1O1WA

Solution structure of the rnase h domain of the hiv-1 reverse transcriptase in the presence of magnesium
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
138
Chain Sequence
MNELYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE H
publication title Solution Structure of the Rnase H Domain of the HIV-1 Reverse Transcriptase in the Presence of Magnesium
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 26
structure length 138
sequence length 138
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1o1wA00
4M41A 3OYNA 4KREA 1W9HA 2P1JA 4XIUA 3L2WA 4F4KA 3VQ6A 4DSLA 2HHWA 3V9XA 3RMDA 1JLBA 4CJPA 3P1GA 4I7FA 2BANA 1R0AA 1CZ9A 1ITGA 4FVMA 1JLGA 4RG8A 5CY4A 2ZD1A 5D3GA 4M45A 4EP5A 3VN5A 1WNSA 3AO2A 4CF1A 4N76A 4FW1A 4MQ3A 1S1WA 3S9HA 3TAPA 4RW4A 1U45A 4YFUA 4IFYA 1A5XA 3EYZA 3K2PA 3I8DA 3KLIA 1A5VA 4KAZA 3P83D 1UA1A 4FJ8A 2FBVA 1C1BA 3SUNA 3QO9A 3NCIA 1U4BA 1BI4B 3SPYA 1T03A 4OGEA 4EP4A 4HUEA 4NCBA 4Z4IA 3OYDA 3BDPA 1BHLA 1TGOA 4OGCA 3DMJA 3NBPA 3QETA 2PZSA 4J2BA 2F8TA 2HHTA 3T19A 4AHVA 3O3GA 3RMCA 2VWKA 4KTQA 4CJRA 1IO2A 2G8FA 3AVBA 3QINA 1U04A 4DF4A 4B9LA 2HHQA 1JLEA 4CGHA 3MAQA 4F8RA 2O4IA 1TKZA 1RTHA 4B9SA 4CJSA 2B6AA 1RTIA 3LP3A 5C42A 3HP6A 3QNOA 3LZIA 4F2SA 2BGGA 3TAEA 1RT7A 3HPHA 1EETA 5DK5A 3ZSQA 3DLRA 2IC3A 1S1TA 4QCLA 3PX4A 1ZBLA 4Y1CA 3V1RA 1RDCA 4L8RB 4HUGA 4M3ZA 4Z4EA 4E89A 4DTMA 4I2QA 2G8HA 1Z25A 5KRSA 1B9DA 4I2PA 1X1PA 1QE1A 3AO4A 3TABA 4HHTA 2IAJA 2YKNA 4E7IA 3ZSYA 4AHRA 1SL1A 4JLHA 4DQPA 1J54A 5E41A 2OYQA 1XC9A 5J1EA 1S9GA 1RT4A 1JLFA 3C95A 1RDBA 4KO0A 5HRRA 3ZSVA 3MXMA 2Y1IA 1TK5A 1IKYA 4QOZB 1D8YA 4CIEA 3C94A 3KK1A 3SQ4A 2W42A 4BDYA 1N5YA 3MEEA 1FKOA 4CHOA 1CZBA 1BQNA 2RPIA 3QLHA 4FW2A 2WONA 4CFAA 3F9KA 3SUOA 2KW4A 1JLCA 3OYJA 4FXDA 3C6UA 3SQ2A 1NOYA 2QKKA 1VSIA 1Y97A 3TAGA 3AA2A 3OYMA 2IGIA 1KVCA 3A2FA 4J2AA 4PA1A 3OYCA 3OYFA 3KD1E 5SWMA 3QEIA 1HNIA 1RBVA 3AVCA 4CHPA 3IG1A 2IS3A 4ZTJA 4AHTA 3DYAA 3DOLA 3LDSA 3BGRA 4DTRA 2DY4A 3B6PA 4KFBA 1QSLA 1ASVA 3AVKA 1U49A 4CEOA 3CQ8A 3PO5A 4CESA 1HNVA 2R7YA 1U47A 3QERA 4W5OA 1LAVA 4FCYA 3TI0A 4C8LA 3CYMA 2ZE2A 4AHUA 3HO1A 3CFPA 4E7JA 4FZXC 4B3OA 3NF6A 3D0PA 3WNGA 1VSHA 4CEBA 1NJXA 1HRHA 1NJZA 3M8SA 4NCAA 4EZ9A 2VG6A 1DLOA 4OKEA 3O4NA 3TAQA 3TARA 1WSJA 3HPGA 4W5RA 4DSKA 3I0RA 1QQCA 5HBMA 1XWLA 4DU3A 4KHWA 4KI4A 3JSMA 2HNZA 2OZMA 4FZYA 3NH2A 2IDOA 1JLQA 3OYLA 4DF8A 3VQ7A 4CHZA 3NE6A 4DSIA 1ZBHA 2I5JA 5FRMA 1VSMA 1WSHA 3AO5A 4IDKA 1NOZA 1S1XA 1HQEA 4R5PA 4BDZA 4J2EA 1TL1A 2WOMA 4DLGA 1UA0A 1N6QA 4J2DA 1LW0A 2OPQA 4H4OA 5CYQA 3SPZA 5J2MA 1TVRA 3WNFA 2B4JA 4CJQA 4DTNA 3T1AA 1X9MA 2DFFA 3K5LA 1NJYA 3QIOA 2G8WA 4EZ6A 3LAKA 2GUIA 3HT3A 4DS4A 3AVHA 4CHNA 3RWUA 3DLEA 1RBSA 4KKOA 3LZJA 3NFAA 3SJJA 1QSSA 3NH0A 1KLNA 1D5AA 1BISA 5FRNA 4CIFA 5I42A 1HMVA 4Y1DA 2JGUA 2YNGA 2VWJA 3PY8A 4O4GA 1Q9XA 4E7LA 4RW8A 1TKTA 1F21A 4KHSA 4DU4A 2QXFA 3ULDA 4C8MA 2PYLA 2HVIA 3EY1A 1BL3A 3ZT2A 2EHGA 4CFBA 4FJ9A 3V1QA 1UWBA 3H08A 1TL3A 4FLVA 4JS5A 1NK8A 3SV3A 2F96A 4DSJA 3V1OA 3VQ9A 4TSXA 4DFPA 3SUQA 4CJEA 1SKRA 4KHUA 3VQQA 3AVJA 3QESA 1NKCA 3NHGA 3L2VA 3KLHA 3I0SA 4DQIA 4KHQA 4OLBA 1RTDA 4FJ7A 2HHVA 2KFZA 4C8NA 2KZZA 3U6FA 3VQ5A 3SYZA 1MU2A 4MFBA 1REVA 3SCXA 3SNNA 2YHAA 2RKIA 3G0ZA 5CYMA 5J2NA 3ALYA 4CK3A 4CF8A 4DQSA 4FM1A 5KTQA 1IG9A 1RT5A 3LPUA 3ZT1A 4CEAA 4KRFA 3NDKA 4M3XA 4M3WA 1TAUA 2E6LA 3ZT3A 3V4IA 4FJLA 4K8ZA 3HK2A 3AVAA 2YNIA 4CGJA 4CJ4A 3V81A 1KRPA 1FXXA 3HP9A 4CEFA 1T8EA 1X9SA 1SKSA 4HCBA 1DTQA 1BCOA 4B8AB 4N5SA 3QEPA 4FLZA 1KTQA 3LP0A 1TKXA 2NUBA 3MXJA 3DLKA 4QAGA 4CJVA 4IG3A 4OPJA 4FM2A 1TKDA 2Z1HA 4LH4A 4CJKA 1QSYA 3RR7A 3SI6A 3AA4A 4B9TA 3PX6A 1KVBA 3ZT0A 4FJKA 5JS1A 2YNFA 5HRPA 3MXIA 2P51A 2G8KA 1RT2A 4KI6A 1VRTA 4LSNA 4CJTA 3KLEA 4O55A 1L5UA 4FJXA 5SZTA 2PY5A 4CHYA 3O3FA 3AA5X 4FK0A 1WSEA 3MECA 2KFNA 3VQPA 1J9AA 3PX0A 2YHBA 4FJMA 4W5QA 1CXQA 2E6MA 3T3FA 2D0AA 2FBTA 4AHCA 4FYDA 1NK9A 1LW2A 4N47A 1IKXA 1CXUA 4E1MA 1L3VA 4WE1A 2KZMA 5T7BA 4LY7A 4K8XA 1VSEA 1FK9A 1LAWA 5KGWA 2ATQA 3DLGA 1XI1A 1HYSA 4LD0A 3S3OA 1NK0A 1EX4A 4CEEA 2KTQA 1RT1A 4CF0A 3V9UA 3AVMA 3M8QA 4GW6A 4B9UA 3OYIA 1RILA 3KIOA 4FLXA 3HYFA 1YTAA 5J2QA 3TANA 5C24A 3KLGA 4KTWA 4CFCA 2X6NA 5EU7A 4CK2A 1QTMA 1UAXA 3LP1A 4OVLA 3VQ4A 3OYAA 1HYZA 3OYGA 4Z4CA 1LV5A 4O0JA 2O4GA 1HJRA 3HM9A 4M3YA 2HW3A 4ZHRA 3HVTA 1D9FA 2FBYA 1VSLA 1S6QA 3CM6A 4I9LA 4HUFA 1SL2A 2OPRA 4IBNA 5HRSA 4ELVA 2HVHA 4PQUA 2Z1JA 2X6SA 3L8BA 4DG1A 5K14A 3LWMA 3S3NA 4B9NA 3DM2A 2PYJA 4CEDA 1LWEA 3PO4A 3OS0A 4CJLA 3MEDA 4H8KA 3SV4A 5I3UA 1JL1A 3RRGA 4HCCA 1QHTA 4JRPA 3L2UA 2HHXA 4NYFA 4ID5A 3VA3A 3LANA 4OKKA 4BACA 2XRIA 4DTXA 1GOCA 1RBUA 3WNHA 4DLEA 4DFMA 1NK7A 1ASWA 1TV6A 3KKRA 4PWDA 4ID1A 1RNHA 3ASMA 3NF8A 3VQ8A 1VK0A 4CJ5A 3ITHA 4LSLA 3V9WA 2HMIA 1EKEA 1VSKA 2YKMA 3LAMA 3V6DA 4BE0A 1VSFA 2YNHA 4FM0A 3FFIA 1C0UA 3KD5E 4AHSA 3VA0A 4KB0A 4AH9A 5FROA 1WAJA 1JXEA 3G10A 2XY5A 4FJ5A 4DWIA 1YTUA 2OZSA 1SV5A 3OYKA 1X9WA 2BDPA 1WSIA 4ZTFA 1CLQA 1XHXA 4BWMA 4DTPA 4CK1A 4UQGA 4FJGA 2P5OA 4ELTA 3HSTB 3QNNA 3V9ZA 4CJFA 3HJFA 1VSJA 1S1UA 2F8SA 3B6OA 1KFDA 1ZBFA 4PY5A 5HRNA 4OPKA 4YNQA 2HHSA 3ZSOA 4DTOA 2DFHA 4FJJA 3F73A 1C0MA 3K59A 3D45A 1BGXT 5KI6A 3KK3A 1C1CA 1EP4A 2ZQBA 3ZSXA 4JRQA 3SQ0A 2ITGA 3VQEA 4FK2A 3M8PA 1RTJA 3NGZA 1L3SA 2XY7A 3LALA 4KTZA 4CECA 4RW6A 2HHUA 4CJWA 1RT6A 3K5MA 2X78A 3AO3A 1DTTA 3E01A 5HLFA 1U48A 1XHZA 1C6VA 1LWCA 2ETJA 3TAMA 3WNEA 3QEVA 3DRRA 1S1VA 3TR8A 4Z0UA 4LH5A 1D9DA 4RW9A 4CE9A 3AVIA 3IRXA 3CG7A 4OKJA 4FK4A 4BWJA 1NK4A 3RR8A 1KCFA 1SUQA 1VRUA 2DFEA 4DTSA 1BIZA 2X74A 3MEGA 1RBRA 4E7KA 3L3VA 4DFKA 4CF2A 1B9FA 4C8KA 1RDAA 3TWHA 3RMAA 3OJSA 4G1QA 4N56A 4Q5VA 3KTQA 1WAFA 5JS2A 3HXMA 2XO7A 1KVAA 3DLHA 1B92A 4DTJA 1A5WA 1HPZA 1GOAA 1BCMA 1JL2A 3IS9A 1O1WA 4H4MA 4HVJA 4FZZA 1RT3A 3KJVA 3OJUA 2AJQA 2DTUA 3AVNA 3K5NA 4DSFA 4CERA 2XY6A 3ISNC 3K5OA 4CEZA 4GMJB 4B9MA 4B9VA 4DTUA 1I3AA 3KKSA 1S6PA 2XY8A 3EZ5A 2HB5A 2D5RA 3CFOA 4KHNA 1JKHA 2RN2A 1TK8A 4C8OA 1ZBUA 1RDDA 4E1NA 3O3HA 2KQ2A 3OS2A 3DRSA 4JS4A 4M3TA 1I39A 3NGIA 4E3SA 3HL8A 3OYBA 4NCGA 4CCHA 5J2PA 3ZSWA 2G8VA 3K58A 4Z4HA 3HVRA 3VQDA 3SZ2A 1SKWA 4BDPA 2BE2A 2HNYA 3DRPA 3SUPA 4E19A 3AVGA 4O5BA 4CJUA 1KLMA 4CF9A 4Z4GA 3AV9A 1LWFA 1Q9YA 4IFVA 4N41A 2GV9A 4M42A 1ZBIA 1EXQA 3O4QA 5KRTA 3DOKA 1T05A 2LSNA 3ZT4A 1J5OA 2Y1JA 3DLBA 1IKVA 2D0BA 4FLUA 2VG7A 3LP2A 4DU1A 4CGGA 3UIQA 3THVA 1YT3A 4DSEA 2D0CA 5DMRA 4BE1A 1J53A 3S3MA 2G8IA 2Q3SA 5CZ2A 1C1AA 2B5JA 1VSDA 3C6TA 3JYTA 1G15A 4KPYA 1QS4A 1YVUA 3NF9A 3M8RA 3OS1A 4DFJA 2G8UA 1T7PA 1C0TA 4F3OA 4FLYA 3OVNA 4FLTA 3LPTA 4IG0A 1Q8IA 4BE2A 1NKBA 4FJNA 2GBZA 2Z1GA 3AVLA 4GVMA 3OYHA 5HROA 1BQMA 2XHBA 1NK6A 4FJIA 1JLAA 4CEQA 2RF2A 2YV0X 3CM5A 1FKPA 5FDLA 3L2QA 3RRHA 3PV8A 4ELUA 1IH7A 1L3UA 2Z1IA 4AILC 1L3TA 2OA8A 3PUFA 3VQAA 1WSGA 4M3RA 4FLWA 1HYVA 1WSFA 3TAFA 4I9QA 4W5NA 1GOBA 4ICLA 4DMNA 3ZCMA 4CFDA 3ZSZA 1NK5A 3VQBA 1TAQA 3QEXA 4E0DA 4OJRA 5KGXA 3DI6A 1S9EA 1Z26A 3LWLA 1WLJA 3NAEA 3RTVA 2IOCA 3L3UA 4B08A 4O0IA 4E7HA 2OPSA 1KFSA 2OPPA 3U3YA 1SL0A 3IAYA 4CJ3A 3KLFA 4DS5A 4O44A 1RBTA 1JXBA 4NYNA 2JLEA 4F3TA 4CIGA 4F2RA 3RMBA 1W0HA 1ASUA 3V9SA 4OLAA 1S5JA 4CGFA 3SQ1A 3AVFA 4Z4FA 4W5TA 3K57A 3CFRA 2A1SA 1RCHA 2VG5A 3L2RA 2FC0A 3NGYA 3KK2A 4CHQA 1K6YA 4KV8A 4HTUA 2QK9A 2EX3A 1ZYQA 4KHYA 1BIUA 3OYEA 3U3GA 4PUOA 3VQCA 5CZ1A 2A1RA 1UOCA 4RW7A 5HP1A 4DQRA 1KSPA 1NKEA 2FBXA 1WN7A 3QIPA 3NH1A 4B8CA 4M3UA 3AO1A 4KB1A 2E4LA 1IKWA 4DQQA 4Q0BA 3AA3A 3OY9A 2HNDA 5C25A 1TK0A 1HQUA 4CGDA 4FJHA 2QKBA 3QEWA 2P5GA 1BI4A 4CGIA 4IKFA 3ZSRA 3HPOA 1NJWA 3NF7A 3P5JA
chains in the Genus database with same CATH superfamily
4F4KA 3HSCA 4DSLA 4I7FA 1ITGA 2ZD1A 5FPDA 5D3GA 4EP5A 1NU0A 3AO2A 4JK7A 2FF6A 2VQFK 3S9HA 3SMSA 4YFUA 1K8AO 3KLIA 3P83D 5IWAK 2V7YA 3SPYA 1E3MA 1KD1O 4NCBA 2AP1A 3OYDA 1TGOA 4OGCA 3VEVA 3NBPA 4J2BA 3A5NC 2F8TA 4AHVA 4JI2K 3O6WA 3PIPL 2G8FA 3AVBA 1NWKA 3L4QA 1U04A 3KVGA 2HHQA 1M1KO 4O5FA 1TKZA 1K73O 4B9SA 4CJSA 1QZ5A 3TAEA 3CETA 2GELA 4IEIA 4QCLA 3PX4A 3T69A 4HUGA 4DTMA 1Q81O 1B9DA 4HHTA 3ZSYA 4AHRA 4BGAA 4JLHA 3SBGA 2Q2RA 2NRZA 4DR2K 5J1EA 3TSPA 4KO0A 4QS7A 1IKYA 4QOZB 3SQ4A 3MEEA 4FL9A 4FW2A 2WONA 2ZGYA 3SUOA 1JLCA 3SQ2A 5LL6Z 4BG9A 1VSIA 4K41A 3TAGA 3OYFA 1VQPN 3SAHA 3QEIA 5C10A 1RBVA 3AVCA 3FZLA 4CHPA 3IG1A 3GBTA 3K9KA 2W41A 2QEXN 1HKCA 4DR4K 1N32K 1K9MO 3PO5A 5GAHP 2HOEA 3TI0A 3VESA 2ZE2A 3FZMA 4B3OA 3WNGA 4CEBA 1NJXA 4FWKA 5GAEP 4EZ9A 4BR9A 4OKEA 3O4NA 3TAQA 1WSJA 4NLCA 3NH2A 1JLQA 4H0TB 2Q31A 3VQ7A 4DF8A 4CHZA 1VQ7N 4DSIA 1ZBHA 2I5JA 1VSMA 3VERA 4PKIA 3ZX0A 1HQEA 3R6MA 2WOMA 1UA0A 4J2DA 1LW0A 4B1ZA 4JI8K 1TVRA 4J2AA 3T1AA 1X9MA 2DFFA 2NRXA 3K5LA 4EZ6A 2GUIA 3D6RA 4PL8A 3O80A 5BREA 3LZJA 3S41A 3NFAA 3ULEA 1KLNA 2YNGA 2VWJA 1WOQA 3GDQA 4O4GA 1Q9XA 4RW8A 1TKTA 1F21A 4DU4A 1ZXOA 3CC7N 3CERA 3J81O 3EY1A 3ZT2A 4FJ9A 1NK8A 1P8ZA 4DSJA 3VQQA 2CH5A 3AVJA 5KPTA 1NKCA 3NHGA 5LY3A 1YJ9N 1RTDA 1BG3A 4MLEA 4CD3A 2KZZA 4CBWA 2NZTA 3SNNA 2RKIA 4CF8A 3ZT1A 3GE1A 3LDPA 3ZT3A 4FJLA 3THYA 1KRPA 2YNIA 4CGJA 1DTQA 1BCOA 4B8AB 3J80O 4N5SA 3QEPA 3CIPA 4U7BA 1QVGM 3HRGA 4IG3A 4H5NA 4CJKA 1XMQK 1X3MA 3ZT0A 2P9LA 4FJKA 3HI0A 2YNFA 3DXKA 2W6LA 3HTVA 5AFUH 4ISEA 5AQKA 5SZTA 3O3FA 3AA5X 2RHKA 2JWKA 3EE9A 3VEOA 2E6MA 2D0AA 4DCHA 2OCEA 1L3VA 3W3DA 2Q0UA 3DXMA 4K8XA 5F1XA 5KPRA 4LD0A 3K0SA 3WUHA 1EX4A 1NLVA 3A5LC 1NGEA 4CEEA 1BWFO 3DXKB 1RT1A 4CF0A 5KPZA 3V9UA 2E1YA 4B1WB 1RFQA 2A6AA 4FLXA 3HYFA 1ZC6A 4MDAA 1OH8A 3KLGA 4CFCA 2X6NA 5EU7A 3O9UA 1UAXA 1U6ZA 3KWIA 4GY2B 4KH4A 4O0JA 2O4GA 4YOUA 4ZHRA 4A5AA 4FOEA 5HRSA 4ELVA 4PQUA 2Z1JA 2X6SA 3L8BA 4IXCA 4DG1A 4IOXA 4YOYA 4CEDA 3VTHA 4MLHA 4CJLA 2QWMA 3SV4A 1NMDA 1QHTA 2BTFA 3O1WA 1S22A 3LANA 3RSEA 1GOCA 4DTXA 4C1NK 4DFMA 1NK7A 3KKRA 4IWVA 4CW7B 3KWGA 3I56N 1NGFA 1VK0A 2HMIA 1EKEA 2YKMA 3LAMA 3V6DA 3ZLJA 2HBLA 3VA0A 5I9EB 2P9UA 2HF4A 1JXEA 1WBDA 3G10A 2O8EA 1SV5A 1CLQA 2YJFA 2BDPA 4K25A 4ZTFA 3TSUA 2P5OA 4ELTA 3QNNA 3HJFA 4A62A 1S1UA 3B6OA 4OPKA 3N4QA 4GV6A 2E2OA 2DFHA 1C0MA 3K59A 2PBDA 3WXJA 3KK3A 2JWLA 4JKGA 2ZQBA 3SQ0A 1L3SA 3WXKA 1MWKA 2P9UB 4CECA 2QM1A 2UXCK 2O8EB 2HHUA 2X78A 3E01A 1DTTA 5AZJA 1XHZA 1XNRK 1ATNA 3DRRA 1N33K 4I6MA 4NO7A 3IRXA 1NK4A 1SUQA 1VRUA 2DFEA 3M5RA 5GAGP 1HNXK 1NNEA 1RBRA 4E7KA 4JKGB 3EKUA 1B9FA 4G1QA 4BR0A 4A59A 3DLHA 4GNIA 2HBKA 2BH1A 4FZZA 4AF1A 3QDKA 2QTDA 2DTUA 3AVNA 3WQTA 2Q36A 5ELZA 4CERA 4I6MB 4CEZA 5LJVA 4GMJB 4B9VA 4DTUA 1I3AA 2HB5A 1J5EK 3PIOL 1ZBUA 2A3ZA 4E1NA 3O3HA 4XH5A 4C8OA 4M3TA 1HX1A 2AA4A 3HL8A 5J2PA 3MN9A 4JKCA 3K58A 4AQYK 3VQDA 1X3NA 2YHWA 3AAPA 4FWNA 1NMNA 2PAVA 2E2PA 4CJUA 1KLMA 1ESVA 3UKUA 1Q9YA 3VEWA 3O4QA 3H1VX 4JKBA 3DOKA 2LSNA 3Q7CA 3QFPA 4CGGA 5EXWA 4DSEA 5DMRA 4BE1A 3EKSA 3H1QA 5CZ2A 2B5JA 1NGGA 4H0XB 1RGIA 3OHRA 3NF9A 4DFJA 3CCUN 1C0TA 4IG0A 4DV4K 4A5BA 1Q8IA 3C7NA 1NBWA 2Z1GA 4GVMA 3OYHA 1NK6A 1BQMA 4DQ8A 4A61A 1JLAA 4CEQA 2P9PA 3P39A 3PUFA 1W2BM 1HYVA 3TAFA 4H0VB 2P9SA 3MMVA 3ZSZA 1YF5L 5LJWA 1TAQA 3QEXA 4OJRA 1NM1A 5KGXA 1Z26A 3LWLA 2IOCA 4B08A 4O0IA 4E7HA 3C7NB 4CJ3A 1MWMA 3KLFA 3BP8A 4DS5A 1JXBA 2JLEA 5AQLA 3U9ZA 1W0HA 1ASUA 1BOTO 4BRPA 3VF4A 1HKGA 2E2QA 3FZKA 3Q7BA 2P9PB 4EIAA 4W5TA 2IVPA 3O5BA 4IOCL 3ZETB 2A1SA 3L2RA 3R8EA 1GLEG 4HTUA 1ZYQA 1BIUA 3OYEA 1IBMK 4FVUA 2I7NA 4BRIA 1KSPA 3MWPA 4WFNL 3WQUA 4BR5A 3GG4A 1TK0A 4FJHA 1EWQA 4IKFA 3ZSRA 3NF7A 4M41A 4BQZA 2P1JA 4XIUA 2NNWA 4JNEA 2WUSA 3VQ6A 4CJPA 4WFBL 3P1GA 5M1OA 4FVMA 4RG8A 3ATVA 3A8YA 4N76A 2O8CA 1S1WA 2NLXA 1U45A 4IFYA 1A5XA 5JLFA 5EVZA 2PFUA 4KAZA 2A5XA 2FBVA 1C1BA 1M90O 3QO9A 3VMFB 4OGEA 2GWKA 2VWKA 4CJRA 4JAXA 5AFUA 2WTUA 4DF4A 4B9LA 2O8CB 2FSNA 1MA9B 3G71N 3WXIA 2B6AA 2E5LK 3LP3A 3HP6A 4F2SA 1RT7A 4HWIA 4B1UB 3HPHA 1S3XA 3N4PA 1X9JA 5AQOA 5DK5A 3ZSQA 3DLRA 2IC3A 4BRDA 2QWLA 2NRVA 1ZBLA 4Z4EA 1BA1A 4WYBA 4I2PA 1QE1A 2IAJA 1HJOA 1J54A 4GVEA 2OYQA 3F5TA 3E9LA 5IT9O 3ZSVA 3MXMA 3EN9A 3FE1A 3FZFA 3SK3A 2ASOA 4C23A 3KZBA 1KC8O 4CIEA 4BDYA 1OKJA 4RCHA 4CHOA 2YJEA 2RPIA 3QLHA 4JEPA 3BF1A 4FXDA 5CHIA 4BR2A 1Y97A 3AA2A 2IGIA 3OYCA 4HTLA 4ZTJA 4AHTA 3DYAA 2VYPA 3DOLA 3LDSA 3VETA 2ZJRL 1QSLA 1ASVA 1U49A 4CEOA 3CPWM 5FPMA 3CQ8A 1HNVA 2R7YA 4DUZK 1SQKA 4W5OA 4L3QA 1QZ6A 4C8LA 3CYMA 2P9NA 4FWMA 3CFPA 5BN8A 3NF6A 3D0PA 1Q86O 1HRHA 3TARA 5AQTA 2QWNA 4LF6K 1WBBA 4DSKA 3I0RA 1QQCA 4WF9L 3CCMN 5AQIA 2OZMA 4PKGA 3A5MC 3AO5A 3LDNA 1TL1A 3FLCO 2HHHK 2KLAA 4H4OA 2B4JA 4DKWA 3HT3A 4DS4A 3EZWA 2GEMA 3NVMA 3EEQA 3MN7A 1QSSA 3NH0A 1D5AA 1BISA 1W7AA 4CIFA 5FRNA 1HMVA 3MX2A 2JGUA 3PY8A 2ZF5O 4E7LA 4B3SK 3G6EN 4B1YB 1FW6A 1BL3A 4CFBA 2EHGA 1UWBA 4JYAK 4FLVA 4JS5A 3SV3A 2F96A 3V1OA 1SKRA 1NG9A 3CMEN 3L2VA 5CE3A 3KLHA 4DR1K 3C65A 3O8MA 2IVOA 5LMNK 4FJ7A 2HHVA 1QQOA 4WCEL 4K42A 1MU2A 4MFBA 4BRQA 3G0ZA 5J2NA 2WBNA 4CK3A 5ADXA 3LPUA 4CEAA 4X66K 3NDKA 1TAUA 2E6LA 4H03B 3V81A 5KQDA 4MO5A 1SKSA 4HCBA 2UXBK 1N34K 1YHQN 1OVYA 4FLZA 2NUBA 3M6GA 4JD2A 2Z1HA 4LH4A 3RR7A 3AA4A 2P9IA 4BC2A 4NXMK 3PX6A 4B3TK 1RT2A 4CHYA 4FK0A 2KFNA 3MECA 4FWSA 1VQ8N 3VQPA 5HOOA 3PX0A 4FJMA 1EQYA 4W5QA 3TU5A 4AHCA 4CZIA 1BO5O 1NK9A 1CXUA 4JD2B 2KZMA 1EWRA 1KAYA 2P9IB 1LAWA 2ATQA 1HYSA 2GUPA 4JI0K 4BR4A 2KTQA 2HBMA 4GW6A 4B9UA 3OYIA 5BR8K 2PY5A 1YTAA 4KTWA 4CK2A 1QTMA 2E88A 3AGRA 3VQ4A 1HYZA 3OYGA 3ZX2A 3HM9A 1SS6A 3AY9A 4EHTA 4CVNE 2FBYA 4HUFA 3CM6A 4I9LA 4IBNA 4O8UA 5C2DA 1LCUA 2KKZA 3S3NA 3VGMA 5K14A 3LWMA 1XUPO 3DM2A 4YOWA 1LWEA 3MEDA 2V7ZA 1RDWX 3CC4N 3L2UA 4XH4A 2HHXA 4LFBK 4M7XA 4BACA 4IOAL 5AQWA 3LDOA 3NF8A 4CJ5A 5BN9A 2ASMA 3FFIA 3M3ZA 3E9OA 2E20A 4AHSA 4KB0A 4RWTA 1WAJA 2D1KA 4BVOA 1YTUA 5AQHA 4DR3K 2QWRA 3OYKA 1XHXA 4DTPA 4UQGA 3HSTB 4CJFA 2F8SA 3PSFA 1KFDA 1ZBFA 4PY5A 5HRNA 4YNQA 1NGDA 1OH6A 4FJJA 1VQ4N 4ILGB 4CD1A 3M8PA 4G9ZA 3NGZA 1GLAG 3LALA 4BC3A 3C6HA 4KTZA 4M7YA 3DLLL 5TKWA 4RW6A 3T1YK 2ETJA 4FK4A 4OKJA 5BPLA 4BWJA 2EWSA 3MEGA 4CF2A 2CH6A 3TWHA 3RMAA 3G4SN 4E1JA 4N56A 4Q5VA 3KTQA 5JS2A 2XO7A 1HPMA 1DKGD 1BCMA 1JL2A 4CZGA 4HVJA 4YOVA 1RT3A 2AJQA 5AQNA 3BUZB 2HF3A 4CBXA 2XY6A 3ZEUB 4B9MA 2Q1NA 1OVQA 4KHNA 1JKHA 2RN2A 1LOTB 4JS4A 1S72N 3CHWA 4CCHA 3OYBA 4NCGA 1V4TA 3ZSWA 2G8VA 4CJ7A 3QB0A 5BR9A 4Z4HA 3SZ2A 4B3RK 4IO8A 1HUXA 2BE2A 2HNYA 3DRPA 3VGKA 4H5VA 3AVGA 4Z4GA 4CF9A 1LWFA 4IFVA 1EXQA 4ISGA 1T05A 1G99A 3GL1A 2Y1JA 1IKVA 2D0BA 4CZKA 2VG7A 3THVA 1J53A 3MCPA 1C1AA 3JYTA 1G15A 1HNWK 4LF4K 3G25A 3LPTA 3CCEN 4GKJK 3FZHA 1K8KB 2UU9K 4IZ9A 3TTDA 2RF2A 2YV0X 1FKPA 1T6CA 3RRHA 4JI7K 1IH7A 3WXMB 2OA8A 2UUBK 3VQAA 4C1NI 1GOBA 4ICLA 4DMNA 3L4IA 3DI6A 3ENBA 1S9EA 1WLJA 3L3UA 3CI5A 2OPPA 1SL0A 3IAYA 2O8FB 2D4WA 4O44A 4NYNA 4CIGA 2ZJQL 2NRHA 3V9SA 1S5JA 5LMUK 4DV6K 1RCHA 2VG5A 1JCEA 4FO0A 4O8KA 1K6YA 3ATUA 4KHYA 4YOXA 3WT0A 1NKEA 1WN7A 3QIPA 4B8CA 3AO1A 1HKBA 4KB1A 1IKWA 1HQUA 3CCRN 3D7EO 4CGDA 3QEWA 1BI4A 4FSVA 3P5JA 3MDQA 3L2WA 4IJAA 4YY3K 5A2QO 5H1SQ 1R0AA 2BANA 3SAFA 1CZ9A 1YVNA 1TUYA 4JKEA 3D2FB 4LFAK 1XMOK 4PKHA 3VN5A 1WNSA 4CF1A 4FW1A 4MQ3A 3UKRA 4A57A 3EYZA 1A5VA 1XNQK 1UA1A 4FJ8A 3SUNA 3NCIA 2QI2A 1BI4B 1U4BA 4Z4IA 3CCJN 3BDPA 2HHTA 2PZSA 3O3GA 2QWPA 3SMPA 2CGLA 1IO2A 3T7ZA 4K43A 2O4IA 3UKRB 1RTHA 2F9TA 1VHXA 4B9QA 5C42A 3LZIA 2BGGA 1YAGA 1EETA 4DV7K 4L8RB 1RDCA 4M3ZA 3DJCA 2G8HA 1X1PA 4E7IA 3FFKB 1SL1A 4DQPA 5E41A 1XC9A 3C6AA 1S9GA 5HRRA 1JLFA 3C95A 4YORA 4JI4K 4KBOA 2QXLA 2Y1IA 1TK5A 1H1VA 4X64K 3KK1A 1FKOA 1CZBA 1VAZA 3F9KA 5CR4A 5AQYA 3OYJA 5F2RA 3C6UA 2QKKA 1NOYA 2F9WA 4JI1K 3NVKA 4IFEA 4JKDA 2O8DB 3OYMA 4GV3A 3KD1E 2HBJA 5SWMA 2V52B 3BGRA 5M1QA 1GLFO 4CZEA 5C12A 1HLUA 3AVKA 4Y0WA 3A0IX 3ZETA 1VQ5N 4JKHA 4CESA 1WB9A 5KQ8A 1LAVA 4FCYA 4AHUA 3HO1A 4E7JA 4FZXC 4BRMA 1NJZA 2Q97A 3BZCA 4NCAA 2VG6A 4W5RA 2GX9A 3FR0A 4KHWA 1O13A 4KI4A 3JSMA 2HNZA 3CPEA 4QS8A 4FZYA 2IDOA 3OYLA 3CCLN 4AM6A 1WSHA 1QQMA 4IDKA 4BRCA 4R5PA 4BDZA 1N6QA 4DLGA 2OPQA 3ID6A 3SPZA 5CYQA 3ENOA 5J2MA 2UUAK 4CJQA 4DTNA 3LAKA 4DR7K 2UXDK 1RBSA 5AQVA 3JAMO 4DV1K 3SJJA 3CXCM 4CZLA 5AQSA 5GADP 4KHSA 3H6EA 1KAXA 3ULDA 4C8MA 1QQNA 3HBTA 4JI6K 4LC9B 3V1QA 1TL3A 1NGIA 3J7ZO 5AQJA 3MX5A 3SUQA 2YHYA 4KHUA 3FGUA 4BQLA 3QESA 4KH5A 3K9JA 1NGHA 4KHQA 4FPAA 4BROA 4BRFA 2KFZA 4C8NA 3SYZA 4B1VA 1REVA 3SCXA 3CQYA 2YHAA 3O4WA 1BA0A 3ALYA 1IG9A 4FM1A 5KTQA 1TYQB 2W40A 3BF3A 3J7YP 4M3WA 4WQ5C 3HK2A 4EAHD 1FXXA 3HP9A 4CEFA 4FWPA 1QVFM 3GOIA 5AQFA 3MXJA 3DLKA 2ZM6K 4CJVA 2G8IA 3LM9A 4OPHA 3BEXA 1U2VA 4BGBA 4KHPK 4B9TA 1KVBA 5JS1A 5HRPA 3OW2M 3MXIA 1VRTA 4LSNA 4CJTA 2VCPA 3B8AX 4O55A 2UUCK 3WEEA 1SZ2A 1WSEA 2FLOA 3P38A 3PLAA 1CXQA 2FBTA 4UY8O 4FYDA 1LW2A 4N47A 4E1MA 4WE1A 1RDUA 4LY7A 4BR7A 1U2VB 1XI1A 3RVCA 3QBWA 3AAQA 2YCHA 3IKMA 1DT9A 3M1FA 3AVMA 3M8QA 1VQ9N 3KIOA 5C24A 4JV5K 2D0PA 3WEEB 5HL7L 4IDHA 4H5WA 4Z4CA 1LV5A 1HJRA 4GV9A 4EHUA 3HVTA 1D9FA 2I7PA 3E9PA 2OPRA 2HVHA 5AQGA 4B9NA 2PYJA 3PO4A 4DR6K 4H8KA 4A2AA 5I3UA 3RRGA 4JRPA 3A5OC 4ID5A 3VA3A 1XC3A 2XRIA 3EL2A 5AQXA 3R3LA 4DLEA 1ASWA 1FJGK 4BC5A 4JK8A 4LF5K 4ID1A 3VQ8A 2VWBA 4LSLA 4BC4A 2FXUA 3TSQA 4BE0A 1VSFA 2E1ZA 2DPNA 2YNHA 3HM8A 3I8BA 1C0UA 3KD5E 5AQRA 5M1NA 3LDLA 4FJ5A 1GLLO 2XY5A 4DWIA 5E26A 1VQMN 1X9WA 2VGNA 1WSIA 4BWMA 4CK1A 1VSJA 2E2NA 2O8BB 2CGJA 3IDHA 3F73A 3D45A 1BGXT 3KHYA 5KI6A 4JRQA 3ZSXA 3VQEA 1RTJA 2KHOA 5BPNA 2HMPA 1RT6A 3F2KA 3K5MA 4YHHK 3IMXA 4R79A 1C6VA 1LWCA 3TAMA 3WNEA 1NGCA 4DHYA 3QEVA 4CZHA 4LH5A 1IV0A 1D9DA 4RW9A 5BRHA 3DWLA 3AVIA 3CG7A 1KCFA 4DTSA 3J7AP 1E4FT 2NRTA 2X74A 4BRGA 4FWQA 4C8KA 3OJSA 3O08A 4YOTA 1GLCG 3HXMA 1D4XA 4CBUA 1HPZA 1GOAA 3IS9A 4FWRA 1Z05A 1N36K 5C2FA 4JHDA 3K5NA 3JXUA 4WQ5A 3VENA 1JCGA 1S6PA 2D5RA 3CFOA 3OS2A 1RDDA 2KQ2A 4NLBA 3NGIA 1N8RO 4FPBA 2OTLN 5TKYA 3HVRA 1YI2N 1SKWA 5FPEA 4JI3K 3SUPA 4BRNA 4CZMA 4E19A 5AQUA 4O5BA 2W6KA 4JHDB 3AV9A 4X65K 4M42A 4N41A 1R59O 3E66A 1JCFA 2A41A 4FOIA 3ZT4A 5BRFA 2NRRA 4FLUA 5F0XA 3TTFA 5EX5A 3S3MA 2Q3SA 5AJ3K 1VSDA 4X62K 4F9OA 1IBLK 2J4RA 4PL7A 4KPYA 1YVUA 3M8RA 2G8UA 3OS1A 3OVNA 4BE2A 4WFAL 5EY4A 1NKBA 1BUPA 1QHAA 2GBZA 3AVLA 5M1PA 5HROA 4BRLA 1JJ2M 4FJIA 3L2QA 4ELUA 1L3UA 2Z1IA 5JVHL 4AILC 1L3TA 3LM2A 1Q82O 4M3RA 4I9QA 4W5NA 2NRWA 3ZCMA 1T44A 3VF2A 1NK5A 4E0DA 2Q0RA 1KFSA 2OPSA 3U3YA 1DEJA 3CCQN 4F2RA 5BPMA 3U8XA 2E8AA 2GWJA 1KQSM 1Z6RA 3K57A 3CFRA 2YHXA 2FC0A 3NGYA 3THXA 4LF9K 2QA4N 3U3GA 3HOTA 4PUOA 3VQCA 5CZ1A 4DV0K 2A1RA 1UOCA 3AGKA 4RW7A 5B8HA 3NH1A 4M3UA 2E4LA 4DUYK 3AA3A 1ATRA 2QKBA 4CGIA 3HPOA 1ZBSA 3OYNA 3THXB 4OX9K 1W9HA 5AZIA 4KREA 3O9RA 3ZEUA 3IFRA 3VTIA 2HHWA 3V9XA 3RMDA 1JLBA 3CCVN 1JLGA 5CY4A 3OBWA 2ZJPL 3HZ6A 4M45A 3QMLA 3TAPA 4JK9A 4RW4A 3K2PA 3CJ1A 3I8DA 4GKKK 3ULEB 1T03A 2ZGZA 4EP4A 4HUEA 3CF5L 4LFCK 1BHLA 5AZIB 3DMJA 3QETA 3T19A 3RMCA 3UE5A 4KTQA 3QINA 3L0QA 3U4LA 1JLEA 4CGHA 3MAQA 4F8RA 4KH6A 1RTIA 3QNOA 3MN6A 3U9DA 2IIRA 4IJNA 1S1TA 3P31A 4Y1CA 3V1RA 5AR0A 4E89A 3I55N 4I2QA 4MDBA 1K8KA 1Z25A 3TTCA 5KRSA 3TABA 3AO4A 2F4VK 2YKNA 3SLCA 4V19S 1OH5A 4J8FA 1RT4A 1RDBA 3THYB 1D8YA 3I33A 3C94A 2W42A 3THWA 1N5YA 1BQNA 4CFAA 2KW4A 4B3MK 3ZYYX 5DM6L 2O8FA 4YDUC 5BRDA 1VQ6N 1KVCA 3A2FA 2P9LB 4PA1A 1GLBG 4OPAA 1HNIA 2YX6A 3UB5A 4WQ4C 2IS3A 3VPZA 5EOYA 4DTRA 2DY4A 1ILYA 3B6PA 4KFBA 3THWB 2YI1A 1U47A 4BRAA 3QERA 3CD6N 2UYTA 3ID8A 1YIJN 3O1BA 3PSIA 3VEXA 3QBXA 3DXMB 1VSHA 3M8SA 1DLOA 4NB4A 3HPGA 5M1FA 3EE8A 5HBMA 1XWLA 4DU3A 4IO9L 3QFUA 1MDUB 3O9TA 4MO4A 3HOSA 3NE6A 4BY9C 5FRMA 1NOZA 1S1XA 4J2EA 3J8AA 2QW9A 3D2FA 3WNFA 1NGJA 5MLCQ 4FWLA 1NJYA 3QIOA 2G8WA 1YJWN 3AVHA 4CHNA 3KK7A 3RWUA 3DLEA 3EO3A 4KKOA 1EO1A 3R9PA 3RSEB 5I42A 4Y1DA 3BY5A 2QXFA 3MN5A 2PYLA 3LDQA 2HVIA 3LL3A 4PHTX 3H08A 5AQMA 3VQ9A 4TSXA 4DFPA 4CJEA 5M1KA 2FSJA 3WXLA 4DQIA 1T3VA 3I0SA 4OLBA 4JKFA 3OTOK 4ILHA 3U6FA 3VQ5A 1VQKN 2GTDA 4U67L 1Y64A 4JKAA 2VQEK 1NJIO 5CYMA 4DQSA 3T1HK 1RT5A 1HNZK 3F9MA 3CMAN 4KRFA 4M3XA 4H5RA 3C0BA 3V4IA 5FLXO 4K8ZA 3AVAA 4CJ4A 2P9KA 1T8EA 1X9SA 5AZJB 4IEEA 1KTQA 3LP0A 4CZFA 1TKXA 4QAGA 4FM2A 1P90A 4EFHA 1TKDA 4OPJA 1QSYA 1IJJA 3SI6A 2O8DA 4H0YB 3CJCA 2WFBA 4KI6A 1XQSC 2P51A 2G8KA 1NGAA 3KLEA 3SJHA 5AQPA 4FJXA 1L5UA 5ADXH 1KXPA 1VQNN 2P9KB 1J9AA 2YHBA 3T3FA 5C15A 1TUUA 2A40A 3O9QA 1IKXA 5T7BA 1VSEA 1FK9A 5JLHA 5KGWA 4DV3K 3DLGA 3MK6A 4RTFD 3S3OA 1Q7YO 4K0KK 1NK0A 1RILA 3TANA 5J2QA 4CI6A 2WC9A 3LP1A 4OVLA 4YDUA 3OYAA 1T6DA 4M63C 4M3YA 2HW3A 1GLJO 3UKUB 4WQ4A 1VSLA 1S6QA 1SL2A 1CZAN 1YXQA 4DV2K 4XH1A 3OS0A 4JI5K 1JL1A 4HCCA 2F7TA 4NYFA 2V51B 3MWTA 3BZKA 4OKKA 1BDGA 1RBUA 3WNHA 1KAZA 4B1XB 4CZJA 1TV6A 1VQON 4PWDA 5AQQA 4NXNK 1RNHA 3ASMA 3QICA 4Z94A 3DLBA 3ITHA 3V9WA 1VSKA 4FM0A 4AH9A 5FROA 2OZSA 1SAZA 2QWOA 3VOVA 4FJGA 2P9SB 5DM7L 3V9ZA 3CJ9A 1C0GA 4H5TA 3CC2N 2HHSA 4JN4A 3ZSOA 4DTOA 4LF7K 4FWOA 3SBTA 1C1CA 1EP4A 1TYQA 4FK2A 2ITGA 2XY7A 1W97L 4CJWA 3AO3A 5GIPA 5HLFA 1U48A 1S1VA 3TR8A 4Z0UA 4CE9A 2A42A 2BUPA 3RR8A 5AQZA 1BIZA 4BREA 3D2EA 4DFKA 3L3VA 1RDAA 3TPQA 3L6QA 5FPNA 5JVGL 1WAFA 3IUCA 1KVAA 1B92A 4DTJA 1A5WA 3VEZA 1O1WA 4H4MA 1IBKK 3KJVA 3OJUA 4BRKA 4DSFA 3E1YA 3OBYA 3ISNC 3K5OA 3P4IA 5JMVA 3KKSA 3EZ5A 2XY8A 1BU6O 3ZX3A 1TK8A 4OO1J 4H0PA 3DRSA 3D2EB 1I39A 4H0OA 4BRHA 4BVPA 1Q18A 1VQLN 4E3SA 2VGMA 2OTJN 3W0LA 4ILJA 4BDPA 1V4SA 4A2BA 4DR5K 3CQXA 5JICA 1ZBIA 2GV9A 2FF3B 5GIOA 2ITMA 5KRTA 2D0OA 1J5OA 2ASPA 3H3NO 3NMUA 3OA9A 1GLDG 3LP2A 4DU1A 3UIQA 4QS9A 1YT3A 2D0CA 2QWQA 4BG8A 2IVNA 2RE2A 4DB3A 3C6TA 4ISFA 4AM7A 1QS4A 1T7PA 4F3OA 4FLYA 4FLTA 1J6ZA 1YUWA 4FJNA 3MCAB 3O9SA 2XHBA 3CJ7A 2HSTA 1OH7A 2ZWHA 3DAWA 3CM5A 5FDLA 3PV8A 3H46O 1IG8A 2FSKA 1C0FA 1ATSA 3VEYA 5E84A 1E4GT 4FLWA 1WSGA 1HR0K 1YJNN 1WSFA 5C0YA 3CJBA 3R1XA 4CFDA 3VQBA 2O8BA 3NAEA 3RTVA 4LF8K 1DGKN 1RBTA 3H3OB 4F3TA 3RMBA 4OLAA 4DV5K 4XEIA 4CGFA 5GINA 3SQ1A 3SAGA 3AVFA 4Z4FA 3CCSN 2H3GX 3KK2A 3AARA 2OANA 3CJAA 4CHQA 2QK9A 4KV8A 3ENHA 3JS6A 2EX3A 2P9NB 3H45C 5HP1A 1WUAA 4DQRA 2FBXA 3VGLA 1NGBA 4Q0BA 4DQQA 1YITN 2CGKA 3OY9A 2HNDA 5C25A 3VF6A 1I94K 2P5GA 1NJWA
chains in the Genus database with same CATH topology
4M41A 3OYNA 4KREA 1W9HA 2P1JA 4XIUA 3L2WA 4F4KA 3VQ6A 4DSLA 2HHWA 3V9XA 3RMDA 1JLBA 4CJPA 3P1GA 4I7FA 2BANA 1R0AA 1CZ9A 1ITGA 4FVMA 1JLGA 4RG8A 5CY4A 2ZD1A 5D3GA 4M45A 4EP5A 3VN5A 1WNSA 3AO2A 4CF1A 4N76A 4FW1A 4MQ3A 1S1WA 3S9HA 3TAPA 4RW4A 1U45A 4YFUA 4IFYA 1A5XA 3EYZA 3K2PA 3I8DA 3KLIA 1A5VA 4KAZA 3P83D 1UA1A 4FJ8A 2FBVA 1C1BA 3SUNA 3QO9A 3NCIA 1U4BA 1BI4B 3SPYA 1T03A 4OGEA 4EP4A 4HUEA 4NCBA 4Z4IA 3OYDA 3BDPA 1BHLA 1TGOA 4OGCA 3DMJA 3NBPA 3QETA 2PZSA 4J2BA 2F8TA 2HHTA 3T19A 4AHVA 3O3GA 3RMCA 2VWKA 4KTQA 4CJRA 1IO2A 2G8FA 3AVBA 3QINA 1U04A 4DF4A 4B9LA 2HHQA 1JLEA 4CGHA 3MAQA 4F8RA 2O4IA 1TKZA 1RTHA 4B9SA 4CJSA 2B6AA 1RTIA 3LP3A 5C42A 3HP6A 3QNOA 3LZIA 4F2SA 2BGGA 3TAEA 1RT7A 3HPHA 1EETA 5DK5A 3ZSQA 3DLRA 2IC3A 1S1TA 4QCLA 3PX4A 1ZBLA 4Y1CA 3V1RA 1RDCA 4L8RB 4HUGA 4M3ZA 4Z4EA 4E89A 4DTMA 4I2QA 2G8HA 1Z25A 5KRSA 1B9DA 4I2PA 1X1PA 1QE1A 3AO4A 3TABA 4HHTA 2IAJA 2YKNA 4E7IA 3ZSYA 4AHRA 1SL1A 4JLHA 4DQPA 1J54A 5E41A 2OYQA 1XC9A 5J1EA 1S9GA 1RT4A 1JLFA 3C95A 1RDBA 4KO0A 5HRRA 3ZSVA 3MXMA 2Y1IA 1TK5A 1IKYA 4QOZB 1D8YA 4CIEA 3C94A 3KK1A 3SQ4A 2W42A 4BDYA 1N5YA 3MEEA 1FKOA 4CHOA 1CZBA 1BQNA 2RPIA 3QLHA 4FW2A 2WONA 4CFAA 3F9KA 3SUOA 2KW4A 1JLCA 3OYJA 4FXDA 3C6UA 3SQ2A 1NOYA 2QKKA 1VSIA 1Y97A 3TAGA 3AA2A 3OYMA 2IGIA 1KVCA 3A2FA 4J2AA 4PA1A 3OYCA 3OYFA 3KD1E 5SWMA 3QEIA 1HNIA 1RBVA 3AVCA 4CHPA 3IG1A 2IS3A 4ZTJA 4AHTA 3DYAA 3DOLA 3LDSA 3BGRA 4DTRA 2DY4A 3B6PA 4KFBA 1QSLA 1ASVA 3AVKA 1U49A 4CEOA 3CQ8A 3PO5A 4CESA 1HNVA 2R7YA 1U47A 3QERA 4W5OA 1LAVA 4FCYA 3TI0A 4C8LA 3CYMA 2ZE2A 4AHUA 3HO1A 3CFPA 4E7JA 4FZXC 4B3OA 3NF6A 3D0PA 3WNGA 1VSHA 4CEBA 1NJXA 1HRHA 1NJZA 3M8SA 4NCAA 4EZ9A 2VG6A 1DLOA 4OKEA 3O4NA 3TAQA 3TARA 1WSJA 3HPGA 4W5RA 4DSKA 3I0RA 1QQCA 5HBMA 1XWLA 4DU3A 4KHWA 4KI4A 3JSMA 2HNZA 2OZMA 4FZYA 3NH2A 2IDOA 1JLQA 3OYLA 4DF8A 3VQ7A 4CHZA 3NE6A 4DSIA 1ZBHA 2I5JA 5FRMA 1VSMA 1WSHA 3AO5A 4IDKA 1NOZA 1S1XA 1HQEA 4R5PA 4BDZA 4J2EA 1TL1A 2WOMA 4DLGA 1UA0A 1N6QA 4J2DA 1LW0A 2OPQA 4H4OA 5CYQA 3SPZA 5J2MA 1TVRA 3WNFA 2B4JA 4CJQA 4DTNA 3T1AA 1X9MA 2DFFA 3K5LA 1NJYA 3QIOA 2G8WA 4EZ6A 3LAKA 2GUIA 3HT3A 4DS4A 3AVHA 4CHNA 3RWUA 3DLEA 1RBSA 4KKOA 3LZJA 3NFAA 3SJJA 1QSSA 3NH0A 1KLNA 1D5AA 1BISA 5FRNA 4CIFA 5I42A 1HMVA 4Y1DA 2JGUA 2YNGA 2VWJA 3PY8A 4O4GA 1Q9XA 4E7LA 4RW8A 1TKTA 1F21A 4KHSA 4DU4A 2QXFA 3ULDA 4C8MA 2PYLA 2HVIA 3EY1A 1BL3A 3ZT2A 2EHGA 4CFBA 4FJ9A 3V1QA 1UWBA 3H08A 1TL3A 4FLVA 4JS5A 1NK8A 3SV3A 2F96A 4DSJA 3V1OA 3VQ9A 4TSXA 4DFPA 3SUQA 4CJEA 1SKRA 4KHUA 3VQQA 3AVJA 3QESA 1NKCA 3NHGA 3L2VA 3KLHA 3I0SA 4DQIA 4KHQA 4OLBA 1RTDA 4FJ7A 2HHVA 2KFZA 4C8NA 2KZZA 3U6FA 3VQ5A 3SYZA 1MU2A 4MFBA 1REVA 3SCXA 3SNNA 2YHAA 2RKIA 3G0ZA 5CYMA 5J2NA 3ALYA 4CK3A 4CF8A 4DQSA 4FM1A 5KTQA 1IG9A 1RT5A 3LPUA 3ZT1A 4CEAA 4KRFA 3NDKA 4M3XA 4M3WA 1TAUA 2E6LA 3ZT3A 3V4IA 4FJLA 4K8ZA 3HK2A 3AVAA 2YNIA 4CGJA 4CJ4A 3V81A 1KRPA 1FXXA 3HP9A 4CEFA 1T8EA 1X9SA 1SKSA 4HCBA 1DTQA 1BCOA 4B8AB 4N5SA 3QEPA 4FLZA 1KTQA 3LP0A 1TKXA 2NUBA 3MXJA 3DLKA 4QAGA 4CJVA 4IG3A 4OPJA 4FM2A 1TKDA 2Z1HA 4LH4A 4CJKA 1QSYA 3RR7A 3SI6A 3AA4A 4B9TA 3PX6A 1KVBA 3ZT0A 4FJKA 5JS1A 2YNFA 5HRPA 3MXIA 2P51A 2G8KA 1RT2A 4KI6A 1VRTA 4LSNA 4CJTA 3KLEA 4O55A 1L5UA 4FJXA 5SZTA 2PY5A 4CHYA 3O3FA 3AA5X 4FK0A 1WSEA 3MECA 2KFNA 3VQPA 1J9AA 3PX0A 2YHBA 4FJMA 4W5QA 1CXQA 2E6MA 3T3FA 2D0AA 2FBTA 4AHCA 4FYDA 1NK9A 1LW2A 4N47A 1IKXA 1CXUA 4E1MA 1L3VA 4WE1A 2KZMA 5T7BA 4LY7A 4K8XA 1VSEA 1FK9A 1LAWA 5KGWA 2ATQA 3DLGA 1XI1A 1HYSA 4LD0A 3S3OA 1NK0A 1EX4A 4CEEA 2KTQA 1RT1A 4CF0A 3V9UA 3AVMA 3M8QA 4GW6A 4B9UA 3OYIA 1RILA 3KIOA 4FLXA 3HYFA 1YTAA 5J2QA 3TANA 5C24A 3KLGA 4KTWA 4CFCA 2X6NA 5EU7A 4CK2A 1QTMA 1UAXA 3LP1A 4OVLA 3VQ4A 3OYAA 1HYZA 3OYGA 4Z4CA 1LV5A 4O0JA 2O4GA 1HJRA 3HM9A 4M3YA 2HW3A 4ZHRA 3HVTA 1D9FA 2FBYA 1VSLA 1S6QA 3CM6A 4I9LA 4HUFA 1SL2A 2OPRA 4IBNA 5HRSA 4ELVA 2HVHA 4PQUA 2Z1JA 2X6SA 3L8BA 4DG1A 5K14A 3LWMA 3S3NA 4B9NA 3DM2A 2PYJA 4CEDA 1LWEA 3PO4A 3OS0A 4CJLA 3MEDA 4H8KA 3SV4A 5I3UA 1JL1A 3RRGA 4HCCA 1QHTA 4JRPA 3L2UA 2HHXA 4NYFA 4ID5A 3VA3A 3LANA 4OKKA 4BACA 2XRIA 4DTXA 1GOCA 1RBUA 3WNHA 4DLEA 4DFMA 1NK7A 1ASWA 1TV6A 3KKRA 4PWDA 4ID1A 1RNHA 3ASMA 3NF8A 3VQ8A 1VK0A 4CJ5A 3ITHA 4LSLA 3V9WA 2HMIA 1EKEA 1VSKA 2YKMA 3LAMA 3V6DA 4BE0A 1VSFA 2YNHA 4FM0A 3FFIA 1C0UA 3KD5E 4AHSA 3VA0A 4KB0A 4AH9A 5FROA 1WAJA 1JXEA 3G10A 2XY5A 4FJ5A 4DWIA 1YTUA 2OZSA 1SV5A 3OYKA 1X9WA 2BDPA 1WSIA 4ZTFA 1CLQA 1XHXA 4BWMA 4DTPA 4CK1A 4UQGA 4FJGA 2P5OA 4ELTA 3HSTB 3QNNA 3V9ZA 4CJFA 3HJFA 1VSJA 1S1UA 2F8SA 3B6OA 1KFDA 1ZBFA 4PY5A 5HRNA 4OPKA 4YNQA 2HHSA 3ZSOA 4DTOA 2DFHA 4FJJA 3F73A 1C0MA 3K59A 3D45A 1BGXT 5KI6A 3KK3A 1C1CA 1EP4A 2ZQBA 3ZSXA 4JRQA 3SQ0A 2ITGA 3VQEA 4FK2A 3M8PA 1RTJA 3NGZA 1L3SA 2XY7A 3LALA 4KTZA 4CECA 4RW6A 2HHUA 4CJWA 1RT6A 3K5MA 2X78A 3AO3A 1DTTA 3E01A 5HLFA 1U48A 1XHZA 1C6VA 1LWCA 2ETJA 3TAMA 3WNEA 3QEVA 3DRRA 1S1VA 3TR8A 4Z0UA 4LH5A 1D9DA 4RW9A 4CE9A 3AVIA 3IRXA 3CG7A 4OKJA 4FK4A 4BWJA 1NK4A 3RR8A 1KCFA 1SUQA 1VRUA 2DFEA 4DTSA 1BIZA 2X74A 3MEGA 1RBRA 4E7KA 3L3VA 4DFKA 4CF2A 1B9FA 4C8KA 1RDAA 3TWHA 3RMAA 3OJSA 4G1QA 4N56A 4Q5VA 3KTQA 1WAFA 5JS2A 3HXMA 2XO7A 1KVAA 3DLHA 1B92A 4DTJA 1A5WA 1HPZA 1GOAA 1BCMA 1JL2A 3IS9A 1O1WA 4H4MA 4HVJA 4FZZA 1RT3A 3KJVA 3OJUA 2AJQA 2DTUA 3AVNA 3K5NA 4DSFA 4CERA 2XY6A 3ISNC 3K5OA 4CEZA 4GMJB 4B9MA 4B9VA 4DTUA 1I3AA 3KKSA 1S6PA 2XY8A 3EZ5A 2HB5A 2D5RA 3CFOA 4KHNA 1JKHA 2RN2A 1TK8A 4C8OA 1ZBUA 1RDDA 4E1NA 3O3HA 2KQ2A 3OS2A 3DRSA 4JS4A 4M3TA 1I39A 3NGIA 4E3SA 3HL8A 3OYBA 4NCGA 4CCHA 5J2PA 3ZSWA 2G8VA 3K58A 4Z4HA 3HVRA 3VQDA 3SZ2A 1SKWA 4BDPA 2BE2A 2HNYA 3DRPA 3SUPA 4E19A 3AVGA 4O5BA 4CJUA 1KLMA 4CF9A 4Z4GA 3AV9A 1LWFA 1Q9YA 4IFVA 4N41A 2GV9A 4M42A 1ZBIA 1EXQA 3O4QA 5KRTA 3DOKA 1T05A 2LSNA 3ZT4A 1J5OA 2Y1JA 3DLBA 1IKVA 2D0BA 4FLUA 2VG7A 3LP2A 4DU1A 4CGGA 3UIQA 3THVA 1YT3A 4DSEA 2D0CA 5DMRA 4BE1A 1J53A 3S3MA 2G8IA 2Q3SA 5CZ2A 1C1AA 2B5JA 1VSDA 3C6TA 3JYTA 1G15A 4KPYA 1QS4A 1YVUA 3NF9A 3M8RA 3OS1A 4DFJA 2G8UA 1T7PA 1C0TA 4F3OA 4FLYA 3OVNA 4FLTA 3LPTA 4IG0A 1Q8IA 4BE2A 1NKBA 4FJNA 2GBZA 2Z1GA 3AVLA 4GVMA 3OYHA 5HROA 1BQMA 2XHBA 1NK6A 4FJIA 1JLAA 4CEQA 2RF2A 2YV0X 3CM5A 1FKPA 5FDLA 3L2QA 3RRHA 3PV8A 4ELUA 1IH7A 1L3UA 2Z1IA 4AILC 1L3TA 2OA8A 3PUFA 3VQAA 1WSGA 4M3RA 4FLWA 1HYVA 1WSFA 3TAFA 4I9QA 4W5NA 1GOBA 4ICLA 4DMNA 3ZCMA 4CFDA 3ZSZA 1NK5A 3VQBA 1TAQA 3QEXA 4E0DA 4OJRA 5KGXA 3DI6A 1S9EA 1Z26A 3LWLA 1WLJA 3NAEA 3RTVA 2IOCA 3L3UA 4B08A 4O0IA 4E7HA 2OPSA 1KFSA 2OPPA 3U3YA 1SL0A 3IAYA 4CJ3A 3KLFA 4DS5A 4O44A 1RBTA 1JXBA 4NYNA 2JLEA 4F3TA 4CIGA 4F2RA 3RMBA 1W0HA 1ASUA 3V9SA 4OLAA 1S5JA 4CGFA 3SQ1A 3AVFA 4Z4FA 4W5TA 3K57A 3CFRA 2A1SA 1RCHA 2VG5A 3L2RA 2FC0A 3NGYA 3KK2A 4CHQA 1K6YA 4KV8A 4HTUA 2QK9A 2EX3A 1ZYQA 4KHYA 1BIUA 3OYEA 3U3GA 4PUOA 3VQCA 5CZ1A 2A1RA 1UOCA 4RW7A 5HP1A 4DQRA 1KSPA 1NKEA 2FBXA 1WN7A 3QIPA 3NH1A 4B8CA 4M3UA 3AO1A 4KB1A 2E4LA 1IKWA 4DQQA 4Q0BA 3AA3A 3OY9A 2HNDA 5C25A 1TK0A 1HQUA 4CGDA 4FJHA 2QKBA 3QEWA 2P5GA 1BI4A 4CGIA 4IKFA 3ZSRA 3HPOA 1NJWA 3NF7A 3P5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M41 A;  3OYN A;  4KRE A;  1W9H A;  2P1J A;  4XIU A;  3L2W A;  4F4K A;  3VQ6 A;  4DSL A;  2HHW A;  3V9X A;  3RMD A;  1JLB A;  4CJP A;  3P1G A;  4I7F A;  2BAN A;  1R0A A;  1CZ9 A;  1ITG A;  4FVM A;  1JLG A;  4RG8 A;  5CY4 A;  2ZD1 A;  5D3G A;  4M45 A;  4EP5 A;  3VN5 A;  1WNS A;  3AO2 A;  4CF1 A;  4N76 A;  4FW1 A;  4MQ3 A;  1S1W A;  3S9H A;  3TAP A;  4RW4 A;  1U45 A;  4YFU A;  4IFY A;  1A5X A;  3EYZ A;  3K2P A;  3I8D A;  3KLI A;  1A5V A;  4KAZ A;  3P83 D;  1UA1 A;  4FJ8 A;  2FBV A;  1C1B A;  3SUN A;  3QO9 A;  3NCI A;  1U4B A;  1BI4 B;  3SPY A;  1T03 A;  4OGE A;  4EP4 A;  4HUE A;  4NCB A;  4Z4I A;  3OYD A;  3BDP A;  1BHL A;  1TGO A;  4OGC A;  3DMJ A;  3NBP A;  3QET A;  2PZS A;  4J2B A;  2F8T A;  2HHT A;  3T19 A;  4AHV A;  3O3G A;  3RMC A;  2VWK A;  4KTQ A;  4CJR A;  1IO2 A;  2G8F A;  3AVB A;  3QIN A;  1U04 A;  4DF4 A;  4B9L A;  2HHQ A;  1JLE A;  4CGH A;  3MAQ A;  4F8R A;  2O4I A;  1TKZ A;  1RTH A;  4B9S A;  4CJS A;  2B6A A;  1RTI A;  3LP3 A;  5C42 A;  3HP6 A;  3QNO A;  3LZI A;  4F2S A;  2BGG A;  3TAE A;  1RT7 A;  3HPH A;  1EET A;  5DK5 A;  3ZSQ A;  3DLR A;  2IC3 A;  1S1T A;  4QCL A;  3PX4 A;  1ZBL A;  4Y1C A;  3V1R A;  1RDC A;  4L8R B;  4HUG A;  4M3Z A;  4Z4E A;  4E89 A;  4DTM A;  4I2Q A;  2G8H A;  1Z25 A;  5KRS A;  1B9D A;  4I2P A;  1X1P A;  1QE1 A;  3AO4 A;  3TAB A;  4HHT A;  2IAJ A;  2YKN A;  4E7I A;  3ZSY A;  4AHR A;  1SL1 A;  4JLH A;  4DQP A;  1J54 A;  5E41 A;  2OYQ A;  1XC9 A;  5J1E A;  1S9G A;  1RT4 A;  1JLF A;  3C95 A;  1RDB A;  4KO0 A;  5HRR A;  3ZSV A;  3MXM A;  2Y1I A;  1TK5 A;  1IKY A;  4QOZ B;  1D8Y A;  4CIE A;  3C94 A;  3KK1 A;  3SQ4 A;  2W42 A;  4BDY A;  1N5Y A;  3MEE A;  1FKO A;  4CHO A;  1CZB A;  1BQN A;  2RPI A;  3QLH A;  4FW2 A;  2WON A;  4CFA A;  3F9K A;  3SUO A;  2KW4 A;  1JLC A;  3OYJ A;  4FXD A;  3C6U A;  3SQ2 A;  1NOY A;  2QKK A;  1VSI A;  1Y97 A;  3TAG A;  3AA2 A;  3OYM A;  2IGI A;  1KVC A;  3A2F A;  4J2A A;  4PA1 A;  3OYC A;  3OYF A;  3KD1 E;  5SWM A;  3QEI A;  1HNI A;  1RBV A;  3AVC A;  4CHP A;  3IG1 A;  2IS3 A;  4ZTJ A;  4AHT A;  3DYA A;  3DOL A;  3LDS A;  3BGR A;  4DTR A;  2DY4 A;  3B6P A;  4KFB A;  1QSL A;  1ASV A;  3AVK A;  1U49 A;  4CEO A;  3CQ8 A;  3PO5 A;  4CES A;  1HNV A;  2R7Y A;  1U47 A;  3QER A;  4W5O A;  1LAV A;  4FCY A;  3TI0 A;  4C8L A;  3CYM A;  2ZE2 A;  4AHU A;  3HO1 A;  3CFP A;  4E7J A;  4FZX C;  4B3O A;  3NF6 A;  3D0P A;  3WNG A;  1VSH A;  4CEB A;  1NJX A;  1HRH A;  1NJZ A;  3M8S A;  4NCA A;  4EZ9 A;  2VG6 A;  1DLO A;  4OKE A;  3O4N A;  3TAQ A;  3TAR A;  1WSJ A;  3HPG A;  4W5R A;  4DSK A;  3I0R A;  1QQC A;  5HBM A;  1XWL A;  4DU3 A;  4KHW A;  4KI4 A;  3JSM A;  2HNZ A;  2OZM A;  4FZY A;  3NH2 A;  2IDO A;  1JLQ A;  3OYL A;  4DF8 A;  3VQ7 A;  4CHZ A;  3NE6 A;  4DSI A;  1ZBH A;  2I5J A;  5FRM A;  1VSM A;  1WSH A;  3AO5 A;  4IDK A;  1NOZ A;  1S1X A;  1HQE A;  4R5P A;  4BDZ A;  4J2E A;  1TL1 A;  2WOM A;  4DLG A;  1UA0 A;  1N6Q A;  4J2D A;  1LW0 A;  2OPQ A;  4H4O A;  5CYQ A;  3SPZ A;  5J2M A;  1TVR A;  3WNF A;  2B4J A;  4CJQ A;  4DTN A;  3T1A A;  1X9M A;  2DFF A;  3K5L A;  1NJY A;  3QIO A;  2G8W A;  4EZ6 A;  3LAK A;  2GUI A;  3HT3 A;  4DS4 A;  3AVH A;  4CHN A;  3RWU A;  3DLE A;  1RBS A;  4KKO A;  3LZJ A;  3NFA A;  3SJJ A;  1QSS A;  3NH0 A;  1KLN A;  1D5A A;  1BIS A;  5FRN A;  4CIF A;  5I42 A;  1HMV A;  4Y1D A;  2JGU A;  2YNG A;  2VWJ A;  3PY8 A;  4O4G A;  1Q9X A;  4E7L A;  4RW8 A;  1TKT A;  1F21 A;  4KHS A;  4DU4 A;  2QXF A;  3ULD A;  4C8M A;  2PYL A;  2HVI A;  3EY1 A;  1BL3 A;  3ZT2 A;  2EHG A;  4CFB A;  4FJ9 A;  3V1Q A;  1UWB A;  3H08 A;  1TL3 A;  4FLV A;  4JS5 A;  1NK8 A;  3SV3 A;  2F96 A;  4DSJ A;  3V1O A;  3VQ9 A;  4TSX A;  4DFP A;  3SUQ A;  4CJE A;  1SKR A;  4KHU A;  3VQQ A;  3AVJ A;  3QES A;  1NKC A;  3NHG A;  3L2V A;  3KLH A;  3I0S A;  4DQI A;  4KHQ A;  4OLB A;  1RTD A;  4FJ7 A;  2HHV A;  2KFZ A;  4C8N A;  2KZZ A;  3U6F A;  3VQ5 A;  3SYZ A;  1MU2 A;  4MFB A;  1REV A;  3SCX A;  3SNN A;  2YHA A;  2RKI A;  3G0Z A;  5CYM A;  5J2N A;  3ALY A;  4CK3 A;  4CF8 A;  4DQS A;  4FM1 A;  5KTQ A;  1IG9 A;  1RT5 A;  3LPU A;  3ZT1 A;  4CEA A;  4KRF A;  3NDK A;  4M3X A;  4M3W A;  1TAU A;  2E6L A;  3ZT3 A;  3V4I A;  4FJL A;  4K8Z A;  3HK2 A;  3AVA A;  2YNI A;  4CGJ A;  4CJ4 A;  3V81 A;  1KRP A;  1FXX A;  3HP9 A;  4CEF A;  1T8E A;  1X9S A;  1SKS A;  4HCB A;  1DTQ A;  1BCO A;  4B8A B;  4N5S A;  3QEP A;  4FLZ A;  1KTQ A;  3LP0 A;  1TKX A;  2NUB A;  3MXJ A;  3DLK A;  4QAG A;  4CJV A;  4IG3 A;  4OPJ A;  4FM2 A;  1TKD A;  2Z1H A;  4LH4 A;  4CJK A;  1QSY A;  3RR7 A;  3SI6 A;  3AA4 A;  4B9T A;  3PX6 A;  1KVB A;  3ZT0 A;  4FJK A;  5JS1 A;  2YNF A;  5HRP A;  3MXI A;  2P51 A;  2G8K A;  1RT2 A;  4KI6 A;  1VRT A;  4LSN A;  4CJT A;  3KLE A;  4O55 A;  1L5U A;  4FJX A;  5SZT A;  2PY5 A;  4CHY A;  3O3F A;  3AA5 X;  4FK0 A;  1WSE A;  3MEC A;  2KFN A;  3VQP A;  1J9A A;  3PX0 A;  2YHB A;  4FJM A;  4W5Q A;  1CXQ A;  2E6M A;  3T3F A;  2D0A A;  2FBT A;  4AHC A;  4FYD A;  1NK9 A;  1LW2 A;  4N47 A;  1IKX A;  1CXU A;  4E1M A;  1L3V A;  4WE1 A;  2KZM A;  5T7B A;  4LY7 A;  4K8X A;  1VSE A;  1FK9 A;  1LAW A;  5KGW A;  2ATQ A;  3DLG A;  1XI1 A;  1HYS A;  4LD0 A;  3S3O A;  1NK0 A;  1EX4 A;  4CEE A;  2KTQ A;  1RT1 A;  4CF0 A;  3V9U A;  3AVM A;  3M8Q A;  4GW6 A;  4B9U A;  3OYI A;  1RIL A;  3KIO A;  4FLX A;  3HYF A;  1YTA A;  5J2Q A;  3TAN A;  5C24 A;  3KLG A;  4KTW A;  4CFC A;  2X6N A;  5EU7 A;  4CK2 A;  1QTM A;  1UAX A;  3LP1 A;  4OVL A;  3VQ4 A;  3OYA A;  1HYZ A;  3OYG A;  4Z4C A;  1LV5 A;  4O0J A;  2O4G A;  1HJR A;  3HM9 A;  4M3Y A;  2HW3 A;  4ZHR A;  3HVT A;  1D9F A;  2FBY A;  1VSL A;  1S6Q A;  3CM6 A;  4I9L A;  4HUF A;  1SL2 A;  2OPR A;  4IBN A;  5HRS A;  4ELV A;  2HVH A;  4PQU A;  2Z1J A;  2X6S A;  3L8B A;  4DG1 A;  5K14 A;  3LWM A;  3S3N A;  4B9N A;  3DM2 A;  2PYJ A;  4CED A;  1LWE A;  3PO4 A;  3OS0 A;  4CJL A;  3MED A;  4H8K A;  3SV4 A;  5I3U A;  1JL1 A;  3RRG A;  4HCC A;  1QHT A;  4JRP A;  3L2U A;  2HHX A;  4NYF A;  4ID5 A;  3VA3 A;  3LAN A;  4OKK A;  4BAC A;  2XRI A;  4DTX A;  1GOC A;  1RBU A;  3WNH A;  4DLE A;  4DFM A;  1NK7 A;  1ASW A;  1TV6 A;  3KKR A;  4PWD A;  4ID1 A;  1RNH A;  3ASM A;  3NF8 A;  3VQ8 A;  1VK0 A;  4CJ5 A;  3ITH A;  4LSL A;  3V9W A;  2HMI A;  1EKE A;  1VSK A;  2YKM A;  3LAM A;  3V6D A;  4BE0 A;  1VSF A;  2YNH A;  4FM0 A;  3FFI A;  1C0U A;  3KD5 E;  4AHS A;  3VA0 A;  4KB0 A;  4AH9 A;  5FRO A;  1WAJ A;  1JXE A;  3G10 A;  2XY5 A;  4FJ5 A;  4DWI A;  1YTU A;  2OZS A;  1SV5 A;  3OYK A;  1X9W A;  2BDP A;  1WSI A;  4ZTF A;  1CLQ A;  1XHX A;  4BWM A;  4DTP A;  4CK1 A;  4UQG A;  4FJG A;  2P5O A;  4ELT A;  3HST B;  3QNN A;  3V9Z A;  4CJF A;  3HJF A;  1VSJ A;  1S1U A;  2F8S A;  3B6O A;  1KFD A;  1ZBF A;  4PY5 A;  5HRN A;  4OPK A;  4YNQ A;  2HHS A;  3ZSO A;  4DTO A;  2DFH A;  4FJJ A;  3F73 A;  1C0M A;  3K59 A;  3D45 A;  1BGX T;  5KI6 A;  3KK3 A;  1C1C A;  1EP4 A;  2ZQB A;  3ZSX A;  4JRQ A;  3SQ0 A;  2ITG A;  3VQE A;  4FK2 A;  3M8P A;  1RTJ A;  3NGZ A;  1L3S A;  2XY7 A;  3LAL A;  4KTZ A;  4CEC A;  4RW6 A;  2HHU A;  4CJW A;  1RT6 A;  3K5M A;  2X78 A;  3AO3 A;  1DTT A;  3E01 A;  5HLF A;  1U48 A;  1XHZ A;  1C6V A;  1LWC A;  2ETJ A;  3TAM A;  3WNE A;  3QEV A;  3DRR A;  1S1V A;  3TR8 A;  4Z0U A;  4LH5 A;  1D9D A;  4RW9 A;  4CE9 A;  3AVI A;  3IRX A;  3CG7 A;  4OKJ A;  4FK4 A;  4BWJ A;  1NK4 A;  3RR8 A;  1KCF A;  1SUQ A;  1VRU A;  2DFE A;  4DTS A;  1BIZ A;  2X74 A;  3MEG A;  1RBR A;  4E7K A;  3L3V A;  4DFK A;  4CF2 A;  1B9F A;  4C8K A;  1RDA A;  3TWH A;  3RMA A;  3OJS A;  4G1Q A;  4N56 A;  4Q5V A;  3KTQ A;  1WAF A;  5JS2 A;  3HXM A;  2XO7 A;  1KVA A;  3DLH A;  1B92 A;  4DTJ A;  1A5W A;  1HPZ A;  1GOA A;  1BCM A;  1JL2 A;  3IS9 A;  1O1W A;  4H4M A;  4HVJ A;  4FZZ A;  1RT3 A;  3KJV A;  3OJU A;  2AJQ A;  2DTU A;  3AVN A;  3K5N A;  4DSF A;  4CER A;  2XY6 A;  3ISN C;  3K5O A;  4CEZ A;  4GMJ B;  4B9M A;  4B9V A;  4DTU A;  1I3A A;  3KKS A;  1S6P A;  2XY8 A;  3EZ5 A;  2HB5 A;  2D5R A;  3CFO A;  4KHN A;  1JKH A;  2RN2 A;  1TK8 A;  4C8O A;  1ZBU A;  1RDD A;  4E1N A;  3O3H A;  2KQ2 A;  3OS2 A;  3DRS A;  4JS4 A;  4M3T A;  1I39 A;  3NGI A;  4E3S A;  3HL8 A;  3OYB A;  4NCG A;  4CCH A;  5J2P A;  3ZSW A;  2G8V A;  3K58 A;  4Z4H A;  3HVR A;  3VQD A;  3SZ2 A;  1SKW A;  4BDP A;  2BE2 A;  2HNY A;  3DRP A;  3SUP A;  4E19 A;  3AVG A;  4O5B A;  4CJU A;  1KLM A;  4CF9 A;  4Z4G A;  3AV9 A;  1LWF A;  1Q9Y A;  4IFV A;  4N41 A;  2GV9 A;  4M42 A;  1ZBI A;  1EXQ A;  3O4Q A;  5KRT A;  3DOK A;  1T05 A;  2LSN A;  3ZT4 A;  1J5O A;  2Y1J A;  3DLB A;  1IKV A;  2D0B A;  4FLU A;  2VG7 A;  3LP2 A;  4DU1 A;  4CGG A;  3UIQ A;  3THV A;  1YT3 A;  4DSE A;  2D0C A;  5DMR A;  4BE1 A;  1J53 A;  3S3M A;  2G8I A;  2Q3S A;  5CZ2 A;  1C1A A;  2B5J A;  1VSD A;  3C6T A;  3JYT A;  1G15 A;  4KPY A;  1QS4 A;  1YVU A;  3NF9 A;  3M8R A;  3OS1 A;  4DFJ A;  2G8U A;  1T7P A;  1C0T A;  4F3O A;  4FLY A;  3OVN A;  4FLT A;  3LPT A;  4IG0 A;  1Q8I A;  4BE2 A;  1NKB A;  4FJN A;  2GBZ A;  2Z1G A;  3AVL A;  4GVM A;  3OYH A;  5HRO A;  1BQM A;  2XHB A;  1NK6 A;  4FJI A;  1JLA A;  4CEQ A;  2RF2 A;  2YV0 X;  3CM5 A;  1FKP A;  5FDL A;  3L2Q A;  3RRH A;  3PV8 A;  4ELU A;  1IH7 A;  1L3U A;  2Z1I A;  4AIL C;  1L3T A;  2OA8 A;  3PUF A;  3VQA A;  1WSG A;  4M3R A;  4FLW A;  1HYV A;  1WSF A;  3TAF A;  4I9Q A;  4W5N A;  1GOB A;  4ICL A;  4DMN A;  3ZCM A;  4CFD A;  3ZSZ A;  1NK5 A;  3VQB A;  1TAQ A;  3QEX A;  4E0D A;  4OJR A;  5KGX A;  3DI6 A;  1S9E A;  1Z26 A;  3LWL A;  1WLJ A;  3NAE A;  3RTV A;  2IOC A;  3L3U A;  4B08 A;  4O0I A;  4E7H A;  2OPS A;  1KFS A;  2OPP A;  3U3Y A;  1SL0 A;  3IAY A;  4CJ3 A;  3KLF A;  4DS5 A;  4O44 A;  1RBT A;  1JXB A;  4NYN A;  2JLE A;  4F3T A;  4CIG A;  4F2R A;  3RMB A;  1W0H A;  1ASU A;  3V9S A;  4OLA A;  1S5J A;  4CGF A;  3SQ1 A;  3AVF A;  4Z4F A;  4W5T A;  3K57 A;  3CFR A;  2A1S A;  1RCH A;  2VG5 A;  3L2R A;  2FC0 A;  3NGY A;  3KK2 A;  4CHQ A;  1K6Y A;  4KV8 A;  4HTU A;  2QK9 A;  2EX3 A;  1ZYQ A;  4KHY A;  1BIU A;  3OYE A;  3U3G A;  4PUO A;  3VQC A;  5CZ1 A;  2A1R A;  1UOC A;  4RW7 A;  5HP1 A;  4DQR A;  1KSP A;  1NKE A;  2FBX A;  1WN7 A;  3QIP A;  3NH1 A;  4B8C A;  4M3U A;  3AO1 A;  4KB1 A;  2E4L A;  1IKW A;  4DQQ A;  4Q0B A;  3AA3 A;  3OY9 A;  2HND A;  5C25 A;  1TK0 A;  1HQU A;  4CGD A;  4FJH A;  2QKB A;  3QEW A;  2P5G A;  1BI4 A;  4CGI A;  4IKF A;  3ZSR A;  3HPO A;  1NJW A;  3NF7 A;  3P5J A; 
#chains in the Genus database with same CATH topology
 4F4K A;  3HSC A;  4DSL A;  4I7F A;  1ITG A;  2ZD1 A;  5FPD A;  5D3G A;  4EP5 A;  1NU0 A;  3AO2 A;  4JK7 A;  2FF6 A;  2VQF K;  3S9H A;  3SMS A;  4YFU A;  1K8A O;  3KLI A;  3P83 D;  5IWA K;  2V7Y A;  3SPY A;  1E3M A;  1KD1 O;  4NCB A;  2AP1 A;  3OYD A;  1TGO A;  4OGC A;  3VEV A;  3NBP A;  4J2B A;  3A5N C;  2F8T A;  4AHV A;  4JI2 K;  3O6W A;  3PIP L;  2G8F A;  3AVB A;  1NWK A;  3L4Q A;  1U04 A;  3KVG A;  2HHQ A;  1M1K O;  4O5F A;  1TKZ A;  1K73 O;  4B9S A;  4CJS A;  1QZ5 A;  3TAE A;  3CET A;  2GEL A;  4IEI A;  4QCL A;  3PX4 A;  3T69 A;  4HUG A;  4DTM A;  1Q81 O;  1B9D A;  4HHT A;  3ZSY A;  4AHR A;  4BGA A;  4JLH A;  3SBG A;  2Q2R A;  2NRZ A;  4DR2 K;  5J1E A;  3TSP A;  4KO0 A;  4QS7 A;  1IKY A;  4QOZ B;  3SQ4 A;  3MEE A;  4FL9 A;  4FW2 A;  2WON A;  2ZGY A;  3SUO A;  1JLC A;  3SQ2 A;  5LL6 Z;  4BG9 A;  1VSI A;  4K41 A;  3TAG A;  3OYF A;  1VQP N;  3SAH A;  3QEI A;  5C10 A;  1RBV A;  3AVC A;  3FZL A;  4CHP A;  3IG1 A;  3GBT A;  3K9K A;  2W41 A;  2QEX N;  1HKC A;  4DR4 K;  1N32 K;  1K9M O;  3PO5 A;  5GAH P;  2HOE A;  3TI0 A;  3VES A;  2ZE2 A;  3FZM A;  4B3O A;  3WNG A;  4CEB A;  1NJX A;  4FWK A;  5GAE P;  4EZ9 A;  4BR9 A;  4OKE A;  3O4N A;  3TAQ A;  1WSJ A;  4NLC A;  3NH2 A;  1JLQ A;  4H0T B;  2Q31 A;  3VQ7 A;  4DF8 A;  4CHZ A;  1VQ7 N;  4DSI A;  1ZBH A;  2I5J A;  1VSM A;  3VER A;  4PKI A;  3ZX0 A;  1HQE A;  3R6M A;  2WOM A;  1UA0 A;  4J2D A;  1LW0 A;  4B1Z A;  4JI8 K;  1TVR A;  4J2A A;  3T1A A;  1X9M A;  2DFF A;  2NRX A;  3K5L A;  4EZ6 A;  2GUI A;  3D6R A;  4PL8 A;  3O80 A;  5BRE A;  3LZJ A;  3S41 A;  3NFA A;  3ULE A;  1KLN A;  2YNG A;  2VWJ A;  1WOQ A;  3GDQ A;  4O4G A;  1Q9X A;  4RW8 A;  1TKT A;  1F21 A;  4DU4 A;  1ZXO A;  3CC7 N;  3CER A;  3J81 O;  3EY1 A;  3ZT2 A;  4FJ9 A;  1NK8 A;  1P8Z A;  4DSJ A;  3VQQ A;  2CH5 A;  3AVJ A;  5KPT A;  1NKC A;  3NHG A;  5LY3 A;  1YJ9 N;  1RTD A;  1BG3 A;  4MLE A;  4CD3 A;  2KZZ A;  4CBW A;  2NZT A;  3SNN A;  2RKI A;  4CF8 A;  3ZT1 A;  3GE1 A;  3LDP A;  3ZT3 A;  4FJL A;  3THY A;  1KRP A;  2YNI A;  4CGJ A;  1DTQ A;  1BCO A;  4B8A B;  3J80 O;  4N5S A;  3QEP A;  3CIP A;  4U7B A;  1QVG M;  3HRG A;  4IG3 A;  4H5N A;  4CJK A;  1XMQ K;  1X3M A;  3ZT0 A;  2P9L A;  4FJK A;  3HI0 A;  2YNF A;  3DXK A;  2W6L A;  3HTV A;  5AFU H;  4ISE A;  5AQK A;  5SZT A;  3O3F A;  3AA5 X;  2RHK A;  2JWK A;  3EE9 A;  3VEO A;  2E6M A;  2D0A A;  4DCH A;  2OCE A;  1L3V A;  3W3D A;  2Q0U A;  3DXM A;  4K8X A;  5F1X A;  5KPR A;  4LD0 A;  3K0S A;  3WUH A;  1EX4 A;  1NLV A;  3A5L C;  1NGE A;  4CEE A;  1BWF O;  3DXK B;  1RT1 A;  4CF0 A;  5KPZ A;  3V9U A;  2E1Y A;  4B1W B;  1RFQ A;  2A6A A;  4FLX A;  3HYF A;  1ZC6 A;  4MDA A;  1OH8 A;  3KLG A;  4CFC A;  2X6N A;  5EU7 A;  3O9U A;  1UAX A;  1U6Z A;  3KWI A;  4GY2 B;  4KH4 A;  4O0J A;  2O4G A;  4YOU A;  4ZHR A;  4A5A A;  4FOE A;  5HRS A;  4ELV A;  4PQU A;  2Z1J A;  2X6S A;  3L8B A;  4IXC A;  4DG1 A;  4IOX A;  4YOY A;  4CED A;  3VTH A;  4MLH A;  4CJL A;  2QWM A;  3SV4 A;  1NMD A;  1QHT A;  2BTF A;  3O1W A;  1S22 A;  3LAN A;  3RSE A;  1GOC A;  4DTX A;  4C1N K;  4DFM A;  1NK7 A;  3KKR A;  4IWV A;  4CW7 B;  3KWG A;  3I56 N;  1NGF A;  1VK0 A;  2HMI A;  1EKE A;  2YKM A;  3LAM A;  3V6D A;  3ZLJ A;  2HBL A;  3VA0 A;  5I9E B;  2P9U A;  2HF4 A;  1JXE A;  1WBD A;  3G10 A;  2O8E A;  1SV5 A;  1CLQ A;  2YJF A;  2BDP A;  4K25 A;  4ZTF A;  3TSU A;  2P5O A;  4ELT A;  3QNN A;  3HJF A;  4A62 A;  1S1U A;  3B6O A;  4OPK A;  3N4Q A;  4GV6 A;  2E2O A;  2DFH A;  1C0M A;  3K59 A;  2PBD A;  3WXJ A;  3KK3 A;  2JWL A;  4JKG A;  2ZQB A;  3SQ0 A;  1L3S A;  3WXK A;  1MWK A;  2P9U B;  4CEC A;  2QM1 A;  2UXC K;  2O8E B;  2HHU A;  2X78 A;  3E01 A;  1DTT A;  5AZJ A;  1XHZ A;  1XNR K;  1ATN A;  3DRR A;  1N33 K;  4I6M A;  4NO7 A;  3IRX A;  1NK4 A;  1SUQ A;  1VRU A;  2DFE A;  3M5R A;  5GAG P;  1HNX K;  1NNE A;  1RBR A;  4E7K A;  4JKG B;  3EKU A;  1B9F A;  4G1Q A;  4BR0 A;  4A59 A;  3DLH A;  4GNI A;  2HBK A;  2BH1 A;  4FZZ A;  4AF1 A;  3QDK A;  2QTD A;  2DTU A;  3AVN A;  3WQT A;  2Q36 A;  5ELZ A;  4CER A;  4I6M B;  4CEZ A;  5LJV A;  4GMJ B;  4B9V A;  4DTU A;  1I3A A;  2HB5 A;  1J5E K;  3PIO L;  1ZBU A;  2A3Z A;  4E1N A;  3O3H A;  4XH5 A;  4C8O A;  4M3T A;  1HX1 A;  2AA4 A;  3HL8 A;  5J2P A;  3MN9 A;  4JKC A;  3K58 A;  4AQY K;  3VQD A;  1X3N A;  2YHW A;  3AAP A;  4FWN A;  1NMN A;  2PAV A;  2E2P A;  4CJU A;  1KLM A;  1ESV A;  3UKU A;  1Q9Y A;  3VEW A;  3O4Q A;  3H1V X;  4JKB A;  3DOK A;  2LSN A;  3Q7C A;  3QFP A;  4CGG A;  5EXW A;  4DSE A;  5DMR A;  4BE1 A;  3EKS A;  3H1Q A;  5CZ2 A;  2B5J A;  1NGG A;  4H0X B;  1RGI A;  3OHR A;  3NF9 A;  4DFJ A;  3CCU N;  1C0T A;  4IG0 A;  4DV4 K;  4A5B A;  1Q8I A;  3C7N A;  1NBW A;  2Z1G A;  4GVM A;  3OYH A;  1NK6 A;  1BQM A;  4DQ8 A;  4A61 A;  1JLA A;  4CEQ A;  2P9P A;  3P39 A;  3PUF A;  1W2B M;  1HYV A;  3TAF A;  4H0V B;  2P9S A;  3MMV A;  3ZSZ A;  1YF5 L;  5LJW A;  1TAQ A;  3QEX A;  4OJR A;  1NM1 A;  5KGX A;  1Z26 A;  3LWL A;  2IOC A;  4B08 A;  4O0I A;  4E7H A;  3C7N B;  4CJ3 A;  1MWM A;  3KLF A;  3BP8 A;  4DS5 A;  1JXB A;  2JLE A;  5AQL A;  3U9Z A;  1W0H A;  1ASU A;  1BOT O;  4BRP A;  3VF4 A;  1HKG A;  2E2Q A;  3FZK A;  3Q7B A;  2P9P B;  4EIA A;  4W5T A;  2IVP A;  3O5B A;  4IOC L;  3ZET B;  2A1S A;  3L2R A;  3R8E A;  1GLE G;  4HTU A;  1ZYQ A;  1BIU A;  3OYE A;  1IBM K;  4FVU A;  2I7N A;  4BRI A;  1KSP A;  3MWP A;  4WFN L;  3WQU A;  4BR5 A;  3GG4 A;  1TK0 A;  4FJH A;  1EWQ A;  4IKF A;  3ZSR A;  3NF7 A;  4M41 A;  4BQZ A;  2P1J A;  4XIU A;  2NNW A;  4JNE A;  2WUS A;  3VQ6 A;  4CJP A;  4WFB L;  3P1G A;  5M1O A;  4FVM A;  4RG8 A;  3ATV A;  3A8Y A;  4N76 A;  2O8C A;  1S1W A;  2NLX A;  1U45 A;  4IFY A;  1A5X A;  5JLF A;  5EVZ A;  2PFU A;  4KAZ A;  2A5X A;  2FBV A;  1C1B A;  1M90 O;  3QO9 A;  3VMF B;  4OGE A;  2GWK A;  2VWK A;  4CJR A;  4JAX A;  5AFU A;  2WTU A;  4DF4 A;  4B9L A;  2O8C B;  2FSN A;  1MA9 B;  3G71 N;  3WXI A;  2B6A A;  2E5L K;  3LP3 A;  3HP6 A;  4F2S A;  1RT7 A;  4HWI A;  4B1U B;  3HPH A;  1S3X A;  3N4P A;  1X9J A;  5AQO A;  5DK5 A;  3ZSQ A;  3DLR A;  2IC3 A;  4BRD A;  2QWL A;  2NRV A;  1ZBL A;  4Z4E A;  1BA1 A;  4WYB A;  4I2P A;  1QE1 A;  2IAJ A;  1HJO A;  1J54 A;  4GVE A;  2OYQ A;  3F5T A;  3E9L A;  5IT9 O;  3ZSV A;  3MXM A;  3EN9 A;  3FE1 A;  3FZF A;  3SK3 A;  2ASO A;  4C23 A;  3KZB A;  1KC8 O;  4CIE A;  4BDY A;  1OKJ A;  4RCH A;  4CHO A;  2YJE A;  2RPI A;  3QLH A;  4JEP A;  3BF1 A;  4FXD A;  5CHI A;  4BR2 A;  1Y97 A;  3AA2 A;  2IGI A;  3OYC A;  4HTL A;  4ZTJ A;  4AHT A;  3DYA A;  2VYP A;  3DOL A;  3LDS A;  3VET A;  2ZJR L;  1QSL A;  1ASV A;  1U49 A;  4CEO A;  3CPW M;  5FPM A;  3CQ8 A;  1HNV A;  2R7Y A;  4DUZ K;  1SQK A;  4W5O A;  4L3Q A;  1QZ6 A;  4C8L A;  3CYM A;  2P9N A;  4FWM A;  3CFP A;  5BN8 A;  3NF6 A;  3D0P A;  1Q86 O;  1HRH A;  3TAR A;  5AQT A;  2QWN A;  4LF6 K;  1WBB A;  4DSK A;  3I0R A;  1QQC A;  4WF9 L;  3CCM N;  5AQI A;  2OZM A;  4PKG A;  3A5M C;  3AO5 A;  3LDN A;  1TL1 A;  3FLC O;  2HHH K;  2KLA A;  4H4O A;  2B4J A;  4DKW A;  3HT3 A;  4DS4 A;  3EZW A;  2GEM A;  3NVM A;  3EEQ A;  3MN7 A;  1QSS A;  3NH0 A;  1D5A A;  1BIS A;  1W7A A;  4CIF A;  5FRN A;  1HMV A;  3MX2 A;  2JGU A;  3PY8 A;  2ZF5 O;  4E7L A;  4B3S K;  3G6E N;  4B1Y B;  1FW6 A;  1BL3 A;  4CFB A;  2EHG A;  1UWB A;  4JYA K;  4FLV A;  4JS5 A;  3SV3 A;  2F96 A;  3V1O A;  1SKR A;  1NG9 A;  3CME N;  3L2V A;  5CE3 A;  3KLH A;  4DR1 K;  3C65 A;  3O8M A;  2IVO A;  5LMN K;  4FJ7 A;  2HHV A;  1QQO A;  4WCE L;  4K42 A;  1MU2 A;  4MFB A;  4BRQ A;  3G0Z A;  5J2N A;  2WBN A;  4CK3 A;  5ADX A;  3LPU A;  4CEA A;  4X66 K;  3NDK A;  1TAU A;  2E6L A;  4H03 B;  3V81 A;  5KQD A;  4MO5 A;  1SKS A;  4HCB A;  2UXB K;  1N34 K;  1YHQ N;  1OVY A;  4FLZ A;  2NUB A;  3M6G A;  4JD2 A;  2Z1H A;  4LH4 A;  3RR7 A;  3AA4 A;  2P9I A;  4BC2 A;  4NXM K;  3PX6 A;  4B3T K;  1RT2 A;  4CHY A;  4FK0 A;  2KFN A;  3MEC A;  4FWS A;  1VQ8 N;  3VQP A;  5HOO A;  3PX0 A;  4FJM A;  1EQY A;  4W5Q A;  3TU5 A;  4AHC A;  4CZI A;  1BO5 O;  1NK9 A;  1CXU A;  4JD2 B;  2KZM A;  1EWR A;  1KAY A;  2P9I B;  1LAW A;  2ATQ A;  1HYS A;  2GUP A;  4JI0 K;  4BR4 A;  2KTQ A;  2HBM A;  4GW6 A;  4B9U A;  3OYI A;  5BR8 K;  2PY5 A;  1YTA A;  4KTW A;  4CK2 A;  1QTM A;  2E88 A;  3AGR A;  3VQ4 A;  1HYZ A;  3OYG A;  3ZX2 A;  3HM9 A;  1SS6 A;  3AY9 A;  4EHT A;  4CVN E;  2FBY A;  4HUF A;  3CM6 A;  4I9L A;  4IBN A;  4O8U A;  5C2D A;  1LCU A;  2KKZ A;  3S3N A;  3VGM A;  5K14 A;  3LWM A;  1XUP O;  3DM2 A;  4YOW A;  1LWE A;  3MED A;  2V7Z A;  1RDW X;  3CC4 N;  3L2U A;  4XH4 A;  2HHX A;  4LFB K;  4M7X A;  4BAC A;  4IOA L;  5AQW A;  3LDO A;  3NF8 A;  4CJ5 A;  5BN9 A;  2ASM A;  3FFI A;  3M3Z A;  3E9O A;  2E20 A;  4AHS A;  4KB0 A;  4RWT A;  1WAJ A;  2D1K A;  4BVO A;  1YTU A;  5AQH A;  4DR3 K;  2QWR A;  3OYK A;  1XHX A;  4DTP A;  4UQG A;  3HST B;  4CJF A;  2F8S A;  3PSF A;  1KFD A;  1ZBF A;  4PY5 A;  5HRN A;  4YNQ A;  1NGD A;  1OH6 A;  4FJJ A;  1VQ4 N;  4ILG B;  4CD1 A;  3M8P A;  4G9Z A;  3NGZ A;  1GLA G;  3LAL A;  4BC3 A;  3C6H A;  4KTZ A;  4M7Y A;  3DLL L;  5TKW A;  4RW6 A;  3T1Y K;  2ETJ A;  4FK4 A;  4OKJ A;  5BPL A;  4BWJ A;  2EWS A;  3MEG A;  4CF2 A;  2CH6 A;  3TWH A;  3RMA A;  3G4S N;  4E1J A;  4N56 A;  4Q5V A;  3KTQ A;  5JS2 A;  2XO7 A;  1HPM A;  1DKG D;  1BCM A;  1JL2 A;  4CZG A;  4HVJ A;  4YOV A;  1RT3 A;  2AJQ A;  5AQN A;  3BUZ B;  2HF3 A;  4CBX A;  2XY6 A;  3ZEU B;  4B9M A;  2Q1N A;  1OVQ A;  4KHN A;  1JKH A;  2RN2 A;  1LOT B;  4JS4 A;  1S72 N;  3CHW A;  4CCH A;  3OYB A;  4NCG A;  1V4T A;  3ZSW A;  2G8V A;  4CJ7 A;  3QB0 A;  5BR9 A;  4Z4H A;  3SZ2 A;  4B3R K;  4IO8 A;  1HUX A;  2BE2 A;  2HNY A;  3DRP A;  3VGK A;  4H5V A;  3AVG A;  4Z4G A;  4CF9 A;  1LWF A;  4IFV A;  1EXQ A;  4ISG A;  1T05 A;  1G99 A;  3GL1 A;  2Y1J A;  1IKV A;  2D0B A;  4CZK A;  2VG7 A;  3THV A;  1J53 A;  3MCP A;  1C1A A;  3JYT A;  1G15 A;  1HNW K;  4LF4 K;  3G25 A;  3LPT A;  3CCE N;  4GKJ K;  3FZH A;  1K8K B;  2UU9 K;  4IZ9 A;  3TTD A;  2RF2 A;  2YV0 X;  1FKP A;  1T6C A;  3RRH A;  4JI7 K;  1IH7 A;  3WXM B;  2OA8 A;  2UUB K;  3VQA A;  4C1N I;  1GOB A;  4ICL A;  4DMN A;  3L4I A;  3DI6 A;  3ENB A;  1S9E A;  1WLJ A;  3L3U A;  3CI5 A;  2OPP A;  1SL0 A;  3IAY A;  2O8F B;  2D4W A;  4O44 A;  4NYN A;  4CIG A;  2ZJQ L;  2NRH A;  3V9S A;  1S5J A;  5LMU K;  4DV6 K;  1RCH A;  2VG5 A;  1JCE A;  4FO0 A;  4O8K A;  1K6Y A;  3ATU A;  4KHY A;  4YOX A;  3WT0 A;  1NKE A;  1WN7 A;  3QIP A;  4B8C A;  3AO1 A;  1HKB A;  4KB1 A;  1IKW A;  1HQU A;  3CCR N;  3D7E O;  4CGD A;  3QEW A;  1BI4 A;  4FSV A;  3P5J A;  3MDQ A;  3L2W A;  4IJA A;  4YY3 K;  5A2Q O;  5H1S Q;  1R0A A;  2BAN A;  3SAF A;  1CZ9 A;  1YVN A;  1TUY A;  4JKE A;  3D2F B;  4LFA K;  1XMO K;  4PKH A;  3VN5 A;  1WNS A;  4CF1 A;  4FW1 A;  4MQ3 A;  3UKR A;  4A57 A;  3EYZ A;  1A5V A;  1XNQ K;  1UA1 A;  4FJ8 A;  3SUN A;  3NCI A;  2QI2 A;  1BI4 B;  1U4B A;  4Z4I A;  3CCJ N;  3BDP A;  2HHT A;  2PZS A;  3O3G A;  2QWP A;  3SMP A;  2CGL A;  1IO2 A;  3T7Z A;  4K43 A;  2O4I A;  3UKR B;  1RTH A;  2F9T A;  1VHX A;  4B9Q A;  5C42 A;  3LZI A;  2BGG A;  1YAG A;  1EET A;  4DV7 K;  4L8R B;  1RDC A;  4M3Z A;  3DJC A;  2G8H A;  1X1P A;  4E7I A;  3FFK B;  1SL1 A;  4DQP A;  5E41 A;  1XC9 A;  3C6A A;  1S9G A;  5HRR A;  1JLF A;  3C95 A;  4YOR A;  4JI4 K;  4KBO A;  2QXL A;  2Y1I A;  1TK5 A;  1H1V A;  4X64 K;  3KK1 A;  1FKO A;  1CZB A;  1VAZ A;  3F9K A;  5CR4 A;  5AQY A;  3OYJ A;  5F2R A;  3C6U A;  2QKK A;  1NOY A;  2F9W A;  4JI1 K;  3NVK A;  4IFE A;  4JKD A;  2O8D B;  3OYM A;  4GV3 A;  3KD1 E;  2HBJ A;  5SWM A;  2V52 B;  3BGR A;  5M1Q A;  1GLF O;  4CZE A;  5C12 A;  1HLU A;  3AVK A;  4Y0W A;  3A0I X;  3ZET A;  1VQ5 N;  4JKH A;  4CES A;  1WB9 A;  5KQ8 A;  1LAV A;  4FCY A;  4AHU A;  3HO1 A;  4E7J A;  4FZX C;  4BRM A;  1NJZ A;  2Q97 A;  3BZC A;  4NCA A;  2VG6 A;  4W5R A;  2GX9 A;  3FR0 A;  4KHW A;  1O13 A;  4KI4 A;  3JSM A;  2HNZ A;  3CPE A;  4QS8 A;  4FZY A;  2IDO A;  3OYL A;  3CCL N;  4AM6 A;  1WSH A;  1QQM A;  4IDK A;  4BRC A;  4R5P A;  4BDZ A;  1N6Q A;  4DLG A;  2OPQ A;  3ID6 A;  3SPZ A;  5CYQ A;  3ENO A;  5J2M A;  2UUA K;  4CJQ A;  4DTN A;  3LAK A;  4DR7 K;  2UXD K;  1RBS A;  5AQV A;  3JAM O;  4DV1 K;  3SJJ A;  3CXC M;  4CZL A;  5AQS A;  5GAD P;  4KHS A;  3H6E A;  1KAX A;  3ULD A;  4C8M A;  1QQN A;  3HBT A;  4JI6 K;  4LC9 B;  3V1Q A;  1TL3 A;  1NGI A;  3J7Z O;  5AQJ A;  3MX5 A;  3SUQ A;  2YHY A;  4KHU A;  3FGU A;  4BQL A;  3QES A;  4KH5 A;  3K9J A;  1NGH A;  4KHQ A;  4FPA A;  4BRO A;  4BRF A;  2KFZ A;  4C8N A;  3SYZ A;  4B1V A;  1REV A;  3SCX A;  3CQY A;  2YHA A;  3O4W A;  1BA0 A;  3ALY A;  1IG9 A;  4FM1 A;  5KTQ A;  1TYQ B;  2W40 A;  3BF3 A;  3J7Y P;  4M3W A;  4WQ5 C;  3HK2 A;  4EAH D;  1FXX A;  3HP9 A;  4CEF A;  4FWP A;  1QVF M;  3GOI A;  5AQF A;  3MXJ A;  3DLK A;  2ZM6 K;  4CJV A;  2G8I A;  3LM9 A;  4OPH A;  3BEX A;  1U2V A;  4BGB A;  4KHP K;  4B9T A;  1KVB A;  5JS1 A;  5HRP A;  3OW2 M;  3MXI A;  1VRT A;  4LSN A;  4CJT A;  2VCP A;  3B8A X;  4O55 A;  2UUC K;  3WEE A;  1SZ2 A;  1WSE A;  2FLO A;  3P38 A;  3PLA A;  1CXQ A;  2FBT A;  4UY8 O;  4FYD A;  1LW2 A;  4N47 A;  4E1M A;  4WE1 A;  1RDU A;  4LY7 A;  4BR7 A;  1U2V B;  1XI1 A;  3RVC A;  3QBW A;  3AAQ A;  2YCH A;  3IKM A;  1DT9 A;  3M1F A;  3AVM A;  3M8Q A;  1VQ9 N;  3KIO A;  5C24 A;  4JV5 K;  2D0P A;  3WEE B;  5HL7 L;  4IDH A;  4H5W A;  4Z4C A;  1LV5 A;  1HJR A;  4GV9 A;  4EHU A;  3HVT A;  1D9F A;  2I7P A;  3E9P A;  2OPR A;  2HVH A;  5AQG A;  4B9N A;  2PYJ A;  3PO4 A;  4DR6 K;  4H8K A;  4A2A A;  5I3U A;  3RRG A;  4JRP A;  3A5O C;  4ID5 A;  3VA3 A;  1XC3 A;  2XRI A;  3EL2 A;  5AQX A;  3R3L A;  4DLE A;  1ASW A;  1FJG K;  4BC5 A;  4JK8 A;  4LF5 K;  4ID1 A;  3VQ8 A;  2VWB A;  4LSL A;  4BC4 A;  2FXU A;  3TSQ A;  4BE0 A;  1VSF A;  2E1Z A;  2DPN A;  2YNH A;  3HM8 A;  3I8B A;  1C0U A;  3KD5 E;  5AQR A;  5M1N A;  3LDL A;  4FJ5 A;  1GLL O;  2XY5 A;  4DWI A;  5E26 A;  1VQM N;  1X9W A;  2VGN A;  1WSI A;  4BWM A;  4CK1 A;  1VSJ A;  2E2N A;  2O8B B;  2CGJ A;  3IDH A;  3F73 A;  3D45 A;  1BGX T;  3KHY A;  5KI6 A;  4JRQ A;  3ZSX A;  3VQE A;  1RTJ A;  2KHO A;  5BPN A;  2HMP A;  1RT6 A;  3F2K A;  3K5M A;  4YHH K;  3IMX A;  4R79 A;  1C6V A;  1LWC A;  3TAM A;  3WNE A;  1NGC A;  4DHY A;  3QEV A;  4CZH A;  4LH5 A;  1IV0 A;  1D9D A;  4RW9 A;  5BRH A;  3DWL A;  3AVI A;  3CG7 A;  1KCF A;  4DTS A;  3J7A P;  1E4F T;  2NRT A;  2X74 A;  4BRG A;  4FWQ A;  4C8K A;  3OJS A;  3O08 A;  4YOT A;  1GLC G;  3HXM A;  1D4X A;  4CBU A;  1HPZ A;  1GOA A;  3IS9 A;  4FWR A;  1Z05 A;  1N36 K;  5C2F A;  4JHD A;  3K5N A;  3JXU A;  4WQ5 A;  3VEN A;  1JCG A;  1S6P A;  2D5R A;  3CFO A;  3OS2 A;  1RDD A;  2KQ2 A;  4NLB A;  3NGI A;  1N8R O;  4FPB A;  2OTL N;  5TKY A;  3HVR A;  1YI2 N;  1SKW A;  5FPE A;  4JI3 K;  3SUP A;  4BRN A;  4CZM A;  4E19 A;  5AQU A;  4O5B A;  2W6K A;  4JHD B;  3AV9 A;  4X65 K;  4M42 A;  4N41 A;  1R59 O;  3E66 A;  1JCF A;  2A41 A;  4FOI A;  3ZT4 A;  5BRF A;  2NRR A;  4FLU A;  5F0X A;  3TTF A;  5EX5 A;  3S3M A;  2Q3S A;  5AJ3 K;  1VSD A;  4X62 K;  4F9O A;  1IBL K;  2J4R A;  4PL7 A;  4KPY A;  1YVU A;  3M8R A;  2G8U A;  3OS1 A;  3OVN A;  4BE2 A;  4WFA L;  5EY4 A;  1NKB A;  1BUP A;  1QHA A;  2GBZ A;  3AVL A;  5M1P A;  5HRO A;  4BRL A;  1JJ2 M;  4FJI A;  3L2Q A;  4ELU A;  1L3U A;  2Z1I A;  5JVH L;  4AIL C;  1L3T A;  3LM2 A;  1Q82 O;  4M3R A;  4I9Q A;  4W5N A;  2NRW A;  3ZCM A;  1T44 A;  3VF2 A;  1NK5 A;  4E0D A;  2Q0R A;  1KFS A;  2OPS A;  3U3Y A;  1DEJ A;  3CCQ N;  4F2R A;  5BPM A;  3U8X A;  2E8A A;  2GWJ A;  1KQS M;  1Z6R A;  3K57 A;  3CFR A;  2YHX A;  2FC0 A;  3NGY A;  3THX A;  4LF9 K;  2QA4 N;  3U3G A;  3HOT A;  4PUO A;  3VQC A;  5CZ1 A;  4DV0 K;  2A1R A;  1UOC A;  3AGK A;  4RW7 A;  5B8H A;  3NH1 A;  4M3U A;  2E4L A;  4DUY K;  3AA3 A;  1ATR A;  2QKB A;  4CGI A;  3HPO A;  1ZBS A;  3OYN A;  3THX B;  4OX9 K;  1W9H A;  5AZI A;  4KRE A;  3O9R A;  3ZEU A;  3IFR A;  3VTI A;  2HHW A;  3V9X A;  3RMD A;  1JLB A;  3CCV N;  1JLG A;  5CY4 A;  3OBW A;  2ZJP L;  3HZ6 A;  4M45 A;  3QML A;  3TAP A;  4JK9 A;  4RW4 A;  3K2P A;  3CJ1 A;  3I8D A;  4GKK K;  3ULE B;  1T03 A;  2ZGZ A;  4EP4 A;  4HUE A;  3CF5 L;  4LFC K;  1BHL A;  5AZI B;  3DMJ A;  3QET A;  3T19 A;  3RMC A;  3UE5 A;  4KTQ A;  3QIN A;  3L0Q A;  3U4L A;  1JLE A;  4CGH A;  3MAQ A;  4F8R A;  4KH6 A;  1RTI A;  3QNO A;  3MN6 A;  3U9D A;  2IIR A;  4IJN A;  1S1T A;  3P31 A;  4Y1C A;  3V1R A;  5AR0 A;  4E89 A;  3I55 N;  4I2Q A;  4MDB A;  1K8K A;  1Z25 A;  3TTC A;  5KRS A;  3TAB A;  3AO4 A;  2F4V K;  2YKN A;  3SLC A;  4V19 S;  1OH5 A;  4J8F A;  1RT4 A;  1RDB A;  3THY B;  1D8Y A;  3I33 A;  3C94 A;  2W42 A;  3THW A;  1N5Y A;  1BQN A;  4CFA A;  2KW4 A;  4B3M K;  3ZYY X;  5DM6 L;  2O8F A;  4YDU C;  5BRD A;  1VQ6 N;  1KVC A;  3A2F A;  2P9L B;  4PA1 A;  1GLB G;  4OPA A;  1HNI A;  2YX6 A;  3UB5 A;  4WQ4 C;  2IS3 A;  3VPZ A;  5EOY A;  4DTR A;  2DY4 A;  1ILY A;  3B6P A;  4KFB A;  3THW B;  2YI1 A;  1U47 A;  4BRA A;  3QER A;  3CD6 N;  2UYT A;  3ID8 A;  1YIJ N;  3O1B A;  3PSI A;  3VEX A;  3QBX A;  3DXM B;  1VSH A;  3M8S A;  1DLO A;  4NB4 A;  3HPG A;  5M1F A;  3EE8 A;  5HBM A;  1XWL A;  4DU3 A;  4IO9 L;  3QFU A;  1MDU B;  3O9T A;  4MO4 A;  3HOS A;  3NE6 A;  4BY9 C;  5FRM A;  1NOZ A;  1S1X A;  4J2E A;  3J8A A;  2QW9 A;  3D2F A;  3WNF A;  1NGJ A;  5MLC Q;  4FWL A;  1NJY A;  3QIO A;  2G8W A;  1YJW N;  3AVH A;  4CHN A;  3KK7 A;  3RWU A;  3DLE A;  3EO3 A;  4KKO A;  1EO1 A;  3R9P A;  3RSE B;  5I42 A;  4Y1D A;  3BY5 A;  2QXF A;  3MN5 A;  2PYL A;  3LDQ A;  2HVI A;  3LL3 A;  4PHT X;  3H08 A;  5AQM A;  3VQ9 A;  4TSX A;  4DFP A;  4CJE A;  5M1K A;  2FSJ A;  3WXL A;  4DQI A;  1T3V A;  3I0S A;  4OLB A;  4JKF A;  3OTO K;  4ILH A;  3U6F A;  3VQ5 A;  1VQK N;  2GTD A;  4U67 L;  1Y64 A;  4JKA A;  2VQE K;  1NJI O;  5CYM A;  4DQS A;  3T1H K;  1RT5 A;  1HNZ K;  3F9M A;  3CMA N;  4KRF A;  4M3X A;  4H5R A;  3C0B A;  3V4I A;  5FLX O;  4K8Z A;  3AVA A;  4CJ4 A;  2P9K A;  1T8E A;  1X9S A;  5AZJ B;  4IEE A;  1KTQ A;  3LP0 A;  4CZF A;  1TKX A;  4QAG A;  4FM2 A;  1P90 A;  4EFH A;  1TKD A;  4OPJ A;  1QSY A;  1IJJ A;  3SI6 A;  2O8D A;  4H0Y B;  3CJC A;  2WFB A;  4KI6 A;  1XQS C;  2P51 A;  2G8K A;  1NGA A;  3KLE A;  3SJH A;  5AQP A;  4FJX A;  1L5U A;  5ADX H;  1KXP A;  1VQN N;  2P9K B;  1J9A A;  2YHB A;  3T3F A;  5C15 A;  1TUU A;  2A40 A;  3O9Q A;  1IKX A;  5T7B A;  1VSE A;  1FK9 A;  5JLH A;  5KGW A;  4DV3 K;  3DLG A;  3MK6 A;  4RTF D;  3S3O A;  1Q7Y O;  4K0K K;  1NK0 A;  1RIL A;  3TAN A;  5J2Q A;  4CI6 A;  2WC9 A;  3LP1 A;  4OVL A;  4YDU A;  3OYA A;  1T6D A;  4M63 C;  4M3Y A;  2HW3 A;  1GLJ O;  3UKU B;  4WQ4 A;  1VSL A;  1S6Q A;  1SL2 A;  1CZA N;  1YXQ A;  4DV2 K;  4XH1 A;  3OS0 A;  4JI5 K;  1JL1 A;  4HCC A;  2F7T A;  4NYF A;  2V51 B;  3MWT A;  3BZK A;  4OKK A;  1BDG A;  1RBU A;  3WNH A;  1KAZ A;  4B1X B;  4CZJ A;  1TV6 A;  1VQO N;  4PWD A;  5AQQ A;  4NXN K;  1RNH A;  3ASM A;  3QIC A;  4Z94 A;  3DLB A;  3ITH A;  3V9W A;  1VSK A;  4FM0 A;  4AH9 A;  5FRO A;  2OZS A;  1SAZ A;  2QWO A;  3VOV A;  4FJG A;  2P9S B;  5DM7 L;  3V9Z A;  3CJ9 A;  1C0G A;  4H5T A;  3CC2 N;  2HHS A;  4JN4 A;  3ZSO A;  4DTO A;  4LF7 K;  4FWO A;  3SBT A;  1C1C A;  1EP4 A;  1TYQ A;  4FK2 A;  2ITG A;  2XY7 A;  1W97 L;  4CJW A;  3AO3 A;  5GIP A;  5HLF A;  1U48 A;  1S1V A;  3TR8 A;  4Z0U A;  4CE9 A;  2A42 A;  2BUP A;  3RR8 A;  5AQZ A;  1BIZ A;  4BRE A;  3D2E A;  4DFK A;  3L3V A;  1RDA A;  3TPQ A;  3L6Q A;  5FPN A;  5JVG L;  1WAF A;  3IUC A;  1KVA A;  1B92 A;  4DTJ A;  1A5W A;  3VEZ A;  1O1W A;  4H4M A;  1IBK K;  3KJV A;  3OJU A;  4BRK A;  4DSF A;  3E1Y A;  3OBY A;  3ISN C;  3K5O A;  3P4I A;  5JMV A;  3KKS A;  3EZ5 A;  2XY8 A;  1BU6 O;  3ZX3 A;  1TK8 A;  4OO1 J;  4H0P A;  3DRS A;  3D2E B;  1I39 A;  4H0O A;  4BRH A;  4BVP A;  1Q18 A;  1VQL N;  4E3S A;  2VGM A;  2OTJ N;  3W0L A;  4ILJ A;  4BDP A;  1V4S A;  4A2B A;  4DR5 K;  3CQX A;  5JIC A;  1ZBI A;  2GV9 A;  2FF3 B;  5GIO A;  2ITM A;  5KRT A;  2D0O A;  1J5O A;  2ASP A;  3H3N O;  3NMU A;  3OA9 A;  1GLD G;  3LP2 A;  4DU1 A;  3UIQ A;  4QS9 A;  1YT3 A;  2D0C A;  2QWQ A;  4BG8 A;  2IVN A;  2RE2 A;  4DB3 A;  3C6T A;  4ISF A;  4AM7 A;  1QS4 A;  1T7P A;  4F3O A;  4FLY A;  4FLT A;  1J6Z A;  1YUW A;  4FJN A;  3MCA B;  3O9S A;  2XHB A;  3CJ7 A;  2HST A;  1OH7 A;  2ZWH A;  3DAW A;  3CM5 A;  5FDL A;  3PV8 A;  3H46 O;  1IG8 A;  2FSK A;  1C0F A;  1ATS A;  3VEY A;  5E84 A;  1E4G T;  4FLW A;  1WSG A;  1HR0 K;  1YJN N;  1WSF A;  5C0Y A;  3CJB A;  3R1X A;  4CFD A;  3VQB A;  2O8B A;  3NAE A;  3RTV A;  4LF8 K;  1DGK N;  1RBT A;  3H3O B;  4F3T A;  3RMB A;  4OLA A;  4DV5 K;  4XEI A;  4CGF A;  5GIN A;  3SQ1 A;  3SAG A;  3AVF A;  4Z4F A;  3CCS N;  2H3G X;  3KK2 A;  3AAR A;  2OAN A;  3CJA A;  4CHQ A;  2QK9 A;  4KV8 A;  3ENH A;  3JS6 A;  2EX3 A;  2P9N B;  3H45 C;  5HP1 A;  1WUA A;  4DQR A;  2FBX A;  3VGL A;  1NGB A;  4Q0B A;  4DQQ A;  1YIT N;  2CGK A;  3OY9 A;  2HND A;  5C25 A;  3VF6 A;  1I94 K;  2P5G A;  1NJW A; 
#chains in the Genus database with same CATH homology
 4M41 A;  3OYN A;  4KRE A;  1W9H A;  2P1J A;  4XIU A;  3L2W A;  4F4K A;  3VQ6 A;  4DSL A;  2HHW A;  3V9X A;  3RMD A;  1JLB A;  4CJP A;  3P1G A;  4I7F A;  2BAN A;  1R0A A;  1CZ9 A;  1ITG A;  4FVM A;  1JLG A;  4RG8 A;  5CY4 A;  2ZD1 A;  5D3G A;  4M45 A;  4EP5 A;  3VN5 A;  1WNS A;  3AO2 A;  4CF1 A;  4N76 A;  4FW1 A;  4MQ3 A;  1S1W A;  3S9H A;  3TAP A;  4RW4 A;  1U45 A;  4YFU A;  4IFY A;  1A5X A;  3EYZ A;  3K2P A;  3I8D A;  3KLI A;  1A5V A;  4KAZ A;  3P83 D;  1UA1 A;  4FJ8 A;  2FBV A;  1C1B A;  3SUN A;  3QO9 A;  3NCI A;  1U4B A;  1BI4 B;  3SPY A;  1T03 A;  4OGE A;  4EP4 A;  4HUE A;  4NCB A;  4Z4I A;  3OYD A;  3BDP A;  1BHL A;  1TGO A;  4OGC A;  3DMJ A;  3NBP A;  3QET A;  2PZS A;  4J2B A;  2F8T A;  2HHT A;  3T19 A;  4AHV A;  3O3G A;  3RMC A;  2VWK A;  4KTQ A;  4CJR A;  1IO2 A;  2G8F A;  3AVB A;  3QIN A;  1U04 A;  4DF4 A;  4B9L A;  2HHQ A;  1JLE A;  4CGH A;  3MAQ A;  4F8R A;  2O4I A;  1TKZ A;  1RTH A;  4B9S A;  4CJS A;  2B6A A;  1RTI A;  3LP3 A;  5C42 A;  3HP6 A;  3QNO A;  3LZI A;  4F2S A;  2BGG A;  3TAE A;  1RT7 A;  3HPH A;  1EET A;  5DK5 A;  3ZSQ A;  3DLR A;  2IC3 A;  1S1T A;  4QCL A;  3PX4 A;  1ZBL A;  4Y1C A;  3V1R A;  1RDC A;  4L8R B;  4HUG A;  4M3Z A;  4Z4E A;  4E89 A;  4DTM A;  4I2Q A;  2G8H A;  1Z25 A;  5KRS A;  1B9D A;  4I2P A;  1X1P A;  1QE1 A;  3AO4 A;  3TAB A;  4HHT A;  2IAJ A;  2YKN A;  4E7I A;  3ZSY A;  4AHR A;  1SL1 A;  4JLH A;  4DQP A;  1J54 A;  5E41 A;  2OYQ A;  1XC9 A;  5J1E A;  1S9G A;  1RT4 A;  1JLF A;  3C95 A;  1RDB A;  4KO0 A;  5HRR A;  3ZSV A;  3MXM A;  2Y1I A;  1TK5 A;  1IKY A;  4QOZ B;  1D8Y A;  4CIE A;  3C94 A;  3KK1 A;  3SQ4 A;  2W42 A;  4BDY A;  1N5Y A;  3MEE A;  1FKO A;  4CHO A;  1CZB A;  1BQN A;  2RPI A;  3QLH A;  4FW2 A;  2WON A;  4CFA A;  3F9K A;  3SUO A;  2KW4 A;  1JLC A;  3OYJ A;  4FXD A;  3C6U A;  3SQ2 A;  1NOY A;  2QKK A;  1VSI A;  1Y97 A;  3TAG A;  3AA2 A;  3OYM A;  2IGI A;  1KVC A;  3A2F A;  4J2A A;  4PA1 A;  3OYC A;  3OYF A;  3KD1 E;  5SWM A;  3QEI A;  1HNI A;  1RBV A;  3AVC A;  4CHP A;  3IG1 A;  2IS3 A;  4ZTJ A;  4AHT A;  3DYA A;  3DOL A;  3LDS A;  3BGR A;  4DTR A;  2DY4 A;  3B6P A;  4KFB A;  1QSL A;  1ASV A;  3AVK A;  1U49 A;  4CEO A;  3CQ8 A;  3PO5 A;  4CES A;  1HNV A;  2R7Y A;  1U47 A;  3QER A;  4W5O A;  1LAV A;  4FCY A;  3TI0 A;  4C8L A;  3CYM A;  2ZE2 A;  4AHU A;  3HO1 A;  3CFP A;  4E7J A;  4FZX C;  4B3O A;  3NF6 A;  3D0P A;  3WNG A;  1VSH A;  4CEB A;  1NJX A;  1HRH A;  1NJZ A;  3M8S A;  4NCA A;  4EZ9 A;  2VG6 A;  1DLO A;  4OKE A;  3O4N A;  3TAQ A;  3TAR A;  1WSJ A;  3HPG A;  4W5R A;  4DSK A;  3I0R A;  1QQC A;  5HBM A;  1XWL A;  4DU3 A;  4KHW A;  4KI4 A;  3JSM A;  2HNZ A;  2OZM A;  4FZY A;  3NH2 A;  2IDO A;  1JLQ A;  3OYL A;  4DF8 A;  3VQ7 A;  4CHZ A;  3NE6 A;  4DSI A;  1ZBH A;  2I5J A;  5FRM A;  1VSM A;  1WSH A;  3AO5 A;  4IDK A;  1NOZ A;  1S1X A;  1HQE A;  4R5P A;  4BDZ A;  4J2E A;  1TL1 A;  2WOM A;  4DLG A;  1UA0 A;  1N6Q A;  4J2D A;  1LW0 A;  2OPQ A;  4H4O A;  5CYQ A;  3SPZ A;  5J2M A;  1TVR A;  3WNF A;  2B4J A;  4CJQ A;  4DTN A;  3T1A A;  1X9M A;  2DFF A;  3K5L A;  1NJY A;  3QIO A;  2G8W A;  4EZ6 A;  3LAK A;  2GUI A;  3HT3 A;  4DS4 A;  3AVH A;  4CHN A;  3RWU A;  3DLE A;  1RBS A;  4KKO A;  3LZJ A;  3NFA A;  3SJJ A;  1QSS A;  3NH0 A;  1KLN A;  1D5A A;  1BIS A;  5FRN A;  4CIF A;  5I42 A;  1HMV A;  4Y1D A;  2JGU A;  2YNG A;  2VWJ A;  3PY8 A;  4O4G A;  1Q9X A;  4E7L A;  4RW8 A;  1TKT A;  1F21 A;  4KHS A;  4DU4 A;  2QXF A;  3ULD A;  4C8M A;  2PYL A;  2HVI A;  3EY1 A;  1BL3 A;  3ZT2 A;  2EHG A;  4CFB A;  4FJ9 A;  3V1Q A;  1UWB A;  3H08 A;  1TL3 A;  4FLV A;  4JS5 A;  1NK8 A;  3SV3 A;  2F96 A;  4DSJ A;  3V1O A;  3VQ9 A;  4TSX A;  4DFP A;  3SUQ A;  4CJE A;  1SKR A;  4KHU A;  3VQQ A;  3AVJ A;  3QES A;  1NKC A;  3NHG A;  3L2V A;  3KLH A;  3I0S A;  4DQI A;  4KHQ A;  4OLB A;  1RTD A;  4FJ7 A;  2HHV A;  2KFZ A;  4C8N A;  2KZZ A;  3U6F A;  3VQ5 A;  3SYZ A;  1MU2 A;  4MFB A;  1REV A;  3SCX A;  3SNN A;  2YHA A;  2RKI A;  3G0Z A;  5CYM A;  5J2N A;  3ALY A;  4CK3 A;  4CF8 A;  4DQS A;  4FM1 A;  5KTQ A;  1IG9 A;  1RT5 A;  3LPU A;  3ZT1 A;  4CEA A;  4KRF A;  3NDK A;  4M3X A;  4M3W A;  1TAU A;  2E6L A;  3ZT3 A;  3V4I A;  4FJL A;  4K8Z A;  3HK2 A;  3AVA A;  2YNI A;  4CGJ A;  4CJ4 A;  3V81 A;  1KRP A;  1FXX A;  3HP9 A;  4CEF A;  1T8E A;  1X9S A;  1SKS A;  4HCB A;  1DTQ A;  1BCO A;  4B8A B;  4N5S A;  3QEP A;  4FLZ A;  1KTQ A;  3LP0 A;  1TKX A;  2NUB A;  3MXJ A;  3DLK A;  4QAG A;  4CJV A;  4IG3 A;  4OPJ A;  4FM2 A;  1TKD A;  2Z1H A;  4LH4 A;  4CJK A;  1QSY A;  3RR7 A;  3SI6 A;  3AA4 A;  4B9T A;  3PX6 A;  1KVB A;  3ZT0 A;  4FJK A;  5JS1 A;  2YNF A;  5HRP A;  3MXI A;  2P51 A;  2G8K A;  1RT2 A;  4KI6 A;  1VRT A;  4LSN A;  4CJT A;  3KLE A;  4O55 A;  1L5U A;  4FJX A;  5SZT A;  2PY5 A;  4CHY A;  3O3F A;  3AA5 X;  4FK0 A;  1WSE A;  3MEC A;  2KFN A;  3VQP A;  1J9A A;  3PX0 A;  2YHB A;  4FJM A;  4W5Q A;  1CXQ A;  2E6M A;  3T3F A;  2D0A A;  2FBT A;  4AHC A;  4FYD A;  1NK9 A;  1LW2 A;  4N47 A;  1IKX A;  1CXU A;  4E1M A;  1L3V A;  4WE1 A;  2KZM A;  5T7B A;  4LY7 A;  4K8X A;  1VSE A;  1FK9 A;  1LAW A;  5KGW A;  2ATQ A;  3DLG A;  1XI1 A;  1HYS A;  4LD0 A;  3S3O A;  1NK0 A;  1EX4 A;  4CEE A;  2KTQ A;  1RT1 A;  4CF0 A;  3V9U A;  3AVM A;  3M8Q A;  4GW6 A;  4B9U A;  3OYI A;  1RIL A;  3KIO A;  4FLX A;  3HYF A;  1YTA A;  5J2Q A;  3TAN A;  5C24 A;  3KLG A;  4KTW A;  4CFC A;  2X6N A;  5EU7 A;  4CK2 A;  1QTM A;  1UAX A;  3LP1 A;  4OVL A;  3VQ4 A;  3OYA A;  1HYZ A;  3OYG A;  4Z4C A;  1LV5 A;  4O0J A;  2O4G A;  1HJR A;  3HM9 A;  4M3Y A;  2HW3 A;  4ZHR A;  3HVT A;  1D9F A;  2FBY A;  1VSL A;  1S6Q A;  3CM6 A;  4I9L A;  4HUF A;  1SL2 A;  2OPR A;  4IBN A;  5HRS A;  4ELV A;  2HVH A;  4PQU A;  2Z1J A;  2X6S A;  3L8B A;  4DG1 A;  5K14 A;  3LWM A;  3S3N A;  4B9N A;  3DM2 A;  2PYJ A;  4CED A;  1LWE A;  3PO4 A;  3OS0 A;  4CJL A;  3MED A;  4H8K A;  3SV4 A;  5I3U A;  1JL1 A;  3RRG A;  4HCC A;  1QHT A;  4JRP A;  3L2U A;  2HHX A;  4NYF A;  4ID5 A;  3VA3 A;  3LAN A;  4OKK A;  4BAC A;  2XRI A;  4DTX A;  1GOC A;  1RBU A;  3WNH A;  4DLE A;  4DFM A;  1NK7 A;  1ASW A;  1TV6 A;  3KKR A;  4PWD A;  4ID1 A;  1RNH A;  3ASM A;  3NF8 A;  3VQ8 A;  1VK0 A;  4CJ5 A;  3ITH A;  4LSL A;  3V9W A;  2HMI A;  1EKE A;  1VSK A;  2YKM A;  3LAM A;  3V6D A;  4BE0 A;  1VSF A;  2YNH A;  4FM0 A;  3FFI A;  1C0U A;  3KD5 E;  4AHS A;  3VA0 A;  4KB0 A;  4AH9 A;  5FRO A;  1WAJ A;  1JXE A;  3G10 A;  2XY5 A;  4FJ5 A;  4DWI A;  1YTU A;  2OZS A;  1SV5 A;  3OYK A;  1X9W A;  2BDP A;  1WSI A;  4ZTF A;  1CLQ A;  1XHX A;  4BWM A;  4DTP A;  4CK1 A;  4UQG A;  4FJG A;  2P5O A;  4ELT A;  3HST B;  3QNN A;  3V9Z A;  4CJF A;  3HJF A;  1VSJ A;  1S1U A;  2F8S A;  3B6O A;  1KFD A;  1ZBF A;  4PY5 A;  5HRN A;  4OPK A;  4YNQ A;  2HHS A;  3ZSO A;  4DTO A;  2DFH A;  4FJJ A;  3F73 A;  1C0M A;  3K59 A;  3D45 A;  1BGX T;  5KI6 A;  3KK3 A;  1C1C A;  1EP4 A;  2ZQB A;  3ZSX A;  4JRQ A;  3SQ0 A;  2ITG A;  3VQE A;  4FK2 A;  3M8P A;  1RTJ A;  3NGZ A;  1L3S A;  2XY7 A;  3LAL A;  4KTZ A;  4CEC A;  4RW6 A;  2HHU A;  4CJW A;  1RT6 A;  3K5M A;  2X78 A;  3AO3 A;  1DTT A;  3E01 A;  5HLF A;  1U48 A;  1XHZ A;  1C6V A;  1LWC A;  2ETJ A;  3TAM A;  3WNE A;  3QEV A;  3DRR A;  1S1V A;  3TR8 A;  4Z0U A;  4LH5 A;  1D9D A;  4RW9 A;  4CE9 A;  3AVI A;  3IRX A;  3CG7 A;  4OKJ A;  4FK4 A;  4BWJ A;  1NK4 A;  3RR8 A;  1KCF A;  1SUQ A;  1VRU A;  2DFE A;  4DTS A;  1BIZ A;  2X74 A;  3MEG A;  1RBR A;  4E7K A;  3L3V A;  4DFK A;  4CF2 A;  1B9F A;  4C8K A;  1RDA A;  3TWH A;  3RMA A;  3OJS A;  4G1Q A;  4N56 A;  4Q5V A;  3KTQ A;  1WAF A;  5JS2 A;  3HXM A;  2XO7 A;  1KVA A;  3DLH A;  1B92 A;  4DTJ A;  1A5W A;  1HPZ A;  1GOA A;  1BCM A;  1JL2 A;  3IS9 A;  1O1W A;  4H4M A;  4HVJ A;  4FZZ A;  1RT3 A;  3KJV A;  3OJU A;  2AJQ A;  2DTU A;  3AVN A;  3K5N A;  4DSF A;  4CER A;  2XY6 A;  3ISN C;  3K5O A;  4CEZ A;  4GMJ B;  4B9M A;  4B9V A;  4DTU A;  1I3A A;  3KKS A;  1S6P A;  2XY8 A;  3EZ5 A;  2HB5 A;  2D5R A;  3CFO A;  4KHN A;  1JKH A;  2RN2 A;  1TK8 A;  4C8O A;  1ZBU A;  1RDD A;  4E1N A;  3O3H A;  2KQ2 A;  3OS2 A;  3DRS A;  4JS4 A;  4M3T A;  1I39 A;  3NGI A;  4E3S A;  3HL8 A;  3OYB A;  4NCG A;  4CCH A;  5J2P A;  3ZSW A;  2G8V A;  3K58 A;  4Z4H A;  3HVR A;  3VQD A;  3SZ2 A;  1SKW A;  4BDP A;  2BE2 A;  2HNY A;  3DRP A;  3SUP A;  4E19 A;  3AVG A;  4O5B A;  4CJU A;  1KLM A;  4CF9 A;  4Z4G A;  3AV9 A;  1LWF A;  1Q9Y A;  4IFV A;  4N41 A;  2GV9 A;  4M42 A;  1ZBI A;  1EXQ A;  3O4Q A;  5KRT A;  3DOK A;  1T05 A;  2LSN A;  3ZT4 A;  1J5O A;  2Y1J A;  3DLB A;  1IKV A;  2D0B A;  4FLU A;  2VG7 A;  3LP2 A;  4DU1 A;  4CGG A;  3UIQ A;  3THV A;  1YT3 A;  4DSE A;  2D0C A;  5DMR A;  4BE1 A;  1J53 A;  3S3M A;  2G8I A;  2Q3S A;  5CZ2 A;  1C1A A;  2B5J A;  1VSD A;  3C6T A;  3JYT A;  1G15 A;  4KPY A;  1QS4 A;  1YVU A;  3NF9 A;  3M8R A;  3OS1 A;  4DFJ A;  2G8U A;  1T7P A;  1C0T A;  4F3O A;  4FLY A;  3OVN A;  4FLT A;  3LPT A;  4IG0 A;  1Q8I A;  4BE2 A;  1NKB A;  4FJN A;  2GBZ A;  2Z1G A;  3AVL A;  4GVM A;  3OYH A;  5HRO A;  1BQM A;  2XHB A;  1NK6 A;  4FJI A;  1JLA A;  4CEQ A;  2RF2 A;  2YV0 X;  3CM5 A;  1FKP A;  5FDL A;  3L2Q A;  3RRH A;  3PV8 A;  4ELU A;  1IH7 A;  1L3U A;  2Z1I A;  4AIL C;  1L3T A;  2OA8 A;  3PUF A;  3VQA A;  1WSG A;  4M3R A;  4FLW A;  1HYV A;  1WSF A;  3TAF A;  4I9Q A;  4W5N A;  1GOB A;  4ICL A;  4DMN A;  3ZCM A;  4CFD A;  3ZSZ A;  1NK5 A;  3VQB A;  1TAQ A;  3QEX A;  4E0D A;  4OJR A;  5KGX A;  3DI6 A;  1S9E A;  1Z26 A;  3LWL A;  1WLJ A;  3NAE A;  3RTV A;  2IOC A;  3L3U A;  4B08 A;  4O0I A;  4E7H A;  2OPS A;  1KFS A;  2OPP A;  3U3Y A;  1SL0 A;  3IAY A;  4CJ3 A;  3KLF A;  4DS5 A;  4O44 A;  1RBT A;  1JXB A;  4NYN A;  2JLE A;  4F3T A;  4CIG A;  4F2R A;  3RMB A;  1W0H A;  1ASU A;  3V9S A;  4OLA A;  1S5J A;  4CGF A;  3SQ1 A;  3AVF A;  4Z4F A;  4W5T A;  3K57 A;  3CFR A;  2A1S A;  1RCH A;  2VG5 A;  3L2R A;  2FC0 A;  3NGY A;  3KK2 A;  4CHQ A;  1K6Y A;  4KV8 A;  4HTU A;  2QK9 A;  2EX3 A;  1ZYQ A;  4KHY A;  1BIU A;  3OYE A;  3U3G A;  4PUO A;  3VQC A;  5CZ1 A;  2A1R A;  1UOC A;  4RW7 A;  5HP1 A;  4DQR A;  1KSP A;  1NKE A;  2FBX A;  1WN7 A;  3QIP A;  3NH1 A;  4B8C A;  4M3U A;  3AO1 A;  4KB1 A;  2E4L A;  1IKW A;  4DQQ A;  4Q0B A;  3AA3 A;  3OY9 A;  2HND A;  5C25 A;  1TK0 A;  1HQU A;  4CGD A;  4FJH A;  2QKB A;  3QEW A;  2P5G A;  1BI4 A;  4CGI A;  4IKF A;  3ZSR A;  3HPO A;  1NJW A;  3NF7 A;  3P5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...