4QAGA

Structure of a dihydroxycoumarin active-site inhibitor in complex with the rnase h domain of hiv-1 reverse transcriptase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structure of a Dihydroxycoumarin Active-Site Inhibitor in Complex with the RNase H Domain of HIV-1 Reverse Transcriptase and Structure-Activity Analysis of Inhibitor Analogs.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4qagA00
1WSIA 2HNZA 1WSGA 2OPSA 4OVLA 5KTQA 1NJZA 1WAJA 4F2SA 1O1WA 1NK8A 3ZSRA 2YNHA 3QNOA 3MXIA 1BCOA 2QXFA 3VQ7A 1LW2A 5CY4A 1UAXA 1CXQA 3EY1A 4JRPA 4OKEA 2HHQA 2X6SA 1F21A 1QSYA 3SI6A 4BDPA 4KREA 5SZTA 4Z4IA 2ETJA 1TKTA 4AHTA 1S6QA 1R0AA 4KO0A 2GUIA 4E7LA 1BISA 3QIOA 4J2DA 4W5NA 3DRRA 3NDKA 4DTJA 4RW7A 3OYKA 4DQSA 5HROA 4OKJA 4E7HA 3V9SA 4C8KA 2VWKA 2JGUA 5E41A 3JYTA 1L3UA 4I9QA 4PA1A 1IKXA 3NF7A 4DG1A 1HYZA 1S9GA 1WN7A 4CIFA 4XIUA 4KHWA 3VQDA 2YV0X 5SWMA 5JS1A 3DRSA 3M8PA 1LWCA 1VSKA 4BE1A 5J2MA 4M41A 1QS4A 3AA3A 1I39A 5HRNA 4OJRA 2KTQA 1SUQA 4BE2A 4CF8A 4CJTA 3SV4A 3MEGA 4DTOA 4KB0A 1VSIA 2ZQBA 4DSEA 4B9SA 3P83D 2XHBA 1WSFA 3CM6A 2B6AA 1KLNA 4OGCA 3QINA 2D0AA 4DTXA 2Y1JA 3ZSXA 3RMDA 1CZBA 3HVRA 1RDBA 1NJWA 4DSKA 3VQ8A 2BE2A 4OPJA 2BDPA 4KB1A 4Z4GA 3PO4A 3UIQA 4JRQA 4CGIA 3K2PA 3ZT1A 1IH7A 1A5WA 4J2AA 3IG1A 1G15A 3ZSQA 3S3MA 1FK9A 5FROA 1ASWA 1JL1A 2OPRA 2YHBA 1ZYQA 1NOZA 1B9FA 3SQ1A 4M3YA 4Z4EA 4G1QA 4DSLA 1KFDA 1RT5A 4BACA 4I9LA 3OVNA 1VSMA 5KRTA 4Z4HA 4N56A 4DFKA 3SQ0A 2Q3SA 2HHVA 2HHWA 4CIEA 3ZSZA 4I7FA 2LSNA 3EYZA 2OPPA 4FZZA 4CJVA 4J2EA 1N5YA 1BI4B 3QO9A 5I42A 1FKPA 1J53A 3NHGA 3S3OA 2G8FA 1NKCA 2GBZA 1S9EA 3IRXA 4PUOA 1CXUA 3OYNA 1Z25A 3VQAA 3K5NA 3K59A 1VRTA 3AO3A 3K5MA 2E6MA 3MXMA 2XY5A 1J9AA 1GOAA 3OYEA 1NJYA 5CZ1A 1RT3A 1WSEA 4CERA 3M8SA 4DQQA 4W5RA 3PY8A 4TSXA 3VA3A 3LWLA 4ELTA 4KFBA 4CHNA 1DTQA 3DLHA 4F4KA 3QEXA 1RT4A 2OYQA 3IAYA 1RBRA 4DTMA 4DU4A 3VQPA 3LP2A 4HTUA 5DK5A 1JLFA 4CEEA 3LWMA 5KRSA 4RG8A 1KCFA 3OYDA 1RBVA 3V9XA 2AJQA 3FFIA 3NF8A 3I0SA 3TABA 4DSIA 5K14A 4FLYA 1RNHA 1X9WA 1NOYA 2NUBA 2P1JA 4FM1A 4BWJA 2HHXA 1NKBA 1DLOA 3TAEA 3AA5X 4ZHRA 1SL2A 3L8BA 2D0BA 1JLQA 2XO7A 1J5OA 4M3XA 1HQEA 4ZTFA 3KTQA 4NCBA 1D5AA 3AVBA 4J2BA 5FDLA 3SPZA 4FJMA 2RKIA 3DLKA 1TKDA 2ZD1A 3V1QA 3WNGA 1ZBUA 3QEWA 3AVMA 4LH5A 4Y1CA 3ZT2A 4FZXC 3C95A 4C8LA 1BQMA 2IS3A 1C0MA 4DQIA 1JLCA 4KTQA 1B92A 3OS2A 4HCCA 2F96A 2F8SA 3DMJA 3OY9A 4IBNA 4B9UA 4FZYA 4F3TA 1HNIA 1ITGA 1RCHA 3V6DA 1C0TA 4DQPA 3LP0A 4LH4A 3ZT3A 2A1RA 4DSJA 4C8MA 3O3HA 4DTUA 4KTWA 2HW3A 3VQEA 1GOCA 4IDKA 5HRSA 1BL3A 4AHUA 5FRMA 3AO5A 4F3OA 3LANA 4NCGA 4E3SA 3M8RA 2OA8A 3KK2A 1D8YA 1BIZA 1TKXA 1UOCA 1BIUA 2X78A 3VQ9A 3NGIA 4FM0A 1NK5A 1A5XA 1HYVA 3KLIA 3KK3A 4JS5A 1QSSA 4FJHA 3VQBA 4W5QA 1L3TA 5FRNA 3MAQA 1X9MA 4W5OA 2IAJA 4CHZA 1SV5A 2FBYA 1TK0A 3AVKA 2Z1JA 2HVHA 1RDAA 4E7KA 2XY6A 1WLJA 2FBTA 4QAGA 4E7IA 1HYSA 1IKYA 3CYMA 4UQGA 3AVCA 5C42A 1RT2A 1EXQA 4FLWA 4CEDA 1X9SA 2EX3A 3LAKA 4HUEA 3H08A 3OJSA 1KVAA 1SL1A 3ZSWA 4CJUA 4N5SA 2XY7A 4E1NA 4ELVA 2DFHA 2VG5A 3C6UA 2WOMA 4RW9A 3HPHA 3L2RA 4FCYA 1L5UA 1CLQA 3SV3A 4FLZA 3V9WA 1TKZA 4E1MA 4EZ9A 4LD0A 2DTUA 4CJSA 4KI6A 4PWDA 1S1WA 3WNEA 3LZJA 1NK7A 1VSFA 3KJVA 1MU2A 2YNIA 4DTNA 3TAPA 2B4JA 3CG7A 4FLTA 2IOCA 4YFUA 3T1AA 4GW6A 3ISNC 4E0DA 2G8KA 4FJ7A 2W42A 4CEFA 4B3OA 3OYIA 4DLEA 1ASVA 4CFDA 1NK4A 4FK2A 5C24A 4B9VA 4CHPA 3ZT0A 5JS2A 1BQNA 3KKSA 3O4NA 3LP1A 3AVLA 1YTUA 5CYQA 1REVA 4CF0A 3V81A 1VSEA 4WE1A 2PY5A 3AVNA 4PQUA 3SJJA 4HUFA 4M3ZA 4OGEA 1EKEA 4ID1A 3U6FA 4B9TA 4CJEA 2ZE2A 4LY7A 3ZSOA 3LZIA 1QE1A 4CJFA 1RBUA 4RW6A 4KRFA 3SCXA 4DFPA 1UA1A 1LW0A 3HT3A 3TAGA 1XI1A 1LV5A 1L3VA 2G8WA 1SKRA 3MEDA 2YKMA 3NFAA 1K6YA 3C6TA 2PYLA 1NK9A 4FYDA 1WAFA 1KVCA 4CESA 4O0JA 1YTAA 2F8TA 4OKKA 3QEIA 2P5GA 1C0UA 3OYLA 1GOBA 3DI6A 4AHVA 3DRPA 1RT6A 2Z1GA 2DFEA 1S1UA 1Z26A 3DOLA 3CFRA 5CYMA 4DF8A 3SQ2A 1VK0A 4K8XA 2YNGA 4KV8A 4EP4A 2KZZA 2KW4A 4B8AB 4CEBA 4CGHA 3NAEA 2KZMA 3QEVA 3VQCA 4CEOA 3QNNA 2OZSA 3JSMA 4CK1A 1RDDA 1XC9A 1D9DA 1HJRA 3OYHA 4FJGA 3F73A 4FJNA 1U4BA 3U3GA 1VSHA 4CEZA 3AA2A 4CGDA 4M3TA 1FKOA 1W0HA 3L3UA 1TL1A 3E01A 2X6NA 4M3WA 1ZBFA 1J54A 4O5BA 4KPYA 1EETA 4Z4FA 2XY8A 1RDCA 2VG6A 4CFBA 3QETA 2G8UA 1JXEA 2P5OA 1C1AA 4IFYA 4CK3A 1RTIA 4CJLA 3K5LA 1B9DA 3RRHA 1S1XA 4CGJA 4CGGA 5J2QA 4CF2A 4C8OA 2EHGA 3DOKA 3QIPA 3KLGA 2Y1IA 4O55A 4NYNA 4EP5A 3AV9A 4CJKA 4DQRA 4CF9A 3TR8A 5C25A 1JLAA 1L3SA 4FJIA 1NK0A 1UWBA 4I2PA 1YVUA 3KLFA 5DMRA 1U47A 2RN2A 4FJKA 4KHNA 1T03A 2VG7A 4ZTJA 1UA0A 4E19A 2I5JA 3HK2A 4AH9A 1RBSA 4LSNA 4OPKA 3AO4A 3AVFA 3SQ4A 4DFMA 4RW8A 4GVMA 4FVMA 2HHUA 3S3NA 1IKVA 4HUGA 3B6OA 2YKNA 1TL3A 2FBXA 4LSLA 3TAMA 1ZBIA 1KVBA 4KTZA 3K58A 5J2NA 1KSPA 1RT1A 2FBVA 1TV6A 3VQQA 3VN5A 3LPUA 3QEPA 3TI0A 4W5TA 3G0ZA 3HPOA 4FW2A 2BGGA 5I3UA 3PV8A 1FXXA 4KKOA 5HP1A 3D45A 2R7YA 2HNYA 4FJ5A 2ITGA 3DYAA 4MQ3A 4DS5A 1TAUA 1IO2A 4DF4A 1VSLA 1BI4A 4CJ4A 3WNFA 4FJ9A 4AHRA 3RR8A 3I8DA 4IG3A 4PY5A 4OLAA 1VSJA 3QESA 4FJXA 1WSJA 4FJ8A 3OYBA 2YHAA 3ULDA 2O4IA 2JLEA 4Z4CA 1U48A 4L8RB 3VQ6A 4CHQA 3L2WA 1KFSA 3ALYA 3F9KA 1HMVA 4AHCA 4CHOA 3RRGA 3PX6A 2PYJA 3NF9A 3SNNA 2DY4A 3LDSA 3NH0A 1KTQA 3SUNA 4KHSA 1S5JA 4O44A 3KIOA 4FJLA 2IDOA 1LWEA 1I3AA 1C6VA 4JLHA 3WNHA 3L2VA 5HRRA 1S1TA 4Q5VA 2XRIA 1U45A 3DLBA 3AVAA 4KHQA 4FXDA 4H4MA 3OYFA 2PZSA 3V9ZA 3OYAA 1N6QA 2G8HA 3RR7A 4CEAA 1XHXA 3L3VA 4IG0A 3ASMA 1IKWA 2E4LA 3L2QA 3OYGA 3RMCA 1TK5A 3OYJA 1RBTA 1JLBA 4EZ6A 3HM9A 1WNSA 3O3FA 4HHTA 4R5PA 3HPGA 1QSLA 3ITHA 3I0RA 3VQ4A 4FJJA 3HXMA 4FK4A 3T19A 3QERA 4MFBA 2DFFA 4BDYA 4B08A 3SPYA 3PO5A 3D0PA 2QKBA 1IG9A 1TK8A 3AA4A 4CK2A 3HJFA 3MECA 3VA0A 4CECA 1T7PA 1TVRA 1W9HA 2KQ2A 1SKSA 3A2FA 4F2RA 4M42A 4E89A 5CZ2A 2P51A 5KGWA 5T7BA 4DS4A 1VSDA 3KK1A 4I2QA 4FM2A 4KI4A 1VRUA 3HVTA 3NGYA 4CJRA 1JLEA 2VWJA 2HHTA 5J2PA 3AVJA 3RMAA 3B6PA 4H8KA 1YT3A 4NCAA 3NH1A 4FLXA 2GV9A 4Z0UA 4RW4A 1ASUA 1T8EA 4DU3A 4ELUA 1Q9XA 2YNFA 4QCLA 2G8IA 1JL2A 4CHYA 1BGXT 1HPZA 2O4GA 3HSTB 4DWIA 1BCMA 2FC0A 4CIGA 3THVA 1NJXA 3ZCMA 3LPTA 1X1PA 2X74A 1Y97A 3AVHA 3HO1A 4O4GA 3DM2A 1RTJA 4ID5A 4DU1A 1XHZA 5J1EA 3AO1A 3VQ5A 2KFNA 4HVJA 3AVGA 4DFJA 4CJQA 3RMBA 1S1VA 2RPIA 4CFCA 4IKFA 4JS4A 3NH2A 3LP3A 3NBPA 4AILC 1KRPA 2B5JA 3HYFA 1JLGA 1RT7A 4BWMA 3OYCA 3CM5A 3TARA 4N76A 3SUOA 1CZ9A 1JXBA 4B9LA 2D5RA 3CFOA 4YNQA 1HQUA 1SKWA 3KKRA 3SUPA 1U04A 3ZT4A 4CFAA 3T3FA 4AHSA 3V1OA 3LALA 3ZSYA 3M8QA 3V4IA 1U49A 3PX4A 1T05A 3ZSVA 4N41A 4KHUA 1LWFA 3L2UA 5HLFA 4B9NA 4CJPA 2E6LA 3SUQA 4FLVA 4CJ5A 3OJUA 2HVIA 3NGZA 4CEQA 1C1BA 3K5OA 4BE0A 1EX4A 1QHTA 3P5JA 3TANA 1NKEA 3DLEA 3NF6A 3KD5E 3SYZA 2HB5A 1SL0A 3CQ8A 3OYMA 4M45A 3P1GA 2IGIA 4DTRA 3RTVA 3O4QA 1RTDA 1NK6A 2QKKA 2A1SA 3IS9A 4IFVA 5EU7A 3O3GA 4DTPA 1DTTA 4FK0A 5HRPA 4CF1A 3OS0A 5HBMA 3C94A 3HP6A 3BDPA 4Y1DA 4E7JA 4M3RA 5KI6A 1QQCA 3EZ5A 4F8RA 2WONA 4DLGA 2HMIA 1A5VA 4DTSA 3HL8A 1LAWA 3KD1E 1Q8IA 4CJ3A 1ZBHA 4FLUA 3MEEA 1LAVA 1BHLA 3BGRA 1JKHA 1WSHA 1TAQA 4KAZA 3K57A 4DSFA 3PUFA 4N47A 4B9MA 4ICLA 4C8NA 4M3UA 4BDZA 4CCHA 3TAQA 4B8CA 1HNVA 4H4OA 2Z1HA 3SZ2A 3G10A 1HRHA 1Q9YA 2OZMA 3DLGA 4GMJB 3RWUA 3AVIA 4CGFA 1S6PA 3PX0A 5D3GA 4FW1A 3AO2A 3V9UA 4KHYA 3NE6A 3NCIA 3DLRA 3CFPA 3MXJA 1QTMA 1TGOA 2IC3A 2HHSA 4CJWA 2OPQA 4K8ZA 4QOZB 1KLMA 4O0IA 2KFZA 4Q0BA 2G8VA 2BANA 3U3YA 3QLHA 3TAFA 2ATQA 3KLHA 4OLBA 1C1CA 1RTHA 1ZBLA 2RF2A 3KLEA 3S9HA 2HNDA 4HCBA 3TWHA 4CE9A 2D0CA 5KGXA 4NYFA 2QK9A 3LAMA 1XWLA 3V1RA 3OS1A 1RILA 4DMNA 2Z1IA 3HP9A 1D9FA 1EP4A
chains in the Genus database with same CATH superfamily
2HNZA 2NNWA 5KTQA 1WAJA 2YNHA 3CQXA 3QNOA 2HHHK 1CZAN 3MXIA 1BCOA 2F4VK 3VQ7A 1LW2A 5CY4A 1LCUA 1NMNA 4H5TA 3SI6A 3LM2A 4JKEA 4Z4IA 2ETJA 4AHTA 4AF1A 1S6QA 3CETA 4YHHK 1VQ8N 3NDKA 4DTJA 3OYKA 4B9QA 2P9PB 4H5WA 4PA1A 1IKXA 3NF7A 1YUWA 1HYZA 1WN7A 3A5NC 4X62K 1NGHA 5J2MA 4M41A 5KPRA 5HRNA 5JVHL 1SUQA 5E84A 4BE2A 1DGKN 4CJTA 3SV4A 4KB0A 1VSIA 2ZQBA 4DSEA 4B9SA 3P83D 1KLNA 1T44A 3ZSXA 3GG4A 1OVYA 3ZT1A 1A5WA 5KPTA 1YAGA 1ZYQA 3CC2N 3SQ1A 4M3YA 4DR7K 4H5RA 4DSLA 3UKUA 1RT5A 4DQ8A 1J5EK 4G9ZA 2A40A 3OVNA 2GX9A 1ATRA 5KRTA 2P9IB 4Z4HA 3I8BA 4QS7A 2YI1A 3A5LC 4J2EA 3VEOA 2GTDA 5LL6Z 1FKPA 1J53A 3NHGA 3S3OA 2G8FA 1MWMA 2YJFA 3HRGA 1S9EA 3OYNA 1QSSA 2E6MA 4CERA 3M8SA 3PIPL 3L0QA 4ELTA 2O8DB 1RT4A 3QFPA 1RBRA 3VEXA 4DTMA 4Z94A 4HTUA 3G25A 5DK5A 1JLFA 3QB0A 4CZFA 5KRSA 1RBVA 3V9XA 2E5LK 3FFIA 3QICA 3ULEB 3TABA 2Q31A 3HOSA 4ZHRA 1GLFO 4IJAA 4M3XA 3KTQA 3AVBA 4FJMA 3DLKA 3WNGA 5AQXA 4CI6A 3RVCA 1YI2N 4C8LA 2UUCK 4DQIA 2F8SA 3DMJA 3OY9A 4B9UA 1DKGD 3V6DA 1K8KB 4DR2K 4C8MA 4DTUA 5BREA 4AHUA 3AO5A 4F3OA 1S72N 5IT9O 4NCGA 4E3SA 1G99A 1D8YA 2X78A 3VQ9A 4BVOA 4FZYA 3KK3A 1HYVA 4MDAA 1ATNA 1NNEA 3EEQA 1SV5A 3AVKA 2HVHA 1T6CA 1VQ5N 3LDPA 4QAGA 1HYSA 3UKRA 5C42A 1X9SA 3LAKA 3OJSA 1XC3A 1SL1A 1OH6A 5AQPA 4CJUA 2XY7A 3C6UA 1RDWX 3HPHA 3OHRA 3M1FA 4RW9A 4NB4A 3LM9A 4FLZA 2HMPA 4JI1K 1TKZA 2HF4A 2DTUA 1GLBG 4KH4A 3LZJA 3CCUN 4CD1A 4E1JA 1MU2A 3CG7A 4BQZA 4L3QA 1Q81O 3T1AA 4DV5K 4DLEA 3CCSN 2ZM6K 4CD3A 4DR6K 2OTJN 4BR5A 4PKHA 2O8BA 4NLCA 3AVLA 4LF5K 4A57A 4M3ZA 1JCEA 1YITN 5EVZA 1V4TA 2ZE2A 4CW7B 3WQUA 4KRFA 3I56N 4DFPA 1OKJA 4JKHA 2ASMA 3MEDA 4K42A 1GLJO 4CESA 1YTAA 3A0IX 4GNIA 4XEIA 4OKKA 3QEIA 4A5AA 2P5GA 3OYLA 2DFEA 1WUAA 3CFRA 2JWLA 1K8AO 3FZHA 2CGLA 3EE9A 4K8XA 4B1YB 3EKUA 1NJIO 1QVGM 2VQFK 2P9PA 3WT0A 3QEVA 2E2NA 3VQCA 4C1NK 1E4GT 4FJGA 4FJNA 3F73A 1OH5A 4FWPA 3EN9A 4ILHA 4CGDA 5KPZA 4BR4A 2GUPA 2W6KA 4M3WA 1ZBFA 1J54A 4O5BA 4KPYA 3ENBA 3QETA 4CFBA 1XMOK 2P5OA 4PUOA 4IFYA 3K5LA 2I7NA 2VYPA 1YJNN 5J2QA 4RWTA 4CGGA 4CF2A 4BRDA 3DOKA 2Y1IA 1TYQB 4A62A 4EP5A 4FJIA 4JK7A 1UWBA 4I2PA 1YVUA 5AQKA 5EY4A 1U47A 2RN2A 4FJKA 4V19S 2P9SB 1NGEA 4ZTJA 4E19A 2I5JA 3GBTA 4FVMA 3ENOA 1IKVA 3MWTA 1ZXOA 2NRHA 3B6OA 1TL3A 1RT1A 3VEWA 2OCEA 2P9IA 3BZCA 5HP1A 2HNYA 1K73O 4DS5A 1OH7A 3I8DA 4IG3A 4OLAA 1BO5O 3U4LA 4L8RB 1KC8O 1KFSA 4KBOA 1HMVA 4J8FA 2PYJA 3QFUA 4ILGB 2O8DA 1KTQA 4DKWA 4KHSA 3KIOA 2IDOA 1I3AA 1ILYA 1BWFO 4Q5VA 1N6QA 2G8HA 3RR7A 4CEAA 1XHXA 3VERA 4UY8O 4BC4A 3P31A 2QWRA 1VQ7N 1KAZA 3HPGA 1QSLA 3VQ4A 2EWSA 5AQFA 4YOTA 4JN4A 3THWB 2DFFA 4I6MB 3SBTA 3E9OA 5BPNA 3AA4A 4FPAA 2NRZA 3MECA 5LMNK 2GWJA 1T7PA 2ZGYA 1TVRA 3D2FB 1SKSA 4DS4A 5CZ2A 2V51B 4FM2A 4I2QA 4CJRA 4PKIA 2Q36A 3IUCA 4YOVA 1K8KA 5J2PA 3MCPA 1W7AA 3CCVN 4K25A 2F9TA 3EZWA 4NCAA 5GADP 3O4WA 4IWVA 4ELUA 1Q9XA 3WXKA 3HTVA 2W6LA 3HSTB 2FC0A 3THVA 3O9UA 1MWKA 3BF1A 1Y64A 3D7EO 2WUSA 4ID5A 4DU1A 2KFNA 4HVJA 4BR9A 4DFJA 2RPIA 3NH2A 3NBPA 2OTLN 1I94K 1HR0K 2B5JA 1RT7A 4FL9A 3N4QA 4B9LA 4YNQA 2JWKA 3SUPA 4CFAA 1NBWA 4AHSA 3V1OA 3V4IA 3M8QA 1U49A 3PX4A 4CJPA 5LMUK 1BU6O 1NGCA 1SS6A 3VEVA 4FLVA 3IMXA 4BE0A 1QHTA 3DLEA 4H0YB 5BR9A 3SYZA 1SL0A 4BR0A 3RTVA 1NK6A 3O08A 1NLVA 5EU7A 2QM1A 3O3GA 4FK0A 3VTIA 4DR1K 5HBMA 3BDPA 1QZ5A 4H0XB 3EZ5A 4DLGA 3F2KA 5JVGL 1A5VA 4DTSA 3HL8A 4DV6K 3I55N 5FLXO 4LC9B 3NMUA 3H3OB 3WXIA 4CJ3A 3KWGA 1ZBHA 3MEEA 1IV0A 3BGRA 4JHDB 3O9RA 2PBDA 2BTFA 4ICLA 4M3UA 2IVOA 4BDZA 1HUXA 3TAQA 3G10A 4GKJK 1Q9YA 5AQOA 1YHQN 1O13A 2OZMA 4FWMA 3FZLA 3CI5A 3AO2A 4FOIA 3V9UA 3NE6A 3MXJA 2VQEK 4K8ZA 4O0IA 3OA9A 4OX9K 2BANA 3QLHA 3CJCA 1RDUA 1RTHA 2RF2A 2HNDA 4BRQA 2O8CB 5AQSA 5KGXA 4NYFA 3OS1A 3VEZA 4DMNA 4ISFA 1RFQA 1D9FA 2UUBK 1BGXT 3ZSRA 3K9KA 2NRTA 4F9OA 4IOAL 2QW9A 2QXFA 1UAXA 1S3XA 1CXQA 3DXKB 3EY1A 2HHQA 3HBTA 1F21A 1NWKA 3BP8A 4KREA 1TYQA 4KHPK 1R0AA 1QZ6A 2GUIA 1XQSC 3B8AX 1BISA 3QIOA 4J2DA 1KXPA 4DQSA 5AQVA 3C6AA 4E7HA 4C8KA 5BRFA 3CJ9A 5E41A 2CH5A 4DG1A 1S9GA 4KHWA 3VQDA 2Q0UA 5AR0A 5SWMA 4FO0A 3G71N 2AP1A 3M8PA 1VSKA 2IVNA 3MEGA 4J2AA 1WSFA 2B6AA 3QINA 4DTXA 4YORA 4R79A 3RMDA 1CZBA 2CGJA 5EOYA 3HVRA 2YHWA 4DSKA 2YHXA 4OPJA 4Z4GA 4KB1A 5AZIA 4JRQA 3E66A 2NZTA 1DEJA 3ZSQA 1JL1A 2OPRA 2YHBA 4C1NI 1B9FA 1EQYA 4I9LA 4BQLA 2HHVA 4CIEA 3M6GA 2LSNA 1IG8A 1N5YA 1BI4B 3QO9A 5I42A 5E26A 3THWA 3H45C 4LFBK 4I6MA 4NLBA 3T1HK 4LFCK 3VQAA 3K59A 1M90O 3K5MA 2A42A 3AO3A 3ZX0A 5EX5A 4W5RA 1EWRA 4TSXA 3VA3A 3CHWA 4CHNA 3Q7CA 3QEXA 3LP2A 3LWMA 3OYDA 3NF8A 5K14A 4FLYA 1JCFA 1NOYA 3DXMB 2P1JA 4JI2K 4BWJA 4FM1A 1NKBA 3OBYA 4YOXA 1DLOA 2HHXA 3AA5X 3AAQA 4JI4K 1SL2A 2XO7A 1HQEA 4ZTFA 4NCBA 4BRKA 5FDLA 2BUPA 5CHIA 1TKDA 3V1QA 4LH5A 3ZT2A 2F96A 3SLCA 4F3TA 3LP0A 2ZWHA 4FWNA 2Q2RA 3N4PA 3O9SA 2D1KA 3VQEA 1D4XA 3VF2A 5HRSA 1BL3A 4H03B 4BRCA 3LANA 3HSCA 1BIZA 1UOCA 3LDLA 2UXCK 5D3GA 3VQBA 4W5QA 1L3TA 5FRNA 3SJHA 2HF3A 4CHZA 4WFAL 4MO4A 4E7KA 4GV9A 3C7NA 4E7IA 1VQPN 1EWQA 3CJ1A 4UQGA 3KZBA 1U2VB 1GLCG 4JI5K 2P9LB 4JKGB 4A2AA 4KH6A 4JKFA 2WOMA 5BRHA 4CVNE 1NGGA 3E9LA 2UUAK 1N8RO 4PWDA 4JNEA 1VSFA 2YNIA 3NVMA 3ISNC 2G8KA 4CEFA 3SK3A 3OYIA 2YX6A 4FOEA 5C24A 1W2BM 1M1KO 4EHUA 4CHPA 3O4NA 1YTUA 5CYQA 1REVA 4PHTX 1VSEA 4WE1A 2PY5A 4PQUA 3SJJA 4H0TB 4B9TA 1T3VA 3ZSOA 4CJFA 1VQON 1RBUA 4RW6A 4KH5A 5GAEP 2G8WA 2GWKA 1XI1A 1FJGK 3DXKA 2D0OA 4FYDA 3C6TA 2PYLA 2W41A 3MX2A 4LF9K 1RT6A 3DOLA 3R3LA 4IO9L 5CYMA 1VK0A 2KW4A 4B8AB 4CEBA 3H6EA 2Q1NA 1D9DA 1KAYA 1LOTB 3MMVA 4BG8A 3IKMA 2HSTA 2VGMA 1YVNA 3L3UA 4DV7K 3E01A 4MDBA 3P39A 2HBLA 2A6AA 5FPMA 2VG6A 3J80O 2GEMA 5M1KA 1C1AA 1OH8A 1RTIA 4B1VA 5AFUA 3RRHA 3R9PA 4CGJA 4BRFA 1YJ9N 1MA9B 3QIPA 3ZETB 4O55A 4NYNA 4DQRA 5C25A 1L3SA 1JLAA 3JS6A 3FLCO 5DMRA 4A2BA 3CCJN 3IDHA 5M1NA 4IDHA 3LL3A 1NU0A 3SQ4A 3PIOL 2E8AA 4HUGA 2KKZA 2YKNA 4LSLA 3THXB 4FWSA 3TAMA 3K58A 5J2NA 3VQQA 1TV6A 1XNRK 2V52B 4W5TA 3DAWA 4FW2A 3A5MC 2CGKA 3PV8A 1FXXA 3EL2A 2ITGA 2FXUA 1IO2A 1VSLA 1BI4A 4MLEA 4CBXA 2E1ZA 4AHRA 1SQKA 3THYA 2GELA 2QWLA 2FSNA 2JLEA 4JK8A 4CHQA 3L2WA 3ALYA 3OBWA 3F9KA 3MN5A 3RRGA 2DY4A 2QI2A 3NH0A 3LDSA 3A8YA 1HNZK 4O44A 2NRWA 3WNHA 2XRIA 4CJ7A 1U45A 3DLBA 4KHQA 2PZSA 4IZ9A 3OYAA 3RMCA 3VPZA 1TK5A 3DXMA 2ZJQL 4ISEA 1RBTA 1JLBA 2P9KB 4LF4K 4JAXA 3CIPA 3HXMA 5AQHA 3QBXA 3CCLN 1U6ZA 3D0PA 4M7YA 1IG9A 3CXCM 3HJFA 3VA0A 3CF5L 1W9HA 2KQ2A 1WB9A 4E89A 1VQ6N 1VSDA 3I33A 2NLXA 5M1OA 3HVTA 5C2FA 3UE5A 4FSVA 2VWJA 1Q7YO 5C0YA 5JICA 1YT3A 2PAVA 4WQ4A 2D0PA 4Z0UA 4DU3A 3VETA 4BGAA 4FWKA 1JL2A 1HPZA 3CPWM 3TTCA 1NJXA 4LF7K 4BVPA 4JKDA 4YOUA 3DM2A 3AVGA 3RMBA 3CJ7A 1S1VA 4CFCA 3EO3A 3Q7BA 3LP3A 4BC5A 3CCQN 3OYCA 3G6EN 4IEIA 4Y0WA 4WF9L 1NGFA 3T1YK 2CH6A 1JXBA 1U2VA 1HQUA 2P9LA 4H0PA 4PL8A 3KKRA 3ZT4A 1T05A 4JKGA 3ZSYA 3CMEN 3ZSVA 2QTDA 4B9NA 4CZEA 4DV1K 1KD1O 4CJ5A 1Z6RA 1C1BA 3K5OA 3P5JA 3TANA 1NKEA 3KD5E 2RE2A 4PL7A 3P1GA 4JKAA 1RTDA 2QKKA 4FWOA 1Q82O 3O80A 4DB3A 3C94A 1HLUA 1MDUB 4E7JA 4M3RA 1QQCA 5TKYA 2HMIA 4DV2K 3T69A 1Q8IA 5F0XA 4FLUA 5LJVA 1BHLA 1JKHA 2QWNA 3K57A 4C8NA 2IVPA 4CCHA 1HNVA 3SZ2A 1ZBSA 3DLGA 3AVIA 4CGFA 3PX0A 3FFKB 4FW1A 3CFPA 1QTMA 2OPQA 2AA4A 2ZF5O 3FZFA 5GIPA 3KLHA 3W0LA 4CZLA 4HCBA 3TWHA 4CE9A 3EE8A 2QEXN 2QK9A 1XWLA 4XH5A 3BEXA 3C65A 1RILA 5BN8A 5A2QO 4IDKA 4OVLA 5C2DA 1WSGA 1NJZA 4F2SA 1O1WA 1NK8A 3CD6N 3S41A 3ULEA 3O1BA 2PFUA 4ILJA 4JRPA 4OKEA 1QSYA 4XH1A 3MWPA 5SZTA 3ZETA 1TKTA 4KO0A 4IOCL 3WUHA 4E7LA 2VWBA 5CE3A 3DRRA 4GV3A 4RW7A 3GDQA 5M1QA 5AFUH 5I9EB 2VWKA 2JGUA 3JYTA 4I9QA 4XIUA 1P90A 1HNXK 2D4WA 4RCHA 2YV0X 3ZX3A 3CCMN 3THXA 4BRPA 3DRSA 4BE1A 1QS4A 1I39A 2KTQA 1HX1A 3PSFA 4CF8A 2QXLA 3CM6A 3RSEB 3HI0A 2Y1JA 3CJAA 2HBKA 1Q18A 1RDBA 3D2EB 2BE2A 2BDPA 3VOVA 3PO4A 3UIQA 4RTFD 1NGJA 3K2PA 4IXCA 1IH7A 4DCHA 3CMAN 1G15A 3S3MA 4FPBA 3TSPA 1ASWA 1NOZA 4Z4EA 5AQGA 3L6QA 4G1QA 3J81O 3MN7A 1VQ4N 1IJJA 1VSMA 4DFKA 2HHWA 2Q3SA 1W97L 3VGLA 2P9KA 3M3ZA 2QWQA 1FW6A 4BGBA 3GOIA 4JI6K 3MX5A 2GBZA 3FR0A 3MXMA 1NJYA 2XY5A 1GOAA 3OYEA 1RT3A 4GV6A 4OPHA 5KQ8A 2UYTA 4FWRA 5BN9A 1DTQA 3DLHA 3IAYA 4B1UB 1HJOA 4CEEA 4DUYK 1IBMK 2YJEA 1KCFA 2FSJA 1RNHA 1X9WA 4K41A 5DM7L 3FE1A 2D0BA 1J5OA 4IOXA 3BUZB 3U9ZA 3SPZA 1HKGA 2RKIA 4M63C 4BRMA 4Y1CA 4EHTA 4X65K 4WQ4C 3C95A 1JLCA 3TSUA 1B92A 3OS2A 4HCCA 2QWMA 3WXJA 4X66K 4LH4A 4WYBA 3VF4A 2A1RA 3O3HA 3CCRN 3AGKA 3M5RA 5FRMA 4IFEA 3T7ZA 3M8RA 1IBLK 3KK2A 3NGIA 1BIUA 3VENA 2A5XA 3KLIA 4JS5A 5BRDA 3O9TA 3MAQA 5AJ3K 2Z1JA 1N33K 1RDAA 1DT9A 4NXMK 2FBTA 2FF3B 5AQZA 4CZJA 4DUZK 2P9UB 3CYMA 4BRIA 3AVCA 1EXQA 1NGAA 4FLWA 4CEDA 2P9SA 2EX3A 2W40A 5C10A 4YDUA 1KVAA 5C15A 4N5SA 4CZMA 4ELVA 4FCYA 3HOTA 3L2RA 3ATUA 3SV3A 1BOTO 4A5BA 4E1MA 4EZ9A 4KI6A 1RGIA 1S1WA 4JKCA 4A61A 1E4FT 2B4JA 2IOCA 3R8EA 4GW6A 3QBWA 4FJ7A 2W42A 4B3OA 4B1WB 1NK4A 3CERA 1XUPO 4CFDA 1GLDG 5JS2A 1BQNA 1R59O 3KKSA 3LP1A 3ZEUB 4BRHA 2H3GX 2HOEA 3C6HA 4CF0A 2NRXA 3L4IA 3AVNA 4BRAA 3H1VX 2V7YA 2UU9K 5B8HA 4HUFA 4OGEA 3U6FA 3LZIA 4LY7A 1HKBA 3WXLA 3SCXA 1NG9A 1UA1A 1LW0A 3TAGA 1LV5A 1SKRA 2YKMA 3NFAA 1NGDA 1NK9A 2F8TA 1GOBA 3DRPA 4JKBA 3SQ2A 1QHAA 3VGMA 1HPMA 2KZMA 4CGHA 1BG3A 3D2FA 4JV5K 3QNNA 4O8KA 3JSMA 4CK1A 1XC9A 1X3MA 4B3SK 5AQUA 5AQRA 1QQMA 4IO8A 1U4BA 4BR2A 1VHXA 4CEZA 5C12A 4IJNA 1FKOA 1W0HA 3DLLL 1TL1A 3SMPA 3DWLA 1GLLO 1EETA 1JCGA 5BPMA 1RDCA 1JXEA 4CK3A 4WQ5C 4FZXC 3RSEA 3KLGA 3VTHA 4YOYA 3TR8A 3D2EA 3AAPA 4KHNA 1T03A 2E88A 3LDNA 1UA0A 4AH9A 4OPKA 5FPNA 3AVFA 4DFMA 3P38A 4JD2B 5LJWA 2ZJRL 3FGUA 2FBXA 1ZBIA 3VN5A 3HPOA 4QS8A 2BGGA 4KKOA 3D45A 1JJ2M 4FJ5A 5FPEA 1BDGA 1XNQK 4CJ4A 4FJ9A 3O9QA 3CPEA 4PY5A 4B3MK 1QVFM 3QESA 4FJXA 3OYBA 2YHAA 4Z4CA 1U48A 3VQ6A 1NMDA 4AHCA 4CHOA 2KHOA 3PX6A 1SAZA 3J7ZO 3SUNA 1S5JA 4FJLA 3GL1A 1C6VA 1GLAG 4JLHA 3L2VA 5HRRA 3DJCA 4FXDA 2Q0RA 4DV0K 3L4QA 2ITMA 2E4LA 3L2QA 3OYGA 3OYJA 3CJBA 4HTLA 4JHDA 2E20A 4EZ6A 3HM9A 5IWAK 1WNSA 2O8EB 1TUUA 4R5PA 4FJJA 1BA0A 3I0RA 4GVEA 3T19A 3QERA 4BDYA 1VQ9N 2UXDK 4B3TK 4B08A 3PO5A 3VGKA 2J4RA 1NGBA 1WBDA 1Q86O 4JK9A 4F2RA 4CECA 4M42A 3A2FA 2QWPA 3HO1A 3KK1A 1N34K 1VRUA 1JLEA 3ENHA 3AVJA 3QMLA 3RMAA 1YXQA 1K9MO 3NH1A 2O8CA 2GV9A 4QCLA 5KQDA 1BA1A 2WFBA 2G8IA 1HNWK 4DR4K 2O4GA 1TUYA 1BCMA 4CIGA 3ZCMA 3FZMA 3LPTA 1X1PA 2X74A 1Y97A 3AVHA 5JLFA 4O4GA 1RTJA 1XHZA 3AO1A 3VQ5A 4CJQA 4BWMA 3JAMO 3TARA 3CM5A 1S22A 2V7ZA 2P9UA 3H1QA 1N32K 3CFOA 1SKWA 1ZC6A 1U04A 4BRGA 3LALA 3J7YP 1LWFA 3ID8A 4H0VB 4CEQA 5F1XA 4FVUA 3E1YA 3NF6A 1ATSA 3OYMA 3H46O 2IGIA 4CBUA 5MLCQ 2A1SA 5ELZA 4DTPA 4CF1A 4YDUC 4BR7A 3HP6A 5BR8K 5DM6L 5KI6A 3ZEUA 1P8ZA 1WBBA 4OO1J 1LAWA 5BPLA 3SAGA 1LAVA 5AQTA 4KAZA 1WSHA 1TAQA 4WCEL 3PUFA 4B9MA 1SZ2A 4JEPA 3LDOA 4BRNA 4B8CA 2Z1HA 1HRHA 3CQYA 2ZGZA 1S6PA 4YOWA 3NVKA 3NCIA 4BY9C 1TGOA 3SBGA 4CJWA 4QOZB 3VF6A 3U3YA 1ZBLA 3W3DA 3LAMA 1Z05A 2Z1IA 1KQSM 3KWIA 4K0KK 1WSIA 2OPSA 5LY3A 3E9PA 1IBKK 4CZGA 2NRRA 4JI8K 3U8XA 4DR3K 5EXWA 2X6SA 2WC9A 5AQLA 4BDPA 4AM6A 4BRLA 4W5NA 4OKJA 4DV4K 3V9SA 3GE1A 4LF6K 4CZKA 3MDQA 1L3UA 4CIFA 4JD2A 5HL7L 1QQOA 5JS1A 2O8FB 3ZX2A 1LWCA 3ID6A 3AA3A 4H5VA 4OJRA 3CC4N 2QWOA 4DTOA 5TKWA 2XHBA 1HKCA 3MN9A 4OGCA 2D0AA 3OW2M 1X3NA 1NJWA 3PLAA 3VQ8A 4FWQA 5M1FA 3TU5A 4CGIA 3IG1A 4U7BA 2HBMA 1FK9A 5FROA 3K0SA 5M1PA 1KFDA 2FF6A 3WEEB 4BACA 2DPNA 1X9JA 4N56A 3VMFB 3SQ0A 3BY5A 3ZSZA 4I7FA 3EYZA 2OPPA 4FZZA 4CJVA 2O8EA 4B3RK 3R1XA 1NKCA 3IRXA 1CXUA 1Z25A 3K5NA 1VRTA 4B9VA 3WXMB 1J9AA 5CZ1A 1WSEA 4DQQA 3O6WA 2UXBK 3A5OC 1N36K 3PY8A 3LWLA 4F4KA 4KFBA 3TTFA 2OYQA 5CR4A 5AQMA 3VQPA 4DU4A 4RG8A 2AJQA 3I0SA 3BF3A 4DSIA 3J8AA 5H1SQ 4NXNK 3WQTA 2E2OA 2NUBA 3EKSA 3TAEA 1C0FA 5GAGP 1JLQA 3L8BA 4O8UA 1D5AA 4J2BA 4JI7K 5AQJA 2ZD1A 2F7TA 1ZBUA 3QEWA 3AVMA 1BQMA 2IS3A 1C0MA 4BG9A 3HZ6A 4IBNA 1HNIA 1ITGA 1RCHA 1C0TA 4DQPA 1VQKN 3ZT3A 4AM7A 1XMQK 4DSJA 4MLHA 4KTWA 2HW3A 4MO5A 1GOCA 1YJWN 4O5FA 1J6ZA 2OA8A 1TKXA 4FM0A 4OPAA 1A5XA 1NK5A 4FJHA 3H3NO 4IEEA 1X9MA 3F9MA 4W5OA 3PSIA 2IAJA 1TK0A 2FBYA 5AZIB 2ZJPL 2XY6A 1WLJA 2HBJA 1IKYA 3HM8A 5AZJB 4NO7A 4EFHA 4AQYK 1RT2A 4H0OA 4WQ5A 4HUEA 3H08A 3ZSWA 1T6DA 4E1NA 2DFHA 2VG5A 4U67L 1L5UA 1CLQA 4JI3K 4JI0K 3V9WA 4LD0A 4CJSA 1OVQA 5GIOA 3WNEA 3R6MA 1NK7A 3AY9A 1VQLN 3KJVA 4DTNA 3TAPA 4FLTA 2NRVA 4YFUA 4E0DA 5GAHP 5AQQA 4CZHA 1ASVA 1VQNN 4FK2A 3ZT0A 2BH1A 5JLHA 4H5NA 1GLEG 3KVGA 3V81A 4XH4A 1YF5L 2P9NB 1EKEA 4BC2A 4ID1A 4CJEA 3ZLJA 1QE1A 3HT3A 1L3VA 1K6YA 2E2QA 1WAFA 1KVCA 2A3ZA 4O0JA 1C0UA 3DI6A 4AHVA 1S1UA 1Z26A 2Z1GA 4ISGA 4DF8A 4LF8K 5ADXA 1NGIA 2YNGA 4KV8A 4EP4A 2KZZA 3NAEA 1H1VA 4CEOA 2FSKA 2OZSA 1RDDA 1HJRA 4WFBL 3OYHA 3U3GA 1VSHA 2O8FA 3AA2A 5AQWA 3J7AP 4PKGA 2X6NA 3F5TA 4Z4FA 2I7PA 2XY8A 2G8UA 4KTQA 4M3TA 4CJLA 2YHYA 5HROA 1B9DA 1S1XA 5GINA 4C8OA 4HWIA 2EHGA 2FLOA 4CJKA 3AV9A 3C7NB 4CF9A 3O8MA 1BUPA 5FPDA 4QS9A 1NK0A 4EIAA 3MK6A 3KLFA 2VG7A 2E2PA 3JXUA 4LFAK 3HK2A 1RBSA 2IIRA 4LSNA 3AO4A 2HHUA 2F9WA 4RW8A 4GVMA 3UB5A 4CZIA 2ASPA 3S3NA 2WBNA 2RHKA 3WEEA 1KVBA 4KTZA 1KSPA 2FBVA 3QEPA 3LPUA 3TI0A 3G0ZA 4DR5K 3SAFA 5I3UA 2ASOA 2R7YA 1TAUA 3DYAA 4MQ3A 4DF4A 3WNFA 3RR8A 1ESVA 1VSJA 5F2RA 4CBWA 4DV3K 1WSJA 3LDQA 4FJ8A 3ULDA 2O4IA 3NF9A 3SNNA 3C0BA 1LWEA 2KLAA 3TSQA 1S1TA 3BZKA 3AVAA 3UKUB 4H4MA 3OYFA 3V9ZA 3KK7A 4FK4A 4IG0A 3L3VA 3ASMA 1IKWA 4B1XB 2YCHA 3O3FA 4BROA 4HHTA 3O5BA 3ITHA 4MFBA 3AGRA 1VQMN 3SPYA 2QKBA 1KAXA 2OANA 4GKKK 1TK8A 4CK2A 3AARA 1QQNA 5KGWA 2P51A 4FWLA 5AQIA 5T7BA 4KI4A 3NGYA 2HHTA 3B6PA 4H8KA 4BC3A 4FLXA 3K9JA 1ASUA 4RW4A 1T8EA 2YNFA 2Q97A 4CHYA 5AQYA 4DWIA 5JMVA 4YY3K 4X64K 5J1EA 4WFNL 4JYAK 4IKFA 4JS4A 3SAHA 4AILC 1KRPA 4N76A 3HYFA 1JLGA 5AZJA 1CZ9A 3SUOA 2D5RA 3TPQA 1YIJN 4M7XA 3T3FA 3O1WA 4KHUA 4N41A 3L2UA 5HLFA 1EO1A 2E6LA 2E1YA 3P4IA 3SUQA 3OJUA 2HVIA 3ZYYX 3NGZA 2VGNA 1NM1A 3OTOK 1EX4A 3MCAB 3TTDA 3FZKA 2HB5A 3VEYA 4BREA 3CQ8A 4M45A 3THYB 4DTRA 3O4QA 5HOOA 1WOQA 3G4SN 3CC7N 3IS9A 2VCPA 4IFVA 4K43A 1DTTA 5HRPA 3OS0A 5AQNA 3QDKA 4Y1DA 3UKRB 4DHYA 4F8RA 3KHYA 2WONA 3U9DA 4B1ZA 4EAHD 3KD1E 3D6RA 2P9NA 1E3MA 4C23A 4DSFA 4GY2B 4N47A 1V4SA 4H4OA 3MN6A 4GMJB 3RWUA 3IFRA 2QA4N 3ATVA 4KHYA 3DLRA 2IC3A 2HHSA 1C0GA 1KLMA 3SMSA 2WTUA 2KFZA 4Q0BA 2G8VA 3TAFA 1VAZA 4OLBA 2ATQA 2O8BB 1C1CA 2A41A 3KLEA 3S9HA 2D0CA 5ADXH 3V1RA 3VESA 3HP9A 3CCEN 4A59A 1EP4A
chains in the Genus database with same CATH topology
1WSIA 2HNZA 1WSGA 2OPSA 4OVLA 5KTQA 1NJZA 1WAJA 4F2SA 1O1WA 1NK8A 3ZSRA 2YNHA 3QNOA 3MXIA 1BCOA 2QXFA 3VQ7A 1LW2A 5CY4A 1UAXA 1CXQA 3EY1A 4JRPA 4OKEA 2HHQA 2X6SA 1F21A 1QSYA 3SI6A 4BDPA 4KREA 5SZTA 4Z4IA 2ETJA 1TKTA 4AHTA 1S6QA 1R0AA 4KO0A 2GUIA 4E7LA 1BISA 3QIOA 4J2DA 4W5NA 3DRRA 3NDKA 4DTJA 4RW7A 3OYKA 4DQSA 5HROA 4OKJA 4E7HA 3V9SA 4C8KA 2VWKA 2JGUA 5E41A 3JYTA 1L3UA 4I9QA 4PA1A 1IKXA 3NF7A 4DG1A 1HYZA 1S9GA 1WN7A 4CIFA 4XIUA 4KHWA 3VQDA 2YV0X 5SWMA 5JS1A 3DRSA 3M8PA 1LWCA 1VSKA 4BE1A 5J2MA 4M41A 1QS4A 3AA3A 1I39A 5HRNA 4OJRA 2KTQA 1SUQA 4BE2A 4CF8A 4CJTA 3SV4A 3MEGA 4DTOA 4KB0A 1VSIA 2ZQBA 4DSEA 4B9SA 3P83D 2XHBA 1WSFA 3CM6A 2B6AA 1KLNA 4OGCA 3QINA 2D0AA 4DTXA 2Y1JA 3ZSXA 3RMDA 1CZBA 3HVRA 1RDBA 1NJWA 4DSKA 3VQ8A 2BE2A 4OPJA 2BDPA 4KB1A 4Z4GA 3PO4A 3UIQA 4JRQA 4CGIA 3K2PA 3ZT1A 1IH7A 1A5WA 4J2AA 3IG1A 1G15A 3ZSQA 3S3MA 1FK9A 5FROA 1ASWA 1JL1A 2OPRA 2YHBA 1ZYQA 1NOZA 1B9FA 3SQ1A 4M3YA 4Z4EA 4G1QA 4DSLA 1KFDA 1RT5A 4BACA 4I9LA 3OVNA 1VSMA 5KRTA 4Z4HA 4N56A 4DFKA 3SQ0A 2Q3SA 2HHVA 2HHWA 4CIEA 3ZSZA 4I7FA 2LSNA 3EYZA 2OPPA 4FZZA 4CJVA 4J2EA 1N5YA 1BI4B 3QO9A 5I42A 1FKPA 1J53A 3NHGA 3S3OA 2G8FA 1NKCA 2GBZA 1S9EA 3IRXA 4PUOA 1CXUA 3OYNA 1Z25A 3VQAA 3K5NA 3K59A 1VRTA 3AO3A 3K5MA 2E6MA 3MXMA 2XY5A 1J9AA 1GOAA 3OYEA 1NJYA 5CZ1A 1RT3A 1WSEA 4CERA 3M8SA 4DQQA 4W5RA 3PY8A 4TSXA 3VA3A 3LWLA 4ELTA 4KFBA 4CHNA 1DTQA 3DLHA 4F4KA 3QEXA 1RT4A 2OYQA 3IAYA 1RBRA 4DTMA 4DU4A 3VQPA 3LP2A 4HTUA 5DK5A 1JLFA 4CEEA 3LWMA 5KRSA 4RG8A 1KCFA 3OYDA 1RBVA 3V9XA 2AJQA 3FFIA 3NF8A 3I0SA 3TABA 4DSIA 5K14A 4FLYA 1RNHA 1X9WA 1NOYA 2NUBA 2P1JA 4FM1A 4BWJA 2HHXA 1NKBA 1DLOA 3TAEA 3AA5X 4ZHRA 1SL2A 3L8BA 2D0BA 1JLQA 2XO7A 1J5OA 4M3XA 1HQEA 4ZTFA 3KTQA 4NCBA 1D5AA 3AVBA 4J2BA 5FDLA 3SPZA 4FJMA 2RKIA 3DLKA 1TKDA 2ZD1A 3V1QA 3WNGA 1ZBUA 3QEWA 3AVMA 4LH5A 4Y1CA 3ZT2A 4FZXC 3C95A 4C8LA 1BQMA 2IS3A 1C0MA 4DQIA 1JLCA 4KTQA 1B92A 3OS2A 4HCCA 2F96A 2F8SA 3DMJA 3OY9A 4IBNA 4B9UA 4FZYA 4F3TA 1HNIA 1ITGA 1RCHA 3V6DA 1C0TA 4DQPA 3LP0A 4LH4A 3ZT3A 2A1RA 4DSJA 4C8MA 3O3HA 4DTUA 4KTWA 2HW3A 3VQEA 1GOCA 4IDKA 5HRSA 1BL3A 4AHUA 5FRMA 3AO5A 4F3OA 3LANA 4NCGA 4E3SA 3M8RA 2OA8A 3KK2A 1D8YA 1BIZA 1TKXA 1UOCA 1BIUA 2X78A 3VQ9A 3NGIA 4FM0A 1NK5A 1A5XA 1HYVA 3KLIA 3KK3A 4JS5A 1QSSA 4FJHA 3VQBA 4W5QA 1L3TA 5FRNA 3MAQA 1X9MA 4W5OA 2IAJA 4CHZA 1SV5A 2FBYA 1TK0A 3AVKA 2Z1JA 2HVHA 1RDAA 4E7KA 2XY6A 1WLJA 2FBTA 4QAGA 4E7IA 1HYSA 1IKYA 3CYMA 4UQGA 3AVCA 5C42A 1RT2A 1EXQA 4FLWA 4CEDA 1X9SA 2EX3A 3LAKA 4HUEA 3H08A 3OJSA 1KVAA 1SL1A 3ZSWA 4CJUA 4N5SA 2XY7A 4E1NA 4ELVA 2DFHA 2VG5A 3C6UA 2WOMA 4RW9A 3HPHA 3L2RA 4FCYA 1L5UA 1CLQA 3SV3A 4FLZA 3V9WA 1TKZA 4E1MA 4EZ9A 4LD0A 2DTUA 4CJSA 4KI6A 4PWDA 1S1WA 3WNEA 3LZJA 1NK7A 1VSFA 3KJVA 1MU2A 2YNIA 4DTNA 3TAPA 2B4JA 3CG7A 4FLTA 2IOCA 4YFUA 3T1AA 4GW6A 3ISNC 4E0DA 2G8KA 4FJ7A 2W42A 4CEFA 4B3OA 3OYIA 4DLEA 1ASVA 4CFDA 1NK4A 4FK2A 5C24A 4B9VA 4CHPA 3ZT0A 5JS2A 1BQNA 3KKSA 3O4NA 3LP1A 3AVLA 1YTUA 5CYQA 1REVA 4CF0A 3V81A 1VSEA 4WE1A 2PY5A 3AVNA 4PQUA 3SJJA 4HUFA 4M3ZA 4OGEA 1EKEA 4ID1A 3U6FA 4B9TA 4CJEA 2ZE2A 4LY7A 3ZSOA 3LZIA 1QE1A 4CJFA 1RBUA 4RW6A 4KRFA 3SCXA 4DFPA 1UA1A 1LW0A 3HT3A 3TAGA 1XI1A 1LV5A 1L3VA 2G8WA 1SKRA 3MEDA 2YKMA 3NFAA 1K6YA 3C6TA 2PYLA 1NK9A 4FYDA 1WAFA 1KVCA 4CESA 4O0JA 1YTAA 2F8TA 4OKKA 3QEIA 2P5GA 1C0UA 3OYLA 1GOBA 3DI6A 4AHVA 3DRPA 1RT6A 2Z1GA 2DFEA 1S1UA 1Z26A 3DOLA 3CFRA 5CYMA 4DF8A 3SQ2A 1VK0A 4K8XA 2YNGA 4KV8A 4EP4A 2KZZA 2KW4A 4B8AB 4CEBA 4CGHA 3NAEA 2KZMA 3QEVA 3VQCA 4CEOA 3QNNA 2OZSA 3JSMA 4CK1A 1RDDA 1XC9A 1D9DA 1HJRA 3OYHA 4FJGA 3F73A 4FJNA 1U4BA 3U3GA 1VSHA 4CEZA 3AA2A 4CGDA 4M3TA 1FKOA 1W0HA 3L3UA 1TL1A 3E01A 2X6NA 4M3WA 1ZBFA 1J54A 4O5BA 4KPYA 1EETA 4Z4FA 2XY8A 1RDCA 2VG6A 4CFBA 3QETA 2G8UA 1JXEA 2P5OA 1C1AA 4IFYA 4CK3A 1RTIA 4CJLA 3K5LA 1B9DA 3RRHA 1S1XA 4CGJA 4CGGA 5J2QA 4CF2A 4C8OA 2EHGA 3DOKA 3QIPA 3KLGA 2Y1IA 4O55A 4NYNA 4EP5A 3AV9A 4CJKA 4DQRA 4CF9A 3TR8A 5C25A 1JLAA 1L3SA 4FJIA 1NK0A 1UWBA 4I2PA 1YVUA 3KLFA 5DMRA 1U47A 2RN2A 4FJKA 4KHNA 1T03A 2VG7A 4ZTJA 1UA0A 4E19A 2I5JA 3HK2A 4AH9A 1RBSA 4LSNA 4OPKA 3AO4A 3AVFA 3SQ4A 4DFMA 4RW8A 4GVMA 4FVMA 2HHUA 3S3NA 1IKVA 4HUGA 3B6OA 2YKNA 1TL3A 2FBXA 4LSLA 3TAMA 1ZBIA 1KVBA 4KTZA 3K58A 5J2NA 1KSPA 1RT1A 2FBVA 1TV6A 3VQQA 3VN5A 3LPUA 3QEPA 3TI0A 4W5TA 3G0ZA 3HPOA 4FW2A 2BGGA 5I3UA 3PV8A 1FXXA 4KKOA 5HP1A 3D45A 2R7YA 2HNYA 4FJ5A 2ITGA 3DYAA 4MQ3A 4DS5A 1TAUA 1IO2A 4DF4A 1VSLA 1BI4A 4CJ4A 3WNFA 4FJ9A 4AHRA 3RR8A 3I8DA 4IG3A 4PY5A 4OLAA 1VSJA 3QESA 4FJXA 1WSJA 4FJ8A 3OYBA 2YHAA 3ULDA 2O4IA 2JLEA 4Z4CA 1U48A 4L8RB 3VQ6A 4CHQA 3L2WA 1KFSA 3ALYA 3F9KA 1HMVA 4AHCA 4CHOA 3RRGA 3PX6A 2PYJA 3NF9A 3SNNA 2DY4A 3LDSA 3NH0A 1KTQA 3SUNA 4KHSA 1S5JA 4O44A 3KIOA 4FJLA 2IDOA 1LWEA 1I3AA 1C6VA 4JLHA 3WNHA 3L2VA 5HRRA 1S1TA 4Q5VA 2XRIA 1U45A 3DLBA 3AVAA 4KHQA 4FXDA 4H4MA 3OYFA 2PZSA 3V9ZA 3OYAA 1N6QA 2G8HA 3RR7A 4CEAA 1XHXA 3L3VA 4IG0A 3ASMA 1IKWA 2E4LA 3L2QA 3OYGA 3RMCA 1TK5A 3OYJA 1RBTA 1JLBA 4EZ6A 3HM9A 1WNSA 3O3FA 4HHTA 4R5PA 3HPGA 1QSLA 3ITHA 3I0RA 3VQ4A 4FJJA 3HXMA 4FK4A 3T19A 3QERA 4MFBA 2DFFA 4BDYA 4B08A 3SPYA 3PO5A 3D0PA 2QKBA 1IG9A 1TK8A 3AA4A 4CK2A 3HJFA 3MECA 3VA0A 4CECA 1T7PA 1TVRA 1W9HA 2KQ2A 1SKSA 3A2FA 4F2RA 4M42A 4E89A 5CZ2A 2P51A 5KGWA 5T7BA 4DS4A 1VSDA 3KK1A 4I2QA 4FM2A 4KI4A 1VRUA 3HVTA 3NGYA 4CJRA 1JLEA 2VWJA 2HHTA 5J2PA 3AVJA 3RMAA 3B6PA 4H8KA 1YT3A 4NCAA 3NH1A 4FLXA 2GV9A 4Z0UA 4RW4A 1ASUA 1T8EA 4DU3A 4ELUA 1Q9XA 2YNFA 4QCLA 2G8IA 1JL2A 4CHYA 1BGXT 1HPZA 2O4GA 3HSTB 4DWIA 1BCMA 2FC0A 4CIGA 3THVA 1NJXA 3ZCMA 3LPTA 1X1PA 2X74A 1Y97A 3AVHA 3HO1A 4O4GA 3DM2A 1RTJA 4ID5A 4DU1A 1XHZA 5J1EA 3AO1A 3VQ5A 2KFNA 4HVJA 3AVGA 4DFJA 4CJQA 3RMBA 1S1VA 2RPIA 4CFCA 4IKFA 4JS4A 3NH2A 3LP3A 3NBPA 4AILC 1KRPA 2B5JA 3HYFA 1JLGA 1RT7A 4BWMA 3OYCA 3CM5A 3TARA 4N76A 3SUOA 1CZ9A 1JXBA 4B9LA 2D5RA 3CFOA 4YNQA 1HQUA 1SKWA 3KKRA 3SUPA 1U04A 3ZT4A 4CFAA 3T3FA 4AHSA 3V1OA 3LALA 3ZSYA 3M8QA 3V4IA 1U49A 3PX4A 1T05A 3ZSVA 4N41A 4KHUA 1LWFA 3L2UA 5HLFA 4B9NA 4CJPA 2E6LA 3SUQA 4FLVA 4CJ5A 3OJUA 2HVIA 3NGZA 4CEQA 1C1BA 3K5OA 4BE0A 1EX4A 1QHTA 3P5JA 3TANA 1NKEA 3DLEA 3NF6A 3KD5E 3SYZA 2HB5A 1SL0A 3CQ8A 3OYMA 4M45A 3P1GA 2IGIA 4DTRA 3RTVA 3O4QA 1RTDA 1NK6A 2QKKA 2A1SA 3IS9A 4IFVA 5EU7A 3O3GA 4DTPA 1DTTA 4FK0A 5HRPA 4CF1A 3OS0A 5HBMA 3C94A 3HP6A 3BDPA 4Y1DA 4E7JA 4M3RA 5KI6A 1QQCA 3EZ5A 4F8RA 2WONA 4DLGA 2HMIA 1A5VA 4DTSA 3HL8A 1LAWA 3KD1E 1Q8IA 4CJ3A 1ZBHA 4FLUA 3MEEA 1LAVA 1BHLA 3BGRA 1JKHA 1WSHA 1TAQA 4KAZA 3K57A 4DSFA 3PUFA 4N47A 4B9MA 4ICLA 4C8NA 4M3UA 4BDZA 4CCHA 3TAQA 4B8CA 1HNVA 4H4OA 2Z1HA 3SZ2A 3G10A 1HRHA 1Q9YA 2OZMA 3DLGA 4GMJB 3RWUA 3AVIA 4CGFA 1S6PA 3PX0A 5D3GA 4FW1A 3AO2A 3V9UA 4KHYA 3NE6A 3NCIA 3DLRA 3CFPA 3MXJA 1QTMA 1TGOA 2IC3A 2HHSA 4CJWA 2OPQA 4K8ZA 4QOZB 1KLMA 4O0IA 2KFZA 4Q0BA 2G8VA 2BANA 3U3YA 3QLHA 3TAFA 2ATQA 3KLHA 4OLBA 1C1CA 1RTHA 1ZBLA 2RF2A 3KLEA 3S9HA 2HNDA 4HCBA 3TWHA 4CE9A 2D0CA 5KGXA 4NYFA 2QK9A 3LAMA 1XWLA 3V1RA 3OS1A 1RILA 4DMNA 2Z1IA 3HP9A 1D9FA 1EP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSI A;  2HNZ A;  1WSG A;  2OPS A;  4OVL A;  5KTQ A;  1NJZ A;  1WAJ A;  4F2S A;  1O1W A;  1NK8 A;  3ZSR A;  2YNH A;  3QNO A;  3MXI A;  1BCO A;  2QXF A;  3VQ7 A;  1LW2 A;  5CY4 A;  1UAX A;  1CXQ A;  3EY1 A;  4JRP A;  4OKE A;  2HHQ A;  2X6S A;  1F21 A;  1QSY A;  3SI6 A;  4BDP A;  4KRE A;  5SZT A;  4Z4I A;  2ETJ A;  1TKT A;  4AHT A;  1S6Q A;  1R0A A;  4KO0 A;  2GUI A;  4E7L A;  1BIS A;  3QIO A;  4J2D A;  4W5N A;  3DRR A;  3NDK A;  4DTJ A;  4RW7 A;  3OYK A;  4DQS A;  5HRO A;  4OKJ A;  4E7H A;  3V9S A;  4C8K A;  2VWK A;  2JGU A;  5E41 A;  3JYT A;  1L3U A;  4I9Q A;  4PA1 A;  1IKX A;  3NF7 A;  4DG1 A;  1HYZ A;  1S9G A;  1WN7 A;  4CIF A;  4XIU A;  4KHW A;  3VQD A;  2YV0 X;  5SWM A;  5JS1 A;  3DRS A;  3M8P A;  1LWC A;  1VSK A;  4BE1 A;  5J2M A;  4M41 A;  1QS4 A;  3AA3 A;  1I39 A;  5HRN A;  4OJR A;  2KTQ A;  1SUQ A;  4BE2 A;  4CF8 A;  4CJT A;  3SV4 A;  3MEG A;  4DTO A;  4KB0 A;  1VSI A;  2ZQB A;  4DSE A;  4B9S A;  3P83 D;  2XHB A;  1WSF A;  3CM6 A;  2B6A A;  1KLN A;  4OGC A;  3QIN A;  2D0A A;  4DTX A;  2Y1J A;  3ZSX A;  3RMD A;  1CZB A;  3HVR A;  1RDB A;  1NJW A;  4DSK A;  3VQ8 A;  2BE2 A;  4OPJ A;  2BDP A;  4KB1 A;  4Z4G A;  3PO4 A;  3UIQ A;  4JRQ A;  4CGI A;  3K2P A;  3ZT1 A;  1IH7 A;  1A5W A;  4J2A A;  3IG1 A;  1G15 A;  3ZSQ A;  3S3M A;  1FK9 A;  5FRO A;  1ASW A;  1JL1 A;  2OPR A;  2YHB A;  1ZYQ A;  1NOZ A;  1B9F A;  3SQ1 A;  4M3Y A;  4Z4E A;  4G1Q A;  4DSL A;  1KFD A;  1RT5 A;  4BAC A;  4I9L A;  3OVN A;  1VSM A;  5KRT A;  4Z4H A;  4N56 A;  4DFK A;  3SQ0 A;  2Q3S A;  2HHV A;  2HHW A;  4CIE A;  3ZSZ A;  4I7F A;  2LSN A;  3EYZ A;  2OPP A;  4FZZ A;  4CJV A;  4J2E A;  1N5Y A;  1BI4 B;  3QO9 A;  5I42 A;  1FKP A;  1J53 A;  3NHG A;  3S3O A;  2G8F A;  1NKC A;  2GBZ A;  1S9E A;  3IRX A;  4PUO A;  1CXU A;  3OYN A;  1Z25 A;  3VQA A;  3K5N A;  3K59 A;  1VRT A;  3AO3 A;  3K5M A;  2E6M A;  3MXM A;  2XY5 A;  1J9A A;  1GOA A;  3OYE A;  1NJY A;  5CZ1 A;  1RT3 A;  1WSE A;  4CER A;  3M8S A;  4DQQ A;  4W5R A;  3PY8 A;  4TSX A;  3VA3 A;  3LWL A;  4ELT A;  4KFB A;  4CHN A;  1DTQ A;  3DLH A;  4F4K A;  3QEX A;  1RT4 A;  2OYQ A;  3IAY A;  1RBR A;  4DTM A;  4DU4 A;  3VQP A;  3LP2 A;  4HTU A;  5DK5 A;  1JLF A;  4CEE A;  3LWM A;  5KRS A;  4RG8 A;  1KCF A;  3OYD A;  1RBV A;  3V9X A;  2AJQ A;  3FFI A;  3NF8 A;  3I0S A;  3TAB A;  4DSI A;  5K14 A;  4FLY A;  1RNH A;  1X9W A;  1NOY A;  2NUB A;  2P1J A;  4FM1 A;  4BWJ A;  2HHX A;  1NKB A;  1DLO A;  3TAE A;  3AA5 X;  4ZHR A;  1SL2 A;  3L8B A;  2D0B A;  1JLQ A;  2XO7 A;  1J5O A;  4M3X A;  1HQE A;  4ZTF A;  3KTQ A;  4NCB A;  1D5A A;  3AVB A;  4J2B A;  5FDL A;  3SPZ A;  4FJM A;  2RKI A;  3DLK A;  1TKD A;  2ZD1 A;  3V1Q A;  3WNG A;  1ZBU A;  3QEW A;  3AVM A;  4LH5 A;  4Y1C A;  3ZT2 A;  4FZX C;  3C95 A;  4C8L A;  1BQM A;  2IS3 A;  1C0M A;  4DQI A;  1JLC A;  4KTQ A;  1B92 A;  3OS2 A;  4HCC A;  2F96 A;  2F8S A;  3DMJ A;  3OY9 A;  4IBN A;  4B9U A;  4FZY A;  4F3T A;  1HNI A;  1ITG A;  1RCH A;  3V6D A;  1C0T A;  4DQP A;  3LP0 A;  4LH4 A;  3ZT3 A;  2A1R A;  4DSJ A;  4C8M A;  3O3H A;  4DTU A;  4KTW A;  2HW3 A;  3VQE A;  1GOC A;  4IDK A;  5HRS A;  1BL3 A;  4AHU A;  5FRM A;  3AO5 A;  4F3O A;  3LAN A;  4NCG A;  4E3S A;  3M8R A;  2OA8 A;  3KK2 A;  1D8Y A;  1BIZ A;  1TKX A;  1UOC A;  1BIU A;  2X78 A;  3VQ9 A;  3NGI A;  4FM0 A;  1NK5 A;  1A5X A;  1HYV A;  3KLI A;  3KK3 A;  4JS5 A;  1QSS A;  4FJH A;  3VQB A;  4W5Q A;  1L3T A;  5FRN A;  3MAQ A;  1X9M A;  4W5O A;  2IAJ A;  4CHZ A;  1SV5 A;  2FBY A;  1TK0 A;  3AVK A;  2Z1J A;  2HVH A;  1RDA A;  4E7K A;  2XY6 A;  1WLJ A;  2FBT A;  4QAG A;  4E7I A;  1HYS A;  1IKY A;  3CYM A;  4UQG A;  3AVC A;  5C42 A;  1RT2 A;  1EXQ A;  4FLW A;  4CED A;  1X9S A;  2EX3 A;  3LAK A;  4HUE A;  3H08 A;  3OJS A;  1KVA A;  1SL1 A;  3ZSW A;  4CJU A;  4N5S A;  2XY7 A;  4E1N A;  4ELV A;  2DFH A;  2VG5 A;  3C6U A;  2WOM A;  4RW9 A;  3HPH A;  3L2R A;  4FCY A;  1L5U A;  1CLQ A;  3SV3 A;  4FLZ A;  3V9W A;  1TKZ A;  4E1M A;  4EZ9 A;  4LD0 A;  2DTU A;  4CJS A;  4KI6 A;  4PWD A;  1S1W A;  3WNE A;  3LZJ A;  1NK7 A;  1VSF A;  3KJV A;  1MU2 A;  2YNI A;  4DTN A;  3TAP A;  2B4J A;  3CG7 A;  4FLT A;  2IOC A;  4YFU A;  3T1A A;  4GW6 A;  3ISN C;  4E0D A;  2G8K A;  4FJ7 A;  2W42 A;  4CEF A;  4B3O A;  3OYI A;  4DLE A;  1ASV A;  4CFD A;  1NK4 A;  4FK2 A;  5C24 A;  4B9V A;  4CHP A;  3ZT0 A;  5JS2 A;  1BQN A;  3KKS A;  3O4N A;  3LP1 A;  3AVL A;  1YTU A;  5CYQ A;  1REV A;  4CF0 A;  3V81 A;  1VSE A;  4WE1 A;  2PY5 A;  3AVN A;  4PQU A;  3SJJ A;  4HUF A;  4M3Z A;  4OGE A;  1EKE A;  4ID1 A;  3U6F A;  4B9T A;  4CJE A;  2ZE2 A;  4LY7 A;  3ZSO A;  3LZI A;  1QE1 A;  4CJF A;  1RBU A;  4RW6 A;  4KRF A;  3SCX A;  4DFP A;  1UA1 A;  1LW0 A;  3HT3 A;  3TAG A;  1XI1 A;  1LV5 A;  1L3V A;  2G8W A;  1SKR A;  3MED A;  2YKM A;  3NFA A;  1K6Y A;  3C6T A;  2PYL A;  1NK9 A;  4FYD A;  1WAF A;  1KVC A;  4CES A;  4O0J A;  1YTA A;  2F8T A;  4OKK A;  3QEI A;  2P5G A;  1C0U A;  3OYL A;  1GOB A;  3DI6 A;  4AHV A;  3DRP A;  1RT6 A;  2Z1G A;  2DFE A;  1S1U A;  1Z26 A;  3DOL A;  3CFR A;  5CYM A;  4DF8 A;  3SQ2 A;  1VK0 A;  4K8X A;  2YNG A;  4KV8 A;  4EP4 A;  2KZZ A;  2KW4 A;  4B8A B;  4CEB A;  4CGH A;  3NAE A;  2KZM A;  3QEV A;  3VQC A;  4CEO A;  3QNN A;  2OZS A;  3JSM A;  4CK1 A;  1RDD A;  1XC9 A;  1D9D A;  1HJR A;  3OYH A;  4FJG A;  3F73 A;  4FJN A;  1U4B A;  3U3G A;  1VSH A;  4CEZ A;  3AA2 A;  4CGD A;  4M3T A;  1FKO A;  1W0H A;  3L3U A;  1TL1 A;  3E01 A;  2X6N A;  4M3W A;  1ZBF A;  1J54 A;  4O5B A;  4KPY A;  1EET A;  4Z4F A;  2XY8 A;  1RDC A;  2VG6 A;  4CFB A;  3QET A;  2G8U A;  1JXE A;  2P5O A;  1C1A A;  4IFY A;  4CK3 A;  1RTI A;  4CJL A;  3K5L A;  1B9D A;  3RRH A;  1S1X A;  4CGJ A;  4CGG A;  5J2Q A;  4CF2 A;  4C8O A;  2EHG A;  3DOK A;  3QIP A;  3KLG A;  2Y1I A;  4O55 A;  4NYN A;  4EP5 A;  3AV9 A;  4CJK A;  4DQR A;  4CF9 A;  3TR8 A;  5C25 A;  1JLA A;  1L3S A;  4FJI A;  1NK0 A;  1UWB A;  4I2P A;  1YVU A;  3KLF A;  5DMR A;  1U47 A;  2RN2 A;  4FJK A;  4KHN A;  1T03 A;  2VG7 A;  4ZTJ A;  1UA0 A;  4E19 A;  2I5J A;  3HK2 A;  4AH9 A;  1RBS A;  4LSN A;  4OPK A;  3AO4 A;  3AVF A;  3SQ4 A;  4DFM A;  4RW8 A;  4GVM A;  4FVM A;  2HHU A;  3S3N A;  1IKV A;  4HUG A;  3B6O A;  2YKN A;  1TL3 A;  2FBX A;  4LSL A;  3TAM A;  1ZBI A;  1KVB A;  4KTZ A;  3K58 A;  5J2N A;  1KSP A;  1RT1 A;  2FBV A;  1TV6 A;  3VQQ A;  3VN5 A;  3LPU A;  3QEP A;  3TI0 A;  4W5T A;  3G0Z A;  3HPO A;  4FW2 A;  2BGG A;  5I3U A;  3PV8 A;  1FXX A;  4KKO A;  5HP1 A;  3D45 A;  2R7Y A;  2HNY A;  4FJ5 A;  2ITG A;  3DYA A;  4MQ3 A;  4DS5 A;  1TAU A;  1IO2 A;  4DF4 A;  1VSL A;  1BI4 A;  4CJ4 A;  3WNF A;  4FJ9 A;  4AHR A;  3RR8 A;  3I8D A;  4IG3 A;  4PY5 A;  4OLA A;  1VSJ A;  3QES A;  4FJX A;  1WSJ A;  4FJ8 A;  3OYB A;  2YHA A;  3ULD A;  2O4I A;  2JLE A;  4Z4C A;  1U48 A;  4L8R B;  3VQ6 A;  4CHQ A;  3L2W A;  1KFS A;  3ALY A;  3F9K A;  1HMV A;  4AHC A;  4CHO A;  3RRG A;  3PX6 A;  2PYJ A;  3NF9 A;  3SNN A;  2DY4 A;  3LDS A;  3NH0 A;  1KTQ A;  3SUN A;  4KHS A;  1S5J A;  4O44 A;  3KIO A;  4FJL A;  2IDO A;  1LWE A;  1I3A A;  1C6V A;  4JLH A;  3WNH A;  3L2V A;  5HRR A;  1S1T A;  4Q5V A;  2XRI A;  1U45 A;  3DLB A;  3AVA A;  4KHQ A;  4FXD A;  4H4M A;  3OYF A;  2PZS A;  3V9Z A;  3OYA A;  1N6Q A;  2G8H A;  3RR7 A;  4CEA A;  1XHX A;  3L3V A;  4IG0 A;  3ASM A;  1IKW A;  2E4L A;  3L2Q A;  3OYG A;  3RMC A;  1TK5 A;  3OYJ A;  1RBT A;  1JLB A;  4EZ6 A;  3HM9 A;  1WNS A;  3O3F A;  4HHT A;  4R5P A;  3HPG A;  1QSL A;  3ITH A;  3I0R A;  3VQ4 A;  4FJJ A;  3HXM A;  4FK4 A;  3T19 A;  3QER A;  4MFB A;  2DFF A;  4BDY A;  4B08 A;  3SPY A;  3PO5 A;  3D0P A;  2QKB A;  1IG9 A;  1TK8 A;  3AA4 A;  4CK2 A;  3HJF A;  3MEC A;  3VA0 A;  4CEC A;  1T7P A;  1TVR A;  1W9H A;  2KQ2 A;  1SKS A;  3A2F A;  4F2R A;  4M42 A;  4E89 A;  5CZ2 A;  2P51 A;  5KGW A;  5T7B A;  4DS4 A;  1VSD A;  3KK1 A;  4I2Q A;  4FM2 A;  4KI4 A;  1VRU A;  3HVT A;  3NGY A;  4CJR A;  1JLE A;  2VWJ A;  2HHT A;  5J2P A;  3AVJ A;  3RMA A;  3B6P A;  4H8K A;  1YT3 A;  4NCA A;  3NH1 A;  4FLX A;  2GV9 A;  4Z0U A;  4RW4 A;  1ASU A;  1T8E A;  4DU3 A;  4ELU A;  1Q9X A;  2YNF A;  4QCL A;  2G8I A;  1JL2 A;  4CHY A;  1BGX T;  1HPZ A;  2O4G A;  3HST B;  4DWI A;  1BCM A;  2FC0 A;  4CIG A;  3THV A;  1NJX A;  3ZCM A;  3LPT A;  1X1P A;  2X74 A;  1Y97 A;  3AVH A;  3HO1 A;  4O4G A;  3DM2 A;  1RTJ A;  4ID5 A;  4DU1 A;  1XHZ A;  5J1E A;  3AO1 A;  3VQ5 A;  2KFN A;  4HVJ A;  3AVG A;  4DFJ A;  4CJQ A;  3RMB A;  1S1V A;  2RPI A;  4CFC A;  4IKF A;  4JS4 A;  3NH2 A;  3LP3 A;  3NBP A;  4AIL C;  1KRP A;  2B5J A;  3HYF A;  1JLG A;  1RT7 A;  4BWM A;  3OYC A;  3CM5 A;  3TAR A;  4N76 A;  3SUO A;  1CZ9 A;  1JXB A;  4B9L A;  2D5R A;  3CFO A;  4YNQ A;  1HQU A;  1SKW A;  3KKR A;  3SUP A;  1U04 A;  3ZT4 A;  4CFA A;  3T3F A;  4AHS A;  3V1O A;  3LAL A;  3ZSY A;  3M8Q A;  3V4I A;  1U49 A;  3PX4 A;  1T05 A;  3ZSV A;  4N41 A;  4KHU A;  1LWF A;  3L2U A;  5HLF A;  4B9N A;  4CJP A;  2E6L A;  3SUQ A;  4FLV A;  4CJ5 A;  3OJU A;  2HVI A;  3NGZ A;  4CEQ A;  1C1B A;  3K5O A;  4BE0 A;  1EX4 A;  1QHT A;  3P5J A;  3TAN A;  1NKE A;  3DLE A;  3NF6 A;  3KD5 E;  3SYZ A;  2HB5 A;  1SL0 A;  3CQ8 A;  3OYM A;  4M45 A;  3P1G A;  2IGI A;  4DTR A;  3RTV A;  3O4Q A;  1RTD A;  1NK6 A;  2QKK A;  2A1S A;  3IS9 A;  4IFV A;  5EU7 A;  3O3G A;  4DTP A;  1DTT A;  4FK0 A;  5HRP A;  4CF1 A;  3OS0 A;  5HBM A;  3C94 A;  3HP6 A;  3BDP A;  4Y1D A;  4E7J A;  4M3R A;  5KI6 A;  1QQC A;  3EZ5 A;  4F8R A;  2WON A;  4DLG A;  2HMI A;  1A5V A;  4DTS A;  3HL8 A;  1LAW A;  3KD1 E;  1Q8I A;  4CJ3 A;  1ZBH A;  4FLU A;  3MEE A;  1LAV A;  1BHL A;  3BGR A;  1JKH A;  1WSH A;  1TAQ A;  4KAZ A;  3K57 A;  4DSF A;  3PUF A;  4N47 A;  4B9M A;  4ICL A;  4C8N A;  4M3U A;  4BDZ A;  4CCH A;  3TAQ A;  4B8C A;  1HNV A;  4H4O A;  2Z1H A;  3SZ2 A;  3G10 A;  1HRH A;  1Q9Y A;  2OZM A;  3DLG A;  4GMJ B;  3RWU A;  3AVI A;  4CGF A;  1S6P A;  3PX0 A;  5D3G A;  4FW1 A;  3AO2 A;  3V9U A;  4KHY A;  3NE6 A;  3NCI A;  3DLR A;  3CFP A;  3MXJ A;  1QTM A;  1TGO A;  2IC3 A;  2HHS A;  4CJW A;  2OPQ A;  4K8Z A;  4QOZ B;  1KLM A;  4O0I A;  2KFZ A;  4Q0B A;  2G8V A;  2BAN A;  3U3Y A;  3QLH A;  3TAF A;  2ATQ A;  3KLH A;  4OLB A;  1C1C A;  1RTH A;  1ZBL A;  2RF2 A;  3KLE A;  3S9H A;  2HND A;  4HCB A;  3TWH A;  4CE9 A;  2D0C A;  5KGX A;  4NYF A;  2QK9 A;  3LAM A;  1XWL A;  3V1R A;  3OS1 A;  1RIL A;  4DMN A;  2Z1I A;  3HP9 A;  1D9F A;  1EP4 A; 
#chains in the Genus database with same CATH topology
 2HNZ A;  2NNW A;  5KTQ A;  1WAJ A;  2YNH A;  3CQX A;  3QNO A;  2HHH K;  1CZA N;  3MXI A;  1BCO A;  2F4V K;  3VQ7 A;  1LW2 A;  5CY4 A;  1LCU A;  1NMN A;  4H5T A;  3SI6 A;  3LM2 A;  4JKE A;  4Z4I A;  2ETJ A;  4AHT A;  4AF1 A;  1S6Q A;  3CET A;  4YHH K;  1VQ8 N;  3NDK A;  4DTJ A;  3OYK A;  4B9Q A;  2P9P B;  4H5W A;  4PA1 A;  1IKX A;  3NF7 A;  1YUW A;  1HYZ A;  1WN7 A;  3A5N C;  4X62 K;  1NGH A;  5J2M A;  4M41 A;  5KPR A;  5HRN A;  5JVH L;  1SUQ A;  5E84 A;  4BE2 A;  1DGK N;  4CJT A;  3SV4 A;  4KB0 A;  1VSI A;  2ZQB A;  4DSE A;  4B9S A;  3P83 D;  1KLN A;  1T44 A;  3ZSX A;  3GG4 A;  1OVY A;  3ZT1 A;  1A5W A;  5KPT A;  1YAG A;  1ZYQ A;  3CC2 N;  3SQ1 A;  4M3Y A;  4DR7 K;  4H5R A;  4DSL A;  3UKU A;  1RT5 A;  4DQ8 A;  1J5E K;  4G9Z A;  2A40 A;  3OVN A;  2GX9 A;  1ATR A;  5KRT A;  2P9I B;  4Z4H A;  3I8B A;  4QS7 A;  2YI1 A;  3A5L C;  4J2E A;  3VEO A;  2GTD A;  5LL6 Z;  1FKP A;  1J53 A;  3NHG A;  3S3O A;  2G8F A;  1MWM A;  2YJF A;  3HRG A;  1S9E A;  3OYN A;  1QSS A;  2E6M A;  4CER A;  3M8S A;  3PIP L;  3L0Q A;  4ELT A;  2O8D B;  1RT4 A;  3QFP A;  1RBR A;  3VEX A;  4DTM A;  4Z94 A;  4HTU A;  3G25 A;  5DK5 A;  1JLF A;  3QB0 A;  4CZF A;  5KRS A;  1RBV A;  3V9X A;  2E5L K;  3FFI A;  3QIC A;  3ULE B;  3TAB A;  2Q31 A;  3HOS A;  4ZHR A;  1GLF O;  4IJA A;  4M3X A;  3KTQ A;  3AVB A;  4FJM A;  3DLK A;  3WNG A;  5AQX A;  4CI6 A;  3RVC A;  1YI2 N;  4C8L A;  2UUC K;  4DQI A;  2F8S A;  3DMJ A;  3OY9 A;  4B9U A;  1DKG D;  3V6D A;  1K8K B;  4DR2 K;  4C8M A;  4DTU A;  5BRE A;  4AHU A;  3AO5 A;  4F3O A;  1S72 N;  5IT9 O;  4NCG A;  4E3S A;  1G99 A;  1D8Y A;  2X78 A;  3VQ9 A;  4BVO A;  4FZY A;  3KK3 A;  1HYV A;  4MDA A;  1ATN A;  1NNE A;  3EEQ A;  1SV5 A;  3AVK A;  2HVH A;  1T6C A;  1VQ5 N;  3LDP A;  4QAG A;  1HYS A;  3UKR A;  5C42 A;  1X9S A;  3LAK A;  3OJS A;  1XC3 A;  1SL1 A;  1OH6 A;  5AQP A;  4CJU A;  2XY7 A;  3C6U A;  1RDW X;  3HPH A;  3OHR A;  3M1F A;  4RW9 A;  4NB4 A;  3LM9 A;  4FLZ A;  2HMP A;  4JI1 K;  1TKZ A;  2HF4 A;  2DTU A;  1GLB G;  4KH4 A;  3LZJ A;  3CCU N;  4CD1 A;  4E1J A;  1MU2 A;  3CG7 A;  4BQZ A;  4L3Q A;  1Q81 O;  3T1A A;  4DV5 K;  4DLE A;  3CCS N;  2ZM6 K;  4CD3 A;  4DR6 K;  2OTJ N;  4BR5 A;  4PKH A;  2O8B A;  4NLC A;  3AVL A;  4LF5 K;  4A57 A;  4M3Z A;  1JCE A;  1YIT N;  5EVZ A;  1V4T A;  2ZE2 A;  4CW7 B;  3WQU A;  4KRF A;  3I56 N;  4DFP A;  1OKJ A;  4JKH A;  2ASM A;  3MED A;  4K42 A;  1GLJ O;  4CES A;  1YTA A;  3A0I X;  4GNI A;  4XEI A;  4OKK A;  3QEI A;  4A5A A;  2P5G A;  3OYL A;  2DFE A;  1WUA A;  3CFR A;  2JWL A;  1K8A O;  3FZH A;  2CGL A;  3EE9 A;  4K8X A;  4B1Y B;  3EKU A;  1NJI O;  1QVG M;  2VQF K;  2P9P A;  3WT0 A;  3QEV A;  2E2N A;  3VQC A;  4C1N K;  1E4G T;  4FJG A;  4FJN A;  3F73 A;  1OH5 A;  4FWP A;  3EN9 A;  4ILH A;  4CGD A;  5KPZ A;  4BR4 A;  2GUP A;  2W6K A;  4M3W A;  1ZBF A;  1J54 A;  4O5B A;  4KPY A;  3ENB A;  3QET A;  4CFB A;  1XMO K;  2P5O A;  4PUO A;  4IFY A;  3K5L A;  2I7N A;  2VYP A;  1YJN N;  5J2Q A;  4RWT A;  4CGG A;  4CF2 A;  4BRD A;  3DOK A;  2Y1I A;  1TYQ B;  4A62 A;  4EP5 A;  4FJI A;  4JK7 A;  1UWB A;  4I2P A;  1YVU A;  5AQK A;  5EY4 A;  1U47 A;  2RN2 A;  4FJK A;  4V19 S;  2P9S B;  1NGE A;  4ZTJ A;  4E19 A;  2I5J A;  3GBT A;  4FVM A;  3ENO A;  1IKV A;  3MWT A;  1ZXO A;  2NRH A;  3B6O A;  1TL3 A;  1RT1 A;  3VEW A;  2OCE A;  2P9I A;  3BZC A;  5HP1 A;  2HNY A;  1K73 O;  4DS5 A;  1OH7 A;  3I8D A;  4IG3 A;  4OLA A;  1BO5 O;  3U4L A;  4L8R B;  1KC8 O;  1KFS A;  4KBO A;  1HMV A;  4J8F A;  2PYJ A;  3QFU A;  4ILG B;  2O8D A;  1KTQ A;  4DKW A;  4KHS A;  3KIO A;  2IDO A;  1I3A A;  1ILY A;  1BWF O;  4Q5V A;  1N6Q A;  2G8H A;  3RR7 A;  4CEA A;  1XHX A;  3VER A;  4UY8 O;  4BC4 A;  3P31 A;  2QWR A;  1VQ7 N;  1KAZ A;  3HPG A;  1QSL A;  3VQ4 A;  2EWS A;  5AQF A;  4YOT A;  4JN4 A;  3THW B;  2DFF A;  4I6M B;  3SBT A;  3E9O A;  5BPN A;  3AA4 A;  4FPA A;  2NRZ A;  3MEC A;  5LMN K;  2GWJ A;  1T7P A;  2ZGY A;  1TVR A;  3D2F B;  1SKS A;  4DS4 A;  5CZ2 A;  2V51 B;  4FM2 A;  4I2Q A;  4CJR A;  4PKI A;  2Q36 A;  3IUC A;  4YOV A;  1K8K A;  5J2P A;  3MCP A;  1W7A A;  3CCV N;  4K25 A;  2F9T A;  3EZW A;  4NCA A;  5GAD P;  3O4W A;  4IWV A;  4ELU A;  1Q9X A;  3WXK A;  3HTV A;  2W6L A;  3HST B;  2FC0 A;  3THV A;  3O9U A;  1MWK A;  3BF1 A;  1Y64 A;  3D7E O;  2WUS A;  4ID5 A;  4DU1 A;  2KFN A;  4HVJ A;  4BR9 A;  4DFJ A;  2RPI A;  3NH2 A;  3NBP A;  2OTL N;  1I94 K;  1HR0 K;  2B5J A;  1RT7 A;  4FL9 A;  3N4Q A;  4B9L A;  4YNQ A;  2JWK A;  3SUP A;  4CFA A;  1NBW A;  4AHS A;  3V1O A;  3V4I A;  3M8Q A;  1U49 A;  3PX4 A;  4CJP A;  5LMU K;  1BU6 O;  1NGC A;  1SS6 A;  3VEV A;  4FLV A;  3IMX A;  4BE0 A;  1QHT A;  3DLE A;  4H0Y B;  5BR9 A;  3SYZ A;  1SL0 A;  4BR0 A;  3RTV A;  1NK6 A;  3O08 A;  1NLV A;  5EU7 A;  2QM1 A;  3O3G A;  4FK0 A;  3VTI A;  4DR1 K;  5HBM A;  3BDP A;  1QZ5 A;  4H0X B;  3EZ5 A;  4DLG A;  3F2K A;  5JVG L;  1A5V A;  4DTS A;  3HL8 A;  4DV6 K;  3I55 N;  5FLX O;  4LC9 B;  3NMU A;  3H3O B;  3WXI A;  4CJ3 A;  3KWG A;  1ZBH A;  3MEE A;  1IV0 A;  3BGR A;  4JHD B;  3O9R A;  2PBD A;  2BTF A;  4ICL A;  4M3U A;  2IVO A;  4BDZ A;  1HUX A;  3TAQ A;  3G10 A;  4GKJ K;  1Q9Y A;  5AQO A;  1YHQ N;  1O13 A;  2OZM A;  4FWM A;  3FZL A;  3CI5 A;  3AO2 A;  4FOI A;  3V9U A;  3NE6 A;  3MXJ A;  2VQE K;  4K8Z A;  4O0I A;  3OA9 A;  4OX9 K;  2BAN A;  3QLH A;  3CJC A;  1RDU A;  1RTH A;  2RF2 A;  2HND A;  4BRQ A;  2O8C B;  5AQS A;  5KGX A;  4NYF A;  3OS1 A;  3VEZ A;  4DMN A;  4ISF A;  1RFQ A;  1D9F A;  2UUB K;  1BGX T;  3ZSR A;  3K9K A;  2NRT A;  4F9O A;  4IOA L;  2QW9 A;  2QXF A;  1UAX A;  1S3X A;  1CXQ A;  3DXK B;  3EY1 A;  2HHQ A;  3HBT A;  1F21 A;  1NWK A;  3BP8 A;  4KRE A;  1TYQ A;  4KHP K;  1R0A A;  1QZ6 A;  2GUI A;  1XQS C;  3B8A X;  1BIS A;  3QIO A;  4J2D A;  1KXP A;  4DQS A;  5AQV A;  3C6A A;  4E7H A;  4C8K A;  5BRF A;  3CJ9 A;  5E41 A;  2CH5 A;  4DG1 A;  1S9G A;  4KHW A;  3VQD A;  2Q0U A;  5AR0 A;  5SWM A;  4FO0 A;  3G71 N;  2AP1 A;  3M8P A;  1VSK A;  2IVN A;  3MEG A;  4J2A A;  1WSF A;  2B6A A;  3QIN A;  4DTX A;  4YOR A;  4R79 A;  3RMD A;  1CZB A;  2CGJ A;  5EOY A;  3HVR A;  2YHW A;  4DSK A;  2YHX A;  4OPJ A;  4Z4G A;  4KB1 A;  5AZI A;  4JRQ A;  3E66 A;  2NZT A;  1DEJ A;  3ZSQ A;  1JL1 A;  2OPR A;  2YHB A;  4C1N I;  1B9F A;  1EQY A;  4I9L A;  4BQL A;  2HHV A;  4CIE A;  3M6G A;  2LSN A;  1IG8 A;  1N5Y A;  1BI4 B;  3QO9 A;  5I42 A;  5E26 A;  3THW A;  3H45 C;  4LFB K;  4I6M A;  4NLB A;  3T1H K;  4LFC K;  3VQA A;  3K59 A;  1M90 O;  3K5M A;  2A42 A;  3AO3 A;  3ZX0 A;  5EX5 A;  4W5R A;  1EWR A;  4TSX A;  3VA3 A;  3CHW A;  4CHN A;  3Q7C A;  3QEX A;  3LP2 A;  3LWM A;  3OYD A;  3NF8 A;  5K14 A;  4FLY A;  1JCF A;  1NOY A;  3DXM B;  2P1J A;  4JI2 K;  4BWJ A;  4FM1 A;  1NKB A;  3OBY A;  4YOX A;  1DLO A;  2HHX A;  3AA5 X;  3AAQ A;  4JI4 K;  1SL2 A;  2XO7 A;  1HQE A;  4ZTF A;  4NCB A;  4BRK A;  5FDL A;  2BUP A;  5CHI A;  1TKD A;  3V1Q A;  4LH5 A;  3ZT2 A;  2F96 A;  3SLC A;  4F3T A;  3LP0 A;  2ZWH A;  4FWN A;  2Q2R A;  3N4P A;  3O9S A;  2D1K A;  3VQE A;  1D4X A;  3VF2 A;  5HRS A;  1BL3 A;  4H03 B;  4BRC A;  3LAN A;  3HSC A;  1BIZ A;  1UOC A;  3LDL A;  2UXC K;  5D3G A;  3VQB A;  4W5Q A;  1L3T A;  5FRN A;  3SJH A;  2HF3 A;  4CHZ A;  4WFA L;  4MO4 A;  4E7K A;  4GV9 A;  3C7N A;  4E7I A;  1VQP N;  1EWQ A;  3CJ1 A;  4UQG A;  3KZB A;  1U2V B;  1GLC G;  4JI5 K;  2P9L B;  4JKG B;  4A2A A;  4KH6 A;  4JKF A;  2WOM A;  5BRH A;  4CVN E;  1NGG A;  3E9L A;  2UUA K;  1N8R O;  4PWD A;  4JNE A;  1VSF A;  2YNI A;  3NVM A;  3ISN C;  2G8K A;  4CEF A;  3SK3 A;  3OYI A;  2YX6 A;  4FOE A;  5C24 A;  1W2B M;  1M1K O;  4EHU A;  4CHP A;  3O4N A;  1YTU A;  5CYQ A;  1REV A;  4PHT X;  1VSE A;  4WE1 A;  2PY5 A;  4PQU A;  3SJJ A;  4H0T B;  4B9T A;  1T3V A;  3ZSO A;  4CJF A;  1VQO N;  1RBU A;  4RW6 A;  4KH5 A;  5GAE P;  2G8W A;  2GWK A;  1XI1 A;  1FJG K;  3DXK A;  2D0O A;  4FYD A;  3C6T A;  2PYL A;  2W41 A;  3MX2 A;  4LF9 K;  1RT6 A;  3DOL A;  3R3L A;  4IO9 L;  5CYM A;  1VK0 A;  2KW4 A;  4B8A B;  4CEB A;  3H6E A;  2Q1N A;  1D9D A;  1KAY A;  1LOT B;  3MMV A;  4BG8 A;  3IKM A;  2HST A;  2VGM A;  1YVN A;  3L3U A;  4DV7 K;  3E01 A;  4MDB A;  3P39 A;  2HBL A;  2A6A A;  5FPM A;  2VG6 A;  3J80 O;  2GEM A;  5M1K A;  1C1A A;  1OH8 A;  1RTI A;  4B1V A;  5AFU A;  3RRH A;  3R9P A;  4CGJ A;  4BRF A;  1YJ9 N;  1MA9 B;  3QIP A;  3ZET B;  4O55 A;  4NYN A;  4DQR A;  5C25 A;  1L3S A;  1JLA A;  3JS6 A;  3FLC O;  5DMR A;  4A2B A;  3CCJ N;  3IDH A;  5M1N A;  4IDH A;  3LL3 A;  1NU0 A;  3SQ4 A;  3PIO L;  2E8A A;  4HUG A;  2KKZ A;  2YKN A;  4LSL A;  3THX B;  4FWS A;  3TAM A;  3K58 A;  5J2N A;  3VQQ A;  1TV6 A;  1XNR K;  2V52 B;  4W5T A;  3DAW A;  4FW2 A;  3A5M C;  2CGK A;  3PV8 A;  1FXX A;  3EL2 A;  2ITG A;  2FXU A;  1IO2 A;  1VSL A;  1BI4 A;  4MLE A;  4CBX A;  2E1Z A;  4AHR A;  1SQK A;  3THY A;  2GEL A;  2QWL A;  2FSN A;  2JLE A;  4JK8 A;  4CHQ A;  3L2W A;  3ALY A;  3OBW A;  3F9K A;  3MN5 A;  3RRG A;  2DY4 A;  2QI2 A;  3NH0 A;  3LDS A;  3A8Y A;  1HNZ K;  4O44 A;  2NRW A;  3WNH A;  2XRI A;  4CJ7 A;  1U45 A;  3DLB A;  4KHQ A;  2PZS A;  4IZ9 A;  3OYA A;  3RMC A;  3VPZ A;  1TK5 A;  3DXM A;  2ZJQ L;  4ISE A;  1RBT A;  1JLB A;  2P9K B;  4LF4 K;  4JAX A;  3CIP A;  3HXM A;  5AQH A;  3QBX A;  3CCL N;  1U6Z A;  3D0P A;  4M7Y A;  1IG9 A;  3CXC M;  3HJF A;  3VA0 A;  3CF5 L;  1W9H A;  2KQ2 A;  1WB9 A;  4E89 A;  1VQ6 N;  1VSD A;  3I33 A;  2NLX A;  5M1O A;  3HVT A;  5C2F A;  3UE5 A;  4FSV A;  2VWJ A;  1Q7Y O;  5C0Y A;  5JIC A;  1YT3 A;  2PAV A;  4WQ4 A;  2D0P A;  4Z0U A;  4DU3 A;  3VET A;  4BGA A;  4FWK A;  1JL2 A;  1HPZ A;  3CPW M;  3TTC A;  1NJX A;  4LF7 K;  4BVP A;  4JKD A;  4YOU A;  3DM2 A;  3AVG A;  3RMB A;  3CJ7 A;  1S1V A;  4CFC A;  3EO3 A;  3Q7B A;  3LP3 A;  4BC5 A;  3CCQ N;  3OYC A;  3G6E N;  4IEI A;  4Y0W A;  4WF9 L;  1NGF A;  3T1Y K;  2CH6 A;  1JXB A;  1U2V A;  1HQU A;  2P9L A;  4H0P A;  4PL8 A;  3KKR A;  3ZT4 A;  1T05 A;  4JKG A;  3ZSY A;  3CME N;  3ZSV A;  2QTD A;  4B9N A;  4CZE A;  4DV1 K;  1KD1 O;  4CJ5 A;  1Z6R A;  1C1B A;  3K5O A;  3P5J A;  3TAN A;  1NKE A;  3KD5 E;  2RE2 A;  4PL7 A;  3P1G A;  4JKA A;  1RTD A;  2QKK A;  4FWO A;  1Q82 O;  3O80 A;  4DB3 A;  3C94 A;  1HLU A;  1MDU B;  4E7J A;  4M3R A;  1QQC A;  5TKY A;  2HMI A;  4DV2 K;  3T69 A;  1Q8I A;  5F0X A;  4FLU A;  5LJV A;  1BHL A;  1JKH A;  2QWN A;  3K57 A;  4C8N A;  2IVP A;  4CCH A;  1HNV A;  3SZ2 A;  1ZBS A;  3DLG A;  3AVI A;  4CGF A;  3PX0 A;  3FFK B;  4FW1 A;  3CFP A;  1QTM A;  2OPQ A;  2AA4 A;  2ZF5 O;  3FZF A;  5GIP A;  3KLH A;  3W0L A;  4CZL A;  4HCB A;  3TWH A;  4CE9 A;  3EE8 A;  2QEX N;  2QK9 A;  1XWL A;  4XH5 A;  3BEX A;  3C65 A;  1RIL A;  5BN8 A;  5A2Q O;  4IDK A;  4OVL A;  5C2D A;  1WSG A;  1NJZ A;  4F2S A;  1O1W A;  1NK8 A;  3CD6 N;  3S41 A;  3ULE A;  3O1B A;  2PFU A;  4ILJ A;  4JRP A;  4OKE A;  1QSY A;  4XH1 A;  3MWP A;  5SZT A;  3ZET A;  1TKT A;  4KO0 A;  4IOC L;  3WUH A;  4E7L A;  2VWB A;  5CE3 A;  3DRR A;  4GV3 A;  4RW7 A;  3GDQ A;  5M1Q A;  5AFU H;  5I9E B;  2VWK A;  2JGU A;  3JYT A;  4I9Q A;  4XIU A;  1P90 A;  1HNX K;  2D4W A;  4RCH A;  2YV0 X;  3ZX3 A;  3CCM N;  3THX A;  4BRP A;  3DRS A;  4BE1 A;  1QS4 A;  1I39 A;  2KTQ A;  1HX1 A;  3PSF A;  4CF8 A;  2QXL A;  3CM6 A;  3RSE B;  3HI0 A;  2Y1J A;  3CJA A;  2HBK A;  1Q18 A;  1RDB A;  3D2E B;  2BE2 A;  2BDP A;  3VOV A;  3PO4 A;  3UIQ A;  4RTF D;  1NGJ A;  3K2P A;  4IXC A;  1IH7 A;  4DCH A;  3CMA N;  1G15 A;  3S3M A;  4FPB A;  3TSP A;  1ASW A;  1NOZ A;  4Z4E A;  5AQG A;  3L6Q A;  4G1Q A;  3J81 O;  3MN7 A;  1VQ4 N;  1IJJ A;  1VSM A;  4DFK A;  2HHW A;  2Q3S A;  1W97 L;  3VGL A;  2P9K A;  3M3Z A;  2QWQ A;  1FW6 A;  4BGB A;  3GOI A;  4JI6 K;  3MX5 A;  2GBZ A;  3FR0 A;  3MXM A;  1NJY A;  2XY5 A;  1GOA A;  3OYE A;  1RT3 A;  4GV6 A;  4OPH A;  5KQ8 A;  2UYT A;  4FWR A;  5BN9 A;  1DTQ A;  3DLH A;  3IAY A;  4B1U B;  1HJO A;  4CEE A;  4DUY K;  1IBM K;  2YJE A;  1KCF A;  2FSJ A;  1RNH A;  1X9W A;  4K41 A;  5DM7 L;  3FE1 A;  2D0B A;  1J5O A;  4IOX A;  3BUZ B;  3U9Z A;  3SPZ A;  1HKG A;  2RKI A;  4M63 C;  4BRM A;  4Y1C A;  4EHT A;  4X65 K;  4WQ4 C;  3C95 A;  1JLC A;  3TSU A;  1B92 A;  3OS2 A;  4HCC A;  2QWM A;  3WXJ A;  4X66 K;  4LH4 A;  4WYB A;  3VF4 A;  2A1R A;  3O3H A;  3CCR N;  3AGK A;  3M5R A;  5FRM A;  4IFE A;  3T7Z A;  3M8R A;  1IBL K;  3KK2 A;  3NGI A;  1BIU A;  3VEN A;  2A5X A;  3KLI A;  4JS5 A;  5BRD A;  3O9T A;  3MAQ A;  5AJ3 K;  2Z1J A;  1N33 K;  1RDA A;  1DT9 A;  4NXM K;  2FBT A;  2FF3 B;  5AQZ A;  4CZJ A;  4DUZ K;  2P9U B;  3CYM A;  4BRI A;  3AVC A;  1EXQ A;  1NGA A;  4FLW A;  4CED A;  2P9S A;  2EX3 A;  2W40 A;  5C10 A;  4YDU A;  1KVA A;  5C15 A;  4N5S A;  4CZM A;  4ELV A;  4FCY A;  3HOT A;  3L2R A;  3ATU A;  3SV3 A;  1BOT O;  4A5B A;  4E1M A;  4EZ9 A;  4KI6 A;  1RGI A;  1S1W A;  4JKC A;  4A61 A;  1E4F T;  2B4J A;  2IOC A;  3R8E A;  4GW6 A;  3QBW A;  4FJ7 A;  2W42 A;  4B3O A;  4B1W B;  1NK4 A;  3CER A;  1XUP O;  4CFD A;  1GLD G;  5JS2 A;  1BQN A;  1R59 O;  3KKS A;  3LP1 A;  3ZEU B;  4BRH A;  2H3G X;  2HOE A;  3C6H A;  4CF0 A;  2NRX A;  3L4I A;  3AVN A;  4BRA A;  3H1V X;  2V7Y A;  2UU9 K;  5B8H A;  4HUF A;  4OGE A;  3U6F A;  3LZI A;  4LY7 A;  1HKB A;  3WXL A;  3SCX A;  1NG9 A;  1UA1 A;  1LW0 A;  3TAG A;  1LV5 A;  1SKR A;  2YKM A;  3NFA A;  1NGD A;  1NK9 A;  2F8T A;  1GOB A;  3DRP A;  4JKB A;  3SQ2 A;  1QHA A;  3VGM A;  1HPM A;  2KZM A;  4CGH A;  1BG3 A;  3D2F A;  4JV5 K;  3QNN A;  4O8K A;  3JSM A;  4CK1 A;  1XC9 A;  1X3M A;  4B3S K;  5AQU A;  5AQR A;  1QQM A;  4IO8 A;  1U4B A;  4BR2 A;  1VHX A;  4CEZ A;  5C12 A;  4IJN A;  1FKO A;  1W0H A;  3DLL L;  1TL1 A;  3SMP A;  3DWL A;  1GLL O;  1EET A;  1JCG A;  5BPM A;  1RDC A;  1JXE A;  4CK3 A;  4WQ5 C;  4FZX C;  3RSE A;  3KLG A;  3VTH A;  4YOY A;  3TR8 A;  3D2E A;  3AAP A;  4KHN A;  1T03 A;  2E88 A;  3LDN A;  1UA0 A;  4AH9 A;  4OPK A;  5FPN A;  3AVF A;  4DFM A;  3P38 A;  4JD2 B;  5LJW A;  2ZJR L;  3FGU A;  2FBX A;  1ZBI A;  3VN5 A;  3HPO A;  4QS8 A;  2BGG A;  4KKO A;  3D45 A;  1JJ2 M;  4FJ5 A;  5FPE A;  1BDG A;  1XNQ K;  4CJ4 A;  4FJ9 A;  3O9Q A;  3CPE A;  4PY5 A;  4B3M K;  1QVF M;  3QES A;  4FJX A;  3OYB A;  2YHA A;  4Z4C A;  1U48 A;  3VQ6 A;  1NMD A;  4AHC A;  4CHO A;  2KHO A;  3PX6 A;  1SAZ A;  3J7Z O;  3SUN A;  1S5J A;  4FJL A;  3GL1 A;  1C6V A;  1GLA G;  4JLH A;  3L2V A;  5HRR A;  3DJC A;  4FXD A;  2Q0R A;  4DV0 K;  3L4Q A;  2ITM A;  2E4L A;  3L2Q A;  3OYG A;  3OYJ A;  3CJB A;  4HTL A;  4JHD A;  2E20 A;  4EZ6 A;  3HM9 A;  5IWA K;  1WNS A;  2O8E B;  1TUU A;  4R5P A;  4FJJ A;  1BA0 A;  3I0R A;  4GVE A;  3T19 A;  3QER A;  4BDY A;  1VQ9 N;  2UXD K;  4B3T K;  4B08 A;  3PO5 A;  3VGK A;  2J4R A;  1NGB A;  1WBD A;  1Q86 O;  4JK9 A;  4F2R A;  4CEC A;  4M42 A;  3A2F A;  2QWP A;  3HO1 A;  3KK1 A;  1N34 K;  1VRU A;  1JLE A;  3ENH A;  3AVJ A;  3QML A;  3RMA A;  1YXQ A;  1K9M O;  3NH1 A;  2O8C A;  2GV9 A;  4QCL A;  5KQD A;  1BA1 A;  2WFB A;  2G8I A;  1HNW K;  4DR4 K;  2O4G A;  1TUY A;  1BCM A;  4CIG A;  3ZCM A;  3FZM A;  3LPT A;  1X1P A;  2X74 A;  1Y97 A;  3AVH A;  5JLF A;  4O4G A;  1RTJ A;  1XHZ A;  3AO1 A;  3VQ5 A;  4CJQ A;  4BWM A;  3JAM O;  3TAR A;  3CM5 A;  1S22 A;  2V7Z A;  2P9U A;  3H1Q A;  1N32 K;  3CFO A;  1SKW A;  1ZC6 A;  1U04 A;  4BRG A;  3LAL A;  3J7Y P;  1LWF A;  3ID8 A;  4H0V B;  4CEQ A;  5F1X A;  4FVU A;  3E1Y A;  3NF6 A;  1ATS A;  3OYM A;  3H46 O;  2IGI A;  4CBU A;  5MLC Q;  2A1S A;  5ELZ A;  4DTP A;  4CF1 A;  4YDU C;  4BR7 A;  3HP6 A;  5BR8 K;  5DM6 L;  5KI6 A;  3ZEU A;  1P8Z A;  1WBB A;  4OO1 J;  1LAW A;  5BPL A;  3SAG A;  1LAV A;  5AQT A;  4KAZ A;  1WSH A;  1TAQ A;  4WCE L;  3PUF A;  4B9M A;  1SZ2 A;  4JEP A;  3LDO A;  4BRN A;  4B8C A;  2Z1H A;  1HRH A;  3CQY A;  2ZGZ A;  1S6P A;  4YOW A;  3NVK A;  3NCI A;  4BY9 C;  1TGO A;  3SBG A;  4CJW A;  4QOZ B;  3VF6 A;  3U3Y A;  1ZBL A;  3W3D A;  3LAM A;  1Z05 A;  2Z1I A;  1KQS M;  3KWI A;  4K0K K;  1WSI A;  2OPS A;  5LY3 A;  3E9P A;  1IBK K;  4CZG A;  2NRR A;  4JI8 K;  3U8X A;  4DR3 K;  5EXW A;  2X6S A;  2WC9 A;  5AQL A;  4BDP A;  4AM6 A;  4BRL A;  4W5N A;  4OKJ A;  4DV4 K;  3V9S A;  3GE1 A;  4LF6 K;  4CZK A;  3MDQ A;  1L3U A;  4CIF A;  4JD2 A;  5HL7 L;  1QQO A;  5JS1 A;  2O8F B;  3ZX2 A;  1LWC A;  3ID6 A;  3AA3 A;  4H5V A;  4OJR A;  3CC4 N;  2QWO A;  4DTO A;  5TKW A;  2XHB A;  1HKC A;  3MN9 A;  4OGC A;  2D0A A;  3OW2 M;  1X3N A;  1NJW A;  3PLA A;  3VQ8 A;  4FWQ A;  5M1F A;  3TU5 A;  4CGI A;  3IG1 A;  4U7B A;  2HBM A;  1FK9 A;  5FRO A;  3K0S A;  5M1P A;  1KFD A;  2FF6 A;  3WEE B;  4BAC A;  2DPN A;  1X9J A;  4N56 A;  3VMF B;  3SQ0 A;  3BY5 A;  3ZSZ A;  4I7F A;  3EYZ A;  2OPP A;  4FZZ A;  4CJV A;  2O8E A;  4B3R K;  3R1X A;  1NKC A;  3IRX A;  1CXU A;  1Z25 A;  3K5N A;  1VRT A;  4B9V A;  3WXM B;  1J9A A;  5CZ1 A;  1WSE A;  4DQQ A;  3O6W A;  2UXB K;  3A5O C;  1N36 K;  3PY8 A;  3LWL A;  4F4K A;  4KFB A;  3TTF A;  2OYQ A;  5CR4 A;  5AQM A;  3VQP A;  4DU4 A;  4RG8 A;  2AJQ A;  3I0S A;  3BF3 A;  4DSI A;  3J8A A;  5H1S Q;  4NXN K;  3WQT A;  2E2O A;  2NUB A;  3EKS A;  3TAE A;  1C0F A;  5GAG P;  1JLQ A;  3L8B A;  4O8U A;  1D5A A;  4J2B A;  4JI7 K;  5AQJ A;  2ZD1 A;  2F7T A;  1ZBU A;  3QEW A;  3AVM A;  1BQM A;  2IS3 A;  1C0M A;  4BG9 A;  3HZ6 A;  4IBN A;  1HNI A;  1ITG A;  1RCH A;  1C0T A;  4DQP A;  1VQK N;  3ZT3 A;  4AM7 A;  1XMQ K;  4DSJ A;  4MLH A;  4KTW A;  2HW3 A;  4MO5 A;  1GOC A;  1YJW N;  4O5F A;  1J6Z A;  2OA8 A;  1TKX A;  4FM0 A;  4OPA A;  1A5X A;  1NK5 A;  4FJH A;  3H3N O;  4IEE A;  1X9M A;  3F9M A;  4W5O A;  3PSI A;  2IAJ A;  1TK0 A;  2FBY A;  5AZI B;  2ZJP L;  2XY6 A;  1WLJ A;  2HBJ A;  1IKY A;  3HM8 A;  5AZJ B;  4NO7 A;  4EFH A;  4AQY K;  1RT2 A;  4H0O A;  4WQ5 A;  4HUE A;  3H08 A;  3ZSW A;  1T6D A;  4E1N A;  2DFH A;  2VG5 A;  4U67 L;  1L5U A;  1CLQ A;  4JI3 K;  4JI0 K;  3V9W A;  4LD0 A;  4CJS A;  1OVQ A;  5GIO A;  3WNE A;  3R6M A;  1NK7 A;  3AY9 A;  1VQL N;  3KJV A;  4DTN A;  3TAP A;  4FLT A;  2NRV A;  4YFU A;  4E0D A;  5GAH P;  5AQQ A;  4CZH A;  1ASV A;  1VQN N;  4FK2 A;  3ZT0 A;  2BH1 A;  5JLH A;  4H5N A;  1GLE G;  3KVG A;  3V81 A;  4XH4 A;  1YF5 L;  2P9N B;  1EKE A;  4BC2 A;  4ID1 A;  4CJE A;  3ZLJ A;  1QE1 A;  3HT3 A;  1L3V A;  1K6Y A;  2E2Q A;  1WAF A;  1KVC A;  2A3Z A;  4O0J A;  1C0U A;  3DI6 A;  4AHV A;  1S1U A;  1Z26 A;  2Z1G A;  4ISG A;  4DF8 A;  4LF8 K;  5ADX A;  1NGI A;  2YNG A;  4KV8 A;  4EP4 A;  2KZZ A;  3NAE A;  1H1V A;  4CEO A;  2FSK A;  2OZS A;  1RDD A;  1HJR A;  4WFB L;  3OYH A;  3U3G A;  1VSH A;  2O8F A;  3AA2 A;  5AQW A;  3J7A P;  4PKG A;  2X6N A;  3F5T A;  4Z4F A;  2I7P A;  2XY8 A;  2G8U A;  4KTQ A;  4M3T A;  4CJL A;  2YHY A;  5HRO A;  1B9D A;  1S1X A;  5GIN A;  4C8O A;  4HWI A;  2EHG A;  2FLO A;  4CJK A;  3AV9 A;  3C7N B;  4CF9 A;  3O8M A;  1BUP A;  5FPD A;  4QS9 A;  1NK0 A;  4EIA A;  3MK6 A;  3KLF A;  2VG7 A;  2E2P A;  3JXU A;  4LFA K;  3HK2 A;  1RBS A;  2IIR A;  4LSN A;  3AO4 A;  2HHU A;  2F9W A;  4RW8 A;  4GVM A;  3UB5 A;  4CZI A;  2ASP A;  3S3N A;  2WBN A;  2RHK A;  3WEE A;  1KVB A;  4KTZ A;  1KSP A;  2FBV A;  3QEP A;  3LPU A;  3TI0 A;  3G0Z A;  4DR5 K;  3SAF A;  5I3U A;  2ASO A;  2R7Y A;  1TAU A;  3DYA A;  4MQ3 A;  4DF4 A;  3WNF A;  3RR8 A;  1ESV A;  1VSJ A;  5F2R A;  4CBW A;  4DV3 K;  1WSJ A;  3LDQ A;  4FJ8 A;  3ULD A;  2O4I A;  3NF9 A;  3SNN A;  3C0B A;  1LWE A;  2KLA A;  3TSQ A;  1S1T A;  3BZK A;  3AVA A;  3UKU B;  4H4M A;  3OYF A;  3V9Z A;  3KK7 A;  4FK4 A;  4IG0 A;  3L3V A;  3ASM A;  1IKW A;  4B1X B;  2YCH A;  3O3F A;  4BRO A;  4HHT A;  3O5B A;  3ITH A;  4MFB A;  3AGR A;  1VQM N;  3SPY A;  2QKB A;  1KAX A;  2OAN A;  4GKK K;  1TK8 A;  4CK2 A;  3AAR A;  1QQN A;  5KGW A;  2P51 A;  4FWL A;  5AQI A;  5T7B A;  4KI4 A;  3NGY A;  2HHT A;  3B6P A;  4H8K A;  4BC3 A;  4FLX A;  3K9J A;  1ASU A;  4RW4 A;  1T8E A;  2YNF A;  2Q97 A;  4CHY A;  5AQY A;  4DWI A;  5JMV A;  4YY3 K;  4X64 K;  5J1E A;  4WFN L;  4JYA K;  4IKF A;  4JS4 A;  3SAH A;  4AIL C;  1KRP A;  4N76 A;  3HYF A;  1JLG A;  5AZJ A;  1CZ9 A;  3SUO A;  2D5R A;  3TPQ A;  1YIJ N;  4M7X A;  3T3F A;  3O1W A;  4KHU A;  4N41 A;  3L2U A;  5HLF A;  1EO1 A;  2E6L A;  2E1Y A;  3P4I A;  3SUQ A;  3OJU A;  2HVI A;  3ZYY X;  3NGZ A;  2VGN A;  1NM1 A;  3OTO K;  1EX4 A;  3MCA B;  3TTD A;  3FZK A;  2HB5 A;  3VEY A;  4BRE A;  3CQ8 A;  4M45 A;  3THY B;  4DTR A;  3O4Q A;  5HOO A;  1WOQ A;  3G4S N;  3CC7 N;  3IS9 A;  2VCP A;  4IFV A;  4K43 A;  1DTT A;  5HRP A;  3OS0 A;  5AQN A;  3QDK A;  4Y1D A;  3UKR B;  4DHY A;  4F8R A;  3KHY A;  2WON A;  3U9D A;  4B1Z A;  4EAH D;  3KD1 E;  3D6R A;  2P9N A;  1E3M A;  4C23 A;  4DSF A;  4GY2 B;  4N47 A;  1V4S A;  4H4O A;  3MN6 A;  4GMJ B;  3RWU A;  3IFR A;  2QA4 N;  3ATV A;  4KHY A;  3DLR A;  2IC3 A;  2HHS A;  1C0G A;  1KLM A;  3SMS A;  2WTU A;  2KFZ A;  4Q0B A;  2G8V A;  3TAF A;  1VAZ A;  4OLB A;  2ATQ A;  2O8B B;  1C1C A;  2A41 A;  3KLE A;  3S9H A;  2D0C A;  5ADX H;  3V1R A;  3VES A;  3HP9 A;  3CCE N;  4A59 A;  1EP4 A; 
#chains in the Genus database with same CATH homology
 1WSI A;  2HNZ A;  1WSG A;  2OPS A;  4OVL A;  5KTQ A;  1NJZ A;  1WAJ A;  4F2S A;  1O1W A;  1NK8 A;  3ZSR A;  2YNH A;  3QNO A;  3MXI A;  1BCO A;  2QXF A;  3VQ7 A;  1LW2 A;  5CY4 A;  1UAX A;  1CXQ A;  3EY1 A;  4JRP A;  4OKE A;  2HHQ A;  2X6S A;  1F21 A;  1QSY A;  3SI6 A;  4BDP A;  4KRE A;  5SZT A;  4Z4I A;  2ETJ A;  1TKT A;  4AHT A;  1S6Q A;  1R0A A;  4KO0 A;  2GUI A;  4E7L A;  1BIS A;  3QIO A;  4J2D A;  4W5N A;  3DRR A;  3NDK A;  4DTJ A;  4RW7 A;  3OYK A;  4DQS A;  5HRO A;  4OKJ A;  4E7H A;  3V9S A;  4C8K A;  2VWK A;  2JGU A;  5E41 A;  3JYT A;  1L3U A;  4I9Q A;  4PA1 A;  1IKX A;  3NF7 A;  4DG1 A;  1HYZ A;  1S9G A;  1WN7 A;  4CIF A;  4XIU A;  4KHW A;  3VQD A;  2YV0 X;  5SWM A;  5JS1 A;  3DRS A;  3M8P A;  1LWC A;  1VSK A;  4BE1 A;  5J2M A;  4M41 A;  1QS4 A;  3AA3 A;  1I39 A;  5HRN A;  4OJR A;  2KTQ A;  1SUQ A;  4BE2 A;  4CF8 A;  4CJT A;  3SV4 A;  3MEG A;  4DTO A;  4KB0 A;  1VSI A;  2ZQB A;  4DSE A;  4B9S A;  3P83 D;  2XHB A;  1WSF A;  3CM6 A;  2B6A A;  1KLN A;  4OGC A;  3QIN A;  2D0A A;  4DTX A;  2Y1J A;  3ZSX A;  3RMD A;  1CZB A;  3HVR A;  1RDB A;  1NJW A;  4DSK A;  3VQ8 A;  2BE2 A;  4OPJ A;  2BDP A;  4KB1 A;  4Z4G A;  3PO4 A;  3UIQ A;  4JRQ A;  4CGI A;  3K2P A;  3ZT1 A;  1IH7 A;  1A5W A;  4J2A A;  3IG1 A;  1G15 A;  3ZSQ A;  3S3M A;  1FK9 A;  5FRO A;  1ASW A;  1JL1 A;  2OPR A;  2YHB A;  1ZYQ A;  1NOZ A;  1B9F A;  3SQ1 A;  4M3Y A;  4Z4E A;  4G1Q A;  4DSL A;  1KFD A;  1RT5 A;  4BAC A;  4I9L A;  3OVN A;  1VSM A;  5KRT A;  4Z4H A;  4N56 A;  4DFK A;  3SQ0 A;  2Q3S A;  2HHV A;  2HHW A;  4CIE A;  3ZSZ A;  4I7F A;  2LSN A;  3EYZ A;  2OPP A;  4FZZ A;  4CJV A;  4J2E A;  1N5Y A;  1BI4 B;  3QO9 A;  5I42 A;  1FKP A;  1J53 A;  3NHG A;  3S3O A;  2G8F A;  1NKC A;  2GBZ A;  1S9E A;  3IRX A;  4PUO A;  1CXU A;  3OYN A;  1Z25 A;  3VQA A;  3K5N A;  3K59 A;  1VRT A;  3AO3 A;  3K5M A;  2E6M A;  3MXM A;  2XY5 A;  1J9A A;  1GOA A;  3OYE A;  1NJY A;  5CZ1 A;  1RT3 A;  1WSE A;  4CER A;  3M8S A;  4DQQ A;  4W5R A;  3PY8 A;  4TSX A;  3VA3 A;  3LWL A;  4ELT A;  4KFB A;  4CHN A;  1DTQ A;  3DLH A;  4F4K A;  3QEX A;  1RT4 A;  2OYQ A;  3IAY A;  1RBR A;  4DTM A;  4DU4 A;  3VQP A;  3LP2 A;  4HTU A;  5DK5 A;  1JLF A;  4CEE A;  3LWM A;  5KRS A;  4RG8 A;  1KCF A;  3OYD A;  1RBV A;  3V9X A;  2AJQ A;  3FFI A;  3NF8 A;  3I0S A;  3TAB A;  4DSI A;  5K14 A;  4FLY A;  1RNH A;  1X9W A;  1NOY A;  2NUB A;  2P1J A;  4FM1 A;  4BWJ A;  2HHX A;  1NKB A;  1DLO A;  3TAE A;  3AA5 X;  4ZHR A;  1SL2 A;  3L8B A;  2D0B A;  1JLQ A;  2XO7 A;  1J5O A;  4M3X A;  1HQE A;  4ZTF A;  3KTQ A;  4NCB A;  1D5A A;  3AVB A;  4J2B A;  5FDL A;  3SPZ A;  4FJM A;  2RKI A;  3DLK A;  1TKD A;  2ZD1 A;  3V1Q A;  3WNG A;  1ZBU A;  3QEW A;  3AVM A;  4LH5 A;  4Y1C A;  3ZT2 A;  4FZX C;  3C95 A;  4C8L A;  1BQM A;  2IS3 A;  1C0M A;  4DQI A;  1JLC A;  4KTQ A;  1B92 A;  3OS2 A;  4HCC A;  2F96 A;  2F8S A;  3DMJ A;  3OY9 A;  4IBN A;  4B9U A;  4FZY A;  4F3T A;  1HNI A;  1ITG A;  1RCH A;  3V6D A;  1C0T A;  4DQP A;  3LP0 A;  4LH4 A;  3ZT3 A;  2A1R A;  4DSJ A;  4C8M A;  3O3H A;  4DTU A;  4KTW A;  2HW3 A;  3VQE A;  1GOC A;  4IDK A;  5HRS A;  1BL3 A;  4AHU A;  5FRM A;  3AO5 A;  4F3O A;  3LAN A;  4NCG A;  4E3S A;  3M8R A;  2OA8 A;  3KK2 A;  1D8Y A;  1BIZ A;  1TKX A;  1UOC A;  1BIU A;  2X78 A;  3VQ9 A;  3NGI A;  4FM0 A;  1NK5 A;  1A5X A;  1HYV A;  3KLI A;  3KK3 A;  4JS5 A;  1QSS A;  4FJH A;  3VQB A;  4W5Q A;  1L3T A;  5FRN A;  3MAQ A;  1X9M A;  4W5O A;  2IAJ A;  4CHZ A;  1SV5 A;  2FBY A;  1TK0 A;  3AVK A;  2Z1J A;  2HVH A;  1RDA A;  4E7K A;  2XY6 A;  1WLJ A;  2FBT A;  4QAG A;  4E7I A;  1HYS A;  1IKY A;  3CYM A;  4UQG A;  3AVC A;  5C42 A;  1RT2 A;  1EXQ A;  4FLW A;  4CED A;  1X9S A;  2EX3 A;  3LAK A;  4HUE A;  3H08 A;  3OJS A;  1KVA A;  1SL1 A;  3ZSW A;  4CJU A;  4N5S A;  2XY7 A;  4E1N A;  4ELV A;  2DFH A;  2VG5 A;  3C6U A;  2WOM A;  4RW9 A;  3HPH A;  3L2R A;  4FCY A;  1L5U A;  1CLQ A;  3SV3 A;  4FLZ A;  3V9W A;  1TKZ A;  4E1M A;  4EZ9 A;  4LD0 A;  2DTU A;  4CJS A;  4KI6 A;  4PWD A;  1S1W A;  3WNE A;  3LZJ A;  1NK7 A;  1VSF A;  3KJV A;  1MU2 A;  2YNI A;  4DTN A;  3TAP A;  2B4J A;  3CG7 A;  4FLT A;  2IOC A;  4YFU A;  3T1A A;  4GW6 A;  3ISN C;  4E0D A;  2G8K A;  4FJ7 A;  2W42 A;  4CEF A;  4B3O A;  3OYI A;  4DLE A;  1ASV A;  4CFD A;  1NK4 A;  4FK2 A;  5C24 A;  4B9V A;  4CHP A;  3ZT0 A;  5JS2 A;  1BQN A;  3KKS A;  3O4N A;  3LP1 A;  3AVL A;  1YTU A;  5CYQ A;  1REV A;  4CF0 A;  3V81 A;  1VSE A;  4WE1 A;  2PY5 A;  3AVN A;  4PQU A;  3SJJ A;  4HUF A;  4M3Z A;  4OGE A;  1EKE A;  4ID1 A;  3U6F A;  4B9T A;  4CJE A;  2ZE2 A;  4LY7 A;  3ZSO A;  3LZI A;  1QE1 A;  4CJF A;  1RBU A;  4RW6 A;  4KRF A;  3SCX A;  4DFP A;  1UA1 A;  1LW0 A;  3HT3 A;  3TAG A;  1XI1 A;  1LV5 A;  1L3V A;  2G8W A;  1SKR A;  3MED A;  2YKM A;  3NFA A;  1K6Y A;  3C6T A;  2PYL A;  1NK9 A;  4FYD A;  1WAF A;  1KVC A;  4CES A;  4O0J A;  1YTA A;  2F8T A;  4OKK A;  3QEI A;  2P5G A;  1C0U A;  3OYL A;  1GOB A;  3DI6 A;  4AHV A;  3DRP A;  1RT6 A;  2Z1G A;  2DFE A;  1S1U A;  1Z26 A;  3DOL A;  3CFR A;  5CYM A;  4DF8 A;  3SQ2 A;  1VK0 A;  4K8X A;  2YNG A;  4KV8 A;  4EP4 A;  2KZZ A;  2KW4 A;  4B8A B;  4CEB A;  4CGH A;  3NAE A;  2KZM A;  3QEV A;  3VQC A;  4CEO A;  3QNN A;  2OZS A;  3JSM A;  4CK1 A;  1RDD A;  1XC9 A;  1D9D A;  1HJR A;  3OYH A;  4FJG A;  3F73 A;  4FJN A;  1U4B A;  3U3G A;  1VSH A;  4CEZ A;  3AA2 A;  4CGD A;  4M3T A;  1FKO A;  1W0H A;  3L3U A;  1TL1 A;  3E01 A;  2X6N A;  4M3W A;  1ZBF A;  1J54 A;  4O5B A;  4KPY A;  1EET A;  4Z4F A;  2XY8 A;  1RDC A;  2VG6 A;  4CFB A;  3QET A;  2G8U A;  1JXE A;  2P5O A;  1C1A A;  4IFY A;  4CK3 A;  1RTI A;  4CJL A;  3K5L A;  1B9D A;  3RRH A;  1S1X A;  4CGJ A;  4CGG A;  5J2Q A;  4CF2 A;  4C8O A;  2EHG A;  3DOK A;  3QIP A;  3KLG A;  2Y1I A;  4O55 A;  4NYN A;  4EP5 A;  3AV9 A;  4CJK A;  4DQR A;  4CF9 A;  3TR8 A;  5C25 A;  1JLA A;  1L3S A;  4FJI A;  1NK0 A;  1UWB A;  4I2P A;  1YVU A;  3KLF A;  5DMR A;  1U47 A;  2RN2 A;  4FJK A;  4KHN A;  1T03 A;  2VG7 A;  4ZTJ A;  1UA0 A;  4E19 A;  2I5J A;  3HK2 A;  4AH9 A;  1RBS A;  4LSN A;  4OPK A;  3AO4 A;  3AVF A;  3SQ4 A;  4DFM A;  4RW8 A;  4GVM A;  4FVM A;  2HHU A;  3S3N A;  1IKV A;  4HUG A;  3B6O A;  2YKN A;  1TL3 A;  2FBX A;  4LSL A;  3TAM A;  1ZBI A;  1KVB A;  4KTZ A;  3K58 A;  5J2N A;  1KSP A;  1RT1 A;  2FBV A;  1TV6 A;  3VQQ A;  3VN5 A;  3LPU A;  3QEP A;  3TI0 A;  4W5T A;  3G0Z A;  3HPO A;  4FW2 A;  2BGG A;  5I3U A;  3PV8 A;  1FXX A;  4KKO A;  5HP1 A;  3D45 A;  2R7Y A;  2HNY A;  4FJ5 A;  2ITG A;  3DYA A;  4MQ3 A;  4DS5 A;  1TAU A;  1IO2 A;  4DF4 A;  1VSL A;  1BI4 A;  4CJ4 A;  3WNF A;  4FJ9 A;  4AHR A;  3RR8 A;  3I8D A;  4IG3 A;  4PY5 A;  4OLA A;  1VSJ A;  3QES A;  4FJX A;  1WSJ A;  4FJ8 A;  3OYB A;  2YHA A;  3ULD A;  2O4I A;  2JLE A;  4Z4C A;  1U48 A;  4L8R B;  3VQ6 A;  4CHQ A;  3L2W A;  1KFS A;  3ALY A;  3F9K A;  1HMV A;  4AHC A;  4CHO A;  3RRG A;  3PX6 A;  2PYJ A;  3NF9 A;  3SNN A;  2DY4 A;  3LDS A;  3NH0 A;  1KTQ A;  3SUN A;  4KHS A;  1S5J A;  4O44 A;  3KIO A;  4FJL A;  2IDO A;  1LWE A;  1I3A A;  1C6V A;  4JLH A;  3WNH A;  3L2V A;  5HRR A;  1S1T A;  4Q5V A;  2XRI A;  1U45 A;  3DLB A;  3AVA A;  4KHQ A;  4FXD A;  4H4M A;  3OYF A;  2PZS A;  3V9Z A;  3OYA A;  1N6Q A;  2G8H A;  3RR7 A;  4CEA A;  1XHX A;  3L3V A;  4IG0 A;  3ASM A;  1IKW A;  2E4L A;  3L2Q A;  3OYG A;  3RMC A;  1TK5 A;  3OYJ A;  1RBT A;  1JLB A;  4EZ6 A;  3HM9 A;  1WNS A;  3O3F A;  4HHT A;  4R5P A;  3HPG A;  1QSL A;  3ITH A;  3I0R A;  3VQ4 A;  4FJJ A;  3HXM A;  4FK4 A;  3T19 A;  3QER A;  4MFB A;  2DFF A;  4BDY A;  4B08 A;  3SPY A;  3PO5 A;  3D0P A;  2QKB A;  1IG9 A;  1TK8 A;  3AA4 A;  4CK2 A;  3HJF A;  3MEC A;  3VA0 A;  4CEC A;  1T7P A;  1TVR A;  1W9H A;  2KQ2 A;  1SKS A;  3A2F A;  4F2R A;  4M42 A;  4E89 A;  5CZ2 A;  2P51 A;  5KGW A;  5T7B A;  4DS4 A;  1VSD A;  3KK1 A;  4I2Q A;  4FM2 A;  4KI4 A;  1VRU A;  3HVT A;  3NGY A;  4CJR A;  1JLE A;  2VWJ A;  2HHT A;  5J2P A;  3AVJ A;  3RMA A;  3B6P A;  4H8K A;  1YT3 A;  4NCA A;  3NH1 A;  4FLX A;  2GV9 A;  4Z0U A;  4RW4 A;  1ASU A;  1T8E A;  4DU3 A;  4ELU A;  1Q9X A;  2YNF A;  4QCL A;  2G8I A;  1JL2 A;  4CHY A;  1BGX T;  1HPZ A;  2O4G A;  3HST B;  4DWI A;  1BCM A;  2FC0 A;  4CIG A;  3THV A;  1NJX A;  3ZCM A;  3LPT A;  1X1P A;  2X74 A;  1Y97 A;  3AVH A;  3HO1 A;  4O4G A;  3DM2 A;  1RTJ A;  4ID5 A;  4DU1 A;  1XHZ A;  5J1E A;  3AO1 A;  3VQ5 A;  2KFN A;  4HVJ A;  3AVG A;  4DFJ A;  4CJQ A;  3RMB A;  1S1V A;  2RPI A;  4CFC A;  4IKF A;  4JS4 A;  3NH2 A;  3LP3 A;  3NBP A;  4AIL C;  1KRP A;  2B5J A;  3HYF A;  1JLG A;  1RT7 A;  4BWM A;  3OYC A;  3CM5 A;  3TAR A;  4N76 A;  3SUO A;  1CZ9 A;  1JXB A;  4B9L A;  2D5R A;  3CFO A;  4YNQ A;  1HQU A;  1SKW A;  3KKR A;  3SUP A;  1U04 A;  3ZT4 A;  4CFA A;  3T3F A;  4AHS A;  3V1O A;  3LAL A;  3ZSY A;  3M8Q A;  3V4I A;  1U49 A;  3PX4 A;  1T05 A;  3ZSV A;  4N41 A;  4KHU A;  1LWF A;  3L2U A;  5HLF A;  4B9N A;  4CJP A;  2E6L A;  3SUQ A;  4FLV A;  4CJ5 A;  3OJU A;  2HVI A;  3NGZ A;  4CEQ A;  1C1B A;  3K5O A;  4BE0 A;  1EX4 A;  1QHT A;  3P5J A;  3TAN A;  1NKE A;  3DLE A;  3NF6 A;  3KD5 E;  3SYZ A;  2HB5 A;  1SL0 A;  3CQ8 A;  3OYM A;  4M45 A;  3P1G A;  2IGI A;  4DTR A;  3RTV A;  3O4Q A;  1RTD A;  1NK6 A;  2QKK A;  2A1S A;  3IS9 A;  4IFV A;  5EU7 A;  3O3G A;  4DTP A;  1DTT A;  4FK0 A;  5HRP A;  4CF1 A;  3OS0 A;  5HBM A;  3C94 A;  3HP6 A;  3BDP A;  4Y1D A;  4E7J A;  4M3R A;  5KI6 A;  1QQC A;  3EZ5 A;  4F8R A;  2WON A;  4DLG A;  2HMI A;  1A5V A;  4DTS A;  3HL8 A;  1LAW A;  3KD1 E;  1Q8I A;  4CJ3 A;  1ZBH A;  4FLU A;  3MEE A;  1LAV A;  1BHL A;  3BGR A;  1JKH A;  1WSH A;  1TAQ A;  4KAZ A;  3K57 A;  4DSF A;  3PUF A;  4N47 A;  4B9M A;  4ICL A;  4C8N A;  4M3U A;  4BDZ A;  4CCH A;  3TAQ A;  4B8C A;  1HNV A;  4H4O A;  2Z1H A;  3SZ2 A;  3G10 A;  1HRH A;  1Q9Y A;  2OZM A;  3DLG A;  4GMJ B;  3RWU A;  3AVI A;  4CGF A;  1S6P A;  3PX0 A;  5D3G A;  4FW1 A;  3AO2 A;  3V9U A;  4KHY A;  3NE6 A;  3NCI A;  3DLR A;  3CFP A;  3MXJ A;  1QTM A;  1TGO A;  2IC3 A;  2HHS A;  4CJW A;  2OPQ A;  4K8Z A;  4QOZ B;  1KLM A;  4O0I A;  2KFZ A;  4Q0B A;  2G8V A;  2BAN A;  3U3Y A;  3QLH A;  3TAF A;  2ATQ A;  3KLH A;  4OLB A;  1C1C A;  1RTH A;  1ZBL A;  2RF2 A;  3KLE A;  3S9H A;  2HND A;  4HCB A;  3TWH A;  4CE9 A;  2D0C A;  5KGX A;  4NYF A;  2QK9 A;  3LAM A;  1XWL A;  3V1R A;  3OS1 A;  1RIL A;  4DMN A;  2Z1I A;  3HP9 A;  1D9F A;  1EP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...