1IKYA

Hiv-1 reverse transcriptase in complex with the inhibitor msc194
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikyA05
4ECSA 3EZUA 5DGAA 3QIPA 1N6QB 2IJNA 1JXLA 2YNGB 4JUZA 5F8IA 2OPQB 5DMRA 1IKVA 5F9LA 3ZCMA 2RKIA 3L2RA 4CJLA 4BACA 2V4QA 4Q5VA 4WXOA 1JLQB 5DK5A 4AHUA 1NK6A 3E01A 3TAFA 5KTQA 3OSNA 2F8TA 1S49A 4W5RA 3BDPA 4KTZA 4ED7A 3PR5B 3L2VA 4IH6A 1JLFB 4IG3A 2QXFA 4M3ZA 1RA7A 3DYAB 1R0AA 4LQ3A 3KD5E 1BIUA 4QWEA 4LSNB 1HPZA 2OH2A 1EETB 3NAEA 3K59A 4O4RA 3S3NA 3NH1A 4Y1DA 4ZPDA 3VQCA 1N56A 3OVNA 4CJVA 3CJ3A 2VG7B 1RT2B 1NJWA 2EX3A 4ID5B 1CSJA 5SZTA 4WYWA 1UA0A 1BQMB 5KGXA 3IGVA 5I42B 1RDRA 3KLIA 1S6PB 4F50A 3DLGB 5HLFA 4CFAA 2AQ4A 4RW9B 3SV3A 3RRHA 2EC0A 4IH5A 4E3SA 5DQHA 4BE0A 4AHVA 3DLEA 3G6XA 3GIJA 5KFSA 5FDLB 2P5GA 5HROA 1U48A 4KHYA 2V4RA 3QIPB 3S3OA 1GX6A 4M3TA 3TQ1A 1TKXA 3AO2A 4Y2CA 4FLYA 1T94A 4URQU 4CFDA 4KB1A 2XHBA 1RYSA 2RKIB 4O55A 3HXMA 4Y2AA 3QNOA 3QESA 4BDPA 1S9GA 5KFWA 3E01B 4FJJA 4ZPBA 1Z4UA 1J5OA 3Q8RB 4YR0A 5DLFA 4Q0BA 3AVMA 3CO9A 4C8OA 2WONA 3LP1B 1NKEA 4FW2A 4IG3B 5L1KA 1R0AB 3FRZA 4ED6A 3KD1E 2I5JA 2B6AA 1L3TA 4NLTA 1XC9A 1C1AA 4F4XA 1LWEB 1RT3A 1L3UA 4CEAA 4OPJA 3OL7A 5E41A 3SUNA 4CHZA 4O3QA 3SZ2A 1S4FA 4ELVA 4RNFA 5DG7A 2XY8A 4ECQA 2BRKA 2DFFA 4FLVA 3BQ0A 2C2RA 2FBTA 1TKDA 3MECA 3DRRA 3QETA 1VSIA 4OJRA 3ULDA 3NH2A 4M94A 4FK0A 4URSA 2ZD1A 3SUPA 2RF2A 2FJXA 3KMQA 3VA0A 4DFJA 1RT6A 3SQ1A 3DOKA 1JXEA 1NK4A 3NAIA 2XI2A 5I3UA 3C94A 3PV8A 1A5VA 1JLCA 2ZE2A 4NYFA 3CVKA 1BCOA 1XHXA 4I7FA 3BSAA 4JLHA 1TKXB 3K58A 3V6HA 4CHYA 4ECRA 4NCBA 4KI4A 4PWDA 4OLBA 3PO4A 3PZPA 1KFSA 1S9GB 2ZQBA 2KFNA 4B8AB 4ZP6A 1TK5A 2BE2A 3P5JA 4KHNA 1RTHA 3V81A 2WOMA 4KSEB 1TK8A 2O4GA 4CJ3A 3KTQA 2HVIA 4K8ZA 1C0UB 5CY4A 2I5JB 1RT5A 3BQ1A 2RPIA 3L8BA 2B6AB 2W7OA 4FZXC 2PYLA 4ED3A 4KAIA 3MFIA 4G3IA 3NGZA 3BGRA 4ECYA 2Y1IA 1IG9A 4KRFA 2FLLA 3PX6A 4FJ7A 4EBCA 4ECUA 3BR9A 4BE1A 3JYTA 4IKFA 2QKBA 3MF5A 5F8GA 2JEFA 2FVQA 5KG0A 3L3VA 1C1CA 4RUAA 5J2MA 2FVCA 1L3SA 2JEGA 4NLQA 3CDWA 1RDCA 3V4IA 1XI1A 4B9SA 4GC6A 3ALYA 2HMIA 1HRHA 2ZD1B 3H5UA 3MEEA 2RF2B 3AVNA 3KLHB 1FKOA 1RT6B 3G6YA 2FVPA 3PUFA 3DOKB 2DFHA 1O1WA 2HHXA 5I3UB 2QK9A 3I5AA 3SCXA 1JLCB 2ZE2B 4CGHA 1NJZA 4KO0A 3RMDA 3THVA 3CJ2A 5J2NA 4QOZB 1C1BB 3N6NA 1RDAA 4GW6A 2KZMA 4MH8A 4ELTA 3NH0A 4IDKA 3KMSA 2O5DA 3LP2A 2KW4A 5KFIA 3AVJA 4RUCA 3H4BA 1YVUA 5KFRA 1VSMA 1S9FA 2XY5A 3NGIA 1Z26A 2BQUA 4FXDA 3V81B 2WOMB 5HP1A 3ZSVA 4CJ5A 4TYBA 3GQCA 2D3UA 1KVBA 1RNHA 1ASUA 2F96A 1RT5B 1JLEA 2R2TA 4DF4A 4OKEA 1KLMA 3GIIA 1HYVA 2QKKA 3QEXA 3BGRB 3B6PA 4M3RA 4BDYA 4ECVA 4PUOA 1GOBA 4BDZA 3JYTB 3GV5B 2C2EA 3ZT3A 4PQUA 4LSLA 4NLDA 2XRIA 3AVFA 3NF6A 3QIOA 2WTFA 4MKAA 3EPGA 1LW2A 3V4IB 5KG7A 5L1JA 4OL8A 2HMIB 2HHQA 4MK9A 1C2PA 3HL8A 4O3PA 3MEEB 3OS2A 4RW4B 1FKOB 4Q45A 4DTUA 3CWJA 4ELUA 3CIZA 1CXQA 4NCGA 1B9DA 3SV4A 3KKSA 3VN5A 3I0SB 1YTAA 4FCYA 3ZSYA 5J2NB 1VSJA 2C22A 3VQ4A 3OYIA 1J54A 5EUHA 3AA3A 1HQUA 4PY5A 5C24A 1SV5A 1W9HA 3LP2B 2W8LA 2VG6A 2ASDA 5D3GA 3CJ5A 4FZYA 2BANA 3AO4A 1SL0A 2FVSA 2HHTA 3FFIA 3H5XA 4X2BA 3M8SA 2W42A 1U49A 2OA8A 4J9OA 2BQ3A 4B3OB 1KFDA 1JLEB 4KHSA 4CJQA 4H4MA 3CFOA 4NYNA 4KPYA 3M8PA 1JL1A 3CM6A 4DQIA 4ED0A 3SPYA 4DWIA 4PUOB 1IKWA 1RT7A 2X74A 4NLUA 3OS1A 3IGNA 2IC3B 2IM0A 1RTJA 4Z0UA 2WHOA 2IMWP 3HVTA 1TKZA 4ZP9A 3WNEA 3NFAA 4KTWA 4YNQA 1SKWA 1LW2B 3QZ7A 3VQPA 3H2LA 3I0RA 3O4NA 1D5AA 1NKCA 2R2RA 3HP6A 5KFKA 3AVCA 4RG8A 1U47A 5EU7A 1NK0A 3V6KA 4CK2A 4NCGB 2HHVA 3PW0A 4CGJA 4TQRA 1ASVA 3ZSOA 2Z1HA 4DTMA 4DTJA 1L5UA 1RBSA 4QWBA 3ZSQA 2XCAA 4W5QA 1RDBA 3KJVA 1HQUB 2G8UA 5C24B 1DLOA 1SV5B 1VSKA 4KV8A 2VG6B 5CYQA 4ZVFA 3UPFA 3I5BA 4M3UA 1VSHA 3LPUA 3TABA 3KOAA 2BANB 5KFNA 4NLSA 3ZT0A 4ECXA 4I2PA 3EPIA 4B8CA 3V1QA 4QPXA 3NF8A 4NLPA 3L2UA 4LD0A 4O0IA 1NOYA 2OZSA 2ASLA 1JX4A 2D0CA 4H4MB 2E9RX 1WSJA 3G86A 3M8PB 3UQSA 4CK1A 3KK2A 4DQSA 1IKWB 3DI6B 1RT7B 4KREA 1HJRA 1RTJB 3EY1A 3PW4A 3S3MA 3HVTB 3AVLA 5KI6A 3OYLA 3HVRA 1DTQA 5F8JA 5C25A 1LAWA 4MFBA 4O3OA 3I0RB 4HUEA 4EZ6A 4DQQA 1D9FA 3RMAA 3TAQA 4FJ5A 1FK9A 3IRXB 1BGXT 4F3TA 2VWKA 1L3VA 3QLHA 2HVHA 3KIOA 1B9FA 4O4GA 3AVIA 4Z4HA 4CJUA 1ZBFA 4M95A 2BRLA 3KHHA 2E9ZA 4KHQA 4CIGA 4KV8B 3MR5A 5CYQB 4J9NA 3KLGA 5J2QA 4NYZA 3OYDA 3RBDA 3NE6A 4F2RA 2A1SA 4FJ9A 4I2PB 5F8LA 5F8NA 3C6TB 4KBIA 5KT7A 4KTQA 4N41A 1I3AA 1KHWA 1RT4A 3RB0A 5FRMA 5SWMA 3BSOA 5CZ1A 3HVAA 2HNZA 4DL2A 5KFUA 4WZQA 4EO6A 2G8KA 2OPSA 4GMJB 1T7PA 3V1RA 1VSFA 2R8IA 2F8EX 1NOZA 4WE1B 4WZMA 4BWMA 1S1WA 2G8IA 1IO2A 2HWHA 4GVMA 1DTQB 2G8HA 2W9AA 4RNNA 5C25B 4BWJA 4MFBB 5EWFA 3OYEA 4B9VA 3KLEB 3TI0A 4LH5A 1NJYA 3OLAA 1S1TA 5KRSA 1Q9XA 3H5SA 1HYZA 4DL5A 5DQIA 3SNNA 3DMJB 2HHUA 4URGA 3QGIA 3GYNA 3PO5A 3QGHA 1G15A 4TXSA 1U04A 4RW8A 4O4GB 4YP3A 3SFUA 3OYFA 3LZJA 4CE9A 4ED1A 1U4BA 2P5OA 4CJTA 4CEBA 1VRUA 3H08A 3SFGA 4WFYA 1C0MA 4RW6B 3JSMB 4CGDA 5J2QB 2ATQA 1IKYA 1VRTB 1QTMA 4ZTJA 4DSEA 1KCFA 1LWCA 1HNVB 4AH9A 5JUMA 3QEVA 3KLVA 2IA6A 1MU2A 3GV7B 4Z4FA 1RT4B 4TN2A 4O5BA 1REVA 1TQLA 1X1PA 4Q44A 4FJIA 2HNZB 2ASJA 2AGQA 2OPSB 1WSFA 3T5JA 5K14A 4DL3A 4EP5A 4CJWA 1IKVB 4DSFA 3V1OA 1N5YA 2BGGA 3AA4A 2YKMA 3U6FA 2OPRA 4HKQA 1JLBA 3N6LA 1W0HA 5KT2A 4ZPCA 1QHTA 1YVFA 4I9LA 4KHRA 4HYKA 1S1TB 5HBMA 4TLRA 1HPZB 4ED2A 3G6VA 2XGQA 3OY9A 4RW8B 4DTNA 4HUFA 3K5LA 2WB4A 5KFCA 3T5KA 4K4WA 3RAXA 2HAIA 1XWLA 2GC8A 2BDPA 1K6YA 4EYHB 1HARA 3VQQA 3OYBA 4FLWA 4ECZA 5KG4A 3KLIB 2J6SA 3NBPA 4FLXA 5HLFB 1IKYB 4DFPA 1LWCB 4KI6A 4O0JA 3CG7A 4CHQA 3VQAA 3DLEB 4FLTA 3MR2A 5CZ2A 4I9QA 4IRDA 3G0ZA 2Z1GA 1MU2B 5HROB 3WNFA 4IBNA 3LZIA 1REVB 2W9CA 3DM2A 3AO3A 4E1MA 3OJSA 2IM2A 4KE5A 5K14B 5KFPA 4CGGA 4ZPAA 3ZSXA 2XC9A 3NHGA 1Y97A 4HTUA 4DL4A 2D5RA 3GV8B 2AGPA 2OPRB 2Z1JA 1J5OB 1D1UA 4E19A 3AO5A 4Q0BB 3KHRA 1ZTWA 2WONB 2FJWA 2LSNA 3SUOA 3PHEA 3F73A 3PW2A 4NLGA 3CQ8A 5HBMB 1YTUA 3T3FA 1RT1A 4B9UA 4J2AA 3L2QA 3PJXA 4H54A 3ASMA 4NRTA 2D0AA 3RRGA 1EXQA 1S0OA 4O3RA 5KT5A 1RT3B 1K1QA 1S5JA 3LDSA 1ZBHA 1CLQA 1SL1A 4CEZA 2IAJA 5KG6A 3S9HA 4C8NA 4CIEA 3NKYA 2DY4A 3I8DA 2OZMA 3AVBA 4PA1A 3MECB 4XIUA 3DRRB 3QO9A 2JC1A 1S1UA 3HPHA 2JEJA 2X6SA 4KAZA 4M45A 3V9ZA 5C5JA 3E51A 5KFOA 1T03A 2W9CB 2FBYA 2XO7A 3HT3A 3BSNA 3LP3A 4I7FB 4OKJA 3GIMA 2W7PA 2IM3A 3T1AA 4PWDB 4Y1CA 1N48A 4B9LA 3FQKA 4IQXA 4CHOA 4Q43A 2P1JA 2KZZA 4CFCA 2IS3A 3L3UA 4K8XA 2HHSA 2BE2B 5HRRA 4K4YA 3MXJA 3NL0A 4K4ZA 1RTHB 1WLJA 1EP4A 4RW7A 1A5WA 3QYYA 4ZVGA 3DLRA 4ICLA 3SJJA 2RDJA 4Y3CA 3T5HA 4E1NA 4AHTA 5KT6A 4FYDA 2UUTA 4XPEA 1ZBLA 3MXIA 3AO1A 4CF9A 2IAJB 4FLUA 5KG2A 1T8EA 1KSPA 2PY5A 4IFYA 4F4YA 3MAQA 1C1CB 5J2MB 1HYSA 3QO9B 4YFUA 1HMVA 4M3XA 1VSLA 4CHPA 3D0PA 4CF0A 1S6QA 4E7JA 1S1UB 2HHWA 1IH7A 3UDLA 1WAFA 5EWEA 3ZSZA 2J6TA 3D28A 4DQRA 2V9WA 3IG1A 4G1QA 2XWYA 5KGWA 5KG5A 5L1IA 4IFVA 4OLAA 3OL9A 3C95A 4DG1A 1UA1A 3DLBA 4YR2A 1NNDA 4NLWA 4DSJA 4KO0B 1X9WA 3BREA 1S48A 5KT3A 5KFMA 4IDKB 3UR0A 3PW7A 2YHBA 2VA3A 2VG5A 2D3ZA 3KHLA 4TYAA 3HYFA 2A1RA 3G10A 3ISNC 2DTUA 3OS0A 2C2DA 5KRTA 4C8MA 1JL2A 1BISA 1QSYA 3QNNA 4MK7A 1ZTTA 5HP1B 1JIHA 1EP4B 4RW7B 1TV6A 3SPZA 4CCHA 4C8LA 3CJ0A 1B92A 3TAEA 1TK0A 3V6DA 5L9XA 4ICLB 4CJSA 4KFBA 5EDWA 1KLMB 3BSCA 3V9UA 3VQ5A 2IOCA 2XI3A 5DG9A 4CJEA 4XPCA 4J9KA 5L1LA 1BQNA 4RU9A 2RDIA 5HRNA 3K57A 4PQUB 4IFYB 4LSLB 4U6PA 2AWZA 4CF2A 1HYSB 3U3GA 3A2FA 1HMVB 5EWGA 1MMLA 3V9XA 3NCIA 1S6QB 2UVVA 4K4SA 5KFAA 1QSLA 2YHAA 2D7SA 4KKOA 5J2PA 3FSIA 2UVRA 4NLRA 3O3FA 2QE5A 4DU4A 4DL7A 3I5CA 4JRPA 1WAJA 4QWAA 1NKBA 5KG3A 4DTXA 4O44A 3TANA 1LW0A 4FJ8A 2UVWA 4FBUA 3KK1A 2VG5B 4TSXA 3MEDA 2ILZA 1NK7A 3TAPA 3V9WA 3AA2A 1W25A 2YNFA 5D3GB 4F4KA 2FVRA 2IM1A 3HKWA 4FM2A 1LWFA 1K1SA 4DEZA 1BHLA 4NLVA 3FFIB 2AJQA 1JXBA 1NHVA 1RDDA 3OYHA 1NJXA 1S0MA 1EX4A 1QS4A 2FBXA 4E0DA 4I2QA 2AU0A 1J9AA 4KFBB 4K50A 1TVRA 3M9NB 1KRPA 2B5JA 5KFHA 1BQNB 5F9NA 4MKBA 3NF7A 1VSDA 2GBZA 2JLEA 4YR3A 1XHZA 1TKZB 1N6QA 4AHCA 2EHGA 4W5NA 3PY8A 4CF8A 4DQPA 2R2UA 1RCHA 2OPQA 3VQ6A 2IBKA 5CYMA 3DLKA 5HRPA 3RTVA 3HO1A 4KKOB 5J2PB 3Q8SB 3RR8A 2VA2A 3SQ4A 3CJ4A 4OPKA 4HCBA 4NLYA 1JLQA 3PW5A 5C42A 2ALZA 3QEIA 5KFYA 4ECTA 2XY7A 3QEPA 2UVUA 3SUQA 4QWDA 3CFRA 3KJVB 1XR5A 2B4JA 1DLOB 4CGFA 4LSNA 1WSGA 3MEDB 3CDEA 4CGIA 4RNMA 4CERA 1HNIA 4ZHRA 2BR0A 2YNFB 4WXWA 3TAMA 5KFBA 3C6UA 2DPIA 4WYLA 3SYZA 2RN2A 1J53A 2GIRA 4I2QB 4DTPA 1WSEA 4CEQA 3SI6A 4J2BA 5I42A 1TVRB 2G8WA 3DLGA 3Q8QB 3OJUA 4K4UA 2JEIA 4KHUA 3ZSWA 4FJGA 3KK2B 4DSIA 3SQ0A 3UIQA 3O3GA 1XR7A 1UAXA 2VWJA 5FRNA 4LY7A 2JGUA 2ILYA 5FDLA 4UQGA 3KNAA 3FQLA 1WNEA 1OS5A 4EBDA 4KHWA 2HWIA 3LPTA 2FC0A 4DTRA 3SQ2A 1FXXA 5CYMB 2YKNA 3DLKB 2WRMA 5KT4A 3WNHA 2HB5A 2IGIA 4AILC 1FK9B 4KB7A 1LAVA 4B9MA 3OLBA 5C42B 1F21A 3QLHB 2DFEA 5F8HA 4JV0A 1RAJA 1T3NA 3CYMA 1X9MA 4J9MA 1JLAA 3TVKA 3LP1A 3NGDA 3OL8A 5F8MA 4CEFA 2HNYA 2R8JA 1QAJA 5T14A 1CZBA 1VK0A 4OVLA 1NK9A 4DLGA 3QZ8A 3K5NA 1HNIB 4ZHRB 3KLGB 3GILA 3VQ7A 3TAMB 1LWEA 4FS2A 4JRQA 4FJXA 3C6UB 3OHAA 3IN5A 1SKRA 2Z1IA 4WFXA 3WNGA 4J2EA 4EZ9A 4ZP7A 5KFVA 3M8QA 3H98A 2IDOA 3K5OA 4E89A 2KTQA 3ZT2A 4R5PA 4EBEA 5KFDA 3TWHA 1TL3A 2C28A 4W5OA 1KVCA 1S1WB 3VQDA 4L8RB 3BQ2A 3DRSA 2WK4A 1WSHA 3K2PA 4ED8A 3LWMA 1TP7A 3MFHA 4FJHA 1I6JA 3ZT1A 4N56A 4ECWA 2YKNB 4IR1A 3V9SA 4F4WA 3OSPA 1TKTA 1IM4A 5DLGA 5KG1A 3O3HA 4AHSA 4MIBA 4DL6A 2ZKUA 1SL2A 1JLAB 2KQ2A 3PX0A 3VQ9A 2HW3A 1GOAA 5DG8A 5JXSA 4AHRA 4H8KA 3AVGA 2HNYB 4DU3A 3AVHA 1C0UA 1VRUB 1A5XA 3HSTB 4FS1A 4IRKA 4ZVEA 1QE1A 4FM1A 4XO0A 1WNSA 3LALA 4CFBA 4MK8A 3VQBA 1RILA 1S10A 2E4LA 5KFXA 4CEDA 4DS5A 1ZBUA 1QUVA 3MTKA 1S1XA 3M8QB 2Y1JA 4IKAA 3H5YA 3QGGA 4YQWA 2XCPA 4R8UA 1SUQA 4LQ9A 4R5PB 4IR9A 4DMNA 1TL3B 3B6OA 3KLHA 4J9RA 1N5YB 4Q8FA 2PZSA 3KHGA 4OKKA 2YKMB 4NRUA 4NLOA 1QQCA 3FDSA 4DSKA 1RBRA 2AX1A 2P51A 3DRSB 3LAKA 2DPJA 2OYQA 1JLBB 3OYKA 3MEGA 3HPOA 3TAGA 4FW1A 4RNOA 2J6UA 3TARA 3AVKA 4RNHA 1C1BA 4E7IA 4QAGA 1QAIA 3RB6A 1DTTA 4DTSA 4FZZA 1Q8IA 2V0NA 1TKTB 1KVAA 1WSIA 4E7KA 1UOCA 2CKWA 2HNDA 1TL1A 1LV5A 4EEYA 3L2WA 4JV2A 4DS4A 3KK3A 3NF9A 1C6VA 4OGEA 1QE1B 2WCXA 3CM5A 4B08A 2GUIA 3H4DA 3V6JA 3NBPB 3P1GA 4LH4A 5KFQA 1KTQA 4DFMA 1X9SA 4J9QA 4CESA 3PR4A 4HCCA 4QW9A 4CEEA 3T19A 1S97A 3PX4A 2R8HA 3M8RA 5KFLA 3DDKA 5KFJA 2D0BA 1U45A 1S1XB 5FROA 2F8SA 3DM2B 3OYJA 1XR6A 1SH3A 4CF1A 1IKXA 3SI8A 1SH0A 4R8UB 4E7HA 1SUQB 4J9PA 4NLXA 4RW4A 3GIKA 2GV9A 1FKPA 3DLHA 4JS5A 4C8KA 3OL6A 2X78A 4IG0A 2BQRA 2R2SA 3I0SA 3MEGB 4O3SA 3MR6A 4ZP8A 1BI4A 4N76A 1YT3A 4FJNA 2YV0X 1DTTB 1RT1B 4F3OA 1RBVA 4J2DA 1RTDA 5T7BA 3D5MA 3ISND 2QV6A 4FM0A 3VA3A 2HNDB 1TL1B 4ID1A 1Q9YA 1NHUA 3OYAA 4DF8A 3HM9A 2G8VA 4DU1A 5DGBA 1JLGA 3IS9A 3MR3A 4ZTFA 4TY8A 3M9MB 3KK3B 1RYRA 4B3OA 2E6LA 1UWBA 4Z4IA 1RBUA 4DFKA 3EYZA 4MQ3A 4CECA 3ZT4A 4CJ4A 4TQSA 4EO8A 3DRPA 2XGPA 2IC3A 4QCLA 1T03B 1BCMA 1C0TA 2R7YA 4FJKA 3PVXA 1IKXB 4NCAA 4R0EA 1ITGA 1TGOA 4EP4A 2YNHA 4E7LA 2AGOA 4YMEA 1ZYQA 3RMBA 3D45A 4RZRA 4CJFA 2KFZA 1ZETA 1FKPB 4BE2A 3AV9A 1TAQA 1GX5A 4IG0B 2W8KA 4N47A 1NK5A 2FJVA 4WFZA 2W9BA 1NK8A 4K4VA 1BI4B 3ITHA 3DOLA 3OYMA 2ETJA 1CXUA 1JKHA 5KFFA 3HPGA 4JS4A 2YNIA 2I1RA 3AA5X 1QSSA 1RTDB 2G8FA 3CDUA 3O4QA 3VQ8A 2D41A 4QW8A 1WN7A 1GOCA 2FLNA 2JC0A 1ZBIA 4O3NA 4GC7A 3Q8PB 2B43A 4EYIB 3PJWA 4J9SA 1JLGB 4TY9A 1RTIA 3IS9B 4TY8B 3KLFA 3RWUA 2NUBA 3ZSRA 1SKSA 3VQEA 3LP0A 1UWBB 3RB4A 3N6MA 3M9OB 3QERA 2FBVA 2AX0A 2E9TA 2R8KA 3ICLA 3MXMA 3H40A 3DI6A 3DRPB 4M3YA 1D9DA 3NGYA 3IG1B 4NZ0A 4G1QB 2ATLA 3HJFA 5KFZA 2X6NA 4Z4CA 3LAMA 1S9EA 1C0TB 4IFVB 4DG1B 2IJFA 4M3WA 4FK2A 4CEOA 4ZMMA 4HHTA 2YNHB 2ITGA 3RB3A 1S1VA 3NDKA 1CZ9A 3LANA 4F4ZA 3H59A 4FBTA 3CFPA 3AVAA 4ZVHA 4Q8EA 3RR7A 1SH2A 1N4LA 3IRXA 4H4OA 5DQGA 2OPPA 1EKEA 2W9BB 1D8YA 1HQEA 1KLNA 1TV6B 1I39A 4CIFA 3ITHB 3DOLB 2FLPA 4FLZA 3QEWA 5J1EA 3BJYA 3V6DB 1TAUA 2UUWA 4IH7A 4Z4GA 1JKHB 4CK3A 4K4TA 4FJLA 2YNIB 4IRCA 2XY6A 3HHKA 3QIDA 1T05A 3EZ5A 4J9LA 1D0EA 3C6TA 1RTIB 4FK4A 4OGCA 3KLFB 3OYNA 3OHBA 3LP0B 3VQSA 3K5MA 1ASWA 3KKRA 3TR8A 2CJQA 1KHVA 4HUGA 1U09A 4M41A 2YNGA 4W5TA 5KFGA 4K4XA 3NMAA 5KFTA 4DTOA 4WE1A 2Q3SA 4QWCA 3RAQA 1S9EB 4M42A 1S0NA 4KB0A 3OYGA 1BIZA 2GIQA 3U3YA 4FVMA 4O44B 2PYJA 1LW0B 1S1VB 3KLEA 4B9NA 1JLFA 5HRSA 3IAYA 1Z25A 3DYAA 3KK1B 1BL3A 4N5SA 4Y34A 4JV1A 1VSEA 3DMJA 2O4IA 1EETA 3T5LA 2R8GA 4DSLA 5JS1A 4H4OB 3RMCA 3LWLA 2OPPB 4Z4EA 1HQEB 1LWFB 2VG7A 4F8RA 1RT2A 3RBEA 3P83D 4CJKA 4F2SA 4CJPA 4B9TA 1RBTA 4ID5A 5J1EB 4KHMA 3OYCA 3HK2A 1BQMA 4U7CA 4HVJA 4IOBA 4CJRA 4RW6A 3JSMA 1RA6A 1S6PA 4CHNA 3NAHA 3F9KA 5JS2A 2E6MA 1VRTA 5KFEA 4DLEA 4RW9A 2B5JB 4MIAA 3QINA 3HVWA 1T05B 1HNVA 4FJMA 3HP9A
chains in the Genus database with same CATH superfamily
2BKPA 2GIFA 3U1MA 5HOOA 1JXLA 2QLBB 2ZBPA 3VVUA 2A42A 2ZH2A 2OPQB 5DMRA 3ZCMA 4CJLA 2X1GA 2VOOA 3DN9A 3M6XA 2FY8A 4QIVA 3MWBA 5IOLA 1NK6A 4HWIA 4QS9A 4ZPVR 4I6MB 4GKKK 3ZX3A 2X3DA 3FGVA 3AOAA 2P9NA 3L2VA 5FJ4A 2GELA 3C8YA 3KD5E 1BIUA 3GZ7A 2J0QD 1SS6A 1X0FA 2KXNB 2OH2A 4O4RA 3NH1A 3VQCA 3VAJA 4USKA 1T3VA 3CJ3A 2VG7B 4J8FA 2EX3A 1WF0A 4ID5B 4CNZA 5I3PA 5SZTA 4RR5A 2MQQA 4ZPTR 3PIPQ 2A2CA 4X84A 5THWA 4X4NA 4QOTA 5GAHI 1S6PB 3TEGA 4CFAA 2FD2A 4J91A 4B1YB 2EC0A 3G8SA 2O66A 3R7SB 2Q1LA 3DLEA 3G6XA 1UCNA 3GIJA 3CPWR 5HROA 5HMYA 2VPYB 3S3OA 1P6TA 2GEMA 3L6QA 3R1HA 1TL5A 1GX6A 1NM2A 3THXA 3AO2A 2FLOA 5L8RC 3U4LA 1CEZA 3LQVA 2OFHX 1VBYA 4Y2AA 3QESA 5KFWA 1DFDA 1MROB 3R9LA 4PXDA 4FJJA 2DNKA 4ZPBA 3KDNA 1Z4UA 1J5OA 3AVMA 3NVMA 1N52B 4EAHD 1O8BA 3CCQS 3JB9k 1I94F 2I5JA 4AL6A 1L3TA 4IJAA 4NLTA 3AQOA 3NOCA 3IKMA 2POKA 5BXIA 1IBLJ 4CLLA 5I3QA 4RNFA 4H5RA 1SC6A 1WSVA 1ZXOA 3IC1A 1LQ9A 4P2XA 3CCEN 2FGOA 2C2RA 1TKDA 3MECA 1MWMA 2ZJRL 4IOAQ 3W63A 1NSKL 3NH2A 3UDCA 1AA1B 3VAKA 1YLXA 4MO4A 1N32J 1P1LA 4DFJA 1YAGA 3DRYA 1Y11A 3NAIA 4YDXA 2PO4A 3W64A 1LEOA 2ZE2A 2ZGYA 3TO8A 4ZCKA 1TKXB 3RAMA 3K58A 2CPZA 2FTRA 1WJ9A 5CHIA 4AT1B 3PZPA 4B3MJ 4QIEA 1KFSA 1S9GB 2AYBA 3VEXA 1TK5A 4BR9A 3D54A 2RRAA 2ZJPQ 1RTHA 4V19S 2WOMA 4CZEA 2O4GA 2HVIA 1KVJA 5A6PA 4K8ZA 2QM1A 3FJ2A 5A6WA 2RPIA 2B6AB 2V4JB 5H9FK 3CERA 2KT3A 2E66A 2QJ3A 1T9UA 1NJIT 3NGZA 2EVZA 3BGRA 4ECYA 2Q6CA 3DDIA 3MMCB 3PX6A 3Q22A 5ETTA 2WTUA 3TUZC 3I87A 3GPAA 3UKUA 2HBZB 2JEFA 2PFFB 1UVIA 3L3VA 4PCQA 4ETXA 3O9TA 2FVCA 3CDWA 2OI2A 1XI1A 1HRHA 4NA1A 2V6AA 4UZBA 3MEEA 3I82A 3T6BA 1FKOA 1RT6B 4BR7A 3DOKB 4GMKA 4LT6A 4DPOA 1ILYA 1WBDA 1WKJA 4LF8F 3SCXA 1FNOA 1NJZA 4KO0A 4CIOA 3CJ2A 4QOZB 5D0GA 1OJ4A 2OEJA 4F4AA 3QFPA 2KZMA 2EXUA 3PRDA 2VGMA 3IAS9 3NRBA 2KW4A 1FTRA 2HVEA 3A4TA 1IR0A 4KY3A 3DOMB 3THTA 4FXDA 1HKGA 1KVBA 2OCEA 2DR7A 3P45B 1R8PA 1RNHA 2DCLA 2R2TA 1RGIA 2KJVA 3CCSS 4CM2A 4DR1F 4I6AA 3MXHP 2KI2A 3H20A 2MY7A 3JYTB 4WFAL 4ILRA 5GMDA 2BA9A 4NLDA 3N9UC 2XRIA 3AVFA 2A2DA 2L9DA 2WTFA 4WP3A 5AQFA 4K43A 5L1JA 1HI0P 2IVPA 3HL8A 4ZVUB 1S79A 1Q81O 3IRWP 3OS2A 1AB8A 1V3ZA 4DTUA 5K8MA 3CWJA 4ELUA 1CXQA 3PYEA 1VHIA 2RB7A 1B9DA 3SV4A 2UYTA 4QPTA 3VN5A 1JWWA 2YWHA 4UOHA 1VSJA 2C22A 3OYIA 3RZAA 3C6HA 3W0LA 1CJUA 3VESA 4BRLA 1PIEA 1W9HA 3E9OA 2GAHC 2PSZA 2GVDB 2M70A 5D3GA 2KXHA 3SMSA 3AO4A 1SL0A 2BABA 3H5XA 4X2BA 4LF8K 3LTOA 2RU9A 2ZGZA 4CJQA 3JQMA 2GO9A 1IBKJ 2AJFE 2P9KA 4KPYA 2W24A 1JL1A 3CM6A 4PUOB 1RT7A 2HQDA 2X74A 4NLUA 3TA0A 4JD2A 1DHMA 2WW4A 4QZVB 2WAQD 4ZP9A 3G8QA 1SKWA 1VLOA 4CNYA 1OQ6A 4DR7K 2KG0A 4USTA 2R9LA 1R6VA 4A8XA 3AVCA 4DR1K 5HJXA 4CK2A 2HHVA 1WC3A 1KEKA 2QIFA 2Z1HA 5CQGA 2QL5B 1L5UA 1RBSA 3M8WA 3ZSQA 4C2MA 1RDBA 3KJVA 1HQUB 4BBYA 3G82B 2DGOA 4ED4A 2B8QA 2CIMA 3BEGB 2GGPB 2K2PA 3TABA 3D2WA 4NLSA 1HBNA 4I2PA 2YQ1A 2YX6A 1QY7A 5LJWA 4YB5A 3V1QA 4B8CA 3EVOA 1RJJA 3R2DJ 3L2UA 2LA4A 2O8FA 2MLYA 1WUUA 4LD0A 1U7LA 2D0CA 3KK2A 2LXIA 1AZSB 1BG3A 3R3LA 4FPAA 1NU0A 3UD5A 3ZXWA 2F4VF 5GADU 1PAUB 1GLEG 3HVTB 1YVNA 3AVLA 1H2UX 1DTQA 2QL9B 4MFBA 2ZM6J 1K73O 5AQVA 3O2IA 2OO4A 3TAQA 1CJVA 5CZXA 4DV1F 2LCWA 1L3VA 2HVHA 1NSQA 1Q79A 1ZAVA 4USMA 3ISZA 3AVIA 2Z8QA 4CJUA 2CAJA 1X5SA 3RGIA 1T3OA 4OJGA 1WOOA 4BVOA 4WTOB 2E9ZA 3M30B 4CIGA 2LQ8A 4NYZA 4WF9Q 2CJYB 4WFNL 2FHKA 1AXQA 3N4QA 3IO1A 4DV2F 4V19J 2X1FA 2HBRB 2YKPA 3C6TB 1Q8KA 5KT7A 5AR0A 1QAYA 1T9YA 3BSOA 4JI6J 5CZ1A 4JV5F 3HVAA 2W01A 4DL2A 1VQ7N 5AQUA 4GMJB 4TU9A 2HQGA 1VSFA 2KYXA 2CPJA 2R8IA 1Q8BA 2ZHOA 1RWKB 3D68A 3CJSA 3QFWA 4UY85 2QWNA 1TYQB 2UUBJ 3I9ZA 1S7HA 4RNNA 5C25B 3EVMA 2HIQA 2GX8A 4HHJA 2QMXA 1WI6A 2ZVSA 1NJYA 3OLAA 2K3KA 2RQKA 3RW6A 4MT1A 3PO5A 4BGAA 2MZ1A 1G15A 4KQZA 1U04A 2V2ZA 2F4VK 4YP3A 2B9WA 4CE9A 4ED1A 3ZEUB 1EWRA 4MMOA 1MN9A 4DR5F 4RW6B 1BU6O 5T7LA 2JLGA 1IKYA 1VRTB 5C2FA 3GJSB 3M2RB 4ZTJA 3P6YC 4WIQA 1LWXA 1LWCA 6AT1B 2RQMA 3MMBA 2CNOB 4DV1K 1YRUA 4K25A 2F9DA 3PSIA 3L7UA 4Z4FA 3QT8A 4Q44A 3CMAN 3NNHA 4MLEA 4P2SA 1SJ3P 3J81O 2HSEB 4DUZJ 4DL3A 3HTVA 2RS2A 2H5EA 1IKVB 4DSFA 4R25A 2HFSA 4RUHA 2CJAA 4U95A 3UKRB 1R89A 1P8GA 1KD1T 5DDPC 4P73A 3VHQA 4I9LA 4KHRA 1Q82O 1UPMB 3CB4A 2ASOA 2D69A 3DDNA 4TLRA 1HPZB 1K44A 1QJHA 3LH2S 5A8KB 1XMBA 5JVGQ 3OY9A 3FZMA 4H5VA 4RBVA 4CI6A 2NZCA 2ROGA 1YJWS 5IWAF 2HAIA 2ZNYA 1XWLA 4U67L 1HARA 1K0TA 1T44A 3ZZOA 5E3QA 1BY9A 5DDOC 3NBPA 5HLFB 4DFPA 3TR5A 5AQSA 2R7OA 4DR6J 3MR2A 2VHGA 4IRDA 2L08A 3HI9A 4IBNA 4ZCLA 2W9CA 2NR0A 3SCIE 3DM2A 2HFZA 2N4CA 5KFPA 4NA3A 4X4VA 1TL4A 2BTFA 4ZPAA 4DR5K 3VENA 2ZJQQ 2V67A 1HHSA 4X4UA 4ZCMA 2MB0B 8ATCB 3M2UB 2OPRB 3LA0A 4UTGA 1HWUA 4E19A 2FJWA 1YHQN 3F73A 4HHUA 3CQ8A 5HO4A 3ETMA 5E3CA 3BO2A 1FNMA 1M1GA 2HFVA 1S0OA 3CO0P 5AT1B 2E88A 2MXYA 4BRNA 4MIWA 2XZTB 3TWZA 3UNGC 4OIXA 3GBTA 1CLQA 4A8OA 5KG6A 2DY4A 3W8PA 3I8DA 1ZPWX 3NGUA 3M8YA 3DRRB 4XIUA 2LEBA 2ZKTA 5E0OA 2JC1A 3CJ7A 1G1XA 4BR2A 1S1UA 2H5IB 4KAZA 1BDGA 5I9EB 4QU7A 3E51A 5TKYA 1T03A 4A5AA 5ETOA 3TZZA 3MUVP 3HT3A 3BSNA 4YEAA 3LP3A 3TX0A 1GNKA 5M2UA 4PHTX 3CJKA 5B7WA 2YH0A 2P9IA 3FQKA 3R3TA 4CHOA 3T69A 2EG2A 5AQYA 5MAOA 1RHKB 2IS3A 4OLOA 5HL7L 4K4ZA 4LF9F 3UCUP 4ES3A 2Z30B 2YHYA 1EP4A 3QYYA 4ICLA 1YJUA 3SJJA 2YKAA 1FDBA 3O5BA 1FXRA 4XH1A 3WX8A 4E1NA 5KT6A 2P2CB 5BYQA 1ZBLA 2IDEA 2EFVA 2O8EA 1TU0B 2DISA 5KQ8A 1T8EA 4IZ9A 3BPSP 4M63C 3ZC4A 5A8RA 1C1CB 1I1GA 3TZXA 5J2MB 3E9PA 4YFUA 4K8RA 5ETKA 1HX1A 1VSLA 3D0PA 2RSQA 4GKJJ 4M7XA 2XSJA 3VOVA 5E26A 3IUCA 2J6TA 1JJ4A 4DQRA 3GWCA 2E5LJ 3M1VB 4RJVA 3DLBA 1NNDA 3VR1A 4H0TB 2M52A 3SSSA 1U1PA 4YOVA 1X9WA 1MWKA 3LGNA 4DN9A 1AW0A 4AXIA 1ZOTA 2C3UA 3KHLA 2ZC3A 4J7CA 4TYAA 3BZQA 3GFXA 3ISNC 4FVCA 1LFWA 4RWWA 5IXUA 2C2DA 5KRTA 1WBBA 1BISA 3B78A 3PFOA 1QSYA 1VOMA 2PAVA 3O6WA 4MK7A 3OBIA 5HP1B 3SPZA 1TV6A 1BUXA 5D77A 4JHDB 5EXWA 3CJ0A 1B92A 3TAEA 1MG7A 3Q8UA 1VQLS 2EFOA 4QIGA 1D3WA 4P6QA 1CJKB 2QMUB 4JI3F 2XI3A 5L1LA 1U1NA 3VGUA 4ZVTB 3KWIA 2D9PA 5K20B 3K57A 4LSLB 2AWZA 3U3GA 2CWKA 2W6LA 1S6QB 3VF0B 2PGCA 1M5HA 1YZ6A 5KFAA 4YOWA 1HNZJ 4KKOA 2DGTA 5J2PA 4ANEA 2A5XA 4NLRA 1T11A 1ZM9A 2QE5A 2OTLS 3R1LA 4DU4A 2JX2A 2V8HA 1NGFA 4I69A 3VERA 2FC8A 1YTYA 4QWAA 4WQ4A 3ZZZA 1NKBA 1R0BG 4FJ8A 2UVWA 1NGEA 4ISFA 4ZVSB 1RAGB 4A47A 3ENHA 2UXCJ 1OPZA 4Y2IA 3TAPA 3V9WA 1UVKA 3HCXA 2IVNA 5HQMA 3GYGA 4WKYA 1LWFA 1K1SA 3SQOP 4C98A 4NLVA 3SEOA 2AJQA 3FFIB 1JXBA 1CG2A 1RDDA 3GFHA 4M8LA 1CZAN 1EX4A 3I6PA 3HOSA 2AU0A 4K50A 4OV6A 1TVRA 1N36F 3N01A 1B0VA 5BRFA 4YOXA 4Y0WA 1Z2ZA 2DIVA 5KFHA 4P75A 1BQNB 3EDQB 3NF7A 2GBZA 1FEHA 2JLEA 1XNRF 2XWXA 2EEYA 3SXLA 2OEMA 4QR1A 2CH6A 3EGZA 5IT9U 4W5NA 3S41A 3PY8A 4CF8A 1TMMA 2V52B 4M5JA 2OPQA 5CYMA 1ELOA 3AY9A 2LQJA 5H1SQ 2MZJA 1RKJA 4HCBA 4NLYA 2B4OA 2XY7A 2D0PA 3QEPA 4B3SF 4OZJA 4Y6IA 5GAHU 5SUHA 4DPUA 5D4PA 3MEDB 1BOTO 1WSGA 4RNMA 4CERA 5M2RA 3AD8C 2YNFB 2BR0A 2E1ZA 2G0CA 1WEXA 3QT6A 2I38A 1OWXA 2VBXA 4WYLA 1IJJA 4JYAK 2DEJA 4KGMA 1TR0A 4RCHA 3D6TB 1WSEA 1JQGA 3SI6A 3C65A 2W2MP 4HTIA 2DO4A 3Q8QB 2DNOA 3GU0A 2CQIA 5L9NA 1FFGB 4FJGA 4FNHA 2VFUA 2G1DA 2VWBA 3DXKB 1XR7A 2QLJB 1UAXA 4IDHA 2W6KA 5FPDA 1LFPA 4H4KA 1VC6A 2ILYA 4UQGA 4ISGA 3FQLA 1NDPA 1TUWA 3DJCA 2FC0A 4WP8A 3SQ2A 2DBBA 2Z2LA 3DLKB 4F0KA 1N36K 4DV0J 2VDIA 5LXRA 4M5KA 1N34J 4KB7A 1R31A 3OLBA 2LKZA 3GG1A 4OX7A 1T3NA 1X9MA 3C15B 1UZHA 3TVKA 3ILOA 1H38A 1HI1A 2FZKB 4MDAA 1XNRK 3NGDA 3OL8A 1NDKA 3A0IX 2MPUA 5T14A 4DX8H 3AXMA 2D0OA 3K5NA 4ZHRB 3NXZA 3DC2A 4ILMA 1KAZA 3T41A 3X3UA 4FJXA 3C6UB 4FOIA 3D6MB 4Q2LA 5M1PA 3I56S 2Z1IA 1VQOS 1HNXF 3WX4A 4CO3A 3WNGA 1BUPA 2VQFF 5KFVA 4X62F 1Y7PA 3H3OB 2HFOA 1YJNS 4OHXA 2AYEA 1RCOB 2Z2YB 3ZT2A 3F9MA 4OZ0A 1CBKA 3VAMA 1S1WB 3IWNC 3IM8A 2RRBA 3G87A 3FNNA 2WK4A 1WSHA 3K2PA 4G6VB 1R8CA 2UV8A 5LL6d 1VQNN 3ZT1A 3Q89A 5GMEA 4IR1A 1RWNB 1OPIA 3OSPA 1B64A 1AROP 2B7BB 3VCDA 3EGVA 2WVBA 4C3LA 4ENOA 1FI4A 3PTWA 1SL2A 2OJ3A 3K17A 1GOAA 4CBUA 4FWQA 5FPMA 1XQSC 2PEHA 5AJ3J 3PM9A 4LJMA 3HHLD 4FS1A 4ZVEA 3EL2A 2V4JA 4XO0A 3EKSA 3IWLA 5GIOA 1S22A 1H74A 3VQBA 2ZWPA 5AZJB 2E4LA 1M0SA 1N33F 3A8EA 3LF0A 4YY3F 1ZBUA 1QUVA 3M8QB 3AD7C 3QT7A 4IKAA 2XCPA 2FC9A 4R8UA 4R5PB 5JJBA 2ZDOA 4DMNA 3JQJA 3GR1A 2YWGA 4HI2A 4USUA 3CCTA 4NLOA 4MYTA 4NXNJ 1H3DA 3Q0AA 2VGNA 5BPMA 4IXCA 1QQOA 3OW2R 1HNXK 3OA9A 4FW1A 3TARA 4RNHA 1N0UA 1QAIA 3VGVA 3VGLA 4YHHK 1Q8IA 2V0NA 2HGNA 1KVAA 1WSIA 2CKWA 3T9ZA 3KG4A 4PAAA 1LV5A 2HMPA 1I51B 3JAMY 2W4PA 1XIQA 4ZLPA 2QSWA 1AYEA 1D8ZA 5FLXO 2MY8A 3CM5A 3V6JA 4CLUA 4PPZA 4RO0A 4LH4A 4CZJA 1VMBA 4DFMA 1X9SA 4CESA 3PR4A 1OVYA 4CLYA 5A76A 3D2FA 4HCCA 5GIPA 1NCLA 4BROA 3T19A 1S97A 1HNWJ 2DHHA 2V63A 1HHTP 1KC8O 3NG8A 4Z2XA 5KFJA 1U45A 2IYIA 3SMZA 1S1XB 4JKBA 1WC0A 3UR3C 1YJ9S 3OYJA 4CZCA 4CF1A 4C11B 1IKXA 4A57A 1SUQB 3G4SS 1TZ0A 2CNKB 1HWKA 1EQMA 4CM0A 3GIKA 4LF6K 3DLHA 1WHWA 2GV1A 1GMVA 1HD0A 2X78A 4LFCK 2R2SA 4JEPA 3MEGB 1MA9B 1N33K 4U7UD 3MPWA 2BJ3A 4NA2A 1DTTB 2QO3A 3PKYA 3BDEA 1HA1A 1RTDA 4JI0K 2QV6A 3F5TA 1LKZA 1YIJN 2EFQA 1SB6A 2G8VA 3NS5A 2IIHA 4DU1A 4A2AA 1JLGA 4NYPA 3IS9A 4DV5K 1F9EB 5EX0A 4JI8F 5LM7E 1BWVA 4F36A 4DFKA 4KBOA 1X9JA 3PYGA 2BXJA 2DB1A 4CJ7A 4FXVA 5B0DA 3B4MA 4QCLA 4QJVA 1S77D 4A8FA 4OJHA 4NCAA 4R0EA 1ITGA 2E7WA 1N5SA 4E7LA 4YMEA 2CVEA 1ZYQA 5E2QA 1YI2N 4CJFA 3PNIA 1FKPB 3AV9A 1PJ7A 2H1YA 3MK6A 2W8KA 1S0VA 2W9BA 7FDRA 3MM8A 3DOLA 4H0OA 3LGHA 3B8HA 1CXUA 3ZYYX 2HBLA 5KFFA 3HPGA 2PFDA 2YNIA 2B0GA 4L75A 4OX9J 2DCUB 2DXFA 3O4QA 2D41A 4QW8A 3OXGA 1WN7A 2BE7D 5J1NA 1YDLA 1GOCA 2L9NA 5DM6Q 4DUYF 1GK8A 1KONA 2ZWOA 2B43A 2BUNA 2GQQA 4TY8B 3P4IA 2NUBA 2NRXA 1UWBB 1FRMA 1YJ7A 4OQJA 3CGIA 4P10A 3QERA 2FHMA 2E9TA 5BR8J 3J7Z5 5A8WA 2V7YA 1AZSA 1C0FA 1SCJB 4F02A 3DRPB 3S1TA 3WZ0A 2CUYA 2E7XA 2CYYA 4AE5A 5AQRA 5AQOA 2ATLA 2V7ZA 2X6NA 1R8HA 2NRVA 1ZBSA 1N0VC 4DG1B 4OZNA 2IDLA 3GG0A 4KHPF 5ETMA 1S1VA 3C46A 1Z6RA 4FWNA 3H59A 1FJ7A 1OYDA 3CFPA 5AXMA 3QWPA 3RR7A 4H4OA 2ZBCA 1RLCL 2NXCA 3CW2C 1HQEA 5JVHL 4YB1P 3DXMA 3O9SA 4CIFA 3ITHB 4FLZA 5J1EA 4MKVA 1TAUA 2UUWA 1JKHB 4DR3F 4IRCA 3SBTA 4K5RA 2ZH4A 3W65A 1RLDA 5C10A 1E6YA 3UE5A 3C6TA 1RTIB 5J1PA 1VISA 3VQSA 1QM9A 2PT0A 3HX9A 4XTTA 3KKRA 2P9CA 3WQPA 2MQNA 1NGAA 4B1VA 4YOYA 1XMOF 4K4XA 1YG0A 2CJXB 1KTVA 1H2VZ 1WC1A 4YOTA 1NBWA 2Q3SA 4EU0A 1S9EB 4CVNE 4DUYK 4JKGA 3CSKA 3K0JA 4EK2A 1HW9A 2PYJA 1LW0B 3M6VA 4K2XA 1JLFA 1HBMB 4DCHA 5B0AA 1VSEA 3KUEA 2O4IA 1EETA 4F67A 2JOQA 3RMCA 2ERRA 4QYZK 3RBEA 2I7PA 4CJKA 4X4QA 3BGLA 3KG1A 4CJPA 2EC2A 3ZEUA 3FRYA 3T1YF 2BACA 1BQMA 3HDSA 4HVJA 4IOBA 2V34A 3TEHB 3LDOA 5FPEA 4RW6A 4Y0FA 1DKGD 3F9KA 4BR5A 4FZVA 1VRTA 5KFEA 4RW9A 2K3IA 2B5JB 4MO5A 3HVWA 1C4CA 1T05B 4PKGA 3P31A 2P9PA 5EOYA 3KUGA 1QD1A 2QWRA 3CETA 4CBWA 5BRHA 2G2ZA 3O9QA 4XDCA 1QUPA 2YNGB 4C6AA 4OYPA 1G99A 5F8IA 2E2QA 5A2QU 4DR3K 1IKVA 4JI5J 2AZ1A 4I0WA 2QA2A 3UN2A 2OHDA 3I33A 2N7YA 4DU8A 4WXOA 2IVFB 5DK5A 4DPXA 3TAFA 3OTCA 2F8TA 1S49A 4KTZA 2QYCA 4NOHA 4IH6A 5HMWA 4HACA 4IG3A 2QXFA 4AYBD 4M3ZA 1R0AA 1Q5YA 3QSIA 4QWEA 1HPZA 1HBUB 1XMOK 3S3NA 5A8KA 1FT8A 2F9JA 1NZAA 2MJUA 2E2OA 4Y1DA 2HGMA 3EJMA 4NZ7A 5D8HB 1GLBG 3OVNA 4PXEA 1RT2B 4A8QA 2P9LA 1VFJA 1XEZA 4B17A 3CCQN 1NG9A 3MUMP 1WB9A 2H54B 4GVLA 3T1HJ 1O5JA 1GMWA 3W3SA 4F50A 5KPTA 5KQDA 5HLFA 4YUDA 3O44A 4JK8A 4IH5A 2XZDB 1RWOB 5DZ6A 4AHVA 3OTDA 5FIIA 5FDLB 4UQTA 1U48A 1OO0B 4KHYA 1FRLA 2DITA 1WUAA 2O8DB 1QVGM 4M3TA 3CI5A 3TQ1A 3T1YK 1J5EF 4Y2CA 4NASA 4LF5F 4URQU 4CFDA 1GLJO 2XHBA 4O55A 3HM8A 2P9SB 1WF1A 1GH8A 2QLFB 1KVIA 2E1YA 1N88A 3ATUA 3M2UA 1MWQA 5DLFA 4YR0A 3CO9A 2P9NB 2OLWA 3W5XA 3TA1A 3FLCO 5L1KA 2XYHB 5F0UA 2J9CA 4DQ8A 1BXNA 1PC5A 3JS9A 1C1AA 4CEAA 3OL7A 3PIOQ 3VPZA 2BV3A 1VQ5S 1W2BM 3SZ2A 5DG7A 3KK7A 4ECQA 1NH8A 4TKTA 3IR7B 4FLVA 4C8ZA 1GLFO 2FBTA 1WOSA 3LM9A 2C2OB 3DRRA 4UOCA 3DRXA 1VSIA 4E2FB 3ULDA 4M94A 1AUDA 2ZD1A 2FJXA 1V4SA 4AQYJ 4DCJB 3LDLA 3CUNA 5AXNA 1KQGB 2HS0A 2N7CA 4KGXB 3VEOA 1XK8A 2UXDJ 1A5VA 2AYMA 4ILHA 4NXMJ 2VICA 2YBVA 1ZM4A 3THXB 2IRXA 3VQTA 5HVHA 3T7ZA 4CHYA 3U9DA 4KI4A 4K0KJ 3NS6A 2EKYA 2H65B 3A1YG 3GSIA 4O5FA 4M5NA 5IC4B 4PRFA 2B8PA 1OIAA 3W5ZA 4UZCA 2KFNA 1VHXA 4IEIA 1VBKA 3CXCR 2AHOB 1TK8A 1WACA 2DGUA 1S7IA 1KVKA 4W4MA 5G0RA 2I5JB 1JJ2M 1RT5A 1BD6A 2R7UA 2IMOA 2CG4A 3AOCA 1J5EK 1DGKN 4LF5K 4G3IA 1PILA 1S59A 4A62A 4RBUA 2LEPA 4FJ7A 4EBCA 1UKUA 4BE1A 5JLFA 2W41A 4K59A 4IWVA 3NMRA 3M5RA 4X65J 1C1CA 5J2MA 2Q36A 3CCSN 2VJUA 3V4IA 4MDBA 3VGKA 1WWHA 2HMIA 4JBCA 2XS2A 2WBNA 2YJEA 3KLHB 4JKCA 3THYA 1SBRA 2Z2MA 3M32A 3OVSA 4ILLA 2AJ0A 4LBHA 3NCRA 2QK9A 3M1VA 3H3NO 3JTPA 2ZE2B 1ATSA 4A2BA 5B0EA 1DQ8A 2O3DA 3THVA 3R2CJ 4NMLA 5J2NA 4WCEQ 4GW6A 4M5HA 1RHJB 1PCAA 5KFIA 3K89A 3HSJA 3PDNA 2O8BB 1P8ZA 1VSMA 1S9FA 4I67A 4GKKJ 3NGIA 4ZJQA 1A0OB 3MR7A 4Y00A 2WOMB 5HP1A 4TYBA 3GQCA 2OEKA 2UXBJ 2VKZG 2J0WA 1ASUA 3A3PB 1JLEA 3H2VE 2F40A 4DF4A 4QIFA 1HYVA 2QG9B 2DNYA 1RHUB 3L95X 2QKKA 2EW9A 3BGRB 3B6PA 4CLWA 4M3RA 4BDYA 1IBLF 2BE9B 1GOBA 1NGJA 1WELA 2AT1B 3UKUB 1X4CA 2NZTA 4LSLA 1U02A 2JWLA 3NF6A 1LW2A 2XMWA 1I3OB 5HANA 5BN9A 4OL8A 4WQ4C 1C2PA 3A8JA 3MAAA 3CCRS 3MEEB 1FKOB 3RVCA 1N32F 1RBOB 5ETSA 4NCGA 2BW2A 1G4CA 3I0SB 5G4DA 1F5BA 3ZSYA 3D3CJ 3HHNB 3EE8A 1J54A 2RNEA 3NLCA 2W8LA 2VG6A 2VUGA 5AE1A 4B3MF 2J7WA 3AARA 4FZYA 2VDHA 2BANA 4LMZA 1Q53A 3SCKE 3FFIA 4CP5A 1AFJA 2W42A 1U49A 1GTEA 4B3OB 1TFYA 2RRNA 1O13A 3CJ9A 4H4MA 1ESVA 3CFOA 3M8PA 4DQIA 2V68A 4JI1K 3SPYA 4DWIA 1GLDG 2V2KA 2HS4A 3IGNA 2IM0A 1EO1A 2B56A 3ENQA 3H42A 3CPWM 3NFAA 3TW0A 1T9XA 3QZ7A 1URRA 1SAZA 3H2LA 2OGUA 2Z57B 2C3MA 1NKCA 2R2RA 3HP6A 5KFKA 1IVZA 1NK0A 1F3VA 4LF4K 3PW0A 4CGJA 1ASVA 4G65A 5D0RA 3OQ2A 4DTMA 2BUPA 3KG0A 1XUPO 4W5QA 1CJUB 2G8UA 2J4RA 3IR6B 4KV8A 2NUUG 4ZVFA 1VQ8S 3MCPA 1RHQB 4M3UA 1KQKA 3RUBL 3KOAA 3TTFA 3FCWA 3ZT0A 3R5DA 2CADA 2C3OA 4QPXA 4NLPA 2YWKA 1NOYA 4H4KC 5H9FJ 3IP0A 2ASLA 2F5GA 2HPUA 4DR4J 3J80U 1RU1A 2Y1RI 1WSJA 2P9KB 2MZTA 4DV4K 4CK1A 4H5WA 3LPYA 1RT7B 1RAAB 4KREA 4FYYB 2E5IA 4JD2B 5DM7Q 1CJTA 4S0MA 3W2WA 3OUYA 4U9RA 4ANCA 1SC1B 4L3KA 3ENWA 2W4DA 4H0PA 3KVGA 5D78A 5L38A 3OD2A 5L46A 4DQQA 3QGPA 4C9DA 2WVDA 1ZS6A 3RMAA 3VAFA 4FJ5A 4F3TA 3CC2S 2LVWA 2IHR1 1B9FA 1F60B 5ITHA 4O4GA 1GLCG 3WXMB 3KKFA 3NY0A 1YZ7A 4N8OA 2HF3A 3M1FA 2XM3A 3O8MA 4QYRA 5LMNJ 1CQMA 4J9NA 3OYDA 1WC6A 2WSEC 4W98A 1HBNB 2VC1A 4I2PB 1OH6A 5F8LA 3HSDA 2Z2ZA 2RDDA 2FHOB 1I3AA 1YUWA 1RT4A 1V5VA 3P8BB 1LOTB 5FRMA 3EM1A 5M1NA 2W2PP 4JI7J 2HNZA 2KRRA 2LP4A 3CD7A 5KFUA 4WZQA 2XHCA 2G8KA 2OPSA 3WXJA 3NOGA 1IBKF 3PSFA 1KXPA 5DO2A 2KT2A 2CZ9A 1S1WA 4WKRA 2DRDA 2HWHA 5EGYA 4GVMA 3NEKA 1DTQB 1WHXA 2HQ3A 3EKUA 5DJBA 3L09A 4MFBB 4BWJA 5EWFA 1RAHB 4LH5A 2NXNA 1S1TA 2KH9A 5KRSA 1RAEB 1CJVB 3SNNA 3DMJB 1RBAA 2UP1A 5E33A 3QGIA 3GYNA 3R5JB 1R0CB 2YQ3A 2ZDPA 4TXSA 3AAWB 5JLHA 1ATNA 4XAKA 3CCMS 2GCFA 3SFUA 3LZJA 3OFEA 2XMKA 2P5OA 1VCTA 4EHTA 4KR0B 3H08A 4ZLJA 4CGDA 4UY8O 2AV5A 2Q66A 2COLA 4OPHA 4DSEA 1KNZA 2KLAA 1YJWN 4AH9A 5JUMA 5AZJA 7AT1B 2IA6A 5ETQA 4Z94A 2HBMA 1TQLA 3ZTSA 3A5LC 3ILIA 1X1PA 1OY9A 1HLUA 2AGQA 5LMUK 2YWWA 1WSFA 5K14A 2XYPB 1WKLA 1YGYA 3SSQA 3VAGA 4LFBJ 1Q81T 2GQCA 5LXYA 2JL9A 1B7YB 2OTJN 4HKQA 2QC3A 5KT2A 1QHTA 4DR7J 2B4VA 2DGWA 3DXSX 3N0VA 3BKUA 4ED2A 1W7WA 4DBQA 2Y8WA 3MPUB 2NYHA 4JK7A 2XGQA 1EJ7L 4FWKA 4PG4A 4HUFA 2XHWA 4EIAA 5KFCA 4EI2A 3T5KA 4K4WA 3RAXA 4OI0A 2GC8A 1K6YA 4RLEA 4BRAA 3VQQA 4ECZA 5M1QA 2J6SA 2NRHA 2PMWA 2XEXA 4FLXA 2CPXA 4CLFA 1IKYB 5K8OA 4ZIVA 4DV6J 1LWCB 4KI6A 4O0JA 4CHQA 2JFKA 3H46O 3G8TA 3TNVA 4K7QA 1URNA 3LZIA 1SQGA 3UNYA 1M5PC 4C11A 1YK9A 3MM5A 4CZKA 4JI6F 4KE5A 2FGCA 1X7VA 4KC5A 3BY5A 3GR0A 3HZ6A 2YHWA 4OI2A 2X1AA 1GLAG 3QT5A 4PG7A 1UMJA 4HTUA 4DL4A 2AGPA 2VFTA 2VBYA 4Q0BB 3KHRA 2ZUGA 2MHNA 2UUBF 2BM1A 4AF1A 3DU6A 1KWMA 1YTUA 3CCES 4M7YA 4PG8A 4IOXA 3PJXA 4H54A 4CWBA 1IUJA 3RRGA 2D0AA 4O3RA 2WSFC 5JICA 1K1QA 1IWGA 1HWLA 3H1VX 3SAFA 1SL1A 3G25A 2MDAA 4H03B 2ZH7A 2WW8A 1VJQA 4TU7A 3MI7X 2OZMA 1JJCB 4PA1A 4NZ6A 3QO9A 1V3RA 2HWTA 3QB0A 1KDNA 2DHAA 3R5AA 3EN9A 2JEJA 2M9KA 1T6DA 3L7PA 2X6SA 2ZJRQ 5C5JA 5KFOA 2FBYA 2W9CB 1PSDA 1XJWB 4OKJA 2IM3A 1EKRA 1N48A 4IQXA 4DUZF 2ZFHA 2P6TA 3EDRB 4CFCA 1K73T 3NL0A 1BWEA 4F3MA 3GFYA 4RW7A 2UUCJ 1A5WA 4ZVGA 1OH7A 3DWLA 1FRHA 5H9EK 2RDJA 4JI6K 1P9YA 2VZ9A 3BO4A 4ZVPB 4WQ5A 2MJNA 1JJHA 1X4AA 4XPEA 3MXIA 3AO1A 3RW7A 5HVGA 3U1LA 5KG2A 3P3DA 5KPZA 2Y3YA 2QWLA 3FSXA 4F4YA 3ENBA 2UUBK 2XO6A 2GS8A 1CVJA 1HMVA 4CF0A 3EGNA 1PAEX 4E7JA 3MM7A 1S1UB 2HHWA 3LM2A 3UDLA 5EWEA 3ZSZA 3QNWB 1S72S 3OTOK 5HQLA 4DR6F 2XWYA 2OELA 3WDOA 5L1IA 4OLAA 4DG1A 2WUSA 4NLWA 2H3GX 3CJKB 3HSCA 3CT9A 3BREA 2WSCC 3VZHA 1S48A 4PKHA 2P9IB 2EBEA 3ZFVA 5KFMA 3UR0A 2C2ZB 3EICA 2VG5A 2QLWA 4LIWA 2OTLN 3HYFA 2A1RA 2DKOB 1HWJA 2E2PA 1JL2A 3G6EN 1XQIA 4ETZA 3C66A 1JIHA 1EP4B 1N5TA 1VQ4N 4BGBA 1XNQJ 1X60A 1UETA 1TK0A 1VQKS 2QEXN 4ICLB 4KH4A 4CJSA 1ROFA 5EDWA 1KLMB 3MURP 3V9UA 1XMQJ 5D4OA 2IOCA 4CJEA 3UWTA 3J7AP 2O8EB 4RU9A 5CD4A 5HRNA 2EBGA 1Q4RA 1QZ5A 4U6PA 1FKAF 3A2FA 5EWGA 4WFAQ 1MMLA 3JQKA 3SBGA 2XSJB 1QSLA 4FPBA 3QJJA 2GHPA 2RH3A 3O3FA 4LUBA 1NZ8A 3BM7A 1NGHA 4RX6A 4D3GA 2P5VA 1X8DA 2YX7A 2FZGB 5KG3A 3TANA 1LW0A 3R5GA 2MSSA 1HLWA 1LXJA 3BYRA 3EX7B 1Q82T 1NLVA 2ILZA 4I56A 3PXGa 3AA2A 1W25A 4O8KA 4F4KA 1CPZA 4DEZA 1DEJA 5B0CA 2X1BA 3AHPA 4DR6K 1NHVA 1FD2A 2RHKA 1YRTA 5E84A 2FBXA 4B3RJ 1MLAA 2B51A 1KR4A 3BEXA 2B5JA 3PLAA 3WHIA 4MYUA 4EGLA 1UFKA 4MKBA 1VSDA 4YR3A 3F44A 3A3NB 1RE1B 2Y0SD 4FVUA 3QBWA 3VQ6A 3HO1A 2V69A 5HRPA 4KKOB 5J2PB 4GKJF 2VA2A 3IMQJ 4OPKA 4FWLA 5C42A 3GP9A 3QEIA 5KFYA 2HZVA 2VQEK 2RU3A 2E5LF 3ULEA 3HOTA 2XLJA 5EN1A 4QWDA 3KJQB 2DNQA 3GDQA 1XR5A 1K8AO 1ZA1B 2B4JA 1DLOB 1W2IA 4CGFA 2HF4A 5AQTA 4CGIA 1HNIA 4WXWA 2V5HG 4FF3A 2KHOA 4UF4A 3TJ9A 1Y64A 1NO8A 3NWGA 5AXKA 2RN2A 2GIRA 3RBXA 5IFMA 2ZH8A 1TVRB 1DT9A 1WD6A 2V2QA 2X7IA 1K0VA 3S7RA 3ENVA 4K4UA 1T6CA 4CZMA 3DGPA 4DSIA 3I56N 2LA6A 1OSCA 4FYWB 5IT9O 2PI5A 1B3TA 5FRNA 4LY7A 5FDLA 1HJOA 3WIUA 3NWRA 3KNAA 1OS5A 1YJNN 2PC6A 1J2VA 2O8DA 4KHWA 2N3OA 1MWZA 5CYMB 5KT4A 3MN9A 2IGIA 2P9SA 4KPCA 4AILC 3FEZA 1HNZF 4DX5A 4M5LA 1JCFA 1F21A 3QLHB 4JV0A 4ZS6A 2R7RA 3CYMA 1TL7B 1K9MO 2LU1A 1X5PA 2R8JA 3KJNB 4LRAA 1VK0A 1NK9A 3QZ8A 3KLGB 2J76E 3VQ7A 1HI8A 1SJ4P 2UXCF 1VQ7S 3U9ZA 4BLGA 5CE3A 4WFNQ 1TMJA 2E7VA 5AQWA 3QRQA 2YXLA 3MCMA 3D4JA 3HRGA 2B4PA 3VAHA 2IDOA 3K5OA 5AE2A 2KTQA 2NPFA 4BC9A 1TL3A 4DR2J 4W5OA 2J5AA 3Q2TC 4CO4A 1YKWA 1KVCA 4Q7AA 4F7VA 5GVQA 4C0HA 3LWMA 3CCLN 4USWA 3BH7B 1I6JA 3AFGA 4N56A 1IBMJ 4X4OA 1VQSA 1RB0A 2CQGA 3C19A 4F4WA 5B0BA 3P96A 4MKYA 1F0XA 1TKTA 5HVFA 5HK4A 4OI4A 2VH7A 4BS2A 1PYTA 4AHSA 2EI5A 4MIBA 4DL6A 1KS2A 1IG8A 5DG8A 5JXSA 2CQ1A 3DKDA 4NLBA 2RHSB 3GJTB 4DU3A 3W1YC 1A5XA 3HSTB 3D3BJ 3AJ1A 1QE1A 2VIHA 4OX8A 4JP8A 5CCLA 2UUAJ 1FJGJ 3GB0A 2FSJA 2D9OA 1W7AA 1U6BA 2A3JA 3UN5A 4MK8A 1HNZK 2NLWA 3SQGA 4DS5A 3QRRA 1FWLA 3MTKA 3IMXA 3QMLA 1FHTA 5AQLA 2Y1JA 2H51B 4GV9A 3WXKA 4YQWA 4DHYA 2FSNA 5LJ5Y 5LOQA 3VGMA 2HZCA 1DRZA 2QA4N 4HVZA 3B6OA 3KLHA 4RTFD 2NRRA 4Q8FA 3KHGA 1X4GA 2YKMB 3BBCA 4DSKA 2AX1A 3MCNA 2R7TA 3LAKA 2YTCA 5CABA 3JXUA 2DHGA 1E6VB 2CPFA 2DH8A 3AVKA 3G4SN 4QAGA 3RB6A 1NAQA 3HHDA 4ZVQB 4E7KA 2O8BA 1U1OA 1KBRA 3JXOA 4BRMA 1ICEB 1N34F 2HNDA 4EEYA 4OZ2A 4JV2A 3L2WA 4CZGA 2CNNB 2ZF5O 3ADAC 1UP1A 2KVIA 1RP5A 3P1GA 1RXOB 4U67Q 3K2YA 2FJDB 2NPIA 2NRZA 1FRJA 4QIWD 2XS5A 4CEEA 4L73A 4JYAJ 2FHJD 4AM6A 2D0BA 1ULRA 1SH3A 1SH0A 5KPRA 4R8UB 3CQYA 5IV3A 1SKUB 1I94K 3KXDA 2B4UA 3DAWA 4J9PA 4KH0B 1Q0NA 3L4IA 4NLXA 1NEEA 1VI7A 2EPIA 4OV1A 2Y1LB 4CZHA 4C8KA 3BGFA 4IOCL 1CULA 3OL6A 1PBAA 4ER8A 2GVZB 4RPFA 3I0SA 2HSTA 1WOQA 4OHVA 1Y00A 4O3SA 3ETOA 2Z0GA 4ZP8A 1IXKA 5HN0A 2M8DB 5ELZA 1U1QA 2YV0X 2NUHA 4J2DA 5T7BA 1M1KT 4FNIA 1H7WA 4FM0A 3NGKA 3HHLA 4DXLA 1FCAA 4ZTFA 2VB6A 2N82B 4CD3A 5ETPA 3J7YP 1RYRA 4B3OA 2E6LA 3W66A 4Z4IA 1P90A 1T9WA 2ASYA 3BN4A 3D2FB 4CJ4A 5MLCQ 4L6V3 3FZLA 4OYBA 5ADXH 2K8GA 2ADCA 2WFBA 1N34K 3TZYA 1C0TA 2KB2A 2R7YA 4FJKA 3PVXA 1IKXB 2DNHA 1PGZA 1TGOA 4GVBB 2YNHA 3P49B 3RMBA 2KFZA 4HT5A 4CLTA 3JTOA 3IR5B 4BE2A 4OLPA 3HFVA 1REGX 3EEQA 1GX5A 4CW7B 3MMJA 4BR0A 4N47A 5A0YA 2FJVA 3ZNJ1 4NXNF 4WFZA 1NK8A 3LGMA 1YITS 1BHNA 1FO1A 3OYMA 5HL7Q 2OUGA 3Q7CA 1HR0J 1RTDB 2G8FA 3CDUA 5BPNA 3CEDA 1U1MA 2NQPA 1XN9A 3WBZA 4GC7A 4EYIB 2HAFA 4J9SA 1JLGB 3IS9B 4DU7A 1LK5A 4PYDA 2WB1D 5MLCV 3NGTA 2QT7A 2ZBIA 3MWPA 4OPAA 3ICLA 3MXMA 1RWVB 2M7SA 4DB3A 2RD5C 2ZBQA 3A5OC 3LAMA 1BE4A 4OYMA 1HNWF 4IFVB 3MMVA 2NS1B 2IJFA 1WDDA 4CEOA 1Q5VA 2MHEA 3AD9C 3NDKA 1CZ9A 3CC7S 4RBTA 4GNIA 4Q8EA 2B9YA 3PCOB 1N4LA 3UI3A 2IIRA 3MCAB 5CZVA 5HI7A 2OPPA 5CXTA 1UEVA 1HNXJ 2GJIA 2W9BB 5CR4A 1WORA 1I39A 2MGZA 3MM8B 3J7ZO 3DOLB 1U25A 3V6DB 3AGKA 1RABB 4YHHJ 4OYAA 3VEVA 4WPAA 4WK3A 2YNIB 2ZOMA 3KWGA 2DH9A 2E5GA 2XY6A 3D7EO 3PYDA 3QBXA 3MTJA 1HWIA 4LRCA 3SCJE 3QIDA 3KZBA 4J9LA 1D0EA 5BJRA 1S3XA 4BRIA 2C3PA 1NB7A 3OYNA 1RAOA 2CQ2A 3BO3A 3TSUA 1X4BA 4NXNK 3TR8A 2ROPA 3R7BB 4HUGA 4M41A 3LPEA 4W5TA 3TUPA 1GTHA 3NMAA 5A8WB 5F0XA 2BMBA 5ADXA 4Z37A 2QFIA 2MZSA 4DTOA 4QWCA 4KGZB 4M42A 3SLCA 2MQ8A 1BIZA 1RWUA 2GIQA 1WF2A 1RK8A 1S1VB 1U1RA 2I2YA 3IAYA 2GFFA 3DYAA 3BR8A 2Q0UA 4LF6J 4N5SA 2BZ2A 5JMNA 4Y34A 4JV1A 3DMJA 4ERDA 1NNEA 3AY0A 1YX2A 4B1WB 4H4OB 4LFCJ 1S12A 3LWLA 4GRSA 1HQEB 2OSRA 4CYUA 5C2GA 2RILA 3J7AN 3P83D 3DXMB 4F2SA 4B9TA 5J1EB 3OYCA 2J8AA 2FF3B 2P9EA 4U7CA 2M0GB 3C3LA 2PMZD 3NAHA 4JI0J 3J81Y 2E6MA 4IFEA 4DLEA 4OX9F 3QINA 3GE1A 3EGWB 1E6YB 2M2BA 4DV5J 3GCWP 4HR2A 4ECSA 3EZUA 3QIPA 1N6QB 2E44A 1KC8T 4YORA 2DR6A 4QR2A 4JUZA 1MW7A 3LO3A 5F9LA 2QA4G 2RKIA 3L2RA 3VALA 2CQBA 4Q5VA 2JH3A 2QZ8A 2Z4PA 2E1MC 3E01A 4JKGB 3UDVA 5KTQA 3OSNA 3Q86A 1S6UA 4ED7A 1VQMS 3PR5B 1JLFB 3L4QA 3OR2A 4ZLLA 5AQIA 1SJRA 3VWSA 1EETB 2PEBA 3K59A 4ZPDA 3R1XA 4NI2B 1NGIA 1N56A 2J7KA 4DCOB 1NJWA 2AF6A 1RWWB 4EUVA 4WYWA 1UA0A 4J9VA 4WK1A 1BQMB 2FF6A 2CH5A 3R7NB 1FVSA 1D9AA 3DLGB 3CJ1A 2AQ4A 4RW9B 3JTNA 1VQ5N 2AYGA 9RUBA 2P9PB 3GJQB 3KJFB 1T02A 1FVQA 3O4WA 2P5GA 2K06A 1X5OA 5A2QO 1A6LA 1RU2A 2I6WA 2M4MA 4WYBA 1U1LA 3THWA 4W90B 2VF3A 1T94A 4FN5A 5HJYA 3QNOA 5AZIA 3M6UA 3BKFA 4BRCA 2D4WA 4DV2K 4NX9A 3G2XA 4JNEA 4DI6A 1CC7A 3Q8RB 4Q0BA 3FBBA 2VJVA 2G0IA 1VQ9S 3W62A 3LP1B 1NKEA 3MX2A 4HACB 4IG3B 4AUKA 1R0AB 3FRZA 4PXBA 4JV5K 2LQBA 1F9HA 1Q78A 4X64J 1XC9A 4DPWA 1LWEB 3BYPA 1FNXH 4OPJA 4KH1B 4NPOA 5E41A 3SUNA 4O3QA 1FF2A 1S4FA 1ZBTA 1UVJA 4ELVA 2P9LB 2GJFA 4JAXA 4BC3A 1RBLA 2BRKA 1HKBA 2QFJA 1NGCA 3NGRA 3EXYA 2UZAA 3HFKA 4FK0A 5GAGU 2RF2A 3SUPA 3KMQA 3VA0A 3W61A 2W1BA 4OYXA 1JXEA 1NK4A 4NEZA 5I3UA 1JLCA 2WBRA 4F26A 4NYFA 2BEFA 1XHXA 1V5IB 4CI0B 3BSAA 4JLHA 2BJDA 5LT5A 4NCBA 3PO4A 1SPBP 2GJ2A 4CLSA 1IR1A 3ILLA 2ZQBA 1Q8LA 1SVDA 4JI5F 4ZP6A 4DUYJ 2JZ5A 4B8AB 3O08A 2IBOA 4W92B 2YHXA 4JOUA 3VTHA 3BF1A 2IFXA 2NYIA 4KHNA 3V81A 1IQZA 4WQ5C 2NZ4A 2DNGA 3KTQA 4CJ3A 5HMXA 1NDCA 5CY4A 3H2UB 3BQ1A 3L8BA 1UFLA 2W7OA 2GMHA 1QQNA 3DNCA 4FZXC 3CDBA 3CMES 2PYLA 2IRYA 3R6GB 2FJBB 1AFIA 1IG9A 2FLLA 1P9QC 1DZ5A 3RJMB 4ECUA 4IKFA 4A61A 2XSFA 3ELHA 1JMTA 4F9OA 1L3KA 5KG0A 4PL7A 3JAMU 1L3SA 2EKNA 4NLQA 3T1HF 3B6BA 3ZTPA 3U27A 3C16A 4B9SA 4GC6A 3K9JA 3KDOA 3KHYA 1VQ6N 2IJRA 2ZD1B 3H5UA 3MPYA 3AVNA 2ABYA 5GAEU 1B70B 1EHWA 2FVPA 3G6YA 3PUFA 2DFHA 2HHXA 1RWMB 5JMVA 1Q7YO 1R6YA 3I5AA 4M5DA 4CGHA 5IWAK 4RWXA 2LDIA 3D66A 3GONA 3CCRN 1RDAA 2BKOA 2ZH1A 2J0SD 4ELTA 1RDUA 2FQQB 3JS6A 3KMSA 3LP2A 1EKSA 1T95A 3AVJA 4RUCA 5KFRA 2XY5A 3OR1A 1WKKA 2BQUA 2ZH9A 3NCPA 2AP1A 3BPDA 4BC5A 4CJ5A 1LNQA 2MZRA 1U6ZA 5G0RB 1RT5B 2XS7A 4OHZA 4O8UA 4OKEA 1KLMA 3GIIA 1XC3A 3QEXA 1SIZA 2O01C 4J90A 4ECVA 4AXJA 2C2MB 4JI5K 1F5AA 3MN5A 3OPKA 2ZEJA 2ZUAA 3IDHA 3QIOA 4BG9A 2UU9J 3A5MC 2E1CA 1Y9OA 2JLFA 3V4IB 5KG7A 2DVIA 4F25A 3O9RA 3DLJA 1RWPB 2HMIB 1NRKA 2DY9A 2A6AA 4O3PA 1JNZB 3ZETA 2ZH5A 4RW4B 2EK6A 3POTA 3THYB 4Q45A 1WOPA 5AQQA 3CIZA 3M32B 5AXLA 1O6XA 5F3TA 4AQYF 3CDAA 1P1TA 4NE9C 1M1HA 2YX1A 4QQBA 4FCYA 2UXDF 1DJ0A 2OAUA 1AUSL 5J2NB 3UDEA 4NXMF 2Q97A 3AA3A 4PEOA 5C24A 2WC9A 1SV5A 3W9IA 5KOXA 4K0KF 3T1HK 3US5A 1W2BR 3CJ5A 4K41A 4F04B 2WZ1A 1OY6A 2YPZA 4HLBA 3M8SA 1KP6A 4J9OA 2G9OA 5ETRA 3BBBA 1KFDA 3V2UC 4K42A 1JLEB 4FSVA 3MPDA 2DJWA 1VQ8N 5AE3A 3E9LA 1QVFM 4ANDA 4BC4A 1IKWA 3QJLA 3OS1A 2EWHA 1HKCA 1RTJA 4Z0UA 2V8DA 1NWKA 4FPRA 3WNEA 4KTWA 4LF9K 2YWFA 4TNOA 3IBFB 4DDFA 1LW2B 1EQYA 3VQPA 1X4EA 3O3LA 4X65F 1F1BB 4WP9A 3MAAB 3I0RA 3E8OA 3O4NA 3QMQA 3FGUA 3VGSA 5E3PA 4RG8A 1U47A 4NCGB 1M90O 5E3AA 3ZSOA 3MMAB 1YBAA 1O0PA 4QWBA 2MQMA 4CLPA 1JJ2R 1M5VC 1UZDA 1DLOA 2CA9A 2VG6B 5CYQA 2CZVC 3CC2N 1VSHA 3LPUA 4BRHA 1EAYC 3S6EA 2BANB 3RU0A 5KFNA 4ECXA 5D15A 1PYOB 5LSOA 3NF8A 3MUTP 1DY3A 2OZSA 3BS9A 2UXBF 4XEIA 3VTIA 2SXLA 5C2CA 4H4MB 2GMJA 4IEEA 3M8PB 3I8BA 1FFSB 3UQSA 2FDNA 4DQSA 4K0KK 1FJEB 3CJTA 3EY1A 2LQ5A 4JI2J 4L72B 4DZ6A 3OYLA 3TSQA 3WC2A 5I4MA 1LAWA 4LR8A 4O3OA 1T0TV 1DURA 4HUEA 4EZ6A 1D9FA 2QSFA 4JI3K 2N4DA 5CCMA 3MPVA 2VWKA 3QLHA 3KIOA 1TL7A 2DTJA 3D2EA 1ZBFA 4M95A 3CULA 1JK9B 8RUCA 3KHHA 3CXCM 2DHXA 2RQ4A 3MHYA 4KHQA 3CCJS 2AA4A 1M1KO 1SI9A 4BRKA 5JVHQ 4KV8B 3MR5A 2YJFA 2NXJA 4BC7A 3KLGA 5J2QA 3U02A 4KYZA 3RBDA 3CCMN 3FMBA 3NE6A 2A1SA 2DNPA 4M5IA 5F8NA 4H0XB 2HHHJ 3J80O 4KBIA 4ZPWR 3G9CA 3F0NA 2P9GA 4FOEA 4C0OC 3ZX0A 2VBWA 3HZEA 1ACMB 4PPDA 1Q18A 2NLXA 3V1RA 4OX6A 2F8EX 2E8AA 4WE1B 4R79A 1VS3A 4BWMA 4WZMA 3LOUA 1CJTB 3W2WB 3OUYB 2ZVIA 4DV7J 2NNWA 3GL1A 3LUYA 1M5SA 1Q16B 1U26A 5H1SV 2W9AA 2GQ2A 3BN7A 4L3QA 2NSBA 4XH5A 3N5BA 3KLEB 3TI0A 2DNRA 2UXBK 2VV5A 1FA0A 4DL5A 5DQIA 4NYOA 4URGA 3CF5L 2DNMA 1R8AA 1APSA 4RW8A 2ZZTA 1D09B 4O4GB 4OYIA 3TSPA 2DNNA 3NGSA 1U4BA 4CJTA 4CEBA 4Y2KA 4WFYA 2I8EA 1QTMA 2BKNA 3FUYA 1HFEL 2VD3A 1SQKA 4IO8A 2B3TB 1MU2A 3RRKA 1RT4B 1RADB 1REVA 1IJFB 2X51A 4I4BA 3ZZRA 1X4DA 4DV3J 1NMDA 4FJIA 4B3SK 2DHSA 2HNZB 2ASJA 3D6RA 2OPSB 4DR4F 3T5JA 4JI1J 1SC3B 1IR2A 3BBFA 1EZZB 3I55N 3AA4A 2BGGA 2YKMA 3U6FA 3HBTA 3OXFA 4G1IA 1IN0A 3N6LA 4ZPCA 1YVFA 2KHDA 1E6VA 4TU8A 2IPOB 5BRDA 1UW4A 1U0HB 1S1TB 5HBMA 1SIWB 3L0QA 4OZ1A 5FLXY 4ITSA 2V51B 4LF4J 3G6VA 1EX8A 2I9SA 4LC9B 4DTNA 3K5LA 1CS4A 3M6WA 5AQMA 2I0XA 2M5YA 2BDPA 2GA7A 1BA0A 4FLWA 3R6LB 5KG4A 3KLIB 1B99A 3PJ9A 3SAHA 1Q7LB 5LMNF 3CG7A 1GQEA 4FLTA 4I9QA 3G0ZA 5AQZA 5DZ7A 3J81j 3WNFA 3MDFA 3M05A 1WSRA 3OXLA 8AT1B 4LRDA 3AO3A 3OJSA 5F3ZA 4DV4J 2HLUA 1U2FA 5K14B 4JI7F 4HH1A 3W60A 1ZM2A 4GVEA 5D0EA 2ZOGA 1Y97A 2BOAA 2E20A 2QTWA 2D5RA 3GV8B 4U8VA 2Z1JA 4CBXA 2GVZA 3FSYA 2HIYA 1ZTWA 2WONB 3D7SB 3PHEA 3PW2A 2VQFK 4NLGA 4X62K 3BZCA 4DHVA 3HHLC 3CCVS 4B9UA 4J2AA 1FE4A 3L2QA 1EXQA 4DR4K 2HBQB 1RT3B 4PG6A 3K8VA 3MX5A 2AD9A 3J7YI 1S5JA 3SDEB 1RACB 4UOGA 4IO9L 1VK8A 4CEZA 2IAJA 3S9HA 2HRYA 4C3MA 3FVYA 4BRPA 3R27A 3TTDA 3Q24A 3NKYA 2DXDA 1Z05A 3OT9A 4V19X 1U24A 4DN0A 3TX8A 4N8NA 5LJ3Y 4PKDB 3HPHA 2XBPA 1VIOA 4M45A 1OSDA 3V9ZA 5TKWA 3HD1A 2XO7A 4B9QA 4ZOSA 3MM5B 4I7FB 1VLYA 3AH6A 3D6HB 4GVBA 3GIMA 3T1AA 3EO3A 4PWDB 4Y1CA 1QTNB 2IRUA 1S72N 3S01A 2P1JA 4KH5A 3Q23A 2KZZA 4JKEA 5LMNK 4K8XA 2BE2B 4LFBF 2F65A 4YY3K 4ZIWA 1WLJA 3ONQA 2N3LA 4DR7F 4LF2A 3GFZA 3I31A 2H48B 3CMQA 2GMLA 4Y3CA 4AHTA 1RGVA 4JI7K 1G6BA 2DNLA 2UUTA 2ASMA 4LVOP 2VODA 2WVFA 4FLUA 1K8KA 4C1NI 1KSPA 3ID8A 1VQKN 4RU2A 2EFNA 4BY9C 4IFYA 2DRAA 2Q6BA 2GWJA 5K9FA 3G71S 1HYSA 3QO9B 4CHPA 2VFRA 1Q86O 4FKYA 4P71A 4FP9A 2FJAB 2J7UA 4UUXA 4DV6F 4F0MA 3D28A 2OD4A 1MMNA 3EZOA 4EHUA 2BYCA 5KGWA 5KG5A 4C23A 4IFVA 4JB8B 4DX6A 1IBCB 5DDQC 4YR2A 3CE8A 3BP8A 4A48A 4PKIA 5ETVA 5LMUJ 2VL1A 3FR0A 3SAGA 1NDLA 3OFGA 2YY3A 1RWXB 3EE3A 5KT3A 4IDKB 2YHBA 2VA3A 2LXUA 1ZA2B 5BYSA 3FEXB 4C8MA 3HKZD 1UJ5A 4CZLA 4RW7B 1S57A 4ATNA 4C8LA 3V6DA 5L9XA 5C15A 1SJFA 1Q1KA 2ZZMA 2HBKA 1YXQA 5BREA 3CIPA 4KFBA 3N4WA 5LJVA 2DRBA 4UY8T 5DG9A 4J9KA 2JFDA 2RDIA 5IT4A 4PQUB 4LFBK 2B7CB 2QWMA 4Y28C 4U96A 1HMVB 3PEJA 3V9XA 3NCIA 3QWUA 3MM7B 2L3MA 4K4SA 2D7SA 3FSIA 2UVRA 4WFBL 3QJPA 5C0YA 3FZFA 4DL7A 3HSGA 3ZZTA 3TP2A 4A8SA 3MN7A 2CPYA 2CGLA 1B0PA 4JI8K 1X4FA 3EUNA 3WEEA 3CCUS 2VG5B