE A;  1ASW A;  3VA0 A;  4KH6 A;  3CFP A;  2Q2R A;  3QEV A;  4KHS A;  4B1U B;  4PKH A;  2F4V K;  1KFD A;  5HRO A;  2D1K A;  1RFQ A;  4CHO A;  1QQN A;  2KTQ A;  3T3F A;  3HT3 A;  1SL0 A;  5LY3 A;  1NJY A;  2Y1I A;  5AQX A;  5I9E B;  4CED A;  2NRZ A;  1XMQ K;  4BRF A;  4BY9 C;  4CFB A;  3S9H A;  2IGI A;  4CF9 A;  2ZD1 A;  3P39 A;  1Q9Y A;  3DM2 A;  3CC2 N;  1TAU A;  4WYB A;  1L3V A;  3MDQ A;  4IOX A;  1WNS A;  3AVF A;  1D9D A;  5DM7 L;  3DXM A;  5A2Q O;  3HRG A;  1I94 K;  1QHT A;  2YX6 A;  1RDB A;  1LAV A;  3P31 A;  4HTU A;  4JEP A;  1CZ9 A;  3QEW A;  4CVN E;  3VET A;  1GLC G;  1KFS A;  4BG8 A;  4LFB K;  4CZK A;  3MCA B;  4IFE A;  4FM2 A;  3OJS A;  1GLJ O;  3GDQ A;  1BQM A;  3OY9 A;  3PV8 A;  3I0R A;  3QIC A;  3SBT A;  4HUE A;  1XWL A;  1NM1 A;  1TL1 A;  3CQY A;  3LPT A;  3ENB A;  4CEB A;  3OYF A;  5AQY A;  3O3G A;  1N36 K;  5T7B A;  3J7Y P;  3O4N A;  5I42 A;  1T44 A;  3PX0 A;  3WXL A;  1NGE A;  4AHR A;  4E3S A;  3CCS N;  4LFA K;  1U2V A;  1N32 K;  3CMA N;  4KTQ A;  3CG7 A;  1HX1 A;  4JI4 K;  1VSD A;  3VF6 A;  3F73 A;  4O55 A;  3NF6 A;  4JI6 K;  1K8K A;  4PL7 A;  4KH5 A;  3CCL N;  4H5R A;  3C6T A;  4PA1 A;  3UKR A;  4X62 K;  1VQK N;  5KRT A;  1NK6 A;  4FWS A;  3WEE A;  4MLE A;  4FCY A;  2P9K A;  1RTI A;  2P9P A;  1MDU B;  3UKU A;  1WB9 A;  1T3V A;  4FJ7 A;  2QA4 N;  1WSF A;  3AVL A;  4H5T A;  4JRQ A;  2XY7 A;  1LW2 A;  4DV5 K;  2VWJ A;  3ZSR A;  2QXL A;  4O5B A;  4FWM A;  2DFE A;  5M1P A;  3HOS A;  4JN4 A;  4DU1 A;  4PKG A;  4J8F A;  3OBY A;  1KSP A;  1VRU A;  3I0S A;  3L0Q A;  3CQ8 A;  1OVY A;  3ISN C;  5AQN A;  4UY8 O;  2A40 A;  1HJO A;  5FPN A;  1JCE A;  1D9F A;  2WFB A;  1BCO A;  4IBN A;  1SUQ A;  2A1R A;  4C8M A;  5JVH L;  2QWO A;  1Q82 O;  1HYZ A;  3DLE A;  4K8Z A;  4ELU A;  2E2N A;  1BI4 A;  3K5L A;  2XRI A;  4CW7 B;  5AQR A;  3NH0 A;  4NLB A;  4BR4 A;  2QWN A;  3PO5 A;  1Q81 O;  4M42 A;  4DTR A;  4DUY K;  1J9A A;  4AM7 A;  4C8N A;  3UKR B;  4JKB A;  1BIZ A;  1EP4 A;  1JLE A;  4BRI A;  1NG9 A;  1T8E A;  3QNO A;  5AQZ A;  2ZJP L;  1K9M O;  2P9P B;  5HRR A;  2ASP A;  4H4M A;  4ILH A;  2RKI A;  3VEV A;  4CZF A;  1G99 A;  3KD1 E;  2HHS A;  3CIP A;  3KIO A;  2HNY A;  5E26 A;  4OLA A;  2HBL A;  3IUC A;  1VK0 A;  5KTQ A;  3ZSX A;  3OW2 M;  1C0F A;  3ZX0 A;  4B8C A;  4Q0B A;  4JKC A;  3NAE A;  4FOI A;  3MXM A;  3HO1 A;  1NOZ A;  3S3M A;  5AQM A;  1LW0 A;  3C6A A;  2IDO A;  4CEF A;  3O4W A;  4IWV A;  1VSJ A;  3LDO A;  4A61 A;  1VQL N;  1XHX A;  2OPQ A;  1T03 A;  5C0Y A;  3HTV A;  4FW2 A;  3L6Q A;  2WTU A;  2ZQB A;  4Q5V A;  4M3W A;  4JI2 K;  4NB4 A;  3LZJ A;  3THW A;  4IG3 A;  5GAD P;  4B1Z A;  3E1Y A;  1NLV A;  4A59 A;  3VEX A;  2FBY A;  1NGJ A;  4B9N A;  4DG1 A;  1W0H A;  3OYC A;  2P9L A;  4JI8 K;  4CHZ A;  3ULE A;  4CHP A;  4FJI A;  1P8Z A;  3J7Z O;  4E7L A;  3OYA A;  2KLA A;  2HBM A;  4WFA L;  3FZK A;  4Z4I A;  1YXQ A;  1TUU A;  3O3F A;  3HL8 A;  3K5O A;  2YNG A;  3CJ1 A;  3NDK A;  3AV9 A;  3O6W A;  3A5L C;  4GV9 A;  4FPB A;  3VQ7 A;  3WXK A;  1I3A A;  2FLO A;  2G8F A;  3OS1 A;  3BUZ B;  5BRD A;  1E4G T;  5C15 A;  5M1K A;  4PUO A;  3B6P A;  5HRS A;  1Z26 A;  4YOT A;  2P1J A;  5BR8 K;  1T6C A;  1TKD A;  2RHK A;  2ZE2 A;  3MEG A;  3AA3 A;  4BRM A;  3CC4 N;  4WF9 L;  3AAP A;  1VSF A;  4H4O A;  3LM2 A;  3AVC A;  1BHL A;  4PKI A;  5IT9 O;  4K41 A;  4FWQ A;  2ZJQ L;  1QQO A;  4WFB L;  3SQ0 A;  1YIT N;  4DLE A;  3PSI A;  3THW B;  4J2D A;  1EX4 A;  1NGG A;  3RR7 A;  4W5N A;  1WSG A;  4KB0 A;  4GV3 A;  3O4Q A;  3U3G A;  3QB0 A;  1HPZ A;  4M3X A;  1B92 A;  4YOW A;  3CYM A;  4DV3 K;  4BRQ A;  1ATN A;  3BF3 A;  4XIU A;  1KAX A;  1RTH A;  1VQ8 N;  1DGK N;  3JXU A;  4X65 K;  4DFP A;  3KKS A;  2HST A;  4JKH A;  1U49 A;  4H5W A;  5AQO A;  3LZI A;  3TAN A;  4FZZ A;  2ETJ A;  2NRT A;  2ITM A;  4YOR A;  1DKG D;  4DWI A;  3L3U A;  3O9S A;  2OA8 A;  1HNI A;  3LDQ A;  4JK8 A;  3O9U A;  3O8M A;  3P5J A;  4CJT A;  5KPT A;  4NYF A;  5AQS A;  3S3N A;  2NRW A;  5FPD A;  1HQE A;  1C6V A;  1VAZ A;  5HL7 L;  3JSM A;  4A5A A;  3T1A A;  2KFN A;  2B5J A;  3GBT A;  5LJV A;  3MED A;  3JAM O;  2P9U B;  2KW4 A;  1SZ2 A;  1HUX A;  3QBX A;  5C10 A;  3FZM A;  3CER A;  4MLH A;  4OLB A;  3K2P A;  3THV A;  3VQQ A;  5JVG L;  3PX4 A;  2O8E B;  4W5T A;  4A5B A;  1N8R O;  1NJX A;  2YJE A;  4CK3 A;  2YKN A;  4RWT A;  3L2V A;  1DLO A;  3AAR A;  1VSL A;  3FZL A;  4DFK A;  4BVO A;  2OZM A;  4BRE A;  4CJ3 A;  4O0I A;  4DTO A;  3SUQ A;  3OBW A;  4CEE A;  3ZSZ A;  4XH5 A;  4GVE A;  1HYV A;  3CCE N;  3DYA A;  1YVU A;  3VQ5 A;  3VES A;  2W6L A;  3VTH A;  1JCG A;  4AHT A;  1E4F T;  4Z4E A;  1C0U A;  1RBV A;  5CR4 A;  1EWQ A;  1QS4 A;  2NRX A;  3K9J A;  3AO4 A;  3AO3 A;  1NWK A;  1E3M A;  4Y1C A;  5IWA K;  3THY A;  2P9I B;  1CLQ A;  4F4K A;  5AZI A;  2AP1 A;  3KD5 E;  3QIN A;  3K59 A;  2UXB K;  3T1Y K;  4JHD A;  1EQY A;  1OH7 A;  4DQI A;  5AQG A;  2YHX A;  1RT4 A;  4FJ5 A;  4CZJ A;  4FK4 A;  4KI6 A;  5B8H A;  1X9W A;  4Y1D A;  5F1X A;  3CQX A;  5FDL A;  1IKV A;  3OYJ A;  1D5A A;  3DLB A;  2UUA K;  2D0A A;  3QES A;  3NH1 A;  3CJ7 A;  3J8A A;  3QEP A;  1L3T A;  1Z25 A;  1VQO N;  3AO5 A;  3KZB A;  4YHH K;  5J2M A;  3HBT A;  5J2Q A;  4YDU A;  4DTS A;  4JKG A;  1FKP A;  4CER A;  4I2P A;  3HSC A;  3D7E O;  1DT9 A;  1Q86 O;  2RF2 A;  4ILG B;  4BWM A;  3EZW A;  3LP1 A;  4X66 K;  3L4Q A;  2WON A;  4OX9 K;  3JS6 A;  1HR0 K;  3ZEU B;  4FWL A;  3ZLJ A;  2I7N A;  3TAG A;  3M6G A;  1QVG M;  2GWJ A;  2Q3S A;  3CCJ N;  4HUF A;  4IFY A;  1J5E K;  3FLC O;  3QBW A;  1T6D A;  2W6K A;  3O3H A;  3CCU N;  4DSI A;  3UIQ A;  3D2F A;  3CPE A;  3THY B;  2PZS A;  2G8I A;  2V7Z A;  3S41 A;  3TTF A;  4X64 K;  1LWC A;  4BRP A;  1MA9 B;  3ATV A;  4JHD B;  3LWL A;  5EX5 A;  3QEX A;  5BRF A;  3PY8 A;  5GIN A;  4R5P A;  1VQ4 N;  4HCB A;  1KCF A;  1LV5 A;  1HMV A;  1WOQ A;  4UQG A;  3ZT1 A;  3EKS A;  4IJA A;  4M3Z A;  2IVO A;  3WNH A;  2E88 A;  1DEJ A;  4YY3 K;  4ID1 A;  5C12 A;  5I3U A;  1HLU A;  4BDY A;  4PY5 A;  1LAW A;  1VQ5 N;  4FJK A;  4E19 A;  4L8R B;  1EET A;  1W7A A;  1N6Q A;  4DTM A;  4ZTJ A;  2OYQ A;  4CIG A;  2HHW A;  3KLI A;  5AQT A;  4JS4 A;  4IFV A;  4CZE A;  3SQ4 A;  3MX5 A;  3MK6 A;  3VEY A;  3ZYY X;  1NKC A;  1KRP A;  2D4W A;  2HHQ A;  3C65 A;  3SNN A;  1TYQ A;  1QSS A;  1MWK A;  2P5O A;  4KHW A;  4IEI A;  3A0I X;  4C8K A;  4RCH A;  4W5O A;  5C2F A;  3CJC A;  3PO4 A;  4FZY A;  4JI0 K;  5AZJ A;  4JI7 K;  3CJA A;  3TSP A;  1YT3 A;  1HNX K;  2O8F B;  3ZT3 A;  3MCP A;  4BC2 A;  1BWF O;  4E7H A;  3OS2 A;  3H08 A;  4EIA A;  2HB5 A;  5EXW A;  4IO8 A;  1YF5 L;  2QK9 A;  2OAN A;  1SKW A;  4B1Y B;  1TUY A;  3QET A;  4IO9 L;  1VQM N;  2GX9 A;  4FVM A;  4YDU C;  3NE6 A;  4B9S A;  4K0K K;  4CBU A;  1WBD A;  3SJJ A;  1GLA G;  4A62 A;  1A5W A;  3MWP A;  3HJF A;  2E8A A;  3K58 A;  1BOT O;  3PX6 A;  4JV5 K;  1RDA A;  3SAH A;  2P9N A;  4DR1 K;  2HNZ A;  3G25 A;  3VQ4 A;  4CBW A;  3O1B A;  3KLG A;  3VN5 A;  4B9L A;  5BRH A;  3M5R A;  3ID6 A;  3I56 N;  2EHG A;  4LF6 K;  2UUC K;  1VQ9 N;  1RT7 A;  1JLF A;  3DRR A;  1TYQ B;  1VSK A;  2CH6 A;  4B3T K;  3OTO K;  2NZT A;  4BRL A;  4CHQ A;  3NMU A;  2OPR A;  5J2N A;  3TTC A;  3NF7 A;  1ZBF A;  1JKH A;  4EZ9 A;  4DR6 K;  1TKZ A;  3THX A;  3BP8 A;  4FO0 A;  4DLG A;  4G9Z A;  3DRS A;  4E1N A;  2QEX N;  3VF4 A;  4CK1 A;  3RMA A;  4RW7 A;  3VMF B;  5FPM A;  4ISG A;  3PIO L;  3NBP A;  3WQU A;  3P83 D;  5GAE P;  2FBT A;  1YHQ N;  3C95 A;  4E0D A;  3U4L A;  4DR7 K;  1YI2 N;  2ZJR L;  4N41 A;  4BR5 A;  3MEC A;  4IKF A;  1RT6 A;  3G6E N;  1IJJ A;  3VPZ A;  3MWT A;  1ASU A;  1U04 A;  4WQ5 C;  3H3N O;  4AQY K;  1C1B A;  3QDK A;  4JKE A;  3PIP L;  2Z1G A;  3DOL A;  1ZXO A;  1XNQ K;  2PFU A;  3D2E A;  4CJ7 A;  3K9K A;  3MAQ A;  4B9T A;  2O4I A;  3ENH A;  3IG1 A;  3V1Q A;  2HHX A;  3MN5 A;  2O8B B;  1JXB A;  3MXI A;  2IVN A;  3ITH A;  4CJP A;  2RE2 A;  3CC7 N;  4O0J A;  1U48 A;  2CH5 A;  2EX3 A;  5EVZ A;  4CEO A;  3GE1 A;  4FJ8 A;  3R3L A;  4CHY A;  4MFB A;  1TV6 A;  1V4T A;  4MDA A;  3U9D A;  4LF9 K;  1B9D A;  1BIU A;  3QFU A;  4CIF A;  3KWI A;  2F8S A;  5AQV A;  1O1W A;  4LFC K;  3JYT A;  5EOY A;  2FSK A;  4I9L A;  4CCH A;  4I9Q A;  4A2A A;  4CES A;  4FLX A;  4FLV A;  4KHP K;  5CZ2 A;  3DXM B;  5EU7 A;  1LWE A;  2YJF A;  3MMV A;  3HK2 A;  4F9O A;  5LMN K;  1TKX A;  4BR9 A;  4RW8 A;  5FRO A;  1Q18 A;  3AA2 A;  2DTU A;  4Z94 A;  4DTP A;  4CF2 A;  2VCP A;  5M1N A;  1NGF A;  4E1J A;  3WNE A;  3NVM A;  4IJN A;  2F96 A;  3LAN A;  1YJW N;  1FKO A;  4HUG A;  4FM1 A;  1IH7 A;  2FF3 B;  3TR8 A;  4NCB A;  2XY5 A;  2QI2 A;  2WC9 A;  5DMR A;  1IBM K;  3VTI A;  4CI6 A;  1T05 A;  2W42 A;  3ULD A;  5AQF A;  1X9M A;  3LWM A;  1VQ6 N;  5HRP A;  3BEX A;  3SQ2 A;  1YVN A;  3OYK A;  4CGF A;  3ZSO A;  2ZF5 O;  3K5M A;  2I7P A;  3IRX A;  1RT5 A;  4K25 A;  1L5U A;  1U2V B;  4H0O A;  1S6P A;  4OPK A;  4B1V A;  3L8B A;  2QM1 A;  3HVT A;  4BR7 A;  1K8K B;  1C0M A;  4N76 A; 
#chains in the Genus database with same CATH homology
 1B92 A;  3NCI A;  2FC0 A;  2BDP A;  3CYM A;  4DS4 A;  4CJ4 A;  4AHS A;  3OYE A;  4F2R A;  4B9U A;  4XIU A;  2YNF A;  1RTH A;  4FZX C;  3V81 A;  3K5N A;  4KAZ A;  4CJF A;  2JGU A;  5D3G A;  4DFP A;  4JLH A;  4CJ5 A;  3KKS A;  1U49 A;  3G10 A;  1QQC A;  2HMI A;  4DFJ A;  4B9V A;  1GOB A;  3AVG A;  4CF1 A;  4C8L A;  4FJG A;  3K57 A;  3LZI A;  3TAN A;  4FZZ A;  2ETJ A;  2QXF A;  3L2R A;  3SPZ A;  2XO7 A;  4DMN A;  4DS5 A;  4DTX A;  4DWI A;  4N56 A;  3L3U A;  1VSI A;  1HQU A;  2OA8 A;  1BL3 A;  1HNI A;  3M8Q A;  3BGR A;  2B4J A;  5HP1 A;  2NUB A;  3P5J A;  4QOZ B;  3OYD A;  4CJT A;  1A5V A;  4AHV A;  1SL2 A;  4NYF A;  3S3N A;  3SZ2 A;  4CJK A;  3L3V A;  3HM9 A;  3TAE A;  1HQE A;  1WSH A;  4M3Y A;  1C6V A;  4M3T A;  1F21 A;  1VSM A;  3TAQ A;  1IKX A;  2VG5 A;  3P1G A;  4QAG A;  2KZZ A;  3OYN A;  3JSM A;  3RMB A;  1SKR A;  2G8V A;  5C25 A;  3T1A A;  4CJV A;  5SZT A;  4DQQ A;  2KFN A;  1RTD A;  2GBZ A;  2YV0 X;  2B5J A;  4OGE A;  4ELT A;  3MED A;  3NGY A;  2KW4 A;  4AIL C;  3QO9 A;  3ZT4 A;  1L3U A;  4OLB A;  3K2P A;  3THV A;  3VQQ A;  3PX4 A;  1TGO A;  4W5T A;  1TVR A;  4CJS A;  4E7I A;  2IAJ A;  4FW1 A;  3A2F A;  4K8X A;  2FBV A;  1WLJ A;  1NJX A;  1RNH A;  4FJ9 A;  1BI4 B;  4CK3 A;  3VQ6 A;  3SUN A;  2IOC A;  1MU2 A;  2YKN A;  1VRT A;  3ZSQ A;  4KRF A;  3L2V A;  3M8R A;  3QEI A;  1DLO A;  3QNN A;  3RMD A;  1RBT A;  1VSL A;  4DFK A;  2P51 A;  2FBX A;  1EXQ A;  3OJU A;  3NHG A;  4F2S A;  3AVJ A;  2OZM A;  2WOM A;  4O0I A;  4CJ3 A;  4DTO A;  3TAF A;  3SUQ A;  1NK9 A;  4W5R A;  1S9G A;  3M8S A;  4CEE A;  1S1T A;  3ZSZ A;  1UA1 A;  3NF9 A;  1NKE A;  1HYV A;  4FJJ A;  2X78 A;  3DYA A;  3TAR A;  4YNQ A;  1YVU A;  3VQ5 A;  1WSE A;  3OS0 A;  4KV8 A;  1ZYQ A;  3MXJ A;  4AHT A;  4Z4E A;  2I5J A;  1C0U A;  1RBV A;  4CGH A;  3HPH A;  1HJR A;  3IS9 A;  4CGJ A;  1J5O A;  4DSJ A;  3HYF A;  3HST B;  4DTN A;  4OKK A;  1NK4 A;  1QS4 A;  3LAK A;  1JLB A;  4AHU A;  3AO4 A;  1S6Q A;  4DU4 A;  4GVM A;  2F8T A;  4CGD A;  4I7F A;  2BGG A;  4FYD A;  4O4G A;  3AO3 A;  3C94 A;  1S1X A;  4L8R B;  1KVC A;  1CZB A;  3KLH A;  3U6F A;  1NK8 A;  2HVH A;  1JLC A;  4Y1C A;  5E41 A;  1CLQ A;  4OPJ A;  2JLE A;  4RW9 A;  4F4K A;  3AVM A;  3SPY A;  5JS1 A;  1RBU A;  3KD5 E;  3QIN A;  3V9U A;  3K59 A;  3D45 A;  1QTM A;  1ZBH A;  2VG7 A;  3ZCM A;  3DLR A;  4YFU A;  1HNV A;  3HPG A;  4DQI A;  2E4L A;  4E7K A;  1D8Y A;  2Z1I A;  4FJX A;  4KHN A;  4OJR A;  1RT4 A;  1Q9X A;  4FJ5 A;  1JLQ A;  5KI6 A;  4DSE A;  1IKW A;  4FK4 A;  4B3O A;  4CE9 A;  1TL3 A;  4KI6 A;  1HYS A;  3V1R A;  1NK0 A;  1X9W A;  2HHU A;  4Y1D A;  1RTJ A;  4CHN A;  1SKS A;  3AA5 X;  3ZSW A;  1U47 A;  1WAJ A;  5FDL A;  1IKV A;  1I39 A;  1D5A A;  3OYJ A;  2PY5 A;  3CM5 A;  3VA3 A;  2YKM A;  3OYM A;  3DLB A;  2D0A A;  4MQ3 A;  3NH2 A;  3KK3 A;  2IC3 A;  1J53 A;  1LWF A;  3QES A;  3NH1 A;  3QEP A;  3OYB A;  4NCA A;  1NJZ A;  4FLW A;  1L3S A;  1Z25 A;  3HP9 A;  4I2Q A;  4M45 A;  1L3T A;  4CJU A;  3AO5 A;  5J2Q A;  5J2M A;  3DMJ A;  4EP5 A;  1IKY A;  3LP0 A;  1ITG A;  3SYZ A;  4DTS A;  3OYL A;  3RMC A;  1ASV A;  1FKP A;  4OKE A;  4ICL A;  4CER A;  2OPP A;  4FK2 A;  4I2P A;  3NGI A;  4CJL A;  3V1O A;  3QIO A;  1DTQ A;  4KHU A;  2RF2 A;  2HHT A;  5JS2 A;  4M41 A;  4GMJ B;  3VQB A;  4BWM A;  3TI0 A;  4KTZ A;  5CY4 A;  4KRE A;  3LP1 A;  2P5G A;  2WON A;  1UAX A;  3AVI A;  1ASW A;  4LY7 A;  1IO2 A;  5KGW A;  3VA0 A;  3E01 A;  3CFP A;  4KHS A;  3QEV A;  4JS5 A;  1ZBI A;  1VSE A;  3TAG A;  1TK8 A;  4RW6 A;  1B9F A;  1KFD A;  3LP3 A;  4M3R A;  3AA4 A;  2Q3S A;  4TSX A;  5HRO A;  4DSK A;  4CHO A;  4HUF A;  4IFY A;  1WAF A;  2KTQ A;  3T3F A;  1RDD A;  2BE2 A;  3PUF A;  3HT3 A;  3TAP A;  2Y1I A;  3S3O A;  1NJY A;  4W5Q A;  1SL0 A;  1IG9 A;  3T19 A;  4CED A;  5SWM A;  3O3H A;  1DTT A;  4CFB A;  4DSI A;  3UIQ A;  3S9H A;  2PZS A;  2G8I A;  1XHZ A;  4FK0 A;  2IGI A;  4CF9 A;  1YTU A;  4KPY A;  2ZD1 A;  1Q9Y A;  4LD0 A;  3DM2 A;  4BDP A;  1LWC A;  2KQ2 A;  4C8O A;  1TAU A;  3LWL A;  1L3V A;  4KB1 A;  3QEX A;  2AJQ A;  4DFM A;  3PY8 A;  2ATQ A;  3AVF A;  1WNS A;  5HRN A;  1D9D A;  4R5P A;  3IAY A;  1BGX T;  3DOK A;  4HCB A;  4KTW A;  1KCF A;  4DF4 A;  1LV5 A;  1HMV A;  4F3T A;  4UQG A;  1U4B A;  1NK5 A;  3ZT1 A;  4RG8 A;  1J54 A;  3ZSY A;  3AVK A;  2ITG A;  1QHT A;  4M3Z A;  1RDB A;  4HVJ A;  3WNH A;  1LAV A;  1TKT A;  1QE1 A;  3AO1 A;  4HTU A;  4Z4F A;  4G1Q A;  1Q8I A;  4E7J A;  4ID1 A;  2YHA A;  4CEC A;  3QIP A;  5I3U A;  4BDY A;  4PY5 A;  1CZ9 A;  3QEW A;  2G8H A;  1LAW A;  3LP2 A;  2HHV A;  3VQ9 A;  4DQS A;  4E19 A;  4AH9 A;  1EET A;  1FK9 A;  1N5Y A;  1N6Q A;  4DTM A;  1KFS A;  3LAM A;  4J2E A;  4ZTJ A;  4FM0 A;  3BDP A;  2OYQ A;  5KRS A;  4CIG A;  4CIE A;  3KLI A;  1UOC A;  4NYN A;  4JS4 A;  4BE1 A;  4FM2 A;  2HHW A;  5J2P A;  4IFV A;  3SQ4 A;  4DSL A;  3OJS A;  1BQM A;  3OY9 A;  3PV8 A;  3I0R A;  2RPI A;  1NKC A;  1KRP A;  4HUE A;  2HHQ A;  3D0P A;  3SNN A;  1XI1 A;  1XWL A;  1TK0 A;  3KJV A;  1QSS A;  1TL1 A;  2A1S A;  3KLF A;  3LPT A;  3RRH A;  2Y1J A;  4CEB A;  2P5O A;  4KHW A;  3QLH A;  3OYF A;  3O3G A;  3VQ8 A;  4C8K A;  1C1A A;  5T7B A;  2DFF A;  4W5O A;  3O4N A;  5I42 A;  3PO4 A;  2OPS A;  4FZY A;  3OYI A;  2DFH A;  3AVH A;  3PX0 A;  3V9W A;  3AVA A;  2D5R A;  2VWK A;  1YT3 A;  4AHC A;  4AHR A;  4E3S A;  3V4I A;  4FJL A;  1C0T A;  3ZT3 A;  1WSJ A;  4B08 A;  3VQE A;  4N5S A;  3CG7 A;  5HLF A;  4KTQ A;  1VSD A;  3DLK A;  3L2U A;  3OS2 A;  3EYZ A;  3F73 A;  3H08 A;  4O55 A;  3NF6 A;  4E7H A;  2HB5 A;  2E6M A;  4PA1 A;  3C6T A;  2QK9 A;  3HPO A;  1X9S A;  1Y97 A;  1ZBU A;  1UA0 A;  5KRT A;  1NK6 A;  1SKW A;  4LH4 A;  4BE2 A;  4CF0 A;  4FCY A;  3QET A;  1NKB A;  1RTI A;  2XY6 A;  3LPU A;  1WSI A;  4IG0 A;  4FVM A;  5FRM A;  3NE6 A;  4FJ7 A;  1UWB A;  4B9S A;  5CZ1 A;  5KGX A;  4E1M A;  1KVB A;  1WSF A;  3AVL A;  4KHQ A;  2DY4 A;  1BQN A;  4JRQ A;  4CEA A;  2XY7 A;  4B8A B;  3SJJ A;  1LW2 A;  1G15 A;  1A5W A;  4B9M A;  2VWJ A;  1JLG A;  3ZSR A;  4FJK A;  4O5B A;  3OYG A;  3K58 A;  4BE0 A;  4HCC A;  3HJF A;  2DFE A;  3I8D A;  4DU1 A;  3PX6 A;  3SI6 A;  1RDA A;  3TAB A;  1KSP A;  4ELV A;  1VRU A;  3I0S A;  3CQ8 A;  3L2Q A;  2HNZ A;  3VQ4 A;  3KLG A;  3VN5 A;  4KKO A;  3ISN C;  4CGI A;  4B9L A;  1TK5 A;  1BCM A;  4CEQ A;  3ZT0 A;  3TAM A;  4DQR A;  2EHG A;  4OGC A;  1D9F A;  1RT7 A;  1JLF A;  3V9Z A;  4CFC A;  1BCO A;  1S9E A;  3AO2 A;  3DRR A;  4CF8 A;  4LSN A;  4DF8 A;  1RT2 A;  1VSK A;  4IBN A;  1GOA A;  3VQA A;  2LSN A;  1SUQ A;  2KZM A;  1FXX A;  1RT3 A;  3SQ1 A;  4C8M A;  2A1R A;  2GUI A;  3KKR A;  4CJW A;  4DTJ A;  4CHQ A;  4NCG A;  2OPR A;  2QKB A;  2IS3 A;  5J2N A;  1HYZ A;  3FFI A;  3DLE A;  4K8Z A;  1RBR A;  3NF7 A;  4ELU A;  1BI4 A;  3K5L A;  2O4G A;  2XRI A;  3TWH A;  1BIS A;  3SV3 A;  1JL2 A;  1JKH A;  1ZBF A;  4EZ9 A;  4FJN A;  1JLA A;  1TKZ A;  3NH0 A;  4DLG A;  1T7P A;  3PO5 A;  1A5X A;  3DRS A;  4DQP A;  4M42 A;  4E1N A;  4DTR A;  1J9A A;  4CK1 A;  3KLE A;  3RMA A;  4RW7 A;  1RIL A;  4C8N A;  3NGZ A;  1ZBL A;  4DSF A;  1JLE A;  1EP4 A;  1BIZ A;  2B6A A;  3RRG A;  3MEE A;  4ZHR A;  2GV9 A;  1T8E A;  3QNO A;  3CFR A;  3NBP A;  1S1U A;  1RDC A;  3P83 D;  5HRR A;  2FBT A;  3NF8 A;  4H4M A;  3VQC A;  3C95 A;  4H8K A;  4FLZ A;  4E0D A;  1WN7 A;  3AVB A;  2RKI A;  5CYM A;  4E89 A;  4LH5 A;  1C1C A;  1R0A A;  3KD1 E;  2HHS A;  1KVA A;  3KIO A;  4F8R A;  4J2B A;  4N41 A;  3MEC A;  3RTV A;  4IKF A;  1RT6 A;  2HNY A;  3V6D A;  3EY1 A;  4CJE A;  1ASU A;  4O44 A;  4M3U A;  1U04 A;  2X6N A;  4KO0 A;  5C42 A;  3KK2 A;  1C1B A;  3RWU A;  1KLM A;  1KTQ A;  4OLA A;  2E6L A;  3DI6 A;  3NFA A;  4FLY A;  1VK0 A;  2Z1G A;  3DOL A;  5KTQ A;  3ZSX A;  4KI4 A;  3F9K A;  1NJW A;  3VQD A;  4B8C A;  3G0Z A;  4Q0B A;  3NAE A;  3MXM A;  3HO1 A;  1W9H A;  3MAQ A;  1NOZ A;  5K14 A;  2PYL A;  4B9T A;  3ALY A;  3SCX A;  3HXM A;  2KFZ A;  2O4I A;  3EZ5 A;  3S3M A;  3IG1 A;  4F3O A;  1LW0 A;  2G8W A;  3V1Q A;  4WE1 A;  2HHX A;  2IDO A;  4CEF A;  2XY8 A;  3KK1 A;  1S1W A;  1VSJ A;  5HBM A;  3SUO A;  2D0C A;  1JXB A;  1XHX A;  2OPQ A;  4RW4 A;  3MXI A;  4FW2 A;  1T03 A;  3DLH A;  1XC9 A;  2ZQB A;  3ITH A;  4CJP A;  4Q5V A;  4M3W A;  4O0J A;  3V9X A;  2BAN A;  1U48 A;  2EX3 A;  4BWJ A;  4CEO A;  4EP4 A;  1GOC A;  1RBS A;  4FJ8 A;  3LZJ A;  4IG3 A;  1JXE A;  2QKK A;  1RCH A;  4QCL A;  4KFB A;  5CYQ A;  4CHY A;  4KHY A;  4MFB A;  4PQU A;  1TV6 A;  1HRH A;  2FBY A;  4CJR A;  4B9N A;  5FRN A;  4DG1 A;  4CEZ A;  1W0H A;  1B9D A;  4Z4C A;  3OYC A;  1BIU A;  1YTA A;  4ZTF A;  3SV4 A;  4N47 A;  2R7Y A;  1CXQ A;  4CFA A;  5C24 A;  1K6Y A;  4CHZ A;  1EKE A;  1JL1 A;  4CHP A;  4CIF A;  4FJI A;  3ZT2 A;  3ZSV A;  3WNG A;  2F8S A;  2HVI A;  4HHT A;  1O1W A;  2YNI A;  3B6O A;  3OVN A;  4CGG A;  3OYA A;  3JYT A;  4E7L A;  2G8K A;  4Z4I A;  4Z4H A;  4FJM A;  4I9L A;  2XHB A;  4CCH A;  2OZS A;  4I9Q A;  3O3F A;  4CES A;  4FLX A;  3HL8 A;  3K5O A;  4FLV A;  2YNG A;  2YHB A;  2PYJ A;  3M8P A;  3CM6 A;  5CZ2 A;  3NDK A;  5EU7 A;  4Z4G A;  1LWE A;  3L2W A;  4CK2 A;  3LDS A;  3HK2 A;  3AV9 A;  1SL1 A;  4Z0U A;  1TKX A;  2X6S A;  4RW8 A;  5FRO A;  2YNH A;  3AA2 A;  4OKJ A;  3AVN A;  3DRP A;  3VQ7 A;  4CF2 A;  4DTP A;  2DTU A;  1I3A A;  2Z1H A;  2G8F A;  3OS1 A;  4PWD A;  1SV5 A;  4FJH A;  2D0B A;  3WNE A;  1NK7 A;  4IDK A;  4JRP A;  1TAQ A;  2F96 A;  3SUP A;  3KTQ A;  4GW6 A;  4PUO A;  3B6P A;  5HRS A;  3LAN A;  1Z26 A;  2P1J A;  4DU3 A;  1TKD A;  1FKO A;  4CJQ A;  3ASM A;  4HUG A;  3U3Y A;  2ZE2 A;  4BAC A;  4FM1 A;  1IH7 A;  3MEG A;  3TR8 A;  3AA3 A;  5J1E A;  4NCB A;  2XY5 A;  1QSL A;  1VSF A;  4H4O A;  5DMR A;  3VQP A;  1CXU A;  3CFO A;  4ID5 A;  3AVC A;  4FLU A;  1BHL A;  1VSH A;  3HP6 A;  3C6U A;  3WNF A;  1S5J A;  1T05 A;  2W42 A;  4OVL A;  1REV A;  4FXD A;  2VG6 A;  3ULD A;  3LAL A;  2X74 A;  1X9M A;  1S1V A;  3LWM A;  4LSL A;  3SQ0 A;  4DLE A;  5HRP A;  5DK5 A;  3OYH A;  3SQ2 A;  1U45 A;  3OYK A;  3QER A;  2RN2 A;  1NOY A;  4CFD A;  4CGF A;  2HW3 A;  4J2D A;  3ZSO A;  1EX4 A;  3K5M A;  1KLN A;  2HND A;  3IRX A;  4J2A A;  4FLT A;  1X1P A;  3RR7 A;  1RT5 A;  1L5U A;  3V9S A;  4W5N A;  1WSG A;  2G8U A;  1S6P A;  4KB0 A;  4OPK A;  3O4Q A;  4DTU A;  3HVR A;  3RR8 A;  3L8B A;  3HVT A;  4EZ6 A;  4BDZ A;  1QSY A;  2Z1J A;  3DLG A;  3U3G A;  1RT1 A;  1C0M A;  4N76 A;  1HPZ A;  4M3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...