3LAKA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-heterocycle pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Heterocyclic pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lakA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lakA05
3WNFA 4EZ9A 1TK0A 2DTUA 2HAIA 4EO6A 3B6OA 4Z4CA 5JS1A 1U45A 1GOAA 2FBYA 4CGDA 2O4IA 3KLIB 2ILYA 3MR2A 3Q8SB 5I42A 3F9KA 4B8AB 5FDLA 3K5OA 1KHVA 5CY4A 1S9FA 4DTRA 2V4RA 3T5HA 2VA3A 1Q9XA 1JLFB 2IJNA 5F8GA 5KFRA 4M42A 3KTQA 1RT5B 4CJWA 1XHZA 2IOCA 2HNZB 4K4UA 1J5OB 3KK3B 3AVGA 4FLZA 2HW3A 1NHUA 4NLXA 4TXSA 2G8WA 2FBXA 3U3YA 2PYJA 4QWBA 4W5OA 5KFBA 1WNSA 1S0NA 3KLIA 1BIZA 4DSIA 1HPZB 4TY9A 3CDEA 4ECSA 2FC0A 2DFFA 1U48A 1U4BA 2YNFB 2F8TA 1EX4A 2X74A 5KFGA 4IQXA 4FM0A 4HVJA 3DLEB 2W9AA 3LP2B 5HRRA 2CKWA 4DU4A 3PR4A 5HLFB 3L8BA 2XHBA 4OKJA 1C6VA 1QHTA 4NCGB 5KFPA 2HNZA 3M9NB 4FBUA 1VSLA 1UOCA 5KFXA 1J5OA 3KK3A 4FJ7A 3ITHA 2KQ2A 1C1BB 4FJ9A 3CVKA 4Q8FA 2IMWP 1YVUA 4CJFA 3WNHA 4FJXA 2I1RA 1S0MA 4M3ZA 3T19A 1RTIB 4PUOB 4CJEA 2XO7A 1HPZA 2RPIA 1KRPA 2HHXA 4Q0BB 2YNFA 2A1SA 1HQUB 3H98A 4J2AA 5J1EB 3DLEA 4KHQA 4EYHB 4OLBA 4CEOA 5HRNA 1S6PB 2KFNA 3HVTA 3RWUA 4IKAA 5HLFA 3QNNA 3E01B 2A1RA 2G8FA 5KFYA 2IM1A 4CJQA 3OJSA 4NCGA 4W5NA 1BQMB 2EHGA 4KREA 2ASLA 2YHAA 4OL8A 2HWIA 5DG7A 1C1BA 4E7KA 4QCLA 4YP3A 3PJWA 4K4TA 3SUQA 3TARA 3V9WA 3MFHA 3LAKA 1UA1A 1YTAA 1RTIA 4PUOA 3RMBA 2KFZA 3QZ7A 1RBRA 4Q0BA 2G8KA 3TAQA 3MEEB 1HQUA 3LPUA 1VSDA 1N6QB 4LQ9A 5J1EA 5L1JA 1R0AB 1S6PA 4JLHA 1IM4A 2FLPA 4CESA 1JXEA 4ZPCA 3SPZA 2O4GA 3QIPB 4B9LA 1BQMA 4XIUA 4OPJA 2C28A 4O4RA 2W42A 3G10A 5KTQA 1DTQB 1WAJA 4CHOA 4U7CA 3SFUA 3NDKA 3V81B 3NMAA 2KZMA 2AGQA 5SZTA 4EBCA 5KFIA 3P5JA 1S1VB 3K5MA 3QLHB 1N6QA 1WSGA 1VRUB 2IJFA 4HTUA 1FKPB 1DTTB 1R0AA 4Z4EA 5F8NA 1S1XB 1QS4A 4EO8A 2XY5A 3D5MA 2IA6A 1I3AA 1ZBFA 4FJMA 3CFOA 5JUMA 4CEEA 3CM6A 4Y2CA 2Q3SA 1Z26A 3QIPA 1W0HA 1NJZA 3GILA 1DLOB 4XPEA 1X1PA 4FLTA 1LWFB 1VSKA 3AVFA 4M45A 4ZP7A 1XI1A 3LWLA 4JUZA 1GX6A 3PVXA 2D3UA 1LW2B 3KHGA 1WSEA 4M3XA 3HPGA 3LALA 4AILC 3D28A 3MAQA 4F4KA 1S1VA 3QLHA 1S6QB 1RT7B 3ASMA 4M3YA 4WFYA 1BL3A 4NLRA 4F4YA 4CGIA 1VRUA 4F2RA 1FKPA 3QGGA 2DPJA 5C42A 1S1XA 1RAJA 2GV9A 4N5SA 4E1MA 5KT5A 5D3GA 4LQ3A 3KLVA 1XHXA 4FM1A 3DM2B 2BRKA 1DLOA 2C2DA 3AO4A 4DU1A 3M9OB 1EP4B 1SV5A 3ZT0A 1SH3A 5EU7A 2ZQBA 5I3UB 3ZSWA 1LW2A 4DTJA 3S3NA 1S4FA 4E7HA 3C6TB 4W5QA 4ED7A 4OGEA 4NLYA 1C1CB 5J2QB 1RT7A 3VQ4A 4RW9B 3PW7A 4KHUA 5C25A 3DLKB 4U6PA 3O4NA 1NJWA 4ED8A 1S9EB 1CLQA 1J54A 3FFIA 3TAEA 3VQ6A 1ASVA 3RR7A 3DI6B 2RDIA 3NAEA 4I9QA 1S0OA 3OYFA 3O3HA 5I3UA 2HHTA 4J9RA 3L3UA 4E0DA 1IKWA 4ICLA 1B92A 3S9HA 1SH2A 3S3MA 4AHTA 4E7LA 1C0MA 4DL3A 1IH7A 2IDOA 5E41A 3L2QA 1NJYA 4BE1A 1C1CA 3LP3A 1HYZA 4CHQA 3MECB 5J2QA 3PW2A 4GMJB 2HMIB 1WSIA 3V6JA 3RBDA 3UPFA 4RW9A 4DTOA 1Z4UA 1VSFA 1LWEB 4O4GB 2GIRA 4RNNA 4FLUA 3DYAA 4BWMA 5F8HA 4J9OA 1S9EA 2AX0A 2AJQA 2YNHB 1JLGB 2JC0A 3DI6A 4FVMA 3T5KA 1RDAA 1N5YB 2B6AB 4FM2A 2PZSA 3RMCA 2FVCA 4DTSA 4J2DA 3RB6A 4DQQA 3ZSQA 3SYZA 3C95A 4NLGA 3GIJA 4FS2A 1N48A 1JLAB 5CZ2A 3MECA 2HMIA 3HVAA 2NUBA 2B5JB 4J9NA 3SI8A 4DL4A 3DRRB 2BANA 5KG0A 1IO2A 2XRIA 4KHYA 1LWEA 4O4GA 4DTMA 4FJ8A 2YV0X 4AHUA 1NK7A 5KFUA 1QAJA 1D9DA 4O3OA 4IFYB 4W5RA 5FRMA 2HVHA 3EPGA 2X6SA 3V4IB 2YNHA 3HJFA 3SQ4A 2R7YA 3Q8PB 3KHRA 1JLGA 3PJXA 1I6JA 5KFZA 1SH0A 3PZPA 1N5YA 2B6AA 2VG6B 1WLJA 4B9TA 4MK9A 1JX4A 1JLAA 1HYSB 2OPRB 2V0NA 1RBVA 3LZIA 1NKCA 3AVAA 2B5JA 1Q9YA 4PY5A 1QSLA 3OLBA 1OS5A 4EBEA 2XY6A 4O44B 2J6TA 4NYZA 2BQUA 3I0SB 2VG7B 1L3VA 3V4IA 1S10A 5KFFA 3BQ0A 1JXBA 3KIOA 4KTWA 1IKVB 1NHVA 3HVWA 4ZVFA 4K4SA 4CEDA 2FJXA 4YNQA 4CJ3A 5KG2A 5J2PB 3IGNA 5KGWA 3SV3A 4F8RA 2OPRA 1RBTA 2XGPA 3H2LA 4N56A 1NJXA 5KRSA 4CHYA 2OA8A 4O44A 2YNIA 1XC9A 4JS5A 4QW8A 3AVJA 1T8EA 3I0SA 2VG7A 1VRTB 1BIUA 3H40A 2R8KA 3NF9A 4FW2A 1JL2A 2BR0A 2BQ3A 4ECVA 4FK2A 3WNEA 4IG3B 5KFSA 4KB7A 4RNOA 5JS2A 3VN5A 2FVQA 4C8LA 2R2UA 2C2RA 4KAIA 4B9VA 2FVRA 3BGRB 5DLFA 2JLEA 4YFUA 4O3QA 2WK4A 3I0RB 3O3FA 3M8RA 4CEAA 5J2PA 1NOZA 4FXDA 3D0PA 2IGIA 4F50A 4Y1DA 5KT3A 2ALZA 1BCMA 4E89A 3TAMB 3EY1A 4MK7A 3AV9A 3ZSZA 3G0ZA 1RT6B 4FBTA 2XWYA 3AVBA 3KKRA 3T1AA 5KFDA 4ECUA 2HHWA 2IM0A 3BDPA 4QPXA 2PY5A 2RDJA 3OYAA 3K5NA 3QEWA 5KT7A 3NGDA 1D5AA 3DRPB 4IG3A 5EWEA 2UVRA 1LWCB 1A5XA 2HHVA 3BGRA 2VWKA 4J9LA 1T7PA 3I0RA 3BQ2A 1S9GB 1XR6A 2IBKA 4IBNA 2D0AA 4DS4A 2P51A 1ITGA 3TAMA 3FQKA 3PX6A 3SJJA 1SL0A 3NH2A 3OYHA 1RT6A 3L2RA 2YNGA 2D41A 4CK2A 2WB4A 1WSJA 4ECYA 1RTHB 1KVCA 3RMDA 3BSOA 4AHCA 1KCFA 1BCOA 2W9BB 3DRPA 4OKKA 4ZPAA 2D5RA 3SQ1A 4CF8A 1S1WA 4IOBA 1LWCA 4WFZA 3RB3A 4HUEA 5C5JA 3HHKA 4QWEA 3CO9A 3HM9A 1S9GA 2IC3A 5EDWA 3GQCA 2OPSB 4FZXC 4NLWA 2XC9A 1T3NA 4H4MB 2XI3A 4L8RB 4YR3A 2OZSA 1UAXA 2GUIA 4N76A 3C94A 4ZP6A 2D7SA 3OL9A 3GV7B 5F8IA 3K2PA 1RTHA 3ZT3A 4RUCA 2C22A 3OJUA 4CF0A 4ECTA 1WAFA 5KFKA 4QWAA 2W8KA 3CWJA 1KFDA 5EUHA 2F96A 4IDKB 4DG1B 3QZ8A 1JLFA 3LANA 1KVBA 3OYNA 2GIQA 1RT5A 3OYKA 3MEGB 1T05B 3CDUA 3ZSYA 2OPSA 4H4MA 4TQSA 4Y3CA 3QEVA 3I5CA 4F4ZA 4I2QB 4DTXA 1RDRA 1L3TA 1F21A 4CGHA 1RT4B 2WCXA 5KT6A 4B9NA 2XI2A 4KE5A 2P5OA 3QEIA 3VQ8A 3HL8A 1UWBB 3QEXA 4ZTJA 3AA4A 3FQLA 4KPYA 2DFEA 3SI6A 3LP2A 5HROB 2BQRA 2RKIB 2R2SA 4BDZA 4ECRA 4IDKA 4DG1A 4ZTFA 1CXUA 1Q8IA 4CIGA 3VQDA 3G6YA 5KRTA 3MEGA 4RNFA 2UVUA 1T05A 2FLLA 3N6MA 4Q45A 2V9WA 3UR0A 3DLRA 3HPOA 4I2QA 1BHLA 1HJRA 4ELTA 5F8JA 4ZP9A 1RT4A 1IKXB 1ZBUA 1TAQA 4IKFA 3QGHA 1SL1A 3KHHA 1RDDA 4DSJA 1WNEA 1QAIA 1WSFA 2XCPA 1JLQB 1C0TB 3E51A 4DF8A 3OYEA 3DOKB 3DDKA 5HROA 4G1QB 4JRPA 3AO2A 2RKIA 4FCYA 1D1UA 1HNIB 5DG9A 2EC0A 1ASUA 3AVHA 2DFHA 3E01A 3G6XA 4KFBB 2R8IA 3LZJA 1EETB 1RILA 4UQGA 3IG1B 3NH0A 3C6UB 3TAFA 4O0IA 2P5GA 4KV8B 4R0EA 3M8QB 1O1WA 4DSFA 4CJRA 3THVA 5FROA 2XY8A 5L1IA 1VK0A 1IKXA 4KB1A 5DGBA 1YT3A 3P1GA 1NNDA 4O3NA 3MEEA 4B3OB 1JLQA 4HHTA 1C0TA 4LSLB 3DOKA 4G1QA 3Q8RB 5L1KA 2X78A 1CZ9A 1HNIA 4URGA 5DQIA 4IRCA 4ED3A 3RMAA 4KFBA 4EZ6A 5T14A 3OS1A 4Z4FA 1EETA 3IG1A 4OVLA 3C6UA 3K59A 1LV5A 4KV8A 3VA3A 1IKYB 1RA6A 4QAGA 3O4QA 4IR9A 3M8QA 5KG1A 3MXIA 3VQ7A 3GIMA 3V9XA 1NKEA 4DQIA 3KLHB 4DFJA 4Z4GA 4RU9A 3GIIA 1DTQA 4CJ4A 5F9LA 3V81A 4DL6A 2JEIA 1GOCA 1FK9B 4DS5A 3K5LA 4DU3A 1WN7A 4CHPA 4F3TA 2DY4A 3LAMA 3NKYA 1RNHA 1TVRB 4B3OA 1JLBB 3V1QA 4DQSA 2Z1GA 3NL0A 1T94A 3GV5B 4LY7A 1DTTA 4NYFA 3H5YA 2YKNB 3VQ9A 3OYDA 4NZ0A 3PHEA 3MR5A 4DSKA 2P1JA 3H4BA 4CF2A 1LWFA 3MEDB 1REVB 3KOAA 5DMRA 4E1NA 2Z1IA 3KHLA 3KLHA 2J6SA 1D0EA 5KFCA 3TVKA 5KFWA 3AVLA 2W9CB 2G8UA 1FK9A 5DGAA 4J9PA 4RW6B 5SWMA 1S1UB 4R5PB 3OVNA 4M3RA 4OJRA 4BE0A 1ZYQA 4Q44A 1TVRA 1S6QA 1JLBA 2Z1JA 4RW7B 3PX0A 3OY9A 1NK0A 4DSEA 2YKNA 3VQAA 1KLMB 1D9FA 4KHMA 3SUPA 3VQQA 2HWHA 2OH2A 1TKZB 3DM2A 3SCXA 1KFSA 3WNGA 4B8CA 1EP4A 3FDSA 4URSA 3MEDA 1REVA 2ATQA 4QOZB 4KI6A 4K8XA 3V6KA 4ED1A 2RN2A 4PWDB 1CZBA 2W9CA 4CE9A 4CJSA 2E9TA 1TGOA 3C6TA 3V9ZA 1X9MA 1TKTB 4YMEA 4RW6A 4CJPA 1S1UA 4NLQA 3RRHA 2I5JB 1ZTWA 4IR1A 3RBEA 3KJVB 4RW7A 1CSJA 3OL8A 1W9HA 3K57A 4F4WA 3DLKA 4CEQA 3VQ5A 3PW4A 4CECA 4H54A 1X9WA 4RW4B 1KLMA 2UUTA 1LAWA 4ED6A 4OPKA 1C2PA 3VQPA 1TKZA 4NLUA 3OYGA 3HXMA 4CJKA 4CIEA 4O55A 2XGQA 1KVAA 1L3SA 4LSNB 5KFHA 3CJ3A 3ZSRA 2VA2A 3I5BA 3HSTB 4RZRA 4LH4A 5J2MB 4PWDA 2HNYB 1U47A 2ILZA 2HHQA 3CG7A 4CK1A 3H4DA 1TKTA 4TQRA 1W25A 3UQSA 5KG7A 2OZMA 4KB0A 3CDWA 5KG4A 5JXSA 3LP1B 3PR5B 4H8KA 4PA1A 1GOBA 5J2NB 1S97A 4MIAA 2FBTA 2QE5A 4RW4A 3HYFA 3PO5A 4FJGA 3OS2A 4KRFA 2OPPB 2R8GA 1S1TB 3HVRA 3DOLB 4CK3A 1EXQA 1CXQA 2ZD1B 3MR6A 1XR5A 4CEFA 2X6NA 4CFCA 4J9MA 4CJ5A 4LSNA 4E19A 4WXWA 4IH6A 3KMSA 2E6MA 1RBUA 3V9UA 5J2MA 2WRMA 1X9SA 2HNYA 4M94A 2Z1HA 2R2TA 1RT2B 3NGZA 2BGGA 3K58A 4E7JA 1NKBA 3BR9A 4EBDA 4QWDA 1RT1B 3CYMA 1S5JA 3VQCA 4ED2A 1RYRA 3DRRA 4TSXA 3LP1A 3CFPA 5J2NA 3CJ4A 2FLNA 5KFVA 2HNDB 1TV6B 2OPPA 3TI0A 4IFYA 4B08A 1S1TA 3GYNA 4AHVA 2VG5B 2ZD1A 4NRUA 4FJLA 1RDCA 2FJVA 3M8SA 2JEGA 5KI6A 4CJVA 1LW0B 2VG6A 4CJLA 5HBMB 5KFJA 2FVSA 3HPHA 4ID5B 1C0UB 3PO4A 2VWJA 3HT3A 1Z25A 1K6YA 1HYSA 1RT1A 2KTQA 4NLPA 1VSIA 4CGFA 4C8OA 5KFLA 4CCHA 4Z0UA 2HNDA 1TV6A 4NLOA 1KTQA 1XWLA 2VG5A 5DG8A 4JRQA 4WYLA 4B9MA 4NYNA 3M8PB 1IKVA 2PYLA 1LW0A 3LDSA 1L3UA 2G8IA 4TYAA 5HBMA 3KK1B 2JEJA 4ID5A 1C0UA 3SV4A 1HYVA 4J2EA 2HVIA 2WTFA 3CJ5A 2GC8A 2QKBA 1QSYA 4EEYA 1N4LA 2OYQA 2AU0A 2YKMB 4ELUA 1RDBA 1VRTA 3RR8A 2AWZA 4CJUA 3L2WA 1TL3B 4CJTA 3OL7A 3ALYA 4TN2A 4E3SA 3MXMA 3M8PA 3SFGA 3PUFA 4KO0B 4GC6A 3T5JA 1Y97A 4FJ5A 2R8HA 2B43A 4ZHRB 2B4JA 3KK1A 3MTKA 4C8MA 1FKOB 2E6LA 4DL5A 5I42B 1XR7A 3H5UA 3EZ5A 1TQLA 2WHOA 3NAHA 3NGIA 4J9SA 3JSMB 4DTPA 2IS3A 4FLWA 4DSLA 4M3WA 4HCCA 2YKMA 3OYCA 3SZ2A 4AHSA 3QYYA 5HRSA 1TL3A 4IH5A 1LAVA 4URQU 4MIBA 2LSNA 3VQSA 3F73A 2D0BA 3I5AA 4KO0A 1BGXT 4ECZA 4KHWA 4J9QA 1RA7A 4OGCA 5KFAA 4ECQA 4E7IA 2GBZA 4ZHRA 3NF8A 3L3VA 4DLGA 4MKAA 1FKOA 3SQ2A 2JGUA 3JYTB 4ID1A 4BWJA 1S49A 1A5VA 1QE1B 4FZZA 4WYWA 3G86A 3HKWA 4RNHA 3L2UA 3OS0A 1JKHB 3JSMA 4G3IA 1K1QA 4DTUA 2O5DA 2AQ4A 4KI4A 4R8UB 3H08A 1MU2B 3BSAA 1TAUA 1TL1B 1TKXB 2UUWA 3ITHB 1ZETA 2W9BA 1NOYA 3Q8QB 1GX5A 3N6LA 4EYIB 3HP6A 4HKQA 3UDLA 3NF7A 5DQHA 4O3RA 5KFNA 4KHRA 3EYZA 3JYTA 3VQEA 3ZT4A 4ZPBA 4LH5A 1KSPA 1QE1A 2WOMB 2EX3A 4KTZA 3OYLA 3HVTB 1JKHA 3H5XA 3HO1A 2IAJB 1SL2A 4WZMA 3QEPA 4O0JA 4R8UA 1NK4A 4DTNA 1ZTTA 3RRGA 2FBVA 3S3OA 5DQGA 1MU2A 4GVMA 1TL1A 1SKRA 1TKXA 3QO9B 3GIKA 4MQ3A 3AO1A 1C1AA 3DLGB 1KLNA 3OYMA 3RAQA 4TYBA 4CHZA 4DQRA 3NHGA 3KMQA 4K4XA 3U6FA 3TABA 1BI4B 4XO0A 2IM2A 2WOMA 4Y2AA 1ZBHA 3QIDA 3DLBA 2IAJA 5F8LA 3PX4A 1JXLA 1JIHA 3RB4A 2ASDA 2C2EA 4ZVEA 5KFMA 5KT2A 3OYIA 4DFKA 4YR2A 4OKEA 1UWBA 3QO9A 4KKOB 4RUAA 3FSIA 5L1LA 3AVKA 1VSJA 3RB0A 3DLGA 4DMNA 4FZYA 4ECXA 5T7BA 3B6PA 2QKKA 2OPQB 1ZBIA 3NGYA 4Z4IA 1TP7A 1RTJB 3BSCA 4RNMA 2D0CA 4IRDA 1J53A 3H5SA 4FJKA 3TAPA 1BI4A 3CM5A 4CFDA 4FW1A 2E4LA 3L2VA 3IGVA 4FJHA 3OHBA 1TK8A 4ECWA 4K50A 5KFQA 1QSSA 1IG9A 1HARA 5HP1B 1SKWA 5EWGA 4OLAA 2ITGA 4KKOA 3SQ0A 4DFMA 3A2FA 3CIZA 3N6NA 4BDPA 2E9ZA 1HQEB 2ZE2B 2ATLA 2UVVA 2OPQA 3KLEB 2FVPA 2F8SA 3AVIA 4K4WA 1VSEA 4MH8A 3GV8B 1RTJA 4WZQA 3PW5A 3IS9B 3NH1A 1MMLA 3TWHA 3V9SA 3AA3A 5FRNA 3I8DA 3ZSVA 1WSHA 1FXXA 2QXFA 3IN5A 2R8JA 2QK9A 5C42B 5D3GB 3V6HA 5HP1A 3V1RA 2G8VA 4K4ZA 3QINA 4NLSA 4NLVA 1SV5B 5KFOA 4LSLA 2DPIA 1RBSA 1JL1A 1HQEA 1HNVB 3QERA 2ZE2A 4CGGA 1HMVB 5KG3A 3AO3A 3TAGA 3NBPB 3KLEA 4MK8A 3BQ1A 3AVCA 3IS9A 4H4OB 4GW6A 4CEZA 4O5BA 2CJQA 1IKYA 4N47A 1J9AA 5HRPA 2WONB 4X2BA 2HHUA 5C25B 3KLGB 4NLDA 3CQ8A 1NK9A 1K1SA 3KNAA 2AX1A 2RF2B 5K14B 1UA0A 1VSMA 4NLTA 3ICLA 3FFIB 5KG5A 2FJWA 4J2BA 4DL2A 5F8MA 4AH9A 4HYKA 4CFBA 3H59A 3AA2A 4IH7A 1HNVA 5DK5A 1IKWB 4ICLB 1HMVA 4I9LA 4N41A 3NBPA 3EZUA 4FJJA 3MR3A 4J9KA 3VA0A 3PV8A 4F3OA 1VSHA 4ZVHA 5KGXA 3AO5A 4H4OA 5KG6A 4CF1A 1YVFA 2WONA 2W7OA 1B9DA 1NK6A 2XCAA 3KLGA 1T03B 3DYAB 3D45A 4ZMMA 4YQWA 5CYMB 4EP4A 4NCAA 2RF2A 3T5LA 4CHNA 5K14A 1SKSA 4FJNA 1RCHA 4FLXA 4HCBA 4R5PA 4FK4A 4M3UA 4O3SA 1SUQB 3ULDA 3NAIA 1N56A 3OYBA 4F2SA 5KT4A 3UIQA 4BACA 3TANA 3OSPA 3ZSOA 2JC1A 5EWFA 1BQNB 3SUNA 4BDYA 3AVNA 3TR8A 2YHBA 1G15A 3TQ1A 4BE2A 2AGOA 2BANB 5C24B 1BISA 2W7PA 4K4YA 3BREA 1T03A 3KD1E 4F4XA 4EP5A 5CYMA 2XY7A 3KK2B 4MFBB 1U04A 4Y1CA 2I5JA 4TY8B 1SUQA 4M3TA 4QWCA 3KJVA 4DL7A 3OYJA 4KHNA 1JLCB 3ISNC 1QQCA 2V4QA 1EKEA 3NE6A 1BQNA 4NRTA 4DEZA 1D8YA 4KAZA 1QUVA 3FRZA 1ZBLA 2ZKUA 3BSNA 5C24A 2BDPA 3V1OA 3P83D 1TK5A 4TLRA 3KK2A 3HP9A 4MFBA 4YR0A 3MXJA 1U09A 4IG0B 3AVMA 4Q43A 3RAXA 4CIFA 3DMJB 4TY8A 4K8ZA 3CJ0A 3QGIA 4CFAA 2W8LA 4HUFA 3CFRA 3KLFB 5KFTA 1JLCA 4PQUB 3NCIA 3RTVA 1I39A 2F8EX 4ED0A 3ZT2A 4QW9A 4FLVA 4M95A 4HUGA 3ISND 2E9RX 4KSEB 4XPCA 4FYDA 3DOLA 4WE1B 2KW4A 5CZ1A 2Y1IA 1B9FA 4Y34A 1RYSA 4DF4A 4Q8EA 4I2PB 5L9XA 1L5UA 2YNIB 2BE2B 1TKDA 1YTUA 3LPTA 3QESA 5KFEA 3EPIA 4IRKA 2KZZA 3DLHA 1RT2A 1JLEB 3IAYA 3LP0B 4IG0A 4FJIA 4AHRA 2HHSA 2QV6A 4KTQA 3HK2A 3DMJA 3MFIA 2AGPA 3QIOA 1RTDB 1RT3B 4ZP8A 3ZSXA 4CERA 3KLFA 4PQUA 4JV2A 2UVWA 3G6VA 4ELVA 5F9NA 3KD5E 2ASJA 3OL6A 4FLYA 3PW0A 4WE1A 3LWMA 4WFXA 2D3ZA 3PY8A 2BRLA 4I7FB 3T3FA 4I2PA 1QTMA 3ZCMA 4IFVB 2BE2A 4ZVGA 4NCBA 4FS1A 3IRXB 1JLEA 3MF5A 3NF6A 3LP0A 5DLGA 4C8NA 3DRSB 3NFAA 1NK8A 1RTDA 1RT3A 4ZPDA 2HB5A 3CJ2A 3SUOA 4FK0A 4K4VA 4Q5VA 5CYQB 4B9UA 4CGJA 4LD0A 3VQBA 3U3GA 4CF9A 3V6DB 4RW8B 1U49A 2IM3A 1HRHA 2R2RA 4WXOA 3OSNA 3SNNA 4C8KA 2G8HA 4I7FA 4IFVA 3KKSA 4M41A 4DQPA 2YNGB 3BJYA 3AA5X 4JV0A 3IRXA 4O3PA 4KBIA 3OLAA 4DWIA 4B9SA 2JEFA 1S48A 3DRSA 5FDLB 2J6UA 1NK5A 4MKBA 4KHSA 4DLEA 3QETA 4W5TA 1S1WB 5CYQA 3ZT1A 4JS4A 4Z4HA 2ETJA 3O3GA 4RG8A 1KHWA 3V6DA 4RW8A 2IC3B 3M9MB 4JV1A 1ASWA 4CEBA 4DFPA 4GC7A 3OHAA 3QNOA 2Y1JA 3SPYA 1A5WA
chains in the Genus database with same CATH superfamily
3NXZA 4LR7A 3RW7A 1TK0A 1QLNA 3PYEA 3B6OA 2Y8WA 4U9RA 2FBYA 2O4IA 5HAOA 5I42A 2P9NA 3K5OA 5CY4A 1EIYB 4DTRA 1NJIT 3D2WA 5D0GA 3LDLA 2LMIA 4ETXA 1LWXA 2VA3A 1OO0B 2QA4N 1KQSR 5F8GA 3C6HA 4M42A 3Q7BA 1XHZA 2DB1A 2LKZA 2VKRA 1J5OB 2HW3A 4NLXA 2G8WA 3IR6B 3GSDA 2FBXA 3U3YA 2PYJA 2MZJA 1V5IB 3U1LA 3RSEA 1WNSA 4MYUA 3EVOA 4WWSA 3OTOJ 2VHGA 4TY9A 1YAGA 4ECSA 2FC0A 1U48A 3CJRA 2IY5B 2F8TA 2ERRA 1NBWA 1TU0B 1FTRA 2W9AA 2EFVA 5HRRA 4DU4A 1AXQA 2XHBA 1ZAVA 2N4DA 1C6VA 1QHTA 3MI7X 1LOTB 4NCGB 2CDQA 4HHHA 5KFPA 5H9EJ 1VSLA 5GAEI 3BY5A 1FRJA 1JJ4A 3VEXA 3KK3A 2KQ2A 1C1BB 5ETSA 3P49B 3UCZP 4DCHA 1FRLA 1VRQC 3WNHA 2I1RA 2HS4A 4M3ZA 2MB0B 2D1KA 1RTIB 2HHXA 1HPZA 3MCSA 4Q0BB 1NGCA 2YNFA 2A1SA 1PBUA 1E6VA 3DLEA 4CP5A 5HRNA 2KFNA 1UMJA 3HVTA 2KKZA 3O6QA 1ZM2A 2QGFB 4YOVA 5KFYA 1WKJA 2EHGA 2K06A 4KREA 1XNQF 2ASLA 4DR2J 2UUAF 2HWIA 5DG7A 4E7KA 4YP3A 4GV6A 1RLDA 3E8OA 5FPDA 5LJ5Y 3AJ1A 3SBGA 4WF9L 1V4SA 5GMEA 4PUOA 4F3QA 3RMBA 2AP6A 2G8KA 3TAQA 2KVIA 5J1EA 2P2CB 2ZJQQ 1VQ7N 4CESA 5JLHA 1RWOB 2ROPA 4ZPCA 1RDWX 1S6UA 4B9LA 1YBTA 3NMUA 2YBVA 5AQWA 1TZ0A 3L3CA 1RAIB 2ZOFA 1U26A 1BXNA 2DH7A 1VC0A 4IOCL 5KTQA 1DTQB 1UP1A 4JHDA 4X66K 4A2AA 1MN7A 5SZTA 4EBCA 3K5MA 1Q82O 1D09B 2IJFA 4HWIA 4PXEA 1DTTB 1QTNB 2BABA 1QS4A 3B6BA 4EO8A 3U8XA 5E5NA 4FJMA 5M1QA 3OT9A 1HBOB 3CM6A 4HT7A 3QNWB 2Q3SA 2W6KA 3QIPA 2EEYA 4F26A 2EC2A 2XS2A 1DLOB 3WXMB 4FLTA 1UVNA 3LWLA 4UY8T 2ACYA 1LW2B 4M3XA 4JK7A 4QR0A 1CULB 2BVZA 1N36F 3HPGA 4ZPVR 1T9TA 1Y64A 3D28A 4F4KA 2GVDB 5JVHQ 1VBKA 1S6QB 2LYVA 1RT7B 2V50A 3ASMA 4WFYA 1RISA 4P9SA 1YBAA 4TVAB 3O9TA 2DPJA 4FVCA 3PIOL 3GYGA 5D3GA 4FM1A 3DM2B 2BRKA 5KQDA 3MM7B 4V19X 1EP4B 1GMWD 4JI2K 4L73A 2CGKA 3G8QA 3SXLA 1RACB 3ZSWA 2RUGA 4W5QA 4ED7A 1C1CB 1FNXH 1RLCL 3BH6B 4CLLA 1PSDA 4C4WA 4PG8A 2MQ8A 1KS2A 4X62K 1U1PA 1FO1A 4U6PA 3O4NA 3Q8UA 2QYGA 1CEZA 3U9DA 1RHQB 2GWJA 2GO8A 1Q79A 4P7TA 2DGQA 2PEBA 3DI6B 5IM0A 3PIPL 7FDRA 1EJ7L 3OYFA 5I3UA 5GADP 3ZTSA 4C0BA 3R5BA 1IKWA 2ZH5A 4X4OA 1B92A 4YOWA 3S3MA 1YJWS 4NZ6A 2RS2A 2HMIB 3SQGB 3RBDA 2NXJA 4RW9A 4DTOA 1HQ2A 1VSFA 1M1KT 2VOPA 1SQEA 4FLUA 5H9FJ 5IV4A 1PBAA 2DY9A 2AJQA 4CDIA 4JI0J 3HDSA 2AEFA 1HBUB 1MMNA 1YVNA 2F63A 1H38A 1FDDA 2VPXB 2LU2A 1MNEA 4B3TK 3J81O 4QIVA 2RAQA 2PZSA 3VAGA 3O8WA 4J2DA 4RR5A 4DQQA 1BA1A 3ILLA 3SYZA 1I94J 2KYZA 3MECA 2ZNYA 2LQ8A 2NUBA 2B5JB 4J9NA 3GP9A 4DL4A 2EG2A 3HZGA 4Q2MA 5KG0A 2AYGA 4O4GA 1ATRA 2J9DA 5LOQA 1NK7A 4USVA 4ILGB 5B08A 2HVHA 1OKJA 4QYZJ 2WC9A 3ZZRA 3LOUA 4CJ7A 4K5RA 2NPFA 2R7YA 3Q8PB 3KHRA 1I6JA 3PHTA 5KFZA 4DPTA 4OX9J 1TUUA 3LW5C 3GU0A 4LBHA 1WLJA 1T44A 1Y10A 4PG7A 3AARA 1IBMF 4F36A 4MK9A 4X4RA 2OLWA 2AF6A 3C0BA 1JLAA 1PCAA 3R9PA 1IUJA 3P4IA 1Q9YA 4PY5A 2O8EA 3PYDA 2XY6A 4NYZA 1EAYC 1JNRB 3RBXA 3I0SB 4U8VA 3V4IA 2EFGA 3BQ0A 4I64A 1FXLA 4QIFA 4CEDA 4ALZA 4I4BA 5RUBA 1SIZA 2DGUA 1HNWK 5J2PB 3A5NC 1YQHA 2HLUA 2Z4PA 4F8RA 3BO3A 2XGPA 3H2LA 3VAFA 2AKWB 2K7JA 5KRSA 3VAHA 4CHYA 4JD2A 1XC9A 4JS5A 2LEAA 2HS3A 3GR1A 4DR7K 1IJFB 1RWKB 1BIUA 3H40A 2R8KA 2NLXA 1JL2A 2BR0A 3WNEA 4ZCIA 1W2BR 3J81U 4KB7A 3IWLA 2FVQA 2MEWA 2X1BA 1UVKA 4B9VA 2FVRA 3BGRB 5D0EA 4O3QA 4C23A 4H0XB 3FK4A 4CEAA 1UJ4A 4D3GA 4BG9A 4FXDA 2HF3A 4LF8K 2IGIA 4ZN1A 1XK8A 4F50A 3AB2B 1WG4A 2ALZA 5LMNF 2E1RA 2BBEA 5C2DA 1HPMA 4FO0A 5D4OA 2EK6A 2MGZB 2V68A 5IC4B 2IM0A 5HL7L 4PG4A 1MG7A 3AHPA 1WOQA 4NXMJ 4OJ1A 1B99A 4KGXB 2KT5A 3DRPB 3AOAA 2DHAA 1HNXK 5BJRA 4YDXA 3L7OA 1M1HA 4A8FA 3I0RA 4WP9A 2MLXA 4PKDB 4DV5J 3K9JA 3HHLC 1ZM9A 1M90T 1LQ9A 4LFCF 4DU8A 1SL0A 3NH2A 3M2UB 3OYHA 3R5CA 1VHFA 3VQTA 3ZEUB 4OYBA 3UN2A 1HNZK 4ECYA 1TYQA 4G65A 2NCKL 1NWKA 4CLKA 3E9OA 4AHCA 2XZDB 4P10A 2E1PA 5ETQA 4ZPAA 2D5RA 3SQ1A 4CF8A 5D6GA 2GX8A 3T1YJ 3J8AA 2D3OR 3HHKA 3CCQN 2ZITA 3CC4N 2WW4A 1NCLA 3THWA 3CO9A 1S9GA 5EDWA 2OPSB 1RGIA 3ZNJ1 2XC9A 1T9UA 1T3NA 2PGCA 1U1NA 3BH7B 1G99A 2DCLA 1DRZA 4CLWA 2GUIA 3C94A 4ZP6A 1WACA 3OL9A 3O5TB 3GV7B 4BRHA 1CJTA 5EN1A 4P74A 4RUCA 3OJUA 9RUBA 2FGOA 1KQKA 4IOAL 1UVIA 4NLCA 3TP2A 3HSZA 1KFDA 3GDQA 4C3LA 2F96A 4DG1B 2Z2LA 2DISA 3ZZYA 1JLFA 3LANA 3NNCA 2ZGYA 4OO1J 3O1WA 3ZSYA 2G0CA 4E98A 4EGLA 4LIRA 1N88A 3I5CA 3PRBA 3R9LA 4I2QB 2K8GA 1P8ZA 2C1EB 4EK2A 2W2MP 5E33A 2WCXA 3AB4B 4A62A 2CJ9A 4ZJOA 2HMPA 1VQ5S 5IQQA 1Q8KA 3DXSX 3GJSB 4QS9A 3OTEA 5LL6d 1PJ6A 3LP2A 3MMCB 4ECRA 4IDKA 2EBGA 4ZTFA 4JNEA 2Y3YA 2O8FA 2VC1A 2K3IA 4CIGA 4QJVA 5EVZA 3MEGA 4RNFA 2UVUA 3PFOA 1T05A 4MMOA 3HZEA 3P5BP 4DR6J 2V9WA 2JWNA 3HPOA 3HD1A 3DHXA 2NSBA 1IKXB 4AE5A 4DR4J 2ZFHA 1YIJS 3DLJA 2CPJA 1SL1A 2DK2A 4OYWA 4DSJA 4OYZA 5DZ6A 1WNEA 1QAIA 2ZH8A 1DJ0A 4KHPJ 3D2FB 3I55S 4G1QB 4YB5A 5HVHA 3AO2A 1JXVA 1D1UA 1TL7A 3GFZA 4FCYA 1HW8A 3IDHA 1FA0A 5F41A 5GIOA 5MLCV 2OO4A 1CPZA 1GLDG 3LZJA 2GS8A 4UQGA 3NH0A 4P73A 2VFUA 3SSRA 4LFBJ 3NMRA 3GTYX 3M8QB 4CO3A 4DSFA 3THVA 3LGNA 4DV2F 3GJQB 2AYEA 4E8UA 1VK0A 4LRFA 4DUZJ 2UP1A 4WFAL 1R89A 5IQ6A 5DGBA 2IVFB 1VAZA 1WF1A 4FVUA 5L1KA 2DNGA 4ISFA 1HNIA 3IBCB 1R6YA 4GV3A 4IRCA 2CRLA 3F41A 2DY1A 4RUBA 1WHVA 4ED4A 1EETA 1IBKK 3C6UA 4EHTA 3MURP 4MDAA 3JQJA 1LCUA 1IV0A 4KV8A 1Y3KA 1IKYB 3FCVA 5BR8J 3MOZA 3O4QA 3K89A 3MXIA 4F0HA 4WU3A 2AEJA 2YXLA 4DQIA 4A2BA 3KLHB 1BUPA 1YK9A 3GE9A 4CJ4A 5F9LA 4LF6F 4BS2A 4J7CA 2FY8A 4DU3A 2HQGA 4DV1K 4CHPA 2MKCA 4YY3J 4B3OA 1VQ9S 2DEJA 3V1QA 4DQSA 3NL0A 4CYUB 3I6PA 4NYFA 3VGVA 3MMBA 4LRAA 3VQ9A 3OYDA 2DXDA 4ZIVA 1AUSL 2XULA 2XO6A 1K73T 2GJIA 2OTLN 2BE9B 4ID8A 2RQMA 1LWFA 1EWQA 1V9OA 3M2RA 4WFBL 1GMUA 5M2RA 3P39A 1WJ9A 3AFGA 4PCQA 1GK8A 2ZH3A 4NWBA 4JK8A 5ETNA 1J5EJ 4RW6B 4DR2K 1S1UB 4R5PB 2FC9A 1ZYQA 3TX0A 4Q44A 1Q8LA 1JLBA 2DYAA 3H2VE 1JJ2M 1YRXA 3GG1A 3FEXB 3E9PA 2YKNA 1JJHA 3Q22A 3CD7A 2CA9A 5GMDA 1KBRA 3SUPA 3MN5A 2HWHA 2A0FB 4GO7X 1QAYA 2X3GA 3WNGA 3FDSA 4URSA 4CO0A 3MEDA 1REVA 4IDHA 1RU1A 3NS7B 1Y11A 3MPWA 2R7QA 3CJBA 2VFRA 3KJVB 4RW7A 3PLAA 1CSJA 1V3SA 3G9CA 1W9HA 1UEVA 4F4WA 3FZFA 3DLKA 1TMJA 4CECA 2W4PA 4H54A 1X9WA 4RW4B 2HBLA 3AOCA 4ED6A 3WQPA 1VQKN 4DCPB 4NLUA 3OYGA 1NAQA 2XGQA 1NBEB 2M88A 1L3SA 2MQOA 5KFHA 2BJ3A 1Y5IB 3US5A 2VJUA 4LH4A 1RXOB 2HQ3A 4N8OA 2VPWB 2RDDA 3ATUA 2D9OA 5JXSA 1QQMA 3MX5A 1S97A 4MIAA 4WQ5C 3VEWA 2F4VJ 3KJQB 2R8GA 1S1TB 5HO4A 3EE9A 3O4WA 2AW0A 3R5AA 4GKKJ 3EM1A 5IWAF 4BC4A 2ZD1B 1XR5A 2L41A 4CEFA 2CZVC 4E19A 4IH6A 2VBZA 3KMSA 4WQ4C 4PKHA 3V9UA 1X9SA 3OVSA 1KOOA 1DY3A 4B3MJ 2R2TA 1VQSA 1RT2B 1SQKA 5G4DA 3SEOA 1DQ9A 3IM8A 2GNKA 2ZZTA 1RT1B 4RBTA 3OUYA 4TSXA 1FI4A 3LP1A 1AZSB 3F0NA 1NU0A 4BC2A 1KQFB 1ZXOA 3ILIA 2HGLA 1VQLN 4AHVA 1URRA 3DLLQ 3W9JA 2FXUA 4FJLA 1SPBP 2FSKA 3CJ8A 2DGVA 3M8SA 2CQHA 2DNMA 3QJPA 3QICA 3H2UB 3H8YA 4A57A 2QM1A 1C0UB 3PO4A 1RABB 1U6FA 4KIAA 2HIQA 4FWMA 1R0CB 1DHMA 4NLPA 3GYXB 2P9KB 4JV5F 3MWBA 5I3QA 1WELA 3OTCA 4CCHA 4L74A 1K8AO 4OPHA 4JAXA 3UVJB 2HNDA 2WSCC 2KG1A 2YPZA 3UKUB 3DJCA 2UV8A 1LOUA 1A0OB 4LF2A 4NYNA 2F7VA 1F0XA 5B7WA 3D3BJ 3FUYA 4ZJQA 3QB0A 4ZVTB 3HX9A 4ZKAA 4H03B 4J2EA 5G0RB 2JDJA 3P8BB 3TSQA 2GC8A 3BKFA 3BN4A 3C66A 1TFWA 3CCWA 2AU0A 2DXEA 2WVDA 2K1RA 1XNRJ 5B0DA 1VRTA 3RR8A 4CJUA 3EJMA 4IO9L 3OL7A 2A41A 1CS4A 5HMWA 2EFNA 3MXMA 2ZH9A 4KO0B 2A5XA 2C42A 4FJ5A 4ZHRB 3W7BA 1VQMN 3MCPA 3ZZZA 2DEIA 4DL5A 1V3ZA 1XR7A 3FBFA 1I5OB 3MM9B 4X4UA 5A0YA 1TQLA 1RAOA 4J9SA 3SQOP 4M3WA 3CCEN 4HCCA 3SZ2A 1IG8A 1MWQA 4I6MA 2RB7A 2XMVA 2BXJA 4JKCA 2HOEA 5AZIA 4X62F 3L3VA 4MKAA 1FKOA 3SQ2A 2GEMA 3JYTB 2HZVA 2D9PA 3CJAA 1HWKA 4B9QA 1QAXA 5C2CA 3MM5A 3AA8A 3F9MA 1D4XA 5AQSA 1QZ5A 5A8KA 5TKYA 4O5FA 1WHWA 4Y28C 3UE2A 4R8UB 2CWXA 1S0VA 2A2CA 2P9LB 4DR1F 1TKXB 4M8LA 4LF1A 1ZETA 1RP5A 2W9BA 1S22A 5CR4A 2B9EA 4HKQA 2PI4A 2VBWA 1VQ8S 2H3GX 5KFNA 2V8DA 2W6LA 1QE1A 3K5PA 1N5TA 3A13A 4CLSA 2EX3A 2RT3A 1JKHA 4IEEA 3BO2A 1XUPO 5AQHA 1SL2A 3W9IA 3QEPA 2FHMA 3FVYA 4OI3A 2V8PA 3KWIA 2YWGA 3S3OA 2DRBA 4MQ3A 2RE1A 2Q79A 3W5XA 3BEGB 1ICEB 1NGJA 1KLNA 3VTIA 1NPPA 2NZCA 1NZAA 4DQRA 3NHGA 1P1TA 4WPAA 1VQON 4K4XA 4DOZA 3TZZA 3EGVA 2YVSA 1GMVA 1EARA 2JNJA 2BJ7A 1BI4B 2IM2A 3BB5A 2L3MA 1AB8A 3QIDA 3QT8A 3KKFA 2PEHA 1JXLA 1FEHA 2ASDA 4JEPA 3A3OB 5KFMA 5ETVA 3EKSA 4YR2A 3QO9A 4KKOB 2R7UA 1GLAG 2ZVSA 2H3EB 3DLGA 3MEKA 4FZYA 4ECXA 3CULA 8AT1B 3C2PA 1ZBIA 1FERA 2RRBA 5T41A 2VQFK 3BSCA 2J9DE 3O9QA 1F5BA 1KD1O 4M1KA 3D6RA 5JVGQ 3CM5A 4CFDA 3IC1A 3L2VA 5ADXA 5HMZA 3U9ZA 4ZVUB 4XH1A 2I9SA 2IDLA 4M5DB 5LM7E 4D3HA 2XSJB 3VPZA 4OYXA 2SXLA 2HURA 4EWTA 2NPIA 1HNWF 3NCQA 3SQ0A 2WW8A 2HG4A 2IVOA 2Y1LB 3CIZA 3QBCA 1HQEB 4NLBA 2ATLA 2E44A 2OPQA 4FWPA 2YX6A 3D7EO 4MH8A 3GV8B 1VQ4S 2AZ1A 3PW5A 3SCKE 3AD9C 5CD4H 1MMLA 1YG0A 3V9SA 3ZSVA 4KYZA 1WSHA 3T9NA 2R8JA 5AXKA 1VQPS 2M9KA 4YEAA 1E6YB 2HRTA 3QT7A 3C19A 3V1RA 5B09A 4NLSA 1PAEX 4CO4A 4LF8F 2EW9A 3HOTA 4LSLA 3T1HF 5DO2A 3VF2A 1M5SA 5KG3A 3AO3A 3CERA 3NBPB 2VBXA 4F0MA 1ZPWX 3ZETA 1KKHA 3M2VB 3BQ1A 2BJDA 2UXBJ 3D7SB 4O5BA 4N47A 1RWMB 1J9AA 5HRPA 3G82A 4X2BA 1I51B 1NSKL 4X4QA 4MT1A 1ZPVA 2E1MC 3W66A 4CLTA 2AX1A 3LGHA 2ZWOA 2P9CA 5KAKA 5KG5A 1S7IA 4OFZA 2GHVC 3H59A 3G71N 2UUAJ 4IH7A 4DCJB 1RAGB 3NGRA 4FJJA 2Q3PA 4PHTX 2DCUB 1RU2A 4F3OA 1VSHA 3TUPA 4ZVHA 5KGXA 1OH5A 1YVFA 2OD4A 1RCOB 2HLTA 1RADB 1B9DA 3SAFA 1T03B 4ZMMA 4YQWA 3J81Y 2GGPB 2RF2A 5HVFA 3T5LA 1SKSA 1EKRA 1SC3B 3QATA 1SUQB 3ULDA 4OQJA 3NAIA 2BOPA 2GAHC 3N28A 5KT4A 2E2PA 2QL5B 1B7YB 2GMLA 1E4FT 4X4PA 3GJRB 1YGYA 5EWFA 2XNQA 1OYDA 2DTJA 2I8EA 2V4JA 4RX6A 1U2VA 1IWAA 4BDYA 2MTLA 3TR8A 1G15A 2AGOA 5C24B 2RHQB 4JI3K 3BREA 2AYMA 5K8MA 1HD1A 2FSNA 5T7LB 4BGAA 4MFBB 3O1BA 4ILHA 1NGBA 2ZBQA 1YJ9S 2I5JA 4JI5J 2F7TA 4M3TA 4QWCA 5AQNA 3CXCM 1NM1A 4DL7A 3Q89A 1RHUB 3OYJA 1VHIA 4KHNA 3I4PA 1NB7A 2M8DB 4DV0K 1EKEA 1MWYA 1BQNA 2WTUA 2ZVIA 1N36J 4DEZA 4NO7A 4KJIA 3T9ZA 1UTAA 2YKAA 2RU3A 3P83D 1TK5A 2Q0UA 1EKSA 4TLRA 2ROEA 1AROP 3O2IA 4YR0A 1U09A 4CIFA 2N82B 4TY8A 2LVWA 2KG0A 4CFAA 3QPIA 3ZT2A 2RJZA 4FXWA 2DNLA 1IQTA 4KSEB 1R8CA 5C15A 4FYDA 3DXKA 4O0NA 4CTAB 1MWZA 2E7XA 1PGZA 2F40A 3ZXWA 3UB5A 3JTPA 4ISEA 5L46A 4Q8EA 1K8AT 2B4VA 4USJC 3RU0A 1NU4A 4JI8K 2YNIB 1H72C 1TKDA 1FEEA 3LPTA 4A8OA 4IRKA 3IAYA 3LP0B 3I32A 2CPYA 3V4MA 3MFIA 1RT3B 4LF9J 3ZSXA 4HT5A 5A8WB 4JV2A 5LMUK 1Y9OA 4ELVA 4UOCA 2AYBA 3CQYA 3PW0A 4WE1A 5U47A 3UDCA 2XMMA 3PY8A 4HHJA 2HQDA 3MMJA 1Q0NA 1TTHB 2GELA 4I2PA 3DGPA 5AE1A 3UDVA 2BE2A 1VCTA 2RSQA 4FS1A 1NMEB 2J7WA 1VDHA 3OTOF 2M52A 3MF5A 1S5ZA 4C8NA 3DRSB 4K7QA 3TW0A 1UVJA 2ZJRQ 2V2VA 1RTDA 2NYHA 2BV3A 2XMJA 1HLUA 3VVTA 3WC2A 2YWKA 5LSLA 2CDRB 5CYQB 4B9UA 3IXQA 4JI1K 3U3GA 4CF9A 4L3KA 3EGZA 1HFEL 2R2RA 2RQ4A 3GCWP 3P38A 4I7FA 4G6VB 3HI0A 1ZBSA 2ZZMA 3PYGA 3KKSA 2J0XA 2YTCA 2ZF5O 2LU1A 4O3PA 3TR5A 3NS6A 3CCMS 2JEFA 2M2BA 1NK5A 4KHSA 3ET6A 4TLQA 4X84A 4OZ3A 3ZT1A 4XEIA 2PC6A 1CJUA 2AA4A 3O6WA 3VAMA 1KHWA 4UW2A 3V6DA 1T95A 5DRKA 1IBMJ 2NYIA 4DR2F 4HDHA 2PE8A 4DFPA 4GC7A 5CH7B 4YHHJ 3OHAA 1N54B 2XWXA 3WNFA 4EZ9A 1MWMA 3RSEB 3L7UA 1UJ5A 5JS1A 4LF7K 4CGDA 1B70B 2APOA 3MR2A 3F9KA 4B8AB 2MY8A 5FDLA 1S9FA 3WIVA 3DRYA 2R7OA 2NXCA 3F56A 2V4RA 2PMHA 3BZQA 3D6FB 4HI1A 1FTCA 3T5HA 5AZJB 1Q9XA 2ABYA 1SJ4P 2IJNA 1Q1KA 3KTQA 1F5AA 4F3MA 4ZCMA 1OSCA 4K4UA 3KK3B 1NHUA 3BEXA 1YJNS 4QWBA 4W5OA 3CPWM 2MJNA 2Z2YB 3EGNA 1S0NA 3M6WA 2ZWHA 5JICA 2H5IB 1HPZB 3CDEA 2YNFB 4OIXA 5KFGA 4IQXA 1OH8A 4FM0A 4RWTA 2B0GA 3DLEB 1SJRA 3IR5B 1QVGR 4DV7K 3L8BA 1GEHA 3IAM9 1ACMB 1K47A 2HNZA 2QW9A 1R7IA 3MX2A 2ZH7A 5KFXA 2BACA 5LMNJ 3CVKA 3MM6A 5LSRA 3OFHA 1YVUA 4WCEL 4CJFA 4EMDA 4BR5A 1S0MA 1SJFA 2NUUG 3A1YG 3T19A 2YQ1A 4L72B 4PUOB 4CJEA 1Y5LB 2XO7A 1KRPA 4MKYA 4K25A 3ELHA 2GV1A 5J1EB 4J2AA 4CEOA 4GMKA 4NASA 4IKAA 5HLFA 3AJDA 1B0TA 3FMBA 5ETKA 1CJKA 4C97A 2D3O1 1KD1T 3OJSA 3TWZA 3R27A 2W2NP 3CGIA 3W2WA 3KFWX 1QJHA 4H0YB 4OL8A 1AA1B 4K4TA 4IOCQ 3JS6A 3W61A 3NWGA 4JHDB 3I56N 1RI7A 4A47A 3LAKA 1R8BA 2L48A 1YTAA 1RBRA 3N4PA 1SJ1A 2AJ4A 3WBZA 1HQUA 3LPUA 2LP4A 1GNKA 4H5NA 4LQ9A 2YJEA 3N4WA 4A8SA 1JJCB 3AA9A 2GZOA 3EWGA 1MA9B 3BPDA 4RLEA 3QIPB 3ZO7A 2OUGA 1RCXB 1BQMA 4XIUA 5AQLA 2VICA 4HH1A 5JJBA 4O4RA 1R0BG 2JOQA 3QAUA 3PFEA 3C16B 4USWA 4CHOA 4U7CA 3SFUA 2IVMA 1N34J 2BKNA 2KZMA 4CLYA 4MLEA 3ZTPA 2CJYB 3P5JA 3NCRA 1XC3A 4K43A 1FNOA 5CE3A 3A12A 1N6QA 4FPRA 3H42A 4QS7A 4HTUA 1NDCA 2QWOA 5AE2A 3MPDA 4JI6K 1R0AA 5M2PA 2VASA 2ZBIA 3D5MA 1I3AA 2GIFA 2BMBA 4DR3K 3MAAA 1YHQN 1NGAA 1NJZA 3GILA 4LMZA 3AVFA 3JXOA 1UW9A 2O66A 2IIHA 3EXCX 1S77D 3O9RA 4BY9C 4JUZA 4GNIA 3CMAN 2RH3A 2QA4G 1WSEA 4Q2LA 5GADI 1S1VA 3CEDA 4ZVRB 1X5SA 4DV6J 3SMZA 4JK9A 2DGTA 4DU7A 3CCVS 1BL3A 4F4YA 5CCLA 1VRUA 2OD6A 2F65A 1U7LA 4KGVB 5C42A 1S1XA 2KL8A 1OH7A 4LQ3A 3KLVA 1XHXA 2R7RA 2C2MB 3VMFB 1FFWB 4DBQA 1YI2S 3G4SN 5KOXA 1SV5A 4OX9F 2GQCA 5IM0B 4WTOB 3GPAA 5EU7A 5I3UB 3TZWA 4U67L 3A8IA 1U2FA 4DTJA 1S4FA 4E7HA 2N4CA 1H0HB 1YITS 3D6TB 3L4QA 1CBKA 4EIAA 4Y65A 3OFFA 1MWKA 1Q4RA 4RW9B 3PW7A 4KHUA 1P9YA 2GVZA 3HFKA 3MN6A 1NJWA 2LDIA 4FWLA 2XM3A 4QPTA 2V9KA 3KG4A 1CLQA 3LDQA 3FFIA 2KU7A 2V51B 1Y7PA 3K8VA 3VQ6A 1YUWA 4QR1A 4I9QA 2WSEC 1S0OA 2VPYB 2HHTA 3N9UC 4J9RA 4ICLA 1SH2A 3TZXA 3U02A 4RUHA 1NJYA 1FE0A 5E41A 3L2QA 4BE1A 2I7PA 3MECB 5J2QA 3P45B 3V6JA 3UPFA 3ZZ0A 3I33A 4CWBA 4O4GB 5MAOA 4RNNA 2VIHA 3DYAA 5F8HA 4J9OA 4FKXA 3VGLA 5FPEA 3L0QA 3WIUA 4CM0A 3X3UA 4QIWD 2OAUA 4GY2B 4PKGA 1Q81O 2UU9K 2D4WA 1U24A 3RMCA 2ZDOA 1K9MO 1FJEB 3RB6A 4C48A 2IIRA 1NGHA 1JLAB 5CZ2A 5AQUA 3HVAA 1O8BA 4OI6A 2O8EB 1LWEA 4DTMA 3K9KA 3FZ2A 3MR7A 4DI6A 5KFUA 3JXUA 2UXBK 5FRMA 2DH8A 2X6SA 3V4IB 4NXMF 1NPRA 2K2PA 1VR6A 3PZPA 3D54A 4CLUA 4WIIA 1HL6A 5M1NA 4B9TA 2RU9A 4DV5F 1RDUA 1JX4A 3BP8A 2M8HA 5K8PA 3LZIA 3AVAA 4DKWA 1OS5A 2QLFB 1BDGA 4EBEA 4JD2B 3RJMB 3ZZPA 4B3SJ 4X64J 3FRYA 2BQUA 3AGKA 1F9EB 2HFSA 2CGLA 4NXNK 1S10A 3HI9A 3CCLS 2B56A 5BYRA 1JXBA 3KIOA 4I6YA 1NHVA 4ZVFA 2FJXA 3T1YF 2R3VA 5K8NA 3A5LC 5C0YA 1DURA 3MPVA 4Z37A 5KGWA 2JX2A 3SV3A 3NVMA 4N56A 3ZTOA 2CJAA 3MWPA 1IWGA 3M8WA 3DDNA 3C7NA 1FXDA 4QW8A 1APSA 4N8NA 3WQUA 1NDKA 3TEGA 2VG7A 2HRUA 2LQ5A 2KH9A 3D67A 5HL7Q 5AE3A 4IUFA 4FW2A 1LNQA 4H4KA 2BQ3A 4FK2A 4ZPTR 4OPAA 1XIQA 3NGKA 3VN5A 2ASOA 2J9EA 2XYPB 4YFUA 3ZZOA 3CC2S 3EEQA 3I0RB 4BRKA 1KC8O 4DN9A 4QZVB 3W5ZA 3D0PA 2YH0A 1GT8A 3MD3A 5KT3A 4CZMA 2AHOB 1BCMA 4E89A 4MK7A 2DD8S 4LR8A 3G0ZA 1KVIA 4FBTA 4KQZA 1SC6A 3KKRA 3T1AA 3PRDA 1TYQB 1YKWA 4XTTA 4QPXA 5IT9O 5KT7A 3NGDA 1SBRA 1RKIA 2FZCB 4UOFA 3ZZUA 3DN9A 4W98A 4KH1B 4NEYA 1OJ4A 1B64A 4J9LA 3BZCA 1T7PA 3THWB 2KLAA 3GG4A 1S9GB 1XR6A 2FB0A 4IBNA 4DS4A 4DR6F 1X4DA 4BRIA 3TAMA 2DR8A 2JLGA 1RT6A 3L2RA 2YNGA 2D41A 4DR4F 2AJFE 3H20A 1CJTB 5D77A 2MKKA 7AT1B 4L3QA 2G1HA 3BSOA 2P9IA 3Q0AA 1VBYA 2IRXA 4C9DA 3R8YA 5CQGA 2B7BB 4IOAQ 1MSWD 3GJTB 3RB3A 2H5EA 3C65A 2FQQB 3GFXA 4PG6A 4ZIWA 4OV1A 2CJKA 2VGMA 3MN7A 4LFBF 4LF9K 3GQCA 3KWGA 4FZXC 1H73A 4V19J 4C11A 1UVLA 2XI3A 5LL6Z 4DV3K 4KC5A 4FP9A 5A6WA 4ITSA 1U2CA 3MUMP 4OV6A 3UW1A 2B8PA 1UVMA 4UOHA 4X66J 2FIUA 2CG4A 3K2PA 1RTHA 4YDUA 3ZT3A 3QSYB 1Y5NB 4ZVPB 5KFKA 1WAFA 2W8KA 1NJIO 1H2UX 1WOOA 4JI3F 4IDKB 4HTJA 3BUZB 2B4OA 2O8FB 1KVBA 1MMDA 3MEGB 1OH6A 1T05B 5BR8F 1C4CA 3R6MA 4H4MA 4Y3CA 4Y2MA 4GKJK 1IBLK 2UYTA 3A8JA 3UKRA 2ZC4A 1YJUA 2XI2A 4KH4A 3CC7S 2P5OA 3TO8A 5IT9U 1Q8BA 1UFLA 3FQLA 4QYRA 4HTIA 3K2YA 2HFNA 2V6AA 2R2SA 1TL7B 2X1AA 1GLJO 3POTA 2QEXS 2UXCK 4C0OC 3OHRA 2YH1A 3PCOB 5CAAA 3G6YA 1VYAA 1WTFA 3GWCA 3ISZA 4Q45A 4WK3A 5B0GA 3UR0A 1QD1A 1SZ2A 3BPSP 3DLRA 1BHLA 2GWKA 4ELTA 4JI2J 3E3XA 3O3LA 3TEHB 4ZP9A 3ENBA 2YWWA 1ZBUA 4F7VA 1J5EF 4IKFA 3QGHA 3G87A 1HR0K 1JJ2R 3KHHA 5M2UA 2OTJS 1B0PA 4WU2A 3E51A 5HROA 4ILJA 1HNIB 4NB4A 2JWKA 2DFHA 3G6XA 4WKRA 1EETB 4XH5A 3OXLA 3C6UB 4KV8B 1V6HA 2GHPA 2VJVA 1DKGD 2CZ9A 2QLWA 2XY8A 2WBMA 2KM8C 2XLJA 2QA4S 4IEIA 4K8RA 5LJWA 2VC0A 4J9UE 3VTHA 1YT3A 2J0SD 1MN9A 3CCJN 4B3OB 1JLQA 3GZ7A 1R43A 4BHQA 4CZKA 2ZJQL 1CZ9A 3AAPA 2YX7A 3MMBB 4URGA 3W2VA 2OFGX 1T02A 3FFKB 1Z05A 3PSFA 5T14A 3OS1A 3IG1A 4QIGA 2A2DA 2X7IA 5ELZA 1RA6A 2VBYA 3M2RB 4QAGA 1JQGA 3HFZB 5KG1A 4A59A 3GIMA 3CCZA 3KDNA 4UT4A 3V9XA 1XMQK 4RU9A 1DTQA 1VI7A 3O44A 4B3TJ 4USMA 2WFBA 4LF5K 2Z57B 3ZYYX 3K5LA 3CSKA 2XEXA 2R7WA 4ZCKA 1RNHA 3NP5A 1JLBB 3MDFA 2Z1GA 1T94A 4TNOA 3GV5B 4LY7A 2R7XA 2FJAB 1OY6A 1DTTA 5IT0A 2F4VF 4MO5A 3H5YA 2YKNB 3D6MB 4NYPA 4O8KA 3MR5A 3P6YC 3K17A 4JKDA 1HBOA 4GKKF 2KYXA 5K5MA 4UTGA 3GE1A 3QMLA 3MEDB 1REVB 3KOAA 1GXUA 3KHLA 2C3MA 1KXPA 1PO6A 2J6SA 1D0EA 5FPMA 4UY8O 2V5HG 4J9PA 4BE0A 4JYAK 5JVHL 4M3RA 1C0FA 1HHTP 1S6QA 2Z1JA 4RW7B 1FJCA 3JQMA 3PX0A 1FKAF 3LA0A 1YLXA 1WC4A 4DSEA 2OMLA 4JI4K 5AFUA 3MWTA 2DGOA 3UCGA 1FDNA 4CT9A 3VQQA 3SCJE 2A10A 3DM2A 2HZAA 4B17A 3SCXA 4B8CA 1F3VA 1EP4A 1IM6A 2E7VA 1UETA 4QOZB 4KI6A 4K8XA 3FGUA 5KPTA 2C2ZB 5F3ZA 2RN2A 1VQ7S 2CNLB 3HSJA 2E9TA 4OLOA 4YMEA 2U1AA 3G2XA 3TUIC 3RRHA 1Q81T 4IR1A 1R59O 1HNWJ 3R5DA 2HBZB 3OL8A 3K57A 5AQYA 5BREA 2DR7A 1XQIA 1PJ7A 2UUTA 3V2UC 4K5SA 3WUHA 2X1FA 4OPKA 1C2PA 2OHDA 1TKZA 2GUPA 2OJ3A 4CIEA 3M6VA 4DR7J 4YDUC 1KWMA 3DXMB 1X31C 4RZRA 1HI1A 5M1KA 4PWDA 2DGXA 6AT1B 3HOSA 1TKTA 3D1OA 3HSCA 3UQSA 5KG7A 1ZZNA 3CDWA 3SQGA 4YUDA 2Z8QA 3OUYB 4L3NA 2C3YA 1X0FA 2DHGA 4LF8J 2HGMA 3LP1B 3M6UA 1TUVA 3PR5B 4DUYK 4H8KA 3QFHA 2FBTA 2JVRA 3THYA 1XNRF 2KJWA 2BH1A 3PO5A 4DV6K 1S12A 5AQFA 4CK3A 1F1BB 5LY3A 3PKYA 4FYYB 1CXQA 1T0TV 2L9NA 3SJHA 2X6NA 4CFCA 2B3TB 3HHNB 4BRGA 2DNPA 2UV8G 1RBUA 2WRMA 4FNIA 2W24A 1HNXJ 4M94A 2Z1HA 3LGMA 1FESA 3BGOP 3FSXA 2DR6A 3EE3A 4CLFA 3VQCA 4ED2A 5E3CA 3R2CJ 3CFPA 2KM8B 1R8AA 3CJ4A 2HNDB 1HWUA 2VZ9A 3GYNA 3R8EA 1KAYA 1HNZJ 4NRUA 2ASYA 1RDCA 1W7AA 1WHYA 2NRWA 4CJVA 4Y00A 4CJLA 3FR0A 2CNOB 1UZHA 2DO0A 1N33K 1ROFA 3QWPA 2VWJA 2R7SA 1K6YA 2DHXA 5DDOC 4CGFA 2QFJA 2FF3B 3JQKA 1WG5A 3TA0A 4Z0UA 2IVNA 3BM7A 2HEKA 2K1RB 1TV6A 3DHWC 4EU0A 2BKPA 2VG5A 1R3NA 1FJGK 2QI2A 4OI2A 1CS4B 5EGYA 3TJ9A 4NOHA 2VU5A 1G2EA 1LW0A 1KP6A 3K0SA 5M1OA 4TYAA 4DN0A 2JEJA 3NLCA 1HYVA 4PL8A 5A0YB 2WTFA 2QKBA 1QSYA 2CYYA 1U1QA 5LT5A 2KFYA 3X1LB 1RWUA 4M63C 4DX6A 4I6MB 3PEJA 4CJTA 1G6BA 3M32A 4TN2A 4FF2A 4E3SA 2QLXA 3SFGA 3H1QA 2MZ1A 4OYPA 2DNOA 5CXTA 5AZIB 2B43A 2XB2D 4XDDA 2D69A 2A6AA 3KK1A 1FKOB 3CE8A 1DBDA 2QL9B 2VDHA 3J80U 4JKFA 3M5RA 3ID6A 2RILA 1NUEA 2WHOA 2QMXA 5A8KB 3SK3A 4FLWA 2N7YA 1Y4ZB 1W2IA 2HVDA 3QYYA 3QDKA 5HRSA 4W92B 4C98A 2IVYA 2LSNA 3VQSA 3F73A 1CQMA 2VF3A 3TVZA 1SVDA 4OGCA 4LR9A 4ECQA 4E7IA 2UUBK 4AUKA 3GONA 3D2EA 1U6ZA 2V2QA 4GV9A 1RUSA 4ID1A 4QQBA 2FLOA 1S49A 3OVBA 3R7NB 2OSRA 1KAXA 2J0QD 1QE1B 4FZZA 4WYWA 3HKWA 2QIFA 4M7YA 1M90O 2O1PA 4RNHA 3OS0A 1JKHB 3WX4A 2FJBB 4DTUA 3ZEUA 3H08A 3JSRA 4H5VA 1C4AA 3LH2S 1TAUA 2QLBB 2RMLA 1KEKA 2UUWA 3ITHB 2H4YB 2ZH2A 3EKUA 4BREA 2YWEA 2XYHB 4IXCA 1FDBA 1GX5A 5JLFA 2E8AA 4ZDNA 5BRHA 1X4FA 4O3RA 3W8PA 2NR0A 1DGKN 3VQEA 4IYQA 2JL9A 2UXDJ 1IBKJ 1LKZA 2DIVA 1X5TA 5DM7L 3VAKA 1MW7A 3HO1A 3C46A 4AQYK 4O0JA 1VLOA 1ZAWA 4GVMA 1TL1A 3OD2A 1Q53A 3QO9B 3AO1A 2HSTA 4DV1J 3R5JB 3RW6A 2P9SA 3DLGB 1PYSB 4G9ZA 3RAQA 1U1OA 2YI1A 5AQZA 1X8DA 4JP8A 3CJCA 1RHJB 3KMQA 1IXKA 4P2MA 2UXBF 4LFAK 1BG3A 5IV3A 4P72A 4DV4J 2DKOB 4KGKA 1RWXB 3JTOA 1T3OA 2KRRA 4CH0S 3DLBA 4ZLLA 4NMLA 3A8YA 3RB4A 1XMOJ 1BMQB 2RQKA 2C2EA 2D74B 1DFDA 5KT2A 1DT9A 4OKEA 5ETRA 3FSIA 3AVKA 5D4LA 3RB0A 2D0OA 2P9PA 1S6OA 3MMCA 3B6PA 2Q66A 2DO4A 2QFIA 2VYPA 2OPQB 1TP7A 2PI5A 4F9OA 1V3RA 3H5SA 1OQ3A 2HHHK 3IGVA 4FJHA 4NYOA 3M8ZA 3CETA 4K50A 1FRIA 4LBIA 1ZBTA 3CCQS 4C8ZA 2Q6CA 3CC4S 3TJAA 3TSUA 2CJXB 2MSSA 1WC0A 2PAVA 3CCRN 3W65A 4DFMA 3A2FA 4BDPA 5I9EB 1HKCA 4K42A 1PJ5A 4C0HA 3IBWA 1SCJB 3ZETB 2O8BA 3WXKA 3CJ9A 4NX9A 2P8IA 5BYQA 3TWHA 4P6QA 3G82B 2NNWA 5FRNA 2HFUA 1FXXA 2QXFA 3IN5A 3CTRA 2QK9A 1WC5A 3LL3A 5LJVA 1ZM4A 2DRAA 3CXCR 2C3PA 1JWWA 5HP1A 3QAEA 1BWVA 1OSDA 2FHJA 4JI5F 4ZK7M 4K4ZA 4UY85 1JNZB 3EGWB 2CQBA 1HBNA 3M1VB 2HK2A 3FBBA 4R79A 4BRAA 3TAGA 3KLEA 3FBEA 4CQ1A 1FFGB 3IS9A 4CEZA 2W41A 1IKYA 3MM8A 3UD4P 1RSCA 5C25B 1N0UA 2MYFA 4CZLA 2F8HA 1K1SA 5IXUA 3K0JA 4K0KK 2RF2B 4BRDA 4CM2A 1VSMA 2OKQA 3HHLA 1WC3A 5JMVA 4DL2A 4B3RJ 4RKUC 3BGLA 5EX3A 3CW2C 4CW7B 4N77A 3CIPA 5DK5A 1HMVA 3EICA 4Y2IA 2V4JB 1U2VB 3PV8A 3TTFA 3CCUN 4H4OA 3HSDA 4CF1A 1K73O 4C6AA 4FDFA 2WONA 2W7OA 3KLGA 2ADBA 2ZHOA 1D9AA 4BR4A 4EP4A 1PIEA 5K14A 4HCBA 4R5PA 4FK4A 2LLZA 4LF9F 4M3UA 1OYEA 4O3SA 2MZRA 4HDGA 4MKVA 3OYBA 2DNNA 3CJKA 4F2SA 4DV3F 4BACA 3OSPA 2E20A 2JC1A 2DVIA 4JKHA 1HHSA 1BQNB 3SUNA 2C2NA 1YZ6A 1X4AA 2HAFA 4P75A 4Q7AA 2PMZD 3TQ1A 4LRCA 2BANB 1WD6A 2PA8D 1BISA 4K4YA 3JTNA 3CD5A 4IOXA 5CYMA 1B4SA 2XY7A 1F6TA 1HJOA 1U04A 3KHYA 2QC3A 3WQTA 4TY8B 3KJVA 4KGZB 4OJ3A 3OPKA 3ISNC 3TYTA 2V4QA 1WHXA 5B0CA 3NE6A 2H5JB 3UR3C 5E3QA 3N4QA 3GLJA 1D8YA 2AD9A 3NGUA 1ZBLA 2V8HA 4CD3A 4O8UA 2BDPA 5THWA 3V1OA 3OV7A 4YOTA 4Z7CA 1O0PA 3KK2A 2UXCF 1CC7A 5GVQA 3MXJA 3IR7B 2OEJA 2OTLS 5KOWA 1XNQK 4JKGA 4OI0A 3RAXA 3B4MA 5GIPA 4K8ZA 3CJ0A 4DB3A 3PDNA 3CFRA 1KONA 2RD5C 1JLCA 3NCIA 4ED0A 4QW9A 1X5PA 4ES2A 2EXUA 3BBFA 4WE1B 4PL7A 5CZ1A 2B9XA 1B9FA 1SB6A 4YHHF 3A8KA 4Y34A 1UCNA 3NNHA 4I2PB 3DGPB 1U02A 3CHWA 3PKMA 2BE2B 4LT6A 2LQJA 3O8MA 3EPIA 3I87A 2KZZA 1RT2A 1H98A 2DH9A 4IG0A 4FJIA 1NXIA 4HLBA 2QV6A 3HK2A 2CPFA 4CLZA 2AGPA 1K44A 1RTDB 2JLFA 3WXIA 5AQXA 3KLFA 2MQPA 4NA2A 4U8YA 4LRBA 2Y9HA 4BR0A 3AJ2A 4P2XA 3G6VA 4YB1P 1NGGA 5F9NA 2ASJA 3OL6A 3G6EN 3Q2SC 3CPWR 2D3ZA 3FGVA 3CDAA 4I7FB 2V2ZA 3T3FA 5IT9Y 2VV5A 4HEA9 4ZOSA 3R1LA 2K7KA 1VQKS 4AL7A 5IZHA 1YWXA 1NK8A 2J7KA 1H74A 1EWRA 2HB5A 3Q24A 3ET6B 3SUOA 1XMQF 4K4VA 3UD5A 2VOOA 3Q23A 3F44A 2VDIA 4Z7YA 3UKUA 4ZVSB 3LDNA 4LF5F 1VQNN 3V6DB 5IS2A 4FPIA 1U49A 3M8YA 2QYCA 2I2YA 1HRHA 3IUCA 2W4DA 1WC6A 2XTJP 3QBXA 2OIHA 3U7JA 2HFZA 2L9WA 3BJYA 3IRXA 4H0OA 2P9UA 4DWIA 3GIRA 5FDLB 3D6HB 4U7UK 3FZHA 4DLEA 3QETA 4W5TA 1SKUB 2CH6A 2EWSA 1S1WB 3SBMA 2NREA 4JS4A 4Z4HA 4RW8A 2IC3B 1FX4A 4ILLA 1WORA 1O13A 4JYAF 4BR2A 4CI6A 1CC8A 1ASWA 4CVNE 2Y1JA 1YJ7A 3UD3P 2DTUA 4EO6A 4JI4F 2NLWA 5IC6B 1V5VA 3AXKA 1TUWA 3VEZA 1VIOA 2ILYA 1VQLS 4FKYA 2E7WA 1RKJA 2VQFJ 3TX8A 1NO8A 2J5AA 3P4UB 3CDBA 1ULRA 2J8SA 1HI0P 5KFRA 3H1VX 1RT5B 3QMQA 4BC9A 1Y3JA 4H0VB 2IOCA 2HNZB 2Q1NA 3AVGA 5AQGA 4TXSA 2NRHA 4AXIA 2DRDA 1PG5B 5E0OA 3MM6B 5BRDA 5KFBA 1N34F 3KLIA 3QRQA 3CB4A 3W9HA 1PAUB 1WI8A 2BM0A 3BDEA 1U4BA 2X74A 2E1CA 4HVJA 3BBBA 5D0RA 2CKWA 5HLFB 1VK8A 1CJKB 2ZWPA 2YHYA 4C3KA 1QUPA 2B9YA 3OR1B 2P9LA 1VQ6N 3M9NB 1T9VA 4FJ7A 1AFJA 2ASPA 4MYTA 4WQ5A 2IMWP 1WEXA 1HD0A 3FZKA 3D4JA 3FE1A 4DV6F 2GQ2A 4A8MP 3WXJA 3W1YC 1HQUB 4KHQA 3EUNA 4EYHB 4WQ4A 1YTYA 1GLEG 1HHQA 3QNNA 1VQMS 3E01B 5C10A 2G8FA 4CJQA 3DNCA 4UUWA 4W5NA 1BQMB 3DCAA 4DXLA 2YHAA 2E5GA 2QG9B 2KVQE 3A3PB 2BKOA 4QCLA 2PSZA 2XLIA 5H1SQ 2KKHA 5AQKA 3CCES 2MKHA 3V9WA 1T6CA 4JKEA 4R0JA 2KFZA 3TSPA 3MEEB 1GXTA 3S41A 1VSDA 1H7WA 1N6QB 1X4EA 4NA1A 1NH7A 1WB9A 1R0AB 1S6PA 1IM4A 2IYGA 2FLPA 3PRVA 3SPZA 3MAAB 2O4GA 1N33F 3R1HA 1NGEA 1TELA 2C28A 2OMOA 4JBCA 1DARA 5A76A 4BRFA 2W42A 3TUJC 3FCWA 3VR1A 3SDEB 3G10A 3OXFA 4GVBA 4CO5A 3SIPB 3V81B 3GB0A 5KFIA 1S1VB 3IAS9 5JVGL 1WSGA 1VRUB 2CAJA 3OVAA 2MHNA 2HBJA 1S1XB 2XY5A 2IA6A 2AP1A 4JI3J 5JUMA 4Y2CA 1Z26A 2UXDK 4XPEA 3UN3A 4M45A 2LA4A 4ZP7A 2P9GA 1A6LA 1VQYA 5EX0A 2HBKA 3NWRA 2IFXA 3PVXA 2D3UA 4Y0WA 2H51B 2YWHA 4DV0J 2Y1RI 3LALA 4NPOA 2C2OB 3DWLA 3QLHA 4A4JA 4WTYA 4M3YA 3DAWA 3TU5A 4NLRA 3SMSA 1FKPA 2HBMA 1N32J 2GVZB 3WXLA 2CADA 3QGGA 3PTWA 1RAJA 4N5SA 2GV9A 3WT0A 4E1MA 5KT5A 3IFEA 1VQOS 4AYBD 4DV4K 2C2DA 3AD7C 3M9OB 5LJ3Y 4LFCK 1SH3A 1RE1B 1XMOK 1M5VC 3J7ZT 3TOQA 3C6TB 1VOMA 4OGEA 2QWLA 1XTZA 3AY0A 5J2QB 2HBRB 5H1SV 3VQ4A 4JI7J 2ZEJA 4ES3A 3CUNA 4CBXA 4B3SF 4X64F 1CJVA 2KT2A 4ED8A 4F0KA 3BKUA 2UUBF 4F02A 2O3DA 4JI8J 1RAEB 1J54A 1RBAA 2I7NA 4M5MA 3RR7A 1WOPA 1PC5A 2XZWA 4GVLA 3O3HA 4DQ8A 4DR5K 4NE9C 3DKDA 4E0DA 3WX8A 3PNIA 3ZTRA 5LMUJ 4E7LA 1IH7A 1HI8A 4J37A 2IDOA 3LP3A 1HYZA 4CHQA 5HATA 3M1FA 2BZ2A 2QN6B 4M5GA 3L09A 1LWEB 2GIRA 3ETOA 2W25A 5E3AA 3Q8VA 1S76D 4BWMA 3WHIA 3FZBA 1S9EA 3ENWA 4CZJA 3CJSA 2V7ZA 2AX0A 3D0IE 2XNRA 3J80Y 2VGNA 4FVMA 1NDPA 4B1UB 1GLBG 3Q83A 4A8XA 3HCXA 2FVCA 4DTSA 2HVEA 2GHWA 3ZSQA 1FWPA 4FS2A 2QRRA 4JI1J 4C7QA 4P2SA 1FFSB 4WYBA 3SI8A 3DRRB 4KH0B 4KHYA 5FIIA 3W3DA 4EI2A 3DFEA 1QAJA 4W5RA 4IFYB 3EPGA 3CMEN 3QQCD 2YNHA 3SQ4A 3GOIA 1JLGA 3PJXA 1SH0A 1KN6A 1N5YA 2B6AA 2P6TA 1AYEA 2VG6B 1RWWB 4P71A 2C3OA 2HKEA 4FWOA 3N0VA 3NS5A 1CG2A 5JMNA 4B3RK 1FRKA 3KUEA 2XMWA 3TQEA 2CXEA 1HYSB 1RBVA 1NKCA 2V34A 4AM6A 4DX5A 3R3TA 3G71S 4AL5A 2NRRA 1S72N 2A6MA 3EDQB 3C7NB 1RBLA 3CO0P 5HQLA 4CZHA 3K7RA 2ZDPA 2VG7B 1ELOA 2V7YA 4LF7J 5KFFA 4ZN3A 1SXLA 4KTWA 2B7CB 1IKVB 4JKBA 3HVWA 4K4SA 8ATCB 4H5TA 2GX9A 2PIIA 5KG2A 3MUTP 5GAHU 5D78A 2OPRA 3NVKA 4P2FA 1NJXA 2CGJA 3LM2A 2DJWA 4PYDA 4U7BA 5ETTA 4U96A 2W01A 1W97L 3KG0A 2OA8A 4O44A 2YNIA 3AVJA 4X66F 4JOUA 4I67A 3KYLA 1OVYA 2X1GA 4ECVA 2DPNA 4MDBA 4BQLA 5KFSA 3OBIA 4RNOA 5JS2A 2AT1B 4C8LA 2R2UA 4DDFA 1I3OB 3RAMA 1OMSA 4LF6K 4DV7J 1PYTA 5FJ4A 3M8RA 5F0UA 3O3FA 1NOZA 5LXYA 1P6TA 2G1DA 1U0SA 4NZ7A 2Z58B 2O8CB 3TAMB 3AV9A 2DR5A 4BG8A 1RT6B 2XWYA 3CIMA 1U6BA 2HHWA 1AT1B 4OI1A 2A42A 1K0TA 2PY5A 2DNHA 1M5PC 2RDJA 1BWEA 3K5NA 2P9IB 3Q7CA 3S8SA 2HQFA 3EMTA 4IG3A 5EWEA 2UVRA 2HHVA 1A5XA 1P8GA 1X4CA 5GAEU 2IBKA 2D0AA 1YBUA 4C11B 5GAHI 1UKUA 2BX6A 1NDLA 3PX6A 2FHJD 4JI2F 2CZ4A 1R6VA 3AQOA 1WSJA 2QWQA 3E1YA 2NRTA 1RTHB 1KVCA 3RMDA 1KCFA 1BCOA 4CZCA 4OKKA 5AQIA 1LWCA 3M6GA 5C5JA 2A3ZA 3WC0A 4A8WA 3L6QA 1LEOA 2ATCB 4B02A 4H4MB 4OZ1A 2MKIA 4L8RB 4YR3A 3HHLD 4M5NA 1REGX 1NLKL 4X4VA 3CJTA 4QU6A 3UKRB 2KHOA 2D7SA 5BXIA 1F9FA 2CQCA 2XZTB 4CF0A 5A8RA 3CWJA 3Q8YA 3C15B 5EUHA 1N5QA 3POTB 2CQ2A 3QZ8A 3R6LB 5AZJA 4JI6J 1LXJA 2GIQA 2PBDA 2YKPA 3LF0A 5J1NA 3VETA 1XMBA 3R7SB 4DR3J 3R1XA 4USTA 4F4ZA 1Y0HA 1UAWA 1RDRA 1L3TA 4B3TF 1QM9A 2GAGC 3QBWA 2XHCA 4FWSA 2OP5A 1M0SA 4KE5A 1WUUA 4NEZA 5IWAK 2ZBRA 3A0IX 3FEYB 3FC9A 3HL8A 1UWBB 3VQ8A 4ZTJA 1ZH5A 4KPYA 3T69A 2DFEA 1GTHA 3SI6A 5HROB 2JHEA 4XK8C 1BOTO 4BDZA 1NEEA 1Q8IA 2ZM6J 5FD1A 1X9JA 3VQDA 5HN0A 1QVFM 4LF4K 1WKKA 2FLLA 2J76E 3N6MA 2AJ2A 3GL1A 2NRZA 5AR0A 3B4DA 1Q95G 1HJRA 2CIMA 1RT4A 4PXDA 1IVZA 1TAQA 1UL3A 2KDOA 4ILMA 1RDDA 1RK8A 3D0HE 1M1GA 1P9QC 4RO0A 1JLQB 4DF8A 4FWRA 3CCSS 2RKIA 2N7CA 5DG9A 2W2QP 1ASUA 5BN8A 3W2VB 2CWKA 5F1XA 4UUXA 1NLVA 3E2EA 3MZIA 4A8QA 3IG1B 3TAFA 4JV5K 4PG5A 1O5JA 1O1WA 5A6PA 5FROA 3I96A 1UFKA 4B1ZA 2QMWA 5L9NA 2IBOA 1U2RA 4KB1A 4FZVA 3P1GA 1VMBA 3PACA 1HKAA 3L4IA 4HHTA 1C0TA 3DOKA 1RHMB 5ITHA 2X78A 2Z2MA 5DQIA 4ENOA 4ED3A 2RVJA 4KFBA 4EZ6A 1QVGM 1G1XA 1FT8A 2RS8A 3H3OB 1K8KA 4DR7F 4FPAA 3K59A 8RUCA 3VA3A 4WFNL 4IR9A 3VQ7A 1NKEA 3C16A 4DFJA 4Z4GA 2XYGB 4TKTA 3GIIA 2UU9J 1WEZA 1GOCA 3L95X 1U0HA 2MKSA 1WN7A 4F3TA 2DY4A 2UUCK 2E5LK 4CD1A 3AH6A 4Z2XA 4EFHA 5DM6L 1XERA 3EE8A 2D1CA 2NZTA 4DSKA 1YRTA 3H4BA 2FPHX 3U1NA 3T6JA 1NB2A 2BA9A 3DDIA 5DMRA 3L9ZA 1BC6A 2BEFA 1HNXF 3O5BA 4I6AA 3W62A 3W3SA 3TVKA 5BN9A 3AVLA 2Q6BA 3QT6A 3IMXA 4YN3B 1FK9A 5DGAA 5SWMA 2XS5A 5ETPA 4QR2A 1RTZA 3C14A 1TVRA 4X65K 4ANEA 4HACA 4MTPA 2FYXA 3OY9A 4Y0FA 2HS0A 2JZ5A 2V69A 3I56S 5B8HA 1OY9A 3QJLA 3HF5A 1TKZB 1HNZF 4NXNJ 2YPYA 4WBFA 4CIOA 3CD6N 2A3JA 2W7AA 1N8RT 4PAAA 4PWDB 2RHKA 1CZBA 3THXA 2W9CA 3N01A 1TGOA 3V9ZA 4DPXA 1X9MA 4LJMA 1TKTB 4USIA 4DR1K 1VIXA 4NLQA 1XJWB 1RHKB 1J2VA 2VL1A 2IHR1 3H3NO 3OXGA 2OELA 4LSZB 3VQ5A 3PW4A 4E2FB 3THYB 3S1TA 1KLMA 1LAWA 5D15A 3VQPA 3HXMA 4CJKA 4O55A 2M7SA 4BC3A 2R4FA 4YOEA 5DS7A 3CJ3A 4I6WA 2GJFA 2HK3A 2ILZA 2HHQA 1X7VA 3N5BA 4CK1A 3H4DA 1YHQS 5AQRA 1S57A 5E84A 3FZLA 4PA1A 2R42A 4OZ0A 3CMAS 3D9BA 2F1FA 4KRFA 3OS2A 1KDNA 1YF5L 3DOLB 4HTLA 1N32K 2YCHA 3MR6A 5DDPC 5DJBA 4CJ5A 5HMXA 1NSPA 4LSNA 4M7XA 2MKYA 2E6MA 1D3WA 5J2MA 4G1PA 4Z94A 2HNYA 3THTA 5EOYA 1RFQA 4E7JA 1WBDA 4RWWA 1R31A 4QWDA 3G4SS 2W2OP 2WBNA 4TU9A 5J2NA 4PEOA 1KNZA 4CZGA 5KFVA 3U27A 1TV6B 2OPPA 2IDEA 1SI9A 3HJVA 2VG5B 4JI7K 5E3PA 3MMVA 5GAGP 2DHHA 2JEGA 4LBPA 4AL6A 2DHSA 1LW0B 3IM9A 5KFJA 2FVSA 2QO3A 3HT3A 1Z25A 3M6XA 1O6XA 4TU7A 4C8OA 4GRSA 3H46O 1WF2A 4DV3J