1IKYA

Hiv-1 reverse transcriptase in complex with the inhibitor msc194
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikyA05
4KKOA 1T94A 4RZRA 5KFFA 1JXLA 4OGCA 1SH2A 4CEQA 4EYIB 3CJ5A 4ID5B 3ZT4A 3M8RA 2P5GA 2V0NA 2WONB 2YNFB 1XC9A 4N56A 3AA4A 3V9WA 3M8QA 3IS9B 1C0UA 1ASUA 2IA6A 3LWLA 3AO1A 1JLBB 4HCBA 2YKMB 1HQEA 2D3ZA 4WFXA 4E7JA 3TARA 4ZVHA 4CK3A 4YR0A 3V9XA 1S1WB 3PV8A 3VQSA 2W9BA 3AVJA 1ZBIA 4AHCA 5F8GA 2RDJA 1NNDA 3CYMA 3CFOA 3L8BA 4IFVB 4FJMA 1S9EA 4O3NA 3QESA 1U04A 2GUIA 4F4ZA 3H59A 5SWMA 3MEDA 3AVGA 1JXBA 3HPHA 1RT1A 4E3SA 4JV0A 3L2VA 4ID1A 3OYBA 2ASJA 3IRXB 4DS4A 1EP4B 1WLJA 3BQ1A 4EP5A 2XY8A 4PA1A 4W5RA 5DK5A 4Z0UA 1BQMB 2OPQA 3OYKA 2F8EX 3BGRB 1EETB 2W9AA 1ZTTA 4NRTA 1S1TA 5L1JA 3LALA 1TAUA 3OY9A 4IQXA 1NK4A 1FKOA 5EDWA 3P5JA 2ZE2B 5KGWA 4CHPA 2D7SA 3VQ9A 1VRTA 3G6VA 2KZMA 4MKAA 3S3MA 4XPCA 1JLQB 1JKHA 3Q8RB 4J9OA 4CEBA 3H5YA 1U49A 5F8JA 4RG8A 4BE1A 5C5JA 3TAEA 1KSPA 3K5LA 5I42A 2DPIA 1YTAA 1U45A 1RDAA 4FK2A 3ZT2A 1YTUA 4FLXA 1TKZB 1JLEB 1YVUA 1T05B 4CJKA 4ED8A 4WE1A 3I5AA 5C42A 4CECA 3ZT3A 4E89A 3CDWA 5SZTA 1RTDB 3PUFA 4FBTA 1NKCA 1L3SA 3E01B 3NAIA 1U48A 4OPJA 3OYNA 2D0BA 3ZSXA 3BSCA 4Y2CA 3K5NA 4DTRA 4W5OA 4NLPA 2OPSA 4LSNA 4WXWA 4K4WA 2IGIA 2J6SA 2VWJA 4LQ3A 2W8KA 4CE9A 1RTHA 3RRGA 1VRUB 3ISNC 4KHNA 4MIBA 1SV5A 2HMIB 1RT7B 3T5KA 3QGIA 3MEDB 2ASLA 2G8VA 5DLFA 1TVRA 2XWYA 4XO0A 3VN5A 3PX4A 1TKTA 1BISA 4C8KA 1OS5A 4DF8A 4QOZB 5E41A 2V4RA 3KLFB 4NZ0A 5CZ2A 2IC3B 4IBNA 2FJWA 3CJ2A 3L2WA 5CYQA 1MMLA 2BE2A 3VQDA 4ZVGA 1C1CB 5HBMA 4KV8B 2IM0A 4ED7A 2D41A 1NK6A 2BRKA 4ECVA 4KBIA 3KMQA 4R5PB 2HNZA 2RKIB 1RT1B 4CIEA 3RTVA 3SQ0A 2HHTA 1S0OA 4IH6A 4JV2A 2FBYA 1A5VA 2UVUA 3AO4A 4CJLA 1TKXB 1UA1A 1NOYA 2RDIA 3AVNA 1J9AA 2OPPB 5J2MA 1T03A 3MEGA 3LPTA 4WZMA 3RWUA 3FFIB 5CY4A 1CLQA 3NBPB 4O4RA 3KHLA 3C95A 3LWMA 1B9FA 1HYSB 1Z26A 4K4YA 3L2UA 5KFYA 3PHEA 5F9NA 1FK9A 1HPZA 3QINA 1FKOB 4DTSA 4DFPA 1TKZA 4QAGA 1SH0A 3EYZA 1L5UA 2C22A 3NE6A 2WOMB 5J1EB 3VQCA 2C2DA 3MR2A 4CFCA 1RTDA 4FJ8A 2V9WA 3NFAA 4MK7A 3LZJA 4Q0BB 4ECWA 4DSLA 1QE1B 4CGGA 4C8MA 1BHLA 2R8IA 1VSDA 3K2PA 1MU2A 3LP3A 3ITHA 2KFNA 1RBUA 3HVRA 2ITGA 3OHBA 4RW9B 3AA5X 4BE0A 1HNVA 3LZIA 1L3VA 3PZPA 4NLDA 3OSPA 4PY5A 5KFIA 1KVAA 2PZSA 5KT7A 1D1UA 5JS2A 1D5AA 4F2SA 1RT3A 4O3RA 1IKXA 2I5JB 3EPGA 3ZSWA 1O1WA 4NCGB 4NLTA 3MR6A 1CXUA 2XO7A 3HVTB 1N6QB 2G8FA 1RBSA 1XHXA 2R8JA 3OYDA 4DTXA 2IM1A 1S6PA 3V81A 2HAIA 2ZQBA 3ZSOA 3U3GA 5DGBA 1HNIB 3ZSQA 4QCLA 3SQ2A 3BR9A 3JSMA 4RW8A 5HP1A 4FS1A 4KPYA 1HMVA 3KLHB 4ZP9A 1N5YA 3PW7A 4Q45A 1IKYA 4K50A 2R8HA 2IC3A 1T03B 1HYVA 1A5WA 4LD0A 2FLPA 3HK2A 1IO2A 4HCCA 5KG2A 1KRPA 3VA0A 1DTQB 4DU1A 2RPIA 2HNYB 4TYAA 3KIOA 1RAJA 1X1PA 5HRNA 4OGEA 3LP2A 4RW4B 4IG3A 4FLYA 4NRUA 1XR5A 5KFOA 4FYDA 4B3OA 2HNDA 3D5MA 2FLLA 2FJXA 1HYSA 1Y97A 2E9ZA 3WNFA 1WSHA 1CZ9A 4NLRA 2JEFA 4GC6A 5L1IA 5KFEA 3OS0A 2CJQA 1VSEA 3OL8A 3MAQA 4B9MA 5KFZA 2OZSA 3SJJA 3MR5A 4RNFA 1VSIA 2VA2A 3ZSRA 4RNNA 4O3SA 5L9XA 2FC0A 4EO8A 4CGIA 2HWIA 4CGDA 1WAFA 3OYGA 3SUQA 1TGOA 4FJKA 4E7HA 4AHUA 5J2PB 2EX3A 3LAKA 2J6TA 2FVRA 2E9TA 3KHGA 3ALYA 1S9GA 2Q3SA 4RNMA 3H5UA 2ATLA 1W9HA 4CJTA 3U6FA 5KFXA 4CF0A 3H5SA 2OA8A 4HUFA 4CFAA 4CHZA 4IFVA 4B8AB 1FXXA 5C24A 1S5JA 1TP7A 4F50A 2X78A 4K4SA 3U3YA 2R2TA 5CZ1A 3M8PA 5KFAA 4CHYA 1KLNA 2YNGA 4CCHA 3TANA 4EBDA 1D9FA 4BWJA 5KRSA 2KFZA 4DG1A 5EWGA 3HJFA 1Q8IA 1LWFB 5HROB 4Q43A 3SI8A 4FK0A 3KHRA 1A5XA 3IGVA 4OKEA 4CFBA 1BIUA 2XCPA 3UPFA 4YR2A 1KFDA 2VG5B 2KZZA 1QHTA 2Y1JA 4J2EA 4BDZA 4FJIA 1N6QA 3QLHA 5KG4A 2W42A 3GV8B 3NF8A 4PUOB 2HW3A 3VA3A 4CF8A 1TL3A 4IFYA 2NUBA 1BL3A 3NCIA 4ZHRA 4NYZA 3V1RA 1NK5A 2HHQA 3LP2B 2ZE2A 3TAQA 1TL1A 4C8NA 3NGYA 3KLIA 4ZTJA 3AVBA 2YV0X 5KFGA 5KFMA 4E1NA 4DL3A 1RA6A 4DSJA 4KTWA 3L3UA 2IBKA 3IN5A 3PJXA 4CFDA 3QEWA 4UQGA 2HNYA 3DRSB 5D3GB 3I8DA 4E7KA 4URSA 4QW9A 3L2RA 3AO5A 2BR0A 4RW4A 3UQSA 1N48A 3PR4A 4EZ6A 2G8IA 4E7IA 4YR3A 2DFEA 4I7FB 4KSEB 1WSJA 1KLMA 3E01A 2WCXA 5DG7A 3WNGA 4CJWA 1TVRB 4DLGA 4NLQA 1HJRA 3OYMA 4B9TA 3VQQA 4DTOA 3AA2A 2R7YA 4E0DA 3LDSA 4B9VA 3SUPA 4RUAA 1SKWA 4NCAA 3CM5A 4M3WA 2ZKUA 1GX6A 3OYCA 1JLGB 4I2PA 2Z1HA 3OVNA 5K14A 3FQLA 3Q8SB 3H2LA 1ITGA 3C6UA 2QKKA 3DLGB 1TKTB 1C1BA 3O3HA 3OYHA 3NL0A 1RT6A 3HYFA 2R8KA 1ASWA 4OKKA 3FFIA 1W25A 4JLHA 2XY7A 4F2RA 4DS5A 4YFUA 2AQ4A 2FBXA 1WSIA 3I0RB 2F96A 4MFBB 2JC1A 4AH9A 3ZSZA 3O3GA 4H4OA 1X9WA 4O4GB 3TAMB 4O0JA 3MXMA 3FSIA 3KLEA 1S48A 1TL1B 2WONA 2YNFA 3EZ5A 1U47A 4CHNA 3CJ0A 1S1VA 4WZQA 1TKXA 4NLSA 3KLIB 3HL8A 1EKEA 4IG0A 3CFPA 2P1JA 4MK8A 3RRHA 2WHOA 1C6VA 2F8SA 4CF1A 3QETA 3I5CA 1HPZB 3M9NB 1CXQA 3ITHB 3HSTB 3MFIA 3AVHA 3S9HA 4ID5A 5F9LA 3TAFA 4TYBA 3LP0B 4KB0A 4ECUA 4J9NA 1NHVA 4KFBB 3OS2A 2HVHA 1S9EB 4FCYA 4CJPA 2QV6A 4CF9A 3RBEA 1JLBA 2P51A 2YHBA 4X2BA 4DQQA 4CGHA 4KHUA 1EP4A 1I39A 3G86A 4Z4FA 2XGQA 1ASVA 3HP9A 5D3GA 3SZ2A 4KB1A 2IJFA 5FROA 2IJNA 3L2QA 3SQ4A 1EETA 1S97A 1S6PB 2XY6A 4KHRA 1RT5B 4I2PB 3KK3B 3V6KA 5DQIA 2FVCA 4ECYA 1RDBA 4NLXA 1K1SA 4QWAA 4DQSA 3Q8QB 2W9BB 1C1AA 1VRTB 1K6YA 1LW2A 4DQIA 1HYZA 3CO9A 1JLQA 1RT2B 4YQWA 3OLAA 2WB4A 3MTKA 2G8KA 2HHWA 3LP1A 5HRPA 3I5BA 3G0ZA 3CJ3A 3KOAA 2BQ3A 4G1QA 4ZMMA 2EC0A 2C2EA 1RDDA 3JSMB 3KLGA 1XI1A 3DLGA 4ED2A 3TAMA 3S3OA 2DFHA 3D0PA 1C1BB 3QIOA 2X74A 4DFKA 4KHQA 2IM2A 1RBTA 2IMWP 2J6UA 3NH2A 1C2PA 3VQ5A 4RNHA 4N5SA 2OPQB 1JKHB 3KK1B 4TSXA 1ZTWA 4M95A 4NLGA 2AJQA 4IH5A 1RT4B 3DLKB 3KLVA 3BREA 4NCBA 1CZBA 1J5OA 4MK9A 3H5XA 1LWEB 1XR6A 2IDOA 4NYNA 3K58A 4GC7A 4DL7A 1C0TB 4DWIA 4C8LA 4ED6A 1ZETA 2AGPA 2D0CA 3KMSA 1UA0A 5C42B 3SUOA 1NKBA 4IKAA 3C6TB 5F8NA 1KVCA 3QEXA 1KVBA 1J54A 4FLWA 4RUCA 3V6HA 4CEDA 2B4JA 2AGOA 3KKSA 5J2PA 4Z4HA 3OS1A 2XRIA 3NGZA 2OPRB 4BDPA 5I3UB 3AVIA 5KFLA 1R0AA 3SV3A 2VA3A 5L1KA 1NJYA 1TV6A 5CYQB 4LH5A 4M3YA 2BANB 4ED1A 2HMIA 3P1GA 4E1MA 2Z1JA 1UWBB 4R5PA 2YNGB 3JYTB 2E6MA 3UR0A 4M3TA 3CVKA 1UOCA 4CJQA 1NK0A 1T7PA 3BSAA 1Q9XA 3F73A 5EUHA 1BQNB 1G15A 4H4MB 3UDLA 2XCAA 4IRDA 3QEIA 1LAWA 3DRPA 2JC0A 3PR5B 2QK9A 3V4IA 4KV8A 4KREA 4I2QB 3LAMA 3VQ8A 3LP1B 5DQGA 5DG8A 2UVRA 1B9DA 4J2DA 3DOKB 4FJ7A 2RKIA 2RF2B 5HLFA 5J2NB 1RTIB 2WOMA 3DMJA 3OYIA 3QGGA 3G6XA 2CKWA 2GBZA 4M3RA 2F8TA 5KG6A 2DFFA 5KFBA 2UUTA 3HPOA 3PX0A 2UVVA 1NOZA 1U4BA 2IOCA 5KT5A 4FBUA 5HRSA 3V1QA 2GC8A 1JLFB 4CJVA 2YNIB 4URGA 4RW9A 1QUVA 5KFCA 3ZSYA 4G3IA 2FVQA 4IR1A 1VSJA 4K8XA 4IDKA 3GIKA 1FKPB 5KFSA 3RAXA 4MQ3A 3AVCA 4FJNA 4OVLA 1KHWA 3OLBA 2ATQA 1QE1A 4RW6A 3NH1A 4KHWA 1CSJA 2A1RA 4IKFA 2E4LA 4FJ5A 1NK8A 2G8UA 4ICLB 3BSNA 1BCOA 1NHUA 1VK0A 4FXDA 2XHBA 2AU0A 4QPXA 2OYQA 1ZBHA 4WFYA 1GOAA 1WN7A 5EWFA 3KTQA 2W7OA 1RYSA 1DTTB 4O44A 4JRPA 3FRZA 4Z4IA 1KLMB 3TABA 3DI6B 1IG9A 3TVKA 4URQU 4TQSA 3DRRB 4CJ4A 1QTMA 2I5JA 3K5OA 1EX4A 2R8GA 4IH7A 4NCGA 1IKYB 5F8IA 3DRPB 3QERA 1U09A 3C94A 1VSMA 3L3VA 3RR8A 1S10A 1TKDA 4I2QA 4CJFA 3KJVB 4FLZA 2QE5A 2QKBA 4FLTA 4ECRA 4B9UA 4KB7A 2IS3A 2AX0A 3KLEB 2A1SA 1ZBUA 1LW0B 1QS4A 1EXQA 3I0SB 4ECZA 2R2SA 4FJLA 2W8LA 4Y34A 3KK2A 4AILC 4F3OA 3KKRA 3PJWA 1NJZA 4EO6A 4B9SA 5KT3A 2R2UA 2FBVA 3NGDA 4CK1A 4B9NA 3PO5A 3THVA 2E6LA 1QSSA 1RTIA 2LSNA 3QIPA 3OL9A 4RNOA 4HYKA 4O5BA 4U7CA 3D28A 4QW8A 5KFJA 4KTZA 4IRCA 4FJGA 1JLCA 3B6PA 4AHSA 4KTQA 3QEVA 5I42B 1WSEA 1XWLA 3DOLB 1BCMA 1RBVA 3ASMA 2FVSA 3V1OA 1I6JA 4W5NA 3LP0A 4OKJA 4IG3B 3Q8PB 2DPJA 1S6QB 4FLVA 4OLBA 5KFWA 3DLBA 2HNDB 1RT5A 3DM2A 1HQUA 1SH3A 1BI4B 3DDKA 4N47A 3WNHA 1NK7A 2JEJA 2HHSA 4Y1DA 4O3QA 3AVFA 4TY8A 2OPSB 3KLFA 1GX5A 2B6AA 2P5OA 3V6DA 1RTHB 3LANA 4KI4A 2JLEA 4F3TA 4N41A 1X9SA 5KFNA 1RILA 4DTUA 3H4DA 4O44B 3HKWA 3TR8A 1YT3A 3PX6A 4ZPBA 1ZYQA 3ZCMA 4DF4A 1LAVA 3NHGA 2AX1A 1JIHA 4E19A 4DQPA 5C25A 3NGIA 2KW4A 1LW0A 4J9KA 4KO0A 2XI2A 1RT2A 3KK1A 4J2BA 4Z4GA 2WRMA 1C1CA 2Z1IA 3NDKA 1S1UB 3CQ8A 4YMEA 3OYLA 3MEEB 4IFYB 3P83D 3QGHA 4DL6A 4JRQA 1FK9B 4ECQA 2JGUA 4ZTFA 1S0NA 1SKSA 4ELVA 4YNQA 4PWDA 1LWFA 4RW7B 4CGFA 4LH4A 3C6TA 3RMBA 4CEEA 4CIGA 1IKVA 3RMAA 1HARA 4I7FA 3I0SA 4DTNA 1LWCB 5DGAA 3NBPA 2G8WA 3KK2B 2BQUA 4DSFA 2OPRA 2ZD1A 4ZHRB 1WSGA 3DRSA 3AA3A 3T19A 5KG0A 3GYNA 3OL7A 5KG3A 3PW4A 2JEIA 2BANA 3QIPB 3SYZA 1S49A 1TK0A 3AVLA 4PQUB 1TQLA 5KT4A 2ETJA 2XY5A 1S1XB 2VG7B 4O3OA 3QZ7A 4FJ9A 2YHAA 1RT3B 4I9LA 3OYJA 5DMRA 5I3UA 3BQ2A 3SFGA 3IAYA 1R0AB 3QNOA 3HP6A 3RMCA 1HNVB 1TK8A 4TN2A 3V6JA 3VQBA 5J2QB 1IM4A 3TAPA 5KGXA 4Y3CA 1IH7A 3V81B 4F8RA 1HQUB 5K14B 4RU9A 3RR7A 2O5DA 4J9PA 2RF2A 3PW5A 3JYTA 5CYMB 1JXEA 3NF6A 2V4QA 4J2AA 3C6UB 1IKXB 4Z4CA 2BGGA 5C25B 4GVMA 2E9RX 4DL2A 5KTQA 3HVWA 1GOCA 4DU4A 4J9QA 3GILA 3V6DB 4YP3A 4IR9A 4CK2A 3V4IB 4M41A 1KTQA 3BGRA 1T8EA 4CESA 4CERA 4H8KA 3I0RA 3OSNA 4JS4A 5DQHA 4K4UA 3HO1A 5FRMA 4ZP6A 1SL1A 4RW8B 1JX4A 3AVAA 4WE1B 4PWDB 3DMJB 1UAXA 4ECXA 4J9LA 4IG0B 4HKQA 4B08A 3CIZA 4Z4EA 3HPGA 3BSOA 4NLYA 4Y2AA 2WTFA 4FVMA 4LSNB 1YVFA 4CJUA 4ICLA 5F8MA 4NLWA 4FZXC 4DL4A 4H4OB 3KNAA 1JLEA 2EHGA 4IDKB 1S1VB 3VQEA 3SFUA 4DMNA 2XI3A 2OZMA 5HRRA 4ELUA 1HRHA 3N6MA 4K8ZA 3KK3A 4CEZA 2ILYA 1XHZA 3G6YA 2VG7A 3MXIA 1GOBA 2BRLA 1RTJA 2I1RA 3AO3A 5KG1A 2ZD1B 4F4WA 4CJ5A 4FZZA 4ZP7A 5KFVA 2R2RA 2AGQA 2VWKA 3CFRA 2DTUA 1VSKA 4ZP8A 4TLRA 3GQCA 1T05A 1RNHA 2HHUA 2FLNA 2KQ2A 2PY5A 3KD5E 2QXFA 4MIAA 4ED3A 4BE2A 1TK5A 3GIMA 1RT7A 4EZ9A 2HVIA 3H08A 4FM1A 5KRTA 4PQUA 4HUGA 5KT6A 1RYRA 4FW2A 4NLVA 1VSLA 5CYMA 4LSLA 4KRFA 4Q44A 3T5HA 3QIDA 3SQ1A 1DLOA 3MF5A 3T5JA 1SL2A 1WNEA 3GIJA 3PO4A 3MEGB 3H98A 1W0HA 4BACA 4HVJA 3CDEA 5J2QA 4QWDA 4FW1A 4ED0A 5JXSA 4DSKA 4WYLA 2RN2A 4DSEA 1KFSA 3VQ6A 2X6NA 3BDPA 3FQKA 2HB5A 4B8CA 4TY9A 4XIUA 4KAZA 2UVWA 3H4BA 4EBCA 1SUQB 5DLGA 3ZT0A 4AHVA 4ZVEA 2AWZA 3NH0A 5J1EA 1RDCA 3K5MA 4Q5VA 2B43A 5JS1A 4DL5A 4ZPDA 3K57A 4IOBA 1QAJA 1Q9YA 4FJJA 4K4VA 1RT4A 1B92A 4FJHA 4EYHB 1JLCB 3DLKA 4DQRA 1IKWA 3RMDA 3OJUA 4CHOA 4G1QB 4J9RA 4Q8EA 1C0TA 2XGPA 5DG9A 5KFHA 1Z4UA 4NLOA 5F8HA 4J9MA 3DYAB 1KHVA 4DTJA 1S6QA 2D3UA 3AVKA 1J53A 4GW6A 3EY1A 4OL8A 3M8QB 4LY7A 2OPPA 4WXOA 4K4XA 3N6LA 2YKMA 4EBEA 1MU2B 4R8UA 3M9OB 3V9ZA 1RCHA 4KKOB 3BJYA 1RTJB 4DLEA 4FM0A 1S1WA 2BDPA 1ZBFA 1LWEA 4TY8B 3V9SA 2FBTA 3KD1E 2HWHA 4CEFA 3OYEA 1LV5A 3OL6A 4W5QA 2O4IA 2D0AA 3HVTA 4AHTA 3SV4A 5KFPA 1SL0A 3IS9A 4Q0BA 4NYFA 4DTPA 2IM3A 3CG7A 1HQEB 1QSLA 5HLFB 1NJXA 3OHAA 5HP1B 4QWEA 3T3FA 2OH2A 4DFJA 3ICLA 3RB3A 1QQCA 1BQNA 2Z1GA 4QWCA 3MECB 5KFTA 3RB0A 4XPEA 1QSYA 3LPUA 1TV6B 4O3PA 4EP4A 3SPZA 4CIFA 4M42A 1S1UA 1VSHA 1I3AA 5KFKA 3TI0A 1KCFA 3B6OA 1JLGA 1UWBA 2W7PA 3ZSVA 4LQ9A 2D5RA 3QYYA 3IRXA 1NK9A 4LSLB 1FKPA 2JEGA 4F4YA 3VQAA 1ZBLA 5EU7A 1N5YB 3PW0A 2PYLA 4CEAA 5KG5A 1WSFA 4K4TA 3HT3A 4KHSA 5FRNA 4CJRA 2IAJA 1LWCA 3E51A 3DLEB 4RW6B 3RB6A 1S1TB 3TAGA 2GIQA 1D8YA 3SPYA 1DTQA 2FVPA 1HNIA 3O4NA 2FJVA 2YNIA 1WAJA 5T14A 4FK4A 4FS2A 3DLHA 4O4GA 1SKRA 1X9MA 2YKNB 5T7BA 5KFDA 3NF9A 2Y1IA 3WNEA 4BWMA 1IKVB 1RA7A 3KHHA 3K59A 3EPIA 4OPKA 2XC9A 3VQPA 2ILZA 3TWHA 5FDLB 2HHXA 4DFMA 4JUZA 1JLFA 2B5JA 3DYAA 4KHMA 4WFZA 2G8HA 3DLRA 2HHVA 3H40A 3S3NA 1SV5B 3OJSA 4CGJA 3ULDA 1S4FA 1JLAB 1DTTA 3CDUA 4CEOA 1NJWA 3DI6A 3NF7A 2C2RA 4U6PA 4Y1CA 4CF2A 4GMJB 4WYWA 2YNHB 3PY8A 3IG1A 4DG1B 3HHKA 5JUMA 2VG6A 1S9GB 1Z25A 5KFUA 4F4XA 3VQ7A 1QAIA 1RBRA 4M3UA 3VQ4A 1L3TA 4M3ZA 1VRUA 1BGXT 1N4LA 4HUEA 4PUOA 4OJRA 3V9UA 3ISND 1TL3B 4MH8A 3FDSA 1N56A 3GIIA 4EEYA 4JV1A 2ASDA 3AVMA 4C8OA 4HTUA 3SCXA 3DRRA 4B9LA 3HVAA 4H54A 4TQRA 3T1AA 3HM9A 1LW2B 3QEPA 3QO9A 4I9QA 2KTQA 3MECA 1D9DA 3SNNA 4DU3A 5J2MB 4AHRA 2BE2B 4ECTA 2IAJB 2DY4A 3QLHB 3NAHA 5HBMB 4BDYA 4KHYA 5C24B 3KJVA 4M3XA 3M8PB 1K1QA 2HNZB 3DOLA 4M94A 5KFQA 3KLGB 1RDRA 3MR3A 4FJXA 4MKBA 3CM6A 1T3NA 2YKNA 5HROA 2X6SA 1REVB 2UUWA 3RBDA 2VG5A 1C0UB 3PW2A 3DLEA 3QZ8A 1D0EA 2W9CA 5FDLA 3F9KA 2BQRA 4JS5A 3O4QA 4NLUA 1J5OB 3M8SA 4ELTA 2C28A 4O0IA 3M9MB 1WNSA 4KAIA 1VSFA 4W5TA 4FLUA 4CJ3A 4CJSA 4CJEA 3RAQA 2ALZA 3QNNA 3N6NA 4F4KA 1NKEA 4FZYA 4ZPAA 3CWJA 3DM2B 3NKYA 4ZPCA 3ZT1A 1BI4A 3BQ0A 1XR7A 3SI6A 4R0EA 1F21A 4OLAA 3IGNA 2YNHA 4L8RB 4KI6A 4KE5A 3CJ4A 4ZVFA 3HXMA 5F8LA 3AO2A 1S9FA 2VG6B 5KG7A 1JL1A 4H4MA 2B5JB 4HHTA 3OYFA 1BQMA 3PVXA 4E7LA 3MXJA 2GIRA 4IRKA 3SUNA 1JLAA 3A2FA 5KT2A 5EWEA 4MFBA 3GV5B 4K4ZA 1JL2A 3NMAA 2O4GA 1L3UA 1SUQA 4DTMA 3IG1B 1TAQA 3O3FA 3GV7B 3EZUA 1DLOB 1S0MA 4DEZA 4J9SA 3QO9B 2B6AB 4KO0B 3T5LA 4ECSA 3D45A 4DSIA 3G10A 3MEEA 4O55A 1C0MA 4CHQA 4QWBA 3DOKA 1BIZA 2GV9A 3NAEA 5J2NA 5KI6A 3UIQA 4FM2A 3MFHA 4RW7A 1HMVB 3KLHA 1REVA 3TQ1A 5L1LA 1RT6B 3AV9A 4KFBA 5KFRA 3RB4A 4B3OB 4TXSA 2WK4A 4M45A 3OYAA 2W9CB 1S1XA 2PYJA 4N76A 4R8UB 4Q8FA 1IKWB
chains in the Genus database with same CATH superfamily
4KKOA 1SJ3P 4DCOB 3ULEB 1M5PC 2XNRA 1E6YB 4RKUC 4CEQA 1FRIA 3ISZA 3M8RA 4BR2A 1XC9A 2MYFA 4CZKA 3TZZA 3M8QA 3IS9B 1C0UA 1ASUA 3LWLA 3Q24A 3AO1A 3EEQA 2F9JA 2D3ZA 4WFXA 3PSIA 1YZ7A 1Y3KA 3V9XA 3I6PA 1N0VC 1RAEB 4K0KK 2H65B 1F9EB 1X5TA 1B7FA 2VCPA 2RDJA 4QS9A 4X4VA 5D0HA 3DOMA 1NNDA 2QA4G 2F4VJ 3CYMA 4GKJK 1EQMA 4FJMA 1S9EA 4O3NA 3CCVS 1BWEA 4DV1F 2QA4N 1ZZNA 3MEDA 4C98A 2V8PA 3LF0A 4W90B 3ZTOA 4ID1A 4BRPA 3IRXB 5LMNF 1CZAN 1EP4B 4C0BA 4YY3F 3WQTA 5E3QA 1HBNB 4PA1A 1JNZB 4I56A 5AJ3J 2NSCA 3DLJA 1YI2N 2EKYA 2OD6A 3BGRB 2VQFK 2QW9A 3DXKB 4NRTA 5L1JA 3O6WA 2GGPB 3H8YA 3HFZB 1VQ5N 3UVJA 4LF7J 4IQXA 1NK4A 3PDNA 2LA6A 2D7SA 5EXWA 3G4SN 1SIZA 1VRTA 2KZMA 3ZNUA 2YWGA 4XPCA 3ZZPA 1JLQB 1B7YB 4J9OA 2FYXA 4CEBA 5ETLA 4RG8A 3TAEA 1FF2A 1CS4A 4HT7A 1RDAA 4FK2A 2C2KB 2LP4A 5HJXA 4V19S 1KEKA 4PPZA 4FKYA 1YVUA 4H0PA 4WE1A 3A12A 4CECA 3U9DA 2KKZA 3R5DA 3EGWB 4JD2B 4E89A 3CDWA 4BR5A 5ETMA 1NKCA 2QWLA 2BKOA 4KGVB 4OYWA 2ZDOA 4UUXA 4OPJA 2ZBPA 3ZSXA 1RKJA 4W5OA 4NLPA 4DKWA 2O66A 2V8HA 5IXUA 3D7SB 4NEZA 4LRDA 4I64A 2IVYA 3LW5C 1RTHA 5C12A 3PHTA 2G2ZA 4MIBA 3Q89A 3BEXA 4LF8F 4JYAJ 3T1YF 3EZOA 1Q0NA 2RS2A 1XTZA 3D0HE 5DLFA 1TVRA 3ILJA 4ENOA 2HRUA 1VLOA 2DGUA 1BISA 5L38A 4C8KA 1N33K 2RQMA 4PG4A 2E1RA 1F2GA 4FYXB 4NZ0A 3ZETA 2IC3B 2FJWA 2DXDA 3QJJA 1RBOB 2HBLA 1D8ZA 2IM0A 1NK6A 3KK7A 2ZH7A 4BROA 2W4CA 4ECVA 1ROFA 1KVJA 2AYEA 1Q79A 4R5PB 2XHCA 1RT1B 4WTYA 3RJMB 4CIEA 2CG4A 1S0OA 2HSTA 3KJNB 1U0HB 3AARA 2HURA 1XNRK 3AO4A 4CJLA 2FQQB 3L95X 4A59A 2VH7A 5J2MA 3J7Z5 1T03A 4WZMA 5M2UA 3RWUA 1UPMB 2MZQA 2ZJRL 1V4SA 5AJ3F 3NCQA 3C95A 1B9FA 2ZH1A 1Z26A 4Y00A 3L2UA 4WPAA 5F9NA 1HPZA 5B08A 4H0XB 1VK8A 4YOYA 4DFPA 4QAGA 3EYZA 1L5UA 4X62K 1VJWA 1K8KB 2O8CB 4DN0A 2RHSB 3LA0A 4IOAL 1VQMN 3MR2A 4CFCA 2OEJA 2AEFA 4I6AA 3ZEUB 3LZJA 2ZOGA 3MMAB 4ECWA 5FLXY 4TNOA 3K2PA 5AQIA 4YB1P 1MU2A 4EGLA 2BVZA 2GVZB 8ATCB 1KQFB 2NRZA 2DGVA 3HVRA 2ITGA 4X4PA 1GNKA 1XNQF 4UZBA 3WDOA 3NLCA 2PZSA 3TTDA 1XMOK 4USIA 4F2SA 1N5TA 2VOOA 3HMJG 3HF5A 1O1WA 4K0KJ 2RE2A 4DHYA 3WXKA 4WP8A 5IWAJ 3QGPA 3CCZA 1TZ0A 3FBCA 3GONA 5U47A 2R8JA 4N8NA 2IM1A 3W3SA 1N5QA 5G4DA 2AKWB 5MLCQ 3V81A 1FRJA 4EHTA 2OJ3A 5DGBA 5ADZA 1WF1A 3JSMA 4RW8A 3BF3A 4KPYA 3CDAA 1RWWB 2VDIA 3HX9A 3LDNA 2E20A 2RDDA 1S76D 4K50A 1T03B 1GLAG 1S72N 1VQON 1HYVA 3HCXA 2X51A 3HK2A 3CCRN 4LR9A 5E0OA 2GQCA 3MTJA 1R0CB 2JDJA 3KIOA 3D1HA 1X1PA 4OGEA 1PBAA 1SC4B 1NO8A 2LVWA 2BKNA 3VCDA 3CJCA 1JJ4A 2LU1A 3TWZA 2EFOA 1TTHB 2ATCB 3CJ9A 3JAMO 4M5MA 2CA9A 2LQ9A 3IAS9 4DCPB 2DR7A 5AQWA 3K8WA 1C4CA 4DR4K 2M70A 1ZM2A 4Y2IA 1WSHA 1B0PA 1N34J 2JEFA 5L1IA 4B1WB 1IJEB 1NDLA 5KFEA 1YLXA 3IR6B 2A10A 1VSEA 1D3WA 1UEVA 1WTBA 5AQHA 4MT1A 5KFZA 2FSKA 2DYAA 3N4QA 5C7PA 4UY8T 4LF5K 1VAZA 1WD6A 4F0MA 2FC0A 3ZEUA 4EO8A 2MKJA 4GV3A 2HWIA 3OYGA 1RAGB 2J6TA 4OX8A 3BF4A 4CLLA 3SMPA 3KHGA 3ALYA 3H5UA 1W9HA 1S7HA 1RB0A 5KFXA 4E8UA 5A8RB 2OA8A 1SJ1A 1GLFO 5CR4A 4JHDB 1G6BA 2MTLA 4XH5A 4IFVA 2WVCA 2MHEA 2Z2YB 4D3GA 2FHMA 1FXXA 1X3NA 2X78A 2ABYA 2UUCK 3A3PB 1KLNA 2YNGA 3TANA 3NWGA 4AL5A 1PCAA 2ROEA 5ETQA 3C8YA 2GMJA 3KHRA 4NZ7A 2ZZTA 3IGVA 2QO3A 3UPFA 1ZAVA 1QHTA 4FJIA 2ZHOA 1KD1O 5KG4A 1EKRA 4KT0C 3NF8A 2W42A 5BR8J 1Q7YT 1I3OB 1HIYA 4TVAB 5AXNA 4ZHRA 3IXQA 2HHQA 2A6MA 3M05A 4ZA1A 4M5KA 1ZXOA 3W2WB 3NGYA 2CQ3A 2VHGA 1Y4ZB 3PSFA 5KFMA 2XWXA 3L7PA 1RA6A 1SC1B 3LOUA 2PMHA 1WHYA 3IN5A 4A47A 3JAMU 4B1VA 4YOUA 5D4LA 3HD2A 4E7KA 3P39A 3BGOP 4LF8J 4JYAF 4URSA 1UVKA 2E7XA 5AR0A 3PR4A 1TL7A 3NOCA 2G8IA 1HNZK 4YR3A 1Q5YA 2FJAB 3WNGA 5DG7A 2OEMA 4CO1A 1XMBA 1OH8A 2ZH3A 4P2XA 4B9TA 3VQQA 3AA2A 2LEPA 2XZDB 5IT9O 4LR8A 1HD0A 2ZM6K 1Y10A 2B4OA 1OH6A 3OA9A 3LQVA 3H2LA 1M5HA 3G8TA 5JLHA 2QKKA 4GVEA 3DLGB 3W5YA 1VFJA 3O3HA 2AYBA 3WQUA 2MHNA 1F60B 3FEYB 2R8KA 2I9SA 4F2RA 1V9OA 2ITMA 3DRXA 2RQCA 3VEZA 2QLBB 1DQAA 4MFBB 2E2PA 3ZSZA 2DEJA 3O3GA 1X9WA 3MXMA 2W24A 1U47A 2V2ZA 2R7QA 1TKXA 3WC0A 4RWTA 3KLIB 3HL8A 2QLFB 3UN5A 3GL1A 1EKSA 1ZM9A 2E5IA 1SJRA 3KYLA 2GWJA 2J5AA 3I5CA 3V2UC 3ITHB 1IXKA 3PKMA 2DNGA 3ZZZA 3W65A 4A8QA 4ID5A 2MJNA 5F9LA 3TAFA 4TYBA 1NMDA 2F63A 1BO5O 3MD3A 4KFBB 5AQYA 1TL7B 5J1NA 2P9KB 2QV6A 5L9NA 2DRBA 5H9FK 4MLHA 4K0KF 1FVQA 3HT0A 2ZBCA 1J2VA 3PFEA 3R1LA 5D3GA 4L76A 2IJFA 3A5OC 1WSRA 5FROA 4DV2K 1GK8A 3L2QA 3SQ4A 1S97A 3AGRA 4OX7A 2CQPA 2PA8D 2J7KA 1RT5B 4KHRA 3L09A 1RDBA 4FPAA 2R4FA 2P9LB 1UP1A 1O6XA 1K1SA 2I7PA 3Q8QB 2P8IA 1VRTB 5JLFA 4B9QA 4DQIA 2DBBA 3CO9A 2XZTB 1UFKA 3OLAA 2HFNA 3VEXA 3MTKA 3D6RA 2GX8A 3RBXA 3LP1A 3CJ1A 3QJPA 3I5BA 3G0ZA 3CJ3A 1ZPWX 3GSIA 3WHIA 1YITS 2K3IA 2C2EA 1VQ4S 1GLEG 4H0VB 1XI1A 4J9UE 2XBPA 1DARA 4L73A 2CPHA 1N32K 2IMWP 2J6UA 3AAPA 2DCLA 1C2PA 3RYLA 5FPEA 3VQ5A 4A8XA 1ZTWA 3BN7A 5B0GA 1KN6A 3GYXB 2R7RA 5AQGA 1WACA 3D6MB 3KLVA 1U1PA 1GFWB 1TUWA 4NYNA 3K58A 2UV8G 2VONA 1VHIA 3JXOA 1VQ5S 2BZ2A 2UUCJ 5C42B 3BS9A 3C6TB 4LJMA 4FLWA 3G25A 4BRLA 5DZ7A 2DR6A 3HFKA 2BJ9A 3KKSA 5J2PA 4USMA 5E26A 1V4TA 1P9YA 2XRIA 3NGZA 4BDPA 5LMUF 4JKCA 4JI5K 2CJBA 5L1KA 4YN3B 1TV6A 3H42A 3UDCA 1N5SA 4KBOA 4OI2A 4M63A 5JJBA 4JHDA 2HMIA 3P1GA 3OFFA 4Z2XA 2QTDA 1OMSA 5CZXA 3P6YC 2Z1JA 2YKQA 1JB0C 4CLUA 2GFFA 4JKBA 2JRSA 4P2MA 3CVKA 3M2UA 1UOCA 4CJQA 2AIRB 2RILA 4AXJA 1G15A 1ZM4A 3DRPA 1Y00A 5HI7A 2N7CA 2OGUA 3V4IA 1UKUA 3RUBL 4I2QB 4MLEA 3LP1B 4MO5A 4J2DA 4FJ7A 5IT0A 4U8YA 2J7UA 4FWOA 4V1Ak 4K5SA 3OYIA 1UWAA 3MPYA 4PWWA 2MKKA 3G9CA 2LQJA 3TPQA 3MCSA 5KG6A 1NGJA 2LEBA 4OX6A 1U4BA 1TMMA 5A0YB 4FBUA 4I4BA 2R7WA 5HRSA 4DR5J 2GEMA 3CCJN 2ASMA 4URGA 5KFCA 3IFRA 2YX4A 1KR4A 2FVQA 4C2MA 3CPWM 4K8XA 3GIKA 1YG0A 4MQ3A 2HFOA 1KQSM 2VFSA 1VQ4N 4FOEA 4OVLA 4DV4K 3M8WA 1LXJA 3A8EA 4OHVA 3NCRA 3WX8A 4RW6A 2KL8A 1CBKA 4P73A 1EARA 4OX9J 1HHTP 4FPRA 4WKYA 1NHUA 4PKIA 4JAXA 4CZJA 3WC2A 3SBMA 4QPXA 3IMXA 4IXCA 4WFYA 2AEMA 1A6LA 5I9EB 3KTQA 2D9PA 4O44A 2P9IB 3FRZA 4WYBA 1KLMB 3TABA 4CWBA 4DX5A 4TQSA 1XMQF 1GLJO 3US5A 1EX4A 5BYQA 5B0CA 3ZX3A 2R8GA 4IH7A 4FYVB 1IKYB 2NRHA 4M5DB 4A2AA 3L3VA 5AQVA 4XEIA 1U6BA 2DXEA 4FLTA 5D4PA 2CQCA 5CZVA 2BABA 1Q95G 3P96A 3KLEB 2NUUG 2QWRA 1K47A 1QVFM 3A13A 4NXMF 4KH6A 4Z7CA 4B1XB 3S01A 2DPNA 2R2SA 5C15A 4DJBA 4FJLA 1FWPA 4Y34A 2NLXA 4CH0S 3BUZB 3LGMA 1BWFO 3N9UC 4KHPJ 4P74A 4CK1A 1CULB 4LF6J 4DQ8A 3A3OB 3VEWA 4CM2A 3IFEA 3TZYA 2IMOA 1QZ6A 4CDIA 4HDHA 3OL9A 4RNOA 3C15A 4U7CA 5FPDA 4QW8A 1LXNA 4DPYA 3MPVA 4QU7A 4FDFA 3O9UA 5KPRA 4LF2A 3CJKA 3QEVA 3D2EB 3OW2M 5KOWA 1XWLA 2BYCA 4W5NA 2QGFB 3AHPA 1BWVA 4X65J 2OFHX 2DO4A 4YHHF 5FLXO 5IFMA 4Q2MA 5LJ5Y 2HNDB 3DM2A 3SMSA 3DDKA 1DJ0A 3CW2C 1VBYA 3D7EO 4M1KA 3CSKA 2OPSB 1TL4A 1GXTA 2CAJA 3CE8A 3NOGA 2B6AA 3GDQA 2FHJD 2QFJA 4PWUA 3HOSA 3CMQA 2BJEA 5TKYA 4DPXA 2ZOMA 5GAGI 1X5PA 4DV4F 5M1QA 4FWQA 1ZYQA 3ZCMA 1FX2A 4A8KA 1LAVA 2UXBJ 2CQGA 1JIHA 2OI2A 5DM7L 3L4IA 1XEZA 1IR0A 2XI2A 2VBXA 3O1LA 1S6OA 1UJ6A 3NGRA 3B8AX 2ZBIA 3CQ8A 4YMEA 3OYLA 2P9PB 1JWWA 5KPZA 2JGUA 1R6VA 1SBRA 5AXMA 3R27A 3SAFA 4DV0K 2OLWA 2Z2MA 3PEJA 4LH4A 3P4UB 3C0BA 3KUGA 3C6TA 1RE1B 4CIGA 2GJFA 3VF6A 1WC4A 3RMAA 5BYRA 3I0SA 3NBPA 2AP1A 3MGJA 2BQUA 1N32J 2OPRA 1HW9A 4UY85 1X3MA 1R43A 4PL7A 1WSGA 5KG0A 2HBKA 3QFHA 2GIFA 5CABA 2FZCB 2CJYB 5AXKA 3OL7A 2VODA 1HQ2A 4TU8A 4A5BA 3SYZA 2VU5A 2O8DA 1YRUA 3TJ8A 3MAHA 4O0NA 4MJKA 4A57A 3QZ7A 4FJ9A 1RT3B 4I9LA 3M2UB 3O8MA 3OYJA 4FF4A 3G82B 2CPZA 2BM0A 2CPFA 3IAYA 1IBKJ 3QNOA 5CE3A 2IIRA 4X4NA 3PYFA 2NQPA 1TK8A 1G99A 1L3KA 4JKGA 3ZC4A 4WBFA 3NNAA 4BGAA 5AQQA 1Q82O 3HHLD 3AFGA 2LU2A 2CVIA 1N8RT 5K8OA 1HQUB 5K14B 3GR1A 4RU9A 3ID8A 5A2QY 3JYTA 1JXEA 4LIWA 1Q4RA 1S59A 1IKXB 1VQ6S 1PGZA 2PMZD 2BGGA 1VCTA 3U7JA 3HSDA 4WF9L 4DU4A 3GG1A 3GILA 3V6DB 3MCMA 2F5GA 4YP3A 4IR9A 1BA0A 5DDPC 4QIVA 2VQEF 5BYSA 4CESA 1B99A 3I0RA 3TZXA 1VISA 5DQHA 4K4UA 3MCPA 2E1MC 2GAHC 2IBOA 3CIMA 1SL1A 1JX4A 4WE1B 1IR2A 4PL8A 3ET6B 1Z6RA 1VQ6N 4IG0B 4HKQA 4JV5F 2FHKA 3PEHA 2JL9A 4CIOA 3HPGA 5BN8A 3B82A 2XB2D 2WTFA 4ICLA 3X3UA 4FWKA 1JLEA 1BE4A 4NB4A 3NEKA 4NOHA 3JB9k 2CPXA 3VQEA 1QAYA 3KWIA 5HRRA 3OVSA 3JQKA 4GV6A 1Y5NB 2P9LA 1GOBA 5KG1A 2ZD1B 4ZP7A 5KFVA 2PT0A 1NBWA 3TRGA 2R2RA 1EX8A 3TEHB 1H2VZ 4ZP8A 4AT1B 1RNHA 2BJ3A 3LM2A 2VC1A 1U1RA 3KFWX 2KQ2A 2PY5A 4JKGB 4MIAA 2QA2A 4EZ9A 2CNOB 4PQUA 4Y2KA 1P8ZA 4GV9A 4B3SK 2OEKA 1RYRA 5CYMA 2DHGA 3R5BA 3VAMA 1DLOA 2DO0A 3MF5A 2XG8A 4K42A 2MZTA 3H98A 3DN9A 3TU5A 1IBKF 2B8PA 1HNZJ 4ED0A 2OHDA 4WYLA 2RN2A 4L74A 3VQ6A 2X6NA 3FQKA 4B8CA 2OELA 4TY9A 4XIUA 1HNWJ 4KAZA 2QWNA 2CQHA 2EBGA 4P71A 1SUQB 5DLGA 1VS3A 2G1HA 3NH0A 2O8CA 5LJVA 4Q5VA 2B43A 2FTRA 4DL5A 4OYBA 3ID6A 3KUEA 1Q81T 4XH1A 5AXLA 1B92A 4NASA 1WF2A 3A8IA 4KR0B 1JLCB 1W97L 1IKWA 2YHYA 2HGNA 1FWKA 1Y11A 1LKZA 5HQLA 5F8HA 3SQGB 3HHEA 4ZIWA 4OL8A 3M8QB 1RWVB 4WXOA 2RJZA 1RK8A 3NWRA 3V9ZA 1QD1A 3LDQA 4DR5F 2A0FB 1RCHA 1RTJB 5F0WA 4DLEA 1S1WA 3Q7CA 4FM0A 2IVPA 4PG5A 4LF5F 2FBTA 3OYEA 4LF1A 4BRCA 3IUCA 5CA5A 2IVNA 4ZK7M 1HHQA 3UDVA 1HNWF 1OPZA 2MGZA 3IS9A 2XLIA 3MMAA 4JI2J 1UW4A 2XQCA 1FEEA 4DTPA 1QSLA 5HLFB 4WJBA 3OHAA 2YHXA 4EFHA 5ETPA 3T3FA 3M6XA 3RZAA 4DFJA 3RB3A 1N36F 4DUYK 1QQCA 1UZDA 3SXLA 2Z1GA 2RT3A 5KFTA 4NE9C 4XPEA 1BLUA 1AUSL 4U67L 3TSUA 4CIFA 4M42A 3M30A 1S1UA 3MR7A 1VSHA 1AW0A 2GGPA 4P10A 4ILLA 4Y65A 3G4SS 2ZH9A 2W7PA 4LQ9A 4QJVA 4Z37A 3QYYA 2QWMA 4YUDA 1OY6A 4MYTA 4LSLB 3ZZYA 2JEGA 1ZBLA 1EIYB 1HBUB 5EU7A 2PYLA 4CEAA 3VENA 2OSRA 2HFUA 4MTPA 1YBAA 3HT3A 5FRNA 2D9OA 4ZVTB 3RB6A 1YIJS 2MJUA 2MQ8A 3QRQA 1IUJA 1HNIA 4DV4J 2YNIA 2CFXA 1SKRA 5T7BA 4JI2F 3NF9A 2Y1IA 3WNEA 4BHQA 3MM9A 1IKVB 1RA7A 2PC6A 3K59A 3VWSA 3EPIA 3CMEN 4NPOA 3VQPA 2HLTA 1UL3A 3BO4A 2HK3A 1PIEA 2DHXA 2HMPA 5D4OA 4JUZA 1SJQA 2X3GA 2AYGA 2BW2A 2XMAA 3FZLA 2CH5A 2B5JA 3DYAA 4KHMA 4H4KC 2G8HA 2HHVA 3MMJA 3ULDA 1DTTA 4FWPA 4DR7J 4CEOA 4D3HA 3C19A 3AOBA 4U6PA 5B09A 3O9SA 2VG6A 1S9GB 2XYHB 4H5TA 3VQ7A 1QAIA 5C2FA 1LOUA 3VQ4A 1BGXT 2NZ4A 4HI1A 3CJ7A 4PUOA 3DDNA 4KJIA 2WVEA 3ENWA 4MH8A 2ZBQA 4LF7K 4HTUA 1K9MO 1FTRA 5HK4A 4V19J 3D0IE 3UKUB 3QEPA 4P7VA 1R8CA 3ETOA 3SNNA 4LFCJ 4AHRA 4A61A 2BE2B 4X66J 4OIXA 4JI1K 4MAKA 1NGDA 5C24B 2QMUB 3KJVA 4M3XA 2D0PA 3KLGB 5HVFA 3GSDA 2B4VA 3MR3A 2YQ0A 2YKNA 3VF0B 3SCJE 5M2PA 4DV3J 5HROA 3HI0A 3QAUA 3PXGa 1NNEA 1YITN 4OZ1A 4OI1A 1T0TV 3KHYA 4I1TA 3G6EN 1C0UB 2DR5A 1D0EA 2W9CA 5FDLA 1V3RA 4QYZK 4NLUA 1J5OB 2KM8C 4CTAA 3DFEA 1UCNA 2C28A 4DBQA 4O0IA 3FZBA 2Y0SD 2VB6A 3VQTA 3FGVA 4CJSA 2I2YA 1QAXA 4F4KA 2V51B 1IBMJ 5DJBA 3THYA 1ELOA 4OZNA 3CWJA 1U8SA 2HGLA 1BI4A 3SI6A 3QFPA 4OLAA 2YNHA 4BRMA 5D0EA 5CAAA 1VGYA 3FK4A 1LQ9A 3HXMA 3AO2A 5KG7A 3RW6A 4H4MA 1BUXA 2DVIA 1BQMA 1H2TZ 4E7LA 2GIRA 1W7AA 2A6OA 4ISGA 4PXCA 2YKOA 5A6WA 2JOQA 5D78A 1VOMA 5KT2A 4MFBA 4BRDA 3Q8UA 4PYDA 4BQLA 2HVEA 5M1PA 3MN7A 1L3UA 1SUQA 3IG1B 4JP8A 2VL1A 3UNYA 2CQ4A 2QA1A 5LT5A 4WK1A 3T5LA 3OT9A 3E8OA 3OR1A 3I56S 4B1YB 3BYPA 3G10A 4QWBA 3UWTA 2B7BB 5K9FA 1BIZA 4ZLJA 3UIQA 1RU1A 4JI0K 5KFRA 3POTA 4B3OB 4TXSA 1EWRA 3D1QA 5E84A 4FYWB 1ZAWA 4CNZA 4EWTA 3OYAA 2IPOB 3MK6A 2W9CB 1S1XA 2GO9A 4Q8FA 1KS2A 1KQKA 3T6JA 3VGLA 1F5CA 2P9CA 3TUPA 2IA0A 1JXLA 1WF0A 2RUGA 5AQTA 3O80A 4XAKA 2WONB 3DLLQ 2EW9A 3M7VA 1F3VA 2P9SB 2ZWOA 3HHLB 2HQDA 1R27B 2DXFA 2QL7B 4NYOA 4HCBA 4KH0B 4JN4A 2W2OP 1HQEA 2A6AA 3WXJA 4E7JA 4PR6A 4ZVHA 5ETTA 4OYZA 1UETA 1S1WB 3BZCA 3VQSA 2P9GA 2XMUA 3AVJA 4GNIA 3GU0A 1E6VA 3MPWA 4LMZA 4UOHA 3GFHA 3GE9A 4KHPK 2Z2ZA 2XHWA 3CFOA 4IFVB 1U8WA 2YPYA 1RHUB 3QESA 4Z7YA 4FXWA 4F4ZA 1X0FA 3AVGA 1JXBA 3FZ2A 2A2CA 2HYIB 4E3SA 4JV0A 3BQ1A 4EP5A 1HI1A 1RSCA 2EK6A 1X4DA 2N82B 4Z0UA 1BQMB 5AE1A 2CPIA 3TSQA 2Q1LA 2CNKB 5B0AA 4BC7A 3LALA 1TAUA 2I0XA 5TKWA 4OHZA 2D69A 5HMZA 3E66A 1FKOA 3SCKE 2GX9A 3P45B 2JX2A 3MHYA 5KGWA 5B7WA 1ZA2B 2ZDPA 1KP6A 3G6VA 2H5EA 1WWHA 2W2NP 3H5YA 4BE1A 5F3TA 1KSPA 3MWPA 2DPIA 1YTAA 4EUVA 1H74A 4ED4A 2YCHA 3BKFA 4UUWA 1YTUA 2OFGX 1JLEB 4USHA 4P52A 4ED8A 3I5AA 4DV0F 5SZTA 3PUFA 4FBTA 4M5HA 4G6VB 5HMYA 3KG0A 3WIUA 1KWMA 2K06A 1N88A 1S12A 2JFDA 3FMBA 3I8BA 3BSCA 3QPIA 4Y2CA 2W7AA 3J7ZO 4LSNA 4WXWA 1Y7PA 2H4WB 1SQGA 5DETA 4K4WA 4DV5J 2F7TA 2GQQA 4BC5A 4LQ3A 4CE9A 1SV5A 4UOFA 5M2RA 5IV4A 4RR5A 3QGIA 3PACA 3BF1A 2BX6A 2ASLA 5HVGA 2W25A 1SC6A 2XWYA 4LT6A 4AQYF 4HTJA 1RCXB 3GG4A 2HG4A 3VAHA 1TKTA 2QXLA 1VBXA 1X7VA 5E41A 1WC3A 3CJ2A 2NYIA 1YDLA 2BE2A 2VF3A 3SSSA 4FWRA 3VQDA 4F9OA 2A1BA 4WFAL 4ED7A 2D41A 3MUTP 4KBIA 4NI2A 3C66A 2HNZA 3ZTPA 3RTVA 4IH6A 1BU6O 2MKHA 1NUEA 4JV2A 2HAFA 2FBYA 1NH8A 3J7A1 3K0SA 1SVDA 3PYEA 2M52A 2RDIA 3HULA 4PKHA 3MEGA 4WP3A 1SC3B 4AM6A 1CLQA 2AJ0A 2UXBK 4O4RA 3LWMA 4YDUC 5K8PA 3GTYX 4K4YA 4UQTA 4QR1A 1CS4B 5HJYA 3M1VA 3JS6A 2DGQA 4GVLA 4BREA 1D4XA 3TUIC 4OJGA 5HO4A 3N0VA 2C22A 1IBMF 4ZLLA 3NE6A 3FBBA 5J1EB 4CZIA 2JH3A 5I3PA 4RBVA 4OZ2A 3D0GE 4Q0BB 4CYUA 2CWKA 2DRDA 4Q7AA 5H1SQ 3CCMN 5M1KA 4CLKA 1BXNA 4LF9F 4GO7X 3S41A 3O4WA 3QFUA 2VD3A 4L3NA 4BE0A 3O9RA 3ELHA 1P27B 1NDKA 1GLDG 2Z0GA 1G2EA 4NLDA 2HEKA 4PY5A 5KT7A 3JSRA 1Z2ZA 4UOCA 2LMIA 1ZA1B 2OSQA 3OBIA 3M6GA 3G82A 1VQKS 3ZSWA 1OQ3A 1VR6A 1RU2A 1SS6A 4AE5A 4XK8C 3MR6A 1N6QB 2G8FA 1FFWB 3CJTA 4DTXA 1S6PA 1WI8A 3NGTA 3SCIE 4AL7A 4MYUA 3VGTA 3SQ2A 1V5VA 5HP1A 4FS1A 5I3QA 3VAFA 3KLHB 3L6QA 3D54A 2DK2A 3PW7A 4C23A 4Q45A 1IKYA 3CO0P 2IC3A 3EDRB 1XNRF 4LD0A 1I5OB 2WSCC 4GVBB 4BRFA 4X62J 5KG2A 1KRPA 3VA0A 2BXJA 4TYAA 5A2QO 1HHSA 1RWKB 2KT3A 5HOOA 3LP2A 4FZVA 2AA4A 4RU2A 4RW4B 5D6GA 4NRUA 4TKTA 4FYDA 2DR9A 3MWTA 4DPOA 3EVOA 3VEVA 4FSVA 3D5MA 4JI0F 2AJ1A 4CO2A 2W2PP 2FJXA 4DOZA 1HYSA 2YWHA 2E9ZA 3MMCB 3L9ZA 5CXTA 2QWPA 1RBAA 1CZ9A 4MIWA 1IVZA 3TTFA 3OS0A 3MAQA 4B9MA 4DCHA 2QYCA 3Q8VA 1U1LA 3SJJA 3AXKA 4RNFA 2P9SA 2VA2A 4RNNA 5L9XA 4J91A 1YBTA 1OH5A 2RE1A 2QTWA 4CGIA 4CGDA 3SUQA 4FJKA 1W26A 2DIVA 1NGFA 2O8FA 1VJQA 4QR2A 4NXNJ 3ZTQA 2Q43A 2XYPB 1S9GA 2Q3SA 1NSPA 4RNMA 2K1RB 4DX7A 3VEYA 4CJTA 1X31C 3U6FA 4CF0A 4HUFA 4CFAA 4UZCA 4B8AB 3PIOQ 5AQNA 5C24A 4K4SA 4PKGA 1WEZA 4CCHA 3O1WA 4EBDA 2KFZA 5CD4H 5EWGA 1Q8IA 4Q43A 4FK0A 1A5XA 4CFBA 2VG5B 3EICA 2WAQD 4IWVA 4B3SJ 3QLHA 3VA3A 2Q6BA 4GRSA 4CF8A 1FT8A 1CJVB 4RUHA 2NUBA 1DT9A 1BL3A 3ZX2A 4NYZA 4QIFA 4H0TB 1VQMS 1D9AA 2ZE2A 2O8BB 1RI7A 2EXUA 3MPDA 1TL1A 4R0JA 2VQFF 3UKUA 1HFEL 1CJUB 2YV0X 5KFGA 4E1NA 4YY3K 5KAKA 1RJJA 2C3PA 3CCSS 1X4HA 3PJXA 4CFDA 2POKA 2HNYA 3Q22A 4ZVPB 3JS9A 4HI2A 3L2RA 1S6UA 2RRNA 3VGUA 2ZHBA 3R3LA 4RW4A 3SQGA 2RSQA 3UQSA 1FRMA 2WTUA 4E7IA 1YTYA 1WSJA 3E01A 2JNJA 1UJ5A 2H5JB 3FRYA 3TZWA 3IR5B 1FNMA 2HHHF 5CQGA 4JK9A 4ETZA 1NZ8A 4JBCA 2CJKA 4E0DA 1YK9A 3UKRB 4GKJJ 4IQMA 3SUPA 3QRPA 4RUAA 3BN4A 4M3WA 4YOEA 2ZKUA 4BR0A 4X4QA 3AJ2A 3FQLA 3C65A 2Y3YA 1K73T 2CJ9A 4CBXA 1XQSC 1FX4A 1ITGA 2VV5A 1TKTB 2HRYA 4CLZA 1C1BA 2YKAA 1HBUA 1WBDA 3AB4B 2WUSA 3TNVA 1ASWA 3KWGA 1X60A 1W25A 3D3CJ 4ZJOA 4DS5A 4HHJA 4YFUA 1U6ZA 1C0GA 3R5JB 3QBCA 4O4GB 1O0PA 3KLEA 1S48A 3P8BB 2YNFA 3QATA 4CHNA 3CJ0A 1WKJA 4NZ6A 1YJTA 4NLSA 3EX7B 2DHAA 1WB9A 1EKEA 4IG0A 3CFPA 1HBMB 4MK8A 1QQMA 5A8WB 2WHOA 1LCUA 3QETA 3K9JA 3M9NB 4X4SA 4X4TA 1XN9A 3I56N 1VQPN 4ATNA 2NREA 2H5IB 1OVQA 3S9HA 5BJRA 3GFXA 4ECUA 1WC1A 4J9NA 3DXMA 4CJ7A 3OS2A 2UXCK 1LOTB 4X64F 2ZH8A 4LFCK 3PYDA 4LRFA 2P51A 1JLBA 2YHBA 1NPPA 4DQQA 4BG8A 1T3OA 4CGHA 4KY3A 2VFVA 3G86A 1WBBA 4USKA 4NO7A 3AY9A 2CQIA 2EC2A 1XNQK 1NGHA 3ILIA 3ZZTA 3K5PA 2N3LA 2IJNA 2ZC4A 3L7OA 2D1KA 2XY6A 1YHQN 4NMXA 3KK3B 3P5TL 1FXLA 2FVCA 3CNQP 4ILMA 5GAGU 3C46A 1M0SA 1XBWA 1HLUA 5AQMA 1K6YA 1LW2A 3CCLS 3B78A 3ILLA 2HHHJ 1HNXJ 4X62F 3HZGA 1JLQA 2J9DA 3HBTA 2G8KA 1X0PA 3GJSB 1UMJA 2HOEA 4CNYA 4G1QA 1B0TA 1RDDA 1N36J 3JSMB 1LWXA 3IR7B 1YKWA 3DLGA 2R3VA 4DR6F 2UXDF 3VTHA 1F5BA 3S3OA 3MOZA 4DFKA 2X74A 4KHQA 2IM2A 3A3NB 4JB8B 3NH2A 2F8HA 4RNHA 1JKHB 2RRBA 4ES1A 3BKUA 4C3LA 5HSPA 1XMOJ 1JCEA 4WQ5C 4NL5A 3BREA 3HKZD 2IDOA 1XR6A 4GC7A 1NPRA 4JI8F 2HSEB 2PA3A 3ENAA 3BBCA 4ED6A 2AGPA 3KMSA 5THWA 1LEOA 1NKBA 1S72S 1FCAA 4IKAA 4GKKF 5F8NA 1HW8A 4NLCA 3CC7N 1MN7A 1IBMK 3OS1A 2D3O1 5I3UB 5GAEU 4FF3A 2UU9F 2DD8S 4HACA 4MKYA 2WB1D 4M3YA 1FDAA 2AJ4A 3P31A 5KOXA 4K43A 1NSAA 4CO3A 2QSWA 4E1MA 1UWBB 1PAEX 5AQLA 5EY4A 2KB2A 3JYTB 3SAHA 3GB0A 1Q9XA 1BQNB 2XCAA 1P9QC 1LAWA 3EZWA 2W01A 2EKNA 2E2QA 4KV8A 1SAZA 3W64A 1T95A 1RWMB 2UVRA 2ADBA 1B9DA 4OLOA 3OTOK 3BO3A 1PYTA 1WSVA 4UT4A 4ZN3A 5GAHI 1HUXA 2RKIA 3K7RA 5BR8K 3O9TA 3OUYB 1ZM3A 4DV7F 3DLLL 3GYGA 3PNIA 2WOMA 1B4SA 2YX1A 3G6XA 2VPWB 1NDPA 4WIIA 4CYUB 4CZMA 2DFFA 5KFBA 2P9UA 3HPOA 3PX0A 2Z2LA 2UVVA 3EE9A 1TFWA 3IC1A 2Y1LB 3M1FA 3DHWC 1NZAA 1JLFB 2W2QP 3ZSYA 4G3IA 3KDOA 1BG3A 4HTIA 1VSJA 4IDKA 1FKPB 5KFSA 3RAXA 3BDEA 2YBVA 4XDCA 3OLBA 2ATQA 4NXMJ 1XMQK 4QIGA 2ACMA 2FF3B 3BR8A 3NH1A 2R7OA 1VQOS 3A4TA 2JWKA 2IHR1 3T69A 2G8UA 3JXUA 1SQEA 3GJQB 3CCSN 1BCOA 4CO5A 2XHBA 2WZ1A 3IRWP 3DOMB 2OYQA 1ZBHA 4EFAC 1WN7A 3NGSA 2W7OA 4ZIVA 4AFFA 3R6MA 4Z4IA 5JMVA 2HQFA 2IY5B 4H03B 2BUPA 2HF3A 1MWQA 3C6AA 2KVQE 1XIQA 1FNXH 3IKMA 1SPBP 5F8IA 3DRPB 3QERA 1HA1A 5EX3A 3EJMA 2BMBA 2Q66A 4Y6IA 4W98A 4B02A 1S10A 1FJ7A 1SKUB 3EWGA 1T9WA 4K2JA 2P9PA 2QKBA 1GMUA 4ECRA 4JI5J 3C7NA 4X4OA 2AX0A 4JI6K 2A1SA 3DCAA 1F9FA 1G7CB 2KVIA 5LOQA 1BQXA 1RXOB 4FWNA 3N4PA 2V2KA 3U1MA 2HS0A 3B4DA 3I0SB 4ECZA 5C0YA 4BY9C 1V6HA 3KK2A 4AILC 3KKRA 1MNEA 3PJWA 4DZ6A 1NJIO 2AMCB 2W4DA 3PM9A 2FBVA 5EOYA 2A5XA 1JJHA 1RZMA 2X3DA 1NGIA 2ZH2A 3D28A 1DY3A 4KTZA 2YXLA 2BM1A 4AHSA 3E9OA 4WFNL 5I42B 3ENHA 3DOLB 1SB6A 1KNZA 3HHLC 1UJ4A 1I6JA 4WFAQ 1S6QB 4CLWA 4CT8A 4IO1A 3R7NB 1P90A 1VQ7S 3SSQA 1T44A 5LJ3Y 1HQUA 5A6PA 1BI4B 3FC9A 2JEJA 4OI0A 2HHSA 4O3QA 3TVYA 3CC7S 2K7KA 3T1YK 1GX5A 2ZWPA 1VC0A 4ZVUB 4CI0B 3MM7A 3CD6N 3R1HA 4DTUA 3H4DA 1GLBG 4MO4A 4O44B 4ZCLA 2DNKA 2EWSA 2G2YA 3NHGA 2KN4A 2CGJA 4E19A 5C25A 4J9KA 4KO0A 3CD0A 1AFJA 3ULHA 3KK1A 4J2BA 3NDKA 3E2EA 1S1UB 1Q7YO 2HIYA 4IFYB 4NI2B 5AQXA 2MQNA 4DV2F 1GMWA 4OZ5A 2E7VA 1C4AA 5IWAF 2IVOA 2H3EB 3RMBA 5IC6B 3OBYA 1JJ2R 4O8KA 5BRFA 3CB4A 4LF7F 2JWNA 4MDAA 1IBLJ 3KK2B 4YOWA 1Q53A 1F1BB 2ZD1A 2DNHA 4ZHRB 1FRLA 3DRSA 2M7SA 2NYHA 3HHDA 1CULA 5I4MA 4USTA 3FZHA 3HTVA 4FPBA 5KG3A 3G96A 5LJWA 4FF2A 3PYGA 3VAGA 5FPNA 1TK0A 3RGIA 3TSPA 5KT4A 2ETJA 2XY5A 3PRBA 4UY8O 4O3OA 1RISA 2M9KA 3CJKB 2G0JA 4CT9A 4FVUA 1HR0F 5DMRA 2Y8WA 2M4MA 2WFBA 2ZM6J 2C2ZB 2GNKA 3FZFA 1YUWA 4WP9A 2M5YA 2ZH5A 4TN2A 3IWXA 3V6JA 1I51B 2KRRA 1S99A 3BGUA 2JSXA 1IM4A 3TAPA 4DR1J 3CHWA 4A8FA 1IH7A 4F8RA 3MAAB 1Z05A 2MY7A 4CZGA 1OVYA 4I6MA 1P6TA 3C6UB 2P5VA 2MZJA 4Z4CA 5C25B 4GVMA 2IDLA 3IM8A 1RCOB 3DWLA 3DU6A 4CK2A 4JEPA 3V4IB 1KTQA 3WXMB 3BGRA 3DAWA 3OBWA 1UAWA 4CERA 2VASA 3M8ZA 1QVGM 1VC6A 3M6UA 5FRMA 4ZP6A 4AD6A 2NXEA 3G71S 4FWMA 2GHWA 2IVMA 1R8PA 3DMJB 4J5OA 1FRXA 1YJ9N 3QRRA 3ATVA 2QA4S 2CJAA 3CIZA 5BREA 2RHKA 5E3AA 3W63A 3CDBA 3CF5L 1GMVA 2DISA 3QJLA 3FEZA 2CVEA 4FVMA 1K0VA 1JQGA 3IO1A 4OPHA 4FZXC 1UVJA 4OLPA 2IVFB 4DL4A 4H4OB 3CGIA 4B3MF 3MOJB 3VF4A 1S1VB 3IBFB 1RDWX 2OZMA 3AQOA 4QYRA 4OZ0A 4ELUA 1HRHA 3N6MA 2V50A 3WEEA 2UP1A 1XHZA 3G6YA 1YJ9S 2L08A 4P72A 4BG9A 3MXIA 5L8RC 1Q81O 2OIHA 4FZZA 2QN6B 4EI2A 3ZETB 3GQCA 4UOGA 2HHUA 4X84A 2FLNA 2QXFA 4ED3A 2COLA 4BE2A 3GIMA 3QBXA 2XS7A 2VFRA 1N34K 4HUGA 2WC9A 4NLVA 1VSLA 3UE5A 4N77A 3T5HA 3QIDA 4CZEA 3T5JA 1RUSA 1SL2A 2HFSA 4IO8A 2W4PA 3BYRA 3GIJA 3PO4A 2IRUA 4BACA 5J2QA 2LFVA 3MM8A 1DURA 2C3UA 3TA2A 5LMNK 1RBLA 1WOQA 4DSKA 4NXNK 2CZ9A 1S3XA 1LK5A 1PILA 1TUYA 3K89A 3BDPA 2HB5A 4U7UD 3M2RB 2UXCF 1G3OA 2AWZA 3K5MA 1H98A 1ZS6A 1NMEB 1CJKB 5GIPA 3MDFA 5JS1A 1H7WA 2GQ2A 1M90O 1NLVA 1Q9YA 2R7TA 2CQBA 2E1ZA 2CRLA 4PXEA 2OAUA 5AQFA 4ZOSA 5LMNJ 4PPDA 1C0TA 1PG5B 4HACB 4PRFA 2GV1A 5KFHA 1RWPB 1Z4UA 3B54A 3CMES 4NLOA 2Y0BB 2VICA 4CH1A 1Q7LB 4H0OA 3R7SB 4DTJA 3AVKA 2OD4A 3H46O 1J53A 2CG8A 2P9EA 4X4RA 3NVKA 2Z8QA 3E9PA 1HLWA 2MKCA 2KXNB 4FVCA 2O1PA 2YQ1A 4K4XA 4EBEA 1MU2B 3KUHA 4R8UA 3M9OB 2HZAA 2W1BA 2XZWA 3BJYA 5HQ8A 1ZBFA 4FKXA 3KD1E 2HWHA 4X4UA 3OL6A 3UKRA 4W5QA 2CQ2A 2NZTA 1GT8A 2V7ZA 2Q0UA 3U02A 1VBKA 2RQ4A 2QZ8A 1WEXA 3O2IA 2FB0A 2YVSA 1EO1A 5JVHQ 2HBJA 3CUNA 4FN5A 3HSJA 5ETNA 1Q78A 5AZIA 1BQNA 1GQEA 2ZBRA 1XK8A 4O3PA 4EP4A 3VGVA 3K9KA 3W2VB 4RJVA 3B6OA 4ZCIA 3GCXP 4A62A 1JLGA 3UCZP 1TELA 3PRDA 1NEEA 3SBTA 1WOSA 2SXLA 1AFIA 1NK9A 2DH9A 3CCRS 4DX6A 2I6WA 1N5YB 3PW0A 2KHOA 3TX0A 2RD5C 1YJRA 1WSFA 4DPTA 2CZVC 4K4TA 1H1VA 2WW8A 1CQNA 1LWCA 4X65F 1S57A 4RW6B 1PJ5A 1BDGA 5L46A 3TAGA 2GIQA 1D8YA 5AQUA 3R7BB 2RNEA 3OFEA 2FVPA 3G8SA 4S0MA 3O4NA 3TJ9A 3OUYA 5M1FA 3VAIA 4FS2A 3DLHA 3FUYA 1X9MA 1EQ0A 4M63C 1ZZFA 1KVKA 1JXVA 3RG6A 3KHHA 2M8HA 4WQ5A 4OHXA 4OPKA 2ZWHA 3T9ZA 4DFMA 4LFCF 4X64K 4ANDA 4WWSA 3I55N 1BA1A 4NEYA 1WJ9A 2E44A 3UCGA 1U2CA 1VQLS 2GJIA 1MROA 4M5DA 4WFZA 3DLRA 3S3NA 2YWEA 4CGJA 2AP6A 5IZHA 1RQ0A 2XEXA 1NJWA 3NMUA 3NF7A 2CQDA 3Q23A 4PYAA 1E4FT 5F0XA 3I96A 2YNHB 3IG1A 2L41A 4DG1B 2E1YA 5JUMA 2X1AA 3H25A 2DY1A 1WG5A 5KFUA 2ZJRQ 2V94A 1VRUA 1N4LA 4OJRA 1R6YA 3R6GB 4DPWA 4YORA 3FDSA 4EEYA 4JV1A 1SXLA 4C8OA 3UCUP 3DRRA 5HATA 3HVAA 4H54A 1MMDA 1IQTA 1JNRB 2ALYB 3D2WA 3HM9A 1LW2B 4I9QA 5A8KA 3NS6A 4Z94A 4ECTA 5HBMB 1RHJB 4BDYA 3VZIA 3QT7A 1RKIA 2EFVA 2MDAA 1PJ6A 3NRBA 4R25A 3CJQA 2HNZB 5AZJB 2ZNYA 4M94A 1JK9B 3TVZA 3IWNC 4K5RA 1RDRA 4FJXA 3CM6A 3W9IA 4FWLA 3OQ2A 2X6SA 4G1PA 1REVB 2J9EA 5HQMA 4DR3J 1U7LA 1H2UX 2AYMA 3QZ8A 3J7ZT 2YH0A 2QYGA 1R8HA 1J6ZA 4B3TF 3BBBA 2KI2A 2Z58B 3FEXB 1XQIA 5CCMA 2LXUA 5GMDA 4W92B 1WNSA 3K8VA 4W5TA 1RWUA 3RAQA 3QB0A 3QNNA 3N6NA 4C48A 4EAHD 4IZ9A 1ZPVA 2VGNA 4G1IA 4ZPAA 4HEA9 4RO0A 3TQEA 5HMXA 3QSYB 2DITA 4OYMA 4L8RB 5IC4B 3DHXA 5IM0B 1AROP 3WT0A 1JL1A 3ENVA 1YQHA 2B5JB 4CI6A 2H9ZA 1KAXA 3OYFA 3PVXA 4FNIA 3LDPA 2PIIA 1U1NA 4JV5J 1SIWB 4LRAA 4A8YA 1W2BR 2AZ3A 1GXUA 1X4GA 3GV5B 1FKAF 3EM1A 5BN9A 2P2CB 1JL2A 3NMAA 2O4GA 2VYPA 4F0HA 3C14A 3GV7B 3EZUA 1DLOB 1S0MA 4DEZA 4J9SA 3EXYA 3QQCD 4FNHA 4KO0B 3VERA 2WBNA 1FEHA 1WEYA 4ECSA 3D45A 3ZZRA 4DSIA 4G9ZA 2J0QD 3MEEA 4CHQA 4YB6A 4ZJQA 4F0KA 1VHFA 1U1QA 1KAZA 1JMTA 4JI1F 3BO2A 1HKAA 2WW4A 3MFHA 1HNXF 1VIXA 1HMVB 1RT6B 1NBEB 4WFBL 1MWMA 4V19X 2KJVA 2WK4A 1IR1A 4A5AA 3L4BC 4N76A 1PJ7A 4LF5J 1IKWB 1X4FA 3PCOB 2CNNB 2H54B 1SH2A 1NGBA 4CZLA 4EYIB 4ID5B 1CEZA 4X66K 2P5GA 2V0NA 1K73O 4LF4K 4EK2A 4DR4J 1KTVA 4RPFA 2BE9B 2IA6A 1JLBB 4O23A 5HAOA 3CCJS 3QDKA 4CK3A 4YR0A 4CZFA 4B3MJ 1OYEA 3C16B 4GKKJ 4CVNE 1ZBIA 4AHCA 3DXSX 2VC0A 2HBQB 2MZRA 1NCLA 3U9ZA 4DR5K 1N52B 2GUIA 1EZZB 3H59A 3WUHA 4A8MP 2NXCA 3DRYA 3CCUN 5DDRC 4PG7A 2ASJA 4DS4A 1VQ8S 3KJQB 2JJ4D 2V4JB 5DK5A 4WK3A 3ET6A 4W5RA 5BPMA 5A8RA 1ZOTA 2W9AA 1ZTTA 1S1TA 2FGCA 5LXRA 3OY9A 4I6MB 5EDWA 3P5JA 2ZE2B 1FTCA 1H7XA 2KDOA 4ES3A 3X1LB 1J27A 2Y9HA 4AQYJ 2DHHA 5CCLA 2GVDB 3CCMS 3S3MA 1YJNS 3VPZA 1U49A 5F8JA 5KPTA 3M4XA 5C5JA 3K5LA 3ZT2A 1E6YA 4FLXA 1QJHA 4CJKA 5CH7B 5C42A 3ZT3A 4BRKA 1IV0A 4LREA 5CHIA 4PEOA 3POTB 2CGLA 3NY0A 1L3SA 3E01B 4C11A 4F26A 1J5EK 4HDGA 1TYQA 3FNNA 3NAIA 1U48A 3OYNA 2D0BA 3LM9A 4DTRA 1AA1B 2K2PA 5DM6Q 1YAGA 2IGIA 2J6SA 2CGKA 4H5VA 2AZ1A 4FO0A 2MQPA 3RRGA 3ISNC 3CD5A 2ACYA 2M8DB 3T5KA 2UUAF 4P2FA 3MEDB 2MLZA 4XO0A 4OX9F 2Z30B 2MKYA 1WI6A 3LGNA 2QX0A 3M2RA 4EIAA 1X8DA 2J4RA 3MM6A 4USJC 1XNRJ 4ZJLA 1OS5A 4QOZB 2V4RA 5CZ2A 2VPXB 3FLCO 5AFUH 3L2WA 1MMLA 1FRKA 3DGVA 5HBMA 3JQMA 4IOAQ 3KMQA 5DM6L 2KU7A 4CBUA 2RKIB 2FJDB 3OPKA 3SQ0A 4FYYB 3CXCM 2ZUAA 1N33J 1A5VA 2YWFA 4JI7J 2UVUA 2B9YA 1NOYA 5IQ6A 3UR3C 1J9AA 2OPPB 3OTOF 3FBFA 2K8GA 3FFIB 1M5SA 2F9TA 3NBPB 2XMMA 3JSYA 5KFYA 3PHEA 4AXIA 4OV1A 3IA0A 4L72B 2MQOA 3QINA 4C0OC 1BOTO 3MEKA 2NPFA 1SH0A 4JK8A 2WOMB 4AUKA 5HL7L 1DGKN 2C2DA 1WHXA 1RTDA 4FJ8A 2V9WA 2A2DA 1FVSA 3NFAA 1NU0A 2ZHAA 4DSLA 4CGGA 1KDNA 4C8MA 3T6BA 2ZJPQ 1VSDA 1FWLA 5H1SV 4OQJA 3WXLA 4DU8A 3ITHA 3GCWP 2DNPA 2KFNA 4H4KA 3OHBA 4I67A 1HNVA 5AQKA 3EGNA 2AJFE 3M3ZA 3MCOA 3ATUA 2JHEA 5KFIA 1KVAA 2P9IA 5JS2A 3DXBA 2ZGZA 3N5FA 1RT3A 1IKXA 2I5JB 1GH8A 5GVQA 1HPMA 3EPGA 4B3SF 4NCGB 4LFBJ 2DJWA 1S4EA 1KOHA 4NLTA 1FO1A 1CXUA 2XO7A 3HVTB 5IWAK 1RBSA 1XHXA 3V5RA 1NWKA 3ZZ0A 4YOXA 2ZQBA 5G0RB 3U3GA 2LDYA 1HNIB 4QCLA 1N32F 3CCQS 1IQZA 1U2VA 2B4UA 2BTFA 1HMVA 3MM6B 1YJNN 2XYGB 1N5YA 3DC2A 1A5WA 3A8KA 2VJUA 1FFSB 1YF5L 4JI4J 1XUPO 4DU1A 2F4VK 2RPIA 2HNYB 1RAJA 2PI4A 5HRNA 2U2FA 2BJDA 4O8UA 4JV5K 1VQ7N 4IG3A 2A40A 4FLYA 5C2GA 4QPTA 1YBUA 4A8OA 2HNDA 3LTOA 1KKHA 4C4WA 1TR0A 2FLLA 2LYVA 3SCLE 1Y97A 3WNFA 2DGWA 1PC4A 3GPAA 3CJRA 4NLRA 2EFQA 2NXUA 2KJWA 2QRRA 3OL8A 2OZSA 2MSTA 3EVWA 2HKEA 3DDIA 3MR5A 1VSIA 3ZSRA 2A41A 4O3SA 1NGAA 4DR1K 3W9HA 2VQEJ 7FD1A 1Q86T 1WAFA 3GFZA 3CCES 1TGOA 3RBZA 3LAKA 2FVRA 1DHMA 4F04B 4KC5A 4LRCA 3B8HA 2M2BA 2WSFC 4JI4K 2AHOB 1PC5A 2G9OA 3U27A 3TP2A 2D0OA 3MM8B 3RSEB 3D2FA 4CHZA 4YOVA 1S5JA 1TP7A 2QT7A 2R2TA 5CZ1A 5SUHA 3M8PA 3EVMA 5KFAA 3MX2A 2BJ1A 4CHYA 3HHNB 1D9FA 1H72C 5KRSA 1FE0A 3KJFB 3HJFA 2DB1A 3SI8A 3M5RA 2VPZB 4OKEA 1BIUA 2XCPA 4YR2A 2KZZA 2Y1JA 4J2EA 3W60A 4JKEA 3H1VX 3B4MA 1N6QA 2G0CA 4YDXA 4KH4A 4ZDNA 3GV8B 1YI2S 2HW3A 2IYIA 1CJTB 1TL3A 4IFYA 3H3OB 1VYAA 1QUPA 1XMQJ 4NXMK 3V1RA 2L9NA 2Q31A 2KT5A 4C8NA 1FERA 3S7RA 1NB7A 3AAWB 4ZTJA 2LQBA 5A8KB 3THYB 2JLFA 1OYDA 4DL3A 2PEHA 4DSJA 4KTWA 2IBKA 3E9LA 5C10A 5AZJA 5K20B 5D3GB 3I8DA 1GTHA 2KH9A 4KRWA 2MQLA 1B0VA 2MQQA 3PG9A 2D4WA 1X5OA 4EZ6A 4PXDA 3L3CA 4ANEA 3L4QA 2DFEA 4I7FB 3J81O 4KSEB 1KLMA 2WCXA 1OSDA 1TVRB 2ZJQL 2EEYA 3PTWA 4PG8A 1KOOA 2CDRB 1HJRA 4WFBQ 2FD2A 4I6WA 2QL5B 1FJGK 3D68A 2OP5A 3BPDA 4DR4F 2CDQA 2VZ9A 4K25A 3P4IA 1SKWA 3CM5A 2YWWA 3NS7B 1T9YA 3OYCA 1B70B 2Z1HA 3OVNA 3MAAA 2CXEA 3WZ0A 2VBYA 4U96A 4ZPTR 3C6UA 3MXHP 3NVMA 3QT6A 3OYHA 3NL0A 1RT6A 3HYFA 2DH8A 1VQSA 2HS3A 1YWXA 1A0OB 2C42A 2XY7A 4JLHA 4P9SA 3RSEA 4LF6K 4JI8J 2E66A 3CCTA 3G71N 2FBXA 1VQ9S 8AT1B 4ZLNA 2JC1A 2BW7A 2G2OA 1TFYA 4JI3F 1Q8KA 1N8RO 1T11A 4H4OA 1Y5LB 2V67A 3THTA 2HLUA 4O0JA 2E7WA 1TL1B 3EZ5A 2N3OA 3H90A 4A46A 1R8AA 4B3RK 3FMWA 3UD4P 4IYQA 1K44A 1VQLN 2E5LF 4ZITA 2F8SA 1C6VA 4CF1A 3U1NA 1K0TA 3H20A 2DCUB 3OTBA 1CXQA 2QG9B 4J90A 1WELA 1U26A 3HSTB 5LSRA 5EX0A 3MFIA 4J9VA 1K8KA 4CO4A 1V5IB 4KB0A 1NHVA 3RAMA 1S9EB 3VVTA 2VWBA 4FCYA 4CJPA 3L0QA 4CF9A 1S77D 4X2BA 4EMDA 4Z4FA 2FPHX 4JI8K 1ASVA 1ULRA 3OFGA 3ADAC 4DHVA 1S79A 1VIOA 5IS2A 2NPIA 3IP0A 2ZZMA 3AAQA 1S6PB 3DGPA 4C8YA 4I2PB 3QFWA 2RMLA 2Q36A 5DQIA 4ECYA 2GZOA 3HDSA 5B0DA 4DQSA 3MMVA 2W9BB 1C1AA 5B0EA 1HYZA 4JNEA 1T9VA 4PG6A 1MG7A 1VI7A 4YQWA 3FE1A 6FD1A 5HRPA 3LPEA 1X4EA 2BQ3A 2A3JA 4BVPA 3KLGA 1VMBA 4ED2A 3TAMA 2I8EA 5LL6d 2DFHA 3D0PA 1C1BB 4JOUA 2I7NA 3QIOA 2UUBJ 1RBTA 2V4JA 1UFWA 2FGOA 1XNQJ 2N4DA 4RTFD 2KXFA 2OPQB 4TSXA 4NLGA 4IH5A 1RT4B 2HRTA 1YXQA 1MWKA 2AJ2A 2PDAA 3IMQJ 1CZBA 2BOPA 1WC0A 2ASPA 1J5OA 1TUUA 4J8FA 1LWEB 3FZMA 2AT1B 1C0TB 1PAUB 1K9MT 2BA9A 5B0FA 3CPEA 2D0CA 3SUOA 2YQ3A 3FJ2A 3OTOJ 1MSWD 4RUCA 2UYTA 2RU9A 4CEDA 2B4JA 1VRQC 1R31A 4OYAA 5B0BA 5BRDA 4Z4HA 3AOCA 2H3GX 4FL9A 5FJ4A 1HR0K 2NZCA 4B3RF 3WBZA 3AVIA 1WC5A 5KFLA 2L48A 3SV3A 5ITHA 1O5JA 3EL2A 4B1UB 1REGX 1E4GT 2E5LK 1NJYA 2Z57B 2QSFA 3HOTA 3N5BA 1P1TA 3I4PA 5JVGL 4WCEL 3C6HA 1K8AT 3D1OA 5E3CA 1OO0B 5BR9A 2GAGC 4LF9J 4U95A 3GJRB 3I31A 3R5CA 2E6MA 4P6QA 4C3MA 3D6TB 1T7PA 3F73A 3QBWA 4H4MB 4WU2A 3UDLA 1RAOA 4IRDA 5IT9Y 2PE8A 3QEIA 3R3TA 2QK9A 4A48A 4M8LA 2LCWA 3TO8A 4BQZA 3LAMA 3VQ8A 1O51A 5DQGA 5DG8A 2D3OR 2JFKA 3NNCA 3N4WA 3DOKB 1U2FA 3UD5A 4E2FB 5J2NB 3EKSA 1MN9A 3DMJA 3QGGA 4JKFA 3UD3P 4BGBA 2CKWA 3VGSA 2GBZA 3BEGB 1IJJA 2F8TA 2K3KA 4CLTA 2UUTA 3QT8A 4PZVA 1NOZA 3LDOA 2IOCA 3WX4A 2HBYB 5KT5A 3G8QA 2CNLB 3VVUA 3D2EA 4YY3J 4CJVA 2HWTA 4IEIA 4RW9A 3Q83A 2F3JA 3I32A 3MM9B 3R97A 1KHWA 2FLOA 5GAEI 1QE1A 1Q5VA 1UVIA 2A1RA 2Q3PA 1YJ7A 2W6LA 4FJ5A 4GKJF 4ICLB 3BSNA 4FXDA 1BD6A 3P49B 3QNWB 1GOAA 2QC3A 3KXDA 4A8WA 5EWFA 4ZKAA 3PLAA 3CQYA 2EK1A 3T1HF 4JRPA 1U6FA 3DI6B 1UTAA 1IG9A 2VUGA 4URQU 3DRRB 2DEIA 1QTMA 2I5JA 3CERA 3K5OA 3D6FB 2J9CA 3CD6S 3I9V9 2XO6A 2HFVA 4DV0J 4JKAA 1YJWS 4OPAA 1U09A 3GMGA 3C94A 3H6EA 4KQZA 1IJFB 3QWUA 1TKDA 4I2QA 1FDNA 2QE5A 4KGZB 3R1XA 3CQXA 4M5NA 4RCHA 3ZO7A 4WFNQ 1ZBUA 3R2CJ 1YVNA