1IKYA

Hiv-1 reverse transcriptase in complex with the inhibitor msc194
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikyA05
4XPCA 4DQIA 1J9AA 1ZBUA 4FJMA 5L9XA 1RT7A 1MU2A 3V1RA 1GX6A 5E41A 2HNYB 3D0PA 4E89A 3KK3B 2ATLA 3NF6A 4OVLA 1TL1B 3EZ5A 2XCAA 4IFYA 2IAJB 2XRIA 1J53A 4FLTA 3PY8A 4ECSA 3NDKA 1RTHA 2O4IA 4CJSA 1TAQA 3G6XA 3L3VA 3VQ9A 3QLHB 2YKMA 4H4OA 5JS2A 2ALZA 1KFDA 3TAPA 2R2TA 2OPSA 3KLEA 3RR8A 1I6JA 2D0BA 3AV9A 3M8RA 3U3GA 3LP0A 3HVRA 1T8EA 3HHKA 3SUQA 1T05A 4IKAA 4F4XA 1J54A 4F3TA 3I0SA 3SCXA 4XO0A 5KG7A 4L8RB 5KFPA 2D7SA 2R8KA 3SQ4A 2QKKA 4MFBA 3H2LA 4H54A 4GC6A 4E7LA 3QEIA 3CJ0A 2B4JA 1U48A 5HLFA 3SZ2A 2RKIA 4FLZA 4R5PA 4FYDA 3IAYA 3C6TA 2DFEA 4WYWA 3PZPA 1NK5A 2HAIA 1BCMA 4QW9A 1IKXA 3DLKA 1NK4A 3CM5A 3RRGA 1EKEA 3G6VA 3IS9A 4ZP9A 3NL0A 1BI4B 2RF2A 2ASLA 4F50A 3H5XA 4CGIA 3TARA 3P5JA 4DTOA 3VQ6A 4PWDA 2B5JA 5DG7A 1S9GA 4KHQA 1T03A 3DM2A 1SL2A 5L1LA 3QERA 3KLFB 1YT3A 1RA7A 4CF9A 4AH9A 4WE1A 5DLGA 3FFIB 1WSGA 4OKEA 1HYSB 4Q45A 1IO2A 1XHZA 4MIBA 2YNGB 3V4IA 3PW7A 3ZSVA 4NLVA 4DU1A 3IRXB 3CJ2A 4C8NA 4DQPA 2V4RA 3ZSQA 5KFVA 1FK9A 4KHMA 3IGNA 2A1RA 3CJ5A 3TVKA 4CK2A 4DTPA 4ZTFA 4NLDA 3JYTA 3VQ7A 3OHBA 1X9WA 4DL2A 1JLQA 5KG2A 3KLIA 2WK4A 2R8GA 1S49A 5KG0A 3LDSA 5F8NA 4ECXA 3MECA 1RT6A 5CYQB 4Q0BA 2JC1A 4ID5A 3K59A 3AO3A 4HUGA 2VA3A 4IFVB 2BE2B 3UIQA 1D5AA 4O5BA 4TY8A 4B9UA 1JLBB 5L1JA 1BI4A 3SV4A 1XC9A 3BSNA 3SJJA 1S1TB 3ZT3A 4CFAA 4OPKA 5F8GA 4E7IA 2WOMB 3DI6B 1NK9A 3V6HA 3QO9B 2W8KA 2FVSA 4O3NA 2ILZA 4KHSA 1J5OA 1JLEA 2OZSA 3C6UB 4B9SA 3H59A 3NCIA 4W5OA 3F9KA 3PR4A 3EZUA 1ZBIA 5C25A 3QINA 1JLGA 1F21A 4CCHA 3EPGA 4TQSA 4G1QA 4UQGA 3VA0A 3M8SA 1D9FA 5J2QB 4O55A 5F9LA 1JLAB 3QIPA 3I5CA 3PUFA 5KG1A 4KHWA 1RT1A 3LAKA 5L1IA 4RNHA 1L3SA 3CQ8A 2KZZA 1SV5B 3TAMB 4CEZA 4LSLA 1TK8A 5KFQA 1S6QA 5HBMB 4CEQA 2VG5A 4BDYA 2D0CA 5HP1B 1HNIA 3M9MB 1O1WA 2W9BB 2YHBA 4J9KA 3V6DB 4CF2A 3L2RA 1RDRA 4NLQA 4KTWA 1N6QB 3IGVA 4DSJA 3TR8A 4CFCA 5SZTA 3KHHA 4MK7A 4F4ZA 1ITGA 5DLFA 1TVRA 5DK5A 4MQ3A 2UVWA 3LP1B 3WNEA 1FKPA 3G86A 3HSTB 4BWJA 2YHAA 1TKZA 4N47A 4KO0B 3PX0A 1RYRA 1HNVA 3VQEA 4FLYA 3JSMB 4ZMMA 4DQSA 1ZBHA 1TAUA 2IC3A 4NCGA 1U09A 1RBRA 3OJSA 2CKWA 3RB3A 1N5YA 5CYMA 3M9NB 1S6PA 2I1RA 4DTRA 4N56A 2I5JA 4RNMA 5EWFA 3I5AA 1NKCA 1DLOB 1S9EB 5HROB 4WXWA 1YTUA 2G8VA 4CEDA 1S1VB 2XY7A 3KD1E 3PVXA 1ZTTA 3SFUA 2XHBA 5DMRA 5FDLA 1KTQA 4HVJA 4J9OA 3TAMA 3RBEA 1SUQB 2V0NA 2ASDA 4HUEA 1BQMB 1NOYA 1TK5A 4O3OA 1RBSA 5KFDA 1IG9A 3O4NA 4FW2A 4OGEA 4F8RA 1LWEA 5HRRA 3T5LA 3NGYA 2DFHA 1NHVA 2XCPA 4FJXA 1WNEA 1C1BA 2HVIA 3MR3A 3T5HA 2HHQA 1QHTA 1VSDA 2IJFA 1RDCA 2D3UA 4CHQA 3PX4A 3H4DA 1S1UB 3N6MA 3TWHA 3V9WA 3LZIA 3LP2A 3KJVB 3A2FA 3KMQA 3GIJA 4RU9A 4K4WA 4ECTA 1QQCA 4NYZA 3HVWA 1KHVA 1S10A 2Z1HA 2PY5A 3IG1B 5KFHA 4DQRA 3KNAA 3MEDB 4C8MA 4NLOA 3BQ2A 1QE1B 4DSEA 5K14B 5C5JA 5EU7A 5CZ1A 2ZE2B 3D45A 4OGCA 1IKWB 4EP4A 4O44B 3KK1B 1S1VA 3OYAA 3V1OA 3QEPA 2IM2A 1TGOA 3HVTB 3DRPB 2AGOA 2J6UA 1QSLA 4I2QB 3HK2A 1XR7A 5KFZA 3GILA 3P1GA 4M94A 3UDLA 3ITHB 3P83D 4ICLB 3OJUA 5J2NA 5L1KA 5DQHA 4DF4A 2R2RA 4LQ9A 3M8QA 3DYAA 2FBXA 1WSFA 2OPPA 2UVUA 3MEGB 4OLAA 3AVJA 5DQIA 2KFZA 3GV8B 1UWBB 4M3RA 4FK2A 4IG0B 1FXXA 4KKOA 1YTAA 4CGJA 2XY6A 1S1XA 2VWJA 2GV9A 4J9RA 2FVPA 1EP4A 4PQUA 4ED6A 2OYQA 1RT2A 4CEOA 3MFHA 1HYVA 4ZHRA 2V4QA 4IDKB 2ZQBA 3AVMA 4E3SA 2F8SA 2JEJA 1EETA 3OYLA 2Z1GA 3OYIA 2G8KA 5DG9A 1BQNB 1QTMA 3KD5E 3V9SA 2G8HA 2G8FA 5KFUA 4I7FB 1L3UA 4Z4EA 3ZSYA 3GIKA 1S4FA 4CJRA 4FJJA 4MH8A 4M3ZA 4CJLA 4TXSA 2HMIA 4FZYA 3OY9A 4Y1DA 1RBVA 2IS3A 3HP6A 3E01B 1RT5A 1DTQA 3NBPB 4O0JA 1LWFA 5KFWA 1KLMB 3T5KA 1A5WA 4NYFA 3BDPA 4CHNA 4Z4CA 3KK1A 1TKTA 4DSKA 2WTFA 4IRCA 1C0MA 2ZD1A 4I2QA 1D1UA 1LW0A 3AA5X 4DFKA 2OPRA 4KFBA 4ECZA 4FS1A 5HRSA 1N56A 5FRMA 3DOKB 5F9NA 3DMJA 3FSIA 5KFGA 3MFIA 2DPJA 1CXQA 3OYJA 4FJKA 5KFRA 5D3GB 3QESA 4CEFA 4ZP8A 4K4XA 1RT3B 2GUIA 5KT3A 2VG7B 4LSNA 1GOBA 1JLFB 4EZ6A 2KFNA 1BL3A 4FK4A 1T94A 4M3XA 5SWMA 1JKHA 3FDSA 1TV6A 4O3RA 4JV0A 4FZZA 2HNZB 4KTQA 4DFMA 4URQU 3SNNA 4NLRA 3L8BA 4CJQA 4JV2A 3G0ZA 1IKYA 2OA8A 1FKOB 3V81A 4ECQA 1X1PA 3OS2A 3S3MA 4DG1B 3V1QA 3UR0A 4I7FA 3RB4A 2HWIA 3WNHA 4H4MA 3CWJA 1WSEA 5EWGA 1ZTWA 1RCHA 2IMWP 4CFBA 1RDBA 5J1EA 4EYHB 5J2PA 4OKKA 1NK7A 3AVNA 4U6PA 4IQXA 1TKXB 3DRRA 2X78A 3QETA 2XGPA 4CGDA 3QGGA 4ID1A 1NK6A 1NOZA 4DL7A 3UQSA 1ASUA 1WAFA 4QAGA 3THVA 2IOCA 5KFEA 3AVKA 3QIDA 4NYNA 1NK0A 1C1CB 2PYLA 3FQKA 3VQPA 4KRFA 4JLHA 3GIMA 3PW2A 1D9DA 3M8PB 4LH5A 4KHRA 3BQ1A 1UAXA 2B6AA 3DDKA 1REVB 5I42B 4K4ZA 3OYEA 1CXUA 4RW6B 4K8XA 4XIUA 2W9CB 4M95A 2WONA 2YNFA 4ZVGA 2DFFA 4YNQA 4B3OA 4KV8B 5C24A 2AGQA 4DLGA 2BRKA 5KFFA 4E1MA 1KCFA 1RTJB 4CJEA 3SPYA 1HPZB 4E0DA 3DLEB 3OLAA 4DTMA 3NHGA 4ZPDA 4FJIA 4ZTJA 4E1NA 1QSSA 4ZPBA 4AHUA 3Q8RB 1N4LA 4FJNA 4CJPA 2E6LA 4NLTA 3RWUA 4NCAA 4IG3A 2XI3A 4ELTA 3K5LA 3ISNC 1S5JA 4CF8A 3LPUA 4HYKA 3PV8A 1NK8A 2AX1A 4FJ9A 4C8KA 1RTDB 4EYIB 5JXSA 2KQ2A 2HNYA 1NHUA 4Y2CA 1I39A 3KLHB 3KK3A 4FLVA 2FJWA 1TL1A 3KKRA 3T1AA 4TYAA 1K1QA 3AVIA 2IAJA 1QUVA 1UA1A 2BQRA 2OH2A 3AO4A 3OYNA 1NJWA 3SI8A 1LV5A 2P51A 5KFOA 4HCBA 3AVGA 4EBEA 4DMNA 4YMEA 3L3UA 1KVBA 1WSIA 2OPQB 3DOLB 3CJ4A 1B9DA 1RDAA 3KK2B 3VQ4A 2WB4A 4CECA 2HNDB 1RT4B 4FBTA 5KFYA 4ZVEA 3QLHA 4RG8A 3NH1A 3PW5A 2WHOA 4CGFA 4F3OA 3SV3A 4QCLA 3OYFA 4BACA 4KAIA 3DLEA 3QEVA 1S9FA 1VSKA 3EY1A 3AA3A 1LWCB 3DLRA 1X9SA 5KFLA 1D8YA 2WRMA 5EDWA 3L2VA 1XR5A 4RW7B 1IKVB 4PUOB 2QE5A 5KT4A 3K5NA 1I3AA 4NCBA 3B6OA 3RAQA 3EPIA 3HL8A 2IM0A 1MMLA 3I8DA 5FRNA 2FBVA 4CE9A 1C0TB 4DU4A 3BGRB 3NH0A 3HPHA 4FJ7A 3BQ0A 3MXIA 2KZMA 3OL8A 2IBKA 2DPIA 4KHUA 5EWEA 4FVMA 1ZBFA 3MR5A 5KGWA 4DSIA 4CHZA 1NJYA 4CK3A 4IH7A 1VSFA 4E19A 1SH0A 4KB7A 2FC0A 1KVAA 3KLFA 2B43A 3LWMA 2YNHB 3H4BA 3FFIA 1HARA 2AGPA 2BQUA 3K5OA 1HYSA 2YNGA 4IRDA 1NJZA 4J2DA 3LPTA 3IRXA 5F8HA 4RNFA 4IRKA 1KVCA 4JRQA 2ATQA 4B9MA 4O0IA 4RW8B 1IH7A 2FVQA 4WXOA 3GQCA 1EXQA 4HHTA 4KBIA 1LAWA 1HMVB 2C2RA 1SKRA 1HYZA 4BE2A 1DTTB 5DGAA 5CYQA 1A5XA 1JLCB 2VG6B 4IR1A 4QOZB 5I3UB 3OS1A 2ILYA 3ZSXA 3HYFA 4OL8A 3DLGB 2J6SA 4IFVA 2BE2A 3SPZA 3KLGB 4LH4A 4FK0A 1S97A 3GV5B 1JLBA 3C94A 2E9TA 4J9LA 5KT5A 1S1TA 3T5JA 1HQUB 2FLLA 3MR6A 1SKSA 3KKSA 3S9HA 1C1AA 1UA0A 2WOMA 3DI6A 1LW2B 3QO9A 3TI0A 2RN2A 3K2PA 2P1JA 3WNFA 2KW4A 4FZXC 4J9SA 3C6UA 2YNHA 1GOAA 1L5UA 4LD0A 5KG4A 2GC8A 4FJ5A 4ZP7A 4K8ZA 1W0HA 3NGIA 1Q9XA 4BE1A 2QXFA 2JC0A 3OHAA 5J2QA 4Q5VA 2F96A 3VA3A 4RW8A 1JLAA 4IOBA 1ZBLA 4EEYA 3CFRA 3E51A 3O4QA 2YKNB 1C2PA 3QEWA 2F8EX 1BISA 1SV5A 2G8WA 1RILA 3QZ8A 4KHYA 4DWIA 1JXBA 5HBMA 2DY4A 4MKBA 1K1SA 3SUOA 5HP1A 4C8OA 1HQEB 3V9XA 2VG6A 2W9BA 3RMDA 3V6DA 3VQDA 4AHCA 4RW9B 4LY7A 5KI6A 1BHLA 4DL3A 1SKWA 1N6QA 4CESA 2AQ4A 4M3WA 3LP1A 2D0AA 3CDUA 4KO0A 1C6VA 4N41A 5C42B 1L3TA 3JSMA 1QAIA 1VSEA 2Y1JA 5J2MB 2VA2A 1OS5A 5F8IA 3AVLA 1VRTB 2ETJA 3VQCA 3OVNA 3SQ1A 1ASVA 3B6PA 3MF5A 4AHVA 4BE0A 3MXMA 4DS5A 4AHSA 3RMCA 1DLOA 1S9EA 5HROA 2R8IA 3AVCA 3VQAA 3LAMA 3VN5A 1TP7A 2JGUA 3ZT0A 3LALA 3I5BA 2R2SA 3C95A 3CJ3A 3HVAA 2PZSA 5KFTA 4AHTA 2YKNA 4Z0UA 4Z4GA 3ZT1A 1U4BA 1SUQA 2HHUA 1BQMA 2P5OA 1ZETA 4ED7A 3QGHA 5KFAA 4X2BA 2F8TA 4DSFA 1Z26A 4I2PB 4ECYA 3OYKA 4TSXA 3BSCA 3KLVA 1VSIA 1S1UA 4DU3A 1G15A 3KJVA 3FQLA 2HHWA 2BANB 1U04A 4CJTA 4O3QA 4FCYA 1VRUB 1VRTA 4DSLA 3CFPA 4PY5A 2YV0X 3QNNA 3IG1A 1B92A 3MEDA 1QE1A 5K14A 4DS4A 5KFSA 4OLBA 2YNIB 4CJUA 4QWBA 4B9LA 3G6YA 2ZE2A 2PYJA 4K4UA 3SYZA 3HPOA 3DRSB 1IKWA 3PJWA 4O44A 4O4GB 2EHGA 1RTIB 4B8AB 5KGXA 1S1WB 3DRPA 3HVTA 5CZ2A 3OYCA 4H8KA 4FLUA 2KTQA 3D5MA 4RW4B 3SQ0A 1RYSA 2WCXA 2BDPA 4J9PA 4RZRA 4R8UB 3ITHA 1CSJA 3GV7B 3NGDA 3VQSA 1Q9YA 4CFDA 2C2DA 4ICLA 1W25A 2FBTA 3ZSOA 4YFUA 4K4YA 3NMAA 4EBCA 2X6SA 1KFSA 3ZSWA 3MEGA 1RT7B 1MU2B 3O3FA 5KG5A 1UWBA 3ISND 3KHRA 4IG0A 4ZP6A 1CZBA 3QIOA 3NE6A 1LAVA 4KI4A 4IFYB 5DG8A 4Z4HA 4W5RA 1NKBA 2HWHA 4CJFA 3EYZA 3MXJA 4J9NA 1TKDA 4IR9A 3NF9A 3ZT4A 3WNGA 2JEFA 4IDKA 1RTHB 2AJQA 3SFGA 4K4SA 1WLJA 3PR5B 1VSMA 3TAGA 3H40A 1BQNA 5KFJA 1YVFA 2YKMB 4H4OB 3BREA 1JXLA 2OPSB 3AVHA 3KLEB 4OPJA 3DLBA 3LWLA 4CHYA 2YNIA 3E01A 3LP0B 3NBPA 1KLMA 3HPGA 4CJVA 2GIRA 3TANA 1T05B 3H5YA 1WNSA 4HCCA 3OLBA 1CZ9A 3I0SB 1TL3B 4FM2A 4B8CA 3OS0A 1QSYA 2HHSA 4MFBB 1Z25A 1TK0A 2BRLA 3K5MA 3HM9A 1K6YA 4G3IA 1VSJA 4CF1A 4ZVHA 3V6JA 4CERA 2IM3A 3PW0A 4DTNA 3RB6A 2O5DA 5KT6A 3DOKA 5HLFB 4WFYA 3VQ5A 4FJHA 4JS4A 2RKIB 4J2AA 4B9NA 4R5PB 2R2UA 3C6TB 4CIEA 3NAIA 3FRZA 5D3GA 4ECRA 4YR2A 3NAEA 1IKXB 3DLKB 1RT3A 2VG7A 2FJVA 5KFXA 3MAQA 4O3PA 5KFMA 2R8HA 3IS9B 1JLFA 2RF2B 3T3FA 3ZSRA 4JRPA 4PWDB 1EX4A 2B5JB 5JS1A 1S9GB 1T03B 3BJYA 3DM2B 2HNZA 1JXEA 4E7JA 3Q8SB 4DQQA 1R0AB 4TY9A 1BCOA 1FKOA 4WE1B 1RNHA 4CEEA 4CJ5A 4DG1A 4Z4FA 4K4VA 3V4IB 2RDIA 5KFCA 5F8JA 1NNDA 4HUFA 3NAHA 3RMAA 2A1SA 4DFJA 5KG3A 1FK9B 4DF8A 2FVRA 4FLWA 3MTKA 2BR0A 3CFOA 4WYLA 1TKXA 4ED3A 5KRSA 1U49A 1JL1A 2C2EA 4FM1A 2HW3A 3JYTB 5KRTA 1TL3A 1JLQB 1ZYQA 3KLIB 4KPYA 3KHLA 4ECVA 4QWDA 4FW1A 3MECB 2IGIA 3U6FA 1RT6B 4Q0BB 5DGBA 1U47A 4ID5B 1C1CA 4CHPA 4WFZA 3CIZA 4FXDA 3M8PA 2C28A 1XHXA 1QAJA 4Y3CA 3AA2A 4TY8B 2NUBA 1REVA 5I42A 1GOCA 4RW6A 2W9CA 4XPEA 4NLWA 4ED1A 3ZSZA 4CGHA 3K57A 4EP5A 2HVHA 4KV8A 1RTJA 2W9AA 1R0AA 2UVVA 3HXMA 1HPZA 2W8LA 1J5OB 1JLEB 3V9UA 3RAXA 1A5VA 3BSAA 1GX5A 2AX0A 3F73A 1KRPA 4O4RA 3KHGA 2G8UA 5C25B 1JLGB 3H5SA 2O4GA 4G1QB 4RNOA 3LZJA 3TABA 2Z1JA 2J6TA 4I9LA 3ZCMA 3IN5A 4ZPAA 4TLRA 3NF7A 3VQQA 1XWLA 4Y1CA 3QIPB 3T19A 3M9OB 1IM4A 4HKQA 3CDWA 4Q8FA 1RT1B 4EO6A 5F8MA 4ED8A 4R0EA 1RTDA 4OJRA 4LSLB 3UPFA 1S6QB 4DL5A 3KLHA 4NLGA 4RUCA 2VG5B 3NFAA 3L2WA 1HNIB 4F2SA 4NRUA 4KE5A 4J2BA 4WFXA 2G8IA 2QV6A 1UOCA 4TYBA 2E4LA 2W7PA 2FLPA 3TAFA 2XC9A 3KOAA 3VQ8A 1S0OA 2JLEA 5KTQA 2JEGA 2OPQA 3DOLA 1TVRB 2IJNA 3MEEB 3KK2A 1FKPB 2HNDA 3QYYA 1RT4A 3AO2A 4M3UA 1TKZB 4W5TA 4CHOA 2IA6A 3OYGA 1HNVB 2IM1A 1HJRA 3AVAA 3CYMA 5T7BA 1JX4A 4IBNA 4YR3A 2IC3B 4NCGB 4DTXA 5DQGA 1N5YB 4Y34A 2R8JA 5CYMB 1S6PB 1JIHA 3HKWA 4NRTA 1LWCA 2ZKUA 2I5JB 3NH2A 2AWZA 1ASWA 4Y2AA 2HHXA 1SH3A 3I0RB 4BDZA 3Q8QB 1T3NA 3O3GA 1XI1A 4RW7A 4K50A 3V9ZA 1IKVA 4PUOA 2W7OA 2R7YA 2E6MA 3HP9A 1SL0A 3H98A 4M45A 1XR6A 3RBDA 2XY8A 2RDJA 4Q44A 3N6LA 5FDLB 4FJLA 4JUZA 1RBTA 1C0TA 3OYBA 3BGRA 1D0EA 4GW6A 4DTJA 3HT3A 4IKFA 2UVRA 4CIGA 2V9WA 2Z1IA 1LWEB 1BGXT 1C1BB 1YVUA 2HB5A 4NLPA 3DLHA 1T7PA 3MEEA 4WZQA 2E9ZA 4F2RA 2X74A 4CEBA 4FLXA 3LP2B 4URSA 4F4WA 1VSHA 4N76A 4FS2A 3AA4A 4NZ0A 4YQWA 4GC7A 1L3VA 4B9VA 4W5NA 1S0MA 4ECUA 4CIFA 1X9MA 4YR0A 4URGA 3PHEA 5JUMA 2QK9A 4KHNA 3L2UA 1HMVA 4EZ9A 1VK0A 3OL9A 2FBYA 3QNOA 4QWEA 3LANA 3I0RA 4LQ3A 2BQ3A 4DEZA 5KT7A 1DTTA 4MK9A 5KFNA 4CF0A 1JLCA 2VWKA 4EO8A 2JEIA 5I3UA 3Q8PB 4E7KA 4KREA 4QWCA 3DLGA 2GIQA 2XO7A 3KLGA 5J2NB 5KG6A 3LP3A 1S0NA 3M8QB 3DYAB 1WSHA 5KFBA 2ITGA 3SUPA 4KB1A 4MK8A 2OPPB 2XY5A 1WAJA 3VQBA 3OSPA 1HQUA 4NLSA 2X6NA 4GMJB 5HRPA 2CJQA 4KKOB 3QGIA 1LW2A 1S1XB 3KTQA 3V6KA 1EP4B 4PQUB 1RT2B 1BIZA 4DTUA 4KI6A 2AU0A 4I9QA 3TAQA 3KMSA 1Y97A 3RB0A 4ZHRB 4WZMA 4CEAA 3AO1A 4M41A 4CJWA 1EETB 3OYHA 2OZMA 4CJ3A 1RDDA 3ULDA 3PO5A 3PJXA 4FJ8A 2DTUA 4E7HA 4N5SA 3OYDA 2FLNA 1KLNA 1CLQA 4J9QA 2HMIB 1U45A 3RR7A 1RT5B 2UUWA 3CO9A 1RBUA 4Z4IA 1DTQB 1LWFB 3NF8A 3S3OA 1VSLA 4BDPA 4DL4A 1TKTB 3TAEA 4C8LA 4EBDA 1HQEA 4YP3A 2ZD1B 2FJXA 4F4YA 1LW0B 4DLEA 4TQRA 2OPRB 4KFBB 4RW9A 4OKJA 3OL7A 2QKBA 5T14A 3MR2A 2UUTA 1C0UB 4DFPA 3DMJB 1QS4A 3OYMA 3HO1A 4M3YA 4HTUA 4CJ4A 4IH5A 3BR9A 3AVBA 3SI6A 2D3ZA 5HRNA 4LSNB 3QEXA 5C42A 3RMBA 1B9FA 4B08A 3KIOA 5F8LA 4KAZA 4F4KA 3SUNA 5J2MA 4TN2A 1JKHB 3H5UA 1KSPA 1TV6B 3TQ1A 4JS5A 3D28A 3RRHA 3BSOA 5KT2A 4ELUA 2D41A 4W5QA 3U3YA 1IKYB 3V81B 1S48A 4RUAA 4IH6A 3CG7A 2GBZA 2Q3SA 4KTZA 4J9MA 3L2QA 4Q8EA 1HRHA 4CK1A 2D5RA 2Y1IA 1SH2A 1TQLA 4J2EA 3CVKA 4H4MB 1KHWA 3S3NA 1WSJA 1SL1A 4KB0A 4ECWA 2EC0A 4MIAA 3ZT2A 5J1EB 4K4TA 5J2PB 4GVMA 3GYNA 4QW8A 2XWYA 2XGQA 3DRRB 2IDOA 3O3HA 3N6NA 4ZVFA 4AHRA 4CGGA 4JV1A 4FBUA 5FROA 3ICLA 4NLXA 3RTVA 4FJGA 3PO4A 4DTSA 4NLYA 4DL6A 3NGZA 3AO5A 4M3TA 4ED0A 4I2PA 3OSNA 3AVFA 1C0UA 2E9RX 3K58A 4ZPCA 5CY4A 4RNNA 4KSEB 3GIIA 4MKAA 2EX3A 4CJKA 3G10A 3PW4A 4ED2A 4QPXA 2ASJA 4B9TA 2B6AB 4PA1A 4U7CA 3ASMA 2BANA 3PX6A 1JL2A 4O3SA 1RA6A 4Q43A 1WN7A 2WONB 3ALYA 2YNFB 1VRUA 1RAJA 3CM6A 2C22A 4B3OB 4NLUA 2LSNA 1Q8IA 1W9HA 5KFIA 3HJFA 5C24B 2P5GA 1NJXA 1NKEA 5KFKA 1N48A 1BIUA 2HHTA 4ELVA 4BWMA 3DRSA 3QZ7A 3CDEA 2FVCA 4AILC 4O4GA 2RPIA 2XI2A 3OL6A 2W42A 1RTIA 3H08A 1S1WA 2HHVA 3NKYA 4FM0A 4RW4A 4IG3B 4M42A 4QWAA 5EUHA 4R8UA 1Z4UA 3SQ2A 2BGGA
chains in the Genus database with same CATH superfamily
4GVLA 4DQIA 2O1PA 1J9AA 4CH1A 5M1OA 4ETXA 2U2FA 1CULB 1RT7A 5L9XA 3AAPA 3B8HA 1GX6A 3WC2A 3VR1A 4JKCA 3D0PA 4CIOA 4E89A 2B8PA 1TL1B 1MG7A 2Y1RI 1NGBA 4I67A 2IAJB 2QWQA 7FD1A 4JI3J 1J53A 4FLTA 2CQGA 2AP1A 4O8UA 1QVGM 4RUHA 4UY85 1MMDA 3J7YP 3G6XA 3ULEB 2PC6A 3VQ9A 2P9LA 3OW2R 2ALZA 2G4BA 2R2TA 1FFWB 5E3AA 2D0BA 3QPIA 1URRA 2N4DA 2J7KA 4PG6A 2RMLA 1NJIT 3SUQA 4H5WA 1T05A 1IQZA 4IKAA 2P6TA 5IS2A 4F4XA 2LQ9A 2CJKA 2K7JA 4BGBA 3I0SA 4GKJF 3SCXA 4DV7F 4XO0A 4YOXA 2MY8A 2C3MA 2QKKA 2PFDA 1DBDA 4FNIA 2P9SB 3J7AP 3W64A 3QEIA 5LT5A 1Q7LB 1WB9A 3SZ2A 3PKYA 2MHNA 2VYPA 3OXFA 5AZJA 1HBMB 1H0HB 2A5XA 1T6CA 3DLKA 3CM5A 2OIHA 5JVGL 3G6VA 3NL0A 2DNZA 1BI4B 5AE1A 2YH1A 3H5XA 4CGIA 1U26A 3S7RA 5E3QA 1HR0J 3VQ6A 4NXMK 4JKBA 3R5CA 4BRIA 4DR7K 3DRYA 5L1LA 1QVGR 5DDOC 2LXUA 2MYFA 2DIUA 3KG4A 3VVTA 3MN5A 3PIOL 3UN5A 4OKEA 5I9EB 1LK7A 2OLWA 2A6AA 1XHZA 3V4IA 1IBKJ 5D0HA 4JI5J 4IEIA 3J81O 1VRQC 4C8NA 2VBZA 1PJ7A 3ZSQA 3IGNA 3TVKA 2QRRA 2VDHA 2QM1A 1JLQA 4PKGA 2R8GA 2LECA 4WIIA 5KG0A 3OFEA 4IOAL 5AR0A 5F8NA 1WELA 3MECA 5A2QY 5CYQB 4U8VA 1OO0B 1RWPB 2SXLA 3L9ZA 3C15B 5CYJA 2VA3A 3DKDA 5CD4A 3UIQA 1K8KB 4O5BA 1OPIA 4B9UA 3I6PA 3FZBA 2V2VA 2NPFA 3MUMP 4LF9K 5L1JA 2DHXA 2KO1A 2OKQA 5IM0A 4MO4A 3WIVA 4OPKA 5F8GA 1SJQA 3QO9B 4FN5A 4KHSA 3AQPA 1Q82O 4MYUA 1W2BM 1F5CA 1FVQA 5EVZA 3QAEA 4IO1A 3J8AA 4DUZK 1JLGA 1F21A 4XTTA 4EIAA 2GGPB 1HKBA 3HOTA 3LDPA 4GRSA 2JX2A 2CPIA 5LMNJ 3D6TB 3PM9A 1WEXA 2DNLA 3QT8A 3EJMA 5J1PA 4RNHA 2KZZA 1P90A 3TAMB 1T11A 2GMJA 4FP9A 4YDUA 2LDIA 2HIYA 2PIIA 2W9BB 1IBLK 2RSQA 3K9JA 2CNOB 3PYEA 4UZBA 1RE1B 4NLQA 3MM5A 3PRVA 1N36J 4H5VA 4MK7A 1TVRA 5DK5A 2IVPA 4EFAC 4WQ4C 1N34K 3G86A 1TKZA 2H9ZA 4CLUA 4KO0B 3BEGB 2V7YA 1HNVA 4ZPWR 5M2RA 2MJNA 4FLYA 1FJEB 1AROP 1J5EF 1VJWA 1TAUA 3ZXWA 2KXFA 1RBRA 3GFZA 2E1AA 4LSZB 1W2BR 1VR6A 5LXRA 4GKKF 4N56A 4DV3J 3FRYA 2Z8QA 4Q2MA 4WBFA 5HROB 5FLXU 4WXWA 5ITHA 3MD3A 1LEOA 2H4WB 2LXIA 1YBTA 2XY7A 4YUDA 4K2JA 3MMJA 4EAHD 1ZTTA 1HX1A 5DO2A 3SFUA 2DITA 2XHBA 1KTQA 1R8PA 2HQGA 4NZ7A 1TK5A 5G0RA 1DAXA 3IC1A 3X1LB 4BREA 5AQLA 2Q0UA 3M1VB 1LWEA 4C3KA 1HBNB 2BJ9A 1NHVA 5FIIA 1KQFB 1AFJA 1QZ6A 2HVIA 3N9UC 2HHQA 1QHTA 1UJ5A 1HWLA 3LP2A 4ZLJA 3J7AN 2W2NP 2VFRA 2XMWA 4RU9A 5D78A 1GLFO 1QQCA 1KONA 4LFAJ 1PYTA 1IVZA 2C3OA 1KHVA 1WSRA 2L9WA 1H3DA 3KNAA 2IBOA 1FW6A 2GEMA 1QE1B 5K14B 2XHWA 1IWAA 3D45A 3BBCA 4WP9A 5B09A 3W8PA 5IT0A 4U67L 4O44B 3QEPA 3KUHA 1TGOA 3DRPB 1QSLA 2Q3PA 3HK2A 2V2ZA 4NA2A 3GILA 2QWRA 3UDLA 3GL1A 2BJ8A 3ITHB 1N33J 1SJ3P 1I94J 5J2NA 4EGLA 3IWNC 1WSFA 3VETA 1EHWA 3VOVA 3TTDA 3DU6A 1H1VA 3W5XA 4PPZA 4PG8A 3DJCA 4L75A 4CEOA 3MFHA 2V4QA 4IDKB 3HHEA 2ZQBA 4KGXB 4A59A 3OYLA 1QTMA 1RAIB 4DR2F 3EGWB 3K89A 3TVYA 3NG8A 4WFNQ 5EOYA 5KFUA 1FXRA 1WOSA 1HI0P 3OY9A 3JSYA 3HP6A 1R43A 3NLCA 1DTQA 3NBPB 2FJDB 4OV6A 3VAHA 3FSYA 4X4PA 1A5WA 4NYFA 3BDPA 4Z4CA 1WOOA 3D0HE 2UXDK 1C0MA 3AA5X 2OPRA 4KFBA 4FS1A 1G7CB 5HRSA 2XLJA 4QOTA 3DMJA 5ELZA 3BN4A 4I6WA 2CJBA 3KJQB 2DPJA 4LF8J 2E5LJ 4FJKA 3M1FA 3GFYA 3QESA 4CEFA 4K4XA 3HTVA 2ZWOA 2VPWB 2HRUA 2PMZD 2DCUB 1Q78A 3MM7B 4HTIA 1WEYA 1VLOA 4BG9A 5SWMA 3WEEA 3CT9A 3BH7B 4B1YB 2RT3A 5IC4B 4KTQA 4URQU 5IWAK 4HT5A 4CJQA 3E3XA 2WSCC 5LSRA 1IKYA 3O4WA 2KL8A 1X1PA 2A42A 1HPMA 4CT9A 3UO0A 1NHKL 2J4RA 3RB4A 4DUTA 1C4AA 4ISGA 1ZTWA 5JMVA 5J1EA 1RDUA 3M7VA 3TWZA 3MM9A 3THWA 1TKXB 1WBDA 4GV9A 4ED4A 3HJVA 4CGDA 4CLKA 3QGGA 2DRBA 5KPTA 1NK6A 1WAFA 3THVA 3HHNB 1GTHA 3QIDA 4DV5F 4RR5A 1NK0A 2KHDA 3PHTA 4Y00A 4DI6A 5KAKA 2PYLA 3FQKA 1RBLA 4B3MK 4DR7J 4RCHA 4KH6A 3M8PB 5H1SQ 3D2FA 3F9MA 2B6AA 1SC1B 3GFXA 3TA2A 3I4HX 2RQMA 1REVB 3OYEA 3UCUP 2E88A 1KOOA 2IVOA 4M7XA 2DIVA 3R9LA 4ZVGA 2DFFA 5IT9U 2E1YA 5CE3A 3MMBB 1KN6A 4DLGA 2BRKA 3ONQA 4LIWA 1KCFA 3SPYA 4V1Ak 2E7WA 3B8AX 3DLEB 3OLAA 3LGMA 5D77A 4YHHK 4OYPA 3PFEA 1B64A 4OZNA 4F0KA 3PSIA 4YDDB 3CW2C 1K9MO 1N4LA 4FJNA 5HMXA 2E6LA 1BMQB 2ACYA 1QZ5A 4NEYA 3GSIA 3HFZB 4DR6K 2XULA 4N8NA 2RUGA 4LF6K 1RTDB 3MTJA 2HNYA 2QMXA 4Y2CA 3M2RB 1SXLA 3K17A 3KK3A 2KN4A 3GCWP 1FHTA 1MWYA 1WF1A 4RU2A 3N79A 3T1AA 1HBUA 1K1QA 1IXKA 2PFUA 1UA1A 3J7YU 1YJRA 4C97A 3LH2S 4HCBA 3CF5Q 3BDEA 4DPOA 4YMEA 3L3UA 1GLJO 1WSIA 3CC4S 1BA1A 1VQMN 3Q23A 4ZVEA 4GO5X 3D54A 3NH1A 1D3WA 2HOEA 4ANEA 4F3OA 3SV3A 3OYFA 5A76A 4FYYB 3RGIA 4IO8A 1APSA 1S9FA 3EY1A 3AA3A 5AJ3F 3FEYB 5FD1A 2DR7A 2NSCA 1WHWA 4K42A 2FQQB 1P9YA 2UUAF 4E98A 2RNEA 2O8EB 4PUOB 5GMKa 1BU6O 1I3AA 4NCBA 3B6OA 4RL1A 4L76A 2BXJA 3IA0A 3I8DA 2XMAA 4KH4A 3JS9A 1C0GA 3K2YA 2F9JA 3HZ6A 5HQMA 3MXIA 3L6QA 2KZMA 4NXNK 1UEUA 2IBKA 4FVMA 2EFOA 3MR5A 4IQMA 1JJ4A 4IH7A 5A8RB 1UVNA 4V19J 1KVAA 3AD9C 3KLFA 4UW2A 1HYSA 3CC2S 1S72S 3EVMA 1NGGA 3MCAB 3IRXA 2YH0A 4EFHA 5F8HA 4RNFA 4QS8A 1WBBA 2ATQA 2Q97A 3THXA 2G2ZA 2DY9A 4O0IA 3M6GA 1IH7A 2VB6A 4JI4F 1NGAA 3OVAA 3UNYA 5K8NA 4WXOA 5GINA 1FT8A 4HHTA 4KBIA 1YJ7A 2LFVA 2QTDA 3W8GA 4BE2A 4A61A 3CCQS 1KD1O 1A5XA 2R7RA 2VG6B 1TUWA 4QOZB 4L3QA 3OS1A 3ETMA 2ILYA 2DKOB 4ZCMA 4OL8A 5E26A 2J6SA 4IFVA 2BE2A 2Q31A 3R8YA 4FK0A 2NXJA 4OX9J 3T6JA 3GV5B 3C94A 3MN7A 3S1TA 1S12A 3T5JA 5DS7A 4K0KJ 3S9HA 1C1AA 1UA0A 1LW2B 2E2NA 2RN2A 1RWMB 2EI5A 2KW4A 1UFLA 3PYDA 4BC5A 1SVDA 2CZ9A 3UWTA 4K8ZA 1W0HA 2WZ1A 3NGIA 3EEQA 4NPOA 2UUCJ 3NGKA 1FI4A 1FNOA 4I69A 2QXFA 2BH1A 4WPAA 3OHAA 4RW8A 1JQGA 3IWLA 2OI2A 4EEYA 3O4QA 3QEWA 1UVLA 2O66A 3NGRA 1SV5A 2F9DA 1Z2ZA 2CQ1A 5HBMA 3TO8A 1SC6A 4XDCA 6AT1B 2OSRA 2H3GX 3LL3A 3CCWA 4OHVA 3N4WA 5AQZA 3V9XA 1NSKL 5HOOA 3UNGC 2C2OB 4RW9B 2ZBPA 1I3OB 3LP1A 2HRTA 2D0AA 3MZIA 4M5DA 2P9NA 2Y0SD 4BC3A 4C0HA 1JXVA 3QJJA 4FPRA 2XNRA 4X84A 2OCEA 2VA2A 2QWNA 4ENOA 1FRMA 1Q7YO 2QWMA 5KPRA 1VRTB 3FZHA 2ZC4A 1N5SA 1G6BA 3MF5A 4P9SA 3BO3A 3HD2A 3IM8A 4AHSA 1DLOA 2R8IA 4PKIA 4C0BA 2VC1A 3HSCA 4JAXA 3S6EA 2YWKA 3ZO7A 2ZZNA 2JGUA 3LALA 4HVZA 1VQ8S 2O8BB 2IHR1 1OH8A 1SUQA 5CCMA 2GHVC 2Z56B 3GR1A 1ZETA 3D2EB 4FVCA 3DOMA 3MM8A 3PRDA 1JNZB 2FC8A 2F8TA 2X1FA 4LBPA 1QY7A 2BE7D 4ECYA 4DDFA 4W98A 4TSXA 4DPXA 3CC4N 3LA0A 1LNQA 5IWAJ 1RADB 1YTYA 2JFKA 4IWVA 4ZJQA 3FQLA 1HNXF 1Q1KA 2WVFA 2ZVSA 1U2VB 2VCPA 3AQOA 4CJTA 4JD2B 1VRUB 3T9NA 2L9DA 3D6HB 3QNNA 3QNWB 3E9OA 3NWGA 2B9EA 3FMBA 2A41A 4RTFD 3QICA 3BH6B 1IKWA 4O4GB 4G65A 5ETOA 5HK4A 4B8AB 5KGXA 2RAQA 3C65A 4E8UA 1XN9A 4C8ZA 2KTQA 1M5PC 3HSGA 4J9PA 2V8VA 1CSJA 1MDUB 1A7GE 3IAS9 2FBTA 3ZSOA 2ZWPA 4QR0A 2VPXB 2CGLA 1KFSA 3P38A 4JYAF 2V7ZA 4XH4A 3HHLD 5KQDA 4B3TK 1CZBA 4K5SA 9RUBA 4DR5J 3QFPA 2A10A 1XMOF 4JI7K 5F0WA 1RU2A 4PXCA 4Z4HA 4W5RA 5A2QU 4CJFA 3AODA 2CWXA 2JLFA 1RTHB 2AJQA 1ZZNA 4H0TB 3R5GA 3D68A 3H40A 4Y2KA 4X4QA 3MN6A 4YEAA 4H4OB 1SCJB 4F25A 2OPSB 3CDAA 3KLEB 3DLBA 2YNIA 3NXZA 3E01A 3LP0B 3EGZA 3BV8A 5FJ4A 1JCGA 3HPGA 2ROPA 3H5YA 2MSTA 4DR6J 3CCQN 3WHIA 1CZ9A 2OUGA 2MKCA 4LF6J 5ETMA 4MFBB 1Z25A 3G4SS 1TK0A 1K6YA 2NLWA 4Z94A 5E5NA 1ROFA 4CERA 2IM3A 4DTNA 4ZVTB 2O5DA 5KT6A 5HLFB 5C10A 4J2AA 3OTBA 4H0YB 2QJ3A 4LRDA 4USUA 4LFBF 2CG8A 2KVIA 2VG7A 1WC4A 1VQPS 5GAEI 5KFMA 3BUZB 4CM2A 1CLFA 1AW0A 3R7BB 1AYEA 2UUBK 4JRPA 4PWDB 5FLXO 2JRSA 2K1RA 3EVWA 1S9GB 1U0HB 4BRQA 1JXEA 2QX0A 3WT0A 1VK8A 3H8YA 1G99A 3UDCA 1ZM2A 4H0OA 4CEEA 3HT0A 4DG1A 3CIPA 2JNJA 2RDIA 5F8JA 3EM1A 4HUFA 1F1BB 3NAHA 1TFYA 3ZTOA 4ID8A 3A5NC 5KG3A 1BDGA 3OA9A 3C7NB 1Y5IB 5ADXH 2BR0A 1OPZA 2GS8A 5DZ7A 3MPYA 4ED3A 5KRSA 2NXEA 2Z2MA 2C2EA 3OTDA 1N36F 1TL3A 3KLIB 1RP5A 1N88A 4ECVA 3BS9A 2CPEA 4I1TA 2V8DA 1EIYB 3AARA 3C19A 1RT6B 1C1CA 2V8HA 5D8HB 3W61A 4WFZA 1N5TA 3CIZA 1OSDA 1B7FA 2O8FA 1WDDA 4CVNE 1XNQJ 2NUBA 1GOCA 3VTIA 4RW6A 2I8EA 3GJTB 4OQJA 2W9CA 2XEXA 4CGHA 2VASA 2CDRB 1QM9A 3D3BJ 3M6XA 2W9AA 3M2VA 3HXMA 1KNZA 1J5OB 1JLEB 2I7PA 1A5VA 4J37A 4FWRA 4DR1K 5ETPA 3IO1A 3QWPA 1NLKL 2QFJA 3DDIA 2O4GA 4H5RA 4G1QB 1U2CA 1NAQA 4I6MA 3HHDA 2H5IB 2ZC3A 4ZPAA 3NF7A 3PACA 1VQ8N 2VONA 2VV5A 1SS6A 5D4OA 1Y4ZB 1UJ6A 1HNWF 2BM0A 2FY8A 3M9OB 1Q7YT 3ENOA 1P27B 3CDWA 2LU2A 1YJWS 1TYQB 5GADP 4USIA 2MGZB 1X5PA 1ZOTA 1NMDA 2M8DB 1S6QB 3KLHA 3UW1A 1L3KA 4RUCA 2VG5B 2CQPA 4OLOA 5K8PA 4KE5A 3UKRB 2QV6A 2XC9A 3KOAA 2IRXA 5KTQA 4FF3A 2ZJPL 4CRJA 2OPQA 1V5IB 1FKPB 2HNDA 3AO2A 4M3UA 2R7QA 4W5TA 2IA6A 4B3RK 2KRBA 2QI2A 5C2GA 3R6LB 2XS5A 4X66J 3CYMA 1JX4A 2CIMA 4YR3A 4ZVSB 5EX0A 1FNMA 4MDAA 4EI2A 2W2MP 3MCSA 3K0JA 4G1PA 2NZ4A 3D3CJ 4KH1B 1VJQA 3P45B 1MN7A 4Y2AA 3K5PA 2HHXA 1SH3A 1VIXA 3I0RB 2LCWA 5AQQA 1WG1A 4RW7A 3W60A 4YOEA 1UAWA 4M45A 4H4KA 1XR6A 2N82B 3RBDA 5GVQA 4FJLA 4JV5K 2XM3A 1UEVA 4PXBA 1EAYC 1C0TA 1FWKA 4CO0A 1S77D 1M1KO 2QA2A 1WHVA 3P96A 3G2XA 2UVRA 4YB5A 1BGXT 3P4IA 4ZVRB 5AQTA 4FYWB 1X0FA 1VQLS 1T7PA 4LRFA 4CZLA 3MEEA 2GZOA 3C6HA 3UVJA 1E6YA 3MHYA 4C9DA 3ZZZA 4FLXA 3OUYB 1HLWA 1NG9A 3W3DA 4URSA 1VSHA 4N76A 4AL6A 3CB4A 4FS2A 3AA4A 4YQWA 1L3VA 3O2IA 3S01A 2AJ1A 2HZVA 2GQQA 4ED5A 3PHEA 2QK9A 1Q5VA 3PXGa 3AHPA 2RHSB 3E1YA 4M5MA 2VFSA 1S99A 3QNOA 3LANA 1RK8A 3TVZA 3G4SN 3FFKB 3N0VA 4IOAQ 2ITMA 1N32K 2ZWHA 3J7ZT 4EO8A 5I3UA 3VWSA 3Q8PB 4KREA 1TTHB 2GIQA 1ZC6A 3LP3A 5IT9O 4USVA 1YI2S 3M8QB 1WSHA 1VC0A 2FHJA 3R2CJ 2OPPB 2ZOMA 3NRBA 3SCLE 1Q8LA 3OSPA 1HQUA 4FZVA 1YQHA 2CJQA 1S3XA 4A8WA 4OYBA 3QGIA 1V4TA 2RRNA 4YS2A 3M5RA 3P5TL 4A48A 3CMES 2CRLA 1XNRJ 3TAQA 3KMSA 2Q1NA 4ZHRB 4ZN3A 4WZMA 4CEAA 1KVIA 3P31A 2L3MA 1QD1A 3OYHA 1AXQA 3ULDA 5D0GA 2GVDB 4CLPA 5AE2A 2WVDA 3H25A 4Q2LA 4E7HA 3OYDA 2DYAA 1CLQA 3J7A1 3RR7A 2ADBA 4OMFG 4NXMF 1ITPA 2UUWA 1U24A 4DR7F 3S3OA 3Q89A 4BDPA 2LXFA 2CQCA 1TKTB 4CO5A 3TAEA 2B51A 1JB0C 4C8LA 2Z30B 5L8RC 4WKRA 1SI9A 4YP3A 3GSDA 3WQTA 3R9PA 5IV4A 5T7LB 5CR4A 2F7VA 4RWTA 4WU3A 2IVNA 3R2DJ 5F0XA 3MR2A 3R1XA 4DFPA 4C1NK 1CJVA 5D4LA 2LYVA 2HFUA 4M3YA 5BN8A 1H2UX 2J9CA 4CJ4A 3SXLA 2QG9B 1F9EB 2DR8A 1O8BA 4LSNB 2YKPA 4KHPK 5D4PA 1Q81O 4ZITA 5DETA 4F4KA 4OV1A 2C2KB 3AY0A 1TV6B 5CZVA 3T9ZA 3MAAA 1O13A 3RRHA 3MURP 3F2KA 1MWQA 1HQ2A 1HA1A 4WJBA 4JI0K 2GBZA 4KTZA 4J9MA 4LF9F 1TQLA 4H4MB 3S3NA 1WSJA 1BUXA 1K0TA 2EC0A 2VFVA 4MIAA 4K4TA 5J2PB 3GYNA 2GVZA 1TUUA 4MDBA 4DXLA 2IVMA 4W4MA 3DRRB 2IDOA 1Q8KA 2MLXA 4K8RA 3CETA 2JH3A 1U25A 2DRDA 4F02A 4ZVUB 4DUZF 2KXHA 3BZCA 4R25A 2Y8YA 1B0VA 2CVIA 3AO5A 2GMLA 1IBMK 1YZ6A 2OAUA 3OSNA 3AVFA 3JTNA 5HVGA 4RNNA 3ENBA 3MOJB 2EX3A 3G71S 1WHYA 1ZA2B 3G10A 3O1WA 3RRKA 3RSEB 2JVRA 5B08A 3FK4A 1KAYA 2V2KA 3ASMA 2BANA 1HD1A 3IBWA 4O3SA 1JL2A 5ETVA 1WN7A 1FDBA 4B3OB 4F9OA 1Q8IA 4KH0B 1W9HA 3VF4A 2P5GA 2YY3A 5KFKA 2DT9A 1LWXA 1F3VA 1IBLF 3CD0A 1HNZJ 4NMXA 4ES3A 4ELVA 3M30B 2FSNA 2R7OA 4BWMA 4Y0FA 3PYFA 3O6WA 1BLUA 4CLTA 1N34F 4OYAA 2N3LA 4FM0A 1U8SA 4DR3K 2HFVA 4R8UA 5D4NA 2RJZA 4P73A 3ZZ0A 1H73A 3R3TA 4OHYA 3AH6A 2MKKA 5AZJB 1KR4A 1ZBUA 4FJMA 3D1OA 3C14A 2DNKA 2ZNZA 4F7VA 4PWWA 4BR5A 3KXDA 3EZ5A 4JK7A 4LFCJ 2DNPA 1VQLN 2XMUA 2CZ4A 2CNLB 2QA4S 2HAFA 3NDKA 2ZBQA 3AA9A 1M1KT 4CZIA 3QLHB 1IG8A 3M8ZA 3KWMA 3TAPA 5GIPA 2HHHF 3RR8A 4FKYA 3F56A 2MQOA 3M8RA 3U3GA 3NGSA 3HVRA 3U1NA 4CNYA 1SQGA 4X65K 1X4BA 1R31A 4DJBA 2H54B 3ZYYX 2CPXA 2WBMA 1J54A 5KG7A 3VEVA 5E2QA 2DHSA 4H54A 1CJUB 4BVOA 2VFUA 4X4OA 4E7LA 3L4QA 3CJ0A 1U48A 2B4JA 3PDNA 2RKIA 4FLZA 1YI2N 4OI6A 2P9UA 2MZ1A 4EHTA 4QW9A 4NWBA 1TUVA 3L09A 1NK4A 3RRGA 2DNQA 2KT2A 1EKEA 4ZP9A 2CWKA 4LREA 4X62J 4F50A 1A0OB 3TARA 4B3RJ 2B5JA 2H1YA 4KHQA 2RS8A 1T03A 3QERA 3AOAA 2HS4A 2KDOA 3FCWA 2YX7A 1MWKA 5DLGA 4OPAA 4PRFA 4MYTA 4LF4J 4Q45A 3H2VE 1N54B 3QT5A 3PW7A 3AD7C 3ZSVA 2H65B 1TR0A 3HHLA 3CPWM 2V4RA 2IIRA 5KFVA 3IR6B 3CJ5A 4DTPA 4ZTFA 4NLDA 3JYTA 3OHBA 5IC6B 4DL2A 4C3MA 2WK4A 3UKUB 2AYEA 3LDSA 1DY3A 1W7AA 3IUCA 5LJVA 4Q0BA 4QYZK 4DN0A 2DO0A 2I2YA 3N28A 3B54A 2PT0A 2DR9A 2E29A 5GAHU 4TY8A 1JLBB 1TUGB 2NRHA 2O8DA 3SJJA 3BYPA 1S1TB 2HSEB 4PR6A 3ZT3A 3DI6B 1H72C 1KQKA 2QL7B 2FVSA 4O3NA 2UXDF 3NCPA 2E44A 3BYRA 1F2HA 3PLAA 3C6UB 2ZKTA 3TZXA 2FHOB 3H59A 4W5OA 3EZUA 2XQCA 4CCHA 2HFNA 4UQGA 2LEPA 1KQGB 3CPWR 3OR1B 5A6WA 4OYMA 1Q81T 3CJ8A 2GQCA 4O55A 5GADU 1N32J 2ZEJA 4LF5K 3QIPA 3I5CA 4DU8A 2B9WA 4WIQA 3MCNA 1Q53A 3O9QA 5JVHL 4CEZA 4LSLA 4KR0B 1TK8A 3VV2B 5KFQA 1BHNA 5IWAF 5A2QO 1K73O 1FJGK 2ROEA 5HP1B 1HNIA 3M9MB 6FD1A 1O1WA 1UVKA 2YHBA 4J9KA 3V6DB 2H51B 4CF2A 2HFOA 1RBOB 1WI8A 4M63C 3G71N 2HVDA 4KTWA 4DSJA 3TR8A 3AD8C 4F4ZA 1P6TA 4MQ3A 2O8CA 4N47A 1D8ZA 1RYRA 1GMWA 1HBOA 3JQJA 3BKTA 3ENHA 4ZMMA 4DQSA 1F9FA 3WC0A 3HI0A 1U09A 1WWHA 2CKWA 4C11A 4DV4J 1N5YA 3GFHA 2I1RA 1OYEA 4JI2K 2W40A 4QU7A 2I5JA 4RNMA 5C2DA 3I5AA 4B3MF 1YTUA 3O9RA 4ILMA 1KKHA 1FX2A 2PA8D 1LOTB 2G8VA 4DR4F 2DVIA 3R5AA 2VJVA 2ZH2A 2YPZA 2QC3A 4FWNA 1X7VA 3Q8VA 4DV0J 1IV0A 4M1KA 1K8AT 5FDLA 3J80U 2KXNB 8AT1B 3UE2A 3CD7A 2R7WA 4MLHA 1U2FA 4TU9A 3ZZOA 4CZMA 4HUEA 1BQMB 2F4FA 5E3RA 2D69A 3SMZA 2EFGA 2I6WA 4IO9Q 3C0BA 3A5LC 2ZBRA 5KFDA 1IG9A 4P2FA 4YHHF 5BYSA 2KJVA 4F8RA 4FW2A 5D0RA 3T5LA 2XCPA 2E20A 5TKYA 2QA4N 4Y2MA 3DAWA 3R1LA 2D3UA 4C1NI 3N6MA 3TWHA 3LZIA 4DR6F 3QQCD 5LJ5Y 2VBWA 2CPDA 3AAWB 1UPMB 3R27A 5BPLA 3CHWA 3GIJA 4K4WA 4ECTA 4FYXB 2W4PA 4NYZA 4JHDB 3ZLJA 3CUNA 3MEDB 2M4MA 4DSEA 5EU7A 3ET6A 2ZE2B 3BR8A 4DV2J 4PL7A 3I96A 3OYAA 3CJKB 2PI4A 2J6UA 3WBZA 8ATCB 1RCOB 2HBRB 4ILRA 2KHOA 3I82A 2ZM6F 2NS1B 3P1GA 4K2XA 3E66A 3MR7A 2BOPA 3VMFB 2V63A 3DYAA 2FBXA 4K43A 3SK3A 3MEGB 1HHTP 4J5OA 2KFZA 3GV8B 4M3RA 6FDRA 1FF2A 1HL6A 1J6ZA 1FXXA 4UT4A 2FSKA 2QO3A 1S1XA 3P8BB 2CJXB 3NOCA 1ZM4A 1EP4A 4PQUA 3MI7X 4ILLA 1RT2A 2GELA 1YJ9S 4WQ5C 4RLEA 3L7UA 4UOCA 1NBWA 3Q7CA 5AZIB 2LDYA 3BKFA 2O01C 2B4UA 1EETA 3ZZTA 2G8KA 1BQNB 3C46A 3GR0A 3KD5E 2ABYA 1S76D 2CNNB 2G8FA 1HW8A 3FNNA 1L3UA 4Z4EA 3ZSYA 4NXNF 3KDNA 3CCRS 4MH8A 1WSVA 4TXSA 1WC3A 1U02A 4XH5A 3ZTPA 4RWXA 2IS3A 1FRXA 2DGXA 3W2WB 1T95A 4ZIVA 2B3TB 5KFWA 1KLMB 2B7CB 3O9SA 2HGMA 5M1QA 2UP1A 3T5KA 5ETTA 2OO4A 4DSKA 4IRCA 2ZD1A 4I2QA 1D1UA 1LW0A 1Q16B 3KG0A 4YOYA 3NNHA 1N56A 5FRMA 3DOKB 5F9NA 2A1BA 3DXMA 5AXMA 1CXQA 2M5YA 1B0PA 5KFRA 2GO9A 1RT3B 1RWNB 5DRKA 2GUIA 3AA8A 3W9JA 1GOBA 1JLFB 1RAGB 2KFNA 2UU9J 2F3JA 3RU0A 5AQWA 1T6DA 4JI6K 1GEHA 3FDSA 2JOQA 3LM2A 3MPUB 5DM7L 3CF5L 5FLXY 4FZZA 2HNZB 1VISA 2HK2A 4NLRA 3CJ9A 3THYB 3G0ZA 1X0PA 1FKOB 4X65J 4ECQA 3AY9A 2ACMA 5K9FA 2OTJS 4EHUA 3VGUA 1R6YA 2HGLA 1XMQF 1RAEB 2QLXA 5ADXA 3CPEA 5M1KA 1NM2A 1U1KA 2VQFK 4OKKA 1NK7A 4U6PA 4IQXA 2DBBA 2X78A 4USWA 3QETA 4PZVA 4P2SA 1NOZA 4DL7A 3UQSA 2FJBB 4YB7A 4DZDA 3ZX3A 5H9EK 2IOCA 5KFEA 3AVKA 2V68A 3GYXB 2N4CA 3GLJA 2RQ4A 5DM6L 1KAZA 3VEZA 4KRFA 3MUVP 1DJ0A 4JLHA 3PW2A 1D9DA 4LH5A 3H2UB 2Z2LA 3HBTA 1UAXA 2BBEA 3MM6A 4CWBA 4K4ZA 4PHTX 3HI9A 1CXUA 1WF0A 3FCVA 1K73T 1R27B 4M95A 1UETA 2OGUA 2OEMA 2WONA 1PGZA 4KV8B 2VFTA 4B9QA 5KFFA 3KUEA 3NS6A 4TKTA 3IMQJ 1HPZB 1FTCA 1U8WA 4HL9A 2MLZA 3BGLA 3QSIA 4FJIA 2VQEJ 1PAUB 4E1NA 4ZPBA 1RGVA 3FBEA 2BM1A 4CLFA 1FEHA 4CYUA 4DV6K 4CJPA 1SJ4P 5A0YB 4NLTA 2W1BA 4NCAA 5C15A 4IG3A 4ELTA 2BJ1A 4M5KA 1U0SA 4Y6IA 2GJFA 4CBXA 2VKRA 4QYZJ 1S5JA 2YWHA 2DNOA 2P9PB 2ZUGA 4HYKA 3PV8A 1NK8A 2AX1A 2Q0RA 1CULA 2V67A 1KTVA 1R7IA 2ZBIA 4C8KA 4EYIB 3B6BA 2QW9A 3GBTA 1NHUA 4JB8B 1I39A 3OPKA 3JXOA 4ERDA 4J8FA 2P2CB 1TL1A 3KKRA 2IAJA 1QUVA 3I9V9 3AO4A 4AL7A 3SI8A 4AYBD 4KY3A 4DCJB 3T6BA 3DOLB 1RDAA 1ATSA 3KK2B 3IWXA 2YHWA 2WB4A 3MX2A 3PRBA 1C4CA 3IDHA 5KFYA 3ULEA 1RWUA 3OR2B 3VGLA 4CD3A 2WHOA 4CGFA 4JI3K 1Y10A 3LDNA 4YB1P 3GYGA 2CGKA 3OFGA 1YKWA 4ZA1A 1LWCB 3DLRA 3P6YC 2ZVIA 5C12A 2KHCA 4AQYF 4V19X 2G0JA 3NCRA 3L2VA 1XR5A 2P9SA 4WFBQ 5B0AA 4KC5A 1IKVB 5T41A 5LOQA 2MQQA 4YY3F 2YKOA 1YIJS 3RAQA 3HL8A 4KIAA 1ZXOA 1FA0A 5EHHA 3M6WA 2QSWA 2ZNYA 5FRNA 2CPYA 3UR3C 1HBMA 3NH0A 4FJ7A 3FVYA 1IR2A 3EWGA 1FFSB 4KHUA 4I68A 2YX4A 1BC6A 4DSIA 5CCLA 1YJ9N 2XSFA 1F0XA 4MO5A 2DR6A 4KB7A 2FC0A 2B43A 5ETLA 1YAGA 3R5JB 2AGPA 3DHXA 3K5OA 4JI2J 3A3PB 1Y5LB 4BR0A 4M5JA 3K0SA 1RBAA 4DU7A 1HR0K 4IRDA 4CTAB 1R0CB 2W4CA 3CCRN 2XB2D 4OJ1A 4RW8B 4B3TF 1UPPA 4EMDA 2Q43A 4JI7F 2FJEB 3EE9A 4UTGA 4JI5K 2C2RA 4GMKA 3QBCA 4ATNA 1HYZA 4ZK7M 2C2MB 2DHAA 2QLJB 4XDDA 1VQ7S 5DGAA 5CYQA 4CT8A 4OHWA 1TL7B 3BF1A 1ZM9A 2CQ3A 3VF0B 4OI0A 2BUPA 4C6AA 3C15A 1V4SA 2JLGA 1B70B 3DLGB 5AQYA 3OHRA 1K8KA 4AUKA 4PWUA 1EQMA 2VGMA 4RBTA 3UE5A 3L7OA 5IT9Y 1WG5A 5KT5A 4AT1B 1NZ8A 2FLLA 2HZCA 2G0IA 3KKSA 3RBZA 4B02A 4FO0A 3QMQA 3ENQA 1HD0A 3QO9A 3ZEUB 4QPTA 3TI0A 3K2PA 1TFWA 3WNFA 1D4XA 3U9DA 1NDPA 1NJIO 2KM8C 2YNHA 1GOAA 4B17A 1L5UA 4AF1A 3L0QA 4LD0A 3C6AA 2V9KA 4FJ5A 4BRKA 3QBXA 2GGPA 3Q2SC 4AE5A 3BPDA 2F96A 1XIQA 2D3O1 4O0NA 2BE9B 3UDEA 1ZBLA 3R6MA 1KS2A 2I38A 3E51A 5B0CA 2UUBF 2E66A 2N7YA 1C2PA 1CC7A 1V9OA 3CD5A 3QZ8A 4KHYA 1DFDA 2PAVA 2DY4A 2WVEA 3DC2A 2ZZTA 3IFEA 4MKBA 2VBXA 5LMNK 1HQEB 3DOMB 2W9BA 3MMAB 3E2EA 4FWOA 5M1NA 3HZGA 5A6PA 1Y9OA 3OTCA 1SKWA 4DL3A 1BHLA 2Z57B 3VF6A 2QA4G 4M3WA 2ZJPQ 3AGKA 4RBVA 4ES2A 3GG1A 1GXUA 2WUSA 4KO0A 4CQ1A 2M9KA 1NU4A 3IR7B 4J9UE 2EG2A 4WU2A 5MAOA 1L3TA 3OTOK 2MKYA 1QAIA 2ZFHA 1TMMA 3SDEB 4CH7A 3DXKB 2FF3B 4AD6A 4BE0A 4DS5A 4PPDA 5HROA 3AVCA 1M5HA 2YTCA 2MPUA 2YQ0A 1RKJA 1FKAF 3U1LA 5IT4A 3DGPB 4AHTA 3TJ8A 4Z4GA 4IJNA 1U4BA 1DEJA 1RKIA 3TPQA 4ED7A 1EX8A 5AQMA 4LIRA 5AQPA 1RAHB 2RE1A 3CJ7A 2U1AA 2ATCB 3KJFB 4LF1A 4DR1F 1MA9B 3M1VA 5KFAA 4X2BA 1HBNA 3T1HJ 2FJAB 4KT0C 1Z26A 4I2PB 3OYKA 4JKGB 3NGTA 3KLVA 4FWMA 2BKPA 4P74A 3G9CA 2OD6A 3N4PA 1G15A 3ZX0A 3BZKA 3H0PA 4O3QA 3QFHA 2YV0X 2IYGA 1B92A 1FD8A 4FWPA 1QE1A 3I33A 5K14A 4DS4A 5KFSA 2X1AA 2YNIB 4OZ5A 1U1LA 1OMSA 4HTJA 2RILA 3SYZA 1D9AA 3SIPB 3PJWA 2A2DA 4O44A 3ZX2A 1S1WB 3DRPA 1YIJN 2HF4A 2CPHA 2A3JA 5H9EJ 4FF4A 3FSXA 5BR8F 3ITHA 3GV7B 4EK2A 4CP5A 3VQSA 3FKBA 2M2BA 3GWCA 2AF6A 1NGIA 2EC2A 4K4YA 3WQPA 1MU2B 4JI8J 4LR7A 2YI1A 1GMUA 1H7XA 1VGYA 2V52B 3VAIA 1N33K 1I94K 1S6OA 4IFYB 4CZEA 5DG8A 4MLEA 2HWHA 1H7WA 3MXJA 1TKDA 1CBKA 4IUFA 1RWWB 3A12A 2JEFA 4IDKA 2UXCK 1FWPA 4JV5F 1VSMA 1XERA 1ZBSA 4USJC 2UXBJ 2YKMB 2QLWA 3FZ2A 3OW2M 2W25A 1PYOB 3BREA 4DV6J 1JXLA 4PYAA 1CJTB 3W2VB 3FBFA 4OPJA 2H5JB 4PEOA 4BRHA 4CHYA 2JDJA 2XZTB 3NBPA 2R9LA 2GIRA 3TANA 3CCES 3BKUA 1NH8A 4WCEL 2B9XA 5THWA 4YORA 1TL3B 3OXLA 2ZHAA 3OQ2A 4B8CA 3EGVA 2WW8A 2Z0GA 2GV1A 5LMUK 4ZVHA 4QBUA 3RB6A 3CCLS 4WFYA 3OVBA 2JWKA 3VQ5A 2IVYA 3QFWA 1CEZA 4R5PB 1XQIA 3BPSP 4BRCA 3C6TB 1U6BA 1EQYA 4ECRA 2VF3A 1IKXB 1O0PA 2R8HA 4OI1A 3IS9B 2E2QA 2LA6A 3TTCA 1OSCA 2RF2B 3T3FA 3ZSRA 1HKGA 1HWUA 4PYDA 4CH0S 3V5RA 2C42A 3BJYA 3DM2B 1RWXB 4LF8K 2E5LK 3Q8SB 3BF4A 1A6LA 4IOCL 1UTAA 1BCOA 4WE1B 1GNKA 3J80O 2E5IA 2F63A 4Z4FA 2AV5A 2CQIA 4IFEA 1NNDA 2DHHA 3LPEA 1HHSA 1YGYA 1FK9B 4DF8A 1H2TZ 2DK2A 3CFOA 3KKFA 4WYLA 1TKXA 2ZJQL 3DGVA 4K41A 2FDNA 5KRTA 2X3GA 4KPYA 3KHLA 3CJAA 1LXNA 4LF7J 3VAFA 3T1YJ 4FW1A 1WUUA 5E3PA 4JEPA 5DGBA 1U47A 3WXMB 2XWXA 1CVJA 4ID5B 4ZCIA 2DHGA 3HX9A 4HR2A 1NSPA 5F2RA 3PYGA 3TJ9A 5EY4A 4O8KA 3M8PA 3Q83A 1Y00A 1REVA 2NXUA 4NLWA 2GTDA 1VQKS 2DPNA 4CZFA 1FDDA 3MMBA 2F8HA 1ZZFA 2UVVA 1NH7A 1UVJA 2G1DA 4DUYJ 3SQOP 1NDKA 5C25B 3H5SA 3D7SB 4ZN1A 3LZJA 2Z1JA 4I9LA 3IN5A 2P8IA 1T02A 2V4JB 4Y1CA 4KHPF 3D0GE 5K8OA 2ZHBA 4FL9A 3AJDA 3KWGA 1RT1B 1MSWD 5F8MA 3R5DA 4M5IA 5C2FA 2HFZA 1YWXA 1RTDA 3NWRA 2N3OA 2HVEA 1X4AA 3SEOA 3M2RA 4DL5A 3RZAA 1AUSL 1VIOA 3L2WA 3PFOA 4JI0F 2IRYA 2FSJA 2XO6A 4USKA 2FLPA 4CI6A 3VQ8A 1S0OA 1NGCA 3MEEB 4KJIA 1Y3KA 2J0XA 5FPMA 3QYYA 1B3TA 5DDPC 2CADA 3OYGA 3CJRA 3ZZPA 1HJRA 3KJNB 2CAJA 3CC7S 2MKJA 4IBNA 2IC3B 4NCGB 3SSQA 4DOZA 5CYMB 4PAAA 1S6PB 1IBMF 1FRHA 4NRTA 2QEXS 2QFIA 1GLLO 4DHYA 1O6XA 2BOAA 4I6YA 2KRRA 1FE4A 4MIWA 1QQOA 1URNA 4BDZA 1SJ1A 1X60A 2BJ7A 2OTLS 2O8EA 4PUOA 2W7OA 3QATA 1ZAWA 2RDJA 4JOUA 3N4QA 1Q4RA 2R7UA 4AM6A 2AJ0A 4DV7J 4GW6A 1EWRA 4DTJA 4I4BA 3BEXA 4QIEA 1IR1A 5JJBA 1FDAA 3HRGA 3P5BP 1C0FA 2AHOB 5CHIA 4OZ3A 2CQHA 5A8RA 2J8SA 3OTOJ 1IUJA 1C1BB 1OY9A 1HKAA 4UQTA 2IIHA 1PJ5A 3ILJA 3DLHA 4DR3F 5AQIA 2E9ZA 1T9UA 2DNRA 4CEBA 4B1VA 2K06A 2HBKA 4F26A 4DV5K 1YJVA 4F4WA 5IOLA 4NZ0A 3EO3A 2E1MC 2G1HA 4DQ8A 4ECUA 3C8YA 4J90A 1X9MA 4YR0A 2K2PA 3CCEN 5RUBA 3D6RA 3M3ZA 4KHNA 4EZ9A 2OD4A 4FF1A 1VK0A 5A8WB 3IFRA 3VEOA 1VDHA 4QWEA 2YXLA 4GNIA 4LQ3A 3SBMA 2BQ3A 2MLYA 4DEZA 1HUXA 4MK9A 3CCLN 1HI8A 1R8CA 4J9VA 3DLJA 1U2RA 5F3TA 3ZNUA 4OIXA 3LO3A 5KG6A 2GWKA 5CQGA 1SZ2A 1IR0A 2NZCA 3A5MC 2I9SA 3PNIA 4KKOB 1LW2A 2IFXA 1U1NA 3QSYB 4KYZA 4OX9K 2WAQD 1BIZA 4P7VA 2F1FA 3A1YG 4C23A 4HDGA 3AO1A 4K0KK 5CA5A 1O51A 1VQMS 2QL9B 2MQPA 3PO5A 1GMVA 3BP8A 2DTUA 1PC5A 4F0MA 3PG9A 4C0OC 1KLNA 1X8DA 5B0FA 1ZH5A 4GVBB 4J9QA 2RQKA 2HMIB 4AL5A 1U45A 1YJNS 1RT5B 1F5AA 3TUPA 5HQLA 1LWFB 5L9NA 1S6UA 1LFWA 5JVHQ 2UUCK 1VSLA 4AXIA 1M1GA 3NMRA 4DL4A 4A8OA 4DCHA 4N77A 2FJXA 4F4YA 1KAXA 4RW9A 3OL7A 2QZ8A 5HJYA 2UUTA 3OYMA 1WEZA 3AJ2A 1S22A 3O1BA 2VOOA 3SI6A 2B8QA 3QAUA 2UXCJ 1VQKN 2UUAK 5HRNA 4NEZA 5F41A 2YX1A 1ZAVA 3RMBA 2X51A 3KIOA 1PILA 1YLXA 3SUNA 2ROGA 4TN2A 1JKHB 1VC5A 3H5UA 1E6VB 3LUYA 3NEKA 3L4BC 3LDLA 3BSOA 1QAYA 5KT2A 3F44A 2GAGC 2BABA 1YBAA 4CNZA 1RZMA 3V81B 2VPZB 2Q3SA 1TL5A 1NBEB 4Q8EA 2Y1IA 3W9HA 3MMCB 1J5EJ 2BV3A 3IP0A 3CVKA 2O8BA 5LMUJ 3E8OA 4ES1A 4GVMA 4QW8A 4GKKJ 3MCPA 3V2UC 2XGQA 3SMPA 4Z7YA 4CZCA 4ZVFA 4AHRA 2ZGZA 4JV1A 4FBUA 5FROA 3D2EA 4JKFA 3RTVA 4FJGA 3PO4A 1F9HA 4DV1F 2HGNA 1C0UA 5CY4A 3GIIA 4KSEB 3CSKA 1SAZA 1KXPA 3IKMA 4LF5F 1PCAA 5AQNA 3PW4A 5E84A 4ED2A 4QPXA 4B9TA 4PA1A 3MCMA 3CC7N 4JKDA 1U2VA 1YRTA 2VDIA 4JD2A 2WVBA 3TNVA 2ASOA 2YNFB 1VRUA 1FJGF 1FXLA 1S59A 5KFIA 1V3ZA 5C24B 3QJPA 2QEXN 5I3PA 2Q2RA 2WSEC 1R8BA 3H45C 3VGVA 2HHTA 1FRKA 3CCVS 4CDIA 2OHDA 4O4GA 2XI2A 2W42A 4F4AA 2OTLN 1RAAB 2HHVA 3NKYA 2M0GB 4ZOSA 2HMPA 4M42A 1Z4UA 3BBBA 4LJMA 4DL0C 4XPCA 3UI3A 1S7HA 4ETZA 4OI3A 4X64K 3LPYA 3V1RA 2M7SA 5AFUH 2V8PA 2E1CA 2DTJA 2MKSA 4A8MP 5AQRA 3EICA 2EW9A 5SUHA 2XCAA 4BC7A 2F5GA 1AT1B 2XRIA 3HDSA 4ECSA 3M32B 2Y0BB 3JS6A 1RTHA 2O4IA 4CJSA 4DR5K 2DISA 4WTOB 1TAQA 1HFEL 3O80A 1VCTA 5EX5A 1MLAA 2QWOA 1M90O 3O5TB 4H4OA 5JS2A 4OJ3A 1BWVA 5CH7B 2MQNA 2PGCA 2OPSA 3KLEA 3V4MA 3LP0A 1T8EA 3HHKA 2NR0A 1VMBA 1N0VC 3CMAS 2DH8A 1ULRA 3HMJG 3DNCA 3SAFA 3QWUA 1KVKA 4DR2J 4MFBA 2QTWA 2BX6A 5MLCV 2HYIB 3QT7A 7FDRA 1T44A 4TNOA 3TSQA 2HS3A 4LBHA 5HLFA 3DFEA 4PL8A 2E5GA 1NEEA 4FYDA 4XAKA 3IAYA 4AFFA 1VFJA 1AZSB 3PZPA 2HAIA 5FPEA 3D0IE 4NLBA 1X4DA 2D1KA 2DJWA 4DKWA 3P5JA 4DTOA 4PWDA 3GE1A 5DG7A 1S9GA 4U95A 1U0HA 4A5BA 5DM7Q 2Q1LA 4CF9A 4OYZA 3OBWA 2FF6A 3TZZA 3FFIB 1WSGA 4QS7A 3VESA 2YNGB 3CO0P 4PXEA 1JMTA 1WTFA 3CJ2A 3ENWA 2J7UA 2PD1A 3C7NA 1YJNN 4KHMA 1YG0A 3PCOB 1N5QA 1YXQA 2XLIA 4X4RA 2FHJD 2C3PA 4S0MA 1HNXK 3ZETB 3HCXA 1X9WA 1YBUA 3VAKA 3KLIA 2ZDOA 2LEBA 1S49A 2DEJA 1U1MA 1NLVA 1RT6A 2KJWA 1KDNA 3K59A 2NREA 2ZBCA 5DM6Q 3JSBA 5HQ8A 4QIVA 4HUGA 4C4WA 2OJ3A 1D5AA 1VLYA 4IO9L 5BYQA 1VK3A 3DXBA 1RLCL 2Q79A 2J8AA 2O8CB 2GFFA 4DPTA 1K47A 1XC9A 3BSNA 2GO8A 4BROA 3O1LA 4YDUC 4CFAA 2EFVA 4DV5J 2WOMB 2KG0A 1SC3B 3V6HA 2W8KA 3ZZRA 4P2XA 2ILZA 3CDBA 1J5OA 1JLEA 3TUZC 1XNQK 4BQLA 4LRBA 4DN9A 3F9KA 3PR4A 1CJKB 1ZBIA 3EPGA 4TQSA 4ER8A 4G1QA 2BMBA 3M8SA 5J2QB 1JLAB 5ADZA 4U7UK 5M2PA 2ZH9A 2OSQA 4L73A 5KG1A 4CZHA 4KHWA 1TYQA 3LAKA 4JI6F 5JLFA 2MGZA 1L3SA 1BO5O 1S6QA 3W5ZA 1WG4A 2VG5A 4BDYA 3UKRA 1CZAN 1RDRA 1NXIA 2KM8B 1GLBG 1N6QB 3MCOA 3KHHA 1CQNA 2VQFF 2UVWA 3WNEA 1FKPA 4WYBA 1QJHA 2MHEA 3FZFA 2CPZA 3MD1A 2CQ0A 2OEKA 4A4JA 3OFHA 3ID6A 3JSMB 3O9TA 1ZBHA 1QLNA 3THTA 2LP4A 2FIUA 3RB3A 1OQ3A 2KT3A 4BRAA 3SQGB 3CCVN 2CQ4A 2HBMA 3LQVA 5HANA 5EWFA 3U4LA 1S9EB 3B78A 3H1VX 4X66K 3NNCA 4CEDA 3GB0A 3PVXA 3CCUS 2F4VF 4J7CA 5DMRA 4HVJA 3ILIA 4J9OA 4WQ4A 5AJ3J 2V0NA 3WXJA 5BR9A 3ZFVA 2CXEA 3CE8A 4CW7B 4WFAL 1NOYA 1B4SA 4MKYA 4O3OA 1KBRA 4X4VA 1RBSA 2XBPA 3G6ES 3VGSA 3O4NA 2UUAJ 3GONA 4USMA 1YHQS 5HRRA 2DFHA 3MPWA 4Y65A 1UZHA 3MR3A 3T5HA 1VBXA 3PIPL 2IJFA 2JHEA 4CHQA 2HG4A 3PX4A 3NVKA 3PEHA 1S1UB 4BR4A 3OUYA 2C2NA 3KJVB 3A2FA 2F7TA 3KMQA 4WF9Q 1KC8O 2A6MA 2DGUA 3HVWA 4USTA 2Z1HA 2CUYA 1S10A 4ZVQB 3IG1B 3CMAN 4C8MA 3BQ2A 3TUJC 1BOTO 4F36A 3SAGA 3K9KA 1SJFA 5HVHA 5CZ1A 2HQCA 4JI1K 4OGCA 3O44A 1FDNA 2B9YA 4EP4A 1S1VA 3V1OA 1R89A 3ID8A 3HVTB 1M90T 5BN9A 4I2QB 2F65A 1DQAA 2RU3A 5KFZA 4JI4J 4M94A 2QIFA 2E7VA 2YCHA 2P5VA 4CO3A 3P83D 4JI3F 4ICLB 2W6KA 5L1KA 4G6VB 5DQHA 4DF4A 4LQ9A 3M8QA 2OPPA 4U96A 3DRXA 4L6V3 1UWBB 1ICEB 4FK2A 4IG0B 1BWFO 2P9EA 2XY6A 4J9RA 1YDLA 1GLDG 2RU9A 3M4XA 2WFBA 2J9DA 2YWFA 1HYVA 2DGQA 4ZHRA 1Z1ZA 2VIHA 2JEJA 1YJUA 3OYIA 3V9SA 3F0NA 2GVDA 4TVAB 2HBQB 2PDAA 3TP2A 2MXYA 3GIKA 1XNRK 2WSFC 4CJLA 1EJ7L 4Y1DA 1R8HA 2DGWA 4O23A 1NPRA 1MROB 1S7IA 2QMUB 2LQJA 3MDFA 2Y8WA 4B1XB 3ENAA 4N8OA 1W7WA 5AQFA 3KK1A 1TKTA 4X64J 2Y3YA 2WTFA 1Q5YA 2A6OA 1VQ6S 2VICA 5T7LA 2Y1LB 1ATNA 1HR0F 4ECZA 3N01A 3FSIA 4C98A 2ZGYA 2WVCA 5D3GB 4ZP8A 4LSNA 2RH3A 1BE4A 1IBKF 3TYTA 4EZ6A 4NMLA 3WXKA 4JI5F 4FK4A 4M3XA 3LF0A 2ASYA 1TV6A 4O3RA 2NSBA 3VGMA 3FBBA 4DFMA 2W41A 3SNNA 1A9NB 1ZAXA 3L8BA 4FKXA 1VHXA 4OPHA 3S3MA 2G2OA 3MOZA 3V1QA 2GQ2A 1GFWB 2BW2A 3P3DA 3J7ZO 4I7FA 2GJ2A 3J80Y 3WNHA 1NM1A 4H4MA 3CWJA 1WSEA 4RBUA 5EWGA 1RWOB 1SKUB 4EYHB 5J2PA 3AVNA 2VU5A 4HI1A 3DRRA 3H7HB 2OMLA 2XGPA 3GJRB 1S57A 3U8XA 1ASUA 2KKHA 2P9GA 4QAGA 4WFBL 3BBFA 5KPZA 4G1IA 2IVFB 4NYNA 4A57A 1X4FA 4CO4A 3I87A 4HACB 4UUXA 3GIMA 1MWZA 3BQ1A 5DDQC 2C1EB 2QYCA 3RSEA 3DDKA 5I42B 4K8XA 4XIUA 4LVNP 1OJ4A 3SBGA 4YNQA 4B3OA 5HN0A 2AGQA 2VL1A 5LMNF 3GP9A 1HIYA 1RTJB 3PSFA 4CJEA 4E0DA 1VHFA 4ZPTR 4PCQA 3NHGA 1VQNS 1T9XA 3M30A 3A8EA 1N52B 4ZPDA 3HLUA 4ZTJA 1HNXJ 2XSJB 4BR2A 1QSSA 3FJ2A 3Q8RB 2CG4A 4BBYA 3CCUN 4GV6A 4A62A 1HNZK 2ZF5O 1NPPA 4M5LA 2UYTA 4GO7X 2RUSA 3OTOF 1WI6A 3D1HA 4ZDNA 4OZLA 3W0LA 2DGTA 4FJ9A 3G6EN 1GMWD 2KQ2A 4LUBA 2ZH7A 4M8LA 1YHQN 4FOEA 3JSRA 3AFGA 3B82A 1Z6RA 3H20A 2DNNA 2YPYA 3WX4A 4TYAA 4FOIA 3AVIA 3KHYA 2XZDB 2KB2A 4NL5A 2YVSA 1LV5A 2P51A 3CCZA 3AVGA 2CJ9A 3C2PA 1KVBA 2B4OA 3CJ4A 4DV3F 4JYAJ 1X4HA 1RT4B 4FBTA 3M05A 1FRJA 2OEJA 3GJSB 3HF5A 3G8SA 2DNGA 3QLHA 5GAHP 4LFCK 2W2QP 4P2MA 3PW5A 5BYRA 1XMOJ 2IMOA 4IZ9A 1PSDA 3ZNJ1 4BACA 2MY7A 3UCGA 1Z05A 2EVZA 4KAIA 3C16B 1CC8A 5KOXA 1MMNA 1VSKA 2HBLA 4P10A 1BWEA 1X9SA 4WCEQ 4L3KA 1F60B 3ZTSA 5GAGI 5EDWA 4A8XA 3EX7B 1CJUA 5AT1B 4KH5A 4YDXA 1KC8T 4MKVA 5KT4A 3K5NA 3EPIA 1MMLA 1H2VZ 2FGOA 4ZPVR 2CH6A 1VBYA 4CE9A 2YJEA 2MDAA 4DU4A 3BGRB 3W63A 2RRBA 3NGUA 3ILLA 3OL8A 1J2VA 3EZWA 1ZBFA 1IWGA 2DH9A 4D3GA 2XMVA 4RX6A 4CHZA 3POTB 4LFAF 1VSFA 4BQZA 4E19A 2QLFB 3H90A 4OJHA 4LFBJ 3UFCX 3LWMA 1RHJB 2YNHB 4E1JA 4IOCQ 3EKSA 2BQUA 3FC9A 4X62K 5HJXA 1NJZA 4CM0A 2LU1A 3LPTA 3W65A 1KVCA 2IY5B 4JRQA 4L3NA 4B9MA 4U7BA 5MLCQ 3OV7A 3F41A 2FVQA 4JP8A 1N33F 2ZJQQ 4LF4K 3GQCA 4PABA 1I94F 1F3FA 1HMVB 3I31A 3UKUA 2AMCB 2FUG9 1VQ6N 3RW6A 5HAOA 4XK8C 2UXCF 1DTTB 3CTRA 1JLCB 4IR1A 2LKZA 4FVUA 2Z2ZA 2MZJA 2EWHA 3ZSXA 1WKLA 3HYFA 2MKHA 5AQVA 1RLDA 3U02A 4QS9A 3KLGB 1Q95G 1S97A 1JLBA 2E9TA 4J9LA 2J76E 1XBWA 1YSJA 1S1TA 2YWWA 3MR6A 1X5OA 3HFVA 3DI6A 2A3ZA 1Y7PA 2P1JA 3GCXP 4J9SA 5BREA 3C6UA 5LMUF 2BVZA 2C2ZB 4ZP7A 4PKHA 3Q2TC 4JI1J 1QAXA 4BE1A 2MMYA 2NRWA 1X5TA 3OR1A 3H3NO 3A8YA 5ETSA 1RHKB 4M5HA 3W7BA 4A8KA 4FWKA 3GIRA 2BJDA 1PBUA 2APOA 2F8EX 4NYPA 2G8WA 3MK6A 2W24A 4LF8F 4DWIA 3GG0A 2E5LF 2CQ2A 2HLUA 4P72A 4ILJA 2FYXA 2MQ8A 3H3OB 1BUPA 3LTOA 1K1SA 3SUOA 5HP1A 4C8OA 2HHHK 5B0BA 3RMDA 3V6DA 5F0UA 3VEXA 1HNWJ 4LY7A 5KI6A 5AQXA 2Z58B 4QIWD 3O9UA 5HVFA 3TEHB 2AQ4A 5L39A 5B7WA 1U7LA 3CDUA 1UW4A 4GVEA 4OI2A 5C42B 3L3CA 4BR9A 1YUWA 1X4EA 1IJFB 5J2MB 1OS5A 2NPIA 4PG5A 2ETJA 3SQ1A 5A8KB 3B6PA 1VQNN 2V34A 2JSXA 1XJWB 4AHVA 3OVSA 3RMCA 5E7OB 4BRDA 2P9IB 5LSLA 3Q8YA 3LAMA 4X4NA 5BRHA 4BC2A 2HLTA 3BGFA 4NI2B 1I5OB 1NGDA 3MWTA 3UD3P 4DV4K 3A0IX 2R2SA 3C95A 3CJ3A 2W2PP 3S41A 5KFTA 2YKNA 2LMIA 1SC4B 4Z0UA 5JLHA 3R6GB 3ZT1A 2HHUA 1BQMA 1SJRA 2KG1A 3FEZA 3D67A 3WZ0A 4DV0K 4B3SK 2L9NA 1DRZA 1RHUB 5I4MA 3VTHA 3MDQA 4DSFA 1EZZB 1BA0A 3RVCA 1S5ZA 4NASA 4Z7CA 1PBAA 3TR5A 4R79A 3M2UB 5IFMA 2IRUA 4BHQA 3W9IA 2NCKL 3QRRA 4PQAA 5B0GA 1CS4B 1SQKA 5AQOA 2HHWA 4HH0A 2E2OA 3G82B 1U04A 3BO2A 2ZZMA 1NRKA 4FCYA 4JHDA 4PY5A 4WK3A 3MEDA 1NZAA 4QWBA 2QWLA 4B9LA 3G6YA 2ZE2A 2KT5A 1RTZA 3DRSB 2JWLA 4LMZA 1M5SA 2X1GA 1RTIB