4I7FA

Hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase
publication title Synthesis and biological evaluation of phosphonate analogues of nevirapine.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 153
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i7fA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i7fA05
3UIQA 1MU2B 3M8PA 3QGIA 3G10A 3BGRA 1XHZA 1JL1A 4XO0A 2A1SA 3NF7A 4CERA 4C8MA 1SKRA 4BWJA 4AH9A 2W9CB 4GMJB 4R5PA 4DL3A 2XCAA 2W9CA 3ZT4A 3FRZA 3DM2B 3VQ7A 4KTWA 5DG7A 1S1UB 4O0JA 5KRTA 2IM1A 3OHBA 1N4LA 2OZSA 2FJXA 4HKQA 3ASMA 2OH2A 2W42A 3MR5A 3DRRB 4NLPA 3ZSXA 3LP0B 4ED6A 3LP0A 5KGWA 4FJMA 4ED8A 4NYNA 3PR5B 3H08A 1JLQA 1QE1B 3DOKA 1NHUA 3AA2A 1K6YA 3T5KA 1YT3A 4PUOA 1QE1A 3KKSA 4OKKA 5KFEA 3IS9B 4IFYB 1C2PA 3IS9A 1KVAA 2HAIA 4U6PA 3KLFB 3NKYA 4Z4FA 4ED3A 3ZSQA 5EWEA 4FM2A 4F2SA 1BIZA 2JEGA 1S6PA 4DSJA 1LWFA 4J9MA 3TI0A 4CJRA 4ZP6A 4O3QA 1S10A 5KFNA 3QZ7A 3C95A 1Z26A 4Z4EA 4DSEA 4F4WA 4DL4A 5F8GA 2X74A 3G0ZA 4BE1A 3HVWA 4IFVB 4O44B 2R8JA 5KFCA 4CHNA 3OJUA 2FLNA 4IFVA 3QEWA 2C2DA 3H4BA 1RT2A 4GC6A 4KHQA 4ZP7A 4IRDA 1ITGA 4NLDA 4DQSA 3IGNA 3DLKB 4OL8A 3AVMA 3RBEA 2XY5A 2XRIA 3DLKA 3GIKA 2GIQA 4EYHB 3H98A 1X9WA 3OL6A 3QNOA 1LAVA 3NL0A 3AV9A 1GOAA 2VWKA 3F73A 1ZBUA 3MR3A 4Y1CA 2ZQBA 2B6AA 4E89A 3DMJB 2XGPA 3AVNA 3K58A 3U3YA 1XHXA 4FLXA 1NJWA 1SH2A 1Q9XA 4Q8FA 3HVTA 5FDLA 3PW0A 2OPRA 3SPYA 3FDSA 1JLEB 1S1XB 4WYLA 1WSIA 1JLEA 1S1XA 2QE5A 4BDYA 3SZ2A 3PR4A 3OYCA 3PVXA 4IKFA 4ZTJA 2E9TA 2LSNA 3TAQA 4BDPA 3AVJA 2IM3A 3DRPA 4K8XA 3BQ2A 3PX4A 3H5XA 4K4UA 3I5BA 2VA3A 2HHSA 4ED1A 4IQXA 1VSDA 4ECSA 5F8JA 3DI6B 1C1BA 1FKOA 4FJLA 1IKYB 2FVCA 2AU0A 2Z1JA 4MIAA 4FW2A 1BL3A 4JRQA 4ZP9A 5KFKA 4NCBA 1MMLA 1RT1B 5HROB 3V6DA 3MR2A 5C42B 4RW4A 2FBXA 5EWFA 4KTQA 3BQ1A 1S9EA 1RDAA 2R8GA 1ZYQA 4XPEA 4O3OA 1DTQB 4ECTA 5KI6A 4B08A 3MFHA 4N76A 3E51A 4AHSA 2HHVA 1SKWA 2GUIA 3QIPB 2DY4A 4J2EA 2X6SA 1WAFA 2G8KA 4NLXA 4TQRA 4FJ8A 1I3AA 1F21A 3C6TB 5KFIA 4IDKA 2C2RA 1TAQA 3KMQA 2ATLA 5L1IA 2WHOA 3JSMB 2W9AA 2HW3A 1JLCA 3CVKA 3MXMA 4FYDA 1I6JA 4DTUA 3HHKA 1RCHA 2IDOA 3T5HA 3RB3A 1C1CA 2HVHA 2R2RA 1X9MA 4MK7A 4BE0A 1JLGB 1QUVA 5HP1A 3WNGA 1JLGA 3MEGA 3KD1E 4CJLA 4IOBA 3TAMB 5KFBA 5L1LA 4EZ9A 4DLEA 4CJ3A 1CSJA 4O3SA 3V1RA 4WZMA 2OPQB 3P83D 4E7KA 2V9WA 4DF4A 3S3OA 4CJQA 4CF2A 1CZ9A 1BQMB 4HVJA 3H5UA 4ECUA 4CEOA 3A2FA 3ZCMA 4RNHA 4Q5VA 1KSPA 1HQUB 2OPSA 5C24B 2HNDB 1SH0A 4FJJA 2HNDA 4JV2A 4HUGA 4H4MA 3LP3A 2J6TA 4FZZA 2HNYB 4NLWA 2FVRA 1L3TA 4KFBB 3SNNA 3BREA 4CHPA 4FBTA 3NGDA 4F4YA 4NCGA 4O4RA 2PZSA 3PJXA 2BE2A 3WNFA 4EO6A 3MEEA 3VA0A 3D5MA 1WSJA 3AA4A 3KLEB 2A1RA 2ZE2A 3KLIB 1N6QA 5F8NA 1S1WB 3KLEA 4TYBA 4DSKA 2WOMB 4URGA 2VG6A 3RWUA 1HQEB 1C0TB 4NLSA 3QNNA 3M8RA 3QEIA 3KLVA 4ED2A 4C8NA 2C28A 4CHQA 4LSNB 3DRSB 4CJSA 4OPKA 3GILA 1CXUA 3DRSA 1T03A 4WZQA 4PQUB 1QS4A 1WAJA 5L1JA 3B6PA 1IKXB 4E3SA 4M3RA 4QWAA 4CGDA 3LP2B 1IKXA 2HNZA 2I5JB 4ZVGA 2E9ZA 3OYJA 1Z4UA 1B9FA 4MIBA 2IJFA 3HPOA 2KQ2A 5F8IA 3N6LA 3DLEB 5KFDA 2JGUA 4CK3A 1XR6A 4CEBA 3KLHA 3TANA 2HWHA 1BQNA 2B5JA 5HBMA 1R0AA 4O55A 4DTJA 1KFDA 2HHXA 4OJRA 3M8QB 1KCFA 1UA1A 1TP7A 4ZPDA 4H4OA 1HMVB 2YKNB 1J53A 3AO5A 4KHUA 5F8MA 4ECXA 2QK9A 1LWCB 4KBIA 4I7FA 3LAMA 2YKNA 2YNHB 1TAUA 4JV0A 2KZZA 1LWCA 1K1QA 1JLFB 1KLNA 3V4IB 4ZPCA 3AO4A 4EP4A 1WSGA 2EC0A 1NOYA 3WNEA 3L2VA 1IKVA 4EEYA 3NH2A 3PV8A 1Z25A 5D3GB 5C5JA 2P1JA 3CFRA 3TAEA 3IRXA 3MXIA 3ICLA 4E7JA 5J2QB 4CHOA 3NF8A 4RNMA 4B9LA 3RR8A 1RTJB 4ICLB 2G8VA 1RTJA 1ASWA 5KG2A 1JKHA 4CCHA 3ZSOA 5KFVA 3IGVA 3L2UA 4KRFA 4K4XA 2C22A 1C0MA 2HHWA 2AWZA 5J2MB 3LDSA 2IMWP 4WYWA 3NMAA 4RW8B 3RAQA 4EO8A 5J2NB 3IG1A 3LALA 4AHTA 1RAJA 2XI3A 3AVGA 4H54A 4M3YA 3OVNA 1LW0A 3AVFA 5EU7A 4FZXC 5KT3A 1NJXA 1NOZA 1RDBA 4FLZA 2PYLA 4MK9A 3PO4A 4JS4A 3AVAA 4N56A 1C0UB 3I0RB 1GX6A 1XC9A 4J9NA 3NDKA 2KFZA 4BDZA 3I0SB 1ZTTA 4NLQA 4K8ZA 2AGQA 3MECB 3HK2A 4RW7B 4CHYA 5HRSA 3MECA 5J1EA 3QGHA 4CJUA 1GOCA 4RW7A 1QAJA 4F4XA 1KLMB 4O3RA 2JEIA 3HPHA 1RNHA 3SUQA 2FVSA 1U45A 4FJGA 1DTTA 2IAJA 1HPZB 4DG1A 3GV7B 1S48A 3VQDA 5DQIA 5DG8A 3FQKA 4W5TA 3CJ3A 4QOZB 4DQIA 1CLQA 3LP1B 4I2PB 1NK5A 5KG4A 3V81B 3PZPA 3LP1A 1TK5A 4DSLA 3CDUA 3GIJA 5KG6A 3DYAA 1TKZA 3KK1B 1ZETA 4E19A 3M9NB 4F3TA 3T5LA 4RNNA 5HRRA 2ASLA 3PW2A 2Q3SA 2BANB 4ECYA 4ZHRB 1SUQA 3ITHA 4ZP8A 1VRUB 2BR0A 3OYEA 3D0PA 1N56A 3S9HA 2C2EA 3NFAA 2PY5A 1VRUA 1RBSA 2R2UA 4WFYA 3RRHA 4CESA 5I42B 1HYSB 1SL0A 1XI1A 3OYNA 4Y34A 4W5RA 4M45A 3QEVA 3G86A 1HRHA 2R8KA 2AQ4A 2XGQA 2UVWA 3M8PB 1S4FA 3BGRB 4ZVHA 1LWEA 4B3OB 3TAFA 4KAIA 3VQ8A 2YV0X 3UR0A 4B3OA 1EETA 3HL8A 4R5PB 3P5JA 1RT4A 2VA2A 4Q45A 2HWIA 3AVBA 4CGGA 3HJFA 1RBUA 3ZSRA 4ELUA 3IN5A 4TY8A 5KFMA 2AJQA 4EBCA 4X2BA 3O3FA 2P5GA 4NRTA 4ZPBA 3KHRA 2OYQA 5EUHA 3VQ4A 1ZBIA 4DTRA 4N5SA 2VG5A 4URSA 4RUCA 4FCYA 1L3UA 1VSHA 3AVLA 1JLQB 3DOKB 1S9GA 4PUOB 4AHUA 1N5YA 1IH7A 4CJ4A 3L2WA 4FJXA 4LH4A 3K57A 4CGIA 4ZPAA 4KHNA 3HM9A 2IC3B 3ULDA 4M94A 2XWYA 2IC3A 5KG3A 1REVB 1S6PB 3O4QA 1LWFB 3EYZA 1REVA 2UVRA 4ECRA 3OS0A 3G6VA 5KFWA 5KT4A 2Y1IA 5CZ1A 3KIOA 5DMRA 1ZTWA 3L2QA 1L5UA 4CF9A 1TKDA 1TQLA 2YNFB 1RT2B 2WONA 3OY9A 4KV8A 3EPGA 4IR1A 3SUOA 1TKTA 4IR9A 2YNFA 1QSLA 4E7IA 3K5LA 1QQCA 1KHVA 3KK3A 4CIFA 3LZIA 4O5BA 3QYYA 1B9DA 4J9QA 4KAZA 4IH6A 5EWGA 3AVKA 2W9BA 2DPJA 3HT3A 2YNGA 2FBTA 5KFHA 4K50A 2KZMA 3ISND 4KB1A 4CEAA 4O4GA 2B6AB 1ZBFA 3SCXA 4G3IA 3EZ5A 2D41A 4KI6A 4DS5A 2PYJA 2OZMA 2Z1GA 3HVTB 5FDLB 2IA6A 1HNIA 5KG7A 2OPRB 4PWDA 4J9RA 4FLYA 1U09A 2WTFA 2P51A 4E7LA 4HTUA 4WFZA 4Z4HA 4K4SA 1K1SA 4W5NA 4O3PA 2YKMA 4E0DA 3DRPB 4J2AA 3C94A 4TQSA 1RBTA 1RA7A 1UWBA 4Q43A 1RT3A 3B6OA 4UQGA 2HB5A 4FW1A 2D0AA 2XC9A 2RDJA 2F8TA 1C1BB 2BGGA 4CHZA 1FKOB 3QESA 1WNEA 3N6MA 4CEFA 3SQ1A 3PHEA 3U3GA 2HHTA 1OS5A 1S0OA 4HYKA 1VSEA 2UUTA 1VSLA 1WSEA 4YFUA 2G8FA 2FLPA 4DTNA 3V6DB 3DLHA 1S6QA 3P1GA 5E41A 4E7HA 4RW4B 3HVRA 5KFTA 1T8EA 1RTDA 3KHHA 3ZT0A 4NLGA 4R0EA 1Q8IA 3LPTA 4F4ZA 1S9EB 2RF2A 2ZD1A 3TAPA 3GQCA 1JX4A 1J9AA 4CJ5A 4TXSA 4ECVA 3SQ2A 1JLBB 4K4WA 4M3ZA 4HHTA 4CECA 2FBVA 3VQ5A 1JLBA 4TLRA 3T1AA 2VG7A 1S9FA 3AA3A 4IDKB 1ASVA 3MEDA 1D5AA 1W9HA 1W0HA 3GIIA 1FK9A 4QW8A 1JLCB 3GIMA 4DL6A 3VN5A 3BSCA 2IOCA 1U4BA 1C1CB 4FJIA 1YTAA 4OPJA 4DL7A 5SWMA 3KOAA 2ILYA 3THVA 4QPXA 5HP1B 3V9SA 4NLRA 4J9OA 3MEGB 4NYZA 4M3UA 3BDPA 3CM6A 2BQUA 3KLGA 4JV1A 2YHBA 3HPGA 3OYKA 3MFIA 4FLUA 3SUNA 1G15A 2J6UA 2DFHA 4KO0A 1NKEA 3CJ0A 3QERA 1S97A 3L3VA 4CGHA 3H59A 2YHAA 1FKPA 2HMIA 3O3GA 2QKKA 3RB6A 2OPSB 4URQU 1EKEA 4TY9A 3JYTA 2GV9A 4H4MB 3SUPA 1J5OA 1JLAA 5DLGA 2UUWA 1RDCA 4KHMA 4QWEA 2JC1A 3I5CA 4DLGA 3PW5A 4RW9A 1TKXA 3T3FA 1L3VA 4I2QA 4DMNA 3V6JA 1RT5A 4J9KA 4NCGB 4CJWA 3G6XA 3KKRA 4F2RA 1CZBA 2BE2B 4HUEA 2RKIA 3S3MA 5CYMA 1W25A 1U48A 3MEEB 2BRKA 4R8UA 2ZE2B 4Y2CA 3NGYA 3OS1A 1N6QB 4J2DA 5F8LA 4RUAA 1BHLA 2XO7A 3TARA 4F4KA 5DQGA 4FJ7A 2VG6B 1ZBLA 4JRPA 4ZTFA 4FS2A 3VQCA 5HRNA 4W5QA 1RT7A 5KFGA 5KG5A 4Y3CA 4MFBA 4YR2A 3D45A 3VQBA 3KJVA 3U6FA 1T03B 1WSFA 3D28A 2IBKA 1TVRA 1KVBA 3V1OA 1BIUA 4NLYA 1IKWB 2D7SA 5FRMA 1NK9A 5KRSA 1T94A 4RNOA 1IKWA 3RAXA 3WNHA 2HNZB 1GOBA 3KNAA 4ID1A 3KK2A 4AHCA 3DLGA 4O3NA 4HCBA 4B9UA 1HNVA 4CEDA 1RILA 1UA0A 4CGJA 4DTPA 2WCXA 3TWHA 1S0NA 3OSNA 3KLHB 4FJNA 3CG7A 1BQNB 2B5JB 3K5NA 5HBMB 1R0AB 4RNFA 5KFRA 5KGXA 1TK0A 4TYAA 2D3ZA 1HARA 3OSPA 3SQ4A 4OVLA 2G8WA 1U04A 4AHVA 1S1VB 4H4OB 4DQQA 1S1VA 4I7FB 4DFMA 4M42A 4B9VA 2E6LA 3GV8B 3NAEA 3DOLA 1D8YA 5I3UB 4C8KA 4KHSA 1JXEA 5KT6A 4YR0A 4CF1A 4G1QA 5I3UA 4DU4A 3Q8SB 1IKVB 1RT6A 3TABA 5KG0A 1NK7A 4CJEA 4DFPA 3IRXB 2J6SA 3UQSA 4K4VA 3CM5A 2BRLA 3HYFA 5DGBA 3NAHA 1VK0A 4PY5A 4Y1DA 1NHVA 4B9TA 3H5YA 4ECZA 1JKHB 3EZUA 3OYGA 4QWBA 4YQWA 1TL3A 2X78A 2QXFA 4TSXA 2X6NA 1KFSA 3M8SA 3AA5X 3L2RA 3PX6A 3ISNC 4IH7A 2KW4A 2Z1IA 4OGCA 3LZJA 3NBPA 3BSAA 5J2PA 3E01B 1CXQA 4KREA 3HXMA 3E01A 1T3NA 3ZT2A 4JUZA 3IG1B 2FLLA 4ECWA 2OPPA 4FLWA 3RB0A 4KHYA 2IM2A 1LW0B 1YTUA 5CYQA 3VQEA 1EX4A 4FM0A 3CJ2A 4DFKA 2F8SA 3LWMA 4LSLA 3H2LA 5C25A 4QCLA 4DWIA 3QO9B 3QEXA 1X1PA 3QO9A 1U47A 2YNIB 1S49A 4FXDA 4BACA 1YVFA 2XY8A 2YNIA 5J1EB 1VSKA 3OJSA 2XY6A 2ALZA 3AO1A 4Q44A 1WNSA 3IAYA 4JLHA 5KFLA 3UDLA 4LQ9A 4H8KA 4I9QA 1WLJA 5K14B 1DTTB 2IAJB 5CY4A 5K14A 3OLAA 4DG1B 4CEEA 1SV5B 5F9NA 3AVIA 1C6VA 3K5MA 3CIZA 4DL5A 1SV5A 1TL1A 2XI2A 2B43A 2FJVA 3ZT1A 1ZBHA 3N6NA 5L1KA 2FBYA 4TN2A 2IJNA 5KFJA 1JIHA 1RDRA 2AX0A 3DYAB 3TQ1A 2ITGA 1TKZB 3I8DA 4L8RB 2O4IA 4KKOA 3ZT3A 1WSHA 2V4QA 1SUQB 3ITHB 1XR7A 1HYZA 3O4NA 3SYZA 3RB4A 3EPIA 1DLOA 1BI4A 2QKBA 4IH5A 3OYLA 4KI4A 1S0MA 4FJ9A 1VSMA 2KTQA 2FVPA 2JEFA 2ATQA 2RDIA 4DF8A 4O0IA 4ZVEA 3VQ6A 2VWJA 3SJJA 4RW6B 3RMCA 3TAGA 4RW6A 1KVCA 3CFPA 1RTHA 1LWEB 4IG0B 4PA1A 5JS1A 5HLFB 3NH1A 3OYFA 2E6MA 4KSEB 3BSNA 4IG0A 4K4YA 1EETB 5HLFA 3S3NA 5KFQA 4ID5A 2ZKUA 3ZSVA 3HP6A 2KFNA 2CJQA 1RT4B 2F8EX 4QWCA 4B9MA 5JUMA 4J9LA 1IO2A 4LD0A 3NAIA 4QAGA 2XY7A 3FSIA 2EHGA 4AILC 2AGPA 4KB7A 3ZSZA 3OYAA 4IG3A 4TY8B 3MXJA 1NK8A 3ALYA 4WE1A 3QETA 3DDKA 1MU2A 4OGEA 5KTQA 4C8LA 2IS3A 4B8AB 4J2BA 2VG5B 1NKCA 5KFUA 4Q0BB 4Q0BA 2W8LA 4EZ6A 3DM2A 4BE2A 2F96A 1S9GB 2JC0A 2AGOA 1S1UA 2V0NA 1N5YB 5DGAA 4RZRA 1LAWA 1VRTB 2FJWA 1VRTA 3DRRA 4FJ5A 1VSFA 3VQPA 4DTXA 4W5OA 1N48A 3UPFA 4CIEA 2WRMA 4NCAA 4FK4A 1VSIA 3OYBA 4JS5A 3GV5B 1A5XA 2WB4A 1U49A 4CJPA 3SFGA 3OS2A 3AO3A 1BCOA 2O4GA 4IFYA 3PUFA 1T05B 2JLEA 4CGFA 2RN2A 3KLFA 4NLVA 1T05A 5KFPA 3SV4A 2WONB 4KV8B 3HKWA 1TKTB 2DFEA 1A5VA 1ASUA 3KK3B 1RBVA 4EBEA 4DU3A 4F3OA 4IBNA 3HP9A 4B9NA 2QV6A 2W9BB 4DEZA 2YNGB 3NE6A 4CF0A 4O44A 3SPZA 4O4GB 2R8HA 3L3UA 3SFUA 1EP4B 1NK4A 4B9SA 1JXBA 1EP4A 1C1AA 2W7OA 2AX1A 5KFFA 1HNIB 2GIRA 1JL2A 1S5JA 4YMEA 4PWDB 4M3WA 2HVIA 5DK5A 2W7PA 3TVKA 3OL9A 4CK2A 3QIDA 1T7PA 1RTIB 3F9KA 3NF9A 2R2SA 4KPYA 1RTIA 3DMJA 1NJYA 3V9UA 2D0BA 2YKMB 3KHGA 4ECQA 4Z4GA 3NGZA 4N47A 5DG9A 1RDDA 3M9OB 4Z4IA 1UWBB 4NRUA 1RT3B 3QIOA 1Q9YA 4YP3A 1XR5A 1KHWA 4CFCA 2P5OA 3OL8A 4KHRA 1SH3A 1KTQA 1A5WA 3VQAA 4GC7A 4GW6A 4DTSA 1S6QB 3OHAA 4OLAA 2FVQA 3OLBA 5KT5A 4CJFA 4E1MA 3T5JA 1RTDB 4M41A 4DU1A 1XWLA 4Y2AA 3OYDA 4KHWA 2RF2B 2ZD1B 3CWJA 2W8KA 4DTMA 3MTKA 3Q8PB 4CIGA 3DI6A 3TR8A 1QAIA 2ASDA 1IKYA 2JEJA 5KFXA 1TGOA 2HHQA 4ELTA 1UOCA 2E4LA 5EDWA 3QGGA 3HVAA 3MF5A 1RT1A 2VG7B 3QLHB 4NZ0A 5HROA 4WXOA 3RMBA 3EY1A 3K5OA 3QLHA 4YNQA 4EYIB 1L3SA 5C42A 4MK8A 2R8IA 4MKAA 3MEDB 1NKBA 1FK9B 3CDEA 4KTZA 2UVVA 1JXLA 1DTQA 3O3HA 5JS2A 3PW7A 3MAQA 3SI8A 2DTUA 3FQLA 4CE9A 2Y1JA 4DFJA 2DPIA 5FROA 3RTVA 3QIPA 1RA6A 5F9LA 3CFOA 3PY8A 3C6TA 2G8IA 1J54A 1BCMA 3KLGB 5HRPA 3CO9A 3KHLA 2GBZA 3JSMA 4KO0B 1LV5A 4HUFA 2G8UA 1D9DA 4CJVA 1D9FA 1Y97A 1FKPB 2HMIB 3NH0A 3V9XA 4C8OA 2RPIA 3JYTB 4EBDA 4FLVA 3TAMA 1J5OB 1JLAB 1D1UA 3RBDA 2OPQA 1RBRA 2IGIA 3ZSWA 3HO1A 3M9MB 4RW9B 1TKXB 3KD5E 4CJKA 4I2QB 4GVMA 1RT5B 3CQ8A 3OYMA 1O1WA 1BQMA 4ELVA 1NK6A 3OL7A 4FBUA 3PO5A 4F8RA 3NHGA 5DQHA 2RKIB 5CYMB 4ED0A 4QW9A 1QHTA 1HQUA 4R8UB 5C24A 2G8HA 3Q8QB 3LPUA 5KFYA 4LH5A 4RG8A 1RT7B 4FVMA 4MFBB 3KJVB 2HNYA 4FZYA 1SKSA 4KFBA 5JXSA 4U7CA 3I5AA 1TV6B 1TVRB 1TV6A 1RYRA 4CK1A 4E1NA 3QINA 2DFFA 3OYIA 4DSIA 3KTQA 3RR7A 3KLIA 1S1WA 1NK0A 3KK2B 2WOMA 1I39A 3DLGB 4ED7A 4DTOA 3T19A 1HNVB 3KMSA 1HQEA 1C0TA 3CYMA 2O5DA 4FJKA 4DSFA 2R7YA 4LSNA 3H40A 2EX3A 2CKWA 5KFOA 4Q8EA 2ASJA 4F50A 4XPCA 4KB0A 4PQUA 3V6KA 3V9WA 3AVCA 4CEQA 5T7BA 3HSTB 1UAXA 4N41A 4M3XA 3LP2A 2I5JA 1IM4A 1S1TB 1S1TA 3V1QA 3OYHA 5L9XA 3VA3A 3DOLB 3CJ4A 3AVHA 3DLEA 4G1QB 3AO2A 5KFSA 3SV3A 4DQPA 1RT6B 3FFIB 2UVUA 3FFIA 5T14A 4WXWA 1KRPA 3M8QA 4EP5A 2BQ3A 1FXXA 3PW4A 4I9LA 4CEZA 1HMVA 3CDWA 4HCCA 3MR6A 2YNHA 3ZSYA 3LANA 1JLFA 1TL3B 3LAKA 1NNDA 3V4IA 1B92A 3DLRA 1VSJA 2HHUA 3NGIA 3NBPB 3H5SA 5J2PB 2GC8A 4K4TA 4J9PA 1HYVA 2NUBA 4OKEA 3H4DA 1SL2A 5D3GA 4ZVFA 3LWLA 1LW2B 1X9SA 1QTMA 4NLUA 3NF6A 5J2QA 3PJWA 4NYFA 4NLOA 2OA8A 1LW2A 2OPPB 4NLTA 4B8CA 5DLFA 2V4RA 4ICLA 2D5RA 1BISA 3C6UB 5CYQB 3QZ8A 4FJHA 3CJ5A 3C6UA 1RYSA 4DQRA 4J9SA 3GYNA 1IG9A 2WK4A 4CJTA 3RRGA 4CFDA 2D0CA 3QEPA 4LSLB 4IRCA 5C25B 1D0EA 2BQRA 4Z0UA 3BQ0A 2BDPA 5J2MA 4DL2A 4RW8A 5J2NA 5F8HA 4BWMA 3BSOA 4WFXA 4QWDA 4IRKA 4OKJA 2E9RX 4AHRA 1SL1A 4FLTA 1QSSA 4MKBA 4FM1A 3L8BA 5KFZA 4KE5A 4IKAA 4MH8A 5KT7A 1C0UA 3I0RA 2I1RA 2IM0A 5KT2A 3I0SA 4LY7A 1TL1B 1HJRA 1YVUA 4OLBA 3BR9A 4YR3A 4CF8A 3NCIA 3RMAA 4M3TA 1TK8A 4XIUA 1KLMA 3G6YA 4CFAA 2XHBA 3Q8RB 2B4JA 4KKOB 3VQ9A 1HPZA 3K2PA 4CFBA 3K59A 1DLOB 1BI4B 4I2PA 3V81A 5FRNA 1WN7A 1GX5A 3VQSA 1EXQA 2XCPA 2ETJA 2ILZA 3KK1A 3SQ0A 1RTHB 4FK2A 4ZMMA 2BANA 4ZHRA 5SZTA 4ID5B 3V6HA 2FC0A 4FS1A 2Z1HA 3PX0A 3RMDA 3SI6A 4DS4A 5KFAA 2D3UA 1QSYA 4M95A 4RU9A 3VQQA 4K4ZA 4LQ3A 4FK0A 5I42A 1HYSA 1NJZA 4Z4CA 1BGXT 3V9ZA 2R2TA 3BJYA 4MQ3A 4IG3B 5CZ2A 3DLBA 5KG1A 4WE1B
chains in the Genus database with same CATH superfamily
3M8PA 1CQMA 1RWWB 3BGRA 3LDLA 1AFJA 5EX0A 2V2VA 3NF7A 4OZJA 5BR9A 4CLKA 3DJCA 2QWNA 2MXYA 3H6EA 3ZT4A 1T9WA 1KP6A 2YHYA 3FRZA 2M4MA 2DO4A 4O8UA 3D6HB 2ITMA 4OHYA 1WKKA 2R4FA 4M5NA 2C3YA 3VTIA 2A0FB 4HKQA 4QIVA 2DNHA 2AEFA 3HKZD 1HHQA 3AODA 3C7NA 3T7ZA 1TL4A 3MR5A 3EGZA 3DRRB 2W42A 4UY8O 5CZXA 1RHKB 3FZFA 1X4DA 1NRKA 4ED6A 1XC3A 3R5DA 3LP0A 3ILJA 2DEJA 3E9OA 2DNMA 3RRKA 5KOWA 5LMUJ 1KQGB 4DZ6A 3PR5B 4P52A 2QO3A 3C6AA 3DOKA 4DV4J 3OT9A 3T5KA 3BGOP 3RSEB 1HBUB 3ILLA 6FD1A 5KFEA 4JI3J 1J27A 3HBTA 3OXFA 4IFYB 4GKJJ 3IS9A 2NRTA 4FOEA 2HAIA 3KLFB 1QVFM 3SK3A 4LF9K 4ZCKA 1FXLA 3KG0A 1M90T 4CZGA 3BS9A 3RBXA 3SQGB 2NSCA 3J7YU 3TI0A 1S10A 4DSEA 3A5MC 2P2CB 5F8GA 2HQCA 3G0ZA 4DV5J 3AA9A 1NCLA 3UKUA 4IFVB 4ILHA 3SSQA 4CHNA 3H1QA 2E5GA 1X5TA 3G82A 5IV3A 3NP5A 2UUAK 3ZZTA 4PG4A 3OFHA 3D1OA 1X3MA 1REGX 4I68A 3DLKA 3H98A 3L7OA 3J7YI 2QTWA 3QNOA 3BDEA 1XMQF 1RKIA 1LAVA 3AV9A 1GOAA 2D9PA 2DKOB 2VWKA 1H2VZ 1X60A 3AJ2A 1ZA1B 5E0OA 1FRLA 3O4WA 1WBBA 4L3NA 3ZZRA 4ILMA 4JI4J 1ZH5A 2LEPA 4YY3J 2IIRA 3D2EB 2HQDA 3DGVA 3U3YA 1K0VA 3GJSB 5D15A 3CCZA 3U27A 2X3DA 2P9UA 5AE1A 1N32F 5JVGQ 1EAYC 3L0QA 1JLEA 1S1XA 2CQ0A 2QE5A 2O8CB 3D6MB 3SZ2A 4EIAA 3OYCA 3CPWR 2NRXA 4AD6A 1Q78A 4BDPA 3AVJA 4BC7A 3QBXA 1WC3A 4LF8K 3W9JA 5GAHP 3I5BA 3OFGA 2HHSA 1M5VC 2GQ2A 4Y0FA 3CULA 3WXMB 4WWSA 1FF2A 5HOOA 4OI1A 5I3PA 2OFHX 4FNHA 1W97L 4JRQA 2QI2A 1MMLA 1H38A 1S72N 4J90A 1MMNA 2BOPA 3SBTA 2QC3A 2HBYB 3D3BJ 3CETA 3MCPA 3UKRA 1RDAA 2GZOA 4XPEA 4J8FA 1DTQB 4BRNA 4F0HA 4N76A 2KM8C 2KG1A 1UVLA 4ZA1A 2DY4A 3HZ6A 1NPRA 1K73O 1LKZA 3M30A 5A2QY 4FJ8A 2Z56B 4PYAA 2VQEK 3C6TB 2C3MA 4OYIA 1UJ6A 3CCUS 1TAQA 1YK9A 3H46O 3ZTPA 2ATLA 2WHOA 2W9AA 4JI7J 2HW3A 1YIJN 3G4SS 1JLCA 4FYDA 3MXMA 1NM2A 2DRDA 1RCHA 5B09A 1X9MA 3MM9A 3IO1A 5BJRA 4MK7A 3JSBA 1T95A 2CQ4A 4LFCJ 4IOBA 4JK7A 5KFBA 5L1LA 3T1HF 2V67A 4CLYA 3NOCA 1QZ5A 2OPQB 2XM3A 1EWQA 3GIRA 2V9WA 5AQTA 1K44A 1CZ9A 3MM7B 4FPAA 2CQHA 2K7KA 4HVJA 3H5UA 1Y3JA 1DEJA 1NDCA 2Q97A 3A2FA 1IBLK 4Q5VA 1HQUB 3EMTA 5D8HB 3CCQS 1S7HA 2GX9A 4H4MA 1RWOB 3TJAA 1WI6A 9RUBA 1XNRF 2HNYB 1U0SA 4H0PA 2FVRA 4KFBB 3F56A 3SNNA 4CHPA 3I55N 3BV8A 4F4YA 1UFKA 3W62A 2A2DA 1QAXA 3OD2A 2ZBIA 2AJFE 2RRAA 3WNFA 2CA9A 2A1RA 3N4PA 4ID8A 2DGVA 2WOMB 5EOYA 3D7EO 1VQLS 1KC8T 4USHA 1HQEB 3QNNA 2CG8A 2ADBA 4C8NA 3DRSB 4UQTA 2VH7A 4WZQA 4FOIA 1VQSA 1CJUB 3H2VE 2LXUA 4PQUB 3R8YA 4DU8A 1Q8KA 3NMUA 3B6PA 2CVIA 2L08A 4M3RA 4CGDA 5E3QA 1NGBA 1GMVA 2IJFA 3HD2A 1R6YA 1XEZA 4Y6IA 3N6LA 1E4GT 4I6WA 2JGUA 1N33F 4DI6A 2HWHA 1BQNA 2B5JA 2HHXA 1KFDA 2UUBK 4NB4A 4FF3A 2JFKA 4ZPDA 4H4OA 3AO5A 3O8WA 2UU9F 1LWCB 2FQQB 3A8JA 4ATNA 4DR2F 2MZSA 1CS4A 4ZPCA 3AO4A 4EP4A 2EC0A 1C4CA 3OW2M 1XUPO 1X4CA 1Z25A 4G1PA 3L4BC 4M7YA 2AD9A 3TNVA 3ICLA 4EAHD 1VQNN 4CHOA 4X4UA 3OTOF 4ICLB 2G8VA 2B0GA 3KHYA 1VHXA 2IVYA 2NXJA 1FD2A 4OLPA 4KRFA 5BPMA 2MKCA 4LVOP 1CG2A 2C22A 3SCIE 2YWHA 4EO8A 2XS7A 3TJ8A 4H54A 1W2BM 4M3YA 3DDNA 1LW0A 3AVFA 1E6YA 1YJVA 2HYIB 3CTRA 4LF6F 2EVZA 1CC8A 4MK9A 3AVAA 3CPEA 2BABA 3I0SB 2FJDB 1R89A 5SUHA 2AGQA 5BR8K 2HMPA 4QIGA 4GV9A 2F7TA 1M1KT 5J1EA 1UCNA 4DR6F 1QAJA 2ZC3A 2PEBA 3CXCR 4WFBL 4O3RA 1ZM9A 3I87A 3ILIA 2QXLA 2PSZA 4CM2A 1HNZK 2FVSA 3K7RA 4FJGA 3L9ZA 2MQMA 5AQXA 5M1NA 2KB2A 1HPZB 3VQDA 4X66J 3THTA 4QOZB 2AA4A 1NK5A 2R7RA 3V81B 4CM0A 2KRBA 5AE2A 2JRSA 3FEXB 2W41A 1C4AA 4A8WA 2ZZTA 1PAUB 1NG9A 3RW6A 4CLTA 2DNLA 5HRRA 1GLCG 2V9KA 4ECYA 1SUQA 3RU0A 1YBAA 2X1FA 2H3EB 5DO2A 1BA0A 1DT9A 2C2EA 3NFAA 3RRHA 4CESA 4H0TB 1HYSB 4DXLA 4W5RA 3D2FB 4HVZA 3DRXA 1HRHA 1YJ9S 1LCUA 5ETKA 3HJVA 2XGQA 2GVDB 4LFAJ 2DNZA 1KVIA 4ZVHA 1R59O 3TAFA 5AQUA 3AARA 3I82A 2I2YA 1I5OB 1OIAA 4KAIA 2HHHJ 2NRZA 2E2NA 2B9YA 4CJ7A 2VA2A 4Y0WA 2GGPA 2E44A 3BF4A 3EEQA 3G2XA 2RSQA 3US5A 2CJ9A 2HLUA 2UXBJ 1RBUA 1FJGK 4UZBA 4ELUA 4NXMJ 3PHTA 1Q7YT 5C2GA 2AJQA 1VQ4S 1HA1A 2DNKA 3PRDA 5IQQA 3MM8A 4EBCA 3O3FA 3TOQA 3VF0B 4BC3A 1ZBIA 4DTRA 5HATA 2VG5A 1DAXA 2AJ2A 1BA1A 1VSHA 4C0OC 2I38A 2B4UA 4UOHA 1X5OA 2J0SD 4RU2A 1N5YA 3T1YF 3GJRB 1V3SA 2PMHA 4FJXA 2GAGC 3IR5B 5DDOC 2F9JA 4KHNA 3HM9A 3KDNA 1FWPA 2Q6CA 3QAEA 3D1QA 5KG3A 1T9TA 1REVB 1S6PB 1MWKA 1LWFB 3FZBA 2QMXA 5GAHU 5ADZA 4QYRA 3O6WA 2OJ3A 3W5YA 4ZPWR 3G6VA 2K7JA 5KT4A 2WBMA 3F0NA 3LH2S 2G0IA 1PJ5A 1HPMA 1H74A 3QAUA 4AXIA 4LC9B 4X65K 4KYZA 3OY9A 3PJ9A 3EPGA 2F9DA 5E7OB 4B17A 1VC6A 3K5LA 1FWKA 5B08A 2QL5B 5M1PA 2AYEA 4O5BA 5GAHI 4H5RA 3ATUA 2DPJA 3ENAA 2UYTA 2FBTA 4NZ7A 2ZNYA 2CXEA 2KZMA 4IOAQ 3ISND 4KB1A 4CEAA 1DQ9A 3W3SA 2VGMA 1RZMA 2RT3A 2WVDA 2BV3A 5HL7Q 1SAZA 3DXKB 2FLOA 4M63C 1X5PA 4KI6A 4DS5A 4OV1A 4F04B 4K42A 2GMLA 2DGSA 1Q18A 2OPRB 3PXGa 1M5SA 4G6VB 3UE5A 3MDFA 1U09A 1OKJA 1RWXB 4P75A 1S5ZA 2Z58B 4O23A 2YH0A 1IQZA 4LREA 4FWOA 3DRPB 4J2AA 2GCFA 5T7LB 3CC4S 4ZVRB 4Q43A 2HB5A 3FGVA 2D0AA 3Q86A 1C1BB 3GBTA 2KJWA 3QESA 1Q95G 3N6MA 4PPDA 3PHEA 2HHTA 1OS5A 5DZ6A 3X3UA 2GMHA 1UFWA 2XSJB 3DLHA 2R7QA 3P1GA 2ZOMA 2RQCA 1SIZA 2ZC4A 5A8RB 3KHHA 3ZT0A 4NLGA 4F4ZA 3TTCA 2JLFA 1G6BA 3GQCA 2L48A 5D4PA 1J9AA 2LA6A 3FJ2A 3MAAA 3SQ2A 4DR1F 2R7WA 2QYGA 4CECA 4UF4A 3CD6S 3G8SA 1JLBA 3WUHA 3EL2A 2C42A 2OSRA 1S9FA 3AA3A 4IDKB 3MEDA 2CZ4A 1ZZNA 4GO7X 5E5NA 1WG5A 1FK9A 1YX2A 3PYDA 3D67A 1Q53A 2XZTB 5IQ6A 5ETRA 3FZ2A 5FPMA 4OPJA 4DL7A 1G1XA 3F41A 2BUPA 4JKGB 2BYCA 3N01A 2NPFA 4ZLLA 2AYGA 5HP1B 4NLRA 4H5VA 4BRGA 5LSLA 3KLGA 4JV1A 2CNNB 2YHBA 4P6QA 3SCKE 5ADXH 5AQNA 2DFHA 1NKEA 3CJ0A 4WFAL 4Y00A 2CQPA 4Q2LA 2LDYA 4KH6A 2MLXA 3O9TA 3J80U 2HMIA 2QKKA 3RB6A 3ULEB 2R9LA 1J5OA 3VAKA 1YJWN 2ATCB 1VJWA 4DZDA 4R0JA 4C8ZA 4Y2KA 4CBXA 4RUHA 1RT5A 4J9KA 2AHOB 4F2RA 1H98A 1Y64A 4DB3A 3NOGA 5CYMA 3S3MA 4P7TA 2HIQA 2ZE2B 3NGYA 1F6TA 5JMNA 1BHLA 1XBWA 3QQCD 2FHKA 1EZZB 3CMES 1ZBLA 4EHUA 2OAUA 2V69A 5KG5A 3CCES 4Y3CA 1GLAG 3KZBA 4JK8A 5MAOA 3KJVA 3U6FA 1BMQB 3D28A 2IBKA 1KVBA 3V1OA 1BIUA 5EXWA 4B3SJ 3KWGA 4JKDA 2KVIA 1T94A 5H1SQ 3RAXA 4FPBA 4ID1A 3TWZA 4CZJA 4AHCA 4HCBA 5D0GA 1HNVA 2KT2A 3IBFB 4CEDA 2CGKA 3FSXA 1HUXA 3DU5A 1CJKA 1HQ2A 4OX7A 1S0NA 2GS8A 3CG7A 2J9DE 2P6TA 3K5NA 5HBMB 3MCMA 3VAJA 4DHYA 4WTYA 1VQKS 4R25A 4O8KA 1U2VB 2E5IA 1HARA 3SQ4A 1U04A 3FZMA 4F9OA 3WQUA 4I7FB 3CJKB 4DBQA 3FC9A 1RE1B 4DPOA 1B0PA 2UV8G 5I3UB 2WC9A 2HF4A 1JXEA 2ZWOA 4YR0A 2W25A 4G1QA 5DJBA 1E6VA 3Q8SB 1IKVB 1RT6A 3TABA 1Q0NA 1VQYA 3PIOQ 2FSJA 1PYTA 4I0WA 4PY5A 3ENWA 2K06A 4OHWA 3MDQA 3HT0A 3PYEA 1JKHB 2IA0A 4S0MA 3H0PA 4CH1A 2FSNA 4YQWA 2QXFA 4JEPA 2X6NA 3M8SA 3U8XA 3PX6A 3ISNC 2KW4A 1SB6A 3BSAA 2ZWHA 1VBXA 3Q89A 1M1KO 4AM6A 1CXQA 1SJ3P 3HXMA 2EG1A 1RB0A 2FLLA 4J9UE 4BR7A 4KHYA 1B0VA 2RJZA 1FFWB 4BRCA 4EI2A 3VQEA 1EX4A 3MMCB 3CJ2A 4A48A 1IR0A 1VQON 4DR7F 3O1LA 1H7WA 2A3ZA 2IVFB 3R5AA 3QO9A 1VYAA 5DM7L 4FXDA 2VASA 3NVKA 1R8HA 1TUUA 2ASYA 3IAYA 3UVJB 2A6AA 4LQ9A 3O1BA 4I9QA 4B1XB 4KT0C 1RBAA 1DTTB 3OLAA 4CO3A 1OQ3A 2RHSB 2HVDA 1Y7PA 3K5MA 3CIZA 2YKPA 3FCWA 3M2UB 3S7RA 1HX1A 3DRYA 4JYAK 2HEKA 3MAHA 3T1HJ 2IJNA 5CAAA 2YXLA 2JVOA 4MO4A 3BBCA 4DV0J 1TKZB 2HVZA 1M5PC 2DGWA 5M2UA 2DNPA 4KKOA 2RUGA 3ITHB 1XR7A 1HYZA 3D1HA 3O4NA 3RB4A 3EPIA 4CO2A 1DLOA 1I94F 2KKZA 1OVYA 1SC6A 3HDSA 2WSFC 3VEZA 2NLWA 2KLAA 2BACA 5L39A 2VWJA 4CZMA 2H51B 2HFNA 1NO8A 4RW6B 1XNRJ 1QVGR 2CNKB 3RMCA 3AJ1A 1UEVA 3G71S 1LWEB 4IG0B 4C3KA 5LMNJ 3J81j 2E6MA 2FHJA 3BSNA 1YSJA 2FUG9 3IDHA 3FFKB 3ZSVA 1U1RA 1RT4B 4QWCA 4B9MA 1AXQA 1I3OB 3VQTA 2UXDK 4DV2F 3FSIA 3BGUA 3VAIA 4WK1A 5C0YA 4A2AA 4DPTA 3W66A 2ZJQQ 4LF5J 4Y28C 1FA0A 5KTQA 4C8LA 2G13A 3RZAA 4B8AB 4B1VA 2ZITA 1NKCA 3MN9A 3N4QA 2M70A 1OYDA 2W8LA 4BE2A 3OUYB 4EK2A 2AGOA 4OZ2A 4HEA9 2ZNZA 2MTLA 2HS0A 2ZJPL 1DARA 3DRRA 3VAMA 5JVGL 4YOTA 3TA1A 4W5OA 1KN6A 5CHIA 1KR4A 3UPFA 1HR0K 4DU7A 1VAZA 5AQPA 5AQYA 2WB4A 3RSEA 4DR2J 3SFGA 3BO3A 1WI8A 1NB2A 1P1TA 3AAPA 4IFYA 1T05B 1QY7A 2HG4A 2RN2A 3KLFA 3SV4A 3SQOP 2WONB 3EGWB 2ZH8A 1TKTB 2HBZB 3NS6A 2RQ4A 4EBEA 3SQGA 2YWFA 2OSQA 2EW9A 4F3OA 3R2CJ 1R0CB 3AQOA 3J7ZT 2DPNA 2XYHB 3B6BA 5LJVA 2PC6A 1U1LA 3J81Y 3NE6A 1WC1A 2EWSA 1WHVA 3OFFA 2ACMA 4B9SA 1YJRA 2H4YB 4BR5A 3CDBA 2AX1A 2ZHAA 5A0YB 1UVKA 2MQOA 3GLJA 2AIRB 2V8HA 3ZTOA 1JL2A 5A6WA 4GKKJ 4BC2A 2HZVA 4D3HA 1RDUA 1NH7A 2UUAF 2LA4A 3A12A 2HVIA 2P8IA 3GYXB 2PAVA 1MROA 3G96A 5ADXA 4KPYA 1YTYA 5FLXU 5IFMA 2D0BA 1U6BA 3IUCA 3NGZA 2AJ1A 2HQIA 4OV6A 7FDRA 3CDAA 4Z4IA 1UWBB 3PSFA 2HFVA 4YP3A 2E7VA 5HMXA 2Z57B 3IMQJ 2O8CA 3VQAA 1FTCA 4DV7F 1JCFA 4GC7A 4GW6A 1UVIA 4DTSA 4YS2A 1S6QB 2J9DA 3BPDA 4ZLJA 3OHAA 4JI6K 5CD4A 5KT5A 3GZ7A 1HNWK 1UPMB 1FW6A 1XWLA 3KK7A 5U47A 3THPA 3OYDA 2VB6A 4JV5J 2RF2B 2ZD1B 2COLA 2DJWA 3U1MA 3I4PA 2LXIA 3Q8PB 1MA9B 3TR8A 2ASDA 4LF8F 4HI2A 1TGOA 2EFQA 2JSXA 2QLXA 5EDWA 3TUPA 5EX3A 1I51B 2JLGA 3QLHB 3J81O 2M8HA 5EHHA 2R8IA 1KQSM 4LBIA 5HMZA 2AP1A 5DM6Q 1ZAXA 1DTQA 1WSRA 3PW7A 1FFGB 3FQLA 3KNGA 2DTUA 1F60B 2V51B 5FROA 5F9LA 3CFOA 5M1OA 2CPXA 3MX5A 1XIQA 3C6TA 4P2XA 1GMWD 3BM7A 3CO9A 3J80Y 3KHLA 2MQLA 1FNXH 3R27A 4JI2K 1PGZA 4KHPJ 2G8UA 1PSDA 4CJVA 1A0OB 3GMGA 3RW7A 1FKPB 2V8PA 1N5VA 3NH0A 3NNCA 4DUZK 3A3OB 3JYTB 3AD9C 3GU0A 3NGUA 4QR0A 1D1UA 1PBUA 2OPQA 1IVZA 2IGIA 4M63A 1BQXA 5LL6Z 3HO1A 3M9MB 3MN6A 3GJQB 5C2FA 4CJKA 4I2QB 4PAAA 1NK6A 1RKJA 3PO5A 3FNNA 2F63A 2RKIB 1QHTA 1HQUA 3LPUA 3MN5A 3CCUN 1XMOK 5KFYA 3P4IA 1FCAA 1RT7B 2GHPA 4MFBB 4PXCA 5J1PA 3DXMB 2HNYA 2BJDA 3G4SN 4KFBA 1WUUA 1TV6B 2A10A 3HSDA 3DLLQ 1N34F 2M5YA 3R97A 2Y0BB 2Y1LB 2A40A 4L74A 2VBYA 3RR7A 2JWKA 3D54A 2WOMA 5K5MA 4HTLA 1HQEA 2QX0A 1AUDA 2V6AA 1AYEA 5D6GA 2ASJA 1CJUA 4CZCA 2YX7A 4F50A 2CPYA 1NDLA 4PXDA 4PQUA 3V6KA 3OVSA 5T7BA 4A8FA 3MZIA 2BEFA 2CZVC 5C2DA 1NEEA 3TUZC 4N41A 4M3XA 3J80O 1IM4A 3VALA 3V1QA 2ZM6F 3QT5A 2CH5A 5KFSA 1EQ0A 2KFYA 2M88A 2VU5A 1NGEA 2L9WA 2IFXA 2B56A 4WTOB 2VFSA 2BQ3A 3PW4A 3CDWA 4XH4A 2ZOGA 2ZZNA 3ZSYA 2XNQA 1CULB 1OMSA 5IT0A 5BYSA 3IR7B 3EVOA 5HANA 1XN9A 2P9PB 3DLRA 5B0DA 3UN5A 4DUYK 3HSJA 1PC5A 4K4TA 2GC8A 2GMJA 1VQ6S 2D0PA 3H4DA 2UUBF 3CCSS 1YLXA 3VR1A 4NZ6A 4BG8A 4ZVFA 1LXJA 4NLUA 1K8AO 4LUBA 3CNQP 4ICLA 2XZWA 3V4MA 3TZZA 5CYQB 3GOIA 3FMBA 5BYQA 4DQRA 2QA1A 2WK4A 3RRGA 3WXKA 2HBRB 1D0EA 4Z0UA 2PA8D 2KU7A 4JD2B 2DH9A 3FUYA 2N7CA 2DHHA 5F8HA 1UAWA 4QWDA 3IBCB 2J7WA 2PIIA 2AF6A 3JAMY 4NXNF 4K0KK 4FLTA 4H03B 3PCOB 3GP9A 2Z2LA 1NJIT 3I0SA 4OPHA 2BA9A 4PKGA 3U02A 3R6MA 4P73A 5GIPA 4C97A 1VQ5S 4M3TA 1TK8A 4XIUA 1QVFR 4A47A 2O8DB 3BGLA 3UCZP 1T9VA 3HSCA 2MQQA 1HPZA 3VF2A 1VBKA 3RAMA 3K2PA 4F67A 3CCTA 5H1SV 2AW0A 3AH6A 4WPAA 5AQRA 3V81A 2J0QD 2QW9A 2Z0GA 1LOTB 1HNZF 1WN7A 1VQPN 1N52B 4BR9A 2E88A 4YN3B 3LPYA 3H45C 2E5LK 4UOFA 5LT5A 3MWTA 3THWA 2ETJA 4K7QA 4PR6A 4ILGB 3SQ0A 2QL9B 3EE8A 1MSWD 4HACB 1FFSB 5SZTA 4ID5B 3WC0A 1MLAA 3R5BA 4CDIA 2Z1HA 3M32B 5KFAA 4NA1A 1JJ2M 4RU9A 1HYSA 1CQNA 2QG9B 1NJZA 2RE2A 1GLBG 3SSRA 2R2TA 1N36K 4DV6F 4X4TA 3D2FA 4IG3B 4RPFA 3T6JA 1KBRA 2DGXA 4WE1B 4LSZB 2GVDA 1S4EA 1J5EK 3P49B 4U9RA 1JL1A 3JTOA 4C8MA 2JDJA 2DITA 4BWJA 1SKRA 4AH9A 4GMJB 1F2HA 2XCAA 2W9CA 3JAMO 4DV3K 4OZ1A 1Q16B 3CC7S 1AROP 1S1UB 5DG7A 4W90B 4JI5J 2IM1A 1ATSA 3FBCA 3VETA 2OZSA 3LM2A 3ZSXA 1P6TA 2E2QA 3LP0B 1XMBA 3J7ZO 1MG7A 1NPPA 3VVTA 4ED8A 3D66A 2EFVA 4NYNA 2YI1A 4HTIA 3H08A 2A41A 1YT3A 1ZAVA 3LQVA 4OKKA 4HL9A 1KQKA 5AQWA 3IS9B 4OZLA 4AE5A 2GTDA 3VGMA 4Z4FA 3ZSQA 3ZNJ1 5EWEA 2ZJRL 3SAFA 1BIZA 4YOYA 3KUHA 1S6PA 3CD5A 4YHHF 3WX8A 1LWFA 2JNJA 2F9WA 1HWUA 4ISEA 2NYHA 3W7BA 4AT1B 2JX2A 5AXMA 4OX9J 3C95A 4A8KA 2HQ3A 4F4WA 4OJGA 2E7WA 2X3GA 4DL4A 3WC2A 1YUWA 4WIIA 4BE1A 4GRSA 4O44B 2R8JA 2FLNA 1VQ4N 4CLZA 3QEWA 3H4BA 3EZOA 4UUWA 4KHQA 2DCLA 4FXWA 4ZP7A 2XB2D 3EDRB 4MLHA 3P6YC 3DLKB 5IWAK 5IT9Y 3RBEA 3DGPA 5A76A 2J76E 3NL0A 4X65F 5FLXY 3P96A 2MEWA 1ZBUA 3MR3A 4Y1CA 4B1UB 1RHJB 3K58A 1NHKL 4KR0B 3R6LB 3DXKA 1NJWA 2F4VK 2EFPA 2KO1A 3ID8A 4Q8FA 3E66A 3VGKA 2LQ9A 3QT7A 5BXIA 3PW0A 4CI6A 5BYRA 1IJEB 1S6UA 2JHEA 2OPRA 5JVHL 3L95X 3FDSA 1RADB 1JLEB 2NXUA 2AKWB 3QRPA 1S1XB 4WYLA 1WSIA 4BDYA 2ZHBA 3CQXA 2FJBB 3EJMA 3H3OB 4FWMA 1V4SA 3Q24A 3DRPA 3LW5C 1WELA 5BN9A 2K3IA 5T7LA 3PX4A 2XMMA 3H5XA 1GLJO 4LMZA 3UDEA 3PYFA 4ECSA 1Q4RA 5F8JA 1QDUB 1C1BA 2VKRA 1GT8A 2FVCA 3I56S 4OPAA 3LM9A 2BJEA 1LFPA 2VFVA 1N0VC 5KFKA 4NCBA 1U2CA 1I94J 2XSJA 2VQFF 3CD0A 3T9ZA 3GR0A 1FNOA 3FBBA 2X7IA 2FBXA 5AQJA 5A8RA 2KYXA 4KTQA 1RLDA 1LK5A 3CCLS 2VC1A 3HHLA 2A1BA 3S41A 3MFHA 3E51A 2NUUG 4DCOB 3I33A 2GUIA 3QIPB 4C98A 4EUVA 2QM1A 1WAFA 4NLXA 5FLXO 1T02A 4DV2J 4USWA 4IDKA 3C65A 2C2RA 3CC4N 3BO2A 4DPXA 4CO0A 3JSMB 3B4DA 1UZDA 4I6AA 4DV0K 1I6JA 4DTUA 3HHKA 3TRGA 3T5HA 3K5PA 1Q8LA 2R2RA 2IBOA 4JKGA 3GG0A 2DXDA 3TVYA 1QUVA 5HP1A 3WNGA 1JLGA 4CJLA 4JI8K 1WACA 3L4IA 4DLEA 4BRQA 3OW2R 3UD3P 4O3SA 2A2CA 5A8WB 4WZMA 2KKHA 4E7KA 1HW9A 1R3NA 3A8IA 2IRXA 4C7QA 1HJOA 5LOQA 4EWTA 3ZCMA 4RNHA 3O9QA 2GAHC 3BYRA 3ULEA 2HNDA 4FJJA 3KFWX 5D0RA 1NDPA 2J6TA 1S79A 1L3TA 3BREA 3Q2TC 1QQOA 2QWOA 3QMQA 4MJKA 4O4RA 4OZ3A 3A3PB 3PJXA 1W2BR 2VJVA 4KJIA 4P2SA 2ZE2A 3KLIB 3R7BB 3K9JA 4NYOA 1U6FA 4URGA 2MSSA 4LF9J 3OR1B 1Q82T 2ASOA 3QEIA 3KLVA 4P72A 2H54B 4LSNB 2BJ1A 2ABYA 3GILA 4EFHA 2GW8A 2R7OA 4K5RA 2BTFA 1SKUB 2CIMA 1Z4UA 4CD3A 1V5IB 4JOUA 3UNYA 3W65A 1XR6A 3TANA 4B3TJ 2DR8A 2DR7A 1VQ7N 3IKMA 5HBMA 2FTRA 4DTJA 4OJRA 1KCFA 1UA1A 1J53A 3CJRA 2QK9A 4KBIA 4I7FA 2YKNA 3CMEN 3TX0A 1X4BA 2W1BA 4JI3F 1K1QA 5F2RA 4IEIA 3CJKA 1KLNA 1IXKA 2HBKA 4MO5A 1WSGA 2DGTA 1YJNN 3WNEA 3L2VA 1IKVA 5IXUA 4EEYA 5C5JA 2P1JA 1BD6A 2ZHOA 3MXIA 1APSA 3NF8A 3VGLA 1H2TZ 4QU7A 5C10A 3CD7A 4CI0B 4FP9A 3RR8A 3O1WA 2ZH7A 3DC2A 1RTJA 5H9EJ 1ASWA 5KG2A 2CJBA 1JKHA 4DDFA 1HIYA 5E3RA 4K4XA 3VTHA 1C0MA 2V50A 4A5BA 1P8ZA 1VQKN 4CNZA 2IIHA 2W24A 1PAEX 5HK4A 1WOQA 3OVNA 5EU7A 4ES1A 2JVRA 4FZXC 1NJXA 1RDBA 2ZDOA 3UNGC 3MMCA 3VZHA 2BJ9A 4YY3F 4DHVA 2E1CA 3B8AX 3I0RB 4J9NA 2KFZA 3NDKA 2HRTA 4BDZA 3W2VB 2G2OA 4FVUA 1NAQA 4R79A 2CQGA 2VODA 5HRSA 3MECA 4DCHA 3ILOA 3QGHA 4CJUA 2YQ3A 4RW7A 1R27B 1PJ6A 1KLMB 3UVJA 2MSTA 3FK4A 1HNXK 1DTTA 1YG0A 4B9QA 2CGJA 3GL1A 3GV7B 3D0GE 2VQEJ 3DHWC 3BR8A 3M2UA 4C11A 1CLQA 2ADCA 3PZPA 2E1MC 2G2YA 1UPPA 4DSLA 4UOGA 3LPEA 4BR2A 1CZAN 1TKZA 4F3TA 1IBKJ 4RNNA 4LIRA 2ASLA 2N3OA 4ZHRB 4F26A 3ITHA 4XTTA 4C1NI 3FEYB 4JYAF 4LF4K 3SBGA 4NL5A 5CCLA 3OYEA 1NM1A 3S9HA 2PY5A 2WTUA 1WDTA 4P7VA 2HHPA 2OFGX 2YTCA 5I42B 2Q2RA 4DPUA 1BG3A 3DNCA 3ZEUB 5T41A 3VEXA 2HBQB 1U1KA 2R8KA 2AQ4A 4P71A 5HVHA 1VQ8S 2V8GA 2YHWA 1UWAA 2UVWA 2D1CA 4F25A 2VV5A 3B8HA 1IBLJ 1LWEA 4HI1A 5AQSA 1H6KX 3HL8A 1MDUB 3MMBB 4KHPK 4ALZA 3P5JA 2HLTA 1NGAA 4A2BA 1RT4A 2FY1A 1DQ8A 2R7TA 4CGGA 3HJFA 3IWXA 3IN5A 1U24A 4CTAB 5KFMA 1G7CB 1U7LA 2V34A 3MM8B 3J7AP 2VDIA 4NRTA 3KHRA 4URSA 3N79A 3AVLA 4USTA 1JLQB 4WFBQ 3OUYA 4PUOB 2DHGA 1FEEA 5AJ3K 4CJ4A 4LH4A 2M9KA 2PN6A 2ROPA 1JCGA 1VBYA 4QIEA 2ZBQA 3G71N 4TVAB 1RQ0A 3ULDA 4M94A 4LF7K 2IC3A 2CJYB 2X51A 1ULRA 2KG0A 2BE7D 3WQPA 4KGKA 3OS0A 1DQAA 1FWLA 1MN9A 1KD1T 1Q7LB 2F8HA 5E3CA 5KFWA 1ZTWA 1YHQS 1HR0F 1L5UA 2UUBJ 2DNYA 3ATVA 4C23A 1RT2B 4DR4K 2WONA 4IR1A 1TKTA 1QSLA 2YNFA 1KHVA 1RWKB 1OVQA 1B9DA 5EWGA 2IY5B 4FKYA 3SDEB 3CE8A 4IO9L 3MWPA 1CBKA 4K50A 1EB0A 2WZ1A 1EQYA 4X64J 3ETMA 5MLCQ 1SQKA 1UFLA 3SCXA 4DCPB 4HTJA 3EZ5A 4DR5J 5B8HA 2HGLA 5EGYA 2XMTA 1U1PA 2E1ZA 1SBRA 4PL8A 3HVTB 2IA6A 2A6MA 2DBBA 4F0KA 1M1HA 4J9RA 4FLYA 1IUJA 2WTFA 2P51A 4E7LA 3D3CJ 4PEOA 1DBDA 4IFEA 2HGMA 1BLUA 1BO5O 1FO1A 4K2JA 2FGCA 3D0IE 5GMKa 3C94A 4WFNL 4KGMA 1KVKA 4HH1A 1FX2A 1UWBA 4BRPA 1O13A 3B6OA 3AXKA 2HURA 3NNHA 2PFUA 5BR8J 4X4OA 1VSEA 1VSLA 2UUTA 4YFUA 3DXSX 3V6DB 2M3DA 1S6QA 1DKGD 3E1YA 3HSGA 4C0HA 4RW4B 2WVFA 2UZAA 1BUPA 1HNZJ 1T8EA 1NGFA 3LPTA 1S9EB 2RF2A 2ZD1A 2GUPA 4FO0A 4CJ5A 3AAWB 2ZGYA 2HSEB 2R7UA 4JI6F 4B3MK 4M8LA 1JLBB 2H9ZA 1PILA 4TLRA 2UV8A 3T1AA 2BJ3A 3PIPL 2WVBA 2V4JB 2YQ0A 2UUCJ 4ANCA 1YTAA 1D09B 5CQGA 5L46A 3H25A 4QPXA 1VISA 4ES2A 3P8BB 1NMEB 2QMUB 2IVPA 4ZPVR 3BKFA 4NYZA 4M3UA 2Q31A 2E5JA 3LL3A 2BQUA 4A8OA 5A2QU 2NCKL 3IC1A 2J6UA 2AZ3A 5BRHA 5GMDA 4X66F 3L3VA 4CGHA 3TA2A 1R8AA 1FKPA 4OI0A 4FXVA 4QPTA 1Q82O 1FJGJ 3JYTA 1UW9A 2Q1NA 2O67A 1K73T 4JI2F 5DLGA 2QJ3A 3AY0A 4WQ5A 2CQCA 4KHMA 3I5CA 4DLGA 2YWKA 3WDOA 2NR0A 1NH8A 4RCHA 3P5BP 4I2QA 4DMNA 3V6JA 4MYTA 4NCGB 3KKRA 3G8TA 2BE2B 2RKIA 1U48A 3MEEB 2MHEA 3OS1A 1N6QB 5F8LA 3O80A 3TARA 4F4KA 4FJ7A 2CPEA 2YKOA 4H0YB 4FS2A 5HRNA 3Q7BA 4LFAF 1Z05A 1RT7A 4ZVUB 4FYWB 4MFBA 3DXMA 2DNRA 4A62A 4IJNA 2A18A 1WSFA 4WK3A 2ZH5A 4NLYA 1Z2LA 4QR1A 5FRMA 5KRSA 1ICEB 4I1TA 2CQBA 2GHWA 2HNZB 2W4CA 2ASPA 2UXBF 3CIPA 2CWXA 2SXLA 2DEIA 4B9UA 3W61A 2CDRB 2FYXA 2BH1A 1S22A 3JQJA 1YRUA 1Z2ZA 4RNFA 3BEGB 1TK0A 1TL5A 4IQMA 2VPWB 4TYAA 2OD4A 2D3ZA 4I56A 1WG4A 3OSPA 1WHYA 2GQCA 5FPDA 3HI0A 2DXEA 1S1VA 1D8YA 2I7PA 4WFAQ 4ZPTR 4KHSA 4ZJOA 5KT6A 1J2VA 2CWKA 3VZIA 4CJEA 4DFPA 3IRXB 3TQEA 2J6SA 3QWPA 4N8NA 2DD8S 5C7PA 4JKAA 3CM5A 3HYFA 3C15B 3ZX0A 5LJ3Y 3KUEA 1NHVA 4CLLA 1IM6A 4CZFA 4AL5A 4UUXA 3PYGA 3T9NA 1NSAA 2KN4A 3OYGA 1IWAA 3MMVA 2VF3A 1GXTA 2FHOB 2X78A 1RUSA 4TSXA 1YKWA 2W7AA 2A5XA 3G25A 2P9PA 3CF5L 1RWUA 2XWXA 3GB0A 2GNKA 3E01A 1URRA 4V19S 4OYBA 1T3NA 1KEKA 1LWXA 3IG1B 4M5IA 2E1YA 3H20A 3FCHA 3O9UA 1OSDA 1V3ZA 3ID6A 3QWUA 2HGNA 5CYQA 3NNAA 5AQHA 5CZVA 2BXJA 1OH6A 4DFKA 3M1FA 3LWMA 3H2LA 1X0PA 2L3MA 4JD2A 4DWIA 3QO9B 1BC6A 2ZVIA 1U47A 5KOXA 2OTJS 1YVFA 4WCEL 3IA0A 4I69A 3OJSA 1VSKA 3PEJA 2OTLS 1RWPB 3HFVA 2ALZA 4Q44A 4BCAA 4DN0A 3M7VA 3A13A 4GVBA 5KFLA 1WC6A 3I31A 3JSYA 2IAJB 1TFYA 1VQ6N 5F9NA 5JMVA 3AVIA 1G99A 3VENA 2D0OA 3GR1A 2YPZA 5L1KA 5KFJA 1JIHA 2Z2MA 3M4XA 3KVGA 2O8DA 2ITGA 3IWNC 4C8YA 4PXEA 1JMTA 3I4HX 4LR7A 2O8FA 3SYZA 3GWCA 2QKBA 3OYLA 1R31A 1EQMA 2M8DB 3I8BA 1VSMA 2FVPA 2JEFA 2RDIA 4BBYA 4DF8A 4K41A 1Z1ZA 4HT7A 4FWPA 3SJJA 3UWTA 1KVCA 3CFPA 3F9MA 4LT6A 2FZKB 4KSEB 4K4YA 4HACA 4XDDA 4ID5A 3BBFA 1WOOA 4P2MA 4X62J 1YWXA 1O5JA 3M32A 2G9OA 5LXRA 4LD0A 3NAIA 2ZH1A 3IM8A 3MM6A 2EHGA 1VQ5N 1EIYB 4IG3A 4YOXA 3MXJA 4H0OA 3ALYA 2HFOA 4WE1A 3O6QA 3QETA 3DDKA 3NS7B 4I64A 1KD1O 5DM7Q 1ZM3A 1SQGA 2MDAA 1SVDA 4XK8C 1N36F 1H72C 4Q0BA 5GAEP 1HLWA 1S9GB 2RUSA 4U8YA 1NGIA 1S1UA 2V0NA 4P2FA 4RZRA 3RJMB 4OHXA 3OVBA 2V2ZA 4I6MB 1VSFA 3VQPA 1UEKA 4J37A 1ZC6A 1QHAA 4XEIA 2W6LA 2WRMA 2PFFB 4JS5A 3D9BA 5BPLA 1A5XA 1U49A 4CJPA 1GMUA 1GFWB 2K8GA 1N8RO 3WEEA 2JLEA 3VGTA 1TUGB 5HO4A 1XMQK 3AOBA 4KV8B 1CLFA 2E2OA 3HKWA 2W2OP 1FESA 3HULA 1NGJA 1NLVA 1WD6A 1KQSR 3ZZPA 4YDDB 5M1QA 3KK3B 1RBVA 4JI1K 4CO1A 4J5OA 4KRWA 2LU1A 4A8MP 2VZ9A 4KGXB 4IBNA 3CC7N 2FHJD 1T9UA 4PG8A 3W0LA 5AZIB 2QA4G 4P74A 4FL9A 2HKEA 4O44A 2VIHA 3SPZA 4O4GB 3L3UA 4B3SF 1NK4A 1EP4A 4B3TK 2XMAA 3GSDA 1TMJA 3Q22A 1N32K 3ZXWA 3AY9A 3O9SA 3OHRA 4ISFA 5DZ7A 4QIWD 1HNIB 1OPZA 4IO8A 1YI2N 4CZIA 4YMEA 2MQ8A 1VK3A 4M3WA 2R7VA 1MROB 2P9EA 2E29A 3F9KA 4NMLA 2YKQA 2ZF5O 2HBJA 3V9UA 2YKMB 3AGRA 3KHGA 4Z4GA 2QA2A 3V5RA 2LYVA 1VLOA 3CJ8A 1RT3B 3QIOA 3TSUA 2ZJPQ 5H9EK 1XR5A 1RAFB 5CA5A 3QB0A 3MPYA 2W2PP 3I96A 1FERA 2N4CA 1OWXA 5FJ4A 2FVQA 3OLBA 4JI0K 1FX4A 4CJFA 3A0IX 4E1MA 5K8NA 1M5OC 5IM0B 4CH0S 4KHWA 3ONQA 1SXLA 3EE9A 4DTMA 4CIGA 4WQ4A 2JEJA 1GLLO 3X1LB 2HHQA 1FTRA 4ELTA 3QDKA 2MJNA 4JYAJ 2E4LA 3R1XA 1VQ9N 2VG7B 5TKYA 3KDOA 1TMMA 3K5OA 4EYIB 1L3SA 4MK8A 3TW0A 1YJUA 2CUYA 1AZSB 1Y10A 2WB1D 4IOCQ 1ZM4A 4KTZA 1JXLA 3UW1A 4FNIA 3SI8A 2DPIA 2D9OA 3RTVA 3QIPA 3C3LA 4NMXA 3EDQB 4M5HA 3CJ1A 5HAOA 1X9JA 1MWMA 3JSMA 1M5KC 1GQEA 1LV5A 3UR3C 5HQMA 2PI4A 4QS8A 2MHNA 1FEHA 2CJXB 1IBKK 2UXDJ 4C8OA 4RBTA 1SI9A 1HL6A 4QBUA 2MZ1A 1YZ6A 1JLAB 3K89A 4DV0F 4CWBA 5A8WA 2XO6A 4RW9B 2M7SA 3CCLN 3BZKA 1O1WA 4ELVA 2A42A 2CPFA 1F0XA 5DQHA 4R8UB 4DR3J 2G8HA 3SXLA 3TVZA 1VR6A 2B7CB 2OCEA 3U9DA 4FVMA 1UKUA 1RAAB 5LMNF 4FZYA 3M6UA 1SKSA 4GVEA 2CH6A 1Y5NB 1HR0J 2QMWA 3QINA 1FKAF 2IHR1 3OYIA 2DHXA 3KLIA 3KK2B 4FWKA 1Q1KA 4DTOA 3MI7X 4LF5F 3CYMA 3OR1A 1X0FA 1OH7A 4LSNA 2EX3A 2UU9K 5A2QO 4Q8EA 3V9WA 2RD5C 4X4VA 5JLFA 1SJ1A 5CYJA 2DH8A 3I9ZA 4E1JA 3VEWA 1AA1B 3AA8A 1GH8A 3MCAB 1U25A 3OYHA 1YJTA 5L9XA 3VA3A 3ENOA 4DQ8A 3WHIA 3OTOK 1GNKA 3SV3A 3IAS9 4CT9A 1Q86T 4E2FB 5DRKA 3FFIA 3MPWA 3ZTRA 1KRPA 1WC5A 4MT1A 7AT1B 1HHSA 2YQ1A 3UE2A 4CEZA 5D4LA 4HCCA 3O2IA 1KAXA 1YBTA 3MR6A 1JQGA 5GMEA 4CRJA 5AQLA 3MUMP 1WEXA 2KT3A 2HHUA 3H5SA 5J2PB 1HYVA 4OKEA 1JJ2R 2LFVA 3O5TB 3VVUA 1RHUB 4X64K 2G1HA 3PJWA 5LSRA 4LF6K 1LW2A 3EKSA 1NU0A 4DR5K 2D5RA 3L6QA 1B70B 4J9SA 4BRIA 3BZCA 1DHMA 4YOUA 3NLCA 3QEPA 4LSLB 3UI3A 4IRCA 5C25B 3QNWB 4DR6K 4JKEA 2BQRA 1IBMK 1YDLA 1FJEB 2BDPA 2VBXA 4IO1A 4JI6J 4DL2A 1HNWJ 1BUXA 4BWMA 5JLHA 5A8KB 5HQ8A 4WFXA 4M5DA 5E26A 4GKKF 1NMDA 1SL1A 4B1ZA 4LR8A 1QSSA 1O51A 4Y2MA 1PO6A 1HKGA 5KFZA 2DGQA 4CH7A 4CW7B 3I0RA 2B7BB 4HR2A 2HS3A 5GAEU 1WG1A 1RISA 2B4PA 2YJEA 3W2VA 4YR3A 4P10A 3Q23A 3NCIA 2O66A 3W1YC 3L7UA 1KLMA 4CFAA 4UZCA 2XHBA 3MMAB 4YDUC 5B0CA 4F3QA 4BRFA 5HQLA 4ZDNA 4W92B 5ETMA 1XNQK 3K59A 3EE3A 2HQGA 1BWVA 3M6GA 5FIIA 5GAEI 5FRNA 4PPZA 1HI0P 4JHDA 3VQSA 4JV5F 3THWB 4JI2J 4CIOA 3AHPA 2CPDA 2ILZA 2Q43A 1RTHB 1M5HA 4DUZJ 4ZHRA 2UUCK 4G65A 2VDHA 2XS5A 2PBDA 5AQIA 4L3KA 2NUHA 5B0EA 2F65A 1GK8A 4LQ3A 4FK0A 1RLCL 5I42A 4RLEA 3CIMA 3ZEUA 1RXOB 1S57A 5ETQA 2JWLA 2P9GA 1MU2B 3G10A 4YB5A 3T1YK 5GINA 2A1SA 4CERA 2W9CB 4OI4A 3CQYA 3MMBA 3OA9A 1XMOJ 2QL7B 4KTWA 1K9MO 3IRWP 1KS2A 3OHBA 1N4LA 2FJXA 3IBWA 2OH2A 5HJXA 4CTAA 4KHPF 2IVNA 2O3DA 3ENHA 4PG5A 3QFUA 1CEZA 2V7ZA 5C12A 4FJMA 3M6WA 5A6PA 3H90A 4F0MA 3FBEA 5B0FA 1JLQA 1NHUA 1SCJB 3AA2A 3VMFB 4PUOA 1QE1A 1RU1A 3SJHA 4ZOSA 4B1WB 5M1KA 4WP8A 5ETSA 1VQ8N 5I3QA 4ED3A 2E1RA 4FM2A 1X4HA 3LGNA 4BREA 2JEGA 3EZWA 3K0JA 5AJ3F 4DSJA 4J9MA 3E8OA 5DETA 2YH1A 5KFNA 1MN7A 2OUGA 4Z4EA 3LOUA 1KVJA 2X74A 4LF7F 4HLBA 5KAKA 2MZJA 2OIHA 4GY2B 4OIXA 2DNOA 3THXB 5EN1A 1RT2A 1V3RA 1ITGA 1VJQA 3AVMA 3DGPB 3DKDA 3BO4A 3GIKA 2GIQA 4EYHB 1X9WA 4DUYJ 3OL6A 1HWJA 3SDEA 4K8RA 3JSRA 2V52B 4IWVA 3CCRN 2IMOA 4O5FA 3HMJG 3J81U 3WQTA 4LFBJ 2CPZA 4FLXA 1SH2A 2HIYA 4RTFD 1Q9XA 1KQFB 3HVTA 4O0NA 1YXQA 3SPYA 2CGLA 2M0GB 3U9ZA 3FLCO 3FCVA 1YHQN 1Y00A 3PR4A 4ZCIA 4IKFA 4ZTJA 2E9TA 4L73A 2LSNA 4GV3A 3TAQA 3TZXA 2O8BB 2IM3A 2LU2A 2DGOA 2HK3A 4Z94A 4K0KJ 4K8XA 4C4WA 3BQ2A 1NWKA 3AD8C 2HFZA 4DR1K 2VA3A 4ED1A 4IQXA 1VSDA 4FDFA 3K0SA 2YWEA 2ZH4A 3NWGA 3H1VX 4CP5A 2ZJRQ 3C0BA 4PCQA 2AU0A 3SMSA 1LOUA 2YX4A 4FW2A 1BL3A 1VC5A 4ZP9A 4NYPA 3BBBA 3OPKA 3V6DA 5C15A 1WF0A 2NZTA 4RW4A 5EWFA 4DN9A 3BQ1A 1S9EA 1ZYQA 4O3OA 3HHLB 2ASMA 2HHVA 4AHSA 4EU0A 4L3QA 5HVGA 1SKWA 4ZJLA 1BE4A 2WUSA 2VWBA 2P6SA 2MKIA 2WVCA 4NPOA 5ETVA 2E5LJ 3LDQA 1I3AA 3CSKA 5ETTA 2QLBB 2VJUA 1U02A 3VWSA 3KMQA 2QEXS 3TSPA 2KVQE 5DDQC 2V4JA 4BG9A 4OJ3A 3KWMA 4U7BA 1CC7A 3CVKA 4WIQA 1UTAA 3RB3A 1EWRA 3E9LA 3EVWA 3SIPB 2WW8A 3GTYX 1JLGB 2P9SB 1VDHA 1N36J 2YVSA 4I67A 3TAMB 1FRMA 5JVHQ 3QFPA 2J0XA 3G6ES 4JN4A 2KL8A 4CJ3A 1CSJA 4AF1A 4IUFA 3V1RA 3EICA 1J5EJ 4CBUA 5CE3A 4DF4A 3S3OA 4CJQA 1BQMB 4DV3J 2QIFA 4L75A 4CEOA 5AFUA 5C24B 2HNDB 2O1PA 1SH0A 2RS2A 4X62K 2V5HG 4JV2A 2P9IA 3VHQA 4FZZA 4A5AA 2GX8A 2F9TA 3GG1A 4I4BA 3NGDA 3R7NB 4NCGA 5CD4H 2P9NB 2YWWA 2BE2A 5IC4B 1VIOA 4ZLNA 3MEEA 1WSJA 3HHLD 1N6QA 5F8NA 1S1WB 3KLEA 4DSKA 2VPXB 1Q86O 3RWUA 1C0TB 4RO0A 2OHDA 4BC9A 3M8RA 4ED2A 1UL3A 2J8AA 1OO0B 2D69A 3GG4A 4CJSA 2JWNA 4U7UK 4PWWA 4OPKA 1Y5IB 5HSPA 2GWJA 3B78A 1W7WA 4FYYB 5AQZA 1R43A 4RR5A 5L1JA 1WAJA 4AFFA 1YITN 4QWAA 3LP2B 1IKXA 2HNZA 2I5JB 2E9ZA 4JI5F 3KUGA 5IV4A 4MIBA 2ZH2A 3HPOA 2KQ2A 3VGVA 3DLEB 5KFDA 3J7Z5 4CEBA 1VQMN 5M2PA 1VQOS 4O55A 5IWAJ 1T11A 1GAOA 1RWMB 3M8QB 3NCRA 4X4PA 4FWQA 2QTDA 3WIUA 4EFAC 1TP7A 2YKNB 4KHUA 5F8MA 4ECXA 2P9CA 4A8SA 3LAMA 3NS5A 3QJPA 1TAUA 4JV0A 2RE1A 2MMYA 2HZAA 3V4IB 2BM1A 2ALYB 4DUTA 1FVSA 3NH2A 3PV8A 5D3GB 2F4VJ 3TAEA 3IRXA 2LECA 5HVFA 2ZH9A 5D0HA 3C15A 5M1FA 4RNMA 4B9LA 1RTJB 2WBNA 4OX9F 3W8GA 5D4NA 4CCHA 5CABA 5KFVA 3IGVA 3ZSOA 3NWRA 3L2UA 1SJFA 4OO1J 3DXBA 1TUWA 2RB7A 5F0WA 1S59A 1ROFA 4U67L 1CJVB 2XBPA 5J2MB 3M2RB 2J7UA 2IMWP 3RAQA 3IG1A 3W9IA 1RAJA 3E2EA 3R1LA 2OMOA 3AVGA 2RNEA 4BQZA 4USJC 3NMRA 2WW4A 2PYLA 1HW8A 5B0BA 1EO1A 2DNGA 3PO4A 2E1AA 1GX6A 3W5ZA 3MEKA 4PWUA 1ZTTA 1F9FA 2G2ZA 4USVA 2YBVA 3MECB 4FF2A 4RW7B 1DZ5A 4CHYA 1GOCA 1B7YB 1K8AT 4A8QA 2F7VA 3TEHB 4B3RK 3HPHA 3VF6A 2KDOA 3IFEA 4LR9A 1RNHA 4HWIA 1HD0A 2EFOA 4KH4A 3SUQA 1U45A 1WDDA 3QT6A 3ZX3A 2IAJA 4FVCA 3JAMU 4C11B 5DQIA 3H8YA 1URNA 5DG8A 3FQKA 1HD1A 3CJ3A 2Q3PA 1I1GA 4DQIA 4PKIA 4BC4A 5KG4A 2QWLA 4U7UD 3LP1A 4KH0B 3CDUA 3MUTP 1VFJA 2B51A 2PMZD 3KK1B 3IM9A 1ZETA 3T5LA 1IJFB 4IXCA 3PW2A 4WYBA 4WJBA 4ZP8A 4JI8J 3F5TA 2ZBCA 1NSPA 1VRUA 1RBSA 4Y2IA 1SL0A 1R8CA 2CZ9A 5K20B 1XI1A 2OTLN 3A8EA 4HDGA 2PMWA 3M8ZA 4M45A 2NZCA 3QEVA 2FC9A 3G86A 2H3GX 1YF5L 2KXNB 1MWQA 1S4FA 3CHWA 2POKA 3VERA 3LGHA 4JK9A 1NGDA 2VOPA 4B3OA 4HH0A 4BVOA 3QSYB 4R5PB 1TZ0A 3AVBA 3MPDA 1G3OA 2W2QP 3DOMA 3JXOA 3BY5A 3HHNB 1U2FA 3LDNA 4PYDA 2XHCA 2FC8A 2IJRA 3THYB 2H5IB 1VGYA 4X2BA 3T41A 1SS6A 2P5GA 1WTFA 3ADAC 4EGLA 1QLNA 4N5SA 4RUCA 1L3UA 1WJ9A 3CCJS 4ED5A 2QN6B 1EHWA 1S9GA 4DR3K 4AHUA 2OO4A 2BJ8A 5ETLA 4ZCLA 4CGIA 4ZPAA 4I6MA 4PZVA 3C19A 2IC3B 3D6TB 3CERA 1DRZA 3O4QA 4ILRA 3HHLC 5FD1A 2L41A 3EYZA 2UVRA 3HSZA 5KQ8A 4CLWA 3GONA 2XMJA 2NRHA 3BKTA 2Y1IA 1TL7B 3KIOA 5DMRA 3SAHA 1U1OA 4ZVTB 3L2QA 1TUYA 3IAM9 1NDKA 5C2CA 4M1KA 4CF9A 2YNFB 1RBOB 2VBZA 4KV8A 2WSCC 4QR2A 4TKTA 3MM5A 4E7IA 4OFZA 4YDUA 3KK3A 3LZIA 3C16B 1SQEA 1UVMA 3QYYA 4LF9F 2B8PA 4KAZA 3AVKA 5AZIA 3C14B 4IOCL 1F5BA 4O4GA 4JI1F 2B6AB 2IDLA 1ZBFA 5BRDA 2C2ZB 3Q7CA 3IP0A 1VBZA 2D41A 4A4JA 1XTZA 2PYJA 2Z1GA 5FDLB 1TR0A 4DV7K 1HNIA 2AMCB 2A6OA 2BKOA 4B3TF 5IT9U 4LBPA 4HTUA 1WHXA 2C2OB 2MKHA 1K1SA 2G0JA 2M2BA 4LVNP 2L9NA 1UJ4A 2YKMA 4KBOA 3E3XA 3OR2B 4E0DA 1PYOB 5F3TA 4TQSA 3MCOA 1RA7A 1WF1A 5I4MA 1RT3A 3CJSA 1EX8A 4UQGA 2FZGB 2RDJA 9ATCB 2QGFB 2NREA 3U7JA 4CHZA 2BGGA 1FKOB 1WNEA 2CFXA 2AT1B 2PD1A 3HTVA 1VRQC 4CEFA 2BW2A 4HYKA 3HD1A 3TTFA 2FLPA 3LTOA 4DTNA 4IEEA 1HFEL 4E7HA 1HNXJ 3HVRA 4F4AA 4NLCA 4NLBA 4B02A 4YORA 1Q8IA 4R0EA 5IM0A 1ZZFA 3GCXP 4DV1K 1JX4A 3UN2A 3SMPA 2YHXA 4TXSA 1DY3A 2NRVA 4JI0F 5H9FK 4K4WA 4M3ZA 2RHQB 2GEMA 4HHTA 1NZ8A 4H5WA 2VG7A 3NCPA 2V8DA 3EKUA 4IO9Q 1D5AA 4WP9A 1W0HA 3LDPA 1AZSA 4KGZB 4Z2XA 3VN5A 4DL6A 4LF4J 4X4QA 3VAGA 4ZKAA 3BSCA 2IOCA 1C1CB 4MDAA 1VS3A 2ILYA 3QBCA 2N82B 3THVA 3ULHA 1YBUA 2P9KB 4A8XA 3TSQA 1T3OA 3V9SA 2B9EA 4J9OA 3MEGB 1WTBA 4PRFA 2OANA 4QYZK 2Q0RA 2NXCA 2Y0SD 4C0BA 2B9WA 3CM6A 2W4DA 3OYKA 4X4RA 2C2NA 3RYLA 1FNMA 3MFIA 2QZ8A 2Y9HA 3MN7A 3HCXA 4I6YA 2PE8A 1J6ZA 3QERA 2VQEF 1F3FA 3H59A 4WFNQ 4YEAA 2OPSB 4URQU 3BF3A 3M8WA 3R9LA 1N34K 2AYMA 2CQ1A 2GELA 1JLAA 2UUWA 1K47A 2JC1A 4ANDA 1IBKF 3PW5A 4RW9A 3T3FA 1L3VA 1GTHA 1WORA 4F02A 3G6XA 2NYIA 4HUEA 4U8VA 1X3NA 2BRKA 4OYMA 4R8UA 5AJ3J 2MQPA 3M1VA 4AYBD 5JICA 2O8EB 2VG6B 1KWMA 3PRVA 3R3LA 4W5QA 2W2MP 2X1GA 4BLGA 4LF7J 5KFGA 1IBLF 4YR2A 3VQBA 2DTJA 1T03B 3LO3A 4C1NK 2ZM6K 3UDVA 4IYQA 2D7SA 3WXLA 3FE1A 3PIPQ 1IKWA 1GOBA 4IDHA 3QFWA 3KK2A 5AQVA 4O3NA 3HHDA 4WF9L 1LQ9A 4CGJA 2KYZA 3NGTA 3JB9k 2E2PA 2NNWA 4DR4J 1OH8A 3KLHB 4FJNA 2W2NP 1R0AB 4OYOA 5KFRA 1N88A 5EY4A 2E20A 1UJ5A 1KAYA 2G8WA 3CCQN 4AHVA 1S1VB 1B99A 2EWHA 4LRAA 5DDRC 1H2UX 3GV8B 3NAEA 5LM7E 4C8KA 2LXFA 4IJAA 4DU4A 4OHVA 2HPUA 4F3MA 1UVJA 4K4VA 4LRBA 3NAHA 1GXLA 4Y1DA 3NGSA 4B9TA 2J8SA 1VQLN 3VCDA 3D0HE 3J7A1 3CCVS 2JH3A 1DGKN 4OGCA 3LZJA 5J2PA 4ED4A 3U4LA 3E01B 4NXNK 3JTPA 2Q36A 4KREA 2MB0B 1HBOA 4JUZA 4LFBK 1N5QA 4KQZA 2H65B 5L8RC 5K8OA 1YTUA 1JJHA 2MY8A 1VQPS 4FM0A 2F8SA 4X64F 4LSLA 4IOXA 5C25A 3EO3A 1R8BA 4QCLA 3R5JB 3QEXA 4DR5F 2K1RB 1H1VA 3U1NA 3F44A 2UXCJ 1S49A 4BACA 2VUGA 1QJHA 4H4KA 1BDGA 2XY8A 5A8KA 2YNIA 1FE4A 2XY6A 3I9V9 5IC6B 1IBMF 2GJFA 4GVBB 3FZHA 3ZC4A 2VFUA 2N3LA 5B0GA 4B3MJ 4XDCA 3FGUA 5CY4A 5K14A 4DG1B 3GFYA 3WXJA 1C6VA 3ZZ0A 4DL5A 1SV5A 4PXBA 3IXQA 3PTWA 2FPHX 2XI2A 1Y11A 2VFRA 5D0EA 3ZT1A 3N6NA 3CJQA 1PG5B 2FBYA 2FJAB 4BRKA 4TN2A 1B4SA 4FWNA 2AX0A 3DYAB 3MMAA 4XAKA 4L76A 3I8DA 1VLYA 5BR8F 1HI8A 1IQTA 2O4IA 2O8FB 2GJIA 3DWLA