1IKYA

Hiv-1 reverse transcriptase in complex with the inhibitor msc194
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 155
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikyA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikyA05
3OYHA 3CJ2A 5KRSA 1QTMA 3H5YA 1SUQA 4ZP7A 4B8CA 3RMDA 1NK7A 3GV8B 1NJZA 3GQCA 2OPPB 4R8UB 1RT5A 3ZSYA 4C8OA 4B9VA 1LW0B 3SCXA 2F8EX 4O3PA 4CJKA 2HHWA 3NF9A 4K4WA 4DFKA 5EU7A 1TL1A 4E19A 2ILZA 3KKSA 3MR2A 2P5OA 4O3NA 1JXEA 3OYDA 2E6LA 1RT7B 5F8NA 4JS5A 1WSIA 5HRNA 2YNIA 2C22A 4Q5VA 1WSHA 2J6UA 2D0BA 3HO1A 1JL1A 4M3ZA 4RW7B 4MK7A 4BACA 5I3UB 4CFCA 1NK0A 2IOCA 2R8KA 4FS1A 4E7IA 3IN5A 4RW7A 5KFEA 1FK9B 1BI4A 4Y1DA 2OPRB 5I3UA 5KG6A 3QNOA 3QEPA 3PJWA 4O3SA 4DTXA 3OYKA 4FBTA 2AX0A 3P1GA 3ZSOA 4C8KA 4KBIA 2ITGA 2HHQA 1S5JA 3K57A 3V9WA 4DL2A 3NAHA 4CE9A 4OGCA 4BDZA 4EO6A 1C0TB 3NF7A 4DQPA 5I42B 4I7FA 1CSJA 5HP1B 3KK2A 4J9PA 4GVMA 3AA5X 4ICLB 1EP4A 4AHRA 2R2TA 5HROB 3AVFA 3IG1A 2KTQA 5I42A 5HP1A 3SI6A 1RT2B 1D9DA 5KFMA 5J1EB 4ICLA 1S1VB 2RDJA 4EBCA 3CJ3A 3F73A 2XHBA 1RT2A 4DEZA 2BRKA 5J1EA 4OLBA 3KKRA 3SV3A 2W9AA 3U3YA 4DSLA 2VG6B 3ZT3A 4W5NA 5C5JA 1TK0A 3MXJA 3V6DB 3NGIA 1QSLA 2JC0A 2HHUA 4FM0A 4XIUA 4PQUB 2BE2A 3DLKB 3V6DA 2RF2A 2KFNA 3KNAA 4MQ3A 4KB7A 3NL0A 3L8BA 4PQUA 1QS4A 1S1WB 3HM9A 3FQLA 1YVUA 4J9SA 3UDLA 4KKOB 3SYZA 4KTQA 3VQQA 3NH2A 4BE2A 4MIBA 2VWKA 4ED2A 4XPEA 3PJXA 1S1WA 4KREA 5KFLA 4QOZB 1HMVB 2DPJA 4ELUA 4CGJA 5KG7A 3BSOA 4K4ZA 1GOCA 4FLZA 3MEEB 1S1XB 4K4YA 5KFUA 3PW7A 2JEGA 1EX4A 2UUTA 4I2QB 3ZCMA 3BJYA 3OS0A 1HMVA 1HQEB 3K5OA 1N5YB 3NMAA 5L1LA 3MEEA 1SH0A 1X9MA 4I2QA 3JYTB 3VN5A 1HQEA 5KFPA 1CLQA 2DFEA 3DLGB 1JLAB 3AVCA 2HNZA 3KD1E 4NLOA 4B3OA 4ECRA 1NK6A 3DLGA 4B9MA 1JLAA 5DQHA 3CJ4A 4Q44A 3I0RB 4QWBA 1EXQA 3QEVA 3PV8A 1L3SA 3BSNA 2HHTA 1L5UA 5KG2A 1KLNA 1TKTB 5DMRA 3I0RA 2IS3A 5J2QB 4FYDA 3O3FA 4YR0A 1TKTA 2I5JA 5F9NA 4WE1A 4PUOA 2BQ3A 5J2QA 3QESA 1KHVA 3OSNA 3ZT1A 1D8YA 3KK1B 5JXSA 3T5KA 3SUPA 4NCBA 4TQSA 1VRTA 5CYQA 4ECTA 4HUGA 5L9XA 4Q45A 1VSDA 1T03B 4URGA 1RT4A 2KW4A 4I2PB 3KK1A 2C2RA 4M94A 2RPIA 3BGRA 1I39A 2JC1A 1T03A 3SV4A 2F8SA 3KLVA 4J9QA 3NHGA 3RWUA 2ATLA 4J9RA 1J53A 3H59A 2IM2A 3OY9A 3PX0A 3S3OA 4IKFA 4LD0A 5DGBA 4OLAA 1X9SA 4CEDA 3PW0A 3C94A 3RTVA 1JLCB 3EPGA 4ZMMA 1S1TA 4BE0A 1IKVB 5KFJA 4B9NA 4DTPA 3KLHB 1JLCA 2BDPA 1CZBA 1BCOA 3LWMA 1S9GB 4LH5A 4ZVHA 4NLYA 3I5AA 2UUWA 3HPGA 2UVVA 1IKVA 4GC7A 1S49A 4O44B 4HYKA 1YT3A 1TKXB 3PW5A 2D3UA 4IFYB 3VQ6A 3QNNA 1S9GA 4Y1CA 4DLGA 5CZ1A 3K5LA 1S48A 4NLGA 4WFYA 2O4GA 1OS5A 3KLIB 1B9FA 4E1NA 5F8MA 3KHLA 4IFYA 4KSEB 3CJ5A 1QE1A 1Q8IA 1LWEA 1C1BB 3T19A 3K5NA 4DTOA 4DWIA 1S6QB 1I6JA 4DLEA 2ALZA 4CJLA 4MK9A 5KG4A 1IG9A 4RUAA 4EO8A 2BQUA 4F4ZA 1QAJA 4L8RB 4TYBA 4J2EA 5F8IA 3SZ2A 5L1KA 4O4GB 2YNHA 1WNSA 2W8KA 5DK5A 1JIHA 3AVNA 4EBDA 4DSKA 5C42B 4BWMA 1S0NA 2XC9A 2HHSA 1MU2A 1JXLA 3L3UA 3DRPA 4IRCA 5FROA 5DQIA 4FLVA 3I0SB 4CJ4A 4IH6A 4DQSA 1GOBA 3K2PA 4FM1A 2FBVA 2FBYA 4KB0A 3CM5A 2ETJA 4GC6A 5KT7A 3ULDA 3QGHA 3HYFA 3HVRA 4K8ZA 4F4KA 3GIIA 3BREA 2OA8A 4RW4A 3EYZA 4J2DA 2WTFA 1J54A 4FJNA 2C2EA 4PA1A 3ZSQA 1NK8A 3DLBA 2YKNA 1RTDB 4CFDA 3AA4A 3V6KA 1KVBA 1YTAA 3LP0B 2GIRA 4E89A 2XO7A 2HNYA 5J2MB 4Y2CA 4KHSA 1FXXA 4OKEA 1T7PA 4ZPCA 1A5VA 5SWMA 4BDPA 3QEWA 3T5LA 3LP0A 5HRSA 1RBRA 3CDUA 4RNOA 4Z4CA 1RDCA 1GX6A 4I9LA 2HMIA 5KT3A 4DTJA 3QO9B 1FKOA 4URQU 3IRXA 4ECQA 3QLHB 3DLEB 3HHKA 3LWLA 1SV5B 3ITHB 3M8RA 4CEAA 1LW2B 3E01A 1VSJA 3BQ0A 2E9RX 4E3SA 3QO9A 5HRRA 3QLHA 3DLEA 3LP2B 4LSNB 3ITHA 1LW2A 3UR0A 3V4IB 3KLEB 4C8LA 2DPIA 1VK0A 1Y97A 3SPZA 4ED8A 3L3VA 4DL3A 2CKWA 3I8DA 4LSNA 1C6VA 4CEFA 1O1WA 3TABA 3S9HA 3HVTB 3OYNA 5C24A 5DLFA 4HKQA 3MECB 3V4IA 3MR3A 3LANA 1VRUB 4AHUA 3ISNC 3M9OB 3SUOA 4KRFA 5KFGA 3SFGA 2DFFA 4ELTA 3HVTA 2FJVA 3M8PB 5D3GB 4CEBA 3TAGA 1NK5A 2PYLA 1TL3B 4Z4HA 1FKPB 3AVBA 4DTSA 1TAUA 2EC0A 3DRSB 3ZSRA 3M8PA 5D3GA 2P1JA 1TL3A 4IFVA 3VQPA 3FDSA 4O0IA 2HB5A 4CGHA 1XWLA 4N56A 4O3QA 5F8GA 1WAJA 4DL7A 4FJHA 4CJPA 1ZBIA 2HWIA 3MXIA 3FSIA 2WB4A 4HTUA 3SQ4A 3QYYA 4K4SA 4J9MA 3T3FA 4Z4FA 5J2PA 5DG9A 1ASUA 1RT5B 5EWEA 2P51A 4H4MA 2E4LA 4IRKA 2AQ4A 3KMQA 5HLFA 3LPTA 2FLNA 4KI6A 1MMLA 1UA1A 4IRDA 1VSHA 3H2LA 1TL1B 1QUVA 3RB3A 4Z4GA 3RMCA 1RDDA 4CJFA 1C0UB 1IKXB 3G0ZA 4Y3CA 3RRHA 2Y1IA 4CJEA 4CHYA 4C8MA 4DS4A 4FLTA 4QWCA 1C0UA 1IKXA 4NLRA 2YNIB 3CG7A 1NJXA 3T1AA 2A1SA 1JLEB 1XR6A 4RU9A 3RMAA 3IGVA 4B9TA 1S10A 3OYLA 3NH0A 3AO2A 2J6SA 2GUIA 3HPHA 4IBNA 1ZETA 1JLEA 4CJWA 1SH2A 4W5QA 2ASJA 4WZMA 4J9OA 3DRRA 2D5RA 4FJKA 5KFWA 3HJFA 4ID1A 1S6PA 1BI4B 3QIOA 3MF5A 3LALA 5F8LA 3AA3A 3OYFA 4MKBA 1NKCA 1C0MA 3LAMA 1RDRA 3C6TB 2ATQA 4NLTA 4CGIA 3CWJA 1NOYA 3B6OA 3Q8RB 2R2UA 5KG0A 1W25A 2V9WA 3LDSA 4KTZA 5J2NB 4I7FB 4ED1A 3KK2B 3OL8A 2HW3A 2YKMA 4NLSA 3TAPA 3C6TA 2OPQB 4DFMA 4GW6A 1EP4B 3IG1B 5J2NA 4KHRA 3C6UB 1Q9YA 1JKHA 4BWJA 1EETA 2G8KA 2OPQA 4KAZA 4CJQA 4FXDA 4N47A 4IQXA 1RAJA 1NHUA 5KGWA 5KFTA 2AGPA 3C6UA 3TQ1A 4DSIA 3LZIA 4Y2AA 1TKDA 2F96A 1SL0A 2VWJA 5KFKA 1BIZA 1LWFA 1VSLA 2IDOA 2QKKA 4M3UA 2DY4A 1U45A 3NF6A 4HVJA 2YNFB 2FVSA 3HPOA 2B4JA 2IC3B 1SL2A 2FVCA 5KFBA 4HHTA 2BE2B 3F9KA 4NLDA 1JLBA 4M3TA 5EWFA 1LWCB 1IKWB 2RF2B 4FLYA 2YNFA 2IC3A 1HNVB 1IM4A 3NH1A 2WHOA 5FRMA 2HHXA 1T3NA 1QAIA 1LWCA 4QWEA 1IKWA 3ZSWA 4YNQA 3CJ0A 5HBMA 2X6SA 3QETA 1S9EA 1HNVA 2JGUA 2OZSA 3NAIA 3KD5E 4KFBB 1WSEA 1NNDA 4NCGB 1YTUA 1U09A 3Q8SB 3KK3B 4J9NA 4LQ9A 3SUQA 2VG5B 4KFBA 3V81A 3BQ1A 3V1QA 1QSYA 2WOMA 4NCGA 2QE5A 4ZPAA 3KK3A 3HK2A 4M42A 3O3HA 2VG5A 1W0HA 4TQRA 3DYAB 3SFUA 1IKYB 2W9BB 2OZMA 4ZTJA 1KFSA 4EP5A 2PY5A 2E6MA 3DYAA 1IKYA 2W9BA 2HNZB 1WAFA 1L3VA 2OPSB 4J2BA 3MEGA 1DTTB 4B3OB 5CZ2A 3TWHA 4XPCA 4WXWA 2GV9A 3GV5B 2JEFA 4EYHB 1RTJA 5EWGA 4QW9A 4FZZA 2OPSA 3QERA 3L2RA 1DTTA 2IMWP 3FRZA 4KAIA 3GILA 3QZ7A 4KE5A 1RT6B 4ZVFA 4M45A 3E51A 2V4RA 3NE6A 5KT5A 3DOKA 1L3UA 4OL8A 4EP4A 1BGXT 2XY5A 3HVAA 2HVIA 1RYSA 3PVXA 3LAKA 3PX4A 4FK4A 1RT6A 4TYAA 2I5JB 2BQRA 2O4IA 3Q8PB 3UPFA 4FCYA 4WE1B 2BANB 4PUOB 4H8KA 2OYQA 1JLQA 4WFXA 1U4BA 1SKSA 4EZ6A 4CK2A 4C8NA 4IR9A 2NUBA 1HARA 3H4BA 2Z1IA 4KHYA 1HYZA 1VRTB 5CYQB 3S3MA 2BANA 3DMJB 5KRTA 3AO5A 1RT4B 3RR8A 4RNHA 3GIMA 4NRUA 3KHGA 4AHCA 3BGRB 3TARA 2HAIA 3DMJA 2WONB 4M41A 4LQ3A 4ZPBA 4NYZA 4W5RA 4CF9A 2B6AA 1VSKA 1T05B 2RKIB 1TK5A 1QQCA 4ZVGA 2WONA 3NCIA 4DL5A 3VQCA 1WLJA 4JV0A 1D9FA 3VA3A 3OJUA 3UIQA 4CF2A 3HP9A 2I1RA 2ILYA 2J6TA 1S9FA 4EZ9A 1T05A 2KZMA 1DTQB 2RKIA 1LAWA 1BIUA 3RBEA 3PX6A 1S1TB 1ZBHA 3MXMA 4U7CA 2EHGA 4NCAA 1VSMA 1DTQA 1D5AA 4FLXA 5KFHA 1K1QA 1BISA 4CF0A 1GX5A 1W9HA 3O4QA 4MH8A 1N4LA 5JS1A 2G8UA 1NHVA 1K6YA 2AU0A 3GIJA 3EZUA 4IH5A 1F21A 3KTQA 3DDKA 3ZT0A 3CFOA 1VSIA 4FK2A 3M8SA 4O4RA 1QE1B 1LWEB 3KLGA 4FJ8A 1ZTTA 3H5UA 1RBVA 4WZQA 4HUFA 4F8RA 3NGDA 3CFRA 4R0EA 4CEQA 1BHLA 4CHPA 4K8XA 4JRPA 3RB4A 3CDWA 3PR4A 1QSSA 3BQ2A 4FJLA 4K4XA 4ZP8A 1C2PA 1JLGB 2BGGA 1RBTA 4I9QA 3WNEA 2YNHB 4KPYA 1KVAA 1XHXA 2YV0X 5KFRA 4ID5B 3VQDA 1JLGA 4YR2A 2E9ZA 1CXUA 3H98A 1MU2B 4ECVA 3VQ4A 2ZD1B 3DRPB 1RCHA 1UWBA 4CFAA 4ID5A 4EBEA 3PHEA 2C2DA 2ASDA 4CJ3A 3AVGA 5F8JA 3SQ2A 2ZD1A 3HVWA 5KFFA 3L2VA 3HXMA 1D0EA 3Q8QB 4AH9A 5FDLA 4CJ5A 4RW4B 2FVRA 3VQAA 3KIOA 3VQ5A 1BQNA 3B6PA 2QK9A 2HNDA 2FJWA 4J9LA 3ASMA 4FW1A 2AWZA 4ZVEA 4M3RA 2ZKUA 5KT4A 1ZBFA 2YKNB 4JRQA 4FZXC 1HPZA 4RW6A 5KFCA 2G8WA 4Q0BB 1WSGA 2HNYB 3I5BA 3CVKA 4DF8A 4Q0BA 1X1PA 1TGOA 1TP7A 2HMIB 2D0AA 1RYRA 1HYVA 1TVRB 2Q3SA 3G86A 1FKOB 3IRXB 4G3IA 2WK4A 4J2AA 1KSPA 4O3RA 2FBTA 3E01B 2IBKA 1TVRA 2W42A 3TAMB 2ASLA 4DU1A 4URSA 4IG3B 3OS2A 3VQBA 2XY7A 3H5SA 3TANA 2W9CB 2CJQA 5KT6A 3KLFA 3NBPA 1UAXA 4M95A 3TAMA 4IG3A 1N56A 1WSFA 2D3ZA 2FLPA 4JUZA 2XI2A 3CM6A 3VQ9A 4FS2A 3V1RA 2W9CA 4JV1A 4DTUA 1KHWA 4R5PA 5EUHA 4QPXA 1SKRA 4ECSA 4LH4A 3QEXA 4F4WA 1NJWA 5C24B 1XR5A 5L1JA 2ZE2A 3NGYA 3HP6A 2UVUA 3DLRA 3S3NA 4CIGA 2Z1JA 1REVA 3MTKA 2WRMA 1WNEA 4HCCA 1NKBA 2OH2A 4LSLA 4BE1A 4AHVA 4IOBA 3V9ZA 1A5XA 4ED3A 3ZSZA 4H4OB 1NKEA 3EZ5A 3M8QB 4TY8B 1QHTA 4IFVB 4DSJA 5KFOA 1S0MA 4H4OA 3KJVB 3M8QA 4TY8A 1Z4UA 2FVQA 3OL6A 4X2BA 1NK4A 4KHUA 1A5WA 4QCLA 4CHQA 3AA2A 4CF8A 4NYFA 1RT1B 4TN2A 3KJVA 2XCPA 1HNIA 4B8AB 5J2PB 1ZBUA 4H4MB 1RT1A 4F50A 1U48A 4KI4A 5HLFB 2UVWA 5KGXA 3QINA 2E9TA 4JLHA 3C95A 3MAQA 2PZSA 3D28A 4WFZA 2FBXA 4F3TA 2XWYA 2QXFA 1SKWA 4FJIA 3FFIA 4DTRA 2BR0A 2BRLA 2HVHA 3QIPA 2R8JA 3PR5B 3TR8A 1RTHA 4W5TA 2Y1JA 3SJJA 2V0NA 4M3WA 2IA6A 1T94A 1ZYQA 4ED0A 4E7KA 3TI0A 1BL3A 3EY1A 5F9LA 3WNFA 4RUCA 4QWDA 2GBZA 3H08A 3HKWA 3LP1B 4GMJB 1XC9A 3D5MA 3DRRB 2XRIA 1JLFB 2YHAA 4Z0UA 3V1OA 4CJRA 3MR6A 2F8TA 2OPPA 4R8UA 1S6PB 3IGNA 1C1AA 3LP1A 4NLQA 2FC0A 3OHAA 1LW0A 1ZTWA 3AVMA 1G15A 3L2WA 1JLFA 4DTNA 4MKAA 4F2SA 1RBSA 3CFPA 4PY5A 4O55A 1XR7A 1TV6B 4CHNA 2PYJA 3H40A 3CYMA 4RG8A 3AO3A 4E7JA 4Z4EA 1CXQA 4Q8EA 3IS9B 2DTUA 1TV6A 4NRTA 3HL8A 2YKMB 1RT7A 1HJRA 3NKYA 4EEYA 3OSPA 3PO5A 3IS9A 4KV8B 4OVLA 3ZT4A 4MK8A 4DU4A 3OYAA 2W7PA 4FBUA 1JKHB 3AVAA 1EETB 2D41A 3NF8A 4ECYA 3LP3A 4FLWA 3AVHA 3L2UA 4KV8A 3QIDA 4CHZA 2AGQA 1ASWA 5L1IA 4AHSA 3BSAA 4ZPDA 3OYMA 1RA7A 4OPJA 4NLXA 4KHWA 1FK9A 1UOCA 3CO9A 2OPRA 1VSEA 4YQWA 1LWFB 4CJSA 1KFDA 3OYGA 3OYEA 3SQ1A 2O5DA 4F4YA 4IDKB 5C25B 4QAGA 4CGFA 1WSJA 1JLBB 5KFQA 3V9SA 1C0TA 5KI6A 1S1UB 4IDKA 3AVLA 5C25A 4Q43A 3H4DA 4K4TA 5KFDA 1B9DA 5KT2A 1N6QB 3AO1A 3OJSA 2V4QA 2QV6A 1S1UA 3G6YA 5HROA 4FK0A 4IKAA 5HBMB 3RB0A 1S9EB 4E0DA 1N6QA 1S1VA 4FJXA 4DL4A 4RW8B 1GOAA 4KO0B 5DG7A 1X9WA 3ZSVA 1Q9XA 5KFZA 1S4FA 3CIZA 4CK3A 4Y34A 4FZYA 3VQSA 2X78A 3V9UA 1IO2A 3V81B 4RW8A 2HWHA 4KO0A 4O5BA 3DOLB 4FM2A 2VG6A 2WOMB 3DM2B 4E1MA 5KTQA 5HRPA 1J5OB 4DL6A 1RTIB 4ECUA 4CESA 4ZTFA 1LV5A 3U6FA 4TSXA 2IJNA 4N76A 4CEEA 2IM0A 4FJJA 4RZRA 4FJGA 3DOLA 1TAQA 3DM2A 3D45A 2YNGB 3PUFA 1J5OA 2EX3A 1RTIA 3DLKA 1KVCA 3RAXA 1Z25A 4RNMA 3MEGB 3V6HA 5FRNA 2YNGA 4B9SA 3K59A 4IH7A 4JS4A 3HSTB 1DLOB 1RTJB 4KKOA 1XHZA 5SZTA 4XO0A 3AVIA 1C1CB 2R8HA 1KCFA 3NGZA 1DLOA 3PW4A 3OL9A 3O4NA 4K50A 2RN2A 3ISND 3DOKB 1C1CA 1JXBA 2GC8A 4TY9A 1T8EA 1S1XA 3OLBA 3JSMB 1RDBA 3HT3A 3PY8A 2X6NA 1N5YA 1JLQB 3OYBA 4OPKA 3SI8A 3N6NA 4CEOA 4CEZA 3JSMA 3VQ7A 4J9KA 3SNNA 3JYTA 2FJXA 2R2RA 4FW2A 3KHHA 2A1RA 3WNHA 2AGOA 2Z1GA 5DGAA 4EYIB 4HUEA 4DFPA 1BCMA 3OL7A 4TXSA 4CGGA 3ALYA 3NFAA 5KFIA 1KLMB 4B9LA 2B6AB 4CGDA 4FJ5A 2QKBA 1SL1A 5DLGA 3EPIA 3PZPA 4N5SA 1KLMA 4TLRA 4ECXA 3BSCA 2JEIA 2IJFA 4RW9B 2B5JB 3QZ8A 4H54A 3V6JA 2R2SA 4NLUA 3SUNA 1ZBLA 4CJTA 5KG3A 5CY4A 3I5CA 2KFZA 1NK9A 3K58A 2XGQA 4O0JA 4RW9A 2B5JA 4KHQA 2KQ2A 3TAFA 4ECWA 3OYIA 4WXOA 4RNNA 3MFIA 2FLLA 4LY7A 3GIKA 1Z26A 3G6XA 2XY6A 3QGIA 3OS1A 2YHBA 4DTMA 3G6VA 3MFHA 1U49A 1UA0A 5EDWA 4I2PA 1J9AA 2UVRA 4U6PA 2D7SA 4RNFA 4CHOA 1RNHA 1RA6A 5JUMA 4BDYA 3ZT2A 5KFAA 3V9XA 1RDAA 4OJRA 4WYLA 2DFHA 1L3TA 5KFSA 1U47A 4F2RA 3KLGB 4OKKA 4FLUA 2HHVA 4ED6A 3QGGA 4DSEA 4CECA 3LZJA 4NLWA 3OYJA 4W5OA 3K5MA 3QEIA 3RBDA 4PWDB 4ZP6A 3G10A 4OGEA 1VSFA 4CK1A 3SQ0A 1YVFA 4PWDA 3A2FA 3KLHA 1NOZA 1HYSB 2ZQBA 5T7BA 4CF1A 2JEJA 5T14A 3WNGA 3PO4A 3OYCA 4NLPA 4N41A 2IAJB 4O44A 2R7YA 1TKZB 1TKXA 2XY8A 1HYSA 5DQGA 3RB6A 1ASVA 3TAQA 4E7LA 1UWBB 2VA3A 1WN7A 3VQEA 4F3OA 2IAJA 3KLIA 3MR5A 1R0AB 1TKZA 1JL2A 1LAVA 2Z1HA 2XCAA 3OLAA 4DQQA 2W8LA 2G8VA 1C1BA 3SPYA 1U04A 1S6QA 4ED7A 5FDLB 4ZHRB 1R0AA 1BQNB 4KHNA 4WYWA 3H5XA 5K14B 2HNDB 2R8GA 5JS2A 4DS5A 2G8HA 2AJQA 4ZHRA 5KG1A 4DFJA 2RDIA 1HPZB 1KTQA 3L2QA 3CQ8A 3VQ8A 4ECZA 1K1SA 4RW6B 5K14A 2W7OA 4O4GA 1EKEA 2X74A 4HCBA 4ELVA 5CYMB 4FJ7A 4NYNA 3DLHA 5C42A 2VA2A 4CIEA 4OKJA 5KFVA 5KFYA 1HRHA 4NZ0A 2AX1A 1ITGA 1D1UA 3ZSXA 1RILA 1TQLA 3D0PA 3I0SA 5CYMA 3CDEA 3KHRA 4YFUA 2IGIA 4KHMA 3NAEA 4MFBB 4DF4A 1TK8A 1NJYA 3N6LA 4B9UA 4MFBA 2WCXA 2G8FA 3DI6B 4DQRA 4CJUA 3KLFB 3NBPB 3FQKA 1CZ9A 2JLEA 4G1QB 1XI1A 4FJMA 3RMBA 4E7HA 1KRPA 4K4UA 1RTDA 3AO4A 3O3GA 3DI6A 3BDPA 4R5PB 4KB1A 1RT3B 3RRGA 4G1QA 5J2MA 2ZE2B 4CJVA 3THVA 1I3AA 4K4VA 2XGPA 2P5GA 2IM1A 4O3OA 1REVB 1RT3A 3TAEA 3PW2A 2XI3A 3AVKA 1S97A 4AHTA 5KG5A 4DU3A 3RR7A 4LSLB 3MEDB 4FJ9A 2C28A 1B92A 3M9MB 3U3GA 4CERA 3BR9A 4M3YA 4Q8FA 3P5JA 1SV5A 3MEDA 4QWAA 4CIFA 4B08A 2R8IA 3OVNA 4DSFA 5E41A 1HQUB 3VA0A 4DG1B 2B43A 3GYNA 4Z4IA 4IG0B 4YP3A 4JV2A 4IR1A 3LP2A 2D0CA 2GIQA 2KZZA 3M9NB 1HQUA 2VG7B 4DG1A 1SH3A 2IM3A 3KOAA 3KLEA 1HNIB 5F8HA 1RBUA 4CFBA 4IG0A 3P83D 4MIAA 4M3XA 1N48A 3IAYA 3AV9A 5KFNA 2VG7A 3T5JA 3GV7B 3LPUA 1BQMB 3MECA 4DMNA 1VRUA 4FVMA 3NDKA 1S0OA 3ICLA 4CCHA 4AILC 5KFXA 3FFIB 5DG8A 4QW8A 3AVJA 4ZP9A 1BQMA 3TVKA 2G8IA 1JX4A 3QIPB 1FKPA 4YR3A 3KMSA 1RTHB 4DQIA 3T5HA 3DRSA 3N6MA 4NLVA 4KTWA 2FVPA 3UQSA 3RAQA 4UQGA 2LSNA 4YMEA 1SUQB 1IH7A 3OHBA 4F4XA
chains in the Genus database with same CATH superfamily
5KPTA 3SCJE 2PEHA 3OV7A 3R1XA 3HFVA 4RJVA 1KKHA 1NK7A 3GQCA 8ATCB 4B3SJ 4K2JA 4I64A 4C8OA 1V9OA 1LW0B 2XMWA 3GG0A 4K0KJ 3SCXA 3IKMA 4QS9A 2HHWA 4CJKA 3DLJA 2RE1A 2LDYA 3NF9A 1F2HA 4WFAL 4K8RA 1AA1B 2P5OA 3KKFA 3QPIA 3OYDA 3NG8A 3W60A 1SQKA 4OYPA 5C0YA 2ZGZA 3O5TB 2YNIA 1K73T 3JQJA 3BKUA 1IBMJ 1WSHA 2D0BA 1JL1A 3R7BB 1HNWK 2ITMA 4CFCA 2IOCA 2R8KA 4HI1A 4ITSA 4E7IA 3IN5A 3T41A 1PYOB 2KM8B 4RW7A 3TQEA 2RS8A 4LBIA 2LCWA 4DV4F 5I3UA 2LXFA 2O8BA 1WSRA 5E33A 5GAEI 1NGCA 4KBIA 2HHQA 2ITGA 1S5JA 3V9WA 1AZSA 1AROP 3NAHA 4C0OC 5HMWA 3QFPA 5LSLA 5I42B 1CSJA 2RUSA 3KK2A 3AJ1A 3OW2M 4GVMA 1O8BA 4YDDB 4JI3F 2QLXA 3IG1A 3F41A 1G3OA 1D9DA 1X31C 2VASA 4ICLA 2DNHA 1S1VB 2OP5A 4EBCA 1NM1A 2QWQA 2B9YA 2MLZA 3UNYA 3G6ES 3J81O 1XNRJ 2LEPA 4PXDA 2QLBB 2VQEF 1WG4A 3SV3A 3U3YA 2W4CA 5RUBA 3WXIA 4ETXA 2VDIA 2HBRB 4NI2A 2G13A 2OO4A 3MXJA 3V6DB 1T95A 3I56S 2JC0A 1Q7YT 4B1UB 1NBWA 2LU2A 2A42A 1YJWS 3OFEA 2NRTA 4UW2A 4X66K 3JSRA 2XLJA 3DRYA 4MQ3A 3TO8A 4OZ1A 1Y3JA 3P4IA 4PQUA 1QS4A 1FW6A 1TFWA 4J9SA 3SYZA 2BZ2A 3FZKA 2GHVC 5D77A 3VQQA 1EO1A 3UKUA 1VIXA 4ED2A 4XPEA 5AFUH 2VICA 3PG9A 3JQMA 3X1LB 5D6GA 2DPJA 1FERA 3W3SA 2M5YA 5THWA 4K4ZA 5GMDA 2HRUA 4KIAA 4YY3K 3PW7A 2UUTA 3ZCMA 3OS0A 3PFOA 1YGYA 3K9KA 3NMAA 1HWKA 3MEEA 2RNEA 5ETLA 1IV0A 3O44A 1HNWJ 5KFPA 2RU3A 1CLQA 3DLGB 2VD3A 4QIVA 1R8HA 3NWGA 3FMWA 2H4WB 4ILRA 4LF9F 3MMVA 3CJTA 4NLOA 1NK6A 1E4GT 3VF6A 1JLAA 4Q44A 4F36A 3AAWB 1YUWA 3QEVA 3TTDA 3R1LA 1L3SA 3UCUP 2HHTA 3PYFA 1LFWA 3HI0A 1FKAF 3C15B 2RRBA 2U2FA 4FYDA 3DXMA 4BR7A 3O3FA 2I5JA 4A8WA 1VJQA 4J7CA 5F9NA 2BQ3A 4M5KA 1M90O 4P7VA 3LQVA 3QESA 3UVJA 4NWBA 1D8YA 3KK1B 2VB6A 1X4BA 3B54A 3SUPA 5AJ3K 5CYQA 4HUGA 2YHYA 1RT4A 2R7OA 4USMA 2BOPA 3BGRA 1E6VA 1I39A 2WFBA 3NEKA 2YBVA 3KLVA 1RBLA 3VV2B 4DV0F 2MQ8A 2AJ4A 2ATLA 3I96A 3QT6A 3C65A 3CGIA 3O5BA 3NRBA 3O8MA 1VQ5N 4ZMMA 1ZM9A 4JI5K 4CZJA 4AXIA 5AQWA 4LFCK 3KLHB 1JLCA 2QYGA 1HL6A 3LWMA 1HWIA 1IKVA 4OYOA 5D78A 3W62A 3E9PA 1S9GA 3QNNA 1G6BA 4E2FB 2O66A 2VFRA 4YY3J 2M4MA 4HR2A 3KLIB 2ZH3A 3VGKA 3CJKA 3ZTOA 3KHLA 5DM6L 3DGPB 4KSEB 5A8RA 1C1BB 3T19A 2NNWA 3C16B 4DTOA 3KWGA 1S6QB 2ALZA 2MSSA 1VQ9N 3D0IE 1R59O 4MK9A 1SJRA 2HBYB 2AYGA 2DHGA 4OV6A 4NA3A 4EO8A 4DV7F 4RUHA 1EWRA 1RU2A 2BQUA 1QAJA 4TYBA 4QIGA 4FN5A 3DCAA 3SSSA 3OTDA 2XMAA 1WNSA 4IOXA 1RE1B 5C42B 4CYUB 4WQ5C 3K2YA 4EUVA 4Y2IA 2XC9A 1MWQA 2WSCC 3P5BP 4CJ4A 2QL7B 3VOVA 3CCTA 4YOEA 2FBYA 3AY9A 4GC6A 2EKNA 1HLWA 2JFKA 3MWPA 1NSAA 4F4KA 2IY5B 5AJ3J 1WSVA 3EYZA 4J2DA 4FWRA 3AA8A 2R9LA 4RTFD 4FJNA 2M88A 1C0GA 3H2VE 2ZH4A 3T69A 2DRBA 2HFZA 1JCFA 2XO7A 4QZVB 1T7PA 4ZPCA 4BDPA 1A5VA 4FPBA 1WELA 3PYGA 5SWMA 3QEWA 2UUCJ 3AGRA 3M32B 4A2BA 2P9GA 1RBRA 4UOFA 2LYVA 1VQ5S 4K5SA 4Z4CA 4I9LA 2HMIA 5KT3A 4B02A 4F67A 4V19J 4JI5J 3P31A 3HHKA 1SV5B 2QO3A 4BRNA 4LFCJ 4OMFG 4FKXA 3OR2B 5HRRA 3SQGA 3LP2B 1LW2A 2VBZA 4P72A 2HBJA 2RQKA 3I87A 3KLEB 1VK0A 3L3VA 4DL3A 1CULA 3PCOB 3I8DA 4LSNA 3DWLA 4TKTA 2XYGB 1C6VA 4CEFA 1FVSA 2CVIA 2H5IB 3TTFA 2XMVA 3J7ZT 3V4IA 1VRUB 4AHUA 3M9OB 3SUOA 4KRFA 5KFGA 2EFNA 5GMKa 4FYWB 4PCQA 5D3GB 2ZHOA 4CEBA 3TAGA 1FKPB 1GMVA 4DTSA 1TAUA 2DISA 2RDDA 1WG5A 5DETA 3ZSRA 3M8PA 4IFVA 5HQLA 3ZX0A 5DO2A 4B3TF 4DR6F 1XWLA 4JN4A 5F8GA 2HBLA 1Y10A 4CJPA 3EZOA 3MXIA 3QYYA 4Z4FA 5J2PA 2OSRA 2OELA 2AQ4A 1ZA2B 4Y65A 1Q53A 1YF5L 2FLNA 3O2IA 5IT9Y 4JK7A 4KHPF 4IRDA 2OD6A 1OH6A 3FR0A 4LFAK 4U8VA 2QGFB 4CJFA 2XMKA 4LRAA 3G0ZA 3KWMA 4CJEA 3P4UB 4C8MA 4DS4A 4FLTA 1NAQA 1C0UA 3QJJA 1XR6A 2AYBA 3RMAA 3IGVA 3H0PA 3F5TA 3U9DA 5C2FA 2GVZB 4I68A 3EVWA 1YITN 1SH2A 2CQ3A 4B17A 4J9OA 1O6XA 4GVEA 3SAGA 1W26A 5KFWA 3HJFA 2YWFA 4QIWD 4C0HA 2DNZA 3JB9k 2YWKA 4GKKF 1GNKA 1LQ9A 2L9NA 5F8LA 1E6YB 4A5AA 2EFVA 2VJUA 3KK7A 3HHEA 1NKCA 1GLBG 2VBXA 3C6TB 3B6OA 3Q8RB 1W25A 2ZBQA 3OXFA 5JVGL 5AFUA 5J2NB 3R6GB 4ED1A 3OL8A 4NLSA 1QDUB 4JK8A 4YB5A 4OZ3A 1EP4B 3AB4B 4KHRA 4LF7K 3I82A 2RQMA 4MO5A 4L76A 3IR7B 2ZM6F 2R7WA 4FXDA 4CJQA 2AP1A 1VQON 4N47A 4IQXA 2FUG9 2O1PA 5KGWA 4USIA 5D0GA 1VC0A 3FEZA 4USKA 2OTJS 1TKDA 4NX9A 2F96A 2K7KA 2IDOA 4CO2A 1BY9A 2DXFA 2B4JA 1NLKL 3IBWA 2FVCA 2F7TA 2BE2B 4NLDA 1JLBA 1Y5IB 1T9XA 4ZDNA 4F7VA 1V5VA 1FRLA 3VAJA 1LWCB 2RF2B 4FLYA 2YNFA 1HNVB 2HFUA 4DN0A 2CGLA 3WDOA 1UZDA 2F1FA 5G0RB 4QWEA 3ZSWA 2RS2A 2X6SA 4A8MP 2BKPA 2ZEJA 2OZSA 3NAIA 3CMEN 1F5CA 3FZBA 4HH0A 4NCGB 5ETVA 4NXNF 1RJJA 4LFAJ 2DBBA 2VG5B 3AAPA 3V81A 3BQ1A 1SQGA 3OA9A 3UR3C 2QE5A 1FNOA 3AOAA 1SXLA 4U7UD 2VFUA 3HK2A 1EQYA 5EX0A 3O3HA 3WIUA 2X1BA 1TMJA 4ZTJA 1Y5NB 1T6DA 1FWKA 2PGCA 1LXJA 3A1YG 3LGMA 1DKGD 1FE4A 2QSWA 3FRYA 3C14B 3L4BC 3DYAA 2E5LF 1WAFA 4J2BA 2OCEA 2FHOB 1K0TA 1FRKA 4IO9Q 5CZ2A 3W2WA 1S12A 3POTB 4CD3A 2E44A 3GV5B 2JEFA 4EYHB 1N88A 4FZZA 1J6ZA 4QQBA 4M1KA 5A6WA 2AW0A 3GILA 1FRMA 3QZ7A 1RT6B 4ZVFA 3E51A 1HWLA 5E5NA 4OYBA 4KGMA 5KT5A 1M1GA 4EP4A 3HVAA 2HFOA 1DHMA 1WD6A 4FK4A 3LAKA 1XMBA 2D0PA 4TYAA 2LU1A 3DAWA 3ETMA 4H8KA 1JLQA 4NYPA 3MWBA 5ETTA 1WJ9A 4LF7J 1HARA 3H4BA 2WBNA 4KHYA 4R25A 1VRTB 3ETOA 1HA1A 2BANA 4WK3A 3GCWP 4Y0WA 4RNHA 2AIRB 3UD4P 3R9PA 1QZ6A 3KHGA 4AHCA 3NGSA 4M41A 4LQ3A 1TU0B 1MWYA 4NYZA 2Y1LB 4CF9A 1WHXA 4QPTA 5DDRC 5K20B 2RKIB 1BQXA 2WONA 4QYZK 3VQCA 2V67A 1D9FA 1IG8A 3VA3A 3HP9A 2J6TA 1WORA 4X62F 4EZ9A 3ENWA 5B0AA 3NS7B 3UW1A 4DN9A 2DPNA 3RBEA 1KVIA 1RGIA 2NQPA 2CJYB 5EN1A 1D5AA 4FLXA 1HFEL 1BISA 4JI7J 4IUFA 4P10A 2N4DA 2XHWA 5GIOA 1NJIT 3J7AP 4JI6J 1CEZA 3EZUA 3HHDA 4IH5A 3CD7A 1HI1A 1IBKJ 1K47A 3AB2B 3MX5A 1VSIA 4O4RA 3KLGA 5U47A 2N7YA 4F8RA 2H3EB 2WUSA 4OI2A 5LL6d 3RB4A 4I6MA 2B3TB 3CDWA 2ZHBA 4X4OA 3PR4A 3TW0A 2EFPA 3GYGA 3MM7A 3KVGA 1KP6A 4FJLA 3BS9A 4K4XA 4ZP8A 4F0HA 4IZ9A 1PCAA 3FBFA 4I9QA 2OGUA 1KVAA 3US5A 5HN0A 5KFRA 4ID5B 1JJHA 4YR2A 2O8EA 3NXZA 2JH3A 2RRAA 5M2PA 1MU2B 1U6ZA 1RCHA 4FNIA 3FSYA 1N5TA 3OHRA 3PHEA 2C2DA 2ASDA 3AD9C 1FVQA 5BR9A 3AVGA 4HWIA 3M2UA 4Z37A 2ZD1A 2E2PA 4C48A 3U7JA 3L2VA 2MHEA 5FDLA 2B51A 3KIOA 2A2DA 1ITPA 3SMPA 4LFBF 2RIJA 3A8YA 4FW1A 2CQIA 2AWZA 5L39A 4F04B 2AKWB 3QATA 4JRQA 5MAOA 2XSJA 2DCUB 2QZ8A 3MMBA 3LO3A 2HNYB 3MM8A 3VESA 2AJ1A 3THYA 1OPIA 3OUYB 4QYZJ 3HX9A 4JEPA 1YTYA 4Q0BA 3CJ9A 4DV4K 4JKHA 1X9JA 5HMYA 1GLFO 1TVRB 2EBGA 1NLVA 4TVAB 4ZLJA 3M2RA 3CPWR 2MKJA 4G3IA 2Q1LA 4O3RA 1Q16B 2W42A 2EWSA 4IG3B 3OS2A 4BGBA 1GK8A 1SZ2A 3TANA 2W9CB 3JTPA 4IXCA 2CQ1A 6AT1B 3KNGA 3SCIE 3VWSA 4JI3K 1XUPO 4FF3A 4DTUA 4QPXA 4LH4A 3QEXA 3WT0A 1B64A 1FDBA 5CCMA 4IEIA 2E7WA 1WF2A 2L48A 1HW8A 1IBCB 1FRIA 5AQGA 3MTKA 3C0BA 4LSZB 2ACYA 1X8DA 3FCHA 1BWVA 2UU9F 4NMLA 2IVYA 4H4OB 1NKEA 5CAAA 3M8QB 4TY8B 2KYXA 1QHTA 3R5AA 2E1YA 1X5SA 3IM8A 4QOTA 1CJUA 2GO8A 3TZZA 3KJVB 3QRRA 3GE1A 1WACA 1Z4UA 3OL6A 4QCLA 5AE1A 2XWXA 3T9ZA 1XK8A 2DNNA 2V6AA 2EKYA 3VEXA 4C0BA 3WXKA 4B8AB 3QRQA 4O8KA 1BA0A 1RT1A 4F50A 3LDQA 3G71N 3QINA 2HS0A 3BYPA 4CD1A 3CCQS 2DGSA 2FBXA 2QXFA 1I94F 1I3OB 2BR0A 2YWGA 3QIPA 4YOTA 5HJYA 4M3WA 2E2OA 1J2VA 1T94A 3VGSA 5A8WA 3BR8A 4LR8A 2UP1A 4LF9K 3BF4A 2M8HA 4WP9A 3GFYA 3LP1B 4ZIWA 3D5MA 5E26A 4DV4J 4Z0UA 3V1OA 3MR6A 1X4FA 3CPEA 3IGNA 3EKUA 3ZTPA 2FC0A 2B8PA 1R6VA 4HH1A 3L2WA 1JLFA 1RBSA 2DNQA 3CFPA 3PM9A 3CIPA 3H40A 2W4DA 1F2GA 5E2QA 4Z4EA 2ZH6A 1EAYC 1UPPA 2V52B 4YHHF 2DTUA 4JI3J 4NRTA 2YKMB 2JJ4D 2DY9A 1O13A 1F60B 1X7VA 2E5HA 3M3ZA 4YOXA 3OYAA 1CC7A 2APOA 2W7PA 1WUAA 2O8DB 3E3XA 4OZJA 4ECYA 2AYEA 4KBOA 3LP3A 3AODA 3AVHA 1K9MT 4KV8A 5B0CA 4AHSA 2OFGX 4NXMF 4MKVA 3OYMA 3RW7A 2AJ2A 2P6SA 3G4SN 4KHWA 2JVRA 1UOCA 2OPRA 3NNCA 1LWFB 3VGLA 4CJSA 1HBOA 1KFDA 2H5EA 2ZJQQ 2CJAA 5FLXO 2O5DA 2HURA 4IDKB 3U27A 1CPZA 1HBNB 5KFQA 5KI6A 4PL8A 3R7SB 5C25A 1HNXF 4NO7A 3MMAA 2XMJA 1B9DA 1BUPA 5C2GA 3MUTP 1W7WA 4JHDB 4ZVPB 1NGGA 3ZETB 3RGIA 1N36K 1S1UA 3G71S 2IYGA 1IBLJ 3RB0A 2LQBA 3MEKA 1TELA 3NLCA 4FJXA 4NLBA 4DL4A 2C1EB 1BMQB 2FZKB 2LLZA 4KO0B 5IV4A 1Q9XA 4YOWA 3HDSA 3CIZA 2LEAA 1AW0A 3G82B 1GT8A 4RW8A 5IQQA 4O5BA 3DOLB 5AT1B 1PC4A 3FZFA 2WOMB 4E1MA 2Q6CA 3AD7C 3IAM9 4ZTFA 3U6FA 4N76A 4C11A 3TVYA 2IBOA 3DM2A 1RHMB 4KGKA 4LF9J 1OMSA 4B1VA 1RTIA 1PC5A 2ASMA 4DV7K 1T9YA 5H1SQ 1U2VB 2JWKA 1Z25A 4ANCA 4RNMA 3MEGB 3BB5A 2CADA 1N32K 4I67A 3V5RA 1RTJB 3BYRA 1KQGB 1C1CB 4P74A 4Z7YA 1KNZA 1Z2LA 1KCFA 2VKRA 2PMHA 3PW4A 2YWEA 2HQIA 4K50A 3ISND 3TWZA 3DOKB 2B4OA 3K17A 4X65F 1JXBA 2GC8A 4L73A 1S1XA 3OLBA 4UZBA 2XMMA 1N5YA 1ZC6A 2VPYB 3OYBA 4DR2F 2BACA 3FC9A 4CEZA 3ZNJ1 1FD2A 2BW7A 1J5EF 2FJXA 3SCLE 4E1JA 3WNHA 4PG5A 5F41A 2DH9A 4EYIB 1BCMA 4TXSA 4FXVA 2KKHA 2WVBA 2K1RA 3GONA 4USTA 2V94A 3FUYA 4B9LA 4LRCA 2QKBA 1PBUA 1KLMA 4P9SA 1RQ0A 2IJFA 3G9CA 1YHQS 4XH5A 1N34F 4KGVB 2R2SA 4CJTA 5AE2A 1HNZK 3I5CA 1NM2A 2B5JA 5LJVA 4KHQA 4O0NA 2A6AA 1N36J 4WXOA 4WTOB 2FLLA 2XG8A 4B3MF 3C6HA 1VQMN 3CSKA 4C6AA 4B9QA 3G6VA 1KAYA 2KH9A 2UVRA 4CHOA 2CNNB 4BDYA 3ZT2A 2DGOA 4DX5A 4XH4A 2RT3A 4JD2A 1Z05A 1RSCA 2Y1RI 1NDLA 4FLUA 1NJIO 4ED6A 2V8DA 3VALA 4DSEA 4IOAQ 3ID8A 1WC6A 3QEIA 4PWDB 3TR5A 1YWXA 3G10A 3PIOQ 4OGEA 1VSFA 3THWB 3QRPA 1N32J 1GMWA 3A2FA 4B3TK 2KRBA 4DR6K 2FGCA 5CXTA 1NXIA 1NEEA 1HBMB 1V3RA 3SBMA 3E9LA 3WNGA 3OYCA 1G4CA 4ERDA 4JKGA 2HGLA 1HYSA 1ASVA 1B7YB 5IQ6A 5IT4A 3D2EA 1RKJA 3GFXA 1HHTP 2XBPA 4F3OA 2F4VF 3ZZPA 1YVNA 4KHPK 2Z1HA 3BN4A 2ZBPA 2G8VA 4G1IA 1U04A 1BG3A 1R0AA 3CT9A 1UTAA 3MOJB 4DMZA 1XNQF 1BQNB 4U7BA 3A3OB 4B1ZA 4WF9Q 1YLXA 4DUYF 5FD1A 2OTLS 4UF4A 1YG0A 4D3HA 2RDIA 3M2VA 3L2QA 4ECZA 3U8XA 3DHXA 4B3RF 5GAEU 2XQCA 3S7RA 1RAGB 2KJVA 4ELVA 1YIJN 4NYNA 2RILA 3BH7B 5KFVA 1VQKS 2AX1A 2P9IB 2QLJB 5B08A 4GKKK 3MDFA 4K43A 1HNZJ 4BR9A 2DXDA 4NE9C 3QJPA 1NJYA 3IFRA 2F8HA 4IDHA 4GVLA 1FD8A 3J81j 1VQMS 1WKLA 4B9UA 3N01A 1WUUA 2G8FA 3ULEB 4ZVOB 2LQJA 2OD4A 3CEDA 2CH5A 2RHQB 1Q86T 3FQKA 2B9XA 4GV6A 4WFNQ 4G1QB 1YJNN 1FCAA 5IS2A 3U9ZA 2ADBA 3D54A 4CM0A 2ZM6K 3RRGA 2N82B 2D9OA 3W5XA 2ZE2B 3HOSA 1OYDA 4FWKA 3P96A 2XGPA 2P5GA 3L7PA 2MKSA 1REVB 1RT3A 5EOYA 3AVKA 3J81U 2GMJA 1OY8A 3OTOF 3THXA 1UJ6A 5A2QO 4CO1A 4W98A 5M1OA 3U3GA 3MCNA 1JQGA 4OHXA 4CERA 4Q8FA 4JI4K 2N7CA 3C46A 3PSIA 3H1QA 2PT0A 4B3TJ 4DR6J 2HOEA 4CIFA 3FGVA 1Q4RA 3VA0A 4DG1B 3GYNA 3U4LA 4Z4IA 3BO2A 1WKKA 3IO1A 2GIQA 2CJ9A 2K3IA 1SC1B 1H7XA 3TEHB 3MM9A 2B8QA 2P5VA 2VG7B 3IP0A 1HNIB 1SJQA 1VFJA 1RBUA 1FJEB 2KVIA 1WI8A 2QC3A 1N0UA 3RZAA 5ETMA 3T5JA 1GXTA 1BQMB 4K41A 1CJTB 5ADZA 4DMNA 4NXNK 4FVMA 4PZVA 3ICLA 3ZZRA 4AILC 2FHJD 3OQ2A 4YEAA 5H9EK 5KFXA 1FF2A 3AVJA 4ZS6A 4I69A 3CC4N 5E3RA 5CA5A 3WQUA 2PO4A 3DRSA 2VONA 3QSIA 4KTWA 4DR1K 3EGVA 1R8PA 2LSNA 4YMEA 1SUQB 4CZKA 2Z4PA 3OHBA 2FD2A 3AGKA 2UUBK 2N3LA 2H3GX 1KR4A 1F6TA 4ZP7A 3ZNUA 1NJZA 4GKKJ 4R8UB 3EGWB 1RT5A 2DXEA 3ZSYA 2L41A 2F8EX 2I7NA 4CO3A 1WTBA 1U1RA 2V8HA 5ETQA 2Q2RA 9ATCB 4DXLA 3NOGA 2A6OA 3QMQA 3KKSA 3GL1A 1RHJB 4X4QA 2E1CA 4O3NA 1JXEA 3VF4A 1YJNS 4MJKA 3SMZA 2KU7A 3EZWA 2ZM6J 1HLUA 4FWNA 2MQLA 4NEZA 4CTAB 1MMDA 3J8AA 4ZJLA 5AQLA 4C2MA 4WK1A 4MK7A 2DR9A 2CPJA 4M7YA 1MSWD 1NK0A 4H0OA 4FS1A 3TP2A 1FK9B 4FF2A 1QD1A 1DARA 3QEPA 1RHQB 2NRZA 3CJ8A 4JI4J 1BHNA 1SI9A 4X84A 5IM0B 3LOUA 4X62K 2J5AA 2VF3A 1K9MO 3L95X 4DL2A 3CIMA 2F4FA 3ZEUA 2G2YA 3BPDA 1RKIA 4OGCA 2GHPA 4DUZF 2ZNZA 1TUVA 2HS4A 4I7FA 1LXNA 1P6TA 3S01A 4J9PA 1YJ7A 4KRWA 3AA5X 2F7VA 5CZXA 4CZHA 2P9KA 5DZ7A 5M1QA 5ETOA 3RRKA 4DCOB 2KTQA 5I42A 4QJVA 3SI6A 5KFMA 5J1EB 3ENVA 3HULA 3F73A 1R43A 2RDJA 4NXNJ 4P6QA 1RWKB 4B1XB 5H9EJ 2XHBA 3BEGB 2FF6A 2CWXA 1QUPA 5AE3A 5GAHP 3BO3A 2EWHA 2VG6B 1RAAB 4CT8A 2LQ5A 1WF0A 4L72B 4DR1J 3CTRA 2V7ZA 2DNRA 1RAHB 2HHUA 5IXUA 4FM0A 1U2RA 1DJ0A 2MLYA 4XIUA 2IHR1 4W4MA 2UUBJ 3DLKB 3CQYA 3D67A 3EWGA 2EVZA 3V6DA 2HK3A 3HZEA 5EY4A 3KNAA 2E5GA 3NWRA 3GB0A 3NL0A 1IN0A 3FVYA 1VBZA 2GMHA 4KKOB 1QQOA 4BE2A 3QBCA 5KQ8A 3R5GA 4KREA 2MGZB 3M6XA 1HMVB 4ELUA 1B4SA 5KG7A 3BSOA 1EZZB 3U02A 2F65A 1NRKA 5AZJA 2HZCA 3MCOA 5AQUA 3BJYA 2P2CB 3R97A 1HQEB 2A2CA 2HG4A 3K5OA 4OZ2A 1CC8A 4A48A 5ITHA 4UOHA 1OH7A 5F1XA 5L1LA 2HF4A 4LFBK 1LK5A 3LW5C 3ELHA 3TJ8A 3KG4A 2HNZA 5A8KB 3QT7A 1YKWA 4B3OA 5D0EA 2DNKA 4M63C 3DLGA 3CJ4A 1KXPA 3P49B 1EXQA 1Q79A 1WB9A 4OI1A 4X62J 1L5UA 5KG2A 2LKZA 1KLNA 1QTNB 1TKTB 4EK2A 3GR0A 2BJ8A 2CQCA 2IS3A 5J2QB 4ZLPA 1LWXA 2UXCK 1FRXA 3A8EA 1TYQB 1VJWA 4YR0A 3C15A 1SJ3P 1R31A 4WE1A 4DUTA 1KHVA 4PG4A 3OSNA 3ZT1A 4FWMA 4ZCMA 3OBWA 4Q45A 1VSDA 2Z2MA 3IRWP 4OZNA 4N8OA 2JRSA 2V9KA 2KW4A 4BREA 3KK1A 1S57A 3M30B 3PRVA 4M94A 3T1YJ 1NMEB 2JC1A 4BRDA 3CDAA 2F8SA 4CNYA 2PDAA 4J9RA 3D0GE 3CXCR 1K8AT 2L9DA 4J9VA 2UU9K 2GVDA 3IC1A 3S3OA 3IR6B 4BR4A 2IVPA 4LD0A 5DGBA 3VAMA 4CEDA 4DR7F 3C94A 3EPGA 2M8DB 3K0JA 4EWTA 1YXQA 2GS8A 4OYWA 4LF4K 4K2XA 5KFJA 5HL7L 1SJ4P 3LPYA 2WBMA 4ISFA 2W2QP 1AB8A 2BMBA 2RQ4A 3L4IA 1GMWD 3HPGA 2UVVA 1FXDA 2YQ3A 4O44B 4HYKA 1TKXB 4CLLA 2D3UA 4IFYB 3VQ6A 1GQEA 2A3JA 1S48A 4WFYA 2O4GA 3HOTA 2ALYB 2Q6BA 2MMYA 1QE1A 1LWEA 3K5NA 4DWIA 4ED5A 4DLEA 4N77A 4LFBJ 2Q0RA 5M2UA 1Q8BA 3JXOA 1M1KO 4JKDA 2PI5A 2VPWB 3FZ2A 3O6WA 2NRWA 4RUAA 5FIIA 2WW8A 1RWVB 4WCEL 1RI7A 3W63A 2HQFA 3GG4A 1RTZA 1VS3A 5DK5A 1JIHA 3W3DA 3PTWA 1UVLA 3GBTA 1RAIB 3DRPA 5DQIA 5LJ5Y 3TZXA 2UXCJ 3I0SB 2YCHA 1FX4A 4PHTX 2WW4A 3M1VA 1I1GA 4LF8F 3RUBL 3FZLA 1J27A 2ETJA 1RB0A 1K8KB 5KT7A 3ULDA 2CQGA 3QGHA 4XEIA 1BUXA 5JICA 2PMWA 3GIIA 4YHHK 3GJQB 4UY8T 1J54A 4USJC 2C2EA 5F0XA 2J7KA 4ZJQA 1NK8A 4XK8C 4A57A 2OMLA 2AZ1A 1L3KA 3V6KA 1FEHA 3LP0B 1YTAA 2V4JB 2GIRA 5CQGA 5J2MB 4Y2CA 4KHSA 1FXXA 4OX9F 1WWHA 4R79A 5HO4A 3M4XA 4C3LA 4NXMK 4L6V3 2UU9J 4KGXB 5BN8A 1SQFA 3A5OC 1HR0F 2Z2ZA 3CJBA 1FKOA 4URQU 1KQKA 3QLHB 3J7A1 4LF4J 5A0YB 3HHLC 3ITHB 4CEAA 3E01A 2MZ1A 1VSJA 3R1HA 1PAEX 1FJCA 2GQ2A 1HNXK 4F26A 1GXUA 3G87A 1IVZA 1S22A 4MIWA 1PO6A 4BRGA 2CKWA 2QX0A 1IR0A 3CMQA 2VL1A 1T9TA 1O1WA 3BKFA 2YJFA 2LFVA 3OYNA 2GNKA 5C24A 1D8ZA 4M8LA 2UUCF 2OUGA 2V8VA 2IA0A 2BV3A 2OHDA 2GHWA 2MB0B 2KXFA 2DFFA 4OHZA 4CW7B 1H6KX 1NK5A 3G8TA 1ZM3A 1NZAA 2E20A 5C10A 3JXUA 3R5DA 4LFCF 2OSQA 3D3CJ 5D3GA 3CPWM 2P1JA 3RSEB 3VQPA 2KJWA 2FJAB 1IWGA 4O0IA 4XH1A 2R4FA 3K89A 1V6HA 2FC9A 4CZGA 2VBYA 4JKCA 4DCHA 4DCJB 4O3QA 4M5MA 4DL7A 2A3ZA 2WB4A 3SQ4A 4HL9A 2E2QA 1ASUA 3SXLA 1UFKA 4H4MA 4C23A 2KYZA 1P9YA 4IRKA 5HLFA 2DIUA 1SB6A 1RHRB 3L3CA 5DDPC 4X65K 3RB3A 5LXRA 7FD1A 2M70A 1RDDA 4Y28C 4M5NA 4DR2K 4Y3CA 3SCKE 4O8UA 2B9EA 2RJZA 5TKWA 3C2PA 3QWUA 2YNIB 1J5EK 3CG7A 1T0TV 1DEJA 3KJFB 4H0VB 5HMXA 4OFZA 2J6SA 2GUIA 1R8AA 2J76E 4NXMJ 4ZOSA 2ASJA 2NZCA 3DRRA 2D5RA 4FJKA 2GVZA 3W2VA 2IDLA 3N79A 1TL7A 3NCQA 3HSJA 1QVGR 2V51B 3TTCA 1S6PA 3QIOA 2M9KA 3DXKA 3LALA 2ZGYA 1D9AA 2CNLB 2ZC4A 3GPAA 2HFVA 1AZSB 4CLYA 2ZH7A 1C0MA 1N34K 1ZPVA 1GAOA 4OYMA 5KG0A 3KFWX 5LSRA 3LDSA 3ILIA 3CCZA 4CLSA 4RBTA 4X4PA 3KK2B 3C6TA 2OPQB 4DFMA 4B3MK 4I6WA 4OYXA 2PEBA 1WI6A 2KRRA 4GW6A 2F9WA 1M5HA 3VVTA 2MKIA 2J9EA 3IG1B 5J2NA 5CABA 1G1XA 2G8KA 3KUEA 5B0GA 4RLEA 5AQXA 1T3VA 2AGPA 2IMOA 3TQ1A 2UUAK 4BQLA 1NDKA 3IA0A 4Y2AA 3VZHA 4R0JA 2J0QD 3LPEA 3WX8A 4DV3F 2VWJA 4P75A 5KFKA 1PJ5A 4M3UA 5K9FA 1U45A 3NF6A 4HVJA 2H9ZA 3MCPA 2MKCA 1U1NA 2AD9A 2JL9A 3S1TA 2VWBA 4HHTA 3GR1A 3SBTA 4M3TA 1IKWB 3ZZYA 2V2VA 2QA1A 1S72N 2EK6A 3MUVP 4NA1A 1T3NA 4OPAA 2E1MC 1LWCA 4YNQA 4BHQA 4ZKAA 3QETA 3UKUB 1HNVA 1CG2A 4DDFA 3KD5E 1NNDA 1NZ8A 4CZMA 4X65J 3HHLB 3Q8SB 1ZBSA 4F9OA 1X3NA 2P9NA 4LQ9A 4DR2J 1QSYA 1QZ5A 4NCGA 4PABA 2CG8A 2VG5A 3QWPA 1J5EJ 1S77D 1W0HA 5M1FA 2OZMA 3CCRN 1XNQK 4F0KA 1KFSA 4U95A 3ID6A 2HHHF 4JYAF 4DUYK 2VGMA 4H0YB 4RPFA 2CIMA 4DPXA 2ZH2A 4LRBA 3FZMA 2MDAA 3LM2A 4B3RK 2ZBRA 4MLEA 3TWHA 5DS7A 1KD1T 4Q2MA 1NH7A 3W9IA 1XC3A 3L2RA 4TU8A 3POTA 1ATSA 1DAXA 2UV8A 4KAIA 3FCVA 1ESVA 1N34J 5LXYA 3NE6A 2XS2A 1L3UA 4OL8A 4OO1J 1BGXT 3UKRB 3DXMB 3EJMA 4C8YA 3PVXA 1R0BG 1RYSA 1RT6A 2H54B 2I5JB 2O4IA 3Q8PB 4PPDA 5IT9O 2RSQA 2YX6A 2OYQA 4WFXA 1U4BA 3LDLA 4CK2A 1RWWB 4FWQA 2NRRA 4CVNE 3MPWA 4LJMA 3CD6S 5CYQB 4BC4A 2V2ZA 3AO5A 1RT4B 3RR8A 4NRUA 3CCSS 5BJRA 4C98A 2UUAJ 3TARA 1CQMA 3BGRB 1E6VB 2C2ZB 3EDRB 1VQ4N 1VQ8S 2DNMA 3HFZB 4W5RA 2Q36A 1VSKA 3IDHA 3HSDA 4ZVGA 4DL5A 1WHYA 3OTOK 1WLJA 2MKHA 1T9VA 4QIEA 4CF2A 3J7AN 1RHKB 2KZMA 1DTQB 2IVMA 1YDLA 2RKIA 3ZLJA 1LAWA 2QWPA 3WC2A 1BIUA 1BOTO 3PX6A 2YWHA 1ZBHA 3MXMA 3NP5A 2EHGA 3OTBA 1K8AO 2CJBA 3NGKA 3HT0A 1VRQC 2F63A 1M5OC 3EEQA 3MN7A 4ZVUB 3MN9A 1Q82T 1W9HA 1VLYA 4K59A 3TSQA 2MZQA 1N4LA 4QU7A 5CH7B 3ENAA 1F21A 3KTQA 3RBZA 3GSIA 4BRIA 3CJKB 3ZT0A 5H9FJ 4NZ6A 4FK2A 2NZTA 1PJ7A 3W5YA 3CCRS 1XNQJ 4HUFA 3EM1A 3NGDA 4CT9A 4R0EA 2P9CA 2CPDA 4CEQA 4DUYJ 4DPYA 4JRPA 1N0VC 3DKDA 4CO0A 2W24A 3TZYA 4B3RJ 3BQ2A 3QGPA 4JI7F 2BGGA 2Z0GA 3SIPB 1VQSA 3WNEA 4OYZA 1TUYA 4DX8H 4IOAL 1EX8A 4JI6F 2E9ZA 3FGUA 1S0VA 3H98A 4ECVA 2PBDA 3B4MA 1IBKF 1AUSL 4ID5A 4EBEA 2RH3A 2MQNA 5HVGA 4UY85 1RP5A 3HVWA 5KFFA 4UOCA 1HD1A 1UPMB 1GLLO 3Q8QB 4P2SA 2FJBB 2ZJRQ 1H72C 3VQ5A 3NY0A 1GTEA 4JKEA 3B6PA 1NMNA 3T7ZA 2W40A 4M3RA 1LNQA 1ZBFA 3LDPA 3WHIA 1G7CB 4FZXC 1FFWB 2ZDPA 4RW6A 5KFCA 1M5KC 4UY8O 2YTCA 2E2NA 3I5BA 3ZFVA 5E3QA 3CCEN 2NXNA 1X1PA 5AXLA 1VQ6N 4F4AA 3M6WA 4IO1A 1E4FT 4J9UE 3OUYA 3LGNA 4WF9L 2HMIB 1RYRA 2J8SA 3G86A 2J0XA 4JKBA 2NSCA 1UETA 2CQPA 2B4VA 1KSPA 5FLXU 4UTGA 5ADXH 2IBKA 1GLDG 1TVRA 3TAMB 1GLEG 2Y0SD 2XY7A 4DUZK 2GIFA 2VBWA 2X3GA 2CJQA 2NSBA 2KLAA 3KLFA 2X1GA 4M95A 4IG3A 1N56A 5HATA 4JUZA 4KH6A 4FS2A 3V1RA 2W9CA 1CULB 2NPFA 4R5PA 1Q78A 2YKPA 5ETSA 4OQJA 2RD5C 1XR5A 3NGYA 4OHVA 2OEJA 3DLRA 2Z1JA 1KBRA 3LDNA 5B0FA 2CPYA 1WNEA 2DO4A 3MAAA 4HEA9 4BE1A 2G1DA 1U8SA 1A5XA 4WPAA 4ED3A 4WFNL 2PFUA 1PYSB 2DH7A 5C2CA 4IFVB 3K5PA 5MLCV 4KH4A 2B56A 5KFOA 4A4JA 4CDIA 4C7QA 4H4OA 5BYRA 3UFCX 2DR5A 1I5OB 3M8QA 5D0RA 4TY8A 4KHUA 4CHQA 2EC2A 2LXIA 3AA2A 1TTHB 3N9UC 4RWXA 3FLCO 3KJVA 2KG1A 2XCPA 1VI7A 5J2PB 1UMJA 2KO1A 3H3NO 2W1BA 3T6JA 3HZ6A 3J80U 2DK2A 2ZH1A 1JCGA 2NXUA 2PZSA 3KWIA 5T7LA 4WFZA 1VQPN 4CBUA 1SKWA 1R27B 4OZLA 3FFIA 1U1KA 1RDUA 4DTRA 4FJIA 3KG0A 3VEOA 2VUGA 3ZXWA 3DXSX 2HPUA 3TJAA 2R8JA 4OX6A 3TVZA 2BABA 3L6QA 3N28A 4P2MA 4KY3A 4W5TA 1NGFA 1IM6A 5L38A 1ZYQA 4E7KA 1ZXOA 1UVIA 3D1QA 2HQCA 3EY1A 4BG9A 3WNFA 4RUCA 5F3ZA 4QWDA 2GBZA 3H08A 2QN6B 4NMXA 1LK7A 2YHAA 3QAEA 3O9RA 2F8TA 2OPPA 1C1AA 3LP1A 4NLQA 4O23A 4K7QA 2BBEA 4FWLA 1G15A 4FYXB 4MKAA 3MM6A 3D6HB 1NGHA 3THPA 2YX7A 3R3LA 4CHNA 4DUZJ 3CYMA 3A3NB 4WWSA 2Y9HA 2X3DA 3IS9B 1JCEA 1RT7A 5BPNA 3QFWA 5JLHA 1HJRA 4EEYA 4QU6A 3OSPA 3SEOA 3R2DJ 4AM6A 3ZT4A 4MK8A 4FBUA 3ENHA 1GH8A 2JDJA 2P9SA 3M6GA 3KG1A 4F3QA 5AQZA 2BUNA 3L2UA 3MM5A 5GIPA 3FBCA 3QIDA 3BSAA 1MROB 1VQ7S 4ZPDA 3AAQA 3S41A 1Y4ZB 3CCJN 1VLOA 4YQWA 4OI3A 1PIEA 4J91A 2DCLA 5CHIA 1OO0B 2HFNA 4DR7K 4PYAA 1CS4B 1FTRA 1JLBB 3AXKA 1IR1A 1C0TA 4M5LA 4IDKA 2YKOA 3TA2A 5GMEA 1HBNA 4CIOA 4BGAA 1VDHA 3NGRA 1YJRA 2IIHA 4GKJF 3ZTSA 2Y0BB 5D8HB 5AQTA 5HROA 4FK0A 4IKAA 7AT1B 3TA1A 4DBQA 3WXLA 5I3QA 1GOAA 5DG7A 5GADP 3M5RA 5KFZA 1S4FA 4Y34A 2ZZMA 3BBFA 3V9UA 1IO2A 1VQLS 3V81B 4KO0A 1HPMA 3QBXA 4MKYA 4LUBA 5HRPA 1J5OB 4DL6A 2Q79A 3EVOA 4H0XB 3W66A 5AQRA 4TSXA 2IJNA 2VIHA 3Q23A 1VC5A 4RZRA 2WVDA 3DOLA 1PJ6A 5L8RC 7FDRA 4Q7AA 1SC4B 3NNHA 4A59A 1BDGA 2ZBCA 1S76D 2UXDF 3MMJA 2ZUAA 3V6HA 5FRNA 3W2WB 2J8AA 1IBLF 1KAXA 4DHYA 2E7XA 2C2MB 5K8NA 2P9EA 3HSZA 3OL9A 4FYVB 3DXBA 4LF8K 1KD1O 1C1CA 3AHPA 3WUHA 1Q1KA 4TY9A 1T8EA 1RDBA 3CCLN 3HT3A 2X6NA 1JLQB 2FGOA 2IJRA 4OPKA 3R5BA 2MXYA 3BP8A 4J9KA 3JYTA 3Q89A 5B7WA 5I9EB 2KL8A 2AEJA 3W9JA 3OBIA 2JNJA 5C7PA 5IC4B 4HUEA 4DFPA 3OL7A 4CGGA 4X4RA 1S7HA 5I3PA 3ALYA 2MLXA 5HVFA 2RB7A 4OX9K 3CCJS 4FJ5A 4ES3A 1SL1A 3QQCD 1HR0K 1F9HA 5T41A 1YI2N 3PZPA 4DR7J 2QWNA 3GTYX 2U1AA 2JEIA 2P6TA 3QZ8A 3W64A 5HAOA 4TNOA 3V6JA 2DHXA 3AJDA 1WHVA 5AXMA 4NLUA 5A2QU 1KN6A 5KG3A 4ZA1A 1HHQA 4UUXA 2QMXA 3MFIA 3PKYA 5DM6Q 2HF3A 2YHBA 4DTMA 4CZLA 4TLQA 4JOUA 2YHWA 5EDWA 4I2PA 1J9AA 4U6PA 2D7SA 1GXLA 1RA6A 2DR7A 2BJDA 4LF2A 2IPOB 2QL9B 3VGUA 2QA2A 1VBXA 2UUCK 2LVWA 3EKSA 3V9XA 1RDAA 3VF2A 3NMUA 1L3TA 1KQSR 3AH6A 5KFSA 1Q82O 1U47A 4F2RA 3KLGB 1FJGF 2GAGC 3GWCA 3QGGA 1Q5VA 4NLWA 4W5OA 3K5MA 3RBDA 1M1HA 2CZ9A 2DHSA 1VQNN 1ZAVA 3TEGA 2ZDOA 3D7SB 2VOOA 4ZLLA 5BPLA 3W61A 3SQ0A 1N36F 1WBBA 4PWDA 4C4WA 3FCWA 5B0EA 2XNRA 4YB1P 2VYPA 4H5WA 3THWA 3ET6B 3OTEA 4A46A 1RDWX 1U0HB 2AA4A 2IAJB 5ADXA 2O8EB 2VJVA 3SAFA 3RB6A 3Q0AA 4LF8J 3A5MC 3TAQA 2VPZB 5AQQA 2HZAA 1WN7A 4U67L 2E5IA 1JL2A 3D2FA 3M2UB 2XCAA 1X0PA 1FWPA 2FSJA 3CXCM 5FDLB 3VAIA 2N3OA 2RHKA 4KHNA 4WYWA 3H5XA 2IRXA 2NLXA 4BRKA 2CDQA 1N32F 1C4CA 3MMCA 1QLNA 2AJQA 4AD6A 3PIPL 1OVQA 2XSJB 3CQ8A 4OX9J 1P8GA 1O5JA 3PKMA 4O4GA 4J90A 1WOQA 4A2AA 1YI2S 2EW9A 2QM1A 5CYMB 1HR0J 2HGNA 3IMXA 4CIEA 3I6PA 4OKJA 1HRHA 1ITGA 3R27A 3KHRA 1Q7LB 4YFUA 2A0FB 4L74A 4KHMA 5FLXY 1HKBA 3OVSA 2V7YA 3OR1A 3HD2A 1WOSA 1MA9B 4CJUA 1X5TA 1CZ9A 1RCOB 2I9SA 1XBWA 2JLEA 2ASPA 4E7HA 1RAFB 4X4VA 3A0IX 1OKJA 1RTDA 3AO4A 3ULEA 5BPMA 2Z30B 1WDDA 3MD1A 2BXJA 1E3MA 3P38A 3D4JA 2BH1A 4G1QA 3K9JA 4K4VA 4A5BA 3ISZA 3M8WA 3L9ZA 4O3OA 2LDIA 2XI3A 1EB0A 5DDQC 4DU3A 2D1KA 3RR7A 1XMQF 1VQNS 4DV3K 2HKEA 4FJ9A 4TU9A 4P52A 3S8SA 1XMOF 1HNZF 2KFYA 2X1FA 1V5IB 4M3YA 2R7TA 2OANA 4YB7A 2KVQE 4QWAA 1WC4A 5E3AA 4DSFA 5E41A 2V68A 2HS3A 1NMDA 1HQUB 3P45B 4IG0B 4YP3A 1U1MA 3GJRB 4WQ4C 1RLCL 2GJ2A 3CD5A 3O4WA 4DG1A 4C97A 3KOAA 3Q83A 2HRYA 4CFBA 1RBAA 3N4WA 4H5TA 5CD4H 5C12A 3B6BA 4M3XA 1VQ9S 4K5RA 1F5BA 3IAYA 2VG7A 3TPQA 3MECA 3OVBA 1YRTA 3G96A 1T6CA 5DG8A 4QW8A 1BQMA 3CJRA 1CJTA 3ZZ0A 3QIPB 4BRCA 4YR3A 2IVNA 2QSFA 2GWJA 3KMSA 3DLLQ 4BC3A 3T5HA 4HHUA 1AFIA 3N6MA 1U26A 3FSXA 2HHHK 4JYAK 5A8WB 3RAQA 2GEMA 1VOMA 4UQGA 1OH5A 4UQTA 1UWAA 1XI1A 4F4XA 3OYHA 5KRSA 1QTMA 1WG1A 2R3VA 4M5GA 1SUQA 4B8CA 2WAQD 3RMDA 2FDNA 4AYBD 2DITA 1CJKB 5JVGQ 5AZIB 1MWZA 1D09B 4O3PA 4ZN1A 3ADAC 4DFKA 3HTVA 3WC0A 1TL1A 3THTA 4HTJA 4E19A 1XQIA 2ILZA 4HHHA 3GMGA 3TX0A 4OYIA 2GQCA 4UZCA 2GTDA 4ILGB 3UE5A 2R7SA 3WQPA 2W41A 2P9UA 2BJEA 5GVQA 1UAWA 4Q5VA 2W2OP 2DNGA 4M3ZA 3PXGa 2EBEA 4EI2A 4BACA 1WC1A 2HWTA 4CTAA 3W0LA 1P1TA 2NXCA 4DV3J 1ZM2A 4UOGA 3BBBA 1CLFA 4CLPA 2HBMA 3DHWC 4PYDA 4ZVTB 1BI4A 2K8GA 4Y1DA 5LJ3Y 2OPRB 5KG6A 3IR5B 3PJWA 1YJ9N 3P1GA 4C8KA 4OX8A 2BYCA 4CE9A 1X3MA 2P9LA 1ZA1B 1PBAA 2C2OB 3H8YA 4GV3A 2C3UA 3FNNA 4BDZA 4EO6A 2P9PB 2ZUGA 3IBCB 4BCAA 3NF7A 4S0MA 5HP1B 2NYIA 3MMAB 2WBRA 3Q2TC 2NUUG 2MY7A 3W1YC 2MYFA 4AHRA 4LF1A 1KAZA 2KXHA 1URRA 1RT2B 3VAKA 3AD8C 3CJ3A 2QFIA 2ZWPA 5GADI 2BKNA 2F9DA 4JV5K 3O6QA 2ZHAA 3SBGA 5J1EA 4OLBA 2IDEA 4A8QA 2W9AA 1RWMB 4DSLA 4JI4F 1QVGM 2GGPA 4W5NA 5C5JA 2M0GB 1HKGA 3MPDA 1NGJA 1NH8A 2C42A 2HHHJ 4JYAJ 4PKDB 4XAKA 2ERRA 4V19S 1R3NA 5EHHA 1U02A 3CULA 3ZTQA 5AXKA 4KH5A 2W2MP 1U0SA 4JI7K 4YB6A 4EU0A 1F9FA 1FDNA 2ATCB 2OJ3A 3L8BA 4DCPB 1S1WB 1TZ0A 3WXMB 2HVDA 1YVUA 3A5NC 2QT7A 3CCUN 4JI6K 3E1YA 4LT6A 1CQNA 4MIBA 2VWKA 3RAMA 3PJXA 2NRHA 1IBKK 3VAFA 5FPEA 2CPXA 1GTHA 2AZ3A 1X60A 3UNGC 4JKFA 3A12A 1RAOA 1S1XB 4K4YA 3KYLA 3VENA 1EX4A 2MGZA 4I2QB 4BR2A 3H2UB 1HMVA 3H7HB 4DR1F 1N5YB 4YOUA 1YRUA 1YITS 3S6EA 1ZBTA 4F0MA 2UUBF 3VN5A 1HQEA 2W2PP 4DV1F 2YHXA 1YZ7A 2DFEA 4OLPA 2N4CA 3PACA 2G0CA 2GCFA 2V50A 3FE1A 4ECRA 2JSXA 1N5VA 4B9MA 5DQHA 1YBAA 3MD3A 3I0RB 4QWBA 4PRFA 1HJOA 6FDRA 1I51B 3D66A 4UUWA 2BX6A 4KJIA 4J37A 1BLUA 3MCSA 2VFTA 2UXBF 1NB2A 2QEXN 3FMBA 4H0TB 3DU6A 2VC1A 4I1TA 1UCNA 3JAMO 2CZ4A 1TKTA 3F44A 4PUOA 1IUJA 3JS6A 1VQOS 2RVJA 4Y00A 1H74A 5J2QA 3KXDA 4BRQA 1HQ2A 5JXSA 4J5OA 3T5KA 1FFGB 4NCBA 4ECTA 4IFEA 1T03B 4URGA 8AT1B 1R8CA 2Z2LA 4JV5J 4X4TA 1FFSB 1H3DA 2R7VA 3PYDA 2B9WA 2RPIA 1W2IA 2VPXB 1JB0C 4J9QA 4GO5X 4ZCKA 4JD2B 1NGBA 3VR1A 3GOIA 3Q86A 3MOZA 1NDCA 2W4PA 3RWUA 1RUSA 1J53A 2BOAA 3H59A 2IM2A 2CDRB 2CG4A 3OY9A 4H5RA 2F9JA 1DQAA 4M5DA 2HQGA 3PX0A 1QJHA 4IKFA 3QAUA 1U1LA 1NU4A 3OXGA 3NGTA 1S1TA 2CFXA 4YDUA 4OZ5A 3CMES 1H7WA 3HZGA 1N33F 3CCUS 1BCOA 4LH5A 4ZVHA 4JI2F 4NLYA 4RO0A 2DVIA 3O9QA 4GC7A 1S49A 1ILYA 2EFOA 4RU2A 3T1YF 3WXJA 4BR0A 3K8VA 3VVUA 1YAGA 2EPIA 4Y1CA 4DLGA 3D2EB 5K5MA 1OS5A 3OFGA 3T9NA 4M7XA 4OLOA 4IFYA 4P7TA 3I55N 2R7QA 4IJAA 2QJ3A 1LOUA 1I6JA 3H45C 4MTPA 3H6EA 5HOOA 4CJLA 4C3MA 5KG4A 4USWA 2QWOA 2Q31A 3CCMN 4F4ZA 2DEIA 3IWXA 4L8RB 1RHUB 2HBZB 4J2EA 5F8IA 1VYAA 4MDAA 5L1KA 3O1LA 2OAUA 1U6FA 3BGOP 4J8FA 2H1YA 1ZM4A 2YNHA 1P9QC 3OFFA 5E3CA 3U1MA 2D4WA 2I7PA 1UVMA 4EBDA 2D69A 4BWMA 1S0NA 5HQ8A 4IWVA 2HHSA 3OPKA 1JXLA 3L3UA 4P73A 4HVZA 4IRCA 4FLVA 2D3O1 4IH6A 4DQSA 3MPYA 2F9TA 3CMAN 1GOBA 3K2PA 1EKSA 1HKAA 3TJ9A 2FBVA 1QVFR 2JLGA 4FVUA 3HYFA 5HQMA 2ACMA 3B4DA 3HVRA 5CD4A 3NCRA 4DZ6A 2MZRA 4FL9A 3TUJC 4RW4A 1S7IA 2YPYA 1JMTA 5IWAK 1M5VC 2WTFA 2CAJA 1DRZA 1GLJO 4W90B 2YX4A 4IOCL 3DLBA 4PR6A 4BRAA 2YKNA 2NLWA 3K8WA 4GRSA 4IQMA 1HI0P 4E89A 3I32A 1EJ7L 4ETZA 4PXCA 3T5LA 4ZN3A 3DGVA 3LP0A 5HRSA 2PMZD 2ZJRL 1JK9B 1XQSC 2UXCF 3CDUA 3VTIA 4RNOA 3THXB 1GX6A 1WKJA 3CNQP 2FTRA 3QO9B 3IRXA 3DLEB 2ABYA 3O3LA 4CH1A 3W8GA 1M0SA 2XYHB 4E3SA 4LR7A 3QLHA 4JP8A 2EI5A 1NCLA 3ITHA 3A5LC 4GKJK 3CW2C 4WIIA 4ENOA 3GFZA 4LMZA 3DJCA 4C8LA 4M63A 4ES2A 2DPIA 4ED8A 2O8CA 3RG6A 3B8HA 3S9HA 2JFDA 3HVTB 2O01C 2HBKA 5DLFA 4DX6A 2CQ4A 3CJQA 1YX2A 1XN9A 2CPFA 3Q8YA 3SFGA 2A41A 2CWKA 1EQMA 2FJVA 2W25A 2PYLA 1YRXA 1TL3B 3BGLA 1GFWB 2AF6A 4Z4HA 3AVBA 5DZ6A 4LF4F 1KC8T 2E1AA 2EC0A 3DRSB 4PWWA 3OXLA 1OIAA 5EX3A 2PA8D 2UXDK 1F3VA 1QAXA 1BC6A 3QJLA 2HFSA 4CBWA 1GLCG 1WAJA 1QM9A 2FHJA 1IBLK 2SXLA 3I56N 4FJHA 1ZBIA 1NNEA 4HTUA 4J9MA 4K25A 1YJWN 3T3FA 5DG9A 3CB4A 1RT5B 3F2KA 5EWEA 3KMQA 2F8MA 3LPTA 1AFJA 3L7OA 1VK8A 1UA1A 2BJ7A 4DB3A 1LCUA 4FPAA 1QUVA 2RAQA 3DC2A 3NS6A 4CZEA 4Z4GA 5IWAJ 4Q2LA 1IKXB 2WZ1A 4MLHA 4CLZA 3C6AA 3M8ZA 5IT9U 1UKUA 1S5ZA 2X7IA 3KUHA 4QWCA 4NLRA 3FFKB 2A1SA 3H20A 1JLEB 4RU9A 3QBWA 2EFQA 4B9TA 1S10A 3OYLA 3NH0A 1OVYA 2A6MA 4L75A 1ZETA 2GV1A 1OYEA 4W5QA 4WZMA 1A9NB 4ID1A 1H2UX 5D4NA 1ATNA 1KVKA 3MF5A 1N54B 1PKUA 3AA3A 3OYFA 4MKBA 4I6YA 1NGIA 3K0SA 2L08A 3ZEUB 1DY3A 3IXQA 4BBYA 2ATQA 3N0VA 4NLTA 3CWJA 2QTDA 4CGIA 1NOYA 4MDBA 4USVA 2DGWA 2V9WA 2HQ3A 4GKJJ 4I7FB 1OWXA 2HW3A 3TAPA 2P9KB 1P90A 5HI7A 5D4OA 4DR5F 1UVJA 3KUGA 1WTFA 3C6UB 1Q9YA 1JKHA 1EETA 3VGTA 2OPQA 4KAZA 3IAS9 2ADCA 3A8JA 4DR4F 1RAJA 3EGNA 5KFTA 4OI0A 3HRGA 1VQYA 5LJWA 2MKYA 4DSIA 3NVKA 4L3KA 1CJVB 5LY3A 2FZGB 3LZIA 3BV8A 3FZHA 4HT7A 4LBPA 1FJGK 4BG8A 1SL0A 1JJ2R 2QKKA 1S6OA 3EVMA 2FVSA 3HPOA 4G1PA 3EO3A 5KOXA 2IC3B 4PEOA 4BQZA 2UXDJ 2YKQA 5KFBA 3E9OA 4CLUA 3PLAA 4Z94A 1IM4A 4PL7A 2WHOA 1OQ3A 2HHXA 3Q7CA 3LTOA 2J9DA 1IKWA 1N52B 5HBMA 5CYJA 1S9EA 1YQHA 4KFBB 1WSEA 1Y7PA 3BBCA 2KDOA 1YTUA 3TA0A 1U09A 3MGJA 3KK3B 3DDNA 4J9NA 5AZJB 2J9DE 3V1QA 4FF1A 1ZZFA 1NG9A 2BJ3A 4ZPAA 3HHLA 3SK3A 3D6MB 2V69A 3ILOA 3SFUA 1IKYB 5F3TA 2W9BB 4X4UA 5SUHA 3M1FA 4EP5A 2PY5A 3TRGA 2E6MA 3H42A 4I6AA 2HNZB 1L3VA 1UFWA 2OPSB 3J80O 1DTTB 4B3OB 3SAHA 4FYYB 4WXWA 2GV9A 3F0NA 1GEHA 5EWGA 2E8AA 2D9PA 3QERA 4H4KC 3BZCA 3FRZA 4KE5A 1Q0NA 4G6VB 2MJNA 2YQ1A 2PIIA 2Q1NA 2M3DA 2XY5A 8RUCA 2VQFF 2HVIA 2BQRA 4FPRA 4FCYA 4WE1B 1S4EA 1DGKN 4EZ6A 4A61A 3UKRA 4C8NA 2NUBA 3Q8VA 2OEKA 2Z1IA 1HYZA 4QS7A 4WTYA 3ZZTA 3DMJB 3W5ZA 3G4SS 5BN9A 5M1PA 2QA4G 2AJ0A 3MCAB 2HAIA 3CJAA 4ZPBA 1FJGJ 3MZIA 2B6AA 1IWAA 2ZJPQ 1FDDA 1T05B 4DV5F 1QQNA 1XMQK 2GVDB 2HSTA 1XMOK 1S9FA 1EWQA 1FNMA 1OPZA 3GE9A 4NZ7A 4NCAA 3I4HX 5LM7E 1VSMA 1DTQA 5JVHQ 4X66J 3PEJA 2LXUA 1GX5A 1FO1A 1N8RO 4LC9B 3MPVA 1O0PA 2HGMA 5HMZA 2UUAF 1Y11A 5DJBA 4B1YB 2FXUA 3TX8A 2H48B 3MPUB 4CLKA 1VISA 3DDKA 2DNYA 2W6LA 3V4MA 1QE1B 1LWEB 1X4HA 3WEEB 4FJ8A 1ZTTA 3W9HA 3H5UA 4WZQA 3NS5A 4BS2A 2HAFA 4DR3F 3GLJA 3LUYA 1V3ZA 4K8XA 3C7NA 2VGNA 4FOEA 4ILMA 1QSSA 2I8EA 4HACA 2ZOGA 1PSDA 1JLGB 4AL6A 1HHSA 1B0PA 3KDNA 4KPYA 1T3OA 4P71A 3ILJA 2YV0X 1M1KT 1MWKA 3VQDA 3A13A 2HEKA 1CXUA 4GV9A 3VQ4A 5HJXA 3DRPB 1ELOA 1UWBA 4CFAA 3M1VB 2FZCB 1RXOB 4CJ3A 1HKCA 1H2TZ 3EX7B 1KQSM 3SQ2A 4GVBB 2KB2A 4OYAA 4DV2F 1D0EA 4AH9A 1NBEB 3VQAA 1B99A 3QFUA 3SJHA 2QK9A 2HNDA 3ASMA 3OVAA 5A76A 1RABB 5KT4A 2QWLA 4U7UK 4M5JA 1HPZA 4JI1F 2G2OA 2G8WA 3OBYA 3P3DA 2NS1B 2XZWA 2QIFA 4CBXA 2COLA 2V2QA 3GP9A 4DF8A 1XMQJ 4AUKA 2DGQA 2VFSA 1XMOJ 4HDHA 1Q8KA