3LAKA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-heterocycle pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Heterocyclic pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lakA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lakA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lakA05
1HYVA 3KHGA 4NLVA 4BWMA 1XHZA 1I3AA 4E7IA 3L2QA 2HHWA 4KHRA 4IDKB 3B6OA 1NK8A 4ED7A 3KK1B 2IM3A 4DU4A 4G1QA 3SPYA 1DLOA 3PV8A 3AVNA 1IKVB 3IRXB 5HRRA 2HWHA 4M3YA 2JEFA 3GIMA 3QEWA 3TAMA 4DLGA 1C6VA 2IC3A 1GOCA 3HSTB 1D9DA 4DL7A 3EZ5A 4GC6A 2OYQA 4G3IA 4ZVGA 1C0UB 2CKWA 1FKPB 4JRQA 3F9KA 4RW4A 3AO4A 5DLGA 4OGCA 5DLFA 2P1JA 4Y1CA 4W5QA 2FBVA 5KG6A 2RDJA 1NHUA 4F50A 3SUQA 1S48A 3RWUA 3CFPA 1RTIB 3HO1A 5HP1A 4ICLB 1JLAB 3BGRA 5KT5A 3DRSA 3MR2A 4BACA 1TGOA 4KO0B 1RTIA 4IQXA 3KD5E 3AVJA 3G10A 3TR8A 5KFYA 3VQ9A 4URSA 4IR1A 3S9HA 4O3OA 3ZSZA 1RT3B 1SV5A 1GOAA 1HPZB 2IAJB 4Q44A 3ITHB 4DQIA 4DSIA 5HP1B 4DEZA 2YKNA 3SI6A 3PUFA 4ID1A 1QHTA 3AVLA 2HHTA 1RA7A 3MEEA 2AGPA 1KVBA 3HT3A 2W9AA 3HPGA 2JGUA 1NNDA 2E4LA 4CJPA 4J9KA 1C1CB 2XO7A 1JLGB 2C28A 3OYNA 3MXJA 2GIQA 1EXQA 2ZD1B 4EEYA 1QE1B 1Q9YA 4QWAA 3O4QA 4K4XA 2XC9A 3KHRA 4RW8B 1K1QA 5FROA 1FKOB 1ASUA 1FK9B 5KRSA 4O5BA 4E7KA 4DFKA 1Q8IA 4E3SA 2JLEA 3ZT3A 3CM6A 3V9XA 4OKJA 1RT6A 4CF1A 4BDYA 4JV1A 4F4KA 3VA0A 4ECQA 4UQGA 4DQSA 3SUNA 3HL8A 5JS1A 4FZXC 2HB5A 4FLWA 4FM0A 3MXMA 2FBXA 3QYYA 1SKRA 4B9UA 1QSYA 3OY9A 5J1EB 2DFEA 2JC1A 3LP1A 4M3RA 4CJFA 4HUGA 1S6PB 3FSIA 4TLRA 3GIJA 2Y1IA 2HHVA 1A5VA 3OSPA 1HARA 4FLTA 3DM2A 5KG3A 4KTQA 4WXWA 4EBDA 4ZPCA 3PW4A 5KG2A 4JRPA 1HPZA 4KPYA 1JLFB 1QE1A 2W7OA 1LW0A 3QZ8A 2FLPA 5C24B 3LP0A 1R0AB 1TQLA 3AVFA 3RMBA 3DLKA 4CEZA 1DTTB 3BSOA 5EUHA 3I0RA 5C25A 1IH7A 4CK1A 4XPCA 2JEGA 4QAGA 3C95A 4EP5A 5EWFA 2AWZA 2AU0A 1N56A 4ECUA 3T1AA 3MAQA 4YNQA 3QLHB 2VWJA 5KFBA 3MR5A 1UAXA 2IM1A 2E6MA 1SV5B 3O4NA 1BCOA 3DOKB 4FLUA 2FLNA 5KFJA 4FW2A 1DTTA 1S0OA 1RT2A 2J6SA 3QEIA 3TAQA 1RDAA 3V81A 5KG0A 3PX0A 2QV6A 4N76A 3RRHA 3DRSB 1IKYB 3I5BA 5HLFA 5KFKA 3I5AA 1U49A 2WONB 5KFPA 4FK2A 4RNHA 3FQLA 5C24A 3QESA 1IKVA 3OYIA 4CF8A 5KT2A 5KFXA 2VG5B 3BDPA 1K1SA 1KVCA 4CJKA 2GUIA 4C8OA 2C2DA 5K14A 5KFAA 4ECSA 2R2TA 2VA3A 3B6PA 4H4MB 4OLAA 1JLQB 1S1TB 4LQ9A 4DU3A 3UPFA 3OYFA 1J9AA 4CEQA 4CJTA 3SI8A 4Q45A 1T94A 4DG1B 1UWBB 4EZ6A 2WOMA 1S1XA 1RT5A 3RB0A 3HVTB 3UIQA 1I39A 4QWEA 1ZBLA 2V0NA 2D5RA 3SFUA 4CEEA 4WFZA 3S3MA 4RW6B 1IO2A 2IBKA 4E19A 2VWKA 4GVMA 2FVQA 3SPZA 5KGXA 2BR0A 4DSLA 5KG1A 4DQPA 3OS1A 1T05A 3H5XA 2PYJA 4W5OA 1S1UB 4K4UA 3L3VA 1HNIA 1BISA 4DSFA 3N6MA 4PWDB 4KE5A 4BE0A 4J2AA 1IKWA 2IAJA 2BE2B 1UA1A 3NGIA 1S0NA 4IRDA 2HNYB 1GOBA 1TKTB 3ZSXA 4KFBA 1ZBHA 5KT7A 4DTNA 5KFHA 2XGQA 2R2RA 3H40A 3NHGA 3MEEB 3PZPA 2WTFA 1RDBA 3IGNA 1C1BB 4KO0A 3NCIA 4DFPA 1N4LA 5DG9A 4LD0A 4IFYB 3ZT2A 2QK9A 3V1QA 3G86A 3OLAA 4HCCA 4HHTA 3S3OA 2HHUA 3LANA 2DFHA 1ASVA 4CF9A 3LALA 3V9ZA 1FXXA 3KLGA 3H98A 4OKEA 4R8UA 3TABA 1SKSA 3CFRA 4FLVA 4RW4B 4I2PB 3BGRB 3EPGA 3H2LA 2HW3A 5J2MB 3GV8B 3OL8A 3G6YA 3AA5X 4OL8A 3KLVA 4O3SA 3P83D 5T14A 1KRPA 3CJ5A 2R8JA 1S49A 1VRTA 4AHUA 1RBSA 1S6QA 2DPIA 2ASJA 4BDZA 4IH6A 1TL1B 4FJJA 5SZTA 4FJNA 1RYSA 3IGVA 4NLDA 1IM4A 4F3OA 3ULDA 3VQSA 2XY7A 1L3SA 4NLTA 1KLMB 3U3YA 1S1WA 4KB7A 4KAIA 1TKXB 3KLIA 4OPKA 2X6NA 3MFHA 4WE1B 1RT5B 1S1XB 4WXOA 4MQ3A 2D3ZA 4ZVEA 3V6HA 3VN5A 4J2BA 2D41A 3CDEA 2F8TA 4B9SA 3SCXA 1NKBA 4IRCA 2R2SA 1EETB 3U3GA 1X9SA 3IN5A 3ISNC 4MKAA 4FK0A 3FRZA 3K5NA 4DWIA 3E01A 1ZBUA 2KFNA 1EX4A 4NRTA 4PY5A 1TAQA 4DS4A 2D7SA 3AO2A 3KLFB 2GC8A 3CJ0A 3KK3A 3DOLB 4KFBB 1IG9A 3NH1A 3NH0A 5KFWA 2FJVA 3RB3A 5CYMB 3M8PA 1EETA 3KMQA 4IFVA 4K4YA 3NE6A 1LV5A 4TY9A 1NHVA 4IKFA 1ZBFA 1TL3B 2GV9A 3ZSYA 4IH5A 5KRTA 3E01B 4NLYA 3AVCA 3OYHA 4B8CA 1KHVA 4RNFA 4GMJB 4NLWA 3VQDA 4RW9B 1HNVA 3DOKA 3PW5A 5J2NA 3Q8SB 1J5OA 3NF7A 3NGDA 1JKHA 3OYCA 3LDSA 3KMSA 2ALZA 1NJWA 3LZJA 3V6DB 3NBPA 2WK4A 5KFFA 1WSIA 3RAQA 2HNZA 5L9XA 4M3XA 3DRPA 5KG4A 4K8XA 1VRTB 1KLMA 3MECB 1WN7A 1SL1A 3KLEA 3CFOA 2C2EA 4LH5A 3LP0B 3QINA 1KTQA 4DTPA 4Z4EA 3VQ8A 3RBEA 4LSLA 2WRMA 3NH2A 5KFLA 3VA3A 2R8GA 5J2MA 1WSGA 3D28A 3DDKA 2R8KA 4O44A 2IS3A 5EDWA 3S3NA 4R8UB 1XWLA 3SNNA 4KHQA 3AVIA 4YFUA 4LH4A 4M95A 1UA0A 1ZBIA 4NLQA 4WZMA 4BE2A 3G0ZA 4YP3A 3O3HA 4N41A 4PUOA 2OPRB 3HXMA 1YTAA 4CEAA 5L1LA 4MIBA 3KLEB 5KT6A 2AX0A 3KLHA 2ASLA 2HHSA 3M8RA 2YNFA 4DU1A 4NLUA 2E9TA 3QO9B 4ECVA 4HUFA 1BGXT 3EPIA 3I0SB 3VQCA 3NBPB 2FVSA 1TKZA 4CHZA 1VSFA 4CE9A 4NYFA 2FJXA 5EWEA 2BQ3A 4ZVHA 3SQ0A 4CHYA 3KK2B 4AH9A 5CYQA 4OPJA 1FKOA 2DPJA 4CIGA 4O0IA 5DG7A 2HWIA 3DLEB 2FVPA 4DTMA 4PWDA 1JLBB 4YQWA 3VQQA 2D0BA 2EHGA 3Q8QB 4ZP7A 2YNHB 1REVA 1EKEA 4KI6A 1S5JA 2A1RA 5C25B 1L3TA 4FJ5A 4FM1A 4DSJA 3VQBA 4J9NA 2C22A 3QIPA 3OYLA 1REVB 4FZYA 2UUWA 3AA4A 3M8PB 4ZP6A 3V4IA 4MIAA 1HNIB 3M9MB 4M42A 1U45A 4RW6A 4FYDA 4ZP9A 5F8MA 4E1MA 3T5HA 3ITHA 4CIFA 2AGQA 3FFIB 1T03B 4OLBA 2WOMB 4MK9A 5FRNA 4HKQA 4JUZA 5FDLB 3QGIA 1LW2B 4URQU 2UVVA 2KQ2A 2O4GA 3HPHA 3OYEA 3GIIA 1B9DA 4IG0B 1O1WA 1JLQA 5F8NA 4FJIA 3PO4A 3ZT4A 1U09A 2YKMA 3RMAA 4E1NA 5KFZA 4DG1A 5F9LA 4KHMA 4EO6A 2Z1JA 3CYMA 1G15A 4BE1A 4PQUA 1RYRA 2ILZA 4NZ0A 3RB6A 3QZ7A 4KSEB 3A2FA 4J9MA 3M8QB 4CFAA 2V4QA 2WONA 1JL1A 1KLNA 3Q8PB 3BQ1A 4DS5A 1SL2A 2VG6B 4CGDA 4M3TA 3SFGA 2P51A 3ZCMA 4CF2A 4H4OB 2IC3B 3V81B 4ECWA 4DMNA 2P5GA 2R8IA 3DRPB 3TARA 3DI6B 4DF4A 2J6UA 5E41A 1LWEB 3OL6A 1RTHA 3GQCA 4F4ZA 1QSLA 3SQ4A 1ZTTA 4IRKA 3H4DA 3MEDA 1S1VB 4DL6A 4B9VA 1KSPA 3TANA 3K58A 2XWYA 3BR9A 3D45A 1C1AA 2IM0A 1RTJB 4KV8A 1NK9A 2F8EX 3BSNA 2WB4A 2RF2A 1LWFA 4CK2A 2I5JB 3KHLA 1U48A 1RT3A 3AVBA 1TKDA 1GX6A 4C8LA 5KFVA 3C6UB 4NCAA 4ZMMA 2IJNA 4O55A 4CIEA 4CGIA 4R5PB 1HYZA 1D0EA 3H5SA 3AO1A 2AGOA 3HM9A 1JLAA 1VSJA 2E9ZA 1HYSA 4FJKA 1Y97A 1C1BA 5CYMA 1BCMA 3NF6A 1RBVA 1WAFA 3KTQA 2W42A 1BIUA 4BWJA 1HMVB 1HMVA 5L1IA 5HBMA 5FDLA 3MFIA 3KLFA 2FVCA 4CK3A 3TAFA 4DL5A 3FFIA 3AV9A 2B43A 3OYGA 4HUEA 2W9BB 3O3FA 1BQMA 3V9WA 1FKPA 4KRFA 2ITGA 2X6SA 3CVKA 3QIPB 1C0MA 1U4BA 4NYZA 1QS4A 4EYIB 1NK4A 1W25A 2EX3A 3KKRA 1RCHA 4TSXA 4NCGB 2C2RA 4QWBA 4E89A 1RTDA 1RA6A 1VSDA 4ELVA 3G6VA 1JLBA 3PVXA 1VSHA 2OA8A 1JLCA 2QXFA 1JLCB 2OPPB 2P5OA 4CFBA 4B9TA 2XGPA 1RTHB 1CXQA 1QAIA 2FBYA 4W5RA 1WNSA 1EP4A 3VQ5A 5KI6A 4F8RA 1XR6A 2XRIA 3SQ2A 3OL9A 3HK2A 1C1CA 1L3VA 2UVRA 1S10A 2IM2A 4NYNA 4DTSA 3KKSA 3V9SA 4ECXA 1WSFA 3RRGA 1Z26A 1RILA 2ZD1A 3LWMA 5JUMA 4IOBA 2RKIB 2YKNB 4PUOB 4O4RA 4M41A 3SV3A 3MTKA 3ALYA 3M9OB 4N5SA 3BQ2A 1WNEA 3NF9A 3UDLA 4X2BA 4DTOA 2QKBA 3PJXA 2W8LA 4F4XA 5D3GA 4O44B 3OJUA 3CO9A 3V9UA 2V9WA 1DTQB 2OPQB 3PW7A 2G8WA 2E9RX 4AHRA 3UQSA 4TY8A 4Z4GA 4RUAA 1JXBA 3H4BA 4E0DA 4B9LA 4I2QB 4LQ3A 3RR7A 4CF0A 3VQ4A 4ZPDA 1NK0A 4ID5A 1N5YA 3VQAA 1RTJA 1RT7B 3RAXA 4O3RA 3H59A 2XCAA 3SUPA 3V4IB 2JC0A 4NLXA 2BE2A 4IR9A 1TVRA 1A5WA 4YR0A 2BQRA 3BREA 1X1PA 4FBUA 1Z25A 3L2UA 4CJWA 2X74A 4KHSA 2BANA 2W7PA 1SUQA 1SH2A 3HJFA 3WNHA 2GBZA 4MH8A 4OJRA 5FRMA 2GIRA 1T05B 3NKYA 4W5TA 3HKWA 5L1JA 2ASDA 1BHLA 1ITGA 4FLZA 3TAMB 4Q8FA 4XPEA 4M3UA 4GC7A 1SL0A 1RBRA 3LAMA 3DLBA 1RAJA 3IAYA 4J9OA 2ZE2B 3OL7A 2FJWA 2XCPA 2B5JB 1T7PA 5I3UA 1S0MA 2HVHA 4ECYA 4CJVA 2YKMB 4F2RA 5EWGA 3PR4A 4ED1A 4ZP8A 3NAIA 2B6AB 4DL3A 3RR8A 3NGYA 4RZRA 3H5UA 1LWCB 4CGGA 3OSNA 2VG5A 1FK9A 1ZETA 1J54A 4RW8A 4CEFA 2ZE2A 3P5JA 1NOZA 1SUQB 4B08A 4LSLB 4Z0UA 4H8KA 4ZHRB 3L3UA 2OPSB 3QEXA 3JSMB 4Q43A 4KHUA 4N56A 4CJQA 4K50A 5HLFB 1IKYA 1D9FA 1WLJA 4M3ZA 1TAUA 4B3OA 1ASWA 2G8FA 4KKOA 3E51A 4FJMA 3WNGA 3GV7B 4ED8A 1IKXB 2RPIA 3CQ8A 1XR5A 4KHWA 2Z1IA 3LP2B 3EY1A 1JKHB 3AVMA 4RW7A 4FJ7A 3IS9A 3DYAA 4CJSA 3BQ0A 4KTZA 1TKZB 3HHKA 4ZVFA 4O3NA 3LP3A 4ID5B 1D8YA 1RNHA 4Y3CA 3VQ7A 3RB4A 1VSLA 4F4YA 4Q8EA 1S9GB 1DTQA 2OPQA 4U7CA 1D5AA 5KG7A 2KZZA 1JLEB 2EC0A 1QUVA 4MK7A 1MU2A 3RMDA 3HP6A 4ICLA 1S4FA 4CCHA 4QWCA 3LP2A 3EYZA 5JS2A 5J2QA 4ZPBA 3BJYA 2A1SA 1W0HA 3OYMA 1S97A 1LAVA 4J9QA 3QERA 1S1UA 3LP1B 1WSJA 4FJ9A 4U6PA 2JEIA 3EZUA 3L2RA 4E7LA 5DK5A 4ECZA 4C8KA 3OLBA 4ZHRA 5KFTA 2IJFA 3CJ2A 3OHBA 3AO3A 3CJ3A 1ZTWA 4Q5VA 1YVUA 2Z1HA 5KFIA 1RT6B 1TV6A 3ICLA 3IG1B 4JV0A 4ED0A 4HTUA 5KFGA 1DLOB 3PJWA 3KK1A 1NKEA 4CHPA 1TK0A 5SWMA 2B6AA 2XHBA 3QIDA 3K5MA 3OS0A 4FJHA 1BI4A 1RBTA 3M8SA 3QEPA 4YMEA 4PA1A 2R8HA 1TV6B 4FJGA 4ED3A 1NJZA 1S6QB 3GYNA 2W9BA 2BANB 2CJQA 1XR7A 5KFDA 4GW6A 4EZ9A 1WSHA 4IFVB 1OS5A 4R0EA 5C42A 3PHEA 3PR5B 2XI3A 5F8HA 3DRRB 3NF8A 5K14B 4RU9A 1B92A 2Y1JA 3G6XA 4FJXA 3ZSRA 1D1UA 3HVRA 3HPOA 2DY4A 4ELTA 3PW0A 1U47A 3V6KA 3GV5B 3AA3A 3KLGB 4AHTA 4QW8A 1GX5A 4FCYA 3C6TB 5L1KA 4ED6A 1MU2B 1JLEA 5DQIA 3MR3A 3TQ1A 4E7HA 2IOCA 4CESA 1NOYA 1IKXA 3SJJA 4I7FB 4MKBA 4O0JA 1VSIA 4ECRA 1L5UA 1BQNB 3D5MA 3DYAB 3IS9B 4FLYA 4CEBA 2W8KA 4KV8B 4IH7A 5KFRA 4H54A 4WYWA 4KAZA 1R0AA 1CXUA 5KFQA 4HCBA 3AVKA 1TL1A 4WZQA 4TY8B 2OZMA 4B3OB 5F8LA 1S9FA 4TQSA 3H5YA 1KVAA 4O4GA 4FLXA 5F8IA 3OVNA 1SH3A 2ETJA 4YR2A 4CJUA 3F73A 1TP7A 4TXSA 4K4TA 4EP4A 2XY5A 2O5DA 1S6PA 3FDSA 2YHBA 1HQUA 2F96A 2OPPA 5J1EA 4TYBA 3LZIA 4F3TA 2IGIA 4CECA 4DTUA 4IDKA 4Y1DA 3SUOA 3T5LA 4CGHA 2HMIA 3DM2B 4AHCA 4M94A 4NCGA 3MEGA 3CWJA 1C0TA 3TWHA 3LPUA 4MFBA 4QW9A 3DLGA 3NGZA 1B9FA 3LPTA 3THVA 2VG7A 5KFEA 2HAIA 4NLPA 3CDUA 3K2PA 4DTXA 2BDPA 4FS2A 2B5JA 2AQ4A 3NFAA 2YHAA 5KG5A 2J6TA 4OGEA 4IG0A 2KFZA 3GILA 4CJEA 4ECTA 1A5XA 5DQHA 5J2PB 3VQPA 5F8GA 4IKAA 4LSNB 3ISND 5I42B 4WYLA 2D0CA 4NCBA 4Z4IA 4O4GB 3UR0A 2KZMA 1ZYQA 3ZSVA 4HYKA 4CHQA 3T3FA 1BQMB 2XI2A 2QE5A 1S9EA 2B4JA 1VK0A 3CM5A 3SZ2A 1JLGA 3K57A 3VQEA 4Z4HA 2HNDB 1YVFA 4I9QA 2I1RA 4YR3A 5KT4A 2G8KA 2HVIA 2FVRA 1LWFB 3RTVA 4LSNA 5I42A 5KFSA 3HP9A 4I2QA 1RT4B 4TYAA 1WSEA 3TAPA 3L8BA 2XY6A 3MEDB 1HYSB 1N5YB 4J9RA 3KLHB 1HQEA 4AILC 5DMRA 3OYBA 3KJVA 3SYZA 4NLOA 5KGWA 4NLGA 3AVGA 3C6UA 3DLGB 3KHHA 4TQRA 2KTQA 3QO9A 2HHXA 4H4MA 1LW0B 5KFUA 1MMLA 5CZ2A 2W9CA 2RF2B 1C0TB 4RG8A 2D0AA 1CZ9A 1YT3A 4C8NA 4FW1A 3PO5A 2RN2A 3N6NA 4WFXA 1S1VA 3DLHA 3TAGA 1C0UA 2YNGB 4EBCA 3CIZA 4FK4A 1T8EA 4KI4A 3L2VA 2YNGA 4K4WA 2HHQA 5DGAA 2IDOA 2FLLA 5F8JA 3KJVB 2R2UA 4DFMA 3QGGA 3OS2A 2W9CB 2VG6A 4MK8A 2OH2A 2Q3SA 4AHVA 2IMWP 1RT4A 1Z4UA 4CJ5A 1RT2B 4XIUA 3M8QA 2FBTA 1LW2A 4JS4A 2V4RA 5J2NB 1EP4B 1HQEB 4EO8A 2BGGA 3CDWA 4PQUB 3KNAA 3HVWA 4DSKA 5HRPA 4KB1A 3IG1A 3CG7A 4BDPA 1J53A 1S9EB 4J9PA 1RTDB 1L3UA 4KTWA 5KTQA 4CJ4A 5DQGA 1TK5A 2PY5A 2R7YA 4CEDA 4FS1A 2BQUA 5CZ1A 1NJXA 4DFJA 1RDRA 3O3GA 3DOLA 2BRKA 2YNHA 3HVAA 4Z4FA 2YNIA 4CHNA 3ZT1A 1N48A 2Z1GA 4CGJA 4RNNA 4K4SA 3BSCA 3BSAA 3RMCA 2KW4A 5CY4A 1C2PA 3DRRA 5CYQB 4JV2A 2E6LA 5HBMB 2F8SA 3JYTA 5HRSA 5J2PA 2UUTA 5C5JA 3N6LA 2D3UA 5DGBA 2YNFB 4CGFA 4R5PA 2HMIB 1TKXA 5KT3A 2UVUA 1HQUB 3T5KA 1S1WB 2YV0X 4IG3B 3NAHA 4MFBB 1JXLA 4OKKA 2I5JA 4NLSA 4TN2A 1F21A 1QTMA 3MEGB 1VRUB 4LY7A 1NKCA 4FXDA 4WE1A 1X9MA 3NL0A 4H4OA 4M45A 3U6FA 1RDCA 3QEVA 3WNEA 1U04A 4DL4A 4KREA 1LWEA 4B9MA 4NRUA 3DI6A 3DMJA 3H08A 4N47A 2DFFA 4J9SA 4ED2A 1JX4A 4CERA 4ELUA 3PX6A 4DTJA 3OYKA 1KCFA 1VSKA 1VRUA 3ZSWA 3TI0A 4Q0BA 1RT1B 4I2PA 1NK7A 4KHYA 4KB0A 4QWDA 4IBNA 2O4IA 3I5CA 3OHAA 3D0PA 1J5OB 3OYDA 4DSEA 1BQNA 3LAKA 4Y2CA 3C6TA 4RNMA 2PYLA 4Z4CA 5I3UB 4KBIA 4L8RB 1S9GA 3MXIA 1K6YA 2ATQA 4F2SA 3V6JA 3NDKA 1T03A 4I9LA 1JL2A 3RBDA 4QPXA 1N6QB 5F9NA 3ZT0A 3KK3B 3L2WA 5C42B 3OYAA 3KIOA 4EYHB 2X78A 2NUBA 1HNVB 2AJQA 4Y2AA 4F4WA 4JS5A 4M3WA 3NMAA 4QOZB 5KFMA 4KKOB 1TK8A 1NK6A 3GIKA 4J9LA 2G8IA 4QCLA 2RDIA 3QNNA 3QNOA 1NK5A 3SQ1A 1IKWB 5T7BA 1TVRB 2ATLA 1BI4B 2WHOA 3TAEA 3DLEA 4RUCA 4B8AB 1KFDA 1SH0A 1CSJA 2OPSA 1QQCA 3T5JA 1VSMA 1WAJA 4O3PA 1RT7A 3IRXA 3PW2A 3I0SA 4G1QB 2LSNA 1NJYA 4XO0A 3AVHA 2XY8A 1LWCA 1JXEA 2ZKUA 5DG8A 1X9WA 1CZBA 2G8VA 1Q9XA 4FJ8A 1RDDA 3KK2A 1S1TA 2BRLA 3SV4A 3ZSQA 3C94A 2OPRA 2JEJA 4W5NA 4NLRA 1HRHA 1XI1A 3HVTA 4K4ZA 4HVJA 4FJLA 4DTRA 5KFOA 1UWBA 1QSSA 3ASMA 2DTUA 4CEOA 5KFNA 1RBUA 5J2QB 1QAJA 4DLEA 4ZTFA 2AX1A 5KFCA 3HYFA 4JLHA 3QIOA 4AHSA 1CLQA 1W9HA 4CHOA 1UOCA 4C8MA 3VQ6A 1JIHA 3OJSA 2RKIA 3AVAA 4URGA 1RT1A 2OZSA 4Q0BB 1KFSA 2QKKA 3QGHA 3K5LA 3K5OA 1LAWA 3MECA 5JXSA 4DF8A 3NAEA 4Y34A 4FVMA 2FC0A 5EU7A 5HRNA 3Q8RB 1SKWA 4J2EA 4CFCA 3LWLA 5HROB 4WFYA 3PX4A 3DMJB 3QETA 4IG3A 1I6JA 4RNOA 4CJ3A 2HNZB 3MR6A 3CJ4A 1T3NA 1VSEA 4RW9A 4FBTA 3V1OA 4I7FA 3V6DA 1BIZA 4O3QA 3OYJA 3MF5A 2IA6A 4RW7B 3I0RB 1XHXA 3KD1E 2G8HA 4EBEA 2HNDA 3QLHA 3FQKA 3M9NB 1KHWA 3JSMA 4DQRA 4OVLA 1HJRA 3JYTB 3TVKA 5HROA 3I8DA 4IFYA 1JLFA 3V1RA 3K59A 1YTUA 3DLRA 2UVWA 4CJRA 4KHNA 4FZZA 3AO5A 1TL3A 2ILYA 4ZPAA 4DQQA 3WNFA 3DLKB 3PY8A 3P1GA 5D3GB 2YNIB 4CFDA 2ZQBA 1XC9A 1TKTA 4FM2A 3T19A 2HNYA 4J2DA 1N6QA 4B9NA 3ZSOA 4CJLA 4K8ZA 4ZTJA 4DL2A 4K4VA 3KOAA 4E7JA 2VA2A 1BL3A 2G8UA 2VG7B 2WCXA 3AA2A 2PZSA 3KLIB
chains in the Genus database with same CATH superfamily
2RMLA 4BWMA 1N33K 3OV7A 4PEOA 4CBWA 5F0XA 1NK8A 3CJRA 3SPYA 2QLXA 3IRXB 5HRRA 2VFVA 4M3YA 4YDXA 1BUPA 4W90B 3QEWA 5DZ6A 3O5BA 1VQ8N 1GOCA 4LVOP 4DV4J 4DL7A 3EZ5A 3ZC4A 4OYAA 2OYQA 4BRQA 4G3IA 3HX9A 3W65A 1IQZA 2CJAA 2CZ4A 1URRA 3IDHA 4U8VA 2FHJA 2K3KA 3OBYA 1PAEX 3R5GA 1U02A 2KI2A 1TUGB 4Y1CA 1EQYA 3VR1A 1WEXA 4A4JA 1VYAA 1YI2N 2RILA 5AXLA 1S99A 5LJVA 4ICLB 2HHHK 3NS5A 1SAZA 2B9EA 2JVOA 1NDLA 3BBFA 2KT2A 4B3MK 3MR2A 1WBDA 3DN9A 4B3SF 4IQXA 4KH6A 1KP6A 1SC3B 2QMUB 3AVJA 2J7KA 2OTJS 3TR8A 5KFYA 1ESVA 4IR1A 3S9HA 1SKUB 1PBUA 1SV5A 1YJWN 2Q6CA 4H4KA 1URNA 1LKZA 3I55S 3JXUA 3MEEA 1KVBA 3HT3A 1DZ5A 3P8BB 3HPGA 2C1EB 3HSJA 1FJGF 2UXBJ 2JGUA 1WKLA 2H5JB 1C1CB 3QMQA 1UJ4A 1RLCL 2C28A 3OYNA 4CLFA 1Y5IB 4B1UB 3QT5A 1QE1B 3W3DA 4J8FA 2VGMA 4FYWB 1K1QA 3F0NA 4DV6J 3GFZA 4O5BA 5D0GA 3MCMA 4PPZA 4ZCKA 4E3SA 1OY9A 3CM6A 3AODA 3BZKA 3O4WA 2BJ8A 1C4CA 2ZUAA 1RWWB 1RLDA 3GONA 5JS1A 4CO1A 3OVAA 2XNQA 3MURP 3MXMA 1M5PC 1M0SA 4L76A 3OY9A 2DFEA 3LP1A 4BRKA 4OYZA 3CMAN 5JJBA 3OUYA 1A0OB 4TLRA 3NLCA 3GIJA 2HHVA 3QMLA 1HNXK 3D6FB 1HARA 1YXQA 4FLTA 4NXMK 4WXWA 4ZPCA 3PW4A 5KG2A 4JRPA 1HPZA 1XNQF 3AH6A 4LRBA 3U7JA 2W7OA 1LW0A 4ZA1A 3LP0A 1R0AB 4P74A 1O51A 3AVFA 1FCAA 4LF4J 2E7VA 3QWUA 4CEZA 2Q2RA 2KT5A 1IH7A 4FWLA 1X4CA 2LXFA 3UKRB 2KG0A 2DR9A 3PJ9A 4KQZA 5CHCB 2QA4N 4WIIA 3BYRA 2F4VK 2CA9A 3MR5A 1UAXA 4EFAC 2IM1A 1MWKA 4M1KA 1GLBG 3R2CJ 2B4OA 5LT5A 4FLUA 1NH7A 1OVQA 1RT2A 2J6SA 3HT0A 4CQ1A 3PX0A 2P9PA 2O8CA 4N76A 3PSIA 4CD3A 3Q2SC 3FVYA 4M63C 1H98A 1V4SA 2VQEF 2G2ZA 2Z2YB 4JKCA 1Y4ZB 1H73A 1MSWD 3VEOA 2VFUA 3QESA 1CLFA 1IKVA 5K5MA 3OYIA 4CF8A 4I56A 3F44A 5B8HA 5KFAA 4LJMA 3QFWA 4C4WA 5M1QA 3VESA 1K0VA 4WCEQ 4H4MB 1JLQB 4WU2A 1GXLA 2XMVA 2A42A 4H5TA 1X5SA 4L3KA 1SQEA 2Z57B 3LH2S 2CGLA 4B3TF 2MKSA 3FBBA 4Q45A 4DG1B 4JI5J 4EZ6A 1YRXA 2D5RA 3W9JA 3SFUA 4QOTA 3S3MA 1IO2A 1VQKS 1HQ2A 4E19A 2HBRB 3C14A 4H4KC 4DSLA 1T05A 2CPDA 4OZ5A 5F0UA 3M32A 3N6MA 4PWDB 3MHYA 4KE5A 4A8WA 5LMNF 4J2AA 3UVJB 4AQYJ 5IWAK 2BYCA 3S41A 1S0NA 2GJFA 4ES1A 1GT8A 5C12A 2ATCB 4I6WA 3H40A 3MEEB 1S4EA 2WTFA 3FKBA 1RDBA 1C1BB 4L6V3 8RUCA 5HATA 3NCIA 5DG9A 4N8OA 2FPHX 2VD3A 3G86A 4XTTA 4BRDA 4DV3J 3MX5A 2AJ1A 2BXJA 2UU9F 2Y8WA 1CULA 2GS8A 4DQ8A 5AQZA 4A8FA 1ASVA 3D0IE 1FXXA 3RW6A 4CO4A 2A6OA 2GVZB 2GZOA 3CCES 2CFXA 4FLVA 4RW4B 1M1GA 4I2PB 3H2LA 3TVYA 4RBUA 1GLEG 1V6HA 1X0PA 1JJ4A 3R5BA 1YHQS 3KLVA 2Y9HA 1YSJA 3A4TA 3CJ5A 4QIEA 1FO1A 2R8JA 2UUBF 1VRTA 5GAHP 3R5DA 3CCEN 1S6QA 1RAIB 2ASJA 4F7VA 2OFGX 3IGVA 2P6SA 3P31A 3CCVN 4M5IA 3VQSA 4YS2A 2PA8D 1KLMB 3U3YA 4YY3J 4KAIA 2CGKA 3I4PA 1VQ7S 2X6NA 3MFHA 4WE1B 1S1XB 4MQ3A 3IAM9 1VQYA 1VQ5S 2A5XA 1VK3A 4ZVSB 2FZKB 1WTFA 5IWAJ 4AQYK 4QR1A 1KQKA 1DHMA 1V3SA 2R2SA 1YBTA 5EVZA 1EETB 2NYIA 3U3GA 5B0EA 2M88A 4PG8A 3R7BB 1GNKA 4PY5A 4WWSA 4JI7K 3HFKA 4DS4A 3KLFB 3WX8A 3CJ0A 4DR1F 5DZ7A 2EFNA 3KK3A 2ZHBA 3FCWA 3M8PA 2CPZA 5EX0A 4JI5K 3TUZC 1NHVA 4HVZA 2HKEA 1ZBFA 4K41A 5HMWA 2LEAA 3H2VE 4NLYA 2MB0B 4B8CA 1KHVA 4KH0B 3VALA 3WQUA 2P9NA 3VERA 3BR8A 4NLWA 3VQDA 3PW5A 3Q8SB 1J5OA 3NF7A 1WKKA 3OYCA 4ZKAA 1TU0B 2CPIA 3UKUB 4HLBA 1WSIA 2F9WA 1VBYA 2BOAA 2MGZB 1YJ7A 4M3XA 4DUZJ 1KLMA 3CCQS 3MECB 1WN7A 4JKFA 2ZGYA 3KLEA 2HIQA 2C2EA 3HTVA 4WK3A 2CQ1A 4BGBA 3JTNA 4DTPA 1VLYA 4C1NI 2Z58B 1MWQA 2IYIA 2C3OA 3B8HA 2B51A 5HJYA 2R8GA 3C46A 1OH5A 3D28A 3NXZA 1X31C 3NGRA 2A1BA 2WBRA 1XWLA 3SQGA 3C0BA 4KHQA 1IBLK 4YFUA 1UA0A 1HKGA 1ZBIA 3MK6A 1NBEB 3G0ZA 3O3HA 1DEJA 3L9ZA 1XUPO 3FGUA 4MIBA 3KLEB 2JJ4D 3OFGA 1OH7A 1FRKA 3CJTA 3CCLS 2DNMA 1U6FA 3MM9A 3EPIA 4X4VA 1TKZA 4CHZA 1VSFA 4CE9A 2ZKTA 2BQ3A 3WQTA 4OYMA 2F4VF 2DPJA 4NXNJ 1X5TA 4DL0C 2FVPA 3CD0A 3MGJA 1S0VA 1JLBB 1D09B 4YQWA 2UUCK 2P9NB 2EHGA 4DN9A 1U2CA 3QT8A 3D54A 2YNHB 4NA3A 1EKEA 1S5JA 4NLBA 1XJWB 2DK2A 4ENOA 3J7AP 4DSJA 4YOXA 5ITHA 4OJGA 4FZYA 2UUWA 4KIAA 3AA4A 3M8PB 3V2UC 3V4IA 4MIAA 1FX4A 4RW6A 4M5HA 3FBCA 5F8MA 3ITHA 4CIFA 2J8SA 4MK9A 4RCHA 4HKQA 2X3GA 2XMWA 4OV6A 5FDLB 4DV6K 2MQQA 3ULEB 2KXHA 4BREA 3O1BA 4WK1A 3OYEA 3GIIA 3OW2M 1EAYC 4HI1A 5F8NA 1U09A 2YKMA 1WC3A 1T9WA 4NZ7A 3EXCX 4E1NA 4DG1A 1WG4A 3HZ6A 3AOCA 2X1GA 2YX4A 4BR0A 2YWEA 4BR5A 3MPDA 2LQBA 1FDNA 5THWA 2HBKA 3QZ7A 3A2FA 1KQGB 3WEEA 3M8QB 5GIOA 1X4FA 2HRUA 1JL1A 3BF1A 3B82A 1RHRB 4DCPB 3CW2C 5LJ5Y 3BQ1A 3R8YA 4DS5A 4V19J 5B0GA 1SL2A 3ZYYX 1UPMB 4M3TA 4CZGA 2P51A 3CCUS 2RQKA 4OYOA 2IC3B 2P9SA 5LMUK 1W97L 1RSCA 2R8IA 3DRPB 3AAQA 4LF4F 2LQ5A 5D6GA 3TARA 3MDQA 2F9JA 2J6UA 2ZM6F 3GQCA 5LY3A 1ZTTA 4HEA9 2M4MA 3MEDA 3TANA 5A8WB 3K7RA 1YBAA 3JQJA 3KNGA 5CAAA 1RT3A 2RAQA 4NCAA 3OD2A 4B3RJ 1NGBA 1BA0A 2V6AA 1HYZA 2NZTA 1X4HA 1U1RA 2DBBA 3HM9A 1EJ7L 2R7XA 4FJKA 1C1BA 5CYMA 3D6HB 4RBVA 2H4YB 2D1KA 5ETVA 3KTQA 4BWJA 5L1IA 1P90A 1SIZA 3D7SB 4CK3A 3T6BA 5AQLA 3RVCA 1BA1A 2A18A 4QS8A 4UOGA 4RTFD 3SJHA 1BQMA 3CCRN 1BE4A 1FKPA 1RQ0A 2AMCB 4KRFA 4OLOA 4PR6A 2LYVA 4CYUB 1U4BA 4LFCK 1W7AA 3O80A 1S5ZA 3A8KA 4B17A 1RCHA 5DDPC 4NCGB 2C2RA 3A8YA 1RA6A 1GLLO 5AQNA 2M8HA 3G6VA 3PVXA 1I3OB 2KL8A 5KPRA 1RUSA 4PHTX 2YCHA 5EHHA 2MQNA 4QIWD 2FBYA 1HD1A 4NI2B 1WNSA 3ZTOA 1KVIA 2HRTA 5KI6A 3OL9A 3W2WB 4F0KA 2UVRA 1S10A 2IM2A 4NYNA 4DTSA 2YX7A 4C3KA 4ECXA 4B3SJ 4R79A 3RRGA 3MUTP 1Z26A 5JUMA 3LL3A 4M41A 4CLWA 3CD6N 3SV3A 3ZZOA 2E5HA 3AD8C 1WNEA 3NF9A 3RG6A 2YX1A 5DO2A 2K2PA 4ILGB 1XEZA 3S01A 1R0BG 3VCDA 4GRSA 2GAGC 3OPKA 1H7WA 1SJQA 4JI0F 3HHLC 4TY8A 4Z4GA 1PAUB 3PCOB 2HVEA 4DDFA 4RUAA 3H4BA 4PXEA 4LQ3A 2NZ4A 2ROEA 4ID5A 1N5YA 1YVNA 3HD2A 1SQGA 3H59A 2E20A 2D9OA 4OZ3A 3V4IB 1VI7A 3P5TL 2QA4S 5IT4A 2UP1A 2ADBA 1TVRA 1HLUA 2W2MP 4DHVA 2KM8B 5LXRA 4CJWA 4JI4F 4KHSA 2HZCA 4BRGA 4CZMA 4DR4J 3OHRA 2IRUA 3WNHA 3NKYA 3T1YJ 5FIIA 4ZVOB 4CNZA 1ITGA 3J81j 3D4JA 1UJ5A 4BCAA 3T6JA 3A3OB 4CLTA 2IRXA 3DLBA 1GH8A 4JV5J 4DR4K 5E0OA 3AXKA 7FD1A 4FWOA 2JL9A 2HVHA 2QEXN 5HO4A 2M70A 4ECYA 4CJVA 2JDJA 4CW7B 2YKMB 2OEJA 1VAZA 3PR4A 4H03B 3VEXA 3GCXP 2QWOA 2B6AB 4RX6A 2E1YA 1S6OA 3NGYA 3PRBA 3H5UA 2QXLA 4X65J 5A6PA 2IVNA 3BH6B 4F25A 1V9OA 5M2RA 3GSDA 1Q81T 3L3UA 3VGVA 2C2NA 2DISA 1PYSB 4CVNE 4Q43A 2VPZB 2C42A 4N56A 3CMEN 3THWA 1D9FA 4M3ZA 5E3RA 3C66A 4FJMA 4ED8A 3HZGA 1Q86O 1NM1A 3HDSA 5AQKA 5ETSA 1TKZB 1GXTA 4X64F 2F7TA 1FRMA 4O3NA 4LRDA 4Y3CA 3RB4A 5IT0A 2EKYA 1FE0A 2OPQA 2GELA 2VFTA 2KZZA 1A9NB 1MU2A 2BM0A 3QAEA 3RMDA 1RDWX 3RAMA 4ICLA 1S4FA 1U2RA 1ZA2B 2XHWA 2DHSA 3J7YI 3LP2A 5JS2A 1JNRB 3OTOK 2JH3A 4WP8A 2UUBK 3A5MC 2ZH2A 2BV3A 1WSJA 4DUYF 4ZCIA 3EZUA 4CH1A 1V4TA 3L2RA 2EXUA 4C8KA 2CADA 3OLBA 4PPDA 3ULHA 5CQGA 1ZTWA 5D77A 3AD7C 3SMSA 1RT6B 2FHKA 2LXUA 5CCMA 4ED0A 4HTUA 3EE8A 3UD4P 3GE1A 4NE9C 3JAMY 4RU2A 1TR0A 1TELA 2GAHC 1VMBA 3QIDA 4AQYF 1YRTA 4FJHA 1YTYA 1P8GA 3QEPA 4YMEA 4PA1A 3NNAA 2XYHB 4B3RK 3MN5A 1TV6B 4FJGA 4ED3A 2J8AA 1WBBA 1S6QB 2M7SA 4DPYA 5LOQA 1GTEA 2QYCA 4GW6A 2EG1A 1YI2S 4K5SA 2V63A 3P6YC 5EX5A 2XI3A 3AD9C 2X1FA 3CPWR 4USVA 2VJUA 5F8HA 4PAAA 3P4UB 5K14B 4RU9A 3AHPA 4FJXA 1C0GA 3HVRA 1ZBTA 3C7NA 3OBIA 3CT9A 4AHTA 1GX5A 1T3OA 5CE3A 4FCYA 3C6TB 3DCAA 3FMBA 5EOYA 4DV5K 4YORA 1ZZFA 2W4PA 4IJNA 5H9EK 1H74A 1KN6A 2IOCA 4CESA 3R9PA 4I7FB 4MKBA 3QT7A 3CJSA 3D5MA 1CEZA 3DYAB 1F1BB 5GAEI 3GFXA 5KFRA 3CPEA 2BMBA 4KAZA 3J81U 5HVHA 3J81O 4W98A 5KFQA 2VF3A 3HF5A 3AVKA 4JI8F 4WZQA 1F9EB 3G82B 4Q2MA 3MPWA 4JKDA 2CQ3A 1E6YA 4B3OB 5F8LA 4DX8H 2V8HA 4FLXA 4HDHA 3GSIA 3KDOA 3T1HF 4CJUA 1TP7A 2WVCA 4K4TA 2XY5A 2O5DA 4UY85 1S6PA 2HGMA 1TZ0A 4YDUA 3LZIA 3TYTA 4DTUA 1MA9B 4IDKA 4NL5A 5D8HB 5EN1A 4Y1DA 2HMIA 3I32A 1FERA 4M5NA 2PI4A 2J0QD 4NCGA 3ZZTA 2RUSA 3CWJA 1IBMF 2C3MA 1F3FA 3M3ZA 3THVA 3LPTA 2VG7A 2HAIA 3KXDA 4P7TA 4X66K 3CULA 3CDUA 1R7IA 2BDPA 2W24A 4DV4K 1VQSA 3QDKA 1AUDA 4RR5A 3UO0A 2YHAA 4IG0A 4IYQA 3TQEA 4ECTA 1A5XA 1BDGA 5LSRA 4DPWA 1N32F 4KT0C 5F8GA 5I42B 3EZWA 5BR8K 4WYLA 5T7LA 4IOAL 4BY9C 1TYQB 4DN0A 4XH1A 2HVZA 1EKSA 3UVJA 3M4XA 1OYDA 1U8WA 4LF2A 5BN8A 3KG0A 4FPAA 4I64A 1Q0NA 3AJDA 2XI2A 1RU2A 4X4QA 1FEHA 2B4JA 4F9OA 3AAWB 3K57A 1IBLJ 1HBMA 1DGKN 1IBKJ 3LDNA 3OTOJ 5CA5A 1B70B 2XZDB 2WSEC 4LSNA 4UT4A 1OQ6A 3C8YA 3KG4A 5JVGQ 3R6GB 4G1PA 1RT4B 4NYPA 4TYAA 3RJMB 1YIJS 3MEDB 1HYSB 2F40A 1LFWA 5A6WA 3KLHB 1RKIA 2FSJA 3OYBA 3KJVA 3SYZA 4NLOA 3GP9A 1MMDA 3CCZA 3QO9A 2DITA 4H4MA 1LW0B 1RHUB 1MMLA 5B7WA 5CZ2A 3VGUA 3JQKA 2UV8A 1IR1A 2RRAA 1IWAA 2QA2A 4UZCA 4JI3K 3PO5A 4WFBL 4HWIA 1S1VA 3ZZRA 2Q66A 3CIZA 1T8EA 4CTAA 4A8KA 3L2VA 2VBYA 2HHQA 4JP8A 5DGAA 1RHQB 5AXNA 2FLLA 5F8JA 3KJVB 3SAHA 3Q22A 1KR4A 4PXBA 1UVJA 2VG6A 1RT4A 1Z4UA 3SMPA 4CJ5A 1RT2B 1V3RA 4XIUA 1CQNA 3TUIC 2FBTA 3ULEA 5J2NB 1XNRJ 1HQEB 2A2CA 3IG1A 4CYUA 3NOCA 2NZCA 1UVMA 1XMBA 4CJ4A 1AZSA 5DQGA 1TK5A 1WB9A 3PKMA 2R7YA 1KQSM 3MMCA 1A7GE 3MX2A 5CZ1A 4CIOA 2Z0GA 4DFJA 1LOUA 2F9TA 1F5CA 4FF3A 3DOLA 2YNHA 3EDQB 2YNIA 4CHNA 3BGFA 1VC6A 1NMDA 1JJ2M 1N48A 3BSCA 2JWKA 1VQLN 2E5LK 3W62A 4E8UA 2AEFA 2CH5A 2GX8A 2UUTA 4Y0FA 2KYZA 2D3UA 2H65B 5DGBA 3M2VA 3MM6B 2B4VA 1H6KX 2KVIA 4R5PA 2HMIB 3ADAC 3O9QA 4M8LA 4DI6A 2FYXA 4UOHA 3T5KA 4I67A 1S1WB 1FKAF 4DZ6A 3TW0A 2ITMA 1JXLA 3KYLA 5IXUA 4TN2A 1AFJA 4HR2A 3IA0A 1QTMA 3MEGB 3EE3A 2I2YA 2BKPA 1RBOB 3KWMA 3U6FA 3KJFB 1YJ9S 3WNEA 1NNEA 5EY4A 4DL4A 5U47A 1P9YA 1X7VA 2DFFA 4BRHA 3DGPA 4BC9A 2KHDA 2NSCA 2V9KA 2OIHA 3BY5A 3OYKA 1X3MA 4MLHA 2ZEJA 1EX8A 3LTOA 2MZRA 1VRUA 3ZSWA 2MY8A 3T41A 1NK7A 4KHYA 1VQ7N 4YY3F 4IBNA 9ATCB 3D0PA 1J5OB 3GTYX 3ILJA 3OYDA 2PA3A 4Y2CA 3EN9A 3C6TA 4RNMA 1WF2A 2I7PA 5AQJA 2G0JA 5AZJA 1RWNB 4FXWA 4F2SA 2XWXA 4GV6A 2G9OA 3V6JA 3NDKA 3ZXWA 1U2VB 1UTAA 2AKWB 3A8JA 1WTBA 3X3UA 5K8MA 2CGJA 1FEEA 3H0PA 3KK3B 2FGCA 3L2WA 5D0HA 2NUBA 1HPMA 4Y2AA 4JS5A 4QOZB 3C2PA 4XAKA 5AE1A 4J9LA 5FPEA 4PG5A 3DLJA 4ZJOA 2YKQA 2ZVSA 1KAYA 1OKJA 4B8AB 3SQOP 1SH0A 1QQCA 1LXJA 1M5SA 3G8TA 1RT7A 3IRXA 2HHPA 5GAEU 3PW2A 3GR0A 4BR4A 3W63A 4WFNQ 1Q8BA 2LSNA 4ZLPA 4YOWA 1NGHA 2G8VA 4A5AA 2B7BB 3KK2A 3C94A 1N52B 4NLRA 5DM7L 4CZCA 2KXFA 3G6EN 4L73A 1U2VA 2DGQA 5KFOA 3SAFA 2ZH4A 4QIGA 2A3ZA 3IC1A 4QR2A 4IJAA 2OTLS 1B7YB 4CEOA 3T9ZA 1N0VC 4JI6F 4DLEA 4OX9J 2VOPA 5DDOC 4ZTFA 2QZ8A 4X64J 2G4BA 1SJFA 4JLHA 2X51A 4CHOA 2DXEA 2BABA 1ATSA 2CXEA 1JIHA 5ETOA 5B08A 4URGA 1VS3A 2OZSA 1HA1A 2HK3A 3QGHA 3W2VA 5AQWA 3MECA 5JXSA 4BQZA 4DF8A 3ZETB 2CQHA 1WSRA 3IAS9 5EU7A 4J2EA 1OIAA 3LPYA 3LWLA 3DGPB 3B8AX 3FFKB 3UKUA 2RS2A 3QPIA 3PX4A 1ZM2A 4MYUA 3QETA 2FSNA 4L74A 1I6JA 4ZN3A 3J80Y 4OYWA 2R9LA 1VJQA 3NG8A 2GW8A 2YWHA 1AW0A 4WFNL 2ZNYA 2IA6A 3I0RB 2AJ0A 1WI6A 1T95A 5IT9O 5MLCV 2HFUA 1AYEA 3KD1E 3Q23A 4DR7K 3JYTB 5HROA 5ETQA 2GQ2A 2UVWA 4CJRA 1SCJB 2BX6A 2J76E 1J5EF 1X8DA 3MMBB 3DLKB 1KNZA 4LIWA 3PY8A 1BG3A 1UVNA 2ZQBA 3C65A 2XYPB 1TKTA 1GK8A 2PFUA 1N6QA 2R3VA 3ILIA 3SSSA 5AQOA 1TUYA 1VBZA 3KOAA 2R42A 2KHOA 2VA2A 3NGKA 4GKJK 1F2GA 4DV4F 3AA2A 4QZVB 4AT1B 3HM8A 4A8XA 2HZAA 5D0EA 2SXLA 2LDIA 4OHXA 1I3AA 4I6AA 4LF7F 2KKHA 4KGVB 3MCNA 4DR2J 3B6OA 4A59A 2P6TA 4ED7A 2QC3A 2DRDA 3PV8A 3AVNA 1IKVB 2ADCA 2E1AA 1NPPA 2GMJA 2HWHA 3KVGA 1NDCA 3GIMA 4ILLA 2J5AA 1LOTB 2CH6A 3TAMA 4HHUA 4W4MA 4DLGA 3HSTB 3BZCA 1P1LA 4GNIA 1C0UB 3E3XA 3AAPA 3W8PA 1D4XA 1HI8A 4HTIA 2XO6A 1QAYA 4NOHA 2ZHOA 4RW4A 4OGCA 3IFRA 5DLFA 3D0GE 2W6KA 5KG6A 1RI7A 2IA0A 1RU1A 3E1YA 3SUQA 3QBCA 1RTIB 3M1FA 3THXB 1NO8A 1JLAB 2O1PA 3DRSA 2YQ3A 2WVDA 2YHWA 3KD5E 3G10A 4CI6A 3HULA 4FNIA 4LSZB 4OV1A 4JKEA 2NPFA 2D4WA 1F9HA 4M5JA 4DU7A 4EK2A 1HPZB 3WZ0A 3VENA 1KAXA 3D2FA 4H0YB 4DSIA 4DEZA 1R8PA 4DPTA 3SI6A 3PUFA 1QHTA 2HHTA 3AVLA 4LFAJ 1RA7A 1YJWS 3ATVA 2W2PP 1VQ9S 1P6TA 3CETA 3I4HX 2KHCA 2IVFB 4CJPA 4KHPJ 1WI8A 3OFFA 1X60A 1EXQA 3VGMA 2EK6A 4DKWA 4K59A 2XC9A 4BC2A 3JSYA 4RW8B 1FKOB 1ASUA 1W26A 1S22A 2JLFA 2DH7A 5KRSA 4E7KA 4LF6F 2C3PA 3MCAB 4FWRA 4OZ0A 2IBOA 1HW9A 4JV1A 3ATUA 4ECQA 4DQSA 1O8BA 4FZXC 3NCQA 3TJ9A 4KBOA 4FLWA 3H3OB 3HI0A 1SKRA 4B9UA 2ACMA 3QGPA 4CJ7A 4M3RA 4CJFA 4HUGA 1NZ8A 1TL7B 4ED5A 1NXIA 5KQ8A 2DCLA 2KT3A 3OSPA 2HBQB 1M5HA 5KG3A 4EBDA 5KOWA 4ISGA 3L7PA 2IDLA 4YB6A 1JLFB 1SI9A 3QZ8A 2FLPA 1GAOA 2VOOA 1TQLA 4P2XA 2N4CA 3RMBA 3DLKA 5HQLA 3CMAS 3MWPA 4UOFA 5C25A 4XH5A 4CK1A 4XPCA 2OP5A 1RE1B 3UCGA 2ZBQA 3DAWA 2BJDA 2DGUA 5EWFA 2AWZA 1N56A 3T1AA 4D3HA 5GAGI 4YNQA 2VWJA 5KFBA 5DJBA 3O4NA 1BCOA 2VWBA 2FLNA 4PZVA 1VHXA 4LFBF 2DVIA 3TAQA 2P9SB 2QV6A 2PAVA 2M52A 1V3ZA 2BH1A 5C15A 1B0TA 3B4DA 3DRSB 1T6DA 3ZZPA 2MTLA 3I5BA 5HLFA 3WXIA 2O67A 3MDFA 1LQ9A 4MTPA 4RNHA 5RUBA 3KHYA 5HVFA 2E5GA 1X4BA 3VF2A 3ZTQA 2VG5B 1KVCA 2R7OA 3VHQA 1IXKA 4CLSA 3AARA 2GX9A 5K14A 3CEDA 2VA3A 2FY8A 2RQMA 3A0IX 3NGSA 4LQ9A 4DU3A 3ENOA 3UPFA 4CT9A 1BC6A 1CVJA 1UVIA 4JAXA 1FF2A 2R7SA 3RB0A 2WW4A 4X65F 1I39A 1ZBLA 3CB4A 2V0NA 4B1YB 4CEEA 4RW6B 3FJ2A 5BYSA 2VWKA 1X0FA 2F7VA 4GVMA 3MD1A 2FHJD 3PSFA 3SPZA 2BR0A 3EVWA 3VPZA 3FLCO 1VQKN 3W61A 3H5XA 2PYJA 4W5OA 4ZIWA 1S1UB 4K4UA 4V19S 2WUSA 4FSVA 4UY8T 3OQ2A 4M7XA 1N8RO 3AJ2A 1SC4B 1SJ3P 1QDUB 5G4DA 4BE0A 4WP3A 1T9YA 5JLHA 1NG9A 3RSEB 2BE2B 1UA1A 4QU6A 3NGIA 1KS2A 1TKTB 3W5YA 3AQOA 1FFGB 1ZBHA 5KT7A 4A48A 4DCJB 5KFHA 4DTNA 2E1ZA 1T9TA 2XGQA 3BO3A 3PZPA 1U24A 3UCUP 2JLGA 2RRBA 4LD0A 2NNWA 5F0WA 3ZT2A 2B0GA 2OD6A 2HHHF 5AQSA 4HCCA 4ISFA 2HHUA 3MXHP 1GMVA 1R8HA 4CF9A 2XSFA 2D1CA 4GKJF 4OKEA 3CIMA 5BXIA 3TABA 3BGRB 1ZAXA 2V69A 1R6VA 4U7UK 3M30B 2ZJRQ 4LF7J 4OL8A 1CJKA 3CCSN 4ISEA 3P83D 3CC7S 2VKRA 4ZLLA 1N5QA 1V5IB 2HURA 5T14A 3OR2A 3A3NB 4X4SA 2N3LA 3JAMO 3C6AA 3MCSA 4BDZA 1YRUA 2L9WA 5SZTA 4FJNA 1RYSA 4NLDA 2AEMA 2RNEA 1L3SA 1SVDA 5DM7Q 1KD1O 1S72N 1TKXB 2A6MA 3KLIA 5FD1A 1GMUA 2BE9B 3VWSA 2O8FB 3IBFB 4WXOA 1R8AA 2D3ZA 3VEWA 4J2BA 1YJTA 4KYZA 1QVGR 4MDAA 3VAGA 3CDEA 5AZIB 1NSQA 2MJNA 2BW2A 5LJWA 1VQ5N 1SZ2A 3F56A 3SAGA 2V67A 1X9SA 4KPCA 3IN5A 3EVOA 3FRZA 4PYDA 4DWIA 3E01A 3PDNA 1ZBUA 4K0KF 1NPKA 2NYHA 4NRTA 2NRXA 2ZH1A 5A8RA 2P8IA 2D7SA 3AO2A 3KFWX 1UWAA 2QA1A 3C16B 3LGMA 1ZA1B 3RSEA 1EETA 3N5BA 4IFVA 4TY9A 3M7VA 4IKFA 2MZQA 2GWKA 2H5EA 1TL3B 2E88A 3P5BP 3AA8A 3ZSYA 1NU0A 5CABA 2I7NA 3I56S 1E6VB 2QI2A 3Q7BA 5JVHQ 4RNFA 4JV5F 2CPEA 2Q79A 4B1VA 4KGMA 2X1AA 1XMOK 5E3CA 1NB2A 2MQ8A 2WSFC 3LZJA 3PIOL 3V6DB 4DV7F 1ULRA 2B3TB 2WK4A 2OTLN 4GVLA 3HFVA 2RJZA 1VBKA 4DR4F 5AZJB 2HNZA 1VRTB 1OPZA 5CHIA 5FLXU 3TTFA 3CFOA 1X5OA 4LH5A 4F3MA 1J5EK 3QINA 1KTQA 1SC1B 2HHHJ 4DUZF 3VQ8A 2BKNA 4LF8F 3ENQA 5DDRC 2OANA 1WSGA 3TR5A 3ID8A 3MUVP 2MQMA 3G71N 3SNNA 3C15B 4LH4A 4BE2A 1M1HA 4N41A 4L75A 2FSKA 3MMAA 1PIEA 2ASMA 4CEAA 5L1LA 2AX0A 3DOMB 3QO9B 1CQMA 4ECVA 1BGXT 2EKNA 4LMZA 3I0SB 2VKZG 3TUJC 4NEYA 4HH0A 2UXCK 3QFUA 3T69A 2Q97A 2LLZA 1FKOA 2YXLA 5DG7A 1NPRA 3D6TB 5MAOA 4PWDA 3VQQA 3Q8QB 1KC8T 3LDPA 4ZP7A 1REVA 5C25B 4IEEA 1L3TA 4FM1A 3O8WA 1RADB 3VQBA 4YB1P 1HBMB 1REVB 4ZP6A 3TSPA 1HNIB 4M42A 2J7WA 3FEXB 3TZZA 4E1MA 2AGQA 2NRWA 5GAGU 4OLBA 4HHJA 5FRNA 1K8KB 3EVMA 2ZH9A 1LW2B 2P9UB 2UVVA 3WXMB 1WOOA 2F8HA 2W1BA 5ELZA 3HPHA 1B0VA 4P71A 1IBKF 1HHQA 1B9DA 4IG0B 1O1WA 5AFUH 1JLQA 1TMJA 2VH7A 3PO4A 4FJIA 3RMAA 2F1FA 5KFZA 1UCNA 4H0OA 3GFHA 5CYJA 4EO6A 3CYMA 4C1NK 5JICA 2GMHA 1KWMA 4BE1A 3L7OA 2BUNA 5A2QO 4DXLA 3RB6A 3DXMA 2HIYA 4J9MA 3BN4A 1N32J 1RACB 4L3NA 2V4QA 3DRXA 1YWXA 2MQLA 3Q8PB 4JN4A 4DUYK 4WF9L 2VG6B 1IM6A 4CGDA 4USJC 4PWUA 2ZBPA 3SFGA 3ZCMA 2DH9A 2VQFK 2P9EA 5LL6Z 2F3JA 1HI0P 2QLWA 4DMNA 1E4FT 4BRAA 3DI6B 2R7QA 4USKA 3OL6A 1RTHA 1FRJA 3EGWB 2QJ3A 1G6BA 4DUTA 1S1VB 3GMGA 3D45A 2HQFA 1RJJA 1ROFA 2IM0A 1Y10A 2F8EX 3BSNA 4CK2A 3UW1A 1Z6RA 1TKDA 4C8LA 4ZMMA 4O55A 4YOVA 4LF1A 2ZJQL 1RAFB 3AO1A 1XTZA 3I82A 6FD1A 1JLAA 2H3EB 2E9ZA 1HYSA 1GLCG 1VISA 1Q78A 3GOIA 4O0NA 4DZDA 2XG8A 1HMVB 3MM8B 5J1PA 4XH4A 5FDLA 3MFIA 1JK9B 3I31A 3TAFA 5HMZA 4BVOA 3AV9A 3OYGA 3MM7A 1VIXA 2W9BB 2KJWA 1U1MA 3CCQN 4USUA 3DDIA 3V5RA 4DV5F 3CVKA 4DV0F 4QS7A 2CJ9A 7AT1B 3CCRS 1QS4A 1S12A 1Q5VA 3H25A 2ACYA 2RHQB 5T7LB 2RSQA 2EX3A 3KKRA 2HOEA 4PKIA 4JV5K 1VQ6N 1JLBA 3QQCD 1JLCB 2I6WA 2OPPB 2P5OA 2EC2A 3HJVA 3C3LA 1IG8A 4CFBA 2BUPA 2XGPA 2E5LJ 1EP4A 2EBGA 4P73A 5FPMA 3SQ2A 3GE9A 1C1CA 1U1KA 3CCJS 5L9NA 2QWRA 1UEVA 3PLAA 1ATNA 4C9DA 3KKSA 3C15A 3L09A 5E26A 1Y7PA 4HDGA 1AXQA 3QJLA 3WDOA 3OR2B 4EFHA 3LWMA 4IOBA 3U1LA 2VBZA 4ES2A 4BRIA 2VUGA 1RXOB 4U95A 2E1PA 2LQ8A 4RUBA 4JI7F 3UDLA 4CBUA 2IFXA 4NYOA 1PJ5A 4IO9Q 3O9UA 1BD6A 1XNRK 2M9KA 2WW8A 1O13A 2GGPA 4O23A 2V9WA 1DTQB 2GMLA 5HANA 2YWFA 2G8WA 1U1LA 5A8KA 3UQSA 1B3TA 3PKYA 3QBWA 3FZBA 3W66A 2D3OR 1IN0A 2UXDK 2EI5A 4E0DA 5LJ3Y 4DUYJ 4I2QB 5B0AA 4ANDA 3VQ4A 3SDEB 3NGUA 2RIJA 3CO0P 3VQAA 1RTJA 1RT7B 1CJUA 4FWPA 1G4CA 2DB1A 2XCAA 1ZPVA 2ZH7A 2DGWA 3HZEA 2QWMA 2BE2A 5D4PA 1NZAA 2CDQA 3TSQA 1A5WA 4FBUA 4F4AA 2NRHA 4EMDA 2X74A 3T1HK 1SUQA 5DRKA 3ETMA 1DRZA 2D3O1 3CJ1A 1CPZA 5CXTA 4MLEA 2MZJA 1FXDA 4Q8FA 2DGVA 1H2UX 1SJRA 4YEAA 3JTOA 3LAMA 3KUGA 1ITPA 1Y64A 3IAYA 4J9OA 4M63A 4UY8O 1Q7LB 4BS2A 1RP5A 3OVBA 4M5MA 2QL9B 2XCPA 4ZLNA 1H2VZ 4FPIA 5AQGA 4B1XB 4Y6IA 1W7WA 3SXLA 1TMMA 4F2RA 4LFAK 4ZP8A 2LVWA 3HOSA 2MMYA 4DL3A 3RR8A 4ILMA 2XZTB 2CNLB 4CGGA 3OSNA 2VG5A 1FK9A 1ZETA 2QWLA 3HSDA 4BRCA 2YX6A 2FJDB 1SUQB 4JI5F 4B08A 4LSLB 3IBWA 1XQSC 2PGCA 4KHUA 3OA9A 3LGNA 2YQ0A 5HLFB 3UDVA 4K50A 4CJQA 3M6UA 4C6AA 1WLJA 4X66J 4LR9A 1TAUA 1ASWA 2CG8A 2E7XA 1GFWB 4H0VB 3K17A 3TA1A 4FWQA 2VL1A 3CQ8A 1FFSB 3LP2B 1JKHB 3WC2A 4JYAF 3CI5A 1JCEA 4RW7A 5HAOA 4LRCA 4F3QA 3GL1A 3DU6A 3VGLA 4ZVFA 3E2EA 4ID5B 3LP3A 3VQ7A 4PWWA 4F4YA 5IV3A 2AP6A 5HQMA 1DTQA 4DV2F 2W2NP 5KG7A 3VOVA 1JLEB 2VB6A 3Q8VA 1KXPA 1QUVA 4MK7A 3TX0A 3HP6A 1F3VA 3MPVA 2DNRA 3CC7N 2KJVA 4CCHA 2MSTA 1B99A 3VMFB 4ZVQB 3MOZA 5HN0A 5A0YA 3TPQA 1BWEA 3QT6A 1IBCB 3QSIA 1U1NA 1MLAA 2EWHA 4ZPBA 3BJYA 4LR8A 4IUFA 1W0HA 3OYMA 3ENBA 4GKJJ 3CJKA 4ALZA 5HL7L 2XZWA 2LFVA 1S1UA 2D74B 2IVOA 3L7UA 4OQJA 1NLVA 3BB5A 5K8PA 1T3VA 1LWXA 3DWLA 1OPIA 2Q1NA 5KFTA 3AO3A 1VQPS 1YVUA 5KFIA 3IG1B 4JV0A 5J1NA 5KFGA 1DLOB 3PJWA 3O2IA 4H5WA 3H42A 2DIVA 1TK0A 1BMQB 2FUG9 5SWMA 2B6AA 3K5MA 3MZIA 1BI4A 1GLFO 1RBTA 4CLUA 1N54B 4ZCLA 4DR7J 5AQIA 2E2QA 4IQMA 2W9BA 2BANB 2CJQA 3CDAA 3QSYB 1XR7A 1QVFM 3GG4A 5H9FJ 2Y8YA 2CJKA 4EZ9A 3MPUB 1VQNS 1T9UA 4R0EA 2BBEA 5C42A 5ETLA 3FEYB 2E5LF 2UUCJ 2RD5C 4CLLA 5LSLA 3ZSRA 5LXYA 3DXBA 2HBYB 2DY4A 1DARA 4ELTA 3PW0A 3V6KA 2V34A 3AA3A 2XMUA 1NRKA 1FDBA 2WFBA 3IR6B 4E1JA 2BW7A 5L1KA 2VQFF 2K7KA 4YB5A 3EL2A 4MMOA 2DHHA 3I56N 4TNOA 4C8ZA 1AZSB 4I69A 3QWPA 1U8SA 1NOYA 3SJJA 4OYIA 3WT0A 4O0JA 4V19X 4ECRA 4A5BA 4KJIA 1WUAA 2RHKA 1BQNB 3TRGA 1ZC6A 3IS9B 2B4UA 1IVZA 4FLYA 4BC4A 1UZDA 4AYBD 1Y0HA 4IH7A 2XS2A 4HCBA 3THPA 3TUPA 2MLZA 4TY8B 5E84A 2PMZD 2ZWHA 1S9FA 3G71S 2K7JA 3OVNA 1Q16B 3G8SA 1TYQA 4YR2A 1HR0F 3JSRA 1RBAA 1VOMA 3F73A 3PEJA 2E44A 1HW8A 3BKUA 3O5TB 3FDSA 1YJUA 1YJNN 2YHBA 1HQUA 5D0RA 1YITS 4TYBA 2HRYA 4F3TA 5TKWA 3ZX0A 3SUOA 1KEKA 4M94A 1DAXA 1YITN 2ASOA 4EGLA 2W2OP 4MFBA 2F5GA 4QW9A 3A13A 1VIOA 4OI2A 1B9FA 5AQHA 5BYQA 3LM9A 3NWGA 3QBXA 2BE7D 2O01C 2A41A 4DTXA 4FS2A 3N9UC 4NI2A 4P6QA 4CP5A 2B5JA 4LF9K 4MKVA 2RRNA 2AQ4A 2LEBA 3A8EA 5AFUA 5KG5A 2XSJB 4OGEA 2KFZA 3GILA 3RZAA 2RQCA 1RHJB 2EK1A 5DQHA 4CD1A 4I0WA 4LSNB 3ISND 3PNIA 1H2TZ 1QY7A 3PFEA 2IJRA 1W2BR 4Z4IA 4FXVA 2F9DA 4O8KA 1RAOA 2Q6BA 1CJVA 1ZYQA 2MKJA 1U0HA 1DJ0A 5GADI 2QWQA 3T3FA 1QZ6A 1BQMB 2QE5A 4RKUC 1S9EA 3SZ2A 2LQ9A 2I8EA 3GJRB 4I9QA 3UDEA 4OZNA 5KT4A 2QO3A 2HVIA 1LWFB 1NGGA 5I42A 4DV6F 3HP9A 2W25A 4ZPVR 1WSEA 2HF3A 3L8BA 2NS1B 4KY3A 2EBEA 1FWLA 2M0GB 2HVDA 3V4MA 1RWVB 4CNYA 3HHLB 1RWPB 4NZ6A 4AILC 3T1YK 3MMAB 4B3MF 3EGZA 4GO5X 1ZH5A 3BH7B 4IZ9A 2XS5A 3Q0AA 4C8NA 1CS4B 4FW1A 2RN2A 1F9FA 4WFXA 2QMWA 5K20B 3TAGA 1WWHA 1QVFR 1C0UA 2YNGB 1GLAG 4K4WA 5K8OA 3OTOF 2ZWPA 1F5AA 1TFYA 5GAEP 3T9NA 1Z2ZA 2NRRA 3RUBL 3QJPA 4IXCA 3OS2A 2W9CB 2KG1A 2O3DA 2OH2A 2CAJA 1UAWA 3M8QA 2D69A 3ET6B 3BF3A 1Q53A 3CDWA 1UMJA 4JK9A 3HVWA 2Z56B 2P9GA 1R3NA 1N0UA 1J53A 4J9PA 1RTDB 4ZVTB 4NASA 4Z7CA 5KTQA 2PY5A 2BQUA 1NJXA 1RDRA 2QG9B 4G65A 4Z4FA 1C4AA 3ZT1A 1MW7A 4WBFA 4K4SA 3BSAA 3PYDA 2NXCA 3D9BA 4AXIA 3W60A 2PMHA 1C2PA 1WC6A 3VVUA 4A8MP 5HBMB 3O44A 3JYTA 1J2VA 3FE1A 2HLUA 5J2PA 5AJ3K 3IKMA 3IR5B 4UW2A 4BR9A 5C5JA 4FWMA 2GEMA 3NMRA 4FYXB 5AZIA 2VIHA 2YNFB 1RCOB 3BGUA 1BHNA 2V7ZA 4P52A 3VEVA 2N82B 1TKXA 1O6XA 2UVUA 2P9KA 1M5OC 2YV0X 3EX7B 5AQUA 4JI3J 1RGVA 4OKKA 2I5JA 5AQYA 2ZF5O 2OKQA 3AGRA 1VRUB 2ZZTA 4WE1A 1ILYA 3NL0A 4H4OA 4M45A 2CWKA 3K5PA 3QEVA 1FD2A 3UCZP 4KREA 1LWEA 3W1YC 4B9MA 4ZVUB 3DMJA 1R59O 5IS2A 3PRDA 1E4GT 2MQPA 2ZOGA 3PX6A 3H2UB 3FC9A 3JB9k 1W2BM 2VV5A 1UFLA 3DRYA 3SQGB 3LOUA 1HKBA 3K8VA 1TUWA 1SQFA 4QWDA 2HPUA 1WORA 3Q86A 3IM9A 3LAKA 2LKZA 2PYLA 3PYGA 3D67A 4OYXA 2N7YA 5BR8J 1MWZA 1M1KT 1JL2A 3RBDA 3KJQB 1Y5NB 2ZJQQ 4K5RA 4QPXA 2P9LB 5F9NA 4K0KK 4DR2K 2GJ2A 3ZT0A 4NXMJ 4AD6A 3L4QA 4EYHB 1YIJN 2X78A 4F4WA 2LP4A 4M3WA 2QFIA 5D4LA 1XBWA 3GIKA 1MWMA 2G8IA 2BTFA 2CQBA 2OLWA 2DEIA 5JMVA 4A57A 5T7BA 2ATLA 4DV3F 1TVRB 1OO0B 2QLFB 3KDNA 3IO1A 1KQFB 3TAEA 3MMCB 1VC0A 2O8BB 4FL9A 1KFDA 5FPDA 5BJRA 1JJ2R 1RBLA 2PE8A 5F1XA 5GINA 1MG7A 4O3PA 4KRWA 3K0SA 2OEMA 4ILJA 3GJSB 2YJEA 4G1QB 2IPOB 4XO0A 2CZVC 2XY8A 2ZKUA 1QQNA 5B0CA 3OTCA 3I9ZA 3GBTA 4FJ8A 2BRLA 3H90A 1RAAB 2OPRA 2JEJA 1FJCA 5LMNJ 1EIYB 4W5NA 1HRHA 5K8NA 1XI1A 4WPAA 4K4ZA 4H5VA 2BJEA 1QSSA 3ASMA 3BO2A 2YHYA 4ZOSA 2DTUA 2N4DA 5KFNA 1S3XA 5J2QB 2Q3PA 1QAJA 4JI2J 4OI4A 5KFCA 3R1HA 2CNOB 1DBDA 3CSKA 4JK8A 5H9EJ 2BA9A 3OJSA 4CO5A 3OR1A 1XERA 1I5OB 4C97A 4Q0BB 2ERRA 4LBHA 3A5OC 2YWGA 3OBWA 3P45B 2EFVA 4ZCMA 4HHHA 3MM5B 3GU0A 3W0LA 2DR6A 1L3KA 2YH1A 4FVMA 5DS7A 2XQCA 1APSA 3W2WA 4OJ3A 1R89A 2NPIA 5JVHL 2PO4A 4X62J 2WTUA 3R3LA 4MIWA 2UXBF 3CJ4A 1T3NA 4RW9A 4FBTA 1VCTA 5IM0A 1H7XA 3J7ZO 3NCRA 2LXIA 3BYPA 2DTJA 2GNKA 1CULB 2GHPA 1YX2A 1KHWA 3JSMA 3BM7A 4DQRA 2VQEK 1HJRA 2ABYA 4DR5J 4DCOB 3V1RA 1JLFA 5IWAF 3DLRA 2RE2A 2VFSA 2ILYA 4DB3A 3O08A 2YNIB 4CFDA 1K44A 5DETA 3J7A1 2IHR1 2AYMA 1EWRA 4FM2A 4J2DA 2EW9A 3R1LA 3CC4N 3TEHB 4K4VA 5C2DA 3UDCA 1XQIA 3CD5A 3PYEA 4E7JA 4LF5K 1PGZA 1BL3A 5L46A 2VG7B 2WCXA 2UUBJ 1PJ7A 4UUWA 1YAGA 3AY9A 3KHGA 4NLVA 1XHZA 3L2QA 2KLAA 2YY3A 4Y2KA 4KHRA 4IDKB 3GWCA 5BPNA 3N79A 2IYGA 4M5DA 3KK1B 3TJAA 4DU4A 4LF8J 5IT9U 1D8ZA 1ZM9A 2L3MA 1HBNA 4G6VB 4JI8K 3OVSA 2PI5A 1C6VA 4J7CA 2IC3A 4PG6A 1D9DA 3EDRB 1KC8O 1FXRA 1TFWA 2K3IA 3MAAB 4ANCA 1FKPB 3GLJA 1NGFA 2DNGA 3EMTA 1NJIT 5G0RB 4JRQA 2Y1RI 1ELOA 5DLGA 1HNZJ 4W5QA 2QSFA 3IWLA 4PKHA 2RDJA 1NHUA 4BHQA 4F50A 1EKRA 2KXNB 2AHOB 3RWUA 2I0XA 4DR3K 3CUNA 5GAHI 1Q86T 1Q7YT 4C0HA 5KT5A 2KU7A 1MWYA 2LEPA 3THYA 4KO0B 3R6MA 1RTIA 4OHZA 4XK8C 4FNHA 3J7YP 1HNWF 4PXCA 4O3OA 1RT3B 4Y2IA 1F6TA 3IUCA 3ITHB 4DQIA 1R27B 4ID1A 2FF6A 1T44A 2CYYA 2YTCA 2AGPA 4QQBA 2W9AA 2D0OA 4A2BA 1NNDA 1RFQA 2E4LA 4NA1A 3A5NC 4J9KA 2QYGA 1NDPA 1KAZA 1JLGB 4USMA 3SSRA 3MXJA 2GIQA 4BG9A 2CIMA 2ZD1B 2Q0UA 1YKWA 3GYGA 4GV3A 3KHRA 4CLZA 1DQ8A 4OHWA 2P9IB 1QZ5A 4DFKA 2ZH8A 1Q8IA 1WUUA 4OYBA 3ZT3A 5ETMA 2GV1A 3ZEUB 2ZWOA 3V9XA 4ZPWR 3MM9B 4OKJA 1RT6A 4CBXA 3Q8YA 3K9KA 4BG8A 4CF1A 4JI2F 4RL1A 2CNKB 3VA0A 3SUNA 2R7UA 4BGAA 2HB5A 3VETA 4FM0A 2FBXA 4DR7F 3UD5A 2JC1A 4HTLA 3ZO7A 1S6PB 1UPPA 3CD6S 3G87A 1AUSL 3FSIA 4NPOA 2UXCF 4EUVA 3DXKB 3MCOA 3DM2A 4DR2F 4K8RA 3VV2B 1E6YB 2FIUA 2QL5B 4BRPA 4L72B 1QE1A 1S76D 4J91A 3WIUA 5AT1B 5C24B 2UU9J 4QYZJ 1DTTB 2DD8S 3I0RA 3D7EO 4F36A 4RWXA 3C95A 4EP5A 2DNQA 2DNLA 1BQXA 1VQOS 1EWQA 3R27A 4AF1A 1FD8A 3QLHB 5HJXA 2DR7A 3PACA 4DCHA 2E6MA 1SV5B 2FD2A 3QRQA 1U2FA 1X5PA 3ZZ0A 1S0OA 3QEIA 1RDAA 3V81A 3L6QA 5KG0A 3W5ZA 2PSZA 3RRHA 5B0FA 4ILRA 1HI1A 3W2VB 2CJYB 5KFKA 3I5AA 2F65A 1U49A 5C7PA 3AGKA 2YPZA 1VC5A 4XDCA 3G9CA 1YDLA 1LXNA 1UEUA 2Z8QA 5F41A 5C24A 3WX4A 2AV5A 4JHDA 5KT2A 5KFXA 2WSCC 3BDPA 1K1SA 1A6LA 4I4BA 4LFCJ 2GUIA 4FPBA 1IBKK 4C8OA 2PMWA 2C2DA 3DXKA 2R2TA 1WOSA 3B6PA 3NCPA 1NB7A 5GMDA 4OLAA 2QWPA 5C2CA 2L9NA 1P1TA 4OX6A 3J7YU 3OYFA 1J9AA 5BRHA 3BPSP 2MGZA 4LF4K 2WOMA 1S1XA 1TUVA 4EAHD 1GXUA 3UIQA 2WAQD 4MAKA 2DJWA 4R0JA 1VRQC 1YG0A 2B56A 5M2PA 2FVQA 2RH3A 5KGXA 1HNXJ 5KG1A 4NMXA 1UKUA 6FDRA 1B7FA 2YKAA 3B78A 4LIRA 1BISA 5BRDA 4I68A 3JS6A 2YWWA 3TZYA 1IKWA 2IAJA 2PFDA 1RAGB 1NBWA 3ZSXA 3NEKA 5AR0A 3NNCA 3HHDA 2V2KA 2R2RA 3EO3A 4NWBA 4RWWA 2CQGA 1HIYA 3R1XA 2C3UA 3LO3A 2O8EA 4RLEA 4IFYB 4HACB 1K9MT 2VDHA 2QK9A 3V1QA 3CHWA 6AT1B 3OLAA 1JQGA 4HHTA 2BM1A 3S3OA 2CQCA 1VK8A 3R8EA 4WCEL 1KOOA 2DFHA 3CTRA 2ROPA 3V9ZA 2Y0SD 1VQ6S 2G2OA 3KLGA 3H98A 3THYB 3O9RA 4OMFG 1U7LA 3KJNB 2HW3A 2GTDA 4PL7A 2VYPA 3GV8B 3G6YA 4ID8A 4ZJLA 4ZK7M 3AA5X 1KRPA 1S49A 2G0IA 1RBSA 1ZXOA 1FRHA 3SCIE 4IOXA 2DNOA 4IH6A 1TL1B 3LA0A 1CJTA 1IM4A 4F3OA 3P38A 4LF6J 4YDDB 1P9QC 1S1WA 4KB7A 5CD4H 2M8DB 4OPKA 4HTJA 1NAQA 5BRFA 4ZVEA 3VN5A 3U1MA 4DOZA 3MM6A 4H0PA 2GVZA 5FLXY 4B9SA 3LW5C 3PIOQ 2E2OA 3U8XA 5M1NA 4KHPF 3K9JA 3PIPL 2EFQA 2EFGA 1RZMA 1P8ZA 3CDBA 3CC2N 4DX7A 3ISNC 4MKAA 3VGTA 3K5NA 2OAUA 1RWUA 2KFNA 1M1KO 4LT6A 2ZJRL 1MROB 4LFAF 1KD1T 2HWTA 1TAQA 2GC8A 2NREA 3OXFA 2CJXB 4UZBA 3DOLB 1N5TA 1IG9A 3NH1A 3NH0A 4X62F 5CYMB 3FGVA 4FPRA 1LFPA 4K42A 4K4YA 1U1QA 1LV5A 4QU7A 2GFFA 3U4LA 1YUWA 2GV9A 4IH5A 2GVDA 2HZVA 1HKCA 4CDIA 4F0MA 2E2PA 1NSKL 4GMJB 9RUBA 1HNVA 4B3TK 5J2NA 5IFMA 2QL7B 1YQHA 1NJWA 1CZAN 4A46A 4EI2A 4Z2XA 1R0CB 3NBPA 2XM3A 1N8RT 3RGIA 2FLOA 1WC5A 2ZBIA 3DRPA 3BEXA 1SL1A 1Y00A 3BPDA 4JK7A 3CJAA 3CF5L 1R6YA 2IVMA 3LP0B 5DM6Q 3EGNA 4Z4EA 1FI4A 3H46O 2DNZA 5J2MA 4NO7A 2VPXB 3DDKA 1VQ4S 3WXKA 4JYAK 2DHGA 5EDWA 2DGSA 2M5YA 4R8UB 1VQ4N 3W7BA 4M95A 4WZMA 3CQYA 4YP3A 2B9WA 1WC0A 2AZ1A 4CRJA 2L48A 1H3DA 3KLHA 2ASLA 3M8RA 1I94F 4DU1A 4NLUA 2E1MC 4P2SA 4TLQA 4OI1A 3VQCA 3P39A 3NBPB 1NGCA 2FVSA 3D68A 2FJXA 4CHYA 5CYQA 4OPJA 2DNKA 4CIGA 4O0IA 2HWIA 3DLEB 2CQPA 1WHVA 1Q4RA 3RRKA 5BR8F 3ZFVA 3J80O 4XEIA 4Z94A 3UKRA 4KI6A 4WFAQ 4FJ5A 2GA7A 1FNXH 2BJ3A 3NWRA 3OYLA 1REGX 4W92B 5FJ4A 2JWLA 1PBAA 3GZ7A 4FYDA 1MDUB 3CCMS 3T5HA 2YBVA 2GQCA 2BACA 1T03B 4LC9B 2V2ZA 3QGIA 1MROA 4FDFA 3AQPA 1FA0A 3H6EA 1AB8A 2PEBA 4I1TA 2OI2A 4RPFA 2ROGA 5M1KA 4KHMA 3ILLA 3CCVS 4KH5A 2E1RA 1RYRA 2ILZA 4NZ0A 1UFKA 4JI3F 3Q89A 4CFAA 2WONA 1KLNA 2ZH5A 4Y00A 1VJWA 4C23A 2KM8C 1CJTB 1RWOB 4LFBK 2P5VA 1LK5A 4Q7AA 4KH1B 2V2VA 2V8DA 1QQMA 2Q43A 4CF2A 2VJVA 1VQNN 1K47A 2QEXS 2B4PA 2JNJA 3L4BC 4ECWA 2QX0A 2XMTA 4DF4A 5E41A 1LWEB 3SQ4A 4DL6A 5T41A 1MMNA 3MI7X 3K58A 5HL7Q 1C1AA 4P75A 1NK9A 3FZ2A 3EWGA 4WKRA 2I5JB 2XMJA 1WF0A 1GX6A 2H1YA 1IJEB 5KFVA 3C6UB 5JMNA 4B3SK 1EARA 1W2IA 3IBCB 3PIPQ 4CIEA 4PRFA 3CJQA 1D0EA 5EXWA 3H5SA 2AGOA 3JTPA 2GHWA 2E7WA 3C7NB 4QIFA 4A61A 2PFFB 1VSJA 3TO8A 3NF6A 1G1XA 1HWLA 3GPAA 5HBMA 3UN2A 2E2NA 3KLFA 2FVCA 4DL5A 3UR3C 3FFIA 5CCLA 2B43A 3K8WA 2V8GA 1H38A 3O3FA 4B3TJ 3MN9A 3V9WA 3M1VB 3R5CA 2FDNA 2ITGA 2X6SA 4X66F 3QIPB 1C0MA 5D4NA 3CD7A 1NK4A 2E8AA 2LMIA 2YH0A 3H20A 2DGXA 4K25A 4CO3A 2J9DE 4TSXA 1HX1A 5L38A 4QWBA 2CNNB 1WOQA 2OUGA 1RTDA 1VSDA 4ELVA 2OA8A 2QXFA 1NGEA 1LK7A 4R25A 2HFZA 1CXQA 1YJNS 1WC4A 2MPUA 2GIFA 4USTA 2XRIA 3HK2A 4DR6J 1L3VA 4JI1J 1WSFA 1PYTA 2F8MA 3CCLN 2CQ0A 4BC7A 1RILA 2ZD1A 5A2QU 2AYGA 4CI0B 2RKIB 2YKNB 4PUOB 4O4RA 4JEPA 3MTKA 3ALYA 2AJFE 2F4VJ 2J9DA 1YZ6A 2QT7A 5E3PA 2W8LA 1PKUA 4P9SA 4O44B 2E66A 2NUHA 3G2XA 1OY6A 3CO9A 3V9UA 2HK2A 2DPNA 2OPQB 3PW7A 3R3TA 4X62K 5LMUJ 5CZVA 1RGIA 2O8DA 3M2RA 5ADZA 1JXBA 1DFDA 3M8ZA 3RR7A 1XK8A 4F26A 2VDIA 5AQVA 3U1NA 3J8AA 2QW9A 3HHLA 3CCMN 1F0XA 2CQ2A 3A1YG 2KFYA 4O3RA 2V52B 2QN6B 2BVZA 4NLXA 4IR9A 3THWB 2KO1A 3AOBA 5DM6L 4YR0A 2BQRA 3M32B 4ERDA 1X1PA 4LR7A 1Z25A 1HR0K 2W7PA 4X4PA 4CZFA 2GBZA 5CZXA 1ZM3A 1XMQJ 5HI7A 1N5VA 1WJ9A 1T05B 4QIVA 3HCXA 3PTWA 4QBUA 4W5TA 2ASDA 5L1JA 4J9UE 3FNNA 3C14B 4GC7A 1SL0A 3N28A 4WQ5C 2MDAA 1RAJA 2MHEA 1ZAWA 1S57A 4PKGA 3OL7A 2MZ1A 1WHYA 1IV0A 4A8QA 2K1RA 2B5JB 1T7PA 5I3UA 2BJ1A 1S0MA 5EWGA 4EU0A 5ETTA 4ED1A 3NAIA 1FJGJ 3P96A 2W7AA 3WXLA 5IC6B 4NXNK 2MY7A 2ZDPA 3SEOA 2P9IA 2XNRA 4UF4A 2ZE2A 1HWUA 4ER8A 3VZHA 2W41A 4Z0UA 2V5HG 2XTJP 4H8KA 1ZZNA 2OPSB 4NEZA 3QEXA 1MN7A 4B3MJ 1VR6A 4JKAA 4MKYA 2L9DA