3LAKA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-heterocycle pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Heterocyclic pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lakA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lakA05
4K8XA 2B6AB 3OL8A 2IA6A 5L1LA 4CEQA 4KAIA 3SV3A 3ISNC 4BACA 3V9XA 1C1CA 3AO5A 1VSJA 3VQCA 4JRPA 4DS5A 3VQ6A 4ED8A 1GOBA 1BHLA 4NLYA 2B4JA 4ZP9A 1KHVA 4RUCA 3KK3B 1RYRA 5KG7A 1XI1A 5JUMA 2HHUA 3TAQA 1A5XA 4ZVHA 2IC3A 2G8IA 4J2AA 3THVA 2R8KA 4DQPA 2IM0A 3L2UA 3IG1A 2VWJA 3BQ2A 2XWYA 2OPPB 2Z1GA 3OYMA 4CHOA 2KW4A 3LP2B 1RTHA 1VSFA 1JIHA 1SUQA 1S6QB 2FBTA 2YNGB 4RNFA 2XI3A 3KK1B 4EP5A 5KG5A 3C6UB 1GOCA 1YVUA 1G15A 4E7IA 3OS2A 3H4BA 3RMAA 3KKSA 3RB4A 5DMRA 5CY4A 4EBEA 3G6YA 3LZJA 4DWIA 2OZMA 3BDPA 3V4IA 4Z0UA 1NKCA 1J9AA 2ASLA 1QHTA 5KFTA 1NK6A 4RW6B 4DFMA 3NAIA 2QK9A 2AGOA 1RBVA 4K4YA 2IM3A 2XY7A 2WRMA 2OPRA 2HNDA 1L3VA 2EHGA 2C2DA 3PJXA 3IG1B 1C0UB 1IM4A 3HL8A 2W7PA 3I5BA 5KG2A 4TSXA 4XO0A 3HO1A 5KGWA 4LSLA 3TABA 3DOKA 3VQ8A 1SUQB 3H2LA 4R5PA 4NLQA 2VA2A 3QINA 4AHVA 3CDEA 2IBKA 4ECWA 1JLGA 3VA0A 4F4WA 3OS0A 4JUZA 3E01A 1KVAA 1RTIA 2FJWA 1JLEA 3MR3A 3BR9A 3H40A 4ID5A 5FRMA 3UPFA 1RDCA 2WHOA 4CJUA 3FQKA 3HP6A 3ULDA 1A5WA 2HMIA 4C8MA 4KI6A 1RT3A 4FM0A 4FJIA 3V4IB 3MR2A 2C2RA 2V9WA 4DTUA 4HCBA 4OPKA 3KKRA 2GIQA 1HNIA 1NHUA 3T19A 2JC1A 3DMJA 4OKKA 1FKOA 2ZD1A 1S1WB 3OLAA 3AVCA 2B43A 2OPRB 3GV8B 3HXMA 2XY8A 2HNDB 3JYTA 3HVRA 4FZXC 3DYAA 3ISND 4NLDA 4I9QA 4M3UA 1J5OA 5KFVA 4IFYA 1K1SA 1EETA 3MEGA 1TK5A 4KTZA 1RBTA 2P1JA 2YV0X 2WTFA 4LSLB 4KAZA 5KFDA 4ZHRA 2J6TA 3PZPA 2Y1JA 2V0NA 5KFYA 3RR7A 3SPYA 5C24A 4DL3A 4Q0BA 4B3OA 2UVRA 1C1AA 2FC0A 2RKIA 1S6PA 4FM1A 1JLGB 4XPEA 4YR2A 3AVFA 3NF7A 5F8GA 1CZ9A 1I6JA 1HQUB 4FJNA 4DSFA 3P5JA 1JLEB 5K14B 5J2MA 3MXJA 1JLBA 4I9LA 3QEWA 3IRXA 3CJ4A 1MU2A 2W42A 2WB4A 4NZ0A 3AV9A 1UA0A 1UOCA 4LH4A 5HP1A 1RT5A 3OYHA 2HMIB 3ZT2A 2XCPA 4CFAA 1TL1A 3AVNA 4Q43A 4CE9A 4IG0A 3NHGA 4CIGA 1HNIB 4CJVA 2XHBA 4DTMA 5EWEA 4M95A 1ZBHA 5KG4A 4J9LA 3DMJB 1FKOB 2ZD1B 4CECA 4ELVA 1LW2B 4O3NA 4LQ9A 3D28A 3M8PB 3I8DA 3SNNA 3DYAB 4I2QB 3L2VA 1EETB 4KO0A 3UDLA 4IBNA 4FJKA 4FZYA 3MEGB 4CGFA 3BSCA 3LWMA 5J2NA 4DL5A 4QCLA 4ZHRB 1BL3A 3NF8A 1VRUB 1U45A 4N5SA 3D0PA 4Q0BB 4B3OB 2AU0A 4RNMA 4J9SA 2R2UA 1VSIA 1HRHA 4FBTA 4EZ9A 3PW2A 4ZPAA 3H5YA 3K5NA 4DQRA 1QUVA 3SFUA 5DG8A 3AVMA 2FJVA 2IJNA 1MU2B 4LH5A 3RRHA 2YKNB 5FDLA 3GQCA 4ED6A 5HP1B 4CJLA 1RT5B 5EWFA 2BDPA 4NLXA 1TL1B 3KMQA 1VRTA 4EO6A 3QO9B 5HBMA 4IG0B 4FZZA 1JLAA 1JKHB 4UQGA 4DSLA 2HWIA 3WNHA 3CWJA 2G8UA 3OYGA 4F4KA 1U04A 5C42A 2VG7A 2E9RX 2XCAA 4BE0A 5D3GA 2W9CA 4E1NA 5KGXA 3SI8A 4B9NA 4GC7A 4Y2CA 1LW0A 4KSEB 4ECQA 2OPQA 4KO0B 4KHUA 4Z4GA 1S9FA 2W9BB 5J2NB 4B08A 2XC9A 2HVIA 2B5JA 3KHLA 3DRSB 2FLPA 4B9SA 1QSYA 2IGIA 4W5QA 1S4FA 5KFZA 2E6LA 5DLFA 2FVCA 3ZSZA 4FJMA 1W25A 2KQ2A 3C95A 3G0ZA 5KRSA 3HJFA 4ZVEA 4XIUA 4CJKA 2HHWA 1X9SA 1X9WA 5HLFA 1L3TA 3KK2A 4M3RA 4DL7A 3OSNA 3K5OA 3ALYA 3QEIA 5FDLB 5KFBA 1EX4A 1LWFA 3N6MA 3VQ5A 4KBIA 4HKQA 1JLAB 4CCHA 4NYZA 3QZ7A 1W0HA 1BQMA 1TL3A 4URGA 4J9RA 3KLHA 5KI6A 4ECTA 2OH2A 2VG7B 2DFFA 4ECVA 4BDZA 5D3GB 2W9CB 4FLWA 3GIMA 1NJWA 3U3YA 2ILYA 1LW0B 4ECRA 2OPQB 4FCYA 3RWUA 2HHTA 3S3NA 4B9UA 5DG7A 3AA4A 2FVRA 4KHRA 1TV6A 5L1KA 4FW2A 2D0BA 3ITHB 4URSA 5KT2A 2B5JB 4YQWA 4DQQA 1VSEA 4CJ3A 1KTQA 1D9FA 4K4VA 3LDSA 2RPIA 1ZYQA 3LP0A 4G1QA 3RBEA 3LP1B 2R2TA 3OYJA 4CEFA 3L8BA 3E51A 3NCIA 4MIAA 3OYEA 2G8VA 4PWDA 4O4GA 3LALA 2AJQA 2QXFA 5HLFB 4GMJB 2P5GA 4KFBA 4IOBA 4LD0A 3M9MB 1ZBFA 5KT5A 3MR6A 2AWZA 4ELTA 4NCGA 3SFGA 3VQPA 5CYMB 1XR7A 3NL0A 4OLBA 1LWFB 1UWBA 2KTQA 2ITGA 4ELUA 1N4LA 1UAXA 2ETJA 1TKDA 3GIJA 3QNOA 3G6VA 2HHXA 1GX5A 1CZBA 2G8FA 1SH0A 2DPJA 1S9EA 3KJVA 2FVQA 4CF8A 3VQSA 1BQMB 3V9WA 1TL3B 4M3XA 3BSNA 3NE6A 1DTTB 3CIZA 1S0OA 1XWLA 3S3OA 4J9OA 4ECUA 4CIFA 1BQNB 2YNIA 3SI6A 4DFKA 4NLGA 4F3OA 5KFIA 3KLVA 1Q9XA 4DSKA 1TV6B 1J53A 2AGQA 2R8IA 4CGIA 4F2SA 1LWCB 1WNSA 4QW8A 1W9HA 5HRSA 3LP0B 4HYKA 4E89A 4G1QB 4YNQA 4H4MA 1LAVA 4CEAA 3WNEA 2HVHA 4PWDB 4M42A 4BDYA 2YNHB 3AA3A 5KFCA 3O4NA 2E9ZA 4ZP7A 1JL1A 4CFDA 4K4SA 3QLHB 4NCGB 3VQBA 2ZE2A 1UWBB 4FK2A 2PZSA 5F9LA 3OVNA 4FJ5A 5JS2A 1S9EB 3KJVB 2XI2A 4ZMMA 2KFZA 2ASDA 2BGGA 4Q8EA 3ZCMA 3DLBA 3V9UA 3V9SA 1JL2A 1KFSA 5T14A 3OYFA 3U6FA 3RR8A 3KLIB 2WK4A 2FBYA 1L5UA 3SYZA 2ASJA 5KFFA 2I1RA 4IH6A 2RN2A 3V6KA 1XHXA 4N47A 2BE2A 2WONB 4DSJA 5KFRA 2PY5A 2JEJA 3KIOA 1FKPA 2BANB 4GW6A 4MH8A 4O3PA 3JSMB 2E4LA 3GV5B 4N56A 1VSKA 1JLQA 4ECSA 4MKAA 3OYKA 4KB7A 4OLAA 4BWMA 3QETA 3AO3A 4CJPA 2HNYA 4E7LA 4ED1A 3M8RA 4RW4B 3MECB 5HRNA 3AVIA 2KZMA 2BRKA 2ZE2B 1Q9YA 1N6QA 4C8NA 2HW3A 1NK8A 1GX6A 1Z4UA 1S9GB 1WSHA 4K8ZA 3HVTA 3V81A 5J2QA 1LWEA 5FROA 4WXOA 4JS4A 1O1WA 3PVXA 1TVRB 4HTUA 3RMDA 4K4UA 3TAMA 3NH2A 2VWKA 1SV5A 4DS4A 2D0CA 5DGAA 1XHZA 1RBUA 3DLEA 3CJ3A 5F8HA 5KFUA 2A1SA 4CK3A 1SL1A 1HYVA 4NLWA 3ZSXA 3BSOA 1WSIA 4FJ8A 4KB1A 1D1UA 1C1CB 1KVBA 2WCXA 1WN7A 4Z4CA 3OYIA 4QWBA 3NBPA 1JLQB 4JLHA 1HQEA 3L3UA 4XPCA 4OVLA 4OL8A 4ZTFA 1S1XA 1S0NA 2HNYB 3V1QA 3K57A 4RU9A 3QERA 4DSEA 2IC3B 4H8KA 5SWMA 1VK0A 4HUGA 3DLRA 3BGRA 1ITGA 3HHKA 2FVPA 4JV2A 1S1UA 3V81B 5J2QB 3D45A 2OZSA 2AQ4A 3O3HA 2HAIA 3LWLA 3KHHA 1RTHB 3TAMB 4AH9A 3ZSYA 4U6PA 1RT7A 2UVVA 3S3MA 4DU1A 5KG3A 2D7SA 4CEDA 3SZ2A 4DFPA 4BE1A 2G8KA 3DLGA 3H08A 4E7HA 1TGOA 3I5AA 1R0AA 4IH7A 3TAGA 2R8JA 4CGGA 4ZPDA 4CFBA 4IQXA 1QSSA 2R2RA 3CFOA 1C0TA 1XR5A 2IJFA 2ZQBA 3RTVA 3NBPB 4WE1A 4Y3CA 3KD1E 2HNZA 1HQEB 3MXMA 5F8LA 4Q45A 4TYAA 3VN5A 3DM2A 3DLHA 4KPYA 5F8MA 1S5JA 1ASUA 1NK4A 1XR6A 1HMVA 4FYDA 3DLKA 1RDDA 4YFUA 1N5YA 1BGXT 3IS9A 3K59A 3BGRB 4CJ5A 3WNFA 1TK8A 1S1UB 3PR4A 1KLMA 5I3UA 2R8GA 2XRIA 3NGYA 1NKBA 4ED0A 1U49A 5DG9A 3DOKB 3ICLA 4R5PB 3AVBA 1RT7B 1TKTA 3M8QA 4F4YA 3MR5A 1OS5A 2J6UA 4DTJA 1SKRA 4DLGA 4K4TA 4DU4A 4CESA 3GIKA 4IR1A 4FBUA 1QE1A 3E01B 1R0AB 1RTIB 1EKEA 3SUNA 4KHSA 3CQ8A 4CF0A 4ID5B 1HJRA 1RAJA 2X6SA 5KFAA 4JRQA 2E6MA 4QW9A 1RT3B 3OLBA 2JEFA 5EU7A 4J2DA 5KFSA 4WE1B 4DTRA 2F8EX 3QEVA 2JGUA 1FK9A 3O4QA 3VQ4A 3SPZA 4CEEA 4U7CA 4M3TA 1BI4A 1EXQA 3CJ0A 1ZBLA 3DLKB 3JYTB 1N5YB 3IS9B 1J5OB 4IFYB 3TVKA 4O0IA 3V6HA 1JX4A 4LQ3A 1JXEA 3D5MA 3NGDA 1NHVA 4GVMA 3KLEA 2C2EA 2AX1A 4H54A 4NCAA 5C24B 1TKTB 3M8QB 2RKIB 5HROA 3BQ0A 1S6PB 4I2PA 3AO4A 2D5RA 1HPZA 1QE1B 4W5NA 2QE5A 4QAGA 5J2MB 1NOZA 1JLBB 3IRXB 4ID1A 1S1TA 4O3QA 1YT3A 3NF9A 4FJLA 4B8CA 4DEZA 3MEDA 2BQ3A 4OGEA 3EY1A 3OS1A 5F8IA 5L1JA 3OYBA 4R8UA 2YKMA 1FK9B 4Y1CA 4WFXA 2DY4A 4F4ZA 4EP4A 1ZETA 4O0JA 3EZ5A 3LAMA 5CZ2A 1CXQA 3Q8QB 1D0EA 1BI4B 3OL9A 3OYLA 3QZ8A 3MXIA 4CGJA 1IKVA 4CJQA 1C0MA 4CJEA 5T7BA 1U48A 4WFZA 4J9NA 4YR0A 1JXLA 2P5OA 5KFJA 4YR3A 1T05A 3LPUA 3LP3A 1RCHA 4O3RA 3KLGA 2JLEA 2BR0A 1QSLA 3RB6A 1KRPA 5EUHA 3HP9A 1T03A 1FXXA 2Z1IA 4RW7A 2O5DA 1ASWA 5HROB 2A1RA 4I2PB 2X6NA 3NH1A 3V1RA 2C28A 1HPZB 1JLFA 4DF8A 3QESA 2LSNA 4PQUA 4Y2AA 3P1GA 1Z25A 1TKXA 3PX6A 3KNAA 1RDAA 3C94A 4URQU 3VA3A 2R8HA 1VRTB 3MEDB 5HBMB 4ECYA 4PY5A 4RW9A 2XY6A 4R8UB 2YKMB 3GIIA 4NYNA 4NLOA 2FJXA 3Q8SB 3O3GA 2CKWA 5C42B 4WZMA 2D3ZA 4TQSA 1WNEA 4DG1A 1RDBA 3CM6A 5KFPA 4I7FA 1IKVB 1J54A 1YTUA 1RNHA 1K6YA 2YHAA 1T05B 4RUAA 1DLOA 3AO1A 3RAQA 3KLGB 3OL6A 4Y1DA 1VSHA 1MMLA 2Z1HA 4ZTJA 4ZP8A 1XC9A 4F4XA 4M3YA 4DTNA 1RT2A 2Q3SA 4KREA 1T03B 4WZQA 2HB5A 4RW7B 3I5CA 4Q5VA 1VSDA 1DTQA 4Y34A 5L1IA 4FLXA 4IRKA 3SUPA 3NAEA 1JLFB 4PQUB 3H5UA 3K5MA 3K5LA 3QIPA 2IMWP 3KK2B 4BWJA 3NH0A 3S9HA 3LANA 1TKXB 4ZP6A 4PA1A 3PJWA 5SZTA 5KT7A 1QAIA 3OHAA 1SL0A 3FDSA 3OYCA 4B9MA 4NLUA 4J9KA 4CGHA 3T5LA 4WFYA 3PR5B 1YVFA 3ZSOA 4IDKA 1B9FA 4F50A 1ASVA 2XO7A 4DQIA 5C5JA 3KLHB 4KHYA 4TY9A 4CEBA 4W5RA 5HRRA 2IM1A 4KKOA 3VQ7A 3OYAA 4DU3A 4DG1B 4DQSA 1QQCA 3CO9A 4I7FB 3CFRA 4AHRA 1U47A 4OKJA 1DLOB 3PHEA 4IRDA 4AHUA 5F8NA 4CJTA 1KFDA 4RW8A 2JEIA 1RT2B 4OPJA 3NDKA 3UQSA 4CF1A 4B8AB 2F8SA 5FRNA 4IG3A 1S10A 1ZBIA 1LAWA 3HPOA 1IKYA 5C25A 3H98A 3CFPA 3QEPA 1WAJA 1VSLA 2G8HA 4O4GB 3FSIA 2NUBA 4FK0A 3MAQA 3QIPB 4KFBB 2C22A 2OA8A 3EYZA 1IO2A 1IG9A 3F9KA 4DTXA 4KE5A 4AHTA 4J9PA 4CERA 3BJYA 4O5BA 1TK0A 2XGPA 2XY5A 3KHRA 3M9NB 3PO5A 2AX0A 3RB0A 5I42A 5EDWA 2EC0A 4KHNA 4KKOB 3P83D 4G3IA 1C1BA 1QTMA 4KV8A 2YNIB 3SCXA 2GIRA 4DSIA 4TYBA 4M94A 4CJ4A 4E3SA 4KTQA 3KHGA 3QIOA 2PYJA 4MK9A 2VG5A 1SKSA 3MTKA 2I5JA 1CXUA 1N48A 4OJRA 3M8SA 1D9DA 4K50A 1S6QA 4RW8B 2FLNA 3DOLA 2QKBA 2UVWA 2HHSA 5KFQA 1JXBA 4H4MB 4ICLA 1NNDA 1IKYB 5KFKA 4Q44A 3KOAA 3AO2A 3T3FA 4WXWA 3F73A 5EWGA 2XGQA 1S1VA 4Z4HA 2IOCA 5DQIA 3OHBA 1WLJA 4DL2A 2ZKUA 1K1QA 4O3SA 4ZPBA 3EPIA 3TI0A 4KHQA 4RW6A 4CHNA 1RT6A 4CJRA 3ZSVA 1X9MA 4MIBA 5I42B 3U3GA 1EP4A 5DQGA 1C1BB 2ATQA 2IAJA 3I0RA 4OGCA 4TY8A 3BQ1A 2JEGA 4KV8B 4CEOA 1C0UA 2VA3A 3K2PA 4FLZA 1N56A 3EZUA 3EPGA 4FJ7A 5KFWA 3PW4A 3L2RA 2IDOA 5J2PA 2BE2B 4YMEA 3TAFA 4Z4IA 1NK9A 2VG5B 1LV5A 2O4GA 2I5JB 3H5SA 1NJYA 3PO4A 1FKPB 3T1AA 3PX0A 3MEEA 3C6TA 3DOLB 3SQ4A 2YNFA 3HSTB 1NK5A 4ZPCA 2F96A 4ICLB 4HUFA 1HNVA 3HVWA 1KLNA 1VSMA 3VQ9A 3PX4A 5JS1A 4KB0A 4HHTA 1S1VB 1WSFA 3SQ1A 1NK7A 4WYWA 3VQDA 4HUEA 3Q8RB 1N6QB 3RRGA 3LAKA 4FJGA 3NGIA 4TN2A 1BCOA 3T5JA 4O3OA 3HVTB 4O44A 4HCCA 1SKWA 1RT6B 4FLVA 3MFHA 1LWEB 3HPHA 4HVJA 3QNNA 1CSJA 4AHSA 1S1WA 2JC0A 4JS5A 4NLTA 2QV6A 3DDKA 1SV5B 1EP4B 3IN5A 4MFBA 4CF2A 4E7KA 2HHVA 3ZT0A 2IAJB 3I0RB 4TY8B 1RTDA 4FJHA 3DLEB 4TQRA 2DPIA 4CHYA 3NKYA 2D3UA 1NKEA 3GILA 1TAUA 3NMAA 2ALZA 2GC8A 5E41A 2W8KA 3FQLA 2Z1JA 4K4ZA 5J2PB 4E1MA 1QS4A 3K58A 4KI4A 4K4XA 4FLTA 2V4QA 4C8LA 4J9MA 3HK2A 3MEEB 3C6TB 4W5TA 1IKXA 1T7PA 3QIDA 3FFIA 4EO8A 1HARA 2YNFB 1HQUA 4N41A 2W9AA 4ECZA 1RTJA 3TAPA 1HNVB 1S1XB 5K14A 3OYDA 3KLFA 2UUTA 1RYSA 1BISA 4IR9A 4M41A 4B9LA 3PY8A 4CK1A 4CIEA 4QWAA 1TQLA 3PW0A 4CJFA 4DTPA 1TP7A 2RF2A 4O44B 4QWEA 3V6JA 4MK8A 3AVAA 2OPSA 2O4IA 1HYZA 3CDUA 4JV1A 4PUOA 1LW2A 5DGBA 1X1PA 2W7OA 4Z4FA 4Q8FA 3M8PA 4MFBB 4EBCA 3VQAA 2DTUA 1RBRA 4I2QA 3O3FA 4FM2A 1RTDB 2EX3A 4FS2A 3DLGB 1I39A 4BDPA 4TXSA 1ZTWA 2ILZA 2KZZA 3N6LA 4EYIB 3B6PA 1KSPA 1TKZA 3H5XA 1VRUA 3VQEA 1NJXA 2BQRA 4FVMA 1IKXB 4NLVA 1C0TB 5KFEA 1D5AA 3FFIB 1RT4A 4NCBA 3LZIA 2HNZB 5CYQA 1RTJB 4J2EA 4B9TA 4FJ9A 4TLRA 3AVGA 3SV4A 3DM2B 5DK5A 3ZT3A 3KLFB 3CYMA 3UIQA 5KG0A 2YKNA 4DL4A 4CF9A 1I3AA 5KFGA 4F8RA 1HMVB 4CGDA 4C8OA 3QO9A 1F21A 3TARA 4JV0A 2J6SA 4EEYA 2X78A 1JKHA 2RF2B 3Q8PB 4F3TA 3GV7B 2AGPA 1KLMB 5I3UB 1Z26A 2OPSB 3V1OA 3SQ0A 1UA1A 4PUOB 2RDJA 1WAFA 3PW5A 1NJZA 4ZVFA 3HKWA 1SH2A 2GV9A 4W5OA 3KD5E 1TAQA 3KTQA 2FVSA 2W9BA 2P51A 4NRUA 3SUQA 3DRSA 1TKZB 5L9XA 4NYFA 4J9QA 4M45A 3L3VA 1L3SA 3TANA 4M3ZA 3HT3A 3ZSRA 4CEZA 4QWCA 1RT4B 3ZSQA 3CM5A 5CYQB 4RG8A 5KFLA 4DTOA 3GYNA 3QGHA 4NLRA 3AVHA 3CJ2A 3RBDA 2D41A 3SUOA 3OL7A 3B6OA 4R0EA 1Y97A 4ZVGA 1YTAA 2Y1IA 5JXSA 3CG7A 1KHWA 4CHPA 4LY7A 3KLEB 4IKAA 1BIUA 4DL6A 2GBZA 2BQUA 3N6NA 3TAEA 2X74A 1S0MA 1T94A 5DLGA 3PW7A 3UR0A 2FLLA 3T5HA 4O55A 2GUIA 5KT4A 4NLPA 4E0DA 3ITHA 3QYYA 2ATLA 3MFIA 2VG6A 4ED7A 1S1TB 3RAXA 3OYNA 4NLSA 2HHQA 2FBVA 4K4WA 4DMNA 4FS1A 3LP1A 1NOYA 2UUWA 1GOAA 3CVKA 1KCFA 1B92A 1BIZA 1RILA 4B9VA 4QWDA 4FW1A 4KRFA 4O4RA 4QOZB 2UVUA 3V6DA 4KTWA 3QEXA 5KT6A 3ZT4A 1WSEA 2FBXA 1S48A 1REVA 4ED2A 5KFXA 1KVCA 3CJ5A 4X2BA 3NF6A 1JLCA 3CDWA 3NFAA 4N76A 5CYMA 3H4DA 1IH7A 5KTQA 4FK4A 5DQHA 2D0AA 3OY9A 5KFMA 4BE2A 4LSNA 3OJSA 1C2PA 1NK0A 4AHCA 1DTTA 3AA5X 2DFHA 4E7JA 3DI6A 3HPGA 1S49A 4H4OA 4DTSA 4KHWA 4M3WA 1BQNA 5J1EA 2E9TA 4IKFA 5KT3A 1A5VA 4CJSA 4OKEA 4RNHA 3PUFA 1C6VA 3G10A 1IKWA 1RT1A 3QGGA 1LWCA 2VG6B 3HVAA 2DFEA 4IRCA 4IFVA 4L8RB 4FLYA 3NAHA 2IS3A 3DRPA 2G8WA 1RA6A 1RDRA 3NGZA 3L2WA 4DLEA 3G86A 4E19A 4CHZA 1T3NA 2R2SA 3V6DB 4RW9B 3AVJA 4YP3A 4DFJA 2WOMA 2YNHA 3H59A 4FJJA 4CHQA 1REVB 3DRRA 3AA2A 1HYSA 3BREA 3QLHA 1JLCB 3G6XA 1Q8IA 2HWHA 3A2FA 1D8YA 3KMSA 2YHBA 2R7YA 4EYHB 1U4BA 3IGNA 1SL2A 3OSPA 1S97A 3I0SA 5HRPA 5F8JA 4LSNB 2IM2A 1SH3A 3SJJA 3RMBA 4J2BA 4KHMA 5KFHA 4WYLA 3T5KA 3V9ZA 2BRLA 2W8LA 4CJWA 3DI6B 3L2QA 3KLIA 4H4OB 4CK2A 2OYQA 4ECXA 4QPXA 3ZSWA 5J1EB 1DTQB 3M9OB 1RBSA 4DF4A 4FLUA 1CLQA 4MKBA 2B6AA 2CJQA 4CFCA 4AILC 4EZ6A 2WONA 3RB3A 1ZBUA 3VQQA 1IKWB 1RT1B 4RNOA 3IAYA 2BANA 4IFVB 4ED3A 3HM9A 2F8TA 5KG1A 3JSMA 3DRPB 4MQ3A 4C8KA 1WSJA 3ASMA 4FJXA 3QGIA 5KFNA 4RNNA 3KK3A 5KFOA 5CZ1A 3WNGA 4EBDA 3AVKA 4IDKB 3AVLA 2WOMB 4RZRA 3TR8A 5KRTA 3DRRB 4RW4A 3MECA 1HYSB 1T8EA 3TQ1A 3FRZA 1WSGA 2RDIA 3PV8A 3HYFA 3TWHA 4FXDA 1S9GA 3ZT1A 1B9DA 2KFNA 2OPPA 3I0SB 4GC6A 3IGVA 4NRTA 3LPTA 4F2RA 1QAJA 3SQ2A 3LP2A 1TVRA 1U09A 5F9NA 4IH5A 4Z4EA 4MK7A 1BCMA 2YNGA 1RA7A 3BSAA 2PYLA 2QKKA 5KG6A 3KK1A 4IG3B 3MF5A 3C6UA 1ZTTA 3OJUA 2V4RA 1L3UA 3RMCA 5C25B
chains in the Genus database with same CATH superfamily
4K8XA 3OL8A 3VZIA 5CYJA 3CPEA 3VOVA 5HATA 3LQVA 3V9XA 1C1CA 4O8UA 3AO5A 3GOIA 2G1DA 1GOBA 4U7UK 4JI0J 2ZH5A 2B4JA 4ZP9A 1R6YA 3W63A 5KG7A 2IYIA 1XI1A 3R7NB 5JUMA 1VJWA 1O0PA 5DETA 1NJIO 4J2AA 3HTVA 2QO3A 3L2UA 2J7KA 2OPPB 2Z1GA 2RNEA 3QFHA 2H9ZA 3LP2B 3GYGA 3J7ZT 4JI5K 1JIHA 4HVZA 4USMA 4B3RF 2ZBPA 4RNFA 1WHXA 3KK1B 3DXKA 5T7LA 4JI5J 4JI2K 1OY8A 2KU7A 1JB0C 3HSCA 3C14B 2VIHA 1T0TV 1BD6A 4CVNE 2J0SD 4C4WA 5FPMA 3M2UB 4OYXA 5CY4A 1DHMA 3G6YA 3THYB 2AKWB 1DAXA 1NKCA 3CJCA 2P9KB 3JQJA 3LTOA 5KFTA 4I1TA 1NK6A 1W2BM 4DFMA 4IOXA 1LQ9A 3FCHA 2FZGB 1AXQA 2VB6A 3OTBA 3MTJA 1BUPA 2EHGA 3OR1A 3PJXA 2MKYA 2VC1A 1URRA 3CJSA 1TMMA 1HBNB 1S4EA 1TUWA 3KWMA 3I5BA 5KG2A 2MYFA 4OLPA 3FKBA 3TABA 5FLXO 4BC7A 3DOKA 3H2LA 4R5PA 4NLQA 2UUCJ 5IQQA 2A2DA 4H5WA 2GMJA 4W98A 3QINA 5AQTA 5IV4A 4DV2K 1JLGA 2LDYA 4DR3F 1M90T 3AB2B 4ZVSB 2FHMA 3CTRA 4JUZA 4LF8J 2FJWA 1JLEA 1BHNA 5FRMA 3NVKA 4CJUA 3HP6A 2AYMA 1SQEA 2Z2ZA 4C8MA 2HMIA 4A46A 1MWKA 2PEHA 3V4IB 1RHKB 4HCBA 1WOSA 1Y0HA 1NHUA 3T19A 3DU6A 1CZAN 2JC1A 4OKKA 2EFGA 1S1WB 1SJ1A 1N5SA 2QA4S 3NCPA 4PL7A 2M3DA 2B43A 3HXMA 4JOUA 3G87A 1UFKA 3ZX3A 3P45B 4YY3F 1C0GA 1YRXA 1EETA 5GIOA 1YQHA 2ZOFA 3MEGA 1FJ7A 5ETNA 4CO3A 1RBTA 2P1JA 4LSLB 2Q6CA 3CCES 1U1RA 2J6TA 5GAHP 5AQPA 2V0NA 3OR2B 3M2VB 4Q0BA 2AJFE 4FO0A 5IM0B 4WCEL 1R8PA 2ZF5O 1HWLA 4BG8A 4YR2A 4JI8F 1CZ9A 3JS6A 4YOVA 3VALA 4BR0A 3U7JA 4WQ4A 5J2MA 1NSAA 2C3MA 4FP9A 1OH6A 4NZ0A 4KGMA 1YJ9S 4LH4A 4OJ3A 1RT5A 1BE4A 3Q86A 2D9PA 4OJ1A 3K7RA 3NS7B 4DR6F 4IG0A 1H0HB 2WVCA 3UCZP 4RU2A 4CIGA 1HNIB 4RX6A 2VHGA 1NGHA 2XHBA 4C3LA 4OLOA 3CJTA 4J9LA 2ZD1B 2HQCA 4H0PA 5IOLA 1QM9A 3M8PB 1KD1T 3SNNA 3DYAB 1HL6A 2N3LA 2PSZA 3D3CJ 4I67A 5AQIA 3K9JA 4QU6A 4IBNA 3C19A 3JTNA 4CGFA 3NGRA 1Z1ZA 4DL5A 3C16B 1ACMB 3OBIA 4ZHRB 1BL3A 2GO8A 5AQHA 3PHTA 2A1BA 1XMQF 1RI7A 3IR5B 2BUNA 1RXOB 1UVIA 3BYRA 4M5JA 2LQ9A 2LMIA 2FUG9 4NEZA 2ATCB 3SFUA 3AVMA 3BV8A 1N36K 4YUDA 2IJNA 1PBUA 3I55N 5SUHA 2R42A 5EWFA 4NLXA 3KMQA 4EO6A 4FZZA 5BRDA 2H65B 1UFWA 4UQGA 3CWJA 2G8UA 3PCOB 3OYGA 4F4KA 4O8KA 3HOSA 1WSRA 2XCAA 1VQ5N 5D3GA 5KGXA 4B9NA 2M5YA 2V2VA 4GC7A 1WC0A 4KSEB 4RR5A 2VGNA 2OPQA 4KO0B 2RU3A 1VFJA 3RBZA 1WEYA 1V5VA 1S9FA 2O3DA 2W9BB 3HD2A 1PGZA 2XC9A 3KHLA 4U67L 4B9SA 3I82A 1OPIA 3WQUA 2QEXN 4WP3A 4YOTA 3MCSA 5C2CA 4XIUA 5HJXA 4CJKA 1L3TA 3KK2A 4LRAA 3F44A 4XH4A 1Q53A 3K5OA 3A8EA 5D0RA 5KFBA 1LWFA 3NS6A 3CF5Q 4HWIA 4D3HA 1BQMA 1UVJA 2E1YA 2QTWA 4ZS6A 3CC4S 4ECVA 1X4EA 4BDZA 4FLWA 2F9TA 3FZHA 2G4BA 2ILYA 1LW0B 3M1VA 3LH2S 4UQTA 3S3NA 2P9UB 3W0LA 3ENBA 4FW2A 2D0BA 2XMUA 3U8XA 1GFWB 4DQQA 2Q43A 4CJ3A 2RPIA 4HEA9 1ZYQA 2CPDA 1RLCL 3CJRA 3LP1B 2PC6A 1P1TA 3L8BA 3NCIA 2NXJA 2M70A 3C2PA 1KN6A 2AJQA 1HKCA 2QXFA 5HLFB 4GMJB 4OX6A 2HHHK 1ZBFA 4ELTA 4NCGA 3VQPA 1SC4B 3O9RA 1R59O 2XZTB 4OLBA 1UWBA 4ELUA 1TKDA 1UAXA 2HHXA 3A1YG 3OXFA 1SH0A 4ISGA 5D78A 2DPJA 3V2UC 2O8CA 2VFVA 3V9WA 1TL3B 4FKXA 3BSNA 3AT1B 2XS7A 1YHQS 3CIZA 4FYXB 1XWLA 2F4VJ 2HRYA 2BKOA 1HIYA 4ECUA 1N33J 4NZ7A 2O8DB 3EMTA 3UO0A 2YNIA 3A5LC 4F3OA 2DRBA 3R7SB 3KLVA 1RDWX 1X4DA 3QRRA 1Q9XA 2JJ4D 2R8IA 1RUSA 3J81Y 2H5EA 1U1KA 1WNSA 3OBWA 2J0QD 2C2ZB 1RHUB 4HYKA 3QATA 4G1QB 1SZ2A 3QB0A 2P5VA 2DKOB 3VAFA 1N0UA 4A5AA 1ZXOA 2YNHB 3BR8A 3JTPA 2E9ZA 3BPSP 4K4SA 1QVFM 2GHPA 3VAKA 3D4JA 1FRKA 3UDVA 1YDLA 4FK2A 3OVNA 4FJ5A 5JS2A 3KJVB 2XI2A 2VD3A 2KFZA 2MQLA 5IWAF 3THWA 4LJMA 3AOAA 4EGLA 3V9SA 1PC5A 1JL2A 1HQ2A 5B8HA 1KFSA 2QZ8A 3OYFA 2OEMA 3MM7A 3KLIB 2V94A 3LW5C 4IH6A 3V6KA 2MDAA 1O8BA 3N01A 3RW7A 1VQPS 4FYYB 4PPDA 2DPNA 1K73T 1KXPA 2I2YA 5HAOA 4K8RA 3G71N 3G8QA 3M6VA 4MKAA 3OYKA 4OLAA 4ED1A 3L4IA 2K3IA 1FXDA 2KZMA 2BRKA 3H2VE 1U0HB 1N6QA 4QBUA 1U7LA 4LFBK 3F56A 4CRJA 1RP5A 2QLJB 5C0YA 3HVTA 4M5HA 3V81A 5ELZA 3MR7A 2PA8D 5B7WA 4WXOA 1FWPA 4QIFA 3PVXA 4FOIA 4HTUA 3RMDA 2J7UA 1EWQA 4DR5J 3NH2A 3TYTA 3BB5A 4A2BA 4IOAL 1V4SA 1XHZA 1RBUA 1XBWA 3VAJA 3HF5A 3B4DA 5F8HA 2R3VA 3DXBA 5CXTA 2E5LJ 1F0XA 4CK3A 1H74A 3WXIA 3VTIA 2X1BA 1T9TA 1WSIA 4BHQA 4Z4CA 2DNYA 3OYIA 4QWBA 3W1YC 4YDXA 3ZTPA 3DGPA 1JK9B 3NY0A 2VASA 1S1XA 2APOA 2AZ3A 1RBOB 2CQDA 1VLOA 3IR7B 3K57A 4RU9A 3K17A 1OO0B 4IO9L 3IBWA 1BWVA 2Z0GA 3QSIA 4QYRA 4H8KA 1RBAA 5SWMA 3VEOA 2NRZA 2V8PA 3HHKA 4PYAA 2CQBA 3LGNA 3D45A 2NPIA 2OZSA 1HR0F 4LF5F 1VR6A 3H20A 4M5MA 4S0MA 4BC9A 1H1VA 4AH9A 4RJVA 3ZSYA 4QR0A 4DU1A 2D7SA 3PACA 3OV7A 3C0BA 2DHSA 5EN1A 4BBYA 4DFPA 2W6LA 2G8KA 3P6YC 3I5AA 4N8OA 3MM6A 3TAGA 2R8JA 3BO2A 1W2BR 4CGGA 4ZPDA 2V63A 3M30A 3M8ZA 1UKUA 4WE1A 4ZA1A 1GMVA 2HNZA 4K2JA 2F7TA 1F5CA 2DY9A 3GTYX 2QFJA 2VICA 5E2QA 4JKGB 2ZM6K 4A8QA 2P8IA 3PSFA 1S5JA 2H1YA 2SXLA 1YZ7A 3T6BA 2H4WB 3R2CJ 1RDDA 1OSCA 3K59A 4CJ5A 1TK8A 4C0HA 1DQAA 1QAYA 1NKBA 1ESVA 1ZPWX 1AUSL 3MR5A 2ASMA 3GJSB 1I1GA 4DU4A 3ZZOA 5E33A 4OYMA 2FY8A 1CVJA 4IR1A 3MD1A 3CCJS 1CULA 1FXRA 1RTIB 3BZCA 3SUNA 4KHSA 3CQ8A 2MKSA 5C15A 5BR9A 4ID5B 2M8DB 5A6WA 4JRQA 1RAOA 3NCQA 1RT3B 3ELHA 4NOHA 5EU7A 2BX6A 4J2DA 5H9FJ 2F8EX 5J1PA 3LDNA 4GV3A 3TVZA 1KQSM 3I96A 3J81O 4M3TA 3IWNC 2V5HG 3CJ0A 2CJYB 4IFYB 2MKIA 1YSJA 3C15B 5AXMA 2H3GX 2ITMA 2LCWA 2AX1A 4H54A 5C24B 2KN4A 2RHKA 3M8QB 2J5AA 5LMUK 4OYZA 4I2PA 4BRPA 4FWLA 3C46A 1HPZA 3NGSA 1ZBSA 1JCGA 4W5NA 4H5RA 4AQYJ 4QAGA 4M5IA 3LGHA 1VQ4S 3OQ2A 2K1RB 4WBFA 4PYDA 4B1WB 4FVUA 2JZ5A 2AW0A 2BQ3A 4OGEA 4DXLA 5F8IA 5L1JA 1Q7YO 1XMOK 4R8UA 4KGKA 2ZOMA 2RDDA 4EP4A 1JJ2M 3LAMA 1CXQA 4GKJJ 3OL9A 3QZ8A 1J27A 4DV0J 1LOTB 1IKVA 2NR0A 1SCJB 4DV3J 2C2NA 2QA2A 4YR3A 3GJTB 2OHDA 3DCAA 2KRRA 1R0CB 3TNVA 1IR0A 1VBZA 2B0GA 4J91A 4X66J 1KRPA 2H4YB 3CCLS 3HP9A 5GAHI 1T03A 2KYXA 3B82A 3HKZD 3NH1A 1WKKA 3V1RA 1BQXA 2F8HA 4DF8A 4B3MJ 5C12A 3P1GA 1Z25A 1TKXA 1YI2N 1X5OA 3AY9A 5EX5A 3IWLA 3KNAA 4MLEA 3ENWA 2MLZA 1W2IA 2R8HA 4WTYA 2A40A 3HHNB 1U25A 3WEEA 4CZKA 1HBMB 4LREA 3O3GA 4QS9A 5I4MA 4WZMA 5CD4H 4DG1A 1WG4A 3IC1A 2VDIA 1KC8O 1YRUA 5KFPA 1UJ4A 3KXDA 1HBUA 2IVFB 3A8YA 2QC3A 3F9MA 4H4KA 3WX4A 4RUAA 5CHCB 3G25A 2Q66A 3KLGB 1VSHA 1MMLA 3KK7A 5JICA 1IWAA 1RT2A 2Q3SA 1EQ0A 4DR1J 3FLCO 2DR9A 4Q5VA 1DTQA 2NRWA 5L1IA 1N8RT 5D4PA 1OKJA 2QXLA 1F60B 5M1NA 1JLFB 3W2WA 3K5LA 1VI7A 4L3NA 2IMWP 3NH0A 3HULA 4PA1A 3GL1A 4CO2A 4LF9K 1RBLA 2XULA 3NP5A 2XS2A 2UP1A 1SL0A 1X8DA 3MN9A 1N88A 1EB0A 1ZA2B 4LF6K 3J7ZO 3OTEA 4X4RA 2MKJA 1NCLA 4WFYA 4IDKA 4F50A 5C5JA 3VTHA 4TY9A 4ILMA 2V2KA 3K8VA 3A3NB 2XBPA 3VQ7A 3CFRA 4AHRA 4F02A 4ILGB 4CLKA 4YDDB 3ILIA 1U47A 4OKJA 2X1AA 1DLOB 4C8ZA 4JYAF 4AHUA 5CZXA 5F8NA 3CERA 4F3MA 1R89A 1ZBIA 3IAS9 4V19X 4HHJA 2G8HA 2BM1A 4LFAK 3CD6N 2BKNA 2QW9A 3PYGA 1FDNA 1ZZNA 4KFBB 4J9PA 5GAEI 1CJKB 1CJTB 3BJYA 4O5BA 1TK0A 4FKYA 2VOPA 4XH5A 4Z7YA 3EZWA 4AL6A 3WXKA 2NXEA 2UXBK 3CCZA 2UU9F 4LBIA 3T1YK 1DZ5A 1M5VC 3CUNA 3VEWA 2GWKA 2DGWA 4WK3A 2GIRA 4G65A 4DSIA 4TYBA 3SAHA 4CJ4A 3KHGA 2PYJA 1WC5A 1XJWB 4MK9A 4LR9A 4I6AA 3FRYA 4ISEA 3MTKA 2I5JA 1CXUA 1LFWA 1HJOA 1S6QA 7AT1B 2FLNA 3TTDA 3RG6A 1E6YB 1QVFR 2HHSA 5MLCQ 4H4MB 2ZJPL 1XTZA 1YJ7A 4DV6F 1NNDA 3CD7A 5JJBA 1XC3A 2Y1LB 4ES1A 2DNZA 3D6HB 3F73A 4M1KA 4GMKA 1WB9A 4Z4HA 2B4PA 2IOCA 3VEZA 1QVGM 5M1PA 2ZBRA 3OHBA 2HGLA 1TL7A 1NDCA 2XMKA 2JOQA 5MAOA 4ZPBA 3EPIA 4RW6A 3B8HA 4OPHA 4OMFG 3N5BA 3ZSVA 4FWSA 1UL3A 3OHRA 2A18A 3J80U 4RWWA 2ATQA 2IAJA 3GSIA 4OGCA 1C0UA 5C2FA 3K2PA 3FZBA 4FLZA 3R8EA 1N56A 3EPGA 5KFWA 2LEPA 3PW4A 3DDIA 3ATUA 2CVEA 3PO4A 4M5NA 2UV8G 3MEEA 3C6TA 4PG4A 1ZZFA 5HSPA 3SSSA 3HSZA 1NK5A 4ICLB 1VJQA 5AXNA 3J7AP 3O9TA 2VQFJ 2ZNYA 4ZOSA 2PBDA 4KB0A 5EX0A 2CDQA 2UUAJ 4HHTA 1S1VB 1NK7A 1VQ9S 1OPZA 1FTCA 5E0OA 1NSQA 2B4VA 2BABA 3R27A 4TN2A 3CULA 4O3OA 2YKOA 2PFUA 4O44A 4KH1B 5HQMA 4XH1A 1VQLS 2NUHA 1GQEA 3HPHA 4HVJA 4C11B 1UVMA 1GXUA 2JC0A 2ZITA 2PEBA 2P9LB 3DDKA 2HMPA 3Q8VA 3IN5A 3ZT0A 3DLEB 1NEEA 4A8XA 1ATSA 2UXCK 4X4NA 2ALZA 1PIEA 1OJ4A 4DV1F 1QS4A 4KI4A 2F1FA 1XUPO 4FLTA 3HK2A 2P9NA 1NRKA 3MDQA 1T7PA 4LRCA 3ULEA 1HARA 2YNFB 1HQUA 1K0TA 2C2OB 2W9AA 1MA9B 1HNVB 1YLXA 5GAGI 5K14A 3LOUA 2BYCA 3E9PA 3LPEA 3C8YA 5D6GA 1BISA 4M41A 1HWIA 2DYAA 4B9LA 1KR4A 1HNZJ 1XK8A 3FMWA 1CC8A 1HWUA 2HQ3A 2CPJA 1FW6A 4NLBA 4FXVA 1Q5YA 4C3KA 5ETTA 3V5RA 3V6JA 2H3EB 1K0VA 3AVAA 2NRRA 4JV1A 4PUOA 3CCSS 4F4AA 3CCQN 1HW8A 4Q8FA 4LIWA 2XYPB 3VQAA 2LEBA 1U1PA 2DTUA 3TZXA 1H38A 3QJLA 1RTDB 3T9NA 3R1HA 4FS2A 1I39A 5DO2A 5AQYA 2UUBK 2ILZA 3N6LA 4DV7J 4EYIB 4J90A 4ANDA 2D9OA 3UVJA 1R8HA 4ZITA 1IBLF 4CIOA 4HACA 1IKXB 2XSJB 2F9WA 1FFWB 4OO1J 5K8NA 2P9GA 3QT8A 4KYZA 5CYQA 4TLRA 3LDLA 4LF7J 3DM2B 5DK5A 3ZT3A 3CETA 3KLFB 1FRXA 1GTEA 2YBVA 4F0HA 4YHHK 1F21A 1BA0A 3M6GA 2RF2B 1T9YA 1UW9A 2DITA 1KLMB 3J7Z5 1OVQA 4LT6A 1Z26A 3V1OA 4AXJA 3PNIA 3A13A 4JI4J 3ID6A 4OI4A 1OY6A 5BPNA 1SH2A 2X3DA 2GV9A 4W5OA 3O9SA 5JLHA 2FVSA 1FRLA 4GVBB 4DR7J 2L48A 2P51A 2QL5B 3VEVA 3DRSA 2CVIA 3D2FB 5L9XA 4OX8A 1YJUA 4J9QA 1X0FA 4M3ZA 5DM6Q 4PWUA 3ZSRA 1RT4B 2GO9A 1Q0NA 4X65J 3CM5A 3WZ0A 1SIZA 4UY8T 2YVSA 5KFLA 3IFRA 2ZGYA 3QGHA 1XNRJ 5IT0A 1ZPVA 3ET6B 4AF1A 3OPKA 1N32J 3SQGB 3FEYB 1FEEA 1BY9A 3IKMA 3R9PA 3KFWX 3CG7A 5HL7Q 2AP1A 1APSA 1RGVA 4LY7A 2HSTA 5GIPA 4IKAA 1OVYA 1NSPA 3ENHA 4UTGA 2X74A 4IQMA 5LJ3Y 1KOHA 3FE1A 5DLGA 3PW7A 1TYQB 3DXSX 3P3DA 4I68A 4E0DA 2ACMA 1ZAWA 3TJAA 2ATLA 4ILHA 1VQKS 1KVIA 4JV5J 3DDNA 4JI8K 1JJ2R 3OYNA 5M2PA 2E1RA 2ZUGA 2FBVA 2C3UA 4GV6A 1NOYA 2UUWA 3CVKA 1P8GA 4HTLA 4FW1A 3K0JA 3OVAA 1W97L 3MN6A 4O4RA 3JB9k 3P38A 3MMCA 5KT6A 1WSEA 2FHJD 5CD4A 5KFXA 4CH7A 4YEAA 1JLCA 4DR6K 3MURP 3NFAA 4N76A 1WTBA 1P8ZA 2MZJA 4BE2A 3OJSA 3BY5A 3QDKA 4NB4A 5DZ7A 3EM1A 4ZJQA 1DTTA 3RJMB 3CQYA 4OYOA 2VGMA 1EQYA 1S49A 4MO5A 3H25A 4DTSA 4DUZF 1BQNA 2E9TA 4CJSA 5HOOA 3PUFA 1CS4B 5BJRA 3QGGA 2VG6B 3SCJE 2M52A 2MY7A 2IS3A 2MGZB 3NGZA 1M1GA 3G86A 3GPAA 4CHZA 2QYCA 3AVJA 4M7XA 4MAKA 4WTOB 1Z2LA 2WOMA 3WC0A 1REVB 2MTLA 4F25A 5HANA 2CQ4A 3G6XA 2Y9HA 1KAXA 2DXDA 3D1OA 2XLKA 4NXNJ 2R7YA 2ZEJA 1BG3A 4FWPA 5F8JA 1P27B 2DD8S 4CYUB 2KT2A 4QIWD 1QQMA 4Q2MA 1VQ8N 3P31A 4KHMA 4WYLA 3MK6A 1X3NA 3DI6B 4JI5F 4H0YB 4H4OB 4CK2A 2OYQA 4QPXA 1HHTP 2BA9A 3M9OB 1RBSA 3HD1A 4R0JA 4OIXA 2MZRA 4JI2F 2FHOB 1ZBUA 5JLFA 1RT1B 4RNOA 3HM9A 1AB8A 3DRPB 4C8KA 3G2XA 2RD5C 3D66A 5KFOA 2FHJA 4RBUA 4RZRA 1D8ZA 3VZHA 5KRTA 4RW4A 2GMHA 2D0OA 3ENVA 4PEOA 3BS9A 4W92B 3UKUB 3PV8A 3HYFA 1VQSA 1PILA 3TUJC 2VBZA 2OPPA 3I0SB 4GC6A 3R5CA 4NRTA 1UVKA 1TMJA 2F7VA 3LP2A 1TVRA 3UN3A 4IH5A 4Z4EA 4TKTA 4M5GA 2PYLA 4JKHA 2Q1LA 2HZVA 5KG6A 2N7CA 3KK1A 4IG3B 2GHVC 4GKKK 3AXKA 3C14A 5C25B 2B6AB 2IA6A 4CEQA 1NHKL 3TU5A 3GCXP 1ILYA 2W6KA 4F36A 5D15A 3UD4P 3WQTA 3ISNC 4ZKAA 4GKKJ 2XHWA 2R7RA 3H42A 1WG1A 2N7YA 1CJUB 4RUCA 3KK3B 1RYRA 2HBLA 1IUJA 3GONA 2J76E 4OV1A 2GMLA 1UJ6A 1A5XA 4ZVHA 2QL7B 3NMRA 3W3DA 4F3QA 1VDHA 4M63A 1C4CA 3I55S 2G8IA 3I4HX 3THVA 4Y65A 2V52B 2O8FB 3LUYA 3WC2A 3BQ2A 3SMZA 1UP1A 1HBNA 3VF2A 3TP2A 4I64A 3FZMA 2DEIA 4NI2B 2KW4A 1RTHA 1J5EJ 1VSFA 1NGAA 1M5SA 3LDQA 3BYPA 1VQ5S 2ZBQA 4DR4K 4GNIA 4EP5A 4YB6A 1QVGR 4E98A 1P6TA 1E3MA 4E7IA 3OS2A 2DNLA 3VHQA 4DR4J 2KLAA 4B02A 2KVIA 3BDPA 2RQ4A 3THTA 3V4IA 4Z0UA 4GVLA 4IEEA 2ASLA 2IDEA 1KDNA 1G4CA 3KNGA 1FVQA 4EHUA 2DRAA 4HH1A 3NG8A 3NAIA 4JKAA 1RK8A 1RBVA 2KXHA 2XY7A 2DBBA 3J7AN 3CCWA 1GLJO 1N0VC 1ZM4A 2CQHA 4TSXA 2ASOA 2H48B 4XO0A 3HO1A 5KGWA 1PCAA 4LSLA 2NXCA 2E66A 2EFVA 3OR2A 4FPBA 2NNWA 4AHVA 3CDEA 2IBKA 4ECWA 4A5BA 4HT7A 4Y2IA 1MNEA 1R7IA 3E66A 3OS0A 4EHTA 2NYHA 2YX1A 5J1NA 2ZH4A 5AFUH 3MR3A 4G6VB 2ZZTA 5KPZA 2OEJA 2DTJA 1FWKA 3ULDA 1N36F 1RGIA 2Q1NA 3S7RA 3AQOA 4FM0A 1FDBA 2C2RA 2WVEA 4K25A 3QFWA 3SCIE 5T41A 2GIQA 1HNIA 1RAGB 2OIHA 1FFSB 3Q7CA 2ZD1A 3O1WA 2V4JA 4C3MA 3GV8B 2XY8A 3U4LA 3DYAA 4JBCA 4M3UA 3NXZA 4CZJA 1TK5A 4FWQA 2MZQA 2V69A 4DHYA 5KFDA 4ZHRA 3MDFA 3PZPA 2K2PA 5KFYA 3HZGA 5EX3A 2Q36A 1MWQA 2QA1A 1GH8A 3THXA 1N52B 2RKIA 1GLLO 1S6PA 4ZVTB 3NGUA 3NF7A 1FNMA 5F8GA 3SBMA 4FJNA 1GMWD 1NJIT 2HQGA 1OMSA 3M2RB 3MXJA 3IRXA 3TRGA 1H7WA 4JI3K 1CPZA 4DPXA 2LQ5A 3LM9A 4FPIA 3ZT2A 2XCPA 3AVNA 1ZM2A 2U1AA 2V50A 4WCEQ 4DR2K 4JI3J 3R3TA 2DXFA 4CJVA 2W2QP 3K0SA 5EWEA 2G13A 5CZVA 5KG4A 3DMJB 1N5VA 4ANCA 3BN7A 4DR2J 4CECA 3HLUA 4LF4J 4CZIA 1FHTA 2Y8YA 3I8DA 1Q82O 3D6MB 4I2QB 2KHCA 3L2VA 4KO0A 3UDLA 4NXMJ 5BR8J 1MSWD 2VFRA 1KEKA 4CW7B 2JHEA 4NE9C 2EW9A 1UEUA 4QCLA 4C0BA 3N5FA 4KGXB 3NVMA 3CB4A 1N5TA 2E1CA 3GG1A 4EZ9A 4FBTA 3PW2A 4ZPAA 4DQRA 1KBRA 1S22A 2VL1A 1O13A 2FJVA 4OZ0A 2BE7D 5AQQA 1DRZA 1MU2B 4LH5A 3RRHA 4TU9A 2YKNB 2YJEA 4ED6A 5HP1B 4CJLA 2HHHF 3CCTA 3CCUS 4HLBA 1TL1B 1VRTA 9ATCB 4KHPJ 5HBMA 3TWZA 1UWAA 2OJ3A 1VQ6N 5BRFA 1MN9A 4ERDA 3ZZUA 3G71S 4DSLA 4LUBA 1ITPA 2E2OA 1WI8A 3IDHA 2MZSA 1BA1A 5C42A 1WBDA 2RQKA 2AJ0A 2GA7A 5KOXA 3PIPQ 3SI8A 1LW0A 2HBKA 4C0OC 4OQJA 2IVMA 2P9UA 5B0GA 1BU6O 2XSFA 3H7HB 4LBHA 2VQEJ 4BRFA 1U0SA 2LA4A 2C3YA 2A6OA 4W5QA 1G3OA 5KFZA 2OFHX 4J8FA 2CJBA 4RBVA 5DLFA 1GMWA 3VAGA 3ZSZA 4FJMA 1W25A 4DBQA 2KQ2A 4PG8A 5HVFA 3MM8A 3NS5A 4ZVEA 1X9SA 5HLFA 4DL7A 3ALYA 3GG4A 1ZAVA 2FSKA 4U67Q 4FWOA 3GE9A 3N6MA 3KWGA 2G2OA 1WDDA 3IWXA 3D1QA 1JLAB 4CCHA 1ZC6A 3QZ7A 1TL3A 3KLHA 4C48A 2OH2A 2VG7B 2XZDB 4C8YA 4JI1J 4KH0B 1UETA 1YJTA 2W9CB 1EHWA 3PKMA 2O8DA 1NJWA 3PKYA 1R8BA 4ECRA 3RWUA 4B9UA 1P1LA 1RWMB 3K5PA 3ITHB 4URSA 3IAM9 4YQWA 3HBTA 3TTFA 3UN5A 1M5HA 4K4VA 3OUYB 4CI0B 3EXYA 4AYBD 3H2UB 4G1QA 3RBEA 2R2TA 3W5XA 3E51A 2P9PB 4MIAA 1H3DA 4O4GA 4IOBA 3M9MB 1NLVA 4QOTA 2CH5A 4BLGA 3VGUA 3NL0A 2HK2A 2ZOGA 1N4LA 4FYVB 5LMNK 1GX5A 2G8FA 3MUMP 3CJKB 3KJVA 2GVZA 3H8YA 5D4LA 4LFBF 2DRDA 3VQSA 3CJBA 4DB3A 5LMNJ 2IRUA 4I4BA 3ZTRA 5E26A 1OIAA 3LL3A 5IFMA 3CJQA 2DGVA 2ZH8A 1B0TA 4M5DB 2VFUA 1HNWK 3MM5A 4QR1A 1MWZA 1TV6B 1J53A 3UWTA 2LLZA 1FTRA 4F2SA 3I8BA 1T3OA 3X1LB 1W9HA 4HL9A 1MG7A 2JFKA 1DGKN 1VBYA 2R9LA 3LP0B 2HS0A 4X64J 2M7SA 2D1CA 1LAVA 3D7SB 1HNXK 2HVHA 2CIMA 4PWDB 2I38A 2KB2A 1U1LA 4OHXA 5KQ8A 4BDYA 1Q1KA 2HLTA 3TZZA 2JRSA 1R27B 3AA3A 4USKA 1FRMA 4EIAA 1HNXJ 4ZP7A 1JL1A 5M1FA 3G8TA 3FCWA 2J0XA 3OFEA 1UJ5A 4PABA 3L7OA 2ZDPA 5AXKA 4CT9A 1EJ7L 2FXUA 2ZFHA 2YTCA 1S9EB 2ASDA 3PTWA 3MD3A 1M1KO 2BGGA 1T9VA 1YX2A 4H0VB 4Q8EA 3V9UA 4JD2B 3ONQA 3U6FA 3RR8A 4U95A 1QHAA 2FBYA 1L5UA 2ASJA 5GADI 1FF2A 2A3JA 1TFWA 2RN2A 1FVSA 2CDRB 2BE2A 2XMWA 2WONB 4DSJA 5KFRA 2HZCA 3VV2B 2E8AA 2BANB 3JSMB 2LVWA 4ILRA 3Q22A 3EEQA 4BVPA 2DK2A 1NGGA 3QETA 4KJIA 3AO3A 4CJPA 2DNRA 4K42A 2BJEA 1U8WA 2ZM6F 3MECB 4ETXA 1FE4A 4QZVB 1Q9YA 4ZCMA 4E2FB 2O1PA 1Z4UA 1S9GB 2I6WA 2MHEA 2DHHA 4CLTA 1LWEA 3D6TB 4RUHA 3TSPA 5FROA 3I87A 4JS4A 2BKPA 1O1WA 4B3SK 4XDDA 2DXEA 4OI3A 2DH9A 4ES2A 1SV5A 5AQRA 6FD1A 1KAZA 3D6FB 1YJRA 2L3MA 3CJ3A 5HN0A 3AFGA 3CMAN 2HFUA 1A0OB 3HZ6A 5KFUA 2A1SA 2DNHA 3I6PA 1AT1B 2OP5A 1SL1A 3JQKA 4RL1A 3ZSXA 4DPWA 5LJWA 2BOAA 3T1HK 1C1CB 2WVFA 2WCXA 1WN7A 2QWNA 3CD0A 3N9UC 4JLHA 3L3UA 4XPCA 4IOAQ 4OL8A 4AFFA 4JKGA 1S0NA 4BRLA 1LK5A 2J9DA 1I94K 4LRBA 4DSEA 5U47A 5TKWA 4FWRA 1IBMK 4YDUC 4ENOA 1VK0A 2EK1A 4DX6A 1SKUB 3MPUB 4QQBA 1ITGA 2DNKA 9RUBA 2FVPA 1GXLA 1IBMJ 2UU9K 2HAIA 3MCMA 3KHHA 4RCHA 3CMEN 3TAMB 3BGOP 5HK4A 3TW0A 2VUGA 3NNHA 4ATNA 4ZVQB 1ZM9A 5AFUA 2VZ9A 3WX8A 5T7LB 3VR1A 3DLGA 5LMUF 4L75A 4NX9A 1FWLA 2HFZA 2O66A 1U26A 4YOYA 1PKUA 2FJEB 5D0EA 1V4TA 3H46O 1YJWN 3KG0A 1YBTA 1C0TA 3W2VA 4NASA 5A0YB 2ZQBA 4NLCA 2MKHA 1HQEB 3MXMA 3KDNA 3KUHA 4Q45A 4TYAA 1GLAG 2CWXA 2Y0BB 3CPWM 2VBWA 3A8JA 1NK4A 1XR6A 4RBTA 3W60A 1HMVA 2N4DA 4DV3F 1BGXT 4FDFA 2DJWA 1U8SA 1QZ5A 5FPEA 3BGRB 3IP0A 3WNFA 5CCMA 1Y3KA 2BTFA 2EI5A 1S1UB 1NGJA 4TNOA 4X66F 5I3UA 3NGYA 2W40A 3CCVN 3DOKB 2IYGA 3ICLA 2PD1A 4R5PB 3M8QA 1OS5A 2J6UA 3EX7B 4DTJA 2IIHA 4DLGA 4K4TA 4OJGA 4B3RJ 3EL2A 4CESA 1RAIB 3IO1A 3GIKA 1RWKB 1B7YB 5KAKA 1R0AB 3EKSA 4F26A 2COLA 3J81j 4CF0A 1HJRA 2CNLB 2K1RA 5KFAA 4CZGA 2CA9A 2E6MA 1SC3B 4QW9A 1Q79A 4TU7A 1NMEB 1OQ6A 2R7OA 2E29A 4DTRA 2DR5A 1HLWA 3O4QA 3CD6S 2HGMA 4QYZK 3VQ4A 2NLXA 1KTVA 2BJ7A 1RAEB 3P5TL 1S6UA 4N7TA 3DLKB 3AARA 2LXFA 1N5YB 3FZKA 3IS9B 2RRNA 4QYZJ 1LEOA 4O0IA 4WFBQ 3DFEA 1JXEA 4LQ3A 4OZ3A 1PO6A 4GO7X 2ZC3A 1IG8A 2C2EA 4NCAA 2JLFA 3SEOA 2F4FA 3KJFB 1EARA 4BRQA 4B1VA 3WDOA 4DR3J 5J2MB 3CCMS 3SK3A 2YKPA 3O44A 1DBDA 1S1TA 4O3QA 3MPDA 1YRTA 4U96A 4DEZA 3EY1A 3OS1A 1M0SA 4JK7A 4EMDA 1WEZA 4LF6F 1FK9B 1HBMA 7FD1A 4F4ZA 5GMEA 1HD0A 1D0EA 3Q8QB 1BI4B 1MDUB 4OX9K 4CJEA 4CBXA 2A42A 1U48A 4YR0A 1KWMA 2QLWA 2FJDB 4YY3J 3LPUA 3LP3A 4MKVA 4CD3A 5G4DA 3KLGA 1VBKA 4OX9J 4A8FA 2JLEA 2BR0A 1GLDG 2VPZB 4Z94A 2V68A 2G0CA 3MM9A 3R2DJ 3KG1A 2Z1IA 4HH0A 5HROB 2G0IA 4UOCA 2C28A 1X4HA 5AE3A 3RU0A 2RB7A 3CIPA 4V19J 3CDAA 1JLFA 2DGSA 5BREA 4Y2AA 1IBKK 4LFAF 1NUEA 4XAKA 3KJQB 1TL4A 3C94A 2DH7A 4URQU 3VA3A 4C7QA 3KUEA 4CM2A 1K8AO 2DNGA 2QMUB 4PY5A 4RW9A 2VBYA 4P2SA 3PM9A 1EIYB 4P2FA 3DKDA 4NLOA 1UVLA 2CKWA 2ADCA 4XTTA 5BPLA 1WKLA 3IUCA 4K7QA 2UXBF 3QMLA 4MKYA 2YY3A 3DLJA 1RNHA 1AFIA 2YHAA 4A47A 1T05B 1T9UA 1DLOA 2CPHA 3AO1A 2RU9A 4UUXA 1H98A 2Z1HA 1XC9A 2Q79A 4F4XA 1T44A 4M3YA 4CO1A 2ZKTA 4PHTX 2C3PA 5AQXA 4WZQA 1P9YA 4RW7B 1WC3A 3R5GA 4Y34A 2HG4A 1RCOB 1MMNA 1XMQJ 3SUPA 5B09A 2HBZB 4PQUB 3K5MA 4M8LA 3TA1A 3KK2B 4HI1A 3S9HA 2YKAA 3LANA 2QA4N 5CR4A 3OHAA 4NL5A 3OYCA 4B9MA 3U9ZA 4DUYK 4J9KA 4CGHA 2RMLA 2IRYA 1IJFB 2WVBA 2RSQA 3ZSOA 5IC4B 2W24A 1RKJA 3CCEN 4KHYA 4WQ5C 3NRBA 4CEBA 3CT9A 5HRRA 4H0XB 2MQQA 2K06A 3BEXA 1F9EB 4BCAA 5A6PA 3OA9A 3CO9A 1X4AA 4I7FB 1VQMN 3QAUA 3M1VB 2QLFB 3BEGB 4ETZA 2V6AA 4IRDA 8AT1B 1YJ9N 1N54B 1Q7YT 4CJTA 2JEIA 4XK8C 3CCQS 4CF1A 2KM8B 4B8AB 3CGIA 1E6YA 3H45C 2VQFF 2VODA 1LAWA 3HPOA 4UY85 4F0MA 3CFPA 1WAJA 4X4OA 1UW4A 2PFDA 2NUBA 2UUAF 2N3OA 3ZX2A 3ZZYA 1QZ6A 4RLEA 3F9KA 2DNPA 1VC6A 1ZBTA 4KE5A 2DCLA 3QRPA 3L4BC 1GEHA 1JJ4A 3BO3A 4QIEA 4C2MA 2QWRA 3M9NB 5ETMA 1I51B 4OYBA 3C6AA 3IXQA 1FRIA 3TUZC 2P9SB 4JKCA 5KQDA 2PGCA 2UYTA 2YNIB 3OVSA 3CNQP 4DPUA 1AA1B 1S72S 2OFGX 5E5NA 3QIOA 5D8HB 3HJVA 2B9EA 1SKSA 2UXCF 3UKRB 1JJCB 1VC0A 1S0VA 1N48A 4DUZK 3M8SA 4RW8B 1FX2A 2GAGC 1T9XA 2QKBA 2VDHA 2UVWA 2V2ZA 3K8WA 3F0NA 3UFCX 5KFQA 3EGVA 3TX8A 4O23A 4ICLA 1IKYB 5KFKA 4Q44A 2FC9A 2E44A 1KC8T 1D09B 4JI0K 4WXWA 1SI9A 1HNZF 5EWGA 2ZJRL 1S1VA 2VKRA 3EN9A 1AUDA 2ZKUA 1K1QA 1ZA1B 3EKUA 4J9UE 4KHQA 3UD5A 3F2KA 4Y6IA 3RW6A 2ZJPQ 1A9NB 1NLKL 1VHXA 1JXVA 5HQLA 5I42B 4C1NK 2P9LA 1NGIA 2V8GA 2AMCB 1TL5A 4CEOA 3O9QA 2B4OA 2KJVA 4I6MA 2LXUA 3MCOA 2IDOA 5G0RB 2VG5B 2HFVA 1GAOA 3I32A 2UUBF 3DOLB 1HKAA 3HHLC 2YNFA 4LFCK 3HSTB 1PJ7A 4LF7F 1VQON 1HNVA 4C97A 2YWEA 2XMVA 3RSEA 4UOHA 3VQ9A 3HFKA 4AM6A 2BW7A 3O1BA 4LFCJ 3CC4N 1Q8KA 1YJVA 3ZNUA 1A7GE 2LYVA 1N6QB 4FJGA 1WKJA 3T5JA 3HVTB 4YHHF 4HCCA 4J7CA 3EGWB 1RT6B 1FT8A 4FF3A 2EFQA 2M4MA 3QNWB 2JNJA 2DR6A 4NLTA 4ZCLA 5IWAJ 1EP4B 2OMLA 4CWBA 4CF2A 1WORA 4E7KA 3CC7N 3AQPA 3BDEA 2HHVA 1RTDA 2UUCK 3E3XA 4YOEA 4ZVPB 2D3UA 4BR4A 5DDRC 2W8KA 5J2PB 4E1MA 3UR3C 4OHYA 3CC2N 4LF8K 2VOOA 3ZEUB 1IKXA 2XSJA 3QIDA 5H9EJ 3CMQA 2PMZD 1VQYA 4ECZA 4DOZA 1FJEB 1XNRF 1S1XB 1U2CA 2X3GA 3KLFA 1YHQN 1I5OB 3VVUA 3G9CA 2DIUA 1TQLA 4CJFA 1OYEA 1TP7A 4DL0C 2RF2A 3QT5A 2HLUA 4QWEA 2P6TA 4PXEA 1ZOTA 1LW2A 1IM6A 1X1PA 2W7OA 2M2BA 2HS3A 3GZ7A 1LFPA 3O3FA 4LBPA 2V51B 2EX3A 1H7XA 2LU1A 2PE8A 4CBUA 4GVBA 4KGZB 4TXSA 1ZTWA 4JV5F 3R5JB 1KSPA 4BC2A 4USHA 1VRUA 3H5XA 3VQEA 3OTOK 1VQ8S 1NJXA 3CPWR 3BKUA 3FUYA 4FVMA 4NLVA 4FNIA 1YBUA 5KFEA 3FFIB 1RT4A 4NCBA 1SAZA 1IQZA 2HNZB 3OTOJ 2Y3YA 4FJ9A 4R79A 3CJ9A 1SJ4P 3AVGA 3CYMA 4BR5A 4CF9A 2E7VA 4DJBA 3ZETB 3SQGA 4F8RA 4I6WA 1U2VB 3QO9A 4P6QA 4ZDNA 1PG5B 4PG6A 4EEYA 1JKHA 3Q8PB 4J9VA 1B7FA 3F5TA 3FGUA 4UF4A 3SMPA 4WP8A 1S59A 3W9HA 3O6WA 2MKCA 1PSDA 1WAFA 2OD4A 2W41A 4FF1A 5GAEU 2QN6B 1ROFA 4E1JA 5C7PA 4ZCKA 3KTQA 2HVDA 5E3QA 1RU2A 3VMFB 3SUQA 5LY3A 1TKZB 2FGCA 4KC5A 4NYFA 3E1YA 4UUWA 3TANA 3HT3A 3S8SA 2BXJA 3M32B 2CUYA 3LDOA 3W3SA 4IJNA 5D4OA 2LKZA 3GB0A 3IM9A 2F9JA 3PIPL 1G6BA 3AVHA 2AHOB 3RBDA 4NXNF 2QLBB 2GNKA 5JVHL 4NMLA 4P7VA 3VETA 1YKWA 5DS7A 1Y97A 4C23A 4ZVGA 1NGDA 2BW2A 3NWGA 4PXBA 4LMZA 2GUPA 1YWXA 4DL6A 2BQUA 3GIRA 3L7UA 3VEXA 2FLLA 2Q0RA 5KT4A 4FWMA 3HDSA 1CS4A 2DNMA 2PDAA 4A8YA 3QYYA 5A8WA 2VG6A 3MX2A 4X4VA 4ED7A 3H1QA 2KH9A 3QBXA 4NLSA 3VGSA 2MGZA 2FPHX 4PKHA 4DMNA 1K8KB 2XB2D 3SSQA 1RILA 4B9VA 3FZLA 4QOZB 2CH6A 2FBXA 1REVA 1VQ7S 1AYEA 1KVCA 2Q0UA 2V8VA 5C10A 4ZK7M 4B1XB 5CYMA 1IR1A 1GK8A 1WUAA 3FBCA 5KTQA 1EZZB 5DQHA 2WBRA 3UCGA 3LO3A 1NK0A 5A8RB 3CD5A 4LF2A 3DWLA 2DFHA 3DI6A 4OYWA 4CZCA 4H4OA 2WSFC 4KHWA 4QS8A 4Z7CA 2IA0A 2BJ3A 4YN3B 1Q81O 1KAYA 1SBRA 4RNHA 4OKEA 2CQPA 4CNZA 4GKKF 2KRBA 1RT1A 1LWCA 2DFEA 3MMAB 1TFYA 1C4AA 1NXIA 2VPWB 3U1NA 3DRPA 2AYGA 4BRKA 4CLZA 1RA6A 4DLEA 4E19A 2KO1A 2CAJA 3RUBL 1GXTA 1T3NA 2R2SA 2QX0A 3WEEB 3H59A 2LQBA 3R5DA 3BREA 4JKEA 3GP9A 4DCHA 3QLHA 2Z2MA 3Q7BA 3UKUA 1D8YA 4D3GA 2RS8A 3JQMA 2DEJA 5H1SQ 1OWXA 4H5TA 5AZJB 1VK3A 4J5OA 5D77A 1DEJA 2F4VK 3I0SA 4LVNP 4WQ4C 1J5EF 1N33K 4H5NA 5GAGU 2F3JA 4BREA 4J2BA 1HKGA 1NB2A 3BGLA 3T5KA 3N4QA 4P7TA 2W8LA 3R3LA 3L2QA 3UNYA 2CJKA 4BC4A 1DTQB 2DGUA 2QMWA 4DR4F 2DGQA 1CLQA 2B6AA 2UV8A 4EZ6A 5BXIA 2ZNZA 3VQQA 2KJWA 1IKWB 3GFYA 2WFBA 3QPIA 3IM8A 2CNNB 3TA2A 4IFVB 2JH3A 3EE8A 2F8TA 4RO0A 4OJHA 2JFDA 1WSJA 5BYSA 1TELA 1V9OA 4FJXA 1CJUA 1NG9A 5KFNA 4RNNA 3KK3A 2AT1B 4L72B 5CZ1A 3CJ1A 4DX7A 3TUPA 4B3TK 5KPTA 4IDKB 3A5OC 2CG8A 3DRRB 3ISZA 4OI0A 1HYSB 3QRQA 2V8DA 1T8EA 4WKRA 1F2GA 1TU0B 2VBXA 4B3TJ 2RDIA 5AE2A 2MQNA 1DJ0A 2O8FA 4FXDA 3ZT1A 1VIOA 4NI2A 5ETOA 2PI4A 3JAMY 3DLLQ 1QAJA 2QWOA 4DX8H 4L73A 3MWBA 4DV5K 2KT3A 1BCMA 3ZZZA 3DHXA 3RYLA 1VOMA 4USJC 1G7CB 1V6HA 4DV5J 4ZVUB 2NPFA 1MROA 1S79A 1X4BA 4BACA 4JI6K 3BBFA 2DH8A 3CJ8A 1VSJA 4DS5A 4JRPA 5ETSA 3RRKA 3VQ6A 2G2YA 1RDUA 1IN0A 5ETRA 1BHLA 4NLYA 1F6TA 4CDIA 2Q97A 4JI6J 3NGKA 2OCEA 3BM7A 5AQJA 2V7ZA 3GJRB 3DGVA 5DM7L 3TAQA 1YITS 4USIA 3GJQB 4CO0A 2IC3A 5TKYA 3CW2C 4DQPA 4IUFA 3UD3P 2VWJA 4DR5K 1YBAA 5AXLA 1O51A 2GW8A 4AL5A 1RABB 2PFFB 3AD9C 3QJPA 2OO4A 2YX6A 1VLYA 1SB6A 2E5LK 2UZAA 1S6QB 4JYAJ 2YNGB 4ITSA 4AD6A 4KGVB 3KJNB 3C6UB 1GOCA 1YVUA 1YIJN 1PJ5A 4PPZA 3H4BA 3RMAA 3QQCD 4OYIA 1SC6A 2HSEB 5DMRA 2BH1A 1DKGD 3LZJA 4XDCA 4DHVA 4JI3F 3SXLA 3FZ2A 2G1HA 1J9AA 3V4MA 3KHYA 1QHTA 2B7BB 2E7XA 4RW6B 4DR2F 1W7AA 1QLNA 3DXMB 2AJ2A 4K4YA 5DJBA 2IM3A 2WRMA 4PCQA 2L9WA 2PAVA 2KM8C 5M1QA 5BR8F 1UZDA 4MYTA 2GWJA 1NDLA 3IG1B 2HQFA 2HK3A 1C0UB 4P52A 1IM4A 3FMBA 5CH7B 2RE2A 4ILJA 3GU0A 4CLUA 3VQ8A 1SUQB 2GEMA 2VA2A 4BR2A 4OI6A 3TOQA 1HD1A 5F2RA 3TJ9A 5EY4A 3VA0A 3WT0A 2ACYA 2FY1A 3E01A 2C2MB 3BKTA 1KVAA 3PIOQ 1NH7A 3BR9A 3OTDA 4DV6J 3UPFA 1R6VA 2GGPB 4C9DA 3EDQB 3FQKA 1REGX 1A5WA 4KI6A 4P73A 3MR2A 1IR2A 4DTUA 4OPKA 4JK8A 3R6LB 2WW8A 1QQOA 2GCFA 1NU4A 2OI2A 4HI2A 3DMJA 3OLAA 4KPCA 2OPRB 2HNDB 3JYTA 4FZXC 4M5KA 1J5OA 5KFVA 3JSRA 1VQNS 4BRDA 2E5HA 2C2KB 2RUSA 4DPOA 2OANA 3IRWP 2YI1A 4A61A 4CTAB 4JI7J 2RAQA 3W64A 4ALZA 1Z6RA 3SDEA 5LSRA 2Y1JA 4DL3A 5L39A 1C1AA 4BRIA 2KHDA 4GRSA 3DN9A 1WC4A 4KBOA 1HQUB 5DDOC 3DOMA 3JSBA 2NRVA 5K14B 4FPRA 3QEWA 1JLBA 4I9LA 5AQUA 1E6VA 5H9FK 1Y5NB 1MU2A 3EGZA 3AV9A 1UA0A 1UOCA 5HP1A 1IJEB 4IDHA 2D69A 3ULHA 3HFZB 2WB1D 2OKQA 4WFBL 1TL1A 4I69A 4BC3A 4Q43A 1WEXA 4NWBA 2EWHA 2J7WA 3VENA 1FDDA 2GQQA 4M95A 2MSSA 1BWFO 1FKOB 4PXDA 8RUCA 4I0WA 2HEKA 3GCWP 1D9AA 4LQ9A 4O3NA 3D28A 2CFXA 3PDNA 2CPEA 2RIJA 2XWXA 3CE8A 5AQLA 3LWMA 1K9MO 2V67A 3FC9A 5KOWA 2M0GB 1R43A 4DV1J 3UVJB 4B3OB 1FFGB 1GNKA 4AQYK 4RNMA 4HACB 3IA0A 2R2UA 3AD8C 1HRHA 3CCRN 4OZ5A 3H5YA 3K5NA 3DHWC 2ZH6A 2HIYA 1WELA 2WZ1A 4P2MA 3B4MA 3TPQA 3JAMO 3AH6A 5IXUA 5DG8A 3HM8A 3OVBA 3WBZA 1RAHB 2ZH9A 1NU0A 2BDPA 3AOCA 1IVZA 3N79A 2E1MC 4GKJK 1SQFA 1QY7A 1JLAA 3IFEA 4G1PA 2DHGA 5LMNF 4DV0K 1EAYC 1T11A 4DV3K 1U04A 3AXMA 4A59A 2VG7A 2KT5A 4AT1B 4BE0A 2W9CA 4E1NA 5IC6B 1PYSB 4Y2CA 4ECQA 4X66K 3HI9A 3KUGA 2JLGA 4Z4GA 5J2NB 3QT6A 4B08A 3TZYA 2KKHA 6AT1B 3DRSB 1HNWF 3L4QA 1H2VZ 3GWCA 3OUYA 2IGIA 4B3MK 3I33A 1NGCA 4NPOA 4K41A 2FVCA 1IBLJ 4DKWA 2P9PA 3C95A 3HJFA 3CMAS 3ADAC 1HNXF 4IO8A 1F2HA 5E3PA 5FDLB 2HOEA 4I6YA 4HR2A 3P8BB 1EX4A 1MWYA 2MY8A 4KBIA 3H3NO 2H54B 4NYZA 1W0HA 4ECTA 1BUXA 2EPIA 2UXDK 1WSVA 4B1YB 3AJDA 1NNEA 2R7QA 3N4WA 1B3TA 4DR1K 4M5DA 2UXDJ 3CIMA 2E1ZA 3AA4A 2FVRA 2MZTA 1TV6A 5L1KA 2B5JB 4DPYA 1U2RA 1KTQA 3CMES 2ZJQL 1D9FA 3AODA 4YB1P 5ETQA 3LP0A 5FJ4A 4GV9A 4CEFA 3OYEA 3A4TA 4PWDA 1BOTO 2HFSA 1FJCA 4RKUC 1Q82T 3A12A 1FEHA 2CQ1A 1Q7LB 4JKDA 5KT5A 3MR6A 3QSYB 2AWZA 1YZ6A 1RACB 3OW2M 2KTQA 1YJWS 1QJHA 2ITGA 4PKDB 3L3CA 5IT9U 2NRXA 3G6VA 1CZBA 1S9EA 2FVQA 1PAEX 2MHNA 2W4DA 3NE6A 1MMDA 2BVZA 2CJAA 1DTTB 4JD2A 4J9OA 3AB4B 4B3SF 2LFVA 2BJ9A 3D3BJ 4CIFA 4HT5A 1BQNB 3SI6A 3MHYA 2C42A 4NLGA 1NMDA 3HOTA 3S01A 1CQMA 5LJVA 4OZLA 2K7JA 5KPRA 3CCVS 4WKYA 4QW8A 5AJ3K 2BJ8A 2XG8A 3T1HF 4YNQA 2FHKA 5F3TA 2GX8A 1IXKA 3WNEA 4M42A 5AJ3J 2WVDA 2A6AA 1OYDA 2BUPA 1I94F 2FSNA 4OYPA 5E3AA 3ILJA 1IBMF 1JQGA 2KL8A 2MPUA 1OH7A 5IS2A 2J9EA 2PZSA 2JWLA 5F9LA 2WUSA 3WXLA 3IMQJ 3DLBA 3CQXA 1KQKA 2AV5A 3FK4A 2WK4A 4P71A 5ETLA 3G82B 3SYZA 3S41A 2AP6A 4OZ1A 5A2QU 4QIGA 4FL9A 2ZHBA 3TEGA 5EHHA 4AXIA 3R5AA 2JEJA 4MTPA 3F41A 1FKPA 3NNCA 4GW6A 2ZH1A 5BN8A 4O3PA 2CXEA 4MJKA 4QJVA 4N56A 3N28A 1VSKA 1FD8A 4BC5A 3ZTSA 4ECSA 2EKYA 3O5TB 2CZVC 4KB7A 1NPPA 4BWMA 4LR8A 4OZ2A 3M8RA 4ZPVR 2KDOA 2ZZNA 4RW4B 1GT8A 3DAWA 5B0DA 5HRNA 3AVIA 5DRKA 2VPXB 4GVEA 2IJRA 2ZE2B 4C8NA 2HW3A 1D3WA 4K0KK 5MLCV 2P9IB 1H2TZ 1VQKN 4K0KJ 1TVRB 1V3RA 3TAMA 2VWKA 3D1HA 2D0CA 4A57A 5DGAA 3E9LA 4NMXA 3SCKE 3M3ZA 3VESA 2CYYA 4NLWA 4CLFA 2V34A 3SAFA 2HBMA 3BSOA 5B0FA 4CZFA 2XMMA 4JI2J 4PAAA 1KVBA 2IVPA 2QTDA 2MKKA 2VQFK 3R1XA 2VYPA 5A0YA 1SC1B 2VONA 3W66A 1JLQB 3B78A 1HQEA 2UUAK 1IV0A 4WYBA 4H4KC 2HNYB 5F1XA 3UDEA 2XLIA 3QERA 1RLDA 3ZLJA 4ISFA 3UDCA 4EU0A 2HGNA 3DLRA 4ZVRB 5HMWA 3BGRA 1U6BA 2NZTA 3EUNA 1Y5IB 4JV2A 1S1UA 3FCVA 5J2QB 4IWVA 2DISA 2AQ4A 3OXGA 1RWPB 3O3HA 3LWLA 2GQ2A 1Q18A 1RTHB 4B17A 4U6PA 1Y5LB 3AA9A 2UVVA 3S3MA 1DARA 3Q24A 3HSDA 5L46A 3TVYA 3H08A 3WUHA 1R0AA 4IH7A 3NGTA 1GTHA 4DV2J 1FERA 3CI5A 4CFBA 2R2RA 3BF3A 1M1KT 1HLUA 2IJFA 1QUPA 3EVWA 3NBPB 1E4GT 1LXNA 5AE1A 5F8LA 1HNZK 5HO4A 2VCPA 2K3KA 3DLHA 4UZBA 1NM1A 1ASUA 2I7NA 4RWTA 4YOUA 4FYDA 3DLKA 4IXCA 1N5YA 4JAXA 2K7KA 3IS9A 4WPAA 3M05A 3VGTA 4CLSA 3Q0AA 2QIFA 2PI5A 1SVDA 3PR4A 4OX9F 3K2YA 2R8GA 2XRIA 2CGKA 3EVMA 2Z8QA 1RT7B 3DRYA 4DV7K 2AYEA 2FDNA 1SKRA 1WWHA 1CC7A 4DCPB 4OZJA 2ZGZA 3VGKA 1VQMS 2L41A 4FBUA 2VJUA 4JNEA 4WFNL 1M1HA 3SIPB 1EKEA 3L0QA 5FPDA 4X4SA 3MPYA 3O8WA 1EKSA 2NXNA 1RAJA 4AL7A 1IBKF 4LF7K 4PZVA 2EFPA 3OLBA 2JEFA 2ROGA 2WAQD 3EE3A 5KFSA 1EQMA 4W4MA 1KQFB 4LF1A 2GJFA 3QEVA 3FNNA 2JGUA 1FK9A 3R7BB 2EFNA 3SPZA 3L9ZA 2Q31A 4CEEA 1BI4A 3J8AA 2MLXA 2V4JB 2HBJA 4W90B 3PFEA 3D2WA 2HHPA 2MJNA 3V6HA 1JX4A 2YCHA 3GBTA 4JI4K 3D5MA 1HHSA 3NGDA 1NHVA 3KLEA 1WF0A 5IV3A 1B70B 4OZNA 3MGJA 3B8AX 4DR7K 1TKTB 3THXB 4OI2A 2RKIB 5HROA 1S6PB 2MEWA 3MPVA 3AO4A 2D5RA 1QE1B 2QE5A 1U1OA 5ITHA 4G1IA 5D0HA 4X65K 4KH4A 3IRXB 4DCOB 4ID1A 2QT7A 1KQSR 4BY9C 3DC2A 1YT3A 4O5FA 1EX8A 1TUUA 3RVCA 1XNRK 1N36J 1T02A 1FO1A 1UFLA 1D4XA 4DUTA 3J7A1 5GADU 1N32K 4DUYF 3QBCA 2XZWA 4PG5A 4A2AA 2YQ3A 1ZETA 4O0JA 3EZ5A 4RWXA 5CZ2A 1NZ8A 1HBOB 2VKZG 1WDTA 3MXIA 3HI0A 3UB5A 1C0MA 4WFZA 4J9NA 2P5OA 1T05A 3GMGA 3P4UB 2GJ2A 2CQ2A 2Z30B 3RAMA 1FKAF 5EUHA 3EGNA 1FNOA 1H73A 1FXXA 4RW7A 2O5DA 1FXLA 2X6NA 1GLCG 3MCAB 4JV5K 5DDQC 1CJVB 5CHIA 2LSNA 4PQUA 4KRWA 5AQNA 3CJ7A 2BJDA 2DB1A 3UW1A 3TUIC 3R6MA 2P9CA 5GAEP 2W25A 3LA0A 1UPMB 3ZXWA 1VRTB 3MEDB 5HBMB 4PKIA 2R7SA 4ECYA 1VQOS 3LPYA 2YKMB 3GIIA 4NYNA 4CBWA 5THWA 2F63A 5C42B 2M88A 3BH7B 1RDBA 1SIWB 1V5IB 2A3ZA 2QG9B 3CM6A 4I7FA 5IZHA 1J54A 1YTUA 1JJHA 4QU7A 4ZIWA 2WW4A 1CEZA 3OL6A 4Y1DA 2Y1RI 4ZTJA 4ZP8A 3UNGC 3UE5A 3M6XA 4DTNA 4KREA 3QWUA 3G6EN 3I5CA 1TR0A 2B7CB 3CC7S 2JVRA 3W7BA 4IRKA 3MM8B 3NAEA 2MMYA 1Q86O 2QMXA 3PJWA 5SZTA 3A3PB 1NM2A 5LSOA 4JI0F 3CC2S 3IBFB 3GFZA 3FDSA 3ILLA 2HHHJ 3ZX0A 3BN4A 4X4TA 4UW2A 2ZUAA 1K47A 1YVFA 4UT4A 1B9FA 2XO7A 4DQIA 1ASVA 4NXNK 3KLHB 2RRBA