1N6QA

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n6qA05
3DM2B 4BDYA 4CCHA 3LPTA 3ZSXA 3SQ2A 4NYNA 4EBEA 3NH2A 2VG7A 5KFGA 3LZJA 4XO0A 3IS9B 2XCAA 3MEEA 1VSIA 1QE1A 4ECUA 5KT4A 1UA0A 5DQIA 4TQSA 1S0OA 3DLGB 4DG1A 1RA6A 3PW0A 1TKDA 2E9ZA 3V9WA 3V9SA 5KGWA 3DLGA 4I7FA 2QV6A 2F8TA 1FKPB 1KVAA 5DMRA 3NFAA 4ZPBA 3ZCMA 4F4ZA 2IMWP 3SFUA 3LPUA 2B6AA 4IR9A 1JKHB 1S1VB 5HBMB 1QSYA 4ELVA 1TKZA 1SV5A 3A2FA 5KFEA 4K4YA 4RNOA 3E01B 3I5CA 4CJQA 2WB4A 3RTVA 3D0PA 1TVRA 3AVFA 3L2RA 1IKXA 3NGIA 1TK5A 4Y2AA 2BRLA 5C42A 4PWDB 3QO9B 3DOLA 4DL6A 3AO2A 1QE1B 3KD5E 1TP7A 5I3UA 2E6MA 4TY8B 5J2MA 3LWMA 3V6KA 2I1RA 1J9AA 3VQ6A 3RB6A 3G6XA 2X74A 1RBRA 4Q5VA 4CK1A 2VG7B 2GIQA 1YTAA 4G3IA 2JEGA 2ZD1A 2DPJA 1GOCA 2UUTA 3GIJA 4FM1A 4CEFA 3KK2B 2HNYB 1C1CA 4DTPA 1HQEB 5KFOA 4ZMMA 1VSDA 4CF8A 3V9UA 3M8PB 3VQ7A 4AHTA 4WXOA 4N47A 3Q8PB 4IDKB 2G8VA 5I42B 2R8HA 4B9UA 4NLPA 1XR7A 4FVMA 3GV5B 1N6QA 4NLWA 4DU3A 4FJNA 1NJZA 2YKMB 1TL1A 1RTIB 3AVCA 3D28A 1C1AA 3MAQA 2R2RA 2P5GA 3LZIA 2FJWA 3DRSB 3Q8SB 4HUEA 2F8EX 4CJVA 3DOKA 4DFJA 4DSJA 2WONA 1ZTTA 1GOBA 1J5OB 1WSIA 3QESA 1RT3A 4XIUA 4HCCA 4H54A 3ZT4A 2HNDA 2GV9A 3IRXB 4CEEA 5F8IA 3TAPA 4E1NA 4O44A 1LWEB 4B08A 3KK1B 4EP4A 3RMDA 4TXSA 5KFIA 4FBTA 3ISNC 5KT3A 3OJSA 3P83D 1NK6A 1NKBA 1LAVA 3CM6A 4CHQA 3RBDA 5CZ1A 3WNGA 2LSNA 3KLHA 3KIOA 3V9XA 3NAHA 3C6TB 1S0NA 3HP6A 3AVBA 4I2PB 2E6LA 4IG0A 3TAGA 3HPOA 3ZSRA 5K14B 3FFIA 5J2PA 4KHYA 4O3NA 2YNHB 1TAQA 4J9KA 4QWAA 2ALZA 5KT2A 2BR0A 4CECA 1LW2B 3PW5A 2FBTA 3LP2A 3PV8A 4DSFA 4MQ3A 3HO1A 4LSLA 3LP0A 5J2QA 4OL8A 3BSNA 3SV4A 5HROB 4O55A 3AVJA 3TWHA 2JLEA 3QGIA 3F9KA 3KKSA 1HQUA 3T1AA 2R2UA 1W9HA 2W9CA 2XY6A 3KHRA 4QW9A 3CVKA 1VRTA 5KRSA 2YV0X 4YNQA 1VSLA 4IBNA 1HYZA 4KV8B 4JLHA 4KSEB 1DTTA 1CZ9A 2KQ2A 4KB7A 1ZBHA 4QAGA 3MECA 3DLKA 2XI2A 2YNFA 4I9QA 3TANA 1KRPA 1Y97A 2HHTA 4ED8A 4QWBA 3NF6A 4ECQA 1K1SA 3JYTB 1TKXB 4FS2A 1WLJA 3SNNA 2DFFA 4K50A 4Z0UA 4K4SA 2G8HA 4E7IA 4MK7A 4FW1A 2C2RA 2R8KA 4M45A 5F8JA 2Y1IA 2YKNB 1SUQA 1NNDA 4FZYA 2XY5A 1QUVA 1O1WA 3OYAA 4KO0B 1NHUA 3LP1B 3C94A 1NKCA 3V9ZA 4I2QB 4OVLA 3QLHA 3HL8A 3BQ1A 3OS1A 3LP0B 2VG6B 4Z4CA 2RF2A 2B5JB 2HNZB 2BANA 2OPSA 3OSNA 3MFHA 4RW7B 1LWFA 1JLQA 2JEFA 1RT7A 4C8NA 4CIEA 3HYFA 4FM0A 4M3YA 4GVMA 4IRKA 3L2QA 2I5JA 3NMAA 4CFCA 2WCXA 4N56A 1NOZA 2X78A 3PX6A 2WOMA 4CJWA 2HB5A 4RNFA 1JXBA 1KLMB 3UIQA 1RDBA 4BDZA 2ITGA 1IG9A 2JC1A 3OSPA 4PA1A 4J9NA 5JXSA 2WHOA 1TK8A 4LH5A 4M42A 2G8IA 3DDKA 3CM5A 3KLIA 3T5KA 5K14A 4DLEA 1X9SA 3O3FA 3LP1A 3SUPA 3TABA 3VQQA 1T03A 1BL3A 4ID5B 4GC7A 3MXMA 3CFOA 4N5SA 4OLAA 3S3OA 2WTFA 1TK0A 1SL1A 1S9EA 4CJFA 4IKFA 3KLEB 2XHBA 2Q3SA 3G6YA 3OY9A 3KJVB 2Z1IA 1LAWA 1NJYA 3AVNA 3MEGB 3UDLA 3DMJA 2HVHA 5F9NA 3IG1B 2ZKUA 4ZHRB 1QS4A 3VQCA 5CYMA 1S1XA 1L3VA 2HNDB 2ILYA 1SKSA 2R8JA 2J6UA 2W9CB 1UOCA 4KHWA 5DG8A 4B9MA 2ZE2A 1Q8IA 3OVNA 3DLKB 1UWBB 4LD0A 4KHUA 2XY8A 5HROA 1RDDA 1KVCA 1WNSA 2BQUA 3OYEA 3E51A 5EDWA 1N5YA 3M8PA 1B92A 3I0RB 3G86A 4KAIA 2AQ4A 1SKWA 2YNIA 3GILA 4BDPA 3PJWA 4RW6A 3QEXA 1KSPA 1QHTA 4FJ7A 3QNNA 4O4GA 3L3VA 2IC3A 2C2EA 3VQPA 1C1BB 4AHUA 3N6NA 4H4MA 1DTQB 4DTXA 4FK2A 5KI6A 3NF8A 1D0EA 2KZZA 4NLYA 1X9WA 4CHPA 3KLVA 4ECYA 1S1UA 3K5LA 4Q0BA 4K8XA 4M3UA 4O3OA 4QWCA 4BWMA 4F2SA 3FFIB 1CSJA 3TR8A 4BE1A 1ZTWA 4RW8A 1TL3B 4CIGA 2KFZA 5KFNA 3M9OB 4RW9A 4O3QA 5F8NA 2ASDA 3ZSWA 3VA3A 4RW4B 4OJRA 2RN2A 3PJXA 2IJFA 4RNMA 4FJXA 3UPFA 2ASJA 4CEDA 5KRTA 3K2PA 5DQHA 1IKVA 2IS3A 1LWEA 4URGA 4WYWA 1HYSB 1J54A 3MF5A 2OZMA 4YR0A 2ATLA 4IH5A 2FBYA 2BE2B 5FDLB 1OS5A 5KFFA 5L1KA 2AX1A 3RB4A 1HNVA 4IOBA 1RBUA 4KI6A 1JIHA 4DLGA 3SPZA 1BCMA 1S0MA 4O0IA 3DLEB 1I3AA 4KI4A 3EZ5A 1UAXA 4KHQA 4CE9A 1TKXA 1JLAA 2E4LA 3PX0A 1RT6B 1RCHA 4EP5A 1JLGB 1X9MA 1LW0A 3SUQA 4RUAA 5CYQA 3CJ5A 1I6JA 4IDKA 2QKBA 3SQ0A 4FLXA 3LAKA 1JLAB 3PR5B 2XCPA 1YTUA 3DOLB 3M9MB 4DS5A 2NUBA 1D9DA 5DLGA 1IKWA 4ED7A 5FRNA 4EBDA 1IKXB 2P1JA 2ASLA 4IR1A 3MXJA 1BQMA 4EBCA 2F96A 4ZPDA 4C8KA 1HYVA 5HP1B 4DF4A 3CDUA 1ZBLA 5DK5A 2RPIA 4K4TA 3C6UB 2IM3A 4CEBA 5KFMA 4NLOA 4F3TA 3HK2A 1WSHA 3RB0A 3SZ2A 3LP2B 4MIAA 1U47A 1IKYB 5KG5A 4H8KA 2CKWA 3B6PA 3SQ4A 1XHXA 2AGPA 4NLUA 3SQ1A 2OPPB 1ASWA 1S1TB 3KK3A 5FDLA 3AVMA 1B9DA 5HBMA 3G0ZA 3EY1A 3TVKA 1HARA 1RT2B 3S3MA 3MR6A 3OL7A 4TY9A 1FK9A 4ZPCA 4DTMA 2G8WA 3MEDA 2HHWA 2HMIA 3HJFA 3VQAA 3PVXA 4K4VA 3L2UA 1U48A 3V1RA 4F50A 3IRXA 1FXXA 1RT3B 4J2AA 4DFMA 1XC9A 5SZTA 3KOAA 3OYKA 4E7LA 2YNIB 3AA2A 4E19A 3JSMB 2DTUA 1RBSA 1QTMA 4CIFA 3DRRB 4MKAA 1YVUA 3V4IA 3EPIA 1RDAA 3H40A 5F8MA 2OPQB 2OPRA 3BDPA 4CJPA 4NCBA 4CJKA 1BQNB 2PYJA 3DLRA 3C6UA 3QGGA 1HYSA 4CHZA 5I42A 1RNHA 3CFRA 4NRTA 4EO6A 3D45A 4B9NA 3SUOA 1D9FA 3OL9A 3GIMA 4GMJB 5HRNA 2IBKA 4BE2A 3EZUA 1RBVA 2D5RA 5KG0A 4IQXA 4MH8A 4J9LA 4OKEA 2ZD1B 4KB1A 4RW9B 4DFPA 5L9XA 2D41A 4J9OA 2G8KA 4FJ8A 1S1XB 3MR2A 3QETA 1S6PA 4Z4EA 4NLDA 4TY8A 1TAUA 4AILC 4KKOA 3AA5X 4CEQA 1FKOB 4ED0A 3QNOA 1HMVA 4M3ZA 1SKRA 1S1WB 1W25A 4CGDA 1FK9B 2XGQA 4I9LA 3Q8QB 1C6VA 4DU1A 2G8FA 4H4MB 3FQLA 4B9LA 2IC3B 2EC0A 1Z26A 1Q9XA 4CGFA 1BIUA 3OYMA 4NZ0A 2J6SA 4RW6B 4DTNA 2W9AA 3NH0A 3GQCA 4CF0A 3L2WA 3I0RA 4LSNB 3PW7A 5KFUA 3QEWA 2KW4A 2B5JA 2HNZA 4WFZA 2XO7A 3H2LA 1CLQA 2R2SA 4AHSA 2FJVA 3KTQA 3QEVA 3KLGB 4IG3B 5C25B 4JV2A 4O3RA 4CHOA 3PO4A 3KLFA 3CDWA 3NGZA 2OH2A 4CEAA 4YP3A 4RW4A 1J53A 3CQ8A 3LALA 2HW3A 4EZ6A 3KJVA 1GOAA 1D8YA 4FK4A 3OL8A 3V81B 2IJNA 3BSCA 5KFWA 3T5HA 3PW4A 4KFBA 4KHNA 1HPZB 2X6SA 3OL6A 1RT4B 1JX4A 3S9HA 2C2DA 3SYZA 4KHRA 5JUMA 1VRUB 1S10A 4NRUA 1RTDA 3TI0A 2QKKA 3BREA 4M94A 1W0HA 2AU0A 2JGUA 4K4ZA 3V6DA 1RT4A 4W5RA 2FVPA 1D1UA 4RU9A 1LWCB 4LQ3A 3H5UA 2YNGA 4JUZA 4E1MA 3O3HA 2FC0A 3G10A 3AVHA 3RMBA 4F4WA 3ZSYA 3JYTA 1NK7A 2O5DA 1VK0A 3LP3A 4DMNA 3HKWA 4DTUA 2GBZA 1RDCA 3VN5A 1RT5B 4Q43A 2E9RX 1IM4A 2DY4A 3ZT2A 2HWHA 1IKVB 5KFYA 4FS1A 1BCOA 2EX3A 5KT7A 1R0AA 4M3WA 4YFUA 4EYHB 3O4QA 3SUNA 3PO5A 2R8GA 1S1UB 1VSJA 4HKQA 2O4GA 4UQGA 1YT3A 4K4UA 2IM0A 2UVWA 2FLPA 5KG6A 1SUQB 2XY7A 5KG4A 3NKYA 3NF7A 3OJUA 2GC8A 3VQEA 4E7HA 2XWYA 2V9WA 3WNEA 1WAFA 1T7PA 1SL2A 4M3RA 4F4YA 3DYAA 4TN2A 1A5WA 1Z25A 4CK3A 4Q0BB 3RR7A 4FYDA 3BSAA 4L8RB 4NLQA 3L8BA 2C28A 3ULDA 2GUIA 3TAMB 1KLMA 1C0MA 2R2TA 2D3UA 5L1LA 3SFGA 2BQRA 2EHGA 4C8LA 4Z4GA 2W9BA 3AO4A 1VSMA 4ZVGA 2ILZA 1VSHA 4J9RA 5F8LA 2V0NA 4J9PA 1MU2A 4CHYA 2Y1JA 3IGNA 1N5YB 4ZPAA 2W9BB 3QLHB 3VQSA 2HWIA 1RT5A 3SPYA 4F4KA 3FRZA 2UVVA 3UQSA 3UR0A 4PUOB 4ID5A 4M95A 4TLRA 4AHRA 1N56A 4XPEA 1KTQA 4JRQA 3QYYA 1SH2A 3HVWA 1EKEA 4IRCA 3DMJB 1RTHB 4DQQA 4RG8A 3DRRA 5SWMA 4CF9A 5F8GA 3JSMA 3CJ0A 3QINA 4O5BA 3H5SA 1S9FA 3KLEA 5F8HA 4DFKA 2AWZA 5KFZA 3HP9A 1U09A 3PHEA 4DL4A 4ZP7A 3NGDA 4FLUA 5HLFB 3FDSA 3VQ9A 3PW2A 2Z1JA 3MXIA 5KTQA 3VQ4A 4DTOA 1WSGA 2HMIB 4WYLA 3KLGA 3OLBA 2B43A 2BQ3A 2FLLA 4WFXA 3KLIB 1R0AB 3H4DA 3DYAB 4CFBA 2BRKA 1RT1B 4Q8EA 2DFEA 3K58A 3S3NA 1T05B 3ALYA 4O44B 4R5PB 4MK9A 4WZMA 1T3NA 2QE5A 4E89A 1ASVA 4IH6A 2V4RA 1EX4A 3NBPB 3I8DA 5DGAA 4FJJA 4R8UB 3PZPA 2QK9A 4OLBA 1HQUB 4O3PA 5C25A 3N6MA 4O4RA 4ZP6A 3T5LA 1FKPA 5J2QB 3MFIA 1RT7B 3P1GA 3H08A 4EO8A 4DG1B 2BANB 2OPSB 4DTRA 4DU4A 5JS1A 4U6PA 3QZ8A 4M3TA 1LWCA 4LH4A 4RNNA 4DL2A 2W42A 3VQDA 2VWJA 4JS5A 3H5YA 4Q8FA 2A1RA 4FJ5A 1SV5B 1WNEA 3L3UA 1S6PB 5EWFA 1ITGA 2D7SA 3AO1A 1EP4B 2KZMA 3V1OA 1BHLA 5KG3A 1B9FA 3MECB 4CGGA 5KFKA 4J2BA 4J9SA 1K6YA 2FJXA 2YHBA 3HPHA 3SCXA 2WK4A 3TAFA 1S6QB 2WRMA 4FW2A 3V81A 3TAQA 3PX4A 2ETJA 4MFBB 3LAMA 4FXDA 5EWEA 4Y3CA 3ZT3A 1BISA 5J2NB 5KFVA 5I3UB 5FROA 3AVKA 5CZ2A 5HRPA 2PY5A 1S49A 4CJ4A 5KFBA 3OYLA 1HPZA 2XRIA 3QZ7A 2X6NA 1BI4B 5HRRA 3OYFA 1VSEA 5F9LA 3HXMA 5CY4A 2R7YA 2D3ZA 1NJXA 2AGQA 4BWJA 4MK8A 2P51A 4TQRA 3DLBA 3RWUA 1RTJB 1TKZB 3HVRA 4DSLA 1S1VA 4FJ9A 3OYDA 4TYAA 3BJYA 2QXFA 2YHAA 2Z1HA 1SH0A 4ZVHA 4CF2A 3T5JA 4CEZA 3KMQA 4NYZA 1EETA 4F3OA 3NCIA 1WSFA 4WE1B 4M3XA 1UA1A 4F2RA 3U3YA 3AV9A 3OYGA 4IH7A 2RKIA 1KHWA 4ECXA 3IS9A 3M9NB 1TKTB 1JL1A 1C0TB 2FVCA 4KHSA 1U49A 4NCGB 3BQ0A 2RDJA 3ASMA 3KHHA 1CXQA 3HM9A 1S1TA 3KK3B 1KHVA 4PY5A 4O3SA 2HHQA 2W8KA 1HMVB 3AA3A 1JLCA 2W7PA 4FJKA 1ZBUA 4WE1A 4KKOB 5C24B 4KE5A 5KFHA 1RTIA 4DTSA 4KAZA 4ED1A 1QSSA 3RR8A 1KVBA 1C1BA 3NH1A 4FBUA 3HVTB 5KFAA 4N76A 1GX6A 1JKHA 3MR5A 3AA4A 4BE0A 3HPGA 3CFPA 5T7BA 3CJ2A 3T19A 4DTJA 3ISND 4EEYA 1BI4A 1NHVA 1IKWB 4LY7A 2UUWA 3M8QB 3GV8B 4GC6A 5KT5A 5DG9A 3MEEB 4Y1CA 1NJWA 5E41A 4CJTA 1U04A 1IO2A 4FJGA 1JXLA 1NK8A 1A5XA 4URQU 3M8QA 5HP1A 4Z4HA 5T14A 3MEGA 3GV7B 4ED3A 3SJJA 2W7OA 3V4IB 2F8SA 4ZVEA 4DSEA 4O0JA 3DLEA 1JXEA 3ZT1A 4ZP8A 3KNAA 4ZVFA 3SV3A 4RZRA 2FVQA 2VWKA 1JLBB 1RT2A 2HHXA 3E01A 4CFDA 3OLAA 4YR3A 3VA0A 4DQPA 2RKIB 3CG7A 4CJUA 1LV5A 2XI3A 3H5XA 4DQSA 3EYZA 4FZXC 1JLCB 4E7JA 3M8RA 5C42B 4OPKA 3AVGA 2BDPA 5EU7A 1S9GA 4CK2A 1A5VA 2IAJA 3AO3A 4FJHA 4NCGA 4R8UA 4CJ5A 4FJLA 1JLFA 3I5AA 2BE2A 1JLFB 3RRGA 3WNHA 3TAEA 1TL3A 1BQMB 1S9GB 4NLTA 3QIDA 1RBTA 4ED2A 1T05A 4QWEA 4QWDA 2KTQA 4NLSA 3CYMA 3LWLA 3K5MA 4XPCA 4I2QA 5KT6A 3THVA 3LDSA 3QEPA 5J2NA 4ELUA 3BGRA 4PQUA 5L1JA 2DPIA 3NBPA 1LW0B 3IGVA 1RYRA 2D0BA 3PY8A 4X2BA 3AVLA 4MFBA 2UVRA 1D5AA 1ZBFA 4RW8B 1G15A 4FCYA 3PR4A 2IM1A 3QIOA 4Y1DA 4FLWA 2FBVA 3K5OA 3KHLA 3ITHA 3OHAA 4J9MA 2J6TA 3ZT0A 4NLVA 3C95A 4CJRA 3DLHA 2IDOA 3OHBA 1JLEA 4B9SA 2JEIA 4CGJA 4Y2CA 2OZSA 1NKEA 5CYQB 3NAIA 4ZTJA 1DTQA 2ZE2B 1JLGA 3DRPB 5L1IA 3AVIA 4Y34A 1ASUA 5CYMB 3U6FA 3O4NA 3IG1A 1DTTB 3D5MA 1S6QA 3I5BA 3NF9A 4TYBA 4NCAA 4DS4A 4KRFA 4NLXA 1HNIA 3M8SA 1S9EB 3BQ2A 1EP4A 4HUFA 1HNVB 1HJRA 1RYSA 4MKBA 4H4OA 3OYCA 3HVTA 1S5JA 1GX5A 5EUHA 1DLOA 1T94A 4OGCA 3ZSQA 3TQ1A 2VA2A 4QW8A 3DI6B 3ZSZA 4QPXA 1TV6B 3MTKA 4R5PA 4ECZA 2ZQBA 5C24A 1RT1A 3ZSVA 4JV1A 1MU2B 2PZSA 2V4QA 2UVUA 4HVJA 2E9TA 2AGOA 1TQLA 4HCBA 2VA3A 4B9TA 5J1EB 3RAXA 2BGGA 3CJ4A 3H98A 3OYHA 3RAQA 1L3SA 4IFVA 1T03B 4CJ3A 4CERA 3N6LA 4FK0A 5HLFA 2HHVA 4FJMA 4K4XA 4KHMA 5KGXA 4GW6A 3RRHA 4O4GB 1C0TA 2OA8A 3ZSOA 5KFTA 4B3OB 4CJEA 3OYNA 2AJQA 4KTQA 4NYFA 2G8UA 1S48A 3PUFA 3KK1A 2D0CA 2VG6A 1NK9A 1VSKA 4KTWA 3QERA 4NLRA 4DQRA 4DF8A 1NK4A 1UWBA 4RUCA 4W5NA 3U3GA 1XR5A 1QSLA 5J1EA 1L3UA 3OYIA 3O3GA 2YKNA 4ZHRA 4G1QA 4C8MA 4E0DA 3V1QA 3QIPB 1Z4UA 3HHKA 3NE6A 4ZP9A 3CO9A 3BR9A 2R8IA 3KD1E 1JL2A 3NAEA 2VG5B 1RTHA 1HRHA 4KREA 5KFLA 1RA7A 4OPJA 3K5NA 3CWJA 2AX0A 3V6DB 2XC9A 4DEZA 1NK0A 4KO0A 4ICLA 1XR6A 3VQ5A 1VRUA 1IH7A 1F21A 1ZETA 1JLEB 3OS2A 2HHUA 3ITHB 4KBIA 4CEOA 4IFYA 3OYBA 3OYJA 3WNFA 4AH9A 4ID1A 1QQCA 3GIIA 3DRPA 4OKKA 3ICLA 4IFVB 1VRTB 3TAMA 2WOMB 2RDIA 4F8RA 5HRSA 5D3GB 4QCLA 1RDRA 2PYLA 1N4LA 4CJLA 4AHVA 4NLGA 3L2VA 1RILA 3QO9A 1T8EA 1JLQB 4RW7A 1KLNA 3I0SA 4FLVA 4ECTA 3Q8RB 4KV8A 2W8LA 3I0SB 4N41A 4K4WA 3KKRA 3QIPA 4U7CA 1XHZA 1MMLA 3KMSA 4FLYA 4G1QB 1REVB 5DLFA 3NL0A 5JS2A 2C22A 4I2PA 3SI8A 3G6VA 4MIBA 5EWGA 2GIRA 4B9VA 1WAJA 2I5JB 2IAJB 1REVA 3KLHB 4OGEA 3CDEA 4EYIB 2Z1GA 4I7FB 1LWFB 4J2DA 3HSTB 4JV0A 3IN5A 4LSNA 2A1SA 3B6OA 1U45A 4DSKA 2RF2B 4IFYB 4ECRA 3TARA 1K1QA 2ATQA 4FM2A 4QOZB 5KG7A 4B3OA 4FLZA 5KFQA 5J2PB 3K59A 4KTZA 4TSXA 5D3GA 4YQWA 4AHCA 2JEJA 4ICLB 1SH3A 5KFJA 3C6TA 4W5QA 2KFNA 3DM2A 3RB3A 1I39A 3AO5A 4CHNA 2FBXA 2B4JA 4DL7A 3P5JA 3HVAA 1EXQA 2VG5A 2YNGB 4E7KA 4J9QA 3V6HA 1NK5A 4FZZA 4RNHA 4M41A 4OKJA 5KG2A 3GYNA 2JC0A 5KFRA 1L5UA 2YKMA 1QAIA 4HYKA 1BGXT 1RTDB 1TGOA 1TV6A 1CZBA 3DI6A 3OS0A 3H59A 3KLFB 4B8AB 1JLBA 4PUOA 4JRPA 5KFSA 3HT3A 3GIKA 2YNFB 1WSJA 4H4OB 1WSEA 5DQGA 4WZQA 2IGIA 4KB0A 2HAIA 3F73A 4ELTA 5FRMA 5KG1A 1RAJA 4HHTA 4HTUA 1S4FA 5DG7A 4FJIA 4WFYA 4Q45A 2O4IA 4Z4FA 4DWIA 1KFDA 4CGIA 2IOCA 5KFCA 4CFAA 4IG3A 4DSIA 4ECSA 4DQIA 1X1PA 1VSFA 4LSLB 3SI6A 1NOYA 4JS4A 1C2PA 3NDKA 1LW2A 1XI1A 5KFXA 3KHGA 4DL5A 4PWDA 2YNHA 4E3SA 4J2EA 3KK2A 1Q9YA 1S97A 4Z4IA 1WN7A 5C5JA 2OYQA 4IG0B 3QEIA 2IM2A 1L3TA 1ZYQA 1DLOB 5DGBA 2XGPA 1J5OA 4W5TA 4BACA 4YMEA 3BGRB 1N48A 2WONB 5J2MB 1S1WA 2FLNA 2B6AB 4URSA 3T3FA 2FVSA 3CJ3A 1FKOA 3MEDB 4EZ9A 5KFDA 1IKYA 3EPGA 1EETB 4FLTA 4IKAA 3NHGA 5KFPA 2P5OA 1TVRB 1TL1B 3RBEA 1CXUA 3VQ8A 1KCFA 4HUGA 1ZBIA 2HVIA 1N6QB 1RTJA 1TKTA 4CJSA 4CESA 4ED6A 4LQ9A 4ECWA 1QAJA 2OPRB 2OPQA 3FQKA 2OPPA 3MR3A 3DOKB 4IRDA 3H4BA 3VQBA 4YR2A 1KFSA 1HNIB 4WXWA 3FSIA 4Q44A 3DRSA 4W5OA 1C0UB 2FVRA 1C1CB 3RMCA 1YVFA 4B8CA 2DFHA 3NGYA 2CJQA 3AVAA 4C8OA 2IA6A 4CGHA 4KPYA 4R0EA 1BQNA 3K57A 3CIZA 4DL3A 1BIZA 4ZTFA 4PQUB 4K8ZA 2HHSA 4F4XA 1RT6A 4ECVA 1U4BA 3QGHA 2D0AA 3IAYA 3LANA 1HQEA 1SL0A 2HNYA 1C0UA 4CF1A 4KFBB 3RMAA 3BSOA 1XWLA 3V6JA
chains in the Genus database with same CATH superfamily
4CCHA 3CJKB 1OQ3A 2XNRA 4M7YA 3SEOA 4PL8A 4KGKA 4XO0A 3IS9B 2JL9A 3QFUA 3MEEA 2MKHA 1YI2S 1AZSB 4HLBA 2QLJB 5LL6d 1LK7A 5LMUF 5JVGQ 1T3VA 3CD7A 4TQSA 2WC9A 3NG8A 3PW0A 5DMRA 3NFAA 1XJWB 4WTYA 1K8KB 5IWAF 1PGZA 2OD6A 1ZPWX 1VJWA 3A2FA 3E01B 1S57A 3RTVA 2VQFK 3D0PA 3AVFA 2KKZA 2Z2YB 1IKXA 3NGIA 2OMLA 1NGAA 3JQKA 3ZEUA 3ZTQA 1QE1B 5I3UA 1FFWB 2E6MA 5J2MA 2AHOB 3V6KA 1LOUA 1T9VA 3VQ6A 3RB6A 4BC5A 4WK3A 1YTAA 1CQMA 4Q2LA 1V3ZA 1LWXA 3B54A 4TNOA 3GIJA 4FM1A 3KK2B 1C1CA 2IVOA 1HQEB 1NDKA 1VSDA 4CF8A 1KN6A 2AZ1A 3Q8PB 4IDKB 3WXMB 2ZZNA 5I42B 2R8HA 4B9UA 4PYDA 2G9OA 3N01A 2E2NA 4FVMA 2O8CB 1R0CB 1UTAA 4NB4A 1GXUA 3P4UB 2LEAA 1RTIB 2VF3A 3G87A 2B56A 1C1AA 3R3LA 3MAQA 2P5GA 4HUEA 1ILYA 4WQ5C 1FTCA 2ZVSA 2F8EX 2LVWA 2ASOA 5FD1A 4M5DB 2WVDA 2YPZA 1XNQK 2WONA 1WBBA 3JTOA 1NMNA 3QBCA 3SJHA 2AJ4A 3EDQB 3AOBA 2YJFA 3IRXB 1RLDA 4ILHA 5GAHI 1KAZA 3RMDA 1CEZA 3W5ZA 2EG2A 2LXIA 3D0HE 3GR0A 2HGNA 3GSDA 3UO0A 3CMES 2E44A 1RGVA 2Q79A 3KNGA 1URNA 4H5RA 4C0HA 2LSNA 1BXNA 4WJBA 4GKKK 3C6TB 3JXUA 3DDNA 4HVZA 3AGKA 4IG0A 4GRSA 3HPOA 4ILRA 5K14B 3EXCX 2C3PA 2VV5A 3WXIA 3CCQS 4O3NA 3T41A 3H42A 2BW7A 1TAQA 4DQ8A 4J9KA 2XYHB 1AXQA 4OV1A 4BR4A 3PW5A 2FBTA 2V94A 3PV8A 4MQ3A 4LSLA 4OL8A 3BSNA 2DO4A 3DXMB 4UUWA 2BXJA 3BZKA 3T1AA 2R2UA 2O8BA 3OTOK 5KRSA 2YV0X 4WK1A 4G65A 2WW8A 3FE1A 4IBNA 2V4JB 3CCLN 3NGKA 4V19S 1UKUA 1HI8A 2RHQB 2FTRA 1CZ9A 2E66A 1ZBHA 3RG6A 3LUYA 3MECA 4FYWB 3DLKA 4I9QA 3E9PA 1YBUA 4P52A 2DISA 1GXTA 3KJNB 2HHTA 2AYBA 1MDUB 3CCTA 1K73O 3G25A 3JYTB 2LA6A 3PYGA 1OH5A 2MQNA 4FS2A 3SNNA 2ZF5O 2BJ7A 1B0PA 4DU7A 2E5GA 2G8HA 3GFHA 3MUTP 1MWQA 3W66A 4LRBA 1IJFB 4FW1A 2Y1IA 5F8JA 3MTJA 1SUQA 4B1XB 2XY5A 1O1WA 2JRSA 4KO0B 1NHUA 4DR3F 3P96A 1NKCA 3CC4S 1HI0P 2HHHK 3D1HA 1GQEA 4I2QB 4CO1A 3I55S 3BQ1A 2IHR1 3W3DA 1KD1O 2B5JB 2HNZB 2VPYB 2BANA 3OSNA 3M1FA 3MMCA 1JLQA 3O9TA 1W7WA 4CIEA 4B3SK 4WTOB 4FM0A 4X66K 1G7CB 4CFCA 4N56A 3PX6A 1Y3JA 3QSYB 2CZ9A 3QNWB 3QBWA 4LR8A 2CPXA 3OSPA 4ISFA 5HMWA 4PA1A 2XBPA 1DKGD 4J9NA 4B3MK 4OQJA 4XDDA 3R9PA 1GLBG 3D7EO 3BO2A 3BZCA 2H4WB 2GAGC 2PIIA 5AR0A 2CNKB 2DBBA 1WHYA 4DLEA 1X9SA 2DD8S 2YWFA 5ADXA 3SUPA 2HVEA 3TUJC 1BL3A 2D0OA 3MXMA 4OLAA 1RWPB 4FP9A 3L0QA 2WTFA 1SL1A 3GU0A 2QA1A 3KLEB 3TWZA 5HMYA 3OW2M 2Q3SA 3G6YA 2Z1IA 3KJVB 1LAWA 1MROB 3MEGB 3MM6A 1OPIA 1NGBA 5HOOA 3IG1B 4ZHRB 4RU2A 3G6EN 1S1XA 2ZJPQ 1L3VA 1U0HA 2JWKA 2MKYA 4B9MA 2ZE2A 1SJ3P 2XY8A 5HROA 1JWWA 1WNSA 1UW4A 3OYEA 5EDWA 5AE1A 3NLCA 2A41A 2PGCA 2KJWA 5A2QO 3R7SB 3CCEN 1VDHA 4BDPA 3NVMA 3QEXA 1V3SA 4AQYF 4P74A 4DPXA 1RWVB 4DR1J 4C98A 3VQPA 3R2CJ 2F8MA 1KQFB 4HH1A 3GE1A 1AT1B 2JLFA 1H73A 3GIRA 1D0EA 2OIHA 4NLYA 1X9WA 3O3LA 4CHPA 4AF1A 2HURA 4Q0BA 3PRBA 4TU7A 4K8XA 4M3UA 4O3OA 1X4EA 1CSJA 4QU6A 3TR8A 4BE1A 3Q2SC 1TL3B 3MM5B 2EK1A 3CCUS 1S79A 2Q2RA 3FBCA 4RW9A 1H0HB 2NPIA 4O3QA 3ZSWA 2LQ9A 1S77D 1ITPA 3D0GE 3CHWA 2HFZA 3L7UA 4IDHA 4DN9A 2J76E 3UPFA 3G4SN 2ASJA 3MPUB 4FWQA 4AE5A 1R59O 1ZPVA 5DQHA 1IKVA 2CJKA 1LWEA 1N8RO 4YB1P 5IT4A 4GVLA 2CDQA 3AFGA 3FK4A 1LXJA 1PC5A 2FD2A 2BBEA 2FBYA 5A8WA 3VTIA 2AX1A 4IOBA 3TSQA 4BRCA 3CJKA 5CQGA 4TU9A 3SPZA 3FNNA 1S0MA 4KHPK 4X66F 1HLWA 1VRQC 1NG9A 1ATNA 2CIMA 1YJWS 3E8OA 4FWNA 1EWQA 1JLAA 1RCHA 4OX8A 2M8HA 3MMAA 4CLSA 1JLGB 3U27A 1X9MA 2IDLA 1K73T 1AB8A 4P7TA 2QKBA 4GVBB 2XCPA 3FJ2A 4CT9A 1JNZB 4H0PA 2A2CA 1P90A 2ASPA 3T69A 4G1IA 2WZ1A 3CDAA 3MM8A 5AXLA 3DU6A 1W2IA 4C8KA 2IBOA 2F4VF 2GJIA 2P9NA 4JI5K 1VOMA 3G96A 3N79A 2RPIA 2K06A 5A0YA 3CERA 1QQOA 4ZCMA 2GCFA 1KVIA 4FPAA 4JI2K 4L72B 2MTLA 5KG5A 2V8PA 1IWAA 2MQLA 3B6PA 1YG0A 2AGPA 4NASA 2O8FA 2CDRB 4NLUA 4X64F 2K1RB 2ZEJA 3RGIA 3GR1A 3A3NB 5FLXU 1RAIB 4PQAA 5HBMA 2MQPA 1EKRA 3EY1A 4LF8J 1RT2B 1M1GA 2Q97A 3MR6A 3TJ8A 3OL7A 2DIVA 3UW1A 4MT1A 4ZPCA 3BBCA 2R7XA 4KT0C 4CD1A 4KGXB 4PHTX 1HNWK 1HA1A 3MAAA 1FVQA 5EN1A 3L09A 1JJ2M 4F50A 2AF6A 2RUSA 3ENWA 2DNZA 3ETMA 3WQUA 1RT3B 1FRKA 1BY9A 2BKOA 4DR7J 4I6WA 1XC9A 3TOQA 2OELA 4E7LA 1R3NA 4WFBQ 2YNIB 1GMUA 1RBSA 3DRRB 2HFUA 2CQIA 3EPIA 3W2VB 1RDAA 3BEGB 2OPRA 3BDPA 2JDJA 2CFXA 4NCBA 1WHXA 4CJKA 1WHWA 5JLHA 3T6JA 3DLRA 2YY3A 3BUZB 4EUVA 1HYSA 3QICA 1RNHA 3I4HX 2FJDB 4WF9Q 1Q81O 5HO4A 1JJHA 1YIJS 3R5CA 1PSDA 5BR8J 5E26A 2UV8A 3GIMA 3BGUA 2RS2A 5EY4A 3VETA 1YDLA 1RZMA 1RBVA 1H3DA 4MH8A 3FFKB 2CVEA 4CIOA 1V6HA 2D41A 4J9OA 1OY9A 1S1XB 3MR2A 2PBDA 1XQIA 4NLDA 4MO5A 3C6AA 1WSVA 5AQLA 2HGMA 4ZS6A 3SQOP 3NCQA 4ED0A 1W25A 4CGDA 5L38A 4B3RK 1BDGA 2ATCB 4EGLA 3B6BA 2OGUA 3UCUP 4H4MB 1K9MT 3VQTA 3TYTA 3IFEA 3I9V9 3I55N 2RVJA 4XK8C 4CGFA 4YS2A 2XMWA 1NSKL 1N88A 5AXMA 4CF0A 4CTAB 4DI6A 5B0AA 4DR2F 1TL5A 4WFZA 2DHXA 2H48B 3QT6A 2IY5B 1Y7PA 3KLGB 1N0UA 5KPRA 3QEVA 2DJWA 2J0QD 1RGIA 2G2ZA 4OPAA 1VCTA 2OH2A 3LO3A 4CEAA 3WX8A 3Q8YA 3T9ZA 3LALA 2F63A 1BD6A 1D8YA 3BSCA 3T5HA 4NMXA 3HHDA 1MMNA 1HPZB 4OX9F 3QDKA 2X6SA 4DPOA 3OL6A 4X62K 1WC4A 1FW6A 3T9NA 3SYZA 3PXGa 2V63A 4C8YA 5H9FJ 5JUMA 3CJ8A 1S10A 5BRFA 4NRUA 2E20A 1RTDA 2IRUA 4JK7A 2M4MA 4I56A 3AARA 5JVGL 3V6DA 5E3AA 4DR7F 4JD2B 4RU9A 3H5UA 5E3PA 1H2UX 4E1MA 3O3HA 2FC0A 4NYOA 3AVHA 4YOWA 4F4WA 4DV0K 3JYTA 5K8NA 1NK7A 1FJ7A 2O5DA 4DPTA 4U7UD 3PIOL 3QAUA 2HYIB 2M2BA 3H6EA 1RDCA 1FA0A 3OT9A 1GLLO 4ZVUB 4L76A 3WEEB 4LF8F 4B17A 1AYEA 1KQSR 4NLBA 4F9OA 1NPRA 1YGYA 2E9RX 5GAGU 3DLLQ 2Z58B 1IKVB 1ICEB 2RQKA 3PO5A 3SUNA 1HKAA 1S1UB 3L3CA 4HKQA 4J7CA 1YT3A 4K4UA 2UVWA 2QA4G 3ELHA 1SBRA 3QRRA 3NKYA 2EI5A 3NF7A 3TO8A 3VQEA 4E7HA 1FE4A 3TSUA 1WAFA 4ZITA 1A5WA 4CK3A 4Q0BB 4KH6A 4FF4A 3IMXA 5IT9Y 1OJ4A 4L8RB 3ULHA 2C28A 2J4RA 1KLMA 2FC8A 2V2VA 1C0MA 2R2TA 2V52B 5L1LA 1A0OB 4QOTA 4PEOA 1EQ0A 2GMHA 3VR1A 3LGMA 3OVBA 2BJ9A 5I4MA 3CCQN 2FJEB 2HLUA 2V0NA 1MU2A 2XMJA 5I3QA 5IZHA 3CCWA 3IGNA 4ZPAA 2ZUGA 1VAZA 2MQMA 1UVIA 4X66J 3VQSA 2HWIA 1U02A 1RT5A 1B7FA 4F4KA 2K2PA 2UVVA 2HRUA 4ZVOB 2X3GA 4ID5A 3VHQA 2EK6A 4AHRA 2YXLA 3O5TB 4XPEA 4M5DA 4MAKA 4WKRA 4IRCA 1XNQJ 3DRRA 5SWMA 4DR6K 4CF9A 3CJ0A 5AQHA 1NDLA 4OLPA 3KLEA 4C6AA 1T9YA 1WF0A 5KFZA 2JLGA 1U09A 3HP9A 4DL4A 3NGDA 1MWYA 1CC7A 1DY3A 3FDSA 1W2BR 4X4VA 4F4AA 2VH7A 2CPJA 2OANA 2BABA 2XM3A 1OPZA 2QWLA 1Q82T 4OYBA 4DTOA 3OLBA 2BQ3A 2Q6BA 2BRKA 1NAQA 2DFEA 3NOGA 1T05B 5IFMA 1QAXA 3F5TA 5A8RB 5CCLA 3TSPA 5IT9O 1IQZA 3MOZA 4IYQA 1NEEA 1Y11A 2JX2A 3E1YA 3QFPA 2V4RA 3FCVA 4Y2MA 4CZLA 4FJJA 3W5YA 4A59A 3TTDA 2OSRA 2K1RA 1HQUB 4O3PA 5C25A 4O4RA 4L73A 3ZLJA 3NEKA 3P1GA 2DGVA 4CYUB 2VFRA 1WDDA 2BANB 1U2RA 5JS1A 3QZ8A 4LH4A 1FESA 3KWMA 1RWWB 3J81O 3EKUA 3J7YP 1MWMA 4Q8FA 3M2RB 2B4VA 3L3UA 4M5KA 1EP4B 2BX6A 2KZMA 2AEFA 2GVZA 5KG3A 3G4SS 3G9CA 4YOYA 1B99A 1NM1A 3EE9A 3HPHA 2QWRA 3O9UA 1C0FA 3TAFA 3VERA 1YXQA 1S6QB 1KDNA 3LM9A 3TAQA 4IEEA 4BRGA 4P75A 3ZZ0A 3ZTSA 4EAHD 4Y3CA 5C12A 1DT9A 3VVTA 3O8MA 3BF1A 5J2NB 5DDPC 2A40A 2EBEA 5CXTA 1H74A 3CDBA 5CZ2A 4CJ4A 3P8BB 4K5RA 4V19J 2XRIA 2X6NA 1FWPA 2UUAK 3HXMA 2R7YA 2W6LA 4BWJA 3J81U 5LJWA 2PFFB 3NRBA 1UL3A 3G2XA 3OYDA 4FJ9A 3BJYA 2YHAA 1HKBA 2Z1HA 4CF2A 3T5JA 1N36J 1NRKA 1EETA 4F3OA 3UD5A 1FWKA 1UA1A 2MGZA 4F2RA 5LSLA 4ERDA 2Y1LB 3EE8A 5D0HA 3J80O 4DR2K 3I82A 4IH7A 3OXLA 2RKIA 2XZTB 3M9NB 4KHSA 2WAQD 3PFEA 3BQ0A 2RDJA 2KXHA 3ASMA 1AFJA 4HTLA 1S1TA 3KK3B 4RTFD 4H0XB 4PY5A 4LFAF 2CH6A 2AJ0A 3R3TA 2QA2A 2R7TA 1ZBUA 1RAAB 4WE1A 4KKOB 3VGSA 2BJ1A 4ZVQB 5C24B 3EJMA 2L08A 3MEKA 1FE0A 4DTSA 2UXCK 1NWKA 3MMVA 1KVBA 3OVSA 4FBUA 3W1YC 3HVTB 5KFAA 3MR5A 4BE0A 3MM9B 5LSRA 3UCZP 1TUYA 4DTJA 4LVOP 3ISND 2FJAB 1BI4A 1NHVA 4BREA 4U8YA 4YY3K 1XUPO 2NRWA 4YY3J 4CLKA 2UP1A 2HSEB 1UZDA 1VHFA 1IO2A 4C8ZA 4URQU 4Z4HA 2PD1A 4C3KA 1NM2A 3MEGA 3TNVA 1I3OB 3D6FB 2GAHC 4C4WA 4CBWA 1VHXA 2HHPA 3ZT1A 4ZP8A 1VI7A 3DCAA 3M8ZA 1N33F 4XDCA 1Z2ZA 5AZJB 2FVQA 1VQ9N 2X1BA 3UB5A 5D4OA 5ETVA 4QIEA 1S0VA 1RT2A 1UVNA 2HHXA 4LF7K 4PKDB 4CFDA 2VOOA 2C2KB 3BY5A 4YR3A 4ES1A 1Q7LB 2P9IA 3JSYA 1U6BA 3E2EA 5EOYA 1LV5A 2F9DA 2DHAA 4NA2A 5HAOA 4DV2K 4OPKA 1HNWF 2BDPA 1EZZB 1A5VA 2RILA 2OMOA 2UXDF 2BE2A 1JLFB 1JMTA 2BTFA 3QMLA 1UETA 3MZIA 1Q53A 5F3ZA 1JCEA 2HBRB 5BN9A 5FPEA 2OTLS 3BYRA 4LF4K 4PAAA 3AJDA 3OV7A 4I2QA 4OJ1A 3E9OA 3J7ZO 1OQ6A 1A6LA 3QEPA 4USTA 3NBPA 4JKCA 2J9DA 1T0TV 1JJCB 1RWNB 2D0BA 4X2BA 4DV1J 2UVRA 3C16B 4FCYA 2DNGA 3JTNA 1G2EA 3CC4N 1YX2A 5GMEA 3NCPA 5H9FK 4LFBJ 2IM1A 3QIOA 2XS7A 3K5OA 3OTOJ 3OHAA 4NA1A 2NXEA 4CJRA 2CVIA 2MZJA 2JEIA 2DK2A 2KXNB 3K7RA 2LU2A 5ETPA 2HBQB 5D15A 5L1IA 4PWUA 4Y34A 1ASUA 1VQSA 5CYMB 3ZETA 1J5EJ 4IOCL 1S6QA 3NF9A 1KVJA 4NCAA 3MR7A 5AQRA 2C3MA 2WVBA 2VICA 3M8SA 1YWXA 4CZIA 3BQ2A 1EP4A 1RYSA 2K7JA 4H4OA 4NMLA 5AJ3F 4KR0B 4OGCA 4NXMK 4NXMJ 3ZSZA 1SB6A 3MM5A 4A8KA 1BMQB 2C3UA 2VBYA 2QL9B 2CWXA 4JI6F 2LCWA 4Z7CA 2MKIA 3AT1B 1HW8A 2BUNA 1X5SA 2R9LA 3P45B 3X1LB 3UKRB 4FYVB 4J5OA 3BZQA 4W90B 4CJ3A 3N6LA 4FK0A 2HHVA 4P7VA 4K4XA 4KHMA 4A46A 1T9XA 3RRHA 3D6RA 2DRDA 1RWUA 3R27A 4B3OB 4CJEA 3H90A 1WI6A 2AJQA 2G8UA 2V8GA 4DCJB 4QQBA 3CJCA 2D0PA 1WOSA 2H5EA 1W7AA 1VSKA 5B0FA 1NK4A 3SBTA 2M8DB 3SIPB 3U3GA 4QR2A 3HFKA 5B0DA 2IFXA 5J1EA 2XYPB 3O3GA 2YKNA 1Y10A 4ZHRA 4B3TJ 4CZMA 3N9UC 4E0DA 1Z4UA 3C65A 1WG1A 3OVAA 3BR9A 2VG5B 3VGTA 1HRHA 1Z6RA 3CJQA 2DGOA 3LQVA 2N7YA 1GLAG 4DV5F 1S6UA 5HQMA 4DEZA 1NK0A 2L3MA 4ICLA 4CZKA 4H5NA 2UUAF 1VRUA 1QJHA 4LJMA 4QIWD 2RH3A 2KT2A 1IH7A 5GAHP 1XMOJ 1F21A 4WU2A 2DNRA 1JLEB 1YJVA 3OR1A 3WIVA 3D6TB 4KBIA 2A10A 1KXPA 1S59A 4CEOA 3IP0A 3WNFA 3VTHA 2QRRA 3UE5A 3BYPA 3SK3A 2XMMA 1UJ6A 3GIIA 3DRPA 1LEOA 4OKKA 2GJFA 3ICLA 1V5VA 4WKYA 2DHGA 2RDIA 4F8RA 4BGBA 1WKJA 2MZSA 3MWTA 1HHQA 1HNZK 2DGXA 4CJLA 1ZOTA 2FDNA 4AHVA 3L2VA 2CQPA 1JLQB 1H72C 1KLNA 4FLVA 2DGWA 3B82A 4ECTA 3Q8RB 2GQQA 1HIYA 2M70A 5DLFA 4I2PA 4OZLA 2I5JB 2IAJB 3MDFA 4J9VA 2B4PA 1B0VA 1K8KA 3MN7A 4F0MA 2ZJQQ 4PABA 5HVFA 4CLLA 1YQHA 5C15A 4D3GA 4I64A 4MTPA 3IN5A 4LSNA 3B6OA 3A8EA 3NS7B 5AQZA 4PXCA 4C3LA 1VJQA 4B3OA 1VC5A 1U1PA 2RDDA 4JI7K 4TSXA 4UY85 5D3GA 1XN9A 1K8AT 1QLNA 1SH3A 5AZIB 4W5QA 2KFNA 4FWPA 2X51A 3W8GA 2X7IA 2PDAA 3P5JA 4J91A 3HVAA 3JSRA 3I32A 1NK5A 4JD2A 4M41A 2MXYA 5KG2A 3GYNA 1VQNS 3Q89A 1QAIA 1TGOA 1RTDB 1KR4A 4JI8K 1U8WA 5IQQA 1JLBA 4PUOA 2MB0B 3HT3A 3GIKA 2YNFB 4H4OB 4PKGA 3WXJA 2DXFA 3IR7B 5M1NA 1RBLA 1XMQF 1U1QA 2DITA 5DQGA 1NB7A 4WZQA 5IT9U 4JEPA 3M6UA 1NSAA 1CS4A 2FLOA 2HAIA 2ZJRL 3F56A 1SVDA 5KG1A 5E3QA 1H2VZ 5E3CA 1HBOA 3MM7A 4FJIA 1HR0J 2L41A 3T1YK 4DWIA 1KFDA 1N36K 1F3VA 2QEXN 2HLTA 2WBMA 2IOCA 5KFCA 4CM2A 5C0YA 3SI6A 3JAMO 4RBUA 2W40A 2A2DA 5FIIA 3ZO7A 5KFXA 4HTJA 4DL5A 4PWDA 4DV4J 4E3SA 4KH5A 1X5TA 2QTDA 4Z4IA 1WN7A 2H51B 3C8YA 2OYQA 3C3LA 2CZ4A 2QWOA 2ASMA 2WUSA 1XEZA 2ITMA 4BG8A 3VV2B 5DGBA 4W5TA 2P9UB 2WONB 2OP5A 4K59A 2LKZA 1UW9A 3CJ3A 2QMXA 3J81Y 3GB0A 5AQFA 2P6TA 2QC3A 2FHJD 4JI4J 3EVWA 3VWSA 1CZAN 4FLTA 3NHGA 3EKSA 1YITN 1SJ1A 3AAQA 5KFPA 3K5PA 3CPWM 3TVZA 5DS7A 2P5OA 3G8TA 3RBEA 2RAQA 4KQZA 1ZBIA 4C9DA 3CMAN 2WVEA 3MN6A 1RTJA 1ZA1B 3QATA 4JV5F 3R5GA 4ED6A 4LQ9A 1QAJA 1BOTO 1HNIB 2A5XA 4DUYJ 3HSCA 3M6GA 1XQSC 4IFEA 4OJ3A 3DRSA 1GLEG 4HACB 3ZC4A 2XB2D 4EWTA 1UCNA 1C1CB 2A6MA 1F5BA 3RMCA 2YPYA 2DFHA 1VYAA 3HRGA 4CGHA 4KPYA 2ZH9A 4B1YB 4USWA 4AUKA 1KP6A 3GSIA 3D0IE 4K8ZA 2VB6A 1U1NA 3D3CJ 5C7PA 4EI2A 3ZX3A 1Q8LA 3SSQA 2EW9A 4H5VA 1SL0A 2HNYA 2OEMA 2JWNA 2IVNA 2UUBK 1N32K 3LPTA 3D1OA 4YB6A 5AJ3K 3IM9A 1OSCA 1WKKA 5MLCV 3LL3A 3NH2A 2VG7A 5KFGA 1OYEA 1NUEA 3LZJA 5D0RA 1XNRF 3AHPA 2UUBF 1MNEA 1NXIA 3I6PA 4DMZA 2RMLA 4ECUA 3QAEA 4JI1F 3L95X 2G2OA 1EX8A 3NY0A 1TKDA 5KGWA 4P10A 2QV6A 1XNRK 1KVAA 3MCAB 4B3SJ 4ZPBA 5C2DA 4FF3A 2MSSA 4F26A 2IMWP 3A0IX 1VQKN 4IR9A 3W64A 1MWZA 5HBMB 5HI7A 2EPIA 1QSYA 4DR4K 1S72N 2ROEA 3GZ7A 5C2FA 4CJQA 2WB4A 2BJ3A 3G71N 3IA0A 3ATUA 4K2JA 2BRLA 5C42A 4PWDB 2CPZA 3HHNB 3AB4B 4J37A 2NCKL 2ZBIA 3HHLB 2DVIA 4ENOA 4TY8B 3BN4A 1PAUB 3BBBA 5JJBA 4D3HA 3G6XA 3DLJA 2KHDA 1NGFA 4CK1A 1RTZA 2YKQA 4G3IA 3S8SA 2A42A 1GOCA 4JI8F 1FJGF 3MM7B 4BRFA 3MDQA 5KFOA 3RU0A 2ZWHA 3V9UA 1OH8A 5H9EK 3BH6B 4N47A 2MLXA 4DX6A 2G8VA 2DXDA 1D09B 2GVDB 3DC2A 2U2FA 1IR2A 1Q5YA 4DU3A 4FJNA 3C19A 3PG9A 1NJZA 2PAVA 1TL1A 3F41A 4JI0K 4B02A 3M1VB 4FPRA 2M5YA 2FGCA 3KG0A 4CRJA 4DSJA 4RLEA 3BKTA 1GOBA 5AZIA 3QESA 1QHAA 4XIUA 4JBCA 4CLZA 5F8IA 4E1NA 1LWEB 3WC0A 2Z30B 3FSYA 2IRXA 4RUBA 4EP4A 4TXSA 3CCVS 5E0OA 2HZVA 4NXNK 4FBTA 3P83D 1G4CA 4BQZA 1IBLJ 3K8VA 2FF6A 1HHSA 1LAVA 3H3OB 4DU8A 4ZDNA 2KKHA 1Q86T 1S0NA 4FWRA 1T3OA 3AVBA 4I2PB 2E6LA 2QWQA 3U02A 2VGMA 1X4HA 2HMPA 4PL7A 2W24A 4KHYA 1U25A 2ZOGA 1YVNA 4QWAA 1X0PA 2ALZA 3R5DA 1OVYA 4NEYA 2DT9A 2BR0A 1LW2B 1M90T 4DX7A 4NOHA 3VZIA 3N4PA 3SV4A 3I8BA 3TWHA 3KYLA 1HQUA 3KKSA 2JZ5A 4DV7J 3FMWA 3P3DA 3CVKA 4BLGA 1RAHB 5M1QA 1GLJO 4IWVA 2KRBA 2H65B 1TFWA 1HYZA 4KV8B 4ZVTB 2VFUA 4JLHA 3R6LB 3ZTRA 1DTTA 1HFEL 1S99A 4M5LA 2FZKB 3IBCB 1N34F 4OI1A 4FWSA 4X4UA 2ABYA 1K47A 3CMAS 2QA4N 2IYGA 4DX8H 4ED8A 5M2UA 2VDHA 3UR3C 4QR1A 1K1SA 1TKXB 1ATSA 4M5IA 2QGFB 4FXVA 2FZGB 4K4SA 4WP9A 2W2MP 2GEMA 3IUCA 3D2EB 2Z57B 2C42A 2XSJB 4BR7A 2YKNB 2XEXA 2UXCJ 1NNDA 3J7ZT 3OYAA 3SBGA 4AL6A 2G4BA 4JNEA 3FGUA 3VGMA 3QRPA 1U2FA 2NRVA 4LRAA 4KHPF 3HTVA 1U1OA 1GEHA 3LP0B 3OS1A 1NGEA 4Z4CA 1FNOA 3D67A 1RAGB 4RW7B 2JEFA 1RT7A 2FF3B 2E7VA 2Q3PA 4M63A 4M3YA 3L2QA 3MX5A 2A3JA 2WCXA 1NOZA 4DHVA 2X78A 3HSGA 2WOMA 2HB5A 2F7VA 5D77A 2J7KA 1KLMB 2YQ1A 2D3O1 1RDBA 1O6XA 1IG9A 4HH0A 4RBTA 2E88A 4B3MF 3JSBA 3OHRA 2EKYA 3GG0A 2HHHJ 3K0JA 3KLIA 3VAGA 3RAMA 2QX0A 2V51B 1PAEX 3CCMS 4WQ4A 4YDUA 2MQQA 3O3FA 1YIJN 1TELA 4DBQA 3G82A 1T03A 4RR5A 3MWPA 3TP2A 3CFOA 4N5SA 4DV3J 2ZJQL 3S3OA 2OI2A 1N0VC 1U2VA 2B9WA 4CJFA 4IKFA 1W2BM 1NGGA 3KUHA 1NSQA 5FLXY 3AVNA 1PG5B 3TQEA 2HVZA 4JKAA 5HATA 5CYMA 2ILYA 1SKSA 2R8JA 2UYTA 2W9CB 5DG8A 3MCSA 1SZ2A 3HFVA 3DLKB 1UWBB 4LD0A 3KK7A 3GFXA 4KHUA 4FN5A 1X5OA 1KVCA 1SC3B 3ONQA 1CPZA 1R8HA 3VEOA 3ATVA 2DHHA 2OJ3A 1Q78A 1X4CA 2Z8QA 1B92A 2XQCA 3G86A 4KAIA 2AQ4A 2ZHBA 4YHHJ 2LXUA 1DQAA 4FJ7A 3QNNA 3MCPA 2KI2A 4C7QA 3L3VA 2QFJA 2C2EA 3N6NA 4H4MA 2QYGA 1V4TA 5AFUA 3G82B 3DXMA 3LDOA 4FK2A 4FPIA 5ETKA 5IV4A 3NF8A 2E5JA 4LFCK 3KLVA 3K5LA 1RXOB 4F0HA 4QWCA 4LF6F 4RW8A 5J1NA 2KFZA 4K5SA 4B3RJ 3ZXWA 3M9OB 4CLYA 4ZIWA 2RD5C 1IG8A 3SCKE 5F8NA 4ZJQA 2ASDA 3VA3A 1SC1B 1Y00A 2RN2A 3WX4A 1QTNB 3US5A 2P9GA 4OI6A 4FJXA 2RUGA 4U96A 1K9MO 4KC5A 5CD4A 2IVPA 4GV3A 3AY0A 1HYSB 3MF5A 2OZMA 3E3XA 3UE2A 4LF6K 3CC7S 4IH5A 1H1VA 1OS5A 5KFFA 4OI0A 3LGHA 2F4FA 1HNVA 3D9BA 2KG0A 2CZVC 4JYAF 4YB7A 4KI6A 3CT9A 4Y28C 1RBAA 2ZZMA 1KVKA 3R5JB 3EZ5A 2NSCA 1TKXA 3PX0A 1RT6B 1IJJA 1LQ9A 4P6QA 3Q2TC 1PYTA 1IBLK 4IDKA 4ISGA 3PDNA 4ZPVR 3LAKA 3PR5B 4U7UK 5F41A 1WELA 1YHQS 3H45C 3DOLB 4LFAK 2IRYA 4LRCA 1D9DA 3UDEA 1NGJA 4EBDA 1RDUA 3MPVA 4LF8K 2ASLA 2LQ5A 4HL9A 2Y0BB 2NYHA 2F96A 4EBCA 2FHMA 4BRLA 4NO7A 2LDIA 2GX9A 5AQQA 2QLFB 4K4TA 2MQ8A 4FWOA 5KFMA 4F3TA 3HK2A 1Y5LB 2YHXA 1WSHA 2O8FB 3ZEUB 1BWEA 3R1XA 1VQNN 2G0IA 3U1NA 3SZ2A 4MIAA 4H8KA 2CKWA 2DY9A 3SQ4A 3PYEA 3SQ1A 5A0YB 4B1ZA 4KH1B 2EFQA 4DUZJ 1S1TB 3KK3A 2G13A 5B0CA 3AY9A 5BR9A 1Y3KA 1DRZA 3TVKA 1HARA 1ZXOA 4DL0C 3ZYYX 1IQTA 1VQMS 1NGHA 4B3MJ 3LDLA 2CGJA 5CD4H 3ZZRA 1Q4RA 2G8WA 2HMIA 3HJFA 3VQAA 3L2UA 4GVBA 4U95A 1HR0K 3CJSA 1V5IB 3Q22A 1V9OA 3ET6A 4QYZJ 3O1BA 2NRXA 5HL7L 2RU9A 5SZTA 3KOAA 1HW9A 2DR7A 5LMUK 4XAKA 4E19A 2DTUA 1QTMA 4CIFA 3GDQA 3AAWB 3V4IA 4DV4K 5ETMA 1D4XA 3MCOA 1VQ8N 2AV5A 3H40A 2DR5A 3TA0A 2UXCF 2OPQB 1LFPA 4JI2J 4LF5F 3QT8A 1U8SA 1BQNB 2ZWPA 3ET6B 5F0UA 3IBWA 2ZH1A 3QGGA 4GO5X 2P9NB 4EO6A 3D45A 4B9NA 5LMNF 1D9FA 3ZTOA 1WC3A 2NPFA 3EGWB 3OL9A 4GMJB 4DV0J 4ZJLA 1U2VB 2IBKA 3U7JA 5KG0A 2LEPA 4OKEA 4KGZB 3Q86A 1UFKA 3V2UC 4KB1A 4RW9B 4PXEA 4DFPA 1L3KA 3QETA 4K0KK 3CI5A 2Y0SD 3G71S 1QM9A 4TY8A 2N4CA 4AILC 4CO2A 2AD9A 3HSDA 1ZAWA 3AA5X 4CNZA 4WQ4C 4CEQA 3CCLS 2XLIA 1SAZA 3QNOA 1HMVA 4CYUA 4M3ZA 1FK9B 2VZ9A 4DV7F 1UVLA 1Q82O 1RHQB 3Q0AA 4DU1A 1DQ9A 3ZZYA 4LRDA 1Q9XA 3SCJE 4C48A 3EWGA 4K0KF 5DZ6A 1UEKA 2QLXA 4JI7J 2HIQA 3GQCA 3L2WA 1VQMN 3M3ZA 4LSNB 3QEWA 3P31A 3AJ2A 3N28A 2X1FA 1A9NB 2B0GA 4X4RA 1M1HA 4NX9A 3PRVA 4O3RA 3R8YA 2JSXA 3RZAA 3PO4A 2O8EA 3NGZA 3CDWA 1VQON 4HI1A 1J53A 4X4QA 3CQ8A 4ANEA 1RHJB 2HW3A 3DXKB 3HBTA 1VQPS 2NUHA 3KJVA 2WVCA 1GOAA 3OL8A 2KJVA 4NEZA 3W3SA 2IJRA 3PW4A 2CJBA 1GT8A 4NA3A 3S9HA 2C2DA 2ZDPA 4FOEA 3QT5A 4KHRA 1H6KX 4JI3F 3DJCA 3BREA 3TVYA 3JB9k 1S4EA 2AU0A 4K4ZA 1RT4A 4W5RA 4C2MA 5A8KB 1D1UA 3C7NA 1LWCB 2UU9F 1V4SA 1YHQN 4JUZA 5IM0B 4C11A 5KOWA 2ZOFA 2KH9A 1GLCG 1VK0A 2OCEA 3RSEA 4NYPA 3LW5C 2ACYA 3DHWC 4CDIA 4Q43A 3QBXA 3A8JA 5DDRC 1IM4A 3KWGA 2HWHA 2V8HA 2EX3A 2VQFF 5E33A 2HQDA 4M3WA 4YFUA 1VSJA 2QL7B 2O4GA 2IM0A 3CGIA 1F6TA 3HD1A 1S12A 1SUQB 4M1KA 4LFCF 2XY7A 2ZBRA 1VGYA 5D0EA 3OTEA 4ATNA 1GLDG 3OJUA 1YKWA 1RWMB 2XWYA 2V9WA 1NZAA 2CJXB 3A4TA 1T7PA 1SL2A 3KJFB 3VEWA 4F4YA 3DYAA 4TN2A 3EE3A 1IM6A 3ENHA 3L4QA 4AL5A 5K5MA 4DZ6A 2GUIA 3JXOA 3C14A 3O1WA 3R5AA 2EHGA 4C8LA 2QN6B 3KDNA 1VSMA 4ZVGA 1QDUB 2ILZA 1VSHA 5BPMA 1P8ZA 1X60A 4E8UA 4J9PA 5M1FA 4DN0A 4CHYA 3TJ9A 2Y1JA 1N5YB 1DURA 7FD1A 1CS4B 2R3VA 4CI0B 2YX6A 3VEZA 2W9BB 2ADCA 1RLCL 2H3EB 4BC2A 3FRZA 2HS4A 3UR0A 2DR8A 4Q2MA 4PUOB 5FLXO 1X4GA 2OO4A 2XO6A 1KTQA 4JYAK 2A6OA 2M9KA 5DETA 4FKXA 2WSEC 2GWKA 5D4NA 1RTHB 4LF7F 2QLBB 3JSMA 4J90A 4O5BA 3VF6A 3QT7A 4DFKA 1DGKN 2AWZA 2RHSB 4OJHA 4FLUA 2VQEF 3OD2A 4Z2XA 1FWLA 3PW2A 2XHCA 3BEXA 4ZCKA 5LJVA 5AE3A 4WF9L 4WYLA 3KLGA 4WFXA 3H4DA 2RRAA 3DYAB 4CFBA 1RT1B 3R5BA 3ALYA 1N8RT 4PKIA 4MK9A 3SSSA 2QE5A 1ASVA 4N77A 3OW2R 1EX4A 3NBPB 3I8DA 5DGAA 1HNXJ 3HULA 3PZPA 4RJVA 2QK9A 3GYGA 4OLBA 4ZP6A 5M1PA 3D2EA 3MFIA 4RO0A 5ETRA 3H08A 2OPSB 1RHMB 2HBLA 9ATCB 4DU4A 3UD4P 2FY1A 1Y5NB 2ZJPL 3J80Y 1FFSB 4RNNA 3RW6A 2I6WA 1M1KT 2W42A 3VQDA 4JS5A 2A1RA 4FJ5A 4OZ2A 5EXWA 3CJBA 5D4PA 3V1OA 2VPZB 5AQVA 1BHLA 3CPWR 4OZNA 4QIGA 1K6YA 2YHBA 2WK4A 2WRMA 3F0NA 5E5NA 1H98A 3PX4A 4JK9A 1BE4A 5A8KA 2ETJA 4MFBB 2P9IB 3OFGA 2CQ3A 5EWEA 5LMNK 5A6WA 4NZ7A 1N32F 1BISA 1JB0C 1EB0A 2CQCA 4DPYA 2VFVA 5I3UB 4ZN3A 5FROA 3CCMN 2V9KA 2DRAA 1VQ6S 3ENBA 4LF9J 2NQPA 1YJNS 3T1HF 1VIOA 4FOIA 1VSEA 3C6HA 1NB2A 3VZHA 5F9LA 6FD1A 1YJWN 3HT0A 1RTJB 3EGZA 2O3DA 1BC6A 5MLCQ 3MMBA 4ZVHA 3R6GB 2B3TB 2IPOB 2AJ2A 1IN0A 3UFCX 3NCIA 1G3OA 4BRQA 4M3XA 2DNYA 3U3YA 4Z7YA 4OJGA 1KHWA 3U1MA 3IFRA 4ECXA 5BRDA 3IS9A 4ZVPB 1TKTB 3THWA 5AQTA 4NCGB 1ZZNA 4DV6F 4BHQA 2W2QP 2W2PP 1HI1A 1YZ7A 1HMVB 3MPDA 2A0FB 4LF6J 2A6AA 1RUSA 2KO1A 5KFHA 4QIVA 4UOCA 2VWBA 1QSSA 3SDEA 4CLWA 2ZBCA 3UN5A 1VIXA 3O08A 3AA4A 5T7BA 3CJ2A 3OTBA 2PE8A 4EEYA 2XMVA 1PILA 2PMWA 1B0TA 2E1ZA 1RCXB 2UUWA 2PO4A 1Y5IB 3GV8B 4GC6A 2DGSA 4CH1A 2F40A 3MEEB 4Y1CA 2FYXA 1NJWA 4W92B 4N7TA 3U9DA 2J0SD 1JXLA 1NK8A 1Q7YT 3M8QA 5HP1A 4ISEA 3SJJA 3CCJS 2QT7A 3BN7A 3C15A 3MWBA 2W7OA 4EIAA 3V4IB 4ZJOA 4ZVEA 2HWTA 3OBWA 4JHDA 2RQ4A 5ADZA 2UUAJ 3J7AP 3I4PA 3M2VB 1NDPA 4L3KA 3H0PA 4M8LA 5C2GA 2MHEA 4DV3F 1QQMA 4F3MA 3OLAA 2O8DA 3L9ZA 5A8WB 5HQLA 3O44A 2HBMA 3VA0A 4DQPA 4ED4A 3CG7A 2XI3A 4LIRA 4DR4F 4B3TF 2H3GX 1U26A 1OH7A 1U7LA 3KUGA 4LR7A 3AVGA 3TZZA 3SMSA 5GAEP 1XK8A 2IAJA 1F9FA 4X65F 3J7AN 3VGKA 4R8UA 4BS2A 3OFFA 1JLFA 1WB9A 2D1KA 4OYOA 4PZVA 2XLKA 3TAEA 1TL3A 4EMDA 1BQMB 3FEZA 4GKKF 1VQ6N 4DR4J 4ED2A 2ZNZA 4USMA 2J7UA 4OYIA 2GV1A 1R31A 3HOSA 3GLJA 3CYMA 3K5MA 4XPCA 1Q95G 5KT6A 2X1AA 2UUCF 2GJ2A 1E6YA 4G6VB 3L6QA 2PA8D 4KHPJ 1LW0B 3IGVA 4WCEL 4ETXA 1RYRA 2CWKA 3PY8A 3GOIA 4MFBA 3W8PA 1ZS6A 5LJ5Y 1G15A 2E1RA 2V34A 2DNLA 5H1SQ 3DAWA 5BYQA 3L7PA 3PR4A 4Y1DA 4NXMF 4J9MA 3ZT0A 2KDOA 4NLVA 1EQYA 1JLEA 4Y2CA 2KVQE 3POTA 5ETTA 4A8WA 1DTQA 2ZE2B 2ZH4A 4ED5A 2GUPA 3AGRA 2NXJA 3CJAA 2F5GA 3VENA 3U6FA 1XMOK 3IG1A 3D5MA 2V8DA 4DR5K 2G0JA 4PKHA 1HBNA 2LLZA 2D74B 4JKBA 2QJ3A 2APOA 1WOQA 1HNVB 1U6ZA 1I51B 3D54A 3HVTA 1S5JA 5EUHA 2M52A 2GFFA 3ZSQA 3TQ1A 2ZH2A 4QW8A 3OTOF 3DI6B 3B4MA 2ZQBA 5C24A 1RT1A 3ZSVA 1MU2B 2PZSA 4DV1F 4DKWA 4O5FA 2B51A 4HVJA 2E9TA 2F9TA 1SPBP 2AGOA 3GJTB 4DV6J 3CTRA 2VA3A 4B9TA 4I6AA 3RAXA 3P4IA 1OVQA 2BGGA 2VBXA 1L3SA 2H1YA 2HIYA 4IFVA 3L7OA 2RHKA 5DDOC 4PYAA 5KGXA 4GW6A 4WFBL 1VQ4N 4A5BA 2KYZA 2HQCA 1R89A 4NYFA 1HD0A 3PUFA 2A3ZA 1WC0A 3DU5A 3DGVA 1A7GE 3UN2A 4X65J 3QERA 4Y0FA 1OMSA 2VFSA 3R7BB 4OLOA 3VVUA 5G0RA 1XR5A 1CJTB 2ZVIA 3CJ9A 3QIPB 1TUVA 3HHKA 4LF9F 3BKFA 4ZP9A 5BREA 1VQYA 2NRHA 2R8IA 3KD1E 3RYLA 1JL2A 4BRMA 4KREA 3BP8A 1ZAVA 2CJAA 1RA7A 2YH0A 4OPJA 1OH6A 2VU5A 3CWJA 1TYQA 1KQSM 1KONA 1LK5A 1SCJB 2XC9A 4ZA1A 3UDCA 3C14B 3H3NO 2RJZA 4UY8O 2DGTA 2DKOB 2W2OP 4ALZA 4PG5A 3CUNA 3CETA 2KM8B 2KXFA 4IJAA 2EBGA 2RNEA 3EL2A 2Y8WA 4AH9A 3T1YJ 1QQCA 2V50A 2VBWA 3N5FA 3OQ2A 4C1NI 1FXDA 4YY3F 4CO4A 1VQ7N 3TAMA 3EDRB 1HKGA 1BLUA 2N82B 3S41A 5HRSA 1FRLA 2DNPA 3AQOA 5AQOA 3UD3P 1WWHA 3PLAA 1RILA 3FRYA 3TUIC 1T8EA 2VFTA 3VAIA 3EX7B 3KFWX 4RWWA 5LJ3Y 3KKRA 1XHZA 2XHWA 3CCRS 4FLYA 5DM6Q 4DR6F 2Q36A 4F7VA 4S0MA 1CLFA 4HHUA 3RSEB 3G6VA 1RWOB 4IO9Q 1REVA 2QMWA 4EYIB 2VC0A 4LFAJ 4I7FB 1N54B 2L9NA 1WUUA 4DCHA 4OYPA 1VISA 1EAYC 4USKA 2ATQA 1AROP 2H5JB 4EFHA 3U1LA 4QOZB 5KFQA 5J2PB 4Z37A 2GELA 2VQEK 4YQWA 4AHCA 2IIRA 4ICLB 3L4IA 5KFJA 1VFJA 4F0KA 1PJ6A 2NZ4A 3DM2A 3AA9A 1UAWA 1E3MA 4DL7A 2KFYA 1X9JA 2CQHA 3ZZUA 4LF7J 4NLCA 3NWGA 2VG5A 2YNGB 1RAEB 5T7LA 2XULA 3SAGA 4C3MA 3V6HA 1FD2A 2HFVA 4FZZA 2Q66A 3J7YI 5KFRA 2ACMA 2ZH3A 4HYKA 1BGXT 4IEIA 1QVFM 4E2FB 2VIHA 4KBOA 4OX9K 3D68A 2Q1LA 1T44A 2F9WA 5IT0A 4KB0A 3I96A 4ELTA 1H7XA 3VF2A 2J0WA 4HHTA 5M1KA 3KUEA 3FBBA 5DG7A 1N32J 2O4IA 4MYTA 4WFYA 4IQMA 4Z4FA 2FSNA 3C46A 3BH7B 2YJEA 3KHYA 1VQ5N 3Q8UA 2IVMA 3IRWP 2AT1B 4IG3A 1VBXA 2E5LJ 2NRZA 1NJIT 1LW2A 3MK6A 5IWAK 3EZOA 3AJ1A 4F36A 4DPWA 3JS6A 2OTJS 3N5BA 1L3TA 2ZITA 4H03B 4B1VA 4OX6A 1RHUB 2XGPA 2HFNA 2HVDA 3BGRB 5AXKA 4EFAC 1S1WA 1FFGB 2VQFJ 4URSA 2J8SA 4HDGA 1HLUA 1FKOA 3JTPA 1VC0A 1IKYA 5KAKA 3R7NB 1EETB 4RKUC 4DV4F 2H54B 1ULRA 3CPEA 1TVRB 2VBZA 2QL5B 1FXLA 4YB5A 1AZSA 1SC6A 3M6XA 2N7CA 2OPQA 4A8FA 3FQKA 2NUUG 4G9ZA 4YR2A 3WQTA 1X4FA 2WBRA 4Q44A 1C0UB 4MJKA 3CO0P 4B8CA 1U1MA 3NGYA 3D1QA 2LECA 1C0GA 1TZ0A 4R0EA 4FXWA 1XMQJ 1WACA 3O6WA 2ERRA 3SMPA 2GVDA 1BIZA 4ZTFA 1FKAF 2DR6A 3Q8VA 2Z0GA 4F4XA 3J80U 4ECVA 3TEGA 3QGHA 2LA4A 1QVFR 3LANA 3O8WA 3J7Z5 1QAYA 3IWNC 3ZSXA 2CUYA 1I1GA 2DNOA 3JAMU 4NYNA 3UNYA 1YF5L 2Z2ZA 3M2RA 3VAKA 5LL6Z 1T02A 2EWSA 2DNNA 4QBUA 4YDUC 2O66A 3J7YU 1RA6A 3V9WA 3V9SA 1U2CA 3DLGA 3BPDA 4PWWA 3IWXA 3ZZTA 3ZCMA 2W2NP 4F4ZA 2EFOA 3SFUA 4ZPTR 3P49B 1JKHB 3CCJN 1E4FT 1SV5A 3LDQA 3ZZZA 5KFEA 4K4YA 4UZCA 3F2KA 4CO5A 1B7YB 1TR0A 1TVRA 4DR6J 3L2RA 2YX4A 5DM7Q 4Y2AA 2DIUA 1X4BA 3QO9B 2HQGA 3DOLA 1N33K 3KDOA 3U4LA 4DV5K 4KGMA 3LWMA 4I4BA 2C2OB 2QSFA 3BV8A 4Q5VA 5A2QY 2VG7B 4K25A 3AH6A 1YBAA 4YDXA 1FRXA 2DPJA 3MXHP 4JP8A 4CEFA 2HNYB 3T1YF 4WBFA 3QFHA 3M8PB 3VQ7A 5M2PA 5KPTA 4OFZA 1KAXA 3OR2B 4WXOA 1CJUB 3MD3A 2NS1B 4NLPA 2L9WA 4OMFG 1XR7A 3GV5B 4BQLA 4A8SA 2RIJA 3OBIA 1N6QA 4F3QA 1R43A 2RE1A 2HFOA 1WI8A 2DCUB 1Z2LA 1NPPA 2E1CA 2P6SA 2FXUA 2R2RA 1NDCA 2GMJA 3LZIA 1D9AA 3DRSB 3Q8SB 2UUCJ 1KWMA 3OPKA 1ZBSA 2NRRA 3RRKA 4DFJA 2F65A 4QS8A 4A48A 1J5OB 3CCZA 5ETQA 1RT3A 2VJUA 2MZ1A 4H54A 4FNHA 3ZT4A 4UF4A 1U0HB 1S7HA 3TAPA 4B08A 3KK1B 3MM6B 2UXDK 4CD3A 5KFIA 3CD6N 4HHHA 3OJSA 4CZGA 3AA8A 4MLHA 1NKBA 1H2TZ 4CHQA 2DXEA 1VBYA 1DHMA 5CZ1A 4OZ1A 3KLHA 1JNRB 2QI2A 4OHVA 3HP6A 3FZBA 3CCES 3TAGA 3MUVP 3D3BJ 3ZSRA 2V67A 3FFIA 5J2PA 3GFZA 3CD6S 1M5OC 2D3OR 1HNXK 2I7NA 3RUBL 5KT2A 5DRKA 5L46A 4BR2A 4DSFA 3HO1A 4E1JA 3DKDA 4O55A 3AVJA 3PJ9A 1MW7A 3HSZA 1T9TA 5GAGP 4EHUA 2O67A 2W9CA 2MPUA 4X4OA 3KHRA 2KVIA 4QW9A 1VRTA 1WORA 4CJ7A 3TZWA 4YNQA 2YWWA 4P72A 4UOGA 4FO0A 1VSLA 2E1MC 3KJQB 1FRJA 2P8IA 3HSJA 1J6ZA 2NLWA 4ITSA 4KRWA 4KB7A 2KQ2A 1TUGB 4QAGA 2CJYB 3LA0A 4JKGA 4UW2A 1NU4A 1AFIA 2YNFA 1Q81T 6FDRA 4CVNE 4KPCA 5B0EA 4PXDA 3HM8A 4EU0A 2C2MB 4ECQA 2ZFHA 4JKGB 1F9HA 4JK8A 5LOQA 4Z0UA 3KWIA 1Y0HA 4X4TA 1YJRA 1X4DA 4MK7A 4JI2F 2C2RA 2R8KA 1T6CA 3PRDA 1QUVA 3UN3A 1OO0B 4FWMA 3LP1B 3V9ZA 3DN9A 3D4JA 2KG1A 3QLHA 4CQ1A 2VG6B 5CE3A 2A1BA 3EMTA 3MFHA 3D7SB 2D69A 2CJ9A 3HYFA 4GVMA 3CCUN 5BN8A 1CJTA 2I5JA 4GKKJ 3NMAA 4CZJA 2O8BB 1N5QA 4LIWA 4B9QA 1G1XA 1OY6A 2M0GB 4BGAA 2DNMA 1JXBA 3KVGA 2C1EB 3WIUA 4BDZA 4CH7A 2ITGA 5HMZA 3QWPA 4C0OC 4LF9K 5IXUA 4X65K 3CXCM 3VGUA 4F25A 4BRDA 1TK8A 4M42A 3W9HA 3T5KA 3D2FB 1GK8A 5K14A 3T1HJ 2KHCA 4IOAL 1GLFO 5BXIA 4ID5B 5EGYA 2B7BB 3OXFA 3MN9A 4LF4F 3LH2S 4USHA 3B8AX 3NGSA 2QYCA 2XHBA 3OY9A 1Q7YO 5HN0A 1JJ4A 2DCLA 1I94K 3OR1B 1QVGM 3DMJA 5F9NA 2BJ8A 2ZKUA 3FZLA 2J6UA 1XTZA 1Q8IA 1WC1A 1IBCB 3OVNA 2Q31A 4USUA 3M8PA 3D2WA 2V2ZA 5HJXA 3M8WA 1SKWA 2YNIA 3GILA 4RW6A 3HD2A 3GCWP 4O4GA 2QM1A 1TL7A 1C1BB 4AHUA 3VAMA 5D0GA 3BBFA 5AQYA 1DTQB 4V19X 4DTXA 1DQ8A 3FZMA 3CCSN 1PO6A 5KI6A 2CA9A 4B3TK 9RUBA 1HNXF 2AJFE 4J8FA 1FHTA 2R7SA 5M2RA 4ECYA 1S1UA 3EZWA 3THPA 4BWMA 4F2SA 4OZ0A 1I94F 1AA1B 4A62A 4CIGA 1VLOA 2P5VA 5KFNA 8ATCB 2OTJN 1EO1A 4OJRA 4GKJK 1C4CA 2IJFA 2PA3A 1WF1A 2Z2MA 2W6KA 4KGVB 3UCGA 5C10A 1FCAA 3ENVA 4CEDA 2VQEJ 1TTHB 1IXKA 5B7WA 2JOQA 5KRTA 1PJ5A 2RE2A 1J54A 2JFDA 3TJAA 4ANCA 2ATLA 4JKEA 5FDLB 5L1KA 4L75A 3GJRB 4C0BA 5K20B 5B08A 1FX2A 1BCMA 4H0TB 2E5IA 4O0IA 4FYXB 1I3AA 4BRNA 1BA0A 1HBUB 3M7VA 4C97A 4KHQA 3R6MA 3OUYA 1S5ZA 2E4LA 3CJ5A 4DUTA 1I6JA 4M5MA 2J0XA 4FLXA 1JLAB 3W2WA 2QWPA 2ZZTA 1YTUA 4F67A 3M9MB 1UPMB 5DLGA 1IKWA 4USVA 4ED7A 2P9PA 5FRNA 2P9LA 2P1JA 1HBMA 4YHHK 3PM9A 3MXJA 3QJLA 4ZPDA 2MSTA 2AZ3A 1HYVA 5HP1B 3CDUA 5DK5A 4BCAA 5DZ7A 2IM3A 2HQ3A 2CNOB 2DGQA 3CD0A 3DGPA 3RB0A 2V6AA 1U47A 1IKYB 1S22A 1WBDA 1WUAA 1ZA2B 4RL1A 5FDLA 1Y64A 1CJKA 1P8GA 1X31C 4CLPA 2Y9HA 1EHWA 3SDEB 4M5GA 4K2XA 2Y8YA 3S3MA 5HSPA 1RAFB 4CLUA 3MEDA 4GMKA 2MLYA 2XMTA 3HCXA 3M30A 1U48A 1FDNA 5KQ8A 2UU9J 3IRXA 3QRQA 3GFYA 4GNIA 2HRYA 4DFMA 1HNZJ 3THWB 4TVAB 4CO0A 3A3OB 1DZ5A 4CNYA 1Q79A 4IUFA 1ACMB 2MJUA 4MKAA 2CNLB 4WP3A 1FD8A 1T9WA 1YVUA 3CJ1A 1TMJA 4DV6K 2JFKA 3ZZPA 3RVCA 2QFIA 3I56N 5B0BA 5F8MA 2NYIA 3C6UA 4K7QA 4CHZA 5I42A 5GMKa 3CFRA 4NRTA 2NZTA 4JAXA 3KG1A 1F5AA 5HRNA 1DARA 2YWHA 2D5RA 4UQTA 4WPAA 2P9UA 3THYB 3MD1A 3CMEN 3UKUA 1N34J 5K8MA 5L9XA 2ZHOA 2G8KA 4FJ8A 3QJPA 1S6PA 4IXCA 1XERA 3MUMP 1TAUA 4KKOA 2C3YA 3HDSA 4P2MA 2LQBA 3SQGA 2GNKA 4BRIA 4QZVB 2OTLN 4KIAA 2Z4PA 2H5IB 3GPAA 4I9LA 1RAOA 2IYIA 3Q8QB 2HBJA 2G8FA 1N5VA 3FQLA 4B9LA 3NMRA 2XMUA 2IC3B 3UNGC 4P2XA 2QMUB 1BIUA 1NGIA 4BC4A 4HDHA 4DTNA 5GADP 3NH0A 3B78A 3I0RA 2NR0A 3PW7A 2CYYA 5KFUA 4DCOB 2QW9A 2KW4A 4OHWA 3C2PA 1I5OB 2B5JA 2HNZA 3IAM9 2XO7A 3H2LA 1QUPA 2R2SA 1RADB 2WBNA 2FJVA 3KTQA 4QIFA 4JV2A 2VD3A 4CHOA 3MCMA 3LM2A 1FTRA 4RW4A 4ZCIA 3BDEA 2F7TA 3IR5B 2NXUA 4EZ6A 4FK4A 3V81B 4LF5J 1FVSA 4KHNA 3UWTA 5KOXA 1JX4A 3NNCA 2ZUAA 1LNQA 2VDIA 1R6VA 4LMZA 4M94A 2RRBA 4ID8A 1FRMA 2JGUA 3PSIA 1HNZF 3O9RA 1RWXB 1TYQB 2FPHX 3EEQA 1YJTA 5E3RA 3G10A 4O8KA 2V4JA 2MY8A 4AL7A 1H38A 1AUDA 3ZSYA 2Q43A 1O8BA 3LP3A 3LPYA 4DMNA 3GL1A 1K0VA 2RU3A 1J27A 4DTUA 2GBZA 3TX8A 3VN5A 3C0BA 3TZYA 4FKYA 4ZOSA 1T11A 2HS3A 4B1WB 4B1UB 3ZT2A 2PMZD 4OHYA 2HFSA 5KFYA 5KT7A 3CIPA 1R0AA 3GTYX 2R8GA 4JI7F 4KH0B 1ZC6A 2PEHA 3V4MA 4AXJA 2EWHA 2G2YA 3O6QA 2GGPB 4L74A 4DHYA 1FJEB 3RR7A 4I6YA 3VF0B 2BJEA 2NZCA 4FSVA 2ZC4A 3BSAA 3W0LA 2GW8A 4NLQA 3L8BA 3ULDA 4PG6A 5THWA 2V2KA 2ZKTA 1GMWD 4L6V3 2BQRA 1TL7B 2PN6A 5LXRA 3FKBA 2CQ4A 1MN7A 1QY7A 1NZ8A 3TW0A 4J9RA 3H7HB 5F8LA 4HEA9 1CJVB 1O5JA 2I8EA 1HBNB 4DV0F 1XNRJ 1R0BG 2E2PA 5LMNJ 2VPWB 3SPYA 1PIEA 3UQSA 2K3IA 4TLRA 3A8YA 1N56A 1RABB 3QYYA 2Q6CA 1SH2A 3HVWA 1EKEA 3DMJB 2EG1A 2GZOA 4DQQA 5F8GA 5D8HB 3H5SA 4M5NA 1S9FA 4XH4A 4A4JA 5F8HA 4MKYA 3A1YG 3K17A 4DXLA 5FPDA 3PHEA 1YRUA 2PFUA 4ZP7A 3CE8A 2XMKA 2YTCA 3T7ZA 3VQ9A 1QZ6A 4CO3A 2Z1JA 3UKRA 3MXIA 2ZM6K 3PIPQ 3OR2A 4DUYF 4U67L 2PSZA 1Z05A 2UU9K 1VK3A 3EGVA 5F3TA 1R0AB 3BKUA 4Q8EA 5TKWA 1I94J 1WD6A 3H1VX 3HHLD 3UI3A 4OO1J 2IMOA 4LRFA 2ZC3A 4Y0WA 4ZPWR 4O44B 5H9EJ 2HPUA 5AE2A 1T3NA 5ETNA 2BM0A 1WTFA 4IH6A 4NWBA 3SAHA 4NPOA 4NXNJ 3IM8A 4R8UB 1S7IA 2ZBPA 4CLTA 1P1LA 2VL1A 3N6MA