1IKYA

Hiv-1 reverse transcriptase in complex with the inhibitor msc194
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikyA05
1LV5A 2W8KA 4GMJB 3ZSRA 3QIPA 3KLGA 2G8UA 3HHKA 3MR5A 2AX0A 4M42A 3H2LA 4E7LA 5CZ2A 4KTWA 4WZMA 3DLBA 3PR4A 3DYAB 4OGEA 2HNYA 4I7FA 2BANB 2DTUA 2WTFA 2HAIA 1NKCA 2FVSA 4EBEA 3VQ8A 3DI6B 1SV5B 1RDDA 1TK0A 5D3GB 2R2UA 2XY7A 3HXMA 1RT4B 4GC6A 3AVAA 1XR7A 4RUCA 3PW5A 3SUPA 4IG0B 5K14A 4BE1A 1B9DA 2WONA 3OJSA 3LALA 4O3QA 4FJXA 1IKVB 1S0NA 2VG6A 1JLEB 4H4MB 4KO0B 1NK5A 3BSNA 3SUNA 3L3VA 3DLGA 1VSFA 4KV8B 3QEVA 3ZSOA 1HNIB 2KZZA 3KOAA 1ZTTA 5KI6A 1MU2A 3AVKA 1Z4UA 3PHEA 2OZSA 4FS2A 4CE9A 5E41A 4WFXA 2RKIB 3QYYA 4FW1A 2KZMA 1KCFA 4ED8A 4ECUA 5KG0A 3V6DA 4J9QA 4XPEA 4DSFA 1S1TB 1RTHA 1X9MA 5HRRA 1RDBA 4E89A 1J9AA 4YR2A 5J1EA 5I42B 2FVPA 3AVFA 1S1XA 4QWAA 4FYDA 2WB4A 3O4NA 5EWEA 3V4IB 1A5VA 4Q43A 1RTDA 4DTUA 3I0RA 2QXFA 4N76A 4WXOA 3V6JA 5HLFB 4FK4A 1HNVB 4QW9A 1D5AA 4H4MA 4KO0A 4CK3A 2HNYB 3OL6A 2R8JA 4DQQA 5KT7A 2E9RX 3NGIA 3V81B 4WYWA 1YVUA 1ZBLA 1XR5A 5CYQA 3WNHA 4M94A 2JEGA 3PZPA 1J54A 4N5SA 4KKOB 4NLVA 2UUTA 1S97A 3IRXB 4ZPAA 2B6AA 4DFMA 1TKDA 3LDSA 1NK6A 4CIFA 2DPJA 1Z25A 4EZ6A 4KFBA 3K58A 4MIBA 2G8VA 1HARA 3PW7A 1WSIA 1W25A 4RW6B 2FVQA 1BIUA 2B5JB 5SWMA 1J5OB 3KK1A 3MECB 4TY9A 4J2BA 4PWDB 4DS5A 3KMSA 5J2NB 2X6NA 4E19A 4DU3A 3OVNA 4FLXA 1EP4A 4DTNA 3G6VA 4CGHA 1NK4A 5C42A 3OS0A 3SV3A 2FBTA 3PW2A 2UVWA 1RTIA 2Z1IA 4J9NA 3MXIA 1SL0A 3TR8A 4CIEA 3NMAA 2PZSA 5KG2A 4IFYA 4CEOA 4RW4B 4OGCA 3AO4A 3RMCA 2OPSA 5I42A 1RNHA 1KTQA 4J9PA 2YNHB 4G1QA 4DG1A 4J9SA 1KLNA 3CYMA 3RRHA 4F4WA 1YT3A 1JLQA 1WSEA 3KLIA 3RR8A 4FJ8A 1UWBB 5JS2A 4ZMMA 4OJRA 3KHLA 3CM5A 4IFVA 1JIHA 5J2PA 3HJFA 1XHXA 1IKWB 4NLDA 3MXMA 4LH5A 4EO6A 4IH6A 4EYHB 3ZT4A 1VSJA 1LWCA 5KFCA 4FM2A 5KFVA 2OH2A 5HROA 4DTJA 3MEDA 3SV4A 1JLBB 4WE1A 4ED7A 5KG3A 3C6UB 2ALZA 5KFAA 1TV6B 1RCHA 3ISNC 3QINA 4B9MA 3OYGA 1TL3B 2X74A 1DTTB 2AGQA 2VWKA 3GV5B 2IMWP 3HYFA 3MF5A 4F2SA 5JUMA 1EP4B 2ASJA 4OLAA 4KHNA 1VSEA 4PWDA 4CFDA 2F8EX 4DFJA 3V9SA 4ED1A 1U04A 2FLLA 3MXJA 2IAJB 1C1AA 1TL1B 4E3SA 3WNGA 3QGHA 4BE0A 4FBTA 1C0UA 3ALYA 3V9ZA 1HYSA 3KLFA 3LWLA 3H40A 2E6LA 2HVIA 1S1UA 5I3UB 4O44A 3EZUA 1C1CA 1RT3A 3PVXA 3PW4A 2HMIA 1F21A 5CZ1A 4K4WA 4WZQA 3VQ5A 4B8CA 1KLMB 4FK2A 4TYAA 4RW4A 3U3YA 1ASWA 4HHTA 3TAMA 4K4TA 5KT5A 1IKVA 3OLAA 4X2BA 1L5UA 2BQUA 1SL2A 4BDPA 3D28A 1DTTA 5DGAA 3NAIA 5KT6A 1GOBA 5FRNA 4CIGA 3K5OA 5DQGA 3NDKA 4B3OB 3T19A 3QO9B 1SKSA 3OSNA 1CLQA 4BWJA 4Z4HA 1ZETA 5C5JA 4Y3CA 3SUOA 1DLOB 3O3GA 4GW6A 2D0AA 1R0AB 2YKMA 2HHVA 2RKIA 1NK9A 3IGNA 1JLBA 1REVB 4RZRA 1BI4A 5F9LA 1HYSB 3MFHA 5L1IA 3QGIA 5DMRA 4HUFA 4JV2A 1KHWA 4FCYA 4CHQA 2HHWA 3OLBA 1QTMA 4DS4A 3FQLA 3L2WA 4HCBA 3DI6A 3FFIA 4TN2A 2PYJA 4J9KA 2WHOA 3DM2A 3M8QA 3PUFA 5KFUA 1UA0A 1TL3A 1J53A 2IDOA 4I2PB 1FKPA 4Q45A 4FJKA 3NKYA 5KFFA 4O0IA 3V1OA 5EDWA 2OPPB 1JLGA 4NLRA 2GIRA 2A1SA 2E9ZA 3RMDA 3QIPB 2B43A 3SQ4A 2IBKA 1EKEA 1HMVA 4HTUA 4DSIA 3M8SA 5C42B 3HL8A 4JRQA 3MEEA 2IM0A 1TK8A 1WAFA 1YTAA 3DRPB 1IM4A 4KKOA 4HKQA 1R0AA 4NLYA 2BANA 5SZTA 4DLEA 3OHBA 4ZHRB 4ZPBA 2YNIA 4HVJA 4CF2A 3KHGA 3CVKA 4O55A 4KSEB 5KFRA 3UDLA 4ELUA 4ZVFA 4Q8EA 4Q0BA 3DLKA 1QAJA 4W5TA 1RILA 4KREA 5KFJA 3OYCA 1S6PA 2X6SA 3RB6A 2BR0A 3B6OA 2W9CA 4KV8A 3G10A 4DEZA 4OKEA 1UOCA 4O5BA 3K5NA 2VG6B 4KAIA 1QE1A 3TAEA 1VRUB 2XGPA 2AWZA 2XC9A 5C24B 3NGZA 3GIIA 4H4OB 2AU0A 4CJEA 4RW8A 1BCOA 4WFYA 1WLJA 2GBZA 1A5WA 1IKXA 4AHCA 3IAYA 1S6QA 3ZT0A 4N41A 1X9SA 3M9NB 1HYZA 1VSLA 2JC1A 2ASDA 4B9LA 4J2AA 2DFHA 4OKJA 4ECVA 3QEXA 2YNFB 4FJ9A 1SUQB 2I5JB 4EP5A 4K4ZA 4JS5A 4B8AB 3DLGB 4F4ZA 2UUWA 4K8XA 1S4FA 3LAMA 2JEFA 4FLUA 2BDPA 4NLPA 1SH0A 1Q8IA 3FDSA 4EP4A 3SI6A 5HRSA 1KFDA 1NNDA 1T03B 4OLBA 2B5JA 1LWEB 5HLFA 1ASUA 3E51A 5DQIA 1RDRA 3DRPA 3SQ1A 2HHUA 4CJ3A 3MR3A 4E7HA 4MKAA 2IM2A 4YR0A 1RTHB 3OS1A 4FJLA 5HROB 1HRHA 3H5SA 4IKAA 2RDIA 3P1GA 2Z1GA 4F4KA 3MFIA 4CGJA 1RT1A 1ZYQA 2RF2A 2Y1JA 4DSJA 2ZKUA 1U4BA 4IDKA 2JC0A 2ETJA 2FVRA 2XGQA 1WAJA 1HNVA 3HVTB 4K4UA 1SKWA 4JLHA 1EETA 3OYNA 1IKYB 3HPOA 2BQRA 2J6SA 1BL3A 4HUGA 1QUVA 4URGA 3TWHA 3NFAA 3G0ZA 4PQUA 2G8KA 4KB1A 2XCPA 4RNNA 4IR1A 1C2PA 3KLEA 4DL4A 4ECQA 2XCAA 1IKXB 4YR3A 4CHYA 2W42A 1X1PA 4NLWA 4CHNA 5J2PB 4RW8B 1C0MA 4FZXC 4KI6A 4DL2A 2ATLA 1RBRA 3S3NA 4NCAA 3IG1B 3RB4A 3LANA 4MH8A 3RMBA 3OHAA 3KTQA 3AO5A 3DLEA 4M3YA 2I5JA 3BSCA 3EYZA 2WONB 1S1VB 4J9MA 4F4YA 3RMAA 4RNOA 2VG5A 1T94A 5KT2A 1RBSA 1QAIA 5KFDA 4FJJA 4TY8B 2RPIA 3QEWA 4FLWA 1TKTB 2XI2A 4MFBB 3KKSA 5DG9A 1IKWA 1VSDA 3VQ4A 3O3HA 1ZBFA 3CG7A 3DDKA 1TAUA 1NJXA 4IRDA 4YP3A 4IG3A 4CJPA 3UPFA 3K57A 1VSMA 1C0TA 5CYQB 3T5JA 4UQGA 1TP7A 1TL1A 4DL3A 4DTRA 3V9XA 1RT2B 1CZBA 2ZD1B 3GIKA 5JS1A 3ZSVA 1RTJB 2VA3A 4IRKA 4O44B 4RNHA 1JXBA 4C8OA 4ZPDA 2E4LA 4TSXA 3S9HA 1U49A 4KE5A 4AILC 2GIQA 4KFBB 2J6UA 2OZMA 4AHRA 2XY6A 4KHMA 3EY1A 3V6HA 3H4BA 1VRTA 3KLGB 3AVHA 3L2UA 4LY7A 3NH2A 1JLFB 1YVFA 3EPGA 3KLEB 1O1WA 5C25A 2IM3A 3MEEB 4LD0A 4ICLB 4C8NA 3Q8SB 2YHAA 1CXQA 4CK2A 3TI0A 1RYRA 4HYKA 5J1EB 4CHZA 3LP3A 5JXSA 3TAFA 4ECSA 1N48A 4ZVHA 2YKMB 3VQSA 4Z4EA 4N47A 4NLQA 2CJQA 5HBMB 1LW2B 3H5UA 2BE2B 2GV9A 3AO3A 2YHBA 2IOCA 2E6MA 4WXWA 3TQ1A 3OSPA 3I5BA 2OA8A 5F9NA 1JLCA 4CJRA 3DLEB 4TXSA 4Y1CA 4DL5A 2OPSB 4IH7A 4RNMA 1BQNB 2D7SA 4O4GA 4E7KA 2XY5A 2FBXA 2XI3A 2W9BA 3N6MA 1ZBHA 4EEYA 4B9TA 4CJFA 5FRMA 3QO9A 3ITHB 3DLRA 4R0EA 1BI4B 4JS4A 1RT3B 3CFPA 2WOMA 1XC9A 1S9GA 3KKRA 4CGIA 3TARA 2KFZA 4EBDA 1S5JA 1VK0A 2FLPA 4DWIA 1JX4A 4DTSA 1RAJA 4IOBA 2HNDA 4CJKA 1BQMB 4ECRA 2GUIA 3K2PA 3SQ2A 2R7YA 4CF0A 3AA2A 5J2QA 2XWYA 1LAWA 3V4IA 1JLEA 1NK8A 1JKHB 3VA3A 4EZ9A 1SL1A 4ECWA 4QCLA 3KLIB 5C25B 3PO4A 5KG1A 1S9EB 1JLAB 3DOKB 3C6TA 4CEDA 3AA5X 3KJVB 5KFEA 1KSPA 1UA1A 3SFUA 1LW0B 4AHVA 1KVAA 3BSOA 2NUBA 1ZBIA 3BQ0A 1S0MA 2YNGB 3OL7A 3AVMA 3LPTA 1S10A 2C28A 1YTUA 3IRXA 2BQ3A 5FROA 4KB0A 3RB0A 3PX4A 3ZT1A 3DLHA 1S1WB 4DQPA 2ATQA 1S6QB 2HNDB 4BDZA 1HQEA 5KT4A 1LWFA 4FJHA 2JEJA 4M95A 2BRKA 1IKYA 4KHWA 4EYIB 3OYMA 1BQNA 3FSIA 3BSAA 1T3NA 5F8HA 2RN2A 2AX1A 3QIOA 2V4QA 4CF1A 4CF8A 2ZE2A 4NLTA 4FM0A 5T14A 3DMJB 4R5PA 4QWCA 4H4OA 5F8NA 2CKWA 4C8KA 4DL7A 1T03A 3KJVA 3LZIA 3VQ7A 2R2TA 1W0HA 4CHOA 5KRTA 4I2QB 4FM1A 4Z0UA 2V4RA 2P5OA 3ISND 4NCGB 3JSMA 4YMEA 1QSYA 3NCIA 3H4DA 4DF4A 3BQ2A 4CEFA 3HVAA 5CYMB 3ZSXA 3V9WA 1RA6A 3RBEA 4I9QA 4NLXA 4G3IA 3ZSYA 2HHSA 2IGIA 3GQCA 2F8SA 3H98A 3KLHA 5DK5A 1T05B 4IG0A 5K14B 1NOZA 3LP0A 4AHSA 4XIUA 1U45A 3F73A 3KIOA 4K4SA 4E1NA 2WCXA 1TK5A 2IJFA 1A5XA 3KHHA 1C1CB 3NAEA 2UVVA 2PY5A 2YV0X 3N6NA 3E01A 2D3ZA 3OYEA 2JGUA 3GIMA 4NLUA 4PUOB 4Q8FA 2R2SA 3TAMB 3T5KA 1FKOB 4ZP7A 4ID5B 3RBDA 4DTMA 3HSTB 3KLVA 4NCGA 3JSMB 1N5YA 4ZVGA 4W5RA 3PY8A 4Z4GA 2D3UA 3SJJA 1WNSA 4EO8A 3D45A 2W7OA 1RYSA 2RF2B 4ZVEA 5KFPA 3PV8A 3KK3A 3L3UA 1DLOA 4PQUB 1Y97A 4RU9A 4DSKA 4URQU 2EC0A 2J6TA 2QK9A 3KMQA 3PO5A 3C94A 3PX6A 2DPIA 3HK2A 2D41A 3L8BA 1C1BA 4EBCA 3HP9A 1N4LA 1TAQA 3AO1A 5HBMA 4RW9A 4FJIA 4PUOA 2W7PA 4DQRA 2FJVA 4IDKB 2IC3A 3VQ9A 1KLMA 2HW3A 5CYMA 1JLCB 3RAQA 2Z1JA 2ZD1A 3LAKA 1DTQB 4CEEA 3OYLA 5KFLA 4F50A 5DLFA 2R8IA 3AVBA 2W9BB 4ED6A 5KFXA 3SZ2A 4IBNA 4KPYA 2P51A 4FJGA 1K1QA 4MFBA 1QSSA 1SH3A 4FBUA 3OYIA 2G8HA 3CDEA 3NH0A 4TLRA 3GV8B 4TY8A 4F3OA 3K5LA 2ZQBA 1QQCA 1LWEA 3P5JA 3LWMA 3UQSA 5J2NA 3ZCMA 3U6FA 4KHYA 4M41A 3HO1A 2WOMB 1BGXT 4ID5A 2OYQA 1B9FA 4M3WA 4KTQA 2B6AB 4Q0BB 1HQUB 5KRSA 5F8LA 4B9VA 1RBTA 1CZ9A 2QKBA 3JYTA 1HPZB 1S6PB 1D8YA 4O4RA 3VQ6A 3NBPA 4Z4IA 3FRZA 3M8RA 4RUAA 3CJ5A 1HYVA 3HKWA 4YNQA 3BR9A 2B4JA 3KHRA 1VSHA 3BQ1A 1L3VA 2OPQB 4ZP6A 3NH1A 4I2PA 5KFTA 5L1LA 4CJ4A 2IJNA 1S9FA 3OL8A 3K59A 2W9AA 5KFWA 1G15A 1FXXA 4JRPA 4LQ3A 4F4XA 2KQ2A 2KW4A 1CXUA 3WNEA 2GC8A 4Q44A 4FLZA 3QERA 5KG5A 5L9XA 3ZT2A 2HNZB 4R8UA 4M3ZA 1REVA 1RT2A 3RR7A 5DG8A 4TQSA 3FQKA 2R8GA 5KGWA 4DSEA 4FLTA 3RWUA 2FVCA 2AJQA 3BGRB 1GX6A 5EUHA 2YNFA 3F9KA 4ZP8A 2AGPA 3PJXA 1JXEA 2UVUA 4CEZA 2IC3B 2WK4A 4F2RA 4B9NA 1TKZB 4RW7A 4OPJA 4W5QA 3DM2B 3M8QB 3NF8A 4BACA 4CJTA 4WE1B 3L2QA 4XPCA 2V9WA 3OYDA 1QHTA 5KFIA 1IG9A 4B9UA 1I39A 3DOLB 2LSNA 3SCXA 4KBIA 1HQUA 1JLAA 4K8ZA 2VG7A 3GILA 4W5NA 5FDLB 4NYNA 3JYTB 1D9FA 3DRSB 4J9OA 3QZ7A 4DU1A 4K4VA 3H5YA 1KVBA 4U6PA 1BIZA 3PX0A 4WFZA 1N5YB 4H54A 4DFKA 4CF9A 1NK0A 4Y2CA 4LSNA 2W8LA 4CJLA 1TQLA 3A2FA 3GV7B 4CFAA 2ASLA 1RA7A 3UR0A 3T5LA 3KK1B 3SI8A 3AVCA 4ZTJA 1VRUA 2G8FA 1JKHA 1NJYA 4CK1A 4FJ5A 3H5XA 4FJ7A 2A1RA 2O5DA 3SQ0A 3KLFB 4LQ9A 3HP6A 2KFNA 2RDJA 3V9UA 3CM6A 1D0EA 4WYLA 3N6LA 4JUZA 1QS4A 1WSJA 4CFBA 4KHQA 4MQ3A 3VA0A 4OKKA 2DY4A 1QSLA 4QWEA 2O4IA 1RT5B 3VN5A 3MEGA 2F96A 4CJWA 2V0NA 1GX5A 4AHTA 4CESA 3M8PB 3RB3A 3ULDA 3HVTA 3M9MB 3AVJA 1J5OA 4DU4A 3RRGA 5KG4A 4CEBA 3AVNA 4DF8A 3BREA 3DOLA 5KFSA 4K50A 5DGBA 1S0OA 2OPPA 5DQHA 4J9RA 4E1MA 1JLFA 3LP1A 1KFSA 2R8KA 2ZE2B 1OS5A 2Q3SA 3Q8PB 1EXQA 2O4GA 4RNFA 2C2RA 4O3OA 4H8KA 4F8RA 3H59A 3DRSA 1WN7A 4RW9B 3VQDA 3OYJA 4CERA 3K5MA 2FLNA 3CQ8A 4BE2A 2E9TA 1NKBA 1HQEB 1LAVA 1Z26A 5KG7A 3QEPA 4CGGA 1BISA 4B9SA 3C6UA 3LP2B 4CJSA 4NLSA 4M3XA 1VRTB 3ASMA 4O3NA 2OPRB 3PR5B 4C8LA 3HVWA 3ZT3A 4FZZA 3I0RB 3HM9A 4DFPA 1RDCA 3SUQA 1UWBA 3VQCA 2IM1A 4QPXA 4LSLB 1MU2B 2R2RA 4M45A 3THVA 1RBUA 4IH5A 1U09A 4ECYA 3C6TB 3V1RA 2D0CA 1SKRA 1ASVA 3BJYA 3U3GA 1EX4A 1FK9A 4ZHRA 1LW2A 3PW0A 1C6VA 4IG3B 1C0UB 5F8MA 3MTKA 3T3FA 2BGGA 4NZ0A 1C0TB 3QZ8A 4J2DA 2D0BA 1IH7A 3CFOA 4RW7B 1S49A 4ECTA 2X78A 4CJUA 2OPQA 3LP2A 1TKXA 3CIZA 4QWBA 4QOZB 2AQ4A 3TAPA 4FS1A 3OY9A 4ID1A 3VQAA 3OJUA 1WSFA 1NKEA 5F8IA 2VA2A 4DQSA 4N56A 5DLGA 3DOKA 4OPKA 1QE1B 1TGOA 3OS2A 1X9WA 1HNIA 3NL0A 4R5PB 2VG7B 3ZSQA 3OYKA 5FDLA 4NLOA 3BGRA 1TVRB 2ILZA 4CHPA 1BQMA 1L3TA 3LZJA 2G8WA 3CJ3A 3VQPA 1C1BB 3NF9A 1N6QB 4AHUA 5KFQA 2HHTA 5D3GA 4BDYA 1LWCB 4PY5A 1U48A 3MR2A 4LSNB 4OVLA 1NK7A 1XR6A 2DFFA 3QESA 4K4XA 3QLHB 3NF6A 4IKFA 3MECA 5KFMA 3GIJA 1KVCA 3AVGA 4TQRA 4DTOA 3CWJA 3QEIA 4FLVA 4C8MA 5HP1A 5KFGA 5KFYA 2P1JA 3BDPA 2ITGA 2QV6A 1FK9B 2PYLA 5KFHA 3AO2A 4CGDA 4FZYA 1SV5A 3Q8QB 3NAHA 4IRCA 4DSLA 3DRRB 4CFCA 5KFKA 1NHVA 3TVKA 3NGYA 3VQBA 4CJVA 4FW2A 4XO0A 3QNOA 4KHRA 1RT6B 4CEAA 2IS3A 3RAXA 4I9LA 2YNIB 2BE2A 4ED2A 3I0SA 1TV6A 4YFUA 3OYHA 3O4QA 4KTZA 4ECXA 3IS9A 2FBVA 4LH4A 5KT3A 2R8HA 3CDUA 3NF7A 3IGVA 3KLHB 3DMJA 4KB7A 3QLHA 2XY8A 4W5OA 3NE6A 1S1VA 3KK3B 4DTXA 5CY4A 4ELTA 3QNNA 3QETA 1RT7B 2I1RA 2IAJA 4HUEA 4CGFA 3SNNA 5L1KA 3ITHA 1JXLA 3KNAA 3S3OA 3E01B 2BRLA 4I7FB 1CSJA 4ZTFA 1ITGA 3OL9A 5KGXA 4TYBA 3CO9A 3SFGA 2D5RA 2G8IA 3TAGA 1T7PA 2HHXA 1S1XB 4CEQA 2KTQA 1WSHA 5HRPA 1T05A 4B08A 4KI4A 2JLEA 5EWGA 3DLKB 4ZP9A 3O3FA 4ZPCA 4CECA 3HVRA 3NGDA 2YKNA 4MK8A 3M8PA 2VG5B 1LWFB 1WSGA 3TANA 1SUQA 1KRPA 3TAQA 1Q9YA 4MK9A 2W9CB 4AH9A 2ILYA 1GOCA 1VSIA 1T8EA 4L8RB 4ELVA 3GYNA 3M9OB 5HP1B 4M3TA 1S9EA 3V81A 4DMNA 2VWJA 4IQXA 1JLQB 2QKKA 3LP1B 3VQEA 4CJ5A 4FVMA 1JLGB 4M3RA 3PJWA 3G6YA 4IR9A 1RBVA 1D1UA 4M3UA 2Z1HA 3DRRA 5KG6A 1B92A 4KAZA 1I6JA 1ZBUA 1HMVB 2AGOA 4QWDA 5F8JA 4Y1DA 2JEIA 3V6DB 3D0PA 3S3MA 1NHUA 3AV9A 3FFIB 3TABA 2HWIA 3H08A 2HWHA 3MEDB 4OL8A 2P5GA 1Q9XA 3ZSWA 1U47A 3IS9B 1TKXB 1NJWA 3V1QA 3SYZA 4J2EA 2YNHA 4G1QB 3VQQA 3D5MA 1RT7A 1EETB 4MKBA 4IFVB 4Z4CA 2EX3A 4LSLA 1S48A 2UVRA 4MK7A 5F8GA 4FJMA 2QE5A 3OYBA 4JV0A 1WNEA 3KK2B 3MAQA 4YQWA 1L3SA 3AVLA 3I8DA 3OYAA 3WNFA 1GOAA 2XHBA 2WRMA 4HCCA 3EPIA 1NOYA 3SPYA 2HB5A 1S9GB 2XRIA 2DFEA 3MR6A 4Y34A 3I5AA 4IFYB 3CJ2A 1SH2A 4E7IA 1ZTWA 4NYZA 1RT5A 2YKNB 4E0DA 5KFZA 3HPGA 3HPHA 1NJZA 1HPZA 4KHUA 3IN5A 2HMIB 5J2MB 2HHQA 4MIAA 1FKPB 4O0JA 4NRTA 1MMLA 4KHSA 1RDAA 5J2QB 3CDWA 1UAXA 1BCMA 4DQIA 1VSKA 4RW6A 1RTDB 4U7CA 1XHZA 1KHVA 1JL2A 4O3RA 3SPZA 4O4GB 3ZSZA 4QW8A 4NYFA 1XWLA 4QAGA 4DLGA 4RG8A 3AA3A 5HRNA 3C95A 2C2DA 5C24A 5L1JA 4CJQA 3DYAA 1L3UA 3AVIA 1JL1A 4ED0A 1N56A 3LPUA 1S1UB 5I3UA 4NLGA 2HNZA 1TVRA 4R8UB 2HVHA 3B6PA 5KFOA 2EHGA 3UIQA 3V6KA 4KRFA 4DTPA 3Q8RB 1HJRA 1FKOA 3IG1A 3AA4A 2F8TA 3G86A 4NRUA 3EZ5A 4GC7A 1RTJA 1TKZA 3CJ0A 3G6XA 3QGGA 3HT3A 4O3PA 3ICLA 4DL6A 4Z4FA 4K4YA 5KFBA 1RT4A 3CJ4A 5KFNA 2IA6A 1RT1B 1K6YA 2OPRA 3P83D 2FJWA 4FXDA 3I5CA 4ED3A 4FLYA 3L2VA 4ECZA 4FK0A 2XO7A 1TKTA 4FJNA 4PA1A 1XI1A 3KK2A 2FC0A 5EWFA 3NHGA 3KD5E 4I2QA 3T5HA 4JV1A 1LW0A 4ICLA 4URSA 3RTVA 4BWMA 2C2EA 4CCHA 4J9LA 1RT6A 5KTQA 1RTIB 1D9DA 4NCBA 5J2MA 4GVMA 2YNGA 1I3AA 1S1TA 3KD1E 1W9HA 4O3SA 1IO2A 3I0SB 3OYFA 1K1SA 3T1AA 1BHLA 3NBPB 4Y2AA 4Q5VA 5EU7A 2FBYA 1S1WA 1N6QA 1DTQA 4E7JA 3MEGB 2FJXA 3QIDA 3L2RA 3LP0B 2Y1IA 4F3TA 4DG1B 3CFRA 5T7BA 2C22A 4B3OA 5DG7A
chains in the Genus database with same CATH superfamily
3HOSA 2AX0A 4EMDA 3H2LA 4YOUA 2QWOA 2RD5C 4KTWA 4OGEA 5A2QO 2HNYA 2BANB 1PBUA 1YLXA 2QA4G 1QZ5A 4DV3F 5HL7L 2WVCA 4A8KA 1NG9A 3FMWA 4CVNE 1RT4B 4GC6A 4FYWB 2NRWA 1B9DA 1H2UX 4O3QA 3WX4A 3ETMA 4UY85 2P9LB 2VG6A 3G2XA 4HLBA 3G6ES 3SUNA 4CTAA 1XJWB 3J7AN 3QEVA 1QJHA 1VJWA 1ZTTA 4X4UA 3BBCA 2YKAA 4FPIA 2KYXA 5B08A 1Z4UA 4A8FA 4CE9A 2H1YA 1QVFR 1KCFA 4ED8A 1JNRB 2HVZA 4F04B 5IS2A 4J9QA 4XPEA 4YDXA 1RDBA 1R6YA 3GTYX 2H3GX 1XNQJ 1W97L 1MROB 3QMLA 5ETMA 3AVFA 3O4NA 4GKJF 1AUSL 4A8QA 3V4IB 3UR3C 5J1NA 1RWWB 2W2PP 4DTUA 2QXFA 4PL8A 3V6JA 3PIPQ 4H4MA 2EPIA 4DQQA 4R79A 5D6GA 3CMES 3W2WB 3OV7A 1SCJB 2E9RX 1UZHA 1QVGR 3LTOA 2ASYA 3WNHA 4B3RF 4RBUA 4M94A 4YDUA 2JEGA 3NWRA 4U7UD 3Q2TC 1UEKA 4I69A 4KKOB 2KU7A 4X84A 2LXIA 1LWXA 3BBBA 2B6AA 4DFMA 2CQPA 2VICA 3LDSA 5CZVA 1B64A 4CIFA 2DPJA 1IBMF 4KFBA 3K58A 3MD3A 2RHSB 5M2UA 1HARA 1W25A 1WD6A 5BPNA 4J91A 2DY9A 1J5OB 3TP2A 3MECB 2CH5A 1PIEA 2IDLA 2NUUG 4D3HA 2GMLA 1ZZNA 2LA6A 5BPLA 4QZVB 2Y0BB 3OXLA 2DITA 2VPWB 3ZZTA 4DTNA 2G2YA 1NK4A 1S7HA 1NGBA 2EBEA 3JTOA 1VQOS 1RTIA 1ZM3A 2XSJB 4HH1A 3UFCX 2Q31A 1LFWA 3C6AA 3HHLB 1YJTA 4Z94A 3NMAA 3FSXA 2PZSA 1IN0A 2W2MP 5SUHA 4IFYA 4KH6A 3ZLJA 2OPSA 1KTQA 2FJAB 2W4DA 4G1QA 3SCLE 1KLNA 3RRHA 4F4WA 1YT3A 3B6BA 4ZOSA 4UUXA 4JI4J 3KLIA 3RR8A 3UDVA 4ZMMA 3KHLA 3CM5A 4QQBA 4OX8A 4IFVA 3GJRB 5M2PA 2DEJA 3CC4S 3W5XA 3FZHA 2Q6CA 3FKBA 2GGPA 3HJFA 5ELZA 1XHXA 3M2UA 4LH5A 4GV3A 4ZCLA 3GIRA 1VSJA 2PI4A 2ZOGA 3GFXA 3A8KA 2VFVA 1YGYA 5GADU 4CZMA 2OH2A 5HROA 4IXCA 3KUGA 5KFAA 1NMDA 1TV6B 1RCHA 3QINA 1X4GA 1CVJA 1IUJA 1TL3B 1DTTB 4QPTA 2YX1A 4KGZB 2AGQA 1IXKA 2IMWP 3MF5A 1U1RA 4F2SA 1EP4B 1YSJA 3A3NB 4QOTA 4Q2MA 3ZTPA 4JHDA 4UOGA 2ASJA 1FVQA 4LRCA 4OLAA 4WIIA 1PCAA 2DO4A 1AROP 4DFJA 4IO1A 2BX6A 4MYTA 2FLLA 2V68A 1XMQJ 3OBYA 4E3SA 2QYGA 3QGHA 4FBTA 4FNHA 3ALYA 1HYSA 3KLFA 3LWLA 3H40A 2HVIA 2JLGA 1R43A 3D4JA 3PVXA 2HMIA 3UKUB 4BRDA 3LDQA 1VQYA 2W41A 4CZGA 2BMBA 5EX5A 4BGBA 4USMA 2X1AA 2GAHC 2B9EA 1OJ4A 1RTZA 4YB7A 2LEBA 4JI5K 4WPAA 1N32J 5BR8J 3AQOA 1OH5A 1FERA 3D28A 1DTTA 6FDRA 2B8PA 2RT3A 3NAIA 2LQ5A 1NSPA 1WF2A 3K5OA 4DR3K 1ATNA 3OR1A 3W60A 2Y8YA 1SJ4P 1LNQA 1NB2A 4DCHA 4Z4HA 3QT5A 4Y3CA 4GW6A 3W63A 2D0AA 3FVYA 3IGNA 4K5SA 2YVSA 4GV6A 2FTRA 5D0HA 3HSDA 3ZZUA 4WU2A 1T9VA 1ZM4A 1VHFA 3KJFB 2JHEA 4DS4A 4HCBA 4OI1A 3O3LA 2AJ4A 2WHOA 1RGVA 3U4LA 3DM2A 3M8QA 1EZZB 3ZETA 1J53A 2IDOA 1SC6A 4O0IA 1FJGF 3V1OA 1B4SA 4EU0A 1VQNS 3RMDA 2DGQA 4KH5A 2MMYA 1D9AA 3AOAA 5HATA 2ZDOA 3EGNA 4DSIA 2QL9B 4JRQA 5GINA 4USWA 1YTAA 3DRPB 4NLYA 2BANA 1KOHA 1N88A 1Y0HA 5CH7B 3P5BP 3KHGA 4KSEB 1RADB 2DNLA 3W8GA 3GFHA 2PMZD 4Q8EA 3MMCB 3OYCA 1KAYA 3IAM9 1S6PA 4Q2LA 2X6SA 2EFQA 4ZN1A 4JK7A 2XMWA 3GP9A 1N34F 5GMKa 4KV8A 2D4WA 1FDAA 3G10A 4DEZA 2OEJA 4XH5A 1PSDA 3TAEA 2OD6A 1YJWN 2XGPA 2HBKA 2NXJA 4BRGA 1SBRA 5C24B 3GIIA 4ZJQA 1VHXA 2GTDA 3DOMB 1GQEA 1FJGJ 1WLJA 4MTPA 3SLCA 3QWUA 4JKDA 3ZT0A 2BE9B 2MQMA 3M9NB 1WI8A 2A1BA 3EGWB 2JC1A 1R8BA 4DPTA 2DFHA 4OX7A 4ECVA 4JD2B 2AD9A 5IT4A 4LR8A 3F2KA 4K4ZA 4JS5A 1UKUA 4BRCA 5IZHA 4AQYF 5GAGU 2BDPA 3CJQA 4K59A 2NZCA 1KFDA 1NNDA 3P49B 2B5JA 3EE3A 3SK3A 1KVKA 3DRPA 4FOEA 1HKBA 3ETOA 3SQ1A 1IJFB 4OLOA 4M5DA 5L39A 1J27A 1RTHB 3OS1A 3F56A 3IBCB 4G1PA 1ZM9A 3P1GA 4OHYA 2E2PA 2RF2A 3GPAA 3MCOA 3SCIE 1U4BA 2XNQA 1V4TA 2FVRA 2XGQA 1WF0A 1HNVA 3NNHA 1W26A 3GCXP 1EETA 3VVTA 1IKYB 2YWFA 3H1VX 2EG1A 4MKVA 3CCSS 1U8WA 4KB1A 4CBWA 1SC4B 3U1MA 5T7LA 3KLEA 2LU1A 1VQKN 4YR3A 2VOPA 4CHNA 1KN6A 2LVWA 4FZXC 4B3SJ 4IOAQ 2J4RA 1NRKA 1UVMA 1RBRA 1X4HA 1U7LA 3IG1B 1RLDA 2AZ3A 5FPDA 3AAPA 5AR0A 3A13A 5EOYA 3WQTA 4MLHA 1SIZA 3OHAA 1KXPA 5IC4B 3EYZA 3MWBA 3D2FB 1WJ9A 3EJMA 2VG5A 2HYIB 1RBSA 3JAMO 1WBDA 4BC9A 4FJJA 1ZZFA 2RPIA 3FCWA 1TKTB 3KKSA 4BQLA 3BDEA 2NXUA 1HFEL 1VSDA 2L9WA 2NRTA 2AYEA 4JI3F 4FYYB 1ZBFA 2LKZA 3DDKA 4LF9F 3MM6A 5IT9U 2WW8A 2DGXA 3V9XA 4DBQA 2J8SA 3GIKA 5JS1A 3ZSVA 3M6VA 1RTJB 3MMBA 5A0YB 1PC4A 4BRHA 3FCHA 4O44B 1VQLS 4JI3K 4TSXA 5KOXA 3C7NB 2ERRA 4ZA1A 1HNWK 2DXEA 3UNGC 5GIPA 1S6OA 4L76A 2J6UA 3CJ8A 2OZMA 3KLGB 1NSAA 1LOTB 4LFAF 3CUNA 3EPGA 5F1XA 1O1WA 4DN9A 2ZH9A 2OTLS 4FL9A 2VCPA 3MEEB 4X4TA 3HM8A 3I96A 1YBAA 2QMUB 2YHAA 4G9ZA 1JNZB 1OO0B 4CK2A 4I4BA 5ETTA 7FD1A 4WTOB 4CHZA 1YRUA 3A8EA 4ECSA 2WSEC 1N48A 1O5JA 4CP5A 2HF3A 5K5MA 2CJQA 4KHPK 2GV9A 1NH7A 4OYAA 3ZZZA 4KHPJ 2YHBA 4DV7J 3Q2SC 2E6MA 4WXWA 1VQ4S 1NJIT 3BY5A 1XMOF 3GFYA 4CJRA 3DLEB 4DR7F 4Y1CA 4RLEA 4DL5A 2OPSB 2DNQA 4MJKA 3DWLA 4H5WA 4E7KA 3DXSX 3NLCA 5I9EB 2HZAA 3OXGA 1ZBHA 3CNQP 4I68A 3GG1A 2U1AA 2DR6A 4WKYA 2FC9A 4B9TA 2NZTA 5THWA 5FRMA 2WVBA 3DXMA 3ITHB 1GLEG 4OFZA 2MLZA 2HWTA 5LXYA 3DLRA 5AZJB 4JS4A 3RAMA 1VQMN 3TARA 2CZ4A 4EBDA 1UVNA 3FUYA 1DEJA 1JX4A 3POTB 4IOBA 2V51B 3ZX3A 5ADXH 3K2PA 2R7YA 5I3QA 2DRDA 1QZ6A 4CF0A 1FFWB 2BACA 4ZCIA 1Q81T 3V4IA 1ULRA 2PBDA 1JKHB 2GQ2A 4QCLA 3KLIB 2MB0B 3J80Y 3AA5X 1XMOJ 4BRLA 3I55N 2E5LK 3VF4A 1KVAA 3BSOA 2NUBA 4YOVA 2PMHA 3ZTRA 1ZBIA 4ILHA 2VU5A 3FSYA 3OL7A 2D9PA 3LPTA 4LSZB 1E6YB 2HZCA 1YTUA 3A12A 3Q8UA 2BQ3A 4A59A 4CZKA 3RB0A 5IXUA 3R5JB 3TUJC 2CQ4A 4K5RA 2GIFA 3MUMP 4BDZA 2BM0A 5KT4A 2OI2A 3D6TB 4CLYA 1HW8A 4M95A 4HR2A 2BRKA 4IDHA 2R7XA 5D0EA 1NB7A 1BQNA 4H0XB 4DV6F 2XMAA 2AX1A 1O6XA 2V4QA 3GBTA 2ZE2A 4NLTA 4TU9A 3H8YA 4O5FA 2O8BA 1T03A 5LMUJ 1U26A 4CHOA 4DPYA 1VQ5S 2P5OA 2ZITA 2B9WA 5HAOA 4YMEA 1QSYA 3CMQA 2Z56B 2MQOA 3K7RA 3BQ2A 4CEFA 1VQ6S 3HSGA 2MDAA 2K3KA 4IJNA 2MJUA 2NZ4A 1CJUA 2MSTA 5DK5A 1T05B 4IG0A 5K14B 1HWLA 2LDYA 4I6YA 1HKAA 3F73A 2QL5B 2VPYB 1M1KT 1F9EB 2UV8G 5G0RA 3THYA 3UWTA 4JI7K 5CA5A 4E1NA 2WAQD 4JI7J 2GX9A 3KHHA 3KYLA 3NAEA 3WUHA 2YV0X 1KVIA 1VIXA 3OYEA 1LEOA 2CPZA 3BKUA 1IBKJ 3HHEA 4NLUA 3UD4P 4ILLA 4YB5A 4J8FA 4ZP7A 4DTMA 4FXWA 4NCGA 1N5YA 3THWB 3D54A 5B0CA 3SJJA 2PI5A 3LA0A 1WNSA 4LRBA 4EO8A 2DIVA 1RYSA 3T41A 5DZ7A 5KFPA 3OD2A 3L3UA 1VC6A 3MX5A 1Y3KA 4DV1J 3PIOL 5ADXA 4DSKA 4URQU 2GX8A 2OTLN 4L75A 1P9QC 3KMQA 2RNEA 3R6MA 4WFNQ 2HQFA 3PX6A 3C94A 3A8JA 5C2FA 2DPIA 2ZBIA 4FDFA 1S12A 3BPSP 4C8YA 1C1BA 2B4VA 3HP9A 1N4LA 3VENA 1FKAF 3QBCA 3UKUA 3TX8A 2IC3A 5AQRA 3VQ9A 3VEYA 2UUCF 5F3ZA 2W40A 1U6ZA 4P2XA 3FMBA 4LIWA 2J0QD 3LAKA 3PEJA 4JNEA 3N4WA 3QT7A 1K73T 1DTQB 4CEEA 2AMCB 1G4CA 2LQJA 3W1YC 2W9BB 1RDUA 2QWNA 3SZ2A 1R89A 3QQCD 5MAOA 4FJGA 1EWQA 4MFBA 4FBUA 3NH0A 3CCES 4TLRA 1FA0A 1QQCA 3P5JA 5J2NA 1Q4RA 2IYIA 4KHYA 3GG4A 1I5OB 5AFUA 3GB0A 2WOMB 1BGXT 1B9FA 4JEPA 4M3WA 4NI2A 4KTQA 2F5GA 1HQUB 4LFBF 1HD1A 1BE4A 1YJNS 1RBTA 3S01A 3D1QA 3JYTA 1D8YA 4O4RA 3VQ6A 3M8RA 4RUAA 3IBFB 1HNXJ 4CLLA 4YB6A 3HKWA 1KKHA 4Z7YA 1QLNA 4YNQA 2GHVC 2B4JA 4ZP6A 1FDNA 5KFTA 1SPBP 2IJNA 5KPTA 1SKUB 3KNGA 4GNIA 1BC6A 2BW7A 3R1XA 3DGVA 2MKKA 1KQFB 3BS9A 3WNEA 5L9XA 2XS7A 4M3ZA 1GMWD 2X51A 3KUEA 5EY4A 2YQ0A 1KC8O 3J7AP 4TQSA 1ZA1B 3AOBA 2R8GA 1VBYA 3RWUA 2AJQA 5EUHA 5HQMA 3HD2A 4ZDNA 5E5NA 2FY8A 2AGPA 4FWLA 1L3KA 2UVUA 4MO4A 2FJBB 1N36F 1TKZB 1YXQA 4RW7A 4OPJA 3NGTA 2Y1RI 3ULEB 2V5HG 4WE1B 4B1ZA 3L2QA 4OO1J 4XPCA 2V9WA 5A2QU 2DR9A 1HI1A 1FNOA 1FCAA 2DCLA 1WDDA 1YRXA 3DOLB 2LSNA 3MXHP 2P9KA 5HQ8A 2A3ZA 2CJ9A 3P96A 4NZ6A 1XMBA 2IVYA 3MMAB 2DNHA 3KWMA 3C66A 1MDUB 1U1LA 1RCOB 1UEVA 3D68A 3JYTB 5HI7A 1CEZA 4DUZK 4DU1A 1OVYA 2FD2A 4K4VA 4IZ9A 1IR1A 4H54A 4DFKA 3R7BB 5LXRA 3QATA 1NK0A 1N0VC 1CS4A 3A2FA 1TMJA 3NMUA 4X64J 1NGGA 1H7WA 3C7NA 1RA7A 3UR0A 1K9MT 1PG5B 4DV6K 3SI8A 2XHCA 3PRBA 3EVOA 4FJ5A 2A1RA 2O5DA 4LQ9A 2FGOA 3CM6A 1IR2A 3VGVA 1N0UA 2YBVA 4AT1B 1YAGA 1NGHA 1S5ZA 1WC0A 3UD5A 2R4FA 3MWPA 2ZJQQ 3SMSA 1T3OA 2CRLA 1A9NB 4FVCA 4PYAA 3CJTA 4QWEA 3R9LA 2GS8A 2F96A 2CGJA 5AFUH 3VN5A 3HCXA 3SEOA 5JMNA 1RAFB 1GX5A 4CESA 3NGUA 3RB3A 3M9MB 3QT6A 1U1NA 1BA1A 2DHXA 4KHPF 3FBBA 4JP8A 5D77A 4CZEA 4JI3J 4DF8A 4DXLA 1SC1B 1Y5IB 3QDKA 3BREA 3MCPA 3D9BA 1UETA 2OPPA 2RQMA 3GU0A 3D3CJ 1JLFA 3W62A 1EXQA 3CC2S 2O4GA 2HK3A 3LGNA 3QBWA 4H8KA 2D1CA 3H59A 1WN7A 4RW9B 3VEWA 4C0OC 2E9TA 1HQEB 1LAVA 1KOOA 4P7TA 4OJ3A 1LCUA 3R3LA 1U6FA 3ASMA 4C8LA 3I9ZA 1NU4A 5L46A 3IRWP 3O8WA 1UWBA 5E2QA 5AQLA 2B9XA 3VMFB 2KFYA 1JJ2R 4LSLB 2DNMA 1MU2B 4XDCA 2ZM6F 4M45A 1KAXA 4IH5A 2W2NP 2YH1A 1G3OA 2H5JB 1P9YA 3QJLA 1PKUA 4CZCA 1SKRA 5FLXY 5H9FJ 2BGGA 2Q36A 3OFHA 4I6MB 3QZ8A 4NLCA 3SMZA 4ZVOB 4J2DA 4HHJA 4BROA 1N54B 1SJRA 3ENVA 4NXMJ 2AEFA 1S49A 3TZXA 2CJXB 2X78A 5DM7Q 1QQOA 2OPQA 1XC3A 4FPBA 4JKCA 4JI6F 1HI8A 3PEHA 3MUVP 2M2BA 3CC7S 2R9LA 5DLGA 1LXJA 3WQPA 2ZHBA 1KAZA 4ZLLA 1TGOA 1X9WA 4DPOA 2AHOB 5LT5A 3HMJG 4DR6F 5FDLA 4JYAK 1SXLA 1TVRB 2ILZA 4CHPA 3PLAA 3S8SA 1RE1B 2YHYA 3THWA 2G8WA 4OZ2A 2HQCA 4PXCA 3W5YA 3CD5A 2I38A 1DQ8A 1AFJA 3VAJA 1C1BB 2BA9A 2E2OA 3HI0A 3NF9A 3G8TA 2QWMA 5F2RA 5GAGI 3L7PA 3OFGA 2HHHK 4BDYA 3J81Y 4PHTX 1LWCB 4PY5A 2KI2A 1U48A 4OVLA 4LSNB 2HKEA 2XHWA 5BREA 3RBXA 2XMKA 3GIJA 4DTOA 2RH3A 3DKDA 1FRLA 5KFGA 3ENOA 5KFYA 1EIYB 3BDPA 4ZLNA 5M1NA 3TZYA 2PYLA 4RUBA 1YIJS 2H5IB 2DNKA 4CGDA 5E3PA 4FZYA 1SV5A 1NZAA 4QU7A 4DSLA 4M5GA 1WEZA 2BKNA 1NHVA 3TVKA 3HHLC 3VF6A 4CEAA 1RQ0A 2IS3A 3RAXA 3CJ1A 1EKSA 3ELHA 4M63A 3I0SA 1TV6A 3S1TA 2UUBJ 2P5VA 4KTZA 2WW4A 3G6EN 2UUBK 1GLCG 3BF1A 3M4XA 4CW7B 2B4UA 3G8QA 1ZXOA 3KLHB 1FWPA 5CHCB 3CJSA 3Q0AA 4Y2MA 2O8BB 3GR1A 1XQIA 3THYB 3QETA 2VH7A 1Z1ZA 2I1RA 1YJ9S 4Y0WA 3CCWA 5HSPA 3R2CJ 1AT1B 4D3GA 1GMWA 3E01B 2BRLA 2UXBF 4ZTFA 3MMVA 3N4QA 3AB4B 4CRJA 5KGXA 4TYBA 1E6YA 1GMUA 2G8IA 3NP5A 1HNZF 1EWRA 1S1XB 3DXBA 1HNWF 5EWGA 3LF0A 4PKGA 2BJ9A 3VOVA 3HVRA 4JI6K 3NGDA 1LWFB 3TANA 4FVUA 2B7CB 1KRPA 3TAQA 1QM9A 5ETQA 3CCJN 4AH9A 2ILYA 3RUBL 3GYNA 3GYXB 2LDIA 5HP1B 2QMWA 1S9EA 4K41A 3JQJA 2GVZB 2E1AA 3LP1B 3VGUA 4CJ5A 3LL3A 4FVMA 1JLGB 2PDAA 2H65B 1RBVA 5IV4A 1WEXA 3V5RA 1R8AA 2UXCJ 4KAZA 2FHKA 1SAZA 2DR8A 2MYFA 4Y6IA 4Y1DA 2JEIA 1FRXA 4C1NK 1WC3A 1PYTA 3AV9A 2G2ZA 1SC3B 4MMOA 4LFCJ 4OL8A 2P5GA 4LFCF 1U47A 3IS9B 2GCFA 1TKXB 4PR6A 1DHMA 2G0IA 4JI8J 3D5MA 1RT7A 1EETB 4MKBA 3KG1A 3OUYA 1F9HA 4MK7A 3CJBA 2QE5A 1UCNA 3NXZA 3KK2B 1NBEB 4YHHJ 2VV5A 2G9OA 2WRMA 2E8AA 3SPYA 2HB5A 1S9GB 4M5DB 1RB0A 4Y34A 1XMQK 3DCAA 3O9TA 2KRRA 3RSEB 4B1UB 1SH2A 3HKZD 1F2GA 1RT5A 2YKNB 5KFZA 1Q1KA 3R7NB 3HPGA 3DOMA 4WCEL 1P8GA 1MNEA 5J2MB 4F9OA 4MIAA 4P75A 4O0JA 4M5IA 4KHSA 1MW7A 5J2QB 1UAXA 1HBMB 4NMXA 4LF7K 4CLKA 4DQIA 3MAHA 1VSKA 4RW6A 1NAQA 3KFWX 3Q86A 4CJ7A 1JL2A 2HQIA 4O3RA 5ETKA 3SPZA 3W7BA 4GRSA 3HDSA 4P52A 4CO5A 2C2DA 4NXNJ 2P9IA 2W01A 3UE5A 1ZAXA 5I3UA 4ILGB 4NLGA 2GQCA 4KRFA 3PRVA 3M6WA 2DHHA 4IEIA 4DTPA 3Q8RB 3E2EA 2B9YA 2M5YA 3IG1A 3HSJA 3FNNA 3OBIA 1T02A 2MY7A 3GJQB 2HGMA 1RTJA 2FB0A 1TKZA 2F4VJ 3QGGA 4X62F 2XQCA 4ZIWA 2LLZA 2PT0A 3QGPA 1RT4A 3CJ4A 1OY6A 3D2FA 4X66J 1LK5A 2UUCJ 2OCEA 2WVFA 4AXJA 5EXWA 3P83D 4ETZA 3U02A 3I5CA 4PG5A 3S6EA 5E33A 3BN4A 1TKTA 3JQKA 2FC0A 5EWFA 3NEKA 2QWQA 2I7NA 2CZVC 4JV1A 1LW0A 3RTVA 4J9LA 1RT6A 1RTIB 3GWCA 2DRAA 1I94K 3IWLA 2DGTA 1FJ7A 3M2RB 4GVMA 1S1TA 3M8WA 1W9HA 3I32A 2YCHA 1K1SA 3T1AA 4A2AA 1BHLA 1F9FA 2JVRA 1H73A 3N28A 4BRPA 4KGXB 2I8EA 3A1YG 4OYBA 5EU7A 1NWKA 2FBYA 3TSQA 1WUAA 3MURP 1OY9A 5GAGP 1X3NA 3LP0B 2ZNYA 2CG8A 5T7BA 1MMNA 2C22A 3MAAB 4WP3A 3PYEA 2W8KA 4LC9B 4RX6A 3KLGA 2G8UA 3K5PA 2HVEA 4MT1A 5A8KA 3NS7B 4U96A 1ZC6A 1VLOA 3O5TB 8AT1B 2CNNB 3VZIA 4R25A 3O9SA 5CD4A 5AZIA 1NGEA 5GAEU 5IOLA 4EBEA 4RCHA 4WK3A 2ZBCA 4DV7F 2DTJA 5M1KA 2Y3YA 5D3GB 2YQ3A 2QXLA 2AIRB 2R2UA 1MROA 4AUKA 1N52B 3AVAA 2QG9B 2ASPA 3R2DJ 2VBZA 2XYGB 3LALA 4FJXA 1S0NA 1EQYA 3WEEB 4JKGB 1JLEB 4H4MB 1X0PA 1NK5A 3BSNA 2RQCA 3L3VA 3PM9A 3DLGA 1WB9A 4Z2XA 3W3SA 2KZZA 2FQQB 1OQ6A 3R8EA 3AVKA 2WVDA 4A61A 4ZN3A 2OZSA 4WFXA 3CDAA 2RKIB 4O8UA 2LQ9A 5D4NA 3AD9C 4C11B 2B8QA 5KG0A 3V6DA 1M1HA 2ZJQL 3GOIA 2ROPA 4LF9J 3U1NA 5HMZA 2CG4A 2RUGA 2FVPA 2KJVA 5CABA 4GKJJ 3LDNA 5EWEA 2HBLA 4WXOA 4FK4A 4QW9A 3D1HA 2BJ8A 1D5AA 4RO0A 4IO9L 1RWNB 1PO6A 1UJ5A 1GH8A 4WYWA 2ZUAA 1YVUA 2F65A 2C1EB 5JVHQ 4FWKA 1XR5A 4C3LA 1ZBLA 1VC0A 3FBFA 1U25A 1UW4A 3WC0A 4WQ5C 2HBMA 1Y7PA 3W9IA 2N4CA 2VGMA 2JFDA 3VAMA 2PFDA 3WDOA 1VYAA 2UP1A 3MDFA 3ENAA 2NRXA 1JCEA 2MLXA 4EZ6A 3TNVA 3SAFA 3IM9A 2JFKA 2QN6B 2FZGB 4JHDB 2F9WA 4TY9A 2V4JB 3L7UA 3MMJA 2OSQA 3KMSA 4E19A 1VBZA 3VTHA 1EP4A 2IIRA 1RBAA 3BH6B 3ZFVA 1TTHB 5C42A 3H2UB 3OS0A 3W66A 3SV3A 2XLJA 3PW2A 1FVSA 1YIJN 3J8AA 3PNIA 1MG7A 1VIOA 1VBKA 2KT5A 3C6HA 4QS7A 5HL7Q 5C15A 2Z2ZA 1WG1A 5KG2A 4RW4B 2BJ7A 1EAYC 2ZOMA 4H0YB 5I42A 3D0GE 4J9PA 2UUCK 2YNHB 2E2QA 4DG1A 4J9SA 3CYMA 3M6UA 1EX8A 1QUPA 1VQON 1UWBB 4CLTA 2K1RA 3MGJA 2V4JA 3QMQA 1JIHA 3J7YI 2V8DA 2DNRA 4CI6A 4FXVA 2PA8D 4NLDA 1K8KB 1N33F 1WKLA 1CJTA 5B0AA 4BC2A 1LWCA 5KQ8A 2VQEJ 3P45B 4E8UA 4DTJA 3LOUA 1VLYA 5D15A 4ED7A 4KR0B 3RSEA 5ITHA 5KG3A 3ISNC 1FRHA 2HFVA 2C42A 2OKQA 1FJCA 3OYGA 5IT0A 4Y65A 2DNZA 4QIGA 2VWKA 4LF4F 3GV5B 2F3JA 2KB2A 4USTA 2NNWA 3ZC4A 1WELA 4HHHA 2MTLA 4USVA 3J81O 2GEMA 2V2QA 4ZS6A 3E8OA 3MXJA 2VJUA 1U1MA 1TL1B 3PSFA 3WNGA 1UPMB 1C0UA 4ZVPB 1IV0A 4UTGA 5FLXU 2E6LA 2HPUA 4P71A 3EGVA 3PW4A 4ANEA 1F21A 5B0EA 3TZWA 4K4WA 4QR2A 3J81U 1KLMB 1ZPVA 2GJIA 4DL0C 4FK2A 2ZH3A 1OIAA 1FRIA 1NSKL 4JI8K 4DUYJ 3EEQA 3EO3A 1SL2A 3MTJA 4TLQA 1Z2LA 4JI1K 1C0GA 4W4MA 1GOBA 3T19A 3M8YA 2P9CA 1CLQA 2AEMA 1ZETA 5A8RA 3SUOA 1DLOB 3RW7A 1NK9A 4HTIA 1JLBA 2UU9F 2J9EA 5L1IA 3MM9B 4DI6A 4JV2A 5AQJA 4CHQA 3FQLA 5M1QA 3L2WA 3DI6A 2PYJA 4ENOA 4J9KA 2JWLA 4DR7K 5KFUA 1WBBA 2V2KA 2CQCA 4Q45A 1GK8A 3NKYA 2DNYA 2P9SB 3B54A 1JLGA 4X62J 3AA9A 1Q79A 2E9ZA 4DV3K 1FX2A 4RWTA 2B43A 3LDLA 3D3BJ 1HQ2A 2VBWA 3DXKB 2P9IB 5HO4A 1E6VA 2CVIA 4O0NA 4DLEA 2MKHA 5SZTA 3OHBA 2YHXA 4ZHRB 4ZPBA 4KYZA 4XEIA 1MLAA 4HVJA 4ATNA 4BR7A 1XK8A 5DRKA 4X4QA 4O55A 2V94A 5KFRA 4ELUA 4E98A 3TTCA 1QAJA 2MXYA 1UMJA 5KFJA 1YJUA 1RAEB 3CJAA 4FNIA 2X3DA 1UOCA 3C14B 1CJVB 2ABYA 2VG6B 4KAIA 1QE1A 3M3ZA 3WZ0A 2AWZA 2Y8WA 2OSRA 1OKJA 5B0BA 1DT9A 2ZH5A 2OELA 2A2DA 4JYAJ 3GJTB 4H4OB 1IR0A 2AU0A 2VASA 4CJEA 4L6V3 1BCOA 2X1BA 2LMIA 3JTPA 2DT9A 2GBZA 1A5WA 4AHCA 2W4PA 1S6QA 3UN3A 4RJVA 1Q8KA 2AJ1A 5K8PA 4N41A 5CXTA 1UFKA 1HYZA 2ZH4A 4CO0A 2DHGA 2G2OA 1X4FA 4OYMA 4BRMA 1CJKA 4OKJA 1Y5LB 1KONA 3FZMA 3N01A 4FKXA 4Z7CA 2RUSA 4B8AB 3DLGB 4F4ZA 3CPWM 4EAHD 4BC5A 2UUWA 1DQAA 3VEXA 1YX2A 4FLUA 1AYEA 1Q8IA 3FDSA 4EP4A 5HRSA 1NM2A 1LWEB 2VB6A 3J7YU 3BB5A 5DQIA 3NCQA 5LJ3Y 1EHWA 1Q8BA 2HHUA 4LF6K 4MKAA 4YR0A 1D3WA 3C65A 5HROB 3JS9A 4I1TA 3VGSA 3H5SA 4DR2J 1F6TA 1X9JA 2Z1GA 4C4WA 4CGJA 3E9OA 4DSJA 2ZKUA 5D8HB 2PAVA 4FWOA 2G0CA 3ENQA 4DR2K 3OYNA 5BYRA 5IT9Y 2GELA 2Q79A 5AQIA 3T9NA 4I6AA 3NFAA 4PQUA 5AXKA 2LQBA 4IR1A 1MWQA 2GV1A 1U1KA 1R0BG 4OPAA 1Z05A 2W42A 1X1PA 5J2PB 3CCTA 4RW8B 1EQMA 1C0MA 5AZIB 2GGPB 4KI6A 4CM0A 2H54B 1RHKB 4NCAA 3Q23A 1HBNB 3CHWA 3RB4A 1Q78A 2MLYA 2CIMA 4DV0K 3NMRA 3KTQA 3G96A 3W2VB 4X4VA 3AO5A 3DLEA 2KKHA 2XMJA 3BSCA 1WOQA 4RBTA 2C2MB 2E7XA 1OSDA 4M5HA 3RMAA 1T94A 1RXOB 4WQ4C 4BR9A 4TY8B 4EGLA 4FLWA 3GSDA 2OUGA 2CWXA 3D6MB 1PYOB 3DN9A 3VQ4A 3IP0A 3CG7A 3EM1A 1U8SA 2Q1LA 2NXCA 3C8YA 4CJPA 3O9RA 4ALZA 1VQ8N 1C0TA 3T5JA 4JKAA 1TP7A 2UV8A 2VODA 1RT2B 1KD1T 5M1PA 5BRDA 4CLPA 5BYQA 3KJQB 2VA3A 2C3OA 2KVIA 3ID6A 2W2QP 2E4LA 1FESA 2G0JA 4PQAA 4FWMA 1U49A 2PEHA 2K1RB 2G13A 4KFBB 4DV4F 4J5OA 4DV4J 3THPA 1ESVA 3EY1A 3V6HA 1OYDA 2QYCA 1VRTA 3L2UA 1OH6A 3OHRA 5HN0A 2QEXN 3ADAC 4WU3A 1JLFB 1YVFA 2KRBA 4PABA 5C25A 2IM3A 3THXB 1D4XA 4ICLB 2QSWA 4IWVA 3TI0A 4HYKA 4YORA 3LP3A 5JXSA 3TAFA 3A5MC 2YKMB 3VQSA 4N47A 1BMQB 4DR1F 3AO3A 2NREA 3TQ1A 1YITN 3I5BA 1HLWA 2IJRA 4BY9C 1JLCA 5IWAK 4TXSA 1JJ2M 4F0KA 3FR0A 4RNMA 1BQNB 1V3ZA 2XI3A 4HT7A 3O08A 4AFFA 3H25A 2CNLB 2E1ZA 5D4LA 1RFQA 3CT9A 2FLOA 2N4DA 3MN7A 4DX6A 4NOHA 3KZBA 3TX0A 1YI2S 4F4AA 4DV5F 4V19S 3BO4A 4R0EA 1S9GA 4CGIA 3BN7A 4UUWA 3UDEA 4F36A 1S5JA 4DU8A 1VK0A 4DWIA 4DTSA 3ILJA 4CO2A 4ECRA 2GUIA 3I87A 3AA2A 5IV3A 3B78A 4HI2A 5J2QA 4K0KK 1R6VA 2CWKA 1WC4A 3VA3A 1SL1A 2OEKA 5C25B 3E3XA 4ZCMA 3THXA 5BYSA 1V5VA 1JLAB 1O51A 2KL8A 1KS2A 4F25A 3C6TA 5HVFA 1X5TA 1T0TV 3IO1A 3SFUA 1URRA 5AQYA 1N8RT 2IFXA 3EZWA 1S0MA 4O23A 1REGX 2RE1A 1IJEB 1FDDA 2C28A 3AA8A 4KB0A 2CJYB 4KPCA 4OX9K 1S1WB 2NRVA 4DQPA 2ATQA 3C0BA 2ZJPL 5LJ5Y 3I55S 1LWFA 1DZ5A 3IDHA 4FJHA 1ITPA 3R27A 1IKYA 2FDNA 3L7OA 1YWXA 2CPEA 3MCSA 2YKQA 4N8OA 5F8HA 2RN2A 5I3PA 4CF1A 4CF8A 4B3SF 5ADZA 3DGPA 4R5PA 5F8NA 4DV1K 4W98A 1VQMS 3VQ7A 2R2TA 3MN5A 2VIHA 4I2QB 2IRYA 4CIOA 2JLFA 1ZPWX 3TQEA 3ISND 4NCGB 2QZ8A 3ZO7A 3Q8YA 4RWWA 3H4DA 3MHYA 2V8HA 3HVAA 5CYMB 4MO5A 4LF4K 3TYTA 3RBEA 3AGRA 1G1XA 1AZSA 1FEEA 4CNYA 2ZJRL 4NLXA 3KLHA 1C4AA 5HMWA 3LP0A 3UW1A 4XIUA 1U45A 1Q7YT 1ROFA 4NX9A 3CC2N 3ENHA 5I4MA 1CC7A 2EXUA 2XMUA 2WCXA 3J7ZT 3D7EO 1N33K 2PY5A 5H9EJ 3E01A 2RIJA 2D3ZA 5E0OA 4C0HA 2NLXA 3GIMA 1HBUB 4WK1A 2R2SA 2XO6A 1VQKS 3NOGA 3DLJA 3T5KA 4OIXA 4ID5B 4XAKA 3RBDA 1N32F 4ED5A 3JSMB 4ANDA 4W5RA 3ZZPA 2Y9HA 2D3UA 4CO3A 2W7OA 2QM1A 2RF2B 4BRKA 2YPZA 4OYZA 4DCOB 1MWZA 4CYUB 1TUUA 2G4BA 1DLOA 4DV1F 3RBZA 4JI2K 3HJVA 3SAHA 4GKKJ 1CJVA 2J6TA 1UEUA 2QK9A 2F9DA 4B3RK 2WB1D 3IA0A 3AD8C 2MQQA 2FSKA 2YX6A 1V5IB 1RWPB 3AO1A 1AW0A 4FJIA 2W7PA 2FJVA 3DDNA 1X7VA 2DH7A 1KLMA 1ZAVA 3NS5A 3ULEA 4YN3B 4JI5F 2HW3A 3G8SA 2HG4A 1IM6A 3TTFA 3OYLA 2LCWA 3O5BA 4GVBB 2R8IA 2A6MA 2XS2A 1U02A 2NSCA 3A4TA 4PG6A 4ED6A 3ET6A 1SH3A 3SMPA 3OYIA 2VKRA 3GV8B 2RRBA 1TUYA 3K5LA 2ZQBA 1LWEA 3LWMA 3UQSA 3U6FA 4M41A 4KQZA 4ID5A 1HL6A 3E66A 3VQTA 2F40A 4OJGA 3PSIA 1UL3A 2KVQE 2FY1A 3M2RA 3PYGA 5BN9A 3MMBB 5A0YA 1H0HB 3PYDA 4B9VA 2QKBA 1N5SA 1FD2A 2J0WA 5IC6B 1HPZB 2VL1A 5AQZA 3PACA 4M5JA 2O8FA 2GHPA 4PZVA 2EG2A 3JAMY 3BR9A 1L3VA 2OFHX 4I2PA 3RYLA 5L1LA 4CJ4A 3MM7B 3K59A 5KFWA 1YRTA 1MN9A 1WKJA 2MHEA 1QDUB 4JRPA 4LQ3A 4G1IA 4F4XA 2JOQA 4K42A 2GC8A 4JI1J 4UF4A 1VQNN 5KG5A 4R8UA 1XMQF 3AARA 4JV5J 3G25A 1KQKA 4DSEA 2NS1B 3UN5A 3R1LA 2FVCA 1GX6A 3B8AX 4C11A 4ZP8A 3PJXA 1JXEA 4DPUA 4CEZA 4B9NA 4KRWA 4N8NA 1RABB 4BACA 1OPZA 1UTAA 2NRRA 4K0KJ 4QU6A 1QHTA 5KFIA 4YOWA 1C4CA 3R5CA 2ZFHA 2M8HA 1IG9A 1Q8LA 4V19J 3VCDA 1B7FA 4HACA 5IM0B 4I56A 3QWPA 3AGKA 2NYIA 3EUNA 1LFPA 2HGLA 2ZJPQ 3MPYA 3Q22A 3GILA 4W5NA 5FD1A 5FDLB 3DRSB 3O1BA 2BJ1A 3H5YA 1KVBA 5A2QY 2WC9A 3PX0A 5K9FA 3VPZA 4WFZA 2PN6A 2ATCB 2VOOA 3EL2A 4Y2CA 4LSNA 3K8WA 3ZTQA 5MLCQ 2AT1B 1NGJA 3GV7B 2L3MA 2F7VA 4K8RA 4CFAA 2QTDA 1H38A 4WJBA 4DUZF 3OQ2A 1URNA 1HIYA 3AVCA 3NRBA 1VRUA 1JKHA 3TU5A 4QIWD 1NJYA 4CK1A 4USJC 4FJ7A 4LF7J 3GL1A 3SQ0A 3V9UA 1W2IA 3N6LA 2CPJA 2RU3A 2XLKA 1ZA2B 4JV5F 3O6WA 3HOTA 2HBJA 2DY4A 3VWSA 1QSLA 3M2VA 3MEGA 4ZPWR 2CGLA 3BZQA 4LJMA 2MQPA 5AQFA 2Z30B 4AD6A 4DU4A 3ATUA 2UXBJ 2C2ZB 4CEBA 3AVNA 4JN4A 3BYRA 1S0OA 3P6YC 5AQWA 5DQHA 2YX7A 4B3RJ 1NUEA 3D67A 5LM7E 2ZE2B 4BG8A 4RNFA 4O3OA 3KKFA 4H4KA 5C2GA 2BV3A 2HQDA 4BR0A 4EHUA 3D66A 3VQDA 2K2PA 4CERA 2QTWA 3K5MA 1YZ7A 3O8MA 4IO8A 5KG7A 4CGGA 1BISA 2QLFB 1T9TA 1VRTB 3V2UC 1WHXA 3RVCA 4BC4A 2OPRB 3PR5B 2KT2A 5FPEA 3OTOF 1RDCA 1GLFO 3MDQA 1FTRA 3VQCA 2WBNA 2H3EB 5LMNF 1UW9A 1LKZA 1WOSA 1Q7LB 3O6QA 1GAOA 3U3GA 3BJYA 3BZKA 2F4VK 1NMEB 3OTOK 4B3SK 1RWVB 1LW2A 4ETXA 4X64K 1IQZA 3T3FA 4ILRA 1C0TB 2XULA 3R9PA 3W3DA 3S41A 4B02A 4RPFA 1UZDA 1Y5NB 3SIPB 1IH7A 2CQ2A 1CJUB 1UPPA 4ID8A 3OVAA 3CFOA 5JLHA 1JK9B 2HSEB 5CCMA 2NRZA 3N0VA 3JQMA 2RU9A 4UOHA 4QOZB 2QI2A 5GAEP 4P6QA 1LK7A 3VQAA 3VGLA 4WBFA 1WSFA 3N9UC 4DOZA 4C48A 1NKEA 1SQGA 5F8IA 5IQQA 2VA2A 1ZM2A 3DOKA 1U2CA 1SJ3P 4OPKA 1MWYA 3NCRA 1HNIA 2VBYA 4DHYA 1UFLA 2VG7B 2A40A 4CZIA 4OV1A 3ATVA 3LW5C 3NGRA 1T11A 4KGKA 5KFQA 3OVBA 1S57A 2OTJS 2HHTA 4GO5X 5C10A 3AJ1A 3BBFA 1LOUA 1GT8A 1NZ8A 3MR2A 2N82B 2XZTB 1T3VA 1N33J 1MN7A 3NF6A 4IKFA 1RWUA 3P4UB 5CR4A 2EI5A 1RUSA 3AVGA 4TQRA 1BDGA 3L95X 3VETA 5KPZA 2VDIA 3B82A 4C8MA 4QJVA 5HP1A 2GO8A 2ZWOA 1XERA 2ITGA 3AJDA 2QV6A 4FWRA 2QWRA 1NPPA 3C19A 1FJEB 4PWWA 3P3DA 3NAHA 3VZHA 4C2MA 2L41A 4JKEA 4NI2B 2FGCA 2EFOA 3NGYA 3VQBA 3LDPA 1BD6A 3S7RA 2OEMA 4I9LA 2HBZB 2EFNA 3FZLA 3TUPA 4CWBA 4C3KA 4YUDA 1X8DA 4YFUA 2FBVA 5KT3A 4H0TB 3CDUA 3HD1A 2CQ0A 2MHNA 1ZBSA 5CAAA 3NS6A 3NE6A 2POKA 1S1VA 2M70A 4JB8B 1RT7B 2IAJA 4HUEA 4CGFA 1KC8T 3SNNA 4LF9K 4DR5K 1FNMA 2Q0UA 3QRQA 4QBUA 4I7FB 5E26A 4PG4A 1F3FA 1T9WA 4P72A 3GONA 2XYHB 2Z2LA 2IVMA 3CIMA 1S0VA 3TAGA 1OYEA 4DV4K 5HRPA 2AYGA 2O01C 2JLEA 3VV2B 4IOAL 1WI6A 3O3FA 2VDHA 3PTWA 2YKNA 3M8PA 1WSGA 4F67A 2CUYA 2V7YA 4MK9A 1GOCA 2HLTA 4ELVA 4L8RB 3JAMU 2MZ1A 2J9DA 1FRMA 3M1VA 4GVBA 2GAGC 4RU2A 1JLQB 3JS6A 3QJPA 3VQEA 3FBCA 4IOXA 3PJWA 3NCPA 1OVQA 1U0SA 2CADA 3ILOA 5KPRA 3DRRA 5KG6A 1B92A 5EHHA 1I6JA 4E2FB 3H3OB 1QY7A 2AGOA 4KIAA 2J7WA 3UCGA 4CDIA 3IR6B 1NHUA 2GJFA 2KG0A 2HWIA 2QMXA 3OFFA 3OR2B 4CBUA 1X4AA 3ZSWA 1VRQC 2Z57B 2ZH1A 3FCVA 4J2EA 3ISZA 3H45C 4Z4CA 3R6GB 1YHQN 4LSLA 4M5LA 3NVMA 1PYSB 1RZMA 3IR5B 2FYXA 2ZC4A 4JV0A 1L3SA 2BABA 3I8DA 1LQ9A 5C2DA 3OYAA 3FEZA 1Y11A 1TL7B 2J0SD 1GOAA 2HK2A 1NOYA 1HLUA 3MR6A 3L6QA 4XK8C 4OZ3A 4IFYB 3AQPA 3CJ2A 4DR2F 3W5ZA 3FE1A 4E0DA 3HPHA 1NJZA 1HPZA 3TVZA 4BVOA 1OMSA 2KN4A 2HHQA 1FKPB 4NRTA 5E3CA 3CDWA 5L9NA 3M1VB 1BCMA 2E88A 1VISA 2F63A 3EDQB 5AXNA 4QW8A 1BY9A 3CW2C 2E1CA 2XMMA 2HHPA 3AXMA 1YG0A 5AZJA 4CJQA 3BO2A 4PWUA 4ED0A 3ULHA 1VQ9N 1S1UB 1RP5A 3O4WA 4R8UB 3ILIA 1UFWA 3B6PA 5AJ3K 2CQBA 1FKOA 2HLUA 3MOZA 2AYMA 3OTEA 3E1YA 3OVSA 3U8XA 2FPHX 5BRFA 1PC5A 3CJ0A 3CQXA 4O3PA 3ICLA 2ZHAA 5AQVA 5KFNA 2JJ4D 1AB8A 2HS4A 2C3MA 4A62A 1JJHA 4H5VA 2V2ZA 2FJWA 3O1LA 4FXDA 4FLYA 4LF4J 2DGUA 4ECZA 5DO2A 4V1Ak 4DB3A 5IQ6A 4KBOA 1V9OA 2R42A 4URSA 2MJNA 2C2EA 4R0JA 4CCHA 1NPRA 2ZVIA 1D9DA 1N36K 4RL1A 3BGUA 1M1KO 4U95A 3L4IA 2DY1A 2AYBA 3I0SB 2YX4A 5FIIA 3FK4A 2NCKL 3MEGB 4F3TA 5TKWA 3BGFA 4DG1B 5C2CA 4B3OA 3L09A 1VAZA 5DG7A 4PEOA 5ETRA 4GMJB 3ZSRA 2BM1A 1MMDA 3MR5A 4X4NA 2NLWA 3U27A 4E7LA 2YWEA 2JNJA 3DGPB 3BEXA 4AL7A 4WZMA 3VALA 2RQ4A 3DAWA 1NLVA 2DTUA 2HAIA 4DV2K 1NKCA 2FVSA 3VQ8A 5M2RA 1RDDA 1RHRB 5AQOA 1TK0A 2DCUB 2UYTA 2XY7A 1DKGD 2EKYA 2AJFE 2PO4A 3T9ZA 4JI7F 2ZGZA 2FC8A 1M5VC 1N8RO 3PW5A 3SUPA 4IG0B 5K14A 4LVOP 1UAWA 3L0QA 3QFPA 1VR6A 3L4BC 1IKVB 3A5LC 1R8CA 4QR1A 2APOA 1VSFA 3AD7C 2DRBA 2GFFA 5KI6A 1MU2A 2H4YB 3EX7B 3Q8VA 1Q53A 3PHEA 5E41A 4NASA 4FW1A 3DLLQ 3TZZA 2KZMA 4ZITA 3D6RA 1A0OB 2Q1NA 5ETLA 2HSTA 4DSFA 1X9MA 2BJEA 4BHQA 4E89A 2DD8S 3R8YA 4K25A 4KY3A 3A5NC 3EN9A 1S1XA 4QWAA 2W4CA 2WB4A 4FYDA 1RKIA 4YY3K 1GTHA 3J7A1 3KVGA 1A5VA 1MSWD 4Q43A 1RTDA 5C7PA 1F5AA 3GLJA 5HLFB 1J6ZA 4KO0A 4CK3A 4DR6J 3G9CA 3M30A 5KT7A 2A42A 3V81B 2COLA 4TKTA 2FIUA 2XZDB 4MLEA 2RHQB 2GVZA 2OIHA 1PBAA 1J54A 2E5LF 4N5SA 2KG1A 1BLUA 2B4PA 1A7GE 2RJZA 2PFUA 1S97A 1OSCA 2X1FA 1TKDA 1NK6A 5F0XA 2ZH8A 1Z25A 4NL5A 4OYPA 1IBKK 3J7YP 1FXLA 4OI3A 5LMNK 2GQQA 1S22A 1WSIA 1ILYA 1F60B 4RW6B 4M1KA 4DCJB 3HZEA 1HPMA 4A8YA 2VQEK 4DS5A 3VGMA 4FLXA 1QQMA 4CLFA 4NZ7A 3G6VA 2FHMA 1GTEA 4CGHA 1HNXK 1Y64A 3MR7A 3FBEA 5LSRA 4J9NA 3MXIA 3T1HJ 5EGYA 1SL0A 2J7UA 1VQ4N 4CEOA 3KDOA 2HBYB 3ONQA 3T69A 3RMCA 3H1QA 1H2TZ 5IT9O 3M6GA 1SS6A 3LQVA 3IUCA 3MCAB 1JLQA 2J7KA 1WSEA 2L9DA 2R7WA 2ZZTA 4FJ8A 4DV0J 5JS2A 1HJOA 2JZ5A 3PIPL 1Z6RA 4Z37A 4NXMK 1KQGB 1CC8A 2KLAA 1IBCB 1FF2A 4AYBD 1IKWB 4YHHK 5F41A 4DPWA 3VERA 3ZT4A 2UXBK 3WX8A 1NSQA 3QAEA 4B9QA 5KFCA 3MM9A 2Q66A 4FM2A 4JKBA 3SV4A 1JLBB 2EBGA 3F5TA 4WE1A 1D09B 2K8GA 3C6UB 2AJ2A 4YY3F 3I4HX 3CCZA 3T1YJ 1H1VA 3CJ7A 2UXCK 2H5EA 2DHSA 3TWZA 1QAXA 5JUMA 3HT0A 5AQQA 3L3CA 4KHNA 4PWDA 4X66F 4CFDA 2O67A 4XDDA 3V9SA 2K7JA 4ED1A 3HHLD 1FTCA 5ETVA 4S0MA 2IAJB 1NCLA 2QLWA 3V9ZA 2HFUA 3P38A 1VJQA 4G6VB 1WSRA 1KP6A 5I3UB 1J2VA 4O44A 3EZUA 2D3O1 1WG4A 1C1CA 1BXNA 2XZWA 1RT3A 2PA3A 1R8PA 1EARA 3I8BA 3ENBA 3MI7X 5CZ1A 2JH3A 1WSVA 1YHQS 2ZH6A 3HZ6A 4B8CA 3EE9A 4H0VB 5AQNA 2N7CA 4A2BA 3K2YA 4HHTA 3TAMA 3K89A 2RSQA 4K4TA 4JBCA 5KT5A 3MM7A 4DX5A 1YZ6A 3US5A 1Q5VA 1CLFA 3WBZA 2CQ3A 5DQGA 3BEGB 3QO9B 1SKSA 3OSNA 3HLUA 5C5JA 2LECA 3O3GA 2P9PA 3N5FA 1R0AB 1B0PA 2HHVA 9RUBA 3TJAA 4RZRA 1BI4A 4CO4A 5DM6Q 5F9LA 2YWGA 4LF6J 2M7SA 4FCYA 2OANA 3OLBA 1QTMA 2YJEA 4TN2A 4YY3J 2B3TB 5GADI 1VQ5N 4X65K 3MAAA 2P9UB 1TL3A 4I2PB 4X65J 1DAXA 4P7VA 1I1GA 5KFFA 1WOPA 5EDWA 4NLRA 4OI6A 4USIA 2GIRA 2A1SA 4OYXA 4OZJA 2H9ZA 4K2XA 3LGHA 1YJ9N 4HTUA 2BZ2A 5BRHA 4WFBQ 3M8SA 2LEAA 4LRDA 3HL8A 3JXOA 1SVDA 1IM4A 4KKOA 3K17A 1R0AA 4DMZA 2YNIA 8RUCA 4CF2A 3H3NO 3CC4N 3CVKA 2BEFA 2CPYA 2P2CB 4QYZJ 4ZVFA 2XEXA 4Q0BA 3CEDA 2R7SA 4W5TA 1GLBG 4IYQA 4KREA 1HHTP 5F3TA 2BR0A 2W9CA 4CNZA 3CCRS 2EWHA 4B3MK 1CULB 4O5BA 5AJ3F 3K5NA 1HR0F 3VTIA 1VRUB 3M1FA 2XC9A 3C16A 3WC2A 2IHR1 2K7KA 2C3PA 1WTFA 3NGZA 2JL9A 3DRYA 1BOTO 1RISA 3HF5A 2CH6A 1CG2A 3HZGA 1BWEA 5BPMA 3IAYA 2V50A 1FT8A 4LF2A 3GFZA 1JWWA 1VSLA 2ASDA 4B9LA 2X7IA 3QEXA 2YNFB 4FJ9A 3DJCA 2OTJN 2CXEA 3W0LA 2AJ0A 4EP5A 2UU9K 4JI2F 3FEYB 3H6EA 2B0GA 4L72B 3B8HA 3ZETB 4K8XA 4BQZA 2JEFA 3LAMA 2HRUA 4OQJA 4OZ5A 3OA9A 3CCSN 4NLPA 4BRAA 2AF6A 4N7TA 1RI7A 1T03B 1UP1A 4LIRA 1WHVA 1SJ1A 1RDRA 3BPDA 4FPAA 5IWAF 5GAHU 1HWKA 1RAGB 2E5JA 1H72C 4UT4A 2O8EB 2IM2A 5H1SV 4FJLA 1HBOA 2IVPA 4LRAA 2XNRA 4IKAA 4OHWA 2JSXA 3A3OB 2RDIA 2MZJA 5HJYA 2QJ3A 2Y1JA 3CMAS 3WXMB 2JC0A 4DR1J 1GLDG 2ETJA 1W2BM 1CULA 1WAJA 3H90A 4K4UA 2ZEJA 4ZKAA 4J9VA 2J6SA 4JKGA 3D2EA 1BL3A 4HUGA 3DHWC 2G8KA 3G0ZA 2EC2A 2XCPA 1BWFO 4RNNA 2JVOA 2D69A 4BS2A 4CD1A 2O8DA 4ECQA 1RHUB 4PKIA 4BC7A 2UUBF 5EVZA 1V3RA 3BH7B 4ISGA 3CJKA 3FGUA 1QTNB 4PL7A 3HSCA 5HMYA 2UUAF 2ATLA 3S3NA 2F8MA 3MPWA 3W65A 1SI9A 2XLIA 3RW6A 4AL5A 4ISEA 1PJ7A 4BRFA 3KDNA 3RMBA 3MM5A 4X4SA 3H2VE 3IR7B 2R7TA 5TKYA 4MAKA 1VQ6N 4C0BA 4GKKK 4M3YA 4DV0F 2I5JA 2HEKA 3FFKB 4DR1K 4J9MA 2Q6BA 5HK4A 2RMLA 3TPQA 2C2NA 2CNOB 5LMUF 1QAIA 3M8ZA 3FEXB 5G4DA 3KG0A 2I0XA 3QEWA 4CH7A 4CZJA 1VFJA 2K06A 1T95A 2OO4A 1FW6A 1S72S 3CSKA 3NNAA 4LFBJ 1SQEA 3DXMB 3O3HA 3UO0A 1TAUA 4DUTA 1ELOA 1NJXA 3OXFA 4IRDA 4IG3A 2GZOA 3UPFA 3K57A 2Q0RA 5CD4H 4DL3A 2IMOA 3WXIA 2ZD1B 4IRKA 5ETOA 1GXLA 4RNHA 3MWTA 5ETPA 3CPWR 1NGCA 2Y1LB 2GIQA 2OGUA 3BZCA 3OTDA 3DNCA 2A6OA 2XY6A 5JICA 2V9KA 1NBWA 4LY7A 3KHYA 4OJ1A 1FJGK 3KLEB 1J5EJ 2FF6A 4C8NA 5LSLA 3Q8SB 1P1TA 2HS0A 1RYRA 4DZ6A 5J1EB 2EWSA 2C2OB 5K8NA 2JWNA 2IVFB 2V63A 4ZVHA 1E4FT 1UJ4A 4NLQA 5HBMB 1LW2B 2GA7A 2L48A 2VYPA 1RSCA 4M63C 4XH1A 2UU9J 2VC0A 4L74A 1RAOA 1Y3JA 1NXIA 1WC1A 2XY5A 4WFAQ 3FZ2A 2EKNA 1EB0A 5K8OA 4ZK7M 1XNRK 4EFAC 4CJFA 3SAGA 3QO9A 3HHNB 1U24A 4W90B 3NGKA 3O2IA 4QS9A 4HDHA 2UXCF 2QA1A 1RT3B 1WTBA 3CFPA 2N7YA 4WQ5A 2WOMA 1XC9A 4FF2A 3HFKA 2BW2A 1BO5O 2IRXA 3C46A 2DHAA 5F0UA 3CCVN 3T6JA 1FI4A 4GKKF 9ATCB 4FN5A 3SQ2A 4J37A 1RHJB 3BGLA 2JDJA 1JJ4A 4A57A 3LM9A 2RS2A 1NK8A 3GCWP 3NOCA 2QWLA 3UNYA 3SJHA 3G4SS 5AT1B 5AQTA 3ET6B 2KXFA 1S9EB 3IAS9 1X60A 3DOKB 1Y4ZB 4BRNA 3RG6A 4CEDA 1ATSA 5T7LB 3KJVB 5KFEA 3HFVA 2F4VF 2CVEA 2DVIA 1RKJA 4WKRA 4MIWA 1UVKA 1HBUA 1P8ZA 2HURA 1UJ6A 2DIUA 3AVMA 3I82A 1S10A 3LM2A 3IMQJ 1NGDA 2RQKA 2QEXS 3PX4A 1AUDA 3MMCA 3T1YK 3DLHA 1NGAA 4X4PA 4OHXA 2JWKA 4EIAA 1YVNA 3P31A 2PGCA 2CFXA 2VHGA 1CJKB 4EYIB 3OYMA 1JCFA 4NXMF 3Q24A 2IIHA 3BSAA 4RR5A 4B3TF 5F0WA 3IM8A 3QIOA 3O1WA 2D9OA 4FZVA 4FM0A 4PG8A 1TUWA 5T14A 3DMJB 4H4OA 2CKWA 2VQFJ 2YHWA 3KJVA 1RU1A 2Q43A 1N36J 4FOIA 1W0HA 2CYYA 5KRTA 4FM1A 4Z0UA 1FE0A 4K2JA 2V4RA 4FWQA 3JSMA 3UCUP 2DGOA 3LPYA 1TFWA 3C15B 4DF4A 3ZSXA 3V9WA 1RA6A 4F3QA 4I9QA 1RWKB 1N34J 2HHSA 2ZVSA 2F8SA 3H98A 1FEHA 3QFWA 3I31A 2BH1A 4I64A 1OH8A 3KIOA 2M4MA 2IVOA 3VVUA 1NLKL 2IPOB 4X65F 4U67Q 2IJFA 3MN9A 1C1CB 4YHHF 2D1KA 3TUIC 1HR0K 1APSA 4A8OA 2CQDA 4Q8FA 2E5HA 3TAMB 5DDOC 5CHIA 1FKOB 2V52B 5LY3A 3KLVA 4DUYF 1YJ7A 3CMAN 7AT1B 4F26A 3R5BA 4GVEA 3D45A 4B1VA 3ZZRA 3PV8A 3FZKA 2DH9A 3ZZYA 4PQUB 4IJAA 4A8MP 3UVJB 3AXKA 4DDFA 4JI0J 2CJBA 1TMMA 2EC0A 4LF5K 2VWBA 3Q89A 2QWPA 1YK9A 4ITSA 2CDQA 4KGMA 2I9SA 2WBRA 2O8DB 3HK2A 3D6FB 2D41A 4EBCA 2NRHA 2Z2MA 4JI6J 2D3OR 4RW9A 3SSQA 2NUHA 2YXLA 4OPHA 1WHYA 1FDBA 2CDRB 4PPZA 4ZLPA 3TSPA 4UOFA 2I6WA 4QIVA 5DLFA 3NGSA 3W2WA 3NNCA 5KFXA 1HX1A 4DV5J 4EFHA 4KPYA 1QSSA 3CJKB 4YOTA 2G8HA 4TY8A 3RU0A 3ZCMA 3K8VA 5AQSA 2QW9A 2FJDB 3J81j 2NSBA 4DR5J