4WFAL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with linezolid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfaL01
5DM7L 1KC8O 1VQ4N 1VQ6N 5JVHL 3CPWM 4WFAL 2ZJPL 1YI2N 1VQMN 1W2BM 1NJIO 3CCUN 1YJ9N 3CC2N 4WF9L 4IO9L 5DM6L 1K8AO 2ZJQL 1Q82O 3CCLN 1VQ7N 5GAHP 3CCQN 4U67L 5HL7L 1K73O 1VQPN 2QA4N 1VQNN 5MLCQ 4UY8O 3CXCM 1M90O 5GAEP 3I55N 4WFBL 1N8RO 1VQON 1VQ8N 2OTLN 4WCEL 3CF5L 1YHQN 3CMAN 3G4SN 5JVGL 2QEXN 1Q86O 3CMEN 3G6EN 2ZJRL 3CCSN 1KD1O 1OVYA 4WFNL 1QVFM 3CCVN 3PIPL 3I56N 1KQSM 5GAGP 1VQ5N 3CCMN 4IOCL 5H1SQ 3OW2M 1M1KO 3CC7N 3G71N 3CCJN 1K9MO 1ILYA 1YIJN 1VQ9N 3CD6N 1VQKN 1YJNN 1JJ2M 1S72N 3PIOL 3CC4N 3CCEN 4IOAL 2OTJN 1YJWN 1QVGM 1Q7YO 1Q81O 5GADP 1VQLN 3CCRN 1YITN 3J7ZO 3DLLL
chains in the Genus database with same CATH superfamily
1RFQA 2NRWA 5F2RA 4H5WA 1X3MA 3RR7A 4JI8K 3R3LA 4O5BA 4C23A 3DOKA 3ZSOA 2XY7A 1E4GT 4B9UA 3V1OA 4IFEA 2D4WA 5AQMA 4CJRA 3V9XA 1BCMA 4OKKA 3QFPA 1NKBA 3SUQA 3KD5E 3QESA 4DWIA 1UOCA 3PX6A 4AHSA 5A2QO 2D0BA 3MN6A 3J80O 4DR4K 5AQLA 1C6VA 1SQKA 3O08A 2QA4N 1NJZA 1WSEA 3WXKA 1TAQA 2A1SA 4C8MA 3O4WA 4DQIA 2AJQA 3NF6A 2GWJA 3KLIA 3CG7A 2CH6A 4GKJK 4MFBA 4I9LA 3JS6A 4I2PA 4BC2A 2QWNA 1QZ5A 1Q86O 3M8QA 3AA3A 3HZ6A 2I5JA 2G8KA 2CGJA 2XHBA 3DM2A 4DTJA 3HK2A 3O3HA 1YVUA 1HUXA 5E26A 4CECA 1WOQA 3KJVA 2D0AA 4BRDA 4FLZA 4CERA 4CJFA 4B1UB 3MX2A 4GW6A 3AVIA 1VSFA 5SZTA 1EETA 4B8CA 1ZC6A 5C42A 1CLQA 3G71N 3FFIA 1KVBA 3TI0A 4X62K 4QCLA 3B8AX 4WQ5A 3MDQA 4BQZA 3U4LA 1P90A 1GLJO 3ID8A 3AVKA 3D2FB 2ZGZA 1JJ2M 4BREA 3QBWA 3O9UA 4F3TA 3THVA 3SJHA 4IFYA 1ITGA 3NAEA 2P51A 3ZSQA 5AZIB 3CJBA 2PFUA 4B9NA 3ZT2A 3NH1A 4E19A 4F2RA 3QEIA 1BHLA 2XO7A 4DQPA 2FBVA 2YV0X 2NLXA 2GUPA 1A5VA 3SZ2A 2OCEA 3LDPA 4NYFA 2Q0RA 2NZTA 4CI6A 5I9EB 3NCIA 4FZXC 4B9TA 3EY1A 3IFRA 5AZJB 3ZSYA 1BA1A 1XNQK 3J81O 3F5TA 3OY9A 2ASOA 3OYEA 2A42A 2E4LA 4CJPA 4FK4A 2RE2A 3HSTB 4FW2A 5GINA 4WF9L 3A2FA 3HPHA 2GUIA 1WN7A 3CJ9A 3C95A 5LMNK 3EEQA 4I7FA 3Q7BA 2ZD1A 4JNEA 3IG1A 1BGXT 2P9SB 2IIRA 3O6WA 4A57A 2HHWA 1HJRA 5J1EA 4FYDA 5C10A 1JCEA 1IV0A 1GOAA 4WFBL 4Z4FA 3HVTA 2W41A 4FPAA 1U2VB 3O9TA 2KW4A 5AQKA 4IDHA 4CK1A 4KAZA 4EP5A 2F7TA 3QEXA 3E1YA 5JMVA 4CIEA 1NOZA 4FJHA 2I7PA 2HVIA 3FE1A 4DV5K 4RW8A 4F9OA 3VEZA 3CCMN 1VQ5N 3JSMA 1IKVA 3OW2M 2KTQA 3L3VA 1M1KO 4LH5A 1KLNA 1EXQA 2VQFK 1BWFO 2H3GX 4E89A 5J2PA 3GBTA 1WB9A 4FWMA 2E2NA 2E5LK 3AO2A 3CHWA 2HHHK 4LFAK 4PWDA 4QS9A 1RDDA 4FJJA 4M3YA 3IMXA 4H03B 3PX4A 1K8KB 4CFCA 4AILC 5LJVA 4CESA 4L8RB 1JLEA 4DR5K 4EAHD 1IKXA 3H3OB 3GL1A 1FK9A 4DSIA 3VEOA 1IG9A 1NK8A 3ZCMA 2PAVA 3QINA 5EOYA 1KAXA 1GLCG 2ZQBA 4BVPA 3FZFA 2Q31A 3EO3A 2O4IA 4B9QA 1BI4B 3P5JA 1Q8IA 3WNHA 3C6AA 3LL3A 4DUZK 4KFBA 3U9DA 3LPTA 1WAFA 2P9LB 3SAGA 1T44A 4H0VB 2HOEA 3M3ZA 2Q3SA 1FW6A 1NGAA 1XC3A 2LSNA 4JRQA 1KRPA 5BR9A 4BRKA 4IDKA 4CBXA 3RVCA 5C2DA 1S1XA 5AQPA 3HOTA 3L6QA 1TKZA 5AQSA 3ZT1A 4M41A 1VQON 2HHUA 3WNGA 2AA4A 4BC3A 3EL2A 4OJRA 1D8YA 3CYMA 3LP1A 4DG1A 5KGXA 2UYTA 3O3FA 4BR5A 2V51B 4CZIA 1O1WA 4GV3A 3H3NO 3AA5X 4FJIA 3LZJA 3DAWA 2OPSA 4LD0A 1NK7A 4KHQA 2VWKA 2ZM6K 3CCVN 3DLEA 1VHXA 4Q5VA 1XWLA 1KQSM 2Y1IA 2YHWA 3A5LC 2PZSA 1XHXA 5JLHA 3DYAA 3AA2A 2Q1NA 5AQJA 2E1YA 1X9MA 2OYQA 2A6AA 3WXMB 3M8SA 2UXCK 3FFKB 2HHSA 1MWKA 3IAYA 4AHCA 4DQQA 3OS0A 1D4XA 2W6KA 3VF6A 1NK9A 4FJ7A 4KPYA 1RDWX 3MCAB 3V4IA 1NK4A 3O1BA 3F9MA 3E66A 3BGRA 2BH1A 2FSNA 4GVEA 4BG9A 1S6PA 2O8EA 1ATNA 1C0MA 4IXCA 2P9PB 3ZSZA 4Z94A 3LDLA 3RSEA 2IC3A 3NGZA 3LM2A 3DXKA 3L4QA 2KHOA 4CF9A 3OYIA 1I94K 1BOTO 5DM7L 4DSFA 3C6HA 1QQMA 2YNIA 2NRRA 1RDUA 4LY7A 1IJJA 1YJ9N 4RCHA 4B9VA 1B92A 3H46O 3ZLJA 1HKBA 3O8MA 2HHVA 5LY3A 3ZSWA 1VSHA 4EIAA 3OBWA 2W6LA 4CD3A 2VYPA 4F2SA 4U67L 2RPIA 4WYBA 4I6MA 3O5BA 2G8FA 4X64K 4MO4A 3OHRA 4IO8A 5ADXH 1VQNN 3CFOA 1DTTA 3SAFA 1MA9B 4FJXA 3FZMA 4M3RA 4C8LA 1M90O 3NH0A 2HHTA 3NGIA 3OYMA 1LAVA 4FL9A 3M8PA 4NLBA 4XEIA 4KHSA 3TSQA 3DLBA 3QETA 3SUOA 3KD1E 4BRIA 1BDGA 3AVGA 4N47A 3QFUA 5AFUA 3PV8A 1T6CA 2GX9A 4HCBA 4WFNL 4DSEA 4NCAA 1HKGA 4J2EA 3V9UA 2WTUA 1U45A 2P9UB 5LJWA 4B1XB 1T03A 4Y0WA 2ZF5O 1NGFA 3L4IA 5CYQA 5CE3A 3KLHA 5BN9A 1IBLK 1XQSC 3VGMA 4LSNA 1RBVA 2WUSA 1HPMA 4DV4K 4BWJA 3CJ1A 1ZBHA 1NWKA 1GLEG 2NRXA 4CJSA 1RTHA 1RTIA 3OYCA 4BRMA 1QVGM 4OO1J 1H1VA 3ZSRA 3LP2A 4CBUA 4OPHA 4E7KA 3WNEA 2QWOA 4CGDA 2HBKA 1GLDG 4KI6A 1X1PA 3K0SA 1TVRA 4HTUA 4KI4A 1LW2A 4KV8A 4QOZB 3DLLL 3VQ4A 4WQ4A 4K41A 1KFSA 1LAWA 1S1UA 3AGRA 5JVHL 3O9RA 2VWBA 2YCHA 2ASPA 1TKXA 3DLRA 4LF8K 2PYJA 2YKNA 4HUGA 4NB4A 3DRSA 3SUPA 1RNHA 4QS8A 4DHYA 2BDPA 3HVRA 1L3TA 4ZHRA 4PKGA 1Z6RA 2KKZA 3NMUA 3DXKB 3UKRB 1ASVA 4ISEA 1OH5A 3ZT3A 3NH2A 3S3MA 1HX1A 3KTQA 1ZBFA 3OYJA 1VSLA 5BRHA 5CYMA 2JWLA 1YVNA 3G0ZA 1NGJA 4YOWA 4FZYA 4O44A 4CFAA 1CXUA 4DU4A 3K9KA 4DQ8A 3FLCO 2OPQA 4RW7A 3HP9A 3I55N 3HL8A 2KFZA 1RT2A 4H5TA 1J9AA 3BF1A 4ID1A 3TAGA 3K57A 1FKOA 3ZX0A 2QEXN 1EQYA 4I6MB 2YHXA 4B9LA 1BA0A 1HYVA 4CHYA 1J53A 4CZJA 1HQEA 3O3GA 1WSHA 2ZJRL 3L2QA 1KTQA 3QNNA 1LWEA 3UIQA 5KRSA 2O8CB 4PKHA 4HCCA 1IBMK 4KHWA 4O5FA 3BZCA 1ZXOA 4JK9A 5AQZA 1RBRA 1X9JA 3RWUA 4CHZA 3R8EA 1U47A 4JV5K 4MLEA 1NGIA 4AHTA 5BRFA 4KBOA 3AO5A 2QW9A 3QEVA 4DTPA 4O0JA 1Y97A 4K43A 4CF8A 3VEWA 4FSVA 2Q2RA 2FF6A 3D2FA 1HNXK 4FWSA 4H8KA 4J2BA 1MU2A 4YOVA 4LF7K 4IKFA 1A5XA 4FWOA 2P5GA 2WOMA 3S41A 4DTXA 3VETA 1UWBA 5AQFA 1FKPA 1EKEA 3TARA 3EN9A 4JKEA 4YHHK 4KTZA 4LFBK 3NF7A 3A5OC 3OS2A 3P4IA 4Z4EA 4CZFA 5AZJA 3SBGA 5J2MA 1T7PA 3B6OA 4XIUA 4DKWA 3SMSA 3E9OA 2GWKA 4IO9L 1F21A 4JI1K 1RILA 4X65K 1JXBA 4B9MA 3DMJA 1NMDA 1Q82O 4MO5A 1RDCA 4YOXA 3NGYA 2NRVA 4PA1A 3FZKA 2FBXA 4JI2K 4DV1K 3TAPA 2ZWHA 3VESA 1JL1A 3C0BA 4CJQA 5J2NA 3CI5A 4OVLA 1UAXA 2P9SA 3VEYA 4DSLA 4E7HA 3PLAA 2HHXA 1NNEA 1VQ8N 4X66K 4NCGA 1YHQN 1CZ9A 1SL2A 1VAZA 3VQEA 5JVGL 4BRQA 3CPEA 4N56A 3ZT4A 1CZAN 3OYDA 3CFPA 2FXUA 1U2VA 3MN9A 4JYAK 3HRGA 4AM6A 1V4TA 3ZYYX 3DRPA 1RT5A 2A5XA 4CF1A 4FLWA 5IT9O 1NGBA 2OZMA 4FJNA 3K58A 2NNWA 3H08A 4PKIA 4Z4IA 3OYAA 2HF4A 4Y1DA 3SBTA 4BVOA 2FC0A 4FWRA 1K9MO 4FJLA 1NGCA 3VOVA 4V19S 4CJLA 4E7LA 3LDSA 1QE1A 2AP1A 3RR8A 4FLUA 1D9DA 3T19A 4JRPA 2HBMA 3O9QA 4J2DA 1NK0A 3W0LA 5BPMA 2B4JA 2QWQA 5D3GA 2UXBK 4XH5A 4DF8A 4DU3A 1K8KA 3A5MC 1RT6A 1NJWA 1KVCA 1OH7A 2HB5A 1RDAA 2D0PA 4E7JA 5ADXA 2GBZA 3I0SA 4NXNK 4BRFA 3CETA 4AH9A 2FLOA 3THWA 2WONA 1C0UA 1CXQA 4DR2K 3PX0A 5FPMA 4BRNA 3CC2N 1JL2A 4A62A 1TYQA 3SQ1A 2BUPA 3LM9A 4GVMA 5AQRA 1BI4A 3SLCA 4BROA 2ZJQL 5IWAK 3DRRA 3KK7A 4IJNA 1TUYA 2KLAA 1CZBA 2P9LA 4CJ3A 4JKCA 4KHYA 4CIFA 1YTAA 1Y64A 3AVAA 4DS4A 3BDPA 1D5AA 3QIOA 3I33A 3TTCA 5AQOA 4M42A 4EZ9A 1N6QA 4CJWA 1KXPA 1NJYA 1VSKA 4I9QA 4CHQA 4N76A 1VSEA 3TAMA 1YXQA 3N4QA 4TSXA 4FM2A 5EX5A 3V9SA 1J5EK 2HNDA 1OVYA 4BRHA 2DPNA 3OYBA 1UA0A 1NGGA 4FXDA 4CJEA 4DV6K 4KTQA 4DTUA 4YFUA 3ISNC 4ILJA 2HSTA 4OPKA 1TGOA 2BTFA 4A5AA 3PUFA 1HYSA 4H5NA 1WBBA 1NGEA 5KQ8A 4DTNA 2Y1JA 1BG3A 3M6GA 4K42A 1QZ6A 5AR0A 3I8BA 3SQ0A 1KVAA 5CZ2A 1BQNA 1U04A 3CQXA 3JYTA 4G9ZA 4HUFA 5FRMA 1XUPO 1YUWA 3VA3A 1NK5A 1Q7YO 4BDPA 3T1AA 3N4PA 4E7IA 3C7NA 4DSJA 3ULEA 4DLGA 2IAJA 4BGAA 2P9IB 1MDUB 2J4RA 4N5SA 4GV6A 4EZ6A 4ISGA 4JS5A 4C1NK 1G99A 3VQAA 3H1VX 4B3RK 4KHNA 5I42A 2P9PA 4DUYK 4O8UA 4B1YB 4KREA 1C1AA 3CFRA 1QQNA 4DS5A 3NVKA 5C24A 3OYHA 3RTVA 4N41A 4CGJA 1JLGA 3AV9A 4K25A 3T3FA 3BF3A 3VQ9A 2F8SA 3VQCA 4YOYA 1N34K 4CF2A 3THWB 3V1RA 5FRNA 3AVHA 1IH7A 1HJOA 5FPDA 4CJ4A 4CK3A 3P38A 4KHUA 4FWNA 3AVFA 1TYQB 1IKWA 1XMQK 4PUOA 1W7AA 5KQDA 1DTQA 3CJCA 4W5TA 3BUZB 4BACA 1LWCA 3THXB 3DXMB 1W97L 5AQQA 1NLVA 4CZMA 2E1ZA 4IWVA 4JKHA 3U6FA 5JLFA 1QQOA 2Q97A 3OS1A 1JLBA 5GAGP 4CHNA 3GOIA 2FSKA 1HQUA 5HRPA 1NMNA 4JLHA 1TK0A 3KWIA 1NU0A 2GV9A 4JI4K 3TANA 4CZEA 3CC7N 3TSPA 1OH8A 3WXLA 2P9UA 2ATQA 3CD6N 2PYLA 1U48A 1NGDA 1HKCA 3TAQA 5HRRA 3HJFA 5C0YA 1S72N 5AQNA 4CF0A 4IOAL 2OTJN 1YJWN 4IFVA 1N32K 3VERA 1BQMA 4YDUC 3KKRA 2O8BB 4UQGA 4DFKA 1ZYQA 3G10A 2A3ZA 3ZETB 4CD1A 2D0CA 1VQ4N 1L3UA 1TV6A 3C7NB 5SWMA 1C1BA 1ATSA 3ULEB 3K5NA 1SKRA 4RW4A 5TKYA 3QICA 3VGLA 3ID6A 4OPJA 3MWTA 4CGFA 2IGIA 1N33K 5AQUA 1GOCA 2YJFA 1SUQA 2V7YA 4AHRA 2OZSA 3E9LA 3QBXA 4BRPA 5GAHP 3BP8A 3UKRA 3MN5A 4H0TB 4M7XA 1U49A 5BRDA 4FO0A 3LP3A 4ELTA 3RMBA 3IDHA 3O80A 4UY8O 4FJKA 3CXCM 2FBYA 3QO9A 2NRHA 5GAEP 1XHZA 2JLEA 3R6MA 5M1OA 4Y1CA 4NXMK 1JKHA 4KH5A 4CHPA 2PBDA 5AQTA 1V4SA 4FOEA 3C65A 3PSIA 4FJ5A 2KZMA 5C25A 1Q18A 2OANA 1NM1A 2QKBA 3ZEUB 4BDZA 4E1NA 2Z1HA 1W0HA 2X6SA 4KB1A 4IG3A 4BRGA 3CQYA 2VGNA 1RT4A 5HRSA 4IOCL 4U7BA 1S1WA 4FJMA 4ZTFA 2O8CA 1IKYA 4DCHA 1W9HA 1R0AA 1TKTA 3OBYA 2NRTA 4LC9B 1YIJN 1Z25A 3KWGA 4FLXA 3WT0A 2DFEA 3O4NA 1N36K 1YJNN 1NBWA 3KKSA 4QS7A 4C1NI 4B1VA 2ITMA 4FLTA 1YAGA 1BO5O 3HXMA 4FWLA 1R59O 4B8AB 2VCPA 4Z4HA 4FOIA 1GLBG 2QXFA 2HBLA 1JCFA 3GDQA 3HM9A 2BANA 2P9KB 4JN4A 1OH6A 5JICA 4DSKA 1G15A 1KCFA 4GNIA 4C8OA 3V6DA 2V7ZA 3MN7A 3LAMA 4CJVA 3MMVA 4LF5K 3I0RA 1N5YA 1RBTA 3K5LA 4FVUA 3IUCA 1VQ6N 3OYKA 1K6YA 3CPWM 1HYZA 4A61A 4WFAL 4JI3K 1VQMN 4NO7A 4CFDA 5KTQA 1HNVA 2A1RA 3CCUN 4B1ZA 1A5WA 3CERA 3SQ4A 5JS2A 1SL1A 2ITGA 3O1WA 2KZZA 1TL1A 2ETJA 5C15A 3TPQA 3HPOA 3PO5A 1RT7A 4OX9K 4RW9A 1VQ7N 4H5VA 2O8FB 3KLFA 1K73O 3BEXA 3WNFA 4BC4A 4MQ3A 3NBPA 3WQUA 3UKUA 1T6DA 3H1QA 1RTDA 3ENOA 3VN5A 1SV5A 3AVBA 5KPRA 4GKKK 4ZTJA 3F9KA 2G8IA 4KO0A 3WQTA 3CM5A 3CMAN 2YKMA 1EO1A 2VG6A 5BR8K 3E9PA 4JKDA 3AARA 3S9HA 3VQDA 2QWMA 3AO4A 4JK7A 4M3TA 2YHAA 4CEBA 3TTFA 1QVFM 2ZE2A 5M1FA 3AAPA 3PIPL 1EWQA 3ZT0A 3R9PA 3KZBA 1JXEA 1C1CA 2F8TA 3Q7CA 3MX5A 3L2RA 1KFDA 2IS3A 2P1JA 3MEGA 4H5RA 5BREA 5EU7A 3P1GA 3V81A 5AQHA 1WUAA 4KH6A 3G25A 1VSMA 1Z26A 3QLHA 3WEEB 3O4QA 2Q36A 5K14A 1ZBSA 1X9SA 5FROA 3SV3A 4ELUA 3OYGA 4NCBA 1D9FA 3T1HK 2QWRA 4CJTA 3EKUA 4ICLA 2OA8A 5ELZA 3PY8A 3TABA 3MCPA 3MWPA 3OTOK 2HMPA 4R79A 4HWIA 5KGWA 2IVOA 4CGIA 1VSDA 4Z4GA 4NLCA 4BE2A 1Q9XA 1C0GA 5HROA 4M3XA 3TWHA 1ZBLA 4WE1A 3HI0A 4F4KA 4B3TK 3A8YA 1WSFA 4E3SA 2HNZA 1E3MA 2YNGA 4PHTX 3VF4A 2P5OA 2D1KA 4EHUA 2YJEA 5DMRA 2QM1A 3NF8A 3VMFB 4HUEA 4O0IA 4FZZA 3KK3A 3KHYA 5E84A 3WXJA 2G8HA 2Z1GA 3THYB 1WSJA 4LFCK 1NKCA 2OTLN 3J7YP 3DLHA 3U3YA 4WCEL 3CF5L 1ESVA 1VSIA 4W5RA 3H45C 3ULDA 3CMEN 2A41A 3AAQA 3IRXA 3UKUB 4A2AA 1HRHA 4GY2B 3D0PA 3RMCA 1DLOA 4FPBA 1B9DA 4AQYK 2CH5A 1ASUA 4OGEA 2ASMA 3OYLA 3UE5A 5CHIA 2X78A 4JK8A 4DFJA 1ASWA 2E20A 2EHGA 3LPUA 5AQVA 3AA4A 2OPRA 5CR4A 3SJJA 1ILYA 4BR2A 1VQKN 4DFPA 4RWTA 3VGKA 4DV0K 5HBMA 4IOXA 1YF5L 2O8DB 4JKBA 3SAHA 3L0QA 4HVJA 2HW3A 4ISFA 1O13A 5EVZA 2YNFA 3TU5A 2E6LA 4CVNE 2OPPA 3ASMA 1ZBIA 1T05A 1JLFA 2W42A 5EY4A 2YNHA 3OA9A 4CJKA 5C12A 1Q9YA 4M63C 3MXIA 4FLYA 4JD2B 2P9IA 1J5OA 3EZ5A 1SKWA 3LWLA 2KFNA 4RW6A 4MLHA 2YI1A 3J7AP 3P31A 3KK1A 3TTDA 3T69A 4KTWA 4E0DA 3GG4A 4C8KA 1QSLA 2WFBA 3QEPA 1IBKK 3A0IX 4M3ZA 4BQLA 3C94A 3FR0A 3TAEA 1NG9A 1HNIA 4ILGB 1BL3A 1WSGA 4OKJA 5EXWA 4CK2A 4CZKA 2EWSA 4FM0A 2G8WA 3FZLA 3U8XA 1DEJA 3AVMA 4BE1A 1VQPN 3AGKA 3ENHA 2GTDA 1XNRK 1TK8A 4CJ7A 2Z1JA 1LWFA 4A2BA 3MEDA 1RCHA 1BISA 1DGKN 3ZSVA 2HMIA 3MXJA 4O8KA 3SPYA 4C8NA 4J2AA 1NJXA 2E2PA 2P9NA 3G6EN 3SYZA 4DQSA 4BR0A 1RDBA 3THXA 3DXMA 3VA0A 3QERA 1EWRA 3A5NC 5AFUH 1KD1O 4H0XB 3AO3A 1NKEA 3AY9A 1FXXA 3SUNA 3L3UA 3KVGA 2E2QA 3WXIA 3L2VA 4H0YB 4OPAA 2RKIA 2A40A 3FZHA 1NOYA 2FBTA 4MDBA 1RTJA 3OYNA 4M3WA 3DJCA 3KK2A 4W5QA 2IOCA 4FLVA 3QNOA 4JKGB 3M8RA 3GE1A 3F2KA 3HSCA 4JS4A 1QS4A 4DR1K 3NVMA 1FJGK 2GELA 1SL0A 3H6EA 3CC4N 3CCEN 2VG5A 5HLFA 3ZX3A 3TR8A 4BR4A 5KPTA 2XY8A 2UUBK 2YHBA 3K2PA 4JHDB 5AJ3K 3CCRN 1LW0A 2Q0UA 3EZWA 4OKEA 4IZ9A 1TKDA 3NHGA 4JI7K 4RG8A 4WQ5C 4CGHA 2FSJA 4DV3K 2O8BA 4BC5A 4F3OA 1BIUA 5TKWA 1JLAA 3ZETA 1I3AA 1Z05A 4YOUA 3P83D 1W2BM 3NF9A 5BPLA 3L2UA 5M1QA 4CZHA 3PO4A 4CHOA 1K8AO 3SK3A 3C6UA 5KI6A 4B9SA 4M45A 4BR7A 3CCLN 4DTRA 4PL8A 4JI6K 2QI2A 1OVQA 1JLQA 1RGIA 2HHQA 1S1TA 1X3NA 2PY5A 4G1QA 3VF2A 5AQGA 4FJGA 2E88A 3EE9A 3SCXA 3VQBA 3W3DA 2DFFA 4FK2A 4CJUA 1P8ZA 4KH4A 1VRTA 3L2WA 4L3QA 3LDQA 3K5OA 1WSIA 3E01A 1GLLO 4FWKA 4W5NA 3VQ7A 3VQPA 2HBJA 3CCSN 1WBDA 4BRAA 2WC9A 3I56N 4KB0A 1BU6O 4YDUA 3O9SA 1WNSA 2UUCK 3ZEUA 3ALYA 2G8UA 1SAZA 4CE9A 2P9NB 1KSPA 2HVHA 3JXUA 3VPZA 1ZBUA 3AVNA 1B9FA 1ATRA 1LV5A 4JI0K 4NYNA 1S6QA 2E6MA 4Q0BA 4E1JA 4BRLA 4DQRA 3AVLA 2DTUA 3IS9A 3SMPA 2X6NA 2F4VK 4F8RA 3DI6A 5AQWA 1DKGD 1OKJA 1HNZK 4CEZA 3HOSA 3C6TA 4CEEA 4IG0A 5FPNA 1JCGA 4OLBA 2BGGA 4CW7B 4FJ8A 4AHVA 4LH4A 3M1FA 2IDOA 1T8EA 3J8AA 3M5RA 1YTUA 2P9KA 1QQCA 3D2EA 3QEWA 4FVMA 3CJAA 5HRNA 2E8AA 4M3UA 1QTMA 1LOTB 3VQQA 3AO1A 4DR7K 1SKSA 1DT9A 2HF3A 2F96A 4H4OA 2RN2A 3VQ6A 3KLEA 1XI1A 4DR6K 5KPZA 3DOLA 4AM7A 1QSSA 3UB5A 4EHTA 4FCYA 2NRZA 1RT1A 3CCQN 3R1XA 2ZGYA 3NE6A 2CGKA 1HR0K 2QWPA 3HYFA 5HP1A 3D7EO 4BWMA 4A59A 5KRTA 2O8FA 4KKOA 4FWQA 3HTVA 5BN8A 2QWLA 4EFHA 2O4GA 1JLCA 3K59A 1E4FT 1SZ2A 1IG8A 4AF1A 3LP0A 1U4BA 4R5PA 5F1XA 5E41A 2DY4A 3HO1A 2I7NA 1EX4A 4MDAA 3VEVA 3VTIA 5M1PA 4O4GA 3B6PA 4DTMA 3MK6A 5LL6Z 5LMUK 1T3VA 5AQXA 5F0XA 3U9ZA 1XMOK 3MECA 1NK6A 1VQ9N 1GLFO 4JI5K 3TSUA 1BIZA 1QHTA 3SV4A 4YOTA 3TAFA 3ATUA 4XH1A 4DLEA 3PIOL 4LF6K 4RTFD 1LCUA 1C0FA 1RT3A 3F73A 3VEXA 4HHTA 3OYFA 5GADP 4DMNA 3RRGA 4LF4K 1VQLN 3LDOA 1WLJA 3WEEA 2F9WA 3HPGA 3QMLA 5GIOA 1HMVA 4OLAA 3DLGA 1YITN 3CM6A 3V9ZA 1S5JA 3LWMA 3HBTA 3QIPA 1WAJA 2UU9K 4CCHA 4O55A 3HP6A 1UA1A 1KC8O 1EP4A 4XH4A 3V9WA 3EYZA 1GLAG 2G8VA 5AQIA 4B3SK 1RBSA 1YI2N 4HTLA 4KRFA 5T7BA 4PY5A 2VGMA 2IVNA 4DR3K 3JAMO 3NFAA 3RRHA 2KQ2A 4CIGA 2YX6A 2RHKA 4FK0A 3D2EB 4Z4CA 3SNNA 4B08A 4FWPA 5C2FA 5HL7L 2E2OA 1KAYA 4EP4A 3HT3A 2QK9A 2XY6A 4PQUA 4CZLA 5MLCQ 1S9EA 1KAZA 4CFBA 4JEPA 1N8RO 4QAGA 1S9GA 3OJUA 3LZIA 2YHYA 3PSFA 3SI6A 4CGGA 3G4SN 4JKAA 3K5MA 4CZGA 3THYA 1HPZA 3LALA 3OJSA 1IO2A 1TK5A 3D45A 4H0OA 4B3MK 4GV9A 2VQEK 3AVCA 5DK5A 4BDYA 2XY5A 2X74A 3WUHA 1BCOA 3L8BA 4DF4A 4A5BA 2JWKA 3QDKA 1BUPA 3VQ8A 3CCJN 4K0KK 4K8XA 4CBWA 5CY4A 2D5RA 3VENA 4BY9C 2B5JA 3DLKA 2B6AA 4IJAA 5CZ1A 1NGHA 2QKKA 2UUAK 3ENBA 2RF2A 4H4MA 4KHPK 1S3XA 1VSJA 2FF3B 3EKSA 4DU1A 2WBNA 2O8EB 5JS1A 1L3VA 1Q81O 4BRCA 5HOOA 2O8DA 5B8HA 3RSEB 3I8DA 5FLXO 1HNWK 4BGBA 5I3UA 3OVNA 4CJ5A 3J7ZO 4DV7K 1SS6A 3LAKA 3S3OA 2QXLA 3ATVA 4CEQA 1I39A 4DB3A 4JAXA 4JD2A 2VG7A 2ZJPL 2CGLA 3CQ8A 1MWMA 3VQ5A 4CEAA 3MXMA 2F9TA 3D6RA 1XC9A 1NJIO 1QSYA 3VTHA 1S22A 5AQYA 2VWJA 2IVPA 1REVA 5M1KA 4IBNA 5DM6L 4B3OA 4ILHA 3CJ7A 3CIPA 4JKFA 4CEFA 1U6ZA 2EX3A 4E1MA 3T1YK 2JGUA 3KIOA 1VK0A 3SPZA 1VRUA 4DV2K 1S1VA 2Z1IA 4WQ4C 4BR9A 1C0TA 4J8FA 4DTSA 4YNQA 5J2QA 1TUUA 3IKMA 3SQ2A 1RBUA 3HM8A 3ZSXA 3MAQA 4M7YA 1QHAA 2NUBA 2HNYA 4W5OA 5FPEA 2DFHA 4GMJB 3DWLA 2QTDA 3LDNA 3RMAA 3K9JA 3EE8A 4DFMA 5BPNA 3RMDA 3FGUA 5M1NA 2GEMA 4CEOA 3QB0A 2R7YA 3ITHA 3NDKA 4I2QA 1GOBA 2BE2A 2V52B 4YY3K 1YT3A 3BY5A 4ELVA 5H1SQ 4B1WB 4AHUA 1TL3A 4K8ZA 1X9WA 5AZIA 1KLMA 4YORA 1J6ZA 4LSLA 4FJ9A 3S3NA 3P39A 3LANA 1L5UA 5GIPA 3U3GA 4FM1A 1L3SA 4CEDA 4ID5A 3KLGA 3AVJA 4JKGA 5FDLA 3V1QA 3MEEA 1HLUA 2W40A 1J54A 4DTOA 4Z0UA 4OGCA 4IEIA 4PL7A 4LF9K 4BG8A 1TAUA 4IEEA 4FW1A 2D0OA 3T7ZA 4H0PA 4JHDA 4BE0A 3ZX2A 2UXDK 2XRIA 3BZKA
chains in the Genus database with same CATH topology
1RFQA 4WQ4A 2NRWA 4K41A 5F2RA 1VQ4N 3AGRA 4H5WA 5JVHL 3O9RA 2VWBA 2YCHA 1X3MA 5TKWA 2ASPA 3C7NB 3R3LA 3ZETA 1ATSA 3ULEB 1Z05A 4YOUA 4C23A 5TKYA 3QICA 1E4GT 3VGLA 4NB4A 1W2BM 3ID6A 5BPLA 4IFEA 2D4WA 5AQMA 3MWTA 5M1QA 3QFPA 4QS8A 4DHYA 4CZHA 4PKGA 5AQUA 1Z6RA 2KKZA 3NMUA 2YJFA 3DXKB 4ISEA 3UKRB 1K8AO 3SK3A 1HX1A 2V7YA 3MN6A 3E9LA 3QBXA 5AQLA 4BR7A 4BRPA 5BRHA 3CCLN 5GAHP 3BP8A 2JWLA 3UKRA 3MN5A 1SQKA 1YVNA 4H0TB 4M7XA 4PL8A 4FO0A 2QI2A 5BRDA 1NGJA 3O08A 4YOWA 2QA4N 3IDHA 3WXKA 1RGIA 1X3NA 3O80A 3O4WA 4UY8O 3K9KA 4DQ8A 3FLCO 3VF2A 2GWJA 3CXCM 5AQGA 2CH6A 2E88A 2NRHA 3EE9A 5GAEP 3I55N 3R6MA 4H5TA 3W3DA 3BF1A 3JS6A 4BC2A 5M1OA 2QWNA 1P8ZA 1QZ5A 4KH5A 2PBDA 4KH4A 1V4SA 5AQTA 3ZX0A 2QEXN 1EQYA 3C65A 4FOEA 4I6MB 4L3QA 1Q86O 2YHXA 3HZ6A 1BA0A 3LDQA 4CZJA 2CGJA 1GLLO 1Q18A 4FWKA 2OANA 1NM1A 1HUXA 2ZJRL 2HBJA 3ZEUB 3CCSN 5E26A 4BRAA 2WC9A 1WOQA 4PKHA 4BRDA 3I56N 4BRGA 1BU6O 4O5FA 4YDUA 1ZXOA 2VGNA 3CQYA 4JK9A 5AQZA 3O9SA 4B1UB 3MX2A 1X9JA 3ZEUA 4IOCL 4U7BA 1ZC6A 3R8EA 1SAZA 2P9NB 4DCHA 4MLEA 3JXUA 3VPZA 3G71N 1NGIA 3OBYA 3B8AX 4WQ5A 3MDQA 4BQZA 5BRFA 2NRTA 4LC9B 3U4LA 4KBOA 1YIJN 1ATRA 1P90A 3KWGA 1GLJO 2QW9A 3WT0A 3ID8A 4E1JA 4BRLA 3D2FB 1YJNN 1NBWA 2ZGZA 1JJ2M 4QS7A 4C1NI 3SMPA 4B1VA 4BREA 4K43A 2ITMA 3QBWA 3O9UA 1YAGA 3SJHA 1BO5O 4FWLA 1R59O 5AQWA 1DKGD 1OKJA 4FSVA 2VCPA 3VEWA 2Q2RA 2FF6A 3D2FA 4FOIA 5AZIB 1GLBG 3HOSA 3CJBA 2PFUA 4FWSA 2HBLA 1JCFA 5FPNA 3GDQA 1JCGA 2P9KB 4YOVA 4JN4A 5JICA 3M1FA 4FWOA 4GNIA 3S41A 3J8AA 2NLXA 2V7ZA 2GUPA 3M5RA 3MN7A 3MMVA 3VETA 3LDPA 4CI6A 2Q0RA 2P9KA 2NZTA 5I9EB 5AQFA 3D2EA 4FVUA 3IUCA 3IFRA 1VQ6N 3CJAA 5AZJB 3EN9A 3CPWM 4JKEA 2E8AA 4A61A 4WFAL 1LOTB 1BA1A 3F5TA 1VQMN 4NO7A 3A5OC 2ASOA 1DT9A 2A42A 2HF3A 3P4IA 4CZFA 5AZJA 3SBGA 3CCUN 4B1ZA 3CERA 2RE2A 5GINA 4WF9L 4DKWA 3SMSA 3E9OA 2GWKA 4IO9L 3O1WA 5C15A 5KPZA 3TPQA 4AM7A 3UB5A 1NMDA 3CJ9A 4EHTA 1Q82O 2NRZA 1VQ7N 4H5VA 4MO5A 3CCQN 3Q7BA 3R1XA 2ZGYA 4JNEA 2NRVA 2CGKA 3BEXA 3FZKA 4BC4A 4YOXA 1K73O 2QWPA 3WQUA 3UKUA 2P9SB 2IIRA 1T6DA 3O6WA 4A57A 3D7EO 3H1QA 4A59A 2ZWHA 3ENOA 5C10A 1JCEA 3VESA 5KPRA 3C0BA 4FWQA 3CI5A 3HTVA 4WFBL 2P9SA 3VEYA 5BN8A 3WQTA 2QWLA 3PLAA 4EFHA 1VQ8N 1E4FT 2W41A 4FPAA 1U2VB 3O9TA 1YHQN 3CMAN 1SZ2A 1IG8A 4AF1A 1EO1A 1VAZA 5JVGL 4BRQA 5F1XA 3CPEA 1CZAN 3E9PA 4JKDA 2FXUA 3AARA 1U2VA 5AQKA 2QWMA 3MN9A 2I7NA 4IDHA 4JK7A 3HRGA 4AM6A 2F7TA 3E1YA 3TTFA 5JMVA 1QVFM 1V4TA 5M1FA 3AAPA 2I7PA 4MDAA 3ZYYX 3VEVA 3VTIA 3PIPL 3FE1A 5M1PA 3R9PA 4F9OA 2A5XA 3KZBA 3VEZA 3CCMN 1VQ5N 3MK6A 1NGBA 3Q7CA 3MX5A 3OW2M 1T3VA 2NNWA 4PKIA 5AQXA 2HF4A 4H5RA 3SBTA 5F0XA 1M1KO 4BVOA 4FWRA 3U9ZA 1K9MO 1NGCA 3VOVA 5BREA 1BWFO 5C0YA 1VQ9N 1GLFO 2H3GX 3GBTA 3TSUA 4FWMA 2E2NA 5AQHA 2AP1A 3CHWA 4YOTA 1WUAA 3ATUA 4XH1A 4KH6A 3G25A 3PIOL 4QS9A 4RTFD 3WEEB 1LCUA 1C0FA 2Q36A 3IMXA 3VEXA 2HBMA 1ZBSA 4H03B 3O9QA 5GADP 3W0LA 1K8KB 5BPMA 1VQLN 3LDOA 5LJVA 2QWQA 3WEEA 2F9WA 4EAHD 2QWRA 3EKUA 3QMLA 5GIOA 4XH5A 3H3OB 1YITN 3GL1A 1K8KA 5ELZA 3VEOA 3A5MC 2PAVA 3HBTA 5EOYA 1KAXA 3MCPA 1GLCG 3MWPA 2D0PA 2HMPA 4BVPA 4R79A 4HWIA 5ADXA 1KC8O 4XH4A 2IVOA 3FZFA 4NLCA 1GLAG 4BRFA 5AQIA 1C0GA 3CETA 2Q31A 2FLOA 3EO3A 1YI2N 4HTLA 4B9QA 3HI0A 5FPMA 3C6AA 4BRNA 3CC2N 3LL3A 4A62A 2VGMA 2IVNA 1TYQA 3A8YA 3U9DA 2P9LB 2BUPA 3LM9A 1T44A 5AQRA 4H0VB 3SAGA 2YX6A 2HOEA 2RHKA 3M3ZA 3SLCA 3D2EB 1NGAA 1XC3A 4BROA 2ZJQL 4PHTX 5BR9A 4BRKA 3KK7A 4FWPA 3VF4A 4IJNA 1TUYA 2D1KA 2KLAA 2P9LA 4CBXA 4EHUA 3RVCA 4JKCA 2E2OA 2YJEA 5C2FA 5HL7L 5C2DA 1KAYA 2QM1A 5AQPA 3VMFB 3L6QA 3HOTA 4CZLA 5MLCQ 1Y64A 5AQSA 1KAZA 3KHYA 4JEPA 5E84A 1N8RO 3WXJA 1VQON 2AA4A 4BC3A 3I33A 3TTCA 2OTLN 5AQOA 3EL2A 2YHYA 3ZX2A 4WCEL 3CF5L 1ESVA 3G4SN 4JKAA 1KXPA 2UYTA 3H45C 4CZGA 4BR5A 2A41A 3AAQA 3CMEN 2V51B 3UKUB 4CZIA 4GV3A 3H3NO 4A2AA 3DAWA 4GY2B 1YXQA 3N4QA 4FPBA 5EX5A 4H0OA 2CH5A 1OVYA 4BRHA 2DPNA 3CCVN 4GV9A 2ASMA 1NGGA 3UE5A 5CHIA 1KQSM 2YHWA 3WUHA 3A5LC 4JK8A 4A5BA 2JWKA 3QDKA 1BUPA 4ILJA 5JLHA 2E20A 2HSTA 2Q1NA 5AQJA 2E1YA 2BTFA 4A5AA 2A6AA 5AQVA 3WXMB 3CCJN 4H5NA 4CBWA 3FFKB 5CR4A 1NGEA 1ILYA 4BR2A 3VENA 5KQ8A 4BY9C 1BG3A 1MWKA 3M6GA 1QZ6A 4K42A 3I8BA 4IJAA 5AR0A 1VQKN 1NGHA 4RWTA 3VGKA 3CQXA 3ENBA 1YF5L 4IOXA 4G9ZA 1D4XA 1XUPO 1YUWA 1S3XA 4JKBA 3VF6A 3SAHA 3L0QA 2FF3B 3EKSA 2WBNA 4ISFA 1Q7YO 1Q81O 1RDWX 1O13A 3MCAB 3N4PA 3O1BA 3F9MA 5EVZA 4BRCA 5HOOA 3E66A 3TU5A 3C7NA 5B8HA 3RSEB 2BH1A 2FSNA 4GVEA 3ULEA 4BG9A 4BGAA 2P9IB 1MDUB 5EY4A 3OA9A 2J4RA 1ATNA 4IXCA 2P9PB 4Z94A 4GV6A 5C12A 4BGBA 4ISGA 3LDLA 4M63C 3RSEA 3J7ZO 3LM2A 4JD2B 3DXKA 3L4QA 4C1NK 2KHOA 2P9IA 1G99A 1SS6A 1BOTO 3H1VX 2QXLA 3ATVA 4MLHA 5DM7L 2P9PA 2YI1A 3C6HA 3P31A 4O8UA 4DB3A 4B1YB 4JAXA 3TTDA 4JD2A 3T69A 2ZJPL 2CGLA 1QQMA 1QQNA 1MWMA 2NRRA 3GG4A 3NVKA 2F9TA 1RDUA 3D6RA 1NJIO 1IJJA 2WFBA 1YJ9N 4RCHA 3VTHA 1S22A 5AQYA 3A0IX 4BQLA 2IVPA 5M1KA 4K25A 3BF3A 3FR0A 3H46O 1HKBA 3O8MA 5DM6L 4ILHA 3CJ7A 4ILGB 5LY3A 3CIPA 4JKFA 4EIAA 1U6ZA 3OBWA 5EXWA 4YOYA 4CZKA 2EWSA 4CD3A 2VYPA 4U67L 3FZLA 3U8XA 4WYBA 1HJOA 1DEJA 4I6MA 3O5BA 5FPDA 1VQPN 3AGKA 4MO4A 3ENHA 2GTDA 3OHRA 3P38A 4IO8A 4FWNA 4WQ4C 5ADXH 1VQNN 4BR9A 4CJ7A 1TYQB 3SAFA 1MA9B 3FZMA 4J8FA 5KQDA 1M90O 3CJCA 1TUUA 3IKMA 4A2BA 3BUZB 1DGKN 3HM8A 3DXMB 1W97L 5AQQA 4O8KA 4FL9A 4M7YA 1NLVA 4CZMA 2E1ZA 1QHAA 4IWVA 2E2PA 4NLBA 2P9NA 4XEIA 3TSQA 3G6EN 4BR0A 4BRIA 4JKHA 1BDGA 5JLFA 3DXMA 5FPEA 3DWLA 2QTDA 3LDNA 3QFUA 3K9JA 1QQOA 5AFUA 2Q97A 3A5NC 1T6CA 3EE8A 2GX9A 5AFUH 5BPNA 1KD1O 3FGUA 4H0XB 5M1NA 4WFNL 3AY9A 2GEMA 3QB0A 1HKGA 5GAGP 3KVGA 2E2QA 2FSKA 3GOIA 3WXIA 4H0YB 4OPAA 2V52B 2P9UB 5LJWA 2A40A 3KWIA 4B1XB 5H1SQ 4Y0WA 2ZF5O 3FZHA 1NGFA 3L4IA 4B1WB 4CZEA 5CE3A 5BN9A 3CC7N 4MDBA 5AZIA 1XQSC 3VGMA 3TSPA 4YORA 3DJCA 3WXLA 2P9UA 1J6ZA 3CD6N 2WUSA 1HPMA 4JKGB 1NGDA 3GE1A 3P39A 3F2KA 3HSCA 3CJ1A 1HKCA 3NVMA 5GIPA 1NWKA 1GLEG 2GELA 2NRXA 3H6EA 3CC4N 1S72N 3CCEN 5AQNA 4IOAL 4JKGA 2OTJN 1YJWN 3ZX3A 4BRMA 4BR4A 5KPTA 1QVGM 4OO1J 3VERA 1HLUA 2W40A 4YDUC 1H1VA 4JHDB 4IEIA 4CBUA 4OPHA 3CCRN 2QWOA 2Q0UA 3EZWA 4PL7A 4BG8A 2HBKA 4IEEA 1GLDG 2D0OA 4IZ9A 3T7ZA 4H0PA 4JHDA 2A3ZA 4WQ5C 3ZETB 4CD1A 2FSJA 3DLLL 4BC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 L;  1KC8 O;  1VQ4 N;  1VQ6 N;  5JVH L;  3CPW M;  4WFA L;  2ZJP L;  1YI2 N;  1VQM N;  1W2B M;  1NJI O;  3CCU N;  1YJ9 N;  3CC2 N;  4WF9 L;  4IO9 L;  5DM6 L;  1K8A O;  2ZJQ L;  1Q82 O;  3CCL N;  1VQ7 N;  5GAH P;  3CCQ N;  4U67 L;  5HL7 L;  1K73 O;  1VQP N;  2QA4 N;  1VQN N;  5MLC Q;  4UY8 O;  3CXC M;  1M90 O;  5GAE P;  3I55 N;  4WFB L;  1N8R O;  1VQO N;  1VQ8 N;  2OTL N;  4WCE L;  3CF5 L;  1YHQ N;  3CMA N;  3G4S N;  5JVG L;  2QEX N;  1Q86 O;  3CME N;  3G6E N;  2ZJR L;  3CCS N;  1KD1 O;  1OVY A;  4WFN L;  1QVF M;  3CCV N;  3PIP L;  3I56 N;  1KQS M;  5GAG P;  1VQ5 N;  3CCM N;  4IOC L;  5H1S Q;  3OW2 M;  1M1K O;  3CC7 N;  3G71 N;  3CCJ N;  1K9M O;  1ILY A;  1YIJ N;  1VQ9 N;  3CD6 N;  1VQK N;  1YJN N;  1JJ2 M;  1S72 N;  3PIO L;  3CC4 N;  3CCE N;  4IOA L;  2OTJ N;  1YJW N;  1QVG M;  1Q7Y O;  1Q81 O;  5GAD P;  1VQL N;  3CCR N;  1YIT N;  3J7Z O;  3DLL L; 
#chains in the Genus database with same CATH topology
 1RFQ A;  2NRW A;  5F2R A;  4H5W A;  1X3M A;  3RR7 A;  4JI8 K;  3R3L A;  4O5B A;  4C23 A;  3DOK A;  3ZSO A;  2XY7 A;  1E4G T;  4B9U A;  3V1O A;  4IFE A;  2D4W A;  5AQM A;  4CJR A;  3V9X A;  1BCM A;  4OKK A;  3QFP A;  1NKB A;  3SUQ A;  3KD5 E;  3QES A;  4DWI A;  1UOC A;  3PX6 A;  4AHS A;  5A2Q O;  2D0B A;  3MN6 A;  3J80 O;  4DR4 K;  5AQL A;  1C6V A;  1SQK A;  3O08 A;  2QA4 N;  1NJZ A;  1WSE A;  3WXK A;  1TAQ A;  2A1S A;  4C8M A;  3O4W A;  4DQI A;  2AJQ A;  3NF6 A;  2GWJ A;  3KLI A;  3CG7 A;  2CH6 A;  4GKJ K;  4MFB A;  4I9L A;  3JS6 A;  4I2P A;  4BC2 A;  2QWN A;  1QZ5 A;  1Q86 O;  3M8Q A;  3AA3 A;  3HZ6 A;  2I5J A;  2G8K A;  2CGJ A;  2XHB A;  3DM2 A;  4DTJ A;  3HK2 A;  3O3H A;  1YVU A;  1HUX A;  5E26 A;  4CEC A;  1WOQ A;  3KJV A;  2D0A A;  4BRD A;  4FLZ A;  4CER A;  4CJF A;  4B1U B;  3MX2 A;  4GW6 A;  3AVI A;  1VSF A;  5SZT A;  1EET A;  4B8C A;  1ZC6 A;  5C42 A;  1CLQ A;  3G71 N;  3FFI A;  1KVB A;  3TI0 A;  4X62 K;  4QCL A;  3B8A X;  4WQ5 A;  3MDQ A;  4BQZ A;  3U4L A;  1P90 A;  1GLJ O;  3ID8 A;  3AVK A;  3D2F B;  2ZGZ A;  1JJ2 M;  4BRE A;  3QBW A;  3O9U A;  4F3T A;  3THV A;  3SJH A;  4IFY A;  1ITG A;  3NAE A;  2P51 A;  3ZSQ A;  5AZI B;  3CJB A;  2PFU A;  4B9N A;  3ZT2 A;  3NH1 A;  4E19 A;  4F2R A;  3QEI A;  1BHL A;  2XO7 A;  4DQP A;  2FBV A;  2YV0 X;  2NLX A;  2GUP A;  1A5V A;  3SZ2 A;  2OCE A;  3LDP A;  4NYF A;  2Q0R A;  2NZT A;  4CI6 A;  5I9E B;  3NCI A;  4FZX C;  4B9T A;  3EY1 A;  3IFR A;  5AZJ B;  3ZSY A;  1BA1 A;  1XNQ K;  3J81 O;  3F5T A;  3OY9 A;  2ASO A;  3OYE A;  2A42 A;  2E4L A;  4CJP A;  4FK4 A;  2RE2 A;  3HST B;  4FW2 A;  5GIN A;  4WF9 L;  3A2F A;  3HPH A;  2GUI A;  1WN7 A;  3CJ9 A;  3C95 A;  5LMN K;  3EEQ A;  4I7F A;  3Q7B A;  2ZD1 A;  4JNE A;  3IG1 A;  1BGX T;  2P9S B;  2IIR A;  3O6W A;  4A57 A;  2HHW A;  1HJR A;  5J1E A;  4FYD A;  5C10 A;  1JCE A;  1IV0 A;  1GOA A;  4WFB L;  4Z4F A;  3HVT A;  2W41 A;  4FPA A;  1U2V B;  3O9T A;  2KW4 A;  5AQK A;  4IDH A;  4CK1 A;  4KAZ A;  4EP5 A;  2F7T A;  3QEX A;  3E1Y A;  5JMV A;  4CIE A;  1NOZ A;  4FJH A;  2I7P A;  2HVI A;  3FE1 A;  4DV5 K;  4RW8 A;  4F9O A;  3VEZ A;  3CCM N;  1VQ5 N;  3JSM A;  1IKV A;  3OW2 M;  2KTQ A;  3L3V A;  1M1K O;  4LH5 A;  1KLN A;  1EXQ A;  2VQF K;  1BWF O;  2H3G X;  4E89 A;  5J2P A;  3GBT A;  1WB9 A;  4FWM A;  2E2N A;  2E5L K;  3AO2 A;  3CHW A;  2HHH K;  4LFA K;  4PWD A;  4QS9 A;  1RDD A;  4FJJ A;  4M3Y A;  3IMX A;  4H03 B;  3PX4 A;  1K8K B;  4CFC A;  4AIL C;  5LJV A;  4CES A;  4L8R B;  1JLE A;  4DR5 K;  4EAH D;  1IKX A;  3H3O B;  3GL1 A;  1FK9 A;  4DSI A;  3VEO A;  1IG9 A;  1NK8 A;  3ZCM A;  2PAV A;  3QIN A;  5EOY A;  1KAX A;  1GLC G;  2ZQB A;  4BVP A;  3FZF A;  2Q31 A;  3EO3 A;  2O4I A;  4B9Q A;  1BI4 B;  3P5J A;  1Q8I A;  3WNH A;  3C6A A;  3LL3 A;  4DUZ K;  4KFB A;  3U9D A;  3LPT A;  1WAF A;  2P9L B;  3SAG A;  1T44 A;  4H0V B;  2HOE A;  3M3Z A;  2Q3S A;  1FW6 A;  1NGA A;  1XC3 A;  2LSN A;  4JRQ A;  1KRP A;  5BR9 A;  4BRK A;  4IDK A;  4CBX A;  3RVC A;  5C2D A;  1S1X A;  5AQP A;  3HOT A;  3L6Q A;  1TKZ A;  5AQS A;  3ZT1 A;  4M41 A;  1VQO N;  2HHU A;  3WNG A;  2AA4 A;  4BC3 A;  3EL2 A;  4OJR A;  1D8Y A;  3CYM A;  3LP1 A;  4DG1 A;  5KGX A;  2UYT A;  3O3F A;  4BR5 A;  2V51 B;  4CZI A;  1O1W A;  4GV3 A;  3H3N O;  3AA5 X;  4FJI A;  3LZJ A;  3DAW A;  2OPS A;  4LD0 A;  1NK7 A;  4KHQ A;  2VWK A;  2ZM6 K;  3CCV N;  3DLE A;  1VHX A;  4Q5V A;  1XWL A;  1KQS M;  2Y1I A;  2YHW A;  3A5L C;  2PZS A;  1XHX A;  5JLH A;  3DYA A;  3AA2 A;  2Q1N A;  5AQJ A;  2E1Y A;  1X9M A;  2OYQ A;  2A6A A;  3WXM B;  3M8S A;  2UXC K;  3FFK B;  2HHS A;  1MWK A;  3IAY A;  4AHC A;  4DQQ A;  3OS0 A;  1D4X A;  2W6K A;  3VF6 A;  1NK9 A;  4FJ7 A;  4KPY A;  1RDW X;  3MCA B;  3V4I A;  1NK4 A;  3O1B A;  3F9M A;  3E66 A;  3BGR A;  2BH1 A;  2FSN A;  4GVE A;  4BG9 A;  1S6P A;  2O8E A;  1ATN A;  1C0M A;  4IXC A;  2P9P B;  3ZSZ A;  4Z94 A;  3LDL A;  3RSE A;  2IC3 A;  3NGZ A;  3LM2 A;  3DXK A;  3L4Q A;  2KHO A;  4CF9 A;  3OYI A;  1I94 K;  1BOT O;  5DM7 L;  4DSF A;  3C6H A;  1QQM A;  2YNI A;  2NRR A;  1RDU A;  4LY7 A;  1IJJ A;  1YJ9 N;  4RCH A;  4B9V A;  1B92 A;  3H46 O;  3ZLJ A;  1HKB A;  3O8M A;  2HHV A;  5LY3 A;  3ZSW A;  1VSH A;  4EIA A;  3OBW A;  2W6L A;  4CD3 A;  2VYP A;  4F2S A;  4U67 L;  2RPI A;  4WYB A;  4I6M A;  3O5B A;  2G8F A;  4X64 K;  4MO4 A;  3OHR A;  4IO8 A;  5ADX H;  1VQN N;  3CFO A;  1DTT A;  3SAF A;  1MA9 B;  4FJX A;  3FZM A;  4M3R A;  4C8L A;  1M90 O;  3NH0 A;  2HHT A;  3NGI A;  3OYM A;  1LAV A;  4FL9 A;  3M8P A;  4NLB A;  4XEI A;  4KHS A;  3TSQ A;  3DLB A;  3QET A;  3SUO A;  3KD1 E;  4BRI A;  1BDG A;  3AVG A;  4N47 A;  3QFU A;  5AFU A;  3PV8 A;  1T6C A;  2GX9 A;  4HCB A;  4WFN L;  4DSE A;  4NCA A;  1HKG A;  4J2E A;  3V9U A;  2WTU A;  1U45 A;  2P9U B;  5LJW A;  4B1X B;  1T03 A;  4Y0W A;  2ZF5 O;  1NGF A;  3L4I A;  5CYQ A;  5CE3 A;  3KLH A;  5BN9 A;  1IBL K;  1XQS C;  3VGM A;  4LSN A;  1RBV A;  2WUS A;  1HPM A;  4DV4 K;  4BWJ A;  3CJ1 A;  1ZBH A;  1NWK A;  1GLE G;  2NRX A;  4CJS A;  1RTH A;  1RTI A;  3OYC A;  4BRM A;  1QVG M;  4OO1 J;  1H1V A;  3ZSR A;  3LP2 A;  4CBU A;  4OPH A;  4E7K A;  3WNE A;  2QWO A;  4CGD A;  2HBK A;  1GLD G;  4KI6 A;  1X1P A;  3K0S A;  1TVR A;  4HTU A;  4KI4 A;  1LW2 A;  4KV8 A;  4QOZ B;  3DLL L;  3VQ4 A;  4WQ4 A;  4K41 A;  1KFS A;  1LAW A;  1S1U A;  3AGR A;  5JVH L;  3O9R A;  2VWB A;  2YCH A;  2ASP A;  1TKX A;  3DLR A;  4LF8 K;  2PYJ A;  2YKN A;  4HUG A;  4NB4 A;  3DRS A;  3SUP A;  1RNH A;  4QS8 A;  4DHY A;  2BDP A;  3HVR A;  1L3T A;  4ZHR A;  4PKG A;  1Z6R A;  2KKZ A;  3NMU A;  3DXK B;  3UKR B;  1ASV A;  4ISE A;  1OH5 A;  3ZT3 A;  3NH2 A;  3S3M A;  1HX1 A;  3KTQ A;  1ZBF A;  3OYJ A;  1VSL A;  5BRH A;  5CYM A;  2JWL A;  1YVN A;  3G0Z A;  1NGJ A;  4YOW A;  4FZY A;  4O44 A;  4CFA A;  1CXU A;  4DU4 A;  3K9K A;  4DQ8 A;  3FLC O;  2OPQ A;  4RW7 A;  3HP9 A;  3I55 N;  3HL8 A;  2KFZ A;  1RT2 A;  4H5T A;  1J9A A;  3BF1 A;  4ID1 A;  3TAG A;  3K57 A;  1FKO A;  3ZX0 A;  2QEX N;  1EQY A;  4I6M B;  2YHX A;  4B9L A;  1BA0 A;  1HYV A;  4CHY A;  1J53 A;  4CZJ A;  1HQE A;  3O3G A;  1WSH A;  2ZJR L;  3L2Q A;  1KTQ A;  3QNN A;  1LWE A;  3UIQ A;  5KRS A;  2O8C B;  4PKH A;  4HCC A;  1IBM K;  4KHW A;  4O5F A;  3BZC A;  1ZXO A;  4JK9 A;  5AQZ A;  1RBR A;  1X9J A;  3RWU A;  4CHZ A;  3R8E A;  1U47 A;  4JV5 K;  4MLE A;  1NGI A;  4AHT A;  5BRF A;  4KBO A;  3AO5 A;  2QW9 A;  3QEV A;  4DTP A;  4O0J A;  1Y97 A;  4K43 A;  4CF8 A;  3VEW A;  4FSV A;  2Q2R A;  2FF6 A;  3D2F A;  1HNX K;  4FWS A;  4H8K A;  4J2B A;  1MU2 A;  4YOV A;  4LF7 K;  4IKF A;  1A5X A;  4FWO A;  2P5G A;  2WOM A;  3S41 A;  4DTX A;  3VET A;  1UWB A;  5AQF A;  1FKP A;  1EKE A;  3TAR A;  3EN9 A;  4JKE A;  4YHH K;  4KTZ A;  4LFB K;  3NF7 A;  3A5O C;  3OS2 A;  3P4I A;  4Z4E A;  4CZF A;  5AZJ A;  3SBG A;  5J2M A;  1T7P A;  3B6O A;  4XIU A;  4DKW A;  3SMS A;  3E9O A;  2GWK A;  4IO9 L;  1F21 A;  4JI1 K;  1RIL A;  4X65 K;  1JXB A;  4B9M A;  3DMJ A;  1NMD A;  1Q82 O;  4MO5 A;  1RDC A;  4YOX A;  3NGY A;  2NRV A;  4PA1 A;  3FZK A;  2FBX A;  4JI2 K;  4DV1 K;  3TAP A;  2ZWH A;  3VES A;  1JL1 A;  3C0B A;  4CJQ A;  5J2N A;  3CI5 A;  4OVL A;  1UAX A;  2P9S A;  3VEY A;  4DSL A;  4E7H A;  3PLA A;  2HHX A;  1NNE A;  1VQ8 N;  4X66 K;  4NCG A;  1YHQ N;  1CZ9 A;  1SL2 A;  1VAZ A;  3VQE A;  5JVG L;  4BRQ A;  3CPE A;  4N56 A;  3ZT4 A;  1CZA N;  3OYD A;  3CFP A;  2FXU A;  1U2V A;  3MN9 A;  4JYA K;  3HRG A;  4AM6 A;  1V4T A;  3ZYY X;  3DRP A;  1RT5 A;  2A5X A;  4CF1 A;  4FLW A;  5IT9 O;  1NGB A;  2OZM A;  4FJN A;  3K58 A;  2NNW A;  3H08 A;  4PKI A;  4Z4I A;  3OYA A;  2HF4 A;  4Y1D A;  3SBT A;  4BVO A;  2FC0 A;  4FWR A;  1K9M O;  4FJL A;  1NGC A;  3VOV A;  4V19 S;  4CJL A;  4E7L A;  3LDS A;  1QE1 A;  2AP1 A;  3RR8 A;  4FLU A;  1D9D A;  3T19 A;  4JRP A;  2HBM A;  3O9Q A;  4J2D A;  1NK0 A;  3W0L A;  5BPM A;  2B4J A;  2QWQ A;  5D3G A;  2UXB K;  4XH5 A;  4DF8 A;  4DU3 A;  1K8K A;  3A5M C;  1RT6 A;  1NJW A;  1KVC A;  1OH7 A;  2HB5 A;  1RDA A;  2D0P A;  4E7J A;  5ADX A;  2GBZ A;  3I0S A;  4NXN K;  4BRF A;  3CET A;  4AH9 A;  2FLO A;  3THW A;  2WON A;  1C0U A;  1CXQ A;  4DR2 K;  3PX0 A;  5FPM A;  4BRN A;  3CC2 N;  1JL2 A;  4A62 A;  1TYQ A;  3SQ1 A;  2BUP A;  3LM9 A;  4GVM A;  5AQR A;  1BI4 A;  3SLC A;  4BRO A;  2ZJQ L;  5IWA K;  3DRR A;  3KK7 A;  4IJN A;  1TUY A;  2KLA A;  1CZB A;  2P9L A;  4CJ3 A;  4JKC A;  4KHY A;  4CIF A;  1YTA A;  1Y64 A;  3AVA A;  4DS4 A;  3BDP A;  1D5A A;  3QIO A;  3I33 A;  3TTC A;  5AQO A;  4M42 A;  4EZ9 A;  1N6Q A;  4CJW A;  1KXP A;  1NJY A;  1VSK A;  4I9Q A;  4CHQ A;  4N76 A;  1VSE A;  3TAM A;  1YXQ A;  3N4Q A;  4TSX A;  4FM2 A;  5EX5 A;  3V9S A;  1J5E K;  2HND A;  1OVY A;  4BRH A;  2DPN A;  3OYB A;  1UA0 A;  1NGG A;  4FXD A;  4CJE A;  4DV6 K;  4KTQ A;  4DTU A;  4YFU A;  3ISN C;  4ILJ A;  2HST A;  4OPK A;  1TGO A;  2BTF A;  4A5A A;  3PUF A;  1HYS A;  4H5N A;  1WBB A;  1NGE A;  5KQ8 A;  4DTN A;  2Y1J A;  1BG3 A;  3M6G A;  4K42 A;  1QZ6 A;  5AR0 A;  3I8B A;  3SQ0 A;  1KVA A;  5CZ2 A;  1BQN A;  1U04 A;  3CQX A;  3JYT A;  4G9Z A;  4HUF A;  5FRM A;  1XUP O;  1YUW A;  3VA3 A;  1NK5 A;  1Q7Y O;  4BDP A;  3T1A A;  3N4P A;  4E7I A;  3C7N A;  4DSJ A;  3ULE A;  4DLG A;  2IAJ A;  4BGA A;  2P9I B;  1MDU B;  2J4R A;  4N5S A;  4GV6 A;  4EZ6 A;  4ISG A;  4JS5 A;  4C1N K;  1G99 A;  3VQA A;  3H1V X;  4B3R K;  4KHN A;  5I42 A;  2P9P A;  4DUY K;  4O8U A;  4B1Y B;  4KRE A;  1C1A A;  3CFR A;  1QQN A;  4DS5 A;  3NVK A;  5C24 A;  3OYH A;  3RTV A;  4N41 A;  4CGJ A;  1JLG A;  3AV9 A;  4K25 A;  3T3F A;  3BF3 A;  3VQ9 A;  2F8S A;  3VQC A;  4YOY A;  1N34 K;  4CF2 A;  3THW B;  3V1R A;  5FRN A;  3AVH A;  1IH7 A;  1HJO A;  5FPD A;  4CJ4 A;  4CK3 A;  3P38 A;  4KHU A;  4FWN A;  3AVF A;  1TYQ B;  1IKW A;  1XMQ K;  4PUO A;  1W7A A;  5KQD A;  1DTQ A;  3CJC A;  4W5T A;  3BUZ B;  4BAC A;  1LWC A;  3THX B;  3DXM B;  1W97 L;  5AQQ A;  1NLV A;  4CZM A;  2E1Z A;  4IWV A;  4JKH A;  3U6F A;  5JLF A;  1QQO A;  2Q97 A;  3OS1 A;  1JLB A;  5GAG P;  4CHN A;  3GOI A;  2FSK A;  1HQU A;  5HRP A;  1NMN A;  4JLH A;  1TK0 A;  3KWI A;  1NU0 A;  2GV9 A;  4JI4 K;  3TAN A;  4CZE A;  3CC7 N;  3TSP A;  1OH8 A;  3WXL A;  2P9U A;  2ATQ A;  3CD6 N;  2PYL A;  1U48 A;  1NGD A;  1HKC A;  3TAQ A;  5HRR A;  3HJF A;  5C0Y A;  1S72 N;  5AQN A;  4CF0 A;  4IOA L;  2OTJ N;  1YJW N;  4IFV A;  1N32 K;  3VER A;  1BQM A;  4YDU C;  3KKR A;  2O8B B;  4UQG A;  4DFK A;  1ZYQ A;  3G10 A;  2A3Z A;  3ZET B;  4CD1 A;  2D0C A;  1VQ4 N;  1L3U A;  1TV6 A;  3C7N B;  5SWM A;  1C1B A;  1ATS A;  3ULE B;  3K5N A;  1SKR A;  4RW4 A;  5TKY A;  3QIC A;  3VGL A;  3ID6 A;  4OPJ A;  3MWT A;  4CGF A;  2IGI A;  1N33 K;  5AQU A;  1GOC A;  2YJF A;  1SUQ A;  2V7Y A;  4AHR A;  2OZS A;  3E9L A;  3QBX A;  4BRP A;  5GAH P;  3BP8 A;  3UKR A;  3MN5 A;  4H0T B;  4M7X A;  1U49 A;  5BRD A;  4FO0 A;  3LP3 A;  4ELT A;  3RMB A;  3IDH A;  3O80 A;  4UY8 O;  4FJK A;  3CXC M;  2FBY A;  3QO9 A;  2NRH A;  5GAE P;  1XHZ A;  2JLE A;  3R6M A;  5M1O A;  4Y1C A;  4NXM K;  1JKH A;  4KH5 A;  4CHP A;  2PBD A;  5AQT A;  1V4S A;  4FOE A;  3C65 A;  3PSI A;  4FJ5 A;  2KZM A;  5C25 A;  1Q18 A;  2OAN A;  1NM1 A;  2QKB A;  3ZEU B;  4BDZ A;  4E1N A;  2Z1H A;  1W0H A;  2X6S A;  4KB1 A;  4IG3 A;  4BRG A;  3CQY A;  2VGN A;  1RT4 A;  5HRS A;  4IOC L;  4U7B A;  1S1W A;  4FJM A;  4ZTF A;  2O8C A;  1IKY A;  4DCH A;  1W9H A;  1R0A A;  1TKT A;  3OBY A;  2NRT A;  4LC9 B;  1YIJ N;  1Z25 A;  3KWG A;  4FLX A;  3WT0 A;  2DFE A;  3O4N A;  1N36 K;  1YJN N;  1NBW A;  3KKS A;  4QS7 A;  4C1N I;  4B1V A;  2ITM A;  4FLT A;  1YAG A;  1BO5 O;  3HXM A;  4FWL A;  1R59 O;  4B8A B;  2VCP A;  4Z4H A;  4FOI A;  1GLB G;  2QXF A;  2HBL A;  1JCF A;  3GDQ A;  3HM9 A;  2BAN A;  2P9K B;  4JN4 A;  1OH6 A;  5JIC A;  4DSK A;  1G15 A;  1KCF A;  4GNI A;  4C8O A;  3V6D A;  2V7Z A;  3MN7 A;  3LAM A;  4CJV A;  3MMV A;  4LF5 K;  3I0R A;  1N5Y A;  1RBT A;  3K5L A;  4FVU A;  3IUC A;  1VQ6 N;  3OYK A;  1K6Y A;  3CPW M;  1HYZ A;  4A61 A;  4WFA L;  4JI3 K;  1VQM N;  4NO7 A;  4CFD A;  5KTQ A;  1HNV A;  2A1R A;  3CCU N;  4B1Z A;  1A5W A;  3CER A;  3SQ4 A;  5JS2 A;  1SL1 A;  2ITG A;  3O1W A;  2KZZ A;  1TL1 A;  2ETJ A;  5C15 A;  3TPQ A;  3HPO A;  3PO5 A;  1RT7 A;  4OX9 K;  4RW9 A;  1VQ7 N;  4H5V A;  2O8F B;  3KLF A;  1K73 O;  3BEX A;  3WNF A;  4BC4 A;  4MQ3 A;  3NBP A;  3WQU A;  3UKU A;  1T6D A;  3H1Q A;  1RTD A;  3ENO A;  3VN5 A;  1SV5 A;  3AVB A;  5KPR A;  4GKK K;  4ZTJ A;  3F9K A;  2G8I A;  4KO0 A;  3WQT A;  3CM5 A;  3CMA N;  2YKM A;  1EO1 A;  2VG6 A;  5BR8 K;  3E9P A;  4JKD A;  3AAR A;  3S9H A;  3VQD A;  2QWM A;  3AO4 A;  4JK7 A;  4M3T A;  2YHA A;  4CEB A;  3TTF A;  1QVF M;  2ZE2 A;  5M1F A;  3AAP A;  3PIP L;  1EWQ A;  3ZT0 A;  3R9P A;  3KZB A;  1JXE A;  1C1C A;  2F8T A;  3Q7C A;  3MX5 A;  3L2R A;  1KFD A;  2IS3 A;  2P1J A;  3MEG A;  4H5R A;  5BRE A;  5EU7 A;  3P1G A;  3V81 A;  5AQH A;  1WUA A;  4KH6 A;  3G25 A;  1VSM A;  1Z26 A;  3QLH A;  3WEE B;  3O4Q A;  2Q36 A;  5K14 A;  1ZBS A;  1X9S A;  5FRO A;  3SV3 A;  4ELU A;  3OYG A;  4NCB A;  1D9F A;  3T1H K;  2QWR A;  4CJT A;  3EKU A;  4ICL A;  2OA8 A;  5ELZ A;  3PY8 A;  3TAB A;  3MCP A;  3MWP A;  3OTO K;  2HMP A;  4R79 A;  4HWI A;  5KGW A;  2IVO A;  4CGI A;  1VSD A;  4Z4G A;  4NLC A;  4BE2 A;  1Q9X A;  1C0G A;  5HRO A;  4M3X A;  3TWH A;  1ZBL A;  4WE1 A;  3HI0 A;  4F4K A;  4B3T K;  3A8Y A;  1WSF A;  4E3S A;  2HNZ A;  1E3M A;  2YNG A;  4PHT X;  3VF4 A;  2P5O A;  2D1K A;  4EHU A;  2YJE A;  5DMR A;  2QM1 A;  3NF8 A;  3VMF B;  4HUE A;  4O0I A;  4FZZ A;  3KK3 A;  3KHY A;  5E84 A;  3WXJ A;  2G8H A;  2Z1G A;  3THY B;  1WSJ A;  4LFC K;  1NKC A;  2OTL N;  3J7Y P;  3DLH A;  3U3Y A;  4WCE L;  3CF5 L;  1ESV A;  1VSI A;  4W5R A;  3H45 C;  3ULD A;  3CME N;  2A41 A;  3AAQ A;  3IRX A;  3UKU B;  4A2A A;  1HRH A;  4GY2 B;  3D0P A;  3RMC A;  1DLO A;  4FPB A;  1B9D A;  4AQY K;  2CH5 A;  1ASU A;  4OGE A;  2ASM A;  3OYL A;  3UE5 A;  5CHI A;  2X78 A;  4JK8 A;  4DFJ A;  1ASW A;  2E20 A;  2EHG A;  3LPU A;  5AQV A;  3AA4 A;  2OPR A;  5CR4 A;  3SJJ A;  1ILY A;  4BR2 A;  1VQK N;  4DFP A;  4RWT A;  3VGK A;  4DV0 K;  5HBM A;  4IOX A;  1YF5 L;  2O8D B;  4JKB A;  3SAH A;  3L0Q A;  4HVJ A;  2HW3 A;  4ISF A;  1O13 A;  5EVZ A;  2YNF A;  3TU5 A;  2E6L A;  4CVN E;  2OPP A;  3ASM A;  1ZBI A;  1T05 A;  1JLF A;  2W42 A;  5EY4 A;  2YNH A;  3OA9 A;  4CJK A;  5C12 A;  1Q9Y A;  4M63 C;  3MXI A;  4FLY A;  4JD2 B;  2P9I A;  1J5O A;  3EZ5 A;  1SKW A;  3LWL A;  2KFN A;  4RW6 A;  4MLH A;  2YI1 A;  3J7A P;  3P31 A;  3KK1 A;  3TTD A;  3T69 A;  4KTW A;  4E0D A;  3GG4 A;  4C8K A;  1QSL A;  2WFB A;  3QEP A;  1IBK K;  3A0I X;  4M3Z A;  4BQL A;  3C94 A;  3FR0 A;  3TAE A;  1NG9 A;  1HNI A;  4ILG B;  1BL3 A;  1WSG A;  4OKJ A;  5EXW A;  4CK2 A;  4CZK A;  2EWS A;  4FM0 A;  2G8W A;  3FZL A;  3U8X A;  1DEJ A;  3AVM A;  4BE1 A;  1VQP N;  3AGK A;  3ENH A;  2GTD A;  1XNR K;  1TK8 A;  4CJ7 A;  2Z1J A;  1LWF A;  4A2B A;  3MED A;  1RCH A;  1BIS A;  1DGK N;  3ZSV A;  2HMI A;  3MXJ A;  4O8K A;  3SPY A;  4C8N A;  4J2A A;  1NJX A;  2E2P A;  2P9N A;  3G6E N;  3SYZ A;  4DQS A;  4BR0 A;  1RDB A;  3THX A;  3DXM A;  3VA0 A;  3QER A;  1EWR A;  3A5N C;  5AFU H;  1KD1 O;  4H0X B;  3AO3 A;  1NKE A;  3AY9 A;  1FXX A;  3SUN A;  3L3U A;  3KVG A;  2E2Q A;  3WXI A;  3L2V A;  4H0Y B;  4OPA A;  2RKI A;  2A40 A;  3FZH A;  1NOY A;  2FBT A;  4MDB A;  1RTJ A;  3OYN A;  4M3W A;  3DJC A;  3KK2 A;  4W5Q A;  2IOC A;  4FLV A;  3QNO A;  4JKG B;  3M8R A;  3GE1 A;  3F2K A;  3HSC A;  4JS4 A;  1QS4 A;  4DR1 K;  3NVM A;  1FJG K;  2GEL A;  1SL0 A;  3H6E A;  3CC4 N;  3CCE N;  2VG5 A;  5HLF A;  3ZX3 A;  3TR8 A;  4BR4 A;  5KPT A;  2XY8 A;  2UUB K;  2YHB A;  3K2P A;  4JHD B;  5AJ3 K;  3CCR N;  1LW0 A;  2Q0U A;  3EZW A;  4OKE A;  4IZ9 A;  1TKD A;  3NHG A;  4JI7 K;  4RG8 A;  4WQ5 C;  4CGH A;  2FSJ A;  4DV3 K;  2O8B A;  4BC5 A;  4F3O A;  1BIU A;  5TKW A;  1JLA A;  3ZET A;  1I3A A;  1Z05 A;  4YOU A;  3P83 D;  1W2B M;  3NF9 A;  5BPL A;  3L2U A;  5M1Q A;  4CZH A;  3PO4 A;  4CHO A;  1K8A O;  3SK3 A;  3C6U A;  5KI6 A;  4B9S A;  4M45 A;  4BR7 A;  3CCL N;  4DTR A;  4PL8 A;  4JI6 K;  2QI2 A;  1OVQ A;  1JLQ A;  1RGI A;  2HHQ A;  1S1T A;  1X3N A;  2PY5 A;  4G1Q A;  3VF2 A;  5AQG A;  4FJG A;  2E88 A;  3EE9 A;  3SCX A;  3VQB A;  3W3D A;  2DFF A;  4FK2 A;  4CJU A;  1P8Z A;  4KH4 A;  1VRT A;  3L2W A;  4L3Q A;  3LDQ A;  3K5O A;  1WSI A;  3E01 A;  1GLL O;  4FWK A;  4W5N A;  3VQ7 A;  3VQP A;  2HBJ A;  3CCS N;  1WBD A;  4BRA A;  2WC9 A;  3I56 N;  4KB0 A;  1BU6 O;  4YDU A;  3O9S A;  1WNS A;  2UUC K;  3ZEU A;  3ALY A;  2G8U A;  1SAZ A;  4CE9 A;  2P9N B;  1KSP A;  2HVH A;  3JXU A;  3VPZ A;  1ZBU A;  3AVN A;  1B9F A;  1ATR A;  1LV5 A;  4JI0 K;  4NYN A;  1S6Q A;  2E6M A;  4Q0B A;  4E1J A;  4BRL A;  4DQR A;  3AVL A;  2DTU A;  3IS9 A;  3SMP A;  2X6N A;  2F4V K;  4F8R A;  3DI6 A;  5AQW A;  1DKG D;  1OKJ A;  1HNZ K;  4CEZ A;  3HOS A;  3C6T A;  4CEE A;  4IG0 A;  5FPN A;  1JCG A;  4OLB A;  2BGG A;  4CW7 B;  4FJ8 A;  4AHV A;  4LH4 A;  3M1F A;  2IDO A;  1T8E A;  3J8A A;  3M5R A;  1YTU A;  2P9K A;  1QQC A;  3D2E A;  3QEW A;  4FVM A;  3CJA A;  5HRN A;  2E8A A;  4M3U A;  1QTM A;  1LOT B;  3VQQ A;  3AO1 A;  4DR7 K;  1SKS A;  1DT9 A;  2HF3 A;  2F96 A;  4H4O A;  2RN2 A;  3VQ6 A;  3KLE A;  1XI1 A;  4DR6 K;  5KPZ A;  3DOL A;  4AM7 A;  1QSS A;  3UB5 A;  4EHT A;  4FCY A;  2NRZ A;  1RT1 A;  3CCQ N;  3R1X A;  2ZGY A;  3NE6 A;  2CGK A;  1HR0 K;  2QWP A;  3HYF A;  5HP1 A;  3D7E O;  4BWM A;  4A59 A;  5KRT A;  2O8F A;  4KKO A;  4FWQ A;  3HTV A;  5BN8 A;  2QWL A;  4EFH A;  2O4G A;  1JLC A;  3K59 A;  1E4F T;  1SZ2 A;  1IG8 A;  4AF1 A;  3LP0 A;  1U4B A;  4R5P A;  5F1X A;  5E41 A;  2DY4 A;  3HO1 A;  2I7N A;  1EX4 A;  4MDA A;  3VEV A;  3VTI A;  5M1P A;  4O4G A;  3B6P A;  4DTM A;  3MK6 A;  5LL6 Z;  5LMU K;  1T3V A;  5AQX A;  5F0X A;  3U9Z A;  1XMO K;  3MEC A;  1NK6 A;  1VQ9 N;  1GLF O;  4JI5 K;  3TSU A;  1BIZ A;  1QHT A;  3SV4 A;  4YOT A;  3TAF A;  3ATU A;  4XH1 A;  4DLE A;  3PIO L;  4LF6 K;  4RTF D;  1LCU A;  1C0F A;  1RT3 A;  3F73 A;  3VEX A;  4HHT A;  3OYF A;  5GAD P;  4DMN A;  3RRG A;  4LF4 K;  1VQL N;  3LDO A;  1WLJ A;  3WEE A;  2F9W A;  3HPG A;  3QML A;  5GIO A;  1HMV A;  4OLA A;  3DLG A;  1YIT N;  3CM6 A;  3V9Z A;  1S5J A;  3LWM A;  3HBT A;  3QIP A;  1WAJ A;  2UU9 K;  4CCH A;  4O55 A;  3HP6 A;  1UA1 A;  1KC8 O;  1EP4 A;  4XH4 A;  3V9W A;  3EYZ A;  1GLA G;  2G8V A;  5AQI A;  4B3S K;  1RBS A;  1YI2 N;  4HTL A;  4KRF A;  5T7B A;  4PY5 A;  2VGM A;  2IVN A;  4DR3 K;  3JAM O;  3NFA A;  3RRH A;  2KQ2 A;  4CIG A;  2YX6 A;  2RHK A;  4FK0 A;  3D2E B;  4Z4C A;  3SNN A;  4B08 A;  4FWP A;  5C2F A;  5HL7 L;  2E2O A;  1KAY A;  4EP4 A;  3HT3 A;  2QK9 A;  2XY6 A;  4PQU A;  4CZL A;  5MLC Q;  1S9E A;  1KAZ A;  4CFB A;  4JEP A;  1N8R O;  4QAG A;  1S9G A;  3OJU A;  3LZI A;  2YHY A;  3PSF A;  3SI6 A;  4CGG A;  3G4S N;  4JKA A;  3K5M A;  4CZG A;  3THY A;  1HPZ A;  3LAL A;  3OJS A;  1IO2 A;  1TK5 A;  3D45 A;  4H0O A;  4B3M K;  4GV9 A;  2VQE K;  3AVC A;  5DK5 A;  4BDY A;  2XY5 A;  2X74 A;  3WUH A;  1BCO A;  3L8B A;  4DF4 A;  4A5B A;  2JWK A;  3QDK A;  1BUP A;  3VQ8 A;  3CCJ N;  4K0K K;  4K8X A;  4CBW A;  5CY4 A;  2D5R A;  3VEN A;  4BY9 C;  2B5J A;  3DLK A;  2B6A A;  4IJA A;  5CZ1 A;  1NGH A;  2QKK A;  2UUA K;  3ENB A;  2RF2 A;  4H4M A;  4KHP K;  1S3X A;  1VSJ A;  2FF3 B;  3EKS A;  4DU1 A;  2WBN A;  2O8E B;  5JS1 A;  1L3V A;  1Q81 O;  4BRC A;  5HOO A;  2O8D A;  5B8H A;  3RSE B;  3I8D A;  5FLX O;  1HNW K;  4BGB A;  5I3U A;  3OVN A;  4CJ5 A;  3J7Z O;  4DV7 K;  1SS6 A;  3LAK A;  3S3O A;  2QXL A;  3ATV A;  4CEQ A;  1I39 A;  4DB3 A;  4JAX A;  4JD2 A;  2VG7 A;  2ZJP L;  2CGL A;  3CQ8 A;  1MWM A;  3VQ5 A;  4CEA A;  3MXM A;  2F9T A;  3D6R A;  1XC9 A;  1NJI O;  1QSY A;  3VTH A;  1S22 A;  5AQY A;  2VWJ A;  2IVP A;  1REV A;  5M1K A;  4IBN A;  5DM6 L;  4B3O A;  4ILH A;  3CJ7 A;  3CIP A;  4JKF A;  4CEF A;  1U6Z A;  2EX3 A;  4E1M A;  3T1Y K;  2JGU A;  3KIO A;  1VK0 A;  3SPZ A;  1VRU A;  4DV2 K;  1S1V A;  2Z1I A;  4WQ4 C;  4BR9 A;  1C0T A;  4J8F A;  4DTS A;  4YNQ A;  5J2Q A;  1TUU A;  3IKM A;  3SQ2 A;  1RBU A;  3HM8 A;  3ZSX A;  3MAQ A;  4M7Y A;  1QHA A;  2NUB A;  2HNY A;  4W5O A;  5FPE A;  2DFH A;  4GMJ B;  3DWL A;  2QTD A;  3LDN A;  3RMA A;  3K9J A;  3EE8 A;  4DFM A;  5BPN A;  3RMD A;  3FGU A;  5M1N A;  2GEM A;  4CEO A;  3QB0 A;  2R7Y A;  3ITH A;  3NDK A;  4I2Q A;  1GOB A;  2BE2 A;  2V52 B;  4YY3 K;  1YT3 A;  3BY5 A;  4ELV A;  5H1S Q;  4B1W B;  4AHU A;  1TL3 A;  4K8Z A;  1X9W A;  5AZI A;  1KLM A;  4YOR A;  1J6Z A;  4LSL A;  4FJ9 A;  3S3N A;  3P39 A;  3LAN A;  1L5U A;  5GIP A;  3U3G A;  4FM1 A;  1L3S A;  4CED A;  4ID5 A;  3KLG A;  3AVJ A;  4JKG A;  5FDL A;  3V1Q A;  3MEE A;  1HLU A;  2W40 A;  1J54 A;  4DTO A;  4Z0U A;  4OGC A;  4IEI A;  4PL7 A;  4LF9 K;  4BG8 A;  1TAU A;  4IEE A;  4FW1 A;  2D0O A;  3T7Z A;  4H0P A;  4JHD A;  4BE0 A;  3ZX2 A;  2UXD K;  2XRI A;  3BZK A; 
#chains in the Genus database with same CATH homology
 1RFQ A;  4WQ4 A;  2NRW A;  4K41 A;  5F2R A;  1VQ4 N;  3AGR A;  4H5W A;  5JVH L;  3O9R A;  2VWB A;  2YCH A;  1X3M A;  5TKW A;  2ASP A;  3C7N B;  3R3L A;  3ZET A;  1ATS A;  3ULE B;  1Z05 A;  4YOU A;  4C23 A;  5TKY A;  3QIC A;  1E4G T;  3VGL A;  4NB4 A;  1W2B M;  3ID6 A;  5BPL A;  4IFE A;  2D4W A;  5AQM A;  3MWT A;  5M1Q A;  3QFP A;  4QS8 A;  4DHY A;  4CZH A;  4PKG A;  5AQU A;  1Z6R A;  2KKZ A;  3NMU A;  2YJF A;  3DXK B;  4ISE A;  3UKR B;  1K8A O;  3SK3 A;  1HX1 A;  2V7Y A;  3MN6 A;  3E9L A;  3QBX A;  5AQL A;  4BR7 A;  4BRP A;  5BRH A;  3CCL N;  5GAH P;  3BP8 A;  2JWL A;  3UKR A;  3MN5 A;  1SQK A;  1YVN A;  4H0T B;  4M7X A;  4PL8 A;  4FO0 A;  2QI2 A;  5BRD A;  1NGJ A;  3O08 A;  4YOW A;  2QA4 N;  3IDH A;  3WXK A;  1RGI A;  1X3N A;  3O80 A;  3O4W A;  4UY8 O;  3K9K A;  4DQ8 A;  3FLC O;  3VF2 A;  2GWJ A;  3CXC M;  5AQG A;  2CH6 A;  2E88 A;  2NRH A;  3EE9 A;  5GAE P;  3I55 N;  3R6M A;  4H5T A;  3W3D A;  3BF1 A;  3JS6 A;  4BC2 A;  5M1O A;  2QWN A;  1P8Z A;  1QZ5 A;  4KH5 A;  2PBD A;  4KH4 A;  1V4S A;  5AQT A;  3ZX0 A;  2QEX N;  1EQY A;  3C65 A;  4FOE A;  4I6M B;  4L3Q A;  1Q86 O;  2YHX A;  3HZ6 A;  1BA0 A;  3LDQ A;  4CZJ A;  2CGJ A;  1GLL O;  1Q18 A;  4FWK A;  2OAN A;  1NM1 A;  1HUX A;  2ZJR L;  2HBJ A;  3ZEU B;  3CCS N;  5E26 A;  4BRA A;  2WC9 A;  1WOQ A;  4PKH A;  4BRD A;  3I56 N;  4BRG A;  1BU6 O;  4O5F A;  4YDU A;  1ZXO A;  2VGN A;  3CQY A;  4JK9 A;  5AQZ A;  3O9S A;  4B1U B;  3MX2 A;  1X9J A;  3ZEU A;  4IOC L;  4U7B A;  1ZC6 A;  3R8E A;  1SAZ A;  2P9N B;  4DCH A;  4MLE A;  3JXU A;  3VPZ A;  3G71 N;  1NGI A;  3OBY A;  3B8A X;  4WQ5 A;  3MDQ A;  4BQZ A;  5BRF A;  2NRT A;  4LC9 B;  3U4L A;  4KBO A;  1YIJ N;  1ATR A;  1P90 A;  3KWG A;  1GLJ O;  2QW9 A;  3WT0 A;  3ID8 A;  4E1J A;  4BRL A;  3D2F B;  1YJN N;  1NBW A;  2ZGZ A;  1JJ2 M;  4QS7 A;  4C1N I;  3SMP A;  4B1V A;  4BRE A;  4K43 A;  2ITM A;  3QBW A;  3O9U A;  1YAG A;  3SJH A;  1BO5 O;  4FWL A;  1R59 O;  5AQW A;  1DKG D;  1OKJ A;  4FSV A;  2VCP A;  3VEW A;  2Q2R A;  2FF6 A;  3D2F A;  4FOI A;  5AZI B;  1GLB G;  3HOS A;  3CJB A;  2PFU A;  4FWS A;  2HBL A;  1JCF A;  5FPN A;  3GDQ A;  1JCG A;  2P9K B;  4YOV A;  4JN4 A;  5JIC A;  3M1F A;  4FWO A;  4GNI A;  3S41 A;  3J8A A;  2NLX A;  2V7Z A;  2GUP A;  3M5R A;  3MN7 A;  3MMV A;  3VET A;  3LDP A;  4CI6 A;  2Q0R A;  2P9K A;  2NZT A;  5I9E B;  5AQF A;  3D2E A;  4FVU A;  3IUC A;  3IFR A;  1VQ6 N;  3CJA A;  5AZJ B;  3EN9 A;  3CPW M;  4JKE A;  2E8A A;  4A61 A;  4WFA L;  1LOT B;  1BA1 A;  3F5T A;  1VQM N;  4NO7 A;  3A5O C;  2ASO A;  1DT9 A;  2A42 A;  2HF3 A;  3P4I A;  4CZF A;  5AZJ A;  3SBG A;  3CCU N;  4B1Z A;  3CER A;  2RE2 A;  5GIN A;  4WF9 L;  4DKW A;  3SMS A;  3E9O A;  2GWK A;  4IO9 L;  3O1W A;  5C15 A;  5KPZ A;  3TPQ A;  4AM7 A;  3UB5 A;  1NMD A;  3CJ9 A;  4EHT A;  1Q82 O;  2NRZ A;  1VQ7 N;  4H5V A;  4MO5 A;  3CCQ N;  3Q7B A;  3R1X A;  2ZGY A;  4JNE A;  2NRV A;  2CGK A;  3BEX A;  3FZK A;  4BC4 A;  4YOX A;  1K73 O;  2QWP A;  3WQU A;  3UKU A;  2P9S B;  2IIR A;  1T6D A;  3O6W A;  4A57 A;  3D7E O;  3H1Q A;  4A59 A;  2ZWH A;  3ENO A;  5C10 A;  1JCE A;  3VES A;  5KPR A;  3C0B A;  4FWQ A;  3CI5 A;  3HTV A;  4WFB L;  2P9S A;  3VEY A;  5BN8 A;  3WQT A;  2QWL A;  3PLA A;  4EFH A;  1VQ8 N;  1E4F T;  2W41 A;  4FPA A;  1U2V B;  3O9T A;  1YHQ N;  3CMA N;  1SZ2 A;  1IG8 A;  4AF1 A;  1EO1 A;  1VAZ A;  5JVG L;  4BRQ A;  5F1X A;  3CPE A;  1CZA N;  3E9P A;  4JKD A;  2FXU A;  3AAR A;  1U2V A;  5AQK A;  2QWM A;  3MN9 A;  2I7N A;  4IDH A;  4JK7 A;  3HRG A;  4AM6 A;  2F7T A;  3E1Y A;  3TTF A;  5JMV A;  1QVF M;  1V4T A;  5M1F A;  3AAP A;  2I7P A;  4MDA A;  3ZYY X;  3VEV A;  3VTI A;  3PIP L;  3FE1 A;  5M1P A;  3R9P A;  4F9O A;  2A5X A;  3KZB A;  3VEZ A;  3CCM N;  1VQ5 N;  3MK6 A;  1NGB A;  3Q7C A;  3MX5 A;  3OW2 M;  1T3V A;  2NNW A;  4PKI A;  5AQX A;  2HF4 A;  4H5R A;  3SBT A;  5F0X A;  1M1K O;  4BVO A;  4FWR A;  3U9Z A;  1K9M O;  1NGC A;  3VOV A;  5BRE A;  1BWF O;  5C0Y A;  1VQ9 N;  1GLF O;  2H3G X;  3GBT A;  3TSU A;  4FWM A;  2E2N A;  5AQH A;  2AP1 A;  3CHW A;  4YOT A;  1WUA A;  3ATU A;  4XH1 A;  4KH6 A;  3G25 A;  3PIO L;  4QS9 A;  4RTF D;  3WEE B;  1LCU A;  1C0F A;  2Q36 A;  3IMX A;  3VEX A;  2HBM A;  1ZBS A;  4H03 B;  3O9Q A;  5GAD P;  3W0L A;  1K8K B;  5BPM A;  1VQL N;  3LDO A;  5LJV A;  2QWQ A;  3WEE A;  2F9W A;  4EAH D;  2QWR A;  3EKU A;  3QML A;  5GIO A;  4XH5 A;  3H3O B;  1YIT N;  3GL1 A;  1K8K A;  5ELZ A;  3VEO A;  3A5M C;  2PAV A;  3HBT A;  5EOY A;  1KAX A;  3MCP A;  1GLC G;  3MWP A;  2D0P A;  2HMP A;  4BVP A;  4R79 A;  4HWI A;  5ADX A;  1KC8 O;  4XH4 A;  2IVO A;  3FZF A;  4NLC A;  1GLA G;  4BRF A;  5AQI A;  1C0G A;  3CET A;  2Q31 A;  2FLO A;  3EO3 A;  1YI2 N;  4HTL A;  4B9Q A;  3HI0 A;  5FPM A;  3C6A A;  4BRN A;  3CC2 N;  3LL3 A;  4A62 A;  2VGM A;  2IVN A;  1TYQ A;  3A8Y A;  3U9D A;  2P9L B;  2BUP A;  3LM9 A;  1T44 A;  5AQR A;  4H0V B;  3SAG A;  2YX6 A;  2HOE A;  2RHK A;  3M3Z A;  3SLC A;  3D2E B;  1NGA A;  1XC3 A;  4BRO A;  2ZJQ L;  4PHT X;  5BR9 A;  4BRK A;  3KK7 A;  4FWP A;  3VF4 A;  4IJN A;  1TUY A;  2D1K A;  2KLA A;  2P9L A;  4CBX A;  4EHU A;  3RVC A;  4JKC A;  2E2O A;  2YJE A;  5C2F A;  5HL7 L;  5C2D A;  1KAY A;  2QM1 A;  5AQP A;  3VMF B;  3L6Q A;  3HOT A;  4CZL A;  5MLC Q;  1Y64 A;  5AQS A;  1KAZ A;  3KHY A;  4JEP A;  5E84 A;  1N8R O;  3WXJ A;  1VQO N;  2AA4 A;  4BC3 A;  3I33 A;  3TTC A;  2OTL N;  5AQO A;  3EL2 A;  2YHY A;  3ZX2 A;  4WCE L;  3CF5 L;  1ESV A;  3G4S N;  4JKA A;  1KXP A;  2UYT A;  3H45 C;  4CZG A;  4BR5 A;  2A41 A;  3AAQ A;  3CME N;  2V51 B;  3UKU B;  4CZI A;  4GV3 A;  3H3N O;  4A2A A;  3DAW A;  4GY2 B;  1YXQ A;  3N4Q A;  4FPB A;  5EX5 A;  4H0O A;  2CH5 A;  1OVY A;  4BRH A;  2DPN A;  3CCV N;  4GV9 A;  2ASM A;  1NGG A;  3UE5 A;  5CHI A;  1KQS M;  2YHW A;  3WUH A;  3A5L C;  4JK8 A;  4A5B A;  2JWK A;  3QDK A;  1BUP A;  4ILJ A;  5JLH A;  2E20 A;  2HST A;  2Q1N A;  5AQJ A;  2E1Y A;  2BTF A;  4A5A A;  2A6A A;  5AQV A;  3WXM B;  3CCJ N;  4H5N A;  4CBW A;  3FFK B;  5CR4 A;  1NGE A;  1ILY A;  4BR2 A;  3VEN A;  5KQ8 A;  4BY9 C;  1BG3 A;  1MWK A;  3M6G A;  1QZ6 A;  4K42 A;  3I8B A;  4IJA A;  5AR0 A;  1VQK N;  1NGH A;  4RWT A;  3VGK A;  3CQX A;  3ENB A;  1YF5 L;  4IOX A;  4G9Z A;  1D4X A;  1XUP O;  1YUW A;  1S3X A;  4JKB A;  3VF6 A;  3SAH A;  3L0Q A;  2FF3 B;  3EKS A;  2WBN A;  4ISF A;  1Q7Y O;  1Q81 O;  1RDW X;  1O13 A;  3MCA B;  3N4P A;  3O1B A;  3F9M A;  5EVZ A;  4BRC A;  5HOO A;  3E66 A;  3TU5 A;  3C7N A;  5B8H A;  3RSE B;  2BH1 A;  2FSN A;  4GVE A;  3ULE A;  4BG9 A;  4BGA A;  2P9I B;  1MDU B;  5EY4 A;  3OA9 A;  2J4R A;  1ATN A;  4IXC A;  2P9P B;  4Z94 A;  4GV6 A;  5C12 A;  4BGB A;  4ISG A;  3LDL A;  4M63 C;  3RSE A;  3J7Z O;  3LM2 A;  4JD2 B;  3DXK A;  3L4Q A;  4C1N K;  2KHO A;  2P9I A;  1G99 A;  1SS6 A;  1BOT O;  3H1V X;  2QXL A;  3ATV A;  4MLH A;  5DM7 L;  2P9P A;  2YI1 A;  3C6H A;  3P31 A;  4O8U A;  4DB3 A;  4B1Y B;  4JAX A;  3TTD A;  4JD2 A;  3T69 A;  2ZJP L;  2CGL A;  1QQM A;  1QQN A;  1MWM A;  2NRR A;  3GG4 A;  3NVK A;  2F9T A;  1RDU A;  3D6R A;  1NJI O;  1IJJ A;  2WFB A;  1YJ9 N;  4RCH A;  3VTH A;  1S22 A;  5AQY A;  3A0I X;  4BQL A;  2IVP A;  5M1K A;  4K25 A;  3BF3 A;  3FR0 A;  3H46 O;  1HKB A;  3O8M A;  5DM6 L;  4ILH A;  3CJ7 A;  4ILG B;  5LY3 A;  3CIP A;  4JKF A;  4EIA A;  1U6Z A;  3OBW A;  5EXW A;  4YOY A;  4CZK A;  2EWS A;  4CD3 A;  2VYP A;  4U67 L;  3FZL A;  3U8X A;  4WYB A;  1HJO A;  1DEJ A;  4I6M A;  3O5B A;  5FPD A;  1VQP N;  3AGK A;  4MO4 A;  3ENH A;  2GTD A;  3OHR A;  3P38 A;  4IO8 A;  4FWN A;  4WQ4 C;  5ADX H;  1VQN N;  4BR9 A;  4CJ7 A;  1TYQ B;  3SAF A;  1MA9 B;  3FZM A;  4J8F A;  5KQD A;  1M90 O;  3CJC A;  1TUU A;  3IKM A;  4A2B A;  3BUZ B;  1DGK N;  3HM8 A;  3DXM B;  1W97 L;  5AQQ A;  4O8K A;  4FL9 A;  4M7Y A;  1NLV A;  4CZM A;  2E1Z A;  1QHA A;  4IWV A;  2E2P A;  4NLB A;  2P9N A;  4XEI A;  3TSQ A;  3G6E N;  4BR0 A;  4BRI A;  4JKH A;  1BDG A;  5JLF A;  3DXM A;  5FPE A;  3DWL A;  2QTD A;  3LDN A;  3QFU A;  3K9J A;  1QQO A;  5AFU A;  2Q97 A;  3A5N C;  1T6C A;  3EE8 A;  2GX9 A;  5AFU H;  5BPN A;  1KD1 O;  3FGU A;  4H0X B;  5M1N A;  4WFN L;  3AY9 A;  2GEM A;  3QB0 A;  1HKG A;  5GAG P;  3KVG A;  2E2Q A;  2FSK A;  3GOI A;  3WXI A;  4H0Y B;  4OPA A;  2V52 B;  2P9U B;  5LJW A;  2A40 A;  3KWI A;  4B1X B;  5H1S Q;  4Y0W A;  2ZF5 O;  3FZH A;  1NGF A;  3L4I A;  4B1W B;  4CZE A;  5CE3 A;  5BN9 A;  3CC7 N;  4MDB A;  5AZI A;  1XQS C;  3VGM A;  3TSP A;  4YOR A;  3DJC A;  3WXL A;  2P9U A;  1J6Z A;  3CD6 N;  2WUS A;  1HPM A;  4JKG B;  1NGD A;  3GE1 A;  3P39 A;  3F2K A;  3HSC A;  3CJ1 A;  1HKC A;  3NVM A;  5GIP A;  1NWK A;  1GLE G;  2GEL A;  2NRX A;  3H6E A;  3CC4 N;  1S72 N;  3CCE N;  5AQN A;  4IOA L;  4JKG A;  2OTJ N;  1YJW N;  3ZX3 A;  4BRM A;  4BR4 A;  5KPT A;  1QVG M;  4OO1 J;  3VER A;  1HLU A;  2W40 A;  4YDU C;  1H1V A;  4JHD B;  4IEI A;  4CBU A;  4OPH A;  3CCR N;  2QWO A;  2Q0U A;  3EZW A;  4PL7 A;  4BG8 A;  2HBK A;  4IEE A;  1GLD G;  2D0O A;  4IZ9 A;  3T7Z A;  4H0P A;  4JHD A;  2A3Z A;  4WQ5 C;  3ZET B;  4CD1 A;  2FSJ A;  3DLL L;  4BC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...