2GTDA

Crystal structure of a type iii pantothenate kinase: insight into the catalysis of an essential coenzyme a biosynthetic enzyme universally distributed in bacteria
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Type III Pantothenate Kinase
publication title Crystal Structure of a Type III Pantothenate Kinase: Insight into the Mechanism of an Essential Coenzyme A Biosynthetic Enzyme Universally Distributed in Bacteria.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 78
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gtdA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gtdA02
4CZLA 3GL1A 4BRLA 4BC4A 2V7ZA 2DPNA 3DXMA 4B1ZA 3S41A 5FPEA 4JN4A 1YAGA 3ZETB 2ZWHA 2YHYA 3SMPA 1DKGD 3UKRB 1U6ZA 5BRDA 2A3ZA 4M7YA 4B1WB 3FZLA 2YJFA 3OHRA 5FPDA 2NLXA 1NGFA 1U2VB 2E1YA 4ISGA 4JD2B 4CZGA 2P9LB 4BRNA 5AQKA 3CIPA 2QWPA 4MLHA 1EQYA 3WEEA 4WQ5C 2P9IA 4MLEA 3IUCA 5AZJB 5FPNA 3QBXA 3MN7A 3SLCA 1HUXA 2P9PA 3WQTA 2Q0RA 2UYTA 4JHDA 3A5LC 2IVPA 5TKYA 5AQYA 4CD3A 2Q0UA 4EAHD 3QICA 3C7NA 2Q36A 3UB5A 2AA4A 1TUUA 1GLCG 1NM1A 1S3XA 4MO4A 2GUPA 5LJWA 3AAPA 3R9PA 2W40A 2QWMA 4H5WA 3M6GA 4BVPA 4H0XB 3MDQA 4BC5A 3DWLA 4YDUA 5AFUH 4KBOA 1YVNA 4GNIA 5AQXA 1XC3A 3VEOA 2QW9A 4L3QA 4E1JA 3M1FA 2HOEA 4PKIA 3RSEB 2D4WA 3IDHA 4BQZA 3VGLA 4ISEA 4MO5A 1KXPA 4FWMA 5AQGA 3CJAA 5FPMA 3ULEA 4BGBA 5BN9A 4BRCA 1Q18A 3O80A 4C23A 3HTVA 5KPTA 5AQJA 3VOVA 1NWKA 2FF3B 3ZETA 5AQMA 4BRPA 1IJJA 3EO3A 3UKRA 3ZEUB 3SMSA 3SJHA 1R59O 3HBTA 1Z6RA 2ASPA 2EWSA 1U2VA 3ZX0A 4DHYA 4PL8A 2FSKA 3BF1A 4JD2A 3KZBA 2P9LA 1NLVA 3FZKA 4WQ5A 2HMPA 3CQYA 4FWLA 5BN8A 3W0LA 3SK3A 4H5VA 5E26A 2QWRA 1HKGA 2F9WA 2GWKA 4H5NA 3WUHA 3ATUA 1ATNA 5AZJA 3FZFA 3O1BA 4DQ8A 1K8KB 4FWPA 3GOIA 3JXUA 4FPAA 4HTLA 2GEMA 4FOEA 5JLFA 1YXQA 3TU5A 4BR7A 1HPMA 2CH5A 3O6WA 1GLLO 4FO0A 3CERA 4BR9A 3QFUA 1C0GA 4IZ9A 4JNEA 2QWOA 4WQ4C 1NGCA 1NGJA 3VF2A 1H1VA 3LDLA 2ZGYA 5AQRA 5I9EB 5BPNA 1KAXA 1MA9B 2GELA 2E2PA 3KHYA 3VESA 3F9MA 3DAWA 3W3DA 3WXIA 2HF4A 4PKHA 2E2NA 3LDQA 3H1VX 4BRDA 1X3MA 5EX5A 3A5MC 4I6MB 3AY9A 3LM2A 4FWQA 1QQMA 3RSEA 1HX1A 4BRQA 5EVZA 1HJOA 3FZMA 2P9UA 3O1WA 1HLUA 4CZEA 2Q2RA 3U8XA 4BR2A 1X9JA 1S22A 3MN5A 5AQTA 4BREA 4CD1A 2YHXA 3ZEUA 5BPMA 4NB4A 4CZHA 3O08A 2V7YA 3CI5A 4H03B 4BRGA 4M63C 2I7NA 2D0PA 3H3OB 1KAYA 4RWTA 3VF6A 2P9SA 3EZWA 4QS8A 2FXUA 3ZX3A 5JLHA 3QB0A 5AQLA 2CGLA 1BOTO 3L6QA 4CBUA 3VPZA 4H0YB 3D2FB 4QS9A 1K8KA 4HWIA 4FWNA 2IVNA 2GTDA 3G25A 3UE5A 4CJ7A 5CE3A 3O4WA 4A62A 4WQ4A 1GLDG 3CJCA 4F9OA 4A2BA 3CETA 1GLAG 4EHTA 1DGKN 1BDGA 1NGDA 2QM1A 4BVOA 1BG3A 3B8AX 3H1QA 5BPLA 4BG8A 2HF3A 1JCGA 3L0QA 3H45C 2CGJA 2QXLA 3LDPA 2WUSA 3U9DA 4CZMA 1T6DA 4FWOA 4BG9A 4I6MA 4AM6A 1QZ6A 3GG4A 3AARA 3LL3A 4H0OA 4O8KA 1NMDA 2NRHA 3ZX2A 1BA1A 4BRAA 3DJCA 1Y64A 1ZXOA 1ESVA 2A41A 4FPBA 5BREA 3CJ9A 2V52B 3C0BA 3WXLA 1D4XA 3AAQA 3HI0A 3I33A 3EN9A 2FSNA 4CBWA 5BR9A 1OKJA 4IXCA 2Q1NA 3GE1A 1NGGA 3VEZA 4PKGA 2Q31A 2YCHA 3D2FA 2QWLA 1ZBSA 3H3NO 3VERA 4CZIA 1NGIA 3UKUB 5B8HA 3U9ZA 1MDUB 2A5XA 1NGBA 2NZTA 5ELZA 3D2EB 5LJVA 3WXJA 3GBTA 3BUZB 5AQUA 2E8AA 2ASMA 1J6ZA 2P9IB 4FWRA 1GLFO 5BRFA 1E4FT 4H0PA 1TYQB 2QWNA 3BF3A 4GY2B 3HSCA 3A5NC 2F9TA 2VYPA 3I8BA 4XH4A 3VETA 3QDKA 5ADXH 5JICA 3EKUA 4CZKA 3VEVA 2YHWA 1ZC6A 4B1XB 5EOYA 4BR0A 4J8FA 4Y0WA 4K41A 3C7NB 3FGUA 1SAZA 5BRHA 1C0FA 2D0OA 3BEXA 4BROA 1LCUA 4IJAA 3FLCO 2GWJA 4BRFA 4CZFA 4RTFD 1JCFA 5KQ8A 5E84A 3VF4A 3DXKB 5AQHA 3A8YA 1BUPA 4B1VA 1RFQA 2A42A 5KPRA 3LM9A 5AQWA 2Q97A 2J4RA 1RDWX 2P9NB 1GLBG 3ULEB 3WXKA 4CI6A 1V4SA 3O5BA 4CBXA 1NGHA 2QWQA 4AM7A 2P9KB 3HM8A 4BQLA 5AZIB 4DCHA 4BC3A 4K42A 1NGEA 1HKCA 3QMLA 1CZAN 1T6CA 3UKUA 1SQKA 1YUWA 2H3GX 2KHOA 4BRKA 3EKSA 2ASOA 4H0VB 5F1XA 4BRMA 3H46O 3D2EA 1TUYA 3IMXA 2PAVA 3L4IA 1DEJA 1QHAA 3H6EA 1WUAA 3MMVA 1BA0A 5ADXA 1V4TA 4M7XA 4EFHA 2E1ZA 4BR4A 1HKBA 1LOTB 3FR0A 3M3ZA 5JMVA 1TYQA 2FSJA 3CJ1A 1BU6O 3J8AA 4BC2A 3ID8A 4XH1A 1T44A 1Z05A 3A0IX 1MWKA 1KAZA 1JCEA 1QZ5A 5AQPA 2A6AA 2ITMA 3TPQA 2PBDA 3EL2A 1G99A 1ATSA 3R8EA 3A5OC 4BGAA 3VEYA 2ZGZA 4A2AA 3P4IA 1RGIA 2BTFA 4Z94A 4B1UB 1IG8A 3VGKA 4B9QA 1GLEG 2D1KA 3CJBA 4NO7A 2E2OA 3FFKB 3IFRA 4FSVA 3D7EO 5AQSA 5EY4A 1GLJO 4BR5A 4ISFA 1BO5O 1SZ2A 4FOIA 2IVOA 3JS6A 2OANA 3DXKA 5AR0A 5AQQA 3ENHA 2E2QA 4RCHA 5AQIA 3VGMA 3WQUA 2VCPA 4PL7A 4H5RA 1P8ZA 2CH6A 2V51B 2IIRA 2A40A 4K25A 2P9NA 4FWKA 5AQVA 4BRHA 3FE1A 1NBWA 2P9UB 3QFPA 4DB3A 3ATVA 3DXMB 2BUPA 1QQOA 3O8MA 2P9KA 3VEXA 5AQZA 5AZIA 3GDQA 4XEIA 3CQXA 3WT0A 4IJNA 5AQFA 4IWVA 2YJEA 3ENOA 1WOQA 2W41A 3LDNA 5KQDA 2P9SB 2FLOA 1ATRA 3MCPA 3WEEB 1XQSC 2YI1A 5KPZA 1E4GT 3MN9A 1MWMA 4A61A 2I7PA 4H0TB 3CJ7A 4O5FA 4WYBA 2P9PB 5LY3A 4JHDB 4JAXA 4XH5A 4BRIA 4IO8A 4QS7A 4H5TA 4EIAA 3R6MA 2ZF5O 2VWBA 2FF6A 4EHUA 1NGAA 3BP8A 2CGKA 4CZJA 1QQNA 5EXWA 5F2RA 2AP1A 5AFUA 3KVGA 4LC9B 4FL9A 5AQNA 3CHWA 4B1YB 5F0XA 2E88A 3MK6A 3VEWA 1XUPO 3VENA 3FZHA 3MN6A 1X3NA 3QBWA 5AQOA 1BWFO 4FWSA 4YDUC 3U4LA 4K43A 3LDOA 3HZ6A 2E20A
chains in the Genus database with same CATH superfamily
3CCJN 3KK3A 2JGUA 1XHZA 2DPNA 3DXMA 1VQ6N 2UUAK 1WB9A 3S41A 2A1RA 5FPEA 4OKJA 2OZMA 3C6HA 2UXBK 1YAGA 3ZETB 5HROA 2ZWHA 4DQSA 3O9TA 1U6ZA 5BRDA 4B1WB 5HRPA 3FZLA 2YJFA 3OHRA 5FPDA 3M8RA 1NGFA 2VWJA 2IAJA 4X64K 5AQKA 4RW9A 4WFBL 3HSTB 4JLHA 2ITGA 4MLHA 3AVMA 4JKAA 3MWTA 5AZJB 5FPNA 1IKVA 3VQ9A 4B9UA 3MN7A 3SLCA 1NK7A 3Q7CA 4OPAA 3CC4N 2OZSA 4R5PA 2XHBA 4BE2A 1NK6A 3AVCA 1JXBA 3OVNA 1TUUA 1KFDA 1QTMA 4EP5A 4BC5A 3N4PA 2X6NA 4GNIA 2HNDA 1REVA 4AHRA 4L3QA 3EZ5A 1L3VA 4KI4A 4ID1A 3ZSRA 4E1JA 1L5UA 3S9HA 3R1XA 5GINA 3OTOK 4A57A 1VSJA 1S9EA 1KD1O 4JEPA 1U48A 3ULEA 4M3YA 1WBBA 4C23A 4FVUA 5KPTA 3CFPA 1J5EK 2P51A 3MXIA 1NWKA 3SNNA 3TSQA 4DG1A 2ZJPL 5AQMA 3E9OA 4B8AB 1QS4A 3M5RA 3NHGA 2ASPA 4DHYA 1HQEA 2FSKA 4DV3K 3CCVN 2NRZA 4C8KA 3L2VA 4FWLA 3CFRA 4FJ9A 4QAGA 2F9WA 3RTVA 4DFPA 3C6TA 4JKGB 4RW8A 3O1BA 1BIZA 3GOIA 4HTLA 1HNIA 5FDLA 3TU5A 4BR7A 4F8RA 4YORA 3CERA 2A1SA 4AHTA 3S3OA 2BANA 4DU3A 1X9SA 3VF2A 1S1TA 5AQRA 5BPNA 1TGOA 3AO2A 5C2DA 2G8VA 2KZZA 4FJNA 1KLMA 3ASMA 4DSLA 1RTIA 4FJ8A 1BGXT 2ZQBA 4PUOA 4FWQA 3RMBA 3O1WA 1TK0A 1X1PA 3HPHA 4PY5A 4YOXA 4CZEA 4DSEA 2YNIA 3V1QA 3Q7BA 1CLQA 4F2SA 3U8XA 1S22A 3NGZA 4CJKA 4RG8A 2G8HA 1CZ9A 1LWFA 3O08A 4UY8O 4N56A 4DU4A 4JK7A 2I7NA 1Z26A 3VF6A 3A2FA 4QS8A 3E9LA 3SUQA 1NG9A 5AQLA 1BOTO 4BE1A 4H0YB 4ID5A 1FXXA 4QS9A 1HRHA 4NYNA 1Z25A 3ZT4A 2O8BA 5FROA 3THYB 3ZT2A 3LALA 3RR7A 1YJNN 4A62A 1GLDG 2RPIA 4KV8A 4KH5A 5JVGL 4QOZB 3CCMN 3OJSA 3CETA 1S1XA 1BDGA 3QLHA 1WNSA 2O8CA 3M8PA 3THXA 2HF3A 1JCGA 2JWLA 4DR6K 1T8EA 4M3UA 1WSGA 1BIUA 1S5JA 1Q7YO 1C0MA 1VSKA 4CHNA 3L4QA 3TTFA 1IBMK 4DV4K 1NMDA 2NRHA 3ZX2A 4O55A 2P5OA 2KFNA 2VQEK 4Z4CA 3DRRA 4YY3K 3C6UA 4BRAA 2GBZA 3QINA 1KC8O 4HUEA 3E1YA 3CJ9A 3VQPA 3TANA 3AAQA 4KHNA 3HI0A 3I33A 4W5RA 1TVRA 2GV9A 5MLCQ 1NOZA 3I56N 4Q5VA 1VSDA 5JS2A 4PKGA 4FK2A 4JI5K 1Q9YA 4KO0A 3ZLJA 4CEAA 4IBNA 1FW6A 3V9UA 3D2EB 4NLCA 1A5WA 3BUZB 2GX9A 3L2RA 4OLBA 1GLFO 5BRFA 3HPOA 1TYQB 2QWNA 4N5SA 3LZIA 3HSCA 3A5NC 4KRFA 2F9TA 4XH4A 1S9GA 3I8BA 1QQCA 5ADXH 3L8BA 2IDOA 3OYKA 4CZKA 2YHWA 3MEDA 2XY7A 2O8EB 3T1YK 3RVCA 4K41A 3FGUA 4CHOA 1SAZA 5BRHA 3NFAA 1C0FA 2D0OA 2OCEA 3PX4A 3OS1A 1LCUA 2HHHK 4M42A 2IC3A 4BRFA 4M41A 5E84A 3VQ4A 3DXKB 5AQHA 4FJIA 3AGRA 2BE2A 3VQ7A 4B1VA 2YKMA 2A42A 3J80O 4DR4K 1L3TA 2BGGA 1WSFA 3WXKA 1V4SA 3MX2A 2P9KB 3HPGA 1JKHA 4JKGA 1LW0A 4CFBA 4IFVA 4JKBA 2PFUA 4BC3A 3KD5E 4DR7K 4DS5A 1TK8A 2PY5A 4M3TA 1T6CA 4WE1A 3M8QA 2QXFA 3WNFA 1D5AA 1SQKA 4CHYA 1YVUA 2D0BA 1QHAA 1WUAA 1RTJA 5ADXA 4BE0A 4EFHA 2E1ZA 1LOTB 3M3ZA 3SBTA 1N33K 4JV5K 4JKHA 1HNXK 1A5VA 1BU6O 4YOVA 1VQ9N 4CJWA 4Z4IA 4G9ZA 3ID8A 3WNGA 3K5LA 4DTXA 1C0TA 2OPQA 1W0HA 1DTTA 1KAZA 5AQPA 2A6AA 4JKCA 1C1BA 2ZGZA 2BTFA 3E66A 1Q9XA 4B9QA 3THVA 4V19S 3LAKA 4NO7A 2E2OA 3CG7A 3DOLA 3FFKB 5M1NA 3D7EO 4IKFA 1GOCA 1WBDA 5EY4A 2Z1HA 1J9AA 4ISFA 1SZ2A 2RF2A 3DM2A 5AQQA 5AQIA 3VGMA 3LWLA 4AILC 5CHIA 2HHWA 2V51B 3OYEA 3CCEN 2P9NA 5AQVA 4BRHA 4CJ4A 1XMQK 2KTQA 2Q3SA 1TKXA 4YOWA 3QFPA 3DXMB 1N5YA 3VEXA 3WXMB 1IO2A 4XEIA 3JAMO 4JI7K 1X9WA 2B6AA 4LF8K 4HUFA 1L3UA 2B4JA 2EHGA 5AQFA 5BR8K 4IWVA 3CCQN 4OLAA 1RCHA 5KQDA 1ZBHA 2YHBA 3HRGA 3MCPA 4DTJA 3O3FA 1XHXA 2W42A 4OKEA 2YI1A 1MWMA 2XY6A 1NMNA 3CJ7A 3IKMA 4XH5A 1HYVA 4BRIA 4NXMK 4QS7A 4FJGA 4FZZA 4JI3K 2ZF5O 5KRSA 3D45A 3SPZA 3CMEN 1RT3A 5LL6Z 1BISA 3OYGA 4KHQA 1RDCA 3PIOL 5F2RA 2AP1A 5AFUA 3KVGA 4LC9B 3MXJA 2HVIA 5CYQA 4WFNL 3R3LA 4B1YB 4DTSA 4RW4A 1QVGM 4K8ZA 3MXMA 4FJKA 1GOBA 3LP1A 3I55N 3FZHA 5GAHP 1VSFA 4E7JA 1IBKK 1BWFO 1ASUA 4IFEA 4FJLA 2QKBA 3F9KA 2YNHA 3U4LA 2HHTA 3TAFA 3OYDA 4CZLA 4CJFA 3GL1A 1J53A 1VQON 4E1MA 1UA0A 4B1ZA 2G8FA 4JN4A 4BWJA 3LZJA 3P83D 3CC2N 3PO5A 5EU7A 3J7ZO 4M7YA 2NLXA 4B3TK 2HBMA 2NRTA 2E1YA 4ISGA 1VSLA 1HMVA 1YITN 4DF4A 1RDDA 3LAMA 4OPHA 3WEEA 3CCSN 4NXNK 2WBNA 1VSEA 3QBXA 2YX6A 4FJMA 1HUXA 4JHDA 1NJYA 1K8AO 1S1UA 2WFBA 5AQYA 4DMNA 3CXCM 3HL8A 3QICA 1D9FA 1EWRA 2KZMA 1I39A 1VK0A 1S3XA 2GUPA 4LFAK 2EX3A 3OW2M 2W40A 2QWMA 4H5WA 1L3SA 1OH5A 4H0XB 3MDQA 4FLUA 2QA4N 3HO1A 4C1NK 1XC3A 2QW9A 5GIOA 4U67L 4CJ3A 4FJHA 4PKIA 4Z4EA 3IDHA 4MO5A 1KXPA 1VRUA 3CJAA 1UOCA 4LH5A 5C25A 3AVBA 3VOVA 2PYJA 2R7YA 4LF6K 2P1JA 3EO3A 3SJHA 3DLRA 3HBTA 3VQ8A 1Z6RA 2IS3A 4OPJA 3ZX0A 3BF1A 4JD2A 1O13A 2HMPA 3CQYA 1D9DA 3W0LA 3SK3A 4H5VA 2HHXA 4LY7A 1ASVA 4DTPA 2NRXA 5K14A 2XY8A 4FPAA 4FWPA 2AJQA 2GEMA 2O8BB 5CR4A 3HVTA 1NK5A 1BL3A 1SUQA 3O6WA 3RMDA 4FO0A 4BDYA 1CXUA 1YJ9N 2Z1JA 1R0AA 5FLXO 1NGCA 2JWKA 3DOKA 3V1OA 5I9EB 1MA9B 5KGWA 3THXB 2E2PA 3CYMA 3F9MA 2UXDK 4UQGA 3LDQA 4F3TA 4JS4A 4FLZA 1X3MA 3AO1A 5EX5A 1K73O 4CGDA 3MEGA 5D3GA 3AY9A 3DLEA 4DUYK 1QQMA 4BRQA 1TKDA 5EVZA 1RT1A 4CJEA 5DMRA 1VHXA 1HNZK 4E0DA 4FZXC 4KTZA 3T19A 2Q2RA 5AQTA 4FVMA 1KRPA 4BREA 3SCXA 2VWKA 4CD1A 3ZEUA 4CEQA 5BPMA 4CZHA 2VGMA 3CI5A 3QETA 4BRGA 2UUCK 4JKDA 4RWTA 3T7ZA 2O8FA 1WSHA 2FXUA 3OY9A 5I3UA 4CHZA 4CFDA 3L6QA 4DUZK 3KTQA 2NRVA 4I2QA 4DTRA 4EZ9A 4HWIA 2RKIA 4CJPA 2GTDA 4DQQA 4DR2K 4CJ7A 2VG5A 4E7KA 1RBUA 5FRMA 1TKZA 4BY9C 3QEIA 3VQDA 1VQLN 1GLAG 1DGKN 2QM1A 1VSIA 3TAGA 1SV5A 2HBKA 1NOYA 5LMNK 3V1RA 1QSYA 4LF9K 3L0QA 2WUSA 1T6DA 4KHSA 4FWOA 4I6MA 2YV0X 3BDPA 5J2NA 4DTMA 3KKRA 4CK2A 4Z4HA 3LL3A 4H0OA 4W5OA 1BCMA 4DV5K 5IWAK 1BA1A 3CQ8A 1HYZA 4DLEA 3AO4A 3VQEA 3HOSA 1FJGK 3DJCA 1Y64A 4LFBK 1C1CA 2A41A 4FPBA 5BREA 4FK4A 2V52B 3SUPA 1IKWA 4CEEA 4IOCL 3EN9A 4N76A 1RDBA 4CBWA 4MDAA 2QTDA 2HMIA 2Q1NA 3GE1A 3TAPA 4IFYA 5M1FA 4KB1A 3BGRA 3SUOA 1NGGA 2OPRA 2OA8A 2Q31A 4H4MA 3H3NO 4ZTFA 4FW2A 1N6QA 3VERA 4DV6K 4FJ5A 1QSSA 4CIGA 1IH7A 1NGBA 4CGJA 3AA5X 1KLNA 4OO1J 1T7PA 2P5GA 5AQUA 3NAEA 3HP6A 5JS1A 4HHTA 1IG9A 1NK8A 2UU9K 3BF3A 1C6VA 2VYPA 3MCAB 4K0KK 3VETA 3OA9A 1C0UA 5JICA 3EKUA 4ELTA 3AA2A 3VEVA 1ZC6A 1U04A 3HP9A 4B1XB 5EOYA 4J8FA 5KTQA 3NMUA 4Y0WA 3C7NB 3MWPA 4KB0A 1RTHA 2X6SA 2DFFA 4CFAA 3BEXA 1JL2A 3J7YP 3NH2A 4CZFA 5C0YA 3VF4A 1K9MO 3J7AP 1ZBUA 5DM7L 5JVHL 1BUPA 2BDPA 3LM9A 3QNNA 2J4RA 2P9NB 4IG0A 3PY8A 1GLBG 3EY1A 3O5BA 4CBXA 1IBLK 2QWQA 3OYMA 1M1KO 1BCOA 3K5OA 3V9ZA 4K42A 3QMLA 2FC0A 4JRPA 4HTUA 2E4LA 4Q0BA 4C8MA 4CF1A 1T3VA 4H0VB 4BRKA 2ZD1A 4ELUA 4KHYA 4BRMA 1JL1A 4CHQA 4O44A 1SKSA 2PAVA 4OGCA 3H6EA 3CCUN 4KPYA 3MMVA 4KHPK 4DU1A 1HPZA 3B6OA 3VMFB 1OH6A 3P5JA 3CM5A 3CJ1A 4C8OA 4DSIA 4BC2A 3PIPL 4XH1A 4JK9A 4CECA 1Z05A 3A0IX 1QZ5A 3TPQA 2ITMA 4ZTJA 2PBDA 3A5OC 4BGAA 3CFOA 4I9LA 4J2EA 3M8SA 2B5JA 4ZHRA 1IG8A 2WC9A 1GLEG 2D1KA 1D8YA 3AVGA 3AO5A 5HLFA 3IFRA 5AQSA 1N36K 3NF7A 1S72N 5M1KA 4DR1K 3JS6A 2OANA 1RTDA 3WQUA 1RDUA 2VCPA 1F21A 4PL7A 5J1EA 4YNQA 1RT5A 5J2MA 2A40A 4FWKA 1VQ4N 4DV2K 3K2PA 4DS4A 4DB3A 5AQZA 1JLFA 3GDQA 4DV0K 4JI6K 2F8SA 3QNOA 3CF5L 4CGHA 4DLGA 3WT0A 2YJEA 2D0AA 1HNWK 4IDHA 2W6LA 2FLOA 2HB5A 2HNYA 3SYZA 3WEEB 5KPZA 3AVJA 5C2FA 3MN9A 2I7PA 2PZSA 4O5FA 1OH7A 4WYBA 4JHDB 3AGKA 4H5TA 4EIAA 3R6MA 3AA4A 3O3GA 2VWBA 5CZ2A 4HVJA 2RE2A 4EHUA 1NGAA 3BP8A 2OYQA 2E5LK 1RT4A 2W6KA 1QQNA 3P38A 1YTUA 3NF8A 1NKEA 5AQNA 4WF9L 3O9UA 3CMAN 1SL2A 4C8NA 3ZT0A 2YHAA 2ZE2A 3OYFA 2KKZA 3VENA 3OYAA 4I7FA 4E19A 3QBWA 4YOUA 4KI6A 5E41A 3HZ6A 4OX9K 1Q81O 4BRLA 4BC4A 2X78A 4DTNA 2V7ZA 2HW3A 4BDPA 4EP4A 5GADP 4CJVA 4B3RK 4FXDA 3I0SA 3VN5A 1TL1A 1QE1A 3OS0A 1XMOK 3E01A 4JD2B 4NYFA 4CZGA 4BRNA 3G6EN 3KLIA 2KW4A 4E1NA 1RT6A 4WQ5C 3VA3A 4MLEA 3IUCA 3K5MA 4H4OA 1HNVA 4OGEA 3DLHA 4HUGA 3A5LC 4CK1A 3RR8A 5TKYA 3SV3A 4CD3A 1QSLA 2Q0UA 5M1OA 4EAHD 3D0PA 3G0ZA 3C7NA 3THWA 4LF4K 3V6DA 1BQMA 4MO4A 5LJWA 3DMJA 4FJXA 2G8UA 3L3UA 3CPEA 3VQ5A 3DWLA 3L2QA 2G8WA 5AFUH 4KBOA 1YVNA 3VEOA 1LWEA 3ZSVA 1U47A 2HOEA 4FCYA 2HVHA 4BQZA 3S3MA 1NJZA 3LPUA 4FWMA 5FPMA 1U4BA 5KRTA 3KLGA 1Q18A 5M1PA 5AQJA 4LF7K 3FFIA 2OTLN 3DLKA 2DTUA 1VSHA 4BRPA 4Z4GA 3UKRA 3ZEUB 3SMSA 4FM0A 3AVLA 1XC9A 1R59O 3K9JA 1J5OA 1U2VA 4PL8A 3QEPA 1OH8A 2FBVA 3KZBA 2KLAA 4CJUA 2P9LA 4CCHA 2O8FB 4BDZA 1NLVA 3FZKA 3P39A 4WQ5A 5BN8A 4R79A 4PA1A 3HJFA 4NLBA 5E26A 2QWRA 3AA3A 3EEQA 1ATNA 4L8RB 3E9PA 4MDBA 4CIEA 4FOEA 4FZYA 1YXQA 3VTHA 2OTJN 2RHKA 5J2PA 2CH5A 4BR9A 3QFUA 3DLLL 2QWOA 5HRNA 3NF6A 1XNQK 5GIPA 1NGJA 4CEOA 3VQAA 4W5QA 3QESA 4F4KA 1H1VA 1ZYQA 1N8RO 4LFCK 3LDLA 4CE9A 4B3SK 3VQCA 1KAXA 1TKTA 3KHYA 4AHCA 3PV8A 4J2DA 3O9SA 3ENBA 2QI2A 4DR3K 4CEDA 3AVNA 3KLEA 2O4IA 3BZKA 3H1VX 4BRDA 1SKWA 4IOXA 1RBVA 1I3AA 4B9SA 4GV3A 4I6MB 3LM2A 5H1SQ 5T7BA 3RSEA 1HX1A 2ATQA 1KFSA 1RNHA 1HJOA 3FZMA 1VQ5N 4AHVA 3LDSA 3LP3A 5HL7L 3O3HA 1WN7A 4BR2A 4DSJA 2YHXA 1WAFA 4NB4A 4F2RA 1J54A 3ZSXA 4FW1A 3PUFA 3LANA 3PLAA 3H3OB 1KAYA 1W9HA 2WOMA 3EZWA 4CIFA 4M3RA 3ZX3A 5JLHA 3QB0A 1JJ2M 3ULDA 4QCLA 4CEBA 4CJQA 4ILJA 3K57A 3CM6A 1K8KA 4FYDA 3LP0A 4FWNA 3SUNA 3T69A 1WSIA 2IVNA 4DFKA 3G25A 3UE5A 5CE3A 3O4WA 2XO7A 2NUBA 3DLBA 4W5NA 1SS6A 3CJCA 4F9OA 2KQ2A 3U3GA 4CFCA 4CGFA 1N32K 4A2BA 3SI6A 1S6QA 1Q8IA 5KI6A 1Q82O 4H8KA 1BG3A 3O4QA 4LSNA 5BPLA 4BG8A 5HP1A 1RBRA 3T1AA 1LV5A 2CGJA 2QXLA 2VG6A 4Z0UA 3LDPA 4CJTA 1DLOA 2FBYA 5CYMA 3U9DA 1UAXA 1B92A 3KK1A 4BG9A 4CHPA 4JYAK 3HVRA 3GG4A 4PWDA 1EKEA 5C42A 3PSFA 4O8KA 1OVQA 3LPTA 1TV6A 3QEVA 1ZXOA 4LSLA 1LAVA 3LWMA 3KWGA 3C0BA 1T03A 3SQ0A 2PYLA 1ZBIA 3OBYA 2FSNA 3IS9A 3K59A 5IT9O 4IXCA 3RRGA 3KD1E 1IKXA 3VEZA 3D2FA 2YCHA 4DTOA 1EX4A 1ZBSA 4GKKK 4CZIA 2HHQA 4IDKA 1NGIA 5HRSA 5B8HA 3U9ZA 4IEIA 1LWCA 4B3MK 2A5XA 2WTUA 4FLTA 3ZSZA 4LD0A 3NDKA 1C1AA 5ELZA 3WXJA 2DFHA 3L2WA 4CESA 1JLGA 3TSPA 1J6ZA 1EP4A 2P9IB 4FWRA 1WAJA 2D0CA 4H0PA 5C12A 3O9QA 4GY2B 3JSMA 4J2BA 3QDKA 5M1QA 4B9NA 1YF5L 1ILYA 3HT3A 4BR0A 2LSNA 4AHSA 4FM2A 4DSFA 1KQSM 4DSKA 4M3ZA 4Z4FA 1TAUA 1JLAA 2HHUA 3HYFA 4YOTA 4BROA 4IJAA 3FLCO 4ICLA 4JS5A 1NJIO 4X66K 2YNGA 3DYAA 5C24A 3MAQA 1LW2A 1EETA 1KCFA 1ZBLA 3NH0A 3CC7N 1JLQA 1RFQA 5KPRA 3ZT1A 1QHTA 2Q97A 3NF9A 1RDWX 5A2QO 1ITGA 2QEXN 3KKSA 4BQLA 4BWMA 4TSXA 4CF2A 3TABA 3RMAA 4CF0A 4DCHA 4KAZA 3TAMA 3UKUA 5I42A 3QERA 2Y1JA 2H3GX 2KHOA 2ASOA 4FK0A 3O9RA 3VTIA 3L4IA 2BH1A 4JI2K 4B9MA 1BA0A 4M3WA 1V4TA 4M7XA 5CY4A 3VQQA 1HKBA 3N4QA 3CD6N 3ISNC 3ZT3A 4N41A 1GOAA 4IOAL 1MWKA 1JCEA 1FKOA 3EL2A 1G99A 2F96A 3OYHA 3PSIA 4GVEA 3KLHA 4DF8A 2HBLA 3P4IA 4DFJA 3DI6A 4Z94A 3IAYA 4Y1CA 3DLGA 3VGKA 1HR0K 1S1VA 5FRNA 4FJ7A 4HCCA 3L3VA 4FSVA 3K0SA 4B9TA 3OYLA 4BR5A 3F73A 1BO5O 3SAGA 2IVOA 2FBTA 4FM1A 3ENHA 2E2QA 1KSPA 1VRTA 2CH6A 4H5RA 2Y1IA 3C94A 2IIRA 2NRWA 3FE1A 1FKPA 1NBWA 2P9UB 4MFBA 2VQFK 2BUPA 1K6YA 4DQIA 3O8MA 2Z1IA 1UA1A 4J2AA 3BZCA 5AZIA 3AVHA 3SBGA 4FLVA 3O4NA 1WOQA 2W41A 3LDNA 4EZ6A 4HCBA 4GW6A 2P9SB 3OYBA 3TSUA 1ATRA 3C6AA 4CW7B 1LAWA 4RW6A 3SV4A 1JLCA 1E4GT 4A61A 4H0TB 2OPPA 5LY3A 1OVYA 4JAXA 4IO8A 3UIQA 4PHTX 1W7AA 3I0RA 1U45A 5HOOA 3KK7A 3THWB 3SQ2A 4DR5K 4CZJA 4BACA 4CJLA 4FL9A 3L2UA 4MQ3A 3CHWA 4GMJB 3J81O 5F0XA 2E88A 3VEWA 2F4VK 1XUPO 4O8UA 3MN6A 1X3NA 1JLEA 5AQOA 4JKEA 4YDUC 3D6RA 4O5BA 3VQBA 3K5NA 3G4SN 2I5JA 3DRSA 4K43A 4E7IA 3TI0A 3NH1A 4KHUA 5GAGP 2HHVA 2YHYA 3SMPA 1DKGD 3UKRB 2A3ZA 4YHHK 3QEXA 3PX0A 1U2VB 2P9LB 3K9KA 3CIPA 2QWPA 1EQYA 1SL0A 3HM9A 2P9IA 3MECA 2HHSA 3SPYA 1HYSA 3V9SA 3KLFA 2P9PA 3WQTA 2Q0RA 2UYTA 1WSEA 2IVPA 3RMCA 4DWIA 3MX5A 5GAEP 5HBMA 3EE9A 1T05A 3IG1A 2Q36A 3QIPA 3UB5A 2AA4A 4CGGA 1GLCG 1VQ8N 1NM1A 4JI0K 4CF9A 3AAPA 3R9PA 4G1QA 3M6GA 4JKFA 1G15A 4BVPA 1BI4A 3KIOA 4KH4A 4YDUA 1RBTA 5AQXA 3SJJA 1IV0A 1NKBA 3QO9A 3M1FA 4KTWA 3RSEB 2D4WA 3VGLA 4ISEA 2UUBK 5AQGA 4BGBA 1NK4A 5BN9A 3V81A 4BRCA 1B9FA 3O80A 1VQKN 3HTVA 4GVMA 3WNHA 1DT9A 2FF3B 3ZETA 1IJJA 3LP2A 1RT7A 1VQMN 4WFAL 4M45A 4JI8K 1W2BM 2EWSA 2ZJQL 4CEFA 4DQPA 4IEEA 1U49A 3HXMA 3TR8A 4I9QA 3P31A 1HKGA 2GWKA 4H5NA 3WUHA 3ATUA 3HK2A 5AZJA 3FZFA 4O4GA 4B08A 4DQ8A 1K8KB 3JXUA 1QVFM 4KKOA 3CCRN 5JLFA 4E7HA 1HPMA 3G71N 4E89A 1GLLO 3V9WA 1C0GA 3AVFA 4IZ9A 1EXQA 4JNEA 1TK5A 4WQ4C 5SWMA 4C8LA 4CERA 3NBPA 1VQPN 2ZGYA 3SZ2A 4CGIA 2GELA 3MEEA 3VESA 4AH9A 1NK9A 4E7LA 4FJJA 3DAWA 3SAHA 3W3DA 3WXIA 2HF4A 4PKHA 2E2NA 3A5MC 4XIUA 4JI1K 4OPKA 3NGYA 3OS2A 4ILHA 1X9MA 2P9UA 3TAEA 4NCBA 3T3FA 1HLUA 1YI2N 3AVIA 4YOYA 4PQUA 1E3MA 1X9JA 3MN5A 4B9LA 1KTQA 3NGIA 3OYCA 4CVNE 3VQ6A 1EO1A 2V7YA 3QIOA 4H03B 2FBXA 4M63C 2D0PA 1KVCA 2P9SA 4O0IA 2ZJRL 5DM6L 3V4IA 1P90A 2Z1GA 1CXQA 4YFUA 4FLXA 2CGLA 4CBUA 3VPZA 4DV1K 3D2FB 3V9XA 4B3OA 3U3YA 4WCEL 3KWIA 2O8DB 4LH4A 1BQNA 4A5AA 3EE8A 2YNFA 3TTCA 4C1NI 4WQ4A 1BHLA 1VQ7N 3TARA 4X65K 3CCLN 4IO9L 2QK9A 4EHTA 1NGDA 4DKWA 4B9VA 4BVOA 2D5RA 3B8AX 3H1QA 3OYIA 3AO3A 2WONA 4B8CA 3H45C 1I94K 1WLJA 2F8TA 2DY4A 4CZMA 2HSTA 4RW7A 1NJXA 4AM6A 1QZ6A 1CZBA 3AARA 4DFMA 4N47A 3ZSWA 3K58A 3G10A 4KFBA 1NNEA 1UWBA 3ITHA 1RILA 1ESVA 4KTQA 4A5BA 3WXLA 1D4XA 5C10A 1RBSA 1VQNN 1ZBFA 1XI1A 4CJSA 5BR9A 1OKJA 3VA0A 3U6FA 1S1WA 1KVBA 2HNZA 2OPSA 4JRQA 4GKJK 2GUIA 2E6LA 3T1HK 2QWLA 3ZSQA 1N34K 3C95A 3THYA 3B6PA 3UKUB 1MDUB 4I2PA 3AV9A 1SKRA 2O4GA 2NZTA 5TKWA 1O1WA 5LJVA 3KJVA 3GBTA 2E8AA 2ASMA 1Q86O 2HBJA 2XRIA 1E4FT 4JI4K 4ILGB 3NVKA 2VGNA 1WSJA 2IOCA 3NCIA 1JLBA 5HRRA 2GWJA 2G8IA 4W5TA 1YT3A 4FLWA 1YJWN 4RTFD 1JCFA 5KQ8A 2X74A 3A8YA 5AJ3K 3ZSOA 3TAQA 4X62K 2UXCK 3RRHA 1IKYA 5AQWA 5LMUK 4GV6A 2RN2A 3ULEB 4CI6A 3ID6A 3NVMA 3OJUA 5CZ1A 3HOTA 4M3XA 1NGHA 4AM7A 3CPWM 4JK8A 3HM8A 5AZIB 1NU0A 4E3SA 1ASWA 4DTUA 1NGEA 1HKCA 2DFEA 3PX6A 1CZAN 1YUWA 4NCAA 3EKSA 5F1XA 3OBWA 3H46O 1HJRA 1TAQA 3IMXA 3D2EA 1TUYA 1MU2A 3C65A 1KVAA 1DEJA 4KH6A 3ZYYX 5KGXA 1B9DA 2YKNA 1JXEA 4LF5K 4KREA 4OKKA 4BR4A 3FR0A 5JMVA 1TYQA 2FSJA 2NNWA 3J8AA 2ETJA 4IG3A 4CEZA 1T44A 4OVLA 2ZM6K 2O8EA 1ATSA 3R8EA 4DV7K 3VEYA 4A2AA 1RGIA 4B1UB 3SQ4A 1EWQA 3RWUA 4AHUA 2G8KA 4CK3A 3CJBA 4GV9A 1HQUA 1M90O 4ELVA 3DRPA 3OYNA 1GLJO 3TTDA 4FOIA 1Y97A 3DXKA 5AR0A 3QEWA 1YTAA 4RCHA 1VAZA 3KK2A 1P8ZA 2IGIA 5C15A 1RDAA 4K25A 3NE6A 3ZCMA 1XWLA 2KFZA 1SL1A 3ATVA 1QQOA 2XY5A 2P9KA 4AF1A 4CJRA 1DTQA 4A59A 5SZTA 4F3OA 3CQXA 3IRXA 2O8DA 4IJNA 3I8DA 3ENOA 1YIJN 1A5XA 2JLEA 4NCGA 3S3NA 5DK5A 2F7TA 3WNEA 1NKCA 3ZSYA 1XNRK 4K8XA 2NRRA 2E6MA 3F2KA 3AVAA 1VSMA 3PO4A 3JYTA 1XQSC 4Y1DA 3EYZA 1W97L 4FLYA 3OYJA 2P9PB 3AVKA 1NJWA 4U7BA 3BY5A 3TWHA 1NK0A 1YHQN 4OJRA 2FF6A 3SAFA 2CGKA 1FK9A 5EXWA 3P1GA 4O0JA 4KHWA 2O8CB 2QKKA 1BI4B 3F5TA 1TL3A 3H08A 1RT2A 3ALYA 3MK6A 3SQ1A 4CJ5A 5J2QA 4FWSA 2VG7A 4DQRA 4AQYK 3LDOA 1S6PA 4CF8A 2E20A
chains in the Genus database with same CATH topology
3CCJN 4CZLA 1Q81O 3GL1A 4BRLA 4BC4A 2V7ZA 2DPNA 5GAGP 1VQON 3DXMA 1VQ6N 4B1ZA 3S41A 5FPEA 3C6HA 5GADP 4JN4A 1YAGA 3ZETB 3CC2N 2ZWHA 3J7ZO 3O9TA 2YHYA 3SMPA 1DKGD 3UKRB 1U6ZA 5BRDA 2A3ZA 4M7YA 4B1WB 3FZLA 2YJFA 3OHRA 5FPDA 2NLXA 1NGFA 1U2VB 2HBMA 2NRTA 2E1YA 4ISGA 4JD2B 4CZGA 1YITN 2P9LB 4BRNA 5AQKA 3G6EN 3K9KA 4WFBL 3CIPA 2QWPA 4MLHA 1EQYA 4OPHA 3WEEA 4WQ5C 3CCSN 2P9IA 4JKAA 2WBNA 4MLEA 3MWTA 3IUCA 5AZJB 5FPNA 3QBXA 3MN7A 3SLCA 2YX6A 1HUXA 2P9PA 3Q7CA 2Q0RA 2UYTA 4JHDA 4OPAA 3WQTA 3CC4N 3A5LC 2IVPA 1K8AO 5TKYA 2WFBA 5AQYA 3MX5A 5GAEP 4CD3A 2Q0UA 3CXCM 5M1OA 4EAHD 3QICA 3C7NA 3EE9A 2Q36A 3UB5A 2AA4A 1TUUA 1GLCG 1VQ8N 1NM1A 1S3XA 4MO4A 2GUPA 5LJWA 3AAPA 3R9PA 3OW2M 2W40A 2QWMA 3CPEA 4H5WA 3M6GA 4JKFA 4BVPA 4H0XB 3MDQA 4BC5A 3DWLA 3N4PA 4KH4A 4YDUA 2QA4N 4C1NK 5AFUH 4KBOA 1YVNA 4GNIA 5AQXA 1XC3A 3VEOA 2QW9A 4L3QA 5GIOA 4U67L 4E1JA 3M1FA 2HOEA 4PKIA 3RSEB 2D4WA 3IDHA 4BQZA 3R1XA 3VGLA 5GINA 4ISEA 4A57A 1KD1O 4JEPA 1KXPA 4FWMA 4MO5A 3CJAA 5AQGA 5FPMA 3ULEA 3ZYYX 4BGBA 5BN9A 4BRCA 1Q18A 3O80A 5M1PA 4C23A 3HTVA 5KPTA 1VQKN 5AQJA 4FVUA 3VOVA 1NWKA 1DT9A 2OTLN 3TSQA 2FF3B 3ZETA 2ZJPL 5AQMA 3E9OA 4BRPA 1IJJA 3EO3A 3UKRA 3ZEUB 3SMSA 3SJHA 1VQMN 1R59O 3K9JA 3HBTA 4WFAL 3M5RA 1Z6RA 2ASPA 1W2BM 2EWSA 1U2VA 3ZX0A 4DHYA 2ZJQL 4PL8A 2FSKA 3BF1A 4JD2A 3CCVN 2NRZA 2KLAA 3KZBA 2P9LA 4IEEA 1O13A 1NLVA 3FZKA 3P39A 2HMPA 3CQYA 4FWLA 4WQ5A 5BN8A 4R79A 3W0LA 3SK3A 4H5VA 4NLBA 3P31A 2QWRA 5E26A 1HKGA 2F9WA 2GWKA 4H5NA 3WUHA 2NRXA 3ATUA 1ATNA 4JKGB 3FZFA 3E9PA 3O1BA 4DQ8A 1K8KB 4FWPA 3GOIA 3JXUA 4FPAA 4HTLA 4MDBA 2GEMA 1QVFM 3CCRN 4FOEA 5AZJA 5JLFA 1YXQA 5CR4A 3VTHA 2RHKA 3TU5A 4BR7A 2OTJN 1HPMA 2CH5A 3G71N 3O6WA 1GLLO 4YORA 4FO0A 3CERA 4BR9A 3QFUA 1C0GA 4IZ9A 1YJ9N 3DLLL 4JNEA 2QWOA 4WQ4C 5GIPA 1NGCA 1NGJA 3VF2A 2JWKA 1H1VA 1N8RO 1VQPN 3LDLA 2ZGYA 5AQRA 5I9EB 5BPNA 1KAXA 1MA9B 2GELA 5C2DA 2E2PA 3KHYA 3VESA 3F9MA 3O9SA 3ENBA 3DAWA 3SAHA 2QI2A 3W3DA 3WXIA 2HF4A 4PKHA 2E2NA 3LDQA 3H1VX 4BRDA 1X3MA 5EX5A 3A5MC 1K73O 4IOXA 4GV3A 4I6MB 3AY9A 3LM2A 5H1SQ 4FWQA 1QQMA 3RSEA 1HX1A 4ILHA 4BRQA 5EVZA 1HJOA 3FZMA 1VQ5N 2P9UA 3O1WA 1HLUA 1YI2N 4YOXA 4CZEA 4YOYA 5HL7L 3Q7BA 2Q2RA 3U8XA 4BR2A 1X9JA 1S22A 3MN5A 5AQTA 4BREA 4CD1A 2YHXA 3ZEUA 5BPMA 4NB4A 4CZHA 3O08A 2VGMA 2V7YA 3CI5A 4H03B 4UY8O 1EO1A 4JK7A 4M63C 2I7NA 2D0PA 4BRGA 3H3OB 1KAYA 4JKDA 3VF6A 2P9SA 3T7ZA 4RWTA 3EZWA 2ZJRL 4QS8A 5DM6L 2FXUA 1P90A 3E9LA 3ZX3A 5JLHA 3QB0A 1JJ2M 5AQLA 2CGLA 1BOTO 3L6QA 4CBUA 3VPZA 4H0YB 3D2FB 4ILJA 2NRVA 4QS9A 1K8KA 4HWIA 4FWNA 4WCEL 3KWIA 3T69A 2IVNA 2GTDA 4A5AA 3G25A 3UE5A 3EE8A 4CJ7A 5CE3A 3TTCA 3O4WA 4A62A 4C1NI 1YJNN 4WQ4A 1GLDG 1VQ7N 4KH5A 1SS6A 5JVGL 4BY9C 3CCMN 3CJCA 4F9OA 3CCLN 4IO9L 1VQLN 4A2BA 3CETA 1GLAG 4EHTA 1DGKN 1BDGA 1NGDA 2QM1A 1Q82O 4DKWA 4BVOA 1BG3A 3B8AX 3H1QA 2HBKA 4BG8A 5BPLA 2HF3A 1JCGA 2JWLA 3L0QA 3H45C 2CGJA 2QXLA 3LDPA 2WUSA 3U9DA 4CZMA 2HSTA 1T6DA 4FWOA 4BG9A 1Q7YO 4I6MA 4AM6A 1QZ6A 3L4QA 3GG4A 3AARA 3TTFA 3LL3A 4H0OA 4O8KA 1NMDA 2NRHA 3ZX2A 1BA1A 4BRAA 3HOSA 3DJCA 1Y64A 1ZXOA 1KC8O 1ESVA 2A41A 4FPBA 3E1YA 4A5BA 3CJ9A 5BREA 3KWGA 2V52B 3C0BA 3WXLA 1D4XA 5C10A 3PLAA 3AAQA 3HI0A 3I33A 3EN9A 4IOCL 1VQNN 3OBYA 2FSNA 4CBWA 4MDAA 5MLCQ 2QTDA 1OKJA 5BR9A 4IXCA 2Q1NA 3GE1A 5M1FA 3I56N 1NGGA 3VEZA 4PKGA 2Q31A 2YCHA 3D2FA 2QWLA 1ZBSA 3H3NO 3VERA 4CZIA 1NGIA 3UKUB 5B8HA 3U9ZA 1MDUB 4IEIA 2A5XA 1NGBA 5TKWA 2NZTA 5ELZA 3D2EB 5LJVA 4OO1J 4NLCA 3WXJA 3GBTA 3BUZB 5AQUA 2E8AA 2GX9A 2ASMA 1Q86O 3TSPA 1J6ZA 2HBJA 2P9IB 4FWRA 1GLFO 5BRFA 1E4FT 4H0PA 1TYQB 2QWNA 3BF3A 3O9QA 4GY2B 5C12A 3HSCA 3A5NC 4ILGB 2F9TA 2VYPA 3I8BA 3MCAB 4XH4A 3VETA 3OA9A 3QDKA 5ADXH 5M1QA 5JICA 3NVKA 3EKUA 4CZKA 3VEVA 2YHWA 1ZC6A 1YF5L 4B1XB 1ILYA 2VGNA 5EOYA 4BR0A 4J8FA 1KQSM 3RVCA 3NMUA 4Y0WA 4K41A 3C7NB 3MWPA 3FGUA 1SAZA 5BRHA 1C0FA 2D0OA 4YOTA 3BEXA 4BROA 1LCUA 4IJAA 3FLCO 1NJIO 2GWJA 4BRFA 4CZFA 5C0YA 1YJWN 4RTFD 1JCFA 5KQ8A 5E84A 3VF4A 1K9MO 3DXKB 5AQHA 3A8YA 5DM7L 3AGRA 5JVHL 3CC7N 1BUPA 4B1VA 1RFQA 2A42A 5KPRA 3LM9A 5AQWA 2Q97A 2J4RA 4GV6A 1RDWX 2P9NB 1GLBG 3ULEB 3WXKA 3ID6A 3NVMA 4CI6A 1V4SA 3O5BA 4CBXA 3HOTA 2QEXN 1NGHA 2QWQA 3MX2A 4AM7A 2P9KB 3CPWM 4JK8A 3HM8A 4BQLA 5AZIB 1M1KO 4JKGA 4DCHA 4JKBA 2PFUA 4BC3A 4K42A 1NGEA 1HKCA 3QMLA 1CZAN 1T6CA 3UKUA 1SQKA 1YUWA 2H3GX 2KHOA 1T3VA 3EKSA 2ASOA 4H0VB 4BRKA 5F1XA 4BRMA 3OBWA 3H46O 3O9RA 3VTIA 3D2EA 1TUYA 2BH1A 2PAVA 3C65A 3IMXA 1DEJA 1QHAA 3H6EA 3L4IA 1WUAA 4KH6A 3MMVA 3CCUN 1BA0A 5ADXA 1V4TA 4M7XA 4EFHA 2E1ZA 3VMFB 1HKBA 1LOTB 3FR0A 3M3ZA 3N4QA 3SBTA 4BR4A 5JMVA 4JKHA 1TYQA 2FSJA 2NNWA 3CJ1A 3CD6N 1VQ9N 1BU6O 3J8AA 4YOVA 4BC2A 4G9ZA 3PIPL 3ID8A 4XH1A 4JK9A 1T44A 1Z05A 4IOAL 3A0IX 1MWKA 1KAZA 1JCEA 1QZ5A 5AQPA 2A6AA 2ITMA 3TPQA 2PBDA 3EL2A 1G99A 1ATSA 4JKCA 3R8EA 4GVEA 3A5OC 4BGAA 3VEYA 2ZGZA 4A2AA 2HBLA 3P4IA 1RGIA 2BTFA 4Z94A 4B1UB 3E66A 1IG8A 3VGKA 4B9QA 2WC9A 1GLEG 2D1KA 3CJBA 4NO7A 2E2OA 1M90O 4GV9A 3FFKB 3IFRA 4FSVA 3D7EO 5AQSA 5M1NA 5EY4A 1GLJO 3TTDA 4BR5A 1S72N 4ISFA 1BO5O 1SZ2A 3SAGA 4FOIA 2IVOA 3JS6A 2OANA 3DXKA 5AR0A 5M1KA 5AQQA 3ENHA 2E2QA 4RCHA 5AQIA 1VAZA 1RDUA 3VGMA 3WQUA 2VCPA 4PL7A 4H5RA 1P8ZA 2CH6A 5CHIA 2V51B 5C15A 2IIRA 3CCEN 2A40A 4K25A 2NRWA 2P9NA 4FWKA 5AQVA 3FE1A 4BRHA 1VQ4N 1NBWA 4YOWA 2P9UB 3QFPA 4DB3A 3ATVA 3DXMB 2BUPA 1QQOA 3O8MA 2P9KA 4AF1A 3VEXA 5AQZA 3WXMB 5AZIA 3GDQA 4XEIA 4A59A 3SBGA 3CQXA 3CF5L 3WT0A 4IJNA 5AQFA 4IWVA 2YJEA 3CCQN 3ENOA 1YIJN 1WOQA 2W41A 3LDNA 5KQDA 4IDHA 2P9SB 2F7TA 3HRGA 3TSUA 2FLOA 1ATRA 3C6AA 3MCPA 2NRRA 3F2KA 3WEEB 1XQSC 2YI1A 5KPZA 1E4GT 5C2FA 3MN9A 1MWMA 4A61A 1W97L 2I7PA 4H0TB 3CJ7A 4O5FA 4WYBA 3IKMA 2P9PB 5LY3A 1OVYA 4JHDB 4JAXA 4XH5A 4BRIA 3AGKA 4IO8A 4QS7A 4PHTX 4H5TA 4U7BA 4EIAA 3R6MA 2ZF5O 1YHQN 5HOOA 2VWBA 3CMEN 3KK7A 2FF6A 3SAFA 2RE2A 4EHUA 1NGAA 3BP8A 2CGKA 4CZJA 3P38A 1QQNA 5EXWA 5F2RA 2AP1A 3PIOL 5AFUA 3KVGA 4LC9B 4FL9A 5AQNA 3O9UA 4WF9L 3CMAN 3CHWA 4WFNL 3R3LA 4B1YB 3F5TA 5F0XA 2E88A 1QVGM 3MK6A 3VEWA 1XUPO 4O8UA 3I55N 2KKZA 3FZHA 3MN6A 3VENA 5GAHP 1X3NA 3QBWA 4YOUA 1BWFO 4FWSA 5AQOA 4JKEA 4YDUC 3D6RA 4IFEA 3G4SN 3U4LA 4K43A 3LDOA 3HZ6A 2E20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZL A;  3GL1 A;  4BRL A;  4BC4 A;  2V7Z A;  2DPN A;  3DXM A;  4B1Z A;  3S41 A;  5FPE A;  4JN4 A;  1YAG A;  3ZET B;  2ZWH A;  2YHY A;  3SMP A;  1DKG D;  3UKR B;  1U6Z A;  5BRD A;  2A3Z A;  4M7Y A;  4B1W B;  3FZL A;  2YJF A;  3OHR A;  5FPD A;  2NLX A;  1NGF A;  1U2V B;  2E1Y A;  4ISG A;  4JD2 B;  4CZG A;  2P9L B;  4BRN A;  5AQK A;  3CIP A;  2QWP A;  4MLH A;  1EQY A;  3WEE A;  4WQ5 C;  2P9I A;  4MLE A;  3IUC A;  5AZJ B;  5FPN A;  3QBX A;  3MN7 A;  3SLC A;  1HUX A;  2P9P A;  3WQT A;  2Q0R A;  2UYT A;  4JHD A;  3A5L C;  2IVP A;  5TKY A;  5AQY A;  4CD3 A;  2Q0U A;  4EAH D;  3QIC A;  3C7N A;  2Q36 A;  3UB5 A;  2AA4 A;  1TUU A;  1GLC G;  1NM1 A;  1S3X A;  4MO4 A;  2GUP A;  5LJW A;  3AAP A;  3R9P A;  2W40 A;  2QWM A;  4H5W A;  3M6G A;  4BVP A;  4H0X B;  3MDQ A;  4BC5 A;  3DWL A;  4YDU A;  5AFU H;  4KBO A;  1YVN A;  4GNI A;  5AQX A;  1XC3 A;  3VEO A;  2QW9 A;  4L3Q A;  4E1J A;  3M1F A;  2HOE A;  4PKI A;  3RSE B;  2D4W A;  3IDH A;  4BQZ A;  3VGL A;  4ISE A;  4MO5 A;  1KXP A;  4FWM A;  5AQG A;  3CJA A;  5FPM A;  3ULE A;  4BGB A;  5BN9 A;  4BRC A;  1Q18 A;  3O80 A;  4C23 A;  3HTV A;  5KPT A;  5AQJ A;  3VOV A;  1NWK A;  2FF3 B;  3ZET A;  5AQM A;  4BRP A;  1IJJ A;  3EO3 A;  3UKR A;  3ZEU B;  3SMS A;  3SJH A;  1R59 O;  3HBT A;  1Z6R A;  2ASP A;  2EWS A;  1U2V A;  3ZX0 A;  4DHY A;  4PL8 A;  2FSK A;  3BF1 A;  4JD2 A;  3KZB A;  2P9L A;  1NLV A;  3FZK A;  4WQ5 A;  2HMP A;  3CQY A;  4FWL A;  5BN8 A;  3W0L A;  3SK3 A;  4H5V A;  5E26 A;  2QWR A;  1HKG A;  2F9W A;  2GWK A;  4H5N A;  3WUH A;  3ATU A;  1ATN A;  5AZJ A;  3FZF A;  3O1B A;  4DQ8 A;  1K8K B;  4FWP A;  3GOI A;  3JXU A;  4FPA A;  4HTL A;  2GEM A;  4FOE A;  5JLF A;  1YXQ A;  3TU5 A;  4BR7 A;  1HPM A;  2CH5 A;  3O6W A;  1GLL O;  4FO0 A;  3CER A;  4BR9 A;  3QFU A;  1C0G A;  4IZ9 A;  4JNE A;  2QWO A;  4WQ4 C;  1NGC A;  1NGJ A;  3VF2 A;  1H1V A;  3LDL A;  2ZGY A;  5AQR A;  5I9E B;  5BPN A;  1KAX A;  1MA9 B;  2GEL A;  2E2P A;  3KHY A;  3VES A;  3F9M A;  3DAW A;  3W3D A;  3WXI A;  2HF4 A;  4PKH A;  2E2N A;  3LDQ A;  3H1V X;  4BRD A;  1X3M A;  5EX5 A;  3A5M C;  4I6M B;  3AY9 A;  3LM2 A;  4FWQ A;  1QQM A;  3RSE A;  1HX1 A;  4BRQ A;  5EVZ A;  1HJO A;  3FZM A;  2P9U A;  3O1W A;  1HLU A;  4CZE A;  2Q2R A;  3U8X A;  4BR2 A;  1X9J A;  1S22 A;  3MN5 A;  5AQT A;  4BRE A;  4CD1 A;  2YHX A;  3ZEU A;  5BPM A;  4NB4 A;  4CZH A;  3O08 A;  2V7Y A;  3CI5 A;  4H03 B;  4BRG A;  4M63 C;  2I7N A;  2D0P A;  3H3O B;  1KAY A;  4RWT A;  3VF6 A;  2P9S A;  3EZW A;  4QS8 A;  2FXU A;  3ZX3 A;  5JLH A;  3QB0 A;  5AQL A;  2CGL A;  1BOT O;  3L6Q A;  4CBU A;  3VPZ A;  4H0Y B;  3D2F B;  4QS9 A;  1K8K A;  4HWI A;  4FWN A;  2IVN A;  2GTD A;  3G25 A;  3UE5 A;  4CJ7 A;  5CE3 A;  3O4W A;  4A62 A;  4WQ4 A;  1GLD G;  3CJC A;  4F9O A;  4A2B A;  3CET A;  1GLA G;  4EHT A;  1DGK N;  1BDG A;  1NGD A;  2QM1 A;  4BVO A;  1BG3 A;  3B8A X;  3H1Q A;  5BPL A;  4BG8 A;  2HF3 A;  1JCG A;  3L0Q A;  3H45 C;  2CGJ A;  2QXL A;  3LDP A;  2WUS A;  3U9D A;  4CZM A;  1T6D A;  4FWO A;  4BG9 A;  4I6M A;  4AM6 A;  1QZ6 A;  3GG4 A;  3AAR A;  3LL3 A;  4H0O A;  4O8K A;  1NMD A;  2NRH A;  3ZX2 A;  1BA1 A;  4BRA A;  3DJC A;  1Y64 A;  1ZXO A;  1ESV A;  2A41 A;  4FPB A;  5BRE A;  3CJ9 A;  2V52 B;  3C0B A;  3WXL A;  1D4X A;  3AAQ A;  3HI0 A;  3I33 A;  3EN9 A;  2FSN A;  4CBW A;  5BR9 A;  1OKJ A;  4IXC A;  2Q1N A;  3GE1 A;  1NGG A;  3VEZ A;  4PKG A;  2Q31 A;  2YCH A;  3D2F A;  2QWL A;  1ZBS A;  3H3N O;  3VER A;  4CZI A;  1NGI A;  3UKU B;  5B8H A;  3U9Z A;  1MDU B;  2A5X A;  1NGB A;  2NZT A;  5ELZ A;  3D2E B;  5LJV A;  3WXJ A;  3GBT A;  3BUZ B;  5AQU A;  2E8A A;  2ASM A;  1J6Z A;  2P9I B;  4FWR A;  1GLF O;  5BRF A;  1E4F T;  4H0P A;  1TYQ B;  2QWN A;  3BF3 A;  4GY2 B;  3HSC A;  3A5N C;  2F9T A;  2VYP A;  3I8B A;  4XH4 A;  3VET A;  3QDK A;  5ADX H;  5JIC A;  3EKU A;  4CZK A;  3VEV A;  2YHW A;  1ZC6 A;  4B1X B;  5EOY A;  4BR0 A;  4J8F A;  4Y0W A;  4K41 A;  3C7N B;  3FGU A;  1SAZ A;  5BRH A;  1C0F A;  2D0O A;  3BEX A;  4BRO A;  1LCU A;  4IJA A;  3FLC O;  2GWJ A;  4BRF A;  4CZF A;  4RTF D;  1JCF A;  5KQ8 A;  5E84 A;  3VF4 A;  3DXK B;  5AQH A;  3A8Y A;  1BUP A;  4B1V A;  1RFQ A;  2A42 A;  5KPR A;  3LM9 A;  5AQW A;  2Q97 A;  2J4R A;  1RDW X;  2P9N B;  1GLB G;  3ULE B;  3WXK A;  4CI6 A;  1V4S A;  3O5B A;  4CBX A;  1NGH A;  2QWQ A;  4AM7 A;  2P9K B;  3HM8 A;  4BQL A;  5AZI B;  4DCH A;  4BC3 A;  4K42 A;  1NGE A;  1HKC A;  3QML A;  1CZA N;  1T6C A;  3UKU A;  1SQK A;  1YUW A;  2H3G X;  2KHO A;  4BRK A;  3EKS A;  2ASO A;  4H0V B;  5F1X A;  4BRM A;  3H46 O;  3D2E A;  1TUY A;  3IMX A;  2PAV A;  3L4I A;  1DEJ A;  1QHA A;  3H6E A;  1WUA A;  3MMV A;  1BA0 A;  5ADX A;  1V4T A;  4M7X A;  4EFH A;  2E1Z A;  4BR4 A;  1HKB A;  1LOT B;  3FR0 A;  3M3Z A;  5JMV A;  1TYQ A;  2FSJ A;  3CJ1 A;  1BU6 O;  3J8A A;  4BC2 A;  3ID8 A;  4XH1 A;  1T44 A;  1Z05 A;  3A0I X;  1MWK A;  1KAZ A;  1JCE A;  1QZ5 A;  5AQP A;  2A6A A;  2ITM A;  3TPQ A;  2PBD A;  3EL2 A;  1G99 A;  1ATS A;  3R8E A;  3A5O C;  4BGA A;  3VEY A;  2ZGZ A;  4A2A A;  3P4I A;  1RGI A;  2BTF A;  4Z94 A;  4B1U B;  1IG8 A;  3VGK A;  4B9Q A;  1GLE G;  2D1K A;  3CJB A;  4NO7 A;  2E2O A;  3FFK B;  3IFR A;  4FSV A;  3D7E O;  5AQS A;  5EY4 A;  1GLJ O;  4BR5 A;  4ISF A;  1BO5 O;  1SZ2 A;  4FOI A;  2IVO A;  3JS6 A;  2OAN A;  3DXK A;  5AR0 A;  5AQQ A;  3ENH A;  2E2Q A;  4RCH A;  5AQI A;  3VGM A;  3WQU A;  2VCP A;  4PL7 A;  4H5R A;  1P8Z A;  2CH6 A;  2V51 B;  2IIR A;  2A40 A;  4K25 A;  2P9N A;  4FWK A;  5AQV A;  4BRH A;  3FE1 A;  1NBW A;  2P9U B;  3QFP A;  4DB3 A;  3ATV A;  3DXM B;  2BUP A;  1QQO A;  3O8M A;  2P9K A;  3VEX A;  5AQZ A;  5AZI A;  3GDQ A;  4XEI A;  3CQX A;  3WT0 A;  4IJN A;  5AQF A;  4IWV A;  2YJE A;  3ENO A;  1WOQ A;  2W41 A;  3LDN A;  5KQD A;  2P9S B;  2FLO A;  1ATR A;  3MCP A;  3WEE B;  1XQS C;  2YI1 A;  5KPZ A;  1E4G T;  3MN9 A;  1MWM A;  4A61 A;  2I7P A;  4H0T B;  3CJ7 A;  4O5F A;  4WYB A;  2P9P B;  5LY3 A;  4JHD B;  4JAX A;  4XH5 A;  4BRI A;  4IO8 A;  4QS7 A;  4H5T A;  4EIA A;  3R6M A;  2ZF5 O;  2VWB A;  2FF6 A;  4EHU A;  1NGA A;  3BP8 A;  2CGK A;  4CZJ A;  1QQN A;  5EXW A;  5F2R A;  2AP1 A;  5AFU A;  3KVG A;  4LC9 B;  4FL9 A;  5AQN A;  3CHW A;  4B1Y B;  5F0X A;  2E88 A;  3MK6 A;  3VEW A;  1XUP O;  3VEN A;  3FZH A;  3MN6 A;  1X3N A;  3QBW A;  5AQO A;  1BWF O;  4FWS A;  4YDU C;  3U4L A;  4K43 A;  3LDO A;  3HZ6 A;  2E20 A; 
#chains in the Genus database with same CATH topology
 3CCJ N;  3KK3 A;  2JGU A;  1XHZ A;  2DPN A;  3DXM A;  1VQ6 N;  2UUA K;  1WB9 A;  3S41 A;  2A1R A;  5FPE A;  4OKJ A;  2OZM A;  3C6H A;  2UXB K;  1YAG A;  3ZET B;  5HRO A;  2ZWH A;  4DQS A;  3O9T A;  1U6Z A;  5BRD A;  4B1W B;  5HRP A;  3FZL A;  2YJF A;  3OHR A;  5FPD A;  3M8R A;  1NGF A;  2VWJ A;  2IAJ A;  4X64 K;  5AQK A;  4RW9 A;  4WFB L;  3HST B;  4JLH A;  2ITG A;  4MLH A;  3AVM A;  4JKA A;  3MWT A;  5AZJ B;  5FPN A;  1IKV A;  3VQ9 A;  4B9U A;  3MN7 A;  3SLC A;  1NK7 A;  3Q7C A;  4OPA A;  3CC4 N;  2OZS A;  4R5P A;  2XHB A;  4BE2 A;  1NK6 A;  3AVC A;  1JXB A;  3OVN A;  1TUU A;  1KFD A;  1QTM A;  4EP5 A;  4BC5 A;  3N4P A;  2X6N A;  4GNI A;  2HND A;  1REV A;  4AHR A;  4L3Q A;  3EZ5 A;  1L3V A;  4KI4 A;  4ID1 A;  3ZSR A;  4E1J A;  1L5U A;  3S9H A;  3R1X A;  5GIN A;  3OTO K;  4A57 A;  1VSJ A;  1S9E A;  1KD1 O;  4JEP A;  1U48 A;  3ULE A;  4M3Y A;  1WBB A;  4C23 A;  4FVU A;  5KPT A;  3CFP A;  1J5E K;  2P51 A;  3MXI A;  1NWK A;  3SNN A;  3TSQ A;  4DG1 A;  2ZJP L;  5AQM A;  3E9O A;  4B8A B;  1QS4 A;  3M5R A;  3NHG A;  2ASP A;  4DHY A;  1HQE A;  2FSK A;  4DV3 K;  3CCV N;  2NRZ A;  4C8K A;  3L2V A;  4FWL A;  3CFR A;  4FJ9 A;  4QAG A;  2F9W A;  3RTV A;  4DFP A;  3C6T A;  4JKG B;  4RW8 A;  3O1B A;  1BIZ A;  3GOI A;  4HTL A;  1HNI A;  5FDL A;  3TU5 A;  4BR7 A;  4F8R A;  4YOR A;  3CER A;  2A1S A;  4AHT A;  3S3O A;  2BAN A;  4DU3 A;  1X9S A;  3VF2 A;  1S1T A;  5AQR A;  5BPN A;  1TGO A;  3AO2 A;  5C2D A;  2G8V A;  2KZZ A;  4FJN A;  1KLM A;  3ASM A;  4DSL A;  1RTI A;  4FJ8 A;  1BGX T;  2ZQB A;  4PUO A;  4FWQ A;  3RMB A;  3O1W A;  1TK0 A;  1X1P A;  3HPH A;  4PY5 A;  4YOX A;  4CZE A;  4DSE A;  2YNI A;  3V1Q A;  3Q7B A;  1CLQ A;  4F2S A;  3U8X A;  1S22 A;  3NGZ A;  4CJK A;  4RG8 A;  2G8H A;  1CZ9 A;  1LWF A;  3O08 A;  4UY8 O;  4N56 A;  4DU4 A;  4JK7 A;  2I7N A;  1Z26 A;  3VF6 A;  3A2F A;  4QS8 A;  3E9L A;  3SUQ A;  1NG9 A;  5AQL A;  1BOT O;  4BE1 A;  4H0Y B;  4ID5 A;  1FXX A;  4QS9 A;  1HRH A;  4NYN A;  1Z25 A;  3ZT4 A;  2O8B A;  5FRO A;  3THY B;  3ZT2 A;  3LAL A;  3RR7 A;  1YJN N;  4A62 A;  1GLD G;  2RPI A;  4KV8 A;  4KH5 A;  5JVG L;  4QOZ B;  3CCM N;  3OJS A;  3CET A;  1S1X A;  1BDG A;  3QLH A;  1WNS A;  2O8C A;  3M8P A;  3THX A;  2HF3 A;  1JCG A;  2JWL A;  4DR6 K;  1T8E A;  4M3U A;  1WSG A;  1BIU A;  1S5J A;  1Q7Y O;  1C0M A;  1VSK A;  4CHN A;  3L4Q A;  3TTF A;  1IBM K;  4DV4 K;  1NMD A;  2NRH A;  3ZX2 A;  4O55 A;  2P5O A;  2KFN A;  2VQE K;  4Z4C A;  3DRR A;  4YY3 K;  3C6U A;  4BRA A;  2GBZ A;  3QIN A;  1KC8 O;  4HUE A;  3E1Y A;  3CJ9 A;  3VQP A;  3TAN A;  3AAQ A;  4KHN A;  3HI0 A;  3I33 A;  4W5R A;  1TVR A;  2GV9 A;  5MLC Q;  1NOZ A;  3I56 N;  4Q5V A;  1VSD A;  5JS2 A;  4PKG A;  4FK2 A;  4JI5 K;  1Q9Y A;  4KO0 A;  3ZLJ A;  4CEA A;  4IBN A;  1FW6 A;  3V9U A;  3D2E B;  4NLC A;  1A5W A;  3BUZ B;  2GX9 A;  3L2R A;  4OLB A;  1GLF O;  5BRF A;  3HPO A;  1TYQ B;  2QWN A;  4N5S A;  3LZI A;  3HSC A;  3A5N C;  4KRF A;  2F9T A;  4XH4 A;  1S9G A;  3I8B A;  1QQC A;  5ADX H;  3L8B A;  2IDO A;  3OYK A;  4CZK A;  2YHW A;  3MED A;  2XY7 A;  2O8E B;  3T1Y K;  3RVC A;  4K41 A;  3FGU A;  4CHO A;  1SAZ A;  5BRH A;  3NFA A;  1C0F A;  2D0O A;  2OCE A;  3PX4 A;  3OS1 A;  1LCU A;  2HHH K;  4M42 A;  2IC3 A;  4BRF A;  4M41 A;  5E84 A;  3VQ4 A;  3DXK B;  5AQH A;  4FJI A;  3AGR A;  2BE2 A;  3VQ7 A;  4B1V A;  2YKM A;  2A42 A;  3J80 O;  4DR4 K;  1L3T A;  2BGG A;  1WSF A;  3WXK A;  1V4S A;  3MX2 A;  2P9K B;  3HPG A;  1JKH A;  4JKG A;  1LW0 A;  4CFB A;  4IFV A;  4JKB A;  2PFU A;  4BC3 A;  3KD5 E;  4DR7 K;  4DS5 A;  1TK8 A;  2PY5 A;  4M3T A;  1T6C A;  4WE1 A;  3M8Q A;  2QXF A;  3WNF A;  1D5A A;  1SQK A;  4CHY A;  1YVU A;  2D0B A;  1QHA A;  1WUA A;  1RTJ A;  5ADX A;  4BE0 A;  4EFH A;  2E1Z A;  1LOT B;  3M3Z A;  3SBT A;  1N33 K;  4JV5 K;  4JKH A;  1HNX K;  1A5V A;  1BU6 O;  4YOV A;  1VQ9 N;  4CJW A;  4Z4I A;  4G9Z A;  3ID8 A;  3WNG A;  3K5L A;  4DTX A;  1C0T A;  2OPQ A;  1W0H A;  1DTT A;  1KAZ A;  5AQP A;  2A6A A;  4JKC A;  1C1B A;  2ZGZ A;  2BTF A;  3E66 A;  1Q9X A;  4B9Q A;  3THV A;  4V19 S;  3LAK A;  4NO7 A;  2E2O A;  3CG7 A;  3DOL A;  3FFK B;  5M1N A;  3D7E O;  4IKF A;  1GOC A;  1WBD A;  5EY4 A;  2Z1H A;  1J9A A;  4ISF A;  1SZ2 A;  2RF2 A;  3DM2 A;  5AQQ A;  5AQI A;  3VGM A;  3LWL A;  4AIL C;  5CHI A;  2HHW A;  2V51 B;  3OYE A;  3CCE N;  2P9N A;  5AQV A;  4BRH A;  4CJ4 A;  1XMQ K;  2KTQ A;  2Q3S A;  1TKX A;  4YOW A;  3QFP A;  3DXM B;  1N5Y A;  3VEX A;  3WXM B;  1IO2 A;  4XEI A;  3JAM O;  4JI7 K;  1X9W A;  2B6A A;  4LF8 K;  4HUF A;  1L3U A;  2B4J A;  2EHG A;  5AQF A;  5BR8 K;  4IWV A;  3CCQ N;  4OLA A;  1RCH A;  5KQD A;  1ZBH A;  2YHB A;  3HRG A;  3MCP A;  4DTJ A;  3O3F A;  1XHX A;  2W42 A;  4OKE A;  2YI1 A;  1MWM A;  2XY6 A;  1NMN A;  3CJ7 A;  3IKM A;  4XH5 A;  1HYV A;  4BRI A;  4NXM K;  4QS7 A;  4FJG A;  4FZZ A;  4JI3 K;  2ZF5 O;  5KRS A;  3D45 A;  3SPZ A;  3CME N;  1RT3 A;  5LL6 Z;  1BIS A;  3OYG A;  4KHQ A;  1RDC A;  3PIO L;  5F2R A;  2AP1 A;  5AFU A;  3KVG A;  4LC9 B;  3MXJ A;  2HVI A;  5CYQ A;  4WFN L;  3R3L A;  4B1Y B;  4DTS A;  4RW4 A;  1QVG M;  4K8Z A;  3MXM A;  4FJK A;  1GOB A;  3LP1 A;  3I55 N;  3FZH A;  5GAH P;  1VSF A;  4E7J A;  1IBK K;  1BWF O;  1ASU A;  4IFE A;  4FJL A;  2QKB A;  3F9K A;  2YNH A;  3U4L A;  2HHT A;  3TAF A;  3OYD A;  4CZL A;  4CJF A;  3GL1 A;  1J53 A;  1VQO N;  4E1M A;  1UA0 A;  4B1Z A;  2G8F A;  4JN4 A;  4BWJ A;  3LZJ A;  3P83 D;  3CC2 N;  3PO5 A;  5EU7 A;  3J7Z O;  4M7Y A;  2NLX A;  4B3T K;  2HBM A;  2NRT A;  2E1Y A;  4ISG A;  1VSL A;  1HMV A;  1YIT N;  4DF4 A;  1RDD A;  3LAM A;  4OPH A;  3WEE A;  3CCS N;  4NXN K;  2WBN A;  1VSE A;  3QBX A;  2YX6 A;  4FJM A;  1HUX A;  4JHD A;  1NJY A;  1K8A O;  1S1U A;  2WFB A;  5AQY A;  4DMN A;  3CXC M;  3HL8 A;  3QIC A;  1D9F A;  1EWR A;  2KZM A;  1I39 A;  1VK0 A;  1S3X A;  2GUP A;  4LFA K;  2EX3 A;  3OW2 M;  2W40 A;  2QWM A;  4H5W A;  1L3S A;  1OH5 A;  4H0X B;  3MDQ A;  4FLU A;  2QA4 N;  3HO1 A;  4C1N K;  1XC3 A;  2QW9 A;  5GIO A;  4U67 L;  4CJ3 A;  4FJH A;  4PKI A;  4Z4E A;  3IDH A;  4MO5 A;  1KXP A;  1VRU A;  3CJA A;  1UOC A;  4LH5 A;  5C25 A;  3AVB A;  3VOV A;  2PYJ A;  2R7Y A;  4LF6 K;  2P1J A;  3EO3 A;  3SJH A;  3DLR A;  3HBT A;  3VQ8 A;  1Z6R A;  2IS3 A;  4OPJ A;  3ZX0 A;  3BF1 A;  4JD2 A;  1O13 A;  2HMP A;  3CQY A;  1D9D A;  3W0L A;  3SK3 A;  4H5V A;  2HHX A;  4LY7 A;  1ASV A;  4DTP A;  2NRX A;  5K14 A;  2XY8 A;  4FPA A;  4FWP A;  2AJQ A;  2GEM A;  2O8B B;  5CR4 A;  3HVT A;  1NK5 A;  1BL3 A;  1SUQ A;  3O6W A;  3RMD A;  4FO0 A;  4BDY A;  1CXU A;  1YJ9 N;  2Z1J A;  1R0A A;  5FLX O;  1NGC A;  2JWK A;  3DOK A;  3V1O A;  5I9E B;  1MA9 B;  5KGW A;  3THX B;  2E2P A;  3CYM A;  3F9M A;  2UXD K;  4UQG A;  3LDQ A;  4F3T A;  4JS4 A;  4FLZ A;  1X3M A;  3AO1 A;  5EX5 A;  1K73 O;  4CGD A;  3MEG A;  5D3G A;  3AY9 A;  3DLE A;  4DUY K;  1QQM A;  4BRQ A;  1TKD A;  5EVZ A;  1RT1 A;  4CJE A;  5DMR A;  1VHX A;  1HNZ K;  4E0D A;  4FZX C;  4KTZ A;  3T19 A;  2Q2R A;  5AQT A;  4FVM A;  1KRP A;  4BRE A;  3SCX A;  2VWK A;  4CD1 A;  3ZEU A;  4CEQ A;  5BPM A;  4CZH A;  2VGM A;  3CI5 A;  3QET A;  4BRG A;  2UUC K;  4JKD A;  4RWT A;  3T7Z A;  2O8F A;  1WSH A;  2FXU A;  3OY9 A;  5I3U A;  4CHZ A;  4CFD A;  3L6Q A;  4DUZ K;  3KTQ A;  2NRV A;  4I2Q A;  4DTR A;  4EZ9 A;  4HWI A;  2RKI A;  4CJP A;  2GTD A;  4DQQ A;  4DR2 K;  4CJ7 A;  2VG5 A;  4E7K A;  1RBU A;  5FRM A;  1TKZ A;  4BY9 C;  3QEI A;  3VQD A;  1VQL N;  1GLA G;  1DGK N;  2QM1 A;  1VSI A;  3TAG A;  1SV5 A;  2HBK A;  1NOY A;  5LMN K;  3V1R A;  1QSY A;  4LF9 K;  3L0Q A;  2WUS A;  1T6D A;  4KHS A;  4FWO A;  4I6M A;  2YV0 X;  3BDP A;  5J2N A;  4DTM A;  3KKR A;  4CK2 A;  4Z4H A;  3LL3 A;  4H0O A;  4W5O A;  1BCM A;  4DV5 K;  5IWA K;  1BA1 A;  3CQ8 A;  1HYZ A;  4DLE A;  3AO4 A;  3VQE A;  3HOS A;  1FJG K;  3DJC A;  1Y64 A;  4LFB K;  1C1C A;  2A41 A;  4FPB A;  5BRE A;  4FK4 A;  2V52 B;  3SUP A;  1IKW A;  4CEE A;  4IOC L;  3EN9 A;  4N76 A;  1RDB A;  4CBW A;  4MDA A;  2QTD A;  2HMI A;  2Q1N A;  3GE1 A;  3TAP A;  4IFY A;  5M1F A;  4KB1 A;  3BGR A;  3SUO A;  1NGG A;  2OPR A;  2OA8 A;  2Q31 A;  4H4M A;  3H3N O;  4ZTF A;  4FW2 A;  1N6Q A;  3VER A;  4DV6 K;  4FJ5 A;  1QSS A;  4CIG A;  1IH7 A;  1NGB A;  4CGJ A;  3AA5 X;  1KLN A;  4OO1 J;  1T7P A;  2P5G A;  5AQU A;  3NAE A;  3HP6 A;  5JS1 A;  4HHT A;  1IG9 A;  1NK8 A;  2UU9 K;  3BF3 A;  1C6V A;  2VYP A;  3MCA B;  4K0K K;  3VET A;  3OA9 A;  1C0U A;  5JIC A;  3EKU A;  4ELT A;  3AA2 A;  3VEV A;  1ZC6 A;  1U04 A;  3HP9 A;  4B1X B;  5EOY A;  4J8F A;  5KTQ A;  3NMU A;  4Y0W A;  3C7N B;  3MWP A;  4KB0 A;  1RTH A;  2X6S A;  2DFF A;  4CFA A;  3BEX A;  1JL2 A;  3J7Y P;  3NH2 A;  4CZF A;  5C0Y A;  3VF4 A;  1K9M O;  3J7A P;  1ZBU A;  5DM7 L;  5JVH L;  1BUP A;  2BDP A;  3LM9 A;  3QNN A;  2J4R A;  2P9N B;  4IG0 A;  3PY8 A;  1GLB G;  3EY1 A;  3O5B A;  4CBX A;  1IBL K;  2QWQ A;  3OYM A;  1M1K O;  1BCO A;  3K5O A;  3V9Z A;  4K42 A;  3QML A;  2FC0 A;  4JRP A;  4HTU A;  2E4L A;  4Q0B A;  4C8M A;  4CF1 A;  1T3V A;  4H0V B;  4BRK A;  2ZD1 A;  4ELU A;  4KHY A;  4BRM A;  1JL1 A;  4CHQ A;  4O44 A;  1SKS A;  2PAV A;  4OGC A;  3H6E A;  3CCU N;  4KPY A;  3MMV A;  4KHP K;  4DU1 A;  1HPZ A;  3B6O A;  3VMF B;  1OH6 A;  3P5J A;  3CM5 A;  3CJ1 A;  4C8O A;  4DSI A;  4BC2 A;  3PIP L;  4XH1 A;  4JK9 A;  4CEC A;  1Z05 A;  3A0I X;  1QZ5 A;  3TPQ A;  2ITM A;  4ZTJ A;  2PBD A;  3A5O C;  4BGA A;  3CFO A;  4I9L A;  4J2E A;  3M8S A;  2B5J A;  4ZHR A;  1IG8 A;  2WC9 A;  1GLE G;  2D1K A;  1D8Y A;  3AVG A;  3AO5 A;  5HLF A;  3IFR A;  5AQS A;  1N36 K;  3NF7 A;  1S72 N;  5M1K A;  4DR1 K;  3JS6 A;  2OAN A;  1RTD A;  3WQU A;  1RDU A;  2VCP A;  1F21 A;  4PL7 A;  5J1E A;  4YNQ A;  1RT5 A;  5J2M A;  2A40 A;  4FWK A;  1VQ4 N;  4DV2 K;  3K2P A;  4DS4 A;  4DB3 A;  5AQZ A;  1JLF A;  3GDQ A;  4DV0 K;  4JI6 K;  2F8S A;  3QNO A;  3CF5 L;  4CGH A;  4DLG A;  3WT0 A;  2YJE A;  2D0A A;  1HNW K;  4IDH A;  2W6L A;  2FLO A;  2HB5 A;  2HNY A;  3SYZ A;  3WEE B;  5KPZ A;  3AVJ A;  5C2F A;  3MN9 A;  2I7P A;  2PZS A;  4O5F A;  1OH7 A;  4WYB A;  4JHD B;  3AGK A;  4H5T A;  4EIA A;  3R6M A;  3AA4 A;  3O3G A;  2VWB A;  5CZ2 A;  4HVJ A;  2RE2 A;  4EHU A;  1NGA A;  3BP8 A;  2OYQ A;  2E5L K;  1RT4 A;  2W6K A;  1QQN A;  3P38 A;  1YTU A;  3NF8 A;  1NKE A;  5AQN A;  4WF9 L;  3O9U A;  3CMA N;  1SL2 A;  4C8N A;  3ZT0 A;  2YHA A;  2ZE2 A;  3OYF A;  2KKZ A;  3VEN A;  3OYA A;  4I7F A;  4E19 A;  3QBW A;  4YOU A;  4KI6 A;  5E41 A;  3HZ6 A;  4OX9 K;  1Q81 O;  4BRL A;  4BC4 A;  2X78 A;  4DTN A;  2V7Z A;  2HW3 A;  4BDP A;  4EP4 A;  5GAD P;  4CJV A;  4B3R K;  4FXD A;  3I0S A;  3VN5 A;  1TL1 A;  1QE1 A;  3OS0 A;  1XMO K;  3E01 A;  4JD2 B;  4NYF A;  4CZG A;  4BRN A;  3G6E N;  3KLI A;  2KW4 A;  4E1N A;  1RT6 A;  4WQ5 C;  3VA3 A;  4MLE A;  3IUC A;  3K5M A;  4H4O A;  1HNV A;  4OGE A;  3DLH A;  4HUG A;  3A5L C;  4CK1 A;  3RR8 A;  5TKY A;  3SV3 A;  4CD3 A;  1QSL A;  2Q0U A;  5M1O A;  4EAH D;  3D0P A;  3G0Z A;  3C7N A;  3THW A;  4LF4 K;  3V6D A;  1BQM A;  4MO4 A;  5LJW A;  3DMJ A;  4FJX A;  2G8U A;  3L3U A;  3CPE A;  3VQ5 A;  3DWL A;  3L2Q A;  2G8W A;  5AFU H;  4KBO A;  1YVN A;  3VEO A;  1LWE A;  3ZSV A;  1U47 A;  2HOE A;  4FCY A;  2HVH A;  4BQZ A;  3S3M A;  1NJZ A;  3LPU A;  4FWM A;  5FPM A;  1U4B A;  5KRT A;  3KLG A;  1Q18 A;  5M1P A;  5AQJ A;  4LF7 K;  3FFI A;  2OTL N;  3DLK A;  2DTU A;  1VSH A;  4BRP A;  4Z4G A;  3UKR A;  3ZEU B;  3SMS A;  4FM0 A;  3AVL A;  1XC9 A;  1R59 O;  3K9J A;  1J5O A;  1U2V A;  4PL8 A;  3QEP A;  1OH8 A;  2FBV A;  3KZB A;  2KLA A;  4CJU A;  2P9L A;  4CCH A;  2O8F B;  4BDZ A;  1NLV A;  3FZK A;  3P39 A;  4WQ5 A;  5BN8 A;  4R79 A;  4PA1 A;  3HJF A;  4NLB A;  5E26 A;  2QWR A;  3AA3 A;  3EEQ A;  1ATN A;  4L8R B;  3E9P A;  4MDB A;  4CIE A;  4FOE A;  4FZY A;  1YXQ A;  3VTH A;  2OTJ N;  2RHK A;  5J2P A;  2CH5 A;  4BR9 A;  3QFU A;  3DLL L;  2QWO A;  5HRN A;  3NF6 A;  1XNQ K;  5GIP A;  1NGJ A;  4CEO A;  3VQA A;  4W5Q A;  3QES A;  4F4K A;  1H1V A;  1ZYQ A;  1N8R O;  4LFC K;  3LDL A;  4CE9 A;  4B3S K;  3VQC A;  1KAX A;  1TKT A;  3KHY A;  4AHC A;  3PV8 A;  4J2D A;  3O9S A;  3ENB A;  2QI2 A;  4DR3 K;  4CED A;  3AVN A;  3KLE A;  2O4I A;  3BZK A;  3H1V X;  4BRD A;  1SKW A;  4IOX A;  1RBV A;  1I3A A;  4B9S A;  4GV3 A;  4I6M B;  3LM2 A;  5H1S Q;  5T7B A;  3RSE A;  1HX1 A;  2ATQ A;  1KFS A;  1RNH A;  1HJO A;  3FZM A;  1VQ5 N;  4AHV A;  3LDS A;  3LP3 A;  5HL7 L;  3O3H A;  1WN7 A;  4BR2 A;  4DSJ A;  2YHX A;  1WAF A;  4NB4 A;  4F2R A;  1J54 A;  3ZSX A;  4FW1 A;  3PUF A;  3LAN A;  3PLA A;  3H3O B;  1KAY A;  1W9H A;  2WOM A;  3EZW A;  4CIF A;  4M3R A;  3ZX3 A;  5JLH A;  3QB0 A;  1JJ2 M;  3ULD A;  4QCL A;  4CEB A;  4CJQ A;  4ILJ A;  3K57 A;  3CM6 A;  1K8K A;  4FYD A;  3LP0 A;  4FWN A;  3SUN A;  3T69 A;  1WSI A;  2IVN A;  4DFK A;  3G25 A;  3UE5 A;  5CE3 A;  3O4W A;  2XO7 A;  2NUB A;  3DLB A;  4W5N A;  1SS6 A;  3CJC A;  4F9O A;  2KQ2 A;  3U3G A;  4CFC A;  4CGF A;  1N32 K;  4A2B A;  3SI6 A;  1S6Q A;  1Q8I A;  5KI6 A;  1Q82 O;  4H8K A;  1BG3 A;  3O4Q A;  4LSN A;  5BPL A;  4BG8 A;  5HP1 A;  1RBR A;  3T1A A;  1LV5 A;  2CGJ A;  2QXL A;  2VG6 A;  4Z0U A;  3LDP A;  4CJT A;  1DLO A;  2FBY A;  5CYM A;  3U9D A;  1UAX A;  1B92 A;  3KK1 A;  4BG9 A;  4CHP A;  4JYA K;  3HVR A;  3GG4 A;  4PWD A;  1EKE A;  5C42 A;  3PSF A;  4O8K A;  1OVQ A;  3LPT A;  1TV6 A;  3QEV A;  1ZXO A;  4LSL A;  1LAV A;  3LWM A;  3KWG A;  3C0B A;  1T03 A;  3SQ0 A;  2PYL A;  1ZBI A;  3OBY A;  2FSN A;  3IS9 A;  3K59 A;  5IT9 O;  4IXC A;  3RRG A;  3KD1 E;  1IKX A;  3VEZ A;  3D2F A;  2YCH A;  4DTO A;  1EX4 A;  1ZBS A;  4GKK K;  4CZI A;  2HHQ A;  4IDK A;  1NGI A;  5HRS A;  5B8H A;  3U9Z A;  4IEI A;  1LWC A;  4B3M K;  2A5X A;  2WTU A;  4FLT A;  3ZSZ A;  4LD0 A;  3NDK A;  1C1A A;  5ELZ A;  3WXJ A;  2DFH A;  3L2W A;  4CES A;  1JLG A;  3TSP A;  1J6Z A;  1EP4 A;  2P9I B;  4FWR A;  1WAJ A;  2D0C A;  4H0P A;  5C12 A;  3O9Q A;  4GY2 B;  3JSM A;  4J2B A;  3QDK A;  5M1Q A;  4B9N A;  1YF5 L;  1ILY A;  3HT3 A;  4BR0 A;  2LSN A;  4AHS A;  4FM2 A;  4DSF A;  1KQS M;  4DSK A;  4M3Z A;  4Z4F A;  1TAU A;  1JLA A;  2HHU A;  3HYF A;  4YOT A;  4BRO A;  4IJA A;  3FLC O;  4ICL A;  4JS5 A;  1NJI O;  4X66 K;  2YNG A;  3DYA A;  5C24 A;  3MAQ A;  1LW2 A;  1EET A;  1KCF A;  1ZBL A;  3NH0 A;  3CC7 N;  1JLQ A;  1RFQ A;  5KPR A;  3ZT1 A;  1QHT A;  2Q97 A;  3NF9 A;  1RDW X;  5A2Q O;  1ITG A;  2QEX N;  3KKS A;  4BQL A;  4BWM A;  4TSX A;  4CF2 A;  3TAB A;  3RMA A;  4CF0 A;  4DCH A;  4KAZ A;  3TAM A;  3UKU A;  5I42 A;  3QER A;  2Y1J A;  2H3G X;  2KHO A;  2ASO A;  4FK0 A;  3O9R A;  3VTI A;  3L4I A;  2BH1 A;  4JI2 K;  4B9M A;  1BA0 A;  4M3W A;  1V4T A;  4M7X A;  5CY4 A;  3VQQ A;  1HKB A;  3N4Q A;  3CD6 N;  3ISN C;  3ZT3 A;  4N41 A;  1GOA A;  4IOA L;  1MWK A;  1JCE A;  1FKO A;  3EL2 A;  1G99 A;  2F96 A;  3OYH A;  3PSI A;  4GVE A;  3KLH A;  4DF8 A;  2HBL A;  3P4I A;  4DFJ A;  3DI6 A;  4Z94 A;  3IAY A;  4Y1C A;  3DLG A;  3VGK A;  1HR0 K;  1S1V A;  5FRN A;  4FJ7 A;  4HCC A;  3L3V A;  4FSV A;  3K0S A;  4B9T A;  3OYL A;  4BR5 A;  3F73 A;  1BO5 O;  3SAG A;  2IVO A;  2FBT A;  4FM1 A;  3ENH A;  2E2Q A;  1KSP A;  1VRT A;  2CH6 A;  4H5R A;  2Y1I A;  3C94 A;  2IIR A;  2NRW A;  3FE1 A;  1FKP A;  1NBW A;  2P9U B;  4MFB A;  2VQF K;  2BUP A;  1K6Y A;  4DQI A;  3O8M A;  2Z1I A;  1UA1 A;  4J2A A;  3BZC A;  5AZI A;  3AVH A;  3SBG A;  4FLV A;  3O4N A;  1WOQ A;  2W41 A;  3LDN A;  4EZ6 A;  4HCB A;  4GW6 A;  2P9S B;  3OYB A;  3TSU A;  1ATR A;  3C6A A;  4CW7 B;  1LAW A;  4RW6 A;  3SV4 A;  1JLC A;  1E4G T;  4A61 A;  4H0T B;  2OPP A;  5LY3 A;  1OVY A;  4JAX A;  4IO8 A;  3UIQ A;  4PHT X;  1W7A A;  3I0R A;  1U45 A;  5HOO A;  3KK7 A;  3THW B;  3SQ2 A;  4DR5 K;  4CZJ A;  4BAC A;  4CJL A;  4FL9 A;  3L2U A;  4MQ3 A;  3CHW A;  4GMJ B;  3J81 O;  5F0X A;  2E88 A;  3VEW A;  2F4V K;  1XUP O;  4O8U A;  3MN6 A;  1X3N A;  1JLE A;  5AQO A;  4JKE A;  4YDU C;  3D6R A;  4O5B A;  3VQB A;  3K5N A;  3G4S N;  2I5J A;  3DRS A;  4K43 A;  4E7I A;  3TI0 A;  3NH1 A;  4KHU A;  5GAG P;  2HHV A;  2YHY A;  3SMP A;  1DKG D;  3UKR B;  2A3Z A;  4YHH K;  3QEX A;  3PX0 A;  1U2V B;  2P9L B;  3K9K A;  3CIP A;  2QWP A;  1EQY A;  1SL0 A;  3HM9 A;  2P9I A;  3MEC A;  2HHS A;  3SPY A;  1HYS A;  3V9S A;  3KLF A;  2P9P A;  3WQT A;  2Q0R A;  2UYT A;  1WSE A;  2IVP A;  3RMC A;  4DWI A;  3MX5 A;  5GAE P;  5HBM A;  3EE9 A;  1T05 A;  3IG1 A;  2Q36 A;  3QIP A;  3UB5 A;  2AA4 A;  4CGG A;  1GLC G;  1VQ8 N;  1NM1 A;  4JI0 K;  4CF9 A;  3AAP A;  3R9P A;  4G1Q A;  3M6G A;  4JKF A;  1G15 A;  4BVP A;  1BI4 A;  3KIO A;  4KH4 A;  4YDU A;  1RBT A;  5AQX A;  3SJJ A;  1IV0 A;  1NKB A;  3QO9 A;  3M1F A;  4KTW A;  3RSE B;  2D4W A;  3VGL A;  4ISE A;  2UUB K;  5AQG A;  4BGB A;  1NK4 A;  5BN9 A;  3V81 A;  4BRC A;  1B9F A;  3O80 A;  1VQK N;  3HTV A;  4GVM A;  3WNH A;  1DT9 A;  2FF3 B;  3ZET A;  1IJJ A;  3LP2 A;  1RT7 A;  1VQM N;  4WFA L;  4M45 A;  4JI8 K;  1W2B M;  2EWS A;  2ZJQ L;  4CEF A;  4DQP A;  4IEE A;  1U49 A;  3HXM A;  3TR8 A;  4I9Q A;  3P31 A;  1HKG A;  2GWK A;  4H5N A;  3WUH A;  3ATU A;  3HK2 A;  5AZJ A;  3FZF A;  4O4G A;  4B08 A;  4DQ8 A;  1K8K B;  3JXU A;  1QVF M;  4KKO A;  3CCR N;  5JLF A;  4E7H A;  1HPM A;  3G71 N;  4E89 A;  1GLL O;  3V9W A;  1C0G A;  3AVF A;  4IZ9 A;  1EXQ A;  4JNE A;  1TK5 A;  4WQ4 C;  5SWM A;  4C8L A;  4CER A;  3NBP A;  1VQP N;  2ZGY A;  3SZ2 A;  4CGI A;  2GEL A;  3MEE A;  3VES A;  4AH9 A;  1NK9 A;  4E7L A;  4FJJ A;  3DAW A;  3SAH A;  3W3D A;  3WXI A;  2HF4 A;  4PKH A;  2E2N A;  3A5M C;  4XIU A;  4JI1 K;  4OPK A;  3NGY A;  3OS2 A;  4ILH A;  1X9M A;  2P9U A;  3TAE A;  4NCB A;  3T3F A;  1HLU A;  1YI2 N;  3AVI A;  4YOY A;  4PQU A;  1E3M A;  1X9J A;  3MN5 A;  4B9L A;  1KTQ A;  3NGI A;  3OYC A;  4CVN E;  3VQ6 A;  1EO1 A;  2V7Y A;  3QIO A;  4H03 B;  2FBX A;  4M63 C;  2D0P A;  1KVC A;  2P9S A;  4O0I A;  2ZJR L;  5DM6 L;  3V4I A;  1P90 A;  2Z1G A;  1CXQ A;  4YFU A;  4FLX A;  2CGL A;  4CBU A;  3VPZ A;  4DV1 K;  3D2F B;  3V9X A;  4B3O A;  3U3Y A;  4WCE L;  3KWI A;  2O8D B;  4LH4 A;  1BQN A;  4A5A A;  3EE8 A;  2YNF A;  3TTC A;  4C1N I;  4WQ4 A;  1BHL A;  1VQ7 N;  3TAR A;  4X65 K;  3CCL N;  4IO9 L;  2QK9 A;  4EHT A;  1NGD A;  4DKW A;  4B9V A;  4BVO A;  2D5R A;  3B8A X;  3H1Q A;  3OYI A;  3AO3 A;  2WON A;  4B8C A;  3H45 C;  1I94 K;  1WLJ A;  2F8T A;  2DY4 A;  4CZM A;  2HST A;  4RW7 A;  1NJX A;  4AM6 A;  1QZ6 A;  1CZB A;  3AAR A;  4DFM A;  4N47 A;  3ZSW A;  3K58 A;  3G10 A;  4KFB A;  1NNE A;  1UWB A;  3ITH A;  1RIL A;  1ESV A;  4KTQ A;  4A5B A;  3WXL A;  1D4X A;  5C10 A;  1RBS A;  1VQN N;  1ZBF A;  1XI1 A;  4CJS A;  5BR9 A;  1OKJ A;  3VA0 A;  3U6F A;  1S1W A;  1KVB A;  2HNZ A;  2OPS A;  4JRQ A;  4GKJ K;  2GUI A;  2E6L A;  3T1H K;  2QWL A;  3ZSQ A;  1N34 K;  3C95 A;  3THY A;  3B6P A;  3UKU B;  1MDU B;  4I2P A;  3AV9 A;  1SKR A;  2O4G A;  2NZT A;  5TKW A;  1O1W A;  5LJV A;  3KJV A;  3GBT A;  2E8A A;  2ASM A;  1Q86 O;  2HBJ A;  2XRI A;  1E4F T;  4JI4 K;  4ILG B;  3NVK A;  2VGN A;  1WSJ A;  2IOC A;  3NCI A;  1JLB A;  5HRR A;  2GWJ A;  2G8I A;  4W5T A;  1YT3 A;  4FLW A;  1YJW N;  4RTF D;  1JCF A;  5KQ8 A;  2X74 A;  3A8Y A;  5AJ3 K;  3ZSO A;  3TAQ A;  4X62 K;  2UXC K;  3RRH A;  1IKY A;  5AQW A;  5LMU K;  4GV6 A;  2RN2 A;  3ULE B;  4CI6 A;  3ID6 A;  3NVM A;  3OJU A;  5CZ1 A;  3HOT A;  4M3X A;  1NGH A;  4AM7 A;  3CPW M;  4JK8 A;  3HM8 A;  5AZI B;  1NU0 A;  4E3S A;  1ASW A;  4DTU A;  1NGE A;  1HKC A;  2DFE A;  3PX6 A;  1CZA N;  1YUW A;  4NCA A;  3EKS A;  5F1X A;  3OBW A;  3H46 O;  1HJR A;  1TAQ A;  3IMX A;  3D2E A;  1TUY A;  1MU2 A;  3C65 A;  1KVA A;  1DEJ A;  4KH6 A;  3ZYY X;  5KGX A;  1B9D A;  2YKN A;  1JXE A;  4LF5 K;  4KRE A;  4OKK A;  4BR4 A;  3FR0 A;  5JMV A;  1TYQ A;  2FSJ A;  2NNW A;  3J8A A;  2ETJ A;  4IG3 A;  4CEZ A;  1T44 A;  4OVL A;  2ZM6 K;  2O8E A;  1ATS A;  3R8E A;  4DV7 K;  3VEY A;  4A2A A;  1RGI A;  4B1U B;  3SQ4 A;  1EWQ A;  3RWU A;  4AHU A;  2G8K A;  4CK3 A;  3CJB A;  4GV9 A;  1HQU A;  1M90 O;  4ELV A;  3DRP A;  3OYN A;  1GLJ O;  3TTD A;  4FOI A;  1Y97 A;  3DXK A;  5AR0 A;  3QEW A;  1YTA A;  4RCH A;  1VAZ A;  3KK2 A;  1P8Z A;  2IGI A;  5C15 A;  1RDA A;  4K25 A;  3NE6 A;  3ZCM A;  1XWL A;  2KFZ A;  1SL1 A;  3ATV A;  1QQO A;  2XY5 A;  2P9K A;  4AF1 A;  4CJR A;  1DTQ A;  4A59 A;  5SZT A;  4F3O A;  3CQX A;  3IRX A;  2O8D A;  4IJN A;  3I8D A;  3ENO A;  1YIJ N;  1A5X A;  2JLE A;  4NCG A;  3S3N A;  5DK5 A;  2F7T A;  3WNE A;  1NKC A;  3ZSY A;  1XNR K;  4K8X A;  2NRR A;  2E6M A;  3F2K A;  3AVA A;  1VSM A;  3PO4 A;  3JYT A;  1XQS C;  4Y1D A;  3EYZ A;  1W97 L;  4FLY A;  3OYJ A;  2P9P B;  3AVK A;  1NJW A;  4U7B A;  3BY5 A;  3TWH A;  1NK0 A;  1YHQ N;  4OJR A;  2FF6 A;  3SAF A;  2CGK A;  1FK9 A;  5EXW A;  3P1G A;  4O0J A;  4KHW A;  2O8C B;  2QKK A;  1BI4 B;  3F5T A;  1TL3 A;  3H08 A;  1RT2 A;  3ALY A;  3MK6 A;  3SQ1 A;  4CJ5 A;  5J2Q A;  4FWS A;  2VG7 A;  4DQR A;  4AQY K;  3LDO A;  1S6P A;  4CF8 A;  2E20 A; 
#chains in the Genus database with same CATH homology
 3CCJ N;  4CZL A;  1Q81 O;  3GL1 A;  4BRL A;  4BC4 A;  2V7Z A;  2DPN A;  5GAG P;  1VQO N;  3DXM A;  1VQ6 N;  4B1Z A;  3S41 A;  5FPE A;  3C6H A;  5GAD P;  4JN4 A;  1YAG A;  3ZET B;  3CC2 N;  2ZWH A;  3J7Z O;  3O9T A;  2YHY A;  3SMP A;  1DKG D;  3UKR B;  1U6Z A;  5BRD A;  2A3Z A;  4M7Y A;  4B1W B;  3FZL A;  2YJF A;  3OHR A;  5FPD A;  2NLX A;  1NGF A;  1U2V B;  2HBM A;  2NRT A;  2E1Y A;  4ISG A;  4JD2 B;  4CZG A;  1YIT N;  2P9L B;  4BRN A;  5AQK A;  3G6E N;  3K9K A;  4WFB L;  3CIP A;  2QWP A;  4MLH A;  1EQY A;  4OPH A;  3WEE A;  4WQ5 C;  3CCS N;  2P9I A;  4JKA A;  2WBN A;  4MLE A;  3MWT A;  3IUC A;  5AZJ B;  5FPN A;  3QBX A;  3MN7 A;  3SLC A;  2YX6 A;  1HUX A;  2P9P A;  3Q7C A;  2Q0R A;  2UYT A;  4JHD A;  4OPA A;  3WQT A;  3CC4 N;  3A5L C;  2IVP A;  1K8A O;  5TKY A;  2WFB A;  5AQY A;  3MX5 A;  5GAE P;  4CD3 A;  2Q0U A;  3CXC M;  5M1O A;  4EAH D;  3QIC A;  3C7N A;  3EE9 A;  2Q36 A;  3UB5 A;  2AA4 A;  1TUU A;  1GLC G;  1VQ8 N;  1NM1 A;  1S3X A;  4MO4 A;  2GUP A;  5LJW A;  3AAP A;  3R9P A;  3OW2 M;  2W40 A;  2QWM A;  3CPE A;  4H5W A;  3M6G A;  4JKF A;  4BVP A;  4H0X B;  3MDQ A;  4BC5 A;  3DWL A;  3N4P A;  4KH4 A;  4YDU A;  2QA4 N;  4C1N K;  5AFU H;  4KBO A;  1YVN A;  4GNI A;  5AQX A;  1XC3 A;  3VEO A;  2QW9 A;  4L3Q A;  5GIO A;  4U67 L;  4E1J A;  3M1F A;  2HOE A;  4PKI A;  3RSE B;  2D4W A;  3IDH A;  4BQZ A;  3R1X A;  3VGL A;  5GIN A;  4ISE A;  4A57 A;  1KD1 O;  4JEP A;  1KXP A;  4FWM A;  4MO5 A;  3CJA A;  5AQG A;  5FPM A;  3ULE A;  3ZYY X;  4BGB A;  5BN9 A;  4BRC A;  1Q18 A;  3O80 A;  5M1P A;  4C23 A;  3HTV A;  5KPT A;  1VQK N;  5AQJ A;  4FVU A;  3VOV A;  1NWK A;  1DT9 A;  2OTL N;  3TSQ A;  2FF3 B;  3ZET A;  2ZJP L;  5AQM A;  3E9O A;  4BRP A;  1IJJ A;  3EO3 A;  3UKR A;  3ZEU B;  3SMS A;  3SJH A;  1VQM N;  1R59 O;  3K9J A;  3HBT A;  4WFA L;  3M5R A;  1Z6R A;  2ASP A;  1W2B M;  2EWS A;  1U2V A;  3ZX0 A;  4DHY A;  2ZJQ L;  4PL8 A;  2FSK A;  3BF1 A;  4JD2 A;  3CCV N;  2NRZ A;  2KLA A;  3KZB A;  2P9L A;  4IEE A;  1O13 A;  1NLV A;  3FZK A;  3P39 A;  2HMP A;  3CQY A;  4FWL A;  4WQ5 A;  5BN8 A;  4R79 A;  3W0L A;  3SK3 A;  4H5V A;  4NLB A;  3P31 A;  2QWR A;  5E26 A;  1HKG A;  2F9W A;  2GWK A;  4H5N A;  3WUH A;  2NRX A;  3ATU A;  1ATN A;  4JKG B;  3FZF A;  3E9P A;  3O1B A;  4DQ8 A;  1K8K B;  4FWP A;  3GOI A;  3JXU A;  4FPA A;  4HTL A;  4MDB A;  2GEM A;  1QVF M;  3CCR N;  4FOE A;  5AZJ A;  5JLF A;  1YXQ A;  5CR4 A;  3VTH A;  2RHK A;  3TU5 A;  4BR7 A;  2OTJ N;  1HPM A;  2CH5 A;  3G71 N;  3O6W A;  1GLL O;  4YOR A;  4FO0 A;  3CER A;  4BR9 A;  3QFU A;  1C0G A;  4IZ9 A;  1YJ9 N;  3DLL L;  4JNE A;  2QWO A;  4WQ4 C;  5GIP A;  1NGC A;  1NGJ A;  3VF2 A;  2JWK A;  1H1V A;  1N8R O;  1VQP N;  3LDL A;  2ZGY A;  5AQR A;  5I9E B;  5BPN A;  1KAX A;  1MA9 B;  2GEL A;  5C2D A;  2E2P A;  3KHY A;  3VES A;  3F9M A;  3O9S A;  3ENB A;  3DAW A;  3SAH A;  2QI2 A;  3W3D A;  3WXI A;  2HF4 A;  4PKH A;  2E2N A;  3LDQ A;  3H1V X;  4BRD A;  1X3M A;  5EX5 A;  3A5M C;  1K73 O;  4IOX A;  4GV3 A;  4I6M B;  3AY9 A;  3LM2 A;  5H1S Q;  4FWQ A;  1QQM A;  3RSE A;  1HX1 A;  4ILH A;  4BRQ A;  5EVZ A;  1HJO A;  3FZM A;  1VQ5 N;  2P9U A;  3O1W A;  1HLU A;  1YI2 N;  4YOX A;  4CZE A;  4YOY A;  5HL7 L;  3Q7B A;  2Q2R A;  3U8X A;  4BR2 A;  1X9J A;  1S22 A;  3MN5 A;  5AQT A;  4BRE A;  4CD1 A;  2YHX A;  3ZEU A;  5BPM A;  4NB4 A;  4CZH A;  3O08 A;  2VGM A;  2V7Y A;  3CI5 A;  4H03 B;  4UY8 O;  1EO1 A;  4JK7 A;  4M63 C;  2I7N A;  2D0P A;  4BRG A;  3H3O B;  1KAY A;  4JKD A;  3VF6 A;  2P9S A;  3T7Z A;  4RWT A;  3EZW A;  2ZJR L;  4QS8 A;  5DM6 L;  2FXU A;  1P90 A;  3E9L A;  3ZX3 A;  5JLH A;  3QB0 A;  1JJ2 M;  5AQL A;  2CGL A;  1BOT O;  3L6Q A;  4CBU A;  3VPZ A;  4H0Y B;  3D2F B;  4ILJ A;  2NRV A;  4QS9 A;  1K8K A;  4HWI A;  4FWN A;  4WCE L;  3KWI A;  3T69 A;  2IVN A;  2GTD A;  4A5A A;  3G25 A;  3UE5 A;  3EE8 A;  4CJ7 A;  5CE3 A;  3TTC A;  3O4W A;  4A62 A;  4C1N I;  1YJN N;  4WQ4 A;  1GLD G;  1VQ7 N;  4KH5 A;  1SS6 A;  5JVG L;  4BY9 C;  3CCM N;  3CJC A;  4F9O A;  3CCL N;  4IO9 L;  1VQL N;  4A2B A;  3CET A;  1GLA G;  4EHT A;  1DGK N;  1BDG A;  1NGD A;  2QM1 A;  1Q82 O;  4DKW A;  4BVO A;  1BG3 A;  3B8A X;  3H1Q A;  2HBK A;  4BG8 A;  5BPL A;  2HF3 A;  1JCG A;  2JWL A;  3L0Q A;  3H45 C;  2CGJ A;  2QXL A;  3LDP A;  2WUS A;  3U9D A;  4CZM A;  2HST A;  1T6D A;  4FWO A;  4BG9 A;  1Q7Y O;  4I6M A;  4AM6 A;  1QZ6 A;  3L4Q A;  3GG4 A;  3AAR A;  3TTF A;  3LL3 A;  4H0O A;  4O8K A;  1NMD A;  2NRH A;  3ZX2 A;  1BA1 A;  4BRA A;  3HOS A;  3DJC A;  1Y64 A;  1ZXO A;  1KC8 O;  1ESV A;  2A41 A;  4FPB A;  3E1Y A;  4A5B A;  3CJ9 A;  5BRE A;  3KWG A;  2V52 B;  3C0B A;  3WXL A;  1D4X A;  5C10 A;  3PLA A;  3AAQ A;  3HI0 A;  3I33 A;  3EN9 A;  4IOC L;  1VQN N;  3OBY A;  2FSN A;  4CBW A;  4MDA A;  5MLC Q;  2QTD A;  1OKJ A;  5BR9 A;  4IXC A;  2Q1N A;  3GE1 A;  5M1F A;  3I56 N;  1NGG A;  3VEZ A;  4PKG A;  2Q31 A;  2YCH A;  3D2F A;  2QWL A;  1ZBS A;  3H3N O;  3VER A;  4CZI A;  1NGI A;  3UKU B;  5B8H A;  3U9Z A;  1MDU B;  4IEI A;  2A5X A;  1NGB A;  5TKW A;  2NZT A;  5ELZ A;  3D2E B;  5LJV A;  4OO1 J;  4NLC A;  3WXJ A;  3GBT A;  3BUZ B;  5AQU A;  2E8A A;  2GX9 A;  2ASM A;  1Q86 O;  3TSP A;  1J6Z A;  2HBJ A;  2P9I B;  4FWR A;  1GLF O;  5BRF A;  1E4F T;  4H0P A;  1TYQ B;  2QWN A;  3BF3 A;  3O9Q A;  4GY2 B;  5C12 A;  3HSC A;  3A5N C;  4ILG B;  2F9T A;  2VYP A;  3I8B A;  3MCA B;  4XH4 A;  3VET A;  3OA9 A;  3QDK A;  5ADX H;  5M1Q A;  5JIC A;  3NVK A;  3EKU A;  4CZK A;  3VEV A;  2YHW A;  1ZC6 A;  1YF5 L;  4B1X B;  1ILY A;  2VGN A;  5EOY A;  4BR0 A;  4J8F A;  1KQS M;  3RVC A;  3NMU A;  4Y0W A;  4K41 A;  3C7N B;  3MWP A;  3FGU A;  1SAZ A;  5BRH A;  1C0F A;  2D0O A;  4YOT A;  3BEX A;  4BRO A;  1LCU A;  4IJA A;  3FLC O;  1NJI O;  2GWJ A;  4BRF A;  4CZF A;  5C0Y A;  1YJW N;  4RTF D;  1JCF A;  5KQ8 A;  5E84 A;  3VF4 A;  1K9M O;  3DXK B;  5AQH A;  3A8Y A;  5DM7 L;  3AGR A;  5JVH L;  3CC7 N;  1BUP A;  4B1V A;  1RFQ A;  2A42 A;  5KPR A;  3LM9 A;  5AQW A;  2Q97 A;  2J4R A;  4GV6 A;  1RDW X;  2P9N B;  1GLB G;  3ULE B;  3WXK A;  3ID6 A;  3NVM A;  4CI6 A;  1V4S A;  3O5B A;  4CBX A;  3HOT A;  2QEX N;  1NGH A;  2QWQ A;  3MX2 A;  4AM7 A;  2P9K B;  3CPW M;  4JK8 A;  3HM8 A;  4BQL A;  5AZI B;  1M1K O;  4JKG A;  4DCH A;  4JKB A;  2PFU A;  4BC3 A;  4K42 A;  1NGE A;  1HKC A;  3QML A;  1CZA N;  1T6C A;  3UKU A;  1SQK A;  1YUW A;  2H3G X;  2KHO A;  1T3V A;  3EKS A;  2ASO A;  4H0V B;  4BRK A;  5F1X A;  4BRM A;  3OBW A;  3H46 O;  3O9R A;  3VTI A;  3D2E A;  1TUY A;  2BH1 A;  2PAV A;  3C65 A;  3IMX A;  1DEJ A;  1QHA A;  3H6E A;  3L4I A;  1WUA A;  4KH6 A;  3MMV A;  3CCU N;  1BA0 A;  5ADX A;  1V4T A;  4M7X A;  4EFH A;  2E1Z A;  3VMF B;  1HKB A;  1LOT B;  3FR0 A;  3M3Z A;  3N4Q A;  3SBT A;  4BR4 A;  5JMV A;  4JKH A;  1TYQ A;  2FSJ A;  2NNW A;  3CJ1 A;  3CD6 N;  1VQ9 N;  1BU6 O;  3J8A A;  4YOV A;  4BC2 A;  4G9Z A;  3PIP L;  3ID8 A;  4XH1 A;  4JK9 A;  1T44 A;  1Z05 A;  4IOA L;  3A0I X;  1MWK A;  1KAZ A;  1JCE A;  1QZ5 A;  5AQP A;  2A6A A;  2ITM A;  3TPQ A;  2PBD A;  3EL2 A;  1G99 A;  1ATS A;  4JKC A;  3R8E A;  4GVE A;  3A5O C;  4BGA A;  3VEY A;  2ZGZ A;  4A2A A;  2HBL A;  3P4I A;  1RGI A;  2BTF A;  4Z94 A;  4B1U B;  3E66 A;  1IG8 A;  3VGK A;  4B9Q A;  2WC9 A;  1GLE G;  2D1K A;  3CJB A;  4NO7 A;  2E2O A;  1M90 O;  4GV9 A;  3FFK B;  3IFR A;  4FSV A;  3D7E O;  5AQS A;  5M1N A;  5EY4 A;  1GLJ O;  3TTD A;  4BR5 A;  1S72 N;  4ISF A;  1BO5 O;  1SZ2 A;  3SAG A;  4FOI A;  2IVO A;  3JS6 A;  2OAN A;  3DXK A;  5AR0 A;  5M1K A;  5AQQ A;  3ENH A;  2E2Q A;  4RCH A;  5AQI A;  1VAZ A;  1RDU A;  3VGM A;  3WQU A;  2VCP A;  4PL7 A;  4H5R A;  1P8Z A;  2CH6 A;  5CHI A;  2V51 B;  5C15 A;  2IIR A;  3CCE N;  2A40 A;  4K25 A;  2NRW A;  2P9N A;  4FWK A;  5AQV A;  3FE1 A;  4BRH A;  1VQ4 N;  1NBW A;  4YOW A;  2P9U B;  3QFP A;  4DB3 A;  3ATV A;  3DXM B;  2BUP A;  1QQO A;  3O8M A;  2P9K A;  4AF1 A;  3VEX A;  5AQZ A;  3WXM B;  5AZI A;  3GDQ A;  4XEI A;  4A59 A;  3SBG A;  3CQX A;  3CF5 L;  3WT0 A;  4IJN A;  5AQF A;  4IWV A;  2YJE A;  3CCQ N;  3ENO A;  1YIJ N;  1WOQ A;  2W41 A;  3LDN A;  5KQD A;  4IDH A;  2P9S B;  2F7T A;  3HRG A;  3TSU A;  2FLO A;  1ATR A;  3C6A A;  3MCP A;  2NRR A;  3F2K A;  3WEE B;  1XQS C;  2YI1 A;  5KPZ A;  1E4G T;  5C2F A;  3MN9 A;  1MWM A;  4A61 A;  1W97 L;  2I7P A;  4H0T B;  3CJ7 A;  4O5F A;  4WYB A;  3IKM A;  2P9P B;  5LY3 A;  1OVY A;  4JHD B;  4JAX A;  4XH5 A;  4BRI A;  3AGK A;  4IO8 A;  4QS7 A;  4PHT X;  4H5T A;  4U7B A;  4EIA A;  3R6M A;  2ZF5 O;  1YHQ N;  5HOO A;  2VWB A;  3CME N;  3KK7 A;  2FF6 A;  3SAF A;  2RE2 A;  4EHU A;  1NGA A;  3BP8 A;  2CGK A;  4CZJ A;  3P38 A;  1QQN A;  5EXW A;  5F2R A;  2AP1 A;  3PIO L;  5AFU A;  3KVG A;  4LC9 B;  4FL9 A;  5AQN A;  3O9U A;  4WF9 L;  3CMA N;  3CHW A;  4WFN L;  3R3L A;  4B1Y B;  3F5T A;  5F0X A;  2E88 A;  1QVG M;  3MK6 A;  3VEW A;  1XUP O;  4O8U A;  3I55 N;  2KKZ A;  3FZH A;  3MN6 A;  3VEN A;  5GAH P;  1X3N A;  3QBW A;  4YOU A;  1BWF O;  4FWS A;  5AQO A;  4JKE A;  4YDU C;  3D6R A;  4IFE A;  3G4S N;  3U4L A;  4K43 A;  3LDO A;  3HZ6 A;  2E20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...