2XY8A

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xy8A00
1UA1A 3OS0A 1NOZA 3OYNA 1HNVA 3DLBA 3AO2A 4PQUA 2BANA 4O55A 3DLHA 3VQPA 1RT4A 4CJVA 3RR7A 3KK2A 3M8RA 4DS5A 2DY4A 3DLKA 4FJ5A 1NKBA 3V9SA 2RPIA 3VN5A 1KFSA 3C6UA 1NK9A 2PYLA 3D45A 4CJEA 1IKXA 3DYAA 4W5QA 1B92A 2VG5A 3LPTA 4FLZA 3QNNA 1T03A 3TAGA 2OA8A 1S5JA 4CECA 1NK4A 4CJRA 1D9FA 1W0HA 2YNHA 3VQAA 2G8KA 4CJWA 4FJMA 3HP9A 4DTRA 2F96A 1WAFA 4ID5A 3CFRA 3QIOA 5HP1A 1GOBA 1WAJA 4OPKA 1WSGA 4DFPA 2EHGA 2D0CA 3I0SA 2GBZA 2AJQA 3OY9A 1TAUA 3CYMA 3KLEA 2BE2A 3I8DA 4M3UA 4OGCA 2ZQBA 3ZSOA 4BWJA 3VQDA 2A1RA 4CJQA 3OYAA 1EKEA 1KVCA 1XHZA 1IKWA 4IDKA 1JLEA 3CG7A 1WN7A 2X6SA 3LP3A 4OKKA 5J2MA 3HPGA 4E0DA 3RRGA 4LSLA 2FBTA 3ZT1A 4DFMA 1N5YA 5HBMA 1QHTA 3IRXA 1NKEA 1L5UA 5D3GA 5C25A 4FJ9A 4I2QA 4KAZA 4ELVA 4E3SA 4ID1A 1KLMA 3ZSQA 5CY4A 3SZ2A 4OLBA 3AVBA 4KI6A 2F8SA 4F4KA 1FKPA 4KI4A 1XI1A 3SUOA 5CZ2A 1FKOA 1TKDA 1NJXA 3OYBA 3E01A 3M8SA 4CCHA 2G8IA 4HUGA 4E7KA 4AHSA 2VG7A 4FJNA 4Z4IA 1ASUA 4FXDA 2HNYA 4Q0BA 3B6OA 5KGXA 4B8AB 1QQCA 2P1JA 4DQIA 1ZBHA 3DI6A 4E7LA 4KB1A 1GOAA 3V1OA 4B9SA 3VQ5A 4CGFA 3I0RA 1NK5A 3LWLA 3V4IA 1NK7A 3NF9A 4FLTA 3SV3A 4C8LA 4NCAA 1RDAA 1HJRA 3KLGA 1I39A 3OYJA 3NBPA 3NCIA 3TAFA 4M3XA 3DRPA 4JS4A 1SV5A 3AV9A 2DFFA 1NK8A 3LAMA 4H8KA 1NJZA 4B9UA 5DK5A 3SQ2A 2YKNA 5FDLA 1HYVA 4BE0A 3HPOA 1HQEA 2VG6A 2VWJA 2HB5A 1TAQA 3QINA 3LWMA 4NYNA 3EZ5A 4BE1A 4CK3A 1XWLA 4HHTA 1HMVA 3K5NA 2QKKA 4FJ8A 4B9NA 4DTNA 3OYGA 3HM9A 4J2AA 3KK1A 1RT7A 1S9EA 4DU1A 4DTJA 3PX0A 4CF1A 3KD5E 4FZZA 3SI6A 4EP4A 1RCHA 3AVAA 4O4GA 2G8WA 4FZXC 3AVHA 1RDCA 3HK2A 4F3TA 4N5SA 3KIOA 1TL1A 4MQ3A 2KZZA 4QCLA 4KHNA 4M42A 1JL2A 5DMRA 4K8XA 4DG1A 2IS3A 3FFIA 4FJLA 2X6NA 3NAEA 4KHQA 1RILA 4CFBA 4XIUA 1XC9A 2R7YA 4DWIA 1WSFA 3PO5A 1C1CA 4O44A 1ASVA 1EX4A 1J53A 4IG0A 1JLAA 1SKRA 3BDPA 4PWDA 3MXIA 4CHPA 3NDKA 4DTXA 1CZBA 3LAKA 1L3UA 5C42A 2DFHA 2G8VA 4J2DA 1LAWA 2IDOA 4CGDA 4CJPA 3QEWA 3QETA 4G1QA 1C1BA 3VQ6A 3TARA 3L2QA 3RRHA 1C6VA 1U4BA 3K2PA 2HHSA 3MEGA 2ATQA 3B6PA 1BQMA 2X74A 1X9WA 1TGOA 1HYSA 1G15A 3ASMA 2BDPA 4AILC 4CFAA 2HW3A 4M3YA 1Y97A 4B9LA 1VSFA 2W42A 3TANA 4CERA 3RMAA 4N76A 3TR8A 4ZTJA 4BDYA 4CJTA 1BL3A 3P1GA 1X1PA 4Z4CA 1RT5A 4OKJA 3O3HA 3D0PA 1WNSA 3S9HA 1LWEA 3MXJA 3HT3A 4E1MA 3LANA 1TK0A 3OYKA 2G8HA 2OZSA 3VQQA 3AO3A 2F8TA 4CK1A 3T3FA 3AA2A 3M8PA 4LY7A 2FBYA 1QTMA 4GVMA 4FCYA 4I9QA 3NF8A 1RBVA 1A5XA 3OYDA 4JRQA 1TV6A 2RF2A 4NYFA 2YHBA 4HUEA 3K59A 3F9KA 4KTQA 1QSYA 4O5BA 5K14A 4KO0A 3DRRA 5CYQA 4AHVA 3NH0A 1RT6A 4K8ZA 1BQNA 5FRMA 1ITGA 3NH1A 3VQCA 4O0IA 3LALA 3DM2A 3TAEA 4IKFA 4Z4EA 4DTOA 3F73A 1A5WA 4C8MA 1S1XA 5JS2A 2OPRA 2X78A 2QXFA 4CJKA 2P51A 3C95A 3KJVA 3P83D 4FW1A 3SQ1A 2I5JA 4FM2A 3AO5A 3U6FA 1HPZA 5KRSA 2Z1GA 4I2PA 1UWBA 4KRFA 3ZSYA 4FLWA 1S1TA 1KVBA 4I9LA 1R0AA 3IAYA 2FBVA 2D0AA 2XY6A 1LW0A 1BCOA 4B9VA 3KLFA 3UIQA 4HCBA 3AVNA 4M3ZA 3K5LA 1CLQA 3CFOA 3KKRA 3DLRA 1O1WA 3P5JA 4PA1A 3SCXA 1YT3A 4KPYA 2Q3SA 1TKZA 3WNFA 3V1RA 3ZT3A 5I42A 1X9SA 3VQ9A 4NCBA 2JLEA 5SZTA 4DU3A 2LSNA 3ISNC 4MFBA 1S1UA 5HROA 2XY8A 1S6PA 1YTAA 4FM0A 4OVLA 4HTUA 1JLBA 4DF8A 3AA5X 1T8EA 1XHXA 4Z4FA 4CEQA 3KTQA 1JXEA 1RBSA 3HXMA 4B9TA 1CXUA 3L3UA 1QSSA 2HHXA 2P5OA 4CHZA 3S3NA 1SUQA 1ZBLA 1WLJA 1IKYA 2O4IA 1TL3A 2G8FA 4CE9A 4CHOA 3VQEA 3SV4A 3CFPA 2IAJA 3SUNA 3K57A 4PY5A 3MXMA 3THVA 2D5RA 3C6TA 3T1AA 2B4JA 2RKIA 3H08A 4CESA 1J54A 4IFYA 4EP5A 4R5PA 4CGIA 4B9MA 4FW2A 4C8OA 3SQ4A 4CF8A 4JRPA 4B8CA 4CIFA 4C8NA 3KLHA 3PX6A 3PUFA 4CJSA 3BGRA 3SPYA 4E19A 1UOCA 3TWHA 4OKEA 3AVFA 3ITHA 4FJIA 3WNEA 4F2RA 3RTVA 3WNGA 4EZ6A 4F2SA 2ITGA 1SL0A 2HVIA 4JS5A 4N47A 3LZJA 3PV8A 2HNZA 4ELUA 4DQRA 1IKVA 5CYMA 3VQ4A 4Q5VA 1RDBA 2KFZA 4RW4A 1N6QA 3T19A 2YV0X 3OYEA 1K6YA 3NGZA 3MECA 2Y1JA 3HVTA 1FK9A 1U45A 1RBRA 4ELTA 4B3OA 4QOZB 3NGIA 1BISA 4FK2A 4KHSA 5J2QA 3KD1E 2QKBA 4RW8A 1W9HA 3KK3A 4M45A 3QIPA 1JLCA 1KTQA 1BIZA 4CJ5A 4E1NA 4KHYA 2XO7A 4Y1DA 1RTDA 4J2EA 4CFCA 2Z1HA 1VSKA 1SKSA 1EETA 4DQPA 1ZBIA 1IO2A 3AVCA 2E4LA 4CFDA 4FJJA 3AVGA 4AHTA 1LWFA 5HRRA 1Q8IA 5E41A 1TVRA 2YNIA 3VA0A 3SPZA 1T05A 2PY5A 3TAMA 5J1EA 1X9MA 4I7FA 4FLVA 3QEPA 5JS1A 4FZYA 4CHQA 5J2PA 4PUOA 2JGUA 3CQ8A 1J9AA 3AA4A 2Z1IA 1Z26A 1RTJA 4M41A 1ZYQA 1NJYA 1D9DA 1C0UA 4QAGA 4CEDA 1NK0A 1KLNA 4Z4GA 2KZMA 4RW9A 3ALYA 4DFJA 4M3TA 3DLEA 3AVJA 2HVHA 3VQ7A 4W5RA 4CK2A 1SKWA 2GUIA 2E6MA 5I3UA 1HYZA 5KRTA 1RTHA 3L3VA 1YTUA 4CIGA 4IFVA 1ZBUA 3TAPA 3K5OA 3OJSA 4FYDA 3RMCA 3QERA 1QS4A 4CF0A 4GMJB 1IH7A 4H4MA 4OJRA 4CJ4A 4CGGA 1U49A 3VA3A 5CZ1A 1KVAA 3QLHA 3LZIA 3SQ0A 4CIEA 3ZSWA 4DS4A 1C1AA 3CM5A 1JKHA 3NGYA 2BGGA 2GV9A 1BIUA 3ZT0A 1A5VA 3NHGA 4CEBA 1QE1A 2NUBA 1KSPA 4AH9A 1KCFA 2OZMA 4J2BA 1HNIA 4KFBA 1U04A 1TKXA 3LP0A 4M3WA 4FLUA 2OYQA 5SWMA 1RT3A 1VSJA 4DTUA 3QEXA 3AO1A 3HP6A 2XHBA 1NKCA 4DMNA 3L2VA 3ZSRA 4DSFA 4FJKA 1DLOA 3NF6A 2PZSA 4Z4HA 3G10A 2XY5A 4FJGA 2YNGA 2RN2A 4WE1A 3O4NA 3K5MA 1TK5A 1Z25A 3M8QA 3VQ8A 1Q9XA 5EU7A 4EZ9A 4DQSA 2ZE2A 3AVLA 3L2WA 3O3GA 1C0MA 3G0ZA 4AHCA 3OYMA 5HRNA 2G8UA 4AHRA 3VQBA 2XRIA 3RWUA 1VK0A 1L3VA 2YNFA 4C8KA 2QK9A 4FM1A 1JLFA 3IS9A 3RR8A 1NJWA 4BE2A 3AO4A 4KKOA 1S9GA 1DTTA 4CJFA 3V81A 4ZHRA 4LSNA 1IG9A 3AVKA 2FC0A 1VSDA 1GOCA 4CHYA 4KHUA 4KTZA 3OJUA 3AVIA 3S3OA 2Z1JA 3PY8A 3DOKA 2HHVA 1YVUA 2A1SA 3QNOA 1RT2A 4LH4A 4CGHA 3ZT4A 4DSKA 3SNNA 1RTIA 4O0JA 1WSIA 5KTQA 1BI4B 4UQGA 3HL8A 3QEVA 4DQQA 3AVMA 5C24A 1UA0A 4FK0A 1CXQA 1SL1A 4JLHA 3OVNA 3V1QA 1TK8A 3C94A 1MU2A 2ZD1A 4CJ3A 1BGXT 3EYZA 3QEIA 3PO4A 2DTUA 4BACA 1FXXA 2YHAA 4E7JA 4KB0A 2IOCA 3O3FA 3LP2A 3LP1A 2KW4A 1S1VA 4DTSA 4NCGA 3V9ZA 1NK6A 2IC3A 4ZTFA 4CGJA 1F21A 2HNDA 3L2RA 3LDSA 4DLGA 4DTMA 2KFNA 4KHWA 3JSMA 4CJLA 3HYFA 2B6AA 4RW6A 3SYZA 1B9DA 4W5NA 2YKMA 3O4QA 1HQUA 1BI4A 3SUPA 4Z0UA 4M3RA 3QO9A 1RBTA 2PYJA 2XY7A 1L3TA 4FJHA 4W5OA 2OPPA 4HVJA 1RBUA 4KTWA 1J5OA 2O4GA 3HSTB 3IG1A 3TI0A 1SL2A 3SJJA 3A2FA 4IG3A 3SUQA 2P5GA 2VWKA 3HO1A 2FBXA 1C0TA 3OS1A 3S3MA 2HMIA 4FJXA 3RMBA 3NH2A 4HCCA 4E7HA 3ZSZA 1LV5A 3HPHA 3U3YA 1HRHA 3OS2A 3RMDA 1D8YA 4CEZA 2ETJA 2WONA 3U3GA 3ULDA 4TSXA 3V9XA 2HHQA 3MEEA 1I3AA 4CJUA 4F3OA 3PX4A 1NOYA 4CHNA 5KI6A 4KV8A 4L8RB 3OYFA 4HUFA 4CEOA 1TKTA 3ZSXA 1BCMA 4AHUA 4OLAA 1Q9YA 4BWMA 3NF7A 1WSJA 1WSHA 3TABA 1VSIA 3WNHA 1LWCA 2OPQA 3ZSVA 4DSIA 2DFEA 4GW6A 1WSEA 1RNHA 4N56A 3MEDA 5J2NA 1VSHA 1ZBFA 2OPSA 4H4OA 3HJFA 3JYTA 4FLYA 4RW7A 4DU4A 4F8RA 1LW2A 1RT1A 3OYHA 5KGWA 5FRNA 2E6LA 3EY1A 4LD0A 1D5AA 4CF9A 4W5TA 1EP4A 5FROA 4DF4A 4OPJA 2IGIA 4FK4A 1CZ9A 1VRTA 1DTQA 3NE6A 3CM6A 3LPUA 1L3SA 3V6DA 2HHWA 3OYLA 4DLEA 1U48A 1UAXA 2HHTA 4YFUA 3L8BA 4FVMA 3NFAA 4DSEA 1VRUA 1JLQA 2Y1IA 3V9UA 4DFKA 4BDPA 4DSLA 5HLFA 5HRPA 2HHUA 4ICLA 1S1WA 4CEEA 1EXQA 4E7IA 1BHLA 4CF2A 3OYCA 2D0BA 2EX3A 1JLGA 3OYIA 4KREA 1JL1A 2WOMA 1QSLA 3KLIA 4IBNA 4B08A 3DOLA 4E89A 1RDDA 1VSLA 2KQ2A 1JXBA 1U47A 3HVRA 4CEAA 1VSMA 3K58A 1S6QA 3DRSA 3ZT2A 4BDZA 3DLGA 2KTQA 1B9FA 3ZCMA 4FJ7A 1KRPA 4DTPA 4YNQA 4DSJA 1ASWA 1LAVA 1T7PA 3AA3A 3KKSA 3TAQA 4RG8A 1VSEA 4LH5A 1REVA 3L2UA 4Y1CA 2B5JA 3V9WA 4N41A 3DMJA 3MAQA 3QESA 1KFDA 5T7BA 4CEFA 4OGEA 4FLXA 5HRSA
chains in the Genus database with same CATH superfamily
1UA1A 4PQUA 1HNVA 3DLBA 2V52B 3VQPA 1RT4A 3RR7A 2QA4N 3M8RA 3H3NO 3WQTA 3DLKA 4FJ5A 3ENOA 5AJ3K 4BGAA 3D45A 1SAZA 1B92A 3TAGA 1S5JA 2W40A 1NK4A 3VQAA 2HMPA 3DXMA 2F96A 3E9LA 3CFRA 1MWKA 1WAJA 4Z94A 5ADXA 2GBZA 3CMEN 1NNEA 3VMFB 3T1YK 2BE2A 2ZQBA 5AQZA 2V51B 4BWJA 3VQDA 2A1RA 4GV3A 3PLAA 4CJQA 1KVCA 1JLEA 3LP3A 3G4SN 3OW2M 3THXB 4E0DA 2E88A 4LSLA 3ZT1A 1L5UA 5D3GA 5TKWA 4FWKA 5GINA 4H0TB 5C25A 4I2QA 4KAZA 1OH8A 4ELVA 4FJ9A 4OX9K 1ZXOA 1KLMA 3ENHA 3ZSQA 4KI6A 4F4KA 3ZX3A 1FKPA 4KI4A 5CZ2A 2P9PA 4B9QA 4RTFD 3OYBA 3E01A 4CCHA 4JKAA 4AHSA 4WF9L 5AQOA 1ASUA 4FXDA 5M1NA 3CPWM 2JWKA 4B8AB 4J8FA 3QDKA 4CGFA 3I0RA 1MWMA 1QQNA 4FLTA 3EO3A 4NCAA 3W0LA 4DUYK 4JS4A 2DFFA 1NK8A 1HYVA 1U2VB 3HPOA 3K9KA 3HZ6A 1XNRK 1NGFA 2WFBA 3EZ5A 4IO9L 4BE1A 4CZGA 3PSIA 4CK3A 3GBTA 1TUYA 3M1FA 4DV0K 4IJAA 1NU0A 4DTJA 5AZIA 4FZZA 1RDUA 4EP4A 4FZXC 3HK2A 1RDCA 4F3TA 4DR3K 4QCLA 4KHNA 2F9WA 1HX1A 2Q36A 1EX4A 3NDKA 1X9JA 4B1UB 3EKUA 1LAWA 3F9MA 2IDOA 3CQXA 2DPNA 4G1QA 1FW6A 3TARA 1QQMA 3L2QA 1N32K 4MDBA 1VQ8N 3S41A 3KWGA 1TGOA 1HYSA 1VSFA 2W42A 4O8KA 3TANA 4QS8A 3E1YA 5C0YA 4N76A 3BUZB 5KQ8A 4CZEA 4BDYA 4ZTJA 1BL3A 1X1PA 3FE1A 3O3HA 3D0PA 4E1MA 4H0YB 3MN6A 3AO3A 3VENA 3E9PA 3AA2A 4LY7A 4NLBA 4FCYA 3ZLJA 3OYDA 1NGAA 1YJWN 4KTQA 4O5BA 4AHVA 1ITGA 3LALA 4LFAK 2Q0UA 1S1XA 4CJKA 3C95A 1YVNA 3EE8A 3D2FA 2I5JA 4LFCK 3CHWA 4FLWA 1KVBA 1R0AA 4NLCA 4IO8A 3P39A 1LW0A 4B9VA 3KLFA 3K5LA 4X62K 2KKZA 2UUBK 3DLRA 3P5JA 1YT3A 5I42A 3VQ9A 4DU3A 2RE2A 1KC8O 4K42A 3O5BA 4GVEA 4Z4FA 4CEQA 3KTQA 2HHXA 4B3RK 5HOOA 1TL3A 5H1SQ 2G8FA 3O6WA 3VQEA 3SUNA 3T1AA 3H08A 4R5PA 1J54A 4CF8A 3JAMO 2QEXN 2ASOA 3SPYA 4E19A 3SJHA 3CJ1A 3I8BA 3WNEA 4F2SA 3C7NA 3RTVA 2G8UA 3WEEB 3Q7CA 1DEJA 3VQ4A 1RDBA 1NGDA 2Y1JA 1FK9A 1U45A 3GL1A 4FOEA 4IWVA 2HOEA 4AM6A 4FK2A 1GLBG 4H5NA 1W9HA 4JK8A 3KK3A 3QIPA 1JLCA 1KTQA 1MA9B 4CJ5A 4KHYA 5AQJA 1RTDA 4CFCA 5C12A 5E41A 1BOTO 5J1EA 1EWRA 2QWPA 2YX6A 4A61A 3QEPA 4JI5K 3KZBA 5J2PA 4CZIA 1D9DA 1RTJA 4M41A 1NJYA 4QAGA 4CEDA 4RW9A 1SKWA 1VQPN 2GUIA 4BRPA 2E6MA 1HYZA 2CH5A 5KRTA 3SAFA 3L3VA 2IIRA 4FYDA 3QERA 2O8BB 4IOAL 4GMJB 1IH7A 2CGJA 4CGGA 5CZ1A 1N33K 4JYAK 1KXPA 3SQ0A 1GLLO 3MCPA 4JKEA 3NGYA 1BIUA 1A5VA 3IUCA 4CEBA 2NUBA 1KSPA 3FZLA 4J2BA 4BC3A 5JVHL 5EX5A 4KFBA 1P90A 2VQEK 2OANA 4HTLA 1VAZA 3LP0A 2D1KA 4M3WA 2OYQA 5LMNK 3ULEB 4DV4K 1N8RO 3E9OA 3NF6A 2ZJPL 4JEPA 2XY5A 2RN2A 3O4NA 1TK5A 1Z25A 2QI2A 3M8QA 3MN5A 3VEOA 3VQ8A 5EU7A 1Q9XA 4DQSA 2ZE2A 3ID8A 3L2WA 3QBWA 1C0MA 3G0ZA 4FL9A 5AFUH 5HRNA 3OYMA 3CF5L 4C8KA 2QK9A 3RSEA 3AAQA 3IS9A 2Q2RA 1YITN 1NJWA 3RR8A 1S9GA 3KK7A 4CJFA 3V81A 3SMPA 3FR0A 1YF5L 4BRNA 4FWSA 4F9OA 2Z1JA 3WXMB 3DOKA 4I6MB 4BQLA 3QNOA 1T6DA 4FPAA 4DV6K 1ATNA 3SNNA 4BRAA 4UQGA 3TU5A 1CXQA 3V1QA 2BH1A 3CJCA 2DTUA 3EE9A 4H5TA 3V9ZA 1NK6A 4B1YB 4BC4A 2UUAK 3E66A 1F21A 2O8FA 3UKUA 3HRGA 2HSTA 4CJLA 1B9DA 2GWKA 1RGIA 1BI4A 3AAPA 4Z0UA 2XY7A 2P9UA 2NZTA 4HVJA 4LF4K 4A5AA 4FPBA 3O9UA 4GNIA 3NH2A 3CCEN 3U3YA 2WONA 3NVKA 3MEEA 2ZM6K 4IEEA 5KPRA 5AQRA 4L8RB 4CEOA 4BRKA 3J8AA 1Q9YA 5AQPA 3WNHA 2VGNA 4GY2B 3ZSVA 4EAHD 3AARA 4N56A 5C2FA 5J2NA 4H4OA 1BA0A 3JYTA 1QVFM 4FLYA 4RW7A 1YJ9N 3OYHA 5FRNA 5AFUA 4YOTA 2HBKA 4C1NK 2IGIA 1CZ9A 1VRTA 2A5XA 3WXIA 4FSVA 2VGMA 4DSEA 4H5RA 1JLQA 5HLFA 5HRPA 4ICLA 3KHYA 4CEEA 4E7IA 5AQMA 1EWQA 1JLGA 4KREA 2QWOA 3KLIA 3BP8A 5M1KA 4E89A 1GLFO 4CEAA 3O80A 5AZJA 2KTQA 1B9FA 3ZCMA 4FJ7A 4DTPA 2I7PA 4DSJA 3DXMB 1ASWA 4RG8A 1VSEA 2P9NA 1REVA 3LDQA 1QHAA 3DMJA 3MAQA 3QESA 3CC2N 1KFDA 5T7BA 4JI7K 3F2KA 5JLHA 2FF6A 1C0GA 3EZWA 2FSNA 3DLHA 4O55A 2QWNA 3KK2A 4DS5A 3ZX2A 2DY4A 1NGIA 2RPIA 2V7ZA 3VN5A 3C6UA 1NK9A 5AQLA 3O8MA 1IKXA 3DYAA 4YY3K 3LDOA 1D9FA 4LFBK 2YNHA 4JI1K 4FJMA 3T69A 4FWLA 5F2RA 1GOBA 4DFPA 2EHGA 2BTFA 2AJQA 3OY9A 3A5MC 4OGCA 5FPMA 1NGCA 3OYAA 1EKEA 5BR8K 1XQSC 4PKIA 4IDKA 5J2MA 1WN7A 2GTDA 2P9IA 2X6SA 4FWMA 3HPGA 4K0KK 4DFMA 3IRXA 4CW7B 4IOCL 4ID1A 4LF8K 3BF3A 1NGBA 2F8SA 1XI1A 1FKOA 1OKJA 4HUGA 5BN9A 2VG7A 4FJNA 1W7AA 2HBMA 1E3MA 1BUPA 1ZBHA 3HI0A 3DI6A 4CD3A 4LF6K 5AZIB 5BRFA 1GOAA 4KB1A 3VQ5A 4A57A 3LWLA 1NK5A 4FO0A 3NF9A 4C8LA 1HJRA 1I39A 3NCIA 2KHOA 3TAFA 4LF9K 2UYTA 3AV9A 3SAHA 5DK5A 4CZLA 1IBKK 2VG6A 2FSKA 2VWJA 1TAQA 4IOXA 4YOYA 3EKSA 5BRHA 3CMAN 3VESA 1XWLA 4FJ8A 1K8AO 3J7YP 3OYGA 4H0VB 3KK1A 1S9EA 4DU1A 3SI6A 4O4GA 4ISEA 2Q1NA 3AVHA 2VCPA 2KZZA 4AQYK 1K8KA 4O8UA 1JL2A 4DG1A 2IS3A 4FJLA 2X6NA 3NAEA 2O8CA 4KHQA 1W97L 4DV3K 1RILA 4CFBA 4XIUA 1XC9A 2R7YA 4DWIA 1BO5O 3AGKA 1C1CA 1SKRA 4GKJK 1JLAA 4DV2K 2I7NA 4DUZK 1L3UA 5BPMA 5F0XA 4PKHA 4B1ZA 3TSUA 3QEWA 3QETA 4YOVA 3L4QA 1C6VA 2PAVA 2P9KB 3K2PA 1BU6O 3VTIA 2ATQA 3B6PA 1BQMA 2X74A 4BR7A 3U9DA 4X66K 2BDPA 4WCEL 3P4IA 1Y97A 5EXWA 5BN8A 3CQYA 4CERA 5GAEP 1C0FA 3P1GA 4OKJA 3CC7N 1WNSA 3S9HA 1LWEA 1TK0A 3HT3A 3LANA 5EY4A 3D7EO 4WQ4A 4BC2A 4GVMA 3NF8A 2RF2A 4PHTX 3H3OB 4HUEA 4BRCA 4BREA 3DRRA 5FRMA 3THWB 3BEXA 2QWQA 4JI2K 4IKFA 4Z4EA 4BVPA 4C8MA 5JS2A 2OPRA 2X78A 2P51A 4GV9A 4FW1A 1ATRA 4FM2A 1S22A 1YAGA 1HPZA 5CR4A 5KRSA 4WFBL 4KRFA 1UWBA 4I9LA 3DLLL 2D0AA 3CERA 4A2AA 3ZYYX 4BG8A 3AVNA 2IVNA 4MLEA 1O1WA 4PA1A 2F7TA 3WNFA 3ZT3A 5A2QO 2VWBA 5SZTA 3C7NB 3VF6A 1S6PA 3VPZA 5JICA 4OVLA 4BG9A 1XHXA 3MN7A 1RBSA 4B9TA 1QSSA 2P5OA 1SUQA 3N4QA 1ZBLA 1YIJN 4CE9A 4CHOA 2P9LB 4PY5A 3MXMA 3THVA 3C6TA 2B4JA 4EP5A 4K43A 4CBWA 4DR4K 4JRPA 4B8CA 3O9TA 4C8NA 1HPMA 3CCUN 3D6RA 1UOCA 3TWHA 4OKEA 1XNQK 3PIOL 4EZ6A 2ITGA 3LL3A 1SL0A 4JS5A 2E2PA 3LZJA 5FPNA 3PV8A 2UUCK 1IKVA 5CYMA 4RW4A 1K6YA 3TPQA 1HLUA 1BISA 4KHSA 1NWKA 4RW8A 4M45A 1BIZA 4J2EA 4Y1DA 5AQYA 4NXNK 4FWPA 1VSKA 4JHDB 3U8XA 3AVCA 5HRRA 4CVNE 2CH6A 1TVRA 2YNIA 3VA0A 3SPZA 1N36K 3TAMA 1X9MA 5JS1A 4FZYA 2JGUA 2Z1IA 1Z26A 1ZYQA 4Z4GA 1C0UA 3GE1A 4DFJA 3DLEA 3AVJA 2HVHA 3QBXA 2E20A 5FPDA 1RTHA 2FF3B 4GKKK 5AQGA 3R9PA 5AQKA 1OH5A 1S3XA 1BA1A 1U49A 4JKGA 4CIEA 4DS4A 3RSEB 1YI2N 1IV0A 1QE1A 4AH9A 2OZMA 3VGKA 1P8ZA 4K25A 3BZKA 1XUPO 3CJ9A 3HP6A 1NKCA 4DMNA 1NMDA 2PZSA 2KLAA 2YNGA 2ASMA 1NMNA 4AHRA 1NG9A 1L3VA 2YNFA 4IEIA 5AQVA 3CPEA 3O4WA 5GIPA 4KKOA 1DTTA 4ZHRA 2FC0A 3ZX0A 3AVIA 3PY8A 1YVUA 4O0JA 1WSIA 1BI4B 3QEVA 3HL8A 4DQQA 3AVMA 3AGRA 5C24A 1YUWA 4MO5A 2NNWA 2PFUA 4AM7A 4CJ3A 1BGXT 3QEIA 4A2BA 4GV6A 5EVZA 3HOTA 4YOWA 3LM2A 2IC3A 4ZTFA 3FZMA 3ENBA 2KFNA 5MLCQ 3CC4N 4B3MK 4WFNL 4KHWA 4JD2A 2IVOA 3MMVA 4BRLA 4BY9C 3O4QA 5M1PA 3SUPA 4M3RA 2IVPA 1L3TA 4XH4A 1J5OA 2P9SB 3HSTB 1XMOK 3SUQA 1C0TA 3OS1A 3DXKB 4KH6A 1IJJA 1GLAG 4JN4A 2A42A 4E7HA 1HRHA 3OS2A 2ETJA 3U3GA 2HHQA 2FLOA 3UKRB 4CJUA 4F3OA 3PX4A 4CHNA 5KI6A 4KV8A 3OYFA 4HUFA 1I94K 3CJBA 3VERA 5GAGP 3CJAA 3ZSXA 4AHUA 4OLAA 3LDLA 3TABA 2OPQA 1K73O 2QW9A 1RNHA 3HJFA 2OPSA 3WXKA 5AZJB 5KPZA 3H6EA 4DU4A 1K9MO 1LW2A 3H46O 5I9EB 5KGWA 4DR2K 3EY1A 2ITMA 1D5AA 4W5TA 1S72N 4OPJA 2P9NB 3NE6A 1DTQA 2W6KA 3LPUA 3V6DA 4DLEA 2HHUA 3V9UA 1LCUA 3J7ZO 4NO7A 1S1WA 4U67L 1BHLA 4CF2A 3OYCA 2D0BA 3L4IA 2YHYA 1JL1A 4BRIA 4B08A 3VEYA 3DOLA 1VSLA 4DR1K 4JI0K 1VSMA 4JKCA 1S6QA 4BDZA 3DLGA 3DWLA 3FLCO 3M6GA 2NRRA 1KRPA 4BC5A 4YDUC 4YNQA 4M7YA 1BG3A 1T7PA 3AA3A 3KKSA 3TAQA 3L2UA 3V9WA 4DR6K 3L6QA 4OGEA 4FLXA 4BR4A 4EHTA 1GLEG 3OS0A 5GIOA 3VEZA 3OYNA 4NB4A 2YJFA 2P9IB 4EIAA 4CJVA 2JWLA 4JI4K 3J81O 3P38A 1NKBA 4H5VA 2UXBK 4CJEA 4W5QA 2VG5A 4JNEA 4FLZA 1YJNN 1T03A 2OA8A 5AQWA 2Q0RA 3CETA 1RDWX 4CJRA 5M1QA 5DM7L 2G8KA 4JV5K 3HP9A 4DTRA 3SBTA 1WAFA 1VQ6N 2A40A 1WSGA 1TYQA 4G9ZA 1WB9A 3ZEUB 3SBGA 3I8DA 5KQDA 3O1BA 1U47A 2QTDA 2W41A 5BPLA 2E2QA 1N5YA 1QHTA 1NKEA 3VF2A 1OVYA 2E2OA 4E3SA 3WQUA 5CY4A 2D4WA 4OLBA 3AVBA 3ZETA 2G8IA 3R8EA 1NBWA 4ILHA 4X64K 2HNYA 5BPNA 3SAGA 4Q0BA 3B6OA 1X3NA 1QQCA 2P1JA 4DQIA 4B9SA 3V4IA 5AQXA 3KLGA 3OYJA 3NBPA 4M3XA 5HL7L 3DRPA 1M1KO 2O8CB 3LAMA 4B9UA 1NJZA 1VQON 2YKNA 4BE0A 1OH6A 2UXCK 1HQEA 1R59O 3LWMA 3RVCA 4NYNA 4QS7A 3K0SA 4DV7K 4DQ8A 5JMVA 4HHTA 2QKKA 4DTNA 3HM9A 3HM8A 1X3MA 3AY9A 1RT7A 1Q7YO 1HNWK 4HWIA 3FGUA 3CCVN 2G8WA 4N5SA 3KIOA 1TL1A 3D2EA 4MQ3A 1NLVA 4M42A 2A41A 5AQHA 3FFIA 2GEMA 3QB0A 2H3GX 1E4FT 1WSFA 3NMUA 1Q86O 3PO5A 1ASVA 3BDPA 4KH5A 3T1HK 4CHPA 4DTXA 1CZBA 3LAKA 2WC9A 2DFHA 2G8VA 4CGDA 1HNXK 4CD1A 3WXLA 1C1BA 3RRHA 3JS6A 2HHSA 2J4RA 4UY8O 3H45C 1G15A 4BRHA 4AILC 4B9LA 1VQKN 5E26A 4BRDA 5C2DA 4CJTA 1SS6A 2OTJN 5FLXO 4CK1A 4JKHA 3M8PA 3OBWA 4V19S 4CBUA 1RBVA 4JRQA 3LDNA 1GLDG 3A0IX 4CZJA 2YHBA 2WTUA 1QSYA 5K14A 1RT6A 4ISGA 3VF4A 3VQCA 3DM2A 3TAEA 1A5WA 4BR0A 2P9PB 2QXFA 3FZKA 3THYA 3SQ1A 2ASPA 3CCQN 3AO5A 2O8BA 2Z1GA 4I2PA 4JK7A 5AR0A 3ZSYA 1SQKA 4JK9A 2FBVA 2VQFK 3MDQA 2XY6A 1DGKN 4A59A 3UIQA 4JI3K 4M3ZA 4B3TK 4HCBA 2OCEA 1V4TA 3IMXA 4IXCA 3SCXA 2UXDK 2Q3SA 3V1RA 5AQUA 1X9SA 2O8EA 3ISNC 4MFBA 1S1UA 5HROA 2XY8A 3ULEA 2NRWA 4WQ5C 4FM0A 1JLBA 4MO4A 3P31A 3M3ZA 1BWFO 3HXMA 2YHXA 4CHZA 2YCHA 2O4IA 1WLJA 1IKYA 5IWAK 3HSCA 2NLXA 5IT9O 1EO1A 3SV4A 3CFPA 3K57A 3BY5A 1OVQA 2RKIA 4IFYA 4B9MA 4CGIA 1YHQN 1G99A 4FW2A 3SQ4A 4H5WA 4CIFA 3KLHA 3PUFA 4CJSA 3BGRA 5AQNA 4BRGA 3ITHA 4YOUA 4E1JA 1T6CA 4FOIA 2HVIA 3CD6N 2HNZA 1HUXA 4B1VA 2KFZA 1N6QA 5B8HA 2YV0X 3NGZA 4CI6A 1RBRA 4PL8A 4ELTA 1GLJO 4B3OA 2F4VK 4BVOA 3NGIA 3OHRA 4BRMA 5EOYA 1Q81O 5LY3A 2Z1HA 3C6AA 4U7BA 4JKBA 1SKSA 4DQPA 4CFDA 4FJJA 2E4LA 1ZBIA 3AVGA 1Q8IA 1T05A 2ZJQL 2HHHK 3WUHA 4X65K 5LJVA 4ILGB 4PUOA 3CQ8A 1J9AA 2KZMA 1NK0A 3MWTA 2ZJRL 3VQ7A 4W5RA 3G6EN 2GX9A 5I3UA 3LDPA 4CIGA 2F9TA 3D2FB 3K5OA 3RMCA 2NRXA 4KBOA 1TUUA 4CF0A 2CGKA 4H4MA 4OJRA 3C65A 3LZIA 1YXQA 1XMQK 1ATSA 3ZSWA 1C1AA 3CM5A 4IDHA 2BGGA 2GV9A 1VQ9N 3FFKB 3ZT0A 1BDGA 1OH7A 2BUPA 1KCFA 4CZFA 3FZHA 3R1XA 1WBDA 1HNIA 1U04A 1TKXA 3QICA 5FPEA 3GOIA 4FLUA 1RT3A 2HBJA 4DTUA 3QEXA 3AO1A 2XHBA 3L2VA 4OO1J 3ZSRA 4FJKA 1DLOA 5AQTA 4Z4HA 3G10A 4FJGA 3K5MA 2E8AA 1KD1O 4FWOA 4EZ9A 3HTVA 3AVLA 2QM1A 4BGBA 1Z6RA 5BRDA 1VK0A 1IBMK 4DHYA 4FM1A 3MWPA 3AO4A 4LSNA 3AVKA 2EWSA 5CE3A 3I56N 1VSDA 4CHYA 3OJUA 3S3OA 2HHVA 4EFHA 2A1SA 1RT2A 4JD2B 3ZT4A 4DSKA 2O8DA 1KAZA 5KTQA 5E84A 4YORA 1UA0A 1ZBSA 3TSQA 4JLHA 3OVNA 3CCSN 1TK8A 3C94A 1MU2A 2ZD1A 3EYZA 3PO4A 4H0OA 1FXXA 2YHAA 5BR9A 4KB0A 4BROA 3LP2A 2KW4A 1S1VA 4DTSA 4NCGA 1T3VA 5BREA 4B1XB 3ID6A 3L2RA 4C1NI 3LDSA 4DTMA 1VHXA 1CZAN 4W5NA 2B6AA 1E4GT 1VQNN 1O13A 1HQUA 2PYJA 2A6AA 3K9JA 4W5OA 2OPPA 3CCLN 2O4GA 1WBBA 3TI0A 1SL2A 3SJJA 3A2FA 3HO1A 1Y64A 2VWKA 3S3MA 2HMIA 5GAHP 3O1WA 4FJXA 1ILYA 1JCGA 4HCCA 1QZ6A 3ZSZA 3HPHA 3RMDA 1D8YA 3ULDA 3V9XA 1I3AA 3R6MA 1JJ2M 3MX2A 1TKTA 3VEWA 1D4XA 1W2BM 4BWMA 3NF7A 1WSHA 1LWCA 2DFEA 4GW6A 3MCAB 1ZBFA 1DKGD 1QZ5A 1NJIO 3QFUA 1HJOA 4F8RA 1RT1A 4LD0A 4DV5K 4CF9A 2Q97A 2CGLA 3WT0A 1L3SA 3PSFA 1U48A 4NXMK 3DJCA 3KWIA 4FVMA 4H03B 3L8BA 1VRUA 3N4PA 2Y1IA 4DSLA 1EXQA 4JAXA 4R79A 3PIPL 2HF3A 2A3ZA 3OYIA 2WOMA 4IBNA 5AQSA 3HVRA 3HOSA 3K58A 4CZKA 1LAVA 4YOXA 2UU9K 3C6HA 4LH5A 1TYQB 3A5NC 4N41A 3NVMA 4CEFA 5HRSA 4Y0WA 1NOZA 3AO2A 2BANA 1IBLK 4C23A 5TKYA 3V9SA 3CJ7A 2PYLA 1KFSA 2P9KA 3LPTA 3QNNA 2O8FB 3O9QA 4CECA 3UKUB 3ZETB 1W0HA 2E1ZA 1XC3A 4CJWA 3CXCM 3ATUA 3GDQA 4ID5A 5HP1A 3QIOA 4L3QA 2NRZA 3UE5A 4OPKA 2D0CA 3I0SA 1VQ4N 3QMLA 1TAUA 2P9UB 3CYMA 3KLEA 4M3UA 3ZSOA 3B8AX 4JKDA 1XHZA 1IKWA 3CG7A 4OKKA 3BF1A 2NRHA 4OPHA 3TTDA 4CZMA 2FBTA 3RRGA 5HBMA 2FXUA 3A8YA 3C0BA 3CI5A 3THWA 3SZ2A 2GWJA 5KPTA 1T44A 3SUOA 1TKDA 4FVUA 2D0PA 1NJXA 3M8SA 4E7KA 4Z4IA 2HF4A 2WUSA 5KGXA 4M7XA 4WFAL 4E7LA 3V1OA 4BR5A 1NK7A 1FJGK 3D2EB 3SV3A 3THXA 1RDAA 1Q18A 1N34K 1SV5A 4H8KA 3SQ2A 5FDLA 2HB5A 3QINA 4BQZA 1VQMN 4LF7K 1HMVA 3K5NA 4B9NA 4H0PA 4J2AA 1JCFA 3TSPA 3O9SA 3U4LA 2AP1A 2QWMA 4CF1A 2ZGYA 3KD5E 4PKGA 3SMSA 1RCHA 3AVAA 2E5LK 2P9LA 2ZF5O 2W6LA 1V4SA 5DMRA 3SK3A 4K8XA 3CCJN 1WOQA 3A5OC 3G25A 5LJWA 4CJ7A 1U2VA 4O44A 4IG0A 1J53A 4B3SK 4PWDA 4ILJA 3VEVA 3MXIA 5C42A 4J2DA 4YHHK 3JXUA 4CJPA 3VQ6A 1U4BA 5LL6Z 3MEGA 4BRFA 1X9WA 3BZCA 3M5RA 3ASMA 1HR0K 4CFAA 2HW3A 4M3YA 2NRTA 4KH4A 3THYB 3RMAA 3TR8A 3J80O 3H1VX 4Z4CA 4PL7A 1RT5A 1NGHA 4JHDA 3MXJA 2G8HA 3OYKA 3F5TA 2OZSA 4B1WB 3VQQA 2F8TA 3KVGA 3VOVA 3OBYA 3T3FA 1QTMA 2FBYA 3HBTA 3TTFA 4I9QA 1A5XA 1TV6A 4NYFA 3VEXA 3K59A 1U6ZA 3F9KA 4KO0A 2PBDA 5CYQA 3NH0A 2O8EB 4K8ZA 1BQNA 3NH1A 4O0IA 1MDUB 3IFRA 4DTOA 3F73A 5M1FA 3KJVA 3IKMA 3P83D 4AF1A 2QWLA 3U6FA 3O9RA 4BR2A 1S1TA 3IAYA 3WXJA 4IJNA 1BCOA 1CLQA 3CFOA 3KKRA 2ZWHA 4DR7K 3CCMN 4YDUA 4FWRA 4KPYA 4M63C 1VQ5N 1TKZA 1NGJA 4NCBA 2JLEA 5CHIA 2LSNA 3DAWA 1YTAA 3CCRN 4HTUA 4RCHA 4DF8A 3AA5X 1T8EA 3OA9A 1JXEA 1QVGM 1CXUA 3L3UA 4ISFA 4A5BA 3S3NA 5ELZA 2IAJA 4JI6K 5C10A 3MN9A 2D5RA 5DM6L 3L0QA 4KHPK 1K8KB 4DR5K 4CESA 4XEIA 1HKCA 4C8OA 1H1VA 3IDHA 4LC9B 2QXLA 4DV1K 3GG4A 4QS9A 3PX6A 3LM9A 3AVFA 1JCEA 4FJIA 4F2RA 3WNGA 4N47A 3H1QA 3SLCA 4ELUA 3U9ZA 4DQRA 4EHUA 4Q5VA 4BRQA 3T19A 3OYEA 3MECA 2OTLN 3HVTA 4JI8K 1IG8A 4A62A 3VETA 4QOZB 2D0OA 5J2QA 3KD1E 4BR9A 1NGEA 2QKBA 4E1NA 2XO7A 1EETA 1IO2A 3G71N 4AHTA 1LWFA 2PY5A 1QQOA 3MX5A 4I7FA 4FLVA 3WEEA 5F1XA 4CHQA 4IZ9A 2AA4A 4JKFA 5AQFA 3AA4A 3VGMA 2P9SA 1KLNA 3ALYA 4M3TA 3FZFA 2YHWA 3DXKA 4RWTA 4FWQA 4CK2A 5AQQA 3I33A 1YTUA 4IFVA 1ZBUA 3TAPA 3OJSA 1QS4A 3O08A 2VYPA 3UKRA 1J6ZA 4CJ4A 3MK6A 1EQYA 3VA3A 4XH1A 1KVAA 3QLHA 1JKHA 5C15A 4DKWA 3OTOK 3NHGA 5JLFA 2E2NA 3J7AP 5GADP 1M90O 2YI1A 1SZ2A 2O8DB 5SWMA 1VSJA 1NGGA 4CZHA 4DSFA 4CBXA 2YJEA 3VGLA 3ATVA 4WE1A 3PX0A 3O3GA 4AHCA 4O5FA 3RWUA 3VQBA 2XRIA 1ESVA 1JLFA 4BE2A 1IG9A 1GOCA 2ZGZA 4KTZA 4KHUA 4LH4A 4CGHA 1RTIA 3QFPA 1LOTB 2QWRA 4FK0A 3UB5A 1SL1A 4BACA 4E7JA 3CIPA 2IOCA 3O3FA 1WUAA 3LP1A 5M1OA 1HNZK 1J5EK 2RHKA 2GUPA 1Z05A 4CGJA 2HNDA 4DLGA 1KAYA 2HBLA 3R3LA 1HKGA 4I6MA 3JSMA 3HYFA 4RW6A 3SYZA 2YKMA 5LMUK 1ZC6A 3Q7BA 3QO9A 1RBTA 5AQIA 3ZEUA 4FJHA 3A5LC 1RBUA 4KTWA 1VQLN 2Q31A 3IG1A 4IG3A 2P5GA 2FBXA 4MLHA 3RMBA 4K41A 4WYBA 2E1YA 5ADXH 1LV5A 4WQ5A 4CEZA 4TSXA 3EEQA 1NOYA 4OPAA 4JKGB 1VQ7N 4H0XB 1BCMA 1GLCG 1WSJA 1VSIA 4DSIA 1Q82O 1WSEA 4FWNA 3MEDA 1VSHA 4WQ4C 3W3DA 1RFQA 2WBNA 4DB3A 2E6LA 1NM1A 5JVGL 1EP4A 5FROA 4DF4A 2FSJA 4FK4A 3CM6A 3EN9A 2HHWA 3OYLA 1UAXA 2HHTA 4YFUA 4LF5K 3NFAA 4BDPA 4DFKA 1KAXA 4MDAA 1DT9A 1KQSM 2EX3A 3TTCA 1QSLA 1RDDA 2KQ2A 1JXBA 3I55N 4IFEA 2NRVA 3DRSA 3ZT2A 2GELA 4DCHA 3EL2A 4XH5A 1HKBA 4Y1CA 2B5JA 3T7ZA 3VTHA 2V7YA
chains in the Genus database with same CATH topology
1UA1A 3OS0A 1NOZA 3OYNA 1HNVA 3DLBA 3AO2A 4PQUA 2BANA 4O55A 3DLHA 3VQPA 1RT4A 4CJVA 3RR7A 3KK2A 3M8RA 4DS5A 2DY4A 3DLKA 4FJ5A 1NKBA 3V9SA 2RPIA 3VN5A 1KFSA 3C6UA 1NK9A 2PYLA 3D45A 4CJEA 1IKXA 3DYAA 4W5QA 1B92A 2VG5A 3LPTA 4FLZA 3QNNA 1T03A 3TAGA 2OA8A 1S5JA 4CECA 1NK4A 4CJRA 1D9FA 1W0HA 2YNHA 3VQAA 2G8KA 4CJWA 4FJMA 3HP9A 4DTRA 2F96A 1WAFA 4ID5A 3CFRA 3QIOA 5HP1A 1GOBA 1WAJA 4OPKA 1WSGA 4DFPA 2EHGA 2D0CA 3I0SA 2GBZA 2AJQA 3OY9A 1TAUA 3CYMA 3KLEA 2BE2A 3I8DA 4M3UA 4OGCA 2ZQBA 3ZSOA 4BWJA 3VQDA 2A1RA 4CJQA 3OYAA 1EKEA 1KVCA 1XHZA 1IKWA 4IDKA 1JLEA 3CG7A 1WN7A 2X6SA 3LP3A 4OKKA 5J2MA 3HPGA 4E0DA 3RRGA 4LSLA 2FBTA 3ZT1A 4DFMA 1N5YA 5HBMA 1QHTA 3IRXA 1NKEA 1L5UA 5D3GA 5C25A 4FJ9A 4I2QA 4KAZA 4ELVA 4E3SA 4ID1A 1KLMA 3ZSQA 5CY4A 3SZ2A 4OLBA 3AVBA 4KI6A 2F8SA 4F4KA 1FKPA 4KI4A 1XI1A 3SUOA 5CZ2A 1FKOA 1TKDA 1NJXA 3OYBA 3E01A 3M8SA 4CCHA 2G8IA 4HUGA 4E7KA 4AHSA 2VG7A 4FJNA 4Z4IA 1ASUA 4FXDA 2HNYA 4Q0BA 3B6OA 5KGXA 4B8AB 1QQCA 2P1JA 4DQIA 1ZBHA 3DI6A 4E7LA 4KB1A 1GOAA 3V1OA 4B9SA 3VQ5A 4CGFA 3I0RA 1NK5A 3LWLA 3V4IA 1NK7A 3NF9A 4FLTA 3SV3A 4C8LA 4NCAA 1RDAA 1HJRA 3KLGA 1I39A 3OYJA 3NBPA 3NCIA 3TAFA 4M3XA 3DRPA 4JS4A 1SV5A 3AV9A 2DFFA 1NK8A 3LAMA 4H8KA 1NJZA 4B9UA 5DK5A 3SQ2A 2YKNA 5FDLA 1HYVA 4BE0A 3HPOA 1HQEA 2VG6A 2VWJA 2HB5A 1TAQA 3QINA 3LWMA 4NYNA 3EZ5A 4BE1A 4CK3A 1XWLA 4HHTA 1HMVA 3K5NA 2QKKA 4FJ8A 4B9NA 4DTNA 3OYGA 3HM9A 4J2AA 3KK1A 1RT7A 1S9EA 4DU1A 4DTJA 3PX0A 4CF1A 3KD5E 4FZZA 3SI6A 4EP4A 1RCHA 3AVAA 4O4GA 2G8WA 4FZXC 3AVHA 1RDCA 3HK2A 4F3TA 4N5SA 3KIOA 1TL1A 4MQ3A 2KZZA 4QCLA 4KHNA 4M42A 1JL2A 5DMRA 4K8XA 4DG1A 2IS3A 3FFIA 4FJLA 2X6NA 3NAEA 4KHQA 1RILA 4CFBA 4XIUA 1XC9A 2R7YA 4DWIA 1WSFA 3PO5A 1C1CA 4O44A 1ASVA 1EX4A 1J53A 4IG0A 1JLAA 1SKRA 3BDPA 4PWDA 3MXIA 4CHPA 3NDKA 4DTXA 1CZBA 3LAKA 1L3UA 5C42A 2DFHA 2G8VA 4J2DA 1LAWA 2IDOA 4CGDA 4CJPA 3QEWA 3QETA 4G1QA 1C1BA 3VQ6A 3TARA 3L2QA 3RRHA 1C6VA 1U4BA 3K2PA 2HHSA 3MEGA 2ATQA 3B6PA 1BQMA 2X74A 1X9WA 1TGOA 1HYSA 1G15A 3ASMA 2BDPA 4AILC 4CFAA 2HW3A 4M3YA 1Y97A 4B9LA 1VSFA 2W42A 3TANA 4CERA 3RMAA 4N76A 3TR8A 4ZTJA 4BDYA 4CJTA 1BL3A 3P1GA 1X1PA 4Z4CA 1RT5A 4OKJA 3O3HA 3D0PA 1WNSA 3S9HA 1LWEA 3MXJA 3HT3A 4E1MA 3LANA 1TK0A 3OYKA 2G8HA 2OZSA 3VQQA 3AO3A 2F8TA 4CK1A 3T3FA 3AA2A 3M8PA 4LY7A 2FBYA 1QTMA 4GVMA 4FCYA 4I9QA 3NF8A 1RBVA 1A5XA 3OYDA 4JRQA 1TV6A 2RF2A 4NYFA 2YHBA 4HUEA 3K59A 3F9KA 4KTQA 1QSYA 4O5BA 5K14A 4KO0A 3DRRA 5CYQA 4AHVA 3NH0A 1RT6A 4K8ZA 1BQNA 5FRMA 1ITGA 3NH1A 3VQCA 4O0IA 3LALA 3DM2A 3TAEA 4IKFA 4Z4EA 4DTOA 3F73A 1A5WA 4C8MA 1S1XA 5JS2A 2OPRA 2X78A 2QXFA 4CJKA 2P51A 3C95A 3KJVA 3P83D 4FW1A 3SQ1A 2I5JA 4FM2A 3AO5A 3U6FA 1HPZA 5KRSA 2Z1GA 4I2PA 1UWBA 4KRFA 3ZSYA 4FLWA 1S1TA 1KVBA 4I9LA 1R0AA 3IAYA 2FBVA 2D0AA 2XY6A 1LW0A 1BCOA 4B9VA 3KLFA 3UIQA 4HCBA 3AVNA 4M3ZA 3K5LA 1CLQA 3CFOA 3KKRA 3DLRA 1O1WA 3P5JA 4PA1A 3SCXA 1YT3A 4KPYA 2Q3SA 1TKZA 3WNFA 3V1RA 3ZT3A 5I42A 1X9SA 3VQ9A 4NCBA 2JLEA 5SZTA 4DU3A 2LSNA 3ISNC 4MFBA 1S1UA 5HROA 2XY8A 1S6PA 1YTAA 4FM0A 4OVLA 4HTUA 1JLBA 4DF8A 3AA5X 1T8EA 1XHXA 4Z4FA 4CEQA 3KTQA 1JXEA 1RBSA 3HXMA 4B9TA 1CXUA 3L3UA 1QSSA 2HHXA 2P5OA 4CHZA 3S3NA 1SUQA 1ZBLA 1WLJA 1IKYA 2O4IA 1TL3A 2G8FA 4CE9A 4CHOA 3VQEA 3SV4A 3CFPA 2IAJA 3SUNA 3K57A 4PY5A 3MXMA 3THVA 2D5RA 3C6TA 3T1AA 2B4JA 2RKIA 3H08A 4CESA 1J54A 4IFYA 4EP5A 4R5PA 4CGIA 4B9MA 4FW2A 4C8OA 3SQ4A 4CF8A 4JRPA 4B8CA 4CIFA 4C8NA 3KLHA 3PX6A 3PUFA 4CJSA 3BGRA 3SPYA 4E19A 1UOCA 3TWHA 4OKEA 3AVFA 3ITHA 4FJIA 3WNEA 4F2RA 3RTVA 3WNGA 4EZ6A 4F2SA 2ITGA 1SL0A 2HVIA 4JS5A 4N47A 3LZJA 3PV8A 2HNZA 4ELUA 4DQRA 1IKVA 5CYMA 3VQ4A 4Q5VA 1RDBA 2KFZA 4RW4A 1N6QA 3T19A 2YV0X 3OYEA 1K6YA 3NGZA 3MECA 2Y1JA 3HVTA 1FK9A 1U45A 1RBRA 4ELTA 4B3OA 4QOZB 3NGIA 1BISA 4FK2A 4KHSA 5J2QA 3KD1E 2QKBA 4RW8A 1W9HA 3KK3A 4M45A 3QIPA 1JLCA 1KTQA 1BIZA 4CJ5A 4E1NA 4KHYA 2XO7A 4Y1DA 1RTDA 4J2EA 4CFCA 2Z1HA 1VSKA 1SKSA 1EETA 4DQPA 1ZBIA 1IO2A 3AVCA 2E4LA 4CFDA 4FJJA 3AVGA 4AHTA 1LWFA 5HRRA 1Q8IA 5E41A 1TVRA 2YNIA 3VA0A 3SPZA 1T05A 2PY5A 3TAMA 5J1EA 1X9MA 4I7FA 4FLVA 3QEPA 5JS1A 4FZYA 4CHQA 5J2PA 4PUOA 2JGUA 3CQ8A 1J9AA 3AA4A 2Z1IA 1Z26A 1RTJA 4M41A 1ZYQA 1NJYA 1D9DA 1C0UA 4QAGA 4CEDA 1NK0A 1KLNA 4Z4GA 2KZMA 4RW9A 3ALYA 4DFJA 4M3TA 3DLEA 3AVJA 2HVHA 3VQ7A 4W5RA 4CK2A 1SKWA 2GUIA 2E6MA 5I3UA 1HYZA 5KRTA 1RTHA 3L3VA 1YTUA 4CIGA 4IFVA 1ZBUA 3TAPA 3K5OA 3OJSA 4FYDA 3RMCA 3QERA 1QS4A 4CF0A 4GMJB 1IH7A 4H4MA 4OJRA 4CJ4A 4CGGA 1U49A 3VA3A 5CZ1A 1KVAA 3QLHA 3LZIA 3SQ0A 4CIEA 3ZSWA 4DS4A 1C1AA 3CM5A 1JKHA 3NGYA 2BGGA 2GV9A 1BIUA 3ZT0A 1A5VA 3NHGA 4CEBA 1QE1A 2NUBA 1KSPA 4AH9A 1KCFA 2OZMA 4J2BA 1HNIA 4KFBA 1U04A 1TKXA 3LP0A 4M3WA 4FLUA 2OYQA 5SWMA 1RT3A 1VSJA 4DTUA 3QEXA 3AO1A 3HP6A 2XHBA 1NKCA 4DMNA 3L2VA 3ZSRA 4DSFA 4FJKA 1DLOA 3NF6A 2PZSA 4Z4HA 3G10A 2XY5A 4FJGA 2YNGA 2RN2A 4WE1A 3O4NA 3K5MA 1TK5A 1Z25A 3M8QA 3VQ8A 1Q9XA 5EU7A 4EZ9A 4DQSA 2ZE2A 3AVLA 3L2WA 3O3GA 1C0MA 3G0ZA 4AHCA 3OYMA 5HRNA 2G8UA 4AHRA 3VQBA 2XRIA 3RWUA 1VK0A 1L3VA 2YNFA 4C8KA 2QK9A 4FM1A 1JLFA 3IS9A 3RR8A 1NJWA 4BE2A 3AO4A 4KKOA 1S9GA 1DTTA 4CJFA 3V81A 4ZHRA 4LSNA 1IG9A 3AVKA 2FC0A 1VSDA 1GOCA 4CHYA 4KHUA 4KTZA 3OJUA 3AVIA 3S3OA 2Z1JA 3PY8A 3DOKA 2HHVA 1YVUA 2A1SA 3QNOA 1RT2A 4LH4A 4CGHA 3ZT4A 4DSKA 3SNNA 1RTIA 4O0JA 1WSIA 5KTQA 1BI4B 4UQGA 3HL8A 3QEVA 4DQQA 3AVMA 5C24A 1UA0A 4FK0A 1CXQA 1SL1A 4JLHA 3OVNA 3V1QA 1TK8A 3C94A 1MU2A 2ZD1A 4CJ3A 1BGXT 3EYZA 3QEIA 3PO4A 2DTUA 4BACA 1FXXA 2YHAA 4E7JA 4KB0A 2IOCA 3O3FA 3LP2A 3LP1A 2KW4A 1S1VA 4DTSA 4NCGA 3V9ZA 1NK6A 2IC3A 4ZTFA 4CGJA 1F21A 2HNDA 3L2RA 3LDSA 4DLGA 4DTMA 2KFNA 4KHWA 3JSMA 4CJLA 3HYFA 2B6AA 4RW6A 3SYZA 1B9DA 4W5NA 2YKMA 3O4QA 1HQUA 1BI4A 3SUPA 4Z0UA 4M3RA 3QO9A 1RBTA 2PYJA 2XY7A 1L3TA 4FJHA 4W5OA 2OPPA 4HVJA 1RBUA 4KTWA 1J5OA 2O4GA 3HSTB 3IG1A 3TI0A 1SL2A 3SJJA 3A2FA 4IG3A 3SUQA 2P5GA 2VWKA 3HO1A 2FBXA 1C0TA 3OS1A 3S3MA 2HMIA 4FJXA 3RMBA 3NH2A 4HCCA 4E7HA 3ZSZA 1LV5A 3HPHA 3U3YA 1HRHA 3OS2A 3RMDA 1D8YA 4CEZA 2ETJA 2WONA 3U3GA 3ULDA 4TSXA 3V9XA 2HHQA 3MEEA 1I3AA 4CJUA 4F3OA 3PX4A 1NOYA 4CHNA 5KI6A 4KV8A 4L8RB 3OYFA 4HUFA 4CEOA 1TKTA 3ZSXA 1BCMA 4AHUA 4OLAA 1Q9YA 4BWMA 3NF7A 1WSJA 1WSHA 3TABA 1VSIA 3WNHA 1LWCA 2OPQA 3ZSVA 4DSIA 2DFEA 4GW6A 1WSEA 1RNHA 4N56A 3MEDA 5J2NA 1VSHA 1ZBFA 2OPSA 4H4OA 3HJFA 3JYTA 4FLYA 4RW7A 4DU4A 4F8RA 1LW2A 1RT1A 3OYHA 5KGWA 5FRNA 2E6LA 3EY1A 4LD0A 1D5AA 4CF9A 4W5TA 1EP4A 5FROA 4DF4A 4OPJA 2IGIA 4FK4A 1CZ9A 1VRTA 1DTQA 3NE6A 3CM6A 3LPUA 1L3SA 3V6DA 2HHWA 3OYLA 4DLEA 1U48A 1UAXA 2HHTA 4YFUA 3L8BA 4FVMA 3NFAA 4DSEA 1VRUA 1JLQA 2Y1IA 3V9UA 4DFKA 4BDPA 4DSLA 5HLFA 5HRPA 2HHUA 4ICLA 1S1WA 4CEEA 1EXQA 4E7IA 1BHLA 4CF2A 3OYCA 2D0BA 2EX3A 1JLGA 3OYIA 4KREA 1JL1A 2WOMA 1QSLA 3KLIA 4IBNA 4B08A 3DOLA 4E89A 1RDDA 1VSLA 2KQ2A 1JXBA 1U47A 3HVRA 4CEAA 1VSMA 3K58A 1S6QA 3DRSA 3ZT2A 4BDZA 3DLGA 2KTQA 1B9FA 3ZCMA 4FJ7A 1KRPA 4DTPA 4YNQA 4DSJA 1ASWA 1LAVA 1T7PA 3AA3A 3KKSA 3TAQA 4RG8A 1VSEA 4LH5A 1REVA 3L2UA 4Y1CA 2B5JA 3V9WA 4N41A 3DMJA 3MAQA 3QESA 1KFDA 5T7BA 4CEFA 4OGEA 4FLXA 5HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UA1 A;  3OS0 A;  1NOZ A;  3OYN A;  1HNV A;  3DLB A;  3AO2 A;  4PQU A;  2BAN A;  4O55 A;  3DLH A;  3VQP A;  1RT4 A;  4CJV A;  3RR7 A;  3KK2 A;  3M8R A;  4DS5 A;  2DY4 A;  3DLK A;  4FJ5 A;  1NKB A;  3V9S A;  2RPI A;  3VN5 A;  1KFS A;  3C6U A;  1NK9 A;  2PYL A;  3D45 A;  4CJE A;  1IKX A;  3DYA A;  4W5Q A;  1B92 A;  2VG5 A;  3LPT A;  4FLZ A;  3QNN A;  1T03 A;  3TAG A;  2OA8 A;  1S5J A;  4CEC A;  1NK4 A;  4CJR A;  1D9F A;  1W0H A;  2YNH A;  3VQA A;  2G8K A;  4CJW A;  4FJM A;  3HP9 A;  4DTR A;  2F96 A;  1WAF A;  4ID5 A;  3CFR A;  3QIO A;  5HP1 A;  1GOB A;  1WAJ A;  4OPK A;  1WSG A;  4DFP A;  2EHG A;  2D0C A;  3I0S A;  2GBZ A;  2AJQ A;  3OY9 A;  1TAU A;  3CYM A;  3KLE A;  2BE2 A;  3I8D A;  4M3U A;  4OGC A;  2ZQB A;  3ZSO A;  4BWJ A;  3VQD A;  2A1R A;  4CJQ A;  3OYA A;  1EKE A;  1KVC A;  1XHZ A;  1IKW A;  4IDK A;  1JLE A;  3CG7 A;  1WN7 A;  2X6S A;  3LP3 A;  4OKK A;  5J2M A;  3HPG A;  4E0D A;  3RRG A;  4LSL A;  2FBT A;  3ZT1 A;  4DFM A;  1N5Y A;  5HBM A;  1QHT A;  3IRX A;  1NKE A;  1L5U A;  5D3G A;  5C25 A;  4FJ9 A;  4I2Q A;  4KAZ A;  4ELV A;  4E3S A;  4ID1 A;  1KLM A;  3ZSQ A;  5CY4 A;  3SZ2 A;  4OLB A;  3AVB A;  4KI6 A;  2F8S A;  4F4K A;  1FKP A;  4KI4 A;  1XI1 A;  3SUO A;  5CZ2 A;  1FKO A;  1TKD A;  1NJX A;  3OYB A;  3E01 A;  3M8S A;  4CCH A;  2G8I A;  4HUG A;  4E7K A;  4AHS A;  2VG7 A;  4FJN A;  4Z4I A;  1ASU A;  4FXD A;  2HNY A;  4Q0B A;  3B6O A;  5KGX A;  4B8A B;  1QQC A;  2P1J A;  4DQI A;  1ZBH A;  3DI6 A;  4E7L A;  4KB1 A;  1GOA A;  3V1O A;  4B9S A;  3VQ5 A;  4CGF A;  3I0R A;  1NK5 A;  3LWL A;  3V4I A;  1NK7 A;  3NF9 A;  4FLT A;  3SV3 A;  4C8L A;  4NCA A;  1RDA A;  1HJR A;  3KLG A;  1I39 A;  3OYJ A;  3NBP A;  3NCI A;  3TAF A;  4M3X A;  3DRP A;  4JS4 A;  1SV5 A;  3AV9 A;  2DFF A;  1NK8 A;  3LAM A;  4H8K A;  1NJZ A;  4B9U A;  5DK5 A;  3SQ2 A;  2YKN A;  5FDL A;  1HYV A;  4BE0 A;  3HPO A;  1HQE A;  2VG6 A;  2VWJ A;  2HB5 A;  1TAQ A;  3QIN A;  3LWM A;  4NYN A;  3EZ5 A;  4BE1 A;  4CK3 A;  1XWL A;  4HHT A;  1HMV A;  3K5N A;  2QKK A;  4FJ8 A;  4B9N A;  4DTN A;  3OYG A;  3HM9 A;  4J2A A;  3KK1 A;  1RT7 A;  1S9E A;  4DU1 A;  4DTJ A;  3PX0 A;  4CF1 A;  3KD5 E;  4FZZ A;  3SI6 A;  4EP4 A;  1RCH A;  3AVA A;  4O4G A;  2G8W A;  4FZX C;  3AVH A;  1RDC A;  3HK2 A;  4F3T A;  4N5S A;  3KIO A;  1TL1 A;  4MQ3 A;  2KZZ A;  4QCL A;  4KHN A;  4M42 A;  1JL2 A;  5DMR A;  4K8X A;  4DG1 A;  2IS3 A;  3FFI A;  4FJL A;  2X6N A;  3NAE A;  4KHQ A;  1RIL A;  4CFB A;  4XIU A;  1XC9 A;  2R7Y A;  4DWI A;  1WSF A;  3PO5 A;  1C1C A;  4O44 A;  1ASV A;  1EX4 A;  1J53 A;  4IG0 A;  1JLA A;  1SKR A;  3BDP A;  4PWD A;  3MXI A;  4CHP A;  3NDK A;  4DTX A;  1CZB A;  3LAK A;  1L3U A;  5C42 A;  2DFH A;  2G8V A;  4J2D A;  1LAW A;  2IDO A;  4CGD A;  4CJP A;  3QEW A;  3QET A;  4G1Q A;  1C1B A;  3VQ6 A;  3TAR A;  3L2Q A;  3RRH A;  1C6V A;  1U4B A;  3K2P A;  2HHS A;  3MEG A;  2ATQ A;  3B6P A;  1BQM A;  2X74 A;  1X9W A;  1TGO A;  1HYS A;  1G15 A;  3ASM A;  2BDP A;  4AIL C;  4CFA A;  2HW3 A;  4M3Y A;  1Y97 A;  4B9L A;  1VSF A;  2W42 A;  3TAN A;  4CER A;  3RMA A;  4N76 A;  3TR8 A;  4ZTJ A;  4BDY A;  4CJT A;  1BL3 A;  3P1G A;  1X1P A;  4Z4C A;  1RT5 A;  4OKJ A;  3O3H A;  3D0P A;  1WNS A;  3S9H A;  1LWE A;  3MXJ A;  3HT3 A;  4E1M A;  3LAN A;  1TK0 A;  3OYK A;  2G8H A;  2OZS A;  3VQQ A;  3AO3 A;  2F8T A;  4CK1 A;  3T3F A;  3AA2 A;  3M8P A;  4LY7 A;  2FBY A;  1QTM A;  4GVM A;  4FCY A;  4I9Q A;  3NF8 A;  1RBV A;  1A5X A;  3OYD A;  4JRQ A;  1TV6 A;  2RF2 A;  4NYF A;  2YHB A;  4HUE A;  3K59 A;  3F9K A;  4KTQ A;  1QSY A;  4O5B A;  5K14 A;  4KO0 A;  3DRR A;  5CYQ A;  4AHV A;  3NH0 A;  1RT6 A;  4K8Z A;  1BQN A;  5FRM A;  1ITG A;  3NH1 A;  3VQC A;  4O0I A;  3LAL A;  3DM2 A;  3TAE A;  4IKF A;  4Z4E A;  4DTO A;  3F73 A;  1A5W A;  4C8M A;  1S1X A;  5JS2 A;  2OPR A;  2X78 A;  2QXF A;  4CJK A;  2P51 A;  3C95 A;  3KJV A;  3P83 D;  4FW1 A;  3SQ1 A;  2I5J A;  4FM2 A;  3AO5 A;  3U6F A;  1HPZ A;  5KRS A;  2Z1G A;  4I2P A;  1UWB A;  4KRF A;  3ZSY A;  4FLW A;  1S1T A;  1KVB A;  4I9L A;  1R0A A;  3IAY A;  2FBV A;  2D0A A;  2XY6 A;  1LW0 A;  1BCO A;  4B9V A;  3KLF A;  3UIQ A;  4HCB A;  3AVN A;  4M3Z A;  3K5L A;  1CLQ A;  3CFO A;  3KKR A;  3DLR A;  1O1W A;  3P5J A;  4PA1 A;  3SCX A;  1YT3 A;  4KPY A;  2Q3S A;  1TKZ A;  3WNF A;  3V1R A;  3ZT3 A;  5I42 A;  1X9S A;  3VQ9 A;  4NCB A;  2JLE A;  5SZT A;  4DU3 A;  2LSN A;  3ISN C;  4MFB A;  1S1U A;  5HRO A;  2XY8 A;  1S6P A;  1YTA A;  4FM0 A;  4OVL A;  4HTU A;  1JLB A;  4DF8 A;  3AA5 X;  1T8E A;  1XHX A;  4Z4F A;  4CEQ A;  3KTQ A;  1JXE A;  1RBS A;  3HXM A;  4B9T A;  1CXU A;  3L3U A;  1QSS A;  2HHX A;  2P5O A;  4CHZ A;  3S3N A;  1SUQ A;  1ZBL A;  1WLJ A;  1IKY A;  2O4I A;  1TL3 A;  2G8F A;  4CE9 A;  4CHO A;  3VQE A;  3SV4 A;  3CFP A;  2IAJ A;  3SUN A;  3K57 A;  4PY5 A;  3MXM A;  3THV A;  2D5R A;  3C6T A;  3T1A A;  2B4J A;  2RKI A;  3H08 A;  4CES A;  1J54 A;  4IFY A;  4EP5 A;  4R5P A;  4CGI A;  4B9M A;  4FW2 A;  4C8O A;  3SQ4 A;  4CF8 A;  4JRP A;  4B8C A;  4CIF A;  4C8N A;  3KLH A;  3PX6 A;  3PUF A;  4CJS A;  3BGR A;  3SPY A;  4E19 A;  1UOC A;  3TWH A;  4OKE A;  3AVF A;  3ITH A;  4FJI A;  3WNE A;  4F2R A;  3RTV A;  3WNG A;  4EZ6 A;  4F2S A;  2ITG A;  1SL0 A;  2HVI A;  4JS5 A;  4N47 A;  3LZJ A;  3PV8 A;  2HNZ A;  4ELU A;  4DQR A;  1IKV A;  5CYM A;  3VQ4 A;  4Q5V A;  1RDB A;  2KFZ A;  4RW4 A;  1N6Q A;  3T19 A;  2YV0 X;  3OYE A;  1K6Y A;  3NGZ A;  3MEC A;  2Y1J A;  3HVT A;  1FK9 A;  1U45 A;  1RBR A;  4ELT A;  4B3O A;  4QOZ B;  3NGI A;  1BIS A;  4FK2 A;  4KHS A;  5J2Q A;  3KD1 E;  2QKB A;  4RW8 A;  1W9H A;  3KK3 A;  4M45 A;  3QIP A;  1JLC A;  1KTQ A;  1BIZ A;  4CJ5 A;  4E1N A;  4KHY A;  2XO7 A;  4Y1D A;  1RTD A;  4J2E A;  4CFC A;  2Z1H A;  1VSK A;  1SKS A;  1EET A;  4DQP A;  1ZBI A;  1IO2 A;  3AVC A;  2E4L A;  4CFD A;  4FJJ A;  3AVG A;  4AHT A;  1LWF A;  5HRR A;  1Q8I A;  5E41 A;  1TVR A;  2YNI A;  3VA0 A;  3SPZ A;  1T05 A;  2PY5 A;  3TAM A;  5J1E A;  1X9M A;  4I7F A;  4FLV A;  3QEP A;  5JS1 A;  4FZY A;  4CHQ A;  5J2P A;  4PUO A;  2JGU A;  3CQ8 A;  1J9A A;  3AA4 A;  2Z1I A;  1Z26 A;  1RTJ A;  4M41 A;  1ZYQ A;  1NJY A;  1D9D A;  1C0U A;  4QAG A;  4CED A;  1NK0 A;  1KLN A;  4Z4G A;  2KZM A;  4RW9 A;  3ALY A;  4DFJ A;  4M3T A;  3DLE A;  3AVJ A;  2HVH A;  3VQ7 A;  4W5R A;  4CK2 A;  1SKW A;  2GUI A;  2E6M A;  5I3U A;  1HYZ A;  5KRT A;  1RTH A;  3L3V A;  1YTU A;  4CIG A;  4IFV A;  1ZBU A;  3TAP A;  3K5O A;  3OJS A;  4FYD A;  3RMC A;  3QER A;  1QS4 A;  4CF0 A;  4GMJ B;  1IH7 A;  4H4M A;  4OJR A;  4CJ4 A;  4CGG A;  1U49 A;  3VA3 A;  5CZ1 A;  1KVA A;  3QLH A;  3LZI A;  3SQ0 A;  4CIE A;  3ZSW A;  4DS4 A;  1C1A A;  3CM5 A;  1JKH A;  3NGY A;  2BGG A;  2GV9 A;  1BIU A;  3ZT0 A;  1A5V A;  3NHG A;  4CEB A;  1QE1 A;  2NUB A;  1KSP A;  4AH9 A;  1KCF A;  2OZM A;  4J2B A;  1HNI A;  4KFB A;  1U04 A;  1TKX A;  3LP0 A;  4M3W A;  4FLU A;  2OYQ A;  5SWM A;  1RT3 A;  1VSJ A;  4DTU A;  3QEX A;  3AO1 A;  3HP6 A;  2XHB A;  1NKC A;  4DMN A;  3L2V A;  3ZSR A;  4DSF A;  4FJK A;  1DLO A;  3NF6 A;  2PZS A;  4Z4H A;  3G10 A;  2XY5 A;  4FJG A;  2YNG A;  2RN2 A;  4WE1 A;  3O4N A;  3K5M A;  1TK5 A;  1Z25 A;  3M8Q A;  3VQ8 A;  1Q9X A;  5EU7 A;  4EZ9 A;  4DQS A;  2ZE2 A;  3AVL A;  3L2W A;  3O3G A;  1C0M A;  3G0Z A;  4AHC A;  3OYM A;  5HRN A;  2G8U A;  4AHR A;  3VQB A;  2XRI A;  3RWU A;  1VK0 A;  1L3V A;  2YNF A;  4C8K A;  2QK9 A;  4FM1 A;  1JLF A;  3IS9 A;  3RR8 A;  1NJW A;  4BE2 A;  3AO4 A;  4KKO A;  1S9G A;  1DTT A;  4CJF A;  3V81 A;  4ZHR A;  4LSN A;  1IG9 A;  3AVK A;  2FC0 A;  1VSD A;  1GOC A;  4CHY A;  4KHU A;  4KTZ A;  3OJU A;  3AVI A;  3S3O A;  2Z1J A;  3PY8 A;  3DOK A;  2HHV A;  1YVU A;  2A1S A;  3QNO A;  1RT2 A;  4LH4 A;  4CGH A;  3ZT4 A;  4DSK A;  3SNN A;  1RTI A;  4O0J A;  1WSI A;  5KTQ A;  1BI4 B;  4UQG A;  3HL8 A;  3QEV A;  4DQQ A;  3AVM A;  5C24 A;  1UA0 A;  4FK0 A;  1CXQ A;  1SL1 A;  4JLH A;  3OVN A;  3V1Q A;  1TK8 A;  3C94 A;  1MU2 A;  2ZD1 A;  4CJ3 A;  1BGX T;  3EYZ A;  3QEI A;  3PO4 A;  2DTU A;  4BAC A;  1FXX A;  2YHA A;  4E7J A;  4KB0 A;  2IOC A;  3O3F A;  3LP2 A;  3LP1 A;  2KW4 A;  1S1V A;  4DTS A;  4NCG A;  3V9Z A;  1NK6 A;  2IC3 A;  4ZTF A;  4CGJ A;  1F21 A;  2HND A;  3L2R A;  3LDS A;  4DLG A;  4DTM A;  2KFN A;  4KHW A;  3JSM A;  4CJL A;  3HYF A;  2B6A A;  4RW6 A;  3SYZ A;  1B9D A;  4W5N A;  2YKM A;  3O4Q A;  1HQU A;  1BI4 A;  3SUP A;  4Z0U A;  4M3R A;  3QO9 A;  1RBT A;  2PYJ A;  2XY7 A;  1L3T A;  4FJH A;  4W5O A;  2OPP A;  4HVJ A;  1RBU A;  4KTW A;  1J5O A;  2O4G A;  3HST B;  3IG1 A;  3TI0 A;  1SL2 A;  3SJJ A;  3A2F A;  4IG3 A;  3SUQ A;  2P5G A;  2VWK A;  3HO1 A;  2FBX A;  1C0T A;  3OS1 A;  3S3M A;  2HMI A;  4FJX A;  3RMB A;  3NH2 A;  4HCC A;  4E7H A;  3ZSZ A;  1LV5 A;  3HPH A;  3U3Y A;  1HRH A;  3OS2 A;  3RMD A;  1D8Y A;  4CEZ A;  2ETJ A;  2WON A;  3U3G A;  3ULD A;  4TSX A;  3V9X A;  2HHQ A;  3MEE A;  1I3A A;  4CJU A;  4F3O A;  3PX4 A;  1NOY A;  4CHN A;  5KI6 A;  4KV8 A;  4L8R B;  3OYF A;  4HUF A;  4CEO A;  1TKT A;  3ZSX A;  1BCM A;  4AHU A;  4OLA A;  1Q9Y A;  4BWM A;  3NF7 A;  1WSJ A;  1WSH A;  3TAB A;  1VSI A;  3WNH A;  1LWC A;  2OPQ A;  3ZSV A;  4DSI A;  2DFE A;  4GW6 A;  1WSE A;  1RNH A;  4N56 A;  3MED A;  5J2N A;  1VSH A;  1ZBF A;  2OPS A;  4H4O A;  3HJF A;  3JYT A;  4FLY A;  4RW7 A;  4DU4 A;  4F8R A;  1LW2 A;  1RT1 A;  3OYH A;  5KGW A;  5FRN A;  2E6L A;  3EY1 A;  4LD0 A;  1D5A A;  4CF9 A;  4W5T A;  1EP4 A;  5FRO A;  4DF4 A;  4OPJ A;  2IGI A;  4FK4 A;  1CZ9 A;  1VRT A;  1DTQ A;  3NE6 A;  3CM6 A;  3LPU A;  1L3S A;  3V6D A;  2HHW A;  3OYL A;  4DLE A;  1U48 A;  1UAX A;  2HHT A;  4YFU A;  3L8B A;  4FVM A;  3NFA A;  4DSE A;  1VRU A;  1JLQ A;  2Y1I A;  3V9U A;  4DFK A;  4BDP A;  4DSL A;  5HLF A;  5HRP A;  2HHU A;  4ICL A;  1S1W A;  4CEE A;  1EXQ A;  4E7I A;  1BHL A;  4CF2 A;  3OYC A;  2D0B A;  2EX3 A;  1JLG A;  3OYI A;  4KRE A;  1JL1 A;  2WOM A;  1QSL A;  3KLI A;  4IBN A;  4B08 A;  3DOL A;  4E89 A;  1RDD A;  1VSL A;  2KQ2 A;  1JXB A;  1U47 A;  3HVR A;  4CEA A;  1VSM A;  3K58 A;  1S6Q A;  3DRS A;  3ZT2 A;  4BDZ A;  3DLG A;  2KTQ A;  1B9F A;  3ZCM A;  4FJ7 A;  1KRP A;  4DTP A;  4YNQ A;  4DSJ A;  1ASW A;  1LAV A;  1T7P A;  3AA3 A;  3KKS A;  3TAQ A;  4RG8 A;  1VSE A;  4LH5 A;  1REV A;  3L2U A;  4Y1C A;  2B5J A;  3V9W A;  4N41 A;  3DMJ A;  3MAQ A;  3QES A;  1KFD A;  5T7B A;  4CEF A;  4OGE A;  4FLX A;  5HRS A; 
#chains in the Genus database with same CATH topology
 1UA1 A;  4PQU A;  1HNV A;  3DLB A;  2V52 B;  3VQP A;  1RT4 A;  3RR7 A;  2QA4 N;  3M8R A;  3H3N O;  3WQT A;  3DLK A;  4FJ5 A;  3ENO A;  5AJ3 K;  4BGA A;  3D45 A;  1SAZ A;  1B92 A;  3TAG A;  1S5J A;  2W40 A;  1NK4 A;  3VQA A;  2HMP A;  3DXM A;  2F96 A;  3E9L A;  3CFR A;  1MWK A;  1WAJ A;  4Z94 A;  5ADX A;  2GBZ A;  3CME N;  1NNE A;  3VMF B;  3T1Y K;  2BE2 A;  2ZQB A;  5AQZ A;  2V51 B;  4BWJ A;  3VQD A;  2A1R A;  4GV3 A;  3PLA A;  4CJQ A;  1KVC A;  1JLE A;  3LP3 A;  3G4S N;  3OW2 M;  3THX B;  4E0D A;  2E88 A;  4LSL A;  3ZT1 A;  1L5U A;  5D3G A;  5TKW A;  4FWK A;  5GIN A;  4H0T B;  5C25 A;  4I2Q A;  4KAZ A;  1OH8 A;  4ELV A;  4FJ9 A;  4OX9 K;  1ZXO A;  1KLM A;  3ENH A;  3ZSQ A;  4KI6 A;  4F4K A;  3ZX3 A;  1FKP A;  4KI4 A;  5CZ2 A;  2P9P A;  4B9Q A;  4RTF D;  3OYB A;  3E01 A;  4CCH A;  4JKA A;  4AHS A;  4WF9 L;  5AQO A;  1ASU A;  4FXD A;  5M1N A;  3CPW M;  2JWK A;  4B8A B;  4J8F A;  3QDK A;  4CGF A;  3I0R A;  1MWM A;  1QQN A;  4FLT A;  3EO3 A;  4NCA A;  3W0L A;  4DUY K;  4JS4 A;  2DFF A;  1NK8 A;  1HYV A;  1U2V B;  3HPO A;  3K9K A;  3HZ6 A;  1XNR K;  1NGF A;  2WFB A;  3EZ5 A;  4IO9 L;  4BE1 A;  4CZG A;  3PSI A;  4CK3 A;  3GBT A;  1TUY A;  3M1F A;  4DV0 K;  4IJA A;  1NU0 A;  4DTJ A;  5AZI A;  4FZZ A;  1RDU A;  4EP4 A;  4FZX C;  3HK2 A;  1RDC A;  4F3T A;  4DR3 K;  4QCL A;  4KHN A;  2F9W A;  1HX1 A;  2Q36 A;  1EX4 A;  3NDK A;  1X9J A;  4B1U B;  3EKU A;  1LAW A;  3F9M A;  2IDO A;  3CQX A;  2DPN A;  4G1Q A;  1FW6 A;  3TAR A;  1QQM A;  3L2Q A;  1N32 K;  4MDB A;  1VQ8 N;  3S41 A;  3KWG A;  1TGO A;  1HYS A;  1VSF A;  2W42 A;  4O8K A;  3TAN A;  4QS8 A;  3E1Y A;  5C0Y A;  4N76 A;  3BUZ B;  5KQ8 A;  4CZE A;  4BDY A;  4ZTJ A;  1BL3 A;  1X1P A;  3FE1 A;  3O3H A;  3D0P A;  4E1M A;  4H0Y B;  3MN6 A;  3AO3 A;  3VEN A;  3E9P A;  3AA2 A;  4LY7 A;  4NLB A;  4FCY A;  3ZLJ A;  3OYD A;  1NGA A;  1YJW N;  4KTQ A;  4O5B A;  4AHV A;  1ITG A;  3LAL A;  4LFA K;  2Q0U A;  1S1X A;  4CJK A;  3C95 A;  1YVN A;  3EE8 A;  3D2F A;  2I5J A;  4LFC K;  3CHW A;  4FLW A;  1KVB A;  1R0A A;  4NLC A;  4IO8 A;  3P39 A;  1LW0 A;  4B9V A;  3KLF A;  3K5L A;  4X62 K;  2KKZ A;  2UUB K;  3DLR A;  3P5J A;  1YT3 A;  5I42 A;  3VQ9 A;  4DU3 A;  2RE2 A;  1KC8 O;  4K42 A;  3O5B A;  4GVE A;  4Z4F A;  4CEQ A;  3KTQ A;  2HHX A;  4B3R K;  5HOO A;  1TL3 A;  5H1S Q;  2G8F A;  3O6W A;  3VQE A;  3SUN A;  3T1A A;  3H08 A;  4R5P A;  1J54 A;  4CF8 A;  3JAM O;  2QEX N;  2ASO A;  3SPY A;  4E19 A;  3SJH A;  3CJ1 A;  3I8B A;  3WNE A;  4F2S A;  3C7N A;  3RTV A;  2G8U A;  3WEE B;  3Q7C A;  1DEJ A;  3VQ4 A;  1RDB A;  1NGD A;  2Y1J A;  1FK9 A;  1U45 A;  3GL1 A;  4FOE A;  4IWV A;  2HOE A;  4AM6 A;  4FK2 A;  1GLB G;  4H5N A;  1W9H A;  4JK8 A;  3KK3 A;  3QIP A;  1JLC A;  1KTQ A;  1MA9 B;  4CJ5 A;  4KHY A;  5AQJ A;  1RTD A;  4CFC A;  5C12 A;  5E41 A;  1BOT O;  5J1E A;  1EWR A;  2QWP A;  2YX6 A;  4A61 A;  3QEP A;  4JI5 K;  3KZB A;  5J2P A;  4CZI A;  1D9D A;  1RTJ A;  4M41 A;  1NJY A;  4QAG A;  4CED A;  4RW9 A;  1SKW A;  1VQP N;  2GUI A;  4BRP A;  2E6M A;  1HYZ A;  2CH5 A;  5KRT A;  3SAF A;  3L3V A;  2IIR A;  4FYD A;  3QER A;  2O8B B;  4IOA L;  4GMJ B;  1IH7 A;  2CGJ A;  4CGG A;  5CZ1 A;  1N33 K;  4JYA K;  1KXP A;  3SQ0 A;  1GLL O;  3MCP A;  4JKE A;  3NGY A;  1BIU A;  1A5V A;  3IUC A;  4CEB A;  2NUB A;  1KSP A;  3FZL A;  4J2B A;  4BC3 A;  5JVH L;  5EX5 A;  4KFB A;  1P90 A;  2VQE K;  2OAN A;  4HTL A;  1VAZ A;  3LP0 A;  2D1K A;  4M3W A;  2OYQ A;  5LMN K;  3ULE B;  4DV4 K;  1N8R O;  3E9O A;  3NF6 A;  2ZJP L;  4JEP A;  2XY5 A;  2RN2 A;  3O4N A;  1TK5 A;  1Z25 A;  2QI2 A;  3M8Q A;  3MN5 A;  3VEO A;  3VQ8 A;  5EU7 A;  1Q9X A;  4DQS A;  2ZE2 A;  3ID8 A;  3L2W A;  3QBW A;  1C0M A;  3G0Z A;  4FL9 A;  5AFU H;  5HRN A;  3OYM A;  3CF5 L;  4C8K A;  2QK9 A;  3RSE A;  3AAQ A;  3IS9 A;  2Q2R A;  1YIT N;  1NJW A;  3RR8 A;  1S9G A;  3KK7 A;  4CJF A;  3V81 A;  3SMP A;  3FR0 A;  1YF5 L;  4BRN A;  4FWS A;  4F9O A;  2Z1J A;  3WXM B;  3DOK A;  4I6M B;  4BQL A;  3QNO A;  1T6D A;  4FPA A;  4DV6 K;  1ATN A;  3SNN A;  4BRA A;  4UQG A;  3TU5 A;  1CXQ A;  3V1Q A;  2BH1 A;  3CJC A;  2DTU A;  3EE9 A;  4H5T A;  3V9Z A;  1NK6 A;  4B1Y B;  4BC4 A;  2UUA K;  3E66 A;  1F21 A;  2O8F A;  3UKU A;  3HRG A;  2HST A;  4CJL A;  1B9D A;  2GWK A;  1RGI A;  1BI4 A;  3AAP A;  4Z0U A;  2XY7 A;  2P9U A;  2NZT A;  4HVJ A;  4LF4 K;  4A5A A;  4FPB A;  3O9U A;  4GNI A;  3NH2 A;  3CCE N;  3U3Y A;  2WON A;  3NVK A;  3MEE A;  2ZM6 K;  4IEE A;  5KPR A;  5AQR A;  4L8R B;  4CEO A;  4BRK A;  3J8A A;  1Q9Y A;  5AQP A;  3WNH A;  2VGN A;  4GY2 B;  3ZSV A;  4EAH D;  3AAR A;  4N56 A;  5C2F A;  5J2N A;  4H4O A;  1BA0 A;  3JYT A;  1QVF M;  4FLY A;  4RW7 A;  1YJ9 N;  3OYH A;  5FRN A;  5AFU A;  4YOT A;  2HBK A;  4C1N K;  2IGI A;  1CZ9 A;  1VRT A;  2A5X A;  3WXI A;  4FSV A;  2VGM A;  4DSE A;  4H5R A;  1JLQ A;  5HLF A;  5HRP A;  4ICL A;  3KHY A;  4CEE A;  4E7I A;  5AQM A;  1EWQ A;  1JLG A;  4KRE A;  2QWO A;  3KLI A;  3BP8 A;  5M1K A;  4E89 A;  1GLF O;  4CEA A;  3O80 A;  5AZJ A;  2KTQ A;  1B9F A;  3ZCM A;  4FJ7 A;  4DTP A;  2I7P A;  4DSJ A;  3DXM B;  1ASW A;  4RG8 A;  1VSE A;  2P9N A;  1REV A;  3LDQ A;  1QHA A;  3DMJ A;  3MAQ A;  3QES A;  3CC2 N;  1KFD A;  5T7B A;  4JI7 K;  3F2K A;  5JLH A;  2FF6 A;  1C0G A;  3EZW A;  2FSN A;  3DLH A;  4O55 A;  2QWN A;  3KK2 A;  4DS5 A;  3ZX2 A;  2DY4 A;  1NGI A;  2RPI A;  2V7Z A;  3VN5 A;  3C6U A;  1NK9 A;  5AQL A;  3O8M A;  1IKX A;  3DYA A;  4YY3 K;  3LDO A;  1D9F A;  4LFB K;  2YNH A;  4JI1 K;  4FJM A;  3T69 A;  4FWL A;  5F2R A;  1GOB A;  4DFP A;  2EHG A;  2BTF A;  2AJQ A;  3OY9 A;  3A5M C;  4OGC A;  5FPM A;  1NGC A;  3OYA A;  1EKE A;  5BR8 K;  1XQS C;  4PKI A;  4IDK A;  5J2M A;  1WN7 A;  2GTD A;  2P9I A;  2X6S A;  4FWM A;  3HPG A;  4K0K K;  4DFM A;  3IRX A;  4CW7 B;  4IOC L;  4ID1 A;  4LF8 K;  3BF3 A;  1NGB A;  2F8S A;  1XI1 A;  1FKO A;  1OKJ A;  4HUG A;  5BN9 A;  2VG7 A;  4FJN A;  1W7A A;  2HBM A;  1E3M A;  1BUP A;  1ZBH A;  3HI0 A;  3DI6 A;  4CD3 A;  4LF6 K;  5AZI B;  5BRF A;  1GOA A;  4KB1 A;  3VQ5 A;  4A57 A;  3LWL A;  1NK5 A;  4FO0 A;  3NF9 A;  4C8L A;  1HJR A;  1I39 A;  3NCI A;  2KHO A;  3TAF A;  4LF9 K;  2UYT A;  3AV9 A;  3SAH A;  5DK5 A;  4CZL A;  1IBK K;  2VG6 A;  2FSK A;  2VWJ A;  1TAQ A;  4IOX A;  4YOY A;  3EKS A;  5BRH A;  3CMA N;  3VES A;  1XWL A;  4FJ8 A;  1K8A O;  3J7Y P;  3OYG A;  4H0V B;  3KK1 A;  1S9E A;  4DU1 A;  3SI6 A;  4O4G A;  4ISE A;  2Q1N A;  3AVH A;  2VCP A;  2KZZ A;  4AQY K;  1K8K A;  4O8U A;  1JL2 A;  4DG1 A;  2IS3 A;  4FJL A;  2X6N A;  3NAE A;  2O8C A;  4KHQ A;  1W97 L;  4DV3 K;  1RIL A;  4CFB A;  4XIU A;  1XC9 A;  2R7Y A;  4DWI A;  1BO5 O;  3AGK A;  1C1C A;  1SKR A;  4GKJ K;  1JLA A;  4DV2 K;  2I7N A;  4DUZ K;  1L3U A;  5BPM A;  5F0X A;  4PKH A;  4B1Z A;  3TSU A;  3QEW A;  3QET A;  4YOV A;  3L4Q A;  1C6V A;  2PAV A;  2P9K B;  3K2P A;  1BU6 O;  3VTI A;  2ATQ A;  3B6P A;  1BQM A;  2X74 A;  4BR7 A;  3U9D A;  4X66 K;  2BDP A;  4WCE L;  3P4I A;  1Y97 A;  5EXW A;  5BN8 A;  3CQY A;  4CER A;  5GAE P;  1C0F A;  3P1G A;  4OKJ A;  3CC7 N;  1WNS A;  3S9H A;  1LWE A;  1TK0 A;  3HT3 A;  3LAN A;  5EY4 A;  3D7E O;  4WQ4 A;  4BC2 A;  4GVM A;  3NF8 A;  2RF2 A;  4PHT X;  3H3O B;  4HUE A;  4BRC A;  4BRE A;  3DRR A;  5FRM A;  3THW B;  3BEX A;  2QWQ A;  4JI2 K;  4IKF A;  4Z4E A;  4BVP A;  4C8M A;  5JS2 A;  2OPR A;  2X78 A;  2P51 A;  4GV9 A;  4FW1 A;  1ATR A;  4FM2 A;  1S22 A;  1YAG A;  1HPZ A;  5CR4 A;  5KRS A;  4WFB L;  4KRF A;  1UWB A;  4I9L A;  3DLL L;  2D0A A;  3CER A;  4A2A A;  3ZYY X;  4BG8 A;  3AVN A;  2IVN A;  4MLE A;  1O1W A;  4PA1 A;  2F7T A;  3WNF A;  3ZT3 A;  5A2Q O;  2VWB A;  5SZT A;  3C7N B;  3VF6 A;  1S6P A;  3VPZ A;  5JIC A;  4OVL A;  4BG9 A;  1XHX A;  3MN7 A;  1RBS A;  4B9T A;  1QSS A;  2P5O A;  1SUQ A;  3N4Q A;  1ZBL A;  1YIJ N;  4CE9 A;  4CHO A;  2P9L B;  4PY5 A;  3MXM A;  3THV A;  3C6T A;  2B4J A;  4EP5 A;  4K43 A;  4CBW A;  4DR4 K;  4JRP A;  4B8C A;  3O9T A;  4C8N A;  1HPM A;  3CCU N;  3D6R A;  1UOC A;  3TWH A;  4OKE A;  1XNQ K;  3PIO L;  4EZ6 A;  2ITG A;  3LL3 A;  1SL0 A;  4JS5 A;  2E2P A;  3LZJ A;  5FPN A;  3PV8 A;  2UUC K;  1IKV A;  5CYM A;  4RW4 A;  1K6Y A;  3TPQ A;  1HLU A;  1BIS A;  4KHS A;  1NWK A;  4RW8 A;  4M45 A;  1BIZ A;  4J2E A;  4Y1D A;  5AQY A;  4NXN K;  4FWP A;  1VSK A;  4JHD B;  3U8X A;  3AVC A;  5HRR A;  4CVN E;  2CH6 A;  1TVR A;  2YNI A;  3VA0 A;  3SPZ A;  1N36 K;  3TAM A;  1X9M A;  5JS1 A;  4FZY A;  2JGU A;  2Z1I A;  1Z26 A;  1ZYQ A;  4Z4G A;  1C0U A;  3GE1 A;  4DFJ A;  3DLE A;  3AVJ A;  2HVH A;  3QBX A;  2E20 A;  5FPD A;  1RTH A;  2FF3 B;  4GKK K;  5AQG A;  3R9P A;  5AQK A;  1OH5 A;  1S3X A;  1BA1 A;  1U49 A;  4JKG A;  4CIE A;  4DS4 A;  3RSE B;  1YI2 N;  1IV0 A;  1QE1 A;  4AH9 A;  2OZM A;  3VGK A;  1P8Z A;  4K25 A;  3BZK A;  1XUP O;  3CJ9 A;  3HP6 A;  1NKC A;  4DMN A;  1NMD A;  2PZS A;  2KLA A;  2YNG A;  2ASM A;  1NMN A;  4AHR A;  1NG9 A;  1L3V A;  2YNF A;  4IEI A;  5AQV A;  3CPE A;  3O4W A;  5GIP A;  4KKO A;  1DTT A;  4ZHR A;  2FC0 A;  3ZX0 A;  3AVI A;  3PY8 A;  1YVU A;  4O0J A;  1WSI A;  1BI4 B;  3QEV A;  3HL8 A;  4DQQ A;  3AVM A;  3AGR A;  5C24 A;  1YUW A;  4MO5 A;  2NNW A;  2PFU A;  4AM7 A;  4CJ3 A;  1BGX T;  3QEI A;  4A2B A;  4GV6 A;  5EVZ A;  3HOT A;  4YOW A;  3LM2 A;  2IC3 A;  4ZTF A;  3FZM A;  3ENB A;  2KFN A;  5MLC Q;  3CC4 N;  4B3M K;  4WFN L;  4KHW A;  4JD2 A;  2IVO A;  3MMV A;  4BRL A;  4BY9 C;  3O4Q A;  5M1P A;  3SUP A;  4M3R A;  2IVP A;  1L3T A;  4XH4 A;  1J5O A;  2P9S B;  3HST B;  1XMO K;  3SUQ A;  1C0T A;  3OS1 A;  3DXK B;  4KH6 A;  1IJJ A;  1GLA G;  4JN4 A;  2A42 A;  4E7H A;  1HRH A;  3OS2 A;  2ETJ A;  3U3G A;  2HHQ A;  2FLO A;  3UKR B;  4CJU A;  4F3O A;  3PX4 A;  4CHN A;  5KI6 A;  4KV8 A;  3OYF A;  4HUF A;  1I94 K;  3CJB A;  3VER A;  5GAG P;  3CJA A;  3ZSX A;  4AHU A;  4OLA A;  3LDL A;  3TAB A;  2OPQ A;  1K73 O;  2QW9 A;  1RNH A;  3HJF A;  2OPS A;  3WXK A;  5AZJ B;  5KPZ A;  3H6E A;  4DU4 A;  1K9M O;  1LW2 A;  3H46 O;  5I9E B;  5KGW A;  4DR2 K;  3EY1 A;  2ITM A;  1D5A A;  4W5T A;  1S72 N;  4OPJ A;  2P9N B;  3NE6 A;  1DTQ A;  2W6K A;  3LPU A;  3V6D A;  4DLE A;  2HHU A;  3V9U A;  1LCU A;  3J7Z O;  4NO7 A;  1S1W A;  4U67 L;  1BHL A;  4CF2 A;  3OYC A;  2D0B A;  3L4I A;  2YHY A;  1JL1 A;  4BRI A;  4B08 A;  3VEY A;  3DOL A;  1VSL A;  4DR1 K;  4JI0 K;  1VSM A;  4JKC A;  1S6Q A;  4BDZ A;  3DLG A;  3DWL A;  3FLC O;  3M6G A;  2NRR A;  1KRP A;  4BC5 A;  4YDU C;  4YNQ A;  4M7Y A;  1BG3 A;  1T7P A;  3AA3 A;  3KKS A;  3TAQ A;  3L2U A;  3V9W A;  4DR6 K;  3L6Q A;  4OGE A;  4FLX A;  4BR4 A;  4EHT A;  1GLE G;  3OS0 A;  5GIO A;  3VEZ A;  3OYN A;  4NB4 A;  2YJF A;  2P9I B;  4EIA A;  4CJV A;  2JWL A;  4JI4 K;  3J81 O;  3P38 A;  1NKB A;  4H5V A;  2UXB K;  4CJE A;  4W5Q A;  2VG5 A;  4JNE A;  4FLZ A;  1YJN N;  1T03 A;  2OA8 A;  5AQW A;  2Q0R A;  3CET A;  1RDW X;  4CJR A;  5M1Q A;  5DM7 L;  2G8K A;  4JV5 K;  3HP9 A;  4DTR A;  3SBT A;  1WAF A;  1VQ6 N;  2A40 A;  1WSG A;  1TYQ A;  4G9Z A;  1WB9 A;  3ZEU B;  3SBG A;  3I8D A;  5KQD A;  3O1B A;  1U47 A;  2QTD A;  2W41 A;  5BPL A;  2E2Q A;  1N5Y A;  1QHT A;  1NKE A;  3VF2 A;  1OVY A;  2E2O A;  4E3S A;  3WQU A;  5CY4 A;  2D4W A;  4OLB A;  3AVB A;  3ZET A;  2G8I A;  3R8E A;  1NBW A;  4ILH A;  4X64 K;  2HNY A;  5BPN A;  3SAG A;  4Q0B A;  3B6O A;  1X3N A;  1QQC A;  2P1J A;  4DQI A;  4B9S A;  3V4I A;  5AQX A;  3KLG A;  3OYJ A;  3NBP A;  4M3X A;  5HL7 L;  3DRP A;  1M1K O;  2O8C B;  3LAM A;  4B9U A;  1NJZ A;  1VQO N;  2YKN A;  4BE0 A;  1OH6 A;  2UXC K;  1HQE A;  1R59 O;  3LWM A;  3RVC A;  4NYN A;  4QS7 A;  3K0S A;  4DV7 K;  4DQ8 A;  5JMV A;  4HHT A;  2QKK A;  4DTN A;  3HM9 A;  3HM8 A;  1X3M A;  3AY9 A;  1RT7 A;  1Q7Y O;  1HNW K;  4HWI A;  3FGU A;  3CCV N;  2G8W A;  4N5S A;  3KIO A;  1TL1 A;  3D2E A;  4MQ3 A;  1NLV A;  4M42 A;  2A41 A;  5AQH A;  3FFI A;  2GEM A;  3QB0 A;  2H3G X;  1E4F T;  1WSF A;  3NMU A;  1Q86 O;  3PO5 A;  1ASV A;  3BDP A;  4KH5 A;  3T1H K;  4CHP A;  4DTX A;  1CZB A;  3LAK A;  2WC9 A;  2DFH A;  2G8V A;  4CGD A;  1HNX K;  4CD1 A;  3WXL A;  1C1B A;  3RRH A;  3JS6 A;  2HHS A;  2J4R A;  4UY8 O;  3H45 C;  1G15 A;  4BRH A;  4AIL C;  4B9L A;  1VQK N;  5E26 A;  4BRD A;  5C2D A;  4CJT A;  1SS6 A;  2OTJ N;  5FLX O;  4CK1 A;  4JKH A;  3M8P A;  3OBW A;  4V19 S;  4CBU A;  1RBV A;  4JRQ A;  3LDN A;  1GLD G;  3A0I X;  4CZJ A;  2YHB A;  2WTU A;  1QSY A;  5K14 A;  1RT6 A;  4ISG A;  3VF4 A;  3VQC A;  3DM2 A;  3TAE A;  1A5W A;  4BR0 A;  2P9P B;  2QXF A;  3FZK A;  3THY A;  3SQ1 A;  2ASP A;  3CCQ N;  3AO5 A;  2O8B A;  2Z1G A;  4I2P A;  4JK7 A;  5AR0 A;  3ZSY A;  1SQK A;  4JK9 A;  2FBV A;  2VQF K;  3MDQ A;  2XY6 A;  1DGK N;  4A59 A;  3UIQ A;  4JI3 K;  4M3Z A;  4B3T K;  4HCB A;  2OCE A;  1V4T A;  3IMX A;  4IXC A;  3SCX A;  2UXD K;  2Q3S A;  3V1R A;  5AQU A;  1X9S A;  2O8E A;  3ISN C;  4MFB A;  1S1U A;  5HRO A;  2XY8 A;  3ULE A;  2NRW A;  4WQ5 C;  4FM0 A;  1JLB A;  4MO4 A;  3P31 A;  3M3Z A;  1BWF O;  3HXM A;  2YHX A;  4CHZ A;  2YCH A;  2O4I A;  1WLJ A;  1IKY A;  5IWA K;  3HSC A;  2NLX A;  5IT9 O;  1EO1 A;  3SV4 A;  3CFP A;  3K57 A;  3BY5 A;  1OVQ A;  2RKI A;  4IFY A;  4B9M A;  4CGI A;  1YHQ N;  1G99 A;  4FW2 A;  3SQ4 A;  4H5W A;  4CIF A;  3KLH A;  3PUF A;  4CJS A;  3BGR A;  5AQN A;  4BRG A;  3ITH A;  4YOU A;  4E1J A;  1T6C A;  4FOI A;  2HVI A;  3CD6 N;  2HNZ A;  1HUX A;  4B1V A;  2KFZ A;  1N6Q A;  5B8H A;  2YV0 X;  3NGZ A;  4CI6 A;  1RBR A;  4PL8 A;  4ELT A;  1GLJ O;  4B3O A;  2F4V K;  4BVO A;  3NGI A;  3OHR A;  4BRM A;  5EOY A;  1Q81 O;  5LY3 A;  2Z1H A;  3C6A A;  4U7B A;  4JKB A;  1SKS A;  4DQP A;  4CFD A;  4FJJ A;  2E4L A;  1ZBI A;  3AVG A;  1Q8I A;  1T05 A;  2ZJQ L;  2HHH K;  3WUH A;  4X65 K;  5LJV A;  4ILG B;  4PUO A;  3CQ8 A;  1J9A A;  2KZM A;  1NK0 A;  3MWT A;  2ZJR L;  3VQ7 A;  4W5R A;  3G6E N;  2GX9 A;  5I3U A;  3LDP A;  4CIG A;  2F9T A;  3D2F B;  3K5O A;  3RMC A;  2NRX A;  4KBO A;  1TUU A;  4CF0 A;  2CGK A;  4H4M A;  4OJR A;  3C65 A;  3LZI A;  1YXQ A;  1XMQ K;  1ATS A;  3ZSW A;  1C1A A;  3CM5 A;  4IDH A;  2BGG A;  2GV9 A;  1VQ9 N;  3FFK B;  3ZT0 A;  1BDG A;  1OH7 A;  2BUP A;  1KCF A;  4CZF A;  3FZH A;  3R1X A;  1WBD A;  1HNI A;  1U04 A;  1TKX A;  3QIC A;  5FPE A;  3GOI A;  4FLU A;  1RT3 A;  2HBJ A;  4DTU A;  3QEX A;  3AO1 A;  2XHB A;  3L2V A;  4OO1 J;  3ZSR A;  4FJK A;  1DLO A;  5AQT A;  4Z4H A;  3G10 A;  4FJG A;  3K5M A;  2E8A A;  1KD1 O;  4FWO A;  4EZ9 A;  3HTV A;  3AVL A;  2QM1 A;  4BGB A;  1Z6R A;  5BRD A;  1VK0 A;  1IBM K;  4DHY A;  4FM1 A;  3MWP A;  3AO4 A;  4LSN A;  3AVK A;  2EWS A;  5CE3 A;  3I56 N;  1VSD A;  4CHY A;  3OJU A;  3S3O A;  2HHV A;  4EFH A;  2A1S A;  1RT2 A;  4JD2 B;  3ZT4 A;  4DSK A;  2O8D A;  1KAZ A;  5KTQ A;  5E84 A;  4YOR A;  1UA0 A;  1ZBS A;  3TSQ A;  4JLH A;  3OVN A;  3CCS N;  1TK8 A;  3C94 A;  1MU2 A;  2ZD1 A;  3EYZ A;  3PO4 A;  4H0O A;  1FXX A;  2YHA A;  5BR9 A;  4KB0 A;  4BRO A;  3LP2 A;  2KW4 A;  1S1V A;  4DTS A;  4NCG A;  1T3V A;  5BRE A;  4B1X B;  3ID6 A;  3L2R A;  4C1N I;  3LDS A;  4DTM A;  1VHX A;  1CZA N;  4W5N A;  2B6A A;  1E4G T;  1VQN N;  1O13 A;  1HQU A;  2PYJ A;  2A6A A;  3K9J A;  4W5O A;  2OPP A;  3CCL N;  2O4G A;  1WBB A;  3TI0 A;  1SL2 A;  3SJJ A;  3A2F A;  3HO1 A;  1Y64 A;  2VWK A;  3S3M A;  2HMI A;  5GAH P;  3O1W A;  4FJX A;  1ILY A;  1JCG A;  4HCC A;  1QZ6 A;  3ZSZ A;  3HPH A;  3RMD A;  1D8Y A;  3ULD A;  3V9X A;  1I3A A;  3R6M A;  1JJ2 M;  3MX2 A;  1TKT A;  3VEW A;  1D4X A;  1W2B M;  4BWM A;  3NF7 A;  1WSH A;  1LWC A;  2DFE A;  4GW6 A;  3MCA B;  1ZBF A;  1DKG D;  1QZ5 A;  1NJI O;  3QFU A;  1HJO A;  4F8R A;  1RT1 A;  4LD0 A;  4DV5 K;  4CF9 A;  2Q97 A;  2CGL A;  3WT0 A;  1L3S A;  3PSF A;  1U48 A;  4NXM K;  3DJC A;  3KWI A;  4FVM A;  4H03 B;  3L8B A;  1VRU A;  3N4P A;  2Y1I A;  4DSL A;  1EXQ A;  4JAX A;  4R79 A;  3PIP L;  2HF3 A;  2A3Z A;  3OYI A;  2WOM A;  4IBN A;  5AQS A;  3HVR A;  3HOS A;  3K58 A;  4CZK A;  1LAV A;  4YOX A;  2UU9 K;  3C6H A;  4LH5 A;  1TYQ B;  3A5N C;  4N41 A;  3NVM A;  4CEF A;  5HRS A;  4Y0W A;  1NOZ A;  3AO2 A;  2BAN A;  1IBL K;  4C23 A;  5TKY A;  3V9S A;  3CJ7 A;  2PYL A;  1KFS A;  2P9K A;  3LPT A;  3QNN A;  2O8F B;  3O9Q A;  4CEC A;  3UKU B;  3ZET B;  1W0H A;  2E1Z A;  1XC3 A;  4CJW A;  3CXC M;  3ATU A;  3GDQ A;  4ID5 A;  5HP1 A;  3QIO A;  4L3Q A;  2NRZ A;  3UE5 A;  4OPK A;  2D0C A;  3I0S A;  1VQ4 N;  3QML A;  1TAU A;  2P9U B;  3CYM A;  3KLE A;  4M3U A;  3ZSO A;  3B8A X;  4JKD A;  1XHZ A;  1IKW A;  3CG7 A;  4OKK A;  3BF1 A;  2NRH A;  4OPH A;  3TTD A;  4CZM A;  2FBT A;  3RRG A;  5HBM A;  2FXU A;  3A8Y A;  3C0B A;  3CI5 A;  3THW A;  3SZ2 A;  2GWJ A;  5KPT A;  1T44 A;  3SUO A;  1TKD A;  4FVU A;  2D0P A;  1NJX A;  3M8S A;  4E7K A;  4Z4I A;  2HF4 A;  2WUS A;  5KGX A;  4M7X A;  4WFA L;  4E7L A;  3V1O A;  4BR5 A;  1NK7 A;  1FJG K;  3D2E B;  3SV3 A;  3THX A;  1RDA A;  1Q18 A;  1N34 K;  1SV5 A;  4H8K A;  3SQ2 A;  5FDL A;  2HB5 A;  3QIN A;  4BQZ A;  1VQM N;  4LF7 K;  1HMV A;  3K5N A;  4B9N A;  4H0P A;  4J2A A;  1JCF A;  3TSP A;  3O9S A;  3U4L A;  2AP1 A;  2QWM A;  4CF1 A;  2ZGY A;  3KD5 E;  4PKG A;  3SMS A;  1RCH A;  3AVA A;  2E5L K;  2P9L A;  2ZF5 O;  2W6L A;  1V4S A;  5DMR A;  3SK3 A;  4K8X A;  3CCJ N;  1WOQ A;  3A5O C;  3G25 A;  5LJW A;  4CJ7 A;  1U2V A;  4O44 A;  4IG0 A;  1J53 A;  4B3S K;  4PWD A;  4ILJ A;  3VEV A;  3MXI A;  5C42 A;  4J2D A;  4YHH K;  3JXU A;  4CJP A;  3VQ6 A;  1U4B A;  5LL6 Z;  3MEG A;  4BRF A;  1X9W A;  3BZC A;  3M5R A;  3ASM A;  1HR0 K;  4CFA A;  2HW3 A;  4M3Y A;  2NRT A;  4KH4 A;  3THY B;  3RMA A;  3TR8 A;  3J80 O;  3H1V X;  4Z4C A;  4PL7 A;  1RT5 A;  1NGH A;  4JHD A;  3MXJ A;  2G8H A;  3OYK A;  3F5T A;  2OZS A;  4B1W B;  3VQQ A;  2F8T A;  3KVG A;  3VOV A;  3OBY A;  3T3F A;  1QTM A;  2FBY A;  3HBT A;  3TTF A;  4I9Q A;  1A5X A;  1TV6 A;  4NYF A;  3VEX A;  3K59 A;  1U6Z A;  3F9K A;  4KO0 A;  2PBD A;  5CYQ A;  3NH0 A;  2O8E B;  4K8Z A;  1BQN A;  3NH1 A;  4O0I A;  1MDU B;  3IFR A;  4DTO A;  3F73 A;  5M1F A;  3KJV A;  3IKM A;  3P83 D;  4AF1 A;  2QWL A;  3U6F A;  3O9R A;  4BR2 A;  1S1T A;  3IAY A;  3WXJ A;  4IJN A;  1BCO A;  1CLQ A;  3CFO A;  3KKR A;  2ZWH A;  4DR7 K;  3CCM N;  4YDU A;  4FWR A;  4KPY A;  4M63 C;  1VQ5 N;  1TKZ A;  1NGJ A;  4NCB A;  2JLE A;  5CHI A;  2LSN A;  3DAW A;  1YTA A;  3CCR N;  4HTU A;  4RCH A;  4DF8 A;  3AA5 X;  1T8E A;  3OA9 A;  1JXE A;  1QVG M;  1CXU A;  3L3U A;  4ISF A;  4A5B A;  3S3N A;  5ELZ A;  2IAJ A;  4JI6 K;  5C10 A;  3MN9 A;  2D5R A;  5DM6 L;  3L0Q A;  4KHP K;  1K8K B;  4DR5 K;  4CES A;  4XEI A;  1HKC A;  4C8O A;  1H1V A;  3IDH A;  4LC9 B;  2QXL A;  4DV1 K;  3GG4 A;  4QS9 A;  3PX6 A;  3LM9 A;  3AVF A;  1JCE A;  4FJI A;  4F2R A;  3WNG A;  4N47 A;  3H1Q A;  3SLC A;  4ELU A;  3U9Z A;  4DQR A;  4EHU A;  4Q5V A;  4BRQ A;  3T19 A;  3OYE A;  3MEC A;  2OTL N;  3HVT A;  4JI8 K;  1IG8 A;  4A62 A;  3VET A;  4QOZ B;  2D0O A;  5J2Q A;  3KD1 E;  4BR9 A;  1NGE A;  2QKB A;  4E1N A;  2XO7 A;  1EET A;  1IO2 A;  3G71 N;  4AHT A;  1LWF A;  2PY5 A;  1QQO A;  3MX5 A;  4I7F A;  4FLV A;  3WEE A;  5F1X A;  4CHQ A;  4IZ9 A;  2AA4 A;  4JKF A;  5AQF A;  3AA4 A;  3VGM A;  2P9S A;  1KLN A;  3ALY A;  4M3T A;  3FZF A;  2YHW A;  3DXK A;  4RWT A;  4FWQ A;  4CK2 A;  5AQQ A;  3I33 A;  1YTU A;  4IFV A;  1ZBU A;  3TAP A;  3OJS A;  1QS4 A;  3O08 A;  2VYP A;  3UKR A;  1J6Z A;  4CJ4 A;  3MK6 A;  1EQY A;  3VA3 A;  4XH1 A;  1KVA A;  3QLH A;  1JKH A;  5C15 A;  4DKW A;  3OTO K;  3NHG A;  5JLF A;  2E2N A;  3J7A P;  5GAD P;  1M90 O;  2YI1 A;  1SZ2 A;  2O8D B;  5SWM A;  1VSJ A;  1NGG A;  4CZH A;  4DSF A;  4CBX A;  2YJE A;  3VGL A;  3ATV A;  4WE1 A;  3PX0 A;  3O3G A;  4AHC A;  4O5F A;  3RWU A;  3VQB A;  2XRI A;  1ESV A;  1JLF A;  4BE2 A;  1IG9 A;  1GOC A;  2ZGZ A;  4KTZ A;  4KHU A;  4LH4 A;  4CGH A;  1RTI A;  3QFP A;  1LOT B;  2QWR A;  4FK0 A;  3UB5 A;  1SL1 A;  4BAC A;  4E7J A;  3CIP A;  2IOC A;  3O3F A;  1WUA A;  3LP1 A;  5M1O A;  1HNZ K;  1J5E K;  2RHK A;  2GUP A;  1Z05 A;  4CGJ A;  2HND A;  4DLG A;  1KAY A;  2HBL A;  3R3L A;  1HKG A;  4I6M A;  3JSM A;  3HYF A;  4RW6 A;  3SYZ A;  2YKM A;  5LMU K;  1ZC6 A;  3Q7B A;  3QO9 A;  1RBT A;  5AQI A;  3ZEU A;  4FJH A;  3A5L C;  1RBU A;  4KTW A;  1VQL N;  2Q31 A;  3IG1 A;  4IG3 A;  2P5G A;  2FBX A;  4MLH A;  3RMB A;  4K41 A;  4WYB A;  2E1Y A;  5ADX H;  1LV5 A;  4WQ5 A;  4CEZ A;  4TSX A;  3EEQ A;  1NOY A;  4OPA A;  4JKG B;  1VQ7 N;  4H0X B;  1BCM A;  1GLC G;  1WSJ A;  1VSI A;  4DSI A;  1Q82 O;  1WSE A;  4FWN A;  3MED A;  1VSH A;  4WQ4 C;  3W3D A;  1RFQ A;  2WBN A;  4DB3 A;  2E6L A;  1NM1 A;  5JVG L;  1EP4 A;  5FRO A;  4DF4 A;  2FSJ A;  4FK4 A;  3CM6 A;  3EN9 A;  2HHW A;  3OYL A;  1UAX A;  2HHT A;  4YFU A;  4LF5 K;  3NFA A;  4BDP A;  4DFK A;  1KAX A;  4MDA A;  1DT9 A;  1KQS M;  2EX3 A;  3TTC A;  1QSL A;  1RDD A;  2KQ2 A;  1JXB A;  3I55 N;  4IFE A;  2NRV A;  3DRS A;  3ZT2 A;  2GEL A;  4DCH A;  3EL2 A;  4XH5 A;  1HKB A;  4Y1C A;  2B5J A;  3T7Z A;  3VTH A;  2V7Y A; 
#chains in the Genus database with same CATH homology
 1UA1 A;  3OS0 A;  1NOZ A;  3OYN A;  1HNV A;  3DLB A;  3AO2 A;  4PQU A;  2BAN A;  4O55 A;  3DLH A;  3VQP A;  1RT4 A;  4CJV A;  3RR7 A;  3KK2 A;  3M8R A;  4DS5 A;  2DY4 A;  3DLK A;  4FJ5 A;  1NKB A;  3V9S A;  2RPI A;  3VN5 A;  1KFS A;  3C6U A;  1NK9 A;  2PYL A;  3D45 A;  4CJE A;  1IKX A;  3DYA A;  4W5Q A;  1B92 A;  2VG5 A;  3LPT A;  4FLZ A;  3QNN A;  1T03 A;  3TAG A;  2OA8 A;  1S5J A;  4CEC A;  1NK4 A;  4CJR A;  1D9F A;  1W0H A;  2YNH A;  3VQA A;  2G8K A;  4CJW A;  4FJM A;  3HP9 A;  4DTR A;  2F96 A;  1WAF A;  4ID5 A;  3CFR A;  3QIO A;  5HP1 A;  1GOB A;  1WAJ A;  4OPK A;  1WSG A;  4DFP A;  2EHG A;  2D0C A;  3I0S A;  2GBZ A;  2AJQ A;  3OY9 A;  1TAU A;  3CYM A;  3KLE A;  2BE2 A;  3I8D A;  4M3U A;  4OGC A;  2ZQB A;  3ZSO A;  4BWJ A;  3VQD A;  2A1R A;  4CJQ A;  3OYA A;  1EKE A;  1KVC A;  1XHZ A;  1IKW A;  4IDK A;  1JLE A;  3CG7 A;  1WN7 A;  2X6S A;  3LP3 A;  4OKK A;  5J2M A;  3HPG A;  4E0D A;  3RRG A;  4LSL A;  2FBT A;  3ZT1 A;  4DFM A;  1N5Y A;  5HBM A;  1QHT A;  3IRX A;  1NKE A;  1L5U A;  5D3G A;  5C25 A;  4FJ9 A;  4I2Q A;  4KAZ A;  4ELV A;  4E3S A;  4ID1 A;  1KLM A;  3ZSQ A;  5CY4 A;  3SZ2 A;  4OLB A;  3AVB A;  4KI6 A;  2F8S A;  4F4K A;  1FKP A;  4KI4 A;  1XI1 A;  3SUO A;  5CZ2 A;  1FKO A;  1TKD A;  1NJX A;  3OYB A;  3E01 A;  3M8S A;  4CCH A;  2G8I A;  4HUG A;  4E7K A;  4AHS A;  2VG7 A;  4FJN A;  4Z4I A;  1ASU A;  4FXD A;  2HNY A;  4Q0B A;  3B6O A;  5KGX A;  4B8A B;  1QQC A;  2P1J A;  4DQI A;  1ZBH A;  3DI6 A;  4E7L A;  4KB1 A;  1GOA A;  3V1O A;  4B9S A;  3VQ5 A;  4CGF A;  3I0R A;  1NK5 A;  3LWL A;  3V4I A;  1NK7 A;  3NF9 A;  4FLT A;  3SV3 A;  4C8L A;  4NCA A;  1RDA A;  1HJR A;  3KLG A;  1I39 A;  3OYJ A;  3NBP A;  3NCI A;  3TAF A;  4M3X A;  3DRP A;  4JS4 A;  1SV5 A;  3AV9 A;  2DFF A;  1NK8 A;  3LAM A;  4H8K A;  1NJZ A;  4B9U A;  5DK5 A;  3SQ2 A;  2YKN A;  5FDL A;  1HYV A;  4BE0 A;  3HPO A;  1HQE A;  2VG6 A;  2VWJ A;  2HB5 A;  1TAQ A;  3QIN A;  3LWM A;  4NYN A;  3EZ5 A;  4BE1 A;  4CK3 A;  1XWL A;  4HHT A;  1HMV A;  3K5N A;  2QKK A;  4FJ8 A;  4B9N A;  4DTN A;  3OYG A;  3HM9 A;  4J2A A;  3KK1 A;  1RT7 A;  1S9E A;  4DU1 A;  4DTJ A;  3PX0 A;  4CF1 A;  3KD5 E;  4FZZ A;  3SI6 A;  4EP4 A;  1RCH A;  3AVA A;  4O4G A;  2G8W A;  4FZX C;  3AVH A;  1RDC A;  3HK2 A;  4F3T A;  4N5S A;  3KIO A;  1TL1 A;  4MQ3 A;  2KZZ A;  4QCL A;  4KHN A;  4M42 A;  1JL2 A;  5DMR A;  4K8X A;  4DG1 A;  2IS3 A;  3FFI A;  4FJL A;  2X6N A;  3NAE A;  4KHQ A;  1RIL A;  4CFB A;  4XIU A;  1XC9 A;  2R7Y A;  4DWI A;  1WSF A;  3PO5 A;  1C1C A;  4O44 A;  1ASV A;  1EX4 A;  1J53 A;  4IG0 A;  1JLA A;  1SKR A;  3BDP A;  4PWD A;  3MXI A;  4CHP A;  3NDK A;  4DTX A;  1CZB A;  3LAK A;  1L3U A;  5C42 A;  2DFH A;  2G8V A;  4J2D A;  1LAW A;  2IDO A;  4CGD A;  4CJP A;  3QEW A;  3QET A;  4G1Q A;  1C1B A;  3VQ6 A;  3TAR A;  3L2Q A;  3RRH A;  1C6V A;  1U4B A;  3K2P A;  2HHS A;  3MEG A;  2ATQ A;  3B6P A;  1BQM A;  2X74 A;  1X9W A;  1TGO A;  1HYS A;  1G15 A;  3ASM A;  2BDP A;  4AIL C;  4CFA A;  2HW3 A;  4M3Y A;  1Y97 A;  4B9L A;  1VSF A;  2W42 A;  3TAN A;  4CER A;  3RMA A;  4N76 A;  3TR8 A;  4ZTJ A;  4BDY A;  4CJT A;  1BL3 A;  3P1G A;  1X1P A;  4Z4C A;  1RT5 A;  4OKJ A;  3O3H A;  3D0P A;  1WNS A;  3S9H A;  1LWE A;  3MXJ A;  3HT3 A;  4E1M A;  3LAN A;  1TK0 A;  3OYK A;  2G8H A;  2OZS A;  3VQQ A;  3AO3 A;  2F8T A;  4CK1 A;  3T3F A;  3AA2 A;  3M8P A;  4LY7 A;  2FBY A;  1QTM A;  4GVM A;  4FCY A;  4I9Q A;  3NF8 A;  1RBV A;  1A5X A;  3OYD A;  4JRQ A;  1TV6 A;  2RF2 A;  4NYF A;  2YHB A;  4HUE A;  3K59 A;  3F9K A;  4KTQ A;  1QSY A;  4O5B A;  5K14 A;  4KO0 A;  3DRR A;  5CYQ A;  4AHV A;  3NH0 A;  1RT6 A;  4K8Z A;  1BQN A;  5FRM A;  1ITG A;  3NH1 A;  3VQC A;  4O0I A;  3LAL A;  3DM2 A;  3TAE A;  4IKF A;  4Z4E A;  4DTO A;  3F73 A;  1A5W A;  4C8M A;  1S1X A;  5JS2 A;  2OPR A;  2X78 A;  2QXF A;  4CJK A;  2P51 A;  3C95 A;  3KJV A;  3P83 D;  4FW1 A;  3SQ1 A;  2I5J A;  4FM2 A;  3AO5 A;  3U6F A;  1HPZ A;  5KRS A;  2Z1G A;  4I2P A;  1UWB A;  4KRF A;  3ZSY A;  4FLW A;  1S1T A;  1KVB A;  4I9L A;  1R0A A;  3IAY A;  2FBV A;  2D0A A;  2XY6 A;  1LW0 A;  1BCO A;  4B9V A;  3KLF A;  3UIQ A;  4HCB A;  3AVN A;  4M3Z A;  3K5L A;  1CLQ A;  3CFO A;  3KKR A;  3DLR A;  1O1W A;  3P5J A;  4PA1 A;  3SCX A;  1YT3 A;  4KPY A;  2Q3S A;  1TKZ A;  3WNF A;  3V1R A;  3ZT3 A;  5I42 A;  1X9S A;  3VQ9 A;  4NCB A;  2JLE A;  5SZT A;  4DU3 A;  2LSN A;  3ISN C;  4MFB A;  1S1U A;  5HRO A;  2XY8 A;  1S6P A;  1YTA A;  4FM0 A;  4OVL A;  4HTU A;  1JLB A;  4DF8 A;  3AA5 X;  1T8E A;  1XHX A;  4Z4F A;  4CEQ A;  3KTQ A;  1JXE A;  1RBS A;  3HXM A;  4B9T A;  1CXU A;  3L3U A;  1QSS A;  2HHX A;  2P5O A;  4CHZ A;  3S3N A;  1SUQ A;  1ZBL A;  1WLJ A;  1IKY A;  2O4I A;  1TL3 A;  2G8F A;  4CE9 A;  4CHO A;  3VQE A;  3SV4 A;  3CFP A;  2IAJ A;  3SUN A;  3K57 A;  4PY5 A;  3MXM A;  3THV A;  2D5R A;  3C6T A;  3T1A A;  2B4J A;  2RKI A;  3H08 A;  4CES A;  1J54 A;  4IFY A;  4EP5 A;  4R5P A;  4CGI A;  4B9M A;  4FW2 A;  4C8O A;  3SQ4 A;  4CF8 A;  4JRP A;  4B8C A;  4CIF A;  4C8N A;  3KLH A;  3PX6 A;  3PUF A;  4CJS A;  3BGR A;  3SPY A;  4E19 A;  1UOC A;  3TWH A;  4OKE A;  3AVF A;  3ITH A;  4FJI A;  3WNE A;  4F2R A;  3RTV A;  3WNG A;  4EZ6 A;  4F2S A;  2ITG A;  1SL0 A;  2HVI A;  4JS5 A;  4N47 A;  3LZJ A;  3PV8 A;  2HNZ A;  4ELU A;  4DQR A;  1IKV A;  5CYM A;  3VQ4 A;  4Q5V A;  1RDB A;  2KFZ A;  4RW4 A;  1N6Q A;  3T19 A;  2YV0 X;  3OYE A;  1K6Y A;  3NGZ A;  3MEC A;  2Y1J A;  3HVT A;  1FK9 A;  1U45 A;  1RBR A;  4ELT A;  4B3O A;  4QOZ B;  3NGI A;  1BIS A;  4FK2 A;  4KHS A;  5J2Q A;  3KD1 E;  2QKB A;  4RW8 A;  1W9H A;  3KK3 A;  4M45 A;  3QIP A;  1JLC A;  1KTQ A;  1BIZ A;  4CJ5 A;  4E1N A;  4KHY A;  2XO7 A;  4Y1D A;  1RTD A;  4J2E A;  4CFC A;  2Z1H A;  1VSK A;  1SKS A;  1EET A;  4DQP A;  1ZBI A;  1IO2 A;  3AVC A;  2E4L A;  4CFD A;  4FJJ A;  3AVG A;  4AHT A;  1LWF A;  5HRR A;  1Q8I A;  5E41 A;  1TVR A;  2YNI A;  3VA0 A;  3SPZ A;  1T05 A;  2PY5 A;  3TAM A;  5J1E A;  1X9M A;  4I7F A;  4FLV A;  3QEP A;  5JS1 A;  4FZY A;  4CHQ A;  5J2P A;  4PUO A;  2JGU A;  3CQ8 A;  1J9A A;  3AA4 A;  2Z1I A;  1Z26 A;  1RTJ A;  4M41 A;  1ZYQ A;  1NJY A;  1D9D A;  1C0U A;  4QAG A;  4CED A;  1NK0 A;  1KLN A;  4Z4G A;  2KZM A;  4RW9 A;  3ALY A;  4DFJ A;  4M3T A;  3DLE A;  3AVJ A;  2HVH A;  3VQ7 A;  4W5R A;  4CK2 A;  1SKW A;  2GUI A;  2E6M A;  5I3U A;  1HYZ A;  5KRT A;  1RTH A;  3L3V A;  1YTU A;  4CIG A;  4IFV A;  1ZBU A;  3TAP A;  3K5O A;  3OJS A;  4FYD A;  3RMC A;  3QER A;  1QS4 A;  4CF0 A;  4GMJ B;  1IH7 A;  4H4M A;  4OJR A;  4CJ4 A;  4CGG A;  1U49 A;  3VA3 A;  5CZ1 A;  1KVA A;  3QLH A;  3LZI A;  3SQ0 A;  4CIE A;  3ZSW A;  4DS4 A;  1C1A A;  3CM5 A;  1JKH A;  3NGY A;  2BGG A;  2GV9 A;  1BIU A;  3ZT0 A;  1A5V A;  3NHG A;  4CEB A;  1QE1 A;  2NUB A;  1KSP A;  4AH9 A;  1KCF A;  2OZM A;  4J2B A;  1HNI A;  4KFB A;  1U04 A;  1TKX A;  3LP0 A;  4M3W A;  4FLU A;  2OYQ A;  5SWM A;  1RT3 A;  1VSJ A;  4DTU A;  3QEX A;  3AO1 A;  3HP6 A;  2XHB A;  1NKC A;  4DMN A;  3L2V A;  3ZSR A;  4DSF A;  4FJK A;  1DLO A;  3NF6 A;  2PZS A;  4Z4H A;  3G10 A;  2XY5 A;  4FJG A;  2YNG A;  2RN2 A;  4WE1 A;  3O4N A;  3K5M A;  1TK5 A;  1Z25 A;  3M8Q A;  3VQ8 A;  1Q9X A;  5EU7 A;  4EZ9 A;  4DQS A;  2ZE2 A;  3AVL A;  3L2W A;  3O3G A;  1C0M A;  3G0Z A;  4AHC A;  3OYM A;  5HRN A;  2G8U A;  4AHR A;  3VQB A;  2XRI A;  3RWU A;  1VK0 A;  1L3V A;  2YNF A;  4C8K A;  2QK9 A;  4FM1 A;  1JLF A;  3IS9 A;  3RR8 A;  1NJW A;  4BE2 A;  3AO4 A;  4KKO A;  1S9G A;  1DTT A;  4CJF A;  3V81 A;  4ZHR A;  4LSN A;  1IG9 A;  3AVK A;  2FC0 A;  1VSD A;  1GOC A;  4CHY A;  4KHU A;  4KTZ A;  3OJU A;  3AVI A;  3S3O A;  2Z1J A;  3PY8 A;  3DOK A;  2HHV A;  1YVU A;  2A1S A;  3QNO A;  1RT2 A;  4LH4 A;  4CGH A;  3ZT4 A;  4DSK A;  3SNN A;  1RTI A;  4O0J A;  1WSI A;  5KTQ A;  1BI4 B;  4UQG A;  3HL8 A;  3QEV A;  4DQQ A;  3AVM A;  5C24 A;  1UA0 A;  4FK0 A;  1CXQ A;  1SL1 A;  4JLH A;  3OVN A;  3V1Q A;  1TK8 A;  3C94 A;  1MU2 A;  2ZD1 A;  4CJ3 A;  1BGX T;  3EYZ A;  3QEI A;  3PO4 A;  2DTU A;  4BAC A;  1FXX A;  2YHA A;  4E7J A;  4KB0 A;  2IOC A;  3O3F A;  3LP2 A;  3LP1 A;  2KW4 A;  1S1V A;  4DTS A;  4NCG A;  3V9Z A;  1NK6 A;  2IC3 A;  4ZTF A;  4CGJ A;  1F21 A;  2HND A;  3L2R A;  3LDS A;  4DLG A;  4DTM A;  2KFN A;  4KHW A;  3JSM A;  4CJL A;  3HYF A;  2B6A A;  4RW6 A;  3SYZ A;  1B9D A;  4W5N A;  2YKM A;  3O4Q A;  1HQU A;  1BI4 A;  3SUP A;  4Z0U A;  4M3R A;  3QO9 A;  1RBT A;  2PYJ A;  2XY7 A;  1L3T A;  4FJH A;  4W5O A;  2OPP A;  4HVJ A;  1RBU A;  4KTW A;  1J5O A;  2O4G A;  3HST B;  3IG1 A;  3TI0 A;  1SL2 A;  3SJJ A;  3A2F A;  4IG3 A;  3SUQ A;  2P5G A;  2VWK A;  3HO1 A;  2FBX A;  1C0T A;  3OS1 A;  3S3M A;  2HMI A;  4FJX A;  3RMB A;  3NH2 A;  4HCC A;  4E7H A;  3ZSZ A;  1LV5 A;  3HPH A;  3U3Y A;  1HRH A;  3OS2 A;  3RMD A;  1D8Y A;  4CEZ A;  2ETJ A;  2WON A;  3U3G A;  3ULD A;  4TSX A;  3V9X A;  2HHQ A;  3MEE A;  1I3A A;  4CJU A;  4F3O A;  3PX4 A;  1NOY A;  4CHN A;  5KI6 A;  4KV8 A;  4L8R B;  3OYF A;  4HUF A;  4CEO A;  1TKT A;  3ZSX A;  1BCM A;  4AHU A;  4OLA A;  1Q9Y A;  4BWM A;  3NF7 A;  1WSJ A;  1WSH A;  3TAB A;  1VSI A;  3WNH A;  1LWC A;  2OPQ A;  3ZSV A;  4DSI A;  2DFE A;  4GW6 A;  1WSE A;  1RNH A;  4N56 A;  3MED A;  5J2N A;  1VSH A;  1ZBF A;  2OPS A;  4H4O A;  3HJF A;  3JYT A;  4FLY A;  4RW7 A;  4DU4 A;  4F8R A;  1LW2 A;  1RT1 A;  3OYH A;  5KGW A;  5FRN A;  2E6L A;  3EY1 A;  4LD0 A;  1D5A A;  4CF9 A;  4W5T A;  1EP4 A;  5FRO A;  4DF4 A;  4OPJ A;  2IGI A;  4FK4 A;  1CZ9 A;  1VRT A;  1DTQ A;  3NE6 A;  3CM6 A;  3LPU A;  1L3S A;  3V6D A;  2HHW A;  3OYL A;  4DLE A;  1U48 A;  1UAX A;  2HHT A;  4YFU A;  3L8B A;  4FVM A;  3NFA A;  4DSE A;  1VRU A;  1JLQ A;  2Y1I A;  3V9U A;  4DFK A;  4BDP A;  4DSL A;  5HLF A;  5HRP A;  2HHU A;  4ICL A;  1S1W A;  4CEE A;  1EXQ A;  4E7I A;  1BHL A;  4CF2 A;  3OYC A;  2D0B A;  2EX3 A;  1JLG A;  3OYI A;  4KRE A;  1JL1 A;  2WOM A;  1QSL A;  3KLI A;  4IBN A;  4B08 A;  3DOL A;  4E89 A;  1RDD A;  1VSL A;  2KQ2 A;  1JXB A;  1U47 A;  3HVR A;  4CEA A;  1VSM A;  3K58 A;  1S6Q A;  3DRS A;  3ZT2 A;  4BDZ A;  3DLG A;  2KTQ A;  1B9F A;  3ZCM A;  4FJ7 A;  1KRP A;  4DTP A;  4YNQ A;  4DSJ A;  1ASW A;  1LAV A;  1T7P A;  3AA3 A;  3KKS A;  3TAQ A;  4RG8 A;  1VSE A;  4LH5 A;  1REV A;  3L2U A;  4Y1C A;  2B5J A;  3V9W A;  4N41 A;  3DMJ A;  3MAQ A;  3QES A;  1KFD A;  5T7B A;  4CEF A;  4OGE A;  4FLX A;  5HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...