3LAKA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-heterocycle pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Heterocyclic pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lakA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lakA05
2E9TA 3KD1E 2RN2A 4M3TA 4DSLA 4O3QA 2NUBA 1Z25A 1RT5B 2UUWA 4EBEA 5KFLA 3QIOA 5HRRA 3QO9B 4ECTA 3AA3A 3DRPB 4FLZA 1WLJA 2IS3A 1T05A 4DQSA 2OPPA 4EEYA 3LP2A 5JS1A 4ZPBA 4B3OB 3QNNA 2VA2A 4G1QB 3JSMA 2E9RX 4IR1A 4CJKA 3DM2B 3VQ8A 1FXXA 2DFHA 3HVAA 1KTQA 4Z0UA 3NHGA 1RTHA 3LDSA 2HNDB 5L1JA 2FJWA 3NAHA 5KI6A 1TK5A 4KSEB 5FROA 1MU2A 1VSEA 3FRZA 4DLGA 3HT3A 5KGWA 2FJXA 4KB0A 4EP4A 5C42A 3CDEA 3V6KA 2XRIA 2HHUA 1U09A 1NK5A 2X6NA 2ASDA 4HTUA 4ECUA 2F8TA 1BCMA 2VG6A 3LP2B 5SZTA 1SV5B 4NLDA 4CHOA 2G8WA 2IJFA 2AGPA 3DLKA 1L3UA 4CEOA 2HHVA 5EU7A 4EYHB 3OS1A 1HMVA 2BDPA 4YNQA 2YNGB 4H4MB 5I3UB 1HQEB 2AX1A 4FLTA 3THVA 3SPZA 4K4TA 2IM3A 1S1XA 4IQXA 1B9FA 3OYHA 1FK9B 5DQHA 3ZSZA 1N6QB 4ZVEA 5D3GB 1CZBA 2FBVA 4QPXA 5KG7A 1YTUA 4Y1DA 4K4UA 4FJGA 2YNIA 4ED8A 3OYIA 3LAKA 4ZP8A 4O3NA 2BE2B 4JLHA 4RW6B 1KLNA 4B08A 3WNGA 4NCGB 3HVWA 5KG6A 3PO4A 5C25B 2IDOA 1J9AA 4WFZA 4ZHRB 4ZPCA 1EP4B 1NK4A 1RT3B 3CYMA 4IKFA 4J9LA 4WE1B 1J54A 4KHMA 4R0EA 3DLEA 5F9LA 1S1WA 4DQIA 3QERA 4NZ0A 1X9WA 5HBMB 1RTDB 2VG5B 4IRCA 1GX6A 4GC6A 3OY9A 4CJFA 4ZP9A 4PWDA 2AGOA 2HW3A 2O4GA 4ZVFA 2XGQA 4LQ9A 3GIKA 3DYAA 3HJFA 4DG1A 4IOBA 2VG6B 5JXSA 3UIQA 3QIPA 2FC0A 3U3YA 4F3TA 2WHOA 4ZHRA 3BSCA 4FJKA 1LAWA 5I42A 2KZMA 1RTIB 2DTUA 4C8NA 4FJ5A 3K5OA 3NDKA 1HQEA 3RR8A 4OPJA 3KLFB 4HUEA 4RW7A 3P83D 4CJQA 5HP1A 2YKNA 4RNMA 1GOBA 3Q8SB 3ITHB 4C8OA 2C2RA 1FKPB 4OL8A 4CJ4A 1TK0A 1MMLA 2UUTA 1SKSA 2RPIA 3IGNA 4NLQA 3HPHA 4CJWA 4DMNA 4BWMA 1SKRA 4J9NA 1JXEA 3M8PB 3ZCMA 4DG1B 3KLIB 5CY4A 4I7FA 4BE0A 4FM2A 1JXBA 3M8QA 1S1WB 4TXSA 1Z4UA 4DQRA 4QWCA 3MXMA 5JUMA 4DSIA 1N5YB 3TAMA 2RKIA 4NLPA 4RW9A 1ZBUA 4ZVGA 3I0SA 3DDKA 1YVUA 1X9MA 2UVRA 1JLFB 2HWIA 2BQ3A 4QWDA 3CDUA 1RDRA 3S3MA 1HYSB 3PJWA 1BCOA 1UAXA 4F4KA 5C24A 2R2SA 3QNOA 1LWCB 4N76A 1WSFA 2GIRA 1GOAA 2OPPB 3SV3A 4KHRA 4QAGA 1UA1A 1LW2A 2G8HA 2HWHA 5KT4A 4CK3A 1D9FA 1LV5A 1C0TA 3K2PA 1JKHB 1JIHA 3DLRA 2FVQA 2C28A 4K8ZA 1KHVA 4I2PA 1C1BA 2O4IA 1HRHA 3RMDA 4FBTA 1JLQA 3TABA 3C95A 4B8AB 1I3AA 2ILYA 4ECRA 4NLXA 3OYFA 4CJEA 4JV1A 1X9SA 2HHTA 4KI4A 1RNHA 2G8KA 1HNVB 1TV6A 4KTWA 2BQRA 2F8SA 4BE1A 5F9NA 1JLBA 3RAXA 1NOZA 4QOZB 3U3GA 1KFDA 4CGIA 1VRTA 1XR6A 4B3OA 2ZE2B 3KLVA 4CEZA 1RYSA 4F2RA 3D5MA 4ECSA 4JS5A 4DU3A 2UVUA 4KHQA 3G6VA 1NNDA 3RTVA 4KB7A 5L9XA 2E6MA 4KTZA 3RBEA 3VQEA 4I9QA 1C1AA 4DTRA 4Q0BA 4NYNA 3AA2A 1OS5A 3QINA 4HKQA 5HLFA 2W9BA 1LWEA 1LW2B 1RA6A 4K8XA 1TAQA 4AHTA 1S1VB 1RDBA 5HP1B 1SL0A 4QWEA 2R8JA 1TKDA 1IM4A 3C6UA 1KFSA 1TKXA 2WONA 2HVHA 2XO7A 3OYAA 4PUOB 3OSNA 4IDKB 4EYIB 1EETB 1BHLA 1S6PB 1EP4A 2W7PA 1VSIA 1SL1A 4B9TA 4IBNA 3ZSQA 1HNVA 2VWKA 4TYBA 2P5GA 4AILC 4DL5A 5DLFA 1NJZA 3KLIA 3RBDA 1A5XA 3KLHB 4F4WA 1FKOB 4J9QA 3LPTA 3IRXA 5D3GA 4IH7A 3GV8B 1QHTA 5FRNA 1S9EB 4ZTFA 4DTSA 3CM5A 3QIPB 1UOCA 4AH9A 4CEQA 1EETA 4Q8EA 3QYYA 2OPQB 2C2EA 4YFUA 3JSMB 3KHGA 2O5DA 3BREA 3KK1A 2FLPA 3H5SA 1D9DA 3OYJA 3SYZA 1C2PA 1QAJA 2XHBA 4RNNA 4FXDA 2HNDA 3CWJA 1EKEA 2XI2A 4QCLA 3G6XA 3NGZA 5EWFA 1LWEB 1N4LA 3C6TA 3KLEA 2AGQA 2D0AA 4CIEA 5KFZA 3OVNA 4N5SA 5EWEA 3OL6A 3PZPA 3QLHB 4EBCA 4HVJA 1S0MA 1NOYA 3SV4A 4KAZA 1REVA 4TQSA 3D45A 3SFGA 5KFEA 5E41A 3NE6A 4FLVA 3OHBA 3DRSA 4CGJA 1S0OA 2HHSA 4FZXC 2IC3B 4DF4A 1C1CA 4RUCA 1YVFA 1YTAA 1QTMA 3RR7A 1R0AB 2FBYA 4RZRA 4Y34A 4WFYA 4TY9A 4TY8B 4KBIA 1JLEB 5KFPA 1QE1A 4KKOA 2Y1JA 2J6UA 2Z1JA 1VK0A 3VQCA 1N6QA 4GVMA 1RT4B 3LP1B 3PV8A 4RNFA 1TQLA 2E4LA 4J2EA 4MQ3A 4O0JA 1DTQA 5KFNA 1S1TA 4JV0A 4I9LA 1DTTA 3OS0A 3VQQA 3EPIA 1FKPA 2YKMB 1BIUA 3AO4A 4ECWA 2J6TA 4E3SA 4ED1A 3AVIA 1XHXA 1RTJA 3KLGB 1QUVA 4FW1A 3ZSYA 4IFYB 4CJUA 1J53A 4M42A 4CEDA 1TK8A 3V6DB 3SQ4A 4FJMA 1WSHA 2HB5A 4CJLA 4K4WA 2XCAA 4Q5VA 1WSEA 4DTXA 4CHYA 3KLEB 1BQMB 4GMJB 2HNYB 1A5WA 3OLAA 3V81A 3UQSA 1SH0A 3MEGB 2D0BA 4RW8B 4I2PB 4NLSA 3KMSA 4NLVA 2R8IA 3AVFA 4EZ6A 2W9CB 2P1JA 2AU0A 4DFPA 4MFBA 4O4GA 1J5OA 3NAEA 3SUOA 3V9ZA 4FLYA 1EX4A 1TKXB 1S48A 3H5YA 2AJQA 2WB4A 1HYVA 4AHSA 4J9PA 3OYEA 1NK9A 4IG0B 4KKOB 5C24B 5KFKA 3GV7B 5CYQB 4TQRA 3NF9A 1HQUB 3PX0A 3VQ7A 3PW5A 3TAEA 3MEGA 4ZMMA 3CJ3A 1S1TB 5KFBA 2B4JA 2BR0A 2ITGA 3SI8A 3NMAA 1VSJA 2XWYA 3I5AA 1NK6A 1N56A 4DTMA 4W5RA 2G8FA 4Z4IA 1ZBLA 3CO9A 1VSFA 3AA5X 3A2FA 3ZT1A 4IFYA 4CHZA 4KI6A 4E7HA 1KLMB 5DQIA 2WK4A 4MKBA 1S1UA 5HROB 2X74A 4CCHA 4K4SA 1ASUA 3AVLA 3HSTB 2YHBA 2JEGA 4JRPA 3QO9A 1TGOA 3MEDA 1KVBA 4Y2CA 3KOAA 3WNHA 5J2PB 5L1LA 3KK2A 1QQCA 3V1QA 1LW0B 3CDWA 4CJ3A 3GIMA 3ZT4A 5CZ1A 4J2AA 4J9OA 4FJJA 2BE2A 3PW7A 1UWBB 4ICLA 4KPYA 1MU2B 5F8IA 1RCHA 2VA3A 5KT6A 5HROA 1S6QB 5DGAA 4PY5A 3UR0A 1RBSA 3SQ1A 1T05B 4KE5A 4NLTA 2WTFA 4CFBA 5KFFA 3K5NA 2HHXA 3NH0A 5J2PA 2OPSA 2QXFA 2BRKA 4TN2A 4E89A 3NCIA 3RB4A 4ELTA 3ICLA 1JXLA 1IG9A 5L1IA 3TR8A 1G15A 3ZSVA 3KK1B 2D3ZA 2R2TA 4NLWA 3CIZA 4QW9A 3EY1A 4O44A 3FQLA 3PW0A 2HMIA 4I2QB 5HRSA 2WOMA 2G8IA 1XWLA 4K4VA 4DTUA 4NLUA 3LP0A 2D0CA 4Q43A 5KFMA 5KFQA 3C6TB 3NH2A 3T1AA 5C42B 4J2BA 3SZ2A 2B5JB 4CFAA 2IM0A 4K4XA 2OH2A 4DWIA 4ECVA 4YQWA 2IC3A 3H2LA 2IGIA 2E9ZA 1SV5A 3BGRA 2C2DA 3SUNA 1F21A 3DI6A 5KFWA 3MEEB 3EPGA 3IG1B 3M9OB 4CIGA 5EWGA 3L2QA 3UDLA 3QGGA 4DSKA 1RBTA 3I5CA 3HXMA 1S6QA 3E51A 1HNIA 4H4MA 4ED3A 4BACA 4PQUB 1K6YA 4N56A 4IFVB 4H54A 3HL8A 3GIJA 1JLGA 1RT1B 3V1RA 1L3VA 3OL7A 4JS4A 2I5JB 1ZBIA 3ZT2A 4O3PA 4Q8FA 5HBMA 1RTDA 1NKEA 3MECA 4KO0B 3L2RA 5I42B 4FJ9A 4GW6A 4DSFA 4O4RA 5KFIA 3VN5A 2F96A 4TSXA 1A5VA 4H8KA 2WONB 1JLEA 1HJRA 3TAGA 1XR5A 2W8KA 4F4ZA 2YKNB 1C0MA 2CJQA 1BQMA 3H98A 4O3OA 1KCFA 3VQPA 4ED0A 3NAIA 2AX0A 3GIIA 2G8UA 2QKKA 2B5JA 1ASVA 3SCXA 1RBVA 1W0HA 5J2QA 3DOLA 1I39A 3TAPA 5F8NA 3GILA 3QEIA 1SKWA 3BSAA 2ALZA 2QKBA 5KFDA 4KO0A 4N47A 3HHKA 4URGA 4MFBB 2HAIA 4XIUA 3VQ9A 1BQNB 1Z26A 3MEEA 4FYDA 4ID1A 2RDJA 3NBPA 3KIOA 1JLQB 1GX5A 2I5JA 3N6NA 4NLOA 4DF8A 3KKSA 1Q9XA 3ZSRA 1TL3A 3MFHA 3I0RB 2ETJA 3AO5A 3AVMA 2X6SA 5CYMA 3QEPA 3LAMA 3MR5A 2OYQA 4DL3A 3CFRA 5DMRA 1KSPA 3KK3A 2YNFA 3OLBA 2QV6A 3D28A 3MTKA 3I0SB 3RWUA 2BANB 4O3RA 1FK9A 3KNAA 4CECA 3QZ7A 1IKVB 5KFYA 2DFEA 5KG2A 3BSOA 4EBDA 3AO3A 3P5JA 4HUFA 1VRUA 2ATLA 1NJXA 4M3ZA 2HVIA 3DLGB 2IAJA 3E01A 2EX3A 4ECYA 4DL7A 3LPUA 3PJXA 2DPIA 3RMAA 1LWCA 5FDLA 5KFAA 1RILA 3M8PA 1RT5A 4CGFA 2IOCA 5KGXA 3RMBA 5CZ2A 4LH4A 3D0PA 3KK3B 3QEXA 4EO8A 4WE1A 2R8KA 1RT3A 1N5YA 5KG5A 5KFHA 4NLGA 3K58A 1NK7A 1S9FA 2JEJA 3WNFA 4CEAA 1S1VA 1TKZA 1NHUA 4ECZA 4CF9A 3KLGA 1RT7A 2B43A 4K50A 4MIBA 3L3UA 3P1GA 2IM2A 4KHNA 1NKBA 4O5BA 3S9HA 4W5QA 1GOCA 4C8KA 4F8RA 4OKJA 1TP7A 3Q8RB 2V4QA 4IDKA 4CJSA 1D8YA 2ZKUA 2FJVA 4M41A 3KJVB 1RAJA 1L3TA 3ZT3A 3AA4A 1C6VA 3TANA 4HUGA 3NGDA 2A1RA 2R8GA 1CSJA 3PHEA 3FDSA 4FM1A 2FLLA 3H08A 4KV8A 1WNEA 4R5PA 2YNHA 4FK2A 4KB1A 4KHSA 2ZQBA 1NJYA 1RT7B 1SL2A 3FQKA 4YR2A 1IKVA 4CEFA 3H40A 2HHQA 2KQ2A 4QWAA 2BGGA 4IH6A 2HNZB 5T7BA 4B9UA 2XCPA 1BISA 1SH3A 4ZP7A 4FS1A 1LAVA 4E7IA 2ILZA 2FVCA 2GC8A 3OYLA 2G8VA 3ULDA 3AVAA 5J2MB 3LANA 1HQUA 4NYFA 3L2UA 4F2SA 5KFXA 4I7FB 3WNEA 3CVKA 4ELVA 3DLKB 2HHWA 4HHTA 4RW4A 3L8BA 3CFPA 1BI4B 3QLHA 3PO5A 3AO1A 1RA7A 2D3UA 4BWJA 4TYAA 4CIFA 4ID5A 3DMJA 2BRLA 5J2NA 2GUIA 1TKTB 4DTPA 4OLBA 4JRQA 3SFUA 4H4OB 4OGEA 5C25A 3CG7A 4CK1A 3B6OA 3K5LA 3S3OA 4DTNA 5DK5A 5K14B 4OPKA 4B9NA 2BQUA 3BQ2A 1RBUA 3NFAA 4Y3CA 3G0ZA 1L3SA 3AVNA 5L1KA 2OPRB 3BJYA 1HARA 3BQ1A 2B6AA 1C0TB 3IS9A 3CJ2A 4QW8A 3KD5E 1S10A 4DEZA 1K1QA 1IKYB 3BDPA 4NCAA 4KFBB 3VQ4A 4LQ3A 5J2NB 3LWLA 3M9MB 4URSA 2V0NA 1JLCB 4LSNB 1JLBB 3DOKB 5F8MA 3JYTA 1FKOA 3OYNA 4J9MA 1NK8A 4EZ9A 2IA6A 3RMCA 5FRMA 3V81B 3VQDA 1XHZA 1U47A 1QSSA 3PUFA 2EC0A 1VRTB 3HPOA 3DRRA 3SUPA 1TKZB 3T5HA 3OHAA 2FBTA 4LSLA 3DMJB 3NBPB 2IMWP 1CXUA 3AVCA 1TKTA 3KMQA 3S3NA 4IKAA 3G6YA 1YT3A 3QETA 4WYLA 1TL1B 1VSDA 1U49A 4F3OA 4IR9A 1RT6B 3NF7A 2X78A 1W9HA 1RDCA 3OYDA 4O44B 2D41A 4I2QA 1IKYA 1QE1B 2R2RA 1HPZB 4DFMA 5KTQA 4AHUA 4TLRA 3VA3A 4BDZA 4ZPDA 1VRUB 2VG5A 3DLGA 3E01B 3PR4A 2PYJA 3DOKA 1DTQB 3OJUA 1JLFA 1BQNA 4OGCA 3AVBA 1HNIB 3NGIA 1TL1A 3ISNC 1WNSA 4PUOA 3VQ5A 1U45A 2V4RA 4IRDA 4DFJA 4GC7A 1DLOB 3VQAA 3AVKA 5KG4A 2ASJA 1T3NA 1QS4A 3DLBA 5DQGA 5KFTA 2JLEA 4CGHA 3RB6A 3H5UA 3QGIA 2GV9A 4FLXA 1IKWA 4FK0A 5KFSA 5DG7A 3OYMA 4E1MA 1W25A 3SQ0A 3GYNA 1LW0A 3OYCA 2VWJA 3GV5B 3VA0A 5FDLB 4YMEA 5KFJA 2R2UA 5C5JA 4CF1A 5CYQA 1SUQB 1HMVB 4YR3A 2RF2A 5J1EA 1RDAA 1NHVA 4N41A 2Q3SA 3OYGA 3T5LA 1ZBHA 2E6LA 3QGHA 4EO6A 3PY8A 2PZSA 3DOLB 3TAMB 3VQ6A 4M95A 4M45A 3NH1A 4NCBA 1KLMA 1S1UB 4HYKA 3DRPA 4CGDA 1B92A 3OL9A 3QZ8A 3AVJA 1VSLA 4DLEA 4CJPA 1DLOA 4WYWA 5T14A 2YNFB 4DFKA 4FJXA 2JEFA 5DG9A 2QE5A 3HVTB 3M8SA 3ALYA 5KRTA 2PYLA 4OKKA 1BI4A 4O55A 4O3SA 3RB0A 2V9WA 4Q0BB 1QSLA 1JLAB 3G10A 3OYBA 4FJ7A 3NF8A 3PW2A 4F4YA 4YR0A 3Q8PB 4DSEA 4LY7A 3G86A 2QK9A 3SNNA 4J2DA 3T5JA 4JV2A 3BSNA 4FW2A 1B9DA 1BIZA 3HVTA 3V1OA 3SQ2A 2PY5A 2W42A 2DPJA 3U6FA 3KLHA 4CHPA 4FJHA 5F8GA 4RNOA 4RW4B 1Y97A 5KFVA 3IGVA 1JLGB 4Y2AA 4E7KA 2UVVA 1T94A 1WAJA 2KW4A 3HP9A 2ZE2A 1JX4A 2FBXA 3K5MA 1TAUA 1D5AA 2WOMB 1S5JA 3HPGA 4O4GB 1J5OB 4F4XA 4ELUA 3LP0B 3CJ0A 3CM6A 1WSIA 5JS2A 3AO2A 3ZSOA 3LZIA 4NCGA 5K14A 2AQ4A 4X2BA 2WCXA 3HKWA 4ECXA 4RU9A 4Q44A 3V6JA 4FLUA 3OYKA 1WSGA 3M8QB 1K1SA 2D7SA 2W9BB 2IJNA 1CLQA 5HRNA 3DLEB 1L5UA 1JLAA 4LD0A 3LWMA 3GQCA 3M9NB 3PR5B 1T7PA 4CJVA 2J6SA 1XC9A 1HYZA 3H4BA 3MXIA 4CJ5A 1VSHA 3F9KA 2HNZA 4KRFA 4TY8A 4KTQA 2W8LA 3BGRB 4DL6A 1TL3B 3V4IA 2Z1GA 3I0RA 4O0IA 4CESA 3IN5A 3DRSB 4ECQA 1HPZA 4AHRA 1SUQA 4PWDB 1T03B 2VG7A 1X1PA 4URQU 4AHVA 3TQ1A 1WN7A 4CF8A 4CFCA 3MEDB 4DU1A 3HYFA 2XY8A 1RT1A 1JL2A 1RTJB 4CHNA 2I1RA 4LSLB 3K59A 4BE2A 2C22A 3MR6A 3L3VA 1S49A 3RB3A 3O4NA 4DQPA 4B9MA 5KFCA 1IH7A 3QESA 5KT3A 2WRMA 3OL8A 3BR9A 4CJTA 4DTOA 2GIQA 1WSJA 2XY6A 3PVXA 3VQBA 2P5OA 5KG1A 2F8EX 4AHCA 4CFDA 1S1XB 1RTIA 2ASLA 4CEBA 1VSMA 4CE9A 4CJRA 1T8EA 3M8RA 2UVWA 4IG3A 4EP5A 1XR7A 4RW7B 1T03A 3QEVA 1WAFA 4FBUA 5KFUA 3MAQA 4HCBA 1C0UB 5KG3A 3HM9A 4Z4GA 3O3FA 3PW4A 5KRSA 4IG0A 3VQSA 3JYTB 2HMIB 4K4ZA 5KT2A 4E7JA 5HLFB 4YP3A 2W9CA 5EDWA 2XY7A 4NRTA 4MH8A 1QSYA 4FJIA 2IBKA 5F8HA 1ZTWA 1IO2A 4ZVHA 4DQQA 3TAQA 4G1QA 3V9XA 3O3GA 3MFIA 1KHWA 4W5TA 4BDYA 2P51A 1DTTB 4NRUA 2BANA 1RTHB 1KRPA 2R7YA 4PA1A 4M3WA 4HCCA 3DI6B 4NLYA 3KHRA 1S6PA 3DM2A 3QIDA 1RYRA 4FK4A 3H4DA 4XPCA 4C8LA 3SJJA 1NK0A 4RW8A 3I5BA 4Y1CA 3MR3A 3KLFA 3Q8QB 4PQUA 5KFGA 4CK2A 4DSJA 4U7CA 4IFVA 3B6PA 2Y1IA 3FFIB 2ZD1B 2KFZA 4B8CA 4IG3B 1S9EA 1ZETA 4FM0A 4FJNA 1TVRB 4J9KA 4B9LA 4M3XA 2FVRA 1ITGA 3KTQA 3ZSWA 2IM1A 1O1WA 1ZYQA 3O4QA 1ZTTA 2YNGA 5KT7A 4KHWA 5F8LA 1CXQA 3L2WA 4JUZA 4KREA 1D1UA 2GBZA 4RNHA 1IKXA 3V9WA 3V4IB 3DLHA 1UWBA 4ICLB 3T5KA 2XGPA 2EHGA 2OPSB 4CGGA 4CF0A 3TI0A 1S4FA 4DS4A 3OSPA 3FSIA 4W5NA 2RKIB 1KVCA 1TVRA 1Q8IA 1RT2A 1IKWB 5DGBA 5KFOA 4RUAA 2Z1HA 4DTJA 4ED6A 2OZSA 4CF2A 3EZ5A 3C6UB 4FZYA 2RF2B 5J1EB 2DY4A 3F73A 4E0DA 1HYSA 4WZMA 4Z4HA 2XY5A 4B9VA 1VSKA 4G3IA 4KV8B 4ZPAA 3RAQA 3SPYA 3KK2B 5SWMA 1UA0A 1RBRA 1JLCA 1RT4A 3LP1A 4LSNA 2RDIA 4WXWA 3RRHA 4Z4CA 4UQGA 1S97A 1JKHA 4J9SA 3CJ5A 2KFNA 1IKXB 2ZD1A 4ZP6A 3IRXB 4H4OA 3DRRB 3SI6A 3ISND 3ZSXA 4MKAA 2IAJB 4R8UA 3NF6A 4ID5B 5J2MA 2OPQA 1RT2B 1BGXT 3V6DA 3TVKA 1RT6A 1TV6B 4DL4A 4LH5A 3TAFA 5I3UA 3IG1A 4CHQA 4OJRA 5EUHA 3OJSA 4CERA 3PX6A 1EXQA 5KFRA 1N48A 2KTQA 2YNIB 4QWBA 4NLRA 2B6AB 3HK2A 4WXOA 4FVMA 4IRKA 4KHUA 3V9SA 4E1NA 3KJVA 3MECB 3T19A 3KHLA 4Q45A 4L8RB 4ZTJA 4Z4EA 4M94A 4IH5A 4R8UB 5J2QB 4KFBA 3SUQA 2VG7B 2YNHB 4M3UA 4FS2A 1NJWA 2W7OA 4R5PB 3CQ8A 3NL0A 1REVB 2YHAA 2FVPA 1ASWA 3KKRA 3C94A 4FLWA 1U4BA 3K57A 5HRPA 3LP3A 1NKCA 3IAYA 3H59A 3AVGA 4DU4A 3NGYA 3N6LA 3HO1A 2XC9A 4KAIA 3ZT0A 3EYZA 4RW9B 3CFOA 1D0EA 2AWZA 3PX4A 3H5XA 3V6HA 2XI3A 1C1CB 1S0NA 1R0AA 1KVAA 3LALA 1JL1A 3I8DA 4M3YA 5KG0A 4ED2A 1LWFB 2HNYA 4MIAA 3O3HA 2OA8A 4B9SA 4BDPA 3MF5A 4MK7A 2JC0A 4CEEA 3TWHA 3MR2A 4U6PA 3KHHA 1C0UA 4XO0A 4FZZA 3QEWA 1ZBFA 2KZZA 4J9RA 3DYAB 2YKMA 1U48A 1U04A 2LSNA 1I6JA 4NYZA 2R8HA 1S9GB 3T3FA 3BQ0A 5DLGA 3L2VA 4KHYA 3AVHA 3RRGA 4OKEA 4DL2A 2A1SA 2OPRA 3AV9A 4ED7A 2YV0X 3CJ4A 1BL3A 5DG8A 4WZQA 4FJ8A 3LZJA 1QAIA 5KT5A 2FLNA 4WFXA 2Z1IA 4E7LA 4K4YA 1XI1A 4XPEA 4C8MA 3ITHA 4RW6A 4W5OA 1LWFA 3MXJA 3NKYA 4OVLA 3IS9B 3UPFA 2D5RA 1RDDA 4DS5A 4FCYA 2CKWA 1SH2A 2JEIA 4M3RA 3EZUA 4RG8A 1CZ9A 3N6MA 5CYMB 3HP6A 4Z4FA 4OLAA 2JC1A 4MK9A 2FVSA 4FJLA 1S9GA 2ATQA 3TARA 2JGUA 3FFIA 3OS2A 2W9AA 3HVRA 4MK8A 5F8JA 3V9UA 1Q9YA 2DFFA 4F50A 1C1BB 2OZMA 3ASMA 4E19A
chains in the Genus database with same CATH superfamily
1DQAA 2E9TA 3BV8A 1RWWB 2RN2A 1Z25A 3QO9B 3GG1A 1ITPA 4P74A 3BH6B 2P9UB 3KYLA 4JEPA 4JI4J 2OPPA 2BYCA 4P9SA 4EEYA 3NMRA 3OBIA 1HKGA 3BKUA 4OZ0A 2VA2A 4NA3A 1NDKA 1VQ6S 2V8PA 1NCLA 4C4WA 2DFHA 2E7XA 1KTQA 3K17A 1ZBSA 3NHGA 1RTHA 5L1JA 2FJWA 4CT8A 5AZJA 1TK5A 3U1MA 4ZVSB 3CCEN 5FROA 1MU2A 5KGWA 2FJXA 2OTLS 1VR6A 4OV1A 1UVNA 1VK3A 5A6PA 2HHUA 3VTIA 3EXCX 1YJVA 2X6NA 1RXOB 2PAVA 2M3DA 2DT9A 3Q8VA 1HKAA 3P4IA 3NOCA 2F7VA 2QMXA 3VV2B 1L3UA 5D0HA 1YRXA 1XNQJ 2PGCA 2GFFA 4EYHB 3CD7A 4YNQA 1DFDA 3BGOP 3PACA 1G2EA 4FLTA 1R3NA 1K47A 1FNMA 2AJFE 2VB6A 1UZDA 2LXIA 3G6ES 3KG1A 2OMOA 3OYHA 4HHHA 2N4DA 5DQHA 2B7BB 4ETZA 1N6QB 4ZVEA 5D3GB 2QA4S 2UUBF 2J5AA 4QPXA 5KG7A 4Y1DA 4XK8C 2YNIA 4OZLA 4MJKA 4DV4J 4LF9K 4KQZA 1KLNA 2V68A 3IMXA 1FD8A 2X1GA 1RU2A 2IDOA 3E9OA 1J9AA 1CQMA 3GP9A 1FE0A 3O5TB 2ZH8A 2LQBA 1RT3B 3CYMA 2MQNA 3U1NA 3L95X 5F9LA 1S1WA 4DQIA 3P4UB 4NZ0A 1FJGK 3OY9A 4PWDA 1U1QA 4Y2IA 1X4HA 1SJ1A 2JH3A 4PZVA 3B4DA 2C2OB 4DG1A 2XZWA 3NNAA 2AKWB 3U3YA 1OO0B 3ZX0A 4ZHRA 3ENVA 4BC9A 1T44A 2LXUA 2KZMA 2DYAA 4PPZA 3NDKA 1HQEA 5GAHI 3RR8A 3T7ZA 4X62K 3P83D 1XTZA 4CJQA 5HP1A 1GOBA 5ETRA 4H4KA 3HD1A 3WXLA 2VFUA 3VOVA 2DR8A 1MMLA 5AXNA 1B64A 2UUTA 1SKSA 1PIEA 1YJRA 4ZPTR 2F63A 4DMNA 1T9UA 3HOTA 1SKRA 3DXMB 1YG0A 4DG1B 4OHZA 5CY4A 2LEPA 3M32A 1SQKA 3DOMA 4FM2A 3TQEA 2CJKA 1FE4A 4YOUA 4DQRA 3HTVA 3JAMY 4L3KA 1IBMJ 3TAMA 4HWIA 3QGPA 5LJ5Y 3MMCA 4ATNA 4RW9A 3CCRS 5FIIA 2P9CA 3WQUA 2UVRA 1JLFB 2QTWA 1B4SA 3FVYA 5BRHA 1HYSB 2EPIA 2QMWA 1HNZF 1BCOA 2DTJA 1UAXA 1BOTO 5C24A 1HLWA 3QNOA 3N4PA 2DNYA 3DXKB 4UTGA 4W98A 1GOAA 3SV3A 4KHRA 1K73T 2NRWA 1LW2A 1Y7PA 1ZA2B 1D9FA 5KT4A 2BOPA 1WG4A 2XEXA 4OQJA 1VC0A 3C15A 2U2FA 2O4IA 2BE7D 3RMDA 3VEVA 4FBTA 1JLQA 1YITN 1VQ8S 3TABA 3P49B 4KGVB 1I3AA 3HKZD 5A8RB 5FPEA 1RNHA 2H5EA 2QEXN 1FJ7A 2BH1A 2B4UA 1N36K 5AQJA 1NB2A 1SZ2A 3U3GA 5D6GA 3W62A 3NLCA 4NMXA 4ZDNA 1Y10A 3S41A 4MIWA 1XR6A 2OHDA 3SBGA 1RYSA 7FD1A 4ECSA 1SIZA 2D0OA 4Q7AA 1VOMA 4KHQA 2MZQA 3RTVA 2E6MA 2P9PB 3P31A 3VQEA 3UD3P 4GKJK 4IO9Q 4DTRA 3GLJA 1WHWA 4Q0BA 4ZS6A 3AA2A 4AD6A 1WI8A 1JWWA 5JMNA 1RB0A 4K5SA 2RHSB 2HHHF 1LWEA 2Y9HA 2KYZA 3H1VX 3M1VB 1KTVA 4KR0B 1F2GA 1WBDA 4FKXA 3A4TA 1VQNN 5GADP 3KJNB 1VAZA 2XO7A 4DX6A 4IDKB 2Y8YA 4MTPA 1Q18A 2UU9F 1LQ9A 3US5A 1CULB 2BJDA 3CJCA 2W7PA 2E2QA 2EC2A 1HNVA 4AYBD 4TYBA 2P5GA 2W4CA 4AILC 2ZDOA 1NJZA 1U2VA 3KLIA 1A5XA 1S22A 5GAEI 4K0KJ 1FKOB 2BEFA 3CJRA 4JI1J 2C3PA 2MKYA 5FRNA 4ZTFA 4DTSA 2PEHA 1N32F 2C2EA 3DWLA 1RQ0A 5BR8K 3JSMB 3KHGA 4U67Q 1XNRK 2GJIA 2O5DA 1NSQA 1UPPA 2CVEA 1VQ5N 1D3WA 2GAHC 3SYZA 4RNNA 1RGIA 2QWPA 3CEDA 1N33F 2XI2A 1YX2A 1U1OA 1EHWA 3CCUS 1T02A 3KLEA 1CULA 4JKDA 3ZNJ1 2B8PA 4TNOA 4P72A 4N5SA 1UMJA 5ADXH 3QLHB 1HJOA 5A76A 1NOYA 4DV1J 3A12A 2ZF5O 4PQAA 3SFGA 3IUCA 2YQ1A 5B08A 5BR8F 2D9PA 3DRSA 2MKKA 1S0OA 1XNRF 4FZXC 4A8YA 3W65A 1YVFA 4LUBA 1QTMA 1R0AB 4H5RA 3MPYA 4RZRA 5A0YA 2NNWA 4KBIA 4CQ1A 3T6JA 2F4VF 2AIRB 3CULA 4BCAA 4ZLPA 3VQCA 4GVMA 4YN3B 1TQLA 2C3MA 4X66J 2B9YA 3L4IA 2M52A 2OEKA 4I9LA 1UETA 1Q86O 1LWXA 3AQOA 3OD2A 5ETNA 2MQ8A 1QUVA 2F4VK 3MI7X 4PPDA 4IFYB 4CEDA 1TK8A 3V6DB 4FJMA 1WSHA 4WF9L 5HQ8A 2XG8A 4CHYA 1BQMB 4JYAK 4N77A 1XMOJ 1SH0A 2HBJA 3MEGB 4RW8B 1KAXA 4Y6IA 3G4SN 2P1JA 4DFPA 3NAEA 2BABA 1XMQJ 3V9ZA 1TKXB 3QMLA 4KGKA 2ZM6K 2CQGA 4J9PA 3LTOA 1NK9A 4IG0B 1P9YA 4FF3A 5BRFA 2L9NA 4WFNQ 5KFKA 1RBAA 3GV7B 4L74A 5L8RC 4JYAF 1M5HA 1HW8A 1RBLA 1T9VA 4FPRA 4K2XA 2M2BA 3VQ7A 4GO5X 4ZMMA 3SSQA 1S1TB 2BR0A 2ITGA 3ELHA 1EAYC 2XWYA 4LSZB 5AXMA 2DXEA 3R8YA 3QICA 2IVPA 3D6FB 2DHAA 2ZM6F 4LFAJ 3CERA 4Z4IA 2X7IA 4KI6A 3CMAN 3IR6B 4E7HA 1PYOB 4LF9F 2E2OA 1U2FA 1WWHA 4X4RA 2ZH2A 4CCHA 2VGNA 5H1SQ 3THYA 3IAM9 3HSTB 2YHBA 1PBAA 3AGRA 2G1DA 3UN2A 4QBUA 2HSEB 4PG7A 3W8GA 4PWUA 1YIJN 5J2PB 2ADCA 3J7ZO 5LOQA 4HDHA 4BVOA 1SC4B 1LW0B 2MLYA 4DCOB 3GIMA 4WQ4C 5CZ1A 4LF2A 4I56A 2XS5A 1WC4A 3FMWA 2O01C 4OYMA 3JTNA 4CO5A 4HACA 3HMJG 3SQ1A 2VYPA 5LJVA 2EEYA 3ETOA 1LK5A 1FX2A 5KFFA 2FSNA 4CTAA 1I1GA 4EI2A 3NH0A 1WBBA 3NGUA 3IFRA 2OPSA 1OPZA 1GT8A 4TN2A 4ZVUB 2Z57B 1QQNA 4JD2A 4G9ZA 1LNQA 1NGIA 2ZHBA 3TR8A 3CMES 3E2EA 4QW9A 4ZLJA 4YDUC 3FQLA 5AJ3K 2G8IA 1XWLA 4XH4A 2CQ3A 3K0SA 5KFMA 5KFQA 3M30A 3J80O 4J2BA 3SZ2A 3BM7A 1TTHB 3R6GB 4JI2F 2P5VA 1U8SA 2OH2A 4M1KA 3KNGA 5EGYA 1R89A 4ECVA 4YQWA 2IC3A 1FXRA 2IGIA 1NZ8A 1EJ7L 1SV5A 2O67A 3BGRA 2C2DA 3SUNA 5KFWA 3V5RA 1ILYA 3GCWP 4ZJQA 1NGJA 1VGYA 1UVJA 1BHNA 5EWGA 1YJTA 4DSKA 1RBTA 1M5VC 2KB2A 1S6QA 5M2UA 1N0UA 4BY9C 4N56A 2UP1A 1R8AA 2LQ8A 5T7LB 1JLGA 3TJAA 4JS4A 1S6OA 4TU9A 1ZBIA 4H0OA 4O3PA 1RTDA 4KO0B 2Y0SD 3QSYB 2CGJA 5I42B 4O4RA 3O1WA 2IRYA 3KWMA 1TUUA 4TSXA 5DZ6A 2PIIA 4DR3K 3MM5A 1XR5A 1T0TV 5K8PA 2CJQA 1WC5A 3VQPA 3OR1B 5EY4A 3E9LA 3C16A 4QIWD 1RBVA 4P7VA 1JB0C 4QYRA 1U6FA 5F0UA 4RCHA 1M5SA 2FF3B 3ULEA 3L7PA 3HHKA 1M1HA 3PEHA 3SMPA 4XIUA 1BQNB 2FGCA 4IDHA 2CRLA 3OBYA 1UPMB 3NBPA 3KIOA 2Q0UA 1I94K 4PYDA 2H54B 3MFHA 1Q7YO 2IBOA 2X6SA 4O5FA 2OYQA 4DL3A 2O8EB 2Z0GA 3CFRA 1UW4A 1H2VZ 3D0GE 2GJFA 1S99A 2GS8A 2DFEA 3EMTA 4USVA 3P5JA 4P6QA 4OYBA 2BV3A 2HVIA 3R5JB 3D1HA 1W7AA 3IM9A 4DCPB 1JJ2M 2FTRA 4J37A 4LVOP 2W25A 1HBNB 5CZ2A 2AMCB 2R8KA 2H3GX 1RT3A 4OIXA 1ATSA 1NGCA 5EHHA 1NK7A 3B78A 2R7OA 2KG0A 4CEAA 1S1VA 4ECZA 4CF9A 3FSYA 2JFDA 4X65F 4DV7K 4CYUB 3L3UA 3P1GA 2YXLA 3BO2A 2R4FA 4W5QA 4JKBA 2B4VA 2E1AA 2FJVA 2WUSA 4JI7K 1TUYA 3ZT3A 1FNXH 4ALZA 3TANA 3NGDA 3V4MA 1CSJA 1SCJB 1Y5IB 4DCJB 3FDSA 5E84A 4LFBJ 3H08A 2X1AA 1KP6A 5AQNA 3EVMA 2E88A 4KHSA 2ZQBA 2PSZA 1URNA 1RT7B 3FQKA 1W7WA 1RAEB 4DV7F 4X65K 4V1Ak 1H98A 1OH7A 1IKVA 5D8HB 4LRBA 4ILHA 2HNZB 2ZH4A 4DR6J 2XCPA 3GE9A 1RAHB 2C3UA 2F40A 2C2KB 1LAVA 4YUDA 2GC8A 4H5TA 3OYLA 3CIPA 4RTFD 2J0WA 2ZNYA 3LANA 2A10A 4DCHA 4NYFA 2BJ9A 1DHMA 3CD6N 5FD1A 4A59A 1U2RA 3GR0A 1RWXB 3CVKA 3HF5A 3TEGA 1X7VA 3TEHB 2W1BA 2VQEJ 4M5DB 3VEWA 1S7IA 1RA7A 3ZZPA 1HQ2A 2GUIA 4JKEA 3W66A 4DTPA 2MJUA 2CA9A 2MSTA 3D7SB 3ENBA 2QN6B 4H4OB 1T3OA 4CK1A 2KH9A 3CUNA 3B6OA 3MZIA 1YWXA 4DTNA 2VV5A 2Q6CA 5DK5A 3VZIA 3BQ2A 1RBUA 3PIPQ 3PIOQ 4FWNA 5DM7Q 5D4LA 4U8VA 5G0RB 5L9NA 3BJYA 5HJXA 3R2DJ 2A0FB 3FMBA 2B6AA 2MZTA 1WEYA 3E9PA 3G71S 3IS9A 3OXLA 5GINA 2NXEA 4GV3A 3A5LC 4DR2F 4NCAA 5A6WA 3LL3A 3VQ4A 4BG9A 2AP6A 4IO9L 5GIOA 2V0NA 1JLCB 2YBVA 5D4PA 4YB5A 3VVUA 2A40A 1JLBB 3DOKB 3PRDA 3UNYA 3HHNB 3R1LA 3HSZA 3RMCA 3V81B 3Q7CA 1IJJA 5LL6d 2EC0A 3HPOA 3DRRA 1TKZB 3OHAA 3DMJB 5ETVA 2BJ3A 1NSAA 5CZXA 4DUZF 2U1AA 2NUUG 3MM6A 2YCHA 1QZ5A 4ZIVA 2MKJA 3Q83A 3J7YI 1HR0J 1U49A 2R42A 2V69A 4F3OA 1J27A 4WQ5A 4LF5J 3MM9A 1W9HA 2F9JA 3OYDA 4O44B 3IKMA 3HSDA 3CF5L 2R2RA 1HPZB 4DFMA 2JWLA 1QD1A 4TLRA 4LRCA 1ZZFA 3VAFA 4HI1A 3E01B 3DOKA 2WVBA 4CBWA 3CCQN 3T1YF 3L7UA 3NGIA 1TL1A 3VQ5A 4TLQA 3VQAA 4RU2A 4EAHD 1F5BA 5KG4A 3ZZOA 2P9EA 2WZ1A 2PMZD 3DLBA 5DQGA 3HD2A 4CGHA 3RB6A 1IWAA 3QGIA 2MQPA 4B3SK 2VKRA 3IXQA 3EVWA 4E1MA 5KPRA 3MM8B 1W25A 3O9UA 2NRTA 2J0XA 1UVLA 3OUYB 5KAKA 5FDLB 1RCOB 2R2UA 3VPZA 1WF2A 2BBEA 5J1EA 1V5VA 3ZZYA 3PM9A 1OYDA 4N41A 4I6AA 2DGQA 3Q24A 1VBXA 1Y5LB 2BJEA 1VQ7N 4LF5F 1PAEX 2YI1A 1B99A 3PY8A 2PZSA 3TAMB 4M45A 3NGTA 2DITA 1OIAA 2RRBA 1KLMA 3A13A 1S1UB 2NYIA 2QSFA 2DH7A 4WCEQ 4HYKA 2E20A 4CGDA 1GLFO 4DLEA 3KHYA 2YNFB 4DFKA 1V9OA 3BYRA 3IWNC 5AZJB 3BS9A 2QE5A 5HO4A 2UYTA 4DQ8A 5FLXO 5KRTA 1JCGA 3BO3A 4O55A 4DJBA 5AQGA 5CAAA 3NF8A 3TA1A 3PW2A 1K9MT 4PABA 4CO4A 1JCFA 1HL6A 3L7OA 3G86A 4L72B 4OX7A 4J2DA 2MLZA 2J7WA 4ILMA 4JKFA 1EX8A 4LMZA 1B9DA 3KXDA 2KM8B 4IYQA 4CHPA 4YB6A 1KOHA 3HSCA 3WXIA 4DV0J 3BO4A 4RW4B 1Y97A 3IGVA 5IT4A 3NNCA 2D9OA 2UVVA 4ISEA 5E3CA 3P3DA 1T95A 4ELUA 3WEEB 3RJMB 5CQGA 4JN4A 2JOQA 2CPIA 4FLUA 2AEFA 1S76D 4IUFA 2E5GA 2CQ2A 3W60A 1FWKA 3GONA 1XMOK 4LD0A 4L75A 3KZBA 2MGZA 2QGFB 2N82B 3M9NB 2VQFJ 2ZOMA 2EFOA 2IYGA 2HAFA 1OQ3A 1HYZA 3A5OC 3H4BA 2ALYB 1PAUB 2DNZA 1U0SA 1PSDA 2E1MC 3GPAA 4NYOA 4O0IA 2AJ0A 3IN5A 4AHRA 2CVIA 1VDHA 1QQOA 4AHVA 3TQ1A 1U1MA 1SB6A 1CPZA 2YX1A 4NXNK 4CFCA 3CD5A 3C8YA 2YTCA 4DU1A 2EG1A 1D4XA 1RTJB 4CHNA 2I1RA 3ZZZA 3Q22A 2GMLA 4WKYA 4DV4K 3AXMA 1F5CA 4OPAA 1IH7A 3FCWA 4PG8A 1HNXJ 3CJ8A 3DXMA 4PL7A 4DR1F 1HPMA 3VQBA 5HOOA 5E3PA 4CFDA 2JJ4D 1S1XB 1NGBA 1NRKA 4RJVA 1RFQA 1RE1B 4AT1B 1WAFA 4FBUA 1C0UB 2V51B 4DV4F 2XNQA 3K8WA 3PIPL 4Z4GA 3O3FA 3R8EA 5LMNF 3QB0A 3UCZP 2DY9A 2HMIB 5HLFB 4YP3A 2XY7A 4NRTA 4A62A 4BRDA 2PFDA 2PMWA 5IT0A 5F8HA 1AZSB 3KKFA 4WTYA 1VQ9S 1IO2A 4ZVHA 4G1QA 5HAOA 1ESVA 3BF4A 1KHWA 2F8HA 1O0PA 4CI6A 2FZCB 4NL5A 2ADBA 4NRUA 2E5LK 3TRGA 3CC4S 3C15B 1KRPA 1Y5NB 1RHJB 2MY8A 1MWZA 4OJ3A 5K8OA 1GMWD 1S6PA 3ZX2A 1QZ6A 4PKGA 3QIDA 1PBUA 4FK4A 4C23A 1G3OA 1OQ6A 1SPBP 4DL0C 3I5BA 4Y1CA 3MR3A 2GGPA 3KLFA 2PA8D 5DDQC 3B6PA 3BKTA 2KFZA 2NYHA 4BBYA 4IG3B 1ZETA 1YKWA 3MX2A 4M3XA 2FVRA 2CPEA 1P6TA 4QJVA 1O1WA 4FWSA 2VQFF 1ZTTA 3CF5Q 5KT7A 3M2UB 1CXQA 3L2WA 4JUZA 2QWMA 1D1UA 1I94J 4CDIA 1QTNB 1LKZA 3L9ZA 2QFJA 3GTYX 3SQGA 4HTJA 1VQ4N 3AJ1A 1NUEA 4DDFA 5LM7E 1NJIO 5HSPA 2CQCA 2HFUA 3TTCA 5M1OA 4GKKF 4YOTA 3SAHA 1RT2A 3L09A 3LOUA 2XYGB 2Z1HA 2EW9A 3RUBL 4AFFA 4F25A 4CF2A 2JHEA 3CXCR 2RF2B 2YHWA 1HKCA 1QM9A 4B3MK 4WZMA 4RWTA 2JLFA 3M2VA 4ZPAA 3ZO7A 4RWWA 4HLBA 1N0VC 1RT4A 3LP1A 4WXWA 4DKWA 3G71N 3NNHA 3NP5A 3H0PA 4C2MA 4UQGA 1N36J 4J9SA 3CJ5A 3HSGA 1S5ZA 3R5DA 4YOWA 3SI6A 1S72S 4MKAA 1RWNB 4R8UA 3NF6A 2NRZA 1RT2B 1BGXT 3N79A 4NI2B 3TTFA 3TVKA 2QLFB 1RT6A 1TV6B 1BXNA 3TAFA 5I3UA 2WVFA 4FYWB 2FIUA 5D15A 3B82A 5EUHA 1WUAA 4JI3J 5KFRA 2Z8QA 3P5BP 2KTQA 4M8LA 3TR5A 1KOOA 2HQCA 2FB0A 4NLRA 3HK2A 1KXPA 2E7WA 3CDBA 3T9NA 3GFZA 4NXMK 4JNEA 4KHUA 3RSEB 3QFUA 3CCMN 3MECB 4KGMA 3KHLA 3R2CJ 4PKDB 5C12A 4JI5K 4R8UB 3SUQA 2VG7B 2YNHB 1NJWA 2W7OA 1Q8LA 2XS7A 1REVB 1ASWA 3AOBA 4DX7A 5HRPA 4HI2A 2K2PA 3H46O 3K0JA 4WPAA 3AVGA 1VQON 3NGYA 2ROGA 2UV8G 2FJEB 4JKHA 2BMBA 3EYZA 4RW9B 3CC7S 4KC5A 3KK7A 1WHVA 4JI5F 5GIPA 1S0NA 1R0AA 3I8DA 3LALA 4PEOA 1JL1A 2HVEA 1EKRA 4DHYA 5AQRA 1DURA 3O3HA 4MIAA 3F9MA 5M1PA 2ZHAA 2HYIB 1ICEB 5DM6Q 3MR2A 1GTHA 3LW5C 3DYAB 4J9RA 1CJUA 2ZH9A 1U04A 1IBLJ 4F7VA 3R9PA 2KI2A 3RRGA 4OKEA 1AYEA 5DZ7A 3CJ4A 1BL3A 5DG8A 4WZQA 3LZJA 1QAIA 5KT5A 4A8QA 2FLNA 4C3MA 2VH7A 1FJGF 3NG8A 1NPRA 4K4YA 1FO1A 4MMOA 4OI0A 3MWBA 1BMQB 1SBRA 3JSRA 4OVLA 3IS9B 2RH3A 3D68A 2G9OA 4Y0WA 2FXUA 4BRKA 2CKWA 2E7VA 3DGPA 3G4SS 2CZVC 2P9IB 4M3RA 2CYYA 4BR2A 4Z4FA 1OY6A 2O8EA 4OLAA 2FVSA 2G0IA 2Z4PA 3AA9A 3BF3A 3FFIA 3OS2A 4X62F 1Q9YA 2DFFA 1OY9A 1XMOF 1C1BB 4JK7A 2Q1LA 2AZ3A 3BPDA 1OH6A 4X4TA 5B0EA 3ZETA 4PCQA 4ZJLA 4WTOB 4M3TA 4DSLA 4O3QA 2UUWA 5KFLA 5HRRA 3THXA 4H0YB 2GVZA 2QL9B 2MLXA 3W2WB 4FLZA 2MB0B 2EFPA 4U67L 1A0OB 4DQSA 1WSRA 5JS1A 3FCVA 2LVWA 4B3OB 2IVFB 2XO6A 2P9KB 3MK6A 4L73A 1YJ9N 4DN9A 3HVAA 1DBDA 4K42A 4QQBA 4RX6A 1EQYA 4ZCMA 4KSEB 2M4MA 2F4VJ 3ZLJA 3QT5A 2HEKA 4DLGA 1NXIA 3OFEA 4BR9A 5F3TA 4KB0A 3CDEA 1GNKA 3V6KA 1KQSM 1T9WA 3SMSA 2QLWA 3MMCB 4ED4A 3LPEA 3BUZB 2MXYA 4K59A 3CJ9A 2VUGA 2Q43A 4ECUA 2F8TA 4X4OA 1SV5B 5LSOA 4ISGA 1FRLA 2AGPA 2YHYA 1B7FA 2DISA 2HHVA 3GOIA 1LXJA 2BDPA 1KC8T 2YNGB 2DGVA 3WX4A 3UO0A 2P9UA 2IM3A 3TA2A 3ILJA 2Y3YA 4JB8B 3VEOA 5G4DA 4IQXA 1B9FA 3W5YA 3RU0A 2GQ2A 1FK9B 1N36F 1F3FA 1X60A 1U02A 3KWIA 4FJGA 4ED8A 2DHHA 3LAKA 2D0PA 4LF4F 2BE2B 4JLHA 1RI7A 1HKBA 4PXDA 1FCAA 4CNYA 4NCGB 4DPYA 2M70A 5KG6A 3PO4A 5DS7A 2IRUA 4GKJF 5AQSA 1X5OA 3G9CA 4BQLA 1NK4A 4DV3J 5HMZA 1AXQA 2GMJA 4WE1B 4FWPA 3TO8A 4YDUA 4GC6A 4PKHA 4CJFA 2AGOA 4ZVFA 4CBUA 2D1KA 5AQVA 2HG4A 4LQ9A 1EKSA 4IOBA 4RBUA 2CG4A 1EWQA 4F3TA 3H6EA 2RS8A 2WHOA 4AM7A 4QYZK 1JMTA 5I42A 3WZ0A 2UU9K 1U7LA 5IV4A 3Q8YA 3HRGA 4FJ5A 3A8KA 2HF3A 1UAWA 1WC0A 3CCWA 4RNMA 5HMWA 3CPWR 1K73O 1ZAVA 3Q8SB 3ITHB 2C2RA 3SBMA 1FKPB 2DRDA 1W97L 4F3MA 3FZFA 4UOFA 3CCQS 4CJ4A 4CVNE 2EFVA 2DR9A 3SAGA 2M7SA 3IGNA 4NLQA 1VQ8N 4BC3A 2ZJQQ 3WX8A 2IY5B 2W24A 3ZCMA 4CO2A 2CUYA 3KLIB 2RUGA 2ZOGA 4I7FA 4B3MF 2CZ4A 4Y65A 2C42A 1S1WB 1Z4UA 4QWCA 2QYCA 1YRUA 2E1ZA 5KPTA 3PTWA 4J7CA 4FOIA 2RKIA 4E1JA 2ZZMA 1ZBUA 1XN9A 1GMWA 3H20A 4V19S 2F4FA 1X9MA 1XJWB 4YHHJ 2WBRA 3CDUA 1RDRA 2EFQA 4FWOA 4CZEA 2YWKA 2DGTA 3AAWB 2ZGZA 4N76A 1WSFA 1YQHA 2GIRA 2OPPB 4QAGA 2F9DA 4V19X 3LDLA 1LV5A 1C0TA 2ROPA 2VFTA 3DLRA 3UI3A 3D3CJ 2F3JA 4CTAB 1BO5O 4I2PA 1HRHA 2Y8WA 2VPXB 2YQ3A 1KN6A 1NBEB 2ILYA 4BROA 4JV1A 4CJEA 4KI4A 1MLAA 1FTRA 4KTWA 4BRPA 1HBMA 3FE1A 1NPKA 4OJ1A 4PR6A 5F9NA 1NOZA 2YWEA 4JBCA 1UJ4A 1B70B 4C7QA 2P9LA 4IOXA 4NOHA 4CGIA 2ZUGA 3ET6A 4JS5A 4DU3A 2UVUA 1H3DA 3P8BB 3U9ZA 2VIHA 3MPUB 3ZXWA 4I9QA 1CG2A 2MDAA 2LQ5A 2CNLB 5HL7L 3QINA 5CD4H 4HKQA 3FJ2A 5HLFA 1RLDA 4DOZA 4OMFG 3M6UA 1M1GA 1LW2B 5B0DA 1RA6A 3OTOF 3UVJB 4K8XA 2YWWA 1RDBA 2KJVA 1ATNA 4GV6A 4NEYA 4M5HA 4QWEA 1HD0A 1NM2A 1TKXA 2WONA 2VBZA 2A5XA 2V8HA 5AT1B 4CLFA 3PSIA 3AGKA 2HQGA 4I4BA 5FLXY 4BRAA 3GMGA 5M1FA 2Q79A 3H90A 1H0HB 3RBDA 2UV8A 4F4WA 2GGPB 2XMWA 3W61A 2V2VA 1NU0A 1GXTA 4BRGA 5D3GA 5CCLA 4JI6K 4IH7A 2HGNA 4KH4A 1S9EB 2A1BA 2OEJA 4MO4A 3CM5A 2Q0RA 4Q2LA 4OYPA 1HNWK 3Q0AA 4YY3K 4I64A 3BREA 3KK1A 2FLPA 1D9DA 3OYJA 1C2PA 4ZLNA 2HNDA 3CWJA 2OO4A 3FNNA 3UNGC 4QCLA 3G6XA 2XZDB 3MM9B 2OIHA 1LWEB 1N4LA 1HI0P 5AQZA 1Q81O 2D0AA 4JI6F 5KFZA 4KH5A 1IBMK 3OVNA 3PZPA 4L76A 4HVJA 1S0MA 4QR1A 4KAZA 5I9EB 2DO0A 5I4MA 3OHBA 2HHSA 4UT4A 2O8BA 2CAJA 2G2ZA 2AD9A 2VBWA 3ZTPA 1VQYA 4K7QA 3WQPA 5AQMA 3MAAA 4J91A 4TY9A 1M90T 5KFPA 1QE1A 1K44A 4KKOA 2WSEC 2Y1JA 1IWGA 1K8KB 1V3RA 5AJ3F 5ETLA 1IBMF 4LBPA 3JSYA 1HHTP 3CPWM 1DTQA 3PHTA 3K8VA 4JV0A 3CXCM 1DTTA 1Q82O 3VQQA 1WI6A 2YKMB 1NDCA 4ILLA 2CDQA 4E3SA 3B8AX 4Z7YA 3CCMS 1RTJA 2OTLN 3H3NO 4JK9A 4AE5A 4MAKA 2YH1A 2VC1A 3PKYA 1J53A 3M30B 1HBUA 3TUJC 2QSWA 4Q5VA 1WSEA 3DOMB 3ULHA 3KLEB 1A5WA 2P9SA 3OLAA 4DR5K 1FD2A 4F0KA 2V34A 4NLSA 2W2QP 2RE1A 4EZ6A 1S77D 4MFBA 3WXJA 4O4GA 5CZVA 2WB4A 2BKOA 1U8WA 1MDUB 1WDDA 5C24B 3PRVA 2KHOA 2BVZA 1Q95G 3LA0A 1RISA 3R5BA 1WKJA 2MYFA 3MEGA 4HVZA 1M90O 4HT5A 5KFBA 4YB1P 3VGMA 2ROEA 3NMAA 4PAAA 5JLFA 2VODA 3T6BA 3ILIA 4DTMA 4W5RA 2G8FA 3ZT1A 4IFYA 4KPCA 2QM1A 4DUZJ 1KLMB 5EVZA 1S1UA 3POTB 1I94F 3SCJE 3OR2B 3TTDA 5DJBA 1FI4A 3AVLA 4ES1A 4JRPA 1TGOA 3MUTP 1KVBA 4Y2CA 4OJHA 2YVSA 3WNHA 3CJSA 5ETTA 5L1LA 3KK2A 1TL5A 5HK4A 2KG1A 4CO3A 1GK8A 3TUPA 4OI2A 4H0TB 1PCAA 4LF6J 3IWXA 4J2AA 5GAGI 4J9OA 4FJJA 4ICLA 2IVNA 1MN7A 4XTTA 2HS4A 1P9QC 3UN5A 5BYRA 4M7YA 2BE9B 4RO0A 4EHUA 1OWXA 3M2UA 3TNVA 2EBEA 4YS2A 1RBSA 1T05B 1RWOB 4NLTA 2DR7A 4CFBA 2SXLA 1ACMB 4OI4A 3LPYA 4UUWA 3UE2A 1R7IA 3DLLL 4WFBQ 5J2PA 4CLPA 5IM0A 5E3RA 3UW1A 1GLBG 1JXLA 3KUGA 2P9NA 1HWIA 3HULA 3MEKA 3GFYA 3QFWA 3O44A 2R2TA 1PC4A 3I96A 1Q7YT 4R79A 3LH2S 3EY1A 5FLXU 4ZKAA 2YWFA 2H48B 4DZDA 3O1BA 5C42B 3RYLA 2DY1A 2B5JB 2NR0A 3AD8C 1HX1A 5FPDA 2IM0A 3C65A 3WC2A 1RTZA 4ZITA 4DWIA 1PYSB 1SJFA 2QLBB 4OV6A 3SLCA 4JK8A 4PRFA 4QOTA 3DI6A 2E44A 3DLJA 3MEEB 5GMKa 1GLCG 3CCES 2H5IB 3IG1B 3FZLA 3L4BC 3UDLA 2FUG9 3E51A 5SUHA 4H4MA 1KAZA 4ED3A 4E98A 2HMPA 3ID6A 1K6YA 2JSXA 3LDQA 2KM8C 1VQMN 3HL8A 4DV5J 4DR5J 1N33K 3OL7A 4QZVB 4I6WA 4Q8FA 5HBMA 1FJEB 1N34J 1QQMA 3L2RA 5C2DA 4TVAB 4FJ9A 4DSFA 2BM0A 2OGUA 1Q4RA 1A5VA 4H8KA 2RQ4A 4Y00A 1TL4A 4HH0A 3H98A 1BQMA 1KCFA 4WCEL 2AX0A 2J9CA 2G8UA 3DOLA 4F0MA 3GILA 3VHQA 1G7CB 1Y64A 1TU0B 2ALZA 1Q16B 4KO0A 4YDDB 2H3EB 4DV2F 4KY3A 1YDLA 3VQ9A 3W9HA 4FYDA 4USJC 4ID1A 2RDJA 1JLQB 1GX5A 1T3VA 4JI4F 3LF0A 3KKSA 3U27A 1HNZJ 1NHKL 3TSUA 2ETJA 2PE8A 3QEPA 3Q8UA 4XDDA 3HZ6A 3KK3A 1CJVA 1QVGM 2YNFA 3D28A 2DR6A 2PFFB 4PXEA 1VQKS 2BANB 4O3RA 4CECA 2ASPA 2VL1A 5KFYA 5JVHL 4DV2K 5KG2A 3CO0P 2KN4A 4EBDA 1P90A 4HUFA 1VRUA 2ATLA 2IVMA 2IAJA 3O6QA 3KJQB 2OMLA 3J7A1 2K3KA 5KFAA 1RT5A 2YKPA 4AF1A 3MM7B 2ZWHA 2Z2ZA 5KGXA 3RMBA 2L08A 1GLJO 1R0CB 1HUXA 5KG5A 1X4BA 4NLGA 2LFVA 1TKZA 4FNHA 1NHUA 4BLGA 2ZH1A 2IM2A 1NKBA 1GOCA 3MXHP 1TP7A 2MZRA 3CCVS 4IDKA 2ZKUA 2QA4G 4M41A 5EX0A 5IFMA 3T1YK 1HNWF 2ZJQL 3M8YA 3CMQA 2D4WA 2R8GA 4FM1A 5AQKA 4R5PA 2XULA 2QO3A 3OBWA 5CHCB 2UXDJ 4MDBA 3A3NB 4D3GA 1NJYA 1SL2A 2MKSA 2CPHA 4RUBA 3BP8A 2HRTA 2FSJA 1LXNA 3H40A 5BN8A 2BA9A 4FOEA 4CO1A 5GAGP 4UY85 4ZP7A 4FS1A 1UVIA 2ILZA 1RAFB 3ULDA 1HQUA 2HWTA 2AA4A 1SJ4P 1ZH5A 5KFXA 2RIJA 4EHTA 3HHLB 3BGUA 4NX9A 4ELVA 3PJ9A 3DLKB 4FPIA 3CNQP 4KH1B 3L8BA 4FL9A 4EMDA 4GMKA 3E8OA 1V4SA 2OSQA 3NGKA 4HTIA 3QLHA 1B3TA 4F0HA 4WKRA 2YPYA 3FGVA 1ZAXA 2JZ5A 3OA9A 5D0GA 3UDVA 4JRQA 3SFUA 3CG7A 4DR3J 5A0YB 1YIJS 4C8ZA 4OPKA 2BQUA 3NCRA 2QI2A 2VOPA 4C8YA 4B3MJ 2R7XA 2GQQA 1L3SA 4B9QA 2OPRB 3P39A 5LXRA 3CTRA 3AJ2A 1TFYA 1C0TB 1D09B 1FWPA 4DV7J 3VGLA 5BR9A 4JI2K 1QVGR 2EK1A 3IBFB 4QW8A 1MA9B 3KD5E 4ILRA 3PCOB 4KFBB 4CM0A 4DV3F 2Z58B 5H9FK 4LFBK 2KVQE 1AROP 3M9MB 4URSA 4C0BA 4LSNB 3TOQA 4NEZA 5F8MA 3NS7B 2HF4A 2HZVA 2RSQA 1E6VA 4X65J 5FRMA 4MO5A 3VQDA 2MPUA 1QSSA 1R8BA 3BPSP 4S0MA 2FBTA 4CLTA 3NBPB 1CXUA 3AVCA 3PRBA 4WP8A 4IKAA 4CD1A 3G6YA 4LRDA 2HLTA 1JNRB 1YBTA 3WIVA 1ROFA 2X78A 1BD6A 5KPZA 3LQVA 2Q3PA 2PC6A 4I2QA 5KTQA 3EEQA 3ZC4A 2X1BA 4DR3F 1M5OC 3HHLD 1X0PA 4P2SA 4ZPVR 3DAWA 3R5CA 5LMUF 2PYJA 3ADAC 3AOCA 4LC9B 4IJAA 1BQNA 3AVBA 2E1CA 2AJ2A 1HNWJ 2RHKA 4HL9A 2V4RA 2O66A 5AXLA 3U4LA 4GC7A 1DLOB 3AVKA 4Z37A 1FTCA 1T3NA 5KFTA 2CPXA 1N5SA 4UOHA 5KFSA 5DG7A 3TZYA 3ZTSA 3SQ0A 1LEOA 3VR1A 3T41A 5DDOC 1LW0A 3M8WA 4CLSA 3OHRA 2W6KA 4EFHA 3GV5B 4DR2J 2UZAA 3NGRA 5CYQA 1X9JA 2AEJA 1HMVB 4YR3A 2RF2A 3I4PA 3ILLA 1Y4ZB 2V6AA 3VEYA 2B4OA 3W7BA 2ABYA 2NCKL 3SAFA 2NRHA 3I33A 2E2PA 3U8XA 3U02A 5LSLA 3T5LA 2E6LA 5AQWA 4JKCA 4EO6A 3LO3A 3VQ6A 3J7ZT 2IYIA 1U1KA 3OL9A 1VSLA 3A3OB 4X4QA 5T14A 4ZK7M 3C2PA 5C7PA 1Z2LA 4C11B 3HVTB 2PYLA 4OKKA 1VS3A 2CPYA 1VHIA 3CMAS 2LECA 4DR4F 4KIAA 4ENOA 3L3CA 4LY7A 3IM8A 3SNNA 2A2DA 2DRAA 3K5PA 4JV2A 2JL9A 2D1CA 3WBZA 2GEMA 2LDYA 3TZZA 3SQ2A 2PY5A 5JVHQ 2DNPA 2MEWA 4OLOA 2FQQB 2N7YA 5KFVA 2P9PA 1JLGB 1KQKA 2WAQD 3HP9A 1QDUB 2HBYB 2M0GB 2WOMB 3HPGA 4IO1A 4F4XA 3Q23A 3LP0B 3A3PB 2B7CB 3VF2A 1UFLA 3EKUA 5DRKA 3R3TA 4NCGA 1IVZA 2AQ4A 4X2BA 2QMUB 5IV3A 2LU1A 3HKWA 3W2VA 4GY2B 3ATUA 4ECXA 2A6AA 4RU9A 4USIA 4Q44A 1VQSA 2DGSA 1WSGA 3M8QB 1B0TA 1QUPA 2WFBA 4OZ3A 2Z2YB 2IJNA 1CLQA 5HRNA 2J0SD 4CT9A 2CJBA 2J8AA 2AYEA 2GX9A 2OKQA 3MXIA 5GADI 4CJ5A 2WSFC 1ZOTA 3JQJA 3KG4A 3D2EB 2MQQA 4M7XA 1VQLN 4ECQA 1HPZA 1SUQA 3P38A 4PWDB 1NG9A 3BYPA 5GADU 2Q97A 4WFBL 4GVEA 2L48A 3V2UC 1KR4A 1YBUA 1N8RO 1RT1A 3OQ2A 1JL2A 2RT3A 1Z1ZA 2BJ1A 3A5NC 3E1YA 2DH9A 1AUSL 1X4GA 1YK9A 3O4NA 4B9MA 1WORA 1F9FA 2VJUA 5KT3A 3OL8A 4HHJA 2WW4A 4DUZK 3P5TL 2GIQA 1VLOA 2N4CA 3PVXA 5HQLA 2Y1RI 5KG1A 2F8EX 4H03B 2HQFA 1OSDA 2N3LA 3B4MA 2NPFA 1NBWA 2CGKA 1VSMA 4CJRA 2UUCK 2O8CA 3C6AA 2QWLA 5KFUA 2XTJP 1MROA 4F04B 3R6MA 4LF6K 3S01A 2HK3A 2VDIA 5K9FA 2WSCC 3JYTB 4K4ZA 2P6SA 1W2BR 2W9CA 5EDWA 3FCHA 4DUYJ 4MH8A 2E5JA 2IFXA 1QSYA 1CZAN 2EKNA 2IBKA 2F7TA 5GAEP 3GL1A 4DQQA 1ZC6A 1GLDG 4PL8A 1SS6A 3N28A 4CZMA 4PG6A 4W5TA 4BDYA 5AXKA 3IBWA 5F0WA 1DTTB 4B3TF 1RTHB 3W5ZA 1PKUA 3DRXA 2R7YA 4KYZA 3W64A 4OYIA 4K41A 4HCCA 3DI6B 4NLYA 5M1NA 4M63A 3KHRA 3C19A 1RYRA 1TMMA 2V8GA 4YOVA 2CIMA 4C8LA 1URRA 1NK0A 3I4HX 3FR0A 3SJJA 4RW8A 3G2XA 1YJ9S 3PYFA 3C0BA 5C15A 3Q8QB 1DARA 1O5JA 5KFGA 4DSJA 1IG8A 2CNNB 4EK2A 3I6PA 4DBQA 4JI2J 4RLEA 4FYXB 2D3O1 1HFEL 3TW0A 2ZD1B 4B8CA 4FJNA 1TVRB 2O1PA 2A42A 4FO0A 3KTQA 4IFEA 1UP1A 5IT9U 2I0XA 1RHQB 3O4QA 2ZBIA 4LRFA 4U7BA 3FBFA 3WT0A 4KREA 5D4NA 3IA0A 2GBZA 4RNHA 4ZA1A 1IKXA 4BRNA 3AQPA 3H8YA 3V4IB 3V9WA 1UWBA 4OJGA 2XSJA 2XGPA 3T5KA 3MUVP 3GFHA 1S4FA 2QEXS 4DS4A 4W5NA 2EFNA 1IKWB 5DGBA 5KFOA 4RUAA 2FJDB 5DDPC 3BY5A 2EG2A 1NPPA 2LQ9A 2LA6A 3F73A 4E0DA 1SAZA 2FHMA 4NB4A 4FN5A 3F41A 4Z4HA 4A8KA 1VSKA 4G3IA 4Y0FA 4XH5A 5SWMA 4JAXA 1MWMA 1JLCA 5AQUA 1K9MO 1JJ2R 3FBEA 1JKHA 4DV6J 3IMQJ 2KFNA 1IKXB 1AUDA 3CJBA 3DRRB 4V19J 2RILA 1X31C 1Q81T 2IAJB 3UN3A 4ID5B 4JKGB 3O80A 1IBKF 4LRAA 4FF4A 4LF8F 3UFCX 1HBNA 4LH5A 1JJCB 5IWAF 4KH0B 2CQHA 3GU0A 4CHQA 3HSJA 4OJRA 4TKTA 3OJSA 2P6TA 4CERA 3TA0A 2ZH5A 3PX6A 3I55N 5LJ3Y 3TWZA 2NXCA 1E3MA 4WXOA 5D4OA 5AZIA 2GQCA 2HSTA 4JOUA 3UD4P 1WTBA 3MGJA 3V9SA 4E1NA 1HA1A 2ZZNA 1CEZA 4L8RB 2IIRA 2AEMA 2AJ1A 1KAYA 4M3UA 4R5PB 1VLYA 3NL0A 3R7SB 1RHUB 1NAQA 1R59O 3BGFA 3K57A 4X4NA 1GXLA 3M6XA 1G1XA 4NXNF 1NSKL 1WUUA 1YUWA 3HO1A 1S72N 3GSIA 3ZT0A 4KAIA 2DNMA 3ATVA 3OTEA 2RU9A 4BHQA 3NS5A 4JI7J 3H5XA 1PC5A 3UKRA 5HVHA 4A61A 1APSA 2C3OA 1PJ5A 2I7PA 3DRYA 5KG0A 4NA2A 3ZEUB 3QFPA 2VPYB 3PIOL 3BZQA 4OZ5A 1RAOA 1HLUA 4JHDA 1NMNA 2KXNB 3H25A 4NE9C 1UW9A 3D6HB 4B9SA 3PNIA 4DR1K 5IZHA 1FDDA 3K9KA 1E4GT 4MK7A 5E2QA 2QTDA 3PG9A 4U6PA 3KHHA 1MMDA 1C0UA 1V6HA 5KQDA 4FWQA 2DKOB 4DR4K 3TSQA 2YKMA 2VFVA 3U9DA 3TU5A 2B0GA 5DLGA 3L2VA 2J4RA 1VIXA 1TFWA 4X4UA 1Q8BA 4ED7A 1HBMB 2AYMA 1VQ4S 4WFXA 2GVDB 3AHPA 2XNRA 4E7LA 1XI1A 2ZGYA 2KXFA 3BGLA 1WTFA 4GV9A 1RDWX 2D5RA 4DS5A 3ET6B 1U6ZA 4JI8F 3OW2R 1DKGD 3VF0B 3MDQA 1CZ9A 3N6MA 1LOUA 1T9YA 5BXIA 3EDQB 6FD1A 2V5HG 2JC1A 2QA4N 4I1TA 4Y2MA 1HW9A 1PGZA 3HHDA 2Y1LB 2W9AA 3VGUA 2F9TA 5F8JA 4ZVTB 4F50A 2ASYA 1FRIA 3DNCA 4C3LA 1WC6A 2VJVA 3VENA 3R1HA 3VVTA 3LGHA 4E19A 2FJAB 2P9IA 2V9KA 1BQXA 1NLKL 2DEIA 1RT5B 3M5RA 1PO6A 2W01A 4FVUA 3AA3A 3DRPB 4C0OC 1OYEA 1WLJA 1T05A 1NEEA 5F41A 4K0KF 2J76E 3LGNA 2UUAF 3LP2A 2B8QA 4ZPBA 1BUXA 4YOEA 4QU6A 4I69A 4G6VB 3JSMA 4O0NA 4IR1A 1YRTA 2BKNA 4CLLA 5HATA 3M3ZA 4CJKA 3DM2B 3VQ8A 1FXXA 3JTPA 2V63A 1Y00A 2V4JB 4Z0UA 2GX8A 1FDNA 3LDSA 3NAHA 5KI6A 4DMZA 3LGMA 5GAHU 1D8ZA 1VSEA 3WXMB 1BA0A 4K0KK 3HT3A 3F0NA 2YHXA 2UUAK 4EP4A 5C42A 1ZM9A 1FHTA 4JD2B 2A3JA 4AM6A 3IRWP 1AW0A 1NK5A 5AQIA 3SSRA 4EGLA 4HTUA 2CWKA 2CGLA 5LL6Z 3M6WA 3AT1B 2AHOB 2DPNA 2XMAA 2CQIA 3R27A 2VG6A 3LP2B 1J5EF 3KDOA 2G8WA 1RLCL 4CEOA 4LF6F 3OVBA 3MDFA 2CADA 5EU7A 1FEHA 3OS1A 4H4MB 5I3UB 2AX1A 4ZLLA 2CQDA 3SPZA 2O8FB 4K4TA 1S1XA 3W3SA 3EE9A 1YJNN 2DNLA 3SK3A 1Y3JA 3I56N 5KQ8A 2IA0A 1K8KA 1ZZNA 1REGX 3MN7A 2DVIA 4R25A 1YTUA 1CS4A 3J7AP 3EX7B 4ZP8A 2J9EA 1NLVA 4ZCLA 4O3NA 3E66A 3W0LA 2KT3A 4B08A 3WNGA 3HVWA 3TX8A 3QRQA 4WFZA 4ZPCA 5IXUA 1EP4B 4NXMF 4IKFA 4J9LA 1J54A 1HBUB 4R0EA 3DLEA 1X9WA 3QERA 1RTDB 2DNNA 1GX6A 1FFWB 4U9RA 3D2FB 2HW3A 2O4GA 2V52B 1MWKA 2NLXA 3OTOK 2I9SA 3DYAA 4O23A 3HJFA 5LY3A 3A8EA 5JXSA 3QIPA 2FC0A 1FEEA 2XBPA 1LAWA 3CJAA 1HWJA 5HMXA 5HI7A 1XC3A 2ASMA 1DQ9A 4C8NA 3KUHA 4GO7X 4OPJA 2M88A 4ZVQB 1M5PC 3KLFB 4HUEA 1PJ6A 4RW7A 2NSCA 1YZ6A 3D4JA 4OYAA 1MMNA 2RE2A 4FWLA 2NPIA 4OL8A 2VOOA 1WOOA 2ATCB 3HPHA 5AQYA 3EE3A 5E33A 4RR5A 1JXEA 3THYB 2AJ4A 1ZA1B 3PLAA 2EWSA 3VZHA 3AOAA 1XUPO 1JXBA 4TXSA 2LEBA 1XBWA 1X5PA 7FDRA 3D6TB 4NLPA 5IQQA 1FRMA 4Z7CA 3T69A 3ETMA 2IVOA 4ZVGA 5EX3A 1YVUA 4ZN3A 2GNKA 3ZETB 1CBKA 2HWIA 2BQ3A 4QWDA 2CQPA 3S3MA 1FRKA 1TR0A 3QT6A 5ETOA 3VALA 2R2SA 5TKYA 2A41A 2DGUA 1UA1A 4LF8K 2G8HA 4CK3A 1U0HA 2FZKB 3K2PA 4UY8O 3MPWA 4G1PA 4CBXA 3FC9A 2C28A 4K8ZA 1C1BA 2R9LA 4RKUC 3HFZB 2CJXB 1R6VA 3MOZA 3C95A 4B8AB 2IVYA 1Z2ZA 1VQLS 1UEVA 1TMJA 3G8TA 1SQGA 1XMBA 2HHTA 1X9SA 3GFXA 3R9LA 3T1HJ 3UCGA 3HI0A 1TV6A 2BJ8A 2HK2A 5GMEA 4UW2A 4O8UA 2BQRA 2F8SA 4BE1A 2ZBCA 3RAXA 4QOZB 2VCPA 1OVYA 3OFFA 1DT9A 1KFDA 3NCPA 4B3OA 1OKJA 2R7QA 3IP0A 3ONQA 4CEZA 2JDJA 4DR5F 4UOCA 1NNDA 2RAQA 4KB7A 6AT1B 3RBEA 3D9BA 4X4SA 4MT1A 2QWNA 3TZWA 2YKOA 4OHWA 1U1RA 2HFNA 1X8DA 3T1YJ 2W9BA 3S8SA 3O8WA 3N4WA 5AQOA 3FUYA 4OX8A 3G82A 1FXDA 3HI9A 4AL7A 5AE3A 4AHTA 1QVFR 1EQ0A 2UUCJ 2ZJPL 2QIFA 3A8JA 2EK6A 1P8ZA 4FP9A 2R8JA 3KDNA 1KFSA 1RUSA 5JICA 4YHHK 3CJQA 4CNZA 2XYPB 1EETB 4A48A 1BHLA 1IBCB 1S6PB 1E6YB 1NH7A 1WEZA 3VGTA 3AXKA 1VSIA 3UD5A 3VGKA 4B3RJ 3D67A 3QWUA 5DLFA 3WIUA 1H1VA 4JYAJ 3LPTA 5AFUA 4PXBA 3IRXA 5HVFA 3WEEA 4DV1F 1QHTA 3VWSA 4F26A 2LKZA 2QWOA 4AH9A 1UOCA 4Q8EA 3QYYA 1XMQF 2OPQB 4B3TJ 2GWJA 4YFUA 3MD3A 5K8NA 2KO1A 1NZAA 2UXCF 1FKAF 3H5SA 2ZBPA 4LF4K 4LF1A 4U8YA 4B1XB 1QAJA 2H4YB 1TUGB 4Z94A 3F44A 2MSSA 3C6TA 2AGQA 4JV5F 3ENHA 2VPZB 4CIEA 5EWEA 3CETA 3QT7A 1ZM3A 2PFUA 4YOYA 2AT1B 4TQSA 3D45A 5KFEA 3CCSN 5E41A 3NE6A 3I82A 4I6YA 4JV5J 3K9JA 4CGJA 2DIUA 2UXCK 4RUCA 1C1CA 3MCOA 2VU5A 1RWKB 3AODA 1C0GA 1KD1O 4WFYA 1JLEB 3MD1A 3P96A 2NQPA 1GTEA 2OP5A 2YH0A 2DR5A 2Z1JA 1VK0A 2ZNZA 1RT4B 3LP1B 2V67A 4X66F 4AUKA 2E4LA 1UTAA 4AXJA 4MQ3A 1UCNA 2QL7B 2FJBB 3PFOA 2D74B 2VQEF 2KKHA 1DJ0A 1V3SA 2XMVA 3OS0A 1FKPA 1BIUA 2Z30B 4ECWA 1W2IA 2J6TA 4XAKA 4ED1A 2LLZA 1XHXA 3AVIA 3CPEA 1ZAWA 3CQYA 2FPHX 4LREA 2B56A 3QNWB 4M42A 3RVCA 2FZGB 2HB5A 1X4DA 3O2IA 5RUBA 3MR7A 3EN9A 4QPTA 1FX4A 2E1YA 4DTXA 5I3PA 2HNYB 2VQEK 2PBDA 3UQSA 1MWQA 2D0BA 3TP2A 4X62J 4I2PB 4QR2A 2XB2D 2KKZA 4NLVA 2R8IA 3AVFA 3JXOA 4A46A 1J5OA 3SUOA 4UOGA 4FLYA 3M6VA 2EXUA 1S48A 2COLA 3QT8A 1HYVA 2P8IA 3OYEA 1Y9OA 3TVYA 5A8KB 1G4CA 4KKOB 4A8OA 2NS1B 4UF4A 1VQ6N 5CYQB 4TQRA 3NF9A 1HQUB 3PX0A 4M63C 3VMFB 2GO8A 3D1OA 3QWPA 3EL2A 3CJ3A 1OVQA 2QRRA 2LQJA 1FJGJ 2QA2A 2Y0BB 2YQ0A 4C97A 4DR1J 3GJSB 3I5AA 4B02A 4E8UA 5DM6L 2ZFHA 4BG8A 3HX9A 2B9WA 1ZBLA 1CVJA 3CO9A 5H9FJ 1VSFA 2YPZA 3AA5X 4C1NK 2DIVA 3G6EN 5HROB 4W92B 4K4SA 2K3IA 2JEGA 2QWQA 3QO9A 4ZVPB 2P9SB 3MEDA 1VQPS 5A8KA 2B51A 3FBBA 5EX5A 4IZ9A 1VK8A 3VEXA 1PG5B 3DJCA 3N0VA 4AQYF 3ZT4A 2BE2A 2RMLA 3PW7A 2HIYA 4KPYA 2KT5A 3TYTA 1RABB 2YJEA 5F8IA 1RCHA 2VA3A 4LF4J 5KT6A 2UXDF 3MN5A 4DX5A 5DGAA 3G25A 1Q7LB 2EBGA 4KE5A 1FERA 5U47A 3K5NA 4DV6F 3AB4B 2RHQB 4HR2A 5M2RA 2BUNA 4X64F 5ITHA 2J8SA 3NCIA 3RB4A 3ICLA 1IG9A 4AQYK 2HQIA 3IR5B 1VQOS 2QXLA 5L1IA 3ZSVA 3KK1B 2D3ZA 4NLWA 5EOYA 3CIZA 1KS2A 4O44A 4ZOSA 5HRSA 4WQ4A 2WOMA 1YHQN 5LT5A 3SCLE 5AFUH 4DTUA 4NLUA 3LP0A 2WBNA 5KOWA 1SC6A 4FNIA 1NWKA 3TSPA 3IR7B 3MUMP 2J7UA 4CM2A 4KH6A 1S3XA 5ETPA 2ITMA 1FNOA 1TYQA 1MNEA 4C48A 2EWHA 1QHAA 4MKVA 1VC6A 1VJWA 4CIGA 4BQZA 3QGGA 1ZBTA 4CWBA 3U7JA 4YY3F 5HANA 3ZTOA 4BACA 4PQUB 2DRBA 5E0OA 1RKIA 1L3VA 2HQ3A 3I87A 2UUBJ 3ZT2A 3AARA 4DUYF 1NKEA 2MJNA 3MECA 4GVLA 4IOCQ 4GW6A 5KFIA 4PG5A 4BC2A 3VN5A 3W1YC 1VMBA 2F96A 3VGVA 4FXWA 1HJRA 1YBAA 3TAGA 4ID8A 1P27B 2GCFA 2W8KA 4F4ZA 3NWGA 2YKNB 2W2NP 3I56S 3NAIA 3GIIA 1WOSA 1Q0NA 1X5TA 2B5JA 1B0VA 3QEIA 1SKWA 3BSAA 2QKBA 3OVSA 1GLLO 3N5FA 2G4BA 2A6MA 4URGA 2MKIA 4MFBB 2ZDPA 2EVZA 3VERA 1Z26A 3MEEA 2XHCA 2MZ1A 3FZHA 4OX9J 4NLOA 1N8RT 4DF8A 4BRIA 2ZWPA 3ZSRA 1TL3A 4MLEA 1Q9XA 3I0RB 5CH7B 2CPFA 3AVMA 4O8KA 2DNOA 4DV3K 5DMRA 1J5EJ 1RP5A 3OLBA 3I8BA 3I0SB 3RWUA 1FK9A 3QZ7A 5A2QU 1FJCA 3NVKA 2YJFA 3AD7C 2M8HA 3DLGB 5LMNJ 5B8HA 3HZEA 4CLZA 2V2KA 4ECYA 3LPUA 1RADB 3PJXA 3RMAA 1LWCA 1V3ZA 5ETKA 1RILA 3M8PA 4CGFA 4CP5A 4EUVA 2IOCA 1BU6O 3CD6S 5IOLA 3FBCA 4LH4A 4AXIA 3D0PA 3KK3B 4EO8A 2RDDA 4WE1A 1FW6A 2UXBJ 3L6QA 2PEBA 1N5YA 1T6CA 5KFHA 2XSJB 1XERA 1S9FA 2JEJA 3UVJA 2HBZB 1RAGB 4KJIA 3WNFA 3CJTA 4JI0F 3KLGA 3MCSA 4K50A 4MYTA 1BDGA 4MIBA 3DKDA 3J7AN 4DV1K 4C8KA 4F8RA 4USWA 3Q8RB 4IXCA 1D8YA 4CJSA 3KJVB 1RAJA 1NDPA 3GJTB 3GE1A 1XMQK 3D6MB 4HUGA 4WIIA 3PHEA 2QX0A 1WNEA 3HCXA 3B6BA 3FZKA 1ELOA 3A8YA 3PSFA 2RS2A 1GAOA 2IIHA 2GW8A 4YR2A 3GYXB 4JV5K 4QWAA 2CH6A 2BGGA 5T7BA 4OYZA 4B9UA 3M7VA 4ISFA 1SH3A 3CCLN 1BWFO 4E7IA 1RWPB 2XLKA 2DEJA 2FVCA 3MCAB 2A6OA 1HNXK 2BZ2A 1LK7A 2HBMA 4MLHA 1X4CA 4XEIA 2GJ2A 4I7FB 4FWMA 3WNEA 1QAYA 2YKAA 2HHWA 4HHTA 2NZCA 4ZCIA 3N4QA 1BI4B 3CI5A 2EKYA 3QJJA 2MQLA 4NZ6A 4A4JA 4TYAA 4LFCF 2NRVA 2BRLA 2XSFA 1NMEB 5IC4B 2LCWA 1TKTB 2FD2A 3DFEA 4KHPF 1RGVA 4OGEA 5C25A 3FFKB 2BTFA 5K14B 1H6KX 4B9NA 3UKUA 1RKJA 4LIWA 3CD0A 5JLHA 3SSSA 2DGXA 3AVNA 5L1KA 4A8SA 1HARA 3BQ1A 1WKLA 3HBTA 4WU2A 2BACA 1U0HB 1WHYA 1IQZA 4BRHA 3W8PA 4LFCK 4F36A 1RHMB 4P75A 4KHPK 2JVOA 1YLXA 1VQ5S 2MKCA 1CJKB 3D7EO 4OX9K 4MKYA 3OVAA 3IBCB 2KHCA 3BF1A 4CLYA 3ZZTA 1K1QA 2G0JA 5ETMA 1IKYB 3TX0A 4USMA 3EDRB 4LQ3A 3MN6A 4Y28C 5HL7Q 3QFHA 4GKKJ 3JYTA 5B0CA 3CT9A 3VAHA 3OYNA 4X84A 4J9MA 1NK8A 5TKWA 3RBZA 1FRJA 4EZ9A 2IA6A 1U47A 3J81O 2ZJPQ 3W63A 4BRLA 3T5HA 4LSLA 2IMWP 1N32J 1TL7B 4DN0A 3O9TA 2X3GA 1SC1B 2ZBQA 1Q5YA 3KMQA 3S3NA 2QFIA 4USTA 1FFSB 3NY0A 3QETA 4WYLA 1VSDA 2E1RA 3GCXP 1Q79A 5I3QA 1RDCA 3EKSA 4QS7A 3OV7A