3LAKA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-heterocycle pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
publication title N1-Heterocyclic pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lakA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lakA05
1T05A 2W42A 4EBEA 4N47A 5C25A 4IRKA 3QO9A 1S6PA 1RT4A 3LAKA 3M8PB 4CJVA 3WNEA 4ECZA 1S9FA 1JLGA 1BQMA 3KD5E 5KFNA 3ISNC 3IS9B 2UVRA 2YNIA 3MR3A 3QO9B 4ED3A 1DTQA 3N6LA 4Q45A 3LPTA 2KQ2A 1I6JA 2YNFA 1QSSA 3PW0A 2KFZA 5EWGA 5DG7A 3VQCA 1BQMB 1W0HA 4Y2AA 3CO9A 2YKNA 1BI4B 4NYFA 5SWMA 1WNEA 2HHTA 4DTSA 3LZIA 3CG7A 2Y1IA 1FXXA 2YNFB 4NLDA 2FLPA 3H08A 4Q44A 1TAQA 3DRPA 3Q8RB 1WSEA 3LP0A 1SL1A 3T3FA 3C6UB 3SQ2A 1FKPA 1S10A 4K4XA 1NKEA 3FSIA 1ZBFA 4F50A 3C6TA 3SV3A 1JL2A 1B9DA 4KO0B 2WOMA 3LP0B 4Q43A 3OY9A 2AU0A 3KNAA 1WAFA 2KZZA 2BGGA 4U6PA 2QKKA 2RN2A 4KV8A 3MECB 2CJQA 1SH0A 1CZ9A 1S1VA 1TV6A 3A2FA 2WOMB 1U48A 5HLFA 4RW4A 4BACA 3Q8QB 1ASVA 3VQ6A 2D41A 4FCYA 4DQIA 3CYMA 2VG7B 1LW0A 5KT7A 4FLUA 1W25A 4WYWA 2IJFA 1TV6B 4HHTA 5DQHA 3NBPA 3GYNA 4RW4B 5DLFA 4LY7A 3HK2A 3HSTB 3DDKA 4Y1DA 3RB0A 4ZVHA 4B08A 4KAIA 5KFMA 4ECXA 3PUFA 1NJZA 1SH3A 2F8SA 2PYLA 2X6SA 3AA2A 3NBPB 1IG9A 3AVJA 4JS4A 4KHRA 1MMLA 3DLEB 3AVAA 2FVCA 3TAEA 1C1BA 4RZRA 4KREA 3IRXA 1UA1A 5F8JA 3G6VA 3P5JA 4OLAA 3ZT2A 2C28A 1U49A 2ATQA 2DFFA 3DOLA 4HUGA 3MEDA 1JXLA 2FJVA 1U4BA 1NK5A 3O3FA 2IM1A 4Z4HA 4FM1A 4FBUA 1C1BB 1QAIA 2P1JA 2YHAA 3NL0A 1B9FA 3DLKB 3O4NA 1N4LA 2P51A 3CJ3A 4M3WA 3DOLB 3JYTA 1TQLA 3PO4A 4R8UB 5DG8A 3TAPA 4M45A 1UOCA 5KFEA 4J9LA 4RUAA 3LWLA 4DLGA 3C95A 4FK0A 4K4TA 4FXDA 5KTQA 3CM6A 4F2SA 4M41A 3JYTB 4NLQA 1JXEA 3LP1A 1IKXA 4CEDA 4ZP8A 2C2EA 4DF8A 2HVIA 4Y2CA 3H40A 5L1IA 4ZVGA 4DFPA 5HRPA 5J2QB 2ILZA 5DG9A 5KT6A 4JRQA 1WSIA 3TAMB 3QIPA 3DLBA 1NJYA 4FJGA 2XY7A 1IKXB 4LH4A 3LP3A 4MKAA 1L3TA 1HMVA 4IBNA 4EO8A 1D5AA 4QWBA 5KT2A 3G86A 4DQQA 4ID5B 3VQAA 1KSPA 4B9MA 3ZSQA 3T19A 4HUFA 3QIPB 2BE2B 1Z4UA 1SL2A 3QZ8A 4GC7A 1KLNA 1VSJA 4IH7A 4PQUA 4B9NA 5KT4A 1LW2A 3CIZA 3MEGA 4U7CA 4IR1A 4WFXA 1S1TB 4ZPDA 3U6FA 1EP4A 2HAIA 2ITGA 5J2MB 1ZTTA 3RR7A 4AHCA 4KI4A 1RTIA 3HVAA 4RW9B 4JV1A 1GOBA 3PHEA 1LAWA 3MR2A 1LW2B 3OYBA 1S1WA 1VSEA 2D0BA 4OJRA 4IG3B 4YP3A 1BISA 1SH2A 1S4FA 4CGGA 2G8IA 4WFZA 3SPYA 2AX1A 2OPRB 4HKQA 4CJ3A 3G6YA 1VRTB 3HVTB 5KFTA 3VQSA 3ZSZA 3RB6A 3D0PA 4XPEA 1KLMA 4KKOA 3NGYA 5KRSA 4O3OA 3ZT1A 4DL4A 1CXUA 5KI6A 1JLBB 4TY8B 4O0IA 4JV0A 2AQ4A 1GOAA 3ZT4A 1KLMB 4KKOB 1RDCA 4QOZB 4FK4A 4R5PA 4CF9A 2VG5B 3SFGA 3RMCA 4GVMA 5KFHA 4L8RB 4B9SA 5KFDA 5SZTA 4ZP9A 4Q5VA 1FKOA 2BR0A 1I3AA 4IRDA 2HB5A 2B4JA 3ZSYA 4QWEA 2OA8A 3H2LA 4DL3A 2UVWA 4Q0BB 1Z26A 5HP1A 3OYCA 3IGVA 4FW1A 3IG1A 4CGIA 2IOCA 2BQRA 3FDSA 4NYZA 2WONA 2YNHA 5HRRA 3LWMA 3TVKA 4ECRA 4G1QA 3H5SA 3DYAA 1D9DA 4BDPA 4WE1A 5HP1B 3RAXA 4Z0UA 3Q8SB 3V6HA 3AVFA 3IG1B 3NE6A 2WONB 1X9SA 2YNHB 2YV0X 1J5OB 4Z4EA 1S1XA 4W5OA 3DYAB 1RILA 4B9TA 4WE1B 4EYIB 4K4VA 2BANB 5CYQB 4ZPAA 2B43A 4DL6A 1S97A 1C2PA 4IFVB 2BRLA 4NRUA 2FBVA 3TI0A 3L3VA 4OKKA 3IAYA 3T1AA 1K6YA 3DLGA 4EZ6A 2BQ3A 4GC6A 3OL7A 2DFHA 2YKMB 1T03A 3HYFA 4ELVA 2IMWP 3LP2A 3E01A 3QZ7A 4W5RA 5J2PB 1WSGA 5FRMA 4NZ0A 5J1EA 3SUNA 4J9NA 3OSNA 4GMJB 3HKWA 4O3NA 1ZBLA 4J9RA 3GIKA 2E4LA 1QSYA 2ZE2B 3T5JA 1HARA 5KFOA 4MKBA 2IA6A 2HNZA 4I7FA 1RT1A 4ED6A 3M9OB 3LPUA 3KLFA 4RU9A 1LV5A 3KK3A 3PR5B 3K5OA 4MIAA 5J1EB 2AGOA 2JLEA 4ECVA 5F8IA 1CLQA 1SKSA 3PW5A 4CK1A 3ITHA 1NHUA 1WSFA 4F4KA 2HNZB 1RT1B 2JEFA 3T5HA 5FRNA 1B92A 1DTTA 3KLFB 3S3NA 3I5BA 3KK3B 5KFWA 4N76A 4M3UA 1WSJA 4LSNB 4BE0A 2GUIA 4QW9A 3G6XA 4TQRA 4CIFA 4RW6A 3ITHB 2E9RX 4NCGA 2UUTA 4DU3A 3SFUA 2HW3A 2O4IA 2R8IA 1RBSA 1BCMA 5KG5A 2HHVA 1KFDA 4O4GA 1S0OA 1Q8IA 1L3UA 4NLXA 4E3SA 4EP4A 1TKZA 2UUWA 2J6SA 3V1OA 4ECYA 1BIZA 1JLAB 4KTQA 5KFFA 2RKIA 4I2QA 4O5BA 1L3VA 4DTPA 2HHXA 1U09A 3AVKA 4NCBA 3UPFA 4CF8A 4FBTA 3BSCA 4CEEA 5KFGA 1VSKA 1JLFB 4IH5A 1CSJA 4W5NA 3OYAA 3Q8PB 1EX4A 1SUQB 4W5TA 1S1UB 2QXFA 3NF6A 4CFBA 3DMJA 5CZ2A 3K2PA 5HBMA 1EXQA 4Z4FA 4DQPA 3TQ1A 2W9BA 4DLEA 3TARA 2E6LA 3F9KA 3RRGA 3CDWA 4CJWA 4CF2A 4DSJA 4IDKB 3DMJB 4PWDB 1IKWA 4J2EA 4F3OA 4IRCA 5KFKA 1RBVA 5HBMB 1K1QA 4F4ZA 4CEAA 3B6PA 3NAHA 3RB4A 1OS5A 3KLVA 2DPIA 1HYZA 4NRTA 2W9BB 2W9CA 1S9GA 1EKEA 3TANA 5KFUA 4ICLA 4M95A 2AX0A 3NAIA 2R8JA 1D9FA 5KGWA 3VQEA 4J9MA 3CDUA 3M8PA 1GX6A 2EC0A 1RT5A 1VK0A 2G8KA 4LQ9A 5F8HA 4DS5A 1S9GB 3HP9A 3IS9A 4CJQA 4OGEA 4AHTA 4ICLB 3V81A 2O4GA 3KK1A 4FJXA 3OYMA 1MU2A 5HROA 2IC3A 3PY8A 1VRUB 4ELUA 1RT5B 5CY4A 5C5JA 3TR8A 4K50A 2XGPA 3OSPA 3KKRA 1L3SA 4RNHA 2RDJA 1JKHA 1BI4A 4OKJA 4CFCA 4RNMA 3V6JA 3ULDA 3V81B 4E7KA 5JXSA 3KK1B 5EUHA 1RT2A 3OYGA 1MU2B 1YVFA 5HROB 4IFYA 2IC3B 5CYMB 2XCAA 3SI6A 1VSLA 3C6UA 3LANA 2JGUA 2Q3SA 2ZKUA 4CJUA 3SYZA 1JKHB 4BDZA 4J2BA 2FJXA 3ZCMA 1RT2B 3H4BA 4IFYB 4KO0A 4QW8A 3VQDA 2NUBA 1I39A 4EZ9A 4WFYA 3HXMA 2HHSA 4YR3A 3EPGA 4CHYA 4DF4A 2C2DA 3VQBA 3F73A 3GIJA 2FVQA 4DL5A 1LAVA 1F21A 3OYJA 4NLRA 3QEIA 3MECA 4XIUA 3QNOA 3S9HA 3KHGA 1C1CB 5KT5A 3MFIA 1RA6A 4ECUA 5DGAA 2VG7A 3RB3A 3AVMA 4FVMA 1D1UA 1A5VA 3CWJA 1TAUA 3L2VA 4YQWA 4FLYA 4CJEA 3QEPA 3S3MA 5EDWA 1QQCA 3CVKA 5F8NA 5K14A 3SCXA 2ZD1A 3V1RA 3V4IA 4F4YA 2IM0A 5F8LA 3ZSOA 4WZQA 4W5QA 3M9NB 1W9HA 3BSNA 3PO5A 3PW4A 4NYNA 1RDDA 1HYVA 4H4MB 4ECSA 4DL2A 4PY5A 5K14B 2ZD1B 5KG4A 3V4IB 2HWHA 2FBTA 1RDRA 3LALA 5KRTA 3DLEA 3M8SA 3AO5A 3AVLA 5F9LA 5L1JA 4CFDA 4NLPA 3ALYA 4FJJA 1S6QB 4ED0A 1LWFB 4FJ7A 2AJQA 3MR5A 3H4DA 2WCXA 1XC9A 1SL0A 4LH5A 3KLHB 4KHWA 3HPOA 3M8RA 2Z1IA 3DLKA 2CKWA 1RBTA 4JV2A 3EY1A 3TAQA 1U45A 4RW8A 3O4QA 4R8UA 4CJPA 1RT7B 4ELTA 4KFBB 1Q9XA 4EP5A 3PV8A 1N48A 3NCIA 5KFYA 1IO2A 4RW8B 3EZ5A 4AHUA 5F8MA 4PUOB 2B5JB 1ZBIA 5DK5A 4TN2A 3GIMA 3NH2A 1RT6B 4DU4A 3M9MB 1JLEA 5J2QA 4KSEB 4IKAA 3HT3A 2W8LA 4FLZA 3TAMA 4CEBA 1JLQA 3WNHA 3UIQA 2HMIA 1X9MA 2QK9A 5KG3A 1A5XA 1JLEB 2YNGB 4ID5A 3HJFA 1JLQB 2F8TA 2BE2A 2HMIB 1BHLA 4O3SA 4RNOA 5JS2A 4ZPBA 1S1TA 3LAMA 5J2MA 3ZSVA 2G8VA 5KFQA 2G8FA 3QEXA 3DLRA 1VSHA 4RG8A 3KMQA 1HJRA 2F8EX 4RW9A 4RNNA 4FJ5A 1ZYQA 5EWEA 2D0CA 3ASMA 4IG3A 3VQPA 2WHOA 2R8KA 2OPRA 3OS2A 1NNDA 1VRTA 1IKYB 4K8XA 3HVTA 3KJVB 4OPJA 3DOKA 3L2QA 4TLRA 4M3RA 1TK0A 5KFLA 4MK7A 5KFJA 3NAEA 2G8WA 1KHVA 4CIGA 3L2UA 4KHYA 1SV5B 1KTQA 4QCLA 1NK0A 5L1KA 3DOKB 4E89A 4TYAA 3SQ1A 1JLBA 1KFSA 4TY8A 3I5CA 3P83D 4Q8FA 3KLEA 1NJXA 2F96A 3HO1A 5L1LA 2OPPB 3KTQA 1WNSA 3D5MA 4DTXA 4F2RA 2VG5A 4CK3A 1J54A 3OJSA 4FJHA 5I42B 4DQRA 1T94A 2JEIA 1CXQA 3LDSA 4TXSA 1S0MA 2KTQA 3KLEB 2WK4A 4NLTA 2HWIA 5KFRA 1YVUA 4FLTA 4Q0BA 4JLHA 4C8LA 1FK9A 3I0RA 2Z1JA 2PYJA 1D0EA 1HNIB 4AILC 3L8BA 3PW7A 1U04A 4K8ZA 3RRHA 1BQNA 3UQSA 4CGDA 4FLWA 3CQ8A 1IKVB 1FK9B 2IAJB 4ED7A 4ECWA 4PA1A 3I0RB 4J9SA 4OKEA 4ZMMA 4DQSA 4IR9A 3DLHA 1J5OA 2OPSB 2XI2A 4NLWA 3PX0A 3SUOA 2XRIA 3GV7B 2VWKA 1BQNB 2BANA 5CYQA 2VWJA 2R2UA 4CJFA 1QSLA 4IFVA 3KD1E 4E1NA 1O1WA 2KFNA 2VG6A 5EU7A 3MEEB 4H54A 4DFMA 5JS1A 1TKTB 2YKMA 2XC9A 1RTJB 4URGA 3I0SB 3BREA 2GV9A 3BSOA 2PZSA 4B9LA 2FBYA 5J2PA 2VG6B 4EYHB 4CFAA 3CFRA 1RYSA 2ZE2A 3CJ4A 4URQU 4E7HA 4DSLA 4F8RA 1TVRB 1K1SA 2HNDB 3QLHB 1KCFA 4HYKA 4HVJA 1N5YA 1XR6A 2E9ZA 3AO4A 1RT3A 2XY6A 4QPXA 3THVA 3KLGA 5KG2A 4Z4GA 4ZP7A 4O3RA 1RTHA 4E1MA 3MF5A 4CGHA 3NGZA 2IDOA 3OVNA 2IM3A 4CHNA 4JS5A 1N5YB 4M3TA 3DM2A 2GIRA 2JC1A 4LSNA 3RTVA 1RT3B 4DSEA 5D3GA 4CJ4A 4FZXC 2XY5A 3KLGB 4ZTFA 2W9AA 4RW7A 4ZP6A 1RTHB 4N5SA 3CJ5A 1XHXA 1ITGA 3OYKA 4E7LA 1HQEB 5C42A 1KRPA 3DM2B 1JX4A 2GIQA 1XHZA 3L2RA 4KHSA 1X9WA 5D3GB 1NOYA 1D8YA 2ATLA 3EZUA 3HVRA 1RCHA 4RW7B 2UVUA 4K4UA 2C22A 1HRHA 3K5NA 4WXWA 4ED1A 1JLAA 1RNHA 1JLCA 1HNVA 3T5LA 4JUZA 5C42B 1WLJA 2HNYA 4TQSA 3N6MA 2UVVA 4CF1A 3SJJA 1TKXB 4I2PB 4ECQA 3V9UA 3HPHA 4CEOA 2DY4A 1X1PA 5JUMA 4CERA 1JLFA 1BIUA 4FJNA 4CIEA 2A1SA 2OZMA 1JLCB 1HNVB 4Q8EA 4C8MA 1G15A 1SUQA 3KK2B 2V0NA 4X2BA 1S1UA 2HNYB 1C0TA 3HHKA 3HVWA 4O0JA 3O3GA 4YR0A 1TK5A 2OZSA 1N56A 1DLOA 2P5OA 2JEJA 4FM2A 2I1RA 4FLVA 3QNNA 2ASDA 3QEVA 1C0TB 4O55A 4IDKA 3QESA 4PWDA 4QAGA 2EX3A 4FS1A 3VA0A 2KW4A 3SUPA 4CHZA 3V9ZA 2V4RA 3MXMA 1DLOB 3V9WA 4ZHRA 2WTFA 4FJIA 5DGBA 3BR9A 3L3UA 4K4WA 3SUQA 2IJNA 3BSAA 2XI3A 4KHNA 3EPIA 4KE5A 3AA5X 1REVA 3MAQA 5KFSA 4J2DA 2C2RA 1RTDA 1TGOA 2DTUA 4ZHRB 4CGFA 3AVGA 2X78A 2QKBA 1KHWA 2AGPA 4DL7A 4LSLB 5KFCA 3MXJA 2FLNA 4ZVEA 4K4ZA 2EHGA 5J2NB 2WB4A 2FC0A 5F8GA 3V6DA 1REVB 1VSDA 4GW6A 3BQ1A 1NK7A 1RTDB 5DQIA 1Q9YA 3VQQA 3QERA 4FZYA 1VRUA 4CJ5A 2OYQA 3S3OA 2W8KA 3SI8A 3V6DB 4CESA 3M8QA 2E6MA 5CYMA 4KBIA 3BGRA 3VQ7A 1BGXT 2RF2B 4KHQA 1RA7A 2HVHA 4ED2A 3OHAA 4KTZA 1C0UB 4ZVFA 4NLGA 3KHRA 4N56A 5F9NA 3M8QB 4CEQA 4M42A 3BGRB 3BQ0A 5I3UB 1R0AB 5KG0A 4HCCA 4F4WA 4DTUA 2GC8A 1LWCA 4XPCA 1VSFA 1S9EA 2BQUA 1T05B 2QE5A 1WAJA 5C25B 2D3UA 2XY8A 3I8DA 3GQCA 1S6PB 4O3PA 3PVXA 1RDBA 4M3ZA 1RT4B 4DTOA 2A1RA 3V1QA 4C8OA 2YHBA 1KVCA 5DMRA 2ASJA 3PX4A 1C1CA 3QINA 3LZJA 3RWUA 4XO0A 1JLGB 4YMEA 1LWCB 3QIDA 3VQ4A 4Z4IA 1ZBHA 1S9EB 2RPIA 2YNIB 2FLLA 3RMBA 1DTQB 4EBDA 4K4YA 1GOCA 1KVAA 3MXIA 4O4RA 2R2TA 3MFHA 1UA0A 3AVNA 3OYNA 3NDKA 3FQKA 4CF0A 4BE2A 1SKRA 5KFVA 4IKFA 3VN5A 4FJ8A 3SZ2A 4AHRA 3K59A 4EEYA 2YKNB 4DFKA 3MR6A 2I5JA 4AHVA 2VA3A 3KMSA 2G8UA 2IGIA 3KIOA 3NH1A 4H4MA 3DRPB 3WNGA 4E0DA 2R2SA 4Y3CA 2OPQA 4NLOA 4DSKA 1Z25A 1FKPB 1QE1A 2XHBA 3U3YA 4KAZA 2LSNA 2I5JB 5FROA 4N41A 4H4OA 3C6TB 3NKYA 4MIBA 2XO7A 2FVPA 3AVBA 2IM2A 1S6QA 3NHGA 5L9XA 1LWFA 2OPQB 1TL1A 1S48A 1QE1B 4TYBA 4NLUA 3OJUA 2GBZA 3KLHA 4KV8B 4H4OB 4AHSA 5T14A 1HQUA 4J9QA 2DPJA 3L2WA 1S1VB 1TL1B 3ISND 5EWFA 5HLFB 2ALZA 1S49A 3HL8A 3O3HA 4MQ3A 1RT7A 4AH9A 1UWBA 4KFBA 1NK4A 1RDAA 1LW0B 4FJLA 1HQUB 4M94A 4CHQA 4LD0A 3RMAA 3OYDA 1XR7A 1CZBA 4FZZA 4PUOA 1SKWA 3H5UA 1JL1A 2J6TA 2B5JA 4O3QA 2ILYA 3CM5A 4BDYA 1UWBB 3K5MA 3RMDA 1RT6A 3V9SA 4KB1A 1WN7A 3VQ5A 1RBRA 4IG0A 2QV6A 4ED8A 1BL3A 1Y97A 3GV5B 4YNQA 2E9TA 3KHHA 4ID1A 4TSXA 3IRXB 2V4QA 1NKCA 3HP6A 3OL6A 2FVRA 5KT3A 2YNGA 2OH2A 3PZPA 3V6KA 4IG0B 1C0MA 3BJYA 1ZETA 3MEDB 4BWJA 3RR8A 1XWLA 1T7PA 3OYLA 4JRPA 1ASUA 1RAJA 3OHBA 1NHVA 2P5GA 1C1AA 2R2RA 1LWEA 3SV4A 4KRFA 4B8CA 3RAQA 1QTMA 3PW2A 3NH0A 3MTKA 4B9VA 4BWMA 1BCOA 3TAFA 3EYZA 2J6UA 1ZTWA 3D28A 3H5YA 1LWEB 4DG1A 4CJSA 5KFPA 1ASWA 2BRKA 1IKYA 5FDLA 4CJKA 3KJVA 4H8KA 3LP1B 3QIOA 2G8HA 4DSFA 1L5UA 4DTMA 3DI6A 4C8NA 4KHUA 3HPGA 1JXBA 4Y1CA 2RDIA 2PY5A 1HPZA 4EO6A 4DG1B 1SV5A 2JEGA 2X6NA 5FDLB 3OS0A 4I9QA 1VSMA 4I9LA 1QHTA 3AO2A 3K57A 1HMVB 3OYEA 1EETA 3DI6B 4DMNA 2O5DA 3ICLA 2OPPA 3TABA 1HPZB 4OL8A 2ASLA 5KG7A 2HHQA 3IGNA 5I42A 4DU1A 5E41A 1J53A 1S5JA 4CEFA 3U3GA 1RYRA 1EETB 4PQUB 3MEGB 3P1GA 3OYFA 3D45A 4OGCA 1EP4B 2B6AA 4FYDA 4FJMA 4MH8A 1ZBUA 3T5KA 4J9PA 1RTIB 4IH6A 1HNIA 4DSIA 4KB0A 5C24A 4RUCA 1S1WB 4KI6A 2B6AB 4CHPA 4FS2A 3QGGA 4TY9A 2AWZA 4G3IA 3AVHA 3QYYA 1IKVA 2IAJA 4IOBA 4UQGA 5KFAA 3NF9A 1HYSA 5C24B 3RBDA 2OPSA 3QGIA 3IN5A 2X74A 4NCAA 4B9UA 3VQ8A 4FM0A 4WXOA 2R8GA 1A5WA 3BDPA 5CZ1A 1HYSB 4E19A 3MEEA 1IH7A 1T8EA 4CK2A 5KFBA 1TKTA 3DRRA 4FK2A 3G10A 3I5AA 3N6NA 1RTJA 4WYLA 4R5PB 1T3NA 3I0SA 2Z1GA 4M3XA 4BE1A 4R0EA 1IM4A 3FRZA 1WSHA 3NGIA 3CFPA 1QUVA 1FKOB 3QGHA 2ZQBA 1RBUA 3CFOA 3ZSWA 3DRRB 4Z4CA 5KG6A 5KFXA 1TVRA 4NLVA 2HNDA 1NK8A 3QLHA 3PR4A 1NOZA 4EBCA 3B6OA 1C6VA 3OL8A 3AO3A 2FVSA 4NLSA 5KG1A 1JIHA 3G0ZA 2R8HA 3VQ9A 2D3ZA 2XWYA 3OS1A 4CJRA 4G1QB 4ECTA 1NJWA 4URSA 3BQ2A 3AA4A 3KKSA 3AO1A 3OLBA 3HM9A 2V9WA 3PJXA 4KB7A 4HCBA 2HHWA 3QEWA 2D7SA 3AV9A 3C94A 2AGQA 1S1XB 1S0NA 2W7PA 3SPZA 3H5XA 3JSMA 4YR2A 4OVLA 1HQEA 2R7YA 4MFBA 4FW2A 4ZPCA 3GILA 5KGXA 5HRNA 3TWHA 3KLIA 4Y34A 3NF7A 4CJLA 4KPYA 3DLGB 4F3TA 1XR5A 4QWDA 3ZT0A 1J9AA 3OYHA 1T03B 4OLBA 1KVBA 4WZMA 3JSMB 4MFBB 3LP2B 3E01B 3KLIB 3NMAA 1TKXA 4I2PA 4CEZA 5HRSA 5DLGA 3GIIA 4I7FB 2FJWA 1NK9A 4HTUA 3NGDA 3E51A 3FFIA 3KK2A 2JC0A 4O44A 4KTWA 4MK9A 5T7BA 3SQ4A 3KOAA 2FBXA 4MK8A 3CJ0A 1TP7A 3ZSRA 1N6QA 4CECA 1NK6A 3VA3A 2XCPA 3H59A 4E7IA 4LQ3A 3CDEA 4CJTA 1DTTB 1GX5A 2HHUA 2IS3A 3H98A 4J9OA 4DEZA 5KFIA 3NFAA 3FFIB 3AVCA 5KFZA 1YTAA 4O44B 4QWCA 2Y1JA 3ZT3A 4B3OA 2W7OA 4QWAA 4YFUA 1N6QB 4RW6B 2DFEA 1XI1A 4NCGB 2XGQA 4CE9A 2BDPA 1VSIA 2D0AA 4FJKA 3K58A 4FJ9A 1TKDA 4FLXA 3SNNA 4C8KA 1TL3A 3WNFA 1QAJA 4B3OB 2WRMA 4O4GB 1YT3A 2KZMA 2VA2A 3OYIA 1TKZB 3KHLA 3UR0A 3DRSA 3RBEA 2IBKA 1YTUA 2ETJA 2RKIB 4I2QB 4LSLA 1TL3B 5J2NA 4CGJA 4DTNA 1NKBA 4K4SA 4F4XA 3UDLA 1U47A 4DWIA 4M3YA 4HUEA 4RNFA 4DFJA 4CCHA 2D5RA 3NF8A 3DRSB 3OLAA 3OL9A 3FQLA 3AA3A 3PX6A 4DTRA 3CJ2A 3K5LA 5DQGA 4ZTJA 1UAXA 4DS4A 3AVIA 3QETA 4NLYA 2RF2A 4J9KA 4KHMA 1QS4A 4E7JA 1C0UA 4OPKA 3ZSXA 1TK8A 4DTJA 1IKWB 3TAGA 3V9XA 3PJWA 5I3UA 1R0AA 2Z1HA 4CHOA 2W9CB 3GV8B 4IQXA 3SQ0A 4J2AA 4B8AB
chains in the Genus database with same CATH superfamily
2W42A 4N47A 3EICA 1RT4A 1VJWA 1SZ2A 3M8PB 5LL6d 2E7WA 5DDRC 2POKA 1HBMB 2QA4N 3KD5E 2GW8A 2ZJQL 2F9JA 3MR3A 2B3TB 4Q45A 1F9FA 3PW0A 1U25A 1IJEB 5EWGA 5DG7A 3VQCA 4A62A 1BQMB 1W0HA 1ZM4A 2RILA 2E2PA 5SWMA 1NSAA 1XNQK 3LZIA 3FCHA 3CG7A 4NA1A 4NLDA 3H08A 4YDDB 4Q44A 2LU1A 4BC7A 3LP0A 4P52A 1SL1A 4GKKK 3KUGA 1FKPA 3KZBA 3CCEN 4ZVSB 4EIAA 4LF5K 3FSIA 1ZBFA 3ENAA 3DFEA 3M05A 4F50A 2PGCA 4QPTA 4QBUA 3SV3A 4P2FA 2RS2A 4KO0B 1OYDA 3DGPA 2CWXA 1AZSA 2DYAA 4Q43A 1XMBA 3W66A 4OZ5A 1AA1B 2YWGA 5AXMA 4LF9F 2XHCA 3NRBA 4DV4F 2HOEA 2QKKA 5FPMA 3VCDA 3MURP 2CJQA 4OZLA 1CZ9A 4CNYA 4BREA 4JI5K 2AJ1A 5HLFA 2VCPA 1NHKL 1I3OB 1KC8T 1ASVA 5MAOA 2VG7B 1M90T 1W25A 4BC3A 1TV6B 3D66A 3HI9A 3C16A 3NOCA 3TOQA 4LY7A 3HK2A 3HSTB 4Y1DA 2VICA 1NDCA 3JXOA 4B08A 1HX1A 4GKJK 3T6BA 4QU7A 3HOTA 8RUCA 2QIFA 2X6SA 2IIRA 4HDGA 1IG9A 2HQIA 1MMLA 3DLEB 3AVAA 3TAEA 3HFVA 2W4PA 1WKKA 2MKKA 2ATCB 1M5PC 3P5JA 2QEXS 4OLAA 3G96A 1IQZA 2C28A 1U49A 4RBVA 2ATQA 4HUGA 5A8KA 4PABA 3MEDA 2CNKB 4UOHA 2RUGA 2MZQA 4CH0S 3MX2A 2DNQA 2P1JA 2WVFA 3A8JA 5A2QY 4K2XA 3CJ3A 5B0EA 3BP8A 3DOLB 4RLEA 2B4PA 2EI5A 4BVPA 5AQRA 3BBCA 1UOCA 2WZ1A 1UW9A 2OFGX 1Y11A 4WFNQ 4FK0A 4K4TA 4OYBA 4FXDA 1LNQA 3CM6A 2HFUA 3JYTB 4NLQA 2C2KB 1WHVA 5K9FA 2XZTB 2CQ4A 1IKXA 2OAUA 3P4IA 2GWKA 1WG5A 1S0VA 3H40A 3IM9A 3QWUA 5J2QB 3UR3C 1T9VA 3KWMA 4LJMA 3E66A 1P8ZA 3TAMB 1UVKA 1VQNN 1ZAXA 2P6SA 1P6TA 4I6MA 4FJGA 4OHZA 2XNRA 3THWB 4QS9A 4L3QA 3QMQA 3LP3A 1L3TA 1KTVA 4GV9A 3MGJA 2DD8S 4GO5X 2P9KA 3QATA 3ILJA 5T7LA 4HTLA 4HUFA 4K0KK 5DDPC 1SL2A 2ZH4A 2YBVA 1KLNA 4BVOA 1HW8A 1KNZA 1G4CA 3CIZA 2RU9A 4WFXA 4ZPDA 3E8OA 2HAIA 2GELA 2FHKA 5E26A 2JH3A 3CCSN 4J5OA 2YKQA 1IWAA 4WYBA 4YOWA 3B78A 3O1WA 4PR6A 3R97A 1RTIA 4CLSA 2HPUA 3ILOA 2F7TA 3DXMA 4IG3B 2DHXA 2PBDA 3FNNA 1FE4A 2E7VA 2G8IA 5AQOA 4EAHD 2PFDA 3G6YA 1C4CA 3D1QA 4P2XA 4CZIA 3RB6A 1Q8LA 4DR3F 1KLMA 3A12A 4KKOA 3OBYA 3BB5A 3NGYA 4AL5A 3ZNJ1 2QZ8A 5KRSA 2HZVA 4O3OA 1YZ6A 2EW9A 2L3MA 5M2UA 5JVHQ 3D2WA 4O0IA 4GVEA 3HFZB 4FK4A 2FC8A 3HJVA 3RMCA 1IXKA 4JI3F 1S99A 4L8RB 3BF1A 3R1XA 2PIIA 4Q5VA 2J8AA 1I3AA 5BR8F 4QWEA 2CPHA 3H2LA 4DL3A 4OZ3A 1U1MA 5HP1A 1V5VA 3ELHA 1BU6O 3IBWA 3VGVA 4NMLA 1BG3A 3IG1A 3FCVA 2IOCA 2OO4A 4PKGA 5M1QA 4MTPA 3C7NB 3DYAA 1I1GA 1OSCA 2Y9HA 1HNZF 2A1BA 4Z0UA 2HGLA 1MSWD 4ZJQA 4NEYA 5LT5A 2YNHB 3SDEA 2BW2A 5A8WB 2E2NA 1RDUA 3B54A 2CFXA 5D8HB 2ZJRL 4WE1B 3JSBA 2B43A 4DL6A 3OTDA 5AQQA 2BRLA 4C9DA 4NI2A 3L3VA 2RHQB 4ITSA 5M1FA 4GC6A 2RDDA 1DAXA 5FLXY 5AQWA 1FRXA 2CGLA 4M1KA 3IR5B 3A3NB 5J1EA 3SUNA 3MCOA 4FKYA 1DBDA 4XDDA 2CPDA 3ISZA 5ETSA 4J9RA 1KVJA 4CZHA 3H20A 1VCTA 2HNZA 3W1YC 1R8PA 1VIXA 1NDKA 4OHXA 1DQ9A 2VBXA 2UXDK 3KK3A 3K5OA 1RHKB 1CLQA 1SKSA 4X4UA 3ITHA 3I32A 3JQKA 1PILA 5FRNA 5JICA 2QO3A 1H74A 5KFWA 2ZHBA 2RRNA 2GVDA 4N76A 4USTA 1WSJA 4M3UA 2FSKA 4LSNB 1GTEA 1O6XA 2QA1A 2DRBA 1B7YB 1VR6A 2LEPA 2KT5A 1WBBA 3SFUA 3TJAA 2HW3A 3FGVA 3KKFA 4O4GA 1S0OA 1WOOA 1Q8IA 2V5HG 4NLXA 4LF4F 3S1TA 1TKZA 4LR8A 3P39A 4EP4A 2HG4A 2DH9A 2EEYA 2K1RA 1JLAB 4IOXA 3R8YA 1AFIA 1RCXB 4UTGA 3EN9A 2DPNA 2RSQA 2O8EB 3AVKA 1ULRA 3C3LA 1VSKA 2P9GA 4OJHA 4M5NA 4A8WA 4C4WA 3OYAA 3Q8PB 1EX4A 2E5HA 2QXFA 4CFBA 4JNEA 3DMJA 1XMOF 1SC4B 4YHHK 1R8HA 2NNWA 4USHA 2ZDOA 2W9BA 3TQ1A 2UUBJ 3TARA 3CD7A 4CJWA 2QYCA 1TUGB 3CETA 1SJQA 2P5VA 4IDKB 1IKWA 3I87A 4F3OA 4IRCA 5LSLA 5KFKA 1RBVA 1QHAA 1YHQS 4H5NA 2E29A 2KLAA 2C2OB 3OBIA 4NRTA 1H2VZ 2W9CA 4EGLA 5F3ZA 3FLCO 1HI8A 2DGVA 4PEOA 1MNEA 4DUYK 3TANA 4L72B 3G8QA 4J8FA 4D3HA 2E5JA 3K5PA 1FJEB 2GS8A 1IBKJ 2EC0A 3A3OB 2V2QA 1RT5A 2FHJA 1VK0A 5F8HA 2QWRA 4DS5A 4P74A 4BRPA 3T69A 3IS9A 4CJQA 4OGEA 2J0QD 4ICLB 4DPXA 2BXJA 2O4GA 2QXLA 1A0OB 4FJXA 3UCUP 3I8BA 1VRUB 4ELUA 2RQMA 1CC8A 2PT0A 2XGPA 3LM9A 3ETOA 3OSPA 5ADZA 3ADAC 3TVZA 2CNNB 2P9PB 1BI4A 3WXIA 2MXYA 4RNMA 4FPBA 4RUBA 3J7Z5 1RFQA 2OD4A 3OYGA 5HROB 2IC3B 4MYTA 5CYMB 2F9WA 2PO4A 1VSLA 5E3RA 2B56A 2JGUA 3SYZA 2E2OA 3F9MA 3HSGA 3M2RB 1X3NA 3RSEA 2RMLA 1RUSA 3J81U 4QW8A 2NUBA 4CO5A 5CD4H 4A8MP 4FP9A 4CHYA 2VD3A 5HANA 3GIJA 1UKUA 2W2PP 3OYJA 2VB6A 5KPZA 1RJJA 3TW0A 2V8PA 4NMXA 3VAMA 4USJC 1VC0A 2L9WA 3MFIA 1RA6A 3DGVA 1ZH5A 2VYPA 3RB3A 3BF3A 2DGUA 3QEPA 2EFQA 3CVKA 4PZVA 3DDIA 4LF1A 2QSFA 3CD5A 2ZD1A 4QR0A 4F4YA 1RAAB 4LIWA 3E3XA 3ZTRA 5F8LA 2XMTA 3RGIA 3BSNA 3GSDA 4JHDA 2K3IA 2UXBF 1SCJB 1QZ5A 2Z4PA 1HYVA 3CCMS 4ECSA 3C66A 1EARA 5KG4A 1Y00A 3I4PA 1OY9A 5EHHA 2CQIA 5IC6B 3J7YP 3GR0A 4UOCA 5GVQA 5F9LA 3J81j 4LF9K 5L1JA 4DV4K 4IO9L 3ALYA 5C12A 4FOEA 1LWFB 3QJJA 1YQHA 1DGKN 1ZM2A 2MLZA 4JI7F 4KY3A 1XC9A 4E1JA 4FXVA 3OVAA 3HPOA 3DLKA 2ACYA 2VL1A 1RBTA 1U8SA 1VQ9S 4JV2A 1U45A 3CJAA 1RU2A 4RW8A 1S72S 3FBFA 5L9NA 5HAOA 4ELTA 3HZEA 1Q9XA 3PV8A 4ZCMA 1N48A 3L7PA 5KFYA 4PG4A 3EZ5A 2G2YA 3GBTA 4PUOB 3J8AA 3T7ZA 2B7CB 3AGKA 5M1KA 1BDGA 1ZBIA 4OV6A 2VGMA 3NP5A 5E3AA 2JWKA 3W60A 4WK1A 4LIRA 3VF0B 4KSEB 1HBUB 4IKAA 2W8LA 2E8AA 4FLZA 1JLQA 3UIQA 1X60A 2D69A 1I5OB 3O9QA 4X66J 3TO8A 2QK9A 1LXJA 5KG3A 3R2CJ 5K8MA 2YNGB 3SSRA 1GLAG 2MKHA 1MG7A 2QL7B 2FLOA 2RT3A 2YI1A 2BE2A 4O3SA 5DZ7A 5JS2A 1UVIA 5HQLA 3TRGA 1S1TA 4AQYF 3PEHA 3ZSVA 2H5IB 3Q86A 4M63A 4ZOSA 3CO0P 1FERA 3FCWA 3NMRA 3MAHA 3DLRA 2CQBA 4TU7A 4RG8A 3KMQA 2F8EX 4RW9A 4RNNA 2YX7A 4FJ5A 4WJBA 4HH0A 2V8GA 5EWEA 1CULB 5IWAJ 2R8KA 3C65A 4BRFA 3HT0A 5IT9U 4K8XA 3AOCA 3HVTA 2E1ZA 1HKGA 4TLRA 2PMHA 1Y3KA 2BZ2A 2WW4A 1TK0A 2EFVA 5KFLA 5KFJA 3NAEA 3CMAS 4KHYA 3PXGa 4JD2B 5C2CA 3TP2A 3BPSP 3RAMA 3R8EA 3VHQA 2ZH8A 4IDHA 3P83D 3KLEA 1XEZA 1S5ZA 2F96A 3M4XA 5AQYA 2X1BA 5RUBA 2D3OR 4I69A 4LRFA 3GWCA 4CK3A 5AQGA 5I42B 1NEEA 1WBDA 1BWVA 3ILIA 1Q8BA 1UP1A 3J7YU 4USUA 1S0MA 4PKHA 2QA4G 3R3LA 3CCVN 3B8HA 1VQOS 2HWIA 1MW7A 5KFRA 2CZ9A 4Q0BA 3IRWP 3UW1A 3ENOA 1TUVA 2I0XA 4K43A 3H3NO 5LJ3Y 3SQGB 3PW7A 2WTUA 2F9TA 3THXA 4G1PA 3W65A 1NLKL 4DR3K 3RRHA 1E3MA 1DZ5A 2QEXN 4NX9A 5GMDA 2O67A 5AQLA 4AM7A 3Q7CA 1D4XA 1SIZA 4CYUB 3W8GA 4NYOA 1J5OA 2IYIA 3W7BA 4CZCA 2R7XA 3SUOA 2VWKA 3MD1A 2BANA 5CYQA 3TTDA 1R59O 4IFVA 3KD1E 4JI3K 1O1WA 2VG6A 5EU7A 2R7QA 5B0DA 5JS1A 2IVMA 4BC5A 1TKTB 2YWHA 2O8BA 1RTJB 3OBWA 5BR8K 4MKVA 4URGA 3BREA 2GV9A 2NRVA 2QL5B 4B9LA 5J2PA 3T1YF 4EYHB 4CFAA 1RYSA 1RCOB 4R0JA 4URQU 2XSJB 4DSLA 1TVRB 4P71A 1K1SA 4IJNA 2HNDB 2J76E 3V2UC 3CJCA 3LQVA 1FJ7A 1KCFA 2O1PA 4HYKA 4HVJA 1HNZK 2VDIA 2YX6A 4ANCA 4X4PA 1XR6A 2E9ZA 5BRFA 8ATCB 4I0WA 5KPTA 4A8YA 4B3RJ 4QPXA 1S22A 1MROB 1D09B 3TUPA 4O3RA 1JB0C 3ET6B 3OVNA 1Z2ZA 2ZC3A 2JC1A 1T02A 2ZHOA 3VOVA 3ZTQA 5D3GA 5J1PA 3BN7A 2W9AA 1RTHB 3IAM9 4B3TF 2DNKA 2RRBA 4JBCA 5HK4A 2V52B 4S0MA 3CJ5A 1D8ZA 1ITGA 4CH1A 1U1NA 2CQCA 1J2VA 3DM2B 5C15A 1XHZA 3L2RA 4KHSA 3G82B 1NOYA 4DV2F 3MM8B 3GCWP 4L3NA 4A5AA 4B1YB 4WXWA 1U1QA 4ED1A 3VPZA 3T5LA 1U2VB 2LQ5A 5C42B 3BGFA 2JLFA 3O5TB 2ZJQQ 3CCLN 2WB1D 3SJJA 1HNXJ 5AFUA 2BABA 4I2PB 1X1PA 2WAQD 2QTDA 3AY0A 2UXCJ 1K8AO 1GMWA 1KQSR 4CIEA 3ZFVA 2DGTA 1KAYA 1SUQA 2V0NA 1C0TA 3BZQA 3EGNA 2KKZA 3IDHA 4PG5A 1N56A 2K2PA 2JEJA 2G13A 1S6OA 1FWPA 1V4SA 3QT5A 3D54A 3QEVA 1RKJA 2GHVC 3QESA 3QAUA 4PWDA 2HBYB 2ZF5O 5CZVA 2XS2A 5BR9A 1RHJB 3UKRA 1KVIA 3J80Y 3SUPA 3VGSA 1DLOB 3K8VA 1GEHA 4LF4K 4C0BA 3FR0A 3BR9A 1LOTB 3BYRA 4FWKA 3P96A 4ZVRB 1H73A 1REVA 3MWBA 3CCJS 3WQUA 2C2RA 1RTDA 3GDQA 5HVFA 1RHUB 1XMQF 2EHGA 3EMTA 1XMOK 1NK7A 3VQTA 5DQIA 3MM6A 4CLUA 4CRJA 3OUYB 5HQMA 1DHMA 2JVOA 2BKOA 1XJWB 1OY8A 4LSZB 4ZITA 1NGBA 1OH7A 3V6DB 1PAUB 4CESA 3M8QA 2LMIA 3OHRA 4KBIA 3RVCA 1RSCA 1N88A 4OX6A 5GMEA 1ICEB 2H4WB 2BEFA 2HAFA 3G4SN 2IRUA 4B02A 4N56A 3U9DA 3VMFB 1RAFB 1E6YB 5I3UB 3MCAB 4ISFA 1LWCA 2HGNA 5H1SQ 2QE5A 1WAJA 2D3UA 2YHXA 4PYAA 3I8DA 1WTFA 1RT4B 4DTOA 4H0OA 4JI8F 4Y2MA 3MX5A 1SJRA 2ZC4A 3GB0A 1GLFO 2LXIA 3U27A 2PE8A 1NSKL 1ZBHA 4C11A 4DV5J 3L9ZA 1WB9A 2CWKA 3RMBA 1KVAA 3MXIA 2XNQA 4PKDB 2R2TA 1UA0A 3OYNA 1KR4A 3BKFA 3S41A 2HHHJ 4DFKA 4O8KA 2I5JA 2FY8A 3FKBA 3VESA 4H4MA 4Y3CA 4NB4A 2NRWA 1N54B 4C8YA 4NLOA 1FKPB 2XHBA 2CG8A 3Q8UA 1U1KA 5H9FJ 1S3XA 2OD6A 5FROA 4RR5A 4DI6A 5ADXA 4MIBA 2XO7A 2KHDA 2IM2A 3DGPB 3MK6A 3NHGA 4CO0A 1AZSB 3T1HF 2ZBIA 1PBAA 2F4FA 2IVFB 1QVGR 4NLUA 4LRAA 4WTOB 2GGPA 2P6TA 4AHSA 4BRKA 3L2WA 1M5KC 1Q7YO 1TL1B 5HLFB 3CCRS 1OMSA 2MJUA 1WTBA 2XM3A 3CXCR 3CI5A 3O3HA 4C6AA 4MQ3A 2Y8YA 1NK4A 1RGIA 4FJLA 1HQUB 4BR0A 2QWOA 2UXBK 1YHQN 2K3KA 5CHIA 5H9EJ 2VQEF 2VKRA 4FZZA 3H5UA 1FNXH 2RHSB 3EL2A 4LF7F 1S79A 1UWBB 3K5MA 1RT6A 2HQCA 2MPUA 1WN7A 1RBRA 4IG0A 3Q89A 1N33F 4JI7K 4M5IA 2FGCA 4TSXA 2J0XA 3S8SA 1NKCA 3HP6A 3OL6A 1G6BA 3AOBA 2R3VA 3DXKB 4GV6A 3MEDB 3W9IA 4JK8A 3SAGA 5LMUF 1T7PA 2ZUGA 4IUFA 1NHVA 4YB5A 2KDOA 4DV7J 2IVYA 1LWEA 2LDIA 3GCXP 3C14A 1QTMA 3NH0A 5IT0A 2R7TA 3LTOA 2A18A 3VEXA 4JKAA 2A10A 1N32F 1N5VA 4N7TA 4JV5J 1VIOA 5G4DA 2C2ZB 1FRHA 4OYZA 1FJGJ 2G8HA 5FPNA 2QLFB 4JKFA 3DNCA 3K17A 4DTMA 3DI6A 4C8NA 1KVKA 2GA7A 3HPGA 3O8MA 4ENOA 1X31C 1HPZA 4DG1B 1ZBTA 1NZAA 3FUYA 2ZM6J 2ZJRQ 3DHWC 5FDLB 3CNQP 4I9QA 1VSMA 4I6MB 3IP0A 4OPAA 1FRJA 1IR0A 3OYEA 1EETA 2P9KB 2MLYA 4ZK7M 1DKGD 3TABA 4AQYK 5T7LB 4V1Ak 3IGNA 5HOOA 4BBYA 2ZFHA 5CE3A 1J53A 1S5JA 3U3GA 2CDQA 2CPEA 3P1GA 2CJBA 2OKQA 1FEHA 3CJ9A 2DH7A 2YQ3A 1U1RA 3T5KA 3MPVA 1RTIB 1IG8A 5C24A 3OTOF 2H1YA 4RUCA 4KI6A 3OFFA 2B6AB 3TSPA 2VOPA 3QGGA 1X7VA 3H25A 4DR2F 2IAJA 2MKIA 4UQGA 1QVFM 5KFAA 1HWJA 1U02A 1VISA 3A4TA 4QOTA 3RBDA 2HLTA 3SCJE 2B0GA 2V9KA 1FW6A 3SCKE 3NNHA 3IN5A 3DRXA 2QM1A 3VEOA 1UWAA 4NCAA 1VQ9N 1PJ5A 2E5IA 4JKGA 4L3KA 2E5LF 4UOFA 4WXOA 1HI1A 1Y4ZB 4IFEA 2GVZB 4IOAL 1S72N 1A9NB 3THYB 4H0TB 3Q7BA 3MEEA 3AH6A 1IH7A 1T8EA 3NGUA 2VODA 4DV6J 3J80O 3I5AA 1X5PA 4A5BA 3MI7X 3I0SA 2GJ2A 4XAKA 5E2QA 1YJTA 2M2BA 5K5MA 1WSHA 3NGIA 2AD9A 4FF3A 4OO1J 3LW5C 2ZH9A 4ZN1A 2ZQBA 3ZSWA 5IZHA 3AB2B 4WQ4A 1N8RO 1EHWA 1NOZA 4EBCA 4B3MJ 3B6OA 1C6VA 4NO7A 2QTWA 2FY1A 3EKUA 2DXFA 4NLSA 3QFPA 1NAQA 4LF8F 3PEJA 1WG4A 1NJWA 2XTJP 5C7PA 1HWUA 1HR0J 4ZKAA 3KKSA 3AO1A 3OLBA 3ENQA 2HHWA 3QEWA 2RE2A 2D74B 1RWPB 2AGQA 5HVHA 3MM5B 2VGNA 4I68A 2GX9A 4DU8A 3JSMA 3CC2S 4YR2A 4OVLA 4DCPB 1UJ4A 4MFBA 4FW2A 3D9BA 5KGXA 2P9IB 4LFAF 1XNRJ 4NI2B 2O8DA 3UCZP 3T1YK 4F3TA 2ZM6F 4UY85 4HL9A 4YN3B 3HHNB 3ZT0A 1J9AA 4X4QA 2R7SA 1C0GA 1KD1O 1TL7B 3RW7A 3R6GB 4DBQA 3LGMA 1NSQA 3E51A 1P9QC 4ES2A 3KK2A 4A47A 3VALA 3CJ0A 5LXRA 2Z58B 1MWKA 1BA0A 4A4JA 3IFEA 1GX5A 2HHUA 2IS3A 4B3TK 3I9V9 4KH0B 1YRXA 2V51B 1FTCA 4O44B 2GVDB 4O23A 1SC3B 1HD0A 4FF4A 2ZWHA 3JAMY 4ETZA 1WJ9A 4DV2K 1IJJA 2B7BB 1NGAA 3NLCA 2BDPA 4BQLA 2FJBB 2D0AA 3DLLL 3QGPA 3GJTB 5GAHI 4CW7B 2FF6A 1TL3A 3WNFA 4B3OB 2YJEA 4O4GB 3O1BA 3OYIA 3U8XA 3EGVA 4HR2A 5HL7L 1TKZB 1KKHA 1WSVA 3RBEA 1ZBSA 1FVSA 1WF1A 1IM6A 3UDLA 1YK9A 4WFBL 2CJ9A 3OFEA 3TUZC 4HUEA 4CCHA 2D5RA 5ETLA 3DRSB 1Y0HA 1HWIA 2MZJA 4DPTA 5ETQA 2KM8C 1ILYA 1EQYA 3SMSA 3Q23A 2DTJA 4DS4A 4NLBA 4L75A 5EX0A 4NLYA 2RF2A 4J9KA 1T44A 3VR1A 4E7JA 1TK8A 1IKWB 1VQSA 3CMES 5DZ6A 3TAGA 3HX9A 4PHTX 5A0YA 1O51A 3MEKA 3PJWA 2FPHX 4X65J 4IO9Q 3H3OB 2V8DA 4ZA1A 1HBMA 2W9CB 3MN5A 1GAOA 2CQHA 4OYMA 1VQ6S 3SQ0A 4IRKA 5EOYA 2E1CA 1S6PA 1XMQK 2VFSA 5DDOC 2AEFA 3FZMA 3K2YA 5AQSA 3WNEA 4BS2A 1S9FA 3J7AP 1BHNA 1BQMA 4Q2LA 5KFNA 3IS9B 4I64A 1IBMF 3MUVP 5E0OA 3QO9B 1H6KX 2F1FA 4UY8O 4ED3A 1DTQA 4X4OA 5D4OA 1I6JA 4C0HA 3HLUA 3HSZA 3UN3A 2WBNA 2PEHA 2HQGA 2CNOB 4OZ2A 2Q0UA 4FVUA 1UMJA 4OLOA 2MKJA 3PYEA 1JCGA 2JDJA 1BI4B 3D7EO 4NYFA 2HHTA 2A42A 4DTSA 4QIVA 1FXXA 2YNFB 3PG9A 2NSBA 4KGKA 4L73A 3R27A 5D77A 2GX8A 2FF3B 5B7WA 3IUCA 4CI6A 3RSEB 1S10A 4K4XA 3NXZA 3M8WA 1F2GA 4JI8K 1Y5IB 1X0FA 3O08A 2QLXA 1FRMA 2AU0A 3KNAA 1G3OA 1HNWF 2BGGA 2YVSA 1SH0A 4RWTA 1TV6A 1U48A 1APSA 1VDHA 1M5SA 3A1YG 1HLUA 1T6CA 3Q8QB 1LXNA 4DR7F 1LW0A 2VQFJ 1E4GT 4WYWA 4OI3A 1T9YA 2IJFA 1PYOB 5GAGP 5DQHA 4HHTA 4WKYA 2NXUA 1YRTA 2D3O1 3GYNA 4LUBA 4RW4B 1HKCA 3D1OA 3RG6A 4J9VA 3O9TA 3DDKA 4ATNA 4YDUA 3PJ9A 4ZVHA 4H5WA 4KAIA 5KFMA 3VF6A 3PUFA 3GONA 1NJZA 4FZVA 3ILLA 3WHIA 3NBPB 1FRIA 3LPEA 3T1HK 4KHRA 3D6HB 4G65A 1SC1B 3G6VA 5GAEP 5MLCQ 2FUG9 2MY8A 4UUXA 3DOLA 2XQCA 1K0TA 2P9CA 2A2CA 1JXLA 1NK5A 3PYFA 1G2EA 4LBHA 1U2RA 3NL0A 3O4NA 3DLKB 2LFVA 1V6HA 3N79A 4LVNP 4GNIA 5GADP 3JYTA 1Q82T 2KXNB 2VQEK 3L4QA 4BHQA 3TAPA 4LF7K 5KFEA 4J9LA 4DV3J 1EX8A 3C95A 4BY9C 1NXIA 4AT1B 1WOSA 2ZH5A 4M41A 4ZPTR 5DM6L 2N82B 3LP1A 3THWA 4A46A 2NR0A 2WBRA 1MLAA 1N33K 1RWNB 4ILHA 2PD1A 4K7QA 3EJMA 5GINA 4ZVGA 5HRPA 3OVBA 3WQPA 5DG9A 3LDPA 3DLBA 4N8OA 3MPYA 2XY7A 1ZS6A 5LMUK 4MKAA 2Z2MA 3TJ8A 4QWBA 3TA2A 5KT2A 3G86A 4DQQA 1TUYA 2ZBCA 3VQAA 2NPIA 3ZSQA 1XC3A 2E2QA 3QIPB 2BE2B 2D9OA 3FSXA 2BACA 2OEKA 3IR6B 1RI7A 4U9RA 1AFJA 1NDLA 2G2OA 3MEGA 4IR1A 1FDDA 1S1TB 3U6FA 4LF6J 4X64F 1ZTTA 3RR7A 1EIYB 1N32K 4DHYA 4AHCA 3TTCA 2CQ2A 4OYOA 3HVAA 4RW9B 1GOBA 3K7RA 3PHEA 1LW2B 1QM9A 1S1WA 3H1VX 4YP3A 4QS8A 2U2FA 4X4NA 4CJ3A 1Z1ZA 3HVTB 1LOUA 5KAKA 2OMOA 4XPEA 4X62J 1TELA 2G0CA 4USWA 5GAGU 1UVJA 4CM2A 5DDQC 4JI4J 1AW0A 1FNOA 3GR1A 2AHOB 1O5JA 2BVZA 4NXMJ 1RDCA 3BEGB 4JKDA 2IY5B 3SFGA 3TUJC 2WBMA 3TZYA 1ELOA 3VGTA 2ASMA 1A6LA 5SZTA 4ZP9A 5DRKA 1FKOA 3F41A 2RUSA 2KT2A 2HB5A 3OTOK 2B4JA 2A6MA 5GAEU 3ZSYA 2C1EB 3C7NA 2OA8A 1MWZA 4Q0BB 2UVWA 4DPOA 4H0PA 2KHOA 4DR2K 4FN5A 3BBFA 2HFSA 3IGVA 2BQRA 3FDSA 4NYZA 2YNHA 3W9JA 4ZIWA 3LWMA 3AAQA 3H5SA 3SBTA 1D9DA 4WE1A 4ILLA 3L4BC 5GADU 4P9SA 3UNGC 2BBEA 2V68A 2E5LK 3R2DJ 1FDNA 2VH7A 1PKUA 4RX6A 2YV0X 1J5OB 5AFUH 2R7VA 1YJ9N 1FA0A 3MUMP 3UN5A 3SCLE 4EYIB 2CAJA 2BANB 5CYQB 2MZSA 3OTEA 1S97A 1C2PA 1RBLA 4IFVB 4UUWA 4NRUA 2FBVA 3N28A 2IBOA 2BUPA 3DLGA 4EZ6A 2BQ3A 1HFEL 3OL7A 2MGZB 4ER8A 4TNOA 4FSVA 4ZCKA 3HYFA 4WF9L 1RWUA 1MN9A 4ELVA 2IMWP 3LP2A 1SB6A 5EX3A 5J2PB 3D67A 4J9NA 4LC9B 3M2UA 2J0SD 4GMJB 3HKWA 4O3NA 3FBCA 3D2EA 4CLYA 3M6UA 2IA6A 4YOEA 4LF8K 2MTLA 4LBIA 4RU9A 2DXEA 1IBLF 4UQTA 4ECVA 1FXLA 3HHEA 3HMJG 3PW5A 4F4KA 2FTRA 5CXTA 2FJEB 1B92A 1DTTA 1CJKA 2KFYA 2NQPA 1YJNS 5B0GA 4AL7A 2OI2A 4RW6A 4LFAK 2JFDA 2IIHA 2D0PA 4HH1A 9ATCB 2W4CA 1RK8A 5HMWA 1BCMA 5KG5A 4CLWA 2HHVA 1BXNA 2O8EA 4LT6A 5AQVA 1AUSL 1WF2A 4DV0F 4ZLJA 3QNWB 4E3SA 2UUWA 2J6SA 1GLEG 3ZYYX 3W8PA 2RS8A 4ECYA 1S12A 1B64A 1L3VA 1YX2A 2HHXA 3NCRA 3QQCD 4NCBA 4CF8A 3BSCA 1OQ3A 1X9JA 1YJUA 2GMHA 2I7NA 1YGYA 1CSJA 2Y0SD 2EKNA 4W5NA 1V3ZA 1SUQB 2UU9F 2LP4A 1GXUA 3DU6A 4LRBA 4B3SF 4HHUA 1PCAA 3NF6A 3GP9A 4KPCA 1EXQA 2K06A 2MSSA 2F4VJ 4DMZA 4CLPA 4RU2A 2HS4A 1OIAA 2DNRA 1EQMA 1YI2S 3KYLA 1H38A 4PWDB 3TEGA 1HWKA 5HBMB 4F4ZA 4CEAA 4F02A 3B6PA 1OS5A 2DPIA 1OO0B 5B08A 4DR1F 4P73A 2LVWA 4ICLA 3L7OA 2R8JA 4OYPA 3L3CA 2XS5A 1Q82O 5FPDA 3VAGA 2P8IA 1OWXA 2IVPA 4H4KC 4LQ9A 2G4BA 1S9GB 3ZC4A 3LM2A 2G9OA 1BO5O 1HA1A 4AHTA 1TUWA 4OYIA 3LDNA 4FPIA 1Q81O 5HROA 2IC3A 5ADXH 3MM6B 3PY8A 3QPIA 2ZGYA 5C5JA 4YEAA 1DQAA 3D6RA 2QWMA 3M2RA 4E7KA 4ANDA 1MU2B 1CJVB 2P9EA 5I9EB 2HF3A 2Q6BA 3W5YA 3SI6A 4C3MA 3C6UA 4E2FB 2QL9B 4CJUA 1JKHB 2V4JB 5D0EA 4J2BA 2FJXA 2CQPA 1A7GE 2L41A 1SS6A 3ZCMA 3FEYB 4IFYB 1RHRB 3VQDA 3L09A 4EZ9A 1I39A 4FWRA 2HHSA 2C2DA 5E3QA 2HRUA 3L6QA 1F21A 1IBMK 3MECA 3CIMA 3QNOA 3S9HA 4WP8A 1NWKA 2IDEA 4C11B 1LQ9A 2M7SA 4Z2XA 2KU7A 1XUPO 2FYXA 4ECUA 1Q86O 2B9EA 2MKYA 2GZOA 1ZAWA 1TAUA 4USIA 4YQWA 3S3MA 3CJQA 1WUAA 4DR6J 2L9DA 2O66A 5KQDA 3V1RA 2IM0A 2PC6A 4ISEA 5CAAA 4WZQA 3M9NB 4BRGA 1HL6A 2DCLA 3MN9A 3PW4A 1RDDA 4H4MB 1X4DA 4DL2A 1RHQB 5LOQA 5K14B 3UDCA 2FBTA 1RDRA 3LALA 2KRBA 1JNZB 3M8SA 1YJ7A 4BRQA 3FZKA 1NZ8A 1HNWK 4FKXA 4NLPA 2HBZB 3BPDA 1M0SA 3U1MA 1FNMA 4BQZA 2NLXA 1RISA 2WCXA 1S4EA 1F60B 4LH5A 2CKWA 3BGUA 4DR7K 1F9EB 4UZCA 3EY1A 3TAQA 2DNNA 3O4QA 3KFWX 3HTVA 3KUHA 2YH1A 2OHDA 2QWNA 1BQXA 3MAAB 1RLDA 1HBUA 2WC9A 1VQ6N 5DK5A 3VGMA 1RT6B 4ZVPB 1VAZA 3QT7A 1RZMA 3BH6B 2VFUA 1UEUA 2ZZTA 1GT8A 3WNHA 2J9DA 2XYGB 5H1SV 1J27A 1X9MA 3R5JB 3O80A 2M9KA 2RQ4A 1J5EJ 1U1OA 4IOAQ 2DRAA 1A5XA 4N77A 1D9AA 1VQ8S 2DNGA 4ID5A 2AJ2A 4WIQA 1N36J 3PRBA 3F5TA 2HMIB 4Y00A 1BHLA 4RNOA 5THWA 1XQIA 1CULA 3KG0A 1T3VA 3RBZA 4V19J 3CCQS 1RDWX 3QEXA 3WZ0A 3C14B 3TZWA 2C3PA 2LEBA 1Q78A 4OX9J 1RWKB 3N4WA 1ZYQA 1EJ7L 4IWVA 5B09A 3PCOB 2WVBA 3OS2A 5LMNJ 1YIJS 1VRTA 3D6FB 4OPJA 2NYIA 1X5SA 4M3RA 2ITMA 4BRCA 4U96A 4MK7A 5BN8A 1MMDA 1DARA 5AQZA 1KTQA 1WWHA 2BJEA 3DOKB 1KFSA 5FJ4A 3I5CA 3K0JA 5HO4A 4AXIA 5ETNA 2HZAA 1JXVA 2J7UA 3KTQA 3D5MA 4X64K 4FJHA 2ASOA 3P8BB 1R7IA 8AT1B 1VK3A 2KTQA 3LDOA 3EDQB 2NRRA 1YVUA 4J9UE 3MPUB 4NXNJ 1NGHA 2VJUA 4Q7AA 4CDIA 1U04A 4CYUA 2J9EA 1GLCG 3DOMA 3AD7C 3M2VB 1N0VC 3CQ8A 1FK9B 2IAJB 2VUGA 3I0RB 4OKEA 4ZMMA 1EWQA 2YWWA 2V8HA 2UUCJ 2XI2A 2MEWA 3DDNA 3PX0A 1WOQA 1Y7PA 1BQNB 1CS4A 1UFWA 2VWJA 2ZDPA 4IZ9A 3DLLQ 1UETA 3MEEB 4H54A 3N4PA 1AXQA 2XSJA 2M8HA 2Z57B 3I0SB 2HS3A 3BSOA 4QYZK 4GVLA 3TR5A 2HVDA 2UP1A 4JI1J 3Q0AA 3LDQA 1HHSA 2H54B 2QC3A 3F44A 4OI2A 3QWPA 5CHCB 4F8RA 4WFBQ 3GG1A 3ET6A 3D7SB 2A41A 4O0NA 2KJWA 3AD9C 3TX8A 1VQ7S 4KHPK 3H8YA 4CLFA 5AE2A 4CO3A 3A0IX 2HBRB 1NH8A 1RTHA 1U2FA 3HSJA 4CGHA 3NGZA 2GQCA 2WFBA 4EMDA 4LFBJ 3JB9k 4KGZB 4MYUA 3DM2A 3FEXB 3ZZYA 1ZPVA 1OY6A 4YOUA 3G82A 4FZXC 3BKUA 4JI6J 3KLGB 4ZTFA 3V5RA 2BKNA 1T6DA 2Y0BB 2LECA 3OYKA 1HLWA 1U2VA 1S76D 5C42A 3VEYA 1JX4A 2O8DB 5I4MA 1T9WA 2ZZMA 2L08A 2UVUA 4K4UA 4RW7B 2A2DA 1RAEB 3K5NA 2C22A 1HRHA 4FF2A 4DR5F 3BO2A 4JUZA 7FD1A 4TQSA 2UVVA 4CF1A 1IBLK 3HPHA 4CEOA 3A13A 2DY4A 2KRRA 2WSEC 4MAKA 3UO0A 4CBUA 1BIUA 3OVSA 1JLCB 2EFNA 4Q8EA 4DOZA 1G15A 2AIRB 3TSQA 3KK2B 4RKUC 3HHKA 4O0JA 3HULA 4K5SA 2DGSA 5ETKA 1Q18A 3QDKA 3MMJA 5GMKa 1DLOA 2J7KA 3O6QA 1CJUA 5HJXA 1U0SA 4KH4A 2I1RA 2ASDA 2PA3A 1XTZA 2APOA 3F0NA 2QSWA 3V9ZA 4DV0K 1YAGA 3NCPA 3R7NB 3V9WA 4XTTA 2QLWA 5DGBA 1QJHA 5AJ3F 1F9HA 3X1LB 4K4WA 3BSAA 4MT1A 5F0XA 4FDFA 1VBZA 3FEZA 4J2DA 3ZETB 4ZHRB 1YITN 4DL7A 3WIUA 5KFCA 3MXJA 4ZVEA 5AZIB 2FC0A 1WC4A 2UU9K 4XH4A 4B3SK 3TQEA 5F8GA 2BA9A 3V6DA 4GW6A 2F5GA 4FNIA 5B0FA 3I55N 5LM7E 1Q9YA 3NY0A 4DUZF 4FZYA 4CO4A 1WDDA 4KJIA 1R8BA 4C48A 5IV3A 4JI1F 3I6PA 3L7UA 4RUHA 1M1KT 1OYEA 4JYAJ 2Q79A 2YWEA 1FX2A 4DR4J 1E6YA 3IXQA 4LBPA 5E3CA 1BGXT 2RF2B 1RA7A 3AJ1A 4MIWA 4KTZA 4DR1K 3LL3A 1P90A 4ZVFA 2IRYA 2ASPA 3P6YC 1WEXA 5F9NA 2LQBA 5CH7B 5A0YB 3BGRB 3S7RA 2QX0A 4B17A 5ETOA 4HCCA 4XPCA 1CC7A 1WC5A 3WXKA 2XY8A 3MM7A 3GQCA 1S6PB 4O3PA 2ROGA 1RDBA 2KN4A 2FSNA 3AODA 2H5EA 2A1RA 2YHBA 4FPRA 1GLLO 4L76A 1C1CA 3LZJA 3RWUA 3KUEA 2AP1A 3CD6S 5AXNA 1Y10A 2OELA 1YJNN 4OZNA 2FLLA 1DTQB 3FBEA 1GOCA 1X3MA 3MFHA 1ZPWX 3FQKA 2UUAJ 4LR9A 4CF0A 4BE2A 1SKRA 4DX7A 4IKFA 3VN5A 4FJ8A 5C2DA 3SZ2A 4AHRA 2RNEA 5DM6Q 3HOSA 4AHVA 3KMSA 2IGIA 4ZVOB 2E88A 3NGKA 2R2SA 1I94J 3CD0A 4ZLPA 1N52B 3BBBA 3U3YA 2CGKA 4KAZA 4N41A 2G2ZA 2EK6A 2ZH1A 3RW6A 3SIPB 1S6QA 3FMBA 3FVYA 2ZGZA 2O8CB 1WC0A 1DEJA 1TL1A 2AEMA 3KVGA 3Q83A 3BO4A 4JI0F 3OJUA 3BO3A 4YY3F 2ZBRA 3TU5A 5T14A 1HQUA 2QYGA 3CDBA 2P9NB 5EWFA 2HURA 1VLOA 2NSCA 1RT7A 1B4SA 1OVYA 3EWGA 1UWBA 4KFBA 2VJVA 1RDAA 4FWLA 2ZH7A 1LW0B 4BR2A 1VQPN 2OP5A 1VQYA 4CHQA 2DGQA 2MDAA 2HZCA 3AD8C 1H2TZ 5HMXA 2QI2A 1CZAN 2ILYA 1FWLA 3RMDA 3OQ2A 5A2QU 3DXKA 1PAEX 2R7WA 3NVKA 1BL3A 1VQ4N 1MWYA 1HIYA 4YNQA 2CDRB 4KHPJ 2EPIA 4ID1A 2EFGA 2V4QA 3EZWA 2FVRA 3NNAA 2BMBA 2OH2A 4DV1F 4M5LA 2DBBA 1TMJA 1ZETA 4M5HA 3RR8A 2MQ8A 3AT1B 1ASUA 1WORA 2MQQA 3G25A 3D3BJ 3EE3A 1QTNB 2AYGA 2DGXA 1Z2LA 3GFYA 4X4RA 3H5YA 3AGRA 1YZ7A 1K8KB 3QRPA 4DG1A 4CJSA 2NXCA 3E1YA 4X84A 1IKYA 5FDLA 2GO9A 4CJKA 3C6HA 3LP1B 4DSFA 1CQMA 2FQQB 1NUEA 5ETPA 4KHUA 2UUAF 1T11A 2RDIA 4EO6A 1SV5A 1VHIA 2QLBB 1EB0A 4ZDNA 2PI4A 4RWXA 2UYTA 1QHTA 3K57A 4CZEA 2GAGC 3C46A 2A3ZA 2OPPA 3O1LA 1AROP 4OL8A 1M5OC 2BJ8A 1KEKA 2QA2A 4DU1A 3JXUA 5E41A 4WF9Q 3KG1A 1RYRA 3KNGA 4DXLA 3MEGB 3OYFA 1ZA2B 4JKHA 1X0PA 2B6AA 3O9RA 4FYDA 3W5XA 2KL8A 3KDOA 2MKSA 4ZVUB 4LFCJ 3VAJA 1PC5A 2I7PA 4C98A 4J9PA 2VU5A 3CB4A 5HI7A 1TUUA 4KB0A 1YLXA 1XN9A 1S1WB 4ES3A 5KOWA 4CHPA 2AWZA 1VQKS 2E1PA 3QYYA 2HIYA 4BRMA 4IO8A 2Z2YB 1N34J 1QQMA 3NF9A 2OTLN 1XIQA 2GVZA 3NVMA 3UDEA 3THYA 1U1PA 5MLCV 3GOIA 2AYBA 3KJNB 1HBNA 4B9UA 4F26A 1K9MT 2WSCC 2LU2A 2R8GA 1A5WA 2C3OA 7AT1B 2WUSA 1HYSB 1M5VC 5LSOA 4E19A 3FZFA 3ATUA 4CK2A 2H3EB 3D6MB 1L3KA 3M6XA 4FWOA 2KT3A 4Y65A 2EG2A 2BJDA 3SAFA 4FWPA 1TYQB 3MOJB 1QUVA 3EVWA 1FKOB 3QGHA 2BX6A 1LK7A 4C1NK 1RBUA 1BA1A 5EXWA 5ETVA 4NLVA 1M1KO 3QLHA 3MUTP 3OV7A 3LF0A 3AO3A 4I67A 4NE9C 2R42A 3MN7A 1X4FA 1JIHA 4GMKA 3MM5A 4I56A 5FLXU 4ED5A 4WP9A 2WVEA 1XNQJ 3HM9A 2V9WA 2P9IA 3KHYA 4KB7A 1V3SA 2D7SA 3TUIC 2Q36A 1EKRA 3ZNUA 4ERDA 4GKKJ 3CCQN 1UZDA 1TL7A 4WKRA 4LF5J 2P9LA 4CJLA 3O44A 3DLGB 4QWDA 1KVBA 1RQ0A 5CQGA 3LP2B 3NMAA 2O8FB 3W5ZA 1EKSA 1TKXA 3K9KA 3M2UB 3SMPA 5AZJB 1ZM9A 4P7TA 4AE5A 3D2EB 4CEZA 2AV5A 4NYPA 1OJ4A 3GIIA 2L48A 1BLUA 1WEZA 4JI5J 1NK9A 1Y3JA 1BE4A 1VQ5N 4U67L 2DRDA 5CYJA 4WU3A 3HD2A 4O44A 4BC9A 3SQ4A 3KOAA 2FBXA 1TP7A 4J91A 2R4FA 3ULHA 3ZSRA 2MHEA 1VRQC 3QFUA 4EHUA 3U7JA 3U9ZA 3H59A 3RYLA 4CO1A 1DTTB 3H98A 1CJKB 4J9OA 5KFIA 1JJ2R 5KFZA 3QJLA 1YTAA 1VOMA 4WP3A 4QWCA 3ZTPA 4B3OA 4YFUA 2RQKA 4GKJJ 1N6QB 4RW6B 4NLCA 4YS2A 1T9XA 2YKPA 1KC8O 4OI1A 2DNOA 5B0CA 2QRRA 2CUYA 4JK9A 3UDVA 3M8YA 1M90O 1TKDA 5AQKA 4DR5K 1VHXA 1QAJA 4FWQA 3PACA 1R8AA 2V50A 2KZMA 1YT3A 3M6WA 1G7CB 2PMWA 4RWWA 2HS0A 1F5BA 3UR0A 3DU5A 3A5NC 3DRSA 1NMDA 4CNZA 4LSLA 2HFOA 2NREA 5J2NA 4CGJA 4DTNA 1NKBA 4K4SA 4F4XA 4H0XB 4OZ0A 4DWIA 4M3YA 3MPDA 1LK5A 5JLFA 1KN6A 1FTRA 1WEYA 3OLAA 3VAKA 1UL3A 2DHHA 3FQLA 4YORA 2Q97A 2G0JA 4Y0FA 1UAXA 1SPBP 2BOPA 4JI2K 4A61A 1WF0A 4TKTA 3UB5A 2ZUAA 1YXQA 3W63A 3AVIA 4A8XA 3QETA 1DRZA 4KHMA 3I82A 5AJ3K 2IJRA 4NPOA 3T9NA 2XBPA 3JS9A 1KAXA 2DB1A 3H2UB 4F67A 5KOXA 6FD1A 2LQ8A 5C25A 3QO9A 3ZZTA 3LAKA 2E1RA 2VDHA 4PQAA 5A2QO 4CJVA 5BYQA 3WIVA 4K0KJ 1JLGA 4DUZK 1UTAA 1H98A 2UVRA 2YNIA 2KXFA 3EGZA 1Q5YA 1RWWB 4P10A 2YNFA 2CJKA 1QSSA 2EFPA 1VQNS 4CZLA 2KFZA 2ZNZA 1CLFA 3CO9A 2YKNA 1QQNA 2Y1IA 3CW2C 4PG8A 3P5TL 2X3DA 2RE1A 2FLPA 1TAQA 3Q8RB 1WSEA 1O13A 3T3FA 3C6UB 4KYZA 4HT7A 1WHWA 3PTWA 2GMJA 4GO7X 1WHXA 3GTYX 3CCSS 3T9ZA 3DJCA 3ZEUB 1JL2A 1B9DA 1VQMN 5IQQA 4K8RA 1YKWA 3H0PA 3PYDA 1WC3A 3I4HX 1NB7A 3QBCA 1FT8A 1WAFA 2H3GX 4U6PA 4KV8A 1N5QA 3MECB 1DURA 1NGJA 4OHWA 4KH1B 1S1VA 2WOMB 4RW4A 4BACA 1UVNA 3VQ6A 2D41A 4WIIA 4FCYA 4DQIA 2HVEA 3CYMA 4BG9A 4NZ7A 5LL6Z 1ZAVA 2H5JB 3R3TA 5ETTA 3PFEA 2ROEA 3NBPA 2DO0A 3BH7B 2P9UB 3JSYA 3ZZUA 1RWMB 3RB0A 2N7YA 4ECXA 4EHTA 4PPDA 1SH3A 2UUBF 3H2VE 3TA1A 2PYLA 2AYEA 2CADA 3GU0A 1EZZB 2KH9A 1B0TA 4Z7CA 4XK8C 1K73T 1CJTA 4JI0K 3AAPA 4KREA 1UA1A 2C2MB 2MZRA 4UT4A 4YY3K 4HI1A 2DFFA 1U4BA 3O3FA 4Z4HA 4FM1A 1PYTA 2Q1LA 1B70B 1C1BB 1QAIA 2YHAA 1IBKF 2P51A 2LCWA 4M3WA 1ATSA 1EQ0A 1TQLA 1ATNA 5DO2A 3SSSA 5DG8A 3CC7N 4M45A 1W2IA 4DLGA 3Q2SC 1K44A 3VTHA 1UAWA 5KTQA 4BRLA 4F2SA 1KXPA 2PEBA 2UXDJ 1JXEA 3GFHA 2XMWA 4CD1A 3NNCA 4CEDA 3EVMA 4ZP8A 4DF8A 4Y2CA 3MCSA 5L1IA 4AF1A 4EWTA 3L0QA 4DFPA 1NMEB 3W61A 3LGNA 3G71S 5KT6A 4JRQA 1HD1A 2VV5A 2NCKL 2JHEA 1WSIA 4DV1K 3QIPA 2ACMA 1NJYA 4RCHA 4LH4A 3CD6N 1HMVA 4IBNA 3N9UC 4EO8A 3CJKB 1D5AA 1ITPA 4BRHA 2JJ4D 4ID5B 1KSPA 4PPZA 2MQNA 4HLBA 5FLXO 1Z4UA 1NSPA 2XEXA 2WSFC 4YB7A 5C10A 2GV1A 5CA5A 4IH7A 4PQUA 2UV8G 5KT4A 1LW2A 4B9NA 4U7CA 3MN6A 1EP4A 2NZCA 2ITGA 1S6UA 4KT0C 1JK9B 4FL9A 4KI4A 1URNA 4JV1A 1LAWA 4F36A 3PRDA 4XH1A 3B4DA 1VSEA 2Q31A 2RJZA 2D0BA 3THPA 4M8LA 1S4FA 1R31A 2MY7A 4CGGA 4WFZA 2AX1A 3EE8A 4MLEA 1VRTB 4JB8B 2LEAA 1HHTP 2KXHA 3ZSZA 4Y0WA 2FHMA 2ZHAA 4YHHJ 3JTPA 3UWTA 1UCNA 2NRHA 1ZOTA 2QFIA 1YG0A 2NS1B 5F1XA 2JX2A 3OFHA 3ZT1A 4DL4A 2K8GA 1CXUA 3IBCB 2AQ4A 1UEVA 3CHWA 3IFRA 4DN0A 2DK2A 4JI2J 5C0YA 2CNLB 4CF9A 4FPAA 1NU4A 2FDNA 2DH8A 5F3TA 2Z56B 4GVMA 3M8ZA 2Z2LA 4DUYJ 5KFHA 4B9SA 5KFDA 3D4JA 4BG8A 1NDPA 4ZVTB 1F1BB 2BR0A 3PNIA 2J4RA 3OYCA 1FVQA 2YH0A 1HQ2A 2QG9B 3AQPA 3EVOA 4CGIA 4N8NA 5HRRA 3H45C 2ZNYA 4ECRA 4G1QA 1HBOB 3DOMB 3OW2R 3RAXA 1BD6A 1BMQB 3Q8SB 1RAOA 3G87A 1OH6A 4FF1A 4QQBA 3V6HA 3PDNA 3DC2A 4I1TA 3QRRA 2YPYA 3MMBA 3VAIA 2WONB 1X9SA 1OH8A 2RQCA 1S1XA 1RACB 5KQ8A 1RILA 2MGZA 1CS4B 1B0PA 4ZPAA 4K4VA 5AQJA 4X66F 3TPQA 1B3TA 2ZVIA 3ETMA 4FOIA 3TI0A 3CC4S 4OKKA 3C19A 2ZVSA 1K6YA 1GK8A 5IOLA 3QZ7A 3OSNA 2E4LA 1QSYA 4C3KA 5D4PA 1NPKA 1QDUB 3T5JA 1VLYA 4MKBA 5KFOA 4PCQA 3HHLD 4USVA 3M9OB 4ED6A 1FEEA 5LXYA 1LV5A 3PR5B 2F65A 4A59A 1YVNA 4U8YA 1RTZA 4ZJOA 5IWAF 4OJGA 4KH5A 1RT1B 3KLFB 3S3NA 3EGWB 1T9UA 4BE0A 2GUIA 4CIFA 2FD2A 2CQGA 2YKOA 2E9RX 4NCGA 2UUTA 5GAEI 1ZZNA 1NM1A 2O4IA 1H7XA 3IMXA 1KFDA 2BYCA 3GG0A 4LF9J 3P45B 1SAZA 4DV4J 1TFYA 1L3UA 3VVTA 3FRYA 1RBAA 4PL7A 3WXLA 4KTQA 5KFFA 3ZZRA 1VQKN 2RKIA 4I2QA 1IR2A 4O5BA 3JQMA 3ZZOA 3PKMA 4DTPA 2BJ9A 4DDFA 4WU2A 2X1GA 2HMPA 4DCJB 4FBTA 2OCEA 4CEEA 3J80U 4H5RA 4M5GA 1YBUA 1KONA 3EE9A 4W5TA 2DITA 1FFSB 2GUPA 3EX7B 1WDTA 1N0UA 3K2PA 2W4DA 5HBMA 3Q2TC 5U47A 3WC2A 4Z4FA 2JNJA 2XMUA 1YUWA 2EK1A 1CJUB 4YB6A 4DLEA 2E6LA 1K73O 3RRGA 4WQ5A 4DSJA 4WPAA 2NXNA 5AE3A 3MMVA 3RB4A 2A3JA 3HBTA 4CZMA 4AFFA 1S9GA 1EKEA 3CJ1A 4M95A 2NXJA 5KGWA 3VQEA 1WG1A 3CDUA 5J1NA 2XZDB 3SBMA 2MQOA 1WUUA 3R6MA 2VZ9A 4CO2A 2MKCA 2G1DA 2CQDA 3HP9A 3B8AX 3THTA 4ZCLA 4QIWD 2YWFA 3IBFB 4F3MA 3AQOA 4JKBA 2AJ0A 2HYIB 5BPNA 3OYMA 1MU2A 1YJRA 2BM0A 1CJVA 5CY4A 2X3GA 3TR8A 4K50A 1FE0A 3OR1A 1L3SA 3SXLA 2RDJA 3KKRA 3VEWA 1JKHA 5B0BA 2V4JA 4CFCA 3ULDA 3V81B 4B3RF 3KK1B 4BGAA 2CPYA 4IFYA 2JSXA 1DJ0A 5G0RB 2DKOB 1IR1A 4U7BA 4OZJA 2Q3SA 3WXMB 2BJ7A 2CGJA 4BDZA 4F0KA 4U95A 1VFJA 1RT2B 2I38A 3C0BA 3E9OA 3DWLA 2BUNA 2JLGA 4WFYA 3HXMA 5EN1A 4ZPWR 5LJWA 2FVQA 4PAAA 1LAVA 3CEDA 3MM7B 4ZLNA 1SI9A 1F3VA 4XIUA 1C1CB 2JVRA 1HNXF 3JSRA 3A8KA 3LPYA 4NZ6A 4A2AA 5DGAA 5BRDA 5IT4A 3F56A 3AVMA 1D1UA 1A5VA 4FLYA 2HIQA 5EDWA 2UXCF 2PAVA 1QQCA 5CCMA 4A57A 5K14A 3SCXA 1N5TA 2ZH3A 1W9HA 4EFHA 1VK8A 3N5FA 3IMQJ 4NYNA 4DR3J 2Z30B 2W2NP 3V4IB 2HWHA 2CIMA 3R5DA 3FE1A 3CCVS 4NEZA 3AO5A 3AVLA 3M6GA 4P72A 4CFDA 3R9PA 1S6QB 5GIPA 4ED0A 5M1OA 2AJQA 3MR5A 4JI3J 1VJQA 1ESVA 4M5DB 2A40A 1W2BM 4MO5A 3M8RA 4KHWA 2VASA 3MAAA 4DL0C 2VHGA 3GJRB 3VGKA 3LUYA 3P5BP 4OIXA 5BR8J 1X4EA 2BV3A 1NBWA 4JAXA 4MDBA 1YBAA 4R8UA 3K0SA 1DY3A 1RT7B 2OJ3A 4QU6A 4KFBB 1SBRA 1Y5NB 3NCIA 1IO2A 3CJ8A 4J37A 4WTYA 2UUBK 5AQPA 5BJRA 3VEZA 3UI3A 3EXCX 3BR8A 1HNZJ 4DX6A 1E6VA 1JJHA 4HI2A 4W92B 3HT3A 1Z05A 2VPZB 2VPYB 3U4LA 2HMIA 4C3LA 1WHYA 2I8EA 2M4MA 2OFHX 1ZZFA 5A8RA 5FPEA 2Q3PA 3D0IE 1KWMA 1PYSB 1JLEB 4M7YA 1IBKK 2DGOA 4DX5A 2F8TA 4ZVQB 3WUHA 5AE1A 2CQ0A 3VGUA 3X3UA 2N3OA 3W3DA 2GWJA 4ZPBA 1KOOA 3LAMA 4IQMA 5J2MA 4XEIA 2UV8A 1CPZA 1PIEA 4DV5F 3NCQA 1VSHA 2VOOA 3M7VA 3B4MA 3WX4A 1ZC6A 2D0CA 1M1GA 4AUKA 4MKYA 3ASMA 1MWMA 1RAHB 1NBEB 2DJWA 2V34A 3O2IA 1U0HA 3CERA 5IV4A 3C6AA 2OPRA 2HHHF 1IKYB 1HW9A 3CCUS 1MMNA 1R8CA 3DOKA 3L2QA 3IWLA 4E8UA 3R7SB 3IR7B 4DCHA 2G8WA 2XMVA 4KIAA 4QZVB 1SV5B 3RBXA 4C1NI 3AAWB 4QCLA 3MDQA 1NK0A 3CCLS 1T95A 3GE1A 3IO1A 3BKTA 4E89A 4TYAA 3SQ1A 1JLBA 4TY8A 5E84A 2GNKA 3POTB 4Q8FA 4W98A 1NJXA 4BR9A 3HO1A 3ZLJA 2OPPB 5AQIA 1WNSA 4DTXA 4A8SA 4F2RA 2VG5A 3RZAA 3OJSA 4LF4J 2QGFB 2RAQA 3GIRA 4DQRA 3CCMN 2JEIA 4GV3A 4TXSA 2PFUA 2WK4A 2OEMA 4O5FA 1IBCB 4P7VA 1WSRA 4FLTA 3M2VA 1FK9A 1BY9A 3WXJA 4CZKA 1RWOB 3I0RA 3HHLC 2J5AA 2H51B 2Z1JA 4J90A 1UVMA 4U67Q 3OA9A 3L8BA 3QMLA 4A8QA 4K8ZA 1XMOJ 5IXUA 3PIPL 2DIUA 4F0MA 1BQNA 4FLWA 4ED7A 2XLIA 4ECWA 4PA1A 4C23A 2XZWA 3QSIA 3NOGA 3HI0A 3MMAA 3NGTA 3BUZB 1PG5B 4IR9A 3SQOP 3EZOA 2DY1A 2F3JA 1HBNB 3GE9A 4W4MA 3FMWA 3W3SA 2R2UA 1QSLA 4CJFA 4E1NA 2A6OA 4BR5A 2KI2A 2ZZNA 2V2KA 1FX4A 5L38A 1WI8A 4DFMA 2HQFA 1H7WA 1UPMB 3R5GA 2YKMA 4P2MA 4LRCA 5EX5A 2PZSA 4JK7A 4B1UB 4AM6A 3J7ZT 3CFRA 4DV7F 2ZE2A 3NG8A 4E7HA 2V6AA 3QLHB 1RLCL 2DNZA 5EGYA 2ALYB 3G71N 4NWBA 4QIGA 3VETA 3G4SS 2DR7A 4W90B 3W2VB 3IWXA 3AO4A 3M32A 4JV5F 3KLGA 4Z4GA 3CE8A 4ZP7A 4E1MA 3MF5A 2IDOA 2G1HA 1FJGF 2IM3A 4CHNA 1N5YB 1FD2A 4M3TA 4ZIVA 4X66K 2YXLA 1JNRB 4NA2A 1RT3B 3RTVA 2NZ4A 1HJOA 1HHQA 4CJ4A 4RW7A 3W2WB 5AQFA 2QT7A 4N5SA 2C3UA 2VC1A 1XHXA 4E7LA 5BRHA 2GIQA 2VPXB 2P9LB 4YUDA 2YQ0A 1D8YA 1R6YA 3EZUA 3HVRA 1YF5L 1RCH