4QAGA

Structure of a dihydroxycoumarin active-site inhibitor in complex with the rnase h domain of hiv-1 reverse transcriptase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structure of a Dihydroxycoumarin Active-Site Inhibitor in Complex with the RNase H Domain of HIV-1 Reverse Transcriptase and Structure-Activity Analysis of Inhibitor Analogs.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4qagA00
4DS4A 4WE1A 1NK5A 3ZSQA 4CJRA 1XI1A 4KHUA 1F21A 1S1UA 1WSFA 3AVIA 4N56A 1RT4A 4DLEA 1EKEA 4F2SA 3WNEA 1JLGA 1QHTA 3NHGA 3VQ4A 4M3XA 3L3UA 1SL1A 2RF2A 4KTWA 1LW2A 4F3TA 1L3VA 3HL8A 1WAFA 1BQMA 4JS5A 4FK2A 2HNZA 3AO4A 1NJYA 3LAKA 2VG5A 4FZZA 4FK4A 3QIOA 3OYMA 4AHTA 4CESA 4AHRA 3C6TA 1DTTA 3T19A 4GVMA 4EZ6A 3ZSZA 2OPRA 3QESA 3QLHA 1X9MA 3HM9A 1NJXA 2XY6A 4CIFA 3TI0A 3PO5A 4I9QA 1DTQA 3PO4A 1NK6A 2ATQA 4B3OA 4I2PA 1BQNA 4FM2A 3QEXA 3DI6A 3SJJA 1NOZA 3OS2A 3ZSXA 3SUQA 4FLUA 1X9WA 4KV8A 2ZQBA 4HUFA 2D0BA 4N5SA 3L2RA 4M45A 1W9HA 3KTQA 4FJMA 4BE0A 1WSGA 4KI4A 2QKBA 1RT6A 1VSKA 5KGWA 2O4IA 2HVHA 3I0SA 4CJSA 3AV9A 3DLGA 3V1OA 4Z4CA 1IKVA 3SNNA 1J54A 1WNSA 3T1AA 5HP1A 4B08A 5T7BA 4OKJA 4RG8A 3LWLA 1BISA 1KTQA 3SQ2A 4FLTA 2I5JA 4DLGA 3MXMA 1YTAA 1SUQA 4NYFA 3S3NA 1ZBLA 5J1EA 2HMIA 1C1CA 3LP0A 2R7YA 3AO1A 1IKYA 3LP2A 3AVLA 4W5TA 3HPOA 4BDPA 4DSLA 1I39A 3HPHA 3OYAA 3QNNA 4M3UA 4DTRA 4CJKA 2OPSA 3AVFA 4BE1A 3SQ4A 1J9AA 3DRSA 3ASMA 4LSNA 4NYNA 1C1BA 2F96A 4E7KA 1RDDA 4KHQA 1RTJA 3RR8A 4LD0A 2G8HA 1G15A 3LDSA 3D0PA 3CM6A 3KLIA 4DSIA 3IS9A 1S6QA 5KRSA 3MEDA 1SL0A 1MU2A 3M8QA 4CF9A 4Y1DA 3AVHA 2RN2A 5J2PA 1Z26A 4DTPA 4KO0A 4KPYA 1JLEA 1LWCA 2HNDA 2KFZA 4OKKA 1TKDA 3V4IA 2G8IA 4FJ8A 4I9LA 5DMRA 3ZSOA 3OJSA 5CYQA 4FJKA 4PUOA 4BE2A 3KKSA 3HYFA 4OPJA 4CE9A 1ASUA 3NH1A 4CF1A 4AHCA 3U6FA 1RT7A 1RBRA 2PYLA 2YKNA 3AA4A 3RR7A 2B4JA 2FC0A 1D9FA 2Y1IA 1BHLA 4CK3A 2XY7A 1GOCA 3WNGA 3SUNA 1BIUA 1RCHA 3AO5A 3CYMA 2OPPA 3MEEA 5CZ2A 4CGIA 2YNHA 1LWEA 3OYGA 1BIZA 4QOZB 1J53A 3M8PA 3HPGA 4DG1A 4AILC 4FJHA 4W5RA 3MXIA 2GUIA 2ITGA 1RILA 4LH5A 3ZCMA 2P1JA 1YT3A 4CGGA 3OYCA 5FRMA 3FFIA 2HHWA 1WLJA 4DU4A 3BDPA 4M3ZA 1XWLA 3ITHA 2EHGA 4N47A 4B9LA 3AVCA 3O4NA 2VWKA 3SUPA 1UOCA 4MFBA 2VWJA 1UA1A 4ICLA 1TKZA 1LV5A 2KQ2A 2A1RA 4KKOA 4RW4A 1X9SA 3O3GA 1KFSA 1K6YA 5CZ1A 1BGXT 3OYJA 4FJIA 3QETA 4E7IA 4JRQA 1GOAA 2HHVA 3VQBA 4CJ3A 2QKKA 4CHOA 1RTIA 1L3UA 4CEBA 3V9ZA 4Z4HA 3NH0A 4B9UA 5J2MA 3HVRA 3SI6A 4G1QA 1LWFA 4KB0A 2KZMA 3BGRA 4BDZA 4CJTA 3V9XA 2P5GA 1KFDA 2RPIA 1JL2A 4B8AB 1VSFA 4FLXA 4DTUA 4JRPA 3PX0A 2HVIA 1KLMA 3C95A 1U47A 1U04A 2ZD1A 1JXEA 4AHUA 5D3GA 3AO3A 3NDKA 2YV0X 1SKRA 2HW3A 2KW4A 4RW9A 2E6MA 1TV6A 2HHQA 3TAEA 2KZZA 3VQAA 2HHTA 1FXXA 1S1WA 3I8DA 3L2QA 1W0HA 4DTOA 1IG9A 4EZ9A 2VG7A 3SCXA 3TANA 1S9GA 4H4OA 1WAJA 3G0ZA 4CJEA 1VRUA 3AVNA 1ZBFA 1REVA 2IGIA 3AVGA 4EP5A 4M3TA 1QQCA 4CGHA 3P5JA 4IKFA 4YFUA 2DY4A 2EX3A 4MQ3A 4ZTFA 2OA8A 1QTMA 3V6DA 1JLCA 1TK8A 4E1NA 4O55A 2IC3A 4Z4EA 3PV8A 1B92A 2DFEA 2O4GA 1UA0A 4F2RA 3HT3A 3OJUA 1RT2A 4CJ4A 1B9FA 1HYVA 3VQ9A 1FKOA 4Y1CA 4FLWA 5SZTA 4M3WA 4CFDA 1Z25A 2F8SA 3HP6A 1C0MA 1RBUA 1WSHA 4DF8A 3K58A 4JS4A 1YVUA 3SPYA 1FKPA 4CF2A 3QNOA 4Q0BA 2QXFA 4NCBA 4DTSA 1EXQA 1EP4A 2G8VA 3L2VA 2XRIA 1CXUA 3L2UA 3U3YA 4E1MA 4H8KA 3L3VA 2X74A 1WSJA 3SZ2A 4HCBA 1HYZA 3AA5X 5I42A 2YNGA 4DQRA 2IAJA 5C25A 3AA3A 2DFFA 4RW6A 1QSSA 1KRPA 4FJNA 2Y1JA 4FJLA 1GOBA 1WN7A 4KHWA 2F8TA 1D5AA 4Z0UA 4CEFA 3B6PA 2B5JA 1IH7A 3DM2A 2Z1JA 3AO2A 4HUEA 4FLVA 2KFNA 4ELTA 3NF9A 1RDCA 4NCAA 1JLFA 4W5OA 4O0JA 4KRFA 2FBYA 3VN5A 4CERA 4B9NA 4ELUA 3ISNC 2OZSA 4JLHA 1VSHA 3WNFA 1BI4B 1C6VA 3CM5A 4YNQA 4OPKA 2PYJA 4KB1A 1RTHA 2ETJA 3I0RA 1XHZA 1T7PA 1A5WA 4RW7A 4FLZA 4E7HA 4HUGA 4HCCA 3KLEA 3VQPA 1HJRA 2A1SA 4CIEA 2HHUA 4CECA 1QS4A 4OVLA 4CFAA 3DYAA 2JLEA 4B8CA 3KD1E 3RTVA 1L5UA 3CFOA 3KIOA 5FROA 1TK5A 3OY9A 5FRNA 1HMVA 3AA2A 1Q8IA 4FLYA 2DTUA 3ZT1A 4O44A 1U4BA 1XHXA 4KAZA 3T3FA 3CG7A 3M8SA 5HROA 4HVJA 4PY5A 1JLBA 1L3TA 4F8RA 1BI4A 1UAXA 3NAEA 2Z1HA 1LW0A 4FW1A 4DTJA 3TAQA 2BGGA 2FBVA 3ZSWA 5CY4A 2IS3A 4PA1A 3IG1A 4E19A 2E6LA 2Z1IA 2YHAA 1ZBHA 1RNHA 3VA0A 2G8WA 1VSJA 3ZSRA 4QCLA 4IG3A 3DLRA 1U49A 1NKCA 5E41A 4UQGA 1BCOA 3JSMA 4DWIA 2D0CA 1EX4A 4DSKA 4KTZA 4LH4A 3RWUA 2X6NA 4ZTJA 1J5OA 3ZT3A 4DFPA 3RRHA 2OYQA 2QK9A 2RKIA 4BWMA 4ID5A 1S5JA 1B9DA 3CFRA 4E7LA 2HHSA 1NOYA 2OPQA 4FM0A 1KVAA 3E01A 1Q9XA 1TK0A 1RT1A 3DLBA 3G10A 1L3SA 1NK0A 4J2AA 3DRPA 4CK2A 4BDYA 4KHNA 4CEOA 5HRSA 3SQ0A 4O5BA 3S3OA 4OGCA 3KD5E 2KTQA 3F73A 1SV5A 3HXMA 3LZIA 4C8LA 3K57A 1BL3A 2BANA 4DTNA 4DTMA 5C24A 3NGIA 4C8NA 4DQSA 4FXDA 1TVRA 3LPTA 1KCFA 4W5NA 4DSEA 1HQUA 4CHPA 2BE2A 4CGJA 3VQQA 3OYIA 4GW6A 3KK3A 3QEWA 4B9VA 3AVBA 4C8MA 2NUBA 3ZT0A 2YNFA 1NKEA 1N5YA 4FZXC 3QERA 1VK0A 3DRRA 2E4LA 1NK8A 1HNIA 3NGYA 3P83D 1VSIA 3KK1A 3EYZA 1RBSA 1SKSA 3HSTB 3K59A 4FJ5A 3LWMA 4DU1A 4J2DA 4IDKA 3OYDA 3K5OA 1KVCA 5C42A 2GBZA 3HVTA 3K5MA 3EY1A 3CQ8A 4R5PA 4M42A 3L2WA 1DLOA 3TAGA 1CLQA 4CEAA 4CJQA 4CJVA 4FJ9A 4CF0A 4FK0A 3PUFA 1VRTA 1D8YA 4NCGA 1TKTA 3QO9A 1RTDA 1A5XA 4FJ7A 4DSJA 3ZT2A 3VQ8A 3LP1A 3C94A 5J2NA 3DMJA 4KREA 3SUOA 4DMNA 2GV9A 3RMDA 3H08A 3VQEA 1NK7A 1QSLA 1VSEA 2WOMA 3THVA 4DTXA 1TL1A 3A2FA 2D5RA 4HTUA 4E7JA 1LAVA 3NH2A 4TSXA 4FJXA 5KTQA 2D0AA 1TL3A 1WSIA 1BCMA 4OGEA 3TAMA 4CJWA 3B6OA 4CHYA 3S3MA 3NE6A 4Z4IA 1HPZA 5HRPA 4FJGA 3LANA 4N41A 1CZBA 4C8KA 1ITGA 4DQIA 1IO2A 3VQ7A 3ZT4A 4FVMA 4XIUA 4J2BA 3RRGA 4FM1A 3O3HA 4J2EA 3AVJA 1RT3A 3TARA 1T05A 2YNIA 3L8BA 1TAUA 1IKWA 3RMAA 4M3RA 3SV4A 3RMCA 1KSPA 2B6AA 3TAFA 4N76A 1IKXA 4B9SA 1TAQA 3LPUA 3ZSYA 3K2PA 3NFAA 4CIGA 3CFPA 4CGDA 5SWMA 2G8FA 4LSLA 4LY7A 3KLHA 3PX4A 4I2QA 5JS2A 2WONA 1NJWA 3DLKA 1HYSA 4C8OA 2IDOA 5KGXA 2XHBA 3AVAA 4KI6A 2X78A 3QIPA 4OLAA 4CGFA 3OVNA 4IBNA 4I7FA 1ASWA 2VG6A 4ZHRA 3V9WA 2FBTA 1C0UA 3TAPA 4FJJA 4OKEA 3KK2A 4CEQA 1TGOA 3MAQA 1ZBUA 2G8KA 1RDBA 3DOLA 1NKBA 1T8EA 3LAMA 3DLEA 3JYTA 3EZ5A 4O0IA 4M41A 3IAYA 4OLBA 1Q9YA 2HB5A 1CXQA 3QEIA 1C1AA 3DOKA 1S6PA 3ALYA 4GMJB 3K5LA 1NK4A 4Z4FA 3QEVA 1HNVA 1RDAA 1UWBA 1VSDA 3KKRA 2P51A 4IG0A 4EP4A 4CHZA 4DF4A 4CJPA 4PQUA 4DFKA 1U48A 1SKWA 1NJZA 5HRNA 4F3OA 3OYEA 1S1XA 3MECA 3MXJA 3IRXA 2Q3SA 3NF7A 3PX6A 5HBMA 4K8ZA 2YKMA 2YHBA 3HK2A 3OS0A 1ASVA 1T03A 2ZE2A 3ULDA 1JLQA 1RT5A 4CJUA 5HLFA 1ZBIA 1RBTA 1JLAA 2IOCA 3HP9A 3V1RA 3OYNA 3OYHA 3AVMA 4AHSA 4CHNA 2X6SA 2PZSA 2W42A 1CZ9A 4CEZA 4CCHA 3HO1A 1R0AA 3QEPA 3NF8A 3SQ1A 4K8XA 5K14A 3V1QA 1S9EA 5KI6A 4FW2A 4CFBA 1A5VA 2HNYA 5HRRA 3ZSVA 2DFHA 1HQEA 3C6UA 3K5NA 3LP3A 4DQQA 4W5QA 3O4QA 2XY8A 1S1VA 4Z4GA 1VSMA 4OJRA 3AVKA 3VQ5A 3D45A 4FYDA 4KHSA 4DS5A 2XY5A 1VSLA 3WNHA 1JXBA 4O4GA 3M8RA 3UIQA 4ID1A 4BWJA 4DSFA 2AJQA 3PY8A 1Y97A 4AHVA 4H4MA 4B9MA 3MEGA 4CJ5A 2G8UA 4E89A 3F9KA 3VQDA 2FBXA 4QAGA 2OZMA 1QSYA 1YTUA 4Q5VA 4E0DA 4DFMA 2JGUA 3U3GA 5EU7A 5I3UA 2P5OA 1I3AA 1O1WA 3TWHA 1ZYQA 4CEEA 3KLFA 1JL1A 1KLNA 4B9TA 1SL2A 3OYLA 3VQ6A 3VA3A 1TKXA 3V81A 3P1GA 3O3FA 4HHTA 4BACA 2BDPA 3OS1A 4FCYA 4DFJA 3NF6A 4IFYA 2LSNA 3DLHA 2PY5A 1FK9A 1WSEA 3VQCA 4DQPA 4DU3A 4IFVA 3TR8A 1N6QA 4KTQA 5JS1A 4CEDA 3SV3A 1KVBA 1S1TA 3NCIA 1U45A 1JKHA 4RW8A 4AH9A 3V9UA 3TABA 1D9DA 1LAWA 1XC9A 1HRHA 3RMBA 3KJVA 3V9SA 3SPZA 4F4KA 1RBVA 3NBPA 4PWDA 1C0TA 3NGZA 1X1PA 3KLGA 3HJFA 5CYMA 4M3YA 5DK5A 4L8RB 1EETA 3S9HA 4E3SA 3OYFA 4CF8A 3LALA 4CJFA 1NK9A 3QINA 4CFCA 4KFBA 5KRTA 3OYKA 1QE1A 4CHQA 3OYBA 3SYZA 2Z1GA 4KHYA 2XO7A 4FZYA 2HHXA 4CK1A 5J2QA 4ELVA 5FDLA 4CJLA 3LZJA
chains in the Genus database with same CATH superfamily
1HUXA 4WE1A 1NK5A 1WBDA 1XI1A 1S1UA 1EKEA 1LOTB 2VGNA 1YHQN 3WNEA 1QHTA 3VQ4A 4LFCK 2WUSA 2RF2A 2FSKA 4KTWA 1L3VA 3LAKA 3LDNA 4FZZA 2W6LA 5JMVA 3OYMA 4AHTA 2Q0UA 1BWFO 3MWTA 1LCUA 2OPRA 3QESA 3PO5A 4CIFA 2P9SA 4FM2A 3DI6A 4MO5A 1ZC6A 5FPDA 3IMXA 3OS2A 3ZSXA 3ZX3A 4FLUA 1X9WA 1VQMN 4KV8A 4N5SA 3FZKA 3L2RA 4M45A 3KTQA 1T44A 1X3NA 4BE0A 4DV1K 1VHXA 4DR2K 1VSKA 2QWMA 2F4VK 2HVHA 5AQYA 4CJSA 4H5TA 3SNNA 1IBKK 5HP1A 1T6CA 5T7BA 4OKJA 1KTQA 5AQTA 2HBJA 3VGLA 1YI2N 1SUQA 5AQKA 4RTFD 1C1CA 1IKYA 3HPOA 4M3UA 4DSLA 1I39A 2E8AA 4DTRA 3MWPA 4CJKA 3SQ4A 3AAPA 1W2BM 3DRSA 1RDDA 1YVNA 1VQON 1OH5A 3J7YP 3MEDA 4FWMA 2HOEA 1BOTO 2RN2A 3O8MA 3JAMO 4KO0A 1LWCA 2HNDA 5KQDA 5BRDA 1TKDA 4WCEL 4FJKA 5C2DA 3VTHA 3KKSA 4OPJA 2ZF5O 4CE9A 3H1VX 3NH1A 4A5BA 5DM7L 2YKNA 2B4JA 1D9FA 4JI0K 2Y1IA 3UB5A 3VESA 3VEVA 1GOCA 1HNZK 2O8EB 3MX5A 1BIUA 5AFUH 5EX5A 3MEEA 1I94K 2VYPA 4R79A 1LWEA 3OYGA 1BIZA 3M8PA 3E66A 3ULEA 5FRMA 1YT3A 3FFIA 1WLJA 4DU4A 4BRQA 4DR1K 2Q97A 4N47A 4JHDA 3CF5L 2VWKA 2VWJA 1TKZA 1LV5A 2KQ2A 4KKOA 4RW4A 5CZ1A 4H03B 2O8BB 2KLAA 2YHYA 4E7IA 4JI5K 2HHVA 1RDUA 4CJ3A 1IBLK 4Z4HA 4KB0A 4G1QA 1LWFA 2RPIA 1JL2A 4BR0A 5BPMA 4BR9A 4FLXA 4DR5K 5BR8K 2Q31A 3PX0A 2H3GX 2ZD1A 4BC3A 3AO3A 3DXKA 3EO3A 4PKGA 1N32K 3O1BA 3WEEA 4JKGB 3TPQA 1VQLN 3M3ZA 3AVNA 3WXJA 1REVA 2IGIA 3EKUA 1M1KO 2DY4A 3P5JA 4XH5A 4MQ3A 1HKGA 4O55A 2IC3A 2F7TA 4A57A 1UA0A 3T7ZA 1WBBA 4F2RA 3U9ZA 3HT3A 4FLWA 1QVFM 3CETA 2NRRA 3HP6A 1C0MA 5AZIB 1YVUA 4Q0BA 1FKPA 3J8AA 1CXUA 1WSJA 1RFQA 5AQMA 3TTDA 1GLFO 4KHWA 4H5RA 4C1NK 2Q1NA 3DM2A 1BA0A 4HUEA 4FLVA 2FSJA 2KFNA 4IJAA 1JLFA 4FWRA 1S72N 4W5OA 2FBYA 3VN5A 4B9NA 5AQRA 2UUBK 4IJNA 4YNQA 3CCQN 2ETJA 1A5WA 4RW7A 4DB3A 3HBTA 2HHUA 4CFAA 2JLEA 3RTVA 1L5UA 3KIOA 1GLAG 3CPEA 2D0PA 1QQOA 5HROA 5FLXO 3CC2N 4PY5A 1LW0A 4DTJA 3WXIA 2E6LA 2Z1IA 1X3MA 4KH5A 2G8WA 4WQ4C 1EWRA 3JSMA 5JVGL 4FWPA 3VTIA 3RRHA 2W41A 4B1VA 4ID5A 4E7LA 1B9DA 5AQUA 1KVAA 1TK0A 4J2AA 4BDYA 4GKKK 3F73A 1NGFA 1NWKA 4C8LA 4FXDA 4DQSA 2NNWA 4C8NA 1TVRA 3C65A 4CHPA 3VQQA 3OYIA 3QEWA 5E84A 3SLCA 3QDKA 2AP1A 2NUBA 3C0BA 3ZT0A 4B3MK 3EEQA 2QEXN 3PLAA 3KK1A 5EXWA 4IOAL 1SKSA 4FJ5A 4J2DA 5C42A 1G99A 4PKIA 3TSUA 3A5LC 3K9JA 1U2VA 2ZJPL 1SAZA 3SMPA 5EOYA 4CF0A 3CCSN 1VRTA 1IJJA 1IBMK 2HMPA 2FF3B 1VQKN 3F9MA 3C94A 2I7PA 4KREA 2GV9A 1QSLA 3THVA 5EY4A 3VEZA 3QB0A 4TSXA 1J5EK 3S3MA 1KC8O 4FOEA 3BUZB 4Z4IA 4FJGA 3MN6A 4OPAA 4N41A 3ZX0A 1IO2A 3VQ7A 4B9QA 2UXDK 2Q36A 4XIUA 5AR0A 4FM1A 3O3HA 4J2EA 1RT3A 1TUUA 3TARA 1VQ6N 3RMAA 2WTUA 2B6AA 4CW7B 3TAFA 1IKXA 1ATNA 3ZSYA 4BGBA 3D6RA 2HHHK 3C7NB 2WONA 1HYSA 3CJ1A 4JV5K 2XHBA 3CCUN 2GWKA 3GL1A 4IBNA 4ZHRA 3HOTA 2ZJQL 3SAFA 4FJJA 3HZ6A 1ZBUA 1RDBA 3EZ5A 4CZGA 3QBXA 4CI6A 4A5AA 4GMJB 3K5LA 1UWBA 2E2PA 3QICA 4CJPA 1U48A 3CQYA 1NJZA 4F3OA 4FSVA 5AQGA 3NF7A 3OW2M 3OS0A 4U7BA 4YOXA 1JLAA 3OYNA 1JCGA 3RSEA 1CZAN 2W42A 3HO1A 4FW2A 3VERA 2HNYA 4DQQA 3K5NA 3LP3A 1VSMA 3AGRA 3AVKA 4HWIA 4WQ5A 4EHTA 4K43A 1K9MO 4ID1A 2NRVA 4AHVA 4H4MA 4B9MA 2FBXA 3SAHA 2OZMA 5JICA 1YTUA 1KAZA 4E0DA 4DFMA 4NO7A 4CEEA 1R59O 1JL1A 2GUPA 2PBDA 4B9TA 3OYLA 4HHTA 3SAGA 3DLLL 2BDPA 1Q18A 3OS1A 5B8HA 3LDPA 3NF6A 4DQPA 1N6QA 2YHXA 1T6DA 1KVBA 3LM2A 3NCIA 1U45A 2QA4N 4BGAA 4BRLA 1RBVA 3ENBA 4YOYA 3HJFA 4L8RB 4IEIA 3OYFA 4CJFA 1VQ7N 2P9UB 3OYBA 4CHQA 2Z1GA 5AQOA 4FZYA 2O8BA 4CK1A 4ELVA 5FDLA 4CJLA 4DQ8A 4BRHA 1ATRA 1WSFA 3THXB 3NHGA 3L3UA 3VMFB 3NVKA 4F3TA 1T3VA 4JS5A 1YJ9N 2VG5A 3QIOA 3G25A 3CC7N 4CESA 3J80O 4EZ6A 1X9MA 1NJXA 4CZIA 4I9QA 4CBUA 1DTQA 1NU0A 4H0YB 1ATSA 2EWSA 4H5WA 1NOZA 2ZQBA 1BA1A 4HUFA 3ID8A 1WSGA 2UYTA 3LM9A 1KXPA 5M1NA 4I6MB 4FPAA 2ITMA 3LWLA 4RG8A 4FLTA 4WYBA 4E1JA 1YTAA 3SMSA 3S3NA 2HMIA 5J1EA 2BUPA 3LL3A 3F2KA 3LP2A 4W5TA 5AZIA 4BDPA 1KAYA 3HPHA 3QFUA 3L0QA 4BG9A 4EFHA 3OYAA 5AQWA 3QNNA 3PSFA 4BE1A 4JKAA 3ASMA 4KHQA 2P9KB 2F96A 4FVUA 4PHTX 4DV7K 4BRMA 1NM1A 3O6WA 2IVNA 2G8HA 1G15A 3ZETA 1NGHA 3CM6A 3KLIA 5FPMA 4IO9L 1SL0A 3ATVA 3P38A 3VGKA 3ATUA 2D4WA 5J2PA 3BZCA 3U8XA 4LFAK 3AARA 1H1VA 1OVYA 5DMRA 3ZSOA 4AM7A 3OJSA 4PUOA 3HYFA 4LF5K 4AHCA 5ADXA 4A2BA 1N8RO 2PYLA 2A40A 3AA4A 3RR7A 2FC0A 4CK3A 4BRPA 4JD2B 3FE1A 3SUNA 2E1ZA 3CYMA 2OPPA 4CGIA 4QOZB 4DG1A 3HPGA 4BRNA 2ITGA 4LH5A 3FZFA 5HL7L 2P1JA 3A8YA 3BDPA 3ITHA 4FWNA 3IFRA 4NB4A 1SQKA 2FLOA 1X9SA 4B1XB 1M90O 3OYJA 4FJIA 3H45C 1GOAA 4BR7A 3VQBA 3K9KA 5F1XA 5KQ8A 4BDZA 3V9XA 3EE8A 4CZHA 4JRPA 5LJVA 5C10A 1NMNA 1SKRA 2YV0X 2E6MA 2HHQA 3D2EB 3S41A 3VQAA 3HOSA 1FXXA 1S1WA 3I8DA 1V4SA 2WC9A 4EZ9A 3H3OB 3TANA 3O1WA 4CJEA 3AVGA 3LDLA 3TSQA 4M3TA 1QQCA 4CGHA 4IKFA 4BRAA 3WUHA 3LDOA 5M1QA 4LC9B 3PV8A 5LL6Z 4MDAA 2DFEA 1QZ6A 3OJUA 3GBTA 4Y1CA 4CFDA 1WSHA 4GKJK 1YAGA 4JS4A 2QXFA 5AQNA 4NCBA 4DTSA 1S22A 1EXQA 3L2VA 3F5TA 5HOOA 2X74A 4IXCA 3SZ2A 1HYZA 3AA5X 5I42A 3K0SA 4DQRA 4JI3K 5C25A 1W97L 2DFFA 4RW6A 3HTVA 4DV6K 1GOBA 1MWKA 3FGUA 4OPHA 3B6PA 4K42A 1NGAA 4MDBA 4NCAA 4KHPK 4O0JA 2JWLA 4CERA 4IOXA 3EL2A 2OZSA 4JLHA 1YIJN 2PYJA 4CBWA 3TSPA 1RTHA 3I0RA 4YOWA 2A1SA 1QS4A 3DYAA 4NLCA 4B8CA 3KD1E 3O9UA 5FROA 1TK5A 1DKGD 3OY9A 1HMVA 2QW9A 2DTUA 4O44A 4BROA 3UKUB 3CG7A 3M8SA 4HVJA 4CBXA 1BI4A 3NAEA 4FW1A 2BGGA 3D7EO 3ZSWA 1YJWN 2O8DB 4PA1A 3IG1A 2ASPA 5AFUA 2YHAA 2QM1A 4BR4A 5IT9O 3MCAB 4QS9A 3IKMA 3ZSRA 4QCLA 3DLRA 1NKCA 2VCPA 4UQGA 4DWIA 2D0CA 4DSKA 4BG8A 4LH4A 4DFPA 2OYQA 3L4IA 4BWMA 2UXBK 1S5JA 3GDQA 4FM0A 4ILJA 1RT1A 3DLBA 1HNWK 5AQZA 4O5BA 2KTQA 1SV5A 3LZIA 4K41A 1GLEG 2BANA 3UKRA 5C2FA 4W5NA 1E4GT 2E88A 4JK7A 1KCFA 4CGJA 3KK3A 1VQ5N 4B9VA 3THYB 3AVBA 4H0VB 4DV3K 2YNFA 2A42A 1NGDA 3CHWA 3NGYA 3P83D 3EYZA 1Z6RA 3HSTB 3K59A 4BC4A 4K0KK 4IDKA 3GOIA 3OYDA 1VAZA 3KVGA 4YOUA 1CLQA 4CJVA 1WOQA 4CJQA 4FJ9A 2WFBA 1NGEA 3KK7A 4FWQA 4NCGA 1ZXOA 3QO9A 3VEYA 1A5XA 3FZHA 3VF2A 5J2NA 1BO5O 2GX9A 2QI2A 1VSEA 1J6ZA 4JI6K 3T1YK 2PFUA 1WSIA 1BCMA 3TAMA 2Q2RA 4CHYA 3NE6A 4O8UA 5HRPA 5GAEP 4DQIA 3RRGA 4BY9C 3AVJA 1T05A 1OH7A 1TAUA 3RVCA 1IKWA 3RMCA 1HR0K 1KSPA 3K2PA 3NFAA 4CIGA 3JS6A 4CGDA 2G8FA 3VF4A 3THXA 5JS2A 4Y0WA 1NBWA 3DLKA 4C8OA 3OVNA 4I7FA 1ASWA 2VG6A 5LMNK 3THWA 4IEEA 4DR4K 5AZJB 4H0TB 3CCEN 3LAMA 3DLEA 4OLBA 4JKHA 1CXQA 3DOKA 3ALYA 1HNVA 1VSDA 5AQHA 4DF4A 4CHZA 3M6GA 4I6MA 5HRNA 3OYEA 5ELZA 3MECA 3IRXA 2Q3SA 2NRHA 3KWIA 1K8AO 4FPBA 5HBMA 4XEIA 3DXMB 2YKMA 2ZE2A 3ULDA 3VOVA 4CJUA 2IOCA 3GE1A 1N33K 1VQNN 4AHSA 1BUPA 1K8KB 4DUYK 2PZSA 4CEZA 1EWQA 3VEWA 3MN5A 4JK9A 3QEPA 1R0AA 3NF8A 3SQ1A 1W7AA 2P9KA 4CFBA 2DFHA 1S1VA 3OBWA 3MDQA 4FYDA 1EQYA 2CGJA 4A2AA 4CZLA 5CHIA 1JXBA 3UIQA 2NLXA 3LDQA 4BWJA 3L6QA 1Y97A 1C0GA 4DV5K 5AQXA 4E89A 2P9LB 3VQDA 5AQJA 2P9PA 2P9IB 1YUWA 4BRIA 1QQMA 1KAXA 5EU7A 3R6MA 3TWHA 1ZYQA 4PL7A 1SL2A 3VA3A 3V81A 1TKXA 1JCFA 3O3FA 4WFAL 4BACA 4KH6A 4OO1J 4FCYA 3CD6N 4IFYA 1FK9A 3SV3A 4BVOA 4AH9A 3BP8A 3C6HA 3SPZA 3B8AX 4F4KA 4PWDA 3NGZA 4EIAA 5C12A 4M3YA 5DK5A 1EETA 4FWKA 3CJBA 3Q7BA 4J8FA 5KRTA 3OYKA 3E9OA 5LJWA 3CERA 1XUPO 4DS4A 4FOIA 1DT9A 1X9JA 3ZSQA 2RHKA 3AVIA 3OHRA 4DLEA 2P9SB 1JLGA 4M3XA 3R8EA 3IUCA 5AQVA 4FK2A 2HNZA 1NJYA 1JCEA 4FK4A 3SK3A 4O8KA 3C6TA 3T19A 4LF8K 3D2EA 3HM9A 3TI0A 1BU6O 1QQNA 3PO4A 4B3OA 4I2PA 3QEXA 2V52B 5MLCQ 4B3TK 3SUQA 3CJ9A 2D0BA 1NJIO 3W3DA 4KI4A 1RT6A 3I0SA 3W0LA 3DLGA 4Z4CA 1J54A 4X64K 3DJCA 1WNSA 4RCHA 1BISA 2F9TA 3KHYA 4DLGA 2I7NA 3CMAN 5FPNA 3MXMA 4NYFA 1ZBLA 4X65K 4CZEA 3AVLA 5TKWA 2O8FB 4LSNA 4E7KA 1XNRK 5BPLA 1RTJA 4BRCA 3IS9A 1S6QA 5KRSA 3CC4N 4HTLA 4XH4A 2D0OA 3AVHA 4DTPA 4GY2B 5TKYA 1HKCA 4FJ8A 1U6ZA 3ID6A 1ASUA 4CF1A 3ULEB 5AQIA 5BRHA 1RBRA 4CD1A 4CZMA 1BHLA 2XY7A 2HBMA 3WXLA 3WNGA 4FWLA 5CZ2A 3AO5A 3R3LA 1RGIA 2E2QA 3VF6A 1HNXK 5BN9A 1J53A 3UKUA 4AILC 2GUIA 3A0IX 1RILA 1NGGA 3ZCMA 4CGGA 3OYCA 3A5OC 2HHWA 2O8DA 3BZKA 3ENOA 3ZX2A 1XWLA 2O8EA 3AVCA 2IIRA 3KZBA 3O4NA 4ILHA 3SUPA 3PSIA 4MFBA 3ENHA 2A1RA 3CCMN 4BC2A 3O3GA 1KFSA 1WUAA 3QETA 2O8CB 3CQXA 2QKKA 3DXKB 1L3UA 4CEBA 3WQUA 4YY3K 3NH0A 3HVRA 3H6EA 4B1ZA 2P5GA 2FF6A 4B8AB 1NNEA 1VSFA 1ILYA 3VEXA 4DTUA 5CE3A 1KLMA 3C95A 1U47A 1U04A 5M1OA 1JXEA 4AHUA 2HW3A 4RW9A 4B3RK 4LF6K 3TAEA 3THYA 2HHTA 1TUYA 1W0HA 2DPNA 5AJ3K 4DTOA 1YITN 2YHWA 3SCXA 3CPWM 4EHUA 4H4OA 5I9EB 4Z94A 1ZBFA 5BRFA 4BQZA 2A6AA 4ZTFA 3V6DA 4H5NA 1TK8A 4Z4EA 4JKEA 1B92A 2O4GA 4L3QA 1RT2A 4CJ4A 3BEXA 1B9FA 1HYVA 2ASMA 4NXMK 3VQ9A 4JKGA 5SZTA 4M3WA 4DF8A 3SPYA 4CF2A 5AQPA 2ASOA 3O5BA 2XRIA 4C23A 5GIPA 3L2UA 4E1MA 1BDGA 4H8KA 4HCBA 2YNGA 5JLHA 2IAJA 2QWQA 4BREA 3AA3A 1KRPA 4FJNA 3I8BA 4FJLA 1WN7A 3D2FB 3R1XA 3G4SN 4CZJA 2B5JA 1GLBG 2YCHA 3AO2A 4ELTA 1RDCA 4YDUC 1P90A 1Y64A 3ISNC 3CIPA 4KB1A 3WNFA 1C6VA 3CM5A 3UE5A 5LY3A 1T7PA 2ZWHA 1OH8A 4HUGA 3KLEA 1HJRA 3CJ7A 4K8XA 3CFOA 2FSNA 2J4RA 4EAHD 3AA2A 1HX1A 4F8RA 1UAXA 5AZJA 3TTFA 5CY4A 4FWSA 2IS3A 1KQSM 5FPEA 1N36K 2UUAK 5C15A 4ISFA 1ZBHA 3VA0A 1VSJA 1NGCA 4IG3A 3PIPL 5E41A 3DAWA 3VPZA 2OCEA 4JYAK 3RWUA 2GWJA 2X6NA 4ZTJA 2QK9A 3DXMA 4GV3A 3A5NC 2VWBA 4MO4A 3CFRA 2HHSA 2OPQA 1OKJA 3E01A 2NRZA 1Q81O 1Q9XA 1K8KA 3G10A 4DR7K 4PL8A 4KHNA 5HRSA 3SQ0A 4OGCA 3KD5E 3HM8A 3HXMA 3K57A 3I33A 4DTNA 4WF9L 4DTMA 5C24A 3NGIA 3LPTA 2BE2A 4GW6A 3KWGA 4KH4A 1MWMA 2V7YA 4CD3A 3MX2A 4C8MA 3N4PA 4DR6K 1U2VB 1E4FT 1NKEA 4BRGA 3DRRA 2E4LA 1HNIA 2JWKA 2P9LA 3WXKA 5GAGP 1ESVA 1IG8A 2P9IA 3J81O 3K5OA 4IWVA 3K5MA 4M42A 3EY1A 4R5PA 3MCPA 3TAGA 4CEAA 4FWOA 2ZJRL 3O9QA 4B1YB 3MN7A 4V19S 4GV6A 1RTDA 4FJ7A 4WQ5C 1Q7YO 4DSJA 3L4QA 3LP1A 4IDHA 3H08A 3VQEA 3OA9A 3NMUA 4DTXA 3A2FA 5AQSA 2D5RA 4E7JA 1WB9A 4FJXA 5KTQA 1TL3A 4CJWA 2GELA 3LANA 2NRWA 1CZBA 3H3NO 3O9TA 3ZT4A 4FVMA 3O9RA 3T69A 4DV0K 3CCVN 3E9LA 4JN4A 3L8BA 4N76A 3N4QA 4B9SA 1TAQA 4BR2A 1D4XA 3LPUA 2W40A 3CFPA 4WQ4A 5SWMA 4LY7A 3PX4A 4I2QA 2CH6A 4G9ZA 4JKDA 3DWLA 4KI6A 2X78A 3QIPA 1TYQB 4OLAA 5JLFA 4CGFA 3VGMA 5LMUK 2FBTA 1C0UA 4OKEA 3HSCA 3KK2A 3M5RA 1TGOA 3MAQA 2G8KA 4H0PA 1NKBA 3JYTA 2NRXA 3C7NA 3IAYA 4M41A 1HLUA 1Q9YA 2HB5A 1C1AA 4Z4FA 2YI1A 3EN9A 3KKRA 3RSEB 4EP4A 4DFKA 4DUZK 1SKWA 3MXJA 1XQSC 2UU9K 2YHBA 1ASVA 1T03A 1VQ8N 5HLFA 1RT5A 2QTDA 1ZBIA 1RBTA 3V1RA 2F9WA 3OYHA 4MLHA 3AVMA 2X6SA 1CZ9A 4JKBA 3U9DA 5K14A 2O8FA 3V1QA 5KI6A 4M7XA 1L3TA 1HQEA 3C6UA 1E3MA 1XMOK 3O4QA 2UXCK 4Z4GA 3VQ5A 3D45A 4KHSA 3MN9A 3SJHA 4DS5A 2XY5A 5M1FA 4O4GA 2QWNA 5F0XA 2P9NB 4DSFA 2AJQA 5GIOA 3PY8A 3ZLJA 3F9KA 1QSYA 2A5XA 2OANA 3FR0A 2JGUA 3U3GA 1I3AA 1O1WA 3KLFA 1MA9B 2QWRA 4B1UB 3ZEUB 3O9SA 4DFJA 3DLHA 2LSNA 2PY5A 3OTOK 3VQCA 4M63C 3SBTA 1NGIA 1S1TA 3V9UA 3TABA 2IVOA 1O13A 1SZ2A 1LAWA 1XC9A 3KJVA 3V9SA 3NBPA 2CH5A 1HKBA 3KLGA 5CYMA 5CR4A 3S9HA 4AM6A 4E3SA 4LFBK 4C1NI 4CF8A 4BRKA 3LALA 3QINA 4CFCA 4KFBA 1V4TA 5GADP 2HHXA 5BPNA 4FO0A 2O8CA 4CJRA 4KHUA 1F21A 1XC3A 3FFKB 4N56A 1RT4A 4F2SA 4GNIA 1SL1A 1LW2A 5KPRA 2P9UA 3HL8A 1WAFA 1BQMA 3FZLA 3AO4A 2BH1A 4AHRA 1DTTA 4GVMA 3ZSZA 4BRDA 3QLHA 4QS7A 1VQPN 2ZGZA 2ATQA 1NK6A 3G6EN 1BQNA 3Q7CA 2VQFK 3SJJA 2NZTA 2YJEA 4CVNE 4FJMA 1W9HA 2QKBA 3NVMA 3TU5A 5KGWA 2O4IA 3AV9A 3V1OA 1IKVA 3T1AA 4B08A 1DEJA 4LF9K 5AQFA 3I56N 3SQ2A 2I5JA 1P8ZA 2CGKA 3WXMB 3ZETB 1XMQK 3LP0A 2R7YA 3AO1A 4O5FA 2OPSA 3AVFA 4GVEA 1J9AA 4NYNA 4WFNL 4LF7K 1C1BA 4H0OA 5BN8A 3CXCM 3RR8A 4LD0A 3LDSA 3D0PA 4DSIA 1MU2A 3D2FA 3M8QA 4CF9A 4Y1DA 4BVPA 1Z26A 4KPYA 1JLEA 2KFZA 3VETA 4A61A 4OKKA 2G8IA 3V4IA 3SBGA 4I9LA 5CYQA 4BE2A 3P4IA 3U6FA 2UUCK 3P31A 1RT7A 5JVHL 3R9PA 2IVPA 1RCHA 2YX6A 2YNHA 3O08A 4DV4K 4FJHA 5KPTA 2HSTA 4W5RA 3MXIA 3CCLN 3H46O 1VQ4N 3G71N 4DV2K 4JKFA 1ZBSA 2QWPA 4M3ZA 2EHGA 4JD2A 4B9LA 1QVGM 1UOCA 3WT0A 1UA1A 3GG4A 4ICLA 1K6YA 2A41A 4RWTA 1BGXT 3OBYA 4JRQA 1XNQK 3CJAA 4X66K 1NMDA 4CHOA 1RTIA 3C6AA 3V9ZA 4B9UA 3EE9A 5J2MA 3SI6A 2KZMA 3BGRA 4CJTA 1YJNN 1KFDA 4JI4K 1HPMA 1SS6A 2HVIA 4BC5A 5D3GA 3NDKA 2KW4A 1FW6A 1TV6A 2KZZA 4GV9A 4QS8A 4OX9K 3L2QA 3BF1A 3QBWA 1IG9A 3BY5A 2VG7A 4DR3K 2WBNA 1S9GA 4YDUA 1OH6A 1WAJA 2V51B 3G0ZA 1VRUA 4EP5A 2V7ZA 3EKSA 4YFUA 2EX3A 2OA8A 1QTMA 4JAXA 2HF3A 3E1YA 1JLCA 4JKCA 4E1NA 5GAHP 3J7ZO 4DHYA 4B1WB 1FKOA 1Z25A 2F8SA 1RBUA 3K58A 3QNOA 4UY8O 1EP4A 2G8VA 3U3YA 3L3VA 4IOCL 2GEMA 1DGKN 1QSSA 5BR9A 1S3XA 1KD1O 2Y1JA 2F8TA 1D5AA 4Z0UA 4CEFA 1IH7A 2Z1JA 2D1KA 4A62A 3NF9A 3MMVA 3JXUA 2VGMA 4KRFA 1EO1A 4ELUA 1VSHA 1BI4B 4OPKA 1Q82O 4H5VA 4YOVA 1XHZA 4FLZA 4E7HA 4HCCA 4JI1K 3VQPA 3ZYYX 3E9PA 4JI7K 4CIEA 4CECA 1TYQA 4OVLA 5DM6L 4IFEA 3FLCO 5FRNA 1Q8IA 4FLYA 3ZT1A 1U4BA 1XHXA 4KAZA 3T3FA 4NXNK 1JLBA 2Z1HA 3TAQA 2FBVA 3MK6A 4E19A 1MDUB 2HBLA 1RNHA 2E20A 4JHDB 5M1KA 3HI0A 1U49A 1BCOA 1EX4A 4KTZA 2Q0RA 3P39A 3I55N 1J5OA 3ZT3A 2RKIA 3UKRB 3O80A 4K25A 4B3SK 1GLDG 1IV0A 1VQ9N 1NOYA 4DCHA 2NRTA 4JEPA 4JK8A 1L3SA 2QWOA 1NK0A 3DRPA 4CK2A 4CEOA 3S3OA 4M7YA 4XH1A 4YOTA 1BL3A 4DSEA 1HQUA 5C0YA 1NLVA 4YORA 5H1SQ 2RE2A 2YJFA 1N5YA 4FZXC 2P9NA 4ISGA 1VK0A 3QERA 1NK8A 3WEEB 1VSIA 1RBSA 2FXUA 2KHOA 3LWMA 2ZM6K 4DU1A 3WQTA 3FZMA 1KVCA 2GBZA 3HVTA 3CQ8A 2OTJN 3AGKA 3L2WA 1DLOA 4CZKA 4BQLA 1Z05A 4KBOA 4IO8A 4FK0A 3PUFA 1YF5L 1D8YA 1TKTA 2QXLA 3ZEUA 3QFPA 1K73O 3ZT2A 3VQ8A 3U4LA 3QMLA 3DMJA 3M1FA 4DMNA 3T1HK 3RMDA 3SUOA 3O4WA 1NK7A 2WOMA 1TL1A 4NLBA 4HTUA 1LAVA 4BR5A 4YHHK 3NH2A 2D0AA 4OGEA 3B6OA 2CGLA 1HPZA 1C0FA 4C8KA 3TTCA 1ITGA 4DKWA 4ILGB 5EVZA 4J2BA 1Q86O 2YNIA 4M3RA 2E2OA 4CJ7A 3SV4A 1GLCG 3AY9A 3THWB 4ISEA 2W6KA 1GLJO 4WFBL 4LSLA 3KLHA 1NJWA 2KKZA 2IDOA 5KGXA 3AVAA 5M1PA 4H0XB 4JI8K 3V9WA 3TAPA 4CEQA 3J7AP 5A2QO 3IDHA 3DOLA 2GTDA 3CMEN 4O0IA 2BTFA 3QEIA 1NK4A 1S6PA 3PIOL 3QEVA 1RDAA 3AAQA 4IG0A 5IWAK 2P51A 4AQYK 4U67L 4AF1A 2HF4A 4PQUA 1N34K 1S1XA 5AQQA 1HJOA 3PX6A 4K8ZA 1GLLO 3CCJN 3HK2A 1NGJA 4FL9A 1QZ5A 1JLQA 3HP9A 1BG3A 3A5MC 2E2NA 4CHNA 4CCHA 4A59A 3CI5A 2ZGYA 1YXQA 1S9EA 5F2RA 2E1YA 3VENA 1A5VA 1T8EA 5HRRA 3ZSVA 1JJ2M 3HRGA 4W5QA 2P9PB 2XY8A 3EZWA 4OJRA 1QHAA 2HBKA 3H1QA 1VSLA 3WNHA 3M8RA 4BRFA 5ADXH 5AQLA 3MEGA 4CJ5A 2G8UA 1OVQA 4QAGA 4JI2K 3CCRN 2OTLN 4Q5VA 1NG9A 4X62K 5GINA 5I3UA 4IZ9A 4PKHA 2P5OA 5BREA 1KLNA 1FJGK 4LF4K 3VQ6A 3P1GA 3VEOA 1WSEA 4KTQA 4DU3A 4IFVA 3TR8A 5JS1A 5KPZA 4CEDA 3CJCA 1JKHA 4RW8A 1D9DA 3BF3A 4MLEA 1HRHA 3RMBA 1NGBA 2A3ZA 2AA4A 1C0TA 1X1PA 4F9OA 4CZFA 2E5LK 2PAVA 4JNEA 2QWLA 1NK9A 3SYZA 2XY6A 1RDWX 1QE1A 4KHYA 2XO7A 5E26A 5J2QA 2VQEK 3LZJA
chains in the Genus database with same CATH topology
4DS4A 4WE1A 1NK5A 3ZSQA 4CJRA 1XI1A 4KHUA 1F21A 1S1UA 1WSFA 3AVIA 4N56A 1RT4A 4DLEA 1EKEA 4F2SA 3WNEA 1JLGA 1QHTA 3NHGA 3VQ4A 4M3XA 3L3UA 1SL1A 2RF2A 4KTWA 1LW2A 4F3TA 1L3VA 3HL8A 1WAFA 1BQMA 4JS5A 4FK2A 2HNZA 3AO4A 1NJYA 3LAKA 2VG5A 4FZZA 4FK4A 3QIOA 3OYMA 4AHTA 4CESA 4AHRA 3C6TA 1DTTA 3T19A 4GVMA 4EZ6A 3ZSZA 2OPRA 3QESA 3QLHA 1X9MA 3HM9A 1NJXA 2XY6A 4CIFA 3TI0A 3PO5A 4I9QA 1DTQA 3PO4A 1NK6A 2ATQA 4B3OA 4I2PA 1BQNA 4FM2A 3QEXA 3DI6A 3SJJA 1NOZA 3OS2A 3ZSXA 3SUQA 4FLUA 1X9WA 4KV8A 2ZQBA 4HUFA 2D0BA 4N5SA 3L2RA 4M45A 1W9HA 3KTQA 4FJMA 4BE0A 1WSGA 4KI4A 2QKBA 1RT6A 1VSKA 5KGWA 2O4IA 2HVHA 3I0SA 4CJSA 3AV9A 3DLGA 3V1OA 4Z4CA 1IKVA 3SNNA 1J54A 1WNSA 3T1AA 5HP1A 4B08A 5T7BA 4OKJA 4RG8A 3LWLA 1BISA 1KTQA 3SQ2A 4FLTA 2I5JA 4DLGA 3MXMA 1YTAA 1SUQA 4NYFA 3S3NA 1ZBLA 5J1EA 2HMIA 1C1CA 3LP0A 2R7YA 3AO1A 1IKYA 3LP2A 3AVLA 4W5TA 3HPOA 4BDPA 4DSLA 1I39A 3HPHA 3OYAA 3QNNA 4M3UA 4DTRA 4CJKA 2OPSA 3AVFA 4BE1A 3SQ4A 1J9AA 3DRSA 3ASMA 4LSNA 4NYNA 1C1BA 2F96A 4E7KA 1RDDA 4KHQA 1RTJA 3RR8A 4LD0A 2G8HA 1G15A 3LDSA 3D0PA 3CM6A 3KLIA 4DSIA 3IS9A 1S6QA 5KRSA 3MEDA 1SL0A 1MU2A 3M8QA 4CF9A 4Y1DA 3AVHA 2RN2A 5J2PA 1Z26A 4DTPA 4KO0A 4KPYA 1JLEA 1LWCA 2HNDA 2KFZA 4OKKA 1TKDA 3V4IA 2G8IA 4FJ8A 4I9LA 5DMRA 3ZSOA 3OJSA 5CYQA 4FJKA 4PUOA 4BE2A 3KKSA 3HYFA 4OPJA 4CE9A 1ASUA 3NH1A 4CF1A 4AHCA 3U6FA 1RT7A 1RBRA 2PYLA 2YKNA 3AA4A 3RR7A 2B4JA 2FC0A 1D9FA 2Y1IA 1BHLA 4CK3A 2XY7A 1GOCA 3WNGA 3SUNA 1BIUA 1RCHA 3AO5A 3CYMA 2OPPA 3MEEA 5CZ2A 4CGIA 2YNHA 1LWEA 3OYGA 1BIZA 4QOZB 1J53A 3M8PA 3HPGA 4DG1A 4AILC 4FJHA 4W5RA 3MXIA 2GUIA 2ITGA 1RILA 4LH5A 3ZCMA 2P1JA 1YT3A 4CGGA 3OYCA 5FRMA 3FFIA 2HHWA 1WLJA 4DU4A 3BDPA 4M3ZA 1XWLA 3ITHA 2EHGA 4N47A 4B9LA 3AVCA 3O4NA 2VWKA 3SUPA 1UOCA 4MFBA 2VWJA 1UA1A 4ICLA 1TKZA 1LV5A 2KQ2A 2A1RA 4KKOA 4RW4A 1X9SA 3O3GA 1KFSA 1K6YA 5CZ1A 1BGXT 3OYJA 4FJIA 3QETA 4E7IA 4JRQA 1GOAA 2HHVA 3VQBA 4CJ3A 2QKKA 4CHOA 1RTIA 1L3UA 4CEBA 3V9ZA 4Z4HA 3NH0A 4B9UA 5J2MA 3HVRA 3SI6A 4G1QA 1LWFA 4KB0A 2KZMA 3BGRA 4BDZA 4CJTA 3V9XA 2P5GA 1KFDA 2RPIA 1JL2A 4B8AB 1VSFA 4FLXA 4DTUA 4JRPA 3PX0A 2HVIA 1KLMA 3C95A 1U47A 1U04A 2ZD1A 1JXEA 4AHUA 5D3GA 3AO3A 3NDKA 2YV0X 1SKRA 2HW3A 2KW4A 4RW9A 2E6MA 1TV6A 2HHQA 3TAEA 2KZZA 3VQAA 2HHTA 1FXXA 1S1WA 3I8DA 3L2QA 1W0HA 4DTOA 1IG9A 4EZ9A 2VG7A 3SCXA 3TANA 1S9GA 4H4OA 1WAJA 3G0ZA 4CJEA 1VRUA 3AVNA 1ZBFA 1REVA 2IGIA 3AVGA 4EP5A 4M3TA 1QQCA 4CGHA 3P5JA 4IKFA 4YFUA 2DY4A 2EX3A 4MQ3A 4ZTFA 2OA8A 1QTMA 3V6DA 1JLCA 1TK8A 4E1NA 4O55A 2IC3A 4Z4EA 3PV8A 1B92A 2DFEA 2O4GA 1UA0A 4F2RA 3HT3A 3OJUA 1RT2A 4CJ4A 1B9FA 1HYVA 3VQ9A 1FKOA 4Y1CA 4FLWA 5SZTA 4M3WA 4CFDA 1Z25A 2F8SA 3HP6A 1C0MA 1RBUA 1WSHA 4DF8A 3K58A 4JS4A 1YVUA 3SPYA 1FKPA 4CF2A 3QNOA 4Q0BA 2QXFA 4NCBA 4DTSA 1EXQA 1EP4A 2G8VA 3L2VA 2XRIA 1CXUA 3L2UA 3U3YA 4E1MA 4H8KA 3L3VA 2X74A 1WSJA 3SZ2A 4HCBA 1HYZA 3AA5X 5I42A 2YNGA 4DQRA 2IAJA 5C25A 3AA3A 2DFFA 4RW6A 1QSSA 1KRPA 4FJNA 2Y1JA 4FJLA 1GOBA 1WN7A 4KHWA 2F8TA 1D5AA 4Z0UA 4CEFA 3B6PA 2B5JA 1IH7A 3DM2A 2Z1JA 3AO2A 4HUEA 4FLVA 2KFNA 4ELTA 3NF9A 1RDCA 4NCAA 1JLFA 4W5OA 4O0JA 4KRFA 2FBYA 3VN5A 4CERA 4B9NA 4ELUA 3ISNC 2OZSA 4JLHA 1VSHA 3WNFA 1BI4B 1C6VA 3CM5A 4YNQA 4OPKA 2PYJA 4KB1A 1RTHA 2ETJA 3I0RA 1XHZA 1T7PA 1A5WA 4RW7A 4FLZA 4E7HA 4HUGA 4HCCA 3KLEA 3VQPA 1HJRA 2A1SA 4CIEA 2HHUA 4CECA 1QS4A 4OVLA 4CFAA 3DYAA 2JLEA 4B8CA 3KD1E 3RTVA 1L5UA 3CFOA 3KIOA 5FROA 1TK5A 3OY9A 5FRNA 1HMVA 3AA2A 1Q8IA 4FLYA 2DTUA 3ZT1A 4O44A 1U4BA 1XHXA 4KAZA 3T3FA 3CG7A 3M8SA 5HROA 4HVJA 4PY5A 1JLBA 1L3TA 4F8RA 1BI4A 1UAXA 3NAEA 2Z1HA 1LW0A 4FW1A 4DTJA 3TAQA 2BGGA 2FBVA 3ZSWA 5CY4A 2IS3A 4PA1A 3IG1A 4E19A 2E6LA 2Z1IA 2YHAA 1ZBHA 1RNHA 3VA0A 2G8WA 1VSJA 3ZSRA 4QCLA 4IG3A 3DLRA 1U49A 1NKCA 5E41A 4UQGA 1BCOA 3JSMA 4DWIA 2D0CA 1EX4A 4DSKA 4KTZA 4LH4A 3RWUA 2X6NA 4ZTJA 1J5OA 3ZT3A 4DFPA 3RRHA 2OYQA 2QK9A 2RKIA 4BWMA 4ID5A 1S5JA 1B9DA 3CFRA 4E7LA 2HHSA 1NOYA 2OPQA 4FM0A 1KVAA 3E01A 1Q9XA 1TK0A 1RT1A 3DLBA 3G10A 1L3SA 1NK0A 4J2AA 3DRPA 4CK2A 4BDYA 4KHNA 4CEOA 5HRSA 3SQ0A 4O5BA 3S3OA 4OGCA 3KD5E 2KTQA 3F73A 1SV5A 3HXMA 3LZIA 4C8LA 3K57A 1BL3A 2BANA 4DTNA 4DTMA 5C24A 3NGIA 4C8NA 4DQSA 4FXDA 1TVRA 3LPTA 1KCFA 4W5NA 4DSEA 1HQUA 4CHPA 2BE2A 4CGJA 3VQQA 3OYIA 4GW6A 3KK3A 3QEWA 4B9VA 3AVBA 4C8MA 2NUBA 3ZT0A 2YNFA 1NKEA 1N5YA 4FZXC 3QERA 1VK0A 3DRRA 2E4LA 1NK8A 1HNIA 3NGYA 3P83D 1VSIA 3KK1A 3EYZA 1RBSA 1SKSA 3HSTB 3K59A 4FJ5A 3LWMA 4DU1A 4J2DA 4IDKA 3OYDA 3K5OA 1KVCA 5C42A 2GBZA 3HVTA 3K5MA 3EY1A 3CQ8A 4R5PA 4M42A 3L2WA 1DLOA 3TAGA 1CLQA 4CEAA 4CJQA 4CJVA 4FJ9A 4CF0A 4FK0A 3PUFA 1VRTA 1D8YA 4NCGA 1TKTA 3QO9A 1RTDA 1A5XA 4FJ7A 4DSJA 3ZT2A 3VQ8A 3LP1A 3C94A 5J2NA 3DMJA 4KREA 3SUOA 4DMNA 2GV9A 3RMDA 3H08A 3VQEA 1NK7A 1QSLA 1VSEA 2WOMA 3THVA 4DTXA 1TL1A 3A2FA 2D5RA 4HTUA 4E7JA 1LAVA 3NH2A 4TSXA 4FJXA 5KTQA 2D0AA 1TL3A 1WSIA 1BCMA 4OGEA 3TAMA 4CJWA 3B6OA 4CHYA 3S3MA 3NE6A 4Z4IA 1HPZA 5HRPA 4FJGA 3LANA 4N41A 1CZBA 4C8KA 1ITGA 4DQIA 1IO2A 3VQ7A 3ZT4A 4FVMA 4XIUA 4J2BA 3RRGA 4FM1A 3O3HA 4J2EA 3AVJA 1RT3A 3TARA 1T05A 2YNIA 3L8BA 1TAUA 1IKWA 3RMAA 4M3RA 3SV4A 3RMCA 1KSPA 2B6AA 3TAFA 4N76A 1IKXA 4B9SA 1TAQA 3LPUA 3ZSYA 3K2PA 3NFAA 4CIGA 3CFPA 4CGDA 5SWMA 2G8FA 4LSLA 4LY7A 3KLHA 3PX4A 4I2QA 5JS2A 2WONA 1NJWA 3DLKA 1HYSA 4C8OA 2IDOA 5KGXA 2XHBA 3AVAA 4KI6A 2X78A 3QIPA 4OLAA 4CGFA 3OVNA 4IBNA 4I7FA 1ASWA 2VG6A 4ZHRA 3V9WA 2FBTA 1C0UA 3TAPA 4FJJA 4OKEA 3KK2A 4CEQA 1TGOA 3MAQA 1ZBUA 2G8KA 1RDBA 3DOLA 1NKBA 1T8EA 3LAMA 3DLEA 3JYTA 3EZ5A 4O0IA 4M41A 3IAYA 4OLBA 1Q9YA 2HB5A 1CXQA 3QEIA 1C1AA 3DOKA 1S6PA 3ALYA 4GMJB 3K5LA 1NK4A 4Z4FA 3QEVA 1HNVA 1RDAA 1UWBA 1VSDA 3KKRA 2P51A 4IG0A 4EP4A 4CHZA 4DF4A 4CJPA 4PQUA 4DFKA 1U48A 1SKWA 1NJZA 5HRNA 4F3OA 3OYEA 1S1XA 3MECA 3MXJA 3IRXA 2Q3SA 3NF7A 3PX6A 5HBMA 4K8ZA 2YKMA 2YHBA 3HK2A 3OS0A 1ASVA 1T03A 2ZE2A 3ULDA 1JLQA 1RT5A 4CJUA 5HLFA 1ZBIA 1RBTA 1JLAA 2IOCA 3HP9A 3V1RA 3OYNA 3OYHA 3AVMA 4AHSA 4CHNA 2X6SA 2PZSA 2W42A 1CZ9A 4CEZA 4CCHA 3HO1A 1R0AA 3QEPA 3NF8A 3SQ1A 4K8XA 5K14A 3V1QA 1S9EA 5KI6A 4FW2A 4CFBA 1A5VA 2HNYA 5HRRA 3ZSVA 2DFHA 1HQEA 3C6UA 3K5NA 3LP3A 4DQQA 4W5QA 3O4QA 2XY8A 1S1VA 4Z4GA 1VSMA 4OJRA 3AVKA 3VQ5A 3D45A 4FYDA 4KHSA 4DS5A 2XY5A 1VSLA 3WNHA 1JXBA 4O4GA 3M8RA 3UIQA 4ID1A 4BWJA 4DSFA 2AJQA 3PY8A 1Y97A 4AHVA 4H4MA 4B9MA 3MEGA 4CJ5A 2G8UA 4E89A 3F9KA 3VQDA 2FBXA 4QAGA 2OZMA 1QSYA 1YTUA 4Q5VA 4E0DA 4DFMA 2JGUA 3U3GA 5EU7A 5I3UA 2P5OA 1I3AA 1O1WA 3TWHA 1ZYQA 4CEEA 3KLFA 1JL1A 1KLNA 4B9TA 1SL2A 3OYLA 3VQ6A 3VA3A 1TKXA 3V81A 3P1GA 3O3FA 4HHTA 4BACA 2BDPA 3OS1A 4FCYA 4DFJA 3NF6A 4IFYA 2LSNA 3DLHA 2PY5A 1FK9A 1WSEA 3VQCA 4DQPA 4DU3A 4IFVA 3TR8A 1N6QA 4KTQA 5JS1A 4CEDA 3SV3A 1KVBA 1S1TA 3NCIA 1U45A 1JKHA 4RW8A 4AH9A 3V9UA 3TABA 1D9DA 1LAWA 1XC9A 1HRHA 3RMBA 3KJVA 3V9SA 3SPZA 4F4KA 1RBVA 3NBPA 4PWDA 1C0TA 3NGZA 1X1PA 3KLGA 3HJFA 5CYMA 4M3YA 5DK5A 4L8RB 1EETA 3S9HA 4E3SA 3OYFA 4CF8A 3LALA 4CJFA 1NK9A 3QINA 4CFCA 4KFBA 5KRTA 3OYKA 1QE1A 4CHQA 3OYBA 3SYZA 2Z1GA 4KHYA 2XO7A 4FZYA 2HHXA 4CK1A 5J2QA 4ELVA 5FDLA 4CJLA 3LZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DS4 A;  4WE1 A;  1NK5 A;  3ZSQ A;  4CJR A;  1XI1 A;  4KHU A;  1F21 A;  1S1U A;  1WSF A;  3AVI A;  4N56 A;  1RT4 A;  4DLE A;  1EKE A;  4F2S A;  3WNE A;  1JLG A;  1QHT A;  3NHG A;  3VQ4 A;  4M3X A;  3L3U A;  1SL1 A;  2RF2 A;  4KTW A;  1LW2 A;  4F3T A;  1L3V A;  3HL8 A;  1WAF A;  1BQM A;  4JS5 A;  4FK2 A;  2HNZ A;  3AO4 A;  1NJY A;  3LAK A;  2VG5 A;  4FZZ A;  4FK4 A;  3QIO A;  3OYM A;  4AHT A;  4CES A;  4AHR A;  3C6T A;  1DTT A;  3T19 A;  4GVM A;  4EZ6 A;  3ZSZ A;  2OPR A;  3QES A;  3QLH A;  1X9M A;  3HM9 A;  1NJX A;  2XY6 A;  4CIF A;  3TI0 A;  3PO5 A;  4I9Q A;  1DTQ A;  3PO4 A;  1NK6 A;  2ATQ A;  4B3O A;  4I2P A;  1BQN A;  4FM2 A;  3QEX A;  3DI6 A;  3SJJ A;  1NOZ A;  3OS2 A;  3ZSX A;  3SUQ A;  4FLU A;  1X9W A;  4KV8 A;  2ZQB A;  4HUF A;  2D0B A;  4N5S A;  3L2R A;  4M45 A;  1W9H A;  3KTQ A;  4FJM A;  4BE0 A;  1WSG A;  4KI4 A;  2QKB A;  1RT6 A;  1VSK A;  5KGW A;  2O4I A;  2HVH A;  3I0S A;  4CJS A;  3AV9 A;  3DLG A;  3V1O A;  4Z4C A;  1IKV A;  3SNN A;  1J54 A;  1WNS A;  3T1A A;  5HP1 A;  4B08 A;  5T7B A;  4OKJ A;  4RG8 A;  3LWL A;  1BIS A;  1KTQ A;  3SQ2 A;  4FLT A;  2I5J A;  4DLG A;  3MXM A;  1YTA A;  1SUQ A;  4NYF A;  3S3N A;  1ZBL A;  5J1E A;  2HMI A;  1C1C A;  3LP0 A;  2R7Y A;  3AO1 A;  1IKY A;  3LP2 A;  3AVL A;  4W5T A;  3HPO A;  4BDP A;  4DSL A;  1I39 A;  3HPH A;  3OYA A;  3QNN A;  4M3U A;  4DTR A;  4CJK A;  2OPS A;  3AVF A;  4BE1 A;  3SQ4 A;  1J9A A;  3DRS A;  3ASM A;  4LSN A;  4NYN A;  1C1B A;  2F96 A;  4E7K A;  1RDD A;  4KHQ A;  1RTJ A;  3RR8 A;  4LD0 A;  2G8H A;  1G15 A;  3LDS A;  3D0P A;  3CM6 A;  3KLI A;  4DSI A;  3IS9 A;  1S6Q A;  5KRS A;  3MED A;  1SL0 A;  1MU2 A;  3M8Q A;  4CF9 A;  4Y1D A;  3AVH A;  2RN2 A;  5J2P A;  1Z26 A;  4DTP A;  4KO0 A;  4KPY A;  1JLE A;  1LWC A;  2HND A;  2KFZ A;  4OKK A;  1TKD A;  3V4I A;  2G8I A;  4FJ8 A;  4I9L A;  5DMR A;  3ZSO A;  3OJS A;  5CYQ A;  4FJK A;  4PUO A;  4BE2 A;  3KKS A;  3HYF A;  4OPJ A;  4CE9 A;  1ASU A;  3NH1 A;  4CF1 A;  4AHC A;  3U6F A;  1RT7 A;  1RBR A;  2PYL A;  2YKN A;  3AA4 A;  3RR7 A;  2B4J A;  2FC0 A;  1D9F A;  2Y1I A;  1BHL A;  4CK3 A;  2XY7 A;  1GOC A;  3WNG A;  3SUN A;  1BIU A;  1RCH A;  3AO5 A;  3CYM A;  2OPP A;  3MEE A;  5CZ2 A;  4CGI A;  2YNH A;  1LWE A;  3OYG A;  1BIZ A;  4QOZ B;  1J53 A;  3M8P A;  3HPG A;  4DG1 A;  4AIL C;  4FJH A;  4W5R A;  3MXI A;  2GUI A;  2ITG A;  1RIL A;  4LH5 A;  3ZCM A;  2P1J A;  1YT3 A;  4CGG A;  3OYC A;  5FRM A;  3FFI A;  2HHW A;  1WLJ A;  4DU4 A;  3BDP A;  4M3Z A;  1XWL A;  3ITH A;  2EHG A;  4N47 A;  4B9L A;  3AVC A;  3O4N A;  2VWK A;  3SUP A;  1UOC A;  4MFB A;  2VWJ A;  1UA1 A;  4ICL A;  1TKZ A;  1LV5 A;  2KQ2 A;  2A1R A;  4KKO A;  4RW4 A;  1X9S A;  3O3G A;  1KFS A;  1K6Y A;  5CZ1 A;  1BGX T;  3OYJ A;  4FJI A;  3QET A;  4E7I A;  4JRQ A;  1GOA A;  2HHV A;  3VQB A;  4CJ3 A;  2QKK A;  4CHO A;  1RTI A;  1L3U A;  4CEB A;  3V9Z A;  4Z4H A;  3NH0 A;  4B9U A;  5J2M A;  3HVR A;  3SI6 A;  4G1Q A;  1LWF A;  4KB0 A;  2KZM A;  3BGR A;  4BDZ A;  4CJT A;  3V9X A;  2P5G A;  1KFD A;  2RPI A;  1JL2 A;  4B8A B;  1VSF A;  4FLX A;  4DTU A;  4JRP A;  3PX0 A;  2HVI A;  1KLM A;  3C95 A;  1U47 A;  1U04 A;  2ZD1 A;  1JXE A;  4AHU A;  5D3G A;  3AO3 A;  3NDK A;  2YV0 X;  1SKR A;  2HW3 A;  2KW4 A;  4RW9 A;  2E6M A;  1TV6 A;  2HHQ A;  3TAE A;  2KZZ A;  3VQA A;  2HHT A;  1FXX A;  1S1W A;  3I8D A;  3L2Q A;  1W0H A;  4DTO A;  1IG9 A;  4EZ9 A;  2VG7 A;  3SCX A;  3TAN A;  1S9G A;  4H4O A;  1WAJ A;  3G0Z A;  4CJE A;  1VRU A;  3AVN A;  1ZBF A;  1REV A;  2IGI A;  3AVG A;  4EP5 A;  4M3T A;  1QQC A;  4CGH A;  3P5J A;  4IKF A;  4YFU A;  2DY4 A;  2EX3 A;  4MQ3 A;  4ZTF A;  2OA8 A;  1QTM A;  3V6D A;  1JLC A;  1TK8 A;  4E1N A;  4O55 A;  2IC3 A;  4Z4E A;  3PV8 A;  1B92 A;  2DFE A;  2O4G A;  1UA0 A;  4F2R A;  3HT3 A;  3OJU A;  1RT2 A;  4CJ4 A;  1B9F A;  1HYV A;  3VQ9 A;  1FKO A;  4Y1C A;  4FLW A;  5SZT A;  4M3W A;  4CFD A;  1Z25 A;  2F8S A;  3HP6 A;  1C0M A;  1RBU A;  1WSH A;  4DF8 A;  3K58 A;  4JS4 A;  1YVU A;  3SPY A;  1FKP A;  4CF2 A;  3QNO A;  4Q0B A;  2QXF A;  4NCB A;  4DTS A;  1EXQ A;  1EP4 A;  2G8V A;  3L2V A;  2XRI A;  1CXU A;  3L2U A;  3U3Y A;  4E1M A;  4H8K A;  3L3V A;  2X74 A;  1WSJ A;  3SZ2 A;  4HCB A;  1HYZ A;  3AA5 X;  5I42 A;  2YNG A;  4DQR A;  2IAJ A;  5C25 A;  3AA3 A;  2DFF A;  4RW6 A;  1QSS A;  1KRP A;  4FJN A;  2Y1J A;  4FJL A;  1GOB A;  1WN7 A;  4KHW A;  2F8T A;  1D5A A;  4Z0U A;  4CEF A;  3B6P A;  2B5J A;  1IH7 A;  3DM2 A;  2Z1J A;  3AO2 A;  4HUE A;  4FLV A;  2KFN A;  4ELT A;  3NF9 A;  1RDC A;  4NCA A;  1JLF A;  4W5O A;  4O0J A;  4KRF A;  2FBY A;  3VN5 A;  4CER A;  4B9N A;  4ELU A;  3ISN C;  2OZS A;  4JLH A;  1VSH A;  3WNF A;  1BI4 B;  1C6V A;  3CM5 A;  4YNQ A;  4OPK A;  2PYJ A;  4KB1 A;  1RTH A;  2ETJ A;  3I0R A;  1XHZ A;  1T7P A;  1A5W A;  4RW7 A;  4FLZ A;  4E7H A;  4HUG A;  4HCC A;  3KLE A;  3VQP A;  1HJR A;  2A1S A;  4CIE A;  2HHU A;  4CEC A;  1QS4 A;  4OVL A;  4CFA A;  3DYA A;  2JLE A;  4B8C A;  3KD1 E;  3RTV A;  1L5U A;  3CFO A;  3KIO A;  5FRO A;  1TK5 A;  3OY9 A;  5FRN A;  1HMV A;  3AA2 A;  1Q8I A;  4FLY A;  2DTU A;  3ZT1 A;  4O44 A;  1U4B A;  1XHX A;  4KAZ A;  3T3F A;  3CG7 A;  3M8S A;  5HRO A;  4HVJ A;  4PY5 A;  1JLB A;  1L3T A;  4F8R A;  1BI4 A;  1UAX A;  3NAE A;  2Z1H A;  1LW0 A;  4FW1 A;  4DTJ A;  3TAQ A;  2BGG A;  2FBV A;  3ZSW A;  5CY4 A;  2IS3 A;  4PA1 A;  3IG1 A;  4E19 A;  2E6L A;  2Z1I A;  2YHA A;  1ZBH A;  1RNH A;  3VA0 A;  2G8W A;  1VSJ A;  3ZSR A;  4QCL A;  4IG3 A;  3DLR A;  1U49 A;  1NKC A;  5E41 A;  4UQG A;  1BCO A;  3JSM A;  4DWI A;  2D0C A;  1EX4 A;  4DSK A;  4KTZ A;  4LH4 A;  3RWU A;  2X6N A;  4ZTJ A;  1J5O A;  3ZT3 A;  4DFP A;  3RRH A;  2OYQ A;  2QK9 A;  2RKI A;  4BWM A;  4ID5 A;  1S5J A;  1B9D A;  3CFR A;  4E7L A;  2HHS A;  1NOY A;  2OPQ A;  4FM0 A;  1KVA A;  3E01 A;  1Q9X A;  1TK0 A;  1RT1 A;  3DLB A;  3G10 A;  1L3S A;  1NK0 A;  4J2A A;  3DRP A;  4CK2 A;  4BDY A;  4KHN A;  4CEO A;  5HRS A;  3SQ0 A;  4O5B A;  3S3O A;  4OGC A;  3KD5 E;  2KTQ A;  3F73 A;  1SV5 A;  3HXM A;  3LZI A;  4C8L A;  3K57 A;  1BL3 A;  2BAN A;  4DTN A;  4DTM A;  5C24 A;  3NGI A;  4C8N A;  4DQS A;  4FXD A;  1TVR A;  3LPT A;  1KCF A;  4W5N A;  4DSE A;  1HQU A;  4CHP A;  2BE2 A;  4CGJ A;  3VQQ A;  3OYI A;  4GW6 A;  3KK3 A;  3QEW A;  4B9V A;  3AVB A;  4C8M A;  2NUB A;  3ZT0 A;  2YNF A;  1NKE A;  1N5Y A;  4FZX C;  3QER A;  1VK0 A;  3DRR A;  2E4L A;  1NK8 A;  1HNI A;  3NGY A;  3P83 D;  1VSI A;  3KK1 A;  3EYZ A;  1RBS A;  1SKS A;  3HST B;  3K59 A;  4FJ5 A;  3LWM A;  4DU1 A;  4J2D A;  4IDK A;  3OYD A;  3K5O A;  1KVC A;  5C42 A;  2GBZ A;  3HVT A;  3K5M A;  3EY1 A;  3CQ8 A;  4R5P A;  4M42 A;  3L2W A;  1DLO A;  3TAG A;  1CLQ A;  4CEA A;  4CJQ A;  4CJV A;  4FJ9 A;  4CF0 A;  4FK0 A;  3PUF A;  1VRT A;  1D8Y A;  4NCG A;  1TKT A;  3QO9 A;  1RTD A;  1A5X A;  4FJ7 A;  4DSJ A;  3ZT2 A;  3VQ8 A;  3LP1 A;  3C94 A;  5J2N A;  3DMJ A;  4KRE A;  3SUO A;  4DMN A;  2GV9 A;  3RMD A;  3H08 A;  3VQE A;  1NK7 A;  1QSL A;  1VSE A;  2WOM A;  3THV A;  4DTX A;  1TL1 A;  3A2F A;  2D5R A;  4HTU A;  4E7J A;  1LAV A;  3NH2 A;  4TSX A;  4FJX A;  5KTQ A;  2D0A A;  1TL3 A;  1WSI A;  1BCM A;  4OGE A;  3TAM A;  4CJW A;  3B6O A;  4CHY A;  3S3M A;  3NE6 A;  4Z4I A;  1HPZ A;  5HRP A;  4FJG A;  3LAN A;  4N41 A;  1CZB A;  4C8K A;  1ITG A;  4DQI A;  1IO2 A;  3VQ7 A;  3ZT4 A;  4FVM A;  4XIU A;  4J2B A;  3RRG A;  4FM1 A;  3O3H A;  4J2E A;  3AVJ A;  1RT3 A;  3TAR A;  1T05 A;  2YNI A;  3L8B A;  1TAU A;  1IKW A;  3RMA A;  4M3R A;  3SV4 A;  3RMC A;  1KSP A;  2B6A A;  3TAF A;  4N76 A;  1IKX A;  4B9S A;  1TAQ A;  3LPU A;  3ZSY A;  3K2P A;  3NFA A;  4CIG A;  3CFP A;  4CGD A;  5SWM A;  2G8F A;  4LSL A;  4LY7 A;  3KLH A;  3PX4 A;  4I2Q A;  5JS2 A;  2WON A;  1NJW A;  3DLK A;  1HYS A;  4C8O A;  2IDO A;  5KGX A;  2XHB A;  3AVA A;  4KI6 A;  2X78 A;  3QIP A;  4OLA A;  4CGF A;  3OVN A;  4IBN A;  4I7F A;  1ASW A;  2VG6 A;  4ZHR A;  3V9W A;  2FBT A;  1C0U A;  3TAP A;  4FJJ A;  4OKE A;  3KK2 A;  4CEQ A;  1TGO A;  3MAQ A;  1ZBU A;  2G8K A;  1RDB A;  3DOL A;  1NKB A;  1T8E A;  3LAM A;  3DLE A;  3JYT A;  3EZ5 A;  4O0I A;  4M41 A;  3IAY A;  4OLB A;  1Q9Y A;  2HB5 A;  1CXQ A;  3QEI A;  1C1A A;  3DOK A;  1S6P A;  3ALY A;  4GMJ B;  3K5L A;  1NK4 A;  4Z4F A;  3QEV A;  1HNV A;  1RDA A;  1UWB A;  1VSD A;  3KKR A;  2P51 A;  4IG0 A;  4EP4 A;  4CHZ A;  4DF4 A;  4CJP A;  4PQU A;  4DFK A;  1U48 A;  1SKW A;  1NJZ A;  5HRN A;  4F3O A;  3OYE A;  1S1X A;  3MEC A;  3MXJ A;  3IRX A;  2Q3S A;  3NF7 A;  3PX6 A;  5HBM A;  4K8Z A;  2YKM A;  2YHB A;  3HK2 A;  3OS0 A;  1ASV A;  1T03 A;  2ZE2 A;  3ULD A;  1JLQ A;  1RT5 A;  4CJU A;  5HLF A;  1ZBI A;  1RBT A;  1JLA A;  2IOC A;  3HP9 A;  3V1R A;  3OYN A;  3OYH A;  3AVM A;  4AHS A;  4CHN A;  2X6S A;  2PZS A;  2W42 A;  1CZ9 A;  4CEZ A;  4CCH A;  3HO1 A;  1R0A A;  3QEP A;  3NF8 A;  3SQ1 A;  4K8X A;  5K14 A;  3V1Q A;  1S9E A;  5KI6 A;  4FW2 A;  4CFB A;  1A5V A;  2HNY A;  5HRR A;  3ZSV A;  2DFH A;  1HQE A;  3C6U A;  3K5N A;  3LP3 A;  4DQQ A;  4W5Q A;  3O4Q A;  2XY8 A;  1S1V A;  4Z4G A;  1VSM A;  4OJR A;  3AVK A;  3VQ5 A;  3D45 A;  4FYD A;  4KHS A;  4DS5 A;  2XY5 A;  1VSL A;  3WNH A;  1JXB A;  4O4G A;  3M8R A;  3UIQ A;  4ID1 A;  4BWJ A;  4DSF A;  2AJQ A;  3PY8 A;  1Y97 A;  4AHV A;  4H4M A;  4B9M A;  3MEG A;  4CJ5 A;  2G8U A;  4E89 A;  3F9K A;  3VQD A;  2FBX A;  4QAG A;  2OZM A;  1QSY A;  1YTU A;  4Q5V A;  4E0D A;  4DFM A;  2JGU A;  3U3G A;  5EU7 A;  5I3U A;  2P5O A;  1I3A A;  1O1W A;  3TWH A;  1ZYQ A;  4CEE A;  3KLF A;  1JL1 A;  1KLN A;  4B9T A;  1SL2 A;  3OYL A;  3VQ6 A;  3VA3 A;  1TKX A;  3V81 A;  3P1G A;  3O3F A;  4HHT A;  4BAC A;  2BDP A;  3OS1 A;  4FCY A;  4DFJ A;  3NF6 A;  4IFY A;  2LSN A;  3DLH A;  2PY5 A;  1FK9 A;  1WSE A;  3VQC A;  4DQP A;  4DU3 A;  4IFV A;  3TR8 A;  1N6Q A;  4KTQ A;  5JS1 A;  4CED A;  3SV3 A;  1KVB A;  1S1T A;  3NCI A;  1U45 A;  1JKH A;  4RW8 A;  4AH9 A;  3V9U A;  3TAB A;  1D9D A;  1LAW A;  1XC9 A;  1HRH A;  3RMB A;  3KJV A;  3V9S A;  3SPZ A;  4F4K A;  1RBV A;  3NBP A;  4PWD A;  1C0T A;  3NGZ A;  1X1P A;  3KLG A;  3HJF A;  5CYM A;  4M3Y A;  5DK5 A;  4L8R B;  1EET A;  3S9H A;  4E3S A;  3OYF A;  4CF8 A;  3LAL A;  4CJF A;  1NK9 A;  3QIN A;  4CFC A;  4KFB A;  5KRT A;  3OYK A;  1QE1 A;  4CHQ A;  3OYB A;  3SYZ A;  2Z1G A;  4KHY A;  2XO7 A;  4FZY A;  2HHX A;  4CK1 A;  5J2Q A;  4ELV A;  5FDL A;  4CJL A;  3LZJ A; 
#chains in the Genus database with same CATH topology
 1HUX A;  4WE1 A;  1NK5 A;  1WBD A;  1XI1 A;  1S1U A;  1EKE A;  1LOT B;  2VGN A;  1YHQ N;  3WNE A;  1QHT A;  3VQ4 A;  4LFC K;  2WUS A;  2RF2 A;  2FSK A;  4KTW A;  1L3V A;  3LAK A;  3LDN A;  4FZZ A;  2W6L A;  5JMV A;  3OYM A;  4AHT A;  2Q0U A;  1BWF O;  3MWT A;  1LCU A;  2OPR A;  3QES A;  3PO5 A;  4CIF A;  2P9S A;  4FM2 A;  3DI6 A;  4MO5 A;  1ZC6 A;  5FPD A;  3IMX A;  3OS2 A;  3ZSX A;  3ZX3 A;  4FLU A;  1X9W A;  1VQM N;  4KV8 A;  4N5S A;  3FZK A;  3L2R A;  4M45 A;  3KTQ A;  1T44 A;  1X3N A;  4BE0 A;  4DV1 K;  1VHX A;  4DR2 K;  1VSK A;  2QWM A;  2F4V K;  2HVH A;  5AQY A;  4CJS A;  4H5T A;  3SNN A;  1IBK K;  5HP1 A;  1T6C A;  5T7B A;  4OKJ A;  1KTQ A;  5AQT A;  2HBJ A;  3VGL A;  1YI2 N;  1SUQ A;  5AQK A;  4RTF D;  1C1C A;  1IKY A;  3HPO A;  4M3U A;  4DSL A;  1I39 A;  2E8A A;  4DTR A;  3MWP A;  4CJK A;  3SQ4 A;  3AAP A;  1W2B M;  3DRS A;  1RDD A;  1YVN A;  1VQO N;  1OH5 A;  3J7Y P;  3MED A;  4FWM A;  2HOE A;  1BOT O;  2RN2 A;  3O8M A;  3JAM O;  4KO0 A;  1LWC A;  2HND A;  5KQD A;  5BRD A;  1TKD A;  4WCE L;  4FJK A;  5C2D A;  3VTH A;  3KKS A;  4OPJ A;  2ZF5 O;  4CE9 A;  3H1V X;  3NH1 A;  4A5B A;  5DM7 L;  2YKN A;  2B4J A;  1D9F A;  4JI0 K;  2Y1I A;  3UB5 A;  3VES A;  3VEV A;  1GOC A;  1HNZ K;  2O8E B;  3MX5 A;  1BIU A;  5AFU H;  5EX5 A;  3MEE A;  1I94 K;  2VYP A;  4R79 A;  1LWE A;  3OYG A;  1BIZ A;  3M8P A;  3E66 A;  3ULE A;  5FRM A;  1YT3 A;  3FFI A;  1WLJ A;  4DU4 A;  4BRQ A;  4DR1 K;  2Q97 A;  4N47 A;  4JHD A;  3CF5 L;  2VWK A;  2VWJ A;  1TKZ A;  1LV5 A;  2KQ2 A;  4KKO A;  4RW4 A;  5CZ1 A;  4H03 B;  2O8B B;  2KLA A;  2YHY A;  4E7I A;  4JI5 K;  2HHV A;  1RDU A;  4CJ3 A;  1IBL K;  4Z4H A;  4KB0 A;  4G1Q A;  1LWF A;  2RPI A;  1JL2 A;  4BR0 A;  5BPM A;  4BR9 A;  4FLX A;  4DR5 K;  5BR8 K;  2Q31 A;  3PX0 A;  2H3G X;  2ZD1 A;  4BC3 A;  3AO3 A;  3DXK A;  3EO3 A;  4PKG A;  1N32 K;  3O1B A;  3WEE A;  4JKG B;  3TPQ A;  1VQL N;  3M3Z A;  3AVN A;  3WXJ A;  1REV A;  2IGI A;  3EKU A;  1M1K O;  2DY4 A;  3P5J A;  4XH5 A;  4MQ3 A;  1HKG A;  4O55 A;  2IC3 A;  2F7T A;  4A57 A;  1UA0 A;  3T7Z A;  1WBB A;  4F2R A;  3U9Z A;  3HT3 A;  4FLW A;  1QVF M;  3CET A;  2NRR A;  3HP6 A;  1C0M A;  5AZI B;  1YVU A;  4Q0B A;  1FKP A;  3J8A A;  1CXU A;  1WSJ A;  1RFQ A;  5AQM A;  3TTD A;  1GLF O;  4KHW A;  4H5R A;  4C1N K;  2Q1N A;  3DM2 A;  1BA0 A;  4HUE A;  4FLV A;  2FSJ A;  2KFN A;  4IJA A;  1JLF A;  4FWR A;  1S72 N;  4W5O A;  2FBY A;  3VN5 A;  4B9N A;  5AQR A;  2UUB K;  4IJN A;  4YNQ A;  3CCQ N;  2ETJ A;  1A5W A;  4RW7 A;  4DB3 A;  3HBT A;  2HHU A;  4CFA A;  2JLE A;  3RTV A;  1L5U A;  3KIO A;  1GLA G;  3CPE A;  2D0P A;  1QQO A;  5HRO A;  5FLX O;  3CC2 N;  4PY5 A;  1LW0 A;  4DTJ A;  3WXI A;  2E6L A;  2Z1I A;  1X3M A;  4KH5 A;  2G8W A;  4WQ4 C;  1EWR A;  3JSM A;  5JVG L;  4FWP A;  3VTI A;  3RRH A;  2W41 A;  4B1V A;  4ID5 A;  4E7L A;  1B9D A;  5AQU A;  1KVA A;  1TK0 A;  4J2A A;  4BDY A;  4GKK K;  3F73 A;  1NGF A;  1NWK A;  4C8L A;  4FXD A;  4DQS A;  2NNW A;  4C8N A;  1TVR A;  3C65 A;  4CHP A;  3VQQ A;  3OYI A;  3QEW A;  5E84 A;  3SLC A;  3QDK A;  2AP1 A;  2NUB A;  3C0B A;  3ZT0 A;  4B3M K;  3EEQ A;  2QEX N;  3PLA A;  3KK1 A;  5EXW A;  4IOA L;  1SKS A;  4FJ5 A;  4J2D A;  5C42 A;  1G99 A;  4PKI A;  3TSU A;  3A5L C;  3K9J A;  1U2V A;  2ZJP L;  1SAZ A;  3SMP A;  5EOY A;  4CF0 A;  3CCS N;  1VRT A;  1IJJ A;  1IBM K;  2HMP A;  2FF3 B;  1VQK N;  3F9M A;  3C94 A;  2I7P A;  4KRE A;  2GV9 A;  1QSL A;  3THV A;  5EY4 A;  3VEZ A;  3QB0 A;  4TSX A;  1J5E K;  3S3M A;  1KC8 O;  4FOE A;  3BUZ B;  4Z4I A;  4FJG A;  3MN6 A;  4OPA A;  4N41 A;  3ZX0 A;  1IO2 A;  3VQ7 A;  4B9Q A;  2UXD K;  2Q36 A;  4XIU A;  5AR0 A;  4FM1 A;  3O3H A;  4J2E A;  1RT3 A;  1TUU A;  3TAR A;  1VQ6 N;  3RMA A;  2WTU A;  2B6A A;  4CW7 B;  3TAF A;  1IKX A;  1ATN A;  3ZSY A;  4BGB A;  3D6R A;  2HHH K;  3C7N B;  2WON A;  1HYS A;  3CJ1 A;  4JV5 K;  2XHB A;  3CCU N;  2GWK A;  3GL1 A;  4IBN A;  4ZHR A;  3HOT A;  2ZJQ L;  3SAF A;  4FJJ A;  3HZ6 A;  1ZBU A;  1RDB A;  3EZ5 A;  4CZG A;  3QBX A;  4CI6 A;  4A5A A;  4GMJ B;  3K5L A;  1UWB A;  2E2P A;  3QIC A;  4CJP A;  1U48 A;  3CQY A;  1NJZ A;  4F3O A;  4FSV A;  5AQG A;  3NF7 A;  3OW2 M;  3OS0 A;  4U7B A;  4YOX A;  1JLA A;  3OYN A;  1JCG A;  3RSE A;  1CZA N;  2W42 A;  3HO1 A;  4FW2 A;  3VER A;  2HNY A;  4DQQ A;  3K5N A;  3LP3 A;  1VSM A;  3AGR A;  3AVK A;  4HWI A;  4WQ5 A;  4EHT A;  4K43 A;  1K9M O;  4ID1 A;  2NRV A;  4AHV A;  4H4M A;  4B9M A;  2FBX A;  3SAH A;  2OZM A;  5JIC A;  1YTU A;  1KAZ A;  4E0D A;  4DFM A;  4NO7 A;  4CEE A;  1R59 O;  1JL1 A;  2GUP A;  2PBD A;  4B9T A;  3OYL A;  4HHT A;  3SAG A;  3DLL L;  2BDP A;  1Q18 A;  3OS1 A;  5B8H A;  3LDP A;  3NF6 A;  4DQP A;  1N6Q A;  2YHX A;  1T6D A;  1KVB A;  3LM2 A;  3NCI A;  1U45 A;  2QA4 N;  4BGA A;  4BRL A;  1RBV A;  3ENB A;  4YOY A;  3HJF A;  4L8R B;  4IEI A;  3OYF A;  4CJF A;  1VQ7 N;  2P9U B;  3OYB A;  4CHQ A;  2Z1G A;  5AQO A;  4FZY A;  2O8B A;  4CK1 A;  4ELV A;  5FDL A;  4CJL A;  4DQ8 A;  4BRH A;  1ATR A;  1WSF A;  3THX B;  3NHG A;  3L3U A;  3VMF B;  3NVK A;  4F3T A;  1T3V A;  4JS5 A;  1YJ9 N;  2VG5 A;  3QIO A;  3G25 A;  3CC7 N;  4CES A;  3J80 O;  4EZ6 A;  1X9M A;  1NJX A;  4CZI A;  4I9Q A;  4CBU A;  1DTQ A;  1NU0 A;  4H0Y B;  1ATS A;  2EWS A;  4H5W A;  1NOZ A;  2ZQB A;  1BA1 A;  4HUF A;  3ID8 A;  1WSG A;  2UYT A;  3LM9 A;  1KXP A;  5M1N A;  4I6M B;  4FPA A;  2ITM A;  3LWL A;  4RG8 A;  4FLT A;  4WYB A;  4E1J A;  1YTA A;  3SMS A;  3S3N A;  2HMI A;  5J1E A;  2BUP A;  3LL3 A;  3F2K A;  3LP2 A;  4W5T A;  5AZI A;  4BDP A;  1KAY A;  3HPH A;  3QFU A;  3L0Q A;  4BG9 A;  4EFH A;  3OYA A;  5AQW A;  3QNN A;  3PSF A;  4BE1 A;  4JKA A;  3ASM A;  4KHQ A;  2P9K B;  2F96 A;  4FVU A;  4PHT X;  4DV7 K;  4BRM A;  1NM1 A;  3O6W A;  2IVN A;  2G8H A;  1G15 A;  3ZET A;  1NGH A;  3CM6 A;  3KLI A;  5FPM A;  4IO9 L;  1SL0 A;  3ATV A;  3P38 A;  3VGK A;  3ATU A;  2D4W A;  5J2P A;  3BZC A;  3U8X A;  4LFA K;  3AAR A;  1H1V A;  1OVY A;  5DMR A;  3ZSO A;  4AM7 A;  3OJS A;  4PUO A;  3HYF A;  4LF5 K;  4AHC A;  5ADX A;  4A2B A;  1N8R O;  2PYL A;  2A40 A;  3AA4 A;  3RR7 A;  2FC0 A;  4CK3 A;  4BRP A;  4JD2 B;  3FE1 A;  3SUN A;  2E1Z A;  3CYM A;  2OPP A;  4CGI A;  4QOZ B;  4DG1 A;  3HPG A;  4BRN A;  2ITG A;  4LH5 A;  3FZF A;  5HL7 L;  2P1J A;  3A8Y A;  3BDP A;  3ITH A;  4FWN A;  3IFR A;  4NB4 A;  1SQK A;  2FLO A;  1X9S A;  4B1X B;  1M90 O;  3OYJ A;  4FJI A;  3H45 C;  1GOA A;  4BR7 A;  3VQB A;  3K9K A;  5F1X A;  5KQ8 A;  4BDZ A;  3V9X A;  3EE8 A;  4CZH A;  4JRP A;  5LJV A;  5C10 A;  1NMN A;  1SKR A;  2YV0 X;  2E6M A;  2HHQ A;  3D2E B;  3S41 A;  3VQA A;  3HOS A;  1FXX A;  1S1W A;  3I8D A;  1V4S A;  2WC9 A;  4EZ9 A;  3H3O B;  3TAN A;  3O1W A;  4CJE A;  3AVG A;  3LDL A;  3TSQ A;  4M3T A;  1QQC A;  4CGH A;  4IKF A;  4BRA A;  3WUH A;  3LDO A;  5M1Q A;  4LC9 B;  3PV8 A;  5LL6 Z;  4MDA A;  2DFE A;  1QZ6 A;  3OJU A;  3GBT A;  4Y1C A;  4CFD A;  1WSH A;  4GKJ K;  1YAG A;  4JS4 A;  2QXF A;  5AQN A;  4NCB A;  4DTS A;  1S22 A;  1EXQ A;  3L2V A;  3F5T A;  5HOO A;  2X74 A;  4IXC A;  3SZ2 A;  1HYZ A;  3AA5 X;  5I42 A;  3K0S A;  4DQR A;  4JI3 K;  5C25 A;  1W97 L;  2DFF A;  4RW6 A;  3HTV A;  4DV6 K;  1GOB A;  1MWK A;  3FGU A;  4OPH A;  3B6P A;  4K42 A;  1NGA A;  4MDB A;  4NCA A;  4KHP K;  4O0J A;  2JWL A;  4CER A;  4IOX A;  3EL2 A;  2OZS A;  4JLH A;  1YIJ N;  2PYJ A;  4CBW A;  3TSP A;  1RTH A;  3I0R A;  4YOW A;  2A1S A;  1QS4 A;  3DYA A;  4NLC A;  4B8C A;  3KD1 E;  3O9U A;  5FRO A;  1TK5 A;  1DKG D;  3OY9 A;  1HMV A;  2QW9 A;  2DTU A;  4O44 A;  4BRO A;  3UKU B;  3CG7 A;  3M8S A;  4HVJ A;  4CBX A;  1BI4 A;  3NAE A;  4FW1 A;  2BGG A;  3D7E O;  3ZSW A;  1YJW N;  2O8D B;  4PA1 A;  3IG1 A;  2ASP A;  5AFU A;  2YHA A;  2QM1 A;  4BR4 A;  5IT9 O;  3MCA B;  4QS9 A;  3IKM A;  3ZSR A;  4QCL A;  3DLR A;  1NKC A;  2VCP A;  4UQG A;  4DWI A;  2D0C A;  4DSK A;  4BG8 A;  4LH4 A;  4DFP A;  2OYQ A;  3L4I A;  4BWM A;  2UXB K;  1S5J A;  3GDQ A;  4FM0 A;  4ILJ A;  1RT1 A;  3DLB A;  1HNW K;  5AQZ A;  4O5B A;  2KTQ A;  1SV5 A;  3LZI A;  4K41 A;  1GLE G;  2BAN A;  3UKR A;  5C2F A;  4W5N A;  1E4G T;  2E88 A;  4JK7 A;  1KCF A;  4CGJ A;  3KK3 A;  1VQ5 N;  4B9V A;  3THY B;  3AVB A;  4H0V B;  4DV3 K;  2YNF A;  2A42 A;  1NGD A;  3CHW A;  3NGY A;  3P83 D;  3EYZ A;  1Z6R A;  3HST B;  3K59 A;  4BC4 A;  4K0K K;  4IDK A;  3GOI A;  3OYD A;  1VAZ A;  3KVG A;  4YOU A;  1CLQ A;  4CJV A;  1WOQ A;  4CJQ A;  4FJ9 A;  2WFB A;  1NGE A;  3KK7 A;  4FWQ A;  4NCG A;  1ZXO A;  3QO9 A;  3VEY A;  1A5X A;  3FZH A;  3VF2 A;  5J2N A;  1BO5 O;  2GX9 A;  2QI2 A;  1VSE A;  1J6Z A;  4JI6 K;  3T1Y K;  2PFU A;  1WSI A;  1BCM A;  3TAM A;  2Q2R A;  4CHY A;  3NE6 A;  4O8U A;  5HRP A;  5GAE P;  4DQI A;  3RRG A;  4BY9 C;  3AVJ A;  1T05 A;  1OH7 A;  1TAU A;  3RVC A;  1IKW A;  3RMC A;  1HR0 K;  1KSP A;  3K2P A;  3NFA A;  4CIG A;  3JS6 A;  4CGD A;  2G8F A;  3VF4 A;  3THX A;  5JS2 A;  4Y0W A;  1NBW A;  3DLK A;  4C8O A;  3OVN A;  4I7F A;  1ASW A;  2VG6 A;  5LMN K;  3THW A;  4IEE A;  4DR4 K;  5AZJ B;  4H0T B;  3CCE N;  3LAM A;  3DLE A;  4OLB A;  4JKH A;  1CXQ A;  3DOK A;  3ALY A;  1HNV A;  1VSD A;  5AQH A;  4DF4 A;  4CHZ A;  3M6G A;  4I6M A;  5HRN A;  3OYE A;  5ELZ A;  3MEC A;  3IRX A;  2Q3S A;  2NRH A;  3KWI A;  1K8A O;  4FPB A;  5HBM A;  4XEI A;  3DXM B;  2YKM A;  2ZE2 A;  3ULD A;  3VOV A;  4CJU A;  2IOC A;  3GE1 A;  1N33 K;  1VQN N;  4AHS A;  1BUP A;  1K8K B;  4DUY K;  2PZS A;  4CEZ A;  1EWQ A;  3VEW A;  3MN5 A;  4JK9 A;  3QEP A;  1R0A A;  3NF8 A;  3SQ1 A;  1W7A A;  2P9K A;  4CFB A;  2DFH A;  1S1V A;  3OBW A;  3MDQ A;  4FYD A;  1EQY A;  2CGJ A;  4A2A A;  4CZL A;  5CHI A;  1JXB A;  3UIQ A;  2NLX A;  3LDQ A;  4BWJ A;  3L6Q A;  1Y97 A;  1C0G A;  4DV5 K;  5AQX A;  4E89 A;  2P9L B;  3VQD A;  5AQJ A;  2P9P A;  2P9I B;  1YUW A;  4BRI A;  1QQM A;  1KAX A;  5EU7 A;  3R6M A;  3TWH A;  1ZYQ A;  4PL7 A;  1SL2 A;  3VA3 A;  3V81 A;  1TKX A;  1JCF A;  3O3F A;  4WFA L;  4BAC A;  4KH6 A;  4OO1 J;  4FCY A;  3CD6 N;  4IFY A;  1FK9 A;  3SV3 A;  4BVO A;  4AH9 A;  3BP8 A;  3C6H A;  3SPZ A;  3B8A X;  4F4K A;  4PWD A;  3NGZ A;  4EIA A;  5C12 A;  4M3Y A;  5DK5 A;  1EET A;  4FWK A;  3CJB A;  3Q7B A;  4J8F A;  5KRT A;  3OYK A;  3E9O A;  5LJW A;  3CER A;  1XUP O;  4DS4 A;  4FOI A;  1DT9 A;  1X9J A;  3ZSQ A;  2RHK A;  3AVI A;  3OHR A;  4DLE A;  2P9S B;  1JLG A;  4M3X A;  3R8E A;  3IUC A;  5AQV A;  4FK2 A;  2HNZ A;  1NJY A;  1JCE A;  4FK4 A;  3SK3 A;  4O8K A;  3C6T A;  3T19 A;  4LF8 K;  3D2E A;  3HM9 A;  3TI0 A;  1BU6 O;  1QQN A;  3PO4 A;  4B3O A;  4I2P A;  3QEX A;  2V52 B;  5MLC Q;  4B3T K;  3SUQ A;  3CJ9 A;  2D0B A;  1NJI O;  3W3D A;  4KI4 A;  1RT6 A;  3I0S A;  3W0L A;  3DLG A;  4Z4C A;  1J54 A;  4X64 K;  3DJC A;  1WNS A;  4RCH A;  1BIS A;  2F9T A;  3KHY A;  4DLG A;  2I7N A;  3CMA N;  5FPN A;  3MXM A;  4NYF A;  1ZBL A;  4X65 K;  4CZE A;  3AVL A;  5TKW A;  2O8F B;  4LSN A;  4E7K A;  1XNR K;  5BPL A;  1RTJ A;  4BRC A;  3IS9 A;  1S6Q A;  5KRS A;  3CC4 N;  4HTL A;  4XH4 A;  2D0O A;  3AVH A;  4DTP A;  4GY2 B;  5TKY A;  1HKC A;  4FJ8 A;  1U6Z A;  3ID6 A;  1ASU A;  4CF1 A;  3ULE B;  5AQI A;  5BRH A;  1RBR A;  4CD1 A;  4CZM A;  1BHL A;  2XY7 A;  2HBM A;  3WXL A;  3WNG A;  4FWL A;  5CZ2 A;  3AO5 A;  3R3L A;  1RGI A;  2E2Q A;  3VF6 A;  1HNX K;  5BN9 A;  1J53 A;  3UKU A;  4AIL C;  2GUI A;  3A0I X;  1RIL A;  1NGG A;  3ZCM A;  4CGG A;  3OYC A;  3A5O C;  2HHW A;  2O8D A;  3BZK A;  3ENO A;  3ZX2 A;  1XWL A;  2O8E A;  3AVC A;  2IIR A;  3KZB A;  3O4N A;  4ILH A;  3SUP A;  3PSI A;  4MFB A;  3ENH A;  2A1R A;  3CCM N;  4BC2 A;  3O3G A;  1KFS A;  1WUA A;  3QET A;  2O8C B;  3CQX A;  2QKK A;  3DXK B;  1L3U A;  4CEB A;  3WQU A;  4YY3 K;  3NH0 A;  3HVR A;  3H6E A;  4B1Z A;  2P5G A;  2FF6 A;  4B8A B;  1NNE A;  1VSF A;  1ILY A;  3VEX A;  4DTU A;  5CE3 A;  1KLM A;  3C95 A;  1U47 A;  1U04 A;  5M1O A;  1JXE A;  4AHU A;  2HW3 A;  4RW9 A;  4B3R K;  4LF6 K;  3TAE A;  3THY A;  2HHT A;  1TUY A;  1W0H A;  2DPN A;  5AJ3 K;  4DTO A;  1YIT N;  2YHW A;  3SCX A;  3CPW M;  4EHU A;  4H4O A;  5I9E B;  4Z94 A;  1ZBF A;  5BRF A;  4BQZ A;  2A6A A;  4ZTF A;  3V6D A;  4H5N A;  1TK8 A;  4Z4E A;  4JKE A;  1B92 A;  2O4G A;  4L3Q A;  1RT2 A;  4CJ4 A;  3BEX A;  1B9F A;  1HYV A;  2ASM A;  4NXM K;  3VQ9 A;  4JKG A;  5SZT A;  4M3W A;  4DF8 A;  3SPY A;  4CF2 A;  5AQP A;  2ASO A;  3O5B A;  2XRI A;  4C23 A;  5GIP A;  3L2U A;  4E1M A;  1BDG A;  4H8K A;  4HCB A;  2YNG A;  5JLH A;  2IAJ A;  2QWQ A;  4BRE A;  3AA3 A;  1KRP A;  4FJN A;  3I8B A;  4FJL A;  1WN7 A;  3D2F B;  3R1X A;  3G4S N;  4CZJ A;  2B5J A;  1GLB G;  2YCH A;  3AO2 A;  4ELT A;  1RDC A;  4YDU C;  1P90 A;  1Y64 A;  3ISN C;  3CIP A;  4KB1 A;  3WNF A;  1C6V A;  3CM5 A;  3UE5 A;  5LY3 A;  1T7P A;  2ZWH A;  1OH8 A;  4HUG A;  3KLE A;  1HJR A;  3CJ7 A;  4K8X A;  3CFO A;  2FSN A;  2J4R A;  4EAH D;  3AA2 A;  1HX1 A;  4F8R A;  1UAX A;  5AZJ A;  3TTF A;  5CY4 A;  4FWS A;  2IS3 A;  1KQS M;  5FPE A;  1N36 K;  2UUA K;  5C15 A;  4ISF A;  1ZBH A;  3VA0 A;  1VSJ A;  1NGC A;  4IG3 A;  3PIP L;  5E41 A;  3DAW A;  3VPZ A;  2OCE A;  4JYA K;  3RWU A;  2GWJ A;  2X6N A;  4ZTJ A;  2QK9 A;  3DXM A;  4GV3 A;  3A5N C;  2VWB A;  4MO4 A;  3CFR A;  2HHS A;  2OPQ A;  1OKJ A;  3E01 A;  2NRZ A;  1Q81 O;  1Q9X A;  1K8K A;  3G10 A;  4DR7 K;  4PL8 A;  4KHN A;  5HRS A;  3SQ0 A;  4OGC A;  3KD5 E;  3HM8 A;  3HXM A;  3K57 A;  3I33 A;  4DTN A;  4WF9 L;  4DTM A;  5C24 A;  3NGI A;  3LPT A;  2BE2 A;  4GW6 A;  3KWG A;  4KH4 A;  1MWM A;  2V7Y A;  4CD3 A;  3MX2 A;  4C8M A;  3N4P A;  4DR6 K;  1U2V B;  1E4F T;  1NKE A;  4BRG A;  3DRR A;  2E4L A;  1HNI A;  2JWK A;  2P9L A;  3WXK A;  5GAG P;  1ESV A;  1IG8 A;  2P9I A;  3J81 O;  3K5O A;  4IWV A;  3K5M A;  4M42 A;  3EY1 A;  4R5P A;  3MCP A;  3TAG A;  4CEA A;  4FWO A;  2ZJR L;  3O9Q A;  4B1Y B;  3MN7 A;  4V19 S;  4GV6 A;  1RTD A;  4FJ7 A;  4WQ5 C;  1Q7Y O;  4DSJ A;  3L4Q A;  3LP1 A;  4IDH A;  3H08 A;  3VQE A;  3OA9 A;  3NMU A;  4DTX A;  3A2F A;  5AQS A;  2D5R A;  4E7J A;  1WB9 A;  4FJX A;  5KTQ A;  1TL3 A;  4CJW A;  2GEL A;  3LAN A;  2NRW A;  1CZB A;  3H3N O;  3O9T A;  3ZT4 A;  4FVM A;  3O9R A;  3T69 A;  4DV0 K;  3CCV N;  3E9L A;  4JN4 A;  3L8B A;  4N76 A;  3N4Q A;  4B9S A;  1TAQ A;  4BR2 A;  1D4X A;  3LPU A;  2W40 A;  3CFP A;  4WQ4 A;  5SWM A;  4LY7 A;  3PX4 A;  4I2Q A;  2CH6 A;  4G9Z A;  4JKD A;  3DWL A;  4KI6 A;  2X78 A;  3QIP A;  1TYQ B;  4OLA A;  5JLF A;  4CGF A;  3VGM A;  5LMU K;  2FBT A;  1C0U A;  4OKE A;  3HSC A;  3KK2 A;  3M5R A;  1TGO A;  3MAQ A;  2G8K A;  4H0P A;  1NKB A;  3JYT A;  2NRX A;  3C7N A;  3IAY A;  4M41 A;  1HLU A;  1Q9Y A;  2HB5 A;  1C1A A;  4Z4F A;  2YI1 A;  3EN9 A;  3KKR A;  3RSE B;  4EP4 A;  4DFK A;  4DUZ K;  1SKW A;  3MXJ A;  1XQS C;  2UU9 K;  2YHB A;  1ASV A;  1T03 A;  1VQ8 N;  5HLF A;  1RT5 A;  2QTD A;  1ZBI A;  1RBT A;  3V1R A;  2F9W A;  3OYH A;  4MLH A;  3AVM A;  2X6S A;  1CZ9 A;  4JKB A;  3U9D A;  5K14 A;  2O8F A;  3V1Q A;  5KI6 A;  4M7X A;  1L3T A;  1HQE A;  3C6U A;  1E3M A;  1XMO K;  3O4Q A;  2UXC K;  4Z4G A;  3VQ5 A;  3D45 A;  4KHS A;  3MN9 A;  3SJH A;  4DS5 A;  2XY5 A;  5M1F A;  4O4G A;  2QWN A;  5F0X A;  2P9N B;  4DSF A;  2AJQ A;  5GIO A;  3PY8 A;  3ZLJ A;  3F9K A;  1QSY A;  2A5X A;  2OAN A;  3FR0 A;  2JGU A;  3U3G A;  1I3A A;  1O1W A;  3KLF A;  1MA9 B;  2QWR A;  4B1U B;  3ZEU B;  3O9S A;  4DFJ A;  3DLH A;  2LSN A;  2PY5 A;  3OTO K;  3VQC A;  4M63 C;  3SBT A;  1NGI A;  1S1T A;  3V9U A;  3TAB A;  2IVO A;  1O13 A;  1SZ2 A;  1LAW A;  1XC9 A;  3KJV A;  3V9S A;  3NBP A;  2CH5 A;  1HKB A;  3KLG A;  5CYM A;  5CR4 A;  3S9H A;  4AM6 A;  4E3S A;  4LFB K;  4C1N I;  4CF8 A;  4BRK A;  3LAL A;  3QIN A;  4CFC A;  4KFB A;  1V4T A;  5GAD P;  2HHX A;  5BPN A;  4FO0 A;  2O8C A;  4CJR A;  4KHU A;  1F21 A;  1XC3 A;  3FFK B;  4N56 A;  1RT4 A;  4F2S A;  4GNI A;  1SL1 A;  1LW2 A;  5KPR A;  2P9U A;  3HL8 A;  1WAF A;  1BQM A;  3FZL A;  3AO4 A;  2BH1 A;  4AHR A;  1DTT A;  4GVM A;  3ZSZ A;  4BRD A;  3QLH A;  4QS7 A;  1VQP N;  2ZGZ A;  2ATQ A;  1NK6 A;  3G6E N;  1BQN A;  3Q7C A;  2VQF K;  3SJJ A;  2NZT A;  2YJE A;  4CVN E;  4FJM A;  1W9H A;  2QKB A;  3NVM A;  3TU5 A;  5KGW A;  2O4I A;  3AV9 A;  3V1O A;  1IKV A;  3T1A A;  4B08 A;  1DEJ A;  4LF9 K;  5AQF A;  3I56 N;  3SQ2 A;  2I5J A;  1P8Z A;  2CGK A;  3WXM B;  3ZET B;  1XMQ K;  3LP0 A;  2R7Y A;  3AO1 A;  4O5F A;  2OPS A;  3AVF A;  4GVE A;  1J9A A;  4NYN A;  4WFN L;  4LF7 K;  1C1B A;  4H0O A;  5BN8 A;  3CXC M;  3RR8 A;  4LD0 A;  3LDS A;  3D0P A;  4DSI A;  1MU2 A;  3D2F A;  3M8Q A;  4CF9 A;  4Y1D A;  4BVP A;  1Z26 A;  4KPY A;  1JLE A;  2KFZ A;  3VET A;  4A61 A;  4OKK A;  2G8I A;  3V4I A;  3SBG A;  4I9L A;  5CYQ A;  4BE2 A;  3P4I A;  3U6F A;  2UUC K;  3P31 A;  1RT7 A;  5JVH L;  3R9P A;  2IVP A;  1RCH A;  2YX6 A;  2YNH A;  3O08 A;  4DV4 K;  4FJH A;  5KPT A;  2HST A;  4W5R A;  3MXI A;  3CCL N;  3H46 O;  1VQ4 N;  3G71 N;  4DV2 K;  4JKF A;  1ZBS A;  2QWP A;  4M3Z A;  2EHG A;  4JD2 A;  4B9L A;  1QVG M;  1UOC A;  3WT0 A;  1UA1 A;  3GG4 A;  4ICL A;  1K6Y A;  2A41 A;  4RWT A;  1BGX T;  3OBY A;  4JRQ A;  1XNQ K;  3CJA A;  4X66 K;  1NMD A;  4CHO A;  1RTI A;  3C6A A;  3V9Z A;  4B9U A;  3EE9 A;  5J2M A;  3SI6 A;  2KZM A;  3BGR A;  4CJT A;  1YJN N;  1KFD A;  4JI4 K;  1HPM A;  1SS6 A;  2HVI A;  4BC5 A;  5D3G A;  3NDK A;  2KW4 A;  1FW6 A;  1TV6 A;  2KZZ A;  4GV9 A;  4QS8 A;  4OX9 K;  3L2Q A;  3BF1 A;  3QBW A;  1IG9 A;  3BY5 A;  2VG7 A;  4DR3 K;  2WBN A;  1S9G A;  4YDU A;  1OH6 A;  1WAJ A;  2V51 B;  3G0Z A;  1VRU A;  4EP5 A;  2V7Z A;  3EKS A;  4YFU A;  2EX3 A;  2OA8 A;  1QTM A;  4JAX A;  2HF3 A;  3E1Y A;  1JLC A;  4JKC A;  4E1N A;  5GAH P;  3J7Z O;  4DHY A;  4B1W B;  1FKO A;  1Z25 A;  2F8S A;  1RBU A;  3K58 A;  3QNO A;  4UY8 O;  1EP4 A;  2G8V A;  3U3Y A;  3L3V A;  4IOC L;  2GEM A;  1DGK N;  1QSS A;  5BR9 A;  1S3X A;  1KD1 O;  2Y1J A;  2F8T A;  1D5A A;  4Z0U A;  4CEF A;  1IH7 A;  2Z1J A;  2D1K A;  4A62 A;  3NF9 A;  3MMV A;  3JXU A;  2VGM A;  4KRF A;  1EO1 A;  4ELU A;  1VSH A;  1BI4 B;  4OPK A;  1Q82 O;  4H5V A;  4YOV A;  1XHZ A;  4FLZ A;  4E7H A;  4HCC A;  4JI1 K;  3VQP A;  3ZYY X;  3E9P A;  4JI7 K;  4CIE A;  4CEC A;  1TYQ A;  4OVL A;  5DM6 L;  4IFE A;  3FLC O;  5FRN A;  1Q8I A;  4FLY A;  3ZT1 A;  1U4B A;  1XHX A;  4KAZ A;  3T3F A;  4NXN K;  1JLB A;  2Z1H A;  3TAQ A;  2FBV A;  3MK6 A;  4E19 A;  1MDU B;  2HBL A;  1RNH A;  2E20 A;  4JHD B;  5M1K A;  3HI0 A;  1U49 A;  1BCO A;  1EX4 A;  4KTZ A;  2Q0R A;  3P39 A;  3I55 N;  1J5O A;  3ZT3 A;  2RKI A;  3UKR B;  3O80 A;  4K25 A;  4B3S K;  1GLD G;  1IV0 A;  1VQ9 N;  1NOY A;  4DCH A;  2NRT A;  4JEP A;  4JK8 A;  1L3S A;  2QWO A;  1NK0 A;  3DRP A;  4CK2 A;  4CEO A;  3S3O A;  4M7Y A;  4XH1 A;  4YOT A;  1BL3 A;  4DSE A;  1HQU A;  5C0Y A;  1NLV A;  4YOR A;  5H1S Q;  2RE2 A;  2YJF A;  1N5Y A;  4FZX C;  2P9N A;  4ISG A;  1VK0 A;  3QER A;  1NK8 A;  3WEE B;  1VSI A;  1RBS A;  2FXU A;  2KHO A;  3LWM A;  2ZM6 K;  4DU1 A;  3WQT A;  3FZM A;  1KVC A;  2GBZ A;  3HVT A;  3CQ8 A;  2OTJ N;  3AGK A;  3L2W A;  1DLO A;  4CZK A;  4BQL A;  1Z05 A;  4KBO A;  4IO8 A;  4FK0 A;  3PUF A;  1YF5 L;  1D8Y A;  1TKT A;  2QXL A;  3ZEU A;  3QFP A;  1K73 O;  3ZT2 A;  3VQ8 A;  3U4L A;  3QML A;  3DMJ A;  3M1F A;  4DMN A;  3T1H K;  3RMD A;  3SUO A;  3O4W A;  1NK7 A;  2WOM A;  1TL1 A;  4NLB A;  4HTU A;  1LAV A;  4BR5 A;  4YHH K;  3NH2 A;  2D0A A;  4OGE A;  3B6O A;  2CGL A;  1HPZ A;  1C0F A;  4C8K A;  3TTC A;  1ITG A;  4DKW A;  4ILG B;  5EVZ A;  4J2B A;  1Q86 O;  2YNI A;  4M3R A;  2E2O A;  4CJ7 A;  3SV4 A;  1GLC G;  3AY9 A;  3THW B;  4ISE A;  2W6K A;  1GLJ O;  4WFB L;  4LSL A;  3KLH A;  1NJW A;  2KKZ A;  2IDO A;  5KGX A;  3AVA A;  5M1P A;  4H0X B;  4JI8 K;  3V9W A;  3TAP A;  4CEQ A;  3J7A P;  5A2Q O;  3IDH A;  3DOL A;  2GTD A;  3CME N;  4O0I A;  2BTF A;  3QEI A;  1NK4 A;  1S6P A;  3PIO L;  3QEV A;  1RDA A;  3AAQ A;  4IG0 A;  5IWA K;  2P51 A;  4AQY K;  4U67 L;  4AF1 A;  2HF4 A;  4PQU A;  1N34 K;  1S1X A;  5AQQ A;  1HJO A;  3PX6 A;  4K8Z A;  1GLL O;  3CCJ N;  3HK2 A;  1NGJ A;  4FL9 A;  1QZ5 A;  1JLQ A;  3HP9 A;  1BG3 A;  3A5M C;  2E2N A;  4CHN A;  4CCH A;  4A59 A;  3CI5 A;  2ZGY A;  1YXQ A;  1S9E A;  5F2R A;  2E1Y A;  3VEN A;  1A5V A;  1T8E A;  5HRR A;  3ZSV A;  1JJ2 M;  3HRG A;  4W5Q A;  2P9P B;  2XY8 A;  3EZW A;  4OJR A;  1QHA A;  2HBK A;  3H1Q A;  1VSL A;  3WNH A;  3M8R A;  4BRF A;  5ADX H;  5AQL A;  3MEG A;  4CJ5 A;  2G8U A;  1OVQ A;  4QAG A;  4JI2 K;  3CCR N;  2OTL N;  4Q5V A;  1NG9 A;  4X62 K;  5GIN A;  5I3U A;  4IZ9 A;  4PKH A;  2P5O A;  5BRE A;  1KLN A;  1FJG K;  4LF4 K;  3VQ6 A;  3P1G A;  3VEO A;  1WSE A;  4KTQ A;  4DU3 A;  4IFV A;  3TR8 A;  5JS1 A;  5KPZ A;  4CED A;  3CJC A;  1JKH A;  4RW8 A;  1D9D A;  3BF3 A;  4MLE A;  1HRH A;  3RMB A;  1NGB A;  2A3Z A;  2AA4 A;  1C0T A;  1X1P A;  4F9O A;  4CZF A;  2E5L K;  2PAV A;  4JNE A;  2QWL A;  1NK9 A;  3SYZ A;  2XY6 A;  1RDW X;  1QE1 A;  4KHY A;  2XO7 A;  5E26 A;  5J2Q A;  2VQE K;  3LZJ A; 
#chains in the Genus database with same CATH homology
 4DS4 A;  4WE1 A;  1NK5 A;  3ZSQ A;  4CJR A;  1XI1 A;  4KHU A;  1F21 A;  1S1U A;  1WSF A;  3AVI A;  4N56 A;  1RT4 A;  4DLE A;  1EKE A;  4F2S A;  3WNE A;  1JLG A;  1QHT A;  3NHG A;  3VQ4 A;  4M3X A;  3L3U A;  1SL1 A;  2RF2 A;  4KTW A;  1LW2 A;  4F3T A;  1L3V A;  3HL8 A;  1WAF A;  1BQM A;  4JS5 A;  4FK2 A;  2HNZ A;  3AO4 A;  1NJY A;  3LAK A;  2VG5 A;  4FZZ A;  4FK4 A;  3QIO A;  3OYM A;  4AHT A;  4CES A;  4AHR A;  3C6T A;  1DTT A;  3T19 A;  4GVM A;  4EZ6 A;  3ZSZ A;  2OPR A;  3QES A;  3QLH A;  1X9M A;  3HM9 A;  1NJX A;  2XY6 A;  4CIF A;  3TI0 A;  3PO5 A;  4I9Q A;  1DTQ A;  3PO4 A;  1NK6 A;  2ATQ A;  4B3O A;  4I2P A;  1BQN A;  4FM2 A;  3QEX A;  3DI6 A;  3SJJ A;  1NOZ A;  3OS2 A;  3ZSX A;  3SUQ A;  4FLU A;  1X9W A;  4KV8 A;  2ZQB A;  4HUF A;  2D0B A;  4N5S A;  3L2R A;  4M45 A;  1W9H A;  3KTQ A;  4FJM A;  4BE0 A;  1WSG A;  4KI4 A;  2QKB A;  1RT6 A;  1VSK A;  5KGW A;  2O4I A;  2HVH A;  3I0S A;  4CJS A;  3AV9 A;  3DLG A;  3V1O A;  4Z4C A;  1IKV A;  3SNN A;  1J54 A;  1WNS A;  3T1A A;  5HP1 A;  4B08 A;  5T7B A;  4OKJ A;  4RG8 A;  3LWL A;  1BIS A;  1KTQ A;  3SQ2 A;  4FLT A;  2I5J A;  4DLG A;  3MXM A;  1YTA A;  1SUQ A;  4NYF A;  3S3N A;  1ZBL A;  5J1E A;  2HMI A;  1C1C A;  3LP0 A;  2R7Y A;  3AO1 A;  1IKY A;  3LP2 A;  3AVL A;  4W5T A;  3HPO A;  4BDP A;  4DSL A;  1I39 A;  3HPH A;  3OYA A;  3QNN A;  4M3U A;  4DTR A;  4CJK A;  2OPS A;  3AVF A;  4BE1 A;  3SQ4 A;  1J9A A;  3DRS A;  3ASM A;  4LSN A;  4NYN A;  1C1B A;  2F96 A;  4E7K A;  1RDD A;  4KHQ A;  1RTJ A;  3RR8 A;  4LD0 A;  2G8H A;  1G15 A;  3LDS A;  3D0P A;  3CM6 A;  3KLI A;  4DSI A;  3IS9 A;  1S6Q A;  5KRS A;  3MED A;  1SL0 A;  1MU2 A;  3M8Q A;  4CF9 A;  4Y1D A;  3AVH A;  2RN2 A;  5J2P A;  1Z26 A;  4DTP A;  4KO0 A;  4KPY A;  1JLE A;  1LWC A;  2HND A;  2KFZ A;  4OKK A;  1TKD A;  3V4I A;  2G8I A;  4FJ8 A;  4I9L A;  5DMR A;  3ZSO A;  3OJS A;  5CYQ A;  4FJK A;  4PUO A;  4BE2 A;  3KKS A;  3HYF A;  4OPJ A;  4CE9 A;  1ASU A;  3NH1 A;  4CF1 A;  4AHC A;  3U6F A;  1RT7 A;  1RBR A;  2PYL A;  2YKN A;  3AA4 A;  3RR7 A;  2B4J A;  2FC0 A;  1D9F A;  2Y1I A;  1BHL A;  4CK3 A;  2XY7 A;  1GOC A;  3WNG A;  3SUN A;  1BIU A;  1RCH A;  3AO5 A;  3CYM A;  2OPP A;  3MEE A;  5CZ2 A;  4CGI A;  2YNH A;  1LWE A;  3OYG A;  1BIZ A;  4QOZ B;  1J53 A;  3M8P A;  3HPG A;  4DG1 A;  4AIL C;  4FJH A;  4W5R A;  3MXI A;  2GUI A;  2ITG A;  1RIL A;  4LH5 A;  3ZCM A;  2P1J A;  1YT3 A;  4CGG A;  3OYC A;  5FRM A;  3FFI A;  2HHW A;  1WLJ A;  4DU4 A;  3BDP A;  4M3Z A;  1XWL A;  3ITH A;  2EHG A;  4N47 A;  4B9L A;  3AVC A;  3O4N A;  2VWK A;  3SUP A;  1UOC A;  4MFB A;  2VWJ A;  1UA1 A;  4ICL A;  1TKZ A;  1LV5 A;  2KQ2 A;  2A1R A;  4KKO A;  4RW4 A;  1X9S A;  3O3G A;  1KFS A;  1K6Y A;  5CZ1 A;  1BGX T;  3OYJ A;  4FJI A;  3QET A;  4E7I A;  4JRQ A;  1GOA A;  2HHV A;  3VQB A;  4CJ3 A;  2QKK A;  4CHO A;  1RTI A;  1L3U A;  4CEB A;  3V9Z A;  4Z4H A;  3NH0 A;  4B9U A;  5J2M A;  3HVR A;  3SI6 A;  4G1Q A;  1LWF A;  4KB0 A;  2KZM A;  3BGR A;  4BDZ A;  4CJT A;  3V9X A;  2P5G A;  1KFD A;  2RPI A;  1JL2 A;  4B8A B;  1VSF A;  4FLX A;  4DTU A;  4JRP A;  3PX0 A;  2HVI A;  1KLM A;  3C95 A;  1U47 A;  1U04 A;  2ZD1 A;  1JXE A;  4AHU A;  5D3G A;  3AO3 A;  3NDK A;  2YV0 X;  1SKR A;  2HW3 A;  2KW4 A;  4RW9 A;  2E6M A;  1TV6 A;  2HHQ A;  3TAE A;  2KZZ A;  3VQA A;  2HHT A;  1FXX A;  1S1W A;  3I8D A;  3L2Q A;  1W0H A;  4DTO A;  1IG9 A;  4EZ9 A;  2VG7 A;  3SCX A;  3TAN A;  1S9G A;  4H4O A;  1WAJ A;  3G0Z A;  4CJE A;  1VRU A;  3AVN A;  1ZBF A;  1REV A;  2IGI A;  3AVG A;  4EP5 A;  4M3T A;  1QQC A;  4CGH A;  3P5J A;  4IKF A;  4YFU A;  2DY4 A;  2EX3 A;  4MQ3 A;  4ZTF A;  2OA8 A;  1QTM A;  3V6D A;  1JLC A;  1TK8 A;  4E1N A;  4O55 A;  2IC3 A;  4Z4E A;  3PV8 A;  1B92 A;  2DFE A;  2O4G A;  1UA0 A;  4F2R A;  3HT3 A;  3OJU A;  1RT2 A;  4CJ4 A;  1B9F A;  1HYV A;  3VQ9 A;  1FKO A;  4Y1C A;  4FLW A;  5SZT A;  4M3W A;  4CFD A;  1Z25 A;  2F8S A;  3HP6 A;  1C0M A;  1RBU A;  1WSH A;  4DF8 A;  3K58 A;  4JS4 A;  1YVU A;  3SPY A;  1FKP A;  4CF2 A;  3QNO A;  4Q0B A;  2QXF A;  4NCB A;  4DTS A;  1EXQ A;  1EP4 A;  2G8V A;  3L2V A;  2XRI A;  1CXU A;  3L2U A;  3U3Y A;  4E1M A;  4H8K A;  3L3V A;  2X74 A;  1WSJ A;  3SZ2 A;  4HCB A;  1HYZ A;  3AA5 X;  5I42 A;  2YNG A;  4DQR A;  2IAJ A;  5C25 A;  3AA3 A;  2DFF A;  4RW6 A;  1QSS A;  1KRP A;  4FJN A;  2Y1J A;  4FJL A;  1GOB A;  1WN7 A;  4KHW A;  2F8T A;  1D5A A;  4Z0U A;  4CEF A;  3B6P A;  2B5J A;  1IH7 A;  3DM2 A;  2Z1J A;  3AO2 A;  4HUE A;  4FLV A;  2KFN A;  4ELT A;  3NF9 A;  1RDC A;  4NCA A;  1JLF A;  4W5O A;  4O0J A;  4KRF A;  2FBY A;  3VN5 A;  4CER A;  4B9N A;  4ELU A;  3ISN C;  2OZS A;  4JLH A;  1VSH A;  3WNF A;  1BI4 B;  1C6V A;  3CM5 A;  4YNQ A;  4OPK A;  2PYJ A;  4KB1 A;  1RTH A;  2ETJ A;  3I0R A;  1XHZ A;  1T7P A;  1A5W A;  4RW7 A;  4FLZ A;  4E7H A;  4HUG A;  4HCC A;  3KLE A;  3VQP A;  1HJR A;  2A1S A;  4CIE A;  2HHU A;  4CEC A;  1QS4 A;  4OVL A;  4CFA A;  3DYA A;  2JLE A;  4B8C A;  3KD1 E;  3RTV A;  1L5U A;  3CFO A;  3KIO A;  5FRO A;  1TK5 A;  3OY9 A;  5FRN A;  1HMV A;  3AA2 A;  1Q8I A;  4FLY A;  2DTU A;  3ZT1 A;  4O44 A;  1U4B A;  1XHX A;  4KAZ A;  3T3F A;  3CG7 A;  3M8S A;  5HRO A;  4HVJ A;  4PY5 A;  1JLB A;  1L3T A;  4F8R A;  1BI4 A;  1UAX A;  3NAE A;  2Z1H A;  1LW0 A;  4FW1 A;  4DTJ A;  3TAQ A;  2BGG A;  2FBV A;  3ZSW A;  5CY4 A;  2IS3 A;  4PA1 A;  3IG1 A;  4E19 A;  2E6L A;  2Z1I A;  2YHA A;  1ZBH A;  1RNH A;  3VA0 A;  2G8W A;  1VSJ A;  3ZSR A;  4QCL A;  4IG3 A;  3DLR A;  1U49 A;  1NKC A;  5E41 A;  4UQG A;  1BCO A;  3JSM A;  4DWI A;  2D0C A;  1EX4 A;  4DSK A;  4KTZ A;  4LH4 A;  3RWU A;  2X6N A;  4ZTJ A;  1J5O A;  3ZT3 A;  4DFP A;  3RRH A;  2OYQ A;  2QK9 A;  2RKI A;  4BWM A;  4ID5 A;  1S5J A;  1B9D A;  3CFR A;  4E7L A;  2HHS A;  1NOY A;  2OPQ A;  4FM0 A;  1KVA A;  3E01 A;  1Q9X A;  1TK0 A;  1RT1 A;  3DLB A;  3G10 A;  1L3S A;  1NK0 A;  4J2A A;  3DRP A;  4CK2 A;  4BDY A;  4KHN A;  4CEO A;  5HRS A;  3SQ0 A;  4O5B A;  3S3O A;  4OGC A;  3KD5 E;  2KTQ A;  3F73 A;  1SV5 A;  3HXM A;  3LZI A;  4C8L A;  3K57 A;  1BL3 A;  2BAN A;  4DTN A;  4DTM A;  5C24 A;  3NGI A;  4C8N A;  4DQS A;  4FXD A;  1TVR A;  3LPT A;  1KCF A;  4W5N A;  4DSE A;  1HQU A;  4CHP A;  2BE2 A;  4CGJ A;  3VQQ A;  3OYI A;  4GW6 A;  3KK3 A;  3QEW A;  4B9V A;  3AVB A;  4C8M A;  2NUB A;  3ZT0 A;  2YNF A;  1NKE A;  1N5Y A;  4FZX C;  3QER A;  1VK0 A;  3DRR A;  2E4L A;  1NK8 A;  1HNI A;  3NGY A;  3P83 D;  1VSI A;  3KK1 A;  3EYZ A;  1RBS A;  1SKS A;  3HST B;  3K59 A;  4FJ5 A;  3LWM A;  4DU1 A;  4J2D A;  4IDK A;  3OYD A;  3K5O A;  1KVC A;  5C42 A;  2GBZ A;  3HVT A;  3K5M A;  3EY1 A;  3CQ8 A;  4R5P A;  4M42 A;  3L2W A;  1DLO A;  3TAG A;  1CLQ A;  4CEA A;  4CJQ A;  4CJV A;  4FJ9 A;  4CF0 A;  4FK0 A;  3PUF A;  1VRT A;  1D8Y A;  4NCG A;  1TKT A;  3QO9 A;  1RTD A;  1A5X A;  4FJ7 A;  4DSJ A;  3ZT2 A;  3VQ8 A;  3LP1 A;  3C94 A;  5J2N A;  3DMJ A;  4KRE A;  3SUO A;  4DMN A;  2GV9 A;  3RMD A;  3H08 A;  3VQE A;  1NK7 A;  1QSL A;  1VSE A;  2WOM A;  3THV A;  4DTX A;  1TL1 A;  3A2F A;  2D5R A;  4HTU A;  4E7J A;  1LAV A;  3NH2 A;  4TSX A;  4FJX A;  5KTQ A;  2D0A A;  1TL3 A;  1WSI A;  1BCM A;  4OGE A;  3TAM A;  4CJW A;  3B6O A;  4CHY A;  3S3M A;  3NE6 A;  4Z4I A;  1HPZ A;  5HRP A;  4FJG A;  3LAN A;  4N41 A;  1CZB A;  4C8K A;  1ITG A;  4DQI A;  1IO2 A;  3VQ7 A;  3ZT4 A;  4FVM A;  4XIU A;  4J2B A;  3RRG A;  4FM1 A;  3O3H A;  4J2E A;  3AVJ A;  1RT3 A;  3TAR A;  1T05 A;  2YNI A;  3L8B A;  1TAU A;  1IKW A;  3RMA A;  4M3R A;  3SV4 A;  3RMC A;  1KSP A;  2B6A A;  3TAF A;  4N76 A;  1IKX A;  4B9S A;  1TAQ A;  3LPU A;  3ZSY A;  3K2P A;  3NFA A;  4CIG A;  3CFP A;  4CGD A;  5SWM A;  2G8F A;  4LSL A;  4LY7 A;  3KLH A;  3PX4 A;  4I2Q A;  5JS2 A;  2WON A;  1NJW A;  3DLK A;  1HYS A;  4C8O A;  2IDO A;  5KGX A;  2XHB A;  3AVA A;  4KI6 A;  2X78 A;  3QIP A;  4OLA A;  4CGF A;  3OVN A;  4IBN A;  4I7F A;  1ASW A;  2VG6 A;  4ZHR A;  3V9W A;  2FBT A;  1C0U A;  3TAP A;  4FJJ A;  4OKE A;  3KK2 A;  4CEQ A;  1TGO A;  3MAQ A;  1ZBU A;  2G8K A;  1RDB A;  3DOL A;  1NKB A;  1T8E A;  3LAM A;  3DLE A;  3JYT A;  3EZ5 A;  4O0I A;  4M41 A;  3IAY A;  4OLB A;  1Q9Y A;  2HB5 A;  1CXQ A;  3QEI A;  1C1A A;  3DOK A;  1S6P A;  3ALY A;  4GMJ B;  3K5L A;  1NK4 A;  4Z4F A;  3QEV A;  1HNV A;  1RDA A;  1UWB A;  1VSD A;  3KKR A;  2P51 A;  4IG0 A;  4EP4 A;  4CHZ A;  4DF4 A;  4CJP A;  4PQU A;  4DFK A;  1U48 A;  1SKW A;  1NJZ A;  5HRN A;  4F3O A;  3OYE A;  1S1X A;  3MEC A;  3MXJ A;  3IRX A;  2Q3S A;  3NF7 A;  3PX6 A;  5HBM A;  4K8Z A;  2YKM A;  2YHB A;  3HK2 A;  3OS0 A;  1ASV A;  1T03 A;  2ZE2 A;  3ULD A;  1JLQ A;  1RT5 A;  4CJU A;  5HLF A;  1ZBI A;  1RBT A;  1JLA A;  2IOC A;  3HP9 A;  3V1R A;  3OYN A;  3OYH A;  3AVM A;  4AHS A;  4CHN A;  2X6S A;  2PZS A;  2W42 A;  1CZ9 A;  4CEZ A;  4CCH A;  3HO1 A;  1R0A A;  3QEP A;  3NF8 A;  3SQ1 A;  4K8X A;  5K14 A;  3V1Q A;  1S9E A;  5KI6 A;  4FW2 A;  4CFB A;  1A5V A;  2HNY A;  5HRR A;  3ZSV A;  2DFH A;  1HQE A;  3C6U A;  3K5N A;  3LP3 A;  4DQQ A;  4W5Q A;  3O4Q A;  2XY8 A;  1S1V A;  4Z4G A;  1VSM A;  4OJR A;  3AVK A;  3VQ5 A;  3D45 A;  4FYD A;  4KHS A;  4DS5 A;  2XY5 A;  1VSL A;  3WNH A;  1JXB A;  4O4G A;  3M8R A;  3UIQ A;  4ID1 A;  4BWJ A;  4DSF A;  2AJQ A;  3PY8 A;  1Y97 A;  4AHV A;  4H4M A;  4B9M A;  3MEG A;  4CJ5 A;  2G8U A;  4E89 A;  3F9K A;  3VQD A;  2FBX A;  4QAG A;  2OZM A;  1QSY A;  1YTU A;  4Q5V A;  4E0D A;  4DFM A;  2JGU A;  3U3G A;  5EU7 A;  5I3U A;  2P5O A;  1I3A A;  1O1W A;  3TWH A;  1ZYQ A;  4CEE A;  3KLF A;  1JL1 A;  1KLN A;  4B9T A;  1SL2 A;  3OYL A;  3VQ6 A;  3VA3 A;  1TKX A;  3V81 A;  3P1G A;  3O3F A;  4HHT A;  4BAC A;  2BDP A;  3OS1 A;  4FCY A;  4DFJ A;  3NF6 A;  4IFY A;  2LSN A;  3DLH A;  2PY5 A;  1FK9 A;  1WSE A;  3VQC A;  4DQP A;  4DU3 A;  4IFV A;  3TR8 A;  1N6Q A;  4KTQ A;  5JS1 A;  4CED A;  3SV3 A;  1KVB A;  1S1T A;  3NCI A;  1U45 A;  1JKH A;  4RW8 A;  4AH9 A;  3V9U A;  3TAB A;  1D9D A;  1LAW A;  1XC9 A;  1HRH A;  3RMB A;  3KJV A;  3V9S A;  3SPZ A;  4F4K A;  1RBV A;  3NBP A;  4PWD A;  1C0T A;  3NGZ A;  1X1P A;  3KLG A;  3HJF A;  5CYM A;  4M3Y A;  5DK5 A;  4L8R B;  1EET A;  3S9H A;  4E3S A;  3OYF A;  4CF8 A;  3LAL A;  4CJF A;  1NK9 A;  3QIN A;  4CFC A;  4KFB A;  5KRT A;  3OYK A;  1QE1 A;  4CHQ A;  3OYB A;  3SYZ A;  2Z1G A;  4KHY A;  2XO7 A;  4FZY A;  2HHX A;  4CK1 A;  5J2Q A;  4ELV A;  5FDL A;  4CJL A;  3LZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...