3LAKA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-heterocycle pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Heterocyclic pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lakA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lakA05
3K59A 3AA4A 3NH0A 1NHUA 3LP3A 3DMJB 1N5YA 4I2PA 3LAMA 1IKVA 3OYNA 3DYAA 4EBCA 3MXJA 1REVB 5KFYA 2VG7B 4TQSA 1BI4B 4DL4A 3NF6A 2VG5A 5L1LA 2F8EX 3RB3A 3Q8SB 2IBKA 5EWGA 5KRTA 5DG8A 4OKEA 2QKKA 2VA2A 3M8PB 3BSOA 3HJFA 5KFRA 1K6YA 3V6JA 1S1UB 1I3AA 1VRTB 4DFPA 3KLEA 1VSHA 3KHHA 3QESA 2C2RA 1C0UA 3IS9A 1DLOA 4FZYA 2X6NA 4LSNB 4F4YA 3OJUA 3AVAA 3KOAA 3A2FA 3CG7A 2Z1IA 3KK1A 3MEEB 4Z4IA 4FJKA 3AA5X 1GX5A 3LZIA 4BDZA 2G8FA 2XHBA 4BDPA 4TYBA 3P5JA 5KFNA 3OYLA 3TWHA 1D8YA 4FK2A 4FJIA 5T14A 4Q8EA 4B9UA 3CFRA 3GIMA 5KFJA 4X2BA 4CERA 4FJ7A 1FK9A 4CFDA 5KFKA 3PX4A 1Z25A 4KFBA 3KLGA 1QAJA 3U3YA 5DG9A 4OL8A 1GOAA 1KLMB 4CJ3A 3BSNA 1JLFB 4ZP8A 3OYJA 3ZSWA 5CYQB 1LWEA 1A5XA 2XY6A 2BDPA 2UVUA 1JKHB 5HRPA 3G6XA 2XI2A 1Z26A 2VG7A 4W5OA 1BQNA 3DLEA 2ALZA 2B6AB 2OPPB 4KO0B 3CYMA 3SI8A 5KFHA 4TYAA 1W0HA 4DTXA 3FQKA 2DFHA 2JEGA 3NF9A 4ICLB 3CDEA 4OVLA 3HVRA 4M3YA 1S1UA 3G10A 3M8QA 3H5YA 1WLJA 5KRSA 4YR3A 1RA7A 1S0MA 2W7PA 4IKFA 4EO6A 1JLQA 4QOZB 4BE0A 4R5PA 3V9SA 2JEIA 1LW2B 4Y34A 3ZSRA 1I6JA 4FJJA 4F3TA 3SJJA 1K1QA 1L3SA 3GIIA 1T05B 2R2SA 1HNVB 5J2QB 3JSMA 1KHWA 3MXMA 3V9XA 5KFGA 4O3RA 3VQSA 4Q45A 4K4XA 3V6DB 4DTOA 1TK8A 3PHEA 2ASDA 2XRIA 4RNFA 2ETJA 3NH1A 2AX0A 4KHUA 4FLYA 4M3TA 5J2NA 1D9DA 2BR0A 1S49A 2DFFA 5HP1B 3SI6A 2ZE2A 3NDKA 4ID5A 4DQSA 4CESA 3CDUA 3L2UA 3LDSA 4W5NA 2R2UA 1JLFA 1QUVA 5KFVA 3LANA 1BCOA 3C94A 3QETA 1NJYA 3KLIB 4O3QA 1UOCA 3H40A 4B08A 4JRPA 4CJUA 4IQXA 3KK3B 2B6AA 4KO0A 1QSSA 3OYBA 3KD1E 2IA6A 3BQ1A 3F9KA 2ZD1B 1JL1A 3FFIA 4FK0A 2D7SA 3KKRA 3OSPA 1HQUB 4NRTA 3SFGA 2P1JA 1TL1B 4RW6A 2RDIA 3OL7A 1WAFA 2GV9A 2G8HA 3MFIA 4XO0A 1C2PA 2ZKUA 1LWCA 1NKCA 3H5UA 5FRMA 4K4SA 3D5MA 3VQPA 2JEJA 3NCIA 2F96A 3MECA 4ECZA 2I5JA 3HHKA 4K4UA 3I5AA 1U04A 1RBVA 3TAMA 3AVHA 1UA1A 4Z4GA 4KTZA 4FJGA 1CXQA 4TY9A 4B9VA 1IKXA 3LP0B 2C22A 2HHUA 1TQLA 4XPCA 3GYNA 4ZPBA 3M8RA 1T7PA 4GC6A 4QWAA 1F21A 5KG4A 1KTQA 1VRUA 4YMEA 4AHSA 3EYZA 2JEFA 2EX3A 3NAEA 3AVJA 3DOKA 3SPZA 4KPYA 4JS4A 5CYMA 3ASMA 3M9NB 1ITGA 1RBRA 1QTMA 1SUQB 1SL2A 5T7BA 1UWBB 4MFBB 1LW0A 3IRXA 4KB7A 3V4IA 1BHLA 2G8KA 1IO2A 4CF9A 3BDPA 3BJYA 2P51A 2ITGA 5I3UB 2ZD1A 4FJ5A 1RT6B 2BQRA 4KTQA 1D1UA 4JV1A 3BGRB 3DI6B 3AVLA 3SFUA 2OZSA 3B6OA 1LV5A 4CJLA 4AHRA 3E01A 3QO9B 1RNHA 5F8HA 3I0SA 2Y1JA 1SV5B 4EO8A 1O1WA 4LSLA 3AO5A 4O4RA 4RW4B 1N6QA 3WNFA 3HPGA 3IN5A 2HVHA 4KTWA 3OHAA 4DSLA 2OPQA 4KHNA 5I42B 4B9TA 1RT7A 4CJPA 1TGOA 2WCXA 3RB6A 4EYHB 1C6VA 2WOMA 1RBTA 4E3SA 1HPZB 4IFVA 4U7CA 3ITHA 3CJ5A 4H4MA 4H4OA 5F8GA 1IG9A 1S1TA 4AHTA 5KI6A 1RT3A 2P5OA 3GILA 5KT5A 1TL3A 4N5SA 4URSA 3QIOA 4B9SA 5J2MA 2A1RA 1NK5A 4QWEA 4PA1A 2IJFA 1S1WA 3DLKA 3SUOA 1RT5A 3RB4A 5KFWA 3PUFA 4DFJA 4QCLA 4HCBA 3QGGA 4E1MA 4CHYA 3QNOA 4MIAA 3EZUA 3S9HA 3M8SA 2XO7A 3VQQA 1S9FA 4DU1A 3DLGB 5J1EB 1JXLA 4ZTFA 3DI6A 4RW7A 4F2RA 4G1QB 1SKWA 4CGGA 2KTQA 5HROA 1RILA 2E4LA 3BSCA 4M94A 4B9NA 2ATLA 1RDBA 3ZCMA 1SV5A 1T3NA 2FBVA 1MU2B 1CSJA 2XY8A 4WE1B 3LP2A 2YKMB 3DRRA 4YP3A 1XR7A 4OKKA 5KFQA 2PYLA 4IRKA 5C24A 4M3UA 1RTHB 1HYSB 1R0AA 1LAWA 4CFBA 3KK2B 1YVUA 5I42A 1NNDA 1TKXA 3Q8PB 3ZT1A 4NLPA 3GV7B 3KKSA 4WYWA 5KT7A 3AVFA 4J2AA 2HWHA 1WSGA 3KD5E 3LP1B 4Z4HA 1RTIA 2R8KA 4OPJA 1NJWA 3VQ4A 4WXOA 1JXBA 4R0EA 3CFPA 1ASVA 1WSIA 1N4LA 5C5JA 4CJSA 1BQMB 1RT4B 1KSPA 3PZPA 4KAIA 3L2VA 1X1PA 4CF1A 3ZT3A 2YV0X 4KSEB 5F9NA 4CFCA 3B6PA 4FJXA 3KJVB 4CEQA 4E7LA 4OGCA 5HBMA 1QSLA 3DOLA 4Q5VA 3LWLA 3UPFA 2AGOA 3CVKA 3K5LA 3N6MA 1GOCA 2YNIA 1U47A 4OPKA 5K14A 4EZ9A 3OS1A 1RDCA 1S6QA 3NF7A 5L9XA 4BACA 3CM5A 1N5YB 5E41A 4I2PB 3PJXA 3QNNA 1NOYA 4MIBA 4EYIB 1IKVB 3KK2A 3DYAB 2ILYA 3MXIA 3IG1A 3RB0A 4KB0A 3KTQA 1RYSA 4FLVA 5KG1A 4DMNA 1ZBHA 1BISA 2WK4A 4ECYA 4K8XA 5JS1A 3LP1A 3RTVA 1NJXA 3E51A 3HVTA 2J6TA 2XCPA 3H5SA 2HHTA 3KLEB 2WTFA 3S3MA 3ALYA 2YNHA 1C0UB 2FBTA 1DLOB 1HNIA 4O0JA 4E7IA 3TI0A 2KFNA 4HCCA 3U6FA 2FBXA 4MH8A 3KK1B 5KFBA 4RG8A 2Z1HA 3T5JA 2R8HA 4DTJA 4I7FA 2R2TA 3HK2A 3N6NA 3TAGA 3NF8A 3AVKA 4N41A 3V1QA 4KFBB 4Z4EA 3KLGB 3V9UA 3H08A 4GC7A 4DTPA 3SUPA 4KKOA 3OJSA 3RAXA 1LWEB 2IM0A 4CHQA 4TXSA 2IDOA 3AVGA 4RU9A 4YR2A 1BQNB 4KAZA 4MKBA 3DLEB 3WNHA 3VQ5A 2BANA 3D0PA 1QSYA 1BGXT 3PVXA 4C8LA 2OPSB 4FW1A 1FKPA 3CO9A 4EEYA 4ID1A 3VQCA 3QEVA 2FLLA 2A1SA 4FXDA 2CJQA 4ECQA 1RBSA 4K4VA 5EWEA 4BWMA 1WN7A 1XR6A 3M8QB 1CZBA 4DG1A 2IS3A 3H4DA 2UVVA 2R8GA 4OLBA 2W7OA 1T03A 1LWFB 5DG7A 1JLQB 5L1IA 4R5PB 3AO3A 4B9MA 2O5DA 4O5BA 3K5NA 2UVRA 1TV6A 3HM9A 4XPEA 4CIGA 2F8SA 3CJ3A 4NLTA 4ZPCA 2D3ZA 3JSMB 4O44A 5KT6A 4KI4A 4EBDA 2OPRA 1SH0A 4O0IA 4QPXA 4O3NA 4RNMA 1RT2A 3TABA 5J2NB 1ZTWA 3AV9A 2ZE2B 3K58A 4ID5B 3I5CA 4ED8A 4L8RB 3KLHA 4URGA 4DL7A 4WFYA 5KFFA 4CJQA 1XR5A 3H5XA 2G8UA 2HNZA 3KHRA 4DSEA 4FM2A 4RW8A 4M42A 3MTKA 2X6SA 4NLQA 3OYHA 2QK9A 4NLVA 3OL8A 1JLEB 3OYMA 3T5LA 3K57A 5DQGA 3GQCA 1S1VB 2OPSA 4CE9A 4CJVA 4MK8A 3SZ2A 3OS0A 4YNQA 1NK8A 3ISNC 4FJLA 4IH6A 1IKYA 3FFIB 3VQ6A 4C8KA 1SH3A 2EHGA 1L3UA 4IG0A 4HKQA 1VSIA 4RW6B 2IOCA 3HSTB 4DL3A 1JIHA 1BIUA 4IR9A 1X9SA 4AHVA 1KVBA 1HJRA 1YTAA 1LWFA 3SQ1A 1LWCB 2P5GA 4W5RA 4IG3A 2FJXA 2YHAA 4B8AB 4ZVGA 4J9MA 2AGPA 2JGUA 3MECB 2I5JB 2FLPA 4JS5A 3TAMB 2HB5A 3V1RA 1C0TA 4J9OA 1XHZA 4URQU 1HRHA 4HUGA 4Y1DA 3PY8A 4M41A 1IKXB 4YQWA 2YKNA 4Z4FA 4B8CA 2HNDA 2FVRA 5FDLA 2OZMA 2PYJA 3RMAA 4FS2A 3RBDA 3CJ0A 1VRUB 1I39A 2IM2A 3S3NA 4DTSA 2FLNA 4RW9A 3M9OB 3DOKB 2BGGA 1S0NA 2XWYA 5CYMB 2HNYA 5KGXA 1NKBA 4FJ8A 1JLEA 4BE1A 3SNNA 1LW0B 4DTUA 3RR7A 3IRXB 3V4IB 1S1VA 2E9RX 1RDDA 3L3UA 1WNSA 4PUOA 2IJNA 3KLFA 4LH5A 4ELUA 3VQ8A 4QWDA 1HQEA 4ED6A 4AILC 2JC1A 3G6VA 3OYEA 5J2PA 4J2BA 2D41A 3E01B 3TQ1A 5KT4A 1NK6A 4CF0A 3I0SB 4BWJA 4AH9A 3OYGA 1YT3A 4LSLB 4HUEA 4DU4A 4O3SA 2FBYA 4DS4A 5D3GA 4JRQA 3SUNA 1N6QB 4ZP6A 3PJWA 3DLBA 4TY8A 3AVNA 4HTUA 1Q9XA 4KHSA 4ED0A 4J9RA 4NYFA 3OVNA 2OPQB 4WYLA 3OYIA 2E9ZA 1WSHA 1RT7B 4IKAA 3S3OA 4KE5A 2WOMB 4IFVB 3ITHB 3LAKA 2WHOA 4H4OB 4H4MB 2FVCA 4M3ZA 2XY5A 1S1TB 1RT3B 3GIJA 4NCGA 3G0ZA 1GOBA 1TL3B 3PW4A 4PQUA 4YFUA 4E7HA 3RMCA 4F2SA 5J2MB 4NLRA 2D0BA 1ZBUA 4I2QA 3EZ5A 1S1WB 3DLKB 4Q0BA 3VQ7A 1RT5B 3NAIA 3FRZA 4MK7A 4I9QA 4E1NA 1S5JA 2XCAA 1NKEA 2YNGB 4LQ9A 1X9WA 4LY7A 2IM3A 3VA0A 3UR0A 1RTJA 3N6LA 5KFSA 3FDSA 1D0EA 1K1SA 2KQ2A 4DS5A 4O4GA 4CEEA 4LH4A 2VWJA 1SH2A 3NBPA 4RW7B 3ISND 3H2LA 1ASWA 4H54A 4WFXA 5HROB 4IFYB 4EP4A 4IBNA 2OA8A 3HKWA 3LP2B 1KLNA 3DRRB 5C24B 2E9TA 3Q8QB 3TAFA 3O3HA 3QGHA 1R0AB 3NGYA 5DQHA 4ECUA 3BSAA 3MEGB 4FM0A 1TKXB 4DLGA 3DRPA 4CEZA 3ZSYA 1NHVA 4IOBA 3QZ8A 1T94A 3VN5A 1NJZA 3CDWA 4FK4A 4DSFA 3SYZA 1C1CA 3BREA 1KFSA 5KG7A 1RTIB 2IMWP 2GBZA 4DQRA 3MFHA 5HLFA 1L3VA 3AA3A 1HYVA 1KCFA 3LALA 5SWMA 3MEDB 3V9WA 2X74A 3GIKA 4FJ9A 3HP9A 3T5KA 5DK5A 4IDKA 3O4NA 2YNGA 3OS2A 4KHWA 1TAQA 5HRNA 1SL0A 2R8JA 4FCYA 5DMRA 2VG6B 4ECXA 1SL1A 1EP4B 4E0DA 1EXQA 3KIOA 1VSMA 4TSXA 4CJTA 3PR4A 3OYDA 1WSEA 3AO1A 4O3OA 5HBMB 2HAIA 4NLSA 3DOLB 4KB1A 5EU7A 4ED1A 1WAJA 4ZVFA 2LSNA 4NYZA 2GUIA 4CGJA 2G8VA 4IFYA 2YNIB 4KHMA 3TAPA 5K14B 1S6QB 5KTQA 3KLVA 4FZXC 3THVA 1J5OB 3F73A 3WNGA 2HVIA 4Y1CA 4DL5A 4CJWA 2OH2A 1N48A 4K4ZA 3IG1B 3MEGA 1Y97A 2YNFA 3PR5B 3RAQA 4DSJA 2V4RA 3GV8B 3H98A 3C6UA 2DPJA 2JLEA 4ECVA 3T5HA 4PWDA 5KFLA 5KFDA 2BRLA 4DF4A 2R2RA 1S9EA 5F9LA 4ZP7A 5KG6A 1U48A 2BE2A 3DDKA 4NLYA 3HVTB 3QIPA 5KFPA 1S1XA 5KFXA 4CK1A 3QEPA 4Y3CA 4DEZA 3NGDA 1JL2A 3TAEA 4J9KA 2IC3A 3MEDA 3C95A 4CFAA 5EWFA 2YNHB 4UQGA 4DTNA 3T19A 2RPIA 3NH2A 1HNIB 1HARA 3VQDA 1ASUA 4NLOA 5L1KA 1HMVA 2VG6A 1CZ9A 5KGWA 4E89A 1EP4A 4K4TA 4BE2A 1VK0A 4EP5A 5F8NA 4RNNA 1S6PB 3DM2A 5JS2A 2V9WA 4JV2A 4I7FB 5F8LA 4JLHA 2D5RA 2AJQA 2WONA 4ECWA 4KHRA 3AO4A 1ZETA 4IH7A 4NZ0A 3UIQA 1VSFA 4ZHRA 3HYFA 4KHQA 2IGIA 4XIUA 3CJ4A 4PY5A 3SUQA 2B5JA 4CK2A 3D45A 2PY5A 4KKOB 2YHBA 3TVKA 1VSLA 1TKTA 1J5OA 4H8KA 3K5OA 3OLAA 4NRUA 3QEIA 2EC0A 2AGQA 4FYDA 3L2QA 4RNOA 4G3IA 4M45A 5KG0A 2G8WA 2BANB 1KHVA 1FKPB 3V6HA 4WXWA 1U4BA 4FJMA 3WNEA 4O55A 5C42A 4CIEA 4KREA 4WZQA 4CJRA 3MF5A 2JC0A 3PW5A 4KV8A 4DG1B 3K5MA 3IGNA 4J9LA 1T03B 4MQ3A 2W9CB 3NGZA 1TK0A 5JUMA 4ZMMA 3K2PA 4YR0A 2D0AA 1Z4UA 4J9PA 1QS4A 1TV6B 4Y2CA 1XI1A 1S9GA 3ZSVA 3HXMA 4ED7A 1S6PA 1EKEA 4O44B 4CHNA 3PV8A 4HHTA 4Q43A 1YVFA 3MR5A 5DGBA 4LQ3A 2OPRB 1OS5A 1S0OA 4F50A 3T1AA 2GIQA 1W25A 3GV5B 2HHXA 1JLGA 1RT2B 4QW9A 1XWLA 3BQ2A 4NCAA 1VSEA 3KLHB 2FJVA 2IM1A 3L2WA 4DU3A 5KFOA 4F4WA 1CXUA 4DFMA 1EETB 4DF8A 1Q9YA 1TKZA 3HL8A 3DLHA 2HNZB 4FW2A 4RW8B 3VQEA 3I8DA 3TAQA 3DRSA 3LPUA 2VA3A 2GIRA 1A5VA 4QAGA 2GC8A 4FLXA 3CFOA 1DTTA 1C0MA 2V4QA 2C2DA 3QLHA 4KBIA 1IKYB 2AQ4A 1BIZA 3NAHA 1WSFA 3L8BA 2ZQBA 4IG0B 3P83D 3OSNA 1RCHA 3OL9A 5DGAA 4CJKA 3ZSOA 4CF8A 4CGIA 4HVJA 4FBTA 2W9CA 4RUAA 4QWCA 4IG3B 4Q8FA 5HRSA 3NFAA 3C6TA 3O4QA 2G8IA 1ZTTA 4K4YA 2AWZA 4FLZA 3V6KA 4ZPAA 1C0TB 3HP6A 1QE1B 4F3OA 1B9FA 2YKNB 4NYNA 4B9LA 5KT3A 3CIZA 2HNDB 5KFUA 3G6YA 3BQ0A 4NLGA 2D0CA 4CK3A 1Q8IA 3LPTA 5FDLB 3I0RA 4J2EA 1DTQB 1RAJA 3NGIA 3SV3A 4E7JA 3G86A 1C1AA 5DLFA 1MMLA 3V81A 1EETA 1TK5A 4RW9B 4WZMA 1VSDA 3JYTA 3PO5A 3TR8A 2HNYB 3OYCA 3ZT4A 1EX4A 3KHGA 4FLWA 1FKOA 4E7KA 3PW0A 1S48A 5JXSA 2F8TA 4IRDA 4JUZA 4CJ5A 3DMJA 4PUOB 3AA2A 4CJ4A 1L5UA 3KLFB 2Y1IA 4CEAA 3RWUA 1HQEB 4NLXA 1REVA 3V1OA 2ASJA 1QAIA 1JLCB 4KRFA 1NK7A 1BI4A 5J2PB 3VQAA 2ILZA 2IAJB 3OL6A 3PX6A 5KG3A 1IM4A 5EDWA 2UUTA 2ASLA 1JXEA 3M8PA 2D3UA 5KFEA 4ED2A 5D3GB 5F8IA 2RDJA 4ZPDA 1VRTA 4TY8B 3MR2A 4N56A 3SV4A 4M3WA 1RYRA 4DTMA 4W5TA 2C2EA 3TARA 1QE1A 1U49A 3NHGA 3ULDA 2PZSA 2RF2B 4LSNA 3KNAA 1TVRB 2DPIA 3RRGA 1IH7A 2HHSA 3MEEA 3H59A 5KFAA 1DTQA 4NCGB 2HMIB 4PQUB 4CEDA 3ZSXA 1J54A 4DQPA 1UA0A 5FRNA 2V0NA 4I2QB 1KRPA 4Q0BB 4GVMA 4EBEA 1TAUA 1RT1B 5KFIA 5KFTA 3HVWA 4R8UB 1S97A 1KLMA 1RTJB 2W9BB 4ZVHA 4ECTA 4Q44A 3UQSA 5CYQA 2RKIB 4O4GB 4ZVEA 3LZJA 1JKHA 3H4BA 3SQ2A 3QGIA 3NBPB 1ZBFA 1JLCA 1CLQA 4RNHA 3PX0A 4U6PA 5SZTA 2OPPA 3OLBA 3HVAA 1U45A 2IAJA 4RZRA 4K4WA 4OGEA 1FXXA 3NKYA 4ECSA 3I5BA 4ICLA 4DQIA 3SCXA 4FJHA 3LWMA 2W8KA 4BDYA 4TLRA 2Z1JA 3QYYA 1X9MA 2KZZA 2W8LA 2X78A 3T3FA 1WSJA 2UUWA 2RF2A 3DRPB 1U09A 1TVRA 1LW2A 2O4IA 3PW2A 3RRHA 4O3PA 4GW6A 1C1CB 1W9HA 3ZSZA 2J6SA 4I9LA 1T05A 3ZT0A 4KI6A 4K50A 2HMIA 3HT3A 1HNVA 5J2QA 3MR6A 5HLFB 1N56A 2KW4A 2BQ3A 1WNEA 3V6DA 3QINA 3EY1A 3QEWA 5KFCA 1JLBB 3O3GA 2FVQA 4FVMA 4DFKA 1RT1A 3EPGA 5HP1A 4R8UA 4IDKB 2VWKA 1J53A 3AVMA 4Y2AA 4CJEA 2W9BA 4CGHA 1C1BB 5F8MA 3ZSQA 1SKRA 3PW7A 3OYFA 1ZBIA 3KLIA 4NLWA 1KVAA 4DL6A 4DSIA 4MK9A 2RKIA 5FROA 3KMQA 3MR3A 2QXFA 5KG2A 3NE6A 4QW8A 1L3TA 2QE5A 3KK3A 3D28A 3MAQA 4F4XA 4DLEA 5KFZA 5C25B 4ELTA 4F8RA 2HHVA 3AVCA 4TQRA 1LAVA 4OJRA 4DWIA 4MKAA 1J9AA 4FLTA 4RUCA 1QHTA 5HRRA 3OY9A 3RMDA 1HQUA 1T8EA 1TL1A 4TN2A 1JLAB 4E19A 1QQCA 2YNFB 4CCHA 3OYAA 2HW3A 3C6UB 3VQBA 4WFZA 2DFEA 4ELVA 4PWDB 4DSKA 2WRMA 1S9EB 2BRKA 3QERA 2B4JA 1S10A 5F8JA 2BE2B 4CJFA 2HHWA 2E6MA 3QIPB 1S1XB 2CKWA 3PO4A 2FJWA 3O3FA 3SPYA 3UDLA 1JLBA 3LP0A 2BQUA 4C8MA 2Q3SA 2IC3B 4GMJB 1NOZA 4M3XA 4K8ZA 2XGQA 1D5AA 4FS1A 4CGDA 3OYKA 4FBUA 4J9QA 1C1BA 1HMVB 1BL3A 1RDRA 3RBEA 4EZ6A 2Z1GA 4IRCA 4NCBA 3AVBA 3RMBA 5CZ2A 3DM2B 1KVCA 2XY7A 2DTUA 3ICLA 1SUQA 2ATQA 1UWBA 4MFBA 2WONB 2NUBA 1TP7A 4CHOA 2E6LA 1TKDA 3ZT2A 5C25A 3KMSA 2QKBA 4ZHRB 2O4GA 4AHUA 2HWIA 2J6UA 2B5JB 5I3UA 1RT6A 4HYKA 2FC0A 3FQLA 2B43A 2WB4A 4CECA 5L1JA 4ECRA 3AO2A 1TKTB 4ZP9A 4FLUA 3BGRA 3RR8A 1JLAA 1RTDB 3QEXA 4QWBA 1SKSA 4FJNA 3QO9A 4ZTJA 1KFDA 4W5QA 4C8NA 2OYQA 1IKWB 3AVIA 1BCMA 4ED3A 4J9NA 2HHQA 1ZYQA 4J2DA 2AU0A 4RW4A 1NK4A 1NK0A 2XC9A 5C42B 3QIDA 3M9MB 1RDAA 2DY4A 4F4ZA 3TANA 1A5WA 4KV8B 2W9AA 3CWJA 1HPZA 2UVWA 4Z4CA 3P1GA 4DL2A 1YTUA 5KFMA 3L2RA 3FSIA 5EUHA 2AX1A 1ZBLA 1S9GB 1B92A 4B3OB 1B9DA 1XHXA 4Z0UA 4C8OA 4CEFA 3HPOA 2KZMA 3NL0A 2W42A 3CJ2A 4CF2A 3DLRA 1JLGB 1D9FA 2R7YA 3U3GA 4CEBA 4DTRA 1RA6A 1NK9A 3DLGA 5J1EA 1XC9A 1RTDA 1TKZB 1UAXA 4G1QA 4AHCA 3SQ0A 4OKJA 2C28A 3DRSB 4J9SA 1IKWA 3V9ZA 1MU2A 4WE1A 3HPHA 2RN2A 2YKMA 1DTTB 3QZ7A 1RBUA 2XI3A 1RTHA 3QLHB 2R8IA 4CHPA 1HYSA 5KG5A 3SQ4A 2FVPA 4N76A 5DQIA 3VA3A 4DQQA 2FVSA 3EPIA 3VQ9A 1G15A 3CQ8A 2VG5B 4IR1A 2QV6A 4M95A 4CGFA 3BR9A 4NLDA 3C6TB 3L3VA 1S4FA 4FM1A 1GX6A 5CY4A 1JX4A 4CHZA 4B3OA 5KT2A 4JV0A 1BQMA 2XGPA 4KHYA 3IS9B 1RT4A 1VSKA 2KFZA 1VSJA 4CEOA 4NLUA 3I0RB 3KJVA 3HO1A 4LD0A 3NMAA 4HUFA 4N47A 2I1RA 3V81B 4M3RA 3IGVA 4IH5A 3KHLA 4OLAA 3JYTB 3IAYA 4F4KA 3Q8RB 5CZ1A 3OHBA 1FK9B 4CIFA 3CM6A 4FZZA 1FKOB 5DLGA 1HYZA
chains in the Genus database with same CATH superfamily
3K59A 3AA4A 2C2NA 1NHUA 3LDQA 2BACA 1R8PA 4E1JA 3FCVA 5DZ7A 3HMJG 1REVB 1Q81T 2VG7B 2P6TA 3HHLD 1BI4B 3VCDA 4DL4A 3NF6A 2HBMA 2VG5A 3Q8SB 3H7HB 5EWGA 2IBKA 5KRTA 1JCFA 2QKKA 4LF2A 2MKIA 1WJ9A 3ILIA 3ZZYA 1I3AA 4DFPA 3KLEA 1Y0HA 4G6VB 1VSHA 3KHHA 1R8BA 1H73A 1DLOA 1KWMA 3ZC4A 2CPJA 3AVAA 2P8IA 3LDLA 3QJLA 2GHVC 3GYGA 4Z4IA 4OMFG 5AQVA 1GX5A 4WU2A 3GG4A 1F1BB 4IO9L 4DI6A 3P6YC 2E5LF 4BDPA 3P5JA 3TWHA 2A3JA 3JTPA 2M4MA 5H9EK 5KFJA 4CERA 4FJ7A 2ZH8A 4IOAL 2NR0A 5IT9O 4KFBA 4H4KA 3KLGA 1S72S 3U3YA 4KBOA 1U26A 1GOAA 1V3SA 3BSNA 4AQYK 2GNKA 1Q4RA 4ZP8A 2VONA 4LREA 5AXLA 2XY6A 2P9PA 5HRPA 1RHQB 2Z58B 2ZOGA 1Z26A 1BQNA 5GAGI 1MWYA 3PCOB 4DV0J 4CO5A 1X4HA 4I6AA 4KO0B 3C14B 2IYGA 3VAHA 4DTXA 2DFHA 5EGYA 4ICLB 2QGFB 3CDEA 3OFGA 4M1KA 2EFVA 4M3YA 1S1UA 3M8QA 2HVZA 1WLJA 4C1NI 1HR0J 5L38A 2Y8YA 5HOOA 4JYAJ 4H5RA 4IKFA 1JLQA 4QOZB 2K2PA 2ZGYA 4R5PA 4RU2A 3MM8B 3ZSRA 1OSCA 4FJJA 2E7VA 4CLWA 5ETLA 1L3SA 3GIIA 1BUPA 2R2SA 3JSMA 1KHWA 3R5BA 2V51B 2EC2A 3NGTA 4C6AA 3V6DB 5LMNK 3SBMA 2ETJA 2IVYA 3NH1A 2J0QD 5F3ZA 4FLYA 4M3TA 2ITMA 5J2NA 1G7CB 1S49A 2QW9A 3SI6A 4BC9A 4ID5A 2HS0A 3GLJA 4CESA 5ETMA 1HNXK 2YX1A 2CFXA 3LANA 3C94A 2OMLA 2AEFA 5FLXU 1VQ7N 2B4PA 3SDEA 1VCTA 4CJUA 4IQXA 3KK3B 3R3LA 2V8HA 5AQZA 3FR0A 2FYXA 2HBKA 1QSSA 1B7FA 2XMWA 2BBEA 2E1ZA 2IA6A 3BQ1A 1FDDA 2N3LA 4YB5A 2D7SA 3KKRA 1HQUB 4BRLA 3SFGA 4RW6A 1SQKA 3AOBA 2GV9A 2UXBK 4DPUA 1LWCA 5FRMA 3D5MA 2WVCA 2JEJA 3ONQA 3BP8A 3W9JA 3E9PA 2F4FA 3R5CA 3HHKA 2QFJA 2K8GA 1CXQA 4TY9A 2DNZA 1XMQF 3AQOA 2HHUA 1TQLA 2MTLA 5IZHA 4XPCA 1Q8BA 1LEOA 2V68A 3GYNA 4ZPBA 5AQQA 3T6JA 3M8RA 4G1IA 3O9RA 5KG4A 1KTQA 4YMEA 1UEVA 2XNRA 3EYZA 1QD1A 1UZDA 3DOKA 1FWLA 4KPYA 4JS4A 5CZXA 1RBRA 4JI1J 5T7BA 1LW0A 2O66A 2KB2A 1TFYA 1RLDA 5AQRA 3ZX0A 2ZH7A 2P51A 5GVQA 1ZS6A 5CHIA 4FJ5A 1JMTA 4KTQA 1D1UA 3Q22A 4DV2K 4RTFD 3DI6B 1YBUA 3W63A 4WFAQ 5LXRA 3E01A 1DT9A 1RNHA 1U0HA 3H90A 3E2EA 1RHUB 2E2QA 1O1WA 4LSLA 3AO5A 2ZH5A 2XTJP 4RW4B 2Z2MA 1YRXA 4DUTA 2E1CA 3ISZA 4CJPA 1EX8A 1C6VA 1RBTA 2EG1A 1HPZB 4IFVA 8ATCB 5U47A 4JI7F 2Y8WA 3GILA 4PXCA 4OI4A 3S8SA 5KT5A 4M5GA 2VQFJ 4ZOSA 1HFEL 4URSA 3QIOA 1NNEA 4PA1A 4WP9A 4A8SA 2F8MA 4A8KA 3MN9A 1VQ7S 3CD0A 2LU1A 3IA0A 4DFJA 1Y9OA 4QCLA 3MN7A 1RAAB 1CS4A 2DGQA 3QGGA 2VBXA 4KHPF 3FZLA 3I87A 4AUKA 4B17A 3EZUA 1PYTA 2OEKA 3R1LA 3M8SA 3POTA 1FD2A 2DJWA 5G0RB 2GTDA 1OJ4A 3MWBA 3DLGB 3LO3A 4RW7A 3G96A 1SKWA 2GV1A 4B9NA 4YY3K 4ZA1A 2IIRA 1MMNA 3ZCMA 2FBVA 1CSJA 2LP4A 2P9SA 1IQTA 4OKKA 4GKJF 2PYLA 4M3UA 2M70A 1HYSB 2O8CA 4FF1A 3KK2B 3R6GB 5FPNA 3ZT1A 1KC8O 2XLKA 3KXDA 3ZZUA 4NXNK 2ZH1A 3VF0B 4LF4J 2GGPB 4Z4HA 1H6KX 3TRGA 3GFXA 4WXOA 4R0EA 5D0GA 2BA9A 4LFAK 3HHEA 1ASVA 4QIEA 4CZIA 5C5JA 2RHKA 1IWAA 2RS8A 1VJQA 4KAIA 3L2VA 3WXLA 4I6WA 3DJCA 5LMUF 4DR6J 3B6PA 3VAFA 4BRKA 3KJVB 3IWNC 1X7VA 5I9EB 1HKAA 5HBMA 1XEZA 4UOCA 3DOLA 4LF8F 5FPMA 3LWLA 3F9MA 4HTIA 3UPFA 2AGOA 1DFDA 3LM2A 5K14A 1R27B 2CYYA 5L9XA 4BACA 3G82B 4BR5A 1GNKA 3MCMA 3BV8A 1S57A 4RBTA 3CM5A 1RFQA 4CWBA 3IDHA 3PJXA 1GLJO 3Q8YA 2GAHC 3R9PA 2CQ4A 4EYIB 3CJRA 1IKVB 3MXIA 1BDGA 1ZA2B 4JB8B 3WUHA 4LFCJ 4Y0WA 1JWWA 5KG1A 3W0LA 1ZBHA 2VWBA 4ECYA 4K8XA 1V3RA 5JS1A 4KRWA 3LP1A 2QC3A 4ZLPA 1JB0C 1ZOTA 2HHHK 1FNXH 2XCPA 2HHTA 2LEPA 3TWZA 2WTFA 2FTRA 3M1VA 1Z2LA 4DPOA 1ICEB 1V5VA 1DQ9A 4C97A 1S76D 1ACMB 2Z57B 1HBUB 3C46A 1N5VA 4C23A 5KFBA 5BR8K 4FXWA 2R8HA 4DTJA 1X60A 4I7FA 2UUBK 2XM3A 4A4JA 3HHLA 5L39A 1GLDG 3AVKA 3MMCB 2PFFB 4QZVB 4IQMA 2QWLA 4I1TA 1UVLA 3H08A 4DTPA 4OLPA 5HSPA 1ROFA 1IXKA 3ZTOA 2KXHA 2NZCA 3OJSA 2DGWA 4Y2KA 3VTIA 1LWEB 2BJ8A 2V7ZA 3GJTB 3K8WA 4CHQA 3J7Z5 4UOGA 2BH1A 1FRHA 4OI3A 3AVGA 1YJVA 1UJ4A 2BANA 1BGXT 3BBFA 3PVXA 2OPSB 5LM7E 4FW1A 3QAUA 2O8EB 3KK7A 3L4IA 4ID1A 3UVJB 5HMYA 1IBKK 2CJQA 4ECQA 4K4VA 1U2FA 4Z37A 2K3IA 1CZBA 2UVVA 3WHIA 4OJ3A 4X62J 4KGVB 2ZM6F 5EXWA 3IP0A 2Q6BA 3VHQA 1NZAA 3AO3A 3QNWB 4O5BA 3K5NA 2UVRA 1TV6A 4CIGA 2NXNA 1NB2A 3V5RA 3RG6A 4WP8A 1SQEA 4X65F 3MZIA 2ZC3A 4NX9A 1SH0A 4RNMA 2NSCA 4ALZA 2DY1A 2C1EB 3OR2B 1OVYA 4CZFA 4ED8A 4WU3A 2BW2A 2VPXB 1IJEB 1SI9A 3D2FA 3ENWA 3J81j 4DR1J 4WF9Q 4WBFA 3U02A 1XR5A 4NMLA 3H5XA 2G8UA 3KHRA 1N33J 4F67A 4FM2A 5D6GA 4M42A 2QK9A 3EZOA 1WG5A 1JLEB 1NJIO 5GMEA 3GQCA 4ZCIA 3SZ2A 3N79A 4IH6A 3PYGA 3FFIB 3VQ6A 1WC6A 1SH3A 1YGYA 4WQ5A 1VSIA 4IOCL 2CWKA 3R6MA 1TR0A 1WWHA 4B1VA 1NRKA 2J7UA 1BIUA 4IR9A 1X9SA 4BCAA 1HJRA 4CO1A 1YTAA 1LWFA 2FJXA 4EI2A 2YHAA 3OFFA 3KWMA 4J9MA 3HTVA 2AGPA 5DM6Q 3MK6A 4HACA 4N8OA 3UW1A 2I5JB 4WP3A 3TAMB 1D3WA 1C0TA 1XHZA 2XS2A 4URQU 3U4LA 4Y1DA 1VYAA 2YKNA 3PKMA 2HNDA 1FESA 3W66A 3D68A 4CO0A 3NCRA 2OZMA 3RMAA 2VPZB 3N01A 4C9DA 1Y11A 3CERA 4X4NA 2HRUA 1K8AT 1NB7A 1NKBA 2LEBA 4B3RF 4BE1A 3JSBA 1RQ0A 4QIGA 4ZPVR 3D54A 3L3UA 3ENHA 1WNSA 3BYRA 3H45C 4OJHA 2LVWA 1NM1A 1F60B 4X66F 2O8FA 1M90T 3VQ8A 2ZH3A 4QWDA 2JC1A 3DN9A 1FXDA 2K06A 2D41A 2Z8QA 3GJRB 3THYA 4FYYB 2CWXA 5HL7L 1PAEX 4AH9A 3D2EB 3OYGA 3GR1A 1IN0A 1FRIA 1VS3A 4DU4A 4O3SA 4JRQA 4YEAA 5HMXA 4OYIA 2HSTA 4USJC 3K89A 1NO8A 3GG0A 4KHSA 1N52B 2OPQB 3OYIA 3BB5A 4LMZA 1RI7A 1GLBG 4KE5A 1DGKN 4DV3K 2WOMB 3T9NA 4CZLA 3R3TA 2DO0A 1HIYA 2DIVA 4ZVOB 4NCGA 1LK5A 1TL3B 2VDIA 4F2SA 5J2MB 1ZBUA 4DXLA 1S1WB 4Q0BA 1GMVA 4MK7A 4A8YA 1Q16B 4JI2F 2CQHA 3HX9A 4LQ9A 4QU6A 1RTJA 1HHSA 2PGCA 2E88A 1NGAA 2R7UA 1X4AA 2F65A 5D8HB 4O4GA 4LH4A 2Z2LA 2VF3A 4P7VA 2OJ3A 1ZPVA 1WOSA 3DLLL 2UXDF 3DXKB 2QA2A 2QSFA 4CW7B 4IBNA 3QT5A 4CLKA 2P9IB 2OA8A 3LP2B 1VQSA 2HQFA 4OZNA 4P10A 4H5NA 4BC2A 3MPUB 1R0AB 4BRDA 3MXHP 2RHQB 3DGPA 2GVZA 2XBPA 3CCQN 1TKXB 1XMQK 5SUHA 3P45B 4ANDA 3B6BA 2Z4PA 3CW2C 3SYZA 3BREA 1EIYB 5KG7A 1RTIB 2UZAA 4ILLA 4Z94A 4JI3K 4TU9A 5A8WA 3BF1A 3UO0A 1LXJA 4RLEA 4NLBA 3LF0A 3P4UB 3WZ0A 5SWMA 1FEHA 2X74A 1MROA 3GIKA 3OXFA 3T5KA 3TSPA 4F26A 5M1QA 2YNGA 4CLSA 5HRNA 4FYXB 3IBCB 3TSQA 1SL1A 1EP4B 4E0DA 3OBIA 3IO1A 1YVNA 3PR4A 1WSEA 3B54A 4NLSA 4KB1A 7FD1A 2WSCC 1E4FT 4AD6A 2LSNA 4NYZA 3I4HX 4P2XA 3AHPA 2G8VA 4IFYA 2AZ1A 2YNIB 4KHMA 1N36K 2KHCA 3WXMB 2XSJA 4CYUA 3M5RA 1S6QB 3PFEA 5K5MA 3KLVA 1AYEA 1J5OB 1FWPA 4CT8A 2AD9A 3AODA 3HDSA 1SVDA 1GXLA 1Y97A 3PR5B 4DSJA 4CBWA 3W9HA 5HK4A 3T5HA 3JB9k 2CPEA 3R8EA 2MKCA 2KG0A 5JVGQ 1H2VZ 3M2RB 4LF7F 4NLYA 4HVZA 3HVTB 2LDYA 2XYGB 1RBAA 2M7SA 5A8RB 3NGDA 3VESA 3TAEA 2HFUA 2HZAA 3C95A 2Z2YB 2X3GA 5EWFA 4UQGA 2P9NA 3T19A 3SAGA 2RPIA 4C1NK 3VQDA 4ZK7M 1HMVA 2VG6A 5KGWA 4E89A 3JSRA 1VK0A 2NRWA 4EP5A 5F3TA 4RNNA 1VRQC 1S6PB 4F3MA 3U1NA 3DOMA 4JV2A 3D0IE 2CJAA 5EX0A 1OYEA 2CDRB 4JLHA 2D5RA 4KHRA 4OZ1A 3A3OB 3JTOA 4IH7A 1R8AA 2XWXA 4ZHRA 3HYFA 2WVDA 4XIUA 2IGIA 4PY5A 1XN9A 2HBJA 2KRBA 3GYXB 2MMYA 3TVKA 2Y1LB 4TLQA 1FDAA 2Z2ZA 5AFUH 2EC0A 3WC2A 4G3IA 3CCQS 4U67Q 4WXWA 3JSYA 2NRTA 4FJMA 5HVFA 2B9WA 3WNEA 2EEYA 3SQGB 5B0EA 3JXOA 5CQGA 3KG4A 2EW9A 2OELA 4UOFA 4ZVUB 2W2MP 1TK0A 1I94J 3CJQA 3NS7B 3H2VE 3HKZD 1PAUB 1Z4UA 4J9UE 5HMWA 3HXMA 4ED7A 1EQ0A 3OTCA 1OS5A 1S0OA 4ISEA 4LF8K 1FHTA 1X3NA 2V6AA 1T0TV 1RT2B 3J7A1 4PHTX 2XS7A 4C98A 4ANEA 5LJ3Y 2SXLA 4C4WA 3VV2B 1VSEA 3O8WA 2MSTA 3MM7B 3THWB 1IV0A 3MM9B 4CLPA 4MO5A 3R1XA 5MAOA 4I6MB 3MM6A 2EWHA 4H5VA 3DLHA 2HNZB 4FW2A 2DGOA 1T9XA 4A8OA 1J5EJ 2MY7A 3UDVA 3DRSA 3LPUA 1A5VA 2VCPA 4QAGA 1CJTB 2MZRA 5AQPA 3IBFB 3CFOA 1C0MA 2WBNA 4E98A 3J7YU 2HS3A 2C2DA 3O9TA 2RS2A 1ZAXA 4OFZA 4O8UA 4Y28C 2D74B 4HEA9 5DGAA 1WOOA 2DNPA 4BQLA 2CQIA 4HVJA 1TYQA 2MPUA 4S0MA 3NFAA 3HBTA 2G8IA 3CJCA 1K9MT 2QWQA 4K4YA 2J76E 5DETA 2AWZA 3W5YA 3V6KA 3HP6A 1ZC6A 4QIVA 5KT3A 3BQ0A 2D0CA 4CK3A 3PDNA 3LPTA 5FDLB 4DV7F 3I0RA 1QVFM 3SV3A 2JVOA 4JK9A 2EK6A 2JWKA 3SK3A 4KIAA 3G86A 1BHNA 4B3SK 1TL7B 1EETA 2F9TA 2M5YA 1GT8A 4RW9B 4JK7A 1LWXA 1UEKA 1Y5NB 2FLOA 2YWGA 3OYCA 2AW0A 3W60A 1FKOA 2DGSA 4E7KA 5JXSA 2F8TA 1XNRF 3DMJA 3KLFB 3TP2A 1U24A 4XAKA 3ATUA 4GV6A 5K8OA 3B8AX 1WF0A 4FF2A 3NLCA 1HBOB 1U6FA 3NWRA 4X4RA 3M05A 2ZM6K 4DV4J 3QT6A 2ASLA 2FF6A 5KFEA 4ED2A 5D3GB 2QMXA 3MR2A 2JJ4D 3I6PA 4DTMA 1C4AA 4QR0A 1XMOJ 2C2EA 3MURP 3TARA 2PZSA 5IT9U 4LSNA 3VZIA 4JV5J 4X65K 1TVRB 2DPIA 1FWKA 2DYAA 4H0YB 2BJ1A 2HBLA 1WELA 1IH7A 2HHSA 1X5TA 3H59A 5KFAA 2XMUA 4PQUB 4CEDA 4R25A 5M2PA 3ZSXA 1Z2ZA 1J54A 2R7QA 2V0NA 1RWMB 3L3CA 4YB1P 4I2QB 1KRPA 5LSRA 5KFIA 4CTAB 1KLMA 3QB0A 2W9BB 2OANA 1VQLN 4W92B 3DRXA 1FJCA 5GAEP 3LGHA 2RKIB 4I56A 3LZJA 1JKHA 3H4BA 1H0HB 3NBPB 3R9LA 1EO1A 4RNHA 2L48A 4JKHA 2RQ4A 4FWPA 5SZTA 2OPPA 5DZ6A 2VC0A 4OGEA 4RBUA 1YKWA 2HF3A 1FXXA 1N34K 1ZAWA 4IEIA 2V8VA 4A8MP 1YK9A 4DQIA 4DV0F 4HHHA 4GO7X 5KOWA 5AJ3J 3FCWA 5B8HA 2XZDB 1K0TA 4B3MK 2KYZA 2DB1A 1WSJA 2UUWA 3BBCA 4DX8H 3DRPB 2KI2A 4WK1A 2QWOA 2CPHA 4PG5A 1YBTA 2J6SA 1HR0F 4K2XA 2CNNB 1T05A 3ZT0A 4KI6A 1CQMA 4K50A 1RZMA 4JYAF 1HNVA 4C3KA 4KH4A 5HLFB 2W01A 3EY1A 2V67A 3MN5A 2C2KB 3QEWA 3FZBA 5E5NA 3AJDA 2U2FA 1KQFB 1XBWA 1RT1A 2ZHAA 3PKYA 4B3RK 4IDKB 2RUGA 1J53A 5CHCB 3AVMA 3M2VB 1MW7A 3OYFA 1IBMK 1FT8A 5B0CA 4MK9A 2J9DA 4FWSA 5KG2A 1XQIA 4QW8A 3MPDA 1RACB 4RBVA 1QUPA 1Y3JA 5E3PA 4ELTA 3AVCA 2F8HA 2GAGC 2MQOA 1J9AA 4WQ4C 2V2ZA 5HRRA 5IM0A 4MAKA 4I67A 2MGZB 1T8EA 4A8XA 4TN2A 4E19A 1PYSB 4JHDA 2DHGA 3MMAA 4GV9A 4BGBA 4H0PA 2V69A 3C6UB 5H1SQ 4NYPA 4WFZA 4YUDA 1HHQA 2BJDA 4EK2A 2V2KA 2BE2B 2HHHJ 5CD4H 3TQEA 2ASPA 1S1XB 3PO4A 2FJWA 3O3FA 2HLTA 3OVBA 2BQUA 2IC3B 3MM5B 1NOZA 4M3XA 5HQLA 2RRNA 2XGQA 2GQ2A 4CGDA 4JKCA 4P72A 1SIZA 4J9QA 2I0XA 4CO4A 4OHWA 4EZ6A 2AKWB 5BR8J 1M5OC 1VQLS 2KT2A 1VAZA 1VIOA 2LCWA 3IC1A 1KVCA 3HM8A 3H8YA 4MFBA 3SMSA 4CLLA 1CPZA 1TP7A 4CHOA 2QYCA 4PKDB 2R7VA 2E20A 4UQTA 3AQPA 2ZH6A 2VICA 4HYKA 4JI1F 4ECRA 2LECA 3EUNA 1TKTB 4ZP9A 4FLUA 2JVRA 3RR8A 1B99A 3DDNA 1A9NB 4XEIA 4ZTJA 1FF2A 3KNGA 4B1WB 2OYQA 1YQHA 2CZVC 4ZS6A 3ZETA 1D4XA 4FSVA 2AU0A 3AT1B 4NO7A 4EGLA 4GRSA 1IBKJ 3QIDA 4F4ZA 3HCXA 3T69A 2W9AA 1BO5O 1V6HA 1JJ4A 5LJWA 4DV6J 3THXA 5HMZA 5EUHA 5AZJA 4B3OB 1HLUA 2E2NA 3R5AA 4C8OA 3TO8A 2XB2D 2W42A 2ZVSA 4OHVA 2VQFF 3I4PA 4NA2A 1Z05A 4U7BA 2LEAA 3G87A 4GMKA 4JI6K 3A8YA 4NZ6A 5AE1A 4DTRA 1NPPA 1YF5L 3JQMA 4C11A 1XC9A 4ZITA 4UY85 1TKZB 1X5OA 2DNQA 3M8WA 3SQ0A 4OKJA 2OI2A 3KFWX 5ETNA 2DR7A 5CZVA 3GL1A 3I55N 2YKPA 2RN2A 2HOEA 3W61A 2FZKB 4X64J 3R5GA 2XEXA 5HVGA 2HBZB 3OXGA 3C7NB 4LF7K 3D7SB 1HKGA 4ITSA 2ZJQQ 3EPIA 4P7TA 5BRFA 4CGFA 1RWKB 2Y1RI 3M3ZA 2AYMA 4YOVA 1Q8KA 1S4FA 4FM1A 1YZ6A 2XMAA 1RBLA 5CY4A 3RUBL 3UWTA 4CHZA 1ZM4A 3TU5A 2RSQA 2RE1A 4JV0A 2OGUA 1BQMA 4LF4F 4KHYA 2FC9A 2VHGA 2KFZA 1X3MA 1VSJA 3D66A 2IVPA 3SJHA 1N5TA 4LD0A 1QQMA 4HUFA 1WG1A 3DU5A 2I1RA 3V81B 4OI6A 4JI4J 4A61A 1T9YA 3IGVA 4IH5A 2B7BB 3KHLA 4O23A 2ZC4A 3MX2A 2UXCJ 3JAMU 5CZ1A 4H0VB 4FZVA 4MLHA 3CM6A 5DLGA 5LY3A 2PMZD 3UFCX 3NG8A 4BR9A 1WBBA 2GVDB 1CJUB 1FTCA 3DYAA 4UF4A 4EBCA 1ZM3A 3V4MA 3DXBA 3A1YG 4TQSA 4XDCA 3M30A 5L1LA 3OPKA 1XERA 4M5JA 1CJVB 2VDHA 5E7OB 1FNOA 1B70B 5AQFA 4LFCF 4ZPWR 3V6JA 4L6V3 4LF9J 2GFFA 3BKFA 2RD5C 2CG8A 3GJQB 5AXKA 2MXYA 1C0UA 3IS9A 4C0BA 3OHRA 1VQ6N 1BXNA 4A48A 4DV3J 2LA6A 3IR7B 3A2FA 2ZNYA 4USTA 4EIAA 3W9IA 3CCEN 1WHWA 4BDZA 1S7IA 2XHBA 2W7AA 4TYBA 1X9JA 1DZ5A 3OYLA 5T7LA 1NGFA 2FJAB 4Q8EA 1NGGA 3MUMP 4X2BA 1FK9A 1Y00A 3I55S 1T9VA 3OYJA 1TUVA 2GO9A 3ZSWA 2DEJA 1TL4A 1A5XA 3R27A 3G6XA 1K0VA 3HD2A 3NGUA 3DKDA 2VG7A 4ES2A 1Y64A 3JXUA 3DLEA 4JAXA 3UKUB 2ZEJA 2B6AB 3CYMA 2C2ZB 2LMIA 3J7ZT 4XK8C 1VHFA 4TYAA 5K8MA 2LQBA 2VYPA 3NXZA 5AQKA 1DRZA 4QU7A 3SAFA 3HVRA 3G10A 5FLXO 3H5YA 3W2VB 3IAM9 2AP1A 2E5GA 2W4CA 5KRSA 3P5BP 1NU4A 2VOPA 4YB7A 4YB6A 1UTAA 1RA7A 3VVTA 1GMWD 2RAQA 4Y34A 1I6JA 3EN9A 4GV3A 1WDDA 4DV7K 4JI3J 4X62F 5J2QB 5KFGA 3VQSA 4Q45A 4K4XA 2ZOMA 2YHXA 4MTPA 1TK8A 4RNFA 4JKEA 3EGNA 3RBZA 2G0JA 1R6YA 2JZ5A 3NDKA 4F02A 4DQSA 1S12A 2QWRA 2Q0RA 4EWTA 3HRGA 1QUVA 3QETA 3TNVA 4DX7A 1XNRK 1A6LA 2NRHA 3BZQA 4FYVB 3BO2A 5M2UA 2JWLA 3GR0A 1P9YA 4KO0A 1N36J 4V19S 3Q2TC 1IM6A 3OYBA 1N33F 3MHYA 2ZD1B 1OKJA 4WFBL 4FK0A 4H5TA 2P1JA 1TL1B 3VERA 2AYBA 1K47A 1UL3A 2VKZG 2EKYA 2KDOA 5ETSA 2OLWA 3H5UA 1H74A 1VQ6S 2B8PA 2DR5A 2F96A 3MECA 4ECZA 2HQIA 2L9NA 3GZ7A 3I5AA 4J9VA 1U04A 1RBVA 2FZGB 4G65A 3ENOA 3WXJA 3CCES 2C42A 1ATNA 3LP0B 2C22A 2KL8A 5B0GA 4LIWA 1VLOA 5AZIB 4EHTA 1CG2A 3AA8A 2DR6A 1VRUA 4AHSA 3EMTA 1Q82T 5A2QY 5M1NA 3QAEA 3ASMA 4N7TA 1ZZNA 1SUQB 1UWBB 3BR8A 4U8YA 3MUVP 3IRXA 3HSJA 3V4IA 2AV5A 2DNNA 3CJKB 4PXDA 2IRXA 3CCUN 1BG3A 1JJ2M 1RT6B 1UAWA 3A8KA 4JV1A 3VGVA 4CH7A 1KQSR 4DV0K 3B6OA 2AMCB 4CJLA 2VOOA 3BDEA 2BV3A 2P9GA 2CPDA 3I0SA 2Y1JA 1SV5B 5E33A 4B3TJ 4EO8A 1TUGB 1Y10A 2QZ8A 4O4RA 3HZ6A 1N6QA 3QMQA 1HR0K 3NGKA 1LCUA 4IXCA 4KTWA 2DRDA 4JYAK 3OHAA 4DSLA 4KHNA 3ZLJA 1RT7A 4KYZA 3W8PA 2DITA 1TGOA 3M2UB 4DUZK 4KC5A 1VFJA 3FRYA 3D3CJ 3BM7A 3CJ5A 4H4MA 4JOUA 1RT3A 1DURA 3UDCA 3FCHA 4PG6A 1VHIA 4K2JA 4B9SA 4QWEA 1NM2A 2IJFA 1DJ0A 1RT5A 1G6BA 3RB4A 3PTWA 5JVHL 5KFWA 3CCMN 2QG9B 4KGMA 3MMJA 3QNOA 4MIAA 1R0BG 3GCWP 2N82B 1NGDA 3A3PB 4M8LA 2JWNA 1HWIA 5J1EB 4ZTFA 5AQSA 4F04B 3DI6A 2APOA 2P6SA 3IM8A 5IQQA 2ATLA 4JKGB 1RDBA 1H7WA 3E66A 3P5TL 1FJGJ 4X4UA 3DRRA 5KFQA 2R7TA 3ZZPA 2NREA 4CFBA 4Y65A 1RK8A 5D4PA 1YVUA 1X0FA 4QS9A 1NNDA 5T41A 3TZZA 4FWLA 4NPOA 3GV7B 2KXNB 5KT7A 3AVFA 4J2AA 3RBXA 1WEYA 4NZ7A 4K7QA 1WC5A 2K1RB 2R8KA 4OPJA 1NJWA 4DX5A 1Y5IB 1ZA1B 2OO4A 3LGMA 4KT0C 3PYFA 5HJYA 4CJSA 2MLZA 3PZPA 4A5BA 1OH7A 4X4QA 2VASA 4CLUA 4CFCA 4ZVTB 4DX6A 4BRQA 3CCUS 4B3SJ 2MYFA 4Q5VA 1EQYA 3CQYA 1CULA 1NH7A 4JI1K 2HGNA 2BABA 1UKUA 4EZ9A 1RDCA 3MCAB 2KT5A 4CZJA 2H4WB 3NCQA 2HIQA 3PFOA 3HSDA 3I33A 4JI5J 3QNNA 2NZTA 4YOTA 3KK2A 3SSSA 3KTQA 1DBDA 2HGLA 4YHHJ 1U6ZA 3D6MB 4DMNA 2A42A 1H72C 2ZWOA 3AD7C 2F63A 1FI4A 4FPBA 1YRUA 4YOWA 3D4JA 2PMHA 3H5SA 3DHXA 1IJFB 4AXJA 1GH8A 3KLEB 2DH9A 2FC8A 3US5A 2W24A 3S3MA 5C12A 2YXLA 2FBTA 1DLOB 2F7TA 4ENOA 3K8VA 3BF3A 4O0JA 3AGRA 2CQ3A 3C0BA 4M63A 3SCIE 2RDDA 2KFNA 3CCMS 2VQFK 4HCCA 4O0NA 1RWPB 4MH8A 4NXMJ 4WCEQ 4OX6A 5I4MA 5LOQA 3T5JA 1RAOA 2R2TA 2ZWHA 1KS2A 2RILA 5HANA 3X3UA 4KFBB 1M1KT 1NGJA 4Z4EA 3KLGB 4GC7A 3LPEA 4A5AA 3SUPA 2BUPA 4KKOA 3TA1A 3FGUA 2HQGA 1S59A 2WC9A 3RAXA 2X3DA 3IWLA 2P9PB 4TXSA 1GLCG 2CNLB 1YAGA 2IDOA 5GAHI 1BQNB 4HI1A 2GHWA 4MKBA 3CJTA 3AAPA 3WNHA 3VQ5A 1QSYA 4ZDNA 4C8LA 4PYDA 1FKPA 4ZLNA 1N34J 1VBKA 2FLLA 4FXDA 2CVIA 1RBSA 1RAHB 3TR5A 2ZHOA 3M8QB 2OUGA 4DG1A 4HT5A 4B3MJ 3HZEA 2GEMA 3SSQA 1T02A 4DR5K 1T03A 5DG7A 4LF4K 1JLQB 4AF1A 2C2MB 4R5PB 3D1OA 3RSEB 3CJ3A 2OFGX 4ZPCA 1WEZA 1FDNA 3JSMB 1KQKA 4O44A 3LUYA 3FBBA 1I94F 4AL6A 2E7WA 4EBDA 3QICA 3A5NC 3UR3C 5DM7L 1Y5LB 4QPXA 5J2NB 2D3O1 1M5VC 1ZTWA 3AV9A 4DR6K 3IFRA 2PMWA 5KQDA 4ID5B 3I5CA 4ER8A 5B08A 3QWUA 3KLHA 4URGA 4DL7A 3ZEUA 5KFFA 7AT1B 1YXQA 5JVHQ 1IBMJ 3HULA 1X5SA 4BRCA 4DSEA 3SDEB 4RW8A 2X6SA 3OYHA 4BC7A 4X4PA 4NLVA 5IWAJ 1HBMA 2NPIA 3MCNA 1S1VB 4J7CA 2YQ3A 1DAXA 4GKKJ 2OPSA 1GMWA 1PBUA 1N88A 3NWGA 3UVJA 4A46A 1J5EF 4FJLA 1YLXA 3C16A 1L3UA 4UZCA 4IG0A 4RW6B 2CADA 1N8RO 5AQTA 4DL3A 4YOUA 3I96A 2J0XA 3SQ1A 1HWJA 1LWCB 2P5GA 4IG3A 5GAEI 3PIPQ 4BBYA 4ATNA 3S01A 4OX9J 3NY0A 3FKBA 4LRAA 3VAMA 1RU2A 2CQGA 2JGUA 3G6EN 1YZ7A 5CE3A 4JS5A 3VGSA 3E8OA 4P73A 4HUGA 1UVNA 5B0DA 3EVOA 3LM9A 4B8CA 1OYDA 1LOUA 1PBAA 1MLAA 2WB1D 3OV7A 5C0YA 3ZX3A 2NXUA 1VQ8N 2E1AA 4DTSA 4DN0A 2FLNA 3DOKB 4P52A 2HNYA 5KGXA 2Q1NA 2FGCA 4FJ8A 1JLEA 2GMLA 4BVPA 1LW0B 3CCJN 2DXDA 1WHXA 2BEFA 4PUOA 2IJNA 1MN9A 1RISA 3KWIA 1NGCA 4U8VA 3N4QA 1HKCA 1RGIA 4AILC 1RLCL 2KKHA 5J2PA 5JLFA 4J2BA 3E01B 4X4TA 2BYCA 1NK6A 1U0HB 4CF0A 2FY8A 3UCGA 4BWJA 2ACMA 3CDAA 1R8CA 2G2OA 4LSLB 2CXEA 2FBYA 3KYLA 4DS4A 4ZLLA 3SUNA 4ZP6A 3PJWA 3DLBA 4TY8A 2XZWA 4C7QA 3PRBA 3AVNA 2X7IA 4FVUA 4G9ZA 3C19A 1KBRA 4X62K 4JI8J 4NYFA 3BKTA 2Q3PA 4DV4F 3OVNA 2E9ZA 2V94A 3MMBA 2AJ1A 2I6WA 1RAEB 3CHWA 1OMSA 2J0SD 4IFVB 3TJAA 1R59O 4USHA 2KO1A 3GIJA 1XMOF 4E7HA 4JV5F 2XNQA 4ILRA 4MIWA 3O8MA 2UV8G 1H98A 4DV1J 3LPYA 2X1FA 3VQ7A 3CD6N 4E1NA 1S5JA 2F3JA 1CS4B 2XCAA 3IAS9 5I3PA 4LY7A 1R43A 3UR0A 1QVFR 3P3DA 1F3FA 5KFSA 3CT9A 3FDSA 4DR1K 3POTB 4JI6J 3QRQA 2HWTA 1BQXA 3EKUA 2CPXA 2E1RA 4ANCA 1X5PA 5AR0A 3CDBA 4RW7B 3ISND 4PWWA 3WEEA 4H54A 4WFXA 2UUAJ 2MJUA 3ID8A 4ZVQB 4CQ1A 1QZ6A 2EFOA 1RAIB 4PEOA 2P9SB 1VQMN 3HKWA 1QJHA 1HI0P 2XHCA 2E9TA 3Q8QB 3O3HA 2O8CB 1RTZA 4RUBA 3G6ES 3BSAA 3MEGB 3DAWA 4FM0A 4DLGA 3MI7X 3ZSYA 3QZ8A 3VN5A 1NJZA 3ZTQA 5AJ3F 4FK4A 3I9ZA 4DSFA 1C1CA 1GFWB 3CD5A 2DHSA 8AT1B 1F2HA 2GBZA 4DQRA 3R6LB 1L3VA 2MQNA 2NQPA 3A3NB 2RT3A 3OW2M 2DH8A 1VQ8S 3LALA 1YJ9N 4LFBJ 3TVYA 2V4JB 3HP9A 4YS2A 2GS8A 1UCNA 2R8JA 4LFAF 2RIJA 3CCJS 2GW8A 4KH5A 4J91A 5MLCV 1EXQA 3KIOA 1OH8A 1VSMA 4CJTA 3OYDA 3T1HJ 5DM7Q 5BRHA 3AO1A 2PN6A 4O3OA 5HBMB 3DOLB 4U96A 5EU7A 5ETKA 2ZKTA 3DC2A 1J2VA 1IBLJ 3TAPA 2A1BA 3N4PA 4GY2B 3M6WA 5KOXA 5K14B 2VFUA 3SMZA 1Z6RA 3WQPA 2JHEA 1K73O 1MNEA 3AB2B 3W8GA 3HFVA 3M6GA 4FZXC 2XULA 3WNGA 2GO8A 4CJWA 2OH2A 1N48A 4K4ZA 2YNFA 3RAQA 2CG4A 2NZ4A 2V4RA 2JLEA 4LR8A 2OTJN 1GK8A 1R8HA 1U7LA 3C6HA 1S9EA 3D0HE 3KHYA 1Q5VA 4K8RA 4JKFA 1EQMA 1RB0A 5EN1A 4Y3CA 4DEZA 4MDBA 3OA9A 4CI0B 3M1VB 2AA4A 2J5AA 4DTNA 3C66A 3CMAN 1RWUA 5JLHA 5D4OA 3CD6S 1JNRB 2HHHF 2GQCA 2IVFB 3U9DA 1EP4A 5MLCQ 3BH7B 4ZCKA 3DM2A 5JS2A 2V9WA 3VAGA 4I7FB 2WONA 4ECWA 2YVSA 5CH7B 3HHLB 5J1PA 4NZ0A 4JNEA 3UIQA 2ZWPA 1RXOB 2KG1A 1CJKA 3CJ4A 4ZVPB 5BR8F 2IY5B 2MKSA 4Q7AA 1NH8A 1G99A 1VQMS 1J5OA 5C10A 3K5OA 2CQDA 2HFSA 2AGQA 4FYDA 4OYMA 1RGVA 2BVZA 4NI2A 4UW2A 3ILJA 2V63A 4M45A 2BANB 2HFVA 2DR9A 1VIXA 1KHVA 2G1HA 3V6HA 2AJ0A 2ZZMA 5C42A 3M2RA 4OZLA 4KREA 4WZQA 3MF5A 2HHPA 2QLJB 3CI5A 4GVBB 3K5MA 4ISGA 4FWOA 2H9ZA 1VQON 1YJ9S 1IBKF 3LOUA 5JUMA 1APSA 2UV8A 3K2PA 1SJRA 4J9PA 1TV6B 4OJ1A 1QS4A 3CTRA 3I56N 1XI1A 4OV1A 1S9GA 3ZSVA 1PO6A 2W2QP 3RU0A 1S6PA 1QY7A 4Q43A 5DGBA 4LQ3A 1S3XA 3GV5B 1UFKA 2H54B 1HHTP 1UFLA 3D67A 2WVBA 2MQLA 3HHDA 4CBUA 4NCAA 2MKYA 1EKRA 3EE9A 3D2FB 5KFOA 5D77A 5E3RA 4Q2MA 2ZF5O 4M5KA 4WK3A 4BRAA 2BOAA 3VQEA 3I8DA 4HDHA 2RB7A 1Q78A 2GC8A 1FE0A 4FLXA 4FN5A 4UY8T 2E5HA 2WVFA 4YDUC 1HPMA 3QLHA 2OTJS 1WC4A 5DDOC 2AQ4A 1BIZA 4C8ZA 1S99A 2QIFA 1PCAA 3L8BA 5BXIA 4C48A 4YOXA 4QR1A 5D78A 4DCPB 2YKOA 1W2BM 5ADXH 4X64F 3O2IA 4FPIA 3A5LC 1AFIA 4FBTA 2D1KA 3TEGA 4QWCA 1FA0A 3C6TA 3CMAS 3KUHA 4HACB 3TW0A 3J7YP 3PG9A 4ZPAA 1C0TB 2M9KA 4AE5A 1QE1B 3J81Y 2YWHA 2YKNB 4HH0A 5A76A 3CIZA 2HNDB 1GLAG 1Q8IA 4J2EA 3QBXA 1DTQB 3THWA 2ZBCA 5DLFA 4PPZA 4PG4A 1TK5A 4OZ3A 3JYTA 1X4CA 3GOIA 3QFPA 5AXNA 3ZT4A 1EX4A 3L0QA 3GCXP 3X1LB 4F7VA 3EDQB 3PW0A 2NPFA 2DO4A 4JI4F 3O9UA 4IRDA 4CJ5A 3LA0A 1L5UA 4CJ4A 2UXCF 1YJNN 1F9HA 2O8FB 2QXLA 4EMDA 3CULA 4M7XA 4KRFA 1I3OB 4YOEA 3M1FA 3O4WA 4TVAB 2FXUA 3DCAA 2Z0GA 2K7JA 1YI2N 1GMUA 3THYB 1YWXA 1OPIA 2DCLA 2XS5A 2CJBA 1VQOS 2YX6A 1FDBA 3M8PA 3MMVA 3ETMA 1NMDA 1OO0B 1G1XA 5F8IA 2RDJA 4ZPDA 1VRTA 1U2VA 5LSOA 1JNZB 3I56S 3C8YA 2H3GX 2J4RA 1U49A 3NHGA 4JKDA 3Q24A 1HJOA 1I94K 2DY9A 2FDNA 5ETRA 4DUZJ 1WHVA 3N9UC 4LF9F 1O8BA 3TOQA 3MEEA 4NCGB 1UETA 2WW4A 2HMIB 1YDLA 1VQPN 4DV3F 1KN6A 3GFYA 4Q0BB 1T9TA 3NCPA 4LRDA 2FF3B 4AM6A 3HVWA 4NOHA 5AQUA 1M5PC 2CJKA 4PG7A 2O1PA 4DCHA 2CVEA 4NEZA 1RTJB 3W64A 1O51A 4Q44A 5CYQA 4NYOA 4O4GB 1F3VA 3ENVA 2BTFA 1J5EK 3SQ2A 3MGJA 5E26A 3G25A 2A6MA 2Q43A 1CLQA 1PSDA 4LR7A 5LL6Z 3VEZA 2F40A 1R6VA 3HVAA 2WUSA 4RZRA 4K4WA 3ILOA 1AW0A 2OEJA 3NKYA 3I5BA 2RU3A 2RQMA 3GPAA 5IC6B 4FJHA 3R5DA 2W8KA 4TLRA 3QYYA 3O6QA 3W7BA 2O8BB 3IRWP 1URNA 3R2DJ 3DGPB 2X78A 2GVZB 4ZN1A 1YSJA 2JOQA 1TVRA 1LW2A 3C3LA 5KPTA 3PW2A 2H51B 3RRHA 3RAMA 4O3PA 5JMNA 2QL5B 1ATSA 5A8WB 3HT3A 4HL9A 3MR6A 2BQ3A 3VWSA 4BRMA 4HH1A 3O3GA 2IMOA 2FVQA 1MROB 4FVMA 1R3NA 5HP1A 2LXIA 4JI3F 4CTAA 2FSNA 2BX6A 2VWKA 1LQ9A 4HLBA 4IEEA 5GIPA 4CJEA 2W9BA 4CGHA 1C1BB 2H5IB 5F8MA 1ZBIA 3KLIA 4DSIA 1KVAA 2RKIA 4WKYA 5FROA 3BYPA 4C0OC 5GMDA 3KMQA 3TJ9A 2GA7A 5BYQA 1RWOB 2MLYA 1YJNS 2CGJA 2QE5A 4LBIA 5A6PA 3MAQA 1FXRA 4F4XA 4DR4J 2HHVA 4JK8A 4KH0B 3T1YJ 2XSJB 2R7XA 2GX9A 4MKAA 1YI2S 3FFKB 2CNOB 2VPWB 3TX8A 4RUCA 4FLTA 5BJRA 2HRTA 2ZFHA 1EZZB 1VLYA 2WSEC 3U7JA 5IOLA 1WB9A 2XMMA 1N36F 5D0HA 1QAXA 2DGVA 1SC1B 5AT1B 4DV4K 2HW3A 2A10A 2FJBB 2PD1A 3EXCX 4CZCA 3O9QA 1XMOK 1F5AA 2E6MA 2DKOB 2CKWA 3TEHB 3CJAA 1VQPS 1TUYA 3UDLA 4JV5K 1FFSB 3KJNB 4GMJB 2YY3A 2P9NB 2P5VA 4K8ZA 1D5AA 5I3QA 1N5QA 1OY6A 1HL6A 5A0YA 1HMVB 1BL3A 2FZCB 3RBEA 4PWUA 1RCXB 2YPYA 3AVBA 5FPDA 5CZ2A 2WBRA 1WACA 3DOMB 3DHWC 2DTUA 3ICLA 3HT0A 2NUBA 1TKDA 4ZLJA 3QBCA 4XDDA 3KMSA 4FWQA 1Q86O 4ZHRB 2O4GA 2V9KA 2QKBA 4IO9Q 2IPOB 5C7PA 4AHUA 5I3UA 2CPFA 2DT9A 1SCJB 3FQLA 2O67A 3AO2A 2B51A 3BGRA 3IM9A 3QEXA 4IOAQ 2R7WA 2AZ3A 3QO9A 1LFPA 5BPMA 4W5QA 4LRFA 2PAVA 1IKWB 2Z30B 3FZHA 4WWSA 4ED3A 3BH6B 5AJ3K 1RADB 4WJBA 2PT0A 1Q7YO 5THWA 2DY4A 4W90B 3QFUA 4IO1A 4OZJA 2KM8B 4B3TF 1A5WA 3MM5A 3BZKA 2CNKB 1MDUB 4PKHA 3ZZRA 4DR5J 1G3OA 1YTUA 5KFMA 3L2RA 3FSIA 2OP5A 2XMVA 1F5BA 4CIOA 4LF6J 1S5ZA 1WKKA 1P1LA 1GLLO 4Z0UA 4CH1A 3HPOA 3F2KA 1CC8A 4PPDA 4P71A 2KZMA 4CF2A 4JD2A 2A2CA 2D9OA 2FUG9 1D9FA 1KVKA 3ATVA 1FRLA 1XNQJ 1N54B 3MM6B 4M5LA 5IT9Y 4G1QA 1W2IA 3U27A 1D09B 5B09A 4AHCA 1FFWB 2BJEA 3DRSB 1NHKL 3J80O 2CIMA 1MU2A 4WE1A 2PA8D 1JJ2R 2YKMA 2ZBRA 3M7VA 3K7RA 3AAQA 4B02A 4DR2J 1O0PA 1Q5YA 1P8ZA 1RTHA 4CHPA 3ULEA 4A2AA 2JX2A 3SQ4A 2FVPA 4N76A 3HF5A 4LBHA 1WSRA 5DQIA 2KU7A 3VA3A 3EE3A 4MMOA 1FJGF 1NLVA 4DQQA 2FVSA 2HGMA 1FRMA 1WHYA 1G15A 1N32J 1HA1A 2CQBA 3JAMO 1PC4A 4RPFA 4K5RA 4FF4A 9ATCB 2A6OA 1FVSA 3BR9A 3OFHA 2AJ4A 1GX6A 3VF2A 3DGVA 2WW8A 4B3OA 1SC6A 4FYWB 5KT2A 1KKHA 5AE3A 1RT4A 4H0XB 1VSKA 3E9OA 3QMLA 2YJFA 4NLUA 3VEXA 2MZTA 3PYEA 3I0RB 1U1MA 3EGVA 3UKRA 1MWZA 4OYBA 4N47A 2GWJA 4CDIA 4BRGA 1VI7A 5H9FJ 4UUXA 3IAYA 4DR3J 4F4KA 3Q0AA 3A5OC 3J7AP 4CIFA 1I5OB 1EAYC 1FKOB 3H3OB 4B3SF 1T6DA 4X4OA 4D3GA 1BOTO 3NH0A 2QFIA 3LP3A 3DMJB 1N5YA 2GJIA 4I2PA 3LAMA 3HI0A 3PIOL 1E6VB 3CMEN 5A8KA 1U1PA 3MXJA 5KFYA 5DO2A 2Q1LA 1SC3B 1SBRA 3BKUA 4V19J 5DDRC 1FD8A 3N0VA 4HTJA 5EVZA 1LKZA 4JI5F 1RWWB 3CE8A 2VA2A 3P38A 2HK2A 1RU1A 3CC2N 4M5MA 2F5GA 3HJFA 5KFRA 4YHHF 3ET6A 2DRBA 3MN6A 3P39A 2RH3A 3QESA 2C2RA 5EX5A 4DV6K 4WIQA 2X6NA 4LSNB 4F4YA 2QTWA 3OJUA 1V5IB 3KOAA 2QLWA 3CG7A 3FK4A 1PJ6A 1ITPA 2Z1IA 3GFZA 3GSIA 3KK1A 3D6TB 3H3NO 4FJKA 3AA5X 3QBWA 2G8FA 3CJ9A 4KQZA 3Q86A 5KFNA 2CA9A 1D8YA 2JNJA 5T14A 4B9UA 3CFRA 3MAAA 4NXMF 2R7OA 4CFDA 1VQKN 1AXQA 1QAJA 5DG9A 4OL8A 1XJWB 2W40A 1KLMB 3KVGA 1JLFB 3VVUA 2LQJA 4M5DA 2GVDA 2UVUA 1JKHB 2H48B 2P9UA 1TU0B 1BWFO 3O1WA 4W5OA 2OPPB 1M0SA 1V9OA 5KFHA 4X64K 1BY9A 1CJVA 5ETOA 1W0HA 1KD1O 3MAHA 2JEGA 3NF9A 3TA2A 4ILGB 4OVLA 5L46A 2ASMA 4F9OA 3F56A 2X1BA 1LXNA 3WQTA 4YR3A 3QPIA 1N34F 1VQ4N 3FMWA 2W7PA 3FBCA 3QSYB 1ESVA 3VGKA 2JEIA 3V9SA 2ZJRL 3KUGA 5A6WA 4F3TA 3UCUP 1K1QA 3QT7A 2W2OP 1A0OB 4B3MF 1T05B 3ADAC 4JI2J 1KC8T 1HNVB 3MXMA 3ZFVA 3DWLA 3OTBA 4P75A 4O3RA 2EI5A 4DTOA 2YWWA 2ASDA 2XRIA 2AX0A 4KHUA 1T3VA 4C0HA 4L3KA 1D9DA 1VQYA 2BR0A 1RKJA 2ZE2A 2G2YA 4ZJOA 3QT8A 3CDUA 3L2UA 3LDSA 1FW6A 4ETXA 4JI4K 4O3QA 1UOCA 2BMBA 3TUIC 2UXCK 2KXFA 1CEZA 4JRPA 5AQXA 4LF5J 1SJFA 3CMES 2B6AA 2RQKA 2QTDA 1IBMF 1RAGB 3GU0A 3RVCA 2ASOA 1JL1A 5IM0B 3CJ7A 3OSPA 1YRTA 4NRTA 2P9KA 3CC2S 2RDIA 4GKKF 2Q31A 4FWNA 4JHDB 2G8HA 3MFIA 4XO0A 1F6TA 2IYIA 2XYHB 2HURA 2ZKUA 3MMAB 1NKCA 2AP6A 3AFGA 4QS7A 3VQPA 1DQ8A 3NCIA 4Z7YA 4F25A 3UNGC 4LF9K 2CQ1A 3PYDA 2HEKA 3AVHA 4Z4GA 1RDUA 3DFEA 2C3OA 1IKXA 4OX9F 4NEYA 1BA0A 4QJVA 5IC4B 5LSLA 1T7PA 4GC6A 2B9XA 4QWAA 1F21A 4UOHA 1VQKS 4P2MA 3JQKA 5FIIA 1NPRA 2RU9A 3CJBA 2DBBA 4DHVA 5CYMA 2B0GA 2OTLN 3M9NB 1ITGA 4ZIVA 1SL2A 4MFBB 3EE8A 2VFTA 2EBGA 4KB7A 1WC3A 2LYVA 1Q81O 3CXCM 3N5BA 5IT0A 2UYTA 3BDPA 3BJYA 2ITGA 2ZD1A 3UNYA 1YJUA 1NLKL 4YDXA 2OZSA 4BRIA 4AHRA 4QIFA 3MR7A 3NS6A 5F8HA 1CC7A 1JCEA 2D4WA 1VQ4S 3ZETB 5ETVA 3R7SB 1OQ3A 2VV5A 3WNFA 3K9JA 4USKA 3IN5A 1G2EA 2HVHA 1U8WA 1VR6A 2HK3A 3SMPA 4CNZA 5I42B 4PR6A 2OCEA 2OD4A 4FL9A 2WCXA 4EYHB 1WI6A 1KVJA 3P31A 3W65A 3F44A 3LDNA 4DCOB 3THXB 3ITHA 5GADU 4H4OA 1IG9A 1S1TA 4AHTA 2ZH9A 2E2OA 4JI8F 3TX0A 1QVGM 3K5PA 1EKSA 2ZDPA 2A1RA 4LVOP 4X4SA 1NK5A 2BZ2A 3PM9A 1Y7PA 3DLKA 3TZXA 1F2GA 3PUFA 1FCAA 3HJVA 2FHMA 1FXLA 3M8ZA 4CHYA 4TU7A 1NEEA 2HFZA 2JLFA 3CJKA 1S77D 4DV1F 3VQQA 1OY8A 1R7IA 3VENA 4C11B 3EEQA 4F2RA 4ILMA 3ZTSA 5HROA 1RILA 2E4LA 1K8KA 1QTNB 1GLEG 3BSCA 4M94A 4JI6F 3F5TA 3L6QA 3OR1A 2DXEA 1SV5A 2XY8A 1Y3KA 4YP3A 5C24A 2ADCA 3ENBA 4ILHA 4CJ7A 2UUAF 3FLCO 2QYGA 1NPKA 1IVZA 1NJIT 2W6LA 2AHOB 3Q8PB 4WFNL 4PYAA 3KUEA 4LSZB 1UPMB 3KKSA 3VF4A 4WYWA 2HWHA 2C3UA 2XMKA 3KD5E 4IOCQ 3LQVA 3A12A 1SC4B 4E2FB 3FVYA 1KXPA 1H38A 1JXBA 5C15A 3CFPA 1DKGD 3G9CA 1WSIA 1N4LA 2G4BA 1M5SA 1T3OA 2DR8A 1BQMB 4ILJA 3VF6A 4RKUC 3G8TA 2OTLS 4CF1A 3A4TA 2AIRB 2F4VJ 1QSLA 2VL1A 5IXUA 2P9LB 3ZTRA 3K5LA 3N6MA 3AY0A 3PRDA 1U47A 2KRRA 4OPKA 2BXJA 3OS1A 3T1HF 2ZUAA 3F0NA 1S6UA 3G8QA 3NF7A 4FPAA 1S7HA 1NDCA 1IBLF 3O08A 4MIBA 3DYAB 3TTCA 3IG1A 4C8YA 2N7YA 3M30B 2LXUA 4B3TK 1UPPA 3QGPA 2WK4A 2YBVA 3RTVA 1GXTA 1NJXA 2XQCA 2ZBQA 2J0WA 3M32A 3A8EA 3BGOP 2B9EA 4H4KC 3BUZB 2DGUA 4AL7A 3NNAA 5HL7Q 2DPNA 3B78A 5BRDA 2XLIA 3ALYA 2YNHA 1C0UB 4OI0A 3N28A 1HNIA 3K0JA 9RUBA 3TI0A 4E7IA 3FC9A 2QLBB 3U6FA 2FBXA 3DXSX 2B7CB 2V2VA 4N77A 3U1MA 4RG8A 1B0VA 3OW2R 3CIMA 5K20B 1HKBA 3O44A 4JBCA 1JCGA 2PA3A 2H5JB 3HK2A 5T7LB 2D0PA 2EWSA 4N41A 5BN9A 3V1QA 3J7YI 3I9V9 4WFAL 4FXVA 2PI5A 3D0GE 4L3QA 5EY4A 3CCRN 2IM0A 4P2FA 4BRPA 1WG4A 4B1YB 4U95A 2BKPA 4YR2A 5HAOA 1F9EB 1YBAA 2PSZA 3DLEB 2EKNA 2XYPB 1FJGK 1FTRA 3EVMA 2VGNA 1BLUA 4IYQA 4EEYA 3MTJA 3DLLQ 2A1SA 3HHNB 3TVZA 4BWMA 5EWEA 1WN7A 2B9YA 3DLJA 2IS3A 4FOEA 2R8GA 2C3PA 3LDPA 2Q66A 2E5JA 5FPEA 5HO4A 2ZOFA 5RUBA 4OX7A 5L1IA 4B9MA 2O5DA 2IRYA 3PJ9A 1ZBSA 4XPEA 4RUHA 2HFOA 2F8SA 2D3ZA 2E1PA 1URRA 4U7UK 3NGSA 4QPTA 2OPRA 4BG9A 3TABA 4QR2A 5GAHP 5M2RA 5GINA 4P2SA 4LT6A 4DV5K 4BR7A 3BY5A 3EO3A 4CJQA 1SPBP 2WTUA 2ZZTA 3MTKA 4NLQA 3OL8A 2WBMA 2MEWA 3OYMA 2YWKA 3T5LA 3D9BA 5DQGA 4BHQA 3Q7BA 4IFEA 1EARA 4CJVA 3TYTA 4QOTA 4JI5K 3ISNC 3S41A 1IKYA 3OTOK 4F0KA 4HKQA 3R8YA 3RZAA 4YHHK 4KJIA 2DHHA 2IOCA 4ZVSB 1KVBA 5GAGU 2G13A 2EBEA 4ZVGA 3RSEA 1KNZA 3H1QA 3MECB 4WFNQ 2WAQD 3ZZ0A 2LLZA 8RUCA 3V1RA 3I82A 1KDNA 1U1RA 2QM1A 3PY8A 4M41A 4Z4FA 1HBNA 1U02A 1GXUA 1V4TA 2FVRA 1RKIA 2ALYB 5B0AA 4NXMK 2PYJA 1IUJA 4FS2A 3RBDA 2P9CA 1VRUB 3CJ0A 4B1XB 4QYZJ 1I39A 3CCLN 3S3NA 2W2PP 1GEHA 4RWWA 1VK8A 2BGGA 1S0NA 3SIPB 3CCRS 3RR7A 3IRXB 2HYIB 3V4IB 1S1VA 1FRKA 1RDDA 1E4GT 3VOVA 4LH5A 2OD6A 3UB5A 1YJTA 2QI2A 2GJ2A 1HQEA 1NGBA 4BY9C 1RHMB 4BRNA 3TQ1A 5KT4A 2N7CA 3I0SB 4OPAA 4ID8A 4P6QA 3IR5B 4J37A 3L4BC 1YT3A 3GSDA 3PSFA 2G0CA 1VQ9N 1RWXB 1N6QB 3DXMA 1B7YB 1TFWA 1V3ZA 1FERA 2LQ9A 4HTUA 1Q9XA 2AEMA 4ED0A 4JN4A 2RRBA 1HI1A 4J9RA 1W2BR 4WYLA 1RT7B 4IKAA 3OBWA 1RHRB 1QM9A 3GFHA 5DS7A 1O13A 4OV6A 5H1SV 4A59A 5EHHA 2V8GA 5DDPC 4OHXA 2WHOA 3LAKA 4H4MB 3L7UA 4M3ZA 2K3KA 1RT3B 2NSBA 3G0ZA 1GOBA 2CGKA 1FJEB 2QA4N 3RMCA 2PEBA 4RJVA 4DUZF 3G4SN 3EZ5A 4AFFA 1RT5B 3W62A 3NAIA 3KJFB 3JTNA 2IM3A 3VA0A 1UWAA 1D0EA 1K1SA 1ELOA 3OVAA 2JRSA 2KQ2A 1AZSA 2VODA 4DS5A 4CEEA 2DNHA 2VWJA 5BYRA 5IWAK 3VPZA 1XUPO 1X4EA 3H2LA 4DDFA 2L08A 4FVCA 1KAYA 4GKKK 1BWEA 1T95A 2EPIA 1X4DA 1KLNA 3DRRB 1R0CB 2J9CA 4L74A 2VFRA 1HI8A 1DARA 2VGMA 1YTYA 3TAFA 1TMMA 3QGHA 3NGYA 1U8SA 5CA5A 2EK1A 5KQ8A 1NHVA 4OX9K 4CBXA 1ZBTA 2QMUB 1XIQA 2I38A 4DR7J 3AOCA 1XC3A 3MFHA 3TUZC 3EJMA 4GO5X 3AA3A 5AQNA 1HYVA 1UMJA 1KCFA 3CCLS 1WTFA 1JK9B 3MEDB 2DTJA 4WF9L 2OSRA 2POKA 3SSRA 4OQJA 4FJ9A 3BO4A 3O4NA 3OS2A 1XQSC 4KHWA 1SL0A 1TUUA 4BC5A 4D3HA 2CRLA 5TKWA 4FCYA 1F9FA 2NXEA 5DMRA 3NS5A 1E6YB 4PZVA 4TSXA 4QBUA 4ED1A 1CULB 4CGJA 3O3LA 1S79A 3I32A 4DU8A 2Q2RA 4OZ5A 2E44A 1JXVA 4PRFA 5KTQA 2AT1B 2CPYA 4ES3A 3THVA 3F73A 2ADBA 4DR4F 3UD4P 3PEJA 4Y1CA 1VQ9S 5DM6L 2CH5A 3QDKA 3T1YF 2KH9A 2N4DA 3MEGA 1TUWA 2XO6A 1MSWD 1NU0A 4PWDA 2WSFC 5KFDA 4DF4A 1UEUA 2IVOA 2R2RA 1RHJB 5F9LA 4ZP7A 2O8DA 1U48A 3HHLC 2GMJA 5K8NA 4JI8K 3QIPA 2IA0A 5KFPA 4CK1A 2NLWA 4WQ4A 1NSKL 3Q8VA 2QA4S 1JL2A