2IDOA

Structure of the e. coli pol iii epsilon-hot proofreading complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
175
structure length
172
Chain Sequence
b'TRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSLHGALLDAQILAEVYLAMTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III epsilon subunit
publication title Structure of the Escherichia coli DNA polymerase III epsilon-HOT proofreading complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 59
structure length 172
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2idoA00
2HNDA 4DF4A 4YNQA 2XHBA 4ELVA 2FBTA 3ZSVA 3MAQA 3F9KA 3PX4A 2A1RA 4CJ3A 3OYKA 4PUOA 3G10A 3VQAA 2YNFA 1W9HA 4DMNA 4DFPA 1D8YA 1RBUA 4OPKA 1NKEA 4OGCA 3SUNA 4O44A 3SI6A 1Z25A 4HCBA 1NK0A 1S6PA 3NH2A 1HRHA 2G8KA 1HYZA 3RRGA 2BGGA 2VWKA 3OYDA 1R0AA 3MEEA 2ATQA 3S3MA 3KIOA 2DFFA 4YFUA 4B9VA 4CHZA 4KAZA 4HUFA 2XY7A 4FJJA 3DLGA 1TGOA 4J2EA 4NCAA 3WNEA 3KLHA 3DI6A 4DSLA 5CYMA 2XRIA 3M8PA 3SCXA 3IG1A 4CEDA 3QNNA 4B9TA 2G8VA 4KB0A 2DY4A 3KK1A 4L8RB 1RTHA 2B5JA 3OY9A 2Q3SA 1QSLA 1KVBA 3I0SA 3U3GA 4CCHA 4NCGA 1TKXA 3VA3A 4C8KA 5HRRA 2P1JA 2YNGA 3VQCA 3OYHA 4QAGA 4FW1A 4AHTA 3HP6A 1DTQA 1WAJA 2FC0A 3ISNC 4KHUA 1C1AA 4FZYA 3RR8A 5KGWA 3IAYA 2YV0X 4CJUA 3HXMA 4FJMA 1IKVA 1X1PA 4PWDA 1RBVA 4FYDA 3SUOA 1QE1A 1LAWA 2PYLA 4RW7A 2I5JA 3QO9A 4BE0A 1HJRA 4CGHA 4CF1A 1RNHA 1X9SA 3HJFA 4RW9A 1X9MA 1RT5A 4DU3A 4E7IA 1GOBA 3AO3A 1BCMA 1C1BA 1L3VA 1CLQA 2QXFA 4CEBA 1RT1A 5CYQA 3VN5A 4CECA 1T05A 4CIFA 4M3YA 1NK8A 4EZ9A 4CJQA 4F3OA 4FM0A 2F96A 2DTUA 2KTQA 3L2WA 3ZT4A 3WNGA 4FW2A 4HHTA 3SQ2A 4N76A 4AHCA 3QERA 3K59A 4PA1A 1BQMA 4E1NA 1TL3A 1FK9A 4E19A 1JL2A 3OS2A 3V9SA 4FJNA 4RG8A 3M8SA 4BE2A 4H4MA 4NCBA 2HVIA 3DLRA 1WSJA 1TK8A 4CJKA 3TAQA 4CFAA 4I7FA 4LD0A 4FK2A 1SKWA 1XWLA 3L3UA 3OYGA 1BL3A 5HBMA 4Q5VA 1JXEA 4M3RA 1N5YA 4DU4A 2EHGA 4LSNA 1ZYQA 4JRPA 1ZBLA 1DTTA 2AJQA 1NJYA 4Q0BA 3NF9A 4FK4A 4AHRA 1Y97A 3LP0A 3RRHA 3HL8A 4FJ9A 2HHWA 3K58A 3FFIA 4LSLA 4I9QA 3NBPA 3P83D 3OYFA 1U4BA 4CJWA 3VQ8A 4OPJA 4CEOA 2OZMA 3VQEA 4FLWA 3AVAA 3K5NA 5HRNA 3CQ8A 3M8RA 1A5XA 3SV3A 4EP5A 1BQNA 1WSEA 4W5OA 2XY8A 1TKZA 1VSEA 3DLEA 4O0IA 4I9LA 4KI4A 3ULDA 4DSKA 4IDKA 4F2SA 3LP3A 3VQ6A 1VSIA 3AVBA 1ASUA 4DTMA 1NKCA 5HP1A 2F8TA 3PUFA 3OYCA 4MQ3A 1XC9A 4CF9A 1CZ9A 3NGYA 4CESA 3OYEA 4KFBA 3QNOA 4J2BA 4FJXA 3CFRA 4CJLA 4BE1A 3TI0A 1Q8IA 1HMVA 2FBXA 1ASVA 1U04A 2RPIA 5EU7A 3OYAA 4QCLA 4UQGA 1WNSA 3K57A 3TAPA 3S3NA 4OLAA 4M3UA 2P51A 2F8SA 4G1QA 1HYSA 4CGGA 3NFAA 1QQCA 2GV9A 3C95A 3IRXA 3OJUA 4DWIA 1MU2A 1JLAA 1S1UA 1VSJA 4DTSA 3QLHA 4F4KA 4CK2A 1WN7A 4FJ8A 1QS4A 1VSLA 3V81A 1ITGA 1LW0A 3ZSZA 3AVCA 3AVIA 2HVHA 4IG0A 1SL1A 1KVCA 2PYJA 5J2QA 5D3GA 3AA3A 2YNIA 2OPRA 3ITHA 1RDCA 4M41A 1GOCA 2G8FA 1C6VA 4CEQA 3HP9A 3KLIA 3P1GA 1VRUA 5KRSA 4ID5A 1HQEA 1NOZA 2D0AA 3HPOA 3L2VA 2VWJA 2OYQA 2G8HA 5HRPA 3ZCMA 4TSXA 3SZ2A 4DTUA 3TANA 1C1CA 1HNVA 3C6TA 3B6PA 2DFHA 3WNFA 1EETA 5HROA 3DOLA 4FM2A 3ZSOA 4GW6A 1G15A 3O3FA 4CFBA 3O3HA 5CZ2A 4FLYA 4XIUA 3DLBA 3EY1A 4FCYA 4CJFA 5T7BA 2RKIA 1BIZA 1RT6A 2ETJA 4CEFA 3PX0A 3ZSYA 3AO4A 4GMJB 4DU1A 3U6FA 1FKPA 3AVNA 1IKXA 1UWBA 3ZT2A 3SQ0A 4OGEA 4JS4A 4DG1A 3JSMA 1X9WA 1RT7A 3NCIA 2X74A 4ID1A 3OJSA 3V9ZA 4BWMA 3PY8A 3MXIA 3D45A 2PZSA 3VQPA 1TKTA 4M3ZA 1CZBA 4N5SA 1I39A 3LAMA 1C0TA 3MXMA 2B6AA 3NF8A 4LH4A 4N56A 4Z4FA 2A1SA 4CEZA 2HHQA 3CFOA 1S9EA 1S6QA 3KKRA 1UAXA 2D0BA 4OVLA 4CERA 4CJ5A 1SV5A 2YKMA 1HYVA 4DSIA 4JS5A 3HT3A 2VG6A 4CK3A 3QEVA 3LZIA 1IH7A 1RCHA 5FRNA 4Z4GA 3OYIA 4DTPA 3NAEA 2FBYA 1BGXT 2IAJA 3K5OA 4KV8A 1KLNA 1QHTA 3SYZA 1WSGA 2D5RA 2X6NA 3V1OA 4FJ5A 1LV5A 3DM2A 4DQSA 1TAUA 4AHUA 4E0DA 1RT3A 1U45A 2R7YA 3CFPA 1SL0A 1WSFA 4NYNA 1J54A 1CXQA 2D0CA 1IO2A 3SJJA 4KB1A 4WE1A 3AV9A 2KQ2A 1REVA 4CHQA 4DLGA 4IFYA 3QEIA 4K8XA 3LWLA 4AHVA 1VSDA 4KHYA 1RT2A 5E41A 3SQ4A 4H4OA 4K8ZA 3A2FA 3LP1A 3V9XA 1S1WA 4DS4A 2Y1IA 1BCOA 1EXQA 4OKKA 3VQ4A 3BDPA 1WLJA 1YTAA 4CJSA 3OYMA 3NHGA 2HHTA 1EKEA 4CJPA 1JLGA 2O4GA 3SV4A 3AO5A 4CJVA 3D0PA 2E6MA 3IS9A 4ZHRA 2XY5A 4LY7A 3OYJA 4BDZA 2P5OA 1QTMA 4FK0A 3KKSA 1ZBUA 3H08A 4DFKA 1IG9A 2P5GA 5KRTA 3OVNA 4C8LA 4CEEA 3DMJA 4F3TA 1B92A 2YHAA 4KHQA 4B9SA 4DQQA 1T7PA 4E1MA 3LPTA 4HUGA 4FJIA 2JLEA 3V1RA 2HHUA 3AVLA 4MFBA 1WSHA 3HM9A 4FJGA 1ZBHA 1NK7A 1TK0A 3KK3A 2ZD1A 2IOCA 3TAGA 3ZSQA 4OKJA 3OYLA 3DOKA 3C94A 2E6LA 4DSFA 1D9DA 2HMIA 1KSPA 2G8WA 3THVA 3V9WA 4HCCA 3QESA 5DMRA 1JKHA 3O4QA 4M42A 4DTNA 4DSJA 2XO7A 4LH5A 4DFMA 1BI4B 3DLKA 1K6YA 1U49A 2VG5A 4DQIA 3NF7A 5J2MA 1KFSA 2X78A 1RT4A 4CF0A 5I42A 3JYTA 1RTJA 5K14A 1EP4A 1TKDA 4IFVA 1BHLA 1C0MA 1FXXA 1GOAA 4CGDA 3KJVA 3SUQA 4BACA 5KGXA 5SWMA 1NJWA 1KFDA 3CG7A 4RW4A 2GBZA 1N6QA 3QIOA 4M3XA 1NJXA 4R5PA 1TV6A 1L3SA 4OKEA 1RDBA 3TAMA 3KK2A 1XI1A 4F2RA 3I8DA 1QSSA 1TL1A 3ZT3A 2KW4A 4NYFA 1JLQA 1LW2A 2HB5A 4I2PA 3NGZA 4E3SA 1KRPA 2PY5A 4AILC 4BDPA 3E01A 4E89A 5C25A 1JLCA 4N41A 1VSKA 4CHOA 4RW6A 3NGIA 3WNHA 3HPGA 3QEPA 1SKSA 2OPSA 4CK1A 2BE2A 3VQQA 4HTUA 3DRSA 4E7HA 2W42A 1T03A 2KZZA 4Z4CA 2RN2A 3L2QA 4DTOA 3RMCA 2HHVA 1VSMA 4PQUA 2Z1GA 3AA4A 5CY4A 3PX6A 2QK9A 2EX3A 2IDOA 4FZXC 4CGIA 4DQPA 4W5QA 1B9FA 1I3AA 2B4JA 4FLVA 3ZSXA 2OZSA 4F8RA 3KLEA 4FVMA 3LWMA 1NK5A 2ITGA 3HSTB 3KLGA 1NJZA 3NH0A 1LWEA 1TVRA 4CJEA 4DTXA 1ZBFA 3MECA 4KPYA 3DRRA 5HLFA 4KI6A 3VA0A 3HVRA 2Z1HA 4CFDA 1HNIA 3LDSA 4J2AA 1C0UA 3VQ7A 5HRSA 4CHNA 3L8BA 3G0ZA 3NE6A 3AVFA 4BDYA 4E7LA 3PO5A 1NKBA 1LWCA 3AVMA 3VQDA 3ALYA 5J2PA 4GVMA 4C8MA 1KLMA 1JXBA 4B9NA 4ICLA 1UOCA 1S5JA 3LP2A 2IGIA 4Z0UA 1IKWA 1RBRA 3C6UA 3QIPA 4O4GA 3P5JA 4M45A 3K5MA 1NK4A 1Q9YA 4ELTA 4M3WA 2HHXA 4W5NA 2Z1JA 4KKOA 4CIGA 1JLEA 3SUPA 3L2RA 3QEWA 3LANA 2BDPA 2G8UA 3TWHA 1JL1A 1TAQA 4DFJA 3RMDA 4ZTJA 4AH9A 3SPZA 1VSFA 4FLTA 4CJ4A 1UA0A 4C8NA 2HW3A 4I2QA 4QOZB 3CYMA 4FLXA 1L3TA 4C8OA 1VK0A 2HNYA 3KD5E 1T8EA 3LAKA 2IC3A 3PV8A 3ZT1A 4ZTFA 1L3UA 3ASMA 4W5RA 3TAEA 1XHXA 4JLHA 1J53A 3NH1A 4B9LA 3O3GA 4FJ7A 4DF8A 4O0JA 3AO2A 4AHSA 5C42A 4FJKA 2QKKA 4KHSA 1BIUA 3KD1E 3HPHA 4FJLA 4IG3A 4H8KA 1W0HA 3AVGA 3KLFA 1J9AA 4CHPA 3RR7A 3KTQA 1S1XA 3HK2A 3TABA 1NK9A 2E4LA 2X6SA 4EZ6A 2WOMA 3LPUA 3VQBA 3DYAA 1F21A 3T19A 3L2UA 5I3UA 1J5OA 4OLBA 1A5VA 4CF2A 5FDLA 4B8AB 4ELUA 3UIQA 1JLBA 4FXDA 3K5LA 3OS1A 4CF8A 4CJRA 4DTRA 1S9GA 3V4IA 3NDKA 1Q9XA 3RWUA 2ZQBA 4M3TA 5J1EA 3QETA 4Y1DA 4KREA 1LAVA 1RTIA 1A5WA 3T1AA 3SQ1A 3DLHA 4FZZA 4KHWA 3MEDA 3AA2A 2OA8A 2VG7A 5CZ1A 1RILA 1EX4A 4Z4HA 4CHYA 1SKRA 1BI4A 1RDAA 2NUBA 3VQ5A 4CIEA 3ZSRA 2HNZA 3RMBA 4DSEA 2OPPA 2GUIA 2KFZA 3PO4A 1L5UA 5FROA 2XY6A 1SL2A 1NK6A 3OYBA 4DTJA 3BGRA 4BWJA 3HO1A 1KVAA 1WSIA 3T3FA 3S3OA 1YT3A 2QKBA 3VQ9A 3AVKA 3TAFA 4J2DA 1KTQA 3SNNA 5C24A 3S9HA 3RTVA 3TARA 1QSYA 4B9MA 4CFCA 3U3YA 4DQRA 2DFEA 4KHNA 4FLZA 1KCFA 2JGUA 3V9UA 4KTZA 1B9DA 1TK5A 2YHBA 4CE9A 1S1TA 4B8CA 2Z1IA 3QEXA 3L3VA 4JRQA 1D5AA 4KTWA 4Z4EA 3V1QA 3DRPA 1S1VA 2WONA 5JS2A 4EP4A 3M8QA 3NF6A 3LALA 4HVJA 4IBNA 2Y1JA 3OYNA 1LWFA 1HPZA 2KFNA 4DLEA 3ZSWA 1FKOA 1Z26A 4B3OA 3MXJA 3AA5X 2KZMA 4CGFA 4RW8A 1JLFA 3AVJA 3RMAA 1D9FA 2O4IA 1YVUA 3SPYA 2BANA 4KO0A 1DLOA 5SZTA 3F73A 4HUEA 4CGJA 4DS5A 1VRTA 4N47A 1XHZA 1RTDA 2G8IA 4OJRA 1RBSA 2RF2A 4KRFA 3AVHA 4FM1A 3MEGA 4FLUA 4E7KA 3ZT0A 4O5BA 4E7JA 2HHSA 5FRMA 3CM5A 3CM6A 3K2PA 2YKNA 3QINA 1ZBIA 3TR8A 1IKYA 4IKFA 1YTUA 1RBTA 4CJTA 3B6OA 1U48A 5DK5A 1U47A 4B9UA 2FBVA 2LSNA 3O4NA 3EZ5A 2IS3A 1RDDA 4O55A 1UA1A 5J2NA 5JS1A 1ASWA 3HVTA 3LZJA 3AO1A 4B08A 4Z4IA 4PY5A 2ZE2A 4CEAA 3OS0A 1VSHA 1CXUA 5KI6A 4KTQA 1WAFA 1BISA 4W5TA 1O1WA 2YNHA 4FJHA 3I0RA 1HQUA 1SUQA 3EYZA 3V6DA 1NOYA 5KTQA 3HYFA 2OPQA 4Y1CA
chains in the Genus database with same CATH superfamily
2XHBA 1GLAG 3GDQA 4H5WA 3ZSVA 2WTUA 4FSVA 3G6EN 2YNFA 4DFPA 1RBUA 3E66A 3KZBA 1NKEA 4OGCA 4B3SK 3SI6A 4M3YA 1NK0A 4H0VB 1HYZA 3RRGA 2BGGA 3S3MA 3KIOA 2DFFA 4YFUA 4LC9B 4A2AA 1YIJN 3MN6A 1Y64A 4KAZA 2XY7A 5AQUA 3WNEA 3VF4A 3KLHA 3M8PA 3QNNA 2G8VA 4L8RB 1RTHA 1BA1A 1QSLA 4FWMA 4CCHA 4NCGA 1TKXA 4BR0A 5HOOA 1NGJA 4FW1A 5AQKA 1DTQA 1HKBA 2QWMA 1OH6A 3ISNC 3CCRN 4CJUA 4FJMA 1RBVA 4FYDA 4CZLA 4JKBA 5BN9A 1U2VB 2PYLA 4RW7A 3QO9A 5AFUH 2F7TA 3DWLA 2Q0UA 1HJRA 4JKHA 3A8YA 3D7EO 4JKDA 3AO3A 4JKGA 1T05A 3VN5A 5EXWA 3K9KA 4CJQA 4FM0A 2F96A 2KTQA 3MN5A 4YOXA 1LCUA 4RCHA 1K8AO 1E3MA 4JV5K 2CGKA 1TL3A 3OS2A 4RG8A 3KWGA 3DLRA 1WSJA 5M1PA 3Q7BA 4CJKA 1TK8A 1QVFM 2O8FB 4I7FA 3HBTA 4M3RA 2UUCK 1ZYQA 1SZ2A 4JRPA 3THWA 1DTTA 1NJYA 3VPZA 2HHWA 3NBPA 2OZMA 3VQ8A 3AGRA 3CETA 3AVAA 3CD6N 2O8EB 4YORA 4EP5A 1HLUA 1V4TA 3ZEUB 3WXLA 1TKZA 4O0IA 4I9LA 1VQON 3VQ6A 2WFBA 2F8TA 4JI3K 3OYCA 1IV0A 2VYPA 4NXMK 4RTFD 4EHUA 1Z05A 5E84A 1YHQN 3QNOA 3TI0A 1HR0K 1NBWA 3D2FA 5EU7A 3S3NA 4M3UA 1VQLN 1HYSA 3NFAA 2GV9A 3C95A 3C7NA 1MU2A 1JLAA 4DR2K 4DTSA 3QLHA 2ZJRL 3KVGA 4CK2A 4H0PA 3V81A 1BU6O 4MDBA 3ZSZA 3WUHA 1Q86O 3PIOL 3AVIA 1KVCA 3AA3A 2OPRA 4M41A 1GOCA 3CCJN 3ATVA 1VRUA 4B1UB 1NOZA 2OYQA 3M5RA 5HRPA 3ZCMA 4PL8A 4WF9L 3VGMA 4ILJA 3C6TA 1VAZA 4B1XB 3LM2A 3O3FA 2QWLA 5AQXA 3H6EA 3WEEA 4CJFA 2P9IB 5T7BA 3HM8A 4DR6K 3ZSYA 2A41A 3AO4A 3LDPA 3AVNA 1X9WA 3JSMA 1X9JA 4CZHA 4JAXA 2X74A 4RWTA 4GV3A 4ID1A 3OJSA 1QHAA 3PSFA 3EE8A 3L6QA 3D45A 1TKTA 4M3ZA 4BRAA 1I39A 4O5FA 1C0TA 2OANA 1S6QA 4OVLA 3CC2N 1SV5A 2VCPA 4DSIA 1JCFA 3BZCA 3E1YA 3CCSN 4CZFA 5FRNA 1KC8O 1KLNA 3ATUA 4R79A 4FJ5A 2W40A 5M1FA 4E0DA 2BH1A 1SL0A 3UKUA 1WSFA 4NYNA 1J54A 1CXQA 3TSUA 2ZJPL 4WE1A 1BWFO 3QEIA 2P9KB 4CBWA 3ZX0A 4YOUA 3V9XA 5M1OA 1EXQA 3WT0A 4XH1A 3E9OA 1IG8A 2HHTA 3NHGA 4NXNK 1JLGA 3IS9A 2XY5A 1T6CA 4LY7A 4MO5A 4CW7B 2YHXA 3H08A 4H0OA 4CEEA 4H5NA 1RGIA 3TTFA 2HBKA 3V1RA 1WSHA 4FJGA 2CH5A 1YITN 4ISGA 4O8UA 3J7ZO 2NZTA 1LOTB 3V9WA 4HCCA 4FPBA 1JKHA 3O4QA 3OW2M 4K41A 4JI2K 4DFMA 1BI4B 3LM9A 2QM1A 5HL7L 2VG5A 1KFSA 1RT4A 3CJ9A 5K14A 5GINA 4JKAA 1C0MA 2GEMA 3R8EA 3VENA 1KFDA 4RW4A 2P9NB 1RDBA 3OBWA 4BR7A 4NYFA 2HB5A 4I2PA 3NGZA 3THWB 3O4WA 3QBXA 3I55N 4N41A 1VSKA 2E20A 2CGLA 4JD2A 4DR3K 2BE2A 2NRRA 2P9SB 3L2QA 3RMCA 1VSMA 2Z1GA 5ADXH 5CY4A 3CCUN 1C0GA 3IMXA 2IDOA 5LMNK 4JK8A 4CGIA 1I3AA 2B4JA 3SBGA 3FZHA 4PKGA 3ZSXA 4F8RA 3LWMA 1NK5A 2ITGA 3HSTB 3KLGA 4JKCA 1LWEA 1TVRA 4DTXA 3DRRA 4KI6A 3CIPA 1N34K 1C0UA 3AVFA 3AVMA 4MO4A 3VQDA 3ALYA 1S5JA 1OH8A 4Z0UA 1RBRA 4O4GA 4KREA 4M3WA 3C7NB 2HHXA 1NK4A 1FW6A 2Z1JA 1GLJO 1TAQA 1ATRA 1VSFA 4FLTA 3H1VX 1L3TA 1S3XA 3KD5E 3LAKA 4W5RA 1D4XA 4JLHA 1RFQA 4B9LA 3O3GA 4BQZA 5EVZA 2QKKA 1BIUA 3U8XA 3KTQA 3HK2A 3FZLA 4DUZK 3BP8A 1NK9A 2X6SA 3U9ZA 3C0BA 3VQBA 3A5OC 1QZ6A 5AQVA 1YXQA 4GY2B 4B8AB 4ELUA 3H1QA 5AZJB 3OS1A 4M3TA 3RWUA 4UY8O 2V51B 2ZQBA 3BY5A 1RTIA 5BREA 1A5WA 3UB5A 3MEDA 5AZIA 5CZ1A 1RDAA 2NUBA 3RMBA 2GUIA 4BRGA 4DV5K 2OCEA 2A3ZA 1NWKA 1NGHA 3VQ9A 5EY4A 3SNNA 4YY3K 4GNIA 4B9MA 1S72N 3U3YA 4WQ4A 3P4IA 3M6GA 4KTZA 1E4GT 2YHBA 4CE9A 4B8CA 3VEYA 2P9UA 1G99A 2ASPA 4FWKA 4JRQA 3UKRA 3WXMB 3DRPA 5KPTA 4OX9K 4EP4A 3ID6A 3M8QA 4BRHA 1HPZA 4DLEA 2A40A 1FKOA 1Z26A 4B3OA 4FO0A 3IKMA 3ID8A 4RW8A 3RMAA 1D9FA 3SPYA 5GAHP 1DLOA 4DS5A 3F73A 4DHYA 4OJRA 2RF2A 4FWQA 1XMQK 3ZT0A 4A2BA 5EOYA 2QWPA 2YHYA 3TR8A 2WC9A 1RBTA 1U48A 4B9UA 2FBVA 3EZ5A 3O4NA 4I6MB 1UA1A 4KHPK 4Z4IA 3O9TA 1ILYA 4CEAA 1VSHA 3LDLA 4IZ9A 1WAFA 1BISA 3E9PA 3L0QA 2YNHA 2A6AA 4CBUA 3EYZA 2OPQA 3N4QA 3DXKB 4ELVA 1NMNA 3Q7CA 3F9KA 2A1RA 3G10A 2VGMA 3VQAA 4BQLA 1W9HA 4DMNA 1D8YA 2QEXN 4OPKA 4A61A 3OYDA 1ESVA 2ATQA 1X3MA 4LF7K 4B9VA 1WBBA 3TSPA 3H3OB 4NCAA 5BRHA 5CYMA 3IG1A 4CEDA 3OY9A 2B5JA 4JD2B 2Q3SA 5M1NA 4C8KA 2P1JA 2YNGA 3VQCA 4LFCK 4QAGA 3D6RA 1K8KA 4AHTA 3WXIA 3EL2A 1N33K 1C1AA 5AJ3K 4FZYA 1IKVA 1X1PA 3MX5A 4IJNA 3OBYA 2P9PA 5MLCQ 4CZEA 3QB0A 4BE0A 4CF1A 1RNHA 4Y0WA 2FSJA 5KQ8A 2W6KA 2QXFA 4JI6K 3CC4N 4F3OA 2DTUA 2HMPA 3WNGA 3IUCA 4AHCA 3QERA 3K59A 4LF9K 1J6ZA 4WYBA 5EX5A 2HVIA 3C65A 4BREA 4HTLA 4CFAA 3T69A 1BL3A 4OPHA 4Q5VA 4KH4A 2EHGA 1ZBLA 1V4SA 3F2KA 3SBTA 3HL8A 4FJ9A 4LSLA 4I9QA 1YAGA 4BVPA 3MDQA 4ISEA 4FLWA 2UXCK 3SV3A 4GV6A 1VSEA 1OVYA 3CI5A 1HX1A 4KI4A 4F2SA 1VSIA 1NKCA 3THYA 1IBLK 3EE9A 5AZIB 3WQUA 4CESA 4FJXA 4J2BA 4CJLA 3VF6A 4GVEA 2ASMA 4CZMA 3K57A 3CCVN 2F8SA 4G1QA 1EWRA 3ULEA 3OJUA 1VSJA 4MLEA 3FE1A 3O1BA 1QS4A 2W41A 1ITGA 1O13A 1NU0A 4DQ8A 2HVHA 4IG0A 2PYJA 5J2QA 3D2EB 4ILGB 1NGBA 3UKRB 3P1GA 5KRSA 3J81O 3SZ2A 3TANA 1YJNN 4BR5A 5GAGP 1Z6RA 2CH6A 2DFHA 3WNFA 1GLDG 3JAMO 1NGGA 4GW6A 4NB4A 4CFBA 5LJWA 4A5BA 3AGKA 2WBNA 4EFHA 4XIUA 4FCYA 2RKIA 1BIZA 4CEFA 3W3DA 1P8ZA 3CJAA 3U6FA 1FKPA 5KPZA 4MDAA 4BWMA 1K9MO 4ILHA 4Z94A 4HWIA 3SLCA 3MXMA 2B6AA 4A57A 4LH4A 3CFOA 1UAXA 4IOXA 1HYVA 3WXJA 4JS5A 3HT3A 4DCHA 4CK3A 3NMUA 1IH7A 3A5MC 4DTPA 3SAFA 1BGXT 1QVGM 3HTVA 3O6WA 4YOYA 4H5TA 1GLBG 1WSGA 2X6NA 3THXA 3JS6A 1LV5A 4PL7A 4E1JA 2R7YA 1IO2A 4JHDA 1REVA 2IVPA 3VGKA 4DLGA 3TTCA 1Q82O 4AHVA 4BRDA 3H3NO 4K8ZA 2E8AA 3A2FA 3LP1A 1S1WA 4OKKA 3VQ4A 3TTDA 4BC5A 1YTAA 4KBOA 3ENOA 3MCAB 1ATNA 2O8BA 4CJVA 2V52B 3OYJA 2YHWA 2P5OA 5AQIA 1U6ZA 3KKSA 1EQYA 4C8LA 1K8KB 2E88A 3OVNA 5JVHL 4F3TA 4BRQA 2YHAA 5CHIA 4B9SA 4DQQA 2NRTA 3AVLA 1M90O 3H45C 4IO9L 4DV6K 1OVQA 3TAGA 2IOCA 3ZSQA 3F5TA 4OKJA 3OYLA 1D9DA 5F1XA 3QESA 5DMRA 1NM1A 4DTNA 2XO7A 3O9SA 1U49A 2X78A 4BR9A 4CF0A 1JCGA 5DM6L 3JYTA 2O8CA 2GWJA 1GLEG 1TKDA 1BHLA 3VEWA 3CHWA 4BACA 5KGXA 4M3XA 1N6QA 3CG7A 3B8AX 3QIOA 2QWOA 1NGDA 1L3SA 1XI1A 3TAMA 3KK2A 4FOIA 3I8DA 3P39A 1KRPA 5GIPA 4YOVA 4BC2A 5C25A 1JLCA 4CHOA 3HRGA 3NGIA 3WNHA 3HPGA 3NVKA 4HTUA 4JK7A 3VQQA 3DRSA 2KZZA 2RN2A 4IJAA 3SAHA 2HHVA 4PQUA 3MN9A 3AA4A 3PX6A 2QK9A 2YJFA 4FZXC 4ISFA 5KQDA 5CR4A 4FLVA 1NJZA 4FWOA 3NH0A 4DV2K 5HLFA 3HVRA 3LDSA 4J2AA 1I94K 3G0ZA 4BDYA 4DV4K 1LWCA 4FWLA 4BRPA 4XH4A 4GVMA 4C8MA 1KLMA 4ICLA 2NRZA 3LP2A 4B9QA 2IGIA 1Q9YA 4M45A 4C1NI 4W5NA 4KKOA 3L2RA 1XNRK 4DFJA 1MA9B 2OTJN 4AH9A 3MMVA 3SPZA 4JI0K 4BGAA 3O9RA 4C8NA 1NGEA 4I2QA 4QOZB 4FLXA 1TYQA 1T8EA 3KWIA 5CE3A 2IC3A 4ZTFA 1L3UA 2V7YA 5C12A 3NH1A 4FJ7A 4KHSA 3L4IA 3HPHA 4FJLA 4IG3A 4H8KA 1J9AA 1GLCG 3TABA 2E4LA 4B1WB 2WOMA 3DYAA 4H5RA 3L2UA 5I3UA 1BOTO 2AP1A 4DV3K 2E2QA 4PKIA 4A59A 4FXDA 1T3VA 4CF8A 4DTRA 1S9GA 3V4IA 4Y1DA 3CPWM 4FZZA 3SJHA 1XC3A 2VG7A 4DR4K 1RILA 1KXPA 4CHYA 5F0XA 5BRDA 3VQ5A 3ZSRA 2HNZA 4OO1J 5IWAK 1SL2A 1ZBSA 3ZYYX 4DTJA 3LL3A 1WSIA 1YT3A 1EWQA 5JICA 3AVKA 3TAFA 4JI5K 1MWKA 4J2DA 1KTQA 5C24A 3S9HA 1QSYA 4DQRA 2DFEA 4FLZA 4FWSA 3V9UA 3THXB 1B9DA 4CZIA 3L3VA 4BR2A 1D5AA 1CZAN 4JKGB 4KTWA 4Z4EA 1FJGK 3QBWA 4JHDB 4IBNA 4JKEA 4YOTA 4JI1K 3MXJA 2KZMA 3AVJA 2O4IA 4IWVA 2IVOA 2NRHA 4HUEA 1XHZA 3ZETA 4N47A 2G8IA 1QZ5A 3MEGA 4O5BA 3K2PA 3VERA 3SK3A 1YTUA 3RSEA 1U47A 5AQZA 1ZC6A 3K9JA 2UU9K 2IS3A 4O55A 5JS1A 3HVTA 3LZJA 4CD1A 4PY5A 3OS0A 2ZJQL 1CXUA 4KTQA 5AQHA 3EO3A 2Q0RA 4CZJA 1JJ2M 2P9LA 3V6DA 3HYFA 1VQMN 2HNDA 1VQKN 2FBTA 3MAQA 3LDNA 3D2FB 3PX4A 4CJ3A 4PUOA 3SUNA 4O44A 2UUAK 1S22A 1Z25A 4HCBA 3NH2A 2G8KA 2VWKA 3SMSA 3MEEA 1VQ8N 5LJVA 3CJ7A 4CHZA 3DXMA 4HUFA 4FJJA 4J2EA 3DI6A 4DSLA 2XRIA 4KB0A 4QS8A 1KVBA 3I0SA 3VA3A 5HRRA 1VHXA 3CQXA 4EHTA 4B1VA 2FC0A 3O80A 3TSQA 3WEEB 2DPNA 1IBKK 5KGWA 1Q18A 2UXBK 2QW9A 5AQPA 3O08A 3LDQA 1LAWA 1XNQK 3HJFA 4RW9A 1IBMK 3E9LA 1RT5A 3W0LA 4DU3A 1GOBA 1C1BA 1L3VA 2GX9A 4NLBA 5CYQA 4CIFA 4EZ9A 1KAYA 3L2WA 4HHTA 2QWNA 4PA1A 4E1NA 1FK9A 2A5XA 1JL2A 3V9SA 4H4MA 1XQSC 1KQSM 5C2DA 4LD0A 4FK2A 1W97L 1W7AA 1XWLA 3OYGA 2GUPA 5IT9O 5HBMA 1N5YA 2QWRA 4OPAA 3FZMA 3GE1A 4LSNA 2HF3A 4WFAL 4H0YB 2AJQA 4H0TB 2FF6A 4Q0BA 3UKUB 3NF9A 4YDUA 4FK4A 4AHRA 3RRHA 3K58A 4BRIA 4CJWA 4CEOA 3VQEA 3K5NA 3CQ8A 5AQMA 2E2NA 4BROA 1XMOK 3DLEA 3GBTA 3QFPA 2D4WA 2GELA 4IDKA 4DSKA 3AVBA 1ASUA 3PUFA 3OA9A 4B3RK 1XC9A 3CCMN 4CF9A 2IVNA 4KFBA 3CFRA 3MN7A 1Q8IA 1HMVA 3OYAA 1ASVA 1CLQA 4UQGA 2P51A 1WN7A 3I56N 1SL1A 1BA0A 4LF5K 5JVGL 2G8FA 3MX2A 1C6VA 3WQTA 3HP9A 3KLIA 4BGBA 4ID5A 2D0AA 3HZ6A 2G8HA 4TSXA 1HNVA 5C2FA 3EKSA 3B6PA 2HSTA 4IDHA 4FM2A 3M3ZA 3CJ1A 4FLYA 3DLBA 3EY1A 4DV1K 1RT6A 2ETJA 4FWPA 1HNZK 3I33A 4GMJB 4DU1A 1DEJA 2JWKA 3ZT2A 1IKXA 1UWBA 1RT7A 4DR7K 3V9ZA 4K43A 4K25A 3PY8A 5AR0A 4YOWA 3ZLJA 3FZKA 3MXIA 5DM7L 2PZSA 3VQPA 2QXLA 1YJWN 2PFUA 5I9EB 4DR5K 4N56A 4CEZA 2HHQA 1S9EA 4CERA 4GKJK 2YKMA 3VEOA 1YJ9N 3QEVA 5LY3A 3BEXA 2GTDA 1SAZA 2FBYA 3A5LC 2O8FA 2IAJA 1YUWA 3K5OA 3HSCA 4KV8A 3VGLA 2YJEA 3S41A 2KLAA 2ZWHA 4B3TK 3V1OA 4C23A 3DM2A 1TAUA 4AHUA 4BVOA 3CFPA 5M1QA 1BO5O 3QDKA 3RVCA 2D0CA 3DJCA 4BRCA 2HBJA 4BRKA 3AV9A 2KQ2A 3VF2A 5BPMA 2J4RA 4IFYA 3LWLA 3DLLL 1VSDA 4KHYA 4O8KA 1RT2A 3CCQN 4JI8K 4H4OA 4DS4A 3BDPA 3CC7N 4F9OA 3ZEUA 3DXMB 1XUPO 5AQLA 4WQ4C 3CERA 2O4GA 2QI2A 3AO5A 5AQSA 4ZHRA 3QFUA 4FK0A 4YDUC 5E26A 4DFKA 2P5GA 5KRTA 4B1YB 2Q36A 3WXKA 4KHQA 4E1MA 4FJIA 2W6LA 2JLEA 4MFBA 1P90A 5BPNA 1ZBHA 1TK0A 1VQ4N 2PBDA 3FR0A 2NNWA 2ZD1A 3VETA 5BR8K 4CZKA 3DOKA 3C94A 2E6LA 2FXUA 4BRMA 3CF5L 2E2PA 4M42A 3R9PA 4LH5A 3DLKA 1K6YA 3TU5A 3O9QA 3NF7A 3PIPL 2FSNA 2VWBA 5C0YA 3PSIA 2JWLA 1EP4A 4IFVA 3VTHA 3SUQA 4L3QA 4JN4A 3SMPA 2P9IA 3T1HK 1TV6A 2PAVA 4F2RA 5AQRA 2NRVA 1TL1A 3FFKB 3ZT3A 2KW4A 2P9UB 1JLQA 1LW2A 4BDPA 1DKGD 3E01A 4E89A 3J8AA 3QEPA 1SKSA 2OPSA 4CK1A 4E7HA 2W42A 4WCEL 4DTOA 1T44A 4BC4A 1NJIO 2E2OA 4W5QA 1B9FA 3C6HA 1T6DA 3KLEA 4IOAL 3JXUA 4CJEA 1ZBFA 3T1YK 4CFDA 5FPDA 3VQ7A 4DUYK 5HRSA 4CHNA 3BZKA 5C10A 1NKBA 5J2PA 1JXBA 4B9NA 3C6UA 1VQ9N 3P5JA 4A62A 4CIGA 2A42A 3SUPA 2P9KA 3QEWA 2G8UA 1YVNA 4ZTJA 3M1FA 5AQTA 4CJ4A 1UA0A 1OKJA 1WB9A 4C8OA 2HF4A 3ZT1A 2NRXA 4LFBK 5FPMA 3TAEA 4YHHK 1J53A 5AQOA 5C42A 3AO2A 4K42A 4AHSA 3KD1E 3GG4A 1YI2N 1W0HA 3RR7A 1S1XA 3GOIA 2FF3B 2HBLA 4OLBA 1A5VA 2UUBK 2YX6A 5FDLA 3CPEA 3HOSA 5J1EA 4FOEA 4KHWA 3DLHA 3F9MA 4NLCA 2OA8A 4XH5A 3CJBA 1SKRA 5FLXO 1BI4A 4X62K 4CIEA 2KFZA 1L5UA 5GAEP 5FROA 4QS7A 1NK6A 3PLAA 2QKBA 4FWRA 3QMLA 2P9PB 4CFCA 2P9NA 3L4QA 1KCFA 4IXCA 4AQYK 1DGKN 3QEXA 4KH6A 3U9DA 4FL9A 4PKHA 2WONA 2E1ZA 3NF6A 1MDUB 3O5BA 4HVJA 3OYNA 2Y1JA 2P9SA 4V19S 2KFNA 3P38A 3ZSWA 3EZWA 4C1NK 4CGFA 5BPLA 1YVUA 1NGFA 4KO0A 1RTDA 4CGJA 4KRFA 3AVHA 4FM1A 4FLUA 4IO8A 4E7KA 4E7JA 3ZX3A 5FRMA 3CM6A 1IKYA 2O8DA 1EO1A 3AY9A 3P31A 4CJTA 4WQ5A 5GIOA 2LSNA 3FLCO 1RDDA 5J2NA 5AQGA 3R3LA 3BUZB 4B08A 4M63C 3OTOK 4JK9A 4W5TA 2Q31A 4DV7K 3THYB 4EIAA 4FJHA 3I0RA 1NOYA 4M7YA 3IFRA 5KTQA 4ELTA 3VTIA 4DF4A 4YNQA 2H3GX 1HUXA 4U7BA 3MWPA 1GLLO 3OYKA 2Q97A 2QTDA 1BG3A 1VQ6N 3ULEB 1QQMA 2RE2A 4BY9C 3QICA 3ZX2A 2FSKA 1S6PA 1HRHA 1R0AA 2ASOA 1N36K 4BRNA 5AZJA 1GLFO 3DLGA 1TGOA 2F9TA 4BC3A 3SCXA 4B9TA 2DY4A 1ATSA 3KK1A 2VQEK 3U3GA 2OTLN 3A5NC 3K0SA 4LFAK 5C15A 3OYHA 2HHHK 5AQWA 3HP6A 1WAJA 2I7NA 4KHUA 3RR8A 1Q7YO 3IAYA 2YV0X 3R6MA 3HXMA 4DR1K 4PWDA 3SUOA 1QE1A 3ENBA 2AA4A 3AAQA 2I5JA 3KHYA 4CGHA 1X9SA 3ENHA 1HNWK 2ZGYA 1X9MA 4E7IA 1BCMA 1NGCA 4CEBA 1RDUA 1RT1A 4CECA 4U67L 5M1KA 2CGJA 2HOEA 2UYTA 1NK8A 3MK6A 3ZT4A 4FW2A 3SQ2A 4LF4K 4N76A 1BQMA 3BF3A 5AQYA 4B1ZA 4E19A 4FJNA 5AQFA 3M8SA 4BE2A 1NG9A 1JCEA 4NCBA 1QQNA 4IEEA 3TAQA 1ZXOA 4GV9A 1SKWA 3L3UA 1JXEA 4DU4A 3OHRA 5AQQA 1Y97A 3LP0A 2I7PA 3FFIA 3J7AP 2Q1NA 3P83D 3OYFA 1U4BA 4OPJA 4I6MA 1NGIA 2Q2RA 4AM6A 5HRNA 3M8RA 1A5XA 5F2RA 1BQNA 1WSEA 4W5OA 5AFUA 4IOCL 2XY8A 2KHOA 5H1SQ 3ULDA 1KD1O 3LP3A 2O8BB 1SS6A 4DTMA 5HP1A 3R1XA 4MQ3A 3CCLN 1NNEA 1CZ9A 3NGYA 3OYEA 3DXKA 4JEPA 5JMVA 4BE1A 2NLXA 2V7ZA 2RPIA 2FBXA 3CQYA 1U04A 4BG9A 4H0XB 4QCLA 4WQ5C 1WNSA 4FVUA 4CVNE 4CJ7A 3TAPA 4OLAA 1VQ7N 4CGGA 4DWIA 1HJOA 1QQCA 3IRXA 1S1UA 4F4KA 3BF1A 4FJ8A 1VSLA 1LW0A 1N8RO 1NLVA 2E1YA 3AVCA 4DKWA 5D3GA 2YNIA 3ITHA 1RDCA 4X65K 3AAPA 4CEQA 1W2BM 3I8BA 3HPOA 1HQEA 2VWJA 3L2VA 4QS9A 4A5AA 2RHKA 1H1VA 3FGUA 4DTUA 1C1CA 2F4VK 2O8CB 4LF8K 1EETA 5HROA 3DOLA 3G71N 3ZSOA 1G15A 3O3HA 5CZ2A 1HKCA 3PX0A 1E4FT 3VEVA 3N4PA 3SQ0A 3VESA 4OGEA 4JS4A 4DG1A 3NCIA 3UE5A 1HNXK 2O8DB 5A2QO 2NRWA 3U4LA 4IFEA 1CZBA 4N5SA 1VQNN 2ITMA 3LAMA 3NF8A 4Z4FA 2A1SA 4BRFA 4X66K 2FLOA 3SAGA 3KKRA 2D0BA 2KKZA 4EAHD 4CJ5A 2VG6A 3LZIA 1RCHA 4Z4GA 3OYIA 3NAEA 2HBMA 4H5VA 4JI7K 3KK7A 1QHTA 2VQFK 3SYZA 2D5RA 4WFBL 2E5LK 4DQSA 5BRFA 1Q81O 1RT3A 1U45A 1J5EK 3SJJA 4KB1A 4CHQA 4DB3A 4K8XA 2EWSA 5E41A 1C0FA 3LDOA 3SQ4A 3G4SN 2Y1IA 1BCOA 1K73O 1WLJA 1KAZA 2VGNA 1TYQB 4CJSA 3OYMA 1EKEA 4MLHA 4CJPA 4CI6A 3SV4A 4K0KK 3D0PA 2E6MA 2YCHA 4XEIA 5B8HA 4BDZA 1QTMA 2BUPA 1OH5A 1ZBUA 1IG9A 3DMJA 1TUYA 1B92A 5JLHA 1T7PA 4HUGA 3LPTA 2HHUA 3HM9A 5BN8A 1NK7A 3CMEN 3KK3A 5AQNA 5AQJA 5FPEA 4DSFA 2HMIA 1KSPA 2G8WA 3THVA 3D2EA 5KPRA 4AM7A 5BR9A 4M7XA 1NMDA 4CBXA 4DSJA 4DQIA 5J2MA 1MWMA 1NGAA 3A0IX 5I42A 1RTJA 1FXXA 1GOAA 4CGDA 3KJVA 5SWMA 4X64K 1NJWA 2GBZA 4PHTX 1NJXA 4R5PA 4OKEA 1QSSA 5TKYA 4E3SA 2PY5A 4AILC 1VQPN 4CD3A 4RW6A 2GWKA 3O1WA 4H03B 3VMFB 2F9WA 1T03A 4Z4CA 2EX3A 1WUAA 1QQOA 4DQPA 3G25A 2OZSA 1YF5L 3DAWA 4FVMA 3ZETB 1X3NA 3MWTA 5ELZA 4CZGA 4KPYA 3MECA 3VA0A 2Z1HA 1HNIA 4AF1A 3EN9A 4FPAA 1WOQA 5TKWA 1U2VA 3NVMA 4J8FA 4BG8A 4BRLA 3L8BA 3NE6A 4E7LA 3PO5A 1SQKA 3RSEB 1UOCA 3VEZA 3C6AA 4FWNA 4LF6K 2UXDK 1IKWA 3QIPA 2D0OA 3K5MA 2BTFA 1JLEA 2BDPA 3LANA 3TWHA 1JL1A 3RMDA 4JKFA 3FZFA 4BR4A 2ZF5O 3EKUA 2HW3A 2P9LB 3CYMA 1VK0A 1R59O 2D1KA 2HNYA 4JI4K 1VQ5N 3PV8A 3ASMA 1IJJA 1XHXA 5LMUK 4DV0K 3VEXA 2ZM6K 1WBDA 5ADXA 4DF8A 4O0JA 4FJKA 3IDHA 5JLFA 2IIRA 3AVGA 3KLFA 4CHPA 3T7ZA 1TUUA 4EZ6A 3LPUA 4B3MK 3CMAN 1J5OA 1F21A 3T19A 1BUPA 2O8EA 1KAXA 4CF2A 3UIQA 5GADP 1JLBA 3TPQA 4GKKK 3K5LA 4CJRA 1Q9XA 1HKGA 3NDKA 1N32K 2YI1A 3QETA 1DT9A 1LAVA 3T1AA 3SQ1A 3AA2A 1EX4A 4Z4HA 4JYAK 4DSEA 2OPPA 3PO4A 2WUSA 2QWQA 2XY6A 3O9UA 3OYBA 3BGRA 4BWJA 3HO1A 1KVAA 3T3FA 3S3OA 3HOTA 3J80O 3TARA 3RTVA 4KHNA 2JGUA 1TK5A 1S1TA 2Z1IA 3GL1A 3V1QA 1BDGA 1S1VA 5JS2A 3LALA 1LWFA 3MCPA 1HPMA 3HI0A 2ZGZA 3J7YP 3AA5X 1JLFA 5FPNA 2BANA 5SZTA 1M1KO 1VRTA 4G9ZA 4WFNL 1RBSA 4NO7A 3O8MA 2HHSA 4KH5A 3CM5A 2YKNA 3EEQA 3QINA 3CCEN 1ZBIA 2D0PA 3H46O 4IKFA 3VOVA 3B6OA 5DK5A 3CXCM 4JNEA 1ASWA 3AARA 3AO1A 2ZE2A 1RDWX 5KI6A 5LL6Z 1O1WA 2QA4N 1HQUA 1SUQA 3CJCA 4IEIA 1OH7A 4Y1CA
chains in the Genus database with same CATH topology
2HNDA 4DF4A 4YNQA 2XHBA 4ELVA 2FBTA 3ZSVA 3MAQA 3F9KA 3PX4A 2A1RA 4CJ3A 3OYKA 4PUOA 3G10A 3VQAA 2YNFA 1W9HA 4DMNA 4DFPA 1D8YA 1RBUA 4OPKA 1NKEA 4OGCA 3SUNA 4O44A 3SI6A 1Z25A 4HCBA 1NK0A 1S6PA 3NH2A 1HRHA 2G8KA 1HYZA 3RRGA 2BGGA 2VWKA 3OYDA 1R0AA 3MEEA 2ATQA 3S3MA 3KIOA 2DFFA 4YFUA 4B9VA 4CHZA 4KAZA 4HUFA 2XY7A 4FJJA 3DLGA 1TGOA 4J2EA 4NCAA 3WNEA 3KLHA 3DI6A 4DSLA 5CYMA 2XRIA 3M8PA 3SCXA 3IG1A 4CEDA 3QNNA 4B9TA 2G8VA 4KB0A 2DY4A 3KK1A 4L8RB 1RTHA 2B5JA 3OY9A 2Q3SA 1QSLA 1KVBA 3I0SA 3U3GA 4CCHA 4NCGA 1TKXA 3VA3A 4C8KA 5HRRA 2P1JA 2YNGA 3VQCA 3OYHA 4QAGA 4FW1A 4AHTA 3HP6A 1DTQA 1WAJA 2FC0A 3ISNC 4KHUA 1C1AA 4FZYA 3RR8A 5KGWA 3IAYA 2YV0X 4CJUA 3HXMA 4FJMA 1IKVA 1X1PA 4PWDA 1RBVA 4FYDA 3SUOA 1QE1A 1LAWA 2PYLA 4RW7A 2I5JA 3QO9A 4BE0A 1HJRA 4CGHA 4CF1A 1RNHA 1X9SA 3HJFA 4RW9A 1X9MA 1RT5A 4DU3A 4E7IA 1GOBA 3AO3A 1BCMA 1C1BA 1L3VA 1CLQA 2QXFA 4CEBA 1RT1A 5CYQA 3VN5A 4CECA 1T05A 4CIFA 4M3YA 1NK8A 4EZ9A 4CJQA 4F3OA 4FM0A 2F96A 2DTUA 2KTQA 3L2WA 3ZT4A 3WNGA 4FW2A 4HHTA 3SQ2A 4N76A 4AHCA 3QERA 3K59A 4PA1A 1BQMA 4E1NA 1TL3A 1FK9A 4E19A 1JL2A 3OS2A 3V9SA 4FJNA 4RG8A 3M8SA 4BE2A 4H4MA 4NCBA 2HVIA 3DLRA 1WSJA 1TK8A 4CJKA 3TAQA 4CFAA 4I7FA 4LD0A 4FK2A 1SKWA 1XWLA 3L3UA 3OYGA 1BL3A 5HBMA 4Q5VA 1JXEA 4M3RA 1N5YA 4DU4A 2EHGA 4LSNA 1ZYQA 4JRPA 1ZBLA 1DTTA 2AJQA 1NJYA 4Q0BA 3NF9A 4FK4A 4AHRA 1Y97A 3LP0A 3RRHA 3HL8A 4FJ9A 2HHWA 3K58A 3FFIA 4LSLA 4I9QA 3NBPA 3P83D 3OYFA 1U4BA 4CJWA 3VQ8A 4OPJA 4CEOA 2OZMA 3VQEA 4FLWA 3AVAA 3K5NA 5HRNA 3CQ8A 3M8RA 1A5XA 3SV3A 4EP5A 1BQNA 1WSEA 4W5OA 2XY8A 1TKZA 1VSEA 3DLEA 4O0IA 4I9LA 4KI4A 3ULDA 4DSKA 4IDKA 4F2SA 3LP3A 3VQ6A 1VSIA 3AVBA 1ASUA 4DTMA 1NKCA 5HP1A 2F8TA 3PUFA 3OYCA 4MQ3A 1XC9A 4CF9A 1CZ9A 3NGYA 4CESA 3OYEA 4KFBA 3QNOA 4J2BA 4FJXA 3CFRA 4CJLA 4BE1A 3TI0A 1Q8IA 1HMVA 2FBXA 1ASVA 1U04A 2RPIA 5EU7A 3OYAA 4QCLA 4UQGA 1WNSA 3K57A 3TAPA 3S3NA 4OLAA 4M3UA 2P51A 2F8SA 4G1QA 1HYSA 4CGGA 3NFAA 1QQCA 2GV9A 3C95A 3IRXA 3OJUA 4DWIA 1MU2A 1JLAA 1S1UA 1VSJA 4DTSA 3QLHA 4F4KA 4CK2A 1WN7A 4FJ8A 1QS4A 1VSLA 3V81A 1ITGA 1LW0A 3ZSZA 3AVCA 3AVIA 2HVHA 4IG0A 1SL1A 1KVCA 2PYJA 5J2QA 5D3GA 3AA3A 2YNIA 2OPRA 3ITHA 1RDCA 4M41A 1GOCA 2G8FA 1C6VA 4CEQA 3HP9A 3KLIA 3P1GA 1VRUA 5KRSA 4ID5A 1HQEA 1NOZA 2D0AA 3HPOA 3L2VA 2VWJA 2OYQA 2G8HA 5HRPA 3ZCMA 4TSXA 3SZ2A 4DTUA 3TANA 1C1CA 1HNVA 3C6TA 3B6PA 2DFHA 3WNFA 1EETA 5HROA 3DOLA 4FM2A 3ZSOA 4GW6A 1G15A 3O3FA 4CFBA 3O3HA 5CZ2A 4FLYA 4XIUA 3DLBA 3EY1A 4FCYA 4CJFA 5T7BA 2RKIA 1BIZA 1RT6A 2ETJA 4CEFA 3PX0A 3ZSYA 3AO4A 4GMJB 4DU1A 3U6FA 1FKPA 3AVNA 1IKXA 1UWBA 3ZT2A 3SQ0A 4OGEA 4JS4A 4DG1A 3JSMA 1X9WA 1RT7A 3NCIA 2X74A 4ID1A 3OJSA 3V9ZA 4BWMA 3PY8A 3MXIA 3D45A 2PZSA 3VQPA 1TKTA 4M3ZA 1CZBA 4N5SA 1I39A 3LAMA 1C0TA 3MXMA 2B6AA 3NF8A 4LH4A 4N56A 4Z4FA 2A1SA 4CEZA 2HHQA 3CFOA 1S9EA 1S6QA 3KKRA 1UAXA 2D0BA 4OVLA 4CERA 4CJ5A 1SV5A 2YKMA 1HYVA 4DSIA 4JS5A 3HT3A 2VG6A 4CK3A 3QEVA 3LZIA 1IH7A 1RCHA 5FRNA 4Z4GA 3OYIA 4DTPA 3NAEA 2FBYA 1BGXT 2IAJA 3K5OA 4KV8A 1KLNA 1QHTA 3SYZA 1WSGA 2D5RA 2X6NA 3V1OA 4FJ5A 1LV5A 3DM2A 4DQSA 1TAUA 4AHUA 4E0DA 1RT3A 1U45A 2R7YA 3CFPA 1SL0A 1WSFA 4NYNA 1J54A 1CXQA 2D0CA 1IO2A 3SJJA 4KB1A 4WE1A 3AV9A 2KQ2A 1REVA 4CHQA 4DLGA 4IFYA 3QEIA 4K8XA 3LWLA 4AHVA 1VSDA 4KHYA 1RT2A 5E41A 3SQ4A 4H4OA 4K8ZA 3A2FA 3LP1A 3V9XA 1S1WA 4DS4A 2Y1IA 1BCOA 1EXQA 4OKKA 3VQ4A 3BDPA 1WLJA 1YTAA 4CJSA 3OYMA 3NHGA 2HHTA 1EKEA 4CJPA 1JLGA 2O4GA 3SV4A 3AO5A 4CJVA 3D0PA 2E6MA 3IS9A 4ZHRA 2XY5A 4LY7A 3OYJA 4BDZA 2P5OA 1QTMA 4FK0A 3KKSA 1ZBUA 3H08A 4DFKA 1IG9A 2P5GA 5KRTA 3OVNA 4C8LA 4CEEA 3DMJA 4F3TA 1B92A 2YHAA 4KHQA 4B9SA 4DQQA 1T7PA 4E1MA 3LPTA 4HUGA 4FJIA 2JLEA 3V1RA 2HHUA 3AVLA 4MFBA 1WSHA 3HM9A 4FJGA 1ZBHA 1NK7A 1TK0A 3KK3A 2ZD1A 2IOCA 3TAGA 3ZSQA 4OKJA 3OYLA 3DOKA 3C94A 2E6LA 4DSFA 1D9DA 2HMIA 1KSPA 2G8WA 3THVA 3V9WA 4HCCA 3QESA 5DMRA 1JKHA 3O4QA 4M42A 4DTNA 4DSJA 2XO7A 4LH5A 4DFMA 1BI4B 3DLKA 1K6YA 1U49A 2VG5A 4DQIA 3NF7A 5J2MA 1KFSA 2X78A 1RT4A 4CF0A 5I42A 3JYTA 1RTJA 5K14A 1EP4A 1TKDA 4IFVA 1BHLA 1C0MA 1FXXA 1GOAA 4CGDA 3KJVA 3SUQA 4BACA 5KGXA 5SWMA 1NJWA 1KFDA 3CG7A 4RW4A 2GBZA 1N6QA 3QIOA 4M3XA 1NJXA 4R5PA 1TV6A 1L3SA 4OKEA 1RDBA 3TAMA 3KK2A 1XI1A 4F2RA 3I8DA 1QSSA 1TL1A 3ZT3A 2KW4A 4NYFA 1JLQA 1LW2A 2HB5A 4I2PA 3NGZA 4E3SA 1KRPA 2PY5A 4AILC 4BDPA 3E01A 4E89A 5C25A 1JLCA 4N41A 1VSKA 4CHOA 4RW6A 3NGIA 3WNHA 3HPGA 3QEPA 1SKSA 2OPSA 4CK1A 2BE2A 3VQQA 4HTUA 3DRSA 4E7HA 2W42A 1T03A 2KZZA 4Z4CA 2RN2A 3L2QA 4DTOA 3RMCA 2HHVA 1VSMA 4PQUA 2Z1GA 3AA4A 5CY4A 3PX6A 2QK9A 2EX3A 2IDOA 4FZXC 4CGIA 4DQPA 4W5QA 1B9FA 1I3AA 2B4JA 4FLVA 3ZSXA 2OZSA 4F8RA 3KLEA 4FVMA 3LWMA 1NK5A 2ITGA 3HSTB 3KLGA 1NJZA 3NH0A 1LWEA 1TVRA 4CJEA 4DTXA 1ZBFA 3MECA 4KPYA 3DRRA 5HLFA 4KI6A 3VA0A 3HVRA 2Z1HA 4CFDA 1HNIA 3LDSA 4J2AA 1C0UA 3VQ7A 5HRSA 4CHNA 3L8BA 3G0ZA 3NE6A 3AVFA 4BDYA 4E7LA 3PO5A 1NKBA 1LWCA 3AVMA 3VQDA 3ALYA 5J2PA 4GVMA 4C8MA 1KLMA 1JXBA 4B9NA 4ICLA 1UOCA 1S5JA 3LP2A 2IGIA 4Z0UA 1IKWA 1RBRA 3C6UA 3QIPA 4O4GA 3P5JA 4M45A 3K5MA 1NK4A 1Q9YA 4ELTA 4M3WA 2HHXA 4W5NA 2Z1JA 4KKOA 4CIGA 1JLEA 3SUPA 3L2RA 3QEWA 3LANA 2BDPA 2G8UA 3TWHA 1JL1A 1TAQA 4DFJA 3RMDA 4ZTJA 4AH9A 3SPZA 1VSFA 4FLTA 4CJ4A 1UA0A 4C8NA 2HW3A 4I2QA 4QOZB 3CYMA 4FLXA 1L3TA 4C8OA 1VK0A 2HNYA 3KD5E 1T8EA 3LAKA 2IC3A 3PV8A 3ZT1A 4ZTFA 1L3UA 3ASMA 4W5RA 3TAEA 1XHXA 4JLHA 1J53A 3NH1A 4B9LA 3O3GA 4FJ7A 4DF8A 4O0JA 3AO2A 4AHSA 5C42A 4FJKA 2QKKA 4KHSA 1BIUA 3KD1E 3HPHA 4FJLA 4IG3A 4H8KA 1W0HA 3AVGA 3KLFA 1J9AA 4CHPA 3RR7A 3KTQA 1S1XA 3HK2A 3TABA 1NK9A 2E4LA 2X6SA 4EZ6A 2WOMA 3LPUA 3VQBA 3DYAA 1F21A 3T19A 3L2UA 5I3UA 1J5OA 4OLBA 1A5VA 4CF2A 5FDLA 4B8AB 4ELUA 3UIQA 1JLBA 4FXDA 3K5LA 3OS1A 4CF8A 4CJRA 4DTRA 1S9GA 3V4IA 3NDKA 1Q9XA 3RWUA 2ZQBA 4M3TA 5J1EA 3QETA 4Y1DA 4KREA 1LAVA 1RTIA 1A5WA 3T1AA 3SQ1A 3DLHA 4FZZA 4KHWA 3MEDA 3AA2A 2OA8A 2VG7A 5CZ1A 1RILA 1EX4A 4Z4HA 4CHYA 1SKRA 1BI4A 1RDAA 2NUBA 3VQ5A 4CIEA 3ZSRA 2HNZA 3RMBA 4DSEA 2OPPA 2GUIA 2KFZA 3PO4A 1L5UA 5FROA 2XY6A 1SL2A 1NK6A 3OYBA 4DTJA 3BGRA 4BWJA 3HO1A 1KVAA 1WSIA 3T3FA 3S3OA 1YT3A 2QKBA 3VQ9A 3AVKA 3TAFA 4J2DA 1KTQA 3SNNA 5C24A 3S9HA 3RTVA 3TARA 1QSYA 4B9MA 4CFCA 3U3YA 4DQRA 2DFEA 4KHNA 4FLZA 1KCFA 2JGUA 3V9UA 4KTZA 1B9DA 1TK5A 2YHBA 4CE9A 1S1TA 4B8CA 2Z1IA 3QEXA 3L3VA 4JRQA 1D5AA 4KTWA 4Z4EA 3V1QA 3DRPA 1S1VA 2WONA 5JS2A 4EP4A 3M8QA 3NF6A 3LALA 4HVJA 4IBNA 2Y1JA 3OYNA 1LWFA 1HPZA 2KFNA 4DLEA 3ZSWA 1FKOA 1Z26A 4B3OA 3MXJA 3AA5X 2KZMA 4CGFA 4RW8A 1JLFA 3AVJA 3RMAA 1D9FA 2O4IA 1YVUA 3SPYA 2BANA 4KO0A 1DLOA 5SZTA 3F73A 4HUEA 4CGJA 4DS5A 1VRTA 4N47A 1XHZA 1RTDA 2G8IA 4OJRA 1RBSA 2RF2A 4KRFA 3AVHA 4FM1A 3MEGA 4FLUA 4E7KA 3ZT0A 4O5BA 4E7JA 2HHSA 5FRMA 3CM5A 3CM6A 3K2PA 2YKNA 3QINA 1ZBIA 3TR8A 1IKYA 4IKFA 1YTUA 1RBTA 4CJTA 3B6OA 1U48A 5DK5A 1U47A 4B9UA 2FBVA 2LSNA 3O4NA 3EZ5A 2IS3A 1RDDA 4O55A 1UA1A 5J2NA 5JS1A 1ASWA 3HVTA 3LZJA 3AO1A 4B08A 4Z4IA 4PY5A 2ZE2A 4CEAA 3OS0A 1VSHA 1CXUA 5KI6A 4KTQA 1WAFA 1BISA 4W5TA 1O1WA 2YNHA 4FJHA 3I0RA 1HQUA 1SUQA 3EYZA 3V6DA 1NOYA 5KTQA 3HYFA 2OPQA 4Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HND A;  4DF4 A;  4YNQ A;  2XHB A;  4ELV A;  2FBT A;  3ZSV A;  3MAQ A;  3F9K A;  3PX4 A;  2A1R A;  4CJ3 A;  3OYK A;  4PUO A;  3G10 A;  3VQA A;  2YNF A;  1W9H A;  4DMN A;  4DFP A;  1D8Y A;  1RBU A;  4OPK A;  1NKE A;  4OGC A;  3SUN A;  4O44 A;  3SI6 A;  1Z25 A;  4HCB A;  1NK0 A;  1S6P A;  3NH2 A;  1HRH A;  2G8K A;  1HYZ A;  3RRG A;  2BGG A;  2VWK A;  3OYD A;  1R0A A;  3MEE A;  2ATQ A;  3S3M A;  3KIO A;  2DFF A;  4YFU A;  4B9V A;  4CHZ A;  4KAZ A;  4HUF A;  2XY7 A;  4FJJ A;  3DLG A;  1TGO A;  4J2E A;  4NCA A;  3WNE A;  3KLH A;  3DI6 A;  4DSL A;  5CYM A;  2XRI A;  3M8P A;  3SCX A;  3IG1 A;  4CED A;  3QNN A;  4B9T A;  2G8V A;  4KB0 A;  2DY4 A;  3KK1 A;  4L8R B;  1RTH A;  2B5J A;  3OY9 A;  2Q3S A;  1QSL A;  1KVB A;  3I0S A;  3U3G A;  4CCH A;  4NCG A;  1TKX A;  3VA3 A;  4C8K A;  5HRR A;  2P1J A;  2YNG A;  3VQC A;  3OYH A;  4QAG A;  4FW1 A;  4AHT A;  3HP6 A;  1DTQ A;  1WAJ A;  2FC0 A;  3ISN C;  4KHU A;  1C1A A;  4FZY A;  3RR8 A;  5KGW A;  3IAY A;  2YV0 X;  4CJU A;  3HXM A;  4FJM A;  1IKV A;  1X1P A;  4PWD A;  1RBV A;  4FYD A;  3SUO A;  1QE1 A;  1LAW A;  2PYL A;  4RW7 A;  2I5J A;  3QO9 A;  4BE0 A;  1HJR A;  4CGH A;  4CF1 A;  1RNH A;  1X9S A;  3HJF A;  4RW9 A;  1X9M A;  1RT5 A;  4DU3 A;  4E7I A;  1GOB A;  3AO3 A;  1BCM A;  1C1B A;  1L3V A;  1CLQ A;  2QXF A;  4CEB A;  1RT1 A;  5CYQ A;  3VN5 A;  4CEC A;  1T05 A;  4CIF A;  4M3Y A;  1NK8 A;  4EZ9 A;  4CJQ A;  4F3O A;  4FM0 A;  2F96 A;  2DTU A;  2KTQ A;  3L2W A;  3ZT4 A;  3WNG A;  4FW2 A;  4HHT A;  3SQ2 A;  4N76 A;  4AHC A;  3QER A;  3K59 A;  4PA1 A;  1BQM A;  4E1N A;  1TL3 A;  1FK9 A;  4E19 A;  1JL2 A;  3OS2 A;  3V9S A;  4FJN A;  4RG8 A;  3M8S A;  4BE2 A;  4H4M A;  4NCB A;  2HVI A;  3DLR A;  1WSJ A;  1TK8 A;  4CJK A;  3TAQ A;  4CFA A;  4I7F A;  4LD0 A;  4FK2 A;  1SKW A;  1XWL A;  3L3U A;  3OYG A;  1BL3 A;  5HBM A;  4Q5V A;  1JXE A;  4M3R A;  1N5Y A;  4DU4 A;  2EHG A;  4LSN A;  1ZYQ A;  4JRP A;  1ZBL A;  1DTT A;  2AJQ A;  1NJY A;  4Q0B A;  3NF9 A;  4FK4 A;  4AHR A;  1Y97 A;  3LP0 A;  3RRH A;  3HL8 A;  4FJ9 A;  2HHW A;  3K58 A;  3FFI A;  4LSL A;  4I9Q A;  3NBP A;  3P83 D;  3OYF A;  1U4B A;  4CJW A;  3VQ8 A;  4OPJ A;  4CEO A;  2OZM A;  3VQE A;  4FLW A;  3AVA A;  3K5N A;  5HRN A;  3CQ8 A;  3M8R A;  1A5X A;  3SV3 A;  4EP5 A;  1BQN A;  1WSE A;  4W5O A;  2XY8 A;  1TKZ A;  1VSE A;  3DLE A;  4O0I A;  4I9L A;  4KI4 A;  3ULD A;  4DSK A;  4IDK A;  4F2S A;  3LP3 A;  3VQ6 A;  1VSI A;  3AVB A;  1ASU A;  4DTM A;  1NKC A;  5HP1 A;  2F8T A;  3PUF A;  3OYC A;  4MQ3 A;  1XC9 A;  4CF9 A;  1CZ9 A;  3NGY A;  4CES A;  3OYE A;  4KFB A;  3QNO A;  4J2B A;  4FJX A;  3CFR A;  4CJL A;  4BE1 A;  3TI0 A;  1Q8I A;  1HMV A;  2FBX A;  1ASV A;  1U04 A;  2RPI A;  5EU7 A;  3OYA A;  4QCL A;  4UQG A;  1WNS A;  3K57 A;  3TAP A;  3S3N A;  4OLA A;  4M3U A;  2P51 A;  2F8S A;  4G1Q A;  1HYS A;  4CGG A;  3NFA A;  1QQC A;  2GV9 A;  3C95 A;  3IRX A;  3OJU A;  4DWI A;  1MU2 A;  1JLA A;  1S1U A;  1VSJ A;  4DTS A;  3QLH A;  4F4K A;  4CK2 A;  1WN7 A;  4FJ8 A;  1QS4 A;  1VSL A;  3V81 A;  1ITG A;  1LW0 A;  3ZSZ A;  3AVC A;  3AVI A;  2HVH A;  4IG0 A;  1SL1 A;  1KVC A;  2PYJ A;  5J2Q A;  5D3G A;  3AA3 A;  2YNI A;  2OPR A;  3ITH A;  1RDC A;  4M41 A;  1GOC A;  2G8F A;  1C6V A;  4CEQ A;  3HP9 A;  3KLI A;  3P1G A;  1VRU A;  5KRS A;  4ID5 A;  1HQE A;  1NOZ A;  2D0A A;  3HPO A;  3L2V A;  2VWJ A;  2OYQ A;  2G8H A;  5HRP A;  3ZCM A;  4TSX A;  3SZ2 A;  4DTU A;  3TAN A;  1C1C A;  1HNV A;  3C6T A;  3B6P A;  2DFH A;  3WNF A;  1EET A;  5HRO A;  3DOL A;  4FM2 A;  3ZSO A;  4GW6 A;  1G15 A;  3O3F A;  4CFB A;  3O3H A;  5CZ2 A;  4FLY A;  4XIU A;  3DLB A;  3EY1 A;  4FCY A;  4CJF A;  5T7B A;  2RKI A;  1BIZ A;  1RT6 A;  2ETJ A;  4CEF A;  3PX0 A;  3ZSY A;  3AO4 A;  4GMJ B;  4DU1 A;  3U6F A;  1FKP A;  3AVN A;  1IKX A;  1UWB A;  3ZT2 A;  3SQ0 A;  4OGE A;  4JS4 A;  4DG1 A;  3JSM A;  1X9W A;  1RT7 A;  3NCI A;  2X74 A;  4ID1 A;  3OJS A;  3V9Z A;  4BWM A;  3PY8 A;  3MXI A;  3D45 A;  2PZS A;  3VQP A;  1TKT A;  4M3Z A;  1CZB A;  4N5S A;  1I39 A;  3LAM A;  1C0T A;  3MXM A;  2B6A A;  3NF8 A;  4LH4 A;  4N56 A;  4Z4F A;  2A1S A;  4CEZ A;  2HHQ A;  3CFO A;  1S9E A;  1S6Q A;  3KKR A;  1UAX A;  2D0B A;  4OVL A;  4CER A;  4CJ5 A;  1SV5 A;  2YKM A;  1HYV A;  4DSI A;  4JS5 A;  3HT3 A;  2VG6 A;  4CK3 A;  3QEV A;  3LZI A;  1IH7 A;  1RCH A;  5FRN A;  4Z4G A;  3OYI A;  4DTP A;  3NAE A;  2FBY A;  1BGX T;  2IAJ A;  3K5O A;  4KV8 A;  1KLN A;  1QHT A;  3SYZ A;  1WSG A;  2D5R A;  2X6N A;  3V1O A;  4FJ5 A;  1LV5 A;  3DM2 A;  4DQS A;  1TAU A;  4AHU A;  4E0D A;  1RT3 A;  1U45 A;  2R7Y A;  3CFP A;  1SL0 A;  1WSF A;  4NYN A;  1J54 A;  1CXQ A;  2D0C A;  1IO2 A;  3SJJ A;  4KB1 A;  4WE1 A;  3AV9 A;  2KQ2 A;  1REV A;  4CHQ A;  4DLG A;  4IFY A;  3QEI A;  4K8X A;  3LWL A;  4AHV A;  1VSD A;  4KHY A;  1RT2 A;  5E41 A;  3SQ4 A;  4H4O A;  4K8Z A;  3A2F A;  3LP1 A;  3V9X A;  1S1W A;  4DS4 A;  2Y1I A;  1BCO A;  1EXQ A;  4OKK A;  3VQ4 A;  3BDP A;  1WLJ A;  1YTA A;  4CJS A;  3OYM A;  3NHG A;  2HHT A;  1EKE A;  4CJP A;  1JLG A;  2O4G A;  3SV4 A;  3AO5 A;  4CJV A;  3D0P A;  2E6M A;  3IS9 A;  4ZHR A;  2XY5 A;  4LY7 A;  3OYJ A;  4BDZ A;  2P5O A;  1QTM A;  4FK0 A;  3KKS A;  1ZBU A;  3H08 A;  4DFK A;  1IG9 A;  2P5G A;  5KRT A;  3OVN A;  4C8L A;  4CEE A;  3DMJ A;  4F3T A;  1B92 A;  2YHA A;  4KHQ A;  4B9S A;  4DQQ A;  1T7P A;  4E1M A;  3LPT A;  4HUG A;  4FJI A;  2JLE A;  3V1R A;  2HHU A;  3AVL A;  4MFB A;  1WSH A;  3HM9 A;  4FJG A;  1ZBH A;  1NK7 A;  1TK0 A;  3KK3 A;  2ZD1 A;  2IOC A;  3TAG A;  3ZSQ A;  4OKJ A;  3OYL A;  3DOK A;  3C94 A;  2E6L A;  4DSF A;  1D9D A;  2HMI A;  1KSP A;  2G8W A;  3THV A;  3V9W A;  4HCC A;  3QES A;  5DMR A;  1JKH A;  3O4Q A;  4M42 A;  4DTN A;  4DSJ A;  2XO7 A;  4LH5 A;  4DFM A;  1BI4 B;  3DLK A;  1K6Y A;  1U49 A;  2VG5 A;  4DQI A;  3NF7 A;  5J2M A;  1KFS A;  2X78 A;  1RT4 A;  4CF0 A;  5I42 A;  3JYT A;  1RTJ A;  5K14 A;  1EP4 A;  1TKD A;  4IFV A;  1BHL A;  1C0M A;  1FXX A;  1GOA A;  4CGD A;  3KJV A;  3SUQ A;  4BAC A;  5KGX A;  5SWM A;  1NJW A;  1KFD A;  3CG7 A;  4RW4 A;  2GBZ A;  1N6Q A;  3QIO A;  4M3X A;  1NJX A;  4R5P A;  1TV6 A;  1L3S A;  4OKE A;  1RDB A;  3TAM A;  3KK2 A;  1XI1 A;  4F2R A;  3I8D A;  1QSS A;  1TL1 A;  3ZT3 A;  2KW4 A;  4NYF A;  1JLQ A;  1LW2 A;  2HB5 A;  4I2P A;  3NGZ A;  4E3S A;  1KRP A;  2PY5 A;  4AIL C;  4BDP A;  3E01 A;  4E89 A;  5C25 A;  1JLC A;  4N41 A;  1VSK A;  4CHO A;  4RW6 A;  3NGI A;  3WNH A;  3HPG A;  3QEP A;  1SKS A;  2OPS A;  4CK1 A;  2BE2 A;  3VQQ A;  4HTU A;  3DRS A;  4E7H A;  2W42 A;  1T03 A;  2KZZ A;  4Z4C A;  2RN2 A;  3L2Q A;  4DTO A;  3RMC A;  2HHV A;  1VSM A;  4PQU A;  2Z1G A;  3AA4 A;  5CY4 A;  3PX6 A;  2QK9 A;  2EX3 A;  2IDO A;  4FZX C;  4CGI A;  4DQP A;  4W5Q A;  1B9F A;  1I3A A;  2B4J A;  4FLV A;  3ZSX A;  2OZS A;  4F8R A;  3KLE A;  4FVM A;  3LWM A;  1NK5 A;  2ITG A;  3HST B;  3KLG A;  1NJZ A;  3NH0 A;  1LWE A;  1TVR A;  4CJE A;  4DTX A;  1ZBF A;  3MEC A;  4KPY A;  3DRR A;  5HLF A;  4KI6 A;  3VA0 A;  3HVR A;  2Z1H A;  4CFD A;  1HNI A;  3LDS A;  4J2A A;  1C0U A;  3VQ7 A;  5HRS A;  4CHN A;  3L8B A;  3G0Z A;  3NE6 A;  3AVF A;  4BDY A;  4E7L A;  3PO5 A;  1NKB A;  1LWC A;  3AVM A;  3VQD A;  3ALY A;  5J2P A;  4GVM A;  4C8M A;  1KLM A;  1JXB A;  4B9N A;  4ICL A;  1UOC A;  1S5J A;  3LP2 A;  2IGI A;  4Z0U A;  1IKW A;  1RBR A;  3C6U A;  3QIP A;  4O4G A;  3P5J A;  4M45 A;  3K5M A;  1NK4 A;  1Q9Y A;  4ELT A;  4M3W A;  2HHX A;  4W5N A;  2Z1J A;  4KKO A;  4CIG A;  1JLE A;  3SUP A;  3L2R A;  3QEW A;  3LAN A;  2BDP A;  2G8U A;  3TWH A;  1JL1 A;  1TAQ A;  4DFJ A;  3RMD A;  4ZTJ A;  4AH9 A;  3SPZ A;  1VSF A;  4FLT A;  4CJ4 A;  1UA0 A;  4C8N A;  2HW3 A;  4I2Q A;  4QOZ B;  3CYM A;  4FLX A;  1L3T A;  4C8O A;  1VK0 A;  2HNY A;  3KD5 E;  1T8E A;  3LAK A;  2IC3 A;  3PV8 A;  3ZT1 A;  4ZTF A;  1L3U A;  3ASM A;  4W5R A;  3TAE A;  1XHX A;  4JLH A;  1J53 A;  3NH1 A;  4B9L A;  3O3G A;  4FJ7 A;  4DF8 A;  4O0J A;  3AO2 A;  4AHS A;  5C42 A;  4FJK A;  2QKK A;  4KHS A;  1BIU A;  3KD1 E;  3HPH A;  4FJL A;  4IG3 A;  4H8K A;  1W0H A;  3AVG A;  3KLF A;  1J9A A;  4CHP A;  3RR7 A;  3KTQ A;  1S1X A;  3HK2 A;  3TAB A;  1NK9 A;  2E4L A;  2X6S A;  4EZ6 A;  2WOM A;  3LPU A;  3VQB A;  3DYA A;  1F21 A;  3T19 A;  3L2U A;  5I3U A;  1J5O A;  4OLB A;  1A5V A;  4CF2 A;  5FDL A;  4B8A B;  4ELU A;  3UIQ A;  1JLB A;  4FXD A;  3K5L A;  3OS1 A;  4CF8 A;  4CJR A;  4DTR A;  1S9G A;  3V4I A;  3NDK A;  1Q9X A;  3RWU A;  2ZQB A;  4M3T A;  5J1E A;  3QET A;  4Y1D A;  4KRE A;  1LAV A;  1RTI A;  1A5W A;  3T1A A;  3SQ1 A;  3DLH A;  4FZZ A;  4KHW A;  3MED A;  3AA2 A;  2OA8 A;  2VG7 A;  5CZ1 A;  1RIL A;  1EX4 A;  4Z4H A;  4CHY A;  1SKR A;  1BI4 A;  1RDA A;  2NUB A;  3VQ5 A;  4CIE A;  3ZSR A;  2HNZ A;  3RMB A;  4DSE A;  2OPP A;  2GUI A;  2KFZ A;  3PO4 A;  1L5U A;  5FRO A;  2XY6 A;  1SL2 A;  1NK6 A;  3OYB A;  4DTJ A;  3BGR A;  4BWJ A;  3HO1 A;  1KVA A;  1WSI A;  3T3F A;  3S3O A;  1YT3 A;  2QKB A;  3VQ9 A;  3AVK A;  3TAF A;  4J2D A;  1KTQ A;  3SNN A;  5C24 A;  3S9H A;  3RTV A;  3TAR A;  1QSY A;  4B9M A;  4CFC A;  3U3Y A;  4DQR A;  2DFE A;  4KHN A;  4FLZ A;  1KCF A;  2JGU A;  3V9U A;  4KTZ A;  1B9D A;  1TK5 A;  2YHB A;  4CE9 A;  1S1T A;  4B8C A;  2Z1I A;  3QEX A;  3L3V A;  4JRQ A;  1D5A A;  4KTW A;  4Z4E A;  3V1Q A;  3DRP A;  1S1V A;  2WON A;  5JS2 A;  4EP4 A;  3M8Q A;  3NF6 A;  3LAL A;  4HVJ A;  4IBN A;  2Y1J A;  3OYN A;  1LWF A;  1HPZ A;  2KFN A;  4DLE A;  3ZSW A;  1FKO A;  1Z26 A;  4B3O A;  3MXJ A;  3AA5 X;  2KZM A;  4CGF A;  4RW8 A;  1JLF A;  3AVJ A;  3RMA A;  1D9F A;  2O4I A;  1YVU A;  3SPY A;  2BAN A;  4KO0 A;  1DLO A;  5SZT A;  3F73 A;  4HUE A;  4CGJ A;  4DS5 A;  1VRT A;  4N47 A;  1XHZ A;  1RTD A;  2G8I A;  4OJR A;  1RBS A;  2RF2 A;  4KRF A;  3AVH A;  4FM1 A;  3MEG A;  4FLU A;  4E7K A;  3ZT0 A;  4O5B A;  4E7J A;  2HHS A;  5FRM A;  3CM5 A;  3CM6 A;  3K2P A;  2YKN A;  3QIN A;  1ZBI A;  3TR8 A;  1IKY A;  4IKF A;  1YTU A;  1RBT A;  4CJT A;  3B6O A;  1U48 A;  5DK5 A;  1U47 A;  4B9U A;  2FBV A;  2LSN A;  3O4N A;  3EZ5 A;  2IS3 A;  1RDD A;  4O55 A;  1UA1 A;  5J2N A;  5JS1 A;  1ASW A;  3HVT A;  3LZJ A;  3AO1 A;  4B08 A;  4Z4I A;  4PY5 A;  2ZE2 A;  4CEA A;  3OS0 A;  1VSH A;  1CXU A;  5KI6 A;  4KTQ A;  1WAF A;  1BIS A;  4W5T A;  1O1W A;  2YNH A;  4FJH A;  3I0R A;  1HQU A;  1SUQ A;  3EYZ A;  3V6D A;  1NOY A;  5KTQ A;  3HYF A;  2OPQ A;  4Y1C A; 
#chains in the Genus database with same CATH topology
 2XHB A;  1GLA G;  3GDQ A;  4H5W A;  3ZSV A;  2WTU A;  4FSV A;  3G6E N;  2YNF A;  4DFP A;  1RBU A;  3E66 A;  3KZB A;  1NKE A;  4OGC A;  4B3S K;  3SI6 A;  4M3Y A;  1NK0 A;  4H0V B;  1HYZ A;  3RRG A;  2BGG A;  3S3M A;  3KIO A;  2DFF A;  4YFU A;  4LC9 B;  4A2A A;  1YIJ N;  3MN6 A;  1Y64 A;  4KAZ A;  2XY7 A;  5AQU A;  3WNE A;  3VF4 A;  3KLH A;  3M8P A;  3QNN A;  2G8V A;  4L8R B;  1RTH A;  1BA1 A;  1QSL A;  4FWM A;  4CCH A;  4NCG A;  1TKX A;  4BR0 A;  5HOO A;  1NGJ A;  4FW1 A;  5AQK A;  1DTQ A;  1HKB A;  2QWM A;  1OH6 A;  3ISN C;  3CCR N;  4CJU A;  4FJM A;  1RBV A;  4FYD A;  4CZL A;  4JKB A;  5BN9 A;  1U2V B;  2PYL A;  4RW7 A;  3QO9 A;  5AFU H;  2F7T A;  3DWL A;  2Q0U A;  1HJR A;  4JKH A;  3A8Y A;  3D7E O;  4JKD A;  3AO3 A;  4JKG A;  1T05 A;  3VN5 A;  5EXW A;  3K9K A;  4CJQ A;  4FM0 A;  2F96 A;  2KTQ A;  3MN5 A;  4YOX A;  1LCU A;  4RCH A;  1K8A O;  1E3M A;  4JV5 K;  2CGK A;  1TL3 A;  3OS2 A;  4RG8 A;  3KWG A;  3DLR A;  1WSJ A;  5M1P A;  3Q7B A;  4CJK A;  1TK8 A;  1QVF M;  2O8F B;  4I7F A;  3HBT A;  4M3R A;  2UUC K;  1ZYQ A;  1SZ2 A;  4JRP A;  3THW A;  1DTT A;  1NJY A;  3VPZ A;  2HHW A;  3NBP A;  2OZM A;  3VQ8 A;  3AGR A;  3CET A;  3AVA A;  3CD6 N;  2O8E B;  4YOR A;  4EP5 A;  1HLU A;  1V4T A;  3ZEU B;  3WXL A;  1TKZ A;  4O0I A;  4I9L A;  1VQO N;  3VQ6 A;  2WFB A;  2F8T A;  4JI3 K;  3OYC A;  1IV0 A;  2VYP A;  4NXM K;  4RTF D;  4EHU A;  1Z05 A;  5E84 A;  1YHQ N;  3QNO A;  3TI0 A;  1HR0 K;  1NBW A;  3D2F A;  5EU7 A;  3S3N A;  4M3U A;  1VQL N;  1HYS A;  3NFA A;  2GV9 A;  3C95 A;  3C7N A;  1MU2 A;  1JLA A;  4DR2 K;  4DTS A;  3QLH A;  2ZJR L;  3KVG A;  4CK2 A;  4H0P A;  3V81 A;  1BU6 O;  4MDB A;  3ZSZ A;  3WUH A;  1Q86 O;  3PIO L;  3AVI A;  1KVC A;  3AA3 A;  2OPR A;  4M41 A;  1GOC A;  3CCJ N;  3ATV A;  1VRU A;  4B1U B;  1NOZ A;  2OYQ A;  3M5R A;  5HRP A;  3ZCM A;  4PL8 A;  4WF9 L;  3VGM A;  4ILJ A;  3C6T A;  1VAZ A;  4B1X B;  3LM2 A;  3O3F A;  2QWL A;  5AQX A;  3H6E A;  3WEE A;  4CJF A;  2P9I B;  5T7B A;  3HM8 A;  4DR6 K;  3ZSY A;  2A41 A;  3AO4 A;  3LDP A;  3AVN A;  1X9W A;  3JSM A;  1X9J A;  4CZH A;  4JAX A;  2X74 A;  4RWT A;  4GV3 A;  4ID1 A;  3OJS A;  1QHA A;  3PSF A;  3EE8 A;  3L6Q A;  3D45 A;  1TKT A;  4M3Z A;  4BRA A;  1I39 A;  4O5F A;  1C0T A;  2OAN A;  1S6Q A;  4OVL A;  3CC2 N;  1SV5 A;  2VCP A;  4DSI A;  1JCF A;  3BZC A;  3E1Y A;  3CCS N;  4CZF A;  5FRN A;  1KC8 O;  1KLN A;  3ATU A;  4R79 A;  4FJ5 A;  2W40 A;  5M1F A;  4E0D A;  2BH1 A;  1SL0 A;  3UKU A;  1WSF A;  4NYN A;  1J54 A;  1CXQ A;  3TSU A;  2ZJP L;  4WE1 A;  1BWF O;  3QEI A;  2P9K B;  4CBW A;  3ZX0 A;  4YOU A;  3V9X A;  5M1O A;  1EXQ A;  3WT0 A;  4XH1 A;  3E9O A;  1IG8 A;  2HHT A;  3NHG A;  4NXN K;  1JLG A;  3IS9 A;  2XY5 A;  1T6C A;  4LY7 A;  4MO5 A;  4CW7 B;  2YHX A;  3H08 A;  4H0O A;  4CEE A;  4H5N A;  1RGI A;  3TTF A;  2HBK A;  3V1R A;  1WSH A;  4FJG A;  2CH5 A;  1YIT N;  4ISG A;  4O8U A;  3J7Z O;  2NZT A;  1LOT B;  3V9W A;  4HCC A;  4FPB A;  1JKH A;  3O4Q A;  3OW2 M;  4K41 A;  4JI2 K;  4DFM A;  1BI4 B;  3LM9 A;  2QM1 A;  5HL7 L;  2VG5 A;  1KFS A;  1RT4 A;  3CJ9 A;  5K14 A;  5GIN A;  4JKA A;  1C0M A;  2GEM A;  3R8E A;  3VEN A;  1KFD A;  4RW4 A;  2P9N B;  1RDB A;  3OBW A;  4BR7 A;  4NYF A;  2HB5 A;  4I2P A;  3NGZ A;  3THW B;  3O4W A;  3QBX A;  3I55 N;  4N41 A;  1VSK A;  2E20 A;  2CGL A;  4JD2 A;  4DR3 K;  2BE2 A;  2NRR A;  2P9S B;  3L2Q A;  3RMC A;  1VSM A;  2Z1G A;  5ADX H;  5CY4 A;  3CCU N;  1C0G A;  3IMX A;  2IDO A;  5LMN K;  4JK8 A;  4CGI A;  1I3A A;  2B4J A;  3SBG A;  3FZH A;  4PKG A;  3ZSX A;  4F8R A;  3LWM A;  1NK5 A;  2ITG A;  3HST B;  3KLG A;  4JKC A;  1LWE A;  1TVR A;  4DTX A;  3DRR A;  4KI6 A;  3CIP A;  1N34 K;  1C0U A;  3AVF A;  3AVM A;  4MO4 A;  3VQD A;  3ALY A;  1S5J A;  1OH8 A;  4Z0U A;  1RBR A;  4O4G A;  4KRE A;  4M3W A;  3C7N B;  2HHX A;  1NK4 A;  1FW6 A;  2Z1J A;  1GLJ O;  1TAQ A;  1ATR A;  1VSF A;  4FLT A;  3H1V X;  1L3T A;  1S3X A;  3KD5 E;  3LAK A;  4W5R A;  1D4X A;  4JLH A;  1RFQ A;  4B9L A;  3O3G A;  4BQZ A;  5EVZ A;  2QKK A;  1BIU A;  3U8X A;  3KTQ A;  3HK2 A;  3FZL A;  4DUZ K;  3BP8 A;  1NK9 A;  2X6S A;  3U9Z A;  3C0B A;  3VQB A;  3A5O C;  1QZ6 A;  5AQV A;  1YXQ A;  4GY2 B;  4B8A B;  4ELU A;  3H1Q A;  5AZJ B;  3OS1 A;  4M3T A;  3RWU A;  4UY8 O;  2V51 B;  2ZQB A;  3BY5 A;  1RTI A;  5BRE A;  1A5W A;  3UB5 A;  3MED A;  5AZI A;  5CZ1 A;  1RDA A;  2NUB A;  3RMB A;  2GUI A;  4BRG A;  4DV5 K;  2OCE A;  2A3Z A;  1NWK A;  1NGH A;  3VQ9 A;  5EY4 A;  3SNN A;  4YY3 K;  4GNI A;  4B9M A;  1S72 N;  3U3Y A;  4WQ4 A;  3P4I A;  3M6G A;  4KTZ A;  1E4G T;  2YHB A;  4CE9 A;  4B8C A;  3VEY A;  2P9U A;  1G99 A;  2ASP A;  4FWK A;  4JRQ A;  3UKR A;  3WXM B;  3DRP A;  5KPT A;  4OX9 K;  4EP4 A;  3ID6 A;  3M8Q A;  4BRH A;  1HPZ A;  4DLE A;  2A40 A;  1FKO A;  1Z26 A;  4B3O A;  4FO0 A;  3IKM A;  3ID8 A;  4RW8 A;  3RMA A;  1D9F A;  3SPY A;  5GAH P;  1DLO A;  4DS5 A;  3F73 A;  4DHY A;  4OJR A;  2RF2 A;  4FWQ A;  1XMQ K;  3ZT0 A;  4A2B A;  5EOY A;  2QWP A;  2YHY A;  3TR8 A;  2WC9 A;  1RBT A;  1U48 A;  4B9U A;  2FBV A;  3EZ5 A;  3O4N A;  4I6M B;  1UA1 A;  4KHP K;  4Z4I A;  3O9T A;  1ILY A;  4CEA A;  1VSH A;  3LDL A;  4IZ9 A;  1WAF A;  1BIS A;  3E9P A;  3L0Q A;  2YNH A;  2A6A A;  4CBU A;  3EYZ A;  2OPQ A;  3N4Q A;  3DXK B;  4ELV A;  1NMN A;  3Q7C A;  3F9K A;  2A1R A;  3G10 A;  2VGM A;  3VQA A;  4BQL A;  1W9H A;  4DMN A;  1D8Y A;  2QEX N;  4OPK A;  4A61 A;  3OYD A;  1ESV A;  2ATQ A;  1X3M A;  4LF7 K;  4B9V A;  1WBB A;  3TSP A;  3H3O B;  4NCA A;  5BRH A;  5CYM A;  3IG1 A;  4CED A;  3OY9 A;  2B5J A;  4JD2 B;  2Q3S A;  5M1N A;  4C8K A;  2P1J A;  2YNG A;  3VQC A;  4LFC K;  4QAG A;  3D6R A;  1K8K A;  4AHT A;  3WXI A;  3EL2 A;  1N33 K;  1C1A A;  5AJ3 K;  4FZY A;  1IKV A;  1X1P A;  3MX5 A;  4IJN A;  3OBY A;  2P9P A;  5MLC Q;  4CZE A;  3QB0 A;  4BE0 A;  4CF1 A;  1RNH A;  4Y0W A;  2FSJ A;  5KQ8 A;  2W6K A;  2QXF A;  4JI6 K;  3CC4 N;  4F3O A;  2DTU A;  2HMP A;  3WNG A;  3IUC A;  4AHC A;  3QER A;  3K59 A;  4LF9 K;  1J6Z A;  4WYB A;  5EX5 A;  2HVI A;  3C65 A;  4BRE A;  4HTL A;  4CFA A;  3T69 A;  1BL3 A;  4OPH A;  4Q5V A;  4KH4 A;  2EHG A;  1ZBL A;  1V4S A;  3F2K A;  3SBT A;  3HL8 A;  4FJ9 A;  4LSL A;  4I9Q A;  1YAG A;  4BVP A;  3MDQ A;  4ISE A;  4FLW A;  2UXC K;  3SV3 A;  4GV6 A;  1VSE A;  1OVY A;  3CI5 A;  1HX1 A;  4KI4 A;  4F2S A;  1VSI A;  1NKC A;  3THY A;  1IBL K;  3EE9 A;  5AZI B;  3WQU A;  4CES A;  4FJX A;  4J2B A;  4CJL A;  3VF6 A;  4GVE A;  2ASM A;  4CZM A;  3K57 A;  3CCV N;  2F8S A;  4G1Q A;  1EWR A;  3ULE A;  3OJU A;  1VSJ A;  4MLE A;  3FE1 A;  3O1B A;  1QS4 A;  2W41 A;  1ITG A;  1O13 A;  1NU0 A;  4DQ8 A;  2HVH A;  4IG0 A;  2PYJ A;  5J2Q A;  3D2E B;  4ILG B;  1NGB A;  3UKR B;  3P1G A;  5KRS A;  3J81 O;  3SZ2 A;  3TAN A;  1YJN N;  4BR5 A;  5GAG P;  1Z6R A;  2CH6 A;  2DFH A;  3WNF A;  1GLD G;  3JAM O;  1NGG A;  4GW6 A;  4NB4 A;  4CFB A;  5LJW A;  4A5B A;  3AGK A;  2WBN A;  4EFH A;  4XIU A;  4FCY A;  2RKI A;  1BIZ A;  4CEF A;  3W3D A;  1P8Z A;  3CJA A;  3U6F A;  1FKP A;  5KPZ A;  4MDA A;  4BWM A;  1K9M O;  4ILH A;  4Z94 A;  4HWI A;  3SLC A;  3MXM A;  2B6A A;  4A57 A;  4LH4 A;  3CFO A;  1UAX A;  4IOX A;  1HYV A;  3WXJ A;  4JS5 A;  3HT3 A;  4DCH A;  4CK3 A;  3NMU A;  1IH7 A;  3A5M C;  4DTP A;  3SAF A;  1BGX T;  1QVG M;  3HTV A;  3O6W A;  4YOY A;  4H5T A;  1GLB G;  1WSG A;  2X6N A;  3THX A;  3JS6 A;  1LV5 A;  4PL7 A;  4E1J A;  2R7Y A;  1IO2 A;  4JHD A;  1REV A;  2IVP A;  3VGK A;  4DLG A;  3TTC A;  1Q82 O;  4AHV A;  4BRD A;  3H3N O;  4K8Z A;  2E8A A;  3A2F A;  3LP1 A;  1S1W A;  4OKK A;  3VQ4 A;  3TTD A;  4BC5 A;  1YTA A;  4KBO A;  3ENO A;  3MCA B;  1ATN A;  2O8B A;  4CJV A;  2V52 B;  3OYJ A;  2YHW A;  2P5O A;  5AQI A;  1U6Z A;  3KKS A;  1EQY A;  4C8L A;  1K8K B;  2E88 A;  3OVN A;  5JVH L;  4F3T A;  4BRQ A;  2YHA A;  5CHI A;  4B9S A;  4DQQ A;  2NRT A;  3AVL A;  1M90 O;  3H45 C;  4IO9 L;  4DV6 K;  1OVQ A;  3TAG A;  2IOC A;  3ZSQ A;  3F5T A;  4OKJ A;  3OYL A;  1D9D A;  5F1X A;  3QES A;  5DMR A;  1NM1 A;  4DTN A;  2XO7 A;  3O9S A;  1U49 A;  2X78 A;  4BR9 A;  4CF0 A;  1JCG A;  5DM6 L;  3JYT A;  2O8C A;  2GWJ A;  1GLE G;  1TKD A;  1BHL A;  3VEW A;  3CHW A;  4BAC A;  5KGX A;  4M3X A;  1N6Q A;  3CG7 A;  3B8A X;  3QIO A;  2QWO A;  1NGD A;  1L3S A;  1XI1 A;  3TAM A;  3KK2 A;  4FOI A;  3I8D A;  3P39 A;  1KRP A;  5GIP A;  4YOV A;  4BC2 A;  5C25 A;  1JLC A;  4CHO A;  3HRG A;  3NGI A;  3WNH A;  3HPG A;  3NVK A;  4HTU A;  4JK7 A;  3VQQ A;  3DRS A;  2KZZ A;  2RN2 A;  4IJA A;  3SAH A;  2HHV A;  4PQU A;  3MN9 A;  3AA4 A;  3PX6 A;  2QK9 A;  2YJF A;  4FZX C;  4ISF A;  5KQD A;  5CR4 A;  4FLV A;  1NJZ A;  4FWO A;  3NH0 A;  4DV2 K;  5HLF A;  3HVR A;  3LDS A;  4J2A A;  1I94 K;  3G0Z A;  4BDY A;  4DV4 K;  1LWC A;  4FWL A;  4BRP A;  4XH4 A;  4GVM A;  4C8M A;  1KLM A;  4ICL A;  2NRZ A;  3LP2 A;  4B9Q A;  2IGI A;  1Q9Y A;  4M45 A;  4C1N I;  4W5N A;  4KKO A;  3L2R A;  1XNR K;  4DFJ A;  1MA9 B;  2OTJ N;  4AH9 A;  3MMV A;  3SPZ A;  4JI0 K;  4BGA A;  3O9R A;  4C8N A;  1NGE A;  4I2Q A;  4QOZ B;  4FLX A;  1TYQ A;  1T8E A;  3KWI A;  5CE3 A;  2IC3 A;  4ZTF A;  1L3U A;  2V7Y A;  5C12 A;  3NH1 A;  4FJ7 A;  4KHS A;  3L4I A;  3HPH A;  4FJL A;  4IG3 A;  4H8K A;  1J9A A;  1GLC G;  3TAB A;  2E4L A;  4B1W B;  2WOM A;  3DYA A;  4H5R A;  3L2U A;  5I3U A;  1BOT O;  2AP1 A;  4DV3 K;  2E2Q A;  4PKI A;  4A59 A;  4FXD A;  1T3V A;  4CF8 A;  4DTR A;  1S9G A;  3V4I A;  4Y1D A;  3CPW M;  4FZZ A;  3SJH A;  1XC3 A;  2VG7 A;  4DR4 K;  1RIL A;  1KXP A;  4CHY A;  5F0X A;  5BRD A;  3VQ5 A;  3ZSR A;  2HNZ A;  4OO1 J;  5IWA K;  1SL2 A;  1ZBS A;  3ZYY X;  4DTJ A;  3LL3 A;  1WSI A;  1YT3 A;  1EWQ A;  5JIC A;  3AVK A;  3TAF A;  4JI5 K;  1MWK A;  4J2D A;  1KTQ A;  5C24 A;  3S9H A;  1QSY A;  4DQR A;  2DFE A;  4FLZ A;  4FWS A;  3V9U A;  3THX B;  1B9D A;  4CZI A;  3L3V A;  4BR2 A;  1D5A A;  1CZA N;  4JKG B;  4KTW A;  4Z4E A;  1FJG K;  3QBW A;  4JHD B;  4IBN A;  4JKE A;  4YOT A;  4JI1 K;  3MXJ A;  2KZM A;  3AVJ A;  2O4I A;  4IWV A;  2IVO A;  2NRH A;  4HUE A;  1XHZ A;  3ZET A;  4N47 A;  2G8I A;  1QZ5 A;  3MEG A;  4O5B A;  3K2P A;  3VER A;  3SK3 A;  1YTU A;  3RSE A;  1U47 A;  5AQZ A;  1ZC6 A;  3K9J A;  2UU9 K;  2IS3 A;  4O55 A;  5JS1 A;  3HVT A;  3LZJ A;  4CD1 A;  4PY5 A;  3OS0 A;  2ZJQ L;  1CXU A;  4KTQ A;  5AQH A;  3EO3 A;  2Q0R A;  4CZJ A;  1JJ2 M;  2P9L A;  3V6D A;  3HYF A;  1VQM N;  2HND A;  1VQK N;  2FBT A;  3MAQ A;  3LDN A;  3D2F B;  3PX4 A;  4CJ3 A;  4PUO A;  3SUN A;  4O44 A;  2UUA K;  1S22 A;  1Z25 A;  4HCB A;  3NH2 A;  2G8K A;  2VWK A;  3SMS A;  3MEE A;  1VQ8 N;  5LJV A;  3CJ7 A;  4CHZ A;  3DXM A;  4HUF A;  4FJJ A;  4J2E A;  3DI6 A;  4DSL A;  2XRI A;  4KB0 A;  4QS8 A;  1KVB A;  3I0S A;  3VA3 A;  5HRR A;  1VHX A;  3CQX A;  4EHT A;  4B1V A;  2FC0 A;  3O80 A;  3TSQ A;  3WEE B;  2DPN A;  1IBK K;  5KGW A;  1Q18 A;  2UXB K;  2QW9 A;  5AQP A;  3O08 A;  3LDQ A;  1LAW A;  1XNQ K;  3HJF A;  4RW9 A;  1IBM K;  3E9L A;  1RT5 A;  3W0L A;  4DU3 A;  1GOB A;  1C1B A;  1L3V A;  2GX9 A;  4NLB A;  5CYQ A;  4CIF A;  4EZ9 A;  1KAY A;  3L2W A;  4HHT A;  2QWN A;  4PA1 A;  4E1N A;  1FK9 A;  2A5X A;  1JL2 A;  3V9S A;  4H4M A;  1XQS C;  1KQS M;  5C2D A;  4LD0 A;  4FK2 A;  1W97 L;  1W7A A;  1XWL A;  3OYG A;  2GUP A;  5IT9 O;  5HBM A;  1N5Y A;  2QWR A;  4OPA A;  3FZM A;  3GE1 A;  4LSN A;  2HF3 A;  4WFA L;  4H0Y B;  2AJQ A;  4H0T B;  2FF6 A;  4Q0B A;  3UKU B;  3NF9 A;  4YDU A;  4FK4 A;  4AHR A;  3RRH A;  3K58 A;  4BRI A;  4CJW A;  4CEO A;  3VQE A;  3K5N A;  3CQ8 A;  5AQM A;  2E2N A;  4BRO A;  1XMO K;  3DLE A;  3GBT A;  3QFP A;  2D4W A;  2GEL A;  4IDK A;  4DSK A;  3AVB A;  1ASU A;  3PUF A;  3OA9 A;  4B3R K;  1XC9 A;  3CCM N;  4CF9 A;  2IVN A;  4KFB A;  3CFR A;  3MN7 A;  1Q8I A;  1HMV A;  3OYA A;  1ASV A;  1CLQ A;  4UQG A;  2P51 A;  1WN7 A;  3I56 N;  1SL1 A;  1BA0 A;  4LF5 K;  5JVG L;  2G8F A;  3MX2 A;  1C6V A;  3WQT A;  3HP9 A;  3KLI A;  4BGB A;  4ID5 A;  2D0A A;  3HZ6 A;  2G8H A;  4TSX A;  1HNV A;  5C2F A;  3EKS A;  3B6P A;  2HST A;  4IDH A;  4FM2 A;  3M3Z A;  3CJ1 A;  4FLY A;  3DLB A;  3EY1 A;  4DV1 K;  1RT6 A;  2ETJ A;  4FWP A;  1HNZ K;  3I33 A;  4GMJ B;  4DU1 A;  1DEJ A;  2JWK A;  3ZT2 A;  1IKX A;  1UWB A;  1RT7 A;  4DR7 K;  3V9Z A;  4K43 A;  4K25 A;  3PY8 A;  5AR0 A;  4YOW A;  3ZLJ A;  3FZK A;  3MXI A;  5DM7 L;  2PZS A;  3VQP A;  2QXL A;  1YJW N;  2PFU A;  5I9E B;  4DR5 K;  4N56 A;  4CEZ A;  2HHQ A;  1S9E A;  4CER A;  4GKJ K;  2YKM A;  3VEO A;  1YJ9 N;  3QEV A;  5LY3 A;  3BEX A;  2GTD A;  1SAZ A;  2FBY A;  3A5L C;  2O8F A;  2IAJ A;  1YUW A;  3K5O A;  3HSC A;  4KV8 A;  3VGL A;  2YJE A;  3S41 A;  2KLA A;  2ZWH A;  4B3T K;  3V1O A;  4C23 A;  3DM2 A;  1TAU A;  4AHU A;  4BVO A;  3CFP A;  5M1Q A;  1BO5 O;  3QDK A;  3RVC A;  2D0C A;  3DJC A;  4BRC A;  2HBJ A;  4BRK A;  3AV9 A;  2KQ2 A;  3VF2 A;  5BPM A;  2J4R A;  4IFY A;  3LWL A;  3DLL L;  1VSD A;  4KHY A;  4O8K A;  1RT2 A;  3CCQ N;  4JI8 K;  4H4O A;  4DS4 A;  3BDP A;  3CC7 N;  4F9O A;  3ZEU A;  3DXM B;  1XUP O;  5AQL A;  4WQ4 C;  3CER A;  2O4G A;  2QI2 A;  3AO5 A;  5AQS A;  4ZHR A;  3QFU A;  4FK0 A;  4YDU C;  5E26 A;  4DFK A;  2P5G A;  5KRT A;  4B1Y B;  2Q36 A;  3WXK A;  4KHQ A;  4E1M A;  4FJI A;  2W6L A;  2JLE A;  4MFB A;  1P90 A;  5BPN A;  1ZBH A;  1TK0 A;  1VQ4 N;  2PBD A;  3FR0 A;  2NNW A;  2ZD1 A;  3VET A;  5BR8 K;  4CZK A;  3DOK A;  3C94 A;  2E6L A;  2FXU A;  4BRM A;  3CF5 L;  2E2P A;  4M42 A;  3R9P A;  4LH5 A;  3DLK A;  1K6Y A;  3TU5 A;  3O9Q A;  3NF7 A;  3PIP L;  2FSN A;  2VWB A;  5C0Y A;  3PSI A;  2JWL A;  1EP4 A;  4IFV A;  3VTH A;  3SUQ A;  4L3Q A;  4JN4 A;  3SMP A;  2P9I A;  3T1H K;  1TV6 A;  2PAV A;  4F2R A;  5AQR A;  2NRV A;  1TL1 A;  3FFK B;  3ZT3 A;  2KW4 A;  2P9U B;  1JLQ A;  1LW2 A;  4BDP A;  1DKG D;  3E01 A;  4E89 A;  3J8A A;  3QEP A;  1SKS A;  2OPS A;  4CK1 A;  4E7H A;  2W42 A;  4WCE L;  4DTO A;  1T44 A;  4BC4 A;  1NJI O;  2E2O A;  4W5Q A;  1B9F A;  3C6H A;  1T6D A;  3KLE A;  4IOA L;  3JXU A;  4CJE A;  1ZBF A;  3T1Y K;  4CFD A;  5FPD A;  3VQ7 A;  4DUY K;  5HRS A;  4CHN A;  3BZK A;  5C10 A;  1NKB A;  5J2P A;  1JXB A;  4B9N A;  3C6U A;  1VQ9 N;  3P5J A;  4A62 A;  4CIG A;  2A42 A;  3SUP A;  2P9K A;  3QEW A;  2G8U A;  1YVN A;  4ZTJ A;  3M1F A;  5AQT A;  4CJ4 A;  1UA0 A;  1OKJ A;  1WB9 A;  4C8O A;  2HF4 A;  3ZT1 A;  2NRX A;  4LFB K;  5FPM A;  3TAE A;  4YHH K;  1J53 A;  5AQO A;  5C42 A;  3AO2 A;  4K42 A;  4AHS A;  3KD1 E;  3GG4 A;  1YI2 N;  1W0H A;  3RR7 A;  1S1X A;  3GOI A;  2FF3 B;  2HBL A;  4OLB A;  1A5V A;  2UUB K;  2YX6 A;  5FDL A;  3CPE A;  3HOS A;  5J1E A;  4FOE A;  4KHW A;  3DLH A;  3F9M A;  4NLC A;  2OA8 A;  4XH5 A;  3CJB A;  1SKR A;  5FLX O;  1BI4 A;  4X62 K;  4CIE A;  2KFZ A;  1L5U A;  5GAE P;  5FRO A;  4QS7 A;  1NK6 A;  3PLA A;  2QKB A;  4FWR A;  3QML A;  2P9P B;  4CFC A;  2P9N A;  3L4Q A;  1KCF A;  4IXC A;  4AQY K;  1DGK N;  3QEX A;  4KH6 A;  3U9D A;  4FL9 A;  4PKH A;  2WON A;  2E1Z A;  3NF6 A;  1MDU B;  3O5B A;  4HVJ A;  3OYN A;  2Y1J A;  2P9S A;  4V19 S;  2KFN A;  3P38 A;  3ZSW A;  3EZW A;  4C1N K;  4CGF A;  5BPL A;  1YVU A;  1NGF A;  4KO0 A;  1RTD A;  4CGJ A;  4KRF A;  3AVH A;  4FM1 A;  4FLU A;  4IO8 A;  4E7K A;  4E7J A;  3ZX3 A;  5FRM A;  3CM6 A;  1IKY A;  2O8D A;  1EO1 A;  3AY9 A;  3P31 A;  4CJT A;  4WQ5 A;  5GIO A;  2LSN A;  3FLC O;  1RDD A;  5J2N A;  5AQG A;  3R3L A;  3BUZ B;  4B08 A;  4M63 C;  3OTO K;  4JK9 A;  4W5T A;  2Q31 A;  4DV7 K;  3THY B;  4EIA A;  4FJH A;  3I0R A;  1NOY A;  4M7Y A;  3IFR A;  5KTQ A;  4ELT A;  3VTI A;  4DF4 A;  4YNQ A;  2H3G X;  1HUX A;  4U7B A;  3MWP A;  1GLL O;  3OYK A;  2Q97 A;  2QTD A;  1BG3 A;  1VQ6 N;  3ULE B;  1QQM A;  2RE2 A;  4BY9 C;  3QIC A;  3ZX2 A;  2FSK A;  1S6P A;  1HRH A;  1R0A A;  2ASO A;  1N36 K;  4BRN A;  5AZJ A;  1GLF O;  3DLG A;  1TGO A;  2F9T A;  4BC3 A;  3SCX A;  4B9T A;  2DY4 A;  1ATS A;  3KK1 A;  2VQE K;  3U3G A;  2OTL N;  3A5N C;  3K0S A;  4LFA K;  5C15 A;  3OYH A;  2HHH K;  5AQW A;  3HP6 A;  1WAJ A;  2I7N A;  4KHU A;  3RR8 A;  1Q7Y O;  3IAY A;  2YV0 X;  3R6M A;  3HXM A;  4DR1 K;  4PWD A;  3SUO A;  1QE1 A;  3ENB A;  2AA4 A;  3AAQ A;  2I5J A;  3KHY A;  4CGH A;  1X9S A;  3ENH A;  1HNW K;  2ZGY A;  1X9M A;  4E7I A;  1BCM A;  1NGC A;  4CEB A;  1RDU A;  1RT1 A;  4CEC A;  4U67 L;  5M1K A;  2CGJ A;  2HOE A;  2UYT A;  1NK8 A;  3MK6 A;  3ZT4 A;  4FW2 A;  3SQ2 A;  4LF4 K;  4N76 A;  1BQM A;  3BF3 A;  5AQY A;  4B1Z A;  4E19 A;  4FJN A;  5AQF A;  3M8S A;  4BE2 A;  1NG9 A;  1JCE A;  4NCB A;  1QQN A;  4IEE A;  3TAQ A;  1ZXO A;  4GV9 A;  1SKW A;  3L3U A;  1JXE A;  4DU4 A;  3OHR A;  5AQQ A;  1Y97 A;  3LP0 A;  2I7P A;  3FFI A;  3J7A P;  2Q1N A;  3P83 D;  3OYF A;  1U4B A;  4OPJ A;  4I6M A;  1NGI A;  2Q2R A;  4AM6 A;  5HRN A;  3M8R A;  1A5X A;  5F2R A;  1BQN A;  1WSE A;  4W5O A;  5AFU A;  4IOC L;  2XY8 A;  2KHO A;  5H1S Q;  3ULD A;  1KD1 O;  3LP3 A;  2O8B B;  1SS6 A;  4DTM A;  5HP1 A;  3R1X A;  4MQ3 A;  3CCL N;  1NNE A;  1CZ9 A;  3NGY A;  3OYE A;  3DXK A;  4JEP A;  5JMV A;  4BE1 A;  2NLX A;  2V7Z A;  2RPI A;  2FBX A;  3CQY A;  1U04 A;  4BG9 A;  4H0X B;  4QCL A;  4WQ5 C;  1WNS A;  4FVU A;  4CVN E;  4CJ7 A;  3TAP A;  4OLA A;  1VQ7 N;  4CGG A;  4DWI A;  1HJO A;  1QQC A;  3IRX A;  1S1U A;  4F4K A;  3BF1 A;  4FJ8 A;  1VSL A;  1LW0 A;  1N8R O;  1NLV A;  2E1Y A;  3AVC A;  4DKW A;  5D3G A;  2YNI A;  3ITH A;  1RDC A;  4X65 K;  3AAP A;  4CEQ A;  1W2B M;  3I8B A;  3HPO A;  1HQE A;  2VWJ A;  3L2V A;  4QS9 A;  4A5A A;  2RHK A;  1H1V A;  3FGU A;  4DTU A;  1C1C A;  2F4V K;  2O8C B;  4LF8 K;  1EET A;  5HRO A;  3DOL A;  3G71 N;  3ZSO A;  1G15 A;  3O3H A;  5CZ2 A;  1HKC A;  3PX0 A;  1E4F T;  3VEV A;  3N4P A;  3SQ0 A;  3VES A;  4OGE A;  4JS4 A;  4DG1 A;  3NCI A;  3UE5 A;  1HNX K;  2O8D B;  5A2Q O;  2NRW A;  3U4L A;  4IFE A;  1CZB A;  4N5S A;  1VQN N;  2ITM A;  3LAM A;  3NF8 A;  4Z4F A;  2A1S A;  4BRF A;  4X66 K;  2FLO A;  3SAG A;  3KKR A;  2D0B A;  2KKZ A;  4EAH D;  4CJ5 A;  2VG6 A;  3LZI A;  1RCH A;  4Z4G A;  3OYI A;  3NAE A;  2HBM A;  4H5V A;  4JI7 K;  3KK7 A;  1QHT A;  2VQF K;  3SYZ A;  2D5R A;  4WFB L;  2E5L K;  4DQS A;  5BRF A;  1Q81 O;  1RT3 A;  1U45 A;  1J5E K;  3SJJ A;  4KB1 A;  4CHQ A;  4DB3 A;  4K8X A;  2EWS A;  5E41 A;  1C0F A;  3LDO A;  3SQ4 A;  3G4S N;  2Y1I A;  1BCO A;  1K73 O;  1WLJ A;  1KAZ A;  2VGN A;  1TYQ B;  4CJS A;  3OYM A;  1EKE A;  4MLH A;  4CJP A;  4CI6 A;  3SV4 A;  4K0K K;  3D0P A;  2E6M A;  2YCH A;  4XEI A;  5B8H A;  4BDZ A;  1QTM A;  2BUP A;  1OH5 A;  1ZBU A;  1IG9 A;  3DMJ A;  1TUY A;  1B92 A;  5JLH A;  1T7P A;  4HUG A;  3LPT A;  2HHU A;  3HM9 A;  5BN8 A;  1NK7 A;  3CME N;  3KK3 A;  5AQN A;  5AQJ A;  5FPE A;  4DSF A;  2HMI A;  1KSP A;  2G8W A;  3THV A;  3D2E A;  5KPR A;  4AM7 A;  5BR9 A;  4M7X A;  1NMD A;  4CBX A;  4DSJ A;  4DQI A;  5J2M A;  1MWM A;  1NGA A;  3A0I X;  5I42 A;  1RTJ A;  1FXX A;  1GOA A;  4CGD A;  3KJV A;  5SWM A;  4X64 K;  1NJW A;  2GBZ A;  4PHT X;  1NJX A;  4R5P A;  4OKE A;  1QSS A;  5TKY A;  4E3S A;  2PY5 A;  4AIL C;  1VQP N;  4CD3 A;  4RW6 A;  2GWK A;  3O1W A;  4H03 B;  3VMF B;  2F9W A;  1T03 A;  4Z4C A;  2EX3 A;  1WUA A;  1QQO A;  4DQP A;  3G25 A;  2OZS A;  1YF5 L;  3DAW A;  4FVM A;  3ZET B;  1X3N A;  3MWT A;  5ELZ A;  4CZG A;  4KPY A;  3MEC A;  3VA0 A;  2Z1H A;  1HNI A;  4AF1 A;  3EN9 A;  4FPA A;  1WOQ A;  5TKW A;  1U2V A;  3NVM A;  4J8F A;  4BG8 A;  4BRL A;  3L8B A;  3NE6 A;  4E7L A;  3PO5 A;  1SQK A;  3RSE B;  1UOC A;  3VEZ A;  3C6A A;  4FWN A;  4LF6 K;  2UXD K;  1IKW A;  3QIP A;  2D0O A;  3K5M A;  2BTF A;  1JLE A;  2BDP A;  3LAN A;  3TWH A;  1JL1 A;  3RMD A;  4JKF A;  3FZF A;  4BR4 A;  2ZF5 O;  3EKU A;  2HW3 A;  2P9L B;  3CYM A;  1VK0 A;  1R59 O;  2D1K A;  2HNY A;  4JI4 K;  1VQ5 N;  3PV8 A;  3ASM A;  1IJJ A;  1XHX A;  5LMU K;  4DV0 K;  3VEX A;  2ZM6 K;  1WBD A;  5ADX A;  4DF8 A;  4O0J A;  4FJK A;  3IDH A;  5JLF A;  2IIR A;  3AVG A;  3KLF A;  4CHP A;  3T7Z A;  1TUU A;  4EZ6 A;  3LPU A;  4B3M K;  3CMA N;  1J5O A;  1F21 A;  3T19 A;  1BUP A;  2O8E A;  1KAX A;  4CF2 A;  3UIQ A;  5GAD P;  1JLB A;  3TPQ A;  4GKK K;  3K5L A;  4CJR A;  1Q9X A;  1HKG A;  3NDK A;  1N32 K;  2YI1 A;  3QET A;  1DT9 A;  1LAV A;  3T1A A;  3SQ1 A;  3AA2 A;  1EX4 A;  4Z4H A;  4JYA K;  4DSE A;  2OPP A;  3PO4 A;  2WUS A;  2QWQ A;  2XY6 A;  3O9U A;  3OYB A;  3BGR A;  4BWJ A;  3HO1 A;  1KVA A;  3T3F A;  3S3O A;  3HOT A;  3J80 O;  3TAR A;  3RTV A;  4KHN A;  2JGU A;  1TK5 A;  1S1T A;  2Z1I A;  3GL1 A;  3V1Q A;  1BDG A;  1S1V A;  5JS2 A;  3LAL A;  1LWF A;  3MCP A;  1HPM A;  3HI0 A;  2ZGZ A;  3J7Y P;  3AA5 X;  1JLF A;  5FPN A;  2BAN A;  5SZT A;  1M1K O;  1VRT A;  4G9Z A;  4WFN L;  1RBS A;  4NO7 A;  3O8M A;  2HHS A;  4KH5 A;  3CM5 A;  2YKN A;  3EEQ A;  3QIN A;  3CCE N;  1ZBI A;  2D0P A;  3H46 O;  4IKF A;  3VOV A;  3B6O A;  5DK5 A;  3CXC M;  4JNE A;  1ASW A;  3AAR A;  3AO1 A;  2ZE2 A;  1RDW X;  5KI6 A;  5LL6 Z;  1O1W A;  2QA4 N;  1HQU A;  1SUQ A;  3CJC A;  4IEI A;  1OH7 A;  4Y1C A; 
#chains in the Genus database with same CATH homology
 2HND A;  4DF4 A;  4YNQ A;  2XHB A;  4ELV A;  2FBT A;  3ZSV A;  3MAQ A;  3F9K A;  3PX4 A;  2A1R A;  4CJ3 A;  3OYK A;  4PUO A;  3G10 A;  3VQA A;  2YNF A;  1W9H A;  4DMN A;  4DFP A;  1D8Y A;  1RBU A;  4OPK A;  1NKE A;  4OGC A;  3SUN A;  4O44 A;  3SI6 A;  1Z25 A;  4HCB A;  1NK0 A;  1S6P A;  3NH2 A;  1HRH A;  2G8K A;  1HYZ A;  3RRG A;  2BGG A;  2VWK A;  3OYD A;  1R0A A;  3MEE A;  2ATQ A;  3S3M A;  3KIO A;  2DFF A;  4YFU A;  4B9V A;  4CHZ A;  4KAZ A;  4HUF A;  2XY7 A;  4FJJ A;  3DLG A;  1TGO A;  4J2E A;  4NCA A;  3WNE A;  3KLH A;  3DI6 A;  4DSL A;  5CYM A;  2XRI A;  3M8P A;  3SCX A;  3IG1 A;  4CED A;  3QNN A;  4B9T A;  2G8V A;  4KB0 A;  2DY4 A;  3KK1 A;  4L8R B;  1RTH A;  2B5J A;  3OY9 A;  2Q3S A;  1QSL A;  1KVB A;  3I0S A;  3U3G A;  4CCH A;  4NCG A;  1TKX A;  3VA3 A;  4C8K A;  5HRR A;  2P1J A;  2YNG A;  3VQC A;  3OYH A;  4QAG A;  4FW1 A;  4AHT A;  3HP6 A;  1DTQ A;  1WAJ A;  2FC0 A;  3ISN C;  4KHU A;  1C1A A;  4FZY A;  3RR8 A;  5KGW A;  3IAY A;  2YV0 X;  4CJU A;  3HXM A;  4FJM A;  1IKV A;  1X1P A;  4PWD A;  1RBV A;  4FYD A;  3SUO A;  1QE1 A;  1LAW A;  2PYL A;  4RW7 A;  2I5J A;  3QO9 A;  4BE0 A;  1HJR A;  4CGH A;  4CF1 A;  1RNH A;  1X9S A;  3HJF A;  4RW9 A;  1X9M A;  1RT5 A;  4DU3 A;  4E7I A;  1GOB A;  3AO3 A;  1BCM A;  1C1B A;  1L3V A;  1CLQ A;  2QXF A;  4CEB A;  1RT1 A;  5CYQ A;  3VN5 A;  4CEC A;  1T05 A;  4CIF A;  4M3Y A;  1NK8 A;  4EZ9 A;  4CJQ A;  4F3O A;  4FM0 A;  2F96 A;  2DTU A;  2KTQ A;  3L2W A;  3ZT4 A;  3WNG A;  4FW2 A;  4HHT A;  3SQ2 A;  4N76 A;  4AHC A;  3QER A;  3K59 A;  4PA1 A;  1BQM A;  4E1N A;  1TL3 A;  1FK9 A;  4E19 A;  1JL2 A;  3OS2 A;  3V9S A;  4FJN A;  4RG8 A;  3M8S A;  4BE2 A;  4H4M A;  4NCB A;  2HVI A;  3DLR A;  1WSJ A;  1TK8 A;  4CJK A;  3TAQ A;  4CFA A;  4I7F A;  4LD0 A;  4FK2 A;  1SKW A;  1XWL A;  3L3U A;  3OYG A;  1BL3 A;  5HBM A;  4Q5V A;  1JXE A;  4M3R A;  1N5Y A;  4DU4 A;  2EHG A;  4LSN A;  1ZYQ A;  4JRP A;  1ZBL A;  1DTT A;  2AJQ A;  1NJY A;  4Q0B A;  3NF9 A;  4FK4 A;  4AHR A;  1Y97 A;  3LP0 A;  3RRH A;  3HL8 A;  4FJ9 A;  2HHW A;  3K58 A;  3FFI A;  4LSL A;  4I9Q A;  3NBP A;  3P83 D;  3OYF A;  1U4B A;  4CJW A;  3VQ8 A;  4OPJ A;  4CEO A;  2OZM A;  3VQE A;  4FLW A;  3AVA A;  3K5N A;  5HRN A;  3CQ8 A;  3M8R A;  1A5X A;  3SV3 A;  4EP5 A;  1BQN A;  1WSE A;  4W5O A;  2XY8 A;  1TKZ A;  1VSE A;  3DLE A;  4O0I A;  4I9L A;  4KI4 A;  3ULD A;  4DSK A;  4IDK A;  4F2S A;  3LP3 A;  3VQ6 A;  1VSI A;  3AVB A;  1ASU A;  4DTM A;  1NKC A;  5HP1 A;  2F8T A;  3PUF A;  3OYC A;  4MQ3 A;  1XC9 A;  4CF9 A;  1CZ9 A;  3NGY A;  4CES A;  3OYE A;  4KFB A;  3QNO A;  4J2B A;  4FJX A;  3CFR A;  4CJL A;  4BE1 A;  3TI0 A;  1Q8I A;  1HMV A;  2FBX A;  1ASV A;  1U04 A;  2RPI A;  5EU7 A;  3OYA A;  4QCL A;  4UQG A;  1WNS A;  3K57 A;  3TAP A;  3S3N A;  4OLA A;  4M3U A;  2P51 A;  2F8S A;  4G1Q A;  1HYS A;  4CGG A;  3NFA A;  1QQC A;  2GV9 A;  3C95 A;  3IRX A;  3OJU A;  4DWI A;  1MU2 A;  1JLA A;  1S1U A;  1VSJ A;  4DTS A;  3QLH A;  4F4K A;  4CK2 A;  1WN7 A;  4FJ8 A;  1QS4 A;  1VSL A;  3V81 A;  1ITG A;  1LW0 A;  3ZSZ A;  3AVC A;  3AVI A;  2HVH A;  4IG0 A;  1SL1 A;  1KVC A;  2PYJ A;  5J2Q A;  5D3G A;  3AA3 A;  2YNI A;  2OPR A;  3ITH A;  1RDC A;  4M41 A;  1GOC A;  2G8F A;  1C6V A;  4CEQ A;  3HP9 A;  3KLI A;  3P1G A;  1VRU A;  5KRS A;  4ID5 A;  1HQE A;  1NOZ A;  2D0A A;  3HPO A;  3L2V A;  2VWJ A;  2OYQ A;  2G8H A;  5HRP A;  3ZCM A;  4TSX A;  3SZ2 A;  4DTU A;  3TAN A;  1C1C A;  1HNV A;  3C6T A;  3B6P A;  2DFH A;  3WNF A;  1EET A;  5HRO A;  3DOL A;  4FM2 A;  3ZSO A;  4GW6 A;  1G15 A;  3O3F A;  4CFB A;  3O3H A;  5CZ2 A;  4FLY A;  4XIU A;  3DLB A;  3EY1 A;  4FCY A;  4CJF A;  5T7B A;  2RKI A;  1BIZ A;  1RT6 A;  2ETJ A;  4CEF A;  3PX0 A;  3ZSY A;  3AO4 A;  4GMJ B;  4DU1 A;  3U6F A;  1FKP A;  3AVN A;  1IKX A;  1UWB A;  3ZT2 A;  3SQ0 A;  4OGE A;  4JS4 A;  4DG1 A;  3JSM A;  1X9W A;  1RT7 A;  3NCI A;  2X74 A;  4ID1 A;  3OJS A;  3V9Z A;  4BWM A;  3PY8 A;  3MXI A;  3D45 A;  2PZS A;  3VQP A;  1TKT A;  4M3Z A;  1CZB A;  4N5S A;  1I39 A;  3LAM A;  1C0T A;  3MXM A;  2B6A A;  3NF8 A;  4LH4 A;  4N56 A;  4Z4F A;  2A1S A;  4CEZ A;  2HHQ A;  3CFO A;  1S9E A;  1S6Q A;  3KKR A;  1UAX A;  2D0B A;  4OVL A;  4CER A;  4CJ5 A;  1SV5 A;  2YKM A;  1HYV A;  4DSI A;  4JS5 A;  3HT3 A;  2VG6 A;  4CK3 A;  3QEV A;  3LZI A;  1IH7 A;  1RCH A;  5FRN A;  4Z4G A;  3OYI A;  4DTP A;  3NAE A;  2FBY A;  1BGX T;  2IAJ A;  3K5O A;  4KV8 A;  1KLN A;  1QHT A;  3SYZ A;  1WSG A;  2D5R A;  2X6N A;  3V1O A;  4FJ5 A;  1LV5 A;  3DM2 A;  4DQS A;  1TAU A;  4AHU A;  4E0D A;  1RT3 A;  1U45 A;  2R7Y A;  3CFP A;  1SL0 A;  1WSF A;  4NYN A;  1J54 A;  1CXQ A;  2D0C A;  1IO2 A;  3SJJ A;  4KB1 A;  4WE1 A;  3AV9 A;  2KQ2 A;  1REV A;  4CHQ A;  4DLG A;  4IFY A;  3QEI A;  4K8X A;  3LWL A;  4AHV A;  1VSD A;  4KHY A;  1RT2 A;  5E41 A;  3SQ4 A;  4H4O A;  4K8Z A;  3A2F A;  3LP1 A;  3V9X A;  1S1W A;  4DS4 A;  2Y1I A;  1BCO A;  1EXQ A;  4OKK A;  3VQ4 A;  3BDP A;  1WLJ A;  1YTA A;  4CJS A;  3OYM A;  3NHG A;  2HHT A;  1EKE A;  4CJP A;  1JLG A;  2O4G A;  3SV4 A;  3AO5 A;  4CJV A;  3D0P A;  2E6M A;  3IS9 A;  4ZHR A;  2XY5 A;  4LY7 A;  3OYJ A;  4BDZ A;  2P5O A;  1QTM A;  4FK0 A;  3KKS A;  1ZBU A;  3H08 A;  4DFK A;  1IG9 A;  2P5G A;  5KRT A;  3OVN A;  4C8L A;  4CEE A;  3DMJ A;  4F3T A;  1B92 A;  2YHA A;  4KHQ A;  4B9S A;  4DQQ A;  1T7P A;  4E1M A;  3LPT A;  4HUG A;  4FJI A;  2JLE A;  3V1R A;  2HHU A;  3AVL A;  4MFB A;  1WSH A;  3HM9 A;  4FJG A;  1ZBH A;  1NK7 A;  1TK0 A;  3KK3 A;  2ZD1 A;  2IOC A;  3TAG A;  3ZSQ A;  4OKJ A;  3OYL A;  3DOK A;  3C94 A;  2E6L A;  4DSF A;  1D9D A;  2HMI A;  1KSP A;  2G8W A;  3THV A;  3V9W A;  4HCC A;  3QES A;  5DMR A;  1JKH A;  3O4Q A;  4M42 A;  4DTN A;  4DSJ A;  2XO7 A;  4LH5 A;  4DFM A;  1BI4 B;  3DLK A;  1K6Y A;  1U49 A;  2VG5 A;  4DQI A;  3NF7 A;  5J2M A;  1KFS A;  2X78 A;  1RT4 A;  4CF0 A;  5I42 A;  3JYT A;  1RTJ A;  5K14 A;  1EP4 A;  1TKD A;  4IFV A;  1BHL A;  1C0M A;  1FXX A;  1GOA A;  4CGD A;  3KJV A;  3SUQ A;  4BAC A;  5KGX A;  5SWM A;  1NJW A;  1KFD A;  3CG7 A;  4RW4 A;  2GBZ A;  1N6Q A;  3QIO A;  4M3X A;  1NJX A;  4R5P A;  1TV6 A;  1L3S A;  4OKE A;  1RDB A;  3TAM A;  3KK2 A;  1XI1 A;  4F2R A;  3I8D A;  1QSS A;  1TL1 A;  3ZT3 A;  2KW4 A;  4NYF A;  1JLQ A;  1LW2 A;  2HB5 A;  4I2P A;  3NGZ A;  4E3S A;  1KRP A;  2PY5 A;  4AIL C;  4BDP A;  3E01 A;  4E89 A;  5C25 A;  1JLC A;  4N41 A;  1VSK A;  4CHO A;  4RW6 A;  3NGI A;  3WNH A;  3HPG A;  3QEP A;  1SKS A;  2OPS A;  4CK1 A;  2BE2 A;  3VQQ A;  4HTU A;  3DRS A;  4E7H A;  2W42 A;  1T03 A;  2KZZ A;  4Z4C A;  2RN2 A;  3L2Q A;  4DTO A;  3RMC A;  2HHV A;  1VSM A;  4PQU A;  2Z1G A;  3AA4 A;  5CY4 A;  3PX6 A;  2QK9 A;  2EX3 A;  2IDO A;  4FZX C;  4CGI A;  4DQP A;  4W5Q A;  1B9F A;  1I3A A;  2B4J A;  4FLV A;  3ZSX A;  2OZS A;  4F8R A;  3KLE A;  4FVM A;  3LWM A;  1NK5 A;  2ITG A;  3HST B;  3KLG A;  1NJZ A;  3NH0 A;  1LWE A;  1TVR A;  4CJE A;  4DTX A;  1ZBF A;  3MEC A;  4KPY A;  3DRR A;  5HLF A;  4KI6 A;  3VA0 A;  3HVR A;  2Z1H A;  4CFD A;  1HNI A;  3LDS A;  4J2A A;  1C0U A;  3VQ7 A;  5HRS A;  4CHN A;  3L8B A;  3G0Z A;  3NE6 A;  3AVF A;  4BDY A;  4E7L A;  3PO5 A;  1NKB A;  1LWC A;  3AVM A;  3VQD A;  3ALY A;  5J2P A;  4GVM A;  4C8M A;  1KLM A;  1JXB A;  4B9N A;  4ICL A;  1UOC A;  1S5J A;  3LP2 A;  2IGI A;  4Z0U A;  1IKW A;  1RBR A;  3C6U A;  3QIP A;  4O4G A;  3P5J A;  4M45 A;  3K5M A;  1NK4 A;  1Q9Y A;  4ELT A;  4M3W A;  2HHX A;  4W5N A;  2Z1J A;  4KKO A;  4CIG A;  1JLE A;  3SUP A;  3L2R A;  3QEW A;  3LAN A;  2BDP A;  2G8U A;  3TWH A;  1JL1 A;  1TAQ A;  4DFJ A;  3RMD A;  4ZTJ A;  4AH9 A;  3SPZ A;  1VSF A;  4FLT A;  4CJ4 A;  1UA0 A;  4C8N A;  2HW3 A;  4I2Q A;  4QOZ B;  3CYM A;  4FLX A;  1L3T A;  4C8O A;  1VK0 A;  2HNY A;  3KD5 E;  1T8E A;  3LAK A;  2IC3 A;  3PV8 A;  3ZT1 A;  4ZTF A;  1L3U A;  3ASM A;  4W5R A;  3TAE A;  1XHX A;  4JLH A;  1J53 A;  3NH1 A;  4B9L A;  3O3G A;  4FJ7 A;  4DF8 A;  4O0J A;  3AO2 A;  4AHS A;  5C42 A;  4FJK A;  2QKK A;  4KHS A;  1BIU A;  3KD1 E;  3HPH A;  4FJL A;  4IG3 A;  4H8K A;  1W0H A;  3AVG A;  3KLF A;  1J9A A;  4CHP A;  3RR7 A;  3KTQ A;  1S1X A;  3HK2 A;  3TAB A;  1NK9 A;  2E4L A;  2X6S A;  4EZ6 A;  2WOM A;  3LPU A;  3VQB A;  3DYA A;  1F21 A;  3T19 A;  3L2U A;  5I3U A;  1J5O A;  4OLB A;  1A5V A;  4CF2 A;  5FDL A;  4B8A B;  4ELU A;  3UIQ A;  1JLB A;  4FXD A;  3K5L A;  3OS1 A;  4CF8 A;  4CJR A;  4DTR A;  1S9G A;  3V4I A;  3NDK A;  1Q9X A;  3RWU A;  2ZQB A;  4M3T A;  5J1E A;  3QET A;  4Y1D A;  4KRE A;  1LAV A;  1RTI A;  1A5W A;  3T1A A;  3SQ1 A;  3DLH A;  4FZZ A;  4KHW A;  3MED A;  3AA2 A;  2OA8 A;  2VG7 A;  5CZ1 A;  1RIL A;  1EX4 A;  4Z4H A;  4CHY A;  1SKR A;  1BI4 A;  1RDA A;  2NUB A;  3VQ5 A;  4CIE A;  3ZSR A;  2HNZ A;  3RMB A;  4DSE A;  2OPP A;  2GUI A;  2KFZ A;  3PO4 A;  1L5U A;  5FRO A;  2XY6 A;  1SL2 A;  1NK6 A;  3OYB A;  4DTJ A;  3BGR A;  4BWJ A;  3HO1 A;  1KVA A;  1WSI A;  3T3F A;  3S3O A;  1YT3 A;  2QKB A;  3VQ9 A;  3AVK A;  3TAF A;  4J2D A;  1KTQ A;  3SNN A;  5C24 A;  3S9H A;  3RTV A;  3TAR A;  1QSY A;  4B9M A;  4CFC A;  3U3Y A;  4DQR A;  2DFE A;  4KHN A;  4FLZ A;  1KCF A;  2JGU A;  3V9U A;  4KTZ A;  1B9D A;  1TK5 A;  2YHB A;  4CE9 A;  1S1T A;  4B8C A;  2Z1I A;  3QEX A;  3L3V A;  4JRQ A;  1D5A A;  4KTW A;  4Z4E A;  3V1Q A;  3DRP A;  1S1V A;  2WON A;  5JS2 A;  4EP4 A;  3M8Q A;  3NF6 A;  3LAL A;  4HVJ A;  4IBN A;  2Y1J A;  3OYN A;  1LWF A;  1HPZ A;  2KFN A;  4DLE A;  3ZSW A;  1FKO A;  1Z26 A;  4B3O A;  3MXJ A;  3AA5 X;  2KZM A;  4CGF A;  4RW8 A;  1JLF A;  3AVJ A;  3RMA A;  1D9F A;  2O4I A;  1YVU A;  3SPY A;  2BAN A;  4KO0 A;  1DLO A;  5SZT A;  3F73 A;  4HUE A;  4CGJ A;  4DS5 A;  1VRT A;  4N47 A;  1XHZ A;  1RTD A;  2G8I A;  4OJR A;  1RBS A;  2RF2 A;  4KRF A;  3AVH A;  4FM1 A;  3MEG A;  4FLU A;  4E7K A;  3ZT0 A;  4O5B A;  4E7J A;  2HHS A;  5FRM A;  3CM5 A;  3CM6 A;  3K2P A;  2YKN A;  3QIN A;  1ZBI A;  3TR8 A;  1IKY A;  4IKF A;  1YTU A;  1RBT A;  4CJT A;  3B6O A;  1U48 A;  5DK5 A;  1U47 A;  4B9U A;  2FBV A;  2LSN A;  3O4N A;  3EZ5 A;  2IS3 A;  1RDD A;  4O55 A;  1UA1 A;  5J2N A;  5JS1 A;  1ASW A;  3HVT A;  3LZJ A;  3AO1 A;  4B08 A;  4Z4I A;  4PY5 A;  2ZE2 A;  4CEA A;  3OS0 A;  1VSH A;  1CXU A;  5KI6 A;  4KTQ A;  1WAF A;  1BIS A;  4W5T A;  1O1W A;  2YNH A;  4FJH A;  3I0R A;  1HQU A;  1SUQ A;  3EYZ A;  3V6D A;  1NOY A;  5KTQ A;  3HYF A;  2OPQ A;  4Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...