4I7FA

Hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and biological evaluation of phosphonate analogues of nevirapine.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase
total genus 153
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i7fA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i7fA05
1VSHA 5FDLB 1RT1A 2R8IA 4N56A 2E9RX 3LWLA 3KTQA 4O44B 2D5RA 4CHYA 3DOKA 1NOZA 3QNNA 5KT3A 1W9HA 5F8GA 1ASVA 4IRCA 4FJ8A 1UWBA 1VRUA 3IGNA 4KHSA 5KRTA 2V4RA 3V6DB 3LPTA 5KRSA 3V81B 2KZMA 1S6QB 3K5OA 2GC8A 4CHOA 1X9SA 2E6MA 4W5OA 4CECA 2PYLA 5J2QA 2DY4A 1KRPA 3TVKA 1S0MA 5F8JA 3O3HA 2C2EA 1RTDB 1ZBFA 4OKJA 3OYLA 4N5SA 3F9KA 4DTOA 3RB3A 3RB6A 1T8EA 4FS1A 2KQ2A 5FROA 2HHQA 2I1RA 4ZP6A 2YV0X 3P5JA 4IG0B 2WTFA 3EZUA 3RBDA 5KFGA 4FK2A 2VG6A 3VQ5A 5J2NB 4CK3A 1LAWA 4FLZA 2G8UA 4Q8FA 3KLEA 4WFZA 3DI6A 5L1KA 4JRQA 4DTUA 4F4XA 4O4GB 4EP4A 4U7CA 1RAJA 4J9MA 5J1EB 3I0SB 5KFJA 1IKWB 1SUQA 4TQRA 4NLWA 1C2PA 2IAJB 3AA5X 5KGWA 3G0ZA 4DS4A 4O3SA 2R2TA 4W5NA 1WAFA 1TKTB 1JL1A 3MTKA 1X1PA 5T7BA 3KLFB 3VQSA 1C0UA 4CIGA 3ASMA 3G6VA 3H40A 4OVLA 3K57A 3M8QA 2EC0A 4EBDA 4KB1A 1GOBA 2YNIB 4F8RA 3GIIA 3HPHA 3QIOA 1L3UA 2W8LA 3OSPA 1RT5B 4NRUA 2ZQBA 3DYAB 3SI8A 2OPPB 3SQ0A 5KG7A 3I0SA 4CJFA 3CYMA 2XI2A 2C2DA 3LP0B 5KFYA 3V1OA 4EZ6A 1TVRB 3DMJB 4XIUA 2RKIA 2AX0A 2IM3A 4CCHA 5KT4A 4DL3A 4Q0BA 4ID5B 3Q8PB 4PQUA 4FXDA 1S9GB 2OYQA 1Y97A 4BDPA 2IMWP 3TWHA 3LAMA 4IDKA 3PR4A 3AVBA 2G8IA 5FDLA 3KKRA 1TK8A 3L3UA 5KT7A 4WFXA 2HNZA 1S9FA 3RMCA 3T5HA 3V9ZA 1JLAB 3BSNA 4IG3B 4NLQA 4R0EA 3K58A 3DRRB 1KVCA 4TQSA 1NKBA 4DWIA 3A2FA 1LWFA 2D3UA 4DSFA 1NJWA 2HVHA 1QTMA 4URGA 2BRLA 1HJRA 4XPEA 4KAIA 1WLJA 4MKAA 3MECA 2FBTA 3IGVA 3OLAA 3TAFA 1JXLA 2YKMA 1TQLA 1RT7B 3LAKA 4J2AA 2W9BB 3PW2A 3DRPB 3MXMA 4KRFA 3IN5A 3VQ8A 2UVUA 1NK4A 4NLDA 2UVWA 4FZZA 4KPYA 2B6AB 1JLBA 3ICLA 3V1RA 3HSTB 1IM4A 5KFXA 3KK3B 3OY9A 4KTWA 3M8QB 4MFBA 1JLBB 4CJ4A 4WZMA 4IQXA 1C0UB 4F50A 3KLIA 2BRKA 5DG7A 4RG8A 2JEJA 4FJHA 4I9QA 4AH9A 2HAIA 3AVHA 3UPFA 4ZVGA 1VRTA 3MECB 4KHMA 5KFWA 4E7LA 5FRMA 1N56A 4CJQA 1WNSA 2ZE2B 3LPUA 1QQCA 1SV5A 3PV8A 3L3VA 1ZBUA 4U6PA 1DTQA 4FZXC 3C6TA 4NLSA 4FK0A 3NBPB 2KZZA 4LSLA 4DSJA 3C95A 3JYTA 1N5YB 3VQ6A 1YTAA 2V9WA 5D3GB 3HKWA 3EPGA 3SPZA 1JKHB 1HQEB 2VG7B 1RT6A 1A5VA 3GV7B 2QK9A 3OYHA 1RCHA 3EYZA 1IKXB 3QEXA 3QGHA 1QAIA 5I42B 2YNIA 4KSEB 2UVRA 1JLCA 4CEDA 3HYFA 3H2LA 4FLVA 4OJRA 5I42A 4RZRA 4YQWA 3KLGB 3OVNA 3U3YA 5JUMA 3OYIA 1S1VB 4I7FB 3FRZA 4FBTA 2IBKA 3V9SA 3Q8RB 4FLTA 1LW2B 3AVLA 4CJ5A 4CEZA 3NHGA 1HMVA 5F8HA 4RW8A 1LV5A 1TL3B 1KVBA 3LZJA 3FDSA 3SV3A 4ZPBA 3OYJA 2B4JA 3DLEA 1RTIB 3KHRA 4IFYB 4HHTA 2ASDA 2JEGA 3OYBA 4J9SA 1RA7A 4KFBA 4MFBB 3UR0A 1VSMA 4Z4HA 4DSLA 3PR5B 1RTHA 1EETB 4W5TA 3KK3A 3SUOA 4O0JA 2HNYB 1BI4A 1HNIA 1SKSA 4CFAA 3VQDA 3I0RA 4J9QA 3BQ1A 3O3FA 3RR7A 3KLHB 4F2RA 4NLPA 5J2PA 2IM2A 1S9EA 4K4WA 2VG5B 1K6YA 2QXFA 2AX1A 2IDOA 1KLNA 3C6TB 1X9WA 3IAYA 4OGCA 4DTMA 3VQ7A 4HKQA 3AO3A 4CE9A 4H4MA 4KV8A 3K5NA 1T94A 2DPJA 5F9LA 4CIEA 4TYBA 4E1MA 1UWBB 1VRUB 5KFPA 1W0HA 3OL8A 5HRSA 3DLKB 3V4IB 4C8LA 2VWJA 1IKVA 4PA1A 4CESA 1EP4B 3T1AA 3QYYA 1U4BA 3MF5A 2E6LA 2BE2A 4OLBA 1XR5A 1VSIA 5KT6A 4IKFA 2E9ZA 2AGPA 2R8HA 4IDKB 1TAQA 4RW9A 1HYSA 3AA4A 2HHUA 4UQGA 3VQEA 1HNIB 1N6QA 4M3ZA 3SZ2A 1KHVA 5F8IA 4FJGA 1DLOB 4LSNA 1ZETA 3VQCA 3CDUA 4TXSA 2R8JA 2AQ4A 4CJPA 4RW7B 3RBEA 3RAQA 2W7PA 2C22A 4KHQA 2CKWA 4O0IA 1BISA 2GIQA 5KGXA 3QO9B 2IA6A 1KTQA 1LWCA 3DI6B 4DFMA 3AVAA 1DTTA 2JLEA 1BGXT 4HVJA 1RYRA 4CGGA 3CG7A 1K1SA 5KFDA 1NK9A 2Q3SA 4ECYA 4K4YA 5KG2A 4J2EA 1RBSA 1FKOB 3TAPA 1WN7A 2A1RA 3HK2A 2HNZB 3E51A 4K4XA 5KFIA 5DGBA 1TK0A 3ZT0A 4HUEA 3K5LA 4F2SA 2G8HA 2B5JA 2F8TA 1L3VA 4CGFA 2C28A 2V4QA 1GOAA 4CJSA 4DL2A 1TL1B 4QW8A 1NHUA 3ZT3A 4KV8B 4PUOB 4DQIA 2FVCA 3SUNA 1NK0A 4EBEA 3QIPA 1L3TA 3LP0A 1QAJA 4M45A 4JUZA 1TKXA 3L2VA 1RILA 2FBVA 4IH6A 1JLEB 3VQBA 1KHWA 4ECSA 2YHBA 4DTXA 4KHNA 5HROA 4ZHRB 4FW1A 4ZP9A 4HTUA 4FW2A 4O3RA 4NLOA 3QEIA 1SL0A 3CVKA 5KFMA 4M3RA 4CJ3A 4Q5VA 1NKEA 4B8AB 3HPGA 4H4OB 4J9KA 1ZTWA 2XY7A 5F8NA 3D28A 2VA2A 3T5LA 1Z4UA 2NUBA 3VA0A 4CEQA 4KHWA 3M8PA 5KFLA 4E1NA 3QO9A 2UUWA 2VG5A 5DQGA 3PX6A 1KVAA 4CHPA 3QESA 2V0NA 1HQUB 4J9NA 1TV6B 2HW3A 1IKYA 3LP2A 1J5OA 1C1CA 2IC3B 1D1UA 3MXJA 3QERA 3DRSB 5F8MA 3DM2A 3SUQA 1T7PA 2AU0A 1X9MA 2YHAA 1N6QB 4Q43A 3KLFA 2OPQA 3NFAA 3KLGA 3GILA 5KT5A 4FJIA 1WAJA 5KT2A 4ID1A 4DG1B 3ULDA 1SH2A 1CSJA 4QWCA 2O5DA 3M8PB 2UVVA 2FJXA 1B92A 4AHSA 2F8SA 3KHLA 1RT2B 5DQIA 4JS5A 3WNHA 2FBYA 1D0EA 1NJXA 4EO6A 3CJ5A 5C42B 4QPXA 4ECUA 3QETA 2YNGA 4PUOA 1S1WB 4BACA 3MEGB 5L9XA 3OS0A 3PO5A 2WHOA 2ALZA 1BCMA 1RDBA 3LP1B 1JLEA 3EZ5A 5K14A 2HB5A 3LP1A 5D3GA 2F96A 3GIKA 1KLMA 3HP6A 1WSJA 3HHKA 4B9TA 1A5XA 3MR3A 4OKEA 3B6OA 3MEEA 4DFKA 3CJ4A 2YNFB 4FM0A 5I3UA 3C6UA 3V6KA 2XY5A 1OS5A 3QEPA 2YKNB 3GV5B 1S9EB 1XHXA 1LW0B 4Y1DA 2B5JB 1HMVB 3MR2A 2HMIA 2P51A 1QE1B 3NF9A 5HRPA 4NCGA 1BIZA 3SV4A 3IG1B 2ATQA 4FJMA 1WSEA 3NCIA 4O55A 3O3GA 2AGOA 4CGJA 1EXQA 4DMNA 1C6VA 3I5CA 4F4ZA 4YR3A 1RTDA 3N6MA 5T14A 1EETA 2FVQA 2IJFA 3MEDA 1R0AB 3H98A 4CF1A 1S9GA 4M41A 3MAQA 3AO1A 4HCBA 4J2DA 3E01A 3V9XA 3ITHB 1S6QA 4B3OA 3CDEA 4I9LA 4OPKA 3TI0A 1S6PA 5C42A 3DOLA 4Y34A 3DLGA 5KFRA 4RW7A 1LW0A 3UIQA 4C8MA 4JLHA 4YNQA 5CYQA 3KMSA 2J6SA 3ISND 1B9DA 3HM9A 2BANA 5KG1A 1WSGA 4ZVHA 3AVFA 4OGEA 5KFNA 1S1UB 4J9OA 1SH3A 3RRGA 4DFJA 3V9UA 4L8RB 3NH0A 5SZTA 3OS2A 3HVAA 4ZPAA 3D45A 4ZVEA 4Q0BB 1CZ9A 4Y2CA 3MXIA 1IKVB 4DF4A 4DSIA 5KFOA 1GX5A 4MQ3A 4Y2AA 2VG7A 1RT3A 2ZKUA 3AVMA 4FJ9A 3NL0A 1D9DA 2YNHB 4IH5A 2XY8A 3HXMA 3GQCA 2WONB 2OPPA 3ZSOA 4ICLA 4B9VA 1WSFA 1TL3A 3LANA 1D5AA 5KFZA 5KFFA 4KAZA 2QKKA 2HNDA 4NYZA 3BGRB 3CM5A 3WNEA 5KI6A 4IR9A 1GX6A 2HVIA 2P5OA 1KLMB 1RT3B 3THVA 4CJEA 4ED7A 4QAGA 3SPYA 1NK6A 2XY6A 1TKTA 3SNNA 1D8YA 1NK8A 4FJKA 5C24A 5KFVA 3JSMA 3VN5A 3OYAA 4Q44A 1JIHA 4KE5A 3AA3A 2OA8A 4FVMA 2ASLA 4H8KA 1RTJA 2X6NA 4IRDA 4FJXA 2CJQA 1T3NA 3CQ8A 5HP1B 3NAEA 3OYNA 2YNFA 1XC9A 3SYZA 2KW4A 4FLYA 1QS4A 4DLGA 3M9OB 3H08A 2XGPA 1BHLA 2ZE2A 2WRMA 4FZYA 4E3SA 4YP3A 4NLTA 4PWDB 4O44A 4AILC 2QE5A 5KFEA 3JSMB 5C25A 2XWYA 3RWUA 3BDPA 3T5KA 1Q9YA 4FJ7A 5EWFA 4ED8A 4HYKA 1HQEA 1JKHA 2FLNA 4ECWA 4LQ3A 3QIPB 4Z0UA 2RKIB 5J2QB 3PW5A 4H4MB 4QWBA 1YT3A 2D0BA 3BSCA 4KFBB 4ECXA 4KREA 1JLQB 4ELUA 4NZ0A 4R5PA 4N76A 2RF2A 1RT2A 4E0DA 2QV6A 4QOZB 4WYWA 1S10A 3OYGA 1RBRA 4J2BA 1VRTB 1SV5B 2IS3A 1S1TB 2BQ3A 3SFUA 2W9CB 2IJNA 3OL6A 4O3PA 2FVRA 3HT3A 4MKBA 1RT1B 3U6FA 3KHHA 4CHQA 1C1BB 4DLEA 2RN2A 2FVSA 4JRPA 3OL9A 4I2QB 3CFPA 3ZSYA 1JX4A 2ATLA 3H4DA 4DQRA 4GC7A 1TKZA 3QIDA 4FCYA 3LZIA 1VSFA 3LP3A 3BR9A 2X6SA 4E7HA 4NLRA 4WE1B 3G86A 3PW0A 3V6JA 3CJ0A 3AO4A 2DFHA 2WOMA 5EWGA 1KFDA 1JLCB 4RU9A 1XHZA 4YR0A 2OZMA 2W9CA 2WB4A 1ZYQA 3NH2A 5DLGA 3SQ2A 1LW2A 4O3OA 4ICLB 4N47A 4RW8B 4ELTA 3ISNC 2VA3A 5KFTA 4QCLA 3OYCA 1TL1A 5J2PB 4B9SA 3NAIA 3DOKB 5JXSA 4F4WA 3PHEA 3SQ4A 2W42A 4O4RA 3RTVA 4R8UB 3RRHA 3SFGA 4NCAA 3L2RA 4ID5A 1VSDA 3U3GA 2DFEA 3MR5A 3QGIA 1CZBA 2FLPA 2HWIA 3OSNA 4URSA 3DRSA 4RNHA 5KFSA 5HRNA 4W5RA 1XWLA 1MU2B 1RBTA 4KB0A 4G1QB 1S1TA 1N48A 2BGGA 1S6PB 4RNFA 2HHWA 4B9LA 4ED0A 4DTSA 1L5UA 4EZ9A 4O5BA 4ZP7A 4C8OA 3WNFA 5FRNA 3C6UB 5KG4A 2FLLA 1HPZA 1RT5A 1REVB 5EDWA 4CJWA 1T05A 4M3TA 2FVPA 3TAMB 3KJVA 4FLXA 1XR6A 2B43A 3EPIA 3S9HA 4B9NA 4J9LA 1RTHB 1RBVA 1NJYA 2Z1GA 4PQUB 4M42A 2BE2B 4KB7A 3TABA 1F21A 3FFIB 4LH4A 4DL5A 4CF0A 1BL3A 4ECTA 1HNVB 3V9WA 1Z25A 4RUCA 1BQNB 4R5PB 1S49A 4LSNB 5HRRA 3O4NA 3M8RA 2X78A 1HARA 3DLGB 1DTQB 4OKKA 3DRRA 1S48A 3S3NA 4NCBA 3ZCMA 3AVKA 4DU3A 3HVTB 4WE1A 1JLGB 1J54A 2XRIA 4DU4A 2Z1JA 1U47A 1I3AA 2WOMB 2HHTA 5C25B 2KTQA 3QZ8A 4CEOA 2W7OA 2RDJA 2DTUA 3IG1A 2AGQA 4LSLB 2A1SA 3PX4A 3SQ1A 5DK5A 5KG0A 4QWEA 5HBMB 2XCPA 4B8CA 4CGHA 4IR1A 3OYEA 4DTRA 3KHGA 3H5YA 1FXXA 2B6AA 2JEFA 2D3ZA 3HP9A 2XHBA 1VSKA 3VA3A 2FC0A 4K8XA 4B08A 3AVIA 2I5JB 4NRTA 4GW6A 2F8EX 1HRHA 3GIMA 4E7KA 1VSJA 1ZBIA 3CWJA 2FJWA 2R7YA 3QZ7A 1WSHA 1FKOA 4FLUA 3TAQA 2G8VA 4F3OA 5CYMA 2UUTA 3ZSQA 4M3YA 3TAMA 3KJVB 3CFRA 4ECZA 1T03B 4I2QA 2R2RA 2ASJA 3PJWA 2R8KA 4DTNA 4Y3CA 4RW4B 3BJYA 5J2MA 3TAGA 3BGRA 3NGIA 1U09A 3Q8QB 4R8UA 3NH1A 5HROB 2IM1A 3HPOA 2G8KA 1NK7A 1XI1A 3EY1A 4EYHB 4Z4FA 3DRPA 4EO8A 1NKCA 2D0AA 4C8KA 2Z1HA 1RT7A 3PW4A 1RDRA 1B9FA 4CFDA 4JV1A 3PZPA 2WCXA 3K2PA 1RYSA 2O4GA 1S5JA 4HCCA 2XI3A 2VWKA 2P5GA 1ZBHA 2DPIA 3ZSXA 2BQRA 1EX4A 4BE2A 3H5UA 3IRXA 1HYVA 3NF6A 3MFHA 4LY7A 5KFCA 3I0RB 4B3OB 2KFZA 1JL2A 3NGYA 3KIOA 3AVCA 5HLFB 1GOCA 3OYKA 3Q8SB 4FM2A 4ED1A 3ZT1A 1FKPA 1YTUA 1NJZA 4DS5A 5KFUA 1TK5A 3V4IA 4FBUA 3DM2B 4RW4A 2R2SA 4TSXA 2GIRA 3SJJA 4XO0A 4ELVA 4DQQA 5KFHA 4CFCA 1UA0A 2BANB 4M95A 3RR8A 1J5OB 4RNNA 1ITGA 3AVNA 5KTQA 1HQUA 3M9MB 2W9BA 2FBXA 4J9RA 4CIFA 4IFVA 4K4VA 4K8ZA 2IAJA 1UA1A 4FJLA 3C94A 4Q45A 4Z4GA 4C8NA 4JV0A 2VG6B 3KLHA 3KLIB 4XPCA 4J9PA 3VQQA 4K4ZA 5L1JA 4KI4A 5SWMA 2D0CA 5DMRA 1REVA 2IC3A 1DTTB 1SH0A 3NGZA 3CJ2A 5CY4A 4Z4EA 1U48A 2OPSB 2RPIA 3NF7A 2ITGA 4LQ9A 1IKXA 2ILZA 1IKYB 3LP2B 1QHTA 5DQHA 1XR7A 1J53A 1EP4A 3MEGA 3LWMA 4MIBA 3L2QA 3PO4A 3CO9A 4TY8B 4CJRA 1RT6B 4ZP8A 4G1QA 5KG5A 3RB4A 4LD0A 2JC1A 4NLXA 1JLAA 4DQPA 4RW9B 1HYSB 4KBIA 3MEEB 4NLUA 3LALA 2PY5A 3MR6A 1N4LA 3H5SA 3GV8B 4BDYA 2OPSA 4CF8A 3WNGA 3T5JA 2BDPA 4WFYA 1TP7A 1TKXB 3IS9B 4ZMMA 1ZBLA 3NGDA 2C2RA 3GYNA 4FM1A 3TQ1A 2EHGA 4IBNA 1RDAA 4DSKA 4M3WA 2D41A 1Q8IA 1S1XB 3K59A 3O4QA 1U04A 1RA6A 4Z4CA 3M9NB 1SUQB 4NLYA 4K4SA 1VK0A 3DLBA 5E41A 5C5JA 3TR8A 4OLAA 4TY8A 4IH7A 2P1JA 4AHCA 3UDLA 2JGUA 3KD5E 4BDZA 3S3OA 2YKNA 4F4KA 3KD1E 2YNHA 2O4IA 2WONA 2FJVA 4YFUA 1TAUA 4MH8A 4TY9A 1LWFB 2GBZA 4NCGB 1LAVA 4NLVA 4N41A 2WK4A 2IM0A 4Q8EA 4IRKA 4CJLA 2OH2A 5HLFA 1BIUA 5EU7A 2HHSA 4GVMA 4K50A 4PWDA 1QE1A 1FKPB 4H54A 1LWCB 2BR0A 4CHNA 2IOCA 4DQSA 1RT4B 1CXUA 4QWDA 3JYTB 1N5YA 5JS2A 3F73A 4YR2A 4ZPCA 4DL7A 2GV9A 1Z26A 4RW6B 1FK9A 2RDIA 4FS2A 3RMAA 3N6NA 3KK1B 5L1LA 4CJKA 3OJUA 4EYIB 3L8BA 3KK2B 4LH5A 4Z4IA 3BQ2A 5HP1A 4X2BA 3QLHB 4IG3A 4DG1A 4WXWA 4ED3A 3DYAA 3IS9A 4GMJB 3QLHA 4WYLA 1C0TA 3RAXA 4MK8A 1QUVA 2HHXA 5CYQB 1QSSA 4ECRA 1IO2A 1MMLA 4DU1A 3D0PA 2JEIA 4G3IA 4CEBA 1KCFA 3AA2A 3PW7A 4HUFA 3V81A 3H4BA 3KK2A 4M94A 4CGIA 1RTIA 3NBPA 1RT4A 5KFKA 1LWEB 2I5JA 3DLRA 4TLRA 1IKWA 4AHUA 3ZSZA 4IFVB 1RTJB 5C24B 1L3SA 4KI6A 3HJFA 2OPQB 4K4TA 1RDDA 4RUAA 4YMEA 3ZSVA 3I5AA 1SL2A 4IG0A 3SI6A 4OL8A 3G6XA 2D7SA 4ZPDA 4ED2A 4DL6A 1J9AA 1U45A 3RMBA 3MFIA 3LDSA 4F4YA 4FK4A 4MIAA 3DDKA 3PY8A 2XC9A 4E7IA 4CEAA 1C0MA 3QGGA 1TKDA 2W8KA 2PZSA 2X74A 3VQ4A 2Y1JA 3VQAA 5EUHA 2YKMB 1I39A 4MK7A 1TV6A 1JLGA 4CJVA 3NAHA 3KLEB 4ECQA 1G15A 1YVUA 3N6LA 3PJXA 3DLKA 2XCAA 2AJQA 1EKEA 4KKOB 1I6JA 4TYAA 1S1XA 2XO7A 4RW6A 3G10A 1QSLA 2G8WA 1SL1A 4ED6A 4DEZA 1YVFA 3FQLA 4AHVA 1JLQA 5KG3A 5F8LA 3DOLB 1NHVA 2GUIA 4KO0B 4M3XA 4CFBA 1CXQA 4FJJA 4Y1CA 4CF2A 2JC0A 3ITHA 2J6UA 3UQSA 1ASWA 4CF9A 3AO2A 3L2UA 3RB0A 5DG9A 4KHRA 1KSPA 4K4UA 3GIJA 3VQPA 1T05B 3NMAA 1O1WA 1T03A 3NE6A 1TVRA 3DMJA 4CJUA 3FSIA 1ZTTA 3BSOA 3KK1A 5CZ1A 5KG6A 4W5QA 4I2PA 4E19A 4DL4A 3E01B 3AV9A 3PUFA 3SUPA 4GC6A 3KKSA 5J1EA 4O3QA 4JS4A 2E4LA 3G6YA 4EEYA 3BSAA 1NOYA 1S0NA 4CK1A 2RF2B 3CDWA 1D9FA 3I5BA 1SKRA 4FJNA 2BQUA 1JLFB 3OYMA 2ZD1A 4NLGA 4ZTJA 1C0TB 2W9AA 2ETJA 3ZSWA 4NYNA 4ZVFA 3QNOA 1S1UA 3SCXA 1VSEA 3BQ0A 1WSIA 3T19A 2HMIB 4FJ5A 5K14B 3HVTA 4HUGA 4DSEA 2PYJA 4CEFA 1S0OA 3ZT4A 5J2NA 4KHYA 5JS1A 4CEEA 3OYFA 4DTJA 3QEVA 3OLBA 2OPRB 3RMDA 1IH7A 4IOBA 3P83D 5KFBA 3TANA 1S1VA 4I7FA 3OHAA 3P1GA 5HBMA 2ILYA 3L2WA 3CJ3A 1ASUA 3ALYA 5F9NA 1QSYA 2EX3A 4CERA 4WXOA 2R2UA 3CFOA 1R0AA 4DFPA 3KLVA 2J6TA 1VSLA 1A5WA 3DLHA 2KFNA 2G8FA 1Q9XA 1JLFA 2QKBA 4E89A 4BE0A 2R8GA 3M8SA 3CIZA 2OPRA 2DFFA 5DGAA 4KKOA 4F3TA 4DF8A 1JXBA 4M3UA 3QEWA 3FFIA 1TGOA 4E7JA 4EBCA 1SKWA 1KFSA 1HNVA 4CK2A 4EP5A 4FLWA 1MU2A 3TARA 4URQU 4FYDA 4H4OA 2HWHA 3NKYA 3PX0A 4I2PB 3D5MA 3HO1A 3FQKA 1CLQA 5I3UB 1BI4B 3H5XA 4AHTA 1NK5A 3HVRA 3AO5A 1HPZB 3AVGA 4BWMA 2E9TA 1C1BA 4ZTFA 3VQ9A 3K5MA 5KFAA 2HNDB 4IKAA 1RDCA 5L1IA 2LSNA 4JV2A 4IFYA 2HHVA 5DLFA 4OPJA 2OZSA 3KOAA 4CJTA 2IGIA 3OS1A 3V1QA 1S4FA 4PY5A 1IG9A 4CGDA 1BCOA 1RBUA 4NYFA 3ZSRA 3V6DA 4QW9A 4WZQA 1FK9B 1BQNA 4ZHRA 1DLOA 5CZ2A 3OJSA 4KHUA 3BREA 3NF8A 1UOCA 5EWEA 4QWAA 4KO0A 3IRXB 3S3MA 1TKZB 1S1WA 5CYMB 4MK9A 3AVJA 3CM6A 4B9UA 2Z1IA 2ZD1B 3T3FA 1U49A 5DG8A 2Y1IA 1RNHA 3OHBA 4O3NA 4B9MA 2YNGB 4RNMA 1K1QA 4AHRA 3DLEB 1JXEA 1C1CB 3H59A 3B6PA 1NNDA 4RNOA 4CHZA 1W25A 4DTPA 3HVWA 4TN2A 3OYDA 3TAEA 4O4GA 3MEDB 3OL7A 5J2MB 1LWEA 4ECVA 1HYZA 3HL8A 4KTQA 3V6HA 2HNYA 3QINA 3I8DA 1UAXA 4KTZA 3PVXA 4BWJA 3KMQA 3ZT2A 4BE1A 1BQMA 3KNAA 1S97A 1C1AA 2XGQA 5KFQA 3NDKA 1BQMB 2AWZA 1WNEA
chains in the Genus database with same CATH superfamily
1VSHA 5FDLB 2Y8YA 2P9SB 4N56A 4FWSA 3KTQA 1E6YA 4MJKA 2B51A 3IFRA 4CH7A 1NOZA 3QNNA 1C0GA 2LKZA 1N8RO 5AQJA 3ATVA 1N34J 1RHMB 3G6ES 4A5AA 4YUDA 5KRTA 2BUNA 2MGZB 2LU2A 1VQOS 1WBBA 3MM8A 4USJC 5JVGQ 3EZWA 3H7HB 2WW4A 4CECA 2PYLA 1H7WA 1ROFA 1SXLA 4JD2B 1KRPA 3O3HA 2C2EA 1RTDB 4OKJA 1JCEA 3QT5A 3OYLA 1NCLA 4N5SA 2Z0GA 2HS4A 1XN9A 1T8EA 2KQ2A 1A6LA 2HHQA 2RHQB 1V3SA 3P5JA 1BWEA 2MKYA 3ENVA 2BE9B 3EZUA 1ZAXA 5KFGA 4NXMJ 1XTZA 4DUYF 2OLWA 3VQ5A 4CLTA 2K1RA 1WSVA 1YGYA 5C12A 3KLEA 4WFZA 3DI6A 4JRQA 4DTUA 1DKGD 1HBUB 4ZVOB 5LXRA 1TUYA 5J1EB 3U1NA 3I0SB 4DV2J 4BRPA 4TQRA 3MD1A 1C2PA 2E2PA 3RYLA 2IAJB 3AA5X 2DXFA 5G4DA 4GKJK 2CPZA 2A5XA 1PKUA 1WAFA 5T7BA 3M2RA 3EDRB 5LY3A 2EC0A 2XSFA 1GOBA 3VF2A 3GIIA 5A2QU 2KT3A 1BO5O 3QIOA 5JLFA 2O8CB 3OSPA 4I64A 1RT5B 2J4RA 1AUSL 2C1EB 3IR7B 4DUTA 1NGEA 1N32J 4H5NA 3C15A 4IO1A 5IT9U 2AJ4A 3D6TB 2J8AA 2E1CA 1WHVA 4EZ6A 2MGZA 2GW8A 3PEJA 2NZTA 2BE7D 4PQUA 1HNXF 2MQNA 3HT0A 2YKOA 4LF6J 2BV3A 3LAMA 1M5OC 1WKJA 3HRGA 2Y0SD 3L3UA 1S76D 1KD1T 1JLAB 3LQVA 4PXBA 1AB8A 1FRJA 4R0EA 4C98A 2FZCB 3DRRB 4TQSA 4F0HA 3MN5A 3AH6A 3A2FA 1YITN 2ZHAA 2D3UA 1N33K 2VQEK 4UY8O 3L6QA 1FRHA 2NXNA 1HJRA 4XPEA 4OJGA 4FF2A 2QYGA 2HK3A 2B9WA 1RT7B 2WBNA 2R42A 4DI6A 3DRPB 3VQ8A 3ATUA 5HMXA 4NLDA 3M32B 4YS2A 4KPYA 1JLBA 3ICLA 1AZSB 2BW7A 4KTWA 4MFBA 4LREA 4WZMA 2AHOB 1M1HA 3KLIA 1X3NA 1YSJA 4JP8A 2ZC4A 4RG8A 1K8KB 4FJHA 4I9QA 3HF5A 4ZVTB 5J1PA 4QR1A 1VRTA 4E7LA 1N56A 3CUNA 2UU9F 1SV5A 3PV8A 1DTQA 1HBMA 4YORA 3JTNA 4NLSA 2I38A 3CDBA 3WXJA 1QD1A 3C95A 3VQ6A 2IJRA 2V9WA 3W2WA 1HQEB 2VG7B 3LM2A 1RT6A 1A5VA 4K2XA 3J7AP 3MDQA 1VIXA 1DQ8A 3EYZA 4Y28C 2HVDA 4V19S 1SC1B 4DPYA 3H2LA 4LMZA 4NXMK 3U3YA 1PIEA 4LF4F 2A10A 1Y64A 3PHTA 1WF2A 2IBKA 3WXIA 5AXLA 5AQYA 3HMJG 2XQCA 4LF5K 2BEFA 4CJ5A 3NHGA 2W7AA 3QFHA 1KVBA 3FMWA 3IXQA 5BPMA 3WIVA 4RBUA 1K8AO 3N0VA 2KB2A 2OSQA 4L3QA 3OYJA 2B4JA 3DLEA 2JEGA 3VVTA 2R7TA 2P9GA 5CA5A 1RA7A 4F26A 3QQCD 4WCEL 3R7BB 4MFBB 2E88A 3CC7N 4W5TA 1FVQA 2C2ZB 1LXNA 2DGTA 5FLXY 4CFAA 3VQDA 2DBBA 3NGTA 4DR4J 2F9WA 4NLPA 2ASOA 4OX8A 2XMMA 5J2PA 2IM2A 3MM6A 5CYJA 4CP5A 5HK4A 4FDFA 4BG8A 2DHAA 5CD4H 4QR2A 1RHQB 1KLNA 2IDOA 3CCRN 1SCJB 4CH0S 4HKQA 5D15A 5F9LA 1UWBB 2M0GB 4AQYJ 3V4IB 4C8LA 2VWJA 4CESA 3QYYA 1U4BA 2E6LA 1X4BA 4U95A 1VSIA 5DM6L 5HVGA 3VV2B 4IDKB 2VU5A 1HYSA 3AA4A 2HHUA 1HNIB 4M3ZA 3SZ2A 5F8IA 1DLOB 1ZETA 3NVMA 2ZKTA 2LA6A 2NLWA 2R8JA 3CDUA 4TXSA 1GLAG 3M6UA 1T9VA 4ENOA 1P27B 2V2QA 4YB6A 2CKWA 4H4KC 4O0IA 3TUIC 3ZZ0A 4X66F 4FWRA 3KWIA 2JLEA 2ZBIA 3G96A 4U7UK 4MKYA 4CGGA 4JI5F 4WQ4A 5KFDA 4WBFA 3T1HF 4FWMA 1FKOB 3SSQA 1WN7A 3O8WA 3TZYA 3HCXA 5DDRC 3ENWA 2FIUA 2MLXA 3GSDA 3TU5A 5DJBA 4FYWB 3FGVA 3B4DA 3DLLL 1L3VA 1OWXA 5GAEU 5DDOC 1GOAA 4DL2A 1TL1B 1NHUA 3ZT3A 4B3MJ 2FVCA 2N4DA 3AAPA 4DU7A 4FWNA 3WDOA 2JLGA 1RHJB 1HW9A 3G4SS 1QAJA 1G1XA 2ZH6A 4IUFA 3A3NB 5H9FJ 2FBVA 4IH6A 3CI5A 2YQ3A 1KOOA 2OO4A 1ZC6A 1KHWA 2EKYA 4FVCA 4DTXA 4HTLA 3VTIA 3CIMA 4A48A 4ZP9A 4OPAA 1KEKA 4NLOA 4NZ6A 2E20A 3UN2A 3R97A 5KFMA 4M3RA 2RU9A 4MAKA 3F9MA 2D4WA 3HPGA 2XY7A 4M5GA 4WU3A 5GMKa 1Z4UA 3THXA 3J80Y 4ES3A 2ZWPA 2ZJRL 4JI1F 3QO9A 2UUWA 1RBAA 4N77A 3PX6A 4KIAA 4ILRA 3NGUA 1SB6A 2XZDB 1C1CA 2IC3B 3JS6A 1Y4ZB 4DJBA 2HFSA 2J76E 2LQJA 3DM2A 3KUGA 2ZOGA 2UUBF 2ZOFA 1DQ9A 3D6FB 1BWVA 3Q8VA 4Q43A 4NB4A 2OPQA 2ZITA 4UOCA 3GILA 2BM0A 3M8PB 1WOSA 4QIWD 1F6TA 2VWBA 5ETSA 1RT2B 4USKA 2KI2A 2U1AA 1K73O 4IEIA 2FBYA 4DV6J 3WHIA 1NJXA 4EO6A 4RPFA 4UUXA 4FVUA 1S1WB 2XZTB 4DR5F 3GP9A 2NPFA 3JB9k 3QT6A 1BA0A 2ZH9A 3DXBA 4Q2MA 1JLEA 3FVYA 3EZ5A 4L76A 4P2SA 2AZ1A 3HD1A 1ZAVA 3W5ZA 3GIKA 3HHKA 3J81j 1PJ5A 1U1KA 4OKEA 2PDAA 3J80U 1IR1A 5M2PA 3IMXA 2QG9B 2GS8A 1VS3A 2W40A 4HLBA 4JI0J 3K8VA 4A8FA 1XHXA 3CJSA 3EICA 3JQMA 3K7RA 1VQ7S 4EFAC 3UE5A 2P51A 4MT1A 5E3CA 5HRPA 5EHHA 4NWBA 4ZN1A 3EWGA 5E7OB 1WSEA 2VBWA 3NLCA 1C6VA 2FY8A 3N6MA 1EETA 3MMBA 4P73A 3LF0A 1R8AA 3T7ZA 3H98A 3IR6B 3HSZA 4M41A 3MAQA 1ZM3A 3UFCX 3V9XA 2K06A 1S6QA 3CDEA 2PI5A 4OPKA 3TI0A 5I4MA 2W6LA 2E1YA 4OHYA 4Y34A 2HHPA 3CD5A 5KFRA 4RW7A 1LW0A 4B02A 3UIQA 2J0XA 4XEIA 4YNQA 2ZNYA 1NRKA 4A8KA 1YRUA 3ISND 1B9DA 3WX8A 2FYXA 4CM2A 1UMJA 3GPAA 4ZVHA 3AVFA 2P9IA 3DRYA 4B1VA 1SH3A 1ZS6A 5SZTA 3HVAA 4ZPAA 2RD5C 4YOTA 4Q0BB 2HBYB 4Y2CA 2YCHA 4DMZA 2HQCA 2HBMA 4MQ3A 1OYEA 1M5VC 2FTRA 2AYEA 2VG7A 2ZKUA 2P9NA 2UUAF 2GGPA 1Q79A 3NL0A 2YNHB 1D8ZA 4DZ6A 2MPUA 4YY3F 3HXMA 4ICLA 2DNRA 2IRUA 4UF4A 3R5DA 3OW2M 3TTDA 5KFZA 4EWTA 2WC9A 1JB0C 1MWYA 2CAJA 4DR6F 5AFUA 3CM5A 4H0TB 4WJBA 1U0HA 2HQDA 5KI6A 4IR9A 5AE2A 4C0HA 5HAOA 3FMBA 1P9QC 2HVIA 3TSUA 5GINA 2P5OA 1KLMB 1H2TZ 1UVKA 4CJEA 1RWMB 3CJKB 3TSQA 3QWUA 2MQMA 2DNHA 2EBGA 1ZH5A 5C24A 3M2VB 4GY2B 3OYAA 1HKBA 4Q44A 1JIHA 4HDGA 3AA3A 2M8HA 3HSGA 3D6MB 2PAVA 4DV5J 4WIQA 4H8KA 1RTJA 4CW7B 4DV5K 5T41A 3CQ8A 4V19J 4YOXA 3HHLD 2ZBPA 2DNZA 1XC9A 3SYZA 1C0FA 1FRXA 4A5BA 2W2OP 4DLGA 2YWEA 2VCPA 1BHLA 2WRMA 3MM7B 4FZYA 4YP3A 2IHR1 5AQVA 3CEDA 5HVFA 4AILC 3RZAA 1MG7A 3RWUA 1MLAA 5F41A 3HX9A 4FJ7A 5LMUJ 2DNMA 1RACB 4ED8A 4LQ3A 2X1FA 1EKSA 4QWBA 1GQEA 4ELUA 5LSRA 4N76A 5E3QA 3EGNA 1VC0A 5GMDA 1EARA 2VKZG 4ZJOA 3M3ZA 1KAZA 3OYGA 1FJGK 2ZNZA 4FYYB 5LJ3Y 3MN9A 1SV5B 2RDDA 4LIRA 2CNLB 3OVAA 2W9CB 1WI8A 3HT3A 4MKBA 4JI6K 3U6FA 4CHQA 2J9EA 2RN2A 4JKCA 2FVSA 3ZSYA 3VGVA 4DV0J 2V63A 4FCYA 5D4OA 4CO3A 3ZFVA 3T1YF 3BR9A 1QAXA 4P2MA 2NRXA 4E7HA 2L9NA 3GL1A 3PW0A 3C16B 4Y6IA 4AQYK 2OIHA 3V6JA 2MZJA 4QYZJ 1KFDA 5IQQA 1JLCB 1DHMA 4RU9A 2OHDA 1XHZA 2OZMA 2W9CA 4LR7A 5DLGA 4XDCA 4O3OA 4ZCIA 4ZVPB 4CLWA 4NA3A 1UZHA 5BPNA 4ELTA 2AZ3A 3OYCA 3D0HE 3PRVA 2QEXN 4F4WA 2W42A 1Q86O 2O8FB 2HQFA 3MURP 3MCPA 3RRHA 3SFGA 5IC6B 3PRBA 3L2RA 3S41A 1VSDA 4JI7K 4PQAA 3MR5A 3LL3A 2YQ1A 1N36J 1R8HA 3QGIA 3U8XA 3OV7A 3M2RB 1CZBA 3QICA 9RUBA 4P6QA 1U26A 4A8XA 3ZTRA 3NVKA 2RUGA 1XWLA 1WC1A 2IYIA 3HHLC 3LA0A 2ADBA 5D8HB 3DXMB 4KB0A 1S1TA 2Q66A 1FF2A 4RNFA 3VEOA 4NMLA 4O5BA 4ZP7A 4CRJA 3TYTA 3C6UB 4ANEA 4FL9A 3CCEN 3EVOA 2MY8A 4CTAA 3GLJA 1REVB 4DB3A 4CJWA 4H0XB 3ZLJA 4M3TA 3TAMB 4O23A 3IWXA 3EPIA 3GOIA 3S9HA 1NLVA 3RRKA 1RTHB 5HANA 4IDHA 3BO4A 4LF4K 3DN9A 3AQOA 3R5CA 1XNQJ 1K9MO 3TABA 4DL5A 1X4FA 3V9WA 4RUCA 1LCUA 2AEFA 1NU0A 4BQLA 3S01A 5JMNA 3A8JA 1X3MA 2YX6A 3DLGB 1S48A 3MM6B 3AVKA 3H3NO 4DU3A 2RUSA 1UVMA 3HOTA 4KH5A 5GADI 4WTOB 2WOMB 3JTPA 4I6MB 2MZTA 4BC9A 2KTQA 3OBWA 3TJ8A 1AFIA 3PX4A 2A1SA 4B8CA 5ETNA 4IR1A 4F04B 2NZ4A 1SZ2A 4DTRA 3W66A 2JEFA 2LVWA 3WUHA 1UTAA 3THPA 1XNRJ 1FJGF 3AAWB 2CWKA 3P8BB 1MSWD 3MMJA 4W4MA 3WXKA 2VKRA 4WP8A 2KYXA 3QZ7A 3JSYA 7FD1A 1E3MA 4DCHA 2HF3A 1HNWK 3M6VA 4M3YA 3UDCA 3TAMA 1NJIT 2O01C 4ECZA 1URNA 3MOZA 4BG9A 3PJWA 4DTNA 4Y3CA 4RW4B 1PSDA 3SDEB 3TAGA 3BGRA 3NGIA 2W2PP 1X4GA 3FK4A 2ZGYA 4EO8A 2V8HA 2P9PB 1WACA 3R7SB 4C8KA 5G0RA 4DR7J 1AT1B 3FNNA 3VEXA 3AOAA 2O4GA 2XMWA 2PIIA 2XI3A 2VWKA 1E6VB 4JEPA 1ZBHA 3MAHA 4J37A 3ZSXA 4AD6A 3FBBA 5MLCQ 3OR1B 4UW2A 1O0PA 4BE2A 1ITPA 2HK2A 2HBRB 3NF6A 4LY7A 3HSDA 5DZ7A 3BGLA 4O0NA 3QPIA 3THWA 4BR0A 3OYKA 1B0VA 4LF7K 3G25A 1RXOB 4JBCA 1FKPA 3KUHA 2ZM6F 3HHNB 2KHCA 1NJZA 4DS5A 1VQNN 1QTNB 1VLOA 4QS8A 2YJFA 3ONQA 3DM2B 3QBXA 4XO0A 3CJKA 1OYDA 2APOA 1KQSM 2MKJA 2WSEC 3CB4A 3AVNA 1KKHA 5KTQA 3N28A 2FBXA 4FP9A 4U9RA 4X4NA 1NGAA 3SQGA 1VK3A 4K4VA 1PJ6A 4LIWA 2IAJA 3OBIA 1JNRB 1WEYA 4OFZA 1N8RT 3KG0A 1RP5A 2NRRA 2PT0A 5IM0B 4Z4GA 5FJ4A 3J7ZT 1NSPA 3KLIB 5AZIA 2X51A 3H45C 1T9XA 2MJNA 1N36K 4KI4A 3D6RA 4WKYA 2MLZA 1RHUB 3GMGA 4DR6K 2WSFC 2F4VJ 2G4BA 1SH0A 2AEMA 3R1LA 2HEKA 3CJ2A 1ZOTA 3H8YA 3GFYA 3MMVA 3K89A 2BM1A 3IM9A 1IKXA 2K3IA 2J7WA 1XR7A 3KG4A 1EP4A 2N7YA 3P3DA 3RAMA 2BH1A 3AQPA 3PO4A 1VIOA 4F0MA 5L46A 3CCMS 4USWA 2WFBA 1RT6B 1Q5YA 2OTJS 2HZCA 1LK7A 4G1QA 4USVA 4B3MK 1BD6A 5M2UA 4CLSA 4NLXA 4DQPA 2RRNA 4RW9B 4JHDA 3MPVA 2QLJB 1FW6A 2R7QA 1N4LA 3H5SA 2CQ2A 4BDYA 2OPSA 1FVSA 2BDPA 3EN9A 4FSVA 4TU9A 3NGDA 2A1BA 2C2RA 4FM1A 5GAHI 4YDUC 2DJWA 4FZVA 5U47A 2CNKB 1SI9A 2D41A 1Q8IA 3G82A 3M9NB 1SUQB 5H9EJ 1VQLS 4UY8T 1IJEB 4K4SA 5LM7E 1DT9A 1GFWB 5ADZA 5E41A 2PMWA 4IH7A 4C6AA 4XAKA 2P1JA 4LF5F 3UDLA 4QYRA 3KD1E 1YZ7A 3TJ9A 4E98A 2CG8A 2VQFF 1BU6O 2DYAA 1IM6A 3Q0AA 2ZZMA 4DUZK 5LMNK 1IBKJ 1B70B 2YWFA 3M30A 2GBZA 1IBLJ 5F2RA 2Z2LA 2DK2A 4N41A 2NCKL 4IRKA 1JQGA 2OH2A 5HLFA 2HHSA 1CJUB 1FKPB 2HYIB 2YHXA 4I6YA 2IOCA 4DQSA 5A8RA 4JI7J 1RT4B 3F73A 4YR2A 4ZPCA 3ZNJ1 1Z26A 1IR0A 2M9KA 4G65A 2RDIA 4FS2A 2VOPA 4KBOA 3KK1B 5L1LA 4CJKA 2FSJA 3L8BA 3KK2B 4CZMA 2ZH1A 3JQKA 3E2EA 1WC5A 5HMYA 2ZF5O 3FZHA 3TEGA 3QLHB 2Y8WA 1V5IB 3W64A 4DG1A 2M3DA 4ED3A 4CZKA 3DYAA 3IS9A 4DN0A 1GLBG 3QLHA 3D66A 4ECRA 4DU1A 2AYMA 3K5PA 1WKKA 2P9KB 3O1BA 4ILJA 4HUFA 4OYWA 3UD5A 4J8FA 1VMBA 5ELZA 3QDKA 1TL7A 1P90A 3CJ8A 3D4JA 5KFKA 3BUZB 2I5JA 1Q7LB 1K8AT 3O4WA 2QW9A 4X84A 4IFVB 4YB5A 1A0OB 3C6HA 5D77A 1YBUA 1RDDA 4YMEA 4M5KA 4H0YB 5T7LA 1PAEX 4NE9C 4IG0A 1VQYA 5F0UA 3O9QA 3G6XA 4HR2A 2WB1D 1J9AA 1U2VA 4F4YA 4FK4A 5DDPC 3NEKA 3CSKA 3CIPA 5GIOA 2X74A 2DD8S 5EUHA 1LXJA 2OFGX 4OYAA 2BJ9A 4ECQA 3PKMA 1VQ5S 2AJQA 1EKEA 1I6JA 3CQYA 4DX6A 1PJ7A 2XO7A 4C3KA 1I3OB 3GYGA 4H0OA 1PYOB 1Q7YO 4CLFA 2JL9A 4P2XA 5F8LA 1NHVA 2YJEA 3P6YC 4Y1CA 3N9UC 2EK1A 3X3UA 3I87A 3AO2A 5BR8K 1L3KA 3L2UA 3RB0A 4KHRA 4K4UA 3Q86A 4K42A 4L3NA 1IWAA 2EVZA 2JOQA 3U1LA 1V9OA 2XNRA 4OI3A 1O1WA 3FRYA 3NE6A 1TVRA 2WTUA 3HBTA 2QRRA 3QJPA 3MZIA 5KG6A 4Z94A 4W5QA 4DPTA 4I2PA 3AV9A 4UOFA 4TU7A 3PUFA 2M88A 1CLFA 4S0MA 3WIUA 2V8VA 2E4LA 4KGXB 4ZDNA 3MOJB 3BSAA 4CK1A 2GMLA 3CDWA 4C0BA 4WQ5A 4AUKA 3OYMA 3SMZA 2ASYA 2DITA 2W9AA 2K3KA 1F5CA 2CJ9A 3TRGA 3N79A 3SCXA 3VAKA 3U9ZA 3L7OA 1VSEA 3LGNA 5KQDA 1WSIA 2FC8A 5AE3A 2HMIB 2ZWOA 1TMMA 4TKTA 2O8BA 8AT1B 2PFUA 1KQSR 1FRIA 4KHYA 2FHKA 4DV1K 2DGXA 2QLBB 2V4JB 3RMDA 7AT1B 3HHEA 3TANA 3OHAA 1IQTA 1Y3KA 5HBMA 2ILYA 3L2WA 3W3SA 2HBKA 2V8GA 3HOSA 2EX3A 2NXCA 2AW0A 1R0AA 1RJJA 3D1OA 1GH8A 2IRYA 3BYRA 2O67A 3I56N 2Q2RA 4CLYA 4QBUA 3KLVA 1VSLA 1A5WA 3DLHA 1CS4B 1JLFA 1GLFO 2LP4A 5B08A 2ZBRA 3VVUA 4NXNF 2DFFA 1RI7A 3CULA 2HPUA 1KQKA 2BABA 2HAFA 1YWXA 1JXBA 2LFVA 4GMKA 1FFWB 3FEXB 2OTLS 3M6WA 4EBCA 3CHWA 1SKWA 1WOOA 2IVYA 3PXGa 1UCNA 4EP5A 2R7RA 3TARA 4KY3A 4URQU 3LDOA 4FYDA 3NKYA 3AB4B 1PC5A 1VQ4N 3VF4A 2XYGB 4KH0B 3TVYA 3VZIA 1XQIA 1BI4B 3FBEA 1RQ0A 3OTOF 1NK5A 1NZ8A 1DGKN 4BWMA 3VMFB 5KFAA 5IV3A 4DR1J 5L1IA 5C7PA 2B9XA 4UOGA 2P2CB 2EBEA 1NPRA 4JV2A 4EAHD 4IFYA 4CO5A 1R8BA 2HHVA 2C3UA 3GG4A 3A8IA 2W25A 2DNKA 3LUYA 4CJTA 2IGIA 3CJBA 3Q8UA 1TELA 2E1ZA 1IG9A 4P7VA 3QJLA 4EUVA 1RBUA 1P6TA 3V6DA 3N01A 1MWZA 4BRCA 2GAHC 3BKUA 1NJIO 1GMWA 3OJSA 3CCVS 3CCVN 3BREA 1NM1A 1KQFB 1FNXH 4QWAA 1R3NA 2FDNA 4USMA 3S3MA 1HNWF 4C9DA 4MK9A 2Z1IA 3T3FA 4JHDB 4ZK7M 1RNHA 4LFAK 4Y2MA 2EEYA 4OZNA 1YF5L 4BR2A 1JXEA 4B3TJ 2DRAA 5KOWA 3MCNA 4DV2F 2XMUA 4DTPA 1R43A 3OTEA 4TN2A 3ILIA 5J2MB 1X60A 4ECVA 1S5ZA 3I8DA 1UAXA 5AXMA 3PVXA 3MMBB 1RSCA 2LDIA 4ISGA 4RO0A 2EWHA 3BH7B 2HSEB 4N8OA 3G71S 2XGQA 3NDKA 2CPYA 3LWLA 3ENAA 3TJAA 3H1QA 2ZH7A 3A4TA 1W9HA 5F8GA 3PCOB 2QA4N 4IRCA 1VRUA 3OVSA 1UWAA 4OLOA 1Y5IB 1HNZF 4X65J 2W2NP 4NEZA 3NG8A 2KZMA 1YG0A 4ZLJA 1YHQN 3K5OA 2GC8A 3AXMA 4PR6A 5BREA 5H1SV 2M8DB 1E4FT 4W5OA 5J2QA 1UVIA 3NOGA 3ZX3A 2E8AA 1WBDA 1NDLA 3TVZA 4FOIA 2D1KA 3RB6A 2J0QD 3TWZA 2KXNB 4EI2A 2E7VA 3DLLQ 4ZP6A 4NEYA 1VQLN 2JWLA 3BF3A 4LBIA 3DOMA 1QHAA 2VG6A 4HEA9 1PGZA 1HWIA 5J2NB 4CK3A 1LAWA 4Q8FA 5L1KA 3VZHA 4F4XA 2G9OA 4U7CA 1RAJA 2G1DA 5KFJA 2XHWA 3ZEUB 1YAGA 4MYUA 4DX7A 5KGWA 4WFAL 3G0ZA 4O3SA 1NSKL 1TKTB 1X1PA 3NMRA 1KOHA 2FSKA 3VQSA 1B0TA 1XC3A 5JVGL 4CIGA 4JI2F 3G6VA 4KB1A 1UZDA 4MO5A 4BCAA 1FDBA 2FHMA 3PIPQ 5D4PA 4NRUA 2ZQBA 3DYAB 2OPPB 2GO9A 3SQ0A 3WQTA 5KG7A 2EG1A 4CJFA 1A7GE 3OBYA 3V1OA 3UKUB 1RZMA 4D3HA 2RKIA 1D3WA 2AX0A 5DS7A 4Q0BA 4RBTA 4ID5B 3Q8PB 2GHVC 2ZH2A 3ZZOA 1UVNA 3VALA 1V3ZA 3TWHA 4IDKA 4WP9A 3AVBA 1TK8A 5KT7A 4WFXA 1RLCL 4PG4A 1QVGM 5KAKA 1D4XA 1DJ0A 2HNZA 2DHGA 1S9FA 3T1HK 3BSNA 1H2UX 3NMUA 2D9OA 3K58A 3NNHA 1KVCA 5CXTA 3QFPA 1NH7A 3M30B 4X4QA 2G0JA 2HVHA 4X65K 2N82B 1S4EA 2M70A 3AFGA 4IOAL 3R27A 1P1LA 2BW2A 4MKAA 4JKDA 3BZQA 4LF9F 1NUEA 2ZH8A 1KDNA 2OAUA 5HQMA 4KRFA 3IN5A 1NK4A 2B6AB 3H6EA 5KFXA 2OKQA 5LT5A 1QVGR 3M8QB 4CO4A 1EX8A 3QATA 2Q1NA 4ES1A 5AQIA 4F50A 2GNKA 2BRKA 1XMOF 1RDWX 2JEJA 4AH9A 5GAEP 1CZAN 5AJ3F 1KXPA 3AVHA 4OX7A 4B1XB 2UXDK 4KHMA 3N4QA 2FGCA 1F2HA 1WNSA 4JI4K 4CLUA 4FWOA 5H9EK 3DOMB 4LSLA 3GWCA 2EC2A 3JYTA 1N5YB 4AL6A 2CRLA 1FJCA 3SPZA 3OD2A 2AP6A 3GV7B 3OYHA 3ID8A 3BV8A 5I42B 2GVDB 2UVRA 4Y0FA 4FPRA 2ZJQQ 4JI3J 3OVNA 5JUMA 3OYIA 3W7BA 3QSIA 3L4BC 3H90A 5AQHA 2WVCA 1EWRA 4R25A 4ZJQA 4RW8A 3WQUA 4M8LA 3LZJA 1IBMJ 2HHHK 3D0IE 3BZKA 2C3OA 5THWA 1K44A 2FJEB 4ZPBA 1RTIB 3KHRA 4A8SA 4IFYB 5AQWA 4HHTA 4ZN3A 3SBMA 4ER8A 4K59A 2ASDA 2CADA 4DV1J 3OYBA 1YI2S 2K8GA 5F0XA 5DO2A 4J9SA 2UUAK 2R7SA 3UR0A 1VSMA 3PR5B 1RTHA 3R6MA 3CC2S 2QTDA 3VERA 4O0JA 2HNYB 1HNIA 3CQXA 3AB2B 1AZSA 1WDTA 2CIMA 3I0RA 4J9QA 1R6YA 3BQ1A 4BRDA 3RR7A 1NWKA 1RAEB 1K9MT 4X4PA 2VG5B 1RAFB 1QDUB 3CCTA 2ZHOA 4BRMA 1FJ7A 3IAYA 3UDVA 3J7AN 3HTVA 2IVNA 4KV8A 3ILOA 4HWIA 2DPJA 3VGSA 2J0SD 5KFPA 5EX5A 3DLKB 1TTHB 1EP4B 1GNKA 4X4VA 1P8ZA 4OLBA 1WUAA 2AGPA 3OVBA 1TAQA 1CPZA 4RW9A 1RE1B 4UQGA 2FXUA 2W4DA 5F3TA 3D2FB 2W4CA 3R6LB 4LSNA 1LOUA 3CCQN 2OANA 1ATRA 3VQCA 4LFBF 1J2VA 1UAWA 2AQ4A 3TQEA 3NY0A 2C22A 3SCIE 4GV3A 2CVIA 3P39A 1FXDA 1R27B 2GIQA 2JVOA 3A1YG 5LJVA 5FLXO 4CBXA 1Q53A 5LMNJ 3M2VA 3NNCA 4HVJA 3CG7A 4AYBD 1Q7YT 3O9UA 1REGX 3R5AA 1FERA 2CQGA 4J2EA 3TAPA 2GJIA 3HK2A 1SJ3P 2E5IA 4BR4A 5KFIA 5ADXA 3P4UB 1XNRF 2QMUB 4Y65A 1FWPA 4DR1K 2MQQA 1EAYC 3GJRB 4C97A 2DNGA 4DV6F 3R8YA 2CQ4A 4HT7A 4A2BA 2UU9K 2Y1LB 1T9YA 4QW8A 3LDQA 4PUOB 2RSQA 1AROP 4DQIA 2C3YA 4OZLA 4OV6A 2FZGB 1QY7A 5G0RB 3QIPA 3LP0A 1TKXA 3CJRA 1VC6A 2Q31A 1RILA 2ZVSA 3OPKA 4ECSA 4AL7A 2J5AA 2RHSB 3NS7B 4ZHRB 5A2QO 4O3RA 2UUBK 3PLAA 4IYQA 4ATNA 1SL0A 3QEIA 5D6GA 2OGUA 4CJ3A 2CXEA 4RUBA 4Q5VA 4WFBL 4KC5A 4H4OB 5HL7Q 1G99A 3T5LA 4KHWA 1W2BR 1XIQA 2VG5A 5DQGA 2N7CA 1KVAA 1Z05A 1Y10A 2VFTA 4J9NA 1TV6B 1UJ5A 3R8EA 1IKYA 3LP2A 2E1MC 3POTB 3M7VA 5F8MA 4UT4A 3H2VE 3SUQA 2AU0A 1X9MA 3M32A 4RL1A 4LF8K 4LF6F 3AD8C 4OV1A 1RDUA 2IA0A 3NFAA 4BC5A 2FSNA 4CZJA 1YRXA 2IRXA 5KPTA 4IOCQ 4AHSA 1HX1A 1M1KT 1SJRA 1NGIA 5KPRA 1NBEB 4M7XA 3WNHA 4JYAK 3RUBL 1UPMB 1OPZA 2V68A 2P9LB 2ZH4A 2JWNA 3EE3A 4NX9A 3PYDA 2PA8D 2QFJA 2YNGA 4PUOA 5GADU 2NYHA 5GVQA 2GFFA 1MN7A 3QMQA 3I6PA 5HQLA 2RHKA 4M63C 2M5YA 3EGZA 2BKPA 1TUUA 4C3MA 5IOLA 5E33A 3GONA 3D54A 3W1YC 3VAHA 3TZWA 2F96A 2CFXA 3HP6A 2PMHA 5B0AA 4B9TA 5AQRA 3OXLA 1J5EJ 1TFYA 1NGBA 3A5MC 4DFKA 1U2CA 3CJ4A 5I3UA 3C6UA 3I4HX 1OS5A 1I94K 1HHQA 4YEAA 3R7NB 4DV7J 3QEPA 2NXJA 3PNIA 2GTDA 5D0GA 2W1BA 1LW0B 2V51B 4Y1DA 1FNMA 3KKFA 5LL6d 2E1RA 4DR6J 1BE4A 5D0HA 4P71A 4U7UD 2RQ4A 3O3GA 3LPEA 4NOHA 3NRBA 2FVQA 2IJFA 1R0AB 1BC6A 4CF1A 3WC2A 3TOQA 2ITMA 3E01A 1CULA 3FKBA 3UCZP 1KNZA 4C7QA 1F5BA 3WC0A 1F2GA 3GJTB 3HHLB 2YPYA 4I68A 4BGAA 1RWNB 4YB1P 4UY85 5CYQA 3BGUA 2CPJA 2J6SA 3OW2R 1KP6A 1IBCB 3AD9C 3IWNC 2BYCA 4JB8B 3SAFA 2BACA 2B7CB 2DR9A 4I6MA 3G6EN 5KFNA 1C4CA 4QS9A 1FA0A 4L8RB 3NH0A 2A2DA 4JV5F 1U1NA 1DY3A 3DLJA 3VAFA 4JI7F 1IKVB 4DF4A 3C16A 1VQSA 3A5NC 2F63A 4FXWA 4YDXA 3AVMA 1HFEL 2MQ8A 5J1NA 6FD1A 1QM9A 2XY8A 3QWPA 2MQOA 3PYEA 2OPPA 1S72S 3LANA 1RLDA 1D5AA 2K7KA 2QZ8A 1U1MA 2FGOA 4KAZA 2QKKA 2HNDA 3B6BA 3NGRA 3NS5A 1U1LA 1EJ7L 2HURA 2P5VA 1GX6A 5BYSA 5B0FA 4D3GA 2UXDJ 2B3TB 4F3QA 3A8YA 1HUXA 2C2MB 4QAGA 3SPYA 1NK6A 2VPZB 2XY6A 2HIQA 2A40A 1U6FA 3ZEUA 1NK8A 2YQ0A 3JSMA 5I3PA 4PCQA 4GVLA 4HTJA 2ERRA 1SJFA 3B82A 2KG1A 4JNEA 3J7Z5 4IRDA 3MPYA 2L3MA 1TL4A 4RU2A 4WTYA 4FWQA 4BC3A 4O44A 1RWWB 2QE5A 4FNIA 4LC9B 4X66J 4GO7X 5D0RA 2CQIA 3JXOA 4U67L 3IWLA 4KH6A 4HYKA 1ZBSA 1JKHA 4ECWA 2JHEA 3OFGA 1N5TA 2RKIB 1IBMK 2KHDA 4EFHA 4ECXA 4DPUA 3HZ6A 2YY3A 4JI4F 1N34K 3DCAA 1WC0A 2OTLN 1RT2A 1WEXA 1MMDA 4ES2A 1SQFA 4E0DA 1JNZB 1U1PA 2GCFA 1RBRA 3J81O 2IS3A 4ED5A 1XJWB 2IJNA 4O3PA 2YHWA 3GSIA 2XSJA 4O8KA 3KHHA 1C1BB 4DLEA 3A5OC 1NPPA 2QLFB 2ZGZA 4JRPA 3CFPA 1JX4A 4GC7A 1TKZA 1H1VA 4NPOA 1HR0K 3LP3A 2ZDOA 2H65B 4DV3J 2BXJA 2X6SA 2HBQB 1FRMA 2VC1A 4NLRA 1NDCA 3G86A 4H5RA 4U7BA 1FWLA 2IBOA 2F9DA 2HFUA 3CJ0A 3UN3A 1QVFR 5HMZA 5EWGA 4OYBA 3RBZA 2X1GA 5IWAF 3O8MA 2UXBF 1ZYQA 3NH2A 1VOMA 2EG2A 1LW2A 2R4FA 1V6HA 4K5SA 5ETVA 2XEXA 4N47A 3HFZB 3M8YA 1P1TA 2HIYA 3Q89A 1NO8A 2KXFA 1VQKS 1TL1A 2Z2YB 5AQNA 3NAIA 3DOKB 3SQ4A 3PHEA 2YH1A 1V5VA 5K8PA 3HJVA 1AUDA 4O4RA 1O5JA 1WTBA 4QU6A 2E2QA 3EE9A 2XLJA 4OJ1A 1U6BA 5LL6Z 4YHHJ 1EO1A 4YOYA 4U8VA 1LQ9A 4I4BA 1Z2ZA 4DX5A 4G1IA 3I8BA 1FDDA 1MU2B 4MKVA 1RBTA 2Y9HA 2CDRB 1KQGB 3HDSA 2OP5A 4KT0C 1N48A 1S6PB 3GR0A 2HHWA 4GNIA 4B9LA 2A3JA 2DIVA 1HNXK 1L5UA 1HJOA 4C8OA 4DOZA 2Q1LA 3T69A 4E1JA 3P31A 2A0FB 4Q7AA 2FVPA 3KJVA 1XR6A 5BXIA 2X3GA 1B4SA 3FBFA 3ULEA 4B9NA 2VASA 3RW7A 4CO0A 1NJYA 2Z1GA 4PQUB 4BREA 1F21A 4LH4A 1FEHA 3OUYA 2XYPB 4CF0A 1BL3A 2UV8A 2JX2A 3CPEA 4A62A 1RHKB 1DZ5A 5HRRA 3DRXA 2UUCF 3O4NA 4JKGA 2VH7A 1T0TV 2ZUGA 4LR9A 1OQ3A 4OKKA 3DRRA 3DFEA 4NCBA 4E2FB 1F60B 2KYZA 3E8OA 4NXMF 2CH6A 3HVTB 1APSA 4WE1A 1JLGB 1J54A 1T9TA 1RGIA 2HHTA 1I3AA 3TZXA 4PXDA 1H6KX 4CEOA 2Q43A 2W7OA 1YLXA 3IG1A 4PEOA 2XLKA 2AGQA 4K5RA 2XO6A 4RR5A 1IV0A 3SQ1A 5DK5A 4QWEA 2A6AA 3OYEA 5IXUA 1RWUA 2X1AA 3HP9A 3VA3A 1VSKA 1NLKL 1GLDG 4M63A 1FTCA 4GW6A 4NRTA 3KZBA 1K47A 5ETOA 1HRHA 4JI8J 5AXKA 2R7YA 2MMYA 3J80O 1WSHA 1N33J 1FKOA 2VICA 3TAQA 3GG1A 3GE1A 2FLOA 3ZSQA 3JS9A 4WF9Q 1T03B 2F4FA 4I2QA 4JKFA 2YX1A 1QZ6A 3BJYA 3C65A 4NLBA 5J2MA 3AT1B 1OO0B 2HFZA 2CQCA 5ITHA 4USIA 3VGTA 2FPHX 1YITS 3NH1A 3EY1A 4EYHB 3MN6A 2D0AA 4IOXA 1IVZA 2Z1HA 1RT7A 3PW4A 1B9FA 3PZPA 3CMQA 1RYSA 2ZJQL 4MTPA 4HCCA 4QIEA 2P5GA 3EKUA 4PRFA 2DPIA 1HI8A 2BQRA 1EX4A 3H5UA 1HYVA 3EEQA 1ZPWX 2HS3A 3MFHA 4BRAA 2LQ8A 2X3DA 3PM9A 1JL2A 3CCJN 3AVCA 1GOCA 2ZOMA 4ED1A 2GWKA 3OT9A 4IO8A 4FBUA 2MZSA 4ELVA 4RW4A 4TSXA 2GIRA 3MCMA 1YTYA 4CFCA 2ZJPQ 1UA0A 2BANB 4M95A 3RR8A 2DO0A 1URRA 1ITGA 4DV4J 4K0KJ 3NCQA 3M9MB 1TL5A 4J9RA 4CIFA 1ZAWA 3VCDA 4FPIA 2HHHF 1HI1A 5CR4A 7FDRA 2JNJA 2MLYA 3C94A 5MLCV 4Q45A 2GX8A 5L39A 4JV0A 2VG6B 1OY9A 3KLHA 2OMLA 2RS2A 3SCJE 2H4YB 1WWHA 3TR5A 4J9PA 5EOYA 2F8MA 5SWMA 1IBKF 2CDQA 1JMTA 2D0CA 5DDQC 4ALZA 1REVA 1ZM9A 2XULA 3NGZA 3HFKA 2E66A 4Z4EA 2H54B 2CQ0A 2RPIA 4C11A 2ITGA 4LQ9A 5LMUF 2ILZA 1CQNA 3BEXA 5DQHA 1YKWA 2LEAA 2DR7A 4LRBA 4MIBA 1PCAA 2HS0A 1K0VA 2QWLA 5AQTA 4ZP8A 4B9QA 2QSWA 5KG5A 2F9TA 5BN9A 1CEZA 4X64K 4PG5A 2QIFA 1JLAA 1HYSB 1FX2A 2FC9A 1VQON 2KDOA 3WNGA 3T5JA 2MXYA 1NMNA 2Q3PA 1TP7A 4ZMMA 4CO2A 4BRHA 2Y3YA 3GYNA 1VQPS 5LJ5Y 3TQ1A 1RDAA 1XERA 4IBNA 2YKPA 3LDPA 5L38A 4M3WA 4FOEA 2E5HA 3JSBA 4Z4CA 4Y00A 1QVFM 4QPTA 1YIJN 3DLBA 3E66A 2IVPA 2PSZA 1BUPA 2JGUA 3KD5E 5A8KB 4BDZA 1CULB 3S3OA 2YKNA 5LXYA 4F4KA 5B0EA 4LFAJ 1FI4A 3NCPA 5E3AA 4JI6F 2O4IA 5HOOA 4DV2K 4YFUA 2CVEA 3IBCB 1UEUA 3BEGB 1RK8A 4MH8A 2VQEJ 2QWRA 3MAAA 2I7NA 4IJAA 3T1YK 3CNQP 4NCGB 2WK4A 1MDUB 2IM0A 4LVOP 3W9JA 4DR3K 2QL9B 3AY0A 1VHIA 3SMPA 4CJLA 2NSCA 2LXIA 2ZVIA 2RE1A 4GVBB 1YJ7A 4K50A 4PWDA 3O1WA 1N36F 2PMZD 2H5JB 4DHVA 3UDEA 6FDRA 3RMAA 5BRDA 3N6NA 3MUMP 3N4PA 3OJUA 4K8RA 1E4GT 3CGIA 4ILMA 5GAGI 2DTJA 4Z4IA 1U1QA 1VHXA 5BRHA 3CJ9A 4WXWA 2P6SA 1SC6A 3ZO7A 1KN6A 4GMJB 2NZCA 4F25A 4W90B 4WYLA 1JK9B 1F9EB 2Q79A 1FE0A 3BN7A 3RAXA 1QUVA 1B3TA 3THWB 1W97L 2CZVC 5HSPA 1FESA 1RU1A 3Q22A 1MMLA 2XNQA 2DGUA 4G3IA 1SC4B 1KCFA 3U4LA 3DXKB 4YB7A 3QRPA 3NBPA 5AQLA 1RT4A 4EGLA 1GK8A 2RE2A 1HKCA 3SLCA 1IKWA 3DXMA 3ZSZA 5C24B 2ROEA 4KI6A 1SQEA 3HJFA 4U67Q 2P9UA 1RBLA 4RUAA 1CQMA 4ZJLA 3FSYA 3GFXA 1SL2A 3QB0A 1UEVA 3SI6A 4OL8A 4ILGB 2D7SA 4ED2A 3D1QA 3RMBA 4E7IA 1M5KC 1TKDA 2W8KA 1RGVA 1IBLK 3VQ4A 4AF1A 1D09B 3ZZUA 1TV6A 4ZPVR 3DWLA 3NAHA 3KLEB 3WBZA 2GQCA 3RSEA 1QSLA 3G10A 1SQGA 3M1VB 3CJAA 3QJJA 4WQ5C 5BJRA 4DEZA 1XK8A 2W41A 1JLQA 5KG3A 3W8GA 5IWAK 4FWPA 3DC2A 3E1YA 1YVNA 2J6UA 3CMES 1ASWA 4C48A 2BOPA 4BRKA 4CYUB 3R5JB 3MPDA 3VQPA 1HWLA 4OYPA 1H7XA 5H9FK 2B4OA 2GZOA 2XS7A 4A57A 3DMJA 4CJUA 1PILA 3S7RA 3T9NA 4O8UA 3EO3A 1ZTTA 1O51A 5CZ1A 2AIRB 1WHYA 1GMVA 3UB5A 3E01B 1B0PA 2VJVA 1I94J 4GC6A 5J1EA 1EQYA 3WT0A 1OSCA 3ENHA 3G6YA 5JVHL 2BA9A 4TNOA 3TA1A 1JXVA 4EEYA 3SQGB 5H1SQ 1SKRA 4DV6K 3CCMN 1JLFB 3FUYA 2ZD1A 4NLGA 1EHWA 3WXMB 3EDQB 4DR1F 3ZSWA 4MDAA 4UZBA 1WDDA 1S1UA 3QNOA 3BQ0A 5IT4A 2PYJA 4CEFA 2FZKB 5J2NA 2V34A 5JS1A 4CEEA 4DTJA 2QN6B 2FD2A 1YBTA 1IH7A 2NR0A 3P83D 1S1VA 4I7FA 3P1GA 2HBZB 2SXLA 2B9EA 5F9NA 1HWKA 4CO1A 3GZ7A 5IV4A 4CERA 2R2UA 3CFOA 2KRRA 5B0CA 2IIHA 1IG8A 4BLGA 1K8KA 3MX2A 1X4HA 2G8FA 4HACA 4LVNP 4E89A 4BE0A 3CMEN 3FLCO 1S57A 3M8SA 2YXLA 2PN6A 2OPRA 5DGAA 2V52B 1KVJA 4KKOA 4F3TA 4YOUA 2AJFE 3M5RA 2MKIA 5SUHA 1MWQA 4B3TF 4KHPJ 1LKZA 3FFIA 2C2OB 4L6V3 2DKOB 1HNXJ 3MHYA 3OUYB 2DR8A 2GV1A 2HWHA 2D3O1 1GAOA 2KKZA 3FQKA 3M6XA 4OYZA 1CLQA 5I3UB 3H5XA 3VEYA 3C7NB 4AHTA 4JK9A 1Q86T 3AO5A 4CTAB 1HWUA 3AVGA 3ADAC 1KAYA 2HNDB 4IKAA 1RDCA 2GWJA 2P9IB 2OI2A 4B17A 2CWXA 3MWBA 3CJ7A 2LSNA 1QQOA 1M1KO 4OPJA 3G8TA 1QLNA 3H25A 4CJ7A 5M1PA 2XLIA 2AJ0A 3FZLA 3V1QA 4PY5A 4PAAA 2L08A 5K9FA 5GMEA 4ETXA 4QW9A 3VGUA 5A8RB 3L4IA 4B3SF 1FK9B 3KHYA 4ZHRA 5CZ2A 3CERA 2V50A 1CBKA 1X0FA 2UUAJ 2OEMA 2CPHA 2OEJA 3NF8A 2OMOA 3TZZA 5EWEA 2O8DA 2HRUA 1UPPA 4JYAJ 4KO0A 5KPZA 3CF5L 5B09A 2HFNA 1TKZB 4DX8H 5CYMB 3AVJA 3CM6A 3TUJC 4IOCL 4JV5K 4Z7CA 1U8WA 3M8WA 1FKAF 1T9UA 4WPAA 4FWKA 3VETA 2XBPA 2XTJP 2V6AA 3TX0A 1J6ZA 4O4GA 3MEDB 4L73A 2KJWA 1ZPVA 1LWEA 3QINA 4KTZA 1EQMA 4OMFG 4BWJA 1XNQK 3ZT2A 1BQMA 4FNHA 1NGCA 3KNAA 1U7LA 1S97A 2AF6A 1C1AA 2Q0RA 5KFQA 2AWZA 3MCSA 4ZVRB 5FLXU 4JD2A 3BS9A 5T7LB 5AJ3K 3GE9A 4CHYA 3BO2A 5KT3A 5LOQA 3IGNA 3WQPA 4OIXA 4IEEA 4B3RK 4P7TA 3HLUA 3A13A 3LPTA 2GMJA 1S72N 1FRLA 2CPEA 2GAGC 3GCWP 2EFGA 4N7TA 2BOAA 4CHOA 4YOWA 2ZWHA 1UVJA 1UP1A 3M2UA 3LPYA 2DY4A 1I5OB 2E2OA 2V94A 3TVKA 1VBXA 1S0MA 4RCHA 2IVMA 4DTOA 3WEEB 3MCOA 1EQ0A 1O8BA 2DNQA 4FS1A 3HSCA 2I1RA 1IR2A 4CZIA 4OI1A 3CT9A 5GIPA 4B3SK 4CLLA 4RWTA 5AZIB 3RBDA 1HI0P 4MYTA 5IQ6A 2FJBB 3R2CJ 2QLXA 2KKHA 4DR3J 3C46A 2XM3A 3AJ1A 3ETOA 2KU7A 4FLZA 2G8UA 2AYBA 2DHHA 2AJ1A 3JTOA 1R8CA 4O4GB 4EP4A 2VFSA 1SUQA 3G4SN 2OEKA 3IFEA 4NLWA 1OH6A 1FDNA 1FWKA 4DV4K 4K0KK 4DS4A 4FF1A 1B7YB 2R2TA 4W5NA 1JL1A 3MTKA 4E8UA 1VQKN 5K5MA 1C0UA 4L74A 1VQMS 3K57A 1XMOJ 4EBDA 1YBAA 2MQLA 4GVEA 2B56A 2R7UA 3HPHA 1RKIA 2MKCA 2B4PA 2RRBA 5D4NA 1L3UA 4LF8F 3MX5A 5IT9Y 3L3CA 1VI7A 3SI8A 3FCHA 3I0SA 1OH7A 1S22A 2OELA 2ACYA 1RWVB 2C2DA 2NUHA 3J7YU 1T3VA 2NNWA 3LP0B 1JJCB 1DQAA 2CPDA 1WEZA 2CZ9A 3DMJB 4GV6A 2IM3A 2WVFA 5AQOA 4CCHA 3BO3A 5KT4A 2VPYB 4DL3A 3QNWB 2GX9A 5K8MA 4FXDA 1FNOA 1S9GB 2OYQA 1Y97A 3EJMA 3PR4A 1V3RA 3KKRA 4CBWA 3RMCA 3T5HA 3V9ZA 1Y0HA 3GCXP 1NKBA 5BR8J 4EHUA 2JWKA 4DSFA 1KVIA 3UVJB 3R3LA 1QTMA 4URGA 2BRLA 2ATCB 1N5SA 1T44A 5EY4A 2BUPA 2FBTA 2BKOA 1TQLA 2DRBA 1NBWA 3HSJA 4X62J 3MXMA 4FZZA 1HNZK 4B1WB 3V1RA 1IM4A 3I33A 3K9KA 3KK3B 3Q2TC 4P2FA 3IO1A 1JLBB 4CJ4A 1PYSB 1C0UB 5C0YA 5DETA 2H3GX 2DH8A 2Y0BB 2HAIA 1WC6A 1VQMN 3UPFA 5KFWA 4M5HA 2I6WA 4A8OA 3PEHA 4KH1B 2ZE2B 3LPUA 2LXUA 4I67A 1ZBUA 1Y9OA 4U6PA 5D4LA 4FK0A 2FHJA 3C19A 3NBPB 2KZZA 3Q24A 1YTAA 4C1NK 5D3GB 3EPGA 1JKHB 4YDUA 1RCHA 1A9NB 3QEXA 2KO1A 3QGHA 3G71N 2NRVA 1NH8A 2YNIA 1PAUB 1JLCA 4CEDA 3HYFA 4M5IA 1UETA 5AQGA 3F0NA 1RAIB 4I6WA 4RZRA 5CAAA 4YQWA 3KLGB 1FJGJ 3SCLE 3U1MA 1CJKB 1S1VB 4I7FB 4FBTA 3V9SA 3RGIA 1O6XA 3Q8RB 4FLTA 3KK7A 4DUYJ 3AVLA 1HMVA 1YUWA 1LV5A 3G2XA 3ISZA 2EFVA 3OTCA 3SV3A 2CQPA 2F1FA 3B8HA 1HPMA 5AQZA 3M05A 4YHHF 1EZZB 1EIYB 1S99A 2VL1A 4A8WA 4DSLA 1U0SA 4CZGA 1BOTO 3KK3A 2BJ3A 4LF2A 1C4AA 3SUOA 2QC3A 2V7ZA 3B4MA 2MJUA 3W63A 1BI4A 3EE8A 3KG1A 1S79A 2DXDA 2K7JA 4IOAQ 4B3RF 3KLHB 4F2RA 2UXCJ 1XMQK 4PZVA 2QWPA 1S9EA 4K4WA 2Q97A 4BVPA 1S77D 1N32F 4RLEA 1JJHA 4A8QA 2HF4A 1DEJA 2AX1A 2VJUA 4DZDA 2HOEA 1X9WA 4OGCA 3ZZRA 3I96A 1RHRB 3VQ7A 3IKMA 4H4MA 5C10A 1T94A 2CJYB 5IT9O 3Q7CA 4CIEA 4TYBA 2NS1B 3LO3A 1N5QA 1VRUB 5HRSA 1IKVA 2ZC3A 4PA1A 4OO1J 3MWTA 1VQ7N 2BE2A 1RCXB 1XR5A 1OY8A 2E9ZA 2R8HA 1HLUA 3EGWB 3A12A 1DAXA 1Z1ZA 4FJGA 2JRSA 2BVZA 2B8QA 1B64A 4FPBA 3FZKA 4DU8A 5HO4A 1NM2A 5DM7L 2V8PA 4AT1B 2W7PA 3F2KA 2F4VF 5KGXA 3QO9B 1Q0NA 3VEVA 1LWCA 1J27A 4DFMA 1NGFA 3AVAA 1GLJO 4X65F 1BGXT 1HBNB 3MTJA 1BA1A 2YX7A 1K1SA 3C3LA 3EKSA 5LMUK 1XMQJ 1WG5A 3C14B 3PSFA 4ZITA 2YWGA 5KG2A 1T9WA 1RBSA 4R79A 3TO8A 4OHWA 2A1RA 1WHXA 2HNZB 3BB5A 4L72B 4K4XA 4OX9K 2M52A 3MMAA 5DGBA 3BGFA 2E5LF 4BQZA 3D68A 1UFLA 3K5LA 3CD7A 4JI8F 1ICEB 2BTFA 1UJ4A 2B5JA 3M6GA 3Q23A 2VPWB 2I8EA 2E44A 2V4QA 2HGMA 4CJSA 3CCJS 4N8NA 2MHEA 4OLPA 1G6BA 3U27A 4DPWA 1L3TA 1W2IA 4M45A 4JUZA 2QWQA 3L2VA 1JLEB 3BGOP 1NGHA 3PDNA 1OVQA 1QQMA 3L09A 4MO4A 1H74A 2MKKA 2HVZA 1RB0A 4FW1A 4HTUA 3C7NA 4C3LA 4ERDA 1KS2A 2V9KA 4B1YB 5AQXA 4JI0K 4GO5X 1NKEA 4B8AB 2XSJB 1ZTWA 5F8NA 3D28A 2VA2A 4LFCF 1HR0J 1N32K 1X5TA 1ZXOA 2MSSA 3VA0A 1GLCG 4CEQA 3M8PA 2ZDPA 4E1NA 3RG6A 3QMLA 4CDIA 3QESA 1HQUB 2HW3A 5I3QA 1D1UA 1T02A 4PKGA 3DRSB 5BYQA 4JI5K 1Q16B 4I0WA 3K0SA 3ULEB 3CD6S 4LBHA 3W2VA 1N6QB 1RWPB 3KLFA 1BWFO 3KFWX 2BKNA 2U2FA 2D3OR 1TUVA 5KT5A 4FJIA 4ID1A 1SVDA 2I7PA 4DG1B 1CSJA 2L48A 3T41A 4QWCA 2HHHJ 2O5DA 2QA2A 2UVVA 2EFNA 2F8SA 3KHLA 1Q82O 5K8OA 5DQIA 2CGKA 3W9HA 4Y0WA 4IO9L 1D0EA 4QPXA 4ECUA 3QETA 1FRKA 1GEHA 4BRNA 2PA3A 5L9XA 4LF9J 3R3TA 2ALZA 1WG1A 1BCMA 4AQYF 3LP1B 5K14A 2COLA 4JK7A 2XMTA 2Z4PA 1Z6RA 2HB5A 3TP2A 4K43A 3LP1A 3MCAB 3W61A 1NAQA 3QFWA 1NGGA 3MR3A 3B6OA 3I55N 3BF4A 2YNFB 3KYLA 3V6KA 2XY5A 4DL0C 2YKNB 3GV5B 3KWMA 1DRZA 3VENA 4DR4F 1YQHA 3J7ZO 3I32A 1VBZA 3ENQA 2B5JB 3F44A 3A0IX 4PABA 5E2QA 4IFEA 3MR2A 3I56S 3TEHB 4WK1A 1U25A 2HMIA 2LEBA 4LR8A 4NCGA 1BIZA 4EHTA 2AV5A 1GT8A 3SV4A 3SJHA 2ATQA 2VV5A 3MM9A 3NCIA 1TUWA 4O55A 4C23A 1EXQA 4DMNA 2OCEA 3I5CA 3BF1A 3A3OB 2GJFA 2MYFA 4YR3A 4F4ZA 1KC8T 1RTDA 3D7EO 3MEDA 4F9OA 3C6AA 1S9GA 4PKHA 2JH3A 4HCBA 4J2DA 3MPWA 4IJNA 4I9LA 2H51B 2QM1A 1RWXB 2EFOA 1S6PA 3ILLA 2XMAA 4GKJJ 1CJVB 2VBZA 5ETKA 5AJ3J 4C8MA 1KWMA 4JLHA 2HG4A 5IS2A 3KMSA 4DR5K 2EPIA 3HM9A 2BMBA 3UO0A 4BROA 1HD1A 1R0BG 3G87A 1SQKA 4J9OA 2ABYA 3RRGA 4DFJA 2VOOA 2V67A 3OS2A 2XMVA 2G13A 2D0OA 3OTOK 2G2OA 2AP1A 3EXCX 4RJVA 2RRAA 1CZ9A 3MXIA 2ZFHA 4Y2AA 4PYDA 2VDIA 1RT3A 2ACMA 2V4JA 4FJ9A 1D9DA 1FO1A 4IH5A 4G6VB 3QT7A 3OFFA 2B4VA 3MWPA 1M90T 1FX4A 3CMAS 4B9VA 1TL3A 3VEWA 4NYZA 2F40A 2ALYB 3WNEA 4B3MF 1MN9A 1YJRA 4PG6A 3TW0A 3JAMY 5FIIA 3PFEA 2NPIA 4OQJA 1RT3B 4KQZA 5CHIA 1TKTA 3SNNA 1D8YA 4C2MA 4FJKA 5KFVA 3VN5A 3SBGA 2ZUAA 2P9EA 2OA8A 3HFVA 2ASLA 1TL7B 2UXBJ 4OZ3A 2X6NA 5ETPA 2UXBK 1HBOA 2CJQA 1T3NA 5HP1B 1MWMA 1Q5VA 4PXEA 1WF1A 3OYNA 2YNFA 4LFBJ 2KW4A 2DNLA 3M9OB 3UVJA 3H08A 2EFPA 4E3SA 3KJFB 1FDAA 4NLTA 1N34F 4OPHA 2LQ5A 2XWYA 1PBAA 3UD4P 3T5KA 2EI5A 2MZQA 3UI3A 5EWFA 4Z7YA 5ETQA 3QIPB 5J2QB 3PW5A 4H4MB 1YT3A 4JK8A 3Q8YA 5GAHP 2D0BA 5HI7A 1JLQB 4NZ0A 2QL5B 4R5PA 3HI9A 1M0SA 2KT2A 2QV6A 1UW4A 1S10A 4LJMA 4BRFA 3FE1A 4U96A 1VRTB 1S1TB 2LYVA 3EMTA 3ZTQA 3OL6A 3O2IA 2FVRA 2HQ3A 1RT1B 3CTRA 2WVDA 5A0YA 4C11B 4I2QB 3QFUA 2H5EA 2YHYA 3IR5B 3H4DA 3O80A 2DNNA 2DNPA 2QLWA 3PIPL 1UVLA 4WE1B 1S7IA 3O6WA 2E2NA 2HVEA 2DFHA 4A4JA 1HBUA 3D3CJ 1BXNA 4YR0A 3L4QA 2IDEA 2WB4A 1Q8KA 2P9CA 4P72A 4DV7K 4WFAQ 2UUCJ 4QCLA 1N0UA 2DGWA 4B9SA 3DU6A 2IDLA 1H2VZ 5GADP 3ENBA 3PIOQ 3CCQS 3AOBA 4W92B 3RTVA 4DUZJ 3DU5A 4NASA 1LFWA 4ID5A 4JI2K 1VAZA 3FZFA 1RAAB 2HWIA 1R59O 2E1PA 3DRSA 5KFSA 3GFZA 4LRDA 4KGMA 3DNCA 1YJUA 4YY3J 1OH8A 1OPIA 2B9YA 4ED0A 4LUBA 4DTSA 5KG4A 1XMBA 4LFCK 1NDPA 2FLLA 2PBDA 1HPZA 2X7IA 3UWTA 4FLXA 4I1TA 2B0GA 1D9AA 1Y3JA 3VHQA 2LMIA 4CNZA 4W98A 1YX2A 4J9LA 1H72C 4DV3K 1RBVA 4WFBQ 4HI2A 4M42A 2BE2B 4KB7A 2Q6BA 1SJ4P 3LDNA 4P10A 2H9ZA 1Z25A 3IMQJ 1AXQA 1BQNB 4R5PB 4JKHA 5JJBA 2UZAA 3V4MA 1WI6A 3M8RA 3ZTSA 4X64F 3U9DA 2UU9J