1IKYA

Hiv-1 reverse transcriptase in complex with the inhibitor msc194
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikyA05
2FBVA 1NK0A 4M3YA 4IRCA 4GW6A 3RWUA 3B6OA 4DQRA 3KHGA 3AO5A 1S10A 4H4OA 4Q8FA 1BQMA 4B3OB 5HP1A 3L2QA 4RW9A 1C1AA 4ZP6A 4JRQA 1T3NA 3ZSOA 3M8QB 2GUIA 3LP2A 3OYMA 3IRXB 3OYCA 4AHUA 3HVWA 1LW0A 2VA3A 4B9MA 2KTQA 3ZT4A 2WTFA 3MECB 4KHSA 4ZVHA 2X74A 3PZPA 2ASLA 5KRTA 3RR8A 3H59A 1HNVA 2VG7B 3TAMB 2E9TA 3DLRA 2HHUA 3I5CA 5L1JA 4PUOB 3HK2A 3AA5X 4EZ9A 4ICLB 1MMLA 4C8MA 2R8IA 1RT6B 2ILYA 2W9AA 4URSA 4MKBA 5KG7A 1JLGB 1YT3A 2ZD1B 3ZSWA 2J6TA 4Q44A 4CHPA 5KG2A 4E0DA 4Y1CA 4DTUA 2ETJA 4H8KA 3WNGA 1QE1A 3OHAA 3AO3A 2OYQA 4E7IA 1EETB 3C6UA 4PQUB 1NK5A 3NH1A 1SL2A 2EHGA 1KVCA 1TV6A 3CJ4A 4KTQA 3LP2B 3LZIA 4IDKB 1BIZA 3IGVA 3PO4A 3E51A 4KHMA 3H2LA 2O5DA 3KLGA 3RB0A 2IJFA 3DRRB 4FVMA 4DTSA 2PY5A 1LW0B 3PX6A 3U3GA 4M3RA 4J9OA 1N4LA 2RKIA 3V1QA 1NK7A 4F2SA 2HNDA 4O3NA 3OYAA 1O1WA 1JLQB 4WFYA 5DK5A 4W5RA 4NLPA 1RTHB 4YQWA 1CSJA 3V6JA 1VRUB 2FVPA 1QAIA 2G8KA 1TKXA 4Q0BB 4CJUA 1UWBB 2FJWA 5HLFB 3IGNA 4NZ0A 5J2NA 3TVKA 1LWCB 3OJUA 4B9NA 5DGAA 4RZRA 3OYLA 4O4GA 4KHQA 2OA8A 4BACA 1VSDA 4E1NA 4K8ZA 4O4RA 2OPQB 3MEDB 3G6XA 4ECWA 3VQAA 1S4FA 4CEBA 3OHBA 3FFIB 4CGFA 3UR0A 3L3UA 3CQ8A 1YVFA 3ZSVA 3PX0A 4DMNA 3DLBA 3MR5A 4HKQA 3V9XA 2VG6A 4NLUA 4BDZA 2XCPA 3SZ2A 4JS5A 4N56A 3KLGB 3QZ7A 4G1QA 1X9MA 5J2QA 3OL8A 4CJ3A 3KLFA 3BQ2A 2HNDB 1N5YA 1XHXA 2VWJA 3LP0A 3GQCA 4MIAA 1D9FA 5DQGA 2VG5B 2DY4A 5KFRA 1SL0A 1HNIA 4F4ZA 4FW2A 1BI4A 1VSJA 5KT4A 1RYSA 1Z25A 1I39A 4DSKA 2XI2A 4CEDA 2HNYA 3DOKB 3QEWA 4DF8A 5EU7A 4HHTA 2DFFA 4CJKA 2XCAA 4ECZA 5CYMB 1S1TA 1XHZA 4O44A 4ECTA 3CG7A 4ED3A 3SV4A 1JLCA 1TQLA 3CJ2A 3MEEA 3NGZA 3DM2B 2XRIA 4QWBA 4ZTJA 2IJNA 4EBDA 1RA6A 4TN2A 1RAJA 1SH2A 3C6TB 3SFGA 3H08A 4OKJA 2AX1A 2B4JA 4ED8A 4DS5A 3H4DA 2HW3A 3OYHA 3KLIB 1MU2A 2B6AB 3T5KA 2XGQA 1LWFB 3PX4A 1S49A 2YKMA 4WFXA 2IS3A 3BSCA 3O3HA 3OYJA 2CKWA 5F9NA 2BQUA 2ZE2B 2VG6B 1CLQA 4RU9A 5SWMA 1RBUA 5J2QB 1VSHA 3CYMA 1C1CA 2W9BA 3PY8A 1TKZB 4KB7A 3KLFB 4FLYA 3QETA 5KFNA 4F3OA 1S1WB 1RT2A 2W7OA 3LP0B 4KHUA 4IH5A 4ELVA 4O3SA 3KMSA 1X9WA 4C8KA 4DU1A 3HYFA 4DTNA 1VSFA 4XO0A 2BRLA 2OPPB 4OPKA 5KFAA 3U6FA 1TAUA 3JSMA 2WHOA 3VQEA 1R0AB 3OS2A 1CZ9A 4I2PA 2HNYB 4RW8B 1ZBFA 4ECSA 4PWDB 3O3GA 4Q43A 2HHQA 3D5MA 5KFXA 2JEFA 4NCGA 4CECA 4CJSA 4CK1A 4Z4EA 5J2PA 4OVLA 4O44B 2ATLA 1NOYA 4I9QA 4NYFA 2IM1A 3ZSZA 3F73A 4CEFA 3WNFA 3V9ZA 5HRPA 2JEGA 3DRPA 5KGXA 1I6JA 1KVBA 4CE9A 1A5WA 4CEZA 1D9DA 4NLYA 1QS4A 3TAFA 1GOCA 3ASMA 3V1OA 1IKVA 5I3UB 1L3TA 2Y1JA 1RILA 1JL2A 4F50A 1UAXA 3OSNA 2Z1JA 4YP3A 1WSEA 4KV8A 4DF4A 1JXEA 3UQSA 2ALZA 3GIIA 2JEJA 4RNHA 1REVB 4J9PA 4RUAA 5DGBA 2UVVA 4FLXA 4NLVA 3NCIA 3M8SA 3NFAA 2ILZA 3NAHA 3PJXA 4IFYA 1T7PA 2I5JA 4OLBA 4QW9A 2E6MA 1TL1A 4XPCA 1T8EA 4QOZB 4O3OA 4J9NA 4E3SA 3BSNA 3AVMA 1KSPA 3NKYA 4NCGB 5DMRA 5J2PB 3KK1A 3DLGB 1XWLA 4CFBA 4ZP9A 4FYDA 1UA0A 5KFMA 2AGOA 3LP1A 3DRPB 1RDRA 3BSOA 3HO1A 1LWEB 1NJZA 3TWHA 3VQCA 5KT2A 2D0AA 4E7KA 4L8RB 2OPSA 4QPXA 3LPTA 3V9SA 2GIQA 1X9SA 2QV6A 4OL8A 4FM2A 1BIUA 4IKAA 4AH9A 3CIZA 3KJVA 5C42A 3I0SB 2P5GA 3DOLA 5DG9A 2DPJA 3OVNA 2KFNA 4CF9A 3OYBA 4KV8B 3HVTA 1RTIB 4CHYA 3ZSYA 3HVAA 1WSHA 4WZQA 2VA2A 3RMCA 1RTJA 3DI6B 3NBPA 3PR4A 2FBTA 4KTZA 1S6PA 3OYKA 5DLGA 1LAVA 3LAKA 2VWKA 1W0HA 4QWDA 2XWYA 3IN5A 4NLDA 2A1SA 3FSIA 3QNOA 3SUPA 4FJIA 2C22A 3AV9A 3C95A 1TK8A 2XGPA 3KLEB 3NAIA 1YTUA 2D3UA 2G8WA 3OS0A 3KK1B 2BANB 3K5OA 5KFOA 3PR5B 1HMVA 1EP4A 4FS1A 4RW4A 4LQ9A 2BE2A 1QAJA 2HHSA 3LP1B 4DSFA 1IM4A 3ISND 2W9CA 5KFWA 1HQUA 4B8CA 2GIRA 1N6QA 1VSIA 4BE1A 3OYFA 2WB4A 2B43A 3LZJA 4JS4A 1KLMA 3KJVB 1U45A 3M9OB 2UVUA 2P51A 4CJVA 2PYLA 3UPFA 2D0CA 1EXQA 3BQ0A 2FLLA 4FCYA 4YR0A 3NF6A 4CCHA 1RTJB 1Z4UA 1EX4A 4KSEB 1S9GA 1TVRB 3T5JA 4IKFA 3AVIA 3C94A 2P5OA 4KFBA 3GIMA 3I5AA 5JUMA 4MK7A 3KHLA 3S3NA 2KZZA 2FVRA 1ZBLA 3SFUA 1JLBB 4R5PA 2WCXA 4DSLA 4CGJA 1ASWA 1S1UA 3ZT2A 1NHUA 4EBEA 1C0TB 1EP4B 3QIOA 4N5SA 2BE2B 3OL6A 1IKYA 2DPIA 3MXJA 2W9CB 1SH3A 3V6HA 2W7PA 3TR8A 4NLXA 2KZMA 4H4MA 4F3TA 1NKEA 4LSNB 3F9KA 2E6LA 1C0UA 1K1SA 3QGIA 5KFIA 2PYJA 3CFPA 4U6PA 1VSEA 1NKBA 3G0ZA 4CIEA 3GYNA 1NOZA 1IKWB 1RBSA 1LW2B 4MK9A 4CFCA 3AA4A 1S9GB 5FDLA 5C25A 3SNNA 1J9AA 4KFBB 2HWIA 1VRTA 1HARA 4ELTA 4O55A 4IH6A 3WNEA 2V0NA 4R8UA 3Q8QB 1WSFA 4RW6B 2HHTA 1HQEA 2JLEA 1QUVA 4CFDA 4DQQA 4J2AA 2YHBA 1DTTA 1S1UB 3HVRA 4DSJA 3K2PA 4O3PA 1C0MA 4URQU 5HBMB 5EWEA 3RRHA 1ITGA 1QSSA 5KFYA 3L2UA 3S9HA 1TKTB 3DLKA 3CDUA 4MH8A 4M42A 5DQIA 3BJYA 2XY8A 1CXQA 4LSLA 2JGUA 3AVGA 3NHGA 3PVXA 4ED6A 2IBKA 3PW0A 2FC0A 1NK9A 4YR2A 2YNFA 1G15A 1RBTA 1NK8A 2UUTA 2CJQA 3MTKA 4KB0A 5KG6A 3SI6A 4J9LA 3UIQA 4J9SA 4H4OB 3LWMA 4CIGA 4JV2A 4M3ZA 1BQMB 4DTRA 1RTDA 4KHWA 5HP1B 3K57A 3OL7A 4E7LA 5FDLB 3QO9A 4RW9B 5F8IA 1NJXA 3FQLA 1XC9A 4FK2A 5F8MA 2W8LA 3H5UA 1WNEA 3RAQA 2R2TA 4DTMA 4FS2A 4DQPA 4ZP7A 1GX5A 4J9RA 3NE6A 3SUOA 4RNMA 1GOBA 4CJQA 1I3AA 4Y34A 3EZUA 2DFEA 3M8RA 3MEGA 4R0EA 3BQ1A 3GV8B 3MAQA 4N41A 4FM1A 1HNVB 4DL2A 4TLRA 4NLTA 2E4LA 3MXMA 4C8LA 3ZCMA 4RG8A 1DTQA 2FVQA 3ZSXA 1TK0A 4DL4A 3CDWA 1TL3A 3KK3A 3NH0A 1U48A 3FRZA 4LSLB 4M3TA 3V1RA 2E9ZA 4KHRA 4OGCA 3M8PA 1D5AA 5CY4A 5J1EA 4ED1A 3E01A 1UA1A 1XI1A 4K4ZA 1SH0A 2QXFA 4EP5A 4K8XA 4DG1A 3TARA 1S9EA 2X6NA 1QE1B 3C6UB 4WE1A 3HPOA 1ZTTA 4FJ9A 2X78A 3QO9B 2GC8A 3AA3A 3NGDA 3CM6A 3MR2A 3K58A 3K59A 1NNDA 3RB4A 1TV6B 3VQ8A 4QWAA 3MR6A 3BSAA 1EKEA 3QEPA 4GC6A 2WONA 4FJKA 3ZSRA 3QGHA 4WYLA 2RKIB 2E9RX 3TAEA 5F8HA 2UVWA 1NKCA 1A5XA 4ECRA 4F4XA 2NUBA 3MEGB 3KLHA 4K4UA 2HWHA 3CDEA 4XIUA 5KTQA 2RF2A 1S5JA 4XPEA 4F2RA 2IDOA 3NF7A 4DL5A 3KIOA 1U09A 1RT1A 1BL3A 3KKSA 4Z4IA 4M95A 4ECYA 1D8YA 4TYAA 5DG7A 3CVKA 1TKXB 1W25A 4Z4HA 2BRKA 3O3FA 5KFUA 5J2NB 1F21A 3KK3B 4JV1A 2ZQBA 5FRNA 3VQDA 4FXDA 4EEYA 4DL7A 2WOMA 3M8PB 4OKKA 2UUWA 4O4GB 1JLEA 4Z0UA 5CZ2A 3E01B 5KFHA 1J5OA 4ZVFA 1S6QA 4DG1B 4LH4A 2HMIA 4M3UA 4ZMMA 4W5OA 2EX3A 4CF0A 4H54A 3GIKA 2D0BA 2OPRA 5HRNA 4W5TA 3MR3A 1KCFA 1BQNA 4CFAA 5C24A 2Z1IA 3EPIA 3TABA 3LPUA 3WNHA 2WONB 2IC3A 4G1QB 3SCXA 4KPYA 1XR6A 3EZ5A 3DLEA 5KFBA 3EYZA 1XR7A 5KFQA 4KI6A 1N5YB 4K4SA 2XY6A 3KLHB 4F8RA 4I2QA 1WLJA 3ZT1A 1HNIB 4N47A 2D7SA 1BCOA 1BI4B 1VSMA 4DSIA 1RT1B 5KG4A 1NK4A 4KE5A 3AVNA 3OYIA 1TKDA 3THVA 5L9XA 4NCBA 3NH2A 4CJRA 3LANA 3VQBA 4EBCA 3T3FA 3AVHA 3VA3A 4ELUA 4NYZA 1S1TB 3VQPA 1JLCB 4IQXA 1JLEB 5E41A 3MEEB 4TQSA 2AGPA 1S1XA 3QEIA 2R2RA 3G86A 3CM5A 1RT7A 3JYTA 2IOCA 4Q8EA 2HMIB 3FQKA 1JKHA 1MU2B 2OPRB 3QZ8A 3P1GA 2YKMB 3LWLA 1BQNB 1KFSA 3D0PA 3VQ6A 5DLFA 4E89A 2IC3B 1JL1A 5JS1A 4ZPBA 1S0NA 3QIPA 1C1CB 1JLFA 4CHQA 3T19A 2W9BB 3SQ4A 1TP7A 4MK8A 4J9QA 1RT2B 4E19A 4Z4GA 3OYEA 2R7YA 4AHSA 3AVBA 2BR0A 2LSNA 1U4BA 4FLZA 3RRGA 3IG1A 4B9SA 4FZZA 4K50A 2YNIA 3PUFA 2B5JA 2IA6A 2Z1GA 3G6VA 4RW7A 3OL9A 3JSMB 3V6DA 4I2PB 4QAGA 1FKPA 3ITHA 1J53A 2J6SA 4DTPA 3DLHA 4NLOA 3L2WA 3DDKA 1Q9YA 5KI6A 4ED0A 5CYQA 1KVAA 3M9NB 4ZTFA 5F8NA 4IH7A 1DLOA 5DQHA 4FLWA 1S9FA 4M41A 3LAMA 4E7JA 2O4IA 3JYTB 4UQGA 2HB5A 1U49A 4QCLA 2YNHA 3SQ1A 3FDSA 1IH7A 1L3VA 1JKHB 3I5BA 4EZ6A 3QEXA 3H4BA 4FZYA 3OS1A 1IKVB 1JLAA 4KAIA 3ZT0A 4TY8A 4W5NA 3MFHA 4ECXA 3G10A 4GC7A 2UVRA 1IKXA 2YV0X 4CJEA 3TAPA 2HAIA 2PZSA 3O4QA 2HNZA 5KG5A 4C8NA 5K14A 1KTQA 4CJ5A 1S1VA 2ATQA 2R2SA 4HUEA 3KNAA 4B8AB 4AILC 5KFZA 1WAJA 1KHWA 4IFYB 3O4NA 2V4QA 2I5JB 4K4TA 2B5JB 4IR9A 4AHTA 3H5XA 2EC0A 1TL1B 3B6PA 4Z4CA 4YNQA 2AX0A 4Q45A 1IO2A 4CK3A 2QE5A 1RT3A 2ITGA 3L3VA 2RPIA 5KG0A 4NYNA 1RDCA 1ASVA 2D41A 4MFBA 3RMBA 3EY1A 3RMDA 2QKBA 5D3GA 2IM0A 3H98A 5L1KA 2C2EA 3VN5A 4CHZA 4ZHRA 2YNHB 3BGRA 5KFCA 1RBVA 2QKKA 2OPSB 4ID5A 3V9WA 5EWGA 4YFUA 4KREA 3QNNA 3VQSA 3MFIA 3T5LA 5C42B 4J2DA 4W5QA 3AVFA 3P5JA 3DOLB 4TYBA 3KTQA 3BREA 4FK0A 1JIHA 2YKNA 1NJWA 4U7CA 3HVTB 5HROA 2IM2A 2IM3A 2OH2A 2HNZB 4NLGA 4YR3A 1WAFA 4CJ4A 1S48A 4AHCA 3NBPB 3GV5B 1TAQA 3PW7A 3MXIA 3SI8A 4CHNA 4CGHA 4DTJA 3CJ5A 1C6VA 1QQCA 4DU3A 4NLSA 1S6PB 4LQ3A 1VK0A 3HL8A 2D3ZA 3T1AA 4BDYA 3HP9A 1ZBIA 1B92A 4B3OA 2AU0A 1SUQA 1KLNA 4ZPAA 1HYZA 2WK4A 3M8QA 3HHKA 4ZPCA 2R8HA 3NGIA 3IRXA 3PO5A 4RNNA 4MFBB 3QINA 1HMVB 3RR7A 2G8VA 4RW4B 4IFVA 4KKOA 4OPJA 4DL6A 3ZT3A 1RDBA 5D3GB 3OLBA 1XR5A 4EO6A 4OJRA 1YVUA 3SPYA 3AVCA 3AVKA 1HQUB 2C2RA 4KHYA 3MECA 4J9MA 1N6QB 4B9TA 4FM0A 1KLMB 3N6LA 4HUFA 2VG7A 3TAMA 2FLNA 5F8JA 4PUOA 1KHVA 5KFGA 3RB6A 4ICLA 3AVAA 1SL1A 4DFKA 4FJNA 4RNOA 2R2UA 1RT6A 1RDDA 2FJXA 1JLGA 2XC9A 4Q5VA 2ZD1A 1N56A 3TQ1A 2OZMA 4NRUA 3PJWA 2DFHA 4CERA 2RDJA 4CJTA 4CEOA 4DFMA 2RN2A 1EETA 4PQUA 3P83D 4AHVA 1JXBA 1L3UA 1SUQB 2W42A 4R5PB 1WNSA 1ZBUA 4CHOA 4QWEA 4B08A 2ZKUA 5KFPA 5KFFA 4IDKA 4RNFA 5F8GA 2AJQA 1Y97A 4IFVB 3DRRA 4KKOB 1RDAA 4FLUA 2Q3SA 1ZYQA 4K4YA 2Y1IA 1IKYB 4IRDA 3QLHA 4EO8A 4DEZA 4HCBA 4EP4A 4DU4A 1Q9XA 4N76A 1JLQA 1HYSA 2P1JA 4ZP8A 3LP3A 4H4MB 1SV5A 4BWMA 1RTHA 3RBEA 1C0UB 3EPGA 5KFTA 4FLVA 3DMJA 1VRUA 4RUCA 1IG9A 3AA2A 3NGYA 1SKWA 1S0OA 2I1RA 4FJJA 4WXWA 4OGEA 4Q0BA 1UWBA 5HLFA 2X6SA 2GBZA 1HPZA 4EYHB 4AHRA 1LWCA 3VQQA 5C25B 3D45A 4C8OA 5JS2A 3AVLA 3S3OA 1VRTB 2FVCA 4O3QA 4FJLA 3NDKA 3D28A 3AO1A 2HVIA 4ED2A 4R8UB 4ZVEA 4KI4A 4IOBA 3OY9A 2OPQA 3MEDA 3SUQA 1HQEB 2XI3A 3FFIA 4Y1DA 5DG8A 4JLHA 1DTTB 3QERA 4J2BA 4NCAA 1BCMA 4PY5A 3SQ0A 3SQ2A 4CESA 4LH5A 4FBTA 4IBNA 1WSJA 4IG3A 1GX6A 1RT5A 3QLHB 4E7HA 4QWCA 5C5JA 3DLKB 3ICLA 1HYSB 2G8FA 2VG5A 3ISNC 3SYZA 1SV5B 2G8IA 2ASJA 4HCCA 3DMJB 3CWJA 1BISA 2YNFB 4MIBA 2BQRA 4FJ8A 3KKRA 3H5YA 3RAXA 3DOKA 4JRPA 1HPZB 3QYYA 1RTDB 1QSYA 2XHBA 1RCHA 5CYMA 1J54A 4F4YA 4FJGA 1HRHA 3DM2A 3GV7B 1N48A 3C6TA 3LALA 3NAEA 2KFZA 3I0RA 3KLIA 3ZSQA 2HHXA 3GILA 2B6AA 1LWFA 3PW5A 4GMJB 3PV8A 1RNHA 4KHNA 4DLEA 4OKEA 4DS4A 4IRKA 4DFJA 2ZE2A 5T14A 1S97A 4DQIA 1RT4A 3NL0A 5T7BA 3QEVA 2O4GA 4CJPA 4IG3B 3CFRA 1TKZA 1RT5B 3SPZA 4F4KA 1A5VA 1S1WA 4B9VA 1DTQB 4LY7A 5KT5A 1T05A 4JUZA 1TL3B 1KFDA 3V9UA 1QSLA 2J6UA 3SV3A 4DWIA 3IAYA 2F8EX 4IG0A 4OLAA 4CGIA 5J1EB 4YMEA 2F8TA 1NK6A 4CIFA 3IS9A 2XO7A 5EWFA 2OPPA 3KOAA 3N6MA 1HJRA 3G6YA 3CJ0A 2FBYA 4NLQA 3K5MA 4O3RA 2V4RA 2FVSA 1S9EB 1R0AA 4RW8A 4WE1B 4FJ5A 4BE0A 4PWDA 2QK9A 5KGWA 4TQRA 3SJJA 4NRTA 4O0IA 2G8UA 3VQ7A 4NLRA 5HRSA 5L1LA 4ZVGA 5KFJA 1JX4A 1FXXA 1W9HA 2XY5A 3I0RB 1KRPA 3PW2A 4G3IA 4Y2CA 2Z1HA 5I42A 4KBIA 4CJFA 4CK2A 2FBXA 4TSXA 3RMAA 3V81A 4K4WA 4K4XA 3KK2A 5I3UA 4M45A 2RF2B 1QTMA 4PA1A 4B9UA 5KFKA 1X1PA 2A1RA 1SKSA 1RT4B 1U47A 4KB1A 2G8HA 2XY7A 4CF2A 4WZMA 5L1IA 3ALYA 4FJXA 4CJLA 3QGGA 3M9MB 1T05B 1REVA 3AO2A 3KD5E 1CXUA 4I7FA 4ECVA 2WOMB 4WYWA 4CF1A 4IG0B 3IS9B 2R8KA 3RB3A 1J5OB 5KFLA 1S6QB 1C1BA 4B9LA 3GIJA 4MKAA 4O5BA 4BE2A 3PW4A 4DQSA 3HSTB 4K4VA 2JC0A 1GOAA 1BGXT 3I8DA 3V6KA 1TGOA 4FZXC 5C24B 3DLGA 4FJMA 4KTWA 4JV0A 5FROA 1HYVA 3TAGA 1ZETA 1WSGA 4CEAA 2YNGA 1LWEA 3DLEB 3Q8SB 2R8JA 5I42B 3KHRA 4CEEA 4I2QB 1QHTA 3V81B 4TY9A 3KK2B 2HHVA 2IMWP 2BQ3A 3I0SA 1Z26A 5F9LA 1WN7A 1C2PA 3H5SA 1FK9A 1RTIA 4HTUA 5HRRA 2C28A 3DYAA 4CJWA 3Q8PB 3DI6A 3T5HA 4I7FB 2IGIA 3U3YA 3LDSA 3HP6A 4E1MA 4WFZA 1LAWA 2R8GA 4CEQA 1K1QA 5KRSA 4J2EA 2BDPA 3CJ3A 1S1XB 2DTUA 2YHAA 1S0MA 3KMQA 1C1BB 2JEIA 3UDLA 1RT7B 4CF8A 4M94A 4BDPA 5SZTA 3OSPA 4DSEA 4KAZA 3AO4A 4LD0A 3Q8RB 5KFVA 4ECQA 3KLEA 4I9LA 2W8KA 3BDPA 5KT3A 4CGGA 4QW8A 2BANA 4Y2AA 5KT7A 4F4WA 1RA7A 3NMAA 2F96A 2AGQA 4NLWA 4ECUA 5EUHA 3QIPB 4TXSA 2YNGB 4KO0A 1JLFB 3DRSA 4CGDA 1B9DA 3QIDA 4FW1A 3QESA 2ASDA 5KFSA 4Z4FA 4FLTA 3CO9A 3PHEA 5FRMA 1OS5A 3HT3A 1CZBA 4DFPA 3IG1B 3MF5A 2WRMA 2FJVA 1SKRA 2C2DA 3HPHA 4MQ3A 2YNIB 5KFDA 1FK9B 2FLPA 3HJFA 5J2MA 4RW7B 3V6DB 3DYAB 1FKPB 3ITHB 3ULDA 4FK4A 3TAQA 1TVRA 1B9FA 4ED7A 5CYQB 4DL3A 4HVJA 1YTAA 1DLOB 5KFEA 4X2BA 2KW4A 4ID1A 3HXMA 4DLGA 1LV5A 1ZBHA 2AWZA 4HUGA 1Q8IA 1JLBA 3K5NA 1NJYA 5CZ1A 2F8SA 1FKOA 3L8BA 1T03A 1JLAB 1C0TA 4FJ7A 3RBDA 4TY8B 2D5RA 4URGA 3TANA 1VSLA 1U04A 3K5LA 5EDWA 1IKXB 5JXSA 3OYGA 3L2VA 2AQ4A 4KO0B 4M3XA 3RTVA 3DRSB 3H40A 2HVHA 1D1UA 1K6YA 2GV9A 5KG3A 1UOCA 5K14B 4KRFA 1S1VB 3A2FA 4LSNA 4FJHA 3AVJA 2IAJA 3V4IA 4Y3CA 4IR1A 2OZSA 1NHVA 1VSKA 3HM9A 4GVMA 3OYNA 1WSIA 1TK5A 1IKWA 3KD1E 5KT6A 5J2MB 2BGGA 4FBUA 3HPGA 3VQ5A 1LW2A 4DTXA 4EYIB 1D0EA 4BWJA 3BR9A 1RT3B 3KHHA 3OJSA 1L3SA 3HKWA 4M3WA 2V9WA 3VQ4A 1L5UA 2KQ2A 2HHWA 4O0JA 4ZPDA 3L2RA 3VQ9A 3TI0A 4HYKA 3VA0A 4RW6A 1T94A 4ZHRB 2JC1A 1RBRA 3BGRB 1JXLA 3NF8A 1ASUA 3S3MA 1BHLA 4ID5B 5KG1A 2RDIA 1FKOB 1T03B 5F8LA 1ZTWA 4J9KA 1RYRA 3SUNA 3NF9A 4DTOA 5HBMA 4WXOA 2YKNB 3KLVA 3OYDA 5HROB 1TKTA 3CFOA 3N6NA 3OLAA 2IAJB 3V4IB
chains in the Genus database with same CATH superfamily
5HSPA 1N36K 1S76D 1NGCA 3B6OA 4DQRA 1C4CA 4ITSA 3AO5A 2W24A 3QWUA 4DN9A 4H4OA 1XMOF 1BQMA 2KO1A 5HP1A 3D2FB 2HQ3A 1N34F 4JKDA 3ZSOA 1VQKN 1UFKA 2MQPA 4J5OA 3ATVA 5F0XA 1HNWJ 3HVWA 1O8BA 4DPYA 1LW0A 4EHTA 2A6MA 1GLBG 4B9MA 3KJQB 4PKDB 3ZT4A 2KHDA 2Q6CA 4BGBA 1FJ7A 3WT0A 3CCVN 3MUTP 3DLRA 5FLXO 1FDNA 2V67A 3FJ2A 1WKKA 3EICA 5FIIA 3AA5X 4LR7A 2N82B 2QZ8A 3THYB 3Q0AA 1NM1A 4YOVA 1R31A 3VZHA 1B0VA 3M1FA 4MKBA 5KG7A 3PCOB 4Z2XA 3ZSWA 1O6XA 4NI2B 4Q44A 4CHPA 5KG2A 4OHZA 3TNVA 3CXCR 2ETJA 1R0CB 2NRWA 4E7IA 3Q89A 2EHGA 5IM0A 2DCLA 1TV6A 1X5TA 2QLFB 3JAMY 1NSPA 2VIHA 3E51A 4ANCA 4A8MP 2PY5A 3QFPA 4M3RA 4J9OA 1N4LA 3V1QA 3TA0A 1NK7A 2Z0GA 1RE1B 3I56N 3CI5A 1KVJA 1ZPVA 3W5ZA 1KAZA 4YQWA 2QX0A 1AROP 1FWKA 1Y0HA 1YZ7A 2GW8A 1A7GE 2G8KA 4Q0BB 4CJUA 4B3RJ 3DC2A 4BRGA 2O8EB 1LWCB 1FDBA 2CQGA 5D0EA 3ZNUA 3OJUA 4CD1A 4RZRA 4O4GA 3THXB 2VDIA 1OPZA 1Y10A 3MCOA 4DR3J 3LF0A 2JVRA 2VBZA 4O4RA 1JQGA 2B4PA 3G6XA 1GFWB 3I9ZA 3G25A 2CPIA 3AQOA 3QT8A 2V2QA 3PX0A 3ZSVA 4HKQA 3V9XA 5E3QA 1QD1A 4FWNA 2F4VJ 3D4JA 3U1LA 3G6EN 1OH7A 5J2QA 5J1NA 4EI2A 3FZBA 3KLFA 3NRBA 2P6SA 1XHXA 2DY4A 1YDLA 5KFRA 4F4ZA 4LMZA 2UP1A 2XMJA 4G65A 3WEEA 3HSDA 4MT1A 3MD3A 1I39A 4U8VA 2P6TA 2XI2A 3D6TB 4CRJA 5T41A 1H7XA 3FMBA 5CYMB 4ECTA 5LMNK 1JLCA 1TQLA 3CJ2A 1NGHA 2DVIA 2C42A 4QWBA 1WTFA 4EBDA 1Z05A 4TN2A 1ULRA 1RAJA 2RE1A 3SFGA 1NGGA 4JI1F 3CHWA 3H08A 2AX1A 1W97L 4RWWA 2G0JA 4DS5A 3H4DA 3RGIA 3T5KA 1HR0F 2XGQA 1Z6RA 3SCIE 4WFXA 3BN4A 2IS3A 3O3HA 2ZE2B 1DAXA 1CLQA 2V94A 5IS2A 1X31C 2VBWA 1YI2N 2DHHA 3ZYYX 2EG2A 4FLYA 5KFNA 4F3OA 4AM7A 1RT2A 3LP0B 4V1Ak 2XEXA 4DUYF 3JTOA 5AJ3F 3SBGA 1XMQF 2W2QP 2BRLA 2A18A 3BO2A 1D9AA 3AD7C 5AZIA 3WIVA 2YX1A 3JSMA 5ETLA 3O3GA 4Q43A 4WU3A 3I9V9 2JEFA 2QSWA 1B7FA 4H5NA 1IG8A 2BVZA 1CS4B 4LSZB 3WNFA 4CI0B 2XNQA 5M1QA 1IJJA 3QT7A 2DBBA 4GO7X 1HBUA 4ILMA 4DPTA 3GPAA 4CZLA 4KGXB 4U8YA 3ASMA 1YK9A 1L3TA 2Y1JA 3ILLA 3SSSA 3CPWR 5BXIA 2LQBA 3CCLS 1QHAA 3ZZ0A 4F50A 4CDIA 3WHIA 1WSEA 3UQSA 2RRBA 1KBRA 4J9PA 3MWBA 2QLJB 4DV3J 1IBKJ 2N7YA 4FLXA 4NLVA 3NCIA 3AB2B 4NYPA 4UOHA 3BZQA 3PJXA 4IFYA 5B0FA 4OLBA 4FWSA 3M1VB 3BSNA 3PYDA 1S4EA 2F9DA 4NCGB 1KOHA 2O1PA 5DMRA 5J2PB 3KK1A 2DH8A 2LA6A 3QGPA 1BU6O 4OI6A 2HHHJ 1WC6A 1Y9OA 2BH1A 3TWHA 3BPDA 5KT2A 4E7KA 3V9SA 5H9FJ 4RBVA 1N5SA 5C42A 5HVHA 1UVMA 1XNQF 2D1CA 5LL6Z 3OR1A 2DPJA 4OIXA 4OHWA 5FPNA 1K8KA 4KV8B 4FXVA 3HVTA 5C2DA 3POTB 4HH1A 3HVAA 2G1HA 4BRPA 4JKFA 3LDQA 5L46A 1P1LA 3PR4A 3S01A 2FC8A 4KTZA 4WQ5A 3ENBA 1S6PA 1EIYB 3BPSP 4OV1A 1HI1A 2LKZA 1K47A 2P9SA 2XLKA 5AQKA 4BRDA 5A8WA 1IBMJ 1W0HA 4QWDA 4I68A 3TZZA 2ZJQQ 1UMJA 4YN3B 3HTVA 3KLEB 3NAIA 3FRYA 3NS7B 3M30A 3MMJA 1QAJA 1CULA 4DSFA 2WC9A 3ISND 2W9CA 2R42A 4B8CA 4HHJA 2DJWA 3MZIA 4L76A 3LZJA 4JS4A 3G87A 1KLMA 1IWAA 2Z58B 2QMWA 4JOUA 5A8KB 1REGX 3D7EO 3OW2R 3SAGA 1EXQA 3BQ0A 3DFEA 2FLLA 4YR0A 4PKGA 3D6HB 4CCHA 1RTJB 1Z4UA 3WZ0A 1U1QA 1UEVA 1S9GA 2KG1A 3AVIA 3C94A 1SVDA 3ENOA 3PKYA 5JUMA 2NSCA 2DNMA 3L6QA 3FSXA 3M4XA 3A8IA 2VWBA 2DGQA 4AQYJ 4Y2KA 1RAGB 2KZZA 1HNXJ 1ZBLA 3UE2A 5CD4H 4ZKAA 2WCXA 3HI0A 2DR6A 1VQ8S 1ASWA 2PN6A 1ZS6A 1Q8BA 4FF2A 5HMYA 4LBPA 4N5SA 2BE2B 2J9EA 5E3AA 3MXJA 4LUBA 2W7PA 5GMEA 2CWXA 1RP5A 3LM9A 4NLXA 3K7RA 5EX5A 5HQ8A 4TKTA 4B3MJ 2YY3A 5KFIA 3QGIA 3CFPA 4DL0C 1UTAA 3G0ZA 4CIEA 5CABA 4DV5F 1PAUB 4CYUA 4P2MA 3TWZA 3MM6A 2JH3A 2D3O1 4ZPVR 2DNLA 2ROPA 1FRJA 4O55A 2N7CA 3WNEA 4YOWA 1SZ2A 3Q8QB 1WSFA 3BKFA 2HHTA 3VOVA 3J80Y 2JLEA 4GKKJ 3MEKA 3IR7B 3VEWA 5AT1B 2X1AA 4DR1K 4WKRA 1RXOB 4O3PA 1Q7YO 3TA2A 1ITGA 1QSSA 1HPMA 3CGIA 3L2UA 3S9HA 3CDUA 4C0OC 2YX7A 4JEPA 2XY8A 2WB1D 2DR9A 2JGUA 3NHGA 5BYSA 1Y7PA 4EIAA 1G15A 1RBTA 3UVJA 2OSQA 1NK8A 3BO3A 4A8YA 2E7XA 1KQFB 5KG6A 4J9LA 3M6VA 4J9SA 2DGTA 2V7ZA 1T6DA 1BDGA 1HQ2A 3UNYA 5CHCB 3QO9A 3JTNA 1M5KC 1UETA 3OTOJ 4CLFA 4FK2A 3B54A 2W8LA 3FC9A 2A5XA 1QVFM 3CJ8A 3CC2S 3AD8C 1G99A 4RNMA 1I3AA 2LLZA 4R0EA 1WHWA 2YQ0A 3GV8B 1NBWA 1XQSC 1HNVB 3TTCA 3RU0A 1LK5A 2WVBA 2FSJA 3DGPA 1FDDA 3ZCMA 1N8RO 4Z7YA 2VGNA 3AY9A 1Q7YT 3R1XA 1DTQA 5F2RA 3ZSXA 1TK0A 4DL4A 3CDWA 1U48A 4YEAA 1GTHA 2RNEA 3V1RA 3J7AP 3M6WA 2R7TA 2F1FA 2V68A 3Q22A 1R8AA 1CJVA 4QS9A 1XI1A 1T95A 3PSFA 1AW0A 2HBKA 2QXFA 4IO9L 4OMFG 4DG1A 2ZH9A 1S9EA 4JI2J 1GLEG 4WE1A 4NOHA 1ZTTA 2GC8A 2HVDA 3MR2A 1NNDA 2ZH2A 3T7ZA 3NVMA 1U25A 3VQ8A 1OQ3A 2QC3A 3O6WA 4KHPK 3QJLA 4PYAA 2WONA 3KJNB 2L48A 2DITA 4FJKA 2E1YA 2DNHA 4KIAA 2B51A 4ECRA 4F4XA 3KLHA 1N54B 3CDEA 4XIUA 2IDOA 2AJ1A 1RADB 4DL5A 4BC2A 2C3OA 3TSUA 2MJUA 4ECYA 1D8YA 3LW5C 3M32B 5DG7A 2FZGB 4Z4HA 1N8RT 3KK3B 2ZQBA 5D0RA 4DV4J 1LQ9A 3VQDA 3CCMS 2JDJA 4EEYA 3ZO7A 4OKKA 2UUWA 3VGLA 2O8DB 3OT9A 1JLEA 3E01B 3CJRA 1J5OA 1S6QA 5EY4A 1TL5A 2CQ3A 1L3KA 1XMOK 2HMIA 1CC8A 1YRXA 2EX3A 3R2DJ 1KCFA 1N34K 3MCPA 4BBYA 3GFXA 2JWLA 3AAPA 2EXUA 4HEA9 3LOUA 3LPUA 4G1QB 3DLEA 5BR8F 1XJWB 5KFQA 2X3DA 1N5YB 3WXIA 3GJRB 4JI0F 2VICA 2CIMA 3DLLL 2I6WA 1WLJA 2HBLA 3H1VX 2B4UA 1BCOA 1BI4B 2PEBA 1NK4A 4Y65A 4OHYA 3OYIA 5AQTA 4NCBA 3KWIA 1N32F 3GYXB 4LF2A 3E9PA 3HM8A 1XTZA 2YHWA 3FBFA 4IQXA 5E41A 1HA1A 3GP9A 1S1XA 3CMQA 3QEIA 2R2RA 4P6QA 3CDBA 4A8QA 3FK4A 3FQKA 4FPAA 1H73A 1YQHA 3GJSB 2CRLA 4KGZB 3P1GA 2YKMB 2NRTA 4F02A 1S57A 2LYVA 3TX8A 3LH2S 3VQ6A 1LFWA 3EJMA 3CCWA 5DLFA 4E89A 3CW2C 4H4KA 1BWVA 5F41A 4M8LA 4YDUA 3IR6B 2ASOA 2FLOA 3M6GA 2F9JA 2R7YA 4HACA 3AVBA 2OGUA 1OY8A 2BR0A 1U4BA 1OH5A 4CTAB 2V8DA 3BF3A 1VI7A 3IG1A 2H5JB 2ZVIA 3ZLJA 1NPKA 2YNIA 2B5JA 2YQ3A 3V6DA 3QJJA 5HK4A 2OSRA 3ITHA 2J6SA 4B3TJ 1B0TA 3DDKA 2CGJA 4FPIA 5B09A 1UPPA 1X5OA 5KI6A 3AFGA 3DXMB 1KVAA 3M9NB 4O8KA 5IOLA 4E7JA 1S9FA 2O4IA 3JYTB 4JP8A 2FF6A 1L3VA 1RZMA 2X1GA 2J0SD 2GUPA 1KC8O 4EZ6A 4NPOA 1K44A 1IKVB 4ISEA 4JI6J 4TLQA 4GO5X 2QMXA 1YHQS 3AHPA 5AXKA 2P5VA 3HSJA 3PG9A 4TY8A 1IUJA 3G10A 4IWVA 2IMOA 2YV0X 2CQHA 4JV5F 4YB7A 1AT1B 1KONA 2HAIA 2O3DA 1H98A 1U2CA 2HNZA 2BKNA 4C8NA 4CNZA 2DH7A 1SQGA 4CJ5A 2ATQA 5HJYA 4C3KA 3OXFA 2Z2LA 5M2PA 1Q82O 4L3QA 2HRYA 1NM2A 2I5JB 4K4TA 4IR9A 5CA5A 1N33F 3FZ2A 3H5XA 1TL1B 5ETTA 5KPTA 4YNQA 3JAMU 1E4GT 1KTVA 3WX8A 4Q45A 2RH3A 4CK3A 3B8HA 2QE5A 1FW6A 2ITGA 3QBCA 3ZC4A 2RPIA 3L3VA 5KG0A 4HR2A 1XN9A 4C0HA 4H0PA 2D41A 3ZEUA 3BBBA 1MWYA 3R9LA 4K43A 3C2PA 5JICA 1FRMA 4H4KC 3LGNA 3BGRA 1ACMB 1AUSL 2BEFA 1HR0K 2FZKB 3QNNA 3EKSA 1HKGA 3MOZA 1KC8T 3AVFA 3DOLB 4FYVB 3CCES 2PI5A 1JIHA 4CO3A 3QRQA 4U7CA 2UZAA 1VCTA 5HROA 2IM3A 4YR3A 1WAFA 2H9ZA 1IBCB 1S48A 4GMKA 3NGSA 4N8NA 4LT6A 1VK3A 3FBCA 4CHNA 3CJ5A 4DUYK 5DM7L 4DU3A 5AJ3K 3P4UB 1XMQK 1Q82T 2CJAA 5D0HA 5GMKa 2ZBRA 3U7JA 4IZ9A 3HP9A 3TQEA 3ZX3A 4QS8A 3RZAA 2AU0A 1WHVA 1TL7A 5AE2A 4DV6F 3HHKA 1TFYA 1WKLA 3QRPA 4QOTA 5GIOA 3EUNA 3QINA 3RR7A 4X62F 2G8VA 2E7WA 4BROA 3L09A 4DL6A 2AYBA 3ZT3A 1HBNB 4LRCA 1RDBA 4ZCKA 3BKTA 1YVUA 2W01A 3ZZUA 4KHYA 1HKCA 7FDRA 2VOPA 3PYFA 5B0BA 4FM0A 1GLDG 1QZ6A 2WVDA 3OBWA 5BPLA 4QIFA 4K8RA 1F3FA 1XMBA 2HLTA 1JJ4A 4H0VB 3ILIA 4KH0B 2MGZA 3M2RB 4FJNA 1PKUA 3H0PA 1RDDA 4X4SA 4Q5VA 1WI6A 4LF9F 1N56A 3JSRA 4C1NK 4ZVRB 5F1XA 2OLWA 4CERA 2RDJA 2MQQA 4CJTA 2CJBA 3KWGA 2GQCA 2N3OA 4IO9Q 4CLSA 3P83D 2IHR1 3DCAA 5EXWA 2FQQB 4YB6A 5BN9A 4ANDA 2VUGA 2UXBK 4B08A 2HFZA 1RWPB 1GXUA 1M5VC 3CEDA 1URRA 4O23A 1ATSA 4IFVB 5I4MA 2Q3SA 3H2VE 4J7CA 4EP4A 1GAOA 2P1JA 1HYSA 4BVPA 4ZP8A 4H4MB 3H7HB 3C14A 3I32A 5KFTA 1WDDA 3MMCA 1IG9A 2MKIA 3AA2A 4LBIA 3VAIA 1S0OA 4FJJA 4WXWA 4OX9F 2BTFA 4Q0BA 3P6YC 3NMRA 2X6SA 1HPZA 3WXJA 2O8EA 1LWCA 2X7IA 4RX6A 3R6LB 3IA0A 2GMJA 3THXA 1S79A 3D28A 2HVIA 2NLWA 4KT0C 3OY9A 2J76E 3TEHB 1JNZB 3T69A 1VMBA 1HQEB 3O6QA 2EI5A 2XI3A 2O8BB 3RBXA 1EAYC 3UD5A 4JLHA 3QERA 2MPUA 3TJ8A 5HMZA 3GSIA 1IQZA 3SQ2A 3FLCO 2MLXA 1W7WA 2E5LJ 1NGJA 2MKCA 1RT5A 2GHVC 3QQCD 1F0XA 4X65F 5C5JA 4MO4A 4C0BA 3KKFA 4PXEA 4DKWA 4YHHF 1N52B 3KDNA 2ASJA 3BGFA 2UUAJ 1R0BG 4FJ8A 2MYFA 1M5HA 1S99A 4DZDA 1CZAN 2HZVA 2XB2D 2XHBA 1RCHA 5CYMA 4NA1A 1HRHA 4M5GA 2LP4A 3W8PA 3R7SB 2OEKA 3OVAA 3MTJA 4OJHA 1ZAWA 3TTFA 4DV2F 3ZSQA 2HHXA 4CO0A 1T9XA 1VHIA 4V19S 1V5IB 3T1YJ 4CLWA 4IRKA 2ZE2A 5T14A 1S97A 4BRKA 2BOAA 3QAEA 2LQ9A 1GLJO 2XMVA 2Q1LA 3QEVA 1FRXA 4ZIVA 2O4GA 4CJPA 3CFRA 1UW9A 3SPZA 2J8SA 1A5VA 4B9VA 2HIYA 4LY7A 2I0XA 3RRKA 1KFDA 3MM8B 1QSLA 1TMMA 2HQIA 2IVNA 4J9UE 4NA3A 4IG0A 5J1EB 4JI5J 3F56A 4YMEA 1NGAA 5EWFA 4A61A 3EZOA 5AQRA 4OZ3A 2FBYA 4NLQA 4DV5K 2Z2YB 4GV9A 2DPNA 3IWLA 4BE0A 4IXCA 1YJ9N 2QK9A 1Y5NB 4NRTA 2G8UA 4OI0A 4K5RA 1CS4A 2D0PA 2ZGZA 4ZVGA 4DU8A 1JX4A 4IOCL 1FXXA 4WQ4A 1KRPA 3O5BA 3DU6A 3PW2A 4G3IA 3RSEB 2LU2A 2Z1HA 1K8AO 3RMAA 1VBYA 1RHKB 1RCXB 2M9KA 2RF2B 2A1RA 2LQ8A 4KB1A 2FJAB 4LFAJ 1PO6A 2QA1A 3RJMB 4NLCA 3G6ES 2IY5B 3ALYA 4CJLA 3QGGA 5E7OB 1XNRF 4OJ3A 4BRAA 1J27A 4I7FA 5D4LA 2E1CA 4ECVA 2W2PP 4AL7A 1B3TA 1HJOA 3IS9B 2IYIA 2X1FA 5C12A 3J7Z5 2MZ1A 1C1BA 3GIJA 3VWSA 4ILHA 1GT8A 4LF5J 4ED5A 3TVYA 5DS7A 4NXMF 2V2ZA 4A5AA 3HD2A 2RAQA 3I8DA 3DXBA 1BGXT 2F65A 4KTWA 1ZZFA 5CD4A 5EN1A 3FBBA 2BJEA 3K0SA 3Q8SB 5I42B 2PDAA 1KQSM 3V81B 2B7CB 3L9ZA 3KK2B 1YUWA 1WG1A 4UOGA 1K8AT 2GJFA 1Z26A 5ETRA 2JLGA 1F9FA 1WN7A 5HMWA 3ID6A 4IJAA 3POTA 2DY1A 1J5EJ 2C28A 3DYAA 1HUXA 1FXLA 4QJVA 3LDSA 1UZHA 3HP6A 1NGEA 2HFOA 5HVGA 4CEQA 5B08A 1K1QA 3ZETA 5KRSA 2KH9A 3J80U 3OFFA 5DM7Q 1S0MA 2YHAA 3UDLA 4C48A 3P96A 4BDPA 2FHJD 5SZTA 2KXFA 2E1ZA 4JKHA 2HBJA 3AO4A 3UKRB 3MPYA 3IAS9 4TU7A 2NRXA 3KLEA 5AQLA 2Q6BA 3CB4A 1HNWF 4Y2AA 6FD1A 1RA7A 3T6BA 1H2TZ 1NGBA 2AGQA 2QA4G 2BJ9A 1R43A 2BACA 1OH8A 3DRSA 5C0YA 3A8YA 5AFUA 5GAEI 3ADAC 4USHA 3HMJG 5ETKA 4FLTA 4BCAA 1H7WA 4ZCLA 1WB9A 5I9EB 1WDTA 4HDGA 5A8KA 3HT3A 1CZBA 5A8RB 5HOOA 4MQ3A 5KFDA 1FK9B 2FLPA 3VF4A 1VYAA 4RW7B 5D4OA 4D3GA 1SJ4P 2UUCK 3D66A 3GWCA 4ED7A 1VQNS 4H0YB 1DLOB 3HXMA 2KW4A 4ZN1A 1FFSB 1Z2LA 4H0TB 3NNHA 1NPPA 1TL4A 2A2DA 3Q2TC 1HWJA 2ACYA 4ER8A 3L8BA 2H65B 4WIIA 4G9ZA 1QAYA 1CBKA 1OPIA 4URGA 2CVEA 3HULA 3CCRN 1VSLA 2VONA 2DIUA 5JXSA 3OYGA 5BR8K 5MAOA 4M5DB 2FHOB 1UOCA 4JI0K 2HIQA 2E5JA 4ZA1A 2D4WA 2B7BB 3VGTA 1R8PA 3ULHA 2J0WA 4C2MA 5IC4B 1X5PA 4DR4J 4OV6A 3W9HA 4GVMA 4B3RF 3L4BC 3KD1E 2NCKL 5J2MB 2BGGA 4Y2MA 1O5JA 3IC1A 3BUZB 3BR9A 1QM9A 3KHHA 3I6PA 2LEPA 3D1OA 4DR3F 1S7HA 3VQ4A 2WTUA 3DXKB 1L5UA 2KQ2A 2LU1A 3B4MA 2F7VA 2HHWA 3L2RA 3MX2A 2AMCB 1KS2A 3O80A 4P2SA 2VOOA 2E1RA 1JXLA 1JK9B 1ASUA 3S3MA 4BQZA 4JHDB 2P9NB 2P9CA 3Q8UA 2F4VF 5F8LA 1I94J 2MDAA 3SQGA 2E2PA 4DTOA 1U1RA 2BABA 1S12A 3PYEA 2K7KA 4TU9A 3CFOA 1F6TA 1V4SA 2RUSA 1KXPA 2FDNA 5SWMA 4A8WA 1BO5O 2FBVA 4M3YA 1EQYA 2OUGA 2VJUA 3R27A 3KHGA 2AP6A 1NGDA 4J91A 4Q8FA 3C46A 2DGOA 4CLZA 1VQ6N 1NU4A 3VEVA 1YSJA 2GMLA 1C1AA 3C6HA 4JRQA 3LPYA 3LP2A 1QVFR 1TUUA 3IRXB 4EFAC 4A2BA 2XZWA 3A5OC 4ES2A 4DV1J 3R3LA 5FLXY 3ZZTA 2VA3A 4WFBL 3AODA 4BC9A 2ZHBA 4YUDA 1OKJA 1UZDA 3OPKA 4ZVHA 5GAGI 1HNVA 3TAMB 1NNEA 4C23A 4OX8A 2HHUA 4EZ9A 2VF3A 1RWVB 4ICLB 4R79A 1MMLA 4JV5K 3FCVA 5AXMA 1APSA 4BRNA 1HI0P 4URSA 1YIJS 5ADXA 2CGLA 3VENA 1JLGB 1YT3A 4ETZA 1K0VA 2J6TA 3PHTA 2DNQA 4Y1CA 3NG8A 4X66J 3WNGA 2C2KB 1EETB 2ACMA 1NK5A 3NH1A 4ZS6A 4P2XA 3W7BA 4KTQA 4ES3A 2QL9B 4BLGA 3TA1A 3IGVA 3PO4A 3ONQA 2GWJA 1S59A 4DTSA 3GJQB 1LW0B 2ZEJA 3E1YA 3A3PB 4IOCQ 4F2SA 2HNDA 4ZCIA 3CJCA 4IOXA 1G6BA 3OYAA 1O1WA 4E2FB 1Q7LB 1F9EB 3M8WA 4NLPA 1FNMA 3NCRA 3JS9A 2HYIB 1KNZA 2DHSA 3CERA 4ISFA 4HWIA 5HLFB 3FSYA 3IGNA 3SK3A 1IBKF 2WSEC 4C4WA 1BA0A 3FEYB 5DGAA 2A41A 3OYLA 2O8DA 2P9UB 2OA8A 4CLKA 2OPQB 3MEDB 2PEHA 4NXNK 3CXCM 1VQ7N 1SI9A 4CEBA 3OHBA 5IM0B 2V52B 4FN5A 3HHLB 3RW7A 2J9DE 4DMNA 3DLBA 4NLUA 3OQ2A 2NYHA 4BDZA 1LFPA 2HHHF 4JS5A 2HZCA 4X62K 4G1QA 3TU5A 5LMUK 2WW8A 1DBDA 4MAKA 1N5YA 1SC3B 1M1HA 2VWJA 5AQSA 3GQCA 1GLAG 1P9QC 5JVGL 4FW2A 3MXHP 2HFSA 1BI4A 3QDKA 4NZ6A 1VSJA 5KT4A 1Z25A 3CNQP 5IFMA 4DSKA 2N4DA 1QJHA 1WG5A 3I4PA 1UEUA 4DR6J 4CEDA 2HNYA 1U8WA 3DHWC 3QEWA 2WSFC 4HHTA 1XHZA 4O44A 3SV4A 4LF9K 4LJMA 2KT2A 3NGZA 4ZTJA 3OTEA 1IBMF 1SH2A 2E44A 3E9OA 4ED8A 3KLIB 3U8XA 3N9UC 1PYOB 1LWFB 2YKMA 2PD1A 5F9NA 2BQUA 4RU9A 2ABYA 1FE4A 3D7SB 1I3OB 4UUWA 5J2QB 2R7WA 2EEYA 2FSNA 3EXYA 3PY8A 1TKZB 2DIVA 3KLFB 4KB7A 3QETA 3NVKA 3HHDA 3HFKA 4KHUA 5CYJA 4AXIA 2HBYB 2GTDA 4MIWA 3PTWA 4L72B 1QVGR 1PIEA 1X9WA 4C8KA 4DU1A 4OYBA 4CTAA 3WEEB 4DTNA 3TO8A 3CPEA 4UF4A 1VSFA 4P7TA 4LF4F 3PFEA 5KFAA 3U6FA 2FB0A 4OX9K 3OS2A 2Y0SD 1EKSA 1CZ9A 3GLJA 4RW8B 3ZTPA 2HHQA 2R7XA 2DHGA 4CJSA 4CK1A 3ZZYA 2F9TA 3DXMA 2CAJA 2IM1A 4CZMA 2MKHA 4AQYF 3OBYA 3IWXA 3JQJA 2JEGA 3DRPA 1I6JA 1A5WA 5GIPA 3F5TA 1D9DA 3B78A 2RD5C 3TAFA 1GOCA 2CJKA 3V1OA 5B7WA 1IKVA 1V5VA 5I3UB 4O5FA 1RILA 2QLWA 5F3ZA 1JL2A 5KPZA 1KVIA 3PDNA 1UAXA 3IFEA 3S8SA 3M05A 2CPXA 3OSNA 1WUAA 2Z1JA 3DLJA 5K5MA 4S0MA 4DF4A 1JXEA 1X5SA 5A2QY 2YH1A 4X65K 2ROEA 2JEJA 4O8UA 4RUAA 4B3MF 3PLAA 1VIXA 5DGBA 4YHHK 1Q95G 3FGUA 4USTA 1EHWA 2BUPA 3JB9k 2NXCA 1T7PA 4TU8A 2I5JA 5CQGA 4X64J 2C3MA 3G82A 2YPYA 3D68A 1TL1A 4XPCA 1T8EA 1R59O 4J9NA 3MPUB 2X51A 3NKYA 2HS0A 3AARA 1RBOB 1YJ7A 2CJXB 4JK8A 5AQNA 1RLCL 3GR0A 3VVTA 1XWLA 4ZP9A 3CJSA 3JSYA 5KFMA 2AGOA 3LP1A 2ZHAA 1I1GA 2VL1A 4GKKF 4ILGB 1NJZA 4DV2K 4IO8A 5ETQA 2OKQA 1X9SA 2DXDA 1BIUA 4AH9A 1URNA 3NY0A 3KJVA 2L9NA 1WG4A 3I0SB 4CM2A 1VQPN 3DOLA 1IM6A 2YJEA 2KFNA 2RQ4A 3OVNA 4UY85 4WWSA 3ZX2A 2LMIA 4CLUA 1F2GA 2HQFA 1WSHA 5CCMA 4Z37A 4IJNA 4WZQA 2VA2A 5M2UA 2JFKA 4DX8H 2OHDA 2VFSA 3QSYB 1R89A 3GG1A 3OYKA 5DLGA 1F3VA 4DZ6A 4X4UA 3IO1A 3Q8VA 1E6YB 2GNKA 2VWKA 3IN5A 5GAEP 2FY8A 3HKZD 2OTLN 2CDRB 3SUPA 3OTOF 2XMUA 2RUGA 2BMBA 3FKBA 5BRHA 3N01A 1NWKA 3KK1B 4JKBA 4FS1A 1WKJA 1IM4A 2GIRA 1HHTP 4WFBQ 4ATNA 5LXRA 1SJQA 3OYFA 3VV2B 1GMWA 3VQTA 3MPWA 1U45A 3NNAA 3M9OB 3UD4P 4H03B 4DX5A 2LDIA 5JVHL 3CSKA 4PG7A 2D0CA 4XK8C 3QB0A 4E1JA 2SXLA 4CBWA 3NF6A 1X4DA 1XNRK 2M3DA 3L7UA 1BWFO 4AM6A 4M5KA 1R27B 2P5OA 4KFBA 3N4WA 2KXNB 4DR5J 2P9SB 4MK7A 3KHLA 1OYEA 4JI2F 3S3NA 2KM8B 3NWRA 4U7UK 2AZ1A 2E2NA 1VDHA 1S7IA 1JLBB 2BBEA 2C2MB 1X0FA 5F0UA 3PNIA 1S1UA 5KAKA 2F9WA 1NHUA 4EBEA 4FNIA 2J9DA 2HFNA 2KKHA 3OL6A 3X1LB 1CULB 1NGFA 1Y5LB 2W9CB 4QR0A 1O51A 1G4CA 2ROGA 3IXQA 2EFNA 2KLAA 1EQMA 5DETA 3TSPA 4H4MA 3Q2SC 4LSNB 2E6LA 2LVWA 3HX9A 2PYJA 4PXDA 1DQAA 2W41A 1ZAXA 1H6KX 1NKBA 3EGNA 1NOZA 2CYYA 4DV4F 3QICA 1LW2B 1GQEA 3OW2M 3O1WA 3AA4A 5JMVA 2NRRA 1S9GB 3SNNA 1T11A 2YVSA 1J9AA 1FERA 5HATA 2YWKA 4FPRA 2HWIA 2W4CA 4ELTA 2QIFA 4DCPB 1ZZNA 1NSKL 2GAGC 4NWBA 1HQEA 5HANA 3BP8A 4DUZJ 2O8BA 2XHWA 4J2AA 5DDPC 2E88A 3M5RA 4H0XB 1HNWK 1TZ0A 4DSJA 3K2PA 2EBEA 3MGJA 2HAFA 1C0MA 2EC2A 2Q66A 3ZTSA 3U9DA 4L3NA 3GIRA 3WXMB 3C16B 2JZ5A 4LSLA 3R1HA 4K25A 3GCXP 1X4AA 2FC0A 1ZA1B 1NK9A 1NBEB 3GYGA 5JVGQ 2W7AA 4LVNP 2VPZB 1RGVA 3VMFB 3PXGa 4KB0A 2YI1A 2BYCA 4WKYA 4JV2A 5GAGP 4M3ZA 4DTRA 3MWPA 2KU7A 3K57A 2LCWA 3OL7A 4LRFA 4RW9B 4CIOA 3FQLA 1XC9A 5F8MA 2ZH4A 2X3GA 1RFQA 1WNEA 1HBOB 3CD0A 2QA2A 5AXLA 3GTYX 4J9RA 4JAXA 5EGYA 3O9TA 3NE6A 3SUOA 2XSFA 2Y1RI 1GOBA 2CPHA 4EWTA 5H9EJ 4Y34A 3EZUA 2DFEA 3JAMO 1X4GA 2NLXA 3MAQA 4M1KA 4DB3A 4BC5A 3KG1A 4TLRA 2E5IA 5AQHA 2WZ1A 3KYLA 3S1TA 2E66A 2PT0A 2FVQA 4BS2A 1OVQA 2V6AA 1FJGJ 1VQLS 4PKHA 3IBWA 3NH0A 2GX8A 3MM8A 2PMHA 3A3NB 5J1EA 4ED1A 2MLYA 2ZWPA 3CJ1A 2ZZMA 1UA1A 4BQLA 4K4ZA 1SH0A 4EP5A 3NNCA 3NLCA 4B3RK 3TARA 4DV7J 4B3TF 5IZHA 3C6UB 3QBWA 2ZH8A 2AEJA 2ZH5A 4WYBA 2X78A 3QO9B 3Q7BA 3K58A 4IQMA 3DN9A 2Y8YA 2QI2A 1RACB 4QWAA 5G4DA 1SPBP 1YAGA 4DR3K 4CLTA 5IT9O 5DZ6A 2B56A 3PFOA 2BKPA 2QWOA 1UFWA 1IJEB 3QGHA 2Y0BB 2RKIB 2GA7A 1LWXA 2UVWA 1A5XA 3PACA 2NUBA 2FPHX 4JI6F 3QPIA 3FE1A 5KTQA 4CI6A 2RF2A 2VDHA 3F0NA 2F4VK 4RBTA 1D3WA 5JLFA 1RT1A 4DCJB 4QQBA 2XYHB 4Z4IA 1YTYA 1YBAA 5EX0A 5D6GA 2YWHA 5J2NB 1F21A 4BRQA 3C15B 5AQWA 4A2AA 3W0LA 1LNQA 1ZM2A 4FXDA 4DL7A 2DEJA 1MA9B 3MURP 3UDEA 2A42A 5AE1A 4H5RA 4Z0UA 4DG1B 2Q36A 3A0IX 3P8BB 1KKHA 2OJ3A 4W5OA 4CF0A 3MR3A 1IXKA 1BQNA 4CFAA 3LGHA 4IO1A 4OPHA 4M5MA 2KYZA 1KQKA 5KQDA 1ZBSA 2Z1IA 3EPIA 4CZKA 2WONB 3SCXA 3EN9A 1KQSR 3EYZA 1XR7A 3DOMA 2QTDA 3KG4A 2DEIA 3KLHB 4F8RA 2XMTA 1N0UA 3ZT1A 4HHHA 2H1YA 2YHXA 2CQBA 2ZHOA 1WI8A 5IV4A 3AVNA 1W2IA 2V2KA 3R5BA 4CJRA 1KEKA 3AVHA 5HQLA 3VA3A 4NYZA 4BR0A 1S1TB 1YITN 1JLEB 3MEEB 2MY7A 1JXVA 4WP8A 2C3UA 2RS8A 2Q3PA 3SDEB 2HMIB 1H2VZ 1XERA 2XM3A 3UKRA 1MU2B 3AJDA 3QZ8A 3MUVP 3ZFVA 4NZ7A 3W61A 1KFSA 2OMOA 2VASA 2G0CA 1W2BR 4OYIA 1K0TA 4GV3A 3PYGA 5ELZA 1ZBTA 4ZLJA 3KWMA 3L3CA 3VAHA 1C1CB 2W9BB 1Q53A 3SQ4A 4MK8A 4E19A 1PGZA 1FVQA 1ZC6A 4ZVQB 1Y5IB 5A8RA 1X4CA 2IRYA 3ENHA 3NGRA 1FHTA 5JVHQ 1UJ5A 3LDNA 2YBVA 2QEXN 2Z1GA 4RW7A 4CLPA 4QAGA 1IBKK 4A8SA 4P72A 3VF2A 3DLHA 3L2WA 2CQDA 1Q9YA 5FLXU 4I69A 4ED0A 2OEJA 2MZTA 1BHNA 1Y3KA 1DLOA 4LC9B 2YXLA 4DX7A 4M41A 4I6YA 4UQGA 4QCLA 3VERA 2EFQA 3I5BA 3P31A 4QYZK 3D6MB 3OS1A 5JJBA 1IWGA 2XHCA 4WFAL 3F44A 2DY9A 2A2CA 2O8CB 2CJ9A 4OJ1A 4ECXA 4GC7A 2M5YA 1DARA 2UVRA 2F4FA 3FEZA 1RWOB 2VQEJ 4MLHA 1M90O 3GFHA 2ERRA 4M5DA 3O4QA 5H9FK 2GVDB 1KTQA 4HACB 1IVZA 1H38A 1VFJA 3QNWB 4B8AB 4AILC 2CFXA 3O4NA 2V4QA 3O9QA 2B5JB 1YVNA 3L95X 1RAAB 1ZM9A 2GJ2A 3NOCA 4LF7J 3EWGA 1IO2A 2RVJA 2H48B 2AF6A 5A6WA 5GADI 4GVEA 3H6EA 3CJTA 3MR7A 1RDCA 3J7A1 2M4MA 2QYGA 3DXKA 4MFBA 2DR7A 3RMDA 1IBMK 3MD1A 5D3GA 2IM0A 4I56A 2C2EA 1RAEB 5KFCA 2FSKA 1K73O 4ZOSA 3RG6A 1HNZF 3WBZA 2OPSB 5EWGA 4QPTA 4JHDA 2VPYB 4OYXA 4KREA 2K7JA 4QS7A 3C66A 3T5LA 4J2DA 1OVYA 2ZZNA 2E5LF 2XZTB 4TYBA 1H2UX 3NGUA 3C7NB 2BM1A 1U0HB 2G2ZA 1QAXA 2IM2A 2HNZB 4NLGA 3A13A 2CA9A 4W98A 1M90T 4FDFA 4AHCA 3NBPB 1TAQA 1Q78A 5GAHI 3SI8A 4DTJA 2XS2A 2UUAF 1Q1KA 1NDCA 3HL8A 2GHWA 1XQIA 4Y6IA 3T1AA 4LF4K 1EWQA 4BDYA 5IT4A 1UVJA 1B92A 4XH4A 2VKRA 4KGMA 3M8YA 1VQMS 2D0OA 4J90A 1KLNA 1FEEA 1HYZA 2ASMA 4K42A 3NGIA 4ZPCA 2R8HA 2POKA 5K8NA 3IRXA 2YWGA 3R7BB 4Y00A 1FXRA 1X3NA 3Q24A 4RW4B 3CCQS 4IEEA 4KKOA 4AQYK 4OPJA 3AY0A 3BF1A 1RWMB 3AVCA 5FPEA 1K9MO 1HQUB 4YB5A 4DV0J 3T1YF 2HEKA 1N6QB 4B9TA 3DXSX 1K73T 4P2FA 2XTJP 3TAMA 2UU9F 4MDAA 5AQQA 5F8JA 4OI2A 3RB6A 4ICLA 1VIOA 1RQ0A 2BKOA 4WK1A 4HVZA 2E1MC 1HWIA 2CNOB 1WC1A 3JTPA 3QATA 4B3MK 4JI5F 1JLGA 2XC9A 2XMKA 2UXBJ 2MKYA 2R7SA 3TPQA 3PJWA 2DFHA 4FSVA 1CJKA 3CO0P 3QFHA 2QA4N 5HVFA 5HI7A 3CQXA 1HW9A 3DJCA 3DNCA 1EETA 4AHVA 2KT3A 3J81j 3PRDA 1JXBA 2Z57B 2W42A 3QT5A 4Y28C 1TL7B 1WNSA 3N4PA 4QWEA 2J9CA 3OXGA 1CG2A 1Y97A 4ZK7M 3UE5A 4A4JA 1IKYB 4IRDA 4P71A 1P90A 1NDLA 4NEZA 2A3JA 3QLHA 4GKKK 4DEZA 4ZLPA 5JMNA 1Q9XA 3EO3A 1DRZA 1K9MT 3LP3A 1SV5A 4BWMA 3RBEA 2QYCA 3DMJA 4LFAF 4RUCA 1SKWA 4PL7A 4K0KJ 2GS8A 2MGZB 3NMUA 5HLFA 3VAGA 2GBZA 2OO4A 4AHRA 2I9SA 1ATRA 1UWAA 5C25B 1PAEX 4C8OA 5JS2A 3MWTA 1VHXA 2FVCA 2P9UA 1X9JA 2AA4A 4OZ5A 4F04B 1YJNS 3IR5B 4LF5F 4A5BA 4ED2A 4R8UB 4ZVEA 3K0JA 4IOBA 2OPQA 4ZLLA 5IT0A 3MEDA 3KG0A 4CH1A 1A0OB 2CG4A 3OTOK 4JI7K 3CJKA 4Y1DA 2VODA 2MTLA 3HHLA 3AXKA 1Y11A 4MJKA 2VQFJ 2LA4A 5A2QU 2UUBJ 4J2BA 3A5MC 1BCMA 2DKOB 3G9CA 3SQ0A 5GAEU 4FBTA 4F25A 1P1TA 3UDVA 4E7HA 4P9SA 3SJHA 3VF6A 2JX2A 4LBHA 3OFHA 3ICLA 1HYSB 4WPAA 2FGOA 3SYZA 1WC5A 3C14B 3IWNC 2G8IA 2DNNA 1BISA 3CWJA 3MMCB 2IBOA 2BQRA 3A3OB 3EZWA 2E2QA 4NE9C 3KKRA 1J5EF 2JSXA 3H5YA 3RAXA 2LFVA 4JRPA 1HPZB 3QYYA 1RTDB 3ULEB 4LF8J 1RJJA 3D67A 2AJ0A 4F4YA 4FJGA 3P39A 1SJRA 3ZXWA 2BE9B 3UFCX 3QSIA 2CWKA 3SBMA 2HKEA 3BF4A 4JI2K 2KFZA 3I0RA 3KLIA 3SLCA 2DGVA 1LWFA 3R5GA 4GMJB 3PV8A 1RNHA 4KHNA 5EVZA 4DS4A 5A0YB 1RT4A 3LTOA 3NL0A 1TKZA 1RT5B 4OZ1A 3ET6B 3CCUN 1T05A 3BR8A 4JUZA 1KN6A 4LF6J 4IFEA 5IWAK 3V9UA 1M1KO 2J6UA 1ZXOA 2Y9HA 1I51B 4PRFA 4DWIA 2F8EX 2OEMA 2F8TA 1LKZA 3GU0A 4U96A 2Q2RA 2HMPA 1PCAA 4P75A 3G6YA 2OTJN 3K5MA 4O3RA 2V4RA 2FVSA 3KHYA 4RW8A 1BUXA 1OMSA 3J81O 3CC4N 2KT5A 4TQRA 3SJJA 2XG8A 2D9PA 3VQ7A 2ASYA 1VOMA 3HHLC 4NLRA 1Q79A 1CJUB 3EGWB 2CQ4A 3VAKA 2XY5A 3P5BP 3TVZA 5LSRA 5KOWA 3ZZZA 4KBIA 4PG8A 1VQ7S 4K4WA 1NSAA 2GGPB 3A8JA 5I3UA 1QTMA 5KFKA 1SKSA 3MCNA 1WACA 2G8HA 1JJ2R 1FDAA 4CO5A 2MQOA 3OR2A 4QZVB 3CCZA 3OTCA 4NX9A 4AE5A 4DR4F 2DHAA 4IG0B 2C2OB 1FNXH 1M1KT 3RB3A 2WUSA 3BS9A 4KPCA 4B9LA 4BVOA 2RHKA 2CPZA 4ETXA 3FZHA 4PKIA 4WCEQ 1DT9A 1A6LA 1S0VA 1CEZA 3U4LA 1IJFB 3AH6A 2DT9A 3HCXA 4K4VA 4JNEA 3O8WA 3MX5A 1RHUB 4ZCMA 4DMZA 3V6KA 5C24B 1TFWA 4FJMA 4JV0A 5HAOA 2ZM6F 1ILYA 1U1MA 4CEAA 2YNGA 5GAGU 5GVQA 4CVNE 2P2CB 3TEGA 1I94F 4TY9A 2IMWP 1SBRA 3I0SA 2RHSB 4BGAA 3UW1A 1C2PA 2Q31A 5KQ8A 2UXDJ 1VISA 4DBQA 1NZAA 2ZH6A 4HTUA 1YJUA 5HRRA 2QWQA 3CMAS 2J5AA 4CJWA 3Q8PB 2GAHC 3T5HA 1Z2ZA 4I7FB 2KRBA 2MSSA 3NXZA 3G8QA 1FJEB 4WFZA 3E66A 2BDPA 1NLVA 2DTUA 2G1DA 1C1BB 1RT7B 1E6YA 4CF8A 4M94A 3U1MA 3IDHA 4DSEA 4B3TK 2AJ4A 4QIWD 4LD0A 2WVCA 1UP1A 3Q8RB 1F5AA 2W8KA 3OFGA 4CGGA 4QW8A 4DV1F 5BRFA 3SBTA 2F96A 2Q0RA 4ECUA 4HTIA 3QIPB 4KO0A 5L9NA 4USWA 2DXEA 4FW1A 2KDOA 4J9VA 3GOIA 3L0QA 2ASDA 2F8HA 2MY8A 4JI6K 4Z4FA 2XMMA 4BREA 3R6GB 3PHEA 1HFEL 2UUCJ 4CBXA 3MF5A 3U02A 2FJVA 1EB0A 2FTRA 5SUHA 1FXDA 3MPDA 3TOQA 4JBCA 3DYAB 1NH7A 2BZ2A 2NUHA 1FKPB 8RUCA 3ULDA 4PAAA 4LVOP 3TAQA 2ATCB 3LDOA 3ZETB 1B9FA 1C0GA 4MKVA 3EM1A 4DL3A 2K06A 4X66F 4HVJA 1KDNA 1RLDA 4DLGA 1N88A 3BYRA 1U6ZA 3KJFB 2AWZA 5A6PA 1Q8IA 1JLBA 5BR8J 5TKYA 5CZ1A 5AQPA 3IM8A 2CPYA 1PBUA 1T03A 2H51B 1JLAB 3PRBA 4A48A 2DNRA 3I31A 3K5LA 3L2VA 3A8KA 3DRSB 1C0FA 2HVHA 3ETOA 4YOXA 4CZEA 5K14B 1VBZA 1ICEB 4LSNA 4FJHA 2IAJA 2BXJA 3V4IA 9ATCB 5C15A 4ISGA 3VGVA 1NHVA 1FT8A 1WSIA 4EU0A 4GKJJ 5DDQC 4BRMA 1LW2A 4DTXA 3HLUA 5DJBA 3JXUA 2G13A 1RT3B 2FJEB 3DRYA 4LFCF 3OJSA 2PAVA 1L3SA 4PABA 4RBUA 2PFFB 2V9WA 4EFHA 4PHTX 1NMEB 4ZPDA 3VQ9A 3VA0A 1T94A 2BJ8A 3KDOA 3BDEA 2ZH3A 1JCEA 3MN6A 1YG0A 5GAHP 1BHLA 5KG1A 2RDIA 3AA9A 4PQAA 1ZTWA 4J9KA 1V6HA 1RYRA 3SUNA 1OIAA 4OZ2A 1U1KA 5FJ4A 4XEIA 1Q81O 2YKNB 2YJFA 3OYDA 1PBAA 3C16A 4F0MA 2NXJA 4DHVA 4OQJA 3OLAA 4DX6A 2XBPA 2Y3YA 4XDCA 2QWLA 2BX6A 5ADZA 4IRCA 3CC2N 4LRAA 4WQ5C 2AEMA 1S10A 4DR6F 2O66A 3TUIC 2M52A 4FWQA 5C2FA 4NA2A 3T41A 4B3OB 1DGKN 2KM8C 3L2QA 4RW9A 4B1WB 1SQFA 1T3NA 3M8QB 4UOFA 1HBOA 2MQ8A 3OYMA 4LREA 5F3TA 2GQ2A 3H3OB 1WORA 1FD8A 2AP1A 1M5OC 4UTGA 3FEXB 4GVBB 2VCPA 4KY3A 2KTQA 4DR7J 4KRWA 2WTFA 3MECB 4KHSA 2CDQA 2X74A 3RVCA 3Q23A 3PZPA 4E8UA 3RW6A 5KRTA 3H59A 1NCLA 5BN8A 2VG7B 2O67A 2E9TA 2OD4A 5L1JA 3SQGB 3M2VA 4PR6A 4OHVA 2EPIA 3HSGA 1Q81T 3JSBA 1P6TA 1RT6B 2ILYA 2UYTA 4RTFD 1EARA 2ZD1B 4CW7B 2OIHA 3ZZPA 2R7OA 5I3QA 4OLPA 2E5HA 4DTUA 1NSQA 5D77A 4H8KA 4DU7A 2HZAA 2E29A 3OHAA 2OYQA 2VV5A 3C6UA 4PQUB 3ZX0A 4L75A 5IXUA 1KVCA 3Q7CA 3CJ4A 3LP2B 2VH7A 3GBTA 5D0GA 4A8FA 1NPRA 2O5DA 3KLGA 3H2LA 2IJFA 4FVMA 3PX6A 3U3GA 2KRRA 2VZ9A 5CZVA 2RKIA 1FTRA 4ZITA 3K17A 3PIPL 1M1GA 3AD9C 1HNZK 4BG9A 1JLQB 2RT3A 1AXQA 2XNRA 3SQOP 4W5RA 1RTHB 2B4VA 3SEOA 2E5LK 2ADBA 2AKWB 1EO1A 1QAIA 5K9FA 1UWBB 2FJWA 3K8WA 1N5TA 4NZ0A 1GNKA 5J2NA 3C15A 1OWXA 4NXNJ 1T9TA 1DHMA 2UUAK 2W6LA 1CPZA 4X64F 4KHQA 1UAWA 4JB8B 1VSDA 5E3RA 2AHOB 4EUVA 2RS2A 4HI2A 5LMUJ 1ZA2B 2OMLA 4CGFA 1RB0A 3UR0A 1TYQB 3L3UA 1IN0A 3MR5A 5ETOA 2P9KA 2VG6A 1VK8A 5LT5A 2XCPA 5M1KA 3SZ2A 2H3EB 4N56A 2D74B 4K2XA 1UL3A 4JKEA 1ESVA 1HWUA 4YS2A 4U7BA 3BQ2A 3P45B 4JI8J 1U6BA 2HNDB 3VHQA 2QWRA 3TJ9A 2VG5B 4F67A 4QIGA 3HHEA 2J7KA 1VQ9S 3ENQA 3IAM9 4QU6A 2UU9K 4LF9J 2HQGA 2EWHA 1VR6A 2R3VA 3AOCA 4NMLA 3EKUA 2NPFA 1UJ4A 3DOKB 4DF8A 1WOQA 2DFFA 4CJKA 3AGKA 2WAQD 1S1TA 5HMXA 4JI5K 3MEEA 5CAAA 5AQOA 4NEYA 1RA6A 4A62A 4XAKA 1JJHA 3C6TB 4C8ZA 5TKWA 3SDEA 4JD2B 2HW3A 3H2UB 3OYHA 1MU2A 3GCWP 4EAHD 5KOXA 1VC6A 1S49A 3UCUP 1U2VB 2CQCA 1XBWA 3W8GA 2RU9A 3OYJA 1YWXA 2CKWA 2DO4A 4CNYA 4ZVUB 1RBUA 4JK7A 5AQYA 1EQ0A 2FD2A 3UCZP 1VSHA 1C1CA 2B0GA 2W9BA 4CZHA 1S1WB 4IH5A 2KXHA 2FYXA 1T3VA 4NO7A 1WSVA 4AYBD 3OVBA 1GXTA 2CH6A 3HYFA 3VEXA 2XMAA 4LFAK 4XO0A 3ISZA 5IV3A 4K2JA 4OPKA 2Q0UA 1OY9A 2F8MA 3VQEA 2HNYB 4ECSA 4PWDB 3KUEA 2E5GA 5KFXA 4O44B 2ATLA 4DR5F 4NYFA 3TZXA 4JKGB 3CD6N 1SC1B 1FE0A 1O0PA 1U26A 1MG7A 2RDDA 3T6JA 4LF5K 1B7YB 4X4TA 3PRVA 3H25A 1KVBA 2YWEA 4NLYA 3W5XA 4X65J 2PFDA 1TUYA 5AQVA 1PSDA 4YHHJ 4C11B 2O8CA 2L08A 3HI9A 4YP3A 1Q5YA 4NYOA 4WF9L 4B1XB 4C8YA 3MMBB 3ILJA 3CCSS 2ALZA 2GVDA 3GIIA 1REVB 5IC6B 4FYYB 5IQ6A 4KJIA 4G6VB 1U2RA 4RWTA 4LFBF 1YJWS 1B0PA 3NFAA 3NAHA 4OZLA 2R7RA 3HZ6A 1QVGM 2QG9B 4OYWA 2NR0A 2CQ2A 4DR2F 2DD8S 4QOZB 3AVMA 1KSPA 3I55S 2QFIA 2WSCC 3GB0A 3HHNB 4F9OA 1RKJA 3CCEN 2BW7A 3DLGB 4CFBA 2J4RA 4I6AA 2I7PA 1LK7A 2KFYA 1UA0A 2QT7A 2C3YA 3ETMA 4ILLA 3DRPB 1RDRA 3BSOA 4DUZF 4L8RB 4ID8A 2OPSA 2E7VA 4QPXA 2QV6A 4Y0FA 4FM2A 4FWOA 3CIZA 4PCQA 2P5GA 4F0KA 1RU2A 4C6AA 3C7NA 4CF9A 3OYBA 4ALZA 2C2ZB 5BRDA 1U0HA 3AQPA 4C3MA 1RTIB 4CHYA 3ZSYA 4WIQA 2AV5A 1GH8A 3RMCA 4PZVA 3DI6B 2MZSA 3NBPA 2FBTA 3D3BJ 3OTDA 2HF3A 4USIA 1VQOS 2EK1A 1LAVA 3NGTA 1V4TA 2V4JA 3G82B 3M6XA 4ENOA 3N28A 5T7LB 1UVLA 3FSIA 1WWHA 2DRDA 3QNOA 2QEXS 3BGUA 3R97A 3AV9A 1TK8A 4PEOA 3OVSA 1YTUA 4UZBA 3OS0A 2JVOA 1IBLJ 2BANB 4WP3A 3K5OA 2PGCA 1P8GA 1EP4A 4RW4A 4KH4A 2AW0A 1G1XA 2HHSA 4JI1K 3LP1B 1U1OA 1Q5VA 3DDNA 5CH7B 1W7AA 5KFWA 1HQUA 1WHYA 5E33A 2JWKA 4YOTA 1N6QA 4YDUC 4BE1A 3CCJS 2B43A 3BKUA 2JJ4D 3KJVB 4M5LA 4GRSA 1DKGD 3AAQA 4CJVA 2PYLA 5G0RB 1FJGF 4W4MA 3OXLA 3TTDA 3VGUA 1EX4A 3K5PA 2HQCA 4KSEB 1TVRB 1HWLA 3T5JA 4IKFA 3THPA 3MCAB 5LJVA 4DR4K 3U9ZA 1N0VC 1PJ5A 3I5AA 3CQYA 1TUVA 4DV7F 4EK2A 3UB5A 1B99A 4OX6A 5U47A 2IVOA 2UXCJ 2FVRA 2FJBB 2BOPA 3SFUA 5E84A 3HOTA 3ZT2A 1G7CB 3QIOA 2ZM6K 2MQMA 1IKYA 2DPIA 1MNEA 4AT1B 3TR8A 2QSFA 3PIPQ 1I94K 4F3TA 1NKEA 1E4FT 4YORA 2KL8A 3HZEA 5EOYA 1K1SA 2EFPA 4U6PA 2CQ0A 3WQUA 1VSEA 2ZJQL 1PJ7A 5LJ5Y 2HBZB 3TUJC 4B17A 4QIEA 2MZJA 3BM7A 5FDLA 5C25A 1S6OA 2DNPA 3CD7A 4KFBB 2CG8A 4IH6A 4G1IA 4L3KA 4R8UA 2IVPA 3P38A 5AQUA 5E3CA 4CO4A 2RB7A 4RW6B 3TZYA 4L6V3 4CFDA 1BUPA 2YHBA 2NZCA 1S1UB 1JJCB 3D54A 2JFDA 3HVRA 4DV1K 4Z7CA 2LECA 3MN7A 4OYOA 5EWEA 4JI3J 5K8PA 2P9LB 2W2NP 3MPVA 1BMQB 5DQIA 1YXQA 1U6FA 2CNNB 3AVGA 2KJWA 4C9DA 3PVXA 4ED6A 3PW0A 1XNQK 3MDFA 2UUTA 3MTKA 1HI8A 3D3CJ 4JYAJ 3D9BA 3AOBA 3SI6A 5HJXA 3UIQA 3LWMA 4CIGA 2I7NA 1RTDA 3T1HJ 3ULEA 3D0GE 4E7LA 3VAMA 4WK3A 2HGLA 3H5UA 5M1OA 1KOOA 3VEYA 4X66K 3RAQA 2R2TA 2XYPB 1TU0B 4DTMA 4FS2A 4DQPA 4FKYA 4ZP7A 1GX5A 3WQTA 3CMEN 1AYEA 1RI7A 2QA4S 5CE3A 2CUYA 3M8RA 3MEGA 3BQ1A 2EFOA 5CXTA 5A0YA 4DL2A 3OD2A 4KH5A 3FGVA 1VQKS 3AGRA 4C8LA 2E4LA 2ZC3A 1YBTA 1YRTA 2IYGA 2AJFE 2CQPA 1Q18A 2M8DB 6FDRA 4RG8A 3O5TB 3ET6A 3B8AX 2B4OA 1RAOA 1SQEA 2ZJPL 2P9GA 4LSLB 1Q86O 4BY9C 5E3PA 3DLLQ 2VC1A 2E9ZA 2K8GA 2GQQA 5BYRA 3M8PA 1HD1A 3H20A 3OFEA 3CCVS 2DGUA 3VR1A 2FC9A 5IT9Y 4BRIA 2X6NA 1QE1B 3UN2A 5GADU 3HPOA 3W3DA 2PO4A 2QTWA 2BM0A 4Y0WA 3AA3A 3NGDA 2GHPA 3K59A 3CM6A 1NH8A 3RB4A 4LFCK 1JWWA 3F41A 3MR6A 3BSAA 2MZQA 2BJ7A 5B0GA 3QEPA 1CJUA 4GC6A 1KWMA 2QL5B 4FL9A 3D6FB 4QBUA 1UFLA 2EFVA 3K89A 2ZNZA 5F8HA 1NKCA 3S7RA 2GMHA 1PC5A 4K4UA 2HWHA 2GGPA 2OCEA 1RWUA 1S5JA 1BD6A 2RIJA 1U09A 2VQEF 1BL3A 1V3ZA 3GR1A 2Q1NA 1TKXB 4M7YA 1WTBA 5GAHU 3DWLA 3O3FA 4WF9Q 4JV1A 2VFTA 4OI4A 2VD3A 3EX7B 3I56S 1BWEA 1Q86T 5CZ2A 4CH7A 1JB0C 3HF5A 4LF7F 4DR6K 3B4DA 1MN7A 3AT1B 4V19J 1R6YA 4ZMMA 1LXNA 3K2YA 1S22A 4H54A 3GIKA 2OPRA 4W5TA 2M88A 5C24A 3H46O 3GMGA 3NS6A 1BY9A 5M2RA 3TABA 3WNHA 7AT1B 2IC3A 4KPYA 1XR6A 2M8HA 2J8AA 3EZ5A 4KI6A 4KQZA 1KAYA 4OO1J 1HNIB 1RWNB 5GINA 1YX2A 1VSMA 2QLXA 1RT1B 2ZH7A 5BREA 4KE5A 3AJ1A 4PL8A 2EKNA 1X0PA 1Q4RA 5HQMA 3THVA 3NH2A 1SJ1A 4FPBA 3LANA 1GTEA 2DYAA 4ELUA 3GL1A 3CCUS 2ZZTA 1WC3A 3W9JA 2ZDOA 2BJDA 3JS6A 1J2VA 4MLEA 1NDPA 4DHYA 3G86A 3CM5A 1T9YA 1RT7A 1X4BA 4NB4A 4YY3J 4Q8EA 3VF0B 4DOZA 2OTJS 4A57A 1JKHA 2FUG9 2VHGA 1TUGB 4G1PA 3LWLA 1BQNB 1WEYA 8AT1B 3CC4S 4FWRA 3D0PA 4PG5A 3J7ZO 1RTZA 2DB1A 1JL1A 5JS1A 1SIWB 4B02A 1S0NA 3DAWA 3QIPA 4DV0F 3T19A 2O8FA 1TP7A 3DOMB 2K3KA 4FXWA 2BA9A 2JL9A 4Z4GA 4C98A 2LXIA 4CM0A 4JI4J 3ID8A 1VQNN 4LIRA 4FLZA 3RRGA 1FESA 3G71N 5A2QO 4FZZA 4XH1A 1SJFA 4QR2A 3G6VA 4UQTA 3OL9A 4DXLA 1YI2S 4I2PB 1VJWA 1H74A 1FKPA 1LEOA 2W2MP 3ZTRA 3CC7N 2UXBF 4H5VA 4QYZJ 4X64K 3CE8A 4IH7A 3MK6A 2V63A 5DQHA 4FLWA 1WD6A 3KXDA 3R8EA 4XDDA 2YNHA 4FP9A 1Q0NA 4WQ4C 2YKQA 2QWPA 3W3SA 4ANEA 3H4BA 4FZYA 1JLAA 2V51B 4KAIA 3HOSA