1N6QA

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n6qA05
4KBIA 2W9BB 2R2RA 2FVRA 3ZSQA 1SL2A 2ASDA 1KVBA 3QO9B 1U4BA 2IM3A 4FBTA 3QEPA 5C24B 4DFMA 1RTHB 4TY8A 3LAMA 5F8MA 2YV0X 4J9LA 2AU0A 3V1QA 1ITGA 2D0CA 5SWMA 1EP4B 1HNIA 3CDEA 3QIDA 2OZSA 3EY1A 3QEIA 4OLAA 3VA0A 3VQDA 4WE1A 4DL4A 3M9OB 3OSPA 2V4QA 1FKPB 1T03A 4E19A 4ZHRB 3U6FA 3OJUA 4RU9A 2AQ4A 2OH2A 3K5OA 3S3NA 2HW3A 5HLFB 3RWUA 4IFVB 5KRSA 4E7KA 3ASMA 4IRCA 1RT1A 4W5NA 4CHZA 1IKWB 3KHHA 3V6HA 4FZZA 1SKWA 3MR6A 3NL0A 3ZT0A 4MFBB 5CYQA 3LZIA 1LW0B 2WONB 3AA5X 2V4RA 4DTPA 5T7BA 1KTQA 2BDPA 4ECWA 3HPGA 3D28A 4DSIA 4NYNA 4DSFA 3SJJA 1IKYB 5J2NA 4IFYB 3HJFA 4CIEA 3ITHA 4FLTA 3OL7A 1UWBB 3ZSZA 2R8JA 3MXMA 4ID5B 4QOZB 4FM2A 2OPRA 1K1QA 3AA4A 2EX3A 2YNGA 4B9TA 2KFNA 1TKTB 1BCMA 3V9XA 2X78A 1LW2B 3PX0A 3QLHB 3NKYA 4URSA 4NRTA 4ECRA 3SPZA 3AVHA 2GC8A 3L3VA 3KMQA 4KV8B 3NDKA 4FYDA 4CEAA 5KI6A 1TK5A 1CZ9A 4NLUA 1I6JA 3HSTB 4J9PA 1SKSA 3OYMA 5KG4A 4O55A 3N6LA 3IGVA 2VA3A 1QS4A 1JXBA 1S6PB 5K14B 5F9NA 3HVTA 1QUVA 4CHOA 4FJGA 3I0RA 1JLFB 3PO4A 4NLGA 1KLMB 2HHUA 3KMSA 3AV9A 4FJMA 5KFMA 4K4XA 4Z4EA 3IG1B 4CE9A 2IC3B 4YFUA 2R2SA 3KOAA 4F3TA 1VSEA 1L3UA 2C2DA 1TL1A 4KO0B 5DQGA 2B6AA 2YHBA 4E7LA 2A1RA 1IKVB 4OPKA 2IS3A 4O4GB 4H8KA 4OGEA 1QE1A 4TYBA 2XY7A 5JUMA 4EO6A 3V6JA 4CGJA 3PHEA 3L2VA 1RTIB 3S3MA 4CCHA 2FJWA 1VK0A 4M3YA 4JS5A 4CGIA 3ISNC 4CHNA 2BQ3A 4K4VA 2HNDB 3ZT4A 4Z4FA 2VG6A 4B8AB 3DOKB 2G8FA 1RT4A 2OPQA 4CF0A 4NCBA 4M3TA 1BQMA 3SUNA 1C0TB 4CEEA 3DM2A 3MEDA 4Q5VA 4Q0BA 1RT6B 3UQSA 5I3UB 2FVPA 3DRRB 1RYRA 4BWJA 3BQ1A 3D0PA 3DLKB 3TARA 1LWEA 4WFXA 1S1XA 3CJ4A 1NOYA 4FW1A 4C8NA 1TKXB 4CJEA 2J6TA 3NF8A 2RPIA 1GOAA 1XHXA 2XY5A 4ELTA 1QSYA 2AJQA 5HBMB 4FLUA 2HHWA 1HYSA 4F4WA 1WAJA 4E7IA 4CEFA 2PYJA 3AO5A 4E7HA 4B9UA 1U47A 3KLGA 4IG0B 1S1UA 2YKMA 3DRPB 5HROA 4J9QA 4IH7A 4J2EA 3OL9A 2KZZA 1TL3B 3KHLA 2HWIA 4ZTFA 3WNEA 4Y1DA 3M8SA 3E51A 5L1LA 1RBRA 4YR0A 1HRHA 3HVAA 4PWDB 4G1QA 3OJSA 4CJUA 2RDJA 2HB5A 4TLRA 4FLWA 3ZT2A 5KFFA 4BDPA 5KFOA 2YNIA 1T3NA 4KB7A 4FK0A 3AVKA 4Z4HA 1N56A 2IM1A 3MR5A 3FDSA 2BQRA 3L2UA 2OPSB 1FK9A 4MH8A 4Q44A 5KT6A 4ECXA 4J9OA 1JXLA 2W7PA 2HAIA 2D0AA 3VA3A 4QWDA 4I2PA 3B6PA 4DSEA 4PY5A 1S5JA 4DF8A 1DLOA 1FKOA 1WSEA 3TI0A 3ICLA 1IG9A 3S3OA 4PQUB 4YMEA 1RBUA 2BANA 4CHYA 1BI4A 1HQEA 3BREA 3OHBA 3V9UA 4RW8A 5D3GB 4Z4CA 5J1EB 4IQXA 1KHVA 3ZCMA 1S1WA 4DTRA 1NJXA 3MR2A 2JEFA 3OYBA 3HK2A 3NBPB 2FLLA 3V9ZA 4B9LA 1REVA 1S9EA 3BDPA 1DTTB 3SQ4A 1HMVA 1IM4A 3OYAA 5KFDA 3IS9A 2XI3A 4CJQA 4RNNA 3G6XA 3DRSB 5J2PB 3PJXA 1QTMA 1HNVB 2J6UA 3PV8A 2JEIA 4NZ0A 3VQ8A 5J2MB 4ZP9A 4GVMA 4I2QB 1VSKA 1QSSA 4RW4A 1RTDB 3CQ8A 4NLOA 4H4MB 4H4OB 4NLYA 3QIOA 1JLEB 4DTMA 1EETB 4ED1A 5F8JA 3PO5A 1RTJB 2RKIB 2C28A 2YKNB 3KLFA 2ZKUA 4MK8A 4FJKA 1VSJA 4KB1A 1WAFA 3O4NA 3I5AA 4DL5A 3CM6A 4BWMA 4XIUA 4OJRA 2WRMA 4CHPA 2B5JA 1RCHA 4FJHA 3WNGA 3OLAA 1C1BA 4B9SA 2HVIA 3BQ0A 1VSHA 4I7FA 2YNHA 3H40A 5KFAA 1B92A 3ZSYA 2OA8A 2D5RA 3VQ9A 4LSLB 1UA1A 5KG3A 1BL3A 1ZBHA 1TQLA 3LDSA 4F4ZA 4IG3A 2FLNA 3IRXB 4J9NA 2IAJB 1S10A 4MQ3A 1Q9YA 3SCXA 2AX1A 3LAKA 2IJFA 3VQ7A 1ZBFA 4M3ZA 3BGRA 4TY8B 4R8UB 1TK0A 4CF2A 4YP3A 3KK2A 4O0IA 4JS4A 4DU3A 1S1TB 2XGPA 2QV6A 1S49A 4R5PA 5L1KA 3L8BA 2AX0A 5DQHA 4WE1B 4NCGB 1I39A 3EPIA 1T03B 3PY8A 3PJWA 3H4DA 3NF7A 4YR2A 4KKOB 5KFXA 4R0EA 2ZD1B 3EZ5A 2FVSA 4KHWA 4HVJA 3MAQA 1D1UA 4W5RA 1NKEA 3KJVB 3KNAA 5KFGA 4FLYA 2VG7A 3NAIA 4QWCA 2HHTA 1NK4A 2ILYA 4AHTA 3TANA 3NH0A 5DG7A 1HYVA 4Z4GA 3ZSRA 4NYZA 3DDKA 3AVMA 3ISND 4ZPCA 4Q45A 3L3UA 3SUQA 4HUGA 4FJIA 3KK3A 2HHQA 3NMAA 3ITHB 4DG1A 1NKCA 2BR0A 3QIPA 4DQPA 3FQLA 2XHBA 4C8KA 4BDYA 2HNYA 4O0JA 2UVWA 5JS1A 5DGAA 2X6SA 3OSNA 4QWBA 2IDOA 2IJNA 4CIGA 2WK4A 4DS4A 4KI4A 2HHSA 1RT2B 3OYFA 1L3SA 1HPZA 3MECB 5KFBA 4I9QA 1QAJA 4Z0UA 2FJVA 4DTUA 3RR7A 2D3ZA 3EPGA 4NLTA 5EDWA 4KHRA 3OVNA 2P5OA 1YVFA 3GYNA 4EZ9A 4FK4A 1WSGA 3VQBA 3OS1A 1MU2B 2I5JA 5HP1A 1XHZA 4BDZA 5CY4A 1VSFA 4K50A 4EZ6A 5JS2A 2VA2A 4HYKA 4ZPBA 3KLEA 4NLPA 1R0AA 2V9WA 4O5BA 1Z26A 3MEGB 3HP9A 3V81A 3SV4A 1DTQA 4UQGA 4LSNB 2C2RA 3KLVA 3QEWA 4CECA 2OPPA 3DOLA 3M8PA 4KTQA 3UDLA 3T5JA 4CGHA 1JLQB 1JKHB 3HM9A 5C25A 5EWEA 3TR8A 1FXXA 3H5SA 3PX4A 3KK1B 2HMIA 5KFZA 2B6AB 3TAMB 3F9KA 3FFIB 2RDIA 4WFYA 1JLAA 2PY5A 4FJXA 4ZTJA 3DYAA 2FC0A 4IKAA 4TXSA 1IO2A 4FXDA 3KLIA 3JSMA 2VG5B 2HNZB 3RMBA 2PZSA 4WXOA 4AH9A 3I0SB 3AO3A 1Z4UA 3HVWA 4OKJA 1RT4B 4EP5A 2P51A 3TAPA 5L1JA 3IGNA 3KLHB 3TAQA 3DI6B 1RA7A 4URGA 4DL7A 3MEDB 5L1IA 1NK5A 3CM5A 4O4RA 5DQIA 3H59A 1C0UA 2ZE2B 1JLCA 3C6UB 1RT7A 2J6SA 4C8OA 2Y1IA 3UIQA 5J2QB 3M8QA 1K1SA 4CJSA 3HVRA 1RDBA 3L2RA 4TY9A 4RW7B 4OGCA 4ED7A 1GX6A 1XR7A 2VWJA 3SQ1A 3FSIA 4KHUA 2ILZA 3C6TB 4W5TA 1XR6A 1NK0A 1SV5A 4XPCA 5HROB 4OVLA 4HTUA 4ED0A 4M41A 5KFJA 1JLGB 5KFTA 2G8KA 3QINA 5F8HA 3NGDA 3JYTA 2Z1IA 3DLGA 5DG8A 4KAIA 1RBSA 3V4IA 3ALYA 3L2WA 5HRRA 3WNHA 3RRGA 1LWFB 1JXEA 1JLBA 1RBTA 5KRTA 4Y2AA 4DFJA 1KFSA 4XPEA 2YHAA 3OYCA 1J53A 2XGQA 1RT5B 3VQEA 4KFBB 2FJXA 4OPJA 4KHNA 1VRUA 4NLQA 4M95A 3HXMA 4N76A 1RT3A 4PUOB 5KFWA 1ASVA 1FKOB 3RR8A 1LWCA 1T94A 4RNHA 4AHRA 4LY7A 2E9TA 3NGYA 4CEQA 1ZBIA 1TGOA 3HKWA 3I5CA 1S1VB 5KG2A 4RW8B 1T05A 1TV6A 1S9FA 2X74A 5KFRA 1WSHA 1S1WB 4M3RA 1REVB 2FBTA 1YTUA 4OL8A 4DSKA 2W9CB 2B43A 1VSMA 1U48A 1HMVB 2I1RA 1J9AA 4NLDA 4ZVEA 3KKSA 4CEZA 4CJTA 2E6LA 3OL8A 3E01B 1B9FA 1ZTWA 4CJFA 3SI6A 4JRQA 2PYLA 4B9MA 1F21A 4CK2A 2W9BA 2IMWP 2A1SA 2HHXA 5I42A 4CEBA 3OYEA 2BQUA 4M42A 1C1CB 1S0OA 3TWHA 1RA6A 4WYLA 5KT7A 2VWKA 2WB4A 5FROA 4IKFA 4CHQA 3I8DA 3QETA 5C24A 2UVUA 1RTHA 2BE2B 3OYIA 2JLEA 1ZTTA 1WNSA 3CVKA 2WOMB 4O44B 4DS5A 2YNFB 3CFRA 4CESA 1TKZB 3NF9A 1EP4A 1ASUA 1SKRA 3UPFA 4FZYA 4FJ9A 4JLHA 4ZP8A 4K4SA 2KZMA 4DEZA 2ZQBA 2G8UA 4F2RA 1FKPA 3H5UA 4ZHRA 3LP1B 3MEEA 2XCAA 4B3OB 5C5JA 5F8LA 1Q9XA 4MK7A 5HLFA 3MR3A 4N56A 4TYAA 4IFVA 2ATLA 3LP0B 3LPTA 4KHQA 1ZETA 4BE2A 5KFPA 3P5JA 1N6QB 1TAUA 1IKWA 4FCYA 2GIRA 3OYDA 5KT3A 4RUAA 4MFBA 5L9XA 1NJWA 3T1AA 3PW0A 1LW0A 4KB0A 4EBDA 1NHVA 1TK8A 2KTQA 3K5NA 2BRLA 1W0HA 1Y97A 3NAHA 2JEJA 4R5PB 1JL2A 1NNDA 2IM2A 2XY8A 3RMAA 3HP6A 1EX4A 3A2FA 2Q3SA 1QQCA 4IFYA 2IA6A 5F8NA 1XI1A 1UWBA 4BE0A 4JV0A 2DPIA 3KHGA 4ID5A 3OYGA 2IGIA 4W5OA 4ZMMA 3GV7B 2JEGA 1TKTA 4KPYA 3GILA 3SV3A 3LWMA 4TN2A 3M9NB 3DMJB 3QLHA 3K5LA 3L2QA 4ECZA 3F73A 4M45A 2R2TA 3BSAA 2E9ZA 3HT3A 4CGGA 5KFIA 3T5KA 3CJ2A 4YR3A 4KV8A 4C8LA 4KHSA 3BSCA 4FM0A 1VRTB 3KK3B 4ELVA 2KW4A 4KTZA 4DG1B 4KI6A 1S9GB 1TVRB 2HNYB 5JXSA 1G15A 1I3AA 1BIUA 4ICLA 4JUZA 4WZMA 1GOCA 3P1GA 2AGQA 4NLVA 3OY9A 4M3WA 1A5VA 4QCLA 2D3UA 4CGFA 1A5XA 1S6PA 5K14A 5KFHA 4ID1A 3T19A 1TAQA 2JC1A 4HKQA 2RF2B 3SUOA 1HJRA 1OS5A 3GV8B 3IG1A 3NAEA 1QAIA 2IC3A 1N5YB 3PX6A 3Q8PB 3M8RA 4J2DA 3V6DB 4FLXA 4KO0A 1HQUB 2BGGA 3D45A 5F9LA 3OHAA 1S6QB 1U04A 1IKVA 3KLEB 3KTQA 4O4GA 4DF4A 1R0AB 4CJWA 4HUFA 4Q43A 3V81B 1X1PA 2C22A 3RRHA 4E1MA 5DLFA 4DLEA 3PUFA 4KRFA 4CF9A 5DMRA 4G3IA 3V9WA 4FLVA 3MFHA 5CYMB 3DLEB 3QERA 2P1JA 4N47A 2HNDA 2XY6A 2P5GA 2D7SA 1QHTA 2HWHA 3RTVA 3KD5E 5EWGA 4CF8A 3LP2A 2D0BA 3TAFA 2D41A 1C0TA 4IRKA 2OZMA 4O3OA 5I3UA 3DRRA 1CXUA 3DLKA 1BGXT 3BQ2A 3VQAA 5KFUA 1HNIB 4BE1A 4GMJB 1UOCA 1X9MA 4H54A 2KQ2A 4ECQA 4ZPDA 1NK8A 5DG9A 5FDLA 3NGIA 5HBMA 5KT5A 1GX5A 4B9VA 5CZ1A 4CJPA 3TAEA 3AVAA 2W8LA 4MK9A 4AILC 5DGBA 1KFDA 4K4TA 4ZVGA 3DRPA 3G6VA 2E4LA 4FW2A 2FBXA 1TL3A 2R8GA 1RT1B 3SQ0A 1J54A 1BISA 3BSNA 2QXFA 1UA0A 4PWDA 1K6YA 1C0MA 4DFKA 3K5MA 4IH5A 5CYQB 4K8XA 1ZBUA 4IR1A 4DTOA 2X6NA 4F2SA 3T5HA 1D9DA 2O4IA 3MFIA 1RILA 2OPSA 3CG7A 4AHCA 1L3VA 5J2NB 1Q8IA 1SL1A 2OYQA 5KT4A 4NRUA 1RDAA 2GBZA 3AVNA 3C95A 3VQ6A 3LPUA 1SV5B 2OPRB 3G0ZA 4NLSA 2XCPA 3HYFA 4TSXA 3KD1E 3HPOA 2YNGB 4CFAA 4IBNA 3VQQA 2QE5A 1W25A 3H5XA 4PQUA 5EUHA 5KFVA 3AO2A 3ZT1A 3EZUA 3M9MB 4RUCA 3DLGB 4MKAA 4X2BA 1BCOA 5J1EA 1RAJA 4C8MA 3GQCA 4WYWA 3NGZA 2CKWA 4Y34A 3GIMA 3NBPA 3H08A 4Z4IA 4K4ZA 4QWAA 1J5OA 4HHTA 3OYKA 3DRSA 5J2PA 3SQ2A 4DSJA 2W9AA 2W7OA 3IN5A 3QGHA 4QAGA 1KVCA 4CJKA 3BJYA 4PA1A 3HO1A 1HNVA 3K2PA 4KAZA 4E89A 4I2QA 4QWEA 4J2AA 1RTDA 4ZVHA 3AA2A 4CJLA 4LD0A 4CF1A 4H4OA 3HVTB 1HYZA 1JLEA 1EETA 4ZP7A 3I0RB 3OLBA 1IH7A 2YKNA 5KG6A 3QNOA 3FRZA 3ZT3A 3TQ1A 4ELUA 4ECYA 4WFZA 4RW6A 3SFGA 4GW6A 4FLZA 4CFBA 2O5DA 5KFSA 4O3RA 1XWLA 1YVUA 3MXIA 2E9RX 2G8VA 3QGIA 1SH3A 4YNQA 1TL1B 5KT2A 1EKEA 3LANA 4IDKA 4E0DA 2HHVA 2IBKA 4RNFA 1D8YA 3QGGA 4JRPA 1QE1B 4LSLA 3BR9A 4XO0A 4CIFA 1BQNA 5I42B 3QYYA 3IRXA 2R8KA 2IAJA 3U3GA 2W8KA 5C42A 4N5SA 3AO4A 2VG6B 4FBUA 3QNNA 3AVCA 4WZQA 2OPQB 4R8UA 4CJRA 5T14A 1BQMB 1RDRA 4RZRA 4DTNA 1QSLA 3CDUA 3GV5B 3TVKA 3DM2B 4FS2A 4Q0BB 3RBDA 1S1TA 4B8CA 4CK1A 4IH6A 2GIQA 2KFZA 3SFUA 3DLRA 1ZYQA 4N41A 3KIOA 1LWEB 4NCGA 4QW8A 1S1XB 2LSNA 1NK7A 1SUQA 3NCIA 2WCXA 4KKOA 4RG8A 3MEEB 1LV5A 2ZD1A 4ED2A 4DLGA 4FJ7A 1IKXA 3V1RA 3AVBA 2XWYA 1UAXA 4FK2A 1CZBA 1NJYA 4DMNA 3KJVA 3C94A 4M3UA 1HYSB 3H98A 5HRSA 1X9SA 3AA3A 3KLGB 4KE5A 5F8IA 4B08A 1S1UB 2YKMB 3CYMA 4EBEA 3OYNA 4NLWA 3RAQA 1S0NA 3CJ0A 1LAVA 5KFYA 4G1QB 5KGXA 2ATQA 2FBVA 2DFFA 3QESA 2YNIB 3MTKA 4JV2A 1L5UA 1T8EA 3LP3A 1FK9B 4DQSA 1C2PA 4AHVA 3G10A 3GIIA 4JV1A 4EYIB 1GOBA 2C2EA 5E41A 4I2PB 1RT2A 4M94A 1VSLA 4RW9A 4DTJA 4DL2A 1DLOB 4J9SA 3MECA 2JC0A 1Z25A 3ZSXA 4E3SA 3RMDA 1KSPA 2DY4A 1HARA 2BANB 1KHWA 4QW9A 4LH5A 3LWLA 3ZSOA 1BI4B 3QEVA 5KG1A 1HQEB 3B6OA 1CLQA 1MU2A 4K4YA 2BRKA 4FVMA 3PVXA 1ASWA 2ITGA 4ICLB 1BIZA 3VN5A 1D9FA 3CO9A 5HRNA 3RB3A 1S9EB 4DU1A 3MEGA 3U3YA 3IS9B 3FQKA 4ECUA 4LSNA 4M3XA 1NHUA 3RMCA 3G86A 3VQSA 4RW4B 3SNNA 3ULDA 1JLQA 2FBYA 1JKHA 1S0MA 3QO9A 3V1OA 3KK1A 1U49A 1S97A 3KLFB 1U09A 3TAMA 4O3NA 1KCFA 1TKDA 3FFIA 4Y2CA 2XC9A 4URQU 1W9HA 3K59A 4IRDA 1JX4A 3K58A 3DLHA 2B5JB 4ZVFA 1C1BB 4DTSA 4FJJA 4I7FB 4KTWA 2YNHB 3V9SA 4WXWA 3Q8RB 5FRNA 4FM1A 2VG5A 4K4WA 2FVQA 3NHGA 2HNZA 4K8ZA 4Q8FA 5HRPA 1YTAA 3I0SA 3PW4A 2Z1JA 3DLBA 3LP2B 4IG3B 1XR5A 3KLHA 3NFAA 3RBEA 3DI6A 4GC6A 4NCAA 4ECSA 4OKEA 5CZ2A 3BGRB 4CEDA 5KFCA 2AWZA 3AVLA 2ZE2A 1S4FA 4IOBA 3C6UA 3KK2B 1NOZA 4J9KA 2RN2A 4RNMA 1LAWA 3NH1A 3KKRA 3N6MA 3AVFA 4CJ5A 2WONA 5J2QA 4O3QA 4EEYA 3IAYA 5KFQA 2NUBA 3BSOA 3CDWA 1WNEA 5FDLB 4RW7A 1SH2A 2Z1HA 1IKYA 4CGDA 3C6TA 4KREA 4F4YA 4DL6A 1NKBA 3VQ5A 4LH4A 1WN7A 1JLGA 5KG5A 5SZTA 4CFCA 2V0NA 3LZJA 4MIAA 5KG7A 3T3FA 1SL0A 4BACA 3O3HA 1ZBLA 5DLGA 3PR5B 2VG7B 4I9LA 1LW2A 5EWFA 3N6NA 2R8HA 4OLBA 4J2BA 2UVVA 3PW7A 1RYSA 3O3FA 1MMLA 2F8EX 4CK3A 1LWFA 3HL8A 3V6KA 2F96A 2CJQA 2ALZA 1RT5A 1JIHA 5FRMA 1KLNA 4KFBA 4O3SA 4CJ3A 3QIPB 3QZ8A 3CJ3A 3CJ5A 4E7JA 2DFHA 1YT3A 4PUOA 3CFPA 4TQRA 2R7YA 3P83D 3RAXA 1C6VA 4DQQA 2GV9A 4ED6A 4AHSA 2O4GA 3THVA 3O4QA 1S1VA 1HPZB 1EXQA 1JLFA 3OYLA 1KLMA 4ZPAA 1CXQA 1KVAA 1U45A 1NJZA 4TQSA 3Q8SB 3OL6A 1N4LA 4W5QA 1S48A 3OYJA 1RNHA 1X9WA 2G8IA 1J5OB 2W9CA 2ASLA 4DU4A 2I5JB 5HP1B 4FJNA 5KGWA 5DK5A 4FJ8A 3E01A 2QK9A 1B9DA 4MIBA 3UR0A 2B4JA 4NYFA 4J9RA 1VSDA 1RTIA 1DTQB 4Y3CA 4LQ3A 3H4BA 1C1CA 3LALA 4KSEB 1WSIA 3Q8QB 2OPPB 3DOLB 2Y1JA 3EYZA 3AVGA 3NF6A 3M8PB 3K57A 4RW6B 2BE2A 3DOKA 1RBVA 1VSIA 3SUPA 5C25B 4LQ9A 2WOMA 4O44A 3CFOA 5KFLA 3CIZA 2QKBA 2XO7A 2YNFA 3VQPA 4ECTA 5EU7A 1TKZA 2HMIB 3NE6A 4NLRA 3KHRA 4HUEA 1RT6A 3VQCA 2IM0A 4IDKB 3VQ4A 3SZ2A 2EHGA 1JLAB 4FZXC 3DYAB 3NH2A 1BQNB 2XRIA 2HVHA 3I5BA 4AHUA 3AO1A 3AVJA 4DQIA 3SPYA 1TKXA 3LP1A 3KLIB 3QEXA 4Y1CA 4B9NA 1WLJA 3TABA 2FLPA 4FJLA 3JSMB 4B3OA 4DQRA 3GIKA 4DFPA 3RB0A 3PW2A 5C42B 1WSFA 2ETJA 3LP0A 1N48A 1C1AA 1JL1A 2AGOA 1N6QA 4FS1A 2R8IA 3PW5A 3HHKA 4O3PA 4DSLA 4IG0A 3D5MA 3G6YA 1NK9A 5F8GA 1RDDA 3MXJA 1T7PA 4EBCA 4ED8A 3SYZA 3MF5A 5KTQA 4OKKA 4GC7A 1NK6A 3O3GA 1C0UB 1SUQB 1JLCB 4L8RB 3ZSWA 1RT7B 4EYHB 2E6MA 3CWJA 4HCBA 3M8QB 3OS0A 1IKXB 4CJVA 3SI8A 4ECVA 3T5LA 2UUWA 1RDCA 4DL3A 5KFNA 1L3TA 2F8SA 3RB4A 3DMJA 4NLXA 2UUTA 4K4UA 3ZSVA 2W42A 4F8RA 1BHLA 4ZP6A 4CEOA 4E1NA 2XI2A 3RB6A 3JYTB 1WSJA 2UVRA 1VRTA 4U7CA 1D5AA 3S9HA 1S9GA 3H5YA 5D3GA 1TVRA 3TAGA 4MKBA 1TP7A 2JGUA 3PR4A 3V4IB 3QZ7A 4IR9A 1SH0A 2F8TA 4F50A 1D0EA 1JLBB 2DPJA 4KHMA 4F4KA 2EC0A 1O1WA 1DTTA 1XC9A 4QPXA 3WNFA 4HCCA 1VRUB 5KFEA 2G8HA 4RW9B 2QKKA 1RT3B 4KHYA 3OS2A 4FJ5A 2WTFA 1LWCB 1CSJA 3H2LA 2RF2A 5KFKA 4J9MA 2FVCA 5J2MA 2ASJA 2Z1GA 3GIJA 2GUIA 2G8WA 2DTUA 3OYHA 4CERA 3PZPA 4CFDA 4Q8EA 4H4MA 2DFEA 1N5YA 2AGPA 4F4XA 1T05B 4YQWA 1TV6B 3HPHA 1RTJA 2RKIA 1KRPA 3V6DA 4DTXA 1HQUA 1S6QA 4EO8A 4EP4A 1A5WA 2R2UA 4CJ4A 3AVIA 5KG0A 4RNOA 4F3OA 2IOCA 4U6PA 4ED3A 4DWIA 5CYMA 3DLEA 2WHOA
chains in the Genus database with same CATH superfamily
2P9SA 4KRWA 2GELA 4FPBA 5LL6Z 2MZTA 4IQMA 1X4AA 1U4BA 2IM3A 2V94A 2M3DA 3NLCA 3I32A 5JMNA 4DUYF 5AQMA 2ZJQL 3ILLA 3THPA 1CJTB 4TY8A 3EGNA 3HKZD 4J9LA 1WKKA 3MWPA 2AP6A 4FYWB 4YOTA 3CDEA 3TZXA 4NPOA 2YKQA 4ATNA 3QEIA 2P8IA 4OLAA 3VA0A 4DL4A 4ES1A 1K0VA 4Y0WA 2H4YB 4OZNA 4ZHRB 3U6FA 3VERA 3OJUA 4RU9A 1UKUA 4Y0FA 2R7UA 2LP4A 5LJVA 4JI5F 3D6MB 2QIFA 3CD5A 3T1YF 3UR3C 1OJ4A 4IRCA 2UUAF 3BEXA 1IKWB 4FZZA 1SKWA 4YEAA 2AIRB 3NL0A 3MMCB 4PYAA 4ILLA 3LZIA 2WONB 2V4RA 4DTPA 3HPGA 1O51A 4RJVA 4NYNA 2ATCB 4DSFA 3WXIA 5AFUA 3HFVA 3D1HA 3A4TA 5J2NA 4IFYB 4FLTA 3UNYA 1RAFB 3ZSZA 1G99A 2R8JA 4ISGA 1NMNA 4EUVA 4QOZB 1FJGF 4DZDA 4UY8O 1K1QA 4KGMA 5E3PA 4JI6K 4B9TA 5A2QY 3AFGA 3U1MA 4DR3J 2BOAA 1LW2B 1W7WA 3PX0A 3QLHB 2J9CA 4LFAJ 1SXLA 3SPZA 4ZJQA 4U7BA 4GMKA 3KMQA 3CD0A 2CPEA 2DRAA 3NDKA 4CEAA 2FHJA 2FD2A 1TK5A 5CH7B 4CBXA 1GAOA 1I6JA 1IBLK 3HSTB 1S7HA 3B54A 4J9PA 1SKSA 5LMUK 1WHWA 2CNKB 3I4HX 4IWVA 2HQDA 3TU5A 1MDUB 4I69A 1Q86O 4HEA9 1U6FA 5G0RB 3G8TA 4JKFA 2HFVA 1CPZA 1QUVA 2MHNA 3MMJA 2JSXA 1U1RA 3Q89A 3KMSA 4K4XA 2F3JA 3DRYA 3IG1B 1Y5NB 2KVQE 1MWKA 4CE9A 2Q1NA 3KOAA 4CBWA 4JD2A 1IWAA 2EKNA 1AUSL 3SAFA 1TL1A 3TRGA 4ZPVR 4O4GB 4H8KA 4BREA 2N4CA 5CCLA 4TYBA 4EO6A 3PHEA 3L2VA 3S3MA 3M5RA 4E2FB 1ULRA 3ENBA 4FF1A 4CHNA 1JJHA 4K4VA 3FZLA 1WI6A 2HF3A 1RT4A 4EIAA 2OPQA 2CQ4A 4NCBA 4OHYA 3JSBA 1WEXA 1BQMA 2HIQA 4JKGA 3DM2A 3ZZPA 2FYXA 4BC9A 1KD1T 4F3QA 3D0PA 2RQ4A 1S1XA 3CJ4A 3ZC4A 1VIOA 4C8NA 1IBLF 2J6TA 3WQPA 1T11A 3IAM9 2GWJA 5LMUF 3LDNA 3NP5A 3P45B 2XY5A 5AQJA 2AJQA 2WBNA 1WAJA 1N33K 2V8PA 4G65A 3AO5A 4B9UA 4E7HA 3MPUB 2WVEA 4BR4A 3DRPB 5DDOC 4J9QA 4YY3K 3CPWM 4ED5A 3TNVA 2WFBA 1TL3B 4DR5K 4Y1DA 1RBRA 4FYXB 3MM8A 4PWDB 3P39A 5DS7A 3LGMA 1GK8A 2RDJA 2HB5A 3CJAA 4FLWA 2RQMA 4OX6A 3ZT2A 5DDRC 4KB7A 3BV8A 3OTOJ 1N56A 1NJIT 4Q44A 2A6OA 2HAIA 1BUXA 4DCOB 2DH9A 2ZH1A 1DLOA 5AQUA 1DZ5A 2AEMA 3AGKA 3EE8A 1IG9A 3SAHA 2MQNA 4YMEA 2BANA 3PDNA 2UUBK 4CHYA 1BI4A 1Y9OA 3BREA 3N5BA 4RW8A 2UUCF 1WBBA 2RT3A 3NBPB 2AA4A 4RBTA 1VQKS 3BDPA 3TZWA 3SCIE 2IIHA 5KFDA 3CCVS 4JI4K 3UD5A 4IOXA 1TMMA 2RMLA 2XO6A 3CCJS 3CNQP 1T6DA 1N33F 4GVMA 4I2QB 1VSKA 4RW4A 1Z2ZA 4E98A 3CQ8A 2GJFA 4H4MB 4YY3F 2CIMA 4LIRA 5HQMA 4ED1A 5F8JA 4CLWA 2RKIB 1UEUA 2YKNB 3KLFA 3CXCR 1HNXJ 4K8RA 1WAFA 5DDPC 3DDNA 1HKAA 4BWMA 4KBOA 2B5JA 5GAHI 3VTHA 3OLAA 5GAEU 2IJRA 2W4CA 3IM8A 1HQ2A 4I7FA 5BJRA 3OFHA 2MZ1A 2YNHA 3H40A 4JAXA 2RHKA 1X7VA 2CJ9A 4GKJJ 2MLYA 3VQ9A 4ZVQB 5KG3A 1BL3A 3X3UA 3OT9A 4JHDB 2OTLS 1IR2A 3BN4A 4ZA1A 4F4ZA 1UVKA 1TYQA 4LF9J 3KZBA 1HNZJ 2MY7A 4DUYJ 4PQAA 1KWMA 4OIXA 3W5XA 2N82B 4X4RA 3SCXA 1V3RA 2UUBF 3VQ7A 4PR6A 1U1OA 4OI4A 5K8MA 1TK0A 1T3VA 3FLCO 1FVQA 2HK2A 2HVDA 4O0IA 2QWMA 4DU3A 2IPOB 2MDAA 1S1TB 4AE5A 1KQKA 2HRTA 2AX0A 5DQHA 3T6BA 1HBMA 1T03B 2NUHA 4JI4F 3H4DA 3FEYB 3T1YJ 2ZWPA 4KHWA 4JKBA 3MAQA 3W3DA 2D9OA 1VC0A 4W5RA 2DGSA 2V7ZA 4RR5A 4M5DA 5KFGA 4FLYA 3GJSB 4JI2J 4QWCA 2JWNA 3LM9A 3N79A 2VASA 5DG7A 4QYRA 2K1RA 2VZ9A 1W2BR 5ADXH 1MROB 3DDKA 3AVMA 2VBWA 3H46O 1YI2S 4FJIA 4HUGA 3Q8YA 2NPFA 3Q7CA 3NMAA 3P3DA 2HHHF 4DG1A 2W41A 3FQLA 4BDYA 4O0JA 4WIIA 3C3LA 1NSAA 5JS1A 2CVIA 1XNRK 3BGOP 3BPSP 2H3GX 3S01A 2WK4A 3ZTSA 4KI4A 1K9MT 3OYFA 3MMAA 4X4NA 4RL1A 3R3TA 3VGMA 3L9ZA 5EX5A 4M7XA 5E33A 4I9QA 1QAJA 4DTUA 2D3ZA 2NYIA 5AQQA 3EPGA 4EZ9A 1WSGA 4FWRA 1HNWJ 3CJBA 2I5JA 4I68A 5CY4A 3RAMA 4C9DA 2RU3A 1DGKN 2U1AA 4K50A 3O1BA 4P2XA 3J81j 3B78A 2CJBA 6FDRA 1S22A 5KOXA 1WACA 3KLEA 3NCQA 3D6FB 1ZAVA 3IBFB 1NB7A 2YH1A 3HP9A 2GHVC 1DTQA 2YX7A 3LGNA 2FDNA 1NLVA 4LSNB 3FZFA 4FO0A 1K44A 3CCVN 2OPPA 3DOLA 4OJ1A 4ZOSA 3IAS9 1BWFO 4KTQA 3UDLA 1SI9A 3J7YU 4LRFA 2W40A 1NPRA 5H9EK 3PX4A 3IR6B 3KK1B 4KH4A 3CMQA 5KFZA 2L9WA 2HRYA 3ISZA 4WFYA 3MCAB 4Q2LA 4ZTJA 3DYAA 2L08A 2R42A 4PL8A 4TXSA 4JI6J 4QIVA 4DCPB 4CT9A 2Z2YB 1PC4A 2RRAA 1XNRF 3MPDA 2VG5B 4OPHA 2PZSA 4AH9A 2GHPA 3PM9A 4DQ8A 4J91A 1PBAA 1RHKB 3KLHB 2CGKA 5CQGA 2B4VA 1DKGD 3MEDB 3N01A 2X1AA 2OTLN 2PGCA 2CXEA 2IHR1 1NK5A 2HURA 3MN9A 2LA4A 4O4RA 2JZ5A 3H59A 1B70B 2B7BB 2DYAA 2HGMA 5LMUJ 1RT7A 2XMKA 1RDWX 2J6SA 1QQOA 1RCXB 2YY3A 4C8OA 4P2SA 1SQEA 5J2QB 4LUBA 4M1KA 4CJSA 1S99A 2OHDA 1S6UA 4XH1A 5HJYA 4OGCA 1FO1A 1GX6A 1XR7A 3SQ1A 1FEEA 1OIAA 1LWXA 1YK9A 1JLGB 1G3OA 4BVPA 2OCEA 3HD1A 3QINA 3NGDA 3MX5A 1PYOB 1NCLA 4CT8A 2B9EA 1U0HB 5T41A 3WHIA 2AKWB 2GGPB 1NUEA 2KI2A 2XMMA 1UVJA 5HRRA 3WNHA 1FFWB 1JXEA 1JLBA 5KRTA 4Y2AA 4DFJA 2Q0UA 4XPEA 2YHAA 4CZEA 2BV3A 3K8VA 4DV3K 1P8ZA 4NLQA 3J81Y 1RT3A 2XSJB 2I6WA 5AXLA 3G96A 1KC8T 5LXRA 1CZAN 1Y3JA 2GNKA 2FHJD 2ROEA 1R0CB 1T05A 1R27B 1Y10A 4CRJA 9RUBA 5KFRA 3KUEA 2XMAA 3CDAA 1RACB 5AXKA 4YHHK 1KXPA 2MKCA 3K9JA 1U48A 1HMVB 4QOTA 4Y2MA 4CJTA 1N33J 5K5MA 1TZ0A 1B9FA 3G71S 2ASOA 3SI6A 3Q2SC 2A0FB 1WWHA 8AT1B 4YY3J 2IMWP 4U9RA 1BE4A 4DR5J 2BKPA 2JHEA 1XMOK 1C1CB 2E1ZA 4QQBA 5KT7A 2DCLA 3HHEA 4FWNA 3I8DA 1RBAA 5LJ5Y 2UVUA 2IRUA 2DO4A 3N0VA 4GY2B 3BO2A 1GFWB 2HGNA 4DKWA 4CESA 2AZ1A 2OMLA 4DX7A 3UPFA 4GV6A 3R7NB 3ZZ0A 2HVZA 2KZMA 5MLCV 4DV3F 2ZQBA 4F2RA 4F02A 2ZH9A 3ATVA 3H5UA 4ZHRA 4IOAL 3G82B 3O3LA 3MEEA 3I9V9 2G2ZA 1F2GA 4JK7A 2UUBJ 3OXGA 3MR3A 1QVGR 4N56A 3CJ8A 1WELA 3LP0B 4EFHA 4KHQA 2CVEA 5KFPA 3P5JA 5CD4H 1W97L 2YKPA 3MN5A 1IKWA 1NM1A 2GMHA 3VETA 3FZMA 3T1AA 3A3OB 2W1BA 4EBDA 2BW7A 3K5NA 2BRLA 2CPHA 3CJ7A 3NAHA 3O9QA 1H3DA 4YHHF 2ZVIA 4GO7X 1NNDA 2F40A 2XY8A 4A59A 1G1XA 3FZHA 2DHGA 3TA0A 3A2FA 1RK8A 4UOCA 3SQGB 4IFYA 1OSCA 4JKEA 2K3IA 5F8NA 1XI1A 3OFFA 4JV0A 1FCAA 1KR4A 3OYGA 5AQSA 2HBRB 4H4KC 4KPYA 4DPOA 2ZWHA 5IT9U 1XMOF 4A8MP 4B1ZA 4TN2A 3VOVA 3QLHA 5ETKA 3K5LA 1O5JA 3H3OB 2BJ7A 5HL7L 1V5IB 1YRUA 3BSAA 2E9ZA 4TKTA 2CQIA 2PMWA 1HI0P 3B6BA 1ZAXA 1GXUA 4A5AA 1NU4A 3KK3B 5JVHL 5CZVA 3ZTOA 2VJVA 1TVRB 1SBRA 3S1TA 5JXSA 3AXKA 3CQYA 3P1GA 2ASYA 1H72C 4USIA 4RUBA 2CFXA 3KK7A 1UFLA 1FVSA 2ADBA 3US5A 1HX1A 5KFHA 4ID1A 3SEOA 4B1UB 2QTDA 1N52B 3QDKA 1NGJA 1RABB 1UPPA 4L6V3 5JLHA 1OS5A 2EK6A 3IG1A 1QAIA 4LR7A 4FDFA 3R1HA 3V6DB 1RCOB 4DCHA 5F9LA 1ZXOA 1FD8A 4EHTA 1EX8A 5L9NA 1U04A 3EE9A 2UU9K 4O4GA 1H2VZ 3AH6A 1RI7A 4E1MA 2XS7A 1T9YA 3HHLD 3V9WA 3MFHA 4O5FA 3QERA 1K73O 3PLAA 4N47A 3TUIC 4CLFA 2P5GA 1MWQA 3L09A 2MXYA 3KD5E 1X5SA 3FGVA 1GNKA 4IRKA 1N32K 2AZ3A 1HWUA 5EHHA 3M2RA 4ES3A 3A0IX 3HSZA 4OJHA 1BGXT 1RP5A 5KFUA 1BWVA 3NS6A 1T0TV 1F9EB 3I4PA 4GMJB 2MQPA 5ETTA 4BE1A 3MMBA 3FNNA 3TUPA 4V19S 5DETA 2MPUA 1NK8A 5DG9A 5FDLA 3VV2B 4B9VA 5CZ1A 3B82A 1FI4A 4DZ6A 1KFDA 2LEBA 4IOAQ 3DRPA 3FK4A 5EX0A 4BR2A 1URNA 2E4LA 4FW2A 3J7ZT 1Q1KA 3VAIA 1TL3A 2J8AA 1RT1B 2C2NA 2KU7A 3NXZA 1J54A 3BSNA 2QXFA 4RTFD 1UA0A 4PWDA 2E5LJ 3K5MA 2LA6A 2VODA 5CYQB 4X66K 4CO4A 1VAZA 2M0GB 2VH7A 2UU9F 5CE3A 2H54B 3ZZOA 3MFIA 1L3VA 2IVFB 1SL1A 2BJ1A 4NRUA 1RDAA 3AVNA 2G1HA 3LPUA 1SV5B 3WX8A 1HL6A 2OPRB 3KXDA 3HYFA 4TSXA 2DY9A 3HPOA 4ZLNA 3VQQA 3SAGA 3Q0AA 1GMWA 2VBZA 4I6WA 4GKKK 5KFVA 7AT1B 3AO2A 1N32F 4CO0A 3I82A 1RAJA 3GQCA 2AEJA 5HL7Q 3S8SA 2BJDA 3OBIA 3NBPA 4A8XA 4B1YB 4PRFA 4U95A 2ZHBA 5JVHQ 1SS6A 5AQYA 4DV4K 3CCRS 3KWMA 3QGHA 3S6EA 4KAZA 3CCQS 4I2QA 1IBCB 4J2AA 1DQ8A 4C0BA 4ZN1A 4CF1A 3HVTB 3OBYA 1HYZA 1PGZA 4OJGA 3OQ2A 1HKCA 3OLBA 2YKNA 1VYAA 4FF3A 3AD8C 4ELUA 2E88A 4RW6A 3SFGA 1OH5A 5KFSA 5ITHA 4X66F 2OANA 4MMOA 4F0HA 5HVGA 2G8VA 2E9RX 1DARA 2NNWA 3QGIA 1X4EA 2YWKA 2LDIA 4IDKA 2B4PA 2HHVA 3FVYA 3QGGA 4AD6A 1QE1B 2K2PA 4XO0A 5AQLA 1HW9A 4JHDA 3H3NO 2AT1B 2FPHX 2BKOA 4FVCA 4GKKF 2D4WA 1LXNA 2W01A 3W5ZA 4UF4A 4FBUA 3QNNA 3AVCA 1S12A 3UFCX 3L3CA 4LBHA 2GTDA 4DTNA 1YX2A 2A6AA 5KAKA 3TZYA 4DV7J 2PEHA 3TVKA 3RBDA 1S1TA 5B08A 3CCLS 2B9XA 2UXCK 3DLRA 2PN6A 2KKHA 2ZH5A 1LWEB 1QZ5A 4KHPF 2CPFA 2HMPA 4DV4F 3NCIA 2NZCA 4DR2K 2PT0A 4ED2A 4DLGA 4FJ7A 1P27B 3FCVA 2E1YA 4OZJA 4UOHA 5I3PA 3A8YA 4NLCA 1WSVA 5HRSA 3AA3A 4KE5A 5F8IA 4RUHA 1S1UB 2YKMB 4Z7CA 2OJ3A 2ACMA 4EBEA 1Y5IB 4LMZA 1YF5L 1RWNB 4OI3A 1MROA 2ZDOA 3VGKA 3CPWR 4LIWA 3BKUA 3W2WB 1TUYA 4G1QB 3HHLC 2VONA 5AQWA 3R5DA 3J80O 2YKOA 3NVMA 2CYYA 5D4OA 4CZCA 2FBVA 4L75A 2Z2ZA 1Q82T 1T8EA 2MQMA 4CZGA 4OYAA 1TUUA 4DQSA 1FK9B 2E5JA 2X3GA 1C2PA 3M6VA 1FFSB 3HD2A 3BKTA 4JV1A 3N4PA 3GDQA 2XZDB 2F9DA 2H4WB 4DJBA 3UO0A 1D8ZA 2VQEJ 1YJUA 2E1PA 4DL2A 2E1AA 4J9SA 1R6YA 2JC0A 2LQ9A 1X4DA 3OD2A 5LJWA 4QW9A 3LWLA 4NL5A 5KG1A 3M6XA 4OZ3A 3JQMA 1F5AA 2BRKA 4USJC 4FVMA 2UXCF 2ITGA 1BIZA 4UT4A 3VN5A 2HZCA 1S9EB 1NH8A 1N5TA 3BB5A 4DR2F 1BDGA 4WPAA 3TA1A 1E6YB 2V68A 4LSNA 2ZBRA 3VQSA 3CCRN 4JP8A 3MN6A 5IV4A 3ULDA 3NMUA 2DH7A 3CCQN 3M2VB 3QO9A 1KOHA 3KK1A 1FE0A 1GXTA 2W24A 3NCPA 3PRBA 1TKDA 2R7VA 3R5CA 4LREA 2DGUA 4G1PA 3VEWA 2CWXA 1VLOA 2BW2A 4HDGA 5LMNJ 1TL4A 3V9SA 2GV1A 3GFYA 3Q8RB 5FRNA 2VG5A 4WQ4A 3K0JA 4K4WA 4L74A 3CD7A 4K8ZA 4FYVB 3SQOP 3BM7A 2OEMA 1YTAA 2Z1JA 5AQRA 4JI7J 5GAGU 3DLBA 2CNOB 5HVHA 3GYXB 2IVOA 2EK1A 3PTWA 4IG3B 1XR5A 3KLHA 4BR7A 1MLAA 2FZCB 2DY1A 5J1NA 2HFZA 3MX2A 3NEKA 2HBMA 3JXUA 1KQSM 1HW8A 2KHOA 4FOEA 5KFCA 1RWUA 2V34A 3NS5A 2OTJN 1R7IA 2OSQA 3MD1A 2DNYA 3N6MA 4KQZA 4U7UD 4KH5A 5J2QA 2MMYA 1I94J 4DHVA 2NUBA 3DXMB 3CDWA 5BN9A 3EGVA 2NRHA 3M8YA 3AJ2A 1IKYA 1YWXA 2VBXA 2Y9HA 1PC5A 5DZ7A 2LCWA 1NKBA 2FHMA 4LH4A 1NBEB 3TTFA 1H7XA 4AM6A 1JLGA 2CH6A 4CFCA 5KG7A 1SL0A 3O3HA 4BC7A 2VG7B 1U0HA 4M63C 1U02A 4M5GA 3P4IA 4J2BA 2GGPA 2RE2A 3CCES 3RJMB 3PIPL 4C4WA 4DR7K 1FKAF 2CJQA 4DV6J 1KLNA 2F4VK 2QMWA 3QIPB 5LY3A 1XERA 1R8AA 1HFEL 3WQTA 5M1KA 4IJAA 4ITSA 4OHZA 4DQQA 5DJBA 3AXMA 1QD1A 1XNQF 5CD4A 1HPZB 1JLFA 3UW1A 4WFAL 1U45A 1XMQJ 3Q8SB 3OL6A 1N4LA 4MLHA 4OX9J 1X9WA 1J5OB 4DU4A 5HP1B 5KGWA 4WWSA 4WU2A 4K5SA 1GMUA 2V6AA 3MTJA 4MIBA 5FIIA 4ILRA 3UR0A 2B4JA 3H45C 2Q97A 4USWA 2C1EB 1X3MA 4DPWA 1C1CA 1ZA1B 1YJNN 4X64K 4DX5A 5D0RA 4JN4A 3EYZA 2ZEJA 4X66J 3SUPA 4LQ9A 4CBUA 2QKBA 3ZTRA 3NCRA 4DR7F 1LOTB 2V63A 4AQYK 4CM0A 3SZ2A 1YLXA 1SC4B 2EHGA 1VK3A 2F4VF 4WFBL 4B3RJ 5IT9O 5M2PA 3I5BA 3DU6A 3AO1A 3G82A 3VF6A 4CWBA 4OJ3A 3QEXA 3TABA 1C0FA 2FLPA 4AM7A 4DQRA 5B0FA 4GKKJ 3RB0A 3R2CJ 4XDCA 2KXHA 2ETJA 3LP0A 1N48A 2VFSA 3GZ7A 1GEHA 1WHXA 5FPEA 4C3MA 4MDAA 1T3OA 4QIEA 4RLEA 2Q1LA 2F7VA 1FRHA 3UI3A 1PG5B 1YTYA 3PYGA 1NDCA 3CCTA 3MF5A 2E8AA 3H6EA 2BOPA 3EXYA 1SUQB 4A4JA 1JLCB 2EEYA 3CWJA 3SQGA 4ES2A 1G7CB 2KVIA 2FXUA 3D6HB 4CZKA 2HZVA 2DPNA 3M8QB 1ZPVA 5AZIB 4DL3A 5KFNA 1XBWA 1AYEA 1L3TA 2F8SA 4JNEA 3EL2A 1QQNA 4X64F 5D0HA 3ZSVA 3S41A 4I6MA 3FE1A 4MO5A 5GIOA 4J7CA 1VQ9S 4CEOA 2QL7B 3JYTB 2UVRA 3H5YA 5D3GA 1TVRA 4MKBA 1TP7A 2GA7A 4AQYF 3V4IB 2YQ3A 1SH0A 1KOOA 3D54A 2GMJA 3PIPQ 2BJ8A 3CCEN 1IJFB 3NGTA 4F4KA 2VQFK 3JS9A 4CI6A 3CJRA 3CJQA 1GMWD 3FUYA 4NA2A 2DT9A 2Y0SD 4QPXA 2RH3A 1VRUB 5KFEA 1HUXA 5ETPA 1VQPS 3H2LA 1S6OA 4J9MA 1QM9A 2CA9A 3V2UC 4RCHA 2G8WA 4I64A 1PSDA 3HM8A 3L4IA 3H20A 3CE8A 1KD1O 1TV6B 3UDCA 1KRPA 3V6DA 2QJ3A 4DTXA 2QW9A 3QRRA 3MEKA 1FRJA 4YOUA 4DR2J 4WFAQ 2DGOA 4JB8B 3D3BJ 4L3QA 1SQKA 3CSKA 4BC4A 5KG0A 1RDUA 2IOCA 2M7SA 4U6PA 4H0TB 3ZXWA 3D6TB 2OUGA 2WAQD 3AARA 3VENA 2M88A 3WX4A 4C2MA 1VQLS 4KBIA 4Y2IA 4F7VA 4JI1K 2FVRA 1SL2A 3ZSQA 4WTOB 5GAGI 4R25A 3D1OA 1JNRB 1KVBA 3CC4N 2QTWA 3MM7B 1CJVB 4QIWD 2GO8A 1J6ZA 4ZIVA 4DFMA 4DR1J 1HBOB 2QWPA 1HBNB 4ZDNA 4A8QA 3V1QA 2CDRB 3Q83A 4K43A 2VQFF 2F4FA 4WCEL 4CZMA 2HSEB 4WE1A 3VQDA 3M9OB 1FKPB 1FDDA 4H5NA 2WVBA 1CQNA 4WFBQ 2HLUA 4QS7A 3J80Y 2VWBA 3K5OA 4OYMA 5B0BA 2HW3A 1Q78A 4BRDA 5KRSA 1IR0A 4E7KA 1RT1A 2FC8A 3FCHA 4R0JA 2V69A 4PXDA 4CHZA 3KHHA 3V6HA 2CJKA 3ZT0A 1NGDA 1WUAA 5CYQA 5T7BA 3I87A 2IFXA 2ZWOA 4A47A 4YDDB 1CJKA 1JCFA 4OI2A 2O3DA 4WFNQ 3HJFA 3HZEA 3ET6B 2I7NA 3O5TB 4ID5B 1QJHA 2MZJA 4FM2A 2OPRA 4PKGA 3ETOA 3MN7A 2RB7A 3PNIA 2KFNA 4JI1F 2EWHA 1TKTB 3ZLJA 3V9XA 3C8YA 4BRMA 3NKYA 4ECRA 3WUHA 5AXMA 2J0XA 2GC8A 3MD3A 5AT1B 5M1OA 4DMZA 4JI0K 1DJ0A 1AXQA 3THWB 3A8JA 4KV8B 3QJPA 1DHMA 4FYDA 1VQ9N 2ZNZA 5E3AA 2AP1A 5KI6A 1CZ9A 3W8PA 1FX2A 1YQHA 2VKZG 3VGVA 2OP5A 2YCHA 1M5OC 4HI1A 2MSTA 2E5HA 4JV5K 1SJRA 3N6LA 4B3MJ 1YAGA 3OTEA 3EXCX 2VA3A 1BMQB 1FEHA 5BYQA 1S6PB 4BRFA 3HVTA 5A6WA 4CHOA 4A8KA 4FJGA 3PO4A 1KLMB 1WC1A 3I55S 3R97A 4OLPA 1VQPN 4J9UE 1XQIA 3F41A 2UXBK 4Z4EA 3BBFA 2IC3B 1L3UA 3FZ2A 4KO0B 3GPAA 1X4FA 2B6AA 2YHBA 4FZVA 2R7TA 2IS3A 3QGPA 2HPUA 1QE1A 5JUMA 2C3MA 1YJ9S 3VR1A 4CGJA 1RTIB 1VISA 3OV7A 1VK0A 4O0NA 2BQ3A 2ZFHA 3NWRA 4PZVA 4RWWA 4B8AB 1N0UA 4YDXA 5FLXU 4DV0K 1U2CA 1YITS 4CF0A 4DR7J 2CNNB 4JI0F 1ZH5A 1C0TB 3CJSA 3UCUP 1GQEA 1RT6B 4CZJA 3UQSA 4KJIA 3FR0A 4BWJA 3DLKB 4HR2A 3VVUA 1LWEA 2GZOA 2LU1A 4WFXA 1NOYA 3HI0A 5FPMA 3V4MA 3NF8A 3EUNA 3PRVA 1DRZA 1CVJA 3OR2B 4JV5F 5DM6Q 4NE9C 1P9QC 1XHXA 4ELTA 2D9PA 2M5YA 4FLUA 3TSPA 1P1LA 3TSUA 4E7IA 4CEFA 3GB0A 3M6GA 4IG0B 1S1UA 2YKMA 2Y8YA 8RUCA 4QU7A 2KZZA 1FRXA 3WNEA 3M8SA 2UXBF 5L1LA 3LH2S 2MSSA 1H6KX 1YIJS 2YTCA 3W2WA 4G1QA 4CJUA 2AJFE 1VQ5S 3FSYA 4X4PA 2K3KA 5KFOA 3GIRA 2ROPA 2J0SD 4Z4HA 1M5HA 3TTDA 3IR7B 3MR5A 4WJBA 4FPAA 1FK9A 5D8HB 3GL1A 4J9OA 3PCOB 3VA3A 3B6PA 2NRZA 3A3NB 4DSEA 1YHQS 1FKOA 1WSEA 3CGIA 3J7AN 2KYZA 4DV0F 3QICA 1S79A 4GVEA 1FDNA 2KHCA 4BRGA 4CLZA 3OHBA 2LMIA 3HBTA 1HKBA 5J1EB 3O9UA 3GE9A 1DQAA 4CLLA 4IQXA 3T41A 1KHVA 1S1WA 1A7GE 1NJXA 3MR2A 2JEFA 2AYMA 3M3ZA 1S9EA 2YWGA 1DTTB 1PJ6A 3DOMB 5HVFA 3OYAA 1HJOA 2XI3A 4CJQA 4RNNA 4B3TJ 2O8BB 3DRSB 5J2PB 2H3EB 1QTMA 1HNVB 1GXLA 1NGBA 2J6UA 2QWLA 3VQ8A 5IS2A 1RTDB 4LFBK 4H4OB 5HK4A 3QIOA 1JLEB 5A8WA 3R9PA 2C28A 1BUPA 4FJKA 4KB1A 4E1JA 2XS2A 3CQXA 4DL5A 4XIUA 1VQ4S 2V9KA 1RCHA 4FJHA 2KHDA 4YN3B 3J7A1 4FWKA 1IBKF 3ZSYA 3CC2N 4OI0A 1NWKA 4Y00A 1XEZA 1IVZA 3MUTP 1ZBHA 1TQLA 2DGTA 4QIFA 3LDSA 1MWYA 3NGRA 1AA1B 1I5OB 1R3NA 4IG3A 2FLNA 2MZQA 4J9NA 2IAJB 2MQ8A 5BR8J 4MQ3A 3LOUA 4TY8B 4CVNE 5M1NA 4JK9A 2VQFJ 4N8OA 3DXSX 1YITN 2QL9B 3DXMA 1S72N 5CABA 4WBFA 2DR6A 1F6TA 3L8BA 1VJWA 3GU0A 3M7VA 3OA9A 1I39A 3C6HA 4ZK7M 3PJWA 1KC8O 4S0MA 5KFXA 2BUNA 2FVSA 1DY3A 5C2FA 4H0OA 2UV8G 2MTLA 4HH1A 3RBZA 2V4JA 1WC0A 3KNAA 4KC5A 4ILHA 4LFBF 2VG7A 2ERRA 1VQMS 4AHTA 3TANA 3OFGA 2A10A 3EDRB 3W65A 4Z4GA 1SJFA 4LBIA 4NYZA 4KT0C 1EIYB 3NNHA 3FZKA 3UN3A 3ISND 3K89A 3L3UA 2H5JB 1X4CA 3SUQA 2L3MA 2HHQA 2ZM6K 2GJ2A 3O6QA 1GMVA 4CNYA 3EDQB 1NKCA 2BR0A 3QIPA 1YIJN 2HNYA 3G8QA 5DGAA 5HATA 3BKFA 2JRSA 2IJNA 1ZBSA 4IUFA 3O8MA 4ETZA 2PAVA 3HMJG 2LXUA 4BRHA 1RHJB 1HPZA 2LQ5A 3ZEUB 3MECB 3VEOA 4Z0UA 2FJVA 1YUWA 4NLTA 1YHQN 1VLYA 2P5OA 1YVFA 3U02A 4FK4A 1MU2B 5HP1A 1XHZA 4BDZA 3B8AX 3I9ZA 1YJ7A 2O1PA 2YVSA 4EZ6A 5JS2A 5JICA 2VA2A 4HYKA 3MCMA 2WUSA 1M1HA 1R0AA 4CD3A 4O5BA 1Z26A 3MEGB 3MAAB 3SV4A 2Q0RA 2QM1A 4QU6A 2C2RA 3KLVA 2CJAA 3BGFA 4BQLA 1NZ8A 1P90A 4CGHA 3HM9A 5EWEA 5D4PA 2Y1RI 4H5VA 2VDHA 1FXXA 4KGKA 2C2MB 2RILA 4DPTA 4ZITA 1HWJA 5DM7L 2RU9A 4OYOA 2ZM6F 2RDIA 4LF7K 2A3ZA 1MSWD 1F2HA 4WK3A 2XMWA 3G8SA 5JLFA 1VQ4N 1NRKA 3CMAS 2HNZB 3RMBA 4WXOA 2G0JA 2JDJA 2QC3A 3BEGB 3MDQA 3AO3A 2CUYA 4OKJA 1RT4B 3EMTA 4EP5A 2P51A 1CJUA 4BRPA 4H0VB 3AGRA 3R5BA 3TAQA 3SBTA 2QZ8A 4DL7A 4X62K 1LQ9A 2B4UA 4QS9A 3EZOA 1NLKL 1LK7A 1UPMB 1JLCA 3C6UB 1VC5A 2OAUA 2WZ1A 4JK8A 3KWIA 4I6YA 1KQSR 4DOZA 2YJFA 1WORA 3M8QA 5D4NA 3CCSN 3CCUN 3L2RA 4TY9A 3NNCA 1S4EA 1VFJA 3T9ZA 1RAEB 1W2IA 2D0PA 1HD0A 1XR6A 1ZM9A 1FWPA 4OVLA 3DDIA 5AQGA 4M41A 2UXBJ 4TU9A 4P6QA 3JSYA 2G8KA 4XDDA 4B17A 1RUSA 2Z0GA 3R5AA 3MM8B 3JYTA 2Z1IA 4NA3A 3VEVA 3LDQA 4FVUA 5DG8A 1GTEA 4YB5A 3TTCA 2RDDA 3L6QA 3V4IA 1VQMN 4LF7F 3ALYA 4WQ5A 3RRGA 4I56A 4CH7A 2QA4G 1RBTA 5L38A 3KDNA 4ISEA 3QAUA 3SSSA 2AD9A 2XGQA 1RT5B 2PA8D 4KHNA 1VRUA 4M95A 2ZITA 3T9NA 5KFWA 3RR8A 1T94A 4NXMK 3JB9k 3DGVA 3WDOA 3VZHA 3HKWA 1S1VB 4RW8B 3PEJA 1TV6A 3VQTA 4OHWA 2X74A 2VU5A 2R7WA 1WHVA 1IR1A 2X1BA 3UKRA 2GVZB 4EMDA 2FBTA 4YOVA 3U8XA 4OL8A 2B43A 3L0QA 1J9AA 3GR1A 2NXUA 3TO8A 4ZVEA 3O4WA 4K0KJ 3KKSA 4PG5A 4ZLJA 4P72A 3E01B 4CK2A 1FESA 4DR6K 2X7IA 3J7ZO 2BXJA 3K5PA 2VICA 2JFDA 4M42A 1S0OA 3QMLA 2LDYA 4WYLA 1Q81T 1RADB 4DI6A 3MM7A 3CJKB 3ZO7A 3IFRA 1CJVA 3QETA 1NU0A 2DXEA 1H2TZ 3D66A 3TUJC 2BE2B 4GNIA 4PXBA 7FDRA 1HBOA 3OYIA 2JLEA 1ZTTA 2WOMB 4W98A 1HBNA 1F3FA 5BRFA 4DS5A 2YNFB 2V50A 5AQZA 1Q8KA 2HGLA 1ASUA 2HS0A 1WC4A 2DHXA 4YDUA 3P5TL 4Y2KA 1FKPA 4TLQA 1SC6A 3LP1B 2C3OA 1ITPA 1VBZA 2XCAA 4B3OB 4NXMF 2AJ2A 1DT9A 4TYAA 4E8UA 4CH1A 1VCTA 3CMAN 1ZETA 4BE2A 2QA1A 4BR0A 1B3TA 1NSPA 1KDNA 5KT3A 5L9XA 1PKUA 1NJWA 1JNZB 4NEYA 2DIVA 4C23A 2I8EA 5GVQA 1W0HA 4RPFA 3GFZA 2JEJA 4EFAC 1NMEB 3GBTA 3DJCA 1EX4A 2XMVA 2DXDA 2GVDA 3FCWA 2VC0A 1HLUA 2E1RA 4ID5A 1LFWA 1NDPA 2IGIA 3BDEA 1N36K 4LFBJ 4A2AA 3GV7B 1TKTA 1IBMK 1RTZA 2LQ8A 3M9NB 2KLAA 4LF5K 4ECZA 3F73A 2AYBA 1JCGA 2UP1A 1Y00A 4LRBA 3D67A 3T5KA 4YR3A 4X4OA 2VGNA 4KV8A 1V5VA 2POKA 1JJ4A 2KW4A 4PHTX 3BF4A 4DG1B 3IP0A 1S9GB 3TVYA 2XLKA 3HI9A 3CT9A 3VTIA 4X65J 1I3AA 1B0PA 1KNZA 3PJ9A 1N5VA 4DUZK 2D3UA 1HR0K 3O8WA 1A5XA 1S6PA 3IXQA 1ACMB 4JEPA 3T19A 3CD6S 4HKQA 2RF2B 1RHMB 1X3NA 2UYTA 1Q18A 2QMUB 2IC3A 2XBPA 5CZXA 3Q8PB 4HTJA 2J9EA 1TFYA 4KO0A 1HQUB 2BGGA 3D45A 2DB1A 5I3QA 4DDFA 3KLEB 2XNRA 4DF4A 2MKKA 1SJ1A 1H38A 5GAEP 3QMQA 1Q8BA 1TL7B 2C22A 1HWKA 1N36F 3TJAA 3O9RA 1BO5O 4DLEA 3BF3A 3A13A 1UL3A 1IBMF 1HHQA 1DAXA 5CYMB 3DLEB 4OYXA 5BPLA 2XY6A 3L7OA 3T6JA 2RSQA 4FNIA 4LF5F 1QHTA 4FWSA 4CF8A 1LNQA 4BQZA 2D41A 1WSRA 1C0TA 1ZAWA 4ZJLA 4OX7A 2HWTA 1R6VA 4DV1F 2I7PA 1CXUA 3DLKA 5EX3A 3BQ2A 4FN5A 1Q82O 4P2MA 2RS8A 1QVGM 2QMXA 4GVBB 1UOCA 1KVJA 3DGPB 3OR2A 4H54A 5ETLA 1GLBG 5B8HA 2FJDB 3NGIA 1VMBA 4DUZF 2ZH4A 3HCXA 1HR0F 4FL9A 1I3OB 4K7QA 3SK3A 1UJ6A 2MGZB 1VBXA 1N0VC 3VZIA 5DGBA 4K4TA 4ZVGA 4JI3J 2DNRA 2W2PP 2R8GA 2LU2A 2WW4A 3IM9A 1BISA 3OHRA 2QFIA 1FXDA 1MN7A 5ELZA 4DFKA 1Q53A 4IH5A 3BN7A 4OX8A 2KRBA 3SJHA 4K8XA 4MYTA 3ZX0A 2DHAA 2RHQB 4J5OA 3HSGA 4DCJB 4BVOA 4FP9A 3V5RA 1RILA 1Q8IA 3GG4A 3JTPA 3UDEA 3C95A 2E7VA 4B02A 2XCPA 3KD1E 3CPEA 3LTOA 4IBNA 1W25A 2DNKA 2UXDK 3ZT1A 1VQON 1WOPA 4LF7J 2P9UB 2Z56B 4P7TA 4X2BA 5J1EA 3M1FA 4C8MA 1Q79A 4WYWA 1PJ5A 4MT1A 2B4OA 3CCZA 3GIMA 4K4ZA 2V2ZA 5D4LA 3DOMA 4HHTA 3JAMO 1KQGB 3OYKA 2O8BA 3DRSA 5J2PA 4OYWA 3SQ2A 4LFCJ 3IN5A 4CJKA 1NGCA 3HO1A 1HNVA 3LQVA 2AF6A 1N5SA 2XZWA 4QWEA 3L7PA 1RTDA 4X62J 4ZVHA 3AA2A 2ZZTA 4N8NA 2PI5A 4H4OA 3W9JA 1JLEA 2N4DA 2V5HG 1MNEA 3ZT3A 4ECYA 5IM0B 3J7YP 3CD6N 1GLAG 2DNNA 4FLZA 3QAEA 2O5DA 2RJZA 4O3RA 3TP2A 3M6UA 3ENWA 2CGJA 4E0DA 4RNFA 1VR6A 1URRA 4LF8J 3P96A 2JFKA 3SCJE 4DV5J 4LT6A 1Q8LA 1HIYA 2Z2MA 2IAJA 4BLGA 3U3GA 5A2QU 2BE7D 2MJUA 2MZRA 2P9LB 2BMBA 3PFEA 2UXDF 4RX6A 3OVSA 1XUPO 2EI5A 5GAHU 3EO3A 2GAHC 3IBCB 4MYUA 1QSLA 4FS2A 4Q0BB 2GIQA 2Z2LA 3KIOA 2VDIA 1BY9A 2MHEA 3CJ9A 1K47A 3MCPA 2WCXA 1SPBP 4LC9B 4RG8A 3MEEB 1LV5A 2BEFA 1IKXA 4Y65A 3Q2TC 1YXQA 3R8EA 3AVBA 2XWYA 4OV1A 1NJYA 3QT8A 4HHHA 1HYSB 4M3UA 4ZCIA 1JJ2M 2BYCA 1AZSB 1X9SA 2XB2D 2M9KA 3KLGB 3T69A 2EG2A 3GTYX 2EFNA 3CYMA 1D9AA 4C97A 1PILA 3OYNA 3ZTPA 1H0HB 4AL6A 4NLWA 3PFOA 3RAQA 3CJ0A 3EWGA 1T6CA 5TKYA 3G6EN 4USMA 2A2CA 2AYGA 4DR6J 3K7RA 3QESA 2E2PA 2YNIB 3MTKA 1L5UA 2A2DA 5AE3A 1VQSA 2YWFA 1OY6A 3G10A 2FTRA 1NPPA 2XLJA 2E7WA 4PPZA 2JX2A 1ATRA 3AJDA 5E41A 4I2PB 4RW9A 4DTJA 5M1QA 3KG4A 3ZEUA 3MECA 4DN0A 5K8OA 3UVJB 4E3SA 3RMDA 1HARA 2FJBB 3B6OA 1CLQA 4FF4A 4CLSA 1MU2A 4K4YA 3HF5A 1YJWS 1XTZA 1D9FA 3R6GB 4A2BA 2GS8A 2EC2A 3MEGA 4IYQA 4QR2A 4DR4K 3IS9B 3MAAA 1D09B 2BJ9A 1SZ2A 4A46A 4M3XA 1NHUA 2DIUA 3RMCA 3CF5L 3JQKA 3TW0A 3UKUB 2H5EA 3TOQA 2YX4A 4CO5A 3SCKE 3SNNA 5H1SQ 3MWTA 4PYDA 1MA9B 2VFVA 1S0MA 4LJMA 2CQ3A 1WEYA 2PC6A 1SC3B 4O3NA 1UZHA 1KCFA 1RGVA 1TTHB 2XC9A 4URQU 1YRXA 1W9HA 1CULB 3IMXA 1C1BB 1IBMJ 1KAYA 4KTWA 4WXWA 3SMPA 4NYOA 3PRDA 2HNZA 4LF5J 4Q8FA 4HWIA 3PACA 3PW4A 3NWGA 1XJWB 2HBZB 2NSCA 2KM8B 4W92B 2XMUA 2H1YA 2UV8A 5C12A 4YOYA 1IM6A 1HBUB 1SCJB 1VBKA 4ZLPA 4IO1A 1V4TA 4GC6A 4DX8H 3M2RB 4NCAA 2UUCK 3TQEA 3H7HB 2HS4A 3BGRB 4CEDA 5D15A 2AWZA 4O23A 2NQPA 1GH8A 3C6UA 1NOZA 2RN2A 4J9KA 5HANA 3KKRA 4CJ5A 2PIIA 3MMBB 4EEYA 3IAYA 3LM2A 2HFOA 5KFQA 3BBBA 3BSOA 1WNEA 5FDLB 2B56A 1T02A 4QPTA 4DR4F 1B64A 4IDHA 4F4YA 3VQ5A 2JVOA 1EO1A 3F2KA 4ANDA 1M5PC 3M6WA 3MDFA 3T3FA 3C16A 4ZCLA 3N6NA 2R8HA 4OLBA 2B7CB 4CO3A 1VK8A 5E84A 3FGUA 4JYAK 1N34K 3PW7A 2DVIA 2HBKA 1MMLA 3OR1B 3HL8A 2ALZA 4HDHA 1RT5A 1JIHA 3HOTA 5FJ4A 5FRMA 3U4LA 3QZ8A 1B4SA 3CJ3A 2F9JA 3CJ5A 4E7JA 3QWPA 4C0OC 4TQRA 3DXKA 1FE4A 1EB0A 2K06A 4FKYA 4K42A 4ED6A 2ZH2A 2O4GA 3D2FA 3THVA 1S1VA 2HHPA 4HACB 2OI2A 1EKRA 3OYLA 3QFHA 4ZPAA 1CXQA 1IV0A 1Q16B 4CD1A 5H9FK 3ZETB 2GVZA 3OYJA 1RNHA 2QWNA 2ZH6A 4ILJA 4FJNA 3D2EB 2HK3A 3E2EA 3KG0A 4NXNK 2DRDA 3E01A 4M5KA 3O6WA 2WBRA 1Z6RA 1RHUB 1YJWN 3D68A 2VYPA 2ACYA 4NYFA 4Y3CA 1N54B 4KSEB 2HIYA 1WSIA 3Q8QB 1AT1B 2KL8A 5T7LB 3C14B 3CJKA 2DR9A 3Q8UA 4RW6B 3CF5Q 2BE2A 1P9YA 3DOKA 4F3MA 3O9TA 5C25B 2J9DA 2WOMA 1TUVA 3CFOA 4JYAF 3CIZA 1N34F 4AL5A 2YNFA 4ECTA 2HHHK 3EGWB 1Z05A 2NRWA 1RAAB 3VQCA 3T1HK 1FJEB 4IDKB 2DD8S 3BH7B 3QSYB 4DHYA 3AVJA 3GJTB 2RQCA 1NG9A 1TKXA 5CR4A 4NMLA 3LP1A 2ROGA 1Q7YT 2OELA 5HQLA 3EE3A 5K8NA 1WLJA 4B3OA 3GIKA 3CCMS 1W26A 1C1AA 5IWAF 4YOWA 5E0OA 4FS1A 2XYHB 2R8IA 3QFPA 3PW5A 1RBOB 4O3PA 4DSLA 1B0VA 5AJ3K 3TEGA 3MPYA 1RDDA 1T7PA 1P1TA 2CPXA 4EBCA 2NRRA 4ED8A 2DHSA 4OKKA 3LL3A 3O3GA 1C0UB 3H8YA 3ZSWA 3TUZC 4HCBA 4JI5J 4NXNF 2YQ1A 3GOIA 4JI8K 2ZGZA 1LCUA 3KWGA 2Z4PA 1SQGA 1PAUB 4OPAA 2UUAJ 2IVNA 2UUWA 1RDCA 2XS5A 1WOOA 4DV2K 4C3KA 4F4AA 1RAOA 3KUHA 4GVLA 3QBWA 4BG9A 3JAMY 1C0GA 5A6PA 1RE1B 2OD6A 2EFVA 2HRUA 1UJ4A 1V3SA 2VBYA 1WSJA 4H0YB 1D5AA 2QWRA 1FJGJ 5B0DA 1S9GA 2ZOFA 4DUTA 3T1HF 2F8TA 1D0EA 1M1KT 3IMQJ 2EC0A 3C0BA 2ZKTA 1O1WA 2IBOA 2PSZA 1YVNA 3RGIA 4FSVA 1XC9A 3B4MA 1QVFR 4HCCA 4LRDA 3BPDA 2LFVA 4H0PA 2W6KA 3OS2A 4IZ9A 2RF2A 5M2UA 5J2MA 3P6YC 3GIJA 2Z1GA 3EEQA 5HSPA 3Q22A 3PZPA 1FNOA 3SSQA 3QJLA 5AJ3F 2KT3A 3N5FA 2DFEA 2ZZMA 4YQWA 1RTJA 2OO4A 1HQUA 3J8AA 2HOEA 2E20A 2MY8A 4CJ4A 4JI8F 3AVIA 5GMEA 1P6TA 1VQKN 4H5RA 2WVCA 1TL7A 3CERA 2EW9A 4RNOA 4L76A 1FRMA 5LM7E 3B8HA 1GLEG 1CQMA 2RAQA 4DV2F 5CYMA 3DLEA 2W9BB 3CCJN 1E6VB 2HQFA 2R2RA 1OY8A 4BGAA 1UFWA 3R27A 2ASDA 4DX6A 2Q2RA 3QO9B 2G2OA 1FX4A 4LVOP 3W2VB 2CH5A 6FD1A 4IEIA 2F5GA 1ITGA 4WP9A 3MPVA 2D0CA 2VL1A 4GVBA 2NPIA 5F0WA 3QIDA 2OZSA 3DGPA 1HA1A 2CQPA 2XNQA 2HKEA 3QNWB 1FW6A 4FWLA 3OSPA 2V4QA 2N7YA 1MMNA 2R7QA 4E19A 3J81U 2MGZA 3KFWX 2AQ4A 2OH2A 2QA4S 4P73A 3SXLA 3S3NA 2O8DB 1CLFA 3RWUA 4IFVB 4K41A 4BY9C 4W5NA 1IBLJ 1XMBA 3QFWA 1Y4ZB 4BCAA 3CCMN 1RZMA 1LW0B 3AA5X 1KTQA 4ECWA 3ID8A 5BRDA 2R3VA 3EVWA 3SJJA 2LECA 1IKYB 4Z37A 3CJTA 5AQOA 3ZFVA 4CIEA 3ITHA 2CQHA 5GMDA 3OL7A 4XH4A 3AY9A 3MXMA 3OUYB 1N8RT 4EGLA 5E3QA 2N7CA 3AA4A 2EX3A 2ZC3A 5CHCB 1WB9A 3MOJB 2X78A 2KB2A 5GADU 4PWWA 4K2JA 2P9UA 3AVHA 2XLIA 1VJQA 3L3VA 4CO1A 3ZZTA 5AE1A 1WD6A 2PDAA 2W25A 4C98A 2FHKA 5E2QA 1YI2N 4NLUA 3MCSA 2AV5A 3IO1A 5A2QO 3DWLA 3OYMA 3VALA 1J27A 1QS4A 3CIMA 4GV9A 1JXBA 5ETVA 2UUCJ 3D0GE 5ETOA 4D3GA 1QTNB 1BC6A 3QPIA 1JLFB 5ETRA 2E7XA 3M8WA 1EZZB 2HHUA 2E2NA 5IM0A 3R1XA 4FJMA 3MM6A 1NGHA 2R2SA 4F3TA 2XMJA 2OEKA 1UVIA 4ZPTR 1R8BA 2A40A 4BR5A 3UN5A 2P9IA 1IKVB 4OPKA 4LFAK 4OGEA 4Y28C 2AJ0A 3CDBA 2ZGYA 3BGUA 3V6JA 4CCHA 1QUPA 2FJWA 2ADCA 5HN0A 4M3YA 2C3UA 2W4DA 2X51A 4WU3A 3BH6B 2P9LA 3BUZB 3CTRA 1OH6A 1RHRB 2R7SA 4MTPA 4Z4FA 1VHIA 1BHNA 4DPYA 2QSFA 4M3TA 1CC7A 2X1GA 1T9TA 3GP9A 4Q5VA 4Q0BA 1F3VA 1WF0A 1U1KA 5I3UB 4UY85 1RYRA 2M8DB 2HS3A 3BQ1A 3TARA 1WF2A 2JL9A 2YHYA 1UCNA 4FW1A 4CJEA 3CCWA 4OYZA 5BREA 1YBTA 4U7UK 3H0PA 1ZA2B 3MAHA 1GOAA 2VPZB 3NMRA 1FRIA 2F65A 1QSYA 1SIWB 2I38A 4X4TA 2Y0BB 1FT8A 1HYSA 4F4WA 1AZSA 1XK8A 3KLGA 2YPZA 4LF2A 2DR5A 5H9FJ 5HROA 3OW2M 1R31A 4IH7A 4J2EA 4ZTFA 1ICEB 1FERA 4JI4J 4P2FA 4YR0A 1HRHA 1KAZA 4NXNJ 2YQ0A 3HVAA 3BP8A 3J7AP 3OJSA 3GJQB 2WC9A 4TLRA 5KFFA 5HQ8A 4LFAF 2YNIA 1R0BG 4FK0A 2YWHA 3AVKA 3KHYA 4BC5A 3FDSA 2PMZD 2BQRA 1BWEA 5KQ8A 3L2UA 5KT6A 4QWDA 4I2PA 3UE2A 4I6MB 1EAYC 2YWWA 3VGSA 3QBXA 4PY5A 3TI0A 1Y3KA 4UUXA 3UVJA 1FRLA 3S3OA 4PQUB 2HHHJ 3R7BB 2V52B 4AXJA 1RBUA 1H74A 3K17A 1BQXA 3V9UA 3BYPA 5D3GB 1TUGB 2JWKA 2NLXA 1DQ9A 4WIQA 3ZCMA 5LOQA 3OYBA 3ENVA 4YB6A 1REVA 4ALZA 3IS9A 3MMVA 3L4BC 3G6XA 3WZ0A 3PJXA 3QRPA 3FBCA 4NZ0A 3UB5A 4ZCKA 4KH1B 3UKUA 2YH0A 2BM0A 2GEMA 4W90B 3OTOK 4DTMA 3PO5A 3SLCA 4X4VA 2ZKUA 4MK8A 4FPRA 3JTOA 1XC3A 3O4NA 3CM6A 4OJRA 4CHPA 1CULA 4K2XA 1BG3A 1C1BA 2OIHA 4B9SA 2HVIA 3BQ0A 1SAZA 1VSHA 2ITMA 2LVWA 1BXNA 5KFAA 5M1PA 4OZ1A 3TYTA 5LXYA 2P9GA 3HHNB 3LA0A 5BXIA 2OA8A 4TVAB 2BX6A 4LSLB 1UA1A 1FTRA 3SCLE 3G71N 1B0TA 1REGX 1RKIA 4CIOA 3K2YA 4PKIA 1HBUA 3IRXB 5JMVA 3G2XA 1TL5A 3MM5B 1Q9YA 3LAKA 1ZBFA 4PL7A 4M3ZA 3BGRA 2N3OA 2QG9B 1TUWA 4XK8C 4R8UB 2DNZA 4CF2A 1RSCA 1XNRJ 2AHOB 3VGLA 4U96A 5KQDA 3DLJA 4JS4A 1IG8A 2LKZA 2QV6A 2QRRA 1S49A 3GFXA 2D3OR 3H1VX 4R5PA 3RU0A 4FXWA 4WE1B 3NOCA 2J7UA 2Y1LB 2A3JA 3NF7A 4BROA 4YR2A 1HNXK 3U27A 2J7KA 7FD1A 3KNGA 3EZ5A 4V19X 4BBYA 3KJVB 1PYSB 3OTOF 4I6AA 1HI1A 3NAIA 3OFEA 1S76D 2Q6BA 2HHTA 2CPDA 2ILYA 4CP5A 5CCMA 4GKJK 1S59A 2PE8A 5GADI 2ZC4A 3NH0A 4CTAB 4HHJA 1JJ2R 1HYVA 3ZSRA 2HBJA 5B09A 3OR1A 2KJVA 2IYIA 1CJKB 1QDUB 4ZPCA 4Q45A 4LF9K 1HNZK 1WG4A 4OMFG 2NRXA 3TR5A 1YZ6A 4DQPA 1E4FT 4MKVA 2UVWA 2X6SA 5H9EJ 3D6RA 2IDOA 4CZIA 4JBCA 1Q81O 4CIGA 2FUG9 2HHSA 1EKSA 3WIVA 1OH8A 5IZHA 3HOSA 4HACA 2CPYA 2MKYA 4EWTA 3RR7A 1R8HA 4HI2A 5EDWA 3ZETA 3VF4A 2FIUA 3OVNA 2GIFA 3GYNA 1W7AA 4PG4A 4KHPK 3D2EA 1VSFA 4UQTA 3W8GA 4DU7A 3RSEB 4J9VA 4WF9L 4JKAA 2CZ4A 2QX0A 1H2UX 1YKWA 3ULEB 2DRBA 2QT7A 1HNXF 2ZJPL 4RBVA 3BY5A 2MEWA 2XHWA 3V81A 4A8YA 4UQGA 5HOOA 3M2UB 3BF1A 3QEWA 1O0PA 3ONQA 5T7LA 3C14A 4DPUA 1K0TA 1RWPB 1ZPWX 3L4QA 3GG1A 2ZNYA 4GKJF 3T5JA 1JKHB 5C25A 3TR8A 1T9UA 2GWKA 3H5SA 3BGLA 4H0XB 4ETXA 2B6AB 1FWLA 1WTBA 3VHQA 1RU1A 3DAWA 3ILOA 4LF9F 3UCZP 3F9KA 3FFIB 1HNZF 1H7WA 3L7UA 2XMTA 4K5RA 2CQCA 3TJ9A 2FC0A 1SJ3P 4IKAA 2ZH3A 2EBEA 1SJ4P 2JOQA 2C2ZB 5DDQC 1IO2A 4FXDA 3MZIA 2K7JA 5BYRA 1WEZA 3P38A 3RYLA 4FYYB 2E66A 1HNWK 2QGFB 3Q86A 1MW7A 3HVWA 4PWUA 2V8DA 3TZZA 2XWXA 3HZGA 1NGFA 3IGNA 3CUNA 3DI6B 2QXLA 2BUPA 4LVNP 1EWRA 3HX9A 4DV3J 5L1IA 2FSKA 2YWEA 3LPEA 3CM5A 1UEKA 1UETA 3RW7A 1RKJA 1KS2A 1C0UA 3BBCA 4MJKA 2ZH8A 4JI2F 2Y1IA 3PG9A 5K8PA 3UIQA 4U8VA 1K1SA 3WXJA 3HVRA 1RDBA 5BPNA 2Y8WA 4ED7A 3FSIA 4GRSA 3FFKB 4UOGA 3C6TB 3O9SA 3AOCA 5AR0A 1NK0A 4XPCA 1SQFA 2ZZNA 1EQ0A 3I31A 5KFJA 4YHHJ 3ZTQA 4NO7A 5F8HA 3P8BB 3P31A 2D0OA 5BYSA 2U2FA 3D4JA 1JWWA 2JWLA 1U8WA 3CMES 3C66A 3DFEA 4MIWA 3DLGA 1IN0A 1XQSC 4KAIA 1RBSA 3ZZUA 1K8AT 1YGYA 5CYJA 2VIHA 1UJ5A 2HFSA 3L2WA 3W64A 1LWFB 2MKJA 1AW0A 5SUHA 1XMOJ 1FA0A 1WUUA 3OYCA 2W2NP 2F9TA 1WOSA 4KFBB 2FJXA 1T95A 4CLUA 3BS9A 3HXMA 4N76A 1HNWF 2NZTA 1FKOB 4LBPA 2IMOA 4M5HA 4RNHA 4AHRA 3MUVP 1H73A 2FZGB 4LY7A 3KUGA 1HHSA 4HL9A 2E9TA 4CEQA 2IY5B 4PG8A 2C2KB 2O66A 3DLLL 2HAFA 1VQ6S 1DBDA 2PI4A 1WSHA 1S1WB 4NOHA 1UWAA 4M3RA 4USTA 2VPYB 1K8KB 5GIPA 2W2OP 2EFPA 3J81O 4DSKA 1VSMA 2I1RA 2AW0A 2DNPA 3FMBA 4CEZA 2QFJA 2E6LA 5AQPA 1ZTWA 1T9VA 1UMJA 4B9MA 4JRQA 4A61A 2PYLA 1F21A 3ZNUA 2SXLA 2W9BA 2QL5B 4WF9Q 4HLBA 1E6VA 2A1SA 2CRLA 4V19J 5CHIA 5I42A 4CEBA 3OYEA 3AD7C 2ZJPQ 1ZC6A 2B9WA 5A8WB 2MLZA 4OZ5A 1RA6A 4JI6F 3W2VA 3M30B 2WB4A 1M5KC 4A62A 2NRTA 4MDBA 4NYPA 3QT5A 1CS4B 3CFRA 3NF9A 2KFYA 5HAOA 5C2GA 3W9IA 4FZYA 3AAQA 4JLHA 4ZP8A 3NGKA 3HSCA 3LPYA 2ZJQQ 5I4MA 1RAHB 4F36A 1VS3A 5F8LA 8ATCB 5LSOA 3H42A 2O8DA 1XNQK 4P71A 4IFVA 3E9PA 3LPTA 1APSA 4LF6K 1N6QB 4FCYA 2GIRA 3PW0A 1WTFA 1LW0A 2VD3A 4KB0A 1NHVA 3I6PA 1Y97A 4B1WB 1QHAA 3R3LA 4O8UA 3HP6A 3FSXA 4XAKA 3CCLN 4M5JA 4BHQA 4GO5X 4BE0A 4NA1A 3KHGA 3OUYA 9ATCB 2ASPA 3PHTA 4KH6A 4W5OA 3QWUA 4ZMMA 4ZKAA 2V4JB 2JEGA 2V8VA 3GILA 3DHWC 3SV3A 3LWMA 2MKSA 2NXEA 2CPJA 3DN9A 3L2QA 2UU9J 1WKLA 5AQIA 2AMCB 4M45A 2R2TA 3HT3A 5KFIA 3O1LA 3K0SA 3UWTA 2K8GA 1VRTB 2YJEA 4ELVA 4KTZA 4KI6A 1AROP 2MZSA 1ROFA 3A12A 3CMEN 2HNYB 2DEIA 4JKDA 4G1IA 3C15B 4ICLA 4CI0B 4JUZA 4WZMA 1AFJA 2GJIA 2AGQA 1LXJA 4M3WA 4ISFA 2FQQB 1A5VA 4YOXA 2MB0B 1N32J 4CGFA 2YX6A 2XYPB 5AQXA 2W4PA 1EQYA 1J2VA 4LF6F 2R7OA 4FNHA 1TMJA 5M1FA 1HJRA 2JVRA