4WFAL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with linezolid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfaL01
1VQON 3CCSN 5GAEP 4WF9L 5JVHL 5GAGP 1K73O 4IOCL 1VQ8N 1M90O 3DLLL 3OW2M 3CCMN 1YITN 1W2BM 3CCLN 1K8AO 3CC7N 1VQ6N 2OTLN 1YHQN 1VQKN 5HL7L 2ZJQL 1KC8O 3CC4N 1VQ9N 5MLCQ 1VQLN 1K9MO 4WFAL 1Q7YO 3CCQN 5DM6L 1YJWN 1YJ9N 4UY8O 3CC2N 5GADP 3G4SN 1Q86O 3CCRN 3G71N 4WCEL 4WFBL 1KQSM 1QVGM 4IOAL 3PIOL 1YIJN 1YI2N 3I56N 5DM7L 4U67L 1N8RO 3CPWM 1S72N 1NJIO 1KD1O 3CCEN 1JJ2M 1VQ5N 1ILYA 1OVYA 1Q82O 1VQPN 3CXCM 1M1KO 3CD6N 3CCUN 3CCVN 4WFNL 3G6EN 3CCJN 1VQMN 1VQ4N 2ZJPL 3PIPL 3CMAN 3I55N 3J7ZO 2QA4N 1YJNN 3CMEN 1VQNN 2QEXN 2OTJN 5JVGL 4IO9L 1VQ7N 2ZJRL 1Q81O 1QVFM 5GAHP 3CF5L 5H1SQ
chains in the Genus database with same CATH superfamily
3CCSN 4JV5K 4FOIA 2WUSA 3P38A 4IOCL 1NJZA 4Z4GA 5M1QA 2GUPA 1LWCA 4YOVA 3V9ZA 3THVA 2D0OA 3AVHA 3KWGA 2ASPA 5E41A 4CBXA 1K8AO 4LFCK 3CC7N 1F21A 2OTLN 2AA4A 3K57A 3L2WA 3DXMA 1R0AA 3VETA 4R79A 3DMJA 4WYBA 4H5VA 5LJWA 3DXKA 1J53A 2VYPA 3CQXA 1NK9A 3WQUA 1JLEA 2PY5A 3CM5A 1VSEA 1ZBUA 5CY4A 4FJ7A 4DV6K 3A5NC 3QIOA 2VWJA 1EWQA 5A2QO 1HNWK 5I42A 3VENA 2VCPA 3G4SN 4CFCA 3NE6A 1TUUA 4JKBA 3OYIA 5LMNK 4BRKA 4DQPA 2E8AA 2O8BB 3KLGA 1HKGA 2W6LA 4NCAA 1I3AA 3CG7A 4KHNA 3NAEA 2VQEK 3C6HA 1HRHA 2NRZA 1OH8A 1KRPA 4RG8A 4G1QA 3MCPA 1GOCA 3O3FA 4BG9A 1T8EA 4YFUA 4ELVA 2PAVA 1VQ5N 5CR4A 3QESA 4AHCA 1NK8A 5C0YA 4B1YB 2YKMA 4WFNL 3CCVN 1RT1A 5J1EA 4Z4FA 2ZJPL 4O8KA 3LM2A 3WEEA 2BTFA 1S1VA 2AJQA 3IS9A 1ZC6A 4FM2A 4DTNA 4N5SA 2Q1NA 3LZJA 4G9ZA 2ETJA 1VQNN 5LL6Z 4KFBA 4AQYK 2UXCK 2F7TA 1QS4A 3LM9A 4EZ6A 1IJJA 2FSJA 4FJIA 4UQGA 1W9HA 5I3UA 3GBTA 3FLCO 1CZ9A 4GNIA 1RTJA 1T3VA 3LWMA 3VQ8A 4DWIA 4BRMA 2YCHA 4L8RB 5KGWA 2E2QA 5M1OA 1TKDA 4X62K 4FLZA 4K25A 4DTSA 1LCUA 1GLCG 1BIUA 1EETA 1OVQA 4CK3A 3L2QA 4DFPA 4M3XA 3D2EA 4Y1DA 4FLYA 1IH7A 3EY1A 2HHWA 1HNIA 4EFHA 1TAUA 2KHOA 2JWLA 3O1WA 1NM1A 5EY4A 1FXXA 4AM7A 2Q3SA 4CK2A 3FR0A 3MX2A 2E6MA 1SL0A 1NNEA 2QTDA 3L8BA 3T69A 3M5RA 5AFUA 1RDDA 1ASVA 4QS7A 4GV9A 3DOKA 5C2FA 4M3UA 2HVHA 4CHYA 1WSIA 4HTLA 4DQQA 3QINA 3VQCA 3I33A 4O44A 1N8RO 3OYGA 1MA9B 1Q82O 4B3SK 1L5UA 3AA2A 3F5TA 3MEEA 4B1WB 1KVCA 2WONA 1EWRA 4YY3K 1XHXA 2ASOA 4CF2A 5EX5A 1VQ4N 4I2PA 4CIGA 3PIPL 4H03B 4O5BA 4CJKA 4YOUA 1C0UA 1GLFO 3OYEA 4KHYA 3RTVA 2Q2RA 3VMFB 3VESA 4CGFA 3KLIA 2QKKA 2QM1A 3P39A 1C1AA 1RBUA 1NMDA 1C0GA 3NMUA 4CZKA 3KLFA 1RT5A 3AVKA 1VQON 1JL2A 3GE1A 3JSMA 4FK0A 4Q0BA 4WF9L 2FF6A 4DQIA 3MN9A 3AVBA 4K42A 1RDWX 2J4RA 3OS0A 3CCLN 4O0JA 3OY9A 4MDBA 4FVUA 3LZIA 2O8EA 5BN9A 1MU2A 3V1QA 3VOVA 2E6LA 1KAXA 3O8MA 1RBSA 2ZJQL 1HJRA 3SUPA 3QETA 3UKRB 3VEXA 1VSIA 3TSUA 3FGUA 3O4NA 1VRTA 3AAQA 3VGLA 3GOIA 3D45A 4Y0WA 4FLTA 4BQLA 2HHVA 4FJ5A 1SAZA 2VG5A 1K9MO 4FWNA 3RRHA 1S1XA 4KH5A 1NK0A 3MMVA 4H5RA 3ATVA 4FJ9A 3VTHA 4BRQA 1C6VA 1Y97A 2A1SA 3NH0A 2RKIA 3L0QA 4H0PA 5TKYA 3THYB 4X65K 3C0BA 3SQ1A 1HKBA 2HHSA 3NFAA 5F1XA 4LF8K 5CE3A 3GG4A 3RMDA 3RSEB 2OANA 3DM2A 4MLHA 3A2FA 4IOAL 3SQ2A 3VN5A 3EYZA 4JD2B 3SUQA 4WQ4C 4DG1A 1NWKA 5DM7L 2WTUA 4OGCA 1EP4A 2YNFA 1JJ2M 2ZF5O 2F9WA 3D2EB 4B9TA 2FBXA 2ZWHA 2CGLA 5KQDA 4JK8A 3DRRA 3CXCM 1WSFA 1LOTB 1NJWA 2ZGZA 3FZFA 2NZTA 2HHTA 1D9FA 1NK7A 5M1KA 2YHXA 4CZEA 3RVCA 5GIPA 1C1CA 2F4VK 2IVPA 3JXUA 4FCYA 4IEEA 3IKMA 3AO4A 3CMEN 4IG3A 3V1RA 3HI0A 4OJRA 4H0XB 3KKSA 4GVMA 2QWOA 3H46O 5KTQA 4W5TA 4CJFA 3TAQA 1VQ7N 1XUPO 2P5OA 5AQPA 2ZGYA 5FPNA 3WXMB 4QOZB 2E88A 3IUCA 4FL9A 5AQYA 2V51B 1C0FA 4U7BA 4Z4EA 4TSXA 5HP1A 3LDNA 1JXBA 4JAXA 4CECA 4H0YB 4KTQA 2A42A 1UA1A 4PA1A 3WXLA 3ENOA 1W2BM 4CJSA 2W40A 3QEIA 1HYSA 3EEQA 2HSTA 1VQKN 4CZIA 4NYNA 3VQ7A 1HPMA 4QS8A 3NGIA 1BUPA 3VF4A 1Z05A 4RTFD 1ATRA 1NGJA 3LDQA 4DR5K 4B8CA 3SUNA 3TWHA 5MLCQ 3CFRA 1TVRA 3HM8A 3DOLA 4CEOA 4E3SA 1S1WA 3A5LC 4KREA 1NK4A 2YHYA 3K58A 3M8QA 3BY5A 4AILC 1NKBA 3U3YA 1KAYA 2HBJA 1SKSA 4H4OA 4GV3A 3VTIA 3VEYA 5JS1A 4CEDA 3QNNA 1KLMA 5BREA 4EAHD 4J2AA 4NYFA 1JCFA 3NHGA 3T1YK 5KQ8A 4BACA 3PIOL 2BUPA 2KW4A 5AZIB 3U9DA 3E9OA 5BRFA 3I56N 2O8DA 4OGEA 4OKEA 1S72N 3H1VX 1NJIO 3UE5A 3ASMA 4RW9A 2O8CA 1DLOA 3QO9A 1SS6A 1E3MA 2HMIA 4JKGB 3GL1A 4BR4A 5KGXA 4QCLA 4M41A 4B1XB 1KSPA 3QFPA 1GLEG 2KFZA 1CZBA 1TUYA 3QICA 2ITGA 2GELA 2HBMA 4AHSA 5JICA 4JYAK 1DEJA 4ICLA 1VSHA 5ADXH 1JLBA 1TYQA 1ATNA 4DR1K 3I8DA 3TAMA 3AY9A 2DPNA 3EZWA 4KKOA 4CF0A 3P5JA 3U4LA 3QLHA 1WLJA 2RN2A 1TK0A 2Y1IA 4V19S 1E4FT 3OS2A 1RCHA 2KKZA 5GAGP 5BN8A 4OKJA 1X9WA 1YITN 3M8SA 3VQPA 2QWNA 4CIFA 1YXQA 3CJBA 4WQ5C 4DSLA 4EIAA 3I0RA 1IBKK 3ULEA 1S22A 1LWFA 3SJJA 1EXQA 3THWB 4JK9A 2E2NA 1SUQA 4FJMA 4CJWA 2A6AA 3KWIA 4MO4A 3RR7A 1GLAG 3HYFA 3ZEUA 4HWIA 1WUAA 2PZSA 3OHRA 3HRGA 4GW6A 2I5JA 4QS9A 2NRVA 4BREA 5IWAK 4QAGA 4NLCA 3P83D 4DSJA 4CF9A 2Q0RA 3DLEA 4O5FA 3HBTA 4A5BA 4N41A 3CJ1A 3PY8A 3LDPA 3K9KA 4AM6A 3CFPA 1TK5A 5KRSA 5C24A 3TR8A 5FPEA 1RT4A 4DR4K 4JRPA 1A5WA 4DV5K 4Z4CA 4LFBK 4DV0K 1NKCA 4PQUA 4GY2B 3KD1E 4DMNA 1RTIA 3LP0A 4BRHA 1RDUA 4PHTX 4FW2A 3C7NA 2YHWA 3R9PA 1HQEA 2P9SB 4FOEA 4C1NK 3SPZA 4I7FA 2YNHA 4BC2A 4DV1K 4PWDA 2RPIA 4K43A 4Z4IA 2QK9A 2VGNA 3CYMA 1QHAA 1REVA 4B08A 1UA0A 4FJ8A 1ATSA 2W42A 4CJRA 3R3LA 5CHIA 3DLHA 3GDQA 2X6SA 5JVGL 2IOCA 4J2EA 4LFAK 3J7AP 2ZJRL 1DGKN 5AZJA 3HM9A 3CF5L 4DFMA 3TAEA 4BRLA 1Y64A 3ZT1A 3QBWA 3HPHA 3S3OA 1RFQA 3CQYA 4AHRA 5E84A 1HJOA 4A2AA 3ZETA 3CCMN 4DSFA 4JRQA 2VGMA 1KVBA 2W6KA 4H8KA 4IFVA 4BGBA 2P9PA 3K5OA 5FPMA 4DTJA 4CJVA 4CEZA 4B1UB 3T3FA 1C1BA 2GTDA 5LY3A 4FJXA 4PKHA 3PLAA 3TAGA 1BQMA 4DSIA 2R7YA 4FWRA 1P90A 5C12A 4EZ9A 3Q7BA 4IZ9A 1TKZA 3DWLA 3ID6A 1NK5A 2CGKA 2IVNA 4KHUA 2JWKA 3UB5A 5BPLA 2FBVA 3LL3A 5HRNA 4OO1J 1HNZK 4DF8A 3QDKA 2E2PA 3RMBA 1QVGM 5J2PA 3T1HK 4CEEA 3IDHA 3THXA 1UWBA 4ZHRA 5SWMA 2UXDK 1XNRK 4F3TA 1XC9A 4BQZA 3WQTA 4JI7K 3ZYYX 4C8KA 1OVYA 4BRIA 2O8FB 3AA4A 3VQ6A 1WBBA 2VG7A 3BEXA 3PSFA 1XWLA 1DTQA 3RMAA 3LP3A 5K14A 3ZSYA 4YDUC 4C1NI 3A0IX 5AFUH 2Q36A 2XY7A 5FRMA 3CETA 4KHPK 1GOAA 3O3GA 1QZ6A 3FZHA 3NH1A 1U48A 1JLFA 2A5XA 2A41A 3VQ4A 2XY5A 2QEXN 2NRTA 4CHQA 1LW0A 4IO9L 4BRAA 4B3MK 2YNGA 2OPPA 3F2KA 3K2PA 1ZYQA 4JS5A 4WQ4A 4HTUA 2P9LB 5AQZA 4M3ZA 3EE8A 3OYNA 1HQUA 4KBOA 3OYCA 2O4GA 3O6WA 2X74A 4KPYA 3FE1A 4DFJA 4LC9B 4HHTA 4BR7A 2B6AA 4BR0A 2WFBA 4BWJA 3NBPA 3JAMO 4R5PA 4E7KA 5LJVA 1Q8IA 3WT0A 3HPOA 4A59A 5EXWA 1YVUA 1ZBSA 3H3NO 3QERA 3OYAA 3VQQA 4AHUA 2A3ZA 1XNQK 1MWMA 3E1YA 2P51A 3VPZA 4B9QA 1H1VA 3WNEA 2YHBA 4K41A 4IO8A 1ZBLA 5M1NA 3I8BA 1YF5L 4I9QA 3WXIA 3RWUA 2YNIA 3EL2A 2OA8A 3DLKA 3HTVA 2Y1JA 1SZ2A 4KB1A 3A5MC 2NNWA 2GV9A 5EU7A 4IEIA 4U67L 3SAHA 3S3NA 1KD1O 4FLXA 3SV4A 5I9EB 4XH1A 2ZM6K 4PY5A 4CCHA 3SJHA 1T44A 4LSNA 3HSTB 3V9SA 3B6PA 2HVIA 2V52B 3ZX2A 4E7LA 5J2QA 3MXIA 1BISA 4ILJA 4X64K 4FPAA 2HBLA 2QWRA 3O1BA 4DQRA 3TSPA 2YX6A 3TI0A 3K0SA 3HXMA 4DU4A 1YJNN 3NCIA 3IAYA 3DXMB 3G25A 3WNGA 1X3NA 5AJ3K 2Z1IA 3AO2A 3V1OA 4IJNA 1KCFA 4JI8K 5CYMA 4PL7A 5BR8K 1RDCA 3J80O 3DXKB 2KFNA 2PFUA 1EO1A 1U04A 5GAEP 3AVJA 5JVHL 1D8YA 3NGZA 1K73O 2UXBK 3CFOA 3VEVA 1M90O 3P31A 4FJLA 4FZZA 3J8AA 2ZE2A 3EO3A 3O3HA 2FSNA 3HP6A 2DY4A 5T7BA 1YHQN 1WSGA 4ISGA 4F9OA 1HUXA 4FWKA 3ZSRA 3IFRA 3PV8A 1G99A 4A2BA 5KPZA 1WSEA 2I7PA 3QIPA 2B4JA 3AV9A 3HOSA 4DLEA 2P5GA 1S3XA 2WOMA 4IOXA 3OA9A 1XHZA 3WUHA 1YJWN 2HF3A 4O55A 2QXLA 4NLBA 2X6NA 4BVPA 3SQ4A 1HYZA 1CXQA 4BDPA 3MDQA 3MK6A 2OPQA 1JLCA 3C6TA 2B5JA 3MWTA 2G8VA 4RW6A 2ZD1A 1TAQA 3WEEB 4WFBL 3FZKA 3D0PA 2HHHK 1BQNA 4JHDA 2YV0X 5AQWA 1NLVA 3AVNA 3TTFA 4M3TA 2Q97A 4CJ3A 4WQ5A 4YOYA 4GVEA 5D3GA 1K8KA 4DU1A 4M3YA 1ZXOA 1HX1A 3ENHA 1HR0K 2HNDA 4DUYK 4B3TK 1ILYA 2P9UA 4FPBA 2CGJA 4HCBA 4L3QA 2XHBA 3ISNC 4CJPA 3HZ6A 1R59O 4E7IA 1GOBA 1J6ZA 3CJ9A 3MECA 3I55N 2P9KA 3S3MA 5AQVA 1U2VA 3C6UA 4XIUA 4Z94A 3SBTA 4DQSA 3NVMA 4KRFA 3IMXA 1SKRA 3AVIA 4X66K 4BVOA 4OKKA 3TAFA 2HNZA 5GAHP 1QTMA 4OVLA 1WN7A 4BWMA 5C2DA 1FK9A 4DFKA 4DCHA 3WXKA 4O4GA 5AQHA 4BRDA 1NGCA 2P9IA 3V81A 2ATQA 3FZMA 3DLLL 1N34K 3OW2M 4KH6A 2IAJA 1HYVA 4KHWA 2QXFA 4JS4A 4BRNA 4YOTA 1TKTA 3HK2A 1BU6O 2NLXA 4JI0K 3KLHA 1FKOA 3QEPA 4IWVA 3DRSA 2D0AA 1D5AA 3UKUA 2V7YA 3NVKA 3I0SA 3L4QA 3LPTA 3VQDA 4OPKA 4AHVA 3JYTA 3HVTA 4BC3A 3VEZA 4HVJA 4DR2K 3TSQA 5KPRA 4E7JA 4IJAA 1RGIA 3HPGA 3O9TA 3G10A 3SMSA 3ZSQA 4JEPA 1JKHA 1JL1A 3SQ0A 1C0MA 4BC5A 1FKPA 3OYBA 2D0PA 3D2FA 4YORA 1QQNA 2GWKA 1WSJA 3CCRN 4CEBA 3EE9A 3KK7A 2O4IA 4LH4A 1TL1A 1KQSM 2G8WA 4H5TA 5CZ1A 1KFSA 3SV3A 1IKXA 4FWMA 5BR9A 1U47A 1DTTA 3VEWA 1TV6A 4CF1A 3S9HA 4B3OA 1FJGK 2G8FA 4EHTA 4FLWA 1QZ5A 1NKEA 1KFDA 3KKRA 5AQMA 4A61A 2G8UA 1EX4A 3SLCA 1NGEA 3CQ8A 1D4XA 1RTDA 3H1QA 1BCMA 5BRDA 3BZKA 5GINA 2O8EB 4PKIA 4FW1A 3OJUA 1XMOK 1QQOA 3AVFA 4ILGB 1LW2A 4FLUA 1T6DA 2P9NA 4C8LA 2AP1A 1NGFA 4CFAA 1Q18A 4JKCA 1OH6A 2PYLA 2QW9A 4H4MA 3DLRA 1RT3A 2NUBA 1VSMA 5KI6A 1LV5A 3AA3A 3KLEA 3O9SA 3OVNA 4IKFA 3TTDA 4FZXC 5AR0A 2GWJA 2RHKA 1YVNA 3TARA 1YAGA 4FWQA 2OZMA 1BA1A 1BOTO 2G8HA 4FWPA 5AQXA 5BRHA 5C25A 2HB5A 2IDOA 4I6MA 1Q9YA 2UYTA 5C15A 1FW6A 3NDKA 2IS3A 3U9ZA 5AQLA 3U3GA 3MN5A 1WSHA 4IG0A 3U6FA 3F9MA 4DTRA 3T7ZA 4CJLA 2EHGA 5GADP 4RCHA 1XC3A 1QSYA 1EKEA 3MN6A 3V9XA 4PL8A 2ZQBA 2P9IB 1X9MA 1Q86O 1CLQA 4B9SA 3Q7CA 4E1MA 5AQRA 4ID5A 3HVRA 1QHTA 2GUIA 4LY7A 2KLAA 1W97L 3BF3A 4DTXA 4LF6K 4LF7K 4W5QA 3C95A 1XMQK 3CJ7A 3V6DA 4B1VA 4CI6A 4IXCA 4WE1A 2NRRA 4F2SA 3ZSXA 1N6QA 3E9PA 5BPMA 2OYQA 2O8BA 2IIRA 1L3UA 1RBTA 1JLGA 4N47A 1YT3A 3KK1A 3HT3A 3UIQA 5J2MA 1HNVA 1Q81O 1RT7A 3TTCA 2Z1JA 4BRGA 2JLEA 5SZTA 4YOXA 2QWQA 2QKBA 2P1JA 1W0HA 4JI1K 1C0TA 3VF6A 2XY6A 1VQ8N 4K8ZA 3NF8A 3OYLA 5FDLA 4KHQA 3SCXA 3DYAA 2GEMA 1OKJA 4ELTA 4A57A 1KXPA 2DFHA 1N33K 3L4IA 2OPRA 1J54A 3KK3A 4C8NA 2HBKA 5TKWA 4FJJA 4CHOA 2O8DB 4BR9A 4BC4A 3PUFA 4M3WA 1B92A 2F96A 5AQNA 4FYDA 3ITHA 2EX3A 2PBDA 1S1TA 4FJKA 2P9NB 2O8CB 2FXUA 1KTQA 1B9FA 3ZSVA 3M6GA 4B9UA 1YTUA 3EN9A 2E5LK 3OBYA 1VRUA 1N36K 4MLEA 4BRFA 3ALYA 3BZCA 4DR6K 1TYQB 4FWLA 1YI2N 2D0CA 5HOOA 4DTMA 3B6OA 3M8PA 4BRPA 3SZ2A 4BROA 2QI2A 4FLVA 1VQPN 4PUOA 1ZBHA 4Z0UA 3DLGA 3PX6A 3MEDA 3OYKA 4CHNA 1Z26A 2RF2A 4KHSA 3KVGA 1I39A 3G6EN 3J81O 4F4KA 3L3UA 4CZFA 3L2RA 4FJHA 3HJFA 4I9LA 2F9TA 2GBZA 4CJEA 3C65A 5HROA 1L3TA 4DV3K 3QEVA 2E2OA 2F8TA 4CJTA 5EVZA 3ULEB 3NH2A 1IBMK 1NGGA 5C42A 1S6PA 4ZTJA 2PYJA 4CFBA 2QWLA 3WNHA 2HNYA 3OYFA 3WNFA 1VSKA 4NO7A 2FF3B 4A5AA 4B9MA 1X9SA 1IV0A 3ZSWA 5JMVA 2UUCK 4H5NA 4DV4K 3ZEUB 4BR5A 3O9RA 1NK6A 2VWBA 3OYHA 1S5JA 4OX9K 3F9KA 1MWKA 3O4QA 3U8XA 1KC8O 1KLNA 4M7YA 2OPSA 3O4WA 2I7NA 4CZHA 3HSCA 2FBYA 3AO3A 5AQGA 4DTUA 4J2DA 3LP1A 1WNSA 4HCCA 4KTZA 5AQUA 4WFAL 1Q7YO 3CERA 3D6RA 5AQJA 2VWKA 4CJ7A 4OPAA 4E19A 3R1XA 4E0DA 1BA0A 3C7NB 3LAMA 1QSSA 4FM1A 3QBXA 3O08A 4NB4A 4M3RA 3OJSA 3C94A 3BP8A 1S9GA 3OS1A 3UKRA 3P4IA 4M7XA 4JI6K 2YKNA 4DUZK 3MEGA 1X3MA 1YIJN 2HHXA 1Z25A 2KZZA 3EKUA 3TU5A 2E4LA 1HMVA 2D4WA 4O0IA 4HUEA 1I94K 4MFBA 4N76A 3AA5X 3LDLA 4C8OA 5AZJB 5CZ2A 5AQOA 1NGIA 1TKXA 4CBUA 4C8MA 4GMJB 3CD6N 5AQQA 2JGUA 3THYA 3MCAB 1S9EA 1UOCA 1BCOA 3ZETB 3H3OB 1BHLA 1RT2A 3RSEA 3N4PA 2E1YA 4CE9A 4IFEA 5E26A 5J2NA 4JD2A 3R8EA 3DI6A 3SNNA 2XRIA 1YUWA 1SQKA 3T1AA 5ELZA 2WBNA 2P9PB 3VGKA 3LPUA 3NF7A 3E01A 1NJYA 2E1ZA 3AO1A 3OTOK 4BE2A 4YNQA 3LDSA 3DAWA 1QVFM 3MX5A 4CEQA 5FROA 5B8HA 4KTWA 4FJNA 5M1FA 3ID8A 1RDAA 3AGRA 1J5OA 2IVOA 4EP5A 1VQ6N 4AF1A 3W0LA 4NXNK 5HL7L 4BGAA 4IBNA 4H0TB 3HP9A 1QSLA 2D0BA 4NCBA 2WC9A 1RTHA 1B9DA 3NGYA 3CC4N 4KAZA 4K8XA 3THXB 3L3VA 1A5VA 2YJFA 5M1PA 1LAWA 2G8KA 1HNXK 4BRCA 2NRXA 4FSVA 4DQ8A 5DM6L 1X9JA 3K59A 2FBTA 2KTQA 4UY8O 3PO4A 3MAQA 1JXEA 3H6EA 1U6ZA 1SKWA 3WXJA 3M8RA 3MXJA 4Y1CA 3G71N 5DK5A 3IRXA 4DV7K 1WB9A 4DS4A 4PKGA 3K9JA 4CGIA 3F73A 1G15A 3AARA 5JS2A 4DKWA 4H0OA 1BI4A 3H08A 3VF2A 5C10A 3CCEN 4FXDA 3SPYA 4O8UA 4A62A 1T05A 4BE0A 1OH5A 4OLBA 2DFEA 3EKSA 3ENBA 4KO0A 3AO5A 4DU3A 1VHXA 4E1NA 3M3ZA 3KJVA 4JNEA 1SV5A 3CHWA 4DB3A 3PX4A 2D1KA 2Q0UA 2FSKA 4RW4A 4KI6A 4XH4A 3CJAA 5AZIA 3OYJA 1WBDA 2F8SA 4KH4A 4E7HA 2LSNA 2NRWA 3TAPA 3QMLA 2QWMA 1RILA 2IGIA 4XH5A 3FZLA 4J2BA 1WOQA 5JLHA 3SUOA 3VQBA 1XI1A 3NF9A 3K5NA 1S6QA 4ID1A 4JKGA 4MQ3A 3B8AX 3E9LA 4JKAA 1NU0A 3VA3A 1NGAA 4GV6A 3N4QA 4F8RA 4CGGA 4JKEA 4YHHK 5HRSA 1ASUA 3CI5A 3OYMA 3L2VA 4CHPA 4IDKA 2KZMA 4W5OA 2D5RA 4JLHA 4CK1A 4DS5A 4KV8A 4BDYA 2HHQA 3O5BA 5HRPA 3QFUA 5F2RA 4BDZA 4FK2A 2BH1A 1IO2A 1IBLK 4ZTFA 1IG9A 1NOZA 2UUAK 4M42A 5FPDA 1DT9A 4DV2K 4FJGA 1VQ9N 1V4TA 1HPZA 5AQTA 5F0XA 2FC0A 3MXMA 1GLJO 1VQLN 1JLQA 4F2RA 3CCQN 1U4BA 2HMPA 3ZX0A 3ZT2A 3ZT0A 3V9UA 1YJ9N 1GLBG 4M63C 1U49A 3CC2N 1EQYA 3VQ9A 4RWTA 1JCEA 2HF4A 4JI5K 1LWEA 4N56A 1NBWA 5CYQA 1QE1A 4CZGA 4CBWA 1NOYA 2HHUA 4B9NA 4W5NA 3VGMA 1GLDG 1HLUA 1D9DA 5HRRA 4B9VA 3AVAA 3THWA 3SK3A 4YOWA 3CPWM 4FO0A 2YI1A 2FLOA 4FZYA 4ISEA 1NG9A 1NGDA 4LF5K 4FM0A 4CD1A 1SL1A 1VK0A 2CH6A 3KIOA 1J9AA 3L2UA 1J5EK 2CH5A 2QWPA 3LP2A 3VEOA 1RT6A 3ZX3A 3CCJN 1VAZA 1T7PA 4B8AB 1BGXT 5KPTA 3CMAN 3E66A 1TL3A 2NRHA 4RW8A 1YTAA 4JN4A 1V4SA 3IG1A 2VG6A 2A40A 4RW7A 3T19A 5AQFA 1XQSC 1DKGD 3ULDA 4DTOA 2P9SA 3OBWA 1CXUA 4FVMA 1BG3A 1BI4B 4W5RA 1VSDA 1NJXA 1W7AA 3VQAA 1T03A 4H0VB 2OCEA 4HUFA 4KB0A 4CJ4A 1Q9XA 1BDGA 4CZJA 3A8YA 1X1PA 3K5LA 3MN7A 5DMRA 4CESA 2DFFA 4JKHA 4DSEA 1L3VA 3TABA 2UUBK 2ASMA 4H5WA 3S41A 4CZMA 1ZBIA 3G0ZA 3HL8A 1SL2A 4CJUA 4CERA 3BDPA 1RBVA 4JHDB 4BE1A 1UAXA 4DR3K 4MO5A 3SAFA 5LMUK 4B9LA 1Z6RA 5BPNA 2YHAA 2Z1HA 1K8KB 4DTPA 3HO1A 4LD0A 3HOTA 2P9UB 2EWSA 3FFIA 3K5MA 2DTUA 2BDPA 5IT9O 4K0KK 3BUZB 1IKWA 3SI6A 4JKDA 3VERA 3LAKA 4GKJK 4C23A 1TK8A 4FWOA 1ZBFA 4YDUA 4Q5VA 4EP4A 3A5OC 4E1JA 4WCEL 3RRGA 2P9KB 1ESVA 4XEIA 5GIOA 1U2VB 2Q31A 4CGDA 5AQSA 3PO5A 3ZLJA 4IDHA 3V9WA 4DSKA 1E4GT 3LDOA 2BGGA 5AQIA 3CJCA 3KHYA 3MWPA 1OH7A 3LANA 4OPJA 1NGHA 3QEXA 4IFYA 1IKVA 3SMPA 4ELUA 3C6AA 1M1KO 3FFKB 3SBGA 2G8IA 3DRPA 3D7EO 4AHTA 3RR8A 2HW3A 3ATUA 4E89A 3M1FA 1TGOA 2XO7A 1GLLO 4JI3K 4ISFA 3LWLA 4CEAA 3AVLA 3DJCA 3J7ZO 1A5XA 4Z4HA 3QNOA 4CD3A 2QA4N 4CJ5A 2UU9K 4CFDA 4CEFA 3UKUB 5FLXO 4CVNE 2VQFK 2BE2A 2KQ2A 2Z1GA 3TANA 1LAVA 5H1SQ 2O8FA 3AGKA 1VSJA 4F3OA 3NF6A 4CHZA 4MDAA 1ASWA 3R6MA 3VQ5A 4BG8A 1KAZA 3AVCA 1MDUB 3QB0A 1ITGA 4NCGA 1N5YA 1K6YA 3SAGA 5AQKA 4LH5A 3ZSZA 1WAJA 3J7YP 3AVGA 5KRTA 3D2FB 4B1ZA 1S1UA 3TPQA 2GX9A 4KI4A 1VSFA 2IC3A 1KVAA 4JI4K 1NGBA 1RDBA 4CZLA 3VQEA 1P8ZA 3JS6A 3VA0A 2YJEA 4M45A 2P9LA 3DLBA 4DHYA 1IKYA 4LSLA 4BR2A 3CM6A 4B3RK 4EHUA 4JK7A 4DLGA 3KD5E 2V7ZA 5HLFA 5ADXA 5FRNA 4JKFA 3H45C 1NMNA 1VSLA 1N32K 1HKCA 1BIZA 3O9QA 2X78A 1L3SA 2BANA 2E20A 5JLFA 4DR7K 3PX0A 3RMCA 1RBRA 1U45A 3SYZA 4JI2K 1O13A 3AAPA 4HUGA 3W3DA 1CZAN 4BY9C 3LALA 4FK4A 1BWFO 3CPEA 1IG8A 3BGRA 2W41A 4CF8A 4CIEA 4ILHA 3OYDA 3AVMA 4AH9A 3V4IA 4DF4A 4CW7B 3EZ5A 3O80A 1JCGA 2XY8A 4OLAA 5EOYA 4LF4K 1BO5O 3CIPA 3CCUN 1QQCA 1O1WA 4NXMK 2H3GX 3L6QA 2RE2A 1VQMN 4FWSA 2OZSA 2A1RA 4CJQA 4OPHA 3P1GA 4CGJA 4J8FA 3O9UA 3ZCMA 3KZBA 4LF9K 3QEWA 1BL3A 1QQMA 1RNHA 3ZSOA 4CGHA 1JLAA 3KTQA 3KK2A 2OTJN 3PSIA 3ZT4A 1WAFA 4I2QA 4I6MB 2HOEA 1T6CA 5HBMA 4GKKK 3ZT3A 2ITMA 3BF1A
chains in the Genus database with same CATH topology
5C2DA 1E4FT 5B8HA 5M1FA 4DCHA 3ID8A 3WXKA 3CCSN 4BRDA 5AQHA 4FOIA 1NGCA 2KKZA 2P9IA 2WUSA 3P38A 5GAGP 5BN8A 4IOCL 3AGRA 5M1QA 3FZMA 3DLLL 2GUPA 3OW2M 4KH6A 4YOVA 1YITN 2IVOA 2D0OA 3KWGA 2ASPA 4CBXA 1K8AO 4BRNA 4YOTA 2QWNA 2OTLN 2AA4A 3CC7N 4AF1A 3W0LA 1VQ6N 1BU6O 1YXQA 2NLXA 3CJBA 4WQ5C 5HL7L 4EIAA 4BGAA 3DXMA 4H0TB 4IWVA 3VETA 4R79A 3UKUA 2V7YA 3ULEA 3NVKA 4WYBA 1S22A 4H5VA 2WC9A 3L4QA 5LJWA 3DXKA 3CC4N 4BC3A 2VYPA 3CQXA 3VEZA 3WQUA 4JK9A 3TSQA 2YJFA 2E2NA 5KPRA 5M1PA 4BRCA 2A6AA 3KWIA 4IJAA 1RGIA 2NRXA 4MO4A 3O9TA 4FSVA 4DQ8A 3A5NC 1GLAG 1X9JA 3SMSA 4JEPA 5DM6L 3ZEUA 4HWIA 1WUAA 4UY8O 3OHRA 3HRGA 4BC5A 4QS9A 2NRVA 4BREA 3VENA 2D0PA 2VCPA 3D2FA 3H6EA 4NLCA 3G4SN 4YORA 2Q0RA 1U6ZA 3WXJA 1QQNA 4O5FA 1TUUA 4JKBA 2GWKA 3HBTA 4BRKA 4A5BA 3CCRN 3CJ1A 3G71N 3EE9A 3KK7A 3LDPA 2E8AA 3K9JA 3K9KA 4PKGA 4AM6A 1KQSM 3AARA 4H5TA 1HKGA 4DKWA 4H0OA 3C6HA 2NRZA 5FPEA 3MCPA 4FWMA 5BR9A 3VF2A 4BG9A 5C10A 3VEWA 3CCEN 2PAVA 1VQ5N 4O8UA 4A62A 5CR4A 4GY2B 5C0YA 3EKSA 3ENBA 4BRHA 4EHTA 1RDUA 4PHTX 1QZ5A 3C7NA 2YHWA 5AQMA 3R9PA 2P9SB 3M3ZA 4FOEA 4B1YB 4C1NK 4JNEA 4WFNL 4BC2A 3CCVN 4K43A 3CHWA 4DB3A 2D1KA 2Q0UA 4A61A 2FSKA 2VGNA 2ZJPL 4O8KA 1QHAA 3LM2A 3SLCA 1NGEA 2BTFA 3WEEA 4XH4A 1D4XA 3H1QA 1ZC6A 3CJAA 5AZIA 5BRDA 4KH4A 5GINA 1ATSA 2NRWA 4PKIA 3QMLA 2Q1NA 2QWMA 1QQOA 1VQNN 4G9ZA 3R3LA 4ILGB 5CHIA 2F7TA 3GDQA 4XH5A 3LM9A 5JVGL 3FZLA 1T6DA 2P9NA 2ZJRL 1WOQA 1DGKN 5AZJA 5JLHA 2AP1A 1NGFA 1Q18A 1IJJA 2FSJA 4JKCA 3CF5L 4BRLA 4JKGA 2QW9A 1Y64A 3GBTA 3B8AX 3FLCO 3E9LA 4JKAA 3QBWA 4GNIA 1NGAA 1RFQA 4GV6A 1T3VA 3CQYA 3N4QA 3O9SA 5E84A 1HJOA 3TTDA 4BRMA 2YCHA 4A2AA 4JKEA 5AR0A 2GWJA 3ZETA 3CCMN 3CI5A 2RHKA 2E2QA 1YVNA 5M1OA 1YAGA 2VGMA 4FWQA 4K25A 1LCUA 1BA1A 1BOTO 1GLCG 4BGBA 3O5BA 2P9PA 5FPMA 3QFUA 4FWPA 5F2RA 5AQXA 2BH1A 3D2EA 5BRHA 4B1UB 4I6MA 5FPDA 2UYTA 1DT9A 5C15A 4EFHA 2GTDA 5LY3A 1VQ9N 2KHOA 1V4TA 2JWLA 5AQTA 4PKHA 3O1WA 1NM1A 5EY4A 5F0XA 3PLAA 4AM7A 3U9ZA 5AQLA 4FWRA 1P90A 3MN5A 1GLJO 1VQLN 3FR0A 5C12A 3MX2A 3Q7BA 3CCQN 4IZ9A 2QTDA 3F9MA 2HMPA 3ZX0A 3T7ZA 3T69A 1YJ9N 1GLBG 3M5RA 5AFUA 4M63C 3DWLA 1EQYA 3ID6A 4RWTA 3CC2N 2CGKA 1JCEA 5GADP 4QS7A 1XC3A 2HF4A 2IVNA 4RCHA 2JWKA 3UB5A 4GV9A 3MN6A 5C2FA 4PL8A 5BPLA 1NBWA 2P9IB 4CZGA 3LL3A 1Q86O 4OO1J 4CBWA 4HTLA 3Q7CA 3QDKA 2E2PA 3VGMA 1QVGM 3IDHA 1GLDG 1HLUA 5AQRA 3SK3A 3I33A 4YOWA 1N8RO 3CPWM 4FO0A 2YI1A 1MA9B 2FLOA 4BQZA 3WQTA 4ISEA 3ZYYX 1OVYA 1NGDA 1Q82O 2KLAA 1W97L 3BF3A 4BRIA 4CD1A 3F5TA 2CH6A 3BEXA 3CJ7A 4B1WB 2CH5A 2QWPA 4B1VA 3VEOA 4CI6A 4IXCA 3ZX3A 3CCJN 1VAZA 2NRRA 2ASOA 4YDUC 5EX5A 4C1NI 1VQ4N 3A0IX 5AFUH 2Q36A 4H03B 5KPTA 3E9PA 3PIPL 3E66A 5BPMA 3CETA 3CMAN 2IIRA 4YOUA 1GLFO 1QZ6A 3FZHA 2NRHA 2A5XA 2Q2RA 4JN4A 3VMFB 3VESA 2A41A 1V4SA 2QEXN 2NRTA 2QM1A 3P39A 2A40A 1NMDA 1C0GA 4BRAA 4IO9L 5AQFA 1Q81O 3NMUA 1XQSC 3TTCA 1DKGD 4BRGA 4CZKA 4YOXA 3F2KA 2QWQA 4WQ4A 1VQON 3GE1A 2P9SA 3OBWA 2P9LB 5AQZA 4WF9L 1BG3A 3EE8A 2FF6A 3VF6A 1VQ8N 4KBOA 3MN9A 4K42A 1RDWX 2J4RA 4H0VB 3CCLN 1BDGA 4CZJA 3A8YA 3O6WA 3MN7A 3FE1A 4MDBA 4FVUA 4LC9B 4JKHA 5BN9A 4BR7A 4BR0A 2GEMA 2ASMA 2WFBA 4H5WA 3S41A 1OKJA 3VOVA 4A57A 1KXPA 1KAXA 3O8MA 3WT0A 4CZMA 5LJVA 2ZJQL 1YIJN 3L4IA 4A59A 3UKRB 5EXWA 1ZBSA 3VEXA 4JHDB 2HBKA 3H3NO 5TKWA 4MO5A 3FGUA 3TSUA 3SAFA 3AAQA 3VGLA 1Z6RA 5BPNA 3GOIA 4BC4A 4BR9A 4Y0WA 1K8KB 5AQNA 4BQLA 2A3ZA 1SAZA 3HOTA 1K9MO 4FWNA 2PBDA 1MWMA 3E1YA 2P9UB 3VPZA 2EWSA 4KH5A 4B9QA 2P9NB 1H1VA 2FXUA 3MMVA 3BUZB 4JKDA 4H5RA 3ATVA 3M6GA 3VERA 3VTHA 4BRQA 3EN9A 4K41A 4IO8A 4C23A 3OBYA 4FWOA 5M1NA 3L0QA 4H0PA 4MLEA 4YDUA 5TKYA 3I8BA 3C0BA 1HKBA 5F1XA 1YF5L 3A5OC 4BRFA 3WXIA 4E1JA 4WCEL 5CE3A 3GG4A 3RSEB 3EL2A 2OANA 4MLHA 2P9KB 4IOAL 1ESVA 1TYQB 3HTVA 4FWLA 4JD2B 1SZ2A 1U2VB 3A5MC 2Q31A 4WQ4C 4XEIA 5GIOA 5AQSA 5HOOA 1NWKA 2NNWA 5DM7L 4IEIA 4U67L 3SAHA 4IDHA 1E4GT 3LDOA 1KD1O 5AQIA 1JJ2M 3CJCA 2ZF5O 2F9WA 4BRPA 3KHYA 3D2EB 3MWPA 2ZWHA 4BROA 2QI2A 5I9EB 1VQPN 2CGLA 5KQDA 1NGHA 4JK8A 4XH1A 3CXCM 3SMPA 3C6AA 1M1KO 3FFKB 1YI2N 1LOTB 3SJHA 1T44A 3SBGA 3KVGA 3D7EO 2ZGZA 3G6EN 3FZFA 2V52B 3ATUA 3ZX2A 2NZTA 3M1FA 4ILJA 1GLLO 2HBLA 2QWRA 3O1BA 4FPAA 4CZFA 2YHXA 5M1KA 4CZEA 2F9TA 2YX6A 4ISFA 3RVCA 3TSPA 5GIPA 3DJCA 3J7ZO 2IVPA 3C65A 3JXUA 4CD3A 4IEEA 2QA4N 3IKMA 1YJNN 3CMEN 2E2OA 3DXMB 3G25A 3HI0A 1X3NA 4H0XB 2QWOA 3H46O 3UKUB 4IJNA 4PL7A 5EVZA 3ULEB 1VQ7N 1XUPO 1NGGA 5AQPA 2ZGYA 5FPNA 3WXMB 3DXKB 5H1SQ 3AGKA 2E88A 3IUCA 2PFUA 4FL9A 2QWLA 5AQYA 2V51B 1EO1A 1C0FA 4MDAA 5GAEP 4U7BA 3LDNA 3R6MA 4JAXA 4BG8A 5JVHL 1KAZA 4H0YB 1K73O 1MDUB 3QB0A 4NO7A 2FF3B 3VEVA 2A42A 4A5AA 3WXLA 5JMVA 1M90O 3ENOA 3P31A 3J8AA 1W2BM 4H5NA 3EO3A 3ZEUB 3SAGA 2FSNA 2W40A 4BR5A 5AQKA 3O9RA 1YHQN 2HSTA 4ISGA 3D2FB 4CZIA 4B1ZA 1VQKN 4F9OA 1HUXA 2VWBA 1HPMA 4FWKA 3TPQA 2GX9A 3IFRA 4QS8A 1BUPA 1MWKA 3VF4A 1Z05A 4RTFD 1ATRA 1G99A 1NGJA 3LDQA 3U8XA 4A2BA 4M7YA 5KPZA 1KC8O 1NGBA 2I7PA 4CZLA 3O4WA 2I7NA 4CZHA 5MLCQ 1P8ZA 3HSCA 3JS6A 2YJEA 2P9LA 4DHYA 3HM8A 3HOSA 5AQGA 4BR2A 4WFAL 5AQUA 1Q7YO 1S3XA 4IOXA 3OA9A 3A5LC 3CERA 3D6RA 4EHUA 3WUHA 5AQJA 4JK7A 1YJWN 4CJ7A 2YHYA 2HF3A 3R1XA 4OPAA 1BA0A 2V7ZA 2QXLA 4NLBA 4BVPA 3C7NB 5ADXA 1KAYA 4JKFA 2HBJA 3QBXA 3H45C 3O08A 4NB4A 3MDQA 3MK6A 4GV3A 3VTIA 3VEYA 1HKCA 3O9QA 3BP8A 5BREA 4EAHD 2E20A 3MWTA 5JLFA 3P4IA 3UKRA 4M7XA 3WEEB 4WFBL 1JCFA 3FZKA 1O13A 3AAPA 5KQ8A 4JHDA 3PIOL 1NLVA 2BUPA 5AQWA 1X3MA 1CZAN 3E9OA 5AZIB 2Q97A 3TTFA 3U9DA 1BWFO 4WQ5A 3W3DA 5BRFA 3I56N 3CPEA 4YOYA 1IG8A 4GVEA 2W41A 3EKUA 3TU5A 1K8KA 2D4WA 4ILHA 3H1VX 1S72N 1ZXOA 1HX1A 3ENHA 3UE5A 1NJIO 1ILYA 3LDLA 2P9UA 4FPBA 5AZJB 5AQOA 1SS6A 1NGIA 1JCGA 3O80A 2CGJA 4JKGB 4L3QA 4CBUA 3GL1A 5EOYA 4BR4A 1BO5O 3CD6N 3CIPA 5AQQA 3HZ6A 3CCUN 1R59O 4B1XB 3QFPA 1GLEG 2H3GX 3L6QA 3MCAB 1TUYA 2RE2A 1VQMN 1J6ZA 3QICA 4FWSA 2GELA 2HBMA 4OPHA 3ZETB 3H3OB 5JICA 1DEJA 3CJ9A 4J8FA 3RSEA 3O9UA 3N4PA 3KZBA 2E1YA 3I55N 2P9KA 4BY9C 5ADXH 4IFEA 5E26A 1TYQA 5AQVA 1ATNA 4JD2A 1U2VA 3R8EA 1QQMA 3AY9A 1YUWA 1SQKA 2DPNA 3SBTA 4Z94A 5ELZA 3EZWA 2WBNA 2P9PB 3NVMA 3VGKA 2OTJN 3IMXA 3U4LA 2E1ZA 4I6MB 2HOEA 1T6CA 3DAWA 4BVOA 1QVFM 3MX5A 2ITMA 5GAHP 3BF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO N;  3CCS N;  5GAE P;  4WF9 L;  5JVH L;  5GAG P;  1K73 O;  4IOC L;  1VQ8 N;  1M90 O;  3DLL L;  3OW2 M;  3CCM N;  1YIT N;  1W2B M;  3CCL N;  1K8A O;  3CC7 N;  1VQ6 N;  2OTL N;  1YHQ N;  1VQK N;  5HL7 L;  2ZJQ L;  1KC8 O;  3CC4 N;  1VQ9 N;  5MLC Q;  1VQL N;  1K9M O;  4WFA L;  1Q7Y O;  3CCQ N;  5DM6 L;  1YJW N;  1YJ9 N;  4UY8 O;  3CC2 N;  5GAD P;  3G4S N;  1Q86 O;  3CCR N;  3G71 N;  4WCE L;  4WFB L;  1KQS M;  1QVG M;  4IOA L;  3PIO L;  1YIJ N;  1YI2 N;  3I56 N;  5DM7 L;  4U67 L;  1N8R O;  3CPW M;  1S72 N;  1NJI O;  1KD1 O;  3CCE N;  1JJ2 M;  1VQ5 N;  1ILY A;  1OVY A;  1Q82 O;  1VQP N;  3CXC M;  1M1K O;  3CD6 N;  3CCU N;  3CCV N;  4WFN L;  3G6E N;  3CCJ N;  1VQM N;  1VQ4 N;  2ZJP L;  3PIP L;  3CMA N;  3I55 N;  3J7Z O;  2QA4 N;  1YJN N;  3CME N;  1VQN N;  2QEX N;  2OTJ N;  5JVG L;  4IO9 L;  1VQ7 N;  2ZJR L;  1Q81 O;  1QVF M;  5GAH P;  3CF5 L;  5H1S Q; 
#chains in the Genus database with same CATH topology
 3CCS N;  4JV5 K;  4FOI A;  2WUS A;  3P38 A;  4IOC L;  1NJZ A;  4Z4G A;  5M1Q A;  2GUP A;  1LWC A;  4YOV A;  3V9Z A;  3THV A;  2D0O A;  3AVH A;  3KWG A;  2ASP A;  5E41 A;  4CBX A;  1K8A O;  4LFC K;  3CC7 N;  1F21 A;  2OTL N;  2AA4 A;  3K57 A;  3L2W A;  3DXM A;  1R0A A;  3VET A;  4R79 A;  3DMJ A;  4WYB A;  4H5V A;  5LJW A;  3DXK A;  1J53 A;  2VYP A;  3CQX A;  1NK9 A;  3WQU A;  1JLE A;  2PY5 A;  3CM5 A;  1VSE A;  1ZBU A;  5CY4 A;  4FJ7 A;  4DV6 K;  3A5N C;  3QIO A;  2VWJ A;  1EWQ A;  5A2Q O;  1HNW K;  5I42 A;  3VEN A;  2VCP A;  3G4S N;  4CFC A;  3NE6 A;  1TUU A;  4JKB A;  3OYI A;  5LMN K;  4BRK A;  4DQP A;  2E8A A;  2O8B B;  3KLG A;  1HKG A;  2W6L A;  4NCA A;  1I3A A;  3CG7 A;  4KHN A;  3NAE A;  2VQE K;  3C6H A;  1HRH A;  2NRZ A;  1OH8 A;  1KRP A;  4RG8 A;  4G1Q A;  3MCP A;  1GOC A;  3O3F A;  4BG9 A;  1T8E A;  4YFU A;  4ELV A;  2PAV A;  1VQ5 N;  5CR4 A;  3QES A;  4AHC A;  1NK8 A;  5C0Y A;  4B1Y B;  2YKM A;  4WFN L;  3CCV N;  1RT1 A;  5J1E A;  4Z4F A;  2ZJP L;  4O8K A;  3LM2 A;  3WEE A;  2BTF A;  1S1V A;  2AJQ A;  3IS9 A;  1ZC6 A;  4FM2 A;  4DTN A;  4N5S A;  2Q1N A;  3LZJ A;  4G9Z A;  2ETJ A;  1VQN N;  5LL6 Z;  4KFB A;  4AQY K;  2UXC K;  2F7T A;  1QS4 A;  3LM9 A;  4EZ6 A;  1IJJ A;  2FSJ A;  4FJI A;  4UQG A;  1W9H A;  5I3U A;  3GBT A;  3FLC O;  1CZ9 A;  4GNI A;  1RTJ A;  1T3V A;  3LWM A;  3VQ8 A;  4DWI A;  4BRM A;  2YCH A;  4L8R B;  5KGW A;  2E2Q A;  5M1O A;  1TKD A;  4X62 K;  4FLZ A;  4K25 A;  4DTS A;  1LCU A;  1GLC G;  1BIU A;  1EET A;  1OVQ A;  4CK3 A;  3L2Q A;  4DFP A;  4M3X A;  3D2E A;  4Y1D A;  4FLY A;  1IH7 A;  3EY1 A;  2HHW A;  1HNI A;  4EFH A;  1TAU A;  2KHO A;  2JWL A;  3O1W A;  1NM1 A;  5EY4 A;  1FXX A;  4AM7 A;  2Q3S A;  4CK2 A;  3FR0 A;  3MX2 A;  2E6M A;  1SL0 A;  1NNE A;  2QTD A;  3L8B A;  3T69 A;  3M5R A;  5AFU A;  1RDD A;  1ASV A;  4QS7 A;  4GV9 A;  3DOK A;  5C2F A;  4M3U A;  2HVH A;  4CHY A;  1WSI A;  4HTL A;  4DQQ A;  3QIN A;  3VQC A;  3I33 A;  4O44 A;  1N8R O;  3OYG A;  1MA9 B;  1Q82 O;  4B3S K;  1L5U A;  3AA2 A;  3F5T A;  3MEE A;  4B1W B;  1KVC A;  2WON A;  1EWR A;  4YY3 K;  1XHX A;  2ASO A;  4CF2 A;  5EX5 A;  1VQ4 N;  4I2P A;  4CIG A;  3PIP L;  4H03 B;  4O5B A;  4CJK A;  4YOU A;  1C0U A;  1GLF O;  3OYE A;  4KHY A;  3RTV A;  2Q2R A;  3VMF B;  3VES A;  4CGF A;  3KLI A;  2QKK A;  2QM1 A;  3P39 A;  1C1A A;  1RBU A;  1NMD A;  1C0G A;  3NMU A;  4CZK A;  3KLF A;  1RT5 A;  3AVK A;  1VQO N;  1JL2 A;  3GE1 A;  3JSM A;  4FK0 A;  4Q0B A;  4WF9 L;  2FF6 A;  4DQI A;  3MN9 A;  3AVB A;  4K42 A;  1RDW X;  2J4R A;  3OS0 A;  3CCL N;  4O0J A;  3OY9 A;  4MDB A;  4FVU A;  3LZI A;  2O8E A;  5BN9 A;  1MU2 A;  3V1Q A;  3VOV A;  2E6L A;  1KAX A;  3O8M A;  1RBS A;  2ZJQ L;  1HJR A;  3SUP A;  3QET A;  3UKR B;  3VEX A;  1VSI A;  3TSU A;  3FGU A;  3O4N A;  1VRT A;  3AAQ A;  3VGL A;  3GOI A;  3D45 A;  4Y0W A;  4FLT A;  4BQL A;  2HHV A;  4FJ5 A;  1SAZ A;  2VG5 A;  1K9M O;  4FWN A;  3RRH A;  1S1X A;  4KH5 A;  1NK0 A;  3MMV A;  4H5R A;  3ATV A;  4FJ9 A;  3VTH A;  4BRQ A;  1C6V A;  1Y97 A;  2A1S A;  3NH0 A;  2RKI A;  3L0Q A;  4H0P A;  5TKY A;  3THY B;  4X65 K;  3C0B A;  3SQ1 A;  1HKB A;  2HHS A;  3NFA A;  5F1X A;  4LF8 K;  5CE3 A;  3GG4 A;  3RMD A;  3RSE B;  2OAN A;  3DM2 A;  4MLH A;  3A2F A;  4IOA L;  3SQ2 A;  3VN5 A;  3EYZ A;  4JD2 B;  3SUQ A;  4WQ4 C;  4DG1 A;  1NWK A;  5DM7 L;  2WTU A;  4OGC A;  1EP4 A;  2YNF A;  1JJ2 M;  2ZF5 O;  2F9W A;  3D2E B;  4B9T A;  2FBX A;  2ZWH A;  2CGL A;  5KQD A;  4JK8 A;  3DRR A;  3CXC M;  1WSF A;  1LOT B;  1NJW A;  2ZGZ A;  3FZF A;  2NZT A;  2HHT A;  1D9F A;  1NK7 A;  5M1K A;  2YHX A;  4CZE A;  3RVC A;  5GIP A;  1C1C A;  2F4V K;  2IVP A;  3JXU A;  4FCY A;  4IEE A;  3IKM A;  3AO4 A;  3CME N;  4IG3 A;  3V1R A;  3HI0 A;  4OJR A;  4H0X B;  3KKS A;  4GVM A;  2QWO A;  3H46 O;  5KTQ A;  4W5T A;  4CJF A;  3TAQ A;  1VQ7 N;  1XUP O;  2P5O A;  5AQP A;  2ZGY A;  5FPN A;  3WXM B;  4QOZ B;  2E88 A;  3IUC A;  4FL9 A;  5AQY A;  2V51 B;  1C0F A;  4U7B A;  4Z4E A;  4TSX A;  5HP1 A;  3LDN A;  1JXB A;  4JAX A;  4CEC A;  4H0Y B;  4KTQ A;  2A42 A;  1UA1 A;  4PA1 A;  3WXL A;  3ENO A;  1W2B M;  4CJS A;  2W40 A;  3QEI A;  1HYS A;  3EEQ A;  2HST A;  1VQK N;  4CZI A;  4NYN A;  3VQ7 A;  1HPM A;  4QS8 A;  3NGI A;  1BUP A;  3VF4 A;  1Z05 A;  4RTF D;  1ATR A;  1NGJ A;  3LDQ A;  4DR5 K;  4B8C A;  3SUN A;  3TWH A;  5MLC Q;  3CFR A;  1TVR A;  3HM8 A;  3DOL A;  4CEO A;  4E3S A;  1S1W A;  3A5L C;  4KRE A;  1NK4 A;  2YHY A;  3K58 A;  3M8Q A;  3BY5 A;  4AIL C;  1NKB A;  3U3Y A;  1KAY A;  2HBJ A;  1SKS A;  4H4O A;  4GV3 A;  3VTI A;  3VEY A;  5JS1 A;  4CED A;  3QNN A;  1KLM A;  5BRE A;  4EAH D;  4J2A A;  4NYF A;  1JCF A;  3NHG A;  3T1Y K;  5KQ8 A;  4BAC A;  3PIO L;  2BUP A;  2KW4 A;  5AZI B;  3U9D A;  3E9O A;  5BRF A;  3I56 N;  2O8D A;  4OGE A;  4OKE A;  1S72 N;  3H1V X;  1NJI O;  3UE5 A;  3ASM A;  4RW9 A;  2O8C A;  1DLO A;  3QO9 A;  1SS6 A;  1E3M A;  2HMI A;  4JKG B;  3GL1 A;  4BR4 A;  5KGX A;  4QCL A;  4M41 A;  4B1X B;  1KSP A;  3QFP A;  1GLE G;  2KFZ A;  1CZB A;  1TUY A;  3QIC A;  2ITG A;  2GEL A;  2HBM A;  4AHS A;  5JIC A;  4JYA K;  1DEJ A;  4ICL A;  1VSH A;  5ADX H;  1JLB A;  1TYQ A;  1ATN A;  4DR1 K;  3I8D A;  3TAM A;  3AY9 A;  2DPN A;  3EZW A;  4KKO A;  4CF0 A;  3P5J A;  3U4L A;  3QLH A;  1WLJ A;  2RN2 A;  1TK0 A;  2Y1I A;  4V19 S;  1E4F T;  3OS2 A;  1RCH A;  2KKZ A;  5GAG P;  5BN8 A;  4OKJ A;  1X9W A;  1YIT N;  3M8S A;  3VQP A;  2QWN A;  4CIF A;  1YXQ A;  3CJB A;  4WQ5 C;  4DSL A;  4EIA A;  3I0R A;  1IBK K;  3ULE A;  1S22 A;  1LWF A;  3SJJ A;  1EXQ A;  3THW B;  4JK9 A;  2E2N A;  1SUQ A;  4FJM A;  4CJW A;  2A6A A;  3KWI A;  4MO4 A;  3RR7 A;  1GLA G;  3HYF A;  3ZEU A;  4HWI A;  1WUA A;  2PZS A;  3OHR A;  3HRG A;  4GW6 A;  2I5J A;  4QS9 A;  2NRV A;  4BRE A;  5IWA K;  4QAG A;  4NLC A;  3P83 D;  4DSJ A;  4CF9 A;  2Q0R A;  3DLE A;  4O5F A;  3HBT A;  4A5B A;  4N41 A;  3CJ1 A;  3PY8 A;  3LDP A;  3K9K A;  4AM6 A;  3CFP A;  1TK5 A;  5KRS A;  5C24 A;  3TR8 A;  5FPE A;  1RT4 A;  4DR4 K;  4JRP A;  1A5W A;  4DV5 K;  4Z4C A;  4LFB K;  4DV0 K;  1NKC A;  4PQU A;  4GY2 B;  3KD1 E;  4DMN A;  1RTI A;  3LP0 A;  4BRH A;  1RDU A;  4PHT X;  4FW2 A;  3C7N A;  2YHW A;  3R9P A;  1HQE A;  2P9S B;  4FOE A;  4C1N K;  3SPZ A;  4I7F A;  2YNH A;  4BC2 A;  4DV1 K;  4PWD A;  2RPI A;  4K43 A;  4Z4I A;  2QK9 A;  2VGN A;  3CYM A;  1QHA A;  1REV A;  4B08 A;  1UA0 A;  4FJ8 A;  1ATS A;  2W42 A;  4CJR A;  3R3L A;  5CHI A;  3DLH A;  3GDQ A;  2X6S A;  5JVG L;  2IOC A;  4J2E A;  4LFA K;  3J7A P;  2ZJR L;  1DGK N;  5AZJ A;  3HM9 A;  3CF5 L;  4DFM A;  3TAE A;  4BRL A;  1Y64 A;  3ZT1 A;  3QBW A;  3HPH A;  3S3O A;  1RFQ A;  3CQY A;  4AHR A;  5E84 A;  1HJO A;  4A2A A;  3ZET A;  3CCM N;  4DSF A;  4JRQ A;  2VGM A;  1KVB A;  2W6K A;  4H8K A;  4IFV A;  4BGB A;  2P9P A;  3K5O A;  5FPM A;  4DTJ A;  4CJV A;  4CEZ A;  4B1U B;  3T3F A;  1C1B A;  2GTD A;  5LY3 A;  4FJX A;  4PKH A;  3PLA A;  3TAG A;  1BQM A;  4DSI A;  2R7Y A;  4FWR A;  1P90 A;  5C12 A;  4EZ9 A;  3Q7B A;  4IZ9 A;  1TKZ A;  3DWL A;  3ID6 A;  1NK5 A;  2CGK A;  2IVN A;  4KHU A;  2JWK A;  3UB5 A;  5BPL A;  2FBV A;  3LL3 A;  5HRN A;  4OO1 J;  1HNZ K;  4DF8 A;  3QDK A;  2E2P A;  3RMB A;  1QVG M;  5J2P A;  3T1H K;  4CEE A;  3IDH A;  3THX A;  1UWB A;  4ZHR A;  5SWM A;  2UXD K;  1XNR K;  4F3T A;  1XC9 A;  4BQZ A;  3WQT A;  4JI7 K;  3ZYY X;  4C8K A;  1OVY A;  4BRI A;  2O8F B;  3AA4 A;  3VQ6 A;  1WBB A;  2VG7 A;  3BEX A;  3PSF A;  1XWL A;  1DTQ A;  3RMA A;  3LP3 A;  5K14 A;  3ZSY A;  4YDU C;  4C1N I;  3A0I X;  5AFU H;  2Q36 A;  2XY7 A;  5FRM A;  3CET A;  4KHP K;  1GOA A;  3O3G A;  1QZ6 A;  3FZH A;  3NH1 A;  1U48 A;  1JLF A;  2A5X A;  2A41 A;  3VQ4 A;  2XY5 A;  2QEX N;  2NRT A;  4CHQ A;  1LW0 A;  4IO9 L;  4BRA A;  4B3M K;  2YNG A;  2OPP A;  3F2K A;  3K2P A;  1ZYQ A;  4JS5 A;  4WQ4 A;  4HTU A;  2P9L B;  5AQZ A;  4M3Z A;  3EE8 A;  3OYN A;  1HQU A;  4KBO A;  3OYC A;  2O4G A;  3O6W A;  2X74 A;  4KPY A;  3FE1 A;  4DFJ A;  4LC9 B;  4HHT A;  4BR7 A;  2B6A A;  4BR0 A;  2WFB A;  4BWJ A;  3NBP A;  3JAM O;  4R5P A;  4E7K A;  5LJV A;  1Q8I A;  3WT0 A;  3HPO A;  4A59 A;  5EXW A;  1YVU A;  1ZBS A;  3H3N O;  3QER A;  3OYA A;  3VQQ A;  4AHU A;  2A3Z A;  1XNQ K;  1MWM A;  3E1Y A;  2P51 A;  3VPZ A;  4B9Q A;  1H1V A;  3WNE A;  2YHB A;  4K41 A;  4IO8 A;  1ZBL A;  5M1N A;  3I8B A;  1YF5 L;  4I9Q A;  3WXI A;  3RWU A;  2YNI A;  3EL2 A;  2OA8 A;  3DLK A;  3HTV A;  2Y1J A;  1SZ2 A;  4KB1 A;  3A5M C;  2NNW A;  2GV9 A;  5EU7 A;  4IEI A;  4U67 L;  3SAH A;  3S3N A;  1KD1 O;  4FLX A;  3SV4 A;  5I9E B;  4XH1 A;  2ZM6 K;  4PY5 A;  4CCH A;  3SJH A;  1T44 A;  4LSN A;  3HST B;  3V9S A;  3B6P A;  2HVI A;  2V52 B;  3ZX2 A;  4E7L A;  5J2Q A;  3MXI A;  1BIS A;  4ILJ A;  4X64 K;  4FPA A;  2HBL A;  2QWR A;  3O1B A;  4DQR A;  3TSP A;  2YX6 A;  3TI0 A;  3K0S A;  3HXM A;  4DU4 A;  1YJN N;  3NCI A;  3IAY A;  3DXM B;  3G25 A;  3WNG A;  1X3N A;  5AJ3 K;  2Z1I A;  3AO2 A;  3V1O A;  4IJN A;  1KCF A;  4JI8 K;  5CYM A;  4PL7 A;  5BR8 K;  1RDC A;  3J80 O;  3DXK B;  2KFN A;  2PFU A;  1EO1 A;  1U04 A;  5GAE P;  3AVJ A;  5JVH L;  1D8Y A;  3NGZ A;  1K73 O;  2UXB K;  3CFO A;  3VEV A;  1M90 O;  3P31 A;  4FJL A;  4FZZ A;  3J8A A;  2ZE2 A;  3EO3 A;  3O3H A;  2FSN A;  3HP6 A;  2DY4 A;  5T7B A;  1YHQ N;  1WSG A;  4ISG A;  4F9O A;  1HUX A;  4FWK A;  3ZSR A;  3IFR A;  3PV8 A;  1G99 A;  4A2B A;  5KPZ A;  1WSE A;  2I7P A;  3QIP A;  2B4J A;  3AV9 A;  3HOS A;  4DLE A;  2P5G A;  1S3X A;  2WOM A;  4IOX A;  3OA9 A;  1XHZ A;  3WUH A;  1YJW N;  2HF3 A;  4O55 A;  2QXL A;  4NLB A;  2X6N A;  4BVP A;  3SQ4 A;  1HYZ A;  1CXQ A;  4BDP A;  3MDQ A;  3MK6 A;  2OPQ A;  1JLC A;  3C6T A;  2B5J A;  3MWT A;  2G8V A;  4RW6 A;  2ZD1 A;  1TAQ A;  3WEE B;  4WFB L;  3FZK A;  3D0P A;  2HHH K;  1BQN A;  4JHD A;  2YV0 X;  5AQW A;  1NLV A;  3AVN A;  3TTF A;  4M3T A;  2Q97 A;  4CJ3 A;  4WQ5 A;  4YOY A;  4GVE A;  5D3G A;  1K8K A;  4DU1 A;  4M3Y A;  1ZXO A;  1HX1 A;  3ENH A;  1HR0 K;  2HND A;  4DUY K;  4B3T K;  1ILY A;  2P9U A;  4FPB A;  2CGJ A;  4HCB A;  4L3Q A;  2XHB A;  3ISN C;  4CJP A;  3HZ6 A;  1R59 O;  4E7I A;  1GOB A;  1J6Z A;  3CJ9 A;  3MEC A;  3I55 N;  2P9K A;  3S3M A;  5AQV A;  1U2V A;  3C6U A;  4XIU A;  4Z94 A;  3SBT A;  4DQS A;  3NVM A;  4KRF A;  3IMX A;  1SKR A;  3AVI A;  4X66 K;  4BVO A;  4OKK A;  3TAF A;  2HNZ A;  5GAH P;  1QTM A;  4OVL A;  1WN7 A;  4BWM A;  5C2D A;  1FK9 A;  4DFK A;  4DCH A;  3WXK A;  4O4G A;  5AQH A;  4BRD A;  1NGC A;  2P9I A;  3V81 A;  2ATQ A;  3FZM A;  3DLL L;  1N34 K;  3OW2 M;  4KH6 A;  2IAJ A;  1HYV A;  4KHW A;  2QXF A;  4JS4 A;  4BRN A;  4YOT A;  1TKT A;  3HK2 A;  1BU6 O;  2NLX A;  4JI0 K;  3KLH A;  1FKO A;  3QEP A;  4IWV A;  3DRS A;  2D0A A;  1D5A A;  3UKU A;  2V7Y A;  3NVK A;  3I0S A;  3L4Q A;  3LPT A;  3VQD A;  4OPK A;  4AHV A;  3JYT A;  3HVT A;  4BC3 A;  3VEZ A;  4HVJ A;  4DR2 K;  3TSQ A;  5KPR A;  4E7J A;  4IJA A;  1RGI A;  3HPG A;  3O9T A;  3G10 A;  3SMS A;  3ZSQ A;  4JEP A;  1JKH A;  1JL1 A;  3SQ0 A;  1C0M A;  4BC5 A;  1FKP A;  3OYB A;  2D0P A;  3D2F A;  4YOR A;  1QQN A;  2GWK A;  1WSJ A;  3CCR N;  4CEB A;  3EE9 A;  3KK7 A;  2O4I A;  4LH4 A;  1TL1 A;  1KQS M;  2G8W A;  4H5T A;  5CZ1 A;  1KFS A;  3SV3 A;  1IKX A;  4FWM A;  5BR9 A;  1U47 A;  1DTT A;  3VEW A;  1TV6 A;  4CF1 A;  3S9H A;  4B3O A;  1FJG K;  2G8F A;  4EHT A;  4FLW A;  1QZ5 A;  1NKE A;  1KFD A;  3KKR A;  5AQM A;  4A61 A;  2G8U A;  1EX4 A;  3SLC A;  1NGE A;  3CQ8 A;  1D4X A;  1RTD A;  3H1Q A;  1BCM A;  5BRD A;  3BZK A;  5GIN A;  2O8E B;  4PKI A;  4FW1 A;  3OJU A;  1XMO K;  1QQO A;  3AVF A;  4ILG B;  1LW2 A;  4FLU A;  1T6D A;  2P9N A;  4C8L A;  2AP1 A;  1NGF A;  4CFA A;  1Q18 A;  4JKC A;  1OH6 A;  2PYL A;  2QW9 A;  4H4M A;  3DLR A;  1RT3 A;  2NUB A;  1VSM A;  5KI6 A;  1LV5 A;  3AA3 A;  3KLE A;  3O9S A;  3OVN A;  4IKF A;  3TTD A;  4FZX C;  5AR0 A;  2GWJ A;  2RHK A;  1YVN A;  3TAR A;  1YAG A;  4FWQ A;  2OZM A;  1BA1 A;  1BOT O;  2G8H A;  4FWP A;  5AQX A;  5BRH A;  5C25 A;  2HB5 A;  2IDO A;  4I6M A;  1Q9Y A;  2UYT A;  5C15 A;  1FW6 A;  3NDK A;  2IS3 A;  3U9Z A;  5AQL A;  3U3G A;  3MN5 A;  1WSH A;  4IG0 A;  3U6F A;  3F9M A;  4DTR A;  3T7Z A;  4CJL A;  2EHG A;  5GAD P;  4RCH A;  1XC3 A;  1QSY A;  1EKE A;  3MN6 A;  3V9X A;  4PL8 A;  2ZQB A;  2P9I B;  1X9M A;  1Q86 O;  1CLQ A;  4B9S A;  3Q7C A;  4E1M A;  5AQR A;  4ID5 A;  3HVR A;  1QHT A;  2GUI A;  4LY7 A;  2KLA A;  1W97 L;  3BF3 A;  4DTX A;  4LF6 K;  4LF7 K;  4W5Q A;  3C95 A;  1XMQ K;  3CJ7 A;  3V6D A;  4B1V A;  4CI6 A;  4IXC A;  4WE1 A;  2NRR A;  4F2S A;  3ZSX A;  1N6Q A;  3E9P A;  5BPM A;  2OYQ A;  2O8B A;  2IIR A;  1L3U A;  1RBT A;  1JLG A;  4N47 A;  1YT3 A;  3KK1 A;  3HT3 A;  3UIQ A;  5J2M A;  1HNV A;  1Q81 O;  1RT7 A;  3TTC A;  2Z1J A;  4BRG A;  2JLE A;  5SZT A;  4YOX A;  2QWQ A;  2QKB A;  2P1J A;  1W0H A;  4JI1 K;  1C0T A;  3VF6 A;  2XY6 A;  1VQ8 N;  4K8Z A;  3NF8 A;  3OYL A;  5FDL A;  4KHQ A;  3SCX A;  3DYA A;  2GEM A;  1OKJ A;  4ELT A;  4A57 A;  1KXP A;  2DFH A;  1N33 K;  3L4I A;  2OPR A;  1J54 A;  3KK3 A;  4C8N A;  2HBK A;  5TKW A;  4FJJ A;  4CHO A;  2O8D B;  4BR9 A;  4BC4 A;  3PUF A;  4M3W A;  1B92 A;  2F96 A;  5AQN A;  4FYD A;  3ITH A;  2EX3 A;  2PBD A;  1S1T A;  4FJK A;  2P9N B;  2O8C B;  2FXU A;  1KTQ A;  1B9F A;  3ZSV A;  3M6G A;  4B9U A;  1YTU A;  3EN9 A;  2E5L K;  3OBY A;  1VRU A;  1N36 K;  4MLE A;  4BRF A;  3ALY A;  3BZC A;  4DR6 K;  1TYQ B;  4FWL A;  1YI2 N;  2D0C A;  5HOO A;  4DTM A;  3B6O A;  3M8P A;  4BRP A;  3SZ2 A;  4BRO A;  2QI2 A;  4FLV A;  1VQP N;  4PUO A;  1ZBH A;  4Z0U A;  3DLG A;  3PX6 A;  3MED A;  3OYK A;  4CHN A;  1Z26 A;  2RF2 A;  4KHS A;  3KVG A;  1I39 A;  3G6E N;  3J81 O;  4F4K A;  3L3U A;  4CZF A;  3L2R A;  4FJH A;  3HJF A;  4I9L A;  2F9T A;  2GBZ A;  4CJE A;  3C65 A;  5HRO A;  1L3T A;  4DV3 K;  3QEV A;  2E2O A;  2F8T A;  4CJT A;  5EVZ A;  3ULE B;  3NH2 A;  1IBM K;  1NGG A;  5C42 A;  1S6P A;  4ZTJ A;  2PYJ A;  4CFB A;  2QWL A;  3WNH A;  2HNY A;  3OYF A;  3WNF A;  1VSK A;  4NO7 A;  2FF3 B;  4A5A A;  4B9M A;  1X9S A;  1IV0 A;  3ZSW A;  5JMV A;  2UUC K;  4H5N A;  4DV4 K;  3ZEU B;  4BR5 A;  3O9R A;  1NK6 A;  2VWB A;  3OYH A;  1S5J A;  4OX9 K;  3F9K A;  1MWK A;  3O4Q A;  3U8X A;  1KC8 O;  1KLN A;  4M7Y A;  2OPS A;  3O4W A;  2I7N A;  4CZH A;  3HSC A;  2FBY A;  3AO3 A;  5AQG A;  4DTU A;  4J2D A;  3LP1 A;  1WNS A;  4HCC A;  4KTZ A;  5AQU A;  4WFA L;  1Q7Y O;  3CER A;  3D6R A;  5AQJ A;  2VWK A;  4CJ7 A;  4OPA A;  4E19 A;  3R1X A;  4E0D A;  1BA0 A;  3C7N B;  3LAM A;  1QSS A;  4FM1 A;  3QBX A;  3O08 A;  4NB4 A;  4M3R A;  3OJS A;  3C94 A;  3BP8 A;  1S9G A;  3OS1 A;  3UKR A;  3P4I A;  4M7X A;  4JI6 K;  2YKN A;  4DUZ K;  3MEG A;  1X3M A;  1YIJ N;  2HHX A;  1Z25 A;  2KZZ A;  3EKU A;  3TU5 A;  2E4L A;  1HMV A;  2D4W A;  4O0I A;  4HUE A;  1I94 K;  4MFB A;  4N76 A;  3AA5 X;  3LDL A;  4C8O A;  5AZJ B;  5CZ2 A;  5AQO A;  1NGI A;  1TKX A;  4CBU A;  4C8M A;  4GMJ B;  3CD6 N;  5AQQ A;  2JGU A;  3THY A;  3MCA B;  1S9E A;  1UOC A;  1BCO A;  3ZET B;  3H3O B;  1BHL A;  1RT2 A;  3RSE A;  3N4P A;  2E1Y A;  4CE9 A;  4IFE A;  5E26 A;  5J2N A;  4JD2 A;  3R8E A;  3DI6 A;  3SNN A;  2XRI A;  1YUW A;  1SQK A;  3T1A A;  5ELZ A;  2WBN A;  2P9P B;  3VGK A;  3LPU A;  3NF7 A;  3E01 A;  1NJY A;  2E1Z A;  3AO1 A;  3OTO K;  4BE2 A;  4YNQ A;  3LDS A;  3DAW A;  1QVF M;  3MX5 A;  4CEQ A;  5FRO A;  5B8H A;  4KTW A;  4FJN A;  5M1F A;  3ID8 A;  1RDA A;  3AGR A;  1J5O A;  2IVO A;  4EP5 A;  1VQ6 N;  4AF1 A;  3W0L A;  4NXN K;  5HL7 L;  4BGA A;  4IBN A;  4H0T B;  3HP9 A;  1QSL A;  2D0B A;  4NCB A;  2WC9 A;  1RTH A;  1B9D A;  3NGY A;  3CC4 N;  4KAZ A;  4K8X A;  3THX B;  3L3V A;  1A5V A;  2YJF A;  5M1P A;  1LAW A;  2G8K A;  1HNX K;  4BRC A;  2NRX A;  4FSV A;  4DQ8 A;  5DM6 L;  1X9J A;  3K59 A;  2FBT A;  2KTQ A;  4UY8 O;  3PO4 A;  3MAQ A;  1JXE A;  3H6E A;  1U6Z A;  1SKW A;  3WXJ A;  3M8R A;  3MXJ A;  4Y1C A;  3G71 N;  5DK5 A;  3IRX A;  4DV7 K;  1WB9 A;  4DS4 A;  4PKG A;  3K9J A;  4CGI A;  3F73 A;  1G15 A;  3AAR A;  5JS2 A;  4DKW A;  4H0O A;  1BI4 A;  3H08 A;  3VF2 A;  5C10 A;  3CCE N;  4FXD A;  3SPY A;  4O8U A;  4A62 A;  1T05 A;  4BE0 A;  1OH5 A;  4OLB A;  2DFE A;  3EKS A;  3ENB A;  4KO0 A;  3AO5 A;  4DU3 A;  1VHX A;  4E1N A;  3M3Z A;  3KJV A;  4JNE A;  1SV5 A;  3CHW A;  4DB3 A;  3PX4 A;  2D1K A;  2Q0U A;  2FSK A;  4RW4 A;  4KI6 A;  4XH4 A;  3CJA A;  5AZI A;  3OYJ A;  1WBD A;  2F8S A;  4KH4 A;  4E7H A;  2LSN A;  2NRW A;  3TAP A;  3QML A;  2QWM A;  1RIL A;  2IGI A;  4XH5 A;  3FZL A;  4J2B A;  1WOQ A;  5JLH A;  3SUO A;  3VQB A;  1XI1 A;  3NF9 A;  3K5N A;  1S6Q A;  4ID1 A;  4JKG A;  4MQ3 A;  3B8A X;  3E9L A;  4JKA A;  1NU0 A;  3VA3 A;  1NGA A;  4GV6 A;  3N4Q A;  4F8R A;  4CGG A;  4JKE A;  4YHH K;  5HRS A;  1ASU A;  3CI5 A;  3OYM A;  3L2V A;  4CHP A;  4IDK A;  2KZM A;  4W5O A;  2D5R A;  4JLH A;  4CK1 A;  4DS5 A;  4KV8 A;  4BDY A;  2HHQ A;  3O5B A;  5HRP A;  3QFU A;  5F2R A;  4BDZ A;  4FK2 A;  2BH1 A;  1IO2 A;  1IBL K;  4ZTF A;  1IG9 A;  1NOZ A;  2UUA K;  4M42 A;  5FPD A;  1DT9 A;  4DV2 K;  4FJG A;  1VQ9 N;  1V4T A;  1HPZ A;  5AQT A;  5F0X A;  2FC0 A;  3MXM A;  1GLJ O;  1VQL N;  1JLQ A;  4F2R A;  3CCQ N;  1U4B A;  2HMP A;  3ZX0 A;  3ZT2 A;  3ZT0 A;  3V9U A;  1YJ9 N;  1GLB G;  4M63 C;  1U49 A;  3CC2 N;  1EQY A;  3VQ9 A;  4RWT A;  1JCE A;  2HF4 A;  4JI5 K;  1LWE A;  4N56 A;  1NBW A;  5CYQ A;  1QE1 A;  4CZG A;  4CBW A;  1NOY A;  2HHU A;  4B9N A;  4W5N A;  3VGM A;  1GLD G;  1HLU A;  1D9D A;  5HRR A;  4B9V A;  3AVA A;  3THW A;  3SK3 A;  4YOW A;  3CPW M;  4FO0 A;  2YI1 A;  2FLO A;  4FZY A;  4ISE A;  1NG9 A;  1NGD A;  4LF5 K;  4FM0 A;  4CD1 A;  1SL1 A;  1VK0 A;  2CH6 A;  3KIO A;  1J9A A;  3L2U A;  1J5E K;  2CH5 A;  2QWP A;  3LP2 A;  3VEO A;  1RT6 A;  3ZX3 A;  3CCJ N;  1VAZ A;  1T7P A;  4B8A B;  1BGX T;  5KPT A;  3CMA N;  3E66 A;  1TL3 A;  2NRH A;  4RW8 A;  1YTA A;  4JN4 A;  1V4S A;  3IG1 A;  2VG6 A;  2A40 A;  4RW7 A;  3T19 A;  5AQF A;  1XQS C;  1DKG D;  3ULD A;  4DTO A;  2P9S A;  3OBW A;  1CXU A;  4FVM A;  1BG3 A;  1BI4 B;  4W5R A;  1VSD A;  1NJX A;  1W7A A;  3VQA A;  1T03 A;  4H0V B;  2OCE A;  4HUF A;  4KB0 A;  4CJ4 A;  1Q9X A;  1BDG A;  4CZJ A;  3A8Y A;  1X1P A;  3K5L A;  3MN7 A;  5DMR A;  4CES A;  2DFF A;  4JKH A;  4DSE A;  1L3V A;  3TAB A;  2UUB K;  2ASM A;  4H5W A;  3S41 A;  4CZM A;  1ZBI A;  3G0Z A;  3HL8 A;  1SL2 A;  4CJU A;  4CER A;  3BDP A;  1RBV A;  4JHD B;  4BE1 A;  1UAX A;  4DR3 K;  4MO5 A;  3SAF A;  5LMU K;  4B9L A;  1Z6R A;  5BPN A;  2YHA A;  2Z1H A;  1K8K B;  4DTP A;  3HO1 A;  4LD0 A;  3HOT A;  2P9U B;  2EWS A;  3FFI A;  3K5M A;  2DTU A;  2BDP A;  5IT9 O;  4K0K K;  3BUZ B;  1IKW A;  3SI6 A;  4JKD A;  3VER A;  3LAK A;  4GKJ K;  4C23 A;  1TK8 A;  4FWO A;  1ZBF A;  4YDU A;  4Q5V A;  4EP4 A;  3A5O C;  4E1J A;  4WCE L;  3RRG A;  2P9K B;  1ESV A;  4XEI A;  5GIO A;  1U2V B;  2Q31 A;  4CGD A;  5AQS A;  3PO5 A;  3ZLJ A;  4IDH A;  3V9W A;  4DSK A;  1E4G T;  3LDO A;  2BGG A;  5AQI A;  3CJC A;  3KHY A;  3MWP A;  1OH7 A;  3LAN A;  4OPJ A;  1NGH A;  3QEX A;  4IFY A;  1IKV A;  3SMP A;  4ELU A;  3C6A A;  1M1K O;  3FFK B;  3SBG A;  2G8I A;  3DRP A;  3D7E O;  4AHT A;  3RR8 A;  2HW3 A;  3ATU A;  4E89 A;  3M1F A;  1TGO A;  2XO7 A;  1GLL O;  4JI3 K;  4ISF A;  3LWL A;  4CEA A;  3AVL A;  3DJC A;  3J7Z O;  1A5X A;  4Z4H A;  3QNO A;  4CD3 A;  2QA4 N;  4CJ5 A;  2UU9 K;  4CFD A;  4CEF A;  3UKU B;  5FLX O;  4CVN E;  2VQF K;  2BE2 A;  2KQ2 A;  2Z1G A;  3TAN A;  1LAV A;  5H1S Q;  2O8F A;  3AGK A;  1VSJ A;  4F3O A;  3NF6 A;  4CHZ A;  4MDA A;  1ASW A;  3R6M A;  3VQ5 A;  4BG8 A;  1KAZ A;  3AVC A;  1MDU B;  3QB0 A;  1ITG A;  4NCG A;  1N5Y A;  1K6Y A;  3SAG A;  5AQK A;  4LH5 A;  3ZSZ A;  1WAJ A;  3J7Y P;  3AVG A;  5KRT A;  3D2F B;  4B1Z A;  1S1U A;  3TPQ A;  2GX9 A;  4KI4 A;  1VSF A;  2IC3 A;  1KVA A;  4JI4 K;  1NGB A;  1RDB A;  4CZL A;  3VQE A;  1P8Z A;  3JS6 A;  3VA0 A;  2YJE A;  4M45 A;  2P9L A;  3DLB A;  4DHY A;  1IKY A;  4LSL A;  4BR2 A;  3CM6 A;  4B3R K;  4EHU A;  4JK7 A;  4DLG A;  3KD5 E;  2V7Z A;  5HLF A;  5ADX A;  5FRN A;  4JKF A;  3H45 C;  1NMN A;  1VSL A;  1N32 K;  1HKC A;  1BIZ A;  3O9Q A;  2X78 A;  1L3S A;  2BAN A;  2E20 A;  5JLF A;  4DR7 K;  3PX0 A;  3RMC A;  1RBR A;  1U45 A;  3SYZ A;  4JI2 K;  1O13 A;  3AAP A;  4HUG A;  3W3D A;  1CZA N;  4BY9 C;  3LAL A;  4FK4 A;  1BWF O;  3CPE A;  1IG8 A;  3BGR A;  2W41 A;  4CF8 A;  4CIE A;  4ILH A;  3OYD A;  3AVM A;  4AH9 A;  3V4I A;  4DF4 A;  4CW7 B;  3EZ5 A;  3O80 A;  1JCG A;  2XY8 A;  4OLA A;  5EOY A;  4LF4 K;  1BO5 O;  3CIP A;  3CCU N;  1QQC A;  1O1W A;  4NXM K;  2H3G X;  3L6Q A;  2RE2 A;  1VQM N;  4FWS A;  2OZS A;  2A1R A;  4CJQ A;  4OPH A;  3P1G A;  4CGJ A;  4J8F A;  3O9U A;  3ZCM A;  3KZB A;  4LF9 K;  3QEW A;  1BL3 A;  1QQM A;  1RNH A;  3ZSO A;  4CGH A;  1JLA A;  3KTQ A;  3KK2 A;  2OTJ N;  3PSI A;  3ZT4 A;  1WAF A;  4I2Q A;  4I6M B;  2HOE A;  1T6C A;  5HBM A;  4GKK K;  3ZT3 A;  2ITM A;  3BF1 A; 
#chains in the Genus database with same CATH homology
 5C2D A;  1E4F T;  5B8H A;  5M1F A;  4DCH A;  3ID8 A;  3WXK A;  3CCS N;  4BRD A;  5AQH A;  4FOI A;  1NGC A;  2KKZ A;  2P9I A;  2WUS A;  3P38 A;  5GAG P;  5BN8 A;  4IOC L;  3AGR A;  5M1Q A;  3FZM A;  3DLL L;  2GUP A;  3OW2 M;  4KH6 A;  4YOV A;  1YIT N;  2IVO A;  2D0O A;  3KWG A;  2ASP A;  4CBX A;  1K8A O;  4BRN A;  4YOT A;  2QWN A;  2OTL N;  2AA4 A;  3CC7 N;  4AF1 A;  3W0L A;  1VQ6 N;  1BU6 O;  1YXQ A;  2NLX A;  3CJB A;  4WQ5 C;  5HL7 L;  4EIA A;  4BGA A;  3DXM A;  4H0T B;  4IWV A;  3VET A;  4R79 A;  3UKU A;  2V7Y A;  3ULE A;  3NVK A;  4WYB A;  1S22 A;  4H5V A;  2WC9 A;  3L4Q A;  5LJW A;  3DXK A;  3CC4 N;  4BC3 A;  2VYP A;  3CQX A;  3VEZ A;  3WQU A;  4JK9 A;  3TSQ A;  2YJF A;  2E2N A;  5KPR A;  5M1P A;  4BRC A;  2A6A A;  3KWI A;  4IJA A;  1RGI A;  2NRX A;  4MO4 A;  3O9T A;  4FSV A;  4DQ8 A;  3A5N C;  1GLA G;  1X9J A;  3SMS A;  4JEP A;  5DM6 L;  3ZEU A;  4HWI A;  1WUA A;  4UY8 O;  3OHR A;  3HRG A;  4BC5 A;  4QS9 A;  2NRV A;  4BRE A;  3VEN A;  2D0P A;  2VCP A;  3D2F A;  3H6E A;  4NLC A;  3G4S N;  4YOR A;  2Q0R A;  1U6Z A;  3WXJ A;  1QQN A;  4O5F A;  1TUU A;  4JKB A;  2GWK A;  3HBT A;  4BRK A;  4A5B A;  3CCR N;  3CJ1 A;  3G71 N;  3EE9 A;  3KK7 A;  3LDP A;  2E8A A;  3K9J A;  3K9K A;  4PKG A;  4AM6 A;  1KQS M;  3AAR A;  4H5T A;  1HKG A;  4DKW A;  4H0O A;  3C6H A;  2NRZ A;  5FPE A;  3MCP A;  4FWM A;  5BR9 A;  3VF2 A;  4BG9 A;  5C10 A;  3VEW A;  3CCE N;  2PAV A;  1VQ5 N;  4O8U A;  4A62 A;  5CR4 A;  4GY2 B;  5C0Y A;  3EKS A;  3ENB A;  4BRH A;  4EHT A;  1RDU A;  4PHT X;  1QZ5 A;  3C7N A;  2YHW A;  5AQM A;  3R9P A;  2P9S B;  3M3Z A;  4FOE A;  4B1Y B;  4C1N K;  4JNE A;  4WFN L;  4BC2 A;  3CCV N;  4K43 A;  3CHW A;  4DB3 A;  2D1K A;  2Q0U A;  4A61 A;  2FSK A;  2VGN A;  2ZJP L;  4O8K A;  1QHA A;  3LM2 A;  3SLC A;  1NGE A;  2BTF A;  3WEE A;  4XH4 A;  1D4X A;  3H1Q A;  1ZC6 A;  3CJA A;  5AZI A;  5BRD A;  4KH4 A;  5GIN A;  1ATS A;  2NRW A;  4PKI A;  3QML A;  2Q1N A;  2QWM A;  1QQO A;  1VQN N;  4G9Z A;  3R3L A;  4ILG B;  5CHI A;  2F7T A;  3GDQ A;  4XH5 A;  3LM9 A;  5JVG L;  3FZL A;  1T6D A;  2P9N A;  2ZJR L;  1WOQ A;  1DGK N;  5AZJ A;  5JLH A;  2AP1 A;  1NGF A;  1Q18 A;  1IJJ A;  2FSJ A;  4JKC A;  3CF5 L;  4BRL A;  4JKG A;  2QW9 A;  1Y64 A;  3GBT A;  3B8A X;  3FLC O;  3E9L A;  4JKA A;  3QBW A;  4GNI A;  1NGA A;  1RFQ A;  4GV6 A;  1T3V A;  3CQY A;  3N4Q A;  3O9S A;  5E84 A;  1HJO A;  3TTD A;  4BRM A;  2YCH A;  4A2A A;  4JKE A;  5AR0 A;  2GWJ A;  3ZET A;  3CCM N;  3CI5 A;  2RHK A;  2E2Q A;  1YVN A;  5M1O A;  1YAG A;  2VGM A;  4FWQ A;  4K25 A;  1LCU A;  1BA1 A;  1BOT O;  1GLC G;  4BGB A;  3O5B A;  2P9P A;  5FPM A;  3QFU A;  4FWP A;  5F2R A;  5AQX A;  2BH1 A;  3D2E A;  5BRH A;  4B1U B;  4I6M A;  5FPD A;  2UYT A;  1DT9 A;  5C15 A;  4EFH A;  2GTD A;  5LY3 A;  1VQ9 N;  2KHO A;  1V4T A;  2JWL A;  5AQT A;  4PKH A;  3O1W A;  1NM1 A;  5EY4 A;  5F0X A;  3PLA A;  4AM7 A;  3U9Z A;  5AQL A;  4FWR A;  1P90 A;  3MN5 A;  1GLJ O;  1VQL N;  3FR0 A;  5C12 A;  3MX2 A;  3Q7B A;  3CCQ N;  4IZ9 A;  2QTD A;  3F9M A;  2HMP A;  3ZX0 A;  3T7Z A;  3T69 A;  1YJ9 N;  1GLB G;  3M5R A;  5AFU A;  4M63 C;  3DWL A;  1EQY A;  3ID6 A;  4RWT A;  3CC2 N;  2CGK A;  1JCE A;  5GAD P;  4QS7 A;  1XC3 A;  2HF4 A;  2IVN A;  4RCH A;  2JWK A;  3UB5 A;  4GV9 A;  3MN6 A;  5C2F A;  4PL8 A;  5BPL A;  1NBW A;  2P9I B;  4CZG A;  3LL3 A;  1Q86 O;  4OO1 J;  4CBW A;  4HTL A;  3Q7C A;  3QDK A;  2E2P A;  3VGM A;  1QVG M;  3IDH A;  1GLD G;  1HLU A;  5AQR A;  3SK3 A;  3I33 A;  4YOW A;  1N8R O;  3CPW M;  4FO0 A;  2YI1 A;  1MA9 B;  2FLO A;  4BQZ A;  3WQT A;  4ISE A;  3ZYY X;  1OVY A;  1NGD A;  1Q82 O;  2KLA A;  1W97 L;  3BF3 A;  4BRI A;  4CD1 A;  3F5T A;  2CH6 A;  3BEX A;  3CJ7 A;  4B1W B;  2CH5 A;  2QWP A;  4B1V A;  3VEO A;  4CI6 A;  4IXC A;  3ZX3 A;  3CCJ N;  1VAZ A;  2NRR A;  2ASO A;  4YDU C;  5EX5 A;  4C1N I;  1VQ4 N;  3A0I X;  5AFU H;  2Q36 A;  4H03 B;  5KPT A;  3E9P A;  3PIP L;  3E66 A;  5BPM A;  3CET A;  3CMA N;  2IIR A;  4YOU A;  1GLF O;  1QZ6 A;  3FZH A;  2NRH A;  2A5X A;  2Q2R A;  4JN4 A;  3VMF B;  3VES A;  2A41 A;  1V4S A;  2QEX N;  2NRT A;  2QM1 A;  3P39 A;  2A40 A;  1NMD A;  1C0G A;  4BRA A;  4IO9 L;  5AQF A;  1Q81 O;  3NMU A;  1XQS C;  3TTC A;  1DKG D;  4BRG A;  4CZK A;  4YOX A;  3F2K A;  2QWQ A;  4WQ4 A;  1VQO N;  3GE1 A;  2P9S A;  3OBW A;  2P9L B;  5AQZ A;  4WF9 L;  1BG3 A;  3EE8 A;  2FF6 A;  3VF6 A;  1VQ8 N;  4KBO A;  3MN9 A;  4K42 A;  1RDW X;  2J4R A;  4H0V B;  3CCL N;  1BDG A;  4CZJ A;  3A8Y A;  3O6W A;  3MN7 A;  3FE1 A;  4MDB A;  4FVU A;  4LC9 B;  4JKH A;  5BN9 A;  4BR7 A;  4BR0 A;  2GEM A;  2ASM A;  2WFB A;  4H5W A;  3S41 A;  1OKJ A;  3VOV A;  4A57 A;  1KXP A;  1KAX A;  3O8M A;  3WT0 A;  4CZM A;  5LJV A;  2ZJQ L;  1YIJ N;  3L4I A;  4A59 A;  3UKR B;  5EXW A;  1ZBS A;  3VEX A;  4JHD B;  2HBK A;  3H3N O;  5TKW A;  4MO5 A;  3FGU A;  3TSU A;  3SAF A;  3AAQ A;  3VGL A;  1Z6R A;  5BPN A;  3GOI A;  4BC4 A;  4BR9 A;  4Y0W A;  1K8K B;  5AQN A;  4BQL A;  2A3Z A;  1SAZ A;  3HOT A;  1K9M O;  4FWN A;  2PBD A;  1MWM A;  3E1Y A;  2P9U B;  3VPZ A;  2EWS A;  4KH5 A;  4B9Q A;  2P9N B;  1H1V A;  2FXU A;  3MMV A;  3BUZ B;  4JKD A;  4H5R A;  3ATV A;  3M6G A;  3VER A;  3VTH A;  4BRQ A;  3EN9 A;  4K41 A;  4IO8 A;  4C23 A;  3OBY A;  4FWO A;  5M1N A;  3L0Q A;  4H0P A;  4MLE A;  4YDU A;  5TKY A;  3I8B A;  3C0B A;  1HKB A;  5F1X A;  1YF5 L;  3A5O C;  4BRF A;  3WXI A;  4E1J A;  4WCE L;  5CE3 A;  3GG4 A;  3RSE B;  3EL2 A;  2OAN A;  4MLH A;  2P9K B;  4IOA L;  1ESV A;  1TYQ B;  3HTV A;  4FWL A;  4JD2 B;  1SZ2 A;  1U2V B;  3A5M C;  2Q31 A;  4WQ4 C;  4XEI A;  5GIO A;  5AQS A;  5HOO A;  1NWK A;  2NNW A;  5DM7 L;  4IEI A;  4U67 L;  3SAH A;  4IDH A;  1E4G T;  3LDO A;  1KD1 O;  5AQI A;  1JJ2 M;  3CJC A;  2ZF5 O;  2F9W A;  4BRP A;  3KHY A;  3D2E B;  3MWP A;  2ZWH A;  4BRO A;  2QI2 A;  5I9E B;  1VQP N;  2CGL A;  5KQD A;  1NGH A;  4JK8 A;  4XH1 A;  3CXC M;  3SMP A;  3C6A A;  1M1K O;  3FFK B;  1YI2 N;  1LOT B;  3SJH A;  1T44 A;  3SBG A;  3KVG A;  3D7E O;  2ZGZ A;  3G6E N;  3FZF A;  2V52 B;  3ATU A;  3ZX2 A;  2NZT A;  3M1F A;  4ILJ A;  1GLL O;  2HBL A;  2QWR A;  3O1B A;  4FPA A;  4CZF A;  2YHX A;  5M1K A;  4CZE A;  2F9T A;  2YX6 A;  4ISF A;  3RVC A;  3TSP A;  5GIP A;  3DJC A;  3J7Z O;  2IVP A;  3C65 A;  3JXU A;  4CD3 A;  4IEE A;  2QA4 N;  3IKM A;  1YJN N;  3CME N;  2E2O A;  3DXM B;  3G25 A;  3HI0 A;  1X3N A;  4H0X B;  2QWO A;  3H46 O;  3UKU B;  4IJN A;  4PL7 A;  5EVZ A;  3ULE B;  1VQ7 N;  1XUP O;  1NGG A;  5AQP A;  2ZGY A;  5FPN A;  3WXM B;  3DXK B;  5H1S Q;  3AGK A;  2E88 A;  3IUC A;  2PFU A;  4FL9 A;  2QWL A;  5AQY A;  2V51 B;  1EO1 A;  1C0F A;  4MDA A;  5GAE P;  4U7B A;  3LDN A;  3R6M A;  4JAX A;  4BG8 A;  5JVH L;  1KAZ A;  4H0Y B;  1K73 O;  1MDU B;  3QB0 A;  4NO7 A;  2FF3 B;  3VEV A;  2A42 A;  4A5A A;  3WXL A;  5JMV A;  1M90 O;  3ENO A;  3P31 A;  3J8A A;  1W2B M;  4H5N A;  3EO3 A;  3ZEU B;  3SAG A;  2FSN A;  2W40 A;  4BR5 A;  5AQK A;  3O9R A;  1YHQ N;  2HST A;  4ISG A;  3D2F B;  4CZI A;  4B1Z A;  1VQK N;  4F9O A;  1HUX A;  2VWB A;  1HPM A;  4FWK A;  3TPQ A;  2GX9 A;  3IFR A;  4QS8 A;  1BUP A;  1MWK A;  3VF4 A;  1Z05 A;  4RTF D;  1ATR A;  1G99 A;  1NGJ A;  3LDQ A;  3U8X A;  4A2B A;  4M7Y A;  5KPZ A;  1KC8 O;  1NGB A;  2I7P A;  4CZL A;  3O4W A;  2I7N A;  4CZH A;  5MLC Q;  1P8Z A;  3HSC A;  3JS6 A;  2YJE A;  2P9L A;  4DHY A;  3HM8 A;  3HOS A;  5AQG A;  4BR2 A;  4WFA L;  5AQU A;  1Q7Y O;  1S3X A;  4IOX A;  3OA9 A;  3A5L C;  3CER A;  3D6R A;  4EHU A;  3WUH A;  5AQJ A;  4JK7 A;  1YJW N;  4CJ7 A;  2YHY A;  2HF3 A;  3R1X A;  4OPA A;  1BA0 A;  2V7Z A;  2QXL A;  4NLB A;  4BVP A;  3C7N B;  5ADX A;  1KAY A;  4JKF A;  2HBJ A;  3QBX A;  3H45 C;  3O08 A;  4NB4 A;  3MDQ A;  3MK6 A;  4GV3 A;  3VTI A;  3VEY A;  1HKC A;  3O9Q A;  3BP8 A;  5BRE A;  4EAH D;  2E20 A;  3MWT A;  5JLF A;  3P4I A;  3UKR A;  4M7X A;  3WEE B;  4WFB L;  1JCF A;  3FZK A;  1O13 A;  3AAP A;  5KQ8 A;  4JHD A;  3PIO L;  1NLV A;  2BUP A;  5AQW A;  1X3M A;  1CZA N;  3E9O A;  5AZI B;  2Q97 A;  3TTF A;  3U9D A;  1BWF O;  4WQ5 A;  3W3D A;  5BRF A;  3I56 N;  3CPE A;  4YOY A;  1IG8 A;  4GVE A;  2W41 A;  3EKU A;  3TU5 A;  1K8K A;  2D4W A;  4ILH A;  3H1V X;  1S72 N;  1ZXO A;  1HX1 A;  3ENH A;  3UE5 A;  1NJI O;  1ILY A;  3LDL A;  2P9U A;  4FPB A;  5AZJ B;  5AQO A;  1SS6 A;  1NGI A;  1JCG A;  3O80 A;  2CGJ A;  4JKG B;  4L3Q A;  4CBU A;  3GL1 A;  5EOY A;  4BR4 A;  1BO5 O;  3CD6 N;  3CIP A;  5AQQ A;  3HZ6 A;  3CCU N;  1R59 O;  4B1X B;  3QFP A;  1GLE G;  2H3G X;  3L6Q A;  3MCA B;  1TUY A;  2RE2 A;  1VQM N;  1J6Z A;  3QIC A;  4FWS A;  2GEL A;  2HBM A;  4OPH A;  3ZET B;  3H3O B;  5JIC A;  1DEJ A;  3CJ9 A;  4J8F A;  3RSE A;  3O9U A;  3N4P A;  3KZB A;  2E1Y A;  3I55 N;  2P9K A;  4BY9 C;  5ADX H;  4IFE A;  5E26 A;  1TYQ A;  5AQV A;  1ATN A;  4JD2 A;  1U2V A;  3R8E A;  1QQM A;  3AY9 A;  1YUW A;  1SQK A;  2DPN A;  3SBT A;  4Z94 A;  5ELZ A;  3EZW A;  2WBN A;  2P9P B;  3NVM A;  3VGK A;  2OTJ N;  3IMX A;  3U4L A;  2E1Z A;  4I6M B;  2HOE A;  1T6C A;  3DAW A;  4BVO A;  1QVF M;  3MX5 A;  2ITM A;  5GAH P;  3BF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...