4QAGA

Structure of a dihydroxycoumarin active-site inhibitor in complex with the rnase h domain of hiv-1 reverse transcriptase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
b'LWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structure of a Dihydroxycoumarin Active-Site Inhibitor in Complex with the RNase H Domain of HIV-1 Reverse Transcriptase and Structure-Activity Analysis of Inhibitor Analogs.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4qagA00
4RW7A 4RW8A 3THVA 2LSNA 1JLCA 1YTAA 4GVMA 3VQ9A 2F8SA 4M3RA 3HXMA 1NK8A 3C6TA 3AVKA 2ZE2A 2PYLA 1WNSA 4E7KA 4CF2A 4PUOA 2EHGA 2G8IA 1C0UA 1Q9XA 1SUQA 3RR8A 3RRHA 2NUBA 2IS3A 3AVHA 3AVNA 5HP1A 4CGIA 1RBRA 3PV8A 3WNEA 2YV0X 4M45A 4N56A 1RT5A 3KK3A 1Q9YA 4B9MA 4KI6A 3M8SA 3QO9A 4FLYA 2OPQA 2RPIA 3S3NA 4FW1A 3OJSA 4KHWA 3DLBA 4E7JA 1XI1A 1C1BA 3M8QA 1CZBA 3SJJA 4B3OA 4IBNA 1NKCA 5C24A 3AO3A 2DFFA 3ZCMA 1ASUA 5CY4A 3BGRA 3OYEA 1IG9A 1QSSA 3NFAA 1RTJA 3AA4A 3MXIA 3O4QA 1WSFA 4DMNA 3KKSA 1EP4A 4RG8A 4HUGA 1L3SA 4DSKA 4WE1A 4KRFA 4CK1A 4DFMA 3OYJA 4DU4A 4M3XA 1NK7A 4CHZA 3IRXA 1UAXA 4CFAA 1S1XA 2Q3SA 3KLIA 3EZ5A 3SV4A 4W5RA 1BL3A 4DLGA 3SQ2A 2IDOA 1T05A 3C95A 3LPUA 3VQQA 1A5XA 3QETA 2EX3A 1Z25A 4CEZA 1C1AA 1LWFA 2HNYA 1DTTA 3HYFA 4M41A 3VQ7A 3KLEA 1UOCA 3AA5X 4Y1DA 3SCXA 4CGJA 4FJGA 3SUOA 4H4MA 3QLHA 3HK2A 5DMRA 2IC3A 4B9UA 1LV5A 3QIPA 3MXMA 1JXEA 3HPHA 4AILC 3QEIA 4KTQA 4BDPA 4ICLA 1U48A 4I9LA 4FLXA 4E7LA 1LAVA 1XHZA 4AHVA 3K5NA 2A1RA 4EP4A 1DLOA 5HRSA 1TGOA 3BDPA 1U04A 2VG6A 3PY8A 3L8BA 3LZJA 4BWMA 4CHYA 3AO2A 3IG1A 4CGFA 3ALYA 1RT3A 4DLEA 3TAFA 3DLEA 4H4OA 3AVFA 1L3UA 4CJFA 1BIZA 3TAGA 1KVBA 3PO5A 4PQUA 2VWJA 1S1WA 2IAJA 4O4GA 4RW9A 3OY9A 3RWUA 3VA0A 4OGCA 4JRPA 4HUFA 4FJ8A 3NGZA 4E7HA 4ZTFA 5CYQA 1C0TA 3CFOA 2W42A 4DTPA 1ZBIA 4FJ9A 3SUQA 3EYZA 2FBTA 1YVUA 2G8UA 4B9TA 4DTOA 3QEWA 3VA3A 1RT7A 4OPKA 4LSLA 1C1CA 1JLFA 3KD1E 1HYVA 1RDAA 3TWHA 4FJNA 5J2PA 1C0MA 3LWMA 1RDDA 4G1QA 3OVNA 3SYZA 3KKRA 5KGXA 3TABA 4F8RA 4CF1A 2FC0A 4OLBA 1D9FA 4FLZA 3KK2A 3TAEA 1IH7A 4C8OA 1S6QA 1C6VA 1B92A 4CEAA 4CJQA 2YNGA 3WNHA 1LAWA 3F73A 1NJWA 4AHTA 3HJFA 1HJRA 1GOBA 4QOZB 1XWLA 3C94A 4GW6A 3WNFA 4HVJA 1EKEA 1RT4A 3L2WA 3P5JA 3QEVA 3B6PA 4MQ3A 2P1JA 2Y1JA 1SL1A 3LWLA 3TAMA 3HL8A 5SWMA 3QNOA 3NAEA 1T7PA 1J54A 2IGIA 4MFBA 2F96A 1J9AA 3KLGA 4O0IA 3O3HA 3S3MA 1SKSA 1XC9A 4AHCA 2PYJA 4KHQA 3NH1A 5CYMA 1JLEA 2ZD1A 4FJKA 1TL3A 5KTQA 4ELUA 4N5SA 3ISNC 4ID5A 4KTZA 1CXQA 4OJRA 4E1MA 4DTMA 3D0PA 3ZSZA 3OYGA 3QEPA 1X9MA 1NK0A 3NF9A 4M3TA 3O4NA 4KREA 1VK0A 1I39A 1SL0A 3V9XA 4B9SA 4NCAA 3K58A 1D5AA 4Z4CA 4OPJA 1U49A 4B9LA 4Z4GA 2HHQA 1SKRA 1VSDA 5C25A 3S3OA 4F4KA 1EXQA 2E6LA 5HROA 4CCHA 4CJWA 1LW2A 4LH5A 1U4BA 4DFKA 4FJIA 4FZZA 1IKYA 1TKXA 1JL1A 4CJ4A 1J53A 4Q5VA 3LALA 4JRQA 4FJMA 4BE1A 3MEGA 3QIOA 5T7BA 2FBYA 1BISA 1UWBA 4OLAA 2RF2A 3O3FA 3DLHA 3MECA 5JS1A 5KI6A 2FBVA 3OYDA 4O44A 4CEQA 1DTQA 1X9SA 3SZ2A 4BE0A 4QCLA 2QK9A 3NGYA 4O5BA 3CFPA 1TV6A 4CF8A 3CG7A 3VQAA 3V9UA 3V81A 1W9HA 4NYNA 3SUPA 4UQGA 4DTRA 2KTQA 3K2PA 3OYNA 4BACA 4M3ZA 4Z4HA 1B9DA 1QHTA 4FM1A 4FJ7A 3DLKA 1HQUA 1I3AA 3WNGA 4DG1A 3ZSQA 3KLHA 3OYKA 2GBZA 3RTVA 2X78A 2DTUA 3SUNA 4ZHRA 2HHTA 4FW2A 3JYTA 5J2MA 1TAUA 4F3OA 3SQ4A 1W0HA 3DOKA 3LPTA 3HP9A 4KI4A 2VWKA 3ASMA 3DLGA 4CERA 1Y97A 1FKPA 4IDKA 4AHRA 4CEBA 3L2UA 3HVRA 3RMAA 4LD0A 4PA1A 4E19A 3NF6A 3MXJA 3TI0A 2G8WA 4C8KA 4DWIA 4KPYA 1UA1A 1JL2A 4W5TA 4I2PA 1FXXA 4N76A 2YKNA 3OS0A 4CJUA 4FXDA 4B08A 3AA2A 1KSPA 1VRUA 5K14A 1JLGA 1RT2A 2XHBA 3U6FA 3NF7A 1CLQA 4CK3A 1NOYA 3NF8A 2HW3A 1HMVA 4CGHA 1ASVA 4B8CA 4OVLA 4FJLA 4W5NA 1RBUA 1BGXT 3HPGA 4DS5A 4ELTA 2I5JA 3U3YA 3SQ1A 4KB0A 1HYSA 1RBVA 3VQ6A 4FK4A 3V1QA 4JS5A 3P83D 1WSIA 4BE2A 4FZYA 3I0SA 2E4LA 4BWJA 4E89A 2P5OA 1Z26A 3LP3A 2VG5A 2BANA 3I0RA 4KTWA 1JKHA 4FM2A 3L3VA 4DF4A 1TK0A 4C8NA 1YTUA 2BDPA 4M42A 1S9EA 3QEXA 3D45A 3DRPA 4E7IA 3MEDA 2G8KA 4CJVA 4CEOA 3A2FA 2DFEA 4CHNA 3OJUA 3TARA 4DQPA 1KLMA 4B9NA 4IFYA 1HNVA 4DSLA 3K5LA 4DTSA 3M8PA 4DSFA 3PUFA 5SZTA 2OPRA 4YNQA 3NE6A 1XHXA 1QSYA 1GOCA 4W5OA 2YHBA 4CEDA 3ZSXA 5HRNA 4PY5A 1TKDA 1FKOA 1IKWA 4HTUA 1WAFA 4HCBA 1WSHA 2IOCA 3SQ0A 2KQ2A 4O0JA 4XIUA 3B6OA 1TVRA 2RN2A 1QTMA 4I2QA 4CIFA 4LY7A 3L2VA 4CGDA 4F3TA 3HM9A 2GUIA 4AH9A 3PO4A 3LDSA 3K5OA 3SPYA 4W5QA 1HQEA 1N6QA 1BCMA 1KCFA 3AVGA 4KFBA 3AVAA 3AVIA 5D3GA 3ULDA 3EY1A 3AO4A 3ZT0A 4HCCA 4N47A 3QNNA 4HHTA 1RDBA 5J1EA 4HUEA 1SL2A 2HVHA 2Z1JA 3FFIA 4OKKA 4CK2A 3AVMA 2HHVA 4KHYA 1JXBA 3KK1A 1VSHA 1RT6A 3PX6A 4B9VA 4DQIA 4JS4A 3CYMA 3KIOA 3G10A 2E6MA 1BI4A 1RCHA 1GOAA 2ATQA 4CFDA 3ZSVA 3L2QA 3ZT1A 3DM2A 2D5RA 4CJPA 4E1NA 3TANA 4CEFA 4KO0A 1JLAA 2HNZA 4FZXC 3I8DA 2XY8A 1ZBHA 3OYLA 4CF0A 2QKKA 4CJEA 3QERA 3ITHA 4CJ3A 4CECA 3RMBA 2D0CA 2BE2A 1A5VA 4R5PA 3LAMA 1RT1A 1ITGA 3ZT4A 4FJXA 2B5JA 1IKXA 2YKMA 4CHPA 4KHNA 1VRTA 3VQ4A 3V1RA 3NH2A 4TSXA 3T1AA 3U3GA 3VQBA 4DS4A 3V6DA 4K8ZA 2HHSA 4ZTJA 4JLHA 3TAPA 2B6AA 3AVJA 1HYZA 3KD5E 4OKJA 1VSEA 1NJXA 4CJ5A 3AV9A 4NYFA 2KZMA 1QS4A 4M3YA 2PZSA 2WOMA 2YNIA 4RW6A 1WN7A 4N41A 3RR7A 4NCBA 4DF8A 4CJLA 3G0ZA 1WSJA 3LAKA 3AA3A 3TR8A 3VQ8A 4DTJA 1O1WA 1BI4B 3KLFA 1YT3A 3TAQA 4DU1A 1RTIA 2DFHA 4IKFA 3OYBA 1S6PA 5FRMA 2ITGA 4Y1CA 3OYCA 4FK2A 1KFSA 2BGGA 1WSGA 4DSJA 1EETA 1VSJA 4FM0A 3NGIA 3AO5A 4OKEA 1TKZA 3NH0A 4J2DA 1SV5A 5CZ1A 1IO2A 1WLJA 3M8RA 2OYQA 3ZSWA 4M3WA 2Z1IA 4DTNA 5KRSA 2Y1IA 2D0AA 1UA0A 2XRIA 2X6NA 1F21A 3NHGA 1IKVA 4FJJA 1KTQA 3DMJA 3SNNA 3OYFA 2JGUA 4FCYA 1LWCA 4CF9A 3PX4A 1A5WA 4DQSA 3V1OA 4EZ6A 2HHUA 2OPSA 4KKOA 3RMDA 3ZSYA 1G15A 1MU2A 1TKTA 5C42A 3MEEA 1CZ9A 1RTHA 1T8EA 1RTDA 4CJSA 2HNDA 3NCIA 1WSEA 5FRNA 4CIEA 1TAQA 4ID1A 3T19A 4CFCA 1D8YA 2G8VA 5HLFA 4CJRA 3OYMA 4J2AA 3LANA 3CQ8A 2XY5A 2ETJA 1L5UA 2QKBA 3VQPA 3K57A 4O55A 4CJKA 4E3SA 4EZ9A 4CIGA 3VQCA 2YNHA 4DFPA 3LP2A 4Q0BA 1QSLA 2GV9A 3K5MA 2QXFA 3HSTB 1S1TA 2PY5A 3ZSOA 2O4GA 5I42A 1TK5A 5J2NA 4KAZA 2OZMA 3S9HA 5FDLA 1HRHA 4CE9A 3HT3A 3O3GA 2VG7A 5HRRA 3VN5A 3RRGA 2HVIA 4F2SA 5HBMA 4FLWA 3V9ZA 3K59A 1HNIA 3VQEA 2HMIA 4DFJA 1S1UA 4LSNA 3F9KA 4CEEA 4FYDA 5HRPA 1BQNA 1NK5A 1T03A 2F8TA 2XO7A 3KTQA 2JLEA 1ASWA 4NCGA 2R7YA 1KLNA 1WAJA 3AVLA 3HVTA 4DTUA 1VSLA 3HP6A 5J2QA 4CHQA 2XY7A 2WONA 4IG3A 4DU3A 1U47A 4CJTA 1KRPA 2KW4A 4CFBA 3DRRA 3DYAA 4IG0A 1KVAA 4FLVA 1BHLA 3CFRA 1EX4A 1X9WA 2A1SA 3AVBA 5I3UA 1L3VA 4BDZA 4FJHA 3LP0A 4CESA 4DTXA 3SPZA 4DSEA 3QINA 1R0AA 4K8XA 3T3FA 5KRTA 4PWDA 3L2RA 4FLUA 2P5GA 4C8MA 3ZT3A 4C8LA 5FROA 1D9DA 4CGGA 1NK4A 4KHSA 3NBPA 1X1PA 1S9GA 1RNHA 1S1VA 2O4IA 2HB5A 4B8AB 4Z4IA 2G8HA 2HHXA 3MAQA 5EU7A 3V4IA 3CM6A 4Z4EA 2RKIA 3SV3A 4FLTA 1ZBFA 2G8FA 3HO1A 1RBSA 3AO1A 2X6SA 2ZQBA 3DOLA 3E01A 3P1GA 3OS2A 2OA8A 2X74A 4AHSA 1VSFA 2DY4A 1KFDA 4CHOA 1LWEA 2Z1GA 4KV8A 4FVMA 5JS2A 3V9WA 1ZYQA 1RILA 1TL1A 4AHUA 4I9QA 4I7FA 4OGEA 1BQMA 3VQDA 1QE1A 3SI6A 4ELVA 1S5JA 3H08A 3LZIA 3DRSA 4LH4A 4F2RA 1NK6A 1J5OA 2KFNA 4E0DA 4J2EA 3OYAA 5DK5A 3QESA 3ZSRA 1CXUA 3JSMA 4KB1A 4Z4FA 4KHUA 3OYIA 1NK9A 2B4JA 1JLBA 4RW4A 3UIQA 1L3TA 2FBXA 1NOZA 4DQRA 4YFUA 2OPPA 2Z1HA 3LP1A 4H8KA 5E41A 4J2BA 2OZSA 1VSIA 1NJYA 1NKBA 1LW0A 5CZ2A 2HHWA 1VSKA 4FK0A 1VSMA 1REVA 3OS1A 1B9FA 3PX0A 1QQCA 2XY6A 1BIUA 1JLQA 1RDCA 2YHAA 3HPOA 3DLRA 1NKEA 4GMJB 1RBTA 4DSIA 3DI6A 1KVCA 1BCOA 3VQ5A 3V9SA 4M3UA 3C6UA 3ZT2A 2KZZA 3CM5A 4L8RB 4EP5A 1N5YA 3NDKA 1HPZA 3L3UA 4FJ5A 4IFVA 3KJVA 4BDYA 2KFZA 2AJQA 1ZBUA 2D0BA 3OYHA 1TK8A 1NJZA 2P51A 3AVCA 3IS9A 1SKWA 1FK9A 1U45A 1K6YA 4QAGA 3RMCA 4Z0UA 1ZBLA 2YNFA 3IAYA 5KGWA 1Q8IA 4DQQA
chains in the Genus database with same CATH superfamily
4RW8A 3THVA 2LSNA 3HXMA 3AVKA 3MX2A 2PYLA 1WNSA 4PUOA 4CF2A 2G8IA 1SUQA 1IBKK 1DT9A 3AAQA 4UY8O 1N32K 2NUBA 3AVNA 5AQIA 4ILHA 3WNEA 4B9MA 4N56A 3QO9A 2RPIA 3S3NA 1HJOA 1P90A 2DFFA 3ZCMA 3OYEA 1IG9A 5AQKA 3MXIA 4BRKA 2NRXA 2W6KA 4LF6K 4WE1A 4CK1A 4DFMA 4DU4A 4M3XA 3K9JA 4BR2A 1UAXA 2Q3SA 1Q82O 3EZ5A 1QQOA 3LPUA 3R8EA 4BRGA 3VQQA 1BO5O 1Z25A 5AQLA 1C1AA 3D2FA 3SAFA 1YUWA 3KLEA 4Y1DA 3A5LC 4CGJA 4FJGA 2O8FB 1EWRA 1VQKN 3VGKA 2UXCK 5AQZA 3MXMA 2AA4A 2P9PA 3HPHA 4BDPA 4ICLA 4I9LA 4E7LA 1LAVA 3K5NA 1WOQA 2A1RA 2E2OA 4OX9K 3DLLL 2VG6A 4YOVA 4PKIA 3MN6A 4ILJA 3WXKA 3HSCA 2NRWA 2VWBA 3AVFA 5FLXO 4CJFA 2O8EB 1ATNA 2VWJA 4RW9A 4OGCA 4JRPA 4HUFA 4JKBA 4ZTFA 1IV0A 1C0TA 2ITMA 1IG8A 2P9NA 3FLCO 5E84A 4DTOA 3KD1E 2UYTA 4B3SK 2ZJRL 3TPQA 2WBNA 2FC0A 4EIAA 5C10A 2Q36A 3KK2A 4CJQA 3WNHA 1LAWA 4AHTA 2VGMA 3WNFA 1RDWX 3P5JA 4DR6K 3B6PA 3CJ1A 1P8ZA 4DR5K 3TTCA 5SWMA 1T7PA 4IJNA 5BR9A 3ZLJA 2Q2RA 1RDUA 4JD2B 2QM1A 3KLGA 4JYAK 3H3OB 4RWTA 3NH1A 2HHHK 1JLEA 5KTQA 3ISNC 4KTZA 3QEPA 1NK0A 4KREA 1I39A 1NGEA 2WUSA 2O8CA 3BF3A 4AM6A 4B9LA 4OPJA 2GWKA 3H6EA 5HROA 2HBJA 3U9ZA 1BDGA 4XEIA 4LH5A 4FJIA 4FZZA 3HBTA 1MA9B 4U67L 1TKXA 1JL1A 1VHXA 4CJ4A 4JRQA 2P9KB 3LALA 4BE1A 3CJCA 5ADXA 4CBUA 1BISA 1UWBA 4MDBA 4O8KA 4BRHA 5JS1A 2QWMA 4CEQA 3DJCA 3OHRA 3VQAA 3V81A 3HOSA 3AY9A 4DTRA 3TSUA 4Z4HA 1QHTA 4DG1A 3ATVA 4JI2K 2GBZA 3RTVA 2X78A 4A59A 3SUNA 4FW2A 4MLHA 5J2MA 1TAUA 3SK3A 3ASMA 1FKPA 4IDKA 4LD0A 4E19A 3TI0A 4C8KA 1UA1A 1JL2A 4I2PA 1FXXA 4DUYK 3MN7A 4PKGA 1KSPA 3W0LA 3QBWA 3NF7A 3A5MC 1W2BM 1QQMA 1HUXA 2A3ZA 5BPLA 2UUBK 5M1PA 1HYSA 3U3YA 4X64K 1RBVA 1WSIA 4BE2A 4BWJA 3R6MA 3LP3A 1EQYA 3M1FA 2BANA 3I0RA 2CH5A 4DF4A 2E5LK 4FWOA 2O8BA 2BDPA 4IEIA 1S9EA 4E7IA 2G8KA 3A2FA 1GLAG 1KLMA 4B9NA 3O9QA 4DTSA 1VQ7N 4DSFA 1ZBSA 2OPRA 4M7YA 3L4IA 1QSYA 4W5OA 2YHBA 3ZSXA 3P39A 3CMEN 1FKOA 5KPRA 1E4GT 1K73O 1N34K 2RN2A 1QTMA 4G9ZA 3VETA 4F3TA 1Q7YO 3HM9A 3LDSA 3SPYA 1C0FA 2ZGZA 3AVGA 3AVAA 5AQHA 5D3GA 4KH6A 3ZT0A 3VERA 4HCCA 4N47A 3AAPA 4XH5A 2ZWHA 4K42A 3FFIA 3AVMA 2HHVA 5FPDA 1OVQA 1RT6A 3TSPA 4JK7A 2YHYA 2UXDK 2ATQA 3L2QA 3THXB 3TANA 3O08A 4CEFA 3I8DA 2XY8A 1ZBHA 2QKKA 4DR4K 5FPNA 3ITHA 4CJ3A 3RMBA 4BRQA 1RT1A 4NLBA 4FJXA 4IEEA 5JVHL 1IKXA 4YOUA 1MWMA 3V1RA 2GUPA 4TSXA 3O9TA 3N4PA 1DKGD 3KVGA 1VSEA 3RSEA 1GLFO 4X66K 3AV9A 4YHHK 3H1VX 2PZSA 2WOMA 1OH5A 2UU9K 4JKEA 4CJLA 4DTJA 1WSJA 1HNZK 3EE8A 1W97L 4B3TK 1YT3A 3TAQA 1RTIA 3HRGA 1NGIA 1S22A 1WSGA 4DSJA 2BGGA 4FM0A 3U8XA 4FOEA 1TKZA 1X9JA 4FWMA 1WLJA 3SMSA 2OYQA 1SZ2A 3RVCA 3ZSWA 2Z1IA 4DTNA 5KRSA 2IIRA 1KTQA 2ASOA 3OYFA 5LJWA 4H0TB 2Q1NA 4FCYA 3CF5L 3PX4A 1A5WA 2HHUA 4KKOA 4WFNL 3RMDA 1MU2A 1WUAA 1T8EA 1RTDA 1WSEA 2QEXN 1HNWK 5HLFA 2ETJA 3DXKB 3K57A 3T1YK 4O55A 4CJKA 4I6MB 5GAHP 2YNHA 3LP2A 3K5MA 1S1TA 4GV3A 1QHAA 4KAZA 3HT3A 2HVIA 1YHQN 3CC4N 4WFBL 1SAZA 4DUZK 5AQJA 5C15A 3K59A 1HNIA 3ULEB 4FYDA 5HRPA 1BQNA 2F8TA 2JLEA 2CGKA 4DQ8A 4DTUA 1VSLA 2XY7A 5A2QO 4DU3A 4CJTA 2KW4A 4CFBA 1GLJO 4IG0A 1YJWN 3AVBA 3E66A 4IDHA 1XMQK 3VMFB 1R0AA 4DTXA 4DSEA 4JEPA 4C8MA 4C8LA 3THYB 4LF4K 2ASPA 4K43A 4B8AB 3JS6A 4ISFA 1IJJA 3SV3A 3J8AA 4LF9K 1ATSA 2G8FA 3HO1A 1RBSA 3OS2A 3E01A 2RHKA 2NRVA 2D4WA 3OBYA 1VSFA 5BRDA 3UE5A 3D2EB 3V9WA 1U6ZA 5JVGL 4AHUA 4CZKA 2WTUA 4ELVA 2P9PB 1J5OA 2OTJN 4E0DA 3QDKA 4KB1A 4Z4FA 4EHUA 5GADP 3OYIA 1XUPO 3CIPA 2FBXA 3LP1A 2A42A 4DV1K 1K8KA 2OZSA 1NMNA 1LW0A 5CZ2A 2P9LB 1VSMA 1REVA 5LMUK 1RDCA 3DLRA 4DV0K 4GMJB 3VQ5A 1BCOA 1T6CA 4L8RB 4EP5A 3NDKA 1N36K 4BR4A 4BDYA 2KFZA 2P9IA 4H0PA 1NJZA 3O9SA 1U45A 4Z0UA 5KGWA 4XH4A 4FPAA 4H5TA 3NVKA 1JLCA 4JNEA 4CZIA 1N33K 2F8SA 3O1BA 3C6TA 2ZE2A 3J80O 4E7KA 3FZMA 1C0UA 2IS3A 3PSIA 3VEYA 2YV0X 4M45A 5MLCQ 1VQLN 4KHWA 2QI2A 4E7JA 3M8QA 1ASUA 3ENBA 4BRPA 1KAZA 1QSSA 3AA4A 4JHDA 1WSFA 4Y0WA 4FL9A 4RG8A 2O8CB 5GINA 4CHZA 3IRXA 3SV4A 3SQ2A 3C95A 3MN9A 4J8FA 2V51B 1A5XA 3KHYA 1LWFA 3ZX2A 3HYFA 4O8UA 3QICA 3QLHA 1JCGA 3HM8A 1NGBA 1LV5A 2FXUA 1CZAN 1DLOA 5H1SQ 3BDPA 3PY8A 1S72N 4R79A 3THWB 3LZJA 1OH6A 4BWMA 3DLEA 1L3UA 4PQUA 3TAGA 1G99A 3CJ9A 2VQFK 1S1WA 3LDPA 3VA0A 3NGZA 2IVNA 2W42A 1ZBIA 4FJ9A 4CVNE 3SUQA 4BRLA 4MO4A 1YVUA 2G8UA 1RT7A 3LDNA 4LSLA 2E2NA 3G71N 3TWHA 4FJNA 3FZKA 3VESA 1C0MA 3SYZA 3ZEUA 5KGXA 4CF1A 1NJIO 3HI0A 2UUCK 4B1UB 3TAEA 4C8OA 1S6QA 1B92A 4WCEL 4BR7A 1HJRA 1GOBA 4FWNA 4GW6A 4QOZB 3A5OC 3VPZA 2Q0RA 1MWKA 4DB3A 3QEVA 1SL1A 2P1JA 2Y1JA 3NMUA 4JKGB 2CH6A 3TAMA 2YI1A 4JI0K 4MFBA 2D1KA 5BR8K 4A62A 4FOIA 4GV6A 4O0IA 3S3MA 2ZGYA 2PYJA 4KHQA 1HR0K 3MMVA 4FWQA 1TL3A 4NXMK 3CCUN 4N5SA 3WXIA 3M3ZA 4C23A 3MWPA 4OJRA 3ZSZA 3OYGA 1M90O 1BUPA 2V52B 3V9XA 4NCAA 4K0KK 1U49A 4Z4GA 2IVOA 2HHQA 4X65K 1SKRA 1VSDA 5C25A 4DV7K 4CCHA 1LW2A 4LF8K 3O6WA 4DFKA 4CD3A 1IKYA 3VEVA 4FJMA 4KHPK 4BR9A 3FZLA 5ELZA 3MEGA 1YI2N 1K8AO 1QZ6A 2QWOA 4DV2K 4XH1A 3E9PA 2BH1A 2QWPA 3K9KA 4QCLA 1VQNN 5AFUH 3CG7A 3IUCA 3P31A 3SUPA 4JI8K 4UQGA 3ID8A 3ZX3A 4RCHA 1NGFA 3O9RA 3OYNA 4M3ZA 4FM1A 3LM9A 1I3AA 3WNGA 3ZSQA 3OYKA 2W40A 1W0HA 3HVRA 4CERA 5KQ8A 4CEBA 4AHRA 3SQ1A 3C65A 4DWIA 4KPYA 3NF6A 5C2DA 1DEJA 4W5TA 2YKNA 4H5RA 2ZJPL 2QWLA 4B08A 4YOWA 4CK3A 2HW3A 4HTLA 4CGHA 3CCVN 4JI6K 3CJBA 1RBUA 4KB0A 3HPGA 2I5JA 4FK4A 4JS5A 2E8AA 2E2QA 1NU0A 1BOTO 4KTWA 4FM2A 3L3VA 1TK0A 1X3NA 4DR3K 1YTUA 3QEXA 3D45A 3TARA 4CHNA 4IFYA 1HNVA 3M8PA 4CZEA 4YNQA 2NNWA 1XHXA 3QB0A 3TTFA 5DM6L 1OKJA 2I7PA 5HRNA 4CEDA 1IKWA 1FJGK 1WAFA 1Y64A 3H46O 2KQ2A 4PHTX 4XIUA 4CZJA 3ZETA 4I2QA 4CIFA 1KCFA 4KFBA 3AVIA 4C1NI 3EY1A 3AO4A 2FF3B 2DPNA 4HHTA 4OKKA 5GAGP 2HF4A 3F9MA 3PX6A 2KLAA 2NRHA 3CYMA 4KH5A 3G10A 5HL7L 2E6MA 1BI4A 3ZSVA 4KO0A 3SBTA 2HNZA 5JLFA 2P9SB 4WF9L 4CJEA 4JI5K 4CECA 5AQUA 4DKWA 1A5VA 3LAMA 3S41A 2P9UA 1ITGA 3ZT4A 4CZFA 1H1VA 4CW7B 1VRTA 3NH2A 3U3GA 1NGJA 4K8ZA 2B6AA 3CQXA 1HYZA 4OKJA 1YITN 1TUUA 4NYFA 3DXMA 4B3MK 4M3YA 3KK7A 3KWIA 3T1HK 1GLEG 3AA3A 3LDLA 2QA4N 1O1WA 3L4QA 3KLFA 4FWPA 3OYBA 1S6PA 1HKCA 4BC3A 5FRMA 1KFSA 3VTHA 4OKEA 3M6GA 1IO2A 4YOYA 5AJ3K 2Y1IA 2D0AA 4FJJA 1IKVA 3SNNA 3PLAA 2JGUA 1LWCA 3WEEA 4CF9A 3V1OA 2OPSA 3ZSYA 3JXUA 5C42A 3MEEA 1CZ9A 1RTHA 4CJSA 5FRNA 2NRTA 3BP8A 1TAQA 3T19A 1JCEA 4CJRA 4B9QA 3CQ8A 1L5UA 3VQPA 3G4SN 3G25A 4E3SA 4EZ9A 4CIGA 2QXFA 3CETA 3P4IA 2O4GA 5I42A 1TK5A 5J2NA 1C0GA 1M1KO 2OZMA 2VG7A 1N8RO 3HZ6A 2PFUA 4DFJA 4LSNA 3BY5A 1NK5A 2D0PA 4H03B 1KLNA 1WAJA 2Q0UA 3HP6A 2WONA 5AQNA 5C2FA 3WT0A 1VQ9N 4FWKA 3T69A 1NMDA 3DYAA 1TYQB 4IOXA 4YORA 3U4LA 1X9WA 1VQ4N 2A1SA 5I3UA 4FJHA 4BDZA 3M5RA 1QQNA 2O8DB 3L2RA 4FLUA 3C6AA 3ZX0A 4KHSA 1NK4A 3VEWA 1RNHA 1S1VA 3VF2A 3D7EO 3MAQA 3O1WA 4CZLA 3CM6A 2RKIA 3J7AP 1ZBFA 3CI5A 3MX5A 3P1GA 2X6SA 3DOLA 2Q31A 5CHIA 1NWKA 1LWEA 5F1XA 4FVMA 5JS2A 1YAGA 2YHWA 1ZYQA 1RILA 1TL1A 4I9QA 2BUPA 3VQDA 3UKUB 1S5JA 3H08A 4WQ4A 3LZIA 2O8FA 4LH4A 4A2AA 2BTFA 4J2EA 3OYAA 5DK5A 4NB4A 3JSMA 1NK9A 1JLBA 3AARA 1L3TA 4J2BA 4BQLA 2Z1HA 4H8KA 4DHYA 1GLBG 1NKBA 1VSKA 4FK0A 2CGJA 2A40A 3PIOL 1RBTA 3V9SA 5AQXA 1YIJN 3LDQA 3CHWA 3EE9A 1KD1O 2KZZA 1U2VB 3C7NB 2AJQA 4YY3K 1TK8A 3AVCA 1IBMK 1NM1A 1SKWA 1FK9A 4DR7K 3GOIA 1OVYA 5AZIB 4QAGA 3RMCA 3EKSA 3RWUA 4DQQA 4RW7A 1JCFA 3EN9A 2EWSA 3J7ZO 1NGDA 4GVMA 1YTAA 3VQ9A 5HOOA 3UKRA 4M3RA 1NK8A 4QS7A 2EHGA 2QWQA 3RRHA 5M1FA 2QXLA 3AVHA 5HP1A 4CGIA 3KK3A 1Q9YA 1WBBA 3CERA 1ESVA 4FLYA 2OPQA 4FW1A 3DLBA 4JK8A 5KPZA 1C1BA 3SJJA 4IBNA 1NKCA 5C24A 3AO3A 2WFBA 5CY4A 3BGRA 1Q86O 5AZJB 3A8YA 1EO1A 3CPWM 1L3SA 1LCUA 4KRFA 3CJAA 2O8EA 1NK7A 2NRZA 3EZWA 5AQFA 1BG3A 1T05A 3SBGA 4HWIA 3HTVA 4M41A 3L6QA 1UOCA 3SCXA 1VQ8N 3SUOA 2PAVA 4H4MA 3LM2A 2NZTA 5DMRA 4B9UA 3I8BA 3QMLA 3QIPA 1JXEA 3VTIA 4AILC 4KTQA 1U48A 1XNRK 4FLXA 1XHZA 5AQTA 4AHVA 2HF3A 2FF6A 4EP4A 4H5VA 5AQVA 4CHYA 1QVFM 1HPMA 5JICA 4DLEA 4M7XA 4FPBA 4H4OA 3PO5A 1BIZA 1KVBA 4O4GA 2IAJA 2FLOA 4FJ8A 4JD2A 5CYQA 3FR0A 4BC4A 4B9TA 3EKUA 3D2FB 4OPKA 1JLFA 1HYVA 1RDAA 5J2PA 3LWMA 1RDDA 4G1QA 3OVNA 3TABA 1IH7A 1X3MA 4CEAA 3F73A 3HJFA 4OPHA 3C94A 4HVJA 1RT4A 3EEQA 2P9KA 2ZF5O 3LWLA 1IBLK 3CJ7A 3I55N 3QNOA 3KZBA 2F96A 5TKYA 1J9AA 1XC9A 4AHCA 5AQGA 2P9NB 2GTDA 4ID5A 2F9TA 4E1MA 4DTMA 3D0PA 4M3TA 4DV5K 3NF9A 4H0OA 1D5AA 1HNXK 3TTDA 3S3OA 2E6LA 3ENOA 1U4BA 2HSTA 3WXJA 4H0YB 4A57A 2E20A 1V4SA 3TU5A 5F0XA 1WBDA 1J53A 4Q5VA 1XQSC 3J81O 3T7ZA 2FBYA 4AQYK 3J7YP 3DLHA 3PIPL 2FBVA 1DTQA 4BRMA 5BPMA 3NGYA 3CFPA 1TV6A 4CF8A 3MN5A 3V9UA 4NYNA 2KTQA 3K2PA 1B9DA 1KQSM 3DLKA 1HQUA 5JLHA 2DTUA 5LMNK 1V4TA 4ZHRA 3JYTA 2VQEK 2E2PA 3SQ4A 1OH7A 3LPTA 3HP9A 2VWKA 3RMAA 3L2UA 4WQ5A 5EY4A 3MXJA 3WQTA 4CZGA 4N76A 4CJUA 1CLQA 1VRUA 2W6LA 1RT2A 3U6FA 1NOYA 3VOVA 3NF8A 5EOYA 3F5TA 1ASVA 4B8CA 5KQDA 4ELTA 2HHXA 2E4LA 5LY3A 1OH8A 2VG5A 1HKGA 4RTFD 1JKHA 4M42A 4NXNK 4BRCA 4IJAA 3OJUA 3PSFA 4DQPA 3VEXA 3K5LA 1NGCA 5GIPA 2ZM6K 3NE6A 3I56N 1GOCA 4EHTA 3THXA 4PY5A 3IMXA 1TKDA 4KH4A 4HTUA 3OA9A 4HCBA 3HOTA 4O0JA 1TVRA 3L2VA 3C6HA 2GUIA 3NVMA 3K5OA 3B8AX 1HKBA 1BCMA 4CBWA 3FE1A 3QNNA 5J1EA 4DR1K 1SL2A 4BRIA 2Z1JA 2O8BB 1JXBA 2FSKA 3KK1A 4IOAL 4GV9A 4DQIA 4JS4A 1RCHA 1GOAA 4CFDA 4BRAA 3ZT1A 4EFHA 4E1NA 1JLAA 4FZXC 2VGNA 3MCAB 3OYLA 4JKAA 3QERA 3D6RA 1J5EK 3ZYYX 2D0CA 1GLLO 4IO9L 2B5JA 4KHNA 4JV5K 3VQ4A 4IOCL 3T1AA 2HHSA 1HX1A 1KAYA 4V19S 4JLHA 5ADXH 2OCEA 3KD5E 3WXMB 3QFUA 1NJXA 4CJ5A 3WQUA 1QS4A 1SS6A 2YNIA 4BG8A 1WN7A 4N41A 4NCBA 3G0ZA 3LAKA 3VQ8A 3DXKA 3TR8A 3CCMN 3CCJN 3K0SA 4LFCK 4DU1A 3VEZA 4IKFA 3FFKB 2ITGA 3OYCA 4IXCA 1EETA 1VSJA 3NGIA 3AO5A 3NH0A 4J2DA 1SV5A 4O5FA 5BRFA 3EL2A 3M8RA 1HLUA 1FW6A 1UA0A 2XRIA 2AP1A 2X6NA 5M1QA 3ULEA 3NHGA 4K25A 1VQ6N 5JMVA 3MCPA 4EZ6A 1KC8O 1EWQA 3FZFA 1G15A 1T44A 1TKTA 3OW2M 3RSEB 2V7ZA 3SLCA 3E1YA 3CCEN 4NO7A 1D8YA 2G8VA 4WQ4C 4GVEA 4J2AA 3LANA 2XY5A 1NGHA 2QKBA 4CZHA 3VQCA 4Q0BA 4DFPA 3THYA 2GV9A 2PY5A 1SQKA 4B1YB 5AQQA 3ZSOA 3GBTA 1NG9A 4JK9A 3S9HA 4FO0A 5HRRA 5HBMA 4FLWA 3UKRB 3C0BA 1KXPA 1T03A 3H1QA 4ISEA 3KTQA 2R7YA 1VQON 3AVLA 3D2EA 5J2QA 4IG3A 1XNQK 3DRRA 1XC3A 1KVAA 2QTDA 1EX4A 3DAWA 5BRHA 1L3VA 3LP0A 4K8XA 5B8HA 3SPZA 1VAZA 3T3FA 3CC7N 1VQMN 3CD6N 2P5GA 3ZT3A 5M1KA 1D9DA 4CGGA 4QS8A 3NBPA 4MO5A 5TKWA 4OO1J 1NGGA 2P9LA 3QBXA 2HB5A 1LOTB 4Z4IA 2G8HA 5EU7A 3V4IA 3BZKA 4LC9B 3WUHA 2F4VK 2ZQBA 2OA8A 1GLCG 5C12A 2A5XA 4CJ7A 4CHOA 4IO8A 1YXQA 4KV8A 3CCLN 3H3NO 1BQMA 4OGEA 4F2RA 2JWKA 4M63C 2W41A 3VEOA 2E1ZA 3WXLA 3ZSRA 2B4JA 4AM7A 4YFUA 3SJHA 5E41A 1NJYA 2UUAK 1QVGM 3U9DA 3OS1A 1B9FA 2XY6A 3O4WA 4WFAL 3HPOA 4DSIA 1NKEA 1KVCA 2RE2A 4M3UA 3C6UA 2A41A 4PKHA 3CM5A 4LFAK 1N5YA 1HPZA 3L3UA 4BG9A 2J4RA 3KJVA 1ZBUA 2D0BA 1XMOK 1K9MO 3IS9A 5LJVA 1YVNA 2OANA 4WYBA 1ZBLA 1Q8IA 2GX9A 1Q9XA 3RR8A 4BVPA 1O13A 4B1XB 1K8KB 3CC2N 5IT9O 5AQYA 3A5NC 1RBRA 3PV8A 1RT5A 4KI6A 3M8SA 4YDUA 4JKDA 3OJSA 5M1OA 3GDQA 4OPAA 1XI1A 4B3OA 1CZBA 5AFUA 4B1ZA 3THWA 3MDQA 1RTJA 3NFAA 3O4QA 4DMNA 2P9IB 3KKSA 1EP4A 4HUGA 4DSKA 2CGLA 4H5NA 3OYJA 5AQWA 5EVZA 4CFAA 1S1XA 3KLIA 4W5RA 1BL3A 4DLGA 4GKKK 2IDOA 3QETA 2EX3A 3UB5A 4CEZA 3GE1A 1J6ZA 1ATRA 1DTTA 2HNYA 3VQ7A 1BA1A 3AA5X 4LF7K 4YOTA 1MDUB 4H5WA 4A61A 3HK2A 4JKFA 3Q7CA 2IC3A 4BREA 4BGBA 3QEIA 1T3VA 3GL1A 4BRDA 1GLDG 5AQPA 3L0QA 5HRSA 1TGOA 5IWAK 1VQPN 1U04A 4BQZA 3L8BA 2F7TA 4JKGA 4FWSA 4JHDB 3AO2A 3IG1A 4CGFA 3ALYA 4BRNA 1RT3A 3TAFA 1BU6O 3CQYA 4ILGB 3OY9A 2HBKA 4JI4K 4E7HA 2H3GX 3CFOA 4BR5A 4DTPA 3EYZA 3O5BA 2FBTA 2YJFA 3QEWA 3VA3A 1C1CA 1JJ2M 4OLBA 3KKRA 4F8RA 3CCSN 1D9FA 4FLZA 2A6AA 3FZHA 2GEMA 1C6VA 3O9UA 2YNGA 1NJWA 2FSNA 1XWLA 5EXWA 3H45C 2YJEA 1EKEA 3L2WA 4BY9C 3LDOA 4MQ3A 4WQ5C 1E3MA 2KKZA 3VGLA 4BR0A 4QS9A 3HL8A 3NAEA 1J54A 1ZXOA 2IGIA 5CE3A 2WC9A 1I94K 1QZ5A 5LL6Z 1E4FT 3O3HA 1SKSA 2YHXA 4EAHD 5CYMA 2ZD1A 4FJKA 4ELUA 4H0VB 1CXQA 1X9MA 3CMAN 4JN4A 3O4NA 3ZEUB 1VK0A 1SL0A 4B9SA 3R3LA 3K58A 4Z4CA 4L3QA 4F4KA 2QWRA 4B3RK 1EXQA 2Q97A 4CJWA 3CCRN 2UXBK 2KHOA 3G6EN 3QIOA 4JAXA 4C1NK 5T7BA 4OLAA 2RF2A 3IKMA 3O3FA 3KWGA 3MECA 5KI6A 3BUZB 3OYDA 4O44A 1X9SA 3SZ2A 3ATUA 1NBWA 2I7NA 4BE0A 2QK9A 5AQMA 3IDHA 4O5BA 3AGKA 1W9HA 2VCPA 4A5AA 4BACA 4FJ7A 4PL7A 3KLHA 2E1YA 2IVPA 3CCQN 3OTOK 2HHTA 4JKHA 4B1VA 4F3OA 3DOKA 1WB9A 4KI4A 3DLGA 1Y97A 4FSVA 5EX5A 1NNEA 1T6DA 4PA1A 3SAHA 2G8WA 2E88A 3BF1A 1ILYA 3OS0A 4FXDA 3AA2A 2XHBA 5K14A 1JLGA 5GAEP 3E9OA 1HMVA 3VF4A 4OVLA 4FJLA 1BA0A 4W5NA 1BGXT 4DS5A 3VQ6A 1RGIA 3V1QA 3P83D 4FZYA 3I0SA 4A2BA 4E89A 2P5OA 1Z26A 4FWLA 4E1JA 2HBLA 3GG4A 4C8NA 4GNIA 3DRPA 4BC5A 4JKCA 4CI6A 3MEDA 4CJVA 4CEOA 1Q81O 2DFEA 2F9WA 4DSLA 4DR2K 3SMPA 3PUFA 5SZTA 2QW9A 3I33A 4MLEA 2ZJQL 1Z6RA 4BRFA 2P9SA 3MK6A 1WSHA 2IOCA 3P38A 4PL8A 3SQ0A 3B6OA 2D0OA 5AR0A 4LY7A 4CGDA 4AH9A 3PO4A 4W5QA 1HQEA 1N6QA 2FSJA 3ULDA 4HUEA 1RDBA 2HVHA 4CK2A 4KHYA 4IWVA 5C0YA 1VSHA 2HMPA 4B9VA 3KIOA 3DM2A 2D5RA 2NRRA 4CJPA 3VF6A 2JWLA 3F2KA 4CF0A 4BC2A 4X62K 3ZETB 1Z05A 4F9OA 2BE2A 3W3DA 4R5PA 4NLCA 2YKMA 4CHPA 3R1XA 3VQBA 4DS4A 4CD1A 3V6DA 4ZTJA 3TAPA 3AVJA 1KAXA 2KZMA 5F2RA 2V7YA 4RW6A 1S3XA 3RR7A 4DF8A 3IFRA 1BI4B 3R9PA 4AF1A 2DFHA 5BPNA 4Y1CA 4FK2A 4IFEA 4BROA 5CZ1A 5GIOA 5BN8A 4M3WA 1NLVA 4BGAA 4DV3K 1F21A 2OTLN 3DMJA 2P9UB 5BREA 1VQ5N 3SAGA 1YF5L 4DQSA 5KPTA 5BN9A 2GWJA 4CBXA 4ISGA 3N4QA 2HNDA 5CR4A 3NCIA 1TYQA 1YJNN 3DXMB 3Q7BA 4H0XB 4CIEA 4ID1A 4CFCA 3OYMA 5FPEA 2YX6A 3DWLA 2O8DA 3EO3A 4IZ9A 4DV4K 1QSLA 3HSTB 2GELA 4K41A 4GKJK 5FDLA 1HRHA 4CE9A 3O3GA 3VN5A 3RRGA 2YCHA 4F2SA 3V9ZA 4FWRA 5AQOA 4DV6K 3VQEA 2HMIA 1S1UA 3MWTA 3F9KA 4CEEA 3E9LA 4CZMA 3WEEB 2XO7A 1ASWA 4NCGA 3HVTA 4CHQA 1U47A 1KRPA 3UKUA 5E26A 4FLVA 1BHLA 3AGRA 3CFRA 5AQRA 2HBMA 4CESA 4LF5K 3QINA 5KRTA 4U7BA 4PWDA 1R59O 5FPMA 3CXCM 3OBWA 1Q18A 5FROA 1DGKN 4JI7K 1BWFO 3CPEA 1X1PA 1S9GA 3A0IX 1NGAA 3JAMO 4KBOA 2O4IA 1RFQA 3VENA 4DCHA 2PBDA 4FLTA 4YOXA 3BEXA 4YDUC 4JI1K 3AO1A 1U2VA 2X74A 4AHSA 2DY4A 1KFDA 3C7NA 2Z1GA 4JI3K 4I7FA 1D4XA 3SI6A 1QE1A 5AZIA 5DM7L 2HOEA 3DRSA 1NK6A 2KFNA 4MDAA 3QESA 1CXUA 3O80A 4BVOA 4KHUA 3QFPA 4A5BA 3BZCA 4RW4A 3O8MA 3UIQA 1NOZA 5AQSA 4DQRA 2OPPA 1VSIA 5I9EB 4B1WB 4FVUA 2HHWA 3ENHA 3PX0A 1ZC6A 1QQCA 1BIUA 5M1NA 1JLQA 2YHAA 1W7AA 3DI6A 1YJ9N 2NLXA 1TUYA 3ZT2A 3LL3A 3TSQA 5AZJA 4FJ5A 4IFVA 2QWNA 4Z94A 3ID6A 3OYHA 4GY2B 4I6MA 2P51A 3FGUA 3VGMA 2VYPA 1K6YA 2ASMA 4LFBK 2YNFA 3IAYA 4Z4EA
chains in the Genus database with same CATH topology
4RW7A 4RW8A 3THVA 2LSNA 1JLCA 1YTAA 4GVMA 3VQ9A 2F8SA 4M3RA 3HXMA 1NK8A 3C6TA 3AVKA 2ZE2A 2PYLA 1WNSA 4E7KA 4CF2A 4PUOA 2EHGA 2G8IA 1C0UA 1Q9XA 1SUQA 3RR8A 3RRHA 2NUBA 2IS3A 3AVHA 3AVNA 5HP1A 4CGIA 1RBRA 3PV8A 3WNEA 2YV0X 4M45A 4N56A 1RT5A 3KK3A 1Q9YA 4B9MA 4KI6A 3M8SA 3QO9A 4FLYA 2OPQA 2RPIA 3S3NA 4FW1A 3OJSA 4KHWA 3DLBA 4E7JA 1XI1A 1C1BA 3M8QA 1CZBA 3SJJA 4B3OA 4IBNA 1NKCA 5C24A 3AO3A 2DFFA 3ZCMA 1ASUA 5CY4A 3BGRA 3OYEA 1IG9A 1QSSA 3NFAA 1RTJA 3AA4A 3MXIA 3O4QA 1WSFA 4DMNA 3KKSA 1EP4A 4RG8A 4HUGA 1L3SA 4DSKA 4WE1A 4KRFA 4CK1A 4DFMA 3OYJA 4DU4A 4M3XA 1NK7A 4CHZA 3IRXA 1UAXA 4CFAA 1S1XA 2Q3SA 3KLIA 3EZ5A 3SV4A 4W5RA 1BL3A 4DLGA 3SQ2A 2IDOA 1T05A 3C95A 3LPUA 3VQQA 1A5XA 3QETA 2EX3A 1Z25A 4CEZA 1C1AA 1LWFA 2HNYA 1DTTA 3HYFA 4M41A 3VQ7A 3KLEA 1UOCA 3AA5X 4Y1DA 3SCXA 4CGJA 4FJGA 3SUOA 4H4MA 3QLHA 3HK2A 5DMRA 2IC3A 4B9UA 1LV5A 3QIPA 3MXMA 1JXEA 3HPHA 4AILC 3QEIA 4KTQA 4BDPA 4ICLA 1U48A 4I9LA 4FLXA 4E7LA 1LAVA 1XHZA 4AHVA 3K5NA 2A1RA 4EP4A 1DLOA 5HRSA 1TGOA 3BDPA 1U04A 2VG6A 3PY8A 3L8BA 3LZJA 4BWMA 4CHYA 3AO2A 3IG1A 4CGFA 3ALYA 1RT3A 4DLEA 3TAFA 3DLEA 4H4OA 3AVFA 1L3UA 4CJFA 1BIZA 3TAGA 1KVBA 3PO5A 4PQUA 2VWJA 1S1WA 2IAJA 4O4GA 4RW9A 3OY9A 3RWUA 3VA0A 4OGCA 4JRPA 4HUFA 4FJ8A 3NGZA 4E7HA 4ZTFA 5CYQA 1C0TA 3CFOA 2W42A 4DTPA 1ZBIA 4FJ9A 3SUQA 3EYZA 2FBTA 1YVUA 2G8UA 4B9TA 4DTOA 3QEWA 3VA3A 1RT7A 4OPKA 4LSLA 1C1CA 1JLFA 3KD1E 1HYVA 1RDAA 3TWHA 4FJNA 5J2PA 1C0MA 3LWMA 1RDDA 4G1QA 3OVNA 3SYZA 3KKRA 5KGXA 3TABA 4F8RA 4CF1A 2FC0A 4OLBA 1D9FA 4FLZA 3KK2A 3TAEA 1IH7A 4C8OA 1S6QA 1C6VA 1B92A 4CEAA 4CJQA 2YNGA 3WNHA 1LAWA 3F73A 1NJWA 4AHTA 3HJFA 1HJRA 1GOBA 4QOZB 1XWLA 3C94A 4GW6A 3WNFA 4HVJA 1EKEA 1RT4A 3L2WA 3P5JA 3QEVA 3B6PA 4MQ3A 2P1JA 2Y1JA 1SL1A 3LWLA 3TAMA 3HL8A 5SWMA 3QNOA 3NAEA 1T7PA 1J54A 2IGIA 4MFBA 2F96A 1J9AA 3KLGA 4O0IA 3O3HA 3S3MA 1SKSA 1XC9A 4AHCA 2PYJA 4KHQA 3NH1A 5CYMA 1JLEA 2ZD1A 4FJKA 1TL3A 5KTQA 4ELUA 4N5SA 3ISNC 4ID5A 4KTZA 1CXQA 4OJRA 4E1MA 4DTMA 3D0PA 3ZSZA 3OYGA 3QEPA 1X9MA 1NK0A 3NF9A 4M3TA 3O4NA 4KREA 1VK0A 1I39A 1SL0A 3V9XA 4B9SA 4NCAA 3K58A 1D5AA 4Z4CA 4OPJA 1U49A 4B9LA 4Z4GA 2HHQA 1SKRA 1VSDA 5C25A 3S3OA 4F4KA 1EXQA 2E6LA 5HROA 4CCHA 4CJWA 1LW2A 4LH5A 1U4BA 4DFKA 4FJIA 4FZZA 1IKYA 1TKXA 1JL1A 4CJ4A 1J53A 4Q5VA 3LALA 4JRQA 4FJMA 4BE1A 3MEGA 3QIOA 5T7BA 2FBYA 1BISA 1UWBA 4OLAA 2RF2A 3O3FA 3DLHA 3MECA 5JS1A 5KI6A 2FBVA 3OYDA 4O44A 4CEQA 1DTQA 1X9SA 3SZ2A 4BE0A 4QCLA 2QK9A 3NGYA 4O5BA 3CFPA 1TV6A 4CF8A 3CG7A 3VQAA 3V9UA 3V81A 1W9HA 4NYNA 3SUPA 4UQGA 4DTRA 2KTQA 3K2PA 3OYNA 4BACA 4M3ZA 4Z4HA 1B9DA 1QHTA 4FM1A 4FJ7A 3DLKA 1HQUA 1I3AA 3WNGA 4DG1A 3ZSQA 3KLHA 3OYKA 2GBZA 3RTVA 2X78A 2DTUA 3SUNA 4ZHRA 2HHTA 4FW2A 3JYTA 5J2MA 1TAUA 4F3OA 3SQ4A 1W0HA 3DOKA 3LPTA 3HP9A 4KI4A 2VWKA 3ASMA 3DLGA 4CERA 1Y97A 1FKPA 4IDKA 4AHRA 4CEBA 3L2UA 3HVRA 3RMAA 4LD0A 4PA1A 4E19A 3NF6A 3MXJA 3TI0A 2G8WA 4C8KA 4DWIA 4KPYA 1UA1A 1JL2A 4W5TA 4I2PA 1FXXA 4N76A 2YKNA 3OS0A 4CJUA 4FXDA 4B08A 3AA2A 1KSPA 1VRUA 5K14A 1JLGA 1RT2A 2XHBA 3U6FA 3NF7A 1CLQA 4CK3A 1NOYA 3NF8A 2HW3A 1HMVA 4CGHA 1ASVA 4B8CA 4OVLA 4FJLA 4W5NA 1RBUA 1BGXT 3HPGA 4DS5A 4ELTA 2I5JA 3U3YA 3SQ1A 4KB0A 1HYSA 1RBVA 3VQ6A 4FK4A 3V1QA 4JS5A 3P83D 1WSIA 4BE2A 4FZYA 3I0SA 2E4LA 4BWJA 4E89A 2P5OA 1Z26A 3LP3A 2VG5A 2BANA 3I0RA 4KTWA 1JKHA 4FM2A 3L3VA 4DF4A 1TK0A 4C8NA 1YTUA 2BDPA 4M42A 1S9EA 3QEXA 3D45A 3DRPA 4E7IA 3MEDA 2G8KA 4CJVA 4CEOA 3A2FA 2DFEA 4CHNA 3OJUA 3TARA 4DQPA 1KLMA 4B9NA 4IFYA 1HNVA 4DSLA 3K5LA 4DTSA 3M8PA 4DSFA 3PUFA 5SZTA 2OPRA 4YNQA 3NE6A 1XHXA 1QSYA 1GOCA 4W5OA 2YHBA 4CEDA 3ZSXA 5HRNA 4PY5A 1TKDA 1FKOA 1IKWA 4HTUA 1WAFA 4HCBA 1WSHA 2IOCA 3SQ0A 2KQ2A 4O0JA 4XIUA 3B6OA 1TVRA 2RN2A 1QTMA 4I2QA 4CIFA 4LY7A 3L2VA 4CGDA 4F3TA 3HM9A 2GUIA 4AH9A 3PO4A 3LDSA 3K5OA 3SPYA 4W5QA 1HQEA 1N6QA 1BCMA 1KCFA 3AVGA 4KFBA 3AVAA 3AVIA 5D3GA 3ULDA 3EY1A 3AO4A 3ZT0A 4HCCA 4N47A 3QNNA 4HHTA 1RDBA 5J1EA 4HUEA 1SL2A 2HVHA 2Z1JA 3FFIA 4OKKA 4CK2A 3AVMA 2HHVA 4KHYA 1JXBA 3KK1A 1VSHA 1RT6A 3PX6A 4B9VA 4DQIA 4JS4A 3CYMA 3KIOA 3G10A 2E6MA 1BI4A 1RCHA 1GOAA 2ATQA 4CFDA 3ZSVA 3L2QA 3ZT1A 3DM2A 2D5RA 4CJPA 4E1NA 3TANA 4CEFA 4KO0A 1JLAA 2HNZA 4FZXC 3I8DA 2XY8A 1ZBHA 3OYLA 4CF0A 2QKKA 4CJEA 3QERA 3ITHA 4CJ3A 4CECA 3RMBA 2D0CA 2BE2A 1A5VA 4R5PA 3LAMA 1RT1A 1ITGA 3ZT4A 4FJXA 2B5JA 1IKXA 2YKMA 4CHPA 4KHNA 1VRTA 3VQ4A 3V1RA 3NH2A 4TSXA 3T1AA 3U3GA 3VQBA 4DS4A 3V6DA 4K8ZA 2HHSA 4ZTJA 4JLHA 3TAPA 2B6AA 3AVJA 1HYZA 3KD5E 4OKJA 1VSEA 1NJXA 4CJ5A 3AV9A 4NYFA 2KZMA 1QS4A 4M3YA 2PZSA 2WOMA 2YNIA 4RW6A 1WN7A 4N41A 3RR7A 4NCBA 4DF8A 4CJLA 3G0ZA 1WSJA 3LAKA 3AA3A 3TR8A 3VQ8A 4DTJA 1O1WA 1BI4B 3KLFA 1YT3A 3TAQA 4DU1A 1RTIA 2DFHA 4IKFA 3OYBA 1S6PA 5FRMA 2ITGA 4Y1CA 3OYCA 4FK2A 1KFSA 2BGGA 1WSGA 4DSJA 1EETA 1VSJA 4FM0A 3NGIA 3AO5A 4OKEA 1TKZA 3NH0A 4J2DA 1SV5A 5CZ1A 1IO2A 1WLJA 3M8RA 2OYQA 3ZSWA 4M3WA 2Z1IA 4DTNA 5KRSA 2Y1IA 2D0AA 1UA0A 2XRIA 2X6NA 1F21A 3NHGA 1IKVA 4FJJA 1KTQA 3DMJA 3SNNA 3OYFA 2JGUA 4FCYA 1LWCA 4CF9A 3PX4A 1A5WA 4DQSA 3V1OA 4EZ6A 2HHUA 2OPSA 4KKOA 3RMDA 3ZSYA 1G15A 1MU2A 1TKTA 5C42A 3MEEA 1CZ9A 1RTHA 1T8EA 1RTDA 4CJSA 2HNDA 3NCIA 1WSEA 5FRNA 4CIEA 1TAQA 4ID1A 3T19A 4CFCA 1D8YA 2G8VA 5HLFA 4CJRA 3OYMA 4J2AA 3LANA 3CQ8A 2XY5A 2ETJA 1L5UA 2QKBA 3VQPA 3K57A 4O55A 4CJKA 4E3SA 4EZ9A 4CIGA 3VQCA 2YNHA 4DFPA 3LP2A 4Q0BA 1QSLA 2GV9A 3K5MA 2QXFA 3HSTB 1S1TA 2PY5A 3ZSOA 2O4GA 5I42A 1TK5A 5J2NA 4KAZA 2OZMA 3S9HA 5FDLA 1HRHA 4CE9A 3HT3A 3O3GA 2VG7A 5HRRA 3VN5A 3RRGA 2HVIA 4F2SA 5HBMA 4FLWA 3V9ZA 3K59A 1HNIA 3VQEA 2HMIA 4DFJA 1S1UA 4LSNA 3F9KA 4CEEA 4FYDA 5HRPA 1BQNA 1NK5A 1T03A 2F8TA 2XO7A 3KTQA 2JLEA 1ASWA 4NCGA 2R7YA 1KLNA 1WAJA 3AVLA 3HVTA 4DTUA 1VSLA 3HP6A 5J2QA 4CHQA 2XY7A 2WONA 4IG3A 4DU3A 1U47A 4CJTA 1KRPA 2KW4A 4CFBA 3DRRA 3DYAA 4IG0A 1KVAA 4FLVA 1BHLA 3CFRA 1EX4A 1X9WA 2A1SA 3AVBA 5I3UA 1L3VA 4BDZA 4FJHA 3LP0A 4CESA 4DTXA 3SPZA 4DSEA 3QINA 1R0AA 4K8XA 3T3FA 5KRTA 4PWDA 3L2RA 4FLUA 2P5GA 4C8MA 3ZT3A 4C8LA 5FROA 1D9DA 4CGGA 1NK4A 4KHSA 3NBPA 1X1PA 1S9GA 1RNHA 1S1VA 2O4IA 2HB5A 4B8AB 4Z4IA 2G8HA 2HHXA 3MAQA 5EU7A 3V4IA 3CM6A 4Z4EA 2RKIA 3SV3A 4FLTA 1ZBFA 2G8FA 3HO1A 1RBSA 3AO1A 2X6SA 2ZQBA 3DOLA 3E01A 3P1GA 3OS2A 2OA8A 2X74A 4AHSA 1VSFA 2DY4A 1KFDA 4CHOA 1LWEA 2Z1GA 4KV8A 4FVMA 5JS2A 3V9WA 1ZYQA 1RILA 1TL1A 4AHUA 4I9QA 4I7FA 4OGEA 1BQMA 3VQDA 1QE1A 3SI6A 4ELVA 1S5JA 3H08A 3LZIA 3DRSA 4LH4A 4F2RA 1NK6A 1J5OA 2KFNA 4E0DA 4J2EA 3OYAA 5DK5A 3QESA 3ZSRA 1CXUA 3JSMA 4KB1A 4Z4FA 4KHUA 3OYIA 1NK9A 2B4JA 1JLBA 4RW4A 3UIQA 1L3TA 2FBXA 1NOZA 4DQRA 4YFUA 2OPPA 2Z1HA 3LP1A 4H8KA 5E41A 4J2BA 2OZSA 1VSIA 1NJYA 1NKBA 1LW0A 5CZ2A 2HHWA 1VSKA 4FK0A 1VSMA 1REVA 3OS1A 1B9FA 3PX0A 1QQCA 2XY6A 1BIUA 1JLQA 1RDCA 2YHAA 3HPOA 3DLRA 1NKEA 4GMJB 1RBTA 4DSIA 3DI6A 1KVCA 1BCOA 3VQ5A 3V9SA 4M3UA 3C6UA 3ZT2A 2KZZA 3CM5A 4L8RB 4EP5A 1N5YA 3NDKA 1HPZA 3L3UA 4FJ5A 4IFVA 3KJVA 4BDYA 2KFZA 2AJQA 1ZBUA 2D0BA 3OYHA 1TK8A 1NJZA 2P51A 3AVCA 3IS9A 1SKWA 1FK9A 1U45A 1K6YA 4QAGA 3RMCA 4Z0UA 1ZBLA 2YNFA 3IAYA 5KGWA 1Q8IA 4DQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RW7 A;  4RW8 A;  3THV A;  2LSN A;  1JLC A;  1YTA A;  4GVM A;  3VQ9 A;  2F8S A;  4M3R A;  3HXM A;  1NK8 A;  3C6T A;  3AVK A;  2ZE2 A;  2PYL A;  1WNS A;  4E7K A;  4CF2 A;  4PUO A;  2EHG A;  2G8I A;  1C0U A;  1Q9X A;  1SUQ A;  3RR8 A;  3RRH A;  2NUB A;  2IS3 A;  3AVH A;  3AVN A;  5HP1 A;  4CGI A;  1RBR A;  3PV8 A;  3WNE A;  2YV0 X;  4M45 A;  4N56 A;  1RT5 A;  3KK3 A;  1Q9Y A;  4B9M A;  4KI6 A;  3M8S A;  3QO9 A;  4FLY A;  2OPQ A;  2RPI A;  3S3N A;  4FW1 A;  3OJS A;  4KHW A;  3DLB A;  4E7J A;  1XI1 A;  1C1B A;  3M8Q A;  1CZB A;  3SJJ A;  4B3O A;  4IBN A;  1NKC A;  5C24 A;  3AO3 A;  2DFF A;  3ZCM A;  1ASU A;  5CY4 A;  3BGR A;  3OYE A;  1IG9 A;  1QSS A;  3NFA A;  1RTJ A;  3AA4 A;  3MXI A;  3O4Q A;  1WSF A;  4DMN A;  3KKS A;  1EP4 A;  4RG8 A;  4HUG A;  1L3S A;  4DSK A;  4WE1 A;  4KRF A;  4CK1 A;  4DFM A;  3OYJ A;  4DU4 A;  4M3X A;  1NK7 A;  4CHZ A;  3IRX A;  1UAX A;  4CFA A;  1S1X A;  2Q3S A;  3KLI A;  3EZ5 A;  3SV4 A;  4W5R A;  1BL3 A;  4DLG A;  3SQ2 A;  2IDO A;  1T05 A;  3C95 A;  3LPU A;  3VQQ A;  1A5X A;  3QET A;  2EX3 A;  1Z25 A;  4CEZ A;  1C1A A;  1LWF A;  2HNY A;  1DTT A;  3HYF A;  4M41 A;  3VQ7 A;  3KLE A;  1UOC A;  3AA5 X;  4Y1D A;  3SCX A;  4CGJ A;  4FJG A;  3SUO A;  4H4M A;  3QLH A;  3HK2 A;  5DMR A;  2IC3 A;  4B9U A;  1LV5 A;  3QIP A;  3MXM A;  1JXE A;  3HPH A;  4AIL C;  3QEI A;  4KTQ A;  4BDP A;  4ICL A;  1U48 A;  4I9L A;  4FLX A;  4E7L A;  1LAV A;  1XHZ A;  4AHV A;  3K5N A;  2A1R A;  4EP4 A;  1DLO A;  5HRS A;  1TGO A;  3BDP A;  1U04 A;  2VG6 A;  3PY8 A;  3L8B A;  3LZJ A;  4BWM A;  4CHY A;  3AO2 A;  3IG1 A;  4CGF A;  3ALY A;  1RT3 A;  4DLE A;  3TAF A;  3DLE A;  4H4O A;  3AVF A;  1L3U A;  4CJF A;  1BIZ A;  3TAG A;  1KVB A;  3PO5 A;  4PQU A;  2VWJ A;  1S1W A;  2IAJ A;  4O4G A;  4RW9 A;  3OY9 A;  3RWU A;  3VA0 A;  4OGC A;  4JRP A;  4HUF A;  4FJ8 A;  3NGZ A;  4E7H A;  4ZTF A;  5CYQ A;  1C0T A;  3CFO A;  2W42 A;  4DTP A;  1ZBI A;  4FJ9 A;  3SUQ A;  3EYZ A;  2FBT A;  1YVU A;  2G8U A;  4B9T A;  4DTO A;  3QEW A;  3VA3 A;  1RT7 A;  4OPK A;  4LSL A;  1C1C A;  1JLF A;  3KD1 E;  1HYV A;  1RDA A;  3TWH A;  4FJN A;  5J2P A;  1C0M A;  3LWM A;  1RDD A;  4G1Q A;  3OVN A;  3SYZ A;  3KKR A;  5KGX A;  3TAB A;  4F8R A;  4CF1 A;  2FC0 A;  4OLB A;  1D9F A;  4FLZ A;  3KK2 A;  3TAE A;  1IH7 A;  4C8O A;  1S6Q A;  1C6V A;  1B92 A;  4CEA A;  4CJQ A;  2YNG A;  3WNH A;  1LAW A;  3F73 A;  1NJW A;  4AHT A;  3HJF A;  1HJR A;  1GOB A;  4QOZ B;  1XWL A;  3C94 A;  4GW6 A;  3WNF A;  4HVJ A;  1EKE A;  1RT4 A;  3L2W A;  3P5J A;  3QEV A;  3B6P A;  4MQ3 A;  2P1J A;  2Y1J A;  1SL1 A;  3LWL A;  3TAM A;  3HL8 A;  5SWM A;  3QNO A;  3NAE A;  1T7P A;  1J54 A;  2IGI A;  4MFB A;  2F96 A;  1J9A A;  3KLG A;  4O0I A;  3O3H A;  3S3M A;  1SKS A;  1XC9 A;  4AHC A;  2PYJ A;  4KHQ A;  3NH1 A;  5CYM A;  1JLE A;  2ZD1 A;  4FJK A;  1TL3 A;  5KTQ A;  4ELU A;  4N5S A;  3ISN C;  4ID5 A;  4KTZ A;  1CXQ A;  4OJR A;  4E1M A;  4DTM A;  3D0P A;  3ZSZ A;  3OYG A;  3QEP A;  1X9M A;  1NK0 A;  3NF9 A;  4M3T A;  3O4N A;  4KRE A;  1VK0 A;  1I39 A;  1SL0 A;  3V9X A;  4B9S A;  4NCA A;  3K58 A;  1D5A A;  4Z4C A;  4OPJ A;  1U49 A;  4B9L A;  4Z4G A;  2HHQ A;  1SKR A;  1VSD A;  5C25 A;  3S3O A;  4F4K A;  1EXQ A;  2E6L A;  5HRO A;  4CCH A;  4CJW A;  1LW2 A;  4LH5 A;  1U4B A;  4DFK A;  4FJI A;  4FZZ A;  1IKY A;  1TKX A;  1JL1 A;  4CJ4 A;  1J53 A;  4Q5V A;  3LAL A;  4JRQ A;  4FJM A;  4BE1 A;  3MEG A;  3QIO A;  5T7B A;  2FBY A;  1BIS A;  1UWB A;  4OLA A;  2RF2 A;  3O3F A;  3DLH A;  3MEC A;  5JS1 A;  5KI6 A;  2FBV A;  3OYD A;  4O44 A;  4CEQ A;  1DTQ A;  1X9S A;  3SZ2 A;  4BE0 A;  4QCL A;  2QK9 A;  3NGY A;  4O5B A;  3CFP A;  1TV6 A;  4CF8 A;  3CG7 A;  3VQA A;  3V9U A;  3V81 A;  1W9H A;  4NYN A;  3SUP A;  4UQG A;  4DTR A;  2KTQ A;  3K2P A;  3OYN A;  4BAC A;  4M3Z A;  4Z4H A;  1B9D A;  1QHT A;  4FM1 A;  4FJ7 A;  3DLK A;  1HQU A;  1I3A A;  3WNG A;  4DG1 A;  3ZSQ A;  3KLH A;  3OYK A;  2GBZ A;  3RTV A;  2X78 A;  2DTU A;  3SUN A;  4ZHR A;  2HHT A;  4FW2 A;  3JYT A;  5J2M A;  1TAU A;  4F3O A;  3SQ4 A;  1W0H A;  3DOK A;  3LPT A;  3HP9 A;  4KI4 A;  2VWK A;  3ASM A;  3DLG A;  4CER A;  1Y97 A;  1FKP A;  4IDK A;  4AHR A;  4CEB A;  3L2U A;  3HVR A;  3RMA A;  4LD0 A;  4PA1 A;  4E19 A;  3NF6 A;  3MXJ A;  3TI0 A;  2G8W A;  4C8K A;  4DWI A;  4KPY A;  1UA1 A;  1JL2 A;  4W5T A;  4I2P A;  1FXX A;  4N76 A;  2YKN A;  3OS0 A;  4CJU A;  4FXD A;  4B08 A;  3AA2 A;  1KSP A;  1VRU A;  5K14 A;  1JLG A;  1RT2 A;  2XHB A;  3U6F A;  3NF7 A;  1CLQ A;  4CK3 A;  1NOY A;  3NF8 A;  2HW3 A;  1HMV A;  4CGH A;  1ASV A;  4B8C A;  4OVL A;  4FJL A;  4W5N A;  1RBU A;  1BGX T;  3HPG A;  4DS5 A;  4ELT A;  2I5J A;  3U3Y A;  3SQ1 A;  4KB0 A;  1HYS A;  1RBV A;  3VQ6 A;  4FK4 A;  3V1Q A;  4JS5 A;  3P83 D;  1WSI A;  4BE2 A;  4FZY A;  3I0S A;  2E4L A;  4BWJ A;  4E89 A;  2P5O A;  1Z26 A;  3LP3 A;  2VG5 A;  2BAN A;  3I0R A;  4KTW A;  1JKH A;  4FM2 A;  3L3V A;  4DF4 A;  1TK0 A;  4C8N A;  1YTU A;  2BDP A;  4M42 A;  1S9E A;  3QEX A;  3D45 A;  3DRP A;  4E7I A;  3MED A;  2G8K A;  4CJV A;  4CEO A;  3A2F A;  2DFE A;  4CHN A;  3OJU A;  3TAR A;  4DQP A;  1KLM A;  4B9N A;  4IFY A;  1HNV A;  4DSL A;  3K5L A;  4DTS A;  3M8P A;  4DSF A;  3PUF A;  5SZT A;  2OPR A;  4YNQ A;  3NE6 A;  1XHX A;  1QSY A;  1GOC A;  4W5O A;  2YHB A;  4CED A;  3ZSX A;  5HRN A;  4PY5 A;  1TKD A;  1FKO A;  1IKW A;  4HTU A;  1WAF A;  4HCB A;  1WSH A;  2IOC A;  3SQ0 A;  2KQ2 A;  4O0J A;  4XIU A;  3B6O A;  1TVR A;  2RN2 A;  1QTM A;  4I2Q A;  4CIF A;  4LY7 A;  3L2V A;  4CGD A;  4F3T A;  3HM9 A;  2GUI A;  4AH9 A;  3PO4 A;  3LDS A;  3K5O A;  3SPY A;  4W5Q A;  1HQE A;  1N6Q A;  1BCM A;  1KCF A;  3AVG A;  4KFB A;  3AVA A;  3AVI A;  5D3G A;  3ULD A;  3EY1 A;  3AO4 A;  3ZT0 A;  4HCC A;  4N47 A;  3QNN A;  4HHT A;  1RDB A;  5J1E A;  4HUE A;  1SL2 A;  2HVH A;  2Z1J A;  3FFI A;  4OKK A;  4CK2 A;  3AVM A;  2HHV A;  4KHY A;  1JXB A;  3KK1 A;  1VSH A;  1RT6 A;  3PX6 A;  4B9V A;  4DQI A;  4JS4 A;  3CYM A;  3KIO A;  3G10 A;  2E6M A;  1BI4 A;  1RCH A;  1GOA A;  2ATQ A;  4CFD A;  3ZSV A;  3L2Q A;  3ZT1 A;  3DM2 A;  2D5R A;  4CJP A;  4E1N A;  3TAN A;  4CEF A;  4KO0 A;  1JLA A;  2HNZ A;  4FZX C;  3I8D A;  2XY8 A;  1ZBH A;  3OYL A;  4CF0 A;  2QKK A;  4CJE A;  3QER A;  3ITH A;  4CJ3 A;  4CEC A;  3RMB A;  2D0C A;  2BE2 A;  1A5V A;  4R5P A;  3LAM A;  1RT1 A;  1ITG A;  3ZT4 A;  4FJX A;  2B5J A;  1IKX A;  2YKM A;  4CHP A;  4KHN A;  1VRT A;  3VQ4 A;  3V1R A;  3NH2 A;  4TSX A;  3T1A A;  3U3G A;  3VQB A;  4DS4 A;  3V6D A;  4K8Z A;  2HHS A;  4ZTJ A;  4JLH A;  3TAP A;  2B6A A;  3AVJ A;  1HYZ A;  3KD5 E;  4OKJ A;  1VSE A;  1NJX A;  4CJ5 A;  3AV9 A;  4NYF A;  2KZM A;  1QS4 A;  4M3Y A;  2PZS A;  2WOM A;  2YNI A;  4RW6 A;  1WN7 A;  4N41 A;  3RR7 A;  4NCB A;  4DF8 A;  4CJL A;  3G0Z A;  1WSJ A;  3LAK A;  3AA3 A;  3TR8 A;  3VQ8 A;  4DTJ A;  1O1W A;  1BI4 B;  3KLF A;  1YT3 A;  3TAQ A;  4DU1 A;  1RTI A;  2DFH A;  4IKF A;  3OYB A;  1S6P A;  5FRM A;  2ITG A;  4Y1C A;  3OYC A;  4FK2 A;  1KFS A;  2BGG A;  1WSG A;  4DSJ A;  1EET A;  1VSJ A;  4FM0 A;  3NGI A;  3AO5 A;  4OKE A;  1TKZ A;  3NH0 A;  4J2D A;  1SV5 A;  5CZ1 A;  1IO2 A;  1WLJ A;  3M8R A;  2OYQ A;  3ZSW A;  4M3W A;  2Z1I A;  4DTN A;  5KRS A;  2Y1I A;  2D0A A;  1UA0 A;  2XRI A;  2X6N A;  1F21 A;  3NHG A;  1IKV A;  4FJJ A;  1KTQ A;  3DMJ A;  3SNN A;  3OYF A;  2JGU A;  4FCY A;  1LWC A;  4CF9 A;  3PX4 A;  1A5W A;  4DQS A;  3V1O A;  4EZ6 A;  2HHU A;  2OPS A;  4KKO A;  3RMD A;  3ZSY A;  1G15 A;  1MU2 A;  1TKT A;  5C42 A;  3MEE A;  1CZ9 A;  1RTH A;  1T8E A;  1RTD A;  4CJS A;  2HND A;  3NCI A;  1WSE A;  5FRN A;  4CIE A;  1TAQ A;  4ID1 A;  3T19 A;  4CFC A;  1D8Y A;  2G8V A;  5HLF A;  4CJR A;  3OYM A;  4J2A A;  3LAN A;  3CQ8 A;  2XY5 A;  2ETJ A;  1L5U A;  2QKB A;  3VQP A;  3K57 A;  4O55 A;  4CJK A;  4E3S A;  4EZ9 A;  4CIG A;  3VQC A;  2YNH A;  4DFP A;  3LP2 A;  4Q0B A;  1QSL A;  2GV9 A;  3K5M A;  2QXF A;  3HST B;  1S1T A;  2PY5 A;  3ZSO A;  2O4G A;  5I42 A;  1TK5 A;  5J2N A;  4KAZ A;  2OZM A;  3S9H A;  5FDL A;  1HRH A;  4CE9 A;  3HT3 A;  3O3G A;  2VG7 A;  5HRR A;  3VN5 A;  3RRG A;  2HVI A;  4F2S A;  5HBM A;  4FLW A;  3V9Z A;  3K59 A;  1HNI A;  3VQE A;  2HMI A;  4DFJ A;  1S1U A;  4LSN A;  3F9K A;  4CEE A;  4FYD A;  5HRP A;  1BQN A;  1NK5 A;  1T03 A;  2F8T A;  2XO7 A;  3KTQ A;  2JLE A;  1ASW A;  4NCG A;  2R7Y A;  1KLN A;  1WAJ A;  3AVL A;  3HVT A;  4DTU A;  1VSL A;  3HP6 A;  5J2Q A;  4CHQ A;  2XY7 A;  2WON A;  4IG3 A;  4DU3 A;  1U47 A;  4CJT A;  1KRP A;  2KW4 A;  4CFB A;  3DRR A;  3DYA A;  4IG0 A;  1KVA A;  4FLV A;  1BHL A;  3CFR A;  1EX4 A;  1X9W A;  2A1S A;  3AVB A;  5I3U A;  1L3V A;  4BDZ A;  4FJH A;  3LP0 A;  4CES A;  4DTX A;  3SPZ A;  4DSE A;  3QIN A;  1R0A A;  4K8X A;  3T3F A;  5KRT A;  4PWD A;  3L2R A;  4FLU A;  2P5G A;  4C8M A;  3ZT3 A;  4C8L A;  5FRO A;  1D9D A;  4CGG A;  1NK4 A;  4KHS A;  3NBP A;  1X1P A;  1S9G A;  1RNH A;  1S1V A;  2O4I A;  2HB5 A;  4B8A B;  4Z4I A;  2G8H A;  2HHX A;  3MAQ A;  5EU7 A;  3V4I A;  3CM6 A;  4Z4E A;  2RKI A;  3SV3 A;  4FLT A;  1ZBF A;  2G8F A;  3HO1 A;  1RBS A;  3AO1 A;  2X6S A;  2ZQB A;  3DOL A;  3E01 A;  3P1G A;  3OS2 A;  2OA8 A;  2X74 A;  4AHS A;  1VSF A;  2DY4 A;  1KFD A;  4CHO A;  1LWE A;  2Z1G A;  4KV8 A;  4FVM A;  5JS2 A;  3V9W A;  1ZYQ A;  1RIL A;  1TL1 A;  4AHU A;  4I9Q A;  4I7F A;  4OGE A;  1BQM A;  3VQD A;  1QE1 A;  3SI6 A;  4ELV A;  1S5J A;  3H08 A;  3LZI A;  3DRS A;  4LH4 A;  4F2R A;  1NK6 A;  1J5O A;  2KFN A;  4E0D A;  4J2E A;  3OYA A;  5DK5 A;  3QES A;  3ZSR A;  1CXU A;  3JSM A;  4KB1 A;  4Z4F A;  4KHU A;  3OYI A;  1NK9 A;  2B4J A;  1JLB A;  4RW4 A;  3UIQ A;  1L3T A;  2FBX A;  1NOZ A;  4DQR A;  4YFU A;  2OPP A;  2Z1H A;  3LP1 A;  4H8K A;  5E41 A;  4J2B A;  2OZS A;  1VSI A;  1NJY A;  1NKB A;  1LW0 A;  5CZ2 A;  2HHW A;  1VSK A;  4FK0 A;  1VSM A;  1REV A;  3OS1 A;  1B9F A;  3PX0 A;  1QQC A;  2XY6 A;  1BIU A;  1JLQ A;  1RDC A;  2YHA A;  3HPO A;  3DLR A;  1NKE A;  4GMJ B;  1RBT A;  4DSI A;  3DI6 A;  1KVC A;  1BCO A;  3VQ5 A;  3V9S A;  4M3U A;  3C6U A;  3ZT2 A;  2KZZ A;  3CM5 A;  4L8R B;  4EP5 A;  1N5Y A;  3NDK A;  1HPZ A;  3L3U A;  4FJ5 A;  4IFV A;  3KJV A;  4BDY A;  2KFZ A;  2AJQ A;  1ZBU A;  2D0B A;  3OYH A;  1TK8 A;  1NJZ A;  2P51 A;  3AVC A;  3IS9 A;  1SKW A;  1FK9 A;  1U45 A;  1K6Y A;  4QAG A;  3RMC A;  4Z0U A;  1ZBL A;  2YNF A;  3IAY A;  5KGW A;  1Q8I A;  4DQQ A; 
#chains in the Genus database with same CATH topology
 4RW8 A;  3THV A;  2LSN A;  3HXM A;  3AVK A;  3MX2 A;  2PYL A;  1WNS A;  4PUO A;  4CF2 A;  2G8I A;  1SUQ A;  1IBK K;  1DT9 A;  3AAQ A;  4UY8 O;  1N32 K;  2NUB A;  3AVN A;  5AQI A;  4ILH A;  3WNE A;  4B9M A;  4N56 A;  3QO9 A;  2RPI A;  3S3N A;  1HJO A;  1P90 A;  2DFF A;  3ZCM A;  3OYE A;  1IG9 A;  5AQK A;  3MXI A;  4BRK A;  2NRX A;  2W6K A;  4LF6 K;  4WE1 A;  4CK1 A;  4DFM A;  4DU4 A;  4M3X A;  3K9J A;  4BR2 A;  1UAX A;  2Q3S A;  1Q82 O;  3EZ5 A;  1QQO A;  3LPU A;  3R8E A;  4BRG A;  3VQQ A;  1BO5 O;  1Z25 A;  5AQL A;  1C1A A;  3D2F A;  3SAF A;  1YUW A;  3KLE A;  4Y1D A;  3A5L C;  4CGJ A;  4FJG A;  2O8F B;  1EWR A;  1VQK N;  3VGK A;  2UXC K;  5AQZ A;  3MXM A;  2AA4 A;  2P9P A;  3HPH A;  4BDP A;  4ICL A;  4I9L A;  4E7L A;  1LAV A;  3K5N A;  1WOQ A;  2A1R A;  2E2O A;  4OX9 K;  3DLL L;  2VG6 A;  4YOV A;  4PKI A;  3MN6 A;  4ILJ A;  3WXK A;  3HSC A;  2NRW A;  2VWB A;  3AVF A;  5FLX O;  4CJF A;  2O8E B;  1ATN A;  2VWJ A;  4RW9 A;  4OGC A;  4JRP A;  4HUF A;  4JKB A;  4ZTF A;  1IV0 A;  1C0T A;  2ITM A;  1IG8 A;  2P9N A;  3FLC O;  5E84 A;  4DTO A;  3KD1 E;  2UYT A;  4B3S K;  2ZJR L;  3TPQ A;  2WBN A;  2FC0 A;  4EIA A;  5C10 A;  2Q36 A;  3KK2 A;  4CJQ A;  3WNH A;  1LAW A;  4AHT A;  2VGM A;  3WNF A;  1RDW X;  3P5J A;  4DR6 K;  3B6P A;  3CJ1 A;  1P8Z A;  4DR5 K;  3TTC A;  5SWM A;  1T7P A;  4IJN A;  5BR9 A;  3ZLJ A;  2Q2R A;  1RDU A;  4JD2 B;  2QM1 A;  3KLG A;  4JYA K;  3H3O B;  4RWT A;  3NH1 A;  2HHH K;  1JLE A;  5KTQ A;  3ISN C;  4KTZ A;  3QEP A;  1NK0 A;  4KRE A;  1I39 A;  1NGE A;  2WUS A;  2O8C A;  3BF3 A;  4AM6 A;  4B9L A;  4OPJ A;  2GWK A;  3H6E A;  5HRO A;  2HBJ A;  3U9Z A;  1BDG A;  4XEI A;  4LH5 A;  4FJI A;  4FZZ A;  3HBT A;  1MA9 B;  4U67 L;  1TKX A;  1JL1 A;  1VHX A;  4CJ4 A;  4JRQ A;  2P9K B;  3LAL A;  4BE1 A;  3CJC A;  5ADX A;  4CBU A;  1BIS A;  1UWB A;  4MDB A;  4O8K A;  4BRH A;  5JS1 A;  2QWM A;  4CEQ A;  3DJC A;  3OHR A;  3VQA A;  3V81 A;  3HOS A;  3AY9 A;  4DTR A;  3TSU A;  4Z4H A;  1QHT A;  4DG1 A;  3ATV A;  4JI2 K;  2GBZ A;  3RTV A;  2X78 A;  4A59 A;  3SUN A;  4FW2 A;  4MLH A;  5J2M A;  1TAU A;  3SK3 A;  3ASM A;  1FKP A;  4IDK A;  4LD0 A;  4E19 A;  3TI0 A;  4C8K A;  1UA1 A;  1JL2 A;  4I2P A;  1FXX A;  4DUY K;  3MN7 A;  4PKG A;  1KSP A;  3W0L A;  3QBW A;  3NF7 A;  3A5M C;  1W2B M;  1QQM A;  1HUX A;  2A3Z A;  5BPL A;  2UUB K;  5M1P A;  1HYS A;  3U3Y A;  4X64 K;  1RBV A;  1WSI A;  4BE2 A;  4BWJ A;  3R6M A;  3LP3 A;  1EQY A;  3M1F A;  2BAN A;  3I0R A;  2CH5 A;  4DF4 A;  2E5L K;  4FWO A;  2O8B A;  2BDP A;  4IEI A;  1S9E A;  4E7I A;  2G8K A;  3A2F A;  1GLA G;  1KLM A;  4B9N A;  3O9Q A;  4DTS A;  1VQ7 N;  4DSF A;  1ZBS A;  2OPR A;  4M7Y A;  3L4I A;  1QSY A;  4W5O A;  2YHB A;  3ZSX A;  3P39 A;  3CME N;  1FKO A;  5KPR A;  1E4G T;  1K73 O;  1N34 K;  2RN2 A;  1QTM A;  4G9Z A;  3VET A;  4F3T A;  1Q7Y O;  3HM9 A;  3LDS A;  3SPY A;  1C0F A;  2ZGZ A;  3AVG A;  3AVA A;  5AQH A;  5D3G A;  4KH6 A;  3ZT0 A;  3VER A;  4HCC A;  4N47 A;  3AAP A;  4XH5 A;  2ZWH A;  4K42 A;  3FFI A;  3AVM A;  2HHV A;  5FPD A;  1OVQ A;  1RT6 A;  3TSP A;  4JK7 A;  2YHY A;  2UXD K;  2ATQ A;  3L2Q A;  3THX B;  3TAN A;  3O08 A;  4CEF A;  3I8D A;  2XY8 A;  1ZBH A;  2QKK A;  4DR4 K;  5FPN A;  3ITH A;  4CJ3 A;  3RMB A;  4BRQ A;  1RT1 A;  4NLB A;  4FJX A;  4IEE A;  5JVH L;  1IKX A;  4YOU A;  1MWM A;  3V1R A;  2GUP A;  4TSX A;  3O9T A;  3N4P A;  1DKG D;  3KVG A;  1VSE A;  3RSE A;  1GLF O;  4X66 K;  3AV9 A;  4YHH K;  3H1V X;  2PZS A;  2WOM A;  1OH5 A;  2UU9 K;  4JKE A;  4CJL A;  4DTJ A;  1WSJ A;  1HNZ K;  3EE8 A;  1W97 L;  4B3T K;  1YT3 A;  3TAQ A;  1RTI A;  3HRG A;  1NGI A;  1S22 A;  1WSG A;  4DSJ A;  2BGG A;  4FM0 A;  3U8X A;  4FOE A;  1TKZ A;  1X9J A;  4FWM A;  1WLJ A;  3SMS A;  2OYQ A;  1SZ2 A;  3RVC A;  3ZSW A;  2Z1I A;  4DTN A;  5KRS A;  2IIR A;  1KTQ A;  2ASO A;  3OYF A;  5LJW A;  4H0T B;  2Q1N A;  4FCY A;  3CF5 L;  3PX4 A;  1A5W A;  2HHU A;  4KKO A;  4WFN L;  3RMD A;  1MU2 A;  1WUA A;  1T8E A;  1RTD A;  1WSE A;  2QEX N;  1HNW K;  5HLF A;  2ETJ A;  3DXK B;  3K57 A;  3T1Y K;  4O55 A;  4CJK A;  4I6M B;  5GAH P;  2YNH A;  3LP2 A;  3K5M A;  1S1T A;  4GV3 A;  1QHA A;  4KAZ A;  3HT3 A;  2HVI A;  1YHQ N;  3CC4 N;  4WFB L;  1SAZ A;  4DUZ K;  5AQJ A;  5C15 A;  3K59 A;  1HNI A;  3ULE B;  4FYD A;  5HRP A;  1BQN A;  2F8T A;  2JLE A;  2CGK A;  4DQ8 A;  4DTU A;  1VSL A;  2XY7 A;  5A2Q O;  4DU3 A;  4CJT A;  2KW4 A;  4CFB A;  1GLJ O;  4IG0 A;  1YJW N;  3AVB A;  3E66 A;  4IDH A;  1XMQ K;  3VMF B;  1R0A A;  4DTX A;  4DSE A;  4JEP A;  4C8M A;  4C8L A;  3THY B;  4LF4 K;  2ASP A;  4K43 A;  4B8A B;  3JS6 A;  4ISF A;  1IJJ A;  3SV3 A;  3J8A A;  4LF9 K;  1ATS A;  2G8F A;  3HO1 A;  1RBS A;  3OS2 A;  3E01 A;  2RHK A;  2NRV A;  2D4W A;  3OBY A;  1VSF A;  5BRD A;  3UE5 A;  3D2E B;  3V9W A;  1U6Z A;  5JVG L;  4AHU A;  4CZK A;  2WTU A;  4ELV A;  2P9P B;  1J5O A;  2OTJ N;  4E0D A;  3QDK A;  4KB1 A;  4Z4F A;  4EHU A;  5GAD P;  3OYI A;  1XUP O;  3CIP A;  2FBX A;  3LP1 A;  2A42 A;  4DV1 K;  1K8K A;  2OZS A;  1NMN A;  1LW0 A;  5CZ2 A;  2P9L B;  1VSM A;  1REV A;  5LMU K;  1RDC A;  3DLR A;  4DV0 K;  4GMJ B;  3VQ5 A;  1BCO A;  1T6C A;  4L8R B;  4EP5 A;  3NDK A;  1N36 K;  4BR4 A;  4BDY A;  2KFZ A;  2P9I A;  4H0P A;  1NJZ A;  3O9S A;  1U45 A;  4Z0U A;  5KGW A;  4XH4 A;  4FPA A;  4H5T A;  3NVK A;  1JLC A;  4JNE A;  4CZI A;  1N33 K;  2F8S A;  3O1B A;  3C6T A;  2ZE2 A;  3J80 O;  4E7K A;  3FZM A;  1C0U A;  2IS3 A;  3PSI A;  3VEY A;  2YV0 X;  4M45 A;  5MLC Q;  1VQL N;  4KHW A;  2QI2 A;  4E7J A;  3M8Q A;  1ASU A;  3ENB A;  4BRP A;  1KAZ A;  1QSS A;  3AA4 A;  4JHD A;  1WSF A;  4Y0W A;  4FL9 A;  4RG8 A;  2O8C B;  5GIN A;  4CHZ A;  3IRX A;  3SV4 A;  3SQ2 A;  3C95 A;  3MN9 A;  4J8F A;  2V51 B;  1A5X A;  3KHY A;  1LWF A;  3ZX2 A;  3HYF A;  4O8U A;  3QIC A;  3QLH A;  1JCG A;  3HM8 A;  1NGB A;  1LV5 A;  2FXU A;  1CZA N;  1DLO A;  5H1S Q;  3BDP A;  3PY8 A;  1S72 N;  4R79 A;  3THW B;  3LZJ A;  1OH6 A;  4BWM A;  3DLE A;  1L3U A;  4PQU A;  3TAG A;  1G99 A;  3CJ9 A;  2VQF K;  1S1W A;  3LDP A;  3VA0 A;  3NGZ A;  2IVN A;  2W42 A;  1ZBI A;  4FJ9 A;  4CVN E;  3SUQ A;  4BRL A;  4MO4 A;  1YVU A;  2G8U A;  1RT7 A;  3LDN A;  4LSL A;  2E2N A;  3G71 N;  3TWH A;  4FJN A;  3FZK A;  3VES A;  1C0M A;  3SYZ A;  3ZEU A;  5KGX A;  4CF1 A;  1NJI O;  3HI0 A;  2UUC K;  4B1U B;  3TAE A;  4C8O A;  1S6Q A;  1B92 A;  4WCE L;  4BR7 A;  1HJR A;  1GOB A;  4FWN A;  4GW6 A;  4QOZ B;  3A5O C;  3VPZ A;  2Q0R A;  1MWK A;  4DB3 A;  3QEV A;  1SL1 A;  2P1J A;  2Y1J A;  3NMU A;  4JKG B;  2CH6 A;  3TAM A;  2YI1 A;  4JI0 K;  4MFB A;  2D1K A;  5BR8 K;  4A62 A;  4FOI A;  4GV6 A;  4O0I A;  3S3M A;  2ZGY A;  2PYJ A;  4KHQ A;  1HR0 K;  3MMV A;  4FWQ A;  1TL3 A;  4NXM K;  3CCU N;  4N5S A;  3WXI A;  3M3Z A;  4C23 A;  3MWP A;  4OJR A;  3ZSZ A;  3OYG A;  1M90 O;  1BUP A;  2V52 B;  3V9X A;  4NCA A;  4K0K K;  1U49 A;  4Z4G A;  2IVO A;  2HHQ A;  4X65 K;  1SKR A;  1VSD A;  5C25 A;  4DV7 K;  4CCH A;  1LW2 A;  4LF8 K;  3O6W A;  4DFK A;  4CD3 A;  1IKY A;  3VEV A;  4FJM A;  4KHP K;  4BR9 A;  3FZL A;  5ELZ A;  3MEG A;  1YI2 N;  1K8A O;  1QZ6 A;  2QWO A;  4DV2 K;  4XH1 A;  3E9P A;  2BH1 A;  2QWP A;  3K9K A;  4QCL A;  1VQN N;  5AFU H;  3CG7 A;  3IUC A;  3P31 A;  3SUP A;  4JI8 K;  4UQG A;  3ID8 A;  3ZX3 A;  4RCH A;  1NGF A;  3O9R A;  3OYN A;  4M3Z A;  4FM1 A;  3LM9 A;  1I3A A;  3WNG A;  3ZSQ A;  3OYK A;  2W40 A;  1W0H A;  3HVR A;  4CER A;  5KQ8 A;  4CEB A;  4AHR A;  3SQ1 A;  3C65 A;  4DWI A;  4KPY A;  3NF6 A;  5C2D A;  1DEJ A;  4W5T A;  2YKN A;  4H5R A;  2ZJP L;  2QWL A;  4B08 A;  4YOW A;  4CK3 A;  2HW3 A;  4HTL A;  4CGH A;  3CCV N;  4JI6 K;  3CJB A;  1RBU A;  4KB0 A;  3HPG A;  2I5J A;  4FK4 A;  4JS5 A;  2E8A A;  2E2Q A;  1NU0 A;  1BOT O;  4KTW A;  4FM2 A;  3L3V A;  1TK0 A;  1X3N A;  4DR3 K;  1YTU A;  3QEX A;  3D45 A;  3TAR A;  4CHN A;  4IFY A;  1HNV A;  3M8P A;  4CZE A;  4YNQ A;  2NNW A;  1XHX A;  3QB0 A;  3TTF A;  5DM6 L;  1OKJ A;  2I7P A;  5HRN A;  4CED A;  1IKW A;  1FJG K;  1WAF A;  1Y64 A;  3H46 O;  2KQ2 A;  4PHT X;  4XIU A;  4CZJ A;  3ZET A;  4I2Q A;  4CIF A;  1KCF A;  4KFB A;  3AVI A;  4C1N I;  3EY1 A;  3AO4 A;  2FF3 B;  2DPN A;  4HHT A;  4OKK A;  5GAG P;  2HF4 A;  3F9M A;  3PX6 A;  2KLA A;  2NRH A;  3CYM A;  4KH5 A;  3G10 A;  5HL7 L;  2E6M A;  1BI4 A;  3ZSV A;  4KO0 A;  3SBT A;  2HNZ A;  5JLF A;  2P9S B;  4WF9 L;  4CJE A;  4JI5 K;  4CEC A;  5AQU A;  4DKW A;  1A5V A;  3LAM A;  3S41 A;  2P9U A;  1ITG A;  3ZT4 A;  4CZF A;  1H1V A;  4CW7 B;  1VRT A;  3NH2 A;  3U3G A;  1NGJ A;  4K8Z A;  2B6A A;  3CQX A;  1HYZ A;  4OKJ A;  1YIT N;  1TUU A;  4NYF A;  3DXM A;  4B3M K;  4M3Y A;  3KK7 A;  3KWI A;  3T1H K;  1GLE G;  3AA3 A;  3LDL A;  2QA4 N;  1O1W A;  3L4Q A;  3KLF A;  4FWP A;  3OYB A;  1S6P A;  1HKC A;  4BC3 A;  5FRM A;  1KFS A;  3VTH A;  4OKE A;  3M6G A;  1IO2 A;  4YOY A;  5AJ3 K;  2Y1I A;  2D0A A;  4FJJ A;  1IKV A;  3SNN A;  3PLA A;  2JGU A;  1LWC A;  3WEE A;  4CF9 A;  3V1O A;  2OPS A;  3ZSY A;  3JXU A;  5C42 A;  3MEE A;  1CZ9 A;  1RTH A;  4CJS A;  5FRN A;  2NRT A;  3BP8 A;  1TAQ A;  3T19 A;  1JCE A;  4CJR A;  4B9Q A;  3CQ8 A;  1L5U A;  3VQP A;  3G4S N;  3G25 A;  4E3S A;  4EZ9 A;  4CIG A;  2QXF A;  3CET A;  3P4I A;  2O4G A;  5I42 A;  1TK5 A;  5J2N A;  1C0G A;  1M1K O;  2OZM A;  2VG7 A;  1N8R O;  3HZ6 A;  2PFU A;  4DFJ A;  4LSN A;  3BY5 A;  1NK5 A;  2D0P A;  4H03 B;  1KLN A;  1WAJ A;  2Q0U A;  3HP6 A;  2WON A;  5AQN A;  5C2F A;  3WT0 A;  1VQ9 N;  4FWK A;  3T69 A;  1NMD A;  3DYA A;  1TYQ B;  4IOX A;  4YOR A;  3U4L A;  1X9W A;  1VQ4 N;  2A1S A;  5I3U A;  4FJH A;  4BDZ A;  3M5R A;  1QQN A;  2O8D B;  3L2R A;  4FLU A;  3C6A A;  3ZX0 A;  4KHS A;  1NK4 A;  3VEW A;  1RNH A;  1S1V A;  3VF2 A;  3D7E O;  3MAQ A;  3O1W A;  4CZL A;  3CM6 A;  2RKI A;  3J7A P;  1ZBF A;  3CI5 A;  3MX5 A;  3P1G A;  2X6S A;  3DOL A;  2Q31 A;  5CHI A;  1NWK A;  1LWE A;  5F1X A;  4FVM A;  5JS2 A;  1YAG A;  2YHW A;  1ZYQ A;  1RIL A;  1TL1 A;  4I9Q A;  2BUP A;  3VQD A;  3UKU B;  1S5J A;  3H08 A;  4WQ4 A;  3LZI A;  2O8F A;  4LH4 A;  4A2A A;  2BTF A;  4J2E A;  3OYA A;  5DK5 A;  4NB4 A;  3JSM A;  1NK9 A;  1JLB A;  3AAR A;  1L3T A;  4J2B A;  4BQL A;  2Z1H A;  4H8K A;  4DHY A;  1GLB G;  1NKB A;  1VSK A;  4FK0 A;  2CGJ A;  2A40 A;  3PIO L;  1RBT A;  3V9S A;  5AQX A;  1YIJ N;  3LDQ A;  3CHW A;  3EE9 A;  1KD1 O;  2KZZ A;  1U2V B;  3C7N B;  2AJQ A;  4YY3 K;  1TK8 A;  3AVC A;  1IBM K;  1NM1 A;  1SKW A;  1FK9 A;  4DR7 K;  3GOI A;  1OVY A;  5AZI B;  4QAG A;  3RMC A;  3EKS A;  3RWU A;  4DQQ A;  4RW7 A;  1JCF A;  3EN9 A;  2EWS A;  3J7Z O;  1NGD A;  4GVM A;  1YTA A;  3VQ9 A;  5HOO A;  3UKR A;  4M3R A;  1NK8 A;  4QS7 A;  2EHG A;  2QWQ A;  3RRH A;  5M1F A;  2QXL A;  3AVH A;  5HP1 A;  4CGI A;  3KK3 A;  1Q9Y A;  1WBB A;  3CER A;  1ESV A;  4FLY A;  2OPQ A;  4FW1 A;  3DLB A;  4JK8 A;  5KPZ A;  1C1B A;  3SJJ A;  4IBN A;  1NKC A;  5C24 A;  3AO3 A;  2WFB A;  5CY4 A;  3BGR A;  1Q86 O;  5AZJ B;  3A8Y A;  1EO1 A;  3CPW M;  1L3S A;  1LCU A;  4KRF A;  3CJA A;  2O8E A;  1NK7 A;  2NRZ A;  3EZW A;  5AQF A;  1BG3 A;  1T05 A;  3SBG A;  4HWI A;  3HTV A;  4M41 A;  3L6Q A;  1UOC A;  3SCX A;  1VQ8 N;  3SUO A;  2PAV A;  4H4M A;  3LM2 A;  2NZT A;  5DMR A;  4B9U A;  3I8B A;  3QML A;  3QIP A;  1JXE A;  3VTI A;  4AIL C;  4KTQ A;  1U48 A;  1XNR K;  4FLX A;  1XHZ A;  5AQT A;  4AHV A;  2HF3 A;  2FF6 A;  4EP4 A;  4H5V A;  5AQV A;  4CHY A;  1QVF M;  1HPM A;  5JIC A;  4DLE A;  4M7X A;  4FPB A;  4H4O A;  3PO5 A;  1BIZ A;  1KVB A;  4O4G A;  2IAJ A;  2FLO A;  4FJ8 A;  4JD2 A;  5CYQ A;  3FR0 A;  4BC4 A;  4B9T A;  3EKU A;  3D2F B;  4OPK A;  1JLF A;  1HYV A;  1RDA A;  5J2P A;  3LWM A;  1RDD A;  4G1Q A;  3OVN A;  3TAB A;  1IH7 A;  1X3M A;  4CEA A;  3F73 A;  3HJF A;  4OPH A;  3C94 A;  4HVJ A;  1RT4 A;  3EEQ A;  2P9K A;  2ZF5 O;  3LWL A;  1IBL K;  3CJ7 A;  3I55 N;  3QNO A;  3KZB A;  2F96 A;  5TKY A;  1J9A A;  1XC9 A;  4AHC A;  5AQG A;  2P9N B;  2GTD A;  4ID5 A;  2F9T A;  4E1M A;  4DTM A;  3D0P A;  4M3T A;  4DV5 K;  3NF9 A;  4H0O A;  1D5A A;  1HNX K;  3TTD A;  3S3O A;  2E6L A;  3ENO A;  1U4B A;  2HST A;  3WXJ A;  4H0Y B;  4A57 A;  2E20 A;  1V4S A;  3TU5 A;  5F0X A;  1WBD A;  1J53 A;  4Q5V A;  1XQS C;  3J81 O;  3T7Z A;  2FBY A;  4AQY K;  3J7Y P;  3DLH A;  3PIP L;  2FBV A;  1DTQ A;  4BRM A;  5BPM A;  3NGY A;  3CFP A;  1TV6 A;  4CF8 A;  3MN5 A;  3V9U A;  4NYN A;  2KTQ A;  3K2P A;  1B9D A;  1KQS M;  3DLK A;  1HQU A;  5JLH A;  2DTU A;  5LMN K;  1V4T A;  4ZHR A;  3JYT A;  2VQE K;  2E2P A;  3SQ4 A;  1OH7 A;  3LPT A;  3HP9 A;  2VWK A;  3RMA A;  3L2U A;  4WQ5 A;  5EY4 A;  3MXJ A;  3WQT A;  4CZG A;  4N76 A;  4CJU A;  1CLQ A;  1VRU A;  2W6L A;  1RT2 A;  3U6F A;  1NOY A;  3VOV A;  3NF8 A;  5EOY A;  3F5T A;  1ASV A;  4B8C A;  5KQD A;  4ELT A;  2HHX A;  2E4L A;  5LY3 A;  1OH8 A;  2VG5 A;  1HKG A;  4RTF D;  1JKH A;  4M42 A;  4NXN K;  4BRC A;  4IJA A;  3OJU A;  3PSF A;  4DQP A;  3VEX A;  3K5L A;  1NGC A;  5GIP A;  2ZM6 K;  3NE6 A;  3I56 N;  1GOC A;  4EHT A;  3THX A;  4PY5 A;  3IMX A;  1TKD A;  4KH4 A;  4HTU A;  3OA9 A;  4HCB A;  3HOT A;  4O0J A;  1TVR A;  3L2V A;  3C6H A;  2GUI A;  3NVM A;  3K5O A;  3B8A X;  1HKB A;  1BCM A;  4CBW A;  3FE1 A;  3QNN A;  5J1E A;  4DR1 K;  1SL2 A;  4BRI A;  2Z1J A;  2O8B B;  1JXB A;  2FSK A;  3KK1 A;  4IOA L;  4GV9 A;  4DQI A;  4JS4 A;  1RCH A;  1GOA A;  4CFD A;  4BRA A;  3ZT1 A;  4EFH A;  4E1N A;  1JLA A;  4FZX C;  2VGN A;  3MCA B;  3OYL A;  4JKA A;  3QER A;  3D6R A;  1J5E K;  3ZYY X;  2D0C A;  1GLL O;  4IO9 L;  2B5J A;  4KHN A;  4JV5 K;  3VQ4 A;  4IOC L;  3T1A A;  2HHS A;  1HX1 A;  1KAY A;  4V19 S;  4JLH A;  5ADX H;  2OCE A;  3KD5 E;  3WXM B;  3QFU A;  1NJX A;  4CJ5 A;  3WQU A;  1QS4 A;  1SS6 A;  2YNI A;  4BG8 A;  1WN7 A;  4N41 A;  4NCB A;  3G0Z A;  3LAK A;  3VQ8 A;  3DXK A;  3TR8 A;  3CCM N;  3CCJ N;  3K0S A;  4LFC K;  4DU1 A;  3VEZ A;  4IKF A;  3FFK B;  2ITG A;  3OYC A;  4IXC A;  1EET A;  1VSJ A;  3NGI A;  3AO5 A;  3NH0 A;  4J2D A;  1SV5 A;  4O5F A;  5BRF A;  3EL2 A;  3M8R A;  1HLU A;  1FW6 A;  1UA0 A;  2XRI A;  2AP1 A;  2X6N A;  5M1Q A;  3ULE A;  3NHG A;  4K25 A;  1VQ6 N;  5JMV A;  3MCP A;  4EZ6 A;  1KC8 O;  1EWQ A;  3FZF A;  1G15 A;  1T44 A;  1TKT A;  3OW2 M;  3RSE B;  2V7Z A;  3SLC A;  3E1Y A;  3CCE N;  4NO7 A;  1D8Y A;  2G8V A;  4WQ4 C;  4GVE A;  4J2A A;  3LAN A;  2XY5 A;  1NGH A;  2QKB A;  4CZH A;  3VQC A;  4Q0B A;  4DFP A;  3THY A;  2GV9 A;  2PY5 A;  1SQK A;  4B1Y B;  5AQQ A;  3ZSO A;  3GBT A;  1NG9 A;  4JK9 A;  3S9H A;  4FO0 A;  5HRR A;  5HBM A;  4FLW A;  3UKR B;  3C0B A;  1KXP A;  1T03 A;  3H1Q A;  4ISE A;  3KTQ A;  2R7Y A;  1VQO N;  3AVL A;  3D2E A;  5J2Q A;  4IG3 A;  1XNQ K;  3DRR A;  1XC3 A;  1KVA A;  2QTD A;  1EX4 A;  3DAW A;  5BRH A;  1L3V A;  3LP0 A;  4K8X A;  5B8H A;  3SPZ A;  1VAZ A;  3T3F A;  3CC7 N;  1VQM N;  3CD6 N;  2P5G A;  3ZT3 A;  5M1K A;  1D9D A;  4CGG A;  4QS8 A;  3NBP A;  4MO5 A;  5TKW A;  4OO1 J;  1NGG A;  2P9L A;  3QBX A;  2HB5 A;  1LOT B;  4Z4I A;  2G8H A;  5EU7 A;  3V4I A;  3BZK A;  4LC9 B;  3WUH A;  2F4V K;  2ZQB A;  2OA8 A;  1GLC G;  5C12 A;  2A5X A;  4CJ7 A;  4CHO A;  4IO8 A;  1YXQ A;  4KV8 A;  3CCL N;  3H3N O;  1BQM A;  4OGE A;  4F2R A;  2JWK A;  4M63 C;  2W41 A;  3VEO A;  2E1Z A;  3WXL A;  3ZSR A;  2B4J A;  4AM7 A;  4YFU A;  3SJH A;  5E41 A;  1NJY A;  2UUA K;  1QVG M;  3U9D A;  3OS1 A;  1B9F A;  2XY6 A;  3O4W A;  4WFA L;  3HPO A;  4DSI A;  1NKE A;  1KVC A;  2RE2 A;  4M3U A;  3C6U A;  2A41 A;  4PKH A;  3CM5 A;  4LFA K;  1N5Y A;  1HPZ A;  3L3U A;  4BG9 A;  2J4R A;  3KJV A;  1ZBU A;  2D0B A;  1XMO K;  1K9M O;  3IS9 A;  5LJV A;  1YVN A;  2OAN A;  4WYB A;  1ZBL A;  1Q8I A;  2GX9 A;  1Q9X A;  3RR8 A;  4BVP A;  1O13 A;  4B1X B;  1K8K B;  3CC2 N;  5IT9 O;  5AQY A;  3A5N C;  1RBR A;  3PV8 A;  1RT5 A;  4KI6 A;  3M8S A;  4YDU A;  4JKD A;  3OJS A;  5M1O A;  3GDQ A;  4OPA A;  1XI1 A;  4B3O A;  1CZB A;  5AFU A;  4B1Z A;  3THW A;  3MDQ A;  1RTJ A;  3NFA A;  3O4Q A;  4DMN A;  2P9I B;  3KKS A;  1EP4 A;  4HUG A;  4DSK A;  2CGL A;  4H5N A;  3OYJ A;  5AQW A;  5EVZ A;  4CFA A;  1S1X A;  3KLI A;  4W5R A;  1BL3 A;  4DLG A;  4GKK K;  2IDO A;  3QET A;  2EX3 A;  3UB5 A;  4CEZ A;  3GE1 A;  1J6Z A;  1ATR A;  1DTT A;  2HNY A;  3VQ7 A;  1BA1 A;  3AA5 X;  4LF7 K;  4YOT A;  1MDU B;  4H5W A;  4A61 A;  3HK2 A;  4JKF A;  3Q7C A;  2IC3 A;  4BRE A;  4BGB A;  3QEI A;  1T3V A;  3GL1 A;  4BRD A;  1GLD G;  5AQP A;  3L0Q A;  5HRS A;  1TGO A;  5IWA K;  1VQP N;  1U04 A;  4BQZ A;  3L8B A;  2F7T A;  4JKG A;  4FWS A;  4JHD B;  3AO2 A;  3IG1 A;  4CGF A;  3ALY A;  4BRN A;  1RT3 A;  3TAF A;  1BU6 O;  3CQY A;  4ILG B;  3OY9 A;  2HBK A;  4JI4 K;  4E7H A;  2H3G X;  3CFO A;  4BR5 A;  4DTP A;  3EYZ A;  3O5B A;  2FBT A;  2YJF A;  3QEW A;  3VA3 A;  1C1C A;  1JJ2 M;  4OLB A;  3KKR A;  4F8R A;  3CCS N;  1D9F A;  4FLZ A;  2A6A A;  3FZH A;  2GEM A;  1C6V A;  3O9U A;  2YNG A;  1NJW A;  2FSN A;  1XWL A;  5EXW A;  3H45 C;  2YJE A;  1EKE A;  3L2W A;  4BY9 C;  3LDO A;  4MQ3 A;  4WQ5 C;  1E3M A;  2KKZ A;  3VGL A;  4BR0 A;  4QS9 A;  3HL8 A;  3NAE A;  1J54 A;  1ZXO A;  2IGI A;  5CE3 A;  2WC9 A;  1I94 K;  1QZ5 A;  5LL6 Z;  1E4F T;  3O3H A;  1SKS A;  2YHX A;  4EAH D;  5CYM A;  2ZD1 A;  4FJK A;  4ELU A;  4H0V B;  1CXQ A;  1X9M A;  3CMA N;  4JN4 A;  3O4N A;  3ZEU B;  1VK0 A;  1SL0 A;  4B9S A;  3R3L A;  3K58 A;  4Z4C A;  4L3Q A;  4F4K A;  2QWR A;  4B3R K;  1EXQ A;  2Q97 A;  4CJW A;  3CCR N;  2UXB K;  2KHO A;  3G6E N;  3QIO A;  4JAX A;  4C1N K;  5T7B A;  4OLA A;  2RF2 A;  3IKM A;  3O3F A;  3KWG A;  3MEC A;  5KI6 A;  3BUZ B;  3OYD A;  4O44 A;  1X9S A;  3SZ2 A;  3ATU A;  1NBW A;  2I7N A;  4BE0 A;  2QK9 A;  5AQM A;  3IDH A;  4O5B A;  3AGK A;  1W9H A;  2VCP A;  4A5A A;  4BAC A;  4FJ7 A;  4PL7 A;  3KLH A;  2E1Y A;  2IVP A;  3CCQ N;  3OTO K;  2HHT A;  4JKH A;  4B1V A;  4F3O A;  3DOK A;  1WB9 A;  4KI4 A;  3DLG A;  1Y97 A;  4FSV A;  5EX5 A;  1NNE A;  1T6D A;  4PA1 A;  3SAH A;  2G8W A;  2E88 A;  3BF1 A;  1ILY A;  3OS0 A;  4FXD A;  3AA2 A;  2XHB A;  5K14 A;  1JLG A;  5GAE P;  3E9O A;  1HMV A;  3VF4 A;  4OVL A;  4FJL A;  1BA0 A;  4W5N A;  1BGX T;  4DS5 A;  3VQ6 A;  1RGI A;  3V1Q A;  3P83 D;  4FZY A;  3I0S A;  4A2B A;  4E89 A;  2P5O A;  1Z26 A;  4FWL A;  4E1J A;  2HBL A;  3GG4 A;  4C8N A;  4GNI A;  3DRP A;  4BC5 A;  4JKC A;  4CI6 A;  3MED A;  4CJV A;  4CEO A;  1Q81 O;  2DFE A;  2F9W A;  4DSL A;  4DR2 K;  3SMP A;  3PUF A;  5SZT A;  2QW9 A;  3I33 A;  4MLE A;  2ZJQ L;  1Z6R A;  4BRF A;  2P9S A;  3MK6 A;  1WSH A;  2IOC A;  3P38 A;  4PL8 A;  3SQ0 A;  3B6O A;  2D0O A;  5AR0 A;  4LY7 A;  4CGD A;  4AH9 A;  3PO4 A;  4W5Q A;  1HQE A;  1N6Q A;  2FSJ A;  3ULD A;  4HUE A;  1RDB A;  2HVH A;  4CK2 A;  4KHY A;  4IWV A;  5C0Y A;  1VSH A;  2HMP A;  4B9V A;  3KIO A;  3DM2 A;  2D5R A;  2NRR A;  4CJP A;  3VF6 A;  2JWL A;  3F2K A;  4CF0 A;  4BC2 A;  4X62 K;  3ZET B;  1Z05 A;  4F9O A;  2BE2 A;  3W3D A;  4R5P A;  4NLC A;  2YKM A;  4CHP A;  3R1X A;  3VQB A;  4DS4 A;  4CD1 A;  3V6D A;  4ZTJ A;  3TAP A;  3AVJ A;  1KAX A;  2KZM A;  5F2R A;  2V7Y A;  4RW6 A;  1S3X A;  3RR7 A;  4DF8 A;  3IFR A;  1BI4 B;  3R9P A;  4AF1 A;  2DFH A;  5BPN A;  4Y1C A;  4FK2 A;  4IFE A;  4BRO A;  5CZ1 A;  5GIO A;  5BN8 A;  4M3W A;  1NLV A;  4BGA A;  4DV3 K;  1F21 A;  2OTL N;  3DMJ A;  2P9U B;  5BRE A;  1VQ5 N;  3SAG A;  1YF5 L;  4DQS A;  5KPT A;  5BN9 A;  2GWJ A;  4CBX A;  4ISG A;  3N4Q A;  2HND A;  5CR4 A;  3NCI A;  1TYQ A;  1YJN N;  3DXM B;  3Q7B A;  4H0X B;  4CIE A;  4ID1 A;  4CFC A;  3OYM A;  5FPE A;  2YX6 A;  3DWL A;  2O8D A;  3EO3 A;  4IZ9 A;  4DV4 K;  1QSL A;  3HST B;  2GEL A;  4K41 A;  4GKJ K;  5FDL A;  1HRH A;  4CE9 A;  3O3G A;  3VN5 A;  3RRG A;  2YCH A;  4F2S A;  3V9Z A;  4FWR A;  5AQO A;  4DV6 K;  3VQE A;  2HMI A;  1S1U A;  3MWT A;  3F9K A;  4CEE A;  3E9L A;  4CZM A;  3WEE B;  2XO7 A;  1ASW A;  4NCG A;  3HVT A;  4CHQ A;  1U47 A;  1KRP A;  3UKU A;  5E26 A;  4FLV A;  1BHL A;  3AGR A;  3CFR A;  5AQR A;  2HBM A;  4CES A;  4LF5 K;  3QIN A;  5KRT A;  4U7B A;  4PWD A;  1R59 O;  5FPM A;  3CXC M;  3OBW A;  1Q18 A;  5FRO A;  1DGK N;  4JI7 K;  1BWF O;  3CPE A;  1X1P A;  1S9G A;  3A0I X;  1NGA A;  3JAM O;  4KBO A;  2O4I A;  1RFQ A;  3VEN A;  4DCH A;  2PBD A;  4FLT A;  4YOX A;  3BEX A;  4YDU C;  4JI1 K;  3AO1 A;  1U2V A;  2X74 A;  4AHS A;  2DY4 A;  1KFD A;  3C7N A;  2Z1G A;  4JI3 K;  4I7F A;  1D4X A;  3SI6 A;  1QE1 A;  5AZI A;  5DM7 L;  2HOE A;  3DRS A;  1NK6 A;  2KFN A;  4MDA A;  3QES A;  1CXU A;  3O80 A;  4BVO A;  4KHU A;  3QFP A;  4A5B A;  3BZC A;  4RW4 A;  3O8M A;  3UIQ A;  1NOZ A;  5AQS A;  4DQR A;  2OPP A;  1VSI A;  5I9E B;  4B1W B;  4FVU A;  2HHW A;  3ENH A;  3PX0 A;  1ZC6 A;  1QQC A;  1BIU A;  5M1N A;  1JLQ A;  2YHA A;  1W7A A;  3DI6 A;  1YJ9 N;  2NLX A;  1TUY A;  3ZT2 A;  3LL3 A;  3TSQ A;  5AZJ A;  4FJ5 A;  4IFV A;  2QWN A;  4Z94 A;  3ID6 A;  3OYH A;  4GY2 B;  4I6M A;  2P51 A;  3FGU A;  3VGM A;  2VYP A;  1K6Y A;  2ASM A;  4LFB K;  2YNF A;  3IAY A;  4Z4E A; 
#chains in the Genus database with same CATH homology
 4RW7 A;  4RW8 A;  3THV A;  2LSN A;  1JLC A;  1YTA A;  4GVM A;  3VQ9 A;  2F8S A;  4M3R A;  3HXM A;  1NK8 A;  3C6T A;  3AVK A;  2ZE2 A;  2PYL A;  1WNS A;  4E7K A;  4CF2 A;  4PUO A;  2EHG A;  2G8I A;  1C0U A;  1Q9X A;  1SUQ A;  3RR8 A;  3RRH A;  2NUB A;  2IS3 A;  3AVH A;  3AVN A;  5HP1 A;  4CGI A;  1RBR A;  3PV8 A;  3WNE A;  2YV0 X;  4M45 A;  4N56 A;  1RT5 A;  3KK3 A;  1Q9Y A;  4B9M A;  4KI6 A;  3M8S A;  3QO9 A;  4FLY A;  2OPQ A;  2RPI A;  3S3N A;  4FW1 A;  3OJS A;  4KHW A;  3DLB A;  4E7J A;  1XI1 A;  1C1B A;  3M8Q A;  1CZB A;  3SJJ A;  4B3O A;  4IBN A;  1NKC A;  5C24 A;  3AO3 A;  2DFF A;  3ZCM A;  1ASU A;  5CY4 A;  3BGR A;  3OYE A;  1IG9 A;  1QSS A;  3NFA A;  1RTJ A;  3AA4 A;  3MXI A;  3O4Q A;  1WSF A;  4DMN A;  3KKS A;  1EP4 A;  4RG8 A;  4HUG A;  1L3S A;  4DSK A;  4WE1 A;  4KRF A;  4CK1 A;  4DFM A;  3OYJ A;  4DU4 A;  4M3X A;  1NK7 A;  4CHZ A;  3IRX A;  1UAX A;  4CFA A;  1S1X A;  2Q3S A;  3KLI A;  3EZ5 A;  3SV4 A;  4W5R A;  1BL3 A;  4DLG A;  3SQ2 A;  2IDO A;  1T05 A;  3C95 A;  3LPU A;  3VQQ A;  1A5X A;  3QET A;  2EX3 A;  1Z25 A;  4CEZ A;  1C1A A;  1LWF A;  2HNY A;  1DTT A;  3HYF A;  4M41 A;  3VQ7 A;  3KLE A;  1UOC A;  3AA5 X;  4Y1D A;  3SCX A;  4CGJ A;  4FJG A;  3SUO A;  4H4M A;  3QLH A;  3HK2 A;  5DMR A;  2IC3 A;  4B9U A;  1LV5 A;  3QIP A;  3MXM A;  1JXE A;  3HPH A;  4AIL C;  3QEI A;  4KTQ A;  4BDP A;  4ICL A;  1U48 A;  4I9L A;  4FLX A;  4E7L A;  1LAV A;  1XHZ A;  4AHV A;  3K5N A;  2A1R A;  4EP4 A;  1DLO A;  5HRS A;  1TGO A;  3BDP A;  1U04 A;  2VG6 A;  3PY8 A;  3L8B A;  3LZJ A;  4BWM A;  4CHY A;  3AO2 A;  3IG1 A;  4CGF A;  3ALY A;  1RT3 A;  4DLE A;  3TAF A;  3DLE A;  4H4O A;  3AVF A;  1L3U A;  4CJF A;  1BIZ A;  3TAG A;  1KVB A;  3PO5 A;  4PQU A;  2VWJ A;  1S1W A;  2IAJ A;  4O4G A;  4RW9 A;  3OY9 A;  3RWU A;  3VA0 A;  4OGC A;  4JRP A;  4HUF A;  4FJ8 A;  3NGZ A;  4E7H A;  4ZTF A;  5CYQ A;  1C0T A;  3CFO A;  2W42 A;  4DTP A;  1ZBI A;  4FJ9 A;  3SUQ A;  3EYZ A;  2FBT A;  1YVU A;  2G8U A;  4B9T A;  4DTO A;  3QEW A;  3VA3 A;  1RT7 A;  4OPK A;  4LSL A;  1C1C A;  1JLF A;  3KD1 E;  1HYV A;  1RDA A;  3TWH A;  4FJN A;  5J2P A;  1C0M A;  3LWM A;  1RDD A;  4G1Q A;  3OVN A;  3SYZ A;  3KKR A;  5KGX A;  3TAB A;  4F8R A;  4CF1 A;  2FC0 A;  4OLB A;  1D9F A;  4FLZ A;  3KK2 A;  3TAE A;  1IH7 A;  4C8O A;  1S6Q A;  1C6V A;  1B92 A;  4CEA A;  4CJQ A;  2YNG A;  3WNH A;  1LAW A;  3F73 A;  1NJW A;  4AHT A;  3HJF A;  1HJR A;  1GOB A;  4QOZ B;  1XWL A;  3C94 A;  4GW6 A;  3WNF A;  4HVJ A;  1EKE A;  1RT4 A;  3L2W A;  3P5J A;  3QEV A;  3B6P A;  4MQ3 A;  2P1J A;  2Y1J A;  1SL1 A;  3LWL A;  3TAM A;  3HL8 A;  5SWM A;  3QNO A;  3NAE A;  1T7P A;  1J54 A;  2IGI A;  4MFB A;  2F96 A;  1J9A A;  3KLG A;  4O0I A;  3O3H A;  3S3M A;  1SKS A;  1XC9 A;  4AHC A;  2PYJ A;  4KHQ A;  3NH1 A;  5CYM A;  1JLE A;  2ZD1 A;  4FJK A;  1TL3 A;  5KTQ A;  4ELU A;  4N5S A;  3ISN C;  4ID5 A;  4KTZ A;  1CXQ A;  4OJR A;  4E1M A;  4DTM A;  3D0P A;  3ZSZ A;  3OYG A;  3QEP A;  1X9M A;  1NK0 A;  3NF9 A;  4M3T A;  3O4N A;  4KRE A;  1VK0 A;  1I39 A;  1SL0 A;  3V9X A;  4B9S A;  4NCA A;  3K58 A;  1D5A A;  4Z4C A;  4OPJ A;  1U49 A;  4B9L A;  4Z4G A;  2HHQ A;  1SKR A;  1VSD A;  5C25 A;  3S3O A;  4F4K A;  1EXQ A;  2E6L A;  5HRO A;  4CCH A;  4CJW A;  1LW2 A;  4LH5 A;  1U4B A;  4DFK A;  4FJI A;  4FZZ A;  1IKY A;  1TKX A;  1JL1 A;  4CJ4 A;  1J53 A;  4Q5V A;  3LAL A;  4JRQ A;  4FJM A;  4BE1 A;  3MEG A;  3QIO A;  5T7B A;  2FBY A;  1BIS A;  1UWB A;  4OLA A;  2RF2 A;  3O3F A;  3DLH A;  3MEC A;  5JS1 A;  5KI6 A;  2FBV A;  3OYD A;  4O44 A;  4CEQ A;  1DTQ A;  1X9S A;  3SZ2 A;  4BE0 A;  4QCL A;  2QK9 A;  3NGY A;  4O5B A;  3CFP A;  1TV6 A;  4CF8 A;  3CG7 A;  3VQA A;  3V9U A;  3V81 A;  1W9H A;  4NYN A;  3SUP A;  4UQG A;  4DTR A;  2KTQ A;  3K2P A;  3OYN A;  4BAC A;  4M3Z A;  4Z4H A;  1B9D A;  1QHT A;  4FM1 A;  4FJ7 A;  3DLK A;  1HQU A;  1I3A A;  3WNG A;  4DG1 A;  3ZSQ A;  3KLH A;  3OYK A;  2GBZ A;  3RTV A;  2X78 A;  2DTU A;  3SUN A;  4ZHR A;  2HHT A;  4FW2 A;  3JYT A;  5J2M A;  1TAU A;  4F3O A;  3SQ4 A;  1W0H A;  3DOK A;  3LPT A;  3HP9 A;  4KI4 A;  2VWK A;  3ASM A;  3DLG A;  4CER A;  1Y97 A;  1FKP A;  4IDK A;  4AHR A;  4CEB A;  3L2U A;  3HVR A;  3RMA A;  4LD0 A;  4PA1 A;  4E19 A;  3NF6 A;  3MXJ A;  3TI0 A;  2G8W A;  4C8K A;  4DWI A;  4KPY A;  1UA1 A;  1JL2 A;  4W5T A;  4I2P A;  1FXX A;  4N76 A;  2YKN A;  3OS0 A;  4CJU A;  4FXD A;  4B08 A;  3AA2 A;  1KSP A;  1VRU A;  5K14 A;  1JLG A;  1RT2 A;  2XHB A;  3U6F A;  3NF7 A;  1CLQ A;  4CK3 A;  1NOY A;  3NF8 A;  2HW3 A;  1HMV A;  4CGH A;  1ASV A;  4B8C A;  4OVL A;  4FJL A;  4W5N A;  1RBU A;  1BGX T;  3HPG A;  4DS5 A;  4ELT A;  2I5J A;  3U3Y A;  3SQ1 A;  4KB0 A;  1HYS A;  1RBV A;  3VQ6 A;  4FK4 A;  3V1Q A;  4JS5 A;  3P83 D;  1WSI A;  4BE2 A;  4FZY A;  3I0S A;  2E4L A;  4BWJ A;  4E89 A;  2P5O A;  1Z26 A;  3LP3 A;  2VG5 A;  2BAN A;  3I0R A;  4KTW A;  1JKH A;  4FM2 A;  3L3V A;  4DF4 A;  1TK0 A;  4C8N A;  1YTU A;  2BDP A;  4M42 A;  1S9E A;  3QEX A;  3D45 A;  3DRP A;  4E7I A;  3MED A;  2G8K A;  4CJV A;  4CEO A;  3A2F A;  2DFE A;  4CHN A;  3OJU A;  3TAR A;  4DQP A;  1KLM A;  4B9N A;  4IFY A;  1HNV A;  4DSL A;  3K5L A;  4DTS A;  3M8P A;  4DSF A;  3PUF A;  5SZT A;  2OPR A;  4YNQ A;  3NE6 A;  1XHX A;  1QSY A;  1GOC A;  4W5O A;  2YHB A;  4CED A;  3ZSX A;  5HRN A;  4PY5 A;  1TKD A;  1FKO A;  1IKW A;  4HTU A;  1WAF A;  4HCB A;  1WSH A;  2IOC A;  3SQ0 A;  2KQ2 A;  4O0J A;  4XIU A;  3B6O A;  1TVR A;  2RN2 A;  1QTM A;  4I2Q A;  4CIF A;  4LY7 A;  3L2V A;  4CGD A;  4F3T A;  3HM9 A;  2GUI A;  4AH9 A;  3PO4 A;  3LDS A;  3K5O A;  3SPY A;  4W5Q A;  1HQE A;  1N6Q A;  1BCM A;  1KCF A;  3AVG A;  4KFB A;  3AVA A;  3AVI A;  5D3G A;  3ULD A;  3EY1 A;  3AO4 A;  3ZT0 A;  4HCC A;  4N47 A;  3QNN A;  4HHT A;  1RDB A;  5J1E A;  4HUE A;  1SL2 A;  2HVH A;  2Z1J A;  3FFI A;  4OKK A;  4CK2 A;  3AVM A;  2HHV A;  4KHY A;  1JXB A;  3KK1 A;  1VSH A;  1RT6 A;  3PX6 A;  4B9V A;  4DQI A;  4JS4 A;  3CYM A;  3KIO A;  3G10 A;  2E6M A;  1BI4 A;  1RCH A;  1GOA A;  2ATQ A;  4CFD A;  3ZSV A;  3L2Q A;  3ZT1 A;  3DM2 A;  2D5R A;  4CJP A;  4E1N A;  3TAN A;  4CEF A;  4KO0 A;  1JLA A;  2HNZ A;  4FZX C;  3I8D A;  2XY8 A;  1ZBH A;  3OYL A;  4CF0 A;  2QKK A;  4CJE A;  3QER A;  3ITH A;  4CJ3 A;  4CEC A;  3RMB A;  2D0C A;  2BE2 A;  1A5V A;  4R5P A;  3LAM A;  1RT1 A;  1ITG A;  3ZT4 A;  4FJX A;  2B5J A;  1IKX A;  2YKM A;  4CHP A;  4KHN A;  1VRT A;  3VQ4 A;  3V1R A;  3NH2 A;  4TSX A;  3T1A A;  3U3G A;  3VQB A;  4DS4 A;  3V6D A;  4K8Z A;  2HHS A;  4ZTJ A;  4JLH A;  3TAP A;  2B6A A;  3AVJ A;  1HYZ A;  3KD5 E;  4OKJ A;  1VSE A;  1NJX A;  4CJ5 A;  3AV9 A;  4NYF A;  2KZM A;  1QS4 A;  4M3Y A;  2PZS A;  2WOM A;  2YNI A;  4RW6 A;  1WN7 A;  4N41 A;  3RR7 A;  4NCB A;  4DF8 A;  4CJL A;  3G0Z A;  1WSJ A;  3LAK A;  3AA3 A;  3TR8 A;  3VQ8 A;  4DTJ A;  1O1W A;  1BI4 B;  3KLF A;  1YT3 A;  3TAQ A;  4DU1 A;  1RTI A;  2DFH A;  4IKF A;  3OYB A;  1S6P A;  5FRM A;  2ITG A;  4Y1C A;  3OYC A;  4FK2 A;  1KFS A;  2BGG A;  1WSG A;  4DSJ A;  1EET A;  1VSJ A;  4FM0 A;  3NGI A;  3AO5 A;  4OKE A;  1TKZ A;  3NH0 A;  4J2D A;  1SV5 A;  5CZ1 A;  1IO2 A;  1WLJ A;  3M8R A;  2OYQ A;  3ZSW A;  4M3W A;  2Z1I A;  4DTN A;  5KRS A;  2Y1I A;  2D0A A;  1UA0 A;  2XRI A;  2X6N A;  1F21 A;  3NHG A;  1IKV A;  4FJJ A;  1KTQ A;  3DMJ A;  3SNN A;  3OYF A;  2JGU A;  4FCY A;  1LWC A;  4CF9 A;  3PX4 A;  1A5W A;  4DQS A;  3V1O A;  4EZ6 A;  2HHU A;  2OPS A;  4KKO A;  3RMD A;  3ZSY A;  1G15 A;  1MU2 A;  1TKT A;  5C42 A;  3MEE A;  1CZ9 A;  1RTH A;  1T8E A;  1RTD A;  4CJS A;  2HND A;  3NCI A;  1WSE A;  5FRN A;  4CIE A;  1TAQ A;  4ID1 A;  3T19 A;  4CFC A;  1D8Y A;  2G8V A;  5HLF A;  4CJR A;  3OYM A;  4J2A A;  3LAN A;  3CQ8 A;  2XY5 A;  2ETJ A;  1L5U A;  2QKB A;  3VQP A;  3K57 A;  4O55 A;  4CJK A;  4E3S A;  4EZ9 A;  4CIG A;  3VQC A;  2YNH A;  4DFP A;  3LP2 A;  4Q0B A;  1QSL A;  2GV9 A;  3K5M A;  2QXF A;  3HST B;  1S1T A;  2PY5 A;  3ZSO A;  2O4G A;  5I42 A;  1TK5 A;  5J2N A;  4KAZ A;  2OZM A;  3S9H A;  5FDL A;  1HRH A;  4CE9 A;  3HT3 A;  3O3G A;  2VG7 A;  5HRR A;  3VN5 A;  3RRG A;  2HVI A;  4F2S A;  5HBM A;  4FLW A;  3V9Z A;  3K59 A;  1HNI A;  3VQE A;  2HMI A;  4DFJ A;  1S1U A;  4LSN A;  3F9K A;  4CEE A;  4FYD A;  5HRP A;  1BQN A;  1NK5 A;  1T03 A;  2F8T A;  2XO7 A;  3KTQ A;  2JLE A;  1ASW A;  4NCG A;  2R7Y A;  1KLN A;  1WAJ A;  3AVL A;  3HVT A;  4DTU A;  1VSL A;  3HP6 A;  5J2Q A;  4CHQ A;  2XY7 A;  2WON A;  4IG3 A;  4DU3 A;  1U47 A;  4CJT A;  1KRP A;  2KW4 A;  4CFB A;  3DRR A;  3DYA A;  4IG0 A;  1KVA A;  4FLV A;  1BHL A;  3CFR A;  1EX4 A;  1X9W A;  2A1S A;  3AVB A;  5I3U A;  1L3V A;  4BDZ A;  4FJH A;  3LP0 A;  4CES A;  4DTX A;  3SPZ A;  4DSE A;  3QIN A;  1R0A A;  4K8X A;  3T3F A;  5KRT A;  4PWD A;  3L2R A;  4FLU A;  2P5G A;  4C8M A;  3ZT3 A;  4C8L A;  5FRO A;  1D9D A;  4CGG A;  1NK4 A;  4KHS A;  3NBP A;  1X1P A;  1S9G A;  1RNH A;  1S1V A;  2O4I A;  2HB5 A;  4B8A B;  4Z4I A;  2G8H A;  2HHX A;  3MAQ A;  5EU7 A;  3V4I A;  3CM6 A;  4Z4E A;  2RKI A;  3SV3 A;  4FLT A;  1ZBF A;  2G8F A;  3HO1 A;  1RBS A;  3AO1 A;  2X6S A;  2ZQB A;  3DOL A;  3E01 A;  3P1G A;  3OS2 A;  2OA8 A;  2X74 A;  4AHS A;  1VSF A;  2DY4 A;  1KFD A;  4CHO A;  1LWE A;  2Z1G A;  4KV8 A;  4FVM A;  5JS2 A;  3V9W A;  1ZYQ A;  1RIL A;  1TL1 A;  4AHU A;  4I9Q A;  4I7F A;  4OGE A;  1BQM A;  3VQD A;  1QE1 A;  3SI6 A;  4ELV A;  1S5J A;  3H08 A;  3LZI A;  3DRS A;  4LH4 A;  4F2R A;  1NK6 A;  1J5O A;  2KFN A;  4E0D A;  4J2E A;  3OYA A;  5DK5 A;  3QES A;  3ZSR A;  1CXU A;  3JSM A;  4KB1 A;  4Z4F A;  4KHU A;  3OYI A;  1NK9 A;  2B4J A;  1JLB A;  4RW4 A;  3UIQ A;  1L3T A;  2FBX A;  1NOZ A;  4DQR A;  4YFU A;  2OPP A;  2Z1H A;  3LP1 A;  4H8K A;  5E41 A;  4J2B A;  2OZS A;  1VSI A;  1NJY A;  1NKB A;  1LW0 A;  5CZ2 A;  2HHW A;  1VSK A;  4FK0 A;  1VSM A;  1REV A;  3OS1 A;  1B9F A;  3PX0 A;  1QQC A;  2XY6 A;  1BIU A;  1JLQ A;  1RDC A;  2YHA A;  3HPO A;  3DLR A;  1NKE A;  4GMJ B;  1RBT A;  4DSI A;  3DI6 A;  1KVC A;  1BCO A;  3VQ5 A;  3V9S A;  4M3U A;  3C6U A;  3ZT2 A;  2KZZ A;  3CM5 A;  4L8R B;  4EP5 A;  1N5Y A;  3NDK A;  1HPZ A;  3L3U A;  4FJ5 A;  4IFV A;  3KJV A;  4BDY A;  2KFZ A;  2AJQ A;  1ZBU A;  2D0B A;  3OYH A;  1TK8 A;  1NJZ A;  2P51 A;  3AVC A;  3IS9 A;  1SKW A;  1FK9 A;  1U45 A;  1K6Y A;  4QAG A;  3RMC A;  4Z0U A;  1ZBL A;  2YNF A;  3IAY A;  5KGW A;  1Q8I A;  4DQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...