3AVNA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avnA00
1HYVA 4OKKA 3AVKA 1A5XA 4DS4A 5J2QA 4YNQA 3S3MA 4DG1A 3K5NA 2D0BA 1JKHA 4DTSA 4M3ZA 1IO2A 4ICLA 5E41A 3OYNA 2DTUA 1IKWA 4CE9A 1JLEA 4CERA 5SWMA 1WN7A 4CEZA 3OS0A 3BDPA 1KFSA 2LSNA 5CZ1A 3AO5A 1VSKA 1W0HA 2E6LA 3VQAA 1NK6A 4B9SA 3K57A 4KRFA 4E7JA 2F8TA 2X6NA 2XRIA 4KTQA 3D45A 3DLEA 1HQUA 4OPKA 4CHYA 1U49A 4GVMA 3VA3A 4HCCA 1I39A 3LPTA 4HUFA 3P5JA 4RW9A 2KQ2A 1W9HA 2IOCA 1HJRA 2BDPA 4C8NA 4J2EA 3NH2A 1WSFA 4CK3A 1FK9A 4FCYA 4CJ4A 4DF4A 1L3VA 4EP4A 4KB1A 4HUGA 3OYDA 3SQ1A 4DSJA 1TL3A 4FK4A 2PY5A 1D8YA 1NJXA 3M8QA 3MAQA 4MQ3A 3KTQA 4FJIA 1ASUA 1BGXT 2E6MA 4FLVA 2ETJA 4CJ3A 4FJ7A 4L8RB 2D0CA 4RG8A 3ZSZA 4GW6A 3VQ6A 4CEDA 4O0JA 4DTRA 4QOZB 3C95A 1NOYA 3LZJA 3LZIA 4E3SA 2F8SA 2FBYA 4CHQA 4JLHA 3PO5A 1ZBFA 1JLBA 1GOAA 3QEIA 3KIOA 1RTHA 1WAFA 3V9ZA 2Y1JA 3KLGA 2XY6A 4FYDA 1QE1A 3E01A 4HCBA 3QETA 3AVLA 4CJQA 1BQMA 4HVJA 2W42A 1RCHA 3RMCA 1A5VA 4AHRA 2YKNA 3NF6A 5KGXA 4N76A 1WSJA 2VG6A 2G8VA 3DLGA 2PYLA 1C0TA 3HO1A 1LV5A 3HP9A 1S9EA 2X74A 1RTIA 3QO9A 1BIUA 2XY5A 4K8ZA 5I42A 2XHBA 5C25A 1RDBA 4CIEA 4CJKA 1XWLA 4LSNA 4RW4A 2Z1IA 3P1GA 1REVA 4AHVA 3QEPA 2P5OA 1RT2A 2OPPA 3OYFA 3LWLA 1KTQA 4AH9A 1VRUA 3VQ8A 3OS1A 3L2WA 5T7BA 4OJRA 1J5OA 2JLEA 1KLNA 3SCXA 1C0MA 4FJKA 1UOCA 3EZ5A 4E7IA 1Z26A 4W5NA 3KLEA 4FZYA 4DQPA 4I2QA 2O4GA 1HYSA 4AHSA 1SKRA 4OLBA 1IKYA 1Z25A 1QHTA 4OKEA 1VSJA 3QIOA 2IC3A 3LPUA 4FW1A 4RW7A 4BDZA 3V9UA 3OYGA 4DQQA 3TAEA 1VSHA 1TVRA 5FRMA 3C94A 1VSDA 2EHGA 4IFYA 3QNNA 3OYAA 3K5OA 4HHTA 3AVMA 2Z1GA 3T19A 3TARA 2OPQA 4KTZA 3F73A 3NAEA 1B92A 3AO4A 4H4OA 3T3FA 3G10A 3RRHA 3DLKA 3DI6A 1S1WA 1C6VA 1BQNA 4CGGA 3OYMA 4DLGA 1NK7A 1ITGA 1RDCA 2F96A 4FW2A 3TAQA 1VSLA 1FKOA 3LP2A 1RTDA 1QTMA 1TAUA 1RTJA 1GOCA 2G8WA 1KFDA 3MXIA 3AVHA 4DSKA 1A5WA 3V9SA 3SPZA 1NK4A 2G8KA 4CHZA 3AVJA 4B9TA 4KHWA 2HVIA 3P83D 3OY9A 4N5SA 2VG7A 3VQ4A 4KO0A 4M3WA 1SL1A 2XY8A 1CZBA 4OGEA 1DTTA 4CK1A 1J9AA 2XY7A 4M3TA 2NUBA 1Y97A 3NBPA 5EU7A 3OYCA 4NCAA 4BWJA 3RTVA 4DU3A 4KI6A 5SZTA 2YNGA 2HB5A 1X9MA 2P1JA 4J2BA 3KKSA 4FZXC 4NYNA 3B6OA 4CHNA 3WNEA 4FJJA 4CGHA 2ZD1A 3WNGA 3AVNA 3M8RA 3IRXA 1SL0A 1NJYA 3L2VA 3CQ8A 3HJFA 3AA5X 3QINA 1KCFA 1UA0A 4PUOA 1CXQA 1TGOA 2Z1JA 1RBUA 2DY4A 1UAXA 4E89A 4ZTJA 2Q3SA 1ZBIA 3ISNC 4B3OA 2HW3A 3SZ2A 1T8EA 3MEGA 3AO3A 5CYMA 5C42A 3HVTA 3I0SA 3HK2A 4CGFA 3V9XA 4KI4A 3RWUA 4FLTA 4F4KA 4W5OA 3IS9A 3DOLA 4W5TA 1TKZA 1HMVA 1CLQA 2RKIA 3LAKA 3RMDA 3PX6A 4QCLA 4E7HA 1S1VA 1JL1A 2I5JA 3ALYA 4BDPA 4FJ5A 4EP5A 1S9GA 1C0UA 2QK9A 4E0DA 3SV4A 3NGIA 1NOZA 4JRQA 3QESA 1KRPA 2ATQA 4CF1A 1D9FA 4F2RA 3LWMA 3JYTA 4CGJA 1VSMA 1J54A 3NF9A 1L3TA 4FK2A 1L3SA 5FRNA 1WSIA 3SQ0A 4RW6A 1N5YA 3FFIA 2IAJA 3OYEA 4E7KA 1NK8A 5J2NA 3L3VA 4E19A 1LWEA 1C1AA 2BANA 4M45A 4QAGA 1VK0A 3TAMA 4DFJA 4KHSA 3SUNA 4ID1A 4CIFA 4CFAA 4FM2A 1RT1A 5K14A 5KTQA 1LWCA 4IDKA 2VWKA 4W5RA 1SKSA 3V1RA 3NF7A 3LP3A 4B8CA 2DFEA 3EYZA 1VSEA 4O44A 4C8OA 4KB0A 4R5PA 4KHYA 3QLHA 1T05A 1U48A 1LAVA 5HRSA 2A1SA 4KKOA 3WNHA 4ZHRA 4ELTA 2HNZA 4LH5A 4J2AA 3SUQA 1ZBHA 4B9VA 4EZ9A 3BGRA 1ZBUA 4O4GA 3NGYA 3PX0A 4O0IA 1KVAA 3AA4A 2OPRA 5DMRA 3ZSOA 4CIGA 3VN5A 1TAQA 3L2UA 3VQ7A 3LDSA 1SKWA 1RILA 3M8SA 2AJQA 1L5UA 3L3UA 4CCHA 4FJXA 4Y1CA 3ZT4A 2QKKA 4LY7A 3ZT0A 5KRSA 3MECA 1TK0A 4B9MA 3C6TA 4Y1DA 1YTAA 4N47A 3DOKA 3ZSVA 5I3UA 1UWBA 1YT3A 4E1NA 4CEEA 1ASWA 1D5AA 2D5RA 4CFCA 3QEXA 1NKBA 4DSLA 3HVRA 3HL8A 2OYQA 3HSTB 1RDDA 3AVFA 3MEDA 1WNSA 3KK2A 2PYJA 4CJEA 4CEBA 1NJWA 1S6PA 5HRRA 3B6PA 1BL3A 3ZSQA 3PX4A 3OYIA 4M42A 1XHZA 4FLXA 1BIZA 4CFBA 4DTPA 4FK0A 3ASMA 2KZMA 4F3TA 2GBZA 3DLRA 3L2QA 2X78A 3CG7A 4OGCA 4CF2A 1S5JA 2DFFA 3LP0A 4G1QA 5FDLA 4LD0A 3OS2A 3NE6A 3SUOA 4CF9A 3DLHA 3IAYA 1RBRA 2JGUA 1C1BA 1VRTA 1KLMA 4CHOA 1JLFA 1LWFA 3DRRA 4ELUA 4IKFA 3DRPA 2IS3A 3NGZA 3HPOA 2OZSA 3KD1E 4KHNA 4JS5A 2FBXA 1I3AA 2HHQA 2P5GA 4CJTA 4EZ6A 4NCGA 4I9QA 4KREA 5HP1A 4BE0A 1IG9A 4Q0BA 3OYHA 1TL1A 3EY1A 3TANA 4H8KA 2A1RA 1QSYA 1JLQA 3LAMA 4PA1A 2D0AA 3CYMA 4B8AB 4DTJA 2YV0X 4DSIA 2DFHA 4TSXA 2KTQA 2KFZA 4FM1A 1BCOA 4E1MA 2HHWA 3AO2A 1TV6A 3VQ9A 1J53A 1WSHA 3OJSA 1EXQA 3C6UA 5CZ2A 4CJFA 3O3GA 4M3XA 1EP4A 1ZYQA 3OYJA 4BWMA 3DYAA 3OYLA 3ZT1A 4Z4FA 2ITGA 2VWJA 3DM2A 3MXJA 4N41A 3K5MA 1TK5A 1B9DA 2HNYA 1RT3A 2GV9A 4FJLA 3SQ2A 4FJ9A 2FC0A 4Z4HA 3U6FA 3RR7A 5KRTA 5HLFA 2P51A 3TR8A 3SQ4A 3I0RA 3K59A 4LSLA 3JSMA 3O3FA 3NF8A 3AO1A 1Q9YA 2EX3A 1HPZA 4O5BA 4H4MA 4AHTA 4CHPA 4IFVA 3VQDA 1EKEA 2QXFA 4BE2A 1HQEA 3TI0A 1QQCA 3AVIA 4CJ5A 4DQIA 4CEQA 1S6QA 4FVMA 1NK5A 3TWHA 1BCMA 3KD5E 3OYKA 3ZSYA 2HHTA 2B6AA 3SUPA 1YTUA 5HROA 1U47A 1FXXA 3AV9A 3TAPA 3V1OA 3KKRA 3O3HA 1U45A 2G8UA 3HYFA 3SNNA 2BE2A 1T7PA 4FJ8A 4ZTFA 3ZT3A 3K58A 4CJPA 3LP1A 4JS4A 5CYQA 3THVA 3SJJA 2HHSA 4F3OA 4Z4CA 3KLHA 4B9LA 4DMNA 4K8XA 5HRNA 1O1WA 3VQQA 3K5LA 2X6SA 2G8IA 1NJZA 2O4IA 4FZZA 4AHCA 3V4IA 2Y1IA 3KLIA 4FJMA 2G8HA 1FKPA 1VSFA 3T1AA 4BACA 4DF8A 3DRSA 5HRPA 3RR8A 1CZ9A 2Z1HA 3PO4A 4C8KA 4B08A 4FLYA 1BI4B 2YNHA 3PV8A 1JXBA 1R0AA 2ZE2A 4WE1A 3PY8A 1DTQA 4FJHA 3V6DA 1S1XA 1Q9XA 4F8RA 2HHVA 3AVGA 4N56A 4OKJA 2RPIA 1NK9A 2B4JA 4C8MA 4CESA 3CFRA 4KHUA 3CM5A 4DFPA 1IH7A 3V81A 2G8FA 3NFAA 3NCIA 3D0PA 2YNFA 3MXMA 3AA2A 3AVBA 3SI6A 1SUQA 2HHUA 1YVUA 4CF8A 4NYFA 4M41A 4BDYA 5J2MA 3RMBA 3L2RA 4KPYA 4KHQA 1WAJA 4M3UA 1X9SA 3O4QA 4PWDA 2YKMA 3KK3A 1WSGA 3G0ZA 1QS4A 3ZSWA 4Z0UA 3TABA 4IG3A 4KTWA 1RT7A 2QKBA 1S1TA 4DTMA 3SYZA 4CK2A 1VSIA 1NKEA 4FJNA 4DTXA 3ULDA 3VQCA 1RBVA 3CFOA 1UA1A 1NKCA 4KFBA 1S1UA 3QEVA 3AVCA 3A2FA 1T03A 1LW0A 2E4LA 4CEAA 1CXUA 4DTOA 3VQPA 4Z4EA 4FLZA 2ZQBA 4KV8A 4I9LA 5FROA 3U3GA 1B9FA 1HYZA 2OZMA 3ITHA 3PUFA 3TAGA 3AVAA 1KVCA 3HXMA 5KI6A 4M3YA 1LAWA 2HHXA 3SV3A 1X9WA 3ZSRA 3QNOA 1XC9A 2FBVA 2RN2A 3CFPA 4HUEA 3QERA 1G15A 4DTUA 3SPYA 4PY5A 4OPJA 4CGIA 2GUIA 3HPGA 2KW4A 4IBNA 4CGDA 3RMAA 4Q5VA 3AA3A 1IKXA 2YNIA 4CEOA 1ZBLA 4DLEA 1RT4A 4GMJB 3NH0A 5KGWA 4FJGA 4CJSA 2OPSA 4C8LA 4JRPA 4DQRA 4BE1A 3ZSXA 5JS2A 4ELVA 1JLGA 4CEFA 1Q8IA 1L3UA 4J2DA 2HNDA 2VG5A 1IKVA 1QSLA 3KK1A 4YFUA 3NDKA 2HVHA 1RDAA 2OA8A 3UIQA 1TKDA 2WOMA 3WNFA 1KSPA 4AHUA 3U3YA 4DTNA 1C1CA 3KLFA 2XO7A 1XHXA 3H08A 3HT3A 3L8BA 3HP6A 3OVNA 4NCBA 3VQBA 3LALA 4DQSA 1RT5A 3VQEA 1LW2A 3HM9A 1GOBA 4Z4IA 1BISA 2KZZA 4B9NA 4DU4A 2R7YA 3QEWA 3I8DA 4CJUA 4PQUA 3F9KA 5C24A 4CFDA 4RW8A 1WLJA 2BGGA 1TKXA 5J2PA 3ZT2A 3NH1A 5DK5A 4DSFA 1EETA 3OJUA 2RF2A 1JL2A 3S9HA 4MFBA 4OVLA 1ASVA 3NHGA 3S3OA 5D3GA 1U04A 3V9WA 3S3NA 1JXEA 2B5JA 3DLBA 3RRGA 4F2SA 4HTUA 3V1QA 3VQ5A 4DFKA 3MEEA 4FLWA 4FLUA 3VA0A 4CF0A 5CY4A 4I7FA 4DSEA 2KFNA 1HNVA 4CJWA 3IG1A 1SV5A 4AILC 2FBTA 1NK0A 2PZSA 4CJLA 1X1PA 1RBSA 1TKTA 3CM6A 1QSSA 1JLCA 1SL2A 4DWIA 4KAZA 4W5QA 1RNHA 3O4NA 1K6YA 4UQGA 3M8PA 1RT6A 4Z4GA 4DS5A 2YHAA 1JLAA 4CECA 3KJVA 5JS1A 1WSEA 3DMJA 1HRHA 1EX4A 1F21A 1D9DA 1TK8A 3TAFA 4CJVA 4IG0A 1HNIA 5J1EA 3OYBA 1U4BA 1N6QA 4OLAA 1XI1A 5HBMA 2YHBA 3ZCMA 4XIUA 4ID5A 1KVBA 3LANA 3HPHA 4FXDA 4DU1A 3K2PA 2IDOA 3QIPA 1DLOA 1MU2A 1BI4A 1BHLA 4I2PA 2HMIA 4CJRA 4O55A 2WONA 4DFMA 2IGIA 1RBTA 4LH4A 4B9UA 4FM0A 4E7LA 4M3RA
chains in the Genus database with same CATH superfamily
4OKKA 4DS4A 1A5XA 1BA0A 2G8UA 4DG1A 4M3ZA 3A5NC 4ICLA 3OYNA 3L6QA 2A3ZA 1IG8A 4CE9A 4CERA 5SWMA 3AAQA 3KWIA 4EFHA 3MDQA 5EY4A 3VQAA 1XMOK 3K57A 2Q31A 2F8TA 3D45A 3DLEA 4A5BA 4OPKA 4GVMA 4OPAA 3LPTA 2V52B 4DV6K 1K73O 4YHHK 2KQ2A 1IV0A 3NH2A 1FK9A 1L3VA 3THYB 1IBLK 3SQ1A 3KVGA 1NJXA 3M8QA 3MAQA 1IBKK 3BUZB 1ASUA 1BGXT 5AZJB 5GAGP 4RG8A 3ZSZA 3ZEUA 4CW7B 2D4WA 4FWSA 4CI6A 1ZBFA 3QEIA 1WAFA 2XY6A 2F9WA 3AY9A 5HL7L 5AQGA 3H1QA 1KAXA 1RCHA 4DR5K 5KGXA 1C0TA 4A59A 4LSNA 4RW4A 4DV2K 2Z1IA 5AFUH 1REVA 3JXUA 3LWLA 2NRVA 3WUHA 3CCLN 4AH9A 1NGGA 2GELA 2H3GX 4NXMK 2ZGZA 3F9MA 4DUYK 1KLNA 3SCXA 4FJKA 1IJJA 4AM6A 4BRCA 3EZ5A 3HM8A 4E7IA 2RE2A 1HX1A 3D2EB 4JD2A 4FZYA 5AQYA 4AHSA 1C0GA 2HBLA 4OLBA 1Z25A 1VSJA 3TTDA 3TAEA 1Y64A 2FSJA 1TVRA 4AM7A 3QNNA 1D8YA 3K5OA 2Z1GA 4JKGB 3TARA 4H4OA 1ATRA 3T3FA 3DI6A 2WTUA 1BQNA 2GWKA 3EZWA 3TAQA 1FKOA 3LP2A 1QTMA 1RTJA 1A5WA 3SAFA 1CZAN 3AVJA 4BR7A 1YJ9N 4KHWA 2I7PA 2VG7A 3THWA 4XEIA 4BG8A 4JI5K 3IMXA 4CK1A 5JMVA 1J9AA 4M3TA 4JKFA 1TUUA 4NCAA 2QWLA 3RTVA 3ENBA 3WT0A 4FWLA 2P1JA 3GE1A 4J2BA 2VGMA 5E26A 4NYNA 4FWQA 3TPQA 3WNGA 3AVNA 1K8KA 3QINA 2Z1JA 2QEXN 4BRFA 3E9LA 1UAXA 4ZTJA 5AFUA 3BF1A 3CC2N 3MEGA 1LCUA 2GUPA 4BC4A 3FFKB 1NNEA 4A61A 1TKZA 1HMVA 5CHIA 4LC9B 4QCLA 3RMDA 5GIOA 5JLHA 1S1VA 1JL1A 3ALYA 3SJHA 2QK9A 1KRPA 4BR0A 2ATQA 3AARA 4F2RA 4C1NI 2F4VK 4RW6A 1DGKN 1NK8A 3L3VA 1C1AA 3CJBA 3KHYA 3CC4N 4QAGA 4OX9K 3SUNA 4CIFA 2P9KB 4FM2A 3SAHA 5ELZA 2KHOA 2VWKA 1SKSA 5M1OA 5AQXA 3LP3A 4C8OA 1VSEA 2YHXA 3QLHA 5LMNK 4HCBA 1LAVA 5HRSA 3WNHA 4ZHRA 3L0QA 3SUQA 4MDBA 4B9VA 4EZ9A 3ZSOA 1HR0K 4DV5K 3L2UA 1SQKA 4DV1K 5C15A 1L5UA 3L3UA 4JI2K 1VAZA 2QKKA 4CZLA 3VF2A 3C6TA 2QW9A 3CHWA 5I3UA 3DOKA 1N34K 3QEXA 1NKBA 2V51B 2HBMA 3HVRA 2OYQA 3HSTB 2VQFK 2A6AA 2W40A 1YVNA 4CJEA 1WUAA 2CH5A 3D2EA 1NJWA 3PX4A 3ASMA 1BDGA 4GV9A 1GLFO 2PFUA 1X9JA 4M63C 4OGCA 2DFFA 4G1QA 3OS2A 3SUOA 3DLHA 3U9ZA 3IAYA 4JI3K 5JVHL 1KLMA 4CHOA 3CCUN 2YI1A 3DRPA 3HPOA 3KD1E 1KQSM 3AGKA 4CJTA 1YAGA 4Q0BA 1TL1A 1Q18A 5E84A 2D0AA 3CYMA 3VGLA 4TSXA 3ID8A 2KFZA 1BCOA 5AQJA 5JLFA 5GINA 1WSHA 4LF4K 4YOYA 1EXQA 3GBTA 4IDHA 1W97L 3OYJA 2NZTA 5BN8A 3O9QA 3ZT1A 4Z4FA 2ITGA 4CJ7A 2VWJA 1RT3A 2FC0A 1BOTO 3H6EA 5KRTA 3TR8A 5HLFA 2V7YA 3I0RA 2HF4A 4LSLA 3MX2A 4O5BA 4H4MA 3A5MC 1EKEA 3R9PA 4JV5K 3FGUA 3SBGA 4JI4K 1QQCA 5M1QA 4CEQA 1S6QA 4G9ZA 4JKAA 2ZGYA 1BA1A 5HROA 1FW6A 1FXXA 3V1OA 1T7PA 2NRWA 1HNXK 4FJ8A 3SNNA 2W6KA 2D1KA 3ZT3A 4JS4A 4B9LA 1QQMA 4DMNA 2G8IA 3QMLA 3H3OB 2O4IA 3KLIA 3J8AA 4IEIA 1ZC6A 4PL8A 2DPNA 4BACA 3RR8A 3QFPA 4X64K 4C8KA 4B08A 4FLYA 4JI0K 4BREA 5C2FA 1BI4B 2YNHA 5AQFA 1DTQA 4F8RA 2HHVA 2P9KA 1NK9A 4CESA 4C8MA 3CFRA 4CZGA 1NM1A 1WOQA 2P9UA 2YNFA 3CQXA 3AVBA 3CQYA 4CF8A 1QZ6A 3HBTA 1KAZA 5J2MA 3RMBA 3L2RA 2W41A 2YKMA 3N4PA 3I33A 1WSGA 1QS4A 3ZSWA 3SLCA 4OO1J 3TABA 4IG3A 1RT7A 2FF3B 2CGLA 5LY3A 2QM1A 1YUWA 4JEPA 1NKEA 1VQ9N 2JWLA 4FJNA 3ULDA 3VQCA 3WEEB 4B1WB 1S1UA 1T03A 2HMPA 2E4LA 4GV3A 1VQ4N 4I9LA 3PSFA 1GLDG 4EHTA 2E8AA 2KKZA 4M3YA 1LAWA 3CCRN 3DJCA 3ZSRA 1XC9A 4V19S 2RN2A 3CFPA 4BRDA 4QS7A 4JKEA 4BVOA 4ILGB 5AQKA 3C65A 1S72N 4JAXA 1IKXA 2YNIA 3HTVA 1GLCG 3NH0A 1KAYA 5KGWA 2OCEA 5BRFA 1ILYA 2FF6A 4B1XB 4BGAA 3ZSXA 3C7NB 4JK9A 3VEVA 4J2DA 4FOIA 4YFUA 3L4QA 5AQOA 2HVHA 1EWQA 3ZX2A 3TSPA 1XHXA 1YJNN 4BRLA 1KXPA 4CD1A 4DQSA 1RT5A 3HM9A 2R7YA 4BR2A 2BGGA 5J2PA 3T1YK 4DSFA 5DK5A 4MFBA 1ASVA 5D3GA 1U04A 1OH8A 3DLBA 4KH5A 2NRRA 4XH1A 1H1VA 3VA0A 3K9KA 3ULEA 2PZSA 1RBSA 1M90O 3DXKB 1JLCA 1SL2A 5BPLA 1X3NA 4Z4GA 3KJVA 4CECA 2P9SA 1EX4A 3BF3A 3E9OA 3TAFA 4CJVA 4IG0A 1N6QA 4OLAA 5HBMA 2YHBA 3ZCMA 3LANA 2GWJA 4X66K 2IDOA 4JKHA 3E66A 1BI4A 1BHLA 5DM6L 2WONA 4DFMA 4LH4A 1VQ5N 1HKCA 4FM0A 1NMDA 3AVKA 4YNQA 3VETA 4DTSA 1JKHA 1X3MA 5E41A 2DTUA 2VGNA 1IKWA 4B9QA 4CEZA 1T3VA 5KPRA 5CZ1A 3AO5A 2E6LA 2WUSA 3RSEB 4E7JA 2NRXA 1WBDA 4X65K 2X6NA 4JKDA 2F7TA 3IKMA 4H0XB 3VF6A 4CHYA 5AQLA 3I8BA 4MLEA 3WEEA 4NXNK 4J2EA 1WSFA 4CK3A 4HUGA 5AQNA 3MX5A 4DSJA 4IJAA 4FK4A 3HRGA 2PY5A 4MQ3A 1XC3A 1JCGA 4FLVA 2CGJA 2Q2RA 4CJ3A 4L8RB 1TUYA 2D0CA 4DTRA 3TTFA 4FOEA 1MWKA 3LZJA 3LZIA 4E3SA 2F8SA 2FBYA 4CHQA 1W2BM 2Y1JA 3ZEUB 4B3TK 4FYDA 1QE1A 3E01A 3QETA 3E9PA 1BQMA 4HVJA 3RMCA 1A5VA 2YKNA 4BRHA 1MA9B 4N76A 1WSJA 2VG6A 1N32K 1E4FT 2ASOA 5AQHA 2PYLA 1LV5A 3QO9A 1BIUA 2EWSA 2XY5A 5I42A 4K8ZA 1XWLA 1NU0A 3QEPA 4AHVA 1RT2A 3L2WA 1VRUA 3VQ8A 2FXUA 2JLEA 3U4LA 1C0MA 3UKRA 5EOYA 1Z26A 4HTLA 3VENA 4IWVA 5A2QO 3VEYA 3R3LA 1IKYA 5IWAK 3V9UA 4BDZA 4FW1A 4DQQA 1VSHA 1VSDA 3IUCA 4FJ5A 3T19A 3LDNA 4YOVA 3NAEA 3AO4A 1N8RO 3G10A 5BRDA 3OYMA 1C6VA 3ID6A 1N33K 1ITGA 3AGRA 1VQKN 5AQUA 4U67L 5GIPA 4K25A 1RTDA 3ATUA 3AVHA 2UU9K 3V9SA 3LM2A 3SPZA 1QZ5A 4B9TA 4WYBA 2HVIA 3OY9A 3LDOA 3VQ4A 3MWTA 4OGEA 2XY8A 2XY7A 3OYCA 4KI6A 2YNGA 3THWB 4BQZA 1X9MA 2W6LA 5IT9O 4FPAA 3KKSA 4FZXC 4FJJA 4CGHA 3VEXA 1VQ6N 4NLCA 1SL0A 3GL1A 1NJYA 3CQ8A 3HJFA 4PUOA 1KCFA 1TGOA 4BRIA 1K8KB 1RBUA 2DY4A 3CD6N 2Q3SA 2RHKA 3ISNC 4B3OA 3SZ2A 3VTIA 3AO3A 3HVTA 3I0SA 3RSEA 3J81O 3HK2A 1RGIA 3U9DA 3DOLA 4W5TA 3VESA 3CMEN 4H03B 4DR1K 3PX6A 4DV3K 2I5JA 3FZHA 1S9GA 1C0UA 4EAHD 1NOZA 2YHWA 2BTFA 3LWMA 4CGJA 1VSMA 1L3TA 1L3SA 3MN9A 1N5YA 3PIPL 3CJCA 3O9RA 2E2QA 1P90A 4E19A 2ZJPL 3A8YA 4M45A 1E3MA 4PKIA 4ID1A 4CZMA 4CFAA 1RT1A 4W5RA 3NF7A 3M3ZA 5AQTA 3UE5A 4O44A 5LJWA 4KB0A 4R5PA 1T05A 2FLOA 1U48A 4ELTA 2HNZA 4LH5A 1ZBUA 1SAZA 4CIGA 2O8CA 3LDSA 1RILA 4M7YA 2AA4A 1J6ZA 2UUBK 5TKWA 3ZT4A 1BUPA 4LY7A 1TK0A 3SMPA 3MMVA 3ZSVA 1YTAA 1E4GT 2HBJA 5DM7L 3O9SA 3A5LC 1ASWA 1D5AA 4XH4A 3CXCM 1RDDA 3GDQA 5ADXH 5M1NA 4CEBA 5HRRA 3ZSQA 4M42A 1XHZA 4CFBA 4B3RK 2KZMA 5JVGL 2X78A 2QXLA 5FDLA 4CF2A 4YOXA 1Z05A 1RBRA 3NVKA 2FSNA 5C10A 1NBWA 1JLFA 1LWFA 3DRRA 4A5AA 4IO9L 1DKGD 2FBXA 1I3AA 4BROA 4I9QA 3FZMA 4BE0A 1YXQA 3W0LA 2YJEA 4XH5A 3OYHA 3EY1A 3TANA 2A1RA 3LAMA 4PA1A 2YV0X 2AP1A 4BR9A 2DFHA 1Z6RA 2UUCK 3CJ1A 4E1MA 3AO2A 3VQ9A 5JICA 3UKUA 3O3GA 4QS8A 4M3XA 1O13A 3DYAA 3O9TA 3HOTA 5FPEA 4JKCA 2GTDA 3OW2M 4WFAL 3GOIA 5LJVA 4WFBL 1OH5A 3AO1A 2EX3A 3VQDA 2QXFA 4LFCK 1NGFA 2CGKA 4DQIA 5BPNA 4FVMA 3SBTA 3CCEN 1NK5A 3TWHA 4FWOA 2B6AA 3D6RA 1U47A 3KKRA 2BE2A 4B3SK 3K58A 1YIJN 5CYQA 3QDKA 4K8XA 1O1WA 3K5LA 2X6SA 1Q82O 3ATVA 3CCSN 4GVEA 4AHCA 3V4IA 5AJ3K 4FJMA 1VQLN 3PV8A 1JXBA 1R0AA 2ZE2A 3IDHA 4WE1A 1IBMK 3PY8A 1Q9XA 4N56A 2RPIA 1OKJA 2B4JA 4CZHA 4KHUA 3WXLA 4DFPA 1IH7A 3V81A 3AA2A 3SI6A 2QWPA 4M41A 4BDYA 2P9UB 3MN6A 3P31A 3VTHA 3DAWA 4Z0UA 4KTWA 2QKBA 1S1TA 1NGAA 5BPMA 3CERA 4LF5K 3A2FA 2YHYA 1CXUA 4DTOA 4Z4EA 1S22A 2OZMA 2CH6A 3ITHA 3TAGA 3AVAA 1X9WA 2FBVA 3C6AA 4CD3A 1HNZK 4DTUA 3QBWA 2E20A 4CGIA 4IBNA 3RMAA 3AA3A 4CEOA 3VMFB 4GMJB 3MN5A 3RVCA 4CJSA 2OPSA 4C8LA 3WXKA 3FZLA 4X62K 1JLGA 1L3UA 1Q8IA 3NDKA 2OA8A 2ASPA 1TKDA 2WOMA 1Q7YO 3OBWA 4DTNA 1C1CA 3H08A 2E1YA 3VOVA 3HP6A 1GLEG 1YHQN 3LALA 3VQEA 1YITN 4CZFA 1LW2A 1GOBA 4K42A 1EQYA 4L3QA 2QWQA 5BRHA 3F9KA 5AQRA 5C24A 4CFDA 1NWKA 4RW8A 1WLJA 3N4QA 4IOAL 5AQVA 3NH1A 4YOWA 3LDPA 2P9NA 5AQZA 3S3OA 3WXJA 3QFUA 3V9WA 3S3NA 3R6MA 5CR4A 4F2SA 4HTUA 4DFKA 4CF0A 4I7FA 4PL7A 4DKWA 4CJLA 3CM6A 3O4WA 4W5QA 1EWRA 1K6YA 3BZKA 4UQGA 3O1BA 4BC5A 3ULEB 3M8PA 1RT6A 4DQ8A 1JJ2M 4DS5A 2P9LA 1JLAA 2YHAA 1N36K 1HRHA 2A41A 4H0TB 4JI6K 4KBOA 4FPBA 4CZKA 1XI1A 4GY2B 4FXDA 2P9SB 1T6DA 4JI8K 3ZX0A 3FLCO 4M3RA 4BRPA 4E7LA 4BY9C 4H5RA 1HPMA 3LDLA 1IO2A 1ESVA 2YCHA 5B8HA 4WF9L 4RTFD 1KFSA 3HOSA 1W0HA 3CJ9A 3CETA 1U6ZA 5AQMA 1QVGM 4B9SA 4JNEA 1HQUA 2E5LK 3VA3A 1QVFM 4HCCA 3D2FA 4QS9A 2IOCA 1HJRA 2BDPA 4C8NA 2O8FB 4CJ4A 3DXMA 4EP4A 3IFRA 5EXWA 1TL3A 1T6CA 3S41A 4CZIA 3KTQA 2E6MA 1HNWK 1NG9A 4BVPA 3VPZA 4GW6A 3VQ6A 4CEDA 4O0JA 1VQPN 1NOYA 3THXA 4JLHA 1JLBA 1GOAA 2P9IA 3OHRA 3V9ZA 3AVLA 4CJQA 4C23A 1XNRK 4WQ5A 3VGMA 4FVUA 4H5TA 3DLGA 1XUPO 3HO1A 3HP9A 1S9EA 2X74A 1RTIA 2XHBA 3P38A 1T44A 1KTQA 3OS1A 3BP8A 5T7BA 4OJRA 1J5OA 4RCHA 1UOCA 3Q7CA 4ISEA 2KLAA 4DQPA 4BRNA 4I2QA 2O4GA 3UKRB 1SKRA 4PHTX 4AQYK 1QHTA 4OKEA 3QIOA 4B3MK 2IC3A 2HW3A 1OVYA 5FRMA 5KPZA 2EHGA 4IFYA 1NKCA 3OYAA 4HHTA 3AVMA 2OPQA 3CCMN 1B92A 4CBUA 2IVPA 1NK7A 2F96A 4FW2A 5GAEP 2O8DA 1NGCA 1VSLA 1GOCA 1G99A 4IOCL 1KFDA 3MXIA 4MO5A 1NK4A 4K41A 3BZCA 4CHZA 3P83D 4N5SA 5F2RA 4JK7A 4KO0A 4M3WA 3C6HA 4OPHA 2NUBA 1Y97A 3NBPA 4BR5A 4BWJA 5H1SQ 3J80O 5SZTA 2HB5A 3EO3A 3PLAA 2ZD1A 3D7EO 3IRXA 1NGHA 3AA5X 1CXQA 3ZETB 1QHAA 5LMUK 5CYMA 1XQSC 5EVZA 4YOTA 3RWUA 3O6WA 1ZXOA 4FLTA 1HUXA 2RKIA 4H0YB 3TU5A 4KH4A 4E7HA 4FWRA 3DWLA 4E0DA 3SV4A 2O8FA 3NGIA 2J4RA 4CF1A 4FK2A 3SQ0A 2IAJA 3OYEA 4BRGA 1LWEA 1BG3A 1VK0A 4A57A 4DFJA 2Q1NA 5MLCQ 5K14A 1LWCA 4IDKA 3WQTA 4B8CA 4DHYA 3EYZA 3G25A 2A1SA 4J2AA 3CIPA 3BGRA 5F0XA 4O0IA 1KVAA 5DMRA 3U8XA 1TAQA 3M8SA 1HKGA 4IZ9A 1SZ2A 1KC8O 2O8CB 3ZT0A 5KRSA 3MECA 4FWPA 5BN9A 4K0KK 4N47A 3CPEA 4IJNA 1UWBA 4CEEA 4DSLA 2D5RA 3MWPA 4CFCA 1RDWX 2V7ZA 3HL8A 1NLVA 1VQNN 3MEDA 4FL9A 1WNSA 4AF1A 3KK2A 2PYJA 3AAPA 1QQOA 1S6PA 1BL3A 4PKHA 3OYIA 4DTPA 1BIZA 2ASMA 4FK0A 2GEMA 3CCQN 3JS6A 4NLBA 1M1KO 4MDAA 3L2QA 4JHDA 1S5JA 3NE6A 4JK8A 3O8MA 4CF9A 4ELUA 4DV4K 5C0YA 3NGZA 2IS3A 3P39A 4JS5A 4DCHA 1HJOA 4NCGA 5CE3A 1XNQK 4LF6K 2A5XA 1NGBA 4H8KA 3HZ6A 4DSIA 4DTJA 2KTQA 4DR2K 4DUZK 4FM1A 1TV6A 3C6UA 5CZ2A 2E2PA 5M1PA 1ZYQA 4IEEA 4BWMA 1YJWN 3K9JA 3UKUB 4N41A 1B9DA 3SQ2A 4FJ9A 4Z4HA 3VGKA 2P51A 3NVMA 3O3FA 1Q9YA 3ZETA 4CHPA 4IFVA 4IFEA 3MCPA 5HOOA 4BE2A 1HQEA 3BY5A 4CJ5A 3OYKA 3SUPA 1YTUA 4FSVA 3MN7A 4BQLA 5AR0A 3NMUA 3AV9A 3HSCA 5M1FA 3O3HA 4ZTFA 3M5RA 4JN4A 3THVA 2HHSA 5BR9A 1BO5O 4Z4CA 5HRNA 1BWFO 3EEQA 1NJZA 4FZZA 1GLLO 2G8HA 1VSFA 3T1AA 1OH6A 3DRSA 1NGDA 5HRPA 1CZ9A 2HOEA 5GADP 3H45C 2YJFA 4LF8K 2NRHA 4GNIA 5BR8K 1EO1A 1D4XA 3AVGA 4OKJA 4LFBK 4LFAK 1I94K 4YORA 1R59O 3HI0A 2G8FA 3NFAA 3MCAB 3ZX3A 2NRZA 4WCEL 2HHUA 3FR0A 4KPYA 1WAJA 1X9SA 3O4QA 1VQON 4DTMA 3SYZA 4KH6A 1VSIA 1GLJO 4DTXA 3CFOA 4KFBA 2BUPA 3QEVA 4B1ZA 3G4SN 1LW0A 5AQQA 3VQPA 4FLZA 2ZQBA 4KV8A 4CBWA 3LM9A 3PUFA 1J5EK 3HXMA 5KI6A 3SV3A 3QB0A 3QNOA 4H5WA 4HUEA 2E2NA 1G15A 3SPYA 4WFNL 4OPJA 4FWKA 2VCPA 2KW4A 3H3NO 3HPGA 2ITMA 4JI1K 4DLEA 1RT4A 2WBNA 4FJGA 1JCEA 3OTOK 4FWNA 4DV7K 4I6MA 5JS2A 4ELVA 4CEFA 2HNDA 2VG5A 4BGBA 3UIQA 1C0FA 3M1FA 3QBXA 2QWOA 1KSPA 3KLFA 2XO7A 4NCBA 3SK3A 1NJIO 4Z4IA 4BRAA 4DU4A 1VHXA 3I8DA 2IVNA 4CJUA 5FPDA 4PQUA 3ZT2A 3VEWA 4JKBA 3OJUA 1JL2A 4DR4K 1TYQA 2B5JA 2P9PA 2O8EA 3V1QA 2P9NB 3VQ5A 3MEEA 4FLWA 3CJ7A 4FLUA 4GKKK 4DSEA 5CY4A 2O8BA 2KFNA 1HNVA 3FZFA 4CJWA 1SV5A 2Q0RA 2FBTA 1QSSA 4KAZA 1RNHA 1U2VA 3QICA 3JAMO 3G6EN 3L4IA 1WSEA 2QWNA 1F21A 4K43A 4B1VA 5AZIA 3OYBA 1U4BA 5ADXA 5J1EA 1VQ8N 2P9LB 4ID5A 1KVBA 4B1UB 4F9OA 3QIPA 4YY3K 2PAVA 4I2PA 4DB3A 2QI2A 2HMIA 1OH7A 4O55A 3O9UA 2IGIA 1RBTA 1HYVA 5J2QA 5EX5A 3S3MA 4WQ4A 2D0BA 3K5NA 2E1ZA 3CC7N 4H5VA 1JLEA 3OS0A 1WN7A 3BDPA 2LSNA 1VSKA 1NK6A 3VERA 5AQPA 3LDQA 4KRFA 2XRIA 4KTQA 3EE9A 3UB5A 1U49A 3THYA 3E1YA 1I39A 4HUFA 3P5JA 4RW9A 1W9HA 5C12A 4ISFA 2QWMA 4FCYA 4DF4A 3EL2A 4KB1A 5AZJA 3OYDA 5F1XA 3D2FB 2GX9A 5LL6Z 5AQWA 4J8FA 4FJIA 4BRMA 2ETJA 3DXMB 3C0BA 2UXBK 4FJ7A 2OTJN 1NGEA 2QTDA 4QOZB 3C95A 3VF4A 2D0PA 2NNWA 3PO5A 3KIOA 1RTHA 3KLGA 4BC3A 3THXB 2W42A 4AHRA 2P9IB 3NF6A 4YDUA 2G8VA 1P8ZA 1LOTB 4CZEA 3O80A 5C25A 1RDBA 4CIEA 4CJKA 2P5OA 3P1GA 5FPNA 2OPPA 3OYFA 3LL3A 4FWMA 2F9TA 1SS6A 4W5NA 3KLEA 3MK6A 1HYSA 3O1WA 4JKGA 3WXMB 4MLHA 4RW7A 3LPUA 1DT9A 3OYGA 3CCVN 3SAGA 2BH1A 3C94A 1OVQA 3T69A 4O8UA 4KTZA 3F73A 4EIAA 5TKYA 3RRHA 3DLKA 3KK7A 1S1WA 4CGGA 4DLGA 3CMAN 1RDCA 1TAUA 4R79A 2VQEK 4HWIA 3ENHA 2G8WA 1DEJA 4DSKA 2G8KA 2O8DB 3CPWM 4EHUA 3J7YP 1SL1A 3W3DA 2NRTA 1CZBA 1DTTA 3CJAA 4FO0A 5FLXO 3F2KA 4LF7K 5EU7A 3TSQA 4DU3A 1ATSA 4CHNA 3B6OA 3WNEA 3M8RA 4BR4A 3WXIA 3L2VA 1UA0A 2ZJRL 2OTLN 4E89A 3K0SA 4BRKA 1ZBIA 5C2DA 3B8AX 1T8EA 5C42A 1XMQK 4CBXA 4CGFA 3V9XA 4KI4A 4F4KA 4W5OA 3IS9A 3EKUA 1CLQA 3LAKA 4BDPA 2IVOA 4EP5A 5KPTA 4NO7A 4JRQA 3QESA 1K8AO 1KD1O 1D9FA 3JYTA 1J54A 2UYTA 3NF9A 3M6GA 3WQUA 5FRNA 1WSIA 3FFIA 3TTCA 4E7KA 1VQMN 5J2NA 5I9EB 1GLBG 2BANA 3TAMA 4KHSA 4H0OA 5KTQA 2QA4N 1MDUB 3V1RA 2DFEA 2A40A 2ZJQL 4DR6K 4KHYA 1NGIA 4ILJA 4YOUA 4KKOA 4JI7K 1ZBHA 2ZF5O 3EE8A 3NGYA 4O4GA 3PX0A 3AA4A 2OPRA 2ZM6K 3VN5A 2I7NA 3VQ7A 1SKWA 2AJQA 4FJXA 4CCHA 4Y1CA 5AQIA 4GV6A 4Y1DA 4DR7K 3I55N 4ISGA 4DV0K 1YT3A 2Q36A 4E1NA 3T7ZA 3PIOL 4NB4A 2NLXA 3AVFA 2WFBA 1JCFA 3B6PA 4MO4A 4WQ4C 4FLXA 5FPMA 3P4IA 3F5TA 3A0IX 1W7AA 4F3TA 2GBZA 3DLRA 3CG7A 3LP0A 4LD0A 2JGUA 1C1BA 1VRTA 4KHPK 4IKFA 4JHDB 4E1JA 1YF5L 3H46O 2OZSA 1Q81O 4KHNA 2HHQA 2P5GA 3EN9A 4C1NK 3T1HK 4EZ6A 4UY8O 4RWTA 4KREA 5HP1A 1IG9A 4Y0WA 2QWRA 1GLAG 1QSYA 1JLQA 4B8AB 3OBYA 2WC9A 3CI5A 2HHWA 3I56N 1J53A 2PBDA 3OJSA 5BREA 4CJFA 1EP4A 3VEOA 4CZJA 3OYLA 3DM2A 4ILHA 4BRQA 3MXJA 3K5MA 1TK5A 4M7XA 2E88A 2HNYA 2OANA 3H1VX 2GV9A 4FJLA 4GKJK 5GAHP 3U6FA 3RR7A 3SQ4A 3K59A 3JSMA 3NF8A 3G71N 1HPZA 3ENOA 4YDUC 4AHTA 3TI0A 3AVIA 4IO8A 3A5OC 4H0VB 1BCMA 3KD5E 3ZSYA 3KWGA 2HHTA 3TAPA 4B9MA 1U45A 3HYFA 4DR3K 1RFQA 2HF3A 4CJPA 3LP1A 3SJJA 3R8EA 4F3OA 3KLHA 3VQQA 2Y1IA 1FKPA 2VWBA 4O8KA 3CF5L 4DF8A 2Z1HA 3PO4A 5KQ8A 4FJHA 3V6DA 1S1XA 4A2AA 1MWMA 3DLLL 3CM5A 3NCIA 3D0PA 1S3XA 3MXMA 2JWKA 1ATNA 1SUQA 1YVUA 4NYFA 1V4SA 4KHQA 4M3UA 4PWDA 4Z94A 3KK3A 2VYPA 3G0ZA 4IOXA 2UUAK 3Q7BA 4CK2A 4H0PA 1RBVA 3R1XA 1UA1A 2FSKA 2Q0UA 1NMNA 3AVCA 3ZLJA 4CEAA 5M1KA 4PKGA 1Q86O 5FROA 4A62A 3U3GA 1B9FA 1HYZA 4BC2A 1KVCA 3J7AP 2HHHK 1WB9A 2HHXA 1WBBA 1VQ7N 3QERA 4PY5A 2GUIA 2UXCK 4CGDA 3C7NA 4IXCA 4Q5VA 3TSUA 1ZBLA 3BEXA 3ZYYX 1RDUA 3KZBA 4JRPA 4DQRA 4BE1A 4A2BA 2YX6A 3VEZA 2HBKA 1IKVA 3SMSA 1QSLA 3KK1A 1RDAA 3OA9A 4I6MB 3J7ZO 1HKBA 3WNFA 4U7BA 4AHUA 3U3YA 2IIRA 3HT3A 3L8BA 1FJGK 3OVNA 3VQBA 3EKSA 1BISA 5AQSA 2KZZA 4B9NA 3QEWA 3PSIA 4JYAK 4JD2B 1BU6O 1TKXA 2D0OA 1EETA 1K9MO 2RF2A 3S9HA 4OVLA 1HLUA 3NHGA 4CVNE 3DXKA 1JXEA 4H5NA 3CCJN 3RRGA 3O5BA 4WQ5C 2Q97A 3IG1A 1TYQB 4AILC 1NK0A 1NGJA 1X1PA 1TKTA 2P9PB 2O8EB 2ZWHA 4DWIA 2O8BB 4LF9K 3O4NA 4BG9A 3O08A 3FE1A 3GG4A 1QQNA 1YI2N 5JS1A 3FZKA 3DMJA 1D9DA 1U2VB 1TK8A 1HNIA 2UXDK 4XIUA 3HPHA 1V4TA 3K2PA 4DU1A 5AZIB 1ZBSA 1DLOA 1MU2A 2A42A 4B1YB 2HSTA 2E2OA 5KQDA 4CJRA 4B9UA 4O5FA
chains in the Genus database with same CATH topology
1HYVA 4OKKA 3AVKA 1A5XA 4DS4A 5J2QA 4YNQA 3S3MA 4DG1A 3K5NA 2D0BA 1JKHA 4DTSA 4M3ZA 1IO2A 4ICLA 5E41A 3OYNA 2DTUA 1IKWA 4CE9A 1JLEA 4CERA 5SWMA 1WN7A 4CEZA 3OS0A 3BDPA 1KFSA 2LSNA 5CZ1A 3AO5A 1VSKA 1W0HA 2E6LA 3VQAA 1NK6A 4B9SA 3K57A 4KRFA 4E7JA 2F8TA 2X6NA 2XRIA 4KTQA 3D45A 3DLEA 1HQUA 4OPKA 4CHYA 1U49A 4GVMA 3VA3A 4HCCA 1I39A 3LPTA 4HUFA 3P5JA 4RW9A 2KQ2A 1W9HA 2IOCA 1HJRA 2BDPA 4C8NA 4J2EA 3NH2A 1WSFA 4CK3A 1FK9A 4FCYA 4CJ4A 4DF4A 1L3VA 4EP4A 4KB1A 4HUGA 3OYDA 3SQ1A 4DSJA 1TL3A 4FK4A 2PY5A 1D8YA 1NJXA 3M8QA 3MAQA 4MQ3A 3KTQA 4FJIA 1ASUA 1BGXT 2E6MA 4FLVA 2ETJA 4CJ3A 4FJ7A 4L8RB 2D0CA 4RG8A 3ZSZA 4GW6A 3VQ6A 4CEDA 4O0JA 4DTRA 4QOZB 3C95A 1NOYA 3LZJA 3LZIA 4E3SA 2F8SA 2FBYA 4CHQA 4JLHA 3PO5A 1ZBFA 1JLBA 1GOAA 3QEIA 3KIOA 1RTHA 1WAFA 3V9ZA 2Y1JA 3KLGA 2XY6A 4FYDA 1QE1A 3E01A 4HCBA 3QETA 3AVLA 4CJQA 1BQMA 4HVJA 2W42A 1RCHA 3RMCA 1A5VA 4AHRA 2YKNA 3NF6A 5KGXA 4N76A 1WSJA 2VG6A 2G8VA 3DLGA 2PYLA 1C0TA 3HO1A 1LV5A 3HP9A 1S9EA 2X74A 1RTIA 3QO9A 1BIUA 2XY5A 4K8ZA 5I42A 2XHBA 5C25A 1RDBA 4CIEA 4CJKA 1XWLA 4LSNA 4RW4A 2Z1IA 3P1GA 1REVA 4AHVA 3QEPA 2P5OA 1RT2A 2OPPA 3OYFA 3LWLA 1KTQA 4AH9A 1VRUA 3VQ8A 3OS1A 3L2WA 5T7BA 4OJRA 1J5OA 2JLEA 1KLNA 3SCXA 1C0MA 4FJKA 1UOCA 3EZ5A 4E7IA 1Z26A 4W5NA 3KLEA 4FZYA 4DQPA 4I2QA 2O4GA 1HYSA 4AHSA 1SKRA 4OLBA 1IKYA 1Z25A 1QHTA 4OKEA 1VSJA 3QIOA 2IC3A 3LPUA 4FW1A 4RW7A 4BDZA 3V9UA 3OYGA 4DQQA 3TAEA 1VSHA 1TVRA 5FRMA 3C94A 1VSDA 2EHGA 4IFYA 3QNNA 3OYAA 3K5OA 4HHTA 3AVMA 2Z1GA 3T19A 3TARA 2OPQA 4KTZA 3F73A 3NAEA 1B92A 3AO4A 4H4OA 3T3FA 3G10A 3RRHA 3DLKA 3DI6A 1S1WA 1C6VA 1BQNA 4CGGA 3OYMA 4DLGA 1NK7A 1ITGA 1RDCA 2F96A 4FW2A 3TAQA 1VSLA 1FKOA 3LP2A 1RTDA 1QTMA 1TAUA 1RTJA 1GOCA 2G8WA 1KFDA 3MXIA 3AVHA 4DSKA 1A5WA 3V9SA 3SPZA 1NK4A 2G8KA 4CHZA 3AVJA 4B9TA 4KHWA 2HVIA 3P83D 3OY9A 4N5SA 2VG7A 3VQ4A 4KO0A 4M3WA 1SL1A 2XY8A 1CZBA 4OGEA 1DTTA 4CK1A 1J9AA 2XY7A 4M3TA 2NUBA 1Y97A 3NBPA 5EU7A 3OYCA 4NCAA 4BWJA 3RTVA 4DU3A 4KI6A 5SZTA 2YNGA 2HB5A 1X9MA 2P1JA 4J2BA 3KKSA 4FZXC 4NYNA 3B6OA 4CHNA 3WNEA 4FJJA 4CGHA 2ZD1A 3WNGA 3AVNA 3M8RA 3IRXA 1SL0A 1NJYA 3L2VA 3CQ8A 3HJFA 3AA5X 3QINA 1KCFA 1UA0A 4PUOA 1CXQA 1TGOA 2Z1JA 1RBUA 2DY4A 1UAXA 4E89A 4ZTJA 2Q3SA 1ZBIA 3ISNC 4B3OA 2HW3A 3SZ2A 1T8EA 3MEGA 3AO3A 5CYMA 5C42A 3HVTA 3I0SA 3HK2A 4CGFA 3V9XA 4KI4A 3RWUA 4FLTA 4F4KA 4W5OA 3IS9A 3DOLA 4W5TA 1TKZA 1HMVA 1CLQA 2RKIA 3LAKA 3RMDA 3PX6A 4QCLA 4E7HA 1S1VA 1JL1A 2I5JA 3ALYA 4BDPA 4FJ5A 4EP5A 1S9GA 1C0UA 2QK9A 4E0DA 3SV4A 3NGIA 1NOZA 4JRQA 3QESA 1KRPA 2ATQA 4CF1A 1D9FA 4F2RA 3LWMA 3JYTA 4CGJA 1VSMA 1J54A 3NF9A 1L3TA 4FK2A 1L3SA 5FRNA 1WSIA 3SQ0A 4RW6A 1N5YA 3FFIA 2IAJA 3OYEA 4E7KA 1NK8A 5J2NA 3L3VA 4E19A 1LWEA 1C1AA 2BANA 4M45A 4QAGA 1VK0A 3TAMA 4DFJA 4KHSA 3SUNA 4ID1A 4CIFA 4CFAA 4FM2A 1RT1A 5K14A 5KTQA 1LWCA 4IDKA 2VWKA 4W5RA 1SKSA 3V1RA 3NF7A 3LP3A 4B8CA 2DFEA 3EYZA 1VSEA 4O44A 4C8OA 4KB0A 4R5PA 4KHYA 3QLHA 1T05A 1U48A 1LAVA 5HRSA 2A1SA 4KKOA 3WNHA 4ZHRA 4ELTA 2HNZA 4LH5A 4J2AA 3SUQA 1ZBHA 4B9VA 4EZ9A 3BGRA 1ZBUA 4O4GA 3NGYA 3PX0A 4O0IA 1KVAA 3AA4A 2OPRA 5DMRA 3ZSOA 4CIGA 3VN5A 1TAQA 3L2UA 3VQ7A 3LDSA 1SKWA 1RILA 3M8SA 2AJQA 1L5UA 3L3UA 4CCHA 4FJXA 4Y1CA 3ZT4A 2QKKA 4LY7A 3ZT0A 5KRSA 3MECA 1TK0A 4B9MA 3C6TA 4Y1DA 1YTAA 4N47A 3DOKA 3ZSVA 5I3UA 1UWBA 1YT3A 4E1NA 4CEEA 1ASWA 1D5AA 2D5RA 4CFCA 3QEXA 1NKBA 4DSLA 3HVRA 3HL8A 2OYQA 3HSTB 1RDDA 3AVFA 3MEDA 1WNSA 3KK2A 2PYJA 4CJEA 4CEBA 1NJWA 1S6PA 5HRRA 3B6PA 1BL3A 3ZSQA 3PX4A 3OYIA 4M42A 1XHZA 4FLXA 1BIZA 4CFBA 4DTPA 4FK0A 3ASMA 2KZMA 4F3TA 2GBZA 3DLRA 3L2QA 2X78A 3CG7A 4OGCA 4CF2A 1S5JA 2DFFA 3LP0A 4G1QA 5FDLA 4LD0A 3OS2A 3NE6A 3SUOA 4CF9A 3DLHA 3IAYA 1RBRA 2JGUA 1C1BA 1VRTA 1KLMA 4CHOA 1JLFA 1LWFA 3DRRA 4ELUA 4IKFA 3DRPA 2IS3A 3NGZA 3HPOA 2OZSA 3KD1E 4KHNA 4JS5A 2FBXA 1I3AA 2HHQA 2P5GA 4CJTA 4EZ6A 4NCGA 4I9QA 4KREA 5HP1A 4BE0A 1IG9A 4Q0BA 3OYHA 1TL1A 3EY1A 3TANA 4H8KA 2A1RA 1QSYA 1JLQA 3LAMA 4PA1A 2D0AA 3CYMA 4B8AB 4DTJA 2YV0X 4DSIA 2DFHA 4TSXA 2KTQA 2KFZA 4FM1A 1BCOA 4E1MA 2HHWA 3AO2A 1TV6A 3VQ9A 1J53A 1WSHA 3OJSA 1EXQA 3C6UA 5CZ2A 4CJFA 3O3GA 4M3XA 1EP4A 1ZYQA 3OYJA 4BWMA 3DYAA 3OYLA 3ZT1A 4Z4FA 2ITGA 2VWJA 3DM2A 3MXJA 4N41A 3K5MA 1TK5A 1B9DA 2HNYA 1RT3A 2GV9A 4FJLA 3SQ2A 4FJ9A 2FC0A 4Z4HA 3U6FA 3RR7A 5KRTA 5HLFA 2P51A 3TR8A 3SQ4A 3I0RA 3K59A 4LSLA 3JSMA 3O3FA 3NF8A 3AO1A 1Q9YA 2EX3A 1HPZA 4O5BA 4H4MA 4AHTA 4CHPA 4IFVA 3VQDA 1EKEA 2QXFA 4BE2A 1HQEA 3TI0A 1QQCA 3AVIA 4CJ5A 4DQIA 4CEQA 1S6QA 4FVMA 1NK5A 3TWHA 1BCMA 3KD5E 3OYKA 3ZSYA 2HHTA 2B6AA 3SUPA 1YTUA 5HROA 1U47A 1FXXA 3AV9A 3TAPA 3V1OA 3KKRA 3O3HA 1U45A 2G8UA 3HYFA 3SNNA 2BE2A 1T7PA 4FJ8A 4ZTFA 3ZT3A 3K58A 4CJPA 3LP1A 4JS4A 5CYQA 3THVA 3SJJA 2HHSA 4F3OA 4Z4CA 3KLHA 4B9LA 4DMNA 4K8XA 5HRNA 1O1WA 3VQQA 3K5LA 2X6SA 2G8IA 1NJZA 2O4IA 4FZZA 4AHCA 3V4IA 2Y1IA 3KLIA 4FJMA 2G8HA 1FKPA 1VSFA 3T1AA 4BACA 4DF8A 3DRSA 5HRPA 3RR8A 1CZ9A 2Z1HA 3PO4A 4C8KA 4B08A 4FLYA 1BI4B 2YNHA 3PV8A 1JXBA 1R0AA 2ZE2A 4WE1A 3PY8A 1DTQA 4FJHA 3V6DA 1S1XA 1Q9XA 4F8RA 2HHVA 3AVGA 4N56A 4OKJA 2RPIA 1NK9A 2B4JA 4C8MA 4CESA 3CFRA 4KHUA 3CM5A 4DFPA 1IH7A 3V81A 2G8FA 3NFAA 3NCIA 3D0PA 2YNFA 3MXMA 3AA2A 3AVBA 3SI6A 1SUQA 2HHUA 1YVUA 4CF8A 4NYFA 4M41A 4BDYA 5J2MA 3RMBA 3L2RA 4KPYA 4KHQA 1WAJA 4M3UA 1X9SA 3O4QA 4PWDA 2YKMA 3KK3A 1WSGA 3G0ZA 1QS4A 3ZSWA 4Z0UA 3TABA 4IG3A 4KTWA 1RT7A 2QKBA 1S1TA 4DTMA 3SYZA 4CK2A 1VSIA 1NKEA 4FJNA 4DTXA 3ULDA 3VQCA 1RBVA 3CFOA 1UA1A 1NKCA 4KFBA 1S1UA 3QEVA 3AVCA 3A2FA 1T03A 1LW0A 2E4LA 4CEAA 1CXUA 4DTOA 3VQPA 4Z4EA 4FLZA 2ZQBA 4KV8A 4I9LA 5FROA 3U3GA 1B9FA 1HYZA 2OZMA 3ITHA 3PUFA 3TAGA 3AVAA 1KVCA 3HXMA 5KI6A 4M3YA 1LAWA 2HHXA 3SV3A 1X9WA 3ZSRA 3QNOA 1XC9A 2FBVA 2RN2A 3CFPA 4HUEA 3QERA 1G15A 4DTUA 3SPYA 4PY5A 4OPJA 4CGIA 2GUIA 3HPGA 2KW4A 4IBNA 4CGDA 3RMAA 4Q5VA 3AA3A 1IKXA 2YNIA 4CEOA 1ZBLA 4DLEA 1RT4A 4GMJB 3NH0A 5KGWA 4FJGA 4CJSA 2OPSA 4C8LA 4JRPA 4DQRA 4BE1A 3ZSXA 5JS2A 4ELVA 1JLGA 4CEFA 1Q8IA 1L3UA 4J2DA 2HNDA 2VG5A 1IKVA 1QSLA 3KK1A 4YFUA 3NDKA 2HVHA 1RDAA 2OA8A 3UIQA 1TKDA 2WOMA 3WNFA 1KSPA 4AHUA 3U3YA 4DTNA 1C1CA 3KLFA 2XO7A 1XHXA 3H08A 3HT3A 3L8BA 3HP6A 3OVNA 4NCBA 3VQBA 3LALA 4DQSA 1RT5A 3VQEA 1LW2A 3HM9A 1GOBA 4Z4IA 1BISA 2KZZA 4B9NA 4DU4A 2R7YA 3QEWA 3I8DA 4CJUA 4PQUA 3F9KA 5C24A 4CFDA 4RW8A 1WLJA 2BGGA 1TKXA 5J2PA 3ZT2A 3NH1A 5DK5A 4DSFA 1EETA 3OJUA 2RF2A 1JL2A 3S9HA 4MFBA 4OVLA 1ASVA 3NHGA 3S3OA 5D3GA 1U04A 3V9WA 3S3NA 1JXEA 2B5JA 3DLBA 3RRGA 4F2SA 4HTUA 3V1QA 3VQ5A 4DFKA 3MEEA 4FLWA 4FLUA 3VA0A 4CF0A 5CY4A 4I7FA 4DSEA 2KFNA 1HNVA 4CJWA 3IG1A 1SV5A 4AILC 2FBTA 1NK0A 2PZSA 4CJLA 1X1PA 1RBSA 1TKTA 3CM6A 1QSSA 1JLCA 1SL2A 4DWIA 4KAZA 4W5QA 1RNHA 3O4NA 1K6YA 4UQGA 3M8PA 1RT6A 4Z4GA 4DS5A 2YHAA 1JLAA 4CECA 3KJVA 5JS1A 1WSEA 3DMJA 1HRHA 1EX4A 1F21A 1D9DA 1TK8A 3TAFA 4CJVA 4IG0A 1HNIA 5J1EA 3OYBA 1U4BA 1N6QA 4OLAA 1XI1A 5HBMA 2YHBA 3ZCMA 4XIUA 4ID5A 1KVBA 3LANA 3HPHA 4FXDA 4DU1A 3K2PA 2IDOA 3QIPA 1DLOA 1MU2A 1BI4A 1BHLA 4I2PA 2HMIA 4CJRA 4O55A 2WONA 4DFMA 2IGIA 1RBTA 4LH4A 4B9UA 4FM0A 4E7LA 4M3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYV A;  4OKK A;  3AVK A;  1A5X A;  4DS4 A;  5J2Q A;  4YNQ A;  3S3M A;  4DG1 A;  3K5N A;  2D0B A;  1JKH A;  4DTS A;  4M3Z A;  1IO2 A;  4ICL A;  5E41 A;  3OYN A;  2DTU A;  1IKW A;  4CE9 A;  1JLE A;  4CER A;  5SWM A;  1WN7 A;  4CEZ A;  3OS0 A;  3BDP A;  1KFS A;  2LSN A;  5CZ1 A;  3AO5 A;  1VSK A;  1W0H A;  2E6L A;  3VQA A;  1NK6 A;  4B9S A;  3K57 A;  4KRF A;  4E7J A;  2F8T A;  2X6N A;  2XRI A;  4KTQ A;  3D45 A;  3DLE A;  1HQU A;  4OPK A;  4CHY A;  1U49 A;  4GVM A;  3VA3 A;  4HCC A;  1I39 A;  3LPT A;  4HUF A;  3P5J A;  4RW9 A;  2KQ2 A;  1W9H A;  2IOC A;  1HJR A;  2BDP A;  4C8N A;  4J2E A;  3NH2 A;  1WSF A;  4CK3 A;  1FK9 A;  4FCY A;  4CJ4 A;  4DF4 A;  1L3V A;  4EP4 A;  4KB1 A;  4HUG A;  3OYD A;  3SQ1 A;  4DSJ A;  1TL3 A;  4FK4 A;  2PY5 A;  1D8Y A;  1NJX A;  3M8Q A;  3MAQ A;  4MQ3 A;  3KTQ A;  4FJI A;  1ASU A;  1BGX T;  2E6M A;  4FLV A;  2ETJ A;  4CJ3 A;  4FJ7 A;  4L8R B;  2D0C A;  4RG8 A;  3ZSZ A;  4GW6 A;  3VQ6 A;  4CED A;  4O0J A;  4DTR A;  4QOZ B;  3C95 A;  1NOY A;  3LZJ A;  3LZI A;  4E3S A;  2F8S A;  2FBY A;  4CHQ A;  4JLH A;  3PO5 A;  1ZBF A;  1JLB A;  1GOA A;  3QEI A;  3KIO A;  1RTH A;  1WAF A;  3V9Z A;  2Y1J A;  3KLG A;  2XY6 A;  4FYD A;  1QE1 A;  3E01 A;  4HCB A;  3QET A;  3AVL A;  4CJQ A;  1BQM A;  4HVJ A;  2W42 A;  1RCH A;  3RMC A;  1A5V A;  4AHR A;  2YKN A;  3NF6 A;  5KGX A;  4N76 A;  1WSJ A;  2VG6 A;  2G8V A;  3DLG A;  2PYL A;  1C0T A;  3HO1 A;  1LV5 A;  3HP9 A;  1S9E A;  2X74 A;  1RTI A;  3QO9 A;  1BIU A;  2XY5 A;  4K8Z A;  5I42 A;  2XHB A;  5C25 A;  1RDB A;  4CIE A;  4CJK A;  1XWL A;  4LSN A;  4RW4 A;  2Z1I A;  3P1G A;  1REV A;  4AHV A;  3QEP A;  2P5O A;  1RT2 A;  2OPP A;  3OYF A;  3LWL A;  1KTQ A;  4AH9 A;  1VRU A;  3VQ8 A;  3OS1 A;  3L2W A;  5T7B A;  4OJR A;  1J5O A;  2JLE A;  1KLN A;  3SCX A;  1C0M A;  4FJK A;  1UOC A;  3EZ5 A;  4E7I A;  1Z26 A;  4W5N A;  3KLE A;  4FZY A;  4DQP A;  4I2Q A;  2O4G A;  1HYS A;  4AHS A;  1SKR A;  4OLB A;  1IKY A;  1Z25 A;  1QHT A;  4OKE A;  1VSJ A;  3QIO A;  2IC3 A;  3LPU A;  4FW1 A;  4RW7 A;  4BDZ A;  3V9U A;  3OYG A;  4DQQ A;  3TAE A;  1VSH A;  1TVR A;  5FRM A;  3C94 A;  1VSD A;  2EHG A;  4IFY A;  3QNN A;  3OYA A;  3K5O A;  4HHT A;  3AVM A;  2Z1G A;  3T19 A;  3TAR A;  2OPQ A;  4KTZ A;  3F73 A;  3NAE A;  1B92 A;  3AO4 A;  4H4O A;  3T3F A;  3G10 A;  3RRH A;  3DLK A;  3DI6 A;  1S1W A;  1C6V A;  1BQN A;  4CGG A;  3OYM A;  4DLG A;  1NK7 A;  1ITG A;  1RDC A;  2F96 A;  4FW2 A;  3TAQ A;  1VSL A;  1FKO A;  3LP2 A;  1RTD A;  1QTM A;  1TAU A;  1RTJ A;  1GOC A;  2G8W A;  1KFD A;  3MXI A;  3AVH A;  4DSK A;  1A5W A;  3V9S A;  3SPZ A;  1NK4 A;  2G8K A;  4CHZ A;  3AVJ A;  4B9T A;  4KHW A;  2HVI A;  3P83 D;  3OY9 A;  4N5S A;  2VG7 A;  3VQ4 A;  4KO0 A;  4M3W A;  1SL1 A;  2XY8 A;  1CZB A;  4OGE A;  1DTT A;  4CK1 A;  1J9A A;  2XY7 A;  4M3T A;  2NUB A;  1Y97 A;  3NBP A;  5EU7 A;  3OYC A;  4NCA A;  4BWJ A;  3RTV A;  4DU3 A;  4KI6 A;  5SZT A;  2YNG A;  2HB5 A;  1X9M A;  2P1J A;  4J2B A;  3KKS A;  4FZX C;  4NYN A;  3B6O A;  4CHN A;  3WNE A;  4FJJ A;  4CGH A;  2ZD1 A;  3WNG A;  3AVN A;  3M8R A;  3IRX A;  1SL0 A;  1NJY A;  3L2V A;  3CQ8 A;  3HJF A;  3AA5 X;  3QIN A;  1KCF A;  1UA0 A;  4PUO A;  1CXQ A;  1TGO A;  2Z1J A;  1RBU A;  2DY4 A;  1UAX A;  4E89 A;  4ZTJ A;  2Q3S A;  1ZBI A;  3ISN C;  4B3O A;  2HW3 A;  3SZ2 A;  1T8E A;  3MEG A;  3AO3 A;  5CYM A;  5C42 A;  3HVT A;  3I0S A;  3HK2 A;  4CGF A;  3V9X A;  4KI4 A;  3RWU A;  4FLT A;  4F4K A;  4W5O A;  3IS9 A;  3DOL A;  4W5T A;  1TKZ A;  1HMV A;  1CLQ A;  2RKI A;  3LAK A;  3RMD A;  3PX6 A;  4QCL A;  4E7H A;  1S1V A;  1JL1 A;  2I5J A;  3ALY A;  4BDP A;  4FJ5 A;  4EP5 A;  1S9G A;  1C0U A;  2QK9 A;  4E0D A;  3SV4 A;  3NGI A;  1NOZ A;  4JRQ A;  3QES A;  1KRP A;  2ATQ A;  4CF1 A;  1D9F A;  4F2R A;  3LWM A;  3JYT A;  4CGJ A;  1VSM A;  1J54 A;  3NF9 A;  1L3T A;  4FK2 A;  1L3S A;  5FRN A;  1WSI A;  3SQ0 A;  4RW6 A;  1N5Y A;  3FFI A;  2IAJ A;  3OYE A;  4E7K A;  1NK8 A;  5J2N A;  3L3V A;  4E19 A;  1LWE A;  1C1A A;  2BAN A;  4M45 A;  4QAG A;  1VK0 A;  3TAM A;  4DFJ A;  4KHS A;  3SUN A;  4ID1 A;  4CIF A;  4CFA A;  4FM2 A;  1RT1 A;  5K14 A;  5KTQ A;  1LWC A;  4IDK A;  2VWK A;  4W5R A;  1SKS A;  3V1R A;  3NF7 A;  3LP3 A;  4B8C A;  2DFE A;  3EYZ A;  1VSE A;  4O44 A;  4C8O A;  4KB0 A;  4R5P A;  4KHY A;  3QLH A;  1T05 A;  1U48 A;  1LAV A;  5HRS A;  2A1S A;  4KKO A;  3WNH A;  4ZHR A;  4ELT A;  2HNZ A;  4LH5 A;  4J2A A;  3SUQ A;  1ZBH A;  4B9V A;  4EZ9 A;  3BGR A;  1ZBU A;  4O4G A;  3NGY A;  3PX0 A;  4O0I A;  1KVA A;  3AA4 A;  2OPR A;  5DMR A;  3ZSO A;  4CIG A;  3VN5 A;  1TAQ A;  3L2U A;  3VQ7 A;  3LDS A;  1SKW A;  1RIL A;  3M8S A;  2AJQ A;  1L5U A;  3L3U A;  4CCH A;  4FJX A;  4Y1C A;  3ZT4 A;  2QKK A;  4LY7 A;  3ZT0 A;  5KRS A;  3MEC A;  1TK0 A;  4B9M A;  3C6T A;  4Y1D A;  1YTA A;  4N47 A;  3DOK A;  3ZSV A;  5I3U A;  1UWB A;  1YT3 A;  4E1N A;  4CEE A;  1ASW A;  1D5A A;  2D5R A;  4CFC A;  3QEX A;  1NKB A;  4DSL A;  3HVR A;  3HL8 A;  2OYQ A;  3HST B;  1RDD A;  3AVF A;  3MED A;  1WNS A;  3KK2 A;  2PYJ A;  4CJE A;  4CEB A;  1NJW A;  1S6P A;  5HRR A;  3B6P A;  1BL3 A;  3ZSQ A;  3PX4 A;  3OYI A;  4M42 A;  1XHZ A;  4FLX A;  1BIZ A;  4CFB A;  4DTP A;  4FK0 A;  3ASM A;  2KZM A;  4F3T A;  2GBZ A;  3DLR A;  3L2Q A;  2X78 A;  3CG7 A;  4OGC A;  4CF2 A;  1S5J A;  2DFF A;  3LP0 A;  4G1Q A;  5FDL A;  4LD0 A;  3OS2 A;  3NE6 A;  3SUO A;  4CF9 A;  3DLH A;  3IAY A;  1RBR A;  2JGU A;  1C1B A;  1VRT A;  1KLM A;  4CHO A;  1JLF A;  1LWF A;  3DRR A;  4ELU A;  4IKF A;  3DRP A;  2IS3 A;  3NGZ A;  3HPO A;  2OZS A;  3KD1 E;  4KHN A;  4JS5 A;  2FBX A;  1I3A A;  2HHQ A;  2P5G A;  4CJT A;  4EZ6 A;  4NCG A;  4I9Q A;  4KRE A;  5HP1 A;  4BE0 A;  1IG9 A;  4Q0B A;  3OYH A;  1TL1 A;  3EY1 A;  3TAN A;  4H8K A;  2A1R A;  1QSY A;  1JLQ A;  3LAM A;  4PA1 A;  2D0A A;  3CYM A;  4B8A B;  4DTJ A;  2YV0 X;  4DSI A;  2DFH A;  4TSX A;  2KTQ A;  2KFZ A;  4FM1 A;  1BCO A;  4E1M A;  2HHW A;  3AO2 A;  1TV6 A;  3VQ9 A;  1J53 A;  1WSH A;  3OJS A;  1EXQ A;  3C6U A;  5CZ2 A;  4CJF A;  3O3G A;  4M3X A;  1EP4 A;  1ZYQ A;  3OYJ A;  4BWM A;  3DYA A;  3OYL A;  3ZT1 A;  4Z4F A;  2ITG A;  2VWJ A;  3DM2 A;  3MXJ A;  4N41 A;  3K5M A;  1TK5 A;  1B9D A;  2HNY A;  1RT3 A;  2GV9 A;  4FJL A;  3SQ2 A;  4FJ9 A;  2FC0 A;  4Z4H A;  3U6F A;  3RR7 A;  5KRT A;  5HLF A;  2P51 A;  3TR8 A;  3SQ4 A;  3I0R A;  3K59 A;  4LSL A;  3JSM A;  3O3F A;  3NF8 A;  3AO1 A;  1Q9Y A;  2EX3 A;  1HPZ A;  4O5B A;  4H4M A;  4AHT A;  4CHP A;  4IFV A;  3VQD A;  1EKE A;  2QXF A;  4BE2 A;  1HQE A;  3TI0 A;  1QQC A;  3AVI A;  4CJ5 A;  4DQI A;  4CEQ A;  1S6Q A;  4FVM A;  1NK5 A;  3TWH A;  1BCM A;  3KD5 E;  3OYK A;  3ZSY A;  2HHT A;  2B6A A;  3SUP A;  1YTU A;  5HRO A;  1U47 A;  1FXX A;  3AV9 A;  3TAP A;  3V1O A;  3KKR A;  3O3H A;  1U45 A;  2G8U A;  3HYF A;  3SNN A;  2BE2 A;  1T7P A;  4FJ8 A;  4ZTF A;  3ZT3 A;  3K58 A;  4CJP A;  3LP1 A;  4JS4 A;  5CYQ A;  3THV A;  3SJJ A;  2HHS A;  4F3O A;  4Z4C A;  3KLH A;  4B9L A;  4DMN A;  4K8X A;  5HRN A;  1O1W A;  3VQQ A;  3K5L A;  2X6S A;  2G8I A;  1NJZ A;  2O4I A;  4FZZ A;  4AHC A;  3V4I A;  2Y1I A;  3KLI A;  4FJM A;  2G8H A;  1FKP A;  1VSF A;  3T1A A;  4BAC A;  4DF8 A;  3DRS A;  5HRP A;  3RR8 A;  1CZ9 A;  2Z1H A;  3PO4 A;  4C8K A;  4B08 A;  4FLY A;  1BI4 B;  2YNH A;  3PV8 A;  1JXB A;  1R0A A;  2ZE2 A;  4WE1 A;  3PY8 A;  1DTQ A;  4FJH A;  3V6D A;  1S1X A;  1Q9X A;  4F8R A;  2HHV A;  3AVG A;  4N56 A;  4OKJ A;  2RPI A;  1NK9 A;  2B4J A;  4C8M A;  4CES A;  3CFR A;  4KHU A;  3CM5 A;  4DFP A;  1IH7 A;  3V81 A;  2G8F A;  3NFA A;  3NCI A;  3D0P A;  2YNF A;  3MXM A;  3AA2 A;  3AVB A;  3SI6 A;  1SUQ A;  2HHU A;  1YVU A;  4CF8 A;  4NYF A;  4M41 A;  4BDY A;  5J2M A;  3RMB A;  3L2R A;  4KPY A;  4KHQ A;  1WAJ A;  4M3U A;  1X9S A;  3O4Q A;  4PWD A;  2YKM A;  3KK3 A;  1WSG A;  3G0Z A;  1QS4 A;  3ZSW A;  4Z0U A;  3TAB A;  4IG3 A;  4KTW A;  1RT7 A;  2QKB A;  1S1T A;  4DTM A;  3SYZ A;  4CK2 A;  1VSI A;  1NKE A;  4FJN A;  4DTX A;  3ULD A;  3VQC A;  1RBV A;  3CFO A;  1UA1 A;  1NKC A;  4KFB A;  1S1U A;  3QEV A;  3AVC A;  3A2F A;  1T03 A;  1LW0 A;  2E4L A;  4CEA A;  1CXU A;  4DTO A;  3VQP A;  4Z4E A;  4FLZ A;  2ZQB A;  4KV8 A;  4I9L A;  5FRO A;  3U3G A;  1B9F A;  1HYZ A;  2OZM A;  3ITH A;  3PUF A;  3TAG A;  3AVA A;  1KVC A;  3HXM A;  5KI6 A;  4M3Y A;  1LAW A;  2HHX A;  3SV3 A;  1X9W A;  3ZSR A;  3QNO A;  1XC9 A;  2FBV A;  2RN2 A;  3CFP A;  4HUE A;  3QER A;  1G15 A;  4DTU A;  3SPY A;  4PY5 A;  4OPJ A;  4CGI A;  2GUI A;  3HPG A;  2KW4 A;  4IBN A;  4CGD A;  3RMA A;  4Q5V A;  3AA3 A;  1IKX A;  2YNI A;  4CEO A;  1ZBL A;  4DLE A;  1RT4 A;  4GMJ B;  3NH0 A;  5KGW A;  4FJG A;  4CJS A;  2OPS A;  4C8L A;  4JRP A;  4DQR A;  4BE1 A;  3ZSX A;  5JS2 A;  4ELV A;  1JLG A;  4CEF A;  1Q8I A;  1L3U A;  4J2D A;  2HND A;  2VG5 A;  1IKV A;  1QSL A;  3KK1 A;  4YFU A;  3NDK A;  2HVH A;  1RDA A;  2OA8 A;  3UIQ A;  1TKD A;  2WOM A;  3WNF A;  1KSP A;  4AHU A;  3U3Y A;  4DTN A;  1C1C A;  3KLF A;  2XO7 A;  1XHX A;  3H08 A;  3HT3 A;  3L8B A;  3HP6 A;  3OVN A;  4NCB A;  3VQB A;  3LAL A;  4DQS A;  1RT5 A;  3VQE A;  1LW2 A;  3HM9 A;  1GOB A;  4Z4I A;  1BIS A;  2KZZ A;  4B9N A;  4DU4 A;  2R7Y A;  3QEW A;  3I8D A;  4CJU A;  4PQU A;  3F9K A;  5C24 A;  4CFD A;  4RW8 A;  1WLJ A;  2BGG A;  1TKX A;  5J2P A;  3ZT2 A;  3NH1 A;  5DK5 A;  4DSF A;  1EET A;  3OJU A;  2RF2 A;  1JL2 A;  3S9H A;  4MFB A;  4OVL A;  1ASV A;  3NHG A;  3S3O A;  5D3G A;  1U04 A;  3V9W A;  3S3N A;  1JXE A;  2B5J A;  3DLB A;  3RRG A;  4F2S A;  4HTU A;  3V1Q A;  3VQ5 A;  4DFK A;  3MEE A;  4FLW A;  4FLU A;  3VA0 A;  4CF0 A;  5CY4 A;  4I7F A;  4DSE A;  2KFN A;  1HNV A;  4CJW A;  3IG1 A;  1SV5 A;  4AIL C;  2FBT A;  1NK0 A;  2PZS A;  4CJL A;  1X1P A;  1RBS A;  1TKT A;  3CM6 A;  1QSS A;  1JLC A;  1SL2 A;  4DWI A;  4KAZ A;  4W5Q A;  1RNH A;  3O4N A;  1K6Y A;  4UQG A;  3M8P A;  1RT6 A;  4Z4G A;  4DS5 A;  2YHA A;  1JLA A;  4CEC A;  3KJV A;  5JS1 A;  1WSE A;  3DMJ A;  1HRH A;  1EX4 A;  1F21 A;  1D9D A;  1TK8 A;  3TAF A;  4CJV A;  4IG0 A;  1HNI A;  5J1E A;  3OYB A;  1U4B A;  1N6Q A;  4OLA A;  1XI1 A;  5HBM A;  2YHB A;  3ZCM A;  4XIU A;  4ID5 A;  1KVB A;  3LAN A;  3HPH A;  4FXD A;  4DU1 A;  3K2P A;  2IDO A;  3QIP A;  1DLO A;  1MU2 A;  1BI4 A;  1BHL A;  4I2P A;  2HMI A;  4CJR A;  4O55 A;  2WON A;  4DFM A;  2IGI A;  1RBT A;  4LH4 A;  4B9U A;  4FM0 A;  4E7L A;  4M3R A; 
#chains in the Genus database with same CATH topology
 4OKK A;  4DS4 A;  1A5X A;  1BA0 A;  2G8U A;  4DG1 A;  4M3Z A;  3A5N C;  4ICL A;  3OYN A;  3L6Q A;  2A3Z A;  1IG8 A;  4CE9 A;  4CER A;  5SWM A;  3AAQ A;  3KWI A;  4EFH A;  3MDQ A;  5EY4 A;  3VQA A;  1XMO K;  3K57 A;  2Q31 A;  2F8T A;  3D45 A;  3DLE A;  4A5B A;  4OPK A;  4GVM A;  4OPA A;  3LPT A;  2V52 B;  4DV6 K;  1K73 O;  4YHH K;  2KQ2 A;  1IV0 A;  3NH2 A;  1FK9 A;  1L3V A;  3THY B;  1IBL K;  3SQ1 A;  3KVG A;  1NJX A;  3M8Q A;  3MAQ A;  1IBK K;  3BUZ B;  1ASU A;  1BGX T;  5AZJ B;  5GAG P;  4RG8 A;  3ZSZ A;  3ZEU A;  4CW7 B;  2D4W A;  4FWS A;  4CI6 A;  1ZBF A;  3QEI A;  1WAF A;  2XY6 A;  2F9W A;  3AY9 A;  5HL7 L;  5AQG A;  3H1Q A;  1KAX A;  1RCH A;  4DR5 K;  5KGX A;  1C0T A;  4A59 A;  4LSN A;  4RW4 A;  4DV2 K;  2Z1I A;  5AFU H;  1REV A;  3JXU A;  3LWL A;  2NRV A;  3WUH A;  3CCL N;  4AH9 A;  1NGG A;  2GEL A;  2H3G X;  4NXM K;  2ZGZ A;  3F9M A;  4DUY K;  1KLN A;  3SCX A;  4FJK A;  1IJJ A;  4AM6 A;  4BRC A;  3EZ5 A;  3HM8 A;  4E7I A;  2RE2 A;  1HX1 A;  3D2E B;  4JD2 A;  4FZY A;  5AQY A;  4AHS A;  1C0G A;  2HBL A;  4OLB A;  1Z25 A;  1VSJ A;  3TTD A;  3TAE A;  1Y64 A;  2FSJ A;  1TVR A;  4AM7 A;  3QNN A;  1D8Y A;  3K5O A;  2Z1G A;  4JKG B;  3TAR A;  4H4O A;  1ATR A;  3T3F A;  3DI6 A;  2WTU A;  1BQN A;  2GWK A;  3EZW A;  3TAQ A;  1FKO A;  3LP2 A;  1QTM A;  1RTJ A;  1A5W A;  3SAF A;  1CZA N;  3AVJ A;  4BR7 A;  1YJ9 N;  4KHW A;  2I7P A;  2VG7 A;  3THW A;  4XEI A;  4BG8 A;  4JI5 K;  3IMX A;  4CK1 A;  5JMV A;  1J9A A;  4M3T A;  4JKF A;  1TUU A;  4NCA A;  2QWL A;  3RTV A;  3ENB A;  3WT0 A;  4FWL A;  2P1J A;  3GE1 A;  4J2B A;  2VGM A;  5E26 A;  4NYN A;  4FWQ A;  3TPQ A;  3WNG A;  3AVN A;  1K8K A;  3QIN A;  2Z1J A;  2QEX N;  4BRF A;  3E9L A;  1UAX A;  4ZTJ A;  5AFU A;  3BF1 A;  3CC2 N;  3MEG A;  1LCU A;  2GUP A;  4BC4 A;  3FFK B;  1NNE A;  4A61 A;  1TKZ A;  1HMV A;  5CHI A;  4LC9 B;  4QCL A;  3RMD A;  5GIO A;  5JLH A;  1S1V A;  1JL1 A;  3ALY A;  3SJH A;  2QK9 A;  1KRP A;  4BR0 A;  2ATQ A;  3AAR A;  4F2R A;  4C1N I;  2F4V K;  4RW6 A;  1DGK N;  1NK8 A;  3L3V A;  1C1A A;  3CJB A;  3KHY A;  3CC4 N;  4QAG A;  4OX9 K;  3SUN A;  4CIF A;  2P9K B;  4FM2 A;  3SAH A;  5ELZ A;  2KHO A;  2VWK A;  1SKS A;  5M1O A;  5AQX A;  3LP3 A;  4C8O A;  1VSE A;  2YHX A;  3QLH A;  5LMN K;  4HCB A;  1LAV A;  5HRS A;  3WNH A;  4ZHR A;  3L0Q A;  3SUQ A;  4MDB A;  4B9V A;  4EZ9 A;  3ZSO A;  1HR0 K;  4DV5 K;  3L2U A;  1SQK A;  4DV1 K;  5C15 A;  1L5U A;  3L3U A;  4JI2 K;  1VAZ A;  2QKK A;  4CZL A;  3VF2 A;  3C6T A;  2QW9 A;  3CHW A;  5I3U A;  3DOK A;  1N34 K;  3QEX A;  1NKB A;  2V51 B;  2HBM A;  3HVR A;  2OYQ A;  3HST B;  2VQF K;  2A6A A;  2W40 A;  1YVN A;  4CJE A;  1WUA A;  2CH5 A;  3D2E A;  1NJW A;  3PX4 A;  3ASM A;  1BDG A;  4GV9 A;  1GLF O;  2PFU A;  1X9J A;  4M63 C;  4OGC A;  2DFF A;  4G1Q A;  3OS2 A;  3SUO A;  3DLH A;  3U9Z A;  3IAY A;  4JI3 K;  5JVH L;  1KLM A;  4CHO A;  3CCU N;  2YI1 A;  3DRP A;  3HPO A;  3KD1 E;  1KQS M;  3AGK A;  4CJT A;  1YAG A;  4Q0B A;  1TL1 A;  1Q18 A;  5E84 A;  2D0A A;  3CYM A;  3VGL A;  4TSX A;  3ID8 A;  2KFZ A;  1BCO A;  5AQJ A;  5JLF A;  5GIN A;  1WSH A;  4LF4 K;  4YOY A;  1EXQ A;  3GBT A;  4IDH A;  1W97 L;  3OYJ A;  2NZT A;  5BN8 A;  3O9Q A;  3ZT1 A;  4Z4F A;  2ITG A;  4CJ7 A;  2VWJ A;  1RT3 A;  2FC0 A;  1BOT O;  3H6E A;  5KRT A;  3TR8 A;  5HLF A;  2V7Y A;  3I0R A;  2HF4 A;  4LSL A;  3MX2 A;  4O5B A;  4H4M A;  3A5M C;  1EKE A;  3R9P A;  4JV5 K;  3FGU A;  3SBG A;  4JI4 K;  1QQC A;  5M1Q A;  4CEQ A;  1S6Q A;  4G9Z A;  4JKA A;  2ZGY A;  1BA1 A;  5HRO A;  1FW6 A;  1FXX A;  3V1O A;  1T7P A;  2NRW A;  1HNX K;  4FJ8 A;  3SNN A;  2W6K A;  2D1K A;  3ZT3 A;  4JS4 A;  4B9L A;  1QQM A;  4DMN A;  2G8I A;  3QML A;  3H3O B;  2O4I A;  3KLI A;  3J8A A;  4IEI A;  1ZC6 A;  4PL8 A;  2DPN A;  4BAC A;  3RR8 A;  3QFP A;  4X64 K;  4C8K A;  4B08 A;  4FLY A;  4JI0 K;  4BRE A;  5C2F A;  1BI4 B;  2YNH A;  5AQF A;  1DTQ A;  4F8R A;  2HHV A;  2P9K A;  1NK9 A;  4CES A;  4C8M A;  3CFR A;  4CZG A;  1NM1 A;  1WOQ A;  2P9U A;  2YNF A;  3CQX A;  3AVB A;  3CQY A;  4CF8 A;  1QZ6 A;  3HBT A;  1KAZ A;  5J2M A;  3RMB A;  3L2R A;  2W41 A;  2YKM A;  3N4P A;  3I33 A;  1WSG A;  1QS4 A;  3ZSW A;  3SLC A;  4OO1 J;  3TAB A;  4IG3 A;  1RT7 A;  2FF3 B;  2CGL A;  5LY3 A;  2QM1 A;  1YUW A;  4JEP A;  1NKE A;  1VQ9 N;  2JWL A;  4FJN A;  3ULD A;  3VQC A;  3WEE B;  4B1W B;  1S1U A;  1T03 A;  2HMP A;  2E4L A;  4GV3 A;  1VQ4 N;  4I9L A;  3PSF A;  1GLD G;  4EHT A;  2E8A A;  2KKZ A;  4M3Y A;  1LAW A;  3CCR N;  3DJC A;  3ZSR A;  1XC9 A;  4V19 S;  2RN2 A;  3CFP A;  4BRD A;  4QS7 A;  4JKE A;  4BVO A;  4ILG B;  5AQK A;  3C65 A;  1S72 N;  4JAX A;  1IKX A;  2YNI A;  3HTV A;  1GLC G;  3NH0 A;  1KAY A;  5KGW A;  2OCE A;  5BRF A;  1ILY A;  2FF6 A;  4B1X B;  4BGA A;  3ZSX A;  3C7N B;  4JK9 A;  3VEV A;  4J2D A;  4FOI A;  4YFU A;  3L4Q A;  5AQO A;  2HVH A;  1EWQ A;  3ZX2 A;  3TSP A;  1XHX A;  1YJN N;  4BRL A;  1KXP A;  4CD1 A;  4DQS A;  1RT5 A;  3HM9 A;  2R7Y A;  4BR2 A;  2BGG A;  5J2P A;  3T1Y K;  4DSF A;  5DK5 A;  4MFB A;  1ASV A;  5D3G A;  1U04 A;  1OH8 A;  3DLB A;  4KH5 A;  2NRR A;  4XH1 A;  1H1V A;  3VA0 A;  3K9K A;  3ULE A;  2PZS A;  1RBS A;  1M90 O;  3DXK B;  1JLC A;  1SL2 A;  5BPL A;  1X3N A;  4Z4G A;  3KJV A;  4CEC A;  2P9S A;  1EX4 A;  3BF3 A;  3E9O A;  3TAF A;  4CJV A;  4IG0 A;  1N6Q A;  4OLA A;  5HBM A;  2YHB A;  3ZCM A;  3LAN A;  2GWJ A;  4X66 K;  2IDO A;  4JKH A;  3E66 A;  1BI4 A;  1BHL A;  5DM6 L;  2WON A;  4DFM A;  4LH4 A;  1VQ5 N;  1HKC A;  4FM0 A;  1NMD A;  3AVK A;  4YNQ A;  3VET A;  4DTS A;  1JKH A;  1X3M A;  5E41 A;  2DTU A;  2VGN A;  1IKW A;  4B9Q A;  4CEZ A;  1T3V A;  5KPR A;  5CZ1 A;  3AO5 A;  2E6L A;  2WUS A;  3RSE B;  4E7J A;  2NRX A;  1WBD A;  4X65 K;  2X6N A;  4JKD A;  2F7T A;  3IKM A;  4H0X B;  3VF6 A;  4CHY A;  5AQL A;  3I8B A;  4MLE A;  3WEE A;  4NXN K;  4J2E A;  1WSF A;  4CK3 A;  4HUG A;  5AQN A;  3MX5 A;  4DSJ A;  4IJA A;  4FK4 A;  3HRG A;  2PY5 A;  4MQ3 A;  1XC3 A;  1JCG A;  4FLV A;  2CGJ A;  2Q2R A;  4CJ3 A;  4L8R B;  1TUY A;  2D0C A;  4DTR A;  3TTF A;  4FOE A;  1MWK A;  3LZJ A;  3LZI A;  4E3S A;  2F8S A;  2FBY A;  4CHQ A;  1W2B M;  2Y1J A;  3ZEU B;  4B3T K;  4FYD A;  1QE1 A;  3E01 A;  3QET A;  3E9P A;  1BQM A;  4HVJ A;  3RMC A;  1A5V A;  2YKN A;  4BRH A;  1MA9 B;  4N76 A;  1WSJ A;  2VG6 A;  1N32 K;  1E4F T;  2ASO A;  5AQH A;  2PYL A;  1LV5 A;  3QO9 A;  1BIU A;  2EWS A;  2XY5 A;  5I42 A;  4K8Z A;  1XWL A;  1NU0 A;  3QEP A;  4AHV A;  1RT2 A;  3L2W A;  1VRU A;  3VQ8 A;  2FXU A;  2JLE A;  3U4L A;  1C0M A;  3UKR A;  5EOY A;  1Z26 A;  4HTL A;  3VEN A;  4IWV A;  5A2Q O;  3VEY A;  3R3L A;  1IKY A;  5IWA K;  3V9U A;  4BDZ A;  4FW1 A;  4DQQ A;  1VSH A;  1VSD A;  3IUC A;  4FJ5 A;  3T19 A;  3LDN A;  4YOV A;  3NAE A;  3AO4 A;  1N8R O;  3G10 A;  5BRD A;  3OYM A;  1C6V A;  3ID6 A;  1N33 K;  1ITG A;  3AGR A;  1VQK N;  5AQU A;  4U67 L;  5GIP A;  4K25 A;  1RTD A;  3ATU A;  3AVH A;  2UU9 K;  3V9S A;  3LM2 A;  3SPZ A;  1QZ5 A;  4B9T A;  4WYB A;  2HVI A;  3OY9 A;  3LDO A;  3VQ4 A;  3MWT A;  4OGE A;  2XY8 A;  2XY7 A;  3OYC A;  4KI6 A;  2YNG A;  3THW B;  4BQZ A;  1X9M A;  2W6L A;  5IT9 O;  4FPA A;  3KKS A;  4FZX C;  4FJJ A;  4CGH A;  3VEX A;  1VQ6 N;  4NLC A;  1SL0 A;  3GL1 A;  1NJY A;  3CQ8 A;  3HJF A;  4PUO A;  1KCF A;  1TGO A;  4BRI A;  1K8K B;  1RBU A;  2DY4 A;  3CD6 N;  2Q3S A;  2RHK A;  3ISN C;  4B3O A;  3SZ2 A;  3VTI A;  3AO3 A;  3HVT A;  3I0S A;  3RSE A;  3J81 O;  3HK2 A;  1RGI A;  3U9D A;  3DOL A;  4W5T A;  3VES A;  3CME N;  4H03 B;  4DR1 K;  3PX6 A;  4DV3 K;  2I5J A;  3FZH A;  1S9G A;  1C0U A;  4EAH D;  1NOZ A;  2YHW A;  2BTF A;  3LWM A;  4CGJ A;  1VSM A;  1L3T A;  1L3S A;  3MN9 A;  1N5Y A;  3PIP L;  3CJC A;  3O9R A;  2E2Q A;  1P90 A;  4E19 A;  2ZJP L;  3A8Y A;  4M45 A;  1E3M A;  4PKI A;  4ID1 A;  4CZM A;  4CFA A;  1RT1 A;  4W5R A;  3NF7 A;  3M3Z A;  5AQT A;  3UE5 A;  4O44 A;  5LJW A;  4KB0 A;  4R5P A;  1T05 A;  2FLO A;  1U48 A;  4ELT A;  2HNZ A;  4LH5 A;  1ZBU A;  1SAZ A;  4CIG A;  2O8C A;  3LDS A;  1RIL A;  4M7Y A;  2AA4 A;  1J6Z A;  2UUB K;  5TKW A;  3ZT4 A;  1BUP A;  4LY7 A;  1TK0 A;  3SMP A;  3MMV A;  3ZSV A;  1YTA A;  1E4G T;  2HBJ A;  5DM7 L;  3O9S A;  3A5L C;  1ASW A;  1D5A A;  4XH4 A;  3CXC M;  1RDD A;  3GDQ A;  5ADX H;  5M1N A;  4CEB A;  5HRR A;  3ZSQ A;  4M42 A;  1XHZ A;  4CFB A;  4B3R K;  2KZM A;  5JVG L;  2X78 A;  2QXL A;  5FDL A;  4CF2 A;  4YOX A;  1Z05 A;  1RBR A;  3NVK A;  2FSN A;  5C10 A;  1NBW A;  1JLF A;  1LWF A;  3DRR A;  4A5A A;  4IO9 L;  1DKG D;  2FBX A;  1I3A A;  4BRO A;  4I9Q A;  3FZM A;  4BE0 A;  1YXQ A;  3W0L A;  2YJE A;  4XH5 A;  3OYH A;  3EY1 A;  3TAN A;  2A1R A;  3LAM A;  4PA1 A;  2YV0 X;  2AP1 A;  4BR9 A;  2DFH A;  1Z6R A;  2UUC K;  3CJ1 A;  4E1M A;  3AO2 A;  3VQ9 A;  5JIC A;  3UKU A;  3O3G A;  4QS8 A;  4M3X A;  1O13 A;  3DYA A;  3O9T A;  3HOT A;  5FPE A;  4JKC A;  2GTD A;  3OW2 M;  4WFA L;  3GOI A;  5LJV A;  4WFB L;  1OH5 A;  3AO1 A;  2EX3 A;  3VQD A;  2QXF A;  4LFC K;  1NGF A;  2CGK A;  4DQI A;  5BPN A;  4FVM A;  3SBT A;  3CCE N;  1NK5 A;  3TWH A;  4FWO A;  2B6A A;  3D6R A;  1U47 A;  3KKR A;  2BE2 A;  4B3S K;  3K58 A;  1YIJ N;  5CYQ A;  3QDK A;  4K8X A;  1O1W A;  3K5L A;  2X6S A;  1Q82 O;  3ATV A;  3CCS N;  4GVE A;  4AHC A;  3V4I A;  5AJ3 K;  4FJM A;  1VQL N;  3PV8 A;  1JXB A;  1R0A A;  2ZE2 A;  3IDH A;  4WE1 A;  1IBM K;  3PY8 A;  1Q9X A;  4N56 A;  2RPI A;  1OKJ A;  2B4J A;  4CZH A;  4KHU A;  3WXL A;  4DFP A;  1IH7 A;  3V81 A;  3AA2 A;  3SI6 A;  2QWP A;  4M41 A;  4BDY A;  2P9U B;  3MN6 A;  3P31 A;  3VTH A;  3DAW A;  4Z0U A;  4KTW A;  2QKB A;  1S1T A;  1NGA A;  5BPM A;  3CER A;  4LF5 K;  3A2F A;  2YHY A;  1CXU A;  4DTO A;  4Z4E A;  1S22 A;  2OZM A;  2CH6 A;  3ITH A;  3TAG A;  3AVA A;  1X9W A;  2FBV A;  3C6A A;  4CD3 A;  1HNZ K;  4DTU A;  3QBW A;  2E20 A;  4CGI A;  4IBN A;  3RMA A;  3AA3 A;  4CEO A;  3VMF B;  4GMJ B;  3MN5 A;  3RVC A;  4CJS A;  2OPS A;  4C8L A;  3WXK A;  3FZL A;  4X62 K;  1JLG A;  1L3U A;  1Q8I A;  3NDK A;  2OA8 A;  2ASP A;  1TKD A;  2WOM A;  1Q7Y O;  3OBW A;  4DTN A;  1C1C A;  3H08 A;  2E1Y A;  3VOV A;  3HP6 A;  1GLE G;  1YHQ N;  3LAL A;  3VQE A;  1YIT N;  4CZF A;  1LW2 A;  1GOB A;  4K42 A;  1EQY A;  4L3Q A;  2QWQ A;  5BRH A;  3F9K A;  5AQR A;  5C24 A;  4CFD A;  1NWK A;  4RW8 A;  1WLJ A;  3N4Q A;  4IOA L;  5AQV A;  3NH1 A;  4YOW A;  3LDP A;  2P9N A;  5AQZ A;  3S3O A;  3WXJ A;  3QFU A;  3V9W A;  3S3N A;  3R6M A;  5CR4 A;  4F2S A;  4HTU A;  4DFK A;  4CF0 A;  4I7F A;  4PL7 A;  4DKW A;  4CJL A;  3CM6 A;  3O4W A;  4W5Q A;  1EWR A;  1K6Y A;  3BZK A;  4UQG A;  3O1B A;  4BC5 A;  3ULE B;  3M8P A;  1RT6 A;  4DQ8 A;  1JJ2 M;  4DS5 A;  2P9L A;  1JLA A;  2YHA A;  1N36 K;  1HRH A;  2A41 A;  4H0T B;  4JI6 K;  4KBO A;  4FPB A;  4CZK A;  1XI1 A;  4GY2 B;  4FXD A;  2P9S B;  1T6D A;  4JI8 K;  3ZX0 A;  3FLC O;  4M3R A;  4BRP A;  4E7L A;  4BY9 C;  4H5R A;  1HPM A;  3LDL A;  1IO2 A;  1ESV A;  2YCH A;  5B8H A;  4WF9 L;  4RTF D;  1KFS A;  3HOS A;  1W0H A;  3CJ9 A;  3CET A;  1U6Z A;  5AQM A;  1QVG M;  4B9S A;  4JNE A;  1HQU A;  2E5L K;  3VA3 A;  1QVF M;  4HCC A;  3D2F A;  4QS9 A;  2IOC A;  1HJR A;  2BDP A;  4C8N A;  2O8F B;  4CJ4 A;  3DXM A;  4EP4 A;  3IFR A;  5EXW A;  1TL3 A;  1T6C A;  3S41 A;  4CZI A;  3KTQ A;  2E6M A;  1HNW K;  1NG9 A;  4BVP A;  3VPZ A;  4GW6 A;  3VQ6 A;  4CED A;  4O0J A;  1VQP N;  1NOY A;  3THX A;  4JLH A;  1JLB A;  1GOA A;  2P9I A;  3OHR A;  3V9Z A;  3AVL A;  4CJQ A;  4C23 A;  1XNR K;  4WQ5 A;  3VGM A;  4FVU A;  4H5T A;  3DLG A;  1XUP O;  3HO1 A;  3HP9 A;  1S9E A;  2X74 A;  1RTI A;  2XHB A;  3P38 A;  1T44 A;  1KTQ A;  3OS1 A;  3BP8 A;  5T7B A;  4OJR A;  1J5O A;  4RCH A;  1UOC A;  3Q7C A;  4ISE A;  2KLA A;  4DQP A;  4BRN A;  4I2Q A;  2O4G A;  3UKR B;  1SKR A;  4PHT X;  4AQY K;  1QHT A;  4OKE A;  3QIO A;  4B3M K;  2IC3 A;  2HW3 A;  1OVY A;  5FRM A;  5KPZ A;  2EHG A;  4IFY A;  1NKC A;  3OYA A;  4HHT A;  3AVM A;  2OPQ A;  3CCM N;  1B92 A;  4CBU A;  2IVP A;  1NK7 A;  2F96 A;  4FW2 A;  5GAE P;  2O8D A;  1NGC A;  1VSL A;  1GOC A;  1G99 A;  4IOC L;  1KFD A;  3MXI A;  4MO5 A;  1NK4 A;  4K41 A;  3BZC A;  4CHZ A;  3P83 D;  4N5S A;  5F2R A;  4JK7 A;  4KO0 A;  4M3W A;  3C6H A;  4OPH A;  2NUB A;  1Y97 A;  3NBP A;  4BR5 A;  4BWJ A;  5H1S Q;  3J80 O;  5SZT A;  2HB5 A;  3EO3 A;  3PLA A;  2ZD1 A;  3D7E O;  3IRX A;  1NGH A;  3AA5 X;  1CXQ A;  3ZET B;  1QHA A;  5LMU K;  5CYM A;  1XQS C;  5EVZ A;  4YOT A;  3RWU A;  3O6W A;  1ZXO A;  4FLT A;  1HUX A;  2RKI A;  4H0Y B;  3TU5 A;  4KH4 A;  4E7H A;  4FWR A;  3DWL A;  4E0D A;  3SV4 A;  2O8F A;  3NGI A;  2J4R A;  4CF1 A;  4FK2 A;  3SQ0 A;  2IAJ A;  3OYE A;  4BRG A;  1LWE A;  1BG3 A;  1VK0 A;  4A57 A;  4DFJ A;  2Q1N A;  5MLC Q;  5K14 A;  1LWC A;  4IDK A;  3WQT A;  4B8C A;  4DHY A;  3EYZ A;  3G25 A;  2A1S A;  4J2A A;  3CIP A;  3BGR A;  5F0X A;  4O0I A;  1KVA A;  5DMR A;  3U8X A;  1TAQ A;  3M8S A;  1HKG A;  4IZ9 A;  1SZ2 A;  1KC8 O;  2O8C B;  3ZT0 A;  5KRS A;  3MEC A;  4FWP A;  5BN9 A;  4K0K K;  4N47 A;  3CPE A;  4IJN A;  1UWB A;  4CEE A;  4DSL A;  2D5R A;  3MWP A;  4CFC A;  1RDW X;  2V7Z A;  3HL8 A;  1NLV A;  1VQN N;  3MED A;  4FL9 A;  1WNS A;  4AF1 A;  3KK2 A;  2PYJ A;  3AAP A;  1QQO A;  1S6P A;  1BL3 A;  4PKH A;  3OYI A;  4DTP A;  1BIZ A;  2ASM A;  4FK0 A;  2GEM A;  3CCQ N;  3JS6 A;  4NLB A;  1M1K O;  4MDA A;  3L2Q A;  4JHD A;  1S5J A;  3NE6 A;  4JK8 A;  3O8M A;  4CF9 A;  4ELU A;  4DV4 K;  5C0Y A;  3NGZ A;  2IS3 A;  3P39 A;  4JS5 A;  4DCH A;  1HJO A;  4NCG A;  5CE3 A;  1XNQ K;  4LF6 K;  2A5X A;  1NGB A;  4H8K A;  3HZ6 A;  4DSI A;  4DTJ A;  2KTQ A;  4DR2 K;  4DUZ K;  4FM1 A;  1TV6 A;  3C6U A;  5CZ2 A;  2E2P A;  5M1P A;  1ZYQ A;  4IEE A;  4BWM A;  1YJW N;  3K9J A;  3UKU B;  4N41 A;  1B9D A;  3SQ2 A;  4FJ9 A;  4Z4H A;  3VGK A;  2P51 A;  3NVM A;  3O3F A;  1Q9Y A;  3ZET A;  4CHP A;  4IFV A;  4IFE A;  3MCP A;  5HOO A;  4BE2 A;  1HQE A;  3BY5 A;  4CJ5 A;  3OYK A;  3SUP A;  1YTU A;  4FSV A;  3MN7 A;  4BQL A;  5AR0 A;  3NMU A;  3AV9 A;  3HSC A;  5M1F A;  3O3H A;  4ZTF A;  3M5R A;  4JN4 A;  3THV A;  2HHS A;  5BR9 A;  1BO5 O;  4Z4C A;  5HRN A;  1BWF O;  3EEQ A;  1NJZ A;  4FZZ A;  1GLL O;  2G8H A;  1VSF A;  3T1A A;  1OH6 A;  3DRS A;  1NGD A;  5HRP A;  1CZ9 A;  2HOE A;  5GAD P;  3H45 C;  2YJF A;  4LF8 K;  2NRH A;  4GNI A;  5BR8 K;  1EO1 A;  1D4X A;  3AVG A;  4OKJ A;  4LFB K;  4LFA K;  1I94 K;  4YOR A;  1R59 O;  3HI0 A;  2G8F A;  3NFA A;  3MCA B;  3ZX3 A;  2NRZ A;  4WCE L;  2HHU A;  3FR0 A;  4KPY A;  1WAJ A;  1X9S A;  3O4Q A;  1VQO N;  4DTM A;  3SYZ A;  4KH6 A;  1VSI A;  1GLJ O;  4DTX A;  3CFO A;  4KFB A;  2BUP A;  3QEV A;  4B1Z A;  3G4S N;  1LW0 A;  5AQQ A;  3VQP A;  4FLZ A;  2ZQB A;  4KV8 A;  4CBW A;  3LM9 A;  3PUF A;  1J5E K;  3HXM A;  5KI6 A;  3SV3 A;  3QB0 A;  3QNO A;  4H5W A;  4HUE A;  2E2N A;  1G15 A;  3SPY A;  4WFN L;  4OPJ A;  4FWK A;  2VCP A;  2KW4 A;  3H3N O;  3HPG A;  2ITM A;  4JI1 K;  4DLE A;  1RT4 A;  2WBN A;  4FJG A;  1JCE A;  3OTO K;  4FWN A;  4DV7 K;  4I6M A;  5JS2 A;  4ELV A;  4CEF A;  2HND A;  2VG5 A;  4BGB A;  3UIQ A;  1C0F A;  3M1F A;  3QBX A;  2QWO A;  1KSP A;  3KLF A;  2XO7 A;  4NCB A;  3SK3 A;  1NJI O;  4Z4I A;  4BRA A;  4DU4 A;  1VHX A;  3I8D A;  2IVN A;  4CJU A;  5FPD A;  4PQU A;  3ZT2 A;  3VEW A;  4JKB A;  3OJU A;  1JL2 A;  4DR4 K;  1TYQ A;  2B5J A;  2P9P A;  2O8E A;  3V1Q A;  2P9N B;  3VQ5 A;  3MEE A;  4FLW A;  3CJ7 A;  4FLU A;  4GKK K;  4DSE A;  5CY4 A;  2O8B A;  2KFN A;  1HNV A;  3FZF A;  4CJW A;  1SV5 A;  2Q0R A;  2FBT A;  1QSS A;  4KAZ A;  1RNH A;  1U2V A;  3QIC A;  3JAM O;  3G6E N;  3L4I A;  1WSE A;  2QWN A;  1F21 A;  4K43 A;  4B1V A;  5AZI A;  3OYB A;  1U4B A;  5ADX A;  5J1E A;  1VQ8 N;  2P9L B;  4ID5 A;  1KVB A;  4B1U B;  4F9O A;  3QIP A;  4YY3 K;  2PAV A;  4I2P A;  4DB3 A;  2QI2 A;  2HMI A;  1OH7 A;  4O55 A;  3O9U A;  2IGI A;  1RBT A;  1HYV A;  5J2Q A;  5EX5 A;  3S3M A;  4WQ4 A;  2D0B A;  3K5N A;  2E1Z A;  3CC7 N;  4H5V A;  1JLE A;  3OS0 A;  1WN7 A;  3BDP A;  2LSN A;  1VSK A;  1NK6 A;  3VER A;  5AQP A;  3LDQ A;  4KRF A;  2XRI A;  4KTQ A;  3EE9 A;  3UB5 A;  1U49 A;  3THY A;  3E1Y A;  1I39 A;  4HUF A;  3P5J A;  4RW9 A;  1W9H A;  5C12 A;  4ISF A;  2QWM A;  4FCY A;  4DF4 A;  3EL2 A;  4KB1 A;  5AZJ A;  3OYD A;  5F1X A;  3D2F B;  2GX9 A;  5LL6 Z;  5AQW A;  4J8F A;  4FJI A;  4BRM A;  2ETJ A;  3DXM B;  3C0B A;  2UXB K;  4FJ7 A;  2OTJ N;  1NGE A;  2QTD A;  4QOZ B;  3C95 A;  3VF4 A;  2D0P A;  2NNW A;  3PO5 A;  3KIO A;  1RTH A;  3KLG A;  4BC3 A;  3THX B;  2W42 A;  4AHR A;  2P9I B;  3NF6 A;  4YDU A;  2G8V A;  1P8Z A;  1LOT B;  4CZE A;  3O80 A;  5C25 A;  1RDB A;  4CIE A;  4CJK A;  2P5O A;  3P1G A;  5FPN A;  2OPP A;  3OYF A;  3LL3 A;  4FWM A;  2F9T A;  1SS6 A;  4W5N A;  3KLE A;  3MK6 A;  1HYS A;  3O1W A;  4JKG A;  3WXM B;  4MLH A;  4RW7 A;  3LPU A;  1DT9 A;  3OYG A;  3CCV N;  3SAG A;  2BH1 A;  3C94 A;  1OVQ A;  3T69 A;  4O8U A;  4KTZ A;  3F73 A;  4EIA A;  5TKY A;  3RRH A;  3DLK A;  3KK7 A;  1S1W A;  4CGG A;  4DLG A;  3CMA N;  1RDC A;  1TAU A;  4R79 A;  2VQE K;  4HWI A;  3ENH A;  2G8W A;  1DEJ A;  4DSK A;  2G8K A;  2O8D B;  3CPW M;  4EHU A;  3J7Y P;  1SL1 A;  3W3D A;  2NRT A;  1CZB A;  1DTT A;  3CJA A;  4FO0 A;  5FLX O;  3F2K A;  4LF7 K;  5EU7 A;  3TSQ A;  4DU3 A;  1ATS A;  4CHN A;  3B6O A;  3WNE A;  3M8R A;  4BR4 A;  3WXI A;  3L2V A;  1UA0 A;  2ZJR L;  2OTL N;  4E89 A;  3K0S A;  4BRK A;  1ZBI A;  5C2D A;  3B8A X;  1T8E A;  5C42 A;  1XMQ K;  4CBX A;  4CGF A;  3V9X A;  4KI4 A;  4F4K A;  4W5O A;  3IS9 A;  3EKU A;  1CLQ A;  3LAK A;  4BDP A;  2IVO A;  4EP5 A;  5KPT A;  4NO7 A;  4JRQ A;  3QES A;  1K8A O;  1KD1 O;  1D9F A;  3JYT A;  1J54 A;  2UYT A;  3NF9 A;  3M6G A;  3WQU A;  5FRN A;  1WSI A;  3FFI A;  3TTC A;  4E7K A;  1VQM N;  5J2N A;  5I9E B;  1GLB G;  2BAN A;  3TAM A;  4KHS A;  4H0O A;  5KTQ A;  2QA4 N;  1MDU B;  3V1R A;  2DFE A;  2A40 A;  2ZJQ L;  4DR6 K;  4KHY A;  1NGI A;  4ILJ A;  4YOU A;  4KKO A;  4JI7 K;  1ZBH A;  2ZF5 O;  3EE8 A;  3NGY A;  4O4G A;  3PX0 A;  3AA4 A;  2OPR A;  2ZM6 K;  3VN5 A;  2I7N A;  3VQ7 A;  1SKW A;  2AJQ A;  4FJX A;  4CCH A;  4Y1C A;  5AQI A;  4GV6 A;  4Y1D A;  4DR7 K;  3I55 N;  4ISG A;  4DV0 K;  1YT3 A;  2Q36 A;  4E1N A;  3T7Z A;  3PIO L;  4NB4 A;  2NLX A;  3AVF A;  2WFB A;  1JCF A;  3B6P A;  4MO4 A;  4WQ4 C;  4FLX A;  5FPM A;  3P4I A;  3F5T A;  3A0I X;  1W7A A;  4F3T A;  2GBZ A;  3DLR A;  3CG7 A;  3LP0 A;  4LD0 A;  2JGU A;  1C1B A;  1VRT A;  4KHP K;  4IKF A;  4JHD B;  4E1J A;  1YF5 L;  3H46 O;  2OZS A;  1Q81 O;  4KHN A;  2HHQ A;  2P5G A;  3EN9 A;  4C1N K;  3T1H K;  4EZ6 A;  4UY8 O;  4RWT A;  4KRE A;  5HP1 A;  1IG9 A;  4Y0W A;  2QWR A;  1GLA G;  1QSY A;  1JLQ A;  4B8A B;  3OBY A;  2WC9 A;  3CI5 A;  2HHW A;  3I56 N;  1J53 A;  2PBD A;  3OJS A;  5BRE A;  4CJF A;  1EP4 A;  3VEO A;  4CZJ A;  3OYL A;  3DM2 A;  4ILH A;  4BRQ A;  3MXJ A;  3K5M A;  1TK5 A;  4M7X A;  2E88 A;  2HNY A;  2OAN A;  3H1V X;  2GV9 A;  4FJL A;  4GKJ K;  5GAH P;  3U6F A;  3RR7 A;  3SQ4 A;  3K59 A;  3JSM A;  3NF8 A;  3G71 N;  1HPZ A;  3ENO A;  4YDU C;  4AHT A;  3TI0 A;  3AVI A;  4IO8 A;  3A5O C;  4H0V B;  1BCM A;  3KD5 E;  3ZSY A;  3KWG A;  2HHT A;  3TAP A;  4B9M A;  1U45 A;  3HYF A;  4DR3 K;  1RFQ A;  2HF3 A;  4CJP A;  3LP1 A;  3SJJ A;  3R8E A;  4F3O A;  3KLH A;  3VQQ A;  2Y1I A;  1FKP A;  2VWB A;  4O8K A;  3CF5 L;  4DF8 A;  2Z1H A;  3PO4 A;  5KQ8 A;  4FJH A;  3V6D A;  1S1X A;  4A2A A;  1MWM A;  3DLL L;  3CM5 A;  3NCI A;  3D0P A;  1S3X A;  3MXM A;  2JWK A;  1ATN A;  1SUQ A;  1YVU A;  4NYF A;  1V4S A;  4KHQ A;  4M3U A;  4PWD A;  4Z94 A;  3KK3 A;  2VYP A;  3G0Z A;  4IOX A;  2UUA K;  3Q7B A;  4CK2 A;  4H0P A;  1RBV A;  3R1X A;  1UA1 A;  2FSK A;  2Q0U A;  1NMN A;  3AVC A;  3ZLJ A;  4CEA A;  5M1K A;  4PKG A;  1Q86 O;  5FRO A;  4A62 A;  3U3G A;  1B9F A;  1HYZ A;  4BC2 A;  1KVC A;  3J7A P;  2HHH K;  1WB9 A;  2HHX A;  1WBB A;  1VQ7 N;  3QER A;  4PY5 A;  2GUI A;  2UXC K;  4CGD A;  3C7N A;  4IXC A;  4Q5V A;  3TSU A;  1ZBL A;  3BEX A;  3ZYY X;  1RDU A;  3KZB A;  4JRP A;  4DQR A;  4BE1 A;  4A2B A;  2YX6 A;  3VEZ A;  2HBK A;  1IKV A;  3SMS A;  1QSL A;  3KK1 A;  1RDA A;  3OA9 A;  4I6M B;  3J7Z O;  1HKB A;  3WNF A;  4U7B A;  4AHU A;  3U3Y A;  2IIR A;  3HT3 A;  3L8B A;  1FJG K;  3OVN A;  3VQB A;  3EKS A;  1BIS A;  5AQS A;  2KZZ A;  4B9N A;  3QEW A;  3PSI A;  4JYA K;  4JD2 B;  1BU6 O;  1TKX A;  2D0O A;  1EET A;  1K9M O;  2RF2 A;  3S9H A;  4OVL A;  1HLU A;  3NHG A;  4CVN E;  3DXK A;  1JXE A;  4H5N A;  3CCJ N;  3RRG A;  3O5B A;  4WQ5 C;  2Q97 A;  3IG1 A;  1TYQ B;  4AIL C;  1NK0 A;  1NGJ A;  1X1P A;  1TKT A;  2P9P B;  2O8E B;  2ZWH A;  4DWI A;  2O8B B;  4LF9 K;  3O4N A;  4BG9 A;  3O08 A;  3FE1 A;  3GG4 A;  1QQN A;  1YI2 N;  5JS1 A;  3FZK A;  3DMJ A;  1D9D A;  1U2V B;  1TK8 A;  1HNI A;  2UXD K;  4XIU A;  3HPH A;  1V4T A;  3K2P A;  4DU1 A;  5AZI B;  1ZBS A;  1DLO A;  1MU2 A;  2A42 A;  4B1Y B;  2HST A;  2E2O A;  5KQD A;  4CJR A;  4B9U A;  4O5F A; 
#chains in the Genus database with same CATH homology
 1HYV A;  4OKK A;  3AVK A;  1A5X A;  4DS4 A;  5J2Q A;  4YNQ A;  3S3M A;  4DG1 A;  3K5N A;  2D0B A;  1JKH A;  4DTS A;  4M3Z A;  1IO2 A;  4ICL A;  5E41 A;  3OYN A;  2DTU A;  1IKW A;  4CE9 A;  1JLE A;  4CER A;  5SWM A;  1WN7 A;  4CEZ A;  3OS0 A;  3BDP A;  1KFS A;  2LSN A;  5CZ1 A;  3AO5 A;  1VSK A;  1W0H A;  2E6L A;  3VQA A;  1NK6 A;  4B9S A;  3K57 A;  4KRF A;  4E7J A;  2F8T A;  2X6N A;  2XRI A;  4KTQ A;  3D45 A;  3DLE A;  1HQU A;  4OPK A;  4CHY A;  1U49 A;  4GVM A;  3VA3 A;  4HCC A;  1I39 A;  3LPT A;  4HUF A;  3P5J A;  4RW9 A;  2KQ2 A;  1W9H A;  2IOC A;  1HJR A;  2BDP A;  4C8N A;  4J2E A;  3NH2 A;  1WSF A;  4CK3 A;  1FK9 A;  4FCY A;  4CJ4 A;  4DF4 A;  1L3V A;  4EP4 A;  4KB1 A;  4HUG A;  3OYD A;  3SQ1 A;  4DSJ A;  1TL3 A;  4FK4 A;  2PY5 A;  1D8Y A;  1NJX A;  3M8Q A;  3MAQ A;  4MQ3 A;  3KTQ A;  4FJI A;  1ASU A;  1BGX T;  2E6M A;  4FLV A;  2ETJ A;  4CJ3 A;  4FJ7 A;  4L8R B;  2D0C A;  4RG8 A;  3ZSZ A;  4GW6 A;  3VQ6 A;  4CED A;  4O0J A;  4DTR A;  4QOZ B;  3C95 A;  1NOY A;  3LZJ A;  3LZI A;  4E3S A;  2F8S A;  2FBY A;  4CHQ A;  4JLH A;  3PO5 A;  1ZBF A;  1JLB A;  1GOA A;  3QEI A;  3KIO A;  1RTH A;  1WAF A;  3V9Z A;  2Y1J A;  3KLG A;  2XY6 A;  4FYD A;  1QE1 A;  3E01 A;  4HCB A;  3QET A;  3AVL A;  4CJQ A;  1BQM A;  4HVJ A;  2W42 A;  1RCH A;  3RMC A;  1A5V A;  4AHR A;  2YKN A;  3NF6 A;  5KGX A;  4N76 A;  1WSJ A;  2VG6 A;  2G8V A;  3DLG A;  2PYL A;  1C0T A;  3HO1 A;  1LV5 A;  3HP9 A;  1S9E A;  2X74 A;  1RTI A;  3QO9 A;  1BIU A;  2XY5 A;  4K8Z A;  5I42 A;  2XHB A;  5C25 A;  1RDB A;  4CIE A;  4CJK A;  1XWL A;  4LSN A;  4RW4 A;  2Z1I A;  3P1G A;  1REV A;  4AHV A;  3QEP A;  2P5O A;  1RT2 A;  2OPP A;  3OYF A;  3LWL A;  1KTQ A;  4AH9 A;  1VRU A;  3VQ8 A;  3OS1 A;  3L2W A;  5T7B A;  4OJR A;  1J5O A;  2JLE A;  1KLN A;  3SCX A;  1C0M A;  4FJK A;  1UOC A;  3EZ5 A;  4E7I A;  1Z26 A;  4W5N A;  3KLE A;  4FZY A;  4DQP A;  4I2Q A;  2O4G A;  1HYS A;  4AHS A;  1SKR A;  4OLB A;  1IKY A;  1Z25 A;  1QHT A;  4OKE A;  1VSJ A;  3QIO A;  2IC3 A;  3LPU A;  4FW1 A;  4RW7 A;  4BDZ A;  3V9U A;  3OYG A;  4DQQ A;  3TAE A;  1VSH A;  1TVR A;  5FRM A;  3C94 A;  1VSD A;  2EHG A;  4IFY A;  3QNN A;  3OYA A;  3K5O A;  4HHT A;  3AVM A;  2Z1G A;  3T19 A;  3TAR A;  2OPQ A;  4KTZ A;  3F73 A;  3NAE A;  1B92 A;  3AO4 A;  4H4O A;  3T3F A;  3G10 A;  3RRH A;  3DLK A;  3DI6 A;  1S1W A;  1C6V A;  1BQN A;  4CGG A;  3OYM A;  4DLG A;  1NK7 A;  1ITG A;  1RDC A;  2F96 A;  4FW2 A;  3TAQ A;  1VSL A;  1FKO A;  3LP2 A;  1RTD A;  1QTM A;  1TAU A;  1RTJ A;  1GOC A;  2G8W A;  1KFD A;  3MXI A;  3AVH A;  4DSK A;  1A5W A;  3V9S A;  3SPZ A;  1NK4 A;  2G8K A;  4CHZ A;  3AVJ A;  4B9T A;  4KHW A;  2HVI A;  3P83 D;  3OY9 A;  4N5S A;  2VG7 A;  3VQ4 A;  4KO0 A;  4M3W A;  1SL1 A;  2XY8 A;  1CZB A;  4OGE A;  1DTT A;  4CK1 A;  1J9A A;  2XY7 A;  4M3T A;  2NUB A;  1Y97 A;  3NBP A;  5EU7 A;  3OYC A;  4NCA A;  4BWJ A;  3RTV A;  4DU3 A;  4KI6 A;  5SZT A;  2YNG A;  2HB5 A;  1X9M A;  2P1J A;  4J2B A;  3KKS A;  4FZX C;  4NYN A;  3B6O A;  4CHN A;  3WNE A;  4FJJ A;  4CGH A;  2ZD1 A;  3WNG A;  3AVN A;  3M8R A;  3IRX A;  1SL0 A;  1NJY A;  3L2V A;  3CQ8 A;  3HJF A;  3AA5 X;  3QIN A;  1KCF A;  1UA0 A;  4PUO A;  1CXQ A;  1TGO A;  2Z1J A;  1RBU A;  2DY4 A;  1UAX A;  4E89 A;  4ZTJ A;  2Q3S A;  1ZBI A;  3ISN C;  4B3O A;  2HW3 A;  3SZ2 A;  1T8E A;  3MEG A;  3AO3 A;  5CYM A;  5C42 A;  3HVT A;  3I0S A;  3HK2 A;  4CGF A;  3V9X A;  4KI4 A;  3RWU A;  4FLT A;  4F4K A;  4W5O A;  3IS9 A;  3DOL A;  4W5T A;  1TKZ A;  1HMV A;  1CLQ A;  2RKI A;  3LAK A;  3RMD A;  3PX6 A;  4QCL A;  4E7H A;  1S1V A;  1JL1 A;  2I5J A;  3ALY A;  4BDP A;  4FJ5 A;  4EP5 A;  1S9G A;  1C0U A;  2QK9 A;  4E0D A;  3SV4 A;  3NGI A;  1NOZ A;  4JRQ A;  3QES A;  1KRP A;  2ATQ A;  4CF1 A;  1D9F A;  4F2R A;  3LWM A;  3JYT A;  4CGJ A;  1VSM A;  1J54 A;  3NF9 A;  1L3T A;  4FK2 A;  1L3S A;  5FRN A;  1WSI A;  3SQ0 A;  4RW6 A;  1N5Y A;  3FFI A;  2IAJ A;  3OYE A;  4E7K A;  1NK8 A;  5J2N A;  3L3V A;  4E19 A;  1LWE A;  1C1A A;  2BAN A;  4M45 A;  4QAG A;  1VK0 A;  3TAM A;  4DFJ A;  4KHS A;  3SUN A;  4ID1 A;  4CIF A;  4CFA A;  4FM2 A;  1RT1 A;  5K14 A;  5KTQ A;  1LWC A;  4IDK A;  2VWK A;  4W5R A;  1SKS A;  3V1R A;  3NF7 A;  3LP3 A;  4B8C A;  2DFE A;  3EYZ A;  1VSE A;  4O44 A;  4C8O A;  4KB0 A;  4R5P A;  4KHY A;  3QLH A;  1T05 A;  1U48 A;  1LAV A;  5HRS A;  2A1S A;  4KKO A;  3WNH A;  4ZHR A;  4ELT A;  2HNZ A;  4LH5 A;  4J2A A;  3SUQ A;  1ZBH A;  4B9V A;  4EZ9 A;  3BGR A;  1ZBU A;  4O4G A;  3NGY A;  3PX0 A;  4O0I A;  1KVA A;  3AA4 A;  2OPR A;  5DMR A;  3ZSO A;  4CIG A;  3VN5 A;  1TAQ A;  3L2U A;  3VQ7 A;  3LDS A;  1SKW A;  1RIL A;  3M8S A;  2AJQ A;  1L5U A;  3L3U A;  4CCH A;  4FJX A;  4Y1C A;  3ZT4 A;  2QKK A;  4LY7 A;  3ZT0 A;  5KRS A;  3MEC A;  1TK0 A;  4B9M A;  3C6T A;  4Y1D A;  1YTA A;  4N47 A;  3DOK A;  3ZSV A;  5I3U A;  1UWB A;  1YT3 A;  4E1N A;  4CEE A;  1ASW A;  1D5A A;  2D5R A;  4CFC A;  3QEX A;  1NKB A;  4DSL A;  3HVR A;  3HL8 A;  2OYQ A;  3HST B;  1RDD A;  3AVF A;  3MED A;  1WNS A;  3KK2 A;  2PYJ A;  4CJE A;  4CEB A;  1NJW A;  1S6P A;  5HRR A;  3B6P A;  1BL3 A;  3ZSQ A;  3PX4 A;  3OYI A;  4M42 A;  1XHZ A;  4FLX A;  1BIZ A;  4CFB A;  4DTP A;  4FK0 A;  3ASM A;  2KZM A;  4F3T A;  2GBZ A;  3DLR A;  3L2Q A;  2X78 A;  3CG7 A;  4OGC A;  4CF2 A;  1S5J A;  2DFF A;  3LP0 A;  4G1Q A;  5FDL A;  4LD0 A;  3OS2 A;  3NE6 A;  3SUO A;  4CF9 A;  3DLH A;  3IAY A;  1RBR A;  2JGU A;  1C1B A;  1VRT A;  1KLM A;  4CHO A;  1JLF A;  1LWF A;  3DRR A;  4ELU A;  4IKF A;  3DRP A;  2IS3 A;  3NGZ A;  3HPO A;  2OZS A;  3KD1 E;  4KHN A;  4JS5 A;  2FBX A;  1I3A A;  2HHQ A;  2P5G A;  4CJT A;  4EZ6 A;  4NCG A;  4I9Q A;  4KRE A;  5HP1 A;  4BE0 A;  1IG9 A;  4Q0B A;  3OYH A;  1TL1 A;  3EY1 A;  3TAN A;  4H8K A;  2A1R A;  1QSY A;  1JLQ A;  3LAM A;  4PA1 A;  2D0A A;  3CYM A;  4B8A B;  4DTJ A;  2YV0 X;  4DSI A;  2DFH A;  4TSX A;  2KTQ A;  2KFZ A;  4FM1 A;  1BCO A;  4E1M A;  2HHW A;  3AO2 A;  1TV6 A;  3VQ9 A;  1J53 A;  1WSH A;  3OJS A;  1EXQ A;  3C6U A;  5CZ2 A;  4CJF A;  3O3G A;  4M3X A;  1EP4 A;  1ZYQ A;  3OYJ A;  4BWM A;  3DYA A;  3OYL A;  3ZT1 A;  4Z4F A;  2ITG A;  2VWJ A;  3DM2 A;  3MXJ A;  4N41 A;  3K5M A;  1TK5 A;  1B9D A;  2HNY A;  1RT3 A;  2GV9 A;  4FJL A;  3SQ2 A;  4FJ9 A;  2FC0 A;  4Z4H A;  3U6F A;  3RR7 A;  5KRT A;  5HLF A;  2P51 A;  3TR8 A;  3SQ4 A;  3I0R A;  3K59 A;  4LSL A;  3JSM A;  3O3F A;  3NF8 A;  3AO1 A;  1Q9Y A;  2EX3 A;  1HPZ A;  4O5B A;  4H4M A;  4AHT A;  4CHP A;  4IFV A;  3VQD A;  1EKE A;  2QXF A;  4BE2 A;  1HQE A;  3TI0 A;  1QQC A;  3AVI A;  4CJ5 A;  4DQI A;  4CEQ A;  1S6Q A;  4FVM A;  1NK5 A;  3TWH A;  1BCM A;  3KD5 E;  3OYK A;  3ZSY A;  2HHT A;  2B6A A;  3SUP A;  1YTU A;  5HRO A;  1U47 A;  1FXX A;  3AV9 A;  3TAP A;  3V1O A;  3KKR A;  3O3H A;  1U45 A;  2G8U A;  3HYF A;  3SNN A;  2BE2 A;  1T7P A;  4FJ8 A;  4ZTF A;  3ZT3 A;  3K58 A;  4CJP A;  3LP1 A;  4JS4 A;  5CYQ A;  3THV A;  3SJJ A;  2HHS A;  4F3O A;  4Z4C A;  3KLH A;  4B9L A;  4DMN A;  4K8X A;  5HRN A;  1O1W A;  3VQQ A;  3K5L A;  2X6S A;  2G8I A;  1NJZ A;  2O4I A;  4FZZ A;  4AHC A;  3V4I A;  2Y1I A;  3KLI A;  4FJM A;  2G8H A;  1FKP A;  1VSF A;  3T1A A;  4BAC A;  4DF8 A;  3DRS A;  5HRP A;  3RR8 A;  1CZ9 A;  2Z1H A;  3PO4 A;  4C8K A;  4B08 A;  4FLY A;  1BI4 B;  2YNH A;  3PV8 A;  1JXB A;  1R0A A;  2ZE2 A;  4WE1 A;  3PY8 A;  1DTQ A;  4FJH A;  3V6D A;  1S1X A;  1Q9X A;  4F8R A;  2HHV A;  3AVG A;  4N56 A;  4OKJ A;  2RPI A;  1NK9 A;  2B4J A;  4C8M A;  4CES A;  3CFR A;  4KHU A;  3CM5 A;  4DFP A;  1IH7 A;  3V81 A;  2G8F A;  3NFA A;  3NCI A;  3D0P A;  2YNF A;  3MXM A;  3AA2 A;  3AVB A;  3SI6 A;  1SUQ A;  2HHU A;  1YVU A;  4CF8 A;  4NYF A;  4M41 A;  4BDY A;  5J2M A;  3RMB A;  3L2R A;  4KPY A;  4KHQ A;  1WAJ A;  4M3U A;  1X9S A;  3O4Q A;  4PWD A;  2YKM A;  3KK3 A;  1WSG A;  3G0Z A;  1QS4 A;  3ZSW A;  4Z0U A;  3TAB A;  4IG3 A;  4KTW A;  1RT7 A;  2QKB A;  1S1T A;  4DTM A;  3SYZ A;  4CK2 A;  1VSI A;  1NKE A;  4FJN A;  4DTX A;  3ULD A;  3VQC A;  1RBV A;  3CFO A;  1UA1 A;  1NKC A;  4KFB A;  1S1U A;  3QEV A;  3AVC A;  3A2F A;  1T03 A;  1LW0 A;  2E4L A;  4CEA A;  1CXU A;  4DTO A;  3VQP A;  4Z4E A;  4FLZ A;  2ZQB A;  4KV8 A;  4I9L A;  5FRO A;  3U3G A;  1B9F A;  1HYZ A;  2OZM A;  3ITH A;  3PUF A;  3TAG A;  3AVA A;  1KVC A;  3HXM A;  5KI6 A;  4M3Y A;  1LAW A;  2HHX A;  3SV3 A;  1X9W A;  3ZSR A;  3QNO A;  1XC9 A;  2FBV A;  2RN2 A;  3CFP A;  4HUE A;  3QER A;  1G15 A;  4DTU A;  3SPY A;  4PY5 A;  4OPJ A;  4CGI A;  2GUI A;  3HPG A;  2KW4 A;  4IBN A;  4CGD A;  3RMA A;  4Q5V A;  3AA3 A;  1IKX A;  2YNI A;  4CEO A;  1ZBL A;  4DLE A;  1RT4 A;  4GMJ B;  3NH0 A;  5KGW A;  4FJG A;  4CJS A;  2OPS A;  4C8L A;  4JRP A;  4DQR A;  4BE1 A;  3ZSX A;  5JS2 A;  4ELV A;  1JLG A;  4CEF A;  1Q8I A;  1L3U A;  4J2D A;  2HND A;  2VG5 A;  1IKV A;  1QSL A;  3KK1 A;  4YFU A;  3NDK A;  2HVH A;  1RDA A;  2OA8 A;  3UIQ A;  1TKD A;  2WOM A;  3WNF A;  1KSP A;  4AHU A;  3U3Y A;  4DTN A;  1C1C A;  3KLF A;  2XO7 A;  1XHX A;  3H08 A;  3HT3 A;  3L8B A;  3HP6 A;  3OVN A;  4NCB A;  3VQB A;  3LAL A;  4DQS A;  1RT5 A;  3VQE A;  1LW2 A;  3HM9 A;  1GOB A;  4Z4I A;  1BIS A;  2KZZ A;  4B9N A;  4DU4 A;  2R7Y A;  3QEW A;  3I8D A;  4CJU A;  4PQU A;  3F9K A;  5C24 A;  4CFD A;  4RW8 A;  1WLJ A;  2BGG A;  1TKX A;  5J2P A;  3ZT2 A;  3NH1 A;  5DK5 A;  4DSF A;  1EET A;  3OJU A;  2RF2 A;  1JL2 A;  3S9H A;  4MFB A;  4OVL A;  1ASV A;  3NHG A;  3S3O A;  5D3G A;  1U04 A;  3V9W A;  3S3N A;  1JXE A;  2B5J A;  3DLB A;  3RRG A;  4F2S A;  4HTU A;  3V1Q A;  3VQ5 A;  4DFK A;  3MEE A;  4FLW A;  4FLU A;  3VA0 A;  4CF0 A;  5CY4 A;  4I7F A;  4DSE A;  2KFN A;  1HNV A;  4CJW A;  3IG1 A;  1SV5 A;  4AIL C;  2FBT A;  1NK0 A;  2PZS A;  4CJL A;  1X1P A;  1RBS A;  1TKT A;  3CM6 A;  1QSS A;  1JLC A;  1SL2 A;  4DWI A;  4KAZ A;  4W5Q A;  1RNH A;  3O4N A;  1K6Y A;  4UQG A;  3M8P A;  1RT6 A;  4Z4G A;  4DS5 A;  2YHA A;  1JLA A;  4CEC A;  3KJV A;  5JS1 A;  1WSE A;  3DMJ A;  1HRH A;  1EX4 A;  1F21 A;  1D9D A;  1TK8 A;  3TAF A;  4CJV A;  4IG0 A;  1HNI A;  5J1E A;  3OYB A;  1U4B A;  1N6Q A;  4OLA A;  1XI1 A;  5HBM A;  2YHB A;  3ZCM A;  4XIU A;  4ID5 A;  1KVB A;  3LAN A;  3HPH A;  4FXD A;  4DU1 A;  3K2P A;  2IDO A;  3QIP A;  1DLO A;  1MU2 A;  1BI4 A;  1BHL A;  4I2P A;  2HMI A;  4CJR A;  4O55 A;  2WON A;  4DFM A;  2IGI A;  1RBT A;  4LH4 A;  4B9U A;  4FM0 A;  4E7L A;  4M3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...