4WFAL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with linezolid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfaL01
5GADP 1VQ4N 1K9MO 1VQNN 1YJWN 1Q7YO 1VQ7N 4WF9L 5GAGP 3G4SN 3CMAN 3J7ZO 1K73O 2QA4N 3G71N 1ILYA 1YI2N 1JJ2M 1YJ9N 4UY8O 5JVHL 5MLCQ 1YITN 1YHQN 3CCEN 3CCJN 1YIJN 1KD1O 1Q86O 1S72N 1VQ8N 4IO9L 3PIOL 4WFAL 5GAEP 4IOCL 3CD6N 1VQLN 3OW2M 3CMEN 1QVGM 5DM6L 1OVYA 2QEXN 3CCLN 2OTLN 5GAHP 3CCUN 1M1KO 1M90O 4WCEL 1YJNN 3I56N 3CCMN 4WFNL 3CXCM 3CCSN 1VQMN 3CF5L 4WFBL 1K8AO 1QVFM 5HL7L 3I55N 3DLLL 3PIPL 5JVGL 3CC4N 1VQPN 2ZJPL 1VQKN 3CPWM 1Q82O 1W2BM 1VQON 3CC7N 1KC8O 3CCQN 3CCRN 1NJIO 4U67L 2OTJN 5DM7L 1KQSM 4IOAL 1N8RO 2ZJQL 3CC2N 3CCVN 5H1SQ 1VQ9N 1Q81O 2ZJRL 3G6EN 1VQ6N 1VQ5N
chains in the Genus database with same CATH superfamily
1ATRA 1NGBA 4LY7A 2YNFA 4CEAA 5JLFA 4M3WA 4DTXA 3NGZA 3SAGA 5J2MA 2O8CB 3T1AA 3F5TA 4RTFD 1VQ7N 4WF9L 3LDPA 4CE9A 3G4SN 3FFKB 4JKBA 3CQ8A 2NRRA 5D3GA 4KB0A 1GLCG 2HB5A 3U9DA 5JVHL 4JS4A 4E7KA 1S1VA 3AVHA 4H0PA 3LDSA 4DTNA 1IG9A 5C25A 3KHYA 2D0OA 4KFBA 1BI4A 4DHYA 3CPEA 4FJNA 3FZKA 2P9UA 3CM6A 2D4WA 4F9OA 3G25A 2GX9A 3TU5A 4IO9L 4F2RA 5BR9A 3P83D 4OO1J 5AQIA 4HHTA 4YHHK 2FBTA 4YOVA 1RT3A 4J2BA 3AY9A 3ZSYA 5DM6L 2VGNA 4GNIA 4BC3A 3R6MA 1ASVA 1RNHA 2DPNA 1UAXA 4ID1A 5AQFA 3H1QA 4AILC 1X9SA 3VMFB 3QB0A 1KFDA 4CZEA 4BRCA 3I56N 3CCMN 1YJNN 2HW3A 1S1UA 1T6CA 5A2QO 1L3VA 1X3NA 4J8FA 3IMXA 3CXCM 3OYNA 5AJ3K 4Z4IA 3M8SA 3P38A 4JKFA 1ZBSA 3C6TA 2I7NA 4OLBA 3S9HA 3KIOA 4W5NA 4AHRA 1QZ5A 4IWVA 5SZTA 4BR0A 3TTCA 3WXJA 1ZBFA 4H0OA 4CJ7A 3KLHA 3BEXA 3HYFA 3VEOA 4AHUA 3THVA 3AAQA 1TAQA 1RT5A 2O8EA 1DGKN 1C6VA 2CH6A 4ELTA 3A8YA 1CXUA 2D1KA 3MWTA 4MLHA 2UXBK 1TVRA 3SNNA 2ITGA 3QEPA 2UU9K 4HCBA 4CGFA 2X78A 3L3UA 5B8HA 5AQXA 4JYAK 2YHYA 3VEXA 4I6MA 4K42A 1NG9A 4A2AA 4CF8A 2BGGA 1NJWA 4CZMA 3B6OA 1JJ2M 1YJ9N 3U8XA 5F0XA 2YCHA 4FWRA 3QEXA 3HP6A 1TKTA 4B8CA 5T7BA 3CCJN 1XC9A 3FE1A 3THXB 4PUOA 3L4QA 3MCAB 2FBXA 2O4GA 3V1OA 1KSPA 2B6AA 2P5GA 4NB4A 4HUEA 3PIOL 3T3FA 4O8UA 3EL2A 3WEEB 4FPBA 1GOAA 3BZKA 4Z4FA 4YDUC 2WTUA 4PKHA 4FCYA 4X66K 1BGXT 4DFKA 4EZ9A 5KGWA 4KHSA 3WQTA 2E6LA 3CQXA 2XY5A 4JI4K 4FWSA 4F4KA 1IKVA 4BR2A 4KHWA 3FGUA 3OJUA 2HHTA 4JKCA 2Q0UA 3AAPA 4ZHRA 1J5OA 3S3NA 1VQMN 4OVLA 2HVHA 4H8KA 4H5TA 4HTLA 4CJLA 3C0BA 1NK8A 1RILA 3AVFA 1UA0A 2RPIA 2HHXA 4GKKK 2O8BA 4CZHA 1WSJA 2O8DB 2GUIA 3ULDA 2UUCK 2R7YA 3T69A 1L3TA 3ZETB 1DEJA 1NK9A 3PO4A 1JL2A 4DF8A 3ISNC 3TAGA 4FOIA 4I7FA 3MN7A 5EXWA 1RT1A 1LWFA 2YJFA 3VF2A 5KPZA 1BL3A 4FM1A 1T03A 3O9UA 1WLJA 2CH5A 4CGGA 3HBTA 1SQKA 3T7ZA 1P8ZA 3KK3A 4B3RK 4DQIA 4DKWA 4RCHA 3TWHA 1VQNN 4DWIA 1YJWN 4Y0WA 1T6DA 2HNYA 4LF4K 1RCHA 4ISEA 3CMAN 1GLFO 4KPYA 3AA2A 1SL0A 4C8KA 3Q7BA 3VEZA 1TAUA 1MWKA 1HNIA 4CF0A 4LC9B 2KFNA 1E4GT 5M1OA 4KHUA 1ZBIA 4CJVA 1HQEA 2E1ZA 4LF7K 3OYDA 1NGJA 1KCFA 4FVMA 4M41A 1JLGA 2WUSA 4B1UB 4IJNA 3ZCMA 5M1PA 4B8AB 3NBPA 1RBRA 3JSMA 1C0UA 5C42A 1NKEA 1G15A 2CGJA 4FSVA 4A61A 1ZBHA 1VSLA 4FZYA 4KREA 3LPTA 4OJRA 3KLGA 5AQLA 1NGGA 2XO7A 3L2RA 1RDUA 2D5RA 4H0XB 4A2BA 3MEGA 1QVFM 4DLEA 3D2FA 5JVGL 3K5NA 2OA8A 5M1KA 3UE5A 3U3YA 2JWKA 3CETA 1CLQA 1U48A 3RWUA 2F8TA 1ZBUA 4B1XB 4CFCA 1NNEA 4CJSA 4C8OA 5C24A 3TPQA 4BGAA 1KC8O 4CGDA 4F3OA 1C0MA 1GLDG 3DXMB 2UUAK 1NJIO 1WAJA 1ESVA 1X1PA 3WQUA 5J1EA 5F2RA 4IOAL 2I7PA 5C12A 1HX1A 2OPRA 4Z94A 1N34K 1SV5A 3ENBA 4BACA 3ZSRA 1YTUA 1VQ6N 4QS8A 5GADP 2O8CA 4JD2B 3K59A 1RBSA 1QE1A 3CG7A 4IFEA 2OZMA 3AA4A 4KI4A 4BRAA 2DFFA 4L3QA 1TK8A 4H0YB 1VSDA 2P9SB 4XH5A 1HKGA 4KBOA 2BE2A 1K73O 4OX9K 3HL8A 1J6ZA 3VA3A 3NH2A 1EO1A 3GBTA 3O6WA 3T19A 3NDKA 1WBDA 4RWTA 1RBTA 3EE8A 5HRSA 2VWBA 4BR7A 5KQDA 1C0TA 4LD0A 4E3SA 5AQQA 1MWMA 4YOUA 1HQUA 2PYLA 4ELUA 3LALA 1JCEA 4OPAA 1K6YA 4FJKA 3G0ZA 2OZSA 3CI5A 4BR4A 3CM5A 3IAYA 4PHTX 1IV0A 2HHWA 3A5MC 5FPNA 1JXEA 3AO1A 3TAFA 2VWKA 3OBYA 4JLHA 4FLVA 3F73A 3VERA 1S1TA 4DSFA 3GOIA 1BOTO 2E2NA 2FSNA 4WCEL 4E89A 4JAXA 4RG8A 4CBUA 2D0PA 3I8BA 3RR8A 5JS1A 3V4IA 4BQLA 3A5NC 4M7YA 3LP2A 2P9IB 3LPUA 2G8KA 1KFSA 4JI7K 2HF3A 2Q1NA 4MO4A 3RVCA 4JEPA 2HMPA 3KLFA 3BDPA 2P9LA 3BY5A 3CC7N 1QTMA 4FLZA 4EZ6A 3PX6A 4PWDA 5AQHA 3HTVA 1KVAA 3QINA 4DR2K 2GWJA 3LZJA 5DM7L 3C6UA 3KWGA 1XHZA 4AHCA 3K58A 3IFRA 4BRDA 1O1WA 1QQCA 2HNDA 3LDLA 2ZJRL 3DWLA 3H08A 2A40A 4JHDB 3CJ7A 4CI6A 4M3XA 1JL1A 4LFBK 2JWLA 2WOMA 4DV4K 4Q0BA 2NRHA 4JI3K 1NKCA 1NKBA 3SAHA 1TGOA 2DTUA 1EQYA 4CHZA 4CJ5A 5I42A 2ZWHA 1IKYA 3MXJA 3OYCA 1D9FA 3THXA 1WSHA 4CZFA 5BR8K 4O0JA 5TKWA 1UOCA 2ASOA 4CJ4A 1EETA 2FF3B 4FM2A 2Z1GA 4XH4A 2ITMA 2RKIA 1IBMK 3NCIA 3LP1A 3ZYYX 3PSFA 3C95A 1ATSA 5JMVA 4CIFA 4WFAL 3EZ5A 3P31A 3BGRA 4E7IA 3SYZA 1BQMA 4DR4K 2HMIA 3PX4A 4LFAK 1FJGK 4AHSA 3AVLA 1RBUA 5DK5A 5FLXO 1BWFO 2BTFA 3QEVA 4CEQA 3QNOA 5LY3A 3FR0A 2QWRA 4B9VA 1HKCA 1FXXA 4FK0A 3ZSWA 4B1YB 4DTJA 1TKZA 5FROA 2HHQA 2VQEK 1MA9B 3O3GA 3AA5X 4FXDA 1K8AO 3WNFA 4E1JA 3CJCA 5J2QA 2KHOA 1KVCA 3R8EA 2A6AA 3U4LA 2XHBA 4IZ9A 1VQPN 2E5LK 2O8DA 1YTAA 4O8KA 3HJFA 3ZT2A 4M7XA 3ZETA 3J80O 1HR0K 3J81O 3ZLJA 1I39A 2PBDA 1V4TA 2QKKA 3DLHA 4CHNA 3M3ZA 1NGAA 4DB3A 3P1GA 1JLCA 1DLOA 5FDLA 5AQPA 2ZGZA 2VQFK 4FLYA 1SKSA 5ELZA 1T3VA 1KQSM 3H46O 4QAGA 5AZJB 1BCOA 4CHQA 4DLGA 1BG3A 4K8ZA 5BRDA 4BWMA 4O0IA 1VQ4N 3RMCA 4ZTFA 4FWNA 4CJTA 3SPZA 4CEEA 2QK9A 4DV5K 3RTVA 4CCHA 5HBMA 1U47A 2AP1A 2QWQA 3I33A 5C15A 2O8FB 4FLTA 1N5YA 3RSEB 4PA1A 5AZIB 3QDKA 2FBYA 4CD3A 5E41A 4Y1CA 4CIGA 4JK7A 3M8PA 2AJQA 2FBVA 3EO3A 4AM7A 4CHPA 5BPLA 4FM0A 3CYMA 4ELVA 1EWQA 4QOZB 4UQGA 3WUHA 5M1FA 4AQYK 1NGFA 5GAEP 3CD6N 4CZGA 4E19A 3V9ZA 1RT6A 2YNIA 5CHIA 2VCPA 3AO5A 2QEXN 3U6FA 3L2QA 3LANA 3MX5A 1EX4A 1TV6A 2OTLN 3DLKA 2OPQA 3A5LC 2Z1JA 3E66A 4CJ3A 2NRVA 3O1WA 1XI1A 3O4NA 1TK5A 3PUFA 3QLHA 3OYAA 4CEOA 3HP9A 3ITHA 1FK9A 4WFBL 4NXNK 2HHSA 1TK0A 3L6QA 4DR1K 4N76A 5FRNA 2X6NA 4XH1A 4I2PA 3MN9A 4LH4A 1I3AA 3A5OC 4GVMA 3SJJA 2QWPA 1HMVA 3H3NO 3DXMA 3L8BA 4GY2B 3OTOK 3LDNA 1W97L 2P9PB 2QKBA 1BQNA 3SQ4A 4K41A 3OYLA 3OS1A 3IG1A 4LSLA 2VYPA 3LWMA 1EWRA 3SJHA 4CJPA 3AV9A 4RW7A 4JD2A 1GOBA 4GV6A 4BC5A 2NUBA 1NU0A 4ILJA 5AQUA 4E1NA 2IAJA 4E7JA 1XMQK 2E20A 5LJVA 4GV3A 1BA1A 3ATVA 2P9SA 3D6RA 4DTOA 3E01A 4BRHA 3DOKA 3RRHA 3LM2A 4MLEA 3V1RA 2A1SA 4M3YA 5AR0A 2KZMA 1X9MA 1GLAG 3CERA 1TUUA 4KH5A 1HNXK 1H1VA 3HSTB 1VRUA 3THWB 4YFUA 2E88A 4B1VA 4EP4A 2PAVA 2RF2A 2D0BA 3THYB 1JCFA 3M8RA 1OH8A 1OH6A 4GV9A 4MDAA 4H5WA 3HXMA 1NGIA 1RT7A 1K8KB 4N47A 3AVIA 3QERA 4CJKA 4WQ5C 3OY9A 3VQ7A 1JLFA 4EAHD 5HLFA 4PY5A 1RGIA 3IRXA 2OANA 4K43A 4LH5A 4W5QA 2W6KA 3IDHA 1T05A 4FYDA 1Z25A 2P9IA 2HHVA 3O80A 3VETA 2Z1HA 2EX3A 4WFNL 1SKWA 5E84A 3DOLA 1QQNA 1SKRA 3HI0A 5BPNA 5HL7L 3V9XA 4BWJA 3ZEUB 3KLIA 1Q9YA 2UUBK 1U2VB 3QIOA 4KTZA 3DI6A 4BC2A 3CQYA 3CPWM 4CERA 1U49A 4FK4A 4ILGB 3JXUA 1X3MA 4CK1A 3ZX0A 1YAGA 3CCRN 4IXCA 4KI6A 4U67L 2KZZA 3SUNA 2VG7A 3TTFA 4CJQA 3NF8A 3O5BA 3FZHA 3SQ1A 1VAZA 4OPHA 4JHDA 4JKEA 3J7AP 4DMNA 3TAMA 3O9SA 1SS6A 2WBNA 4JI6K 3DLEA 2BANA 4G1QA 3NAEA 4BE0A 4FO0A 1VQ5N 1S5JA 3RMBA 3SK3A 4CECA 2V51B 4CFDA 3OYGA 2IIRA 2X6SA 2YHAA 1HPMA 1KLMA 4CBWA 2P5OA 4RW9A 2ASPA 3SAFA 3SZ2A 3TTDA 2QA4N 1YI2N 1NGDA 5AQYA 4DQSA 2CGLA 4OKKA 4CZLA 3LDOA 3ENOA 4JN4A 1HYZA 4FJ5A 3NHGA 4ILHA 3VF6A 3V6DA 1WOQA 3W0LA 2IVOA 3WNGA 3VTIA 5C0YA 4JKHA 4JI2K 4CZIA 4OPJA 1KXPA 3CFPA 2HHUA 1ZBLA 4DTMA 4DR7K 3KKSA 2P9NA 3DLGA 4K25A 1W0HA 4DTPA 3V9UA 5GAHP 3DXKB 5LJWA 4YOWA 1M1KO 4BY9C 1GOCA 1IBKK 3QMLA 3CFRA 3HO1A 4A5AA 4KRFA 1TKDA 4KTWA 3KK7A 4ISGA 1XUPO 4CEBA 3VOVA 3SMSA 4CEFA 3ZX3A 3DAWA 1KAYA 3CC4N 1RT4A 1YVNA 4H0VB 1D8YA 1JKHA 2JLEA 3O9RA 1HJRA 1VSJA 5IT9O 3AO3A 3RR7A 4FZZA 1S9GA 3K2PA 3ZT3A 1VRTA 2QWNA 1VQON 3EYZA 3V81A 3V9WA 1EKEA 2XY7A 3UIQA 2I5JA 5AZJA 4JRQA 1Z05A 3C65A 4DV3K 4BE1A 4HCCA 4J2AA 2ZJQL 4Z4HA 3CCVN 2YKMA 1Q9XA 3O08A 4WQ4C 3D0PA 3SUOA 2HHHK 3BZCA 3LP3A 1J53A 4DQPA 3HVTA 3HVRA 5BRHA 1NGCA 5J2NA 4C8MA 5GAGP 5E26A 2O8FA 3RSEA 2P51A 3HSCA 4JI5K 5AZIA 3AGKA 4CEZA 3WXMB 5EU7A 1JLAA 4V19S 4CJFA 4CJRA 3OA9A 1D9DA 3PV8A 4H5NA 1A5XA 4FJMA 3NMUA 3HM8A 3AO2A 2WFBA 1C0FA 4IEIA 5KPTA 2J4RA 5KTQA 5C2FA 3O1BA 1Z6RA 4KV8A 2W41A 5AQKA 1B9FA 4C8LA 4E1MA 3K57A 4O5BA 4KHPK 2KKZA 4LFCK 2GTDA 5KRTA 3SMPA 3VQQA 3L2UA 1QVGM 3WNHA 1U4BA 1OVYA 1C1AA 1BHLA 3SQ2A 2Q97A 3EZWA 5K14A 1S1XA 4Z4GA 3U3GA 3M6GA 1KRPA 3VQ4A 1IBLK 1RDCA 4IDHA 1WNSA 5AQJA 3SPYA 2ZQBA 4BDZA 4DV0K 2IDOA 3VN5A 4OGCA 3NGIA 4DQ8A 3CJBA 5LMNK 1BIUA 3QEIA 3F9MA 5HRNA 2NZTA 5GINA 2E2PA 2Q36A 2Y1IA 4OKJA 2ASMA 1ASWA 4HUFA 3MXMA 1LWCA 4FL9A 2P9PA 2V52B 3FZLA 4CF9A 3PLAA 3DMJA 4E7HA 2A1RA 3VQ8A 1NK0A 4IFYA 3O8MA 1RFQA 3QFPA 2XY6A 5I9EB 4BREA 3HPHA 5EVZA 5JLHA 1Q81O 3V1QA 4B9UA 3QBXA 3MWPA 1NJXA 1LCUA 2HNZA 1XC3A 3KZBA 3SBGA 4KHNA 4WYBA 1K9MO 1JXBA 3R1XA 4O5FA 1HKBA 1QQOA 1CXQA 3HRGA 4IO8A 3MCPA 3AVKA 4KAZA 2A5XA 4RW4A 4FJJA 3EY1A 1FKOA 1Y97A 1ZC6A 4EP5A 1B92A 1HRHA 4UY8O 4JKDA 3R9PA 3OYJA 4GKJK 4FPAA 3ATUA 3THWA 1T8EA 2RN2A 3EEQA 4NLCA 2ZGYA 4JV5K 3LM9A 3JYTA 4DU4A 4GVEA 1Q86O 4Z4EA 3IUCA 3THYA 2NRXA 3UKUB 1S72N 1ITGA 3MEDA 3B6PA 4N5SA 3KKRA 1G99A 3L0QA 3TANA 3MN6A 4CK3A 1OVQA 3F2KA 1K8KA 5CE3A 4IOCL 5ADXH 3C6AA 4H4OA 3QEWA 3U9ZA 3QO9A 3SUPA 1XMOK 3VQEA 3LAMA 3T1HK 5KQ8A 2FF6A 1O13A 2WC9A 5AQGA 3OS2A 5AQNA 4I9LA 2KFZA 3ZT0A 5CYQA 1C0GA 2W40A 4HUGA 5JICA 2HOEA 3AVNA 1YF5L 3WEEA 4IG3A 3TSUA 4PKIA 4FW1A 1LV5A 4IFVA 3ZEUA 4I2QA 4DFPA 4BRFA 3LDQA 4U7BA 4L8RB 1U2VA 3VF4A 1J5EK 4QS9A 2E2OA 3P39A 4KO0A 3RMAA 4IBNA 1Q82O 2QW9A 3ASMA 1RDBA 4F2SA 4G9ZA 4W5RA 4M3RA 4CVNE 4A62A 4DFMA 4M63C 3ZT1A 4BQZA 3F9KA 4A59A 2YV0X 2YKNA 4J2DA 2QWOA 3ZT4A 2GUPA 2QWLA 3P5JA 3R3LA 3VGLA 1W9HA 4FJLA 3Q7CA 4RW6A 3PSIA 3QFUA 2RHKA 3E9PA 1KVBA 4B3OA 2YHXA 3GDQA 5ADXA 4JKGB 4B9NA 2IGIA 1WAFA 3H45C 3OYBA 5CYMA 4DR6K 4AM6A 3QNNA 4CF2A 3PO5A 3CJAA 4X65K 3NE6A 4CBXA 1JLBA 1KTQA 2KW4A 1J54A 4DS4A 3K9JA 1TYQB 3CHWA 1VSMA 3A0IX 1S1WA 2QTDA 5DMRA 4IDKA 2D0AA 1FKPA 5MLCQ 4FJGA 2KTQA 3OYMA 1RTJA 3FLCO 1YHQN 3IKMA 2PZSA 3M8QA 1TKXA 5AQMA 1YIJN 3S41A 4MQ3A 4CESA 4CD1A 1LW2A 1QZ6A 4NYNA 1LWEA 2KLAA 4FVUA 3S3MA 4FJ8A 1FW6A 4BDYA 1A5WA 1MU2A 2FSKA 3CMEN 2ZE2A 4DV6K 3VEYA 2A41A 3VTHA 3DXKA 2NRTA 4NCBA 1NGHA 5AFUH 1M90O 3A2FA 1E4FT 3ULEB 2LSNA 4IG0A 2YNGA 1GLLO 5BREA 1ZXOA 2HBLA 4EIAA 4B9QA 2NLXA 2YHWA 3CCSN 4DUZK 2E2QA 4B9SA 1WB9A 3DLLL 3VPZA 5C2DA 1XWLA 5KGXA 3L3VA 2ZJPL 4Z4CA 1WSGA 3E1YA 3J8AA 2Q2RA 5F1XA 4NYFA 1T44A 3WNEA 4W5OA 1S3XA 1IO2A 2XRIA 3GL1A 4PKGA 1JLEA 4NXMK 1Q18A 3VESA 4EFHA 3DLRA 4JK8A 1N8RO 3HPGA 4DG1A 3RRGA 4FK2A 2F8SA 4DCHA 3ZSZA 3FZMA 1B9DA 3DYAA 4B9LA 1RTDA 2V7ZA 4R79A 4DTUA 2B5JA 4BRLA 2PYJA 1C1BA 5M1NA 4FWOA 1RDWX 4B1ZA 4CZKA 4B9TA 4TSXA 4JKAA 4DR5K 5AFUA 4F3TA 1WSIA 4FWLA 2JGUA 4FOEA 3CJ9A 3VA0A 2RE2A 4A5BA 2HF4A 3TAEA 4BR5A 3VEVA 3VEWA 3AVJA 1VSKA 1NMDA 4CGJA 4Q5VA 2YI1A 1QHTA 1EXQA 4K8XA 2VG6A 1JCGA 1WSFA 3AVAA 3E9LA 3M1FA 3L2WA 3FFIA 1HNZK 4CFAA 1S22A 1TL3A 3C7NB 3VQ6A 1NJYA 4PL7A 3OW2M 1NK7A 1BCMA 4E7LA 1ASUA 3KJVA 4CZJA 4DSJA 1WUAA 2YNHA 4H4MA 2UXCK 2F7TA 4YOXA 1VSEA 2ETJA 3G10A 4DSIA 4CGHA 3OBWA 4JI1K 2ZM6K 1DTTA 1U6ZA 5HRPA 4DU3A 2UYTA 3OYKA 2VGMA 2E4LA 2P9LB 1BDGA 4BG9A 5LMUK 2W6LA 5AQRA 1YVUA 4CFBA 1KAXA 1HPZA 1L3UA 1SZ2A 1NK5A 4FJHA 2ZF5O 3KD1E 4N41A 3D45A 1J9AA 4W5TA 4ISFA 1UWBA 4BRPA 3SUQA 5CZ2A 1QQMA 3L2VA 1IG8A 2G8WA 4OLAA 5C10A 3I0RA 5FPDA 5GIOA 3AVMA 3QBWA 2GEMA 4WQ5A 5AQOA 4PL8A 3TARA 4CJUA 4EHTA 1BUPA 1Q8IA 3CFOA 2QWMA 1TUYA 2E1YA 4BRQA 1F21A 1U45A 4C23A 1X9WA 4WE1A 3E9OA 3AA3A 1IKWA 4N56A 1HYSA 1SAZA 3K9KA 4CJEA 3KTQA 4KHQA 3KK2A 1RDDA 4NO7A 4KKOA 3T1YK 5HRRA 4YDUA 4DFJA 4A57A 1QSLA 2UXDK 5CZ1A 1ILYA 3EE9A 1N6QA 2HBJA 4JK9A 2NRZA 3H3OB 4FWKA 1V4SA 3MX2A 3TR8A 2FLOA 1MDUB 3SI6A 2DFEA 1XNRK 4M3ZA 1EP4A 3UKUA 5FRMA 4M3UA 3UKRB 3KVGA 3AARA 3OJSA 4B1WB 3VQAA 2BH1A 3SBTA 4FWPA 2OCEA 5AQZA 2OPSA 1CZAN 2YX6A 1I94K 1GLJO 2Z1IA 1OKJA 4IJAA 2QI2A 2EWSA 3CCUN 1DT9A 4BRMA 2P9KB 4JI8K 4H03B 1DKGD 3B8AX 5BN9A 3I0SA 3FZFA 1QHAA 3AVCA 4B9MA 4YY3K 4FW2A 4EHUA 1BU6O 1L5UA 4CGIA 3I55N 5LL6Z 4JNEA 3NGYA 4RW8A 3HPOA 3NVKA 3TI0A 3O3FA 3ZSQA 5I3UA 1REVA 3DJCA 4MDBA 1KAZA 3TSPA 2XY8A 2HSTA 5HOOA 3D7EO 3HOSA 2D0CA 5KPRA 4NCAA 1RT2A 3C6HA 4CW7B 1X9JA 4XEIA 5FPEA 1N32K 2O4IA 2Q0RA 4HWIA 3QESA 1RBVA 3QICA 2F9WA 1ZYQA 1NGEA 4H5RA 4JKGA 3DRSA 4FWMA 4LF5K 3D2EB 2FC0A 2G8IA 3C94A 1OH7A 2F9TA 2H3GX 5SWMA 4HTUA 1Q7YO 1XQSC 2YHBA 4DSEA 3ZSVA 2V7YA 1BISA 2BDPA 1TYQA 1ATNA 3TABA 1A5VA 1VHXA 5IWAK 4H5VA 3VQCA 3G71N 3MK6A 4CEDA 3P4IA 4X62K 4M45A 4BRKA 3WXLA 4YNQA 3SLCA 1OH5A 4IEEA 1KD1O 3ZX2A 4E0DA 3VQDA 5HP1A 4FJIA 2WONA 3V9SA 3QETA 4FLUA 1BI4B 1LAVA 4BG8A 5BRFA 4B08A 2P9UB 4BVOA 1NOZA 4DF4A 1L3SA 1N36K 4WQ4A 2IVPA 4LF8K 3TAPA 1VSHA 2F4VK 4AH9A 1VQLN 5CR4A 3OYFA 4JRPA 2QM1A 4CK2A 3J7YP 3K5MA 2Q31A 3SV3A 5TKYA 5EY4A 3ULEA 3KLEA 3LWLA 1DTQA 2IOCA 2B4JA 2Y1JA 1XHXA 3AVGA 4DTRA 3EKSA 4LF9K 1YT3A 1W7AA 3L4IA 4YOTA 4I9QA 2DFHA 2G8FA 3MDQA 1CZ9A 3OVNA 3EN9A 3ID8A 1NM1A 3GG4A 3CF5L 1BIZA 1D5AA 2F96A 2GBZA 1IKXA 4BRIA 2YJEA 3N4PA 4LF6K 1D4XA 1YUWA 4OGEA 4DV1K 1UA1A 3CIPA 4OPKA 1IJJA 5HROA 3VGKA 1SL1A 5JS2A 1GLBG 4DV2K 5J2PA 3K5OA 3VQBA 4DUYK 5GIPA 3S3OA 4BDPA 3WT0A 4B3MK 2AA4A 3VGMA 4ICLA 3NF9A 3VQPA 3UB5A 1KLNA 3M5RA 1S6PA 3TSQA 1HNWK 4KB1A 2IVNA 3NVMA 2O8EB 4IKFA 3O3HA 3RMDA 4DR3K 4F8RA 2NNWA 4O55A 2KQ2A 2FSJA 4XIUA 4KHYA 2Q3SA 2PY5A 1VSIA 4M42A 5BPMA 3O9QA 3OYEA 4R5PA 2W42A 3LP0A 4QS7A 1HUXA 4DQRA 3ZSOA 3ID6A 1HNVA 1BA0A 4I6MB 1Z26A 3SQ0A 4C8NA 1NWKA 3K5LA 5AQSA 3HK2A 1YITN 1RTIA 4DS5A 2E6MA 3H1VX 4GW6A 3K0SA 5AQTA 3BF1A 1E3MA 2PFUA 1VQ8N 3C7NA 2HVIA 4Y1DA 3HZ6A 4BRNA 4Z0UA 5AQWA 3DM2A 3PY8A 4FLWA 1WBBA 4BRGA 3OHRA 4CHYA 2EHGA 5BN8A 5KI6A 4O4GA 3EKUA 1TL1A 2VG5A 3TAQA 4JI0K 3CCLN 3DRRA 1RTHA 1VK0A 4B3TK 1HLUA 1VSFA 3AVBA 3JAMO 1C1CA 4M3TA 3HT3A 3NF6A 1RDAA 3KK1A 4FJ7A 2CGKA 4NLBA 4J2EA 3ALYA 4BVPA 2ATQA 3DLBA 4QCLA 1S9EA 2GV9A 3IS9A 3AO4A 3KD5E 3PIPL 1QS4A 3SCXA 2FXUA 4FLXA 3ZSXA 3BF3A 1WN7A 3SV4A 3NH1A 4BR9A 4DTSA 3MEEA 1NBWA 4CHOA 2O8BB 3DRPA 3H6EA 5KRSA 1SUQA 2IS3A 3BP8A 1XNQK 4PQUA 3W3DA 4FJXA 1NLVA 4AF1A 4DU1A 1NJZA 3CCQN 4IOXA 3AGRA 3NFAA 2OTJN 4YOYA 1R0AA 1QSYA 5M1QA 2DY4A 2VWJA 4AHTA 1U04A 5H1SQ 3I8DA 1VQ9N 4DSKA 2GWKA 4AHVA 2QXFA 4MFBA 3KWIA 1S6QA 3WXIA 3GE1A 1SL2A 2OPPA 3CJ1A 1T7PA 3MXIA 4BROA 3J7ZO 3BUZB 4B3SK 4O44A 3HM9A 2X74A 3NF7A 5EX5A 4YORA 4C1NI 4KTQA 4BE2A 2A3ZA 1P90A 1HJOA 4ID5A 3UKRA 1NK4A 5FPMA 3LL3A 3CCEN 2P9NB 1BO5O 2G8HA 4KH6A 1LOTB 1YXQA 1NK6A 1R59O 3OS0A 2QXLA 3MECA 3O4QA 3OYIA 1HYVA 1N33K 2IC3A 4JS5A 4X64K 3VQ5A 4GMJB 2G8UA 4CIEA 3O4WA 3ENHA 4H0TB 1NOYA 4CJWA 2P9KA 2A42A 1QSSA 1GLEG 1Y64A 1LW0A 3JS6A 2P1JA 3VQ9A 3NH0A 3QIPA 2ZD1A 4C1NK 1JLQA 2GELA 4FZXC 4OKEA 1CZBA 4FJ9A 3O9TA 3HOTA 3MMVA 1WSEA 5CY4A 4ZTJA 4KH4A 3VENA 4NCGA 4BGBA 1NMNA 2E8AA 3LAKA 4K0KK 4LSNA 2NRWA 3D2FB 1VQKN 1IH7A 4DV7K 5AQVA 5EOYA 1W2BM 2HBKA 4MO5A 2BUPA 3WXKA 2G8VA 2OYQA 2HBMA 4FWQA 4DSLA 3PX0A 3N4QA 3OYHA 4CF1A 3CC2N 4HVJA 1LAWA 3MAQA 3MN5A 3D2EA 4BC4A 3LZIA 4DQQA 3G6EN
chains in the Genus database with same CATH topology
3CJ7A 1ATRA 1NGBA 4CI6A 3E9OA 5JLFA 2ZJRL 1SAZA 3K9KA 3SAGA 2JWLA 5BRHA 2NRHA 4NO7A 1NGCA 3F5TA 4RTFD 1VQ7N 4WF9L 3LDPA 3SAHA 5GAGP 5E26A 3G4SN 3FFKB 4JKBA 4YDUA 3RSEA 3HSCA 4A57A 1EQYA 2NRRA 5AZIA 3AGKA 1ILYA 2ZWHA 1GLCG 3EE9A 3WXMB 2HBJA 3U9DA 4JK9A 2NRZA 3H3OB 5JVHL 3OA9A 4FWKA 4CZFA 4H5NA 1V4SA 4H0PA 3MX2A 2FLOA 1MDUB 5TKWA 3NMUA 3HM8A 2ASOA 2WFBA 2FF3B 1C0FA 2D0OA 3KHYA 4IEIA 4XH4A 2ITMA 3UKUA 4DHYA 3CPEA 3UKRB 5KPTA 2J4RA 3FZKA 5C2FA 3KVGA 2P9UA 3ZYYX 3O1BA 1Z6RA 2D4WA 2W41A 3AARA 5AQKA 4F9OA 3G25A 1ATSA 2GX9A 3TU5A 5JMVA 5BR9A 4IO9L 4B1WB 4WFAL 2BH1A 4OO1J 5AQIA 3P31A 4YOVA 3SBTA 2KKZA 4FWPA 2GTDA 3AY9A 3SMPA 5AQZA 2YX6A 1CZAN 1QVGM 5DM6L 1GLJO 2VGNA 4GNIA 4BC3A 3R6MA 1OVYA 1OKJA 4IJAA 2DPNA 2QI2A 2Q97A 5AQFA 2EWSA 3EZWA 3H1QA 3CCUN 3VMFB 1DT9A 1BWFO 2BTFA 2P9KB 3M6GA 4BRMA 3QB0A 4IDHA 4CZEA 4H03B 4BRCA 5AQJA 5LY3A 3I56N 3CCMN 1YJNN 1DKGD 3FR0A 3B8AX 2QWRA 5BN9A 1T6CA 1HKCA 3FZFA 1X3NA 4J8FA 3IMXA 4B1YB 3CXCM 4DQ8A 3CJBA 1QHAA 1MA9B 1K8AO 4EHUA 1BU6O 4E1JA 3CJCA 3I55N 2KHOA 3F9MA 4JNEA 3R8EA 2A6AA 3U4LA 3NVKA 2NZTA 4IZ9A 2E2PA 2Q36A 5GINA 1VQPN 2ASMA 4O8KA 3P38A 4JKFA 1ZBSA 3DJCA 4MDBA 2I7NA 4M7XA 3ZETA 4FL9A 1KAZA 3TSPA 2P9PA 2V52B 3FZLA 2HSTA 2PBDA 1QZ5A 4IWVA 1V4TA 3PLAA 4BR0A 3TTCA 3WXJA 5HOOA 3D7EO 3HOSA 3M3ZA 1NGAA 4H0OA 4DB3A 4CJ7A 5KPRA 3BEXA 3O8MA 3VEOA 1RFQA 3AAQA 3C6HA 3QFPA 1X9JA 2ZGZA 4XEIA 5AQPA 5ELZA 5FPEA 1T3VA 1KQSM 3H46O 1DGKN 5I9EB 2CH6A 2Q0RA 4HWIA 4BREA 5EVZA 3QICA 5AZJB 2F9WA 5JLHA 1NGEA 4H5RA 1Q81O 3A8YA 3QBXA 4JKGA 4FWMA 3MWPA 1BG3A 2D1KA 1LCUA 3MWTA 4MLHA 3D2EB 5BRDA 1XC3A 3KZBA 3SBGA 1VQ4N 4WYBA 4FWNA 1K9MO 2F9TA 2H3GX 3R1XA 4O5FA 1HKBA 1QQOA 5B8HA 5AQXA 3HRGA 1XQSC 4IO8A 1Q7YO 2YHYA 3MCPA 2AP1A 2V7YA 2QWQA 1TYQA 1ATNA 2A5XA 3I33A 4I6MA 3VEXA 4K42A 4H5VA 4A2AA 5C15A 3G71N 1ZC6A 3MK6A 4CZMA 3RSEB 1JJ2M 1YJ9N 3P4IA 3U8XA 5AZIB 5F0XA 2YCHA 4UY8O 4FWRA 3QDKA 4JKDA 3R9PA 4BRKA 3WXLA 4FPAA 3ATUA 4CD3A 4NLCA 2ZGYA 4JK7A 3SLCA 3CCJN 4IEEA 3FE1A 3LM9A 1KD1O 3ZX2A 3EO3A 4AM7A 3L4QA 3MCAB 4GVEA 5BPLA 1Q86O 3IUCA 2NRXA 3UKUB 4NB4A 1S72N 3PIOL 4BG8A 5BRFA 3L0QA 1G99A 4O8UA 2P9UB 3EL2A 3MN6A 4FPBA 3WEEB 3WUHA 4WQ4A 4BVOA 1NGFA 5M1FA 3F2KA 1K8KA 5GAEP 2IVPA 4CZGA 3C6AA 5ADXH 5CE3A 4IOCL 3CD6N 1VQLN 3U9ZA 5CR4A 5CHIA 2VCPA 2QM1A 4YDUC 2FF6A 5KQ8A 1O13A 2WC9A 2Q31A 2QEXN 4PKHA 5AQGA 5AQNA 5TKYA 5EY4A 3MX5A 3ULEA 2OTLN 1C0GA 2W40A 3A5LC 3E66A 3WQTA 3CQXA 3EKSA 5JICA 2NRVA 3O1WA 2HOEA 3L4IA 4FWSA 4YOTA 1YF5L 3WEEA 4BR2A 3FGUA 3TSUA 4JKCA 3MDQA 2Q0UA 3AAPA 4PKIA 1VQMN 3ZEUA 3EN9A 4H5TA 4HTLA 3ID8A 3LDQA 1NM1A 3GG4A 4BRFA 1U2VA 3C0BA 4WFBL 4U7BA 3CF5L 3VF4A 4QS9A 4BRIA 2YJEA 3L6QA 3N4PA 2E2OA 3P39A 1D4XA 1YUWA 4XH1A 4CZHA 3CIPA 3MN9A 3A5OC 1IJJA 2QWPA 3VGKA 3H3NO 1Q82O 2QW9A 3DXMA 1GLBG 4GY2B 4G9ZA 3T69A 3LDNA 4A62A 1W97L 3ZETB 1DEJA 2P9PB 4M63C 5GIPA 3WT0A 4BQZA 2AA4A 4A59A 3VGMA 4K41A 4FOIA 3MN7A 2QWOA 2VYPA 3UB5A 5EXWA 3M5RA 2GUPA 2YJFA 2QWLA 3R3LA 3VGLA 3VF2A 5KPZA 3SJHA 3TSQA 2IVNA 3Q7CA 3O9UA 4JD2A 3NVMA 4GV6A 4BC5A 2CH5A 3QFUA 2RHKA 3HBTA 3E9PA 4ILJA 1SQKA 3T7ZA 1P8ZA 2YHXA 5AQUA 2NNWA 3GDQA 5ADXA 4JKGB 4DKWA 4RCHA 2FSJA 1VQNN 2E20A 3H45C 5LJVA 4GV3A 1YJWN 1BA1A 3ATVA 2P9SA 3D6RA 4AM6A 4Y0WA 1T6DA 5BPMA 3O9QA 3CJAA 4BRHA 4ISEA 3CMAN 4QS7A 4CBXA 1HUXA 1GLFO 3ID6A 3Q7BA 3VEZA 3LM2A 3K9JA 1MWKA 1BA0A 1TYQB 4MLEA 4I6MB 3CHWA 4LC9B 1NWKA 3A0IX 1E4GT 5M1OA 5AR0A 2QTDA 5AQSA 5MLCQ 1YITN 1GLAG 3FLCO 3H1VX 1YHQN 3IKMA 3CERA 1TUUA 2E1ZA 5AQMA 1YIJN 1NGJA 4KH5A 5AQTA 1H1VA 3S41A 4CD1A 3BF1A 2E88A 4B1VA 2PFUA 1QZ6A 4C23A 2PAVA 2KLAA 3C7NA 1VQ8N 2WUSA 4B1UB 4FVUA 4IJNA 3HZ6A 4BRNA 5AQWA 1JCFA 5M1PA 2FSKA 4GV9A 4MDAA 4BRGA 3OHRA 4H5WA 3CMEN 1NGIA 1K8KB 5BN8A 3EKUA 2A41A 3VEYA 3DXKA 3VTHA 2NRTA 4WQ5C 1NGHA 2CGJA 4FSVA 5AFUH 3CCLN 4EAHD 4A61A 1HLUA 1RGIA 1M90O 2OANA 1E4FT 3ULEB 4K43A 3IDHA 1NGGA 5AQLA 5BREA 1GLLO 1ZXOA 2P9IA 2HBLA 4EIAA 3O80A 2CGKA 4B9QA 3VETA 2NLXA 1RDUA 2YHWA 4NLBA 4WFNL 3CCSN 2E2QA 5E84A 4H0XB 4A2BA 4BVPA 1QQNA 1QVFM 3HI0A 5BPNA 5HL7L 3ZEUB 3D2FA 3VPZA 3DLLL 3PIPL 5JVGL 5C2DA 5M1KA 1U2VB 3UE5A 2FXUA 2ZJPL 3BF3A 2JWKA 4BR9A 3CETA 3E1YA 4BC2A 3CQYA 3J8AA 3CPWM 4B1XB 1NBWA 2Q2RA 5F1XA 4ILGB 3JXUA 1T44A 3H6EA 3TPQA 1X3MA 3BP8A 3W3DA 1S3XA 4BGAA 3ZX0A 1YAGA 1NLVA 4AF1A 1KC8O 1GLDG 3DXMB 3CCQN 4IOXA 3CCRN 4IXCA 3GL1A 3AGRA 4PKGA 1NJIO 4U67L 1ESVA 3TTFA 1Q18A 3WQUA 2OTJN 3O5BA 3VESA 4EFHA 4YOYA 4JK8A 5M1QA 3FZHA 5F2RA 1N8RO 2I7PA 4IOAL 1VAZA 4OPHA 4JHDA 4JKEA 5C12A 1HX1A 4Z94A 4DCHA 5H1SQ 1VQ9N 3ENBA 3O9SA 1SS6A 2GWKA 2WBNA 3FZMA 4FO0A 1VQ5N 4QS8A 1VQ6N 5GADP 2V7ZA 4JD2B 4R79A 3KWIA 3WXIA 3GE1A 3SK3A 2V51B 4BRLA 2IIRA 3CJ1A 5M1NA 4FWOA 4IFEA 1RDWX 4B1ZA 4BRAA 4L3QA 1HPMA 4CZKA 4CBWA 4JKAA 4BROA 3J7ZO 3BUZB 4H0YB 5AFUA 2P9SB 2ASPA 4FWLA 1HKGA 4KBOA 4XH5A 3SAFA 1K73O 3TTDA 2QA4N 4FOEA 3CJ9A 2RE2A 5EX5A 4A5BA 4YORA 4C1NI 1J6ZA 1NGDA 2HF4A 1YI2N 1EO1A 5AQYA 4BR5A 2A3ZA 2CGLA 3GBTA 3O6WA 3VEVA 4CZLA 3LDOA 1P90A 4RWTA 3EE8A 1HJOA 3ENOA 2VWBA 3UKRA 3VEWA 5FPMA 4BR7A 3LL3A 5KQDA 1NMDA 3CCEN 4JN4A 2YI1A 2P9NB 1BO5O 4KH6A 5AQQA 1MWMA 4YOUA 4ILHA 1JCGA 3VF6A 1LOTB 1WOQA 3W0LA 1YXQA 2IVOA 1R59O 1JCEA 4OPAA 3M1FA 3E9LA 2QXLA 3VTIA 1S22A 5C0YA 3C7NB 4JKHA 3CI5A 4BR4A 4CZIA 4PL7A 3OW2M 4PHTX 1KXPA 3A5MC 3O4WA 5FPNA 3ENHA 4H0TB 4CZJA 1WUAA 2P9KA 2F7TA 2A42A 2P9NA 4YOXA 1GLEG 3OBYA 4K25A 1Y64A 3VERA 5GAHP 3OBWA 3JS6A 3DXKB 3GOIA 1BOTO 2E2NA 5LJWA 4YOWA 1M1KO 4BY9C 2FSNA 4WCEL 1U6ZA 4JAXA 2UYTA 2VGMA 4CBUA 2D0PA 3QMLA 4C1NK 3I8BA 2P9LB 1BDGA 4BG9A 4A5AA 2GELA 5AQRA 4BQLA 3A5NC 4M7YA 2P9IB 3KK7A 1KAXA 3O9TA 4ISGA 3HOTA 3MMVA 1SZ2A 1XUPO 2ZF5O 3VOVA 3SMSA 3ZX3A 3DAWA 1KAYA 4KH4A 3VENA 4BGBA 2E8AA 3CC4N 4ISFA 4BRPA 1YVNA 4H0VB 2HF3A 2NRWA 3D2FB 1VQKN 2Q1NA 4MO4A 3RVCA 3O9RA 4JEPA 1QQMA 2HMPA 5AQVA 5EOYA 1W2BM 2HBKA 2P9LA 4MO5A 2QWNA 1VQON 3CC7N 1IG8A 2BUPA 5C10A 3WXKA 5FPDA 5AQHA 5GIOA 3HTVA 2HBMA 3QBWA 4FWQA 2GEMA 4WQ5A 5AQOA 4PL8A 5AZJA 1Z05A 2GWJA 3C65A 5DM7L 3N4QA 3CC2N 2ZJQL 3KWGA 3CCVN 4EHTA 3MN5A 3D2EA 4BC4A 3IFRA 1BUPA 4BRDA 3O08A 2QWMA 4WQ4C 1TUYA 2E1YA 4BRQA 3LDLA 3G6EN 3DWLA 2A40A 4JHDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD P;  1VQ4 N;  1K9M O;  1VQN N;  1YJW N;  1Q7Y O;  1VQ7 N;  4WF9 L;  5GAG P;  3G4S N;  3CMA N;  3J7Z O;  1K73 O;  2QA4 N;  3G71 N;  1ILY A;  1YI2 N;  1JJ2 M;  1YJ9 N;  4UY8 O;  5JVH L;  5MLC Q;  1YIT N;  1YHQ N;  3CCE N;  3CCJ N;  1YIJ N;  1KD1 O;  1Q86 O;  1S72 N;  1VQ8 N;  4IO9 L;  3PIO L;  4WFA L;  5GAE P;  4IOC L;  3CD6 N;  1VQL N;  3OW2 M;  3CME N;  1QVG M;  5DM6 L;  1OVY A;  2QEX N;  3CCL N;  2OTL N;  5GAH P;  3CCU N;  1M1K O;  1M90 O;  4WCE L;  1YJN N;  3I56 N;  3CCM N;  4WFN L;  3CXC M;  3CCS N;  1VQM N;  3CF5 L;  4WFB L;  1K8A O;  1QVF M;  5HL7 L;  3I55 N;  3DLL L;  3PIP L;  5JVG L;  3CC4 N;  1VQP N;  2ZJP L;  1VQK N;  3CPW M;  1Q82 O;  1W2B M;  1VQO N;  3CC7 N;  1KC8 O;  3CCQ N;  3CCR N;  1NJI O;  4U67 L;  2OTJ N;  5DM7 L;  1KQS M;  4IOA L;  1N8R O;  2ZJQ L;  3CC2 N;  3CCV N;  5H1S Q;  1VQ9 N;  1Q81 O;  2ZJR L;  3G6E N;  1VQ6 N;  1VQ5 N; 
#chains in the Genus database with same CATH topology
 1ATR A;  1NGB A;  4LY7 A;  2YNF A;  4CEA A;  5JLF A;  4M3W A;  4DTX A;  3NGZ A;  3SAG A;  5J2M A;  2O8C B;  3T1A A;  3F5T A;  4RTF D;  1VQ7 N;  4WF9 L;  3LDP A;  4CE9 A;  3G4S N;  3FFK B;  4JKB A;  3CQ8 A;  2NRR A;  5D3G A;  4KB0 A;  1GLC G;  2HB5 A;  3U9D A;  5JVH L;  4JS4 A;  4E7K A;  1S1V A;  3AVH A;  4H0P A;  3LDS A;  4DTN A;  1IG9 A;  5C25 A;  3KHY A;  2D0O A;  4KFB A;  1BI4 A;  4DHY A;  3CPE A;  4FJN A;  3FZK A;  2P9U A;  3CM6 A;  2D4W A;  4F9O A;  3G25 A;  2GX9 A;  3TU5 A;  4IO9 L;  4F2R A;  5BR9 A;  3P83 D;  4OO1 J;  5AQI A;  4HHT A;  4YHH K;  2FBT A;  4YOV A;  1RT3 A;  4J2B A;  3AY9 A;  3ZSY A;  5DM6 L;  2VGN A;  4GNI A;  4BC3 A;  3R6M A;  1ASV A;  1RNH A;  2DPN A;  1UAX A;  4ID1 A;  5AQF A;  3H1Q A;  4AIL C;  1X9S A;  3VMF B;  3QB0 A;  1KFD A;  4CZE A;  4BRC A;  3I56 N;  3CCM N;  1YJN N;  2HW3 A;  1S1U A;  1T6C A;  5A2Q O;  1L3V A;  1X3N A;  4J8F A;  3IMX A;  3CXC M;  3OYN A;  5AJ3 K;  4Z4I A;  3M8S A;  3P38 A;  4JKF A;  1ZBS A;  3C6T A;  2I7N A;  4OLB A;  3S9H A;  3KIO A;  4W5N A;  4AHR A;  1QZ5 A;  4IWV A;  5SZT A;  4BR0 A;  3TTC A;  3WXJ A;  1ZBF A;  4H0O A;  4CJ7 A;  3KLH A;  3BEX A;  3HYF A;  3VEO A;  4AHU A;  3THV A;  3AAQ A;  1TAQ A;  1RT5 A;  2O8E A;  1DGK N;  1C6V A;  2CH6 A;  4ELT A;  3A8Y A;  1CXU A;  2D1K A;  3MWT A;  4MLH A;  2UXB K;  1TVR A;  3SNN A;  2ITG A;  3QEP A;  2UU9 K;  4HCB A;  4CGF A;  2X78 A;  3L3U A;  5B8H A;  5AQX A;  4JYA K;  2YHY A;  3VEX A;  4I6M A;  4K42 A;  1NG9 A;  4A2A A;  4CF8 A;  2BGG A;  1NJW A;  4CZM A;  3B6O A;  1JJ2 M;  1YJ9 N;  3U8X A;  5F0X A;  2YCH A;  4FWR A;  3QEX A;  3HP6 A;  1TKT A;  4B8C A;  5T7B A;  3CCJ N;  1XC9 A;  3FE1 A;  3THX B;  4PUO A;  3L4Q A;  3MCA B;  2FBX A;  2O4G A;  3V1O A;  1KSP A;  2B6A A;  2P5G A;  4NB4 A;  4HUE A;  3PIO L;  3T3F A;  4O8U A;  3EL2 A;  3WEE B;  4FPB A;  1GOA A;  3BZK A;  4Z4F A;  4YDU C;  2WTU A;  4PKH A;  4FCY A;  4X66 K;  1BGX T;  4DFK A;  4EZ9 A;  5KGW A;  4KHS A;  3WQT A;  2E6L A;  3CQX A;  2XY5 A;  4JI4 K;  4FWS A;  4F4K A;  1IKV A;  4BR2 A;  4KHW A;  3FGU A;  3OJU A;  2HHT A;  4JKC A;  2Q0U A;  3AAP A;  4ZHR A;  1J5O A;  3S3N A;  1VQM N;  4OVL A;  2HVH A;  4H8K A;  4H5T A;  4HTL A;  4CJL A;  3C0B A;  1NK8 A;  1RIL A;  3AVF A;  1UA0 A;  2RPI A;  2HHX A;  4GKK K;  2O8B A;  4CZH A;  1WSJ A;  2O8D B;  2GUI A;  3ULD A;  2UUC K;  2R7Y A;  3T69 A;  1L3T A;  3ZET B;  1DEJ A;  1NK9 A;  3PO4 A;  1JL2 A;  4DF8 A;  3ISN C;  3TAG A;  4FOI A;  4I7F A;  3MN7 A;  5EXW A;  1RT1 A;  1LWF A;  2YJF A;  3VF2 A;  5KPZ A;  1BL3 A;  4FM1 A;  1T03 A;  3O9U A;  1WLJ A;  2CH5 A;  4CGG A;  3HBT A;  1SQK A;  3T7Z A;  1P8Z A;  3KK3 A;  4B3R K;  4DQI A;  4DKW A;  4RCH A;  3TWH A;  1VQN N;  4DWI A;  1YJW N;  4Y0W A;  1T6D A;  2HNY A;  4LF4 K;  1RCH A;  4ISE A;  3CMA N;  1GLF O;  4KPY A;  3AA2 A;  1SL0 A;  4C8K A;  3Q7B A;  3VEZ A;  1TAU A;  1MWK A;  1HNI A;  4CF0 A;  4LC9 B;  2KFN A;  1E4G T;  5M1O A;  4KHU A;  1ZBI A;  4CJV A;  1HQE A;  2E1Z A;  4LF7 K;  3OYD A;  1NGJ A;  1KCF A;  4FVM A;  4M41 A;  1JLG A;  2WUS A;  4B1U B;  4IJN A;  3ZCM A;  5M1P A;  4B8A B;  3NBP A;  1RBR A;  3JSM A;  1C0U A;  5C42 A;  1NKE A;  1G15 A;  2CGJ A;  4FSV A;  4A61 A;  1ZBH A;  1VSL A;  4FZY A;  4KRE A;  3LPT A;  4OJR A;  3KLG A;  5AQL A;  1NGG A;  2XO7 A;  3L2R A;  1RDU A;  2D5R A;  4H0X B;  4A2B A;  3MEG A;  1QVF M;  4DLE A;  3D2F A;  5JVG L;  3K5N A;  2OA8 A;  5M1K A;  3UE5 A;  3U3Y A;  2JWK A;  3CET A;  1CLQ A;  1U48 A;  3RWU A;  2F8T A;  1ZBU A;  4B1X B;  4CFC A;  1NNE A;  4CJS A;  4C8O A;  5C24 A;  3TPQ A;  4BGA A;  1KC8 O;  4CGD A;  4F3O A;  1C0M A;  1GLD G;  3DXM B;  2UUA K;  1NJI O;  1WAJ A;  1ESV A;  1X1P A;  3WQU A;  5J1E A;  5F2R A;  4IOA L;  2I7P A;  5C12 A;  1HX1 A;  2OPR A;  4Z94 A;  1N34 K;  1SV5 A;  3ENB A;  4BAC A;  3ZSR A;  1YTU A;  1VQ6 N;  4QS8 A;  5GAD P;  2O8C A;  4JD2 B;  3K59 A;  1RBS A;  1QE1 A;  3CG7 A;  4IFE A;  2OZM A;  3AA4 A;  4KI4 A;  4BRA A;  2DFF A;  4L3Q A;  1TK8 A;  4H0Y B;  1VSD A;  2P9S B;  4XH5 A;  1HKG A;  4KBO A;  2BE2 A;  1K73 O;  4OX9 K;  3HL8 A;  1J6Z A;  3VA3 A;  3NH2 A;  1EO1 A;  3GBT A;  3O6W A;  3T19 A;  3NDK A;  1WBD A;  4RWT A;  1RBT A;  3EE8 A;  5HRS A;  2VWB A;  4BR7 A;  5KQD A;  1C0T A;  4LD0 A;  4E3S A;  5AQQ A;  1MWM A;  4YOU A;  1HQU A;  2PYL A;  4ELU A;  3LAL A;  1JCE A;  4OPA A;  1K6Y A;  4FJK A;  3G0Z A;  2OZS A;  3CI5 A;  4BR4 A;  3CM5 A;  3IAY A;  4PHT X;  1IV0 A;  2HHW A;  3A5M C;  5FPN A;  1JXE A;  3AO1 A;  3TAF A;  2VWK A;  3OBY A;  4JLH A;  4FLV A;  3F73 A;  3VER A;  1S1T A;  4DSF A;  3GOI A;  1BOT O;  2E2N A;  2FSN A;  4WCE L;  4E89 A;  4JAX A;  4RG8 A;  4CBU A;  2D0P A;  3I8B A;  3RR8 A;  5JS1 A;  3V4I A;  4BQL A;  3A5N C;  4M7Y A;  3LP2 A;  2P9I B;  3LPU A;  2G8K A;  1KFS A;  4JI7 K;  2HF3 A;  2Q1N A;  4MO4 A;  3RVC A;  4JEP A;  2HMP A;  3KLF A;  3BDP A;  2P9L A;  3BY5 A;  3CC7 N;  1QTM A;  4FLZ A;  4EZ6 A;  3PX6 A;  4PWD A;  5AQH A;  3HTV A;  1KVA A;  3QIN A;  4DR2 K;  2GWJ A;  3LZJ A;  5DM7 L;  3C6U A;  3KWG A;  1XHZ A;  4AHC A;  3K58 A;  3IFR A;  4BRD A;  1O1W A;  1QQC A;  2HND A;  3LDL A;  2ZJR L;  3DWL A;  3H08 A;  2A40 A;  4JHD B;  3CJ7 A;  4CI6 A;  4M3X A;  1JL1 A;  4LFB K;  2JWL A;  2WOM A;  4DV4 K;  4Q0B A;  2NRH A;  4JI3 K;  1NKC A;  1NKB A;  3SAH A;  1TGO A;  2DTU A;  1EQY A;  4CHZ A;  4CJ5 A;  5I42 A;  2ZWH A;  1IKY A;  3MXJ A;  3OYC A;  1D9F A;  3THX A;  1WSH A;  4CZF A;  5BR8 K;  4O0J A;  5TKW A;  1UOC A;  2ASO A;  4CJ4 A;  1EET A;  2FF3 B;  4FM2 A;  2Z1G A;  4XH4 A;  2ITM A;  2RKI A;  1IBM K;  3NCI A;  3LP1 A;  3ZYY X;  3PSF A;  3C95 A;  1ATS A;  5JMV A;  4CIF A;  4WFA L;  3EZ5 A;  3P31 A;  3BGR A;  4E7I A;  3SYZ A;  1BQM A;  4DR4 K;  2HMI A;  3PX4 A;  4LFA K;  1FJG K;  4AHS A;  3AVL A;  1RBU A;  5DK5 A;  5FLX O;  1BWF O;  2BTF A;  3QEV A;  4CEQ A;  3QNO A;  5LY3 A;  3FR0 A;  2QWR A;  4B9V A;  1HKC A;  1FXX A;  4FK0 A;  3ZSW A;  4B1Y B;  4DTJ A;  1TKZ A;  5FRO A;  2HHQ A;  2VQE K;  1MA9 B;  3O3G A;  3AA5 X;  4FXD A;  1K8A O;  3WNF A;  4E1J A;  3CJC A;  5J2Q A;  2KHO A;  1KVC A;  3R8E A;  2A6A A;  3U4L A;  2XHB A;  4IZ9 A;  1VQP N;  2E5L K;  2O8D A;  1YTA A;  4O8K A;  3HJF A;  3ZT2 A;  4M7X A;  3ZET A;  3J80 O;  1HR0 K;  3J81 O;  3ZLJ A;  1I39 A;  2PBD A;  1V4T A;  2QKK A;  3DLH A;  4CHN A;  3M3Z A;  1NGA A;  4DB3 A;  3P1G A;  1JLC A;  1DLO A;  5FDL A;  5AQP A;  2ZGZ A;  2VQF K;  4FLY A;  1SKS A;  5ELZ A;  1T3V A;  1KQS M;  3H46 O;  4QAG A;  5AZJ B;  1BCO A;  4CHQ A;  4DLG A;  1BG3 A;  4K8Z A;  5BRD A;  4BWM A;  4O0I A;  1VQ4 N;  3RMC A;  4ZTF A;  4FWN A;  4CJT A;  3SPZ A;  4CEE A;  2QK9 A;  4DV5 K;  3RTV A;  4CCH A;  5HBM A;  1U47 A;  2AP1 A;  2QWQ A;  3I33 A;  5C15 A;  2O8F B;  4FLT A;  1N5Y A;  3RSE B;  4PA1 A;  5AZI B;  3QDK A;  2FBY A;  4CD3 A;  5E41 A;  4Y1C A;  4CIG A;  4JK7 A;  3M8P A;  2AJQ A;  2FBV A;  3EO3 A;  4AM7 A;  4CHP A;  5BPL A;  4FM0 A;  3CYM A;  4ELV A;  1EWQ A;  4QOZ B;  4UQG A;  3WUH A;  5M1F A;  4AQY K;  1NGF A;  5GAE P;  3CD6 N;  4CZG A;  4E19 A;  3V9Z A;  1RT6 A;  2YNI A;  5CHI A;  2VCP A;  3AO5 A;  2QEX N;  3U6F A;  3L2Q A;  3LAN A;  3MX5 A;  1EX4 A;  1TV6 A;  2OTL N;  3DLK A;  2OPQ A;  3A5L C;  2Z1J A;  3E66 A;  4CJ3 A;  2NRV A;  3O1W A;  1XI1 A;  3O4N A;  1TK5 A;  3PUF A;  3QLH A;  3OYA A;  4CEO A;  3HP9 A;  3ITH A;  1FK9 A;  4WFB L;  4NXN K;  2HHS A;  1TK0 A;  3L6Q A;  4DR1 K;  4N76 A;  5FRN A;  2X6N A;  4XH1 A;  4I2P A;  3MN9 A;  4LH4 A;  1I3A A;  3A5O C;  4GVM A;  3SJJ A;  2QWP A;  1HMV A;  3H3N O;  3DXM A;  3L8B A;  4GY2 B;  3OTO K;  3LDN A;  1W97 L;  2P9P B;  2QKB A;  1BQN A;  3SQ4 A;  4K41 A;  3OYL A;  3OS1 A;  3IG1 A;  4LSL A;  2VYP A;  3LWM A;  1EWR A;  3SJH A;  4CJP A;  3AV9 A;  4RW7 A;  4JD2 A;  1GOB A;  4GV6 A;  4BC5 A;  2NUB A;  1NU0 A;  4ILJ A;  5AQU A;  4E1N A;  2IAJ A;  4E7J A;  1XMQ K;  2E20 A;  5LJV A;  4GV3 A;  1BA1 A;  3ATV A;  2P9S A;  3D6R A;  4DTO A;  3E01 A;  4BRH A;  3DOK A;  3RRH A;  3LM2 A;  4MLE A;  3V1R A;  2A1S A;  4M3Y A;  5AR0 A;  2KZM A;  1X9M A;  1GLA G;  3CER A;  1TUU A;  4KH5 A;  1HNX K;  1H1V A;  3HST B;  1VRU A;  3THW B;  4YFU A;  2E88 A;  4B1V A;  4EP4 A;  2PAV A;  2RF2 A;  2D0B A;  3THY B;  1JCF A;  3M8R A;  1OH8 A;  1OH6 A;  4GV9 A;  4MDA A;  4H5W A;  3HXM A;  1NGI A;  1RT7 A;  1K8K B;  4N47 A;  3AVI A;  3QER A;  4CJK A;  4WQ5 C;  3OY9 A;  3VQ7 A;  1JLF A;  4EAH D;  5HLF A;  4PY5 A;  1RGI A;  3IRX A;  2OAN A;  4K43 A;  4LH5 A;  4W5Q A;  2W6K A;  3IDH A;  1T05 A;  4FYD A;  1Z25 A;  2P9I A;  2HHV A;  3O80 A;  3VET A;  2Z1H A;  2EX3 A;  4WFN L;  1SKW A;  5E84 A;  3DOL A;  1QQN A;  1SKR A;  3HI0 A;  5BPN A;  5HL7 L;  3V9X A;  4BWJ A;  3ZEU B;  3KLI A;  1Q9Y A;  2UUB K;  1U2V B;  3QIO A;  4KTZ A;  3DI6 A;  4BC2 A;  3CQY A;  3CPW M;  4CER A;  1U49 A;  4FK4 A;  4ILG B;  3JXU A;  1X3M A;  4CK1 A;  3ZX0 A;  1YAG A;  3CCR N;  4IXC A;  4KI6 A;  4U67 L;  2KZZ A;  3SUN A;  2VG7 A;  3TTF A;  4CJQ A;  3NF8 A;  3O5B A;  3FZH A;  3SQ1 A;  1VAZ A;  4OPH A;  4JHD A;  4JKE A;  3J7A P;  4DMN A;  3TAM A;  3O9S A;  1SS6 A;  2WBN A;  4JI6 K;  3DLE A;  2BAN A;  4G1Q A;  3NAE A;  4BE0 A;  4FO0 A;  1VQ5 N;  1S5J A;  3RMB A;  3SK3 A;  4CEC A;  2V51 B;  4CFD A;  3OYG A;  2IIR A;  2X6S A;  2YHA A;  1HPM A;  1KLM A;  4CBW A;  2P5O A;  4RW9 A;  2ASP A;  3SAF A;  3SZ2 A;  3TTD A;  2QA4 N;  1YI2 N;  1NGD A;  5AQY A;  4DQS A;  2CGL A;  4OKK A;  4CZL A;  3LDO A;  3ENO A;  4JN4 A;  1HYZ A;  4FJ5 A;  3NHG A;  4ILH A;  3VF6 A;  3V6D A;  1WOQ A;  3W0L A;  2IVO A;  3WNG A;  3VTI A;  5C0Y A;  4JKH A;  4JI2 K;  4CZI A;  4OPJ A;  1KXP A;  3CFP A;  2HHU A;  1ZBL A;  4DTM A;  4DR7 K;  3KKS A;  2P9N A;  3DLG A;  4K25 A;  1W0H A;  4DTP A;  3V9U A;  5GAH P;  3DXK B;  5LJW A;  4YOW A;  1M1K O;  4BY9 C;  1GOC A;  1IBK K;  3QML A;  3CFR A;  3HO1 A;  4A5A A;  4KRF A;  1TKD A;  4KTW A;  3KK7 A;  4ISG A;  1XUP O;  4CEB A;  3VOV A;  3SMS A;  4CEF A;  3ZX3 A;  3DAW A;  1KAY A;  3CC4 N;  1RT4 A;  1YVN A;  4H0V B;  1D8Y A;  1JKH A;  2JLE A;  3O9R A;  1HJR A;  1VSJ A;  5IT9 O;  3AO3 A;  3RR7 A;  4FZZ A;  1S9G A;  3K2P A;  3ZT3 A;  1VRT A;  2QWN A;  1VQO N;  3EYZ A;  3V81 A;  3V9W A;  1EKE A;  2XY7 A;  3UIQ A;  2I5J A;  5AZJ A;  4JRQ A;  1Z05 A;  3C65 A;  4DV3 K;  4BE1 A;  4HCC A;  4J2A A;  2ZJQ L;  4Z4H A;  3CCV N;  2YKM A;  1Q9X A;  3O08 A;  4WQ4 C;  3D0P A;  3SUO A;  2HHH K;  3BZC A;  3LP3 A;  1J53 A;  4DQP A;  3HVT A;  3HVR A;  5BRH A;  1NGC A;  5J2N A;  4C8M A;  5GAG P;  5E26 A;  2O8F A;  3RSE A;  2P51 A;  3HSC A;  4JI5 K;  5AZI A;  3AGK A;  4CEZ A;  3WXM B;  5EU7 A;  1JLA A;  4V19 S;  4CJF A;  4CJR A;  3OA9 A;  1D9D A;  3PV8 A;  4H5N A;  1A5X A;  4FJM A;  3NMU A;  3HM8 A;  3AO2 A;  2WFB A;  1C0F A;  4IEI A;  5KPT A;  2J4R A;  5KTQ A;  5C2F A;  3O1B A;  1Z6R A;  4KV8 A;  2W41 A;  5AQK A;  1B9F A;  4C8L A;  4E1M A;  3K57 A;  4O5B A;  4KHP K;  2KKZ A;  4LFC K;  2GTD A;  5KRT A;  3SMP A;  3VQQ A;  3L2U A;  1QVG M;  3WNH A;  1U4B A;  1OVY A;  1C1A A;  1BHL A;  3SQ2 A;  2Q97 A;  3EZW A;  5K14 A;  1S1X A;  4Z4G A;  3U3G A;  3M6G A;  1KRP A;  3VQ4 A;  1IBL K;  1RDC A;  4IDH A;  1WNS A;  5AQJ A;  3SPY A;  2ZQB A;  4BDZ A;  4DV0 K;  2IDO A;  3VN5 A;  4OGC A;  3NGI A;  4DQ8 A;  3CJB A;  5LMN K;  1BIU A;  3QEI A;  3F9M A;  5HRN A;  2NZT A;  5GIN A;  2E2P A;  2Q36 A;  2Y1I A;  4OKJ A;  2ASM A;  1ASW A;  4HUF A;  3MXM A;  1LWC A;  4FL9 A;  2P9P A;  2V52 B;  3FZL A;  4CF9 A;  3PLA A;  3DMJ A;  4E7H A;  2A1R A;  3VQ8 A;  1NK0 A;  4IFY A;  3O8M A;  1RFQ A;  3QFP A;  2XY6 A;  5I9E B;  4BRE A;  3HPH A;  5EVZ A;  5JLH A;  1Q81 O;  3V1Q A;  4B9U A;  3QBX A;  3MWP A;  1NJX A;  1LCU A;  2HNZ A;  1XC3 A;  3KZB A;  3SBG A;  4KHN A;  4WYB A;  1K9M O;  1JXB A;  3R1X A;  4O5F A;  1HKB A;  1QQO A;  1CXQ A;  3HRG A;  4IO8 A;  3MCP A;  3AVK A;  4KAZ A;  2A5X A;  4RW4 A;  4FJJ A;  3EY1 A;  1FKO A;  1Y97 A;  1ZC6 A;  4EP5 A;  1B92 A;  1HRH A;  4UY8 O;  4JKD A;  3R9P A;  3OYJ A;  4GKJ K;  4FPA A;  3ATU A;  3THW A;  1T8E A;  2RN2 A;  3EEQ A;  4NLC A;  2ZGY A;  4JV5 K;  3LM9 A;  3JYT A;  4DU4 A;  4GVE A;  1Q86 O;  4Z4E A;  3IUC A;  3THY A;  2NRX A;  3UKU B;  1S72 N;  1ITG A;  3MED A;  3B6P A;  4N5S A;  3KKR A;  1G99 A;  3L0Q A;  3TAN A;  3MN6 A;  4CK3 A;  1OVQ A;  3F2K A;  1K8K A;  5CE3 A;  4IOC L;  5ADX H;  3C6A A;  4H4O A;  3QEW A;  3U9Z A;  3QO9 A;  3SUP A;  1XMO K;  3VQE A;  3LAM A;  3T1H K;  5KQ8 A;  2FF6 A;  1O13 A;  2WC9 A;  5AQG A;  3OS2 A;  5AQN A;  4I9L A;  2KFZ A;  3ZT0 A;  5CYQ A;  1C0G A;  2W40 A;  4HUG A;  5JIC A;  2HOE A;  3AVN A;  1YF5 L;  3WEE A;  4IG3 A;  3TSU A;  4PKI A;  4FW1 A;  1LV5 A;  4IFV A;  3ZEU A;  4I2Q A;  4DFP A;  4BRF A;  3LDQ A;  4U7B A;  4L8R B;  1U2V A;  3VF4 A;  1J5E K;  4QS9 A;  2E2O A;  3P39 A;  4KO0 A;  3RMA A;  4IBN A;  1Q82 O;  2QW9 A;  3ASM A;  1RDB A;  4F2S A;  4G9Z A;  4W5R A;  4M3R A;  4CVN E;  4A62 A;  4DFM A;  4M63 C;  3ZT1 A;  4BQZ A;  3F9K A;  4A59 A;  2YV0 X;  2YKN A;  4J2D A;  2QWO A;  3ZT4 A;  2GUP A;  2QWL A;  3P5J A;  3R3L A;  3VGL A;  1W9H A;  4FJL A;  3Q7C A;  4RW6 A;  3PSI A;  3QFU A;  2RHK A;  3E9P A;  1KVB A;  4B3O A;  2YHX A;  3GDQ A;  5ADX A;  4JKG B;  4B9N A;  2IGI A;  1WAF A;  3H45 C;  3OYB A;  5CYM A;  4DR6 K;  4AM6 A;  3QNN A;  4CF2 A;  3PO5 A;  3CJA A;  4X65 K;  3NE6 A;  4CBX A;  1JLB A;  1KTQ A;  2KW4 A;  1J54 A;  4DS4 A;  3K9J A;  1TYQ B;  3CHW A;  1VSM A;  3A0I X;  1S1W A;  2QTD A;  5DMR A;  4IDK A;  2D0A A;  1FKP A;  5MLC Q;  4FJG A;  2KTQ A;  3OYM A;  1RTJ A;  3FLC O;  1YHQ N;  3IKM A;  2PZS A;  3M8Q A;  1TKX A;  5AQM A;  1YIJ N;  3S41 A;  4MQ3 A;  4CES A;  4CD1 A;  1LW2 A;  1QZ6 A;  4NYN A;  1LWE A;  2KLA A;  4FVU A;  3S3M A;  4FJ8 A;  1FW6 A;  4BDY A;  1A5W A;  1MU2 A;  2FSK A;  3CME N;  2ZE2 A;  4DV6 K;  3VEY A;  2A41 A;  3VTH A;  3DXK A;  2NRT A;  4NCB A;  1NGH A;  5AFU H;  1M90 O;  3A2F A;  1E4F T;  3ULE B;  2LSN A;  4IG0 A;  2YNG A;  1GLL O;  5BRE A;  1ZXO A;  2HBL A;  4EIA A;  4B9Q A;  2NLX A;  2YHW A;  3CCS N;  4DUZ K;  2E2Q A;  4B9S A;  1WB9 A;  3DLL L;  3VPZ A;  5C2D A;  1XWL A;  5KGX A;  3L3V A;  2ZJP L;  4Z4C A;  1WSG A;  3E1Y A;  3J8A A;  2Q2R A;  5F1X A;  4NYF A;  1T44 A;  3WNE A;  4W5O A;  1S3X A;  1IO2 A;  2XRI A;  3GL1 A;  4PKG A;  1JLE A;  4NXM K;  1Q18 A;  3VES A;  4EFH A;  3DLR A;  4JK8 A;  1N8R O;  3HPG A;  4DG1 A;  3RRG A;  4FK2 A;  2F8S A;  4DCH A;  3ZSZ A;  3FZM A;  1B9D A;  3DYA A;  4B9L A;  1RTD A;  2V7Z A;  4R79 A;  4DTU A;  2B5J A;  4BRL A;  2PYJ A;  1C1B A;  5M1N A;  4FWO A;  1RDW X;  4B1Z A;  4CZK A;  4B9T A;  4TSX A;  4JKA A;  4DR5 K;  5AFU A;  4F3T A;  1WSI A;  4FWL A;  2JGU A;  4FOE A;  3CJ9 A;  3VA0 A;  2RE2 A;  4A5B A;  2HF4 A;  3TAE A;  4BR5 A;  3VEV A;  3VEW A;  3AVJ A;  1VSK A;  1NMD A;  4CGJ A;  4Q5V A;  2YI1 A;  1QHT A;  1EXQ A;  4K8X A;  2VG6 A;  1JCG A;  1WSF A;  3AVA A;  3E9L A;  3M1F A;  3L2W A;  3FFI A;  1HNZ K;  4CFA A;  1S22 A;  1TL3 A;  3C7N B;  3VQ6 A;  1NJY A;  4PL7 A;  3OW2 M;  1NK7 A;  1BCM A;  4E7L A;  1ASU A;  3KJV A;  4CZJ A;  4DSJ A;  1WUA A;  2YNH A;  4H4M A;  2UXC K;  2F7T A;  4YOX A;  1VSE A;  2ETJ A;  3G10 A;  4DSI A;  4CGH A;  3OBW A;  4JI1 K;  2ZM6 K;  1DTT A;  1U6Z A;  5HRP A;  4DU3 A;  2UYT A;  3OYK A;  2VGM A;  2E4L A;  2P9L B;  1BDG A;  4BG9 A;  5LMU K;  2W6L A;  5AQR A;  1YVU A;  4CFB A;  1KAX A;  1HPZ A;  1L3U A;  1SZ2 A;  1NK5 A;  4FJH A;  2ZF5 O;  3KD1 E;  4N41 A;  3D45 A;  1J9A A;  4W5T A;  4ISF A;  1UWB A;  4BRP A;  3SUQ A;  5CZ2 A;  1QQM A;  3L2V A;  1IG8 A;  2G8W A;  4OLA A;  5C10 A;  3I0R A;  5FPD A;  5GIO A;  3AVM A;  3QBW A;  2GEM A;  4WQ5 A;  5AQO A;  4PL8 A;  3TAR A;  4CJU A;  4EHT A;  1BUP A;  1Q8I A;  3CFO A;  2QWM A;  1TUY A;  2E1Y A;  4BRQ A;  1F21 A;  1U45 A;  4C23 A;  1X9W A;  4WE1 A;  3E9O A;  3AA3 A;  1IKW A;  4N56 A;  1HYS A;  1SAZ A;  3K9K A;  4CJE A;  3KTQ A;  4KHQ A;  3KK2 A;  1RDD A;  4NO7 A;  4KKO A;  3T1Y K;  5HRR A;  4YDU A;  4DFJ A;  4A57 A;  1QSL A;  2UXD K;  5CZ1 A;  1ILY A;  3EE9 A;  1N6Q A;  2HBJ A;  4JK9 A;  2NRZ A;  3H3O B;  4FWK A;  1V4S A;  3MX2 A;  3TR8 A;  2FLO A;  1MDU B;  3SI6 A;  2DFE A;  1XNR K;  4M3Z A;  1EP4 A;  3UKU A;  5FRM A;  4M3U A;  3UKR B;  3KVG A;  3AAR A;  3OJS A;  4B1W B;  3VQA A;  2BH1 A;  3SBT A;  4FWP A;  2OCE A;  5AQZ A;  2OPS A;  1CZA N;  2YX6 A;  1I94 K;  1GLJ O;  2Z1I A;  1OKJ A;  4IJA A;  2QI2 A;  2EWS A;  3CCU N;  1DT9 A;  4BRM A;  2P9K B;  4JI8 K;  4H03 B;  1DKG D;  3B8A X;  5BN9 A;  3I0S A;  3FZF A;  1QHA A;  3AVC A;  4B9M A;  4YY3 K;  4FW2 A;  4EHU A;  1BU6 O;  1L5U A;  4CGI A;  3I55 N;  5LL6 Z;  4JNE A;  3NGY A;  4RW8 A;  3HPO A;  3NVK A;  3TI0 A;  3O3F A;  3ZSQ A;  5I3U A;  1REV A;  3DJC A;  4MDB A;  1KAZ A;  3TSP A;  2XY8 A;  2HST A;  5HOO A;  3D7E O;  3HOS A;  2D0C A;  5KPR A;  4NCA A;  1RT2 A;  3C6H A;  4CW7 B;  1X9J A;  4XEI A;  5FPE A;  1N32 K;  2O4I A;  2Q0R A;  4HWI A;  3QES A;  1RBV A;  3QIC A;  2F9W A;  1ZYQ A;  1NGE A;  4H5R A;  4JKG A;  3DRS A;  4FWM A;  4LF5 K;  3D2E B;  2FC0 A;  2G8I A;  3C94 A;  1OH7 A;  2F9T A;  2H3G X;  5SWM A;  4HTU A;  1Q7Y O;  1XQS C;  2YHB A;  4DSE A;  3ZSV A;  2V7Y A;  1BIS A;  2BDP A;  1TYQ A;  1ATN A;  3TAB A;  1A5V A;  1VHX A;  5IWA K;  4H5V A;  3VQC A;  3G71 N;  3MK6 A;  4CED A;  3P4I A;  4X62 K;  4M45 A;  4BRK A;  3WXL A;  4YNQ A;  3SLC A;  1OH5 A;  4IEE A;  1KD1 O;  3ZX2 A;  4E0D A;  3VQD A;  5HP1 A;  4FJI A;  2WON A;  3V9S A;  3QET A;  4FLU A;  1BI4 B;  1LAV A;  4BG8 A;  5BRF A;  4B08 A;  2P9U B;  4BVO A;  1NOZ A;  4DF4 A;  1L3S A;  1N36 K;  4WQ4 A;  2IVP A;  4LF8 K;  3TAP A;  1VSH A;  2F4V K;  4AH9 A;  1VQL N;  5CR4 A;  3OYF A;  4JRP A;  2QM1 A;  4CK2 A;  3J7Y P;  3K5M A;  2Q31 A;  3SV3 A;  5TKY A;  5EY4 A;  3ULE A;  3KLE A;  3LWL A;  1DTQ A;  2IOC A;  2B4J A;  2Y1J A;  1XHX A;  3AVG A;  4DTR A;  3EKS A;  4LF9 K;  1YT3 A;  1W7A A;  3L4I A;  4YOT A;  4I9Q A;  2DFH A;  2G8F A;  3MDQ A;  1CZ9 A;  3OVN A;  3EN9 A;  3ID8 A;  1NM1 A;  3GG4 A;  3CF5 L;  1BIZ A;  1D5A A;  2F96 A;  2GBZ A;  1IKX A;  4BRI A;  2YJE A;  3N4P A;  4LF6 K;  1D4X A;  1YUW A;  4OGE A;  4DV1 K;  1UA1 A;  3CIP A;  4OPK A;  1IJJ A;  5HRO A;  3VGK A;  1SL1 A;  5JS2 A;  1GLB G;  4DV2 K;  5J2P A;  3K5O A;  3VQB A;  4DUY K;  5GIP A;  3S3O A;  4BDP A;  3WT0 A;  4B3M K;  2AA4 A;  3VGM A;  4ICL A;  3NF9 A;  3VQP A;  3UB5 A;  1KLN A;  3M5R A;  1S6P A;  3TSQ A;  1HNW K;  4KB1 A;  2IVN A;  3NVM A;  2O8E B;  4IKF A;  3O3H A;  3RMD A;  4DR3 K;  4F8R A;  2NNW A;  4O55 A;  2KQ2 A;  2FSJ A;  4XIU A;  4KHY A;  2Q3S A;  2PY5 A;  1VSI A;  4M42 A;  5BPM A;  3O9Q A;  3OYE A;  4R5P A;  2W42 A;  3LP0 A;  4QS7 A;  1HUX A;  4DQR A;  3ZSO A;  3ID6 A;  1HNV A;  1BA0 A;  4I6M B;  1Z26 A;  3SQ0 A;  4C8N A;  1NWK A;  3K5L A;  5AQS A;  3HK2 A;  1YIT N;  1RTI A;  4DS5 A;  2E6M A;  3H1V X;  4GW6 A;  3K0S A;  5AQT A;  3BF1 A;  1E3M A;  2PFU A;  1VQ8 N;  3C7N A;  2HVI A;  4Y1D A;  3HZ6 A;  4BRN A;  4Z0U A;  5AQW A;  3DM2 A;  3PY8 A;  4FLW A;  1WBB A;  4BRG A;  3OHR A;  4CHY A;  2EHG A;  5BN8 A;  5KI6 A;  4O4G A;  3EKU A;  1TL1 A;  2VG5 A;  3TAQ A;  4JI0 K;  3CCL N;  3DRR A;  1RTH A;  1VK0 A;  4B3T K;  1HLU A;  1VSF A;  3AVB A;  3JAM O;  1C1C A;  4M3T A;  3HT3 A;  3NF6 A;  1RDA A;  3KK1 A;  4FJ7 A;  2CGK A;  4NLB A;  4J2E A;  3ALY A;  4BVP A;  2ATQ A;  3DLB A;  4QCL A;  1S9E A;  2GV9 A;  3IS9 A;  3AO4 A;  3KD5 E;  3PIP L;  1QS4 A;  3SCX A;  2FXU A;  4FLX A;  3ZSX A;  3BF3 A;  1WN7 A;  3SV4 A;  3NH1 A;  4BR9 A;  4DTS A;  3MEE A;  1NBW A;  4CHO A;  2O8B B;  3DRP A;  3H6E A;  5KRS A;  1SUQ A;  2IS3 A;  3BP8 A;  1XNQ K;  4PQU A;  3W3D A;  4FJX A;  1NLV A;  4AF1 A;  4DU1 A;  1NJZ A;  3CCQ N;  4IOX A;  3AGR A;  3NFA A;  2OTJ N;  4YOY A;  1R0A A;  1QSY A;  5M1Q A;  2DY4 A;  2VWJ A;  4AHT A;  1U04 A;  5H1S Q;  3I8D A;  1VQ9 N;  4DSK A;  2GWK A;  4AHV A;  2QXF A;  4MFB A;  3KWI A;  1S6Q A;  3WXI A;  3GE1 A;  1SL2 A;  2OPP A;  3CJ1 A;  1T7P A;  3MXI A;  4BRO A;  3J7Z O;  3BUZ B;  4B3S K;  4O44 A;  3HM9 A;  2X74 A;  3NF7 A;  5EX5 A;  4YOR A;  4C1N I;  4KTQ A;  4BE2 A;  2A3Z A;  1P90 A;  1HJO A;  4ID5 A;  3UKR A;  1NK4 A;  5FPM A;  3LL3 A;  3CCE N;  2P9N B;  1BO5 O;  2G8H A;  4KH6 A;  1LOT B;  1YXQ A;  1NK6 A;  1R59 O;  3OS0 A;  2QXL A;  3MEC A;  3O4Q A;  3OYI A;  1HYV A;  1N33 K;  2IC3 A;  4JS5 A;  4X64 K;  3VQ5 A;  4GMJ B;  2G8U A;  4CIE A;  3O4W A;  3ENH A;  4H0T B;  1NOY A;  4CJW A;  2P9K A;  2A42 A;  1QSS A;  1GLE G;  1Y64 A;  1LW0 A;  3JS6 A;  2P1J A;  3VQ9 A;  3NH0 A;  3QIP A;  2ZD1 A;  4C1N K;  1JLQ A;  2GEL A;  4FZX C;  4OKE A;  1CZB A;  4FJ9 A;  3O9T A;  3HOT A;  3MMV A;  1WSE A;  5CY4 A;  4ZTJ A;  4KH4 A;  3VEN A;  4NCG A;  4BGB A;  1NMN A;  2E8A A;  3LAK A;  4K0K K;  4LSN A;  2NRW A;  3D2F B;  1VQK N;  1IH7 A;  4DV7 K;  5AQV A;  5EOY A;  1W2B M;  2HBK A;  4MO5 A;  2BUP A;  3WXK A;  2G8V A;  2OYQ A;  2HBM A;  4FWQ A;  4DSL A;  3PX0 A;  3N4Q A;  3OYH A;  4CF1 A;  3CC2 N;  4HVJ A;  1LAW A;  3MAQ A;  3MN5 A;  3D2E A;  4BC4 A;  3LZI A;  4DQQ A;  3G6E N; 
#chains in the Genus database with same CATH homology
 3CJ7 A;  1ATR A;  1NGB A;  4CI6 A;  3E9O A;  5JLF A;  2ZJR L;  1SAZ A;  3K9K A;  3SAG A;  2JWL A;  5BRH A;  2NRH A;  4NO7 A;  1NGC A;  3F5T A;  4RTF D;  1VQ7 N;  4WF9 L;  3LDP A;  3SAH A;  5GAG P;  5E26 A;  3G4S N;  3FFK B;  4JKB A;  4YDU A;  3RSE A;  3HSC A;  4A57 A;  1EQY A;  2NRR A;  5AZI A;  3AGK A;  1ILY A;  2ZWH A;  1GLC G;  3EE9 A;  3WXM B;  2HBJ A;  3U9D A;  4JK9 A;  2NRZ A;  3H3O B;  5JVH L;  3OA9 A;  4FWK A;  4CZF A;  4H5N A;  1V4S A;  4H0P A;  3MX2 A;  2FLO A;  1MDU B;  5TKW A;  3NMU A;  3HM8 A;  2ASO A;  2WFB A;  2FF3 B;  1C0F A;  2D0O A;  3KHY A;  4IEI A;  4XH4 A;  2ITM A;  3UKU A;  4DHY A;  3CPE A;  3UKR B;  5KPT A;  2J4R A;  3FZK A;  5C2F A;  3KVG A;  2P9U A;  3ZYY X;  3O1B A;  1Z6R A;  2D4W A;  2W41 A;  3AAR A;  5AQK A;  4F9O A;  3G25 A;  1ATS A;  2GX9 A;  3TU5 A;  5JMV A;  5BR9 A;  4IO9 L;  4B1W B;  4WFA L;  2BH1 A;  4OO1 J;  5AQI A;  3P31 A;  4YOV A;  3SBT A;  2KKZ A;  4FWP A;  2GTD A;  3AY9 A;  3SMP A;  5AQZ A;  2YX6 A;  1CZA N;  1QVG M;  5DM6 L;  1GLJ O;  2VGN A;  4GNI A;  4BC3 A;  3R6M A;  1OVY A;  1OKJ A;  4IJA A;  2DPN A;  2QI2 A;  2Q97 A;  5AQF A;  2EWS A;  3EZW A;  3H1Q A;  3CCU N;  3VMF B;  1DT9 A;  1BWF O;  2BTF A;  2P9K B;  3M6G A;  4BRM A;  3QB0 A;  4IDH A;  4CZE A;  4H03 B;  4BRC A;  5AQJ A;  5LY3 A;  3I56 N;  3CCM N;  1YJN N;  1DKG D;  3FR0 A;  3B8A X;  2QWR A;  5BN9 A;  1T6C A;  1HKC A;  3FZF A;  1X3N A;  4J8F A;  3IMX A;  4B1Y B;  3CXC M;  4DQ8 A;  3CJB A;  1QHA A;  1MA9 B;  1K8A O;  4EHU A;  1BU6 O;  4E1J A;  3CJC A;  3I55 N;  2KHO A;  3F9M A;  4JNE A;  3R8E A;  2A6A A;  3U4L A;  3NVK A;  2NZT A;  4IZ9 A;  2E2P A;  2Q36 A;  5GIN A;  1VQP N;  2ASM A;  4O8K A;  3P38 A;  4JKF A;  1ZBS A;  3DJC A;  4MDB A;  2I7N A;  4M7X A;  3ZET A;  4FL9 A;  1KAZ A;  3TSP A;  2P9P A;  2V52 B;  3FZL A;  2HST A;  2PBD A;  1QZ5 A;  4IWV A;  1V4T A;  3PLA A;  4BR0 A;  3TTC A;  3WXJ A;  5HOO A;  3D7E O;  3HOS A;  3M3Z A;  1NGA A;  4H0O A;  4DB3 A;  4CJ7 A;  5KPR A;  3BEX A;  3O8M A;  3VEO A;  1RFQ A;  3AAQ A;  3C6H A;  3QFP A;  1X9J A;  2ZGZ A;  4XEI A;  5AQP A;  5ELZ A;  5FPE A;  1T3V A;  1KQS M;  3H46 O;  1DGK N;  5I9E B;  2CH6 A;  2Q0R A;  4HWI A;  4BRE A;  5EVZ A;  3QIC A;  5AZJ B;  2F9W A;  5JLH A;  1NGE A;  4H5R A;  1Q81 O;  3A8Y A;  3QBX A;  4JKG A;  4FWM A;  3MWP A;  1BG3 A;  2D1K A;  1LCU A;  3MWT A;  4MLH A;  3D2E B;  5BRD A;  1XC3 A;  3KZB A;  3SBG A;  1VQ4 N;  4WYB A;  4FWN A;  1K9M O;  2F9T A;  2H3G X;  3R1X A;  4O5F A;  1HKB A;  1QQO A;  5B8H A;  5AQX A;  3HRG A;  1XQS C;  4IO8 A;  1Q7Y O;  2YHY A;  3MCP A;  2AP1 A;  2V7Y A;  2QWQ A;  1TYQ A;  1ATN A;  2A5X A;  3I33 A;  4I6M A;  3VEX A;  4K42 A;  4H5V A;  4A2A A;  5C15 A;  3G71 N;  1ZC6 A;  3MK6 A;  4CZM A;  3RSE B;  1JJ2 M;  1YJ9 N;  3P4I A;  3U8X A;  5AZI B;  5F0X A;  2YCH A;  4UY8 O;  4FWR A;  3QDK A;  4JKD A;  3R9P A;  4BRK A;  3WXL A;  4FPA A;  3ATU A;  4CD3 A;  4NLC A;  2ZGY A;  4JK7 A;  3SLC A;  3CCJ N;  4IEE A;  3FE1 A;  3LM9 A;  1KD1 O;  3ZX2 A;  3EO3 A;  4AM7 A;  3L4Q A;  3MCA B;  4GVE A;  5BPL A;  1Q86 O;  3IUC A;  2NRX A;  3UKU B;  4NB4 A;  1S72 N;  3PIO L;  4BG8 A;  5BRF A;  3L0Q A;  1G99 A;  4O8U A;  2P9U B;  3EL2 A;  3MN6 A;  4FPB A;  3WEE B;  3WUH A;  4WQ4 A;  4BVO A;  1NGF A;  5M1F A;  3F2K A;  1K8K A;  5GAE P;  2IVP A;  4CZG A;  3C6A A;  5ADX H;  5CE3 A;  4IOC L;  3CD6 N;  1VQL N;  3U9Z A;  5CR4 A;  5CHI A;  2VCP A;  2QM1 A;  4YDU C;  2FF6 A;  5KQ8 A;  1O13 A;  2WC9 A;  2Q31 A;  2QEX N;  4PKH A;  5AQG A;  5AQN A;  5TKY A;  5EY4 A;  3MX5 A;  3ULE A;  2OTL N;  1C0G A;  2W40 A;  3A5L C;  3E66 A;  3WQT A;  3CQX A;  3EKS A;  5JIC A;  2NRV A;  3O1W A;  2HOE A;  3L4I A;  4FWS A;  4YOT A;  1YF5 L;  3WEE A;  4BR2 A;  3FGU A;  3TSU A;  4JKC A;  3MDQ A;  2Q0U A;  3AAP A;  4PKI A;  1VQM N;  3ZEU A;  3EN9 A;  4H5T A;  4HTL A;  3ID8 A;  3LDQ A;  1NM1 A;  3GG4 A;  4BRF A;  1U2V A;  3C0B A;  4WFB L;  4U7B A;  3CF5 L;  3VF4 A;  4QS9 A;  4BRI A;  2YJE A;  3L6Q A;  3N4P A;  2E2O A;  3P39 A;  1D4X A;  1YUW A;  4XH1 A;  4CZH A;  3CIP A;  3MN9 A;  3A5O C;  1IJJ A;  2QWP A;  3VGK A;  3H3N O;  1Q82 O;  2QW9 A;  3DXM A;  1GLB G;  4GY2 B;  4G9Z A;  3T69 A;  3LDN A;  4A62 A;  1W97 L;  3ZET B;  1DEJ A;  2P9P B;  4M63 C;  5GIP A;  3WT0 A;  4BQZ A;  2AA4 A;  4A59 A;  3VGM A;  4K41 A;  4FOI A;  3MN7 A;  2QWO A;  2VYP A;  3UB5 A;  5EXW A;  3M5R A;  2GUP A;  2YJF A;  2QWL A;  3R3L A;  3VGL A;  3VF2 A;  5KPZ A;  3SJH A;  3TSQ A;  2IVN A;  3Q7C A;  3O9U A;  4JD2 A;  3NVM A;  4GV6 A;  4BC5 A;  2CH5 A;  3QFU A;  2RHK A;  3HBT A;  3E9P A;  4ILJ A;  1SQK A;  3T7Z A;  1P8Z A;  2YHX A;  5AQU A;  2NNW A;  3GDQ A;  5ADX A;  4JKG B;  4DKW A;  4RCH A;  2FSJ A;  1VQN N;  2E20 A;  3H45 C;  5LJV A;  4GV3 A;  1YJW N;  1BA1 A;  3ATV A;  2P9S A;  3D6R A;  4AM6 A;  4Y0W A;  1T6D A;  5BPM A;  3O9Q A;  3CJA A;  4BRH A;  4ISE A;  3CMA N;  4QS7 A;  4CBX A;  1HUX A;  1GLF O;  3ID6 A;  3Q7B A;  3VEZ A;  3LM2 A;  3K9J A;  1MWK A;  1BA0 A;  1TYQ B;  4MLE A;  4I6M B;  3CHW A;  4LC9 B;  1NWK A;  3A0I X;  1E4G T;  5M1O A;  5AR0 A;  2QTD A;  5AQS A;  5MLC Q;  1YIT N;  1GLA G;  3FLC O;  3H1V X;  1YHQ N;  3IKM A;  3CER A;  1TUU A;  2E1Z A;  5AQM A;  1YIJ N;  1NGJ A;  4KH5 A;  5AQT A;  1H1V A;  3S41 A;  4CD1 A;  3BF1 A;  2E88 A;  4B1V A;  2PFU A;  1QZ6 A;  4C23 A;  2PAV A;  2KLA A;  3C7N A;  1VQ8 N;  2WUS A;  4B1U B;  4FVU A;  4IJN A;  3HZ6 A;  4BRN A;  5AQW A;  1JCF A;  5M1P A;  2FSK A;  4GV9 A;  4MDA A;  4BRG A;  3OHR A;  4H5W A;  3CME N;  1NGI A;  1K8K B;  5BN8 A;  3EKU A;  2A41 A;  3VEY A;  3DXK A;  3VTH A;  2NRT A;  4WQ5 C;  1NGH A;  2CGJ A;  4FSV A;  5AFU H;  3CCL N;  4EAH D;  4A61 A;  1HLU A;  1RGI A;  1M90 O;  2OAN A;  1E4F T;  3ULE B;  4K43 A;  3IDH A;  1NGG A;  5AQL A;  5BRE A;  1GLL O;  1ZXO A;  2P9I A;  2HBL A;  4EIA A;  3O80 A;  2CGK A;  4B9Q A;  3VET A;  2NLX A;  1RDU A;  2YHW A;  4NLB A;  4WFN L;  3CCS N;  2E2Q A;  5E84 A;  4H0X B;  4A2B A;  4BVP A;  1QQN A;  1QVF M;  3HI0 A;  5BPN A;  5HL7 L;  3ZEU B;  3D2F A;  3VPZ A;  3DLL L;  3PIP L;  5JVG L;  5C2D A;  5M1K A;  1U2V B;  3UE5 A;  2FXU A;  2ZJP L;  3BF3 A;  2JWK A;  4BR9 A;  3CET A;  3E1Y A;  4BC2 A;  3CQY A;  3J8A A;  3CPW M;  4B1X B;  1NBW A;  2Q2R A;  5F1X A;  4ILG B;  3JXU A;  1T44 A;  3H6E A;  3TPQ A;  1X3M A;  3BP8 A;  3W3D A;  1S3X A;  4BGA A;  3ZX0 A;  1YAG A;  1NLV A;  4AF1 A;  1KC8 O;  1GLD G;  3DXM B;  3CCQ N;  4IOX A;  3CCR N;  4IXC A;  3GL1 A;  3AGR A;  4PKG A;  1NJI O;  4U67 L;  1ESV A;  3TTF A;  1Q18 A;  3WQU A;  2OTJ N;  3O5B A;  3VES A;  4EFH A;  4YOY A;  4JK8 A;  5M1Q A;  3FZH A;  5F2R A;  1N8R O;  2I7P A;  4IOA L;  1VAZ A;  4OPH A;  4JHD A;  4JKE A;  5C12 A;  1HX1 A;  4Z94 A;  4DCH A;  5H1S Q;  1VQ9 N;  3ENB A;  3O9S A;  1SS6 A;  2GWK A;  2WBN A;  3FZM A;  4FO0 A;  1VQ5 N;  4QS8 A;  1VQ6 N;  5GAD P;  2V7Z A;  4JD2 B;  4R79 A;  3KWI A;  3WXI A;  3GE1 A;  3SK3 A;  2V51 B;  4BRL A;  2IIR A;  3CJ1 A;  5M1N A;  4FWO A;  4IFE A;  1RDW X;  4B1Z A;  4BRA A;  4L3Q A;  1HPM A;  4CZK A;  4CBW A;  4JKA A;  4BRO A;  3J7Z O;  3BUZ B;  4H0Y B;  5AFU A;  2P9S B;  2ASP A;  4FWL A;  1HKG A;  4KBO A;  4XH5 A;  3SAF A;  1K73 O;  3TTD A;  2QA4 N;  4FOE A;  3CJ9 A;  2RE2 A;  5EX5 A;  4A5B A;  4YOR A;  4C1N I;  1J6Z A;  1NGD A;  2HF4 A;  1YI2 N;  1EO1 A;  5AQY A;  4BR5 A;  2A3Z A;  2CGL A;  3GBT A;  3O6W A;  3VEV A;  4CZL A;  3LDO A;  1P90 A;  4RWT A;  3EE8 A;  1HJO A;  3ENO A;  2VWB A;  3UKR A;  3VEW A;  5FPM A;  4BR7 A;  3LL3 A;  5KQD A;  1NMD A;  3CCE N;  4JN4 A;  2YI1 A;  2P9N B;  1BO5 O;  4KH6 A;  5AQQ A;  1MWM A;  4YOU A;  4ILH A;  1JCG A;  3VF6 A;  1LOT B;  1WOQ A;  3W0L A;  1YXQ A;  2IVO A;  1R59 O;  1JCE A;  4OPA A;  3M1F A;  3E9L A;  2QXL A;  3VTI A;  1S22 A;  5C0Y A;  3C7N B;  4JKH A;  3CI5 A;  4BR4 A;  4CZI A;  4PL7 A;  3OW2 M;  4PHT X;  1KXP A;  3A5M C;  3O4W A;  5FPN A;  3ENH A;  4H0T B;  4CZJ A;  1WUA A;  2P9K A;  2F7T A;  2A42 A;  2P9N A;  4YOX A;  1GLE G;  3OBY A;  4K25 A;  1Y64 A;  3VER A;  5GAH P;  3OBW A;  3JS6 A;  3DXK B;  3GOI A;  1BOT O;  2E2N A;  5LJW A;  4YOW A;  1M1K O;  4BY9 C;  2FSN A;  4WCE L;  1U6Z A;  4JAX A;  2UYT A;  2VGM A;  4CBU A;  2D0P A;  3QML A;  4C1N K;  3I8B A;  2P9L B;  1BDG A;  4BG9 A;  4A5A A;  2GEL A;  5AQR A;  4BQL A;  3A5N C;  4M7Y A;  2P9I B;  3KK7 A;  1KAX A;  3O9T A;  4ISG A;  3HOT A;  3MMV A;  1SZ2 A;  1XUP O;  2ZF5 O;  3VOV A;  3SMS A;  3ZX3 A;  3DAW A;  1KAY A;  4KH4 A;  3VEN A;  4BGB A;  2E8A A;  3CC4 N;  4ISF A;  4BRP A;  1YVN A;  4H0V B;  2HF3 A;  2NRW A;  3D2F B;  1VQK N;  2Q1N A;  4MO4 A;  3RVC A;  3O9R A;  4JEP A;  1QQM A;  2HMP A;  5AQV A;  5EOY A;  1W2B M;  2HBK A;  2P9L A;  4MO5 A;  2QWN A;  1VQO N;  3CC7 N;  1IG8 A;  2BUP A;  5C10 A;  3WXK A;  5FPD A;  5AQH A;  5GIO A;  3HTV A;  2HBM A;  3QBW A;  4FWQ A;  2GEM A;  4WQ5 A;  5AQO A;  4PL8 A;  5AZJ A;  1Z05 A;  2GWJ A;  3C65 A;  5DM7 L;  3N4Q A;  3CC2 N;  2ZJQ L;  3KWG A;  3CCV N;  4EHT A;  3MN5 A;  3D2E A;  4BC4 A;  3IFR A;  1BUP A;  4BRD A;  3O08 A;  2QWM A;  4WQ4 C;  1TUY A;  2E1Y A;  4BRQ A;  3LDL A;  3G6E N;  3DWL A;  2A40 A;  4JHD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...