4I7FA

Hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and biological evaluation of phosphonate analogues of nevirapine.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase
total genus 153
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i7fA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i7fA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i7fA05
2UUTA 4TYAA 2B4JA 3M8QA 3SUOA 1S10A 3PJWA 3TABA 3HL8A 1RTIB 5JS2A 3KHLA 1SH2A 1RT5B 4OVLA 3KD5E 1B9FA 3ZT0A 5EUHA 3S3MA 2QKBA 3FSIA 1ZBLA 1LWCB 3OYKA 5KFGA 4KHWA 1HJRA 2W7OA 3EY1A 2ZE2B 4DSEA 4KRFA 4KBIA 2XO7A 4AILC 1LAVA 3EYZA 3CO9A 3SFUA 3KLFA 3QEIA 3TAMA 3DRSB 4DWIA 4HUGA 4O44A 3V4IB 1S6PA 1QQCA 2VG5A 3BSCA 5HRNA 1RTJB 4NCGB 4ED2A 4URGA 2ILYA 4ID1A 1T05A 4E3SA 3QGGA 4B9SA 1REVB 4LSNA 4KTZA 1IKVB 4QW9A 1VSEA 2F96A 1MU2A 5KG4A 3H08A 1QAJA 4W5QA 3LPUA 1SH3A 3VQ5A 3KLFB 5L1JA 2ALZA 1LW0B 1TV6B 2JEFA 2D0CA 3D28A 3BJYA 2DFEA 3MEEA 4E7KA 2VWJA 1DTQB 4CJQA 2XCAA 3P83D 1T94A 3PR4A 4ELTA 4CEFA 1TL3A 4AHRA 1EXQA 4CGHA 4IG3A 2XCPA 2WOMA 3QETA 3ZSRA 4GC7A 3DDKA 2R2RA 1FKOB 3PO4A 4ECTA 2C2RA 2A1SA 4RNFA 1NJYA 2OPPB 1QS4A 4J2AA 1D9FA 2RKIB 1WSJA 4TY9A 3K58A 3BGRB 3M9NB 1Y97A 4FJXA 2R2UA 3OJSA 4C8KA 3OYGA 1VK0A 3RMBA 3K5LA 3H4DA 4YFUA 4JV1A 5F8JA 2R8GA 2XRIA 3C6UB 4KV8A 2IC3B 4Y3CA 4O55A 3VQPA 4DTPA 4TSXA 3OLAA 5KGXA 1S9GB 3D0PA 3RAXA 2BRLA 4F3OA 3UIQA 4K4XA 3CIZA 1JLBB 4IH6A 3RTVA 4IFVB 3MF5A 3G0ZA 4CEBA 3NAEA 4PQUB 1L5UA 4FJ9A 2O5DA 4R8UB 2QK9A 3PW4A 4FLTA 1X9MA 3DYAB 1ASUA 3AVJA 4XO0A 1S1WB 2JLEA 1REVA 2UVWA 3PZPA 3B6PA 1BL3A 4FLWA 1NK5A 1BQMA 4EEYA 4MK9A 3VQEA 3DLBA 4J2BA 4W5TA 4KHRA 3NF9A 2VG5B 4MIBA 3LPTA 1QSSA 1KRPA 3T5JA 4O3RA 2OPRB 4QAGA 3KK2B 1NK8A 3QINA 1S0OA 5D3GA 4DQSA 4YR3A 3NE6A 4OPKA 1RT5A 3QLHA 3EPGA 4J2EA 1TV6A 4CJSA 1RBVA 4QW8A 4DF8A 1QAIA 4M41A 4NCBA 5L9XA 1NOZA 3MR2A 1HYSB 1IKVA 4B9TA 4FM2A 3NGDA 3K2PA 3KKSA 4O0IA 3THVA 4RNHA 4E7JA 3AVCA 5F9LA 3BSAA 1D9DA 4ED8A 1N4LA 1KLMA 4IFVA 2ZKUA 2YNGB 3G10A 3NBPB 1B9DA 4KB7A 2E9TA 2YHBA 3WNFA 1S1TA 4RZRA 4B9VA 1JLQB 4ECUA 1S6PB 2D41A 2NUBA 2IAJA 5CZ1A 2HMIB 3H4BA 3RB3A 1UA0A 4PWDA 4FJHA 2D7SA 3CJ3A 4N56A 4H8KA 4FS2A 3RR8A 3KJVB 1DTQA 3OYLA 1BCOA 2GIRA 3H59A 1J53A 3HHKA 4C8MA 3QZ8A 4HCBA 5KT2A 1EX4A 1S9EA 5KG7A 3OYAA 3GIJA 1SV5A 2V4QA 5KFFA 2A1RA 3HJFA 4KHMA 5DG7A 3QIOA 4CEQA 2OPPA 4NLSA 2XHBA 5J2PA 4RUAA 2IGIA 2WK4A 1HYSA 3E01A 3TWHA 3RWUA 5KFYA 1YVUA 1CXUA 2JEIA 1TK0A 2W9CB 3Q8SB 3AO3A 1DLOA 3NAIA 1KCFA 2VG6A 3DLGA 5KFRA 4F50A 3T5LA 2KZZA 2B6AA 4KHQA 5HP1A 4NRTA 3RAQA 2ASDA 3CFPA 4I2PB 3MEDB 3MEEB 4LH5A 2AU0A 1YTUA 4FBUA 2LSNA 5JUMA 4G1QB 3ICLA 2AJQA 2D0BA 4RW4B 5KTQA 4GW6A 4CERA 5KFTA 4DL3A 1XHZA 4JS5A 4TLRA 3GV5B 4IH5A 1MMLA 4KHNA 3V6HA 3MECB 4K4TA 2RDIA 1HNIB 1RYRA 5J1EA 2WONA 1W9HA 1S9FA 2O4IA 4J9OA 4FXDA 3BDPA 4LQ3A 1QSLA 3KIOA 3DMJB 2BQUA 3H5UA 4ZPCA 4CFAA 1C1CB 4KI6A 3K5MA 2XI2A 2YNIB 5FDLB 3PX0A 2IOCA 2YKMA 4OKKA 3T3FA 3ZT2A 2IC3A 4IBNA 2BE2B 2YNHB 5L1KA 2HNZB 3HVTA 1C0TA 1HQUB 4J9LA 3FDSA 1O1WA 3HPOA 4AHVA 2W42A 4Z4HA 4ECVA 4FVMA 1C0UB 5KG5A 4EBEA 3SPZA 1NK6A 3GIKA 1TAUA 2XC9A 4K8ZA 5C42A 4CGDA 3RMCA 1WAJA 2BE2A 4MK7A 2Z1HA 2OPSB 4KFBB 1JLCB 3I5AA 3KD1E 4DS5A 4M95A 5DGBA 3TR8A 3SV4A 4DL4A 3DM2B 1UAXA 4EYHB 4MH8A 2C28A 4RW7B 4Z4GA 3DLHA 2YNIA 1ITGA 2OPQB 4CHQA 1JKHB 4RNOA 4FLVA 3QNOA 4M42A 1WN7A 4FJLA 4I7FA 1KTQA 1IKXB 4GMJB 5HP1B 1WSEA 2V9WA 3V6DB 3O4NA 1QHTA 3NAHA 1TK8A 4DTMA 1HYVA 1N5YA 5DLFA 4JLHA 3CVKA 1BQNA 1RT2A 4I9LA 4WXWA 3NHGA 3RRHA 3DLRA 3MR3A 3IGVA 2F8EX 1A5XA 5DG9A 3QEPA 4CFDA 3HSTB 1RTJA 1RT6B 5F8LA 1KHVA 4K4VA 4ZVHA 4O0JA 3C6TA 2W9AA 3NGYA 3AVNA 2E9ZA 5K14A 4TY8B 2HB5A 2IS3A 4IR9A 1NK0A 4FS1A 5F8NA 5E41A 4NRUA 2FBVA 2IM1A 4EO8A 3MEGA 4O3QA 4ZTJA 4IQXA 1SL0A 1I6JA 3Q8PB 3M8QB 3MXJA 1S1XA 3SQ0A 1RT6A 1KVAA 3NFAA 5KT5A 4KPYA 3GQCA 2W7PA 3V6JA 1S1TB 4IOBA 4TQSA 4KAZA 2IM0A 4DTSA 4RW9B 1UOCA 4RW8B 4RNMA 2V4RA 5KFBA 1DTTB 2HNYA 4DL7A 2ZD1A 4CJUA 3F73A 2QKKA 2HAIA 3QO9B 3HVTB 2E6LA 4Q8FA 4B9UA 2R7YA 4M3ZA 4YMEA 4QWAA 3PW0A 3CDUA 5DQGA 2YNHA 5CZ2A 1S9GA 3LP3A 4NLUA 5KFOA 2FVPA 3GIIA 4J9PA 3QEXA 2QV6A 2OZMA 1RDDA 2OPRA 3DOKB 4CEOA 1GX5A 1C2PA 4K4SA 3L3VA 3N6NA 4FJ5A 1I39A 1Z25A 2HMIA 1XWLA 3NMAA 1G15A 3BR9A 4KREA 4J9SA 5J1EB 4WE1B 1T03A 1U4BA 3ZT4A 5C42B 1C6VA 4E7LA 4DSLA 3DOLA 1HNVA 4DQIA 4B9LA 3QESA 3OS1A 2ZD1B 1S6QB 3CJ4A 1CZBA 4DSIA 4CGIA 2HHUA 2HWIA 3CQ8A 2FBXA 3PX6A 1SKWA 4DSKA 2XWYA 2BQ3A 4J2DA 4DFMA 3GV8B 4DU1A 4H4MA 1QE1B 3OYFA 1N5YB 4ZP6A 4CIEA 2GIQA 4NLRA 2YKNA 1RNHA 2FLPA 1D1UA 1S1VB 1FKPA 3H5XA 5F8IA 4IKAA 4G1QA 3KLEA 2DY4A 3MR6A 4DL2A 4CJ4A 4RW4A 3SI6A 4CEEA 3DRRA 4ECRA 3VQQA 3ZSWA 1KVCA 3IN5A 3QERA 3VQDA 3QEVA 1LWEB 2VG6B 3DLGB 4IH7A 4EZ6A 4FJMA 4DQPA 2IM3A 3SI8A 3OJUA 3LAKA 4QOZB 3BQ2A 4OLBA 3OVNA 3OS2A 5KFIA 1SKRA 4RU9A 5DQHA 4R8UA 5EWGA 3L2VA 1NKCA 4IRKA 3CM6A 4ZP9A 3NH0A 3OYMA 5KFXA 2IBKA 1EETA 1JLAA 2FVCA 2OYQA 1VSLA 3ITHA 2EC0A 2ATLA 4O44B 1FKOA 3V1OA 3VQ8A 3AVAA 1HPZB 3LAMA 3SUNA 4WFYA 5C24A 4C8OA 3KHHA 3JYTB 1C1BA 3OL7A 1U45A 2AWZA 5SWMA 5FDLA 5C24B 1YVFA 2BQRA 1ZTWA 5KFPA 3OY9A 4K4YA 4NYNA 3S3NA 5L1LA 1RT7B 5KG6A 4IFYB 3HT3A 3QO9A 4NYZA 4FJIA 2HHVA 1LWFA 4RW8A 4NLYA 3L2UA 3LP0A 4IG0B 2DTUA 1TP7A 4CF1A 4DSFA 3CWJA 2KFZA 3LP2A 4NCGA 4TQRA 3CDEA 3RRGA 5KI6A 1HMVA 2PYJA 4GVMA 1FK9B 4WZMA 4M3TA 1WSFA 4OKJA 3HK2A 3QLHB 1SH0A 1VSIA 3ISNC 4DU4A 3VN5A 5EU7A 4FZXC 4E89A 3BQ0A 3OYCA 2FJVA 3V9UA 2O4GA 3HYFA 1JXLA 3I0RB 4G3IA 1JLQA 5K14B 3EPIA 4JUZA 5KFWA 2D3UA 1TK5A 4M45A 2OH2A 1NOYA 4FK4A 2J6TA 5KG3A 4CK1A 1T05B 1HQEA 3K5NA 1TL1B 4OL8A 3Q8QB 2XGPA 4BWMA 4JS4A 2ATQA 5KRSA 4AHCA 3LWMA 1WSIA 3TVKA 2R8IA 3HPHA 4CJEA 4FZZA 1X1PA 1J5OB 1S9EB 3PHEA 4XPCA 4JV2A 3K57A 1XHXA 1NHUA 3I5BA 2XGQA 2W8LA 1S0NA 3DM2A 1XR7A 4NLDA 3JSMA 1KFSA 4E7IA 5F8HA 2UUWA 4MK8A 1BQMB 3T1AA 4Y1CA 2HHSA 3FRZA 3T19A 3U3YA 4N41A 1JLCA 4KFBA 3QZ7A 5DLGA 2W8KA 4J9MA 1WLJA 3IAYA 4HKQA 2Z1IA 5FROA 4IRCA 1SUQB 2EHGA 4ECSA 4KO0A 4MFBB 4HCCA 4IRDA 1L3VA 4F4KA 1W0HA 4FM1A 3CM5A 4W5RA 5F8MA 4H54A 3A2FA 4IDKA 1JLFB 4ECYA 5KFQA 4FJ7A 2RPIA 4W5NA 1JLGB 3EZUA 4JV0A 1GOAA 4AHSA 4CE9A 1ZBIA 4NCAA 2DFFA 3P1GA 1TVRB 1NK9A 4DS4A 4K8XA 1VSMA 3KK1A 4FJGA 1JLGA 2Q3SA 4PA1A 4MQ3A 3AVGA 1LW0A 1NK7A 1U49A 4E1NA 4ICLB 1S0MA 4E19A 3ZT1A 3FFIB 3KLGB 3KNAA 1FKPB 4FW2A 3AO1A 4DTXA 2ASJA 5HBMA 5CY4A 3MECA 4MFBA 4L8RB 5J2QB 4FK2A 4KKOB 1D0EA 3I5CA 4CCHA 3LWLA 4NLXA 1RT4B 4FBTA 1RCHA 4Y1DA 4Z4FA 1Z26A 2BRKA 1ZETA 4DMNA 4I2QB 5HROA 4WE1A 2I5JB 3OYEA 4BE0A 4CJWA 4HTUA 1UA1A 3V1QA 1RTDA 3BQ1A 3TANA 4NLPA 3PW2A 3OL6A 4KSEB 4ZHRB 4J9RA 3ZSZA 3KOAA 5KFHA 4WXOA 4DLGA 3EZ5A 4WYLA 4U6PA 1A5WA 2R2SA 1NJXA 4KTWA 2OPSA 3ISND 3SFGA 3CG7A 2JC0A 1RA6A 4CJRA 2GUIA 3VQBA 5T7BA 1S6QA 3DI6B 1TKTA 3OHAA 1BIUA 3MTKA 4FJ8A 2C22A 4BE2A 3MR5A 1LWFB 4PUOA 4ZPAA 3F9KA 4QWDA 2AGOA 3NH1A 3I8DA 4DTNA 3CJ2A 4ED0A 2HWHA 2JEJA 4CJPA 4KB0A 3VQ9A 1NJWA 3C95A 4BACA 4IKFA 1S5JA 2HVIA 4X2BA 3GV7B 1VRUB 4BE1A 3PY8A 3V6KA 3PW7A 4M3RA 5KFMA 5EWEA 3LP2B 2IMWP 2ASLA 1JLAB 4PUOB 4EBDA 4NLGA 3AVKA 3VQAA 3D5MA 3P5JA 3WNHA 1N6QB 4DEZA 4TXSA 1OS5A 1T8EA 4LY7A 1N56A 3ZT3A 4OGCA 2G8IA 4CJVA 4O3SA 1S1XB 2B5JB 2D3ZA 4K4WA 4O3OA 4M3UA 1IG9A 5KFKA 3NF8A 3V6DA 2R8KA 3JSMB 3UPFA 3KLIA 2HNDB 2VA2A 3DRPB 3AA5X 4NLWA 2AX0A 2FVSA 2E4LA 1HRHA 3JYTA 3LZIA 2R8JA 3S3OA 4HVJA 2KW4A 4MKAA 3V1RA 3DRPA 3AO5A 2B43A 3C6TB 3DMJA 1KVBA 2Z1GA 5KFNA 3SQ4A 5HRPA 1RBRA 2B5JA 3L8BA 1Q8IA 1RT4A 3LP1B 3O4QA 4C8LA 5DMRA 3OSPA 1KFDA 5CYQB 3L2WA 3ULDA 3HM9A 1RBTA 1XI1A 4ZP8A 3IGNA 4Q8EA 3HVAA 2JC1A 1TL1A 3QGIA 4H4MB 3M8SA 3WNGA 1RT2B 4R5PA 3BREA 2WCXA 4IFYA 4F4YA 5J2QA 3SNNA 1RTHB 3SV3A 3AVFA 1C0TB 3BSNA 2E6MA 4FLUA 2KFNA 2FJWA 3AA2A 4JRQA 4Q44A 2QXFA 4FCYA 2G8FA 2YKMB 2Y1JA 3KJVA 5JXSA 2XI3A 4F4XA 4B8AB 1NHVA 1LWCA 2FLLA 2JEGA 1TVRA 2VG7A 3QIPB 4DTRA 1VSDA 4CF8A 3KLIB 3M8RA 3TAFA 3HVRA 4J9KA 2B6AB 1TKXB 3MXMA 2IAJB 3OYBA 1S48A 5KT4A 1ZTTA 3S9HA 4KB1A 4FLZA 2HHQA 1TAQA 3KK3A 2FBTA 2HHTA 1IKWA 1TKDA 4M3WA 4LQ9A 1C1AA 1EP4A 3M9MB 3LALA 5HRRA 3LZJA 5KG2A 3VQ7A 1SL1A 1T3NA 2FLNA 2DPJA 1IKWB 1KHWA 1WSHA 1JXBA 3NGZA 2FC0A 3O3GA 3NF7A 5C25A 3OYJA 3V9ZA 3RB0A 3OS0A 1JXEA 4LSLB 2G8KA 3E51A 2G8VA 1TKXA 3OL8A 1U47A 4KI4A 1TL3B 3FQLA 4FK0A 3V81B 1SL2A 3DRRB 4EP5A 1XC9A 3KKRA 3V9SA 3VA0A 2YNFA 5KFEA 4URSA 3KLEB 2UVUA 4WFXA 1WSGA 1C1CA 1K1QA 1CSJA 1VRTB 3OHBA 4CECA 4CESA 4ED7A 3UDLA 2AQ4A 4R5PB 4FJNA 1RDRA 5L1IA 1Q9YA 2Y1IA 4GC6A 2CJQA 1C0MA 2WHOA 4DLEA 3QGHA 2D0AA 3HP6A 3HVWA 1CLQA 3K5OA 5KFVA 2QE5A 3VQ4A 3PW5A 3QEWA 1X9WA 4FJJA 4DG1B 4OLAA 1NJZA 3I0SA 4CF0A 1GOCA 1HYZA 3H5YA 4XIUA 1A5VA 3TARA 3I0RA 3TI0A 3OYHA 4Q5VA 5I42B 3V4IA 4CJLA 1S49A 4NYFA 4E1MA 4B3OA 1D8YA 4EO6A 3H98A 4DU3A 2AX1A 2YNFB 1NKEA 3NCIA 5KFSA 3PO5A 4E7HA 3KLHA 3FQKA 3ZSOA 3KLVA 3C6UA 4F8RA 2VWKA 3ALYA 2UVRA 5HRSA 3CJ5A 4I2QA 5HROB 3IS9B 3IRXB 1U04A 4K4ZA 5CYMB 5I3UA 1XR5A 4CEZA 1JX4A 4QWCA 1QTMA 4CHZA 1I3AA 5F9NA 4TN2A 5SZTA 4O4GB 3KHRA 5KGWA 3LP0B 4IG0A 4O3NA 1N6QA 3ZSXA 3SJJA 3RB6A 4CIGA 3PV8A 3MFIA 3G6XA 3RR7A 5HBMB 3DOLB 2ILZA 3ZSYA 5KFCA 4N76A 4ICLA 1VSFA 1NNDA 5F8GA 3DLEA 3OYNA 5J2NB 4U7CA 3DLKB 4FLXA 2KTQA 4KHUA 2OZSA 1C1BB 3QIDA 4FJKA 3NH2A 3TQ1A 3VQCA 4CJFA 2W9BA 4FYDA 3PX4A 2F8TA 4B08A 2E9RX 2BANB 3HO1A 4Q45A 4B9MA 3AVMA 2YNGA 2J6SA 2Z1JA 1RYSA 5KT3A 4Z4CA 4RW6A 1J54A 1TQLA 4KE5A 2RN2A 3ASMA 4BDYA 1CZ9A 2XY8A 5KG1A 1RDCA 4IG3B 4N47A 2ZQBA 2YHAA 4CJKA 1EKEA 4ZPDA 3KHGA 3V9XA 3KK1B 5D3GB 4OPJA 1NKBA 3V81A 1FXXA 4F4WA 3M8PA 2WB4A 1RBSA 5EDWA 1UWBB 4NLQA 5I42A 3T5HA 4IDKB 4ZVFA 5J2MB 1S97A 4CIFA 5KRTA 3TAPA 3BSOA 3KTQA 3DYAA 2C2DA 4KHSA 3MAQA 4K4UA 3U3GA 3AVIA 2CKWA 4XPEA 1TKZA 4ID5A 1R0AA 5DQIA 5DK5A 2RKIA 4KKOA 2RF2B 2ITGA 1X9SA 1HQUA 3D45A 1K6YA 2XY7A 2GC8A 3AV9A 3SUPA 3AO2A 1BGXT 4DTOA 4KHYA 1HARA 3NL0A 1JKHA 1K1SA 4ZVGA 3SPYA 4ECWA 3OYIA 4KV8B 2HW3A 1Q9XA 1D5AA 5J2NA 4ZP7A 2OA8A 1FK9A 2P5GA 3IG1B 3PVXA 5KT7A 4CHYA 1LAWA 4CGFA 1RT3B 5C5JA 2EX3A 1B92A 1VSHA 4CJ3A 2FJXA 4O3PA 1DTTA 3G6VA 1QSYA 4I9QA 1IO2A 1U09A 2RF2A 1JIHA 4O5BA 4LSNB 1TKZB 5CYQA 3DI6A 4OKEA 4ED6A 1RT1A 5FRNA 3IRXA 3IS9A 5I3UB 3OLBA 4DL6A 3ZCMA 4AHUA 4IR1A 4Z4EA 4N5SA 3DRSA 4QWEA 4ZHRA 1JLEB 4JRPA 1QUVA 1LWEA 4Q43A 1IH7A 4ECXA 4DTJA 1WNEA 4K50A 4OJRA 2WTFA 4ECQA 4DSJA 4BWJA 3RBDA 4CJTA 1VSJA 1RILA 3L3UA 2I5JA 4CEAA 3H5SA 4MKBA 4CHPA 4BDZA 2HVHA 3PUFA 4Y2CA 3I0SB 3E01B 1QE1A 1GOBA 3HXMA 4DQQA 3MXIA 2X6SA 2YKNB 5DG8A 4ED3A 4F4ZA 2X78A 4PQUA 4CK3A 1T03B 3H2LA 1JLBA 1RT7A 2IA6A 4J9QA 1RT3A 3FFIA 3KLGA 4CEDA 4LD0A 1LV5A 1L3TA 3OYDA 2UVVA 3N6MA 3M9OB 4CHOA 1N48A 2G8UA 2KQ2A 3MEDA 1YT3A 4CFBA 3DLKA 4Q0BA 5KT6A 4CF2A 2IJFA 5KFUA 3KMSA 4B8CA 3SQ2A 1RTIA 3AVLA 1DLOB 4H4OB 1RT1B 2PY5A 4RW6B 2FVQA 4HYKA 3SUQA 5KFJA 4HHTA 1BI4B 3C94A 4KO0B 1EETB 3AO4A 2F8SA 2DPIA 4RUCA 4O4GA 4FM0A 1BISA 3TAGA 3L2RA 4KTQA 4YR2A 5KFLA 4B9NA 3HPGA 1LW2A 4BDPA 3QNNA 4Q0BB 2IJNA 4HUFA 4AH9A 4HUEA 4PWDB 1HPZA 4YNQA 4B3OB 1J5OA 1T7PA 2JGUA 2YV0X 1RAJA 2DFHA 1RTHA 1RA7A 2GV9A 1MU2B 1WAFA 4PY5A 2BGGA 3Q8RB 3G86A 3BGRA 4F2SA 2HNYB 4NLOA 3RB4A 4F2RA 1W25A 4QCLA 4CFCA 3MFHA 1KLNA 4DG1A 1BIZA 3U6FA 4YQWA 5HLFA 3LDSA 3RMDA 4NZ0A 1ZBFA 3ZSQA 1TGOA 2BANA 1BHLA 1RBUA 1VRTA 1NK4A 2WOMB 5J2MA 3CJ0A 4WZQA 2WRMA 4Z0UA 1RDAA 1SKSA 1UWBA 2X6NA 3VA3A 1JL1A 1L3SA 3QYYA 2ZE2A 1IKXA 3RMAA 3WNEA 2R8HA 1VRUA 1Z4UA 4RG8A 3KK2A 3SQ1A 4O4RA 1HMVB 3LANA 1RTDB 5EWFA 4RW7A 1JLFA 2HNDA 3TAQA 4YR0A 3V9WA 5C25B 1F21A 2P5OA 4ZMMA 2W9CA 4ELVA 2VA3A 1S1WA 4QPXA 4UQGA 3CDWA 4NLTA 1HNVB 4QWBA 1IKYB 4W5OA 2PZSA 2P1JA 4CGJA 2R2TA 4ECZA 4CK2A 4DFJA 3ZSVA 4ZPBA 3L2QA 2IM2A 3CYMA 3RBEA 3KK3B 1ASVA 1S1UB 3IG1A 2HNZA 1VSKA 3AA4A 1BCMA 4DQRA 3O3HA 3UQSA 2OPQA 5KFZA 4M94A 4CJ5A 4FW1A 3NDKA 3MEGB 1ZBUA 4RNNA 3AVHA 4ZTFA 1J9AA 4F3TA 3DLEB 4WFZA 1IM4A 2XY6A 2RDJA 2HHXA 2PYLA 3KMQA 4TY8A 3GIMA 4FZYA 3UR0A 4DFKA 1KLMB 1IKYA 3ITHB 2XY5A 5FRMA 1TKTB 3GILA 3B6OA 4OGEA 1JL2A 4RW9A 4ELUA 5JS1A 1HNIA 2IDOA 1EP4B 2V0NA 4EBCA 4ID5B 1R0AB 1BQNB 2FVRA 4DFPA 4NLVA 3AA3A 4M3XA 4LH4A 4EZ9A 5CYMA 1GX6A 3LP1A 1ZYQA 1ASWA 3TAMB 4YP3A 4Y2AA 2VG7B 1YTAA 3QIPA 4I7FB 4Z4IA 2HHWA 2AGPA 4DL5A 3GYNA 4J9NA 3KLHB 2X74A 3N6LA 3M8PB 3PJXA 4URQU 2ETJA 4CGGA 4I2PA 4KAIA 1XR6A 4ZVEA 1JLEA 4EP4A 2BDPA 4Y34A 2J6UA 2WONB 4ED1A 4WYWA 5HLFB 1S1VA 2AGQA 2C2EA 4MIAA 2I1RA 2FBYA 3O3FA 3OSNA 5J2PB 3HP9A 1HQEB 3NF6A 4C8NA 1ZBHA 3SCXA 2P51A 1WNSA 1KSPA 1BI4A 4CF9A 1SV5B 1S4FA 2W9BB 3TAEA 4H4OA 3DOKA 2G8WA 5DGAA 3PR5B 3K59A 3CFRA 4FLYA 2GBZA 1CXQA 4M3YA 4CHNA 3T5KA 3G6YA 2D5RA 4R0EA 3VQSA 2G8HA 5KFDA 3HKWA 2BR0A 1S1UA 3SYZA 3H40A 4LSLA 4E0DA 1RDBA 3AVBA 1LW2B 3VQ6A 3NKYA 5T14A 3OL9A 4DTUA 4TYBA 5KFAA 1L3UA 3NGIA 3SZ2A 3NBPA 4DF4A 3CFOA 1SUQA 1C0UA 5KG0A 4AHTA 1U48A 2KZMA 4EYIB
chains in the Genus database with same CATH superfamily
2UUTA 2E1PA 2ZH8A 4KPCA 2H9ZA 4PKGA 4X4VA 2B4JA 3M8QA 2AYEA 4BR7A 3MZIA 4ZS6A 1VC6A 3EDRB 3EY1A 2ZE2B 2KHOA 4AILC 1LAVA 3ISZA 4A5BA 1D09B 1S6PA 4M5NA 3UCUP 4IJAA 2DH7A 1RTJB 1SS6A 3B8AX 2E1YA 4CLWA 4H03B 4ID1A 1T05A 4B9SA 4WIQA 2W2PP 4PXBA 4IQMA 3WX8A 1JCFA 1VISA 2WAQD 1MU2A 2QLFB 4C1NI 2C3YA 5L1JA 2JEFA 5D0HA 5CQGA 3W2WA 3MCPA 3BJYA 4BR9A 1DTQB 2YKQA 2XCAA 3P83D 1IUJA 3AOCA 5BJRA 4ELTA 4C9DA 4CEFA 1TL3A 4F25A 4AHRA 4P2SA 2GELA 3A3OB 2B56A 5E3CA 3QETA 1HW9A 1XQSC 1WELA 1FKOB 4RCHA 2C42A 4TU7A 2G0IA 4AT1B 1QS4A 2DO0A 2RKIB 1NB7A 4YDDB 1WSJA 1CJVB 4JI4J 3TJ8A 4TY9A 3K58A 1IWAA 2DY1A 1UVNA 4L73A 3QJLA 3RMBA 2R7SA 1NDCA 1HBNA 2NRZA 4B02A 4LRDA 3MD1A 5I3PA 2IC3B 3UDVA 4O55A 3EVOA 3MMCA 3VQPA 1ZPVA 4DTPA 1S9GB 4BC2A 3WXLA 3VR1A 5IZHA 2CQIA 2XNRA 1JLBB 2GZOA 3D54A 1RWXB 5BYQA 3CCSS 3GB0A 1CQNA 1GFWB 2F4VK 2O5DA 4CD1A 3FR0A 4KH5A 1MWQA 5A8KA 1X9MA 1H38A 4QJVA 4FLWA 2WVBA 4EEYA 4MK9A 3VQEA 2AIRB 3W3DA 4J2BA 3NF9A 2F1FA 1N0UA 1KRPA 3T5JA 4QAGA 2W4PA 3PSFA 3KK2B 4PCQA 2ZWPA 1NK8A 2GO8A 4I6MA 4CBUA 4YR3A 1MMNA 1HWIA 5G0RB 3BPSP 2Q1NA 3N79A 1QAIA 3MX5A 1RJJA 4CZLA 1KD1T 3HSJA 1IBLJ 4ZA1A 3MOJB 5CYJA 2DCUB 3THVA 4XK8C 4E7JA 2YX1A 3TVYA 4JK7A 3UVJA 1WOQA 2G9OA 2DKOB 3LGNA 2GAGC 4R0JA 4YOVA 2YNGB 3KJFB 3NBPB 2J0QD 2GA7A 2J5AA 4WP9A 1NBWA 1JLQB 4MTPA 4ECUA 2NUBA 3H4BA 3AARA 3UD4P 2LDIA 3VEWA 5H1SV 4C8ZA 4PWDA 2KVQE 2KXNB 3OV7A 3CJ3A 6FD1A 3RR8A 3KJVB 5AFUH 1WB9A 4V19J 5ETSA 1N34F 3H59A 2PMHA 3WZ0A 4C8MA 4HCBA 1WWHA 4L6V3 3OR1B 5KG7A 4EAHD 3Q8VA 4C48A 1NGAA 3W63A 3B6BA 1MWZA 2A1RA 1GLDG 3HJFA 3J81j 1RWOB 3D2EB 2QWQA 2D0PA 4OZ5A 4RUAA 2ALYB 3R3LA 4LRBA 4YOEA 3TWHA 3IUCA 1YVUA 1TK0A 5DO2A 1DLOA 2VG6A 2YX4A 5KFRA 3T5LA 2B6AA 5KOXA 4DV6K 5E26A 5HP1A 3RAQA 3GL1A 2VYPA 5EVZA 2ZGYA 4E1JA 4ZPWR 3E1YA 2HKEA 1YJ9S 2D0BA 4GW6A 1RABB 4DL3A 1VK8A 5AQSA 2E2NA 4PKDB 2ZHBA 1FD2A 2V94A 3V6HA 2V8DA 4ZN3A 3V2UC 5ETTA 2RDIA 1CLFA 3SSSA 1FEHA 2CUYA 1ZZNA 2QIFA 4B1VA 3BBFA 4A8WA 1HNZK 1R8AA 2XTJP 2RRAA 1FJGF 2HK3A 3PX0A 2IOCA 2DGQA 2Q2RA 1OQ3A 4RUBA 2H4YB 4XDDA 2GQQA 3FNNA 2IC3A 2H1YA 1VQNN 2XMJA 2W01A 4ZCLA 3QPIA 1D8ZA 1C0TA 1HQUB 1V4TA 2VGNA 2HGLA 3VF0B 3HPOA 2YWGA 4JI8F 3IRWP 2MEWA 4ED5A 4JI6J 2HS4A 2J0WA 4QIWD 2HBZB 2ZM6F 2BOPA 4KFBB 1JLCB 2J9DE 4FDFA 1T9XA 3O3LA 3TWZA 3TR8A 4USHA 4JI1K 3THWA 1YRTA 3DLHA 2YNIA 1ITGA 3BO4A 3DXBA 4FLVA 3QNOA 2H51B 4M42A 2L08A 1FX2A 4J9VA 4CI0B 5U47A 1WSEA 2GVDA 4CBXA 1TK8A 3IWXA 5D0GA 4DTMA 4OHYA 4WXWA 4OX9K 3MN5A 1BMQB 5GAHU 4A8XA 2R7TA 3TOQA 1A5XA 1WI6A 5FPEA 1RTJA 1RT6B 5F8LA 4K4VA 3OTOK 1ZS6A 2EKYA 4YY3K 3AVNA 3THYB 4P74A 3O9RA 4FS1A 4H4KC 4CZHA 1HPMA 4NRUA 3I6PA 4P7TA 5DM7L 1MWMA 2FBVA 4EO8A 2KT5A 4O3QA 1WHVA 1EQYA 5HO4A 2I9SA 2BMBA 1I6JA 2X1FA 1K8KA 3M8QB 2DIVA 1O51A 5KT5A 3GQCA 1S1TB 4DTSA 4DV3J 1UOCA 5AFUA 5KFBA 5IV4A 5F41A 4ENOA 4CJUA 3HVTB 2IVNA 3FBBA 4Y2IA 1HBOA 4YOTA 4QWAA 2VZ9A 3P45B 2LXIA 4NXMJ 2DPNA 1B7YB 1KP6A 4RO0A 2QYGA 4D3GA 2DVIA 2Z57B 4J9PA 1U6BA 4HI2A 5BREA 1GNKA 4CEOA 3SK3A 1I39A 3EGVA 3M32A 3ULEB 1VQOS 3MGJA 2QI2A 4WE1B 2V8GA 1T03A 1U4BA 4BG8A 3RG6A 2A40A 3DOLA 1CZBA 4DSIA 2HWIA 3CQ8A 2FBXA 4PG7A 2BQ3A 3GV8B 4H4MA 1QE1B 3THXA 5LJ3Y 4ZP6A 4ALZA 1N32F 1EB0A 2QSFA 1RNHA 2EFQA 3E66A 3I9ZA 1EQ0A 2W7AA 1S1VB 2P9LB 1FKPA 3Q0AA 4M63C 4G1QA 2DY4A 5AR0A 1T95A 4OHZA 4E8UA 3PIPL 1KVCA 4FKXA 3THWB 2HEKA 4P2XA 1M5PC 4GO7X 2IM3A 4EUVA 5HQMA 4CLFA 4OLBA 3OVNA 4ZCKA 4RU9A 5EWGA 3L2VA 3CM6A 4ZP9A 4RWTA 1XMOK 1U1NA 2NPIA 2IVOA 3VVTA 2E1MC 3ULHA 4O44B 5EX0A 4KHPK 3SBMA 4I56A 3SUNA 3S7RA 4C8OA 1G4CA 1NXIA 1YRXA 4F04B 3OL7A 5DDRC 2AWZA 1F60B 4IO8A 2ZJRQ 1LK5A 2LDYA 2O8DA 2BV3A 2Q31A 2YWFA 1O5JA 1ZTWA 2JFDA 3OY9A 1NSAA 4K4YA 4NYNA 2MXYA 4LFBF 5KG6A 4JI1F 1RHRB 3C16A 4AXIA 3HT3A 1S5ZA 2QC3A 4NYZA 2L9DA 1LWFA 5C0YA 2UUCJ 3GG1A 3UD5A 4H0PA 2DTUA 2FDNA 4DSFA 3CWJA 1EWRA 5HJXA 4WFAQ 3LP2A 4NZ7A 1PYOB 3J7ZT 2UYTA 1TMJA 4PWUA 1S72S 3NS6A 4MO4A 2FJEB 1K0TA 2CQ2A 4DU4A 3VN5A 4LFAJ 4JKBA 4DCPB 5DM6L 3MMBB 4LF7K 2IIHA 3N5BA 2FJVA 4G3IA 3EKUA 3TP2A 3CXCR 1CEZA 1XNQF 1FTCA 4RLEA 1S22A 3IO1A 1HNWJ 4JI7F 1FXRA 1XMOJ 1TL1B 2C1EB 3TZYA 1NPRA 4AHCA 3KWIA 4YB1P 4CJEA 3EXCX 3QB0A 1J5OB 3OR1A 5K9FA 1DRZA 3NGTA 3H42A 4ZLNA 4XPCA 3S1TA 1W97L 1VC0A 3UKUB 3SCKE 4OI1A 3I5BA 4WTYA 2WSEC 3DM2A 5B0FA 1IBKK 2KT2A 3D1QA 1N0VC 3NXZA 4LR9A 3PNIA 4BR4A 3FRZA 4N41A 4FVCA 4KGVB 4J9MA 1HD1A 2W24A 2F3JA 2VPZB 3IAYA 3FVYA 5FROA 1KAZA 1SJ1A 4IRCA 4JI4F 2BOAA 3M7VA 4MFBB 4LFBJ 3TSUA 2QJ3A 1SB6A 4DR1F 5KFQA 3DGPA 4FJ7A 4ZOSA 4AHSA 2WVDA 1ZBIA 1WHXA 1G1XA 1TVRB 1NK9A 1WDDA 1AROP 3UN5A 2Q3SA 2VD3A 4PA1A 2J0SD 4FOEA 2ZBCA 5DDPC 2ZBPA 1U49A 4E1NA 3ID8A 3PRDA 4E19A 3FFIB 3DU5A 4FW2A 3T7ZA 2RRBA 1ZAVA 3MECA 4MFBA 5CY4A 4U8VA 5J2QB 2XEXA 1HI1A 1VQON 2MGZA 4Y1DA 4Z4FA 3B78A 1Z26A 4JEPA 1ZETA 2C2ZB 2GFFA 2I5JB 3DJCA 2ZGZA 4CH1A 2WVFA 2NXEA 3G25A 3V1QA 1RTDA 1IR0A 1NG9A 3CJ8A 3PW2A 2HVZA 2YJEA 5BR8K 1ACMB 2UUAF 4ZHRB 3VZHA 3ZSZA 5A8WA 3KOAA 3A5LC 3MMAA 4RKUC 3M8YA 3EZ5A 4WYLA 1ICEB 1A5WA 3NWGA 4OX8A 1C4CA 2OPSA 3CCUS 2UU9F 2JC0A 5TKWA 1S57A 2GUIA 4H5NA 4H5TA 1RU2A 1TKTA 3OHAA 1VQ6S 2H65B 1LWFB 1HLUA 4ZPAA 2OFHX 3OVAA 3I33A 3CSKA 4PKIA 3I8DA 4U9RA 2Z2YB 4ZLPA 4KB0A 3CTRA 5DM7Q 3VQ9A 3BGFA 4LF4F 2NSBA 2W1BA 1R6YA 3ETMA 2NLXA 1PJ7A 3CJKA 3HFZB 4LF9J 4F02A 3P39A 5CHIA 1WC4A 7FD1A 3AH6A 2YWKA 3LP2B 4EBDA 2CWXA 3P5JA 2CPIA 2HPUA 5CD4A 4DR6K 3G71S 3AXKA 1T8EA 1NJIO 3M1FA 3PYGA 1MG7A 3PEJA 4LY7A 5AQRA 2E1RA 4AYBD 2G2ZA 1S1XB 2D3ZA 4K4WA 1O8BA 3OTBA 3MM7B 3NF8A 1NH8A 3TTFA 2XMWA 3FCWA 2R7UA 3ZO7A 1RTZA 2VQEF 2QA4N 3KLIA 2IRYA 2I7PA 1HIYA 2DJWA 2DXEA 4DV4K 1N34K 2HQ3A 1CJKB 3S3OA 3W61A 4TU8A 4HVJA 1NM2A 4LFBK 1NLVA 4MKAA 2RUSA 3O1WA 2V9KA 1FDDA 1FRJA 2V52B 2R7RA 2Z1GA 1FVQA 5KFNA 4NLCA 3MEKA 2FY8A 5DMRA 1KFDA 4BRPA 3CCUN 1RBTA 5IT0A 3AB4B 1XI1A 2GMLA 4Q8EA 5LMUJ 4H4MB 3THXB 4BS2A 5A6WA 4R5PA 2C3MA 2WCXA 3IFRA 3TR5A 3SNNA 1RTHB 3P3DA 3ZEUB 3M32B 3ULEA 4P75A 2QWLA 1IBMJ 3BSNA 5GAGU 2E6MA 4BR2A 3DCAA 2QA4G 2KFNA 1FRHA 3L7UA 1XNRF 4YN3B 4RTFD 2VB6A 1VS3A 1OPZA 2NREA 4MO5A 3QT5A 1R0CB 4B8AB 4MJKA 4IZ9A 2ZITA 3GJTB 2YBVA 4ED4A 2DIUA 1Y7PA 2ZUAA 2PAVA 4MLEA 1I51B 2HHQA 1JJHA 4WF9Q 4JBCA 2DH8A 1NZ8A 4B3SJ 1SAZA 3GR1A 3M9MB 3IC1A 4XH1A 5HRRA 5KG2A 4ZJOA 5KQDA 1SL1A 1T3NA 4YHHF 4USKA 2AD9A 1WSHA 3NGZA 2FSJA 3NF7A 3GFYA 3VESA 3CCWA 4U67L 4EGLA 2CQCA 1X4DA 1HW8A 1DQ8A 1HFEL 4QR2A 3E51A 1U47A 4QQBA 3FQLA 3FZ2A 4FK0A 1U2RA 2QX0A 3CIPA 3DRRB 1RU1A 4GV3A 3ZLJA 1XC9A 4QIGA 3HZGA 3ZTOA 2OGUA 2HSEB 1VRTB 3OHBA 2B3TB 4ED7A 4BRQA 2M7SA 2AQ4A 4B1UB 4R5PB 1RB0A 1RDRA 2MLZA 5L1IA 3B82A 2Y1IA 1C0MA 2CJQA 1AYEA 3LGHA 3HVWA 2CGKA 3K5OA 1WF1A 5K8PA 2X1AA 3QEWA 4FJJA 4DG1B 4LRFA 1RHUB 2EPIA 3MWBA 4DPOA 5B0AA 2DR6A 2IMOA 1UTAA 3OYHA 3L95X 3MAHA 3V4IA 1S49A 3K9KA 2N4DA 3CXCM 1YBTA 1D8YA 2QG9B 5I3QA 4DU3A 2AX1A 4RPFA 1NKEA 2E7XA 2WVEA 3EWGA 1R8CA 2XULA 4X84A 3C65A 1IR2A 4WP3A 2VWKA 3CMQA 3D6RA 3K7RA 4FWSA 1J6ZA 4CQ1A 4CEZA 4CHZA 1N36F 3KHRA 5DZ6A 1XTZA 2BJ3A 4AM7A 3ZSXA 3QATA 3SJJA 1HNWF 2G1DA 2DNZA 2VHGA 3G6XA 1KQFB 1RKJA 2KM8C 1RWKB 4N76A 4PYDA 4FF4A 5LMUF 3DLEA 2HHHJ 4U7CA 2A3JA 5MLCQ 3BN4A 3DLKB 2UV8A 1N33K 1HNZF 2Q6CA 1RK8A 3Q2TC 4BC3A 2NYHA 4C3MA 2F8TA 1U26A 3JXUA 2BANB 4A59A 3AD9C 2XHWA 1JK9B 4XEIA 2P6TA 2J6SA 1BY9A 5C2FA 2AJ1A 3D4JA 2HIYA 4QR0A 1OYDA 4Z4CA 2RE1A 1NWKA 2FJBB 5GAEU 1HKAA 2CYYA 1UFKA 5A8RB 2DNKA 2HFVA 4N47A 3ZZRA 1HL6A 3G8QA 4DV4F 3BKTA 3V9XA 2G13A 3MWPA 2QL5B 4F4WA 1YUWA 1TL5A 3IM8A 3M8PA 1X5OA 3GU0A 2WB4A 1X3MA 4LF6F 2X51A 1V4SA 2RHKA 1S97A 4CIFA 1GMWA 3W7BA 3BSOA 1PYSB 1RAFB 4AE5A 4PG4A 4HL9A 4XPEA 4ID5A 4DR2F 5DK5A 2C3UA 2XMVA 1Q8LA 3TTDA 1IVZA 2GC8A 2JVRA 2Z58B 4OPHA 4YB5A 1QJHA 3N01A 4FN5A 3CIMA 1TUVA 2Q1LA 4BGAA 4ZVGA 3SPYA 3A3NB 4JKEA 2NUHA 2OA8A 2P5GA 1VQLN 3BKFA 1LAWA 2OUGA 4CYUB 5ETLA 4CJ3A 2ZOGA 4JP8A 2FSNA 1IO2A 2MQ8A 1VQPS 3D1OA 2IJRA 3M1VB 4B1ZA 3HI0A 1YJNS 3QRQA 3TSQA 4NXNJ 4OKEA 4CYUA 3FEZA 3IS9A 4AHUA 2QMUB 3ZCMA 1JNZB 4C3KA 4ZIVA 4IR1A 1S6UA 2PN6A 4N5SA 3HJVA 3CDBA 2DO4A 1TMMA 4Q43A 2YWHA 3HD2A 1WNEA 4B3TJ 4ECQA 2EFGA 4B9QA 2M9KA 4BWJA 1CULB 3RBDA 1J5EK 1VC5A 3ID6A 3BDEA 2R3VA 2CJXB 1VSJA 1RILA 1SXLA 5EX5A 1FFWB 2ZBIA 3VGLA 3U8XA 4JI5F 1CJUB 3PUFA 3Q86A 2VCPA 4LFCJ 3MM9B 3HXMA 3MXIA 2X6SA 2BJ1A 4ED3A 4BVOA 4DZ6A 2X78A 3L09A 3ENOA 1ZC6A 1JLBA 2LEPA 1IXKA 1QY7A 1RT3A 3KLGA 4CEDA 4LD0A 1LV5A 3R7BB 2UVVA 2F8MA 2E5LF 3IM9A 1PC5A 3DLKA 2YWWA 2L3MA 5KT6A 4X65F 2MZRA 4AL6A 3IBFB 3IMXA 2DNRA 1RTIA 4UUWA 1RT1B 2CJ9A 2PY5A 2FVQA 4HYKA 3QWUA 2V7ZA 5KFJA 4B17A 4DV1F 2P9SA 2VICA 1BI4B 3QSYB 3K8VA 2F8SA 2XS2A 2WSFC 1U0HB 4ZJLA 4KH6A 4K5RA 4ILHA 1N33F 2VGMA 1FXDA 5C12A 5LSRA 4C98A 4ZDNA 3C16B 1APSA 2XO6A 5KFLA 4IEIA 2RQKA 1H3DA 3HPGA 3QT8A 5IC4B 4BDPA 3QNNA 2F5GA 3GR0A 3M6VA 3CD0A 4MT1A 9RUBA 4BRAA 4NA2A 1PKUA 1TL7A 3B54A 4X4OA 4YEAA 2GW8A 1R0BG 3DFEA 1VR6A 4UF4A 1KQKA 3T69A 2YV0X 1N8RO 1RAJA 2DFHA 3W2WB 4X4RA 1MU2B 2VDHA 4I1TA 3Q8RB 3PRBA 2HNYB 1V3SA 3RB4A 3GBTA 2F9JA 1KLNA 2PEHA 4DG1A 2Q79A 4ZVTB 3VMFB 5IQ6A 2DGOA 3ZSQA 1G2EA 1BHLA 1RBUA 1VRTA 2RQ4A 1HI0P 1RCXB 3VF2A 2WRMA 2XYHB 4UTGA 1SKSA 4B1YB 3WXIA 3CE8A 2ZE2A 1IKXA 4FVUA 1NMNA 1Y0HA 4ZK7M 1VRUA 1Z4UA 4LVOP 4K0KK 4JK8A 3SQ1A 4O4RA 3LANA 2XSJB 4YDUC 2N4CA 3HT0A 4RL1A 4RW7A 2FHMA 2HNDA 4NXNK 4YR0A 2BE9B 3PKMA 1F21A 4ZMMA 3POTA 1N8RT 2VA3A 4DOZA 1S1WA 3G2XA 4B3TK 1HWUA 4NLTA 1IKYB 5IT9Y 4CGJA 2QEXN 4ECZA 4CK2A 4DFJA 2VDIA 4CZMA 5LMUK 4V19S 1UMJA 5HOOA 2XMAA 4AQYF 1OPIA 3CD7A 3ZZZA 3D0GE 1BCMA 4DQRA 1ZPWX 5H9FJ 3O3HA 8ATCB 2HIQA 4LF9F 3A3PB 3H0PA 2E7VA 2AEJA 2F9TA 4GMKA 5A2QU 4HDHA 4Z7YA 3G6ES 1UJ6A 1TYQB 3H46O 4LF4J 3AVHA 4J37A 1GT8A 5B09A 1S3XA 3BZCA 1F9HA 3H3NO 1BO5O 2WTUA 2HHXA 2QW9A 1WJ9A 2RQMA 4KH4A 4DFKA 1KLMB 1IKYA 4IOCL 4Y65A 3CCQS 5FRMA 3AOAA 3ZEUA 5JS1A 1HNIA 2HZAA 3FE1A 5LMNJ 2V0NA 4EBCA 4DKWA 2B9XA 3KKFA 1T9VA 2FVRA 3P49B 5T41A 4LH4A 4EZ9A 5CYMA 3LL3A 2GVDB 2BW7A 2PEBA 5F0WA 1E6VA 3MOZA 2HHWA 4J9NA 4B3MJ 1WG5A 2X74A 5D6GA 2VQEJ 4CGGA 2BUPA 2BDPA 1UW9A 4UOCA 1KNZA 1N36J 4DR6F 3TO8A 5DETA 3OSNA 5M1NA 3HP9A 1HQEB 1HNXJ 2CZVC 4A62A 1NJIT 1BI4A 3PJ9A 1GLFO 4K5SA 1KOOA 3TAEA 2XNQA 4AL5A 3LA0A 2B9EA 4G65A 1GXLA 4KGKA 4CIOA 3CFRA 4OYWA 1D4XA 2YTCA 2PFUA 3BYPA 2CWKA 3LM2A 2G8HA 4D3HA 3T6JA 4ITSA 5AE3A 5MLCV 1S7IA 1IJJA 3MCAB 3CF5L 1HA1A 1WG4A 2PGCA 3OL9A 4DTUA 2JX2A 2HBKA 1KOHA 2UXDK 3CFOA 1RHKB 3TUIC 2CQDA 2KXHA 3HRGA 1CJTB 2ABYA 1E3MA 4X4PA 1GK8A 2QTDA 1OYEA 3PJWA 3J7Z5 3TABA 1RTIB 3KD5E 2EFOA 4X66K 3S3MA 3C0BA 3FSIA 1ZBLA 3OYKA 2VC0A 4KBIA 2XO7A 3EYZA 1JWWA 1UEKA 1RLCL 5G4DA 3KLFA 2QLBB 3PYDA 3TAMA 2MHNA 3LOUA 2BH1A 5HRNA 3G71N 3HLUA 4URGA 3DHXA 4DN0A 3JSBA 3QGGA 3DWLA 1HBUA 4KTZA 2VOPA 2DGUA 2AZ1A 5AQOA 1IKVB 5AQZA 3EE3A 3M6UA 5C15A 2F96A 4UUXA 5KG4A 1QAJA 3LPUA 5BXIA 1OH7A 3VQ5A 1TV6B 2DFEA 4A8OA 2E2OA 4RR5A 4NL5A 1FRIA 3T1HJ 1Q0NA 3TZZA 3M2RB 1RAGB 1EXQA 2XCPA 3SIPB 4LJMA 3OW2M 4GC7A 4C4WA 2R2RA 4WQ5C 2ASYA 3TUJC 2C2RA 3AGKA 4RNFA 3HZ6A 1Q82O 5BRDA 4RWXA 1NJYA 3LTOA 2A0FB 2FHJD 1D9FA 3M1VA 4EHUA 2HWTA 3HSDA 4CW7B 3O5BA 5JLFA 1B7FA 4QYZJ 2R2UA 2PT0A 4WFNQ 4J9UE 2HS3A 3OYGA 3HHLD 4YFUA 1IBMK 3C6UB 2XRIA 4Y3CA 5F2RA 4TSXA 4LVNP 3D0PA 4WP8A 2BRLA 4F3OA 2MQPA 2VQFF 2G4BA 4F67A 4CTAA 4K4XA 3EGNA 4AD6A 3MF5A 4JOUA 2AA4A 1T11A 3I96A 2RSQA 3ZYYX 3P6YC 4J90A 4A8MP 3NVKA 4R8UB 2V2KA 3PW4A 3G4SN 1FF2A 3QMQA 2WUSA 1WC5A 1KN6A 4BC5A 2SXLA 1BL3A 3DLBA 3SBGA 3PYEA 1T9UA 2Y0BB 4LT6A 2MQMA 4MIBA 4DPYA 4O3RA 2OPRB 4NO7A 3BPDA 4CP5A 1X5PA 4DQSA 4OPKA 1OIAA 4BGBA 2HBQB 4J7CA 1TV6A 4CJSA 4UOGA 2K2PA 4DF8A 1P1LA 1B0TA 1VYAA 4WU3A 3D9BA 4NCBA 2MZQA 2Y8WA 2Z4PA 2ITMA 3AA9A 1IKVA 3QRRA 3KKSA 1VJQA 3F2KA 4FWPA 2B9YA 3R1XA 2HBJA 2HS0A 4LIWA 3AVCA 4DL0C 4OO1J 4ED8A 3ILJA 1N4LA 3LDPA 2ZKUA 1B9DA 4KB7A 3C14B 2E9TA 4RZRA 1BWVA 3FZMA 4KGXB 2UUCK 2IAJA 5CZ1A 2HMIB 4C7QA 2YH1A 4FYXB 1VBZA 3D7SB 1IBLF 2ZEJA 3FRYA 1MROA 2V50A 3MMVA 1MSWD 4H8KA 4FF3A 1DTQA 3UDCA 4DR1K 3UDEA 1RCOB 2J9EA 3DXKB 3HHKA 5KT2A 1EX4A 1S9EA 5CD4H 4HTJA 1T44A 3GIJA 1S72N 4JI3K 5KFFA 3OQ2A 3ZX3A 3VF6A 5DG7A 3FZHA 5IWAJ 1XN9A 4NLSA 2OI2A 4G9ZA 2WK4A 3E01A 1R6VA 4LBIA 4ID8A 4HEA9 3AO3A 1K9MO 4KHQA 2Q0UA 1AXQA 3G96A 4NRTA 2K1RB 1FRLA 5KPTA 2JOQA 2HHHK 3AD7C 2E5LK 4JI7K 5A0YA 4I6WA 1YTUA 1SJFA 4F3MA 1NSKL 4BCAA 5JUMA 4G1QB 2AJQA 4HVZA 5A2QO 1M5HA 4L74A 4HACA 1S0VA 2ATCB 3MCOA 3I8BA 1SBRA 3NMUA 3MM8A 2ZDOA 4C0OC 3RUBL 2YHXA 2G2OA 3OTOF 4K4TA 1BA1A 2NPFA 1HNIB 1RYRA 4KT0C 4FXDA 2QWOA 3DMJB 2BQUA 3ATVA 2A5XA 3K5MA 2XI2A 2D3O1 4QPTA 1K0VA 5BN9A 2RH3A 3T3FA 3ZT2A 3EDQB 2E5GA 5FLXO 3M6GA 1R31A 2O3DA 4OHVA 3HVTA 3MMJA 1QDUB 3R5GA 1GLLO 1O1WA 3HZEA 3HHNB 4AHVA 2FJDB 1URRA 2NRRA 2YH0A 4FVMA 1C0UB 3KUHA 3ETOA 3P8BB 2NYIA 4LFAK 4CGDA 3RMCA 1LQ9A 4DUYJ 2VQFK 4WCEQ 4RJVA 2KN4A 2IRXA 5DGBA 3SV4A 4DL4A 4G6VB 5DM6Q 4EYHB 3EX7B 1W2BM 4LF5K 3R5AA 2C28A 4RW7B 3CF5Q 3D66A 4O8UA 4OZNA 3R3TA 1WHYA 3SAGA 1WUUA 1WN7A 5M1OA 5AQXA 1IKXB 3BEXA 1AZSB 1FRKA 2YVSA 4M5DA 2LMIA 1RWMB 1CVJA 4NMXA 3EGZA 1HYVA 5DLFA 5LM7E 1BQNA 3NHGA 4DUZF 4FP9A 5DG9A 3AFGA 2Y1RI 3DAWA 3CCEN 1VQ6N 1RFQA 2W9AA 3NGYA 1WC1A 2F7TA 3SJHA 4TY8B 2DNPA 2IS3A 4Q7AA 4FWLA 4FO0A 3U1MA 1CJKA 4X66J 5GIPA 1FJGK 4IQXA 2VFSA 3GZ7A 4R25A 3G8TA 1Q95G 3Q8PB 1V6HA 1SQGA 2EFNA 2QZ8A 1CZAN 3MXJA 4LRAA 1S1XA 1RT6A 1KVAA 5HATA 4HHHA 3BBBA 2W7PA 3V6JA 4IOBA 4KAZA 1H2VZ 1GMWD 1Q53A 2B7CB 2C2KB 2F7VA 3BN7A 4RW8B 1DTTB 2HNYA 5D78A 3QO9B 5AQWA 3OR2A 2XYPB 2WBNA 1S7HA 2XZTB 3TEGA 2R7YA 2D9OA 2ZH3A 3D2FB 4XH4A 2OSQA 1QVGR 4JI6K 1D3WA 1RQ0A 2BKNA 2E5LJ 2CPXA 2QA4S 1MROB 3TJAA 3O9SA 3LP3A 1LFPA 5KFOA 1CS4B 3CO0P 2OZMA 5E3QA 2ZC4A 3BB5A 4FF1A 2OPRA 3DOKB 4B3MF 4K4SA 3VENA 1XMBA 3EJMA 2HMIA 2NZTA 3SAFA 3H6EA 4E7LA 4DSLA 3AD8C 1HNVA 2ZD1B 3CJ4A 3N0VA 4DSKA 2XWYA 4J2DA 2R7VA 4DFMA 2MTLA 2HQFA 1Y11A 4CIEA 4WKYA 4RBVA 4DHYA 5F3TA 3MXHP 4WIIA 5F8IA 4CVNE 3UCZP 3QBCA 3KLEA 1TUGB 4M5JA 3MR6A 3UI3A 1NGJA 1OY6A 2CQ1A 1WG1A 4CJ4A 2ZH5A 3SI6A 4F26A 3CMAS 2MKSA 3ZZYA 4ECRA 1NNEA 3QERA 3VQDA 2OMOA 1H74A 2VG6B 2CAJA 5C2CA 5HK4A 3LAKA 4QOZB 4EHTA 5ADXH 1FTRA 3R7SB 4R8UA 3LW5C 4B3RF 4IRKA 2FZKB 2ZOFA 4X62J 2AW0A 2IBKA 3GMGA 4IJNA 1RKIA 3D0HE 3OUYA 5LSOA 1QQMA 1AUDA 1JLAA 2FVCA 2OYQA 1VSLA 4JKHA 2EC0A 5FPDA 2ATLA 1F5AA 3AVAA 4Y2KA 4CTAB 2H5EA 3EE8A 4WFYA 3F56A 3A5NC 1NHKL 1RHMB 1Q81T 1F0XA 4DR5F 1C1BA 2MY8A 4NE9C 4ANEA 3M6WA 2WW8A 5AZIB 5KFPA 2CGJA 3N4QA 5CHCB 1FFSB 2NS1B 1M1GA 3M05A 2XLIA 2VWBA 2VBZA 4DV7F 4JV5J 4FJIA 3RJMB 4DDFA 3C6HA 2OEKA 3UE5A 2QA2A 4NLYA 4CDIA 4IG0B 3BGUA 1TP7A 2DNYA 3EICA 1VI7A 1PSDA 3EXYA 1FVSA 4DV3F 3RRGA 1DY3A 1FNOA 4WZMA 4M3TA 5B0CA 2KJWA 2KG1A 3HK2A 1SH0A 1VSIA 2KT3A 3ISNC 2LLZA 4FZXC 2I0XA 1QAXA 4WJBA 2ZBQA 3V9UA 4DV6F 2YQ0A 3HYFA 4ES2A 1JLQA 5K14B 4A8SA 4JUZA 2D3UA 3FLCO 4M45A 2AF6A 1V5VA 2K06A 1Q5YA 3UVJB 3K5NA 3EVWA 4ZLJA 1OSDA 2XGPA 4DR3J 5A8KB 4JS4A 3LF0A 4NB4A 3LWMA 2R8IA 2G1HA 3I32A 1HR0J 1HKGA 2E1ZA 3VGTA 3MURP 2P6SA 1XHXA 4I6MB 2QMXA 1AUSL 4OX9J 4CZKA 1UP1A 2ZH7A 3J7ZO 1DJ0A 3O80A 1S76D 3CCVS 5AT1B 2W8LA 4QYRA 1XR7A 2Z0GA 2ZM6J 4OYIA 1KFSA 2NXCA 5F8HA 2UUWA 4MK8A 3ZX0A 4NX9A 1OH5A 3V4MA 3U3YA 4X4NA 2MJNA 2GJFA 2UUBJ 2IRUA 2Z1IA 2YKPA 2EHGA 4ECSA 4KO0A 1DARA 4HCCA 3D3BJ 1HNXK 4J5OA 2KYXA 2WB1D 4NMLA 4F4KA 2E5HA 3L3CA 2DHSA 4C0BA 5F8MA 1YI2N 5D4OA 3A2FA 4NYPA 4IDKA 1LCUA 2UV8G 2RPIA 8RUCA 3EZUA 1ELOA 1GOAA 5M1QA 4CE9A 4DR2K 1RWVB 5D4NA 4NCAA 2DFFA 2DHGA 3VEYA 2JWNA 5LL6d 2IDEA 4FJGA 2GMHA 5CCLA 4IXCA 3KFWX 4ES3A 2HRYA 4KIAA 3VTHA 3KNAA 1GEHA 1FKPB 4OI0A 2R7WA 4DTXA 3OFFA 9ATCB 5E5NA 3ET6B 4KKOB 3MPVA 1Q4RA 1TELA 3I5CA 3H2VE 3MPUB 4NLXA 4F7VA 1RT4B 4JI8K 4FBTA 4CNYA 1WBDA 1WEYA 4DMNA 4WE1A 1AZSA 4GKJJ 3JQMA 4BE0A 1VQMN 1UA1A 2CPFA 4PWWA 1ZAWA 4KSEB 3A13A 3GSIA 3BY5A 4WXOA 2M52A 3UKRB 4U6PA 1FRMA 3WEEA 1VLOA 4BRNA 1MW7A 1RA6A 2B51A 3VQBA 3DI6B 5H9FK 2ASPA 4FJ8A 3M2VB 5GINA 2F8HA 3TA2A 5AQLA 3EKSA 2OKQA 4QWDA 2AGOA 3NH1A 4F0HA 4F0MA 1HQ2A 5AQKA 4ED0A 2JEJA 3ZFVA 2M8DB 4A5AA 5JJBA 2E44A 2KYZA 1S5JA 3A8EA 4F0KA 4X2BA 3R2CJ 5LMNK 2ZH1A 4QZVB 3GV7B 1VRUB 2GJIA 1JCGA 3ENWA 4M3RA 2ADBA 2BXJA 2CRLA 4FKYA 3AVKA 4JI2K 1VHIA 3W8GA 3D5MA 2OELA 3ZC4A 5GAEI 2HZVA 3H2UB 4OZLA 2PI4A 2G8IA 2BKOA 4CJVA 3HHDA 2DGWA 2I38A 2RRNA 4JKCA 4M3UA 3WEEB 3A8JA 3KDOA 4DX5A 2QL9B 4NPOA 3JSMB 4OQJA 3EMTA 2HNDB 2XZDB 3AA5X 4A61A 4PL8A 2E4LA 1HRHA 4YY3J 3JYTA 3CCRS 6FDRA 2V4JA 2KW4A 4FNIA 2DR5A 1NDPA 2KB2A 4OI3A 2UUAK 2B43A 3W2VB 3DMJA 4CLTA 2YQ1A 1BDGA 1VQ7N 4DV1K 3FSYA 1Z6RA 2E2QA 1RT4A 4C23A 3OSPA 2JH3A 3L2WA 3ULDA 3HM9A 2PSZA 4NXNF 2D74B 5M2PA 3IGNA 2JC1A 2RQCA 2QN6B 3WNGA 4IOCQ 4QS7A 1VQNS 4IFYA 3HMJG 1SIZA 2PD1A 1C0TB 2EG1A 4YDXA 3R5JB 4K2JA 4DR5K 2KRRA 2FJWA 3AA2A 2QXFA 4ILLA 4JKGA 3DKDA 5CAAA 1TU0B 3MDQA 5JXSA 4JK9A 2VG7A 3KLIB 3M8RA 4DR5J 3R2DJ 4NXMF 1TKXB 3MXMA 2IAJB 3FJ2A 3S9HA 2DNHA 1NZAA 2OLWA 1VDHA 4LQ9A 1FERA 3US5A 1KQSR 2FLNA 3D67A 3KG0A 4I0WA 1Q8BA 3T1YK 1RAOA 1JXEA 1PBAA 1KBRA 1IN0A 2J0XA 2AEMA 3V81B 1SL2A 3O9TA 5EOYA 1FESA 4HI1A 4H0VB 4HDGA 2UVUA 4WFXA 2QRRA 1WSGA 1IJEB 1CSJA 2ZHOA 3ILLA 4CESA 3UDLA 1YVNA 4FJNA 2WFBA 1Q9YA 2NRTA 2DHXA 4BREA 3QGHA 1URNA 5C7PA 1CLQA 4CZGA 2Q97A 2E88A 2R7QA 1XK8A 4CLYA 4U96A 1HYZA 3H5YA 3CCVN 4ES1A 2QL7B 1VFJA 1CULA 5I42B 1FWPA 2O01C 4OV1A 4B3OA 2F63A 2UUBF 3MR7A 2YNFB 3NCIA 5KFSA 5CABA 2BM1A 4BRIA 3C6UA 3CPWR 4F8RA 3EEQA 2UVRA 3UN3A 5HRSA 1IQTA 2J7KA 3E2EA 3VEOA 4OYAA 2P9UB 3IS9B 5MAOA 5H1SQ 1UVMA 2A18A 4DUZK 4TN2A 1VOMA 4O4GB 3CC2S 3DHWC 4IG0A 2EXUA 3OXFA 2LU1A 1N6QA 3PV8A 1F1BB 3RR7A 2RS8A 4ZCMA 5KFCA 3ENBA 1YJWN 1BA0A 1HUXA 5AE1A 1VSFA 4USUA 2A1BA 3J7A1 1NNDA 4UZBA 5F8GA 4F36A 3O44A 2HFNA 1BD6A 3IA0A 1HKCA 5HMXA 4CH0S 2Q43A 5LJWA 4FLXA 1Y4ZB 1B64A 1C1BB 4FJKA 1VQSA 5GMEA 4X66F 3TQ1A 1I94J 3VQCA 3PX4A 4B08A 4YOYA 1SVDA 3SQGB 2E9RX 3HO1A 4OHXA 4B9MA 3GONA 3OUYB 3AVMA 2YNGA 2LYVA 4Z37A 5KT3A 3ONQA 2GV1A 2W41A 3SXLA 1J54A 3PKYA 1KDNA 2RN2A 3VGVA 1M5KC 4BDYA 3UE2A 5KG1A 3GJSB 2LKZA 2YHAA 1OWXA 4CJKA 1EKEA 1E6YA 3KHGA 4PKHA 3UKUA 3KK1B 3GP9A 2ZJQQ 3V81A 1Q16B 2MKJA 5ETPA 3ZTSA 1G6BA 2ZNYA 1BOTO 1D9AA 5I42A 3R9PA 3WBZA 4DU8A 5J2MB 3ZNJ1 2DBBA 2E1CA 5KRTA 3TAPA 2QYCA 2QWNA 2EI5A 4CO4A 3MAQA 1N5QA 4O23A 3M2UB 3CGIA 4CO5A 1HBUB 2IVMA 3CULA 1X0FA 2W2MP 5DQIA 2C3OA 1RISA 2I6WA 2RKIA 4USTA 3N5FA 3ZETA 1T02A 3D45A 2LQ8A 3AV9A 3SUPA 2NQPA 4DTOA 3FCVA 4KHYA 8AT1B 2O8CB 3MUMP 4WFBQ 1JKHA 1K1SA 4X65K 2O8DB 3W9JA 3C19A 3I55N 4ZP7A 4JKGB 2B7BB 1Z1ZA 2KI2A 2UXDF 4AXJA 2VV5A 1EARA 2A2DA 4CHYA 2Q66A 4CGFA 4LFCK 5C2GA 5C5JA 2LA4A 4O3PA 4DR4F 1DTTA 3G6VA 2EFPA 1QSYA 3VF4A 1CJVA 4YDUA 2CZ4A 2ROEA 1TKZB 2CXEA 2UP1A 1MNEA 1TUYA 2KH9A 3OLBA 2BTFA 2VPWB 1GTEA 4Z4EA 3L4IA 3JQJA 4ILRA 2DH9A 2M2BA 3OA9A 2DGSA 2CQHA 3K8WA 4JRPA 1IH7A 4W90B 4DTJA 4OJRA 4RU2A 5IT9U 2I7NA 3B4DA 4M63A 3GE9A 2YJFA 4CJTA 3IR6B 1IBMF 4CEAA 3G82A 2ZM6K 2ZJPL 3H5SA 3F9MA 3OBIA 2HVHA 3OFEA 4OV6A 3SBTA 1QE1A 3S6EA 3VAKA 3CHWA 2GAHC 1GOBA 2WC9A 5DG8A 1M1KO 5AJ3K 4PQUA 4DR3F 1Z2LA 2MZTA 1T03B 2K7KA 3H2LA 3J81O 3PIPQ 3U1NA 4BRLA 3AQOA 4J9QA 2B4OA 1FX4A 3TTCA 4JI3F 1L3TA 3OYDA 3N6MA 4JB8B 4N8OA 5IM0B 1FE4A 3G9CA 1J5EJ 1YT3A 3MEDA 4RWWA 4Q0BA 2AYMA 3AJ1A 1GXUA 4H0TB 1YHQN 2IJFA 5HQ8A 2MPUA 2ZHAA 4KBOA 1UWAA 2E29A 2P2CB 3K5PA 3AVLA 5HJYA 4H4OB 5AQVA 2DNLA 1F5BA 3SUQA 2UXCF 2ZUGA 3PDNA 3C94A 3AA8A 1EETB 3LH2S 4H4KA 4ZVRB 4FM0A 1R8BA 2PA8D 2CQ3A 3UN2A 4BRFA 5IOLA 3SCLE 3HDSA 5GADI 4YR2A 3EZOA 4DV5K 5F0UA 2HSTA 2LU2A 1SKUB 1H7WA 4Q0BB 3VAFA 2IJNA 1FCAA 2VJVA 3LDOA 1Z2ZA 2UXBJ 4JKAA 4HUEA 1ZM3A 3H20A 4YNQA 3QICA 3T9NA 2YWEA 2YPYA 1YK9A 1RTHA 1YJTA 3SMPA 1WAFA 2FF6A 2YKAA 2EW9A 4U67Q 4EIAA 3GG4A 4LF7J 4QS8A 5EY4A 4I6AA 1VQ5N 4CFCA 5HI7A 2F40A 2KVIA 3U6FA 1Q1KA 4YQWA 3LDSA 2LP4A 1UZHA 4WTOB 1ZBFA 1E4FT 3R6GB 3NMRA 2ZBRA 4M5LA 1NK4A 3OPKA 4WZQA 1VGYA 3QFUA 4PQAA 1UWBA 3OFGA 1L3SA 1TL7B 3HBTA 4WQ4C 4EFHA 4RG8A 2K1RA 2GIFA 1YJWS 1HMVB 2MKIA 5HSPA 3TAQA 2ZZTA 4GVBB 3R8YA 3ILIA 5F0XA 2PBDA 1SZ2A 5C25B 3W5XA 5B0DA 3CD6N 2P5OA 2OD4A 2VBWA 1Y00A 4ELVA 4JI8J 3FBEA 1HWJA 2PI5A 3U9DA 4QWBA 4EFAC 3KUGA 2PZSA 1JNRB 2P1JA 3UR3C 1YJ9N 2LXUA 4PAAA 4F3QA 5IV3A 2JSXA 1LKZA 1RWPB 2IM2A 4DR2J 2CG4A 2LVWA 2FGCA 4RBUA 3QWPA 1S1UB 2EKNA 1VSKA 2QA1A 5T7LA 5CZVA 4O8KA 1FJGJ 4DR7F 1OH6A 2DGTA 4CJ5A 1UVJA 5IFMA 1ZBUA 3HCXA 4F3TA 3IFEA 4ZPTR 2XY6A 2P9PA 4MYUA 4LREA 1VQKN 2WSCC 2QWRA 3GIMA 4FZYA 3RAMA 2IVFB 3CQXA 2AV5A 3ITHB 3LDNA 3MUTP 1TKTB 3C14A 4OGEA 5DRKA 3VZIA 1AFIA 3OBYA 1JL2A 4RW9A 4ELUA 3J7YU 4XTTA 2IDOA 3VCDA 1EP4B 4FYWB 3N4PA 2XMMA 5B0EA 2V69A 4DFPA 1P8GA 1NO8A 2JLFA 5GAEP 3VHQA 3AAWB 4MAKA 2HZCA 1ZYQA 3IAS9 3ENAA 3MPDA 1VAZA 4Y2AA 1IBKF 4I7FB 4Z4IA 2AGPA 4DL5A 3KLHB 3B4MA 3GDQA 1NLKL 3HSGA 3J8AA 3PJXA 4URQU 4KAIA 1XR6A 2W2QP 1WC3A 4WYBA 2L9WA 2ZWHA 2W2OP 1V3RA 2A6OA 1NMDA 2V51B 2OMLA 4DV2J 4Y34A 2J6UA 5FD1A 5HLFB 2AGQA 1UEUA 2NXUA 3NF6A 2Z56B 4B3SK 3MM9A 4K42A 3SCXA 2NZCA 2BJ9A 4PXCA 4HT5A 4CLSA 1Q79A 3BKUA 2CPZA 2ZKTA 2VH7A 1RAIB 5DGAA 3K59A 1EQMA 3EL2A 1OKJA 4PPDA 4M3YA 4CHNA 1SQKA 3G6YA 3BEGB 3GIRA 5KFDA 1X4AA 4GV9A 1WOPA 3SYZA 2HLUA 4DX7A 2YKOA 2MQQA 1PYTA 3CCRN 4LSLA 1FDAA 1QQOA 1RDBA 2BE7D 3VTIA 2B4VA 3CPEA 2QT7A 5T14A 3EUNA 3FZKA 3JAMU 4TYBA 1L3UA 3NGIA 1HBMB 1Y5NB 3AAPA 3SZ2A 3S8SA 1HWKA 3NBPA 4DF4A 5AZJA 1VK3A 1X4GA 3J7AP 4JI7J 4P73A 2VQFJ 4I6YA 3D6FB 4TYAA 3IAM9 2D1KA 5SUHA 3BS9A 5JS2A 4K7QA 4BHQA 5HQLA 1SH2A 4OVLA 1ULRA 3CC4S 3EM1A 3RVCA 5EUHA 2CJYB 2QKBA 1LWCB 2OEMA 1X5SA 4ANCA 4KHWA 2CNKB 1HNWK 5CR4A 3CNQP 4KRFA 3CJRA 2XZWA 1VQLS 3SFUA 4JI6F 1WEZA 4P9SA 2KHCA 3QFWA 3DOMB 3DRSB 5CE3A 4HUGA 2OJ3A 3PTWA 5KAKA 1NH7A 1QQCA 3VGKA 2QFIA 1Y9OA 1T6DA 1P1TA 3MCSA 4OJHA 4JV5K 4A8QA 1TR0A 4YS2A 2ILYA 3FGUA 4E3SA 1K44A 2VJUA 2EK6A 3BZQA 3CJ9A 3A5MC 3OBWA 4JAXA 1YJ7A 3RU0A 3X3UA 1VSEA 3ZNUA 1HWLA 4ZCIA 5LXYA 1SH3A 3KLFB 5IS2A 1OY8A 5E0OA 4DV0J 3D28A 2D0CA 3MEEA 4B1XB 2IY5B 5EXWA 2GCFA 4PL7A 2NUUG 2O8EB 2OD6A 5BPNA 1YITN 4CJQA 3I87A 2Z2LA 3THPA 1T94A 2PMWA 2WOMA 1S12A 4C2MA 2XSFA 1B70B 2A41A 3U02A 4ECTA 4X4UA 4UW2A 2A1SA 5EX3A 2OPPB 3N28A 3MX2A 3BGRB 3M9NB 1Y97A 4KGZB 3OJSA 1WSVA 2MKKA 1J2VA 4BC7A 2P9PB 3NGRA 2MKHA 3QT7A 5F8JA 1H73A 4KV8A 2VBXA 5IT4A 3OLAA 4DV0K 2B4UA 1H72C 4FSVA 4LIRA 3N4WA 1LXJA 3VERA 4IOAL 4JD2B 3FEXB 5BN8A 5B0GA 3CIZA 3D2FA 2M5YA 1WF2A 1S77D 3HKZD 2KHDA 4ZVSB 1L5UA 4ISEA 4FJ9A 1MWYA 4CBWA 4DV5J 1WKKA 3MPWA 4FLTA 3CT9A 3AVJA 3DN9A 1PILA 2E66A 2UVWA 3PZPA 1BUXA 3B6PA 1NK5A 2QWMA 1BQMA 1O6XA 3HHEA 2OFGX 4W5TA 4KHRA 3E9PA 1XIQA 2FIUA 4QS9A 3LPTA 1QSSA 2CJAA 3L4BC 5M1KA 1S0OA 5D3GA 2MY7A 4OX7A 2KJVA 3NE6A 2AP6A 1QQNA 3QLHA 3EPGA 1RBVA 3JTPA 4M41A 1RHQB 1U1QA 5L9XA 1NOZA 1HBOB 1HYSB 2BJ7A 4OMFG 4RNHA 2IVPA 1D9DA 2FUG9 1KLMA 4IFVA 4JI5J 2HMPA 1S1TA 4KH0B 4WF9L 1S6PB 3WUHA 4USWA 2D41A 4CO2A 1Q7LB 1N5TA 3FBCA 4H5RA 1IBKJ 2XYGB 1PAUB 1ATRA 3RB3A 1K8KB 4FJHA 2ZH6A 2D7SA 2XMTA 4GO5X 5BR8F 4FS2A 2GX8A 2BJ8A 2GS8A 3NCPA 1BCOA 2ZJPQ 1J53A 3VAGA 4BRDA 1QZ6A 1V5IB 2QSWA 5GMKa 4FPAA 3QIOA 4CEQA 3VEZA 5B0BA 4NEZA 4FXWA 4P2MA 2IGIA 2I8EA 1HYSA 3MM5A 2A6AA 4IEEA 2K8GA 1NBEB 1RXOB 5GADU 2JEIA 1PGZA 3SCJE 3VGUA 3DLGA 4F50A 2KZZA 3ZXWA 3EVMA 2CZ9A 3SMSA 4PPZA 2VUGA 2ASDA 1YGYA 3FEYB 3KVGA 4I2PB 3MEDB 4Z2XA 3PSIA 4LH5A 2KRBA 4PG5A 1QVGM 2VKRA 1AT1B 3THYA 1BUPA 3H25A 4RW4B 3CI5A 3A5OC 5I9EB 2OSRA 1MN9A 4CERA 1LK7A 5KFTA 1XHZA 4AL7A 1TUUA 4JS5A 2NZ4A 4TLRA 2JHEA 3GV5B 4IH5A 5E33A 1MMLA 3J81U 3QBWA 1NDLA 5J1EA 2WONA 1S9FA 2PIIA 4J9OA 2O4IA 2V6AA 4DV5F 3KIOA 2XS7A 3H5UA 4CFAA 3W66A 3WXKA 1U1KA 4KI6A 2O8FB 4DPUA 2YNIB 5FDLB 3CCLS 3CJKB 2D1CA 2YKMA 2F9DA 4OKKA 3U1LA 1EX8A 1HX1A 1X4EA 1YITS 2YNHB 1QUPA 1FWLA 2DYAA 3IBCB 2HNZB 1OSCA 3B8HA 1NM1A 2QLJB 3FDSA 1QVFR 5GADP 4N77A 3UB5A 2W42A 2P9KB 1ZZFA 2KG0A 1ATNA 5KG5A 3SPZA 2QFJA 1U2CA 2XC9A 1SQEA 3KWMA 4K8ZA 5C42A 2EWHA 2ADCA 1L3KA 4MK7A 2NNWA 1WOOA 2OPSB 1XBWA 3I5AA 3PM9A 2FPHX 3KD1E 4M95A 2RU3A 3FBFA 1NGEA 4OYBA 2YI1A 3DXKA 4CLZA 4MH8A 4H5VA 1R3NA 3O08A 3VETA 1GLBG 4Z4GA 1F9EB 2A10A 4CHQA 2YX7A 1JKHB 4FJLA 1VQ8N 1KTQA 1X4CA 4GMJB 2VPXB 1F6TA 5HP1B 1R8PA 2V9WA 3V6DB 4JNEA 3U7JA 3CB4A 1N5YA 2RIJA 2ZH9A 1X4BA 2OAUA 1RBAA 2YX6A 4I9LA 3RRHA 5J1PA 3DLRA 3CC7S 3C46A 1DZ5A 1JMTA 3MR3A 1N36K 3IGVA 1CJUA 5ETQA 4DV1J 2HFSA 3QEPA 4CFDA 1KR4A 3HSTB 1KHVA 5HVFA 4ZVHA 4O0JA 3C6TA 3BH7B 2H54B 1N5SA 5K14A 3O9UA 4C97A 1RDWX 2W4DA 2FHOB 3WQTA 5E41A 1FW6A 2IM1A 5M2RA 3MEGA 4O0NA 1HNZJ 4TVAB 4S0MA 3I31A 3A1YG 3DGVA 3ENVA 1SC4B 2HQCA 1SPBP 3WXMB 2PFDA 4HH1A 1N52B 1RE1B 3TYTA 2IM0A 1XQIA 3O8MA 5THWA 4GNIA 2NLWA 2V4RA 4BROA 2PA3A 5AZJB 4DL7A 3P4UB 2CDQA 1KXPA 3GTYX 4C1NK 2HAIA 3MN9A 3MCNA 2E6LA 5IC6B 1I3OB 4JKDA 4OZ3A 1NCLA 4M3ZA 2JVOA 3VEXA 5KOWA 3CDUA 5DQGA 2V67A 4CJ7A 3J81Y 4NLUA 2FVPA 4GVLA 4LF5F 4LF4K 3GIIA 1NGIA 2OIHA 2QV6A 3NOGA 3A8YA 5BRFA 4A47A 1GX5A 4JKFA 2RHQB 3N6NA 1H98A 3IP0A 5HAOA 5FJ4A 2V8HA 3BR9A 3CCZA 1H2TZ 4J9SA 1G15A 2PDAA 1VQPN 4JYAK 3W5YA 2N3LA 1R59O 5HANA 4B9LA 1UVIA 1B4SA 3QESA 3OS1A 3PYFA 2HHUA 4FWMA 5AQMA 2GWKA 4DU1A 3OYFA 1N5YB 1SC1B 4DV3K 2GHVC 5HN0A 5AQIA 3Q22A 5F3ZA 3H5XA 3JTOA 3BM7A 5GAHI 4DL2A 3EZWA 3CJBA 1T0TV 2CJKA 4CEEA 1HKBA 5KPZA 3T1YF 3VQQA 3ZSWA 3IN5A 1PC4A 5RUBA 1LWEB 4OJ1A 3BR8A 5D77A 3G87A 4IH7A 4KY3A 3SI8A 3VV2B 3BGOP 2KKZA 3K9JA 3CMEN 5KFIA 4BC9A 2O8BA 5DQHA 4N7TA 3E9OA 2FHKA 2VIHA 3LM9A 4IO9Q 3NH0A 3OYMA 3M8WA 5AXKA 1RWWB 2BZ2A 4ZN1A 2H5JB 1Y64A 3T1YJ 4CI6A 5D4PA 4WFBL 1KS2A 3ITHA 1FKOA 3QFPA 3V1OA 3VQ8A 1HPZB 2VOOA 3MMBA 5LL6Z 3KHHA 4QU7A 3GJQB 3CD6S 3TEHB 4O5FA 1U45A 1LOUA 1KC8T 2NRVA 3THTA 5SWMA 4K2XA 5FDLA 1HBNB 1YVFA 2P9EA 1KONA 5ADZA 4CM0A 2V2ZA 2BQRA 4YOWA 5T7LB 3OR2B 1NPPA 4CLPA 3S3NA 1RT7B 2P9NA 4BQLA 1ZA1B 4IFYB 4HLBA 3TZXA 3QO9A 2K7JA 3W60A 1KVJA 4RW8A 2V2VA 3O8WA 1YXQA 2KFZA 4DV7K 3CDEA 3JSYA 4DV6J 2FC9A 1HMVA 4OI6A 1FK9B 1NSPA 4DU7A 4OYXA 1HI8A 1EJ7L 4ISFA 3QAUA 2KM8B 4X65J 5EU7A 1Q5VA 3OYCA 2B8PA 1KC8O 2QLWA 3S41A 1JXLA 4GKJF 2VU5A 4M5GA 4CO1A 2VQEK 3EPIA 3DLJA 1TK5A 3BF3A 4I67A 2OH2A 1NOYA 1F5CA 3D68A 4GKKF 1T05B 1HQEA 1H0HB 1ZM2A 3O6QA 3IR7B 4BWMA 4FZVA 5KRSA 1WSIA 3OTEA 4FZZA 1W7AA 3H7HB 2CVEA 1NHUA 2OTLN 4DV0F 4OYZA 1T3VA 1E6VB 4MIWA 3OT9A 3JSMA 3M8ZA 2RS2A 1O13A 1YHQS 4E7IA 4JHDA 2P9LA 4MYTA 3KG4A 2VPYB 2HHSA 4H0OA 5C10A 2DR9A 3QZ7A 3WC0A 3C7NB 4HKQA 4WK3A 3FZLA 1YWXA 1SUQB 2RT3A 3G8SA 1S99A 1Y3JA 4IRDA 1L3VA 1W0HA 5M2UA 4KC5A 4ZLLA 1NU0A 3WDOA 4W5RA 2ZC3A 4HT7A 4IDHA 1X4HA 4H54A 1MWKA 4OYPA 4W5NA 1JLGB 2P9IB 4JV0A 3E3XA 2FLOA 3HHLC 1HHSA 3P1GA 2IDLA 4DS4A 2DISA 1VSMA 1JLGA 1ILYA 5L39A 2V63A 1LW0A 2XHCA 1NK7A 2J4RA 1S0MA 3OHRA 1AFJA 2LXFA 1QLNA 1FJCA 2ASJA 1NGCA 1M1KT 5L8RC 4CLKA 4FK2A 2DTJA 1RSCA 3KWGA 1XJWB 3M2VA 5EN1A 3FMBA 1KQSM 1C4AA 1X4FA 2AJFE 4CCHA 5ITHA 3LWLA 1RCHA 5DDQC 2XLJA 3JS6A 1FA0A 5HROA 4JHDB 4TLQA 3NS5A 3OYEA 4HTUA 3G82B 1ZBTA 2GGPA 4BVPA 1EIYB 2LEBA 3CJQA 2XSJA 6AT1B 3BQ1A 3TANA 1WUAA 4NLPA 2CVIA 4KGMA 5A0YB 3P31A 2Z30B 3OL6A 5IT9O 3D6MB 2MDAA 2OHDA 4LF9K 2ZNZA 3VEVA 1RAEB 1OH8A 5J1NA 3MM7A 4GRSA 4Z94A 2R2SA 1YKWA 1NJXA 2JDJA 3MAAA 3CG7A 2H3GX 3TRGA 4CJRA 5T7BA 1S6QA 2V7YA 4CLLA 4M8LA 2C22A 2HG4A 3LDQA 1VHFA 3F9KA 4ERDA 3HSZA 2FB0A 2Y9HA 2HWHA 2AEFA 4QIEA 3VGMA 1NJWA 4PABA 4IKFA 5GVQA 2HVIA 3QSIA 5AQTA 3R1LA 4BE1A 3PY8A 3RW6A 3V6KA 3PW7A 5JMVA 5EWEA 4OYMA 2E2PA 2D9PA 1U1OA 1WF0A 2CQPA 4NLGA 3VQAA 2JLGA 4DEZA 1OS5A 4DR3K 3Q8YA 1N56A 2D3OR 4OGCA 2UZAA 4FL9A 2BJDA 2B5JB 4O3OA 2AYBA 5KFKA 1IG9A 2APOA 2DRDA 5DJBA 1LFWA 3DRPB 2B4PA 4TKTA 2FVSA 3FUYA 4EU0A 1VBKA 2X7IA 1VQ9S 4QIVA 5LSLA 2DXFA 5GAGI 1KVBA 2HBLA 3G6EN 1I94K 3IWNC 3L8BA 1Q8IA 2DR7A 3LP1B 4C8LA 1Q86T 1U8SA 5AXLA 4ZP8A 4M5KA 2HF3A 3JS9A 3QGIA 1HBMA 1RT2B 4F4YA 3L9ZA 5J2QA 3SQGA 3AVFA 1BU6O 4PXEA 4ETXA 2AT1B 1EAYC 4V1Ak 1CC8A 5ETNA 2IFXA 4BG9A 4JRQA 4Q44A 2JZ5A 4MMOA 4FCYA 1K9MT 2G8FA 3AGRA 2Y1JA 3BGLA 3KJVA 3GYGA 4F4XA 2MYFA 1LWCA 5D15A