4I7FA

Hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Synthesis and biological evaluation of phosphonate analogues of nevirapine.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Hydrolase/hydrolase inhibitor
total genus 153
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i7fA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i7fA05
4N5SA 4LQ3A 5T14A 1S6PB 3SV3A 4G1QA 2HHSA 3LWLA 2AQ4A 2RDIA 3HM9A 2ETJA 4FLZA 1JLAB 3MEEB 3KLIA 4Y2AA 2W9AA 4IOBA 1I39A 1RTDA 2HNYA 3ZSYA 3HVTB 4EP4A 3TAMB 4TLRA 4K50A 1LWCB 3DI6B 4B9NA 4HCCA 2D0AA 5CY4A 1NKEA 5KG7A 4CJEA 2P5OA 5HP1A 5KFTA 4YR0A 5KG4A 5D3GA 1QSYA 4CF8A 1IH7A 2G8KA 1HYVA 1RT7B 5KFLA 3AVIA 1HQUB 4WYWA 3LP2A 2RF2A 2E9ZA 1JXLA 1W9HA 1FXXA 2R8KA 5EWFA 4DTNA 3I5BA 5J2MB 1KFSA 3KK3A 4H8KA 1FK9B 4DSJA 4FJHA 4RNOA 4F4ZA 4DTSA 4KHNA 4FK4A 1UA0A 1S0OA 1SL2A 5KFJA 4OVLA 1HJRA 3VA3A 1F21A 3IS9B 3AVFA 1NJZA 4LD0A 1R0AA 1SL1A 3QIOA 4NCAA 5KT3A 2YNHB 2W7OA 3EPIA 2WHOA 5HLFB 2J6UA 4M41A 1GOBA 1RDDA 1NOYA 4NLTA 4DL2A 3O4NA 2C22A 2HNDB 5C25B 5KFNA 4O0JA 4KHSA 4FM2A 2VA2A 4Z0UA 4B9UA 1UOCA 1B9DA 2P51A 2YKNA 2BQRA 3AVKA 2G8IA 4IH7A 2DFHA 1SH3A 4QW8A 1ZTWA 4JLHA 4CF2A 1T03B 3ALYA 4E7LA 2JGUA 1TV6A 4WYLA 3ZCMA 4CESA 4ED0A 5DLFA 4OKKA 3KLEA 3GV5B 1RT4A 4K4VA 2IS3A 3KKSA 2HB5A 4J2AA 3OL8A 5FRNA 1NK7A 1ZTTA 4DSKA 5DQIA 1TL3B 4J9KA 4OPKA 3PO4A 4KV8B 3FDSA 4E7KA 2F8TA 2ILZA 1WNSA 1SUQA 4KKOA 4DF4A 4AHSA 4O3RA 3KHGA 1JLQA 1S6PA 3VQ9A 1D9FA 2IM2A 4OKEA 4FK2A 3OY9A 4KE5A 1JIHA 4Q0BB 1IO2A 1KTQA 4FYDA 2OPSB 3SNNA 2HHTA 3QGHA 3V81B 4URGA 3KK1A 2OZMA 1JLAA 3QNNA 3MEEA 2AGPA 4CJPA 4LH5A 3F73A 4ZTFA 4DSEA 3MR5A 1N56A 4FJ5A 3BDPA 3HVTA 4KAIA 1S6QA 3TAMA 5I3UB 3M8RA 4DFKA 4XO0A 3VQEA 1IKYB 3MR6A 3N6NA 1VRTB 4RNMA 1VSEA 3KLFB 3NAIA 2XGQA 1RYRA 5CZ1A 4M3WA 4ECUA 3IAYA 3HK2A 3V6DB 3K57A 4IG3B 4FS1A 1BIZA 5KFDA 4W5OA 5KFHA 4CJQA 4QAGA 3Q8SB 2XY7A 5KRSA 3T3FA 1WAJA 5FDLB 4ZPAA 4URSA 1ZBFA 4RW9B 2YV0X 4ZP7A 1IM4A 2IMWP 3K59A 1KRPA 4IDKB 3SUOA 2F8EX 3K2PA 5C24B 5J2MA 3OYNA 1FK9A 3HP9A 5HRRA 4ED1A 2UVUA 4ZHRB 1NK4A 3IS9A 3AVGA 3NGDA 5J2NB 3NH0A 2YNHA 1CSJA 4H4MA 5HLFA 3CJ0A 4WE1A 2HW3A 4ECWA 4ZMMA 2HNDA 1X1PA 3CWJA 3I0RB 2UUTA 1RBSA 1OS5A 4IH5A 3RTVA 3QEPA 4CHNA 2XY5A 5DQHA 2I5JA 3M8QB 4O3QA 1L3UA 2PZSA 4IKAA 4ZPBA 1KLNA 3L2RA 4DQIA 3OS1A 2ZQBA 3NF9A 3O3GA 3DLRA 4CECA 3VQSA 4J9LA 4DL4A 1ZBIA 4DEZA 1C0TB 3QIPB 4NLRA 4DSLA 3PR4A 1X9WA 1X9MA 3CM6A 4NCGB 1TL3A 3HKWA 4KV8A 5L1JA 1ASWA 4B3OB 3ITHB 4E89A 2W9BB 4PUOB 3C94A 4FJGA 4O3NA 3QO9A 4DFJA 2Z1IA 2WRMA 4B8CA 3QERA 2OPPA 4CHPA 3HL8A 1NHUA 4WFYA 1NJYA 3MXMA 4NRUA 3E01B 3AVAA 3KNAA 4Q0BA 4CFCA 4CHZA 2OPSA 1RBRA 5K14B 3OYHA 3AVBA 2HVIA 2ZD1B 1WSGA 4LY7A 5F8MA 4OGEA 5KGWA 1L3VA 4QW9A 2Z1JA 2FVSA 4FK0A 4Y34A 4QWAA 2Y1IA 3OYKA 2HHQA 4CERA 1IKYA 2ILYA 3GILA 3OL9A 4KFBB 3M8PB 4DU3A 4JV0A 3DLBA 4O4RA 5J2QA 4F3TA 5DGBA 1QUVA 3C6UA 4B8AB 4DL7A 1NK9A 2YNIB 3LP3A 3OYGA 3IG1B 2XRIA 2BRLA 4BACA 3LP1A 4DTOA 4C8MA 1IKXB 4ZPDA 5FDLA 5KT2A 2I1RA 1KFDA 3HPOA 3RB0A 4ELTA 4YMEA 2GUIA 3GQCA 2W9CB 3CDEA 1S9EB 5C24A 4W5QA 1VSHA 1D9DA 1T94A 3V9WA 3AVNA 3CFOA 3SI6A 1VSFA 4ZHRA 3GIIA 1DTTB 1RILA 3C6TB 4CJTA 4RUCA 3MR3A 4RW6A 4YNQA 3T19A 2RN2A 2FLNA 1Q9XA 4C8OA 3TI0A 3BSOA 3FQKA 4W5NA 2UVVA 1K1SA 5KG2A 4AILC 1U45A 4EP5A 3DRRA 4KAZA 2EX3A 4DU4A 1LWEB 3M8QA 4ZP6A 2Z1GA 1HNIB 3VQCA 4B9SA 1JL1A 2AX0A 3L2VA 1BI4A 2IM0A 4O3PA 2GIQA 3EZ5A 1SV5A 4CEEA 3ZSQA 5HBMB 3G6XA 2PY5A 3G86A 4NLGA 4OGCA 1T3NA 2DPJA 4BDYA 3OVNA 4NCGA 3RRHA 4B3OA 3TARA 5KFUA 3I0SB 3ITHA 5EDWA 4J9SA 3L8BA 2W9BA 4F2RA 1TVRB 2VG6A 3KHRA 3DLKB 2HHUA 2V4RA 2RPIA 5F9LA 3NGIA 1X9SA 4OL8A 2FC0A 4RU9A 4CF0A 4CJRA 2JEGA 5FROA 4IR1A 1Y97A 4FLUA 3E01A 4JUZA 5DG9A 4YQWA 2RKIB 3CDWA 4MQ3A 3N6MA 2ZD1A 3MFHA 3ZSVA 3NE6A 1N4LA 2JEJA 3LDSA 4IG0B 2FVQA 4HYKA 2J6TA 5KG5A 3BQ2A 4CFBA 3VQDA 1A5WA 3QZ7A 5HROB 2ATLA 3QETA 1Q8IA 4IFYB 2B43A 2UUWA 4CJ3A 1YVUA 3M8PA 3AA3A 2GC8A 1HNVB 4R0EA 2F96A 4CK3A 4B08A 3EY1A 5CYQB 1BQMB 4IR9A 4NLUA 2VWKA 3KHLA 1XR5A 1VSDA 5DLGA 3IG1A 3H59A 4KTQA 1I3AA 3PO5A 1IKXA 4AHVA 2BRKA 3OL7A 1SL0A 1SH0A 4KTZA 2P5GA 4K4WA 2ASJA 1NOZA 3MXIA 3V9ZA 3MEGA 2W9CA 4M3TA 1EKEA 1S1XB 3MF5A 3N6LA 3ZT0A 4EZ9A 3VQ6A 1U47A 2AJQA 3PJWA 5KI6A 3P1GA 1DTTA 2G8FA 3SUPA 3TABA 3C6TA 4DL3A 3TAPA 4FLWA 3PW7A 1J5OB 4TN2A 3SFGA 3KOAA 3DOKB 5F8GA 2IGIA 3AA4A 3HPGA 5KFRA 4J9QA 4RW4B 1XI1A 1BL3A 4Q43A 3QYYA 4CJVA 3LPUA 1KSPA 3M9NB 3GV8B 1YT3A 4CEQA 2YHAA 2WB4A 1L3SA 3QZ8A 1B92A 4E7HA 4KHMA 3ZSOA 4F2SA 4K4XA 2EC0A 3NF8A 4FZYA 1EETB 3AVJA 4W5RA 4Y2CA 1DLOB 2XC9A 4JV1A 2AGQA 3CJ3A 3BGRB 3GIJA 3JYTB 4MK8A 4HUGA 4WFZA 1HMVB 4KB1A 1T8EA 2FJXA 4DS4A 3PZPA 1GOCA 3EPGA 4ID5B 5DMRA 3DRPA 4K4ZA 3BSCA 4I9LA 4FBUA 4ELVA 3IRXB 4PWDB 4AHCA 2ATQA 3PW5A 2ALZA 4O0IA 2QK9A 3L3VA 4E7JA 2OH2A 3UDLA 3RMAA 4OPJA 1TL1B 3CFRA 3IGNA 3HJFA 1RT1B 3CJ4A 1ZBLA 1TVRA 4TY8B 3DLKA 3OHBA 3F9KA 3D28A 3L3UA 2B6AB 4TYAA 4R8UB 4EZ6A 4KB7A 3PVXA 3VN5A 3DMJB 2Y1JA 4DG1B 5HRNA 1S1WA 3PW0A 4F50A 3WNGA 3ZSZA 4IFVB 2OZSA 1NNDA 4OLBA 2BQ3A 2RKIA 5DG8A 1C1CB 3SPZA 1LW2B 4ECXA 4NLOA 4FJIA 4B9VA 4O44B 1QSLA 4C8NA 5HROA 2X6SA 4QOZB 2X78A 1HNVA 3H4BA 3FRZA 5KFEA 1JLEA 5CYQA 1VSIA 3KLHB 3KJVB 3ZT3A 2UVRA 1BQMA 3T1AA 2O4IA 4AHTA 3H5XA 4GMJB 2OYQA 3QINA 4DL6A 2R2TA 2KFNA 1LWFB 1S1VB 3IGVA 4ZVEA 4PQUB 1S1XA 4DTPA 3LWMA 1EP4B 4L8RB 4LSLB 4J9RA 1JXBA 1GX5A 1RDAA 5KG1A 4O3OA 4KI4A 5KT4A 3QEWA 1N6QA 3SZ2A 1VSJA 3CIZA 3RMBA 5F8IA 4CJ5A 4XPEA 1CLQA 1ASVA 2PYJA 1J5OA 2IAJB 1LW0B 1U09A 4JV2A 3PUFA 4F8RA 3EYZA 1C0MA 2D0CA 4K4UA 4CHYA 5JS2A 1EXQA 1T05B 4KHYA 1RT6B 2BGGA 3I8DA 4MKBA 2W8LA 4ECQA 2BE2B 3C95A 1RT5B 3TWHA 5EWEA 5JXSA 4N41A 1QHTA 3CDUA 3H5YA 1JLGB 4DQQA 4M3XA 4M42A 4LH4A 3SYZA 1DLOA 2YNGB 3BGRA 5EUHA 4FS2A 1CZ9A 1HPZB 3JYTA 4KREA 3WNHA 1TAQA 3CVKA 4J2BA 4KI6A 3RBDA 1JXEA 2IM3A 1RAJA 1LWCA 1FKOB 3DI6A 3B6OA 1S48A 3NL0A 3DLEB 4HUEA 5F8JA 2ZKUA 4RZRA 1CXQA 4AHUA 3DDKA 4HKQA 4O55A 3HXMA 4WXOA 4ED7A 2DFEA 1TKZB 4MH8A 5KFGA 1RT7A 3V6KA 3NHGA 1HQUA 1CXUA 4IKFA 4BE1A 1NHVA 4TY8A 3RB4A 4CGIA 1D0EA 2B6AA 3CO9A 4R8UA 3U3YA 4IRCA 3OL6A 5F8HA 3DMJA 4K4TA 4IH6A 3NBPB 1ZBHA 2XI2A 1RDRA 2R2SA 4IFVA 1ITGA 4E3SA 1S4FA 4E7IA 3HVRA 4MK9A 3FSIA 1LW2A 1YTAA 4JS4A 3H40A 1SKRA 5JUMA 3G0ZA 4NLVA 3OS0A 3LPTA 4O44A 1D5AA 1WSIA 4FJMA 4Q44A 3P5JA 3AO1A 3QLHB 3UQSA 3K5OA 5C25A 4CFAA 1HYSB 1KVCA 3DM2B 2FBYA 3A2FA 3KLHA 3KJVA 2W8KA 3V6JA 4E1NA 1LV5A 4PY5A 2VG5B 1TK8A 3SI8A 1T03A 2AU0A 5SWMA 4KBIA 4GC7A 1EP4A 4WXWA 4M3ZA 4BWJA 2KW4A 4FCYA 1YVFA 3RAQA 4DSFA 5KFFA 3QEXA 5KT7A 1UWBB 4FJNA 3LALA 4I2PB 4XPCA 1FKPB 2OPRB 3OLAA 3V4IB 4CEZA 2IAJA 5C42B 1TQLA 3RWUA 1D8YA 3D5MA 3SCXA 3OYLA 2VG7B 1C0UB 4QWBA 3T5KA 4EYHB 5F8NA 2BE2A 4GVMA 1RT5A 5KFYA 2FLLA 1NK6A 1JLBB 4E0DA 2XCAA 3NMAA 4HVJA 3AVMA 3U6FA 5KFBA 1JLGA 3UIQA 3V81A 3ICLA 2QXFA 2YNGA 4KPYA 3DYAB 3MR2A 3OYEA 3OHAA 4CK1A 5DGAA 1WSFA 4BDZA 5I3UA 1HARA 3H4DA 3G10A 1FKOA 3TQ1A 2GV9A 1VRTA 3DLEA 3G6YA 2QE5A 4CJLA 4B9LA 4F4YA 3KLFA 4Z4FA 3NFAA 1NK5A 3JSMB 3QEIA 3V6DA 1TKZA 4IG3A 5CYMB 4BWMA 2WONB 1B9FA 4RNHA 2ZE2B 2P1JA 4TSXA 4NYNA 1TK5A 3PV8A 4RW9A 1QSSA 2RDJA 4EBEA 4IDKA 1HYZA 3NBPA 4NZ0A 4FZXC 1C1AA 3S3NA 2WOMB 1YTUA 2IC3B 4YP3A 1RBUA 4RUAA 3VQ7A 4Q5VA 4EO8A 3K5NA 2DFFA 4EEYA 2DPIA 4NLPA 2WK4A 5J2NA 3CJ2A 1U04A 2D3UA 4CEDA 3RBEA 3L2UA 2LSNA 3P83D 3PX6A 3PHEA 1BIUA 2B4JA 3QLHA 1WN7A 2E4LA 1NK8A 4URQU 2OPQB 3I0RA 1HYSA 1Q9YA 2VWJA 4Q8EA 3OYMA 4DTJA 2IA6A 3H08A 4CJWA 3OJSA 1NK0A 3CG7A 4ZPCA 2VG5A 1LAVA 3VQQA 4CJFA 1NKCA 3KD1E 1NJXA 1C1BB 4BE2A 2V0NA 2FJWA 2FJVA 4FVMA 1HRHA 1ZYQA 3V9UA 1ASUA 3RMDA 4DFMA 3PW4A 2R8GA 3VQAA 5KFPA 2IJFA 1UWBA 4X2BA 4CEFA 4PA1A 1C0TA 4I2QB 3QIPA 3V4IA 3KLIB 4ZVFA 4FM1A 4I9QA 2R8HA 3MEDB 3L2QA 5C42A 2C28A 4FLVA 1UA1A 3RAXA 4MFBB 2ASDA 5JS1A 4IRDA 4PUOA 5KFAA 2VG7A 1C0UA 4O5BA 4M45A 1JL2A 4CCHA 4ICLB 1XHZA 4DLGA 4FJJA 1N5YB 1U48A 4DQSA 1JLBA 1RA6A 4N56A 2FBTA 4Q8FA 3O3FA 4AH9A 1DTQB 5K14A 5I42B 4KRFA 3DYAA 2RF2B 4FW2A 4FLXA 4ED3A 2C2DA 5DQGA 1QAJA 2BANB 2G8VA 4DLEA 3S3OA 4KFBA 4EO6A 1G15A 3VQ5A 4DQRA 2NUBA 3ISNC 1C2PA 3V1RA 1BISA 1R0AB 5KFOA 1WSJA 3VQ8A 3D0PA 1VK0A 2YNIA 3KMSA 1WLJA 1NJWA 4NYFA 1ZETA 1TGOA 3OYDA 3HPHA 4MIAA 1RTIB 1QS4A 1MU2B 3M9MB 4NLYA 2UVWA 4OKJA 1S9EA 4U7CA 3L2WA 3RRGA 2WOMA 2JC0A 4AHRA 2QKBA 1KLMB 5J2PB 3KKRA 3KTQA 1RBTA 2D0BA 4Y1DA 2KTQA 3T5LA 1I6JA 3TVKA 4Z4GA 3QNOA 5KFIA 5DK5A 4KTWA 3KLEB 3BJYA 4KSEB 4FJKA 3GIKA 1RT4B 3LP0B 2V4QA 2IBKA 2OPQA 4IBNA 1WNEA 4M95A 1RT2B 4Y3CA 2B5JB 4ECVA 4ZP8A 4NLSA 4G3IA 4DTXA 3ZT1A 1LWEA 3SV4A 1RTJB 3SUNA 3M8SA 3RR7A 3SQ4A 1HNIA 3DOLB 4CJ4A 2AX1A 4MK7A 1S9GB 1C1BA 4KKOB 1BCMA 3GV7B 4KHQA 4ECZA 1JLQB 1W25A 4B9TA 4E1MA 4Q45A 4ZVHA 1XR6A 1IKVB 3K5LA 4QPXA 1S0NA 2BQUA 3FQLA 5HBMA 3NAEA 3KK1B 3FFIB 4I2QA 3OYIA 4O3SA 5KFXA 3KD5E 4FJLA 1JLCB 1KHVA 3MEDA 5T7BA 1TAUA 1S10A 1VRUB 4DTMA 3I0SA 1S6QB 4MFBA 3QEVA 3CM5A 1U4BA 1LAWA 1HQEB 3I5CA 3B6PA 2XCPA 3OLBA 4CJUA 1XWLA 4ICLA 2XI3A 3RMCA 1N5YA 2R2RA 3KLGB 4ECYA 3QGGA 1TKDA 4EYIB 3PX0A 1DTQA 5I42A 3H5UA 2QKKA 4K8XA 2D41A 1SKWA 2XGPA 5KTQA 4YFUA 3CYMA 2HAIA 1KCFA 4IG0A 1GX6A 3H5SA 1JX4A 5L9XA 3MFIA 3BSAA 4CGHA 3H2LA 2BANA 3PX4A 4WFXA 4CGDA 2QV6A 4ED2A 4IFYA 4K8ZA 5KG6A 5KGXA 3SQ1A 3H98A 4TQRA 2E6LA 2KFZA 3K58A 1VSMA 2D3ZA 4CEOA 2JEFA 3LAMA 3NGZA 3DRSB 1A5VA 2J6SA 4J9MA 1VSKA 3SPYA 4JS5A 2D5RA 2VA3A 3PW2A 4H4MB 3KMQA 4NCBA 4WE1B 3RB6A 1BQNB 4DTUA 4F4KA 1RTIA 1MU2A 3NCIA 1ZBUA 2DTUA 2FBXA 3TAFA 2HHVA 2CKWA 1C6VA 1KLMA 2I5JB 5J2PA 3DLGB 2D7SA 4EBDA 2XY8A 4J2EA 4OLAA 3LANA 3ZSRA 4DL5A 2F8SA 3KHHA 5L1LA 4FW1A 4CK2A 5L1KA 1NKBA 1TK0A 4W5TA 2WCXA 2ITGA 3AO5A 3NH1A 3DOKA 4FJ8A 4NRTA 4IQXA 3LP0A 4RW4A 3WNEA 4JRPA 2AWZA 5EWGA 3OSPA 1UAXA 4H54A 2KQ2A 1RT2A 4N47A 4ED6A 2B5JA 2FVRA 4FXDA 4DSIA 3RB3A 2C2EA 5KFQA 2G8WA 4I7FB 1RTJA 5KFVA 3AA5X 3VA0A 1EETA 2E9RX 4QWCA 1U49A 5FRMA 3AVLA 3DOLA 1J53A 1S9GA 3SQ0A 4ECRA 3V9SA 3QO9B 3U3GA 4M3RA 1HMVA 4CGFA 4CE9A 4DFPA 4ID1A 2XO7A 2OPPB 4ID5A 1IKVA 3HHKA 3PJXA 4F4XA 4HUFA 4QWEA 1GOAA 4RW7B 5CZ2A 3FFIA 3OS2A 3IRXA 4PWDA 3SQ2A 4HTUA 2XHBA 4CEAA 4J2DA 1JLCA 1TL1A 2C2RA 2FVPA 4DMNA 3ZSWA 1RT1A 1VRUA 2HWIA 1KVBA 4FM0A 1HQEA 2CJQA 4FLYA 3NF7A 4B9MA 4M3YA 3QGIA 3MECB 4M94A 3O3HA 5J2QB 2V9WA 3OYCA 3KLGA 2IM1A 4KO0B 4DG1A 2ASLA 2IJNA 3C6UB 1RDBA 1KHWA 2YKMB 1Z26A 4QCLA 3VQBA 3HT3A 1C1CA 4TXSA 3LP1B 4DQPA 4FJXA 3G6VA 4Z4EA 1K6YA 4FJ7A 3CJ5A 4TYBA 2X6NA 4NLDA 4YR3A 4TY9A 1QTMA 1JLFB 2W7PA 3HP6A 4K4SA 2HHXA 3SFUA 3QIDA 1IKWB 2FVCA 3S3MA 3DRSA 1VSLA 1L3TA 4DF8A 4FJ9A 4RW6B 1BGXT 4ELUA 1A5XA 1WAFA 1BQNA 3Q8PB 3ASMA 2YNFB 4E19A 1RCHA 1LWFA 1S1VA 1TP7A 3NAHA 4PQUA 3DRRB 1N48A 4F3OA 3AVHA 4FZZA 4LSLA 2HHWA 1RDCA 3V9XA 2DY4A 3DLGA 3LAKA 4NLXA 3LZIA 2JEIA 3K5MA 3SJJA 2BR0A 1IG9A 3GYNA 5KT5A 4ZP9A 4H4OB 3TR8A 2FBVA 2Z1HA 4ECTA 1BI4B 1TKXB 1LW0A 4KB0A 3UR0A 4N76A 4ZVGA 4KHRA 4XIUA 2KZZA 1J54A 3CFPA 1WSHA 1SV5B 1Z25A 2R7YA 5KFMA 1T05A 3SUQA 1RT6A 3HVWA 3UPFA 4UQGA 5KG0A 3OYAA 4I7FA 1T7PA 3VQPA 2G8UA 1JKHB 1HPZA 2VG6B 3BSNA 4J9PA 4EBCA 1O1WA 3QESA 2A1RA 5DG7A 5HRSA 3PR5B 3NH2A 4RW7A 3NKYA 5HRPA 1SH2A 3TAGA 5F8LA 3MAQA 4CGGA 3AO4A 1RT3B 4MIBA 4C8KA 1S1UB 3OYFA 2HWHA 1S0MA 4Y1CA 1RTHB 1S1TB 2XY6A 3RR8A 2HMIB 3MECA 3NF6A 4CIGA 4KO0A 3LZJA 1QE1B 4Z4HA 1MMLA 3THVA 2YKMA 4WZQA 3ZT4A 3T5HA 4DS5A 4QWDA 1S49A 2AGOA 1QQCA 3ULDA 3KLVA 1S5JA 3M9OB 2Q3SA 3MEGB 2A1SA 4LSNB 3Q8RB 3MXJA 3NGYA 1TKTB 1K1QA 3GIMA 1REVB 1WSEA 4GW6A 4R5PB 3OYJA 1JLFA 3HYFA 3VQ4A 4RG8A 5J1EB 3KIOA 4RW8B 2BDPA 1IKWA 3DM2A 3KK2B 3ZSXA 5KFZA 3EZUA 4Z4CA 4FBTA 3I5AA 2JC1A 4ED8A 4K4YA 4CHOA 1Z4UA 2HNZB 4CFDA 4DWIA 4CF9A 4O4GB 2YNFA 5KG3A 4CJKA 3TAQA 1EX4A 2JLEA 4NLQA 4G1QB 1XC9A 1XR7A 3DLHA 4IRKA 4BDPA 1L5UA 3AO3A 4I2PA 3BQ1A 4FLTA 1FKPA 2OPRA 4H4OA 1XHXA 3AA2A 4CEBA 4CIEA 1TKXA 2HNYB 1RTDB 4CIFA 3CQ8A 3HVAA 3DRPB 4NLWA 3IN5A 4J9OA 2GBZA 1RNHA 4C8LA 1QAIA 3V1QA 5HP1B 2GIRA 4BE0A 5D3GB 2YHBA 3OJUA 1SKSA 1W0HA 2W42A 2FLPA 3ISND 2X74A 3BREA 3AO2A 3S9HA 1JKHA 3LP2B 4WZMA 3BR9A 4JRQA 1J9AA 4HCBA 2O5DA 1CZBA 4ZTJA 3OSNA 4M3UA 2OA8A 5KRTA 2XWYA 4RNNA 1S1WB 2R8IA 3KK3B 3Q8QB 3OYBA 3PY8A 1RBVA 4F4WA 5E41A 4OJRA 3O4QA 4HHTA 2KZMA 3JSMA 1D1UA 4ECSA 3TAEA 5CYMA 1S9FA 1RT3A 4J9NA 2WONA 3V1OA 1S1UA 2HVHA 5C5JA 1RTHA 2ZE2A 1S1TA 4KHWA 3ZT2A 2HMIA 2E6MA 4CJSA 1S97A 4LQ9A 2PYLA 4MKAA 1JLEB 1RA7A 3HSTB 5L1IA 1QE1A 2YKNB 2IOCA 2IC3A 4DU1A 4YR2A 3HO1A 4NYZA 4GC6A 1TV6B 3AVCA 5KFKA 5F9NA 1KVAA 4LSNA 3T5JA 1TKTA 1BCOA 2R2UA 3AV9A 4CHQA 1REVA 4KHUA 3NDKA 4R5PA 2WTFA 5SZTA 5J1EA 4RW8A 1N6QB 3BQ0A 4U6PA 2IDOA 3KK2A 3MTKA 4CF1A 3TANA 3V6HA 2EHGA 4DTRA 5KFCA 3E51A 1BHLA 2HNZA 2E9TA 2O4GA 4Z4IA 4TQSA 5KFSA 2G8HA 4CGJA 4O4GA 1RYSA 2R8JA 1SUQB 3D45A 3WNFA 5EU7A 4RNFA 5KFWA 5KT6A
chains in the Genus database with same CATH superfamily
4LQ3A 1S6PB 3AH6A 5T41A 2XS7A 3OR1A 2KHOA 1VI7A 1JLAB 4TU8A 3KLIA 3ZZ0A 4FWRA 2XMAA 5AQJA 4IOBA 4JYAJ 3ILJA 2V52B 3D67A 4EP4A 3GIRA 2FDNA 1KOOA 4HCCA 3SQGB 1NKEA 2NRHA 2J7UA 2VQEF 1Z6RA 1K73T 3TTDA 3UCZP 4IOAL 1RWVB 3P38A 1IH7A 3VERA 2YWKA 2ZF5O 3P3DA 2QMWA 5CQGA 3AVIA 2F5GA 4WYWA 3CCES 3CW2C 2FF3B 3T41A 3UW1A 2M7SA 1YKWA 1SCJB 1FXXA 3E9LA 4ZLPA 1CEZA 1RWPB 3ZTPA 4OVLA 1HJRA 4FOIA 2YPYA 4Y2IA 1X4BA 4M63A 4LD0A 1SL1A 5KT3A 4USTA 2V8GA 5HLFB 3MM7B 1GOBA 2DY1A 1HR0J 4FWQA 2HNDB 3PYEA 1X5PA 5C25B 2B4VA 2FD2A 4KIAA 4N8OA 1UOCA 1DHMA 2YKNA 2WBMA 5CYJA 2KT5A 1CPZA 2YX1A 3ALYA 4E7LA 4WYLA 3ZCMA 5DDQC 2IPOB 4ED0A 2O8EA 1I5OB 1RT4A 2MTLA 5FRNA 1FT8A 1BU6O 2QLFB 4DSKA 2YQ0A 3NGSA 4PG6A 1X5TA 4J9KA 2E5LJ 4OPKA 2E5JA 4KV8B 2QM1A 4E7KA 2LQ9A 1YZ6A 4GVLA 4LIWA 4DF4A 1VIOA 4JYAF 5F41A 4MT1A 1FRHA 2FJDB 1VYAA 2IM2A 1HBNB 4Y65A 4KE5A 5H9EK 1JIHA 1KTQA 2WZ1A 3EM1A 4KHPJ 4FYDA 2OJ3A 3P39A 1Q95G 2WVEA 1U1PA 3VEXA 4L3QA 1VISA 2V2ZA 3F73A 5MAOA 1RBLA 3BDPA 5C10A 5AQXA 3LUYA 4I64A 3M8RA 3R8EA 2XEXA 4P52A 3VQEA 1M5VC 1T9TA 3CCJN 3N6NA 3QWPA 1YJNN 3NAIA 1RK8A 3TJAA 2IBOA 1RYRA 4M3WA 4W90B 3RSEA 4IG3B 4RU2A 3H45C 1R8PA 3O1WA 1Q82O 1F5CA 3MPUB 3BM7A 3Q8SB 1OMSA 1W7AA 1K47A 4RPFA 5FDLB 1WC5A 2R7XA 1WTFA 3K59A 3MMVA 3SUOA 3J7A1 5J2MA 4JOUA 1HR0F 4ED1A 3PJ9A 2UVUA 1V4TA 4ZHRB 1VQ6N 4K2XA 3SK3A 1U1OA 4OYMA 4E98A 3H7HB 2RIJA 3CMES 2BZ2A 1VQYA 3MCNA 2HRYA 4NA1A 3J7YP 4LF6J 3R1LA 1RJJA 1FESA 2KKHA 1ZAWA 4RBVA 4C11B 1GXUA 4ECWA 3NGTA 2VONA 4DR7F 1IXKA 1RBSA 4OIXA 3PHTA 3L3CA 3QEPA 3NRBA 2V2QA 3R3TA 3GJRB 2HPUA 3M8QB 4CZHA 4O3QA 5DM7Q 2PZSA 4IKAA 1JJHA 1KLNA 4ES2A 3L2RA 4ZPWR 4Y0WA 2E5LF 2V4JA 5LMNF 3O3GA 2F9DA 3VQSA 1VQPS 4NI2B 2FF6A 3HHLC 4F7VA 3US5A 3EO3A 1KOHA 3K8VA 4WF9Q 2BKOA 4ILHA 3PR4A 2GEMA 2CJYB 4JYAK 4WPAA 1X4FA 3HKWA 3CPWR 4KHPF 1NRKA 1SJ3P 3ITHB 4E89A 4PUOB 1SJ4P 3AB4B 5KAKA 2O8CA 3M2VA 3KUGA 4CHPA 1NHUA 2E1AA 5FPEA 2OPSA 1RBRA 1MWZA 2HVIA 2LDIA 4Q7AA 1Y5IB 2CQGA 4G6VB 5KGWA 4QW9A 4LC9B 2DR8A 2ZHOA 4FK0A 1RWKB 3JQKA 2HHQA 5AE3A 1H2VZ 5CCLA 3CMQA 3VGLA 2BEFA 4B17A 2GHPA 4F3TA 1RWMB 4C0HA 3K7RA 3DOMB 3G8SA 4NLCA 1RZMA 2YNIB 3LP3A 4AXJA 3M3ZA 3OYGA 3IG1B 2ACYA 1MROB 4DTOA 1HR0K 2LQBA 1CJKB 1KFDA 1J27A 2HFUA 2A6MA 2MZTA 1NDCA 3VAJA 1KVIA 2WSFC 4LF6F 2Y8WA 1D9DA 3AVNA 3CFOA 1EWQA 3PTWA 1RAEB 2Q2RA 4YOVA 5A6WA 1VQ8S 5ETRA 5HL7L 1HD0A 3C6TB 2HQIA 1P1TA 2QA4N 4PXDA 4RUCA 3MR3A 4RW6A 4YNQA 2YWGA 3M1FA 2HGLA 1NDKA 3WXIA 3TI0A 2AKWB 1K1SA 2CQHA 5KG2A 3GCXP 1U45A 4EP5A 5B0BA 2ZH2A 2W4CA 4OQJA 3KUEA 2E5LK 1LWEB 1GMWA 2HBQB 4LFAF 1CJTB 2VBZA 4GO7X 3I6PA 5AZJA 5AJ3J 2PI5A 2AX0A 1UETA 1BI4A 1Q18A 4KGZB 2ZH8A 2FJEB 4KHPK 1NM2A 4A8SA 3ZSQA 1NGDA 2PY5A 2FY1A 1VBKA 2Q31A 4I4BA 5L39A 4NCGA 1NGIA 1YITN 3SMPA 4B3OA 3ENQA 5IT9O 4CO5A 4P71A 2W9BA 4F2RA 2QYGA 2VG6A 4XH1A 5DO2A 2U2FA 1TMJA 2RPIA 4PYAA 5HSPA 2JEGA 2RHQB 5RUBA 5BR9A 2QGFB 4UZBA 1NGBA 1H7WA 4YQWA 2BXJA 5AQRA 3N6MA 2ZD1A 3PEJA 3BDEA 3MDFA 3CF5L 3MMJA 4DV0J 3BQ2A 3VQDA 3EMTA 5HROB 2ATLA 1B7YB 5A8WA 2DNRA 3AHPA 4WQ5A 5ADXA 3AA3A 3ULHA 2ZGYA 5CHCB 3EY1A 1VDHA 4CLYA 4NLUA 3UDEA 2MJUA 4LF6K 1FRIA 3G82B 4OPHA 3C16A 3BN7A 4K4WA 2ASJA 4ZVOB 3TW0A 4WP9A 2VODA 1S1XB 3MF5A 1U47A 2AJQA 2DPNA 3PJWA 5KI6A 3P1GA 4ISFA 4RJVA 3D2FB 1DTTA 2AHOB 4DL3A 3TAPA 3W5XA 3UWTA 4FKXA 2E2PA 2IA0A 3SFGA 2G0JA 2ZOGA 3VGUA 3AA4A 4MYTA 5KFRA 3C66A 4J9QA 2ZZMA 4G1IA 2MLXA 5AJ3F 3LPUA 3GV8B 4CEQA 2D4WA 1B92A 4CT8A 4X4UA 1PYOB 2EC0A 2QG9B 4W5RA 1OYEA 1QLNA 1TUGB 4OJHA 1MN9A 3BZKA 4BR9A 4BQZA 2VPZB 2KRBA 2FJXA 1WC4A 2AJ2A 3GLJA 4ID5B 3MMAB 1D9AA 3CJAA 4ZPTR 2OD4A 1HNXF 4K4ZA 4I9LA 1SC6A 1EJ7L 4MO4A 4H0PA 4O0IA 1ZXOA 4E7JA 2NNWA 3P31A 3C15B 3PYDA 1TL1B 4HH1A 3L4QA 3X3UA 3QRQA 1ZBLA 4M5IA 2RS8A 3DLKA 3F9KA 3BZQA 4BGAA 3PVXA 3EDRB 2VJUA 2Y1JA 4DG1B 3BUZB 3GTYX 4J90A 3QBCA 4IFVB 3ZSZA 1NLKL 2FQQB 2V2VA 2BQ3A 1W26A 3OBWA 3SPZA 3QFUA 2UP1A 1VBYA 4NLOA 2N3OA 3EDQB 3G8QA 4FJIA 2D74B 2C2NA 3LO3A 2E1PA 4DV7J 5K20B 3TJ8A 3ZTRA 3CJ9A 2RE1A 2B56A 2ITMA 1UZHA 3KJQB 3FRZA 4FPAA 1VHIA 3KLHB 3THYA 2UVRA 1H74A 4P2FA 2VBWA 2DRBA 5HANA 4DV2J 2F3JA 2VFSA 2ROEA 3ZX3A 2AZ1A 2GFFA 1S1VB 1VOMA 1EP4B 4ILMA 4J9RA 1RU1A 1ZM9A 4KI4A 1HNWJ 1FX4A 4JD2A 3OBIA 1VSJA 4OZ2A 1PG5B 2GVDB 1TL5A 5AJ3K 2VD3A 1HKBA 3HZEA 2QRRA 1TFWA 2IAJB 2CADA 4PKHA 4JV2A 2L9NA 3GSDA 5AR0A 1H2UX 1U2FA 1HBUB 3GSIA 3UKUB 2W8LA 2BE2B 3C95A 2D3O1 2QZ8A 3D0GE 3D6FB 3CDUA 4M3XA 4M42A 2FYXA 3SYZA 2JOQA 1DLOA 5HMYA 3BGRA 4LBHA 3M6XA 3QRPA 2GHVC 1J5EJ 2OTLS 2QWRA 4UY8T 1TAQA 2V68A 4J2BA 1URNA 4GKJJ 3D0IE 1FKOB 4YB7A 3BO3A 3NL0A 4RUHA 4ZN1A 4HUEA 2MQPA 2O3DA 4DV0K 4BRCA 2DFEA 3FZFA 1FDBA 2NXJA 1RT7A 3V6KA 3PG9A 3Q86A 3TUPA 1HQUA 1Q4RA 1CXUA 1FKAF 4CGIA 4MDAA 3BBCA 1R31A 4DV7F 2OD6A 5F8HA 2IVNA 4IOAQ 1TTHB 3NBPB 1ZBHA 1RDRA 3EGNA 4CQ1A 5BN9A 2Z2LA 2U1AA 3HVRA 1M5HA 3OD2A 3H40A 3G0ZA 4NLVA 3GCWP 4ZCLA 4DV2F 1U6ZA 4E2FB 2R9LA 2ASPA 4Q44A 2LQ8A 5D4NA 1BXNA 2P9LA 2OGUA 3DGVA 4H5WA 3P5BP 3K5OA 3A3NB 4CFAA 2CPEA 3DM2B 4LF4J 3A2FA 4A2AA 5HJYA 3MM6B 3MCAB 2W8KA 3HRGA 3V6JA 2KG1A 2Z56B 4E1NA 1HNWF 1TK8A 3DRXA 4ED5A 2RQMA 4IYQA 4L6V3 4PKDB 3CC4N 2CQ2A 4GC7A 2D9OA 4M3ZA 4BWJA 2KW4A 2FUG9 1T9UA 5GAEP 5E2QA 5KT7A 1R43A 1M1KT 5AQTA 1UWBB 4FJNA 1GLFO 2XMVA 4HTJA 1QUPA 3OLAA 4GY2B 4BRDA 4NOHA 3RBXA 2I7PA 3PACA 4C4WA 4WP8A 3WIUA 2ZJPL 2IYGA 1D8YA 2HLUA 2WW8A 1J5EF 3T5KA 3CIPA 3H8YA 2P9PB 3CE8A 5F8NA 4GKJF 1NK6A 2YHXA 3AVMA 3U6FA 1P27B 5KFBA 2RU9A 2VWBA 3V81A 3EICA 3J80O 3DYAB 2IY5B 5KOWA 2OANA 2R7WA 3IWLA 2DGUA 4NL5A 1VS3A 1WHWA 2WW4A 4K42A 2ZH9A 5I3UA 2DIVA 4J7CA 5MLCQ 3TQ1A 3G6YA 4CJLA 2QE5A 2Y3YA 3FCVA 4NYPA 3EJMA 3ENBA 2V69A 3DHXA 3V6DA 4DV7K 3M2RB 4JB8B 4BWMA 1ZOTA 1U6BA 2FY8A 2KVQE 2J8SA 4RNHA 2P1JA 4OYWA 2G0CA 1UFLA 4NZ0A 1VQKN 2WOMB 4DV2K 2IC3B 5AXLA 2FTRA 3K5NA 5AQLA 2DFFA 2JWLA 4B1YB 3W66A 4NLPA 2NRRA 3CJ2A 5AT1B 3OV7A 2W6KA 3GU0A 1BIUA 1MW7A 1RKIA 5ETPA 1WN7A 2DH7A 2E4LA 1HNWK 1WOOA 4URQU 2KJVA 3I0RA 3SMSA 5GAGU 4PQAA 3L6QA 3EEQA 3OYMA 2VWJA 3CMAN 1NK0A 4MDBA 3U1NA 2MQOA 1N5VA 3TZZA 1QZ6A 2MZJA 4ZLNA 1LAVA 1NKCA 4CJFA 3KD1E 2CQBA 3BF4A 2F9JA 1NJXA 3TWZA 4BE2A 3LQVA 2V0NA 4LVNP 1F9FA 2NRXA 2OELA 1ZYQA 4JKDA 2Y1LB 4DV1F 3OR1B 1KVKA 2KXNB 5KFPA 4PA1A 1C0TA 4OJ3A 5HMZA 3K89A 1UVIA 4BRPA 1J5EK 2L3MA 3KLIB 4ZVFA 3MEDB 4X4RA 4EI2A 1BWVA 3HSGA 4GKJK 3RUBL 4MFBB 2ASDA 4PPDA 3MM9A 4IRDA 2VG7A 4FP9A 1JL2A 3DCAA 1XHZA 4DQSA 1JLBA 2VH7A 4DU8A 1N88A 1R6VA 1DTQB 4KRFA 2MQNA 1Q5VA 1XEZA 2GZOA 3VENA 3NOCA 4UOCA 4FLXA 4LIRA 5BR8F 3K2YA 3SAFA 4F4AA 3CCEN 2G8VA 4NX9A 1GLLO 4DLEA 7FD1A 1FWLA 2HSTA 4KFBA 4JKFA 2LYVA 2NUUG 3VQ5A 2LVWA 4CZLA 4QR0A 2NR0A 5C7PA 5KFOA 1VK0A 1I3OB 1WLJA 4JI4J 2AYEA 5IM0A 3PRBA 1QS4A 1W7WA 4LF4K 2CZ9A 4NLYA 2CPHA 2ERRA 1JCEA 2QKBA 2JFKA 2CVIA 3KKRA 3OXGA 2BM0A 3VALA 4BC2A 2ZUAA 3FEYB 3VOVA 4I6MA 2DHHA 2HVDA 1SBRA 3T5LA 1I6JA 1NDPA 3QNOA 2VJVA 1BA1A 2J8AA 2ZOFA 3CJQA 4KSEB 4EGLA 4OI6A 1RT4B 1UFWA 3HTVA 4CIOA 1CQNA 5AQMA 2YHYA 3CQXA 1RU2A 1WNEA 4AFFA 5HL7Q 3WXKA 2B5JB 4ECVA 4ZP8A 3TX0A 4J8FA 4YDXA 3NS6A 2M2BA 3SUNA 1T9WA 5CHIA 3SQ4A 2BOPA 1HNIA 1S9GB 2J9CA 2MZ1A 1V3RA 3OTCA 4B9TA 1RQ0A 5JVGQ 1VQ9N 3THXB 2B8QA 2YKAA 4RO0A 1S0NA 2FXUA 3NAEA 3T6BA 4X4OA 2VGNA 4I2QA 1AFIA 4O3SA 2BYCA 1TL7A 3D1QA 4BCAA 4FJLA 3J7AN 3QPIA 3UN5A 1KHVA 4DTMA 2XMJA 1ZC6A 3I0SA 2NCKL 5F2RA 1Q7YO 1BMQB 3OLBA 1GT8A 3ZEUB 4ICLA 3CJ7A 2XMMA 2YTCA 3N28A 3W8PA 2R2RA 1FE4A 2LU1A 5A2QU 3EL2A 3TEGA 5I42A 2D41A 2XGPA 3GPAA 2O8FB 1N34J 2Z30B 3MR7A 2HAIA 1NLVA 4IG0A 3AGKA 3MFIA 2BANA 4JI4F 4DKWA 4QZVB 4P9SA 3FFKB 4TQRA 1GMVA 5M2RA 3PFOA 2E6LA 3FR0A 2RUSA 3GFHA 3JS6A 2MZQA 2JEFA 3LAMA 3DRSB 5ETSA 1S12A 5B7WA 4N8NA 5LJ5Y 2EK1A 1VSKA 3OHRA 2D5RA 3PYGA 1QTNB 3N4WA 4A48A 3VQTA 2GCFA 3CMEN 4F4KA 1WKLA 1RTIA 1MU2A 2CPIA 1SJRA 1CS4A 3GYXB 1ZBUA 4CLLA 2OUGA 2HHVA 5D0RA 1BOTO 2D7SA 4J2EA 3LANA 3QT7A 4DL5A 4CLZA 3S8SA 4B3MJ 2F8SA 4JV5J 5ETLA 3OA9A 1F9HA 2FHOB 3DOKA 2F1FA 4IQXA 2LA6A 1WTBA 3LP0A 2VF3A 3WNEA 3MX2A 2R7QA 1KEKA 1X4EA 4H54A 4JI6J 1RT2A 2RUGA 4N47A 5GAHI 4OJGA 1SZ2A 4FXDA 2G1DA 4DSIA 2C2EA 4PKGA 1VQPN 1U49A 4AYBD 3AVLA 3M6GA 2ZHAA 3RVCA 4V1Ak 4ECRA 4CLKA 1I94J 3V9SA 3RJMB 4F3MA 3HM8A 4M3RA 2O8CB 4DFPA 2XO7A 2PN6A 3C19A 1V3ZA 3MM8B 1ACMB 1RLDA 1C0FA 3RW6A 4BRLA 4U96A 3R5GA 1HWUA 2ZNZA 4F9OA 3OS2A 2MHNA 1OKJA 2EFGA 3CC7S 5FIIA 4HTUA 4FWOA 2XHBA 4J2DA 2C2RA 5GADI 4LF2A 1VRUA 3WXLA 1D3WA 1VQOS 1N34F 4JI8J 2ZFHA 1K8KA 3UD4P 2M9KA 4DI6A 3IR6B 1RWUA 4B9MA 3NF7A 3SBGA 3OVAA 3MECB 1OSCA 1IJFB 2V9WA 2YKPA 3OYCA 2EXUA 2IJNA 1KHWA 4JI4K 2YKMB 4QCLA 3HT3A 3AD9C 4FJXA 1K6YA 3VEYA 3TNVA 2RHKA 4FYXB 4FJ7A 1DFDA 2B8PA 3UNYA 1X4CA 2PD1A 4YR3A 5E33A 3NP5A 2W7PA 2O66A 2CGJA 1IKWB 1JJ2R 1VSLA 1XMQJ 2H5EA 4DF8A 4YOYA 4RW6B 1VQ8N 4B3MF 2RILA 4BGBA 4JV5F 2QL5B 2XNRA 5J1PA 3M4XA 3ASMA 1FI4A 4PG7A 1RCHA 1LWFA 1YJVA 3J7Z5 5BPLA 4CW7B 2RJZA 1N48A 2DB1A 3VTHA 3AVHA 4LSLA 2E1MC 1RDCA 2MEWA 4FPRA 1D4XA 1OQ3A 5TKYA 1IG9A 5KT5A 5AZJB 3LGNA 1S77D 1BI4B 2DIUA 3UR0A 1XQSC 3EUNA 3MM5B 3TPQA 1Z25A 1I94F 1KXPA 6FDRA 3KXDA 2MZSA 3I32A 3QDKA 1NPPA 3IC1A 2I2YA 4DBQA 4OI3A 1FO1A 2Z2YB 2KL8A 3MTJA 4YB5A 2AEJA 3HCXA 3VQPA 2XHWA 1YLXA 1WHYA 4OJ1A 2VG6B 4X66J 5LXRA 2YX4A 2NRVA 1DAXA 5K8PA 4JI8F 3EGZA 3PR5B 3N01A 4RW7A 2ZBCA 1OY6A 3W9JA 1N34K 2A10A 4GV6A 2YH1A 1NPRA 1K8AT 4CGGA 3AO4A 1U2RA 1RT3B 3QJPA 1NZAA 4C1NI 3EVWA 2KVIA 1RTHB 5A8WB 4OZJA 3BZCA 4C8YA 1GLDG 2EFVA 2V5HG 3LZJA 1WORA 2NQPA 2HEKA 3P4IA 3THVA 1R8HA 2Z0GA 2WSEC 2VV5A 2MKCA 1WBBA 3C16B 2ZBIA 1XMQF 5CAAA 1QQCA 3M9OB 2IJRA 3CJ1A 1REVB 3F41A 1JLFA 2HOEA 4B3MK 4UOFA 4JV5K 5KFZA 4DR2F 3BF1A 3KJFB 1Q0NA 2KLAA 4HACB 2VC1A 5I9EB 2H4WB 3TQEA 2OTJS 2EG1A 2XSJB 4JI6K 2W24A 1F5AA 4JNEA 1EX4A 3O3LA 4ZPVR 1X60A 1R6YA 1YTYA 4I1TA 5E84A 2KN4A 4I2PA 1I94K 2OPRA 3C6HA 3KJNB 1XHXA 4HHUA 1X4DA 4JBCA 4A47A 1TKXA 2HNYB 1RTDB 4PL8A 3CQ8A 1ROFA 2VOOA 3ZZRA 4J9OA 4X66F 5D15A 5ADZA 2GIRA 2W2NP 2UUCJ 5EX3A 2BJ7A 2HQGA 3OJUA 1SKSA 3D6TB 2QN6B 1FD2A 2ZJPQ 3AO2A 4JI8K 4ILGB 1RI7A 4JRQA 4NXNJ 3UD5A 3RBZA 5B09A 4ZTJA 4FOEA 4ER8A 2R7TA 2OA8A 1EB0A 3CJCA 2HIQA 3UCGA 3Q8QB 3OYBA 1HLWA 3O4QA 5E7OB 4HHTA 1Q86O 4D3GA 5IQQA 4ECSA 2HVEA 2CWKA 2HZCA 5GIPA 2J7KA 2HVHA 5C5JA 2DNYA 3WT0A 1BHNA 3BGUA 2ZE2A 1XC3A 1R3NA 2HMIA 1S97A 1HFEL 2PYLA 4MKAA 2A6OA 1H6KX 3UFCX 1XMQK 3THYB 1VQ4S 3PEHA 4BREA 2KO1A 3FMWA 1LOTB 5AQIA 3HO1A 3SCLE 2ZH5A 4WK3A 4NYZA 2MKSA 4GC6A 2KDOA 2NLXA 1TV6B 5KFKA 3B78A 2E5IA 1JK9B 2VPWB 3A3PB 2E7XA 1X3MA 2BKNA 3D3BJ 1BCOA 2FPHX 2J9DA 2J7WA 3AV9A 4CHQA 1EARA 2KH9A 4RW8A 3BQ0A 5ADXH 2PIIA 2DR5A 5C15A 2DNLA 2M70A 2P9KB 3WZ0A 4BC5A 5IV3A 4DTRA 1O6XA 4WYBA 1ZBSA 2HNZA 4M5NA 1UVNA 5ETNA 4XDCA 1SUQB 5LJVA 3WNFA 1IQZA 3ZTOA 3R9PA 4PKIA 2X7IA 5T14A 3SV3A 4G1QA 2VUGA 3LWLA 4OV1A 2FHJD 4G65A 2AQ4A 4LRFA 1HA1A 1RISA 4NZ7A 3HM9A 4FLZA 2A6AA 1PAUB 1SVDA 2VQFJ 2UUCF 3MEEB 2VFRA 1NO8A 4X66K 1WKKA 4IEIA 2W9AA 4FN5A 2O8BA 2CVEA 4DV4J 2DK2A 2CNNB 1CLFA 3HHEA 3TAMB 3JSRA 4TLRA 3I56S 2D0AA 4NXNF 2OTLN 5CY4A 3G6ES 2DNZA 4YOEA 4CBWA 5D3GA 1QSYA 2B4PA 3ONQA 4R0JA 3AGRA 2G8KA 1RT7B 3HHDA 1HQUB 2OEKA 2NREA 5K8MA 4Z37A 1PJ6A 2B9XA 5DM6L 1MSWD 5EWFA 2ZGZA 3I5BA 3A5NC 3KK3A 3VWSA 1FK9B 1X5SA 3FK4A 4RX6A 4ZCIA 1SL2A 5KFJA 4JK7A 3IS9B 1U1QA 1GMUA 1B0TA 4O8UA 2GUPA 3QIOA 2YNHB 2WHOA 4U67L 2CQIA 4M41A 3Q2TC 3FRYA 4O0JA 4HDGA 2VA2A 4K5SA 2ZJQL 3ZFVA 2VPYB 4Y0FA 2Q0UA 2DFHA 2C2MB 1ZTWA 3S01A 1ZM2A 5A6PA 3LM2A 2PBDA 4FWPA 5DLFA 4OKKA 1AXQA 3KLEA 2CNKB 3NXZA 7FDRA 4K4VA 3KKSA 1WHXA 1P1LA 3EXYA 3JTNA 1HX1A 1RAGB 2YKQA 3GFZA 1TL3B 1S5ZA 3PO4A 3DKDA 3CCWA 2ILZA 2C3YA 3GG1A 2CQCA 2BKPA 3BR8A 2ALYB 3QGPA 4DUTA 4DV4F 4E1JA 2UUCK 1S6PA 3VQ9A 3AA8A 1IO2A 3LL3A 3GJSB 4DR4J 3V81B 2OZMA 1JLAA 3TZYA 3MD1A 3HSCA 4NXNK 4CJPA 1KAXA 4LH5A 5BPMA 3M32B 4QPTA 1N56A 2B7BB 2NSCA 4KAIA 1S6QA 5I3UB 2HBJA 4M7YA 1FFWB 1RWWB 3GB0A 1V5IB 3SQGA 4L76A 4RNMA 1VSEA 3IBWA 3RZAA 4WJBA 3Q83A 2P8IA 2HGMA 3MCOA 2XGQA 3AODA 1FTCA 1FRKA 4DHYA 3V6DB 2DITA 3K57A 1JQGA 1UW9A 3EGWB 3DGPB 5KFDA 2HRUA 3QRRA 3OTDA 1C0GA 5KPZA 2EPIA 1WAJA 1NXIA 3C6AA 2YV0X 1IM4A 4YB6A 1K44A 3K2PA 4CVNE 4CLPA 3Q2SC 2GJIA 3HP9A 2QLJB 2XSFA 1Y7PA 2VFVA 2XTJP 3J80Y 4F04B 4HHHA 3NH0A 2O67A 5IC4B 2ZH4A 3AD7C 5HLFA 4RTFD 3MM7A 3CJ0A 3JXUA 3CJKB 4AL7A 2KM8C 4AT1B 4ZMMA 2HNDA 3CWJA 3I0RB 4QS9A 1OS5A 1L3KA 2XS2A 2X51A 3MPDA 4ZJOA 4NPOA 3PSFA 4DQIA 3NF9A 1WC1A 1FNMA 1RB0A 2FJBB 2BJ9A 4ZCMA 4JI7F 4DL4A 4C23A 2HGNA 2EG2A 3PRVA 2VQFK 1C0TB 1KAYA 5AQYA 2XLJA 4DV4K 3QFPA 4KV8A 2NUHA 3J7AP 3DU5A 4DR4F 3ZNUA 2Z57B 1UZDA 4EWTA 3WIVA 3MM9B 1KQFB 2QJ3A 2Z1IA 2JJ4D 2GQQA 3HL8A 4A61A 1NJYA 1HBNA 5IQ6A 3MXMA 3JAMU 3E01B 3AVAA 1GEHA 2RD5C 3OYHA 2L08A 5FJ4A 4OHWA 3UVJB 5DS7A 1V6HA 4L75A 1L3VA 4L3KA 2Z1JA 3LDNA 3VVUA 3QSIA 3DXMB 4QWAA 2NZTA 9RUBA 2V34A 4KFBB 4M5GA 1AT1B 4L3NA 3M8PB 4DU3A 2KYXA 4O4RA 1T9XA 4IJNA 4IEEA 5J2QA 1TU0B 3LTOA 1QUVA 3W0LA 4B8AB 3OTOJ 1NK9A 1EKSA 2XRIA 1FW6A 5FDLA 5KT2A 1U2VB 1N32J 3HPOA 2G13A 1VSHA 3V9WA 2VIHA 1S72S 4ZHRA 4PL7A 3HD1A 1UEUA 2VKRA 1RILA 4CJTA 3U27A 4WFAL 2RQKA 1CVJA 1ZPVA 4H0TB 3T19A 4I69A 2FLNA 3W64A 1KD1T 2CRLA 4AM7A 1WC6A 1NPKA 4C11A 4C8OA 2YHWA 5BREA 4W5NA 2UVVA 4M5HA 1K0VA 5CCMA 4KAZA 2EX3A 5JVHL 3PYFA 2DT9A 1LFPA 1FF2A 3M8QA 2Z1GA 5ETOA 4JEPA 1VK8A 1HNIB 4XK8C 3VQCA 4B9SA 2LQJA 2YWHA 4FPIA 4O3PA 5L9NA 4DR3F 3EZ5A 1SV5A 4DR4K 3NLCA 1HJOA 4NZ6A 4NI2A 1IBLJ 3G86A 2V67A 1T3NA 1S3XA 3D6RA 4DHVA 3OVNA 5KFUA 3I0SB 3ITHA 4AUKA 1VBXA 3B8AX 4JP8A 1P9YA 4IO9Q 5CXTA 4MO5A 2E7WA 5F9LA 1X9SA 3NGIA 4OL8A 1DT9A 4XH4A 3U8XA 4IR1A 3NVMA 1Q7YT 2PA8D 4QR1A 2D69A 4FYVB 5DG9A 2RKIB 3CDWA 3VGKA 3ZSVA 2XM3A 4U8VA 2HHHJ 4LRCA 4IG0B 4CFBA 3OTOF 1WKJA 4OX8A 3EE9A 3QETA 5JJBA 1Q8IA 1KDNA 2KXHA 2PC6A 4B1ZA 3IO1A 4ITSA 2H5JB 1N32F 4CJ3A 3AB2B 1PYSB 2GC8A 1HNVB 4R0EA 4NASA 4CK3A 2NZCA 2YCHA 2DCLA 4ZS6A 1YF5L 1XR5A 1VSDA 4CZFA 3IG1A 3G4SS 1BWEA 1I3AA 3PO5A 1FRLA 3BPDA 2BRKA 1FX2A 5EX5A 4YOTA 3KDOA 1ICEB 1AROP 2ZOMA 4KTZA 3OTBA 5C0YA 1WI6A 4FF3A 1EKEA 5DRKA 2C3PA 3N6LA 4EZ9A 3TJ9A 2FGCA 4LSZB 3TABA 3C6TA 2YWFA 4FLWA 4TN2A 3DOKB 4QR2A 2DNPA 4USVA 2DVIA 3QMLA 3OFEA 1RBOB 1BL3A 2I8EA 3AAWB 2JL9A 2GMJA 1HLUA 3DC2A 2WB4A 4IO1A 4PAAA 5HMWA 3QZ8A 4E7HA 1IBCB 4K5RA 1IBLF 3UE2A 3FLCO 3C46A 4JV1A 2EKNA 2XC9A 1CJTA 2CJXB 4KC5A 4HUGA 3EE8A 3I87A 4WFZA 4ALZA 2E1ZA 2KI2A 3NS7B 5DMRA 2W2QP 5BRFA 1ZA2B 3BSCA 4FZVA 4CDIA 2KT2A 2CWXA 3HMJG 1BO5O 2ATQA 2ALZA 4OPJA 2UXBJ 3CFRA 2YWWA 3IA0A 3IGNA 4PXBA 3VPZA 1SQEA 1U25A 2HHHF 3CC7N 5JICA 2HRTA 4PRFA 1O13A 3D28A 5ETQA 2JVOA 3VN5A 1VQON 5SUHA 5HRNA 2MKJA 2QTWA 3OTOK 2FSNA 3TU5A 1MWYA 3CCVS 3G25A 5DG8A 1LW2B 3U9DA 3O8WA 2OFHX 4B9VA 1N32K 1FRJA 2NSBA 2ZC3A 1QSLA 1REGX 5HROA 2A42A 4QS7A 2COLA 1A7GE 2R7OA 3IRWP 4KBOA 3H4BA 5KFEA 1N36J 1VSIA 3KJVB 3T1AA 3CULA 2O4IA 3H5XA 4JAXA 4GMJB 1FJGJ 4H5NA 1PC5A 2R2TA 1KC8O 2W25A 5H9FJ 1PSDA 1LWFB 4C98A 4WFNL 3O9UA 2ZITA 3IGVA 3E1YA 1S1XA 3AAPA 4LSLB 2IMOA 1JXBA 5KT4A 3QEWA 1PYTA 3FZLA 2H4YB 1EHWA 3VAGA 4CJ5A 1CLQA 2PYJA 2CJKA 4OFZA 1GTHA 3JAMY 1OPIA 3O9RA 1U09A 1RHKB 3PUFA 2QX0A 4F8RA 1C0MA 4K4UA 3ZC4A 5JS2A 1EXQA 1IBLK 3I8DA 4FWKA 4MKBA 4ECQA 3UD3P 5GAGP 1RT5B 5D78A 5EWEA 4RL1A 2DXFA 3MN5A 1P9QC 1JLGB 2EWHA 2VDIA 4LH4A 3OFGA 2XMTA 5EY4A 5EVZA 3VGTA 4FS2A 3AOCA 3DXSX 3WNHA 4F0HA 2APOA 3HSJA 2A2CA 1E4GT 4GRSA 3MMAA 4A8WA 1LWCA 3DI6A 1Y10A 3DLEB 1SC4B 2ZKUA 3VEVA 2HHHK 3IMXA 5C2FA 2VZ9A 4ED7A 2Z8QA 1TKZB 1MMDA 1XMBA 4G9ZA 2CUYA 1Z2ZA 5KFGA 3O9QA 1SI9A 4EFHA 3U1MA 2M4MA 3RB4A 2ZC4A 2Z2ZA 1K9MT 4YEAA 3H42A 3U3YA 4K4TA 2WBRA 2XI2A 3T7ZA 3QFHA 4IFVA 2ZWOA 1ITGA 4E3SA 1R59O 3A0IX 1N36F 4MK9A 4X4PA 4JI5F 1SKRA 2YKOA 1JB0C 2P6SA 1NSQA 3P8BB 4FWLA 4K43A 2GAHC 3IAS9 3W3SA 2R7VA 1FJGF 1ZZNA 2VHGA 1HYSB 1KVCA 1RAHB 3KLHA 2EBEA 3K9JA 3MAHA 5IV4A 3QB0A 1W97L 2F7VA 1YRUA 2GIFA 5HATA 1QVFM 3Q23A 2DGVA 1H38A 1ZZFA 4A8OA 3FZ2A 4MTPA 4BQLA 4LREA 4A8KA 5HK4A 1EP4A 4WXWA 2OTJN 5L8RC 4DSFA 3RAQA 3QEXA 1E6YB 3KG0A 4CNYA 3H1VX 3LALA 4I2PB 2F4VJ 2GVDA 2OPRB 4CEZA 1QVGR 2OIHA 1O8BA 3ZZUA 4F36A 2IAJA 5C42B 3QJLA 2DNKA 3RAMA 2IDLA 4I0WA 1RSCA 1HBUA 3SCXA 3OYLA 4QWBA 5JLHA 4DQ8A 4EYHB 2BE2A 4RLEA 3T9ZA 2UXBK 4PHTX 2D3OR 5E26A 1OVYA 4CZJA 1DQ8A 3UIQA 1NB2A 4K59A 3CCMS 3LH2S 3OYEA 1NBEB 1YJWS 4EUVA 1U8SA 4QIEA 1SJQA 1WSFA 1HBOB 3G10A 1FKOA 1VRTA 3W3DA 1UJ5A 4PWWA 4Z4FA 1Z05A 4NMLA 1YZ7A 1WG1A 2DBBA 2BX6A 4LRBA 1Q86T 2ZE2B 1PCAA 3QBWA 1A6LA 4NYNA 4WQ4A 4RW9A 4CO4A 1N36K 2FC8A 1XK8A 2RDJA 3NBPA 4FZXC 3S3NA 1RBUA 1WUAA 4RUAA 4Q5VA 3VQ7A 3CJBA 3E8OA 1FJGK 2VBXA 3O44A 2DPIA 4LF7J 1VQ4N 5H9FK 2QFIA 1U04A 3P49B 2C2ZB 5BXIA 2D3UA 5F3ZA 3H20A 5CA5A 2EFQA 4B3RF 3L9ZA 2BTFA 2B4JA 1WHVA 1K0TA 2OPQB 1LNQA 2LKZA 2QWLA 4UOHA 1T6CA 3MM6A 1GLBG 3CB4A 3CG7A 3S6EA 4ZPCA 1G4CA 4OX9J 3MN9A 1YBUA 1X4AA 1FFGB 1C1BB 2FJVA 4UY85 5M1KA 4WCEQ 2AT1B 3VEZA 4FYWB 4MLHA 1ASUA 3RMDA 1NZ8A 3PW4A 1PAEX 2IJFA 1SC1B 1UWBA 4WFBL 1AYEA 4I9QA 2R8HA 1XIQA 2YPZA 2HBMA 4FLVA 2ASYA 1UVJA 5JS1A 5KFAA 1Q16B 1NB7A 1QAYA 2P9PA 2C2OB 5D77A 5AQHA 1N5YB 3BBBA 3CDAA 3I56N 3O2IA 3VCDA 3CIMA 2CJBA 3O3FA 2KFYA 3G6EN 5K14A 3PIPL 5LMUJ 4OMFG 3DYAA 2K7KA 3MN6A 4FW2A 2UZAA 2WVFA 1NUEA 2C2DA 1SPBP 1QAJA 4PG8A 4R25A 4Y28C 1CC8A 3V2UC 1WACA 3BS9A 2QA1A 4ZVSB 4EO6A 1G15A 3DDIA 2NUBA 2BUNA 5EHHA 3V1RA 1BISA 1RBAA 3M2RA 4IFEA 3D0PA 2ZJRL 3KMSA 4LF7F 1ZETA 3QWUA 4OI0A 1XERA 1RFQA 4ETZA 4OZNA 3GFYA 3M9MB 2XO6A 1N8RO 3MCSA 2MKIA 4NLBA 1UVMA 1IN0A 2WOMA 2JC0A 4AHRA 2DD8S 1F60B 1U0HA 2HWTA 4Y1DA 2KTQA 4Z4GA 1NAQA 3R5CA 3KLEB 4OX9F 3BJYA 2EI5A 3GIKA 3CJTA 4DB3A 1ZM4A 1R8BA 2J9DE 4M95A 4Y3CA 2F4VK 4GNIA 5LY3A 2E66A 4G3IA 1SAZA 4DTXA 4FF1A 3SV4A 3VF4A 3B8HA 2NYHA 4LR9A 4XDDA 1R0CB 2C3OA 4ECZA 1W25A 3RU0A 1NSKL 1XUPO 4I56A 4WBFA 2XQCA 1IKVB 2IYIA 2VKZG 4QYRA 3FZBA 3OYIA 2XMWA 3MEDA 1NGFA 1S10A 5LMUF 1S6QB 4MFBA 2G2YA 1FDDA 1HQEB 1A0OB 2E88A 1U1NA 1JXVA 3ID6A 4CJUA 3OW2R 1M90O 4OYBA 3RMCA 4PXEA 1MMNA 3KLGB 2LLZA 4ECYA 3AJ2A 4EYIB 2L9WA 3F44A 1DTQA 2DGWA 4L72B 2POKA 1WELA 1Y64A 2F40A 1YUWA 1JX4A 4DV6J 5CZVA 3H2LA 4WFXA 3NWGA 4CGDA 1YXQA 3TRGA 5AZIB 3T1HJ 3WQUA 3H98A 3GOIA 2HBYB 4LF7K 4AF1A 4BLGA 1VSMA 5AE2A 2D3ZA 1NGJA 3N5FA 4CEOA 3DXBA 1A5VA 4CZGA 3CD7A 2W01A 4BRNA 2XHCA 2VA3A 3PW2A 3TVYA 4Q2MA 1BQNB 3JTPA 4DTUA 2XLIA 3B54A 3O1LA 1X9JA 5C2DA 3NCIA 2ABYA 2DTUA 1C6VA 1QY7A 1RAAB 3ZSRA 4OX9K 4WU3A 2Q36A 2CQ0A 4DN0A 4FW1A 3CJRA 3K9KA 1TK0A 2CQ3A 3I4PA 3R7NB 1WF1A 4CM0A 1X31C 2DNGA 5F0XA 3R6LB 4RW4A 4ATNA 1UCNA 2B5JA 2IVPA 5KFQA 4I7FB 3LF0A 4W98A 3J7YI 5KOXA 4CRJA 3NNAA 1S9GA 1VQ9S 2VFUA 4CZEA 1WG5A 3U3GA 2GQCA 2IRYA 4Y00A 2G1HA 1HMVA 5AQOA 1K73O 2LEPA 2W2PP 4WKRA 3THXA 3HHKA 3PJXA 2QTDA 4F4XA 5LMUK 4HTLA 2V8DA 4QWEA 4HUFA 3WC0A 2X1BA 3IRXA 3SQ2A 4H0XB 2F9TA 1KQSM 1WSRA 2QSFA 5EN1A 1IWGA 5THWA 4PXCA 2P6TA 4BBYA 3W9IA 1ZH5A 2CJQA 2DGQA 4MKVA 3D0HE 3ZEUA 2OMLA 5HQMA 4DV6F 4P73A 3MWTA 5DDRC 4M94A 4BVPA 3O3HA 5J2QB 2Y8YA 3T1HF 1UJ4A 3ENHA 1FWKA 3BB5A 4CO0A 1DQAA 3D1OA 1C1CA 2O8FA 4DQPA 3CXCM 3R2DJ 3BPSP 3CJ5A 1IM6A 4TYBA 2FZGB 2J76E 2X6NA 1RWNB 4NLDA 1QTMA 2CPXA 3TA1A 4K4SA 2HHXA 3QIDA 2QC3A 5B0AA 2AJ0A 5AE1A 4HWIA 2OAUA 3M7VA 3DRSA 1SIZA 4UZCA 1FDNA 2M5YA 1S72N 4FJ9A 1BGXT 3ZNJ1 4ELUA 1AUSL 4DXLA 2F7TA 2E2OA 3Q8PB 2YNFB 2M8DB 1ITPA 1VJWA 3EVOA 3N4QA 1PBAA 1W2BR 1TP7A 2E5GA 4FZZA 4HL9A 2DY4A 4X4NA 3LAKA 4NLXA 1RAOA 2MXYA 3K5MA 1OJ4A 4ZJLA 2VL1A 4ECTA 3BH7B 1WEXA 1LW0A 4ERDA 4N76A 3TP2A 4HI1A 4KHRA 3TR5A 3CFPA 2YQ1A 1SV5B 2R7YA 4OV6A 1ZAVA 1T05A 3SUQA 4NA3A 4DCHA 2CZVC 4UQGA 5KG0A 4USUA 2DNOA 3SEOA 1FERA 3ZTSA 4C1NK 2WFBA 1HPZA 4J9PA 4EBCA 3OVBA 1V9OA 1M0SA 3UKRB 2ATCB 3MM8A 4DX5A 1OH7A 2DHSA 3A3OB 4AXIA 3OXLA 2CXEA 1S0VA 5HRPA 2I0XA 4LF9J 2RRBA 4DV6K 4MIBA 4C8KA 1S1UB 5E3PA 3T1HK 1M5PC 3OFFA 2V51B 2CPFA 2ZUGA 1H3DA 1XNRJ 4PG5A 3PDNA 1S1TB 1T0TV 8AT1B 2KXFA 3I55S 3MECA 1LFWA 3QT8A 2VU5A 2CGKA 1QE1B 3HJVA 1FCAA 2ZVSA 2ROPA 2YKMA 3FC9A 5T7LB 2PMWA 2A1SA 5FLXU 3G4SN 3MXJA 3NGYA 3H0PA 1RUSA 2AYBA 2QWNA 2DO0A 3HYFA 5M1NA 5J1EB 2BDPA 2ZNYA 1IKWA 2EFOA 3PSIA 5IWAJ 1KNZA 2JC1A 4HT7A 2LECA 4CHOA 3LDLA 1BLUA 2UV8A 4BVOA 1NH8A 2BJDA 1YI2S 4CFDA 2CPDA 4KT0C 1ESVA 5KG3A 2CQ4A 1CBKA 4PCQA 2AF6A 1XC9A 1XR7A 5LM7E 4IRKA 3M1VB 4DV3J 3AO3A 1T6DA 1DARA 1BG3A 2Q6CA 3AA2A 2LA4A 2CJ9A 1GTEA 4C6AA 2DKOB 3MM5A 2ZH7A 4XH5A 3OVSA 4AL5A 4V19J 3H2VE 3O5BA 4C8LA 4IQMA 3EVMA 5HP1B 2YWEA 2BABA 4KGXB 5C2CA 1NMNA 4LF5J 4X4TA 2W42A 2FLPA 3ISND 2X74A 1NGCA 2E5HA 4M7XA 3LP2B 1YVNA 4WZMA 1J9AA 3M5RA 4ZDNA 4M3UA 2LCWA 4DPUA 3CTRA 2XWYA 3MUMP 4C8ZA 2I38A 3DN9A 2UV8G 1XNRF 3DLJA 5A0YB 2CPJA 4PYDA 5E41A 2AYMA 1S7HA 3JSMA 1D1UA 5CYMA 2XMKA 1S9FA 1UVLA 1RT3A 1TFYA 3JSYA 3CCVN 3ENOA 1O0PA 2FHKA 1RTHA 3J8AA 2B3TB 3ZT2A 2HQCA 2UYTA 1TZ0A 3W7BA 1OWXA 1FNOA 4N7TA 5IWAF 3IM8A 4U8YA 2E29A 4X84A 1TMMA 2K2PA 3CD6S 1REVA 1SJFA 3NDKA 2WTFA 4JKAA 3WDOA 4U6PA 3MTKA 4YS2A 4CF1A 2DH8A 2EHGA 5KFCA 3E51A 3PIOL 4OYPA 1BHLA 4HACA 4DV3F 1VLYA 2O4GA 4OX7A 4CGJA 3AOAA 1R7IA 3C7NB 3CQYA 2XSJA 3NS5A 3OT9A 3KUHA 2PA3A 4JK8A 3SXLA 2HHSA 3MWBA 1TELA 2DCUB 2RDIA 2ETJA 1U0SA 4ILLA 2A3ZA 1WEYA 4Y2AA 4LF5F 1LWXA 1X7VA 3OTEA 1RTDA 2HNYA 3ZSYA 3HVTB 1H73A 5C2GA 4DZ6A 4B9NA 1LWCB 3DI6B 5KG7A 2P5OA 4LF9K 5ETVA 4NMXA 4YR0A 2F9WA 5KG4A 3VAFA 4CO1A 2DHXA 3VAKA 2DISA 1HYVA 4ZVQB 2IDEA 5KFLA 3MI7X 2RF2A 1XNRK 2E9ZA 4DV0F 1JXLA 1GFWB 2NXNA 3ZZYA 3Q7CA 2R8KA 1IBMJ 4DTNA 4UUXA 1KFSA 4DX6A 4DSJA 4FJHA 4F4ZA 4KHNA 2F63A 4I6AA 3CC2S 3VA3A 1F21A 3DLLL 1Q81T 1WF2A 3AVFA 2R42A 4NCAA 4OHVA 2HF4A 2ZH1A 2W7OA 4GKKJ 1HPMA 2CDQA 1VCTA 2LQ5A 1NOYA 3CGIA 3M6UA 4ID8A 4NLTA 3D6HB 4K41A 5IT0A 2WVCA 5IWAK 2ASOA 4FM2A 5AQKA 1GLCG 3AJDA 3MUVP 1PJ5A 4KJIA 2P51A 1P8GA 3MEKA 3GG4A 1KS2A 3R5BA 2G8IA 2ZJRQ 4DR1J 3HSDA 1SH3A 3SLCA 4WF9L 4JLHA 5HVFA 4PG4A 2KYZA 3TA2A 1FFSB 1TV6A 1S4EA 3KG4A 1AW0A 2ASMA 4CESA 5AXKA 3GV5B 2QT7A 2HB5A 4J2AA 3OL8A 2C3UA 4DV3K 2HKEA 3ZETB 5B0FA 3K0JA 3PCOB 2P9KA 3O8MA 4QJVA 2BUPA 3ZX0A 1LKZA 3FDSA 2F8TA 4P10A 3SQOP 3C2PA 3DNCA 1WNSA 2GJFA 1SUQA 3K5PA 4AHSA 1WOSA 2Q3PA 3AT1B 3FVYA 1KQKA 1HUXA 1GK8A 4RBTA 4DV5J 4LF5K 5AQZA 2X1AA 4Q0BB 2HHTA 4FF4A 3SNNA 3QGHA 3KK1A 1M5SA 3AXKA 1RXOB 1RHJB 1TUWA 3QNNA 3MEEA 3MAAB 3WX8A 2AGPA 2AEFA 1RABB 1TR0A 1OY9A 4FJ5A 4JI3J 3CCMN 3TAMA 4XO0A 4ZCKA 1IKYB 2DNQA 1QAXA 3MR6A 3I8BA 2N7YA 2HFVA 1VRTB 2HS0A 3FEXB 5GAEI 1YJWN 3AFGA 2YBVA 2HZVA 1IBMF 4ECUA 3MURP 2ZZTA 4FS1A 2ZBQA 1BIZA 4W5OA 4PWUA 5KFHA 4CJQA 4QAGA 2BH1A 5F3TA 1URRA 5KRSA 2L41A 2QLXA 1ZBFA 4RW9B 4ZP7A 4GKKF 2E1CA 2F8EX 2JLFA 5C24B 1FK9A 5HRRA 4F25A 2DGSA 1RHUB 5ETKA 5BRDA 1BWFO 1TUVA 2VGMA 1NK4A 3IS9A 4TKTA 4NYOA 1VR6A 4HEA9 3D68A 4PR6A 2IVYA 2YNHA 4H4MA 1Y5NB 3BH6B 4WE1A 3GE9A 4F02A 2HW3A 2GW8A 2OLWA 2LEBA 2HFOA 1KBRA 4IH5A 1PC4A 5E5NA 2XY5A 3R97A 5GINA 2I5JA 1OIAA 1L3UA 2RSQA 3KKFA 4OYOA 3OS1A 1VK3A 3TUJC 2MLYA 3TUZC 4DJBA 3WHIA 2W6LA 1HI0P 5IS2A 4J91A 2HQDA 1QQOA 4DEZA 3A5OC 3D7EO 4NLRA 4DSLA 1X9MA 4A46A 4DV5F 3TUIC 1U1LA 1TL3A 1N52B 3RGIA 4EHUA 5JLFA 4UY8O 3W2WB 1GXTA 5HAOA 1VQLS 5B0GA 1YQHA 3QO9A 1NBWA 4JI3F 1WC3A 1VC5A 4WFYA 1LK7A 1Y9OA 4KGMA 2LP4A 4NRUA 4CFCA 3M05A 5K14B 3AVBA 3DAWA 2Q79A 1WC0A 1QJHA 3TSPA 3QMQA 3PKMA 2QYCA 3N0VA 3M32A 4OGEA 2V63A 2FVSA 2EBGA 3CPWM 1YSJA 4JKHA 1RWOB 4Y34A 1IBMK 1B3TA 4I67A 4CERA 2GX9A 2KJWA 3OL9A 2I6WA 1J6ZA 3P45B 2NLWA 3DLBA 4USKA 2QIFA 3CCUS 2GO9A 5DGBA 3RG6A 4C48A 3VEWA 3C6UA 3DGPA 2Y1RI 4DL7A 4GKKK 3CCLS 1HWJA 2BRLA 3LP1A 4BACA 1IKXB 4TU7A 3JSBA 4H4KA 4ED4A 5IXUA 4H5VA 4ELTA 4YMEA 1VRQC 2W9CB 3CDEA 5HI7A 4K2JA 1VC6A 5IC6B 2VASA 2NS1B 2MSSA 4DR1K 1VSFA 3Q24A 5FD1A 1U0HB 4RWWA 3GIIA 1ELOA 4LF4F 3M8WA 3ID8A 1YRXA 1Q53A 4IDHA 1DEJA 1OY8A 1YBTA 2RN2A 1X0PA 4CI0B 3HOSA 3VESA 3CJKA 1Y11A 5LT5A 3FQKA 4FNHA 5M1PA 1M1KO 3SBTA 3O08A 4ZP6A 4M5MA 4ES1A 1ATSA 3VAMA 1JL1A 1X8DA 3L2VA 4LFCJ 1VLOA 4DV5K 5CH7B 1EZZB 2GIQA 4ENOA 4KH4A 1HNZJ 4FWMA 2OFGX 4OGCA 4BDYA 3BBFA 1X3NA 4NXMJ 4JI3K 2KHCA 2WVBA 3NOGA 3KWIA 3RRHA 3TARA 2QMUB 3CT9A 4O23A 4FXWA 5EDWA 4J9SA 1TVRB 5GVQA 2E1RA 3KHRA 4ILRA 2HHUA 2VQEJ 4KH0B 2FC0A 2O1PA 4CF0A 3NNCA 5FROA 4C7QA 1NGGA 3BP8A 4FLUA 3E01A 1M90T 2C2KB 1WEZA 3FCWA 3A8YA 1KQGB 5AQUA 3MFHA 2JRSA 1N4LA 3UVJA 5GAHU 3QBXA 3B82A 4HYKA 5KG5A 1A5WA 1N5SA 3DXMA 1EKRA 1Q1KA 1RCOB 2E8AA 4CYUA 3SCJE 2B43A 3N4PA 2IRUA 1ZA1B 2OO4A 3QSYB 1FWPA 2IHR1 3M8PA 2C42A 1DQ9A 2F96A 1QQNA 4B08A 5CYQB 4CH7A 1YJUA 4FKYA 4ZK7M 1BQMB 4IR9A 1WDDA 2VWKA 3KHLA 5DLGA 4KTQA 9ATCB 4ES3A 2NRWA 3OL7A 1AZSA 4HI2A 1N5QA 1SH0A 1SL0A 1PGZA 1U2VA 2G9OA 2P5GA 1NOZA 3MXIA 5GADU 3VZHA 2GWJA 1JWWA 2BE7D 3MZIA 3VQ6A 2ZH3A 3T69A 2G8FA 3GJTB 3SUPA 4W92B 1R8AA 1J5OB 5F8GA 2IGIA 4RW4B 2AJFE 4Q43A 4AE5A 3QYYA 4FWNA 4CJVA 4LFCF 1PILA 3M9NB 2M3DA 2AJ1A 5LXYA 1YT3A 2YHAA 1L3SA 4KHMA 3ZSOA 3ENWA 1HNZF 3CJSA 4K4XA 3SJHA 4G1PA 5J1NA 1FHTA 4B02A 4IXCA 2AGQA 3EZWA 1RHQB 3GIJA 3JYTB 4WIIA 4NXMF 4JHDB 2Y9HA 2BACA 4B1XB 1HMVB 4KB1A 1T8EA 1HBMA 3UDCA 3PZPA 2DGXA 1GOCA 3DRPA 2NRTA 5D8HB 3A8JA 4ELVA 3IRXB 2EVZA 2QK9A 3L3VA 2GTDA 1XNQJ 2OH2A 4DPWA 1WI8A 3JB9k 3RMAA 1GLEG 3CJ4A 2F4FA 3RYLA 4UF4A 4LT6A 4TY8B 2DXDA 3L3UA 2B6AB 4C3KA 2QL7B 4R8UB 2Z4PA 4MAKA 2BJEA 4KB7A 3DMJB 4YY3J 5FPDA 3PW0A 1QM9A 3D1HA 4F50A 1V5VA 5GMEA 1NNDA 4OLBA 2RKIA 2XG8A 4NEZA 1C1CB 3DWLA 4QS8A 2MSTA 4ANEA 1F6TA 1Q82T 4O44B 4ZLJA 2O8DB 3BEXA 2RRAA 2X6SA 3IXQA 4FVUA 3L4IA 4QOZB 1HNVA 4H5TA 3HOTA 4DUZJ 1JLEA 3ZT3A 3W62A 3CF5Q 4LRDA 2V50A 4AHTA 4L74A 2FHJA 3P6YC 4ANCA 1YRTA 3L09A 3C14A 1VBZA 2K3IA 1Q78A 1Q8KA 2KFNA 4DR7J 3J81U 2DNMA 4A62A 3G71S 4L8RB 2WB1D 2B7CB 1GX5A 1RDAA 5KG1A 5CD4A 4O3OA 4QIFA 4HT5A 1N6QA 1Z1ZA 2RMLA 4LFCK 2K8GA 3HHNB 2A2DA 4V19S 5LMNJ 1LW0B 2J0WA 3CETA 1HNZK 2D0CA 1WOQA 4CHYA 2ZZNA 1T05B 2BGGA 5KQDA 1HWIA 2H9ZA 3GMGA 5B0DA 4NXMK 2LEAA 4N41A 5AQGA 4JN4A 2B4OA 3PIOQ 3H25A 4IOXA 3UDVA 3H5YA 2V8VA 2YNGB 4BC4A 4J37A 1YAGA 5M1QA 1XNQF 1CZ9A 1HPZB 2VQEK 3CHWA 4KI6A 3RBDA 2YVSA 4GVBA 1RAJA 1S48A 3MK6A 5F8JA 1VJQA 3HKZD 3A4TA 3DDKA 4O55A 4YY3F 4X4SA 2CG4A 4RKUC 4MH8A 4OPAA 1KP6A 4DCOB 1OVQA 3MMCA 4PZVA 4Z94A 3NHGA 3SBMA 5D4LA 4BE1A 1NHVA 4NO7A 1D0EA 4CNZA 4P72A 3LDQA 2ACMA 4IH6A 2GELA 3TOQA 3KWGA 3JXOA 3QJJA 1S4FA 3I55N 4DUZF 1YJTA 1LW2A 2YQ3A 3JAMO 5JUMA 3OS0A 1H0HB 1D5AA 5L46A 3GJQB 3D54A 4QU7A 1RHRB 3QFWA 1RADB 4DX8H 2GAGC 3QLHB 2A1BA 2N82B 4DR6J 3DLLQ 3KJVA 3W63A 2P9IB 1SIWB 4FL9A 1LV5A 4PY5A 2B9EA 2VG5B 3SI8A 3KVGA 1T03A 1NSPA 2HBZB 4KH1B 1UWAA 1U26A 1M1GA 5DETA 1XQIA 4C3LA 2R7UA 4E8UA 2AU0A 5SWMA 4KBIA 1F2HA 1YI2N 2UXDJ 1CULA 1YVFA 5KFFA 4JI6F 4LFAJ 4K8RA 3V4IB 4F67A 2OHDA 3D5MA 1C0UB 4Z7CA 2V9KA 2QW9A 3JQMA 1FA0A 1G1XA 4GVMA 1RT5A 1XNQK 2FLLA 1IR2A 4WQ4C 4E0DA 2XCAA 3NMAA 4HVJA 1EO1A 1JLGA 4IJAA 1YJ7A 3ICLA 3U7JA 4KPYA 3OHAA 2NPIA 2YI1A 3K8WA 1DKGD 4CK1A 4YY3K 4BG9A 1HARA 3CJ8A 3E9PA 3KZBA 3AA9A 3L0QA 3ULEB 2P9GA 3DLEA 3SSRA 4B9LA 3U4LA 3KLFA 5E3RA 1MWMA 4B3TJ 4BROA 3IR7B 3NFAA 3JSMB 2YH0A 3QEIA 1TKZA 4XTTA 5CYMB 3CD5A 3GL1A 3PXGa 3M30B 2B9YA 3BY5A 4LUBA 4YOWA 3PV8A 4DUZK 1JNZB 1QSSA 3HI0A 4EBEA 4IDKA 2HHPA 3TEHB 1C1AA 1YTUA 4EO8A 1Q8LA 3MCMA 5A8KB 1U1RA 4DR6F 4OHYA 4EEYA 2WK4A 5J2NA 4DR7K 4WKYA 2HFZA 4CEDA 5GMDA 3IP0A 3L2UA 1BY9A 3PX6A 1BE4A 4K25A 1OPZA 1HYSA 3OR2A 1Z2LA 3CD6N 2UXDF 4Q8EA 2P5VA 5JVGL 2IA6A 5LMNK 4CJWA 3AOBA 1MWQA 3OJSA 3VQQA 5K8OA 2FJWA 4FVMA 1GH8A 2RS2A 2MKKA 1G6BA 2UU9J 1LEOA 2DJWA 2R8GA 1E6YA 1KTVA 3TZXA 1JMTA 1HKCA 3QIPA 4ZVPB 5GIOA 1MWKA 3L2QA 5C42A 5A2QY 2VOPA 2C28A 2M0GB 1QDUB 5ETMA 1T3OA 4O5BA 1R27B 1HNXJ 4CCHA 1X4HA 4X4QA 3CD0A 5B8HA 3D6MB 2OMOA 5AXNA 4BRMA 1RA6A 2WTUA 2CIMA 5LL6Z 2XBPA 3S41A 2WAQD 1K8AO 2MHEA 4CO3A 4B3TF 2PFFB 4USMA 2RF2B 3N5BA 4AM6A 3W60A 1R89A 4ED3A 4WWSA 2DGOA 1HBOA 5IOLA 1N33J 2N4CA 2KKZA 3CDBA 5DZ6A 4Y2KA 3S3OA 3MHYA 2ZEJA 3ISNC 1S59A 3J81Y 4A8MP 4PPZA 5M1FA 1WSJA 1W2IA 1NJWA 4NYFA 3CC2N 1NJIO 1FXDA 2RT3A 2V7ZA 3HPHA 2GJ2A 4UOGA 1RWXB 4ZLLA 1NGAA