4I7FA

Hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Synthesis and biological evaluation of phosphonate analogues of nevirapine.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Hydrolase/hydrolase inhibitor
total genus 153
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i7fA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i7fA05
4DFJA 2OPPB 1N5YA 2IA6A 4JLHA 3PW7A 3CIZA 2UVVA 2IM2A 2XWYA 1JLFB 1S9GA 4RNFA 2ASDA 3AVJA 1U4BA 1TAQA 2A1SA 4DTNA 1RBRA 3KK2A 3BQ0A 5HBMB 3BQ2A 4CJ4A 4IG0B 3G6YA 1IH7A 4DTUA 5L1LA 1SH3A 1JLGB 4H4OA 5F9LA 5HRPA 2YNIA 4CEEA 2W7OA 2FLLA 2GV9A 3OYJA 4QW9A 4NCGB 1VSDA 2F8SA 1TAUA 1T03B 2C2EA 3RMCA 5L1KA 5I42B 1VSFA 3MR3A 4N5SA 1KHWA 2P5OA 1KLMA 3V81A 1S9EA 2BRLA 2GUIA 4Y1DA 3QO9B 1RT2B 1QAIA 1EETB 3V9UA 4E0DA 4MKBA 4DF8A 2HHWA 3KHHA 1C0TB 1LW2A 3OL9A 4KHWA 1ZBLA 4AHSA 4CF8A 2FJXA 1RA7A 2C2DA 1S1UA 3L2QA 1LWFA 2R8JA 1VSHA 4IH6A 1ZTWA 4CJVA 3CDUA 1DLOB 1WSHA 4CERA 1T05B 1D1UA 3E01A 4HKQA 3OS2A 4UQGA 2VG7A 2PYJA 2YNFB 3AVHA 1TKXA 4KB7A 5SZTA 3BSCA 1C1CA 3ISND 3S3NA 4TXSA 1JLQA 3H08A 3KKSA 2XGQA 2YNGA 4CHQA 3KMQA 3QERA 3DRPB 4DEZA 2YHBA 4KAIA 1IO2A 2Z1JA 1ASWA 1SV5B 4E1MA 3CG7A 4K8XA 3SFUA 2BE2A 2QV6A 3IGVA 3MECA 1JLEA 1JLAB 2IBKA 5C24A 3RAQA 4PY5A 1LW0A 3QNOA 3KLEB 3QLHB 3KKRA 4ZPAA 4IFVA 1K1QA 4LSLB 4NLQA 2UVUA 4EZ6A 4DMNA 4M3XA 1TK8A 5F8NA 2HHQA 1RTIA 3PVXA 2Z1HA 3K59A 2R2TA 1TKTB 2W9CA 1NKBA 4I9LA 3LP2B 2E6LA 5KFQA 5EWGA 3CQ8A 1SH2A 1I39A 3LWMA 4EBCA 4XPCA 3HM9A 3UDLA 1NJXA 3PW5A 3EZ5A 2YKMA 1SUQA 3D28A 4B8CA 1XR7A 2B43A 3VQCA 5EUHA 4GMJB 5HRNA 2WOMA 4DU3A 4JS5A 4FW1A 5J2NA 3QYYA 2ALZA 1D9FA 2ATQA 1W0HA 4Z4FA 1RTHB 3H4DA 1HYSA 3DRSA 4EYIB 3DLEA 3MEEB 4FJ7A 4GW6A 4DSLA 1SL2A 2YKNA 4FYDA 2O4GA 5J2PA 3NH0A 1WNEA 4B9LA 3P5JA 4ECRA 4HUGA 1HQEB 3C6UA 4HUFA 4R5PB 5L9XA 5KFXA 4K4TA 4NRTA 4GC6A 4M95A 3M8QA 2P51A 1UOCA 4ZTFA 4KREA 1RCHA 4JV2A 4AHRA 3SQ0A 2YV0X 2R8GA 1RT3A 3L3VA 4KHSA 4RU9A 3QIPA 1EX4A 3S3MA 3KOAA 4NLYA 5KFHA 4J9NA 3DLKA 4IRKA 4CGIA 3KD5E 4EBEA 3LP0A 4RNHA 1IKWA 4DSJA 2IAJB 5C42A 3HT3A 3SYZA 5F8LA 1C1BA 3VQ8A 1KRPA 4CF0A 4B9SA 4ED8A 4YMEA 1VRUB 4I7FA 3IG1B 4IBNA 4K50A 2KFZA 3PW4A 3ITHB 5DQHA 5F8JA 4ZP7A 4KHYA 3DI6A 2QKKA 2WONA 4M45A 2AGQA 1SKSA 1EXQA 4TSXA 3VQQA 3ZCMA 4CJ3A 4BWJA 1BQMA 4B08A 3PX0A 2RPIA 1S6QB 4ICLB 3KLHA 3NGYA 3SUPA 4KHMA 3AO2A 4ZPDA 3QEIA 1IKXB 3OSPA 1CSJA 3Q8SB 1BI4B 1BIUA 2I1RA 4ELVA 3H2LA 4QPXA 2VG6B 4WYWA 4O4GA 3OL6A 2HB5A 1RDRA 3DMJA 2XY8A 4M41A 5J1EA 4WFZA 4CECA 3HP6A 4NLXA 3OYAA 1QE1B 4PUOA 5C25B 4YR0A 4NLGA 2B6AB 2RN2A 1T3NA 2UVRA 5K14B 5KGXA 2DY4A 3BSNA 4EBDA 1RT5A 3QGGA 1SL1A 4ED1A 1NK7A 2JEJA 3DRRB 3T3FA 2WK4A 3CJ3A 2RDJA 1J53A 1SKRA 5FRMA 2OPRA 2OPSB 4FJXA 1CXUA 3CYMA 3PX6A 4BE2A 1S1WB 2DFEA 3EPIA 1Z25A 4CEDA 3SV4A 4C8OA 4MH8A 4ED3A 3KK3A 4KHUA 4DL7A 3PW0A 4W5RA 4IH7A 3H5UA 4OJRA 1A5VA 3MXIA 4ZHRA 4G1QA 3PO4A 4ID1A 3GQCA 1ZBIA 2AJQA 1S1XB 3KMSA 1GOCA 3QINA 1C2PA 2R2RA 1VSJA 3P1GA 3H59A 3TAFA 4N41A 3MEDA 2Q3SA 1RBTA 3FQKA 4KB1A 4MFBB 4RW9B 4E89A 2HHUA 3FFIA 1HNIA 4I9QA 2FVCA 3HL8A 2R2SA 3NGIA 1Q9XA 4DFPA 4DTOA 1U47A 4PWDB 1RT1A 1U04A 1X9SA 4RUAA 5KG6A 3NBPB 1L3SA 5J2MB 2BR0A 1EP4A 1QHTA 1WSEA 3MR5A 3RB6A 2KW4A 2FVQA 1IM4A 1Y97A 4RW8B 4CJPA 3KLFA 1N56A 2HMIA 1FK9A 4Z4CA 4DQSA 2F96A 1KVCA 5CYQB 3V1OA 1BHLA 4CF1A 4CF2A 2KQ2A 3I0RA 3BREA 3RAXA 3CVKA 4DQRA 3HK2A 1S0MA 2IC3A 4CJSA 3KK1A 4H54A 3SUOA 1J9AA 1NK9A 4J9LA 4KRFA 2XY7A 4NLVA 1S4FA 4ZVGA 5KT5A 4F2SA 1C0UB 2EX3A 3H5YA 1RYSA 4NZ0A 3OHAA 4OVLA 4KSEB 4KHNA 1L3UA 3DDKA 4MQ3A 4QCLA 2Y1JA 1RTJB 4Y2AA 3HHKA 3SJJA 4CHZA 4ECQA 3AVLA 3RTVA 3V4IB 2FBTA 5FROA 3JYTA 3GILA 1G15A 3IS9A 3DM2B 2FLNA 1ZYQA 2IDOA 4DG1B 4J9MA 3QEVA 3D45A 4AHTA 4K4VA 4C8MA 3I0SB 4JRQA 5KFPA 3M9OB 3OYDA 1NJWA 1D0EA 3CFRA 2OA8A 3T5KA 3BSOA 2HVIA 1J5OA 3KD1E 3HVAA 3LDSA 2FVRA 4DSKA 1IKYA 5KT2A 1C1AA 2IJFA 4O3NA 2GIQA 5KG3A 1QSSA 1S0OA 5E41A 2AX0A 3TWHA 3RB0A 1HQUB 4FCYA 1NOYA 3K5LA 4ZP8A 3LWLA 4B3OA 3H5SA 4ZP6A 4FM2A 1FKPA 5KRSA 4FZYA 1JL2A 2JGUA 3H40A 3DOKA 4FM0A 1Z4UA 4N47A 3M8PB 3OY9A 2JEGA 4OL8A 3G6VA 3NH2A 3OYGA 3H5XA 4CFDA 4K4SA 1NK6A 3VA3A 1X1PA 1ZBHA 3O4QA 4IDKA 4CGFA 3TABA 3ICLA 3MXMA 3N6LA 4TLRA 4IRCA 2UUTA 4OLBA 4IKFA 4DTMA 5SWMA 3TAMA 1L3TA 5HRRA 3AO3A 3Q8RB 4RG8A 3NAIA 1TKDA 2BDPA 3KLIB 1RBSA 1LAWA 4KTWA 3KIOA 2XRIA 4KTQA 1N5YB 2J6TA 2I5JA 2GBZA 3WNHA 4ECVA 2ZKUA 3PW2A 1W9HA 1XWLA 4KI6A 2HNYA 4FLTA 1S9GB 3OHBA 2B4JA 4NLSA 4Z4HA 2VWJA 1JKHA 2RKIB 4H4MB 3KHLA 3ZT3A 1HMVA 2G8HA 1VSIA 3KK2B 3NL0A 4O0JA 4Q0BB 1CXQA 3ZSZA 1TL1A 3IRXA 5T14A 3CM5A 5JUMA 3DYAA 2VA2A 1LWEA 3FDSA 4O3SA 2XCPA 2YNIB 2A1RA 3VN5A 4WE1B 2XO7A 5JS1A 3HJFA 4J2EA 3V6HA 2OZMA 2PYLA 5HBMA 4NYNA 1ASUA 3WNGA 4N56A 2VG5B 4Y1CA 1TL3B 4FLXA 4FK4A 3OYIA 3GIIA 1TKZB 3RMBA 2IM1A 3V6DB 2XI2A 4DSFA 1SKWA 1JLGA 2HNDA 4DU4A 1RT4B 1WSJA 3V9XA 1JXBA 1RYRA 2WB4A 2AX1A 4YR3A 3FSIA 3DOLA 2G8KA 1J54A 3M9NB 1TGOA 3ZSQA 5DMRA 4ZTJA 2HVHA 4NCGA 3KJVB 2Y1IA 4FLVA 1XHZA 3PJXA 4O3QA 1KHVA 1T03A 5KT7A 5D3GB 5KGWA 4B8AB 3OYKA 1I6JA 1S1UB 5KFMA 1HYZA 2XY6A 5I42A 4ZPBA 3TAPA 4RNOA 2VA3A 2G8FA 3VQ4A 3D0PA 4Q43A 3BJYA 3RRGA 4YNQA 2V0NA 3S3OA 2NUBA 3QO9A 3E01B 3HVTA 4ID5A 1EETA 4ED7A 3RMAA 3BR9A 5I3UB 1C0TA 4NYZA 4YP3A 4F2RA 3LP1B 4RW6B 3MAQA 1JLQB 4CHYA 4AHVA 2YNGB 3FQLA 4AILC 3KLGB 1N48A 3V6KA 1KFSA 1FKOB 4CJEA 1Z26A 2ATLA 1QQCA 1S48A 1DLOA 3LP3A 1U49A 3MECB 1RA6A 1S10A 2FC0A 1T05A 5C24B 3RBEA 1NHVA 3PR4A 1LW0B 2YNFA 4FJ8A 2D7SA 1JXEA 2IOCA 4CK3A 3Q8PB 4IFVB 2QKBA 4M3WA 3DRPA 4CHNA 4E3SA 1BISA 3ZSYA 3V9ZA 3JSMB 3OYHA 1RTIB 1SV5A 4ECYA 2W9CB 3DLGB 4KBIA 3L2VA 2O4IA 1XHXA 1KCFA 3OSNA 3EPGA 4CJWA 3V9SA 1TV6B 4CGDA 3QLHA 5KFAA 3RWUA 4O3PA 3VQPA 5HLFB 4LSLA 1K6YA 1UA0A 3CJ4A 3QESA 1HPZA 4OPKA 2YHAA 1TKTA 2HAIA 4FZXC 1NNDA 5KFVA 1SH0A 3LP2A 3MEGB 4DTPA 1NHUA 4F3TA 4CESA 4U7CA 4I2PB 1D8YA 5L1JA 3K5NA 3O3HA 3DLEB 2BANB 3VQDA 3LAMA 2FBVA 4KHRA 2W8KA 4KE5A 1JLCB 3L3UA 4URGA 3V1RA 3OVNA 4E7HA 5J2PB 3MTKA 1RT7B 1RDBA 1NOZA 3K5OA 1X9MA 1RTDB 3C6UB 1HARA 3QZ8A 5KT4A 4Q45A 4OLAA 3NMAA 5CYMA 4QWEA 4ECZA 1TVRB 4OGEA 4HTUA 4R8UB 4ZMMA 3GV7B 4I2QA 3G10A 4DFKA 4RNMA 1YTUA 1S1VA 4KV8B 1IKVB 2V9WA 4FJHA 5DG9A 4O44B 1S1TB 4OKJA 3B6PA 3VQSA 3GV8B 3OYFA 3PV8A 4ZPCA 3SPZA 3HKWA 3OYCA 1CZBA 4FVMA 4FBUA 1RBUA 2G8WA 2JEFA 4EEYA 4EYHB 2P1JA 3ZSWA 4J9SA 4BDYA 2YNHA 4NLWA 3EZUA 4FS2A 3DI6B 1YTAA 3SFGA 5KT3A 4CIFA 2C22A 3U3GA 2IAJA 1GX6A 2D0CA 3KLHB 4CJ5A 4FK2A 1RT6A 3F9KA 4F4WA 5F8HA 4M3YA 5KFTA 2X6SA 1VRUA 2AQ4A 4CJKA 3C95A 1NJYA 3HSTB 1LWCA 3ITHA 2PY5A 3PJWA 2G8UA 2F8TA 4RW7A 1N6QA 3UIQA 2ILZA 1CLQA 1L3VA 4L8RB 5F8GA 4ECWA 1S6QA 3C6TA 4ICLA 4KFBB 2KZMA 5HP1A 4CK1A 3G0ZA 4W5NA 1IKXA 3UPFA 4TYAA 1BI4A 4ELUA 3VQ6A 3QIDA 5KG1A 5KFKA 1REVA 3VQAA 4F8RA 3QETA 2FJVA 2HWIA 1VRTA 1VSMA 1MMLA 2X6NA 1RBVA 2IM3A 1GOBA 4CEQA 4JV0A 2DPJA 1VSLA 1QE1A 2XY5A 3OYBA 2JEIA 5KRTA 2B6AA 4ED0A 3PZPA 2D5RA 3OJUA 5K14A 5DG7A 3LZJA 4B9NA 1B9DA 4CJLA 2FBXA 3C94A 3NAEA 3QZ7A 4BE1A 4G1QB 3T5LA 3DRRA 1N4LA 2E9ZA 3HVWA 3NHGA 4DL2A 4DQIA 4O5BA 1X9WA 1U09A 3PR5B 2W9AA 1S0NA 4LQ9A 3ASMA 3F73A 4EP4A 3O4NA 4U6PA 2OPSA 4NRUA 3RMDA 4PQUB 3V9WA 2R8HA 2D0AA 3MF5A 4QW8A 5HRSA 1S1WA 4NCBA 4WZQA 4CGGA 4YFUA 4KO0B 4IR1A 1QUVA 2WTFA 3O3GA 2BQRA 2LSNA 4TQSA 3OL7A 4DTSA 4TN2A 4LQ3A 5DLFA 5KT6A 4DLGA 3AVKA 2E9RX 2RDIA 4OGCA 2OPQB 3LALA 1MU2B 3EY1A 1ZTTA 3ZT2A 3M8SA 3KLFB 2HMIB 4RW9A 4E1NA 3PY8A 3K58A 5KG0A 1A5XA 3AO4A 4Z4EA 3OS1A 4FLZA 4JV1A 3LPUA 4RNNA 4M3TA 2IC3B 3KK1B 1R0AA 5DG8A 3OLBA 2RF2B 3ZT1A 5FRNA 3NBPA 2V4QA 3HPHA 1BQNB 1VSEA 4FJMA 1YVFA 4CIGA 2VWKA 4CEAA 3BGRB 5CYQA 2ZD1B 4TY8B 5F8MA 5J2QB 2JC1A 4WYLA 4HYKA 2KTQA 3SV3A 3KTQA 2HHVA 1ITGA 4FLYA 4KPYA 3IS9B 3KLVA 2ZE2B 2XI3A 4LY7A 4DQPA 4K4YA 4F4ZA 4IR9A 4FJNA 1F21A 1S9FA 4ECTA 2Z1GA 4KKOB 4J2BA 3NAHA 1RTJA 3VQ5A 1UWBA 1ZBFA 4FM1A 4CHOA 4MKAA 1BGXT 4FJJA 1J5OB 3V4IA 2E6MA 3CFOA 3SI8A 4AHCA 1KTQA 3RR7A 4QOZB 4FJLA 4WFYA 1QS4A 2E4LA 1Q9YA 2D3ZA 4IFYA 3DM2A 3HO1A 4M3ZA 4DG1A 5FDLB 2ZQBA 3H98A 4O4RA 4DL5A 5F9NA 1I3AA 1NKCA 3KHGA 3I0SA 1KSPA 2W9BA 4B3OB 4ZP9A 4IG3B 4Y3CA 2XHBA 3TI0A 5T7BA 3MR6A 1WSFA 4B9UA 4C8LA 3OS0A 3NF6A 1KLNA 4FJ9A 1U48A 4CFBA 3AA3A 5CZ1A 1WSIA 1DTTB 1XR5A 4DL4A 4KAZA 2XGPA 3AO5A 2HHTA 4B9VA 1HQUA 4Q8EA 4LSNB 4LH5A 3GYNA 2PZSA 2B5JB 1BCMA 3LAKA 4FJGA 2HNZB 1HYVA 3U3YA 3M8PA 3FRZA 4QWAA 1ZETA 3AVBA 1HJRA 1JLBB 1C0MA 4RW4B 2X74A 3TAMB 5KFGA 2D41A 1L5UA 4CEOA 4KTZA 5HROB 3S9HA 3ZSXA 1DTQA 4O3RA 2HWHA 3IGNA 2R7YA 3A2FA 2EHGA 1HNVA 3G86A 4FW2A 2UUWA 1S6PA 4F50A 4F4KA 4NLRA 3SQ1A 4KHQA 3L2RA 4CJUA 3NF7A 3AA4A 3OYLA 4C8NA 3EYZA 4B9TA 1TL1B 2C2RA 3MXJA 3SNNA 3IRXB 5KG7A 4URSA 1CZ9A 1D9DA 3KLIA 4KB0A 2IS3A 1LWEB 3UR0A 4H4OB 4ED6A 2OPPA 4E7KA 3NKYA 5JS2A 4HHTA 2JC0A 3OYMA 5KI6A 3IN5A 4DL6A 4H4MA 2RKIA 1JLFA 1RDDA 5KG4A 1XC9A 4Q0BA 4Q44A 3HPGA 3GV5B 5CZ2A 2WCXA 4IG0A 4IRDA 2OH2A 2HNDB 3CJ5A 3NGZA 1KLMB 3V81B 5KFNA 1RAJA 1S9EB 1GOAA 3SUQA 2W8LA 4Z4IA 2FVPA 2BGGA 4EO8A 4BDPA 3DOLB 4WE1A 1FXXA 3RRHA 3AA2A 1S5JA 4O55A 4GVMA 1LW2B 3TAQA 3GIJA 2VG5A 4Q8FA 1TL3A 1YVUA 5CY4A 3D5MA 3DLBA 4MIBA 4B9MA 4ZVFA 5DLGA 2C28A 5KG2A 5EDWA 1LWFB 1TKZA 3V6DA 3LPTA 4YR2A 3BSAA 4DFMA 1EKEA 1RT4A 1BCOA 3CDWA 2GC8A 3HVTB 4ID5B 4WXWA 2QK9A 1RT2A 4NYFA 2J6UA 4F4YA 2VG7B 3PX4A 3KJVA 4YQWA 1TKXB 4Q5VA 2UVWA 1C1CB 3TAGA 5D3GA 4M94A 4Z4GA 1U45A 1NK0A 1S97A 3RB3A 1YT3A 2AU0A 3N6NA 2BQ3A 3K2PA 4CJTA 4N76A 2BE2B 1D5AA 3BQ1A 3H4BA 4FS1A 1JLEB 4JS4A 3L2WA 3PUFA 4CEBA 1SL0A 5I3UA 4DTXA 2DFHA 3LP1A 4RW6A 4CF9A 1WN7A 4FXDA 3MFHA 3AVGA 2ASJA 3KLGA 1FKOA 1RDAA 2HHSA 4DS5A 1K1SA 3Q8QB 4NLUA 3OYEA 1WNSA 3T5JA 3AO1A 4LH4A 3NE6A 4DS4A 4DU1A 1JLAA 3NCIA 4TYBA 1S49A 4E7IA 3TAEA 1NK8A 3NGDA 3KLEA 3ZSRA 4MK7A 5KG5A 2YKMB 1SUQB 3U6FA 1HPZB 4QWCA 1WSGA 3JSMA 1Q8IA 3CJ0A 2WOMB 1B9FA 3DLGA 4KI4A 3LANA 5KFCA 4BDZA 5J2NB 4OPJA 2IM0A 2AWZA 3LZIA 3CWJA 3T1AA 4FJKA 1HYSB 4NLDA 1VK0A 1TV6A 3DRSB 4WXOA 5HLFA 3QNNA 2V4RA 4DWIA 1IG9A 2YKNB 3QGHA 4NCAA 2D0BA 3K57A 3V6JA 4PA1A 1QAJA 4IKAA 5L1IA 5EU7A 3MEGA 3E51A 3AVNA 4AHUA 4CK2A 1NJZA 3M8QB 3SQ4A 5CYMB 4DQQA 4I2PA 1RTHA 3T5HA 4CE9A 4M3UA 4I2QB 5F8IA 3I5AA 1TK5A 4J9OA 2BANA 1RT3B 3QIPB 4H8KA 1S1VB 3AVIA 1JLCA 4J9RA 3MEEA 4TY9A 3DLKB 5KFYA 3KHRA 1RT7A 4DL3A 2KFNA 4MK9A 3LP0B 1IKWB 3M8RA 1RTDA 5C42B 1HQEA 5KFUA 3AVCA 4G3IA 3VQ9A 5JXSA 3TARA 4E7LA 1C1BB 4R5PA 4WFXA 4CEFA 3V1QA 4CFCA 5KFIA 4I7FB 1TVRA 3HYFA 4M42A 2OYQA 4R8UA 4RZRA 4FZZA 2YNHB 1XI1A 4KV8A 1IKVA 4Z0UA 5KFBA 2IGIA 3ZSVA 2DPIA 1NKEA 2WONB 4O44A 1S1TA 2R8KA 1BQMB 3GIKA 1RT6B 1O1WA 4BACA 5EWEA 3CFPA 2IJNA 3P83D 3I5CA 3TVKA 1LWCB 3IG1A 4DTJA 3CO9A 2Z1IA 4O3OA 4O4GB 5DGAA 3SI6A 3QIOA 3WNFA 4RW7B 1N6QB 4MK8A 3DMJB 4Y2CA 2W42A 4QWBA 5J1EB 3ZT4A 2WRMA 2ITGA 4E7JA 2XC9A 1LV5A 4PUOB 3C6TB 1NK4A 2BRKA 4ZVEA 2FBYA 3UQSA 1WAFA 5HP1B 4E19A 5KFZA 1RT5B 3TR8A 3ISNC 4K8ZA 3CM6A 5DQGA 1REVB 2AGOA 3THVA 3HPOA 2ETJA 4HUEA 1VRTB 2VG6A 1NK5A 2ASLA 3B6OA 3NF9A 1JXLA 2OPRB 3G6XA 4K4ZA 3SPYA 3ULDA 3RBDA 4CIEA 5C25A 4KFBA 4FJ5A 3QEXA 4JUZA 5KTQA 3KK3B 4CJFA 4CJRA 2G8VA 1LAVA 2ILYA 2R2UA 3L2UA 4J9QA 4LD0A 2O5DA 3BDPA 4ZHRB 3HXMA 1QTMA 3PO5A 3AV9A 1XR6A 4ECUA 3NFAA 4ECSA 4CFAA 3QEWA 4EP5A 2QE5A 1T8EA 2BQUA 1TP7A 4NLTA 1RILA 4EZ9A 4OKEA 3RR8A 3MEDB 3VQEA 3O3FA 3SZ2A 4ELTA 4CJQA 3SQ2A 3FFIB 1OS5A 1HNIB 4MIAA 4XPEA 2WHOA 4Y34A 4DF4A 4QWDA 3I8DA 1RT1B 4NLOA 3OL8A 4IOBA 4PQUA 1S1XA 4TQRA 4CCHA 1VSKA 2D3UA 3KNAA 1EP4B 4KO0A 4AH9A 1T94A 5EWFA 3PHEA 2JLEA 3NDKA 3TQ1A 4MFBA 1FK9B 4BE0A 2KZZA 2F8EX 4GC7A 4C8KA 1KVAA 3I0RB 1R0AB 4PWDA 4J9KA 1WLJA 3SCXA 5KFDA 3M9MB 4IH5A 4EO6A 4CEZA 2OPQA 1MU2A 5J2MA 3QGIA 3OYNA 1TQLA 2E9TA 3NH1A 3CJ2A 4FLWA 3OLAA 5KFOA 4RW8A 5KFRA 4CGHA 3AVFA 3ZT0A 3ALYA 1T7PA 1BL3A 2DTUA 1C6VA 3AA5X 1JL1A 4J2DA 1BIZA 2QXFA 2FJWA 3MR2A 4ECXA 1B92A 4HCBA 2RF2A 3SUNA 3JYTB 3L8BA 4J9PA 3I5BA 2CJQA 5KFLA 3QEPA 4ZVHA 4XO0A 1BQNA 4W5TA 5KFEA 3T19A 4NLPA 1C0UA 2OZSA 5DK5A 3BGRA 3NF8A 4FJIA 1QSYA 1UWBB 2ZD1A 4TY8A 2W7PA 3HVRA 4HVJA 5J2QA 3CDEA 4X2BA 4FK0A 4M3RA 3VQ7A 4ED2A 5KFFA 4IQXA 1ZBUA 2DFFA 1UA1A 3N6MA 2FLPA 1IKYB 4IFYB 4K4WA 2AGPA 2ZE2A 1WAJA 4W5QA 4O0IA 4BWMA 4JRPA 1RDCA 2XCAA 4K4UA 4KKOA 1A5WA 2W9BB 4QAGA 2GIRA 3WNEA 5C5JA 1KVBA 1ASVA 1FKPB 5DGBA 4F4XA 5DQIA 3DOKB 2J6SA 5KFJA 1TK0A 5FDLA 1RNHA 3IAYA 3K5MA 5KFSA 4WZMA 3AVAA 4FBTA 1HRHA 1UAXA 1GX5A 2R8IA 2CKWA 3RB4A 4IG3A 4FLUA 4IDKB 4DLEA 3DLRA 3HP9A 4DTRA 3TANA 4HCCA 2FVSA 4CGJA 4RUCA 1JX4A 3DLHA 1DTTA 1KFDA 2IMWP 1JIHA 2HW3A 1DTQB 1W25A 4LSNA 4R0EA 4DSEA 3VA0A 1HNVB 4F3OA 3VQBA 2B5JA 3ZSOA 1S6PB 4XIUA 4CHPA 2I5JB 4DSIA 3GIMA 2HNZA 5KFWA 2HNYB 3MFIA 2EC0A 3OJSA 2HHXA 3AVMA 4K4XA 2P5GA 1JKHB 1JLBA 1HMVB 2X78A 4URQU 4RW4A 2G8IA 5HROA 4J2AA 1QSLA 3DYAB 4W5OA 4OKKA
chains in the Genus database with same CATH superfamily
3NP5A 2G0CA 5IQ6A 1EX8A 4Z7CA 4OI4A 2UVVA 2XWYA 1JLFB 4X66J 4L3QA 3OW2R 2DR9A 3VOVA 1ZPWX 3R8EA 1M90O 1RBRA 3J80U 2HK3A 5AR0A 3W1YC 3WXJA 1V6HA 2L08A 2E66A 4OZLA 5A2QY 2R7WA 1UJ4A 5L1LA 1VQSA 3IAS9 3D2EA 2ZWPA 2YNIA 1GLCG 4I1TA 4TKTA 3OYJA 4MDBA 1N34F 3RZAA 4P7VA 1VSDA 2B51A 1JJ2M 1HWKA 1VS3A 1T03B 2OAUA 4YOYA 2VU5A 3OTOK 1S99A 3RMCA 5L1KA 4HH1A 1RABB 1VSFA 4N5SA 2P5OA 2R42A 5LMUJ 3AT1B 2G9OA 1X4HA 1FJGF 4M5MA 4U8VA 2R9LA 5AE1A 4YDUC 1NSQA 1CC8A 4A61A 3OL9A 1SC4B 2M70A 4KHWA 1ZBLA 3BEXA 2GVDA 4X65F 1RA7A 3HD2A 4JP8A 1ZTWA 3D7SB 1TUUA 4X84A 3VV2B 1FFSB 3PRBA 1WSHA 1RFQA 3ATVA 1UPPA 1T05B 1D1UA 3P5BP 2V94A 5HVHA 2VG7A 2PYJA 2YNFB 4PG4A 3AVHA 4KB7A 5AQZA 4TXSA 4DV0J 4OJ3A 3AA8A 2XGQA 4A59A 3QERA 1N36F 4OX9K 4QIWD 2E5HA 1FTRA 3B54A 3MM5A 3D6HB 1HI0P 1DAXA 5C24A 4DV1K 3G2XA 3J7AP 4JYAF 3KG0A 1Y5LB 2P9SA 1K1QA 3G6ES 1S0VA 2ZFHA 4EZ6A 2B4VA 2CIMA 2YQ1A 2WC9A 4BVOA 4DR7F 2R2TA 1TKTB 2W9CA 2H4YB 1NKBA 4AT1B 3SCIE 3MCPA 3I32A 3VEYA 3NXZA 2L3MA 5ETRA 3P45B 5KFQA 5EWGA 4C2MA 4YORA 4EBCA 4XPCA 2HKEA 3HM9A 3EZ5A 4WPAA 1FRJA 3OV7A 4B8CA 2JLFA 4UOHA 2OJ3A 4Y0WA 3DGPB 5EUHA 2VC0A 2UUCF 4GMJB 4U8YA 4LFBF 4PL7A 4DU3A 3MOZA 4JS5A 1M90T 5J2NA 3O9QA 2ALZA 2XMKA 1OQ6A 4H0XB 2Y1RI 3DRSA 5C7PA 3VQTA 2K2PA 3QJLA 2MEWA 4FJ7A 4GW6A 2C1EB 4DSLA 3QQCD 1SL2A 4X62K 2ZHAA 1WUAA 5J2PA 4DX8H 2QSWA 2BUPA 3Q8UA 2V67A 1M5HA 5L9XA 2DIUA 3GOIA 2V7ZA 1UOCA 4ZTFA 2NSCA 2E5LF 1MW7A 2YKQA 1RCHA 2YV0X 4RU9A 4ZITA 3DLKA 3PIOL 2H3EB 3KD5E 4NA2A 1UJ5A 1UZDA 3C14B 4RNHA 3X3UA 4DL0C 5A8RA 3HT3A 2WW8A 2JJ4D 2XM3A 2QZ8A 3U1MA 3QFWA 4USWA 1EKSA 2HBMA 1KRPA 2JHEA 1VRUB 2IDEA 5DQHA 3LGHA 1CJKB 2Q31A 2XMTA 2QKKA 3ZCMA 4CJ3A 5I3PA 2KG0A 1OO0B 1BQMA 4BWJA 1WBDA 4ICLB 2QC3A 3VGTA 5BJRA 3SUPA 3OXLA 3AO2A 1IKXB 3TUPA 1CSJA 4PQAA 3Q8SB 1BI4B 2V7YA 2XB2D 2FJAB 2HHHK 1B4SA 3H2LA 4WYWA 4O4GA 2C2ZB 2HB5A 3NCRA 1WDDA 1C4AA 5B0GA 5J1EA 3O6QA 4RJVA 4WFZA 2ZH4A 3K8WA 1QVFR 2W6LA 2AEMA 2ZUGA 4YR0A 2CZ9A 1OKJA 1T3NA 2RN2A 5K14B 1H3DA 2Z58B 3MAAA 3CJRA 3O4WA 1EAYC 2RDJA 4AUKA 1BWEA 1B70B 1WSVA 3ZZPA 3VF4A 3ILJA 4DV7F 3MM7B 1REGX 4AL7A 4JI4J 1S1WB 2BJ7A 5KOXA 2V2KA 4KHUA 3DLJA 4W5RA 3R2CJ 4V19X 1TTHB 3DJCA 1D09B 2D9PA 4NXMF 2XNQA 2IVYA 1QAYA 4JV5K 4KHPJ 2IJRA 1R8HA 3TX0A 4LJMA 3MMBA 1S72S 5LXRA 1ZBIA 4CLKA 1PYSB 1KAXA 1T9WA 3CUNA 5K8OA 1ZAVA 2JWNA 5ADZA 4I69A 3H59A 1IBLJ 3M05A 4N41A 4K8RA 3MM8B 2Q3SA 3TOQA 1F3FA 4X66F 4IEEA 1QQOA 4M5GA 2FVCA 3THWB 4IJNA 5GINA 4OV6A 3W5ZA 1Q9XA 4DFPA 2DT9A 3EX7B 1J5EK 4PWDB 3OTEA 1RT1A 5BXIA 3ZTOA 4RUAA 5ETMA 1L3SA 1FXDA 4IOCQ 2BR0A 3R5JB 2GHPA 3LL3A 4LR7A 4CRJA 3RB6A 3TRGA 4U67L 2J0SD 1Y97A 2V34A 4RW8B 4CJPA 2BOAA 2O8DB 1FK9A 1WOOA 3GR1A 2ZGZA 1W7WA 3I0RA 2J9CA 4YOXA 3WZ0A 4H0OA 3SUOA 1QLNA 2HGMA 1J9AA 4O0NA 5LMUF 3IWNC 1UKUA 1FTCA 2XY7A 1S4FA 5KT5A 2EX3A 4KGZB 2NRTA 4NZ0A 4LUBA 4JKCA 4OVLA 2KRRA 1TL7B 4QCLA 2HPUA 2P9PB 3IWLA 2FBTA 5FROA 2E44A 2KDOA 4E1JA 2FLNA 1X5TA 2EG1A 3EWGA 1HNZK 4BR7A 2R7VA 4FWSA 4K4VA 5AQPA 4YOWA 4C8MA 4DV0F 3KJNB 3RJMB 1U6ZA 1D0EA 4CZJA 4LFCJ 2PFDA 4QYZK 2W6KA 3W63A 3LDSA 2M8DB 4DSKA 2ASMA 5KT2A 4IJAA 1IM6A 2OI2A 4HR2A 4LF7J 2WTUA 3TZXA 1QSSA 3CC7N 4ZP8A 2AMCB 4B3MJ 3H5SA 2JX2A 1FKPA 2QLJB 5KRSA 4FZYA 3OUYB 2JGUA 2BOPA 4FPIA 2YQ0A 1Z4UA 3GJSB 1P27B 4WFNQ 4OL8A 3JXOA 2HFUA 2IPOB 4K4SA 1ICEB 1RHKB 3S8SA 1YJUA 3KDOA 1P8ZA 4CGFA 3TABA 3ATUA 5HATA 1DQAA 2UUTA 1WWHA 4HTJA 5GAGU 4F9OA 3GCWP 1RB0A 5IT9O 1TUWA 4DV6J 1TKDA 3D7EO 4ZS6A 2N4DA 1LAWA 3THYB 3ADAC 3IR7B 2J4RA 2XRIA 2QL7B 2RQMA 1N5YB 2GBZA 2VASA 1RWPB 4Z4HA 2VWJA 1HR0J 2G8HA 2LQ8A 4Q0BB 1CXQA 1TL1A 3C16B 5M2UA 2DH9A 3WX4A 2WSCC 3WEEA 2F40A 5ETTA 1KR4A 3TA1A 3IM9A 1CULA 4DUTA 4O23A 3RRKA 4O3SA 2ZNYA 3UCGA 3M5RA 2XULA 1HX1A 1FRLA 1JQGA 2PI5A 3ISZA 5AQYA 2XO7A 5JS1A 4WU3A 3TJ9A 2DGUA 1QHAA 4DPOA 3T69A 4HLBA 3WNGA 3I31A 1U2FA 4XEIA 1S59A 2UXDK 1VK3A 5CHCB 5LSOA 2AF6A 3OYIA 2O67A 3RBZA 1PBUA 1IG8A 5D4OA 2QMWA 1RYRA 4JI7J 4YR3A 4WTOB 3LTOA 3M9NB 1WC1A 2QA1A 2HVHA 1J54A 4DX7A 5CYJA 2B8QA 1XHZA 4ZA1A 1VIOA 5KT7A 1T03A 3FZLA 4BS2A 2HF4A 3BF3A 2ZH9A 3S6EA 3HSDA 3MAHA 4WP9A 3RRGA 5DZ7A 3S3OA 4F02A 3L7PA 3QT8A 1K9MT 3K17A 4ID5A 1QZ5A 4ED7A 5GAGP 3RMAA 3CC2N 4NYZA 4YP3A 4F2RA 4RW6B 1JLQB 3KLGB 4DUYK 1G3OA 5M1OA 1WTFA 2DGQA 3EN9A 4ES2A 4CJEA 1Z26A 5HMZA 3NY0A 2HIYA 4ERDA 1S5ZA 1T05A 4JI4F 3MPVA 4DPWA 3H25A 2YNFA 2D7SA 1R8PA 2VOOA 4LF8J 2P5VA 3RU0A 3ULEB 3CC2S 2QKBA 4M3WA 4E3SA 2DEJA 4KHPF 3ZSYA 1HNWJ 3JSMB 4FSVA 2POKA 3DLGB 3IM8A 1VAZA 3OSNA 1EJ7L 4CJWA 3V9SA 3LOUA 3J7AN 4CO3A 1IBLF 5KFAA 4O3PA 3O5TB 4RPFA 1Q8KA 3HI0A 5GAHI 2LQ5A 2ZKTA 3D6FB 4BRMA 2YXLA 1UA0A 4AD6A 1XQSC 3DWLA 1S7IA 1DQ8A 2DITA 4JI1J 1TKTA 2HAIA 1NNDA 5KFVA 3MEGB 3MPYA 4OYAA 3CW2C 4Y65A 3EL2A 3NGRA 4F3TA 4CESA 1HBMB 4U7CA 2ASPA 1IBMJ 4X64K 1H2TZ 1TL4A 3UNYA 3VEOA 2OLWA 3BH6B 2HSTA 2FBVA 2BVZA 3CCJN 1JLCB 2XZWA 4E7HA 3BGLA 3DGPA 3MTKA 2MLYA 1NOZA 3LGNA 1HNXK 1SJFA 4Q45A 1VHFA 3HZEA 5GMEA 4ECZA 1WOSA 4HTUA 2GWKA 2YWHA 4I2QA 2W24A 1YTUA 1QDUB 2F4VK 2CWXA 4FWQA 4FJHA 3QNWB 3ZEUA 1KQSM 4KGMA 2GZOA 1S1TB 2F7TA 3CCJS 1U2CA 4PL8A 4CBUA 3GV8B 3OYFA 2KHDA 3PV8A 2BKOA 1UVNA 3CCZA 3HKWA 1XK8A 3TU5A 2G8WA 1T3OA 4EEYA 4EYHB 2FSJA 5E3RA 4GKKJ 2OO4A 2HFZA 2UXCJ 3KFWX 3SFGA 5KT3A 4ISEA 2KG1A 2GIFA 2IBOA 8RUCA 4W4MA 3U3GA 4FF1A 1WJ9A 5EHHA 2D0CA 3KLHB 2BA9A 3EXCX 3AY0A 3F9KA 2ZWHA 2YCHA 4LFCF 1WTBA 2X6SA 2CFXA 1VRUA 1FJEB 4DR1J 1IJJA 3HSTB 4M1KA 4LF7F 2C3PA 2PY5A 3PJWA 5AQOA 2F8TA 4RW7A 3UIQA 3K0SA 2ILZA 2RUSA 1F60B 3VF0B 4QBUA 2CQDA 1L3VA 4B3MF 2QYCA 4L8RB 4ICLA 4LT6A 1HI8A 2KZMA 3G8QA 3K0JA 1IKXA 1YLXA 1BI4A 2O8CB 3MX2A 4FYXB 3QETA 2HWIA 2IM3A 1GOBA 4CEQA 3OQ2A 4JV0A 2DPJA 3AAPA 2MKIA 5HN0A 2CG8A 2JEIA 5K14A 5DG7A 3LZJA 4B9NA 4C11B 1OH8A 1B9DA 4CJLA 1GQEA 2C42A 1EO1A 3QZ7A 3TYTA 1G4CA 1E4FT 2O8BB 1K0VA 3TZWA 1X9WA 2LXUA 3PR5B 4E98A 3MM7A 4DV6F 4NRUA 4WK3A 4BRGA 2D0AA 2F8HA 2BEFA 5AXNA 4JKEA 1S1WA 2GMJA 3P8BB 4WZQA 4P73A 1NZAA 1YBAA 2XMVA 1MWMA 3ZTPA 2VKZG 2UUBJ 1QUVA 2WTFA 1HR0F 5IWAK 1NNEA 2P9IB 1YUWA 4TN2A 3R5DA 4EU0A 4LQ3A 1R89A 1SQKA 4YY3K 5AE2A 1W7AA 5KT6A 3AVKA 4FWRA 3QAEA 2RDIA 3DOMB 4E2FB 3MM8A 3ZT2A 3H3NO 3VR1A 1R0BG 4I68A 1A5XA 3OS1A 3FEXB 4JV1A 3QT5A 3A8JA 1GLBG 3O08A 2RU9A 1NPPA 4UUWA 1JWWA 1EQMA 2VQFK 1FRHA 3HPHA 3LA0A 1BQNB 2XSJB 4OHXA 5AQWA 3O44A 2AJFE 2PEBA 2RJZA 4BR9A 3W2VB 2VWBA 4FWLA 1YVFA 2VWKA 4CEAA 1SQFA 3TZYA 4TY8B 4IOAQ 4D3GA 5J2QB 4H0PA 2V8DA 4WYLA 3CCUS 2K7JA 4P2MA 3SV3A 3THPA 4PKHA 5BRFA 4KPYA 3DC2A 4JI2F 4J37A 4H5NA 1X8DA 4A5BA 4K4YA 3TEGA 1F21A 1TL7A 4J2BA 4KKOB 5IM0B 1T9XA 1ZBFA 2P9PA 2YHWA 1BGXT 1J5OB 3CTRA 1NH7A 3CJ9A 2E4LA 5EOYA 4DU7A 5JJBA 3HO1A 1U1KA 4M3ZA 1VLOA 3JXUA 3HFZB 4F04B 1NDCA 1I3AA 3MCNA 2W9BA 2EKNA 4B3OB 1VIXA 1FNOA 5T7BA 3TW0A 1ILYA 3HHLD 1HNWF 4IOCL 1F5CA 2YY3A 5ETVA 4FJ9A 3CMQA 1D8ZA 4KAZA 2XGPA 4MIWA 5IT9U 4Q8EA 2KT5A 3HMJG 3LW5C 1X0FA 3V4MA 2B5JB 2RRAA 4BBYA 4OYMA 2D74B 1HYVA 2LDYA 4JI1F 3BDEA 3AD7C 4YHHJ 2FZGB 4LIWA 1T3VA 2A2DA 4ZJOA 4F4AA 4CEOA 4ANDA 1IBMF 4W92B 1IVZA 1GMWD 1CJVB 2HWHA 3IGNA 4CJ7A 2D3OR 4IUFA 1RBAA 2EHGA 4IDHA 4RBUA 2UUWA 4FWKA 1S6PA 4Q2LA 4F4KA 2QO3A 4NLRA 1NGAA 2Z2MA 4XH5A 3L2RA 2AEJA 4CJUA 1X9JA 4BLGA 2DH8A 3MXJA 3BBBA 2R4FA 1JK9B 1Q7LB 3OT9A 4UOGA 3ZXWA 2HBZB 4DHVA 1TUVA 4KB0A 2H1YA 3THYA 2ZH6A 1F5BA 1NMNA 1OSDA 3Q7CA 3NKYA 4CBWA 2YHYA 3M7VA 3OYMA 4TU9A 3IN5A 6AT1B 3ID6A 1RDDA 2MPUA 2E1YA 4Q0BA 3NMRA 3C16A 3R3LA 4M63A 2ABYA 3U4LA 3AJ2A 2MQQA 4IG0A 4FN5A 2HNDB 3VAFA 3CQYA 2UXCF 2DRDA 4LF4J 2GJFA 3GCXP 3GTYX 3W8PA 4WFNL 4EO8A 2Q66A 2R7OA 1OH5A 3LH2S 1FXXA 2EWSA 3AA2A 4GVMA 2JL9A 2OEJA 1JNRB 2W2MP 3TAQA 2IRUA 1FESA 1ZAWA 1CG2A 1WHWA 2Z8QA 4Q2MA 1S7HA 1MNEA 2YX1A 3S01A 4ZLNA 2JWLA 1Y4ZB 4GNIA 1BCOA 1VQ6N 1K44A 4F67A 1RBOB 3HVTB 2DXDA 4WXWA 2L9NA 2LMIA 4F4YA 2D4WA 1V5VA 3TAGA 4RBTA 4X4RA 4M94A 4Z4GA 3TVYA 3QSIA 1LQ9A 2CNOB 2J5AA 3W65A 4V1Ak 3RB3A 4JNEA 1RTZA 1HBNB 2OFGX 3AOAA 3TNVA 1OYEA 1B7FA 3D6TB 1VQ6S 4Z37A 3CXCR 2CPJA 1X60A 4RW6A 4BRDA 3AXKA 4CF9A 2ASJA 3KLGA 1RU1A 2VKRA 1SB6A 4OHYA 4RLEA 2QEXS 4JKBA 2UXBK 2KU7A 1VFJA 4B1VA 4RX6A 2KXNB 3GU0A 3R6GB 3MM6B 2XZTB 1ATRA 1WNSA 3AO1A 3OR1B 5ETKA 4DU1A 1JLAA 1AZSB 4FKYA 2RSQA 2N7CA 3KLEA 3ULEA 4ETZA 1LOUA 2UUBF 4MK7A 3R5CA 2JZ5A 2PC6A 1SAZA 1HPZB 1OYDA 3JSMA 2QWRA 1LK7A 3CJ0A 1VQ9S 1I3OB 3DLGA 4PG8A 3BUZB 3HJVA 4F0MA 1SJQA 2DGWA 4FJKA 1HYSB 3MX5A 1I94J 2V68A 1AFJA 4WXOA 5FPNA 1HWUA 2LP4A 2YKNB 3QGHA 5FD1A 3ET6A 1NO8A 5EVZA 2HGLA 2DB1A 3FBBA 4QU6A 2ZUAA 4HT5A 3RGIA 3EMTA 4IKAA 5L1IA 1R6VA 3MEGA 3E51A 4CK2A 3FUYA 3T1YF 2PSZA 3M30B 3SQ4A 1RTHA 2VL1A 1XUPO 2V9KA 4M3UA 2JSXA 5F8IA 1RT3B 3QIPB 1Q18A 1S1VB 2DGVA 1JLCA 3G4SN 5KFYA 3KHRA 4DL3A 2QFJA 3LP0B 5AQSA 2F3JA 4CP5A 3AVCA 3VQ9A 3TARA 1C1BB 1Q78A 4YN3B 4CFCA 3AB4B 4I7FB 4B3SF 4M42A 2YX4A 2OYQA 4KH4A 4FZZA 2H5JB 3CMAN 1ZM9A 5AQFA 4BGBA 2MYFA 3ZSVA 1CS4B 1NKEA 4F7VA 1S1TA 4OI1A 1K73O 3G4SS 3TSPA 4HDHA 2IJNA 2VFUA 5J1NA 1ZA1B 1LWCB 3IG1A 1PJ6A 1X5PA 3W5YA 4DTJA 3M1VB 1Z1ZA 2K8GA 5KQ8A 1EHWA 1PO6A 2Z1IA 3TJAA 1K8AO 3WNFA 1P90A 1YX2A 4MK8A 3CMAS 1O5JA 4OQJA 4QWBA 2ZH1A 4O5FA 2KI2A 4JI5K 3ZT4A 2WRMA 1MWQA 2XMMA 3HSCA 3C6TB 3R9LA 5HP1B 3ZZYA 4X4UA 2A42A 3TTCA 2Y9HA 3GG0A 1H72C 3CM6A 3R1LA 3ZX3A 3THVA 2ETJA 4HUEA 1YJNN 1B3TA 4CTAB 1P6TA 3G6XA 4M63C 5E5NA 4YEAA 2CNKB 5C25A 2E1PA 4EHTA 4FJ5A 3QEXA 3WIUA 4ITSA 3QFPA 1VLYA 2G8VA 1JCEA 2O8CA 4LD0A 2VUGA 4YHHF 5ELZA 1Q86T 2D1KA 3AV9A 1ELOA 1XR6A 3NFAA 2QWPA 1ZPVA 1YJNS 3A5MC 1NGEA 3RR8A 3ID8A 2XLKA 3L7OA 3MN9A 3SQ2A 3FFIB 2O8BA 3UKRB 4QWDA 2DO0A 3OL8A 2O01C 4TQRA 2QWLA 3AJ1A 2VYPA 3KNAA 3VGSA 3QMLA 3DFEA 1EP4B 3B8HA 1T6CA 2IFXA 5E3CA 5EWFA 3PHEA 2JLEA 3NWRA 3TQ1A 3HHLB 2BJDA 2ZJRQ 3NS7B 2P9IA 4CO5A 1N8RO 1KVAA 2DR6A 2B8PA 5DRKA 4C8ZA 4EO6A 2NXEA 4PZVA 3FBCA 3DOMA 4PKDB 4CEZA 4LF4F 5GADI 1Q82O 4NXNK 4FLWA 3UO0A 1UAWA 2EPIA 5KFRA 1TYQA 4K42A 3IBCB 3L7UA 3EM1A 2VFRA 3SAGA 1J27A 2OP5A 3CO0P 3W8GA 5HI7A 3FGUA 3EXYA 2A3ZA 2HRUA 3U9DA 4OHWA 1KONA 4ECXA 4A48A 4HCBA 4CLSA 2C3UA 4N77A 3J7Z5 4FF2A 3PYDA 1BQNA 2XSJA 4W5TA 5KFEA 4FDFA 3T19A 4NLPA 1K8AT 3W2VA 1NGDA 3TO8A 2VPWB 3PHTA 4TY8A 4K5SA 4OX8A 5J2QA 3DXBA 4FK0A 2K3KA 1BOTO 2MKJA 2DFFA 1UA1A 2UUAJ 5DDPC 3W2WB 4IFYB 2AHOB 3ZTQA 1KP6A 4W5QA 3GBTA 3M6GA 4DR2K 3PLAA 2XCAA 1LKZA 4KKOA 1FE0A 1A5WA 3WNEA 1M5OC 2VF3A 3ZZ0A 1ASVA 3RG6A 2AJ2A 5DQIA 1Q53A 2J6SA 3DRYA 4WBFA 5F41A 4CZIA 3NNHA 3GYXB 2FC9A 4WZMA 4U96A 3OVAA 2R8IA 2CKWA 1T9UA 1W26A 2GQCA 3MN6A 1NDPA 2DTJA 2MZSA 3DLRA 3E1YA 1S77D 2CVIA 3T6JA 3CF5Q 4RKUC 3OTOJ 4HCCA 2RDDA 4KGVB 4QS9A 4HACB 1VMBA 3B4DA 3PSFA 4EI2A 1I94F 1DTQB 4IOAL 4DSEA 3VA0A 1HNVB 2XZDB 2B5JA 2XO6A 1OY8A 3ZSOA 4CHPA 2I5JB 3F2KA 2JNJA 4DSIA 2Q1LA 3KWIA 5KFWA 2GHWA 2HNYB 4EFHA 3D68A 3AVMA 2FIUA 4LFAK 1JKHB 4RBVA 4ZIWA 4KIAA 1B0TA 3QAUA 4J2AA 2E7VA 5HANA 1YZ6A 4W5OA 1N32K 1I5OB 2VHGA 2OPPB 1Q82T 2JLGA 4JLHA 2IA6A 3SIPB 2HZCA 2H5EA 1RKJA 2GJ2A 4U7UD 3AVJA 1U4BA 4OX9J 4DTNA 3KK2A 3BQ0A 2O8EA 2GMLA 4CJ4A 2APOA 3WT0A 3Q83A 2OEKA 2QG9B 4DV1J 2NZ4A 2MLZA 3VMFB 1XEZA 1Q5VA 4QW9A 2KYZA 3CPWM 2ZH5A 1WORA 4NCGB 3KXDA 3C7NB 1X4FA 1T44A 4XAKA 2CYYA 5ETNA 3WHIA 3ZZZA 3HCXA 1KHWA 2HSEB 5B0BA 1HKGA 2WW4A 4Y1DA 2XWXA 1FW6A 3DU5A 1QAIA 5CAAA 2LXFA 1EETB 3V9UA 4E0DA 1GTHA 1C0TB 4KC5A 1HI1A 4AHSA 2NXUA 1S1UA 4CO0A 2C2MB 2W25A 4ZCMA 4IH6A 3CDUA 1YJWN 2OTJN 1EARA 3OS2A 4UQGA 4X62J 1NEEA 5SZTA 3KKSA 1Y0HA 4HHUA 2ROPA 2YNGA 4CHQA 2BACA 4JI3F 3KMQA 3DRPB 4PKIA 1FJCA 2YHBA 2M5YA 2Z1JA 1JB0C 3GJTB 4E1MA 1HBNA 3O3LA 4ZLLA 1X31C 3BBFA 1WG4A 3MECA 2IBKA 4BRAA 3UKUB 4IQMA 2CQ1A 2RHKA 3QLHB 3KKRA 4CBXA 3PEHA 1FDAA 2YX7A 1GLDG 4H0TB 3HX9A 2A1BA 4NLQA 1HBUB 3CDBA 2WVDA 4M3XA 2B7CB 2ZH2A 1TK8A 4CH7A 1TU0B 4QPTA 1UVLA 1XMQK 3PVXA 5AQKA 2VB6A 4FWOA 5B0AA 3MM6A 3LP2B 3OR1A 2E6LA 4OYBA 3SSSA 4B1UB 1SH2A 1AZSA 2CJYB 3LWMA 3UNGC 4JI7K 2CJAA 3UDLA 3PW5A 4LF9K 1PAUB 4LRFA 4B3TK 4YDDB 2B43A 2HZVA 3Q22A 3MD1A 5K20B 1URNA 2HIQA 2DYAA 5LMNK 4QJVA 2HHHJ 3DXKA 2ATQA 2BJ8A 1W0HA 5BR9A 1HYSA 4PCQA 2KXHA 2QWNA 4EYIB 1WF0A 2F9TA 5KPTA 3DLEA 2E2QA 2KM8B 2YKNA 2O4GA 5BPMA 1U0HA 2EFVA 3P5JA 4ECRA 3KKFA 3C6UA 5A2QU 4R5PB 5KFXA 4NRTA 4M95A 4HH0A 3EE8A 5T7LB 1RGIA 4AHRA 3VEWA 1OQ3A 1JCGA 1RT3A 3SCLE 4KHSA 4B3RK 3QIPA 3MCAB 2UV8A 3FEZA 1UWAA 5KFHA 4U7UK 4IRKA 2WZ1A 4LF8K 5B7WA 3LP0A 5AFUH 3SYZA 5CE3A 2OHDA 4JV5J 2HQIA 3GE1A 1C1BA 1VQPS 1BQXA 4CF0A 4J91A 4YMEA 2UUAF 4I7FA 2J9DA 1KXPA 3BZQA 3FMWA 2KFZA 3PW4A 1CS4A 4GO7X 4ZP7A 3QJJA 3DI6A 4B17A 4B1YB 4M45A 1SKSA 2NUHA 2DNZA 1NWKA 4B08A 1GMVA 4A8OA 3PX0A 4PRFA 3NGYA 4H03B 1QVGR 1C0FA 2HVDA 2K1RA 1J5EJ 3AGKA 4FPAA 2I1RA 4AF1A 3M1VA 4M5IA 4ELVA 2VG6B 2AJ4A 5F0UA 4USUA 2ZDPA 4CECA 1HWIA 1RHJB 1VRQC 1YF5L 5C15A 1FVQA 3VPZA 1R0CB 2B6AB 1FNXH 2W2PP 1F2HA 4RR5A 1UCNA 3OTOF 4ED1A 2JEJA 3DRRB 3T3FA 2HRYA 5K9FA 2DEIA 2WK4A 3CJ3A 5G0RB 5LY3A 4P75A 2E7XA 1VBZA 3PM9A 5D77A 1Z25A 3SV4A 4MH8A 4ED3A 4IH7A 3G96A 1RWXB 2QWQA 4O8UA 4MTPA 3RYLA 9ATCB 1Y9OA 3IWXA 2NR0A 4CZLA 4BC2A 1S1XB 2FPHX 1SS6A 2D69A 1HNZJ 2GO8A 3PACA 5U47A 3CT9A 4OZ3A 1RBTA 3PRVA 4A8KA 4MFBB 3A3PB 3FFIA 4GVEA 4OX9F 4QYZJ 4HVZA 3NGIA 2P9KB 3UKRA 2QRRA 4A5AA 1VQ4N 1VQ8S 4AYBD 2CQ2A 4X65K 3ENQA 5KG6A 3NBPB 2XSFA 5HQMA 3J80Y 4DV1F 1MMDA 1EP4A 5L9NA 2HMIA 3HHLA 5CYQB 3V1OA 2BV3A 3NS6A 3CVKA 3ZTSA 3HK2A 3SBGA 3ONQA 4FL9A 2IC3A 1XBWA 3KK1A 2P6TA 4FWPA 1N36K 4H54A 2ZOFA 4P74A 1VQ4S 3C19A 4F2SA 1C0UB 4DV3F 2CPXA 3FMBA 9RUBA 3RVCA 3CJKB 4MQ3A 2Y1JA 4A47A 2WVCA 3T9NA 1SC3B 4CHZA 3D1HA 3RBXA 2FSKA 3V4IB 2CQ0A 4WTYA 1DHMA 3GILA 2CXEA 4DR7K 1G15A 1AFIA 4C7QA 3IS9A 3DM2B 3BV8A 3GG1A 4DG1B 1WC3A 4X62F 4AHTA 5F3ZA 3UI3A 5CQGA 3U9ZA 3PXGa 2HMPA 5BREA 3T5KA 3BSOA 5F0XA 2HVIA 1JCFA 4R0JA 4NI2B 3KD1E 2FVRA 1MN7A 4Y28C 3D67A 2GIQA 2CJKA 4JD2B 3T7ZA 1NGGA 2AV5A 2KVIA 2ZJRL 2AX0A 3RB0A 3VENA 1LEOA 3VTIA 3H1QA 3E9LA 3T1HK 5ETQA 4FM0A 4K5RA 4N47A 5IZHA 3JTPA 5MLCQ 5TKYA 2JEGA 2UXDJ 1D4XA 3BO4A 3VA3A 3HT0A 1XMOK 2W1BA 4C4WA 1NSKL 4QZVB 3FNNA 1V3SA 3KUGA 1JXVA 4PPZA 1M5VC 3O4QA 1SJ3P 1F3VA 3MDFA 2F1FA 1FERA 3AJDA 3B6BA 2W4PA 2IRXA 4OLBA 3EDQB 1CJTB 4ZJLA 1YAGA 4IKFA 4HACA 5AJ3K 2IIHA 2CZ4A 1IBKK 4USKA 2ACMA 2O1PA 5JVGQ 2MKHA 6FD1A 3KLIB 1OWXA 1RBSA 2HFSA 2I5JA 1H74A 2YWFA 3WNHA 2ZKUA 1C0GA 1XWLA 2HNYA 4DUYJ 1VQLN 1VHIA 3QWUA 1JKHA 4OZ5A 3OD2A 1RI7A 4O0JA 3OXGA 1E6VB 3ZSZA 4BGAA 4BRIA 5T14A 4AL6A 4FP9A 4IO9Q 1LNQA 1RJJA 5JUMA 3CCMN 2VA2A 1LWEA 2VJUA 4HWIA 2XCPA 2YNIB 2JVOA 1KS2A 4CZHA 4XH1A 4PXEA 2QSFA 2RQCA 3VWSA 2R7TA 3SQGB 1LCUA 4WU2A 4JV5F 4ILJA 2GCFA 2OZMA 4J9UE 4NYNA 4DN9A 3LDNA 3GLJA 4CI0B 2QTDA 3FCVA 2A2CA 2E2OA 2PGCA 3NLCA 3GIIA 1TKZB 3RMBA 2XI2A 2G0IA 4DSFA 1SKWA 3BBCA 3CF5L 2CJ9A 1JXBA 1MWZA 3JSBA 3FSIA 3DOLA 3UN2A 4FO0A 5DMRA 3K9JA 2AYMA 4NCGA 2Y1IA 5BYSA 2YHXA 2MZQA 4O3QA 3IP0A 3OYKA 2GVDB 1VQYA 2RE2A 1J5EF 4HEA9 5KFMA 2XY6A 4DQ8A 1K8KA 4RNOA 2VA3A 4MKVA 1KTVA 1CJUA 2FYXA 3N79A 4LBPA 4YNQA 2J8AA 1PJ7A 4X64J 1RLDA 2V0NA 2N3OA 2NUBA 1KOHA 1E6YA 1LXJA 4WCEQ 1EETA 3S7RA 2LEBA 5IV4A 3BR9A 2DNHA 1C0TA 3W66A 1OY6A 4AILC 2HFNA 1N48A 1FKOB 1HNXJ 2G13A 2CPFA 1LXNA 1ATSA 3O9TA 2ATLA 1QQCA 3HHLC 1NGHA 1DY3A 1KEKA 2GX9A 1U49A 1RA6A 3UD3P 3BKFA 2FC0A 3UWTA 5C24B 1NHVA 2F4VJ 4BQZA 3HFVA 2P9SB 5K8PA 3DRPA 3A1YG 1BISA 3SSQA 1Z6RA 2C2KB 2W9CB 5GAEI 1M1GA 1XHXA 1KNZA 3TTFA 4CDIA 1HNZF 1IWAA 2GVZA 2BM1A 4JKHA 5ETPA 3UKUA 2P9LB 3HM8A 4CGDA 3QLHA 3OFFA 3RWUA 2PEHA 3VQPA 1A0OB 3GSIA 5AT1B 1HBUA 3EKUA 2P9GA 2DJWA 3LP2A 1D8YA 3O3HA 2BANB 3PEJA 2QA4G 2EFNA 2W8KA 4W98A 1KQKA 4URGA 2V8PA 5J2PB 4OYIA 2VBWA 1C4CA 1RT7B 1X9MA 3K5OA 2JRSA 4WYBA 3PG9A 2GA7A 3WC2A 2V5HG 5HMXA 4DR4K 2Q0RA 3NMAA 4QWEA 1ZM4A 5C2CA 1ZOTA 5DO2A 2P9UA 1RAIB 1UVMA 3WXLA 1IKVB 2ZF5O 1KD1T 3OW2M 2KJVA 5DG9A 2KHOA 4O44B 5A8RB 1Z05A 1Q95G 3B6PA 2XTJP 2OD6A 3KJQB 3UFCX 5T7LA 4FVMA 3H20A 1RBUA 2PA8D 2NRZA 2HYIB 4J9SA 2YWWA 2YNHA 4NLWA 2KLAA 1U1RA 1YTAA 3SBMA 4ZN1A 1YK9A 5ETLA 1UTAA 1GX6A 4ED4A 5B09A 1BDGA 4FK2A 1RT6A 1WHVA 4F4WA 5KFTA 4NB4A 2AQ4A 2GTDA 4CJKA 4BREA 2ZNZA 4YY3J 4GVLA 2HOEA 3M2RA 5M1FA 2G8UA 1N6QA 2M52A 1CLQA 5D0HA 2VIHA 2DBBA 1X4AA 3CSKA 2YH0A 3CD6N 3AOCA 4BRHA 4W5NA 2UXDF 5FLXY 3O8MA 5IFMA 4F8RA 1KWMA 2EC2A 2VQFJ 2X6NA 4LC9B 2Q3PA 1KOOA 1X7VA 1VSLA 2YJEA 2XY5A 3R5GA 3V5RA 2B6AA 2D5RA 2PMHA 5HMWA 4UY85 4BG8A 4P2XA 4A8MP 2L41A 4ZVPB 3C94A 2PDAA 2BW7A 3THTA 3T5LA 3DRRA 3CD6S 2PN6A 4EK2A 2DCUB 2Q0UA 2IDLA 2R7QA 4G9ZA 1S0NA 2ROEA 5T41A 3PTWA 3RMDA 4PQUB 4BC5A 2R8HA 4DX6A 2E88A 4YFUA 4IR1A 2VFTA 4DUYF 2X1BA 3O3GA 2LSNA 4NYPA 2G1HA 1Y5NB 4DTSA 2DXFA 5D6GA 2XYPB 3SMPA 3M6UA 2RILA 5C0YA 1Q7YO 2FTRA 4WQ4A 3LALA 3O9SA 2OTLN 4KJIA 4DOZA 3TP2A 3M8SA 1YJTA 1H7WA 3K58A 5KG0A 1Y3KA 1RWUA 3VZIA 3L95X 5GMKa 2FF3B 1RKIA 2P9KA 3P38A 3GFZA 1R0AA 3H90A 1GK8A 1GLJO 3OLBA 4LMZA 5FRNA 3NBPA 4ZOSA 3AODA 3FE1A 2I7NA 3KDNA 3EEQA 1PC5A 3T6BA 4ES3A 5GAHU 2CQGA 5FPEA 4CIGA 3BGRB 5CYQA 3I87A 2ZD1B 1X3MA 4FXVA 4WFAQ 4CWBA 4JK7A 3KTQA 2HHVA 1ITGA 2KN4A 4X64F 4FLYA 3KLVA 1N33K 1WUUA 4TNOA 3WDOA 2RU3A 4DQPA 1TL5A 1WC5A 3VAGA 4FJNA 1UMJA 1S9FA 3CJKA 3MGJA 3IMXA 3GIRA 2UU9K 4FM1A 2DIVA 1HKAA 3I9ZA 1RHRB 4MKAA 1HNXF 4ZVSB 1GH8A 4B1XB 2F63A 3V4IA 3SAFA 4A46A 1KTQA 4QOZB 4WFYA 1OPZA 4ZJQA 2R3VA 4C8YA 4WFBQ 3DM2A 4DG1A 4DV5K 2F4VF 1U1MA 3KHGA 3EJMA 1KSPA 4FYYB 1CZAN 3G71N 4Y3CA 3A8KA 1M5SA 4CNYA 2KM8C 4NI2A 3NF6A 3VVUA 4BRKA 3I33A 1KQGB 1OMSA 1OVYA 3NNCA 4NA1A 1QVFM 1XR5A 4JD2A 4B9VA 3H42A 1WI8A 3P96A 4L72B 2PZSA 3M8WA 2MQOA 4OI6A 3QB0A 3FRZA 3B78A 4QWAA 4KH1B 1IR0A 3N4PA 5GAHP 1HJRA 4OX6A 1WHYA 1SC1B 3TSQA 3VGKA 4YS2A 2D41A 3PSIA 4JI8K 1HBOA 3ZSXA 4O3RA 3A12A 3FCHA 2A41A 4CNZA 3A2FA 3R6MA 3BR8A 3G86A 2IMOA 4FW2A 4I67A 2P8IA 2K7KA 3P6YC 4ZVTB 3VF2A 4GRSA 3Q8YA 1OPIA 1XQIA 3OYLA 3MZIA 4C8NA 4H0YB 4NE9C 4AXIA 1TL1B 3SNNA 1MWKA 3OHRA 1D9DA 4URSA 1GFWB 2V52B 4M7YA 2F5GA 3KLIA 2IS3A 2E5IA 4PYAA 1IBCB 3R97A 3UR0A 1NHKL 5BR8F 5JS2A 2LKZA 2IVOA 4DL6A 3FBEA 2C2OB 5KG4A 2UXBJ 1XC9A 3KG4A 3OTBA 1E6VA 3UVJB 2J0WA 2VBYA 5CZ2A 2FHJD 5M1NA 2OH2A 3NGZA 2FUG9 3CJ5A 1KLMB 3V81B 5KFNA 1RAJA 4FNHA 1S9EB 3DCAA 4USTA 1GOAA 3EZWA 3SUQA 2W8LA 1T95A 4J7CA 4Z94A 2BGGA 1XMBA 4BDPA 3D66A 3SQGA 1OSCA 5JICA 2W7AA 5IWAF 1MG7A 4JEPA 1LW2B 4ZPWR 1GMUA 3GIJA 2HFVA 4Q8FA 5CY4A 3DLBA 2ZM6K 3EICA 4MIBA 4Y6IA 4B9MA 1K0TA 4ZVFA 2C28A 5KG2A 5EDWA 5FIIA 4YY3F 2AZ1A 1LWFB 1TKZA 3LPTA 4FYVB 2NREA 4I4BA 4N7TA 4DFMA 2GC8A 3JTNA 2EK6A 4ID5B 2FD2A 3TWZA 2XQCA 1RT2A 2AIRB 3PX4A 2EBGA 3CCRN 1TKXB 2UVWA 4WQ4C 5JVGL 3QT7A 3FEYB 1NK0A 2YJFA 2F4FA 1FFGB 3MN5A 2BQ3A 3NRBA 2VQFF 4CLUA 3AOBA 3SCJE 4JHDB 2BE2B 1I1GA 3BQ1A 1GXLA 3H4BA 1JLEB 4JS4A 3L2WA 1NUEA 4DTXA 4PWUA 1DKGD 4FXDA 5D0RA 4IO9L 1FKOA 1X4CA 1K1SA 4OPAA 1B99A 4H5VA 2HURA 2A6MA 2I7PA 3KJFB 2KT2A 3BS9A 2MHEA 4CO1A 2MJNA 1FVSA 3T5JA 4IZ9A 4DS4A 4LH4A 2IVNA 3C66A 5EN1A 4LRDA 3UR3C 2P2CB 3GJRB 1S49A 3NVMA 1P1LA 1YHQN 3QPIA 3NGDA 5E2QA 4HTLA 4CT9A 1RAFB 4N8OA 1FRIA 4NZ6A 5KG5A 2H5IB 1SUQB 2GW8A 5EXWA 1WSGA 2HS0A 1SBRA 2P9CA 4GO5X 2WOMB 3A8IA 2DNQA 2HVEA 4DR6F 2IM0A 4CLZA 3HI9A 3T1AA 3DU6A 4X4PA 3P4UB 1NMEB 2P9LA 4MMOA 4JI5J 2WSFC 2F8MA 2V4RA 4DWIA 3OBIA 1YHQS 2QLXA 1FRMA 1BC6A 1H6KX 3D3BJ 3K57A 2EKYA 3J81O 3UE2A 3MUMP 3V6JA 4PA1A 2HZAA 4WCEL 3AARA 2CH5A 3M8QB 2HLTA 1FF2A 4I2QB 1YITN 2BANA 3GL1A 3POTB 1WACA 3MEEA 1BUPA 4CZMA 3ZEUB 5KPRA 1RT7A 2KFNA 2ZOMA 4JKDA 1IKWB 3H6EA 5C42B 1U8WA 1PGZA 1HQEA 5JXSA 1S22A 3UCUP 4I6WA 5BYQA 3RW6A 4DPXA 3V1QA 2LU1A 5B0DA 1RAAB 3MWBA 3HYFA 1XNRF 4X4SA 3JS6A 3MMAB 3NCPA 1IKVA 2HQCA 1MN9A 5B0CA 2IGIA 3CJCA 4O44A 2ASOA 4L3KA 4CO4A 5C10A 4DUZK 4BACA 3CFPA 1NGFA 2DR8A 4PABA 2COLA 3D2WA 4XTTA 4C3LA 2F9JA 4CLYA 5HL7Q 5DGAA 4RW7B 2W42A 1HW8A 4DZ6A 3VEZA 4P2SA 3QRPA 4E7JA 2XC9A 4PUOB 1NK4A 3UQSA 1BD6A 1WAFA 1RT5B 2P9NB 1SJ1A 2K3IA 2CQ4A 2AGOA 3HPOA 1YDLA 2G2OA 2OPRB 4NXNJ 4K4ZA 2I8EA 3FZBA 3IFEA 1YTYA 1IQZA 4FVUA 5D0EA 5KTQA 3KK3B 4ILHA 1VQ5N 2RNEA 3H45C 1A7GE 5D0GA 3EDRB 2O5DA 2VFVA 4PKGA 1H2UX 4ZHRB 3HXMA 1QTMA 3PO5A 1SXLA 2V6AA 2PIIA 4CFAA 3QEWA 2MZTA 4KGKA 2BQUA 2R7XA 4NLTA 3E66A 2YWGA 4JKFA 3NGSA 4ELTA 4CJQA 2FLOA 1OS5A 3R5BA 1HNIB 3FKBA 4MIAA 1RQ0A 2VOPA 2M3DA 3GFXA 2Q6BA 4ZLJA 3I8DA 4CLTA 2BZ2A 3G25A 4IOBA 4PQUA 4CCHA 4C98A 1VBXA 1EWQA 1WEZA 4DR2J 3WXIA 1HLUA 2B4UA 2F7VA 1ZM2A 1TUGB 4AH9A 1S3XA 2CQPA 3OR2B 4OI3A 3D0GE 2LVWA 4FF4A 4BE0A 1W2BR 2UXBF 2YWEA 2KZZA 1MROA 1UFLA 2H48B 3J7YI 2V69A 4GC7A 4CH0S 4MAKA 2VICA 4J9KA 3SCXA 5A0YB 5KFDA 1NJIO 2AZ3A 1R27B 5E7OB 1GLAG 5DDRC 2IVMA 5J2MA 1WF1A 4BRCA 3OYNA 2NRHA 1F9FA 2B3TB 5E33A 3NH1A 4C3MA 4A4JA 4QU7A 3OLAA 3AVFA 3ZT0A 3ALYA 1T7PA 3AA5X 2XMAA 4J2DA 2CQIA 2NXJA 1BIZA 2QXFA 5E3AA 3MR2A 3DRXA 3I5BA 4NEZA 5KFLA 1RAOA 2H3GX 1UJ6A 1VHXA 3BGRA 2ZD1A 3HVRA 4HVJA 3Q24A 2CQ3A 3M6XA 4LFAJ 4M3RA 2X7IA 4NMLA 3A0IX 5KFFA 3ZX0A 4IQXA 4NASA 1ZBUA 2FLPA 2NUUG 2AGPA 2B0GA 3GPAA 3CE8A 3CDAA 2LA6A 4JRPA 1N32J 2JWKA 4JI6K 2MXYA 1IR2A 4EFAC 2W9BB 5AXMA 5M2RA 4WIQA 4JB8B 1GTEA 3CJTA 3DOKB 3J8AA 1VJWA 4CD1A 4DV2K 1EQYA 2NS1B 4DDFA 4RUBA 1RNHA 3TVZA 3ENWA 2YI1A 1GX5A 1B0VA 2C3MA 4IDKB 4DLEA 2IRYA 1F6TA 2Z2LA 3VESA 3CGIA 4WKRA 4EWTA 3H7HB 2BE7D 4OX7A 3I55N 3R6LB 3VTHA 1R31A 2HVZA 3CCVN 5LXYA 2MKSA 2OELA 4B3SK 4R0EA 4DCHA 4JI5F 3CC7S 1WG1A 4WFAL 4K43A 1S6PB 3TEHB 2XLIA 1SKUB 2WVFA 4X4TA 2HHXA 2V4JB 2P5GA 1AUDA 4IOXA 2RQ4A 2HBYB 3H2VE 3CCVS 3JTOA 5GIPA 1GLEG 3A5LC 4USVA 4DFJA 2GAGC 5G4DA 2UYTA 1M5PC 5LSRA 3PW7A 3OXFA 3CIZA 4ZPVR 4WFBL 1S9GA 4RNFA 3BP8A 5HQ8A 3V2UC 2C3OA 1TAQA 3DHXA 2A1SA 2M9KA 1URRA 1H2VZ 4GKJK 2RD5C 2NYIA 4ZVQB 1SC6A 1VC6A 2CADA 1FWLA 4IG0B 4DTUA 4A62A 2U1AA 1JLGB 4EMDA 4KYZA 4YDXA 5F9LA 4BRPA 3CCTA 4CEEA 1CC7A 2HQGA 1FEHA 1N0VC 3HDSA 2R7UA 2F8SA 4TVAB 1TAUA 2QM1A 2GMHA 1XMQJ 3J80O 3UVJA 5MAOA 4MKYA 3ZC4A 2W4CA 5AFUA 1KLMA 3V81A 2QTWA 1S9EA 2BRLA 4D3HA 1Q16B 4ZDNA 4LREA 1EKRA 3QT6A 4LF9J 4TLQA 4B3TJ 4MKBA 4ER8A 4UT4A 1LW2A 5HAOA 3G82B 2PMZD 3JQJA 3R1XA 1YRUA 5LMNJ 3IDHA 3L2QA 1LWFA 3MHYA 2JOQA 4CI6A 4CJVA 3QDKA 4Y0FA 2AP6A 5LJWA 3Q7BA 5GADU 4NXNF 4CERA 3E01A 2DR5A 2W40A 1TKXA 3ISND 3W9HA 4FF3A 1T0TV 1KN6A 1IO2A 1ASWA 5CCLA 1DZ5A 3CG7A 4K8XA 3WXKA 4JBCA 5LL6Z 4JHDA 2BE2A 5BN9A 3NVKA 2QV6A 3LDOA 2JVRA 1PAEX 3IGVA 4B3RJ 3N9UC 1JLEA 1JLAB 1Y3JA 2HS3A 4X4OA 1LW0A 3QNOA 3KLEB 4ZPAA 3GFYA 4NA3A 4IFVA 5TKWA 3Q8VA 2UVUA 2FHMA 2EFOA 3KWMA 1M1KO 1RTIA 2Z1HA 2DNOA 2GV1A 4KPCA 3BYRA 3O1WA 3L9ZA 4Z7YA 3ZZTA 3P49B 4ATNA 4DR2F 1BG3A 3CQ8A 3PRDA 3BGUA 3EGVA 2DH7A 1VQMN 3FSXA 1SUQA 3ET6B 2ZZTA 3AQPA 4BR5A 2MGZA 3UD4P 4MO5A 2WOMA 2PA3A 5IT0A 3TA2A 4B02A 3QYYA 2HQDA 4I0WA 3EVMA 1D9FA 1XNQK 4Z4FA 1RTHB 5AQTA 2O8FA 3M2VB 1AA1B 1U02A 2CDQA 3EGZA 1SVDA 3N5FA 1VQMS 4CW7B 1QY7A 3SQOP 1WNEA 5GADP 1R8BA 4LF6K 3GB0A 2D1CA 3M8QA 2P51A 4KREA 3NS5A 2DHHA 4JV2A 3SQ0A 4BRNA 3AAQA 3FSYA 3KOAA 3POTA 4NLYA 4J9NA 4CGIA 2QJ3A 1Q5YA 4DSJA 1IKWA 2IAJB 4M5NA 5C42A 4OYPA 1HFEL 4LFAF 3G9CA 4HI2A 3VQ8A 4RWWA 4B9SA 5H9FK 4ED8A 5BPNA 4GMKA 3IG1B 4IBNA 4K50A 3MMAA 5CZVA 5F8JA 1N32F 2EWHA 2RE1A 2RRNA 4L75A 2AGQA 3VQQA 1M5KC 2VJVA 4MT1A 2JDJA 1XN9A 4J8FA 4ZPDA 3QEIA 1BIUA 4X65J 1JJ4A 3CJAA 5JLFA 4BC7A 3EVOA 2EVZA 3U02A 3DXMB 5EGYA 2XY8A 4M41A 3FBFA 3HP6A 3OYAA 1DQ9A 1U2VA 1YJRA 4PUOA 1QJHA 5C25B 2HWTA 2ZOGA 4NLGA 1YQHA 2UVRA 5KGXA 2DY4A 5E3PA 2XYHB 1V3RA 4EBDA 1RT5A 3M4XA 3D2FB 3JS9A 5DS7A 2P9NA 3QGGA 4UY8O 4CZCA 1NK7A 5IC4B 1M1KT 1J53A 1N36J 1VQNN 3US5A 2AKWB 4USMA 3KG1A 4K2XA 3CXCM 1U24A 5FRMA 2OPRA 2A6AA 2OPSB 2YBVA 1RSCA 4FJXA 1CXUA 1NDKA 3PX6A 4BE2A 4CEDA 2SXLA 3KK3A 1DGKN 3PW0A 2BYCA 4N8NA 4OJRA 1A5VA 3MXIA 2J7UA 4ZHRA 4G1QA 3C2PA 4JKGB 3PO4A 3E3XA 2RB7A 3ILLA 3GQCA 2WVEA 2XHCA 2DNYA 2DVIA 4DR7J 3J7A1 4MYTA 3DXSX 4MLEA 4FXWA 2R2RA 1VSJA 3P1GA 1N52B 4WP3A 3TTDA 5H1SQ 3CD5A 3OPKA 4OIXA 3TAFA 5F0WA 3FQKA 4KB1A 4BC9A 1QAXA 4E89A 2HHUA 2IVPA 1HNIA 5HL7L 1RU2A 3HL8A 4ZCKA 4K2JA 1YJVA 3QICA 4H0VB 1U47A 4R25A 1U04A 3WQUA 1MMNA 1X9SA 1VR6A 3HHDA 1WOPA 4IWVA 2D9OA 2W2OP 2QWOA 2CPHA 1OIAA 5K8NA 3MR5A 3SK3A 2DNGA 4UOFA 2KW4A 2FVQA 3OR2A 5D78A 3W3DA 1TYQB 4GV6A 3KLFA 1N56A 3T1HJ 4DQSA 4Z4CA 3PJ9A 2KQ2A 2NRWA 3BREA 4DQRA 1HQ2A 4JI3K 2QWMA 2A6OA 1S0MA 5A0YA 4CJSA 3SCKE 1UW4A 3LDPA 1XC3A 1NK9A 4RWXA 1XMOJ 4OHVA 4KRFA 4ZVGA 4JI7F 2N82B 1SQGA 3KYLA 3U1NA 2KKHA 1RYSA 1R6YA 2ZH8A 3T41A 3DDKA 1VBYA 5LMNF 3MDQA 3SJJA 4ECQA 1RE1B 5AJ3J 4X4QA 4OYZA 2IYGA 1IBKJ 2BKPA 4KBOA 2B9EA 1ZYQA 4J9MA 2X3GA 3MD3A 3D45A 4DHYA 5CABA 3TSUA 3ENVA 4JRQA 5KFPA 3M9OB 3OYDA 3CFRA 2OA8A 3BM7A 1VQ7N 1LFWA 3O6WA 3DGVA 7AT1B 3HVAA 4OI0A 4AQYK 2IJFA 4B3RF 4O3NA 4J5OA 3VCDA 5AQRA 4LF8F 1ZZNA 3K5LA 4G1IA 1UEUA 2R7RA 3DOKA 1S6UA 3M8PB 4USIA 2NLWA 3G6VA 1HL6A 1VQ7S 3NH2A 2FHJA 3QATA 1YJ7A 1NK6A 5LJVA 3C15A 3JAMY 1ZBHA 2G1DA 4IDKA 1BLUA 2D0PA 5FLXO 5HO4A 3ICLA 2DRAA 1Y7PA 4JI0K 4IRCA 1XTZA 4L73A 5F3TA 3U7JA 4YOVA 4DTMA 5SWMA 4FYWB 3TAMA 1J2VA 1FD8A 5BRHA 3Q8RB 3NAIA 4NLCA 4Y2MA 2BDPA 1EZZB 1GLLO 1MWYA 3ZNUA 2XS5A 2UP1A 4KTQA 4ECVA 1DT9A 3PW2A 1ZS6A 5GIOA 1T9TA 1QQMA 2CVEA 4FLTA 4NLSA 2E29A 2V4JA 4M5HA 1KDNA 4B1WB 4H4MB 2RKIB 3KHLA 3ZT3A 1VSIA 4ANEA 3KK2B 3NL0A 2O8EB 5HVGA 3IRXA 2OKQA 4F0HA 3LQVA 1S79A 2E2NA 3VN5A 2OIHA 4WE1B 4I6MA 1S76D 3HJFA 5CZXA 2E1ZA 1SIZA 2QMXA 2Y0BB 4LSZB 1ASUA 4N56A 2VG5B 2VFSA 1JNZB 3NMUA 4FLXA 4GKKF 4FK4A 2M2BA 4OV1A 4A8WA 1WDTA 2IM1A 1JLGA 4C48A 1F1BB 1RT4B 5B8HA 1WSJA 1NDLA 3GYGA 4PG6A 3V9XA 3FLCO 2G8KA 1NB2A 1FDBA 3ZSQA 1TGOA 4ZTJA 5M2PA 3KJVB 4DPUA 1FDDA 3PJXA 5D3GB 4XK8C 1ESVA 5KGWA 4B8AB 3H8YA 4DU8A 5DZ6A 4DR1F 1S1UB 1HYZA 4HDGA 3N5BA 3THXB 3D0PA 3MTJA 4Q43A 4M5JA 4DBQA 1RBLA 4C9DA 2MSSA 2G4BA 2PE8A 2PBDA 3OBYA 2KYXA 1RHQB 5I3UB 4G65A 3LP1B 3AFGA 4P10A 3G82A 4CHYA 4AHVA 2WFBA 3G6EN 1Z2LA 2YNGB 1KFSA 1D3WA 3VVTA 2MLXA 3CNQP 3ZTRA 4DR4J 1S48A 4UTGA 3LP3A 3ENAA 2NSBA 2RUGA 3AB2B 3MECB 4H5RA 1S10A 4C97A 4ILRA 3KK7A 3RBEA 5AQMA 3PR4A 3Q8PB 2DY1A 3HLUA 4OZ0A 3NGKA 4CHNA 4QOTA 5D15A 4Y00A 4K0KK 3DKDA 3L3CA 3V9ZA 4B9QA 1U1PA 4KBIA 3L2VA 2B4PA 2O4IA 4AM6A 2MQ8A 3EPGA 2P6SA 2X1FA 3MXHP 1TV6B 2ZZMA 3T9ZA 2DHXA 1RADB 4JAXA 4DV3K 2YPZA 3R27A 3L6QA 3QBWA 1PG5B 2DKOB 3CJ4A 1SJ4P 3PKMA 4ILLA 4LVNP 5KQDA 4P72A 4QS8A 2YHAA 4FZXC 4DXLA 1VBKA 1SH0A 3DXKB 3PDNA 4I2PB 5ETSA 3M1FA 1RHMB 2Z2YB 5L1JA 3K5NA 3DLEB 1QTNB 3LAMA 4KE5A 4DB3A 2QMUB 3IC1A 3L3UA 2MZRA 3V1RA 3OVNA 1U0HB 4WK1A 3T1HF 5BPLA 2GFFA 3HBTA 1RTDB 3C6UB 1NH8A 3GR0A 3HHEA 6FDRA 3QZ8A 5KT4A 4S0MA 2ROGA 3M2VA 4OLAA 1XMOF 5CYMA 4CLWA 1TVRB 4R8UB 3GV7B 2CPEA 4KV8B 2V9WA 1P9YA 4C1NI 3ZO7A 3F41A 2ZITA 2FB0A 1QUPA 4ZPCA 5AJ3F 1VYAA 1T9VA 3R5AA 3OYCA 2VODA 1CZBA 2MZ1A 1Y00A 1IBKF 2IIRA 1NGBA 3Q2SC 4MDAA 2JEFA 3M2UB 4G6VB 2P1JA 3ZSWA 3TJ8A 3ENHA 3EZUA 4FS2A 1F5AA 3DI6B 4CIFA 2Q6CA 2J7WA 2MQPA 2IAJA 4DV4K 1FCAA 5F8HA 2K1RB 4M3YA 4OJHA 4OZ1A 1NJYA 4A8FA 2V63A 4BR4A 2OMOA 3GZ7A 3C8YA 4RUHA 4V19S 2YH1A 4ECWA 2FC8A 4KFBB 1PCAA 4CO2A 4CK1A 3G0ZA 5JLHA 4TYAA 4ELUA 2A10A 1S72N 5KFKA 1REVA 3VQAA 2FJVA 3O9RA 3DXMA 1VRTA 1IWGA 3MCOA 2DPNA 5L39A 1NMDA 3SXLA 1K47A 4ALZA 2Y8WA 3PZPA 1U6BA 3FFKB 1ZBSA 2ZHBA 3D2FA 1YRTA 2AP1A 3C65A 3NAEA 2Q2RA 2AT1B 4BE1A 2ZHOA 1G1XA 3ILOA 1N4LA 4OYXA 5E3QA 2E9ZA 1WC6A 3HVWA 3NHGA 4O5BA 4BCAA 3ASMA 4LQ9A 2ZJPQ 3NEKA 2ITMA 2FHKA 3O4NA 4U6PA 1N33J 2OPSA 3V9WA 2OANA 4QW8A 2DY9A 4NCBA 4CGGA 2ADCA 4KO0B 4BROA 4H5TA 2UU9J 2VQEK 1CBKA 4JKGA 3CJSA 2NXCA 3C3LA 4TQSA 3OL7A 1ZXOA 2MY7A 1S12A 1O51A 3E9OA 2YVSA 5ADXH 1ZBTA 3CB4A 5DLFA 4DLGA 1ACMB 4DV5J 2HF3A 3WC0A 2E8AA 2E9RX 2OPQB 1MU2B 3EY1A 5AXLA 1Y10A 5IC6B 4ETXA 2LCWA 1ULRA 2HMIB 4P2FA 4E1NA 3BKUA 3I4HX 4Z4EA 2RT3A 3W3SA 1OJ4A 2D0OA 3CCLN 2GAHC 1ZM3A 5KOWA 5GAEU 4RNNA 1JJ2R 2IC3B 3KK1B 5AXKA 5DG8A 2BBEA 4FNIA 4ENOA 3UDVA 3I4PA 3GDQA 3MPDA 1VSEA 3FRYA 2LEPA 1FNMA 1FEEA 1K73T 3W0LA 2RHQB 1CQMA 4HYKA 3IXQA 3CPEA 4MYUA 3CCLS 1YGYA 3HULA 3C6HA 4JI8J 3IS9B 4PHTX 5D4PA 2YPYA 2CJBA 3G8SA 5IV3A 3QRRA 5DETA 2HBJA 3ENBA 4F4ZA