2IDOA

Structure of the e. coli pol iii epsilon-hot proofreading complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
175
structure length
172
Chain Sequence
TRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase III epsilon subunit
publication title Structure of the Escherichia coli DNA polymerase III epsilon-HOT proofreading complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 172
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2idoA00
2W42A 2FBVA 1YTUA 4CESA 4KI6A 4CJ3A 3KKSA 3V9UA 4RW7A 4DU1A 1NJWA 3AA5X 4CEDA 4DMNA 1F21A 5CY4A 1WSHA 1BQNA 3NDKA 4N41A 3CYMA 4DFPA 1NK9A 1I39A 4FXDA 1JLQA 3IG1A 3VQ5A 4DFMA 2ZE2A 4FJLA 2QK9A 4CHPA 4E1MA 3TWHA 3NF6A 3V9ZA 4CEZA 4DS5A 4DTSA 3SQ1A 3S3MA 2XY8A 4FJ7A 4O55A 4FZXC 4M3WA 4F3TA 1IKVA 2GUIA 1NKBA 3KK3A 4M42A 1LAWA 4LD0A 1UOCA 3OS2A 1BI4A 1WSFA 4MQ3A 4E1NA 2XY5A 1KFDA 3L2QA 3LAMA 4H4MA 3OYKA 4OPJA 3KD1E 3FFIA 1LWCA 4KTWA 1CZ9A 4B9MA 3M8QA 2DFFA 3MEDA 3ULDA 1TL3A 4B9TA 2HNYA 4QOZB 1HYVA 3AVAA 1CXQA 1HRHA 3WNGA 3ZT1A 1TVRA 2VWKA 3VQDA 4IFYA 4GW6A 1ITGA 3WNHA 4B9UA 1UA0A 4E7HA 4FK2A 3KK1A 4G1QA 3NGZA 3PO5A 3ZT0A 3RMAA 4IG0A 4DLEA 1TKDA 3OYNA 3RR7A 3TABA 4HCBA 1BHLA 1C1CA 3F73A 4DSEA 1XHZA 5J1EA 3RRGA 1TV6A 2X74A 3AVFA 5C42A 4CEFA 2Y1IA 2B6AA 1JL1A 5HP1A 1D8YA 3CFPA 1TGOA 1REVA 3L8BA 1C0TA 2KZZA 1VSKA 4HHTA 3IAYA 3DLEA 4ID5A 3K5NA 4FLYA 4IG3A 2B4JA 3O3HA 3OYDA 3RMBA 1RT1A 3K5MA 5CZ2A 2AJQA 5SWMA 3S3OA 2BGGA 4Y1CA 1G15A 3LP1A 3ZSZA 4CEAA 1S1XA 3O4NA 2Z1IA 4UQGA 4I7FA 2VWJA 1EETA 1Z26A 3HL8A 1SKRA 2HHUA 4JS5A 4FZZA 1D5AA 1T05A 4NCAA 1U04A 3VN5A 2BE2A 1NKCA 4O5BA 1L5UA 3MEGA 4F4KA 1J53A 4EZ6A 3AVKA 4IBNA 4M3ZA 3ZSXA 4JRPA 3CM6A 2RKIA 1I3AA 3MXMA 3VQAA 3C94A 1UA1A 1U47A 3DI6A 5J2MA 4DSKA 3TAMA 2P51A 2G8FA 4DFJA 4B8AB 3V1RA 4DTJA 2HNDA 3NGYA 3PX6A 3KD5E 3BGRA 5FROA 1HMVA 1S6PA 4CEBA 1Z25A 4CE9A 3HP6A 3L2VA 3AVLA 1JLGA 4CFDA 2X6SA 3ZSYA 4HUGA 1IG9A 4N56A 1YTAA 5HBMA 5KI6A 5FRMA 4ZTFA 3ALYA 1FXXA 1X9MA 4DQPA 3L3VA 3SQ0A 4M3TA 2WOMA 4ID1A 2HHQA 1WLJA 3SV4A 1JLFA 3HJFA 3PO4A 1S1VA 2OPRA 3V1OA 3RR8A 1RTHA 1S1TA 3MECA 3PV8A 3I0RA 4KO0A 3TAQA 4FVMA 1EKEA 1RILA 4I2QA 4PA1A 1NK5A 2Z1JA 5KTQA 3ISNC 2I5JA 2YHBA 1ZBUA 4TSXA 5HRNA 3LZIA 3SYZA 3P83D 1B92A 5JS2A 3QERA 1QS4A 4KFBA 4BE1A 1RBSA 3SI6A 5I42A 1QSSA 3BDPA 4FJHA 2QXFA 5FDLA 3OJUA 1CXUA 4CGIA 3ASMA 3HPGA 2KFNA 3S3NA 4J2EA 3C6TA 4Z4CA 4OVLA 2G8WA 3H08A 4CGFA 3V1QA 3AO2A 1KFSA 3F9KA 4ELUA 3LZJA 2OPPA 3MXIA 1TKZA 2PYLA 4CEEA 2B5JA 4HTUA 1GOCA 3TAFA 4OKKA 3AVNA 2KW4A 1RT4A 1DLOA 2HHSA 4E0DA 1BCMA 3OS1A 4DTUA 3NGIA 4AHSA 3SUPA 4ELTA 4N76A 2VG5A 4M3XA 5CYMA 4PWDA 4M3YA 3L2RA 1VSJA 3HYFA 1JLCA 1RCHA 4Z4EA 3AO4A 4MFBA 4DLGA 2F8TA 4WE1A 4K8XA 4KAZA 4AHVA 1ASUA 3G10A 2A1SA 4LY7A 4CK3A 1B9FA 2O4GA 1DTQA 3IS9A 4CJFA 4Q5VA 3HXMA 4HCCA 3U3GA 1Q9XA 3RTVA 3NF8A 3ZT2A 3AO5A 4FJIA 3DLRA 3V81A 2YNGA 4CGJA 3KLHA 2GV9A 4CJ4A 3HVRA 1W9HA 4DTMA 4CJTA 1J5OA 3OYLA 3QNNA 4CCHA 1J9AA 4H8KA 3KK2A 4OKJA 2E6MA 4CGDA 1TAQA 2PZSA 4OKEA 1NOYA 4O0IA 3RMDA 2HB5A 3DM2A 3LP2A 3QEXA 3KKRA 4KV8A 4YFUA 4CEQA 2ITGA 4W5TA 3OYCA 3C95A 3PX0A 1RDBA 1VSMA 3DYAA 1X9WA 2YKMA 3AVCA 1KVCA 3VQ4A 2XO7A 3NHGA 3LPUA 1KVAA 4HUFA 1LW0A 4LSNA 2ATQA 4DFKA 4B9LA 5DMRA 3AO1A 4O4GA 3TR8A 4KI4A 4E19A 1IKYA 4EP5A 1VSDA 3VQ6A 3EY1A 1QTMA 2G8UA 1KLMA 1T7PA 3ZT3A 2DTUA 3DLKA 4CHOA 4J2BA 4C8KA 2DFHA 4JS4A 4CERA 4AILC 4KHNA 1C0MA 4FK0A 4FCYA 4DQSA 2E6LA 4CJPA 4F2SA 1JXBA 4KHYA 2LSNA 3ITHA 4DQQA 1X9SA 4FJNA 4OJRA 3DLGA 1RDDA 4FZYA 3QNOA 4B9VA 3EZ5A 4FK4A 1BQMA 1WSGA 2EHGA 2F8SA 4YNQA 3VA3A 1IO2A 3DRSA 4NYNA 4CF0A 4RW6A 3OJSA 1LWEA 1T03A 1L3VA 1HQUA 3ZT4A 3QLHA 3M8RA 1HQEA 4FJKA 3PY8A 2IAJA 4KREA 3HT3A 2IOCA 3QEPA 2FBXA 1X1PA 3DOLA 2D0CA 3LAKA 1YVUA 4I9QA 3DLBA 3T1AA 3VQ7A 3S9HA 4AHCA 4FJJA 4HUEA 3MAQA 3ZSRA 4DS4A 1JLEA 4BE2A 3VQ8A 4F2RA 5SZTA 2JGUA 4OGCA 4QAGA 2G8VA 4DSIA 1NJYA 4NYFA 4E7KA 2QKKA 4FYDA 2DY4A 4OLAA 1NK0A 4CFCA 1RT2A 1KRPA 3LP0A 3ZSWA 4FJ5A 1QE1A 1U48A 4CFBA 1R0AA 3TI0A 1S6QA 4GMJB 3CG7A 4LH5A 3VQEA 1RTJA 1C6VA 2YNIA 4CJEA 4BACA 4FW1A 5J2QA 2ZD1A 4M41A 3HVTA 4DU3A 1TKXA 3MXJA 1B9DA 2HMIA 3K2PA 3V9SA 2OA8A 4DG1A 1KVBA 4CJUA 1NK7A 5D3GA 2XHBA 3HK2A 2PY5A 4CJSA 3OYFA 3T3FA 1XHXA 2RPIA 4FLXA 1C0UA 1HNVA 4DTXA 1BL3A 4JLHA 4J2AA 2KQ2A 1Y97A 5EU7A 2OYQA 3B6PA 4FJ8A 1FKOA 2R7YA 4CIEA 3VQQA 1ASVA 4B08A 3RRHA 2KFZA 1N5YA 1NJXA 2KZMA 1RBTA 4FJGA 1WAFA 4FJMA 4B9SA 4O44A 1D9DA 3AO3A 4DSFA 4FM1A 1LV5A 2HNZA 1RT7A 1RT6A 4DSJA 1QSYA 4Z4HA 4CHYA 1FK9A 4XIUA 4FLWA 1XWLA 4CF9A 1ZYQA 1NKEA 1LWFA 2P5OA 2IC3A 4KB1A 2HW3A 2RF2A 1KSPA 4C8MA 1JXEA 1UAXA 4M45A 1EP4A 1ASWA 2F96A 3O4QA 4NCGA 3HM9A 4DQRA 1KLNA 4ELVA 3AVMA 4B3OA 4RW9A 1NK8A 4CK2A 3OY9A 3PX4A 1RDAA 3LANA 4DTPA 4C8OA 3QINA 1NJZA 4KRFA 1TAUA 3PUFA 3KLGA 3B6OA 4C8NA 4IKFA 1BGXT 2YNHA 4GVMA 3NH0A 3NAEA 3SJJA 3JYTA 3SPZA 1W0HA 1VRTA 2G8KA 2WONA 3M8SA 2OZMA 3P1GA 3VQCA 4Q0BA 3NE6A 3QEVA 1TK8A 4H4OA 2D0AA 1EX4A 3O3FA 4PY5A 4KHUA 4DTRA 1NK4A 2OZSA 2Z1GA 3JSMA 4OPKA 2OPSA 1BISA 1N6QA 2BDPA 3LALA 4W5OA 1BIUA 1SV5A 4PQUA 3K59A 3TAEA 3RWUA 3QIPA 1DTTA 4CGGA 5HRPA 1IH7A 1WAJA 3D45A 3AV9A 5HRRA 1VSEA 4BDYA 1L3UA 1Q8IA 1O1WA 1C1AA 2ETJA 4K8ZA 1IKWA 1RBVA 1BIZA 3A2FA 3NBPA 4CJVA 4B8CA 1HPZA 5JS1A 3LWMA 2DFEA 1S1UA 1RTDA 4EZ9A 3OS0A 3HSTB 1TKTA 1HNIA 5E41A 2G8HA 2GBZA 1ZBFA 3VQ9A 3LPTA 4RW8A 3U3YA 1L3SA 3E01A 3LWLA 3QETA 4KB0A 2HHXA 3AVGA 3I0SA 3P5JA 1U49A 2ZQBA 3HPOA 3QO9A 4FLUA 3L2UA 3LDSA 1U4BA 3OYJA 1K6YA 1JLBA 3OYGA 4BDZA 3K57A 1SL0A 2IDOA 4CECA 3HO1A 2YKNA 3TAGA 3CFOA 5CZ1A 3KJVA 3TAPA 2X6NA 3NCIA 4KHWA 2XY6A 2OPQA 3QIOA 4ZHRA 5C25A 3L2WA 3V9XA 3QEWA 3THVA 3SQ4A 1RTIA 4CJRA 1YT3A 1VRUA 1RBUA 4ICLA 4E7IA 5HLFA 5KGXA 1U45A 4C8LA 4LSLA 3SQ2A 5FRNA 1VSLA 2P1JA 1SUQA 4CF2A 4E7LA 3QEIA 3AA3A 4F3OA 3OYAA 4Y1DA 4W5RA 4E89A 4AHTA 4Z4IA 2FC0A 4DQIA 2HHWA 3K58A 3ZSQA 3T19A 4CEOA 5HRSA 5J2PA 1TL1A 4KKOA 4CHZA 2HVHA 5K14A 3DRPA 4OLBA 3SUQA 4DWIA 3NF9A 5DK5A 4I2PA 4DF4A 1S9EA 4KHQA 3HPHA 1XC9A 1NK6A 3VQBA 4ZTJA 1WSEA 5C24A 1WSJA 3VA0A 2NUBA 3SUNA 2YV0X 4I9LA 5I3UA 1T8EA 5HROA 4DU4A 4Z4GA 2A1RA 4KTZA 4CK1A 4FM2A 4FM0A 1BCOA 3V6DA 3SV3A 1GOBA 4N47A 4CJWA 4CJLA 3OYHA 1JKHA 4CJQA 4CIGA 3C6UA 3SCXA 4FJXA 3EYZA 1TK5A 1ZBLA 2Z1HA 1J54A 4M3RA 2PYJA 3G0ZA 2O4IA 3K5OA 2HVIA 1CLQA 4CJKA 3K5LA 3SZ2A 4F8RA 4AHRA 4CF1A 4QCLA 4LH4A 1UWBA 1CZBA 1GOAA 1RNHA 1WNSA 3AA2A 4KPYA 3V9WA 1WN7A 4BWMA 1JL2A 4DSLA 3IRXA 2XY7A 5KRSA 3KLFA 3AVJA 4CGHA 1A5VA 4W5NA 2HHVA 2YHAA 3CFRA 2FBTA 3VQPA 3KTQA 4DF8A 2D0BA 1FKPA 4IDKA 4DTNA 3SUOA 4FLTA 3UIQA 2IS3A 5J2NA 4FW2A 1ZBIA 2KTQA 1HJRA 1L3TA 4AHUA 3OVNA 1MU2A 2RN2A 2BANA 3DOKA 3HP9A 3KLIA 5CYQA 2P5GA 4BE0A 1A5WA 4JRQA 3DRRA 3KLEA 3O3GA 1SL1A 2E4LA 4PUOA 2Y1JA 3AVIA 1S9GA 5T7BA 4N5SA 1A5XA 1LAVA 3NH2A 4FLVA 3OYIA 3TANA 4J2DA 2D5RA 3AVBA 3SNNA 1VSIA 3KIOA 3MEEA 4KTQA 1KCFA 1QSLA 2VG7A 1RDCA 1WSIA 4AH9A 1S1WA 3CM5A 4KHSA 4IFVA 4CHNA 4BWJA 1SKWA 1HYSA 4CJ5A 1LW2A 3WNFA 4FJ9A 4CIFA 1IKXA 1EXQA 4Z4FA 5KGWA 2VG6A 2G8IA 4RW4A 1RT3A 3D0PA 1KTQA 3DLHA 3DMJA 3ZCMA 3M8PA 1ZBHA 1Q9YA 3NFAA 2EX3A 2XRIA 4EP4A 2JLEA 1VSHA 5KRTA 3CQ8A 2Q3SA 3NH1A 3I8DA 3U6FA 1SKSA 1XI1A 4B9NA 1BI4B 3OYMA 4DTOA 2IGIA 1C1BA 3V4IA 3TARA 1QHTA 3AA4A 3AVHA 4HVJA 4RG8A 1SL2A 1NOZA 4CFAA 1JLAA 1S5JA 1VK0A 4CF8A 1TK0A 1RT5A 3NF7A 4BDPA 3QESA 1D9FA 1HYZA 1RBRA 3ZSVA 4CHQA 3SPYA 4O0JA 4OGEA 4W5QA 3OYEA 2X78A 3LP3A 3ZSOA 4E7JA 4Z0UA 2FBYA 4FLZA 3WNEA 3RMCA 3OYBA 4NCBA 2HHTA 4M3UA 3L3UA 1VSFA 4E3SA 1QQCA 2YNFA 4R5PA 2QKBA 4L8RB
chains in the Genus database with same CATH superfamily
3H3OB 2FBVA 4CESA 2QXLA 5GADP 1NJWA 3ATUA 1F21A 1BQNA 3C6AA 4N41A 3BY5A 4FXDA 4DFMA 4FJLA 2QM1A 4DS5A 2HHUA 4F3TA 1NKBA 3THWA 4M42A 3SMSA 3QICA 3OS2A 1BI4A 4E1NA 1FW6A 5FLXO 4H5TA 1DGKN 4YDUC 1CZ9A 3R1XA 2V7YA 3CCQN 3M8QA 4CD1A 3MN7A 3U9ZA 4YOWA 1NGFA 2Q0RA 2ZGYA 4BY9C 1CXQA 1HRHA 4PL7A 3M1FA 2O8FA 4JAXA 1ITGA 1UA0A 3KK1A 3PO5A 4MDBA 3RMAA 3P38A 4IG0A 4YOTA 3OYNA 1BHLA 1C1CA 4DSEA 4M63C 2P9IB 3RRGA 1TV6A 5AZJB 3AVFA 4CEFA 2B6AA 4DR2K 1TGOA 3L8BA 2YX6A 4FLYA 3B8AX 3O3HA 3OYDA 3K5MA 5AQMA 2OTJN 4FOIA 1G15A 3F2KA 1S72N 2P9UA 2Z1IA 2HBJA 3HL8A 1GLLO 2ZJQL 1U04A 3VN5A 4YOUA 1L5UA 3MEGA 2CGKA 3ENOA 3CD6N 3AVKA 1ESVA 5AZIB 5M1QA 3CM6A 1N33K 3MXMA 3C94A 5J2MA 4DSKA 1YUWA 2E88A 4B8AB 4DTJA 3NGYA 3DAWA 4PKGA 3LDPA 4CE9A 3VEZA 1OKJA 4DB3A 4HUGA 5HBMA 4CZEA 5JVHL 5FRMA 2NRHA 2HBKA 2D4WA 3SQ0A 4WFNL 4O8KA 3RR8A 1S1VA 1RTHA 1YITN 1VQ4N 3PV8A 5GIOA 3I0RA 3WXKA 4FWKA 4YORA 5LJVA 3T69A 1SS6A 2YHBA 5HRNA 3VPZA 2UXBK 1B92A 4KFBA 3SI6A 2QXFA 4CGIA 3ASMA 4BGAA 4J2EA 3C6TA 2G8WA 1CZAN 4U7BA 1JCFA 3CIPA 2PYLA 4CZJA 2HHSA 4M3XA 4CBUA 2VG5A 3D6RA 4M3YA 1JLCA 5M1KA 4OO1J 4K8XA 4AHVA 3G10A 4CK3A 4LY7A 2XY6A 4C8OA 4NO7A 3AAQA 2QWQA 4HCCA 5AQGA 5CHIA 3J7ZO 1Q9XA 4FJIA 3ZT2A 1Q81O 2UUAK 1GLEG 3KLHA 1U2VB 5JLFA 4CCHA 3QNNA 1NGCA 1TAQA 2PZSA 2HB5A 3LP2A 1TK0A 3PX0A 2KKZA 3C95A 1VSMA 3DYAA 3VQ4A 3VMFB 2XO7A 2Q2RA 2IVPA 5KPRA 1BDGA 4BC3A 3AO1A 4KI4A 4JKEA 4JNEA 3CC7N 2DTUA 4YY3K 3ZETA 4J2BA 2DFHA 4CERA 4YOXA 4K25A 2LSNA 2D0PA 3OTOK 4WQ5C 3BZCA 1IO2A 1T03A 1LWEA 3ZT4A 3M8RA 4H5VA 2IAJA 4ISEA 2IOCA 3DOLA 3O9UA 4JKBA 2W6LA 4BR7A 4I9QA 4IZ9A 3T1AA 3C0BA 3I56N 1DEJA 4FWOA 2QW9A 3S9HA 3KWIA 3ZSRA 3CERA 4LF4K 3H1VX 4DSIA 2QKKA 4NYFA 2E2PA 1NK0A 5DM7L 4JKGB 5BRHA 4LF5K 1U48A 4BACA 1C6VA 2YNIA 4FW1A 1B9DA 1S22A 3I55N 2OA8A 4IWVA 2XHBA 2PY5A 3T3FA 4IDHA 3OA9A 2RHKA 4JLHA 1Y97A 4FJ8A 3AARA 2R7YA 5KQ8A 3VQQA 4B08A 1N5YA 4LFBK 2BUPA 4X64K 3O9SA 2P9KA 4ISGA 3H3NO 1VQ7N 3UKUB 1LV5A 2HNZA 4H0YB 1QSYA 4CW7B 4Z4HA 1FK9A 2HW3A 4KB1A 4RWTA 4C8MA 4DQRA 1KLNA 4B3OA 3PX4A 3LANA 1RGIA 3D2FA 4JI1K 3PUFA 3HBTA 1BGXT 2BTFA 3NH0A 2W41A 3OBWA 3JYTA 4DSJA 3U9DA 4Q0BA 4IXCA 4GKJK 1TK8A 1NMNA 3MX5A 4PY5A 4KHUA 2OZSA 2QTDA 1N6QA 1Q18A 1NGEA 3BP8A 3ZX2A 2BDPA 1BIUA 4PQUA 4FL9A 3TAEA 2FSNA 1OH5A 5HRPA 3D7EO 1IH7A 4XH5A 3AV9A 5HRRA 2E1YA 1NJIO 4WFBL 1Q8IA 1O1WA 4BR0A 2ETJA 1IKWA 1RBVA 2ZGZA 4B8CA 3LWMA 4CZHA 2O8FB 4EZ9A 3HSTB 2P9PA 2F9TA 3K9KA 1NNEA 3VQ9A 2OTLN 3P5JA 3A5OC 1SZ2A 3O9RA 4X62K 2CGLA 1U4BA 1JLBA 1SL0A 4CECA 4DQ8A 1N36K 2YKNA 1XMQK 3NCIA 4ZHRA 3V9XA 1N32K 3SQ4A 1YT3A 1RBUA 3THXB 5JICA 4E7IA 5HLFA 5KGXA 1XC3A 3SQ2A 3W3DA 4F3OA 3AA3A 4F9OA 4W5RA 3T1YK 3DXKB 2HHWA 4CEOA 1WB9A 4KKOA 4CHZA 5K14A 1VQ6N 4ILHA 1WSEA 2E8AA 1VQNN 2BH1A 2YV0X 4I9LA 1N34K 4CK1A 3FZLA 1BCOA 3SV3A 4N47A 3OBYA 2JWLA 3PSFA 4M3RA 2PYJA 1CLQA 3K5OA 3K5LA 4CF1A 2VYPA 1UWBA 1CZBA 1RNHA 5FPEA 3V9WA 3VERA 3IRXA 4FPAA 3CJ7A 3KLFA 5BR8K 4W5NA 2FBTA 1NM1A 3IMXA 4JV5K 1ZBIA 5LMNK 3CMAN 3OVNA 5AQLA 2UXDK 1MU2A 5CYQA 3DOKA 3KLIA 4LFCK 3IDHA 3A5NC 5AQPA 5LJWA 3FZHA 1SL1A 1JCGA 1VQMN 5T7BA 4N5SA 1A5XA 3IUCA 3ZYYX 2Q31A 4UY8O 3AVBA 4JKFA 4LC9B 3SNNA 1VSIA 3MEEA 2P9NA 3J8AA 5E26A 1WSIA 4DV7K 3CM5A 4H03B 1HYSA 1LW2A 1NGBA 3TSUA 4CIFA 1EXQA 2G8IA 3LDQA 4JK7A 5KQDA 3TU5A 5TKWA 3PIOL 2XRIA 2ASPA 1VSHA 3I8DA 3U6FA 3PIPL 4DTOA 2IGIA 3E9OA 1SL2A 1NOZA 4CFAA 1YJ9N 4J8FA 4JEPA 3QESA 1RBRA 3ZSVA 4CHQA 4A2BA 4W5QA 3HM8A 2RE2A 2X78A 3LP3A 4I6MA 2FBYA 3OYBA 4M3UA 1VSFA 1QQCA 4BRCA 2QKBA 3NMUA 4DU1A 4RW7A 1X3MA 4H0PA 4CEDA 3NDKA 4DFPA 2QWRA 1I39A 1O13A 3IG1A 3VQ5A 2ZE2A 2VWBA 4DV3K 5AQQA 4CHPA 3TWHA 2P9LA 3V9ZA 4AF1A 1BA0A 4KBOA 4DTSA 3SQ1A 3S3MA 2XY8A 1Z05A 4O55A 4FZXC 3PSIA 1IKVA 1WUAA 3KK3A 2V52B 3J7AP 1LAWA 4LD0A 3KD1E 5JLHA 2Q36A 4JHDA 3CC2N 1LWCA 4B9MA 4GV6A 4B9TA 2HNYA 4QOZB 3ZT1A 2F4VK 1TVRA 4FK2A 4B9UA 3NGZA 3ZT0A 4BRHA 3PLAA 3A8YA 5A2QO 1KAYA 1BG3A 4HCBA 3F73A 1Z6RA 1VQON 2ZJPL 1H1VA 5C42A 2Y1IA 2KZZA 1REVA 3JXUA 4HHTA 3DLEA 4ID5A 4BG8A 3ENBA 3A0IX 1RT1A 5CZ2A 2AJQA 3ID8A 3LM9A 3S3OA 4NLCA 3ZSZA 1S1XA 4R79A 1Z26A 4FZZA 4B1UB 4A61A 4CZIA 1XNRK 4CZFA 2CGJA 4IBNA 3SAFA 2YCHA 4M3ZA 2O8EA 1W2BM 3ZSXA 4JRPA 3VQAA 1UA1A 4H0XB 3HRGA 4H0TB 2G8FA 4BR2A 3PX6A 3KD5E 4CVNE 3EKUA 1TUUA 1W7AA 3AVLA 4CFDA 2X6SA 3ZSYA 1IG9A 5BPMA 2E5LK 3CI5A 4ZTFA 4H0VB 2QI2A 2GX9A 3LDNA 1QZ6A 3SV4A 2WFBA 2OPRA 4YHHK 1S1TA 3MECA 4NLBA 4KO0A 1EKEA 4CZMA 2Z1JA 5KTQA 3ISNC 2I5JA 3GOIA 1ZXOA 3P83D 5JS2A 4BE1A 1RBSA 3BDPA 1ZBSA 1QSSA 5FDLA 1CXUA 3S3NA 3C7NA 4Z4CA 1HJOA 4CGFA 5C12A 4ELUA 3GDQA 3MXIA 3DLLL 1NMDA 3TAFA 3IFRA 4OKKA 2KW4A 3O9TA 1BCMA 5ADXH 1NGAA 3HYFA 4Z4EA 1RCHA 2F8TA 1YJNN 3QB0A 3WUHA 4B1ZA 4Q5VA 4JI5K 3EE8A 2GV9A 4CJ4A 3L4IA 1N8RO 5BRDA 2GWJA 1DT9A 1NGDA 3VF6A 3KK2A 4OKJA 4CI6A 5CR4A 4O0IA 4NCBA 3HZ6A 3C6HA 1IBLK 4W5TA 2ITGA 1BUPA 2YI1A 4DUZK 1RDBA 1KVCA 4C23A 1HKGA 1KVAA 3VGKA 1IG8A 2V51B 2ATQA 4LSNA 5AQJA 2NRWA 4E19A 3EY1A 3MMVA 3ZT3A 4KHPK 4C8KA 3EKSA 4BR5A 4JS4A 4BROA 4FWQA 3VEVA 3O5BA 3ITHA 4DQQA 4FJNA 4OJRA 3DLGA 3QMLA 3QNOA 4BRMA 3EZ5A 5AQWA 1LCUA 4YNQA 5ADXA 4RW6A 3GE1A 5BPNA 1HQEA 3CCVN 4FJKA 3TPQA 3THYA 3HT3A 4ISFA 2D0CA 2PFUA 3LAKA 1YVUA 3DLBA 3VQ7A 1C0GA 1GLBG 3VEXA 4AHCA 4FJJA 2VQFK 4HUEA 3VQ8A 4QAGA 4FYDA 2GEMA 3O6WA 5GINA 1KRPA 3LP0A 3ZSWA 4KH6A 2P9NB 5AQRA 3CXCM 4CFBA 1R0AA 1HNWK 4GMJB 4CJEA 3LM2A 3VGLA 3ZEUA 2NRVA 2QWNA 4CJUA 3P39A 2RPIA 2QEXN 1C0UA 4DTXA 2E2NA 3B6PA 3RRHA 1ASVA 2DPNA 4DV2K 4FJGA 3KWGA 3JAMO 4B9SA 1KXPA 4DSFA 2A5XA 5E84A 1RT7A 1RT6A 3VEWA 3H46O 4I6MB 1X9JA 4FLWA 2CH5A 4KH5A 1UAXA 1ASWA 3O4QA 4BVPA 3HM9A 2WTUA 3GG4A 4RW9A 3OY9A 3BF3A 1WBDA 1K9MO 1NJZA 4KRFA 3RVCA 4C1NI 3FZFA 4IKFA 2YNHA 3A5LC 3NAEA 2OZMA 1W0HA 4L3QA 1LOTB 3QEVA 3O3FA 4BC5A 4DTRA 3SJHA 1NK4A 3JSMA 3LALA 1SV5A 1JJ2M 5AQYA 1QVFM 4IFEA 3UKRA 4DV0K 2HMPA 4JI8K 4HWIA 4DV4K 3E9PA 3D45A 5AJ3K 4BDYA 1L3UA 1QQOA 2KHOA 1BIZA 1U6ZA 3A2FA 5AQIA 5JS1A 1S1UA 1HPMA 3OS0A 1K73O 1TKTA 4GKKK 1FJGK 2O8DB 1HNIA 5E41A 2G8HA 4JK8A 3U3YA 1E4GT 4KB0A 1L3SA 3E01A 1KQSM 3C65A 4XEIA 1HX1A 3HPOA 1NWKA 1K6YA 4B1WB 1ATRA 4KH4A 1NU0A 3CFOA 3KJVA 4YOVA 4IJAA 4KHWA 3QIOA 5C25A 3QEWA 4CJRA 4ICLA 5M1OA 4LF8K 4B3RK 1VSLA 1SUQA 3QEIA 3M6GA 1C0FA 4E89A 1XUPO 3QFUA 1EWRA 2P9SA 5M1PA 4BC4A 3CQXA 2HVHA 2A41A 4OLBA 3VETA 5DK5A 2IVNA 4DF4A 4KHQA 3HPHA 4ZTJA 3SBGA 1WSJA 2FLOA 2GTDA 1T8EA 2A1RA 3KZBA 3SK3A 4FM2A 1GOBA 4ILGB 4CJWA 4CIGA 5LY3A 1W97L 3C6UA 4FOEA 3SCXA 1TK5A 3IKMA 4IJNA 2HVIA 3M5RA 5GAEP 4F8RA 4BG9A 4QCLA 4CZKA 2FSKA 4LH4A 1GOAA 3AA2A 4KPYA 2F7TA 1JL2A 4DSLA 5IT9O 4B3TK 2JWKA 1J5EK 2HHVA 3CFRA 4AM6A 3KTQA 4JI2K 2D0BA 4IDKA 3SUOA 4FLTA 4A57A 2IS3A 5J2NA 5C15A 3VEOA 4AHUA 4WCEL 4DR7K 4BE0A 1A5WA 4JRQA 3DRRA 2Y1JA 2YJFA 3O4WA 1S9GA 2VGMA 3OYIA 4J2DA 1P90A 1X3NA 4A2AA 1QSLA 1S1WA 4KHSA 4DV6K 1BO5O 4RCHA 4RW4A 3LL3A 3HI0A 3DLHA 3DMJA 3ZCMA 3M8PA 3NFAA 4GY2B 3H6EA 2EX3A 5FPMA 5GAHP 3CQ8A 3THWB 4B9QA 3W0LA 1BI4B 3OYMA 3TARA 1ATNA 4RTFD 4A5AA 4BDPA 3H45C 3NF7A 2QWOA 3FFKB 3ULEA 1HYZA 3SPYA 4OGEA 4E7JA 3ZSOA 4FLZA 2O8CA 3RMCA 3L3UA 4E3SA 3FR0A 4MO5A 3WEEA 1YTUA 4KI6A 4CJ3A 3KKSA 2NRTA 1GLFO 4DCHA 4B3MK 4DMNA 5CY4A 3WQTA 1VQKN 2QK9A 4CZGA 3NF6A 3O80A 4CEZA 2VQEK 4M3WA 4GNIA 2GUIA 2ASMA 4OPHA 1UOCA 3CJ1A 1TUYA 4MQ3A 5C0YA 2P9UB 4ILJA 3OYKA 4KTWA 5HL7L 2DFFA 3WNGA 2VWKA 3VQDA 5AQVA 5I9EB 4DLEA 1TKDA 5GIPA 1ATSA 1XHZA 5J1EA 2W40A 2X74A 4DR3K 3O8MA 3CFPA 1VSKA 4BRFA 5MLCQ 5FPNA 4AQYK 3K5NA 2GUPA 4FWRA 2NZTA 4IG3A 2B4JA 3CC4N 3RMBA 1QQNA 1YIJN 5SWMA 4JI4K 3Q7CA 4Y1CA 3LP1A 4UQGA 4I7FA 2VWJA 4DV1K 1MWKA 4IEEA 1SKRA 4NCAA 2BE2A 1NKCA 1J53A 3CJ9A 1NG9A 1I3AA 1SQKA 1U47A 3DI6A 5IWAK 2OANA 3CF5L 5DM6L 3AY9A 5FROA 1HMVA 1S6PA 4CBWA 4CEBA 3L2VA 2P9IA 5AZJA 4EIAA 3LDLA 1YTAA 3N4QA 5KI6A 1ZC6A 1J6ZA 5BRFA 1X9MA 1HNZK 4DQPA 4FWMA 4M3TA 2WOMA 2HHQA 3CPEA 1R59O 4IEIA 3PO4A 4JD2A 4DR6K 3TAQA 4I2QA 4PA1A 3EO3A 4TSXA 3I33A 3LZIA 4GV3A 3VOVA 5I42A 4FJHA 3OJUA 5AZIA 3FZMA 3H08A 4WFAL 4BRGA 3AO2A 3F9KA 4CD3A 2UU9K 3LZJA 1BU6O 4CEEA 2B5JA 2HBLA 1GOCA 3HOTA 5BN8A 1RT4A 4E0DA 3OS1A 1K8KA 3NGIA 2Q0UA 4AHSA 3SUPA 4ELTA 4N76A 4OPAA 3L2RA 4MFBA 4DLGA 4WE1A 3ZETB 5H1SQ 4KAZA 2KLAA 4CJFA 2FXUA 3U3GA 3L0QA 3NF8A 3RTVA 3AO5A 3DLRA 3T1HK 1Q82O 2YNGA 2Q1NA 4FVUA 3HVRA 1W9HA 5EX5A 3OYLA 3ZX3A 1J9AA 4H8KA 2P9SB 4DR4K 4B1VA 3EN9A 1NOYA 3DM2A 1X9WA 1YAGA 3SAHA 3AVCA 3LPUA 4HUFA 1LW0A 5JVGL 4DFKA 1QZ5A 4B9LA 3TR8A 1T3VA 1IKYA 4EP5A 2A40A 3VQ6A 1QTMA 3DLKA 4CHOA 4AILC 4FK0A 1OH6A 2E6LA 4BRPA 4CJPA 4KHYA 1X9SA 1RDWX 2PAVA 1V4TA 2FSJA 4B9VA 4FK4A 4DR5K 1BQMA 4NXMK 2O8BA 3MN6A 1NBWA 2F8SA 2F9WA 4BRDA 1OVQA 4CF0A 1NGJA 3OJSA 4JI3K 1HQUA 3QLHA 1HUXA 2ZM6K 1M90O 4QS8A 2FBXA 1YXQA 1OH8A 2P9KB 3WT0A 4C1NK 5CE3A 1VQLN 3MAQA 4DS4A 5AFUH 3J7YP 3MWTA 4F2RA 5SZTA 5AR0A 2JGUA 4E7KA 4OLAA 4CFCA 5C10A 4WF9L 2A3ZA 1QE1A 3TI0A 4JKAA 4LH5A 4BE2A 1RTJA 5J2QA 3D2FB 2ZD1A 1E4FT 3FE1A 3HVTA 4DU3A 3V9SA 3TSPA 3HK2A 4CJSA 5BR9A 4GV9A 1HNVA 1XQSC 1BL3A 4J2AA 2KQ2A 2OYQA 5EU7A 1FKOA 4U67L 1NJXA 2ZF5O 3A5MC 1WAFA 3ZLJA 4MDAA 4O44A 1D9DA 1GLAG 3AO3A 4FM1A 1EQYA 2VGNA 5EOYA 3F9MA 4CHYA 3VEYA 4XIUA 4O8UA 1ZYQA 1XWLA 4CF9A 3CHWA 1NKEA 1LWFA 1V4SA 5C2FA 4K41A 2RF2A 3CCRN 3L6QA 1EP4A 4JKGA 2F96A 3MN9A 4M45A 4ELVA 3AVMA 4CK2A 3UE5A 2P9PB 3BZKA 3QINA 3B6OA 4C8NA 4IOCL 2ASOA 3NVKA 3P1GA 4PL8A 3VQCA 3NE6A 4BR9A 4H4OA 2D0AA 3D2EA 3TSQA 1T44A 5AFUA 4CZLA 2Z1GA 4OPKA 4W5OA 3CETA 3E66A 3R3LA 3QFPA 3RWUA 3QIPA 3CCUN 1DTTA 4HTLA 3MDQA 3MN5A 3U4LA 3UKUA 3J81O 4EHTA 3E1YA 1M1KO 2YJEA 1C1AA 4K8ZA 3NBPA 4CJVA 1MDUB 3BEXA 1HNXK 1Q7YO 1HPZA 2I7PA 1IV0A 5AQUA 4BQLA 2FF6A 1ZBFA 3LPTA 1QHAA 3LWLA 3QETA 2HHXA 2EWSA 5TKYA 1U49A 3QO9A 3L2UA 3OYJA 3OYGA 2NRZA 1E3MA 3K57A 4LF7K 4K43A 2OPQA 3THVA 4GVEA 1RTIA 4LF9K 1DKGD 1VQ8N 5BPLA 4LSLA 5FRNA 4CF2A 3K9JA 4Y1DA 3O08A 5AQTA 3HTVA 4Z4IA 2FC0A 4BQZA 3K58A 3ZSQA 5J2PA 3M3ZA 5EY4A 3NF9A 4FSVA 2HF4A 1S9EA 1JCEA 4CBXA 3VQBA 3SUNA 4WQ4A 4DU4A 5HROA 4KTZA 3V6DA 4CJLA 1JKHA 3EYZA 2Z1HA 1YJWN 2I7NA 4AHRA 3CCMN 1WNSA 4YOYA 1GLJO 2H3GX 3THXA 1WN7A 3E9LA 4JD2B 3K0SA 4BWMA 2XY7A 3AAPA 3AVJA 4FWLA 4G9ZA 4CGHA 1A5VA 3FGUA 3VQPA 4OX9K 4DF8A 3DXKA 4DTNA 3JS6A 2UUCK 4FW2A 1QVGM 1HJRA 2KTQA 1L3TA 3DXMA 2BANA 2RN2A 1GLDG 2P5GA 4JN4A 3OW2M 5BREA 4X65K 2E4LA 1TYQA 4PUOA 1K8KB 5BN9A 3NH2A 1LAVA 3TANA 3KK7A 1WBBA 4KTQA 2AA4A 1KCFA 4IFVA 3OHRA 2QA4N 1SKWA 4CJ5A 1IKXA 5KGWA 2VG6A 3J80O 1KTQA 4FPBA 2AP1A 2P9LB 2GELA 2IVOA 3R9PA 2CH6A 4JKCA 1Q9YA 1ZBHA 4JKDA 1KAXA 3EL2A 3P31A 5M1NA 2Q3SA 2WBNA 3NH1A 3HSCA 1XI1A 4B9NA 3WXLA 1C1BA 3V4IA 1QHTA 3AA4A 3G25A 5M1FA 3MK6A 4JHDB 1RT5A 1D9FA 4O0JA 4Z0UA 3WNEA 4R5PA 3EZWA 1OVYA 4L8RB 1ILYA 3RSEA 5HOOA 2W42A 4Z94A 3V9UA 3AA5X 2UYTA 4FWPA 1HKCA 1WSHA 3CYMA 4DKWA 1NK9A 1JLQA 2O8BB 4E1MA 3MCAB 4FJ7A 2E2QA 4E1JA 4BR4A 1YF5L 1IBMK 5KPTA 1GLCG 1WSFA 2XY5A 3F5TA 1KFDA 3L2QA 3LAMA 4H4MA 4OPJA 5AQHA 3BUZB 1YI2N 3FFIA 3CPWM 3MEDA 3ULDA 1TL3A 4A62A 1HYVA 3AVAA 2NRXA 4H5RA 2O8EB 4IFYA 4GW6A 3WNHA 4E7HA 4G1QA 3RR7A 3CQYA 3TABA 1HR0K 2NLXA 1JL1A 5HP1A 1D8YA 1C0TA 3IAYA 3GBTA 3CJAA 3G4SN 2BGGA 2YHYA 4CEAA 3O4NA 2D1KA 1EETA 4JS5A 1D5AA 1T05A 4PKHA 4O5BA 5LMUK 4F4KA 4EZ6A 3R6MA 1VQ5N 2RKIA 3C7NB 4BRAA 3O1BA 1S3XA 2P51A 1HLUA 3TAMA 4DFJA 3V1RA 2HNDA 4BC2A 4FWSA 3BGRA 1Z25A 3HP6A 1JLGA 4JI6K 1HKBA 4N56A 1OH7A 2J4RA 3ALYA 1FXXA 3D2EB 3L3VA 4ID1A 5GAGP 1NLVA 1WLJA 1JLFA 3HJFA 3V1OA 2HHHK 5JMVA 4XH1A 4LFAK 4FVMA 1D4XA 1RILA 2V7ZA 5AQSA 1NK5A 1EWQA 3VF2A 3SYZA 1ZBUA 1IJJA 4QS9A 3CCJN 3QERA 1QS4A 3H1QA 3AGKA 3HPGA 2KFNA 2E1ZA 4OVLA 3V1QA 1KFSA 1VAZA 2OPPA 1TKZA 4BGBA 4HTUA 2HOEA 3AVNA 5EXWA 1DLOA 1VQPN 4DTUA 1MWMA 4PWDA 5CYMA 1VSJA 3U8XA 3MCPA 3AO4A 4IOAL 1ASUA 2A1SA 1B9FA 2O4GA 1DTQA 3IS9A 3HXMA 3HOSA 3WXJA 4AM7A 3V81A 4CGJA 4MLEA 4DTMA 4CJTA 1J5OA 2D0OA 4IO9L 3ID6A 5AQFA 2E6MA 1MA9B 5EVZA 4CGDA 3O1WA 4B1YB 4OKEA 3BF1A 3RMDA 3QEXA 3THYB 3KKRA 4KV8A 4YFUA 4CEQA 3OYCA 4MLHA 2YKMA 3QBWA 3NHGA 2HSTA 5DMRA 2UXCK 4O4GA 1VSDA 2G8UA 1KLMA 1T7PA 1P8ZA 3N4PA 4FO0A 5AQXA 4KHNA 1C0MA 4M7XA 4FCYA 4DQSA 3SBTA 1K8AO 4F2SA 4YDUA 1JXBA 3ZEUB 5B8HA 1RDDA 4WQ4C 4FZYA 1WSGA 3VGMA 1KAZA 3T7ZA 2EHGA 2FF3B 3VA3A 4DV5K 1Y64A 3DRSA 4NYNA 1L3VA 3KHYA 3DXMB 4XH4A 3PY8A 4KREA 3QEPA 2W6KA 1X1PA 4BRNA 4O5FA 2VCPA 1JLEA 2IIRA 1VHXA 1T6CA 1TYQB 2A6AA 1XNQK 4OGCA 2G8VA 4B3SK 2DY4A 4WYBA 5ELZA 1RT2A 3WXMB 4FJ5A 1S6QA 3CG7A 3VQEA 4M41A 5C2DA 4NB4A 1TKXA 3MXJA 2HMIA 3K2PA 3TTDA 4DG1A 1RDUA 1KVBA 1NK7A 5D3GA 2NRRA 1SAZA 3OYFA 1XHXA 5KPZA 4FLXA 5LL6Z 3ATVA 2QWMA 3VESA 2KFZA 3UKRB 4CIEA 3MWPA 1KD1O 2KZMA 3EE9A 1RBTA 2ITMA 1EO1A 1I94K 4FJMA 3VENA 2E2OA 4MO4A 3TTFA 3S41A 4JI7K 2P5OA 2IC3A 4JKHA 1KSPA 1JXEA 4NCGA 3G71N 3CCSN 1VQ9N 3RSEB 4EAHD 1NK8A 3QBXA 4Y0WA 1RDAA 4DTPA 1TAUA 3KLGA 4V19S 3SJJA 4GVMA 3SPZA 2G8KA 3WXIA 3SAGA 3CCEN 1VRTA 5F0XA 2WONA 3M8SA 4LF6K 1EX4A 5F1XA 1QQMA 4BRQA 2OPSA 1BISA 3CJCA 3K59A 4CJ7A 3CMEN 4CGGA 1WAJA 1VSEA 3R8EA 5F2RA 4K0KK 4IOXA 3O9QA 3EEQA 3NVMA 4JI0K 4DUYK 4PKIA 3L4QA 2DFEA 2OCEA 5AQOA 4DR1K 1RTDA 2PBDA 2GBZA 4RW8A 2HF3A 1BWFO 3AVGA 2NNWA 3I0SA 2ZQBA 4FLUA 1NGIA 1XMOK 3LDSA 4FWNA 1YHQN 4BDZA 2IDOA 3HO1A 3TAGA 5CZ1A 3TAPA 4B1XB 2X6NA 1NJYA 3L2WA 2Q97A 4DHYA 4NXNK 1VRUA 4C8LA 1U45A 1U2VA 4BRLA 2P1JA 4E7LA 3OYAA 1NGHA 1T6DA 1RFQA 4AHTA 1BA1A 1WOQA 4DQIA 5HRSA 3T19A 1Q86O 1TL1A 3KVGA 3DRPA 3SUQA 4DWIA 4I2PA 4H5WA 2QWLA 2WUSA 1XC9A 1NK6A 5AQNA 2O8DA 5C24A 3VA0A 5I3UA 2NUBA 4Z4GA 3VTHA 4WQ5A 4FM0A 2GWKA 3SMPA 4BREA 4JYAK 3OYHA 4CJQA 4H5NA 4EHUA 4FJXA 1ZBLA 4A59A 1J54A 3CJBA 3G0ZA 4EFHA 4A5BA 3GL1A 2UUBK 4CJKA 3SZ2A 2O4IA 5AQKA 4PHTX 3G6EN 3LDOA 3ZX0A 1KC8O 1G99A 5KRSA 4M7YA 2YHAA 1BOTO 2YHXA 1FKPA 3UIQA 3P4IA 4JK9A 2E20A 4H0OA 3HP9A 3UB5A 3ULEB 5FPDA 2WC9A 3KLEA 2A42A 3O3GA 4IO8A 1IBKK 3MX2A 3CCLN 3AVIA 2O8CB 4FLVA 3WQUA 2D5RA 3WEEB 3DWLA 5AQZA 3KIOA 2VG7A 1RDCA 4K42A 2YHWA 4AH9A 4BRIA 4CHNA 4BWJA 3VF4A 1YVNA 4BRKA 3I8BA 4FJ9A 3WNFA 3TTCA 4Z4FA 3FZKA 2ZWHA 3FLCO 1RT3A 3DJCA 3D0PA 2HBMA 3QDKA 3ENHA 4EP4A 2JLEA 5KRTA 1SKSA 4X66K 2ZJRL 2QWPA 1NGGA 3AVHA 4HVJA 4RG8A 3VTIA 1JLAA 1S5JA 1VK0A 4CF8A 3Q7BA 3OYEA 2HHTA 3AGRA 2YNFA 4QS7A 4BVOA 3SLCA
chains in the Genus database with same CATH topology
2W42A 2FBVA 1YTUA 4CESA 4KI6A 4CJ3A 3KKSA 3V9UA 4RW7A 4DU1A 1NJWA 3AA5X 4CEDA 4DMNA 1F21A 5CY4A 1WSHA 1BQNA 3NDKA 4N41A 3CYMA 4DFPA 1NK9A 1I39A 4FXDA 1JLQA 3IG1A 3VQ5A 4DFMA 2ZE2A 4FJLA 2QK9A 4CHPA 4E1MA 3TWHA 3NF6A 3V9ZA 4CEZA 4DS5A 4DTSA 3SQ1A 3S3MA 2XY8A 4FJ7A 4O55A 4FZXC 4M3WA 4F3TA 1IKVA 2GUIA 1NKBA 3KK3A 4M42A 1LAWA 4LD0A 1UOCA 3OS2A 1BI4A 1WSFA 4MQ3A 4E1NA 2XY5A 1KFDA 3L2QA 3LAMA 4H4MA 3OYKA 4OPJA 3KD1E 3FFIA 1LWCA 4KTWA 1CZ9A 4B9MA 3M8QA 2DFFA 3MEDA 3ULDA 1TL3A 4B9TA 2HNYA 4QOZB 1HYVA 3AVAA 1CXQA 1HRHA 3WNGA 3ZT1A 1TVRA 2VWKA 3VQDA 4IFYA 4GW6A 1ITGA 3WNHA 4B9UA 1UA0A 4E7HA 4FK2A 3KK1A 4G1QA 3NGZA 3PO5A 3ZT0A 3RMAA 4IG0A 4DLEA 1TKDA 3OYNA 3RR7A 3TABA 4HCBA 1BHLA 1C1CA 3F73A 4DSEA 1XHZA 5J1EA 3RRGA 1TV6A 2X74A 3AVFA 5C42A 4CEFA 2Y1IA 2B6AA 1JL1A 5HP1A 1D8YA 3CFPA 1TGOA 1REVA 3L8BA 1C0TA 2KZZA 1VSKA 4HHTA 3IAYA 3DLEA 4ID5A 3K5NA 4FLYA 4IG3A 2B4JA 3O3HA 3OYDA 3RMBA 1RT1A 3K5MA 5CZ2A 2AJQA 5SWMA 3S3OA 2BGGA 4Y1CA 1G15A 3LP1A 3ZSZA 4CEAA 1S1XA 3O4NA 2Z1IA 4UQGA 4I7FA 2VWJA 1EETA 1Z26A 3HL8A 1SKRA 2HHUA 4JS5A 4FZZA 1D5AA 1T05A 4NCAA 1U04A 3VN5A 2BE2A 1NKCA 4O5BA 1L5UA 3MEGA 4F4KA 1J53A 4EZ6A 3AVKA 4IBNA 4M3ZA 3ZSXA 4JRPA 3CM6A 2RKIA 1I3AA 3MXMA 3VQAA 3C94A 1UA1A 1U47A 3DI6A 5J2MA 4DSKA 3TAMA 2P51A 2G8FA 4DFJA 4B8AB 3V1RA 4DTJA 2HNDA 3NGYA 3PX6A 3KD5E 3BGRA 5FROA 1HMVA 1S6PA 4CEBA 1Z25A 4CE9A 3HP6A 3L2VA 3AVLA 1JLGA 4CFDA 2X6SA 3ZSYA 4HUGA 1IG9A 4N56A 1YTAA 5HBMA 5KI6A 5FRMA 4ZTFA 3ALYA 1FXXA 1X9MA 4DQPA 3L3VA 3SQ0A 4M3TA 2WOMA 4ID1A 2HHQA 1WLJA 3SV4A 1JLFA 3HJFA 3PO4A 1S1VA 2OPRA 3V1OA 3RR8A 1RTHA 1S1TA 3MECA 3PV8A 3I0RA 4KO0A 3TAQA 4FVMA 1EKEA 1RILA 4I2QA 4PA1A 1NK5A 2Z1JA 5KTQA 3ISNC 2I5JA 2YHBA 1ZBUA 4TSXA 5HRNA 3LZIA 3SYZA 3P83D 1B92A 5JS2A 3QERA 1QS4A 4KFBA 4BE1A 1RBSA 3SI6A 5I42A 1QSSA 3BDPA 4FJHA 2QXFA 5FDLA 3OJUA 1CXUA 4CGIA 3ASMA 3HPGA 2KFNA 3S3NA 4J2EA 3C6TA 4Z4CA 4OVLA 2G8WA 3H08A 4CGFA 3V1QA 3AO2A 1KFSA 3F9KA 4ELUA 3LZJA 2OPPA 3MXIA 1TKZA 2PYLA 4CEEA 2B5JA 4HTUA 1GOCA 3TAFA 4OKKA 3AVNA 2KW4A 1RT4A 1DLOA 2HHSA 4E0DA 1BCMA 3OS1A 4DTUA 3NGIA 4AHSA 3SUPA 4ELTA 4N76A 2VG5A 4M3XA 5CYMA 4PWDA 4M3YA 3L2RA 1VSJA 3HYFA 1JLCA 1RCHA 4Z4EA 3AO4A 4MFBA 4DLGA 2F8TA 4WE1A 4K8XA 4KAZA 4AHVA 1ASUA 3G10A 2A1SA 4LY7A 4CK3A 1B9FA 2O4GA 1DTQA 3IS9A 4CJFA 4Q5VA 3HXMA 4HCCA 3U3GA 1Q9XA 3RTVA 3NF8A 3ZT2A 3AO5A 4FJIA 3DLRA 3V81A 2YNGA 4CGJA 3KLHA 2GV9A 4CJ4A 3HVRA 1W9HA 4DTMA 4CJTA 1J5OA 3OYLA 3QNNA 4CCHA 1J9AA 4H8KA 3KK2A 4OKJA 2E6MA 4CGDA 1TAQA 2PZSA 4OKEA 1NOYA 4O0IA 3RMDA 2HB5A 3DM2A 3LP2A 3QEXA 3KKRA 4KV8A 4YFUA 4CEQA 2ITGA 4W5TA 3OYCA 3C95A 3PX0A 1RDBA 1VSMA 3DYAA 1X9WA 2YKMA 3AVCA 1KVCA 3VQ4A 2XO7A 3NHGA 3LPUA 1KVAA 4HUFA 1LW0A 4LSNA 2ATQA 4DFKA 4B9LA 5DMRA 3AO1A 4O4GA 3TR8A 4KI4A 4E19A 1IKYA 4EP5A 1VSDA 3VQ6A 3EY1A 1QTMA 2G8UA 1KLMA 1T7PA 3ZT3A 2DTUA 3DLKA 4CHOA 4J2BA 4C8KA 2DFHA 4JS4A 4CERA 4AILC 4KHNA 1C0MA 4FK0A 4FCYA 4DQSA 2E6LA 4CJPA 4F2SA 1JXBA 4KHYA 2LSNA 3ITHA 4DQQA 1X9SA 4FJNA 4OJRA 3DLGA 1RDDA 4FZYA 3QNOA 4B9VA 3EZ5A 4FK4A 1BQMA 1WSGA 2EHGA 2F8SA 4YNQA 3VA3A 1IO2A 3DRSA 4NYNA 4CF0A 4RW6A 3OJSA 1LWEA 1T03A 1L3VA 1HQUA 3ZT4A 3QLHA 3M8RA 1HQEA 4FJKA 3PY8A 2IAJA 4KREA 3HT3A 2IOCA 3QEPA 2FBXA 1X1PA 3DOLA 2D0CA 3LAKA 1YVUA 4I9QA 3DLBA 3T1AA 3VQ7A 3S9HA 4AHCA 4FJJA 4HUEA 3MAQA 3ZSRA 4DS4A 1JLEA 4BE2A 3VQ8A 4F2RA 5SZTA 2JGUA 4OGCA 4QAGA 2G8VA 4DSIA 1NJYA 4NYFA 4E7KA 2QKKA 4FYDA 2DY4A 4OLAA 1NK0A 4CFCA 1RT2A 1KRPA 3LP0A 3ZSWA 4FJ5A 1QE1A 1U48A 4CFBA 1R0AA 3TI0A 1S6QA 4GMJB 3CG7A 4LH5A 3VQEA 1RTJA 1C6VA 2YNIA 4CJEA 4BACA 4FW1A 5J2QA 2ZD1A 4M41A 3HVTA 4DU3A 1TKXA 3MXJA 1B9DA 2HMIA 3K2PA 3V9SA 2OA8A 4DG1A 1KVBA 4CJUA 1NK7A 5D3GA 2XHBA 3HK2A 2PY5A 4CJSA 3OYFA 3T3FA 1XHXA 2RPIA 4FLXA 1C0UA 1HNVA 4DTXA 1BL3A 4JLHA 4J2AA 2KQ2A 1Y97A 5EU7A 2OYQA 3B6PA 4FJ8A 1FKOA 2R7YA 4CIEA 3VQQA 1ASVA 4B08A 3RRHA 2KFZA 1N5YA 1NJXA 2KZMA 1RBTA 4FJGA 1WAFA 4FJMA 4B9SA 4O44A 1D9DA 3AO3A 4DSFA 4FM1A 1LV5A 2HNZA 1RT7A 1RT6A 4DSJA 1QSYA 4Z4HA 4CHYA 1FK9A 4XIUA 4FLWA 1XWLA 4CF9A 1ZYQA 1NKEA 1LWFA 2P5OA 2IC3A 4KB1A 2HW3A 2RF2A 1KSPA 4C8MA 1JXEA 1UAXA 4M45A 1EP4A 1ASWA 2F96A 3O4QA 4NCGA 3HM9A 4DQRA 1KLNA 4ELVA 3AVMA 4B3OA 4RW9A 1NK8A 4CK2A 3OY9A 3PX4A 1RDAA 3LANA 4DTPA 4C8OA 3QINA 1NJZA 4KRFA 1TAUA 3PUFA 3KLGA 3B6OA 4C8NA 4IKFA 1BGXT 2YNHA 4GVMA 3NH0A 3NAEA 3SJJA 3JYTA 3SPZA 1W0HA 1VRTA 2G8KA 2WONA 3M8SA 2OZMA 3P1GA 3VQCA 4Q0BA 3NE6A 3QEVA 1TK8A 4H4OA 2D0AA 1EX4A 3O3FA 4PY5A 4KHUA 4DTRA 1NK4A 2OZSA 2Z1GA 3JSMA 4OPKA 2OPSA 1BISA 1N6QA 2BDPA 3LALA 4W5OA 1BIUA 1SV5A 4PQUA 3K59A 3TAEA 3RWUA 3QIPA 1DTTA 4CGGA 5HRPA 1IH7A 1WAJA 3D45A 3AV9A 5HRRA 1VSEA 4BDYA 1L3UA 1Q8IA 1O1WA 1C1AA 2ETJA 4K8ZA 1IKWA 1RBVA 1BIZA 3A2FA 3NBPA 4CJVA 4B8CA 1HPZA 5JS1A 3LWMA 2DFEA 1S1UA 1RTDA 4EZ9A 3OS0A 3HSTB 1TKTA 1HNIA 5E41A 2G8HA 2GBZA 1ZBFA 3VQ9A 3LPTA 4RW8A 3U3YA 1L3SA 3E01A 3LWLA 3QETA 4KB0A 2HHXA 3AVGA 3I0SA 3P5JA 1U49A 2ZQBA 3HPOA 3QO9A 4FLUA 3L2UA 3LDSA 1U4BA 3OYJA 1K6YA 1JLBA 3OYGA 4BDZA 3K57A 1SL0A 2IDOA 4CECA 3HO1A 2YKNA 3TAGA 3CFOA 5CZ1A 3KJVA 3TAPA 2X6NA 3NCIA 4KHWA 2XY6A 2OPQA 3QIOA 4ZHRA 5C25A 3L2WA 3V9XA 3QEWA 3THVA 3SQ4A 1RTIA 4CJRA 1YT3A 1VRUA 1RBUA 4ICLA 4E7IA 5HLFA 5KGXA 1U45A 4C8LA 4LSLA 3SQ2A 5FRNA 1VSLA 2P1JA 1SUQA 4CF2A 4E7LA 3QEIA 3AA3A 4F3OA 3OYAA 4Y1DA 4W5RA 4E89A 4AHTA 4Z4IA 2FC0A 4DQIA 2HHWA 3K58A 3ZSQA 3T19A 4CEOA 5HRSA 5J2PA 1TL1A 4KKOA 4CHZA 2HVHA 5K14A 3DRPA 4OLBA 3SUQA 4DWIA 3NF9A 5DK5A 4I2PA 4DF4A 1S9EA 4KHQA 3HPHA 1XC9A 1NK6A 3VQBA 4ZTJA 1WSEA 5C24A 1WSJA 3VA0A 2NUBA 3SUNA 2YV0X 4I9LA 5I3UA 1T8EA 5HROA 4DU4A 4Z4GA 2A1RA 4KTZA 4CK1A 4FM2A 4FM0A 1BCOA 3V6DA 3SV3A 1GOBA 4N47A 4CJWA 4CJLA 3OYHA 1JKHA 4CJQA 4CIGA 3C6UA 3SCXA 4FJXA 3EYZA 1TK5A 1ZBLA 2Z1HA 1J54A 4M3RA 2PYJA 3G0ZA 2O4IA 3K5OA 2HVIA 1CLQA 4CJKA 3K5LA 3SZ2A 4F8RA 4AHRA 4CF1A 4QCLA 4LH4A 1UWBA 1CZBA 1GOAA 1RNHA 1WNSA 3AA2A 4KPYA 3V9WA 1WN7A 4BWMA 1JL2A 4DSLA 3IRXA 2XY7A 5KRSA 3KLFA 3AVJA 4CGHA 1A5VA 4W5NA 2HHVA 2YHAA 3CFRA 2FBTA 3VQPA 3KTQA 4DF8A 2D0BA 1FKPA 4IDKA 4DTNA 3SUOA 4FLTA 3UIQA 2IS3A 5J2NA 4FW2A 1ZBIA 2KTQA 1HJRA 1L3TA 4AHUA 3OVNA 1MU2A 2RN2A 2BANA 3DOKA 3HP9A 3KLIA 5CYQA 2P5GA 4BE0A 1A5WA 4JRQA 3DRRA 3KLEA 3O3GA 1SL1A 2E4LA 4PUOA 2Y1JA 3AVIA 1S9GA 5T7BA 4N5SA 1A5XA 1LAVA 3NH2A 4FLVA 3OYIA 3TANA 4J2DA 2D5RA 3AVBA 3SNNA 1VSIA 3KIOA 3MEEA 4KTQA 1KCFA 1QSLA 2VG7A 1RDCA 1WSIA 4AH9A 1S1WA 3CM5A 4KHSA 4IFVA 4CHNA 4BWJA 1SKWA 1HYSA 4CJ5A 1LW2A 3WNFA 4FJ9A 4CIFA 1IKXA 1EXQA 4Z4FA 5KGWA 2VG6A 2G8IA 4RW4A 1RT3A 3D0PA 1KTQA 3DLHA 3DMJA 3ZCMA 3M8PA 1ZBHA 1Q9YA 3NFAA 2EX3A 2XRIA 4EP4A 2JLEA 1VSHA 5KRTA 3CQ8A 2Q3SA 3NH1A 3I8DA 3U6FA 1SKSA 1XI1A 4B9NA 1BI4B 3OYMA 4DTOA 2IGIA 1C1BA 3V4IA 3TARA 1QHTA 3AA4A 3AVHA 4HVJA 4RG8A 1SL2A 1NOZA 4CFAA 1JLAA 1S5JA 1VK0A 4CF8A 1TK0A 1RT5A 3NF7A 4BDPA 3QESA 1D9FA 1HYZA 1RBRA 3ZSVA 4CHQA 3SPYA 4O0JA 4OGEA 4W5QA 3OYEA 2X78A 3LP3A 3ZSOA 4E7JA 4Z0UA 2FBYA 4FLZA 3WNEA 3RMCA 3OYBA 4NCBA 2HHTA 4M3UA 3L3UA 1VSFA 4E3SA 1QQCA 2YNFA 4R5PA 2QKBA 4L8RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W42 A;  2FBV A;  1YTU A;  4CES A;  4KI6 A;  4CJ3 A;  3KKS A;  3V9U A;  4RW7 A;  4DU1 A;  1NJW A;  3AA5 X;  4CED A;  4DMN A;  1F21 A;  5CY4 A;  1WSH A;  1BQN A;  3NDK A;  4N41 A;  3CYM A;  4DFP A;  1NK9 A;  1I39 A;  4FXD A;  1JLQ A;  3IG1 A;  3VQ5 A;  4DFM A;  2ZE2 A;  4FJL A;  2QK9 A;  4CHP A;  4E1M A;  3TWH A;  3NF6 A;  3V9Z A;  4CEZ A;  4DS5 A;  4DTS A;  3SQ1 A;  3S3M A;  2XY8 A;  4FJ7 A;  4O55 A;  4FZX C;  4M3W A;  4F3T A;  1IKV A;  2GUI A;  1NKB A;  3KK3 A;  4M42 A;  1LAW A;  4LD0 A;  1UOC A;  3OS2 A;  1BI4 A;  1WSF A;  4MQ3 A;  4E1N A;  2XY5 A;  1KFD A;  3L2Q A;  3LAM A;  4H4M A;  3OYK A;  4OPJ A;  3KD1 E;  3FFI A;  1LWC A;  4KTW A;  1CZ9 A;  4B9M A;  3M8Q A;  2DFF A;  3MED A;  3ULD A;  1TL3 A;  4B9T A;  2HNY A;  4QOZ B;  1HYV A;  3AVA A;  1CXQ A;  1HRH A;  3WNG A;  3ZT1 A;  1TVR A;  2VWK A;  3VQD A;  4IFY A;  4GW6 A;  1ITG A;  3WNH A;  4B9U A;  1UA0 A;  4E7H A;  4FK2 A;  3KK1 A;  4G1Q A;  3NGZ A;  3PO5 A;  3ZT0 A;  3RMA A;  4IG0 A;  4DLE A;  1TKD A;  3OYN A;  3RR7 A;  3TAB A;  4HCB A;  1BHL A;  1C1C A;  3F73 A;  4DSE A;  1XHZ A;  5J1E A;  3RRG A;  1TV6 A;  2X74 A;  3AVF A;  5C42 A;  4CEF A;  2Y1I A;  2B6A A;  1JL1 A;  5HP1 A;  1D8Y A;  3CFP A;  1TGO A;  1REV A;  3L8B A;  1C0T A;  2KZZ A;  1VSK A;  4HHT A;  3IAY A;  3DLE A;  4ID5 A;  3K5N A;  4FLY A;  4IG3 A;  2B4J A;  3O3H A;  3OYD A;  3RMB A;  1RT1 A;  3K5M A;  5CZ2 A;  2AJQ A;  5SWM A;  3S3O A;  2BGG A;  4Y1C A;  1G15 A;  3LP1 A;  3ZSZ A;  4CEA A;  1S1X A;  3O4N A;  2Z1I A;  4UQG A;  4I7F A;  2VWJ A;  1EET A;  1Z26 A;  3HL8 A;  1SKR A;  2HHU A;  4JS5 A;  4FZZ A;  1D5A A;  1T05 A;  4NCA A;  1U04 A;  3VN5 A;  2BE2 A;  1NKC A;  4O5B A;  1L5U A;  3MEG A;  4F4K A;  1J53 A;  4EZ6 A;  3AVK A;  4IBN A;  4M3Z A;  3ZSX A;  4JRP A;  3CM6 A;  2RKI A;  1I3A A;  3MXM A;  3VQA A;  3C94 A;  1UA1 A;  1U47 A;  3DI6 A;  5J2M A;  4DSK A;  3TAM A;  2P51 A;  2G8F A;  4DFJ A;  4B8A B;  3V1R A;  4DTJ A;  2HND A;  3NGY A;  3PX6 A;  3KD5 E;  3BGR A;  5FRO A;  1HMV A;  1S6P A;  4CEB A;  1Z25 A;  4CE9 A;  3HP6 A;  3L2V A;  3AVL A;  1JLG A;  4CFD A;  2X6S A;  3ZSY A;  4HUG A;  1IG9 A;  4N56 A;  1YTA A;  5HBM A;  5KI6 A;  5FRM A;  4ZTF A;  3ALY A;  1FXX A;  1X9M A;  4DQP A;  3L3V A;  3SQ0 A;  4M3T A;  2WOM A;  4ID1 A;  2HHQ A;  1WLJ A;  3SV4 A;  1JLF A;  3HJF A;  3PO4 A;  1S1V A;  2OPR A;  3V1O A;  3RR8 A;  1RTH A;  1S1T A;  3MEC A;  3PV8 A;  3I0R A;  4KO0 A;  3TAQ A;  4FVM A;  1EKE A;  1RIL A;  4I2Q A;  4PA1 A;  1NK5 A;  2Z1J A;  5KTQ A;  3ISN C;  2I5J A;  2YHB A;  1ZBU A;  4TSX A;  5HRN A;  3LZI A;  3SYZ A;  3P83 D;  1B92 A;  5JS2 A;  3QER A;  1QS4 A;  4KFB A;  4BE1 A;  1RBS A;  3SI6 A;  5I42 A;  1QSS A;  3BDP A;  4FJH A;  2QXF A;  5FDL A;  3OJU A;  1CXU A;  4CGI A;  3ASM A;  3HPG A;  2KFN A;  3S3N A;  4J2E A;  3C6T A;  4Z4C A;  4OVL A;  2G8W A;  3H08 A;  4CGF A;  3V1Q A;  3AO2 A;  1KFS A;  3F9K A;  4ELU A;  3LZJ A;  2OPP A;  3MXI A;  1TKZ A;  2PYL A;  4CEE A;  2B5J A;  4HTU A;  1GOC A;  3TAF A;  4OKK A;  3AVN A;  2KW4 A;  1RT4 A;  1DLO A;  2HHS A;  4E0D A;  1BCM A;  3OS1 A;  4DTU A;  3NGI A;  4AHS A;  3SUP A;  4ELT A;  4N76 A;  2VG5 A;  4M3X A;  5CYM A;  4PWD A;  4M3Y A;  3L2R A;  1VSJ A;  3HYF A;  1JLC A;  1RCH A;  4Z4E A;  3AO4 A;  4MFB A;  4DLG A;  2F8T A;  4WE1 A;  4K8X A;  4KAZ A;  4AHV A;  1ASU A;  3G10 A;  2A1S A;  4LY7 A;  4CK3 A;  1B9F A;  2O4G A;  1DTQ A;  3IS9 A;  4CJF A;  4Q5V A;  3HXM A;  4HCC A;  3U3G A;  1Q9X A;  3RTV A;  3NF8 A;  3ZT2 A;  3AO5 A;  4FJI A;  3DLR A;  3V81 A;  2YNG A;  4CGJ A;  3KLH A;  2GV9 A;  4CJ4 A;  3HVR A;  1W9H A;  4DTM A;  4CJT A;  1J5O A;  3OYL A;  3QNN A;  4CCH A;  1J9A A;  4H8K A;  3KK2 A;  4OKJ A;  2E6M A;  4CGD A;  1TAQ A;  2PZS A;  4OKE A;  1NOY A;  4O0I A;  3RMD A;  2HB5 A;  3DM2 A;  3LP2 A;  3QEX A;  3KKR A;  4KV8 A;  4YFU A;  4CEQ A;  2ITG A;  4W5T A;  3OYC A;  3C95 A;  3PX0 A;  1RDB A;  1VSM A;  3DYA A;  1X9W A;  2YKM A;  3AVC A;  1KVC A;  3VQ4 A;  2XO7 A;  3NHG A;  3LPU A;  1KVA A;  4HUF A;  1LW0 A;  4LSN A;  2ATQ A;  4DFK A;  4B9L A;  5DMR A;  3AO1 A;  4O4G A;  3TR8 A;  4KI4 A;  4E19 A;  1IKY A;  4EP5 A;  1VSD A;  3VQ6 A;  3EY1 A;  1QTM A;  2G8U A;  1KLM A;  1T7P A;  3ZT3 A;  2DTU A;  3DLK A;  4CHO A;  4J2B A;  4C8K A;  2DFH A;  4JS4 A;  4CER A;  4AIL C;  4KHN A;  1C0M A;  4FK0 A;  4FCY A;  4DQS A;  2E6L A;  4CJP A;  4F2S A;  1JXB A;  4KHY A;  2LSN A;  3ITH A;  4DQQ A;  1X9S A;  4FJN A;  4OJR A;  3DLG A;  1RDD A;  4FZY A;  3QNO A;  4B9V A;  3EZ5 A;  4FK4 A;  1BQM A;  1WSG A;  2EHG A;  2F8S A;  4YNQ A;  3VA3 A;  1IO2 A;  3DRS A;  4NYN A;  4CF0 A;  4RW6 A;  3OJS A;  1LWE A;  1T03 A;  1L3V A;  1HQU A;  3ZT4 A;  3QLH A;  3M8R A;  1HQE A;  4FJK A;  3PY8 A;  2IAJ A;  4KRE A;  3HT3 A;  2IOC A;  3QEP A;  2FBX A;  1X1P A;  3DOL A;  2D0C A;  3LAK A;  1YVU A;  4I9Q A;  3DLB A;  3T1A A;  3VQ7 A;  3S9H A;  4AHC A;  4FJJ A;  4HUE A;  3MAQ A;  3ZSR A;  4DS4 A;  1JLE A;  4BE2 A;  3VQ8 A;  4F2R A;  5SZT A;  2JGU A;  4OGC A;  4QAG A;  2G8V A;  4DSI A;  1NJY A;  4NYF A;  4E7K A;  2QKK A;  4FYD A;  2DY4 A;  4OLA A;  1NK0 A;  4CFC A;  1RT2 A;  1KRP A;  3LP0 A;  3ZSW A;  4FJ5 A;  1QE1 A;  1U48 A;  4CFB A;  1R0A A;  3TI0 A;  1S6Q A;  4GMJ B;  3CG7 A;  4LH5 A;  3VQE A;  1RTJ A;  1C6V A;  2YNI A;  4CJE A;  4BAC A;  4FW1 A;  5J2Q A;  2ZD1 A;  4M41 A;  3HVT A;  4DU3 A;  1TKX A;  3MXJ A;  1B9D A;  2HMI A;  3K2P A;  3V9S A;  2OA8 A;  4DG1 A;  1KVB A;  4CJU A;  1NK7 A;  5D3G A;  2XHB A;  3HK2 A;  2PY5 A;  4CJS A;  3OYF A;  3T3F A;  1XHX A;  2RPI A;  4FLX A;  1C0U A;  1HNV A;  4DTX A;  1BL3 A;  4JLH A;  4J2A A;  2KQ2 A;  1Y97 A;  5EU7 A;  2OYQ A;  3B6P A;  4FJ8 A;  1FKO A;  2R7Y A;  4CIE A;  3VQQ A;  1ASV A;  4B08 A;  3RRH A;  2KFZ A;  1N5Y A;  1NJX A;  2KZM A;  1RBT A;  4FJG A;  1WAF A;  4FJM A;  4B9S A;  4O44 A;  1D9D A;  3AO3 A;  4DSF A;  4FM1 A;  1LV5 A;  2HNZ A;  1RT7 A;  1RT6 A;  4DSJ A;  1QSY A;  4Z4H A;  4CHY A;  1FK9 A;  4XIU A;  4FLW A;  1XWL A;  4CF9 A;  1ZYQ A;  1NKE A;  1LWF A;  2P5O A;  2IC3 A;  4KB1 A;  2HW3 A;  2RF2 A;  1KSP A;  4C8M A;  1JXE A;  1UAX A;  4M45 A;  1EP4 A;  1ASW A;  2F96 A;  3O4Q A;  4NCG A;  3HM9 A;  4DQR A;  1KLN A;  4ELV A;  3AVM A;  4B3O A;  4RW9 A;  1NK8 A;  4CK2 A;  3OY9 A;  3PX4 A;  1RDA A;  3LAN A;  4DTP A;  4C8O A;  3QIN A;  1NJZ A;  4KRF A;  1TAU A;  3PUF A;  3KLG A;  3B6O A;  4C8N A;  4IKF A;  1BGX T;  2YNH A;  4GVM A;  3NH0 A;  3NAE A;  3SJJ A;  3JYT A;  3SPZ A;  1W0H A;  1VRT A;  2G8K A;  2WON A;  3M8S A;  2OZM A;  3P1G A;  3VQC A;  4Q0B A;  3NE6 A;  3QEV A;  1TK8 A;  4H4O A;  2D0A A;  1EX4 A;  3O3F A;  4PY5 A;  4KHU A;  4DTR A;  1NK4 A;  2OZS A;  2Z1G A;  3JSM A;  4OPK A;  2OPS A;  1BIS A;  1N6Q A;  2BDP A;  3LAL A;  4W5O A;  1BIU A;  1SV5 A;  4PQU A;  3K59 A;  3TAE A;  3RWU A;  3QIP A;  1DTT A;  4CGG A;  5HRP A;  1IH7 A;  1WAJ A;  3D45 A;  3AV9 A;  5HRR A;  1VSE A;  4BDY A;  1L3U A;  1Q8I A;  1O1W A;  1C1A A;  2ETJ A;  4K8Z A;  1IKW A;  1RBV A;  1BIZ A;  3A2F A;  3NBP A;  4CJV A;  4B8C A;  1HPZ A;  5JS1 A;  3LWM A;  2DFE A;  1S1U A;  1RTD A;  4EZ9 A;  3OS0 A;  3HST B;  1TKT A;  1HNI A;  5E41 A;  2G8H A;  2GBZ A;  1ZBF A;  3VQ9 A;  3LPT A;  4RW8 A;  3U3Y A;  1L3S A;  3E01 A;  3LWL A;  3QET A;  4KB0 A;  2HHX A;  3AVG A;  3I0S A;  3P5J A;  1U49 A;  2ZQB A;  3HPO A;  3QO9 A;  4FLU A;  3L2U A;  3LDS A;  1U4B A;  3OYJ A;  1K6Y A;  1JLB A;  3OYG A;  4BDZ A;  3K57 A;  1SL0 A;  2IDO A;  4CEC A;  3HO1 A;  2YKN A;  3TAG A;  3CFO A;  5CZ1 A;  3KJV A;  3TAP A;  2X6N A;  3NCI A;  4KHW A;  2XY6 A;  2OPQ A;  3QIO A;  4ZHR A;  5C25 A;  3L2W A;  3V9X A;  3QEW A;  3THV A;  3SQ4 A;  1RTI A;  4CJR A;  1YT3 A;  1VRU A;  1RBU A;  4ICL A;  4E7I A;  5HLF A;  5KGX A;  1U45 A;  4C8L A;  4LSL A;  3SQ2 A;  5FRN A;  1VSL A;  2P1J A;  1SUQ A;  4CF2 A;  4E7L A;  3QEI A;  3AA3 A;  4F3O A;  3OYA A;  4Y1D A;  4W5R A;  4E89 A;  4AHT A;  4Z4I A;  2FC0 A;  4DQI A;  2HHW A;  3K58 A;  3ZSQ A;  3T19 A;  4CEO A;  5HRS A;  5J2P A;  1TL1 A;  4KKO A;  4CHZ A;  2HVH A;  5K14 A;  3DRP A;  4OLB A;  3SUQ A;  4DWI A;  3NF9 A;  5DK5 A;  4I2P A;  4DF4 A;  1S9E A;  4KHQ A;  3HPH A;  1XC9 A;  1NK6 A;  3VQB A;  4ZTJ A;  1WSE A;  5C24 A;  1WSJ A;  3VA0 A;  2NUB A;  3SUN A;  2YV0 X;  4I9L A;  5I3U A;  1T8E A;  5HRO A;  4DU4 A;  4Z4G A;  2A1R A;  4KTZ A;  4CK1 A;  4FM2 A;  4FM0 A;  1BCO A;  3V6D A;  3SV3 A;  1GOB A;  4N47 A;  4CJW A;  4CJL A;  3OYH A;  1JKH A;  4CJQ A;  4CIG A;  3C6U A;  3SCX A;  4FJX A;  3EYZ A;  1TK5 A;  1ZBL A;  2Z1H A;  1J54 A;  4M3R A;  2PYJ A;  3G0Z A;  2O4I A;  3K5O A;  2HVI A;  1CLQ A;  4CJK A;  3K5L A;  3SZ2 A;  4F8R A;  4AHR A;  4CF1 A;  4QCL A;  4LH4 A;  1UWB A;  1CZB A;  1GOA A;  1RNH A;  1WNS A;  3AA2 A;  4KPY A;  3V9W A;  1WN7 A;  4BWM A;  1JL2 A;  4DSL A;  3IRX A;  2XY7 A;  5KRS A;  3KLF A;  3AVJ A;  4CGH A;  1A5V A;  4W5N A;  2HHV A;  2YHA A;  3CFR A;  2FBT A;  3VQP A;  3KTQ A;  4DF8 A;  2D0B A;  1FKP A;  4IDK A;  4DTN A;  3SUO A;  4FLT A;  3UIQ A;  2IS3 A;  5J2N A;  4FW2 A;  1ZBI A;  2KTQ A;  1HJR A;  1L3T A;  4AHU A;  3OVN A;  1MU2 A;  2RN2 A;  2BAN A;  3DOK A;  3HP9 A;  3KLI A;  5CYQ A;  2P5G A;  4BE0 A;  1A5W A;  4JRQ A;  3DRR A;  3KLE A;  3O3G A;  1SL1 A;  2E4L A;  4PUO A;  2Y1J A;  3AVI A;  1S9G A;  5T7B A;  4N5S A;  1A5X A;  1LAV A;  3NH2 A;  4FLV A;  3OYI A;  3TAN A;  4J2D A;  2D5R A;  3AVB A;  3SNN A;  1VSI A;  3KIO A;  3MEE A;  4KTQ A;  1KCF A;  1QSL A;  2VG7 A;  1RDC A;  1WSI A;  4AH9 A;  1S1W A;  3CM5 A;  4KHS A;  4IFV A;  4CHN A;  4BWJ A;  1SKW A;  1HYS A;  4CJ5 A;  1LW2 A;  3WNF A;  4FJ9 A;  4CIF A;  1IKX A;  1EXQ A;  4Z4F A;  5KGW A;  2VG6 A;  2G8I A;  4RW4 A;  1RT3 A;  3D0P A;  1KTQ A;  3DLH A;  3DMJ A;  3ZCM A;  3M8P A;  1ZBH A;  1Q9Y A;  3NFA A;  2EX3 A;  2XRI A;  4EP4 A;  2JLE A;  1VSH A;  5KRT A;  3CQ8 A;  2Q3S A;  3NH1 A;  3I8D A;  3U6F A;  1SKS A;  1XI1 A;  4B9N A;  1BI4 B;  3OYM A;  4DTO A;  2IGI A;  1C1B A;  3V4I A;  3TAR A;  1QHT A;  3AA4 A;  3AVH A;  4HVJ A;  4RG8 A;  1SL2 A;  1NOZ A;  4CFA A;  1JLA A;  1S5J A;  1VK0 A;  4CF8 A;  1TK0 A;  1RT5 A;  3NF7 A;  4BDP A;  3QES A;  1D9F A;  1HYZ A;  1RBR A;  3ZSV A;  4CHQ A;  3SPY A;  4O0J A;  4OGE A;  4W5Q A;  3OYE A;  2X78 A;  3LP3 A;  3ZSO A;  4E7J A;  4Z0U A;  2FBY A;  4FLZ A;  3WNE A;  3RMC A;  3OYB A;  4NCB A;  2HHT A;  4M3U A;  3L3U A;  1VSF A;  4E3S A;  1QQC A;  2YNF A;  4R5P A;  2QKB A;  4L8R B; 
#chains in the Genus database with same CATH topology
 3H3O B;  2FBV A;  4CES A;  2QXL A;  5GAD P;  1NJW A;  3ATU A;  1F21 A;  1BQN A;  3C6A A;  4N41 A;  3BY5 A;  4FXD A;  4DFM A;  4FJL A;  2QM1 A;  4DS5 A;  2HHU A;  4F3T A;  1NKB A;  3THW A;  4M42 A;  3SMS A;  3QIC A;  3OS2 A;  1BI4 A;  4E1N A;  1FW6 A;  5FLX O;  4H5T A;  1DGK N;  4YDU C;  1CZ9 A;  3R1X A;  2V7Y A;  3CCQ N;  3M8Q A;  4CD1 A;  3MN7 A;  3U9Z A;  4YOW A;  1NGF A;  2Q0R A;  2ZGY A;  4BY9 C;  1CXQ A;  1HRH A;  4PL7 A;  3M1F A;  2O8F A;  4JAX A;  1ITG A;  1UA0 A;  3KK1 A;  3PO5 A;  4MDB A;  3RMA A;  3P38 A;  4IG0 A;  4YOT A;  3OYN A;  1BHL A;  1C1C A;  4DSE A;  4M63 C;  2P9I B;  3RRG A;  1TV6 A;  5AZJ B;  3AVF A;  4CEF A;  2B6A A;  4DR2 K;  1TGO A;  3L8B A;  2YX6 A;  4FLY A;  3B8A X;  3O3H A;  3OYD A;  3K5M A;  5AQM A;  2OTJ N;  4FOI A;  1G15 A;  3F2K A;  1S72 N;  2P9U A;  2Z1I A;  2HBJ A;  3HL8 A;  1GLL O;  2ZJQ L;  1U04 A;  3VN5 A;  4YOU A;  1L5U A;  3MEG A;  2CGK A;  3ENO A;  3CD6 N;  3AVK A;  1ESV A;  5AZI B;  5M1Q A;  3CM6 A;  1N33 K;  3MXM A;  3C94 A;  5J2M A;  4DSK A;  1YUW A;  2E88 A;  4B8A B;  4DTJ A;  3NGY A;  3DAW A;  4PKG A;  3LDP A;  4CE9 A;  3VEZ A;  1OKJ A;  4DB3 A;  4HUG A;  5HBM A;  4CZE A;  5JVH L;  5FRM A;  2NRH A;  2HBK A;  2D4W A;  3SQ0 A;  4WFN L;  4O8K A;  3RR8 A;  1S1V A;  1RTH A;  1YIT N;  1VQ4 N;  3PV8 A;  5GIO A;  3I0R A;  3WXK A;  4FWK A;  4YOR A;  5LJV A;  3T69 A;  1SS6 A;  2YHB A;  5HRN A;  3VPZ A;  2UXB K;  1B92 A;  4KFB A;  3SI6 A;  2QXF A;  4CGI A;  3ASM A;  4BGA A;  4J2E A;  3C6T A;  2G8W A;  1CZA N;  4U7B A;  1JCF A;  3CIP A;  2PYL A;  4CZJ A;  2HHS A;  4M3X A;  4CBU A;  2VG5 A;  3D6R A;  4M3Y A;  1JLC A;  5M1K A;  4OO1 J;  4K8X A;  4AHV A;  3G10 A;  4CK3 A;  4LY7 A;  2XY6 A;  4C8O A;  4NO7 A;  3AAQ A;  2QWQ A;  4HCC A;  5AQG A;  5CHI A;  3J7Z O;  1Q9X A;  4FJI A;  3ZT2 A;  1Q81 O;  2UUA K;  1GLE G;  3KLH A;  1U2V B;  5JLF A;  4CCH A;  3QNN A;  1NGC A;  1TAQ A;  2PZS A;  2HB5 A;  3LP2 A;  1TK0 A;  3PX0 A;  2KKZ A;  3C95 A;  1VSM A;  3DYA A;  3VQ4 A;  3VMF B;  2XO7 A;  2Q2R A;  2IVP A;  5KPR A;  1BDG A;  4BC3 A;  3AO1 A;  4KI4 A;  4JKE A;  4JNE A;  3CC7 N;  2DTU A;  4YY3 K;  3ZET A;  4J2B A;  2DFH A;  4CER A;  4YOX A;  4K25 A;  2LSN A;  2D0P A;  3OTO K;  4WQ5 C;  3BZC A;  1IO2 A;  1T03 A;  1LWE A;  3ZT4 A;  3M8R A;  4H5V A;  2IAJ A;  4ISE A;  2IOC A;  3DOL A;  3O9U A;  4JKB A;  2W6L A;  4BR7 A;  4I9Q A;  4IZ9 A;  3T1A A;  3C0B A;  3I56 N;  1DEJ A;  4FWO A;  2QW9 A;  3S9H A;  3KWI A;  3ZSR A;  3CER A;  4LF4 K;  3H1V X;  4DSI A;  2QKK A;  4NYF A;  2E2P A;  1NK0 A;  5DM7 L;  4JKG B;  5BRH A;  4LF5 K;  1U48 A;  4BAC A;  1C6V A;  2YNI A;  4FW1 A;  1B9D A;  1S22 A;  3I55 N;  2OA8 A;  4IWV A;  2XHB A;  2PY5 A;  3T3F A;  4IDH A;  3OA9 A;  2RHK A;  4JLH A;  1Y97 A;  4FJ8 A;  3AAR A;  2R7Y A;  5KQ8 A;  3VQQ A;  4B08 A;  1N5Y A;  4LFB K;  2BUP A;  4X64 K;  3O9S A;  2P9K A;  4ISG A;  3H3N O;  1VQ7 N;  3UKU B;  1LV5 A;  2HNZ A;  4H0Y B;  1QSY A;  4CW7 B;  4Z4H A;  1FK9 A;  2HW3 A;  4KB1 A;  4RWT A;  4C8M A;  4DQR A;  1KLN A;  4B3O A;  3PX4 A;  3LAN A;  1RGI A;  3D2F A;  4JI1 K;  3PUF A;  3HBT A;  1BGX T;  2BTF A;  3NH0 A;  2W41 A;  3OBW A;  3JYT A;  4DSJ A;  3U9D A;  4Q0B A;  4IXC A;  4GKJ K;  1TK8 A;  1NMN A;  3MX5 A;  4PY5 A;  4KHU A;  2OZS A;  2QTD A;  1N6Q A;  1Q18 A;  1NGE A;  3BP8 A;  3ZX2 A;  2BDP A;  1BIU A;  4PQU A;  4FL9 A;  3TAE A;  2FSN A;  1OH5 A;  5HRP A;  3D7E O;  1IH7 A;  4XH5 A;  3AV9 A;  5HRR A;  2E1Y A;  1NJI O;  4WFB L;  1Q8I A;  1O1W A;  4BR0 A;  2ETJ A;  1IKW A;  1RBV A;  2ZGZ A;  4B8C A;  3LWM A;  4CZH A;  2O8F B;  4EZ9 A;  3HST B;  2P9P A;  2F9T A;  3K9K A;  1NNE A;  3VQ9 A;  2OTL N;  3P5J A;  3A5O C;  1SZ2 A;  3O9R A;  4X62 K;  2CGL A;  1U4B A;  1JLB A;  1SL0 A;  4CEC A;  4DQ8 A;  1N36 K;  2YKN A;  1XMQ K;  3NCI A;  4ZHR A;  3V9X A;  1N32 K;  3SQ4 A;  1YT3 A;  1RBU A;  3THX B;  5JIC A;  4E7I A;  5HLF A;  5KGX A;  1XC3 A;  3SQ2 A;  3W3D A;  4F3O A;  3AA3 A;  4F9O A;  4W5R A;  3T1Y K;  3DXK B;  2HHW A;  4CEO A;  1WB9 A;  4KKO A;  4CHZ A;  5K14 A;  1VQ6 N;  4ILH A;  1WSE A;  2E8A A;  1VQN N;  2BH1 A;  2YV0 X;  4I9L A;  1N34 K;  4CK1 A;  3FZL A;  1BCO A;  3SV3 A;  4N47 A;  3OBY A;  2JWL A;  3PSF A;  4M3R A;  2PYJ A;  1CLQ A;  3K5O A;  3K5L A;  4CF1 A;  2VYP A;  1UWB A;  1CZB A;  1RNH A;  5FPE A;  3V9W A;  3VER A;  3IRX A;  4FPA A;  3CJ7 A;  3KLF A;  5BR8 K;  4W5N A;  2FBT A;  1NM1 A;  3IMX A;  4JV5 K;  1ZBI A;  5LMN K;  3CMA N;  3OVN A;  5AQL A;  2UXD K;  1MU2 A;  5CYQ A;  3DOK A;  3KLI A;  4LFC K;  3IDH A;  3A5N C;  5AQP A;  5LJW A;  3FZH A;  1SL1 A;  1JCG A;  1VQM N;  5T7B A;  4N5S A;  1A5X A;  3IUC A;  3ZYY X;  2Q31 A;  4UY8 O;  3AVB A;  4JKF A;  4LC9 B;  3SNN A;  1VSI A;  3MEE A;  2P9N A;  3J8A A;  5E26 A;  1WSI A;  4DV7 K;  3CM5 A;  4H03 B;  1HYS A;  1LW2 A;  1NGB A;  3TSU A;  4CIF A;  1EXQ A;  2G8I A;  3LDQ A;  4JK7 A;  5KQD A;  3TU5 A;  5TKW A;  3PIO L;  2XRI A;  2ASP A;  1VSH A;  3I8D A;  3U6F A;  3PIP L;  4DTO A;  2IGI A;  3E9O A;  1SL2 A;  1NOZ A;  4CFA A;  1YJ9 N;  4J8F A;  4JEP A;  3QES A;  1RBR A;  3ZSV A;  4CHQ A;  4A2B A;  4W5Q A;  3HM8 A;  2RE2 A;  2X78 A;  3LP3 A;  4I6M A;  2FBY A;  3OYB A;  4M3U A;  1VSF A;  1QQC A;  4BRC A;  2QKB A;  3NMU A;  4DU1 A;  4RW7 A;  1X3M A;  4H0P A;  4CED A;  3NDK A;  4DFP A;  2QWR A;  1I39 A;  1O13 A;  3IG1 A;  3VQ5 A;  2ZE2 A;  2VWB A;  4DV3 K;  5AQQ A;  4CHP A;  3TWH A;  2P9L A;  3V9Z A;  4AF1 A;  1BA0 A;  4KBO A;  4DTS A;  3SQ1 A;  3S3M A;  2XY8 A;  1Z05 A;  4O55 A;  4FZX C;  3PSI A;  1IKV A;  1WUA A;  3KK3 A;  2V52 B;  3J7A P;  1LAW A;  4LD0 A;  3KD1 E;  5JLH A;  2Q36 A;  4JHD A;  3CC2 N;  1LWC A;  4B9M A;  4GV6 A;  4B9T A;  2HNY A;  4QOZ B;  3ZT1 A;  2F4V K;  1TVR A;  4FK2 A;  4B9U A;  3NGZ A;  3ZT0 A;  4BRH A;  3PLA A;  3A8Y A;  5A2Q O;  1KAY A;  1BG3 A;  4HCB A;  3F73 A;  1Z6R A;  1VQO N;  2ZJP L;  1H1V A;  5C42 A;  2Y1I A;  2KZZ A;  1REV A;  3JXU A;  4HHT A;  3DLE A;  4ID5 A;  4BG8 A;  3ENB A;  3A0I X;  1RT1 A;  5CZ2 A;  2AJQ A;  3ID8 A;  3LM9 A;  3S3O A;  4NLC A;  3ZSZ A;  1S1X A;  4R79 A;  1Z26 A;  4FZZ A;  4B1U B;  4A61 A;  4CZI A;  1XNR K;  4CZF A;  2CGJ A;  4IBN A;  3SAF A;  2YCH A;  4M3Z A;  2O8E A;  1W2B M;  3ZSX A;  4JRP A;  3VQA A;  1UA1 A;  4H0X B;  3HRG A;  4H0T B;  2G8F A;  4BR2 A;  3PX6 A;  3KD5 E;  4CVN E;  3EKU A;  1TUU A;  1W7A A;  3AVL A;  4CFD A;  2X6S A;  3ZSY A;  1IG9 A;  5BPM A;  2E5L K;  3CI5 A;  4ZTF A;  4H0V B;  2QI2 A;  2GX9 A;  3LDN A;  1QZ6 A;  3SV4 A;  2WFB A;  2OPR A;  4YHH K;  1S1T A;  3MEC A;  4NLB A;  4KO0 A;  1EKE A;  4CZM A;  2Z1J A;  5KTQ A;  3ISN C;  2I5J A;  3GOI A;  1ZXO A;  3P83 D;  5JS2 A;  4BE1 A;  1RBS A;  3BDP A;  1ZBS A;  1QSS A;  5FDL A;  1CXU A;  3S3N A;  3C7N A;  4Z4C A;  1HJO A;  4CGF A;  5C12 A;  4ELU A;  3GDQ A;  3MXI A;  3DLL L;  1NMD A;  3TAF A;  3IFR A;  4OKK A;  2KW4 A;  3O9T A;  1BCM A;  5ADX H;  1NGA A;  3HYF A;  4Z4E A;  1RCH A;  2F8T A;  1YJN N;  3QB0 A;  3WUH A;  4B1Z A;  4Q5V A;  4JI5 K;  3EE8 A;  2GV9 A;  4CJ4 A;  3L4I A;  1N8R O;  5BRD A;  2GWJ A;  1DT9 A;  1NGD A;  3VF6 A;  3KK2 A;  4OKJ A;  4CI6 A;  5CR4 A;  4O0I A;  4NCB A;  3HZ6 A;  3C6H A;  1IBL K;  4W5T A;  2ITG A;  1BUP A;  2YI1 A;  4DUZ K;  1RDB A;  1KVC A;  4C23 A;  1HKG A;  1KVA A;  3VGK A;  1IG8 A;  2V51 B;  2ATQ A;  4LSN A;  5AQJ A;  2NRW A;  4E19 A;  3EY1 A;  3MMV A;  3ZT3 A;  4KHP K;  4C8K A;  3EKS A;  4BR5 A;  4JS4 A;  4BRO A;  4FWQ A;  3VEV A;  3O5B A;  3ITH A;  4DQQ A;  4FJN A;  4OJR A;  3DLG A;  3QML A;  3QNO A;  4BRM A;  3EZ5 A;  5AQW A;  1LCU A;  4YNQ A;  5ADX A;  4RW6 A;  3GE1 A;  5BPN A;  1HQE A;  3CCV N;  4FJK A;  3TPQ A;  3THY A;  3HT3 A;  4ISF A;  2D0C A;  2PFU A;  3LAK A;  1YVU A;  3DLB A;  3VQ7 A;  1C0G A;  1GLB G;  3VEX A;  4AHC A;  4FJJ A;  2VQF K;  4HUE A;  3VQ8 A;  4QAG A;  4FYD A;  2GEM A;  3O6W A;  5GIN A;  1KRP A;  3LP0 A;  3ZSW A;  4KH6 A;  2P9N B;  5AQR A;  3CXC M;  4CFB A;  1R0A A;  1HNW K;  4GMJ B;  4CJE A;  3LM2 A;  3VGL A;  3ZEU A;  2NRV A;  2QWN A;  4CJU A;  3P39 A;  2RPI A;  2QEX N;  1C0U A;  4DTX A;  2E2N A;  3B6P A;  3RRH A;  1ASV A;  2DPN A;  4DV2 K;  4FJG A;  3KWG A;  3JAM O;  4B9S A;  1KXP A;  4DSF A;  2A5X A;  5E84 A;  1RT7 A;  1RT6 A;  3VEW A;  3H46 O;  4I6M B;  1X9J A;  4FLW A;  2CH5 A;  4KH5 A;  1UAX A;  1ASW A;  3O4Q A;  4BVP A;  3HM9 A;  2WTU A;  3GG4 A;  4RW9 A;  3OY9 A;  3BF3 A;  1WBD A;  1K9M O;  1NJZ A;  4KRF A;  3RVC A;  4C1N I;  3FZF A;  4IKF A;  2YNH A;  3A5L C;  3NAE A;  2OZM A;  1W0H A;  4L3Q A;  1LOT B;  3QEV A;  3O3F A;  4BC5 A;  4DTR A;  3SJH A;  1NK4 A;  3JSM A;  3LAL A;  1SV5 A;  1JJ2 M;  5AQY A;  1QVF M;  4IFE A;  3UKR A;  4DV0 K;  2HMP A;  4JI8 K;  4HWI A;  4DV4 K;  3E9P A;  3D45 A;  5AJ3 K;  4BDY A;  1L3U A;  1QQO A;  2KHO A;  1BIZ A;  1U6Z A;  3A2F A;  5AQI A;  5JS1 A;  1S1U A;  1HPM A;  3OS0 A;  1K73 O;  1TKT A;  4GKK K;  1FJG K;  2O8D B;  1HNI A;  5E41 A;  2G8H A;  4JK8 A;  3U3Y A;  1E4G T;  4KB0 A;  1L3S A;  3E01 A;  1KQS M;  3C65 A;  4XEI A;  1HX1 A;  3HPO A;  1NWK A;  1K6Y A;  4B1W B;  1ATR A;  4KH4 A;  1NU0 A;  3CFO A;  3KJV A;  4YOV A;  4IJA A;  4KHW A;  3QIO A;  5C25 A;  3QEW A;  4CJR A;  4ICL A;  5M1O A;  4LF8 K;  4B3R K;  1VSL A;  1SUQ A;  3QEI A;  3M6G A;  1C0F A;  4E89 A;  1XUP O;  3QFU A;  1EWR A;  2P9S A;  5M1P A;  4BC4 A;  3CQX A;  2HVH A;  2A41 A;  4OLB A;  3VET A;  5DK5 A;  2IVN A;  4DF4 A;  4KHQ A;  3HPH A;  4ZTJ A;  3SBG A;  1WSJ A;  2FLO A;  2GTD A;  1T8E A;  2A1R A;  3KZB A;  3SK3 A;  4FM2 A;  1GOB A;  4ILG B;  4CJW A;  4CIG A;  5LY3 A;  1W97 L;  3C6U A;  4FOE A;  3SCX A;  1TK5 A;  3IKM A;  4IJN A;  2HVI A;  3M5R A;  5GAE P;  4F8R A;  4BG9 A;  4QCL A;  4CZK A;  2FSK A;  4LH4 A;  1GOA A;  3AA2 A;  4KPY A;  2F7T A;  1JL2 A;  4DSL A;  5IT9 O;  4B3T K;  2JWK A;  1J5E K;  2HHV A;  3CFR A;  4AM6 A;  3KTQ A;  4JI2 K;  2D0B A;  4IDK A;  3SUO A;  4FLT A;  4A57 A;  2IS3 A;  5J2N A;  5C15 A;  3VEO A;  4AHU A;  4WCE L;  4DR7 K;  4BE0 A;  1A5W A;  4JRQ A;  3DRR A;  2Y1J A;  2YJF A;  3O4W A;  1S9G A;  2VGM A;  3OYI A;  4J2D A;  1P90 A;  1X3N A;  4A2A A;  1QSL A;  1S1W A;  4KHS A;  4DV6 K;  1BO5 O;  4RCH A;  4RW4 A;  3LL3 A;  3HI0 A;  3DLH A;  3DMJ A;  3ZCM A;  3M8P A;  3NFA A;  4GY2 B;  3H6E A;  2EX3 A;  5FPM A;  5GAH P;  3CQ8 A;  3THW B;  4B9Q A;  3W0L A;  1BI4 B;  3OYM A;  3TAR A;  1ATN A;  4RTF D;  4A5A A;  4BDP A;  3H45 C;  3NF7 A;  2QWO A;  3FFK B;  3ULE A;  1HYZ A;  3SPY A;  4OGE A;  4E7J A;  3ZSO A;  4FLZ A;  2O8C A;  3RMC A;  3L3U A;  4E3S A;  3FR0 A;  4MO5 A;  3WEE A;  1YTU A;  4KI6 A;  4CJ3 A;  3KKS A;  2NRT A;  1GLF O;  4DCH A;  4B3M K;  4DMN A;  5CY4 A;  3WQT A;  1VQK N;  2QK9 A;  4CZG A;  3NF6 A;  3O80 A;  4CEZ A;  2VQE K;  4M3W A;  4GNI A;  2GUI A;  2ASM A;  4OPH A;  1UOC A;  3CJ1 A;  1TUY A;  4MQ3 A;  5C0Y A;  2P9U B;  4ILJ A;  3OYK A;  4KTW A;  5HL7 L;  2DFF A;  3WNG A;  2VWK A;  3VQD A;  5AQV A;  5I9E B;  4DLE A;  1TKD A;  5GIP A;  1ATS A;  1XHZ A;  5J1E A;  2W40 A;  2X74 A;  4DR3 K;  3O8M A;  3CFP A;  1VSK A;  4BRF A;  5MLC Q;  5FPN A;  4AQY K;  3K5N A;  2GUP A;  4FWR A;  2NZT A;  4IG3 A;  2B4J A;  3CC4 N;  3RMB A;  1QQN A;  1YIJ N;  5SWM A;  4JI4 K;  3Q7C A;  4Y1C A;  3LP1 A;  4UQG A;  4I7F A;  2VWJ A;  4DV1 K;  1MWK A;  4IEE A;  1SKR A;  4NCA A;  2BE2 A;  1NKC A;  1J53 A;  3CJ9 A;  1NG9 A;  1I3A A;  1SQK A;  1U47 A;  3DI6 A;  5IWA K;  2OAN A;  3CF5 L;  5DM6 L;  3AY9 A;  5FRO A;  1HMV A;  1S6P A;  4CBW A;  4CEB A;  3L2V A;  2P9I A;  5AZJ A;  4EIA A;  3LDL A;  1YTA A;  3N4Q A;  5KI6 A;  1ZC6 A;  1J6Z A;  5BRF A;  1X9M A;  1HNZ K;  4DQP A;  4FWM A;  4M3T A;  2WOM A;  2HHQ A;  3CPE A;  1R59 O;  4IEI A;  3PO4 A;  4JD2 A;  4DR6 K;  3TAQ A;  4I2Q A;  4PA1 A;  3EO3 A;  4TSX A;  3I33 A;  3LZI A;  4GV3 A;  3VOV A;  5I42 A;  4FJH A;  3OJU A;  5AZI A;  3FZM A;  3H08 A;  4WFA L;  4BRG A;  3AO2 A;  3F9K A;  4CD3 A;  2UU9 K;  3LZJ A;  1BU6 O;  4CEE A;  2B5J A;  2HBL A;  1GOC A;  3HOT A;  5BN8 A;  1RT4 A;  4E0D A;  3OS1 A;  1K8K A;  3NGI A;  2Q0U A;  4AHS A;  3SUP A;  4ELT A;  4N76 A;  4OPA A;  3L2R A;  4MFB A;  4DLG A;  4WE1 A;  3ZET B;  5H1S Q;  4KAZ A;  2KLA A;  4CJF A;  2FXU A;  3U3G A;  3L0Q A;  3NF8 A;  3RTV A;  3AO5 A;  3DLR A;  3T1H K;  1Q82 O;  2YNG A;  2Q1N A;  4FVU A;  3HVR A;  1W9H A;  5EX5 A;  3OYL A;  3ZX3 A;  1J9A A;  4H8K A;  2P9S B;  4DR4 K;  4B1V A;  3EN9 A;  1NOY A;  3DM2 A;  1X9W A;  1YAG A;  3SAH A;  3AVC A;  3LPU A;  4HUF A;  1LW0 A;  5JVG L;  4DFK A;  1QZ5 A;  4B9L A;  3TR8 A;  1T3V A;  1IKY A;  4EP5 A;  2A40 A;  3VQ6 A;  1QTM A;  3DLK A;  4CHO A;  4AIL C;  4FK0 A;  1OH6 A;  2E6L A;  4BRP A;  4CJP A;  4KHY A;  1X9S A;  1RDW X;  2PAV A;  1V4T A;  2FSJ A;  4B9V A;  4FK4 A;  4DR5 K;  1BQM A;  4NXM K;  2O8B A;  3MN6 A;  1NBW A;  2F8S A;  2F9W A;  4BRD A;  1OVQ A;  4CF0 A;  1NGJ A;  3OJS A;  4JI3 K;  1HQU A;  3QLH A;  1HUX A;  2ZM6 K;  1M90 O;  4QS8 A;  2FBX A;  1YXQ A;  1OH8 A;  2P9K B;  3WT0 A;  4C1N K;  5CE3 A;  1VQL N;  3MAQ A;  4DS4 A;  5AFU H;  3J7Y P;  3MWT A;  4F2R A;  5SZT A;  5AR0 A;  2JGU A;  4E7K A;  4OLA A;  4CFC A;  5C10 A;  4WF9 L;  2A3Z A;  1QE1 A;  3TI0 A;  4JKA A;  4LH5 A;  4BE2 A;  1RTJ A;  5J2Q A;  3D2F B;  2ZD1 A;  1E4F T;  3FE1 A;  3HVT A;  4DU3 A;  3V9S A;  3TSP A;  3HK2 A;  4CJS A;  5BR9 A;  4GV9 A;  1HNV A;  1XQS C;  1BL3 A;  4J2A A;  2KQ2 A;  2OYQ A;  5EU7 A;  1FKO A;  4U67 L;  1NJX A;  2ZF5 O;  3A5M C;  1WAF A;  3ZLJ A;  4MDA A;  4O44 A;  1D9D A;  1GLA G;  3AO3 A;  4FM1 A;  1EQY A;  2VGN A;  5EOY A;  3F9M A;  4CHY A;  3VEY A;  4XIU A;  4O8U A;  1ZYQ A;  1XWL A;  4CF9 A;  3CHW A;  1NKE A;  1LWF A;  1V4S A;  5C2F A;  4K41 A;  2RF2 A;  3CCR N;  3L6Q A;  1EP4 A;  4JKG A;  2F96 A;  3MN9 A;  4M45 A;  4ELV A;  3AVM A;  4CK2 A;  3UE5 A;  2P9P B;  3BZK A;  3QIN A;  3B6O A;  4C8N A;  4IOC L;  2ASO A;  3NVK A;  3P1G A;  4PL8 A;  3VQC A;  3NE6 A;  4BR9 A;  4H4O A;  2D0A A;  3D2E A;  3TSQ A;  1T44 A;  5AFU A;  4CZL A;  2Z1G A;  4OPK A;  4W5O A;  3CET A;  3E66 A;  3R3L A;  3QFP A;  3RWU A;  3QIP A;  3CCU N;  1DTT A;  4HTL A;  3MDQ A;  3MN5 A;  3U4L A;  3UKU A;  3J81 O;  4EHT A;  3E1Y A;  1M1K O;  2YJE A;  1C1A A;  4K8Z A;  3NBP A;  4CJV A;  1MDU B;  3BEX A;  1HNX K;  1Q7Y O;  1HPZ A;  2I7P A;  1IV0 A;  5AQU A;  4BQL A;  2FF6 A;  1ZBF A;  3LPT A;  1QHA A;  3LWL A;  3QET A;  2HHX A;  2EWS A;  5TKY A;  1U49 A;  3QO9 A;  3L2U A;  3OYJ A;  3OYG A;  2NRZ A;  1E3M A;  3K57 A;  4LF7 K;  4K43 A;  2OPQ A;  3THV A;  4GVE A;  1RTI A;  4LF9 K;  1DKG D;  1VQ8 N;  5BPL A;  4LSL A;  5FRN A;  4CF2 A;  3K9J A;  4Y1D A;  3O08 A;  5AQT A;  3HTV A;  4Z4I A;  2FC0 A;  4BQZ A;  3K58 A;  3ZSQ A;  5J2P A;  3M3Z A;  5EY4 A;  3NF9 A;  4FSV A;  2HF4 A;  1S9E A;  1JCE A;  4CBX A;  3VQB A;  3SUN A;  4WQ4 A;  4DU4 A;  5HRO A;  4KTZ A;  3V6D A;  4CJL A;  1JKH A;  3EYZ A;  2Z1H A;  1YJW N;  2I7N A;  4AHR A;  3CCM N;  1WNS A;  4YOY A;  1GLJ O;  2H3G X;  3THX A;  1WN7 A;  3E9L A;  4JD2 B;  3K0S A;  4BWM A;  2XY7 A;  3AAP A;  3AVJ A;  4FWL A;  4G9Z A;  4CGH A;  1A5V A;  3FGU A;  3VQP A;  4OX9 K;  4DF8 A;  3DXK A;  4DTN A;  3JS6 A;  2UUC K;  4FW2 A;  1QVG M;  1HJR A;  2KTQ A;  1L3T A;  3DXM A;  2BAN A;  2RN2 A;  1GLD G;  2P5G A;  4JN4 A;  3OW2 M;  5BRE A;  4X65 K;  2E4L A;  1TYQ A;  4PUO A;  1K8K B;  5BN9 A;  3NH2 A;  1LAV A;  3TAN A;  3KK7 A;  1WBB A;  4KTQ A;  2AA4 A;  1KCF A;  4IFV A;  3OHR A;  2QA4 N;  1SKW A;  4CJ5 A;  1IKX A;  5KGW A;  2VG6 A;  3J80 O;  1KTQ A;  4FPB A;  2AP1 A;  2P9L B;  2GEL A;  2IVO A;  3R9P A;  2CH6 A;  4JKC A;  1Q9Y A;  1ZBH A;  4JKD A;  1KAX A;  3EL2 A;  3P31 A;  5M1N A;  2Q3S A;  2WBN A;  3NH1 A;  3HSC A;  1XI1 A;  4B9N A;  3WXL A;  1C1B A;  3V4I A;  1QHT A;  3AA4 A;  3G25 A;  5M1F A;  3MK6 A;  4JHD B;  1RT5 A;  1D9F A;  4O0J A;  4Z0U A;  3WNE A;  4R5P A;  3EZW A;  1OVY A;  4L8R B;  1ILY A;  3RSE A;  5HOO A;  2W42 A;  4Z94 A;  3V9U A;  3AA5 X;  2UYT A;  4FWP A;  1HKC A;  1WSH A;  3CYM A;  4DKW A;  1NK9 A;  1JLQ A;  2O8B B;  4E1M A;  3MCA B;  4FJ7 A;  2E2Q A;  4E1J A;  4BR4 A;  1YF5 L;  1IBM K;  5KPT A;  1GLC G;  1WSF A;  2XY5 A;  3F5T A;  1KFD A;  3L2Q A;  3LAM A;  4H4M A;  4OPJ A;  5AQH A;  3BUZ B;  1YI2 N;  3FFI A;  3CPW M;  3MED A;  3ULD A;  1TL3 A;  4A62 A;  1HYV A;  3AVA A;  2NRX A;  4H5R A;  2O8E B;  4IFY A;  4GW6 A;  3WNH A;  4E7H A;  4G1Q A;  3RR7 A;  3CQY A;  3TAB A;  1HR0 K;  2NLX A;  1JL1 A;  5HP1 A;  1D8Y A;  1C0T A;  3IAY A;  3GBT A;  3CJA A;  3G4S N;  2BGG A;  2YHY A;  4CEA A;  3O4N A;  2D1K A;  1EET A;  4JS5 A;  1D5A A;  1T05 A;  4PKH A;  4O5B A;  5LMU K;  4F4K A;  4EZ6 A;  3R6M A;  1VQ5 N;  2RKI A;  3C7N B;  4BRA A;  3O1B A;  1S3X A;  2P51 A;  1HLU A;  3TAM A;  4DFJ A;  3V1R A;  2HND A;  4BC2 A;  4FWS A;  3BGR A;  1Z25 A;  3HP6 A;  1JLG A;  4JI6 K;  1HKB A;  4N56 A;  1OH7 A;  2J4R A;  3ALY A;  1FXX A;  3D2E B;  3L3V A;  4ID1 A;  5GAG P;  1NLV A;  1WLJ A;  1JLF A;  3HJF A;  3V1O A;  2HHH K;  5JMV A;  4XH1 A;  4LFA K;  4FVM A;  1D4X A;  1RIL A;  2V7Z A;  5AQS A;  1NK5 A;  1EWQ A;  3VF2 A;  3SYZ A;  1ZBU A;  1IJJ A;  4QS9 A;  3CCJ N;  3QER A;  1QS4 A;  3H1Q A;  3AGK A;  3HPG A;  2KFN A;  2E1Z A;  4OVL A;  3V1Q A;  1KFS A;  1VAZ A;  2OPP A;  1TKZ A;  4BGB A;  4HTU A;  2HOE A;  3AVN A;  5EXW A;  1DLO A;  1VQP N;  4DTU A;  1MWM A;  4PWD A;  5CYM A;  1VSJ A;  3U8X A;  3MCP A;  3AO4 A;  4IOA L;  1ASU A;  2A1S A;  1B9F A;  2O4G A;  1DTQ A;  3IS9 A;  3HXM A;  3HOS A;  3WXJ A;  4AM7 A;  3V81 A;  4CGJ A;  4MLE A;  4DTM A;  4CJT A;  1J5O A;  2D0O A;  4IO9 L;  3ID6 A;  5AQF A;  2E6M A;  1MA9 B;  5EVZ A;  4CGD A;  3O1W A;  4B1Y B;  4OKE A;  3BF1 A;  3RMD A;  3QEX A;  3THY B;  3KKR A;  4KV8 A;  4YFU A;  4CEQ A;  3OYC A;  4MLH A;  2YKM A;  3QBW A;  3NHG A;  2HST A;  5DMR A;  2UXC K;  4O4G A;  1VSD A;  2G8U A;  1KLM A;  1T7P A;  1P8Z A;  3N4P A;  4FO0 A;  5AQX A;  4KHN A;  1C0M A;  4M7X A;  4FCY A;  4DQS A;  3SBT A;  1K8A O;  4F2S A;  4YDU A;  1JXB A;  3ZEU B;  5B8H A;  1RDD A;  4WQ4 C;  4FZY A;  1WSG A;  3VGM A;  1KAZ A;  3T7Z A;  2EHG A;  2FF3 B;  3VA3 A;  4DV5 K;  1Y64 A;  3DRS A;  4NYN A;  1L3V A;  3KHY A;  3DXM B;  4XH4 A;  3PY8 A;  4KRE A;  3QEP A;  2W6K A;  1X1P A;  4BRN A;  4O5F A;  2VCP A;  1JLE A;  2IIR A;  1VHX A;  1T6C A;  1TYQ B;  2A6A A;  1XNQ K;  4OGC A;  2G8V A;  4B3S K;  2DY4 A;  4WYB A;  5ELZ A;  1RT2 A;  3WXM B;  4FJ5 A;  1S6Q A;  3CG7 A;  3VQE A;  4M41 A;  5C2D A;  4NB4 A;  1TKX A;  3MXJ A;  2HMI A;  3K2P A;  3TTD A;  4DG1 A;  1RDU A;  1KVB A;  1NK7 A;  5D3G A;  2NRR A;  1SAZ A;  3OYF A;  1XHX A;  5KPZ A;  4FLX A;  5LL6 Z;  3ATV A;  2QWM A;  3VES A;  2KFZ A;  3UKR B;  4CIE A;  3MWP A;  1KD1 O;  2KZM A;  3EE9 A;  1RBT A;  2ITM A;  1EO1 A;  1I94 K;  4FJM A;  3VEN A;  2E2O A;  4MO4 A;  3TTF A;  3S41 A;  4JI7 K;  2P5O A;  2IC3 A;  4JKH A;  1KSP A;  1JXE A;  4NCG A;  3G71 N;  3CCS N;  1VQ9 N;  3RSE B;  4EAH D;  1NK8 A;  3QBX A;  4Y0W A;  1RDA A;  4DTP A;  1TAU A;  3KLG A;  4V19 S;  3SJJ A;  4GVM A;  3SPZ A;  2G8K A;  3WXI A;  3SAG A;  3CCE N;  1VRT A;  5F0X A;  2WON A;  3M8S A;  4LF6 K;  1EX4 A;  5F1X A;  1QQM A;  4BRQ A;  2OPS A;  1BIS A;  3CJC A;  3K59 A;  4CJ7 A;  3CME N;  4CGG A;  1WAJ A;  1VSE A;  3R8E A;  5F2R A;  4K0K K;  4IOX A;  3O9Q A;  3EEQ A;  3NVM A;  4JI0 K;  4DUY K;  4PKI A;  3L4Q A;  2DFE A;  2OCE A;  5AQO A;  4DR1 K;  1RTD A;  2PBD A;  2GBZ A;  4RW8 A;  2HF3 A;  1BWF O;  3AVG A;  2NNW A;  3I0S A;  2ZQB A;  4FLU A;  1NGI A;  1XMO K;  3LDS A;  4FWN A;  1YHQ N;  4BDZ A;  2IDO A;  3HO1 A;  3TAG A;  5CZ1 A;  3TAP A;  4B1X B;  2X6N A;  1NJY A;  3L2W A;  2Q97 A;  4DHY A;  4NXN K;  1VRU A;  4C8L A;  1U45 A;  1U2V A;  4BRL A;  2P1J A;  4E7L A;  3OYA A;  1NGH A;  1T6D A;  1RFQ A;  4AHT A;  1BA1 A;  1WOQ A;  4DQI A;  5HRS A;  3T19 A;  1Q86 O;  1TL1 A;  3KVG A;  3DRP A;  3SUQ A;  4DWI A;  4I2P A;  4H5W A;  2QWL A;  2WUS A;  1XC9 A;  1NK6 A;  5AQN A;  2O8D A;  5C24 A;  3VA0 A;  5I3U A;  2NUB A;  4Z4G A;  3VTH A;  4WQ5 A;  4FM0 A;  2GWK A;  3SMP A;  4BRE A;  4JYA K;  3OYH A;  4CJQ A;  4H5N A;  4EHU A;  4FJX A;  1ZBL A;  4A59 A;  1J54 A;  3CJB A;  3G0Z A;  4EFH A;  4A5B A;  3GL1 A;  2UUB K;  4CJK A;  3SZ2 A;  2O4I A;  5AQK A;  4PHT X;  3G6E N;  3LDO A;  3ZX0 A;  1KC8 O;  1G99 A;  5KRS A;  4M7Y A;  2YHA A;  1BOT O;  2YHX A;  1FKP A;  3UIQ A;  3P4I A;  4JK9 A;  2E20 A;  4H0O A;  3HP9 A;  3UB5 A;  3ULE B;  5FPD A;  2WC9 A;  3KLE A;  2A42 A;  3O3G A;  4IO8 A;  1IBK K;  3MX2 A;  3CCL N;  3AVI A;  2O8C B;  4FLV A;  3WQU A;  2D5R A;  3WEE B;  3DWL A;  5AQZ A;  3KIO A;  2VG7 A;  1RDC A;  4K42 A;  2YHW A;  4AH9 A;  4BRI A;  4CHN A;  4BWJ A;  3VF4 A;  1YVN A;  4BRK A;  3I8B A;  4FJ9 A;  3WNF A;  3TTC A;  4Z4F A;  3FZK A;  2ZWH A;  3FLC O;  1RT3 A;  3DJC A;  3D0P A;  2HBM A;  3QDK A;  3ENH A;  4EP4 A;  2JLE A;  5KRT A;  1SKS A;  4X66 K;  2ZJR L;  2QWP A;  1NGG A;  3AVH A;  4HVJ A;  4RG8 A;  3VTI A;  1JLA A;  1S5J A;  1VK0 A;  4CF8 A;  3Q7B A;  3OYE A;  2HHT A;  3AGR A;  2YNF A;  4QS7 A;  4BVO A;  3SLC A; 
#chains in the Genus database with same CATH homology
 2W42 A;  2FBV A;  1YTU A;  4CES A;  4KI6 A;  4CJ3 A;  3KKS A;  3V9U A;  4RW7 A;  4DU1 A;  1NJW A;  3AA5 X;  4CED A;  4DMN A;  1F21 A;  5CY4 A;  1WSH A;  1BQN A;  3NDK A;  4N41 A;  3CYM A;  4DFP A;  1NK9 A;  1I39 A;  4FXD A;  1JLQ A;  3IG1 A;  3VQ5 A;  4DFM A;  2ZE2 A;  4FJL A;  2QK9 A;  4CHP A;  4E1M A;  3TWH A;  3NF6 A;  3V9Z A;  4CEZ A;  4DS5 A;  4DTS A;  3SQ1 A;  3S3M A;  2XY8 A;  4FJ7 A;  4O55 A;  4FZX C;  4M3W A;  4F3T A;  1IKV A;  2GUI A;  1NKB A;  3KK3 A;  4M42 A;  1LAW A;  4LD0 A;  1UOC A;  3OS2 A;  1BI4 A;  1WSF A;  4MQ3 A;  4E1N A;  2XY5 A;  1KFD A;  3L2Q A;  3LAM A;  4H4M A;  3OYK A;  4OPJ A;  3KD1 E;  3FFI A;  1LWC A;  4KTW A;  1CZ9 A;  4B9M A;  3M8Q A;  2DFF A;  3MED A;  3ULD A;  1TL3 A;  4B9T A;  2HNY A;  4QOZ B;  1HYV A;  3AVA A;  1CXQ A;  1HRH A;  3WNG A;  3ZT1 A;  1TVR A;  2VWK A;  3VQD A;  4IFY A;  4GW6 A;  1ITG A;  3WNH A;  4B9U A;  1UA0 A;  4E7H A;  4FK2 A;  3KK1 A;  4G1Q A;  3NGZ A;  3PO5 A;  3ZT0 A;  3RMA A;  4IG0 A;  4DLE A;  1TKD A;  3OYN A;  3RR7 A;  3TAB A;  4HCB A;  1BHL A;  1C1C A;  3F73 A;  4DSE A;  1XHZ A;  5J1E A;  3RRG A;  1TV6 A;  2X74 A;  3AVF A;  5C42 A;  4CEF A;  2Y1I A;  2B6A A;  1JL1 A;  5HP1 A;  1D8Y A;  3CFP A;  1TGO A;  1REV A;  3L8B A;  1C0T A;  2KZZ A;  1VSK A;  4HHT A;  3IAY A;  3DLE A;  4ID5 A;  3K5N A;  4FLY A;  4IG3 A;  2B4J A;  3O3H A;  3OYD A;  3RMB A;  1RT1 A;  3K5M A;  5CZ2 A;  2AJQ A;  5SWM A;  3S3O A;  2BGG A;  4Y1C A;  1G15 A;  3LP1 A;  3ZSZ A;  4CEA A;  1S1X A;  3O4N A;  2Z1I A;  4UQG A;  4I7F A;  2VWJ A;  1EET A;  1Z26 A;  3HL8 A;  1SKR A;  2HHU A;  4JS5 A;  4FZZ A;  1D5A A;  1T05 A;  4NCA A;  1U04 A;  3VN5 A;  2BE2 A;  1NKC A;  4O5B A;  1L5U A;  3MEG A;  4F4K A;  1J53 A;  4EZ6 A;  3AVK A;  4IBN A;  4M3Z A;  3ZSX A;  4JRP A;  3CM6 A;  2RKI A;  1I3A A;  3MXM A;  3VQA A;  3C94 A;  1UA1 A;  1U47 A;  3DI6 A;  5J2M A;  4DSK A;  3TAM A;  2P51 A;  2G8F A;  4DFJ A;  4B8A B;  3V1R A;  4DTJ A;  2HND A;  3NGY A;  3PX6 A;  3KD5 E;  3BGR A;  5FRO A;  1HMV A;  1S6P A;  4CEB A;  1Z25 A;  4CE9 A;  3HP6 A;  3L2V A;  3AVL A;  1JLG A;  4CFD A;  2X6S A;  3ZSY A;  4HUG A;  1IG9 A;  4N56 A;  1YTA A;  5HBM A;  5KI6 A;  5FRM A;  4ZTF A;  3ALY A;  1FXX A;  1X9M A;  4DQP A;  3L3V A;  3SQ0 A;  4M3T A;  2WOM A;  4ID1 A;  2HHQ A;  1WLJ A;  3SV4 A;  1JLF A;  3HJF A;  3PO4 A;  1S1V A;  2OPR A;  3V1O A;  3RR8 A;  1RTH A;  1S1T A;  3MEC A;  3PV8 A;  3I0R A;  4KO0 A;  3TAQ A;  4FVM A;  1EKE A;  1RIL A;  4I2Q A;  4PA1 A;  1NK5 A;  2Z1J A;  5KTQ A;  3ISN C;  2I5J A;  2YHB A;  1ZBU A;  4TSX A;  5HRN A;  3LZI A;  3SYZ A;  3P83 D;  1B92 A;  5JS2 A;  3QER A;  1QS4 A;  4KFB A;  4BE1 A;  1RBS A;  3SI6 A;  5I42 A;  1QSS A;  3BDP A;  4FJH A;  2QXF A;  5FDL A;  3OJU A;  1CXU A;  4CGI A;  3ASM A;  3HPG A;  2KFN A;  3S3N A;  4J2E A;  3C6T A;  4Z4C A;  4OVL A;  2G8W A;  3H08 A;  4CGF A;  3V1Q A;  3AO2 A;  1KFS A;  3F9K A;  4ELU A;  3LZJ A;  2OPP A;  3MXI A;  1TKZ A;  2PYL A;  4CEE A;  2B5J A;  4HTU A;  1GOC A;  3TAF A;  4OKK A;  3AVN A;  2KW4 A;  1RT4 A;  1DLO A;  2HHS A;  4E0D A;  1BCM A;  3OS1 A;  4DTU A;  3NGI A;  4AHS A;  3SUP A;  4ELT A;  4N76 A;  2VG5 A;  4M3X A;  5CYM A;  4PWD A;  4M3Y A;  3L2R A;  1VSJ A;  3HYF A;  1JLC A;  1RCH A;  4Z4E A;  3AO4 A;  4MFB A;  4DLG A;  2F8T A;  4WE1 A;  4K8X A;  4KAZ A;  4AHV A;  1ASU A;  3G10 A;  2A1S A;  4LY7 A;  4CK3 A;  1B9F A;  2O4G A;  1DTQ A;  3IS9 A;  4CJF A;  4Q5V A;  3HXM A;  4HCC A;  3U3G A;  1Q9X A;  3RTV A;  3NF8 A;  3ZT2 A;  3AO5 A;  4FJI A;  3DLR A;  3V81 A;  2YNG A;  4CGJ A;  3KLH A;  2GV9 A;  4CJ4 A;  3HVR A;  1W9H A;  4DTM A;  4CJT A;  1J5O A;  3OYL A;  3QNN A;  4CCH A;  1J9A A;  4H8K A;  3KK2 A;  4OKJ A;  2E6M A;  4CGD A;  1TAQ A;  2PZS A;  4OKE A;  1NOY A;  4O0I A;  3RMD A;  2HB5 A;  3DM2 A;  3LP2 A;  3QEX A;  3KKR A;  4KV8 A;  4YFU A;  4CEQ A;  2ITG A;  4W5T A;  3OYC A;  3C95 A;  3PX0 A;  1RDB A;  1VSM A;  3DYA A;  1X9W A;  2YKM A;  3AVC A;  1KVC A;  3VQ4 A;  2XO7 A;  3NHG A;  3LPU A;  1KVA A;  4HUF A;  1LW0 A;  4LSN A;  2ATQ A;  4DFK A;  4B9L A;  5DMR A;  3AO1 A;  4O4G A;  3TR8 A;  4KI4 A;  4E19 A;  1IKY A;  4EP5 A;  1VSD A;  3VQ6 A;  3EY1 A;  1QTM A;  2G8U A;  1KLM A;  1T7P A;  3ZT3 A;  2DTU A;  3DLK A;  4CHO A;  4J2B A;  4C8K A;  2DFH A;  4JS4 A;  4CER A;  4AIL C;  4KHN A;  1C0M A;  4FK0 A;  4FCY A;  4DQS A;  2E6L A;  4CJP A;  4F2S A;  1JXB A;  4KHY A;  2LSN A;  3ITH A;  4DQQ A;  1X9S A;  4FJN A;  4OJR A;  3DLG A;  1RDD A;  4FZY A;  3QNO A;  4B9V A;  3EZ5 A;  4FK4 A;  1BQM A;  1WSG A;  2EHG A;  2F8S A;  4YNQ A;  3VA3 A;  1IO2 A;  3DRS A;  4NYN A;  4CF0 A;  4RW6 A;  3OJS A;  1LWE A;  1T03 A;  1L3V A;  1HQU A;  3ZT4 A;  3QLH A;  3M8R A;  1HQE A;  4FJK A;  3PY8 A;  2IAJ A;  4KRE A;  3HT3 A;  2IOC A;  3QEP A;  2FBX A;  1X1P A;  3DOL A;  2D0C A;  3LAK A;  1YVU A;  4I9Q A;  3DLB A;  3T1A A;  3VQ7 A;  3S9H A;  4AHC A;  4FJJ A;  4HUE A;  3MAQ A;  3ZSR A;  4DS4 A;  1JLE A;  4BE2 A;  3VQ8 A;  4F2R A;  5SZT A;  2JGU A;  4OGC A;  4QAG A;  2G8V A;  4DSI A;  1NJY A;  4NYF A;  4E7K A;  2QKK A;  4FYD A;  2DY4 A;  4OLA A;  1NK0 A;  4CFC A;  1RT2 A;  1KRP A;  3LP0 A;  3ZSW A;  4FJ5 A;  1QE1 A;  1U48 A;  4CFB A;  1R0A A;  3TI0 A;  1S6Q A;  4GMJ B;  3CG7 A;  4LH5 A;  3VQE A;  1RTJ A;  1C6V A;  2YNI A;  4CJE A;  4BAC A;  4FW1 A;  5J2Q A;  2ZD1 A;  4M41 A;  3HVT A;  4DU3 A;  1TKX A;  3MXJ A;  1B9D A;  2HMI A;  3K2P A;  3V9S A;  2OA8 A;  4DG1 A;  1KVB A;  4CJU A;  1NK7 A;  5D3G A;  2XHB A;  3HK2 A;  2PY5 A;  4CJS A;  3OYF A;  3T3F A;  1XHX A;  2RPI A;  4FLX A;  1C0U A;  1HNV A;  4DTX A;  1BL3 A;  4JLH A;  4J2A A;  2KQ2 A;  1Y97 A;  5EU7 A;  2OYQ A;  3B6P A;  4FJ8 A;  1FKO A;  2R7Y A;  4CIE A;  3VQQ A;  1ASV A;  4B08 A;  3RRH A;  2KFZ A;  1N5Y A;  1NJX A;  2KZM A;  1RBT A;  4FJG A;  1WAF A;  4FJM A;  4B9S A;  4O44 A;  1D9D A;  3AO3 A;  4DSF A;  4FM1 A;  1LV5 A;  2HNZ A;  1RT7 A;  1RT6 A;  4DSJ A;  1QSY A;  4Z4H A;  4CHY A;  1FK9 A;  4XIU A;  4FLW A;  1XWL A;  4CF9 A;  1ZYQ A;  1NKE A;  1LWF A;  2P5O A;  2IC3 A;  4KB1 A;  2HW3 A;  2RF2 A;  1KSP A;  4C8M A;  1JXE A;  1UAX A;  4M45 A;  1EP4 A;  1ASW A;  2F96 A;  3O4Q A;  4NCG A;  3HM9 A;  4DQR A;  1KLN A;  4ELV A;  3AVM A;  4B3O A;  4RW9 A;  1NK8 A;  4CK2 A;  3OY9 A;  3PX4 A;  1RDA A;  3LAN A;  4DTP A;  4C8O A;  3QIN A;  1NJZ A;  4KRF A;  1TAU A;  3PUF A;  3KLG A;  3B6O A;  4C8N A;  4IKF A;  1BGX T;  2YNH A;  4GVM A;  3NH0 A;  3NAE A;  3SJJ A;  3JYT A;  3SPZ A;  1W0H A;  1VRT A;  2G8K A;  2WON A;  3M8S A;  2OZM A;  3P1G A;  3VQC A;  4Q0B A;  3NE6 A;  3QEV A;  1TK8 A;  4H4O A;  2D0A A;  1EX4 A;  3O3F A;  4PY5 A;  4KHU A;  4DTR A;  1NK4 A;  2OZS A;  2Z1G A;  3JSM A;  4OPK A;  2OPS A;  1BIS A;  1N6Q A;  2BDP A;  3LAL A;  4W5O A;  1BIU A;  1SV5 A;  4PQU A;  3K59 A;  3TAE A;  3RWU A;  3QIP A;  1DTT A;  4CGG A;  5HRP A;  1IH7 A;  1WAJ A;  3D45 A;  3AV9 A;  5HRR A;  1VSE A;  4BDY A;  1L3U A;  1Q8I A;  1O1W A;  1C1A A;  2ETJ A;  4K8Z A;  1IKW A;  1RBV A;  1BIZ A;  3A2F A;  3NBP A;  4CJV A;  4B8C A;  1HPZ A;  5JS1 A;  3LWM A;  2DFE A;  1S1U A;  1RTD A;  4EZ9 A;  3OS0 A;  3HST B;  1TKT A;  1HNI A;  5E41 A;  2G8H A;  2GBZ A;  1ZBF A;  3VQ9 A;  3LPT A;  4RW8 A;  3U3Y A;  1L3S A;  3E01 A;  3LWL A;  3QET A;  4KB0 A;  2HHX A;  3AVG A;  3I0S A;  3P5J A;  1U49 A;  2ZQB A;  3HPO A;  3QO9 A;  4FLU A;  3L2U A;  3LDS A;  1U4B A;  3OYJ A;  1K6Y A;  1JLB A;  3OYG A;  4BDZ A;  3K57 A;  1SL0 A;  2IDO A;  4CEC A;  3HO1 A;  2YKN A;  3TAG A;  3CFO A;  5CZ1 A;  3KJV A;  3TAP A;  2X6N A;  3NCI A;  4KHW A;  2XY6 A;  2OPQ A;  3QIO A;  4ZHR A;  5C25 A;  3L2W A;  3V9X A;  3QEW A;  3THV A;  3SQ4 A;  1RTI A;  4CJR A;  1YT3 A;  1VRU A;  1RBU A;  4ICL A;  4E7I A;  5HLF A;  5KGX A;  1U45 A;  4C8L A;  4LSL A;  3SQ2 A;  5FRN A;  1VSL A;  2P1J A;  1SUQ A;  4CF2 A;  4E7L A;  3QEI A;  3AA3 A;  4F3O A;  3OYA A;  4Y1D A;  4W5R A;  4E89 A;  4AHT A;  4Z4I A;  2FC0 A;  4DQI A;  2HHW A;  3K58 A;  3ZSQ A;  3T19 A;  4CEO A;  5HRS A;  5J2P A;  1TL1 A;  4KKO A;  4CHZ A;  2HVH A;  5K14 A;  3DRP A;  4OLB A;  3SUQ A;  4DWI A;  3NF9 A;  5DK5 A;  4I2P A;  4DF4 A;  1S9E A;  4KHQ A;  3HPH A;  1XC9 A;  1NK6 A;  3VQB A;  4ZTJ A;  1WSE A;  5C24 A;  1WSJ A;  3VA0 A;  2NUB A;  3SUN A;  2YV0 X;  4I9L A;  5I3U A;  1T8E A;  5HRO A;  4DU4 A;  4Z4G A;  2A1R A;  4KTZ A;  4CK1 A;  4FM2 A;  4FM0 A;  1BCO A;  3V6D A;  3SV3 A;  1GOB A;  4N47 A;  4CJW A;  4CJL A;  3OYH A;  1JKH A;  4CJQ A;  4CIG A;  3C6U A;  3SCX A;  4FJX A;  3EYZ A;  1TK5 A;  1ZBL A;  2Z1H A;  1J54 A;  4M3R A;  2PYJ A;  3G0Z A;  2O4I A;  3K5O A;  2HVI A;  1CLQ A;  4CJK A;  3K5L A;  3SZ2 A;  4F8R A;  4AHR A;  4CF1 A;  4QCL A;  4LH4 A;  1UWB A;  1CZB A;  1GOA A;  1RNH A;  1WNS A;  3AA2 A;  4KPY A;  3V9W A;  1WN7 A;  4BWM A;  1JL2 A;  4DSL A;  3IRX A;  2XY7 A;  5KRS A;  3KLF A;  3AVJ A;  4CGH A;  1A5V A;  4W5N A;  2HHV A;  2YHA A;  3CFR A;  2FBT A;  3VQP A;  3KTQ A;  4DF8 A;  2D0B A;  1FKP A;  4IDK A;  4DTN A;  3SUO A;  4FLT A;  3UIQ A;  2IS3 A;  5J2N A;  4FW2 A;  1ZBI A;  2KTQ A;  1HJR A;  1L3T A;  4AHU A;  3OVN A;  1MU2 A;  2RN2 A;  2BAN A;  3DOK A;  3HP9 A;  3KLI A;  5CYQ A;  2P5G A;  4BE0 A;  1A5W A;  4JRQ A;  3DRR A;  3KLE A;  3O3G A;  1SL1 A;  2E4L A;  4PUO A;  2Y1J A;  3AVI A;  1S9G A;  5T7B A;  4N5S A;  1A5X A;  1LAV A;  3NH2 A;  4FLV A;  3OYI A;  3TAN A;  4J2D A;  2D5R A;  3AVB A;  3SNN A;  1VSI A;  3KIO A;  3MEE A;  4KTQ A;  1KCF A;  1QSL A;  2VG7 A;  1RDC A;  1WSI A;  4AH9 A;  1S1W A;  3CM5 A;  4KHS A;  4IFV A;  4CHN A;  4BWJ A;  1SKW A;  1HYS A;  4CJ5 A;  1LW2 A;  3WNF A;  4FJ9 A;  4CIF A;  1IKX A;  1EXQ A;  4Z4F A;  5KGW A;  2VG6 A;  2G8I A;  4RW4 A;  1RT3 A;  3D0P A;  1KTQ A;  3DLH A;  3DMJ A;  3ZCM A;  3M8P A;  1ZBH A;  1Q9Y A;  3NFA A;  2EX3 A;  2XRI A;  4EP4 A;  2JLE A;  1VSH A;  5KRT A;  3CQ8 A;  2Q3S A;  3NH1 A;  3I8D A;  3U6F A;  1SKS A;  1XI1 A;  4B9N A;  1BI4 B;  3OYM A;  4DTO A;  2IGI A;  1C1B A;  3V4I A;  3TAR A;  1QHT A;  3AA4 A;  3AVH A;  4HVJ A;  4RG8 A;  1SL2 A;  1NOZ A;  4CFA A;  1JLA A;  1S5J A;  1VK0 A;  4CF8 A;  1TK0 A;  1RT5 A;  3NF7 A;  4BDP A;  3QES A;  1D9F A;  1HYZ A;  1RBR A;  3ZSV A;  4CHQ A;  3SPY A;  4O0J A;  4OGE A;  4W5Q A;  3OYE A;  2X78 A;  3LP3 A;  3ZSO A;  4E7J A;  4Z0U A;  2FBY A;  4FLZ A;  3WNE A;  3RMC A;  3OYB A;  4NCB A;  2HHT A;  4M3U A;  3L3U A;  1VSF A;  4E3S A;  1QQC A;  2YNF A;  4R5P A;  2QKB A;  4L8R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...