3AVNA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avnA00
2YHAA 1LAVA 1Q8IA 2KQ2A 3QETA 1BQNA 4CFAA 3QINA 4CJEA 1RILA 4E1NA 1VSJA 1RTJA 3T1AA 2AJQA 4KV8A 1KTQA 3HPGA 4BDYA 2HHTA 2B5JA 4DQSA 2QK9A 4ICLA 2XO7A 2FBXA 2PYLA 2D0CA 3S3NA 4H4MA 4BWMA 3TAEA 5E41A 1Z25A 1TKDA 4CEEA 3D0PA 4B9TA 4PWDA 4CEQA 1TL1A 1RCHA 3MAQA 3DLBA 3M8PA 1J5OA 1QTMA 4FJHA 4CGGA 4B9SA 3OJUA 4F4KA 1LW0A 1SKRA 1ZBUA 4FJNA 4O0JA 3MXJA 4Y1DA 3DLGA 4N56A 4DF8A 4ZTFA 1HYSA 3LP0A 1BHLA 4DU1A 1WSIA 4CECA 1S1WA 4R5PA 3OYNA 5HBMA 4KPYA 1HMVA 4KHSA 1S6QA 3KKSA 3V1QA 3VN5A 5HRNA 3OYMA 4CGHA 3SJJA 1C1AA 2OPQA 3HP9A 4O5BA 3SV3A 4ZTJA 4B9LA 4IG0A 2Y1IA 4DQPA 3LPUA 4HCCA 4FJIA 1W0HA 2FBVA 1J54A 1CZBA 4LY7A 4E0DA 2HHWA 4LSLA 3L2VA 3TAPA 4AHVA 4FJGA 4IKFA 4JRQA 3PV8A 1B92A 3DLEA 2YHBA 1IKWA 1LV5A 4W5OA 3AVHA 3ZSWA 1W9HA 3QEWA 4KREA 4KKOA 4F8RA 4N41A 3AA3A 1ASUA 1QSYA 3LP3A 1I3AA 4E7IA 4M3WA 4CJRA 5HROA 4CCHA 4J2AA 3LANA 2VG7A 4FZZA 1UWBA 1VRUA 3KLHA 4BDPA 5JS1A 4CK2A 4CJWA 1WAJA 4DS5A 4B9MA 4E7KA 3KLEA 1KSPA 2DY4A 1UA1A 4WE1A 1UOCA 5KTQA 4DFJA 1HYVA 4KFBA 2HVHA 4DTSA 1TK0A 1T8EA 4M41A 4E89A 1FK9A 1YTAA 3TI0A 2HW3A 1ASWA 4CHQA 3M8QA 3ZT0A 4BE2A 2HVIA 4HTUA 1JXBA 3NF8A 2WONA 3MXMA 4I9QA 3OS0A 4KHYA 3NGIA 3ZCMA 4JLHA 3RRHA 2O4IA 4FZYA 3RRGA 5HLFA 4HHTA 4Y1CA 3F73A 3SCXA 2G8KA 3WNGA 3OY9A 4FZXC 3L2RA 3DLHA 3MXIA 4EZ6A 1BIZA 4G1QA 4NCGA 3K57A 1Q9XA 2BGGA 2OPPA 4TSXA 4DQIA 1WLJA 2E6LA 4CFDA 2W42A 1R0AA 1CLQA 4CJ5A 1G15A 1C0TA 1RT4A 3VQDA 3OS1A 4JS5A 3K5OA 1LWFA 1EP4A 1BI4A 5KRTA 3VQEA 3SUNA 1QSLA 3ZSXA 3SUQA 2ATQA 4CGFA 3IRXA 2BDPA 4FJ7A 1I39A 3ASMA 3NCIA 4CJVA 5HRPA 4N47A 3I8DA 4O0IA 4FJ5A 4W5RA 1JLQA 1U04A 1J53A 1IKVA 1BGXT 4O4GA 4OVLA 4F2SA 2B4JA 3AO5A 2HHUA 3JSMA 2GUIA 1LWCA 4CEZA 2HNDA 3CFOA 3WNHA 1HQEA 4DTJA 1YTUA 3BGRA 3LAMA 3V4IA 4KO0A 2OZSA 1BCOA 2XY8A 3VQCA 2PY5A 2KW4A 4ELTA 2F8TA 3LDSA 4CF8A 1WSEA 3HM9A 4CGDA 1XWLA 2HHXA 4DFPA 3OYBA 3HYFA 4NYNA 4HUEA 1B9DA 4LH4A 5K14A 3L2QA 2Z1JA 3TR8A 3G10A 1REVA 3K5LA 4CJTA 3SUOA 3ZT4A 4CHPA 3RMBA 1LAWA 2YNIA 3ZSZA 1SUQA 3SZ2A 4DTXA 2QKKA 4FK2A 5KGWA 3AVLA 1VK0A 4CJKA 1D5AA 1RBSA 3QLHA 1NJYA 1TKTA 1VSDA 1VSMA 4MQ3A 5J2PA 3QERA 4FCYA 3ZSOA 2VG5A 4OPKA 3SI6A 4KHQA 2QXFA 2IOCA 3SYZA 4NCBA 1O1WA 3I0SA 5JS2A 4O55A 3CM6A 5HRRA 2G8VA 1JKHA 3HL8A 3O3HA 3P83D 2ITGA 5FROA 2NUBA 1KLNA 2D0AA 4OPJA 3KLFA 4KB1A 3PX0A 1KVBA 1GOAA 3KIOA 1RBUA 3THVA 3ZT3A 2G8IA 3B6OA 2ZQBA 3HXMA 4AILC 1KVAA 1NK8A 1TK8A 1KLMA 3QNNA 1A5VA 3NGYA 3P5JA 3O3FA 1HYZA 1VSEA 4ELVA 3VQ6A 2X74A 3NBPA 3NAEA 3RTVA 3V9XA 4Z4EA 2RF2A 3EZ5A 2D5RA 2WOMA 4IFYA 4DSEA 4FXDA 1D8YA 3SNNA 2ZD1A 2IS3A 1JLGA 2YNHA 4CEBA 1A5XA 3AVGA 1EXQA 4CF1A 3K58A 4C8LA 1TVRA 4DQRA 4M3YA 3SPYA 4B8CA 2G8HA 4IBNA 2QKBA 4E7JA 2P1JA 3VQQA 1YT3A 4DFKA 3V9UA 4E7HA 3QEVA 1GOBA 3LWMA 2XY6A 2BE2A 4RW7A 2IC3A 2RKIA 4E3SA 2KFNA 4RW4A 4B9VA 3HP6A 1QSSA 4W5NA 1JL1A 1ZBHA 1S1XA 3ULDA 1KFDA 1S9EA 4CJ4A 3EYZA 1L3SA 4DSKA 4HUFA 1BL3A 1RT6A 4F3OA 4Z4FA 4I2QA 1U47A 4CJSA 3V9SA 5EU7A 1SKWA 4M3ZA 2X6NA 3HVTA 1Q9YA 1FKPA 1JLEA 1LW2A 2EHGA 3VQ5A 3S9HA 3AVKA 3C6TA 5CYMA 3L2WA 4Z4IA 4PQUA 4M42A 1C1BA 2JGUA 2A1RA 3QESA 4LD0A 2VG6A 1X1PA 1JLAA 1IH7A 5J2MA 1VSLA 3VA3A 2XHBA 3O3GA 3CYMA 1L5UA 2PZSA 1NOZA 3KD1E 4QAGA 5CY4A 4IDKA 4CGJA 1WSHA 1EX4A 4M3UA 2HHQA 5KGXA 4FK4A 3AA4A 4RG8A 1NKEA 4FM1A 1RT5A 4OGEA 2P5GA 3L3VA 3FFIA 1WAFA 3UIQA 1WSGA 1A5WA 3L2UA 4DU4A 1IKYA 3LZIA 1RT1A 4QCLA 1TAQA 3NH2A 4EP5A 1WSFA 5KI6A 3U3GA 4HCBA 4CFCA 2X78A 4DTMA 2DFEA 3LP2A 5HP1A 4FW1A 1NJXA 4KHUA 2YNGA 3C94A 4AH9A 1SL0A 3AVMA 4CE9A 3AV9A 3NF7A 4AHTA 3AO2A 4E1MA 3T3FA 1D9FA 3NF6A 3T19A 1XC9A 1HNIA 4F2RA 4NYFA 3MEEA 1YVUA 3QIPA 3NH1A 1QQCA 4FLVA 4J2EA 3HO1A 1C6VA 4Z4CA 4K8XA 1RDCA 3V81A 4KTQA 4M3XA 3HSTB 1N5YA 3NDKA 4IFVA 1RDAA 3HVRA 2F8SA 4CIFA 3QIOA 4FJ8A 3AA5X 3IG1A 3DRRA 4FM2A 3OS2A 2LSNA 1UAXA 2JLEA 3MEGA 3SV4A 1JLFA 2Z1HA 3AVFA 3VQPA 1DTTA 3KK2A 4CHYA 4KHNA 3SUPA 2Q3SA 5SZTA 4HUGA 1VSHA 4DG1A 1NKBA 3ISNC 3LAKA 5J2QA 1NK7A 5T7BA 4F3TA 3VQBA 2D0BA 4AHUA 3WNEA 3LWLA 4DSFA 4W5QA 5I42A 1J9AA 1RT2A 4FLTA 1VSIA 4KHWA 4ID5A 1U45A 3HK2A 3I0RA 4CF2A 3PUFA 4FJLA 1C0UA 4OGCA 3K5NA 4B9UA 3AVJA 3OYKA 1MU2A 2VWJA 3HT3A 2F96A 3ALYA 1TKZA 4YFUA 3TWHA 1WSJA 3G0ZA 4I7FA 2G8WA 2XY7A 3DLRA 1NK0A 4FJ9A 2DFFA 3O4QA 4GVMA 1RTIA 2VWKA 5CYQA 4CK3A 5I3UA 4FJMA 3AVCA 3SQ1A 3AVNA 1KCFA 1L3VA 2FBTA 4IG3A 4CJ3A 3AVIA 4Z4HA 4EZ9A 4PY5A 2Y1JA 1L3UA 1NK6A 1WN7A 2HHSA 1X9SA 4DSIA 4OLAA 3CM5A 4GW6A 2XY5A 3S3MA 4PUOA 3C95A 2YV0X 3VQAA 3SPZA 4C8MA 3OJSA 4CEAA 4B08A 3KK3A 3TABA 2OYQA 1S9GA 1RTDA 2EX3A 1ITGA 4CJFA 5C25A 1HRHA 1U48A 3V9ZA 3SQ4A 4J2DA 1HNVA 1CXQA 4CEOA 1Y97A 3M8RA 3PX6A 4J2BA 3V6DA 4DF4A 4CJPA 3NE6A 5FRNA 1RNHA 4M3TA 2KZZA 3RMDA 1LWEA 4CJQA 1RBRA 2HNZA 4O44A 1DLOA 1DTQA 1QHTA 4KTZA 3NHGA 4ZHRA 3L8BA 3CFRA 3LP1A 1VRTA 4B8AB 4DU3A 3RMCA 2HMIA 3DM2A 2RPIA 3H08A 4CJLA 3LZJA 2IDOA 3ITHA 3SQ0A 3V1OA 3OYLA 4DLGA 1B9FA 3LALA 3DI6A 3TAQA 3S3OA 1WNSA 2YNFA 3U6FA 3TAFA 1K6YA 1SL2A 3BDPA 4L8RB 3C6UA 3P1GA 4BDZA 1CZ9A 4ELUA 1ZBLA 2IGIA 3OYHA 1TV6A 4FLUA 4KTWA 1NJWA 1RT3A 3ZSVA 3PX4A 4C8KA 1XHXA 1ASVA 4CIEA 2Z1GA 4LH5A 1S1TA 3CG7A 1NOYA 1T05A 3AA2A 4DLEA 1XI1A 3MECA 3NH0A 3OVNA 3LPTA 4CF9A 3ZT2A 4CHNA 3CQ8A 2OZMA 1IO2A 1FKOA 1C1CA 3VQ7A 1SL1A 4CESA 4DS4A 1X9MA 1T7PA 1QS4A 4MFBA 3K2PA 3OYIA 1BCMA 3IAYA 1D9DA 1KVCA 4CK1A 3V9WA 4UQGA 1RBVA 5CZ2A 3NGZA 5FDLA 4DTNA 3KK1A 4DWIA 4I9LA 1EKEA 1S1UA 1UA0A 2I5JA 3KKRA 4LSNA 4CJUA 5HRSA 1KRPA 4FLZA 4FVMA 4Q5VA 4FJKA 4BWJA 4OKJA 3OYJA 4OLBA 2G8FA 2DFHA 2IAJA 2P51A 4DTOA 2KFZA 1ZBFA 3DRPA 3D45A 4OJRA 1NK5A 1JLCA 3QEXA 1BQMA 2OPRA 4N76A 1XHZA 4FK0A 4E19A 4EP4A 4Z4GA 4Q0BA 4KI6A 5J1EA 4OKKA 3QNOA 4M45A 4AHRA 4CGIA 2GBZA 2O4GA 3ZSYA 1TK5A 3OYFA 3TANA 3V1RA 4CEFA 3SQ2A 3ZSQA 4DTUA 3E01A 3VQ8A 3KLGA 4K8ZA 3QEIA 4YNQA 4FW2A 4JRPA 4FLWA 4B9NA 1HJRA 2XRIA 4CIGA 5D3GA 1TKXA 3KD5E 4H8KA 4OKEA 1S6PA 1BI4B 3IS9A 3O4NA 1Z26A 3ZT1A 3AO1A 1RTHA 2ZE2A 4RW9A 1SKSA 2FC0A 3CFPA 2Z1IA 4CHOA 3RMAA 2FBYA 1S5JA 2KTQA 4N5SA 3KJVA 2A1SA 3AO3A 4KAZA 2DTUA 1HQUA 3NF9A 1CXUA 4I2PA 4FLXA 3TARA 4C8OA 1EETA 4CF0A 1U49A 1VSFA 2HB5A 3JYTA 4DTRA 3OYEA 4BE0A 2X6SA 4KRFA 2PYJA 3U3YA 1TL3A 4DTPA 3DRSA 3QEPA 4W5TA 2HHVA 4DMNA 3DOKA 3MEDA 4RW6A 4CEDA 4BACA 4FLYA 1U4BA 1RT7A 1NK4A 1ZBIA 4FJJA 4B3OA 3HPHA 3NFAA 3KLIA 2YKMA 4DFMA 3PO5A 3PO4A 2HNYA 5DK5A 3M8SA 1JL2A 3ZSRA 3RWUA 1TAUA 3AO4A 3K59A 5SWMA 3OYDA 3VA0A 3RR7A 1C0MA 2E4LA 2GV9A 1NK9A 4FYDA 2ETJA 5KRSA 1T03A 2KZMA 4KB0A 2BANA 3L3UA 1NKCA 1KFSA 2R7YA 3F9KA 1HPZA 5DMRA 4DQQA 1S1VA 2G8UA 3HJFA 3OYGA 5C24A 1IG9A 4H4OA 3DLKA 3DOLA 4BE1A 4DSLA 1VSKA 3AVBA 3TAMA 1N6QA 3KTQA 3HPOA 2YKNA 3VQ9A 4GMJB 1NJZA 2P5OA 1RDBA 1ZYQA 2OA8A 3EY1A 3B6PA 1F21A 4ID1A 1BISA 5FRMA 2OPSA 1X9WA 4DSJA 1BIUA 3RR8A 3OYAA 2RN2A 4AHCA 3DMJA 5J2NA 3QO9A 1JLBA 4FM0A 3TAGA 4C8NA 4JS4A 5C42A 1FXXA 4Z0UA 3WNFA 4NCAA 4KI4A 4CFBA 1RBTA 1JXEA 1IKXA 4CHZA 3OYCA 3VQ4A 3PY8A 3K5MA 4FJXA 1SV5A 3DYAA 4AHSA 4CERA 4XIUA 4E7LA 4RW8A 5CZ1A 4M3RA 4QOZB 4PA1A 1TGOA 1RDDA 4HVJA 3AVAA 1L3TA 1QE1A 1GOCA 2E6MA 3A2FA 2B6AA
chains in the Genus database with same CATH superfamily
1OVYA 4JI2K 1BQNA 4CFAA 2WTUA 1GLCG 1VQ6N 3WUHA 2HHTA 3IKMA 4DQSA 3BF1A 2D0CA 4K42A 4BWMA 3TAEA 1TKDA 1Z25A 4H5WA 1QZ5A 4CEEA 4GKJK 3M3ZA 4CEQA 1TL1A 2QWMA 3AY9A 1QTMA 1NMNA 3F9MA 3JXUA 4B9SA 3OJUA 1LW0A 4FJNA 4Y1DA 3DLGA 3VEVA 4C1NI 4BR0A 1WSIA 4DU1A 1S1WA 4R5PA 3LDPA 3M5RA 1S6QA 3VN5A 3SJJA 2OPQA 2ZJPL 4RTFD 1K8KB 4B1YB 3TAPA 3O9SA 5BREA 4JRQA 4IEEA 3PV8A 4W5OA 1M90O 1QSYA 3ZYYX 1I3AA 4E7IA 4H0TB 3LANA 3CJBA 1UWBA 4PHTX 5JS1A 3VESA 1JJ2M 3KLEA 3K9JA 5ADXA 2HHHK 1YTAA 4IXCA 4YORA 4CHQA 2E2PA 3ZT0A 5H1SQ 1BA1A 3NF8A 3AAPA 3E9PA 2EWSA 1BG3A 4JI4K 3NGIA 3RRGA 4XH4A 5GAGP 2E88A 3SCXA 4FZXC 3DLHA 4NCGA 3K57A 1IBKK 3RSEB 4DQIA 1WLJA 2E6LA 4JKCA 1R0AA 1G15A 3OS1A 2GELA 1LWFA 4XH1A 5KRTA 1WOQA 4BR9A 1J6ZA 3OBWA 3AGKA 5FPEA 1J5EK 3SAHA 3SUNA 2FF3B 4CGFA 4OX9K 4H5VA 4X64K 2ZGYA 5HRPA 2QTDA 1XQSC 1OH7A 1U2VB 1J53A 4O4GA 1BGXT 3MWTA 4F2SA 2D0PA 2B4JA 2HHUA 3CQXA 5JVHL 4O8UA 1BO5O 5LJVA 4BROA 1YTUA 3V4IA 2OZSA 4JKEA 1NGBA 3LDSA 4CF8A 4CGDA 1XWLA 1VQ8N 1HUXA 3OYBA 1REVA 4CHPA 3RMBA 3ZSZA 3A5NC 5KGWA 3AVLA 3F5TA 3DAWA 1TKTA 1VSMA 2GWKA 3SAFA 3QERA 3TSPA 4KHQA 3O4WA 5AQHA 1CZAN 3U9DA 2G8VA 2D0AA 1NGDA 4KB1A 1T44A 3BUZB 3PX0A 2ZM6K 4DR3K 3B6OA 2QWLA 1KVAA 1A5VA 3P5JA 3FR0A 5BN9A 1VSEA 1JCGA 1MWMA 3NBPA 3VQ6A 3V9XA 3CF5L 1A5XA 4B9QA 2E1YA 1EXQA 4CI6A 1TVRA 3DLLL 4IBNA 4MDAA 2P1JA 5AQVA 4U67L 2QWPA 4BRIA 4E7HA 2BE2A 1GLBG 3C7NA 3DXKA 3CC7N 2IIRA 2P9SB 1QSSA 4LFAK 4W5NA 1JL1A 1KFDA 1L3SA 2UUBK 4HUFA 5LL6Z 4Z4FA 3DXMB 3CCLN 4I2QA 3MX2A 4CJSA 2O8BB 1SKWA 2X6NA 1JLEA 2EHGA 5AQWA 3VQ5A 2YJFA 3WEEA 4AM6A 2O8FB 3PIPL 3AVKA 4M42A 1RGIA 3QESA 2XHBA 2PZSA 4DHYA 3CMAN 5AZJB 4CGJA 1EX4A 4FK4A 4RG8A 1NKEA 4OGEA 4IFEA 3FFIA 1WAFA 3L2UA 1IKYA 2YJEA 2CGLA 1NGEA 1WSFA 2DFEA 4FW1A 2YNGA 4CE9A 4KHPK 1D9FA 5AQLA 3J7AP 1C0GA 4CZGA 4J2EA 4FLVA 3V81A 2Q0UA 1M1KO 4KTQA 4IFVA 5HOOA 3AA5X 3DRRA 3ZEUA 1UAXA 1EQYA 1JLFA 2Z1HA 5JLFA 3SV4A 2ASOA 3LDOA 4LF9K 3SUPA 3CI5A 5SZTA 1VQPN 1Q81O 1V4TA 4GV9A 1MA9B 4I6MB 3WXLA 3VTHA 5CHIA 3LWLA 5E84A 4KHWA 4ID5A 5FPNA 1XUPO 1C0UA 4JV5K 2O8EA 3HT3A 1BUPA 3ALYA 1TKZA 1KD1O 4I7FA 2G8WA 3DLRA 4GKKK 4EAHD 4GVMA 2OTLN 5CYQA 4LF6K 4FJMA 4YDUA 1VQLN 3AVNA 1L3VA 2FBTA 3AVIA 4Z4HA 4PY5A 2Y1JA 1NK6A 3P4IA 4PUOA 4BRNA 2W6LA 3OJSA 4H0VB 4FOIA 3KK3A 3CETA 3TABA 2O8DB 5C25A 4RWTA 5EX5A 3SQ4A 3E1YA 1Y97A 2P9KA 3M8RA 4J2BA 4AQYK 5CE3A 5FRNA 4M3TA 3P31A 4WFAL 2KZZA 5A2QO 2FLOA 1LWEA 4CJQA 3ENOA 4J8FA 4JKAA 1HKCA 4K43A 1QHTA 1DTQA 4KTZA 1Z05A 2BH1A 4CBWA 5I9EB 3CFRA 1VRTA 4DR2K 3GE1A 2RPIA 2IDOA 3ITHA 4IOXA 3V1OA 4DLGA 1B9FA 3DI6A 3S3OA 2YNFA 3AARA 3TAFA 1K6YA 4WYBA 5TKYA 4M7YA 1CZ9A 4PKGA 1ZBLA 2WC9A 3CCSN 1TV6A 3MX5A 4KTWA 1NJWA 1RT3A 3PX4A 4C8KA 3I8BA 3KZBA 4LF4K 3CXCM 1NOYA 1IBMK 3NH0A 1FKOA 3VEYA 4ILGB 1HLUA 4CESA 4DS4A 4MFBA 3K2PA 1IV0A 4DR1K 1X9JA 1NBWA 5KQDA 3V9WA 5CZ2A 5FDLA 1EKEA 3KKRA 1KRPA 5HRSA 4FLZA 5M1OA 4OKJA 3OYJA 3N4QA 1HKGA 2G8FA 4DTOA 3DRPA 3D45A 1SAZA 3QEXA 1NK5A 1BQMA 4N76A 1XHZA 5AQZA 3EN9A 3VF2A 4FK0A 4KI6A 2F9WA 3K0SA 4AHRA 4H0OA 3U4LA 1Y64A 4CEFA 3HBTA 3ZSQA 4OKEA 1S6PA 1SKSA 5AQPA 2FC0A 2Z1IA 4JKDA 2FBYA 4N5SA 5BPMA 3AO3A 4FLXA 2ZJRL 1EETA 2GUPA 2KKZA 1U49A 1NGAA 1VSFA 2HB5A 4GV6A 5M1FA 4CW7B 2HSTA 4H5RA 4JI1K 3MN9A 4DCHA 3WQTA 4U7BA 4W5TA 3QEPA 4JN4A 3DOKA 3HI0A 1U4BA 4BACA 3ZX2A 1RT7A 2QI2A 3NFAA 1QQMA 2HNYA 1JL2A 3RWUA 4EIAA 4JKGB 5SWMA 3RR7A 2E4LA 4DR7K 4KB0A 3F9KA 4CZMA 1HPZA 5BN8A 3O1BA 5C24A 4H4OA 1ZC6A 4BE1A 3BZCA 1VSKA 3TAMA 1TYQA 2A5XA 1NJZA 1MDUB 1N33K 1F21A 3I33A 1BISA 3IDHA 3H3OB 3D2EA 5AQQA 2RN2A 4AHCA 1ZXOA 4FM0A 3CC4N 4C8NA 4Z0UA 2E1ZA 4CFBA 1WBDA 3ENHA 4WCEL 4B3SK 1SV5A 5KPRA 4CERA 3VGKA 4PA1A 1ATNA 3AVAA 1ZBIA 1YF5L 2YHAA 1LAVA 1Q8IA 4R79A 4CJEA 3QINA 2Q36A 3CCMN 1R59O 4BDYA 2XO7A 4H4MA 4LC9B 4A5AA 2UU9K 2FSNA 3BEXA 2E2QA 4PWDA 4YY3K 3M8PA 4DV1K 3M6GA 4KH5A 3WEEB 1SKRA 1HYSA 1VHXA 4KPYA 4BGAA 5HBMA 1HMVA 5LY3A 5HRNA 3KKSA 3V1QA 3EZWA 1E4FT 3HP9A 4O5BA 3SV3A 4IG0A 2Y1IA 1NWKA 4DQPA 4E0DA 1CZBA 4LSLA 3DLEA 1IKWA 3THYA 2P9NB 3WXJA 2GWJA 3ZSWA 4E1JA 3QEWA 4KKOA 1ASUA 4M3WA 5ADXH 1KAYA 3D2FB 3KLHA 5M1KA 4E7KA 1KSPA 3R6MA 1UA1A 4WE1A 5KTQA 4DFJA 4Y0WA 4KFBA 5KPTA 3TTCA 4E89A 2OTJN 2HW3A 5C10A 2V52B 3ZEUB 3M8QA 1Q86O 4HTUA 1JXBA 5AQFA 5IT9O 4FSVA 5DM6L 4KHYA 3RRHA 4F9OA 2O4IA 4DR4K 4BRHA 2IVPA 3G6EN 4G1QA 2BGGA 4TSXA 1YITN 2IVOA 3K5OA 1BI4A 2VGMA 5BR8K 2O8EB 3ZSXA 3SUQA 2ATQA 3QBXA 3IRXA 4FJ7A 1HNWK 1EWQA 5AQRA 4O0IA 3JSMA 2GUIA 4CEZA 1ATSA 3CQYA 4IJNA 1YIJN 1HQEA 4DTJA 4XH5A 1ESVA 1BCOA 1T6DA 2PY5A 4LFCK 2YHYA 3HM9A 4DFPA 2P9KB 4RCHA 3TTDA 3HYFA 4LH4A 3UKRB 3L2QA 2UUCK 2Z1JA 3TR8A 5C12A 3G10A 3K5LA 5AQTA 4FK2A 1SUQA 3SZ2A 1TUUA 2QKKA 4BG8A 4CJKA 1D5AA 3QLHA 1NJYA 3GDQA 2WBNA 1O13A 2P9LA 4MQ3A 4B3TK 4QS9A 3TSUA 3VMFB 2VG5A 3SI6A 3SYZA 4NCBA 1O1WA 3I0SA 4DV4K 2I7NA 3P83D 2BUPA 3J7ZO 1GLLO 1KLNA 3VGMA 1GOAA 1RBUA 3ZT3A 1NK8A 1TK8A 3QNNA 4BQZA 5GINA 1HYZA 1VQON 4Z4EA 3EZ5A 2D5RA 4IFYA 2ZD1A 1U6ZA 2IS3A 1VQNN 4OPAA 2AP1A 3SPYA 1W7AA 4B8CA 3IUCA 3VQQA 5LJWA 4DFKA 2HBMA 3Q7BA 1GOBA 2XY6A 4RW7A 4JI7K 2IC3A 2KFNA 4RW4A 3WXKA 4B9VA 4LFBK 4FVUA 2WFBA 3ULDA 5BRFA 1S9EA 4CJ4A 2VWBA 1BL3A 1RT6A 3FLCO 4F3OA 2QA4N 3V9SA 3H45C 4DQ8A 1RDWX 3ZX3A 1FKPA 5AQSA 1WUAA 3VTIA 4CZJA 4PQUA 3G71N 2QM1A 2A1RA 4LD0A 1X1PA 5FPMA 1L5UA 3KD1E 4IDKA 2YHWA 2HHQA 1N32K 5KGXA 1QZ6A 4FM1A 1ILYA 1WSGA 3SBGA 1A5WA 2ASMA 3LZIA 4QCLA 1H1VA 4DV7K 4HCBA 4CFCA 1NJXA 1NGHA 3MDQA 4BVOA 3G25A 3T19A 4F2RA 3MEEA 1YVUA 3QIPA 3NH1A 1C6VA 4Z4CA 3O9UA 3HSTB 5JLHA 3NDKA 1OKJA 3HVRA 4FJ8A 4JI8K 3IG1A 3KWIA 4FM2A 5EY4A 3C65A 2LSNA 2JLEA 2A42A 5C15A 3CHWA 1WBBA 4KHNA 3ISNC 2KLAA 1NK7A 2A6AA 1NMDA 1BWFO 3VQBA 4DKWA 3U9ZA 4AHUA 3WNEA 1RT2A 4IZ9A 3D2EB 3HK2A 3I0RA 3VEWA 4CF2A 4DV6K 1XMQK 4UY8O 3K5NA 3AVJA 3SMPA 3OYKA 4CBUA 4FPBA 1NNEA 5AFUA 1WSJA 2A40A 4KH4A 4FJ9A 3H1VX 5I3UA 2VWKA 3DWLA 3AVCA 3SQ1A 3EL2A 1L3UA 3THXA 1X9SA 3HTVA 5EXWA 4WQ5C 3VQAA 3SPZA 2W41A 4C8MA 4K25A 1S9GA 1RTDA 2EX3A 1ITGA 2ZF5O 1HRHA 4J2DA 2NRWA 4CEOA 3PX6A 2OANA 1DGKN 3RMDA 3M1FA 1RBRA 4Z94A 1QHAA 4O44A 4YDUC 4ZHRA 3LP1A 2HMIA 4B8AB 4CJLA 2D0OA 3LALA 1YXQA 4YOXA 3VEZA 5AQMA 3TAQA 3U6FA 4PL8A 1NLVA 1SL2A 2NRZA 3ULEB 4L8RB 4BDZA 4BRKA 3OYHA 4FLUA 1I94K 3CJ9A 3ZSVA 1XHXA 4CIEA 3THYB 2HBKA 4LH5A 1EWRA 3CG7A 3AA2A 3MECA 3OVNA 4CHNA 3EEQA 1IO2A 3LM9A 1SL1A 3CJAA 1T7PA 1QS4A 3O9QA 3OYIA 1WB9A 2ZGZA 3E9LA 3IAYA 1RBVA 4DWIA 4DTNA 4ISFA 3KK1A 4I9LA 1UA0A 4BRGA 4FVMA 2H3GX 2A3ZA 2P51A 2KFZA 1ZBFA 4OJRA 3MCPA 4E19A 4Z4GA 2YCHA 1S3XA 3ZLJA 3QNOA 2O4GA 3TANA 1E3MA 1N34K 4K8ZA 1LCUA 4FW2A 1NG9A 4CZEA 1Q7YO 1HJRA 4CIGA 4H8KA 3PIOL 1BI4B 3T69A 4A57A 1Z26A 2NRRA 3ZT1A 4RW9A 3PSFA 4BRPA 1X3MA 3H6EA 3CFPA 3RMAA 3KJVA 4KAZA 2DTUA 3NF9A 3TARA 4B3MK 4JHDA 2X6SA 3R3LA 4JAXA 4C23A 3U3YA 1TL3A 5M1PA 4OPHA 2HHVA 2A41A 4MDBA 4DMNA 1NK4A 4FJJA 2YKMA 3H3NO 3FE1A 3K59A 3OYDA 4KBOA 2GV9A 4CZFA 4FYDA 2ETJA 5KRSA 3HSCA 2BANA 1VQ4N 4ILHA 3OYGA 2QWRA 1YUWA 4EFHA 3AVBA 1N6QA 3P39A 3KTQA 3I56N 4NXNK 3VQ9A 1RDBA 1ZYQA 3PLAA 1X9WA 1BIUA 2UUAK 3RR8A 3OYAA 4WF9L 4JS4A 3CPWM 1FXXA 4JI6K 4CVNE 4BC4A 3W3DA 3VQ4A 3PY8A 4FJXA 4E7LA 5CZ1A 4HVJA 1RDDA 2UYTA 1L3TA 1QE1A 3CERA 2B6AA 2KQ2A 4FOEA 5AR0A 3D6RA 3VPZA 4E1NA 3J7YP 2B5JA 1K8AO 2QK9A 1HJOA 5C2FA 3S3NA 2JWKA 2GX9A 5E41A 5AQYA 1RCHA 1Z6RA 4CGGA 4FJHA 3BY5A 5D3GA 4O0JA 3D7EO 4N56A 4DF8A 4JK8A 4CECA 3OYNA 4KHSA 3GOIA 4CGHA 4ZTJA 2YI1A 4B9LA 4HCCA 3LPUA 2FBVA 4FWPA 4LY7A 2P9UA 4FL9A 3CJ1A 4FJGA 4JK9A 2Q97A 5C0YA 1RFQA 3VEXA 2OCEA 1KQSM 4N41A 3QB0A 4B1WB 4CJRA 5HROA 5BR9A 4FWOA 4CCHA 4J2AA 2D4WA 3B8AX 3UKUA 2VQEK 4CK2A 4BDPA 4CJWA 1VAZA 3FZHA 4B9MA 2DY4A 1K8KA 3JAMO 2HVHA 3ZETA 4CBXA 1FK9A 3G4SN 1ASWA 4PKHA 4X62K 3CJ7A 3AGRA 3ZCMA 4JLHA 4FZYA 5HLFA 3F73A 2G8KA 3WNGA 3MXIA 1GLAG 1Q9XA 2OPPA 4CFDA 2W42A 3L4QA 5AQNA 3E66A 3CJCA 4CJ5A 5MLCQ 3VQDA 4JS5A 1OH8A 1YHQN 1EP4A 4M63C 1QSLA 1I39A 3ASMA 4JNEA 4CJVA 2YHXA 4FJ5A 4W5RA 3O5BA 3CCEN 2CH5A 4NXMK 4BRQA 1LWCA 2HNDA 2NZTA 3CFOA 2NRXA 4QS8A 4JI0K 3BGRA 3LAMA 1YJNN 2VGNA 3VQCA 4ELTA 2FSKA 1Q18A 2JWLA 2HOEA 3BF3A 3O08A 4K0KK 5K14A 3C6AA 4IJAA 4CJTA 1LAWA 2YNIA 4DTXA 4BRCA 1U2VA 3Q7CA 1VSDA 4BR5A 4FCYA 1QVFM 3ZSOA 4OPKA 2QXFA 2IOCA 4BR7A 3O1WA 2I7PA 4IEIA 3TU5A 4O55A 2E2OA 3CM6A 4K41A 5HRRA 3O3HA 1YJWN 2ITGA 1QQOA 5FROA 3LDQA 2NUBA 3SJHA 4OPJA 3KLFA 4DV5K 1KVBA 3THVA 3C7NB 3DXKB 3HXMA 2ZQBA 1KLMA 3NGYA 4DUYK 3O3FA 3FZFA 4BC5A 2X74A 3F2KA 3NAEA 3RTVA 2WOMA 4B1UB 4DSEA 4FXDA 1D8YA 1JLGA 2QWNA 4CEBA 5ELZA 4CF1A 2Q1NA 4C8LA 3NVKA 4DR5K 3U8XA 2QKBA 5F2RA 3V9UA 2E8AA 3LWMA 1GLDG 4WQ4A 5AQUA 2RKIA 2CGJA 3HP6A 3P38A 1S1XA 1HX1A 1NGFA 4BREA 3EYZA 4FWLA 4FWSA 5EU7A 1NM1A 1LW2A 3L4IA 3J81O 4JYAK 3L2WA 5CYMA 3ENBA 1C1BA 2JGUA 3UE5A 2VG6A 1JLAA 1E4GT 3VA3A 3O3GA 4YOTA 1NOZA 5AQOA 1VQMN 3KHYA 2UXBK 5CY4A 1WSHA 5M1QA 3AA4A 2P5GA 3MWPA 2F4VK 3L3VA 4JI5K 3TSQA 3A5OC 3DXMA 1RT1A 1TAQA 3NH2A 5KI6A 3U3GA 2X78A 4DTMA 3LP2A 4IDHA 3C94A 1SL0A 2PBDA 3T3FA 2ASPA 2O8FA 1GLJO 1XC9A 1HNIA 4NYFA 3H46O 3TTFA 3HO1A 3O6WA 3WQUA 1LOTB 2V7ZA 1RDCA 4M3XA 1RDAA 3T7ZA 1KC8O 4CD3A 5AQXA 4YOUA 3W0LA 5TKWA 3MEGA 2ITMA 2E20A 3UB5A 3VQPA 1DTTA 2Q3SA 1S72N 3MMVA 3LAKA 5J2QA 1SZ2A 2J4RA 5KQ8A 4W5QA 4XEIA 5I42A 1J9AA 4FLTA 1VSIA 1U45A 3CCJN 3QBWA 5AQIA 4OGCA 4B9UA 2P9PA 1MU2A 2VWJA 4X66K 1N8RO 2NNWA 2F96A 3HOSA 1QQNA 4YFUA 3TWHA 1P8ZA 3GBTA 5DM7L 4CK3A 3LDLA 1ZBSA 4EZ9A 4CJ3A 4BVPA 1NGJA 1WN7A 4I6MA 4OLAA 3C95A 2YV0X 3CCRN 4B08A 4DB3A 1U48A 2D1KA 3V9ZA 1HNVA 1KAZA 3WXIA 3A8YA 3V6DA 3HZ6A 3KK7A 4CJPA 3NE6A 1RNHA 3LDNA 3ATUA 4A62A 3TPQA 1DLOA 2HF4A 3GL1A 3NHGA 4DU3A 3H08A 4BRDA 3OYLA 1FJGK 5GIOA 4DR6K 1WNSA 3BDPA 2O8DA 4FWNA 4ELUA 1JCEA 3CPEA 2RE2A 1HNXK 2P9UB 2F9TA 4H0PA 4IO8A 1T6CA 1ASVA 1XNQK 4A5BA 3EE9A 2Z1GA 3FFKB 1XI1A 4GVEA 3LPTA 3ZT2A 3CQ8A 5F0XA 2OZMA 1C1CA 4JD2A 4BC2A 2ZJQL 3VF6A 3UKUB 1KVCA 3MN5A 2HMPA 4DV0K 1S1UA 4LSNA 2WUSA 4JI3K 4Q5VA 3ZETB 4DV3K 2UXDK 2HBLA 2F7TA 2DFHA 4IO9L 1JLCA 1DEJA 1SS6A 4EP4A 4OKKA 4CGIA 3ZSYA 1TK5A 3V1RA 4JKFA 3SQ2A 3DJCA 2O8CA 1EO1A 3QEIA 4YNQA 3AAQA 4JRPA 4B9NA 4MO5A 4FPAA 1QVGM 5IWAK 4CZKA 3AO1A 1RTHA 3EKUA 1NGCA 3KVGA 1KXPA 4CHOA 2A1SA 4KH6A 3THWA 4DTRA 4KRFA 4BRFA 3QFUA 3OW2M 1FW6A 1TYQB 4DTPA 3DRSA 2PAVA 4GNIA 4B3OA 3HPHA 4BC3A 5DK5A 4ILJA 1TAUA 3VA0A 5BRDA 1C0MA 1NK9A 1T03A 2KZMA 2R7YA 5GIPA 4DQQA 1S1VA 3HJFA 1IG9A 4LF8K 3H1QA 1YVNA 2YKNA 3SMSA 1HKBA 1VQ9N 4GMJB 1XNRK 3B6PA 4NO7A 4ID1A 4MLHA 2OPSA 1TUYA 4C1NK 1DT9A 3DMJA 3C6HA 4JKGA 3TAGA 3QMLA 2VCPA 3FZMA 5C42A 5B8HA 3O8MA 2VYPA 3WNFA 4KI4A 1GLEG 1IKXA 4CHZA 5JICA 4M3RA 2E6MA 4FJLA 3LM2A 1NGGA 2G8IA 5LMUK 1OVQA 3J80O 3QETA 3JS6A 1RILA 1BDGA 1G99A 1VSJA 1RTJA 4ISEA 3T1AA 3E9OA 2AJQA 3KWGA 3T1HK 5AQJA 4KV8A 1KTQA 3HPGA 4ICLA 2FBXA 4H03B 2PYLA 4B9TA 2DPNA 3QDKA 3D0PA 4YOYA 3DLBA 3MAQA 1J5OA 1S22A 4B3RK 4F4KA 3FGUA 2P9IA 1ZBUA 3MXJA 1VQKN 4ZTFA 5BPLA 4FWQA 3LP0A 1BHLA 1SQKA 3OYMA 2PFUA 3HRGA 1C1AA 3MN7A 3MK6A 4FJIA 1W0HA 1J54A 2HHWA 4DV2K 3L2VA 4AHVA 4IKFA 2NLXA 1B92A 1LV5A 2YHBA 3AVHA 4KREA 3LL3A 4F8RA 3AA3A 5FLXO 3BP8A 3LP3A 3EKSA 3VETA 2VG7A 2ZWHA 4FZZA 1VRUA 4AF1A 1WAJA 2UXCK 4DS5A 5F1XA 1UOCA 1HYVA 4DTSA 1TK0A 1T8EA 4EHTA 4M41A 4PL7A 3TI0A 4GV3A 2P9NA 4BE2A 2CGKA 2HVIA 1D4XA 2WONA 3MXMA 4I9QA 3OS0A 3C0BA 4HHTA 4Y1CA 3OY9A 2BTFA 5FPDA 3L2RA 4FWKA 4EHUA 1BIZA 4EZ6A 4A2AA 3A5MC 4CZIA 1CLQA 3D2FA 2HBJA 1C0TA 1RT4A 3EO3A 3VOVA 3O9TA 2P9PB 3VQEA 4H5TA 4BRAA 1Q82O 4O8KA 2BDPA 4CZLA 3NCIA 1NU0A 4N47A 3I8DA 2YX6A 1JLQA 1U04A 4NLBA 1IKVA 4IOAL 4OVLA 2P9LB 3AO5A 1DKGD 3WNHA 4WQ5A 4KO0A 3N4PA 4FWMA 2XY8A 2W40A 2KW4A 2F8TA 2NRTA 1W2BM 4MO4A 3CC2N 1WSEA 2HHXA 1W97L 4NYNA 1JCFA 3SAGA 4HUEA 1B9DA 3MCAB 4OO1J 3SK3A 3RVCA 2QWQA 3SUOA 3ZT4A 5JVGL 2VQFK 1BU6O 1VK0A 5M1NA 4WFBL 1RBSA 4QS7A 2Q0RA 3L0QA 5J2PA 3J8AA 4BY9C 5JS2A 1JKHA 3HL8A 1RDUA 4BR4A 4BRLA 3L6QA 1XMOK 3KIOA 3UKRA 3CD6N 4AILC 3K9KA 4GY2B 4ELVA 2RF2A 3SNNA 1HR0K 4ISGA 2YNHA 3AVGA 3CIPA 4JD2B 3K58A 4DQRA 4M3YA 5AZIA 2G8HA 4H5NA 4E7JA 3OA9A 1YT3A 5AQKA 3QEVA 3EE8A 2Q31A 4E3SA 3VERA 4DSKA 3A5LC 1V4SA 5E26A 5GAEP 4BQLA 1U47A 4CJ7A 4YOVA 4M3ZA 3HVTA 1Q9YA 3S9HA 2O8CB 3C6TA 4Z4IA 3NMUA 1IBLK 2IVNA 5GADP 3IFRA 1IH7A 5J2MA 1VSLA 2E5LK 3NVMA 4WQ4C 3CYMA 4LF7K 4QAGA 4M3UA 3BZKA 1RT5A 3VF4A 5CR4A 3UIQA 4HTLA 1XC3A 4DU4A 3THWB 2FF6A 4EP5A 1X3NA 3R8EA 5HP1A 4KHUA 4AH9A 3AVMA 4E1MA 3AV9A 3NF7A 4AHTA 3AO2A 3O9RA 3HOTA 3NF6A 4BGBA 5JMVA 5LMNK 3SLCA 3CCVN 1QQCA 3O80A 4K8XA 1C0FA 3A0IX 5AQGA 1K73O 3ID8A 1N5YA 2NRVA 2F8SA 4CIFA 3QIOA 3I55N 3OS2A 4V19S 3AVFA 4M7XA 2FXUA 3KK2A 3ATVA 4CHYA 3ZX0A 4HUGA 4BR2A 1VSHA 4DG1A 3THXB 1T3VA 2CH6A 1NKBA 4FO0A 4A2BA 5EVZA 5T7BA 4F3TA 3RSEA 2D0BA 4DSFA 2NRHA 2QEXN 2Q2RA 1K9MO 4FWRA 3QICA 1HPMA 3PUFA 1YJ9N 3HM8A 3OBYA 1IJJA 5BPNA 4LF5K 3VEOA 4BRMA 3G0ZA 3T1YK 2XY7A 1NK0A 4PKIA 2DFFA 3O4QA 1RTIA 2V7YA 1KCFA 3ID6A 4IG3A 2HHSA 4DSIA 1ATRA 3CM5A 4GW6A 2XY5A 3S3MA 4DUZK 4CEAA 2OYQA 1YAGA 4CJFA 3OTOK 1CXQA 4YHHK 4JKHA 4DF4A 2V51B 4IWVA 3R9PA 4HWIA 1BA0A 2HNZA 4O5FA 3L8BA 3PSIA 3RMCA 5AJ3K 2P9IB 3DM2A 4X65K 3OHRA 3LZJA 5KPZA 3SQ0A 2W6KA 4H0XB 2E2NA 3C6UA 1NJIO 2QXLA 3P1GA 5BRHA 3CCUN 3MN6A 2IGIA 3CCQN 2QWOA 3R1XA 2KHOA 1S1TA 1T05A 4DLEA 4CF9A 3VQ7A 1X9MA 4IOCL 1BCMA 5C2DA 1D9DA 4JEPA 4CK1A 4UQGA 3NGZA 3ULEA 1ZBHA 2I5JA 4CJUA 4CD1A 4FJKA 4OLBA 5HL7L 4BWJA 2P9SA 2QW9A 2IAJA 3FZLA 3QFPA 1BOTO 4H0YB 4AM7A 2AA4A 2OPRA 4Q0BA 5J1EA 2RHKA 4M45A 2GBZA 2GTDA 2O8BA 4JHDB 4JK7A 3OYFA 1YI2N 4CZHA 4WFNL 4DTUA 3E01A 3VQ8A 3KLGA 4FLWA 2XRIA 1TKXA 3KD5E 5GAHP 3IS9A 3O4NA 4NB4A 2ZE2A 3SBTA 3WXMB 5AZJA 4L3QA 1S5JA 4B1ZA 2KTQA 4G9ZA 1HQUA 4C8OA 1CXUA 4I2PA 3GG4A 3WT0A 4CF0A 4A59A 3JYTA 3OYEA 4BE0A 2PYJA 2GEMA 3IMXA 3MEDA 4RW6A 4CEDA 4FLYA 1N36K 3CMEN 5AFUH 3KLIA 1IG8A 4DFMA 3PO5A 1HNZK 3PO4A 3M8SA 3FZKA 3ZSRA 3AO4A 1MWKA 1OH6A 4NLCA 5EOYA 3L3UA 1NKCA 1KFSA 4YOWA 5DMRA 1P90A 2G8UA 3DLKA 3DOLA 4MLEA 4DSLA 3HPOA 1GLFO 1NGIA 2P5OA 3S41A 2OA8A 3EY1A 4JKBA 5FRMA 2FSJA 4DSJA 2HF3A 4B1VA 5J2NA 3QO9A 1JLBA 4B1XB 3VGLA 4BG9A 4NCAA 1RBTA 1KAXA 1JXEA 3OYCA 3K5MA 1VQ7N 4A61A 3DYAA 4AHSA 4XIUA 4RW8A 4QOZB 1TGOA 3VENA 1W9HA 1VQ5N 1GOCA 1OH5A 5AZIB 3A2FA
chains in the Genus database with same CATH topology
2YHAA 1LAVA 1Q8IA 2KQ2A 3QETA 1BQNA 4CFAA 3QINA 4CJEA 1RILA 4E1NA 1VSJA 1RTJA 3T1AA 2AJQA 4KV8A 1KTQA 3HPGA 4BDYA 2HHTA 2B5JA 4DQSA 2QK9A 4ICLA 2XO7A 2FBXA 2PYLA 2D0CA 3S3NA 4H4MA 4BWMA 3TAEA 5E41A 1Z25A 1TKDA 4CEEA 3D0PA 4B9TA 4PWDA 4CEQA 1TL1A 1RCHA 3MAQA 3DLBA 3M8PA 1J5OA 1QTMA 4FJHA 4CGGA 4B9SA 3OJUA 4F4KA 1LW0A 1SKRA 1ZBUA 4FJNA 4O0JA 3MXJA 4Y1DA 3DLGA 4N56A 4DF8A 4ZTFA 1HYSA 3LP0A 1BHLA 4DU1A 1WSIA 4CECA 1S1WA 4R5PA 3OYNA 5HBMA 4KPYA 1HMVA 4KHSA 1S6QA 3KKSA 3V1QA 3VN5A 5HRNA 3OYMA 4CGHA 3SJJA 1C1AA 2OPQA 3HP9A 4O5BA 3SV3A 4ZTJA 4B9LA 4IG0A 2Y1IA 4DQPA 3LPUA 4HCCA 4FJIA 1W0HA 2FBVA 1J54A 1CZBA 4LY7A 4E0DA 2HHWA 4LSLA 3L2VA 3TAPA 4AHVA 4FJGA 4IKFA 4JRQA 3PV8A 1B92A 3DLEA 2YHBA 1IKWA 1LV5A 4W5OA 3AVHA 3ZSWA 1W9HA 3QEWA 4KREA 4KKOA 4F8RA 4N41A 3AA3A 1ASUA 1QSYA 3LP3A 1I3AA 4E7IA 4M3WA 4CJRA 5HROA 4CCHA 4J2AA 3LANA 2VG7A 4FZZA 1UWBA 1VRUA 3KLHA 4BDPA 5JS1A 4CK2A 4CJWA 1WAJA 4DS5A 4B9MA 4E7KA 3KLEA 1KSPA 2DY4A 1UA1A 4WE1A 1UOCA 5KTQA 4DFJA 1HYVA 4KFBA 2HVHA 4DTSA 1TK0A 1T8EA 4M41A 4E89A 1FK9A 1YTAA 3TI0A 2HW3A 1ASWA 4CHQA 3M8QA 3ZT0A 4BE2A 2HVIA 4HTUA 1JXBA 3NF8A 2WONA 3MXMA 4I9QA 3OS0A 4KHYA 3NGIA 3ZCMA 4JLHA 3RRHA 2O4IA 4FZYA 3RRGA 5HLFA 4HHTA 4Y1CA 3F73A 3SCXA 2G8KA 3WNGA 3OY9A 4FZXC 3L2RA 3DLHA 3MXIA 4EZ6A 1BIZA 4G1QA 4NCGA 3K57A 1Q9XA 2BGGA 2OPPA 4TSXA 4DQIA 1WLJA 2E6LA 4CFDA 2W42A 1R0AA 1CLQA 4CJ5A 1G15A 1C0TA 1RT4A 3VQDA 3OS1A 4JS5A 3K5OA 1LWFA 1EP4A 1BI4A 5KRTA 3VQEA 3SUNA 1QSLA 3ZSXA 3SUQA 2ATQA 4CGFA 3IRXA 2BDPA 4FJ7A 1I39A 3ASMA 3NCIA 4CJVA 5HRPA 4N47A 3I8DA 4O0IA 4FJ5A 4W5RA 1JLQA 1U04A 1J53A 1IKVA 1BGXT 4O4GA 4OVLA 4F2SA 2B4JA 3AO5A 2HHUA 3JSMA 2GUIA 1LWCA 4CEZA 2HNDA 3CFOA 3WNHA 1HQEA 4DTJA 1YTUA 3BGRA 3LAMA 3V4IA 4KO0A 2OZSA 1BCOA 2XY8A 3VQCA 2PY5A 2KW4A 4ELTA 2F8TA 3LDSA 4CF8A 1WSEA 3HM9A 4CGDA 1XWLA 2HHXA 4DFPA 3OYBA 3HYFA 4NYNA 4HUEA 1B9DA 4LH4A 5K14A 3L2QA 2Z1JA 3TR8A 3G10A 1REVA 3K5LA 4CJTA 3SUOA 3ZT4A 4CHPA 3RMBA 1LAWA 2YNIA 3ZSZA 1SUQA 3SZ2A 4DTXA 2QKKA 4FK2A 5KGWA 3AVLA 1VK0A 4CJKA 1D5AA 1RBSA 3QLHA 1NJYA 1TKTA 1VSDA 1VSMA 4MQ3A 5J2PA 3QERA 4FCYA 3ZSOA 2VG5A 4OPKA 3SI6A 4KHQA 2QXFA 2IOCA 3SYZA 4NCBA 1O1WA 3I0SA 5JS2A 4O55A 3CM6A 5HRRA 2G8VA 1JKHA 3HL8A 3O3HA 3P83D 2ITGA 5FROA 2NUBA 1KLNA 2D0AA 4OPJA 3KLFA 4KB1A 3PX0A 1KVBA 1GOAA 3KIOA 1RBUA 3THVA 3ZT3A 2G8IA 3B6OA 2ZQBA 3HXMA 4AILC 1KVAA 1NK8A 1TK8A 1KLMA 3QNNA 1A5VA 3NGYA 3P5JA 3O3FA 1HYZA 1VSEA 4ELVA 3VQ6A 2X74A 3NBPA 3NAEA 3RTVA 3V9XA 4Z4EA 2RF2A 3EZ5A 2D5RA 2WOMA 4IFYA 4DSEA 4FXDA 1D8YA 3SNNA 2ZD1A 2IS3A 1JLGA 2YNHA 4CEBA 1A5XA 3AVGA 1EXQA 4CF1A 3K58A 4C8LA 1TVRA 4DQRA 4M3YA 3SPYA 4B8CA 2G8HA 4IBNA 2QKBA 4E7JA 2P1JA 3VQQA 1YT3A 4DFKA 3V9UA 4E7HA 3QEVA 1GOBA 3LWMA 2XY6A 2BE2A 4RW7A 2IC3A 2RKIA 4E3SA 2KFNA 4RW4A 4B9VA 3HP6A 1QSSA 4W5NA 1JL1A 1ZBHA 1S1XA 3ULDA 1KFDA 1S9EA 4CJ4A 3EYZA 1L3SA 4DSKA 4HUFA 1BL3A 1RT6A 4F3OA 4Z4FA 4I2QA 1U47A 4CJSA 3V9SA 5EU7A 1SKWA 4M3ZA 2X6NA 3HVTA 1Q9YA 1FKPA 1JLEA 1LW2A 2EHGA 3VQ5A 3S9HA 3AVKA 3C6TA 5CYMA 3L2WA 4Z4IA 4PQUA 4M42A 1C1BA 2JGUA 2A1RA 3QESA 4LD0A 2VG6A 1X1PA 1JLAA 1IH7A 5J2MA 1VSLA 3VA3A 2XHBA 3O3GA 3CYMA 1L5UA 2PZSA 1NOZA 3KD1E 4QAGA 5CY4A 4IDKA 4CGJA 1WSHA 1EX4A 4M3UA 2HHQA 5KGXA 4FK4A 3AA4A 4RG8A 1NKEA 4FM1A 1RT5A 4OGEA 2P5GA 3L3VA 3FFIA 1WAFA 3UIQA 1WSGA 1A5WA 3L2UA 4DU4A 1IKYA 3LZIA 1RT1A 4QCLA 1TAQA 3NH2A 4EP5A 1WSFA 5KI6A 3U3GA 4HCBA 4CFCA 2X78A 4DTMA 2DFEA 3LP2A 5HP1A 4FW1A 1NJXA 4KHUA 2YNGA 3C94A 4AH9A 1SL0A 3AVMA 4CE9A 3AV9A 3NF7A 4AHTA 3AO2A 4E1MA 3T3FA 1D9FA 3NF6A 3T19A 1XC9A 1HNIA 4F2RA 4NYFA 3MEEA 1YVUA 3QIPA 3NH1A 1QQCA 4FLVA 4J2EA 3HO1A 1C6VA 4Z4CA 4K8XA 1RDCA 3V81A 4KTQA 4M3XA 3HSTB 1N5YA 3NDKA 4IFVA 1RDAA 3HVRA 2F8SA 4CIFA 3QIOA 4FJ8A 3AA5X 3IG1A 3DRRA 4FM2A 3OS2A 2LSNA 1UAXA 2JLEA 3MEGA 3SV4A 1JLFA 2Z1HA 3AVFA 3VQPA 1DTTA 3KK2A 4CHYA 4KHNA 3SUPA 2Q3SA 5SZTA 4HUGA 1VSHA 4DG1A 1NKBA 3ISNC 3LAKA 5J2QA 1NK7A 5T7BA 4F3TA 3VQBA 2D0BA 4AHUA 3WNEA 3LWLA 4DSFA 4W5QA 5I42A 1J9AA 1RT2A 4FLTA 1VSIA 4KHWA 4ID5A 1U45A 3HK2A 3I0RA 4CF2A 3PUFA 4FJLA 1C0UA 4OGCA 3K5NA 4B9UA 3AVJA 3OYKA 1MU2A 2VWJA 3HT3A 2F96A 3ALYA 1TKZA 4YFUA 3TWHA 1WSJA 3G0ZA 4I7FA 2G8WA 2XY7A 3DLRA 1NK0A 4FJ9A 2DFFA 3O4QA 4GVMA 1RTIA 2VWKA 5CYQA 4CK3A 5I3UA 4FJMA 3AVCA 3SQ1A 3AVNA 1KCFA 1L3VA 2FBTA 4IG3A 4CJ3A 3AVIA 4Z4HA 4EZ9A 4PY5A 2Y1JA 1L3UA 1NK6A 1WN7A 2HHSA 1X9SA 4DSIA 4OLAA 3CM5A 4GW6A 2XY5A 3S3MA 4PUOA 3C95A 2YV0X 3VQAA 3SPZA 4C8MA 3OJSA 4CEAA 4B08A 3KK3A 3TABA 2OYQA 1S9GA 1RTDA 2EX3A 1ITGA 4CJFA 5C25A 1HRHA 1U48A 3V9ZA 3SQ4A 4J2DA 1HNVA 1CXQA 4CEOA 1Y97A 3M8RA 3PX6A 4J2BA 3V6DA 4DF4A 4CJPA 3NE6A 5FRNA 1RNHA 4M3TA 2KZZA 3RMDA 1LWEA 4CJQA 1RBRA 2HNZA 4O44A 1DLOA 1DTQA 1QHTA 4KTZA 3NHGA 4ZHRA 3L8BA 3CFRA 3LP1A 1VRTA 4B8AB 4DU3A 3RMCA 2HMIA 3DM2A 2RPIA 3H08A 4CJLA 3LZJA 2IDOA 3ITHA 3SQ0A 3V1OA 3OYLA 4DLGA 1B9FA 3LALA 3DI6A 3TAQA 3S3OA 1WNSA 2YNFA 3U6FA 3TAFA 1K6YA 1SL2A 3BDPA 4L8RB 3C6UA 3P1GA 4BDZA 1CZ9A 4ELUA 1ZBLA 2IGIA 3OYHA 1TV6A 4FLUA 4KTWA 1NJWA 1RT3A 3ZSVA 3PX4A 4C8KA 1XHXA 1ASVA 4CIEA 2Z1GA 4LH5A 1S1TA 3CG7A 1NOYA 1T05A 3AA2A 4DLEA 1XI1A 3MECA 3NH0A 3OVNA 3LPTA 4CF9A 3ZT2A 4CHNA 3CQ8A 2OZMA 1IO2A 1FKOA 1C1CA 3VQ7A 1SL1A 4CESA 4DS4A 1X9MA 1T7PA 1QS4A 4MFBA 3K2PA 3OYIA 1BCMA 3IAYA 1D9DA 1KVCA 4CK1A 3V9WA 4UQGA 1RBVA 5CZ2A 3NGZA 5FDLA 4DTNA 3KK1A 4DWIA 4I9LA 1EKEA 1S1UA 1UA0A 2I5JA 3KKRA 4LSNA 4CJUA 5HRSA 1KRPA 4FLZA 4FVMA 4Q5VA 4FJKA 4BWJA 4OKJA 3OYJA 4OLBA 2G8FA 2DFHA 2IAJA 2P51A 4DTOA 2KFZA 1ZBFA 3DRPA 3D45A 4OJRA 1NK5A 1JLCA 3QEXA 1BQMA 2OPRA 4N76A 1XHZA 4FK0A 4E19A 4EP4A 4Z4GA 4Q0BA 4KI6A 5J1EA 4OKKA 3QNOA 4M45A 4AHRA 4CGIA 2GBZA 2O4GA 3ZSYA 1TK5A 3OYFA 3TANA 3V1RA 4CEFA 3SQ2A 3ZSQA 4DTUA 3E01A 3VQ8A 3KLGA 4K8ZA 3QEIA 4YNQA 4FW2A 4JRPA 4FLWA 4B9NA 1HJRA 2XRIA 4CIGA 5D3GA 1TKXA 3KD5E 4H8KA 4OKEA 1S6PA 1BI4B 3IS9A 3O4NA 1Z26A 3ZT1A 3AO1A 1RTHA 2ZE2A 4RW9A 1SKSA 2FC0A 3CFPA 2Z1IA 4CHOA 3RMAA 2FBYA 1S5JA 2KTQA 4N5SA 3KJVA 2A1SA 3AO3A 4KAZA 2DTUA 1HQUA 3NF9A 1CXUA 4I2PA 4FLXA 3TARA 4C8OA 1EETA 4CF0A 1U49A 1VSFA 2HB5A 3JYTA 4DTRA 3OYEA 4BE0A 2X6SA 4KRFA 2PYJA 3U3YA 1TL3A 4DTPA 3DRSA 3QEPA 4W5TA 2HHVA 4DMNA 3DOKA 3MEDA 4RW6A 4CEDA 4BACA 4FLYA 1U4BA 1RT7A 1NK4A 1ZBIA 4FJJA 4B3OA 3HPHA 3NFAA 3KLIA 2YKMA 4DFMA 3PO5A 3PO4A 2HNYA 5DK5A 3M8SA 1JL2A 3ZSRA 3RWUA 1TAUA 3AO4A 3K59A 5SWMA 3OYDA 3VA0A 3RR7A 1C0MA 2E4LA 2GV9A 1NK9A 4FYDA 2ETJA 5KRSA 1T03A 2KZMA 4KB0A 2BANA 3L3UA 1NKCA 1KFSA 2R7YA 3F9KA 1HPZA 5DMRA 4DQQA 1S1VA 2G8UA 3HJFA 3OYGA 5C24A 1IG9A 4H4OA 3DLKA 3DOLA 4BE1A 4DSLA 1VSKA 3AVBA 3TAMA 1N6QA 3KTQA 3HPOA 2YKNA 3VQ9A 4GMJB 1NJZA 2P5OA 1RDBA 1ZYQA 2OA8A 3EY1A 3B6PA 1F21A 4ID1A 1BISA 5FRMA 2OPSA 1X9WA 4DSJA 1BIUA 3RR8A 3OYAA 2RN2A 4AHCA 3DMJA 5J2NA 3QO9A 1JLBA 4FM0A 3TAGA 4C8NA 4JS4A 5C42A 1FXXA 4Z0UA 3WNFA 4NCAA 4KI4A 4CFBA 1RBTA 1JXEA 1IKXA 4CHZA 3OYCA 3VQ4A 3PY8A 3K5MA 4FJXA 1SV5A 3DYAA 4AHSA 4CERA 4XIUA 4E7LA 4RW8A 5CZ1A 4M3RA 4QOZB 4PA1A 1TGOA 1RDDA 4HVJA 3AVAA 1L3TA 1QE1A 1GOCA 2E6MA 3A2FA 2B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHA A;  1LAV A;  1Q8I A;  2KQ2 A;  3QET A;  1BQN A;  4CFA A;  3QIN A;  4CJE A;  1RIL A;  4E1N A;  1VSJ A;  1RTJ A;  3T1A A;  2AJQ A;  4KV8 A;  1KTQ A;  3HPG A;  4BDY A;  2HHT A;  2B5J A;  4DQS A;  2QK9 A;  4ICL A;  2XO7 A;  2FBX A;  2PYL A;  2D0C A;  3S3N A;  4H4M A;  4BWM A;  3TAE A;  5E41 A;  1Z25 A;  1TKD A;  4CEE A;  3D0P A;  4B9T A;  4PWD A;  4CEQ A;  1TL1 A;  1RCH A;  3MAQ A;  3DLB A;  3M8P A;  1J5O A;  1QTM A;  4FJH A;  4CGG A;  4B9S A;  3OJU A;  4F4K A;  1LW0 A;  1SKR A;  1ZBU A;  4FJN A;  4O0J A;  3MXJ A;  4Y1D A;  3DLG A;  4N56 A;  4DF8 A;  4ZTF A;  1HYS A;  3LP0 A;  1BHL A;  4DU1 A;  1WSI A;  4CEC A;  1S1W A;  4R5P A;  3OYN A;  5HBM A;  4KPY A;  1HMV A;  4KHS A;  1S6Q A;  3KKS A;  3V1Q A;  3VN5 A;  5HRN A;  3OYM A;  4CGH A;  3SJJ A;  1C1A A;  2OPQ A;  3HP9 A;  4O5B A;  3SV3 A;  4ZTJ A;  4B9L A;  4IG0 A;  2Y1I A;  4DQP A;  3LPU A;  4HCC A;  4FJI A;  1W0H A;  2FBV A;  1J54 A;  1CZB A;  4LY7 A;  4E0D A;  2HHW A;  4LSL A;  3L2V A;  3TAP A;  4AHV A;  4FJG A;  4IKF A;  4JRQ A;  3PV8 A;  1B92 A;  3DLE A;  2YHB A;  1IKW A;  1LV5 A;  4W5O A;  3AVH A;  3ZSW A;  1W9H A;  3QEW A;  4KRE A;  4KKO A;  4F8R A;  4N41 A;  3AA3 A;  1ASU A;  1QSY A;  3LP3 A;  1I3A A;  4E7I A;  4M3W A;  4CJR A;  5HRO A;  4CCH A;  4J2A A;  3LAN A;  2VG7 A;  4FZZ A;  1UWB A;  1VRU A;  3KLH A;  4BDP A;  5JS1 A;  4CK2 A;  4CJW A;  1WAJ A;  4DS5 A;  4B9M A;  4E7K A;  3KLE A;  1KSP A;  2DY4 A;  1UA1 A;  4WE1 A;  1UOC A;  5KTQ A;  4DFJ A;  1HYV A;  4KFB A;  2HVH A;  4DTS A;  1TK0 A;  1T8E A;  4M41 A;  4E89 A;  1FK9 A;  1YTA A;  3TI0 A;  2HW3 A;  1ASW A;  4CHQ A;  3M8Q A;  3ZT0 A;  4BE2 A;  2HVI A;  4HTU A;  1JXB A;  3NF8 A;  2WON A;  3MXM A;  4I9Q A;  3OS0 A;  4KHY A;  3NGI A;  3ZCM A;  4JLH A;  3RRH A;  2O4I A;  4FZY A;  3RRG A;  5HLF A;  4HHT A;  4Y1C A;  3F73 A;  3SCX A;  2G8K A;  3WNG A;  3OY9 A;  4FZX C;  3L2R A;  3DLH A;  3MXI A;  4EZ6 A;  1BIZ A;  4G1Q A;  4NCG A;  3K57 A;  1Q9X A;  2BGG A;  2OPP A;  4TSX A;  4DQI A;  1WLJ A;  2E6L A;  4CFD A;  2W42 A;  1R0A A;  1CLQ A;  4CJ5 A;  1G15 A;  1C0T A;  1RT4 A;  3VQD A;  3OS1 A;  4JS5 A;  3K5O A;  1LWF A;  1EP4 A;  1BI4 A;  5KRT A;  3VQE A;  3SUN A;  1QSL A;  3ZSX A;  3SUQ A;  2ATQ A;  4CGF A;  3IRX A;  2BDP A;  4FJ7 A;  1I39 A;  3ASM A;  3NCI A;  4CJV A;  5HRP A;  4N47 A;  3I8D A;  4O0I A;  4FJ5 A;  4W5R A;  1JLQ A;  1U04 A;  1J53 A;  1IKV A;  1BGX T;  4O4G A;  4OVL A;  4F2S A;  2B4J A;  3AO5 A;  2HHU A;  3JSM A;  2GUI A;  1LWC A;  4CEZ A;  2HND A;  3CFO A;  3WNH A;  1HQE A;  4DTJ A;  1YTU A;  3BGR A;  3LAM A;  3V4I A;  4KO0 A;  2OZS A;  1BCO A;  2XY8 A;  3VQC A;  2PY5 A;  2KW4 A;  4ELT A;  2F8T A;  3LDS A;  4CF8 A;  1WSE A;  3HM9 A;  4CGD A;  1XWL A;  2HHX A;  4DFP A;  3OYB A;  3HYF A;  4NYN A;  4HUE A;  1B9D A;  4LH4 A;  5K14 A;  3L2Q A;  2Z1J A;  3TR8 A;  3G10 A;  1REV A;  3K5L A;  4CJT A;  3SUO A;  3ZT4 A;  4CHP A;  3RMB A;  1LAW A;  2YNI A;  3ZSZ A;  1SUQ A;  3SZ2 A;  4DTX A;  2QKK A;  4FK2 A;  5KGW A;  3AVL A;  1VK0 A;  4CJK A;  1D5A A;  1RBS A;  3QLH A;  1NJY A;  1TKT A;  1VSD A;  1VSM A;  4MQ3 A;  5J2P A;  3QER A;  4FCY A;  3ZSO A;  2VG5 A;  4OPK A;  3SI6 A;  4KHQ A;  2QXF A;  2IOC A;  3SYZ A;  4NCB A;  1O1W A;  3I0S A;  5JS2 A;  4O55 A;  3CM6 A;  5HRR A;  2G8V A;  1JKH A;  3HL8 A;  3O3H A;  3P83 D;  2ITG A;  5FRO A;  2NUB A;  1KLN A;  2D0A A;  4OPJ A;  3KLF A;  4KB1 A;  3PX0 A;  1KVB A;  1GOA A;  3KIO A;  1RBU A;  3THV A;  3ZT3 A;  2G8I A;  3B6O A;  2ZQB A;  3HXM A;  4AIL C;  1KVA A;  1NK8 A;  1TK8 A;  1KLM A;  3QNN A;  1A5V A;  3NGY A;  3P5J A;  3O3F A;  1HYZ A;  1VSE A;  4ELV A;  3VQ6 A;  2X74 A;  3NBP A;  3NAE A;  3RTV A;  3V9X A;  4Z4E A;  2RF2 A;  3EZ5 A;  2D5R A;  2WOM A;  4IFY A;  4DSE A;  4FXD A;  1D8Y A;  3SNN A;  2ZD1 A;  2IS3 A;  1JLG A;  2YNH A;  4CEB A;  1A5X A;  3AVG A;  1EXQ A;  4CF1 A;  3K58 A;  4C8L A;  1TVR A;  4DQR A;  4M3Y A;  3SPY A;  4B8C A;  2G8H A;  4IBN A;  2QKB A;  4E7J A;  2P1J A;  3VQQ A;  1YT3 A;  4DFK A;  3V9U A;  4E7H A;  3QEV A;  1GOB A;  3LWM A;  2XY6 A;  2BE2 A;  4RW7 A;  2IC3 A;  2RKI A;  4E3S A;  2KFN A;  4RW4 A;  4B9V A;  3HP6 A;  1QSS A;  4W5N A;  1JL1 A;  1ZBH A;  1S1X A;  3ULD A;  1KFD A;  1S9E A;  4CJ4 A;  3EYZ A;  1L3S A;  4DSK A;  4HUF A;  1BL3 A;  1RT6 A;  4F3O A;  4Z4F A;  4I2Q A;  1U47 A;  4CJS A;  3V9S A;  5EU7 A;  1SKW A;  4M3Z A;  2X6N A;  3HVT A;  1Q9Y A;  1FKP A;  1JLE A;  1LW2 A;  2EHG A;  3VQ5 A;  3S9H A;  3AVK A;  3C6T A;  5CYM A;  3L2W A;  4Z4I A;  4PQU A;  4M42 A;  1C1B A;  2JGU A;  2A1R A;  3QES A;  4LD0 A;  2VG6 A;  1X1P A;  1JLA A;  1IH7 A;  5J2M A;  1VSL A;  3VA3 A;  2XHB A;  3O3G A;  3CYM A;  1L5U A;  2PZS A;  1NOZ A;  3KD1 E;  4QAG A;  5CY4 A;  4IDK A;  4CGJ A;  1WSH A;  1EX4 A;  4M3U A;  2HHQ A;  5KGX A;  4FK4 A;  3AA4 A;  4RG8 A;  1NKE A;  4FM1 A;  1RT5 A;  4OGE A;  2P5G A;  3L3V A;  3FFI A;  1WAF A;  3UIQ A;  1WSG A;  1A5W A;  3L2U A;  4DU4 A;  1IKY A;  3LZI A;  1RT1 A;  4QCL A;  1TAQ A;  3NH2 A;  4EP5 A;  1WSF A;  5KI6 A;  3U3G A;  4HCB A;  4CFC A;  2X78 A;  4DTM A;  2DFE A;  3LP2 A;  5HP1 A;  4FW1 A;  1NJX A;  4KHU A;  2YNG A;  3C94 A;  4AH9 A;  1SL0 A;  3AVM A;  4CE9 A;  3AV9 A;  3NF7 A;  4AHT A;  3AO2 A;  4E1M A;  3T3F A;  1D9F A;  3NF6 A;  3T19 A;  1XC9 A;  1HNI A;  4F2R A;  4NYF A;  3MEE A;  1YVU A;  3QIP A;  3NH1 A;  1QQC A;  4FLV A;  4J2E A;  3HO1 A;  1C6V A;  4Z4C A;  4K8X A;  1RDC A;  3V81 A;  4KTQ A;  4M3X A;  3HST B;  1N5Y A;  3NDK A;  4IFV A;  1RDA A;  3HVR A;  2F8S A;  4CIF A;  3QIO A;  4FJ8 A;  3AA5 X;  3IG1 A;  3DRR A;  4FM2 A;  3OS2 A;  2LSN A;  1UAX A;  2JLE A;  3MEG A;  3SV4 A;  1JLF A;  2Z1H A;  3AVF A;  3VQP A;  1DTT A;  3KK2 A;  4CHY A;  4KHN A;  3SUP A;  2Q3S A;  5SZT A;  4HUG A;  1VSH A;  4DG1 A;  1NKB A;  3ISN C;  3LAK A;  5J2Q A;  1NK7 A;  5T7B A;  4F3T A;  3VQB A;  2D0B A;  4AHU A;  3WNE A;  3LWL A;  4DSF A;  4W5Q A;  5I42 A;  1J9A A;  1RT2 A;  4FLT A;  1VSI A;  4KHW A;  4ID5 A;  1U45 A;  3HK2 A;  3I0R A;  4CF2 A;  3PUF A;  4FJL A;  1C0U A;  4OGC A;  3K5N A;  4B9U A;  3AVJ A;  3OYK A;  1MU2 A;  2VWJ A;  3HT3 A;  2F96 A;  3ALY A;  1TKZ A;  4YFU A;  3TWH A;  1WSJ A;  3G0Z A;  4I7F A;  2G8W A;  2XY7 A;  3DLR A;  1NK0 A;  4FJ9 A;  2DFF A;  3O4Q A;  4GVM A;  1RTI A;  2VWK A;  5CYQ A;  4CK3 A;  5I3U A;  4FJM A;  3AVC A;  3SQ1 A;  3AVN A;  1KCF A;  1L3V A;  2FBT A;  4IG3 A;  4CJ3 A;  3AVI A;  4Z4H A;  4EZ9 A;  4PY5 A;  2Y1J A;  1L3U A;  1NK6 A;  1WN7 A;  2HHS A;  1X9S A;  4DSI A;  4OLA A;  3CM5 A;  4GW6 A;  2XY5 A;  3S3M A;  4PUO A;  3C95 A;  2YV0 X;  3VQA A;  3SPZ A;  4C8M A;  3OJS A;  4CEA A;  4B08 A;  3KK3 A;  3TAB A;  2OYQ A;  1S9G A;  1RTD A;  2EX3 A;  1ITG A;  4CJF A;  5C25 A;  1HRH A;  1U48 A;  3V9Z A;  3SQ4 A;  4J2D A;  1HNV A;  1CXQ A;  4CEO A;  1Y97 A;  3M8R A;  3PX6 A;  4J2B A;  3V6D A;  4DF4 A;  4CJP A;  3NE6 A;  5FRN A;  1RNH A;  4M3T A;  2KZZ A;  3RMD A;  1LWE A;  4CJQ A;  1RBR A;  2HNZ A;  4O44 A;  1DLO A;  1DTQ A;  1QHT A;  4KTZ A;  3NHG A;  4ZHR A;  3L8B A;  3CFR A;  3LP1 A;  1VRT A;  4B8A B;  4DU3 A;  3RMC A;  2HMI A;  3DM2 A;  2RPI A;  3H08 A;  4CJL A;  3LZJ A;  2IDO A;  3ITH A;  3SQ0 A;  3V1O A;  3OYL A;  4DLG A;  1B9F A;  3LAL A;  3DI6 A;  3TAQ A;  3S3O A;  1WNS A;  2YNF A;  3U6F A;  3TAF A;  1K6Y A;  1SL2 A;  3BDP A;  4L8R B;  3C6U A;  3P1G A;  4BDZ A;  1CZ9 A;  4ELU A;  1ZBL A;  2IGI A;  3OYH A;  1TV6 A;  4FLU A;  4KTW A;  1NJW A;  1RT3 A;  3ZSV A;  3PX4 A;  4C8K A;  1XHX A;  1ASV A;  4CIE A;  2Z1G A;  4LH5 A;  1S1T A;  3CG7 A;  1NOY A;  1T05 A;  3AA2 A;  4DLE A;  1XI1 A;  3MEC A;  3NH0 A;  3OVN A;  3LPT A;  4CF9 A;  3ZT2 A;  4CHN A;  3CQ8 A;  2OZM A;  1IO2 A;  1FKO A;  1C1C A;  3VQ7 A;  1SL1 A;  4CES A;  4DS4 A;  1X9M A;  1T7P A;  1QS4 A;  4MFB A;  3K2P A;  3OYI A;  1BCM A;  3IAY A;  1D9D A;  1KVC A;  4CK1 A;  3V9W A;  4UQG A;  1RBV A;  5CZ2 A;  3NGZ A;  5FDL A;  4DTN A;  3KK1 A;  4DWI A;  4I9L A;  1EKE A;  1S1U A;  1UA0 A;  2I5J A;  3KKR A;  4LSN A;  4CJU A;  5HRS A;  1KRP A;  4FLZ A;  4FVM A;  4Q5V A;  4FJK A;  4BWJ A;  4OKJ A;  3OYJ A;  4OLB A;  2G8F A;  2DFH A;  2IAJ A;  2P51 A;  4DTO A;  2KFZ A;  1ZBF A;  3DRP A;  3D45 A;  4OJR A;  1NK5 A;  1JLC A;  3QEX A;  1BQM A;  2OPR A;  4N76 A;  1XHZ A;  4FK0 A;  4E19 A;  4EP4 A;  4Z4G A;  4Q0B A;  4KI6 A;  5J1E A;  4OKK A;  3QNO A;  4M45 A;  4AHR A;  4CGI A;  2GBZ A;  2O4G A;  3ZSY A;  1TK5 A;  3OYF A;  3TAN A;  3V1R A;  4CEF A;  3SQ2 A;  3ZSQ A;  4DTU A;  3E01 A;  3VQ8 A;  3KLG A;  4K8Z A;  3QEI A;  4YNQ A;  4FW2 A;  4JRP A;  4FLW A;  4B9N A;  1HJR A;  2XRI A;  4CIG A;  5D3G A;  1TKX A;  3KD5 E;  4H8K A;  4OKE A;  1S6P A;  1BI4 B;  3IS9 A;  3O4N A;  1Z26 A;  3ZT1 A;  3AO1 A;  1RTH A;  2ZE2 A;  4RW9 A;  1SKS A;  2FC0 A;  3CFP A;  2Z1I A;  4CHO A;  3RMA A;  2FBY A;  1S5J A;  2KTQ A;  4N5S A;  3KJV A;  2A1S A;  3AO3 A;  4KAZ A;  2DTU A;  1HQU A;  3NF9 A;  1CXU A;  4I2P A;  4FLX A;  3TAR A;  4C8O A;  1EET A;  4CF0 A;  1U49 A;  1VSF A;  2HB5 A;  3JYT A;  4DTR A;  3OYE A;  4BE0 A;  2X6S A;  4KRF A;  2PYJ A;  3U3Y A;  1TL3 A;  4DTP A;  3DRS A;  3QEP A;  4W5T A;  2HHV A;  4DMN A;  3DOK A;  3MED A;  4RW6 A;  4CED A;  4BAC A;  4FLY A;  1U4B A;  1RT7 A;  1NK4 A;  1ZBI A;  4FJJ A;  4B3O A;  3HPH A;  3NFA A;  3KLI A;  2YKM A;  4DFM A;  3PO5 A;  3PO4 A;  2HNY A;  5DK5 A;  3M8S A;  1JL2 A;  3ZSR A;  3RWU A;  1TAU A;  3AO4 A;  3K59 A;  5SWM A;  3OYD A;  3VA0 A;  3RR7 A;  1C0M A;  2E4L A;  2GV9 A;  1NK9 A;  4FYD A;  2ETJ A;  5KRS A;  1T03 A;  2KZM A;  4KB0 A;  2BAN A;  3L3U A;  1NKC A;  1KFS A;  2R7Y A;  3F9K A;  1HPZ A;  5DMR A;  4DQQ A;  1S1V A;  2G8U A;  3HJF A;  3OYG A;  5C24 A;  1IG9 A;  4H4O A;  3DLK A;  3DOL A;  4BE1 A;  4DSL A;  1VSK A;  3AVB A;  3TAM A;  1N6Q A;  3KTQ A;  3HPO A;  2YKN A;  3VQ9 A;  4GMJ B;  1NJZ A;  2P5O A;  1RDB A;  1ZYQ A;  2OA8 A;  3EY1 A;  3B6P A;  1F21 A;  4ID1 A;  1BIS A;  5FRM A;  2OPS A;  1X9W A;  4DSJ A;  1BIU A;  3RR8 A;  3OYA A;  2RN2 A;  4AHC A;  3DMJ A;  5J2N A;  3QO9 A;  1JLB A;  4FM0 A;  3TAG A;  4C8N A;  4JS4 A;  5C42 A;  1FXX A;  4Z0U A;  3WNF A;  4NCA A;  4KI4 A;  4CFB A;  1RBT A;  1JXE A;  1IKX A;  4CHZ A;  3OYC A;  3VQ4 A;  3PY8 A;  3K5M A;  4FJX A;  1SV5 A;  3DYA A;  4AHS A;  4CER A;  4XIU A;  4E7L A;  4RW8 A;  5CZ1 A;  4M3R A;  4QOZ B;  4PA1 A;  1TGO A;  1RDD A;  4HVJ A;  3AVA A;  1L3T A;  1QE1 A;  1GOC A;  2E6M A;  3A2F A;  2B6A A; 
#chains in the Genus database with same CATH topology
 1OVY A;  4JI2 K;  1BQN A;  4CFA A;  2WTU A;  1GLC G;  1VQ6 N;  3WUH A;  2HHT A;  3IKM A;  4DQS A;  3BF1 A;  2D0C A;  4K42 A;  4BWM A;  3TAE A;  1TKD A;  1Z25 A;  4H5W A;  1QZ5 A;  4CEE A;  4GKJ K;  3M3Z A;  4CEQ A;  1TL1 A;  2QWM A;  3AY9 A;  1QTM A;  1NMN A;  3F9M A;  3JXU A;  4B9S A;  3OJU A;  1LW0 A;  4FJN A;  4Y1D A;  3DLG A;  3VEV A;  4C1N I;  4BR0 A;  1WSI A;  4DU1 A;  1S1W A;  4R5P A;  3LDP A;  3M5R A;  1S6Q A;  3VN5 A;  3SJJ A;  2OPQ A;  2ZJP L;  4RTF D;  1K8K B;  4B1Y B;  3TAP A;  3O9S A;  5BRE A;  4JRQ A;  4IEE A;  3PV8 A;  4W5O A;  1M90 O;  1QSY A;  3ZYY X;  1I3A A;  4E7I A;  4H0T B;  3LAN A;  3CJB A;  1UWB A;  4PHT X;  5JS1 A;  3VES A;  1JJ2 M;  3KLE A;  3K9J A;  5ADX A;  2HHH K;  1YTA A;  4IXC A;  4YOR A;  4CHQ A;  2E2P A;  3ZT0 A;  5H1S Q;  1BA1 A;  3NF8 A;  3AAP A;  3E9P A;  2EWS A;  1BG3 A;  4JI4 K;  3NGI A;  3RRG A;  4XH4 A;  5GAG P;  2E88 A;  3SCX A;  4FZX C;  3DLH A;  4NCG A;  3K57 A;  1IBK K;  3RSE B;  4DQI A;  1WLJ A;  2E6L A;  4JKC A;  1R0A A;  1G15 A;  3OS1 A;  2GEL A;  1LWF A;  4XH1 A;  5KRT A;  1WOQ A;  4BR9 A;  1J6Z A;  3OBW A;  3AGK A;  5FPE A;  1J5E K;  3SAH A;  3SUN A;  2FF3 B;  4CGF A;  4OX9 K;  4H5V A;  4X64 K;  2ZGY A;  5HRP A;  2QTD A;  1XQS C;  1OH7 A;  1U2V B;  1J53 A;  4O4G A;  1BGX T;  3MWT A;  4F2S A;  2D0P A;  2B4J A;  2HHU A;  3CQX A;  5JVH L;  4O8U A;  1BO5 O;  5LJV A;  4BRO A;  1YTU A;  3V4I A;  2OZS A;  4JKE A;  1NGB A;  3LDS A;  4CF8 A;  4CGD A;  1XWL A;  1VQ8 N;  1HUX A;  3OYB A;  1REV A;  4CHP A;  3RMB A;  3ZSZ A;  3A5N C;  5KGW A;  3AVL A;  3F5T A;  3DAW A;  1TKT A;  1VSM A;  2GWK A;  3SAF A;  3QER A;  3TSP A;  4KHQ A;  3O4W A;  5AQH A;  1CZA N;  3U9D A;  2G8V A;  2D0A A;  1NGD A;  4KB1 A;  1T44 A;  3BUZ B;  3PX0 A;  2ZM6 K;  4DR3 K;  3B6O A;  2QWL A;  1KVA A;  1A5V A;  3P5J A;  3FR0 A;  5BN9 A;  1VSE A;  1JCG A;  1MWM A;  3NBP A;  3VQ6 A;  3V9X A;  3CF5 L;  1A5X A;  4B9Q A;  2E1Y A;  1EXQ A;  4CI6 A;  1TVR A;  3DLL L;  4IBN A;  4MDA A;  2P1J A;  5AQV A;  4U67 L;  2QWP A;  4BRI A;  4E7H A;  2BE2 A;  1GLB G;  3C7N A;  3DXK A;  3CC7 N;  2IIR A;  2P9S B;  1QSS A;  4LFA K;  4W5N A;  1JL1 A;  1KFD A;  1L3S A;  2UUB K;  4HUF A;  5LL6 Z;  4Z4F A;  3DXM B;  3CCL N;  4I2Q A;  3MX2 A;  4CJS A;  2O8B B;  1SKW A;  2X6N A;  1JLE A;  2EHG A;  5AQW A;  3VQ5 A;  2YJF A;  3WEE A;  4AM6 A;  2O8F B;  3PIP L;  3AVK A;  4M42 A;  1RGI A;  3QES A;  2XHB A;  2PZS A;  4DHY A;  3CMA N;  5AZJ B;  4CGJ A;  1EX4 A;  4FK4 A;  4RG8 A;  1NKE A;  4OGE A;  4IFE A;  3FFI A;  1WAF A;  3L2U A;  1IKY A;  2YJE A;  2CGL A;  1NGE A;  1WSF A;  2DFE A;  4FW1 A;  2YNG A;  4CE9 A;  4KHP K;  1D9F A;  5AQL A;  3J7A P;  1C0G A;  4CZG A;  4J2E A;  4FLV A;  3V81 A;  2Q0U A;  1M1K O;  4KTQ A;  4IFV A;  5HOO A;  3AA5 X;  3DRR A;  3ZEU A;  1UAX A;  1EQY A;  1JLF A;  2Z1H A;  5JLF A;  3SV4 A;  2ASO A;  3LDO A;  4LF9 K;  3SUP A;  3CI5 A;  5SZT A;  1VQP N;  1Q81 O;  1V4T A;  4GV9 A;  1MA9 B;  4I6M B;  3WXL A;  3VTH A;  5CHI A;  3LWL A;  5E84 A;  4KHW A;  4ID5 A;  5FPN A;  1XUP O;  1C0U A;  4JV5 K;  2O8E A;  3HT3 A;  1BUP A;  3ALY A;  1TKZ A;  1KD1 O;  4I7F A;  2G8W A;  3DLR A;  4GKK K;  4EAH D;  4GVM A;  2OTL N;  5CYQ A;  4LF6 K;  4FJM A;  4YDU A;  1VQL N;  3AVN A;  1L3V A;  2FBT A;  3AVI A;  4Z4H A;  4PY5 A;  2Y1J A;  1NK6 A;  3P4I A;  4PUO A;  4BRN A;  2W6L A;  3OJS A;  4H0V B;  4FOI A;  3KK3 A;  3CET A;  3TAB A;  2O8D B;  5C25 A;  4RWT A;  5EX5 A;  3SQ4 A;  3E1Y A;  1Y97 A;  2P9K A;  3M8R A;  4J2B A;  4AQY K;  5CE3 A;  5FRN A;  4M3T A;  3P31 A;  4WFA L;  2KZZ A;  5A2Q O;  2FLO A;  1LWE A;  4CJQ A;  3ENO A;  4J8F A;  4JKA A;  1HKC A;  4K43 A;  1QHT A;  1DTQ A;  4KTZ A;  1Z05 A;  2BH1 A;  4CBW A;  5I9E B;  3CFR A;  1VRT A;  4DR2 K;  3GE1 A;  2RPI A;  2IDO A;  3ITH A;  4IOX A;  3V1O A;  4DLG A;  1B9F A;  3DI6 A;  3S3O A;  2YNF A;  3AAR A;  3TAF A;  1K6Y A;  4WYB A;  5TKY A;  4M7Y A;  1CZ9 A;  4PKG A;  1ZBL A;  2WC9 A;  3CCS N;  1TV6 A;  3MX5 A;  4KTW A;  1NJW A;  1RT3 A;  3PX4 A;  4C8K A;  3I8B A;  3KZB A;  4LF4 K;  3CXC M;  1NOY A;  1IBM K;  3NH0 A;  1FKO A;  3VEY A;  4ILG B;  1HLU A;  4CES A;  4DS4 A;  4MFB A;  3K2P A;  1IV0 A;  4DR1 K;  1X9J A;  1NBW A;  5KQD A;  3V9W A;  5CZ2 A;  5FDL A;  1EKE A;  3KKR A;  1KRP A;  5HRS A;  4FLZ A;  5M1O A;  4OKJ A;  3OYJ A;  3N4Q A;  1HKG A;  2G8F A;  4DTO A;  3DRP A;  3D45 A;  1SAZ A;  3QEX A;  1NK5 A;  1BQM A;  4N76 A;  1XHZ A;  5AQZ A;  3EN9 A;  3VF2 A;  4FK0 A;  4KI6 A;  2F9W A;  3K0S A;  4AHR A;  4H0O A;  3U4L A;  1Y64 A;  4CEF A;  3HBT A;  3ZSQ A;  4OKE A;  1S6P A;  1SKS A;  5AQP A;  2FC0 A;  2Z1I A;  4JKD A;  2FBY A;  4N5S A;  5BPM A;  3AO3 A;  4FLX A;  2ZJR L;  1EET A;  2GUP A;  2KKZ A;  1U49 A;  1NGA A;  1VSF A;  2HB5 A;  4GV6 A;  5M1F A;  4CW7 B;  2HST A;  4H5R A;  4JI1 K;  3MN9 A;  4DCH A;  3WQT A;  4U7B A;  4W5T A;  3QEP A;  4JN4 A;  3DOK A;  3HI0 A;  1U4B A;  4BAC A;  3ZX2 A;  1RT7 A;  2QI2 A;  3NFA A;  1QQM A;  2HNY A;  1JL2 A;  3RWU A;  4EIA A;  4JKG B;  5SWM A;  3RR7 A;  2E4L A;  4DR7 K;  4KB0 A;  3F9K A;  4CZM A;  1HPZ A;  5BN8 A;  3O1B A;  5C24 A;  4H4O A;  1ZC6 A;  4BE1 A;  3BZC A;  1VSK A;  3TAM A;  1TYQ A;  2A5X A;  1NJZ A;  1MDU B;  1N33 K;  1F21 A;  3I33 A;  1BIS A;  3IDH A;  3H3O B;  3D2E A;  5AQQ A;  2RN2 A;  4AHC A;  1ZXO A;  4FM0 A;  3CC4 N;  4C8N A;  4Z0U A;  2E1Z A;  4CFB A;  1WBD A;  3ENH A;  4WCE L;  4B3S K;  1SV5 A;  5KPR A;  4CER A;  3VGK A;  4PA1 A;  1ATN A;  3AVA A;  1ZBI A;  1YF5 L;  2YHA A;  1LAV A;  1Q8I A;  4R79 A;  4CJE A;  3QIN A;  2Q36 A;  3CCM N;  1R59 O;  4BDY A;  2XO7 A;  4H4M A;  4LC9 B;  4A5A A;  2UU9 K;  2FSN A;  3BEX A;  2E2Q A;  4PWD A;  4YY3 K;  3M8P A;  4DV1 K;  3M6G A;  4KH5 A;  3WEE B;  1SKR A;  1HYS A;  1VHX A;  4KPY A;  4BGA A;  5HBM A;  1HMV A;  5LY3 A;  5HRN A;  3KKS A;  3V1Q A;  3EZW A;  1E4F T;  3HP9 A;  4O5B A;  3SV3 A;  4IG0 A;  2Y1I A;  1NWK A;  4DQP A;  4E0D A;  1CZB A;  4LSL A;  3DLE A;  1IKW A;  3THY A;  2P9N B;  3WXJ A;  2GWJ A;  3ZSW A;  4E1J A;  3QEW A;  4KKO A;  1ASU A;  4M3W A;  5ADX H;  1KAY A;  3D2F B;  3KLH A;  5M1K A;  4E7K A;  1KSP A;  3R6M A;  1UA1 A;  4WE1 A;  5KTQ A;  4DFJ A;  4Y0W A;  4KFB A;  5KPT A;  3TTC A;  4E89 A;  2OTJ N;  2HW3 A;  5C10 A;  2V52 B;  3ZEU B;  3M8Q A;  1Q86 O;  4HTU A;  1JXB A;  5AQF A;  5IT9 O;  4FSV A;  5DM6 L;  4KHY A;  3RRH A;  4F9O A;  2O4I A;  4DR4 K;  4BRH A;  2IVP A;  3G6E N;  4G1Q A;  2BGG A;  4TSX A;  1YIT N;  2IVO A;  3K5O A;  1BI4 A;  2VGM A;  5BR8 K;  2O8E B;  3ZSX A;  3SUQ A;  2ATQ A;  3QBX A;  3IRX A;  4FJ7 A;  1HNW K;  1EWQ A;  5AQR A;  4O0I A;  3JSM A;  2GUI A;  4CEZ A;  1ATS A;  3CQY A;  4IJN A;  1YIJ N;  1HQE A;  4DTJ A;  4XH5 A;  1ESV A;  1BCO A;  1T6D A;  2PY5 A;  4LFC K;  2YHY A;  3HM9 A;  4DFP A;  2P9K B;  4RCH A;  3TTD A;  3HYF A;  4LH4 A;  3UKR B;  3L2Q A;  2UUC K;  2Z1J A;  3TR8 A;  5C12 A;  3G10 A;  3K5L A;  5AQT A;  4FK2 A;  1SUQ A;  3SZ2 A;  1TUU A;  2QKK A;  4BG8 A;  4CJK A;  1D5A A;  3QLH A;  1NJY A;  3GDQ A;  2WBN A;  1O13 A;  2P9L A;  4MQ3 A;  4B3T K;  4QS9 A;  3TSU A;  3VMF B;  2VG5 A;  3SI6 A;  3SYZ A;  4NCB A;  1O1W A;  3I0S A;  4DV4 K;  2I7N A;  3P83 D;  2BUP A;  3J7Z O;  1GLL O;  1KLN A;  3VGM A;  1GOA A;  1RBU A;  3ZT3 A;  1NK8 A;  1TK8 A;  3QNN A;  4BQZ A;  5GIN A;  1HYZ A;  1VQO N;  4Z4E A;  3EZ5 A;  2D5R A;  4IFY A;  2ZD1 A;  1U6Z A;  2IS3 A;  1VQN N;  4OPA A;  2AP1 A;  3SPY A;  1W7A A;  4B8C A;  3IUC A;  3VQQ A;  5LJW A;  4DFK A;  2HBM A;  3Q7B A;  1GOB A;  2XY6 A;  4RW7 A;  4JI7 K;  2IC3 A;  2KFN A;  4RW4 A;  3WXK A;  4B9V A;  4LFB K;  4FVU A;  2WFB A;  3ULD A;  5BRF A;  1S9E A;  4CJ4 A;  2VWB A;  1BL3 A;  1RT6 A;  3FLC O;  4F3O A;  2QA4 N;  3V9S A;  3H45 C;  4DQ8 A;  1RDW X;  3ZX3 A;  1FKP A;  5AQS A;  1WUA A;  3VTI A;  4CZJ A;  4PQU A;  3G71 N;  2QM1 A;  2A1R A;  4LD0 A;  1X1P A;  5FPM A;  1L5U A;  3KD1 E;  4IDK A;  2YHW A;  2HHQ A;  1N32 K;  5KGX A;  1QZ6 A;  4FM1 A;  1ILY A;  1WSG A;  3SBG A;  1A5W A;  2ASM A;  3LZI A;  4QCL A;  1H1V A;  4DV7 K;  4HCB A;  4CFC A;  1NJX A;  1NGH A;  3MDQ A;  4BVO A;  3G25 A;  3T19 A;  4F2R A;  3MEE A;  1YVU A;  3QIP A;  3NH1 A;  1C6V A;  4Z4C A;  3O9U A;  3HST B;  5JLH A;  3NDK A;  1OKJ A;  3HVR A;  4FJ8 A;  4JI8 K;  3IG1 A;  3KWI A;  4FM2 A;  5EY4 A;  3C65 A;  2LSN A;  2JLE A;  2A42 A;  5C15 A;  3CHW A;  1WBB A;  4KHN A;  3ISN C;  2KLA A;  1NK7 A;  2A6A A;  1NMD A;  1BWF O;  3VQB A;  4DKW A;  3U9Z A;  4AHU A;  3WNE A;  1RT2 A;  4IZ9 A;  3D2E B;  3HK2 A;  3I0R A;  3VEW A;  4CF2 A;  4DV6 K;  1XMQ K;  4UY8 O;  3K5N A;  3AVJ A;  3SMP A;  3OYK A;  4CBU A;  4FPB A;  1NNE A;  5AFU A;  1WSJ A;  2A40 A;  4KH4 A;  4FJ9 A;  3H1V X;  5I3U A;  2VWK A;  3DWL A;  3AVC A;  3SQ1 A;  3EL2 A;  1L3U A;  3THX A;  1X9S A;  3HTV A;  5EXW A;  4WQ5 C;  3VQA A;  3SPZ A;  2W41 A;  4C8M A;  4K25 A;  1S9G A;  1RTD A;  2EX3 A;  1ITG A;  2ZF5 O;  1HRH A;  4J2D A;  2NRW A;  4CEO A;  3PX6 A;  2OAN A;  1DGK N;  3RMD A;  3M1F A;  1RBR A;  4Z94 A;  1QHA A;  4O44 A;  4YDU C;  4ZHR A;  3LP1 A;  2HMI A;  4B8A B;  4CJL A;  2D0O A;  3LAL A;  1YXQ A;  4YOX A;  3VEZ A;  5AQM A;  3TAQ A;  3U6F A;  4PL8 A;  1NLV A;  1SL2 A;  2NRZ A;  3ULE B;  4L8R B;  4BDZ A;  4BRK A;  3OYH A;  4FLU A;  1I94 K;  3CJ9 A;  3ZSV A;  1XHX A;  4CIE A;  3THY B;  2HBK A;  4LH5 A;  1EWR A;  3CG7 A;  3AA2 A;  3MEC A;  3OVN A;  4CHN A;  3EEQ A;  1IO2 A;  3LM9 A;  1SL1 A;  3CJA A;  1T7P A;  1QS4 A;  3O9Q A;  3OYI A;  1WB9 A;  2ZGZ A;  3E9L A;  3IAY A;  1RBV A;  4DWI A;  4DTN A;  4ISF A;  3KK1 A;  4I9L A;  1UA0 A;  4BRG A;  4FVM A;  2H3G X;  2A3Z A;  2P51 A;  2KFZ A;  1ZBF A;  4OJR A;  3MCP A;  4E19 A;  4Z4G A;  2YCH A;  1S3X A;  3ZLJ A;  3QNO A;  2O4G A;  3TAN A;  1E3M A;  1N34 K;  4K8Z A;  1LCU A;  4FW2 A;  1NG9 A;  4CZE A;  1Q7Y O;  1HJR A;  4CIG A;  4H8K A;  3PIO L;  1BI4 B;  3T69 A;  4A57 A;  1Z26 A;  2NRR A;  3ZT1 A;  4RW9 A;  3PSF A;  4BRP A;  1X3M A;  3H6E A;  3CFP A;  3RMA A;  3KJV A;  4KAZ A;  2DTU A;  3NF9 A;  3TAR A;  4B3M K;  4JHD A;  2X6S A;  3R3L A;  4JAX A;  4C23 A;  3U3Y A;  1TL3 A;  5M1P A;  4OPH A;  2HHV A;  2A41 A;  4MDB A;  4DMN A;  1NK4 A;  4FJJ A;  2YKM A;  3H3N O;  3FE1 A;  3K59 A;  3OYD A;  4KBO A;  2GV9 A;  4CZF A;  4FYD A;  2ETJ A;  5KRS A;  3HSC A;  2BAN A;  1VQ4 N;  4ILH A;  3OYG A;  2QWR A;  1YUW A;  4EFH A;  3AVB A;  1N6Q A;  3P39 A;  3KTQ A;  3I56 N;  4NXN K;  3VQ9 A;  1RDB A;  1ZYQ A;  3PLA A;  1X9W A;  1BIU A;  2UUA K;  3RR8 A;  3OYA A;  4WF9 L;  4JS4 A;  3CPW M;  1FXX A;  4JI6 K;  4CVN E;  4BC4 A;  3W3D A;  3VQ4 A;  3PY8 A;  4FJX A;  4E7L A;  5CZ1 A;  4HVJ A;  1RDD A;  2UYT A;  1L3T A;  1QE1 A;  3CER A;  2B6A A;  2KQ2 A;  4FOE A;  5AR0 A;  3D6R A;  3VPZ A;  4E1N A;  3J7Y P;  2B5J A;  1K8A O;  2QK9 A;  1HJO A;  5C2F A;  3S3N A;  2JWK A;  2GX9 A;  5E41 A;  5AQY A;  1RCH A;  1Z6R A;  4CGG A;  4FJH A;  3BY5 A;  5D3G A;  4O0J A;  3D7E O;  4N56 A;  4DF8 A;  4JK8 A;  4CEC A;  3OYN A;  4KHS A;  3GOI A;  4CGH A;  4ZTJ A;  2YI1 A;  4B9L A;  4HCC A;  3LPU A;  2FBV A;  4FWP A;  4LY7 A;  2P9U A;  4FL9 A;  3CJ1 A;  4FJG A;  4JK9 A;  2Q97 A;  5C0Y A;  1RFQ A;  3VEX A;  2OCE A;  1KQS M;  4N41 A;  3QB0 A;  4B1W B;  4CJR A;  5HRO A;  5BR9 A;  4FWO A;  4CCH A;  4J2A A;  2D4W A;  3B8A X;  3UKU A;  2VQE K;  4CK2 A;  4BDP A;  4CJW A;  1VAZ A;  3FZH A;  4B9M A;  2DY4 A;  1K8K A;  3JAM O;  2HVH A;  3ZET A;  4CBX A;  1FK9 A;  3G4S N;  1ASW A;  4PKH A;  4X62 K;  3CJ7 A;  3AGR A;  3ZCM A;  4JLH A;  4FZY A;  5HLF A;  3F73 A;  2G8K A;  3WNG A;  3MXI A;  1GLA G;  1Q9X A;  2OPP A;  4CFD A;  2W42 A;  3L4Q A;  5AQN A;  3E66 A;  3CJC A;  4CJ5 A;  5MLC Q;  3VQD A;  4JS5 A;  1OH8 A;  1YHQ N;  1EP4 A;  4M63 C;  1QSL A;  1I39 A;  3ASM A;  4JNE A;  4CJV A;  2YHX A;  4FJ5 A;  4W5R A;  3O5B A;  3CCE N;  2CH5 A;  4NXM K;  4BRQ A;  1LWC A;  2HND A;  2NZT A;  3CFO A;  2NRX A;  4QS8 A;  4JI0 K;  3BGR A;  3LAM A;  1YJN N;  2VGN A;  3VQC A;  4ELT A;  2FSK A;  1Q18 A;  2JWL A;  2HOE A;  3BF3 A;  3O08 A;  4K0K K;  5K14 A;  3C6A A;  4IJA A;  4CJT A;  1LAW A;  2YNI A;  4DTX A;  4BRC A;  1U2V A;  3Q7C A;  1VSD A;  4BR5 A;  4FCY A;  1QVF M;  3ZSO A;  4OPK A;  2QXF A;  2IOC A;  4BR7 A;  3O1W A;  2I7P A;  4IEI A;  3TU5 A;  4O55 A;  2E2O A;  3CM6 A;  4K41 A;  5HRR A;  3O3H A;  1YJW N;  2ITG A;  1QQO A;  5FRO A;  3LDQ A;  2NUB A;  3SJH A;  4OPJ A;  3KLF A;  4DV5 K;  1KVB A;  3THV A;  3C7N B;  3DXK B;  3HXM A;  2ZQB A;  1KLM A;  3NGY A;  4DUY K;  3O3F A;  3FZF A;  4BC5 A;  2X74 A;  3F2K A;  3NAE A;  3RTV A;  2WOM A;  4B1U B;  4DSE A;  4FXD A;  1D8Y A;  1JLG A;  2QWN A;  4CEB A;  5ELZ A;  4CF1 A;  2Q1N A;  4C8L A;  3NVK A;  4DR5 K;  3U8X A;  2QKB A;  5F2R A;  3V9U A;  2E8A A;  3LWM A;  1GLD G;  4WQ4 A;  5AQU A;  2RKI A;  2CGJ A;  3HP6 A;  3P38 A;  1S1X A;  1HX1 A;  1NGF A;  4BRE A;  3EYZ A;  4FWL A;  4FWS A;  5EU7 A;  1NM1 A;  1LW2 A;  3L4I A;  3J81 O;  4JYA K;  3L2W A;  5CYM A;  3ENB A;  1C1B A;  2JGU A;  3UE5 A;  2VG6 A;  1JLA A;  1E4G T;  3VA3 A;  3O3G A;  4YOT A;  1NOZ A;  5AQO A;  1VQM N;  3KHY A;  2UXB K;  5CY4 A;  1WSH A;  5M1Q A;  3AA4 A;  2P5G A;  3MWP A;  2F4V K;  3L3V A;  4JI5 K;  3TSQ A;  3A5O C;  3DXM A;  1RT1 A;  1TAQ A;  3NH2 A;  5KI6 A;  3U3G A;  2X78 A;  4DTM A;  3LP2 A;  4IDH A;  3C94 A;  1SL0 A;  2PBD A;  3T3F A;  2ASP A;  2O8F A;  1GLJ O;  1XC9 A;  1HNI A;  4NYF A;  3H46 O;  3TTF A;  3HO1 A;  3O6W A;  3WQU A;  1LOT B;  2V7Z A;  1RDC A;  4M3X A;  1RDA A;  3T7Z A;  1KC8 O;  4CD3 A;  5AQX A;  4YOU A;  3W0L A;  5TKW A;  3MEG A;  2ITM A;  2E20 A;  3UB5 A;  3VQP A;  1DTT A;  2Q3S A;  1S72 N;  3MMV A;  3LAK A;  5J2Q A;  1SZ2 A;  2J4R A;  5KQ8 A;  4W5Q A;  4XEI A;  5I42 A;  1J9A A;  4FLT A;  1VSI A;  1U45 A;  3CCJ N;  3QBW A;  5AQI A;  4OGC A;  4B9U A;  2P9P A;  1MU2 A;  2VWJ A;  4X66 K;  1N8R O;  2NNW A;  2F96 A;  3HOS A;  1QQN A;  4YFU A;  3TWH A;  1P8Z A;  3GBT A;  5DM7 L;  4CK3 A;  3LDL A;  1ZBS A;  4EZ9 A;  4CJ3 A;  4BVP A;  1NGJ A;  1WN7 A;  4I6M A;  4OLA A;  3C95 A;  2YV0 X;  3CCR N;  4B08 A;  4DB3 A;  1U48 A;  2D1K A;  3V9Z A;  1HNV A;  1KAZ A;  3WXI A;  3A8Y A;  3V6D A;  3HZ6 A;  3KK7 A;  4CJP A;  3NE6 A;  1RNH A;  3LDN A;  3ATU A;  4A62 A;  3TPQ A;  1DLO A;  2HF4 A;  3GL1 A;  3NHG A;  4DU3 A;  3H08 A;  4BRD A;  3OYL A;  1FJG K;  5GIO A;  4DR6 K;  1WNS A;  3BDP A;  2O8D A;  4FWN A;  4ELU A;  1JCE A;  3CPE A;  2RE2 A;  1HNX K;  2P9U B;  2F9T A;  4H0P A;  4IO8 A;  1T6C A;  1ASV A;  1XNQ K;  4A5B A;  3EE9 A;  2Z1G A;  3FFK B;  1XI1 A;  4GVE A;  3LPT A;  3ZT2 A;  3CQ8 A;  5F0X A;  2OZM A;  1C1C A;  4JD2 A;  4BC2 A;  2ZJQ L;  3VF6 A;  3UKU B;  1KVC A;  3MN5 A;  2HMP A;  4DV0 K;  1S1U A;  4LSN A;  2WUS A;  4JI3 K;  4Q5V A;  3ZET B;  4DV3 K;  2UXD K;  2HBL A;  2F7T A;  2DFH A;  4IO9 L;  1JLC A;  1DEJ A;  1SS6 A;  4EP4 A;  4OKK A;  4CGI A;  3ZSY A;  1TK5 A;  3V1R A;  4JKF A;  3SQ2 A;  3DJC A;  2O8C A;  1EO1 A;  3QEI A;  4YNQ A;  3AAQ A;  4JRP A;  4B9N A;  4MO5 A;  4FPA A;  1QVG M;  5IWA K;  4CZK A;  3AO1 A;  1RTH A;  3EKU A;  1NGC A;  3KVG A;  1KXP A;  4CHO A;  2A1S A;  4KH6 A;  3THW A;  4DTR A;  4KRF A;  4BRF A;  3QFU A;  3OW2 M;  1FW6 A;  1TYQ B;  4DTP A;  3DRS A;  2PAV A;  4GNI A;  4B3O A;  3HPH A;  4BC3 A;  5DK5 A;  4ILJ A;  1TAU A;  3VA0 A;  5BRD A;  1C0M A;  1NK9 A;  1T03 A;  2KZM A;  2R7Y A;  5GIP A;  4DQQ A;  1S1V A;  3HJF A;  1IG9 A;  4LF8 K;  3H1Q A;  1YVN A;  2YKN A;  3SMS A;  1HKB A;  1VQ9 N;  4GMJ B;  1XNR K;  3B6P A;  4NO7 A;  4ID1 A;  4MLH A;  2OPS A;  1TUY A;  4C1N K;  1DT9 A;  3DMJ A;  3C6H A;  4JKG A;  3TAG A;  3QML A;  2VCP A;  3FZM A;  5C42 A;  5B8H A;  3O8M A;  2VYP A;  3WNF A;  4KI4 A;  1GLE G;  1IKX A;  4CHZ A;  5JIC A;  4M3R A;  2E6M A;  4FJL A;  3LM2 A;  1NGG A;  2G8I A;  5LMU K;  1OVQ A;  3J80 O;  3QET A;  3JS6 A;  1RIL A;  1BDG A;  1G99 A;  1VSJ A;  1RTJ A;  4ISE A;  3T1A A;  3E9O A;  2AJQ A;  3KWG A;  3T1H K;  5AQJ A;  4KV8 A;  1KTQ A;  3HPG A;  4ICL A;  2FBX A;  4H03 B;  2PYL A;  4B9T A;  2DPN A;  3QDK A;  3D0P A;  4YOY A;  3DLB A;  3MAQ A;  1J5O A;  1S22 A;  4B3R K;  4F4K A;  3FGU A;  2P9I A;  1ZBU A;  3MXJ A;  1VQK N;  4ZTF A;  5BPL A;  4FWQ A;  3LP0 A;  1BHL A;  1SQK A;  3OYM A;  2PFU A;  3HRG A;  1C1A A;  3MN7 A;  3MK6 A;  4FJI A;  1W0H A;  1J54 A;  2HHW A;  4DV2 K;  3L2V A;  4AHV A;  4IKF A;  2NLX A;  1B92 A;  1LV5 A;  2YHB A;  3AVH A;  4KRE A;  3LL3 A;  4F8R A;  3AA3 A;  5FLX O;  3BP8 A;  3LP3 A;  3EKS A;  3VET A;  2VG7 A;  2ZWH A;  4FZZ A;  1VRU A;  4AF1 A;  1WAJ A;  2UXC K;  4DS5 A;  5F1X A;  1UOC A;  1HYV A;  4DTS A;  1TK0 A;  1T8E A;  4EHT A;  4M41 A;  4PL7 A;  3TI0 A;  4GV3 A;  2P9N A;  4BE2 A;  2CGK A;  2HVI A;  1D4X A;  2WON A;  3MXM A;  4I9Q A;  3OS0 A;  3C0B A;  4HHT A;  4Y1C A;  3OY9 A;  2BTF A;  5FPD A;  3L2R A;  4FWK A;  4EHU A;  1BIZ A;  4EZ6 A;  4A2A A;  3A5M C;  4CZI A;  1CLQ A;  3D2F A;  2HBJ A;  1C0T A;  1RT4 A;  3EO3 A;  3VOV A;  3O9T A;  2P9P B;  3VQE A;  4H5T A;  4BRA A;  1Q82 O;  4O8K A;  2BDP A;  4CZL A;  3NCI A;  1NU0 A;  4N47 A;  3I8D A;  2YX6 A;  1JLQ A;  1U04 A;  4NLB A;  1IKV A;  4IOA L;  4OVL A;  2P9L B;  3AO5 A;  1DKG D;  3WNH A;  4WQ5 A;  4KO0 A;  3N4P A;  4FWM A;  2XY8 A;  2W40 A;  2KW4 A;  2F8T A;  2NRT A;  1W2B M;  4MO4 A;  3CC2 N;  1WSE A;  2HHX A;  1W97 L;  4NYN A;  1JCF A;  3SAG A;  4HUE A;  1B9D A;  3MCA B;  4OO1 J;  3SK3 A;  3RVC A;  2QWQ A;  3SUO A;  3ZT4 A;  5JVG L;  2VQF K;  1BU6 O;  1VK0 A;  5M1N A;  4WFB L;  1RBS A;  4QS7 A;  2Q0R A;  3L0Q A;  5J2P A;  3J8A A;  4BY9 C;  5JS2 A;  1JKH A;  3HL8 A;  1RDU A;  4BR4 A;  4BRL A;  3L6Q A;  1XMO K;  3KIO A;  3UKR A;  3CD6 N;  4AIL C;  3K9K A;  4GY2 B;  4ELV A;  2RF2 A;  3SNN A;  1HR0 K;  4ISG A;  2YNH A;  3AVG A;  3CIP A;  4JD2 B;  3K58 A;  4DQR A;  4M3Y A;  5AZI A;  2G8H A;  4H5N A;  4E7J A;  3OA9 A;  1YT3 A;  5AQK A;  3QEV A;  3EE8 A;  2Q31 A;  4E3S A;  3VER A;  4DSK A;  3A5L C;  1V4S A;  5E26 A;  5GAE P;  4BQL A;  1U47 A;  4CJ7 A;  4YOV A;  4M3Z A;  3HVT A;  1Q9Y A;  3S9H A;  2O8C B;  3C6T A;  4Z4I A;  3NMU A;  1IBL K;  2IVN A;  5GAD P;  3IFR A;  1IH7 A;  5J2M A;  1VSL A;  2E5L K;  3NVM A;  4WQ4 C;  3CYM A;  4LF7 K;  4QAG A;  4M3U A;  3BZK A;  1RT5 A;  3VF4 A;  5CR4 A;  3UIQ A;  4HTL A;  1XC3 A;  4DU4 A;  3THW B;  2FF6 A;  4EP5 A;  1X3N A;  3R8E A;  5HP1 A;  4KHU A;  4AH9 A;  3AVM A;  4E1M A;  3AV9 A;  3NF7 A;  4AHT A;  3AO2 A;  3O9R A;  3HOT A;  3NF6 A;  4BGB A;  5JMV A;  5LMN K;  3SLC A;  3CCV N;  1QQC A;  3O80 A;  4K8X A;  1C0F A;  3A0I X;  5AQG A;  1K73 O;  3ID8 A;  1N5Y A;  2NRV A;  2F8S A;  4CIF A;  3QIO A;  3I55 N;  3OS2 A;  4V19 S;  3AVF A;  4M7X A;  2FXU A;  3KK2 A;  3ATV A;  4CHY A;  3ZX0 A;  4HUG A;  4BR2 A;  1VSH A;  4DG1 A;  3THX B;  1T3V A;  2CH6 A;  1NKB A;  4FO0 A;  4A2B A;  5EVZ A;  5T7B A;  4F3T A;  3RSE A;  2D0B A;  4DSF A;  2NRH A;  2QEX N;  2Q2R A;  1K9M O;  4FWR A;  3QIC A;  1HPM A;  3PUF A;  1YJ9 N;  3HM8 A;  3OBY A;  1IJJ A;  5BPN A;  4LF5 K;  3VEO A;  4BRM A;  3G0Z A;  3T1Y K;  2XY7 A;  1NK0 A;  4PKI A;  2DFF A;  3O4Q A;  1RTI A;  2V7Y A;  1KCF A;  3ID6 A;  4IG3 A;  2HHS A;  4DSI A;  1ATR A;  3CM5 A;  4GW6 A;  2XY5 A;  3S3M A;  4DUZ K;  4CEA A;  2OYQ A;  1YAG A;  4CJF A;  3OTO K;  1CXQ A;  4YHH K;  4JKH A;  4DF4 A;  2V51 B;  4IWV A;  3R9P A;  4HWI A;  1BA0 A;  2HNZ A;  4O5F A;  3L8B A;  3PSI A;  3RMC A;  5AJ3 K;  2P9I B;  3DM2 A;  4X65 K;  3OHR A;  3LZJ A;  5KPZ A;  3SQ0 A;  2W6K A;  4H0X B;  2E2N A;  3C6U A;  1NJI O;  2QXL A;  3P1G A;  5BRH A;  3CCU N;  3MN6 A;  2IGI A;  3CCQ N;  2QWO A;  3R1X A;  2KHO A;  1S1T A;  1T05 A;  4DLE A;  4CF9 A;  3VQ7 A;  1X9M A;  4IOC L;  1BCM A;  5C2D A;  1D9D A;  4JEP A;  4CK1 A;  4UQG A;  3NGZ A;  3ULE A;  1ZBH A;  2I5J A;  4CJU A;  4CD1 A;  4FJK A;  4OLB A;  5HL7 L;  4BWJ A;  2P9S A;  2QW9 A;  2IAJ A;  3FZL A;  3QFP A;  1BOT O;  4H0Y B;  4AM7 A;  2AA4 A;  2OPR A;  4Q0B A;  5J1E A;  2RHK A;  4M45 A;  2GBZ A;  2GTD A;  2O8B A;  4JHD B;  4JK7 A;  3OYF A;  1YI2 N;  4CZH A;  4WFN L;  4DTU A;  3E01 A;  3VQ8 A;  3KLG A;  4FLW A;  2XRI A;  1TKX A;  3KD5 E;  5GAH P;  3IS9 A;  3O4N A;  4NB4 A;  2ZE2 A;  3SBT A;  3WXM B;  5AZJ A;  4L3Q A;  1S5J A;  4B1Z A;  2KTQ A;  4G9Z A;  1HQU A;  4C8O A;  1CXU A;  4I2P A;  3GG4 A;  3WT0 A;  4CF0 A;  4A59 A;  3JYT A;  3OYE A;  4BE0 A;  2PYJ A;  2GEM A;  3IMX A;  3MED A;  4RW6 A;  4CED A;  4FLY A;  1N36 K;  3CME N;  5AFU H;  3KLI A;  1IG8 A;  4DFM A;  3PO5 A;  1HNZ K;  3PO4 A;  3M8S A;  3FZK A;  3ZSR A;  3AO4 A;  1MWK A;  1OH6 A;  4NLC A;  5EOY A;  3L3U A;  1NKC A;  1KFS A;  4YOW A;  5DMR A;  1P90 A;  2G8U A;  3DLK A;  3DOL A;  4MLE A;  4DSL A;  3HPO A;  1GLF O;  1NGI A;  2P5O A;  3S41 A;  2OA8 A;  3EY1 A;  4JKB A;  5FRM A;  2FSJ A;  4DSJ A;  2HF3 A;  4B1V A;  5J2N A;  3QO9 A;  1JLB A;  4B1X B;  3VGL A;  4BG9 A;  4NCA A;  1RBT A;  1KAX A;  1JXE A;  3OYC A;  3K5M A;  1VQ7 N;  4A61 A;  3DYA A;  4AHS A;  4XIU A;  4RW8 A;  4QOZ B;  1TGO A;  3VEN A;  1W9H A;  1VQ5 N;  1GOC A;  1OH5 A;  5AZI B;  3A2F A; 
#chains in the Genus database with same CATH homology
 2YHA A;  1LAV A;  1Q8I A;  2KQ2 A;  3QET A;  1BQN A;  4CFA A;  3QIN A;  4CJE A;  1RIL A;  4E1N A;  1VSJ A;  1RTJ A;  3T1A A;  2AJQ A;  4KV8 A;  1KTQ A;  3HPG A;  4BDY A;  2HHT A;  2B5J A;  4DQS A;  2QK9 A;  4ICL A;  2XO7 A;  2FBX A;  2PYL A;  2D0C A;  3S3N A;  4H4M A;  4BWM A;  3TAE A;  5E41 A;  1Z25 A;  1TKD A;  4CEE A;  3D0P A;  4B9T A;  4PWD A;  4CEQ A;  1TL1 A;  1RCH A;  3MAQ A;  3DLB A;  3M8P A;  1J5O A;  1QTM A;  4FJH A;  4CGG A;  4B9S A;  3OJU A;  4F4K A;  1LW0 A;  1SKR A;  1ZBU A;  4FJN A;  4O0J A;  3MXJ A;  4Y1D A;  3DLG A;  4N56 A;  4DF8 A;  4ZTF A;  1HYS A;  3LP0 A;  1BHL A;  4DU1 A;  1WSI A;  4CEC A;  1S1W A;  4R5P A;  3OYN A;  5HBM A;  4KPY A;  1HMV A;  4KHS A;  1S6Q A;  3KKS A;  3V1Q A;  3VN5 A;  5HRN A;  3OYM A;  4CGH A;  3SJJ A;  1C1A A;  2OPQ A;  3HP9 A;  4O5B A;  3SV3 A;  4ZTJ A;  4B9L A;  4IG0 A;  2Y1I A;  4DQP A;  3LPU A;  4HCC A;  4FJI A;  1W0H A;  2FBV A;  1J54 A;  1CZB A;  4LY7 A;  4E0D A;  2HHW A;  4LSL A;  3L2V A;  3TAP A;  4AHV A;  4FJG A;  4IKF A;  4JRQ A;  3PV8 A;  1B92 A;  3DLE A;  2YHB A;  1IKW A;  1LV5 A;  4W5O A;  3AVH A;  3ZSW A;  1W9H A;  3QEW A;  4KRE A;  4KKO A;  4F8R A;  4N41 A;  3AA3 A;  1ASU A;  1QSY A;  3LP3 A;  1I3A A;  4E7I A;  4M3W A;  4CJR A;  5HRO A;  4CCH A;  4J2A A;  3LAN A;  2VG7 A;  4FZZ A;  1UWB A;  1VRU A;  3KLH A;  4BDP A;  5JS1 A;  4CK2 A;  4CJW A;  1WAJ A;  4DS5 A;  4B9M A;  4E7K A;  3KLE A;  1KSP A;  2DY4 A;  1UA1 A;  4WE1 A;  1UOC A;  5KTQ A;  4DFJ A;  1HYV A;  4KFB A;  2HVH A;  4DTS A;  1TK0 A;  1T8E A;  4M41 A;  4E89 A;  1FK9 A;  1YTA A;  3TI0 A;  2HW3 A;  1ASW A;  4CHQ A;  3M8Q A;  3ZT0 A;  4BE2 A;  2HVI A;  4HTU A;  1JXB A;  3NF8 A;  2WON A;  3MXM A;  4I9Q A;  3OS0 A;  4KHY A;  3NGI A;  3ZCM A;  4JLH A;  3RRH A;  2O4I A;  4FZY A;  3RRG A;  5HLF A;  4HHT A;  4Y1C A;  3F73 A;  3SCX A;  2G8K A;  3WNG A;  3OY9 A;  4FZX C;  3L2R A;  3DLH A;  3MXI A;  4EZ6 A;  1BIZ A;  4G1Q A;  4NCG A;  3K57 A;  1Q9X A;  2BGG A;  2OPP A;  4TSX A;  4DQI A;  1WLJ A;  2E6L A;  4CFD A;  2W42 A;  1R0A A;  1CLQ A;  4CJ5 A;  1G15 A;  1C0T A;  1RT4 A;  3VQD A;  3OS1 A;  4JS5 A;  3K5O A;  1LWF A;  1EP4 A;  1BI4 A;  5KRT A;  3VQE A;  3SUN A;  1QSL A;  3ZSX A;  3SUQ A;  2ATQ A;  4CGF A;  3IRX A;  2BDP A;  4FJ7 A;  1I39 A;  3ASM A;  3NCI A;  4CJV A;  5HRP A;  4N47 A;  3I8D A;  4O0I A;  4FJ5 A;  4W5R A;  1JLQ A;  1U04 A;  1J53 A;  1IKV A;  1BGX T;  4O4G A;  4OVL A;  4F2S A;  2B4J A;  3AO5 A;  2HHU A;  3JSM A;  2GUI A;  1LWC A;  4CEZ A;  2HND A;  3CFO A;  3WNH A;  1HQE A;  4DTJ A;  1YTU A;  3BGR A;  3LAM A;  3V4I A;  4KO0 A;  2OZS A;  1BCO A;  2XY8 A;  3VQC A;  2PY5 A;  2KW4 A;  4ELT A;  2F8T A;  3LDS A;  4CF8 A;  1WSE A;  3HM9 A;  4CGD A;  1XWL A;  2HHX A;  4DFP A;  3OYB A;  3HYF A;  4NYN A;  4HUE A;  1B9D A;  4LH4 A;  5K14 A;  3L2Q A;  2Z1J A;  3TR8 A;  3G10 A;  1REV A;  3K5L A;  4CJT A;  3SUO A;  3ZT4 A;  4CHP A;  3RMB A;  1LAW A;  2YNI A;  3ZSZ A;  1SUQ A;  3SZ2 A;  4DTX A;  2QKK A;  4FK2 A;  5KGW A;  3AVL A;  1VK0 A;  4CJK A;  1D5A A;  1RBS A;  3QLH A;  1NJY A;  1TKT A;  1VSD A;  1VSM A;  4MQ3 A;  5J2P A;  3QER A;  4FCY A;  3ZSO A;  2VG5 A;  4OPK A;  3SI6 A;  4KHQ A;  2QXF A;  2IOC A;  3SYZ A;  4NCB A;  1O1W A;  3I0S A;  5JS2 A;  4O55 A;  3CM6 A;  5HRR A;  2G8V A;  1JKH A;  3HL8 A;  3O3H A;  3P83 D;  2ITG A;  5FRO A;  2NUB A;  1KLN A;  2D0A A;  4OPJ A;  3KLF A;  4KB1 A;  3PX0 A;  1KVB A;  1GOA A;  3KIO A;  1RBU A;  3THV A;  3ZT3 A;  2G8I A;  3B6O A;  2ZQB A;  3HXM A;  4AIL C;  1KVA A;  1NK8 A;  1TK8 A;  1KLM A;  3QNN A;  1A5V A;  3NGY A;  3P5J A;  3O3F A;  1HYZ A;  1VSE A;  4ELV A;  3VQ6 A;  2X74 A;  3NBP A;  3NAE A;  3RTV A;  3V9X A;  4Z4E A;  2RF2 A;  3EZ5 A;  2D5R A;  2WOM A;  4IFY A;  4DSE A;  4FXD A;  1D8Y A;  3SNN A;  2ZD1 A;  2IS3 A;  1JLG A;  2YNH A;  4CEB A;  1A5X A;  3AVG A;  1EXQ A;  4CF1 A;  3K58 A;  4C8L A;  1TVR A;  4DQR A;  4M3Y A;  3SPY A;  4B8C A;  2G8H A;  4IBN A;  2QKB A;  4E7J A;  2P1J A;  3VQQ A;  1YT3 A;  4DFK A;  3V9U A;  4E7H A;  3QEV A;  1GOB A;  3LWM A;  2XY6 A;  2BE2 A;  4RW7 A;  2IC3 A;  2RKI A;  4E3S A;  2KFN A;  4RW4 A;  4B9V A;  3HP6 A;  1QSS A;  4W5N A;  1JL1 A;  1ZBH A;  1S1X A;  3ULD A;  1KFD A;  1S9E A;  4CJ4 A;  3EYZ A;  1L3S A;  4DSK A;  4HUF A;  1BL3 A;  1RT6 A;  4F3O A;  4Z4F A;  4I2Q A;  1U47 A;  4CJS A;  3V9S A;  5EU7 A;  1SKW A;  4M3Z A;  2X6N A;  3HVT A;  1Q9Y A;  1FKP A;  1JLE A;  1LW2 A;  2EHG A;  3VQ5 A;  3S9H A;  3AVK A;  3C6T A;  5CYM A;  3L2W A;  4Z4I A;  4PQU A;  4M42 A;  1C1B A;  2JGU A;  2A1R A;  3QES A;  4LD0 A;  2VG6 A;  1X1P A;  1JLA A;  1IH7 A;  5J2M A;  1VSL A;  3VA3 A;  2XHB A;  3O3G A;  3CYM A;  1L5U A;  2PZS A;  1NOZ A;  3KD1 E;  4QAG A;  5CY4 A;  4IDK A;  4CGJ A;  1WSH A;  1EX4 A;  4M3U A;  2HHQ A;  5KGX A;  4FK4 A;  3AA4 A;  4RG8 A;  1NKE A;  4FM1 A;  1RT5 A;  4OGE A;  2P5G A;  3L3V A;  3FFI A;  1WAF A;  3UIQ A;  1WSG A;  1A5W A;  3L2U A;  4DU4 A;  1IKY A;  3LZI A;  1RT1 A;  4QCL A;  1TAQ A;  3NH2 A;  4EP5 A;  1WSF A;  5KI6 A;  3U3G A;  4HCB A;  4CFC A;  2X78 A;  4DTM A;  2DFE A;  3LP2 A;  5HP1 A;  4FW1 A;  1NJX A;  4KHU A;  2YNG A;  3C94 A;  4AH9 A;  1SL0 A;  3AVM A;  4CE9 A;  3AV9 A;  3NF7 A;  4AHT A;  3AO2 A;  4E1M A;  3T3F A;  1D9F A;  3NF6 A;  3T19 A;  1XC9 A;  1HNI A;  4F2R A;  4NYF A;  3MEE A;  1YVU A;  3QIP A;  3NH1 A;  1QQC A;  4FLV A;  4J2E A;  3HO1 A;  1C6V A;  4Z4C A;  4K8X A;  1RDC A;  3V81 A;  4KTQ A;  4M3X A;  3HST B;  1N5Y A;  3NDK A;  4IFV A;  1RDA A;  3HVR A;  2F8S A;  4CIF A;  3QIO A;  4FJ8 A;  3AA5 X;  3IG1 A;  3DRR A;  4FM2 A;  3OS2 A;  2LSN A;  1UAX A;  2JLE A;  3MEG A;  3SV4 A;  1JLF A;  2Z1H A;  3AVF A;  3VQP A;  1DTT A;  3KK2 A;  4CHY A;  4KHN A;  3SUP A;  2Q3S A;  5SZT A;  4HUG A;  1VSH A;  4DG1 A;  1NKB A;  3ISN C;  3LAK A;  5J2Q A;  1NK7 A;  5T7B A;  4F3T A;  3VQB A;  2D0B A;  4AHU A;  3WNE A;  3LWL A;  4DSF A;  4W5Q A;  5I42 A;  1J9A A;  1RT2 A;  4FLT A;  1VSI A;  4KHW A;  4ID5 A;  1U45 A;  3HK2 A;  3I0R A;  4CF2 A;  3PUF A;  4FJL A;  1C0U A;  4OGC A;  3K5N A;  4B9U A;  3AVJ A;  3OYK A;  1MU2 A;  2VWJ A;  3HT3 A;  2F96 A;  3ALY A;  1TKZ A;  4YFU A;  3TWH A;  1WSJ A;  3G0Z A;  4I7F A;  2G8W A;  2XY7 A;  3DLR A;  1NK0 A;  4FJ9 A;  2DFF A;  3O4Q A;  4GVM A;  1RTI A;  2VWK A;  5CYQ A;  4CK3 A;  5I3U A;  4FJM A;  3AVC A;  3SQ1 A;  3AVN A;  1KCF A;  1L3V A;  2FBT A;  4IG3 A;  4CJ3 A;  3AVI A;  4Z4H A;  4EZ9 A;  4PY5 A;  2Y1J A;  1L3U A;  1NK6 A;  1WN7 A;  2HHS A;  1X9S A;  4DSI A;  4OLA A;  3CM5 A;  4GW6 A;  2XY5 A;  3S3M A;  4PUO A;  3C95 A;  2YV0 X;  3VQA A;  3SPZ A;  4C8M A;  3OJS A;  4CEA A;  4B08 A;  3KK3 A;  3TAB A;  2OYQ A;  1S9G A;  1RTD A;  2EX3 A;  1ITG A;  4CJF A;  5C25 A;  1HRH A;  1U48 A;  3V9Z A;  3SQ4 A;  4J2D A;  1HNV A;  1CXQ A;  4CEO A;  1Y97 A;  3M8R A;  3PX6 A;  4J2B A;  3V6D A;  4DF4 A;  4CJP A;  3NE6 A;  5FRN A;  1RNH A;  4M3T A;  2KZZ A;  3RMD A;  1LWE A;  4CJQ A;  1RBR A;  2HNZ A;  4O44 A;  1DLO A;  1DTQ A;  1QHT A;  4KTZ A;  3NHG A;  4ZHR A;  3L8B A;  3CFR A;  3LP1 A;  1VRT A;  4B8A B;  4DU3 A;  3RMC A;  2HMI A;  3DM2 A;  2RPI A;  3H08 A;  4CJL A;  3LZJ A;  2IDO A;  3ITH A;  3SQ0 A;  3V1O A;  3OYL A;  4DLG A;  1B9F A;  3LAL A;  3DI6 A;  3TAQ A;  3S3O A;  1WNS A;  2YNF A;  3U6F A;  3TAF A;  1K6Y A;  1SL2 A;  3BDP A;  4L8R B;  3C6U A;  3P1G A;  4BDZ A;  1CZ9 A;  4ELU A;  1ZBL A;  2IGI A;  3OYH A;  1TV6 A;  4FLU A;  4KTW A;  1NJW A;  1RT3 A;  3ZSV A;  3PX4 A;  4C8K A;  1XHX A;  1ASV A;  4CIE A;  2Z1G A;  4LH5 A;  1S1T A;  3CG7 A;  1NOY A;  1T05 A;  3AA2 A;  4DLE A;  1XI1 A;  3MEC A;  3NH0 A;  3OVN A;  3LPT A;  4CF9 A;  3ZT2 A;  4CHN A;  3CQ8 A;  2OZM A;  1IO2 A;  1FKO A;  1C1C A;  3VQ7 A;  1SL1 A;  4CES A;  4DS4 A;  1X9M A;  1T7P A;  1QS4 A;  4MFB A;  3K2P A;  3OYI A;  1BCM A;  3IAY A;  1D9D A;  1KVC A;  4CK1 A;  3V9W A;  4UQG A;  1RBV A;  5CZ2 A;  3NGZ A;  5FDL A;  4DTN A;  3KK1 A;  4DWI A;  4I9L A;  1EKE A;  1S1U A;  1UA0 A;  2I5J A;  3KKR A;  4LSN A;  4CJU A;  5HRS A;  1KRP A;  4FLZ A;  4FVM A;  4Q5V A;  4FJK A;  4BWJ A;  4OKJ A;  3OYJ A;  4OLB A;  2G8F A;  2DFH A;  2IAJ A;  2P51 A;  4DTO A;  2KFZ A;  1ZBF A;  3DRP A;  3D45 A;  4OJR A;  1NK5 A;  1JLC A;  3QEX A;  1BQM A;  2OPR A;  4N76 A;  1XHZ A;  4FK0 A;  4E19 A;  4EP4 A;  4Z4G A;  4Q0B A;  4KI6 A;  5J1E A;  4OKK A;  3QNO A;  4M45 A;  4AHR A;  4CGI A;  2GBZ A;  2O4G A;  3ZSY A;  1TK5 A;  3OYF A;  3TAN A;  3V1R A;  4CEF A;  3SQ2 A;  3ZSQ A;  4DTU A;  3E01 A;  3VQ8 A;  3KLG A;  4K8Z A;  3QEI A;  4YNQ A;  4FW2 A;  4JRP A;  4FLW A;  4B9N A;  1HJR A;  2XRI A;  4CIG A;  5D3G A;  1TKX A;  3KD5 E;  4H8K A;  4OKE A;  1S6P A;  1BI4 B;  3IS9 A;  3O4N A;  1Z26 A;  3ZT1 A;  3AO1 A;  1RTH A;  2ZE2 A;  4RW9 A;  1SKS A;  2FC0 A;  3CFP A;  2Z1I A;  4CHO A;  3RMA A;  2FBY A;  1S5J A;  2KTQ A;  4N5S A;  3KJV A;  2A1S A;  3AO3 A;  4KAZ A;  2DTU A;  1HQU A;  3NF9 A;  1CXU A;  4I2P A;  4FLX A;  3TAR A;  4C8O A;  1EET A;  4CF0 A;  1U49 A;  1VSF A;  2HB5 A;  3JYT A;  4DTR A;  3OYE A;  4BE0 A;  2X6S A;  4KRF A;  2PYJ A;  3U3Y A;  1TL3 A;  4DTP A;  3DRS A;  3QEP A;  4W5T A;  2HHV A;  4DMN A;  3DOK A;  3MED A;  4RW6 A;  4CED A;  4BAC A;  4FLY A;  1U4B A;  1RT7 A;  1NK4 A;  1ZBI A;  4FJJ A;  4B3O A;  3HPH A;  3NFA A;  3KLI A;  2YKM A;  4DFM A;  3PO5 A;  3PO4 A;  2HNY A;  5DK5 A;  3M8S A;  1JL2 A;  3ZSR A;  3RWU A;  1TAU A;  3AO4 A;  3K59 A;  5SWM A;  3OYD A;  3VA0 A;  3RR7 A;  1C0M A;  2E4L A;  2GV9 A;  1NK9 A;  4FYD A;  2ETJ A;  5KRS A;  1T03 A;  2KZM A;  4KB0 A;  2BAN A;  3L3U A;  1NKC A;  1KFS A;  2R7Y A;  3F9K A;  1HPZ A;  5DMR A;  4DQQ A;  1S1V A;  2G8U A;  3HJF A;  3OYG A;  5C24 A;  1IG9 A;  4H4O A;  3DLK A;  3DOL A;  4BE1 A;  4DSL A;  1VSK A;  3AVB A;  3TAM A;  1N6Q A;  3KTQ A;  3HPO A;  2YKN A;  3VQ9 A;  4GMJ B;  1NJZ A;  2P5O A;  1RDB A;  1ZYQ A;  2OA8 A;  3EY1 A;  3B6P A;  1F21 A;  4ID1 A;  1BIS A;  5FRM A;  2OPS A;  1X9W A;  4DSJ A;  1BIU A;  3RR8 A;  3OYA A;  2RN2 A;  4AHC A;  3DMJ A;  5J2N A;  3QO9 A;  1JLB A;  4FM0 A;  3TAG A;  4C8N A;  4JS4 A;  5C42 A;  1FXX A;  4Z0U A;  3WNF A;  4NCA A;  4KI4 A;  4CFB A;  1RBT A;  1JXE A;  1IKX A;  4CHZ A;  3OYC A;  3VQ4 A;  3PY8 A;  3K5M A;  4FJX A;  1SV5 A;  3DYA A;  4AHS A;  4CER A;  4XIU A;  4E7L A;  4RW8 A;  5CZ1 A;  4M3R A;  4QOZ B;  4PA1 A;  1TGO A;  1RDD A;  4HVJ A;  3AVA A;  1L3T A;  1QE1 A;  1GOC A;  2E6M A;  3A2F A;  2B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...