1O1WA

Solution structure of the rnase h domain of the hiv-1 reverse transcriptase in the presence of magnesium
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
138
Chain Sequence
MNELYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Solution Structure of the Rnase H Domain of the HIV-1 Reverse Transcriptase in the Presence of Magnesium
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
total genus 26
structure length 138
sequence length 138
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1o1wA00
3AO4A 4FK2A 1IKWA 2F8SA 4Z4EA 4M3RA 4E1NA 3HXMA 1W9HA 3T19A 4CJPA 4FJIA 4B9TA 3FFIA 3L3UA 3ZT0A 1S1TA 5HRSA 4DTRA 1JLQA 4DQQA 4DTOA 4CGIA 1TAUA 3LWMA 2GBZA 4F8RA 1NK9A 3G10A 3PO4A 1BHLA 3K5MA 3CFPA 1QQCA 3OJSA 4Z4HA 2HHQA 4OLBA 1KVBA 4FJ9A 4C8MA 4CJRA 4UQGA 4FXDA 5C25A 2Z1GA 3AVHA 3OYMA 3SUOA 3LAKA 3DOKA 2DFHA 3LALA 1FKPA 4F3TA 4JRPA 1LW2A 1BQNA 1QSYA 3OYAA 3OYBA 2W42A 1VRUA 3SUPA 1LWFA 4CGHA 3RMAA 4E7JA 3AVBA 3P1GA 1LW0A 5HRNA 2D5RA 4ID5A 5HLFA 3DLBA 4EZ6A 4F2RA 1RDCA 1HMVA 2D0BA 2FBTA 3PUFA 1UA1A 5T7BA 1QSSA 1IH7A 1KCFA 1NJXA 1JLBA 4BE2A 1A5XA 2ZE2A 4CHPA 1X9WA 1CLQA 2LSNA 4OLAA 3M8QA 1BISA 4C8KA 3HP9A 1BI4B 1X9SA 3KJVA 4CCHA 4CHZA 3SUNA 3DYAA 4B8AB 3P83D 3WNHA 1RT1A 3QETA 2G8IA 3PV8A 1RDBA 3I8DA 1W0HA 1B9DA 4AHTA 1HNIA 4CJTA 1D5AA 4IFYA 3KKRA 3K5NA 3F9KA 4M3ZA 4B9SA 4L8RB 3S3NA 3I0RA 4M3UA 1XI1A 3BDPA 4XIUA 4CEEA 5KRTA 5DK5A 1JLAA 1TKZA 1NK6A 3S9HA 1U45A 4CK1A 3K58A 4CGDA 3NF8A 1SKSA 1BGXT 2P51A 3LP1A 2HNDA 4CIFA 1EX4A 3O3GA 1B9FA 1RNHA 3QEWA 3SPYA 2PYJA 2DY4A 1KFDA 4LY7A 4FJLA 1CXUA 4BWJA 4AHSA 2E6LA 4M3YA 4CJKA 3ZSXA 3TANA 4Z4CA 2IS3A 3QIPA 2A1SA 4KKOA 3OYNA 3NAEA 1MU2A 1HRHA 2FBXA 1GOAA 3AVAA 3DLRA 4CK2A 4FJXA 2O4IA 4YFUA 4DF8A 4N47A 1HQUA 2D0AA 3M8RA 3MXIA 1IKYA 4C8LA 4O4GA 5CYMA 3ZSQA 3UIQA 2QKBA 3HK2A 1YTAA 4CFCA 3OJUA 1N5YA 1IG9A 2HNYA 3V9XA 4KI6A 3AO5A 4OJRA 1SKRA 3L8BA 3D0PA 1NKBA 2BDPA 4DQIA 1TGOA 3PO5A 3VQ6A 3LP3A 1VSHA 4TSXA 2IOCA 2YHAA 1GOCA 3NF7A 2HMIA 1UWBA 3NCIA 4MQ3A 3CM6A 1NJZA 4FJKA 1EETA 5I3UA 1NK5A 4DSLA 4HTUA 4KB1A 3V1QA 1FXXA 4ZTFA 2DFEA 2HHXA 4IG0A 2YNIA 4FZXC 1ITGA 1BI4A 3AA5X 4IDKA 4E0DA 1UAXA 3VQ9A 2HVHA 1LAVA 2OPRA 3HL8A 4RG8A 4CERA 4KREA 1RT7A 1LAWA 3I0SA 3LZIA 4DTMA 4CFBA 3RR8A 2YNGA 3WNFA 1G15A 1YT3A 2Z1JA 4GW6A 3VQPA 3IAYA 1TVRA 3KKSA 5KGXA 3DLEA 4HVJA 3HSTB 1VRTA 3ZT1A 3QNNA 4RW6A 3AVGA 1RCHA 1SL2A 2OPQA 3VA0A 2PZSA 3AVCA 3RRGA 1RTDA 4Z4FA 4ELVA 3TR8A 1F21A 4DG1A 4ZTJA 1XWLA 3MXJA 4CGGA 3DOLA 3P5JA 5EU7A 1C1CA 5K14A 3V9UA 3V4IA 4FJ7A 4IKFA 3TAGA 3EZ5A 1XHZA 2EHGA 3A2FA 1SV5A 3DLKA 3TAPA 4DTNA 3U6FA 1L5UA 2HW3A 4OKEA 4CGFA 4DS5A 3LWLA 2P5OA 4B08A 1WAFA 2BE2A 2QXFA 3ZSVA 4DTSA 1NOZA 3IRXA 3VN5A 2O4GA 1Q9XA 2HHSA 1JXBA 2VG7A 4I2PA 1O1WA 4H4OA 2R7YA 4O44A 3KK3A 1VSEA 2FC0A 3SI6A 1NKCA 5D3GA 4KPYA 3DI6A 1VSFA 5J1EA 3KTQA 4E7IA 5HRRA 4FW1A 4BDYA 2P5GA 3PX0A 1ZBHA 4CIGA 1WSGA 5FROA 3TWHA 3TARA 4HCCA 1QE1A 1TKDA 4N5SA 4ZHRA 1S5JA 1ASVA 4CESA 4F4KA 4DSJA 4KFBA 1U48A 3QERA 2KW4A 3TI0A 1TK8A 2HVIA 4KTZA 2XRIA 1JLFA 3QEPA 4M3TA 4FK4A 1WSHA 2KQ2A 1RBSA 1RT2A 1BCMA 3ZSWA 3MAQA 2OZSA 2GUIA 4E3SA 1CZBA 1U47A 3VQCA 3VA3A 4LH4A 1TL1A 3AVNA 3KLGA 3SQ4A 4NCGA 5SZTA 4DTXA 3QEVA 1U4BA 1QHTA 3NBPA 1KRPA 2QKKA 3KD1E 1RT5A 1TKTA 2FBVA 4LSLA 4CFAA 2XY7A 4KV8A 3O4NA 3VQ8A 1NK7A 3MEGA 4F2SA 2F8TA 1R0AA 2HNZA 4EP5A 4N56A 3KK2A 3V9SA 4KAZA 5KI6A 4Z4IA 3AO1A 4DWIA 4CEOA 4Q5VA 4DTUA 1HNVA 4NYFA 5J2NA 3H08A 1RT3A 1BL3A 4H4MA 4FM0A 1ZYQA 2PY5A 3TAMA 1GOBA 4DLGA 4OPJA 4FJ5A 2P1JA 3T3FA 3IS9A 4BDZA 1JL1A 4DF4A 5HP1A 4QCLA 3U3YA 5JS1A 4DQRA 4M3WA 4B9MA 4CEFA 1HQEA 1JLEA 2YHBA 4FCYA 1S1WA 3VQ7A 3OY9A 4E7KA 1L3SA 1S1XA 4B9LA 3ITHA 3QESA 3IG1A 1T03A 3KD5E 4KHWA 4W5NA 1BIZA 3DRSA 1VK0A 3NGYA 4ID1A 4FLWA 4E7HA 1S6QA 4RW7A 1NJWA 4RW9A 4IG3A 4CJVA 3AVIA 4FLVA 4CE9A 4ELUA 3K5OA 2DTUA 2I5JA 1RBVA 3MXMA 3WNGA 1J53A 3TAQA 1HYSA 1C0MA 3MEDA 4FJNA 3L2UA 4CEZA 4EZ9A 3OYDA 4DU1A 3ALYA 3K59A 2KFNA 1X9MA 3OS2A 4CIEA 4KHUA 3JSMA 3SV4A 2KZZA 3V9ZA 1U49A 3NHGA 3TAEA 1KLMA 4CGJA 3OYIA 3QEIA 3SUQA 4NCAA 3V9WA 4CF9A 1REVA 1RILA 1RTHA 2XHBA 3BGRA 1LWCA 4CEDA 3SCXA 3TAFA 3V6DA 3SZ2A 5CY4A 1L3UA 4DLEA 1C6VA 4BWMA 4CJWA 1NJYA 2X78A 4RW4A 1D9DA 4HUEA 3S3MA 3ISNC 4OKKA 5DMRA 1RBRA 3AVJA 4HCBA 5CYQA 4PWDA 3C94A 2D0CA 4B9VA 1BQMA 4GVMA 2B4JA 4CEAA 4KO0A 4CJ5A 1WSIA 2YV0X 3O3HA 3QNOA 1Q9YA 2G8FA 2KFZA 1Z26A 3DRRA 4CJ3A 3OYFA 1JKHA 4LD0A 2F96A 3LPUA 5FRNA 1S9EA 3QINA 3ZCMA 1WSJA 1KVAA 4BE0A 3K2PA 1A5VA 1KVCA 3OVNA 1CXQA 2IAJA 4CJEA 5J2MA 1UOCA 1NK0A 4KB0A 1VSJA 1WAJA 1Z25A 1YVUA 3CYMA 1FK9A 2PYLA 5HRPA 3ULDA 4PY5A 1RDAA 1DTQA 3QIOA 5HBMA 2XY8A 3RRHA 5J2QA 3TABA 1WNSA 4FVMA 1N6QA 3C6UA 4ELTA 4PQUA 1VSMA 1JLCA 1WN7A 2EX3A 5KRSA 1Y97A 4KI4A 2HHVA 1RTIA 3VQAA 1SL1A 2ETJA 2X6NA 1SUQA 4IBNA 5C24A 4EP4A 3M8SA 3OYEA 4DQSA 4DTJA 2GV9A 1LWEA 1B92A 3MECA 3ZT3A 4CF1A 3HT3A 1IKXA 1BIUA 3AVMA 1TL3A 3ZT4A 5HROA 3CFRA 4G1QA 5C42A 4DSEA 4MFBA 2G8KA 2Q3SA 2YNFA 3DM2A 4B9UA 3OYJA 2X74A 3S3OA 4Z0UA 4DSIA 4AH9A 4DTPA 4BDPA 2IDOA 3B6OA 4W5TA 4CECA 3QO9A 2IGIA 3V1OA 4CK3A 3K5LA 3PX4A 1ZBUA 4FM1A 3T1AA 2ITGA 3RWUA 2BGGA 2NUBA 1J9AA 2X6SA 3HPOA 4FM2A 4AILC 3DLHA 3NH1A 1KSPA 4DS4A 4I9QA 2ZQBA 1HYZA 4WE1A 2KZMA 4FLTA 4OGEA 2VWJA 3HM9A 2HB5A 3OYGA 3EY1A 1XC9A 4FW2A 5CZ2A 2AJQA 5JS2A 1KTQA 3MEEA 4CHNA 4Q0BA 3E01A 1WLJA 1TK5A 3AVFA 3NFAA 1EXQA 3VQDA 4C8NA 3NGIA 4HHTA 4FJMA 1VSDA 3DRPA 2XY5A 5I42A 2OZMA 3CG7A 4J2BA 1WSEA 4E19A 4Y1DA 2Y1JA 1S9GA 4E7LA 4AHRA 2HHUA 4KTQA 3SV3A 5J2PA 1ASWA 3DMJA 3PY8A 4DSKA 2E6MA 3WNEA 4DMNA 4J2EA 4FZZA 1X1PA 4GMJB 2OPSA 3LANA 1UA0A 4B9NA 1J54A 1QTMA 4K8ZA 1T7PA 3CFOA 2YKNA 3C6TA 4LSNA 2WOMA 1NOYA 4KHSA 2XO7A 3AA2A 3NF9A 3AV9A 1EP4A 1TK0A 3O4QA 2B6AA 3AO2A 1DTTA 3L2WA 4JLHA 4KHNA 1C0TA 2RF2A 4R5PA 4DFMA 3THVA 4Y1CA 4FJGA 3VQQA 3KK1A 3AO3A 4W5QA 1BCOA 4CHQA 4NCBA 3HJFA 3LAMA 1K6YA 1I3AA 4AHUA 1L3TA 3ZSRA 3VQEA 4Z4GA 4J2DA 1EKEA 2RKIA 3SJJA 1NK8A 2G8VA 3K57A 4YNQA 4J2AA 3SNNA 4IFVA 2OA8A 2WONA 4AHCA 3D45A 1SL0A 1FKOA 3C95A 5SWMA 3NGZA 3KLEA 3AA3A 4LH5A 4CJLA 4FLUA 3KIOA 2IC3A 3L2VA 3SQ2A 3L2RA 1JXEA 1VSIA 3OYLA 1RBUA 1RDDA 1TKXA 2HHTA 2KTQA 2YNHA 3G0ZA 3RMBA 4FLZA 3ASMA 3OYKA 2RN2A 4CJ4A 1RT4A 3PX6A 3HVTA 2RPIA 4CJQA 3SYZA 4CHOA 3M8PA 3RMDA 2JGUA 3RTVA 4CF8A 3LZJA 3B6PA 1RT6A 4O0IA 3OS0A 4DSFA 4DFKA 4I7FA 4OVLA 4M45A 4W5RA 1C0UA 3HVRA 4OPKA 2QK9A 2HHWA 4DQPA 4AHVA 4FJJA 4OGCA 4O5BA 4PA1A 4CF2A 3OS1A 4BACA 1YTUA 2YKMA 3CQ8A 3CM5A 4M41A 4W5OA 1SKWA 1JL2A 4CJSA 1C1BA 3VQ5A 1JLGA 2ATQA 4ICLA 1QSLA 1ZBFA 3NF6A 1IKVA 3EYZA 1I39A 4OKJA 2E4LA 1RBTA 3LP0A 3RMCA 4C8OA 1LV5A 1HYVA 4NYNA 3QLHA 3OYHA 2Z1HA 4FLYA 3RR7A 4N76A 4QOZB 4B3OA 4KTWA 2XY6A 3LPTA 1RTJA 3HP6A 3JYTA 2FBYA 4FJ8A 3NH2A 1NK4A 2G8HA 1Q8IA 4N41A 1S1UA 4CHYA 4PUOA 1ZBIA 4I2QA 4CJUA 2OPPA 3U3GA 4JRQA 3LDSA 1A5WA 4I9LA 5KTQA 1S6PA 3VQBA 2VG6A 4E89A 3DLGA 1VSLA 4H8KA 3SQ0A 3VQ4A 3SQ1A 1DLOA 5KGWA 1D8YA 1HPZA 4RW8A 4DFJA 3QEXA 4JS5A 5FRMA 1VSKA 5FDLA 4CEBA 1T05A 4O55A 4JS4A 1D9FA 4KRFA 1TV6A 4FZYA 1XHXA 4FK0A 4CEQA 4FLXA 1QS4A 2Z1IA 2G8WA 5CZ1A 1KFSA 4KHYA 3HO1A 1U04A 3AVLA 3ZSOA 3V81A 2Y1IA 3NE6A 1T8EA 3O3FA 4KHQA 1HJRA 3HPHA 3KLHA 4DU4A 4E1MA 3ZT2A 2ZD1A 3L2QA 3LP2A 2G8UA 4O0JA 2A1RA 2DFFA 3NH0A 4FJHA 4K8XA 1ZBLA 4HUGA 1KLNA 3V1RA 3KLIA 4CJFA 4F3OA 4DFPA 3F73A 2VG5A 2B5JA 3AVKA 3NDKA 4HUFA 3HYFA 2JLEA 4BE1A 3AA4A 1NKEA 2OYQA 1IO2A 1C1AA 1TAQA 3ZSZA 1CZ9A 2VWKA 4FYDA 1J5OA 2BANA 1S1VA 3L3VA 5E41A 4M3XA 3HPGA 4QAGA 4B8CA 4CFDA 4CF0A 3SPZA 1ASUA 3OYCA 1L3VA 4M42A 3ZSYA 4DU3A 1WSFA 3KLFA
chains in the Genus database with same CATH superfamily
3SMPA 4M3RA 4JD2B 4BC3A 3LDQA 3ZT0A 1S1TA 4DTRA 4DTOA 5AQOA 4F8RA 4BR4A 1NK9A 1HKGA 3CFPA 4IDHA 4OLBA 4C8MA 1NG9A 3CQYA 2Z1GA 3SUOA 2DFHA 3LALA 1BQNA 1QSYA 3TU5A 4EHUA 2E2OA 4F9OA 5AQSA 4CGHA 5HRNA 4ID5A 3DLBA 5JICA 1ZBSA 4H5NA 1VQMN 3PIPL 3ULEB 2ZGZA 2LSNA 3H46O 5DM7L 4C8KA 2OANA 3KJVA 3M6GA 3PV8A 2G8IA 4YDUC 3PSIA 1HNIA 4IFYA 1YI2N 3F9KA 5EXWA 3VTIA 4XH4A 5C2FA 4JI8K 5GAGP 3MCPA 1U45A 1XUPO 1BGXT 2P51A 1EX4A 1IV0A 4LY7A 4I6MA 4BWJA 4V19S 2HF3A 4Z4CA 3QIPA 4KKOA 2A1SA 3OYNA 1MU2A 1HRHA 1QQOA 2FBXA 3AVAA 3DXMB 5AQZA 4CK2A 4DV7K 3MK6A 1NBWA 1HQUA 3CETA 3Q7CA 4C8LA 4O4GA 2PFUA 3UIQA 4BRIA 3KWIA 3FZMA 4IO9L 2QKBA 1YTAA 4CFCA 3HK2A 1N5YA 3MN9A 4H0PA 4BRDA 3RSEB 2GX9A 3V9XA 4OJRA 4WYBA 3D0PA 3PO5A 3LP3A 3C6AA 2YHAA 1GOCA 4FJKA 1EETA 4JHDB 1NK5A 2FLOA 3V1QA 4ZTFA 4FZXC 4E0DA 3SAGA 2E8AA 3VQ9A 4JK7A 3LZIA 4BR9A 4WFAL 3UKUA 4CFBA 2YNGA 1G15A 4FWNA 1YT3A 3IAYA 3E66A 1MA9B 1DEJA 3QFPA 1VRTA 4AM7A 3RRGA 4ELVA 4ZTJA 3MXJA 3P5JA 1C1CA 3B8AX 3V9UA 3THYB 4IKFA 4PHTX 3EZ5A 3DLKA 1GLFO 3SBTA 4DTNA 1U6ZA 3TAPA 1VQPN 1T6CA 4OKEA 4PKHA 2P5OA 3ZSVA 3VEVA 4BRAA 1K8KB 1YJ9N 1O1WA 2WTUA 2FC0A 1NKCA 5E26A 4DHYA 3PLAA 3O9TA 1VSFA 5C15A 1C0FA 5J1EA 3VENA 3ATVA 3IDHA 5BPLA 4FW1A 1JCEA 1ZBHA 4CZKA 5AFUH 4BRMA 1QE1A 4H0YB 3GL1A 4JKGB 1U48A 2D0PA 4ISGA 4KTZA 2NNWA 4B9QA 1WSHA 3ZSWA 3MAQA 3U8XA 1IG8A 2HHHK 2OZSA 3VQCA 3VA3A 2WBNA 5LMNK 1NMNA 3IFRA 5JLHA 3QEVA 1WB9A 1KRPA 3KD1E 2WUSA 3P38A 2FBVA 4LSLA 4KV8A 4C1NK 3J7AP 1R0AA 4EP5A 3M1FA 3JXUA 5KI6A 4Z4IA 4JKAA 4CEOA 4DTUA 4IJNA 4NYFA 5J2NA 4BY9C 4FM0A 1BL3A 3TAMA 4JI6K 4FJ5A 5HP1A 3IS9A 1JL1A 3LDLA 1SQKA 3U3YA 4FVUA 5JS1A 3NVKA 4BR7A 1S1WA 4E7KA 1S1XA 4DV5K 1NNEA 3A5LC 3KD5E 3TSQA 5AQKA 3NGYA 4FLWA 2ASMA 2I7NA 4XEIA 4RW7A 3QB0A 3HSCA 5M1NA 3VESA 4FLVA 3ZYYX 1T44A 3EEQA 4FJNA 4WQ4A 2GEMA 3MN6A 4DU1A 3K59A 2KFNA 1X9MA 3BP8A 3OS2A 5GINA 2KZZA 3CPEA 1VHXA 4BG8A 1JCGA 1IBMK 2FF6A 3GOIA 4U7BA 5H1SQ 5AQJA 4CF9A 1REVA 4H0TB 4KH4A 3BGRA 4CEDA 3SCXA 1IBLK 3SZ2A 3O9RA 1C6VA 3L4QA 4CJWA 1NJYA 2QTDA 4RW4A 4HUEA 3S3MA 4WFNL 4CZEA 1LOTB 3ISNC 1NGCA 1RBRA 4HCBA 4CZGA 1BOTO 3O3HA 1Q9YA 3QNOA 1WSIA 3DRRA 1ATRA 1KVAA 4CJEA 1NK0A 2ASOA 1VSJA 1WAJA 1YVUA 1TYQA 4IZ9A 1VQ7N 1NWKA 4YOTA 3A0IX 1RDAA 3QIOA 3C65A 2OCEA 1WNSA 4ELTA 1NGJA 1Q18A 2EX3A 2HBKA 4ILHA 3VQAA 5GAEP 1SL1A 2ETJA 2X6NA 1X9JA 4KH5A 3HT3A 3AVMA 3CQXA 1HLUA 3DM2A 4B9UA 3OYJA 3UB5A 4Z0UA 3PIOL 3KZBA 2ZJPL 2PBDA 1OVQA 3CCJN 3QO9A 4CK3A 4FM1A 1EQYA 3HI0A 1YJWN 3U4LA 3SBGA 2KZMA 4FLTA 1XC9A 1KTQA 1TUYA 3ZX0A 3AVFA 4FJMA 4DV2K 3O5BA 4E19A 4G9ZA 4AHRA 4KBOA 1ASWA 3DMJA 2E6MA 4FZZA 4O8KA 4GMJB 1QTMA 2HMPA 1KQSM 2V7YA 5BREA 3AV9A 3O4QA 2QEXN 3EKUA 1C0TA 4DFMA 3VQQA 4CHQA 3EKSA 3AGRA 1NJIO 2RKIA 4ISFA 3W0LA 3P31A 3K57A 2A6AA 3SNNA 2WONA 2AP1A 1E3MA 3UKRA 1SL0A 3C95A 3KLEA 2HBMA 2GWJA 3WXIA 3L2RA 4JEPA 1RBUA 1DGKN 2YNHA 3N4PA 3OYKA 3ZLJA 3L0QA 1RT4A 2P9KB 3ID6A 4CJQA 3M8PA 2JGUA 3RTVA 4CF8A 1GLLO 1RT6A 2VYPA 1VQNN 3CF5L 1C0UA 3UE5A 4FJJA 4IEIA 3OS1A 2YKMA 1XMQK 4M41A 1SKWA 1JL2A 4CJSA 1C1BA 1JLGA 3RVCA 4RTFD 1ZBFA 1QSLA 3EYZA 4OKJA 1RBTA 3RMCA 3QMLA 1LV5A 5EX5A 2XY6A 3LPTA 4A59A 3NH2A 5FLXO 1NK4A 1Q8IA 1N8RO 1S1UA 3D2FA 3CC2N 1ZBIA 3HRGA 5KQDA 3U3GA 4JRQA 2NRWA 3KVGA 3EO3A 3CJ7A 3VQBA 4E89A 3VQ4A 2GWKA 1WUAA 1N33K 4FPBA 1HPZA 4RW8A 5AQFA 4BRCA 1YUWA 3EL2A 1VSKA 1T05A 4FK0A 4LC9B 5GIPA 4KHYA 1BDGA 3AVLA 3CJ9A 3DXKB 2AA4A 1HJRA 3HPHA 4DU4A 3P39A 3ZT2A 3AAQA 4E1MA 3LP2A 4O0JA 4HUGA 1NGHA 3UKRB 3KLIA 2B5JA 5BRDA 3HYFA 3OW2M 1NKEA 2OYQA 4A62A 2VWKA 2Q31A 1S1VA 3SPZA 4CF0A 1ASUA 5BN9A 3HOSA 4E1JA 3CC7N 3KLFA 1IKWA 3KHYA 4E1NA 2P9NB 2VGMA 1D4XA 3L3UA 3CCSN 4X66K 1S3XA 4A5AA 1BHLA 1HKBA 3K5MA 4BQLA 5LJVA 3CCQN 2HHQA 5HL7L 3IUCA 1S72N 4FXDA 5C25A 1KC8O 3O9QA 4X64K 1LW2A 4YOWA 3OYAA 4BRPA 1VRUA 3TTDA 4CZIA 3SUPA 3RMAA 3ZETA 3AVBA 4F2RA 1RDCA 1HMVA 2D0BA 2FBTA 3THWA 5T7BA 1QSSA 3GE1A 1KCFA 3DWLA 4MDBA 3VGLA 4BE2A 2ZM6K 4OX9K 4OLAA 3HP9A 1BI4B 1X9SA 4CCHA 4CHZA 3WNHA 3QETA 3LDOA 1B9DA 2WFBA 5AQVA 3K5NA 1DKGD 3S3NA 3I0RA 4B3TK 4M3UA 4IO8A 2NRVA 3BF1A 4WQ5A 4CEEA 4FSVA 5KRTA 5DK5A 3WXKA 2P9UA 1NK6A 3R9PA 4CK1A 4L3QA 4BR0A 4QS7A 3CHWA 1B9FA 2QM1A 1RNHA 3SPYA 2E6LA 1K9MO 3ZSXA 2D4WA 2IS3A 3NAEA 4BC2A 5DM6L 5AQXA 2O4IA 3FFKB 4JI0K 3M8RA 3VF6A 3MXIA 4CZJA 2NRHA 3OJUA 2HNYA 4KI6A 2BDPA 4DQIA 1TGOA 3VQ6A 3FZHA 2Q0RA 4TSXA 3NF7A 4J8FA 3ULEA 4DSLA 2E88A 2DFEA 2FSJA 2HHXA 2YNIA 2QWPA 1ITGA 3AA5X 4LF5K 4YOUA 1UAXA 2HVHA 4IOCL 2OPRA 3K9JA 5I9EB 3I0SA 3RR8A 2ZF5O 1JJ2M 3KKSA 5KGXA 3DLEA 2A5XA 3ZT1A 1VQKN 3CCMN 1RCHA 3AY9A 1SL2A 2PZSA 3R3LA 3TR8A 1F21A 1XWLA 4FJ7A 1XNQK 3DJCA 4FWLA 3P4IA 2EHGA 3CERA 1SV5A 3U6FA 1YHQN 2HBLA 3DXMA 1WAFA 2P9UB 3VEXA 2Q36A 1JXBA 2VG7A 3O9SA 4ISEA 2KHOA 3KK3A 5D3GA 4H5VA 3RSEA 3DI6A 3EN9A 3FGUA 4M7XA 4E7IA 3MN7A 3CJCA 5AFUA 5EVZA 3L4IA 2P5GA 4CIGA 1WSGA 3TWHA 3TARA 1TKDA 4GVEA 3BZKA 4JHDA 1S5JA 4CESA 4KFBA 2KW4A 4FL9A 3TI0A 3D6RA 2XRIA 2BTFA 3VEZA 2KQ2A 4BVOA 1NJXA 4LH4A 1TL1A 3CXCM 1QZ5A 3O4NA 2HF4A 5AQUA 4EHTA 1NK7A 2E5LK 4O5FA 3V9SA 4DWIA 1W2BM 4Q5VA 1HNVA 1RT3A 4FWMA 1GOBA 3ATUA 3THYA 2P1JA 3T3FA 2BUPA 2CH6A 3I33A 4GV6A 3O1BA 4CEFA 5FPMA 4FCYA 2CH5A 4DR7K 1T03A 1K8KA 4ID1A 2YJFA 3E9LA 3BEXA 4IG3A 1QVFM 3O6WA 2DTUA 1U2VB 3MXMA 3WNGA 1BA0A 3TAQA 1HYSA 3L2UA 4EZ9A 3EE9A 3ALYA 2DPNA 1NGIA 4CIEA 4BQZA 3JSMA 4IEEA 3SV4A 4JKGA 3V9ZA 3NHGA 4CGJA 4QS8A 3QEIA 3H1QA 4NCAA 3SAFA 5F2RA 1LWCA 2QWLA 5CY4A 4NXMK 2X78A 5LY3A 2FF3B 5DMRA 4YDUA 3C94A 2V51B 1YF5L 5M1KA 2OA8A 3LM2A 4KO0A 2G8FA 2O8BB 4CJ3A 3LPUA 3QINA 1WSJA 5AQIA 4BE0A 3K2PA 5FPDA 2VQFK 2PYLA 3W3DA 1FK9A 2NZTA 3VETA 4DR5K 1YXQA 5HRPA 4PY5A 1C0GA 4BR5A 5HBMA 3TABA 1N6QA 3C6UA 2ZWHA 3GBTA 1VSMA 2CGKA 4DR4K 3H45C 1JLCA 1SZ2A 1TUUA 4PL7A 4WCEL 3HZ6A 4DQSA 2GV9A 3ZT3A 5C42A 4DSEA 4MFBA 3VEOA 2X74A 3S3OA 4H0OA 2YI1A 3AGKA 3QBWA 4AH9A 3B6OA 1OVYA 2W41A 2YX6A 4W5TA 3CC4N 2Q2RA 5M1OA 3V1OA 4IWVA 3K5LA 1ZBUA 1M90O 5CHIA 3DLHA 4DS4A 1HYZA 4WE1A 3CMEN 3R8EA 4GKJK 1GLAG 2HB5A 3OYGA 5CZ2A 5JS2A 1IJJA 3MEEA 3QBXA 1N34K 1EXQA 3VQDA 3VTHA 1VSDA 2XY5A 3HM8A 5I42A 2OZMA 3WUHA 1S9GA 4H0VB 1E4FT 2HHUA 5J2PA 4J2EA 1X1PA 4B9NA 2OPSA 3CFOA 3SJHA 2WOMA 4KHSA 2Q0UA 4WQ4C 1EP4A 1Q82O 3AO2A 3L2WA 1DTTA 4KHPK 3THVA 2UU9K 1BCOA 2J4RA 3CJBA 5C12A 1HPMA 4K41A 3LAMA 4M63C 4CBWA 1K6YA 2E2NA 3VQEA 4J2DA 3SJJA 2P9LB 3FZKA 4J2AA 1NGEA 3D45A 5SWMA 3O80A 3L2VA 4JKCA 1JXEA 1VSIA 2UXCK 2HHTA 5AQQA 1YJNN 3ASMA 4CJ4A 4Y0WA 4CHOA 3ZEUB 3T1HK 4O0IA 4JKHA 1Z05A 3PSFA 4CD3A 4OPKA 1GLBG 2NRZA 3CQ8A 3CM5A 3TTFA 4DR1K 1T6DA 2E4LA 3AARA 3MWTA 1HYVA 3QLHA 4LFAK 4QOZB 4B3OA 1RTJA 3JYTA 2VGNA 2G8HA 4A2BA 4MLHA 4N41A 4CHYA 2UUCK 1A5WA 1NGGA 4I9LA 1S6PA 2VG6A 1VSLA 4JK8A 3SQ0A 3SQ1A 1NGFA 4C23A 3QEXA 4GKKK 4JS4A 1D9FA 4KRFA 2A3ZA 4B1WB 1TV6A 1HNZK 4FZYA 4CEQA 4FLXA 2G8WA 2Z1IA 1IBKK 1T8EA 3KLHA 2P9KA 3WEEB 4DV1K 1KLNA 3V1RA 4CJFA 4F3OA 4DFPA 3H1VX 3F73A 2O8CB 3AVKA 2P9IB 3NDKA 2JLEA 4BE1A 1IO2A 1TAQA 2QWRA 2UUBK 3O08A 3L3VA 3E9OA 4B8CA 3CI5A 4DU3A 4FK2A 2F8SA 1W9HA 4CJPA 5C10A 4BVPA 5KQ8A 3FFIA 4JI1K 5HRSA 3T1YK 1JLQA 1O13A 2VQEK 4CGIA 4JKDA 2QI2A 2GBZA 1ESVA 3G10A 2GUPA 3PO4A 5TKWA 4BGAA 3OJSA 4Z4HA 4FWPA 5LMUK 4B3RK 4CJRA 3CIPA 3OYMA 1XMOK 2IVPA 3DOKA 1Z6RA 4JRPA 1VQ4N 3OYBA 4GV9A 3CCRN 3DXKA 4E7JA 3P1GA 2O8EB 2D5RA 1SAZA 5HLFA 3PUFA 5ADXH 1JLBA 1WOQA 4JI3K 1BISA 3H6EA 1HKCA 2I7PA 5EOYA 4GY2B 4C1NI 3P83D 1RT1A 1RDBA 4BRNA 4CJTA 3THXB 1D5AA 3MX2A 3KKRA 4IXCA 2ZJRL 4B9SA 1XI1A 3BUZB 3VF4A 1ATNA 2YHWA 4XH5A 3BDPA 4XIUA 4FWKA 1NU0A 2P9NA 3S9HA 4DR6K 4CGDA 1T3VA 3NF8A 1SKSA 3LP1A 4CIFA 3O3GA 3QEWA 2PYJA 1V4TA 3S41A 2DY4A 1KFDA 4FJLA 1QQMA 3TANA 4BC5A 4ILGB 1BG3A 2F9WA 3OBWA 1GLDG 1K8AO 2NRXA 4RWTA 3MCAB 1SKRA 3U9ZA 2QA4N 2H3GX 5KPZA 2F9TA 1UWBA 2HMIA 1NGAA 3CM6A 1H1VA 4HTUA 1FXXA 2ASPA 3BF3A 1BI4A 3ENOA 4IDKA 5AQGA 4RG8A 4KREA 4DTMA 3WNFA 4GW6A 3T7ZA 3VQPA 4LF6K 1HNXK 4X65K 3HSTB 3AVGA 3GG4A 3OBYA 3AVCA 1RTDA 4Z4FA 4NXNK 2NLXA 3DOLA 4JKEA 5EU7A 5K14A 5JMVA 3LL3A 3V4IA 4MLEA 1XHZA 1EWQA 2HW3A 3SLCA 4CGFA 1GLCG 3LWLA 4B08A 2BE2A 1FJGK 4DTSA 1NOZA 4FWQA 1Q9XA 2O4GA 4H4OA 2R7YA 1BU6O 4O44A 3HOTA 1VSEA 3SI6A 4DV6K 3KTQA 5C0YA 5HRRA 5FPNA 2D0OA 4WFBL 4HCCA 4N5SA 4DKWA 4DV0K 1ASVA 5CR4A 4DSJA 2O8DA 1Q7YO 4JI4K 3WQTA 4M3TA 1RBSA 4MO5A 3WXMB 4E3SA 3AVNA 4JK9A 3IMXA 3KLGA 4NCGA 4DTXA 1U4BA 1OH5A 4FJ8A 1QHTA 3NBPA 2QKKA 4FWSA 1RT5A 1TKTA 2GELA 3VQ8A 2F8TA 5BRFA 4BG9A 2D1KA 4N56A 1ATSA 2E1ZA 3H08A 4LFBK 4DLGA 4B1VA 1HJOA 4BDZA 4DF4A 4WF9L 3K0SA 4DQRA 4M3WA 4B9MA 3HBTA 1EO1A 1HQEA 1JLEA 2YHBA 2VCPA 1L3SA 1BWFO 4B9LA 3ITHA 3QESA 4KHWA 4W5NA 1BIZA 3DRSA 3OTOK 2FSNA 4E7HA 1S6QA 4RW9A 5TKYA 4GNIA 3AVIA 4FWRA 4CE9A 2HSTA 2I5JA 2QWMA 2JWKA 1RBVA 4B3SK 1J53A 1C0MA 3MEDA 4CEZA 3OYDA 1U49A 1KLMA 4AF1A 4OPHA 4RCHA 5AZIA 3V6DA 3TAFA 4DLEA 4BWMA 1D9DA 2EWSA 1NGBA 2UXBK 3BY5A 4BRHA 2E2PA 3AVJA 2O8DB 2D0CA 4GVMA 4FJXA 2B4JA 4CEAA 2YV0X 2KFZA 5FRNA 1JKHA 3MWPA 1S9EA 3ZCMA 5B8HA 3T69A 4IOXA 1KVCA 2E20A 1CXQA 2IAJA 5J2MA 4IOAL 4KB0A 3CYMA 4BRKA 2P9SB 2QWOA 4DUZK 1DTQA 4OPAA 2XY8A 4FVMA 2W6LA 5KRSA 4KI4A 2FSKA 4EFHA 1SUQA 4IBNA 1U2VA 1RDWX 1LWEA 4OO1J 3MECA 2BH1A 4K42A 4CF1A 3ZT4A 1TL3A 4YHHK 1N32K 4G1QA 2G8KA 2Q3SA 2YNFA 2W6KA 4GV3A 4DSIA 3M3ZA 4BDPA 2UYTA 2QW9A 4IFEA 4CI6A 1N36K 2OTLN 1LCUA 2IGIA 2BGGA 1OH7A 2Q97A 3GDQA 1VQ9N 2X6SA 4AILC 4I9QA 4DB3A 3G6EN 2ZQBA 5KPTA 5A2QO 4JAXA 2VWJA 3HM9A 3MX5A 4FW2A 2AJQA 3E01A 2O8BA 3R1XA 4MO4A 3NGIA 1R59O 5AZIB 1I94K 1NLVA 1WSEA 4Y1DA 4BR2A 2Y1JA 2YHYA 2NRTA 3SV3A 4JN4A 3PY8A 3EE8A 4H5WA 3WNEA 4X62K 3LANA 1J54A 1T7PA 1NOYA 1VQ6N 3I56N 2XO7A 3AA2A 3NF9A 2QXLA 1TK0A 2B6AA 4JLHA 4KHNA 4R5PA 3NVMA 2P9PB 4Y1CA 4FJGA 3KK1A 3AO3A 4W5QA 1YIJN 1JCFA 4NCBA 3E1YA 3VGMA 1L3TA 3ZSRA 1NK8A 2G8VA 3J81O 4K43A 4IFVA 3VEWA 4AHCA 4JKBA 3NGZA 3CPWM 3SQ2A 3E9PA 4H0XB 1YITN 4JI2K 4BRLA 1FW6A 4FLZA 3WXJA 3PX6A 3HVTA 2RPIA 3SYZA 1W7AA 3CCEN 3A5MC 4YOYA 4DFKA 4OVLA 4M45A 4W5RA 3HVRA 1ZC6A 3R6MA 4OGCA 3WQUA 4CZHA 4BACA 4JKFA 3ENHA 5FPEA 3K9KA 4FWOA 4PKIA 1QVGM 3NF6A 3KWGA 1I39A 3VF2A 3LP0A 4NYNA 3OYHA 4KTWA 3HP6A 5AR0A 2ITMA 4BC4A 3FZLA 3A5OC 5EY4A 5GADP 5GIOA 4LF9K 3TTCA 1DLOA 5IT9O 2YCHA 4BROA 1D8YA 2P9LA 5FRMA 5FDLA 4CEBA 4YOXA 4A2AA 1WBBA 5CZ1A 5AQTA 1BUPA 3HO1A 3ZSOA 4HTLA 3V81A 1WBDA 3NE6A 3O3FA 1KAYA 4DR2K 3O1WA 1BO5O 2ZD1A 3L2QA 3ZEUA 2A1RA 2DFFA 5IWAK 5MLCQ 1ZBLA 3J8AA 3H3OB 1HNWK 3FE1A 2VWBA 1CZ9A 1VQON 1L3VA 4M42A 3ULDA 1WSFA 3AO4A 5JVGL 4Z4EA 3HXMA 4FJIA 3T19A 1V4SA 4B9TA 4O8UA 4DQQA 1TAUA 3LWMA 4HWIA 5AQYA 3VOVA 5BPMA 5F0XA 4I6MB 3H3NO 5AJ3K 1QQCA 4LF8K 1KVBA 3I8BA 4FJ9A 1ILYA 4BGBA 2CGJA 2PAVA 4UQGA 3AVHA 4DV4K 4CZMA 3LAKA 3SK3A 4F3TA 1FKPA 3FLCO 3ID8A 2W42A 1LWFA 1HX1A 1LW0A 4EZ6A 5ADXA 1UA1A 3FR0A 3WEEA 3O8MA 1IH7A 4CBUA 5KPRA 1A5XA 2ZE2A 4CHPA 1X9WA 3TSPA 2E2QA 3J80O 3M8QA 2JWLA 3BZCA 4CD1A 3SUNA 4CBXA 2O8CA 3DYAA 4B8AB 2P9IA 3I8DA 1W0HA 4AHTA 3UKUB 3CCUN 5LJWA 1XNRK 4M3ZA 4EIAA 4L8RB 2NRRA 3CCVN 2IIRA 3AAPA 1JLAA 1TKZA 4KH6A 3G4SN 3K58A 4BRFA 4YORA 2HNDA 3DAWA 1CXUA 4AHSA 4M3YA 4CJKA 4BREA 5F1XA 1GOAA 3DLRA 5ELZA 3MMVA 4B1XB 4YFUA 4N47A 4DF8A 4DUYK 2D0AA 4M7YA 1IKYA 1QZ6A 5CYMA 3ZSQA 4CVNE 3QFUA 3CJ1A 5AQPA 1IG9A 4UY8O 3AO5A 3L8BA 1NKBA 4H5RA 2O8EA 4DR3K 1VSHA 3VMFB 2IOCA 3TSUA 3NCIA 1SS6A 4MQ3A 1NJZA 5I3UA 1P8ZA 4KB1A 1S22A 3SMSA 4U67L 4IG0A 3ZX3A 4CJ7A 1LAVA 3HL8A 4CERA 4PL8A 1RT7A 1LAWA 4A61A 3THXA 3MDQA 3O9UA 4JI5K 1KAZA 2Z1JA 3MN5A 1P90A 1TVRA 4BRGA 2YHXA 4HVJA 4YOVA 3QNNA 4RW6A 2OPQA 3VA0A 4NO7A 4LF4K 4DG1A 4CZLA 1XC3A 4CGGA 3SAHA 3VEYA 3TAGA 1YVNA 3A2FA 1L5UA 3IKMA 3DLLL 4DS5A 2QXFA 3IRXA 3VN5A 2HHSA 2QWNA 1X3NA 4I2PA 3JS6A 5GAHP 1MWMA 4AM6A 4KPYA 4EAHD 2F7TA 4BDYA 4DV3K 3PX0A 5FROA 1RFQA 2RE2A 4ZHRA 4F4KA 3ZX2A 5AQNA 4FPAA 4CW7B 3QERA 1TK8A 2HVIA 3QEPA 4B3MK 1JLFA 4FK4A 1RT2A 1BCMA 4JNEA 3D2EA 2GUIA 1CZBA 3QICA 1U47A 3PX4A 3SQ4A 4KAZA 5CE3A 5SZTA 1OH6A 1BA1A 4F2SA 4CFAA 2XY7A 2RHKA 3MEGA 3WT0A 2HNZA 3KK2A 1J6ZA 3AO1A 3L6QA 1W97L 5AZJA 4H4MA 1ZYQA 2PY5A 4OPJA 5AQLA 4QCLA 4K25A 1X3MA 1NMDA 1RGIA 1TYQB 4B1YB 3LM9A 3VQ7A 3OY9A 3F5TA 3IG1A 4JV5K 1VK0A 1ZXOA 1NJWA 1Q81O 4CJVA 2V52B 4ELUA 2HOEA 1K73O 3K5OA 2KKZA 2UUAK 1KXPA 1DT9A 1NM1A 4KHUA 2GTDA 3TAEA 3N4QA 3G71N 3OYIA 3SUQA 1MWKA 4DQ8A 2W40A 3V9WA 3CJAA 3LDNA 1RILA 1RTHA 2XHBA 1L3UA 4LF7K 1E4GT 5JVHL 1KAXA 2YJEA 4H5TA 3I55N 4OKKA 5CYQA 3CMAN 4B9VA 1BQMA 4CJ5A 3TPQA 3F9MA 1Z26A 3OYFA 4LD0A 3O4WA 2F96A 2Q1NA 2HBJA 2KLAA 1A5VA 3OVNA 3D2EB 4H03B 1UOCA 5LL6Z 4FO0A 1Z25A 2CGLA 1J5EK 4MDAA 3OHRA 3RRHA 5J2QA 2QWQA 4PQUA 1WN7A 1Y97A 5M1PA 5AZJB 2HHVA 1RTIA 3A5NC 4DTJA 3M8SA 4NB4A 5C24A 4EP4A 4DFJA 4PWDA 3OYEA 1B92A 1IKXA 1BIUA 5HROA 1CLQA 3CFRA 4R79A 4NLBA 1MDUB 3LDPA 5M1QA 3U9DA 4DTPA 2IDOA 4K0KK 4CECA 4A5BA 3RWUA 3T1AA 2ITGA 4Z94A 3CD6N 2NUBA 1J9AA 3HPOA 4FM2A 3NH1A 1KSPA 3HTVA 1NGDA 2E1YA 3M5RA 2UXDK 4OGEA 4JYAK 3EY1A 5M1FA 2OTJN 1OKJA 4Q0BA 4CHNA 3C7NA 1WLJA 1TK5A 1YAGA 3OA9A 3NFAA 4C8NA 4HHTA 4WQ5C 3DRPA 5BN8A 3CG7A 4J2BA 2V7ZA 4E7LA 2P9SA 4KTQA 4DSKA 2A42A 4DMNA 3J7YP 4PKGA 1CZAN 3EZWA 1UA0A 5HOOA 4FOIA 4K8ZA 3CCLN 2YKNA 3C6TA 4LSNA 3NMUA 2RF2A 3QDKA 1GLEG 3J7ZO 3D2FB 3Q7BA 3JAMO 4ILJA 3HJFA 5AQWA 4NLCA 1I3AA 4AHUA 4Z4GA 1QQNA 1EKEA 2FXUA 4A57A 2A40A 4YNQA 1FKOA 2ZJQL 3G25A 3AA3A 4LH5A 4CJLA 4FLUA 1Q86O 3KIOA 2IC3A 3KK7A 2O8FA 5AQHA 3OYLA 1RDDA 1TKXA 5C2DA 2KTQA 3G0ZA 3C0BA 3RMBA 1VAZA 1M1KO 4IJAA 2RN2A 4AQYK 5AQRA 3RMDA 4XH1A 3LZJA 1G99A 3B6PA 4FOEA 3OS0A 4DSFA 4I7FA 3F2KA 1VQ5N 4JD2A 1QHAA 2HHWA 2QK9A 4DQPA 1Y64A 4AHVA 1HR0K 4O5BA 4PA1A 4CF2A 1YTUA 4W5OA 5AQMA 3C6HA 3VQ5A 2ATQA 4ICLA 3VGKA 1IKVA 1EWRA 4C8OA 3C7NB 4FLYA 2Z1HA 4N76A 2FBYA 2ZGYA 1KD1O 2P9PA 4PUOA 4I2QA 4CJUA 2OPPA 3D7EO 3LDSA 2F4VK 4LFCK 5KTQA 1OH8A 3A8YA 5E84A 1RDUA 3DLGA 4H8KA 4B1ZA 5KGWA 3FZFA 5BRHA 4JS5A 1VQLN 5BR9A 2IVNA 4O55A 2WC9A 4DCHA 4QS9A 1XHXA 3WXLA 1QS4A 1HUXA 1KFSA 1U04A 3ZETB 2Y1IA 4JI7K 4KHQA 3THWB 3VERA 5JLFA 2G8UA 1GLJO 5BR8K 3NH0A 1VQ8N 5BPNA 4CZFA 4FJHA 4K8XA 1XQSC 3ENBA 2VG5A 4HUFA 2O8FB 3AA4A 1C1AA 3ZSZA 4FYDA 4B1UB 1J5OA 2BANA 5E41A 4M3XA 2IVOA 3HPGA 4QAGA 3VPZA 4BRQA 2A41A 4CFDA 3OYCA 4YY3K 3ZSYA 3RR7A
chains in the Genus database with same CATH topology
3AO4A 4FK2A 1IKWA 2F8SA 4Z4EA 4M3RA 4E1NA 3HXMA 1W9HA 3T19A 4CJPA 4FJIA 4B9TA 3FFIA 3L3UA 3ZT0A 1S1TA 5HRSA 4DTRA 1JLQA 4DQQA 4DTOA 4CGIA 1TAUA 3LWMA 2GBZA 4F8RA 1NK9A 3G10A 3PO4A 1BHLA 3K5MA 3CFPA 1QQCA 3OJSA 4Z4HA 2HHQA 4OLBA 1KVBA 4FJ9A 4C8MA 4CJRA 4UQGA 4FXDA 5C25A 2Z1GA 3AVHA 3OYMA 3SUOA 3LAKA 3DOKA 2DFHA 3LALA 1FKPA 4F3TA 4JRPA 1LW2A 1BQNA 1QSYA 3OYAA 3OYBA 2W42A 1VRUA 3SUPA 1LWFA 4CGHA 3RMAA 4E7JA 3AVBA 3P1GA 1LW0A 5HRNA 2D5RA 4ID5A 5HLFA 3DLBA 4EZ6A 4F2RA 1RDCA 1HMVA 2D0BA 2FBTA 3PUFA 1UA1A 5T7BA 1QSSA 1IH7A 1KCFA 1NJXA 1JLBA 4BE2A 1A5XA 2ZE2A 4CHPA 1X9WA 1CLQA 2LSNA 4OLAA 3M8QA 1BISA 4C8KA 3HP9A 1BI4B 1X9SA 3KJVA 4CCHA 4CHZA 3SUNA 3DYAA 4B8AB 3P83D 3WNHA 1RT1A 3QETA 2G8IA 3PV8A 1RDBA 3I8DA 1W0HA 1B9DA 4AHTA 1HNIA 4CJTA 1D5AA 4IFYA 3KKRA 3K5NA 3F9KA 4M3ZA 4B9SA 4L8RB 3S3NA 3I0RA 4M3UA 1XI1A 3BDPA 4XIUA 4CEEA 5KRTA 5DK5A 1JLAA 1TKZA 1NK6A 3S9HA 1U45A 4CK1A 3K58A 4CGDA 3NF8A 1SKSA 1BGXT 2P51A 3LP1A 2HNDA 4CIFA 1EX4A 3O3GA 1B9FA 1RNHA 3QEWA 3SPYA 2PYJA 2DY4A 1KFDA 4LY7A 4FJLA 1CXUA 4BWJA 4AHSA 2E6LA 4M3YA 4CJKA 3ZSXA 3TANA 4Z4CA 2IS3A 3QIPA 2A1SA 4KKOA 3OYNA 3NAEA 1MU2A 1HRHA 2FBXA 1GOAA 3AVAA 3DLRA 4CK2A 4FJXA 2O4IA 4YFUA 4DF8A 4N47A 1HQUA 2D0AA 3M8RA 3MXIA 1IKYA 4C8LA 4O4GA 5CYMA 3ZSQA 3UIQA 2QKBA 3HK2A 1YTAA 4CFCA 3OJUA 1N5YA 1IG9A 2HNYA 3V9XA 4KI6A 3AO5A 4OJRA 1SKRA 3L8BA 3D0PA 1NKBA 2BDPA 4DQIA 1TGOA 3PO5A 3VQ6A 3LP3A 1VSHA 4TSXA 2IOCA 2YHAA 1GOCA 3NF7A 2HMIA 1UWBA 3NCIA 4MQ3A 3CM6A 1NJZA 4FJKA 1EETA 5I3UA 1NK5A 4DSLA 4HTUA 4KB1A 3V1QA 1FXXA 4ZTFA 2DFEA 2HHXA 4IG0A 2YNIA 4FZXC 1ITGA 1BI4A 3AA5X 4IDKA 4E0DA 1UAXA 3VQ9A 2HVHA 1LAVA 2OPRA 3HL8A 4RG8A 4CERA 4KREA 1RT7A 1LAWA 3I0SA 3LZIA 4DTMA 4CFBA 3RR8A 2YNGA 3WNFA 1G15A 1YT3A 2Z1JA 4GW6A 3VQPA 3IAYA 1TVRA 3KKSA 5KGXA 3DLEA 4HVJA 3HSTB 1VRTA 3ZT1A 3QNNA 4RW6A 3AVGA 1RCHA 1SL2A 2OPQA 3VA0A 2PZSA 3AVCA 3RRGA 1RTDA 4Z4FA 4ELVA 3TR8A 1F21A 4DG1A 4ZTJA 1XWLA 3MXJA 4CGGA 3DOLA 3P5JA 5EU7A 1C1CA 5K14A 3V9UA 3V4IA 4FJ7A 4IKFA 3TAGA 3EZ5A 1XHZA 2EHGA 3A2FA 1SV5A 3DLKA 3TAPA 4DTNA 3U6FA 1L5UA 2HW3A 4OKEA 4CGFA 4DS5A 3LWLA 2P5OA 4B08A 1WAFA 2BE2A 2QXFA 3ZSVA 4DTSA 1NOZA 3IRXA 3VN5A 2O4GA 1Q9XA 2HHSA 1JXBA 2VG7A 4I2PA 1O1WA 4H4OA 2R7YA 4O44A 3KK3A 1VSEA 2FC0A 3SI6A 1NKCA 5D3GA 4KPYA 3DI6A 1VSFA 5J1EA 3KTQA 4E7IA 5HRRA 4FW1A 4BDYA 2P5GA 3PX0A 1ZBHA 4CIGA 1WSGA 5FROA 3TWHA 3TARA 4HCCA 1QE1A 1TKDA 4N5SA 4ZHRA 1S5JA 1ASVA 4CESA 4F4KA 4DSJA 4KFBA 1U48A 3QERA 2KW4A 3TI0A 1TK8A 2HVIA 4KTZA 2XRIA 1JLFA 3QEPA 4M3TA 4FK4A 1WSHA 2KQ2A 1RBSA 1RT2A 1BCMA 3ZSWA 3MAQA 2OZSA 2GUIA 4E3SA 1CZBA 1U47A 3VQCA 3VA3A 4LH4A 1TL1A 3AVNA 3KLGA 3SQ4A 4NCGA 5SZTA 4DTXA 3QEVA 1U4BA 1QHTA 3NBPA 1KRPA 2QKKA 3KD1E 1RT5A 1TKTA 2FBVA 4LSLA 4CFAA 2XY7A 4KV8A 3O4NA 3VQ8A 1NK7A 3MEGA 4F2SA 2F8TA 1R0AA 2HNZA 4EP5A 4N56A 3KK2A 3V9SA 4KAZA 5KI6A 4Z4IA 3AO1A 4DWIA 4CEOA 4Q5VA 4DTUA 1HNVA 4NYFA 5J2NA 3H08A 1RT3A 1BL3A 4H4MA 4FM0A 1ZYQA 2PY5A 3TAMA 1GOBA 4DLGA 4OPJA 4FJ5A 2P1JA 3T3FA 3IS9A 4BDZA 1JL1A 4DF4A 5HP1A 4QCLA 3U3YA 5JS1A 4DQRA 4M3WA 4B9MA 4CEFA 1HQEA 1JLEA 2YHBA 4FCYA 1S1WA 3VQ7A 3OY9A 4E7KA 1L3SA 1S1XA 4B9LA 3ITHA 3QESA 3IG1A 1T03A 3KD5E 4KHWA 4W5NA 1BIZA 3DRSA 1VK0A 3NGYA 4ID1A 4FLWA 4E7HA 1S6QA 4RW7A 1NJWA 4RW9A 4IG3A 4CJVA 3AVIA 4FLVA 4CE9A 4ELUA 3K5OA 2DTUA 2I5JA 1RBVA 3MXMA 3WNGA 1J53A 3TAQA 1HYSA 1C0MA 3MEDA 4FJNA 3L2UA 4CEZA 4EZ9A 3OYDA 4DU1A 3ALYA 3K59A 2KFNA 1X9MA 3OS2A 4CIEA 4KHUA 3JSMA 3SV4A 2KZZA 3V9ZA 1U49A 3NHGA 3TAEA 1KLMA 4CGJA 3OYIA 3QEIA 3SUQA 4NCAA 3V9WA 4CF9A 1REVA 1RILA 1RTHA 2XHBA 3BGRA 1LWCA 4CEDA 3SCXA 3TAFA 3V6DA 3SZ2A 5CY4A 1L3UA 4DLEA 1C6VA 4BWMA 4CJWA 1NJYA 2X78A 4RW4A 1D9DA 4HUEA 3S3MA 3ISNC 4OKKA 5DMRA 1RBRA 3AVJA 4HCBA 5CYQA 4PWDA 3C94A 2D0CA 4B9VA 1BQMA 4GVMA 2B4JA 4CEAA 4KO0A 4CJ5A 1WSIA 2YV0X 3O3HA 3QNOA 1Q9YA 2G8FA 2KFZA 1Z26A 3DRRA 4CJ3A 3OYFA 1JKHA 4LD0A 2F96A 3LPUA 5FRNA 1S9EA 3QINA 3ZCMA 1WSJA 1KVAA 4BE0A 3K2PA 1A5VA 1KVCA 3OVNA 1CXQA 2IAJA 4CJEA 5J2MA 1UOCA 1NK0A 4KB0A 1VSJA 1WAJA 1Z25A 1YVUA 3CYMA 1FK9A 2PYLA 5HRPA 3ULDA 4PY5A 1RDAA 1DTQA 3QIOA 5HBMA 2XY8A 3RRHA 5J2QA 3TABA 1WNSA 4FVMA 1N6QA 3C6UA 4ELTA 4PQUA 1VSMA 1JLCA 1WN7A 2EX3A 5KRSA 1Y97A 4KI4A 2HHVA 1RTIA 3VQAA 1SL1A 2ETJA 2X6NA 1SUQA 4IBNA 5C24A 4EP4A 3M8SA 3OYEA 4DQSA 4DTJA 2GV9A 1LWEA 1B92A 3MECA 3ZT3A 4CF1A 3HT3A 1IKXA 1BIUA 3AVMA 1TL3A 3ZT4A 5HROA 3CFRA 4G1QA 5C42A 4DSEA 4MFBA 2G8KA 2Q3SA 2YNFA 3DM2A 4B9UA 3OYJA 2X74A 3S3OA 4Z0UA 4DSIA 4AH9A 4DTPA 4BDPA 2IDOA 3B6OA 4W5TA 4CECA 3QO9A 2IGIA 3V1OA 4CK3A 3K5LA 3PX4A 1ZBUA 4FM1A 3T1AA 2ITGA 3RWUA 2BGGA 2NUBA 1J9AA 2X6SA 3HPOA 4FM2A 4AILC 3DLHA 3NH1A 1KSPA 4DS4A 4I9QA 2ZQBA 1HYZA 4WE1A 2KZMA 4FLTA 4OGEA 2VWJA 3HM9A 2HB5A 3OYGA 3EY1A 1XC9A 4FW2A 5CZ2A 2AJQA 5JS2A 1KTQA 3MEEA 4CHNA 4Q0BA 3E01A 1WLJA 1TK5A 3AVFA 3NFAA 1EXQA 3VQDA 4C8NA 3NGIA 4HHTA 4FJMA 1VSDA 3DRPA 2XY5A 5I42A 2OZMA 3CG7A 4J2BA 1WSEA 4E19A 4Y1DA 2Y1JA 1S9GA 4E7LA 4AHRA 2HHUA 4KTQA 3SV3A 5J2PA 1ASWA 3DMJA 3PY8A 4DSKA 2E6MA 3WNEA 4DMNA 4J2EA 4FZZA 1X1PA 4GMJB 2OPSA 3LANA 1UA0A 4B9NA 1J54A 1QTMA 4K8ZA 1T7PA 3CFOA 2YKNA 3C6TA 4LSNA 2WOMA 1NOYA 4KHSA 2XO7A 3AA2A 3NF9A 3AV9A 1EP4A 1TK0A 3O4QA 2B6AA 3AO2A 1DTTA 3L2WA 4JLHA 4KHNA 1C0TA 2RF2A 4R5PA 4DFMA 3THVA 4Y1CA 4FJGA 3VQQA 3KK1A 3AO3A 4W5QA 1BCOA 4CHQA 4NCBA 3HJFA 3LAMA 1K6YA 1I3AA 4AHUA 1L3TA 3ZSRA 3VQEA 4Z4GA 4J2DA 1EKEA 2RKIA 3SJJA 1NK8A 2G8VA 3K57A 4YNQA 4J2AA 3SNNA 4IFVA 2OA8A 2WONA 4AHCA 3D45A 1SL0A 1FKOA 3C95A 5SWMA 3NGZA 3KLEA 3AA3A 4LH5A 4CJLA 4FLUA 3KIOA 2IC3A 3L2VA 3SQ2A 3L2RA 1JXEA 1VSIA 3OYLA 1RBUA 1RDDA 1TKXA 2HHTA 2KTQA 2YNHA 3G0ZA 3RMBA 4FLZA 3ASMA 3OYKA 2RN2A 4CJ4A 1RT4A 3PX6A 3HVTA 2RPIA 4CJQA 3SYZA 4CHOA 3M8PA 3RMDA 2JGUA 3RTVA 4CF8A 3LZJA 3B6PA 1RT6A 4O0IA 3OS0A 4DSFA 4DFKA 4I7FA 4OVLA 4M45A 4W5RA 1C0UA 3HVRA 4OPKA 2QK9A 2HHWA 4DQPA 4AHVA 4FJJA 4OGCA 4O5BA 4PA1A 4CF2A 3OS1A 4BACA 1YTUA 2YKMA 3CQ8A 3CM5A 4M41A 4W5OA 1SKWA 1JL2A 4CJSA 1C1BA 3VQ5A 1JLGA 2ATQA 4ICLA 1QSLA 1ZBFA 3NF6A 1IKVA 3EYZA 1I39A 4OKJA 2E4LA 1RBTA 3LP0A 3RMCA 4C8OA 1LV5A 1HYVA 4NYNA 3QLHA 3OYHA 2Z1HA 4FLYA 3RR7A 4N76A 4QOZB 4B3OA 4KTWA 2XY6A 3LPTA 1RTJA 3HP6A 3JYTA 2FBYA 4FJ8A 3NH2A 1NK4A 2G8HA 1Q8IA 4N41A 1S1UA 4CHYA 4PUOA 1ZBIA 4I2QA 4CJUA 2OPPA 3U3GA 4JRQA 3LDSA 1A5WA 4I9LA 5KTQA 1S6PA 3VQBA 2VG6A 4E89A 3DLGA 1VSLA 4H8KA 3SQ0A 3VQ4A 3SQ1A 1DLOA 5KGWA 1D8YA 1HPZA 4RW8A 4DFJA 3QEXA 4JS5A 5FRMA 1VSKA 5FDLA 4CEBA 1T05A 4O55A 4JS4A 1D9FA 4KRFA 1TV6A 4FZYA 1XHXA 4FK0A 4CEQA 4FLXA 1QS4A 2Z1IA 2G8WA 5CZ1A 1KFSA 4KHYA 3HO1A 1U04A 3AVLA 3ZSOA 3V81A 2Y1IA 3NE6A 1T8EA 3O3FA 4KHQA 1HJRA 3HPHA 3KLHA 4DU4A 4E1MA 3ZT2A 2ZD1A 3L2QA 3LP2A 2G8UA 4O0JA 2A1RA 2DFFA 3NH0A 4FJHA 4K8XA 1ZBLA 4HUGA 1KLNA 3V1RA 3KLIA 4CJFA 4F3OA 4DFPA 3F73A 2VG5A 2B5JA 3AVKA 3NDKA 4HUFA 3HYFA 2JLEA 4BE1A 3AA4A 1NKEA 2OYQA 1IO2A 1C1AA 1TAQA 3ZSZA 1CZ9A 2VWKA 4FYDA 1J5OA 2BANA 1S1VA 3L3VA 5E41A 4M3XA 3HPGA 4QAGA 4B8CA 4CFDA 4CF0A 3SPZA 1ASUA 3OYCA 1L3VA 4M42A 3ZSYA 4DU3A 1WSFA 3KLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AO4 A;  4FK2 A;  1IKW A;  2F8S A;  4Z4E A;  4M3R A;  4E1N A;  3HXM A;  1W9H A;  3T19 A;  4CJP A;  4FJI A;  4B9T A;  3FFI A;  3L3U A;  3ZT0 A;  1S1T A;  5HRS A;  4DTR A;  1JLQ A;  4DQQ A;  4DTO A;  4CGI A;  1TAU A;  3LWM A;  2GBZ A;  4F8R A;  1NK9 A;  3G10 A;  3PO4 A;  1BHL A;  3K5M A;  3CFP A;  1QQC A;  3OJS A;  4Z4H A;  2HHQ A;  4OLB A;  1KVB A;  4FJ9 A;  4C8M A;  4CJR A;  4UQG A;  4FXD A;  5C25 A;  2Z1G A;  3AVH A;  3OYM A;  3SUO A;  3LAK A;  3DOK A;  2DFH A;  3LAL A;  1FKP A;  4F3T A;  4JRP A;  1LW2 A;  1BQN A;  1QSY A;  3OYA A;  3OYB A;  2W42 A;  1VRU A;  3SUP A;  1LWF A;  4CGH A;  3RMA A;  4E7J A;  3AVB A;  3P1G A;  1LW0 A;  5HRN A;  2D5R A;  4ID5 A;  5HLF A;  3DLB A;  4EZ6 A;  4F2R A;  1RDC A;  1HMV A;  2D0B A;  2FBT A;  3PUF A;  1UA1 A;  5T7B A;  1QSS A;  1IH7 A;  1KCF A;  1NJX A;  1JLB A;  4BE2 A;  1A5X A;  2ZE2 A;  4CHP A;  1X9W A;  1CLQ A;  2LSN A;  4OLA A;  3M8Q A;  1BIS A;  4C8K A;  3HP9 A;  1BI4 B;  1X9S A;  3KJV A;  4CCH A;  4CHZ A;  3SUN A;  3DYA A;  4B8A B;  3P83 D;  3WNH A;  1RT1 A;  3QET A;  2G8I A;  3PV8 A;  1RDB A;  3I8D A;  1W0H A;  1B9D A;  4AHT A;  1HNI A;  4CJT A;  1D5A A;  4IFY A;  3KKR A;  3K5N A;  3F9K A;  4M3Z A;  4B9S A;  4L8R B;  3S3N A;  3I0R A;  4M3U A;  1XI1 A;  3BDP A;  4XIU A;  4CEE A;  5KRT A;  5DK5 A;  1JLA A;  1TKZ A;  1NK6 A;  3S9H A;  1U45 A;  4CK1 A;  3K58 A;  4CGD A;  3NF8 A;  1SKS A;  1BGX T;  2P51 A;  3LP1 A;  2HND A;  4CIF A;  1EX4 A;  3O3G A;  1B9F A;  1RNH A;  3QEW A;  3SPY A;  2PYJ A;  2DY4 A;  1KFD A;  4LY7 A;  4FJL A;  1CXU A;  4BWJ A;  4AHS A;  2E6L A;  4M3Y A;  4CJK A;  3ZSX A;  3TAN A;  4Z4C A;  2IS3 A;  3QIP A;  2A1S A;  4KKO A;  3OYN A;  3NAE A;  1MU2 A;  1HRH A;  2FBX A;  1GOA A;  3AVA A;  3DLR A;  4CK2 A;  4FJX A;  2O4I A;  4YFU A;  4DF8 A;  4N47 A;  1HQU A;  2D0A A;  3M8R A;  3MXI A;  1IKY A;  4C8L A;  4O4G A;  5CYM A;  3ZSQ A;  3UIQ A;  2QKB A;  3HK2 A;  1YTA A;  4CFC A;  3OJU A;  1N5Y A;  1IG9 A;  2HNY A;  3V9X A;  4KI6 A;  3AO5 A;  4OJR A;  1SKR A;  3L8B A;  3D0P A;  1NKB A;  2BDP A;  4DQI A;  1TGO A;  3PO5 A;  3VQ6 A;  3LP3 A;  1VSH A;  4TSX A;  2IOC A;  2YHA A;  1GOC A;  3NF7 A;  2HMI A;  1UWB A;  3NCI A;  4MQ3 A;  3CM6 A;  1NJZ A;  4FJK A;  1EET A;  5I3U A;  1NK5 A;  4DSL A;  4HTU A;  4KB1 A;  3V1Q A;  1FXX A;  4ZTF A;  2DFE A;  2HHX A;  4IG0 A;  2YNI A;  4FZX C;  1ITG A;  1BI4 A;  3AA5 X;  4IDK A;  4E0D A;  1UAX A;  3VQ9 A;  2HVH A;  1LAV A;  2OPR A;  3HL8 A;  4RG8 A;  4CER A;  4KRE A;  1RT7 A;  1LAW A;  3I0S A;  3LZI A;  4DTM A;  4CFB A;  3RR8 A;  2YNG A;  3WNF A;  1G15 A;  1YT3 A;  2Z1J A;  4GW6 A;  3VQP A;  3IAY A;  1TVR A;  3KKS A;  5KGX A;  3DLE A;  4HVJ A;  3HST B;  1VRT A;  3ZT1 A;  3QNN A;  4RW6 A;  3AVG A;  1RCH A;  1SL2 A;  2OPQ A;  3VA0 A;  2PZS A;  3AVC A;  3RRG A;  1RTD A;  4Z4F A;  4ELV A;  3TR8 A;  1F21 A;  4DG1 A;  4ZTJ A;  1XWL A;  3MXJ A;  4CGG A;  3DOL A;  3P5J A;  5EU7 A;  1C1C A;  5K14 A;  3V9U A;  3V4I A;  4FJ7 A;  4IKF A;  3TAG A;  3EZ5 A;  1XHZ A;  2EHG A;  3A2F A;  1SV5 A;  3DLK A;  3TAP A;  4DTN A;  3U6F A;  1L5U A;  2HW3 A;  4OKE A;  4CGF A;  4DS5 A;  3LWL A;  2P5O A;  4B08 A;  1WAF A;  2BE2 A;  2QXF A;  3ZSV A;  4DTS A;  1NOZ A;  3IRX A;  3VN5 A;  2O4G A;  1Q9X A;  2HHS A;  1JXB A;  2VG7 A;  4I2P A;  1O1W A;  4H4O A;  2R7Y A;  4O44 A;  3KK3 A;  1VSE A;  2FC0 A;  3SI6 A;  1NKC A;  5D3G A;  4KPY A;  3DI6 A;  1VSF A;  5J1E A;  3KTQ A;  4E7I A;  5HRR A;  4FW1 A;  4BDY A;  2P5G A;  3PX0 A;  1ZBH A;  4CIG A;  1WSG A;  5FRO A;  3TWH A;  3TAR A;  4HCC A;  1QE1 A;  1TKD A;  4N5S A;  4ZHR A;  1S5J A;  1ASV A;  4CES A;  4F4K A;  4DSJ A;  4KFB A;  1U48 A;  3QER A;  2KW4 A;  3TI0 A;  1TK8 A;  2HVI A;  4KTZ A;  2XRI A;  1JLF A;  3QEP A;  4M3T A;  4FK4 A;  1WSH A;  2KQ2 A;  1RBS A;  1RT2 A;  1BCM A;  3ZSW A;  3MAQ A;  2OZS A;  2GUI A;  4E3S A;  1CZB A;  1U47 A;  3VQC A;  3VA3 A;  4LH4 A;  1TL1 A;  3AVN A;  3KLG A;  3SQ4 A;  4NCG A;  5SZT A;  4DTX A;  3QEV A;  1U4B A;  1QHT A;  3NBP A;  1KRP A;  2QKK A;  3KD1 E;  1RT5 A;  1TKT A;  2FBV A;  4LSL A;  4CFA A;  2XY7 A;  4KV8 A;  3O4N A;  3VQ8 A;  1NK7 A;  3MEG A;  4F2S A;  2F8T A;  1R0A A;  2HNZ A;  4EP5 A;  4N56 A;  3KK2 A;  3V9S A;  4KAZ A;  5KI6 A;  4Z4I A;  3AO1 A;  4DWI A;  4CEO A;  4Q5V A;  4DTU A;  1HNV A;  4NYF A;  5J2N A;  3H08 A;  1RT3 A;  1BL3 A;  4H4M A;  4FM0 A;  1ZYQ A;  2PY5 A;  3TAM A;  1GOB A;  4DLG A;  4OPJ A;  4FJ5 A;  2P1J A;  3T3F A;  3IS9 A;  4BDZ A;  1JL1 A;  4DF4 A;  5HP1 A;  4QCL A;  3U3Y A;  5JS1 A;  4DQR A;  4M3W A;  4B9M A;  4CEF A;  1HQE A;  1JLE A;  2YHB A;  4FCY A;  1S1W A;  3VQ7 A;  3OY9 A;  4E7K A;  1L3S A;  1S1X A;  4B9L A;  3ITH A;  3QES A;  3IG1 A;  1T03 A;  3KD5 E;  4KHW A;  4W5N A;  1BIZ A;  3DRS A;  1VK0 A;  3NGY A;  4ID1 A;  4FLW A;  4E7H A;  1S6Q A;  4RW7 A;  1NJW A;  4RW9 A;  4IG3 A;  4CJV A;  3AVI A;  4FLV A;  4CE9 A;  4ELU A;  3K5O A;  2DTU A;  2I5J A;  1RBV A;  3MXM A;  3WNG A;  1J53 A;  3TAQ A;  1HYS A;  1C0M A;  3MED A;  4FJN A;  3L2U A;  4CEZ A;  4EZ9 A;  3OYD A;  4DU1 A;  3ALY A;  3K59 A;  2KFN A;  1X9M A;  3OS2 A;  4CIE A;  4KHU A;  3JSM A;  3SV4 A;  2KZZ A;  3V9Z A;  1U49 A;  3NHG A;  3TAE A;  1KLM A;  4CGJ A;  3OYI A;  3QEI A;  3SUQ A;  4NCA A;  3V9W A;  4CF9 A;  1REV A;  1RIL A;  1RTH A;  2XHB A;  3BGR A;  1LWC A;  4CED A;  3SCX A;  3TAF A;  3V6D A;  3SZ2 A;  5CY4 A;  1L3U A;  4DLE A;  1C6V A;  4BWM A;  4CJW A;  1NJY A;  2X78 A;  4RW4 A;  1D9D A;  4HUE A;  3S3M A;  3ISN C;  4OKK A;  5DMR A;  1RBR A;  3AVJ A;  4HCB A;  5CYQ A;  4PWD A;  3C94 A;  2D0C A;  4B9V A;  1BQM A;  4GVM A;  2B4J A;  4CEA A;  4KO0 A;  4CJ5 A;  1WSI A;  2YV0 X;  3O3H A;  3QNO A;  1Q9Y A;  2G8F A;  2KFZ A;  1Z26 A;  3DRR A;  4CJ3 A;  3OYF A;  1JKH A;  4LD0 A;  2F96 A;  3LPU A;  5FRN A;  1S9E A;  3QIN A;  3ZCM A;  1WSJ A;  1KVA A;  4BE0 A;  3K2P A;  1A5V A;  1KVC A;  3OVN A;  1CXQ A;  2IAJ A;  4CJE A;  5J2M A;  1UOC A;  1NK0 A;  4KB0 A;  1VSJ A;  1WAJ A;  1Z25 A;  1YVU A;  3CYM A;  1FK9 A;  2PYL A;  5HRP A;  3ULD A;  4PY5 A;  1RDA A;  1DTQ A;  3QIO A;  5HBM A;  2XY8 A;  3RRH A;  5J2Q A;  3TAB A;  1WNS A;  4FVM A;  1N6Q A;  3C6U A;  4ELT A;  4PQU A;  1VSM A;  1JLC A;  1WN7 A;  2EX3 A;  5KRS A;  1Y97 A;  4KI4 A;  2HHV A;  1RTI A;  3VQA A;  1SL1 A;  2ETJ A;  2X6N A;  1SUQ A;  4IBN A;  5C24 A;  4EP4 A;  3M8S A;  3OYE A;  4DQS A;  4DTJ A;  2GV9 A;  1LWE A;  1B92 A;  3MEC A;  3ZT3 A;  4CF1 A;  3HT3 A;  1IKX A;  1BIU A;  3AVM A;  1TL3 A;  3ZT4 A;  5HRO A;  3CFR A;  4G1Q A;  5C42 A;  4DSE A;  4MFB A;  2G8K A;  2Q3S A;  2YNF A;  3DM2 A;  4B9U A;  3OYJ A;  2X74 A;  3S3O A;  4Z0U A;  4DSI A;  4AH9 A;  4DTP A;  4BDP A;  2IDO A;  3B6O A;  4W5T A;  4CEC A;  3QO9 A;  2IGI A;  3V1O A;  4CK3 A;  3K5L A;  3PX4 A;  1ZBU A;  4FM1 A;  3T1A A;  2ITG A;  3RWU A;  2BGG A;  2NUB A;  1J9A A;  2X6S A;  3HPO A;  4FM2 A;  4AIL C;  3DLH A;  3NH1 A;  1KSP A;  4DS4 A;  4I9Q A;  2ZQB A;  1HYZ A;  4WE1 A;  2KZM A;  4FLT A;  4OGE A;  2VWJ A;  3HM9 A;  2HB5 A;  3OYG A;  3EY1 A;  1XC9 A;  4FW2 A;  5CZ2 A;  2AJQ A;  5JS2 A;  1KTQ A;  3MEE A;  4CHN A;  4Q0B A;  3E01 A;  1WLJ A;  1TK5 A;  3AVF A;  3NFA A;  1EXQ A;  3VQD A;  4C8N A;  3NGI A;  4HHT A;  4FJM A;  1VSD A;  3DRP A;  2XY5 A;  5I42 A;  2OZM A;  3CG7 A;  4J2B A;  1WSE A;  4E19 A;  4Y1D A;  2Y1J A;  1S9G A;  4E7L A;  4AHR A;  2HHU A;  4KTQ A;  3SV3 A;  5J2P A;  1ASW A;  3DMJ A;  3PY8 A;  4DSK A;  2E6M A;  3WNE A;  4DMN A;  4J2E A;  4FZZ A;  1X1P A;  4GMJ B;  2OPS A;  3LAN A;  1UA0 A;  4B9N A;  1J54 A;  1QTM A;  4K8Z A;  1T7P A;  3CFO A;  2YKN A;  3C6T A;  4LSN A;  2WOM A;  1NOY A;  4KHS A;  2XO7 A;  3AA2 A;  3NF9 A;  3AV9 A;  1EP4 A;  1TK0 A;  3O4Q A;  2B6A A;  3AO2 A;  1DTT A;  3L2W A;  4JLH A;  4KHN A;  1C0T A;  2RF2 A;  4R5P A;  4DFM A;  3THV A;  4Y1C A;  4FJG A;  3VQQ A;  3KK1 A;  3AO3 A;  4W5Q A;  1BCO A;  4CHQ A;  4NCB A;  3HJF A;  3LAM A;  1K6Y A;  1I3A A;  4AHU A;  1L3T A;  3ZSR A;  3VQE A;  4Z4G A;  4J2D A;  1EKE A;  2RKI A;  3SJJ A;  1NK8 A;  2G8V A;  3K57 A;  4YNQ A;  4J2A A;  3SNN A;  4IFV A;  2OA8 A;  2WON A;  4AHC A;  3D45 A;  1SL0 A;  1FKO A;  3C95 A;  5SWM A;  3NGZ A;  3KLE A;  3AA3 A;  4LH5 A;  4CJL A;  4FLU A;  3KIO A;  2IC3 A;  3L2V A;  3SQ2 A;  3L2R A;  1JXE A;  1VSI A;  3OYL A;  1RBU A;  1RDD A;  1TKX A;  2HHT A;  2KTQ A;  2YNH A;  3G0Z A;  3RMB A;  4FLZ A;  3ASM A;  3OYK A;  2RN2 A;  4CJ4 A;  1RT4 A;  3PX6 A;  3HVT A;  2RPI A;  4CJQ A;  3SYZ A;  4CHO A;  3M8P A;  3RMD A;  2JGU A;  3RTV A;  4CF8 A;  3LZJ A;  3B6P A;  1RT6 A;  4O0I A;  3OS0 A;  4DSF A;  4DFK A;  4I7F A;  4OVL A;  4M45 A;  4W5R A;  1C0U A;  3HVR A;  4OPK A;  2QK9 A;  2HHW A;  4DQP A;  4AHV A;  4FJJ A;  4OGC A;  4O5B A;  4PA1 A;  4CF2 A;  3OS1 A;  4BAC A;  1YTU A;  2YKM A;  3CQ8 A;  3CM5 A;  4M41 A;  4W5O A;  1SKW A;  1JL2 A;  4CJS A;  1C1B A;  3VQ5 A;  1JLG A;  2ATQ A;  4ICL A;  1QSL A;  1ZBF A;  3NF6 A;  1IKV A;  3EYZ A;  1I39 A;  4OKJ A;  2E4L A;  1RBT A;  3LP0 A;  3RMC A;  4C8O A;  1LV5 A;  1HYV A;  4NYN A;  3QLH A;  3OYH A;  2Z1H A;  4FLY A;  3RR7 A;  4N76 A;  4QOZ B;  4B3O A;  4KTW A;  2XY6 A;  3LPT A;  1RTJ A;  3HP6 A;  3JYT A;  2FBY A;  4FJ8 A;  3NH2 A;  1NK4 A;  2G8H A;  1Q8I A;  4N41 A;  1S1U A;  4CHY A;  4PUO A;  1ZBI A;  4I2Q A;  4CJU A;  2OPP A;  3U3G A;  4JRQ A;  3LDS A;  1A5W A;  4I9L A;  5KTQ A;  1S6P A;  3VQB A;  2VG6 A;  4E89 A;  3DLG A;  1VSL A;  4H8K A;  3SQ0 A;  3VQ4 A;  3SQ1 A;  1DLO A;  5KGW A;  1D8Y A;  1HPZ A;  4RW8 A;  4DFJ A;  3QEX A;  4JS5 A;  5FRM A;  1VSK A;  5FDL A;  4CEB A;  1T05 A;  4O55 A;  4JS4 A;  1D9F A;  4KRF A;  1TV6 A;  4FZY A;  1XHX A;  4FK0 A;  4CEQ A;  4FLX A;  1QS4 A;  2Z1I A;  2G8W A;  5CZ1 A;  1KFS A;  4KHY A;  3HO1 A;  1U04 A;  3AVL A;  3ZSO A;  3V81 A;  2Y1I A;  3NE6 A;  1T8E A;  3O3F A;  4KHQ A;  1HJR A;  3HPH A;  3KLH A;  4DU4 A;  4E1M A;  3ZT2 A;  2ZD1 A;  3L2Q A;  3LP2 A;  2G8U A;  4O0J A;  2A1R A;  2DFF A;  3NH0 A;  4FJH A;  4K8X A;  1ZBL A;  4HUG A;  1KLN A;  3V1R A;  3KLI A;  4CJF A;  4F3O A;  4DFP A;  3F73 A;  2VG5 A;  2B5J A;  3AVK A;  3NDK A;  4HUF A;  3HYF A;  2JLE A;  4BE1 A;  3AA4 A;  1NKE A;  2OYQ A;  1IO2 A;  1C1A A;  1TAQ A;  3ZSZ A;  1CZ9 A;  2VWK A;  4FYD A;  1J5O A;  2BAN A;  1S1V A;  3L3V A;  5E41 A;  4M3X A;  3HPG A;  4QAG A;  4B8C A;  4CFD A;  4CF0 A;  3SPZ A;  1ASU A;  3OYC A;  1L3V A;  4M42 A;  3ZSY A;  4DU3 A;  1WSF A;  3KLF A; 
#chains in the Genus database with same CATH topology
 3SMP A;  4M3R A;  4JD2 B;  4BC3 A;  3LDQ A;  3ZT0 A;  1S1T A;  4DTR A;  4DTO A;  5AQO A;  4F8R A;  4BR4 A;  1NK9 A;  1HKG A;  3CFP A;  4IDH A;  4OLB A;  4C8M A;  1NG9 A;  3CQY A;  2Z1G A;  3SUO A;  2DFH A;  3LAL A;  1BQN A;  1QSY A;  3TU5 A;  4EHU A;  2E2O A;  4F9O A;  5AQS A;  4CGH A;  5HRN A;  4ID5 A;  3DLB A;  5JIC A;  1ZBS A;  4H5N A;  1VQM N;  3PIP L;  3ULE B;  2ZGZ A;  2LSN A;  3H46 O;  5DM7 L;  4C8K A;  2OAN A;  3KJV A;  3M6G A;  3PV8 A;  2G8I A;  4YDU C;  3PSI A;  1HNI A;  4IFY A;  1YI2 N;  3F9K A;  5EXW A;  3VTI A;  4XH4 A;  5C2F A;  4JI8 K;  5GAG P;  3MCP A;  1U45 A;  1XUP O;  1BGX T;  2P51 A;  1EX4 A;  1IV0 A;  4LY7 A;  4I6M A;  4BWJ A;  4V19 S;  2HF3 A;  4Z4C A;  3QIP A;  4KKO A;  2A1S A;  3OYN A;  1MU2 A;  1HRH A;  1QQO A;  2FBX A;  3AVA A;  3DXM B;  5AQZ A;  4CK2 A;  4DV7 K;  3MK6 A;  1NBW A;  1HQU A;  3CET A;  3Q7C A;  4C8L A;  4O4G A;  2PFU A;  3UIQ A;  4BRI A;  3KWI A;  3FZM A;  4IO9 L;  2QKB A;  1YTA A;  4CFC A;  3HK2 A;  1N5Y A;  3MN9 A;  4H0P A;  4BRD A;  3RSE B;  2GX9 A;  3V9X A;  4OJR A;  4WYB A;  3D0P A;  3PO5 A;  3LP3 A;  3C6A A;  2YHA A;  1GOC A;  4FJK A;  1EET A;  4JHD B;  1NK5 A;  2FLO A;  3V1Q A;  4ZTF A;  4FZX C;  4E0D A;  3SAG A;  2E8A A;  3VQ9 A;  4JK7 A;  3LZI A;  4BR9 A;  4WFA L;  3UKU A;  4CFB A;  2YNG A;  1G15 A;  4FWN A;  1YT3 A;  3IAY A;  3E66 A;  1MA9 B;  1DEJ A;  3QFP A;  1VRT A;  4AM7 A;  3RRG A;  4ELV A;  4ZTJ A;  3MXJ A;  3P5J A;  1C1C A;  3B8A X;  3V9U A;  3THY B;  4IKF A;  4PHT X;  3EZ5 A;  3DLK A;  1GLF O;  3SBT A;  4DTN A;  1U6Z A;  3TAP A;  1VQP N;  1T6C A;  4OKE A;  4PKH A;  2P5O A;  3ZSV A;  3VEV A;  4BRA A;  1K8K B;  1YJ9 N;  1O1W A;  2WTU A;  2FC0 A;  1NKC A;  5E26 A;  4DHY A;  3PLA A;  3O9T A;  1VSF A;  5C15 A;  1C0F A;  5J1E A;  3VEN A;  3ATV A;  3IDH A;  5BPL A;  4FW1 A;  1JCE A;  1ZBH A;  4CZK A;  5AFU H;  4BRM A;  1QE1 A;  4H0Y B;  3GL1 A;  4JKG B;  1U48 A;  2D0P A;  4ISG A;  4KTZ A;  2NNW A;  4B9Q A;  1WSH A;  3ZSW A;  3MAQ A;  3U8X A;  1IG8 A;  2HHH K;  2OZS A;  3VQC A;  3VA3 A;  2WBN A;  5LMN K;  1NMN A;  3IFR A;  5JLH A;  3QEV A;  1WB9 A;  1KRP A;  3KD1 E;  2WUS A;  3P38 A;  2FBV A;  4LSL A;  4KV8 A;  4C1N K;  3J7A P;  1R0A A;  4EP5 A;  3M1F A;  3JXU A;  5KI6 A;  4Z4I A;  4JKA A;  4CEO A;  4DTU A;  4IJN A;  4NYF A;  5J2N A;  4BY9 C;  4FM0 A;  1BL3 A;  3TAM A;  4JI6 K;  4FJ5 A;  5HP1 A;  3IS9 A;  1JL1 A;  3LDL A;  1SQK A;  3U3Y A;  4FVU A;  5JS1 A;  3NVK A;  4BR7 A;  1S1W A;  4E7K A;  1S1X A;  4DV5 K;  1NNE A;  3A5L C;  3KD5 E;  3TSQ A;  5AQK A;  3NGY A;  4FLW A;  2ASM A;  2I7N A;  4XEI A;  4RW7 A;  3QB0 A;  3HSC A;  5M1N A;  3VES A;  4FLV A;  3ZYY X;  1T44 A;  3EEQ A;  4FJN A;  4WQ4 A;  2GEM A;  3MN6 A;  4DU1 A;  3K59 A;  2KFN A;  1X9M A;  3BP8 A;  3OS2 A;  5GIN A;  2KZZ A;  3CPE A;  1VHX A;  4BG8 A;  1JCG A;  1IBM K;  2FF6 A;  3GOI A;  4U7B A;  5H1S Q;  5AQJ A;  4CF9 A;  1REV A;  4H0T B;  4KH4 A;  3BGR A;  4CED A;  3SCX A;  1IBL K;  3SZ2 A;  3O9R A;  1C6V A;  3L4Q A;  4CJW A;  1NJY A;  2QTD A;  4RW4 A;  4HUE A;  3S3M A;  4WFN L;  4CZE A;  1LOT B;  3ISN C;  1NGC A;  1RBR A;  4HCB A;  4CZG A;  1BOT O;  3O3H A;  1Q9Y A;  3QNO A;  1WSI A;  3DRR A;  1ATR A;  1KVA A;  4CJE A;  1NK0 A;  2ASO A;  1VSJ A;  1WAJ A;  1YVU A;  1TYQ A;  4IZ9 A;  1VQ7 N;  1NWK A;  4YOT A;  3A0I X;  1RDA A;  3QIO A;  3C65 A;  2OCE A;  1WNS A;  4ELT A;  1NGJ A;  1Q18 A;  2EX3 A;  2HBK A;  4ILH A;  3VQA A;  5GAE P;  1SL1 A;  2ETJ A;  2X6N A;  1X9J A;  4KH5 A;  3HT3 A;  3AVM A;  3CQX A;  1HLU A;  3DM2 A;  4B9U A;  3OYJ A;  3UB5 A;  4Z0U A;  3PIO L;  3KZB A;  2ZJP L;  2PBD A;  1OVQ A;  3CCJ N;  3QO9 A;  4CK3 A;  4FM1 A;  1EQY A;  3HI0 A;  1YJW N;  3U4L A;  3SBG A;  2KZM A;  4FLT A;  1XC9 A;  1KTQ A;  1TUY A;  3ZX0 A;  3AVF A;  4FJM A;  4DV2 K;  3O5B A;  4E19 A;  4G9Z A;  4AHR A;  4KBO A;  1ASW A;  3DMJ A;  2E6M A;  4FZZ A;  4O8K A;  4GMJ B;  1QTM A;  2HMP A;  1KQS M;  2V7Y A;  5BRE A;  3AV9 A;  3O4Q A;  2QEX N;  3EKU A;  1C0T A;  4DFM A;  3VQQ A;  4CHQ A;  3EKS A;  3AGR A;  1NJI O;  2RKI A;  4ISF A;  3W0L A;  3P31 A;  3K57 A;  2A6A A;  3SNN A;  2WON A;  2AP1 A;  1E3M A;  3UKR A;  1SL0 A;  3C95 A;  3KLE A;  2HBM A;  2GWJ A;  3WXI A;  3L2R A;  4JEP A;  1RBU A;  1DGK N;  2YNH A;  3N4P A;  3OYK A;  3ZLJ A;  3L0Q A;  1RT4 A;  2P9K B;  3ID6 A;  4CJQ A;  3M8P A;  2JGU A;  3RTV A;  4CF8 A;  1GLL O;  1RT6 A;  2VYP A;  1VQN N;  3CF5 L;  1C0U A;  3UE5 A;  4FJJ A;  4IEI A;  3OS1 A;  2YKM A;  1XMQ K;  4M41 A;  1SKW A;  1JL2 A;  4CJS A;  1C1B A;  1JLG A;  3RVC A;  4RTF D;  1ZBF A;  1QSL A;  3EYZ A;  4OKJ A;  1RBT A;  3RMC A;  3QML A;  1LV5 A;  5EX5 A;  2XY6 A;  3LPT A;  4A59 A;  3NH2 A;  5FLX O;  1NK4 A;  1Q8I A;  1N8R O;  1S1U A;  3D2F A;  3CC2 N;  1ZBI A;  3HRG A;  5KQD A;  3U3G A;  4JRQ A;  2NRW A;  3KVG A;  3EO3 A;  3CJ7 A;  3VQB A;  4E89 A;  3VQ4 A;  2GWK A;  1WUA A;  1N33 K;  4FPB A;  1HPZ A;  4RW8 A;  5AQF A;  4BRC A;  1YUW A;  3EL2 A;  1VSK A;  1T05 A;  4FK0 A;  4LC9 B;  5GIP A;  4KHY A;  1BDG A;  3AVL A;  3CJ9 A;  3DXK B;  2AA4 A;  1HJR A;  3HPH A;  4DU4 A;  3P39 A;  3ZT2 A;  3AAQ A;  4E1M A;  3LP2 A;  4O0J A;  4HUG A;  1NGH A;  3UKR B;  3KLI A;  2B5J A;  5BRD A;  3HYF A;  3OW2 M;  1NKE A;  2OYQ A;  4A62 A;  2VWK A;  2Q31 A;  1S1V A;  3SPZ A;  4CF0 A;  1ASU A;  5BN9 A;  3HOS A;  4E1J A;  3CC7 N;  3KLF A;  1IKW A;  3KHY A;  4E1N A;  2P9N B;  2VGM A;  1D4X A;  3L3U A;  3CCS N;  4X66 K;  1S3X A;  4A5A A;  1BHL A;  1HKB A;  3K5M A;  4BQL A;  5LJV A;  3CCQ N;  2HHQ A;  5HL7 L;  3IUC A;  1S72 N;  4FXD A;  5C25 A;  1KC8 O;  3O9Q A;  4X64 K;  1LW2 A;  4YOW A;  3OYA A;  4BRP A;  1VRU A;  3TTD A;  4CZI A;  3SUP A;  3RMA A;  3ZET A;  3AVB A;  4F2R A;  1RDC A;  1HMV A;  2D0B A;  2FBT A;  3THW A;  5T7B A;  1QSS A;  3GE1 A;  1KCF A;  3DWL A;  4MDB A;  3VGL A;  4BE2 A;  2ZM6 K;  4OX9 K;  4OLA A;  3HP9 A;  1BI4 B;  1X9S A;  4CCH A;  4CHZ A;  3WNH A;  3QET A;  3LDO A;  1B9D A;  2WFB A;  5AQV A;  3K5N A;  1DKG D;  3S3N A;  3I0R A;  4B3T K;  4M3U A;  4IO8 A;  2NRV A;  3BF1 A;  4WQ5 A;  4CEE A;  4FSV A;  5KRT A;  5DK5 A;  3WXK A;  2P9U A;  1NK6 A;  3R9P A;  4CK1 A;  4L3Q A;  4BR0 A;  4QS7 A;  3CHW A;  1B9F A;  2QM1 A;  1RNH A;  3SPY A;  2E6L A;  1K9M O;  3ZSX A;  2D4W A;  2IS3 A;  3NAE A;  4BC2 A;  5DM6 L;  5AQX A;  2O4I A;  3FFK B;  4JI0 K;  3M8R A;  3VF6 A;  3MXI A;  4CZJ A;  2NRH A;  3OJU A;  2HNY A;  4KI6 A;  2BDP A;  4DQI A;  1TGO A;  3VQ6 A;  3FZH A;  2Q0R A;  4TSX A;  3NF7 A;  4J8F A;  3ULE A;  4DSL A;  2E88 A;  2DFE A;  2FSJ A;  2HHX A;  2YNI A;  2QWP A;  1ITG A;  3AA5 X;  4LF5 K;  4YOU A;  1UAX A;  2HVH A;  4IOC L;  2OPR A;  3K9J A;  5I9E B;  3I0S A;  3RR8 A;  2ZF5 O;  1JJ2 M;  3KKS A;  5KGX A;  3DLE A;  2A5X A;  3ZT1 A;  1VQK N;  3CCM N;  1RCH A;  3AY9 A;  1SL2 A;  2PZS A;  3R3L A;  3TR8 A;  1F21 A;  1XWL A;  4FJ7 A;  1XNQ K;  3DJC A;  4FWL A;  3P4I A;  2EHG A;  3CER A;  1SV5 A;  3U6F A;  1YHQ N;  2HBL A;  3DXM A;  1WAF A;  2P9U B;  3VEX A;  2Q36 A;  1JXB A;  2VG7 A;  3O9S A;  4ISE A;  2KHO A;  3KK3 A;  5D3G A;  4H5V A;  3RSE A;  3DI6 A;  3EN9 A;  3FGU A;  4M7X A;  4E7I A;  3MN7 A;  3CJC A;  5AFU A;  5EVZ A;  3L4I A;  2P5G A;  4CIG A;  1WSG A;  3TWH A;  3TAR A;  1TKD A;  4GVE A;  3BZK A;  4JHD A;  1S5J A;  4CES A;  4KFB A;  2KW4 A;  4FL9 A;  3TI0 A;  3D6R A;  2XRI A;  2BTF A;  3VEZ A;  2KQ2 A;  4BVO A;  1NJX A;  4LH4 A;  1TL1 A;  3CXC M;  1QZ5 A;  3O4N A;  2HF4 A;  5AQU A;  4EHT A;  1NK7 A;  2E5L K;  4O5F A;  3V9S A;  4DWI A;  1W2B M;  4Q5V A;  1HNV A;  1RT3 A;  4FWM A;  1GOB A;  3ATU A;  3THY A;  2P1J A;  3T3F A;  2BUP A;  2CH6 A;  3I33 A;  4GV6 A;  3O1B A;  4CEF A;  5FPM A;  4FCY A;  2CH5 A;  4DR7 K;  1T03 A;  1K8K A;  4ID1 A;  2YJF A;  3E9L A;  3BEX A;  4IG3 A;  1QVF M;  3O6W A;  2DTU A;  1U2V B;  3MXM A;  3WNG A;  1BA0 A;  3TAQ A;  1HYS A;  3L2U A;  4EZ9 A;  3EE9 A;  3ALY A;  2DPN A;  1NGI A;  4CIE A;  4BQZ A;  3JSM A;  4IEE A;  3SV4 A;  4JKG A;  3V9Z A;  3NHG A;  4CGJ A;  4QS8 A;  3QEI A;  3H1Q A;  4NCA A;  3SAF A;  5F2R A;  1LWC A;  2QWL A;  5CY4 A;  4NXM K;  2X78 A;  5LY3 A;  2FF3 B;  5DMR A;  4YDU A;  3C94 A;  2V51 B;  1YF5 L;  5M1K A;  2OA8 A;  3LM2 A;  4KO0 A;  2G8F A;  2O8B B;  4CJ3 A;  3LPU A;  3QIN A;  1WSJ A;  5AQI A;  4BE0 A;  3K2P A;  5FPD A;  2VQF K;  2PYL A;  3W3D A;  1FK9 A;  2NZT A;  3VET A;  4DR5 K;  1YXQ A;  5HRP A;  4PY5 A;  1C0G A;  4BR5 A;  5HBM A;  3TAB A;  1N6Q A;  3C6U A;  2ZWH A;  3GBT A;  1VSM A;  2CGK A;  4DR4 K;  3H45 C;  1JLC A;  1SZ2 A;  1TUU A;  4PL7 A;  4WCE L;  3HZ6 A;  4DQS A;  2GV9 A;  3ZT3 A;  5C42 A;  4DSE A;  4MFB A;  3VEO A;  2X74 A;  3S3O A;  4H0O A;  2YI1 A;  3AGK A;  3QBW A;  4AH9 A;  3B6O A;  1OVY A;  2W41 A;  2YX6 A;  4W5T A;  3CC4 N;  2Q2R A;  5M1O A;  3V1O A;  4IWV A;  3K5L A;  1ZBU A;  1M90 O;  5CHI A;  3DLH A;  4DS4 A;  1HYZ A;  4WE1 A;  3CME N;  3R8E A;  4GKJ K;  1GLA G;  2HB5 A;  3OYG A;  5CZ2 A;  5JS2 A;  1IJJ A;  3MEE A;  3QBX A;  1N34 K;  1EXQ A;  3VQD A;  3VTH A;  1VSD A;  2XY5 A;  3HM8 A;  5I42 A;  2OZM A;  3WUH A;  1S9G A;  4H0V B;  1E4F T;  2HHU A;  5J2P A;  4J2E A;  1X1P A;  4B9N A;  2OPS A;  3CFO A;  3SJH A;  2WOM A;  4KHS A;  2Q0U A;  4WQ4 C;  1EP4 A;  1Q82 O;  3AO2 A;  3L2W A;  1DTT A;  4KHP K;  3THV A;  2UU9 K;  1BCO A;  2J4R A;  3CJB A;  5C12 A;  1HPM A;  4K41 A;  3LAM A;  4M63 C;  4CBW A;  1K6Y A;  2E2N A;  3VQE A;  4J2D A;  3SJJ A;  2P9L B;  3FZK A;  4J2A A;  1NGE A;  3D45 A;  5SWM A;  3O80 A;  3L2V A;  4JKC A;  1JXE A;  1VSI A;  2UXC K;  2HHT A;  5AQQ A;  1YJN N;  3ASM A;  4CJ4 A;  4Y0W A;  4CHO A;  3ZEU B;  3T1H K;  4O0I A;  4JKH A;  1Z05 A;  3PSF A;  4CD3 A;  4OPK A;  1GLB G;  2NRZ A;  3CQ8 A;  3CM5 A;  3TTF A;  4DR1 K;  1T6D A;  2E4L A;  3AAR A;  3MWT A;  1HYV A;  3QLH A;  4LFA K;  4QOZ B;  4B3O A;  1RTJ A;  3JYT A;  2VGN A;  2G8H A;  4A2B A;  4MLH A;  4N41 A;  4CHY A;  2UUC K;  1A5W A;  1NGG A;  4I9L A;  1S6P A;  2VG6 A;  1VSL A;  4JK8 A;  3SQ0 A;  3SQ1 A;  1NGF A;  4C23 A;  3QEX A;  4GKK K;  4JS4 A;  1D9F A;  4KRF A;  2A3Z A;  4B1W B;  1TV6 A;  1HNZ K;  4FZY A;  4CEQ A;  4FLX A;  2G8W A;  2Z1I A;  1IBK K;  1T8E A;  3KLH A;  2P9K A;  3WEE B;  4DV1 K;  1KLN A;  3V1R A;  4CJF A;  4F3O A;  4DFP A;  3H1V X;  3F73 A;  2O8C B;  3AVK A;  2P9I B;  3NDK A;  2JLE A;  4BE1 A;  1IO2 A;  1TAQ A;  2QWR A;  2UUB K;  3O08 A;  3L3V A;  3E9O A;  4B8C A;  3CI5 A;  4DU3 A;  4FK2 A;  2F8S A;  1W9H A;  4CJP A;  5C10 A;  4BVP A;  5KQ8 A;  3FFI A;  4JI1 K;  5HRS A;  3T1Y K;  1JLQ A;  1O13 A;  2VQE K;  4CGI A;  4JKD A;  2QI2 A;  2GBZ A;  1ESV A;  3G10 A;  2GUP A;  3PO4 A;  5TKW A;  4BGA A;  3OJS A;  4Z4H A;  4FWP A;  5LMU K;  4B3R K;  4CJR A;  3CIP A;  3OYM A;  1XMO K;  2IVP A;  3DOK A;  1Z6R A;  4JRP A;  1VQ4 N;  3OYB A;  4GV9 A;  3CCR N;  3DXK A;  4E7J A;  3P1G A;  2O8E B;  2D5R A;  1SAZ A;  5HLF A;  3PUF A;  5ADX H;  1JLB A;  1WOQ A;  4JI3 K;  1BIS A;  3H6E A;  1HKC A;  2I7P A;  5EOY A;  4GY2 B;  4C1N I;  3P83 D;  1RT1 A;  1RDB A;  4BRN A;  4CJT A;  3THX B;  1D5A A;  3MX2 A;  3KKR A;  4IXC A;  2ZJR L;  4B9S A;  1XI1 A;  3BUZ B;  3VF4 A;  1ATN A;  2YHW A;  4XH5 A;  3BDP A;  4XIU A;  4FWK A;  1NU0 A;  2P9N A;  3S9H A;  4DR6 K;  4CGD A;  1T3V A;  3NF8 A;  1SKS A;  3LP1 A;  4CIF A;  3O3G A;  3QEW A;  2PYJ A;  1V4T A;  3S41 A;  2DY4 A;  1KFD A;  4FJL A;  1QQM A;  3TAN A;  4BC5 A;  4ILG B;  1BG3 A;  2F9W A;  3OBW A;  1GLD G;  1K8A O;  2NRX A;  4RWT A;  3MCA B;  1SKR A;  3U9Z A;  2QA4 N;  2H3G X;  5KPZ A;  2F9T A;  1UWB A;  2HMI A;  1NGA A;  3CM6 A;  1H1V A;  4HTU A;  1FXX A;  2ASP A;  3BF3 A;  1BI4 A;  3ENO A;  4IDK A;  5AQG A;  4RG8 A;  4KRE A;  4DTM A;  3WNF A;  4GW6 A;  3T7Z A;  3VQP A;  4LF6 K;  1HNX K;  4X65 K;  3HST B;  3AVG A;  3GG4 A;  3OBY A;  3AVC A;  1RTD A;  4Z4F A;  4NXN K;  2NLX A;  3DOL A;  4JKE A;  5EU7 A;  5K14 A;  5JMV A;  3LL3 A;  3V4I A;  4MLE A;  1XHZ A;  1EWQ A;  2HW3 A;  3SLC A;  4CGF A;  1GLC G;  3LWL A;  4B08 A;  2BE2 A;  1FJG K;  4DTS A;  1NOZ A;  4FWQ A;  1Q9X A;  2O4G A;  4H4O A;  2R7Y A;  1BU6 O;  4O44 A;  3HOT A;  1VSE A;  3SI6 A;  4DV6 K;  3KTQ A;  5C0Y A;  5HRR A;  5FPN A;  2D0O A;  4WFB L;  4HCC A;  4N5S A;  4DKW A;  4DV0 K;  1ASV A;  5CR4 A;  4DSJ A;  2O8D A;  1Q7Y O;  4JI4 K;  3WQT A;  4M3T A;  1RBS A;  4MO5 A;  3WXM B;  4E3S A;  3AVN A;  4JK9 A;  3IMX A;  3KLG A;  4NCG A;  4DTX A;  1U4B A;  1OH5 A;  4FJ8 A;  1QHT A;  3NBP A;  2QKK A;  4FWS A;  1RT5 A;  1TKT A;  2GEL A;  3VQ8 A;  2F8T A;  5BRF A;  4BG9 A;  2D1K A;  4N56 A;  1ATS A;  2E1Z A;  3H08 A;  4LFB K;  4DLG A;  4B1V A;  1HJO A;  4BDZ A;  4DF4 A;  4WF9 L;  3K0S A;  4DQR A;  4M3W A;  4B9M A;  3HBT A;  1EO1 A;  1HQE A;  1JLE A;  2YHB A;  2VCP A;  1L3S A;  1BWF O;  4B9L A;  3ITH A;  3QES A;  4KHW A;  4W5N A;  1BIZ A;  3DRS A;  3OTO K;  2FSN A;  4E7H A;  1S6Q A;  4RW9 A;  5TKY A;  4GNI A;  3AVI A;  4FWR A;  4CE9 A;  2HST A;  2I5J A;  2QWM A;  2JWK A;  1RBV A;  4B3S K;  1J53 A;  1C0M A;  3MED A;  4CEZ A;  3OYD A;  1U49 A;  1KLM A;  4AF1 A;  4OPH A;  4RCH A;  5AZI A;  3V6D A;  3TAF A;  4DLE A;  4BWM A;  1D9D A;  2EWS A;  1NGB A;  2UXB K;  3BY5 A;  4BRH A;  2E2P A;  3AVJ A;  2O8D B;  2D0C A;  4GVM A;  4FJX A;  2B4J A;  4CEA A;  2YV0 X;  2KFZ A;  5FRN A;  1JKH A;  3MWP A;  1S9E A;  3ZCM A;  5B8H A;  3T69 A;  4IOX A;  1KVC A;  2E20 A;  1CXQ A;  2IAJ A;  5J2M A;  4IOA L;  4KB0 A;  3CYM A;  4BRK A;  2P9S B;  2QWO A;  4DUZ K;  1DTQ A;  4OPA A;  2XY8 A;  4FVM A;  2W6L A;  5KRS A;  4KI4 A;  2FSK A;  4EFH A;  1SUQ A;  4IBN A;  1U2V A;  1RDW X;  1LWE A;  4OO1 J;  3MEC A;  2BH1 A;  4K42 A;  4CF1 A;  3ZT4 A;  1TL3 A;  4YHH K;  1N32 K;  4G1Q A;  2G8K A;  2Q3S A;  2YNF A;  2W6K A;  4GV3 A;  4DSI A;  3M3Z A;  4BDP A;  2UYT A;  2QW9 A;  4IFE A;  4CI6 A;  1N36 K;  2OTL N;  1LCU A;  2IGI A;  2BGG A;  1OH7 A;  2Q97 A;  3GDQ A;  1VQ9 N;  2X6S A;  4AIL C;  4I9Q A;  4DB3 A;  3G6E N;  2ZQB A;  5KPT A;  5A2Q O;  4JAX A;  2VWJ A;  3HM9 A;  3MX5 A;  4FW2 A;  2AJQ A;  3E01 A;  2O8B A;  3R1X A;  4MO4 A;  3NGI A;  1R59 O;  5AZI B;  1I94 K;  1NLV A;  1WSE A;  4Y1D A;  4BR2 A;  2Y1J A;  2YHY A;  2NRT A;  3SV3 A;  4JN4 A;  3PY8 A;  3EE8 A;  4H5W A;  3WNE A;  4X62 K;  3LAN A;  1J54 A;  1T7P A;  1NOY A;  1VQ6 N;  3I56 N;  2XO7 A;  3AA2 A;  3NF9 A;  2QXL A;  1TK0 A;  2B6A A;  4JLH A;  4KHN A;  4R5P A;  3NVM A;  2P9P B;  4Y1C A;  4FJG A;  3KK1 A;  3AO3 A;  4W5Q A;  1YIJ N;  1JCF A;  4NCB A;  3E1Y A;  3VGM A;  1L3T A;  3ZSR A;  1NK8 A;  2G8V A;  3J81 O;  4K43 A;  4IFV A;  3VEW A;  4AHC A;  4JKB A;  3NGZ A;  3CPW M;  3SQ2 A;  3E9P A;  4H0X B;  1YIT N;  4JI2 K;  4BRL A;  1FW6 A;  4FLZ A;  3WXJ A;  3PX6 A;  3HVT A;  2RPI A;  3SYZ A;  1W7A A;  3CCE N;  3A5M C;  4YOY A;  4DFK A;  4OVL A;  4M45 A;  4W5R A;  3HVR A;  1ZC6 A;  3R6M A;  4OGC A;  3WQU A;  4CZH A;  4BAC A;  4JKF A;  3ENH A;  5FPE A;  3K9K A;  4FWO A;  4PKI A;  1QVG M;  3NF6 A;  3KWG A;  1I39 A;  3VF2 A;  3LP0 A;  4NYN A;  3OYH A;  4KTW A;  3HP6 A;  5AR0 A;  2ITM A;  4BC4 A;  3FZL A;  3A5O C;  5EY4 A;  5GAD P;  5GIO A;  4LF9 K;  3TTC A;  1DLO A;  5IT9 O;  2YCH A;  4BRO A;  1D8Y A;  2P9L A;  5FRM A;  5FDL A;  4CEB A;  4YOX A;  4A2A A;  1WBB A;  5CZ1 A;  5AQT A;  1BUP A;  3HO1 A;  3ZSO A;  4HTL A;  3V81 A;  1WBD A;  3NE6 A;  3O3F A;  1KAY A;  4DR2 K;  3O1W A;  1BO5 O;  2ZD1 A;  3L2Q A;  3ZEU A;  2A1R A;  2DFF A;  5IWA K;  5MLC Q;  1ZBL A;  3J8A A;  3H3O B;  1HNW K;  3FE1 A;  2VWB A;  1CZ9 A;  1VQO N;  1L3V A;  4M42 A;  3ULD A;  1WSF A;  3AO4 A;  5JVG L;  4Z4E A;  3HXM A;  4FJI A;  3T19 A;  1V4S A;  4B9T A;  4O8U A;  4DQQ A;  1TAU A;  3LWM A;  4HWI A;  5AQY A;  3VOV A;  5BPM A;  5F0X A;  4I6M B;  3H3N O;  5AJ3 K;  1QQC A;  4LF8 K;  1KVB A;  3I8B A;  4FJ9 A;  1ILY A;  4BGB A;  2CGJ A;  2PAV A;  4UQG A;  3AVH A;  4DV4 K;  4CZM A;  3LAK A;  3SK3 A;  4F3T A;  1FKP A;  3FLC O;  3ID8 A;  2W42 A;  1LWF A;  1HX1 A;  1LW0 A;  4EZ6 A;  5ADX A;  1UA1 A;  3FR0 A;  3WEE A;  3O8M A;  1IH7 A;  4CBU A;  5KPR A;  1A5X A;  2ZE2 A;  4CHP A;  1X9W A;  3TSP A;  2E2Q A;  3J80 O;  3M8Q A;  2JWL A;  3BZC A;  4CD1 A;  3SUN A;  4CBX A;  2O8C A;  3DYA A;  4B8A B;  2P9I A;  3I8D A;  1W0H A;  4AHT A;  3UKU B;  3CCU N;  5LJW A;  1XNR K;  4M3Z A;  4EIA A;  4L8R B;  2NRR A;  3CCV N;  2IIR A;  3AAP A;  1JLA A;  1TKZ A;  4KH6 A;  3G4S N;  3K58 A;  4BRF A;  4YOR A;  2HND A;  3DAW A;  1CXU A;  4AHS A;  4M3Y A;  4CJK A;  4BRE A;  5F1X A;  1GOA A;  3DLR A;  5ELZ A;  3MMV A;  4B1X B;  4YFU A;  4N47 A;  4DF8 A;  4DUY K;  2D0A A;  4M7Y A;  1IKY A;  1QZ6 A;  5CYM A;  3ZSQ A;  4CVN E;  3QFU A;  3CJ1 A;  5AQP A;  1IG9 A;  4UY8 O;  3AO5 A;  3L8B A;  1NKB A;  4H5R A;  2O8E A;  4DR3 K;  1VSH A;  3VMF B;  2IOC A;  3TSU A;  3NCI A;  1SS6 A;  4MQ3 A;  1NJZ A;  5I3U A;  1P8Z A;  4KB1 A;  1S22 A;  3SMS A;  4U67 L;  4IG0 A;  3ZX3 A;  4CJ7 A;  1LAV A;  3HL8 A;  4CER A;  4PL8 A;  1RT7 A;  1LAW A;  4A61 A;  3THX A;  3MDQ A;  3O9U A;  4JI5 K;  1KAZ A;  2Z1J A;  3MN5 A;  1P90 A;  1TVR A;  4BRG A;  2YHX A;  4HVJ A;  4YOV A;  3QNN A;  4RW6 A;  2OPQ A;  3VA0 A;  4NO7 A;  4LF4 K;  4DG1 A;  4CZL A;  1XC3 A;  4CGG A;  3SAH A;  3VEY A;  3TAG A;  1YVN A;  3A2F A;  1L5U A;  3IKM A;  3DLL L;  4DS5 A;  2QXF A;  3IRX A;  3VN5 A;  2HHS A;  2QWN A;  1X3N A;  4I2P A;  3JS6 A;  5GAH P;  1MWM A;  4AM6 A;  4KPY A;  4EAH D;  2F7T A;  4BDY A;  4DV3 K;  3PX0 A;  5FRO A;  1RFQ A;  2RE2 A;  4ZHR A;  4F4K A;  3ZX2 A;  5AQN A;  4FPA A;  4CW7 B;  3QER A;  1TK8 A;  2HVI A;  3QEP A;  4B3M K;  1JLF A;  4FK4 A;  1RT2 A;  1BCM A;  4JNE A;  3D2E A;  2GUI A;  1CZB A;  3QIC A;  1U47 A;  3PX4 A;  3SQ4 A;  4KAZ A;  5CE3 A;  5SZT A;  1OH6 A;  1BA1 A;  4F2S A;  4CFA A;  2XY7 A;  2RHK A;  3MEG A;  3WT0 A;  2HNZ A;  3KK2 A;  1J6Z A;  3AO1 A;  3L6Q A;  1W97 L;  5AZJ A;  4H4M A;  1ZYQ A;  2PY5 A;  4OPJ A;  5AQL A;  4QCL A;  4K25 A;  1X3M A;  1NMD A;  1RGI A;  1TYQ B;  4B1Y B;  3LM9 A;  3VQ7 A;  3OY9 A;  3F5T A;  3IG1 A;  4JV5 K;  1VK0 A;  1ZXO A;  1NJW A;  1Q81 O;  4CJV A;  2V52 B;  4ELU A;  2HOE A;  1K73 O;  3K5O A;  2KKZ A;  2UUA K;  1KXP A;  1DT9 A;  1NM1 A;  4KHU A;  2GTD A;  3TAE A;  3N4Q A;  3G71 N;  3OYI A;  3SUQ A;  1MWK A;  4DQ8 A;  2W40 A;  3V9W A;  3CJA A;  3LDN A;  1RIL A;  1RTH A;  2XHB A;  1L3U A;  4LF7 K;  1E4G T;  5JVH L;  1KAX A;  2YJE A;  4H5T A;  3I55 N;  4OKK A;  5CYQ A;  3CMA N;  4B9V A;  1BQM A;  4CJ5 A;  3TPQ A;  3F9M A;  1Z26 A;  3OYF A;  4LD0 A;  3O4W A;  2F96 A;  2Q1N A;  2HBJ A;  2KLA A;  1A5V A;  3OVN A;  3D2E B;  4H03 B;  1UOC A;  5LL6 Z;  4FO0 A;  1Z25 A;  2CGL A;  1J5E K;  4MDA A;  3OHR A;  3RRH A;  5J2Q A;  2QWQ A;  4PQU A;  1WN7 A;  1Y97 A;  5M1P A;  5AZJ B;  2HHV A;  1RTI A;  3A5N C;  4DTJ A;  3M8S A;  4NB4 A;  5C24 A;  4EP4 A;  4DFJ A;  4PWD A;  3OYE A;  1B92 A;  1IKX A;  1BIU A;  5HRO A;  1CLQ A;  3CFR A;  4R79 A;  4NLB A;  1MDU B;  3LDP A;  5M1Q A;  3U9D A;  4DTP A;  2IDO A;  4K0K K;  4CEC A;  4A5B A;  3RWU A;  3T1A A;  2ITG A;  4Z94 A;  3CD6 N;  2NUB A;  1J9A A;  3HPO A;  4FM2 A;  3NH1 A;  1KSP A;  3HTV A;  1NGD A;  2E1Y A;  3M5R A;  2UXD K;  4OGE A;  4JYA K;  3EY1 A;  5M1F A;  2OTJ N;  1OKJ A;  4Q0B A;  4CHN A;  3C7N A;  1WLJ A;  1TK5 A;  1YAG A;  3OA9 A;  3NFA A;  4C8N A;  4HHT A;  4WQ5 C;  3DRP A;  5BN8 A;  3CG7 A;  4J2B A;  2V7Z A;  4E7L A;  2P9S A;  4KTQ A;  4DSK A;  2A42 A;  4DMN A;  3J7Y P;  4PKG A;  1CZA N;  3EZW A;  1UA0 A;  5HOO A;  4FOI A;  4K8Z A;  3CCL N;  2YKN A;  3C6T A;  4LSN A;  3NMU A;  2RF2 A;  3QDK A;  1GLE G;  3J7Z O;  3D2F B;  3Q7B A;  3JAM O;  4ILJ A;  3HJF A;  5AQW A;  4NLC A;  1I3A A;  4AHU A;  4Z4G A;  1QQN A;  1EKE A;  2FXU A;  4A57 A;  2A40 A;  4YNQ A;  1FKO A;  2ZJQ L;  3G25 A;  3AA3 A;  4LH5 A;  4CJL A;  4FLU A;  1Q86 O;  3KIO A;  2IC3 A;  3KK7 A;  2O8F A;  5AQH A;  3OYL A;  1RDD A;  1TKX A;  5C2D A;  2KTQ A;  3G0Z A;  3C0B A;  3RMB A;  1VAZ A;  1M1K O;  4IJA A;  2RN2 A;  4AQY K;  5AQR A;  3RMD A;  4XH1 A;  3LZJ A;  1G99 A;  3B6P A;  4FOE A;  3OS0 A;  4DSF A;  4I7F A;  3F2K A;  1VQ5 N;  4JD2 A;  1QHA A;  2HHW A;  2QK9 A;  4DQP A;  1Y64 A;  4AHV A;  1HR0 K;  4O5B A;  4PA1 A;  4CF2 A;  1YTU A;  4W5O A;  5AQM A;  3C6H A;  3VQ5 A;  2ATQ A;  4ICL A;  3VGK A;  1IKV A;  1EWR A;  4C8O A;  3C7N B;  4FLY A;  2Z1H A;  4N76 A;  2FBY A;  2ZGY A;  1KD1 O;  2P9P A;  4PUO A;  4I2Q A;  4CJU A;  2OPP A;  3D7E O;  3LDS A;  2F4V K;  4LFC K;  5KTQ A;  1OH8 A;  3A8Y A;  5E84 A;  1RDU A;  3DLG A;  4H8K A;  4B1Z A;  5KGW A;  3FZF A;  5BRH A;  4JS5 A;  1VQL N;  5BR9 A;  2IVN A;  4O55 A;  2WC9 A;  4DCH A;  4QS9 A;  1XHX A;  3WXL A;  1QS4 A;  1HUX A;  1KFS A;  1U04 A;  3ZET B;  2Y1I A;  4JI7 K;  4KHQ A;  3THW B;  3VER A;  5JLF A;  2G8U A;  1GLJ O;  5BR8 K;  3NH0 A;  1VQ8 N;  5BPN A;  4CZF A;  4FJH A;  4K8X A;  1XQS C;  3ENB A;  2VG5 A;  4HUF A;  2O8F B;  3AA4 A;  1C1A A;  3ZSZ A;  4FYD A;  4B1U B;  1J5O A;  2BAN A;  5E41 A;  4M3X A;  2IVO A;  3HPG A;  4QAG A;  3VPZ A;  4BRQ A;  2A41 A;  4CFD A;  3OYC A;  4YY3 K;  3ZSY A;  3RR7 A; 
#chains in the Genus database with same CATH homology
 3AO4 A;  4FK2 A;  1IKW A;  2F8S A;  4Z4E A;  4M3R A;  4E1N A;  3HXM A;  1W9H A;  3T19 A;  4CJP A;  4FJI A;  4B9T A;  3FFI A;  3L3U A;  3ZT0 A;  1S1T A;  5HRS A;  4DTR A;  1JLQ A;  4DQQ A;  4DTO A;  4CGI A;  1TAU A;  3LWM A;  2GBZ A;  4F8R A;  1NK9 A;  3G10 A;  3PO4 A;  1BHL A;  3K5M A;  3CFP A;  1QQC A;  3OJS A;  4Z4H A;  2HHQ A;  4OLB A;  1KVB A;  4FJ9 A;  4C8M A;  4CJR A;  4UQG A;  4FXD A;  5C25 A;  2Z1G A;  3AVH A;  3OYM A;  3SUO A;  3LAK A;  3DOK A;  2DFH A;  3LAL A;  1FKP A;  4F3T A;  4JRP A;  1LW2 A;  1BQN A;  1QSY A;  3OYA A;  3OYB A;  2W42 A;  1VRU A;  3SUP A;  1LWF A;  4CGH A;  3RMA A;  4E7J A;  3AVB A;  3P1G A;  1LW0 A;  5HRN A;  2D5R A;  4ID5 A;  5HLF A;  3DLB A;  4EZ6 A;  4F2R A;  1RDC A;  1HMV A;  2D0B A;  2FBT A;  3PUF A;  1UA1 A;  5T7B A;  1QSS A;  1IH7 A;  1KCF A;  1NJX A;  1JLB A;  4BE2 A;  1A5X A;  2ZE2 A;  4CHP A;  1X9W A;  1CLQ A;  2LSN A;  4OLA A;  3M8Q A;  1BIS A;  4C8K A;  3HP9 A;  1BI4 B;  1X9S A;  3KJV A;  4CCH A;  4CHZ A;  3SUN A;  3DYA A;  4B8A B;  3P83 D;  3WNH A;  1RT1 A;  3QET A;  2G8I A;  3PV8 A;  1RDB A;  3I8D A;  1W0H A;  1B9D A;  4AHT A;  1HNI A;  4CJT A;  1D5A A;  4IFY A;  3KKR A;  3K5N A;  3F9K A;  4M3Z A;  4B9S A;  4L8R B;  3S3N A;  3I0R A;  4M3U A;  1XI1 A;  3BDP A;  4XIU A;  4CEE A;  5KRT A;  5DK5 A;  1JLA A;  1TKZ A;  1NK6 A;  3S9H A;  1U45 A;  4CK1 A;  3K58 A;  4CGD A;  3NF8 A;  1SKS A;  1BGX T;  2P51 A;  3LP1 A;  2HND A;  4CIF A;  1EX4 A;  3O3G A;  1B9F A;  1RNH A;  3QEW A;  3SPY A;  2PYJ A;  2DY4 A;  1KFD A;  4LY7 A;  4FJL A;  1CXU A;  4BWJ A;  4AHS A;  2E6L A;  4M3Y A;  4CJK A;  3ZSX A;  3TAN A;  4Z4C A;  2IS3 A;  3QIP A;  2A1S A;  4KKO A;  3OYN A;  3NAE A;  1MU2 A;  1HRH A;  2FBX A;  1GOA A;  3AVA A;  3DLR A;  4CK2 A;  4FJX A;  2O4I A;  4YFU A;  4DF8 A;  4N47 A;  1HQU A;  2D0A A;  3M8R A;  3MXI A;  1IKY A;  4C8L A;  4O4G A;  5CYM A;  3ZSQ A;  3UIQ A;  2QKB A;  3HK2 A;  1YTA A;  4CFC A;  3OJU A;  1N5Y A;  1IG9 A;  2HNY A;  3V9X A;  4KI6 A;  3AO5 A;  4OJR A;  1SKR A;  3L8B A;  3D0P A;  1NKB A;  2BDP A;  4DQI A;  1TGO A;  3PO5 A;  3VQ6 A;  3LP3 A;  1VSH A;  4TSX A;  2IOC A;  2YHA A;  1GOC A;  3NF7 A;  2HMI A;  1UWB A;  3NCI A;  4MQ3 A;  3CM6 A;  1NJZ A;  4FJK A;  1EET A;  5I3U A;  1NK5 A;  4DSL A;  4HTU A;  4KB1 A;  3V1Q A;  1FXX A;  4ZTF A;  2DFE A;  2HHX A;  4IG0 A;  2YNI A;  4FZX C;  1ITG A;  1BI4 A;  3AA5 X;  4IDK A;  4E0D A;  1UAX A;  3VQ9 A;  2HVH A;  1LAV A;  2OPR A;  3HL8 A;  4RG8 A;  4CER A;  4KRE A;  1RT7 A;  1LAW A;  3I0S A;  3LZI A;  4DTM A;  4CFB A;  3RR8 A;  2YNG A;  3WNF A;  1G15 A;  1YT3 A;  2Z1J A;  4GW6 A;  3VQP A;  3IAY A;  1TVR A;  3KKS A;  5KGX A;  3DLE A;  4HVJ A;  3HST B;  1VRT A;  3ZT1 A;  3QNN A;  4RW6 A;  3AVG A;  1RCH A;  1SL2 A;  2OPQ A;  3VA0 A;  2PZS A;  3AVC A;  3RRG A;  1RTD A;  4Z4F A;  4ELV A;  3TR8 A;  1F21 A;  4DG1 A;  4ZTJ A;  1XWL A;  3MXJ A;  4CGG A;  3DOL A;  3P5J A;  5EU7 A;  1C1C A;  5K14 A;  3V9U A;  3V4I A;  4FJ7 A;  4IKF A;  3TAG A;  3EZ5 A;  1XHZ A;  2EHG A;  3A2F A;  1SV5 A;  3DLK A;  3TAP A;  4DTN A;  3U6F A;  1L5U A;  2HW3 A;  4OKE A;  4CGF A;  4DS5 A;  3LWL A;  2P5O A;  4B08 A;  1WAF A;  2BE2 A;  2QXF A;  3ZSV A;  4DTS A;  1NOZ A;  3IRX A;  3VN5 A;  2O4G A;  1Q9X A;  2HHS A;  1JXB A;  2VG7 A;  4I2P A;  1O1W A;  4H4O A;  2R7Y A;  4O44 A;  3KK3 A;  1VSE A;  2FC0 A;  3SI6 A;  1NKC A;  5D3G A;  4KPY A;  3DI6 A;  1VSF A;  5J1E A;  3KTQ A;  4E7I A;  5HRR A;  4FW1 A;  4BDY A;  2P5G A;  3PX0 A;  1ZBH A;  4CIG A;  1WSG A;  5FRO A;  3TWH A;  3TAR A;  4HCC A;  1QE1 A;  1TKD A;  4N5S A;  4ZHR A;  1S5J A;  1ASV A;  4CES A;  4F4K A;  4DSJ A;  4KFB A;  1U48 A;  3QER A;  2KW4 A;  3TI0 A;  1TK8 A;  2HVI A;  4KTZ A;  2XRI A;  1JLF A;  3QEP A;  4M3T A;  4FK4 A;  1WSH A;  2KQ2 A;  1RBS A;  1RT2 A;  1BCM A;  3ZSW A;  3MAQ A;  2OZS A;  2GUI A;  4E3S A;  1CZB A;  1U47 A;  3VQC A;  3VA3 A;  4LH4 A;  1TL1 A;  3AVN A;  3KLG A;  3SQ4 A;  4NCG A;  5SZT A;  4DTX A;  3QEV A;  1U4B A;  1QHT A;  3NBP A;  1KRP A;  2QKK A;  3KD1 E;  1RT5 A;  1TKT A;  2FBV A;  4LSL A;  4CFA A;  2XY7 A;  4KV8 A;  3O4N A;  3VQ8 A;  1NK7 A;  3MEG A;  4F2S A;  2F8T A;  1R0A A;  2HNZ A;  4EP5 A;  4N56 A;  3KK2 A;  3V9S A;  4KAZ A;  5KI6 A;  4Z4I A;  3AO1 A;  4DWI A;  4CEO A;  4Q5V A;  4DTU A;  1HNV A;  4NYF A;  5J2N A;  3H08 A;  1RT3 A;  1BL3 A;  4H4M A;  4FM0 A;  1ZYQ A;  2PY5 A;  3TAM A;  1GOB A;  4DLG A;  4OPJ A;  4FJ5 A;  2P1J A;  3T3F A;  3IS9 A;  4BDZ A;  1JL1 A;  4DF4 A;  5HP1 A;  4QCL A;  3U3Y A;  5JS1 A;  4DQR A;  4M3W A;  4B9M A;  4CEF A;  1HQE A;  1JLE A;  2YHB A;  4FCY A;  1S1W A;  3VQ7 A;  3OY9 A;  4E7K A;  1L3S A;  1S1X A;  4B9L A;  3ITH A;  3QES A;  3IG1 A;  1T03 A;  3KD5 E;  4KHW A;  4W5N A;  1BIZ A;  3DRS A;  1VK0 A;  3NGY A;  4ID1 A;  4FLW A;  4E7H A;  1S6Q A;  4RW7 A;  1NJW A;  4RW9 A;  4IG3 A;  4CJV A;  3AVI A;  4FLV A;  4CE9 A;  4ELU A;  3K5O A;  2DTU A;  2I5J A;  1RBV A;  3MXM A;  3WNG A;  1J53 A;  3TAQ A;  1HYS A;  1C0M A;  3MED A;  4FJN A;  3L2U A;  4CEZ A;  4EZ9 A;  3OYD A;  4DU1 A;  3ALY A;  3K59 A;  2KFN A;  1X9M A;  3OS2 A;  4CIE A;  4KHU A;  3JSM A;  3SV4 A;  2KZZ A;  3V9Z A;  1U49 A;  3NHG A;  3TAE A;  1KLM A;  4CGJ A;  3OYI A;  3QEI A;  3SUQ A;  4NCA A;  3V9W A;  4CF9 A;  1REV A;  1RIL A;  1RTH A;  2XHB A;  3BGR A;  1LWC A;  4CED A;  3SCX A;  3TAF A;  3V6D A;  3SZ2 A;  5CY4 A;  1L3U A;  4DLE A;  1C6V A;  4BWM A;  4CJW A;  1NJY A;  2X78 A;  4RW4 A;  1D9D A;  4HUE A;  3S3M A;  3ISN C;  4OKK A;  5DMR A;  1RBR A;  3AVJ A;  4HCB A;  5CYQ A;  4PWD A;  3C94 A;  2D0C A;  4B9V A;  1BQM A;  4GVM A;  2B4J A;  4CEA A;  4KO0 A;  4CJ5 A;  1WSI A;  2YV0 X;  3O3H A;  3QNO A;  1Q9Y A;  2G8F A;  2KFZ A;  1Z26 A;  3DRR A;  4CJ3 A;  3OYF A;  1JKH A;  4LD0 A;  2F96 A;  3LPU A;  5FRN A;  1S9E A;  3QIN A;  3ZCM A;  1WSJ A;  1KVA A;  4BE0 A;  3K2P A;  1A5V A;  1KVC A;  3OVN A;  1CXQ A;  2IAJ A;  4CJE A;  5J2M A;  1UOC A;  1NK0 A;  4KB0 A;  1VSJ A;  1WAJ A;  1Z25 A;  1YVU A;  3CYM A;  1FK9 A;  2PYL A;  5HRP A;  3ULD A;  4PY5 A;  1RDA A;  1DTQ A;  3QIO A;  5HBM A;  2XY8 A;  3RRH A;  5J2Q A;  3TAB A;  1WNS A;  4FVM A;  1N6Q A;  3C6U A;  4ELT A;  4PQU A;  1VSM A;  1JLC A;  1WN7 A;  2EX3 A;  5KRS A;  1Y97 A;  4KI4 A;  2HHV A;  1RTI A;  3VQA A;  1SL1 A;  2ETJ A;  2X6N A;  1SUQ A;  4IBN A;  5C24 A;  4EP4 A;  3M8S A;  3OYE A;  4DQS A;  4DTJ A;  2GV9 A;  1LWE A;  1B92 A;  3MEC A;  3ZT3 A;  4CF1 A;  3HT3 A;  1IKX A;  1BIU A;  3AVM A;  1TL3 A;  3ZT4 A;  5HRO A;  3CFR A;  4G1Q A;  5C42 A;  4DSE A;  4MFB A;  2G8K A;  2Q3S A;  2YNF A;  3DM2 A;  4B9U A;  3OYJ A;  2X74 A;  3S3O A;  4Z0U A;  4DSI A;  4AH9 A;  4DTP A;  4BDP A;  2IDO A;  3B6O A;  4W5T A;  4CEC A;  3QO9 A;  2IGI A;  3V1O A;  4CK3 A;  3K5L A;  3PX4 A;  1ZBU A;  4FM1 A;  3T1A A;  2ITG A;  3RWU A;  2BGG A;  2NUB A;  1J9A A;  2X6S A;  3HPO A;  4FM2 A;  4AIL C;  3DLH A;  3NH1 A;  1KSP A;  4DS4 A;  4I9Q A;  2ZQB A;  1HYZ A;  4WE1 A;  2KZM A;  4FLT A;  4OGE A;  2VWJ A;  3HM9 A;  2HB5 A;  3OYG A;  3EY1 A;  1XC9 A;  4FW2 A;  5CZ2 A;  2AJQ A;  5JS2 A;  1KTQ A;  3MEE A;  4CHN A;  4Q0B A;  3E01 A;  1WLJ A;  1TK5 A;  3AVF A;  3NFA A;  1EXQ A;  3VQD A;  4C8N A;  3NGI A;  4HHT A;  4FJM A;  1VSD A;  3DRP A;  2XY5 A;  5I42 A;  2OZM A;  3CG7 A;  4J2B A;  1WSE A;  4E19 A;  4Y1D A;  2Y1J A;  1S9G A;  4E7L A;  4AHR A;  2HHU A;  4KTQ A;  3SV3 A;  5J2P A;  1ASW A;  3DMJ A;  3PY8 A;  4DSK A;  2E6M A;  3WNE A;  4DMN A;  4J2E A;  4FZZ A;  1X1P A;  4GMJ B;  2OPS A;  3LAN A;  1UA0 A;  4B9N A;  1J54 A;  1QTM A;  4K8Z A;  1T7P A;  3CFO A;  2YKN A;  3C6T A;  4LSN A;  2WOM A;  1NOY A;  4KHS A;  2XO7 A;  3AA2 A;  3NF9 A;  3AV9 A;  1EP4 A;  1TK0 A;  3O4Q A;  2B6A A;  3AO2 A;  1DTT A;  3L2W A;  4JLH A;  4KHN A;  1C0T A;  2RF2 A;  4R5P A;  4DFM A;  3THV A;  4Y1C A;  4FJG A;  3VQQ A;  3KK1 A;  3AO3 A;  4W5Q A;  1BCO A;  4CHQ A;  4NCB A;  3HJF A;  3LAM A;  1K6Y A;  1I3A A;  4AHU A;  1L3T A;  3ZSR A;  3VQE A;  4Z4G A;  4J2D A;  1EKE A;  2RKI A;  3SJJ A;  1NK8 A;  2G8V A;  3K57 A;  4YNQ A;  4J2A A;  3SNN A;  4IFV A;  2OA8 A;  2WON A;  4AHC A;  3D45 A;  1SL0 A;  1FKO A;  3C95 A;  5SWM A;  3NGZ A;  3KLE A;  3AA3 A;  4LH5 A;  4CJL A;  4FLU A;  3KIO A;  2IC3 A;  3L2V A;  3SQ2 A;  3L2R A;  1JXE A;  1VSI A;  3OYL A;  1RBU A;  1RDD A;  1TKX A;  2HHT A;  2KTQ A;  2YNH A;  3G0Z A;  3RMB A;  4FLZ A;  3ASM A;  3OYK A;  2RN2 A;  4CJ4 A;  1RT4 A;  3PX6 A;  3HVT A;  2RPI A;  4CJQ A;  3SYZ A;  4CHO A;  3M8P A;  3RMD A;  2JGU A;  3RTV A;  4CF8 A;  3LZJ A;  3B6P A;  1RT6 A;  4O0I A;  3OS0 A;  4DSF A;  4DFK A;  4I7F A;  4OVL A;  4M45 A;  4W5R A;  1C0U A;  3HVR A;  4OPK A;  2QK9 A;  2HHW A;  4DQP A;  4AHV A;  4FJJ A;  4OGC A;  4O5B A;  4PA1 A;  4CF2 A;  3OS1 A;  4BAC A;  1YTU A;  2YKM A;  3CQ8 A;  3CM5 A;  4M41 A;  4W5O A;  1SKW A;  1JL2 A;  4CJS A;  1C1B A;  3VQ5 A;  1JLG A;  2ATQ A;  4ICL A;  1QSL A;  1ZBF A;  3NF6 A;  1IKV A;  3EYZ A;  1I39 A;  4OKJ A;  2E4L A;  1RBT A;  3LP0 A;  3RMC A;  4C8O A;  1LV5 A;  1HYV A;  4NYN A;  3QLH A;  3OYH A;  2Z1H A;  4FLY A;  3RR7 A;  4N76 A;  4QOZ B;  4B3O A;  4KTW A;  2XY6 A;  3LPT A;  1RTJ A;  3HP6 A;  3JYT A;  2FBY A;  4FJ8 A;  3NH2 A;  1NK4 A;  2G8H A;  1Q8I A;  4N41 A;  1S1U A;  4CHY A;  4PUO A;  1ZBI A;  4I2Q A;  4CJU A;  2OPP A;  3U3G A;  4JRQ A;  3LDS A;  1A5W A;  4I9L A;  5KTQ A;  1S6P A;  3VQB A;  2VG6 A;  4E89 A;  3DLG A;  1VSL A;  4H8K A;  3SQ0 A;  3VQ4 A;  3SQ1 A;  1DLO A;  5KGW A;  1D8Y A;  1HPZ A;  4RW8 A;  4DFJ A;  3QEX A;  4JS5 A;  5FRM A;  1VSK A;  5FDL A;  4CEB A;  1T05 A;  4O55 A;  4JS4 A;  1D9F A;  4KRF A;  1TV6 A;  4FZY A;  1XHX A;  4FK0 A;  4CEQ A;  4FLX A;  1QS4 A;  2Z1I A;  2G8W A;  5CZ1 A;  1KFS A;  4KHY A;  3HO1 A;  1U04 A;  3AVL A;  3ZSO A;  3V81 A;  2Y1I A;  3NE6 A;  1T8E A;  3O3F A;  4KHQ A;  1HJR A;  3HPH A;  3KLH A;  4DU4 A;  4E1M A;  3ZT2 A;  2ZD1 A;  3L2Q A;  3LP2 A;  2G8U A;  4O0J A;  2A1R A;  2DFF A;  3NH0 A;  4FJH A;  4K8X A;  1ZBL A;  4HUG A;  1KLN A;  3V1R A;  3KLI A;  4CJF A;  4F3O A;  4DFP A;  3F73 A;  2VG5 A;  2B5J A;  3AVK A;  3NDK A;  4HUF A;  3HYF A;  2JLE A;  4BE1 A;  3AA4 A;  1NKE A;  2OYQ A;  1IO2 A;  1C1A A;  1TAQ A;  3ZSZ A;  1CZ9 A;  2VWK A;  4FYD A;  1J5O A;  2BAN A;  1S1V A;  3L3V A;  5E41 A;  4M3X A;  3HPG A;  4QAG A;  4B8C A;  4CFD A;  4CF0 A;  3SPZ A;  1ASU A;  3OYC A;  1L3V A;  4M42 A;  3ZSY A;  4DU3 A;  1WSF A;  3KLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...