4WFAL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with linezolid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfaL01
1W2BM 4WF9L 1Q7YO 3PIPL 3G4SN 1KC8O 2OTJN 1YIJN 3CCJN 5MLCQ 3CF5L 5GAGP 1Q82O 1YJWN 3CC2N 1Q86O 4UY8O 3J7ZO 4IO9L 3G6EN 3CCMN 1VQ7N 1Q81O 3CMAN 1VQ4N 3CCRN 1NJIO 1K73O 4WFAL 3CCLN 2ZJRL 1VQPN 5JVHL 3CXCM 1VQKN 3CPWM 1QVFM 3CD6N 3CCEN 5GAEP 3CC4N 1M90O 5DM6L 3CCVN 5JVGL 1YJNN 2ZJPL 3DLLL 1K8AO 2QEXN 1M1KO 1VQMN 1K9MO 1VQ8N 3CCUN 5DM7L 1YJ9N 4IOCL 1YI2N 1VQ9N 2ZJQL 1YHQN 5HL7L 4WFBL 3CMEN 2QA4N 1VQLN 3CCSN 1QVGM 1YITN 4U67L 3G71N 1VQNN 5GAHP 3OW2M 1KQSM 3PIOL 1ILYA 3I56N 1VQ5N 1VQ6N 5GADP 4WFNL 1S72N 3CCQN 3CC7N 1OVYA 1KD1O 5H1SQ 3I55N 1N8RO 2OTLN 1JJ2M 1VQON 4WCEL 4IOAL
chains in the Genus database with same CATH superfamily
4RW4A 3AVBA 3FZFA 2RN2A 4FJ5A 5JS1A 5LJVA 1HNZK 1C1AA 3B6PA 4EHUA 5AFUA 1HPMA 3DM2A 4PL7A 3ENHA 1VQ7N 1JL1A 3K9JA 3DXMB 3ZSOA 1WLJA 3FGUA 5AQUA 2PAVA 3CMAN 1NMNA 3NF9A 2ZGZA 3NH1A 1LW2A 3VENA 5IT9O 4M3ZA 1E4FT 4KO0A 4B8AB 4ILHA 3UKUB 2G8KA 4FW1A 4IFVA 1M90O 5DM6L 1QS4A 2O8CB 4ILGB 3K58A 3CJAA 2QWMA 1B9FA 3DLRA 1EWRA 1YJNN 3VQDA 4CZLA 5GINA 3DYAA 4A5AA 1IH7A 1KVBA 2HBKA 3C0BA 2V52B 4GVEA 4BRGA 3QEPA 1HLUA 4X65K 2ZJQL 1BISA 3P1GA 4HHTA 4WQ4A 4FM0A 2QA4N 1O1WA 3I0SA 3TARA 3VQ8A 4M3RA 3VTIA 4OPJA 3MAQA 5M1KA 3H45C 4HUEA 1VQNN 4JI0K 4DS4A 3ZEUB 4DV1K 1WNSA 2D0AA 4LH5A 3ZT2A 3QEWA 5M1OA 1I94K 5AQIA 3LDSA 4DFJA 2E4LA 2W40A 4CF8A 2FF6A 4QS7A 4GV6A 4FJLA 4RWTA 1WBDA 2ASMA 5KI6A 3HM8A 3QICA 5FDLA 4F2RA 1WB9A 5JS2A 3ATVA 4NCGA 4KTZA 4YDUA 3CM5A 3DOKA 1NMDA 1VK0A 1Q7YO 2GEMA 3G10A 5F1XA 3OYMA 3LZJA 2EWSA 2OCEA 4B1ZA 3RRHA 4FJ8A 4MQ3A 3QIOA 4H0VB 1RNHA 1T03A 4UY8O 2KZMA 3LPUA 4FPBA 4FOEA 4BE1A 2E6LA 1HYVA 1R59O 1XC3A 3C65A 4CJSA 4BR4A 1UA0A 2O8BB 4XIUA 2E6MA 4PL8A 2I7NA 2A3ZA 4N5SA 1HKCA 2FBVA 3SK3A 4CHZA 1REVA 4IJNA 4CBUA 4FLWA 3HPHA 3W0LA 4C1NI 3KKSA 3O6WA 3TSUA 1HQUA 3V9ZA 4Q0BA 3V1RA 3HSTB 4EFHA 3AA4A 4OPAA 1ZBFA 5JMVA 3E9LA 5LMNK 3MX2A 4BR0A 1V4SA 3QBXA 3S3MA 2NNWA 3L4QA 2OPRA 3HL8A 4BG8A 2O4IA 1TUYA 1L5UA 4CZMA 4KI4A 5J1EA 3CQ8A 1K9MO 4DR7K 1CXQA 3WXJA 4ILJA 4JKFA 4Z4HA 1IBLK 2EHGA 5HLFA 3THYB 2FSJA 3P4IA 3ZETA 1HX1A 1NGBA 1T6CA 2WFBA 3GBTA 2HSTA 2IS3A 1W7AA 4DTRA 5EX5A 4PKIA 5J2PA 4NYFA 5J2NA 4Z4GA 1D5AA 2UUCK 3TSQA 3L0QA 3N4PA 3LWMA 3CJ9A 4DF4A 1FKOA 3JS6A 4BROA 5E41A 3B6OA 4QOZB 4DLEA 3OW2M 3VF4A 3E9OA 2KFNA 4BRCA 3I56N 4H5NA 1HQEA 4F4KA 3KIOA 1L3VA 5HRNA 4GMJB 3VOVA 2F8TA 4BRLA 3PV8A 5AJ3K 1N34K 4BR9A 2RPIA 4OKJA 5H1SQ 1Q8IA 4R79A 5T7BA 2A1RA 2JWKA 3U6FA 5KRTA 3L2VA 5CZ2A 3SBGA 5F2RA 4CZIA 3PX4A 3C7NB 4B9LA 3FFKB 2Y1IA 3SI6A 1RCHA 2NRWA 4FCYA 1B92A 2UUBK 4ID5A 4CJEA 4DR6K 4DV3K 4HTLA 2UXDK 3BF1A 3AAPA 4XH5A 3SQ4A 4E1JA 1MU2A 4HCBA 1P90A 3HBTA 3UIQA 3KJVA 4HVJA 4CHNA 3P83D 4JK9A 1VSIA 3VPZA 1QTMA 5FRNA 3NF7A 3NBPA 5KQ8A 4C8OA 4FJJA 3C6UA 3RMBA 4CFBA 1QHAA 2NRXA 3CJBA 4I9QA 5DMRA 3VQAA 3SUOA 2P9SB 5AQYA 1X9WA 1IKYA 3MWPA 2RE2A 2PBDA 3DLHA 5AQMA 4BC5A 2YNIA 4CD3A 1NK7A 4IG0A 4IOCL 3P31A 1QE1A 3NH0A 5SZTA 1QSSA 1NGCA 1JCGA 2GELA 4Y1DA 4WFBL 3CIPA 5CE3A 4BC4A 5FPMA 1DGKN 1CLQA 1RT3A 1RBVA 2YV0X 4BWJA 1C0UA 3D2FA 4IDKA 3AGRA 3C94A 4CFDA 2IVOA 4FJNA 2HHTA 3G71N 5BRFA 1U2VB 2DTUA 3HOTA 1YTUA 5TKWA 3NHGA 2HF4A 3DMJA 3MN5A 3KLFA 3ZYYX 5LL6Z 5I42A 4LH4A 1JLEA 4H0YB 3S3NA 4B9UA 3ASMA 4CJRA 3RWUA 4CF9A 4BG9A 1S3XA 3VESA 3C95A 1DEJA 1S6PA 3AO5A 3AVMA 3LDNA 3NF6A 4CFCA 1U04A 3IRXA 1TAQA 4CEBA 3CCJN 4GV3A 4DFPA 2P1JA 4CCHA 4CK2A 2O8DA 3SPZA 4MFBA 1Q86O 3NFAA 1SKSA 3RMDA 3RRGA 3BEXA 4O0JA 4DMNA 1RTHA 3K59A 4KAZA 1HJRA 3VA0A 3L4IA 3ZX3A 3T1AA 1Q81O 4GV9A 1NGIA 4DR4K 1JLBA 3ENOA 4DS5A 3RMCA 1IO2A 3CHWA 2HMPA 1E3MA 4LF7K 4JN4A 1X9JA 2YJEA 2FBTA 4OX9K 3BGRA 1LCUA 1Z25A 1JLGA 5C15A 3MEGA 1QQMA 3ALYA 4NLBA 1ZYQA 3CERA 4M41A 5AQGA 1TK0A 2E2NA 4IEEA 4B08A 2DFFA 1BA1A 3CCEN 3OS1A 1TVRA 4RCHA 4GW6A 4DTNA 4JV5K 4L3QA 3TANA 5AQLA 5JICA 1S22A 2QWOA 3WUHA 4A2BA 4YOTA 2Z1IA 3HOSA 1EQYA 4O5FA 2VWJA 3DXKA 3HP6A 4CEAA 3VMFB 1BHLA 3KLIA 2V51B 1BU6O 1D4XA 1U48A 1ZBIA 2YX6A 4DSFA 3MECA 2ZQBA 5E26A 3AVCA 1BCOA 2O8EA 3LANA 1L3SA 4FWMA 3NVMA 3M1FA 5BPLA 2P9LB 3V9WA 4U67L 4JKDA 4YDUC 1NU0A 1XHZA 3ZSYA 1DT9A 1S1TA 3J80O 3QERA 4LF8K 1XMOK 3K0SA 4E3SA 3TU5A 3IUCA 3A5MC 3OBWA 4XEIA 4A59A 3NGZA 2HF3A 5M1NA 3M8PA 4Z4IA 1A5WA 3QNNA 5B8HA 1YAGA 2V7ZA 3KTQA 4BR7A 2QKBA 4OJRA 4FSVA 3TAMA 1JJ2M 2OTLN 1S9EA 1TKTA 3KZBA 3D7EO 3ZT1A 3RSEB 5KRSA 4X64K 3KLGA 3SMPA 1TGOA 4FWQA 4UQGA 1KFSA 2A5XA 1RDUA 1W97L 1KC8O 4PUOA 4C8MA 5EY4A 1NM1A 3N4QA 1MDUB 4JEPA 4M3XA 3K57A 3VTHA 4PKHA 1WSHA 4M3YA 2KQ2A 3VQQA 1VQ4N 1RTJA 3O3HA 4FLXA 2IGIA 3ZSVA 5J2MA 2P9PB 4PWDA 4RG8A 2VG6A 2HOEA 3OS2A 4B9QA 4CIGA 2I5JA 3THWA 1VQKN 2D1KA 2QWLA 4FJKA 5HOOA 4IJAA 1NLVA 3E9PA 3O9RA 3JYTA 2H3GX 1JLFA 3CC4N 3VQ5A 5AQRA 1VSHA 4B3TK 3DAWA 2RHKA 3EKUA 1Z05A 3QBWA 1NGFA 1M1KO 1S6QA 3L3UA 1SL2A 3ID8A 1KRPA 1N32K 1Q18A 3KHYA 4B1WB 3WQTA 4W5OA 3THWB 4J2AA 4LSLA 3H3OB 1YF5L 1NJWA 5KTQA 3LDLA 3E1YA 3ULEB 2V7YA 5KQDA 3HM9A 1RT4A 5HBMA 4LF5K 3H08A 3ITHA 2FC0A 3DLKA 5AFUH 1ZBHA 4DHYA 1SKWA 4ISGA 1QSLA 3U4LA 2E2QA 5BRDA 1EETA 3HJFA 1QHTA 4KHPK 4PHTX 3OBYA 1BCMA 4KKOA 4H0OA 4DQPA 3CC7N 2PZSA 3LP0A 3JXUA 3LP2A 3THYA 3OYNA 4AILC 4G1QA 1U6ZA 4IOAL 1EKEA 1XHXA 3AGKA 4WF9L 1HMVA 1U45A 3V9UA 1RBTA 3PIPL 4ISEA 5JLHA 2E2PA 2O4GA 1T05A 2BH1A 4OKKA 4BE0A 1TAUA 3O08A 3L3VA 4LSNA 2XY5A 3VGKA 4AM7A 1OH5A 2P5GA 2VWBA 3R6MA 2B6AA 5AQKA 3CCMN 1OH6A 3D6RA 3SNNA 2VGMA 4DV6K 4CIFA 3QB0A 3CJ7A 3OJUA 3EE8A 3JAMO 4DR1K 1JLQA 3F5TA 3ZT4A 3NCIA 1VSLA 2IAJA 1TL3A 1ATNA 4CF0A 4EAHD 3HXMA 3PLAA 3DLBA 3VF6A 1HJOA 2OPPA 3AVLA 4NXMK 3BY5A 4JLHA 3TTDA 3KK1A 3C7NA 4FWSA 4JI3K 2IIRA 4EHTA 4AHTA 1ZBUA 1LWFA 2ITGA 4FZXC 1IJJA 2G8IA 5EOYA 3LDPA 4W5RA 4FM2A 4YOXA 3A2FA 4O44A 3H1VX 4JKEA 3SQ0A 4FWPA 4MO4A 3K5OA 5D3GA 4Z4EA 1Y64A 3WEEB 4DQRA 5AQPA 2HBLA 2GWKA 4FW2A 4LF6K 4IG3A 3VN5A 2D0CA 4OKEA 1NKEA 1JCFA 3H6EA 1NOYA 4FLZA 1GLCG 3TAEA 1KFDA 4JI2K 4HCCA 3GDQA 2O8FB 1JKHA 3AY9A 4J2DA 3LWLA 4JKGB 2HHUA 1T3VA 2E5LK 3PIOL 1LAWA 4I7FA 4Z94A 4FWOA 3TPQA 2QWNA 5KPZA 2FBXA 3QFUA 1XMQK 1D8YA 3CM6A 4F8RA 1GOCA 2Q2RA 5KPTA 3B8AX 1OKJA 4DV7K 3O5BA 2E88A 1DTTA 3I55N 4HWIA 4WQ5A 3LM9A 1UA1A 4BDPA 4KHUA 2ZGYA 5CHIA 4FLYA 4F2SA 4E0DA 4A2AA 4FM1A 3MN6A 1YIJN 2Z1GA 3U3GA 1XI1A 4B9NA 1BI4B 1NKBA 4H5WA 3CC2N 4JD2B 1YXQA 2NRHA 1QZ5A 4DWIA 3KLEA 2KHOA 4K41A 3D45A 5C12A 1N5YA 1HR0K 2QWRA 2ZF5O 3OYJA 4EZ6A 3ULDA 3VGLA 1RT6A 2GBZA 4R5PA 3O3GA 4ZTJA 3DJCA 1FJGK 1NGEA 4JHDB 2CH5A 3HVRA 1J9AA 1Y97A 4FWRA 3M5RA 3CD6N 2I7PA 4JD2A 4CGFA 4JI7K 3MX5A 5AQOA 2HNZA 1G15A 4CERA 2X78A 2O8DB 1FXXA 2QEXN 2OYQA 1TV6A 4DQ8A 4ICLA 3CCUN 2GTDA 1NK6A 3AV9A 2VCPA 3HPGA 1N33K 3TAFA 4C23A 1ASVA 1YT3A 4FJHA 1V4TA 2ATQA 3CMEN 1U49A 4CECA 1S5JA 1HNXK 3BP8A 3M8QA 1X9SA 2CGJA 3RVCA 2HHVA 4WE1A 3VQ7A 3O1WA 4M3UA 2HHWA 1WUAA 4B1XB 4A62A 3CJCA 2QK9A 2QXFA 3WEEA 4CGGA 4Z4FA 1S1VA 2P9SA 2D4WA 4FPAA 3VERA 4YY3K 4RW8A 2VG7A 1S72N 3R8EA 3FLCO 5C10A 3EZ5A 1BL3A 1NKCA 3H1QA 5AZIA 1DKGD 1OVYA 3MN7A 4TSXA 1SKRA 2DY4A 3E66A 2O8CA 1SUQA 2WOMA 2O8FA 3HP9A 3AVNA 1TYQA 5EXWA 1K8KB 3TAGA 2A41A 3G4SN 4NLCA 4W5TA 1NK0A 2FSNA 3ZLJA 4JI5K 1NBWA 4KH4A 3G6EN 3HK2A 5I9EB 5HRRA 4M3WA 3U9DA 1XC9A 3BDPA 4BC3A 1K6YA 4CE9A 2P9IB 1QZ6A 1HNWK 1CZ9A 4W5QA 1NJIO 4B9MA 1EP4A 2BANA 4YOWA 4IKFA 1MA9B 3ZSQA 4E7JA 4B1UB 3O9SA 3CXCM 3V6DA 1ASUA 5KGWA 4CEFA 4KPYA 2QXLA 3FZMA 2Z1HA 3RSEA 3PO4A 4F3TA 2QW9A 2X6NA 4CZFA 3T1YK 4CJ3A 4BGBA 5FLXO 4JRPA 3F9MA 4OVLA 1KLNA 4H5RA 2AA4A 3ZSRA 1VSMA 1NK4A 5BR9A 3BZKA 5CY4A 2ZWHA 4I6MA 1NJZA 1F21A 3FZKA 2OA8A 3IG1A 4IWVA 4U7BA 3P38A 3G25A 4DF8A 4RW9A 5IWAK 2G8VA 5BREA 3WQUA 2Q3SA 2OPQA 3E01A 3CFRA 3CCSN 4N56A 1YVUA 2ASOA 2RF2A 2YCHA 3D0PA 2F9WA 2IVNA 1LW0A 3LAMA 2UU9K 4I6MB 2F9TA 2DFHA 4HUGA 4RTFD 2QM1A 1X9MA 1RT2A 3PSIA 1J53A 3KLHA 2UUAK 2NRVA 3F2KA 4B1VA 2QI2A 3AA3A 3SZ2A 5C2FA 1KAZA 4AHSA 4X62K 4YHHK 4NCAA 1I3AA 4Z4CA 1ZBSA 1N8RO 3KK3A 2Q31A 2VQFK 4H0TB 3VQ4A 4BVOA 4F9OA 3M3ZA 4DR5K 1LAVA 1JXBA 2YKNA 1BQNA 1IKXA 3ZT3A 5FROA 2HW3A 4PQUA 2D5RA 1GLLO 3AARA 4CD1A 2WTUA 3J81O 1W9HA 1Z26A 1YJWN 4DFMA 2NUBA 4E19A 3HPOA 2JGUA 4FVMA 3VEVA 3DXMA 3FFIA 1S9GA 5AZJA 2IOCA 1NK8A 5AQSA 2XO7A 2QWPA 4K8XA 4KH5A 5J2QA 1YVNA 2YKMA 4QAGA 3PX0A 2F8SA 1TYQB 5HRPA 3LZIA 4A5BA 2D0PA 3WNGA 1C6VA 3V9SA 3UKUA 4CHQA 1BOTO 1MWMA 4ELUA 1IBKK 5GAEP 2Y1JA 1SS6A 4ID1A 5AZJB 4CJ7A 1UWBA 1UAXA 4FJ9A 2QWQA 5C2DA 3THVA 4BDZA 2G8WA 4JK7A 4JI6K 1X3MA 5FPDA 3P39A 4OPHA 5AR0A 4IFEA 4ELTA 5C24A 3TR8A 2FLOA 5M1QA 3VF2A 4K25A 4RW7A 3QDKA 3AVFA 4BRMA 1LWEA 3SV4A 3VQPA 3ISNC 4AHRA 4BWMA 3RR7A 3WNHA 3ZX2A 4CGIA 1NGAA 2YHXA 3CFOA 3K9KA 1WSEA 1NG9A 4DTPA 4FVUA 3VQCA 4DLGA 1GOAA 5GAHP 1RT5A 3OYFA 2E20A 1ILYA 4YNQA 3ZEUA 2OZMA 3VQ6A 3SAGA 5M1FA 2KLAA 1XWLA 4J2BA 5GADP 2JLEA 3FZHA 4H0PA 1KD1O 1QQCA 1G99A 4FJ7A 2Q1NA 1T7PA 1S1UA 4OLBA 3MWTA 4KRFA 5C25A 4WCEL 4CIEA 3IKMA 4IDHA 5AQXA 4O5BA 4CVNE 2OTJN 4DFKA 3ID6A 4GVMA 4DTUA 4C8NA 3UE5A 4BC2A 4FWNA 1RDAA 3H46O 1Q9XA 3A0IX 3SQ1A 2PFUA 4NO7A 3ZSXA 3AVGA 4BRQA 1RDDA 1K73O 3DRRA 5E84A 2NRTA 4YFUA 1ZC6A 3NAEA 1GLAG 4DB3A 1BIZA 3MXJA 2CH6A 3MN9A 1ZBLA 3MEDA 3EE9A 2P9NA 4FWKA 3HO1A 2KFZA 3V1QA 3CCVN 1KVAA 3NH2A 1VRUA 4BRNA 3SJJA 3A5LC 1TUUA 4DSLA 3WXKA 3LDOA 1BQMA 1LV5A 4B9VA 3Q7BA 3TAPA 3VA3A 1RT1A 4DV2K 5HRSA 2NZTA 4H4OA 4NYNA 3L2RA 3TTFA 4FLVA 1KLMA 3HI0A 2NRZA 2XY8A 1EXQA 2BTFA 4B3RK 4W5NA 1YITN 2HHSA 3AO4A 3FZLA 2VQEK 1FW6A 2R7YA 3PSFA 3WT0A 4EIAA 2P9KA 4E7LA 4DQSA 1A5XA 4CZJA 5LMUK 3KD5E 4CESA 1VSKA 4AHVA 3Q7CA 1KAXA 3OYKA 4BVPA 1NJXA 3HYFA 1VQ6N 3AA5X 3AAQA 3P5JA 2HHHK 2EX3A 2CGKA 4CJKA 3L2QA 4JRQA 4FJGA 2UXBK 3VQEA 4HUFA 1T8EA 3BF3A 4CF1A 4M7XA 4FOIA 4CBWA 5C0YA 3QEIA 4H4MA 4AM6A 2VWKA 3SAFA 4M3TA 1EWQA 4JI1K 1TK5A 3PO5A 1JXEA 4XH1A 4A57A 4AQYK 4OPKA 3F73A 1T6DA 2GUIA 3THXB 1D9DA 4YOUA 3V81A 2P9PA 1C1CA 3QESA 2YHBA 4ISFA 4H0XB 4JAXA 4K8ZA 3VEXA 1RDCA 3CETA 3SV3A 1BUPA 4I2QA 2E1ZA 5EVZA 2PY5A 1O13A 4K42A 2P51A 3ZX0A 2ZD1A 3QFPA 2ETJA 4FLUA 4F3OA 1I39A 2XHBA 1J54A 2IC3A 3CPWM 3THXA 1DLOA 4BR2A 2A42A 3KD1E 4KBOA 4FZZA 2RKIA 3HT3A 3BZCA 2FBYA 5BN8A 3CG7A 4JYAK 1HKGA 2YNGA 1WSFA 2QTDA 3ZSWA 3MMVA 1WAFA 4EZ9A 3LL3A 3O4QA 1GLDG 3NMUA 3SPYA 1NWKA 3O9QA 2YNFA 3OVNA 1HUXA 3OYIA 1WAJA 1ESVA 3SAHA 4LC9B 1NGDA 4CJWA 4FK4A 4WYBA 4CJVA 3VEZA 4IZ9A 3F9KA 4DSIA 4X66K 3QEXA 3VEYA 2W6KA 2YHAA 3KWIA 4BGAA 3VQBA 4KTQA 2KZZA 3IS9A 3HZ6A 1U2VA 1NK5A 4GNIA 1QQNA 4DTJA 3OYBA 2Q97A 3HRGA 4DKWA 4OGCA 1NK9A 4BRDA 1VSEA 4N76A 5ELZA 3ZT0A 3RR8A 3O1BA 3O8MA 4H03B 3V1OA 5HP1A 1VHXA 4AH9A 1P8ZA 1IBMK 2F7TA 3O3FA 1X3NA 3OS0A 3IMXA 3M6GA 1RTDA 2WBNA 4B1YB 1TKDA 4DSEA 3SLCA 4CJLA 1HNIA 2P9KB 4LFAK 2HNDA 1HNVA 4DQIA 4N41A 4CZGA 4H5TA 2YJFA 5GAGP 1Q82O 2HMIA 1RTIA 4O4GA 4CK3A 1S1WA 5AQHA 4QS9A 3KKRA 3K5MA 2WUSA 4WQ5C 3BUZB 5AZIB 3CQYA 5KPRA 4CJPA 1C1BA 3V4IA 4G9ZA 4KI6A 4E7HA 4BQZA 1BIUA 4KHQA 1K8KA 3EO3A 4YOYA 4FL9A 1J6ZA 2P9UA 1L3TA 2FXUA 4V19S 1TK8A 4CW7B 4A61A 4FYDA 2HB5A 3NGYA 2CGLA 3I33A 2BUPA 2KKZA 4MLEA 1JLAA 4N47A 1J5EK 1VQ9N 1C0MA 3MCAB 3VETA 2O8EB 2A6AA 4E7KA 4HTUA 4YOVA 3SYZA 3KVGA 3DOLA 4LD0A 1WSGA 4ZHRA 1L3UA 3ATUA 2X6SA 4CJFA 2P9UB 3EL2A 4AF1A 3J7YP 4LF9K 4IFYA 2P9LA 3CFPA 1U47A 1ITGA 1YUWA 4BACA 1RT7A 3CQXA 5ADXH 4LFCK 3A5NC 1KQSM 4MDAA 3UKRB 4E1NA 3T1HK 1J5OA 5JLFA 1SL1A 5BPMA 1T44A 4DTXA 3EN9A 3R1XA 3OHRA 5CYQA 5BR8K 3K5LA 3ZCMA 3C6HA 4FWLA 1E4GT 5AQFA 3VGMA 1UOCA 4DCHA 4AHUA 3R3LA 3T69A 1XNQK 4BRIA 3NE6A 3O4NA 4BRHA 4I9LA 3U9ZA 2NRRA 2WONA 4Y1CA 5AQJA 5BRHA 5MLCQ 4KH6A 3U3YA 5HROA 2Z1JA 3OY9A 2LSNA 4DV0K 1R0AA 2KW4A 1HPZA 3M8SA 4CJUA 4E1MA 2ZM6K 4DSKA 4Y0WA 3AO3A 5GIPA 2YNHA 2HVIA 3NDKA 3AVAA 4CEZA 4FLTA 2O8BA 4FZYA 3DRPA 3MXMA 1SL0A 3FR0A 2PYLA 1C0TA 4DTMA 3EKSA 5LJWA 2ASPA 4FJIA 1VSFA 5FPNA 5JVGL 3LM2A 3C6TA 3IDHA 1OVQA 1WBBA 4DV4K 4B9TA 3OTOK 4C1NK 1VQ8N 2A1SA 4DR3K 3QLHA 5EU7A 1ATSA 4M42A 3KWGA 4MLHA 4PKGA 4JNEA 3OYHA 2E1YA 3WXLA 4BRAA 4O8KA 5AQTA 1YHQN 2Q0UA 4E7IA 1D9FA 4FK0A 2UYTA 2QKKA 1RBRA 1VQLN 4JKBA 2F96A 4JKAA 1SAZA 3T7ZA 1B9DA 1GLEG 3SUPA 2BGGA 3SJHA 5AQQA 4JI4K 4DU1A 4FXDA 1FK9A 4DU4A 3TABA 4CHYA 3WXIA 4CI6A 3SUNA 1RDWX 1QSYA 4IBNA 1RBSA 4KFBA 5C42A 1XQSC 4CBXA 1W0HA 4NB4A 3O9UA 3FE1A 1GLBG 1BA0A 1RDBA 4CZKA 1GOBA 3QEVA 3LP1A 3MK6A 2P5OA 4XH4A 2W6LA 4CEOA 2HVHA 4CGJA 3U8XA 1XNRK 3LPTA 5DK5A 4KREA 4LFBK 4EP4A 3J8AA 5GIOA 1EO1A 3J7ZO 4IO9L 3AO2A 5CZ1A 1S1XA 4DTSA 4CZHA 4GY2B 3C6AA 4NCBA 4K0KK 4OLAA 3KK2A 3ZETB 3CJ1A 3HSCA 3PUFA 3AVIA 4WFAL 2FF3B 1ASWA 4JS4A 2ZJRL 3DLEA 4FO0A 3SBTA 3CPEA 4DUZK 3OYAA 4B3OA 1U4BA 3JSMA 4Z0UA 3G0ZA 3RTVA 2OANA 1KTQA 1IKWA 3M8RA 1BO5O 2B5JA 3LDQA 4CJ5A 1YTAA 2HHXA 3GL1A 3QMLA 4M45A 5K14A 1IG9A 3AVHA 3DLLL 3H3NO 1SV5A 3QNOA 4RW6A 5DM7L 3S9HA 3DWLA 4JKCA 5AQVA 4KB1A 3O4WA 3LAKA 4MDBA 5AQZA 4BRKA 5HL7L 4CEEA 1EX4A 3DXKB 4ZTFA 3R9PA 1ATRA 3OYCA 2ITMA 1QVGM 4BR5A 1LWCA 1Q9YA 3WNFA 3OJSA 4JS5A 2YHWA 2HNYA 2P9NB 2HBJA 3VEWA 2B4JA 4BE2A 4B3MK 3VQ9A 2VYPA 4CEQA 3DI6A 3D2FB 5I3UA 3AVKA 5TKYA 1SZ2A 2GX9A 4B3SK 1GLJO 4CJ4A 3TWHA 4C8KA 1BG3A 2UXCK 1IG8A 4WQ4C 4O0IA 3TAQA 3S3OA 1GLFO 4CGDA 4KV8A 4CK1A 3HTVA 4KHWA 4M7YA 5A2QO 4OGEA 4CFAA 1VQON 1KCFA 4CZEA 3GOIA 4LY7A 2NLXA 3A8YA 1RFQA 2E2OA 4OO1J 4PA1A 2X74A 4BRFA 3CF5L 4KHNA 3WNEA 2XY7A 1BI4A 2FSKA 3I8DA 3UB5A 1JCEA 4Q5VA 3OYDA 4DU3A 3J7AP 4FJXA 3CCRN 3D2EB 3MXIA 3QIPA 2AJQA 4ELVA 3SCXA 2IVPA 3CCLN 4DSJA 5AQNA 1VQPN 5JVHL 4L8RB 4IO8A 2J4RA 1KSPA 3OYEA 1QVFM 2F4VK 3L2UA 2IDOA 1BDGA 1C0FA 2GWJA 3L2WA 3K2PA 4BRPA 4E89A 3OYLA 4DTOA 4CJTA 2BDPA 2ZJPL 4IEIA 2DPNA 5FPEA 1TKXA 3PY8A 1DTQA 3TSPA 4EP5A 1K8AO 1VQMN 1WOQA 1NJYA 4JI8K 4FK2A 4FJMA 1WSJA 4CF2A 3TI0A 2BE2A 3KK7A 1YJ9N 3OA9A 4C8LA 2Q36A 1LOTB 1YI2N 1KAYA 4IXCA 1N36K 1X1PA 3NGIA 1MWKA 2E8AA 4KHSA 3VEOA 3QINA 2HHQA 2DFEA 5FRMA 2KTQA 3CYMA 3SQ2A 4GKKK 5AQWA 2PYJA 4GKJK 4KHYA 4K43A 1JL2A 2D0OA 1NGGA 4KB0A 4CEDA 1OH7A 3NVKA 4I2PA 1JLCA 3CI5A 3CCQN 4QCLA 1RILA 1C0GA 1CZAN 4BY9C 4YORA 3HVTA 2G8HA 3V9XA 2XY6A 3DRSA 1TL1A 3T3FA 3SMSA 3GG4A 1W2BM 1XUPO 1IV0A 3WXMB 4J8FA 3T19A 3LP3A 4M63C 3EEQA 3LALA 2ZE2A 3QO9A 4O55A 3MCPA 5F0XA 2XRIA 4CGHA 1HYZA 2Q0RA 3S41A 1HKBA 4BQLA 3EYZA 4B9SA 1H1VA 5SWMA 3ZSZA 3UKRA 3K5NA 3I0RA 4QS8A 4MO5A 3AA2A 2GV9A 1RGIA 3QETA 2P9IA 1BGXT 1KVCA 5ADXA 2W42A 3AVJA 4O8UA 2A40A 3AO1A 1CZBA 1VSDA 2W41A 1BWFO 1N6QA 4CHPA 2VG5A 3MEEA 4AHCA 1TKZA 1A5VA 1WN7A 1HYSA 1ZXOA 5CR4A 4CJQA 4J2EA 1NGJA 4CHOA 3D2EA 3DLGA 4H8KA 3A5OC 3EZWA 1Z6RA 4KTWA 1RBUA 2D0BA 4H5VA 3O9TA 3O80A 4BDYA 4B8CA 2GUPA 1QQOA 2OPSA 1KXPA 1SQKA 3PX6A 2VGNA 5BN9A 3EY1A 1IKVA 4NXNK 2HBMA 3SUQA 3IAYA 1HRHA 1VRTA 3W3DA 1FKPA 3IFRA 4DUYK 2YI1A 4LF4K 5BPNA 4DQQA 5M1PA 4JHDA 2JWLA 4IOXA 3RMAA 2AP1A 3ULEA 3ENBA 3I8BA 4BREA 1CXUA 1NOZA 3L6QA 1VQ5N 1OH8A 3NF8A 4DG1A 3OYGA 4DR2K 2OZSA 4WFNL 3TTCA 4PY5A 4JKHA 1WSIA 4JK8A 4JKGA 1VAZA 5CYMA 3L8BA 2YHYA 3GE1A 1NNEA 2G8FA 4DV5K 3MDQA 1NGHA 1VSJA 5LY3A 2WC9A 5KGXA 2G8UA
chains in the Genus database with same CATH topology
3SMPA 4FWQA 3FZFA 3U9ZA 2NRRA 5LJVA 2A5XA 1RDUA 1W97L 1KC8O 5AQJA 5EY4A 1NM1A 5BRHA 5MLCQ 4KH6A 1GLLO 3AARA 4CD1A 4EHUA 5AFUA 1HPMA 4PL7A 1YJWN 3N4QA 1MDUB 4JEPA 3ENHA 3VEVA 3DXMA 5AZJA 1VQ7N 3VTHA 4PKHA 3K9JA 5AQSA 3DXMB 2QWPA 3FGUA 5AQUA 2PAVA 3CMAN 1VQ4N 2ZGZA 4KH5A 4Y0WA 1YVNA 2P9PB 5GIPA 1TYQB 2HOEA 4A5BA 2D0PA 4B9QA 3VENA 1E4FT 1VQKN 2D1KA 2QWLA 3UKUA 5HOOA 4ILHA 3UKUB 4IJAA 3FR0A 1NLVA 1BOTO 1MWMA 3E9PA 3EKSA 3O9RA 2H3GX 5GAEP 5LJWA 2ASPA 3CC4N 1M90O 1SS6A 5DM6L 4ILGB 3CJAA 5AZJB 4CJ7A 5AQRA 5FPNA 2QWMA 3DAWA 2RHKA 5JVGL 2QWQA 3EKUA 3IDHA 3LM2A 5C2DA 1Z05A 1YJNN 4CZLA 5GINA 3QBWA 1NGFA 4JK7A 1M1KO 4A5AA 1X3MA 5FPDA 4C1NK 1VQ8N 3P39A 4OPHA 2HBKA 5AR0A 3C0BA 3ID8A 1ATSA 2V52B 4IFEA 4GVEA 1Q18A 3KHYA 3KWGA 4MLHA 1HLUA 2FLOA 3WQTA 4B1WB 4PKGA 4BRGA 2ZJQL 4JNEA 5M1QA 3VF2A 2E1YA 4K25A 3QDKA 3WXLA 4BRMA 4O8KA 5AQTA 3H3OB 4BRAA 1YHQN 1YF5L 2Q0UA 3LDLA 4WQ4A 2QA4N 2UYTA 3E1YA 3ULEB 2V7YA 5KQDA 4JKBA 3VTIA 3ZX2A 1VQLN 1NGAA 2YHXA 3K9KA 5AFUH 4JKAA 4DHYA 1SAZA 3T7ZA 4FVUA 5M1KA 1GLEG 3H45C 4ISGA 1VQNN 5GAHP 3SJHA 5AQQA 2E20A 3ZEUB 1ILYA 3U4LA 2E2QA 3ZEUA 5BRDA 3WXIA 3SAGA 4CI6A 5M1FA 2KLAA 5GADP 4PHTX 3OBYA 1RDWX 3FZHA 5M1OA 4H0PA 5AQIA 4H0OA 3CC7N 1KD1O 2W40A 2FF6A 3JXUA 1G99A 4QS7A 2Q1NA 4GV6A 4RWTA 1XQSC 4CBXA 2ASMA 4NB4A 3O9UA 3HM8A 3FE1A 3MWTA 3QICA 1U6ZA 1GLBG 1BA0A 3ATVA 4CZKA 4WCEL 4IOAL 4YDUA 3IKMA 3AGKA 4IDHA 4WF9L 1NMDA 3MK6A 5AQXA 3PIPL 1Q7YO 2GEMA 5F1XA 4ISEA 5JLHA 2E2PA 4XH4A 2OTJN 2BH1A 2EWSA 4B1ZA 3ID6A 3U8XA 3O08A 3UE5A 3J8AA 4H0VB 4BC2A 5GIOA 4UY8O 3VGKA 4AM7A 3J7ZO 4IO9L 1EO1A 4FWNA 2VWBA 3R6MA 3H46O 5AQKA 4FPBA 4FOEA 3CCMN 3A0IX 1XC3A 1R59O 2PFUA 3C65A 4GY2B 3D6RA 4NO7A 4BR4A 4CZHA 2VGMA 3C6AA 4PL8A 2I7NA 2A3ZA 1HKCA 3QB0A 3CJ7A 3ZETB 3SK3A 4IJNA 4CBUA 3CJ1A 4BRQA 3HSCA 3EE8A 3F5TA 3W0LA 4C1NI 1K73O 3O6WA 4WFAL 2FF3B 5E84A 2ZJRL 4FO0A 3TSUA 2NRTA 3SBTA 3CPEA 1ATNA 1ZC6A 4EFHA 4EAHD 1GLAG 4DB3A 4OPAA 3PLAA 3VF6A 1HJOA 2OANA 5JMVA 3E9LA 3MX2A 2CH6A 4BR0A 1V4SA 3MN9A 3QBXA 3EE9A 2P9NA 1BO5O 2NNWA 3C7NA 3L4QA 2IIRA 3LDQA 4FWSA 4FWKA 3TTDA 4BG8A 4EHTA 3CCVN 1TUYA 3GL1A 1IJJA 3QMLA 5EOYA 3LDPA 4BRNA 4YOXA 3A5LC 1TUUA 3DLLL 3H3NO 3H1VX 4JKEA 4CZMA 3WXKA 1K9MO 4FWPA 3LDOA 3WXJA 4ILJA 4JKFA 4MO4A 5DM7L 1Y64A 3WEEB 3Q7BA 3DWLA 2HBLA 5AQPA 2GWKA 2FSJA 3P4IA 4JKCA 1HX1A 1NGBA 1T6CA 2WFBA 3O4WA 5AQVA 3ZETA 2NZTA 4MDBA 3GBTA 5AQZA 3TTFA 2HSTA 4BRKA 1JCFA 3H6EA 2NRZA 3HI0A 5HL7L 1GLCG 3DXKB 5EX5A 4PKIA 3R9PA 2BTFA 1ATRA 2ITMA 1QVGM 4BR5A 1YITN 3GDQA 3TSQA 3L0QA 3N4PA 3CJ9A 3FZLA 3JS6A 4BROA 3WT0A 3AY9A 2YHWA 2P9NB 2HBJA 4EIAA 3OW2M 3VF4A 3VEWA 3E9OA 4JKGB 1T3VA 2P9KA 3PIOL 4BRCA 4Z94A 4CZJA 3I56N 4H5NA 2VYPA 4FWOA 3D2FB 3Q7CA 1KAXA 3TPQA 5TKYA 2QWNA 1SZ2A 2GX9A 4BVPA 5KPZA 1VQ6N 1GLJO 3AAQA 3QFUA 2CGKA 3VOVA 1BG3A 4BRLA 2Q2RA 3BF3A 4M7XA 4BR9A 5KPTA 4FOIA 3B8AX 1IG8A 1OKJA 4WQ4C 4CBWA 3O5BA 5H1SQ 5C0YA 2E88A 4R79A 3I55N 1GLFO 4AM6A 4HWIA 4WQ5A 2JWKA 3SAFA 3LM9A 3HTVA 4M7YA 1VQON 2ZGYA 4XH1A 4CZEA 5CHIA 4A57A 3GOIA 3SBGA 5F2RA 4CZIA 3C7NB 4A2AA 3FFKB 2NLXA 3A8YA 1T6DA 1RFQA 3MN6A 2E2OA 1YIJN 4OO1J 2NRWA 4BRFA 3CF5L 4YOUA 2P9PA 4H5WA 3CC2N 4ISFA 4H0XB 4JD2B 1YXQA 2FSKA 2NRHA 4JAXA 1QZ5A 4HTLA 3UB5A 3BF1A 3AAPA 4XH5A 3VEXA 2KHOA 4K41A 3CETA 1JCEA 5C12A 4E1JA 1BUPA 2E1ZA 2QWRA 2ZF5O 1P90A 3HBTA 5EVZA 3VGLA 3CCRN 1O13A 3D2EB 4K42A 3ZX0A 3QFPA 3DJCA 1NGEA 2IVPA 3CCLN 4JHDB 4JK9A 5AQNA 1VQPN 5JVHL 2CH5A 3VPZA 3CPWM 4IO8A 2J4RA 5KQ8A 4BR2A 2A42A 4FWRA 1QVFM 3M5RA 4KBOA 3CD6N 2I7PA 1BDGA 1C0FA 1QHAA 2NRXA 2GWJA 3CJBA 4JD2A 4BRPA 3MX5A 5AQOA 5BN8A 2P9SB 1HKGA 5AQYA 2ZJPL 4IEIA 2DPNA 5FPEA 2QTDA 3TSPA 3MMVA 3MWPA 1K8AO 1VQMN 1WOQA 2QEXN 2RE2A 2PBDA 4DQ8A 5AQMA 3LL3A 4BC5A 3CCUN 4CD3A 1GLDG 2GTDA 3KK7A 3NMUA 1YJ9N 3OA9A 4IOCL 3P31A 1NWKA 3O9QA 2Q36A 1LOTB 1YI2N 1HUXA 1ESVA 1KAYA 4IXCA 3SAHA 2VCPA 1NGDA 4LC9B 4WYBA 1NGCA 1JCGA 3VEZA 4C23A 2GELA 4IZ9A 4WFBL 1V4TA 1MWKA 2E8AA 3CIPA 5FPMA 4BC4A 1DGKN 5CE3A 3CMEN 3VEOA 3BP8A 3VEYA 2CGJA 3KWIA 3D2FA 3RVCA 4BGAA 3O1WA 3AGRA 3HZ6A 1U2VA 1WUAA 2IVOA 5AQWA 4B1XB 4GNIA 1QQNA 4A62A 5BRFA 1U2VB 3G71N 2Q97A 3HOTA 3HRGA 3CJCA 5TKWA 2HF4A 3WEEA 4K43A 4DKWA 2P9SA 2D4WA 4FPAA 3VERA 2D0OA 3MN5A 1NGGA 4BRDA 3ZYYX 3NVKA 5ELZA 1S72N 3CI5A 3O1BA 3R8EA 3FLCO 5C10A 3O8MA 4H03B 3CCQN 4H0YB 3H1QA 5AZIA 1DKGD 1OVYA 1P8ZA 3MN7A 2F7TA 1X3NA 1C0GA 1CZAN 3E66A 3IMXA 4BY9C 4BG9A 1S3XA 3M6GA 3VESA 2WBNA 4B1YB 4YORA 1DEJA 3SLCA 1TYQA 5EXWA 1W2BM 3SMSA 3GG4A 1XUPO 2P9KB 1K8KB 3WXMB 3LDNA 4J8FA 2A41A 3G4SN 4M63C 4CZGA 3CCJN 4GV3A 4NLCA 4H5TA 2FSNA 3MCPA 5F0XA 2YJFA 5GAGP 1Q82O 1NBWA 4KH4A 1Q86O 2Q0RA 3S41A 1HKBA 5AQHA 3G6EN 4QS9A 4BQLA 3BEXA 5I9EB 1H1VA 3UKRA 4QS8A 4MO5A 3L4IA 3U9DA 3ZX3A 4BC3A 1Q81O 4GV9A 1NGIA 1RGIA 2P9IB 1QZ6A 3ENOA 2WUSA 2P9IA 4WQ5C 3BUZB 3CHWA 1NJIO 2HMPA 5ADXA 4JN4A 5AZIB 1X9JA 4YOWA 2YJEA 1MA9B 3CQYA 4O8UA 2A40A 5KPRA 1LCUA 4B1UB 3O9SA 3CXCM 2W41A 4G9ZA 5C15A 1QQMA 1BWFO 2QXLA 4NLBA 3FZMA 4BQZA 3CERA 3RSEA 2QW9A 5AQGA 4CZFA 1K8KA 2E2NA 4IEEA 3CCEN 1BA1A 1ZXOA 5CR4A 3EO3A 4YOYA 4RCHA 4FL9A 4BGBA 4L3QA 3F9MA 5AQLA 1J6ZA 2P9UA 1S22A 2QWOA 3WUHA 1NGJA 4YOTA 4A2BA 5JICA 3D2EA 2FXUA 3A5OC 3EZWA 1Z6RA 2AA4A 4H5RA 1EQYA 4O5FA 3HOSA 4A61A 5BR9A 3DXKA 2CGLA 3O9TA 3I33A 3O80A 4H5VA 2BUPA 2KKZA 2GUPA 2ZWHA 4MLEA 1QQOA 4I6MA 3VMFB 1KXPA 2V51B 1BU6O 1D4XA 1SQKA 1VQ9N 2VGNA 3FZKA 2YX6A 5BN9A 5E26A 3MCAB 3VETA 4IWVA 4U7BA 3P38A 3G25A 2A6AA 4YOVA 4FWMA 3KVGA 2HBMA 3NVMA 3M1FA 5BREA 3WQUA 5BPLA 3CCSN 3ATUA 2P9UB 3EL2A 2P9LB 3W3DA 4AF1A 2ASOA 3IFRA 4U67L 4JKDA 2P9LA 2YI1A 4YDUC 5BPNA 1YUWA 2YCHA 5M1PA 3CQXA 2F9WA 2IVNA 2JWLA 4IOXA 4JHDA 5ADXH 1DT9A 3A5NC 1KQSM 2AP1A 4MDAA 3ENBA 3I8BA 3ULEA 3UKRB 4I6MB 2F9TA 4BREA 3L6QA 1VQ5N 5JLFA 4RTFD 2QM1A 3TU5A 5BPMA 1T44A 3IUCA 3A5MC 3OBWA 4XEIA 4A59A 2HF3A 3EN9A 4WFNL 2NRVA 3F2KA 3R1XA 4B1VA 3OHRA 2QI2A 5M1NA 5C2FA 1KAZA 3TTCA 5B8HA 1YAGA 2V7ZA 3C6HA 4JKHA 4JK8A 4JKGA 4FWLA 1E4GT 4BR7A 1VAZA 5AQFA 3VGMA 1ZBSA 2YHYA 3GE1A 4FSVA 4DCHA 1N8RO 2Q31A 3R3LA 3T69A 1JJ2M 3MDQA 2OTLN 4H0TB 1NGHA 5LY3A 2WC9A 3KZBA 3D7EO 3RSEB 4BVOA 4BRIA 4F9OA 3M3ZA 4BRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B M;  4WF9 L;  1Q7Y O;  3PIP L;  3G4S N;  1KC8 O;  2OTJ N;  1YIJ N;  3CCJ N;  5MLC Q;  3CF5 L;  5GAG P;  1Q82 O;  1YJW N;  3CC2 N;  1Q86 O;  4UY8 O;  3J7Z O;  4IO9 L;  3G6E N;  3CCM N;  1VQ7 N;  1Q81 O;  3CMA N;  1VQ4 N;  3CCR N;  1NJI O;  1K73 O;  4WFA L;  3CCL N;  2ZJR L;  1VQP N;  5JVH L;  3CXC M;  1VQK N;  3CPW M;  1QVF M;  3CD6 N;  3CCE N;  5GAE P;  3CC4 N;  1M90 O;  5DM6 L;  3CCV N;  5JVG L;  1YJN N;  2ZJP L;  3DLL L;  1K8A O;  2QEX N;  1M1K O;  1VQM N;  1K9M O;  1VQ8 N;  3CCU N;  5DM7 L;  1YJ9 N;  4IOC L;  1YI2 N;  1VQ9 N;  2ZJQ L;  1YHQ N;  5HL7 L;  4WFB L;  3CME N;  2QA4 N;  1VQL N;  3CCS N;  1QVG M;  1YIT N;  4U67 L;  3G71 N;  1VQN N;  5GAH P;  3OW2 M;  1KQS M;  3PIO L;  1ILY A;  3I56 N;  1VQ5 N;  1VQ6 N;  5GAD P;  4WFN L;  1S72 N;  3CCQ N;  3CC7 N;  1OVY A;  1KD1 O;  5H1S Q;  3I55 N;  1N8R O;  2OTL N;  1JJ2 M;  1VQO N;  4WCE L;  4IOA L; 
#chains in the Genus database with same CATH topology
 4RW4 A;  3AVB A;  3FZF A;  2RN2 A;  4FJ5 A;  5JS1 A;  5LJV A;  1HNZ K;  1C1A A;  3B6P A;  4EHU A;  5AFU A;  1HPM A;  3DM2 A;  4PL7 A;  3ENH A;  1VQ7 N;  1JL1 A;  3K9J A;  3DXM B;  3ZSO A;  1WLJ A;  3FGU A;  5AQU A;  2PAV A;  3CMA N;  1NMN A;  3NF9 A;  2ZGZ A;  3NH1 A;  1LW2 A;  3VEN A;  5IT9 O;  4M3Z A;  1E4F T;  4KO0 A;  4B8A B;  4ILH A;  3UKU B;  2G8K A;  4FW1 A;  4IFV A;  1M90 O;  5DM6 L;  1QS4 A;  2O8C B;  4ILG B;  3K58 A;  3CJA A;  2QWM A;  1B9F A;  3DLR A;  1EWR A;  1YJN N;  3VQD A;  4CZL A;  5GIN A;  3DYA A;  4A5A A;  1IH7 A;  1KVB A;  2HBK A;  3C0B A;  2V52 B;  4GVE A;  4BRG A;  3QEP A;  1HLU A;  4X65 K;  2ZJQ L;  1BIS A;  3P1G A;  4HHT A;  4WQ4 A;  4FM0 A;  2QA4 N;  1O1W A;  3I0S A;  3TAR A;  3VQ8 A;  4M3R A;  3VTI A;  4OPJ A;  3MAQ A;  5M1K A;  3H45 C;  4HUE A;  1VQN N;  4JI0 K;  4DS4 A;  3ZEU B;  4DV1 K;  1WNS A;  2D0A A;  4LH5 A;  3ZT2 A;  3QEW A;  5M1O A;  1I94 K;  5AQI A;  3LDS A;  4DFJ A;  2E4L A;  2W40 A;  4CF8 A;  2FF6 A;  4QS7 A;  4GV6 A;  4FJL A;  4RWT A;  1WBD A;  2ASM A;  5KI6 A;  3HM8 A;  3QIC A;  5FDL A;  4F2R A;  1WB9 A;  5JS2 A;  3ATV A;  4NCG A;  4KTZ A;  4YDU A;  3CM5 A;  3DOK A;  1NMD A;  1VK0 A;  1Q7Y O;  2GEM A;  3G10 A;  5F1X A;  3OYM A;  3LZJ A;  2EWS A;  2OCE A;  4B1Z A;  3RRH A;  4FJ8 A;  4MQ3 A;  3QIO A;  4H0V B;  1RNH A;  1T03 A;  4UY8 O;  2KZM A;  3LPU A;  4FPB A;  4FOE A;  4BE1 A;  2E6L A;  1HYV A;  1R59 O;  1XC3 A;  3C65 A;  4CJS A;  4BR4 A;  1UA0 A;  2O8B B;  4XIU A;  2E6M A;  4PL8 A;  2I7N A;  2A3Z A;  4N5S A;  1HKC A;  2FBV A;  3SK3 A;  4CHZ A;  1REV A;  4IJN A;  4CBU A;  4FLW A;  3HPH A;  3W0L A;  4C1N I;  3KKS A;  3O6W A;  3TSU A;  1HQU A;  3V9Z A;  4Q0B A;  3V1R A;  3HST B;  4EFH A;  3AA4 A;  4OPA A;  1ZBF A;  5JMV A;  3E9L A;  5LMN K;  3MX2 A;  4BR0 A;  1V4S A;  3QBX A;  3S3M A;  2NNW A;  3L4Q A;  2OPR A;  3HL8 A;  4BG8 A;  2O4I A;  1TUY A;  1L5U A;  4CZM A;  4KI4 A;  5J1E A;  3CQ8 A;  1K9M O;  4DR7 K;  1CXQ A;  3WXJ A;  4ILJ A;  4JKF A;  4Z4H A;  1IBL K;  2EHG A;  5HLF A;  3THY B;  2FSJ A;  3P4I A;  3ZET A;  1HX1 A;  1NGB A;  1T6C A;  2WFB A;  3GBT A;  2HST A;  2IS3 A;  1W7A A;  4DTR A;  5EX5 A;  4PKI A;  5J2P A;  4NYF A;  5J2N A;  4Z4G A;  1D5A A;  2UUC K;  3TSQ A;  3L0Q A;  3N4P A;  3LWM A;  3CJ9 A;  4DF4 A;  1FKO A;  3JS6 A;  4BRO A;  5E41 A;  3B6O A;  4QOZ B;  4DLE A;  3OW2 M;  3VF4 A;  3E9O A;  2KFN A;  4BRC A;  3I56 N;  4H5N A;  1HQE A;  4F4K A;  3KIO A;  1L3V A;  5HRN A;  4GMJ B;  3VOV A;  2F8T A;  4BRL A;  3PV8 A;  5AJ3 K;  1N34 K;  4BR9 A;  2RPI A;  4OKJ A;  5H1S Q;  1Q8I A;  4R79 A;  5T7B A;  2A1R A;  2JWK A;  3U6F A;  5KRT A;  3L2V A;  5CZ2 A;  3SBG A;  5F2R A;  4CZI A;  3PX4 A;  3C7N B;  4B9L A;  3FFK B;  2Y1I A;  3SI6 A;  1RCH A;  2NRW A;  4FCY A;  1B92 A;  2UUB K;  4ID5 A;  4CJE A;  4DR6 K;  4DV3 K;  4HTL A;  2UXD K;  3BF1 A;  3AAP A;  4XH5 A;  3SQ4 A;  4E1J A;  1MU2 A;  4HCB A;  1P90 A;  3HBT A;  3UIQ A;  3KJV A;  4HVJ A;  4CHN A;  3P83 D;  4JK9 A;  1VSI A;  3VPZ A;  1QTM A;  5FRN A;  3NF7 A;  3NBP A;  5KQ8 A;  4C8O A;  4FJJ A;  3C6U A;  3RMB A;  4CFB A;  1QHA A;  2NRX A;  3CJB A;  4I9Q A;  5DMR A;  3VQA A;  3SUO A;  2P9S B;  5AQY A;  1X9W A;  1IKY A;  3MWP A;  2RE2 A;  2PBD A;  3DLH A;  5AQM A;  4BC5 A;  2YNI A;  4CD3 A;  1NK7 A;  4IG0 A;  4IOC L;  3P31 A;  1QE1 A;  3NH0 A;  5SZT A;  1QSS A;  1NGC A;  1JCG A;  2GEL A;  4Y1D A;  4WFB L;  3CIP A;  5CE3 A;  4BC4 A;  5FPM A;  1DGK N;  1CLQ A;  1RT3 A;  1RBV A;  2YV0 X;  4BWJ A;  1C0U A;  3D2F A;  4IDK A;  3AGR A;  3C94 A;  4CFD A;  2IVO A;  4FJN A;  2HHT A;  3G71 N;  5BRF A;  1U2V B;  2DTU A;  3HOT A;  1YTU A;  5TKW A;  3NHG A;  2HF4 A;  3DMJ A;  3MN5 A;  3KLF A;  3ZYY X;  5LL6 Z;  5I42 A;  4LH4 A;  1JLE A;  4H0Y B;  3S3N A;  4B9U A;  3ASM A;  4CJR A;  3RWU A;  4CF9 A;  4BG9 A;  1S3X A;  3VES A;  3C95 A;  1DEJ A;  1S6P A;  3AO5 A;  3AVM A;  3LDN A;  3NF6 A;  4CFC A;  1U04 A;  3IRX A;  1TAQ A;  4CEB A;  3CCJ N;  4GV3 A;  4DFP A;  2P1J A;  4CCH A;  4CK2 A;  2O8D A;  3SPZ A;  4MFB A;  1Q86 O;  3NFA A;  1SKS A;  3RMD A;  3RRG A;  3BEX A;  4O0J A;  4DMN A;  1RTH A;  3K59 A;  4KAZ A;  1HJR A;  3VA0 A;  3L4I A;  3ZX3 A;  3T1A A;  1Q81 O;  4GV9 A;  1NGI A;  4DR4 K;  1JLB A;  3ENO A;  4DS5 A;  3RMC A;  1IO2 A;  3CHW A;  2HMP A;  1E3M A;  4LF7 K;  4JN4 A;  1X9J A;  2YJE A;  2FBT A;  4OX9 K;  3BGR A;  1LCU A;  1Z25 A;  1JLG A;  5C15 A;  3MEG A;  1QQM A;  3ALY A;  4NLB A;  1ZYQ A;  3CER A;  4M41 A;  5AQG A;  1TK0 A;  2E2N A;  4IEE A;  4B08 A;  2DFF A;  1BA1 A;  3CCE N;  3OS1 A;  1TVR A;  4RCH A;  4GW6 A;  4DTN A;  4JV5 K;  4L3Q A;  3TAN A;  5AQL A;  5JIC A;  1S22 A;  2QWO A;  3WUH A;  4A2B A;  4YOT A;  2Z1I A;  3HOS A;  1EQY A;  4O5F A;  2VWJ A;  3DXK A;  3HP6 A;  4CEA A;  3VMF B;  1BHL A;  3KLI A;  2V51 B;  1BU6 O;  1D4X A;  1U48 A;  1ZBI A;  2YX6 A;  4DSF A;  3MEC A;  2ZQB A;  5E26 A;  3AVC A;  1BCO A;  2O8E A;  3LAN A;  1L3S A;  4FWM A;  3NVM A;  3M1F A;  5BPL A;  2P9L B;  3V9W A;  4U67 L;  4JKD A;  4YDU C;  1NU0 A;  1XHZ A;  3ZSY A;  1DT9 A;  1S1T A;  3J80 O;  3QER A;  4LF8 K;  1XMO K;  3K0S A;  4E3S A;  3TU5 A;  3IUC A;  3A5M C;  3OBW A;  4XEI A;  4A59 A;  3NGZ A;  2HF3 A;  5M1N A;  3M8P A;  4Z4I A;  1A5W A;  3QNN A;  5B8H A;  1YAG A;  2V7Z A;  3KTQ A;  4BR7 A;  2QKB A;  4OJR A;  4FSV A;  3TAM A;  1JJ2 M;  2OTL N;  1S9E A;  1TKT A;  3KZB A;  3D7E O;  3ZT1 A;  3RSE B;  5KRS A;  4X64 K;  3KLG A;  3SMP A;  1TGO A;  4FWQ A;  4UQG A;  1KFS A;  2A5X A;  1RDU A;  1W97 L;  1KC8 O;  4PUO A;  4C8M A;  5EY4 A;  1NM1 A;  3N4Q A;  1MDU B;  4JEP A;  4M3X A;  3K57 A;  3VTH A;  4PKH A;  1WSH A;  4M3Y A;  2KQ2 A;  3VQQ A;  1VQ4 N;  1RTJ A;  3O3H A;  4FLX A;  2IGI A;  3ZSV A;  5J2M A;  2P9P B;  4PWD A;  4RG8 A;  2VG6 A;  2HOE A;  3OS2 A;  4B9Q A;  4CIG A;  2I5J A;  3THW A;  1VQK N;  2D1K A;  2QWL A;  4FJK A;  5HOO A;  4IJA A;  1NLV A;  3E9P A;  3O9R A;  3JYT A;  2H3G X;  1JLF A;  3CC4 N;  3VQ5 A;  5AQR A;  1VSH A;  4B3T K;  3DAW A;  2RHK A;  3EKU A;  1Z05 A;  3QBW A;  1NGF A;  1M1K O;  1S6Q A;  3L3U A;  1SL2 A;  3ID8 A;  1KRP A;  1N32 K;  1Q18 A;  3KHY A;  4B1W B;  3WQT A;  4W5O A;  3THW B;  4J2A A;  4LSL A;  3H3O B;  1YF5 L;  1NJW A;  5KTQ A;  3LDL A;  3E1Y A;  3ULE B;  2V7Y A;  5KQD A;  3HM9 A;  1RT4 A;  5HBM A;  4LF5 K;  3H08 A;  3ITH A;  2FC0 A;  3DLK A;  5AFU H;  1ZBH A;  4DHY A;  1SKW A;  4ISG A;  1QSL A;  3U4L A;  2E2Q A;  5BRD A;  1EET A;  3HJF A;  1QHT A;  4KHP K;  4PHT X;  3OBY A;  1BCM A;  4KKO A;  4H0O A;  4DQP A;  3CC7 N;  2PZS A;  3LP0 A;  3JXU A;  3LP2 A;  3THY A;  3OYN A;  4AIL C;  4G1Q A;  1U6Z A;  4IOA L;  1EKE A;  1XHX A;  3AGK A;  4WF9 L;  1HMV A;  1U45 A;  3V9U A;  1RBT A;  3PIP L;  4ISE A;  5JLH A;  2E2P A;  2O4G A;  1T05 A;  2BH1 A;  4OKK A;  4BE0 A;  1TAU A;  3O08 A;  3L3V A;  4LSN A;  2XY5 A;  3VGK A;  4AM7 A;  1OH5 A;  2P5G A;  2VWB A;  3R6M A;  2B6A A;  5AQK A;  3CCM N;  1OH6 A;  3D6R A;  3SNN A;  2VGM A;  4DV6 K;  4CIF A;  3QB0 A;  3CJ7 A;  3OJU A;  3EE8 A;  3JAM O;  4DR1 K;  1JLQ A;  3F5T A;  3ZT4 A;  3NCI A;  1VSL A;  2IAJ A;  1TL3 A;  1ATN A;  4CF0 A;  4EAH D;  3HXM A;  3PLA A;  3DLB A;  3VF6 A;  1HJO A;  2OPP A;  3AVL A;  4NXM K;  3BY5 A;  4JLH A;  3TTD A;  3KK1 A;  3C7N A;  4FWS A;  4JI3 K;  2IIR A;  4EHT A;  4AHT A;  1ZBU A;  1LWF A;  2ITG A;  4FZX C;  1IJJ A;  2G8I A;  5EOY A;  3LDP A;  4W5R A;  4FM2 A;  4YOX A;  3A2F A;  4O44 A;  3H1V X;  4JKE A;  3SQ0 A;  4FWP A;  4MO4 A;  3K5O A;  5D3G A;  4Z4E A;  1Y64 A;  3WEE B;  4DQR A;  5AQP A;  2HBL A;  2GWK A;  4FW2 A;  4LF6 K;  4IG3 A;  3VN5 A;  2D0C A;  4OKE A;  1NKE A;  1JCF A;  3H6E A;  1NOY A;  4FLZ A;  1GLC G;  3TAE A;  1KFD A;  4JI2 K;  4HCC A;  3GDQ A;  2O8F B;  1JKH A;  3AY9 A;  4J2D A;  3LWL A;  4JKG B;  2HHU A;  1T3V A;  2E5L K;  3PIO L;  1LAW A;  4I7F A;  4Z94 A;  4FWO A;  3TPQ A;  2QWN A;  5KPZ A;  2FBX A;  3QFU A;  1XMQ K;  1D8Y A;  3CM6 A;  4F8R A;  1GOC A;  2Q2R A;  5KPT A;  3B8A X;  1OKJ A;  4DV7 K;  3O5B A;  2E88 A;  1DTT A;  3I55 N;  4HWI A;  4WQ5 A;  3LM9 A;  1UA1 A;  4BDP A;  4KHU A;  2ZGY A;  5CHI A;  4FLY A;  4F2S A;  4E0D A;  4A2A A;  4FM1 A;  3MN6 A;  1YIJ N;  2Z1G A;  3U3G A;  1XI1 A;  4B9N A;  1BI4 B;  1NKB A;  4H5W A;  3CC2 N;  4JD2 B;  1YXQ A;  2NRH A;  1QZ5 A;  4DWI A;  3KLE A;  2KHO A;  4K41 A;  3D45 A;  5C12 A;  1N5Y A;  1HR0 K;  2QWR A;  2ZF5 O;  3OYJ A;  4EZ6 A;  3ULD A;  3VGL A;  1RT6 A;  2GBZ A;  4R5P A;  3O3G A;  4ZTJ A;  3DJC A;  1FJG K;  1NGE A;  4JHD B;  2CH5 A;  3HVR A;  1J9A A;  1Y97 A;  4FWR A;  3M5R A;  3CD6 N;  2I7P A;  4JD2 A;  4CGF A;  4JI7 K;  3MX5 A;  5AQO A;  2HNZ A;  1G15 A;  4CER A;  2X78 A;  2O8D B;  1FXX A;  2QEX N;  2OYQ A;  1TV6 A;  4DQ8 A;  4ICL A;  3CCU N;  2GTD A;  1NK6 A;  3AV9 A;  2VCP A;  3HPG A;  1N33 K;  3TAF A;  4C23 A;  1ASV A;  1YT3 A;  4FJH A;  1V4T A;  2ATQ A;  3CME N;  1U49 A;  4CEC A;  1S5J A;  1HNX K;  3BP8 A;  3M8Q A;  1X9S A;  2CGJ A;  3RVC A;  2HHV A;  4WE1 A;  3VQ7 A;  3O1W A;  4M3U A;  2HHW A;  1WUA A;  4B1X B;  4A62 A;  3CJC A;  2QK9 A;  2QXF A;  3WEE A;  4CGG A;  4Z4F A;  1S1V A;  2P9S A;  2D4W A;  4FPA A;  3VER A;  4YY3 K;  4RW8 A;  2VG7 A;  1S72 N;  3R8E A;  3FLC O;  5C10 A;  3EZ5 A;  1BL3 A;  1NKC A;  3H1Q A;  5AZI A;  1DKG D;  1OVY A;  3MN7 A;  4TSX A;  1SKR A;  2DY4 A;  3E66 A;  2O8C A;  1SUQ A;  2WOM A;  2O8F A;  3HP9 A;  3AVN A;  1TYQ A;  5EXW A;  1K8K B;  3TAG A;  2A41 A;  3G4S N;  4NLC A;  4W5T A;  1NK0 A;  2FSN A;  3ZLJ A;  4JI5 K;  1NBW A;  4KH4 A;  3G6E N;  3HK2 A;  5I9E B;  5HRR A;  4M3W A;  3U9D A;  1XC9 A;  3BDP A;  4BC3 A;  1K6Y A;  4CE9 A;  2P9I B;  1QZ6 A;  1HNW K;  1CZ9 A;  4W5Q A;  1NJI O;  4B9M A;  1EP4 A;  2BAN A;  4YOW A;  4IKF A;  1MA9 B;  3ZSQ A;  4E7J A;  4B1U B;  3O9S A;  3CXC M;  3V6D A;  1ASU A;  5KGW A;  4CEF A;  4KPY A;  2QXL A;  3FZM A;  2Z1H A;  3RSE A;  3PO4 A;  4F3T A;  2QW9 A;  2X6N A;  4CZF A;  3T1Y K;  4CJ3 A;  4BGB A;  5FLX O;  4JRP A;  3F9M A;  4OVL A;  1KLN A;  4H5R A;  2AA4 A;  3ZSR A;  1VSM A;  1NK4 A;  5BR9 A;  3BZK A;  5CY4 A;  2ZWH A;  4I6M A;  1NJZ A;  1F21 A;  3FZK A;  2OA8 A;  3IG1 A;  4IWV A;  4U7B A;  3P38 A;  3G25 A;  4DF8 A;  4RW9 A;  5IWA K;  2G8V A;  5BRE A;  3WQU A;  2Q3S A;  2OPQ A;  3E01 A;  3CFR A;  3CCS N;  4N56 A;  1YVU A;  2ASO A;  2RF2 A;  2YCH A;  3D0P A;  2F9W A;  2IVN A;  1LW0 A;  3LAM A;  2UU9 K;  4I6M B;  2F9T A;  2DFH A;  4HUG A;  4RTF D;  2QM1 A;  1X9M A;  1RT2 A;  3PSI A;  1J53 A;  3KLH A;  2UUA K;  2NRV A;  3F2K A;  4B1V A;  2QI2 A;  3AA3 A;  3SZ2 A;  5C2F A;  1KAZ A;  4AHS A;  4X62 K;  4YHH K;  4NCA A;  1I3A A;  4Z4C A;  1ZBS A;  1N8R O;  3KK3 A;  2Q31 A;  2VQF K;  4H0T B;  3VQ4 A;  4BVO A;  4F9O A;  3M3Z A;  4DR5 K;  1LAV A;  1JXB A;  2YKN A;  1BQN A;  1IKX A;  3ZT3 A;  5FRO A;  2HW3 A;  4PQU A;  2D5R A;  1GLL O;  3AAR A;  4CD1 A;  2WTU A;  3J81 O;  1W9H A;  1Z26 A;  1YJW N;  4DFM A;  2NUB A;  4E19 A;  3HPO A;  2JGU A;  4FVM A;  3VEV A;  3DXM A;  3FFI A;  1S9G A;  5AZJ A;  2IOC A;  1NK8 A;  5AQS A;  2XO7 A;  2QWP A;  4K8X A;  4KH5 A;  5J2Q A;  1YVN A;  2YKM A;  4QAG A;  3PX0 A;  2F8S A;  1TYQ B;  5HRP A;  3LZI A;  4A5B A;  2D0P A;  3WNG A;  1C6V A;  3V9S A;  3UKU A;  4CHQ A;  1BOT O;  1MWM A;  4ELU A;  1IBK K;  5GAE P;  2Y1J A;  1SS6 A;  4ID1 A;  5AZJ B;  4CJ7 A;  1UWB A;  1UAX A;  4FJ9 A;  2QWQ A;  5C2D A;  3THV A;  4BDZ A;  2G8W A;  4JK7 A;  4JI6 K;  1X3M A;  5FPD A;  3P39 A;  4OPH A;  5AR0 A;  4IFE A;  4ELT A;  5C24 A;  3TR8 A;  2FLO A;  5M1Q A;  3VF2 A;  4K25 A;  4RW7 A;  3QDK A;  3AVF A;  4BRM A;  1LWE A;  3SV4 A;  3VQP A;  3ISN C;  4AHR A;  4BWM A;  3RR7 A;  3WNH A;  3ZX2 A;  4CGI A;  1NGA A;  2YHX A;  3CFO A;  3K9K A;  1WSE A;  1NG9 A;  4DTP A;  4FVU A;  3VQC A;  4DLG A;  1GOA A;  5GAH P;  1RT5 A;  3OYF A;  2E20 A;  1ILY A;  4YNQ A;  3ZEU A;  2OZM A;  3VQ6 A;  3SAG A;  5M1F A;  2KLA A;  1XWL A;  4J2B A;  5GAD P;  2JLE A;  3FZH A;  4H0P A;  1KD1 O;  1QQC A;  1G99 A;  4FJ7 A;  2Q1N A;  1T7P A;  1S1U A;  4OLB A;  3MWT A;  4KRF A;  5C25 A;  4WCE L;  4CIE A;  3IKM A;  4IDH A;  5AQX A;  4O5B A;  4CVN E;  2OTJ N;  4DFK A;  3ID6 A;  4GVM A;  4DTU A;  4C8N A;  3UE5 A;  4BC2 A;  4FWN A;  1RDA A;  3H46 O;  1Q9X A;  3A0I X;  3SQ1 A;  2PFU A;  4NO7 A;  3ZSX A;  3AVG A;  4BRQ A;  1RDD A;  1K73 O;  3DRR A;  5E84 A;  2NRT A;  4YFU A;  1ZC6 A;  3NAE A;  1GLA G;  4DB3 A;  1BIZ A;  3MXJ A;  2CH6 A;  3MN9 A;  1ZBL A;  3MED A;  3EE9 A;  2P9N A;  4FWK A;  3HO1 A;  2KFZ A;  3V1Q A;  3CCV N;  1KVA A;  3NH2 A;  1VRU A;  4BRN A;  3SJJ A;  3A5L C;  1TUU A;  4DSL A;  3WXK A;  3LDO A;  1BQM A;  1LV5 A;  4B9V A;  3Q7B A;  3TAP A;  3VA3 A;  1RT1 A;  4DV2 K;  5HRS A;  2NZT A;  4H4O A;  4NYN A;  3L2R A;  3TTF A;  4FLV A;  1KLM A;  3HI0 A;  2NRZ A;  2XY8 A;  1EXQ A;  2BTF A;  4B3R K;  4W5N A;  1YIT N;  2HHS A;  3AO4 A;  3FZL A;  2VQE K;  1FW6 A;  2R7Y A;  3PSF A;  3WT0 A;  4EIA A;  2P9K A;  4E7L A;  4DQS A;  1A5X A;  4CZJ A;  5LMU K;  3KD5 E;  4CES A;  1VSK A;  4AHV A;  3Q7C A;  1KAX A;  3OYK A;  4BVP A;  1NJX A;  3HYF A;  1VQ6 N;  3AA5 X;  3AAQ A;  3P5J A;  2HHH K;  2EX3 A;  2CGK A;  4CJK A;  3L2Q A;  4JRQ A;  4FJG A;  2UXB K;  3VQE A;  4HUF A;  1T8E A;  3BF3 A;  4CF1 A;  4M7X A;  4FOI A;  4CBW A;  5C0Y A;  3QEI A;  4H4M A;  4AM6 A;  2VWK A;  3SAF A;  4M3T A;  1EWQ A;  4JI1 K;  1TK5 A;  3PO5 A;  1JXE A;  4XH1 A;  4A57 A;  4AQY K;  4OPK A;  3F73 A;  1T6D A;  2GUI A;  3THX B;  1D9D A;  4YOU A;  3V81 A;  2P9P A;  1C1C A;  3QES A;  2YHB A;  4ISF A;  4H0X B;  4JAX A;  4K8Z A;  3VEX A;  1RDC A;  3CET A;  3SV3 A;  1BUP A;  4I2Q A;  2E1Z A;  5EVZ A;  2PY5 A;  1O13 A;  4K42 A;  2P51 A;  3ZX0 A;  2ZD1 A;  3QFP A;  2ETJ A;  4FLU A;  4F3O A;  1I39 A;  2XHB A;  1J54 A;  2IC3 A;  3CPW M;  3THX A;  1DLO A;  4BR2 A;  2A42 A;  3KD1 E;  4KBO A;  4FZZ A;  2RKI A;  3HT3 A;  3BZC A;  2FBY A;  5BN8 A;  3CG7 A;  4JYA K;  1HKG A;  2YNG A;  1WSF A;  2QTD A;  3ZSW A;  3MMV A;  1WAF A;  4EZ9 A;  3LL3 A;  3O4Q A;  1GLD G;  3NMU A;  3SPY A;  1NWK A;  3O9Q A;  2YNF A;  3OVN A;  1HUX A;  3OYI A;  1WAJ A;  1ESV A;  3SAH A;  4LC9 B;  1NGD A;  4CJW A;  4FK4 A;  4WYB A;  4CJV A;  3VEZ A;  4IZ9 A;  3F9K A;  4DSI A;  4X66 K;  3QEX A;  3VEY A;  2W6K A;  2YHA A;  3KWI A;  4BGA A;  3VQB A;  4KTQ A;  2KZZ A;  3IS9 A;  3HZ6 A;  1U2V A;  1NK5 A;  4GNI A;  1QQN A;  4DTJ A;  3OYB A;  2Q97 A;  3HRG A;  4DKW A;  4OGC A;  1NK9 A;  4BRD A;  1VSE A;  4N76 A;  5ELZ A;  3ZT0 A;  3RR8 A;  3O1B A;  3O8M A;  4H03 B;  3V1O A;  5HP1 A;  1VHX A;  4AH9 A;  1P8Z A;  1IBM K;  2F7T A;  3O3F A;  1X3N A;  3OS0 A;  3IMX A;  3M6G A;  1RTD A;  2WBN A;  4B1Y B;  1TKD A;  4DSE A;  3SLC A;  4CJL A;  1HNI A;  2P9K B;  4LFA K;  2HND A;  1HNV A;  4DQI A;  4N41 A;  4CZG A;  4H5T A;  2YJF A;  5GAG P;  1Q82 O;  2HMI A;  1RTI A;  4O4G A;  4CK3 A;  1S1W A;  5AQH A;  4QS9 A;  3KKR A;  3K5M A;  2WUS A;  4WQ5 C;  3BUZ B;  5AZI B;  3CQY A;  5KPR A;  4CJP A;  1C1B A;  3V4I A;  4G9Z A;  4KI6 A;  4E7H A;  4BQZ A;  1BIU A;  4KHQ A;  1K8K A;  3EO3 A;  4YOY A;  4FL9 A;  1J6Z A;  2P9U A;  1L3T A;  2FXU A;  4V19 S;  1TK8 A;  4CW7 B;  4A61 A;  4FYD A;  2HB5 A;  3NGY A;  2CGL A;  3I33 A;  2BUP A;  2KKZ A;  4MLE A;  1JLA A;  4N47 A;  1J5E K;  1VQ9 N;  1C0M A;  3MCA B;  3VET A;  2O8E B;  2A6A A;  4E7K A;  4HTU A;  4YOV A;  3SYZ A;  3KVG A;  3DOL A;  4LD0 A;  1WSG A;  4ZHR A;  1L3U A;  3ATU A;  2X6S A;  4CJF A;  2P9U B;  3EL2 A;  4AF1 A;  3J7Y P;  4LF9 K;  4IFY A;  2P9L A;  3CFP A;  1U47 A;  1ITG A;  1YUW A;  4BAC A;  1RT7 A;  3CQX A;  5ADX H;  4LFC K;  3A5N C;  1KQS M;  4MDA A;  3UKR B;  4E1N A;  3T1H K;  1J5O A;  5JLF A;  1SL1 A;  5BPM A;  1T44 A;  4DTX A;  3EN9 A;  3R1X A;  3OHR A;  5CYQ A;  5BR8 K;  3K5L A;  3ZCM A;  3C6H A;  4FWL A;  1E4G T;  5AQF A;  3VGM A;  1UOC A;  4DCH A;  4AHU A;  3R3L A;  3T69 A;  1XNQ K;  4BRI A;  3NE6 A;  3O4N A;  4BRH A;  4I9L A;  3U9Z A;  2NRR A;  2WON A;  4Y1C A;  5AQJ A;  5BRH A;  5MLC Q;  4KH6 A;  3U3Y A;  5HRO A;  2Z1J A;  3OY9 A;  2LSN A;  4DV0 K;  1R0A A;  2KW4 A;  1HPZ A;  3M8S A;  4CJU A;  4E1M A;  2ZM6 K;  4DSK A;  4Y0W A;  3AO3 A;  5GIP A;  2YNH A;  2HVI A;  3NDK A;  3AVA A;  4CEZ A;  4FLT A;  2O8B A;  4FZY A;  3DRP A;  3MXM A;  1SL0 A;  3FR0 A;  2PYL A;  1C0T A;  4DTM A;  3EKS A;  5LJW A;  2ASP A;  4FJI A;  1VSF A;  5FPN A;  5JVG L;  3LM2 A;  3C6T A;  3IDH A;  1OVQ A;  1WBB A;  4DV4 K;  4B9T A;  3OTO K;  4C1N K;  1VQ8 N;  2A1S A;  4DR3 K;  3QLH A;  5EU7 A;  1ATS A;  4M42 A;  3KWG A;  4MLH A;  4PKG A;  4JNE A;  3OYH A;  2E1Y A;  3WXL A;  4BRA A;  4O8K A;  5AQT A;  1YHQ N;  2Q0U A;  4E7I A;  1D9F A;  4FK0 A;  2UYT A;  2QKK A;  1RBR A;  1VQL N;  4JKB A;  2F96 A;  4JKA A;  1SAZ A;  3T7Z A;  1B9D A;  1GLE G;  3SUP A;  2BGG A;  3SJH A;  5AQQ A;  4JI4 K;  4DU1 A;  4FXD A;  1FK9 A;  4DU4 A;  3TAB A;  4CHY A;  3WXI A;  4CI6 A;  3SUN A;  1RDW X;  1QSY A;  4IBN A;  1RBS A;  4KFB A;  5C42 A;  1XQS C;  4CBX A;  1W0H A;  4NB4 A;  3O9U A;  3FE1 A;  1GLB G;  1BA0 A;  1RDB A;  4CZK A;  1GOB A;  3QEV A;  3LP1 A;  3MK6 A;  2P5O A;  4XH4 A;  2W6L A;  4CEO A;  2HVH A;  4CGJ A;  3U8X A;  1XNR K;  3LPT A;  5DK5 A;  4KRE A;  4LFB K;  4EP4 A;  3J8A A;  5GIO A;  1EO1 A;  3J7Z O;  4IO9 L;  3AO2 A;  5CZ1 A;  1S1X A;  4DTS A;  4CZH A;  4GY2 B;  3C6A A;  4NCB A;  4K0K K;  4OLA A;  3KK2 A;  3ZET B;  3CJ1 A;  3HSC A;  3PUF A;  3AVI A;  4WFA L;  2FF3 B;  1ASW A;  4JS4 A;  2ZJR L;  3DLE A;  4FO0 A;  3SBT A;  3CPE A;  4DUZ K;  3OYA A;  4B3O A;  1U4B A;  3JSM A;  4Z0U A;  3G0Z A;  3RTV A;  2OAN A;  1KTQ A;  1IKW A;  3M8R A;  1BO5 O;  2B5J A;  3LDQ A;  4CJ5 A;  1YTA A;  2HHX A;  3GL1 A;  3QML A;  4M45 A;  5K14 A;  1IG9 A;  3AVH A;  3DLL L;  3H3N O;  1SV5 A;  3QNO A;  4RW6 A;  5DM7 L;  3S9H A;  3DWL A;  4JKC A;  5AQV A;  4KB1 A;  3O4W A;  3LAK A;  4MDB A;  5AQZ A;  4BRK A;  5HL7 L;  4CEE A;  1EX4 A;  3DXK B;  4ZTF A;  3R9P A;  1ATR A;  3OYC A;  2ITM A;  1QVG M;  4BR5 A;  1LWC A;  1Q9Y A;  3WNF A;  3OJS A;  4JS5 A;  2YHW A;  2HNY A;  2P9N B;  2HBJ A;  3VEW A;  2B4J A;  4BE2 A;  4B3M K;  3VQ9 A;  2VYP A;  4CEQ A;  3DI6 A;  3D2F B;  5I3U A;  3AVK A;  5TKY A;  1SZ2 A;  2GX9 A;  4B3S K;  1GLJ O;  4CJ4 A;  3TWH A;  4C8K A;  1BG3 A;  2UXC K;  1IG8 A;  4WQ4 C;  4O0I A;  3TAQ A;  3S3O A;  1GLF O;  4CGD A;  4KV8 A;  4CK1 A;  3HTV A;  4KHW A;  4M7Y A;  5A2Q O;  4OGE A;  4CFA A;  1VQO N;  1KCF A;  4CZE A;  3GOI A;  4LY7 A;  2NLX A;  3A8Y A;  1RFQ A;  2E2O A;  4OO1 J;  4PA1 A;  2X74 A;  4BRF A;  3CF5 L;  4KHN A;  3WNE A;  2XY7 A;  1BI4 A;  2FSK A;  3I8D A;  3UB5 A;  1JCE A;  4Q5V A;  3OYD A;  4DU3 A;  3J7A P;  4FJX A;  3CCR N;  3D2E B;  3MXI A;  3QIP A;  2AJQ A;  4ELV A;  3SCX A;  2IVP A;  3CCL N;  4DSJ A;  5AQN A;  1VQP N;  5JVH L;  4L8R B;  4IO8 A;  2J4R A;  1KSP A;  3OYE A;  1QVF M;  2F4V K;  3L2U A;  2IDO A;  1BDG A;  1C0F A;  2GWJ A;  3L2W A;  3K2P A;  4BRP A;  4E89 A;  3OYL A;  4DTO A;  4CJT A;  2BDP A;  2ZJP L;  4IEI A;  2DPN A;  5FPE A;  1TKX A;  3PY8 A;  1DTQ A;  3TSP A;  4EP5 A;  1K8A O;  1VQM N;  1WOQ A;  1NJY A;  4JI8 K;  4FK2 A;  4FJM A;  1WSJ A;  4CF2 A;  3TI0 A;  2BE2 A;  3KK7 A;  1YJ9 N;  3OA9 A;  4C8L A;  2Q36 A;  1LOT B;  1YI2 N;  1KAY A;  4IXC A;  1N36 K;  1X1P A;  3NGI A;  1MWK A;  2E8A A;  4KHS A;  3VEO A;  3QIN A;  2HHQ A;  2DFE A;  5FRM A;  2KTQ A;  3CYM A;  3SQ2 A;  4GKK K;  5AQW A;  2PYJ A;  4GKJ K;  4KHY A;  4K43 A;  1JL2 A;  2D0O A;  1NGG A;  4KB0 A;  4CED A;  1OH7 A;  3NVK A;  4I2P A;  1JLC A;  3CI5 A;  3CCQ N;  4QCL A;  1RIL A;  1C0G A;  1CZA N;  4BY9 C;  4YOR A;  3HVT A;  2G8H A;  3V9X A;  2XY6 A;  3DRS A;  1TL1 A;  3T3F A;  3SMS A;  3GG4 A;  1W2B M;  1XUP O;  1IV0 A;  3WXM B;  4J8F A;  3T19 A;  3LP3 A;  4M63 C;  3EEQ A;  3LAL A;  2ZE2 A;  3QO9 A;  4O55 A;  3MCP A;  5F0X A;  2XRI A;  4CGH A;  1HYZ A;  2Q0R A;  3S41 A;  1HKB A;  4BQL A;  3EYZ A;  4B9S A;  1H1V A;  5SWM A;  3ZSZ A;  3UKR A;  3K5N A;  3I0R A;  4QS8 A;  4MO5 A;  3AA2 A;  2GV9 A;  1RGI A;  3QET A;  2P9I A;  1BGX T;  1KVC A;  5ADX A;  2W42 A;  3AVJ A;  4O8U A;  2A40 A;  3AO1 A;  1CZB A;  1VSD A;  2W41 A;  1BWF O;  1N6Q A;  4CHP A;  2VG5 A;  3MEE A;  4AHC A;  1TKZ A;  1A5V A;  1WN7 A;  1HYS A;  1ZXO A;  5CR4 A;  4CJQ A;  4J2E A;  1NGJ A;  4CHO A;  3D2E A;  3DLG A;  4H8K A;  3A5O C;  3EZW A;  1Z6R A;  4KTW A;  1RBU A;  2D0B A;  4H5V A;  3O9T A;  3O80 A;  4BDY A;  4B8C A;  2GUP A;  1QQO A;  2OPS A;  1KXP A;  1SQK A;  3PX6 A;  2VGN A;  5BN9 A;  3EY1 A;  1IKV A;  4NXN K;  2HBM A;  3SUQ A;  3IAY A;  1HRH A;  1VRT A;  3W3D A;  1FKP A;  3IFR A;  4DUY K;  2YI1 A;  4LF4 K;  5BPN A;  4DQQ A;  5M1P A;  4JHD A;  2JWL A;  4IOX A;  3RMA A;  2AP1 A;  3ULE A;  3ENB A;  3I8B A;  4BRE A;  1CXU A;  1NOZ A;  3L6Q A;  1VQ5 N;  1OH8 A;  3NF8 A;  4DG1 A;  3OYG A;  4DR2 K;  2OZS A;  4WFN L;  3TTC A;  4PY5 A;  4JKH A;  1WSI A;  4JK8 A;  4JKG A;  1VAZ A;  5CYM A;  3L8B A;  2YHY A;  3GE1 A;  1NNE A;  2G8F A;  4DV5 K;  3MDQ A;  1NGH A;  1VSJ A;  5LY3 A;  2WC9 A;  5KGX A;  2G8U A; 
#chains in the Genus database with same CATH homology
 3SMP A;  4FWQ A;  3FZF A;  3U9Z A;  2NRR A;  5LJV A;  2A5X A;  1RDU A;  1W97 L;  1KC8 O;  5AQJ A;  5EY4 A;  1NM1 A;  5BRH A;  5MLC Q;  4KH6 A;  1GLL O;  3AAR A;  4CD1 A;  4EHU A;  5AFU A;  1HPM A;  4PL7 A;  1YJW N;  3N4Q A;  1MDU B;  4JEP A;  3ENH A;  3VEV A;  3DXM A;  5AZJ A;  1VQ7 N;  3VTH A;  4PKH A;  3K9J A;  5AQS A;  3DXM B;  2QWP A;  3FGU A;  5AQU A;  2PAV A;  3CMA N;  1VQ4 N;  2ZGZ A;  4KH5 A;  4Y0W A;  1YVN A;  2P9P B;  5GIP A;  1TYQ B;  2HOE A;  4A5B A;  2D0P A;  4B9Q A;  3VEN A;  1E4F T;  1VQK N;  2D1K A;  2QWL A;  3UKU A;  5HOO A;  4ILH A;  3UKU B;  4IJA A;  3FR0 A;  1NLV A;  1BOT O;  1MWM A;  3E9P A;  3EKS A;  3O9R A;  2H3G X;  5GAE P;  5LJW A;  2ASP A;  3CC4 N;  1M90 O;  1SS6 A;  5DM6 L;  4ILG B;  3CJA A;  5AZJ B;  4CJ7 A;  5AQR A;  5FPN A;  2QWM A;  3DAW A;  2RHK A;  5JVG L;  2QWQ A;  3EKU A;  3IDH A;  3LM2 A;  5C2D A;  1Z05 A;  1YJN N;  4CZL A;  5GIN A;  3QBW A;  1NGF A;  4JK7 A;  1M1K O;  4A5A A;  1X3M A;  5FPD A;  4C1N K;  1VQ8 N;  3P39 A;  4OPH A;  2HBK A;  5AR0 A;  3C0B A;  3ID8 A;  1ATS A;  2V52 B;  4IFE A;  4GVE A;  1Q18 A;  3KHY A;  3KWG A;  4MLH A;  1HLU A;  2FLO A;  3WQT A;  4B1W B;  4PKG A;  4BRG A;  2ZJQ L;  4JNE A;  5M1Q A;  3VF2 A;  2E1Y A;  4K25 A;  3QDK A;  3WXL A;  4BRM A;  4O8K A;  5AQT A;  3H3O B;  4BRA A;  1YHQ N;  1YF5 L;  2Q0U A;  3LDL A;  4WQ4 A;  2QA4 N;  2UYT A;  3E1Y A;  3ULE B;  2V7Y A;  5KQD A;  4JKB A;  3VTI A;  3ZX2 A;  1VQL N;  1NGA A;  2YHX A;  3K9K A;  5AFU H;  4JKA A;  4DHY A;  1SAZ A;  3T7Z A;  4FVU A;  5M1K A;  1GLE G;  3H45 C;  4ISG A;  1VQN N;  5GAH P;  3SJH A;  5AQQ A;  2E20 A;  3ZEU B;  1ILY A;  3U4L A;  2E2Q A;  3ZEU A;  5BRD A;  3WXI A;  3SAG A;  4CI6 A;  5M1F A;  2KLA A;  5GAD P;  4PHT X;  3OBY A;  1RDW X;  3FZH A;  5M1O A;  4H0P A;  5AQI A;  4H0O A;  3CC7 N;  1KD1 O;  2W40 A;  2FF6 A;  3JXU A;  1G99 A;  4QS7 A;  2Q1N A;  4GV6 A;  4RWT A;  1XQS C;  4CBX A;  2ASM A;  4NB4 A;  3O9U A;  3HM8 A;  3FE1 A;  3MWT A;  3QIC A;  1U6Z A;  1GLB G;  1BA0 A;  3ATV A;  4CZK A;  4WCE L;  4IOA L;  4YDU A;  3IKM A;  3AGK A;  4IDH A;  4WF9 L;  1NMD A;  3MK6 A;  5AQX A;  3PIP L;  1Q7Y O;  2GEM A;  5F1X A;  4ISE A;  5JLH A;  2E2P A;  4XH4 A;  2OTJ N;  2BH1 A;  2EWS A;  4B1Z A;  3ID6 A;  3U8X A;  3O08 A;  3UE5 A;  3J8A A;  4H0V B;  4BC2 A;  5GIO A;  4UY8 O;  3VGK A;  4AM7 A;  3J7Z O;  4IO9 L;  1EO1 A;  4FWN A;  2VWB A;  3R6M A;  3H46 O;  5AQK A;  4FPB A;  4FOE A;  3CCM N;  3A0I X;  1XC3 A;  1R59 O;  2PFU A;  3C65 A;  4GY2 B;  3D6R A;  4NO7 A;  4BR4 A;  4CZH A;  2VGM A;  3C6A A;  4PL8 A;  2I7N A;  2A3Z A;  1HKC A;  3QB0 A;  3CJ7 A;  3ZET B;  3SK3 A;  4IJN A;  4CBU A;  3CJ1 A;  4BRQ A;  3HSC A;  3EE8 A;  3F5T A;  3W0L A;  4C1N I;  1K73 O;  3O6W A;  4WFA L;  2FF3 B;  5E84 A;  2ZJR L;  4FO0 A;  3TSU A;  2NRT A;  3SBT A;  3CPE A;  1ATN A;  1ZC6 A;  4EFH A;  4EAH D;  1GLA G;  4DB3 A;  4OPA A;  3PLA A;  3VF6 A;  1HJO A;  2OAN A;  5JMV A;  3E9L A;  3MX2 A;  2CH6 A;  4BR0 A;  1V4S A;  3MN9 A;  3QBX A;  3EE9 A;  2P9N A;  1BO5 O;  2NNW A;  3C7N A;  3L4Q A;  2IIR A;  3LDQ A;  4FWS A;  4FWK A;  3TTD A;  4BG8 A;  4EHT A;  3CCV N;  1TUY A;  3GL1 A;  1IJJ A;  3QML A;  5EOY A;  3LDP A;  4BRN A;  4YOX A;  3A5L C;  1TUU A;  3DLL L;  3H3N O;  3H1V X;  4JKE A;  4CZM A;  3WXK A;  1K9M O;  4FWP A;  3LDO A;  3WXJ A;  4ILJ A;  4JKF A;  4MO4 A;  5DM7 L;  1Y64 A;  3WEE B;  3Q7B A;  3DWL A;  2HBL A;  5AQP A;  2GWK A;  2FSJ A;  3P4I A;  4JKC A;  1HX1 A;  1NGB A;  1T6C A;  2WFB A;  3O4W A;  5AQV A;  3ZET A;  2NZT A;  4MDB A;  3GBT A;  5AQZ A;  3TTF A;  2HST A;  4BRK A;  1JCF A;  3H6E A;  2NRZ A;  3HI0 A;  5HL7 L;  1GLC G;  3DXK B;  5EX5 A;  4PKI A;  3R9P A;  2BTF A;  1ATR A;  2ITM A;  1QVG M;  4BR5 A;  1YIT N;  3GDQ A;  3TSQ A;  3L0Q A;  3N4P A;  3CJ9 A;  3FZL A;  3JS6 A;  4BRO A;  3WT0 A;  3AY9 A;  2YHW A;  2P9N B;  2HBJ A;  4EIA A;  3OW2 M;  3VF4 A;  3VEW A;  3E9O A;  4JKG B;  1T3V A;  2P9K A;  3PIO L;  4BRC A;  4Z94 A;  4CZJ A;  3I56 N;  4H5N A;  2VYP A;  4FWO A;  3D2F B;  3Q7C A;  1KAX A;  3TPQ A;  5TKY A;  2QWN A;  1SZ2 A;  2GX9 A;  4BVP A;  5KPZ A;  1VQ6 N;  1GLJ O;  3AAQ A;  3QFU A;  2CGK A;  3VOV A;  1BG3 A;  4BRL A;  2Q2R A;  3BF3 A;  4M7X A;  4BR9 A;  5KPT A;  4FOI A;  3B8A X;  1IG8 A;  1OKJ A;  4WQ4 C;  4CBW A;  3O5B A;  5H1S Q;  5C0Y A;  2E88 A;  4R79 A;  3I55 N;  1GLF O;  4AM6 A;  4HWI A;  4WQ5 A;  2JWK A;  3SAF A;  3LM9 A;  3HTV A;  4M7Y A;  1VQO N;  2ZGY A;  4XH1 A;  4CZE A;  5CHI A;  4A57 A;  3GOI A;  3SBG A;  5F2R A;  4CZI A;  3C7N B;  4A2A A;  3FFK B;  2NLX A;  3A8Y A;  1T6D A;  1RFQ A;  3MN6 A;  2E2O A;  1YIJ N;  4OO1 J;  2NRW A;  4BRF A;  3CF5 L;  4YOU A;  2P9P A;  4H5W A;  3CC2 N;  4ISF A;  4H0X B;  4JD2 B;  1YXQ A;  2FSK A;  2NRH A;  4JAX A;  1QZ5 A;  4HTL A;  3UB5 A;  3BF1 A;  3AAP A;  4XH5 A;  3VEX A;  2KHO A;  4K41 A;  3CET A;  1JCE A;  5C12 A;  4E1J A;  1BUP A;  2E1Z A;  2QWR A;  2ZF5 O;  1P90 A;  3HBT A;  5EVZ A;  3VGL A;  3CCR N;  1O13 A;  3D2E B;  4K42 A;  3ZX0 A;  3QFP A;  3DJC A;  1NGE A;  2IVP A;  3CCL N;  4JHD B;  4JK9 A;  5AQN A;  1VQP N;  5JVH L;  2CH5 A;  3VPZ A;  3CPW M;  4IO8 A;  2J4R A;  5KQ8 A;  4BR2 A;  2A42 A;  4FWR A;  1QVF M;  3M5R A;  4KBO A;  3CD6 N;  2I7P A;  1BDG A;  1C0F A;  1QHA A;  2NRX A;  2GWJ A;  3CJB A;  4JD2 A;  4BRP A;  3MX5 A;  5AQO A;  5BN8 A;  2P9S B;  1HKG A;  5AQY A;  2ZJP L;  4IEI A;  2DPN A;  5FPE A;  2QTD A;  3TSP A;  3MMV A;  3MWP A;  1K8A O;  1VQM N;  1WOQ A;  2QEX N;  2RE2 A;  2PBD A;  4DQ8 A;  5AQM A;  3LL3 A;  4BC5 A;  3CCU N;  4CD3 A;  1GLD G;  2GTD A;  3KK7 A;  3NMU A;  1YJ9 N;  3OA9 A;  4IOC L;  3P31 A;  1NWK A;  3O9Q A;  2Q36 A;  1LOT B;  1YI2 N;  1HUX A;  1ESV A;  1KAY A;  4IXC A;  3SAH A;  2VCP A;  1NGD A;  4LC9 B;  4WYB A;  1NGC A;  1JCG A;  3VEZ A;  4C23 A;  2GEL A;  4IZ9 A;  4WFB L;  1V4T A;  1MWK A;  2E8A A;  3CIP A;  5FPM A;  4BC4 A;  1DGK N;  5CE3 A;  3CME N;  3VEO A;  3BP8 A;  3VEY A;  2CGJ A;  3KWI A;  3D2F A;  3RVC A;  4BGA A;  3O1W A;  3AGR A;  3HZ6 A;  1U2V A;  1WUA A;  2IVO A;  5AQW A;  4B1X B;  4GNI A;  1QQN A;  4A62 A;  5BRF A;  1U2V B;  3G71 N;  2Q97 A;  3HOT A;  3HRG A;  3CJC A;  5TKW A;  2HF4 A;  3WEE A;  4K43 A;  4DKW A;  2P9S A;  2D4W A;  4FPA A;  3VER A;  2D0O A;  3MN5 A;  1NGG A;  4BRD A;  3ZYY X;  3NVK A;  5ELZ A;  1S72 N;  3CI5 A;  3O1B A;  3R8E A;  3FLC O;  5C10 A;  3O8M A;  4H03 B;  3CCQ N;  4H0Y B;  3H1Q A;  5AZI A;  1DKG D;  1OVY A;  1P8Z A;  3MN7 A;  2F7T A;  1X3N A;  1C0G A;  1CZA N;  3E66 A;  3IMX A;  4BY9 C;  4BG9 A;  1S3X A;  3M6G A;  3VES A;  2WBN A;  4B1Y B;  4YOR A;  1DEJ A;  3SLC A;  1TYQ A;  5EXW A;  1W2B M;  3SMS A;  3GG4 A;  1XUP O;  2P9K B;  1K8K B;  3WXM B;  3LDN A;  4J8F A;  2A41 A;  3G4S N;  4M63 C;  4CZG A;  3CCJ N;  4GV3 A;  4NLC A;  4H5T A;  2FSN A;  3MCP A;  5F0X A;  2YJF A;  5GAG P;  1Q82 O;  1NBW A;  4KH4 A;  1Q86 O;  2Q0R A;  3S41 A;  1HKB A;  5AQH A;  3G6E N;  4QS9 A;  4BQL A;  3BEX A;  5I9E B;  1H1V A;  3UKR A;  4QS8 A;  4MO5 A;  3L4I A;  3U9D A;  3ZX3 A;  4BC3 A;  1Q81 O;  4GV9 A;  1NGI A;  1RGI A;  2P9I B;  1QZ6 A;  3ENO A;  2WUS A;  2P9I A;  4WQ5 C;  3BUZ B;  3CHW A;  1NJI O;  2HMP A;  5ADX A;  4JN4 A;  5AZI B;  1X9J A;  4YOW A;  2YJE A;  1MA9 B;  3CQY A;  4O8U A;  2A40 A;  5KPR A;  1LCU A;  4B1U B;  3O9S A;  3CXC M;  2W41 A;  4G9Z A;  5C15 A;  1QQM A;  1BWF O;  2QXL A;  4NLB A;  3FZM A;  4BQZ A;  3CER A;  3RSE A;  2QW9 A;  5AQG A;  4CZF A;  1K8K A;  2E2N A;  4IEE A;  3CCE N;  1BA1 A;  1ZXO A;  5CR4 A;  3EO3 A;  4YOY A;  4RCH A;  4FL9 A;  4BGB A;  4L3Q A;  3F9M A;  5AQL A;  1J6Z A;  2P9U A;  1S22 A;  2QWO A;  3WUH A;  1NGJ A;  4YOT A;  4A2B A;  5JIC A;  3D2E A;  2FXU A;  3A5O C;  3EZW A;  1Z6R A;  2AA4 A;  4H5R A;  1EQY A;  4O5F A;  3HOS A;  4A61 A;  5BR9 A;  3DXK A;  2CGL A;  3O9T A;  3I33 A;  3O80 A;  4H5V A;  2BUP A;  2KKZ A;  2GUP A;  2ZWH A;  4MLE A;  1QQO A;  4I6M A;  3VMF B;  1KXP A;  2V51 B;  1BU6 O;  1D4X A;  1SQK A;  1VQ9 N;  2VGN A;  3FZK A;  2YX6 A;  5BN9 A;  5E26 A;  3MCA B;  3VET A;  4IWV A;  4U7B A;  3P38 A;  3G25 A;  2A6A A;  4YOV A;  4FWM A;  3KVG A;  2HBM A;  3NVM A;  3M1F A;  5BRE A;  3WQU A;  5BPL A;  3CCS N;  3ATU A;  2P9U B;  3EL2 A;  2P9L B;  3W3D A;  4AF1 A;  2ASO A;  3IFR A;  4U67 L;  4JKD A;  2P9L A;  2YI1 A;  4YDU C;  5BPN A;  1YUW A;  2YCH A;  5M1P A;  3CQX A;  2F9W A;  2IVN A;  2JWL A;  4IOX A;  4JHD A;  5ADX H;  1DT9 A;  3A5N C;  1KQS M;  2AP1 A;  4MDA A;  3ENB A;  3I8B A;  3ULE A;  3UKR B;  4I6M B;  2F9T A;  4BRE A;  3L6Q A;  1VQ5 N;  5JLF A;  4RTF D;  2QM1 A;  3TU5 A;  5BPM A;  1T44 A;  3IUC A;  3A5M C;  3OBW A;  4XEI A;  4A59 A;  2HF3 A;  3EN9 A;  4WFN L;  2NRV A;  3F2K A;  3R1X A;  4B1V A;  3OHR A;  2QI2 A;  5M1N A;  5C2F A;  1KAZ A;  3TTC A;  5B8H A;  1YAG A;  2V7Z A;  3C6H A;  4JKH A;  4JK8 A;  4JKG A;  4FWL A;  1E4G T;  4BR7 A;  1VAZ A;  5AQF A;  3VGM A;  1ZBS A;  2YHY A;  3GE1 A;  4FSV A;  4DCH A;  1N8R O;  2Q31 A;  3R3L A;  3T69 A;  1JJ2 M;  3MDQ A;  2OTL N;  4H0T B;  1NGH A;  5LY3 A;  2WC9 A;  3KZB A;  3D7E O;  3RSE B;  4BVO A;  4BRI A;  4F9O A;  3M3Z A;  4BRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...