4QAGA

Structure of a dihydroxycoumarin active-site inhibitor in complex with the rnase h domain of hiv-1 reverse transcriptase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structure of a Dihydroxycoumarin Active-Site Inhibitor in Complex with the RNase H Domain of HIV-1 Reverse Transcriptase and Structure-Activity Analysis of Inhibitor Analogs.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4qagA00
5SWMA 2BE2A 2EX3A 4E19A 2G8WA 3SQ0A 4J2DA 1L5UA 3KTQA 3DOLA 3DYAA 4E7HA 3KK1A 4CK1A 3E01A 3KLFA 4M3ZA 4N47A 4OLBA 3K5MA 1RNHA 1XHZA 3TI0A 1MU2A 3TAFA 1ZBFA 2E6LA 4FZZA 3OYMA 1UA1A 2X78A 1T8EA 3WNEA 1UWBA 2XY5A 4ZTFA 2YKMA 1RBRA 4FJKA 1QHTA 4RW9A 1QQCA 1C1AA 4DTSA 4HUGA 5CYMA 4ICLA 3AO3A 2VWJA 2OPQA 1ASVA 2Z1HA 4DTOA 3RMDA 4CJWA 1VK0A 2KTQA 1S6PA 4C8KA 5JS1A 1IKYA 3AVFA 2F8SA 1EP4A 4M3YA 4BACA 1KCFA 5FRMA 3LAMA 1QSYA 4JS5A 3SQ1A 4KTWA 4OVLA 2HW3A 1ZBUA 4LSNA 4FJXA 3QETA 2NUBA 4AHSA 3VN5A 3RMAA 1NK0A 1SKRA 2OZSA 4F4KA 3PX4A 1NKBA 4CF2A 5CY4A 2HB5A 4DFJA 4B3OA 2GV9A 2G8KA 1TK0A 2PYLA 1CLQA 4CCHA 3ITHA 1TL3A 4DLGA 2W42A 3ASMA 4CECA 3QLHA 4CJPA 4IKFA 5CZ1A 4FCYA 2IDOA 3VA3A 3IAYA 3AO5A 2RF2A 1RCHA 3OYKA 2B5JA 2FBVA 3AVHA 4IBNA 4EZ9A 1BQMA 1GOBA 1WSEA 1CXQA 4I2PA 4E0DA 3OYDA 1VSMA 2QXFA 3HSTB 2OPSA 4CFBA 1NK9A 3K57A 3CYMA 2X74A 3V4IA 4ID1A 1I39A 3ZSRA 4B9LA 4Z4EA 3SYZA 1TAUA 1FKPA 4FLWA 2BDPA 3OYGA 1REVA 4AH9A 2IAJA 3U3YA 3D0PA 3LPUA 1VSKA 3T3FA 3DM2A 2HHVA 4KTZA 4IDKA 3QERA 1J5OA 1BHLA 3HPHA 3V6DA 4FYDA 3NF8A 3KIOA 4MFBA 4C8NA 4FM2A 3RWUA 4FM0A 3KJVA 4KAZA 4FJ7A 5J2QA 3LDSA 3TR8A 1TL1A 4HCCA 1JLAA 1TKZA 3C6TA 2FC0A 1T7PA 1UOCA 5J1EA 4IG0A 3SV4A 4OGEA 4DS5A 2AJQA 2VG7A 4FZXC 1KLMA 1VSLA 3PO4A 3VQPA 1VSEA 4DQIA 4FJJA 3KK3A 3HO1A 3HVTA 3K5NA 5KGWA 3G0ZA 3O3FA 3S9HA 4ID5A 4O44A 4N5SA 5HBMA 4B9VA 1BISA 1RBUA 1RTIA 3SI6A 3S3OA 3WNGA 2IS3A 1HYZA 4KKOA 3V1QA 1JLFA 3ZSQA 4DQRA 3QNOA 5I3UA 3TANA 4OPJA 1JXEA 2G8UA 2KW4A 2VWKA 2DFHA 2LSNA 1S1WA 4DSEA 4DSLA 1DTQA 2HHUA 4C8LA 5I42A 1DLOA 3NH0A 4BDPA 2OPPA 1QSSA 3PY8A 4FJLA 3ZT4A 4CJEA 4CJFA 3OS0A 4AHRA 4F2RA 3VQQA 1WN7A 4M3TA 2IGIA 3DRSA 4JS4A 4E7JA 4EZ6A 1VSDA 1TAQA 2XRIA 2BGGA 3L2UA 3DI6A 4AHTA 3SNNA 1L3UA 3AA4A 1WLJA 3TWHA 1XC9A 4CGHA 4FVMA 5KRTA 1B92A 1BCMA 2JGUA 4DFMA 2XY7A 4MQ3A 3AO4A 3SCXA 2QKKA 4PY5A 3VQCA 1NJYA 1BI4B 3THVA 3CG7A 2QK9A 3B6PA 3RR7A 3M8QA 4B9NA 4KB1A 4DSIA 4I2QA 4HVJA 1ZBIA 1RBTA 3PO5A 1ZYQA 3KD1E 4OPKA 3ZSZA 2OA8A 3ZSWA 1DTTA 3QEVA 1TKXA 4I7FA 4BE2A 2JLEA 3OYLA 4BE0A 3SQ4A 1F21A 3DLHA 5KTQA 3AO1A 3BGRA 1LAWA 3RRGA 1TKDA 4KFBA 1U45A 4G1QA 3NCIA 4M3UA 4GW6A 1SV5A 1JLBA 1Z25A 3LZJA 4FJ8A 3P83D 4KO0A 5KGXA 4W5RA 5J2PA 3NGZA 1HPZA 1RBVA 2G8VA 1B9DA 4CERA 3TAQA 3TARA 2GUIA 1W0HA 3K59A 1RT5A 3K5LA 1S9GA 3ZSYA 3ZT2A 2IOCA 3RMCA 3AVGA 2KZZA 3S3NA 4JLHA 4AHVA 5C25A 3NHGA 1IKVA 4NCGA 1S1TA 1RT3A 3OYEA 4B8CA 3KLHA 2YNIA 4HUFA 4LSLA 2RPIA 3JYTA 3HL8A 3K2PA 1UA0A 4Q0BA 2DFEA 4ELVA 1U4BA 1Y97A 4M45A 3EYZA 3HXMA 1VSIA 1NK5A 1SL1A 2HHWA 4CJUA 3NBPA 1C1BA 4OGCA 4K8ZA 3LWMA 3SPYA 1RTHA 4CJ5A 4W5QA 4CJTA 4CHYA 4CIGA 1L3SA 3DRRA 4KV8A 2ATQA 4IFYA 3HPGA 3NF6A 3OY9A 2E6MA 3KLIA 3L2RA 4HUEA 4FLUA 5FDLA 1NK7A 3DLRA 2P5OA 4DSKA 1YTUA 4CJVA 4W5NA 4FLVA 3AVAA 4KI4A 1NJXA 3OYAA 2X6NA 2D0CA 1VSJA 4HHTA 4DLEA 1NKCA 3F73A 3HK2A 5C42A 2PY5A 3I0SA 2D5RA 4PUOA 1WAJA 3AV9A 2Z1JA 3VQ8A 3ZCMA 4CHZA 4CEBA 4QOZB 2GBZA 3WNHA 3TAPA 4CEOA 4KHUA 4M3WA 4CFAA 4DWIA 2P51A 1W9HA 4RW6A 4CF0A 4DTRA 3TAMA 4M3XA 5HRSA 1HYVA 3QIOA 4CHQA 3EY1A 3CFRA 4F8RA 3AVLA 4AHCA 4B9MA 2DFFA 4CEEA 3HJFA 1HJRA 2HVHA 2RKIA 3O4NA 1U04A 4FK4A 3VQ6A 3V9UA 4O0JA 4YNQA 3VQ7A 4XIUA 4F3OA 1L3VA 3U6FA 3LP2A 1WSFA 1RDDA 4FK2A 2VG6A 2OPRA 4FLXA 3LP1A 2RN2A 3SJJA 1NK8A 4I9QA 4KHSA 3LANA 1JLGA 4E1MA 4UQGA 3MXMA 3PUFA 3DLBA 4KHQA 2A1SA 2ZD1A 5DK5A 1D9FA 1TV6A 1B9FA 2DY4A 3SUPA 3QINA 3MAQA 3OJSA 1T03A 1KRPA 4RW8A 1LAVA 1T05A 1WNSA 3DLEA 1FK9A 1KTQA 4KHYA 1RT2A 4CHNA 4BWMA 3UIQA 2G8FA 3LP0A 1C0TA 1ZBLA 4CIFA 1S1XA 3O4QA 2Y1JA 2WONA 3H08A 4CEDA 4CJ4A 4PWDA 1S5JA 1KVCA 4CF9A 4F3TA 3C6UA 5D3GA 4CGFA 3O3GA 1HQUA 3NH2A 3TAGA 1QSLA 4ELTA 4B9UA 1FXXA 4O4GA 4Z4FA 4NCAA 3KKSA 1EX4A 1WAFA 3OYNA 3DRPA 3L2WA 1O1WA 4DU3A 3L2QA 3SZ2A 3LP3A 3AO2A 1N5YA 3P1GA 3VQ9A 3L8BA 4CHOA 1BCOA 4FLTA 1WSIA 4CIEA 3QEXA 4DTUA 1S9EA 1CZ9A 3C95A 1S1VA 5FROA 5SZTA 3SUOA 2HNYA 4RG8A 1EKEA 4B9TA 1BGXT 3RMBA 2VG5A 1HQEA 4PA1A 4DFPA 2HHXA 4E7KA 3SV3A 1A5XA 1JLEA 3NF7A 1SL2A 1QE1A 3AA2A 3VQEA 3O3HA 3KLGA 1NJWA 4FXDA 3QO9A 2KQ2A 1U48A 1RDAA 5K14A 1NOYA 1BIUA 4O5BA 3CM5A 3AVCA 3S3MA 4HCBA 1SKWA 4H8KA 4DSJA 1RTDA 2PZSA 3ZSOA 4FW2A 4LH5A 4DSFA 1U47A 4M42A 5C24A 4GMJB 4CF1A 3OYFA 1JLCA 1QS4A 1L3TA 1G15A 3KD5E 4DF4A 4FK0A 3OVNA 4CJLA 4DTMA 3OJUA 1CZBA 3KLEA 3ZT3A 3C94A 4M3RA 2Z1GA 4Z4HA 4DQQA 4Z4IA 3MEEA 1TGOA 4O0IA 3I8DA 2XHBA 3CFPA 3A2FA 4CJQA 4FZYA 4CGDA 4W5OA 3NDKA 3DLKA 3V9XA 3ULDA 1D9DA 2E4LA 1D5AA 1C1CA 3QNNA 1U49A 4CK2A 2Z1IA 4GVMA 4CGJA 4CFCA 2ITGA 4KHNA 1VSFA 4K8XA 5E41A 1LV5A 1N6QA 1KLNA 4B9SA 3OYCA 2F96A 2D0BA 2IC3A 1JL2A 1BIZA 3ALYA 3M8PA 3V9SA 3T19A 4Z4GA 3IRXA 3EZ5A 3PV8A 4O55A 1VRUA 3QESA 4CEFA 4YFUA 4FJMA 5EU7A 3SQ2A 3NGYA 3KKRA 4NYFA 4JRPA 1RTJA 1A5VA 2YNHA 4DTJA 3VQDA 1QTMA 1WSHA 4KTQA 4R5PA 2HVIA 4ZHRA 3B6OA 4M41A 4BE1A 2OYQA 4CJ3A 2YNFA 4RW4A 3D45A 3V9WA 2HHSA 3OYIA 3DOKA 1HNIA 2BANA 4OKEA 1KVAA 4CK3A 3NF9A 3OS2A 1Z26A 4FW1A 4FJHA 2HNZA 2YHAA 1I3AA 4DF8A 2D0AA 1XHXA 1C6VA 4OKJA 3CQ8A 4FJGA 4BDZA 4Z0UA 3AVBA 2XY6A 4OLAA 4Y1CA 1RDCA 2HNDA 5DMRA 3OYHA 4Y1DA 1ASUA 3HPOA 2X6SA 5KRSA 3KK2A 2HHQA 3RR8A 2G8IA 4PQUA 1XI1A 3ZT1A 2R7YA 4DFKA 4E1NA 4FLYA 4I9LA 2KFZA 1X9MA 3AA3A 1RILA 1LWCA 1LW2A 3HVRA 1JL1A 3F9KA 1J53A 5HLFA 4KRFA 4E7LA 4B8AB 4KPYA 2YKNA 2KZMA 1LWEA 4CF8A 2P1JA 4DQPA 4RW7A 3SPZA 2O4GA 3M8RA 1SUQA 5HROA 1LWFA 3MEDA 4CJSA 2Y1IA 1Q9XA 4FLZA 1VRTA 5J2NA 5HRRA 4CESA 4CEAA 4CEZA 3G10A 1IKXA 3I0RA 3MEGA 3ZSVA 4H4MA 5JS2A 3HT3A 1NJZA 3QIPA 4N41A 1RT7A 1X9SA 3V81A 3PX6A 1HMVA 3HP6A 3NGIA 4JRQA 2XO7A 4CFDA 4CJKA 1NK6A 1K6YA 4NYNA 3JSMA 4J2BA 2G8HA 1RT6A 1LW0A 3V1RA 1X9WA 4CE9A 1IKWA 1J54A 4Z4CA 1IH7A 1KFSA 3TABA 4KHWA 4CEQA 1WSGA 3M8SA 3MECA 3NFAA 1A5WA 3NAEA 3DLGA 4DTPA 4OJRA 3RRHA 2ZQBA 4ELUA 3DMJA 3L3UA 3P5JA 1ZBHA 1KSPA 3AVMA 1XWLA 3T1AA 3NH1A 4BDYA 3QEIA 5FRNA 4E89A 4KI6A 3TAEA 2YV0X 2QKBA 2B6AA 3L2VA 3V9ZA 4E7IA 3L3VA 3CM6A 4DU4A 4DTXA 4N56A 2P5GA 1TVRA 3ZSXA 2FBTA 4W5TA 3VA0A 1RBSA 3FFIA 3LAKA 3SUNA 1NK4A 1GOAA 3LPTA 5CZ2A 4KREA 1C0UA 1WSJA 2OZMA 1NOZA 4E3SA 2F8TA 3AVJA 1S6QA 4CHPA 5T7BA 1SL0A 3VQ4A 1YTAA 2O4IA 2PYJA 1ASWA 3VQBA 4DQSA 1Q9YA 4C8OA 4DG1A 2FBXA 3SUQA 1JLQA 4QCLA 4J2AA 4H4OA 2XY8A 1GOCA 5HRNA 4CGGA 4LY7A 2HHTA 3LALA 4QAGA 4OKKA 4KB0A 2YNGA 3HYFA 2EHGA 4FJNA 1ITGA 2KFNA 1RT1A 1UAXA 4IFVA 3LWLA 1EXQA 3VQAA 1RDBA 4TSXA 4BWJA 1X1PA 4LD0A 4J2EA 3QEWA 3BDPA 4AHUA 4FJIA 4C8MA 3RTVA 4ZTJA 3NE6A 4DS4A 1HRHA 1KVBA 1TK8A 1BI4A 1EETA 1C0MA 2ZE2A 5J2MA 1KFDA 3K58A 3MXIA 2A1RA 1TKTA 1HNVA 2HMIA 4FJ9A 1CXUA 4L8RB 1NKEA 4Q5VA 1R0AA 3ZT0A 1YVUA 3K5OA 3IS9A 4LH4A 4AILC 5HP1A 3OS1A 1RT4A 3AA5X 1SKSA 2I5JA 4CJRA 3HP9A 1S1UA 4FJ5A 2ETJA 5HRPA 4N76A 4FM1A 1HYSA 3V1OA 1JXBA 3VQ5A 3AVKA 2DTUA 4EP4A 1IG9A 1YT3A 4B08A 4DTNA 3U3GA 3MXJA 4DMNA 3OYBA 4EP5A 4NCBA 4IG3A 1TK5A 1VSHA 1FKOA 2WOMA 1JKHA 1Q8IA 3IG1A 4CGIA 1IO2A 3CFOA 3QEPA 1BQNA 2B4JA 3AVIA 3LZIA 1D8YA 5KI6A 2Q3SA 3HM9A 4F2SA 4WE1A 3ISNC 3AVNA 4HTUA 2FBYA 4DU1A 3PX0A 5CYQA 3WNFA 3OYJA 1BL3A 1J9AA 2YHBA
chains in the Genus database with same CATH superfamily
3IFRA 3CCRN 2A42A 4J2DA 3KTQA 3D7EO 4MLEA 4E7HA 3E01A 5AQVA 2H3GX 4OLBA 4IXCA 2ASPA 3TAFA 1V4SA 1I94K 2HBKA 1T8EA 3WNEA 4H03B 4ZTFA 2XY5A 5GINA 5FPDA 4HUGA 5CYMA 1ASVA 2Z1HA 4LF8K 1S6PA 4BRQA 1IKYA 2QWLA 2P9UA 3ENBA 3OBWA 5FRMA 1KCFA 1NMNA 4BQLA 3LAMA 1RGIA 4FJXA 2WC9A 4LSNA 2O8DB 4AHSA 3ULEA 1NK0A 1SKRA 2HB5A 1QVGM 2NRTA 2E2PA 2YCHA 5AQSA 2WFBA 4DLGA 3ASMA 4CECA 3QLHA 3PIPL 1RCHA 1BQMA 1KAXA 1WSEA 3CJ9A 4E0DA 3NVKA 3CCQN 5C2DA 4CFBA 3I56N 1NGIA 1QQOA 3ZEUB 4B9LA 4Z4EA 2P9PA 3SBGA 1TAUA 4ISEA 1W2BM 3DLLL 2F9WA 3SMPA 4B1VA 4JKFA 2HHVA 3QERA 4K42A 3WXLA 4C8NA 3UE5A 4K0KK 4B3MK 4FJ7A 3LDSA 1TL1A 4HCCA 3HRGA 2FC0A 4IFEA 4IG0A 4BROA 3MN9A 4OGEA 4DQ8A 3VQPA 1VSEA 3OW2M 3KK3A 5BR8K 3CHWA 3BY5A 1BISA 1RTIA 3SI6A 3S3OA 3V1QA 3VEYA 3THXA 5I3UA 3TANA 4X65K 4OPJA 4YOTA 2LSNA 1S1WA 4JKBA 2VYPA 5BN8A 5I42A 3NH0A 4JV5K 3ZT4A 4CJEA 3E9PA 3OS0A 1DEJA 1DKGD 4LF9K 3VQQA 4GKJK 3DRSA 4DKWA 1Q81O 2BGGA 3DI6A 4AHTA 1L3UA 1WLJA 4BY9C 4DFMA 3SCXA 4JNEA 5AQOA 1NJYA 4QS8A 2O8BA 1VQMN 4PL7A 3M8QA 4B9NA 4DSIA 4IEIA 3KD1E 4R79A 3ZSZA 3ZSWA 1SS6A 2FSKA 3AO1A 4KFBA 4GW6A 3H6EA 3LZJA 3MCAB 3P83D 2F4VK 1HPZA 1RBVA 3FFKB 2G8VA 3TAQA 1FW6A 1RT5A 1YVNA 4EAHD 2Q0UA 4LF6K 2KZZA 3S3NA 5AQGA 2GWKA 3MWPA 3SJHA 2E88A 5BRHA 2YI1A 3OYEA 3KLHA 3CPWM 1OKJA 4HUFA 4LSLA 1IBMK 3JYTA 4CJ7A 4PL8A 2BTFA 1NK5A 1Y97A 1VSIA 4CJUA 3A5MC 1W97L 4CHYA 3HBTA 3KZBA 2ATQA 1Q18A 2E6MA 3MCPA 5FDLA 1K8KB 4Z94A 5KPTA 5KPRA 4W5NA 4FLVA 2HBJA 1VSJA 3HK2A 2D5RA 1WAJA 5AZJB 4QOZB 3TAPA 4DV7K 2P51A 3TAMA 2NRXA 4DCHA 4WQ4A 2D0PA 3QIOA 3HJFA 3AVLA 1HJRA 2RKIA 3O1WA 4C1NI 5M1KA 3V9UA 3K9KA 3U6FA 3HTVA 1RDDA 2YHWA 2VG6A 3ENOA 3SJJA 4KHSA 4UQGA 3ZEUA 3PUFA 2IVNA 3CXCM 3QINA 2E2OA 1NG9A 4CZHA 4RW8A 4BQZA 2O8CB 3DLEA 1KTQA 2FLOA 5AFUA 1RT2A 4BWMA 4XH1A 4CJ4A 1S5JA 1KVCA 3O3GA 1QSLA 3NH2A 3TAGA 1P8ZA 3L2WA 3THYB 2KHOA 4ILJA 2OCEA 3L2QA 1WB9A 1KQSM 3AO2A 3FZHA 4JKHA 1N5YA 1OH8A 1YF5L 3L8BA 4U7BA 3DXKB 1VQ4N 1WSIA 4DTUA 1S9EA 3C95A 1EWRA 3WXIA 4DFPA 1OH5A 3NF7A 2HBMA 4DV4K 1U48A 2YHYA 3CM5A 1U2VB 1QQNA 1Q82O 5C24A 4B1XB 3OYFA 4JK7A 4CJLA 2GWJA 4YOUA 1OVYA 3ZT3A 5LJWA 1MWKA 3ZLJA 3DXMA 4YOYA 1TGOA 3I8DA 3EEQA 1K8AO 3ULDA 4CK2A 3UKUA 2HF4A 4K8XA 4JI4K 5E41A 1N6QA 4O8UA 3OYCA 2F96A 2D0BA 1BIZA 3V9SA 4OX9K 3IRXA 3PV8A 3QESA 4CEFA 5EU7A 3VENA 4DTJA 4JRPA 4KTQA 3O9RA 4DUZK 2HVIA 2OYQA 1QZ6A 1E4GT 4CJ3A 5CR4A 2VQEK 3CJCA 2UU9K 2BANA 4JI2K 4WQ5A 3VF2A 4FW1A 4FJHA 3CMAN 2HNZA 3QFUA 4BG9A 1C6VA 4OLAA 1HKCA 3OYHA 3KK2A 2X6SA 5KRSA 2HHQA 3RR8A 3H1VX 1VQ5N 1K8KA 5AQQA 3GDQA 1VQON 1X9MA 3AA3A 2HHHK 4BRMA 5AQHA 3F9KA 1J53A 1Y64A 4B8AB 1EO1A 4DQPA 3E1YA 1YAGA 4BRGA 4FLZA 5J2NA 3H3OB 4CESA 3JS6A 5ADXH 1HPMA 3G10A 1IKXA 1EWQA 4BGAA 3V81A 2QM1A 4JRQA 3PX6A 2E2QA 5LJVA 4PKGA 4CJKA 4IOCL 4NYNA 1VQ6N 4J2BA 2P9NB 3V1RA 1X9WA 1J54A 1KFSA 4KHWA 4DV6K 4JI5K 3NFAA 4OJRA 4BRLA 3OTOK 3T1AA 1XWLA 4CZMA 3QEIA 4KI6A 4CD3A 1ZBSA 4E7IA 4EHTA 3CM6A 4DTXA 1ILYA 5TKYA 4BR9A 2FBTA 1RBSA 3FFIA 1X3NA 1TUUA 3LAKA 5AQUA 3FLCO 3KWGA 4JKGA 4DV3K 3AGKA 4H0XB 1BA0A 4GNIA 1BU6O 4JKCA 2PYJA 4DQSA 3C7NA 5HL7L 2FBXA 3SUQA 1HNZK 1SAZA 5KPZA 4H4OA 2RE2A 1GOCA 5HRNA 4LY7A 4JD2B 4WQ4C 1QHAA 3LALA 4H0PA 3G4SN 3N4QA 1ITGA 3ENHA 4DV0K 3LWLA 1OVQA 2QXLA 1K9MO 4XEIA 1NGFA 4L3QA 2Q0RA 4LD0A 2W40A 3E9OA 4ZTJA 3NE6A 4M63C 3LL3A 4WF9L 3CPEA 4I6MB 1C0MA 5J2MA 1KFDA 3R9PA 3K58A 1TKTA 4FJ9A 1CXUA 1U2VA 1BG3A 3ZT0A 4C1NK 3IS9A 4LH4A 4AILC 1IBKK 4BR4A 3OS1A 1RT4A 3AA5X 3THWB 3GE1A 3SAHA 4N76A 3QBWA 3BZCA 3UKRB 1IG9A 4B08A 4DTNA 1S72N 3MK6A 3O9SA 4IOXA 1GLLO 4FWKA 4EP5A 4NCBA 2IVPA 3HOTA 1VSHA 1FKOA 3MWTA 1IO2A 3CCUN 3CFOA 1D8YA 1VQKN 4WE1A 3ISNC 3AVNA 4HTUA 3WNFA 4EHUA 5C2FA 2ASOA 3TPQA 2BE2A 4E19A 2G8WA 2F9TA 4BREA 4N47A 1RNHA 1XHZA 3TI0A 1MU2A 1ZBFA 3OYMA 2X78A 3D2FB 3DAWA 1UWBA 3N4PA 4FJKA 1C1AA 2D4WA 2QWOA 4YOWA 2VWJA 3RMDA 1JCEA 4H0OA 1VK0A 4LFBK 5AQKA 2KTQA 5JS1A 5A2QO 1EP4A 4M3YA 3OHRA 4JS5A 3SQ1A 3HI0A 4OVLA 3W0LA 1ZBUA 4JKDA 3RMAA 1NGEA 5CY4A 5JVHL 1XNRK 1YIJN 4B3OA 2GV9A 5AQXA 2G8KA 4CCHA 3O9TA 1HKGA 2NRHA 1BWFO 3VA3A 4FCYA 3AO5A 3OYKA 3K9JA 4IBNA 1GOBA 1CXQA 4I2PA 3I55N 2UYTA 2NLXA 2OPSA 5EVZA 3SBTA 3K57A 2NZTA 3CYMA 3ZYYX 4ID1A 4DUYK 3SYZA 2J4RA 5C0YA 1REVA 4GVEA 4AH9A 2IAJA 3WXMB 3T3FA 3DM2A 4KTZA 3NF8A 4FM2A 4MFBA 4NXNK 2Q36A 3RWUA 3MX5A 4FM0A 3CI5A 1QQMA 4JI1K 1T7PA 3SV4A 2AJQA 1KLMA 3IMXA 3PO4A 4DQIA 4ISFA 4HWIA 1LCUA 3HVTA 1W7AA 5KGWA 3O3FA 3S9HA 4N5SA 4B9VA 3CCMN 3ZSQA 1JXEA 2OTJN 1BO5O 2VWKA 3HM8A 4DSEA 1DTQA 1IBLK 5AQTA 4B3TK 2OPPA 3M1FA 1DGKN 3DJCA 4CJFA 4NB4A 4JS4A 3TSUA 4EZ6A 1VSDA 1TAQA 4E1JA 5KQ8A 5E26A 3AA4A 4CZFA 1XC9A 1NGCA 5KRTA 1B92A 1ZC6A 2JGUA 4X62K 2XY7A 4MQ3A 2QKKA 4PY5A 1JCGA 4I6MA 2QI2A 1BI4B 4NLCA 1YJ9N 2QK9A 5EY4A 1MDUB 3B6PA 2GEMA 5AQYA 3RR7A 4I2QA 1RBTA 3VETA 2A5XA 1DTTA 1TKXA 4I7FA 2JLEA 3DLHA 5M1FA 1U45A 3NCIA 3WEEB 5J2PA 5EXWA 4JI3K 1B9DA 5AFUH 3K59A 1S9GA 3ZSYA 3ZT2A 3AVGA 3A8YA 3EZWA 4XH4A 2RHKA 3BUZB 1IKVA 4NCGA 1S1TA 2YNIA 4LF4K 3R8EA 1VQ8N 2RPIA 4CZEA 1UA0A 1HX1A 4Q0BA 2DFEA 2I7PA 1HKBA 1XC3A 3C6AA 4X64K 4B1WB 4OGCA 4K8ZA 1GLFO 1RTHA 4CJ5A 4NLBA 4A2BA 3O6WA 1TUYA 4KV8A 4IFYA 3HPGA 4BC3A 4BR5A 4HUEA 3KLIA 3PSIA 3T7ZA 3SAGA 3WT0A 3OYAA 2X6NA 3AAQA 2D0CA 5JLHA 3F73A 5C42A 2PY5A 3I0SA 4V19S 3TTDA 3AV9A 4CEBA 5GAGP 2GBZA 3WNHA 3TSPA 3C0BA 1BOTO 1W9HA 4CZKA 2ZWHA 1TYQB 2I7NA 5AQWA 3EY1A 4B9QA 5DM6L 3T69A 2DFFA 4CEEA 4B9MA 4CBXA 1YI2N 4FK4A 4YNQA 2A6AA 2PAVA 2P9IB 4FK2A 2AA4A 1QZ5A 3D2EB 5GAEP 3LP1A 2RN2A 4FLXA 1NK8A 1GLAG 3LANA 1JLGA 4E1MA 3MXMA 4KHQA 5AZIB 4NO7A 3O08A 4H5VA 3WUHA 4OO1J 4KHYA 1MWMA 4CHNA 4GY2B 3ZETA 1J5EK 2V7YA 3LP0A 1C0TA 3LDPA 2O8FB 2F7TA 4CF9A 5D3GA 4CGFA 4B9UA 3QFPA 2JWKA 4Z4FA 3MMVA 1EX4A 3OYNA 4CI6A 3R1XA 3G6EN 3UB5A 3O1BA 2VCPA 1BCOA 3RSEB 2QTDA 4CIEA 1NMDA 1S1VA 5FROA 4JI7K 3BF3A 4FWQA 2HNYA 5ELZA 1BGXT 5BPMA 4E7KA 1QE1A 3O3HA 4B1UB 2QWMA 2KQ2A 1RDAA 5K14A 1NOYA 4CVNE 3ZSOA 4B3SK 4M42A 4KH4A 1L3TA 1DT9A 4DF4A 3KD5E 4KH6A 3D6RA 1CZBA 3CMEN 3C94A 4DQQA 3MEEA 2XHBA 3A2FA 4W5OA 4U67L 3NDKA 1C1CA 3QNNA 4LF5K 4ILGB 4CGJA 1VSFA 4GV9A 1JL2A 3ALYA 3KWIA 2A40A 3T19A 2NRRA 4BVOA 3NGYA 4CZJA 3VQDA 1VQLN 4R5PA 1ATSA 4ZHRA 3B6OA 3EE9A 3D45A 2HHSA 2P9KB 4OKEA 3NF9A 1I3AA 4DF8A 4ILHA 4OKJA 1BA1A 2NRWA 5AR0A 4Z0UA 4BDZA 3EE8A 3W3DA 4BRPA 4O5FA 3LM2A 3Q7CA 2O8DA 3HPOA 1YJWN 2G8IA 1N8RO 2R7YA 4I9LA 1RILA 2PFUA 1LW2A 5HLFA 1KAYA 4KPYA 1LWEA 4CF8A 2P1JA 1SUQA 3ZSVA 5JS2A 2GUPA 1NJZA 4BRHA 1NK6A 2P9IA 4JEPA 4FWNA 4DB3A 1A5WA 4EIAA 3DLGA 4DTPA 5AZIA 1XNQK 2P9SB 4BDYA 3QB0A 3TAEA 2YV0X 2B6AA 5C10A 3L2VA 5AQPA 3V9ZA 1NNEA 2QWPA 4FOIA 4JKAA 3EO3A 4DU4A 1TVRA 3ZSXA 3BF1A 2QWQA 1NK4A 3VGKA 3LPTA 5CZ2A 4KREA 2O8FA 3E66A 3AVJA 1SL0A 3O9QA 4C8OA 1ASWA 4DG1A 1JLQA 2IIRA 4H0TB 4O8KA 3NVMA 4FJNA 2KFNA 4A5BA 1NGAA 1UAXA 2ZM6K 1FJGK 3VQAA 1YJNN 5AQMA 3B8AX 3JXUA 1NLVA 5GIOA 3GOIA 1NBWA 3QEWA 3BDPA 1CZAN 4C8MA 3RTVA 4DS4A 3CIPA 2UXBK 1HRHA 2ZE2A 1HNVA 2NNWA 5JICA 4FWLA 2P9LB 1OH7A 2I5JA 4CJRA 5HRPA 3V1OA 1D4XA 3AVKA 3LDQA 4BRFA 3U3GA 3H45C 1J6ZA 3E9LA 2WOMA 1JKHA 4CBWA 4RCHA 1NGHA 2O8EB 3LZIA 2E5LK 5AQZA 4DU1A 3OYJA 3IDHA 2EX3A 1L5UA 3DOLA 3DYAA 4CK1A 5EOYA 3K5MA 1IG8A 1GLCG 1RDWX 1UA1A 4IJNA 4H5RA 2YKMA 1RBRA 5FPMA 4RW9A 1QQCA 1NGBA 4DTSA 3M3ZA 4ICLA 3AO3A 4JK9A 2OPQA 4DTOA 3RVCA 4CJWA 2VQFK 2AP1A 4BACA 3J80O 4KTWA 5M1NA 5F0XA 3G71N 4YHHK 3PX4A 5AZJA 4BG8A 2GTDA 3L6QA 3ITHA 4YY3K 4CJPA 3U9ZA 2RF2A 2B5JA 3AVHA 4EZ9A 3CJAA 4H5TA 3O9UA 1VSMA 3VERA 3HSTB 1GLDG 2X74A 3ZSRA 4BRIA 5BR9A 1FKPA 4FLWA 5AQRA 3OYGA 4Y0WA 4CD1A 1VQ7N 3U3YA 4HTLA 2O8CA 3LPUA 3O4WA 1VSKA 4JI8K 2CH5A 3HPHA 5AQJA 3KJVA 1HR0K 1ATNA 4BRCA 4KAZA 2QW9A 4IZ9A 2JWLA 4CZGA 1UOCA 2HSTA 2VG7A 4FJJA 3THYA 4CBUA 3ZX3A 3G0ZA 2QWRA 4O44A 2NRVA 5HBMA 1HYZA 1JLFA 4DQRA 3QNOA 4MDAA 3DXKA 4IJAA 4FWRA 3VEXA 4PHTX 1KC8O 4DSLA 2HHUA 1ZXOA 4BDPA 2QWNA 3PY8A 3F9MA 4FWPA 3CF5L 5KQDA 2E2NA 4DR6K 2KKZA 3VPZA 3L2UA 3SNNA 3M6GA 3TWHA 4FVMA 3K0SA 1BCMA 4JI0K 2V51B 1NGJA 3AO4A 2GX9A 3VQCA 3THVA 3CG7A 1KD1O 3HZ6A 2PBDA 4NXMK 3OBYA 5AQIA 1ZBIA 3PO5A 2P9LA 1ZYQA 3SK3A 1GLJO 4OPKA 4IEEA 3QEVA 3OYLA 3SQ4A 1F21A 5JMVA 3BGRA 1LAWA 3RRGA 1TKDA 4M3UA 4G1QA 5I9EB 3ID8A 3VGLA 4JYAK 1SZ2A 1Z25A 4FJ8A 3ZX2A 4EFHA 4KO0A 4W5RA 3T1HK 4DHYA 2EWSA 3VF4A 2GUIA 2ZGYA 3K5LA 3RMCA 3L4IA 5B8HA 4JLHA 3J81O 4AHVA 5C25A 3CCEN 1RT3A 2UXDK 4H5WA 3K2PA 3O5BA 2V7ZA 2HHWA 4M45A 3EYZA 1E3MA 3LWMA 3SPYA 4W5QA 1X9JA 3FE1A 3OY9A 3NF6A 3L2RA 3DLRA 1YTUA 3AVAA 1YUWA 2P9UB 4KI4A 4LC9B 1NJXA 4HHTA 4OPAA 4PUOA 3TTCA 2E8AA 3L4QA 3ULEB 3KHYA 1RDUA 4MO4A 4K41A 3VQ8A 3HSCA 3ZCMA 4KHUA 4CFAA 4DWIA 2E1ZA 4CF0A 1KAZA 1U6ZA 3C6HA 3A0IX 4CHQA 4AHCA 1HLUA 3VEZA 2P9NA 3VQ7A 4F3OA 3U9DA 5FPNA 3LP2A 1WSFA 4WQ5C 1S22A 4FO0A 3TTFA 3DLBA 2A1SA 2ZD1A 3P39A 1KXPA 2QA4N 3SUPA 3MAQA 3OJSA 1NJIO 5BPLA 1LAVA 4BR7A 2CGJA 1WNSA 4BRAA 1FK9A 5IWAK 2YHXA 5LMNK 1T44A 1ZBLA 4CIFA 3EN9A 2Y1JA 4PWDA 1HJOA 3C6UA 1VQ9N 3J7YP 1FXXA 4O4GA 4NCAA 1WAFA 2V52B 2KLAA 4JD2A 3DRPA 4QS7A 2YJFA 3SZ2A 5EX5A 1H1VA 4FPAA 3THXB 2ZF5O 3QEXA 1CZ9A 4BRKA 4B9TA 4PA1A 3J7ZO 1JLEA 5GAHP 1SL2A 3KLGA 1NJWA 4FXDA 3QO9A 3CC4N 3PIOL 2WTUA 1BIUA 3S3MA 4H8KA 1YHQN 1RTDA 2PZSA 4LH5A 4ISGA 1U47A 3THWA 4GMJB 1QS4A 3OVNA 2IVOA 4DTMA 3UKRA 3KLEA 4J8FA 2O8BB 4M3RA 4Z4HA 4Z4IA 5CE3A 4O0IA 1SQKA 4IOAL 3QICA 4FZYA 1D5AA 3EKUA 4CFCA 2ITGA 1LV5A 2E1YA 1KLNA 1JCFA 2YJEA 4FOEA 2Q97A 3EZ5A 1K73O 1VRUA 4YFUA 4RTFD 4FL9A 3SQ2A 4FWOA 2NRZA 2YNHA 1QTMA 1WSHA 2A3ZA 4M41A 3D2FA 3IUCA 2YNFA 3DOKA 1HNIA 4CK3A 3ID6A 2D0AA 1XHXA 4FWMA 3FZKA 3CQ8A 4FJGA 4OPHA 2XY6A 3LDNA 3J8AA 4Y1CA 1NGDA 1RDCA 4JI6K 5DMRA 3SMSA 3WQTA 3U4LA 1XI1A 3GBTA 3ZT1A 4DFKA 4F9OA 2WBNA 4FLYA 2KFZA 4RW7A 2O4GA 3M8RA 1LWFA 3MEDA 1Q9XA 1VRTA 5HRRA 4CEAA 4CEZA 3CJ1A 3I0RA 4H4MA 3ZX0A 4N41A 3NGIA 3A5OC 4CFDA 1K6YA 2G8HA 1RT6A 4CE9A 1IKWA 4Z4CA 3TABA 4CEQA 1WSGA 4GV6A 3MECA 3NAEA 2ZQBA 5MLCQ 3L3UA 1IV0A 3P5JA 3NH1A 4JKEA 1XQSC 3L3VA 2ZJQL 4KBOA 4N56A 2P5GA 4W5TA 3VA0A 5FLXO 1GOAA 2W6LA 4BC4A 3CCSN 3TU5A 3CCLN 5T7BA 3VQ4A 1YTAA 4YORA 5CHIA 1Q9YA 2O4IA 1N34K 2QEXN 4IWVA 4J2AA 2XY8A 2HHTA 4H0YB 1HNWK 4OKKA 2YNGA 5LMUK 2EHGA 2D1KA 1Z05A 1E4FT 1HUXA 2BH1A 1Z6RA 4CZIA 2WUSA 2Q2RA 1EXQA 5E84A 1RDBA 4TSXA 4BWJA 1X1PA 4J2EA 4AHUA 4PKIA 4FJIA 4IO9L 3ATVA 1KVBA 3O80A 3R3LA 1BI4A 2UUBK 1NWKA 2A1RA 3CERA 3MN5A 4FPBA 1R0AA 1YVUA 3F2KA 3K5OA 4BC5A 5HP1A 1NM1A 1SKSA 4CW7B 1S1UA 2ETJA 1JXBA 2HF3A 1YT3A 4K25A 4DMNA 4YOXA 3DXMB 3LDOA 3WEEA 4FSVA 3OYBA 4IG3A 2VWBA 3QMLA 1Q8IA 4M7XA 4CGIA 4BR0A 5AJ3K 3UKUB 5KI6A 2Q3SA 2A41A 3HM9A 2FBYA 4XH5A 4MLHA 1M90O 1WUAA 1BL3A 5SWMA 5M1OA 1ESVA 3SQ0A 3QDKA 5JVGL 3KK1A 1NU0A 3KLFA 4M3ZA 4A5AA 4B1ZA 2E6LA 4FZZA 3VGMA 1QHTA 3VEVA 3H46O 1YITN 4C8KA 3AVFA 2F8SA 1Q86O 1QSYA 2HW3A 3QETA 2NUBA 3VN5A 4F4KA 2OZSA 1NKBA 4CF2A 3P38A 4DFJA 1TK0A 2PYLA 1CLQA 1TL3A 1TYQA 4BRNA 2W42A 4IKFA 5CZ1A 4JN4A 2IDOA 3IAYA 1IJJA 2FBVA 3VOVA 4YDUA 3OYDA 2QXFA 3D2EA 3EKSA 4CZLA 1EQYA 1NK9A 1HNXK 1NGGA 4MDBA 3EL2A 3V4IA 1I39A 2BDPA 1VQNN 4BGBA 3CJBA 3D0PA 3GG4A 3HOSA 4IDKA 1J5OA 1BHLA 3SAFA 3V6DA 4FYDA 3R6MA 3KIOA 2E20A 4GKKK 4DR2K 4B3RK 5J2QA 2FF6A 3TR8A 3CCVN 1JLAA 1TKZA 2UUCK 3C6TA 4MO5A 5LL6Z 1RFQA 5J1EA 1XMOK 4DS5A 4FZXC 4B1YB 1VSLA 3HO1A 3K5NA 4JKGB 4ID5A 3CJ7A 1RBUA 3WNGA 2IS3A 4KKOA 1OH6A 2G8UA 3RSEA 4AM7A 1R59O 2KW4A 3C7NB 2DFHA 3A5LC 4M7YA 5GADP 4C8LA 1DLOA 4H0VB 1QSSA 4FJLA 3JAMO 3CCJN 4AHRA 4F2RA 1WN7A 4M3TA 2IGIA 4E7JA 2GELA 2XRIA 5BN9A 4CGHA 4A2AA 3ATUA 4X66K 4DR7K 3VF6A 4JHDB 5BRDA 2UXCK 2ZGZA 4DV1K 5BPNA 4KB1A 1G99A 4HVJA 1T3VA 3AARA 2OA8A 4UY8O 2HOEA 4BE2A 4BE0A 1WBDA 3VTIA 5KTQA 3MN7A 1VHXA 2DPNA 1SV5A 1JLBA 5KGXA 3NGZA 2ZJRL 1VAZA 1C0GA 3TARA 4CERA 1W0HA 3IKMA 3OA9A 3FR0A 5HOOA 2IOCA 1N36K 3NHGA 4LF7K 2P9KA 1BUPA 4B8CA 3BEXA 3HL8A 3VESA 4ELVA 1U4BA 1SL1A 3HXMA 3NBPA 1C1BA 2HMPA 2YX6A 4CJTA 4CIGA 2W6KA 1L3SA 3DRRA 4WCEL 4FLUA 1NK7A 2P5OA 4DSKA 4CJVA 2ASMA 4WFNL 3FGUA 4G9ZA 1C0FA 4JAXA 4DLEA 1NKCA 2OANA 2Z1JA 4CHZA 3MX2A 4M3WA 3FZFA 3O8MA 4CEOA 4RW6A 4DTRA 4M3XA 4AF1A 5HRSA 1HYVA 3CFRA 3CC2N 4F8RA 4RWTA 2HVHA 3O4NA 1U04A 4BRDA 3A5NC 3MDQA 3VQ6A 4O0JA 4XIUA 3VMFB 1L3VA 3J7AP 4BVPA 5BRFA 3I33A 2OPRA 1GLBG 4I9QA 2P9SA 5DK5A 1D9FA 1TV6A 1B9FA 2DY4A 5AQLA 1N33K 3H1QA 1T03A 1KRPA 1T05A 3U8XA 4A57A 2CGKA 1YXQA 3UIQA 2G8FA 3GL1A 4WFAL 1S1XA 1BDGA 3O4QA 2WONA 3H08A 4CEDA 4FVUA 4F3TA 4LFCK 4K43A 1HQUA 4ELTA 3KKSA 5TKWA 3Q7BA 4WYBA 1O1WA 4DU3A 5FPEA 4DV5K 3LP3A 3P31A 3P1GA 3FZMA 3VQ9A 4YDUC 4CHOA 3I8BA 2HBLA 4FLTA 2Q31A 3PLAA 2VGNA 5SZTA 3SUOA 4RG8A 1EKEA 3RMBA 2VG5A 1HQEA 2HHXA 4BC2A 5JLFA 1A5XA 3SV3A 4AQYK 3KVGA 3VQEA 3AA2A 5C15A 4A59A 1LOTB 3LDLA 4IDHA 3M5RA 4O5BA 3AVCA 5GIPA 4HCBA 1SKWA 4DSJA 5DM7L 4FW2A 2FSJA 4DSFA 4CF1A 5AQFA 1JLCA 2ITMA 1G15A 5M1QA 4FK0A 4A61A 4JHDA 4A62A 1GLEG 3OJUA 1X3MA 2Z1GA 2D0OA 3CFPA 4CJQA 4CGDA 3DLKA 3V9XA 2O8EA 2Q1NA 1D9DA 2E4LA 1U49A 2Z1IA 4GVMA 4KHNA 1ATRA 1M1KO 4B9SA 5IT9O 2IC3A 2ZJPL 3M8PA 4Z4GA 4O55A 4FJMA 3KKRA 4NYFA 1RTJA 1A5VA 3LM9A 3FZLA 3CD6N 4BE1A 1T6CA 4RW4A 4DR1K 3V9WA 3BZKA 3OYIA 4DR5K 4LFAK 1KVAA 3OS2A 1Z26A 1WBBA 2YHAA 3S41A 3AVBA 3G25A 4DV2K 2HNDA 3KK7A 4Y1DA 1ASUA 4PQUA 1N32K 4E1NA 4AM6A 3C65A 1LWCA 3CQXA 3HVRA 1JL1A 4IO8A 4KRFA 4E7LA 2YKNA 2KZMA 2CGLA 3WXJA 3SPZA 4GV3A 5HROA 5F1XA 3MN6A 4WFBL 4CJSA 2Y1IA 4YOVA 2BUPA 3CETA 4FWSA 3MEGA 1WOQA 3HT3A 3QIPA 1RT7A 1X9SA 1HMVA 3HP6A 2XO7A 3NMUA 3H3NO 3JSMA 2UUAK 2P9PB 1LW0A 3F5TA 3VTHA 5H1SQ 1IH7A 1MA9B 3AAPA 3M8SA 4ELUA 3QBXA 3RRHA 3DWLA 3DMJA 1ZBHA 1VQPN 1KSPA 3AVMA 5FRNA 1V4TA 3BP8A 2FSNA 5F2RA 4E89A 2CH6A 2QKBA 2FF3B 3SUNA 4KHPK 4KH5A 3ZETB 1C0UA 1WSJA 2OZMA 1NOZA 4JK8A 4E3SA 2FXUA 2F8TA 1S6QA 4CHPA 4DR3K 3VQBA 4QCLA 3SLCA 4CGGA 5M1PA 1O13A 4QAGA 3VEOA 4KB0A 3HYFA 3AGRA 1RT1A 3AY9A 2OTLN 4IFVA 4QS9A 5AQNA 3TSQA 1TK8A 1EETA 5BREA 4PKHA 3MXIA 2W41A 2HMIA 2VGMA 1T6DA 4L8RB 1NKEA 3VEWA 4Q5VA 3PSFA 3WQUA 3WXKA 5ADXA 1P90A 1QVFM 4BR2A 3L0QA 3HP9A 1JJ2M 4FJ5A 2DTUA 3CQYA 4FM1A 3VQ5A 1HYSA 4C23A 4EP4A 1S3XA 3T1YK 4H5NA 3MXJA 3P4IA 4DR4K 1TK5A 3IG1A 3QEPA 1BQNA 1XUPO 2B4JA 3AVIA 5LY3A 4F2SA 3CC7N 1Q7YO 3PX0A 5CYQA 5C12A 1J9AA 1XMQK 2YHBA
chains in the Genus database with same CATH topology
5SWMA 2BE2A 2EX3A 4E19A 2G8WA 3SQ0A 4J2DA 1L5UA 3KTQA 3DOLA 3DYAA 4E7HA 3KK1A 4CK1A 3E01A 3KLFA 4M3ZA 4N47A 4OLBA 3K5MA 1RNHA 1XHZA 3TI0A 1MU2A 3TAFA 1ZBFA 2E6LA 4FZZA 3OYMA 1UA1A 2X78A 1T8EA 3WNEA 1UWBA 2XY5A 4ZTFA 2YKMA 1RBRA 4FJKA 1QHTA 4RW9A 1QQCA 1C1AA 4DTSA 4HUGA 5CYMA 4ICLA 3AO3A 2VWJA 2OPQA 1ASVA 2Z1HA 4DTOA 3RMDA 4CJWA 1VK0A 2KTQA 1S6PA 4C8KA 5JS1A 1IKYA 3AVFA 2F8SA 1EP4A 4M3YA 4BACA 1KCFA 5FRMA 3LAMA 1QSYA 4JS5A 3SQ1A 4KTWA 4OVLA 2HW3A 1ZBUA 4LSNA 4FJXA 3QETA 2NUBA 4AHSA 3VN5A 3RMAA 1NK0A 1SKRA 2OZSA 4F4KA 3PX4A 1NKBA 4CF2A 5CY4A 2HB5A 4DFJA 4B3OA 2GV9A 2G8KA 1TK0A 2PYLA 1CLQA 4CCHA 3ITHA 1TL3A 4DLGA 2W42A 3ASMA 4CECA 3QLHA 4CJPA 4IKFA 5CZ1A 4FCYA 2IDOA 3VA3A 3IAYA 3AO5A 2RF2A 1RCHA 3OYKA 2B5JA 2FBVA 3AVHA 4IBNA 4EZ9A 1BQMA 1GOBA 1WSEA 1CXQA 4I2PA 4E0DA 3OYDA 1VSMA 2QXFA 3HSTB 2OPSA 4CFBA 1NK9A 3K57A 3CYMA 2X74A 3V4IA 4ID1A 1I39A 3ZSRA 4B9LA 4Z4EA 3SYZA 1TAUA 1FKPA 4FLWA 2BDPA 3OYGA 1REVA 4AH9A 2IAJA 3U3YA 3D0PA 3LPUA 1VSKA 3T3FA 3DM2A 2HHVA 4KTZA 4IDKA 3QERA 1J5OA 1BHLA 3HPHA 3V6DA 4FYDA 3NF8A 3KIOA 4MFBA 4C8NA 4FM2A 3RWUA 4FM0A 3KJVA 4KAZA 4FJ7A 5J2QA 3LDSA 3TR8A 1TL1A 4HCCA 1JLAA 1TKZA 3C6TA 2FC0A 1T7PA 1UOCA 5J1EA 4IG0A 3SV4A 4OGEA 4DS5A 2AJQA 2VG7A 4FZXC 1KLMA 1VSLA 3PO4A 3VQPA 1VSEA 4DQIA 4FJJA 3KK3A 3HO1A 3HVTA 3K5NA 5KGWA 3G0ZA 3O3FA 3S9HA 4ID5A 4O44A 4N5SA 5HBMA 4B9VA 1BISA 1RBUA 1RTIA 3SI6A 3S3OA 3WNGA 2IS3A 1HYZA 4KKOA 3V1QA 1JLFA 3ZSQA 4DQRA 3QNOA 5I3UA 3TANA 4OPJA 1JXEA 2G8UA 2KW4A 2VWKA 2DFHA 2LSNA 1S1WA 4DSEA 4DSLA 1DTQA 2HHUA 4C8LA 5I42A 1DLOA 3NH0A 4BDPA 2OPPA 1QSSA 3PY8A 4FJLA 3ZT4A 4CJEA 4CJFA 3OS0A 4AHRA 4F2RA 3VQQA 1WN7A 4M3TA 2IGIA 3DRSA 4JS4A 4E7JA 4EZ6A 1VSDA 1TAQA 2XRIA 2BGGA 3L2UA 3DI6A 4AHTA 3SNNA 1L3UA 3AA4A 1WLJA 3TWHA 1XC9A 4CGHA 4FVMA 5KRTA 1B92A 1BCMA 2JGUA 4DFMA 2XY7A 4MQ3A 3AO4A 3SCXA 2QKKA 4PY5A 3VQCA 1NJYA 1BI4B 3THVA 3CG7A 2QK9A 3B6PA 3RR7A 3M8QA 4B9NA 4KB1A 4DSIA 4I2QA 4HVJA 1ZBIA 1RBTA 3PO5A 1ZYQA 3KD1E 4OPKA 3ZSZA 2OA8A 3ZSWA 1DTTA 3QEVA 1TKXA 4I7FA 4BE2A 2JLEA 3OYLA 4BE0A 3SQ4A 1F21A 3DLHA 5KTQA 3AO1A 3BGRA 1LAWA 3RRGA 1TKDA 4KFBA 1U45A 4G1QA 3NCIA 4M3UA 4GW6A 1SV5A 1JLBA 1Z25A 3LZJA 4FJ8A 3P83D 4KO0A 5KGXA 4W5RA 5J2PA 3NGZA 1HPZA 1RBVA 2G8VA 1B9DA 4CERA 3TAQA 3TARA 2GUIA 1W0HA 3K59A 1RT5A 3K5LA 1S9GA 3ZSYA 3ZT2A 2IOCA 3RMCA 3AVGA 2KZZA 3S3NA 4JLHA 4AHVA 5C25A 3NHGA 1IKVA 4NCGA 1S1TA 1RT3A 3OYEA 4B8CA 3KLHA 2YNIA 4HUFA 4LSLA 2RPIA 3JYTA 3HL8A 3K2PA 1UA0A 4Q0BA 2DFEA 4ELVA 1U4BA 1Y97A 4M45A 3EYZA 3HXMA 1VSIA 1NK5A 1SL1A 2HHWA 4CJUA 3NBPA 1C1BA 4OGCA 4K8ZA 3LWMA 3SPYA 1RTHA 4CJ5A 4W5QA 4CJTA 4CHYA 4CIGA 1L3SA 3DRRA 4KV8A 2ATQA 4IFYA 3HPGA 3NF6A 3OY9A 2E6MA 3KLIA 3L2RA 4HUEA 4FLUA 5FDLA 1NK7A 3DLRA 2P5OA 4DSKA 1YTUA 4CJVA 4W5NA 4FLVA 3AVAA 4KI4A 1NJXA 3OYAA 2X6NA 2D0CA 1VSJA 4HHTA 4DLEA 1NKCA 3F73A 3HK2A 5C42A 2PY5A 3I0SA 2D5RA 4PUOA 1WAJA 3AV9A 2Z1JA 3VQ8A 3ZCMA 4CHZA 4CEBA 4QOZB 2GBZA 3WNHA 3TAPA 4CEOA 4KHUA 4M3WA 4CFAA 4DWIA 2P51A 1W9HA 4RW6A 4CF0A 4DTRA 3TAMA 4M3XA 5HRSA 1HYVA 3QIOA 4CHQA 3EY1A 3CFRA 4F8RA 3AVLA 4AHCA 4B9MA 2DFFA 4CEEA 3HJFA 1HJRA 2HVHA 2RKIA 3O4NA 1U04A 4FK4A 3VQ6A 3V9UA 4O0JA 4YNQA 3VQ7A 4XIUA 4F3OA 1L3VA 3U6FA 3LP2A 1WSFA 1RDDA 4FK2A 2VG6A 2OPRA 4FLXA 3LP1A 2RN2A 3SJJA 1NK8A 4I9QA 4KHSA 3LANA 1JLGA 4E1MA 4UQGA 3MXMA 3PUFA 3DLBA 4KHQA 2A1SA 2ZD1A 5DK5A 1D9FA 1TV6A 1B9FA 2DY4A 3SUPA 3QINA 3MAQA 3OJSA 1T03A 1KRPA 4RW8A 1LAVA 1T05A 1WNSA 3DLEA 1FK9A 1KTQA 4KHYA 1RT2A 4CHNA 4BWMA 3UIQA 2G8FA 3LP0A 1C0TA 1ZBLA 4CIFA 1S1XA 3O4QA 2Y1JA 2WONA 3H08A 4CEDA 4CJ4A 4PWDA 1S5JA 1KVCA 4CF9A 4F3TA 3C6UA 5D3GA 4CGFA 3O3GA 1HQUA 3NH2A 3TAGA 1QSLA 4ELTA 4B9UA 1FXXA 4O4GA 4Z4FA 4NCAA 3KKSA 1EX4A 1WAFA 3OYNA 3DRPA 3L2WA 1O1WA 4DU3A 3L2QA 3SZ2A 3LP3A 3AO2A 1N5YA 3P1GA 3VQ9A 3L8BA 4CHOA 1BCOA 4FLTA 1WSIA 4CIEA 3QEXA 4DTUA 1S9EA 1CZ9A 3C95A 1S1VA 5FROA 5SZTA 3SUOA 2HNYA 4RG8A 1EKEA 4B9TA 1BGXT 3RMBA 2VG5A 1HQEA 4PA1A 4DFPA 2HHXA 4E7KA 3SV3A 1A5XA 1JLEA 3NF7A 1SL2A 1QE1A 3AA2A 3VQEA 3O3HA 3KLGA 1NJWA 4FXDA 3QO9A 2KQ2A 1U48A 1RDAA 5K14A 1NOYA 1BIUA 4O5BA 3CM5A 3AVCA 3S3MA 4HCBA 1SKWA 4H8KA 4DSJA 1RTDA 2PZSA 3ZSOA 4FW2A 4LH5A 4DSFA 1U47A 4M42A 5C24A 4GMJB 4CF1A 3OYFA 1JLCA 1QS4A 1L3TA 1G15A 3KD5E 4DF4A 4FK0A 3OVNA 4CJLA 4DTMA 3OJUA 1CZBA 3KLEA 3ZT3A 3C94A 4M3RA 2Z1GA 4Z4HA 4DQQA 4Z4IA 3MEEA 1TGOA 4O0IA 3I8DA 2XHBA 3CFPA 3A2FA 4CJQA 4FZYA 4CGDA 4W5OA 3NDKA 3DLKA 3V9XA 3ULDA 1D9DA 2E4LA 1D5AA 1C1CA 3QNNA 1U49A 4CK2A 2Z1IA 4GVMA 4CGJA 4CFCA 2ITGA 4KHNA 1VSFA 4K8XA 5E41A 1LV5A 1N6QA 1KLNA 4B9SA 3OYCA 2F96A 2D0BA 2IC3A 1JL2A 1BIZA 3ALYA 3M8PA 3V9SA 3T19A 4Z4GA 3IRXA 3EZ5A 3PV8A 4O55A 1VRUA 3QESA 4CEFA 4YFUA 4FJMA 5EU7A 3SQ2A 3NGYA 3KKRA 4NYFA 4JRPA 1RTJA 1A5VA 2YNHA 4DTJA 3VQDA 1QTMA 1WSHA 4KTQA 4R5PA 2HVIA 4ZHRA 3B6OA 4M41A 4BE1A 2OYQA 4CJ3A 2YNFA 4RW4A 3D45A 3V9WA 2HHSA 3OYIA 3DOKA 1HNIA 2BANA 4OKEA 1KVAA 4CK3A 3NF9A 3OS2A 1Z26A 4FW1A 4FJHA 2HNZA 2YHAA 1I3AA 4DF8A 2D0AA 1XHXA 1C6VA 4OKJA 3CQ8A 4FJGA 4BDZA 4Z0UA 3AVBA 2XY6A 4OLAA 4Y1CA 1RDCA 2HNDA 5DMRA 3OYHA 4Y1DA 1ASUA 3HPOA 2X6SA 5KRSA 3KK2A 2HHQA 3RR8A 2G8IA 4PQUA 1XI1A 3ZT1A 2R7YA 4DFKA 4E1NA 4FLYA 4I9LA 2KFZA 1X9MA 3AA3A 1RILA 1LWCA 1LW2A 3HVRA 1JL1A 3F9KA 1J53A 5HLFA 4KRFA 4E7LA 4B8AB 4KPYA 2YKNA 2KZMA 1LWEA 4CF8A 2P1JA 4DQPA 4RW7A 3SPZA 2O4GA 3M8RA 1SUQA 5HROA 1LWFA 3MEDA 4CJSA 2Y1IA 1Q9XA 4FLZA 1VRTA 5J2NA 5HRRA 4CESA 4CEAA 4CEZA 3G10A 1IKXA 3I0RA 3MEGA 3ZSVA 4H4MA 5JS2A 3HT3A 1NJZA 3QIPA 4N41A 1RT7A 1X9SA 3V81A 3PX6A 1HMVA 3HP6A 3NGIA 4JRQA 2XO7A 4CFDA 4CJKA 1NK6A 1K6YA 4NYNA 3JSMA 4J2BA 2G8HA 1RT6A 1LW0A 3V1RA 1X9WA 4CE9A 1IKWA 1J54A 4Z4CA 1IH7A 1KFSA 3TABA 4KHWA 4CEQA 1WSGA 3M8SA 3MECA 3NFAA 1A5WA 3NAEA 3DLGA 4DTPA 4OJRA 3RRHA 2ZQBA 4ELUA 3DMJA 3L3UA 3P5JA 1ZBHA 1KSPA 3AVMA 1XWLA 3T1AA 3NH1A 4BDYA 3QEIA 5FRNA 4E89A 4KI6A 3TAEA 2YV0X 2QKBA 2B6AA 3L2VA 3V9ZA 4E7IA 3L3VA 3CM6A 4DU4A 4DTXA 4N56A 2P5GA 1TVRA 3ZSXA 2FBTA 4W5TA 3VA0A 1RBSA 3FFIA 3LAKA 3SUNA 1NK4A 1GOAA 3LPTA 5CZ2A 4KREA 1C0UA 1WSJA 2OZMA 1NOZA 4E3SA 2F8TA 3AVJA 1S6QA 4CHPA 5T7BA 1SL0A 3VQ4A 1YTAA 2O4IA 2PYJA 1ASWA 3VQBA 4DQSA 1Q9YA 4C8OA 4DG1A 2FBXA 3SUQA 1JLQA 4QCLA 4J2AA 4H4OA 2XY8A 1GOCA 5HRNA 4CGGA 4LY7A 2HHTA 3LALA 4QAGA 4OKKA 4KB0A 2YNGA 3HYFA 2EHGA 4FJNA 1ITGA 2KFNA 1RT1A 1UAXA 4IFVA 3LWLA 1EXQA 3VQAA 1RDBA 4TSXA 4BWJA 1X1PA 4LD0A 4J2EA 3QEWA 3BDPA 4AHUA 4FJIA 4C8MA 3RTVA 4ZTJA 3NE6A 4DS4A 1HRHA 1KVBA 1TK8A 1BI4A 1EETA 1C0MA 2ZE2A 5J2MA 1KFDA 3K58A 3MXIA 2A1RA 1TKTA 1HNVA 2HMIA 4FJ9A 1CXUA 4L8RB 1NKEA 4Q5VA 1R0AA 3ZT0A 1YVUA 3K5OA 3IS9A 4LH4A 4AILC 5HP1A 3OS1A 1RT4A 3AA5X 1SKSA 2I5JA 4CJRA 3HP9A 1S1UA 4FJ5A 2ETJA 5HRPA 4N76A 4FM1A 1HYSA 3V1OA 1JXBA 3VQ5A 3AVKA 2DTUA 4EP4A 1IG9A 1YT3A 4B08A 4DTNA 3U3GA 3MXJA 4DMNA 3OYBA 4EP5A 4NCBA 4IG3A 1TK5A 1VSHA 1FKOA 2WOMA 1JKHA 1Q8IA 3IG1A 4CGIA 1IO2A 3CFOA 3QEPA 1BQNA 2B4JA 3AVIA 3LZIA 1D8YA 5KI6A 2Q3SA 3HM9A 4F2SA 4WE1A 3ISNC 3AVNA 4HTUA 2FBYA 4DU1A 3PX0A 5CYQA 3WNFA 3OYJA 1BL3A 1J9AA 2YHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SWM A;  2BE2 A;  2EX3 A;  4E19 A;  2G8W A;  3SQ0 A;  4J2D A;  1L5U A;  3KTQ A;  3DOL A;  3DYA A;  4E7H A;  3KK1 A;  4CK1 A;  3E01 A;  3KLF A;  4M3Z A;  4N47 A;  4OLB A;  3K5M A;  1RNH A;  1XHZ A;  3TI0 A;  1MU2 A;  3TAF A;  1ZBF A;  2E6L A;  4FZZ A;  3OYM A;  1UA1 A;  2X78 A;  1T8E A;  3WNE A;  1UWB A;  2XY5 A;  4ZTF A;  2YKM A;  1RBR A;  4FJK A;  1QHT A;  4RW9 A;  1QQC A;  1C1A A;  4DTS A;  4HUG A;  5CYM A;  4ICL A;  3AO3 A;  2VWJ A;  2OPQ A;  1ASV A;  2Z1H A;  4DTO A;  3RMD A;  4CJW A;  1VK0 A;  2KTQ A;  1S6P A;  4C8K A;  5JS1 A;  1IKY A;  3AVF A;  2F8S A;  1EP4 A;  4M3Y A;  4BAC A;  1KCF A;  5FRM A;  3LAM A;  1QSY A;  4JS5 A;  3SQ1 A;  4KTW A;  4OVL A;  2HW3 A;  1ZBU A;  4LSN A;  4FJX A;  3QET A;  2NUB A;  4AHS A;  3VN5 A;  3RMA A;  1NK0 A;  1SKR A;  2OZS A;  4F4K A;  3PX4 A;  1NKB A;  4CF2 A;  5CY4 A;  2HB5 A;  4DFJ A;  4B3O A;  2GV9 A;  2G8K A;  1TK0 A;  2PYL A;  1CLQ A;  4CCH A;  3ITH A;  1TL3 A;  4DLG A;  2W42 A;  3ASM A;  4CEC A;  3QLH A;  4CJP A;  4IKF A;  5CZ1 A;  4FCY A;  2IDO A;  3VA3 A;  3IAY A;  3AO5 A;  2RF2 A;  1RCH A;  3OYK A;  2B5J A;  2FBV A;  3AVH A;  4IBN A;  4EZ9 A;  1BQM A;  1GOB A;  1WSE A;  1CXQ A;  4I2P A;  4E0D A;  3OYD A;  1VSM A;  2QXF A;  3HST B;  2OPS A;  4CFB A;  1NK9 A;  3K57 A;  3CYM A;  2X74 A;  3V4I A;  4ID1 A;  1I39 A;  3ZSR A;  4B9L A;  4Z4E A;  3SYZ A;  1TAU A;  1FKP A;  4FLW A;  2BDP A;  3OYG A;  1REV A;  4AH9 A;  2IAJ A;  3U3Y A;  3D0P A;  3LPU A;  1VSK A;  3T3F A;  3DM2 A;  2HHV A;  4KTZ A;  4IDK A;  3QER A;  1J5O A;  1BHL A;  3HPH A;  3V6D A;  4FYD A;  3NF8 A;  3KIO A;  4MFB A;  4C8N A;  4FM2 A;  3RWU A;  4FM0 A;  3KJV A;  4KAZ A;  4FJ7 A;  5J2Q A;  3LDS A;  3TR8 A;  1TL1 A;  4HCC A;  1JLA A;  1TKZ A;  3C6T A;  2FC0 A;  1T7P A;  1UOC A;  5J1E A;  4IG0 A;  3SV4 A;  4OGE A;  4DS5 A;  2AJQ A;  2VG7 A;  4FZX C;  1KLM A;  1VSL A;  3PO4 A;  3VQP A;  1VSE A;  4DQI A;  4FJJ A;  3KK3 A;  3HO1 A;  3HVT A;  3K5N A;  5KGW A;  3G0Z A;  3O3F A;  3S9H A;  4ID5 A;  4O44 A;  4N5S A;  5HBM A;  4B9V A;  1BIS A;  1RBU A;  1RTI A;  3SI6 A;  3S3O A;  3WNG A;  2IS3 A;  1HYZ A;  4KKO A;  3V1Q A;  1JLF A;  3ZSQ A;  4DQR A;  3QNO A;  5I3U A;  3TAN A;  4OPJ A;  1JXE A;  2G8U A;  2KW4 A;  2VWK A;  2DFH A;  2LSN A;  1S1W A;  4DSE A;  4DSL A;  1DTQ A;  2HHU A;  4C8L A;  5I42 A;  1DLO A;  3NH0 A;  4BDP A;  2OPP A;  1QSS A;  3PY8 A;  4FJL A;  3ZT4 A;  4CJE A;  4CJF A;  3OS0 A;  4AHR A;  4F2R A;  3VQQ A;  1WN7 A;  4M3T A;  2IGI A;  3DRS A;  4JS4 A;  4E7J A;  4EZ6 A;  1VSD A;  1TAQ A;  2XRI A;  2BGG A;  3L2U A;  3DI6 A;  4AHT A;  3SNN A;  1L3U A;  3AA4 A;  1WLJ A;  3TWH A;  1XC9 A;  4CGH A;  4FVM A;  5KRT A;  1B92 A;  1BCM A;  2JGU A;  4DFM A;  2XY7 A;  4MQ3 A;  3AO4 A;  3SCX A;  2QKK A;  4PY5 A;  3VQC A;  1NJY A;  1BI4 B;  3THV A;  3CG7 A;  2QK9 A;  3B6P A;  3RR7 A;  3M8Q A;  4B9N A;  4KB1 A;  4DSI A;  4I2Q A;  4HVJ A;  1ZBI A;  1RBT A;  3PO5 A;  1ZYQ A;  3KD1 E;  4OPK A;  3ZSZ A;  2OA8 A;  3ZSW A;  1DTT A;  3QEV A;  1TKX A;  4I7F A;  4BE2 A;  2JLE A;  3OYL A;  4BE0 A;  3SQ4 A;  1F21 A;  3DLH A;  5KTQ A;  3AO1 A;  3BGR A;  1LAW A;  3RRG A;  1TKD A;  4KFB A;  1U45 A;  4G1Q A;  3NCI A;  4M3U A;  4GW6 A;  1SV5 A;  1JLB A;  1Z25 A;  3LZJ A;  4FJ8 A;  3P83 D;  4KO0 A;  5KGX A;  4W5R A;  5J2P A;  3NGZ A;  1HPZ A;  1RBV A;  2G8V A;  1B9D A;  4CER A;  3TAQ A;  3TAR A;  2GUI A;  1W0H A;  3K59 A;  1RT5 A;  3K5L A;  1S9G A;  3ZSY A;  3ZT2 A;  2IOC A;  3RMC A;  3AVG A;  2KZZ A;  3S3N A;  4JLH A;  4AHV A;  5C25 A;  3NHG A;  1IKV A;  4NCG A;  1S1T A;  1RT3 A;  3OYE A;  4B8C A;  3KLH A;  2YNI A;  4HUF A;  4LSL A;  2RPI A;  3JYT A;  3HL8 A;  3K2P A;  1UA0 A;  4Q0B A;  2DFE A;  4ELV A;  1U4B A;  1Y97 A;  4M45 A;  3EYZ A;  3HXM A;  1VSI A;  1NK5 A;  1SL1 A;  2HHW A;  4CJU A;  3NBP A;  1C1B A;  4OGC A;  4K8Z A;  3LWM A;  3SPY A;  1RTH A;  4CJ5 A;  4W5Q A;  4CJT A;  4CHY A;  4CIG A;  1L3S A;  3DRR A;  4KV8 A;  2ATQ A;  4IFY A;  3HPG A;  3NF6 A;  3OY9 A;  2E6M A;  3KLI A;  3L2R A;  4HUE A;  4FLU A;  5FDL A;  1NK7 A;  3DLR A;  2P5O A;  4DSK A;  1YTU A;  4CJV A;  4W5N A;  4FLV A;  3AVA A;  4KI4 A;  1NJX A;  3OYA A;  2X6N A;  2D0C A;  1VSJ A;  4HHT A;  4DLE A;  1NKC A;  3F73 A;  3HK2 A;  5C42 A;  2PY5 A;  3I0S A;  2D5R A;  4PUO A;  1WAJ A;  3AV9 A;  2Z1J A;  3VQ8 A;  3ZCM A;  4CHZ A;  4CEB A;  4QOZ B;  2GBZ A;  3WNH A;  3TAP A;  4CEO A;  4KHU A;  4M3W A;  4CFA A;  4DWI A;  2P51 A;  1W9H A;  4RW6 A;  4CF0 A;  4DTR A;  3TAM A;  4M3X A;  5HRS A;  1HYV A;  3QIO A;  4CHQ A;  3EY1 A;  3CFR A;  4F8R A;  3AVL A;  4AHC A;  4B9M A;  2DFF A;  4CEE A;  3HJF A;  1HJR A;  2HVH A;  2RKI A;  3O4N A;  1U04 A;  4FK4 A;  3VQ6 A;  3V9U A;  4O0J A;  4YNQ A;  3VQ7 A;  4XIU A;  4F3O A;  1L3V A;  3U6F A;  3LP2 A;  1WSF A;  1RDD A;  4FK2 A;  2VG6 A;  2OPR A;  4FLX A;  3LP1 A;  2RN2 A;  3SJJ A;  1NK8 A;  4I9Q A;  4KHS A;  3LAN A;  1JLG A;  4E1M A;  4UQG A;  3MXM A;  3PUF A;  3DLB A;  4KHQ A;  2A1S A;  2ZD1 A;  5DK5 A;  1D9F A;  1TV6 A;  1B9F A;  2DY4 A;  3SUP A;  3QIN A;  3MAQ A;  3OJS A;  1T03 A;  1KRP A;  4RW8 A;  1LAV A;  1T05 A;  1WNS A;  3DLE A;  1FK9 A;  1KTQ A;  4KHY A;  1RT2 A;  4CHN A;  4BWM A;  3UIQ A;  2G8F A;  3LP0 A;  1C0T A;  1ZBL A;  4CIF A;  1S1X A;  3O4Q A;  2Y1J A;  2WON A;  3H08 A;  4CED A;  4CJ4 A;  4PWD A;  1S5J A;  1KVC A;  4CF9 A;  4F3T A;  3C6U A;  5D3G A;  4CGF A;  3O3G A;  1HQU A;  3NH2 A;  3TAG A;  1QSL A;  4ELT A;  4B9U A;  1FXX A;  4O4G A;  4Z4F A;  4NCA A;  3KKS A;  1EX4 A;  1WAF A;  3OYN A;  3DRP A;  3L2W A;  1O1W A;  4DU3 A;  3L2Q A;  3SZ2 A;  3LP3 A;  3AO2 A;  1N5Y A;  3P1G A;  3VQ9 A;  3L8B A;  4CHO A;  1BCO A;  4FLT A;  1WSI A;  4CIE A;  3QEX A;  4DTU A;  1S9E A;  1CZ9 A;  3C95 A;  1S1V A;  5FRO A;  5SZT A;  3SUO A;  2HNY A;  4RG8 A;  1EKE A;  4B9T A;  1BGX T;  3RMB A;  2VG5 A;  1HQE A;  4PA1 A;  4DFP A;  2HHX A;  4E7K A;  3SV3 A;  1A5X A;  1JLE A;  3NF7 A;  1SL2 A;  1QE1 A;  3AA2 A;  3VQE A;  3O3H A;  3KLG A;  1NJW A;  4FXD A;  3QO9 A;  2KQ2 A;  1U48 A;  1RDA A;  5K14 A;  1NOY A;  1BIU A;  4O5B A;  3CM5 A;  3AVC A;  3S3M A;  4HCB A;  1SKW A;  4H8K A;  4DSJ A;  1RTD A;  2PZS A;  3ZSO A;  4FW2 A;  4LH5 A;  4DSF A;  1U47 A;  4M42 A;  5C24 A;  4GMJ B;  4CF1 A;  3OYF A;  1JLC A;  1QS4 A;  1L3T A;  1G15 A;  3KD5 E;  4DF4 A;  4FK0 A;  3OVN A;  4CJL A;  4DTM A;  3OJU A;  1CZB A;  3KLE A;  3ZT3 A;  3C94 A;  4M3R A;  2Z1G A;  4Z4H A;  4DQQ A;  4Z4I A;  3MEE A;  1TGO A;  4O0I A;  3I8D A;  2XHB A;  3CFP A;  3A2F A;  4CJQ A;  4FZY A;  4CGD A;  4W5O A;  3NDK A;  3DLK A;  3V9X A;  3ULD A;  1D9D A;  2E4L A;  1D5A A;  1C1C A;  3QNN A;  1U49 A;  4CK2 A;  2Z1I A;  4GVM A;  4CGJ A;  4CFC A;  2ITG A;  4KHN A;  1VSF A;  4K8X A;  5E41 A;  1LV5 A;  1N6Q A;  1KLN A;  4B9S A;  3OYC A;  2F96 A;  2D0B A;  2IC3 A;  1JL2 A;  1BIZ A;  3ALY A;  3M8P A;  3V9S A;  3T19 A;  4Z4G A;  3IRX A;  3EZ5 A;  3PV8 A;  4O55 A;  1VRU A;  3QES A;  4CEF A;  4YFU A;  4FJM A;  5EU7 A;  3SQ2 A;  3NGY A;  3KKR A;  4NYF A;  4JRP A;  1RTJ A;  1A5V A;  2YNH A;  4DTJ A;  3VQD A;  1QTM A;  1WSH A;  4KTQ A;  4R5P A;  2HVI A;  4ZHR A;  3B6O A;  4M41 A;  4BE1 A;  2OYQ A;  4CJ3 A;  2YNF A;  4RW4 A;  3D45 A;  3V9W A;  2HHS A;  3OYI A;  3DOK A;  1HNI A;  2BAN A;  4OKE A;  1KVA A;  4CK3 A;  3NF9 A;  3OS2 A;  1Z26 A;  4FW1 A;  4FJH A;  2HNZ A;  2YHA A;  1I3A A;  4DF8 A;  2D0A A;  1XHX A;  1C6V A;  4OKJ A;  3CQ8 A;  4FJG A;  4BDZ A;  4Z0U A;  3AVB A;  2XY6 A;  4OLA A;  4Y1C A;  1RDC A;  2HND A;  5DMR A;  3OYH A;  4Y1D A;  1ASU A;  3HPO A;  2X6S A;  5KRS A;  3KK2 A;  2HHQ A;  3RR8 A;  2G8I A;  4PQU A;  1XI1 A;  3ZT1 A;  2R7Y A;  4DFK A;  4E1N A;  4FLY A;  4I9L A;  2KFZ A;  1X9M A;  3AA3 A;  1RIL A;  1LWC A;  1LW2 A;  3HVR A;  1JL1 A;  3F9K A;  1J53 A;  5HLF A;  4KRF A;  4E7L A;  4B8A B;  4KPY A;  2YKN A;  2KZM A;  1LWE A;  4CF8 A;  2P1J A;  4DQP A;  4RW7 A;  3SPZ A;  2O4G A;  3M8R A;  1SUQ A;  5HRO A;  1LWF A;  3MED A;  4CJS A;  2Y1I A;  1Q9X A;  4FLZ A;  1VRT A;  5J2N A;  5HRR A;  4CES A;  4CEA A;  4CEZ A;  3G10 A;  1IKX A;  3I0R A;  3MEG A;  3ZSV A;  4H4M A;  5JS2 A;  3HT3 A;  1NJZ A;  3QIP A;  4N41 A;  1RT7 A;  1X9S A;  3V81 A;  3PX6 A;  1HMV A;  3HP6 A;  3NGI A;  4JRQ A;  2XO7 A;  4CFD A;  4CJK A;  1NK6 A;  1K6Y A;  4NYN A;  3JSM A;  4J2B A;  2G8H A;  1RT6 A;  1LW0 A;  3V1R A;  1X9W A;  4CE9 A;  1IKW A;  1J54 A;  4Z4C A;  1IH7 A;  1KFS A;  3TAB A;  4KHW A;  4CEQ A;  1WSG A;  3M8S A;  3MEC A;  3NFA A;  1A5W A;  3NAE A;  3DLG A;  4DTP A;  4OJR A;  3RRH A;  2ZQB A;  4ELU A;  3DMJ A;  3L3U A;  3P5J A;  1ZBH A;  1KSP A;  3AVM A;  1XWL A;  3T1A A;  3NH1 A;  4BDY A;  3QEI A;  5FRN A;  4E89 A;  4KI6 A;  3TAE A;  2YV0 X;  2QKB A;  2B6A A;  3L2V A;  3V9Z A;  4E7I A;  3L3V A;  3CM6 A;  4DU4 A;  4DTX A;  4N56 A;  2P5G A;  1TVR A;  3ZSX A;  2FBT A;  4W5T A;  3VA0 A;  1RBS A;  3FFI A;  3LAK A;  3SUN A;  1NK4 A;  1GOA A;  3LPT A;  5CZ2 A;  4KRE A;  1C0U A;  1WSJ A;  2OZM A;  1NOZ A;  4E3S A;  2F8T A;  3AVJ A;  1S6Q A;  4CHP A;  5T7B A;  1SL0 A;  3VQ4 A;  1YTA A;  2O4I A;  2PYJ A;  1ASW A;  3VQB A;  4DQS A;  1Q9Y A;  4C8O A;  4DG1 A;  2FBX A;  3SUQ A;  1JLQ A;  4QCL A;  4J2A A;  4H4O A;  2XY8 A;  1GOC A;  5HRN A;  4CGG A;  4LY7 A;  2HHT A;  3LAL A;  4QAG A;  4OKK A;  4KB0 A;  2YNG A;  3HYF A;  2EHG A;  4FJN A;  1ITG A;  2KFN A;  1RT1 A;  1UAX A;  4IFV A;  3LWL A;  1EXQ A;  3VQA A;  1RDB A;  4TSX A;  4BWJ A;  1X1P A;  4LD0 A;  4J2E A;  3QEW A;  3BDP A;  4AHU A;  4FJI A;  4C8M A;  3RTV A;  4ZTJ A;  3NE6 A;  4DS4 A;  1HRH A;  1KVB A;  1TK8 A;  1BI4 A;  1EET A;  1C0M A;  2ZE2 A;  5J2M A;  1KFD A;  3K58 A;  3MXI A;  2A1R A;  1TKT A;  1HNV A;  2HMI A;  4FJ9 A;  1CXU A;  4L8R B;  1NKE A;  4Q5V A;  1R0A A;  3ZT0 A;  1YVU A;  3K5O A;  3IS9 A;  4LH4 A;  4AIL C;  5HP1 A;  3OS1 A;  1RT4 A;  3AA5 X;  1SKS A;  2I5J A;  4CJR A;  3HP9 A;  1S1U A;  4FJ5 A;  2ETJ A;  5HRP A;  4N76 A;  4FM1 A;  1HYS A;  3V1O A;  1JXB A;  3VQ5 A;  3AVK A;  2DTU A;  4EP4 A;  1IG9 A;  1YT3 A;  4B08 A;  4DTN A;  3U3G A;  3MXJ A;  4DMN A;  3OYB A;  4EP5 A;  4NCB A;  4IG3 A;  1TK5 A;  1VSH A;  1FKO A;  2WOM A;  1JKH A;  1Q8I A;  3IG1 A;  4CGI A;  1IO2 A;  3CFO A;  3QEP A;  1BQN A;  2B4J A;  3AVI A;  3LZI A;  1D8Y A;  5KI6 A;  2Q3S A;  3HM9 A;  4F2S A;  4WE1 A;  3ISN C;  3AVN A;  4HTU A;  2FBY A;  4DU1 A;  3PX0 A;  5CYQ A;  3WNF A;  3OYJ A;  1BL3 A;  1J9A A;  2YHB A; 
#chains in the Genus database with same CATH topology
 3IFR A;  3CCR N;  2A42 A;  4J2D A;  3KTQ A;  3D7E O;  4MLE A;  4E7H A;  3E01 A;  5AQV A;  2H3G X;  4OLB A;  4IXC A;  2ASP A;  3TAF A;  1V4S A;  1I94 K;  2HBK A;  1T8E A;  3WNE A;  4H03 B;  4ZTF A;  2XY5 A;  5GIN A;  5FPD A;  4HUG A;  5CYM A;  1ASV A;  2Z1H A;  4LF8 K;  1S6P A;  4BRQ A;  1IKY A;  2QWL A;  2P9U A;  3ENB A;  3OBW A;  5FRM A;  1KCF A;  1NMN A;  4BQL A;  3LAM A;  1RGI A;  4FJX A;  2WC9 A;  4LSN A;  2O8D B;  4AHS A;  3ULE A;  1NK0 A;  1SKR A;  2HB5 A;  1QVG M;  2NRT A;  2E2P A;  2YCH A;  5AQS A;  2WFB A;  4DLG A;  3ASM A;  4CEC A;  3QLH A;  3PIP L;  1RCH A;  1BQM A;  1KAX A;  1WSE A;  3CJ9 A;  4E0D A;  3NVK A;  3CCQ N;  5C2D A;  4CFB A;  3I56 N;  1NGI A;  1QQO A;  3ZEU B;  4B9L A;  4Z4E A;  2P9P A;  3SBG A;  1TAU A;  4ISE A;  1W2B M;  3DLL L;  2F9W A;  3SMP A;  4B1V A;  4JKF A;  2HHV A;  3QER A;  4K42 A;  3WXL A;  4C8N A;  3UE5 A;  4K0K K;  4B3M K;  4FJ7 A;  3LDS A;  1TL1 A;  4HCC A;  3HRG A;  2FC0 A;  4IFE A;  4IG0 A;  4BRO A;  3MN9 A;  4OGE A;  4DQ8 A;  3VQP A;  1VSE A;  3OW2 M;  3KK3 A;  5BR8 K;  3CHW A;  3BY5 A;  1BIS A;  1RTI A;  3SI6 A;  3S3O A;  3V1Q A;  3VEY A;  3THX A;  5I3U A;  3TAN A;  4X65 K;  4OPJ A;  4YOT A;  2LSN A;  1S1W A;  4JKB A;  2VYP A;  5BN8 A;  5I42 A;  3NH0 A;  4JV5 K;  3ZT4 A;  4CJE A;  3E9P A;  3OS0 A;  1DEJ A;  1DKG D;  4LF9 K;  3VQQ A;  4GKJ K;  3DRS A;  4DKW A;  1Q81 O;  2BGG A;  3DI6 A;  4AHT A;  1L3U A;  1WLJ A;  4BY9 C;  4DFM A;  3SCX A;  4JNE A;  5AQO A;  1NJY A;  4QS8 A;  2O8B A;  1VQM N;  4PL7 A;  3M8Q A;  4B9N A;  4DSI A;  4IEI A;  3KD1 E;  4R79 A;  3ZSZ A;  3ZSW A;  1SS6 A;  2FSK A;  3AO1 A;  4KFB A;  4GW6 A;  3H6E A;  3LZJ A;  3MCA B;  3P83 D;  2F4V K;  1HPZ A;  1RBV A;  3FFK B;  2G8V A;  3TAQ A;  1FW6 A;  1RT5 A;  1YVN A;  4EAH D;  2Q0U A;  4LF6 K;  2KZZ A;  3S3N A;  5AQG A;  2GWK A;  3MWP A;  3SJH A;  2E88 A;  5BRH A;  2YI1 A;  3OYE A;  3KLH A;  3CPW M;  1OKJ A;  4HUF A;  4LSL A;  1IBM K;  3JYT A;  4CJ7 A;  4PL8 A;  2BTF A;  1NK5 A;  1Y97 A;  1VSI A;  4CJU A;  3A5M C;  1W97 L;  4CHY A;  3HBT A;  3KZB A;  2ATQ A;  1Q18 A;  2E6M A;  3MCP A;  5FDL A;  1K8K B;  4Z94 A;  5KPT A;  5KPR A;  4W5N A;  4FLV A;  2HBJ A;  1VSJ A;  3HK2 A;  2D5R A;  1WAJ A;  5AZJ B;  4QOZ B;  3TAP A;  4DV7 K;  2P51 A;  3TAM A;  2NRX A;  4DCH A;  4WQ4 A;  2D0P A;  3QIO A;  3HJF A;  3AVL A;  1HJR A;  2RKI A;  3O1W A;  4C1N I;  5M1K A;  3V9U A;  3K9K A;  3U6F A;  3HTV A;  1RDD A;  2YHW A;  2VG6 A;  3ENO A;  3SJJ A;  4KHS A;  4UQG A;  3ZEU A;  3PUF A;  2IVN A;  3CXC M;  3QIN A;  2E2O A;  1NG9 A;  4CZH A;  4RW8 A;  4BQZ A;  2O8C B;  3DLE A;  1KTQ A;  2FLO A;  5AFU A;  1RT2 A;  4BWM A;  4XH1 A;  4CJ4 A;  1S5J A;  1KVC A;  3O3G A;  1QSL A;  3NH2 A;  3TAG A;  1P8Z A;  3L2W A;  3THY B;  2KHO A;  4ILJ A;  2OCE A;  3L2Q A;  1WB9 A;  1KQS M;  3AO2 A;  3FZH A;  4JKH A;  1N5Y A;  1OH8 A;  1YF5 L;  3L8B A;  4U7B A;  3DXK B;  1VQ4 N;  1WSI A;  4DTU A;  1S9E A;  3C95 A;  1EWR A;  3WXI A;  4DFP A;  1OH5 A;  3NF7 A;  2HBM A;  4DV4 K;  1U48 A;  2YHY A;  3CM5 A;  1U2V B;  1QQN A;  1Q82 O;  5C24 A;  4B1X B;  3OYF A;  4JK7 A;  4CJL A;  2GWJ A;  4YOU A;  1OVY A;  3ZT3 A;  5LJW A;  1MWK A;  3ZLJ A;  3DXM A;  4YOY A;  1TGO A;  3I8D A;  3EEQ A;  1K8A O;  3ULD A;  4CK2 A;  3UKU A;  2HF4 A;  4K8X A;  4JI4 K;  5E41 A;  1N6Q A;  4O8U A;  3OYC A;  2F96 A;  2D0B A;  1BIZ A;  3V9S A;  4OX9 K;  3IRX A;  3PV8 A;  3QES A;  4CEF A;  5EU7 A;  3VEN A;  4DTJ A;  4JRP A;  4KTQ A;  3O9R A;  4DUZ K;  2HVI A;  2OYQ A;  1QZ6 A;  1E4G T;  4CJ3 A;  5CR4 A;  2VQE K;  3CJC A;  2UU9 K;  2BAN A;  4JI2 K;  4WQ5 A;  3VF2 A;  4FW1 A;  4FJH A;  3CMA N;  2HNZ A;  3QFU A;  4BG9 A;  1C6V A;  4OLA A;  1HKC A;  3OYH A;  3KK2 A;  2X6S A;  5KRS A;  2HHQ A;  3RR8 A;  3H1V X;  1VQ5 N;  1K8K A;  5AQQ A;  3GDQ A;  1VQO N;  1X9M A;  3AA3 A;  2HHH K;  4BRM A;  5AQH A;  3F9K A;  1J53 A;  1Y64 A;  4B8A B;  1EO1 A;  4DQP A;  3E1Y A;  1YAG A;  4BRG A;  4FLZ A;  5J2N A;  3H3O B;  4CES A;  3JS6 A;  5ADX H;  1HPM A;  3G10 A;  1IKX A;  1EWQ A;  4BGA A;  3V81 A;  2QM1 A;  4JRQ A;  3PX6 A;  2E2Q A;  5LJV A;  4PKG A;  4CJK A;  4IOC L;  4NYN A;  1VQ6 N;  4J2B A;  2P9N B;  3V1R A;  1X9W A;  1J54 A;  1KFS A;  4KHW A;  4DV6 K;  4JI5 K;  3NFA A;  4OJR A;  4BRL A;  3OTO K;  3T1A A;  1XWL A;  4CZM A;  3QEI A;  4KI6 A;  4CD3 A;  1ZBS A;  4E7I A;  4EHT A;  3CM6 A;  4DTX A;  1ILY A;  5TKY A;  4BR9 A;  2FBT A;  1RBS A;  3FFI A;  1X3N A;  1TUU A;  3LAK A;  5AQU A;  3FLC O;  3KWG A;  4JKG A;  4DV3 K;  3AGK A;  4H0X B;  1BA0 A;  4GNI A;  1BU6 O;  4JKC A;  2PYJ A;  4DQS A;  3C7N A;  5HL7 L;  2FBX A;  3SUQ A;  1HNZ K;  1SAZ A;  5KPZ A;  4H4O A;  2RE2 A;  1GOC A;  5HRN A;  4LY7 A;  4JD2 B;  4WQ4 C;  1QHA A;  3LAL A;  4H0P A;  3G4S N;  3N4Q A;  1ITG A;  3ENH A;  4DV0 K;  3LWL A;  1OVQ A;  2QXL A;  1K9M O;  4XEI A;  1NGF A;  4L3Q A;  2Q0R A;  4LD0 A;  2W40 A;  3E9O A;  4ZTJ A;  3NE6 A;  4M63 C;  3LL3 A;  4WF9 L;  3CPE A;  4I6M B;  1C0M A;  5J2M A;  1KFD A;  3R9P A;  3K58 A;  1TKT A;  4FJ9 A;  1CXU A;  1U2V A;  1BG3 A;  3ZT0 A;  4C1N K;  3IS9 A;  4LH4 A;  4AIL C;  1IBK K;  4BR4 A;  3OS1 A;  1RT4 A;  3AA5 X;  3THW B;  3GE1 A;  3SAH A;  4N76 A;  3QBW A;  3BZC A;  3UKR B;  1IG9 A;  4B08 A;  4DTN A;  1S72 N;  3MK6 A;  3O9S A;  4IOX A;  1GLL O;  4FWK A;  4EP5 A;  4NCB A;  2IVP A;  3HOT A;  1VSH A;  1FKO A;  3MWT A;  1IO2 A;  3CCU N;  3CFO A;  1D8Y A;  1VQK N;  4WE1 A;  3ISN C;  3AVN A;  4HTU A;  3WNF A;  4EHU A;  5C2F A;  2ASO A;  3TPQ A;  2BE2 A;  4E19 A;  2G8W A;  2F9T A;  4BRE A;  4N47 A;  1RNH A;  1XHZ A;  3TI0 A;  1MU2 A;  1ZBF A;  3OYM A;  2X78 A;  3D2F B;  3DAW A;  1UWB A;  3N4P A;  4FJK A;  1C1A A;  2D4W A;  2QWO A;  4YOW A;  2VWJ A;  3RMD A;  1JCE A;  4H0O A;  1VK0 A;  4LFB K;  5AQK A;  2KTQ A;  5JS1 A;  5A2Q O;  1EP4 A;  4M3Y A;  3OHR A;  4JS5 A;  3SQ1 A;  3HI0 A;  4OVL A;  3W0L A;  1ZBU A;  4JKD A;  3RMA A;  1NGE A;  5CY4 A;  5JVH L;  1XNR K;  1YIJ N;  4B3O A;  2GV9 A;  5AQX A;  2G8K A;  4CCH A;  3O9T A;  1HKG A;  2NRH A;  1BWF O;  3VA3 A;  4FCY A;  3AO5 A;  3OYK A;  3K9J A;  4IBN A;  1GOB A;  1CXQ A;  4I2P A;  3I55 N;  2UYT A;  2NLX A;  2OPS A;  5EVZ A;  3SBT A;  3K57 A;  2NZT A;  3CYM A;  3ZYY X;  4ID1 A;  4DUY K;  3SYZ A;  2J4R A;  5C0Y A;  1REV A;  4GVE A;  4AH9 A;  2IAJ A;  3WXM B;  3T3F A;  3DM2 A;  4KTZ A;  3NF8 A;  4FM2 A;  4MFB A;  4NXN K;  2Q36 A;  3RWU A;  3MX5 A;  4FM0 A;  3CI5 A;  1QQM A;  4JI1 K;  1T7P A;  3SV4 A;  2AJQ A;  1KLM A;  3IMX A;  3PO4 A;  4DQI A;  4ISF A;  4HWI A;  1LCU A;  3HVT A;  1W7A A;  5KGW A;  3O3F A;  3S9H A;  4N5S A;  4B9V A;  3CCM N;  3ZSQ A;  1JXE A;  2OTJ N;  1BO5 O;  2VWK A;  3HM8 A;  4DSE A;  1DTQ A;  1IBL K;  5AQT A;  4B3T K;  2OPP A;  3M1F A;  1DGK N;  3DJC A;  4CJF A;  4NB4 A;  4JS4 A;  3TSU A;  4EZ6 A;  1VSD A;  1TAQ A;  4E1J A;  5KQ8 A;  5E26 A;  3AA4 A;  4CZF A;  1XC9 A;  1NGC A;  5KRT A;  1B92 A;  1ZC6 A;  2JGU A;  4X62 K;  2XY7 A;  4MQ3 A;  2QKK A;  4PY5 A;  1JCG A;  4I6M A;  2QI2 A;  1BI4 B;  4NLC A;  1YJ9 N;  2QK9 A;  5EY4 A;  1MDU B;  3B6P A;  2GEM A;  5AQY A;  3RR7 A;  4I2Q A;  1RBT A;  3VET A;  2A5X A;  1DTT A;  1TKX A;  4I7F A;  2JLE A;  3DLH A;  5M1F A;  1U45 A;  3NCI A;  3WEE B;  5J2P A;  5EXW A;  4JI3 K;  1B9D A;  5AFU H;  3K59 A;  1S9G A;  3ZSY A;  3ZT2 A;  3AVG A;  3A8Y A;  3EZW A;  4XH4 A;  2RHK A;  3BUZ B;  1IKV A;  4NCG A;  1S1T A;  2YNI A;  4LF4 K;  3R8E A;  1VQ8 N;  2RPI A;  4CZE A;  1UA0 A;  1HX1 A;  4Q0B A;  2DFE A;  2I7P A;  1HKB A;  1XC3 A;  3C6A A;  4X64 K;  4B1W B;  4OGC A;  4K8Z A;  1GLF O;  1RTH A;  4CJ5 A;  4NLB A;  4A2B A;  3O6W A;  1TUY A;  4KV8 A;  4IFY A;  3HPG A;  4BC3 A;  4BR5 A;  4HUE A;  3KLI A;  3PSI A;  3T7Z A;  3SAG A;  3WT0 A;  3OYA A;  2X6N A;  3AAQ A;  2D0C A;  5JLH A;  3F73 A;  5C42 A;  2PY5 A;  3I0S A;  4V19 S;  3TTD A;  3AV9 A;  4CEB A;  5GAG P;  2GBZ A;  3WNH A;  3TSP A;  3C0B A;  1BOT O;  1W9H A;  4CZK A;  2ZWH A;  1TYQ B;  2I7N A;  5AQW A;  3EY1 A;  4B9Q A;  5DM6 L;  3T69 A;  2DFF A;  4CEE A;  4B9M A;  4CBX A;  1YI2 N;  4FK4 A;  4YNQ A;  2A6A A;  2PAV A;  2P9I B;  4FK2 A;  2AA4 A;  1QZ5 A;  3D2E B;  5GAE P;  3LP1 A;  2RN2 A;  4FLX A;  1NK8 A;  1GLA G;  3LAN A;  1JLG A;  4E1M A;  3MXM A;  4KHQ A;  5AZI B;  4NO7 A;  3O08 A;  4H5V A;  3WUH A;  4OO1 J;  4KHY A;  1MWM A;  4CHN A;  4GY2 B;  3ZET A;  1J5E K;  2V7Y A;  3LP0 A;  1C0T A;  3LDP A;  2O8F B;  2F7T A;  4CF9 A;  5D3G A;  4CGF A;  4B9U A;  3QFP A;  2JWK A;  4Z4F A;  3MMV A;  1EX4 A;  3OYN A;  4CI6 A;  3R1X A;  3G6E N;  3UB5 A;  3O1B A;  2VCP A;  1BCO A;  3RSE B;  2QTD A;  4CIE A;  1NMD A;  1S1V A;  5FRO A;  4JI7 K;  3BF3 A;  4FWQ A;  2HNY A;  5ELZ A;  1BGX T;  5BPM A;  4E7K A;  1QE1 A;  3O3H A;  4B1U B;  2QWM A;  2KQ2 A;  1RDA A;  5K14 A;  1NOY A;  4CVN E;  3ZSO A;  4B3S K;  4M42 A;  4KH4 A;  1L3T A;  1DT9 A;  4DF4 A;  3KD5 E;  4KH6 A;  3D6R A;  1CZB A;  3CME N;  3C94 A;  4DQQ A;  3MEE A;  2XHB A;  3A2F A;  4W5O A;  4U67 L;  3NDK A;  1C1C A;  3QNN A;  4LF5 K;  4ILG B;  4CGJ A;  1VSF A;  4GV9 A;  1JL2 A;  3ALY A;  3KWI A;  2A40 A;  3T19 A;  2NRR A;  4BVO A;  3NGY A;  4CZJ A;  3VQD A;  1VQL N;  4R5P A;  1ATS A;  4ZHR A;  3B6O A;  3EE9 A;  3D45 A;  2HHS A;  2P9K B;  4OKE A;  3NF9 A;  1I3A A;  4DF8 A;  4ILH A;  4OKJ A;  1BA1 A;  2NRW A;  5AR0 A;  4Z0U A;  4BDZ A;  3EE8 A;  3W3D A;  4BRP A;  4O5F A;  3LM2 A;  3Q7C A;  2O8D A;  3HPO A;  1YJW N;  2G8I A;  1N8R O;  2R7Y A;  4I9L A;  1RIL A;  2PFU A;  1LW2 A;  5HLF A;  1KAY A;  4KPY A;  1LWE A;  4CF8 A;  2P1J A;  1SUQ A;  3ZSV A;  5JS2 A;  2GUP A;  1NJZ A;  4BRH A;  1NK6 A;  2P9I A;  4JEP A;  4FWN A;  4DB3 A;  1A5W A;  4EIA A;  3DLG A;  4DTP A;  5AZI A;  1XNQ K;  2P9S B;  4BDY A;  3QB0 A;  3TAE A;  2YV0 X;  2B6A A;  5C10 A;  3L2V A;  5AQP A;  3V9Z A;  1NNE A;  2QWP A;  4FOI A;  4JKA A;  3EO3 A;  4DU4 A;  1TVR A;  3ZSX A;  3BF1 A;  2QWQ A;  1NK4 A;  3VGK A;  3LPT A;  5CZ2 A;  4KRE A;  2O8F A;  3E66 A;  3AVJ A;  1SL0 A;  3O9Q A;  4C8O A;  1ASW A;  4DG1 A;  1JLQ A;  2IIR A;  4H0T B;  4O8K A;  3NVM A;  4FJN A;  2KFN A;  4A5B A;  1NGA A;  1UAX A;  2ZM6 K;  1FJG K;  3VQA A;  1YJN N;  5AQM A;  3B8A X;  3JXU A;  1NLV A;  5GIO A;  3GOI A;  1NBW A;  3QEW A;  3BDP A;  1CZA N;  4C8M A;  3RTV A;  4DS4 A;  3CIP A;  2UXB K;  1HRH A;  2ZE2 A;  1HNV A;  2NNW A;  5JIC A;  4FWL A;  2P9L B;  1OH7 A;  2I5J A;  4CJR A;  5HRP A;  3V1O A;  1D4X A;  3AVK A;  3LDQ A;  4BRF A;  3U3G A;  3H45 C;  1J6Z A;  3E9L A;  2WOM A;  1JKH A;  4CBW A;  4RCH A;  1NGH A;  2O8E B;  3LZI A;  2E5L K;  5AQZ A;  4DU1 A;  3OYJ A;  3IDH A;  2EX3 A;  1L5U A;  3DOL A;  3DYA A;  4CK1 A;  5EOY A;  3K5M A;  1IG8 A;  1GLC G;  1RDW X;  1UA1 A;  4IJN A;  4H5R A;  2YKM A;  1RBR A;  5FPM A;  4RW9 A;  1QQC A;  1NGB A;  4DTS A;  3M3Z A;  4ICL A;  3AO3 A;  4JK9 A;  2OPQ A;  4DTO A;  3RVC A;  4CJW A;  2VQF K;  2AP1 A;  4BAC A;  3J80 O;  4KTW A;  5M1N A;  5F0X A;  3G71 N;  4YHH K;  3PX4 A;  5AZJ A;  4BG8 A;  2GTD A;  3L6Q A;  3ITH A;  4YY3 K;  4CJP A;  3U9Z A;  2RF2 A;  2B5J A;  3AVH A;  4EZ9 A;  3CJA A;  4H5T A;  3O9U A;  1VSM A;  3VER A;  3HST B;  1GLD G;  2X74 A;  3ZSR A;  4BRI A;  5BR9 A;  1FKP A;  4FLW A;  5AQR A;  3OYG A;  4Y0W A;  4CD1 A;  1VQ7 N;  3U3Y A;  4HTL A;  2O8C A;  3LPU A;  3O4W A;  1VSK A;  4JI8 K;  2CH5 A;  3HPH A;  5AQJ A;  3KJV A;  1HR0 K;  1ATN A;  4BRC A;  4KAZ A;  2QW9 A;  4IZ9 A;  2JWL A;  4CZG A;  1UOC A;  2HST A;  2VG7 A;  4FJJ A;  3THY A;  4CBU A;  3ZX3 A;  3G0Z A;  2QWR A;  4O44 A;  2NRV A;  5HBM A;  1HYZ A;  1JLF A;  4DQR A;  3QNO A;  4MDA A;  3DXK A;  4IJA A;  4FWR A;  3VEX A;  4PHT X;  1KC8 O;  4DSL A;  2HHU A;  1ZXO A;  4BDP A;  2QWN A;  3PY8 A;  3F9M A;  4FWP A;  3CF5 L;  5KQD A;  2E2N A;  4DR6 K;  2KKZ A;  3VPZ A;  3L2U A;  3SNN A;  3M6G A;  3TWH A;  4FVM A;  3K0S A;  1BCM A;  4JI0 K;  2V51 B;  1NGJ A;  3AO4 A;  2GX9 A;  3VQC A;  3THV A;  3CG7 A;  1KD1 O;  3HZ6 A;  2PBD A;  4NXM K;  3OBY A;  5AQI A;  1ZBI A;  3PO5 A;  2P9L A;  1ZYQ A;  3SK3 A;  1GLJ O;  4OPK A;  4IEE A;  3QEV A;  3OYL A;  3SQ4 A;  1F21 A;  5JMV A;  3BGR A;  1LAW A;  3RRG A;  1TKD A;  4M3U A;  4G1Q A;  5I9E B;  3ID8 A;  3VGL A;  4JYA K;  1SZ2 A;  1Z25 A;  4FJ8 A;  3ZX2 A;  4EFH A;  4KO0 A;  4W5R A;  3T1H K;  4DHY A;  2EWS A;  3VF4 A;  2GUI A;  2ZGY A;  3K5L A;  3RMC A;  3L4I A;  5B8H A;  4JLH A;  3J81 O;  4AHV A;  5C25 A;  3CCE N;  1RT3 A;  2UXD K;  4H5W A;  3K2P A;  3O5B A;  2V7Z A;  2HHW A;  4M45 A;  3EYZ A;  1E3M A;  3LWM A;  3SPY A;  4W5Q A;  1X9J A;  3FE1 A;  3OY9 A;  3NF6 A;  3L2R A;  3DLR A;  1YTU A;  3AVA A;  1YUW A;  2P9U B;  4KI4 A;  4LC9 B;  1NJX A;  4HHT A;  4OPA A;  4PUO A;  3TTC A;  2E8A A;  3L4Q A;  3ULE B;  3KHY A;  1RDU A;  4MO4 A;  4K41 A;  3VQ8 A;  3HSC A;  3ZCM A;  4KHU A;  4CFA A;  4DWI A;  2E1Z A;  4CF0 A;  1KAZ A;  1U6Z A;  3C6H A;  3A0I X;  4CHQ A;  4AHC A;  1HLU A;  3VEZ A;  2P9N A;  3VQ7 A;  4F3O A;  3U9D A;  5FPN A;  3LP2 A;  1WSF A;  4WQ5 C;  1S22 A;  4FO0 A;  3TTF A;  3DLB A;  2A1S A;  2ZD1 A;  3P39 A;  1KXP A;  2QA4 N;  3SUP A;  3MAQ A;  3OJS A;  1NJI O;  5BPL A;  1LAV A;  4BR7 A;  2CGJ A;  1WNS A;  4BRA A;  1FK9 A;  5IWA K;  2YHX A;  5LMN K;  1T44 A;  1ZBL A;  4CIF A;  3EN9 A;  2Y1J A;  4PWD A;  1HJO A;  3C6U A;  1VQ9 N;  3J7Y P;  1FXX A;  4O4G A;  4NCA A;  1WAF A;  2V52 B;  2KLA A;  4JD2 A;  3DRP A;  4QS7 A;  2YJF A;  3SZ2 A;  5EX5 A;  1H1V A;  4FPA A;  3THX B;  2ZF5 O;  3QEX A;  1CZ9 A;  4BRK A;  4B9T A;  4PA1 A;  3J7Z O;  1JLE A;  5GAH P;  1SL2 A;  3KLG A;  1NJW A;  4FXD A;  3QO9 A;  3CC4 N;  3PIO L;  2WTU A;  1BIU A;  3S3M A;  4H8K A;  1YHQ N;  1RTD A;  2PZS A;  4LH5 A;  4ISG A;  1U47 A;  3THW A;  4GMJ B;  1QS4 A;  3OVN A;  2IVO A;  4DTM A;  3UKR A;  3KLE A;  4J8F A;  2O8B B;  4M3R A;  4Z4H A;  4Z4I A;  5CE3 A;  4O0I A;  1SQK A;  4IOA L;  3QIC A;  4FZY A;  1D5A A;  3EKU A;  4CFC A;  2ITG A;  1LV5 A;  2E1Y A;  1KLN A;  1JCF A;  2YJE A;  4FOE A;  2Q97 A;  3EZ5 A;  1K73 O;  1VRU A;  4YFU A;  4RTF D;  4FL9 A;  3SQ2 A;  4FWO A;  2NRZ A;  2YNH A;  1QTM A;  1WSH A;  2A3Z A;  4M41 A;  3D2F A;  3IUC A;  2YNF A;  3DOK A;  1HNI A;  4CK3 A;  3ID6 A;  2D0A A;  1XHX A;  4FWM A;  3FZK A;  3CQ8 A;  4FJG A;  4OPH A;  2XY6 A;  3LDN A;  3J8A A;  4Y1C A;  1NGD A;  1RDC A;  4JI6 K;  5DMR A;  3SMS A;  3WQT A;  3U4L A;  1XI1 A;  3GBT A;  3ZT1 A;  4DFK A;  4F9O A;  2WBN A;  4FLY A;  2KFZ A;  4RW7 A;  2O4G A;  3M8R A;  1LWF A;  3MED A;  1Q9X A;  1VRT A;  5HRR A;  4CEA A;  4CEZ A;  3CJ1 A;  3I0R A;  4H4M A;  3ZX0 A;  4N41 A;  3NGI A;  3A5O C;  4CFD A;  1K6Y A;  2G8H A;  1RT6 A;  4CE9 A;  1IKW A;  4Z4C A;  3TAB A;  4CEQ A;  1WSG A;  4GV6 A;  3MEC A;  3NAE A;  2ZQB A;  5MLC Q;  3L3U A;  1IV0 A;  3P5J A;  3NH1 A;  4JKE A;  1XQS C;  3L3V A;  2ZJQ L;  4KBO A;  4N56 A;  2P5G A;  4W5T A;  3VA0 A;  5FLX O;  1GOA A;  2W6L A;  4BC4 A;  3CCS N;  3TU5 A;  3CCL N;  5T7B A;  3VQ4 A;  1YTA A;  4YOR A;  5CHI A;  1Q9Y A;  2O4I A;  1N34 K;  2QEX N;  4IWV A;  4J2A A;  2XY8 A;  2HHT A;  4H0Y B;  1HNW K;  4OKK A;  2YNG A;  5LMU K;  2EHG A;  2D1K A;  1Z05 A;  1E4F T;  1HUX A;  2BH1 A;  1Z6R A;  4CZI A;  2WUS A;  2Q2R A;  1EXQ A;  5E84 A;  1RDB A;  4TSX A;  4BWJ A;  1X1P A;  4J2E A;  4AHU A;  4PKI A;  4FJI A;  4IO9 L;  3ATV A;  1KVB A;  3O80 A;  3R3L A;  1BI4 A;  2UUB K;  1NWK A;  2A1R A;  3CER A;  3MN5 A;  4FPB A;  1R0A A;  1YVU A;  3F2K A;  3K5O A;  4BC5 A;  5HP1 A;  1NM1 A;  1SKS A;  4CW7 B;  1S1U A;  2ETJ A;  1JXB A;  2HF3 A;  1YT3 A;  4K25 A;  4DMN A;  4YOX A;  3DXM B;  3LDO A;  3WEE A;  4FSV A;  3OYB A;  4IG3 A;  2VWB A;  3QML A;  1Q8I A;  4M7X A;  4CGI A;  4BR0 A;  5AJ3 K;  3UKU B;  5KI6 A;  2Q3S A;  2A41 A;  3HM9 A;  2FBY A;  4XH5 A;  4MLH A;  1M90 O;  1WUA A;  1BL3 A;  5SWM A;  5M1O A;  1ESV A;  3SQ0 A;  3QDK A;  5JVG L;  3KK1 A;  1NU0 A;  3KLF A;  4M3Z A;  4A5A A;  4B1Z A;  2E6L A;  4FZZ A;  3VGM A;  1QHT A;  3VEV A;  3H46 O;  1YIT N;  4C8K A;  3AVF A;  2F8S A;  1Q86 O;  1QSY A;  2HW3 A;  3QET A;  2NUB A;  3VN5 A;  4F4K A;  2OZS A;  1NKB A;  4CF2 A;  3P38 A;  4DFJ A;  1TK0 A;  2PYL A;  1CLQ A;  1TL3 A;  1TYQ A;  4BRN A;  2W42 A;  4IKF A;  5CZ1 A;  4JN4 A;  2IDO A;  3IAY A;  1IJJ A;  2FBV A;  3VOV A;  4YDU A;  3OYD A;  2QXF A;  3D2E A;  3EKS A;  4CZL A;  1EQY A;  1NK9 A;  1HNX K;  1NGG A;  4MDB A;  3EL2 A;  3V4I A;  1I39 A;  2BDP A;  1VQN N;  4BGB A;  3CJB A;  3D0P A;  3GG4 A;  3HOS A;  4IDK A;  1J5O A;  1BHL A;  3SAF A;  3V6D A;  4FYD A;  3R6M A;  3KIO A;  2E20 A;  4GKK K;  4DR2 K;  4B3R K;  5J2Q A;  2FF6 A;  3TR8 A;  3CCV N;  1JLA A;  1TKZ A;  2UUC K;  3C6T A;  4MO5 A;  5LL6 Z;  1RFQ A;  5J1E A;  1XMO K;  4DS5 A;  4FZX C;  4B1Y B;  1VSL A;  3HO1 A;  3K5N A;  4JKG B;  4ID5 A;  3CJ7 A;  1RBU A;  3WNG A;  2IS3 A;  4KKO A;  1OH6 A;  2G8U A;  3RSE A;  4AM7 A;  1R59 O;  2KW4 A;  3C7N B;  2DFH A;  3A5L C;  4M7Y A;  5GAD P;  4C8L A;  1DLO A;  4H0V B;  1QSS A;  4FJL A;  3JAM O;  3CCJ N;  4AHR A;  4F2R A;  1WN7 A;  4M3T A;  2IGI A;  4E7J A;  2GEL A;  2XRI A;  5BN9 A;  4CGH A;  4A2A A;  3ATU A;  4X66 K;  4DR7 K;  3VF6 A;  4JHD B;  5BRD A;  2UXC K;  2ZGZ A;  4DV1 K;  5BPN A;  4KB1 A;  1G99 A;  4HVJ A;  1T3V A;  3AAR A;  2OA8 A;  4UY8 O;  2HOE A;  4BE2 A;  4BE0 A;  1WBD A;  3VTI A;  5KTQ A;  3MN7 A;  1VHX A;  2DPN A;  1SV5 A;  1JLB A;  5KGX A;  3NGZ A;  2ZJR L;  1VAZ A;  1C0G A;  3TAR A;  4CER A;  1W0H A;  3IKM A;  3OA9 A;  3FR0 A;  5HOO A;  2IOC A;  1N36 K;  3NHG A;  4LF7 K;  2P9K A;  1BUP A;  4B8C A;  3BEX A;  3HL8 A;  3VES A;  4ELV A;  1U4B A;  1SL1 A;  3HXM A;  3NBP A;  1C1B A;  2HMP A;  2YX6 A;  4CJT A;  4CIG A;  2W6K A;  1L3S A;  3DRR A;  4WCE L;  4FLU A;  1NK7 A;  2P5O A;  4DSK A;  4CJV A;  2ASM A;  4WFN L;  3FGU A;  4G9Z A;  1C0F A;  4JAX A;  4DLE A;  1NKC A;  2OAN A;  2Z1J A;  4CHZ A;  3MX2 A;  4M3W A;  3FZF A;  3O8M A;  4CEO A;  4RW6 A;  4DTR A;  4M3X A;  4AF1 A;  5HRS A;  1HYV A;  3CFR A;  3CC2 N;  4F8R A;  4RWT A;  2HVH A;  3O4N A;  1U04 A;  4BRD A;  3A5N C;  3MDQ A;  3VQ6 A;  4O0J A;  4XIU A;  3VMF B;  1L3V A;  3J7A P;  4BVP A;  5BRF A;  3I33 A;  2OPR A;  1GLB G;  4I9Q A;  2P9S A;  5DK5 A;  1D9F A;  1TV6 A;  1B9F A;  2DY4 A;  5AQL A;  1N33 K;  3H1Q A;  1T03 A;  1KRP A;  1T05 A;  3U8X A;  4A57 A;  2CGK A;  1YXQ A;  3UIQ A;  2G8F A;  3GL1 A;  4WFA L;  1S1X A;  1BDG A;  3O4Q A;  2WON A;  3H08 A;  4CED A;  4FVU A;  4F3T A;  4LFC K;  4K43 A;  1HQU A;  4ELT A;  3KKS A;  5TKW A;  3Q7B A;  4WYB A;  1O1W A;  4DU3 A;  5FPE A;  4DV5 K;  3LP3 A;  3P31 A;  3P1G A;  3FZM A;  3VQ9 A;  4YDU C;  4CHO A;  3I8B A;  2HBL A;  4FLT A;  2Q31 A;  3PLA A;  2VGN A;  5SZT A;  3SUO A;  4RG8 A;  1EKE A;  3RMB A;  2VG5 A;  1HQE A;  2HHX A;  4BC2 A;  5JLF A;  1A5X A;  3SV3 A;  4AQY K;  3KVG A;  3VQE A;  3AA2 A;  5C15 A;  4A59 A;  1LOT B;  3LDL A;  4IDH A;  3M5R A;  4O5B A;  3AVC A;  5GIP A;  4HCB A;  1SKW A;  4DSJ A;  5DM7 L;  4FW2 A;  2FSJ A;  4DSF A;  4CF1 A;  5AQF A;  1JLC A;  2ITM A;  1G15 A;  5M1Q A;  4FK0 A;  4A61 A;  4JHD A;  4A62 A;  1GLE G;  3OJU A;  1X3M A;  2Z1G A;  2D0O A;  3CFP A;  4CJQ A;  4CGD A;  3DLK A;  3V9X A;  2O8E A;  2Q1N A;  1D9D A;  2E4L A;  1U49 A;  2Z1I A;  4GVM A;  4KHN A;  1ATR A;  1M1K O;  4B9S A;  5IT9 O;  2IC3 A;  2ZJP L;  3M8P A;  4Z4G A;  4O55 A;  4FJM A;  3KKR A;  4NYF A;  1RTJ A;  1A5V A;  3LM9 A;  3FZL A;  3CD6 N;  4BE1 A;  1T6C A;  4RW4 A;  4DR1 K;  3V9W A;  3BZK A;  3OYI A;  4DR5 K;  4LFA K;  1KVA A;  3OS2 A;  1Z26 A;  1WBB A;  2YHA A;  3S41 A;  3AVB A;  3G25 A;  4DV2 K;  2HND A;  3KK7 A;  4Y1D A;  1ASU A;  4PQU A;  1N32 K;  4E1N A;  4AM6 A;  3C65 A;  1LWC A;  3CQX A;  3HVR A;  1JL1 A;  4IO8 A;  4KRF A;  4E7L A;  2YKN A;  2KZM A;  2CGL A;  3WXJ A;  3SPZ A;  4GV3 A;  5HRO A;  5F1X A;  3MN6 A;  4WFB L;  4CJS A;  2Y1I A;  4YOV A;  2BUP A;  3CET A;  4FWS A;  3MEG A;  1WOQ A;  3HT3 A;  3QIP A;  1RT7 A;  1X9S A;  1HMV A;  3HP6 A;  2XO7 A;  3NMU A;  3H3N O;  3JSM A;  2UUA K;  2P9P B;  1LW0 A;  3F5T A;  3VTH A;  5H1S Q;  1IH7 A;  1MA9 B;  3AAP A;  3M8S A;  4ELU A;  3QBX A;  3RRH A;  3DWL A;  3DMJ A;  1ZBH A;  1VQP N;  1KSP A;  3AVM A;  5FRN A;  1V4T A;  3BP8 A;  2FSN A;  5F2R A;  4E89 A;  2CH6 A;  2QKB A;  2FF3 B;  3SUN A;  4KHP K;  4KH5 A;  3ZET B;  1C0U A;  1WSJ A;  2OZM A;  1NOZ A;  4JK8 A;  4E3S A;  2FXU A;  2F8T A;  1S6Q A;  4CHP A;  4DR3 K;  3VQB A;  4QCL A;  3SLC A;  4CGG A;  5M1P A;  1O13 A;  4QAG A;  3VEO A;  4KB0 A;  3HYF A;  3AGR A;  1RT1 A;  3AY9 A;  2OTL N;  4IFV A;  4QS9 A;  5AQN A;  3TSQ A;  1TK8 A;  1EET A;  5BRE A;  4PKH A;  3MXI A;  2W41 A;  2HMI A;  2VGM A;  1T6D A;  4L8R B;  1NKE A;  3VEW A;  4Q5V A;  3PSF A;  3WQU A;  3WXK A;  5ADX A;  1P90 A;  1QVF M;  4BR2 A;  3L0Q A;  3HP9 A;  1JJ2 M;  4FJ5 A;  2DTU A;  3CQY A;  4FM1 A;  3VQ5 A;  1HYS A;  4C23 A;  4EP4 A;  1S3X A;  3T1Y K;  4H5N A;  3MXJ A;  3P4I A;  4DR4 K;  1TK5 A;  3IG1 A;  3QEP A;  1BQN A;  1XUP O;  2B4J A;  3AVI A;  5LY3 A;  4F2S A;  3CC7 N;  1Q7Y O;  3PX0 A;  5CYQ A;  5C12 A;  1J9A A;  1XMQ K;  2YHB A; 
#chains in the Genus database with same CATH homology
 5SWM A;  2BE2 A;  2EX3 A;  4E19 A;  2G8W A;  3SQ0 A;  4J2D A;  1L5U A;  3KTQ A;  3DOL A;  3DYA A;  4E7H A;  3KK1 A;  4CK1 A;  3E01 A;  3KLF A;  4M3Z A;  4N47 A;  4OLB A;  3K5M A;  1RNH A;  1XHZ A;  3TI0 A;  1MU2 A;  3TAF A;  1ZBF A;  2E6L A;  4FZZ A;  3OYM A;  1UA1 A;  2X78 A;  1T8E A;  3WNE A;  1UWB A;  2XY5 A;  4ZTF A;  2YKM A;  1RBR A;  4FJK A;  1QHT A;  4RW9 A;  1QQC A;  1C1A A;  4DTS A;  4HUG A;  5CYM A;  4ICL A;  3AO3 A;  2VWJ A;  2OPQ A;  1ASV A;  2Z1H A;  4DTO A;  3RMD A;  4CJW A;  1VK0 A;  2KTQ A;  1S6P A;  4C8K A;  5JS1 A;  1IKY A;  3AVF A;  2F8S A;  1EP4 A;  4M3Y A;  4BAC A;  1KCF A;  5FRM A;  3LAM A;  1QSY A;  4JS5 A;  3SQ1 A;  4KTW A;  4OVL A;  2HW3 A;  1ZBU A;  4LSN A;  4FJX A;  3QET A;  2NUB A;  4AHS A;  3VN5 A;  3RMA A;  1NK0 A;  1SKR A;  2OZS A;  4F4K A;  3PX4 A;  1NKB A;  4CF2 A;  5CY4 A;  2HB5 A;  4DFJ A;  4B3O A;  2GV9 A;  2G8K A;  1TK0 A;  2PYL A;  1CLQ A;  4CCH A;  3ITH A;  1TL3 A;  4DLG A;  2W42 A;  3ASM A;  4CEC A;  3QLH A;  4CJP A;  4IKF A;  5CZ1 A;  4FCY A;  2IDO A;  3VA3 A;  3IAY A;  3AO5 A;  2RF2 A;  1RCH A;  3OYK A;  2B5J A;  2FBV A;  3AVH A;  4IBN A;  4EZ9 A;  1BQM A;  1GOB A;  1WSE A;  1CXQ A;  4I2P A;  4E0D A;  3OYD A;  1VSM A;  2QXF A;  3HST B;  2OPS A;  4CFB A;  1NK9 A;  3K57 A;  3CYM A;  2X74 A;  3V4I A;  4ID1 A;  1I39 A;  3ZSR A;  4B9L A;  4Z4E A;  3SYZ A;  1TAU A;  1FKP A;  4FLW A;  2BDP A;  3OYG A;  1REV A;  4AH9 A;  2IAJ A;  3U3Y A;  3D0P A;  3LPU A;  1VSK A;  3T3F A;  3DM2 A;  2HHV A;  4KTZ A;  4IDK A;  3QER A;  1J5O A;  1BHL A;  3HPH A;  3V6D A;  4FYD A;  3NF8 A;  3KIO A;  4MFB A;  4C8N A;  4FM2 A;  3RWU A;  4FM0 A;  3KJV A;  4KAZ A;  4FJ7 A;  5J2Q A;  3LDS A;  3TR8 A;  1TL1 A;  4HCC A;  1JLA A;  1TKZ A;  3C6T A;  2FC0 A;  1T7P A;  1UOC A;  5J1E A;  4IG0 A;  3SV4 A;  4OGE A;  4DS5 A;  2AJQ A;  2VG7 A;  4FZX C;  1KLM A;  1VSL A;  3PO4 A;  3VQP A;  1VSE A;  4DQI A;  4FJJ A;  3KK3 A;  3HO1 A;  3HVT A;  3K5N A;  5KGW A;  3G0Z A;  3O3F A;  3S9H A;  4ID5 A;  4O44 A;  4N5S A;  5HBM A;  4B9V A;  1BIS A;  1RBU A;  1RTI A;  3SI6 A;  3S3O A;  3WNG A;  2IS3 A;  1HYZ A;  4KKO A;  3V1Q A;  1JLF A;  3ZSQ A;  4DQR A;  3QNO A;  5I3U A;  3TAN A;  4OPJ A;  1JXE A;  2G8U A;  2KW4 A;  2VWK A;  2DFH A;  2LSN A;  1S1W A;  4DSE A;  4DSL A;  1DTQ A;  2HHU A;  4C8L A;  5I42 A;  1DLO A;  3NH0 A;  4BDP A;  2OPP A;  1QSS A;  3PY8 A;  4FJL A;  3ZT4 A;  4CJE A;  4CJF A;  3OS0 A;  4AHR A;  4F2R A;  3VQQ A;  1WN7 A;  4M3T A;  2IGI A;  3DRS A;  4JS4 A;  4E7J A;  4EZ6 A;  1VSD A;  1TAQ A;  2XRI A;  2BGG A;  3L2U A;  3DI6 A;  4AHT A;  3SNN A;  1L3U A;  3AA4 A;  1WLJ A;  3TWH A;  1XC9 A;  4CGH A;  4FVM A;  5KRT A;  1B92 A;  1BCM A;  2JGU A;  4DFM A;  2XY7 A;  4MQ3 A;  3AO4 A;  3SCX A;  2QKK A;  4PY5 A;  3VQC A;  1NJY A;  1BI4 B;  3THV A;  3CG7 A;  2QK9 A;  3B6P A;  3RR7 A;  3M8Q A;  4B9N A;  4KB1 A;  4DSI A;  4I2Q A;  4HVJ A;  1ZBI A;  1RBT A;  3PO5 A;  1ZYQ A;  3KD1 E;  4OPK A;  3ZSZ A;  2OA8 A;  3ZSW A;  1DTT A;  3QEV A;  1TKX A;  4I7F A;  4BE2 A;  2JLE A;  3OYL A;  4BE0 A;  3SQ4 A;  1F21 A;  3DLH A;  5KTQ A;  3AO1 A;  3BGR A;  1LAW A;  3RRG A;  1TKD A;  4KFB A;  1U45 A;  4G1Q A;  3NCI A;  4M3U A;  4GW6 A;  1SV5 A;  1JLB A;  1Z25 A;  3LZJ A;  4FJ8 A;  3P83 D;  4KO0 A;  5KGX A;  4W5R A;  5J2P A;  3NGZ A;  1HPZ A;  1RBV A;  2G8V A;  1B9D A;  4CER A;  3TAQ A;  3TAR A;  2GUI A;  1W0H A;  3K59 A;  1RT5 A;  3K5L A;  1S9G A;  3ZSY A;  3ZT2 A;  2IOC A;  3RMC A;  3AVG A;  2KZZ A;  3S3N A;  4JLH A;  4AHV A;  5C25 A;  3NHG A;  1IKV A;  4NCG A;  1S1T A;  1RT3 A;  3OYE A;  4B8C A;  3KLH A;  2YNI A;  4HUF A;  4LSL A;  2RPI A;  3JYT A;  3HL8 A;  3K2P A;  1UA0 A;  4Q0B A;  2DFE A;  4ELV A;  1U4B A;  1Y97 A;  4M45 A;  3EYZ A;  3HXM A;  1VSI A;  1NK5 A;  1SL1 A;  2HHW A;  4CJU A;  3NBP A;  1C1B A;  4OGC A;  4K8Z A;  3LWM A;  3SPY A;  1RTH A;  4CJ5 A;  4W5Q A;  4CJT A;  4CHY A;  4CIG A;  1L3S A;  3DRR A;  4KV8 A;  2ATQ A;  4IFY A;  3HPG A;  3NF6 A;  3OY9 A;  2E6M A;  3KLI A;  3L2R A;  4HUE A;  4FLU A;  5FDL A;  1NK7 A;  3DLR A;  2P5O A;  4DSK A;  1YTU A;  4CJV A;  4W5N A;  4FLV A;  3AVA A;  4KI4 A;  1NJX A;  3OYA A;  2X6N A;  2D0C A;  1VSJ A;  4HHT A;  4DLE A;  1NKC A;  3F73 A;  3HK2 A;  5C42 A;  2PY5 A;  3I0S A;  2D5R A;  4PUO A;  1WAJ A;  3AV9 A;  2Z1J A;  3VQ8 A;  3ZCM A;  4CHZ A;  4CEB A;  4QOZ B;  2GBZ A;  3WNH A;  3TAP A;  4CEO A;  4KHU A;  4M3W A;  4CFA A;  4DWI A;  2P51 A;  1W9H A;  4RW6 A;  4CF0 A;  4DTR A;  3TAM A;  4M3X A;  5HRS A;  1HYV A;  3QIO A;  4CHQ A;  3EY1 A;  3CFR A;  4F8R A;  3AVL A;  4AHC A;  4B9M A;  2DFF A;  4CEE A;  3HJF A;  1HJR A;  2HVH A;  2RKI A;  3O4N A;  1U04 A;  4FK4 A;  3VQ6 A;  3V9U A;  4O0J A;  4YNQ A;  3VQ7 A;  4XIU A;  4F3O A;  1L3V A;  3U6F A;  3LP2 A;  1WSF A;  1RDD A;  4FK2 A;  2VG6 A;  2OPR A;  4FLX A;  3LP1 A;  2RN2 A;  3SJJ A;  1NK8 A;  4I9Q A;  4KHS A;  3LAN A;  1JLG A;  4E1M A;  4UQG A;  3MXM A;  3PUF A;  3DLB A;  4KHQ A;  2A1S A;  2ZD1 A;  5DK5 A;  1D9F A;  1TV6 A;  1B9F A;  2DY4 A;  3SUP A;  3QIN A;  3MAQ A;  3OJS A;  1T03 A;  1KRP A;  4RW8 A;  1LAV A;  1T05 A;  1WNS A;  3DLE A;  1FK9 A;  1KTQ A;  4KHY A;  1RT2 A;  4CHN A;  4BWM A;  3UIQ A;  2G8F A;  3LP0 A;  1C0T A;  1ZBL A;  4CIF A;  1S1X A;  3O4Q A;  2Y1J A;  2WON A;  3H08 A;  4CED A;  4CJ4 A;  4PWD A;  1S5J A;  1KVC A;  4CF9 A;  4F3T A;  3C6U A;  5D3G A;  4CGF A;  3O3G A;  1HQU A;  3NH2 A;  3TAG A;  1QSL A;  4ELT A;  4B9U A;  1FXX A;  4O4G A;  4Z4F A;  4NCA A;  3KKS A;  1EX4 A;  1WAF A;  3OYN A;  3DRP A;  3L2W A;  1O1W A;  4DU3 A;  3L2Q A;  3SZ2 A;  3LP3 A;  3AO2 A;  1N5Y A;  3P1G A;  3VQ9 A;  3L8B A;  4CHO A;  1BCO A;  4FLT A;  1WSI A;  4CIE A;  3QEX A;  4DTU A;  1S9E A;  1CZ9 A;  3C95 A;  1S1V A;  5FRO A;  5SZT A;  3SUO A;  2HNY A;  4RG8 A;  1EKE A;  4B9T A;  1BGX T;  3RMB A;  2VG5 A;  1HQE A;  4PA1 A;  4DFP A;  2HHX A;  4E7K A;  3SV3 A;  1A5X A;  1JLE A;  3NF7 A;  1SL2 A;  1QE1 A;  3AA2 A;  3VQE A;  3O3H A;  3KLG A;  1NJW A;  4FXD A;  3QO9 A;  2KQ2 A;  1U48 A;  1RDA A;  5K14 A;  1NOY A;  1BIU A;  4O5B A;  3CM5 A;  3AVC A;  3S3M A;  4HCB A;  1SKW A;  4H8K A;  4DSJ A;  1RTD A;  2PZS A;  3ZSO A;  4FW2 A;  4LH5 A;  4DSF A;  1U47 A;  4M42 A;  5C24 A;  4GMJ B;  4CF1 A;  3OYF A;  1JLC A;  1QS4 A;  1L3T A;  1G15 A;  3KD5 E;  4DF4 A;  4FK0 A;  3OVN A;  4CJL A;  4DTM A;  3OJU A;  1CZB A;  3KLE A;  3ZT3 A;  3C94 A;  4M3R A;  2Z1G A;  4Z4H A;  4DQQ A;  4Z4I A;  3MEE A;  1TGO A;  4O0I A;  3I8D A;  2XHB A;  3CFP A;  3A2F A;  4CJQ A;  4FZY A;  4CGD A;  4W5O A;  3NDK A;  3DLK A;  3V9X A;  3ULD A;  1D9D A;  2E4L A;  1D5A A;  1C1C A;  3QNN A;  1U49 A;  4CK2 A;  2Z1I A;  4GVM A;  4CGJ A;  4CFC A;  2ITG A;  4KHN A;  1VSF A;  4K8X A;  5E41 A;  1LV5 A;  1N6Q A;  1KLN A;  4B9S A;  3OYC A;  2F96 A;  2D0B A;  2IC3 A;  1JL2 A;  1BIZ A;  3ALY A;  3M8P A;  3V9S A;  3T19 A;  4Z4G A;  3IRX A;  3EZ5 A;  3PV8 A;  4O55 A;  1VRU A;  3QES A;  4CEF A;  4YFU A;  4FJM A;  5EU7 A;  3SQ2 A;  3NGY A;  3KKR A;  4NYF A;  4JRP A;  1RTJ A;  1A5V A;  2YNH A;  4DTJ A;  3VQD A;  1QTM A;  1WSH A;  4KTQ A;  4R5P A;  2HVI A;  4ZHR A;  3B6O A;  4M41 A;  4BE1 A;  2OYQ A;  4CJ3 A;  2YNF A;  4RW4 A;  3D45 A;  3V9W A;  2HHS A;  3OYI A;  3DOK A;  1HNI A;  2BAN A;  4OKE A;  1KVA A;  4CK3 A;  3NF9 A;  3OS2 A;  1Z26 A;  4FW1 A;  4FJH A;  2HNZ A;  2YHA A;  1I3A A;  4DF8 A;  2D0A A;  1XHX A;  1C6V A;  4OKJ A;  3CQ8 A;  4FJG A;  4BDZ A;  4Z0U A;  3AVB A;  2XY6 A;  4OLA A;  4Y1C A;  1RDC A;  2HND A;  5DMR A;  3OYH A;  4Y1D A;  1ASU A;  3HPO A;  2X6S A;  5KRS A;  3KK2 A;  2HHQ A;  3RR8 A;  2G8I A;  4PQU A;  1XI1 A;  3ZT1 A;  2R7Y A;  4DFK A;  4E1N A;  4FLY A;  4I9L A;  2KFZ A;  1X9M A;  3AA3 A;  1RIL A;  1LWC A;  1LW2 A;  3HVR A;  1JL1 A;  3F9K A;  1J53 A;  5HLF A;  4KRF A;  4E7L A;  4B8A B;  4KPY A;  2YKN A;  2KZM A;  1LWE A;  4CF8 A;  2P1J A;  4DQP A;  4RW7 A;  3SPZ A;  2O4G A;  3M8R A;  1SUQ A;  5HRO A;  1LWF A;  3MED A;  4CJS A;  2Y1I A;  1Q9X A;  4FLZ A;  1VRT A;  5J2N A;  5HRR A;  4CES A;  4CEA A;  4CEZ A;  3G10 A;  1IKX A;  3I0R A;  3MEG A;  3ZSV A;  4H4M A;  5JS2 A;  3HT3 A;  1NJZ A;  3QIP A;  4N41 A;  1RT7 A;  1X9S A;  3V81 A;  3PX6 A;  1HMV A;  3HP6 A;  3NGI A;  4JRQ A;  2XO7 A;  4CFD A;  4CJK A;  1NK6 A;  1K6Y A;  4NYN A;  3JSM A;  4J2B A;  2G8H A;  1RT6 A;  1LW0 A;  3V1R A;  1X9W A;  4CE9 A;  1IKW A;  1J54 A;  4Z4C A;  1IH7 A;  1KFS A;  3TAB A;  4KHW A;  4CEQ A;  1WSG A;  3M8S A;  3MEC A;  3NFA A;  1A5W A;  3NAE A;  3DLG A;  4DTP A;  4OJR A;  3RRH A;  2ZQB A;  4ELU A;  3DMJ A;  3L3U A;  3P5J A;  1ZBH A;  1KSP A;  3AVM A;  1XWL A;  3T1A A;  3NH1 A;  4BDY A;  3QEI A;  5FRN A;  4E89 A;  4KI6 A;  3TAE A;  2YV0 X;  2QKB A;  2B6A A;  3L2V A;  3V9Z A;  4E7I A;  3L3V A;  3CM6 A;  4DU4 A;  4DTX A;  4N56 A;  2P5G A;  1TVR A;  3ZSX A;  2FBT A;  4W5T A;  3VA0 A;  1RBS A;  3FFI A;  3LAK A;  3SUN A;  1NK4 A;  1GOA A;  3LPT A;  5CZ2 A;  4KRE A;  1C0U A;  1WSJ A;  2OZM A;  1NOZ A;  4E3S A;  2F8T A;  3AVJ A;  1S6Q A;  4CHP A;  5T7B A;  1SL0 A;  3VQ4 A;  1YTA A;  2O4I A;  2PYJ A;  1ASW A;  3VQB A;  4DQS A;  1Q9Y A;  4C8O A;  4DG1 A;  2FBX A;  3SUQ A;  1JLQ A;  4QCL A;  4J2A A;  4H4O A;  2XY8 A;  1GOC A;  5HRN A;  4CGG A;  4LY7 A;  2HHT A;  3LAL A;  4QAG A;  4OKK A;  4KB0 A;  2YNG A;  3HYF A;  2EHG A;  4FJN A;  1ITG A;  2KFN A;  1RT1 A;  1UAX A;  4IFV A;  3LWL A;  1EXQ A;  3VQA A;  1RDB A;  4TSX A;  4BWJ A;  1X1P A;  4LD0 A;  4J2E A;  3QEW A;  3BDP A;  4AHU A;  4FJI A;  4C8M A;  3RTV A;  4ZTJ A;  3NE6 A;  4DS4 A;  1HRH A;  1KVB A;  1TK8 A;  1BI4 A;  1EET A;  1C0M A;  2ZE2 A;  5J2M A;  1KFD A;  3K58 A;  3MXI A;  2A1R A;  1TKT A;  1HNV A;  2HMI A;  4FJ9 A;  1CXU A;  4L8R B;  1NKE A;  4Q5V A;  1R0A A;  3ZT0 A;  1YVU A;  3K5O A;  3IS9 A;  4LH4 A;  4AIL C;  5HP1 A;  3OS1 A;  1RT4 A;  3AA5 X;  1SKS A;  2I5J A;  4CJR A;  3HP9 A;  1S1U A;  4FJ5 A;  2ETJ A;  5HRP A;  4N76 A;  4FM1 A;  1HYS A;  3V1O A;  1JXB A;  3VQ5 A;  3AVK A;  2DTU A;  4EP4 A;  1IG9 A;  1YT3 A;  4B08 A;  4DTN A;  3U3G A;  3MXJ A;  4DMN A;  3OYB A;  4EP5 A;  4NCB A;  4IG3 A;  1TK5 A;  1VSH A;  1FKO A;  2WOM A;  1JKH A;  1Q8I A;  3IG1 A;  4CGI A;  1IO2 A;  3CFO A;  3QEP A;  1BQN A;  2B4J A;  3AVI A;  3LZI A;  1D8Y A;  5KI6 A;  2Q3S A;  3HM9 A;  4F2S A;  4WE1 A;  3ISN C;  3AVN A;  4HTU A;  2FBY A;  4DU1 A;  3PX0 A;  5CYQ A;  3WNF A;  3OYJ A;  1BL3 A;  1J9A A;  2YHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...