2IDOA

Structure of the e. coli pol iii epsilon-hot proofreading complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
175
structure length
172
Chain Sequence
TRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli DNA polymerase III epsilon-HOT proofreading complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA polymerase III epsilon subunit
total genus 59
structure length 172
sequence length 175
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2idoA00
3V4IA 3O4QA 4MFBA 1T03A 3S3OA 3VQCA 4RW7A 1SV5A 3PX6A 2YKNA 3LANA 4FK4A 1UA0A 3G0ZA 3OVNA 1S1VA 1IKYA 1EXQA 4FLVA 3QEWA 3SV3A 4E7JA 3TAEA 1UA1A 3DLKA 3ISNC 1WAFA 3QEIA 1C0TA 3HJFA 3AVAA 4PUOA 4FM0A 1MU2A 2XY8A 2HVHA 3JYTA 3T1AA 1NOZA 3OS2A 1KRPA 4M3XA 3CM5A 3KLHA 3SYZA 1ZBLA 1K6YA 4AHUA 4H8KA 1RTJA 1RTIA 4FZYA 1EKEA 3AVKA 4YNQA 4DLGA 1NOYA 4RW8A 4F2SA 1Z26A 1A5WA 1BQMA 4DTJA 4KHWA 4CHZA 3MEDA 4DFPA 3SNNA 2R7YA 4AHVA 4E1MA 2PY5A 3PO4A 3VA0A 4HCCA 3V9WA 1KFSA 4ICLA 4PA1A 2QXFA 4CEZA 3HT3A 1KCFA 4BDPA 1NK0A 2F96A 3AO3A 3AVBA 3QETA 3IRXA 1U48A 4R5PA 1JXEA 1KVAA 3D45A 3NDKA 3O3GA 3NGYA 2EX3A 1BI4A 1VK0A 3DOLA 2HB5A 5FROA 3ZSZA 3OY9A 5HP1A 1ASWA 1TKTA 3V9ZA 3S9HA 4CGHA 3OYHA 3O3HA 5HLFA 4OGCA 3BDPA 4JRPA 3SV4A 4ZTFA 1L3TA 4B9NA 4KAZA 3ZSXA 4HUFA 2DTUA 4Z4HA 2KQ2A 4AHCA 4CHOA 2P51A 3CM6A 4KHUA 3OYDA 4OPKA 2HHQA 3CYMA 4LSLA 3ULDA 2G8FA 4E0DA 3NFAA 3M8PA 1A5XA 1VSJA 3VQAA 5KTQA 3OYLA 3HM9A 3SQ0A 3VQPA 4NCBA 3WNEA 1LWEA 1FKOA 4Y1DA 2HW3A 1HYVA 1D5AA 3VQBA 3DMJA 1RT7A 1KLMA 4DLEA 4E3SA 4FJMA 3QIOA 4F2RA 1J5OA 4E89A 3I8DA 4DSJA 4L8RB 1J54A 4ZHRA 1L5UA 3VQ8A 4CEOA 4O5BA 4C8NA 1ZBFA 2E4LA 2P1JA 3AO5A 3ITHA 5HRRA 3ZT3A 4CGFA 4CHYA 2G8VA 4RW9A 1KVCA 1R0AA 3ZSOA 4KHQA 3V9XA 2HHWA 4BDZA 4WE1A 4KKOA 5CZ2A 2XY6A 4M3RA 3KK1A 4DSLA 1LAVA 4DFJA 4I9LA 5KGWA 1RDAA 4XIUA 3P83D 4FJKA 4CJKA 4KHSA 1QSYA 4N41A 2ETJA 3ASMA 2RKIA 1C0UA 3T19A 3PV8A 3OYEA 4W5QA 3PUFA 1JLQA 2GUIA 3I0SA 1ZBIA 4FK2A 1S1UA 4JLHA 4Z4FA 1NK8A 2BANA 3L8BA 1HQEA 1S6PA 3MEEA 4ID5A 2ITGA 4FW2A 4C8MA 4CJTA 5JS2A 1TKDA 2G8KA 4M3UA 1JLEA 4CJQA 3NCIA 4AH9A 3KKSA 3VQQA 1NK5A 1L3UA 4CF0A 1TVRA 3AA5X 4E7IA 1RT2A 2FC0A 4DSEA 1N6QA 3MXJA 3SCXA 3HP6A 4EZ9A 3ZSYA 5I42A 1X1PA 2HHXA 2KFZA 1QSLA 3C95A 2IDOA 2YHAA 3A2FA 1UOCA 1WN7A 2E6LA 2A1RA 4M41A 1RT3A 4FJIA 4KTQA 3AVMA 3OYGA 3RMDA 1NK9A 4O0JA 4FLUA 1RCHA 4FLWA 3AO4A 3HVRA 3CFRA 3C94A 3AVCA 1FK9A 2DFHA 5CYMA 4OJRA 3IAYA 3RMAA 4B9SA 3OYNA 4OKKA 2B4JA 1RBUA 3NF6A 1JLFA 4CGIA 4CEDA 1KFDA 1JL1A 3KLEA 3KD1E 1UWBA 2B5JA 4BE1A 3U6FA 3THVA 2RPIA 4QOZB 3F73A 3AO1A 1B9FA 3CQ8A 4NCGA 3K59A 4DF8A 3TI0A 2QKBA 1JL2A 3LP2A 1RT5A 1YT3A 4CEBA 4CJPA 4CECA 1XHXA 2XRIA 3DRSA 3WNHA 1S9GA 1LAWA 3V6DA 1XC9A 1DLOA 1BCOA 3DLGA 4AHSA 4EP4A 3SPYA 1RILA 2A1SA 4J2EA 1S1WA 1TAQA 4LY7A 1L3VA 3DLRA 3OYKA 3NH2A 1NJWA 3EY1A 3DLEA 4ELTA 2X6NA 2FBVA 1JLCA 4O55A 4KHYA 2OPQA 2VG6A 4E7HA 2W42A 4FJ5A 1VSDA 4IG0A 4OKJA 2BGGA 4LH5A 4F3TA 1JXBA 4DTSA 4FJNA 3M8QA 1RDBA 3O3FA 2HNDA 1T05A 2FBYA 1F21A 3OYJA 3BGRA 2PZSA 1RTHA 3RWUA 3M8RA 3ZT2A 4N56A 3OJSA 2DFEA 2YHBA 4FLXA 3SZ2A 3SUPA 4ZTJA 4BE2A 2YNGA 4FJHA 4HCBA 2OPPA 3DYAA 2YNHA 3HYFA 2OPRA 1RDCA 3OYBA 3PO5A 3LWLA 1S6QA 5FDLA 2RF2A 3AA2A 2Y1JA 1W9HA 3KD5E 4CF9A 4M45A 2XY5A 4TSXA 1QE1A 4DG1A 1BCMA 5DK5A 3V9UA 1WAJA 3OYMA 1WLJA 3TARA 1X9MA 3AV9A 3U3GA 1T8EA 4FLYA 4I7FA 4CJRA 1TL3A 2VG7A 1J9AA 2FBTA 4DS4A 4JS4A 4FJJA 3ZSVA 4B9VA 2ZD1A 3HSTB 3V1OA 4BWMA 4CHQA 1ZBHA 3IG1A 3EYZA 3C6TA 4CJWA 4FJ7A 5KRSA 2PYLA 1VSKA 3MEGA 4QCLA 1GOCA 3EZ5A 3U3YA 1QQCA 2B6AA 4FM2A 1ITGA 2Q3SA 3SJJA 3G10A 1ZYQA 4F3OA 3SI6A 1BHLA 4NYFA 4F8RA 4PY5A 1Z25A 4OGEA 3K5LA 4IG3A 4W5NA 2E6MA 5C24A 1FXXA 3OYIA 2ATQA 3FFIA 3MAQA 3TWHA 3L3VA 4KTWA 3NBPA 1L3SA 4DTMA 2OYQA 4B3OA 1TK5A 3QESA 1VSMA 4GMJB 3SQ4A 2IAJA 4KV8A 3SQ2A 3DM2A 4JS5A 1GOBA 3JSMA 2HHVA 3NF9A 5HRPA 3HPHA 4F4KA 3AVHA 4DTUA 4E1NA 1TK0A 2OZSA 3LP3A 3RRHA 4AHTA 4DWIA 1JLGA 3AA3A 2D0AA 1Y97A 4B08A 1G15A 5KGXA 4W5RA 4CJVA 3DLBA 1BL3A 4CJ4A 1RBTA 4M3TA 4AHRA 3F9KA 3LWMA 2QKKA 1BGXT 4CJSA 4DQRA 5J2PA 2KW4A 2YV0X 3L2QA 4DU3A 3LP1A 1HJRA 4Z4GA 2OPSA 4CJ5A 3KIOA 4KFBA 3LZIA 1CZBA 3LZJA 2OA8A 4CF2A 3KLGA 2EHGA 4CK1A 3I0RA 4M3ZA 2QK9A 2Z1IA 1IG9A 3SQ1A 2G8IA 3QEPA 4CESA 4KO0A 3V1QA 3TAPA 4FJXA 3HVTA 4KREA 4KHNA 1I39A 4DFMA 3NHGA 2I5JA 3TAGA 1QHTA 2WOMA 1WSFA 2WONA 4O4GA 4OVLA 3ZT4A 1I3AA 1LW2A 1WSGA 4EP5A 2P5GA 1EX4A 1GOAA 3QNNA 4AILC 3AVJA 4W5OA 1JLAA 1NK6A 1LW0A 3HL8A 3NF8A 1HQUA 1KSPA 3ZCMA 1Q8IA 4ELVA 1JKHA 4EZ6A 4W5TA 4PWDA 4FJGA 3LAMA 4FVMA 4CFAA 4NCAA 5E41A 1VSFA 3PX0A 1IKWA 2BDPA 4Z4EA 2F8TA 5HBMA 1C6VA 1B9DA 4DU1A 4DTOA 2NUBA 1T7PA 4CJUA 4H4OA 4HUEA 3PX4A 4CJEA 1Q9XA 1S9EA 2G8UA 3V1RA 1NKBA 1TV6A 4CHPA 3SUNA 4C8LA 2OZMA 4OLBA 4DTXA 4IFYA 1XI1A 4CGJA 4CF1A 3QO9A 1S5JA 3AVFA 4DSFA 4DTPA 3HK2A 3LAKA 4DMNA 4IFVA 4DTNA 1XHZA 4LH4A 3VQEA 1VSLA 2XHBA 1KLNA 4J2BA 1TAUA 4CK3A 4K8XA 4Z4IA 4C8OA 1D9FA 1DTQA 1BIZA 1YTAA 3ZT1A 4CFCA 5JS1A 5KI6A 1SL2A 4KB0A 1SKRA 4BWJA 3QIPA 2VWKA 3AVGA 4HVJA 4DTRA 3ZT0A 2Z1HA 3LPUA 4FXDA 4B8CA 1HNIA 4O0IA 4UQGA 5C25A 5HRSA 3RTVA 3TABA 1TGOA 4M42A 1BISA 3NH0A 1KTQA 1IKVA 4RW6A 2HMIA 4KI4A 2HHSA 4FJ9A 2G8HA 1RT6A 3OJUA 4GW6A 4IDKA 4CFDA 3VA3A 3AO2A 1IO2A 2KZZA 1REVA 3ZSQA 3DLHA 4CJ3A 2AJQA 1QSSA 3L2VA 1DTTA 2D0CA 1C1BA 4MQ3A 5KRTA 4FZXC 1YVUA 4CEQA 3VQ7A 3AVIA 2O4GA 2IC3A 5SZTA 5SWMA 4LD0A 1HNVA 3VQDA 3WNFA 4B8AB 1KVBA 3VQ9A 3OS1A 4CFBA 4HTUA 2G8WA 4FZZA 2GV9A 3RR7A 1X9WA 4CIEA 2KZMA 3NH1A 1C0MA 3KK3A 3RMBA 4Q0BA 3NAEA 4I2QA 1RBVA 3K5OA 3ZSWA 2IS3A 1HPZA 1IKXA 3LDSA 1NK4A 1TKXA 4RW4A 2HNYA 4N47A 4DSIA 1SKWA 4DU4A 4FYDA 3CFPA 3SUQA 4NYNA 3WNGA 1X9SA 2D0BA 4FLZA 3MECA 3LP0A 3V81A 2D5RA 3KLIA 1FKPA 4ID1A 1U47A 3O4NA 1RBSA 5CY4A 1XWLA 1VRTA 4DFKA 3V9SA 4E7LA 1SL1A 1S1TA 2YKMA 1WSJA 5FRNA 2KTQA 4CEAA 2PYJA 4E7KA 2KFNA 4N5SA 1JLBA 4FLTA 1U49A 4CF8A 2GBZA 2Z1JA 4Z0UA 3S3MA 3KTQA 1HYZA 5HROA 4KPYA 4CEEA 1NK7A 1B92A 4QAGA 4N76A 2X6SA 1NJYA 5T7BA 3HP9A 4CJFA 2IGIA 3DOKA 1VSEA 4KRFA 1EP4A 4G1QA 3RMCA 3KKRA 3OYFA 1N5YA 1U4BA 1RT1A 1A5VA 1SUQA 5J2QA 4Q5VA 3CG7A 4KB1A 1TL1A 4CEFA 1CXQA 3IS9A 4J2AA 1C1AA 3AA4A 4H4MA 1YTUA 4HUGA 2HVIA 1U04A 2Y1IA 5J2MA 4Y1CA 3SPZA 4CE9A 1CZ9A 4CERA 2DFFA 2YNFA 4DS5A 3K57A 1LWFA 2FBXA 3NF7A 1VSIA 4CCHA 3D0PA 1ASVA 3K5MA 1SL0A 4B9UA 1RNHA 3K5NA 1WSIA 3K2PA 4BE0A 5I3UA 1D9DA 3HO1A 4IBNA 4I9QA 2LSNA 4PQUA 3KJVA 4FM1A 4FW1A 3AVNA 3NGIA 3DRPA 4OLAA 4OPJA 1ASUA 3K58A 1NKCA 5J1EA 3RR8A 4M3YA 2RN2A 4GVMA 3PY8A 4ELUA 3OYCA 1WNSA 4Z4CA 3QEVA 4BDYA 4DQQA 2YNIA 3ALYA 4CK2A 2HHUA 2JLEA 1U45A 4RG8A 2X74A 1NJZA 4C8KA 1BI4B 1EETA 1S1XA 3L2UA 3QNOA 4CIFA 1RTDA 1SKSA 1VSHA 3VN5A 4CGGA 5J2NA 3ZSRA 3B6PA 1ZBUA 3VQ5A 4O44A 4DQIA 3MXMA 2BE2A 4YFUA 4JRQA 1LV5A 4J2DA 1QS4A 2XO7A 1HMVA 3M8SA 3TAFA 1WSHA 3MXIA 2O4IA 4IKFA 3LALA 1BQNA 3KLFA 4BACA 5FRMA 3B6OA 2VWJA 3OYAA 3TANA 5CYQA 3QLHA 1VRUA 2JGUA 4KI6A 4OKEA 3L2RA 3LPTA 1TK8A 4E19A 4KTZA 3L2WA 1NJXA 3QINA 4FK0A 1W0HA 2ZQBA 3C6UA 1O1WA 2Z1GA 3CFOA 5DMRA 5EU7A 1UAXA 5CZ1A 3HPGA 4I2PA 4FCYA 1RT4A 3TR8A 1CLQA 3DI6A 2P5OA 3NE6A 1LWCA 3HXMA 4DQSA 1QTMA 3DRRA 3E01A 4CGDA 4DQPA 4CJLA 2X78A 4CHNA 2XY7A 3TAQA 3RRGA 5HRNA 4FJLA 2HHTA 4DSKA 3P5JA 1Q9YA 3S3NA 1TKZA 1WSEA 3QEXA 4FJ8A 2DY4A 3SUOA 3AVLA 4B9MA 4M3WA 1C1CA 3HPOA 5D3GA 1CXUA 1BIUA 3VQ4A 2ZE2A 1HYSA 2VG5A 3UIQA 4LSNA 1IH7A 3NGZA 3OS0A 4CIGA 4HHTA 3T3FA 1D8YA 4B9LA 4DF4A 2HNZA 1J53A 1RBRA 3KK2A 5K14A 3L3UA 1HRHA 3QERA 3TAMA 3H08A 1RDDA 1NKEA 4B9TA 4K8ZA 2F8SA 2IOCA 3VQ6A 5C42A 3P1GA
chains in the Genus database with same CATH superfamily
2P9KB 4BR2A 4YDUA 1T03A 4BY9C 1XMQK 3QICA 1UA0A 3HOTA 3UE5A 3TAEA 3PLAA 3CC7N 1C0TA 3HJFA 1MU2A 2XY8A 4G9ZA 3MWTA 3JYTA 4M3XA 3CM5A 3SYZA 1ZBLA 4H8KA 4YNQA 1KQSM 3H1QA 1BQMA 4CHZA 2R7YA 3CQXA 4JI8K 4CEZA 4PA1A 2CGLA 3AO3A 3AVBA 4R5PA 1NGHA 3D45A 2EX3A 1VK0A 3DOLA 3FZFA 5FROA 3ZETA 4HWIA 1ASWA 3V9ZA 2QWOA 4CGHA 5TKYA 3BDPA 2IVNA 2YJFA 3SV4A 4ZTFA 4B9NA 2DTUA 1VQPN 2GELA 2E20A 5BRHA 2P51A 2P9UB 3CM6A 3ULDA 2G8FA 1A5XA 1VSJA 3HM9A 4NCBA 3WNEA 4YHHK 4B3MK 5M1NA 3LDOA 1D5AA 1RT7A 3QB0A 1KLMA 3MMVA 4BRFA 4FJMA 4L8RB 1L5UA 3VQ8A 4CGFA 1ZBFA 5HRRA 2G8VA 4CHYA 1R0AA 3ZSOA 4BDZA 4WE1A 5CZ2A 4JYAK 4M3RA 4A2AA 2UUCK 4B1WB 5KGWA 3MN6A 4FJKA 4CJKA 1NGDA 2ETJA 2FSKA 1C0UA 4H0YB 4JKDA 1JLQA 2E8AA 3LM2A 1X3MA 4Z4FA 4A59A 1YF5L 2QXLA 4C8MA 2G8KA 3ID8A 1DT9A 1GLFO 1TKDA 4PL7A 3NCIA 3KKSA 4CF0A 2FC0A 4DSEA 1N6QA 2D4WA 3HP6A 4EZ9A 3C7NB 3CETA 4FSVA 2A1RA 4KTQA 1RT3A 4MLHA 3AO4A 4BGAA 4JI1K 5CYMA 3CFRA 3RMAA 4OKKA 5EXWA 2B4JA 2D0OA 1UWBA 3EN9A 4IXCA 2CGJA 4JD2A 3F73A 3AO1A 1E4GT 5AQWA 1XHXA 1U6ZA 4K25A 1ZBSA 3FR0A 3TSUA 3V6DA 3SPYA 4EP4A 3DLGA 3T1HK 1S1WA 4JI0K 1OH5A 4ELTA 3NH2A 1VAZA 2X6NA 2O8EA 1O13A 2QEXN 2FF6A 1DEJA 3O3FA 5F1XA 5EX5A 3OYJA 3BGRA 1RTHA 4DR1K 3ZT2A 2ASMA 4FJHA 3DYAA 3R8EA 2D1KA 1S6QA 2RF2A 1W9HA 3CCVN 3C7NA 4O8UA 5AQFA 3V9UA 1WAJA 3JXUA 1VHXA 4FLYA 1NBWA 1WUAA 1W7AA 4NO7A 3IDHA 4CHQA 3VESA 3EYZA 4FJ7A 2PYLA 4NLBA 1VSKA 2I7PA 1GLAG 3MEGA 5AQIA 3GE1A 3EZ5A 3U3YA 1ITGA 4MDBA 4F3OA 2HMPA 5BN8A 5FPDA 4IG3A 1YI2N 2QWNA 2QM1A 3QFUA 3L3VA 5KQ8A 1MDUB 2W40A 4KV8A 3SQ2A 3DM2A 4JS5A 4F4KA 4DTUA 3ENOA 1KAZA 2D0PA 3LL3A 4DWIA 3RRHA 4AHTA 3J7ZO 3AA3A 2D0AA 4DV3K 3DLBA 5AQYA 4M3TA 4AHRA 2QKKA 1BGXT 3BUZB 2KW4A 4BC4A 2WFBA 4CJ5A 1CZBA 2EHGA 3FZMA 4CK1A 1YITN 3QMLA 4RCHA 3SQ1A 2G8IA 3QEPA 3SAFA 4FJXA 3HVTA 4B3TK 3TAGA 4WF9L 2WONA 1I3AA 3O9TA 3TSQA 4EP5A 1GOAA 3QNNA 5M1KA 3MK6A 2PAVA 1EWQA 4W5OA 4NB4A 5E84A 3NF8A 3VGMA 4IO8A 1HQUA 3ZCMA 1Q8IA 1W2BM 3MCPA 4W5TA 4H5VA 4FJGA 3LAMA 3MX5A 3CF5L 1XQSC 5E41A 2BDPA 4JKFA 1NU0A 4H4OA 1BA1A 4ILJA 5M1OA 3V1RA 1TV6A 1RGIA 3I55N 1BOTO 3O1BA 4IFYA 1N33K 4CGJA 4DTPA 3LAKA 3J80O 4IFVA 2PFUA 2RHKA 1KAYA 5AJ3K 2XHBA 2IVOA 4C8OA 4CFCA 2E2NA 1SL2A 4BWJA 3AVGA 4XH1A 4HVJA 4XH5A 3R9PA 3P4IA 4M42A 1BISA 1KTQA 2HHSA 4RW6A 1RT6A 3OJUA 1WBDA 3L0QA 3VA3A 3MWPA 1REVA 2AJQA 1QSSA 5HOOA 4CEQA 3WXKA 3VQ7A 2O4GA 5SZTA 5SWMA 1VQ8N 1C0GA 4JI3K 5F2RA 3ZYYX 2G8WA 3MDQA 4FZZA 2GV9A 4JD2B 2KZMA 3NH1A 3RMBA 3NAEA 4I2QA 1NK4A 5JICA 4RW4A 5IWAK 4DSIA 3W3DA 4DU4A 4FYDA 5BN9A 3ENBA 2D0BA 1ZC6A 4DR7K 3WEEA 2D5RA 3KLIA 4ID1A 1NWKA 4NXNK 2NNWA 1HUXA 4IJAA 1SL1A 1VRTA 5LMUK 4E7LA 5BPLA 3NVMA 1Q18A 2KFNA 5GADP 1LCUA 2JWKA 1GLDG 3D2EB 1NGEA 3S3MA 4XH4A 3KTQA 3JS6A 4KPYA 4CEEA 3R1XA 1YJWN 1NK7A 1Z05A 5GAEP 5T7BA 3HP9A 3TPQA 2WBNA 1EP4A 4G1QA 2O8CA 1RT1A 4Q5VA 1TL1A 4CEFA 3WQUA 1E3MA 4H4MA 4HUGA 4Y0WA 4CE9A 3CHWA 4CERA 1IBLK 2DFFA 4DS5A 3EE8A 4H0TB 1VSIA 3ULEB 4JN4A 4LF9K 4I9QA 5AQSA 3VPZA 4WYBA 4PQUA 3KJVA 4FM1A 1BDGA 3A5OC 1NMDA 2RN2A 3QEVA 4DQQA 4CD1A 1NJZA 2X74A 1EETA 1RDUA 5AQRA 2P9LA 3HI0A 3NVKA 3VF2A 5J2NA 3VQ5A 4O44A 1NJIO 3EE9A 3MXMA 4GKJK 4JRQA 1C0FA 2GEMA 2ITMA 1HMVA 1BQNA 3GDQA 3KLFA 3SAHA 3B6OA 2VWJA 4CBXA 5JMVA 2JGUA 3L2RA 4V19S 1TK8A 4E19A 2Q2RA 1VQ7N 1Q81O 4JV5K 2FSJA 3SBTA 3HPGA 1T6CA 2P9KA 1NGCA 5AQLA 3DI6A 2P5OA 1LWCA 4FOEA 4WFBL 3HXMA 4BVOA 4DQSA 3E01A 4CJLA 2X78A 3RRGA 2HHTA 5HRNA 3J7AP 4DSKA 3P5JA 1Q9YA 5DM7L 1TKZA 3QEXA 2QWPA 3OA9A 2BH1A 3HPOA 2A3ZA 4I6MB 1CXUA 5E26A 3VQ4A 1IV0A 3LDPA 2ZE2A 1KC8O 2VG5A 1GLJO 3UIQA 3T3FA 3NGZA 4B9LA 4CIGA 4DF4A 5AQQA 1QVGM 3L3UA 3QERA 3TAMA 1CZAN 5EVZA 5KPZA 5AQOA 4X66K 3CJ9A 3VQCA 1VQMN 1S1VA 1IKYA 4EIAA 4FLVA 4E7JA 3DLKA 4M63C 3AVAA 4PUOA 1NMNA 3CCLN 2JWLA 3KLHA 1K6YA 3IFRA 4F2SA 4DLGA 4YDUC 1NOYA 1Z26A 1A5WA 3AGKA 4R79A 2ZGZA 4BR9A 3MEDA 4DFPA 1VQKN 4HCCA 4AHVA 1QQMA 2PY5A 3VA0A 3VEXA 4BDPA 1QHAA 1E4FT 5LJVA 3NDKA 3THWB 1BI4A 2HB5A 3ZSZA 3IMXA 4BG8A 5M1FA 1TKTA 3S9HA 2KKZA 3E9OA 4OPHA 3EEQA 3TTCA 3M6GA 4KAZA 3DXMA 3ZSXA 4HUFA 3MN9A 4Z4HA 1VQ9N 4AHCA 4CHOA 5BRDA 4CVNE 3TSPA 3H3NO 4LSLA 2ZJPL 4E0DA 2ASPA 3M8PA 5KTQA 3VQAA 2HW3A 3JAMO 3VQBA 3DMJA 2P9UA 1K9MO 4H5NA 5C10A 2V7ZA 3QIOA 4F2RA 1J5OA 3I8DA 3U9ZA 1HJOA 3ZT3A 3AO5A 3ITHA 4RW9A 1KVCA 3V9XA 2HHWA 4BRKA 4IO9L 3O9RA 4I9LA 1FJGK 4XIUA 4KHSA 4N41A 4KBOA 3D6RA 3PV8A 3PUFA 2GUIA 3I0SA 4JLHA 5LY3A 2BANA 4ID5A 2F9WA 2ITGA 1K8KA 4CJTA 5JS2A 3BF3A 4M3UA 1JLEA 3WXLA 4CJQA 3I8BA 3D2FB 5GAGP 2O8BA 3O4WA 2ZM6K 3U4LA 3HM8A 3L4IA 5AQMA 3VEVA 4A5AA 3LDLA 3O1WA 4H5WA 4BR0A 2YHAA 4ILGB 3RMDA 4FLUA 1RCHA 4FLWA 3HVRA 4CZJA 1FK9A 3AVCA 3IAYA 3NF6A 1RBUA 4CGIA 4IDHA 1JL1A 2ZJQL 4BE1A 4H0PA 1S3XA 4NCGA 3K59A 1EQYA 2QKBA 1JL2A 4NXMK 1YT3A 4EAHD 4JEPA 2QWQA 1J5EK 4FWNA 4MO4A 4AHSA 1RILA 2A1SA 4J2EA 4X64K 1TAQA 2W6LA 4LY7A 4A5BA 1NJWA 3DLEA 5C12A 4JI6K 4O55A 4OKJA 3CCUN 4DV1K 2BGGA 4LH5A 4F3TA 3KK7A 4DTSA 4FJNA 1RDBA 2NRRA 2Q36A 3THWA 4BVPA 2QWLA 3ID6A 1F21A 3I33A 2PZSA 4LFAK 1HKBA 2DFEA 2YHBA 4BE2A 2YNGA 5JLHA 4BC3A 5H1SQ 3UKUA 1RDCA 3PO5A 2Q31A 4Z94A 2Y1JA 4M45A 2V52B 1X9MA 3R6MA 1DKGD 3U3GA 1T8EA 1QQOA 1BU6O 1TL3A 3OHRA 5CHIA 2FBTA 4FJJA 3WEEB 3ZSVA 4B9VA 3V1OA 4JI4K 4JKHA 1N36K 1ZBHA 2A6AA 4CJWA 5KRSA 1GOCA 4O8KA 4WFAL 4FM2A 3DXKA 2Q3SA 3SJJA 1HNXK 3G10A 1ZYQA 2F7TA 1BHLA 4NYFA 4PY5A 2NRTA 3K5LA 4W5NA 2E6MA 3DWLA 3W0LA 3FFIA 3MAQA 4KTWA 4DTMA 1TK5A 1VSMA 1V4TA 2IAJA 5DM6L 2O8FA 5HRPA 3HPHA 4RTFD 3LM9A 1Q7YO 1TK0A 2P9SA 2OZSA 3LP3A 4BRIA 3MCAB 1NGBA 4CJVA 4L3QA 4CJ4A 1RBTA 5J2PA 2CH5A 3OW2M 3LP1A 5LJWA 1ATRA 3AGRA 3UB5A 5AQTA 5ADXH 3R3LA 4CF2A 4M3ZA 3J7YP 3SLCA 1WB9A 3H6EA 1IG9A 5BREA 5AQKA 5GIOA 4IEEA 3EL2A 1I39A 4DFMA 2I5JA 1QHTA 4O4GA 4RWTA 1NGAA 5C2FA 3AVJA 4LF5K 3D2FA 3HL8A 3M3ZA 4JI7K 3VF4A 1ATNA 4ILHA 3THXB 3PX0A 3TTDA 3SK3A 2NUBA 3N4QA 4CJEA 1NKBA 4CHPA 3KVGA 4DTXA 2QWMA 3EZWA 1S5JA 3CCSN 3VGLA 1XHZA 4LH4A 1VSLA 3E9LA 5AZIB 3FFKB 4K8XA 3CCRN 1VQ5N 2OANA 1BIZA 2OCEA 4KB0A 1JJ2M 4DV2K 2Z1HA 3BF1A 5AQGA 1HNIA 4UQGA 5HRSA 5FPMA 3TABA 3NMUA 1Z6RA 3SBGA 3NH0A 4KI4A 2FLOA 4H03B 4HTLA 4GW6A 4OO1J 2KZZA 4BGBA 3ZSQA 4ISEA 3FZLA 3CCJN 5AQHA 1DTTA 2D0CA 1YVUA 5AZIA 3AVIA 4YOTA 3K0SA 4KH4A 4H0VB 1HNVA 3VQDA 3WNFA 3OS1A 4CFBA 4HTUA 3FE1A 4CIEA 3LDQA 1C0MA 3QBWA 1RBVA 3ZSWA 3Q7CA 3UKRB 1IKXA 4YOXA 3CJCA 5A2QO 3LDSA 1TKXA 2Q0RA 3OBWA 1X9SA 1HX1A 1GLCG 3MECA 3V81A 4CZMA 5ADXA 4PKIA 1RBSA 2QA4N 4DFKA 3V9SA 1S1TA 4B1UB 4N5SA 5F0XA 1JLBA 4K43A 4Z0UA 3Q7BA 4IOXA 2PBDA 1OH6A 3WXIA 2X6SA 2E2QA 1NJYA 4CJFA 2IGIA 3DOKA 4KRFA 2OTJN 3O9SA 4YOYA 2V51B 3AAQA 2O8EB 4J2AA 3CJAA 5HL7L 4IFEA 5KPRA 3SPZA 4CZEA 1H1VA 3CPEA 1ASVA 3CPWM 1SL0A 4B9UA 3K5NA 5I3UA 4FWOA 4M7XA 3THYB 4BRDA 3AVNA 4FWMA 3K58A 1NKCA 5KPTA 2E1YA 2NRVA 2JLEA 1BI4B 4CIFA 3C6HA 5BPNA 1Q82O 3VN5A 1W97L 3OTOK 3D7EO 4E1JA 4YFUA 2GTDA 2ZJRL 5C0YA 3MXIA 1T6DA 1WSHA 4IKFA 3LALA 5FRMA 5AQVA 3LPTA 2ZQBA 1P8ZA 4B1XB 3C6UA 1O1WA 3CFOA 3F2KA 5GINA 1OH8A 4I2PA 4FCYA 1RT4A 4DQPA 4CGDA 3TAQA 4FJLA 3EO3A 2P9PA 4FJ8A 2DY4A 3DJCA 4U67L 3SUOA 4M3WA 5D3GA 1BIUA 2P9NB 1HYSA 5AR0A 4LSNA 1IH7A 1D8YA 4BR4A 4HHTA 1BO5O 1J53A 5K14A 1HRHA 1VQ4N 4LF8K 3H08A 4BG9A 1NKEA 4B9TA 4K8ZA 2O8FB 5B8HA 2WC9A 4A2BA 3P1GA 1HR0K 3V4IA 5AZJA 3O4QA 4MFBA 3S3OA 2A41A 4RW7A 3PX6A 3LANA 4PKHA 3PIPL 3OVNA 4FVUA 3KWIA 2WUSA 2QWRA 1IBMK 4NLCA 2A42A 3SV3A 1UA1A 4GV6A 4FPAA 1G99A 1WAFA 4YOWA 4FM0A 1RFQA 4JI2K 3T1AA 1NOZA 3OS2A 1MWMA 2GUPA 5EY4A 1RTIA 3AVKA 2HHHK 4DR5K 3VF6A 4DTJA 4E1MA 4J2DA 3PO4A 4ICLA 2UXCK 1KCFA 3VETA 1NK0A 4PHTX 3IRXA 5AFUA 1JXEA 3NGYA 5GAHP 3OY9A 2NRXA 5HP1A 3HBTA 5BR8K 1L3TA 2NRZA 1HKGA 4CI6A 4WFNL 4FO0A 2KQ2A 3C65A 3OYDA 4OPKA 2HHQA 3T1YK 3NFAA 4H5RA 3OYLA 3SQ0A 5JLFA 4YORA 4LF4K 4Y1DA 2VGMA 1HYVA 2I7NA 3O8MA 3CMEN 4GV3A 4DLEA 4E3SA 4DR4K 4E89A 1QQNA 4DSJA 3AY9A 2YHYA 3IKMA 4O5BA 4M3YA 1BWFO 4BRGA 4KHQA 1XNRK 4KKOA 2XY6A 3KWGA 3KK1A 1LAVA 4DFJA 1RDAA 3P83D 1QSYA 4C1NI 2RKIA 3T19A 1J6ZA 4MLEA 4W5QA 3OYEA 3VENA 2ASOA 3FZKA 1ZBIA 4FK2A 1S1UA 4JK7A 3T69A 3L8BA 1HQEA 2P9IB 3MEEA 1JCEA 1JCGA 3A0IX 1NK5A 3EKUA 1L3UA 2KHOA 1RT2A 3SCXA 4AQYK 3ZSYA 2HHXA 2KFZA 4BC5A 1OVYA 1QSLA 1K8KB 3A2FA 1UOCA 1WN7A 5I9EB 4M41A 3AVMA 1NK9A 4O0JA 2J4RA 1TUUA 2DFHA 4OJRA 1IBKK 2E2OA 1JLFA 4CEDA 1KFDA 3KD1E 2B5JA 3U6FA 3THVA 5GIPA 4CBUA 1B9FA 2ZWHA 3CQ8A 4DF8A 4CEBA 4CJPA 2XRIA 1S9GA 1LAWA 2AP1A 1XC9A 3O80A 1BG3A 3OYKA 4DV7K 4A62A 2FBVA 3G4SN 2OPQA 2VG6A 4FJ5A 2W42A 4IG0A 1JXBA 1I94K 2FSNA 5M1QA 2FBYA 3VEWA 3RWUA 2O8DA 4DUYK 1QZ6A 3M8RA 3OJSA 3SZ2A 3SUPA 4PL8A 3QBXA 2HBMA 2OPPA 3ATVA 4JKAA 5AFUH 3LWLA 3M5RA 4WQ4A 5FDLA 4CF9A 3P38A 4H0OA 2XY5A 1BCMA 2NRWA 1WLJA 3OYMA 3AV9A 1YUWA 3A5MC 4CJRA 2VG7A 1J9AA 4DS4A 4JS4A 1HKCA 2ZD1A 4BWMA 4WQ4C 2P9IA 4XEIA 4B1VA 4QCLA 3U8XA 1QQCA 4DV4K 2GX9A 3O6WA 4J8FA 2Q97A 4OPAA 2HOEA 2YHWA 1K73O 1SZ2A 1Z25A 5C24A 1FXXA 4O5FA 2ATQA 3TWHA 4LF7K 3NBPA 1L3SA 4DQ8A 4GMJB 4C1NK 3SQ4A 2H3GX 2HHVA 3JSMA 3NF9A 4DV6K 2P9SB 2YX6A 3F9MA 4EHUA 1BUPA 2F4VK 1Y97A 1G15A 4M7YA 4FWLA 4I6MA 3LWMA 5M1PA 4DQRA 2YV0X 4FWSA 1D4XA 2OPSA 3LZIA 3KIOA 4FWQA 4KFBA 2VQFK 3LZJA 4FWKA 4BROA 2QK9A 2Z1IA 4JKBA 3D2EA 4KO0A 4CZGA 3H46O 3ZT4A 1WSFA 1WBBA 3DLLL 1LW2A 1EX4A 3ZEUA 3SAGA 3PSFA 4A57A 1JLAA 3TTFA 1NK6A 3A5NC 3THXA 1KSPA 4CZHA 4EZ6A 3H1VX 2KLAA 4BREA 4FVMA 4CFAA 4NCAA 5TKWA 2F8TA 4Z4EA 1LOTB 5HBMA 2EWSA 4CJUA 3BY5A 5BPMA 1YJ9N 2FXUA 1S9EA 2OZMA 4C8LA 4OLBA 3QO9A 3AVFA 3HK2A 4DTNA 1KLNA 4J2BA 4CK3A 4Z4IA 1U2VB 4B1YB 1YHQN 3QIPA 4DTRA 4QS7A 3ZT0A 4MO5A 3LPUA 4H0XB 1EWRA 4B8CA 4O0IA 4IEIA 3RTVA 1N32K 1IKVA 1X3NA 4FJ9A 5ELZA 3MX2A 4CFDA 3E66A 3AO2A 1IO2A 4AM6A 3F5TA 3DLHA 4CJ3A 3J81O 4GVEA 1YIJN 3L2VA 3H3OB 4C23A 1C1BA 2F9TA 4MQ3A 1WOQA 2VYPA 2IC3A 3HRGA 4B8AB 1KVBA 3VQ9A 1YXQA 3BP8A 1X9WA 3KK3A 1N34K 2IS3A 1HPZA 1HLUA 2UXDK 2HNYA 4DV5K 1SKWA 5BRFA 1DGKN 3LP0A 1R59O 4JHDA 4JHDB 1U47A 3O4NA 5MLCQ 4JK8A 1XWLA 4CBWA 1HNZK 2YKMA 1WSJA 1NGIA 2PYJA 1U49A 4FLTA 1NGGA 4CF8A 3GBTA 2HF4A 4FOIA 3CXCM 3J8AA 5LMNK 1KD1O 1B92A 4N76A 3G25A 4BRHA 3VTIA 1QVFM 2E1ZA 3RMCA 3OYFA 3KZBA 1U4BA 2DPNA 1A5VA 5J2QA 3AARA 4YY3K 3IS9A 1YTUA 1C1AA 4FWPA 5IT9O 2UUAK 3SMPA 2QTDA 4Y1CA 3E1YA 4BC2A 1GLBG 2YNFA 4YOVA 2YHXA 4X62K 3K57A 1LWFA 5KQDA 2FBXA 3O5BA 3PIOL 3K5MA 1RNHA 4BE0A 1D9DA 2CH6A 1Y64A 4DHYA 4FW1A 1V4SA 3NGIA 4OLAA 4OPJA 1ASUA 4DR2K 3RSEB 5J1EA 3RR8A 4UY8O 4ISFA 3PY8A 4GVMA 4JAXA 3OYCA 4Z4CA 3CC2N 4BRQA 2YNIA 3ALYA 2HHUA 4EFHA 1U45A 1S1XA 1NNEA 1RTDA 1SKSA 3A8YA 1VSHA 3FLCO 1KXPA 4CGGA 3ZSRA 3B6PA 4DQIA 5CR4A 1LV5A 4OX9K 1QS4A 2XO7A 3M8SA 3TAFA 4GV9A 2O4IA 4BACA 1VQLN 4OKEA 4BQZA 1MWKA 3QFPA 3K9JA 4DR6K 3ZEUB 3L2WA 4GNIA 4KTZA 3QINA 2VGNA 5C15A 1K8AO 3CD6N 4DUZK 4BRLA 1VQON 4GY2B 1TUYA 2Z1GA 3CCMN 2A5XA 1UAXA 5AZJB 5AQXA 1GLEG 3LDNA 1ATSA 1WSEA 1YAGA 3AVLA 4B9MA 1C1CA 4LFCK 4K0KK 3OS0A 4IOCL 4BRCA 1RBRA 3KK2A 2Q1NA 2F8SA 3VQ6A 5C42A 3RVCA 4JNEA 1SV5A 2YKNA 4FK4A 3G0ZA 3OBYA 1EXQA 3QEWA 2QI2A 3ISNC 3QEIA 5FPEA 2HVHA 1N8RO 4K41A 1KRPA 4AHUA 1RTJA 4FZYA 1EKEA 4RW8A 1NLVA 4KHWA 3GG4A 3SJHA 1X9JA 4U7BA 3SNNA 1OKJA 3V9WA 1KFSA 2QXFA 1ESVA 3RSEA 3HT3A 4BRMA 2F96A 3QETA 1U48A 1KVAA 3O3GA 5EOYA 2QW9A 1NGJA 1T44A 3OYHA 3CIPA 3T7ZA 3O3HA 5HLFA 4OGCA 5AQUA 4JRPA 3ULEA 1SQKA 3A5LC 3CERA 4IZ9A 4JKGA 2O8DB 4KHUA 4JK9A 1HNWK 3CYMA 3THYA 3VQPA 1LWEA 1FKOA 1JCFA 1HPMA 3CJ7A 1SAZA 1J54A 3VOVA 4ZHRA 4CEOA 3IUCA 3MN7A 4C8NA 2E4LA 2P1JA 3FGUA 4PKGA 4F9OA 1M90O 3ZETB 4DKWA 4DSLA 4IWVA 4CD3A 3ASMA 3HSCA 3C0BA 1BA0A 4KH5A 4CZFA 1S6PA 4FW2A 3WXJA 1NGFA 4AH9A 3VQQA 1TVRA 3AA5X 4E7IA 3MXJA 5I42A 1X1PA 4BRNA 3C95A 2IDOA 1VQNN 2E6LA 4FJIA 3OYGA 4X65K 3C94A 4WCEL 4B9SA 3OYNA 2UU9K 4LFBK 2ZGYA 3KLEA 3VEYA 2RPIA 4CZKA 4QOZB 3TI0A 4BRPA 4CW7B 3LP2A 1ZXOA 4AF1A 2VQEK 1RT5A 3E9PA 4CECA 3DRSA 3WNHA 1Q86O 2P9NA 3G71N 1DLOA 1BCOA 1VQ6N 1L3VA 3DLRA 3EY1A 1IG8A 1NM1A 1JLCA 4KHYA 4E7HA 1VSDA 3O08A 3M8QA 3HTVA 2HNDA 1T05A 4WQ5A 3WQTA 4CZLA 4N56A 4FLXA 4ZTJA 4HCBA 2YNHA 3HYFA 2OPRA 3VTHA 3OYBA 4B3SK 2W6KA 2BUPA 3AA2A 3KD5E 2BTFA 4A61A 3BEXA 1M1KO 4TSXA 1QE1A 4DG1A 5DK5A 3TARA 5AQNA 3O9UA 4QS8A 2O8BB 4I7FA 3HSTB 2UXBK 3FZHA 3IG1A 3C6TA 2CGKA 2GWJA 2B6AA 3L4QA 3SI6A 4F8RA 4OGEA 1T3VA 2OTLN 3N4PA 1OH7A 1SS6A 3OYIA 2YCHA 2V7YA 2OYQA 5JVHL 4B3OA 3CCQN 3QESA 3CQYA 1GOBA 3CJ1A 3AVHA 4E1NA 3WUHA 1JLGA 2UUBK 4B08A 5KGXA 4W5RA 1BL3A 3F9KA 4CJSA 4GKKK 2P9PB 3L2QA 4DU3A 1HJRA 4Z4GA 4JKGB 3DXMB 5BR9A 2OA8A 1U2VA 3KLGA 5AQJA 3I0RA 4DV0K 2IIRA 4CESA 3V1QA 3TAPA 3P39A 4KREA 4KHNA 2NLXA 3NHGA 2WOMA 1NK8A 2P5GA 4OVLA 4WQ5C 1WSGA 4B3RK 3TU5A 5AQZA 4AILC 1LW0A 3M1FA 4ELVA 4BR5A 4JKCA 1JKHA 2P9LB 4PWDA 1IJJA 5AQPA 4QS9A 1VSFA 3VEOA 1IKWA 1NG9A 3UKRA 1C6VA 1B9DA 5FPNA 4DU1A 4DTOA 1T7PA 3PX4A 4HUEA 2FF3B 1Q9XA 2G8UA 3S41A 3SUNA 2UYTA 1XI1A 4CF1A 1OVQA 3O9QA 4DSFA 4DMNA 3VMFB 3VQEA 2WTUA 3UKUB 4B1ZA 1TAUA 1D9FA 1DTQA 1YTAA 3ZT1A 5JS1A 4JKEA 5KI6A 3KHYA 1SKRA 2VWKA 3L6QA 1GLLO 5C25A 1TGOA 3EKSA 3BZCA 2HMIA 2G8HA 2VCPA 2O8CB 3HZ6A 2E88A 3MN5A 4IDKA 4AM7A 2E2PA 4JI5K 3C6AA 1XMOK 4EHTA 3CCEN 3I56N 4B9QA 5KRTA 4FZXC 3K9KA 3WXMB 1P90A 4LD0A 4BRAA 2NZTA 3RR7A 4Q0BA 3K5OA 3BZKA 2A40A 4N47A 4DCHA 3ZX0A 3CFPA 3SUQA 4NYNA 3GOIA 3WNGA 4DR3K 4CJ7A 4FLZA 2GWKA 1FKPA 4LF6K 2HBLA 5CY4A 3GL1A 1S72N 4KHPK 1ILYA 4BR7A 5FRNA 3CC4N 2KTQA 1EO1A 4CEAA 4E7KA 3VEZA 2GBZA 2Z1JA 1HYZA 5HROA 3QDKA 4QAGA 1VSEA 3KKRA 5JVGL 1N5YA 1SUQA 2W41A 1YJNN 3CG7A 4KB1A 1QZ5A 1CXQA 4DB3A 2HVIA 3AA4A 2IVPA 3PSIA 3HOSA 1U04A 2Y1IA 1XUPO 1MA9B 5J2MA 1YVNA 2YI1A 1CZ9A 2RE2A 3SMSA 4CZIA 3NF7A 4CCHA 3D0PA 3CMAN 1WSIA 3K2PA 3CI5A 3HO1A 4IBNA 2LSNA 1KAXA 3VGKA 4IOAL 3DRPA 3B8AX 4MDAA 2VWBA 1RDWX 4ELUA 1WNSA 4BDYA 3WT0A 4K42A 3DXKB 1XNQK 2HF3A 4CK2A 4RG8A 3CJBA 4C8KA 3ENHA 4BQLA 3L2UA 3VERA 3QNOA 4YOUA 4ISGA 2AA4A 5FLXO 1ZBUA 3ZLJA 3ZX3A 2HSTA 2HBJA 5C2DA 2BE2A 3H45C 3G6EN 4H5TA 5LL6Z 3OYAA 4FWRA 3TANA 3ATUA 5CYQA 3QLHA 1VRUA 4KI6A 1TYQB 1NJXA 2ZF5O 3AAPA 4FPBA 4FK0A 1W0HA 3DAWA 2NRHA 3U9DA 5DMRA 5EU7A 2YJEA 5CZ1A 3ZX2A 3TR8A 1CLQA 1XC3A 3NE6A 1QTMA 3DRRA 4CHNA 2XY7A 3P31A 3S3NA 4FL9A 2Q0UA 4LC9B 1FW6A 1S22A 4IJNA 2HNZA 5CE3A 2E5LK 1RDDA 2HBKA 1TYQA 4KH6A 2IOCA 4FXDA
chains in the Genus database with same CATH topology
3V4IA 3O4QA 4MFBA 1T03A 3S3OA 3VQCA 4RW7A 1SV5A 3PX6A 2YKNA 3LANA 4FK4A 1UA0A 3G0ZA 3OVNA 1S1VA 1IKYA 1EXQA 4FLVA 3QEWA 3SV3A 4E7JA 3TAEA 1UA1A 3DLKA 3ISNC 1WAFA 3QEIA 1C0TA 3HJFA 3AVAA 4PUOA 4FM0A 1MU2A 2XY8A 2HVHA 3JYTA 3T1AA 1NOZA 3OS2A 1KRPA 4M3XA 3CM5A 3KLHA 3SYZA 1ZBLA 1K6YA 4AHUA 4H8KA 1RTJA 1RTIA 4FZYA 1EKEA 3AVKA 4YNQA 4DLGA 1NOYA 4RW8A 4F2SA 1Z26A 1A5WA 1BQMA 4DTJA 4KHWA 4CHZA 3MEDA 4DFPA 3SNNA 2R7YA 4AHVA 4E1MA 2PY5A 3PO4A 3VA0A 4HCCA 3V9WA 1KFSA 4ICLA 4PA1A 2QXFA 4CEZA 3HT3A 1KCFA 4BDPA 1NK0A 2F96A 3AO3A 3AVBA 3QETA 3IRXA 1U48A 4R5PA 1JXEA 1KVAA 3D45A 3NDKA 3O3GA 3NGYA 2EX3A 1BI4A 1VK0A 3DOLA 2HB5A 5FROA 3ZSZA 3OY9A 5HP1A 1ASWA 1TKTA 3V9ZA 3S9HA 4CGHA 3OYHA 3O3HA 5HLFA 4OGCA 3BDPA 4JRPA 3SV4A 4ZTFA 1L3TA 4B9NA 4KAZA 3ZSXA 4HUFA 2DTUA 4Z4HA 2KQ2A 4AHCA 4CHOA 2P51A 3CM6A 4KHUA 3OYDA 4OPKA 2HHQA 3CYMA 4LSLA 3ULDA 2G8FA 4E0DA 3NFAA 3M8PA 1A5XA 1VSJA 3VQAA 5KTQA 3OYLA 3HM9A 3SQ0A 3VQPA 4NCBA 3WNEA 1LWEA 1FKOA 4Y1DA 2HW3A 1HYVA 1D5AA 3VQBA 3DMJA 1RT7A 1KLMA 4DLEA 4E3SA 4FJMA 3QIOA 4F2RA 1J5OA 4E89A 3I8DA 4DSJA 4L8RB 1J54A 4ZHRA 1L5UA 3VQ8A 4CEOA 4O5BA 4C8NA 1ZBFA 2E4LA 2P1JA 3AO5A 3ITHA 5HRRA 3ZT3A 4CGFA 4CHYA 2G8VA 4RW9A 1KVCA 1R0AA 3ZSOA 4KHQA 3V9XA 2HHWA 4BDZA 4WE1A 4KKOA 5CZ2A 2XY6A 4M3RA 3KK1A 4DSLA 1LAVA 4DFJA 4I9LA 5KGWA 1RDAA 4XIUA 3P83D 4FJKA 4CJKA 4KHSA 1QSYA 4N41A 2ETJA 3ASMA 2RKIA 1C0UA 3T19A 3PV8A 3OYEA 4W5QA 3PUFA 1JLQA 2GUIA 3I0SA 1ZBIA 4FK2A 1S1UA 4JLHA 4Z4FA 1NK8A 2BANA 3L8BA 1HQEA 1S6PA 3MEEA 4ID5A 2ITGA 4FW2A 4C8MA 4CJTA 5JS2A 1TKDA 2G8KA 4M3UA 1JLEA 4CJQA 3NCIA 4AH9A 3KKSA 3VQQA 1NK5A 1L3UA 4CF0A 1TVRA 3AA5X 4E7IA 1RT2A 2FC0A 4DSEA 1N6QA 3MXJA 3SCXA 3HP6A 4EZ9A 3ZSYA 5I42A 1X1PA 2HHXA 2KFZA 1QSLA 3C95A 2IDOA 2YHAA 3A2FA 1UOCA 1WN7A 2E6LA 2A1RA 4M41A 1RT3A 4FJIA 4KTQA 3AVMA 3OYGA 3RMDA 1NK9A 4O0JA 4FLUA 1RCHA 4FLWA 3AO4A 3HVRA 3CFRA 3C94A 3AVCA 1FK9A 2DFHA 5CYMA 4OJRA 3IAYA 3RMAA 4B9SA 3OYNA 4OKKA 2B4JA 1RBUA 3NF6A 1JLFA 4CGIA 4CEDA 1KFDA 1JL1A 3KLEA 3KD1E 1UWBA 2B5JA 4BE1A 3U6FA 3THVA 2RPIA 4QOZB 3F73A 3AO1A 1B9FA 3CQ8A 4NCGA 3K59A 4DF8A 3TI0A 2QKBA 1JL2A 3LP2A 1RT5A 1YT3A 4CEBA 4CJPA 4CECA 1XHXA 2XRIA 3DRSA 3WNHA 1S9GA 1LAWA 3V6DA 1XC9A 1DLOA 1BCOA 3DLGA 4AHSA 4EP4A 3SPYA 1RILA 2A1SA 4J2EA 1S1WA 1TAQA 4LY7A 1L3VA 3DLRA 3OYKA 3NH2A 1NJWA 3EY1A 3DLEA 4ELTA 2X6NA 2FBVA 1JLCA 4O55A 4KHYA 2OPQA 2VG6A 4E7HA 2W42A 4FJ5A 1VSDA 4IG0A 4OKJA 2BGGA 4LH5A 4F3TA 1JXBA 4DTSA 4FJNA 3M8QA 1RDBA 3O3FA 2HNDA 1T05A 2FBYA 1F21A 3OYJA 3BGRA 2PZSA 1RTHA 3RWUA 3M8RA 3ZT2A 4N56A 3OJSA 2DFEA 2YHBA 4FLXA 3SZ2A 3SUPA 4ZTJA 4BE2A 2YNGA 4FJHA 4HCBA 2OPPA 3DYAA 2YNHA 3HYFA 2OPRA 1RDCA 3OYBA 3PO5A 3LWLA 1S6QA 5FDLA 2RF2A 3AA2A 2Y1JA 1W9HA 3KD5E 4CF9A 4M45A 2XY5A 4TSXA 1QE1A 4DG1A 1BCMA 5DK5A 3V9UA 1WAJA 3OYMA 1WLJA 3TARA 1X9MA 3AV9A 3U3GA 1T8EA 4FLYA 4I7FA 4CJRA 1TL3A 2VG7A 1J9AA 2FBTA 4DS4A 4JS4A 4FJJA 3ZSVA 4B9VA 2ZD1A 3HSTB 3V1OA 4BWMA 4CHQA 1ZBHA 3IG1A 3EYZA 3C6TA 4CJWA 4FJ7A 5KRSA 2PYLA 1VSKA 3MEGA 4QCLA 1GOCA 3EZ5A 3U3YA 1QQCA 2B6AA 4FM2A 1ITGA 2Q3SA 3SJJA 3G10A 1ZYQA 4F3OA 3SI6A 1BHLA 4NYFA 4F8RA 4PY5A 1Z25A 4OGEA 3K5LA 4IG3A 4W5NA 2E6MA 5C24A 1FXXA 3OYIA 2ATQA 3FFIA 3MAQA 3TWHA 3L3VA 4KTWA 3NBPA 1L3SA 4DTMA 2OYQA 4B3OA 1TK5A 3QESA 1VSMA 4GMJB 3SQ4A 2IAJA 4KV8A 3SQ2A 3DM2A 4JS5A 1GOBA 3JSMA 2HHVA 3NF9A 5HRPA 3HPHA 4F4KA 3AVHA 4DTUA 4E1NA 1TK0A 2OZSA 3LP3A 3RRHA 4AHTA 4DWIA 1JLGA 3AA3A 2D0AA 1Y97A 4B08A 1G15A 5KGXA 4W5RA 4CJVA 3DLBA 1BL3A 4CJ4A 1RBTA 4M3TA 4AHRA 3F9KA 3LWMA 2QKKA 1BGXT 4CJSA 4DQRA 5J2PA 2KW4A 2YV0X 3L2QA 4DU3A 3LP1A 1HJRA 4Z4GA 2OPSA 4CJ5A 3KIOA 4KFBA 3LZIA 1CZBA 3LZJA 2OA8A 4CF2A 3KLGA 2EHGA 4CK1A 3I0RA 4M3ZA 2QK9A 2Z1IA 1IG9A 3SQ1A 2G8IA 3QEPA 4CESA 4KO0A 3V1QA 3TAPA 4FJXA 3HVTA 4KREA 4KHNA 1I39A 4DFMA 3NHGA 2I5JA 3TAGA 1QHTA 2WOMA 1WSFA 2WONA 4O4GA 4OVLA 3ZT4A 1I3AA 1LW2A 1WSGA 4EP5A 2P5GA 1EX4A 1GOAA 3QNNA 4AILC 3AVJA 4W5OA 1JLAA 1NK6A 1LW0A 3HL8A 3NF8A 1HQUA 1KSPA 3ZCMA 1Q8IA 4ELVA 1JKHA 4EZ6A 4W5TA 4PWDA 4FJGA 3LAMA 4FVMA 4CFAA 4NCAA 5E41A 1VSFA 3PX0A 1IKWA 2BDPA 4Z4EA 2F8TA 5HBMA 1C6VA 1B9DA 4DU1A 4DTOA 2NUBA 1T7PA 4CJUA 4H4OA 4HUEA 3PX4A 4CJEA 1Q9XA 1S9EA 2G8UA 3V1RA 1NKBA 1TV6A 4CHPA 3SUNA 4C8LA 2OZMA 4OLBA 4DTXA 4IFYA 1XI1A 4CGJA 4CF1A 3QO9A 1S5JA 3AVFA 4DSFA 4DTPA 3HK2A 3LAKA 4DMNA 4IFVA 4DTNA 1XHZA 4LH4A 3VQEA 1VSLA 2XHBA 1KLNA 4J2BA 1TAUA 4CK3A 4K8XA 4Z4IA 4C8OA 1D9FA 1DTQA 1BIZA 1YTAA 3ZT1A 4CFCA 5JS1A 5KI6A 1SL2A 4KB0A 1SKRA 4BWJA 3QIPA 2VWKA 3AVGA 4HVJA 4DTRA 3ZT0A 2Z1HA 3LPUA 4FXDA 4B8CA 1HNIA 4O0IA 4UQGA 5C25A 5HRSA 3RTVA 3TABA 1TGOA 4M42A 1BISA 3NH0A 1KTQA 1IKVA 4RW6A 2HMIA 4KI4A 2HHSA 4FJ9A 2G8HA 1RT6A 3OJUA 4GW6A 4IDKA 4CFDA 3VA3A 3AO2A 1IO2A 2KZZA 1REVA 3ZSQA 3DLHA 4CJ3A 2AJQA 1QSSA 3L2VA 1DTTA 2D0CA 1C1BA 4MQ3A 5KRTA 4FZXC 1YVUA 4CEQA 3VQ7A 3AVIA 2O4GA 2IC3A 5SZTA 5SWMA 4LD0A 1HNVA 3VQDA 3WNFA 4B8AB 1KVBA 3VQ9A 3OS1A 4CFBA 4HTUA 2G8WA 4FZZA 2GV9A 3RR7A 1X9WA 4CIEA 2KZMA 3NH1A 1C0MA 3KK3A 3RMBA 4Q0BA 3NAEA 4I2QA 1RBVA 3K5OA 3ZSWA 2IS3A 1HPZA 1IKXA 3LDSA 1NK4A 1TKXA 4RW4A 2HNYA 4N47A 4DSIA 1SKWA 4DU4A 4FYDA 3CFPA 3SUQA 4NYNA 3WNGA 1X9SA 2D0BA 4FLZA 3MECA 3LP0A 3V81A 2D5RA 3KLIA 1FKPA 4ID1A 1U47A 3O4NA 1RBSA 5CY4A 1XWLA 1VRTA 4DFKA 3V9SA 4E7LA 1SL1A 1S1TA 2YKMA 1WSJA 5FRNA 2KTQA 4CEAA 2PYJA 4E7KA 2KFNA 4N5SA 1JLBA 4FLTA 1U49A 4CF8A 2GBZA 2Z1JA 4Z0UA 3S3MA 3KTQA 1HYZA 5HROA 4KPYA 4CEEA 1NK7A 1B92A 4QAGA 4N76A 2X6SA 1NJYA 5T7BA 3HP9A 4CJFA 2IGIA 3DOKA 1VSEA 4KRFA 1EP4A 4G1QA 3RMCA 3KKRA 3OYFA 1N5YA 1U4BA 1RT1A 1A5VA 1SUQA 5J2QA 4Q5VA 3CG7A 4KB1A 1TL1A 4CEFA 1CXQA 3IS9A 4J2AA 1C1AA 3AA4A 4H4MA 1YTUA 4HUGA 2HVIA 1U04A 2Y1IA 5J2MA 4Y1CA 3SPZA 4CE9A 1CZ9A 4CERA 2DFFA 2YNFA 4DS5A 3K57A 1LWFA 2FBXA 3NF7A 1VSIA 4CCHA 3D0PA 1ASVA 3K5MA 1SL0A 4B9UA 1RNHA 3K5NA 1WSIA 3K2PA 4BE0A 5I3UA 1D9DA 3HO1A 4IBNA 4I9QA 2LSNA 4PQUA 3KJVA 4FM1A 4FW1A 3AVNA 3NGIA 3DRPA 4OLAA 4OPJA 1ASUA 3K58A 1NKCA 5J1EA 3RR8A 4M3YA 2RN2A 4GVMA 3PY8A 4ELUA 3OYCA 1WNSA 4Z4CA 3QEVA 4BDYA 4DQQA 2YNIA 3ALYA 4CK2A 2HHUA 2JLEA 1U45A 4RG8A 2X74A 1NJZA 4C8KA 1BI4B 1EETA 1S1XA 3L2UA 3QNOA 4CIFA 1RTDA 1SKSA 1VSHA 3VN5A 4CGGA 5J2NA 3ZSRA 3B6PA 1ZBUA 3VQ5A 4O44A 4DQIA 3MXMA 2BE2A 4YFUA 4JRQA 1LV5A 4J2DA 1QS4A 2XO7A 1HMVA 3M8SA 3TAFA 1WSHA 3MXIA 2O4IA 4IKFA 3LALA 1BQNA 3KLFA 4BACA 5FRMA 3B6OA 2VWJA 3OYAA 3TANA 5CYQA 3QLHA 1VRUA 2JGUA 4KI6A 4OKEA 3L2RA 3LPTA 1TK8A 4E19A 4KTZA 3L2WA 1NJXA 3QINA 4FK0A 1W0HA 2ZQBA 3C6UA 1O1WA 2Z1GA 3CFOA 5DMRA 5EU7A 1UAXA 5CZ1A 3HPGA 4I2PA 4FCYA 1RT4A 3TR8A 1CLQA 3DI6A 2P5OA 3NE6A 1LWCA 3HXMA 4DQSA 1QTMA 3DRRA 3E01A 4CGDA 4DQPA 4CJLA 2X78A 4CHNA 2XY7A 3TAQA 3RRGA 5HRNA 4FJLA 2HHTA 4DSKA 3P5JA 1Q9YA 3S3NA 1TKZA 1WSEA 3QEXA 4FJ8A 2DY4A 3SUOA 3AVLA 4B9MA 4M3WA 1C1CA 3HPOA 5D3GA 1CXUA 1BIUA 3VQ4A 2ZE2A 1HYSA 2VG5A 3UIQA 4LSNA 1IH7A 3NGZA 3OS0A 4CIGA 4HHTA 3T3FA 1D8YA 4B9LA 4DF4A 2HNZA 1J53A 1RBRA 3KK2A 5K14A 3L3UA 1HRHA 3QERA 3TAMA 3H08A 1RDDA 1NKEA 4B9TA 4K8ZA 2F8SA 2IOCA 3VQ6A 5C42A 3P1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4I A;  3O4Q A;  4MFB A;  1T03 A;  3S3O A;  3VQC A;  4RW7 A;  1SV5 A;  3PX6 A;  2YKN A;  3LAN A;  4FK4 A;  1UA0 A;  3G0Z A;  3OVN A;  1S1V A;  1IKY A;  1EXQ A;  4FLV A;  3QEW A;  3SV3 A;  4E7J A;  3TAE A;  1UA1 A;  3DLK A;  3ISN C;  1WAF A;  3QEI A;  1C0T A;  3HJF A;  3AVA A;  4PUO A;  4FM0 A;  1MU2 A;  2XY8 A;  2HVH A;  3JYT A;  3T1A A;  1NOZ A;  3OS2 A;  1KRP A;  4M3X A;  3CM5 A;  3KLH A;  3SYZ A;  1ZBL A;  1K6Y A;  4AHU A;  4H8K A;  1RTJ A;  1RTI A;  4FZY A;  1EKE A;  3AVK A;  4YNQ A;  4DLG A;  1NOY A;  4RW8 A;  4F2S A;  1Z26 A;  1A5W A;  1BQM A;  4DTJ A;  4KHW A;  4CHZ A;  3MED A;  4DFP A;  3SNN A;  2R7Y A;  4AHV A;  4E1M A;  2PY5 A;  3PO4 A;  3VA0 A;  4HCC A;  3V9W A;  1KFS A;  4ICL A;  4PA1 A;  2QXF A;  4CEZ A;  3HT3 A;  1KCF A;  4BDP A;  1NK0 A;  2F96 A;  3AO3 A;  3AVB A;  3QET A;  3IRX A;  1U48 A;  4R5P A;  1JXE A;  1KVA A;  3D45 A;  3NDK A;  3O3G A;  3NGY A;  2EX3 A;  1BI4 A;  1VK0 A;  3DOL A;  2HB5 A;  5FRO A;  3ZSZ A;  3OY9 A;  5HP1 A;  1ASW A;  1TKT A;  3V9Z A;  3S9H A;  4CGH A;  3OYH A;  3O3H A;  5HLF A;  4OGC A;  3BDP A;  4JRP A;  3SV4 A;  4ZTF A;  1L3T A;  4B9N A;  4KAZ A;  3ZSX A;  4HUF A;  2DTU A;  4Z4H A;  2KQ2 A;  4AHC A;  4CHO A;  2P51 A;  3CM6 A;  4KHU A;  3OYD A;  4OPK A;  2HHQ A;  3CYM A;  4LSL A;  3ULD A;  2G8F A;  4E0D A;  3NFA A;  3M8P A;  1A5X A;  1VSJ A;  3VQA A;  5KTQ A;  3OYL A;  3HM9 A;  3SQ0 A;  3VQP A;  4NCB A;  3WNE A;  1LWE A;  1FKO A;  4Y1D A;  2HW3 A;  1HYV A;  1D5A A;  3VQB A;  3DMJ A;  1RT7 A;  1KLM A;  4DLE A;  4E3S A;  4FJM A;  3QIO A;  4F2R A;  1J5O A;  4E89 A;  3I8D A;  4DSJ A;  4L8R B;  1J54 A;  4ZHR A;  1L5U A;  3VQ8 A;  4CEO A;  4O5B A;  4C8N A;  1ZBF A;  2E4L A;  2P1J A;  3AO5 A;  3ITH A;  5HRR A;  3ZT3 A;  4CGF A;  4CHY A;  2G8V A;  4RW9 A;  1KVC A;  1R0A A;  3ZSO A;  4KHQ A;  3V9X A;  2HHW A;  4BDZ A;  4WE1 A;  4KKO A;  5CZ2 A;  2XY6 A;  4M3R A;  3KK1 A;  4DSL A;  1LAV A;  4DFJ A;  4I9L A;  5KGW A;  1RDA A;  4XIU A;  3P83 D;  4FJK A;  4CJK A;  4KHS A;  1QSY A;  4N41 A;  2ETJ A;  3ASM A;  2RKI A;  1C0U A;  3T19 A;  3PV8 A;  3OYE A;  4W5Q A;  3PUF A;  1JLQ A;  2GUI A;  3I0S A;  1ZBI A;  4FK2 A;  1S1U A;  4JLH A;  4Z4F A;  1NK8 A;  2BAN A;  3L8B A;  1HQE A;  1S6P A;  3MEE A;  4ID5 A;  2ITG A;  4FW2 A;  4C8M A;  4CJT A;  5JS2 A;  1TKD A;  2G8K A;  4M3U A;  1JLE A;  4CJQ A;  3NCI A;  4AH9 A;  3KKS A;  3VQQ A;  1NK5 A;  1L3U A;  4CF0 A;  1TVR A;  3AA5 X;  4E7I A;  1RT2 A;  2FC0 A;  4DSE A;  1N6Q A;  3MXJ A;  3SCX A;  3HP6 A;  4EZ9 A;  3ZSY A;  5I42 A;  1X1P A;  2HHX A;  2KFZ A;  1QSL A;  3C95 A;  2IDO A;  2YHA A;  3A2F A;  1UOC A;  1WN7 A;  2E6L A;  2A1R A;  4M41 A;  1RT3 A;  4FJI A;  4KTQ A;  3AVM A;  3OYG A;  3RMD A;  1NK9 A;  4O0J A;  4FLU A;  1RCH A;  4FLW A;  3AO4 A;  3HVR A;  3CFR A;  3C94 A;  3AVC A;  1FK9 A;  2DFH A;  5CYM A;  4OJR A;  3IAY A;  3RMA A;  4B9S A;  3OYN A;  4OKK A;  2B4J A;  1RBU A;  3NF6 A;  1JLF A;  4CGI A;  4CED A;  1KFD A;  1JL1 A;  3KLE A;  3KD1 E;  1UWB A;  2B5J A;  4BE1 A;  3U6F A;  3THV A;  2RPI A;  4QOZ B;  3F73 A;  3AO1 A;  1B9F A;  3CQ8 A;  4NCG A;  3K59 A;  4DF8 A;  3TI0 A;  2QKB A;  1JL2 A;  3LP2 A;  1RT5 A;  1YT3 A;  4CEB A;  4CJP A;  4CEC A;  1XHX A;  2XRI A;  3DRS A;  3WNH A;  1S9G A;  1LAW A;  3V6D A;  1XC9 A;  1DLO A;  1BCO A;  3DLG A;  4AHS A;  4EP4 A;  3SPY A;  1RIL A;  2A1S A;  4J2E A;  1S1W A;  1TAQ A;  4LY7 A;  1L3V A;  3DLR A;  3OYK A;  3NH2 A;  1NJW A;  3EY1 A;  3DLE A;  4ELT A;  2X6N A;  2FBV A;  1JLC A;  4O55 A;  4KHY A;  2OPQ A;  2VG6 A;  4E7H A;  2W42 A;  4FJ5 A;  1VSD A;  4IG0 A;  4OKJ A;  2BGG A;  4LH5 A;  4F3T A;  1JXB A;  4DTS A;  4FJN A;  3M8Q A;  1RDB A;  3O3F A;  2HND A;  1T05 A;  2FBY A;  1F21 A;  3OYJ A;  3BGR A;  2PZS A;  1RTH A;  3RWU A;  3M8R A;  3ZT2 A;  4N56 A;  3OJS A;  2DFE A;  2YHB A;  4FLX A;  3SZ2 A;  3SUP A;  4ZTJ A;  4BE2 A;  2YNG A;  4FJH A;  4HCB A;  2OPP A;  3DYA A;  2YNH A;  3HYF A;  2OPR A;  1RDC A;  3OYB A;  3PO5 A;  3LWL A;  1S6Q A;  5FDL A;  2RF2 A;  3AA2 A;  2Y1J A;  1W9H A;  3KD5 E;  4CF9 A;  4M45 A;  2XY5 A;  4TSX A;  1QE1 A;  4DG1 A;  1BCM A;  5DK5 A;  3V9U A;  1WAJ A;  3OYM A;  1WLJ A;  3TAR A;  1X9M A;  3AV9 A;  3U3G A;  1T8E A;  4FLY A;  4I7F A;  4CJR A;  1TL3 A;  2VG7 A;  1J9A A;  2FBT A;  4DS4 A;  4JS4 A;  4FJJ A;  3ZSV A;  4B9V A;  2ZD1 A;  3HST B;  3V1O A;  4BWM A;  4CHQ A;  1ZBH A;  3IG1 A;  3EYZ A;  3C6T A;  4CJW A;  4FJ7 A;  5KRS A;  2PYL A;  1VSK A;  3MEG A;  4QCL A;  1GOC A;  3EZ5 A;  3U3Y A;  1QQC A;  2B6A A;  4FM2 A;  1ITG A;  2Q3S A;  3SJJ A;  3G10 A;  1ZYQ A;  4F3O A;  3SI6 A;  1BHL A;  4NYF A;  4F8R A;  4PY5 A;  1Z25 A;  4OGE A;  3K5L A;  4IG3 A;  4W5N A;  2E6M A;  5C24 A;  1FXX A;  3OYI A;  2ATQ A;  3FFI A;  3MAQ A;  3TWH A;  3L3V A;  4KTW A;  3NBP A;  1L3S A;  4DTM A;  2OYQ A;  4B3O A;  1TK5 A;  3QES A;  1VSM A;  4GMJ B;  3SQ4 A;  2IAJ A;  4KV8 A;  3SQ2 A;  3DM2 A;  4JS5 A;  1GOB A;  3JSM A;  2HHV A;  3NF9 A;  5HRP A;  3HPH A;  4F4K A;  3AVH A;  4DTU A;  4E1N A;  1TK0 A;  2OZS A;  3LP3 A;  3RRH A;  4AHT A;  4DWI A;  1JLG A;  3AA3 A;  2D0A A;  1Y97 A;  4B08 A;  1G15 A;  5KGX A;  4W5R A;  4CJV A;  3DLB A;  1BL3 A;  4CJ4 A;  1RBT A;  4M3T A;  4AHR A;  3F9K A;  3LWM A;  2QKK A;  1BGX T;  4CJS A;  4DQR A;  5J2P A;  2KW4 A;  2YV0 X;  3L2Q A;  4DU3 A;  3LP1 A;  1HJR A;  4Z4G A;  2OPS A;  4CJ5 A;  3KIO A;  4KFB A;  3LZI A;  1CZB A;  3LZJ A;  2OA8 A;  4CF2 A;  3KLG A;  2EHG A;  4CK1 A;  3I0R A;  4M3Z A;  2QK9 A;  2Z1I A;  1IG9 A;  3SQ1 A;  2G8I A;  3QEP A;  4CES A;  4KO0 A;  3V1Q A;  3TAP A;  4FJX A;  3HVT A;  4KRE A;  4KHN A;  1I39 A;  4DFM A;  3NHG A;  2I5J A;  3TAG A;  1QHT A;  2WOM A;  1WSF A;  2WON A;  4O4G A;  4OVL A;  3ZT4 A;  1I3A A;  1LW2 A;  1WSG A;  4EP5 A;  2P5G A;  1EX4 A;  1GOA A;  3QNN A;  4AIL C;  3AVJ A;  4W5O A;  1JLA A;  1NK6 A;  1LW0 A;  3HL8 A;  3NF8 A;  1HQU A;  1KSP A;  3ZCM A;  1Q8I A;  4ELV A;  1JKH A;  4EZ6 A;  4W5T A;  4PWD A;  4FJG A;  3LAM A;  4FVM A;  4CFA A;  4NCA A;  5E41 A;  1VSF A;  3PX0 A;  1IKW A;  2BDP A;  4Z4E A;  2F8T A;  5HBM A;  1C6V A;  1B9D A;  4DU1 A;  4DTO A;  2NUB A;  1T7P A;  4CJU A;  4H4O A;  4HUE A;  3PX4 A;  4CJE A;  1Q9X A;  1S9E A;  2G8U A;  3V1R A;  1NKB A;  1TV6 A;  4CHP A;  3SUN A;  4C8L A;  2OZM A;  4OLB A;  4DTX A;  4IFY A;  1XI1 A;  4CGJ A;  4CF1 A;  3QO9 A;  1S5J A;  3AVF A;  4DSF A;  4DTP A;  3HK2 A;  3LAK A;  4DMN A;  4IFV A;  4DTN A;  1XHZ A;  4LH4 A;  3VQE A;  1VSL A;  2XHB A;  1KLN A;  4J2B A;  1TAU A;  4CK3 A;  4K8X A;  4Z4I A;  4C8O A;  1D9F A;  1DTQ A;  1BIZ A;  1YTA A;  3ZT1 A;  4CFC A;  5JS1 A;  5KI6 A;  1SL2 A;  4KB0 A;  1SKR A;  4BWJ A;  3QIP A;  2VWK A;  3AVG A;  4HVJ A;  4DTR A;  3ZT0 A;  2Z1H A;  3LPU A;  4FXD A;  4B8C A;  1HNI A;  4O0I A;  4UQG A;  5C25 A;  5HRS A;  3RTV A;  3TAB A;  1TGO A;  4M42 A;  1BIS A;  3NH0 A;  1KTQ A;  1IKV A;  4RW6 A;  2HMI A;  4KI4 A;  2HHS A;  4FJ9 A;  2G8H A;  1RT6 A;  3OJU A;  4GW6 A;  4IDK A;  4CFD A;  3VA3 A;  3AO2 A;  1IO2 A;  2KZZ A;  1REV A;  3ZSQ A;  3DLH A;  4CJ3 A;  2AJQ A;  1QSS A;  3L2V A;  1DTT A;  2D0C A;  1C1B A;  4MQ3 A;  5KRT A;  4FZX C;  1YVU A;  4CEQ A;  3VQ7 A;  3AVI A;  2O4G A;  2IC3 A;  5SZT A;  5SWM A;  4LD0 A;  1HNV A;  3VQD A;  3WNF A;  4B8A B;  1KVB A;  3VQ9 A;  3OS1 A;  4CFB A;  4HTU A;  2G8W A;  4FZZ A;  2GV9 A;  3RR7 A;  1X9W A;  4CIE A;  2KZM A;  3NH1 A;  1C0M A;  3KK3 A;  3RMB A;  4Q0B A;  3NAE A;  4I2Q A;  1RBV A;  3K5O A;  3ZSW A;  2IS3 A;  1HPZ A;  1IKX A;  3LDS A;  1NK4 A;  1TKX A;  4RW4 A;  2HNY A;  4N47 A;  4DSI A;  1SKW A;  4DU4 A;  4FYD A;  3CFP A;  3SUQ A;  4NYN A;  3WNG A;  1X9S A;  2D0B A;  4FLZ A;  3MEC A;  3LP0 A;  3V81 A;  2D5R A;  3KLI A;  1FKP A;  4ID1 A;  1U47 A;  3O4N A;  1RBS A;  5CY4 A;  1XWL A;  1VRT A;  4DFK A;  3V9S A;  4E7L A;  1SL1 A;  1S1T A;  2YKM A;  1WSJ A;  5FRN A;  2KTQ A;  4CEA A;  2PYJ A;  4E7K A;  2KFN A;  4N5S A;  1JLB A;  4FLT A;  1U49 A;  4CF8 A;  2GBZ A;  2Z1J A;  4Z0U A;  3S3M A;  3KTQ A;  1HYZ A;  5HRO A;  4KPY A;  4CEE A;  1NK7 A;  1B92 A;  4QAG A;  4N76 A;  2X6S A;  1NJY A;  5T7B A;  3HP9 A;  4CJF A;  2IGI A;  3DOK A;  1VSE A;  4KRF A;  1EP4 A;  4G1Q A;  3RMC A;  3KKR A;  3OYF A;  1N5Y A;  1U4B A;  1RT1 A;  1A5V A;  1SUQ A;  5J2Q A;  4Q5V A;  3CG7 A;  4KB1 A;  1TL1 A;  4CEF A;  1CXQ A;  3IS9 A;  4J2A A;  1C1A A;  3AA4 A;  4H4M A;  1YTU A;  4HUG A;  2HVI A;  1U04 A;  2Y1I A;  5J2M A;  4Y1C A;  3SPZ A;  4CE9 A;  1CZ9 A;  4CER A;  2DFF A;  2YNF A;  4DS5 A;  3K57 A;  1LWF A;  2FBX A;  3NF7 A;  1VSI A;  4CCH A;  3D0P A;  1ASV A;  3K5M A;  1SL0 A;  4B9U A;  1RNH A;  3K5N A;  1WSI A;  3K2P A;  4BE0 A;  5I3U A;  1D9D A;  3HO1 A;  4IBN A;  4I9Q A;  2LSN A;  4PQU A;  3KJV A;  4FM1 A;  4FW1 A;  3AVN A;  3NGI A;  3DRP A;  4OLA A;  4OPJ A;  1ASU A;  3K58 A;  1NKC A;  5J1E A;  3RR8 A;  4M3Y A;  2RN2 A;  4GVM A;  3PY8 A;  4ELU A;  3OYC A;  1WNS A;  4Z4C A;  3QEV A;  4BDY A;  4DQQ A;  2YNI A;  3ALY A;  4CK2 A;  2HHU A;  2JLE A;  1U45 A;  4RG8 A;  2X74 A;  1NJZ A;  4C8K A;  1BI4 B;  1EET A;  1S1X A;  3L2U A;  3QNO A;  4CIF A;  1RTD A;  1SKS A;  1VSH A;  3VN5 A;  4CGG A;  5J2N A;  3ZSR A;  3B6P A;  1ZBU A;  3VQ5 A;  4O44 A;  4DQI A;  3MXM A;  2BE2 A;  4YFU A;  4JRQ A;  1LV5 A;  4J2D A;  1QS4 A;  2XO7 A;  1HMV A;  3M8S A;  3TAF A;  1WSH A;  3MXI A;  2O4I A;  4IKF A;  3LAL A;  1BQN A;  3KLF A;  4BAC A;  5FRM A;  3B6O A;  2VWJ A;  3OYA A;  3TAN A;  5CYQ A;  3QLH A;  1VRU A;  2JGU A;  4KI6 A;  4OKE A;  3L2R A;  3LPT A;  1TK8 A;  4E19 A;  4KTZ A;  3L2W A;  1NJX A;  3QIN A;  4FK0 A;  1W0H A;  2ZQB A;  3C6U A;  1O1W A;  2Z1G A;  3CFO A;  5DMR A;  5EU7 A;  1UAX A;  5CZ1 A;  3HPG A;  4I2P A;  4FCY A;  1RT4 A;  3TR8 A;  1CLQ A;  3DI6 A;  2P5O A;  3NE6 A;  1LWC A;  3HXM A;  4DQS A;  1QTM A;  3DRR A;  3E01 A;  4CGD A;  4DQP A;  4CJL A;  2X78 A;  4CHN A;  2XY7 A;  3TAQ A;  3RRG A;  5HRN A;  4FJL A;  2HHT A;  4DSK A;  3P5J A;  1Q9Y A;  3S3N A;  1TKZ A;  1WSE A;  3QEX A;  4FJ8 A;  2DY4 A;  3SUO A;  3AVL A;  4B9M A;  4M3W A;  1C1C A;  3HPO A;  5D3G A;  1CXU A;  1BIU A;  3VQ4 A;  2ZE2 A;  1HYS A;  2VG5 A;  3UIQ A;  4LSN A;  1IH7 A;  3NGZ A;  3OS0 A;  4CIG A;  4HHT A;  3T3F A;  1D8Y A;  4B9L A;  4DF4 A;  2HNZ A;  1J53 A;  1RBR A;  3KK2 A;  5K14 A;  3L3U A;  1HRH A;  3QER A;  3TAM A;  3H08 A;  1RDD A;  1NKE A;  4B9T A;  4K8Z A;  2F8S A;  2IOC A;  3VQ6 A;  5C42 A;  3P1G A; 
#chains in the Genus database with same CATH topology
 2P9K B;  4BR2 A;  4YDU A;  1T03 A;  4BY9 C;  1XMQ K;  3QIC A;  1UA0 A;  3HOT A;  3UE5 A;  3TAE A;  3PLA A;  3CC7 N;  1C0T A;  3HJF A;  1MU2 A;  2XY8 A;  4G9Z A;  3MWT A;  3JYT A;  4M3X A;  3CM5 A;  3SYZ A;  1ZBL A;  4H8K A;  4YNQ A;  1KQS M;  3H1Q A;  1BQM A;  4CHZ A;  2R7Y A;  3CQX A;  4JI8 K;  4CEZ A;  4PA1 A;  2CGL A;  3AO3 A;  3AVB A;  4R5P A;  1NGH A;  3D45 A;  2EX3 A;  1VK0 A;  3DOL A;  3FZF A;  5FRO A;  3ZET A;  4HWI A;  1ASW A;  3V9Z A;  2QWO A;  4CGH A;  5TKY A;  3BDP A;  2IVN A;  2YJF A;  3SV4 A;  4ZTF A;  4B9N A;  2DTU A;  1VQP N;  2GEL A;  2E20 A;  5BRH A;  2P51 A;  2P9U B;  3CM6 A;  3ULD A;  2G8F A;  1A5X A;  1VSJ A;  3HM9 A;  4NCB A;  3WNE A;  4YHH K;  4B3M K;  5M1N A;  3LDO A;  1D5A A;  1RT7 A;  3QB0 A;  1KLM A;  3MMV A;  4BRF A;  4FJM A;  4L8R B;  1L5U A;  3VQ8 A;  4CGF A;  1ZBF A;  5HRR A;  2G8V A;  4CHY A;  1R0A A;  3ZSO A;  4BDZ A;  4WE1 A;  5CZ2 A;  4JYA K;  4M3R A;  4A2A A;  2UUC K;  4B1W B;  5KGW A;  3MN6 A;  4FJK A;  4CJK A;  1NGD A;  2ETJ A;  2FSK A;  1C0U A;  4H0Y B;  4JKD A;  1JLQ A;  2E8A A;  3LM2 A;  1X3M A;  4Z4F A;  4A59 A;  1YF5 L;  2QXL A;  4C8M A;  2G8K A;  3ID8 A;  1DT9 A;  1GLF O;  1TKD A;  4PL7 A;  3NCI A;  3KKS A;  4CF0 A;  2FC0 A;  4DSE A;  1N6Q A;  2D4W A;  3HP6 A;  4EZ9 A;  3C7N B;  3CET A;  4FSV A;  2A1R A;  4KTQ A;  1RT3 A;  4MLH A;  3AO4 A;  4BGA A;  4JI1 K;  5CYM A;  3CFR A;  3RMA A;  4OKK A;  5EXW A;  2B4J A;  2D0O A;  1UWB A;  3EN9 A;  4IXC A;  2CGJ A;  4JD2 A;  3F73 A;  3AO1 A;  1E4G T;  5AQW A;  1XHX A;  1U6Z A;  4K25 A;  1ZBS A;  3FR0 A;  3TSU A;  3V6D A;  3SPY A;  4EP4 A;  3DLG A;  3T1H K;  1S1W A;  4JI0 K;  1OH5 A;  4ELT A;  3NH2 A;  1VAZ A;  2X6N A;  2O8E A;  1O13 A;  2QEX N;  2FF6 A;  1DEJ A;  3O3F A;  5F1X A;  5EX5 A;  3OYJ A;  3BGR A;  1RTH A;  4DR1 K;  3ZT2 A;  2ASM A;  4FJH A;  3DYA A;  3R8E A;  2D1K A;  1S6Q A;  2RF2 A;  1W9H A;  3CCV N;  3C7N A;  4O8U A;  5AQF A;  3V9U A;  1WAJ A;  3JXU A;  1VHX A;  4FLY A;  1NBW A;  1WUA A;  1W7A A;  4NO7 A;  3IDH A;  4CHQ A;  3VES A;  3EYZ A;  4FJ7 A;  2PYL A;  4NLB A;  1VSK A;  2I7P A;  1GLA G;  3MEG A;  5AQI A;  3GE1 A;  3EZ5 A;  3U3Y A;  1ITG A;  4MDB A;  4F3O A;  2HMP A;  5BN8 A;  5FPD A;  4IG3 A;  1YI2 N;  2QWN A;  2QM1 A;  3QFU A;  3L3V A;  5KQ8 A;  1MDU B;  2W40 A;  4KV8 A;  3SQ2 A;  3DM2 A;  4JS5 A;  4F4K A;  4DTU A;  3ENO A;  1KAZ A;  2D0P A;  3LL3 A;  4DWI A;  3RRH A;  4AHT A;  3J7Z O;  3AA3 A;  2D0A A;  4DV3 K;  3DLB A;  5AQY A;  4M3T A;  4AHR A;  2QKK A;  1BGX T;  3BUZ B;  2KW4 A;  4BC4 A;  2WFB A;  4CJ5 A;  1CZB A;  2EHG A;  3FZM A;  4CK1 A;  1YIT N;  3QML A;  4RCH A;  3SQ1 A;  2G8I A;  3QEP A;  3SAF A;  4FJX A;  3HVT A;  4B3T K;  3TAG A;  4WF9 L;  2WON A;  1I3A A;  3O9T A;  3TSQ A;  4EP5 A;  1GOA A;  3QNN A;  5M1K A;  3MK6 A;  2PAV A;  1EWQ A;  4W5O A;  4NB4 A;  5E84 A;  3NF8 A;  3VGM A;  4IO8 A;  1HQU A;  3ZCM A;  1Q8I A;  1W2B M;  3MCP A;  4W5T A;  4H5V A;  4FJG A;  3LAM A;  3MX5 A;  3CF5 L;  1XQS C;  5E41 A;  2BDP A;  4JKF A;  1NU0 A;  4H4O A;  1BA1 A;  4ILJ A;  5M1O A;  3V1R A;  1TV6 A;  1RGI A;  3I55 N;  1BOT O;  3O1B A;  4IFY A;  1N33 K;  4CGJ A;  4DTP A;  3LAK A;  3J80 O;  4IFV A;  2PFU A;  2RHK A;  1KAY A;  5AJ3 K;  2XHB A;  2IVO A;  4C8O A;  4CFC A;  2E2N A;  1SL2 A;  4BWJ A;  3AVG A;  4XH1 A;  4HVJ A;  4XH5 A;  3R9P A;  3P4I A;  4M42 A;  1BIS A;  1KTQ A;  2HHS A;  4RW6 A;  1RT6 A;  3OJU A;  1WBD A;  3L0Q A;  3VA3 A;  3MWP A;  1REV A;  2AJQ A;  1QSS A;  5HOO A;  4CEQ A;  3WXK A;  3VQ7 A;  2O4G A;  5SZT A;  5SWM A;  1VQ8 N;  1C0G A;  4JI3 K;  5F2R A;  3ZYY X;  2G8W A;  3MDQ A;  4FZZ A;  2GV9 A;  4JD2 B;  2KZM A;  3NH1 A;  3RMB A;  3NAE A;  4I2Q A;  1NK4 A;  5JIC A;  4RW4 A;  5IWA K;  4DSI A;  3W3D A;  4DU4 A;  4FYD A;  5BN9 A;  3ENB A;  2D0B A;  1ZC6 A;  4DR7 K;  3WEE A;  2D5R A;  3KLI A;  4ID1 A;  1NWK A;  4NXN K;  2NNW A;  1HUX A;  4IJA A;  1SL1 A;  1VRT A;  5LMU K;  4E7L A;  5BPL A;  3NVM A;  1Q18 A;  2KFN A;  5GAD P;  1LCU A;  2JWK A;  1GLD G;  3D2E B;  1NGE A;  3S3M A;  4XH4 A;  3KTQ A;  3JS6 A;  4KPY A;  4CEE A;  3R1X A;  1YJW N;  1NK7 A;  1Z05 A;  5GAE P;  5T7B A;  3HP9 A;  3TPQ A;  2WBN A;  1EP4 A;  4G1Q A;  2O8C A;  1RT1 A;  4Q5V A;  1TL1 A;  4CEF A;  3WQU A;  1E3M A;  4H4M A;  4HUG A;  4Y0W A;  4CE9 A;  3CHW A;  4CER A;  1IBL K;  2DFF A;  4DS5 A;  3EE8 A;  4H0T B;  1VSI A;  3ULE B;  4JN4 A;  4LF9 K;  4I9Q A;  5AQS A;  3VPZ A;  4WYB A;  4PQU A;  3KJV A;  4FM1 A;  1BDG A;  3A5O C;  1NMD A;  2RN2 A;  3QEV A;  4DQQ A;  4CD1 A;  1NJZ A;  2X74 A;  1EET A;  1RDU A;  5AQR A;  2P9L A;  3HI0 A;  3NVK A;  3VF2 A;  5J2N A;  3VQ5 A;  4O44 A;  1NJI O;  3EE9 A;  3MXM A;  4GKJ K;  4JRQ A;  1C0F A;  2GEM A;  2ITM A;  1HMV A;  1BQN A;  3GDQ A;  3KLF A;  3SAH A;  3B6O A;  2VWJ A;  4CBX A;  5JMV A;  2JGU A;  3L2R A;  4V19 S;  1TK8 A;  4E19 A;  2Q2R A;  1VQ7 N;  1Q81 O;  4JV5 K;  2FSJ A;  3SBT A;  3HPG A;  1T6C A;  2P9K A;  1NGC A;  5AQL A;  3DI6 A;  2P5O A;  1LWC A;  4FOE A;  4WFB L;  3HXM A;  4BVO A;  4DQS A;  3E01 A;  4CJL A;  2X78 A;  3RRG A;  2HHT A;  5HRN A;  3J7A P;  4DSK A;  3P5J A;  1Q9Y A;  5DM7 L;  1TKZ A;  3QEX A;  2QWP A;  3OA9 A;  2BH1 A;  3HPO A;  2A3Z A;  4I6M B;  1CXU A;  5E26 A;  3VQ4 A;  1IV0 A;  3LDP A;  2ZE2 A;  1KC8 O;  2VG5 A;  1GLJ O;  3UIQ A;  3T3F A;  3NGZ A;  4B9L A;  4CIG A;  4DF4 A;  5AQQ A;  1QVG M;  3L3U A;  3QER A;  3TAM A;  1CZA N;  5EVZ A;  5KPZ A;  5AQO A;  4X66 K;  3CJ9 A;  3VQC A;  1VQM N;  1S1V A;  1IKY A;  4EIA A;  4FLV A;  4E7J A;  3DLK A;  4M63 C;  3AVA A;  4PUO A;  1NMN A;  3CCL N;  2JWL A;  3KLH A;  1K6Y A;  3IFR A;  4F2S A;  4DLG A;  4YDU C;  1NOY A;  1Z26 A;  1A5W A;  3AGK A;  4R79 A;  2ZGZ A;  4BR9 A;  3MED A;  4DFP A;  1VQK N;  4HCC A;  4AHV A;  1QQM A;  2PY5 A;  3VA0 A;  3VEX A;  4BDP A;  1QHA A;  1E4F T;  5LJV A;  3NDK A;  3THW B;  1BI4 A;  2HB5 A;  3ZSZ A;  3IMX A;  4BG8 A;  5M1F A;  1TKT A;  3S9H A;  2KKZ A;  3E9O A;  4OPH A;  3EEQ A;  3TTC A;  3M6G A;  4KAZ A;  3DXM A;  3ZSX A;  4HUF A;  3MN9 A;  4Z4H A;  1VQ9 N;  4AHC A;  4CHO A;  5BRD A;  4CVN E;  3TSP A;  3H3N O;  4LSL A;  2ZJP L;  4E0D A;  2ASP A;  3M8P A;  5KTQ A;  3VQA A;  2HW3 A;  3JAM O;  3VQB A;  3DMJ A;  2P9U A;  1K9M O;  4H5N A;  5C10 A;  2V7Z A;  3QIO A;  4F2R A;  1J5O A;  3I8D A;  3U9Z A;  1HJO A;  3ZT3 A;  3AO5 A;  3ITH A;  4RW9 A;  1KVC A;  3V9X A;  2HHW A;  4BRK A;  4IO9 L;  3O9R A;  4I9L A;  1FJG K;  4XIU A;  4KHS A;  4N41 A;  4KBO A;  3D6R A;  3PV8 A;  3PUF A;  2GUI A;  3I0S A;  4JLH A;  5LY3 A;  2BAN A;  4ID5 A;  2F9W A;  2ITG A;  1K8K A;  4CJT A;  5JS2 A;  3BF3 A;  4M3U A;  1JLE A;  3WXL A;  4CJQ A;  3I8B A;  3D2F B;  5GAG P;  2O8B A;  3O4W A;  2ZM6 K;  3U4L A;  3HM8 A;  3L4I A;  5AQM A;  3VEV A;  4A5A A;  3LDL A;  3O1W A;  4H5W A;  4BR0 A;  2YHA A;  4ILG B;  3RMD A;  4FLU A;  1RCH A;  4FLW A;  3HVR A;  4CZJ A;  1FK9 A;  3AVC A;  3IAY A;  3NF6 A;  1RBU A;  4CGI A;  4IDH A;  1JL1 A;  2ZJQ L;  4BE1 A;  4H0P A;  1S3X A;  4NCG A;  3K59 A;  1EQY A;  2QKB A;  1JL2 A;  4NXM K;  1YT3 A;  4EAH D;  4JEP A;  2QWQ A;  1J5E K;  4FWN A;  4MO4 A;  4AHS A;  1RIL A;  2A1S A;  4J2E A;  4X64 K;  1TAQ A;  2W6L A;  4LY7 A;  4A5B A;  1NJW A;  3DLE A;  5C12 A;  4JI6 K;  4O55 A;  4OKJ A;  3CCU N;  4DV1 K;  2BGG A;  4LH5 A;  4F3T A;  3KK7 A;  4DTS A;  4FJN A;  1RDB A;  2NRR A;  2Q36 A;  3THW A;  4BVP A;  2QWL A;  3ID6 A;  1F21 A;  3I33 A;  2PZS A;  4LFA K;  1HKB A;  2DFE A;  2YHB A;  4BE2 A;  2YNG A;  5JLH A;  4BC3 A;  5H1S Q;  3UKU A;  1RDC A;  3PO5 A;  2Q31 A;  4Z94 A;  2Y1J A;  4M45 A;  2V52 B;  1X9M A;  3R6M A;  1DKG D;  3U3G A;  1T8E A;  1QQO A;  1BU6 O;  1TL3 A;  3OHR A;  5CHI A;  2FBT A;  4FJJ A;  3WEE B;  3ZSV A;  4B9V A;  3V1O A;  4JI4 K;  4JKH A;  1N36 K;  1ZBH A;  2A6A A;  4CJW A;  5KRS A;  1GOC A;  4O8K A;  4WFA L;  4FM2 A;  3DXK A;  2Q3S A;  3SJJ A;  1HNX K;  3G10 A;  1ZYQ A;  2F7T A;  1BHL A;  4NYF A;  4PY5 A;  2NRT A;  3K5L A;  4W5N A;  2E6M A;  3DWL A;  3W0L A;  3FFI A;  3MAQ A;  4KTW A;  4DTM A;  1TK5 A;  1VSM A;  1V4T A;  2IAJ A;  5DM6 L;  2O8F A;  5HRP A;  3HPH A;  4RTF D;  3LM9 A;  1Q7Y O;  1TK0 A;  2P9S A;  2OZS A;  3LP3 A;  4BRI A;  3MCA B;  1NGB A;  4CJV A;  4L3Q A;  4CJ4 A;  1RBT A;  5J2P A;  2CH5 A;  3OW2 M;  3LP1 A;  5LJW A;  1ATR A;  3AGR A;  3UB5 A;  5AQT A;  5ADX H;  3R3L A;  4CF2 A;  4M3Z A;  3J7Y P;  3SLC A;  1WB9 A;  3H6E A;  1IG9 A;  5BRE A;  5AQK A;  5GIO A;  4IEE A;  3EL2 A;  1I39 A;  4DFM A;  2I5J A;  1QHT A;  4O4G A;  4RWT A;  1NGA A;  5C2F A;  3AVJ A;  4LF5 K;  3D2F A;  3HL8 A;  3M3Z A;  4JI7 K;  3VF4 A;  1ATN A;  4ILH A;  3THX B;  3PX0 A;  3TTD A;  3SK3 A;  2NUB A;  3N4Q A;  4CJE A;  1NKB A;  4CHP A;  3KVG A;  4DTX A;  2QWM A;  3EZW A;  1S5J A;  3CCS N;  3VGL A;  1XHZ A;  4LH4 A;  1VSL A;  3E9L A;  5AZI B;  3FFK B;  4K8X A;  3CCR N;  1VQ5 N;  2OAN A;  1BIZ A;  2OCE A;  4KB0 A;  1JJ2 M;  4DV2 K;  2Z1H A;  3BF1 A;  5AQG A;  1HNI A;  4UQG A;  5HRS A;  5FPM A;  3TAB A;  3NMU A;  1Z6R A;  3SBG A;  3NH0 A;  4KI4 A;  2FLO A;  4H03 B;  4HTL A;  4GW6 A;  4OO1 J;  2KZZ A;  4BGB A;  3ZSQ A;  4ISE A;  3FZL A;  3CCJ N;  5AQH A;  1DTT A;  2D0C A;  1YVU A;  5AZI A;  3AVI A;  4YOT A;  3K0S A;  4KH4 A;  4H0V B;  1HNV A;  3VQD A;  3WNF A;  3OS1 A;  4CFB A;  4HTU A;  3FE1 A;  4CIE A;  3LDQ A;  1C0M A;  3QBW A;  1RBV A;  3ZSW A;  3Q7C A;  3UKR B;  1IKX A;  4YOX A;  3CJC A;  5A2Q O;  3LDS A;  1TKX A;  2Q0R A;  3OBW A;  1X9S A;  1HX1 A;  1GLC G;  3MEC A;  3V81 A;  4CZM A;  5ADX A;  4PKI A;  1RBS A;  2QA4 N;  4DFK A;  3V9S A;  1S1T A;  4B1U B;  4N5S A;  5F0X A;  1JLB A;  4K43 A;  4Z0U A;  3Q7B A;  4IOX A;  2PBD A;  1OH6 A;  3WXI A;  2X6S A;  2E2Q A;  1NJY A;  4CJF A;  2IGI A;  3DOK A;  4KRF A;  2OTJ N;  3O9S A;  4YOY A;  2V51 B;  3AAQ A;  2O8E B;  4J2A A;  3CJA A;  5HL7 L;  4IFE A;  5KPR A;  3SPZ A;  4CZE A;  1H1V A;  3CPE A;  1ASV A;  3CPW M;  1SL0 A;  4B9U A;  3K5N A;  5I3U A;  4FWO A;  4M7X A;  3THY B;  4BRD A;  3AVN A;  4FWM A;  3K58 A;  1NKC A;  5KPT A;  2E1Y A;  2NRV A;  2JLE A;  1BI4 B;  4CIF A;  3C6H A;  5BPN A;  1Q82 O;  3VN5 A;  1W97 L;  3OTO K;  3D7E O;  4E1J A;  4YFU A;  2GTD A;  2ZJR L;  5C0Y A;  3MXI A;  1T6D A;  1WSH A;  4IKF A;  3LAL A;  5FRM A;  5AQV A;  3LPT A;  2ZQB A;  1P8Z A;  4B1X B;  3C6U A;  1O1W A;  3CFO A;  3F2K A;  5GIN A;  1OH8 A;  4I2P A;  4FCY A;  1RT4 A;  4DQP A;  4CGD A;  3TAQ A;  4FJL A;  3EO3 A;  2P9P A;  4FJ8 A;  2DY4 A;  3DJC A;  4U67 L;  3SUO A;  4M3W A;  5D3G A;  1BIU A;  2P9N B;  1HYS A;  5AR0 A;  4LSN A;  1IH7 A;  1D8Y A;  4BR4 A;  4HHT A;  1BO5 O;  1J53 A;  5K14 A;  1HRH A;  1VQ4 N;  4LF8 K;  3H08 A;  4BG9 A;  1NKE A;  4B9T A;  4K8Z A;  2O8F B;  5B8H A;  2WC9 A;  4A2B A;  3P1G A;  1HR0 K;  3V4I A;  5AZJ A;  3O4Q A;  4MFB A;  3S3O A;  2A41 A;  4RW7 A;  3PX6 A;  3LAN A;  4PKH A;  3PIP L;  3OVN A;  4FVU A;  3KWI A;  2WUS A;  2QWR A;  1IBM K;  4NLC A;  2A42 A;  3SV3 A;  1UA1 A;  4GV6 A;  4FPA A;  1G99 A;  1WAF A;  4YOW A;  4FM0 A;  1RFQ A;  4JI2 K;  3T1A A;  1NOZ A;  3OS2 A;  1MWM A;  2GUP A;  5EY4 A;  1RTI A;  3AVK A;  2HHH K;  4DR5 K;  3VF6 A;  4DTJ A;  4E1M A;  4J2D A;  3PO4 A;  4ICL A;  2UXC K;  1KCF A;  3VET A;  1NK0 A;  4PHT X;  3IRX A;  5AFU A;  1JXE A;  3NGY A;  5GAH P;  3OY9 A;  2NRX A;  5HP1 A;  3HBT A;  5BR8 K;  1L3T A;  2NRZ A;  1HKG A;  4CI6 A;  4WFN L;  4FO0 A;  2KQ2 A;  3C65 A;  3OYD A;  4OPK A;  2HHQ A;  3T1Y K;  3NFA A;  4H5R A;  3OYL A;  3SQ0 A;  5JLF A;  4YOR A;  4LF4 K;  4Y1D A;  2VGM A;  1HYV A;  2I7N A;  3O8M A;  3CME N;  4GV3 A;  4DLE A;  4E3S A;  4DR4 K;  4E89 A;  1QQN A;  4DSJ A;  3AY9 A;  2YHY A;  3IKM A;  4O5B A;  4M3Y A;  1BWF O;  4BRG A;  4KHQ A;  1XNR K;  4KKO A;  2XY6 A;  3KWG A;  3KK1 A;  1LAV A;  4DFJ A;  1RDA A;  3P83 D;  1QSY A;  4C1N I;  2RKI A;  3T19 A;  1J6Z A;  4MLE A;  4W5Q A;  3OYE A;  3VEN A;  2ASO A;  3FZK A;  1ZBI A;  4FK2 A;  1S1U A;  4JK7 A;  3T69 A;  3L8B A;  1HQE A;  2P9I B;  3MEE A;  1JCE A;  1JCG A;  3A0I X;  1NK5 A;  3EKU A;  1L3U A;  2KHO A;  1RT2 A;  3SCX A;  4AQY K;  3ZSY A;  2HHX A;  2KFZ A;  4BC5 A;  1OVY A;  1QSL A;  1K8K B;  3A2F A;  1UOC A;  1WN7 A;  5I9E B;  4M41 A;  3AVM A;  1NK9 A;  4O0J A;  2J4R A;  1TUU A;  2DFH A;  4OJR A;  1IBK K;  2E2O A;  1JLF A;  4CED A;  1KFD A;  3KD1 E;  2B5J A;  3U6F A;  3THV A;  5GIP A;  4CBU A;  1B9F A;  2ZWH A;  3CQ8 A;  4DF8 A;  4CEB A;  4CJP A;  2XRI A;  1S9G A;  1LAW A;  2AP1 A;  1XC9 A;  3O80 A;  1BG3 A;  3OYK A;  4DV7 K;  4A62 A;  2FBV A;  3G4S N;  2OPQ A;  2VG6 A;  4FJ5 A;  2W42 A;  4IG0 A;  1JXB A;  1I94 K;  2FSN A;  5M1Q A;  2FBY A;  3VEW A;  3RWU A;  2O8D A;  4DUY K;  1QZ6 A;  3M8R A;  3OJS A;  3SZ2 A;  3SUP A;  4PL8 A;  3QBX A;  2HBM A;  2OPP A;  3ATV A;  4JKA A;  5AFU H;  3LWL A;  3M5R A;  4WQ4 A;  5FDL A;  4CF9 A;  3P38 A;  4H0O A;  2XY5 A;  1BCM A;  2NRW A;  1WLJ A;  3OYM A;  3AV9 A;  1YUW A;  3A5M C;  4CJR A;  2VG7 A;  1J9A A;  4DS4 A;  4JS4 A;  1HKC A;  2ZD1 A;  4BWM A;  4WQ4 C;  2P9I A;  4XEI A;  4B1V A;  4QCL A;  3U8X A;  1QQC A;  4DV4 K;  2GX9 A;  3O6W A;  4J8F A;  2Q97 A;  4OPA A;  2HOE A;  2YHW A;  1K73 O;  1SZ2 A;  1Z25 A;  5C24 A;  1FXX A;  4O5F A;  2ATQ A;  3TWH A;  4LF7 K;  3NBP A;  1L3S A;  4DQ8 A;  4GMJ B;  4C1N K;  3SQ4 A;  2H3G X;  2HHV A;  3JSM A;  3NF9 A;  4DV6 K;  2P9S B;  2YX6 A;  3F9M A;  4EHU A;  1BUP A;  2F4V K;  1Y97 A;  1G15 A;  4M7Y A;  4FWL A;  4I6M A;  3LWM A;  5M1P A;  4DQR A;  2YV0 X;  4FWS A;  1D4X A;  2OPS A;  3LZI A;  3KIO A;  4FWQ A;  4KFB A;  2VQF K;  3LZJ A;  4FWK A;  4BRO A;  2QK9 A;  2Z1I A;  4JKB A;  3D2E A;  4KO0 A;  4CZG A;  3H46 O;  3ZT4 A;  1WSF A;  1WBB A;  3DLL L;  1LW2 A;  1EX4 A;  3ZEU A;  3SAG A;  3PSF A;  4A57 A;  1JLA A;  3TTF A;  1NK6 A;  3A5N C;  3THX A;  1KSP A;  4CZH A;  4EZ6 A;  3H1V X;  2KLA A;  4BRE A;  4FVM A;  4CFA A;  4NCA A;  5TKW A;  2F8T A;  4Z4E A;  1LOT B;  5HBM A;  2EWS A;  4CJU A;  3BY5 A;  5BPM A;  1YJ9 N;  2FXU A;  1S9E A;  2OZM A;  4C8L A;  4OLB A;  3QO9 A;  3AVF A;  3HK2 A;  4DTN A;  1KLN A;  4J2B A;  4CK3 A;  4Z4I A;  1U2V B;  4B1Y B;  1YHQ N;  3QIP A;  4DTR A;  4QS7 A;  3ZT0 A;  4MO5 A;  3LPU A;  4H0X B;  1EWR A;  4B8C A;  4O0I A;  4IEI A;  3RTV A;  1N32 K;  1IKV A;  1X3N A;  4FJ9 A;  5ELZ A;  3MX2 A;  4CFD A;  3E66 A;  3AO2 A;  1IO2 A;  4AM6 A;  3F5T A;  3DLH A;  4CJ3 A;  3J81 O;  4GVE A;  1YIJ N;  3L2V A;  3H3O B;  4C23 A;  1C1B A;  2F9T A;  4MQ3 A;  1WOQ A;  2VYP A;  2IC3 A;  3HRG A;  4B8A B;  1KVB A;  3VQ9 A;  1YXQ A;  3BP8 A;  1X9W A;  3KK3 A;  1N34 K;  2IS3 A;  1HPZ A;  1HLU A;  2UXD K;  2HNY A;  4DV5 K;  1SKW A;  5BRF A;  1DGK N;  3LP0 A;  1R59 O;  4JHD A;  4JHD B;  1U47 A;  3O4N A;  5MLC Q;  4JK8 A;  1XWL A;  4CBW A;  1HNZ K;  2YKM A;  1WSJ A;  1NGI A;  2PYJ A;  1U49 A;  4FLT A;  1NGG A;  4CF8 A;  3GBT A;  2HF4 A;  4FOI A;  3CXC M;  3J8A A;  5LMN K;  1KD1 O;  1B92 A;  4N76 A;  3G25 A;  4BRH A;  3VTI A;  1QVF M;  2E1Z A;  3RMC A;  3OYF A;  3KZB A;  1U4B A;  2DPN A;  1A5V A;  5J2Q A;  3AAR A;  4YY3 K;  3IS9 A;  1YTU A;  1C1A A;  4FWP A;  5IT9 O;  2UUA K;  3SMP A;  2QTD A;  4Y1C A;  3E1Y A;  4BC2 A;  1GLB G;  2YNF A;  4YOV A;  2YHX A;  4X62 K;  3K57 A;  1LWF A;  5KQD A;  2FBX A;  3O5B A;  3PIO L;  3K5M A;  1RNH A;  4BE0 A;  1D9D A;  2CH6 A;  1Y64 A;  4DHY A;  4FW1 A;  1V4S A;  3NGI A;  4OLA A;  4OPJ A;  1ASU A;  4DR2 K;  3RSE B;  5J1E A;  3RR8 A;  4UY8 O;  4ISF A;  3PY8 A;  4GVM A;  4JAX A;  3OYC A;  4Z4C A;  3CC2 N;  4BRQ A;  2YNI A;  3ALY A;  2HHU A;  4EFH A;  1U45 A;  1S1X A;  1NNE A;  1RTD A;  1SKS A;  3A8Y A;  1VSH A;  3FLC O;  1KXP A;  4CGG A;  3ZSR A;  3B6P A;  4DQI A;  5CR4 A;  1LV5 A;  4OX9 K;  1QS4 A;  2XO7 A;  3M8S A;  3TAF A;  4GV9 A;  2O4I A;  4BAC A;  1VQL N;  4OKE A;  4BQZ A;  1MWK A;  3QFP A;  3K9J A;  4DR6 K;  3ZEU B;  3L2W A;  4GNI A;  4KTZ A;  3QIN A;  2VGN A;  5C15 A;  1K8A O;  3CD6 N;  4DUZ K;  4BRL A;  1VQO N;  4GY2 B;  1TUY A;  2Z1G A;  3CCM N;  2A5X A;  1UAX A;  5AZJ B;  5AQX A;  1GLE G;  3LDN A;  1ATS A;  1WSE A;  1YAG A;  3AVL A;  4B9M A;  1C1C A;  4LFC K;  4K0K K;  3OS0 A;  4IOC L;  4BRC A;  1RBR A;  3KK2 A;  2Q1N A;  2F8S A;  3VQ6 A;  5C42 A;  3RVC A;  4JNE A;  1SV5 A;  2YKN A;  4FK4 A;  3G0Z A;  3OBY A;  1EXQ A;  3QEW A;  2QI2 A;  3ISN C;  3QEI A;  5FPE A;  2HVH A;  1N8R O;  4K41 A;  1KRP A;  4AHU A;  1RTJ A;  4FZY A;  1EKE A;  4RW8 A;  1NLV A;  4KHW A;  3GG4 A;  3SJH A;  1X9J A;  4U7B A;  3SNN A;  1OKJ A;  3V9W A;  1KFS A;  2QXF A;  1ESV A;  3RSE A;  3HT3 A;  4BRM A;  2F96 A;  3QET A;  1U48 A;  1KVA A;  3O3G A;  5EOY A;  2QW9 A;  1NGJ A;  1T44 A;  3OYH A;  3CIP A;  3T7Z A;  3O3H A;  5HLF A;  4OGC A;  5AQU A;  4JRP A;  3ULE A;  1SQK A;  3A5L C;  3CER A;  4IZ9 A;  4JKG A;  2O8D B;  4KHU A;  4JK9 A;  1HNW K;  3CYM A;  3THY A;  3VQP A;  1LWE A;  1FKO A;  1JCF A;  1HPM A;  3CJ7 A;  1SAZ A;  1J54 A;  3VOV A;  4ZHR A;  4CEO A;  3IUC A;  3MN7 A;  4C8N A;  2E4L A;  2P1J A;  3FGU A;  4PKG A;  4F9O A;  1M90 O;  3ZET B;  4DKW A;  4DSL A;  4IWV A;  4CD3 A;  3ASM A;  3HSC A;  3C0B A;  1BA0 A;  4KH5 A;  4CZF A;  1S6P A;  4FW2 A;  3WXJ A;  1NGF A;  4AH9 A;  3VQQ A;  1TVR A;  3AA5 X;  4E7I A;  3MXJ A;  5I42 A;  1X1P A;  4BRN A;  3C95 A;  2IDO A;  1VQN N;  2E6L A;  4FJI A;  3OYG A;  4X65 K;  3C94 A;  4WCE L;  4B9S A;  3OYN A;  2UU9 K;  4LFB K;  2ZGY A;  3KLE A;  3VEY A;  2RPI A;  4CZK A;  4QOZ B;  3TI0 A;  4BRP A;  4CW7 B;  3LP2 A;  1ZXO A;  4AF1 A;  2VQE K;  1RT5 A;  3E9P A;  4CEC A;  3DRS A;  3WNH A;  1Q86 O;  2P9N A;  3G71 N;  1DLO A;  1BCO A;  1VQ6 N;  1L3V A;  3DLR A;  3EY1 A;  1IG8 A;  1NM1 A;  1JLC A;  4KHY A;  4E7H A;  1VSD A;  3O08 A;  3M8Q A;  3HTV A;  2HND A;  1T05 A;  4WQ5 A;  3WQT A;  4CZL A;  4N56 A;  4FLX A;  4ZTJ A;  4HCB A;  2YNH A;  3HYF A;  2OPR A;  3VTH A;  3OYB A;  4B3S K;  2W6K A;  2BUP A;  3AA2 A;  3KD5 E;  2BTF A;  4A61 A;  3BEX A;  1M1K O;  4TSX A;  1QE1 A;  4DG1 A;  5DK5 A;  3TAR A;  5AQN A;  3O9U A;  4QS8 A;  2O8B B;  4I7F A;  3HST B;  2UXB K;  3FZH A;  3IG1 A;  3C6T A;  2CGK A;  2GWJ A;  2B6A A;  3L4Q A;  3SI6 A;  4F8R A;  4OGE A;  1T3V A;  2OTL N;  3N4P A;  1OH7 A;  1SS6 A;  3OYI A;  2YCH A;  2V7Y A;  2OYQ A;  5JVH L;  4B3O A;  3CCQ N;  3QES A;  3CQY A;  1GOB A;  3CJ1 A;  3AVH A;  4E1N A;  3WUH A;  1JLG A;  2UUB K;  4B08 A;  5KGX A;  4W5R A;  1BL3 A;  3F9K A;  4CJS A;  4GKK K;  2P9P B;  3L2Q A;  4DU3 A;  1HJR A;  4Z4G A;  4JKG B;  3DXM B;  5BR9 A;  2OA8 A;  1U2V A;  3KLG A;  5AQJ A;  3I0R A;  4DV0 K;  2IIR A;  4CES A;  3V1Q A;  3TAP A;  3P39 A;  4KRE A;  4KHN A;  2NLX A;  3NHG A;  2WOM A;  1NK8 A;  2P5G A;  4OVL A;  4WQ5 C;  1WSG A;  4B3R K;  3TU5 A;  5AQZ A;  4AIL C;  1LW0 A;  3M1F A;  4ELV A;  4BR5 A;  4JKC A;  1JKH A;  2P9L B;  4PWD A;  1IJJ A;  5AQP A;  4QS9 A;  1VSF A;  3VEO A;  1IKW A;  1NG9 A;  3UKR A;  1C6V A;  1B9D A;  5FPN A;  4DU1 A;  4DTO A;  1T7P A;  3PX4 A;  4HUE A;  2FF3 B;  1Q9X A;  2G8U A;  3S41 A;  3SUN A;  2UYT A;  1XI1 A;  4CF1 A;  1OVQ A;  3O9Q A;  4DSF A;  4DMN A;  3VMF B;  3VQE A;  2WTU A;  3UKU B;  4B1Z A;  1TAU A;  1D9F A;  1DTQ A;  1YTA A;  3ZT1 A;  5JS1 A;  4JKE A;  5KI6 A;  3KHY A;  1SKR A;  2VWK A;  3L6Q A;  1GLL O;  5C25 A;  1TGO A;  3EKS A;  3BZC A;  2HMI A;  2G8H A;  2VCP A;  2O8C B;  3HZ6 A;  2E88 A;  3MN5 A;  4IDK A;  4AM7 A;  2E2P A;  4JI5 K;  3C6A A;  1XMO K;  4EHT A;  3CCE N;  3I56 N;  4B9Q A;  5KRT A;  4FZX C;  3K9K A;  3WXM B;  1P90 A;  4LD0 A;  4BRA A;  2NZT A;  3RR7 A;  4Q0B A;  3K5O A;  3BZK A;  2A40 A;  4N47 A;  4DCH A;  3ZX0 A;  3CFP A;  3SUQ A;  4NYN A;  3GOI A;  3WNG A;  4DR3 K;  4CJ7 A;  4FLZ A;  2GWK A;  1FKP A;  4LF6 K;  2HBL A;  5CY4 A;  3GL1 A;  1S72 N;  4KHP K;  1ILY A;  4BR7 A;  5FRN A;  3CC4 N;  2KTQ A;  1EO1 A;  4CEA A;  4E7K A;  3VEZ A;  2GBZ A;  2Z1J A;  1HYZ A;  5HRO A;  3QDK A;  4QAG A;  1VSE A;  3KKR A;  5JVG L;  1N5Y A;  1SUQ A;  2W41 A;  1YJN N;  3CG7 A;  4KB1 A;  1QZ5 A;  1CXQ A;  4DB3 A;  2HVI A;  3AA4 A;  2IVP A;  3PSI A;  3HOS A;  1U04 A;  2Y1I A;  1XUP O;  1MA9 B;  5J2M A;  1YVN A;  2YI1 A;  1CZ9 A;  2RE2 A;  3SMS A;  4CZI A;  3NF7 A;  4CCH A;  3D0P A;  3CMA N;  1WSI A;  3K2P A;  3CI5 A;  3HO1 A;  4IBN A;  2LSN A;  1KAX A;  3VGK A;  4IOA L;  3DRP A;  3B8A X;  4MDA A;  2VWB A;  1RDW X;  4ELU A;  1WNS A;  4BDY A;  3WT0 A;  4K42 A;  3DXK B;  1XNQ K;  2HF3 A;  4CK2 A;  4RG8 A;  3CJB A;  4C8K A;  3ENH A;  4BQL A;  3L2U A;  3VER A;  3QNO A;  4YOU A;  4ISG A;  2AA4 A;  5FLX O;  1ZBU A;  3ZLJ A;  3ZX3 A;  2HST A;  2HBJ A;  5C2D A;  2BE2 A;  3H45 C;  3G6E N;  4H5T A;  5LL6 Z;  3OYA A;  4FWR A;  3TAN A;  3ATU A;  5CYQ A;  3QLH A;  1VRU A;  4KI6 A;  1TYQ B;  1NJX A;  2ZF5 O;  3AAP A;  4FPB A;  4FK0 A;  1W0H A;  3DAW A;  2NRH A;  3U9D A;  5DMR A;  5EU7 A;  2YJE A;  5CZ1 A;  3ZX2 A;  3TR8 A;  1CLQ A;  1XC3 A;  3NE6 A;  1QTM A;  3DRR A;  4CHN A;  2XY7 A;  3P31 A;  3S3N A;  4FL9 A;  2Q0U A;  4LC9 B;  1FW6 A;  1S22 A;  4IJN A;  2HNZ A;  5CE3 A;  2E5L K;  1RDD A;  2HBK A;  1TYQ A;  4KH6 A;  2IOC A;  4FXD A; 
#chains in the Genus database with same CATH homology
 3V4I A;  3O4Q A;  4MFB A;  1T03 A;  3S3O A;  3VQC A;  4RW7 A;  1SV5 A;  3PX6 A;  2YKN A;  3LAN A;  4FK4 A;  1UA0 A;  3G0Z A;  3OVN A;  1S1V A;  1IKY A;  1EXQ A;  4FLV A;  3QEW A;  3SV3 A;  4E7J A;  3TAE A;  1UA1 A;  3DLK A;  3ISN C;  1WAF A;  3QEI A;  1C0T A;  3HJF A;  3AVA A;  4PUO A;  4FM0 A;  1MU2 A;  2XY8 A;  2HVH A;  3JYT A;  3T1A A;  1NOZ A;  3OS2 A;  1KRP A;  4M3X A;  3CM5 A;  3KLH A;  3SYZ A;  1ZBL A;  1K6Y A;  4AHU A;  4H8K A;  1RTJ A;  1RTI A;  4FZY A;  1EKE A;  3AVK A;  4YNQ A;  4DLG A;  1NOY A;  4RW8 A;  4F2S A;  1Z26 A;  1A5W A;  1BQM A;  4DTJ A;  4KHW A;  4CHZ A;  3MED A;  4DFP A;  3SNN A;  2R7Y A;  4AHV A;  4E1M A;  2PY5 A;  3PO4 A;  3VA0 A;  4HCC A;  3V9W A;  1KFS A;  4ICL A;  4PA1 A;  2QXF A;  4CEZ A;  3HT3 A;  1KCF A;  4BDP A;  1NK0 A;  2F96 A;  3AO3 A;  3AVB A;  3QET A;  3IRX A;  1U48 A;  4R5P A;  1JXE A;  1KVA A;  3D45 A;  3NDK A;  3O3G A;  3NGY A;  2EX3 A;  1BI4 A;  1VK0 A;  3DOL A;  2HB5 A;  5FRO A;  3ZSZ A;  3OY9 A;  5HP1 A;  1ASW A;  1TKT A;  3V9Z A;  3S9H A;  4CGH A;  3OYH A;  3O3H A;  5HLF A;  4OGC A;  3BDP A;  4JRP A;  3SV4 A;  4ZTF A;  1L3T A;  4B9N A;  4KAZ A;  3ZSX A;  4HUF A;  2DTU A;  4Z4H A;  2KQ2 A;  4AHC A;  4CHO A;  2P51 A;  3CM6 A;  4KHU A;  3OYD A;  4OPK A;  2HHQ A;  3CYM A;  4LSL A;  3ULD A;  2G8F A;  4E0D A;  3NFA A;  3M8P A;  1A5X A;  1VSJ A;  3VQA A;  5KTQ A;  3OYL A;  3HM9 A;  3SQ0 A;  3VQP A;  4NCB A;  3WNE A;  1LWE A;  1FKO A;  4Y1D A;  2HW3 A;  1HYV A;  1D5A A;  3VQB A;  3DMJ A;  1RT7 A;  1KLM A;  4DLE A;  4E3S A;  4FJM A;  3QIO A;  4F2R A;  1J5O A;  4E89 A;  3I8D A;  4DSJ A;  4L8R B;  1J54 A;  4ZHR A;  1L5U A;  3VQ8 A;  4CEO A;  4O5B A;  4C8N A;  1ZBF A;  2E4L A;  2P1J A;  3AO5 A;  3ITH A;  5HRR A;  3ZT3 A;  4CGF A;  4CHY A;  2G8V A;  4RW9 A;  1KVC A;  1R0A A;  3ZSO A;  4KHQ A;  3V9X A;  2HHW A;  4BDZ A;  4WE1 A;  4KKO A;  5CZ2 A;  2XY6 A;  4M3R A;  3KK1 A;  4DSL A;  1LAV A;  4DFJ A;  4I9L A;  5KGW A;  1RDA A;  4XIU A;  3P83 D;  4FJK A;  4CJK A;  4KHS A;  1QSY A;  4N41 A;  2ETJ A;  3ASM A;  2RKI A;  1C0U A;  3T19 A;  3PV8 A;  3OYE A;  4W5Q A;  3PUF A;  1JLQ A;  2GUI A;  3I0S A;  1ZBI A;  4FK2 A;  1S1U A;  4JLH A;  4Z4F A;  1NK8 A;  2BAN A;  3L8B A;  1HQE A;  1S6P A;  3MEE A;  4ID5 A;  2ITG A;  4FW2 A;  4C8M A;  4CJT A;  5JS2 A;  1TKD A;  2G8K A;  4M3U A;  1JLE A;  4CJQ A;  3NCI A;  4AH9 A;  3KKS A;  3VQQ A;  1NK5 A;  1L3U A;  4CF0 A;  1TVR A;  3AA5 X;  4E7I A;  1RT2 A;  2FC0 A;  4DSE A;  1N6Q A;  3MXJ A;  3SCX A;  3HP6 A;  4EZ9 A;  3ZSY A;  5I42 A;  1X1P A;  2HHX A;  2KFZ A;  1QSL A;  3C95 A;  2IDO A;  2YHA A;  3A2F A;  1UOC A;  1WN7 A;  2E6L A;  2A1R A;  4M41 A;  1RT3 A;  4FJI A;  4KTQ A;  3AVM A;  3OYG A;  3RMD A;  1NK9 A;  4O0J A;  4FLU A;  1RCH A;  4FLW A;  3AO4 A;  3HVR A;  3CFR A;  3C94 A;  3AVC A;  1FK9 A;  2DFH A;  5CYM A;  4OJR A;  3IAY A;  3RMA A;  4B9S A;  3OYN A;  4OKK A;  2B4J A;  1RBU A;  3NF6 A;  1JLF A;  4CGI A;  4CED A;  1KFD A;  1JL1 A;  3KLE A;  3KD1 E;  1UWB A;  2B5J A;  4BE1 A;  3U6F A;  3THV A;  2RPI A;  4QOZ B;  3F73 A;  3AO1 A;  1B9F A;  3CQ8 A;  4NCG A;  3K59 A;  4DF8 A;  3TI0 A;  2QKB A;  1JL2 A;  3LP2 A;  1RT5 A;  1YT3 A;  4CEB A;  4CJP A;  4CEC A;  1XHX A;  2XRI A;  3DRS A;  3WNH A;  1S9G A;  1LAW A;  3V6D A;  1XC9 A;  1DLO A;  1BCO A;  3DLG A;  4AHS A;  4EP4 A;  3SPY A;  1RIL A;  2A1S A;  4J2E A;  1S1W A;  1TAQ A;  4LY7 A;  1L3V A;  3DLR A;  3OYK A;  3NH2 A;  1NJW A;  3EY1 A;  3DLE A;  4ELT A;  2X6N A;  2FBV A;  1JLC A;  4O55 A;  4KHY A;  2OPQ A;  2VG6 A;  4E7H A;  2W42 A;  4FJ5 A;  1VSD A;  4IG0 A;  4OKJ A;  2BGG A;  4LH5 A;  4F3T A;  1JXB A;  4DTS A;  4FJN A;  3M8Q A;  1RDB A;  3O3F A;  2HND A;  1T05 A;  2FBY A;  1F21 A;  3OYJ A;  3BGR A;  2PZS A;  1RTH A;  3RWU A;  3M8R A;  3ZT2 A;  4N56 A;  3OJS A;  2DFE A;  2YHB A;  4FLX A;  3SZ2 A;  3SUP A;  4ZTJ A;  4BE2 A;  2YNG A;  4FJH A;  4HCB A;  2OPP A;  3DYA A;  2YNH A;  3HYF A;  2OPR A;  1RDC A;  3OYB A;  3PO5 A;  3LWL A;  1S6Q A;  5FDL A;  2RF2 A;  3AA2 A;  2Y1J A;  1W9H A;  3KD5 E;  4CF9 A;  4M45 A;  2XY5 A;  4TSX A;  1QE1 A;  4DG1 A;  1BCM A;  5DK5 A;  3V9U A;  1WAJ A;  3OYM A;  1WLJ A;  3TAR A;  1X9M A;  3AV9 A;  3U3G A;  1T8E A;  4FLY A;  4I7F A;  4CJR A;  1TL3 A;  2VG7 A;  1J9A A;  2FBT A;  4DS4 A;  4JS4 A;  4FJJ A;  3ZSV A;  4B9V A;  2ZD1 A;  3HST B;  3V1O A;  4BWM A;  4CHQ A;  1ZBH A;  3IG1 A;  3EYZ A;  3C6T A;  4CJW A;  4FJ7 A;  5KRS A;  2PYL A;  1VSK A;  3MEG A;  4QCL A;  1GOC A;  3EZ5 A;  3U3Y A;  1QQC A;  2B6A A;  4FM2 A;  1ITG A;  2Q3S A;  3SJJ A;  3G10 A;  1ZYQ A;  4F3O A;  3SI6 A;  1BHL A;  4NYF A;  4F8R A;  4PY5 A;  1Z25 A;  4OGE A;  3K5L A;  4IG3 A;  4W5N A;  2E6M A;  5C24 A;  1FXX A;  3OYI A;  2ATQ A;  3FFI A;  3MAQ A;  3TWH A;  3L3V A;  4KTW A;  3NBP A;  1L3S A;  4DTM A;  2OYQ A;  4B3O A;  1TK5 A;  3QES A;  1VSM A;  4GMJ B;  3SQ4 A;  2IAJ A;  4KV8 A;  3SQ2 A;  3DM2 A;  4JS5 A;  1GOB A;  3JSM A;  2HHV A;  3NF9 A;  5HRP A;  3HPH A;  4F4K A;  3AVH A;  4DTU A;  4E1N A;  1TK0 A;  2OZS A;  3LP3 A;  3RRH A;  4AHT A;  4DWI A;  1JLG A;  3AA3 A;  2D0A A;  1Y97 A;  4B08 A;  1G15 A;  5KGX A;  4W5R A;  4CJV A;  3DLB A;  1BL3 A;  4CJ4 A;  1RBT A;  4M3T A;  4AHR A;  3F9K A;  3LWM A;  2QKK A;  1BGX T;  4CJS A;  4DQR A;  5J2P A;  2KW4 A;  2YV0 X;  3L2Q A;  4DU3 A;  3LP1 A;  1HJR A;  4Z4G A;  2OPS A;  4CJ5 A;  3KIO A;  4KFB A;  3LZI A;  1CZB A;  3LZJ A;  2OA8 A;  4CF2 A;  3KLG A;  2EHG A;  4CK1 A;  3I0R A;  4M3Z A;  2QK9 A;  2Z1I A;  1IG9 A;  3SQ1 A;  2G8I A;  3QEP A;  4CES A;  4KO0 A;  3V1Q A;  3TAP A;  4FJX A;  3HVT A;  4KRE A;  4KHN A;  1I39 A;  4DFM A;  3NHG A;  2I5J A;  3TAG A;  1QHT A;  2WOM A;  1WSF A;  2WON A;  4O4G A;  4OVL A;  3ZT4 A;  1I3A A;  1LW2 A;  1WSG A;  4EP5 A;  2P5G A;  1EX4 A;  1GOA A;  3QNN A;  4AIL C;  3AVJ A;  4W5O A;  1JLA A;  1NK6 A;  1LW0 A;  3HL8 A;  3NF8 A;  1HQU A;  1KSP A;  3ZCM A;  1Q8I A;  4ELV A;  1JKH A;  4EZ6 A;  4W5T A;  4PWD A;  4FJG A;  3LAM A;  4FVM A;  4CFA A;  4NCA A;  5E41 A;  1VSF A;  3PX0 A;  1IKW A;  2BDP A;  4Z4E A;  2F8T A;  5HBM A;  1C6V A;  1B9D A;  4DU1 A;  4DTO A;  2NUB A;  1T7P A;  4CJU A;  4H4O A;  4HUE A;  3PX4 A;  4CJE A;  1Q9X A;  1S9E A;  2G8U A;  3V1R A;  1NKB A;  1TV6 A;  4CHP A;  3SUN A;  4C8L A;  2OZM A;  4OLB A;  4DTX A;  4IFY A;  1XI1 A;  4CGJ A;  4CF1 A;  3QO9 A;  1S5J A;  3AVF A;  4DSF A;  4DTP A;  3HK2 A;  3LAK A;  4DMN A;  4IFV A;  4DTN A;  1XHZ A;  4LH4 A;  3VQE A;  1VSL A;  2XHB A;  1KLN A;  4J2B A;  1TAU A;  4CK3 A;  4K8X A;  4Z4I A;  4C8O A;  1D9F A;  1DTQ A;  1BIZ A;  1YTA A;  3ZT1 A;  4CFC A;  5JS1 A;  5KI6 A;  1SL2 A;  4KB0 A;  1SKR A;  4BWJ A;  3QIP A;  2VWK A;  3AVG A;  4HVJ A;  4DTR A;  3ZT0 A;  2Z1H A;  3LPU A;  4FXD A;  4B8C A;  1HNI A;  4O0I A;  4UQG A;  5C25 A;  5HRS A;  3RTV A;  3TAB A;  1TGO A;  4M42 A;  1BIS A;  3NH0 A;  1KTQ A;  1IKV A;  4RW6 A;  2HMI A;  4KI4 A;  2HHS A;  4FJ9 A;  2G8H A;  1RT6 A;  3OJU A;  4GW6 A;  4IDK A;  4CFD A;  3VA3 A;  3AO2 A;  1IO2 A;  2KZZ A;  1REV A;  3ZSQ A;  3DLH A;  4CJ3 A;  2AJQ A;  1QSS A;  3L2V A;  1DTT A;  2D0C A;  1C1B A;  4MQ3 A;  5KRT A;  4FZX C;  1YVU A;  4CEQ A;  3VQ7 A;  3AVI A;  2O4G A;  2IC3 A;  5SZT A;  5SWM A;  4LD0 A;  1HNV A;  3VQD A;  3WNF A;  4B8A B;  1KVB A;  3VQ9 A;  3OS1 A;  4CFB A;  4HTU A;  2G8W A;  4FZZ A;  2GV9 A;  3RR7 A;  1X9W A;  4CIE A;  2KZM A;  3NH1 A;  1C0M A;  3KK3 A;  3RMB A;  4Q0B A;  3NAE A;  4I2Q A;  1RBV A;  3K5O A;  3ZSW A;  2IS3 A;  1HPZ A;  1IKX A;  3LDS A;  1NK4 A;  1TKX A;  4RW4 A;  2HNY A;  4N47 A;  4DSI A;  1SKW A;  4DU4 A;  4FYD A;  3CFP A;  3SUQ A;  4NYN A;  3WNG A;  1X9S A;  2D0B A;  4FLZ A;  3MEC A;  3LP0 A;  3V81 A;  2D5R A;  3KLI A;  1FKP A;  4ID1 A;  1U47 A;  3O4N A;  1RBS A;  5CY4 A;  1XWL A;  1VRT A;  4DFK A;  3V9S A;  4E7L A;  1SL1 A;  1S1T A;  2YKM A;  1WSJ A;  5FRN A;  2KTQ A;  4CEA A;  2PYJ A;  4E7K A;  2KFN A;  4N5S A;  1JLB A;  4FLT A;  1U49 A;  4CF8 A;  2GBZ A;  2Z1J A;  4Z0U A;  3S3M A;  3KTQ A;  1HYZ A;  5HRO A;  4KPY A;  4CEE A;  1NK7 A;  1B92 A;  4QAG A;  4N76 A;  2X6S A;  1NJY A;  5T7B A;  3HP9 A;  4CJF A;  2IGI A;  3DOK A;  1VSE A;  4KRF A;  1EP4 A;  4G1Q A;  3RMC A;  3KKR A;  3OYF A;  1N5Y A;  1U4B A;  1RT1 A;  1A5V A;  1SUQ A;  5J2Q A;  4Q5V A;  3CG7 A;  4KB1 A;  1TL1 A;  4CEF A;  1CXQ A;  3IS9 A;  4J2A A;  1C1A A;  3AA4 A;  4H4M A;  1YTU A;  4HUG A;  2HVI A;  1U04 A;  2Y1I A;  5J2M A;  4Y1C A;  3SPZ A;  4CE9 A;  1CZ9 A;  4CER A;  2DFF A;  2YNF A;  4DS5 A;  3K57 A;  1LWF A;  2FBX A;  3NF7 A;  1VSI A;  4CCH A;  3D0P A;  1ASV A;  3K5M A;  1SL0 A;  4B9U A;  1RNH A;  3K5N A;  1WSI A;  3K2P A;  4BE0 A;  5I3U A;  1D9D A;  3HO1 A;  4IBN A;  4I9Q A;  2LSN A;  4PQU A;  3KJV A;  4FM1 A;  4FW1 A;  3AVN A;  3NGI A;  3DRP A;  4OLA A;  4OPJ A;  1ASU A;  3K58 A;  1NKC A;  5J1E A;  3RR8 A;  4M3Y A;  2RN2 A;  4GVM A;  3PY8 A;  4ELU A;  3OYC A;  1WNS A;  4Z4C A;  3QEV A;  4BDY A;  4DQQ A;  2YNI A;  3ALY A;  4CK2 A;  2HHU A;  2JLE A;  1U45 A;  4RG8 A;  2X74 A;  1NJZ A;  4C8K A;  1BI4 B;  1EET A;  1S1X A;  3L2U A;  3QNO A;  4CIF A;  1RTD A;  1SKS A;  1VSH A;  3VN5 A;  4CGG A;  5J2N A;  3ZSR A;  3B6P A;  1ZBU A;  3VQ5 A;  4O44 A;  4DQI A;  3MXM A;  2BE2 A;  4YFU A;  4JRQ A;  1LV5 A;  4J2D A;  1QS4 A;  2XO7 A;  1HMV A;  3M8S A;  3TAF A;  1WSH A;  3MXI A;  2O4I A;  4IKF A;  3LAL A;  1BQN A;  3KLF A;  4BAC A;  5FRM A;  3B6O A;  2VWJ A;  3OYA A;  3TAN A;  5CYQ A;  3QLH A;  1VRU A;  2JGU A;  4KI6 A;  4OKE A;  3L2R A;  3LPT A;  1TK8 A;  4E19 A;  4KTZ A;  3L2W A;  1NJX A;  3QIN A;  4FK0 A;  1W0H A;  2ZQB A;  3C6U A;  1O1W A;  2Z1G A;  3CFO A;  5DMR A;  5EU7 A;  1UAX A;  5CZ1 A;  3HPG A;  4I2P A;  4FCY A;  1RT4 A;  3TR8 A;  1CLQ A;  3DI6 A;  2P5O A;  3NE6 A;  1LWC A;  3HXM A;  4DQS A;  1QTM A;  3DRR A;  3E01 A;  4CGD A;  4DQP A;  4CJL A;  2X78 A;  4CHN A;  2XY7 A;  3TAQ A;  3RRG A;  5HRN A;  4FJL A;  2HHT A;  4DSK A;  3P5J A;  1Q9Y A;  3S3N A;  1TKZ A;  1WSE A;  3QEX A;  4FJ8 A;  2DY4 A;  3SUO A;  3AVL A;  4B9M A;  4M3W A;  1C1C A;  3HPO A;  5D3G A;  1CXU A;  1BIU A;  3VQ4 A;  2ZE2 A;  1HYS A;  2VG5 A;  3UIQ A;  4LSN A;  1IH7 A;  3NGZ A;  3OS0 A;  4CIG A;  4HHT A;  3T3F A;  1D8Y A;  4B9L A;  4DF4 A;  2HNZ A;  1J53 A;  1RBR A;  3KK2 A;  5K14 A;  3L3U A;  1HRH A;  3QER A;  3TAM A;  3H08 A;  1RDD A;  1NKE A;  4B9T A;  4K8Z A;  2F8S A;  2IOC A;  3VQ6 A;  5C42 A;  3P1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...