1N6QA

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n6qA05
1TK0A 4I7FB 3OYKA 1RT4B 3LP3A 5KG6A 3ZSQA 4IRDA 4ZPDA 4DMNA 2VA3A 4Y2CA 2IM0A 5KG0A 3RRHA 1BQNB 4XPCA 5JUMA 3I8DA 5J1EA 5KFFA 4CJ4A 2D3UA 3O3GA 1YVUA 5KGXA 3AVHA 1VSJA 4MQ3A 4TYBA 2R2TA 1WSIA 5KG7A 1ZBUA 1REVA 4CJPA 4CJRA 2AGPA 3PO5A 4K4ZA 1Y97A 2Z1JA 3K2PA 2KTQA 1T94A 4MFBA 3NL0A 2OPQB 3MEDA 3AVGA 5L1LA 4DSIA 4XPEA 3V9SA 4CCHA 4C8KA 3I0SA 2YV0X 3LPTA 4CEFA 4NRUA 2WK4A 4FCYA 1NK9A 2RKIB 1TKDA 5T14A 3EPIA 4DTMA 1HMVB 3ISND 1LW2B 3OL8A 3NF7A 4M3RA 4LD0A 4X2BA 4ECXA 3F9KA 1WSEA 1WAFA 5KGWA 3U6FA 1RNHA 4F4YA 4W5TA 1QUVA 3OYNA 4WFZA 2ILYA 1EX4A 2R8GA 3FRZA 4DQPA 2BQUA 1SUQA 4ZTFA 3BSCA 4CEAA 4RW4A 1NK0A 1VSEA 1TVRA 3SYZA 3AO2A 4J2BA 2B6AA 3LP0A 4FLYA 3UIQA 3O4QA 3H40A 2DFFA 1BI4A 4CJKA 4FJJA 3V81B 4OPJA 1DTQA 4CHQA 3HM9A 4TY8B 4IBNA 3BDPA 4OKKA 1QE1B 2QXFA 1JLGA 5CYMB 4KO0A 3VQEA 4JV2A 5HBMA 3QIOA 4DTXA 3OYJA 3RR8A 1S5JA 4DTJA 4O3SA 5J2PA 1NK4A 3C6UA 3GIIA 3NBPA 3QGGA 4CJ5A 1IKXB 4CK2A 5SZTA 4Y3CA 4FJXA 4KV8B 3QETA 3HPOA 1RT7A 5KRSA 3LPUA 4B9UA 2ZKUA 1JLCB 4M45A 4NRTA 5KFKA 2W8KA 3B6PA 5KFSA 3IN5A 2G8FA 3QNOA 2I1RA 3HPGA 3RBEA 4ZVHA 4DTPA 2VG5A 4OLAA 4FS1A 4FW2A 4CJFA 1KSPA 3N6LA 3ZT4A 4CIGA 1RT2A 1RTJA 3AO3A 4CJLA 1YTUA 4Z4CA 1S1TB 3U3GA 3TAMA 1XC9A 3DMJB 2F96A 3F73A 1TL3A 1QSYA 1DTTB 1WSFA 2JEJA 4C8OA 2LSNA 1FKOB 3SUNA 2QKKA 1QAJA 4HKQA 1GOCA 3AVIA 5HRPA 4FVMA 2OA8A 3KLEB 1W9HA 2W42A 4RNMA 4KFBA 1CZBA 3V9XA 4DSJA 3QEPA 3DLEA 2X6NA 4LSNA 3O3HA 5HP1A 5DK5A 5CZ1A 1RTIB 3MECA 3C94A 4W5QA 2ILZA 2HHUA 3PY8A 4QCLA 2HB5A 1L5UA 4FJMA 1JX4A 3S3MA 2R8KA 4E19A 4DU3A 3OS1A 3LP2B 4JS4A 4CJUA 4IFYA 3D5MA 1TL1B 4RW6B 1K6YA 4KBIA 5KFCA 1KRPA 2UUTA 4M3UA 1LWCB 1TKTB 4RNHA 4IR1A 3ITHA 4J9KA 1KCFA 4CEBA 3K5LA 3C6TA 3NAIA 4MKBA 4J9PA 4IRCA 4CFBA 3DLRA 4ED6A 2IGIA 4ZPBA 1XR7A 3AVBA 5J2NA 4AHTA 4BWMA 4CJ3A 4KHMA 4B08A 3BREA 3SUQA 1HJRA 1DLOB 5HLFB 1NJYA 4IKFA 4LY7A 2YNFB 4JLHA 4N76A 1JKHB 5KFJA 4ZP6A 5KFXA 5KT2A 4GMJB 3L8BA 3HYFA 3QLHA 2D0BA 1BQNA 3ZT1A 2YNHA 1QTMA 1IO2A 3NH1A 3DOKB 3HSTB 4JUZA 4M3ZA 3IG1B 2OPPB 4WZMA 3P5JA 3MAQA 3SI6A 4FW1A 4FK4A 4Q0BA 4FJNA 2EX3A 4IG3B 2YNGB 5KFMA 5KG2A 3S3NA 4OLBA 2JEGA 1BIUA 2B5JB 1L3SA 4ZVEA 4NLDA 5KTQA 1HARA 4RNOA 4URQU 4U7CA 2OPQA 1SKSA 1NJWA 2HNZA 3PR4A 1NK7A 4TYAA 3RB4A 3H59A 2HNYA 1RBRA 4YR0A 3RR7A 2EC0A 2O4GA 2BDPA 3ZSYA 3PW4A 4F2RA 1LW2A 4DLEA 2YKMB 4QWAA 3D45A 1KHWA 1W25A 1EP4A 1TKXB 3V1OA 3QESA 1VRUA 4BDPA 4B3OB 2XI3A 1VSIA 3KTQA 3NH2A 1WSJA 4C8MA 3ZSVA 4R5PA 2E6LA 3PX6A 2BANA 4GVMA 3V1RA 4M94A 2HWHA 4NLOA 3OYHA 2G8HA 1RT1B 4KRFA 4CFCA 1C0TB 4K8ZA 3L2UA 2J6TA 2FVCA 4O0IA 4URGA 1FKPB 3RWUA 3ZSZA 3V6DB 3SZ2A 3CM5A 1S4FA 5KFPA 1KVCA 1QE1A 1D5AA 3HVTB 3AVAA 3NCIA 5EWGA 5FROA 4ECQA 2GC8A 2A1SA 4K4SA 3ZSRA 1CLQA 4KHWA 4G1QB 3TAPA 1C0MA 4CHPA 1XR5A 1RT3B 1S1UB 3BGRB 2BRKA 1N6QB 1U48A 2BQRA 4HCBA 1U49A 3SFUA 5KFYA 2HHVA 3M9MB 4EBDA 5DG8A 4H4OA 3K5OA 3VQQA 1RA7A 2RF2B 3GIMA 4ECUA 1BQMA 1LWEA 3KKSA 1S0NA 1VSHA 5HROA 3CFOA 3EPGA 4GW6A 4QPXA 4NLYA 4WYWA 1C0UB 2AU0A 4CEEA 4KAZA 4KKOB 4R0EA 4NZ0A 3UQSA 4J9OA 2FLLA 2C2DA 4FLTA 4MK9A 1I6JA 1ITGA 3VQAA 1MU2B 1JL1A 2GV9A 4CJQA 4FLVA 3OYDA 5EU7A 4H8KA 4CHOA 1T03B 4JS5A 5CYQA 5F9NA 3NHGA 3NDKA 3KLEA 3NFAA 1YTAA 1B9FA 1JLFB 4PUOB 3HK2A 3KHGA 3RMAA 1S49A 2BR0A 2HHTA 1Q9XA 1LAVA 4RW9B 4EO8A 3DLGA 1S1XA 4K50A 4W5OA 3CDUA 4KTWA 2ATQA 3HT3A 4YP3A 1IKVB 4CHYA 5FDLA 1RTIA 4J9QA 4B9LA 2VG7A 2ITGA 4E1NA 3EZUA 4O3NA 4C8NA 1S10A 1C1CB 3TANA 3B6OA 1TL1A 1JXLA 3L2RA 3KK1B 1NNDA 4B8AB 4DEZA 3QO9B 3HL8A 1JLAA 3OYBA 2B4JA 2QK9A 1RT6A 4EEYA 3VQ9A 2ZD1A 5I42B 4PWDA 2E9ZA 3M8PA 3HO1A 1EKEA 3HHKA 2Q3SA 2I5JA 4O3PA 3AA2A 5KFHA 3OY9A 3LP1A 4CJWA 4F50A 3HVRA 2V9WA 3LWMA 3H5UA 4OKJA 2YKNB 3LWLA 2F8SA 5DG9A 3MFHA 4OGEA 1RBSA 5C24B 4CEOA 3RB3A 3ALYA 3RAXA 3FQKA 1JKHA 5K14B 3CG7A 1CXQA 5DQGA 4N5SA 3UR0A 4AHSA 4N56A 2BE2A 3DM2A 3DLKB 1RTDB 2AJQA 2JGUA 1HNVB 4CF0A 3IG1A 4K4XA 4K4VA 3KK3A 1S9FA 4CK1A 1A5VA 1MMLA 2YNGA 4E89A 2OPRB 3L2VA 2B5JA 2D0AA 2A1RA 4FJHA 4E1MA 3VQCA 4FM1A 4ZMMA 4I2PB 3CJ4A 1F21A 3T5HA 1KVBA 5L9XA 2YNIA 2Z1IA 3OYMA 4HUFA 4NLRA 1UWBA 4EBCA 3BQ0A 4CF1A 5EWEA 5KFZA 4DS4A 3VQPA 4PA1A 3JYTA 4AH9A 3L2QA 4DF4A 4HUEA 3RMBA 3OLBA 3MR3A 1J54A 5DLGA 4IR9A 4ID5B 1EXQA 1ASVA 3O4NA 5F8IA 4Z4HA 4FYDA 3TAGA 1ZBLA 4CGIA 1EETA 4CEZA 4CHZA 3NGIA 1D9FA 3PV8A 4K4YA 1IKYA 1CSJA 3QGHA 1KFSA 1HYZA 2RDIA 5EDWA 3VA3A 3BQ2A 1RDRA 3FDSA 4NCGB 5KFOA 1FKPA 2IMWP 4DFKA 4TN2A 3DOLB 4WXWA 3V6DA 3KLHA 3G10A 1S6PB 4CIFA 3E01A 4DTRA 3Q8SB 2WRMA 1RTHB 2V0NA 3FQLA 4R8UA 2R7YA 2KZZA 3SPZA 5C42A 1A5WA 2QV6A 4BE2A 1T05B 3S3OA 1S1UA 2F8TA 4FJKA 1SV5B 4DQQA 4IH6A 4O4GB 4DSKA 1C6VA 1RYRA 3SQ1A 3WNEA 3VQ7A 3SQ4A 1TAQA 2P1JA 2IC3B 2CJQA 2HNDB 3GILA 3CM6A 3QEVA 4Q44A 3DRRA 4NLGA 2G8VA 2WOMA 3M8QB 1S1VA 4OJRA 1HNIB 1L3TA 4PQUA 4Q43A 2XC9A 1HPZB 4CJEA 3KMSA 4NLTA 4FZZA 3PW0A 5HRRA 3QZ8A 4EYHB 4DTOA 4NYFA 2R2RA 1O1WA 2P5GA 1UA1A 1WNSA 3SQ0A 1N5YB 2X78A 4DTUA 4ZVFA 4KKOA 3AVNA 4QWDA 4K4TA 3KLFB 1BCMA 4PY5A 3OLAA 4KI4A 3GIKA 4I9QA 4JRQA 4NLVA 3T5LA 3QEIA 2DFEA 1MU2A 4ECRA 4YMEA 1KLMA 4ZP7A 4J9SA 4N47A 4NCAA 3QIDA 3H5YA 5F9LA 4BWJA 3PR5B 3LANA 1WAJA 4ZP9A 1QAIA 4Z4IA 2W9BA 4DSLA 3QIPA 4HUGA 4QW8A 3KD1E 1D1UA 1N48A 2DPJA 4RW9A 2J6UA 5I3UB 4O4RA 4QWCA 1U47A 4HYKA 2GUIA 4CECA 1J5OB 4DQRA 4EZ9A 4CF8A 2IOCA 2ETJA 2XI2A 3QNNA 4IG0B 5DQHA 2E6MA 1XHZA 4WE1B 3EZ5A 4H4MB 3AVLA 2GIQA 1S9EB 3ZT3A 2VA2A 2PYLA 3H98A 2IAJB 2W9CB 4DTSA 2O4IA 3PJXA 4M41A 3MEEA 3IRXA 3VQSA 3ZSXA 5CZ2A 4DU4A 3KJVB 1LWFA 2V4RA 1IKWB 3IS9B 3JSMA 4FLUA 2WB4A 3NKYA 4DWIA 1C1AA 5J2MB 1K1SA 2OPSB 3FFIB 5C25B 3HP6A 2YKNA 4KTZA 3I5AA 3QINA 1C1BB 4BACA 4Z0UA 1TQLA 4IH5A 5KFEA 2D5RA 1GOAA 3QGIA 5F8MA 3WNHA 3KLIB 4DL6A 3ZT2A 4CGFA 1RDAA 2OZMA 5DGAA 1TV6B 3KKRA 2VG6A 5KFQA 2HWIA 3PO4A 4DG1B 2QE5A 3HPHA 3DLKA 4CK3A 4MK8A 4FJGA 1RTDA 2W8LA 2E4LA 1HNVA 1NKBA 4KHRA 4Q8FA 4QAGA 4IDKA 4DS5A 3K5NA 3DI6A 4FJ9A 1TK8A 2OZSA 1JXEA 2XGQA 2OPRA 2V4QA 4N41A 4Q45A 5KG1A 3OSPA 1FK9A 1Z25A 3DYAB 1NJXA 4I7FA 1GOBA 4CJSA 1RT4A 2P51A 3VQDA 3VQ4A 2KZMA 1JLBB 1KFDA 1I3AA 1BGXT 4IOBA 5KFRA 1QSSA 2G8WA 5KG3A 4EP5A 4TY9A 5JXSA 1HYSB 3MEGB 1JLQB 4TQSA 3OJSA 3NMAA 3MR5A 5KFNA 4Y1DA 3KMQA 5KFGA 1U09A 3KLGB 4ED7A 2BGGA 3OYFA 4QOZB 4BDZA 2XO7A 1NOYA 2RKIA 4CHNA 4UQGA 3I0RB 2D41A 3DOLA 2JC1A 3H5SA 1YVFA 1HMVA 4E7KA 1NKCA 2D3ZA 2FBYA 2WONB 3QYYA 1WNEA 2FLPA 1RBUA 3OS2A 1S0MA 2KQ2A 2FJWA 2W9AA 3OYCA 3CJ5A 2FVPA 2WTFA 3NGDA 4EP4A 3DDKA 3OL6A 1JIHA 5J1EB 4CF9A 1SV5A 1R0AB 2IJFA 1T7PA 3K57A 2PZSA 4F4KA 3KD5E 2J6SA 4DSFA 2IC3A 1RT5B 4F8RA 4MIAA 3K59A 1RDDA 4IQXA 3SJJA 2XGPA 4XO0A 3V81A 4FXDA 1HNIA 3TAEA 4TY8A 5KT7A 3CWJA 5CYMA 3RB6A 4NYZA 4CF2A 2YHAA 4CESA 3G0ZA 4ELVA 4Z4GA 2AX1A 3I0SB 5L1KA 2XCAA 3LAKA 1IKXA 4KB1A 4WZQA 1NK6A 3KIOA 2ASDA 4KV8A 3KK2B 3TR8A 3CJ3A 2DTUA 3CYMA 2OYQA 2ZQBA 2Y1JA 3SI8A 3NGYA 4OPKA 3G6YA 4KB7A 1JLCA 2PYJA 2UVRA 2FBXA 3BJYA 4I9LA 4B9MA 1SUQB 4WFXA 4B9NA 4RW4B 1NK8A 4RZRA 1ZBFA 1BCOA 4DTNA 1CXUA 3G6VA 4DFJA 3LP0B 2HW3A 5DG7A 1JL2A 1RDCA 3UDLA 3ZT0A 3CO9A 1S1TA 1DTQB 5KFDA 4HVJA 1Z4UA 2GIRA 4DL5A 1QHTA 4IG0A 4ECSA 5J2QB 3OYEA 3DMJA 3V9ZA 1JLGB 3V1QA 2AWZA 4KO0B 4WE1A 5HBMB 5KFIA 1DTTA 2HHQA 2NUBA 1FKOA 2FVSA 3N6MA 2W9CA 1D9DA 3M9OB 5SWMA 5J2PB 2GBZA 1ZBHA 3C6UB 3NBPB 1J53A 4F2SA 1TAUA 3KJVA 1UAXA 4ELUA 5KFUA 5HRSA 4NLSA 1QSLA 4M42A 4IKAA 5D3GB 1HQUB 5JS1A 3NE6A 2BQ3A 2JC0A 4YNQA 4FLZA 4M3TA 4DL2A 2G8IA 3EY1A 4KSEB 4XIUA 3SUPA 5F8HA 1OS5A 4CGJA 3PW7A 2JLEA 3H4DA 2R8IA 2VG5B 1D0EA 2D7SA 3M8SA 1UOCA 3MFIA 3LP2A 3VQBA 4KHYA 3KLIA 2DY4A 3O3FA 3TWHA 4RW6A 4M95A 1TKZB 1B92A 4Y34A 4ELTA 3FSIA 5JS2A 1RT2B 1LWCA 1RTJB 1TKTA 4DG1A 3DRPB 1SKRA 3RMDA 3LZJA 3KHHA 3SCXA 1CZ9A 3TAMB 1XI1A 4ECYA 4FS2A 3DRSB 4OVLA 4FBUA 1A5XA 3GV5B 1TL3B 2R8JA 3KHLA 4EO6A 4AHCA 1VSKA 3GV7B 2JEIA 2KFNA 1ASUA 4B9SA 4ID1A 1RAJA 3ZCMA 2W7PA 2G8UA 4ED3A 3MR2A 4KFBB 4BE1A 3DYAA 4ED2A 4Y1CA 1UA0A 3DLBA 3DLEB 4NCBA 1DLOA 5HLFA 4BDYA 2YNFA 5HP1B 3Q8QB 3H4BA 3AA4A 4FLWA 1JLBA 4E7HA 4KAIA 3WNFA 3HXMA 2HVIA 1ASWA 1D8YA 3DOKA 4CFAA 2ASJA 3AVFA 2OPPA 2HMIB 4QW9A 4OKEA 4CGHA 2FC0A 3TAFA 4IFYB 5T7BA 1XR6A 4IG3A 2KFZA 3CIZA 5DGBA 1T3NA 3OYIA 3N6NA 4TLRA 4M3WA 1U04A 3C6TB 3HP9A 1N4LA 1NHUA 2C22A 2HAIA 1SH2A 2ATLA 2XWYA 5KFTA 4ZTJA 2Z1GA 1Q9YA 4YQWA 1FXXA 3HJFA 1VRTB 4KTQA 3MXJA 3CFRA 3NF8A 2R2UA 5L1JA 2YKMA 4DQIA 3MXIA 1VSDA 4B8CA 1TKXA 2R2SA 3L2WA 2WHOA 4B3OA 4NLQA 5DMRA 4W5RA 3QLHB 3TARA 1B9DA 4J9LA 2YNHB 4LSLB 1R0AA 1IG9A 3V4IB 1RT1A 4FJ8A 5KT3A 4Q0BB 4Y2AA 1C0TA 1RT5A 3KOAA 3RMCA 4F4XA 1GX5A 5DLFA 1KVAA 2D0CA 5KFBA 1W0HA 3GIJA 1K1QA 3SV4A 2IDOA 3HVTA 2RDJA 1HQEB 4J2EA 2HNZB 3BSAA 3WNGA 4M3YA 3MF5A 2HNYB 3ISNC 3QERA 4G1QA 5F8GA 4WXOA 2PY5A 3MXMA 4WFYA 1RT3A 3D0PA 3BGRA 3KK2A 1N6QA 4URSA 4ED8A 3ASMA 2DPIA 3VQ6A 3P83D 4W5NA 2IS3A 3V6JA 4FZYA 4F4WA 3KNAA 1BIZA 3AVKA 1EP4B 3C95A 1VRUB 2AGOA 4HTUA 2RF2A 3BSOA 4R5PB 1T8EA 3LALA 2BANB 1SH3A 1S6QB 3TVKA 2VWKA 3TAQA 1C0UA 4RNNA 2IBKA 2HHWA 1LW0B 2ASLA 3RTVA 4O0JA 5J2QA 3SV3A 2F8EX 4CGDA 3IGVA 1S9GB 1VK0A 1T03A 4TQRA 1RA6A 3PHEA 1JLFA 1IH7A 4E7IA 4PUOA 3KHRA 1VSLA 4BE0A 4LQ3A 5D3GA 3HKWA 1HQUA 4FJ5A 4FJLA 4IFVB 5KFWA 3NGZA 4DL4A 4FM2A 4H4OB 1GX6A 4AHRA 1IKVA 3AO1A 4CEDA 3LZIA 3PX0A 4MKAA 3KLVA 1BQMB 4KE5A 3V9UA 1LWEB 4Q8EA 1TGOA 5HROB 2ALZA 3RRGA 2Y1IA 1C1CA 2KW4A 4FBTA 1G15A 5L1IA 3VQ5A 4HHTA 1TKZA 3KK1A 5KFLA 4E3SA 3GYNA 3QO9A 4MH8A 3DRPA 3OYAA 2IM1A 1JXBA 3OHBA 5KT5A 2UUWA 1JLEB 3ICLA 4CEQA 5I42A 3K58A 3DRSA 1KHVA 4O44B 3PUFA 4NLWA 4Z4FA 3SUOA 3OVNA 5CYQB 4Q5VA 4NLXA 4K8XA 2HVHA 1BISA 2C28A 1KLNA 4MIBA 5C24A 3V6KA 1VSFA 1YT3A 4E0DA 3DLGB 1S1XB 3DLHA 3HVWA 2XRIA 3AV9A 3EYZA 4DL7A 3SNNA 5K14A 2FJVA 1SKWA 3L3UA 1HRHA 1LV5A 5FDLB 4J9NA 3OHAA 2VG7B 2FVRA 3HVAA 4RUAA 4ED1A 2HMIA 4IRKA 4DFPA 3NF6A 4EYIB 1I39A 3U3YA 2WCXA 4YR3A 4F3TA 2E9TA 4RW7B 1SL2A 5KFVA 3PZPA 5HRNA 4J9RA 4ZHRB 1NK5A 1JLAB 1X1PA 1QS4A 1RT6B 4L8RB 3RBDA 2ZD1B 3V6HA 3CQ8A 4RNFA 1J9AA 4PWDB 3M8PB 4I2PA 2VWJA 3IAYA 3NAHA 2I5JB 3LP1B 1VSMA 4CE9A 4I2QB 4JV1A 2ZE2B 2O5DA 1VRTA 4RW8B 3I5BA 4Z4EA 3CFPA 1Z26A 3E51A 4KHNA 1X9MA 1NHVA 1S1WB 4H54A 2AX0A 4LH5A 3ZSOA 3SPYA 4CJTA 4F3OA 2UVWA 3OYGA 4ZP8A 4KHSA 1TK5A 4JV0A 3G86A 4O3RA 5F8LA 3OL9A 5F8JA 4O5BA 4ICLB 4ID5A 2BE2B 3DM2B 3ZSWA 4YFUA 3AVJA 2XY8A 4LSLA 3V4IA 5KT6A 4O3OA 4O3QA 5C5JA 1L3VA 3KK3B 3IGNA 1SL1A 3H08A 3OL7A 3RB0A 3PJWA 4LQ9A 4NCGA 4ECZA 2X6SA 5KRTA 3SQ2A 3AVCA 1LAWA 1U4BA 5KG4A 3GV8B 3PVXA 3ULDA 3QZ7A 1S6PA 4B9TA 4GC7A 1KTQA 3BSNA 1RTHA 4E7LA 1HQEA 3TQ1A 2YNIB 3SFGA 3D28A 5EWFA 4QWEA 2R8HA 3L3VA 2FLNA 1UWBB 4DL3A 3NH0A 1T05A 4NLPA 2IJNA 3AA3A 3T5KA 4CJVA 1NKEA 2UVVA 4O4GA 1XHXA 3JYTB 2HNDA 3M9NB 5CY4A 3OS0A 1REVB 4B9VA 1WSGA 4FLXA 2OH2A 3M8QA 3OYLA 3VA0A 1N56A 2X74A 5KFAA 4J2DA 1HPZA 1S97A 1RCHA 4MFBB 1EETB 1S6QA 4MK7A 5KG5A 4RUCA 4O55A 3QEXA 3MEDB 2XHBA 5FRMA 4OGCA 4QWBA 1IKYB 1SL0A 1N5YA 5DQIA 2IM2A 3KLFA 4CIEA 2FBTA 1LW0A 3CDWA 4ECTA 3H2LA 3AO5A 1ZYQA 3KLHB 3E01B 1RDBA 2JEFA 4ZPCA 1S9GA 1SH0A 4KREA 4NLUA 2EHGA 4R8UB 2XY6A 3TI0A 5C42B 4FM0A 3K5MA 4EZ6A 3AVMA 1TVRB 3V9WA 5I3UA 3TABA 4IFVA 2B6AB 4IH7A 1J5OA 4RU9A 2YHBA 3DRRB 3H5XA 1ZTWA 1BI4B 1TP7A 4DU1A 2WOMB 1S1VB 3BQ1A 1QQCA 2RN2A 4PQUB 2FVQA 2HHSA 1U45A 4DF8A 4H4MA 3I5CA 1BHLA 1S9EA 4FK0A 3PW5A 1S48A 2B43A 1RYSA 4CERA 2IAJA 4CFDA 5KT4A 4RG8A 4ED0A 4TSXA 3QEWA 5EUHA 4LH4A 2XY5A 3S9HA 4EBEA 1JLEA 4G3IA 4E7JA 4AHVA 4ZPAA 3M8RA 1IKWA 3IS9A 3CDEA 4OL8A 1RT7B 4O44A 1KLMB 5J2MA 2OPSA 3FFIA 2XCPA 2XY7A 5C25A 4ZVGA 3AO4A 5F8NA 4J2AA 4KHQA 1C1BA 1RBVA 1C2PA 4YR2A 2W9BB 3MR6A 3QIPB 3OJUA 3CVKA 1NOZA 2C2EA 4DQSA 4FZXC 4HCCA 3VN5A 4DLGA 4ECWA 4M3XA 3BR9A 1TV6A 2FJXA 2P5OA 4KPYA 5KI6A 3Q8RB 1NJZA 3VQ8A 4KB0A 4TXSA 4K4UA 3NF9A 4FJIA 4J9MA 4AHUA 3NAEA 4RW7A 2BRLA 4K4WA 4ZHRA 1ZBIA 3T19A 3LDSA 3MEEB 5FRNA 3IRXB 3GQCA 3CJ0A 4DSEA 4ECVA 1WLJA 1LWFB 1ZETA 1S0OA 3OSNA 3JSMB 1RILA 4C8LA 4LSNB 3G6XA 4I2QA 4WYLA 2ZE2A 5E41A 1HYVA 3MECB 4RW8A 4KI6A 3T1AA 1RBTA 2IA6A 3LAMA 1S1WA 1HYSA 3A2FA 3MEGA 1JLQA 3THVA 3UPFA 4FK2A 3RAQA 2E9RX 3PX4A 3Q8PB 4AILC 3T3FA 2AQ4A 3AA5X 2VG6B 4ICLA 4FJ7A 1X9SA 4JRPA 3CJ2A 2CKWA 3ITHB 2IM3A 2G8KA 2C2RA 4U6PA 2UVUA 2HHXA 2FBVA 3KLGA 4GC6A 4IDKB 1WN7A 4NYNA 1Q8IA 3DI6B 2RPIA 3MTKA 2DFHA 1X9WA 1IM4A 2QKBA 2Z1HA 1BL3A 5J2NB 1L3UA 3I0RA 4KHUA 3PW2A 4DFMA 2W7OA 3P1GA 1WSHA 4CGGA 4F4ZA 1XWLA 2AGQA 1FK9B 1ZTTA 3T5JA 2WONA
chains in the Genus database with same CATH superfamily
3CJ7A 1RT4B 5KG6A 4DMNA 2MKCA 4CRJA 2E5LK 3TWZA 4JD2A 4OO1J 2DH7A 3JS9A 2HQ3A 1VS3A 4CLUA 1BQNB 3QQCD 1R3NA 4X66F 1X7VA 4K2JA 5DJBA 3AVHA 1REVA 3R5JB 2RH3A 4X4PA 2GZOA 2R9LA 3OPKA 3CJRA 2XYPB 3A3PB 1Y97A 2OD6A 2JOQA 2AD9A 4LF6K 3ZZYA 1HBMA 2RDDA 2XHWA 1ZM3A 4XPEA 2SXLA 5GINA 3HSCA 2UU9F 3UFCX 1NK9A 1TKDA 3MCOA 4LR9A 2Y9HA 2MY7A 2CJAA 1A0OB 3ISND 2H54B 5BRHA 1UMJA 3OL8A 2VDIA 3O5BA 4M3RA 5M1QA 3W5ZA 4X2BA 4ECXA 2Q1NA 3F9KA 4PXBA 5KGWA 2M52A 5IV4A 2J4RA 5CH7B 4KRWA 4WFZA 2ILYA 2E7XA 2PO4A 1EX4A 5A8RA 4WBFA 1F1BB 5AJ3F 3CCSS 2BQUA 4V19X 4LF8J 2M2BA 4DOZA 5LSOA 3SYZA 5JMVA 4H0VB 4QS8A 1MMDA 1M5KC 3O4QA 1NMNA 2VFTA 4FJJA 1DTQA 2O01C 5J1PA 4TY8B 3RVCA 1R6YA 4IBNA 2WSEC 4OKKA 2R7XA 1QE1B 2QXFA 2AYMA 3R7BB 2FZCB 4JV2A 1NGJA 1J27A 1S5JA 3U1MA 2PN6A 3R1XA 1NK4A 3GIIA 3EE3A 3QSIA 3J81Y 3N9UC 4A48A 1JJ2M 4FJXA 3IM8A 1YJRA 3QETA 3SSRA 4MLHA 4CH7A 4CM2A 2BOAA 2HMPA 3M32A 5THWA 1FRJA 2ZKUA 1JLCB 1LXNA 5KFKA 2DGTA 5KFSA 3ZETB 1FJEB 2O8DA 5AT1B 3QNOA 5D15A 3RBEA 3VCDA 4DTPA 2AHOB 4OLAA 1SC1B 4CJFA 1KN6A 4LFAJ 2EVZA 1H38A 4HHUA 4OYZA 4Z4CA 5AQMA 4ZVRB 4DN0A 2V8VA 3TAMA 2FHKA 5BR8F 1XC9A 1HKCA 5GMDA 1NLVA 3G87A 4DCPB 3FFKB 2JEJA 2JWLA 1GOCA 2RAQA 4NLBA 4FVMA 2UUBJ 5HRPA 3KLEB 2W42A 4KFBA 4XH1A 4AXJA 3HSGA 1CZBA 1R59O 3ET6B 1IV0A 5BR9A 2X6NA 2VPYB 1GTHA 4KH0B 3BKUA 5CZ1A 4ZITA 3U9ZA 1RTIB 4YOYA 2EI5A 5T7LA 1L5UA 2R8KA 5D4PA 4GMKA 1MWKA 4ZVSB 1PO6A 3O9QA 4IFYA 1TL1B 4RW6B 2WVCA 1WWHA 3BBBA 1KRPA 2BACA 4J9KA 3C6TA 3NAIA 3BS9A 4QIWD 3IFEA 4CFBA 4CIOA 3HI9A 4NOHA 3L7OA 2JL9A 4JI7J 4ED6A 1Y11A 3F0NA 1FDNA 3OR1A 1CJTA 4BWMA 2ROEA 2DNYA 4WFAL 4A8WA 2C1EB 2DKOB 5DZ7A 5A0YB 3DDNA 4WK3A 2Q1LA 2C2MB 1HJRA 1DLOB 1NJYA 3FBEA 2QA4G 1TUWA 2YNFB 1K47A 4JLHA 1ZBSA 1MNEA 2P9UB 2XO6A 2D0BA 3ZT1A 1H7XA 2E5JA 2VC1A 5EX0A 1IO2A 3HSTB 3G9CA 3IG1B 4WZMA 1HNZK 2MQMA 3SI6A 4Q0BA 2GQCA 2V8DA 3O80A 4B1XB 4IG3B 4BS2A 3KG4A 4LF7F 2KYXA 3MOZA 1X8DA 1N5QA 2LU1A 2B5JB 5KTQA 2YX4A 1BOTO 4JYAJ 2HURA 1SKSA 3WXLA 4PG5A 1YZ7A 4LRAA 2VC0A 3GONA 2E5GA 4YR0A 2MKHA 3RR7A 4H5RA 3LPYA 3ZSYA 4ERDA 1XN9A 3KG1A 4BG8A 3PW4A 4FKYA 1LW2A 4C98A 2PI5A 3D45A 2PIIA 3W66A 1B64A 2J76E 4BDPA 1W7AA 4B3OB 4UOFA 3BBFA 3NH2A 2QG9B 4R5PA 4TU9A 4DV6J 3PX6A 1VJWA 4YHHK 2HWHA 3B82A 4HT5A 3TPQA 1RT1B 3MPDA 4IOAL 1YGYA 2EFQA 4HT7A 1YJ9N 1N32J 5B7WA 3ZSZA 1WF0A 4ATNA 1KVCA 2V7YA 2E8AA 2YHXA 1D5AA 2EXUA 1QD1A 3M5RA 1XNQF 4AL7A 2GC8A 1NGHA 2A1SA 4K4SA 3ZEUB 1H2UX 4J37A 4G1QB 3VAHA 3UDCA 3A3NB 2B51A 1U48A 5GIPA 1JMTA 5AZJA 2HHVA 3M9MB 4EBDA 3VQQA 4F3QA 1O6XA 4EIAA 1LWEA 2MQQA 2BMBA 3E9LA 3TSQA 2FC9A 3CFOA 3FZKA 4GW6A 2HPUA 2BJ3A 1MWMA 4CEEA 4KKOB 3UQSA 3MD3A 2BM0A 2HIQA 1YKWA 2XMKA 4LVNP 2C2ZB 4FLTA 4JI8F 4AUKA 3FJ2A 2HGNA 1VQ6S 2P6TA 1IBLF 3SDEA 2HLTA 1G7CB 1I6JA 4YB7A 3VQAA 4CD3A 1B0VA 4OJ3A 5LMNK 2E5LF 3FEYB 1YAGA 2A1BA 2MQNA 3SIPB 3NHGA 3O1WA 1QJHA 1YTAA 1EHWA 1JLFB 2UXDJ 5LY3A 3RMAA 3NOCA 1S49A 3A8JA 3NCQA 3T7ZA 4N8NA 5B09A 1LAVA 4Y2MA 4YEAA 2ACMA 1HKAA 4KTWA 2KT2A 4YP3A 2P9SB 4MDAA 4CHYA 4B3MJ 4J9QA 3ENVA 2J7KA 1VRQC 3D6MB 4CDIA 3O8MA 3BH6B 1RWNB 3NNCA 2O8BA 4DR2K 4C8NA 1FDDA 1C1CB 1HBUB 1S10A 4K0KF 5L9NA 3B6OA 1JXLA 2LVWA 4PQAA 3KK1B 2G9OA 3Q2SC 3CCWA 3M1VB 1RT6A 3VQ9A 1XC3A 2FJDB 1UAWA 3GE9A 2FIUA 5I42B 2CPJA 4ZPTR 3R2CJ 3I82A 4CJWA 4LC9B 2C3OA 5D78A 3CJAA 3H5UA 5DDOC 3WUHA 5DG9A 4OGEA 4CEOA 3BF1A 2Q43A 3R3TA 3LH2S 1U7LA 1MN7A 3RAXA 3FQKA 4BREA 4YOXA 1CXQA 4N5SA 1RLCL 4AHSA 3IR6B 2Q36A 3DM2A 4A5BA 2ZHOA 2AJQA 2P9NA 3HHLA 2DNRA 5JVHQ 3CCVN 1OQ3A 3MEKA 5LJ3Y 3J7YU 1A5VA 4TLQA 2KHCA 3VAGA 2OPRB 2CQIA 3L2VA 4ED4A 1GMUA 4R25A 2ZM6F 1LK5A 4RBUA 4FJHA 4NI2B 5F2RA 1YJTA 1U02A 1MROA 4I2PB 4JI5J 4RU2A 2OEJA 2G0JA 2FDNA 1UWBA 5ETRA 1HX1A 2KFYA 3W64A 4PA1A 3EX7B 3UVJB 4UY8T 1RHQB 3C7NB 4HUEA 2UXCK 4M8LA 3QSYB 5DLGA 1EXQA 3NGRA 2P9KA 3VEXA 4EAHD 2RQKA 3LW5C 5LJWA 3VAIA 3TAGA 3VVTA 1EETA 3NGIA 4PZVA 1KFSA 1CSJA 3WIUA 3CC7S 3CPWR 3H0PA 3D7EO 2AYEA 3BQ2A 3SSQA 2DITA 3RW6A 1XK8A 1NPPA 3V6DA 5G4DA 2ADBA 2NNWA 5LMUJ 1DGKN 1I94K 1S6PB 2MZSA 4CIFA 4DTRA 2PGCA 4JI0K 4JI3J 3FMWA 5H1SV 5H1SQ 1GLJO 3SPZA 2QV6A 4BE2A 1S1UA 3VOVA 2FGCA 2RUGA 4IH6A 1TAQA 1FX4A 2CJQA 3CM6A 2L41A 3BGLA 3NCRA 3GFYA 4NLGA 5ETPA 2GEMA 4TU8A 3UW1A 1F3FA 4NLTA 5C10A 3GL1A 4EYHB 4NYFA 2R2RA 1F5BA 5HATA 4DTUA 4A8MP 1WEYA 4FPRA 3AVNA 4FF1A 4PY5A 1HIYA 2KJWA 4KI4A 4YY3K 4NLVA 1NG9A 4ER8A 3IAM9 4FPBA 3TNVA 1KLMA 4UOCA 4ZP7A 3UD3P 4N47A 4MYTA 4WPAA 2CZ9A 3LOUA 5F9LA 2Q2RA 3PR5B 1WAJA 2VCPA 2QLXA 1QAIA 1RU2A 3M2VA 4HUGA 2KLAA 4CH0S 1UFKA 3N4PA 1N48A 2WBMA 2DPJA 5L46A 4WFBQ 4O4RA 2VU5A 3TUJC 5L38A 4DQRA 3E2EA 5FLXU 4EZ9A 4CF8A 1V4TA 1ULRA 2ZBCA 3MM5A 2IOCA 4ZPVR 1U2VB 2XI2A 2LDYA 2IYIA 1YSJA 3IFRA 4LF4K 2VA2A 4FF4A 1WJ9A 3DJCA 3ELHA 1T9UA 3H98A 2G4BA 2IAJB 2F8MA 2W9CB 1XEZA 1VBXA 3NNHA 4DUYK 3WC0A 4WCEQ 3TX8A 5CZ2A 4DU4A 1RHJB 3IS9B 3JSMA 1S7HA 3MAAB 3C6HA 1IBKK 2N82B 2OPSB 2XBPA 3HZEA 5C25B 4DR5J 2DIUA 3I5AA 1VQ7N 1KAXA 2KRBA 4UOGA 2CPXA 2VB6A 4U8VA 2ASYA 4A8FA 2V7ZA 5F8MA 1UFWA 5AQJA 3KLIB 1RKJA 2RS2A 4CGFA 4BGBA 1EKRA 2A3ZA 4Y28C 1X5PA 2J8SA 4F04B 4RKUC 3DLKA 4CK3A 1RTDA 2W8LA 2E4LA 1HNVA 4P6QA 4KHRA 4DS5A 3C15A 4HR2A 3G4SN 3K9JA 1JXEA 2DTJA 2XGQA 4YB1P 1VQNN 3DWLA 2W25A 4Q45A 3QWUA 5KG1A 1FK9A 2KN4A 4M63C 1KD1T 1X9JA 1VQSA 3CSKA 3DYAB 1GOBA 2H4WB 1J5EJ 3MX2A 3J7Z5 1QZ5A 3VQ4A 2KZMA 2NYHA 2WSFC 1QHAA 1MWQA 1I3AA 1GXUA 2RRNA 2RRAA 1URNA 2G8WA 4I56A 1CJUA 3CMAS 4BRNA 4TY9A 3OJSA 4JOUA 4HVZA 2POKA 3CCES 2Z4PA 3P96A 5DM6Q 3VGMA 2PI4A 2VODA 2HHHJ 1A9NB 4USJC 4BDZA 2UV8G 4OX9F 2F8HA 4CHNA 3T1YF 3DOLA 2JC1A 3H5SA 4LFCK 1HMVA 1NKCA 2QA4N 2V2ZA 1T9WA 1CS4B 3PYEA 1J2VA 5LXYA 2FLPA 1RBUA 3OS2A 4P7VA 1S0MA 1IJFB 4X84A 5LM7E 2MLXA 2WTFA 3CJTA 3NGDA 3BKTA 4PR6A 1JIHA 2M3DA 2BVZA 4F4KA 1NMEB 3THWA 4JKFA 4F8RA 3O2IA 2UV8A 2QMWA 1HNIA 1B99A 5KT7A 1HBMB 3QT8A 1N36F 1CQMA 3FEXB 3W7BA 4CF2A 4LMZA 4OZ1A 1X4HA 5E7OB 2WFBA 2AX1A 5HQLA 1SPBP 5L1KA 3A8IA 5AQOA 4ISGA 2MKIA 1IKXA 4MIWA 1WOQA 4WZQA 3EWGA 1NGFA 4OZ0A 2ASDA 1HLUA 2FHOB 3CC4N 4FWQA 1SJ1A 2DTUA 2ZQBA 3GFXA 3SI8A 3G6YA 3W65A 3PXGa 2DH8A 3LDPA 5A8RB 3PACA 5EVZA 2Z57B 1N8RT 4B9NA 3A5OC 1FRXA 1BCOA 1CXUA 4DFJA 1WHWA 3A1YG 2XMTA 5DG7A 1JL2A 1RDCA 1FEHA 3I56S 1S1TA 1DTQB 5J2QB 2MQ8A 3DMJA 1WACA 4YOVA 3OYEA 4C97A 5AFUA 3V1QA 1NSPA 2HHQA 4LF9J 1FKOA 3FKBA 4UY8O 1UFLA 2OEMA 5SWMA 4Q7AA 2ZH5A 3PYGA 2VFVA 1TAUA 3KJVA 5IFMA 2WVBA 4Y2KA 3UDEA 4ES3A 3MDFA 3JAMU 2V94A 2BQ3A 4JI4K 4LRBA 4DL0C 2O66A 4YNQA 4DPWA 2EWHA 2G8IA 1NDCA 4KSEB 1B0TA 1E6YA 5F8HA 3MM7A 3SEOA 2O8DB 3T6JA 4CGJA 3OTBA 2I8EA 3PW7A 1D0EA 3IMXA 3SBTA 4USVA 1APSA 2WBNA 4DR3F 4GO7X 3UO0A 5GAEP 1NGCA 2DY4A 2EPIA 4M95A 3FSIA 3CCQS 3S01A 1LWCA 4Z37A 4DG1A 1SKRA 2R4FA 1UVLA 2G2YA 3RMDA 4FF3A 3LZJA 3SCXA 4BR2A 3TAMB 1I94F 4JI1K 2NXEA 4FS2A 4FBUA 1EIYB 2M5YA 5GADI 1PILA 4PWWA 5E3QA 1KQGB 4AHCA 1VSKA 1ASUA 3D2FB 1RAJA 3ZCMA 1UVIA 4ED3A 4KFBB 3PG9A 4PL8A 1Q8BA 4BE1A 2XULA 4I6WA 4NCBA 4CWBA 3DLBA 4DR1J 2ZWHA 5A2QO 4NXNF 3EJMA 2GX8A 2HEKA 3FK4A 2DNLA 2CH6A 4P2FA 4DV2F 4DV4K 4KAIA 2GMJA 5T7LB 1ASWA 1HKGA 5T41A 3DOKA 1SZ2A 2OPPA 2HMIB 3A5MC 1FRHA 4IFYB 1XR6A 1YQHA 1QY7A 4OLOA 3CIZA 1T3NA 3OYIA 3AHPA 5M2UA 1FFSB 1FJCA 3C6TB 2UUCF 4NEZA 1OY8A 1N4LA 3DNCA 4M5MA 2HAIA 2ATLA 2XWYA 4YQWA 2V2QA 2D9PA 4GVBA 1CJTB 3GFZA 3U7JA 5KAKA 1YUWA 4A4JA 4CI6A 2W6LA 1OY6A 2R2UA 5FPNA 1YF5L 1PBAA 2J9DE 1JNRB 1VSDA 1SVDA 1YI2S 1WUUA 2R2SA 2MPUA 3C0BA 4NLQA 3IUCA 4W5RA 4B3TF 1RWVB 2H4YB 1B9DA 4J9LA 1V6HA 4LSLB 1R0AA 1IG9A 1S6OA 3V4IB 2UUAF 1HKBA 3H1QA 1XMQJ 3R6MA 4FJ8A 3GSIA 5KT3A 3BUZB 5LJVA 4Q0BB 3ULHA 5AQLA 2BKNA 5K8NA 3ZZRA 5KFBA 1W0HA 1GTEA 1RGVA 1RWPB 1QLNA 3HVTA 4RBVA 2RDJA 4J2EA 1IBKF 3QERA 3ID6A 2XS2A 2PY5A 3MXMA 1CULA 3BGRA 3KK2A 1N6QA 2NPFA 2KL8A 3ETMA 2DPIA 3VQ6A 2R7RA 4HTLA 1KXPA 4FZYA 3KNAA 1O0PA 4Z2XA 1FNXH 4DV1J 3C95A 3CJKA 2O67A 1ZAVA 4HTUA 4R5PB 1S99A 2IVPA 4F26A 3LALA 1S6QB 1NPRA 4WFBL 5HK4A 1KD1O 1CZAN 2IBKA 2UYTA 5AQXA 1T02A 1TUGB 2CA9A 4AYBD 3VMFB 2DEIA 4OZNA 3RTVA 2ASLA 4B3SJ 1RB0A 3A5NC 3NP5A 3SV3A 4I64A 3IGVA 1LQ9A 3H6EA 3GR0A 4FPAA 1R27B 3QATA 4IO9L 1A6LA 4TQRA 4OJHA 2HQDA 1NJIT 5AQNA 2IYGA 3CCJS 1Q79A 1IH7A 3KHRA 1VSLA 3GG0A 4LQ3A 3ETOA 5AZJB 4DZDA 1HQUA 1GEHA 2CXEA 5KFWA 4D3GA 3WHIA 3LUYA 1MG7A 3FGVA 4DPYA 2AA4A 4MKAA 1LWEB 1NZ8A 2A3JA 4Q8EA 1TGOA 2ZGYA 2F1FA 4XAKA 1G15A 2ZDPA 4E3SA 1TKZA 1RBOB 3V5RA 3QO9A 3BKFA 4OIXA 4RUBA 4DN9A 1RBLA 3ICLA 4CEQA 3SDEB 1RADB 2IMOA 4O44B 3PUFA 3EDRB 4MJKA 3SUOA 3BPDA 4Q5VA 1WHVA 5CZXA 3W0LA 1U2CA 2F4VJ 1YK9A 1WF2A 3FR0A 4LVOP 4OV1A 1BA1A 2YHYA 1VSFA 1YT3A 4NXMF 1VQLS 4E0DA 2FGOA 3DLHA 1IJJA 1PJ5A 4CLFA 1NPKA 4B9QA 4DL7A 1TL5A 2Y3YA 3SNNA 2LA4A 2QTDA 4JK7A 2YQ1A 3L3UA 2DT9A 3OHAA 3HVAA 4J7CA 3RRKA 2OLWA 1RWKB 2O8BB 2GW8A 2RJZA 3CMEN 2JRSA 4HHHA 4YR3A 1H2VZ 1WTFA 3TRGA 5DM6L 1NK5A 1X1PA 1E6VB 1RT6B 2ZH9A 4L8RB 3RBDA 2MQOA 3CQ8A 7AT1B 3IAYA 2D1CA 2B4OA 1N8RO 3BZKA 4CE9A 2YKOA 3C46A 2VUGA 1OH7A 4Z4EA 3MGJA 3CFPA 1U1LA 1Z26A 4MLEA 4JKAA 4KHNA 1NHVA 1S1WB 3ZSOA 4KPCA 1RISA 1TK5A 2FJBB 4PEOA 3OL9A 4O5BA 2I38A 5IT9U 4ID5A 1SKUB 3K9KA 3DM2B 2IY5B 3HOTA 1G2EA 3I32A 3F2KA 2XY8A 5A8WA 2P9NB 3BB5A 3HHLB 3D2WA 4H5NA 3WXKA 3OHRA 3OL7A 3LQVA 4NCGA 4WF9Q 2ITMA 4OQJA 3AA9A 4DR6J 3M30A 2HS0A 4M5GA 3PVXA 4KGXB 4B9TA 3AB4B 4J9UE 1H72C 4QWEA 3L3VA 1IBCB 2FLNA 1UWBB 4DV3J 3NH0A 3N5BA 1ZOTA 4LR8A 3A13A 2E29A 3T5KA 4FWKA 3KG0A 1U1PA 3SBGA 3M9NB 4O8KA 4JI2J 1MN9A 4B9VA 2OH2A 2P9KB 1ZPWX 2X74A 1HPZA 1S97A 2Z58B 4MFBB 3I33A 2WUSA 5AZIA 1EETB 3G71N 3TVZA 4MK7A 3MEDB 4MKVA 2YWEA 1SL0A 2AV5A 3H20A 3CDWA 1SC4B 4JKBA 3MCNA 1YXQA 2GWJA 5CZVA 1S9GA 1U1NA 2XNQA 3Q22A 2GVZB 3MMCB 4LF5J 2OSRA 2XY6A 1VBKA 3CCTA 3BPSP 2EFVA 4ILMA 3K5MA 1FEEA 2F9JA 1RDWX 1FJGK 2ERRA 1NB7A 1LCUA 3V9WA 5I3UA 3VEWA 4CO4A 3TABA 4IFVA 2B6AB 4CLLA 1PAUB 1ESVA 1YITS 5E84A 1X4EA 1BI4B 4FZVA 1Q53A 2FVQA 1RK8A 2HHSA 2YTCA 3AJDA 2P9GA 3G6EN 4DF8A 3I5CA 2CUYA 2B43A 1NCLA 3KYLA 3R6GB 2V51B 2WC9A 2OSQA 1LK7A 1RABB 4L3NA 4AHVA 4ILJA 1BUXA 1KLMB 1W2BM 5CD4H 4DR4J 4K43A 3FFIA 2NLXA 3BH7B 1HNXJ 3J7YP 5BPNA 5K8OA 1WC5A 1JB0C 3OJUA 4ZOSA 4LF8F 1HI0P 5HAOA 1SB6A 1OQ6A 3VN5A 1P8GA 2CJYB 3CJ8A 1WBBA 4ECWA 4G1IA 2APOA 3VF0B 1LOUA 2VQFJ 3DXKA 2P9IB 4EMDA 3MM5B 3OFGA 3ILIA 5KI6A 1MMNA 3R5GA 4KB0A 3MZIA 1HR0K 1SS6A 4OX7A 2NUUG 1FHTA 4RW7A 2ZNZA 5TKYA 1I51B 4ZHRA 1ZBIA 3T19A 3LDSA 2XEXA 4L3KA 1BG3A 2WB1D 1BC6A 5CABA 4ECVA 2XMAA 4E2FB 4DR7J 1RQ0A 3OSNA 3JSMB 1RILA 2QGFB 3PIOQ 4LSNB 1S22A 1RI7A 1C4CA 3HJVA 4RW8A 4KI6A 2EFPA 3QWPA 4F3MA 3EE9A 5F0UA 3LAMA 1GNKA 3A2FA 3EVOA 3MEGA 5ETVA 3THVA 3SMPA 3PX4A 2E1AA 4GKJK 3AA5X 4LFAF 4FJ7A 2NRZA 4YOUA 1XTZA 1X9SA 4JRPA 3CJ2A 3DU6A 2C2RA 5DRKA 2UVUA 2KHOA 2HVZA 4BQZA 3UN2A 3KLGA 4BRGA 1NJIO 3ZTPA 2FZKB 2QWPA 1Q8IA 2V4JA 2RPIA 1OJ4A 4QS9A 4USIA 3TZZA 1O5JA 1RAIB 1BL3A 5J2NB 2MYFA 3MM6A 2Y0BB 3PW2A 1VCTA 4DFMA 4CGGA 3CD0A 1FK9B 1ZTTA 2UUBF 2FSNA 3T1HK 3MI7X 4Z94A 2A0FB 2CH5A 3ZSQA 2CGLA 2GS8A 1XBWA 3RRHA 1T9TA 4UZBA 2ZH1A 1DHMA 4X4QA 2O8CA 5JUMA 2OIHA 3I8DA 2G2OA 1P90A 3EEQA 3BGFA 1CJUB 3VF6A 2D3UA 2CPHA 2VASA 3O3GA 1N34J 4MQ3A 1WSIA 4M1KA 5E3RA 2PMWA 2AGPA 2Q31A 3K8VA 3POTB 4I6YA 2P9LA 2Z1JA 4DDFA 1T94A 4ZVQB 4C1NK 2R7OA 1NGGA 3NL0A 5L1LA 1PYSB 2DNZA 2P9CA 4OYMA 3V9SA 3P3DA 2FPHX 5E33A 1GLCG 2DXEA 3I0SA 4L74A 4WTYA 4JI7F 4FCYA 4WIQA 3EPIA 3M2RB 1HMVB 3D1HA 3OFEA 1ATRA 3TEGA 1RU1A 3GLJA 1WSEA 1WAFA 2FSJA 3QRRA 4W5TA 2ASPA 1QUVA 3OYNA 3FRZA 4YOWA 5H9EJ 3WZ0A 1SUQA 4ZTFA 3THTA 1VSEA 4FYVB 2N7YA 1FT8A 1HHQA 3DDIA 2Q79A 4FLYA 3X3UA 4M7XA 5C15A 3UIQA 4UZCA 3H40A 2DFFA 2M0GB 4CJKA 3HM9A 4OPJA 2HBLA 4M5KA 3OXGA 2HSTA 1DURA 2HSEB 1JLGA 3DLLQ 5HBMA 3AGKA 2RQ4A 2HZVA 4WTOB 1RHKB 3O3LA 4JYAF 3OYJA 3QRQA 2D0PA 4DTJA 2RE2A 5J2PA 1OVYA 4CLWA 3QGGA 1IKXB 1ZH5A 4Y3CA 4G1PA 2XM3A 3HPOA 3I6PA 1RT7A 2X1FA 1JJHA 2VV5A 4B9UA 5DZ6A 4BC4A 4NRTA 3CEDA 3A0IX 2GVDB 2OCEA 4X64J 4PG4A 3B6PA 3IN5A 3FEZA 2G8FA 1AUDA 3HPGA 1SQKA 4ZVHA 2ZH7A 2Z2YB 2VF3A 4FW2A 3QGPA 4DV6F 2BZ2A 5E0OA 4H0YB 4OX8A 1X0FA 3I31A 1YTUA 1YX2A 4F02A 1S1TB 3U3GA 2LKZA 1VFJA 3DMJB 1TFYA 3RAMA 1N32F 2F96A 3MM8A 4EHTA 4C3LA 4IJAA 1RFQA 1TL3A 1QAXA 1WSFA 3EE8A 4C8OA 3OTOJ 4RWTA 3QBXA 1FKOB 3IMQJ 1IN0A 3HD1A 2BUNA 2K7JA 3TR5A 1F3VA 3CULA 5LT5A 1GMWD 5DO2A 1QQNA 4B1ZA 2HLUA 3V9XA 1T11A 2MHNA 1WOSA 2CRLA 4B17A 1H3DA 1HA1A 1J5EK 4UF4A 3CCLS 3MECA 4ZN3A 3PY8A 2D0OA 4QCLA 4FJMA 1JX4A 2E5IA 3S3MA 2EK6A 3ZYYX 3E9PA 4X4RA 2EKYA 4CJUA 3D5MA 1K6YA 3DOMB 2W2PP 1LWCB 2BYCA 1KCFA 3K5LA 3OT9A 3CF5Q 4IRCA 3OVAA 2XMUA 1VYAA 3EKSA 2EW9A 4FWMA 3ZNJ1 4M63A 2R3VA 3VENA 1XNRJ 2P9PA 4KHMA 4DV0J 3AGRA 3PYFA 1FCAA 3ZC4A 5D8HB 3BREA 4U96A 2UXDF 3KWMA 2ZDOA 4CO0A 2RU9A 2IRUA 4IKFA 4DV7J 5KFXA 3QLHA 2ZOGA 2IHR1 1BQNA 4LT6A 2JWKA 3KNGA 4B3MF 3DOKB 4CYUB 4M3ZA 2OPPB 3MAQA 3EGVA 1L3KA 3MDQA 1VQON 8ATCB 5AQSA 4OZ5A 2RMLA 4PKDB 3S3NA 2CYYA 2CNLB 4LFBJ 2VFRA 1ZAXA 1HUXA 1L3SA 4ZVEA 4NLDA 4CBXA 3QBCA 1WHXA 4RNOA 4URQU 1HI1A 1EQYA 2E2PA 1NJWA 3PR4A 3HFVA 3RB4A 1UJ4A 3ZTSA 3HSDA 3SCLE 3OBWA 2O4GA 4NMXA 4GVBB 4F2RA 3MUMP 1AW0A 3ATUA 2G2ZA 3D0HE 2EFGA 3V1OA 3QESA 2XI3A 1VSIA 3E1YA 1HNWJ 2N3OA 1WSJA 2NSBA 3Q7BA 4A46A 3VEVA 2BANA 3V1RA 2G8HA 2V8GA 1X4AA 4KRFA 1VK3A 2ABYA 4NPOA 4A8SA 4K8ZA 4OPHA 5GMKa 3G8TA 3L2UA 2RHSB 4ANDA 2FVCA 4URGA 4BRPA 1N52B 2I7PA 3W9HA 1NSQA 3SZ2A 3CM5A 4WQ5C 5KFPA 2EFOA 2F5GA 1QE1A 3AFGA 1N33J 1WSRA 3HMJG 3HVTB 2CAJA 2DRAA 3J7ZT 5IWAJ 2YKPA 4JI5F 1CLQA 4BRHA 4KHWA 3D1QA 3TAPA 1M90T 3L7UA 3BGRB 4ZKAA 3AAWB 1N6QB 3VZHA 2F65A 2VL1A 2QM1A 5HO4A 1U49A 3LO3A 1VISA 1U1MA 5DG8A 4NASA 4H4OA 3K5OA 2W2NP 3CERA 3CJKB 2EG2A 3EO3A 3ZETA 1VR6A 4MT1A 3GIMA 4ECUA 5H9FK 3KKSA 2G0CA 1S0NA 1SAZA 5HROA 3EPGA 3KXDA 4QPXA 5E3PA 4A8KA 3N28A 4WYWA 4MO5A 4EU0A 4X62K 3NS5A 4KAZA 2ROPA 5LSRA 2M8DB 1RSCA 2QWLA 4DX8H 2BE7D 4MK9A 1X5SA 1MU2B 1JL1A 1Q7YT 5LMUF 4CJQA 2NYIA 3K89A 4FLVA 1VQ9S 5EU7A 4QIGA 1RCXB 4CHOA 4JI3F 2PDAA 5CYQA 3GG1A 1AFIA 2UXBK 3KLEA 2AJ4A 2E1PA 1CBKA 3HK2A 1YIJS 3FBCA 3JS6A 3ET6A 4OYAA 1Q9XA 4IZ9A 3DLGA 1S1XA 4QIEA 1Q78A 1Q86T 2YXLA 4K50A 1AYEA 1E4GT 3CDUA 4W5OA 3PIOL 4ES2A 4OX6A 3HT3A 4L73A 5D0EA 4ILHA 2K1RB 1RTIA 4H5VA 2IJRA 2VG7A 2ITGA 4L72B 3EZUA 2ZBQA 2QIFA 3Q7CA 2A18A 4QU7A 3TANA 1TL1A 4DU7A 5AQFA 3QO9B 2NUHA 1JLAA 3JTPA 3BM7A 1WC0A 2ZD1A 3ZZ0A 4PWDA 2DYAA 2E9ZA 3HO1A 3M8PA 4OZ2A 2VGNA 3HHKA 2CJ9A 3AA2A 1F6TA 3LP1A 2J0QD 2BABA 3L09A 1XIQA 1H74A 4NZ6A 4F50A 3HVRA 1M1KT 3W2WA 2V9WA 3LWMA 2QT7A 2F8SA 1Q8KA 4KGKA 3FE1A 3RB3A 1CPZA 2VZ9A 4DX7A 1VHIA 2JNJA 3CG7A 4HHJA 3UR0A 1U2RA 4WKYA 3RJMB 2XNRA 1YRTA 2DR6A 2QA2A 3R6LB 1WKLA 3D3CJ 4HACB 4KGVB 3IG1A 3BYPA 3KK3A 2MY8A 4KQZA 1MMLA 1TELA 1EX8A 2B5JA 2D9OA 5MLCV 1REGX 3CCRS 3C3LA 2QEXN 3LDLA 2LCWA 5L9XA 2YNIA 1KVBA 1KVJA 4NLRA 4X4OA 5AQHA 4CF1A 3G96A 1UTAA 1Y5LB 4DV5J 5KFZA 1YRXA 4DR5F 2XLKA 3JYTA 1R8BA 3L2QA 4DF4A 3D6RA 3MR3A 2ZC4A 4IR9A 4ID5B 2D3OR 3K8WA 4A8XA 4FYDA 1ZBLA 5A8WB 4CGIA 1KQSM 3QGHA 2E7VA 2I7NA 1NUEA 3D0IE 3FDSA 4NCGB 5KFOA 1S76D 5E26A 4G6VB 4DFKA 4TN2A 5ETTA 4CT8A 3P49B 3DLLL 3Q8SB 3KVGA 4TU7A 2CNNB 1J6ZA 2DY9A 2V0NA 1RUSA 4R8UA 4FYYB 1J5EF 1F2HA 3DN9A 1A5WA 1EO1A 3OD2A 2FJEB 1HLWA 3S3OA 1ILYA 3LDOA 2F8TA 5IT4A 3VTIA 1SV5B 2VKRA 1C6VA 1RYRA 4P10A 3WNEA 5AE3A 3GILA 4N77A 4Q44A 3DXBA 2OGUA 1FXRA 1DAXA 4V1Ak 2BJ9A 1RLDA 1S1VA 1L3TA 4OJRA 3MMAA 4PQUA 1HPZB 3H7HB 1IVZA 4CJEA 5HRRA 2P5GA 1WNSA 3SLCA 3I9V9 2HHHF 4ZVFA 4KKOA 1NGBA 4QWDA 4JV5K 1BCMA 2NRVA 3NY0A 4ID8A 1Y00A 3GIKA 2HQCA 4F4AA 5M1PA 1LFWA 3O4WA 4J9SA 3QIDA 3H5YA 4BWJA 3LANA 3CQXA 4CP5A 5I3PA 1ELOA 4OYPA 1WG1A 1KAZA 4B3RK 3KD1E 1D1UA 1VGYA 2W2OP 5I3UB 2M4MA 1VQ8N 2W40A 3QRPA 3FBBA 2XYHB 3NWGA 1JK9B 2P9SA 3CETA 2YI1A 3W3DA 2ETJA 4IG0B 3CC2S 3ONQA 4X66K 2W2MP 3NNAA 2H48B 2E6MA 2JVRA 1HBUA 3EZ5A 3W5XA 2PFFB 3VF2A 1OH6A 2DHAA 1D9AA 2CQ1A 4FDFA 1YLXA 5A2QY 4DTSA 2CQDA 5D0RA 5F0WA 3FLCO 3PJXA 3WC2A 4M41A 2DCUB 3IRXA 5DS7A 3JXUA 3OBIA 1GMWA 1LWFA 1H98A 1WHYA 1NGAA 3CF5L 4CBWA 1Y64A 1JCGA 4FLUA 1BU6O 3AD8C 1T6DA 1K1SA 3A8EA 3FFIB 3GPAA 4H0XB 3P31A 4B1YB 4Z0UA 4FL9A 1WDTA 2HFUA 1GOAA 1WSVA 3QGIA 3WNHA 2V2VA 2CFXA 4DL6A 3JSBA 2BTFA 5HSPA 4KHPJ 2OZMA 2LXUA 5DGAA 2ZZMA 4PYAA 2IA0A 3J7ZO 3DXKB 5AJ3K 2QE5A 2J0WA 3H2VE 1ZM4A 4MK8A 1FKAF 2Y1RI 3CJ9A 1M90O 1NKBA 4QAGA 4IDKA 4MO4A 2UU9J 3GTYX 1PYOB 1WELA 3K5NA 4ALZA 1TK8A 1U6ZA 2MJUA 2JLGA 3NS6A 2OPRA 2V4QA 4LF9F 1DQ9A 2LMIA 4HDHA 3R7NB 2OKQA 4OHYA 1QQOA 1NJXA 4I7FA 1VLYA 2P51A 4X4TA 1M5OC 3VQDA 1JLBB 1BGXT 4ITSA 2DH9A 3CNQP 4EP5A 2DIVA 4EFAC 3MEGB 3UVJA 2QZ8A 4TQSA 3NVKA 5AE1A 3C7NA 2ZUAA 2JFDA 1FRKA 4KH6A 2B8PA 2HG4A 4F0KA 2PE8A 4Y1DA 1Q7YO 2QTWA 2FZGB 1KVIA 3KLGB 2BGGA 2RE1A 1TMJA 3OYFA 2E1YA 2V4JB 2CPDA 5DDRC 2CQCA 4QYRA 2RKIA 4RX6A 2NCKL 2R7QA 2EKNA 2CNOB 4Y0WA 1Q86O 2GCFA 3K5PA 3MM6B 2UXBF 3CCUS 3QFPA 4WFAQ 2XYGB 5BR8K 2D3ZA 3H25A 2CPFA 4FNIA 2ZJPL 4N8OA 1YBTA 4JKDA 2FJWA 3DHXA 4ZVOB 5D4OA 3CJ5A 1RWMB 2BEFA 4UUXA 4EP4A 3DDKA 2O8CB 3OL6A 3CD6S 4S0MA 2IJFA 4CNZA 1T7PA 2B9EA 3K57A 2R7SA 3L4BC 4DSFA 4V19J 1RWWB 4GKKJ 3V81A 2P9LB 3N4QA 1M1KO 3ZLJA 2YX6A 2Z2LA 2QI2A 5CYMA 2RUSA 4NYZA 4A47A 3KWIA 4Z4GA 3I0SB 1FFGB 1VQPN 1G1XA 4O5FA 4KB1A 3KIOA 3DU5A 4KV8A 3KJNB 1N0UA 3TR8A 1U1RA 2Y1JA 4CZHA 1K0VA 2BOPA 1Z2ZA 3NGYA 4KB7A 2PYJA 4LRCA 4OLPA 3BJYA 4B9MA 5LOQA 3WQPA 1SUQB 2DHSA 1VQ5N 1NK8A 4EHUA 4RZRA 4DTNA 2MLYA 4JK8A 3IBWA 4IOAQ 1CJVB 4PWUA 1XMQF 4OI1A 2MLZA 4FVCA 4C2MA 5KFDA 2B4UA 3LA0A 4NL5A 4ECSA 2QLBB 2VDHA 4FN5A 4H0TB 1JLGB 5HBMB 1DTTA 2C2NA 4ZCLA 2GX9A 2W9CA 3M9OB 5J2PB 2GBZA 1WG4A 2OTJN 4FNHA 3R8YA 4YB5A 1UAXA 4ELUA 1VJQA 4NLSA 5D3GB 3MWPA 3MAAA 3QT6A 4ED5A 1Q8LA 4M3TA 3VEYA 3ZZTA 3EY1A 3EZOA 4DV1F 3FZFA 3G82B 3GIRA 1OS5A 1UKUA 2DNMA 2JLEA 3H4DA 5M1KA 1UW4A 2D7SA 3M8SA 1YHQS 1UOCA 3MFIA 4NYPA 3LP2A 2KO1A 3LDQA 2ZF5O 3CI5A 3KLIA 3O3FA 4KT0C 3TWHA 4LF7J 1B92A 4ILLA 3DRPB 3F41A 2VWBA 5JICA 2GO8A 1CZ9A 3Q89A 1MW7A 3JB9k 3MM8B 3DRSB 4B3SF 1TL3B 5F3ZA 2O8FA 4ZIVA 3O44A 2JEIA 2VIHA 2KFNA 4ID1A 4L75A 2KHDA 1KAYA 3AOBA 1CJKB 3QBWA 3DYAA 2NXNA 1TMMA 3Q24A 5HLFA 4BDYA 2NRRA 1JCFA 2MQLA 1S4EA 3AA4A 3CJCA 3UDVA 4A62A 2OTLN 2XSFA 2O1PA 2CGJA 1TTHB 4BRIA 1V4SA 2ASJA 4ISFA 2MJNA 4WQ4C 2Q3PA 4HTJA 3CHWA 3NMUA 1AZSA 4LRFA 2Q6CA 3R2DJ 2KFZA 2I9SA 3HRGA 4TLRA 2AYBA 5BXIA 1OVQA 4B1WB 4M3WA 1U04A 3IWXA 1XNQJ 3HP9A 3TA1A 2C22A 1YJ7A 1H73A 1SH2A 5KFTA 2X7IA 2E1CA 2OFHX 5GAEI 4DUZJ 1FXXA 3NGTA 1F5CA 3MAHA 3QJPA 4KTQA 2P9PB 3MWBA 3R5BA 4YDUA 2WVFA 2VQEJ 1IBLK 4J91A 2VGMA 1IBMJ 2F4VF 2NXCA 2YKMA 5GAEU 3MXIA 4WP8A 1QVFR 1Q81T 5KPTA 3FZMA 4A59A 3L2WA 2WHOA 5HMXA 5DMRA 3QLHB 3S41A 3VF4A 2BKPA 4RO0A 3GMGA 3CCMN 2VFUA 4FKXA 1C0TA 3KOAA 4OFZA 3O6WA 4ES1A 4JI8J 3W8PA 2U1AA 1K1QA 4AQYK 3P5TL 3GYXB 1VDHA 2DGUA 2JLFA 1DKGD 4K0KK 3BSAA 2QWMA 3WNGA 4BCAA 3J7AN 4MDBA 4H4KC 2J7WA 2ZHBA 1CLFA 4WFYA 4BVOA 4OI4A 3D0PA 1VAZA 3THPA 3ASMA 4A2AA 4PL7A 1EJ7L 5CYJA 3HDSA 2IS3A 2ZNYA 3UD5A 1AA1B 4LF6J 4MMOA 2AGOA 1S72N 3N4WA 1BDGA 3BSOA 1T8EA 9ATCB 2BANB 2IBOA 1SH3A 3TVKA 2LQJA 4BQLA 2DK2A 3NEKA 4RNNA 2YWWA 3W61A 1OPZA 1GXLA 3UE5A 2L9WA 2HHWA 3R9LA 2R7UA 4JNEA 4O0JA 5HQMA 5ITHA 5J2QA 4DR6F 4QU6A 2WSCC 2ZH8A 4QOTA 1NSAA 1VK0A 1UVMA 1LNQA 4CW7B 1EAYC 2LU2A 2ZM6K 4PUOA 4BE0A 4DV3F 2Q0UA 3CIPA 3GG4A 2P6SA 4RPFA 4DHVA 2F7VA 2X3DA 4FXVA 4IOXA 4C48A 4DL4A 4H4OB 3AO1A 4CEDA 4OPAA 3LZIA 3JQMA 4JI2F 2QMUB 3PX0A 3KLVA 4KE5A 3RSEB 2K3IA 5HROB 2DR9A 3QFHA 1F9FA 2AF6A 2DVIA 2KW4A 5IC6B 2RHQB 5L1IA 1N5TA 4HHTA 5KFLA 3M6WA 4MH8A 1QVFM 1JWWA 3OYAA 3MD1A 2BH1A 4FWOA 3P45B 3U9DA 2UUWA 1JLEB 5CHIA 4HLBA 3VGSA 1X31C 3IDHA 3B4MA 3R97A 3D2FA 5CYQB 2RRBA 1BA0A 2HVHA 4K8XA 2NREA 2JJ4D 4NLCA 4MIBA 5LJ5Y 1BY9A 3GOIA 3DLGB 1S1XB 2XRIA 3EYZA 2KXNB 3I8BA 4O0NA 2PFDA 1FA0A 2LA6A 3AH6A 1HRHA 3ILLA 1LV5A 2R7WA 3OFFA 2VG7B 1Q5YA 5LL6d 5C0YA 4B1UB 3T6BA 2GHWA 1RACB 2HMIA 4KGZB 1GLDG 4IRKA 3VAMA 2VYPA 1I39A 3U3YA 2B3TB 3EKUA 2V69A 2LQ9A 1VQKS 3N01A 3VGKA 3CCSN 1JLAB 7FD1A 3THXA 2F7TA 4W98A 2ZH4A 2ZD1B 4RNFA 2DD8S 4PWDB 3M8PB 2VWJA 1HWJA 1FF2A 3W3SA 3I96A 3LP1B 1SIZA 2HBYB 1FVSA 4I2QB 3W2WB 2HBKA 4DR4F 2O5DA 4PKHA 3I5BA 3FMBA 1HNXF 3O8WA 1B3TA 4PPZA 2OJ3A 3AT1B 4H54A 2AX0A 4KH1B 5SUHA 4F3OA 3OYGA 4KHSA 2HFZA 5F8JA 4L76A 2EWSA 4ICLB 1VIXA 2A42A 2DHGA 4YFUA 2VQFF 4LSLA 2MZ1A 2EK1A 3A8YA 3V4IA 2V50A 5KT6A 4XH5A 2J7UA 3VV2B 3ZNUA 3FCHA 3KK3B 4M5NA 3SMSA 5AQZA 4F9OA 4ECZA 3SQ2A 3AVCA 1U4BA 5KG4A 3GV8B 5GMEA 5IC4B 3ULDA 3QZ7A 1WEXA 1BMQB 3BSNA 3R1LA 2FC8A 3TQ1A 2YJFA 2YNIB 4NEYA 4DR7F 3HHEA 3MCPA 2RILA 5U47A 2IJNA 1HNZJ 4KBOA 4USTA 5FPEA 3MM9A 1JCEA 2X1BA 1GFWB 3J8AA 2OEKA 4E8UA 3JYTB 1Z6RA 2HNDA 1IWGA 1RAOA 4QYZK 4Q2MA 3SSSA 4WU2A 3M8QA 2XZWA 2N4CA 1NNEA 4ZPWR 2B9XA 1RCHA 2MTLA 1S6QA 1TUUA 3QEXA 1GK8A 4OGCA 4QWBA 3G2XA 3TJ9A 1N5YA 2PMZD 4WQ5A 2VJUA 1S77D 2OUGA 4G9ZA 2GNKA 2W4PA 3BEXA 4QQBA 1PC5A 2AEMA 4ECTA 4JI6K 2ZFHA 1ZYQA 2I0XA 3WBZA 2JEFA 2QWRA 4ZPCA 2V63A 3PRDA 1K8AT 4R8UB 4WIIA 3TI0A 1RCOB 4C0OC 4YHHJ 4FM0A 3AA8A 4OI2A 4USUA 3L4IA 3AVMA 5GAGU 1TVRB 4LBHA 4M5LA 4XH4A 4RU9A 1VQMS 4DB3A 3H5XA 1S1VB 3MMAB 4PQUB 2CGKA 3T69A 4OYOA 4H4MA 1BHLA 1S9EA 4RUHA 4FK0A 3PW5A 1HWUA 2JH3A 3ATVA 4ED0A 2WVEA 2O8EA 5CD4A 1Q81O 3H42A 4G3IA 2DGSA 3M8RA 3CDEA 3DC2A 4O44A 4OX9K 2MKKA 1R8CA 1NGDA 2GJIA 1NGEA 2XY7A 1YTYA 4ZVGA 5JVGL 3T1YK 4J2AA 4KHQA 2HAFA 4C3MA 1C2PA 4YR2A 3CVKA 4KJIA 4DQSA 2AW0A 2ZJRQ 5ETSA 3KK7A 2QN6B 4M3XA 3MUVP 2E2QA 1TV6A 3AOCA 2ZOMA 3R8EA 3CO0P 4AQYF 2CQBA 1GLLO 5LMNJ 4X4NA 3FC9A 4K4UA 2HFNA 2IVYA 4RR5A 3NAEA 2KG1A 2BRLA 2QLWA 4K4WA 1RBAA 3PHTA 1E6VA 2JWNA 1SXLA 2VFSA 3IRXB 3GQCA 4I6MA 1OWXA 1F2GA 1LWFB 4Z7CA 2J0SD 1N36K 1ZC6A 1DY3A 4C8LA 5JLHA 4DI6A 2E44A 4WYLA 3J80O 3EXCX 3CQYA 5F0XA 3T1AA 2X1GA 4DR2J 2DNQA 2F4FA 1HWIA 1X60A 4X64F 2IA6A 1RBTA 1S1WA 1KOOA 5GAHP 1DEJA 1JLQA 3UPFA 2E9RX 4AILC 3T3FA 1V3RA 2CZVC 2E2OA 1YWXA 3J7YI 1H7WA 2DNOA 3TA0A 2CKWA 3ITHB 1FWPA 4U6PA 2C3UA 1VI7A 3JSYA 4USHA 4R79A 3AJ1A 4IDKB 1WN7A 2Y8WA 2Z30B 3MTKA 1X9WA 2DFHA 4IYQA 3R3LA 1AFJA 1L3UA 1ZBTA 1FRIA 3I0RA 3OTOF 5EOYA 4KHUA 3VGTA 2W7OA 3P1GA 4CZGA 2AGQA 2ZBRA 3D9BA 4AXIA 4NYOA 3MK6A 4I7FB 3OYKA 3LP3A 4ZPDA 3UKUA 1Q95G 1YJWS 3WEEA 2IM0A 5KG0A 1R89A 3HHNB 3TUIC 3BY5A 4XPCA 1VQ6N 5G0RA 5F1XA 5J1EA 5KFFA 4CJ4A 2QLJB 4CH1A 1YVUA 4C23A 5KGXA 4TYBA 2R2TA 1NXIA 4NA2A 1T6CA 2DGXA 4K4ZA 3K2PA 2RB7A 2KTQA 1CVJA 2CQ3A 4MFBA 3F56A 1UVJA 5ELZA 2OPQB 3MEDA 4JB8B 4DSIA 4DR3K 2MZJA 5BYQA 4CCHA 4C8KA 2YV0X 2CIMA 2WK4A 2B7BB 2RKIB 5T14A 1ATNA 3MHYA 4P7TA 4FSVA 4DTMA 1XNRF 3PYDA 3VZIA 2UXCJ 3NF7A 3EVWA 1QZ6A 2GVZA 3MMCA 1RNHA 2EG1A 4F4YA 4M5DA 2A6AA 3PFOA 4DV7F 1HBNA 1KR4A 4DQPA 1SJFA 1I3OB 2FD2A 4CEAA 5C2FA 4BG9A 3EM1A 4RW4A 3W62A 1NK0A 1UVNA 1TR0A 4AE5A 1VOMA 3AO2A 3THYA 4BR4A 5BRFA 2B6AA 3ID8A 3LP0A 4NXNK 4PG8A 4NMLA 2IDLA 1I1GA 1OH5A 4WWSA 1I94J 1BI4A 3V81B 4NZ7A 4CHQA 4K25A 4DV2K 3ENHA 4JI0J 2YWGA 4LFBF 2WAQD 3H2UB 5CYMB 5HVHA 1BHNA 3QIOA 1WKKA 4DTXA 4DZ6A 3OW2R 1UEUA 4FWRA 4TKTA 5M2PA 4QS7A 3O5TB 3C6UA 3NBPA 4CJ5A 3TTFA 5SZTA 4KV8B 2UUCK 1RE1B 2IPOB 1AB8A 4A2BA 3LF0A 4JAXA 1VQ4S 3EGNA 1X3NA 3LPUA 4A8OA 1T9VA 4BC7A 2W8KA 2I1RA 2VG5A 1UETA 4CD1A 2RVJA 1KS2A 3UR3C 1KSPA 3IM9A 4ZK7M 3N6LA 5HJYA 3ZT4A 4CIGA 1RT2A 3U8XA 4YY3J 1RTJA 4CJLA 4F67A 2P9IA 4B3TK 4XK8C 3VAFA 1V3SA 2FXUA 2GGPA 2QWQA 1CG2A 2UUAK 1QSYA 1DTTB 1N33F 2LSNA 3OTDA 5IOLA 2QKKA 4HKQA 4IO9Q 2P8IA 4ZIWA 5IWAF 3AVIA 2OA8A 1W9HA 1VBZA 3KZBA 4RNMA 1ZS6A 1TZ0A 5HQ8A 4DSJA 2I6WA 3L6QA 3CC7N 3QEPA 3DLEA 3CIMA 4UTGA 3UKRB 4LSNA 3NMRA 3N5FA 1ZZFA 2MZQA 4U9RA 1R7IA 2XHCA 3CPWM 4W5QA 3C94A 3QPIA 3W60A 2ILZA 2HHUA 1IWAA 4X65K 3KJQB 1NDPA 2JX2A 1YJNS 4LF4J 2HB5A 1NH7A 4I0WA 3OTCA 4BC3A 3GB0A 4DU3A 2P2CB 3LP2B 1BLUA 4PHTX 1K0TA 4JS4A 1W2IA 2Y8YA 1AROP 4DUYJ 3Q8VA 5KFCA 2UUTA 1Z05A 1SC6A 3VWSA 4JI6F 1K8AO 4CEBA 3MPYA 4MKBA 1IBKJ 4OYBA 3C66A 4J9PA 3DLRA 1YRUA 1EQMA 2O8FB 1SQEA 2IGIA 4ZPBA 1D09B 3AVBA 2K3KA 5KOWA 5J2NA 4AHTA 2BA9A 1M1HA 2A40A 3IR7B 5ETMA 1K44A 1YG0A 5B8HA 3DRYA 2GMLA 3SUQA 5HLFB 2IVOA 2FSKA 1JKHB 5B08A 5DDPC 3L8BA 3E3XA 4DUTA 3OW2M 3HYFA 3M8YA 2DNKA 3LGHA 3WT0A 1QTMA 3NH1A 2GO9A 4JUZA 3P5JA 2E5HA 4FW1A 4FK4A 1AZSB 1H2TZ 2YNGB 4I4BA 3VEOA 1RDUA 3IWLA 3POTA 2JEGA 1RZMA 3D66A 1HARA 3FZBA 2FLOA 1ITPA 3ENWA 2C42A 1PCAA 2HNZA 1C0FA 4C9DA 3H59A 1XQIA 2H5IB 2EC0A 1BUPA 1U0HA 3SBMA 1LKZA 3U02A 3M2RA 1FD2A 2L9DA 1FVQA 4DLEA 2YKMB 4QWAA 3GBTA 2A5XA 4HTIA 1W25A 2C2KB 1EP4A 1G4CA 1Y0HA 2DRDA 3TA2A 4IEIA 4C8MA 2E6LA 4TNOA 4BR9A 2BW7A 1VK8A 4EK2A 4GVMA 4NXMK 4ZVTB 4CFCA 1C0TB 2DGWA 4LFCJ 2FYXA 1P9QC 5L8RC 4O0IA 4HH0A 3SMZA 1FKPB 3RWUA 5E3AA 1U1QA 3MN7A 4K5RA 5EWGA 5FROA 4ECQA 1ACMB 2DR5A 3MN6A 3ZSRA 3NRBA 3GU0A 1C0MA 4CHPA 1SCJB 4CTAA 3CCZA 1AUSL 4WFNQ 2BQRA 1S79A 3GCXP 3OXLA 3SAFA 4HCBA 2M88A 1LFPA 2YWKA 4UT4A 2GVDA 2HBQB 1RA7A 1NH8A 1BQMA 3SQGB 1WOPA 4H0PA 2QL9B 4KR0B 1VSHA 3I55S 3AY9A 1FW6A 4NLYA 3GJTB 2ZJRL 4WKRA 4EFHA 4R0EA 3M6VA 3VR1A 2X3GA 4QPTA 3CMAN 4FOEA 4DX6A 2YKQA 1ITGA 5AQRA 2OELA 3C16B 2GV9A 1S7IA 2GHVC 1KP6A 3CCEN 4JS5A 5F9NA 1S0VA 3NDKA 2DY1A 2PC6A 1W7WA 4PUOB 2UZAA 5AQKA 1R8PA 4NX9A 4M5IA 2HHTA 3JQJA 4RW9B 2FY8A 5A2QU 1CEZA 1S5ZA 2XS5A 2DCLA 3V4MA 4GV6A 3KUGA 2LEAA 3MXHP 5FDLA 3DCAA 3TZWA 5C2DA 5EGYA 1RAHB 4E1NA 1M0SA 4O3NA 1SJ4P 1DQAA 4ZS6A 1O8BA 3DFEA 5HN0A 3OFHA 1YZ6A 1ZZNA 3AAPA 4K42A 3DOMA 1IR2A 1UW9A 4DEZA 3HL8A 5HMZA 4FPIA 2MMYA 3I87A 4HI1A 2Q3SA 1FE4A 4JI4J 3O1LA 4O3PA 5KFHA 3D54A 3MTJA 5C7PA 4OKJA 2YKNB 1UPPA 3C8YA 3X1LB 2PMHA 2NLWA 3CB4A 1P1TA 3ULEB 2OO4A 5AQUA 2YPYA 1JJ2R 4JI1J 1QVGR 5C12A 4N56A 1K73T 2V2KA 3FSYA 4WQ4A 3MPUB 4CYUA 5K8MA 4K4XA 5FIIA 1DZ5A 4KY3A 1S9FA 4CK1A 1V5IB 4DU8A 4E89A 2DJWA 4QR1A 2V5HG 1S59A 3THXB 1FXDA 1U1KA 4OHWA 2D0AA 1NU4A 3VQCA 2PA3A 4FM1A 3QNWB 1XERA 4HUFA 4DV4J 3I56N 1RAFB 3Q23A 4EBCA 3ENBA 3CJQA 3TJ8A 5AR0A 3VGVA 4DS4A 2MZTA 6AT1B 2VBXA 2EBEA 2BJ7A 2K8GA 3EICA 3NGUA 3RMBA 3OLBA 5AE2A 4G65A 2PFUA 1J54A 3HF5A 4KHPF 2YBVA 1ASVA 3O4NA 5F8IA 4Z4HA 4ZCMA 3H3NO 1D9FA 4LF8K 4K4YA 2PA8D 3FCWA 1IKYA 4WU3A 5B0EA 2DGVA 3DGVA 2RDIA 3FZ2A 4DXLA 3FRYA 4WXWA 5MAOA 2UP1A 3S7RA 1EQ0A 3G10A 1FRLA 2NS1B 4BGAA 2WRMA 4H4KA 3ISZA 1RXOB 2VPWB 4IFEA 3EN9A 1S57A 1S12A 1OSDA 4FOIA 2XMMA 1X4CA 3FQLA 3CCQN 4EGLA 2R7YA 4CBUA 2YX1A 4X65F 3MM9B 1VC0A 4FJKA 4DQQA 3LPEA 1ZPVA 2V34A 4DSKA 2PEHA 3SQ4A 4HL9A 2IC3B 2HNDB 3QEVA 2ZJQL 5ETLA 2H3EB 1NZAA 4MTPA 2G8VA 4J5OA 1DBDA 1G3OA 3M8QB 4JBCA 3TTCA 4P9SA 2XC9A 5HVGA 3PW0A 3QZ8A 4DTOA 3WIVA 3SQ0A 1N5YB 2H5JB 4E1JA 4LFAK 1H0HB 1M5VC 4JRQA 3T5LA 1QVGM 2DFEA 1MU2A 3KUEA 4HWIA 4YMEA 5EHHA 4NCAA 3M2UB 2VICA 3UNYA 9RUBA 2OHDA 3K2YA 4P2MA 1RGIA 1WI6A 2W9BA 4DSLA 1PSDA 4QW8A 2DPNA 2UUBK 5AXKA 4YS2A 3HULA 3RGIA 4QWCA 4HYKA 2ALYB 2HFVA 2GUIA 2CQGA 3E66A 3IC1A 1VC6A 2F40A 2GQ2A 2K1RA 3P4UB 3PNIA 3J7AP 2J5AA 4GKKF 2LFVA 3OTEA 4FWPA 3TSUA 2QWOA 1YI2N 4WE1B 4H4MB 2J0XA 2GIQA 1S9EB 2A6OA 1PJ7A 1O13A 1WDDA 5JMNA 2B0GA 3MEEA 3L95X 2O8EB 1HD0A 1NAQA 3A12A 4OYIA 1FXLA 3ILOA 1N5VA 3ZZPA 3TX0A 3NKYA 5E2QA 3M6XA 5M1OA 1ZA1B 2BJDA 4JI7K 2GV1A 1RAGB 1KQKA 3AAQA 3BEGB 2AZ3A 4BACA 1SC3B 1YJ9S 4BBYA 5KFEA 3IBFB 1FFWB 2F3JA 3ZT2A 1RDAA 1TV6B 3KKRA 1PC4A 4FWSA 3IA0A 5BPLA 3TYTA 4HACA 1UP1A 4Q8FA 4M5JA 4M5HA 4FJ9A 2OZSA 4NB4A 2GMHA 2NRHA 2RNEA 4N41A 4I6MB 3OSPA 3UN5A 3ZZZA 4CZKA 4CJSA 2KM8C 3ZTOA 4JYAK 3N0VA 1GMVA 2HF4A 1KFDA 4U67L 1XJWB 2L48A 5KFRA 1QSSA 2R7VA 2W01A 1CC7A 5JXSA 1JLQB 1X4DA 2M8HA 2LDIA 3MR5A 2MSTA 5KFNA 2CQ0A 3CCJN 2L9NA 1NHKL 2Q97A 3KMQA 1DARA 5KFGA 2KXFA 2GWKA 4C0BA 2EC2A 1B7FA 4ED7A 4DV6K 3VESA 5GAGP 2YH1A 4QOZB 1EKSA 1URRA 2XO7A 4ISEA 4J8FA 1NOYA 1Y5NB 1W97L 3I0RB 5EN1A 4CNYA 4E7KA 1RAEB 2RU3A 1N32K 3QYYA 4JKEA 3UKUB 2KQ2A 2W4CA 4P52A 3WEEB 1WI8A 2FVPA 6FDRA 5G0RB 4DPXA 5J1EB 4WFNL 1SV5A 4IOCQ 3P4IA 2PZSA 3K17A 4AD6A 3HFKA 1WG5A 3LL3A 1RT5B 4MIAA 2JHEA 4IQXA 3SJJA 2XGPA 5J1NA 4XO0A 3AQPA 1UEVA