3AVNA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avnA00
1S1TA 3DLGA 3V81A 2OPPA 1RTJA 1S1UA 4DSIA 4N5SA 1L3UA 4HUFA 3DOLA 2NUBA 4KHSA 5SWMA 5HRSA 1B9FA 3HPHA 4Q5VA 1NK9A 1LV5A 1L5UA 3HM9A 3OYCA 5JS2A 3SV3A 2B5JA 4LSLA 2XY5A 4FLWA 3BDPA 2RF2A 4M42A 4PUOA 3DYAA 3AVFA 3AO3A 4FLZA 1BHLA 4O44A 1A5XA 5JS1A 4IG0A 4DTUA 3OYNA 1Z25A 3WNFA 3HL8A 5K14A 4B9LA 3OY9A 1NK5A 4CIGA 4C8LA 4CF2A 1LW0A 3P5JA 3FFIA 4KO0A 2HB5A 4AHSA 4B9SA 3LALA 4OGEA 1Q9YA 3DM2A 3PY8A 1RNHA 1ASVA 1RBTA 1LW2A 1CZ9A 2IOCA 4CJ4A 5KI6A 4N47A 1RTIA 2HNYA 4KI4A 3OYGA 4O0IA 4FLTA 4CGFA 1HMVA 3ASMA 4Q0BA 3K5OA 3AA3A 3MEEA 2DFFA 1KVAA 4CJFA 1NKEA 4O55A 1SL2A 4E89A 3DLBA 4DFJA 4E7KA 2G8VA 4N76A 3AO1A 2Q3SA 3DLEA 4B3OA 3VQBA 4DU4A 3QO9A 3V4IA 1HYSA 3QINA 3C6TA 2YHBA 5CYMA 3TARA 4Z4FA 1VSFA 1HQEA 2IGIA 1JLBA 1HPZA 4E7IA 1C0UA 3UIQA 3WNEA 2VG5A 4HHTA 4DLEA 3AO4A 1L3VA 1RBVA 3MXIA 4YFUA 4FJHA 4FLYA 3V6DA 1YT3A 2KZMA 1TL1A 3VQDA 4O5BA 5KRSA 3NF8A 3VQEA 3I8DA 1JLEA 2HHVA 4B8CA 3NH1A 2PZSA 3V9WA 4ID1A 1KFSA 4L8RB 3HYFA 4BE0A 4CGIA 3KLFA 1KSPA 4NCBA 3LP3A 4CHQA 4DTXA 3OYHA 3SPYA 1U04A 2B6AA 3T1AA 4CESA 4EP5A 4OKEA 3LDSA 4FW2A 4LSNA 5J1EA 3LZIA 1A5WA 5SZTA 3CFPA 3QESA 3KKRA 4FJXA 2FBTA 3EZ5A 1TV6A 2XRIA 3M8PA 4CJPA 3DI6A 4Y1CA 4H8KA 4CEOA 2XO7A 2D5RA 3ZSYA 1N5YA 1T8EA 1C0MA 3NGYA 1HQUA 4CF0A 4F2SA 4HCCA 4IFVA 1JLGA 1A5VA 3HJFA 3K5NA 4F3OA 4FXDA 3HT3A 1FXXA 5DK5A 4M3UA 1B92A 1J9AA 4F3TA 1HYZA 3OS2A 1J5OA 3V9UA 4FM2A 1XC9A 4DSLA 3DRPA 2KFZA 1RDCA 3S3NA 4KV8A 4FZYA 1K6YA 2G8IA 4FK0A 4E0DA 3VQ5A 3VQ6A 3SUOA 1KLMA 2OPQA 4CK2A 1VSJA 4CJTA 4CIFA 3TAPA 1WSIA 3K57A 4C8KA 4CJVA 4F2RA 1JXEA 3AVNA 3MXJA 2ATQA 4CERA 3OYMA 1LWFA 3KLEA 4DLGA 3RWUA 3TWHA 1NOZA 4M3RA 1D8YA 1FK9A 4ID5A 3VQ8A 1U4BA 3KD1E 3K59A 1LAWA 1L3TA 4FJKA 3SNNA 4J2EA 2HVHA 1BIUA 1RT3A 4DFMA 3LP2A 4FJMA 2Z1JA 4IKFA 1TKZA 1O1WA 2HNZA 2XY6A 4FK2A 3OS0A 4CK1A 4OLAA 2WOMA 1CXQA 3K5LA 4DTNA 3O3HA 4RW8A 5I42A 1RILA 3VQ4A 2P1JA 4M3XA 3OYKA 3MEGA 1I39A 1CXUA 1RDAA 2ZE2A 4LD0A 1BL3A 1NK4A 4Z4CA 2YKNA 1JLAA 4BDYA 1VSMA 1TK8A 4B9TA 1WSFA 1TAUA 1D5AA 1I3AA 3HVRA 1RT4A 2JLEA 4FLUA 5CZ1A 1NJZA 4KPYA 3IAYA 2HHXA 2LSNA 1TK5A 2QKKA 3SQ4A 1NK7A 5T7BA 3OYBA 4DTOA 3EYZA 3SUQA 3L2UA 4K8ZA 2Y1IA 3SPZA 2PYLA 3ZT3A 3NDKA 1ASUA 2GBZA 4CEDA 3IS9A 3RMCA 1U45A 3LPUA 3PO5A 1T7PA 1RT7A 1TKTA 3NHGA 1EP4A 2Z1GA 2I5JA 3VQ9A 4CE9A 3K5MA 4JS5A 4E7JA 4G1QA 4KI6A 2BDPA 1VSKA 3PUFA 1ITGA 3VQCA 2KTQA 4ZTFA 4OPKA 4YNQA 4DF8A 3LP1A 4OVLA 3U3YA 3LAMA 3PX4A 4B9VA 3AO5A 2QKBA 2RN2A 4DQRA 2X78A 4M41A 3L2WA 3ZSOA 1J53A 1GOAA 1YVUA 5HRPA 3QEXA 1S1WA 5HLFA 2HHSA 4CK3A 2FBVA 3E01A 4KREA 2WONA 2OZMA 2Z1HA 4E19A 5C24A 1BGXT 4DQSA 3RMAA 1BI4B 2AJQA 4MFBA 1RBRA 1VSDA 4OGCA 2E4LA 1QSYA 2F8TA 4DSEA 3M8QA 3NH0A 2BGGA 4DTJA 3AVGA 1KVBA 1Q8IA 4I2QA 3LZJA 4JRPA 3EY1A 3DMJA 4FJNA 1SKWA 3AVJA 2P5GA 1LWCA 3V1RA 1TAQA 3ZT2A 1RDDA 3TAMA 3HP6A 2E6LA 5KTQA 1SKSA 2G8FA 4KHYA 4Z4EA 2DTUA 3SI6A 3DLHA 4KHQA 3ULDA 2PY5A 1ZBIA 1C1AA 1IKWA 3ZSRA 4M3YA 3SUNA 1WAFA 4B9UA 2OPRA 5KGXA 1S1VA 5C25A 1VK0A 3AVMA 4HUEA 1RTHA 4ICLA 1WN7A 1YTAA 4DU3A 3THVA 4ELTA 4EZ9A 4TSXA 2XHBA 3VQPA 3L2VA 4PA1A 2IDOA 4RG8A 2RPIA 2P5OA 2HNDA 3TANA 2QXFA 1X9SA 3F73A 1RT1A 2VG7A 2Y1JA 1RBUA 4O0JA 1ZYQA 4CJEA 4I7FA 3SQ2A 2ITGA 2IS3A 4UQGA 3T3FA 1HRHA 1SL1A 1DTQA 3C6UA 3MEDA 1TKDA 3L8BA 4CGJA 2F96A 3RR8A 3KIOA 2EX3A 3SJJA 2VG6A 3ZSXA 3VA3A 4EZ6A 5CY4A 1UA0A 1G15A 3NF6A 3QLHA 3PO4A 1HNIA 2HHTA 4WE1A 3U3GA 3QETA 3QEVA 1ZBFA 3CFRA 2YNIA 4HVJA 3NF7A 4E7HA 4FM1A 4PY5A 4C8MA 4AHRA 3QEIA 4FJ8A 3MXMA 1XWLA 3O4NA 4DQQA 1U49A 3WNHA 1CLQA 1KFDA 4HTUA 1LAVA 1RBSA 4Z0UA 3OYAA 4I9QA 2ZQBA 4R5PA 3AA5X 4LY7A 4CEAA 4BDZA 4CFBA 1KLNA 4CGHA 3RRGA 2XY7A 1EKEA 3MAQA 3O4QA 3DLKA 3OYLA 2OZSA 4DQIA 4CJ5A 4W5RA 3KK1A 1VSIA 4J2BA 1S6PA 2P51A 1U47A 4DMNA 4CEQA 3PV8A 3NH2A 4RW4A 4FJ5A 3HK2A 4AHCA 3DRRA 4AHUA 1NK8A 2X6NA 3NCIA 3RR7A 3V9ZA 1BQNA 2FBXA 3ZT4A 4DS5A 4EP4A 4H4OA 4DTRA 3S3OA 4FJ7A 2X6SA 1F21A 1Q9XA 3ZCMA 3NGIA 2HHQA 3TI0A 1WSGA 1IKVA 1X9WA 5FRNA 4CFDA 1HJRA 3O3FA 3RTVA 2D0BA 4NYFA 3KK2A 4E3SA 3QNOA 1XI1A 1RDBA 3OVNA 3AV9A 3V1OA 3ZT0A 3SCXA 1NKBA 3NE6A 1SUQA 1JL2A 4BWMA 3KK3A 1BCOA 3NBPA 1VRUA 4CGGA 3ZSZA 3RMDA 1EXQA 4KAZA 3HO1A 4OKJA 5J2QA 5CYQA 1JKHA 4ELVA 2JGUA 3B6OA 4M3TA 3QEPA 3C95A 1EETA 1NJWA 4IBNA 3KD5E 4QOZB 3HPOA 4C8OA 1NOYA 1ASWA 2HHWA 3KTQA 1TK0A 3AVBA 3OYDA 4GW6A 2IC3A 3U6FA 2FBYA 4CHPA 3V9SA 1SL0A 4ZHRA 3CG7A 2A1SA 2XY8A 5DMRA 1JL1A 5HROA 4AILC 3LPTA 4QCLA 2YNGA 3BGRA 4Z4HA 2G8WA 4F8RA 4KRFA 3P1GA 4Z4GA 1L3SA 4GMJB 5HBMA 4RW6A 3LP0A 1NKCA 4CFAA 3ALYA 4KKOA 3SUPA 2PYJA 1CZBA 1X1PA 1ZBUA 4Z4IA 1IKXA 3A2FA 1XHXA 3AO2A 4CEEA 4KTQA 2G8KA 2OYQA 2D0CA 3JSMA 1UWBA 4M3ZA 4CJSA 3CYMA 4FLXA 4W5NA 1RT6A 3CFOA 1Y97A 5FRMA 1HNVA 1BISA 3NF9A 3QIOA 4FVMA 2HMIA 2GV9A 1S5JA 4RW9A 1QS4A 3WNGA 1JXBA 1QSLA 4DSJA 3JYTA 3L3VA 4BDPA 3CQ8A 3QNNA 2ETJA 3KJVA 5J2MA 2A1RA 3SQ1A 4KB0A 5HP1A 4O4GA 4FJ9A 3KKSA 4MQ3A 3TAGA 3CM5A 3D45A 2OA8A 3P83D 3M8RA 3KLGA 2RKIA 4Y1DA 4FJIA 2F8SA 1U48A 2KQ2A 3AVHA 2EHGA 1S9GA 5KGWA 4W5OA 1WSJA 3LAKA 1WNSA 4M45A 4FCYA 3AA4A 4JLHA 4HUGA 4FZXC 3ITHA 2R7YA 3C94A 1JLFA 4KTWA 3OS1A 1C0TA 1KTQA 3OJSA 4DWIA 1KVCA 3LANA 4FW1A 3VQAA 4FYDA 2O4IA 1SKRA 3V1QA 4PQUA 4FM0A 3TAFA 3O3GA 4DU1A 4FJLA 1QHTA 1IKYA 3F9KA 4W5TA 3OYJA 3ZSQA 3OYFA 4CCHA 1QTMA 4CEZA 4N56A 3NGZA 1VRTA 1FKOA 1RCHA 2FC0A 1UOCA 1WSEA 4QAGA 4OPJA 2YNHA 4DG1A 4CF1A 4AHVA 4KTZA 4CJUA 4CEFA 4I9LA 2D0AA 4N41A 3HPGA 2VWKA 4FLVA 3RMBA 4HCBA 1WAJA 2DFEA 4CHZA 3L3UA 4NCAA 1KCFA 1N6QA 1BCMA 1C1CA 1Z26A 2YHAA 2Z1IA 5I3UA 3MECA 2E6MA 4DQPA 1RTDA 1RT5A 3KLIA 3AVAA 2OPSA 4CEBA 4PWDA 2O4GA 3AVCA 4ELUA 3HXMA 2HHUA 1MU2A 4IDKA 2IAJA 3L2QA 3VN5A 1NJXA 1ZBLA 1RT2A 1NK0A 3SV4A 3SQ0A 1UAXA 5FROA 3DRSA 4OJRA 3TAQA 4B9NA 3T19A 1TL3A 4CF8A 3QEWA 4ZTJA 4KHNA 4DFKA 1IH7A 3IG1A 1HYVA 4IFYA 3QIPA 4CJKA 3SZ2A 5KRTA 4DF4A 3PX0A 1C6VA 2BANA 3IRXA 4IG3A 1KRPA 2KFNA 1IO2A 3HSTB 3HVTA 3ZSWA 3PX6A 2HW3A 2DFHA 1TVRA 4KFBA 4KHWA 3NFAA 4DTPA 3NAEA 1ZBHA 5E41A 5FDLA 1FKPA 4CHYA 4W5QA 2X74A 4E1NA 1JLQA 4E7LA 1NJYA 4XIUA 3OYIA 2QK9A 2YV0X 4LH4A 1S1XA 4E1MA 3I0RA 2GUIA 4KHUA 4FJGA 1VSLA 2BE2A 4AHTA 4CF9A 3VA0A 4OKKA 1UA1A 4LH5A 1BQMA 3S3MA 4FZZA 1R0AA 1S6QA 4J2AA 3S9HA 4DSKA 3ISNC 4CHNA 5HRNA 3TABA 2VWJA 1S9EA 3I0SA 4H4MA 3OYEA 3L2RA 4BE1A 4RW7A 3VQQA 3HP9A 3DOKA 1WSHA 3QERA 4CECA 4B08A 3H08A 1LWEA 1D9FA 1D9DA 1BI4A 4K8XA 2KZZA 2HVIA 3KLHA 1JLCA 3K58A 1REVA 1VSEA 4BACA 4CJQA 3ZT1A 1B9DA 4CJ3A 3AVLA 4GVMA 4OLBA 5CZ2A 3TR8A 3CM6A 2B4JA 3AVKA 3K2PA 1J54A 1EX4A 4B9MA 3M8SA 3OJUA 2YKMA 4CGDA 4CIEA 1TGOA 1C1BA 4B8AB 4CJLA 3VQ7A 4CJWA 1BIZA 1W0HA 5HRRA 2G8HA 1YTUA 3SYZA 3TAEA 3LWLA 4DTSA 4FK4A 4AH9A 4BWJA 5EU7A 1DTTA 1WLJA 1X9MA 4DTMA 2W42A 2DY4A 3AVIA 1T03A 4FJJA 4CJRA 1GOBA 1T05A 3DLRA 4JS4A 1QE1A 5J2NA 1NK6A 1SV5A 1TKXA 4C8NA 4DFPA 2G8UA 1QQCA 2YNFA 4J2DA 1DLOA 4KB1A 3RRHA 4DSFA 4F4KA 3LWMA 3AA2A 4NYNA 4I2PA 4CFCA 3G0ZA 4M3WA 3V9XA 3ZSVA 1QSSA 2ZD1A 4NCGA 3G10A 1XHZA 4JRQA 1IG9A 1W9HA 1GOCA 5J2PA 2KW4A 1VSHA 3B6PA 4CHOA 3D0PA 4BE2A 5C42A 4DS4A 5D3GA
chains in the Genus database with same CATH superfamily
3GL1A 1RTJA 4DSIA 4KHSA 4N5SA 3DOLA 1JJ2M 3HPHA 4Q5VA 3VEVA 3MCAB 1GLEG 5JS2A 3SV3A 2XY5A 5JMVA 2RF2A 3AY9A 3SAGA 3AO3A 5GINA 2UXDK 4O44A 1A5XA 1KAZA 3OYNA 3WNFA 5K14A 4IJNA 3QICA 4CZFA 3P5JA 4AHSA 3LM2A 4BRFA 4B3SK 3J81O 4FLTA 4X62K 2DFFA 4CJFA 3DLBA 4DFJA 3AO1A 5BN9A 3QINA 3T1HK 4NXNK 3O1BA 3TSPA 5AQFA 3UKUB 1FW6A 1HPZA 5KPTA 1ATRA 3WNEA 4HHTA 1U2VB 2OCEA 3AO4A 1RBVA 1L3VA 3QFPA 1TL1A 2HBJA 1X3MA 2YJEA 4O5BA 5KRSA 3CCEN 3WXMB 1U6ZA 4ID1A 4BE0A 2JWKA 3KLFA 5BPNA 3BEXA 2WUSA 4JI4K 4H0XB 2QWOA 3T1AA 2RHKA 5J1EA 3TPQA 5AQOA 2FBTA 5AQRA 3EZ5A 1T3VA 2Q0UA 4H8KA 4CEOA 3ZSYA 1HQUA 4CF0A 1XMQK 2NRXA 2PBDA 3K5NA 4FXDA 5DM6L 5DK5A 4H5NA 1J5OA 4BC2A 2DPNA 1RDCA 1YITN 3LDLA 3DXKA 3VQ5A 1KLMA 4CK2A 1XMOK 4C8KA 2F4VK 3KWIA 4CJVA 3AVNA 3OYMA 4DLGA 1EWRA 1LWFA 4JKHA 4BROA 1LAWA 3SNNA 4J2EA 2IIRA 4BGBA 3LP2A 4FJMA 3FZFA 1O1WA 2HNZA 4FK2A 1CXQA 4DTNA 3ZEUB 3ZYYX 3MEGA 3HSCA 3D7EO 1BL3A 2QWRA 1TK8A 4B9TA 5GADP 3WXIA 1I3AA 3MMVA 2A6AA 3OBWA 3SQ4A 1ZXOA 1NK7A 2ASMA 2PYLA 3ZT3A 2A5XA 1YJWN 3EN9A 2CH5A 4DV5K 4LF4K 5AQLA 3VEWA 1Q81O 3NHGA 3VQ9A 4I6MA 2HBKA 1XNQK 1ITGA 3VQCA 2KTQA 4OPKA 4B9VA 2QKBA 4M41A 1YVUA 3QEXA 2H3GX 3CJBA 3EL2A 4BVOA 2FBVA 4MDBA 4LFAK 2P9NA 3M6GA 1SQKA 4E19A 3DWLA 3RMAA 4DR4K 3UKRA 3VENA 1VQ9N 1QSYA 4DSEA 3M8QA 4LF8K 4BR4A 2BGGA 3AVGA 1Q8IA 3LZJA 2AA4A 1DT9A 4FJNA 3AVJA 3W0LA 2P5GA 1TAQA 4F9OA 1RDDA 3HP6A 2G8FA 3U9DA 2DTUA 3SI6A 4B1VA 2F9TA 2E1ZA 3LDNA 2PY5A 4M3YA 3SUNA 5KGXA 1S1VA 4IDHA 5C25A 2UYTA 3AVMA 1RTHA 1WN7A 4DU3A 4EZ9A 4PA1A 4LF9K 2IDOA 2RPIA 2HNDA 3GDQA 4IEEA 3F73A 3MWTA 1RBUA 4CJEA 4I7FA 4JKEA 1KQSM 2HBLA 1BDGA 3C6UA 5AQYA 4CGJA 2EX3A 5CY4A 1UA0A 1FJGK 3U8XA 3QLHA 3CFRA 1HKGA 4PY5A 1EO1A 4FJ8A 1BOTO 4B9QA 1CLQA 3R3LA 1VAZA 4Z0UA 2ZQBA 4FOEA 2VQEK 3EEQA 4AQYK 1EKEA 5AQUA 4BRPA 5BRHA 4JK9A 4CJ5A 3KK1A 2KKZA 3HK2A 5AQHA 3DRRA 3NCIA 3RR7A 4FJ7A 3IFRA 3ZT4A 1NGJA 3GG4A 1F21A 3EZWA 1WSGA 4CZHA 3CI5A 3KVGA 3T7ZA 3PIOL 5LMUK 1X9WA 1HJRA 5GAEP 3NE6A 3E9LA 1VRUA 2ZWHA 4YOTA 3HO1A 2NRTA 5CYQA 1WUAA 5BPLA 4M3TA 5AQZA 3SBGA 3QEPA 4BC5A 1EETA 2GWKA 5JLFA 2HHWA 2IC3A 4CHPA 4ZHRA 4JD2A 2XY8A 2YX6A 4OPAA 4CZKA 4KRFA 2G8WA 4F8RA 3P1GA 4KBOA 5M1OA 1L3SA 1NKCA 4DV2K 1VHXA 4YDUA 1CZBA 1ZBUA 4KTQA 2FSKA 1YIJN 4BY9C 4CJSA 3CCJN 5FRMA 3WEEA 1HNVA 2HSTA 4FVMA 2GV9A 1S5JA 2HHHK 3HBTA 1JXBA 3GOIA 2YHYA 1NNEA 4QS8A 3DXKB 5J2MA 2A1RA 3CJ7A 4O4GA 2W40A 2OA8A 3P83D 3KLGA 4FWPA 5KGWA 4W5OA 4IO9L 1WNSA 4FZXC 2R7YA 3O9UA 1W97L 4FW1A 2IVPA 4GV9A 4FYDA 1XUPO 5AQJA 4FM0A 4PQUA 3TAFA 4C23A 4FJLA 4CCHA 3OYFA 2P9IA 2VQFK 4BRLA 2FC0A 4OPJA 4CW7B 1ZC6A 4KTZA 4IOCL 4A5AA 5C15A 3RMBA 3CJ9A 4IXCA 1BCMA 1JCFA 2E6MA 4DQPA 1RT5A 3KLIA 4CEBA 2O4GA 3AVCA 4CZIA 2HHUA 4I6MB 3OW2M 2IAJA 3L2QA 1NJXA 1RT2A 4MDAA 3VF2A 1QQMA 3G71N 5CE3A 3QIPA 5AQGA 1C6VA 2BANA 4JI2K 3HSTB 4BRAA 2P9NB 2E88A 4FO0A 5EVZA 3UKRB 3C65A 1BA0A 4A62A 4E1NA 3W3DA 3OYIA 2YV0X 3NVKA 4E1MA 4KHUA 5FPNA 3VA0A 3MK6A 3CQYA 4OKKA 4WYBA 3TABA 2VWJA 1VQ6N 4RW7A 2Q31A 3H08A 1D9DA 1BI4A 3KLHA 4FWOA 4B1YB 1Z05A 3G4SN 5CZ2A 3ULEA 3CM6A 3VGMA 1J54A 1TGOA 3K9JA 4B8AB 3MX5A 4U7BA 2G8HA 3H1QA 4JI5K 2D0OA 4WQ4C 1WLJA 3VEZA 4DTMA 3THWA 4LF5K 4Z94A 4DFPA 1QQCA 1X3NA 4DSFA 1QVFM 4CFCA 3G0ZA 1S22A 1KXPA 4JRQA 2I7NA 4GKKK 1W9HA 2BUPA 3WXJA 5AR0A 5AQWA 5GIPA 4BE2A 4DS4A 4H0PA 1S1TA 3V81A 4BR7A 1S1UA 2GEMA 3VEYA 2Q97A 5SWMA 1MA9B 1B9FA 2NZTA 3HM9A 2B5JA 4FLWA 3DYAA 2A41A 2CGJA 4FLZA 5JS1A 4DTUA 1YF5L 2ZJRL 5ELZA 1NK5A 4GV6A 4CF2A 2UUBK 1LW0A 2F9WA 3ZX2A 2HB5A 4B9SA 3F2KA 3DM2A 3U4LA 1Q82O 1RBTA 2QWPA 4BRGA 4N47A 5BR9A 3FFKB 3HRGA 4KI4A 4JHDA 1Q86O 4MLEA 1J6ZA 3MEEA 3JXUA 4O55A 4JD2B 4E7KA 4N76A 4DU4A 4WQ4A 3V4IA 4CZMA 1HYSA 3C6TA 2FF3B 1LCUA 3TARA 1RFQA 2IGIA 3QB0A 1C0UA 3UIQA 1JCGA 4OX9K 4DLEA 3MXIA 2PFUA 4FLYA 3V6DA 3FR0A 3IMXA 4K41A 5BREA 1HNXK 2KZMA 3HM8A 3NF8A 3VQEA 2HHVA 3WEEB 4B8CA 3NH1A 1CZAN 3ENBA 3V9WA 4L8RB 3CCLN 4JI3K 3LP3A 4DTXA 3OYHA 1OVYA 1M1KO 3LZIA 2QI2A 1VQLN 1MWMA 1A5WA 3KKRA 3DJCA 4FJXA 2XRIA 2D5RA 1YJ9N 2A3ZA 4FPBA 4F2SA 1N36K 4F3OA 1FXXA 4M3UA 1B92A 4F3TA 1QZ5A 4B1WB 3ATUA 1O13A 3V9UA 5TKWA 4DSLA 4V19S 3S3NA 1H1VA 3HTVA 2P9IB 2G8IA 1C0GA 2GTDA 4DR1K 3SUOA 4CJTA 4XEIA 1WBBA 1WSIA 3THYA 2P9UA 1JXEA 3MXJA 4CERA 4KH6A 1D8YA 1NOZA 4IZ9A 4M3RA 1FK9A 4ID5A 3K59A 3MN7A 4IKFA 1TKZA 3MCPA 3O3HA 5I42A 2P1JA 1I39A 1CXUA 1RDAA 4LD0A 4H5TA 2O8DA 4BDYA 1VSMA 4DV1K 1T6DA 4WFAL 3J8AA 3ENOA 5CZ1A 3SMPA 1NJZA 3P39A 3IAYA 2HHXA 2LSNA 1TK5A 2KHOA 3O1WA 2D1KA 5T7BA 5C2FA 3AAPA 2HOEA 2Y1IA 3SPZA 4K8ZA 3CD6N 3NDKA 3LM9A 4CEDA 2GBZA 3A5MC 3O9QA 3PO5A 1Q18A 1TKTA 3A5OC 3CPEA 1EP4A 4KI6A 2I5JA 4G1QA 4BC3A 5KPZA 4YNQA 5C0YA 4OVLA 4BQZA 3IDHA 4DQRA 5HRPA 1N34K 3BF3A 5HLFA 2NLXA 4BR0A 2HHSA 4NB4A 4KREA 5JLHA 2WONA 4ILGB 5C24A 1BGXT 1BI4B 4IOAL 2AJQA 4MFBA 4OGCA 2E4LA 1K73O 2F8TA 4FL9A 4DTJA 1WBDA 3ULEB 5LJWA 5BRFA 3D2FA 3EY1A 1X9JA 4DR7K 5BPMA 3TAMA 2E6LA 4Z4EA 4CBXA 5M1KA 3LDPA 4JKDA 3L4QA 4KHQA 4XH1A 2WBNA 3ZSRA 3THWB 2EWSA 4AM7A 4YOYA 4DV7K 1TAUA 4ELTA 1YTAA 3BY5A 2ZJQL 3JS6A 3HOSA 4RG8A 1OH5A 3NVMA 3L4IA 3TANA 2QXFA 4GVEA 2P9KB 1X9SA 3CCUN 1RT1A 4A5BA 2Y1JA 4O0JA 3SQ2A 4PHTX 1HRHA 1SL1A 1DTQA 3RR8A 3SJJA 3ZSXA 4M7XA 4DR6K 3CERA 4YHHK 3MX2A 3PO4A 2HHTA 3QEVA 4QS9A 4HVJA 2FSNA 1YAGA 5A2QO 4X65K 3QEIA 4PKGA 3MXMA 3WNHA 3VPZA 4FWMA 1RBSA 1K9MO 3RRGA 1KLNA 3ZX0A 1VSIA 4B3MK 1ESVA 3E1YA 4RW4A 4FJ5A 2D4WA 1NK8A 4AHUA 4JHDB 4WF9L 2UU9K 4JI6K 1BQNA 2FBXA 4DTRA 4IWVA 1Q9XA 2HHQA 3TI0A 1R59O 4YOXA 3CCQN 4O8KA 4CFDA 2HBMA 4NYFA 3ZT0A 4UY8O 2O8BA 3CCRN 2P9PA 1SUQA 1JL2A 4BWMA 3MDQA 4X66K 3VEXA 4KAZA 3ZSZA 4OKJA 4X64K 5J2QA 4ELVA 2OANA 2JGUA 3B6OA 4JI0K 4DV4K 4IBNA 1NJWA 3BZKA 3CMEN 4B1ZA 1K8KA 3SMSA 3WT0A 1NGIA 4GW6A 3U6FA 5AZJA 2OTLN 3CG7A 2A1SA 3QDKA 5HROA 4EAHD 3LPTA 3CC4N 3KK7A 4QCLA 2YNGA 3TTCA 4RW6A 1TUUA 3A5NC 4KKOA 3SUPA 2PYJA 4Z4IA 3A2FA 5AFUA 3E66A 3CMAN 1I94K 2D0CA 3VGKA 3MN6A 3FZLA 1HLUA 1RT6A 4GY2B 4JKFA 1DKGD 2HMIA 2YCHA 4RW9A 1QSLA 1YUWA 4DSJA 5AFUH 4BDPA 5AQXA 3CQ8A 2ETJA 2QTDA 3KJVA 2F7TA 4BRCA 5HP1A 1QQOA 4FJ9A 2CGLA 3TAGA 3CM5A 3VMFB 3THYB 1Z6RA 2P9UB 2F8SA 4FJIA 3AVHA 2ZGYA 3EE9A 3LL3A 1JLFA 4KTWA 3OS1A 1KTQA 4BRHA 1OKJA 1C0FA 3OJSA 3LANA 3VQAA 1D4XA 4DWIA 1SKRA 3V1QA 3VGLA 3D6RA 3DXMA 4W5TA 3F9KA 3ZSQA 2O8DB 1WB9A 1HNZK 4DG1A 3VTHA 3SK3A 1OH7A 4I9LA 2ZGZA 1IG8A 2VWKA 3VESA 4FLVA 4CBUA 1GLBG 1WAJA 4CHZA 4DR5K 5M1QA 4NCAA 4JAXA 1K8AO 2QWQA 4MLHA 1RTDA 1KAXA 1MU2A 4IDKA 3CXCM 1ZBLA 1NK0A 3PSIA 5FROA 3O08A 3DRSA 4OJRA 4YDUC 3T19A 3EKSA 3QEWA 4H0YB 4DFKA 1IH7A 1XNRK 2HF4A 1VQPN 2D0PA 5KRTA 3PX0A 1N32K 3CIPA 4DV0K 1IO2A 3ZSWA 3PX6A 3O8MA 3WUHA 5KQ8A 4KHWA 3VETA 3NAEA 4FWRA 4CHYA 2X74A 1JLQA 3SBTA 1NJYA 4XIUA 1HJOA 1S1XA 3D2FB 5CHIA 3I0RA 4FJGA 4AHTA 1UA1A 3S3MA 1VQON 4R79A 5FPEA 1R0AA 1S6QA 4CHNA 2QA4N 3I0SA 4H4MA 3VQQA 3KWGA 3QERA 4B08A 3F9MA 3K58A 4CJ7A 3QBWA 2NRWA 3ZT1A 3AVLA 4GVMA 4EFHA 3O5BA 1EX4A 3M8SA 2YKMA 3OTOK 4CJWA 4H0TB 1BIZA 1W0HA 3I8BA 5HRRA 3SYZA 1MWKA 3LWLA 4FPAA 4C1NI 4AH9A 4NO7A 3RVCA 3ZX3A 4OO1J 2O8FA 2W42A 1T03A 4KH4A 1GOBA 3EE8A 2Q0RA 5J2NA 4O8UA 1TKXA 4ISGA 5KPRA 1NGDA 4KB1A 3TSQA 3TSUA 4H0OA 2NRVA 4EHTA 4I2PA 4M3WA 3V9XA 2ZD1A 2P9LA 2V52B 4NCGA 3G10A 5AQIA 1GOCA 5J2PA 2ZJPL 1KC8O 5D3GA 1L3UA 4HUFA 3QBXA 1YHQN 5HRSA 1NK9A 1LV5A 1L5UA 3OYCA 2V7ZA 1BA1A 4LSLA 3J80O 3BDPA 4M42A 3AVFA 5AQMA 1BHLA 4FWSA 1SAZA 4IG0A 3OHRA 2QM1A 1E4GT 4B9LA 2O8BB 3OY9A 4C8LA 2P9PB 4M7YA 4KO0A 4OGEA 1Q9YA 2UXCK 1LW2A 1CZ9A 2E2PA 3SLCA 5KI6A 1RTIA 2HNYA 1W7AA 4O0IA 1HMVA 1K8KB 4Q0BA 1G99A 1KVAA 5AZJB 1NKEA 1SL2A 4JKAA 4E89A 3O9RA 5HL7L 2VWBA 2Q3SA 3DLEA 4B3OA 5GAGP 3VQBA 3QO9A 1IJJA 1GLFO 1BWFO 5CYMA 5F1XA 4Z4FA 4JI1K 1HQEA 4E7IA 3I33A 3I55N 2VG5A 1VQ8N 2OTJN 4FJHA 1YI2N 1YT3A 3VQDA 1NWKA 1VQNN 1JLEA 2PZSA 5I9EB 1KFSA 3HYFA 4CGIA 1KSPA 4NCBA 3N4QA 4CHQA 1U04A 3LDSA 1NMDA 4CESA 4OKEA 3VOVA 4FW2A 2BH1A 4DUYK 4PL7A 3HZ6A 1TV6A 4CJPA 5E84A 2XO7A 3DLLL 4YY3K 4PKHA 1N5YA 1T8EA 3J7AP 1C0MA 3L6QA 3NGYA 4HCCA 4LC9B 4AM6A 4MO4A 3C6AA 1XC9A 4FM2A 3DXMB 2KFZA 4KV8A 1K6YA 4FK0A 4E0DA 3VQ6A 2AP1A 4KHPK 2E2NA 3K57A 3CC2N 2ATQA 5ADXA 3RWUA 5GAHP 3TWHA 3VQ8A 1NGAA 3TTDA 1U4BA 3KD1E 2HVHA 3H46O 1L3TA 4IFEA 1BIUA 1RT3A 4AF1A 4DFMA 2Z1JA 3I56N 2XY6A 4FVUA 4CK1A 4LFBK 2WOMA 5ADXH 4JNEA 4A61A 4RW8A 3VQ4A 3OYKA 4Z4CA 1VQ4N 3P4IA 3HVRA 2A40A 4O5FA 2JLEA 1YXQA 4FWQA 2P9KA 5MLCQ 3OYBA 3EYZA 4JYAK 1NGCA 2A42A 3L2UA 3IUCA 3FZMA 4PL8A 4ISFA 1T7PA 1RT7A 2NNWA 3K5MA 4CE9A 4JS5A 4E7JA 3CJ1A 4K0KK 2BDPA 1VSKA 4A2BA 4CD3A 3UB5A 4ZTFA 1V4TA 1EQYA 4BG9A 3PX4A 3LAMA 2QXLA 5TKYA 2RN2A 2O8EA 4OPHA 3L2WA 2CH6A 4ILHA 3E01A 4CK3A 2ASOA 5M1PA 2OZMA 2Z1HA 4DQSA 4CD1A 1E4FT 3NH0A 1KVBA 3VTIA 2QWLA 3DMJA 3V1RA 5KQDA 1WOQA 2V7YA 1SKSA 3O9SA 4KHYA 5KTQA 4EIAA 3J7YP 3DLHA 1ZBIA 3R1XA 2O8FB 2QWNA 4CZGA 2E20A 1WAFA 4B9UA 1SS6A 5F2RA 4HUEA 3WQUA 3THVA 2XHBA 3L2VA 1ZYQA 3QMLA 2P9LB 2ITGA 1BUPA 4UQGA 4RWTA 2E2OA 3CJAA 3T3FA 4ISEA 3L8BA 2F96A 5LMNK 3K0SA 3VA3A 4EZ6A 4BR5A 1G15A 3O4WA 3CCMN 3QETA 4C1NK 1ZBFA 2YNIA 3H6EA 3NF7A 5IWAK 4FM1A 4C8MA 1HKCA 4GNIA 4DQQA 1U49A 1KFDA 3OYAA 4BDZA 2VGMA 3MAQA 3O4QA 5FPDA 1KD1O 3OYLA 1VQ7N 2OZSA 4J2BA 1S6PA 1NGBA 4DMNA 3M3ZA 4CEQA 4DR2K 3NH2A 4BRNA 1GLDG 4AHCA 4BRMA 3S3OA 1EWQA 2KLAA 1BU6O 3ZCMA 2J4RA 1IKVA 4DV3K 1QQNA 2D0BA 2Q2RA 1XI1A 2W6KA 4JI8K 3V1OA 3SCXA 1NKBA 4CZLA 3FLCO 1BCOA 1EXQA 4WQ5C 1JKHA 2QW9A 4RCHA 2Q36A 1NGHA 3VEOA 4A2AA 3KD5E 4QOZB 3HPOA 2ZM6K 3AVBA 3OYDA 3BUZB 2FLOA 5LL6Z 2VCPA 1TUYA 4AILC 2E2QA 5AQPA 3BGRA 2E8AA 4Z4HA 3K9KA 5H1SQ 5HBMA 1VQ5N 4CFAA 3ALYA 4KH5A 5JICA 2E5LK 1X1PA 1XHXA 3AO2A 1ZBSA 5C2DA 4WFBL 2OYQA 4JI7K 3CYMA 4J8FA 1ATSA 4FLXA 5AQVA 3CFOA 1BISA 3NF9A 4IO8A 1QS4A 2VYPA 3AARA 1M90O 3KKSA 5JVHL 3D45A 3THXA 4YOVA 1NMNA 3U9ZA 5M1FA 5AZIA 3ITHA 5E26A 3C94A 1IBLK 3WQTA 1NU0A 3ATVA 3O3GA 4DU1A 3AGRA 1QHTA 3TU5A 1IKYA 3CQXA 4K25A 1QTMA 4CEZA 4WQ5A 4N56A 1VRTA 3NGZA 1FKOA 1RCHA 3DAWA 4QAGA 4CF1A 4AHVA 4CJUA 3CHWA 1GLLO 2D0AA 4N41A 3HPGA 4BQLA 4HCBA 3LDQA 1GLJO 1KCFA 3EKUA 5M1NA 1Z26A 2YHAA 3VF4A 2Z1IA 3GE1A 4B1XB 2OPSA 3HXMA 1S3XA 3VN5A 3SV4A 3SQ0A 1UAXA 3TAQA 2O8CA 5B8HA 2NRHA 4JKBA 4JKGA 4ZTJA 3BF1A 4KHNA 2O8EB 3IG1A 4IFYA 3SZ2A 4B3TK 4H03B 3IRXA 4IG3A 4M63C 1KRPA 3HVTA 3AGKA 3JAMO 3IKMA 3NFAA 4DTPA 5EY4A 4WCEL 1VQKN 1IBMK 1FKPA 4CI6A 3PLAA 2QK9A 4LH4A 4FOIA 4BRKA 2GUIA 4JEPA 2BE2A 4CF9A 4LH5A 1BQMA 2VGNA 4J2AA 4H5VA 3S9HA 4DSKA 3ISNC 4G9ZA 1S9EA 3MN9A 3L2RA 3HP9A 3DOKA 4CECA 4DHYA 2KZZA 2HVIA 1JLCA 1VSEA 4BACA 1B9DA 4CJ3A 2E1YA 4OLBA 3TR8A 2B4JA 2FXUA 4BG8A 3OJUA 4CGDA 1V4SA 1E3MA 1P90A 1YTUA 1LOTB 4CZEA 4BWJA 2ITMA 1GLAG 3AVIA 4FJJA 4IEIA 1T05A 3DLRA 1SV5A 4C8NA 2YNFA 1DLOA 3RRHA 1NLVA 2GX9A 5F0XA 2GUPA 4F4KA 3LWMA 3O6WA 3O9TA 3CCSN 2ZF5O 3C7NA 1XHZA 1N33K 2KW4A 3B6PA 3MN5A 4CHOA 3D0PA 5C42A 1NGEA 1IV0A 3DLGA 2OPPA 4BREA 4E1JA 2NUBA 1NBWA 3KZBA 3Q7CA 4PUOA 3N4PA 3C0BA 1N8RO 1Z25A 1RGIA 2UUCK 3HL8A 4CIGA 5AQKA 2RE2A 3FFIA 3LALA 3PY8A 5AQSA 2ASPA 2YI1A 1RNHA 1ASVA 2IOCA 1SZ2A 4CJ4A 4JK8A 1RDWX 3OYGA 3FZHA 4CGFA 3ASMA 3K5OA 3AA3A 3FGUA 4GKJK 2G8VA 1J5EK 5HOOA 3HOTA 4FWNA 4LF6K 2YHBA 2W6LA 1ILYA 4DUZK 3TTFA 1VSFA 1JLBA 2HMPA 5IT9O 4YFUA 4FSVA 3I8DA 3SPYA 3FE1A 5JVGL 2B6AA 4EP5A 1NJIO 4LSNA 5SZTA 3CFPA 3QESA 4EHUA 1HNWK 1DEJA 3M8PA 3THXB 3DI6A 4Y1CA 4IFVA 1JLGA 1A5VA 5AZIB 3HJFA 3HT3A 3ENHA 1J9AA 1TYQA 1IBKK 3LDOA 1NGGA 1HYZA 2IVNA 3OS2A 3H45C 3DRPA 2HF3A 4FZYA 3CETA 2P9SA 2OPQA 1QZ6A 1VSJA 3A5LC 4K43A 4CIFA 3TAPA 2NRRA 1XQSC 4F2RA 1OH8A 3KLEA 4FJKA 4BRDA 3OS0A 4OLAA 3K5LA 1BG3A 1RILA 4M3XA 5DM7L 3R6MA 2ZE2A 1NK4A 2YKNA 1JLAA 3BP8A 3SAHA 2O8CB 1WSFA 5LJVA 3J7ZO 1D5AA 1RT4A 3ID8A 4JKGB 5EXWA 4FLUA 2JWLA 4KPYA 2QKKA 3D2EA 4FWKA 4DTOA 3SUQA 5BN8A 3ZLJA 2GELA 1ATNA 1ASUA 3IS9A 3RMCA 5BRDA 1U45A 3CC7N 3LPUA 4JKCA 2Z1GA 3NMUA 3PUFA 4DF8A 3LP1A 3U3YA 3RSEA 3AO5A 5EX5A 2X78A 4FWLA 3ZSOA 1J53A 1GOAA 1S1WA 4BR9A 4BR2A 4DV6K 4LFCK 1BO5O 1RDUA 1RBRA 1VSDA 3F5TA 1T6CA 3CPWM 3GBTA 4I2QA 4XH4A 2W41A 4JRPA 4HTLA 4BVPA 2WFBA 1SKWA 1LWCA 3ZT2A 1VQMN 5GIOA 2QWMA 5FPMA 3ULDA 3L0QA 1C1AA 4LF7K 1IKWA 4QS7A 4PKIA 2OPRA 1VK0A 2PAVA 2WTUA 5AQQA 4ICLA 2WC9A 4TSXA 3VQPA 3R8EA 1W2BM 3WXLA 4K42A 2P5OA 2V51B 2VG7A 1NGFA 3C7NB 2YHXA 4NLBA 3G25A 1T44A 2IS3A 4JN4A 4DCHA 3ZETA 1HX1A 4H5WA 5LY3A 3MEDA 1TKDA 3KIOA 2VG6A 1P8ZA 3NF6A 2FF6A 1HNIA 4WE1A 3U3GA 1NG9A 3EO3A 3FZKA 4E7HA 4YOUA 1KAYA 4AHRA 4BGAA 1XWLA 3O4NA 2BTFA 4HTUA 1LAVA 4I9QA 4R5PA 3AA5X 4LY7A 4CEAA 4CFBA 4CGHA 2XY7A 3DLKA 4DQIA 4W5RA 4GV3A 2P51A 1U47A 3PV8A 4RTFD 3T1YK 2Q1NA 2X6NA 5FLXO 4DKWA 3CJCA 3V9ZA 4DS5A 4EP4A 4H4OA 3Q7BA 2X6SA 3NGIA 5FRNA 5C12A 3O3FA 2I7PA 3RTVA 4E3SA 3KK2A 3G6EN 3QNOA 1RDBA 3OVNA 3AV9A 3KK3A 3NBPA 4CGGA 4A57A 3RMDA 3M1FA 3C95A 3C6HA 3E9PA 4C8OA 1NOYA 1ASWA 1HPMA 1TK0A 3KTQA 2FBYA 3V9SA 1SL0A 5DMRA 1JL1A 3CCVN 3BZCA 4IOXA 4Z4GA 3O80A 4GMJB 4YOWA 3LP0A 5EOYA 4U67L 4DR3K 3UKUA 3P31A 5BR8K 1U2VA 1IKXA 4CEEA 2G8KA 3JSMA 4M3ZA 1UWBA 1TYQB 4B1UB 4W5NA 1Y97A 3QIOA 1OVQA 3WNGA 2NRZA 3JYTA 3L3VA 4IJAA 4WFNL 3QNNA 2P9SB 2UUAK 3SQ1A 4KB0A 3VERA 4MQ3A 3M8RA 2RKIA 4Y1DA 1U48A 2KQ2A 4B3RK 2EHGA 1S9GA 3PIPL 1WSJA 3B8AX 3LAKA 1XC3A 4M45A 4FCYA 3AA4A 1OH6A 4JLHA 4HUGA 1C0TA 2GWJA 3H3NO 1KVCA 2O4IA 4L3QA 3CF5L 4JK7A 1DGKN 3OA9A 3PSFA 2YJFA 4BRQA 3OYJA 2FSJA 4NXMK 1UOCA 1WSEA 2YNHA 3ID6A 4CEFA 3T69A 3D2EB 1HKBA 5AQNA 2DFEA 3OBYA 3L3UA 1N6QA 1C1CA 4CBWA 3MECA 5I3UA 3R9PA 3AVAA 4PWDA 4ELUA 4YORA 3ZEUA 1HR0K 3HI0A 3WXKA 4DB3A 1HUXA 4B9NA 1TL3A 3RSEB 4CF8A 4BRIA 1HYVA 4CJKA 3MWPA 4Y0WA 5CR4A 4DF4A 1Q7YO 1QHAA 1GLCG 2IVOA 2KFNA 2HW3A 2DFHA 1TVRA 2YHWA 4KFBA 3A8YA 1ZBHA 5E41A 1JCEA 5FDLA 4W5QA 3H3OB 4E7LA 1YJNN 4H0VB 3H1VX 1MDUB 1VSLA 3A0IX 1YVNA 3S41A 4BC4A 3SJHA 4FZZA 1Y64A 2CGKA 4XH5A 5HRNA 4MO5A 3AAQA 3OYEA 4BE1A 1WSHA 4K8XA 1D9FA 1LWEA 1REVA 4ILJA 4CJQA 1QVGM 3P38A 5AJ3K 3AVKA 3K2PA 4B9MA 3KHYA 4H5RA 4CIEA 3E9OA 1C1BA 3UE5A 5AQTA 4CJLA 3VQ7A 3ZETB 4CVNE 4JV5K 4CZJA 3TAEA 3VF6A 4DTSA 4FK4A 5EU7A 1DTTA 1X9MA 2DY4A 4CJRA 4JS4A 1QE1A 2UXBK 1NK6A 2G8UA 4J2DA 4DQ8A 2QEXN 4HWIA 3AA2A 4NYNA 1S72N 3QFUA 1NM1A 3ZSVA 1QSSA 3SAFA 4A59A 1IG9A 4NLCA 1VSHA 3M5RA 5C10A
chains in the Genus database with same CATH topology
1S1TA 3DLGA 3V81A 2OPPA 1RTJA 1S1UA 4DSIA 4N5SA 1L3UA 4HUFA 3DOLA 2NUBA 4KHSA 5SWMA 5HRSA 1B9FA 3HPHA 4Q5VA 1NK9A 1LV5A 1L5UA 3HM9A 3OYCA 5JS2A 3SV3A 2B5JA 4LSLA 2XY5A 4FLWA 3BDPA 2RF2A 4M42A 4PUOA 3DYAA 3AVFA 3AO3A 4FLZA 1BHLA 4O44A 1A5XA 5JS1A 4IG0A 4DTUA 3OYNA 1Z25A 3WNFA 3HL8A 5K14A 4B9LA 3OY9A 1NK5A 4CIGA 4C8LA 4CF2A 1LW0A 3P5JA 3FFIA 4KO0A 2HB5A 4AHSA 4B9SA 3LALA 4OGEA 1Q9YA 3DM2A 3PY8A 1RNHA 1ASVA 1RBTA 1LW2A 1CZ9A 2IOCA 4CJ4A 5KI6A 4N47A 1RTIA 2HNYA 4KI4A 3OYGA 4O0IA 4FLTA 4CGFA 1HMVA 3ASMA 4Q0BA 3K5OA 3AA3A 3MEEA 2DFFA 1KVAA 4CJFA 1NKEA 4O55A 1SL2A 4E89A 3DLBA 4DFJA 4E7KA 2G8VA 4N76A 3AO1A 2Q3SA 3DLEA 4B3OA 3VQBA 4DU4A 3QO9A 3V4IA 1HYSA 3QINA 3C6TA 2YHBA 5CYMA 3TARA 4Z4FA 1VSFA 1HQEA 2IGIA 1JLBA 1HPZA 4E7IA 1C0UA 3UIQA 3WNEA 2VG5A 4HHTA 4DLEA 3AO4A 1L3VA 1RBVA 3MXIA 4YFUA 4FJHA 4FLYA 3V6DA 1YT3A 2KZMA 1TL1A 3VQDA 4O5BA 5KRSA 3NF8A 3VQEA 3I8DA 1JLEA 2HHVA 4B8CA 3NH1A 2PZSA 3V9WA 4ID1A 1KFSA 4L8RB 3HYFA 4BE0A 4CGIA 3KLFA 1KSPA 4NCBA 3LP3A 4CHQA 4DTXA 3OYHA 3SPYA 1U04A 2B6AA 3T1AA 4CESA 4EP5A 4OKEA 3LDSA 4FW2A 4LSNA 5J1EA 3LZIA 1A5WA 5SZTA 3CFPA 3QESA 3KKRA 4FJXA 2FBTA 3EZ5A 1TV6A 2XRIA 3M8PA 4CJPA 3DI6A 4Y1CA 4H8KA 4CEOA 2XO7A 2D5RA 3ZSYA 1N5YA 1T8EA 1C0MA 3NGYA 1HQUA 4CF0A 4F2SA 4HCCA 4IFVA 1JLGA 1A5VA 3HJFA 3K5NA 4F3OA 4FXDA 3HT3A 1FXXA 5DK5A 4M3UA 1B92A 1J9AA 4F3TA 1HYZA 3OS2A 1J5OA 3V9UA 4FM2A 1XC9A 4DSLA 3DRPA 2KFZA 1RDCA 3S3NA 4KV8A 4FZYA 1K6YA 2G8IA 4FK0A 4E0DA 3VQ5A 3VQ6A 3SUOA 1KLMA 2OPQA 4CK2A 1VSJA 4CJTA 4CIFA 3TAPA 1WSIA 3K57A 4C8KA 4CJVA 4F2RA 1JXEA 3AVNA 3MXJA 2ATQA 4CERA 3OYMA 1LWFA 3KLEA 4DLGA 3RWUA 3TWHA 1NOZA 4M3RA 1D8YA 1FK9A 4ID5A 3VQ8A 1U4BA 3KD1E 3K59A 1LAWA 1L3TA 4FJKA 3SNNA 4J2EA 2HVHA 1BIUA 1RT3A 4DFMA 3LP2A 4FJMA 2Z1JA 4IKFA 1TKZA 1O1WA 2HNZA 2XY6A 4FK2A 3OS0A 4CK1A 4OLAA 2WOMA 1CXQA 3K5LA 4DTNA 3O3HA 4RW8A 5I42A 1RILA 3VQ4A 2P1JA 4M3XA 3OYKA 3MEGA 1I39A 1CXUA 1RDAA 2ZE2A 4LD0A 1BL3A 1NK4A 4Z4CA 2YKNA 1JLAA 4BDYA 1VSMA 1TK8A 4B9TA 1WSFA 1TAUA 1D5AA 1I3AA 3HVRA 1RT4A 2JLEA 4FLUA 5CZ1A 1NJZA 4KPYA 3IAYA 2HHXA 2LSNA 1TK5A 2QKKA 3SQ4A 1NK7A 5T7BA 3OYBA 4DTOA 3EYZA 3SUQA 3L2UA 4K8ZA 2Y1IA 3SPZA 2PYLA 3ZT3A 3NDKA 1ASUA 2GBZA 4CEDA 3IS9A 3RMCA 1U45A 3LPUA 3PO5A 1T7PA 1RT7A 1TKTA 3NHGA 1EP4A 2Z1GA 2I5JA 3VQ9A 4CE9A 3K5MA 4JS5A 4E7JA 4G1QA 4KI6A 2BDPA 1VSKA 3PUFA 1ITGA 3VQCA 2KTQA 4ZTFA 4OPKA 4YNQA 4DF8A 3LP1A 4OVLA 3U3YA 3LAMA 3PX4A 4B9VA 3AO5A 2QKBA 2RN2A 4DQRA 2X78A 4M41A 3L2WA 3ZSOA 1J53A 1GOAA 1YVUA 5HRPA 3QEXA 1S1WA 5HLFA 2HHSA 4CK3A 2FBVA 3E01A 4KREA 2WONA 2OZMA 2Z1HA 4E19A 5C24A 1BGXT 4DQSA 3RMAA 1BI4B 2AJQA 4MFBA 1RBRA 1VSDA 4OGCA 2E4LA 1QSYA 2F8TA 4DSEA 3M8QA 3NH0A 2BGGA 4DTJA 3AVGA 1KVBA 1Q8IA 4I2QA 3LZJA 4JRPA 3EY1A 3DMJA 4FJNA 1SKWA 3AVJA 2P5GA 1LWCA 3V1RA 1TAQA 3ZT2A 1RDDA 3TAMA 3HP6A 2E6LA 5KTQA 1SKSA 2G8FA 4KHYA 4Z4EA 2DTUA 3SI6A 3DLHA 4KHQA 3ULDA 2PY5A 1ZBIA 1C1AA 1IKWA 3ZSRA 4M3YA 3SUNA 1WAFA 4B9UA 2OPRA 5KGXA 1S1VA 5C25A 1VK0A 3AVMA 4HUEA 1RTHA 4ICLA 1WN7A 1YTAA 4DU3A 3THVA 4ELTA 4EZ9A 4TSXA 2XHBA 3VQPA 3L2VA 4PA1A 2IDOA 4RG8A 2RPIA 2P5OA 2HNDA 3TANA 2QXFA 1X9SA 3F73A 1RT1A 2VG7A 2Y1JA 1RBUA 4O0JA 1ZYQA 4CJEA 4I7FA 3SQ2A 2ITGA 2IS3A 4UQGA 3T3FA 1HRHA 1SL1A 1DTQA 3C6UA 3MEDA 1TKDA 3L8BA 4CGJA 2F96A 3RR8A 3KIOA 2EX3A 3SJJA 2VG6A 3ZSXA 3VA3A 4EZ6A 5CY4A 1UA0A 1G15A 3NF6A 3QLHA 3PO4A 1HNIA 2HHTA 4WE1A 3U3GA 3QETA 3QEVA 1ZBFA 3CFRA 2YNIA 4HVJA 3NF7A 4E7HA 4FM1A 4PY5A 4C8MA 4AHRA 3QEIA 4FJ8A 3MXMA 1XWLA 3O4NA 4DQQA 1U49A 3WNHA 1CLQA 1KFDA 4HTUA 1LAVA 1RBSA 4Z0UA 3OYAA 4I9QA 2ZQBA 4R5PA 3AA5X 4LY7A 4CEAA 4BDZA 4CFBA 1KLNA 4CGHA 3RRGA 2XY7A 1EKEA 3MAQA 3O4QA 3DLKA 3OYLA 2OZSA 4DQIA 4CJ5A 4W5RA 3KK1A 1VSIA 4J2BA 1S6PA 2P51A 1U47A 4DMNA 4CEQA 3PV8A 3NH2A 4RW4A 4FJ5A 3HK2A 4AHCA 3DRRA 4AHUA 1NK8A 2X6NA 3NCIA 3RR7A 3V9ZA 1BQNA 2FBXA 3ZT4A 4DS5A 4EP4A 4H4OA 4DTRA 3S3OA 4FJ7A 2X6SA 1F21A 1Q9XA 3ZCMA 3NGIA 2HHQA 3TI0A 1WSGA 1IKVA 1X9WA 5FRNA 4CFDA 1HJRA 3O3FA 3RTVA 2D0BA 4NYFA 3KK2A 4E3SA 3QNOA 1XI1A 1RDBA 3OVNA 3AV9A 3V1OA 3ZT0A 3SCXA 1NKBA 3NE6A 1SUQA 1JL2A 4BWMA 3KK3A 1BCOA 3NBPA 1VRUA 4CGGA 3ZSZA 3RMDA 1EXQA 4KAZA 3HO1A 4OKJA 5J2QA 5CYQA 1JKHA 4ELVA 2JGUA 3B6OA 4M3TA 3QEPA 3C95A 1EETA 1NJWA 4IBNA 3KD5E 4QOZB 3HPOA 4C8OA 1NOYA 1ASWA 2HHWA 3KTQA 1TK0A 3AVBA 3OYDA 4GW6A 2IC3A 3U6FA 2FBYA 4CHPA 3V9SA 1SL0A 4ZHRA 3CG7A 2A1SA 2XY8A 5DMRA 1JL1A 5HROA 4AILC 3LPTA 4QCLA 2YNGA 3BGRA 4Z4HA 2G8WA 4F8RA 4KRFA 3P1GA 4Z4GA 1L3SA 4GMJB 5HBMA 4RW6A 3LP0A 1NKCA 4CFAA 3ALYA 4KKOA 3SUPA 2PYJA 1CZBA 1X1PA 1ZBUA 4Z4IA 1IKXA 3A2FA 1XHXA 3AO2A 4CEEA 4KTQA 2G8KA 2OYQA 2D0CA 3JSMA 1UWBA 4M3ZA 4CJSA 3CYMA 4FLXA 4W5NA 1RT6A 3CFOA 1Y97A 5FRMA 1HNVA 1BISA 3NF9A 3QIOA 4FVMA 2HMIA 2GV9A 1S5JA 4RW9A 1QS4A 3WNGA 1JXBA 1QSLA 4DSJA 3JYTA 3L3VA 4BDPA 3CQ8A 3QNNA 2ETJA 3KJVA 5J2MA 2A1RA 3SQ1A 4KB0A 5HP1A 4O4GA 4FJ9A 3KKSA 4MQ3A 3TAGA 3CM5A 3D45A 2OA8A 3P83D 3M8RA 3KLGA 2RKIA 4Y1DA 4FJIA 2F8SA 1U48A 2KQ2A 3AVHA 2EHGA 1S9GA 5KGWA 4W5OA 1WSJA 3LAKA 1WNSA 4M45A 4FCYA 3AA4A 4JLHA 4HUGA 4FZXC 3ITHA 2R7YA 3C94A 1JLFA 4KTWA 3OS1A 1C0TA 1KTQA 3OJSA 4DWIA 1KVCA 3LANA 4FW1A 3VQAA 4FYDA 2O4IA 1SKRA 3V1QA 4PQUA 4FM0A 3TAFA 3O3GA 4DU1A 4FJLA 1QHTA 1IKYA 3F9KA 4W5TA 3OYJA 3ZSQA 3OYFA 4CCHA 1QTMA 4CEZA 4N56A 3NGZA 1VRTA 1FKOA 1RCHA 2FC0A 1UOCA 1WSEA 4QAGA 4OPJA 2YNHA 4DG1A 4CF1A 4AHVA 4KTZA 4CJUA 4CEFA 4I9LA 2D0AA 4N41A 3HPGA 2VWKA 4FLVA 3RMBA 4HCBA 1WAJA 2DFEA 4CHZA 3L3UA 4NCAA 1KCFA 1N6QA 1BCMA 1C1CA 1Z26A 2YHAA 2Z1IA 5I3UA 3MECA 2E6MA 4DQPA 1RTDA 1RT5A 3KLIA 3AVAA 2OPSA 4CEBA 4PWDA 2O4GA 3AVCA 4ELUA 3HXMA 2HHUA 1MU2A 4IDKA 2IAJA 3L2QA 3VN5A 1NJXA 1ZBLA 1RT2A 1NK0A 3SV4A 3SQ0A 1UAXA 5FROA 3DRSA 4OJRA 3TAQA 4B9NA 3T19A 1TL3A 4CF8A 3QEWA 4ZTJA 4KHNA 4DFKA 1IH7A 3IG1A 1HYVA 4IFYA 3QIPA 4CJKA 3SZ2A 5KRTA 4DF4A 3PX0A 1C6VA 2BANA 3IRXA 4IG3A 1KRPA 2KFNA 1IO2A 3HSTB 3HVTA 3ZSWA 3PX6A 2HW3A 2DFHA 1TVRA 4KFBA 4KHWA 3NFAA 4DTPA 3NAEA 1ZBHA 5E41A 5FDLA 1FKPA 4CHYA 4W5QA 2X74A 4E1NA 1JLQA 4E7LA 1NJYA 4XIUA 3OYIA 2QK9A 2YV0X 4LH4A 1S1XA 4E1MA 3I0RA 2GUIA 4KHUA 4FJGA 1VSLA 2BE2A 4AHTA 4CF9A 3VA0A 4OKKA 1UA1A 4LH5A 1BQMA 3S3MA 4FZZA 1R0AA 1S6QA 4J2AA 3S9HA 4DSKA 3ISNC 4CHNA 5HRNA 3TABA 2VWJA 1S9EA 3I0SA 4H4MA 3OYEA 3L2RA 4BE1A 4RW7A 3VQQA 3HP9A 3DOKA 1WSHA 3QERA 4CECA 4B08A 3H08A 1LWEA 1D9FA 1D9DA 1BI4A 4K8XA 2KZZA 2HVIA 3KLHA 1JLCA 3K58A 1REVA 1VSEA 4BACA 4CJQA 3ZT1A 1B9DA 4CJ3A 3AVLA 4GVMA 4OLBA 5CZ2A 3TR8A 3CM6A 2B4JA 3AVKA 3K2PA 1J54A 1EX4A 4B9MA 3M8SA 3OJUA 2YKMA 4CGDA 4CIEA 1TGOA 1C1BA 4B8AB 4CJLA 3VQ7A 4CJWA 1BIZA 1W0HA 5HRRA 2G8HA 1YTUA 3SYZA 3TAEA 3LWLA 4DTSA 4FK4A 4AH9A 4BWJA 5EU7A 1DTTA 1WLJA 1X9MA 4DTMA 2W42A 2DY4A 3AVIA 1T03A 4FJJA 4CJRA 1GOBA 1T05A 3DLRA 4JS4A 1QE1A 5J2NA 1NK6A 1SV5A 1TKXA 4C8NA 4DFPA 2G8UA 1QQCA 2YNFA 4J2DA 1DLOA 4KB1A 3RRHA 4DSFA 4F4KA 3LWMA 3AA2A 4NYNA 4I2PA 4CFCA 3G0ZA 4M3WA 3V9XA 3ZSVA 1QSSA 2ZD1A 4NCGA 3G10A 1XHZA 4JRQA 1IG9A 1W9HA 1GOCA 5J2PA 2KW4A 1VSHA 3B6PA 4CHOA 3D0PA 4BE2A 5C42A 4DS4A 5D3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1T A;  3DLG A;  3V81 A;  2OPP A;  1RTJ A;  1S1U A;  4DSI A;  4N5S A;  1L3U A;  4HUF A;  3DOL A;  2NUB A;  4KHS A;  5SWM A;  5HRS A;  1B9F A;  3HPH A;  4Q5V A;  1NK9 A;  1LV5 A;  1L5U A;  3HM9 A;  3OYC A;  5JS2 A;  3SV3 A;  2B5J A;  4LSL A;  2XY5 A;  4FLW A;  3BDP A;  2RF2 A;  4M42 A;  4PUO A;  3DYA A;  3AVF A;  3AO3 A;  4FLZ A;  1BHL A;  4O44 A;  1A5X A;  5JS1 A;  4IG0 A;  4DTU A;  3OYN A;  1Z25 A;  3WNF A;  3HL8 A;  5K14 A;  4B9L A;  3OY9 A;  1NK5 A;  4CIG A;  4C8L A;  4CF2 A;  1LW0 A;  3P5J A;  3FFI A;  4KO0 A;  2HB5 A;  4AHS A;  4B9S A;  3LAL A;  4OGE A;  1Q9Y A;  3DM2 A;  3PY8 A;  1RNH A;  1ASV A;  1RBT A;  1LW2 A;  1CZ9 A;  2IOC A;  4CJ4 A;  5KI6 A;  4N47 A;  1RTI A;  2HNY A;  4KI4 A;  3OYG A;  4O0I A;  4FLT A;  4CGF A;  1HMV A;  3ASM A;  4Q0B A;  3K5O A;  3AA3 A;  3MEE A;  2DFF A;  1KVA A;  4CJF A;  1NKE A;  4O55 A;  1SL2 A;  4E89 A;  3DLB A;  4DFJ A;  4E7K A;  2G8V A;  4N76 A;  3AO1 A;  2Q3S A;  3DLE A;  4B3O A;  3VQB A;  4DU4 A;  3QO9 A;  3V4I A;  1HYS A;  3QIN A;  3C6T A;  2YHB A;  5CYM A;  3TAR A;  4Z4F A;  1VSF A;  1HQE A;  2IGI A;  1JLB A;  1HPZ A;  4E7I A;  1C0U A;  3UIQ A;  3WNE A;  2VG5 A;  4HHT A;  4DLE A;  3AO4 A;  1L3V A;  1RBV A;  3MXI A;  4YFU A;  4FJH A;  4FLY A;  3V6D A;  1YT3 A;  2KZM A;  1TL1 A;  3VQD A;  4O5B A;  5KRS A;  3NF8 A;  3VQE A;  3I8D A;  1JLE A;  2HHV A;  4B8C A;  3NH1 A;  2PZS A;  3V9W A;  4ID1 A;  1KFS A;  4L8R B;  3HYF A;  4BE0 A;  4CGI A;  3KLF A;  1KSP A;  4NCB A;  3LP3 A;  4CHQ A;  4DTX A;  3OYH A;  3SPY A;  1U04 A;  2B6A A;  3T1A A;  4CES A;  4EP5 A;  4OKE A;  3LDS A;  4FW2 A;  4LSN A;  5J1E A;  3LZI A;  1A5W A;  5SZT A;  3CFP A;  3QES A;  3KKR A;  4FJX A;  2FBT A;  3EZ5 A;  1TV6 A;  2XRI A;  3M8P A;  4CJP A;  3DI6 A;  4Y1C A;  4H8K A;  4CEO A;  2XO7 A;  2D5R A;  3ZSY A;  1N5Y A;  1T8E A;  1C0M A;  3NGY A;  1HQU A;  4CF0 A;  4F2S A;  4HCC A;  4IFV A;  1JLG A;  1A5V A;  3HJF A;  3K5N A;  4F3O A;  4FXD A;  3HT3 A;  1FXX A;  5DK5 A;  4M3U A;  1B92 A;  1J9A A;  4F3T A;  1HYZ A;  3OS2 A;  1J5O A;  3V9U A;  4FM2 A;  1XC9 A;  4DSL A;  3DRP A;  2KFZ A;  1RDC A;  3S3N A;  4KV8 A;  4FZY A;  1K6Y A;  2G8I A;  4FK0 A;  4E0D A;  3VQ5 A;  3VQ6 A;  3SUO A;  1KLM A;  2OPQ A;  4CK2 A;  1VSJ A;  4CJT A;  4CIF A;  3TAP A;  1WSI A;  3K57 A;  4C8K A;  4CJV A;  4F2R A;  1JXE A;  3AVN A;  3MXJ A;  2ATQ A;  4CER A;  3OYM A;  1LWF A;  3KLE A;  4DLG A;  3RWU A;  3TWH A;  1NOZ A;  4M3R A;  1D8Y A;  1FK9 A;  4ID5 A;  3VQ8 A;  1U4B A;  3KD1 E;  3K59 A;  1LAW A;  1L3T A;  4FJK A;  3SNN A;  4J2E A;  2HVH A;  1BIU A;  1RT3 A;  4DFM A;  3LP2 A;  4FJM A;  2Z1J A;  4IKF A;  1TKZ A;  1O1W A;  2HNZ A;  2XY6 A;  4FK2 A;  3OS0 A;  4CK1 A;  4OLA A;  2WOM A;  1CXQ A;  3K5L A;  4DTN A;  3O3H A;  4RW8 A;  5I42 A;  1RIL A;  3VQ4 A;  2P1J A;  4M3X A;  3OYK A;  3MEG A;  1I39 A;  1CXU A;  1RDA A;  2ZE2 A;  4LD0 A;  1BL3 A;  1NK4 A;  4Z4C A;  2YKN A;  1JLA A;  4BDY A;  1VSM A;  1TK8 A;  4B9T A;  1WSF A;  1TAU A;  1D5A A;  1I3A A;  3HVR A;  1RT4 A;  2JLE A;  4FLU A;  5CZ1 A;  1NJZ A;  4KPY A;  3IAY A;  2HHX A;  2LSN A;  1TK5 A;  2QKK A;  3SQ4 A;  1NK7 A;  5T7B A;  3OYB A;  4DTO A;  3EYZ A;  3SUQ A;  3L2U A;  4K8Z A;  2Y1I A;  3SPZ A;  2PYL A;  3ZT3 A;  3NDK A;  1ASU A;  2GBZ A;  4CED A;  3IS9 A;  3RMC A;  1U45 A;  3LPU A;  3PO5 A;  1T7P A;  1RT7 A;  1TKT A;  3NHG A;  1EP4 A;  2Z1G A;  2I5J A;  3VQ9 A;  4CE9 A;  3K5M A;  4JS5 A;  4E7J A;  4G1Q A;  4KI6 A;  2BDP A;  1VSK A;  3PUF A;  1ITG A;  3VQC A;  2KTQ A;  4ZTF A;  4OPK A;  4YNQ A;  4DF8 A;  3LP1 A;  4OVL A;  3U3Y A;  3LAM A;  3PX4 A;  4B9V A;  3AO5 A;  2QKB A;  2RN2 A;  4DQR A;  2X78 A;  4M41 A;  3L2W A;  3ZSO A;  1J53 A;  1GOA A;  1YVU A;  5HRP A;  3QEX A;  1S1W A;  5HLF A;  2HHS A;  4CK3 A;  2FBV A;  3E01 A;  4KRE A;  2WON A;  2OZM A;  2Z1H A;  4E19 A;  5C24 A;  1BGX T;  4DQS A;  3RMA A;  1BI4 B;  2AJQ A;  4MFB A;  1RBR A;  1VSD A;  4OGC A;  2E4L A;  1QSY A;  2F8T A;  4DSE A;  3M8Q A;  3NH0 A;  2BGG A;  4DTJ A;  3AVG A;  1KVB A;  1Q8I A;  4I2Q A;  3LZJ A;  4JRP A;  3EY1 A;  3DMJ A;  4FJN A;  1SKW A;  3AVJ A;  2P5G A;  1LWC A;  3V1R A;  1TAQ A;  3ZT2 A;  1RDD A;  3TAM A;  3HP6 A;  2E6L A;  5KTQ A;  1SKS A;  2G8F A;  4KHY A;  4Z4E A;  2DTU A;  3SI6 A;  3DLH A;  4KHQ A;  3ULD A;  2PY5 A;  1ZBI A;  1C1A A;  1IKW A;  3ZSR A;  4M3Y A;  3SUN A;  1WAF A;  4B9U A;  2OPR A;  5KGX A;  1S1V A;  5C25 A;  1VK0 A;  3AVM A;  4HUE A;  1RTH A;  4ICL A;  1WN7 A;  1YTA A;  4DU3 A;  3THV A;  4ELT A;  4EZ9 A;  4TSX A;  2XHB A;  3VQP A;  3L2V A;  4PA1 A;  2IDO A;  4RG8 A;  2RPI A;  2P5O A;  2HND A;  3TAN A;  2QXF A;  1X9S A;  3F73 A;  1RT1 A;  2VG7 A;  2Y1J A;  1RBU A;  4O0J A;  1ZYQ A;  4CJE A;  4I7F A;  3SQ2 A;  2ITG A;  2IS3 A;  4UQG A;  3T3F A;  1HRH A;  1SL1 A;  1DTQ A;  3C6U A;  3MED A;  1TKD A;  3L8B A;  4CGJ A;  2F96 A;  3RR8 A;  3KIO A;  2EX3 A;  3SJJ A;  2VG6 A;  3ZSX A;  3VA3 A;  4EZ6 A;  5CY4 A;  1UA0 A;  1G15 A;  3NF6 A;  3QLH A;  3PO4 A;  1HNI A;  2HHT A;  4WE1 A;  3U3G A;  3QET A;  3QEV A;  1ZBF A;  3CFR A;  2YNI A;  4HVJ A;  3NF7 A;  4E7H A;  4FM1 A;  4PY5 A;  4C8M A;  4AHR A;  3QEI A;  4FJ8 A;  3MXM A;  1XWL A;  3O4N A;  4DQQ A;  1U49 A;  3WNH A;  1CLQ A;  1KFD A;  4HTU A;  1LAV A;  1RBS A;  4Z0U A;  3OYA A;  4I9Q A;  2ZQB A;  4R5P A;  3AA5 X;  4LY7 A;  4CEA A;  4BDZ A;  4CFB A;  1KLN A;  4CGH A;  3RRG A;  2XY7 A;  1EKE A;  3MAQ A;  3O4Q A;  3DLK A;  3OYL A;  2OZS A;  4DQI A;  4CJ5 A;  4W5R A;  3KK1 A;  1VSI A;  4J2B A;  1S6P A;  2P51 A;  1U47 A;  4DMN A;  4CEQ A;  3PV8 A;  3NH2 A;  4RW4 A;  4FJ5 A;  3HK2 A;  4AHC A;  3DRR A;  4AHU A;  1NK8 A;  2X6N A;  3NCI A;  3RR7 A;  3V9Z A;  1BQN A;  2FBX A;  3ZT4 A;  4DS5 A;  4EP4 A;  4H4O A;  4DTR A;  3S3O A;  4FJ7 A;  2X6S A;  1F21 A;  1Q9X A;  3ZCM A;  3NGI A;  2HHQ A;  3TI0 A;  1WSG A;  1IKV A;  1X9W A;  5FRN A;  4CFD A;  1HJR A;  3O3F A;  3RTV A;  2D0B A;  4NYF A;  3KK2 A;  4E3S A;  3QNO A;  1XI1 A;  1RDB A;  3OVN A;  3AV9 A;  3V1O A;  3ZT0 A;  3SCX A;  1NKB A;  3NE6 A;  1SUQ A;  1JL2 A;  4BWM A;  3KK3 A;  1BCO A;  3NBP A;  1VRU A;  4CGG A;  3ZSZ A;  3RMD A;  1EXQ A;  4KAZ A;  3HO1 A;  4OKJ A;  5J2Q A;  5CYQ A;  1JKH A;  4ELV A;  2JGU A;  3B6O A;  4M3T A;  3QEP A;  3C95 A;  1EET A;  1NJW A;  4IBN A;  3KD5 E;  4QOZ B;  3HPO A;  4C8O A;  1NOY A;  1ASW A;  2HHW A;  3KTQ A;  1TK0 A;  3AVB A;  3OYD A;  4GW6 A;  2IC3 A;  3U6F A;  2FBY A;  4CHP A;  3V9S A;  1SL0 A;  4ZHR A;  3CG7 A;  2A1S A;  2XY8 A;  5DMR A;  1JL1 A;  5HRO A;  4AIL C;  3LPT A;  4QCL A;  2YNG A;  3BGR A;  4Z4H A;  2G8W A;  4F8R A;  4KRF A;  3P1G A;  4Z4G A;  1L3S A;  4GMJ B;  5HBM A;  4RW6 A;  3LP0 A;  1NKC A;  4CFA A;  3ALY A;  4KKO A;  3SUP A;  2PYJ A;  1CZB A;  1X1P A;  1ZBU A;  4Z4I A;  1IKX A;  3A2F A;  1XHX A;  3AO2 A;  4CEE A;  4KTQ A;  2G8K A;  2OYQ A;  2D0C A;  3JSM A;  1UWB A;  4M3Z A;  4CJS A;  3CYM A;  4FLX A;  4W5N A;  1RT6 A;  3CFO A;  1Y97 A;  5FRM A;  1HNV A;  1BIS A;  3NF9 A;  3QIO A;  4FVM A;  2HMI A;  2GV9 A;  1S5J A;  4RW9 A;  1QS4 A;  3WNG A;  1JXB A;  1QSL A;  4DSJ A;  3JYT A;  3L3V A;  4BDP A;  3CQ8 A;  3QNN A;  2ETJ A;  3KJV A;  5J2M A;  2A1R A;  3SQ1 A;  4KB0 A;  5HP1 A;  4O4G A;  4FJ9 A;  3KKS A;  4MQ3 A;  3TAG A;  3CM5 A;  3D45 A;  2OA8 A;  3P83 D;  3M8R A;  3KLG A;  2RKI A;  4Y1D A;  4FJI A;  2F8S A;  1U48 A;  2KQ2 A;  3AVH A;  2EHG A;  1S9G A;  5KGW A;  4W5O A;  1WSJ A;  3LAK A;  1WNS A;  4M45 A;  4FCY A;  3AA4 A;  4JLH A;  4HUG A;  4FZX C;  3ITH A;  2R7Y A;  3C94 A;  1JLF A;  4KTW A;  3OS1 A;  1C0T A;  1KTQ A;  3OJS A;  4DWI A;  1KVC A;  3LAN A;  4FW1 A;  3VQA A;  4FYD A;  2O4I A;  1SKR A;  3V1Q A;  4PQU A;  4FM0 A;  3TAF A;  3O3G A;  4DU1 A;  4FJL A;  1QHT A;  1IKY A;  3F9K A;  4W5T A;  3OYJ A;  3ZSQ A;  3OYF A;  4CCH A;  1QTM A;  4CEZ A;  4N56 A;  3NGZ A;  1VRT A;  1FKO A;  1RCH A;  2FC0 A;  1UOC A;  1WSE A;  4QAG A;  4OPJ A;  2YNH A;  4DG1 A;  4CF1 A;  4AHV A;  4KTZ A;  4CJU A;  4CEF A;  4I9L A;  2D0A A;  4N41 A;  3HPG A;  2VWK A;  4FLV A;  3RMB A;  4HCB A;  1WAJ A;  2DFE A;  4CHZ A;  3L3U A;  4NCA A;  1KCF A;  1N6Q A;  1BCM A;  1C1C A;  1Z26 A;  2YHA A;  2Z1I A;  5I3U A;  3MEC A;  2E6M A;  4DQP A;  1RTD A;  1RT5 A;  3KLI A;  3AVA A;  2OPS A;  4CEB A;  4PWD A;  2O4G A;  3AVC A;  4ELU A;  3HXM A;  2HHU A;  1MU2 A;  4IDK A;  2IAJ A;  3L2Q A;  3VN5 A;  1NJX A;  1ZBL A;  1RT2 A;  1NK0 A;  3SV4 A;  3SQ0 A;  1UAX A;  5FRO A;  3DRS A;  4OJR A;  3TAQ A;  4B9N A;  3T19 A;  1TL3 A;  4CF8 A;  3QEW A;  4ZTJ A;  4KHN A;  4DFK A;  1IH7 A;  3IG1 A;  1HYV A;  4IFY A;  3QIP A;  4CJK A;  3SZ2 A;  5KRT A;  4DF4 A;  3PX0 A;  1C6V A;  2BAN A;  3IRX A;  4IG3 A;  1KRP A;  2KFN A;  1IO2 A;  3HST B;  3HVT A;  3ZSW A;  3PX6 A;  2HW3 A;  2DFH A;  1TVR A;  4KFB A;  4KHW A;  3NFA A;  4DTP A;  3NAE A;  1ZBH A;  5E41 A;  5FDL A;  1FKP A;  4CHY A;  4W5Q A;  2X74 A;  4E1N A;  1JLQ A;  4E7L A;  1NJY A;  4XIU A;  3OYI A;  2QK9 A;  2YV0 X;  4LH4 A;  1S1X A;  4E1M A;  3I0R A;  2GUI A;  4KHU A;  4FJG A;  1VSL A;  2BE2 A;  4AHT A;  4CF9 A;  3VA0 A;  4OKK A;  1UA1 A;  4LH5 A;  1BQM A;  3S3M A;  4FZZ A;  1R0A A;  1S6Q A;  4J2A A;  3S9H A;  4DSK A;  3ISN C;  4CHN A;  5HRN A;  3TAB A;  2VWJ A;  1S9E A;  3I0S A;  4H4M A;  3OYE A;  3L2R A;  4BE1 A;  4RW7 A;  3VQQ A;  3HP9 A;  3DOK A;  1WSH A;  3QER A;  4CEC A;  4B08 A;  3H08 A;  1LWE A;  1D9F A;  1D9D A;  1BI4 A;  4K8X A;  2KZZ A;  2HVI A;  3KLH A;  1JLC A;  3K58 A;  1REV A;  1VSE A;  4BAC A;  4CJQ A;  3ZT1 A;  1B9D A;  4CJ3 A;  3AVL A;  4GVM A;  4OLB A;  5CZ2 A;  3TR8 A;  3CM6 A;  2B4J A;  3AVK A;  3K2P A;  1J54 A;  1EX4 A;  4B9M A;  3M8S A;  3OJU A;  2YKM A;  4CGD A;  4CIE A;  1TGO A;  1C1B A;  4B8A B;  4CJL A;  3VQ7 A;  4CJW A;  1BIZ A;  1W0H A;  5HRR A;  2G8H A;  1YTU A;  3SYZ A;  3TAE A;  3LWL A;  4DTS A;  4FK4 A;  4AH9 A;  4BWJ A;  5EU7 A;  1DTT A;  1WLJ A;  1X9M A;  4DTM A;  2W42 A;  2DY4 A;  3AVI A;  1T03 A;  4FJJ A;  4CJR A;  1GOB A;  1T05 A;  3DLR A;  4JS4 A;  1QE1 A;  5J2N A;  1NK6 A;  1SV5 A;  1TKX A;  4C8N A;  4DFP A;  2G8U A;  1QQC A;  2YNF A;  4J2D A;  1DLO A;  4KB1 A;  3RRH A;  4DSF A;  4F4K A;  3LWM A;  3AA2 A;  4NYN A;  4I2P A;  4CFC A;  3G0Z A;  4M3W A;  3V9X A;  3ZSV A;  1QSS A;  2ZD1 A;  4NCG A;  3G10 A;  1XHZ A;  4JRQ A;  1IG9 A;  1W9H A;  1GOC A;  5J2P A;  2KW4 A;  1VSH A;  3B6P A;  4CHO A;  3D0P A;  4BE2 A;  5C42 A;  4DS4 A;  5D3G A; 
#chains in the Genus database with same CATH topology
 3GL1 A;  1RTJ A;  4DSI A;  4KHS A;  4N5S A;  3DOL A;  1JJ2 M;  3HPH A;  4Q5V A;  3VEV A;  3MCA B;  1GLE G;  5JS2 A;  3SV3 A;  2XY5 A;  5JMV A;  2RF2 A;  3AY9 A;  3SAG A;  3AO3 A;  5GIN A;  2UXD K;  4O44 A;  1A5X A;  1KAZ A;  3OYN A;  3WNF A;  5K14 A;  4IJN A;  3QIC A;  4CZF A;  3P5J A;  4AHS A;  3LM2 A;  4BRF A;  4B3S K;  3J81 O;  4FLT A;  4X62 K;  2DFF A;  4CJF A;  3DLB A;  4DFJ A;  3AO1 A;  5BN9 A;  3QIN A;  3T1H K;  4NXN K;  3O1B A;  3TSP A;  5AQF A;  3UKU B;  1FW6 A;  1HPZ A;  5KPT A;  1ATR A;  3WNE A;  4HHT A;  1U2V B;  2OCE A;  3AO4 A;  1RBV A;  1L3V A;  3QFP A;  1TL1 A;  2HBJ A;  1X3M A;  2YJE A;  4O5B A;  5KRS A;  3CCE N;  3WXM B;  1U6Z A;  4ID1 A;  4BE0 A;  2JWK A;  3KLF A;  5BPN A;  3BEX A;  2WUS A;  4JI4 K;  4H0X B;  2QWO A;  3T1A A;  2RHK A;  5J1E A;  3TPQ A;  5AQO A;  2FBT A;  5AQR A;  3EZ5 A;  1T3V A;  2Q0U A;  4H8K A;  4CEO A;  3ZSY A;  1HQU A;  4CF0 A;  1XMQ K;  2NRX A;  2PBD A;  3K5N A;  4FXD A;  5DM6 L;  5DK5 A;  4H5N A;  1J5O A;  4BC2 A;  2DPN A;  1RDC A;  1YIT N;  3LDL A;  3DXK A;  3VQ5 A;  1KLM A;  4CK2 A;  1XMO K;  4C8K A;  2F4V K;  3KWI A;  4CJV A;  3AVN A;  3OYM A;  4DLG A;  1EWR A;  1LWF A;  4JKH A;  4BRO A;  1LAW A;  3SNN A;  4J2E A;  2IIR A;  4BGB A;  3LP2 A;  4FJM A;  3FZF A;  1O1W A;  2HNZ A;  4FK2 A;  1CXQ A;  4DTN A;  3ZEU B;  3ZYY X;  3MEG A;  3HSC A;  3D7E O;  1BL3 A;  2QWR A;  1TK8 A;  4B9T A;  5GAD P;  3WXI A;  1I3A A;  3MMV A;  2A6A A;  3OBW A;  3SQ4 A;  1ZXO A;  1NK7 A;  2ASM A;  2PYL A;  3ZT3 A;  2A5X A;  1YJW N;  3EN9 A;  2CH5 A;  4DV5 K;  4LF4 K;  5AQL A;  3VEW A;  1Q81 O;  3NHG A;  3VQ9 A;  4I6M A;  2HBK A;  1XNQ K;  1ITG A;  3VQC A;  2KTQ A;  4OPK A;  4B9V A;  2QKB A;  4M41 A;  1YVU A;  3QEX A;  2H3G X;  3CJB A;  3EL2 A;  4BVO A;  2FBV A;  4MDB A;  4LFA K;  2P9N A;  3M6G A;  1SQK A;  4E19 A;  3DWL A;  3RMA A;  4DR4 K;  3UKR A;  3VEN A;  1VQ9 N;  1QSY A;  4DSE A;  3M8Q A;  4LF8 K;  4BR4 A;  2BGG A;  3AVG A;  1Q8I A;  3LZJ A;  2AA4 A;  1DT9 A;  4FJN A;  3AVJ A;  3W0L A;  2P5G A;  1TAQ A;  4F9O A;  1RDD A;  3HP6 A;  2G8F A;  3U9D A;  2DTU A;  3SI6 A;  4B1V A;  2F9T A;  2E1Z A;  3LDN A;  2PY5 A;  4M3Y A;  3SUN A;  5KGX A;  1S1V A;  4IDH A;  5C25 A;  2UYT A;  3AVM A;  1RTH A;  1WN7 A;  4DU3 A;  4EZ9 A;  4PA1 A;  4LF9 K;  2IDO A;  2RPI A;  2HND A;  3GDQ A;  4IEE A;  3F73 A;  3MWT A;  1RBU A;  4CJE A;  4I7F A;  4JKE A;  1KQS M;  2HBL A;  1BDG A;  3C6U A;  5AQY A;  4CGJ A;  2EX3 A;  5CY4 A;  1UA0 A;  1FJG K;  3U8X A;  3QLH A;  3CFR A;  1HKG A;  4PY5 A;  1EO1 A;  4FJ8 A;  1BOT O;  4B9Q A;  1CLQ A;  3R3L A;  1VAZ A;  4Z0U A;  2ZQB A;  4FOE A;  2VQE K;  3EEQ A;  4AQY K;  1EKE A;  5AQU A;  4BRP A;  5BRH A;  4JK9 A;  4CJ5 A;  3KK1 A;  2KKZ A;  3HK2 A;  5AQH A;  3DRR A;  3NCI A;  3RR7 A;  4FJ7 A;  3IFR A;  3ZT4 A;  1NGJ A;  3GG4 A;  1F21 A;  3EZW A;  1WSG A;  4CZH A;  3CI5 A;  3KVG A;  3T7Z A;  3PIO L;  5LMU K;  1X9W A;  1HJR A;  5GAE P;  3NE6 A;  3E9L A;  1VRU A;  2ZWH A;  4YOT A;  3HO1 A;  2NRT A;  5CYQ A;  1WUA A;  5BPL A;  4M3T A;  5AQZ A;  3SBG A;  3QEP A;  4BC5 A;  1EET A;  2GWK A;  5JLF A;  2HHW A;  2IC3 A;  4CHP A;  4ZHR A;  4JD2 A;  2XY8 A;  2YX6 A;  4OPA A;  4CZK A;  4KRF A;  2G8W A;  4F8R A;  3P1G A;  4KBO A;  5M1O A;  1L3S A;  1NKC A;  4DV2 K;  1VHX A;  4YDU A;  1CZB A;  1ZBU A;  4KTQ A;  2FSK A;  1YIJ N;  4BY9 C;  4CJS A;  3CCJ N;  5FRM A;  3WEE A;  1HNV A;  2HST A;  4FVM A;  2GV9 A;  1S5J A;  2HHH K;  3HBT A;  1JXB A;  3GOI A;  2YHY A;  1NNE A;  4QS8 A;  3DXK B;  5J2M A;  2A1R A;  3CJ7 A;  4O4G A;  2W40 A;  2OA8 A;  3P83 D;  3KLG A;  4FWP A;  5KGW A;  4W5O A;  4IO9 L;  1WNS A;  4FZX C;  2R7Y A;  3O9U A;  1W97 L;  4FW1 A;  2IVP A;  4GV9 A;  4FYD A;  1XUP O;  5AQJ A;  4FM0 A;  4PQU A;  3TAF A;  4C23 A;  4FJL A;  4CCH A;  3OYF A;  2P9I A;  2VQF K;  4BRL A;  2FC0 A;  4OPJ A;  4CW7 B;  1ZC6 A;  4KTZ A;  4IOC L;  4A5A A;  5C15 A;  3RMB A;  3CJ9 A;  4IXC A;  1BCM A;  1JCF A;  2E6M A;  4DQP A;  1RT5 A;  3KLI A;  4CEB A;  2O4G A;  3AVC A;  4CZI A;  2HHU A;  4I6M B;  3OW2 M;  2IAJ A;  3L2Q A;  1NJX A;  1RT2 A;  4MDA A;  3VF2 A;  1QQM A;  3G71 N;  5CE3 A;  3QIP A;  5AQG A;  1C6V A;  2BAN A;  4JI2 K;  3HST B;  4BRA A;  2P9N B;  2E88 A;  4FO0 A;  5EVZ A;  3UKR B;  3C65 A;  1BA0 A;  4A62 A;  4E1N A;  3W3D A;  3OYI A;  2YV0 X;  3NVK A;  4E1M A;  4KHU A;  5FPN A;  3VA0 A;  3MK6 A;  3CQY A;  4OKK A;  4WYB A;  3TAB A;  2VWJ A;  1VQ6 N;  4RW7 A;  2Q31 A;  3H08 A;  1D9D A;  1BI4 A;  3KLH A;  4FWO A;  4B1Y B;  1Z05 A;  3G4S N;  5CZ2 A;  3ULE A;  3CM6 A;  3VGM A;  1J54 A;  1TGO A;  3K9J A;  4B8A B;  3MX5 A;  4U7B A;  2G8H A;  3H1Q A;  4JI5 K;  2D0O A;  4WQ4 C;  1WLJ A;  3VEZ A;  4DTM A;  3THW A;  4LF5 K;  4Z94 A;  4DFP A;  1QQC A;  1X3N A;  4DSF A;  1QVF M;  4CFC A;  3G0Z A;  1S22 A;  1KXP A;  4JRQ A;  2I7N A;  4GKK K;  1W9H A;  2BUP A;  3WXJ A;  5AR0 A;  5AQW A;  5GIP A;  4BE2 A;  4DS4 A;  4H0P A;  1S1T A;  3V81 A;  4BR7 A;  1S1U A;  2GEM A;  3VEY A;  2Q97 A;  5SWM A;  1MA9 B;  1B9F A;  2NZT A;  3HM9 A;  2B5J A;  4FLW A;  3DYA A;  2A41 A;  2CGJ A;  4FLZ A;  5JS1 A;  4DTU A;  1YF5 L;  2ZJR L;  5ELZ A;  1NK5 A;  4GV6 A;  4CF2 A;  2UUB K;  1LW0 A;  2F9W A;  3ZX2 A;  2HB5 A;  4B9S A;  3F2K A;  3DM2 A;  3U4L A;  1Q82 O;  1RBT A;  2QWP A;  4BRG A;  4N47 A;  5BR9 A;  3FFK B;  3HRG A;  4KI4 A;  4JHD A;  1Q86 O;  4MLE A;  1J6Z A;  3MEE A;  3JXU A;  4O55 A;  4JD2 B;  4E7K A;  4N76 A;  4DU4 A;  4WQ4 A;  3V4I A;  4CZM A;  1HYS A;  3C6T A;  2FF3 B;  1LCU A;  3TAR A;  1RFQ A;  2IGI A;  3QB0 A;  1C0U A;  3UIQ A;  1JCG A;  4OX9 K;  4DLE A;  3MXI A;  2PFU A;  4FLY A;  3V6D A;  3FR0 A;  3IMX A;  4K41 A;  5BRE A;  1HNX K;  2KZM A;  3HM8 A;  3NF8 A;  3VQE A;  2HHV A;  3WEE B;  4B8C A;  3NH1 A;  1CZA N;  3ENB A;  3V9W A;  4L8R B;  3CCL N;  4JI3 K;  3LP3 A;  4DTX A;  3OYH A;  1OVY A;  1M1K O;  3LZI A;  2QI2 A;  1VQL N;  1MWM A;  1A5W A;  3KKR A;  3DJC A;  4FJX A;  2XRI A;  2D5R A;  1YJ9 N;  2A3Z A;  4FPB A;  4F2S A;  1N36 K;  4F3O A;  1FXX A;  4M3U A;  1B92 A;  4F3T A;  1QZ5 A;  4B1W B;  3ATU A;  1O13 A;  3V9U A;  5TKW A;  4DSL A;  4V19 S;  3S3N A;  1H1V A;  3HTV A;  2P9I B;  2G8I A;  1C0G A;  2GTD A;  4DR1 K;  3SUO A;  4CJT A;  4XEI A;  1WBB A;  1WSI A;  3THY A;  2P9U A;  1JXE A;  3MXJ A;  4CER A;  4KH6 A;  1D8Y A;  1NOZ A;  4IZ9 A;  4M3R A;  1FK9 A;  4ID5 A;  3K59 A;  3MN7 A;  4IKF A;  1TKZ A;  3MCP A;  3O3H A;  5I42 A;  2P1J A;  1I39 A;  1CXU A;  1RDA A;  4LD0 A;  4H5T A;  2O8D A;  4BDY A;  1VSM A;  4DV1 K;  1T6D A;  4WFA L;  3J8A A;  3ENO A;  5CZ1 A;  3SMP A;  1NJZ A;  3P39 A;  3IAY A;  2HHX A;  2LSN A;  1TK5 A;  2KHO A;  3O1W A;  2D1K A;  5T7B A;  5C2F A;  3AAP A;  2HOE A;  2Y1I A;  3SPZ A;  4K8Z A;  3CD6 N;  3NDK A;  3LM9 A;  4CED A;  2GBZ A;  3A5M C;  3O9Q A;  3PO5 A;  1Q18 A;  1TKT A;  3A5O C;  3CPE A;  1EP4 A;  4KI6 A;  2I5J A;  4G1Q A;  4BC3 A;  5KPZ A;  4YNQ A;  5C0Y A;  4OVL A;  4BQZ A;  3IDH A;  4DQR A;  5HRP A;  1N34 K;  3BF3 A;  5HLF A;  2NLX A;  4BR0 A;  2HHS A;  4NB4 A;  4KRE A;  5JLH A;  2WON A;  4ILG B;  5C24 A;  1BGX T;  1BI4 B;  4IOA L;  2AJQ A;  4MFB A;  4OGC A;  2E4L A;  1K73 O;  2F8T A;  4FL9 A;  4DTJ A;  1WBD A;  3ULE B;  5LJW A;  5BRF A;  3D2F A;  3EY1 A;  1X9J A;  4DR7 K;  5BPM A;  3TAM A;  2E6L A;  4Z4E A;  4CBX A;  5M1K A;  3LDP A;  4JKD A;  3L4Q A;  4KHQ A;  4XH1 A;  2WBN A;  3ZSR A;  3THW B;  2EWS A;  4AM7 A;  4YOY A;  4DV7 K;  1TAU A;  4ELT A;  1YTA A;  3BY5 A;  2ZJQ L;  3JS6 A;  3HOS A;  4RG8 A;  1OH5 A;  3NVM A;  3L4I A;  3TAN A;  2QXF A;  4GVE A;  2P9K B;  1X9S A;  3CCU N;  1RT1 A;  4A5B A;  2Y1J A;  4O0J A;  3SQ2 A;  4PHT X;  1HRH A;  1SL1 A;  1DTQ A;  3RR8 A;  3SJJ A;  3ZSX A;  4M7X A;  4DR6 K;  3CER A;  4YHH K;  3MX2 A;  3PO4 A;  2HHT A;  3QEV A;  4QS9 A;  4HVJ A;  2FSN A;  1YAG A;  5A2Q O;  4X65 K;  3QEI A;  4PKG A;  3MXM A;  3WNH A;  3VPZ A;  4FWM A;  1RBS A;  1K9M O;  3RRG A;  1KLN A;  3ZX0 A;  1VSI A;  4B3M K;  1ESV A;  3E1Y A;  4RW4 A;  4FJ5 A;  2D4W A;  1NK8 A;  4AHU A;  4JHD B;  4WF9 L;  2UU9 K;  4JI6 K;  1BQN A;  2FBX A;  4DTR A;  4IWV A;  1Q9X A;  2HHQ A;  3TI0 A;  1R59 O;  4YOX A;  3CCQ N;  4O8K A;  4CFD A;  2HBM A;  4NYF A;  3ZT0 A;  4UY8 O;  2O8B A;  3CCR N;  2P9P A;  1SUQ A;  1JL2 A;  4BWM A;  3MDQ A;  4X66 K;  3VEX A;  4KAZ A;  3ZSZ A;  4OKJ A;  4X64 K;  5J2Q A;  4ELV A;  2OAN A;  2JGU A;  3B6O A;  4JI0 K;  4DV4 K;  4IBN A;  1NJW A;  3BZK A;  3CME N;  4B1Z A;  1K8K A;  3SMS A;  3WT0 A;  1NGI A;  4GW6 A;  3U6F A;  5AZJ A;  2OTL N;  3CG7 A;  2A1S A;  3QDK A;  5HRO A;  4EAH D;  3LPT A;  3CC4 N;  3KK7 A;  4QCL A;  2YNG A;  3TTC A;  4RW6 A;  1TUU A;  3A5N C;  4KKO A;  3SUP A;  2PYJ A;  4Z4I A;  3A2F A;  5AFU A;  3E66 A;  3CMA N;  1I94 K;  2D0C A;  3VGK A;  3MN6 A;  3FZL A;  1HLU A;  1RT6 A;  4GY2 B;  4JKF A;  1DKG D;  2HMI A;  2YCH A;  4RW9 A;  1QSL A;  1YUW A;  4DSJ A;  5AFU H;  4BDP A;  5AQX A;  3CQ8 A;  2ETJ A;  2QTD A;  3KJV A;  2F7T A;  4BRC A;  5HP1 A;  1QQO A;  4FJ9 A;  2CGL A;  3TAG A;  3CM5 A;  3VMF B;  3THY B;  1Z6R A;  2P9U B;  2F8S A;  4FJI A;  3AVH A;  2ZGY A;  3EE9 A;  3LL3 A;  1JLF A;  4KTW A;  3OS1 A;  1KTQ A;  4BRH A;  1OKJ A;  1C0F A;  3OJS A;  3LAN A;  3VQA A;  1D4X A;  4DWI A;  1SKR A;  3V1Q A;  3VGL A;  3D6R A;  3DXM A;  4W5T A;  3F9K A;  3ZSQ A;  2O8D B;  1WB9 A;  1HNZ K;  4DG1 A;  3VTH A;  3SK3 A;  1OH7 A;  4I9L A;  2ZGZ A;  1IG8 A;  2VWK A;  3VES A;  4FLV A;  4CBU A;  1GLB G;  1WAJ A;  4CHZ A;  4DR5 K;  5M1Q A;  4NCA A;  4JAX A;  1K8A O;  2QWQ A;  4MLH A;  1RTD A;  1KAX A;  1MU2 A;  4IDK A;  3CXC M;  1ZBL A;  1NK0 A;  3PSI A;  5FRO A;  3O08 A;  3DRS A;  4OJR A;  4YDU C;  3T19 A;  3EKS A;  3QEW A;  4H0Y B;  4DFK A;  1IH7 A;  1XNR K;  2HF4 A;  1VQP N;  2D0P A;  5KRT A;  3PX0 A;  1N32 K;  3CIP A;  4DV0 K;  1IO2 A;  3ZSW A;  3PX6 A;  3O8M A;  3WUH A;  5KQ8 A;  4KHW A;  3VET A;  3NAE A;  4FWR A;  4CHY A;  2X74 A;  1JLQ A;  3SBT A;  1NJY A;  4XIU A;  1HJO A;  1S1X A;  3D2F B;  5CHI A;  3I0R A;  4FJG A;  4AHT A;  1UA1 A;  3S3M A;  1VQO N;  4R79 A;  5FPE A;  1R0A A;  1S6Q A;  4CHN A;  2QA4 N;  3I0S A;  4H4M A;  3VQQ A;  3KWG A;  3QER A;  4B08 A;  3F9M A;  3K58 A;  4CJ7 A;  3QBW A;  2NRW A;  3ZT1 A;  3AVL A;  4GVM A;  4EFH A;  3O5B A;  1EX4 A;  3M8S A;  2YKM A;  3OTO K;  4CJW A;  4H0T B;  1BIZ A;  1W0H A;  3I8B A;  5HRR A;  3SYZ A;  1MWK A;  3LWL A;  4FPA A;  4C1N I;  4AH9 A;  4NO7 A;  3RVC A;  3ZX3 A;  4OO1 J;  2O8F A;  2W42 A;  1T03 A;  4KH4 A;  1GOB A;  3EE8 A;  2Q0R A;  5J2N A;  4O8U A;  1TKX A;  4ISG A;  5KPR A;  1NGD A;  4KB1 A;  3TSQ A;  3TSU A;  4H0O A;  2NRV A;  4EHT A;  4I2P A;  4M3W A;  3V9X A;  2ZD1 A;  2P9L A;  2V52 B;  4NCG A;  3G10 A;  5AQI A;  1GOC A;  5J2P A;  2ZJP L;  1KC8 O;  5D3G A;  1L3U A;  4HUF A;  3QBX A;  1YHQ N;  5HRS A;  1NK9 A;  1LV5 A;  1L5U A;  3OYC A;  2V7Z A;  1BA1 A;  4LSL A;  3J80 O;  3BDP A;  4M42 A;  3AVF A;  5AQM A;  1BHL A;  4FWS A;  1SAZ A;  4IG0 A;  3OHR A;  2QM1 A;  1E4G T;  4B9L A;  2O8B B;  3OY9 A;  4C8L A;  2P9P B;  4M7Y A;  4KO0 A;  4OGE A;  1Q9Y A;  2UXC K;  1LW2 A;  1CZ9 A;  2E2P A;  3SLC A;  5KI6 A;  1RTI A;  2HNY A;  1W7A A;  4O0I A;  1HMV A;  1K8K B;  4Q0B A;  1G99 A;  1KVA A;  5AZJ B;  1NKE A;  1SL2 A;  4JKA A;  4E89 A;  3O9R A;  5HL7 L;  2VWB A;  2Q3S A;  3DLE A;  4B3O A;  5GAG P;  3VQB A;  3QO9 A;  1IJJ A;  1GLF O;  1BWF O;  5CYM A;  5F1X A;  4Z4F A;  4JI1 K;  1HQE A;  4E7I A;  3I33 A;  3I55 N;  2VG5 A;  1VQ8 N;  2OTJ N;  4FJH A;  1YI2 N;  1YT3 A;  3VQD A;  1NWK A;  1VQN N;  1JLE A;  2PZS A;  5I9E B;  1KFS A;  3HYF A;  4CGI A;  1KSP A;  4NCB A;  3N4Q A;  4CHQ A;  1U04 A;  3LDS A;  1NMD A;  4CES A;  4OKE A;  3VOV A;  4FW2 A;  2BH1 A;  4DUY K;  4PL7 A;  3HZ6 A;  1TV6 A;  4CJP A;  5E84 A;  2XO7 A;  3DLL L;  4YY3 K;  4PKH A;  1N5Y A;  1T8E A;  3J7A P;  1C0M A;  3L6Q A;  3NGY A;  4HCC A;  4LC9 B;  4AM6 A;  4MO4 A;  3C6A A;  1XC9 A;  4FM2 A;  3DXM B;  2KFZ A;  4KV8 A;  1K6Y A;  4FK0 A;  4E0D A;  3VQ6 A;  2AP1 A;  4KHP K;  2E2N A;  3K57 A;  3CC2 N;  2ATQ A;  5ADX A;  3RWU A;  5GAH P;  3TWH A;  3VQ8 A;  1NGA A;  3TTD A;  1U4B A;  3KD1 E;  2HVH A;  3H46 O;  1L3T A;  4IFE A;  1BIU A;  1RT3 A;  4AF1 A;  4DFM A;  2Z1J A;  3I56 N;  2XY6 A;  4FVU A;  4CK1 A;  4LFB K;  2WOM A;  5ADX H;  4JNE A;  4A61 A;  4RW8 A;  3VQ4 A;  3OYK A;  4Z4C A;  1VQ4 N;  3P4I A;  3HVR A;  2A40 A;  4O5F A;  2JLE A;  1YXQ A;  4FWQ A;  2P9K A;  5MLC Q;  3OYB A;  3EYZ A;  4JYA K;  1NGC A;  2A42 A;  3L2U A;  3IUC A;  3FZM A;  4PL8 A;  4ISF A;  1T7P A;  1RT7 A;  2NNW A;  3K5M A;  4CE9 A;  4JS5 A;  4E7J A;  3CJ1 A;  4K0K K;  2BDP A;  1VSK A;  4A2B A;  4CD3 A;  3UB5 A;  4ZTF A;  1V4T A;  1EQY A;  4BG9 A;  3PX4 A;  3LAM A;  2QXL A;  5TKY A;  2RN2 A;  2O8E A;  4OPH A;  3L2W A;  2CH6 A;  4ILH A;  3E01 A;  4CK3 A;  2ASO A;  5M1P A;  2OZM A;  2Z1H A;  4DQS A;  4CD1 A;  1E4F T;  3NH0 A;  1KVB A;  3VTI A;  2QWL A;  3DMJ A;  3V1R A;  5KQD A;  1WOQ A;  2V7Y A;  1SKS A;  3O9S A;  4KHY A;  5KTQ A;  4EIA A;  3J7Y P;  3DLH A;  1ZBI A;  3R1X A;  2O8F B;  2QWN A;  4CZG A;  2E20 A;  1WAF A;  4B9U A;  1SS6 A;  5F2R A;  4HUE A;  3WQU A;  3THV A;  2XHB A;  3L2V A;  1ZYQ A;  3QML A;  2P9L B;  2ITG A;  1BUP A;  4UQG A;  4RWT A;  2E2O A;  3CJA A;  3T3F A;  4ISE A;  3L8B A;  2F96 A;  5LMN K;  3K0S A;  3VA3 A;  4EZ6 A;  4BR5 A;  1G15 A;  3O4W A;  3CCM N;  3QET A;  4C1N K;  1ZBF A;  2YNI A;  3H6E A;  3NF7 A;  5IWA K;  4FM1 A;  4C8M A;  1HKC A;  4GNI A;  4DQQ A;  1U49 A;  1KFD A;  3OYA A;  4BDZ A;  2VGM A;  3MAQ A;  3O4Q A;  5FPD A;  1KD1 O;  3OYL A;  1VQ7 N;  2OZS A;  4J2B A;  1S6P A;  1NGB A;  4DMN A;  3M3Z A;  4CEQ A;  4DR2 K;  3NH2 A;  4BRN A;  1GLD G;  4AHC A;  4BRM A;  3S3O A;  1EWQ A;  2KLA A;  1BU6 O;  3ZCM A;  2J4R A;  1IKV A;  4DV3 K;  1QQN A;  2D0B A;  2Q2R A;  1XI1 A;  2W6K A;  4JI8 K;  3V1O A;  3SCX A;  1NKB A;  4CZL A;  3FLC O;  1BCO A;  1EXQ A;  4WQ5 C;  1JKH A;  2QW9 A;  4RCH A;  2Q36 A;  1NGH A;  3VEO A;  4A2A A;  3KD5 E;  4QOZ B;  3HPO A;  2ZM6 K;  3AVB A;  3OYD A;  3BUZ B;  2FLO A;  5LL6 Z;  2VCP A;  1TUY A;  4AIL C;  2E2Q A;  5AQP A;  3BGR A;  2E8A A;  4Z4H A;  3K9K A;  5H1S Q;  5HBM A;  1VQ5 N;  4CFA A;  3ALY A;  4KH5 A;  5JIC A;  2E5L K;  1X1P A;  1XHX A;  3AO2 A;  1ZBS A;  5C2D A;  4WFB L;  2OYQ A;  4JI7 K;  3CYM A;  4J8F A;  1ATS A;  4FLX A;  5AQV A;  3CFO A;  1BIS A;  3NF9 A;  4IO8 A;  1QS4 A;  2VYP A;  3AAR A;  1M90 O;  3KKS A;  5JVH L;  3D45 A;  3THX A;  4YOV A;  1NMN A;  3U9Z A;  5M1F A;  5AZI A;  3ITH A;  5E26 A;  3C94 A;  1IBL K;  3WQT A;  1NU0 A;  3ATV A;  3O3G A;  4DU1 A;  3AGR A;  1QHT A;  3TU5 A;  1IKY A;  3CQX A;  4K25 A;  1QTM A;  4CEZ A;  4WQ5 A;  4N56 A;  1VRT A;  3NGZ A;  1FKO A;  1RCH A;  3DAW A;  4QAG A;  4CF1 A;  4AHV A;  4CJU A;  3CHW A;  1GLL O;  2D0A A;  4N41 A;  3HPG A;  4BQL A;  4HCB A;  3LDQ A;  1GLJ O;  1KCF A;  3EKU A;  5M1N A;  1Z26 A;  2YHA A;  3VF4 A;  2Z1I A;  3GE1 A;  4B1X B;  2OPS A;  3HXM A;  1S3X A;  3VN5 A;  3SV4 A;  3SQ0 A;  1UAX A;  3TAQ A;  2O8C A;  5B8H A;  2NRH A;  4JKB A;  4JKG A;  4ZTJ A;  3BF1 A;  4KHN A;  2O8E B;  3IG1 A;  4IFY A;  3SZ2 A;  4B3T K;  4H03 B;  3IRX A;  4IG3 A;  4M63 C;  1KRP A;  3HVT A;  3AGK A;  3JAM O;  3IKM A;  3NFA A;  4DTP A;  5EY4 A;  4WCE L;  1VQK N;  1IBM K;  1FKP A;  4CI6 A;  3PLA A;  2QK9 A;  4LH4 A;  4FOI A;  4BRK A;  2GUI A;  4JEP A;  2BE2 A;  4CF9 A;  4LH5 A;  1BQM A;  2VGN A;  4J2A A;  4H5V A;  3S9H A;  4DSK A;  3ISN C;  4G9Z A;  1S9E A;  3MN9 A;  3L2R A;  3HP9 A;  3DOK A;  4CEC A;  4DHY A;  2KZZ A;  2HVI A;  1JLC A;  1VSE A;  4BAC A;  1B9D A;  4CJ3 A;  2E1Y A;  4OLB A;  3TR8 A;  2B4J A;  2FXU A;  4BG8 A;  3OJU A;  4CGD A;  1V4S A;  1E3M A;  1P90 A;  1YTU A;  1LOT B;  4CZE A;  4BWJ A;  2ITM A;  1GLA G;  3AVI A;  4FJJ A;  4IEI A;  1T05 A;  3DLR A;  1SV5 A;  4C8N A;  2YNF A;  1DLO A;  3RRH A;  1NLV A;  2GX9 A;  5F0X A;  2GUP A;  4F4K A;  3LWM A;  3O6W A;  3O9T A;  3CCS N;  2ZF5 O;  3C7N A;  1XHZ A;  1N33 K;  2KW4 A;  3B6P A;  3MN5 A;  4CHO A;  3D0P A;  5C42 A;  1NGE A;  1IV0 A;  3DLG A;  2OPP A;  4BRE A;  4E1J A;  2NUB A;  1NBW A;  3KZB A;  3Q7C A;  4PUO A;  3N4P A;  3C0B A;  1N8R O;  1Z25 A;  1RGI A;  2UUC K;  3HL8 A;  4CIG A;  5AQK A;  2RE2 A;  3FFI A;  3LAL A;  3PY8 A;  5AQS A;  2ASP A;  2YI1 A;  1RNH A;  1ASV A;  2IOC A;  1SZ2 A;  4CJ4 A;  4JK8 A;  1RDW X;  3OYG A;  3FZH A;  4CGF A;  3ASM A;  3K5O A;  3AA3 A;  3FGU A;  4GKJ K;  2G8V A;  1J5E K;  5HOO A;  3HOT A;  4FWN A;  4LF6 K;  2YHB A;  2W6L A;  1ILY A;  4DUZ K;  3TTF A;  1VSF A;  1JLB A;  2HMP A;  5IT9 O;  4YFU A;  4FSV A;  3I8D A;  3SPY A;  3FE1 A;  5JVG L;  2B6A A;  4EP5 A;  1NJI O;  4LSN A;  5SZT A;  3CFP A;  3QES A;  4EHU A;  1HNW K;  1DEJ A;  3M8P A;  3THX B;  3DI6 A;  4Y1C A;  4IFV A;  1JLG A;  1A5V A;  5AZI B;  3HJF A;  3HT3 A;  3ENH A;  1J9A A;  1TYQ A;  1IBK K;  3LDO A;  1NGG A;  1HYZ A;  2IVN A;  3OS2 A;  3H45 C;  3DRP A;  2HF3 A;  4FZY A;  3CET A;  2P9S A;  2OPQ A;  1QZ6 A;  1VSJ A;  3A5L C;  4K43 A;  4CIF A;  3TAP A;  2NRR A;  1XQS C;  4F2R A;  1OH8 A;  3KLE A;  4FJK A;  4BRD A;  3OS0 A;  4OLA A;  3K5L A;  1BG3 A;  1RIL A;  4M3X A;  5DM7 L;  3R6M A;  2ZE2 A;  1NK4 A;  2YKN A;  1JLA A;  3BP8 A;  3SAH A;  2O8C B;  1WSF A;  5LJV A;  3J7Z O;  1D5A A;  1RT4 A;  3ID8 A;  4JKG B;  5EXW A;  4FLU A;  2JWL A;  4KPY A;  2QKK A;  3D2E A;  4FWK A;  4DTO A;  3SUQ A;  5BN8 A;  3ZLJ A;  2GEL A;  1ATN A;  1ASU A;  3IS9 A;  3RMC A;  5BRD A;  1U45 A;  3CC7 N;  3LPU A;  4JKC A;  2Z1G A;  3NMU A;  3PUF A;  4DF8 A;  3LP1 A;  3U3Y A;  3RSE A;  3AO5 A;  5EX5 A;  2X78 A;  4FWL A;  3ZSO A;  1J53 A;  1GOA A;  1S1W A;  4BR9 A;  4BR2 A;  4DV6 K;  4LFC K;  1BO5 O;  1RDU A;  1RBR A;  1VSD A;  3F5T A;  1T6C A;  3CPW M;  3GBT A;  4I2Q A;  4XH4 A;  2W41 A;  4JRP A;  4HTL A;  4BVP A;  2WFB A;  1SKW A;  1LWC A;  3ZT2 A;  1VQM N;  5GIO A;  2QWM A;  5FPM A;  3ULD A;  3L0Q A;  1C1A A;  4LF7 K;  1IKW A;  4QS7 A;  4PKI A;  2OPR A;  1VK0 A;  2PAV A;  2WTU A;  5AQQ A;  4ICL A;  2WC9 A;  4TSX A;  3VQP A;  3R8E A;  1W2B M;  3WXL A;  4K42 A;  2P5O A;  2V51 B;  2VG7 A;  1NGF A;  3C7N B;  2YHX A;  4NLB A;  3G25 A;  1T44 A;  2IS3 A;  4JN4 A;  4DCH A;  3ZET A;  1HX1 A;  4H5W A;  5LY3 A;  3MED A;  1TKD A;  3KIO A;  2VG6 A;  1P8Z A;  3NF6 A;  2FF6 A;  1HNI A;  4WE1 A;  3U3G A;  1NG9 A;  3EO3 A;  3FZK A;  4E7H A;  4YOU A;  1KAY A;  4AHR A;  4BGA A;  1XWL A;  3O4N A;  2BTF A;  4HTU A;  1LAV A;  4I9Q A;  4R5P A;  3AA5 X;  4LY7 A;  4CEA A;  4CFB A;  4CGH A;  2XY7 A;  3DLK A;  4DQI A;  4W5R A;  4GV3 A;  2P51 A;  1U47 A;  3PV8 A;  4RTF D;  3T1Y K;  2Q1N A;  2X6N A;  5FLX O;  4DKW A;  3CJC A;  3V9Z A;  4DS5 A;  4EP4 A;  4H4O A;  3Q7B A;  2X6S A;  3NGI A;  5FRN A;  5C12 A;  3O3F A;  2I7P A;  3RTV A;  4E3S A;  3KK2 A;  3G6E N;  3QNO A;  1RDB A;  3OVN A;  3AV9 A;  3KK3 A;  3NBP A;  4CGG A;  4A57 A;  3RMD A;  3M1F A;  3C95 A;  3C6H A;  3E9P A;  4C8O A;  1NOY A;  1ASW A;  1HPM A;  1TK0 A;  3KTQ A;  2FBY A;  3V9S A;  1SL0 A;  5DMR A;  1JL1 A;  3CCV N;  3BZC A;  4IOX A;  4Z4G A;  3O80 A;  4GMJ B;  4YOW A;  3LP0 A;  5EOY A;  4U67 L;  4DR3 K;  3UKU A;  3P31 A;  5BR8 K;  1U2V A;  1IKX A;  4CEE A;  2G8K A;  3JSM A;  4M3Z A;  1UWB A;  1TYQ B;  4B1U B;  4W5N A;  1Y97 A;  3QIO A;  1OVQ A;  3WNG A;  2NRZ A;  3JYT A;  3L3V A;  4IJA A;  4WFN L;  3QNN A;  2P9S B;  2UUA K;  3SQ1 A;  4KB0 A;  3VER A;  4MQ3 A;  3M8R A;  2RKI A;  4Y1D A;  1U48 A;  2KQ2 A;  4B3R K;  2EHG A;  1S9G A;  3PIP L;  1WSJ A;  3B8A X;  3LAK A;  1XC3 A;  4M45 A;  4FCY A;  3AA4 A;  1OH6 A;  4JLH A;  4HUG A;  1C0T A;  2GWJ A;  3H3N O;  1KVC A;  2O4I A;  4L3Q A;  3CF5 L;  4JK7 A;  1DGK N;  3OA9 A;  3PSF A;  2YJF A;  4BRQ A;  3OYJ A;  2FSJ A;  4NXM K;  1UOC A;  1WSE A;  2YNH A;  3ID6 A;  4CEF A;  3T69 A;  3D2E B;  1HKB A;  5AQN A;  2DFE A;  3OBY A;  3L3U A;  1N6Q A;  1C1C A;  4CBW A;  3MEC A;  5I3U A;  3R9P A;  3AVA A;  4PWD A;  4ELU A;  4YOR A;  3ZEU A;  1HR0 K;  3HI0 A;  3WXK A;  4DB3 A;  1HUX A;  4B9N A;  1TL3 A;  3RSE B;  4CF8 A;  4BRI A;  1HYV A;  4CJK A;  3MWP A;  4Y0W A;  5CR4 A;  4DF4 A;  1Q7Y O;  1QHA A;  1GLC G;  2IVO A;  2KFN A;  2HW3 A;  2DFH A;  1TVR A;  2YHW A;  4KFB A;  3A8Y A;  1ZBH A;  5E41 A;  1JCE A;  5FDL A;  4W5Q A;  3H3O B;  4E7L A;  1YJN N;  4H0V B;  3H1V X;  1MDU B;  1VSL A;  3A0I X;  1YVN A;  3S41 A;  4BC4 A;  3SJH A;  4FZZ A;  1Y64 A;  2CGK A;  4XH5 A;  5HRN A;  4MO5 A;  3AAQ A;  3OYE A;  4BE1 A;  1WSH A;  4K8X A;  1D9F A;  1LWE A;  1REV A;  4ILJ A;  4CJQ A;  1QVG M;  3P38 A;  5AJ3 K;  3AVK A;  3K2P A;  4B9M A;  3KHY A;  4H5R A;  4CIE A;  3E9O A;  1C1B A;  3UE5 A;  5AQT A;  4CJL A;  3VQ7 A;  3ZET B;  4CVN E;  4JV5 K;  4CZJ A;  3TAE A;  3VF6 A;  4DTS A;  4FK4 A;  5EU7 A;  1DTT A;  1X9M A;  2DY4 A;  4CJR A;  4JS4 A;  1QE1 A;  2UXB K;  1NK6 A;  2G8U A;  4J2D A;  4DQ8 A;  2QEX N;  4HWI A;  3AA2 A;  4NYN A;  1S72 N;  3QFU A;  1NM1 A;  3ZSV A;  1QSS A;  3SAF A;  4A59 A;  1IG9 A;  4NLC A;  1VSH A;  3M5R A;  5C10 A; 
#chains in the Genus database with same CATH homology
 1S1T A;  3DLG A;  3V81 A;  2OPP A;  1RTJ A;  1S1U A;  4DSI A;  4N5S A;  1L3U A;  4HUF A;  3DOL A;  2NUB A;  4KHS A;  5SWM A;  5HRS A;  1B9F A;  3HPH A;  4Q5V A;  1NK9 A;  1LV5 A;  1L5U A;  3HM9 A;  3OYC A;  5JS2 A;  3SV3 A;  2B5J A;  4LSL A;  2XY5 A;  4FLW A;  3BDP A;  2RF2 A;  4M42 A;  4PUO A;  3DYA A;  3AVF A;  3AO3 A;  4FLZ A;  1BHL A;  4O44 A;  1A5X A;  5JS1 A;  4IG0 A;  4DTU A;  3OYN A;  1Z25 A;  3WNF A;  3HL8 A;  5K14 A;  4B9L A;  3OY9 A;  1NK5 A;  4CIG A;  4C8L A;  4CF2 A;  1LW0 A;  3P5J A;  3FFI A;  4KO0 A;  2HB5 A;  4AHS A;  4B9S A;  3LAL A;  4OGE A;  1Q9Y A;  3DM2 A;  3PY8 A;  1RNH A;  1ASV A;  1RBT A;  1LW2 A;  1CZ9 A;  2IOC A;  4CJ4 A;  5KI6 A;  4N47 A;  1RTI A;  2HNY A;  4KI4 A;  3OYG A;  4O0I A;  4FLT A;  4CGF A;  1HMV A;  3ASM A;  4Q0B A;  3K5O A;  3AA3 A;  3MEE A;  2DFF A;  1KVA A;  4CJF A;  1NKE A;  4O55 A;  1SL2 A;  4E89 A;  3DLB A;  4DFJ A;  4E7K A;  2G8V A;  4N76 A;  3AO1 A;  2Q3S A;  3DLE A;  4B3O A;  3VQB A;  4DU4 A;  3QO9 A;  3V4I A;  1HYS A;  3QIN A;  3C6T A;  2YHB A;  5CYM A;  3TAR A;  4Z4F A;  1VSF A;  1HQE A;  2IGI A;  1JLB A;  1HPZ A;  4E7I A;  1C0U A;  3UIQ A;  3WNE A;  2VG5 A;  4HHT A;  4DLE A;  3AO4 A;  1L3V A;  1RBV A;  3MXI A;  4YFU A;  4FJH A;  4FLY A;  3V6D A;  1YT3 A;  2KZM A;  1TL1 A;  3VQD A;  4O5B A;  5KRS A;  3NF8 A;  3VQE A;  3I8D A;  1JLE A;  2HHV A;  4B8C A;  3NH1 A;  2PZS A;  3V9W A;  4ID1 A;  1KFS A;  4L8R B;  3HYF A;  4BE0 A;  4CGI A;  3KLF A;  1KSP A;  4NCB A;  3LP3 A;  4CHQ A;  4DTX A;  3OYH A;  3SPY A;  1U04 A;  2B6A A;  3T1A A;  4CES A;  4EP5 A;  4OKE A;  3LDS A;  4FW2 A;  4LSN A;  5J1E A;  3LZI A;  1A5W A;  5SZT A;  3CFP A;  3QES A;  3KKR A;  4FJX A;  2FBT A;  3EZ5 A;  1TV6 A;  2XRI A;  3M8P A;  4CJP A;  3DI6 A;  4Y1C A;  4H8K A;  4CEO A;  2XO7 A;  2D5R A;  3ZSY A;  1N5Y A;  1T8E A;  1C0M A;  3NGY A;  1HQU A;  4CF0 A;  4F2S A;  4HCC A;  4IFV A;  1JLG A;  1A5V A;  3HJF A;  3K5N A;  4F3O A;  4FXD A;  3HT3 A;  1FXX A;  5DK5 A;  4M3U A;  1B92 A;  1J9A A;  4F3T A;  1HYZ A;  3OS2 A;  1J5O A;  3V9U A;  4FM2 A;  1XC9 A;  4DSL A;  3DRP A;  2KFZ A;  1RDC A;  3S3N A;  4KV8 A;  4FZY A;  1K6Y A;  2G8I A;  4FK0 A;  4E0D A;  3VQ5 A;  3VQ6 A;  3SUO A;  1KLM A;  2OPQ A;  4CK2 A;  1VSJ A;  4CJT A;  4CIF A;  3TAP A;  1WSI A;  3K57 A;  4C8K A;  4CJV A;  4F2R A;  1JXE A;  3AVN A;  3MXJ A;  2ATQ A;  4CER A;  3OYM A;  1LWF A;  3KLE A;  4DLG A;  3RWU A;  3TWH A;  1NOZ A;  4M3R A;  1D8Y A;  1FK9 A;  4ID5 A;  3VQ8 A;  1U4B A;  3KD1 E;  3K59 A;  1LAW A;  1L3T A;  4FJK A;  3SNN A;  4J2E A;  2HVH A;  1BIU A;  1RT3 A;  4DFM A;  3LP2 A;  4FJM A;  2Z1J A;  4IKF A;  1TKZ A;  1O1W A;  2HNZ A;  2XY6 A;  4FK2 A;  3OS0 A;  4CK1 A;  4OLA A;  2WOM A;  1CXQ A;  3K5L A;  4DTN A;  3O3H A;  4RW8 A;  5I42 A;  1RIL A;  3VQ4 A;  2P1J A;  4M3X A;  3OYK A;  3MEG A;  1I39 A;  1CXU A;  1RDA A;  2ZE2 A;  4LD0 A;  1BL3 A;  1NK4 A;  4Z4C A;  2YKN A;  1JLA A;  4BDY A;  1VSM A;  1TK8 A;  4B9T A;  1WSF A;  1TAU A;  1D5A A;  1I3A A;  3HVR A;  1RT4 A;  2JLE A;  4FLU A;  5CZ1 A;  1NJZ A;  4KPY A;  3IAY A;  2HHX A;  2LSN A;  1TK5 A;  2QKK A;  3SQ4 A;  1NK7 A;  5T7B A;  3OYB A;  4DTO A;  3EYZ A;  3SUQ A;  3L2U A;  4K8Z A;  2Y1I A;  3SPZ A;  2PYL A;  3ZT3 A;  3NDK A;  1ASU A;  2GBZ A;  4CED A;  3IS9 A;  3RMC A;  1U45 A;  3LPU A;  3PO5 A;  1T7P A;  1RT7 A;  1TKT A;  3NHG A;  1EP4 A;  2Z1G A;  2I5J A;  3VQ9 A;  4CE9 A;  3K5M A;  4JS5 A;  4E7J A;  4G1Q A;  4KI6 A;  2BDP A;  1VSK A;  3PUF A;  1ITG A;  3VQC A;  2KTQ A;  4ZTF A;  4OPK A;  4YNQ A;  4DF8 A;  3LP1 A;  4OVL A;  3U3Y A;  3LAM A;  3PX4 A;  4B9V A;  3AO5 A;  2QKB A;  2RN2 A;  4DQR A;  2X78 A;  4M41 A;  3L2W A;  3ZSO A;  1J53 A;  1GOA A;  1YVU A;  5HRP A;  3QEX A;  1S1W A;  5HLF A;  2HHS A;  4CK3 A;  2FBV A;  3E01 A;  4KRE A;  2WON A;  2OZM A;  2Z1H A;  4E19 A;  5C24 A;  1BGX T;  4DQS A;  3RMA A;  1BI4 B;  2AJQ A;  4MFB A;  1RBR A;  1VSD A;  4OGC A;  2E4L A;  1QSY A;  2F8T A;  4DSE A;  3M8Q A;  3NH0 A;  2BGG A;  4DTJ A;  3AVG A;  1KVB A;  1Q8I A;  4I2Q A;  3LZJ A;  4JRP A;  3EY1 A;  3DMJ A;  4FJN A;  1SKW A;  3AVJ A;  2P5G A;  1LWC A;  3V1R A;  1TAQ A;  3ZT2 A;  1RDD A;  3TAM A;  3HP6 A;  2E6L A;  5KTQ A;  1SKS A;  2G8F A;  4KHY A;  4Z4E A;  2DTU A;  3SI6 A;  3DLH A;  4KHQ A;  3ULD A;  2PY5 A;  1ZBI A;  1C1A A;  1IKW A;  3ZSR A;  4M3Y A;  3SUN A;  1WAF A;  4B9U A;  2OPR A;  5KGX A;  1S1V A;  5C25 A;  1VK0 A;  3AVM A;  4HUE A;  1RTH A;  4ICL A;  1WN7 A;  1YTA A;  4DU3 A;  3THV A;  4ELT A;  4EZ9 A;  4TSX A;  2XHB A;  3VQP A;  3L2V A;  4PA1 A;  2IDO A;  4RG8 A;  2RPI A;  2P5O A;  2HND A;  3TAN A;  2QXF A;  1X9S A;  3F73 A;  1RT1 A;  2VG7 A;  2Y1J A;  1RBU A;  4O0J A;  1ZYQ A;  4CJE A;  4I7F A;  3SQ2 A;  2ITG A;  2IS3 A;  4UQG A;  3T3F A;  1HRH A;  1SL1 A;  1DTQ A;  3C6U A;  3MED A;  1TKD A;  3L8B A;  4CGJ A;  2F96 A;  3RR8 A;  3KIO A;  2EX3 A;  3SJJ A;  2VG6 A;  3ZSX A;  3VA3 A;  4EZ6 A;  5CY4 A;  1UA0 A;  1G15 A;  3NF6 A;  3QLH A;  3PO4 A;  1HNI A;  2HHT A;  4WE1 A;  3U3G A;  3QET A;  3QEV A;  1ZBF A;  3CFR A;  2YNI A;  4HVJ A;  3NF7 A;  4E7H A;  4FM1 A;  4PY5 A;  4C8M A;  4AHR A;  3QEI A;  4FJ8 A;  3MXM A;  1XWL A;  3O4N A;  4DQQ A;  1U49 A;  3WNH A;  1CLQ A;  1KFD A;  4HTU A;  1LAV A;  1RBS A;  4Z0U A;  3OYA A;  4I9Q A;  2ZQB A;  4R5P A;  3AA5 X;  4LY7 A;  4CEA A;  4BDZ A;  4CFB A;  1KLN A;  4CGH A;  3RRG A;  2XY7 A;  1EKE A;  3MAQ A;  3O4Q A;  3DLK A;  3OYL A;  2OZS A;  4DQI A;  4CJ5 A;  4W5R A;  3KK1 A;  1VSI A;  4J2B A;  1S6P A;  2P51 A;  1U47 A;  4DMN A;  4CEQ A;  3PV8 A;  3NH2 A;  4RW4 A;  4FJ5 A;  3HK2 A;  4AHC A;  3DRR A;  4AHU A;  1NK8 A;  2X6N A;  3NCI A;  3RR7 A;  3V9Z A;  1BQN A;  2FBX A;  3ZT4 A;  4DS5 A;  4EP4 A;  4H4O A;  4DTR A;  3S3O A;  4FJ7 A;  2X6S A;  1F21 A;  1Q9X A;  3ZCM A;  3NGI A;  2HHQ A;  3TI0 A;  1WSG A;  1IKV A;  1X9W A;  5FRN A;  4CFD A;  1HJR A;  3O3F A;  3RTV A;  2D0B A;  4NYF A;  3KK2 A;  4E3S A;  3QNO A;  1XI1 A;  1RDB A;  3OVN A;  3AV9 A;  3V1O A;  3ZT0 A;  3SCX A;  1NKB A;  3NE6 A;  1SUQ A;  1JL2 A;  4BWM A;  3KK3 A;  1BCO A;  3NBP A;  1VRU A;  4CGG A;  3ZSZ A;  3RMD A;  1EXQ A;  4KAZ A;  3HO1 A;  4OKJ A;  5J2Q A;  5CYQ A;  1JKH A;  4ELV A;  2JGU A;  3B6O A;  4M3T A;  3QEP A;  3C95 A;  1EET A;  1NJW A;  4IBN A;  3KD5 E;  4QOZ B;  3HPO A;  4C8O A;  1NOY A;  1ASW A;  2HHW A;  3KTQ A;  1TK0 A;  3AVB A;  3OYD A;  4GW6 A;  2IC3 A;  3U6F A;  2FBY A;  4CHP A;  3V9S A;  1SL0 A;  4ZHR A;  3CG7 A;  2A1S A;  2XY8 A;  5DMR A;  1JL1 A;  5HRO A;  4AIL C;  3LPT A;  4QCL A;  2YNG A;  3BGR A;  4Z4H A;  2G8W A;  4F8R A;  4KRF A;  3P1G A;  4Z4G A;  1L3S A;  4GMJ B;  5HBM A;  4RW6 A;  3LP0 A;  1NKC A;  4CFA A;  3ALY A;  4KKO A;  3SUP A;  2PYJ A;  1CZB A;  1X1P A;  1ZBU A;  4Z4I A;  1IKX A;  3A2F A;  1XHX A;  3AO2 A;  4CEE A;  4KTQ A;  2G8K A;  2OYQ A;  2D0C A;  3JSM A;  1UWB A;  4M3Z A;  4CJS A;  3CYM A;  4FLX A;  4W5N A;  1RT6 A;  3CFO A;  1Y97 A;  5FRM A;  1HNV A;  1BIS A;  3NF9 A;  3QIO A;  4FVM A;  2HMI A;  2GV9 A;  1S5J A;  4RW9 A;  1QS4 A;  3WNG A;  1JXB A;  1QSL A;  4DSJ A;  3JYT A;  3L3V A;  4BDP A;  3CQ8 A;  3QNN A;  2ETJ A;  3KJV A;  5J2M A;  2A1R A;  3SQ1 A;  4KB0 A;  5HP1 A;  4O4G A;  4FJ9 A;  3KKS A;  4MQ3 A;  3TAG A;  3CM5 A;  3D45 A;  2OA8 A;  3P83 D;  3M8R A;  3KLG A;  2RKI A;  4Y1D A;  4FJI A;  2F8S A;  1U48 A;  2KQ2 A;  3AVH A;  2EHG A;  1S9G A;  5KGW A;  4W5O A;  1WSJ A;  3LAK A;  1WNS A;  4M45 A;  4FCY A;  3AA4 A;  4JLH A;  4HUG A;  4FZX C;  3ITH A;  2R7Y A;  3C94 A;  1JLF A;  4KTW A;  3OS1 A;  1C0T A;  1KTQ A;  3OJS A;  4DWI A;  1KVC A;  3LAN A;  4FW1 A;  3VQA A;  4FYD A;  2O4I A;  1SKR A;  3V1Q A;  4PQU A;  4FM0 A;  3TAF A;  3O3G A;  4DU1 A;  4FJL A;  1QHT A;  1IKY A;  3F9K A;  4W5T A;  3OYJ A;  3ZSQ A;  3OYF A;  4CCH A;  1QTM A;  4CEZ A;  4N56 A;  3NGZ A;  1VRT A;  1FKO A;  1RCH A;  2FC0 A;  1UOC A;  1WSE A;  4QAG A;  4OPJ A;  2YNH A;  4DG1 A;  4CF1 A;  4AHV A;  4KTZ A;  4CJU A;  4CEF A;  4I9L A;  2D0A A;  4N41 A;  3HPG A;  2VWK A;  4FLV A;  3RMB A;  4HCB A;  1WAJ A;  2DFE A;  4CHZ A;  3L3U A;  4NCA A;  1KCF A;  1N6Q A;  1BCM A;  1C1C A;  1Z26 A;  2YHA A;  2Z1I A;  5I3U A;  3MEC A;  2E6M A;  4DQP A;  1RTD A;  1RT5 A;  3KLI A;  3AVA A;  2OPS A;  4CEB A;  4PWD A;  2O4G A;  3AVC A;  4ELU A;  3HXM A;  2HHU A;  1MU2 A;  4IDK A;  2IAJ A;  3L2Q A;  3VN5 A;  1NJX A;  1ZBL A;  1RT2 A;  1NK0 A;  3SV4 A;  3SQ0 A;  1UAX A;  5FRO A;  3DRS A;  4OJR A;  3TAQ A;  4B9N A;  3T19 A;  1TL3 A;  4CF8 A;  3QEW A;  4ZTJ A;  4KHN A;  4DFK A;  1IH7 A;  3IG1 A;  1HYV A;  4IFY A;  3QIP A;  4CJK A;  3SZ2 A;  5KRT A;  4DF4 A;  3PX0 A;  1C6V A;  2BAN A;  3IRX A;  4IG3 A;  1KRP A;  2KFN A;  1IO2 A;  3HST B;  3HVT A;  3ZSW A;  3PX6 A;  2HW3 A;  2DFH A;  1TVR A;  4KFB A;  4KHW A;  3NFA A;  4DTP A;  3NAE A;  1ZBH A;  5E41 A;  5FDL A;  1FKP A;  4CHY A;  4W5Q A;  2X74 A;  4E1N A;  1JLQ A;  4E7L A;  1NJY A;  4XIU A;  3OYI A;  2QK9 A;  2YV0 X;  4LH4 A;  1S1X A;  4E1M A;  3I0R A;  2GUI A;  4KHU A;  4FJG A;  1VSL A;  2BE2 A;  4AHT A;  4CF9 A;  3VA0 A;  4OKK A;  1UA1 A;  4LH5 A;  1BQM A;  3S3M A;  4FZZ A;  1R0A A;  1S6Q A;  4J2A A;  3S9H A;  4DSK A;  3ISN C;  4CHN A;  5HRN A;  3TAB A;  2VWJ A;  1S9E A;  3I0S A;  4H4M A;  3OYE A;  3L2R A;  4BE1 A;  4RW7 A;  3VQQ A;  3HP9 A;  3DOK A;  1WSH A;  3QER A;  4CEC A;  4B08 A;  3H08 A;  1LWE A;  1D9F A;  1D9D A;  1BI4 A;  4K8X A;  2KZZ A;  2HVI A;  3KLH A;  1JLC A;  3K58 A;  1REV A;  1VSE A;  4BAC A;  4CJQ A;  3ZT1 A;  1B9D A;  4CJ3 A;  3AVL A;  4GVM A;  4OLB A;  5CZ2 A;  3TR8 A;  3CM6 A;  2B4J A;  3AVK A;  3K2P A;  1J54 A;  1EX4 A;  4B9M A;  3M8S A;  3OJU A;  2YKM A;  4CGD A;  4CIE A;  1TGO A;  1C1B A;  4B8A B;  4CJL A;  3VQ7 A;  4CJW A;  1BIZ A;  1W0H A;  5HRR A;  2G8H A;  1YTU A;  3SYZ A;  3TAE A;  3LWL A;  4DTS A;  4FK4 A;  4AH9 A;  4BWJ A;  5EU7 A;  1DTT A;  1WLJ A;  1X9M A;  4DTM A;  2W42 A;  2DY4 A;  3AVI A;  1T03 A;  4FJJ A;  4CJR A;  1GOB A;  1T05 A;  3DLR A;  4JS4 A;  1QE1 A;  5J2N A;  1NK6 A;  1SV5 A;  1TKX A;  4C8N A;  4DFP A;  2G8U A;  1QQC A;  2YNF A;  4J2D A;  1DLO A;  4KB1 A;  3RRH A;  4DSF A;  4F4K A;  3LWM A;  3AA2 A;  4NYN A;  4I2P A;  4CFC A;  3G0Z A;  4M3W A;  3V9X A;  3ZSV A;  1QSS A;  2ZD1 A;  4NCG A;  3G10 A;  1XHZ A;  4JRQ A;  1IG9 A;  1W9H A;  1GOC A;  5J2P A;  2KW4 A;  1VSH A;  3B6P A;  4CHO A;  3D0P A;  4BE2 A;  5C42 A;  4DS4 A;  5D3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...