2IDOA

Structure of the e. coli pol iii epsilon-hot proofreading complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
175
structure length
172
Chain Sequence
TRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli DNA polymerase III epsilon-HOT proofreading complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA polymerase III epsilon subunit
total genus 59
structure length 172
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2idoA00
1NOZA 3NGIA 4DFPA 3UIQA 3L3VA 1VK0A 1S1TA 4E0DA 1REVA 3VQQA 1RTHA 2VG5A 2PYJA 4CFDA 4OKEA 4F3OA 4N76A 4CJ3A 1R0AA 5HBMA 4CJ4A 5HRNA 4DSIA 4Z4GA 2A1SA 3K5OA 1RNHA 4I7FA 4CJKA 4UQGA 3LP2A 2P51A 3NFAA 4FM2A 2YNIA 1BHLA 4HUEA 1EP4A 4ICLA 4CGGA 2G8FA 1IO2A 1U45A 4CJFA 2BE2A 2F8TA 1FKPA 2O4IA 2F96A 1S6QA 3VQBA 3K57A 2X6SA 3VA3A 3QETA 3TI0A 3B6OA 1SKWA 2HMIA 2OZMA 2RN2A 4FM0A 4YNQA 3HPOA 3TARA 2KTQA 1VSHA 4PWDA 3HVTA 5C42A 2FBVA 4FLYA 3AVIA 3K5NA 3DRPA 3MAQA 4FJHA 3RMAA 2WOMA 1S6PA 5J2MA 2F8SA 4CJUA 2D5RA 3HPGA 2PZSA 4JS5A 3KK1A 4KRFA 1EX4A 4C8KA 1ZBHA 3ZSQA 3KKSA 4KAZA 4W5RA 5CYQA 3AVLA 4DWIA 1JL2A 3NGYA 4DF4A 4O44A 3K5LA 2ZQBA 4DSLA 3AO5A 3TR8A 2D0AA 3KKRA 4CERA 3OYLA 2KFZA 3PX6A 2QK9A 3IS9A 4H8KA 3H08A 4E1MA 4R5PA 3KTQA 2OYQA 1LV5A 1WSIA 5D3GA 4QOZB 3MXJA 1QE1A 1J54A 3SQ4A 1S9EA 3T1AA 4KTZA 4KHWA 4HUFA 1FXXA 3A2FA 3LDSA 4FJ5A 4NYNA 2HNZA 3LWLA 4FLXA 4FLVA 5E41A 1ASUA 3O3HA 4CEBA 1RDBA 1VSLA 3T3FA 1VSDA 3VQ7A 2BGGA 3ZT3A 2DFHA 3OYAA 3DLGA 3C6TA 4DLEA 1T05A 3WNHA 3DLHA 4C8OA 1G15A 4QCLA 1UAXA 2HHUA 4B9TA 1ASVA 3P5JA 5KGXA 4YFUA 1RDDA 1SUQA 1HNVA 4E7JA 3PV8A 3V1OA 3KLHA 4DSEA 3G0ZA 1NK4A 3C95A 4CJLA 2WONA 3O3FA 2PY5A 1ZBLA 4KHNA 3RRHA 2X6NA 2FBYA 1JLEA 3O4NA 3V9UA 5HP1A 1X9WA 3OY9A 4CHQA 3S3NA 1T8EA 2G8VA 2Z1JA 2E4LA 2X78A 1C1CA 3O4QA 1WAFA 1HPZA 4CIGA 4B9NA 4O4GA 4KHSA 2HHQA 3AVFA 3P1GA 4Z4HA 3CQ8A 1CZ9A 3ZSWA 3LZJA 2GBZA 3AVGA 3ASMA 3PO4A 1RCHA 3DRSA 4FLZA 2HB5A 4KHQA 4J2AA 1BCMA 5HRSA 1KFDA 3TWHA 3QNNA 4IBNA 2KW4A 5DMRA 1BQNA 1O1WA 1QSLA 4DTXA 4KTWA 3V6DA 1UA0A 4CJ5A 3QEVA 4RG8A 1RT4A 4LH5A 5CZ1A 4DF8A 4Y1DA 3NBPA 2B5JA 5C24A 4E19A 3NHGA 3VQPA 3BDPA 1XHXA 4DTMA 4Z4FA 2Y1IA 4Z4EA 3AA5X 1RBSA 3CM5A 4AHCA 4M41A 4O55A 1SL0A 4CGHA 1GOBA 3OYFA 4CCHA 2PYLA 3CFPA 3TAGA 1WSGA 1WSEA 1K6YA 4DFJA 3AO2A 5HROA 3TAMA 1QSSA 3RMCA 2GUIA 3HVRA 1HQEA 4BDPA 2ETJA 2DFFA 5FRMA 4JLHA 4W5OA 4BDZA 4RW9A 1RT7A 1N5YA 3TABA 4CF0A 1YT3A 4AHSA 2NUBA 4CHYA 4DU1A 2A1RA 1X9SA 4KB1A 5J2NA 3NAEA 1S5JA 2D0CA 1DTTA 5FROA 3WNGA 4DG1A 4MQ3A 4ZTJA 1SL2A 3AVHA 4CJQA 4F2SA 1KFSA 3AA2A 1KLMA 5FDLA 4CGFA 1RT6A 3K59A 1RT5A 1T03A 4AHUA 4CEFA 2IC3A 3OS0A 2HVIA 1TKXA 4E7IA 3FFIA 3HJFA 1B92A 1N6QA 4N47A 3VQ4A 4M3WA 4AILC 4FZYA 3V1QA 1BIUA 3V9SA 4CGIA 3L3UA 3SNNA 5KTQA 1LAWA 1TK5A 4I2PA 1JLFA 1S1UA 1TKTA 5HLFA 3OYBA 1QSYA 1IG9A 3AVMA 2ZE2A 3I0SA 4ELTA 4B8AB 1GOCA 3AVKA 5KI6A 1I3AA 4E3SA 1WSHA 1J9AA 4RW7A 1NKBA 4M42A 1KTQA 3VQ9A 4FYDA 2HHSA 1F21A 4OVLA 3ZT1A 4KTQA 4IFYA 3LAKA 2O4GA 4CHZA 3CFRA 4DU3A 4M3YA 1RILA 3M8SA 1BQMA 1C0TA 5K14A 3KLFA 3SQ0A 3F9KA 4ID5A 4DSFA 4I9LA 5C25A 2RF2A 3E01A 4DS5A 1MU2A 3DLKA 4E7HA 2XRIA 3ISNC 1RBVA 1TAUA 4IDKA 1RBUA 3EY1A 4DTOA 3K2PA 2BDPA 3RMDA 3RWUA 4CK2A 4L8RB 1WN7A 3KK3A 4CJEA 1YVUA 1L3UA 1L3VA 4FJNA 1BI4B 2YHBA 3NF7A 1NJWA 4ZHRA 4OKKA 4CEEA 1TK0A 3V81A 4IKFA 3OYNA 4KI6A 1TVRA 4AHRA 3TAQA 3SI6A 2HHTA 1LWCA 2OZSA 3HK2A 2HNDA 3G10A 3VA0A 2FBXA 3NGZA 3T19A 3LZIA 2OPSA 4CJSA 1KLNA 4OLAA 2P1JA 2XY7A 3OYDA 4J2BA 1HMVA 1IKYA 3DOLA 1TL1A 4EZ9A 3AO3A 3M8RA 3MXIA 4EZ6A 1X1PA 2EHGA 5J1EA 2P5GA 4QAGA 3ZT4A 3IAYA 4J2DA 4FJ8A 4BE2A 1QHTA 4FJXA 1JLAA 2IAJA 3IRXA 4CGJA 3S3OA 2G8IA 4CHPA 4FJMA 3DYAA 1NKEA 1RTDA 3ZSZA 4OGCA 3RR8A 4FJJA 1CZBA 4FLTA 4FZXC 2XY8A 1WLJA 4DTJA 3RMBA 3ZSVA 5SWMA 3HPHA 3LWMA 4HCCA 3KK2A 3NF8A 1BI4A 2JLEA 3V9ZA 3SUNA 4G1QA 4W5TA 1NK6A 3JSMA 3L2QA 1L5UA 4F2RA 4CIEA 2JGUA 4CFAA 4KI4A 2D0BA 1YTUA 1NJYA 4K8XA 4CIFA 1HYSA 1IKWA 1CXUA 1TAQA 4Z4CA 1D9DA 4GMJB 1D8YA 4CESA 4DQSA 3ITHA 4HTUA 4DTUA 4HCBA 1HQUA 4CGDA 4KPYA 2E6MA 1WSJA 3KLGA 4C8NA 1XI1A 4I9QA 4E7KA 1UWBA 3CG7A 4B9VA 4PQUA 4TSXA 4B9MA 3DRRA 5KRTA 3MECA 5I42A 1A5XA 4M3UA 1BL3A 2DTUA 3DLBA 3PO5A 4NCAA 3ALYA 4W5NA 3TAPA 1JKHA 1SV5A 3LANA 3M8PA 2HW3A 1EKEA 4B08A 4CEAA 3HL8A 1A5WA 4FM1A 1YTAA 3RR7A 1JXBA 2Z1GA 4AHVA 3QEPA 1RT1A 4KV8A 4CK3A 4PY5A 2YNGA 2ITGA 1LW0A 4Z0UA 4E89A 4B3OA 2GV9A 3EYZA 3SUPA 1NK9A 4C8MA 3KLEA 3QEXA 3TAEA 1NJZA 3DOKA 3O3GA 3ZCMA 3S9HA 1L3SA 1BGXT 3CYMA 2IOCA 4B9SA 1JLQA 3SV4A 2ZD1A 4BDYA 1RT2A 2ATQA 1LWEA 3AVJA 3AVNA 3V1RA 3QESA 3QEIA 4B9UA 3OYJA 1BIZA 3LP0A 4DU4A 4ELVA 4KHYA 2IS3A 1HYVA 4LH4A 4CEQA 2XY6A 5I3UA 4OPJA 4CF8A 3PX0A 3QIOA 1QTMA 3SV3A 1ASWA 1HRHA 3AO1A 1I39A 3AV9A 4N5SA 4DLGA 3AA3A 1JLGA 3I8DA 1B9FA 1VRUA 1XC9A 4CE9A 4O0IA 1WSFA 2DFEA 5FRNA 1S1XA 3NF6A 4FLUA 1KSPA 1RBRA 2KFNA 3ZT0A 2HVHA 2DY4A 3VQ5A 4NYFA 4DQRA 4DSJA 1IKXA 1VRTA 1TKDA 2RPIA 3M8QA 1W0HA 1C6VA 1KVBA 1LW2A 2Z1HA 3OYCA 3OYGA 3QNOA 3B6PA 1D5AA 1L3TA 3OS1A 4H4OA 4PA1A 4EP5A 4FLWA 3U6FA 4K8ZA 4BE1A 3QEWA 4LSLA 4CJPA 1C0MA 4CF1A 3AVBA 3HSTB 3VQ6A 3MEEA 3OYKA 4DFKA 3IG1A 3LALA 3AA4A 1TL3A 2OPPA 4FVMA 3VQEA 1Y97A 3ULDA 1DTQA 5J2QA 2B6AA 1LWFA 3HP9A 4CEDA 4CFBA 4W5QA 4FJ7A 4NCGA 2OPQA 1QS4A 5KGWA 3U3GA 3OS2A 4HUGA 4FK4A 4BACA 3OJUA 2Z1IA 1VSKA 3V9WA 4ZTFA 3SPYA 4N56A 2YHAA 3NF9A 3AVCA 3BGRA 4IFVA 4J2EA 2IDOA 3OYIA 3LP3A 3VQ8A 4JRPA 3L8BA 4DTPA 3TAFA 3NDKA 1T7PA 4FJ9A 3DLEA 2YNHA 3AO4A 4ID1A 3RRGA 1Q8IA 4PUOA 1WNSA 1D9FA 1LAVA 3LAMA 3NH2A 4E7LA 4CFCA 4JS4A 3OYEA 1RT3A 3VQAA 1RDCA 3MEDA 3NE6A 4F8RA 1C1AA 1WAJA 1KVAA 4CJRA 4DMNA 4CHOA 3AVAA 2HHXA 4GVMA 4LY7A 1TGOA 1XHZA 2XHBA 3L2WA 3QERA 2KZMA 2B4JA 3MEGA 1U49A 2QKBA 3QINA 3K5MA 1JLBA 4GW6A 4CJVA 3I0RA 4FW2A 1XWLA 4H4MA 1VSIA 3DMJA 4FZZA 4RW4A 3DM2A 5JS1A 2W42A 3WNFA 3KIOA 1ZBIA 1KCFA 2FC0A 4I2QA 4M3XA 2G8WA 3D0PA 1UOCA 3U3YA 5EU7A 1NK5A 4Z4IA 3ZSYA 1JLCA 4RW6A 4LD0A 4EP4A 5CZ2A 3L2RA 4CJTA 4CEZA 4XIUA 3L2VA 4OPKA 5T7BA 2R7YA 4CJWA 3QIPA 1VSJA 4MFBA 4DTRA 4OKJA 2VG6A 1ZYQA 2XO7A 1NK0A 3V9XA 2G8UA 1IH7A 4F3TA 1VSMA 1S1VA 3EZ5A 4NCBA 4IG0A 3QLHA 4C8LA 1S9GA 3CFOA 4HHTA 4F4KA 4M3TA 4Y1CA 3CM6A 3ZT2A 2VG7A 4FK0A 5HRRA 2X74A 2FBTA 3OYMA 3HM9A 3ZSOA 2YV0X 2VWKA 3TANA 1Q9YA 3C94A 4DQPA 3HT3A 3KD5E 1DLOA 1S1WA 3DLRA 5HRPA 3LP1A 1C1BA 3KD1E 1JXEA 5CYMA 4AH9A 3F73A 1NOYA 2G8KA 3SZ2A 4O5BA 3WNEA 1KRPA 2P5OA 4OLBA 4DTSA 3HYFA 1Q9XA 4KHUA 3VN5A 1EXQA 1A5VA 3DI6A 4CF2A 1RTJA 3D45A 4IG3A 1RBTA 2IGIA 2HHWA 2BANA 4KO0A 2KZZA 3LPUA 3NCIA 1HJRA 1EETA 4JRQA 3SUQA 1TK8A 2EX3A 3PUFA 4FK2A 1U47A 1U48A 3S3MA 2Q3SA 3SYZA 3OVNA 1NK8A 1SKRA 5KRSA 1GOAA 3SUOA 1X9MA 1KVCA 2YKNA 1Z25A 3SJJA 4FJKA 3HP6A 1IKVA 4OGEA 3V4IA 2YNFA 3SQ2A 3SQ1A 4FJGA 1TKZA 1RDAA 1B9DA 3KLIA 4E1NA 3OJSA 3NH0A 2OPRA 3RTVA 4KFBA 3HO1A 2OA8A 4DS4A 2E6LA 1ZBUA 4Q5VA 1RTIA 1CXQA 1J53A 1VSEA 4BWMA 3KJVA 4DFMA 4BE0A 2HNYA 3QO9A 4KKOA 4O0JA 1SKSA 4B9LA 4FXDA 3SCXA 4CF9A 5J2PA 2HHVA 1NKCA 1ZBFA 2RKIA 4OJRA 4DSKA 4KREA 3HXMA 3THVA 1HYZA 2YKMA 3JYTA 1JL1A 1W9HA 3PY8A 1NJXA 4Q0BA 4WE1A 1CLQA 4ELUA 1C0UA 1NK7A 5CY4A 2G8HA 4CHNA 4DTNA 1Z26A 3LPTA 2VWJA 3SPZA 2LSNA 3C6UA 4CEOA 4BWJA 3MXMA 2QKKA 2I5JA 3OYHA 1BISA 2Y1JA 2KQ2A 3VQCA 4CECA 1UA1A 4FCYA 1J5OA 5JS2A 4FW1A 3ZSXA 2QXFA 3L2UA 1TV6A 4B8CA 1U4BA 1SL1A 4N41A 4M3RA 4M45A 1FKOA 4M3ZA 3P83D 3ZSRA 1BCOA 4AHTA 4CK1A 5SZTA 4FJIA 4FJLA 1HNIA 1VSFA 4DQIA 4KB0A 3VQDA 1FK9A 1ITGA 3PX4A 4HVJA 4LSNA 3K58A 1U04A 2XY5A 2AJQA 3NH1A 4RW8A 5DK5A 4DQQA 1QQCA
chains in the Genus database with same CATH superfamily
1NGHA 2IVNA 1SZ2A 1VK0A 4DV1K 1RTHA 3EE8A 3M6GA 3VEVA 3O1WA 3MCAB 1BDGA 1Y64A 4Z4GA 4UQGA 3NFAA 1WUAA 4ICLA 2G8FA 1IO2A 3CCMN 1FKPA 1S6QA 3K57A 3TI0A 2RN2A 4FM0A 3HPOA 2KTQA 4DR7K 5C42A 3EZWA 1XNRK 3RMAA 2YHXA 3CIPA 4CJUA 3HPGA 3OW2M 3KK1A 1ATNA 1RGIA 1ZBHA 4KAZA 3AVLA 5AQVA 3E9PA 4O44A 3K5LA 3AO5A 3KKRA 2QK9A 5C0YA 4R5PA 1EWRA 3H08A 1BG3A 1QE1A 3NVKA 1J54A 3BP8A 4DUZK 4CZHA 3TSUA 1KAYA 1RDBA 1VSLA 3T3FA 3H45C 3VQ7A 2O8DA 3OYAA 4DLEA 2DPNA 1T05A 3LDQA 4QCLA 1UAXA 3CQXA 3ZLJA 1SUQA 4E7JA 1T3VA 3O5BA 3FZHA 4CD1A 1IBKK 3GG4A 3O4NA 3O80A 1X9WA 3KWIA 2CGKA 2G8VA 4DB3A 2X78A 1GLAG 4CIGA 1WAFA 4KHSA 3IMXA 4O4GA 1M90O 1E3MA 5AQXA 3LZJA 3ZSWA 3AVGA 1QQOA 2QA4N 1VQLN 4WCEL 2HB5A 4JKBA 2E2OA 3CCEN 2QXLA 3D2EA 4PKIA 1QSLA 1UA0A 3QEVA 4RG8A 4PL8A 4LH5A 3CCJN 3ZX3A 5C10A 3FLCO 5KQDA 2Q0RA 4WYBA 4YOVA 2Y1IA 4Z4EA 4JKHA 1RBSA 1K8KA 4JI5K 2P9SA 4CGHA 4YDUC 1HJOA 1P8ZA 4BR0A 3OYFA 3BZCA 4DR4K 2PYLA 1Z6RA 1QSSA 4WQ4A 4B3MK 2A42A 4W5OA 4BDZA 2ASOA 3O8MA 5AQIA 4KB1A 5J2NA 3NAEA 4DG1A 4ZTJA 4CJQA 4F2SA 3AA2A 3C6HA 5C2FA 4BY9C 5DM7L 1VQ4N 3HJFA 3SLCA 1RFQA 1N6QA 3KK7A 1BIUA 3O9SA 5AQKA 4GV9A 1TK5A 4I2PA 1JLFA 1TKTA 5HLFA 1QSYA 4B8AB 3AVKA 3A5LC 1VHXA 3AGKA 4FYDA 5AZIB 2IVOA 4OVLA 4KTQA 1T6CA 4LF9K 3WXKA 5GINA 3KLFA 4YOXA 3SQ0A 3D2FB 2E2QA 4I9LA 2RF2A 4DS5A 3BF1A 4I6MB 2A3ZA 5M1PA 4E7HA 4YOTA 3EY1A 4DTOA 3K2PA 4X66K 3RMDA 1DKGD 1ZXOA 4CK2A 3DXKA 2PFUA 2HSTA 4IO9L 1W7AA 1YVUA 5AQOA 4ZHRA 5LJVA 1ESVA 4KI6A 1TVRA 4AHRA 3C6AA 3VEOA 1LWCA 2OZSA 3VTIA 3G10A 5C2DA 3T19A 2OPSA 4CJSA 1KLNA 1HMVA 1IKYA 3DOLA 3AO3A 3MXIA 4QAGA 4J2DA 1IG8A 3M3ZA 3R1XA 3P4IA 1JLAA 4CGJA 4FJMA 4JHDB 4FJJA 3SAHA 4HCCA 4NO7A 1BI4A 4BQLA 1J5EK 4G1QA 4R79A 3JSMA 1XC3A 1GLDG 2JGUA 2O8BB 1NJYA 1HYSA 4XEIA 4CESA 4DQSA 1NM1A 2IVPA 3E1YA 4JI2K 4HCBA 1WSJA 1VQKN 4C8NA 1XI1A 4I9QA 4PQUA 4TSXA 5KRTA 5JLHA 2FSNA 5MLCQ 5I42A 2DTUA 3DLBA 3CC4N 3I55N 4W5NA 4JEPA 1K8KB 4FWLA 1SV5A 2HW3A 4FWRA 5BN8A 2PBDA 3RR7A 2Z1GA 1MDUB 5LL6Z 4E89A 2ITGA 4Z0UA 2GV9A 5BPNA 2P9PB 3SUPA 3F2KA 4C8MA 3KLEA 3TAEA 3DOKA 1L3SA 5M1NA 1BGXT 4YOYA 4BRCA 4GY2B 3PSIA 1RT2A 3QESA 3V1RA 1OH7A 1BIZA 4DU4A 2UXBK 4KHYA 4CEQA 3NVMA 2O8DB 2E5LK 2NRVA 4V19S 1QHAA 1YI2N 1XC9A 1GLBG 3NF6A 3H3OB 4EAHD 4LF5K 3ZT0A 3LDNA 4DSJA 4DQRA 3U8XA 3FZKA 3ZEUB 2Z1HA 1KVBA 1LW2A 2VGMA 3HOTA 4BR4A 2ITMA 3L0QA 3ENBA 4BE1A 3QEWA 3O9TA 5LJWA 1KQSM 4WFNL 1WBBA 1ZC6A 1N8RO 2OTLN 1TL3A 2OPPA 1Y97A 1DTQA 5KGWA 3OS2A 3I56N 4HUGA 2QEXN 2A6AA 5KPRA 4BACA 4FK4A 2Z1IA 1VSKA 3NF9A 3AVCA 3BGRA 3CC7N 3L8BA 4DTPA 3WXJA 4EHUA 2JWKA 3DLEA 5KPTA 2YNHA 3TTFA 3AO4A 1N32K 1LAVA 3CJCA 3OYEA 1KVAA 4CJRA 4DMNA 2NRHA 3AVAA 3QB0A 2QI2A 2Q31A 4GVMA 4LY7A 1XHZA 1SAZA 1U49A 4BVOA 3QINA 1JLBA 3I0RA 1NGBA 4FZZA 3BZKA 2W42A 5AQSA 4I2QA 5EU7A 4Z4IA 3ZSYA 2WTUA 3L2VA 3FGUA 5CZ2A 4CJTA 4XIUA 3VOVA 5M1OA 4OPKA 4QOZB 3QIPA 4OKJA 1ZYQA 2XO7A 4F3TA 4NCBA 4IG0A 2HF4A 4WQ4C 1YXQA 2VG7A 2X74A 3OYMA 4JKGB 2YV0X 3TANA 4IWVA 3HT3A 4K25A 3DLRA 3N4PA 5HRPA 2E8AA 3IUCA 5AZJA 3HOSA 4IOCL 5CYMA 1S72N 4O5BA 3W0LA 1VQMN 4BRFA 1EXQA 4CF2A 3D45A 2P9UB 1RBTA 2BANA 4KO0A 3NCIA 4H5VA 3SUQA 1SQKA 3CETA 3N4QA 3PUFA 4IJAA 3WUHA 5M1KA 4C1NI 1U48A 3S3MA 3OVNA 2YCHA 2YHWA 5KRSA 5FLXO 2GUPA 2YJFA 2YNFA 5FPNA 4EIAA 2E1YA 3OJSA 3NH0A 4IOAL 4DS4A 2E6LA 2YJEA 1RTIA 1CXQA 1J53A 4DFMA 3A5OC 3A5NC 2HNYA 1CZAN 5J2PA 3SAGA 1NKCA 1ZBFA 4OJRA 1BO5O 1JCFA 2W6KA 4Q0BA 4JI3K 4ELUA 4DTNA 2VWJA 2LSNA 3C6UA 4BWJA 3QICA 3OYHA 4FOEA 2KQ2A 1UA1A 1IBMK 3ZYYX 4YY3K 1TV6A 3RSEB 4K43A 4BRMA 4J8FA 3ULEB 4FJLA 5F0XA 3VQDA 3JAMO 4HVJA 4NXNK 2OCEA 3SBGA 4H03B 1VAZA 2XY5A 4GV6A 5DK5A 1QQCA 1QVFM 1NOZA 4DFPA 3L3VA 2P9LB 4RCHA 2ZJRL 1NGDA 4BC2A 4CJKA 3LP2A 3CCSN 1BHLA 4HUEA 3TTDA 5BR8K 4CJFA 2BE2A 1HLUA 2HMIA 4ISEA 1HNXK 3DXMA 3B6OA 3O1BA 3O9QA 4YNQA 1VSHA 4PWDA 1KXPA 3K5NA 3MAQA 2WOMA 1S6PA 2P9KB 3L4QA 3J8AA 4JS5A 4KRFA 1EX4A 3KKSA 3VPZA 4BR5A 3MCPA 3QBXA 4AM7A 2PAVA 1JL2A 3NGYA 4DSLA 5AQZA 2D0AA 3OYLA 4A5BA 1V4TA 3KTQA 4E1MA 1KD1O 5D3GA 3ENOA 2KHOA 2D1KA 3LDOA 3JXUA 1FXXA 3A2FA 3UKRA 4FJ5A 4ISGA 3CCLN 1OH8A 4DR1K 4CEBA 3RSEA 2FSKA 3THXA 3J7ZO 3DLGA 4C8OA 3WNHA 4F9OA 4B9TA 1ASVA 4IEEA 4BRAA 1U2VA 3PV8A 3V1OA 3KLHA 1NK4A 4CJLA 1ZBLA 3RRHA 3SBTA 2X6NA 1JLEA 1MWMA 3CF5L 1XQSC 4CHQA 3S3NA 1C1CA 1HPZA 5EOYA 3VERA 4PHTX 5B8HA 1GLLO 4FLZA 2F7TA 5HRSA 3MK6A 5TKWA 2ASPA 4O8KA 5BRDA 3MWTA 5DMRA 3DJCA 3AGRA 1M1KO 3H6EA 2FXUA 4NLCA 1OH5A 3BDPA 3EN9A 4BRQA 4BRGA 3CM5A 4AHCA 3G25A 4O55A 2NNWA 1SL0A 3HM8A 4CBXA 3Q7BA 4DFJA 1D4XA 4BRLA 1W2BM 5CE3A 2O8FB 3RMCA 2GUIA 3HVRA 2ETJA 4JLHA 1QZ5A 3THXB 1T6DA 3CCRN 1RT7A 1N5YA 3P38A 4CF0A 3ENHA 1YT3A 4DU1A 2A1RA 1X9SA 1S5JA 1O13A 2D0CA 5FROA 3OBWA 3EKSA 4MQ3A 1SL2A 1KFSA 1KLMA 5FDLA 4BR2A 2IC3A 3OS0A 2HVIA 4E7IA 3FFIA 3C0BA 1B92A 4N47A 3VQ4A 3DXKB 5KTQA 1LAWA 2KLAA 3J80O 4JK8A 1IG9A 3AVMA 2ZE2A 5KI6A 1TYQA 1I3AA 3CJ1A 3VQ9A 3ZT1A 4DV7K 2ZGZA 3KWGA 4FOIA 3KHYA 1BQMA 1C0TA 1WBDA 3F9KA 4ID5A 3THWB 4JKCA 5F2RA 3QBWA 1TAUA 4IDKA 1RBUA 2BDPA 1U6ZA 1WN7A 2UXCK 4FJNA 1NJWA 2F9WA 3NF7A 4CEEA 3V81A 3OYNA 3TAQA 3SI6A 1DGKN 2A5XA 3UE5A 3HK2A 3CMAN 4OLAA 2P1JA 5BRHA 3OYDA 3H3NO 4DQ8A 1TL1A 1LOTB 3M8RA 3ZX2A 4I6MA 2P5GA 1YUWA 3IAYA 4CBUA 4H0PA 2V7ZA 3VF6A 1NKEA 1RTDA 4OGCA 3TTCA 4NXMK 3SJHA 4JI8K 3RMBA 5GIPA 4CZEA 3HPHA 3VEYA 3KK2A 3NF8A 2JLEA 4F2RA 4FWMA 4CIEA 5AQMA 3GE1A 2D0BA 3K9KA 4FL9A 3A0IX 1Q81O 4K8XA 1TAQA 4GMJB 2Q0UA 3ITHA 3VGLA 4Z94A 3UKUB 3VEWA 4E7KA 1UWBA 3CI5A 3HTVA 1TUUA 4M3UA 3PO5A 4NCAA 3TAPA 4ILJA 2O8BA 1YTAA 4PY5A 4KV8A 2YNGA 1NJZA 3W3DA 3S9HA 2IOCA 1NU0A 3H1QA 3SV4A 3K0SA 4LF8K 2ZD1A 3LDPA 2ATQA 3AVJA 3AVNA 5AZIA 5I3UA 1N34K 4CF8A 3PX0A 3AAQA 1ASWA 4KH6A 4MLHA 3AA3A 1JLGA 2E20A 1VRUA 3D2FA 2VCPA 1S1XA 2Q36A 2RHKA 2HBKA 4BC4A 1RBRA 1KSPA 2HVHA 2DY4A 5C12A 1XNQK 1IKXA 1VQ9N 1TKDA 2RPIA 5M1QA 1W0HA 1NG9A 1YJWN 1L3TA 3B6PA 1D5AA 5AQUA 4PA1A 3QDKA 3BEXA 4EP5A 4K8ZA 5EX5A 4B9QA 2W40A 4CW7B 3OTOK 4CF1A 3OYKA 3MEEA 3CERA 2VQEK 3IG1A 4DFKA 1MA9B 3ULDA 5J2QA 3HP9A 4CEDA 4W5QA 4NCGA 3ZETA 3C7NB 5I9EB 4DV3K 4N56A 4J2EA 3OYIA 4BC5A 3LP3A 2QWLA 5E84A 1T7PA 4DV6K 4ID1A 2O8CA 4PUOA 2HOEA 2HBLA 4CFCA 1RDCA 3MEDA 3TU5A 4DV0K 4H5NA 3A8YA 3UKRB 1NWKA 1U2VB 3WT0A 2XHBA 5BREA 3L2WA 3QERA 2KZMA 2B4JA 2QKBA 3PIPL 3K5MA 4A57A 4GW6A 1VSIA 1KAXA 3DM2A 3KIOA 4X64K 3D0PA 4BQZA 4DUYK 4QS9A 2W6LA 3CPWM 4EP4A 4MO4A 4NB4A 4CEZA 5T7BA 2R7YA 2GEMA 3H46O 1VSJA 2G8UA 2VG6A 3V9XA 3J81O 1IH7A 1VSMA 4YDUA 2VQFK 2A40A 4F4KA 4Y1CA 4JKAA 3SMSA 3FZLA 3HM9A 1YJ9N 4DQPA 4BRPA 2YI1A 4JK7A 4JI1K 3KD1E 4DR5K 3F73A 2CGJA 2P5OA 4DTSA 1Q9XA 4KHUA 3VN5A 4LFAK 1A5VA 2UXDK 5ELZA 5CR4A 4FK2A 2V7YA 1U47A 4UY8O 5FPMA 1NK8A 1X9MA 1GOAA 4IO8A 3MN7A 3HP6A 4OGEA 3F5TA 3SQ1A 1TKZA 5AQHA 1HKBA 3RTVA 4E1NA 2ZWHA 1JCEA 4BWMA 3DAWA 3QO9A 3ATUA 4FXDA 2P9LA 2RKIA 4B3SK 4DSKA 4DR3K 1HYZA 4BC3A 2NRTA 4GV3A 2QWOA 5CY4A 4NLBA 3MXMA 5BPMA 2QKKA 3VTHA 4BRHA 4OX9K 3TSQA 2UYTA 4IZ9A 1U4BA 1SL1A 4N41A 3ZSRA 1BCOA 3DWLA 4FSVA 4CK1A 2E2NA 4FJIA 5AR0A 4DQIA 4H0XB 4IJNA 1ITGA 4LSNA 3K58A 2AJQA 3NH1A 3A5MC 4DQQA 3NGIA 1S1TA 3WEEA 1IBLK 4E0DA 3VQQA 2PYJA 2VG5A 3F9MA 5LMNK 4CFDA 4OKEA 2RE2A 5HL7L 5HBMA 4CJ4A 5HRNA 1BA0A 4DSIA 3K5OA 1RNHA 4XH4A 1X3MA 1EP4A 4CGGA 2F8TA 2F96A 3VQBA 1Q86O 1SKWA 2OZMA 3HVTA 2AP1A 2J4RA 3AVIA 1QZ6A 4FJHA 2BTFA 2D5RA 2PZSA 4CZIA 4W5RA 3O9RA 4KBOA 4DF4A 2ZQBA 1BWFO 3TR8A 2KFZA 4CERA 3PX6A 3IS9A 4H8KA 2OYQA 1WSIA 3MXJA 3AAPA 3EO3A 1S9EA 3T1AA 4KTZA 4WF9L 2P9SB 2Q2RA 4HUFA 3LDSA 1C0GA 2HNZA 3LWLA 4MO5A 3O3HA 2OTJN 1VSDA 2BGGA 3ZT3A 1G15A 1V4SA 3HBTA 3MX5A 4PKHA 5C15A 3P5JA 4YFUA 4K0KK 1P90A 3C95A 1R59O 3O3FA 2PY5A 3CD6N 2FBYA 5AQTA 3MX2A 3V9UA 5HP1A 1T8EA 4CZGA 4B9NA 3R6MA 2HHQA 2QW9A 3MN9A 4JYAK 5AQYA 2D4WA 3OBYA 3ASMA 3I8BA 3DRSA 1YAGA 5GADP 3LM9A 1BCMA 1KFDA 3E66A 4LFBK 3MDQA 1ILYA 4A59A 4KHPK 1O1WA 3O9UA 3V6DA 4KTWA 3K9JA 1RT4A 2P9UA 4JI0K 4DF8A 3O6WA 4Y1DA 4E19A 4M7YA 3VQPA 5JVHL 1JCGA 4DTMA 2ASMA 3IFRA 5JLFA 1K9MO 1OVQA 3B8AX 3DLLL 3ZX0A 4A5AA 3AO2A 5HROA 4BDPA 1HQEA 4IEIA 1OH6A 4AHSA 2NUBA 4CHYA 2P9KA 1DTTA 3WNGA 3KZBA 3AVHA 1MWKA 2HHHK 1RT5A 1T03A 1GLCG 4CEFA 1TUYA 4LF7K 2UUAK 1TKXA 4M3WA 5LY3A 4AILC 3V1QA 4DV4K 2UU9K 3BF3A 3V9SA 3L3UA 1HNZK 1GLEG 4BROA 1KC8O 1S1UA 3OYBA 3GBTA 4ELTA 1H1VA 1GOCA 4E3SA 4DV2K 1KTQA 5AQJA 1F21A 1YJNN 4IFYA 4CHZA 2QM1A 4LFCK 2BUPA 4DU3A 3M8SA 3PLAA 3DLKA 4K42A 4BG8A 3CQYA 1Q82O 3ISNC 4O8UA 3RWUA 2IIRA 4L8RB 2F9TA 2QWMA 4H5TA 4CJEA 1L3VA 3ATVA 2YHBA 1TK0A 4IKFA 1C0FA 3O08A 1N36K 2HHTA 2HNDA 2HBMA 3TPQA 4JD2A 4EZ9A 4OPAA 5A2QO 3IKMA 2EHGA 4FWNA 5J1EA 4FJ8A 3ZT4A 4GKKK 3ZEUA 3IRXA 2G8IA 1KAZA 3RR8A 1JJ2M 2XY8A 1WLJA 3ZSVA 3LWMA 3AARA 1Z05A 3V9ZA 3GL1A 4W5TA 2I7PA 4KI4A 1GLJO 4CIFA 1CXUA 4Z4CA 1D9DA 1D8YA 4FWPA 4JK9A 3QFUA 4HTUA 4DTUA 4CGDA 4AQYK 2E6MA 1GLFO 2E88A 4G9ZA 3D7EO 4B9VA 4IOXA 4H0VB 1BOTO 1A5XA 3U9ZA 1BL3A 3M8PA 1EKEA 4WFBL 3HL8A 4JI6K 4FM1A 1JXBA 1RT1A 1LW0A 4B3OA 3EYZA 4FO0A 4YHHK 4CZKA 4IDHA 1JLQA 4BDYA 3O4WA 4U67L 1LWEA 1OVYA 4B9UA 3LP0A 4ELVA 4FWOA 2IS3A 1HYVA 2ZGYA 1VQPN 3CJ7A 5LMUK 2XY6A 1T44A 4JKEA 1ZBSA 1HRHA 4DLGA 3AV9A 3M5RA 5AQQA 1E4FT 2HMPA 1B9FA 3I8DA 3THWA 4CE9A 1XMOK 4O0IA 1WSFA 2DFEA 1S22A 5ADXH 4FLUA 5AQRA 3MWPA 1EQYA 3OA9A 4JNEA 4NYFA 1XUPO 3M8QA 1C6VA 2ZM6K 3OYGA 2O8FA 3OS1A 4H4OA 4LF6K 4FLWA 3U6FA 5GIOA 4CJPA 1C0MA 5DM6L 3AVBA 3HSTB 1VQ6N 3LALA 4FVMA 4U7BA 5AZJB 1YITN 4CFBA 4FJ7A 5E26A 2OPQA 1YHQN 3LM2A 3SAFA 4DR2K 2JWLA 3OJUA 4B1VA 4QS8A 3CJAA 2WC9A 2IDOA 4RTFD 3VQ8A 1N33K 4BRNA 3E9LA 3EEQA 5GAGP 3EKUA 3RRGA 4CZJA 1D9FA 3LAMA 3NH2A 4JS4A 4F8RA 3VQAA 2VWBA 1C1AA 3PIOL 4CHOA 2F4VK 3CMEN 4BG9A 4BR9A 3MEGA 2FF6A 1J6ZA 1NGAA 1E4GT 1XWLA 4BGBA 3DMJA 2O8EB 5JS1A 1ZBIA 1KCFA 2FC0A 3U3YA 1NK5A 3G71N 1JLCA 2P9IA 4RW6A 3L2RA 3CJ9A 5EY4A 2O8CB 4MFBA 1NK0A 3C65A 1W97L 4BRIA 4EHTA 3EZ5A 2AA4A 3QLHA 4C8LA 4B3RK 4HHTA 4JAXA 4M3TA 3CM6A 3ZT2A 4FK0A 5HRRA 2FBTA 3ZSOA 2VWKA 1Q9YA 3KD5E 3C94A 1DLOA 3LP1A 3MN5A 1JXEA 4AH9A 4M63C 3WNEA 1KRPA 4OLBA 3RVCA 3DI6A 4A2BA 3EE9A 4IG3A 2HHWA 2IGIA 3LPUA 4JRQA 5BR9A 2NRXA 3QMLA 2UUBK 4EFHA 4OPHA 4CJ7A 4H0OA 2Q3SA 3SYZA 4ILGB 4KH5A 2A41A 1Z25A 4FJKA 3LDLA 3SQ2A 1RDAA 4YOUA 1X9JA 1B9DA 3KLIA 3HO1A 1S3XA 2OPRA 1VQON 3FR0A 1NBWA 2WBNA 2OA8A 5AJ3K 1VSEA 3KJVA 5AQFA 4B9LA 4CF9A 3U4LA 3LL3A 3WQUA 3CCQN 3HXMA 3THVA 2YKMA 3JYTA 1JL1A 1W9HA 3PY8A 2E2PA 4WE1A 3SMPA 1CLQA 1C0UA 1NK7A 1VQ7N 2G8HA 3LPTA 5BN9A 4JN4A 4C23A 4DV5K 3WQTA 2QWQA 4GVEA 2FF3B 4WQ5C 4E1JA 3VQCA 1J5OA 3ZSXA 4A2AA 2P9NA 1NMDA 2QXFA 2QTDA 3FFKB 3Q7CA 4M3RA 4M3ZA 5SZTA 1HNIA 1VSFA 5AQWA 1VQ5N 3GDQA 3EL2A 4M7XA 3UIQA 3UB5A 2QWRA 1REVA 4K41A 4F3OA 4N76A 4CJ3A 3CCVN 1R0AA 4FVUA 3R8EA 2A1SA 1VQ8N 4I7FA 1Q18A 4CZLA 1K8AO 2P51A 4JI4K 4FM2A 2YNIA 4H5RA 1IJJA 2OANA 4X65K 1U45A 2ZJPL 5BRFA 2Q97A 1ATSA 2O4IA 3QETA 2X6SA 2P9PA 1SS6A 3TARA 2FBVA 1HUXA 4FLYA 3VF4A 3DRPA 1NMNA 5J2MA 2F8SA 1I94K 5ADXA 1TYQB 3E9OA 5H1SQ 4C8KA 3ZSQA 1BUPA 5CYQA 4DWIA 1OKJA 1YF5L 1DT9A 2HF3A 4BVPA 2CH5A 4JI7K 5AQGA 4DR6K 4JD2B 5AFUH 4JHDA 2V52B 1LV5A 1NGCA 1HX1A 4LF4K 3P31A 1FJGK 3SQ4A 4KHWA 1K73O 5JMVA 4NYNA 4FLXA 4FLVA 4CD3A 5E41A 1ASUA 4XH1A 3G4SN 1NLVA 2DFHA 3C6TA 5CHIA 3DLHA 4H0YB 3D2EB 5KGXA 2YX6A 1RDDA 4A61A 4QS7A 3WXMB 1HNVA 3R9PA 4DSEA 1EO1A 3G0ZA 5GAEP 3TSPA 2WONA 4KHNA 3OY9A 2Z1JA 2E4LA 3O4QA 3U9DA 1ATRA 3AVFA 3P1GA 2FLOA 4Z4HA 3CQ8A 1CZ9A 2GBZA 3PO4A 4MDBA 1RCHA 3MMVA 4KHQA 4J2AA 4RWTA 3TWHA 3PSFA 3QNNA 4IBNA 2KW4A 3AY9A 3WXLA 1BQNA 4DTXA 2EWSA 4CJ5A 4CZMA 4B1YB 3ZETB 2KKZA 5CZ1A 5AQPA 3CPEA 3NBPA 2B5JA 5C24A 3NHGA 3QFPA 3GOIA 3R3LA 1NGJA 5KPZA 1XHXA 4Z4FA 3AA5X 4M41A 3VEXA 4CBWA 2NRWA 1GOBA 4CCHA 4WQ5A 3CFPA 3TAGA 1WSGA 1HNWK 1WSEA 1K6YA 4ILHA 1RDUA 2P9IB 3TAMA 3SK3A 5F1XA 2DFFA 5FRMA 4RW9A 1DEJA 3TABA 3THYB 4FWKA 2D0OA 1G99A 4MDAA 1IV0A 1BU6O 2W41A 2ZF5O 1VQNN 4CGFA 1RT6A 3K59A 4AHUA 4B3TK 4CI6A 3VESA 3HRGA 3JS6A 1HPMA 4CGIA 3SNNA 2ZJQL 4BGAA 3I0SA 3BY5A 1HR0K 1WSHA 1J9AA 4RW7A 1NKBA 4M42A 2HHSA 4HTLA 4H5WA 2GELA 3LAKA 4LC9B 2O4GA 3CFRA 4M3YA 1RILA 3T7ZA 5EXWA 2NRZA 5K14A 4X62K 4DSFA 3UKUA 3E01A 5C25A 1MU2A 3WEEB 2YHYA 2XRIA 2UUCK 3VEZA 1EWQA 1RBVA 1WOQA 5AQNA 5FPEA 3VGMA 4DHYA 4OO1J 4WFAL 3KK3A 1L3UA 3CJBA 4JKGA 1NGEA 5IT9O 5AQLA 3HI0A 1BI4B 4OKKA 2QWNA 4GNIA 3VA0A 2FBXA 3NGZA 3ID6A 3LZIA 2XY7A 2FSJA 2Q1NA 4J2BA 2VYPA 4EZ6A 1X1PA 3HZ6A 4JV5K 4JKFA 4BE2A 1QHTA 4FJXA 1NGIA 4FPAA 2IAJA 3VMFB 3S3OA 4CHPA 3H1VX 3DYAA 3ZSZA 2WFBA 1CZBA 4FLTA 4FZXC 4AM6A 4DTJA 3M1FA 5SWMA 3SUNA 1NK6A 3L2QA 2NZTA 1L5UA 4ISFA 4CFAA 1YTUA 2GWKA 1IKWA 4AF1A 3IDHA 3T69A 5AFUA 1HQUA 4KPYA 4C1NK 5JVGL 4FWSA 3KLGA 3CG7A 4B1XB 4B9MA 3DRRA 3L6QA 4L3QA 3MECA 3C7NA 2P9NB 3ALYA 3CXCM 1JKHA 3KVGA 3LANA 3T1YK 4B08A 4CEAA 1WB9A 1A5WA 3QEPA 4AHVA 4CK3A 4DKWA 3CC2N 5EVZA 1NK9A 3QEXA 3O3GA 3ZCMA 3CYMA 4B9SA 4XH5A 3QEIA 3OYJA 4LH4A 1NGFA 3P39A 4OPJA 3NMUA 3QIOA 5IWAK 1QTMA 3SV3A 3AO1A 4N5SA 4FZYA 1I39A 3HSCA 4BRKA 5HOOA 2NLXA 5FRNA 3L4IA 1XMQK 2KFNA 5M1FA 3VQ5A 1HKCA 1VRTA 3FZFA 3QNOA 3OYCA 3I33A 5FPDA 4LSLA 1Q7YO 4PKGA 4BRDA 4CVNE 3VQ6A 1QVGM 3AA4A 3VQEA 2B6AA 1LWFA 2E1ZA 3BUZB 3U3GA 1QS4A 4HWIA 1YIJN 3V9WA 4ZTFA 4GKJK 3SPYA 1NNEA 2YHAA 4IFVA 4JRPA 4YOWA 4FJ9A 3TAFA 2GTDA 3NDKA 1QQNA 4CZFA 3D6RA 2QWPA 2VGNA 1Q8IA 1WNSA 4E7LA 1NGGA 3NE6A 1RT3A 1WAJA 3J7YP 2HHXA 3WXIA 1TGOA 4CJVA 3T1HK 4B1UB 4FW2A 4H4MA 4RW4A 3WNFA 2H3GX 1FW6A 3J7AP 4M3XA 2G8WA 1UOCA 4LD0A 3VA3A 2I7NA 4BR7A 4B1ZA 3VENA 4CJWA 4DTRA 1S1VA 4PL7A 3MN6A 2HBJA 1S9GA 3CFOA 1RDWX 3VGKA 1NJIO 5JICA 4IXCA 2D0PA 1S1WA 2O8EA 2WUSA 1C1BA 2CGLA 1X3NA 2BH1A 3VETA 1NOYA 3SZ2A 2G8KA 3HYFA 3S41A 1RTJA 3CCUN 5BPLA 2KZZA 4FPBA 1HJRA 1EETA 3OHRA 1TK8A 2EX3A 1LCUA 4JKDA 4B1WB 3FE1A 5GAHP 1SKRA 1YVNA 3SUOA 1KVCA 2YKNA 4KH4A 3SJJA 1IKVA 3V4IA 4FJGA 2GWJA 4KFBA 4FWQA 2HHUA 5TKYA 1ZBUA 4H0TB 4Q5VA 2NRRA 4BE0A 4KKOA 4O0JA 1SKSA 3SCXA 3ULEA 4BREA 2HHVA 3THYA 2V51B 4KREA 2GX9A 4DCHA 1QQMA 1NJXA 4YORA 1HKGA 5KQ8A 4CHNA 1Z26A 3G6EN 3SPZA 4MLEA 4CEOA 2I5JA 1BISA 4IFEA 2Y1JA 4CECA 3VF2A 4FCYA 3CHWA 4FW1A 5JS2A 3L2UA 4B8CA 4O5FA 4M45A 1FKOA 3DXMB 3P83D 4AHTA 4A62A 3FZMA 4KB0A 1FK9A 3PX4A 3ID8A 1BA1A 1U04A 4Y0WA 2CH6A 4RW8A
chains in the Genus database with same CATH topology
1NOZA 3NGIA 4DFPA 3UIQA 3L3VA 1VK0A 1S1TA 4E0DA 1REVA 3VQQA 1RTHA 2VG5A 2PYJA 4CFDA 4OKEA 4F3OA 4N76A 4CJ3A 1R0AA 5HBMA 4CJ4A 5HRNA 4DSIA 4Z4GA 2A1SA 3K5OA 1RNHA 4I7FA 4CJKA 4UQGA 3LP2A 2P51A 3NFAA 4FM2A 2YNIA 1BHLA 4HUEA 1EP4A 4ICLA 4CGGA 2G8FA 1IO2A 1U45A 4CJFA 2BE2A 2F8TA 1FKPA 2O4IA 2F96A 1S6QA 3VQBA 3K57A 2X6SA 3VA3A 3QETA 3TI0A 3B6OA 1SKWA 2HMIA 2OZMA 2RN2A 4FM0A 4YNQA 3HPOA 3TARA 2KTQA 1VSHA 4PWDA 3HVTA 5C42A 2FBVA 4FLYA 3AVIA 3K5NA 3DRPA 3MAQA 4FJHA 3RMAA 2WOMA 1S6PA 5J2MA 2F8SA 4CJUA 2D5RA 3HPGA 2PZSA 4JS5A 3KK1A 4KRFA 1EX4A 4C8KA 1ZBHA 3ZSQA 3KKSA 4KAZA 4W5RA 5CYQA 3AVLA 4DWIA 1JL2A 3NGYA 4DF4A 4O44A 3K5LA 2ZQBA 4DSLA 3AO5A 3TR8A 2D0AA 3KKRA 4CERA 3OYLA 2KFZA 3PX6A 2QK9A 3IS9A 4H8KA 3H08A 4E1MA 4R5PA 3KTQA 2OYQA 1LV5A 1WSIA 5D3GA 4QOZB 3MXJA 1QE1A 1J54A 3SQ4A 1S9EA 3T1AA 4KTZA 4KHWA 4HUFA 1FXXA 3A2FA 3LDSA 4FJ5A 4NYNA 2HNZA 3LWLA 4FLXA 4FLVA 5E41A 1ASUA 3O3HA 4CEBA 1RDBA 1VSLA 3T3FA 1VSDA 3VQ7A 2BGGA 3ZT3A 2DFHA 3OYAA 3DLGA 3C6TA 4DLEA 1T05A 3WNHA 3DLHA 4C8OA 1G15A 4QCLA 1UAXA 2HHUA 4B9TA 1ASVA 3P5JA 5KGXA 4YFUA 1RDDA 1SUQA 1HNVA 4E7JA 3PV8A 3V1OA 3KLHA 4DSEA 3G0ZA 1NK4A 3C95A 4CJLA 2WONA 3O3FA 2PY5A 1ZBLA 4KHNA 3RRHA 2X6NA 2FBYA 1JLEA 3O4NA 3V9UA 5HP1A 1X9WA 3OY9A 4CHQA 3S3NA 1T8EA 2G8VA 2Z1JA 2E4LA 2X78A 1C1CA 3O4QA 1WAFA 1HPZA 4CIGA 4B9NA 4O4GA 4KHSA 2HHQA 3AVFA 3P1GA 4Z4HA 3CQ8A 1CZ9A 3ZSWA 3LZJA 2GBZA 3AVGA 3ASMA 3PO4A 1RCHA 3DRSA 4FLZA 2HB5A 4KHQA 4J2AA 1BCMA 5HRSA 1KFDA 3TWHA 3QNNA 4IBNA 2KW4A 5DMRA 1BQNA 1O1WA 1QSLA 4DTXA 4KTWA 3V6DA 1UA0A 4CJ5A 3QEVA 4RG8A 1RT4A 4LH5A 5CZ1A 4DF8A 4Y1DA 3NBPA 2B5JA 5C24A 4E19A 3NHGA 3VQPA 3BDPA 1XHXA 4DTMA 4Z4FA 2Y1IA 4Z4EA 3AA5X 1RBSA 3CM5A 4AHCA 4M41A 4O55A 1SL0A 4CGHA 1GOBA 3OYFA 4CCHA 2PYLA 3CFPA 3TAGA 1WSGA 1WSEA 1K6YA 4DFJA 3AO2A 5HROA 3TAMA 1QSSA 3RMCA 2GUIA 3HVRA 1HQEA 4BDPA 2ETJA 2DFFA 5FRMA 4JLHA 4W5OA 4BDZA 4RW9A 1RT7A 1N5YA 3TABA 4CF0A 1YT3A 4AHSA 2NUBA 4CHYA 4DU1A 2A1RA 1X9SA 4KB1A 5J2NA 3NAEA 1S5JA 2D0CA 1DTTA 5FROA 3WNGA 4DG1A 4MQ3A 4ZTJA 1SL2A 3AVHA 4CJQA 4F2SA 1KFSA 3AA2A 1KLMA 5FDLA 4CGFA 1RT6A 3K59A 1RT5A 1T03A 4AHUA 4CEFA 2IC3A 3OS0A 2HVIA 1TKXA 4E7IA 3FFIA 3HJFA 1B92A 1N6QA 4N47A 3VQ4A 4M3WA 4AILC 4FZYA 3V1QA 1BIUA 3V9SA 4CGIA 3L3UA 3SNNA 5KTQA 1LAWA 1TK5A 4I2PA 1JLFA 1S1UA 1TKTA 5HLFA 3OYBA 1QSYA 1IG9A 3AVMA 2ZE2A 3I0SA 4ELTA 4B8AB 1GOCA 3AVKA 5KI6A 1I3AA 4E3SA 1WSHA 1J9AA 4RW7A 1NKBA 4M42A 1KTQA 3VQ9A 4FYDA 2HHSA 1F21A 4OVLA 3ZT1A 4KTQA 4IFYA 3LAKA 2O4GA 4CHZA 3CFRA 4DU3A 4M3YA 1RILA 3M8SA 1BQMA 1C0TA 5K14A 3KLFA 3SQ0A 3F9KA 4ID5A 4DSFA 4I9LA 5C25A 2RF2A 3E01A 4DS5A 1MU2A 3DLKA 4E7HA 2XRIA 3ISNC 1RBVA 1TAUA 4IDKA 1RBUA 3EY1A 4DTOA 3K2PA 2BDPA 3RMDA 3RWUA 4CK2A 4L8RB 1WN7A 3KK3A 4CJEA 1YVUA 1L3UA 1L3VA 4FJNA 1BI4B 2YHBA 3NF7A 1NJWA 4ZHRA 4OKKA 4CEEA 1TK0A 3V81A 4IKFA 3OYNA 4KI6A 1TVRA 4AHRA 3TAQA 3SI6A 2HHTA 1LWCA 2OZSA 3HK2A 2HNDA 3G10A 3VA0A 2FBXA 3NGZA 3T19A 3LZIA 2OPSA 4CJSA 1KLNA 4OLAA 2P1JA 2XY7A 3OYDA 4J2BA 1HMVA 1IKYA 3DOLA 1TL1A 4EZ9A 3AO3A 3M8RA 3MXIA 4EZ6A 1X1PA 2EHGA 5J1EA 2P5GA 4QAGA 3ZT4A 3IAYA 4J2DA 4FJ8A 4BE2A 1QHTA 4FJXA 1JLAA 2IAJA 3IRXA 4CGJA 3S3OA 2G8IA 4CHPA 4FJMA 3DYAA 1NKEA 1RTDA 3ZSZA 4OGCA 3RR8A 4FJJA 1CZBA 4FLTA 4FZXC 2XY8A 1WLJA 4DTJA 3RMBA 3ZSVA 5SWMA 3HPHA 3LWMA 4HCCA 3KK2A 3NF8A 1BI4A 2JLEA 3V9ZA 3SUNA 4G1QA 4W5TA 1NK6A 3JSMA 3L2QA 1L5UA 4F2RA 4CIEA 2JGUA 4CFAA 4KI4A 2D0BA 1YTUA 1NJYA 4K8XA 4CIFA 1HYSA 1IKWA 1CXUA 1TAQA 4Z4CA 1D9DA 4GMJB 1D8YA 4CESA 4DQSA 3ITHA 4HTUA 4DTUA 4HCBA 1HQUA 4CGDA 4KPYA 2E6MA 1WSJA 3KLGA 4C8NA 1XI1A 4I9QA 4E7KA 1UWBA 3CG7A 4B9VA 4PQUA 4TSXA 4B9MA 3DRRA 5KRTA 3MECA 5I42A 1A5XA 4M3UA 1BL3A 2DTUA 3DLBA 3PO5A 4NCAA 3ALYA 4W5NA 3TAPA 1JKHA 1SV5A 3LANA 3M8PA 2HW3A 1EKEA 4B08A 4CEAA 3HL8A 1A5WA 4FM1A 1YTAA 3RR7A 1JXBA 2Z1GA 4AHVA 3QEPA 1RT1A 4KV8A 4CK3A 4PY5A 2YNGA 2ITGA 1LW0A 4Z0UA 4E89A 4B3OA 2GV9A 3EYZA 3SUPA 1NK9A 4C8MA 3KLEA 3QEXA 3TAEA 1NJZA 3DOKA 3O3GA 3ZCMA 3S9HA 1L3SA 1BGXT 3CYMA 2IOCA 4B9SA 1JLQA 3SV4A 2ZD1A 4BDYA 1RT2A 2ATQA 1LWEA 3AVJA 3AVNA 3V1RA 3QESA 3QEIA 4B9UA 3OYJA 1BIZA 3LP0A 4DU4A 4ELVA 4KHYA 2IS3A 1HYVA 4LH4A 4CEQA 2XY6A 5I3UA 4OPJA 4CF8A 3PX0A 3QIOA 1QTMA 3SV3A 1ASWA 1HRHA 3AO1A 1I39A 3AV9A 4N5SA 4DLGA 3AA3A 1JLGA 3I8DA 1B9FA 1VRUA 1XC9A 4CE9A 4O0IA 1WSFA 2DFEA 5FRNA 1S1XA 3NF6A 4FLUA 1KSPA 1RBRA 2KFNA 3ZT0A 2HVHA 2DY4A 3VQ5A 4NYFA 4DQRA 4DSJA 1IKXA 1VRTA 1TKDA 2RPIA 3M8QA 1W0HA 1C6VA 1KVBA 1LW2A 2Z1HA 3OYCA 3OYGA 3QNOA 3B6PA 1D5AA 1L3TA 3OS1A 4H4OA 4PA1A 4EP5A 4FLWA 3U6FA 4K8ZA 4BE1A 3QEWA 4LSLA 4CJPA 1C0MA 4CF1A 3AVBA 3HSTB 3VQ6A 3MEEA 3OYKA 4DFKA 3IG1A 3LALA 3AA4A 1TL3A 2OPPA 4FVMA 3VQEA 1Y97A 3ULDA 1DTQA 5J2QA 2B6AA 1LWFA 3HP9A 4CEDA 4CFBA 4W5QA 4FJ7A 4NCGA 2OPQA 1QS4A 5KGWA 3U3GA 3OS2A 4HUGA 4FK4A 4BACA 3OJUA 2Z1IA 1VSKA 3V9WA 4ZTFA 3SPYA 4N56A 2YHAA 3NF9A 3AVCA 3BGRA 4IFVA 4J2EA 2IDOA 3OYIA 3LP3A 3VQ8A 4JRPA 3L8BA 4DTPA 3TAFA 3NDKA 1T7PA 4FJ9A 3DLEA 2YNHA 3AO4A 4ID1A 3RRGA 1Q8IA 4PUOA 1WNSA 1D9FA 1LAVA 3LAMA 3NH2A 4E7LA 4CFCA 4JS4A 3OYEA 1RT3A 3VQAA 1RDCA 3MEDA 3NE6A 4F8RA 1C1AA 1WAJA 1KVAA 4CJRA 4DMNA 4CHOA 3AVAA 2HHXA 4GVMA 4LY7A 1TGOA 1XHZA 2XHBA 3L2WA 3QERA 2KZMA 2B4JA 3MEGA 1U49A 2QKBA 3QINA 3K5MA 1JLBA 4GW6A 4CJVA 3I0RA 4FW2A 1XWLA 4H4MA 1VSIA 3DMJA 4FZZA 4RW4A 3DM2A 5JS1A 2W42A 3WNFA 3KIOA 1ZBIA 1KCFA 2FC0A 4I2QA 4M3XA 2G8WA 3D0PA 1UOCA 3U3YA 5EU7A 1NK5A 4Z4IA 3ZSYA 1JLCA 4RW6A 4LD0A 4EP4A 5CZ2A 3L2RA 4CJTA 4CEZA 4XIUA 3L2VA 4OPKA 5T7BA 2R7YA 4CJWA 3QIPA 1VSJA 4MFBA 4DTRA 4OKJA 2VG6A 1ZYQA 2XO7A 1NK0A 3V9XA 2G8UA 1IH7A 4F3TA 1VSMA 1S1VA 3EZ5A 4NCBA 4IG0A 3QLHA 4C8LA 1S9GA 3CFOA 4HHTA 4F4KA 4M3TA 4Y1CA 3CM6A 3ZT2A 2VG7A 4FK0A 5HRRA 2X74A 2FBTA 3OYMA 3HM9A 3ZSOA 2YV0X 2VWKA 3TANA 1Q9YA 3C94A 4DQPA 3HT3A 3KD5E 1DLOA 1S1WA 3DLRA 5HRPA 3LP1A 1C1BA 3KD1E 1JXEA 5CYMA 4AH9A 3F73A 1NOYA 2G8KA 3SZ2A 4O5BA 3WNEA 1KRPA 2P5OA 4OLBA 4DTSA 3HYFA 1Q9XA 4KHUA 3VN5A 1EXQA 1A5VA 3DI6A 4CF2A 1RTJA 3D45A 4IG3A 1RBTA 2IGIA 2HHWA 2BANA 4KO0A 2KZZA 3LPUA 3NCIA 1HJRA 1EETA 4JRQA 3SUQA 1TK8A 2EX3A 3PUFA 4FK2A 1U47A 1U48A 3S3MA 2Q3SA 3SYZA 3OVNA 1NK8A 1SKRA 5KRSA 1GOAA 3SUOA 1X9MA 1KVCA 2YKNA 1Z25A 3SJJA 4FJKA 3HP6A 1IKVA 4OGEA 3V4IA 2YNFA 3SQ2A 3SQ1A 4FJGA 1TKZA 1RDAA 1B9DA 3KLIA 4E1NA 3OJSA 3NH0A 2OPRA 3RTVA 4KFBA 3HO1A 2OA8A 4DS4A 2E6LA 1ZBUA 4Q5VA 1RTIA 1CXQA 1J53A 1VSEA 4BWMA 3KJVA 4DFMA 4BE0A 2HNYA 3QO9A 4KKOA 4O0JA 1SKSA 4B9LA 4FXDA 3SCXA 4CF9A 5J2PA 2HHVA 1NKCA 1ZBFA 2RKIA 4OJRA 4DSKA 4KREA 3HXMA 3THVA 1HYZA 2YKMA 3JYTA 1JL1A 1W9HA 3PY8A 1NJXA 4Q0BA 4WE1A 1CLQA 4ELUA 1C0UA 1NK7A 5CY4A 2G8HA 4CHNA 4DTNA 1Z26A 3LPTA 2VWJA 3SPZA 2LSNA 3C6UA 4CEOA 4BWJA 3MXMA 2QKKA 2I5JA 3OYHA 1BISA 2Y1JA 2KQ2A 3VQCA 4CECA 1UA1A 4FCYA 1J5OA 5JS2A 4FW1A 3ZSXA 2QXFA 3L2UA 1TV6A 4B8CA 1U4BA 1SL1A 4N41A 4M3RA 4M45A 1FKOA 4M3ZA 3P83D 3ZSRA 1BCOA 4AHTA 4CK1A 5SZTA 4FJIA 4FJLA 1HNIA 1VSFA 4DQIA 4KB0A 3VQDA 1FK9A 1ITGA 3PX4A 4HVJA 4LSNA 3K58A 1U04A 2XY5A 2AJQA 3NH1A 4RW8A 5DK5A 4DQQA 1QQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOZ A;  3NGI A;  4DFP A;  3UIQ A;  3L3V A;  1VK0 A;  1S1T A;  4E0D A;  1REV A;  3VQQ A;  1RTH A;  2VG5 A;  2PYJ A;  4CFD A;  4OKE A;  4F3O A;  4N76 A;  4CJ3 A;  1R0A A;  5HBM A;  4CJ4 A;  5HRN A;  4DSI A;  4Z4G A;  2A1S A;  3K5O A;  1RNH A;  4I7F A;  4CJK A;  4UQG A;  3LP2 A;  2P51 A;  3NFA A;  4FM2 A;  2YNI A;  1BHL A;  4HUE A;  1EP4 A;  4ICL A;  4CGG A;  2G8F A;  1IO2 A;  1U45 A;  4CJF A;  2BE2 A;  2F8T A;  1FKP A;  2O4I A;  2F96 A;  1S6Q A;  3VQB A;  3K57 A;  2X6S A;  3VA3 A;  3QET A;  3TI0 A;  3B6O A;  1SKW A;  2HMI A;  2OZM A;  2RN2 A;  4FM0 A;  4YNQ A;  3HPO A;  3TAR A;  2KTQ A;  1VSH A;  4PWD A;  3HVT A;  5C42 A;  2FBV A;  4FLY A;  3AVI A;  3K5N A;  3DRP A;  3MAQ A;  4FJH A;  3RMA A;  2WOM A;  1S6P A;  5J2M A;  2F8S A;  4CJU A;  2D5R A;  3HPG A;  2PZS A;  4JS5 A;  3KK1 A;  4KRF A;  1EX4 A;  4C8K A;  1ZBH A;  3ZSQ A;  3KKS A;  4KAZ A;  4W5R A;  5CYQ A;  3AVL A;  4DWI A;  1JL2 A;  3NGY A;  4DF4 A;  4O44 A;  3K5L A;  2ZQB A;  4DSL A;  3AO5 A;  3TR8 A;  2D0A A;  3KKR A;  4CER A;  3OYL A;  2KFZ A;  3PX6 A;  2QK9 A;  3IS9 A;  4H8K A;  3H08 A;  4E1M A;  4R5P A;  3KTQ A;  2OYQ A;  1LV5 A;  1WSI A;  5D3G A;  4QOZ B;  3MXJ A;  1QE1 A;  1J54 A;  3SQ4 A;  1S9E A;  3T1A A;  4KTZ A;  4KHW A;  4HUF A;  1FXX A;  3A2F A;  3LDS A;  4FJ5 A;  4NYN A;  2HNZ A;  3LWL A;  4FLX A;  4FLV A;  5E41 A;  1ASU A;  3O3H A;  4CEB A;  1RDB A;  1VSL A;  3T3F A;  1VSD A;  3VQ7 A;  2BGG A;  3ZT3 A;  2DFH A;  3OYA A;  3DLG A;  3C6T A;  4DLE A;  1T05 A;  3WNH A;  3DLH A;  4C8O A;  1G15 A;  4QCL A;  1UAX A;  2HHU A;  4B9T A;  1ASV A;  3P5J A;  5KGX A;  4YFU A;  1RDD A;  1SUQ A;  1HNV A;  4E7J A;  3PV8 A;  3V1O A;  3KLH A;  4DSE A;  3G0Z A;  1NK4 A;  3C95 A;  4CJL A;  2WON A;  3O3F A;  2PY5 A;  1ZBL A;  4KHN A;  3RRH A;  2X6N A;  2FBY A;  1JLE A;  3O4N A;  3V9U A;  5HP1 A;  1X9W A;  3OY9 A;  4CHQ A;  3S3N A;  1T8E A;  2G8V A;  2Z1J A;  2E4L A;  2X78 A;  1C1C A;  3O4Q A;  1WAF A;  1HPZ A;  4CIG A;  4B9N A;  4O4G A;  4KHS A;  2HHQ A;  3AVF A;  3P1G A;  4Z4H A;  3CQ8 A;  1CZ9 A;  3ZSW A;  3LZJ A;  2GBZ A;  3AVG A;  3ASM A;  3PO4 A;  1RCH A;  3DRS A;  4FLZ A;  2HB5 A;  4KHQ A;  4J2A A;  1BCM A;  5HRS A;  1KFD A;  3TWH A;  3QNN A;  4IBN A;  2KW4 A;  5DMR A;  1BQN A;  1O1W A;  1QSL A;  4DTX A;  4KTW A;  3V6D A;  1UA0 A;  4CJ5 A;  3QEV A;  4RG8 A;  1RT4 A;  4LH5 A;  5CZ1 A;  4DF8 A;  4Y1D A;  3NBP A;  2B5J A;  5C24 A;  4E19 A;  3NHG A;  3VQP A;  3BDP A;  1XHX A;  4DTM A;  4Z4F A;  2Y1I A;  4Z4E A;  3AA5 X;  1RBS A;  3CM5 A;  4AHC A;  4M41 A;  4O55 A;  1SL0 A;  4CGH A;  1GOB A;  3OYF A;  4CCH A;  2PYL A;  3CFP A;  3TAG A;  1WSG A;  1WSE A;  1K6Y A;  4DFJ A;  3AO2 A;  5HRO A;  3TAM A;  1QSS A;  3RMC A;  2GUI A;  3HVR A;  1HQE A;  4BDP A;  2ETJ A;  2DFF A;  5FRM A;  4JLH A;  4W5O A;  4BDZ A;  4RW9 A;  1RT7 A;  1N5Y A;  3TAB A;  4CF0 A;  1YT3 A;  4AHS A;  2NUB A;  4CHY A;  4DU1 A;  2A1R A;  1X9S A;  4KB1 A;  5J2N A;  3NAE A;  1S5J A;  2D0C A;  1DTT A;  5FRO A;  3WNG A;  4DG1 A;  4MQ3 A;  4ZTJ A;  1SL2 A;  3AVH A;  4CJQ A;  4F2S A;  1KFS A;  3AA2 A;  1KLM A;  5FDL A;  4CGF A;  1RT6 A;  3K59 A;  1RT5 A;  1T03 A;  4AHU A;  4CEF A;  2IC3 A;  3OS0 A;  2HVI A;  1TKX A;  4E7I A;  3FFI A;  3HJF A;  1B92 A;  1N6Q A;  4N47 A;  3VQ4 A;  4M3W A;  4AIL C;  4FZY A;  3V1Q A;  1BIU A;  3V9S A;  4CGI A;  3L3U A;  3SNN A;  5KTQ A;  1LAW A;  1TK5 A;  4I2P A;  1JLF A;  1S1U A;  1TKT A;  5HLF A;  3OYB A;  1QSY A;  1IG9 A;  3AVM A;  2ZE2 A;  3I0S A;  4ELT A;  4B8A B;  1GOC A;  3AVK A;  5KI6 A;  1I3A A;  4E3S A;  1WSH A;  1J9A A;  4RW7 A;  1NKB A;  4M42 A;  1KTQ A;  3VQ9 A;  4FYD A;  2HHS A;  1F21 A;  4OVL A;  3ZT1 A;  4KTQ A;  4IFY A;  3LAK A;  2O4G A;  4CHZ A;  3CFR A;  4DU3 A;  4M3Y A;  1RIL A;  3M8S A;  1BQM A;  1C0T A;  5K14 A;  3KLF A;  3SQ0 A;  3F9K A;  4ID5 A;  4DSF A;  4I9L A;  5C25 A;  2RF2 A;  3E01 A;  4DS5 A;  1MU2 A;  3DLK A;  4E7H A;  2XRI A;  3ISN C;  1RBV A;  1TAU A;  4IDK A;  1RBU A;  3EY1 A;  4DTO A;  3K2P A;  2BDP A;  3RMD A;  3RWU A;  4CK2 A;  4L8R B;  1WN7 A;  3KK3 A;  4CJE A;  1YVU A;  1L3U A;  1L3V A;  4FJN A;  1BI4 B;  2YHB A;  3NF7 A;  1NJW A;  4ZHR A;  4OKK A;  4CEE A;  1TK0 A;  3V81 A;  4IKF A;  3OYN A;  4KI6 A;  1TVR A;  4AHR A;  3TAQ A;  3SI6 A;  2HHT A;  1LWC A;  2OZS A;  3HK2 A;  2HND A;  3G10 A;  3VA0 A;  2FBX A;  3NGZ A;  3T19 A;  3LZI A;  2OPS A;  4CJS A;  1KLN A;  4OLA A;  2P1J A;  2XY7 A;  3OYD A;  4J2B A;  1HMV A;  1IKY A;  3DOL A;  1TL1 A;  4EZ9 A;  3AO3 A;  3M8R A;  3MXI A;  4EZ6 A;  1X1P A;  2EHG A;  5J1E A;  2P5G A;  4QAG A;  3ZT4 A;  3IAY A;  4J2D A;  4FJ8 A;  4BE2 A;  1QHT A;  4FJX A;  1JLA A;  2IAJ A;  3IRX A;  4CGJ A;  3S3O A;  2G8I A;  4CHP A;  4FJM A;  3DYA A;  1NKE A;  1RTD A;  3ZSZ A;  4OGC A;  3RR8 A;  4FJJ A;  1CZB A;  4FLT A;  4FZX C;  2XY8 A;  1WLJ A;  4DTJ A;  3RMB A;  3ZSV A;  5SWM A;  3HPH A;  3LWM A;  4HCC A;  3KK2 A;  3NF8 A;  1BI4 A;  2JLE A;  3V9Z A;  3SUN A;  4G1Q A;  4W5T A;  1NK6 A;  3JSM A;  3L2Q A;  1L5U A;  4F2R A;  4CIE A;  2JGU A;  4CFA A;  4KI4 A;  2D0B A;  1YTU A;  1NJY A;  4K8X A;  4CIF A;  1HYS A;  1IKW A;  1CXU A;  1TAQ A;  4Z4C A;  1D9D A;  4GMJ B;  1D8Y A;  4CES A;  4DQS A;  3ITH A;  4HTU A;  4DTU A;  4HCB A;  1HQU A;  4CGD A;  4KPY A;  2E6M A;  1WSJ A;  3KLG A;  4C8N A;  1XI1 A;  4I9Q A;  4E7K A;  1UWB A;  3CG7 A;  4B9V A;  4PQU A;  4TSX A;  4B9M A;  3DRR A;  5KRT A;  3MEC A;  5I42 A;  1A5X A;  4M3U A;  1BL3 A;  2DTU A;  3DLB A;  3PO5 A;  4NCA A;  3ALY A;  4W5N A;  3TAP A;  1JKH A;  1SV5 A;  3LAN A;  3M8P A;  2HW3 A;  1EKE A;  4B08 A;  4CEA A;  3HL8 A;  1A5W A;  4FM1 A;  1YTA A;  3RR7 A;  1JXB A;  2Z1G A;  4AHV A;  3QEP A;  1RT1 A;  4KV8 A;  4CK3 A;  4PY5 A;  2YNG A;  2ITG A;  1LW0 A;  4Z0U A;  4E89 A;  4B3O A;  2GV9 A;  3EYZ A;  3SUP A;  1NK9 A;  4C8M A;  3KLE A;  3QEX A;  3TAE A;  1NJZ A;  3DOK A;  3O3G A;  3ZCM A;  3S9H A;  1L3S A;  1BGX T;  3CYM A;  2IOC A;  4B9S A;  1JLQ A;  3SV4 A;  2ZD1 A;  4BDY A;  1RT2 A;  2ATQ A;  1LWE A;  3AVJ A;  3AVN A;  3V1R A;  3QES A;  3QEI A;  4B9U A;  3OYJ A;  1BIZ A;  3LP0 A;  4DU4 A;  4ELV A;  4KHY A;  2IS3 A;  1HYV A;  4LH4 A;  4CEQ A;  2XY6 A;  5I3U A;  4OPJ A;  4CF8 A;  3PX0 A;  3QIO A;  1QTM A;  3SV3 A;  1ASW A;  1HRH A;  3AO1 A;  1I39 A;  3AV9 A;  4N5S A;  4DLG A;  3AA3 A;  1JLG A;  3I8D A;  1B9F A;  1VRU A;  1XC9 A;  4CE9 A;  4O0I A;  1WSF A;  2DFE A;  5FRN A;  1S1X A;  3NF6 A;  4FLU A;  1KSP A;  1RBR A;  2KFN A;  3ZT0 A;  2HVH A;  2DY4 A;  3VQ5 A;  4NYF A;  4DQR A;  4DSJ A;  1IKX A;  1VRT A;  1TKD A;  2RPI A;  3M8Q A;  1W0H A;  1C6V A;  1KVB A;  1LW2 A;  2Z1H A;  3OYC A;  3OYG A;  3QNO A;  3B6P A;  1D5A A;  1L3T A;  3OS1 A;  4H4O A;  4PA1 A;  4EP5 A;  4FLW A;  3U6F A;  4K8Z A;  4BE1 A;  3QEW A;  4LSL A;  4CJP A;  1C0M A;  4CF1 A;  3AVB A;  3HST B;  3VQ6 A;  3MEE A;  3OYK A;  4DFK A;  3IG1 A;  3LAL A;  3AA4 A;  1TL3 A;  2OPP A;  4FVM A;  3VQE A;  1Y97 A;  3ULD A;  1DTQ A;  5J2Q A;  2B6A A;  1LWF A;  3HP9 A;  4CED A;  4CFB A;  4W5Q A;  4FJ7 A;  4NCG A;  2OPQ A;  1QS4 A;  5KGW A;  3U3G A;  3OS2 A;  4HUG A;  4FK4 A;  4BAC A;  3OJU A;  2Z1I A;  1VSK A;  3V9W A;  4ZTF A;  3SPY A;  4N56 A;  2YHA A;  3NF9 A;  3AVC A;  3BGR A;  4IFV A;  4J2E A;  2IDO A;  3OYI A;  3LP3 A;  3VQ8 A;  4JRP A;  3L8B A;  4DTP A;  3TAF A;  3NDK A;  1T7P A;  4FJ9 A;  3DLE A;  2YNH A;  3AO4 A;  4ID1 A;  3RRG A;  1Q8I A;  4PUO A;  1WNS A;  1D9F A;  1LAV A;  3LAM A;  3NH2 A;  4E7L A;  4CFC A;  4JS4 A;  3OYE A;  1RT3 A;  3VQA A;  1RDC A;  3MED A;  3NE6 A;  4F8R A;  1C1A A;  1WAJ A;  1KVA A;  4CJR A;  4DMN A;  4CHO A;  3AVA A;  2HHX A;  4GVM A;  4LY7 A;  1TGO A;  1XHZ A;  2XHB A;  3L2W A;  3QER A;  2KZM A;  2B4J A;  3MEG A;  1U49 A;  2QKB A;  3QIN A;  3K5M A;  1JLB A;  4GW6 A;  4CJV A;  3I0R A;  4FW2 A;  1XWL A;  4H4M A;  1VSI A;  3DMJ A;  4FZZ A;  4RW4 A;  3DM2 A;  5JS1 A;  2W42 A;  3WNF A;  3KIO A;  1ZBI A;  1KCF A;  2FC0 A;  4I2Q A;  4M3X A;  2G8W A;  3D0P A;  1UOC A;  3U3Y A;  5EU7 A;  1NK5 A;  4Z4I A;  3ZSY A;  1JLC A;  4RW6 A;  4LD0 A;  4EP4 A;  5CZ2 A;  3L2R A;  4CJT A;  4CEZ A;  4XIU A;  3L2V A;  4OPK A;  5T7B A;  2R7Y A;  4CJW A;  3QIP A;  1VSJ A;  4MFB A;  4DTR A;  4OKJ A;  2VG6 A;  1ZYQ A;  2XO7 A;  1NK0 A;  3V9X A;  2G8U A;  1IH7 A;  4F3T A;  1VSM A;  1S1V A;  3EZ5 A;  4NCB A;  4IG0 A;  3QLH A;  4C8L A;  1S9G A;  3CFO A;  4HHT A;  4F4K A;  4M3T A;  4Y1C A;  3CM6 A;  3ZT2 A;  2VG7 A;  4FK0 A;  5HRR A;  2X74 A;  2FBT A;  3OYM A;  3HM9 A;  3ZSO A;  2YV0 X;  2VWK A;  3TAN A;  1Q9Y A;  3C94 A;  4DQP A;  3HT3 A;  3KD5 E;  1DLO A;  1S1W A;  3DLR A;  5HRP A;  3LP1 A;  1C1B A;  3KD1 E;  1JXE A;  5CYM A;  4AH9 A;  3F73 A;  1NOY A;  2G8K A;  3SZ2 A;  4O5B A;  3WNE A;  1KRP A;  2P5O A;  4OLB A;  4DTS A;  3HYF A;  1Q9X A;  4KHU A;  3VN5 A;  1EXQ A;  1A5V A;  3DI6 A;  4CF2 A;  1RTJ A;  3D45 A;  4IG3 A;  1RBT A;  2IGI A;  2HHW A;  2BAN A;  4KO0 A;  2KZZ A;  3LPU A;  3NCI A;  1HJR A;  1EET A;  4JRQ A;  3SUQ A;  1TK8 A;  2EX3 A;  3PUF A;  4FK2 A;  1U47 A;  1U48 A;  3S3M A;  2Q3S A;  3SYZ A;  3OVN A;  1NK8 A;  1SKR A;  5KRS A;  1GOA A;  3SUO A;  1X9M A;  1KVC A;  2YKN A;  1Z25 A;  3SJJ A;  4FJK A;  3HP6 A;  1IKV A;  4OGE A;  3V4I A;  2YNF A;  3SQ2 A;  3SQ1 A;  4FJG A;  1TKZ A;  1RDA A;  1B9D A;  3KLI A;  4E1N A;  3OJS A;  3NH0 A;  2OPR A;  3RTV A;  4KFB A;  3HO1 A;  2OA8 A;  4DS4 A;  2E6L A;  1ZBU A;  4Q5V A;  1RTI A;  1CXQ A;  1J53 A;  1VSE A;  4BWM A;  3KJV A;  4DFM A;  4BE0 A;  2HNY A;  3QO9 A;  4KKO A;  4O0J A;  1SKS A;  4B9L A;  4FXD A;  3SCX A;  4CF9 A;  5J2P A;  2HHV A;  1NKC A;  1ZBF A;  2RKI A;  4OJR A;  4DSK A;  4KRE A;  3HXM A;  3THV A;  1HYZ A;  2YKM A;  3JYT A;  1JL1 A;  1W9H A;  3PY8 A;  1NJX A;  4Q0B A;  4WE1 A;  1CLQ A;  4ELU A;  1C0U A;  1NK7 A;  5CY4 A;  2G8H A;  4CHN A;  4DTN A;  1Z26 A;  3LPT A;  2VWJ A;  3SPZ A;  2LSN A;  3C6U A;  4CEO A;  4BWJ A;  3MXM A;  2QKK A;  2I5J A;  3OYH A;  1BIS A;  2Y1J A;  2KQ2 A;  3VQC A;  4CEC A;  1UA1 A;  4FCY A;  1J5O A;  5JS2 A;  4FW1 A;  3ZSX A;  2QXF A;  3L2U A;  1TV6 A;  4B8C A;  1U4B A;  1SL1 A;  4N41 A;  4M3R A;  4M45 A;  1FKO A;  4M3Z A;  3P83 D;  3ZSR A;  1BCO A;  4AHT A;  4CK1 A;  5SZT A;  4FJI A;  4FJL A;  1HNI A;  1VSF A;  4DQI A;  4KB0 A;  3VQD A;  1FK9 A;  1ITG A;  3PX4 A;  4HVJ A;  4LSN A;  3K58 A;  1U04 A;  2XY5 A;  2AJQ A;  3NH1 A;  4RW8 A;  5DK5 A;  4DQQ A;  1QQC A; 
#chains in the Genus database with same CATH topology
 1NGH A;  2IVN A;  1SZ2 A;  1VK0 A;  4DV1 K;  1RTH A;  3EE8 A;  3M6G A;  3VEV A;  3O1W A;  3MCA B;  1BDG A;  1Y64 A;  4Z4G A;  4UQG A;  3NFA A;  1WUA A;  4ICL A;  2G8F A;  1IO2 A;  3CCM N;  1FKP A;  1S6Q A;  3K57 A;  3TI0 A;  2RN2 A;  4FM0 A;  3HPO A;  2KTQ A;  4DR7 K;  5C42 A;  3EZW A;  1XNR K;  3RMA A;  2YHX A;  3CIP A;  4CJU A;  3HPG A;  3OW2 M;  3KK1 A;  1ATN A;  1RGI A;  1ZBH A;  4KAZ A;  3AVL A;  5AQV A;  3E9P A;  4O44 A;  3K5L A;  3AO5 A;  3KKR A;  2QK9 A;  5C0Y A;  4R5P A;  1EWR A;  3H08 A;  1BG3 A;  1QE1 A;  3NVK A;  1J54 A;  3BP8 A;  4DUZ K;  4CZH A;  3TSU A;  1KAY A;  1RDB A;  1VSL A;  3T3F A;  3H45 C;  3VQ7 A;  2O8D A;  3OYA A;  4DLE A;  2DPN A;  1T05 A;  3LDQ A;  4QCL A;  1UAX A;  3CQX A;  3ZLJ A;  1SUQ A;  4E7J A;  1T3V A;  3O5B A;  3FZH A;  4CD1 A;  1IBK K;  3GG4 A;  3O4N A;  3O80 A;  1X9W A;  3KWI A;  2CGK A;  2G8V A;  4DB3 A;  2X78 A;  1GLA G;  4CIG A;  1WAF A;  4KHS A;  3IMX A;  4O4G A;  1M90 O;  1E3M A;  5AQX A;  3LZJ A;  3ZSW A;  3AVG A;  1QQO A;  2QA4 N;  1VQL N;  4WCE L;  2HB5 A;  4JKB A;  2E2O A;  3CCE N;  2QXL A;  3D2E A;  4PKI A;  1QSL A;  1UA0 A;  3QEV A;  4RG8 A;  4PL8 A;  4LH5 A;  3CCJ N;  3ZX3 A;  5C10 A;  3FLC O;  5KQD A;  2Q0R A;  4WYB A;  4YOV A;  2Y1I A;  4Z4E A;  4JKH A;  1RBS A;  1K8K A;  4JI5 K;  2P9S A;  4CGH A;  4YDU C;  1HJO A;  1P8Z A;  4BR0 A;  3OYF A;  3BZC A;  4DR4 K;  2PYL A;  1Z6R A;  1QSS A;  4WQ4 A;  4B3M K;  2A42 A;  4W5O A;  4BDZ A;  2ASO A;  3O8M A;  5AQI A;  4KB1 A;  5J2N A;  3NAE A;  4DG1 A;  4ZTJ A;  4CJQ A;  4F2S A;  3AA2 A;  3C6H A;  5C2F A;  4BY9 C;  5DM7 L;  1VQ4 N;  3HJF A;  3SLC A;  1RFQ A;  1N6Q A;  3KK7 A;  1BIU A;  3O9S A;  5AQK A;  4GV9 A;  1TK5 A;  4I2P A;  1JLF A;  1TKT A;  5HLF A;  1QSY A;  4B8A B;  3AVK A;  3A5L C;  1VHX A;  3AGK A;  4FYD A;  5AZI B;  2IVO A;  4OVL A;  4KTQ A;  1T6C A;  4LF9 K;  3WXK A;  5GIN A;  3KLF A;  4YOX A;  3SQ0 A;  3D2F B;  2E2Q A;  4I9L A;  2RF2 A;  4DS5 A;  3BF1 A;  4I6M B;  2A3Z A;  5M1P A;  4E7H A;  4YOT A;  3EY1 A;  4DTO A;  3K2P A;  4X66 K;  3RMD A;  1DKG D;  1ZXO A;  4CK2 A;  3DXK A;  2PFU A;  2HST A;  4IO9 L;  1W7A A;  1YVU A;  5AQO A;  4ZHR A;  5LJV A;  1ESV A;  4KI6 A;  1TVR A;  4AHR A;  3C6A A;  3VEO A;  1LWC A;  2OZS A;  3VTI A;  3G10 A;  5C2D A;  3T19 A;  2OPS A;  4CJS A;  1KLN A;  1HMV A;  1IKY A;  3DOL A;  3AO3 A;  3MXI A;  4QAG A;  4J2D A;  1IG8 A;  3M3Z A;  3R1X A;  3P4I A;  1JLA A;  4CGJ A;  4FJM A;  4JHD B;  4FJJ A;  3SAH A;  4HCC A;  4NO7 A;  1BI4 A;  4BQL A;  1J5E K;  4G1Q A;  4R79 A;  3JSM A;  1XC3 A;  1GLD G;  2JGU A;  2O8B B;  1NJY A;  1HYS A;  4XEI A;  4CES A;  4DQS A;  1NM1 A;  2IVP A;  3E1Y A;  4JI2 K;  4HCB A;  1WSJ A;  1VQK N;  4C8N A;  1XI1 A;  4I9Q A;  4PQU A;  4TSX A;  5KRT A;  5JLH A;  2FSN A;  5MLC Q;  5I42 A;  2DTU A;  3DLB A;  3CC4 N;  3I55 N;  4W5N A;  4JEP A;  1K8K B;  4FWL A;  1SV5 A;  2HW3 A;  4FWR A;  5BN8 A;  2PBD A;  3RR7 A;  2Z1G A;  1MDU B;  5LL6 Z;  4E89 A;  2ITG A;  4Z0U A;  2GV9 A;  5BPN A;  2P9P B;  3SUP A;  3F2K A;  4C8M A;  3KLE A;  3TAE A;  3DOK A;  1L3S A;  5M1N A;  1BGX T;  4YOY A;  4BRC A;  4GY2 B;  3PSI A;  1RT2 A;  3QES A;  3V1R A;  1OH7 A;  1BIZ A;  4DU4 A;  2UXB K;  4KHY A;  4CEQ A;  3NVM A;  2O8D B;  2E5L K;  2NRV A;  4V19 S;  1QHA A;  1YI2 N;  1XC9 A;  1GLB G;  3NF6 A;  3H3O B;  4EAH D;  4LF5 K;  3ZT0 A;  3LDN A;  4DSJ A;  4DQR A;  3U8X A;  3FZK A;  3ZEU B;  2Z1H A;  1KVB A;  1LW2 A;  2VGM A;  3HOT A;  4BR4 A;  2ITM A;  3L0Q A;  3ENB A;  4BE1 A;  3QEW A;  3O9T A;  5LJW A;  1KQS M;  4WFN L;  1WBB A;  1ZC6 A;  1N8R O;  2OTL N;  1TL3 A;  2OPP A;  1Y97 A;  1DTQ A;  5KGW A;  3OS2 A;  3I56 N;  4HUG A;  2QEX N;  2A6A A;  5KPR A;  4BAC A;  4FK4 A;  2Z1I A;  1VSK A;  3NF9 A;  3AVC A;  3BGR A;  3CC7 N;  3L8B A;  4DTP A;  3WXJ A;  4EHU A;  2JWK A;  3DLE A;  5KPT A;  2YNH A;  3TTF A;  3AO4 A;  1N32 K;  1LAV A;  3CJC A;  3OYE A;  1KVA A;  4CJR A;  4DMN A;  2NRH A;  3AVA A;  3QB0 A;  2QI2 A;  2Q31 A;  4GVM A;  4LY7 A;  1XHZ A;  1SAZ A;  1U49 A;  4BVO A;  3QIN A;  1JLB A;  3I0R A;  1NGB A;  4FZZ A;  3BZK A;  2W42 A;  5AQS A;  4I2Q A;  5EU7 A;  4Z4I A;  3ZSY A;  2WTU A;  3L2V A;  3FGU A;  5CZ2 A;  4CJT A;  4XIU A;  3VOV A;  5M1O A;  4OPK A;  4QOZ B;  3QIP A;  4OKJ A;  1ZYQ A;  2XO7 A;  4F3T A;  4NCB A;  4IG0 A;  2HF4 A;  4WQ4 C;  1YXQ A;  2VG7 A;  2X74 A;  3OYM A;  4JKG B;  2YV0 X;  3TAN A;  4IWV A;  3HT3 A;  4K25 A;  3DLR A;  3N4P A;  5HRP A;  2E8A A;  3IUC A;  5AZJ A;  3HOS A;  4IOC L;  5CYM A;  1S72 N;  4O5B A;  3W0L A;  1VQM N;  4BRF A;  1EXQ A;  4CF2 A;  3D45 A;  2P9U B;  1RBT A;  2BAN A;  4KO0 A;  3NCI A;  4H5V A;  3SUQ A;  1SQK A;  3CET A;  3N4Q A;  3PUF A;  4IJA A;  3WUH A;  5M1K A;  4C1N I;  1U48 A;  3S3M A;  3OVN A;  2YCH A;  2YHW A;  5KRS A;  5FLX O;  2GUP A;  2YJF A;  2YNF A;  5FPN A;  4EIA A;  2E1Y A;  3OJS A;  3NH0 A;  4IOA L;  4DS4 A;  2E6L A;  2YJE A;  1RTI A;  1CXQ A;  1J53 A;  4DFM A;  3A5O C;  3A5N C;  2HNY A;  1CZA N;  5J2P A;  3SAG A;  1NKC A;  1ZBF A;  4OJR A;  1BO5 O;  1JCF A;  2W6K A;  4Q0B A;  4JI3 K;  4ELU A;  4DTN A;  2VWJ A;  2LSN A;  3C6U A;  4BWJ A;  3QIC A;  3OYH A;  4FOE A;  2KQ2 A;  1UA1 A;  1IBM K;  3ZYY X;  4YY3 K;  1TV6 A;  3RSE B;  4K43 A;  4BRM A;  4J8F A;  3ULE B;  4FJL A;  5F0X A;  3VQD A;  3JAM O;  4HVJ A;  4NXN K;  2OCE A;  3SBG A;  4H03 B;  1VAZ A;  2XY5 A;  4GV6 A;  5DK5 A;  1QQC A;  1QVF M;  1NOZ A;  4DFP A;  3L3V A;  2P9L B;  4RCH A;  2ZJR L;  1NGD A;  4BC2 A;  4CJK A;  3LP2 A;  3CCS N;  1BHL A;  4HUE A;  3TTD A;  5BR8 K;  4CJF A;  2BE2 A;  1HLU A;  2HMI A;  4ISE A;  1HNX K;  3DXM A;  3B6O A;  3O1B A;  3O9Q A;  4YNQ A;  1VSH A;  4PWD A;  1KXP A;  3K5N A;  3MAQ A;  2WOM A;  1S6P A;  2P9K B;  3L4Q A;  3J8A A;  4JS5 A;  4KRF A;  1EX4 A;  3KKS A;  3VPZ A;  4BR5 A;  3MCP A;  3QBX A;  4AM7 A;  2PAV A;  1JL2 A;  3NGY A;  4DSL A;  5AQZ A;  2D0A A;  3OYL A;  4A5B A;  1V4T A;  3KTQ A;  4E1M A;  1KD1 O;  5D3G A;  3ENO A;  2KHO A;  2D1K A;  3LDO A;  3JXU A;  1FXX A;  3A2F A;  3UKR A;  4FJ5 A;  4ISG A;  3CCL N;  1OH8 A;  4DR1 K;  4CEB A;  3RSE A;  2FSK A;  3THX A;  3J7Z O;  3DLG A;  4C8O A;  3WNH A;  4F9O A;  4B9T A;  1ASV A;  4IEE A;  4BRA A;  1U2V A;  3PV8 A;  3V1O A;  3KLH A;  1NK4 A;  4CJL A;  1ZBL A;  3RRH A;  3SBT A;  2X6N A;  1JLE A;  1MWM A;  3CF5 L;  1XQS C;  4CHQ A;  3S3N A;  1C1C A;  1HPZ A;  5EOY A;  3VER A;  4PHT X;  5B8H A;  1GLL O;  4FLZ A;  2F7T A;  5HRS A;  3MK6 A;  5TKW A;  2ASP A;  4O8K A;  5BRD A;  3MWT A;  5DMR A;  3DJC A;  3AGR A;  1M1K O;  3H6E A;  2FXU A;  4NLC A;  1OH5 A;  3BDP A;  3EN9 A;  4BRQ A;  4BRG A;  3CM5 A;  4AHC A;  3G25 A;  4O55 A;  2NNW A;  1SL0 A;  3HM8 A;  4CBX A;  3Q7B A;  4DFJ A;  1D4X A;  4BRL A;  1W2B M;  5CE3 A;  2O8F B;  3RMC A;  2GUI A;  3HVR A;  2ETJ A;  4JLH A;  1QZ5 A;  3THX B;  1T6D A;  3CCR N;  1RT7 A;  1N5Y A;  3P38 A;  4CF0 A;  3ENH A;  1YT3 A;  4DU1 A;  2A1R A;  1X9S A;  1S5J A;  1O13 A;  2D0C A;  5FRO A;  3OBW A;  3EKS A;  4MQ3 A;  1SL2 A;  1KFS A;  1KLM A;  5FDL A;  4BR2 A;  2IC3 A;  3OS0 A;  2HVI A;  4E7I A;  3FFI A;  3C0B A;  1B92 A;  4N47 A;  3VQ4 A;  3DXK B;  5KTQ A;  1LAW A;  2KLA A;  3J80 O;  4JK8 A;  1IG9 A;  3AVM A;  2ZE2 A;  5KI6 A;  1TYQ A;  1I3A A;  3CJ1 A;  3VQ9 A;  3ZT1 A;  4DV7 K;  2ZGZ A;  3KWG A;  4FOI A;  3KHY A;  1BQM A;  1C0T A;  1WBD A;  3F9K A;  4ID5 A;  3THW B;  4JKC A;  5F2R A;  3QBW A;  1TAU A;  4IDK A;  1RBU A;  2BDP A;  1U6Z A;  1WN7 A;  2UXC K;  4FJN A;  1NJW A;  2F9W A;  3NF7 A;  4CEE A;  3V81 A;  3OYN A;  3TAQ A;  3SI6 A;  1DGK N;  2A5X A;  3UE5 A;  3HK2 A;  3CMA N;  4OLA A;  2P1J A;  5BRH A;  3OYD A;  3H3N O;  4DQ8 A;  1TL1 A;  1LOT B;  3M8R A;  3ZX2 A;  4I6M A;  2P5G A;  1YUW A;  3IAY A;  4CBU A;  4H0P A;  2V7Z A;  3VF6 A;  1NKE A;  1RTD A;  4OGC A;  3TTC A;  4NXM K;  3SJH A;  4JI8 K;  3RMB A;  5GIP A;  4CZE A;  3HPH A;  3VEY A;  3KK2 A;  3NF8 A;  2JLE A;  4F2R A;  4FWM A;  4CIE A;  5AQM A;  3GE1 A;  2D0B A;  3K9K A;  4FL9 A;  3A0I X;  1Q81 O;  4K8X A;  1TAQ A;  4GMJ B;  2Q0U A;  3ITH A;  3VGL A;  4Z94 A;  3UKU B;  3VEW A;  4E7K A;  1UWB A;  3CI5 A;  3HTV A;  1TUU A;  4M3U A;  3PO5 A;  4NCA A;  3TAP A;  4ILJ A;  2O8B A;  1YTA A;  4PY5 A;  4KV8 A;  2YNG A;  1NJZ A;  3W3D A;  3S9H A;  2IOC A;  1NU0 A;  3H1Q A;  3SV4 A;  3K0S A;  4LF8 K;  2ZD1 A;  3LDP A;  2ATQ A;  3AVJ A;  3AVN A;  5AZI A;  5I3U A;  1N34 K;  4CF8 A;  3PX0 A;  3AAQ A;  1ASW A;  4KH6 A;  4MLH A;  3AA3 A;  1JLG A;  2E20 A;  1VRU A;  3D2F A;  2VCP A;  1S1X A;  2Q36 A;  2RHK A;  2HBK A;  4BC4 A;  1RBR A;  1KSP A;  2HVH A;  2DY4 A;  5C12 A;  1XNQ K;  1IKX A;  1VQ9 N;  1TKD A;  2RPI A;  5M1Q A;  1W0H A;  1NG9 A;  1YJW N;  1L3T A;  3B6P A;  1D5A A;  5AQU A;  4PA1 A;  3QDK A;  3BEX A;  4EP5 A;  4K8Z A;  5EX5 A;  4B9Q A;  2W40 A;  4CW7 B;  3OTO K;  4CF1 A;  3OYK A;  3MEE A;  3CER A;  2VQE K;  3IG1 A;  4DFK A;  1MA9 B;  3ULD A;  5J2Q A;  3HP9 A;  4CED A;  4W5Q A;  4NCG A;  3ZET A;  3C7N B;  5I9E B;  4DV3 K;  4N56 A;  4J2E A;  3OYI A;  4BC5 A;  3LP3 A;  2QWL A;  5E84 A;  1T7P A;  4DV6 K;  4ID1 A;  2O8C A;  4PUO A;  2HOE A;  2HBL A;  4CFC A;  1RDC A;  3MED A;  3TU5 A;  4DV0 K;  4H5N A;  3A8Y A;  3UKR B;  1NWK A;  1U2V B;  3WT0 A;  2XHB A;  5BRE A;  3L2W A;  3QER A;  2KZM A;  2B4J A;  2QKB A;  3PIP L;  3K5M A;  4A57 A;  4GW6 A;  1VSI A;  1KAX A;  3DM2 A;  3KIO A;  4X64 K;  3D0P A;  4BQZ A;  4DUY K;  4QS9 A;  2W6L A;  3CPW M;  4EP4 A;  4MO4 A;  4NB4 A;  4CEZ A;  5T7B A;  2R7Y A;  2GEM A;  3H46 O;  1VSJ A;  2G8U A;  2VG6 A;  3V9X A;  3J81 O;  1IH7 A;  1VSM A;  4YDU A;  2VQF K;  2A40 A;  4F4K A;  4Y1C A;  4JKA A;  3SMS A;  3FZL A;  3HM9 A;  1YJ9 N;  4DQP A;  4BRP A;  2YI1 A;  4JK7 A;  4JI1 K;  3KD1 E;  4DR5 K;  3F73 A;  2CGJ A;  2P5O A;  4DTS A;  1Q9X A;  4KHU A;  3VN5 A;  4LFA K;  1A5V A;  2UXD K;  5ELZ A;  5CR4 A;  4FK2 A;  2V7Y A;  1U47 A;  4UY8 O;  5FPM A;  1NK8 A;  1X9M A;  1GOA A;  4IO8 A;  3MN7 A;  3HP6 A;  4OGE A;  3F5T A;  3SQ1 A;  1TKZ A;  5AQH A;  1HKB A;  3RTV A;  4E1N A;  2ZWH A;  1JCE A;  4BWM A;  3DAW A;  3QO9 A;  3ATU A;  4FXD A;  2P9L A;  2RKI A;  4B3S K;  4DSK A;  4DR3 K;  1HYZ A;  4BC3 A;  2NRT A;  4GV3 A;  2QWO A;  5CY4 A;  4NLB A;  3MXM A;  5BPM A;  2QKK A;  3VTH A;  4BRH A;  4OX9 K;  3TSQ A;  2UYT A;  4IZ9 A;  1U4B A;  1SL1 A;  4N41 A;  3ZSR A;  1BCO A;  3DWL A;  4FSV A;  4CK1 A;  2E2N A;  4FJI A;  5AR0 A;  4DQI A;  4H0X B;  4IJN A;  1ITG A;  4LSN A;  3K58 A;  2AJQ A;  3NH1 A;  3A5M C;  4DQQ A;  3NGI A;  1S1T A;  3WEE A;  1IBL K;  4E0D A;  3VQQ A;  2PYJ A;  2VG5 A;  3F9M A;  5LMN K;  4CFD A;  4OKE A;  2RE2 A;  5HL7 L;  5HBM A;  4CJ4 A;  5HRN A;  1BA0 A;  4DSI A;  3K5O A;  1RNH A;  4XH4 A;  1X3M A;  1EP4 A;  4CGG A;  2F8T A;  2F96 A;  3VQB A;  1Q86 O;  1SKW A;  2OZM A;  3HVT A;  2AP1 A;  2J4R A;  3AVI A;  1QZ6 A;  4FJH A;  2BTF A;  2D5R A;  2PZS A;  4CZI A;  4W5R A;  3O9R A;  4KBO A;  4DF4 A;  2ZQB A;  1BWF O;  3TR8 A;  2KFZ A;  4CER A;  3PX6 A;  3IS9 A;  4H8K A;  2OYQ A;  1WSI A;  3MXJ A;  3AAP A;  3EO3 A;  1S9E A;  3T1A A;  4KTZ A;  4WF9 L;  2P9S B;  2Q2R A;  4HUF A;  3LDS A;  1C0G A;  2HNZ A;  3LWL A;  4MO5 A;  3O3H A;  2OTJ N;  1VSD A;  2BGG A;  3ZT3 A;  1G15 A;  1V4S A;  3HBT A;  3MX5 A;  4PKH A;  5C15 A;  3P5J A;  4YFU A;  4K0K K;  1P90 A;  3C95 A;  1R59 O;  3O3F A;  2PY5 A;  3CD6 N;  2FBY A;  5AQT A;  3MX2 A;  3V9U A;  5HP1 A;  1T8E A;  4CZG A;  4B9N A;  3R6M A;  2HHQ A;  2QW9 A;  3MN9 A;  4JYA K;  5AQY A;  2D4W A;  3OBY A;  3ASM A;  3I8B A;  3DRS A;  1YAG A;  5GAD P;  3LM9 A;  1BCM A;  1KFD A;  3E66 A;  4LFB K;  3MDQ A;  1ILY A;  4A59 A;  4KHP K;  1O1W A;  3O9U A;  3V6D A;  4KTW A;  3K9J A;  1RT4 A;  2P9U A;  4JI0 K;  4DF8 A;  3O6W A;  4Y1D A;  4E19 A;  4M7Y A;  3VQP A;  5JVH L;  1JCG A;  4DTM A;  2ASM A;  3IFR A;  5JLF A;  1K9M O;  1OVQ A;  3B8A X;  3DLL L;  3ZX0 A;  4A5A A;  3AO2 A;  5HRO A;  4BDP A;  1HQE A;  4IEI A;  1OH6 A;  4AHS A;  2NUB A;  4CHY A;  2P9K A;  1DTT A;  3WNG A;  3KZB A;  3AVH A;  1MWK A;  2HHH K;  1RT5 A;  1T03 A;  1GLC G;  4CEF A;  1TUY A;  4LF7 K;  2UUA K;  1TKX A;  4M3W A;  5LY3 A;  4AIL C;  3V1Q A;  4DV4 K;  2UU9 K;  3BF3 A;  3V9S A;  3L3U A;  1HNZ K;  1GLE G;  4BRO A;  1KC8 O;  1S1U A;  3OYB A;  3GBT A;  4ELT A;  1H1V A;  1GOC A;  4E3S A;  4DV2 K;  1KTQ A;  5AQJ A;  1F21 A;  1YJN N;  4IFY A;  4CHZ A;  2QM1 A;  4LFC K;  2BUP A;  4DU3 A;  3M8S A;  3PLA A;  3DLK A;  4K42 A;  4BG8 A;  3CQY A;  1Q82 O;  3ISN C;  4O8U A;  3RWU A;  2IIR A;  4L8R B;  2F9T A;  2QWM A;  4H5T A;  4CJE A;  1L3V A;  3ATV A;  2YHB A;  1TK0 A;  4IKF A;  1C0F A;  3O08 A;  1N36 K;  2HHT A;  2HND A;  2HBM A;  3TPQ A;  4JD2 A;  4EZ9 A;  4OPA A;  5A2Q O;  3IKM A;  2EHG A;  4FWN A;  5J1E A;  4FJ8 A;  3ZT4 A;  4GKK K;  3ZEU A;  3IRX A;  2G8I A;  1KAZ A;  3RR8 A;  1JJ2 M;  2XY8 A;  1WLJ A;  3ZSV A;  3LWM A;  3AAR A;  1Z05 A;  3V9Z A;  3GL1 A;  4W5T A;  2I7P A;  4KI4 A;  1GLJ O;  4CIF A;  1CXU A;  4Z4C A;  1D9D A;  1D8Y A;  4FWP A;  4JK9 A;  3QFU A;  4HTU A;  4DTU A;  4CGD A;  4AQY K;  2E6M A;  1GLF O;  2E88 A;  4G9Z A;  3D7E O;  4B9V A;  4IOX A;  4H0V B;  1BOT O;  1A5X A;  3U9Z A;  1BL3 A;  3M8P A;  1EKE A;  4WFB L;  3HL8 A;  4JI6 K;  4FM1 A;  1JXB A;  1RT1 A;  1LW0 A;  4B3O A;  3EYZ A;  4FO0 A;  4YHH K;  4CZK A;  4IDH A;  1JLQ A;  4BDY A;  3O4W A;  4U67 L;  1LWE A;  1OVY A;  4B9U A;  3LP0 A;  4ELV A;  4FWO A;  2IS3 A;  1HYV A;  2ZGY A;  1VQP N;  3CJ7 A;  5LMU K;  2XY6 A;  1T44 A;  4JKE A;  1ZBS A;  1HRH A;  4DLG A;  3AV9 A;  3M5R A;  5AQQ A;  1E4F T;  2HMP A;  1B9F A;  3I8D A;  3THW A;  4CE9 A;  1XMO K;  4O0I A;  1WSF A;  2DFE A;  1S22 A;  5ADX H;  4FLU A;  5AQR A;  3MWP A;  1EQY A;  3OA9 A;  4JNE A;  4NYF A;  1XUP O;  3M8Q A;  1C6V A;  2ZM6 K;  3OYG A;  2O8F A;  3OS1 A;  4H4O A;  4LF6 K;  4FLW A;  3U6F A;  5GIO A;  4CJP A;  1C0M A;  5DM6 L;  3AVB A;  3HST B;  1VQ6 N;  3LAL A;  4FVM A;  4U7B A;  5AZJ B;  1YIT N;  4CFB A;  4FJ7 A;  5E26 A;  2OPQ A;  1YHQ N;  3LM2 A;  3SAF A;  4DR2 K;  2JWL A;  3OJU A;  4B1V A;  4QS8 A;  3CJA A;  2WC9 A;  2IDO A;  4RTF D;  3VQ8 A;  1N33 K;  4BRN A;  3E9L A;  3EEQ A;  5GAG P;  3EKU A;  3RRG A;  4CZJ A;  1D9F A;  3LAM A;  3NH2 A;  4JS4 A;  4F8R A;  3VQA A;  2VWB A;  1C1A A;  3PIO L;  4CHO A;  2F4V K;  3CME N;  4BG9 A;  4BR9 A;  3MEG A;  2FF6 A;  1J6Z A;  1NGA A;  1E4G T;  1XWL A;  4BGB A;  3DMJ A;  2O8E B;  5JS1 A;  1ZBI A;  1KCF A;  2FC0 A;  3U3Y A;  1NK5 A;  3G71 N;  1JLC A;  2P9I A;  4RW6 A;  3L2R A;  3CJ9 A;  5EY4 A;  2O8C B;  4MFB A;  1NK0 A;  3C65 A;  1W97 L;  4BRI A;  4EHT A;  3EZ5 A;  2AA4 A;  3QLH A;  4C8L A;  4B3R K;  4HHT A;  4JAX A;  4M3T A;  3CM6 A;  3ZT2 A;  4FK0 A;  5HRR A;  2FBT A;  3ZSO A;  2VWK A;  1Q9Y A;  3KD5 E;  3C94 A;  1DLO A;  3LP1 A;  3MN5 A;  1JXE A;  4AH9 A;  4M63 C;  3WNE A;  1KRP A;  4OLB A;  3RVC A;  3DI6 A;  4A2B A;  3EE9 A;  4IG3 A;  2HHW A;  2IGI A;  3LPU A;  4JRQ A;  5BR9 A;  2NRX A;  3QML A;  2UUB K;  4EFH A;  4OPH A;  4CJ7 A;  4H0O A;  2Q3S A;  3SYZ A;  4ILG B;  4KH5 A;  2A41 A;  1Z25 A;  4FJK A;  3LDL A;  3SQ2 A;  1RDA A;  4YOU A;  1X9J A;  1B9D A;  3KLI A;  3HO1 A;  1S3X A;  2OPR A;  1VQO N;  3FR0 A;  1NBW A;  2WBN A;  2OA8 A;  5AJ3 K;  1VSE A;  3KJV A;  5AQF A;  4B9L A;  4CF9 A;  3U4L A;  3LL3 A;  3WQU A;  3CCQ N;  3HXM A;  3THV A;  2YKM A;  3JYT A;  1JL1 A;  1W9H A;  3PY8 A;  2E2P A;  4WE1 A;  3SMP A;  1CLQ A;  1C0U A;  1NK7 A;  1VQ7 N;  2G8H A;  3LPT A;  5BN9 A;  4JN4 A;  4C23 A;  4DV5 K;  3WQT A;  2QWQ A;  4GVE A;  2FF3 B;  4WQ5 C;  4E1J A;  3VQC A;  1J5O A;  3ZSX A;  4A2A A;  2P9N A;  1NMD A;  2QXF A;  2QTD A;  3FFK B;  3Q7C A;  4M3R A;  4M3Z A;  5SZT A;  1HNI A;  1VSF A;  5AQW A;  1VQ5 N;  3GDQ A;  3EL2 A;  4M7X A;  3UIQ A;  3UB5 A;  2QWR A;  1REV A;  4K41 A;  4F3O A;  4N76 A;  4CJ3 A;  3CCV N;  1R0A A;  4FVU A;  3R8E A;  2A1S A;  1VQ8 N;  4I7F A;  1Q18 A;  4CZL A;  1K8A O;  2P51 A;  4JI4 K;  4FM2 A;  2YNI A;  4H5R A;  1IJJ A;  2OAN A;  4X65 K;  1U45 A;  2ZJP L;  5BRF A;  2Q97 A;  1ATS A;  2O4I A;  3QET A;  2X6S A;  2P9P A;  1SS6 A;  3TAR A;  2FBV A;  1HUX A;  4FLY A;  3VF4 A;  3DRP A;  1NMN A;  5J2M A;  2F8S A;  1I94 K;  5ADX A;  1TYQ B;  3E9O A;  5H1S Q;  4C8K A;  3ZSQ A;  1BUP A;  5CYQ A;  4DWI A;  1OKJ A;  1YF5 L;  1DT9 A;  2HF3 A;  4BVP A;  2CH5 A;  4JI7 K;  5AQG A;  4DR6 K;  4JD2 B;  5AFU H;  4JHD A;  2V52 B;  1LV5 A;  1NGC A;  1HX1 A;  4LF4 K;  3P31 A;  1FJG K;  3SQ4 A;  4KHW A;  1K73 O;  5JMV A;  4NYN A;  4FLX A;  4FLV A;  4CD3 A;  5E41 A;  1ASU A;  4XH1 A;  3G4S N;  1NLV A;  2DFH A;  3C6T A;  5CHI A;  3DLH A;  4H0Y B;  3D2E B;  5KGX A;  2YX6 A;  1RDD A;  4A61 A;  4QS7 A;  3WXM B;  1HNV A;  3R9P A;  4DSE A;  1EO1 A;  3G0Z A;  5GAE P;  3TSP A;  2WON A;  4KHN A;  3OY9 A;  2Z1J A;  2E4L A;  3O4Q A;  3U9D A;  1ATR A;  3AVF A;  3P1G A;  2FLO A;  4Z4H A;  3CQ8 A;  1CZ9 A;  2GBZ A;  3PO4 A;  4MDB A;  1RCH A;  3MMV A;  4KHQ A;  4J2A A;  4RWT A;  3TWH A;  3PSF A;  3QNN A;  4IBN A;  2KW4 A;  3AY9 A;  3WXL A;  1BQN A;  4DTX A;  2EWS A;  4CJ5 A;  4CZM A;  4B1Y B;  3ZET B;  2KKZ A;  5CZ1 A;  5AQP A;  3CPE A;  3NBP A;  2B5J A;  5C24 A;  3NHG A;  3QFP A;  3GOI A;  3R3L A;  1NGJ A;  5KPZ A;  1XHX A;  4Z4F A;  3AA5 X;  4M41 A;  3VEX A;  4CBW A;  2NRW A;  1GOB A;  4CCH A;  4WQ5 A;  3CFP A;  3TAG A;  1WSG A;  1HNW K;  1WSE A;  1K6Y A;  4ILH A;  1RDU A;  2P9I B;  3TAM A;  3SK3 A;  5F1X A;  2DFF A;  5FRM A;  4RW9 A;  1DEJ A;  3TAB A;  3THY B;  4FWK A;  2D0O A;  1G99 A;  4MDA A;  1IV0 A;  1BU6 O;  2W41 A;  2ZF5 O;  1VQN N;  4CGF A;  1RT6 A;  3K59 A;  4AHU A;  4B3T K;  4CI6 A;  3VES A;  3HRG A;  3JS6 A;  1HPM A;  4CGI A;  3SNN A;  2ZJQ L;  4BGA A;  3I0S A;  3BY5 A;  1HR0 K;  1WSH A;  1J9A A;  4RW7 A;  1NKB A;  4M42 A;  2HHS A;  4HTL A;  4H5W A;  2GEL A;  3LAK A;  4LC9 B;  2O4G A;  3CFR A;  4M3Y A;  1RIL A;  3T7Z A;  5EXW A;  2NRZ A;  5K14 A;  4X62 K;  4DSF A;  3UKU A;  3E01 A;  5C25 A;  1MU2 A;  3WEE B;  2YHY A;  2XRI A;  2UUC K;  3VEZ A;  1EWQ A;  1RBV A;  1WOQ A;  5AQN A;  5FPE A;  3VGM A;  4DHY A;  4OO1 J;  4WFA L;  3KK3 A;  1L3U A;  3CJB A;  4JKG A;  1NGE A;  5IT9 O;  5AQL A;  3HI0 A;  1BI4 B;  4OKK A;  2QWN A;  4GNI A;  3VA0 A;  2FBX A;  3NGZ A;  3ID6 A;  3LZI A;  2XY7 A;  2FSJ A;  2Q1N A;  4J2B A;  2VYP A;  4EZ6 A;  1X1P A;  3HZ6 A;  4JV5 K;  4JKF A;  4BE2 A;  1QHT A;  4FJX A;  1NGI A;  4FPA A;  2IAJ A;  3VMF B;  3S3O A;  4CHP A;  3H1V X;  3DYA A;  3ZSZ A;  2WFB A;  1CZB A;  4FLT A;  4FZX C;  4AM6 A;  4DTJ A;  3M1F A;  5SWM A;  3SUN A;  1NK6 A;  3L2Q A;  2NZT A;  1L5U A;  4ISF A;  4CFA A;  1YTU A;  2GWK A;  1IKW A;  4AF1 A;  3IDH A;  3T69 A;  5AFU A;  1HQU A;  4KPY A;  4C1N K;  5JVG L;  4FWS A;  3KLG A;  3CG7 A;  4B1X B;  4B9M A;  3DRR A;  3L6Q A;  4L3Q A;  3MEC A;  3C7N A;  2P9N B;  3ALY A;  3CXC M;  1JKH A;  3KVG A;  3LAN A;  3T1Y K;  4B08 A;  4CEA A;  1WB9 A;  1A5W A;  3QEP A;  4AHV A;  4CK3 A;  4DKW A;  3CC2 N;  5EVZ A;  1NK9 A;  3QEX A;  3O3G A;  3ZCM A;  3CYM A;  4B9S A;  4XH5 A;  3QEI A;  3OYJ A;  4LH4 A;  1NGF A;  3P39 A;  4OPJ A;  3NMU A;  3QIO A;  5IWA K;  1QTM A;  3SV3 A;  3AO1 A;  4N5S A;  4FZY A;  1I39 A;  3HSC A;  4BRK A;  5HOO A;  2NLX A;  5FRN A;  3L4I A;  1XMQ K;  2KFN A;  5M1F A;  3VQ5 A;  1HKC A;  1VRT A;  3FZF A;  3QNO A;  3OYC A;  3I33 A;  5FPD A;  4LSL A;  1Q7Y O;  4PKG A;  4BRD A;  4CVN E;  3VQ6 A;  1QVG M;  3AA4 A;  3VQE A;  2B6A A;  1LWF A;  2E1Z A;  3BUZ B;  3U3G A;  1QS4 A;  4HWI A;  1YIJ N;  3V9W A;  4ZTF A;  4GKJ K;  3SPY A;  1NNE A;  2YHA A;  4IFV A;  4JRP A;  4YOW A;  4FJ9 A;  3TAF A;  2GTD A;  3NDK A;  1QQN A;  4CZF A;  3D6R A;  2QWP A;  2VGN A;  1Q8I A;  1WNS A;  4E7L A;  1NGG A;  3NE6 A;  1RT3 A;  1WAJ A;  3J7Y P;  2HHX A;  3WXI A;  1TGO A;  4CJV A;  3T1H K;  4B1U B;  4FW2 A;  4H4M A;  4RW4 A;  3WNF A;  2H3G X;  1FW6 A;  3J7A P;  4M3X A;  2G8W A;  1UOC A;  4LD0 A;  3VA3 A;  2I7N A;  4BR7 A;  4B1Z A;  3VEN A;  4CJW A;  4DTR A;  1S1V A;  4PL7 A;  3MN6 A;  2HBJ A;  1S9G A;  3CFO A;  1RDW X;  3VGK A;  1NJI O;  5JIC A;  4IXC A;  2D0P A;  1S1W A;  2O8E A;  2WUS A;  1C1B A;  2CGL A;  1X3N A;  2BH1 A;  3VET A;  1NOY A;  3SZ2 A;  2G8K A;  3HYF A;  3S41 A;  1RTJ A;  3CCU N;  5BPL A;  2KZZ A;  4FPB A;  1HJR A;  1EET A;  3OHR A;  1TK8 A;  2EX3 A;  1LCU A;  4JKD A;  4B1W B;  3FE1 A;  5GAH P;  1SKR A;  1YVN A;  3SUO A;  1KVC A;  2YKN A;  4KH4 A;  3SJJ A;  1IKV A;  3V4I A;  4FJG A;  2GWJ A;  4KFB A;  4FWQ A;  2HHU A;  5TKY A;  1ZBU A;  4H0T B;  4Q5V A;  2NRR A;  4BE0 A;  4KKO A;  4O0J A;  1SKS A;  3SCX A;  3ULE A;  4BRE A;  2HHV A;  3THY A;  2V51 B;  4KRE A;  2GX9 A;  4DCH A;  1QQM A;  1NJX A;  4YOR A;  1HKG A;  5KQ8 A;  4CHN A;  1Z26 A;  3G6E N;  3SPZ A;  4MLE A;  4CEO A;  2I5J A;  1BIS A;  4IFE A;  2Y1J A;  4CEC A;  3VF2 A;  4FCY A;  3CHW A;  4FW1 A;  5JS2 A;  3L2U A;  4B8C A;  4O5F A;  4M45 A;  1FKO A;  3DXM B;  3P83 D;  4AHT A;  4A62 A;  3FZM A;  4KB0 A;  1FK9 A;  3PX4 A;  3ID8 A;  1BA1 A;  1U04 A;  4Y0W A;  2CH6 A;  4RW8 A; 
#chains in the Genus database with same CATH homology
 1NOZ A;  3NGI A;  4DFP A;  3UIQ A;  3L3V A;  1VK0 A;  1S1T A;  4E0D A;  1REV A;  3VQQ A;  1RTH A;  2VG5 A;  2PYJ A;  4CFD A;  4OKE A;  4F3O A;  4N76 A;  4CJ3 A;  1R0A A;  5HBM A;  4CJ4 A;  5HRN A;  4DSI A;  4Z4G A;  2A1S A;  3K5O A;  1RNH A;  4I7F A;  4CJK A;  4UQG A;  3LP2 A;  2P51 A;  3NFA A;  4FM2 A;  2YNI A;  1BHL A;  4HUE A;  1EP4 A;  4ICL A;  4CGG A;  2G8F A;  1IO2 A;  1U45 A;  4CJF A;  2BE2 A;  2F8T A;  1FKP A;  2O4I A;  2F96 A;  1S6Q A;  3VQB A;  3K57 A;  2X6S A;  3VA3 A;  3QET A;  3TI0 A;  3B6O A;  1SKW A;  2HMI A;  2OZM A;  2RN2 A;  4FM0 A;  4YNQ A;  3HPO A;  3TAR A;  2KTQ A;  1VSH A;  4PWD A;  3HVT A;  5C42 A;  2FBV A;  4FLY A;  3AVI A;  3K5N A;  3DRP A;  3MAQ A;  4FJH A;  3RMA A;  2WOM A;  1S6P A;  5J2M A;  2F8S A;  4CJU A;  2D5R A;  3HPG A;  2PZS A;  4JS5 A;  3KK1 A;  4KRF A;  1EX4 A;  4C8K A;  1ZBH A;  3ZSQ A;  3KKS A;  4KAZ A;  4W5R A;  5CYQ A;  3AVL A;  4DWI A;  1JL2 A;  3NGY A;  4DF4 A;  4O44 A;  3K5L A;  2ZQB A;  4DSL A;  3AO5 A;  3TR8 A;  2D0A A;  3KKR A;  4CER A;  3OYL A;  2KFZ A;  3PX6 A;  2QK9 A;  3IS9 A;  4H8K A;  3H08 A;  4E1M A;  4R5P A;  3KTQ A;  2OYQ A;  1LV5 A;  1WSI A;  5D3G A;  4QOZ B;  3MXJ A;  1QE1 A;  1J54 A;  3SQ4 A;  1S9E A;  3T1A A;  4KTZ A;  4KHW A;  4HUF A;  1FXX A;  3A2F A;  3LDS A;  4FJ5 A;  4NYN A;  2HNZ A;  3LWL A;  4FLX A;  4FLV A;  5E41 A;  1ASU A;  3O3H A;  4CEB A;  1RDB A;  1VSL A;  3T3F A;  1VSD A;  3VQ7 A;  2BGG A;  3ZT3 A;  2DFH A;  3OYA A;  3DLG A;  3C6T A;  4DLE A;  1T05 A;  3WNH A;  3DLH A;  4C8O A;  1G15 A;  4QCL A;  1UAX A;  2HHU A;  4B9T A;  1ASV A;  3P5J A;  5KGX A;  4YFU A;  1RDD A;  1SUQ A;  1HNV A;  4E7J A;  3PV8 A;  3V1O A;  3KLH A;  4DSE A;  3G0Z A;  1NK4 A;  3C95 A;  4CJL A;  2WON A;  3O3F A;  2PY5 A;  1ZBL A;  4KHN A;  3RRH A;  2X6N A;  2FBY A;  1JLE A;  3O4N A;  3V9U A;  5HP1 A;  1X9W A;  3OY9 A;  4CHQ A;  3S3N A;  1T8E A;  2G8V A;  2Z1J A;  2E4L A;  2X78 A;  1C1C A;  3O4Q A;  1WAF A;  1HPZ A;  4CIG A;  4B9N A;  4O4G A;  4KHS A;  2HHQ A;  3AVF A;  3P1G A;  4Z4H A;  3CQ8 A;  1CZ9 A;  3ZSW A;  3LZJ A;  2GBZ A;  3AVG A;  3ASM A;  3PO4 A;  1RCH A;  3DRS A;  4FLZ A;  2HB5 A;  4KHQ A;  4J2A A;  1BCM A;  5HRS A;  1KFD A;  3TWH A;  3QNN A;  4IBN A;  2KW4 A;  5DMR A;  1BQN A;  1O1W A;  1QSL A;  4DTX A;  4KTW A;  3V6D A;  1UA0 A;  4CJ5 A;  3QEV A;  4RG8 A;  1RT4 A;  4LH5 A;  5CZ1 A;  4DF8 A;  4Y1D A;  3NBP A;  2B5J A;  5C24 A;  4E19 A;  3NHG A;  3VQP A;  3BDP A;  1XHX A;  4DTM A;  4Z4F A;  2Y1I A;  4Z4E A;  3AA5 X;  1RBS A;  3CM5 A;  4AHC A;  4M41 A;  4O55 A;  1SL0 A;  4CGH A;  1GOB A;  3OYF A;  4CCH A;  2PYL A;  3CFP A;  3TAG A;  1WSG A;  1WSE A;  1K6Y A;  4DFJ A;  3AO2 A;  5HRO A;  3TAM A;  1QSS A;  3RMC A;  2GUI A;  3HVR A;  1HQE A;  4BDP A;  2ETJ A;  2DFF A;  5FRM A;  4JLH A;  4W5O A;  4BDZ A;  4RW9 A;  1RT7 A;  1N5Y A;  3TAB A;  4CF0 A;  1YT3 A;  4AHS A;  2NUB A;  4CHY A;  4DU1 A;  2A1R A;  1X9S A;  4KB1 A;  5J2N A;  3NAE A;  1S5J A;  2D0C A;  1DTT A;  5FRO A;  3WNG A;  4DG1 A;  4MQ3 A;  4ZTJ A;  1SL2 A;  3AVH A;  4CJQ A;  4F2S A;  1KFS A;  3AA2 A;  1KLM A;  5FDL A;  4CGF A;  1RT6 A;  3K59 A;  1RT5 A;  1T03 A;  4AHU A;  4CEF A;  2IC3 A;  3OS0 A;  2HVI A;  1TKX A;  4E7I A;  3FFI A;  3HJF A;  1B92 A;  1N6Q A;  4N47 A;  3VQ4 A;  4M3W A;  4AIL C;  4FZY A;  3V1Q A;  1BIU A;  3V9S A;  4CGI A;  3L3U A;  3SNN A;  5KTQ A;  1LAW A;  1TK5 A;  4I2P A;  1JLF A;  1S1U A;  1TKT A;  5HLF A;  3OYB A;  1QSY A;  1IG9 A;  3AVM A;  2ZE2 A;  3I0S A;  4ELT A;  4B8A B;  1GOC A;  3AVK A;  5KI6 A;  1I3A A;  4E3S A;  1WSH A;  1J9A A;  4RW7 A;  1NKB A;  4M42 A;  1KTQ A;  3VQ9 A;  4FYD A;  2HHS A;  1F21 A;  4OVL A;  3ZT1 A;  4KTQ A;  4IFY A;  3LAK A;  2O4G A;  4CHZ A;  3CFR A;  4DU3 A;  4M3Y A;  1RIL A;  3M8S A;  1BQM A;  1C0T A;  5K14 A;  3KLF A;  3SQ0 A;  3F9K A;  4ID5 A;  4DSF A;  4I9L A;  5C25 A;  2RF2 A;  3E01 A;  4DS5 A;  1MU2 A;  3DLK A;  4E7H A;  2XRI A;  3ISN C;  1RBV A;  1TAU A;  4IDK A;  1RBU A;  3EY1 A;  4DTO A;  3K2P A;  2BDP A;  3RMD A;  3RWU A;  4CK2 A;  4L8R B;  1WN7 A;  3KK3 A;  4CJE A;  1YVU A;  1L3U A;  1L3V A;  4FJN A;  1BI4 B;  2YHB A;  3NF7 A;  1NJW A;  4ZHR A;  4OKK A;  4CEE A;  1TK0 A;  3V81 A;  4IKF A;  3OYN A;  4KI6 A;  1TVR A;  4AHR A;  3TAQ A;  3SI6 A;  2HHT A;  1LWC A;  2OZS A;  3HK2 A;  2HND A;  3G10 A;  3VA0 A;  2FBX A;  3NGZ A;  3T19 A;  3LZI A;  2OPS A;  4CJS A;  1KLN A;  4OLA A;  2P1J A;  2XY7 A;  3OYD A;  4J2B A;  1HMV A;  1IKY A;  3DOL A;  1TL1 A;  4EZ9 A;  3AO3 A;  3M8R A;  3MXI A;  4EZ6 A;  1X1P A;  2EHG A;  5J1E A;  2P5G A;  4QAG A;  3ZT4 A;  3IAY A;  4J2D A;  4FJ8 A;  4BE2 A;  1QHT A;  4FJX A;  1JLA A;  2IAJ A;  3IRX A;  4CGJ A;  3S3O A;  2G8I A;  4CHP A;  4FJM A;  3DYA A;  1NKE A;  1RTD A;  3ZSZ A;  4OGC A;  3RR8 A;  4FJJ A;  1CZB A;  4FLT A;  4FZX C;  2XY8 A;  1WLJ A;  4DTJ A;  3RMB A;  3ZSV A;  5SWM A;  3HPH A;  3LWM A;  4HCC A;  3KK2 A;  3NF8 A;  1BI4 A;  2JLE A;  3V9Z A;  3SUN A;  4G1Q A;  4W5T A;  1NK6 A;  3JSM A;  3L2Q A;  1L5U A;  4F2R A;  4CIE A;  2JGU A;  4CFA A;  4KI4 A;  2D0B A;  1YTU A;  1NJY A;  4K8X A;  4CIF A;  1HYS A;  1IKW A;  1CXU A;  1TAQ A;  4Z4C A;  1D9D A;  4GMJ B;  1D8Y A;  4CES A;  4DQS A;  3ITH A;  4HTU A;  4DTU A;  4HCB A;  1HQU A;  4CGD A;  4KPY A;  2E6M A;  1WSJ A;  3KLG A;  4C8N A;  1XI1 A;  4I9Q A;  4E7K A;  1UWB A;  3CG7 A;  4B9V A;  4PQU A;  4TSX A;  4B9M A;  3DRR A;  5KRT A;  3MEC A;  5I42 A;  1A5X A;  4M3U A;  1BL3 A;  2DTU A;  3DLB A;  3PO5 A;  4NCA A;  3ALY A;  4W5N A;  3TAP A;  1JKH A;  1SV5 A;  3LAN A;  3M8P A;  2HW3 A;  1EKE A;  4B08 A;  4CEA A;  3HL8 A;  1A5W A;  4FM1 A;  1YTA A;  3RR7 A;  1JXB A;  2Z1G A;  4AHV A;  3QEP A;  1RT1 A;  4KV8 A;  4CK3 A;  4PY5 A;  2YNG A;  2ITG A;  1LW0 A;  4Z0U A;  4E89 A;  4B3O A;  2GV9 A;  3EYZ A;  3SUP A;  1NK9 A;  4C8M A;  3KLE A;  3QEX A;  3TAE A;  1NJZ A;  3DOK A;  3O3G A;  3ZCM A;  3S9H A;  1L3S A;  1BGX T;  3CYM A;  2IOC A;  4B9S A;  1JLQ A;  3SV4 A;  2ZD1 A;  4BDY A;  1RT2 A;  2ATQ A;  1LWE A;  3AVJ A;  3AVN A;  3V1R A;  3QES A;  3QEI A;  4B9U A;  3OYJ A;  1BIZ A;  3LP0 A;  4DU4 A;  4ELV A;  4KHY A;  2IS3 A;  1HYV A;  4LH4 A;  4CEQ A;  2XY6 A;  5I3U A;  4OPJ A;  4CF8 A;  3PX0 A;  3QIO A;  1QTM A;  3SV3 A;  1ASW A;  1HRH A;  3AO1 A;  1I39 A;  3AV9 A;  4N5S A;  4DLG A;  3AA3 A;  1JLG A;  3I8D A;  1B9F A;  1VRU A;  1XC9 A;  4CE9 A;  4O0I A;  1WSF A;  2DFE A;  5FRN A;  1S1X A;  3NF6 A;  4FLU A;  1KSP A;  1RBR A;  2KFN A;  3ZT0 A;  2HVH A;  2DY4 A;  3VQ5 A;  4NYF A;  4DQR A;  4DSJ A;  1IKX A;  1VRT A;  1TKD A;  2RPI A;  3M8Q A;  1W0H A;  1C6V A;  1KVB A;  1LW2 A;  2Z1H A;  3OYC A;  3OYG A;  3QNO A;  3B6P A;  1D5A A;  1L3T A;  3OS1 A;  4H4O A;  4PA1 A;  4EP5 A;  4FLW A;  3U6F A;  4K8Z A;  4BE1 A;  3QEW A;  4LSL A;  4CJP A;  1C0M A;  4CF1 A;  3AVB A;  3HST B;  3VQ6 A;  3MEE A;  3OYK A;  4DFK A;  3IG1 A;  3LAL A;  3AA4 A;  1TL3 A;  2OPP A;  4FVM A;  3VQE A;  1Y97 A;  3ULD A;  1DTQ A;  5J2Q A;  2B6A A;  1LWF A;  3HP9 A;  4CED A;  4CFB A;  4W5Q A;  4FJ7 A;  4NCG A;  2OPQ A;  1QS4 A;  5KGW A;  3U3G A;  3OS2 A;  4HUG A;  4FK4 A;  4BAC A;  3OJU A;  2Z1I A;  1VSK A;  3V9W A;  4ZTF A;  3SPY A;  4N56 A;  2YHA A;  3NF9 A;  3AVC A;  3BGR A;  4IFV A;  4J2E A;  2IDO A;  3OYI A;  3LP3 A;  3VQ8 A;  4JRP A;  3L8B A;  4DTP A;  3TAF A;  3NDK A;  1T7P A;  4FJ9 A;  3DLE A;  2YNH A;  3AO4 A;  4ID1 A;  3RRG A;  1Q8I A;  4PUO A;  1WNS A;  1D9F A;  1LAV A;  3LAM A;  3NH2 A;  4E7L A;  4CFC A;  4JS4 A;  3OYE A;  1RT3 A;  3VQA A;  1RDC A;  3MED A;  3NE6 A;  4F8R A;  1C1A A;  1WAJ A;  1KVA A;  4CJR A;  4DMN A;  4CHO A;  3AVA A;  2HHX A;  4GVM A;  4LY7 A;  1TGO A;  1XHZ A;  2XHB A;  3L2W A;  3QER A;  2KZM A;  2B4J A;  3MEG A;  1U49 A;  2QKB A;  3QIN A;  3K5M A;  1JLB A;  4GW6 A;  4CJV A;  3I0R A;  4FW2 A;  1XWL A;  4H4M A;  1VSI A;  3DMJ A;  4FZZ A;  4RW4 A;  3DM2 A;  5JS1 A;  2W42 A;  3WNF A;  3KIO A;  1ZBI A;  1KCF A;  2FC0 A;  4I2Q A;  4M3X A;  2G8W A;  3D0P A;  1UOC A;  3U3Y A;  5EU7 A;  1NK5 A;  4Z4I A;  3ZSY A;  1JLC A;  4RW6 A;  4LD0 A;  4EP4 A;  5CZ2 A;  3L2R A;  4CJT A;  4CEZ A;  4XIU A;  3L2V A;  4OPK A;  5T7B A;  2R7Y A;  4CJW A;  3QIP A;  1VSJ A;  4MFB A;  4DTR A;  4OKJ A;  2VG6 A;  1ZYQ A;  2XO7 A;  1NK0 A;  3V9X A;  2G8U A;  1IH7 A;  4F3T A;  1VSM A;  1S1V A;  3EZ5 A;  4NCB A;  4IG0 A;  3QLH A;  4C8L A;  1S9G A;  3CFO A;  4HHT A;  4F4K A;  4M3T A;  4Y1C A;  3CM6 A;  3ZT2 A;  2VG7 A;  4FK0 A;  5HRR A;  2X74 A;  2FBT A;  3OYM A;  3HM9 A;  3ZSO A;  2YV0 X;  2VWK A;  3TAN A;  1Q9Y A;  3C94 A;  4DQP A;  3HT3 A;  3KD5 E;  1DLO A;  1S1W A;  3DLR A;  5HRP A;  3LP1 A;  1C1B A;  3KD1 E;  1JXE A;  5CYM A;  4AH9 A;  3F73 A;  1NOY A;  2G8K A;  3SZ2 A;  4O5B A;  3WNE A;  1KRP A;  2P5O A;  4OLB A;  4DTS A;  3HYF A;  1Q9X A;  4KHU A;  3VN5 A;  1EXQ A;  1A5V A;  3DI6 A;  4CF2 A;  1RTJ A;  3D45 A;  4IG3 A;  1RBT A;  2IGI A;  2HHW A;  2BAN A;  4KO0 A;  2KZZ A;  3LPU A;  3NCI A;  1HJR A;  1EET A;  4JRQ A;  3SUQ A;  1TK8 A;  2EX3 A;  3PUF A;  4FK2 A;  1U47 A;  1U48 A;  3S3M A;  2Q3S A;  3SYZ A;  3OVN A;  1NK8 A;  1SKR A;  5KRS A;  1GOA A;  3SUO A;  1X9M A;  1KVC A;  2YKN A;  1Z25 A;  3SJJ A;  4FJK A;  3HP6 A;  1IKV A;  4OGE A;  3V4I A;  2YNF A;  3SQ2 A;  3SQ1 A;  4FJG A;  1TKZ A;  1RDA A;  1B9D A;  3KLI A;  4E1N A;  3OJS A;  3NH0 A;  2OPR A;  3RTV A;  4KFB A;  3HO1 A;  2OA8 A;  4DS4 A;  2E6L A;  1ZBU A;  4Q5V A;  1RTI A;  1CXQ A;  1J53 A;  1VSE A;  4BWM A;  3KJV A;  4DFM A;  4BE0 A;  2HNY A;  3QO9 A;  4KKO A;  4O0J A;  1SKS A;  4B9L A;  4FXD A;  3SCX A;  4CF9 A;  5J2P A;  2HHV A;  1NKC A;  1ZBF A;  2RKI A;  4OJR A;  4DSK A;  4KRE A;  3HXM A;  3THV A;  1HYZ A;  2YKM A;  3JYT A;  1JL1 A;  1W9H A;  3PY8 A;  1NJX A;  4Q0B A;  4WE1 A;  1CLQ A;  4ELU A;  1C0U A;  1NK7 A;  5CY4 A;  2G8H A;  4CHN A;  4DTN A;  1Z26 A;  3LPT A;  2VWJ A;  3SPZ A;  2LSN A;  3C6U A;  4CEO A;  4BWJ A;  3MXM A;  2QKK A;  2I5J A;  3OYH A;  1BIS A;  2Y1J A;  2KQ2 A;  3VQC A;  4CEC A;  1UA1 A;  4FCY A;  1J5O A;  5JS2 A;  4FW1 A;  3ZSX A;  2QXF A;  3L2U A;  1TV6 A;  4B8C A;  1U4B A;  1SL1 A;  4N41 A;  4M3R A;  4M45 A;  1FKO A;  4M3Z A;  3P83 D;  3ZSR A;  1BCO A;  4AHT A;  4CK1 A;  5SZT A;  4FJI A;  4FJL A;  1HNI A;  1VSF A;  4DQI A;  4KB0 A;  3VQD A;  1FK9 A;  1ITG A;  3PX4 A;  4HVJ A;  4LSN A;  3K58 A;  1U04 A;  2XY5 A;  2AJQ A;  3NH1 A;  4RW8 A;  5DK5 A;  4DQQ A;  1QQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...