1O1WA

Solution structure of the rnase h domain of the hiv-1 reverse transcriptase in the presence of magnesium
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
138
Chain Sequence
MNELYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Rnase H Domain of the HIV-1 Reverse Transcriptase in the Presence of Magnesium
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
molecule keywords RIBONUCLEASE H
total genus 26
structure length 138
sequence length 138
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1o1wA00
2HMIA 3LWMA 4E7KA 4DSJA 1JXBA 3NDKA 2EHGA 4Q5VA 3BGRA 1TK0A 3WNFA 2YKMA 4CIFA 1U45A 3FFIA 1CXUA 1HPZA 1B9DA 1VSDA 4AHSA 2YNIA 3ZSWA 4DTRA 3AVFA 4KTWA 3ASMA 4FJKA 3AO3A 1Q9XA 3U3YA 4Z4IA 4HUGA 1S1TA 1RTHA 5DMRA 3RWUA 4KAZA 4FJGA 1TVRA 2YV0X 4W5OA 1TGOA 1RILA 4CEOA 5KI6A 2HHQA 2KZMA 4B8AB 1WN7A 4AH9A 4DTOA 3SQ4A 3AVNA 1BQNA 4CJFA 4N41A 5I3UA 4CGDA 3VQ6A 3UIQA 3QESA 1JXEA 2QXFA 3SV3A 4DQIA 1RDBA 4LSNA 3VQ4A 3K58A 3SPZA 4PQUA 3L3VA 3VQDA 4CJSA 4PWDA 2XO7A 1IKWA 1S6PA 3AA2A 3C94A 4CGIA 3NH2A 3O3FA 1RDDA 2P5OA 4H4MA 4C8LA 4EZ6A 1XI1A 1W0HA 1D8YA 2HVIA 1BIUA 3V9UA 4FJXA 3TANA 2XY8A 2YNHA 3RRHA 4MQ3A 5CZ1A 3OYGA 1A5VA 1S9GA 1HYZA 3HPOA 1NKBA 3VQ8A 4DF4A 1U47A 3NBPA 4E7JA 1BCOA 3CYMA 1HJRA 4DTUA 3G0ZA 4DFPA 3KTQA 4L8RB 3P5JA 4O44A 1JLCA 4DTMA 3MEEA 4B3OA 1VSEA 2Y1JA 3PUFA 4OGEA 3TAEA 3KKRA 4DQSA 1S1WA 1SV5A 2YNGA 4CK2A 1ITGA 4ELVA 4NYNA 1RT2A 1RBRA 5HROA 1NJZA 2G8HA 2B6AA 3ZT4A 3TAGA 5DK5A 3RMBA 2OA8A 1S6QA 3PX4A 3OJSA 3HYFA 3V1RA 3K59A 4PA1A 3OYEA 3HVTA 4GVMA 4CHOA 3KK2A 4CHQA 1WSGA 4JS5A 3TAPA 3AVKA 2D0CA 2Z1HA 4FVMA 5J2NA 1RT4A 3QEXA 2X6NA 3AVBA 4CF0A 4H8KA 1JLAA 4W5TA 1Z26A 1NK7A 1UOCA 3PV8A 4RW9A 4I2QA 3NCIA 1NK0A 1KCFA 3B6OA 1JKHA 3V6DA 1C1AA 2HB5A 4CEQA 4CHNA 3AVIA 1R0AA 4OPKA 1SL1A 4E0DA 4DG1A 4F8RA 4DSFA 4FCYA 1RT1A 4CERA 2QKKA 1BI4A 4E19A 3O3HA 4CEDA 4RW7A 2G8WA 4I2PA 1J53A 4IBNA 5I42A 1NOYA 1D9DA 4CHZA 4B9MA 4FYDA 4KPYA 2ATQA 2IOCA 3HL8A 2OPRA 2KZZA 1D5AA 3ZT0A 4NCAA 3LP0A 4DFJA 1NOZA 2E6LA 3ZSXA 1HYVA 4OVLA 4PUOA 2KFZA 1LAWA 5C24A 3HM9A 1SKSA 1KRPA 4B9SA 3DLKA 1BCMA 4N5SA 4FLTA 2OPSA 3DLHA 1L3VA 1RDAA 1C0MA 3L2VA 3JYTA 1ZBLA 2OYQA 3H08A 3B6PA 1C0TA 4HUFA 4DLEA 1DTTA 3HPGA 4LY7A 1QQCA 1X1PA 4Q0BA 2KFNA 1C0UA 4CGJA 4DU4A 1ZBHA 4HHTA 3C95A 4CK3A 4CHYA 2FBVA 4OJRA 4RG8A 4CJQA 3CG7A 3L2WA 2BDPA 5CY4A 3ZSVA 1A5XA 1KVBA 3NGZA 4CJEA 4DSKA 3PX6A 4IDKA 3DI6A 2P5GA 3VQPA 3NAEA 3PX0A 1WLJA 4NCBA 1WSEA 3RR7A 4DWIA 4OLAA 4FJ7A 1JLQA 1X9MA 4FK4A 4YFUA 3AVLA 1RT5A 3MXMA 1LAVA 3L2QA 4CJTA 5HRNA 3MAQA 4AILC 4OLBA 2FC0A 4DLGA 4FJ9A 3OYDA 3EYZA 1QHTA 1VSLA 4IFVA 4FM0A 2DY4A 5KRTA 3KK1A 2QKBA 4CJUA 5J1EA 1EX4A 2VWJA 1BHLA 3OYHA 3M8RA 1KVCA 3KKSA 5CYQA 3MEDA 1J9AA 4KHSA 4ELUA 1ASVA 2VWKA 4YNQA 1NK4A 4FLWA 4I7FA 4OKJA 3NH1A 4KTZA 3AA5X 1EXQA 1I39A 2KQ2A 3OS0A 1K6YA 3OYAA 3KD5E 3VN5A 4DFKA 1XC9A 4FJJA 2KTQA 3ULDA 4J2BA 2XHBA 1UWBA 3AVAA 2IDOA 5CYMA 4N47A 2A1RA 2OZMA 3SUNA 2HHUA 2HNZA 5J2PA 1LWCA 3NGIA 4CFCA 4DU3A 1VSJA 1HNIA 2YNFA 2F96A 4E1MA 2FBYA 3OYBA 4BDZA 3QEVA 3I0SA 2D0AA 3K57A 4KI4A 4HTUA 1IKXA 3QO9A 4FW1A 1TK8A 4N76A 3I0RA 2RPIA 5HP1A 2I5JA 1J54A 3KJVA 3KLEA 5CZ2A 1NK8A 4FJ8A 1RBSA 3DRSA 4CEFA 2VG5A 4CIGA 3MEGA 3SQ0A 4KHQA 2RF2A 4CECA 4CF2A 2IAJA 5HRRA 2EX3A 4KO0A 3IAYA 2W42A 3EZ5A 1RNHA 3KIOA 1UA1A 4Z4GA 3WNEA 4ZTJA 2YHAA 4O4GA 3AVHA 4HUEA 3MXIA 1WAJA 3RRGA 1X9SA 2D0BA 4DSLA 1VSHA 1QS4A 4F3OA 4QAGA 4CF1A 1LWEA 4M41A 3TR8A 4DTNA 4C8OA 1A5WA 4CGFA 3V1OA 1L5UA 5KTQA 3KLFA 1LW0A 3L8BA 4ELTA 2JGUA 4Y1CA 4DTXA 1DLOA 5FROA 4CJKA 3AA4A 1VSIA 4AHVA 1ASWA 4EP4A 4RW4A 4Z0UA 4CFAA 4FLVA 2IGIA 4DQQA 3KLIA 3EY1A 4CEZA 1YTUA 3K2PA 3K5LA 2Q3SA 5EU7A 5KRSA 3VQBA 1QSSA 2O4IA 4W5RA 1KFSA 1BISA 1HNVA 1HMVA 2XRIA 5HRPA 3M8SA 4KREA 4DMNA 2RN2A 4NCGA 1NJXA 4DTPA 2OPQA 4KHYA 2HHWA 4Z4CA 4LSLA 3P83D 3AVJA 4KKOA 5KGWA 4ZTFA 4LH5A 3KLGA 1TK5A 3O4NA 5SZTA 3QNNA 3HK2A 3VQEA 4FJHA 3AVMA 3TAFA 3SQ1A 4KHNA 2HNYA 4C8MA 1JLBA 2YHBA 4AHUA 3K5MA 3SZ2A 3LALA 3DYAA 4DF8A 3RMAA 4CESA 1J5OA 4DQPA 1RDCA 4FJIA 1JL2A 3IS9A 4ID1A 3S3MA 4FLZA 1NJYA 1TKDA 5KGXA 4Z4EA 4W5QA 1WAFA 2GUIA 3SNNA 2P51A 2R7YA 1NK5A 2OPPA 1DTQA 4QCLA 4FK2A 4CF9A 2AJQA 4J2DA 3AO1A 4IKFA 2PYJA 3VQAA 4EP5A 1U04A 3LP1A 4BE0A 4QOZB 1FKOA 4M3XA 3OYNA 3SUPA 2ZD1A 1U49A 1KSPA 1WNSA 4KHUA 1NKCA 3VA0A 3V81A 4BACA 4ICLA 3K5NA 4CEBA 2OZSA 4FJ5A 4F2RA 3ZCMA 1RTJA 1S1UA 1W9HA 3KK3A 3SPYA 4BDPA 4DSEA 3V9WA 4CK1A 1O1WA 5D3GA 3DLEA 3NF7A 1F21A 4LH4A 4OKKA 1CLQA 1QSYA 4AHRA 4CCHA 4CGGA 1EKEA 1IO2A 3RTVA 2HHSA 4AHTA 3JSMA 1ZBUA 3DRRA 3QIPA 3QLHA 3HT3A 4BE1A 4B9UA 1RT7A 4HCCA 2NUBA 4HCBA 3ZSYA 4J2EA 1TKTA 3NE6A 1X9WA 1JLGA 1TKZA 4O5BA 3BDPA 2WONA 4WE1A 4Z4HA 5FRMA 1RBVA 3O3GA 1RCHA 3ITHA 2WOMA 2E4LA 1IKVA 1ZYQA 2G8VA 3M8PA 3ALYA 3TARA 1GOAA 1CXQA 3CFPA 1WSJA 4FW2A 1TL3A 3AVGA 2D5RA 3ZT3A 5HLFA 1NKEA 1SL0A 3KD1E 3LAMA 5FRNA 2VG7A 2ZQBA 2DTUA 2X6SA 4C8KA 3SUOA 1WSHA 3CM6A 4CHPA 1NJWA 1ASUA 3T3FA 3D45A 3V9SA 1JL1A 1FKPA 2A1SA 3CQ8A 3D0PA 2E6MA 2P1JA 3QIOA 3V1QA 3VQ5A 1XHZA 1JLEA 2JLEA 3NF8A 4OKEA 4BWMA 3KLHA 1LV5A 1RBTA 3VQ7A 3DM2A 4FLXA 1BQMA 3AO5A 4M3TA 3ZSOA 1N6QA 1BL3A 1T8EA 2X74A 3L2RA 1SL2A 4RW8A 3SCXA 1S1XA 3WNGA 4KHWA 1BI4B 1YTAA 1FK9A 4C8NA 4E7HA 1NK6A 2B4JA 1KFDA 3P1GA 1SKRA 4HVJA 1TAUA 3ZSRA 4E7LA 1RTDA 1WSIA 3LP2A 3S3NA 3DLBA 2HHTA 4CE9A 3HVRA 4KI6A 3HJFA 3NFAA 3M8QA 1I3AA 3A2FA 4R5PA 1HQEA 3NGYA 2Z1JA 3CM5A 4CJ3A 2PY5A 2RKIA 3CFRA 4ID5A 3VA3A 4JRQA 2X78A 4GMJB 3QEIA 1U48A 1Q9YA 1TKXA 3V4IA 1XWLA 4CJWA 4CJLA 3OYLA 1IH7A 3TAQA 3RR8A 2Y1IA 3L3UA 4CJVA 3DOLA 1Q8IA 3C6TA 3ISNC 4JRPA 4EZ9A 1YT3A 4KRFA 4J2AA 4F3TA 3DMJA 4DTJA 4O0JA 4OPJA 5T7BA 1QE1A 4UQGA 2PYLA 1UAXA 4FLUA 3NH0A 2QK9A 3RMDA 3WNHA 5E41A 3ZSQA 1UA0A 3DLGA 1WSFA 3HPHA 1HRHA 1ZBFA 1EP4A 1TV6A 3U3GA 1GOCA 5FDLA 4FZYA 1LWFA 1S9EA 1LW2A 2DFFA 4BDYA 4DS5A 4KB1A 1T03A 3DLRA 3E01A 4JLHA 2XY7A 1FXXA 3LANA 1RTIA 4BWJA 4M3RA 4N56A 1QSLA 4FJNA 4FK0A 3AV9A 4B9TA 4F2SA 1TAQA 2KW4A 1KTQA 3T19A 4AHCA 3OYJA 4FLYA 1EETA 1NK9A 4FJLA 3OYCA 3NHGA 2DFEA 2PZSA 4FZXC 3HP6A 3IRXA 1TL1A 3NF9A 2G8UA 1T7PA 4B08A 1C6VA 2HVHA 3DRPA 2O4GA 3NF6A 3TWHA 2FBXA 4E7IA 1VRTA 1BIZA 3MECA 3AO2A 3LPUA 4IFYA 4O0IA 5HBMA 4CJRA 4ZHRA 1Y97A 2F8SA 1RBUA 1RT3A 3T1AA 4CFDA 4CIEA 3LZIA 1SUQA 3HSTB 4H4OA 1G15A 4OGCA 4CJ5A 4M3UA 3HO1A 3AVCA 3OYFA 1YVUA 3QETA 3ZSZA 3L2UA 4KB0A 1HYSA 3K5OA 2HHVA 1KLMA 3V9ZA 4E3SA 4CJ4A 4F4KA 2HHXA 5JS1A 3AA3A 3TI0A 1GOBA 2ITGA 4Y1DA 3TAMA 4FM2A 3PO5A 4GW6A 3ZT2A 4M45A 4NYFA 3OS1A 2Z1GA 5SWMA 3SJJA 1MU2A 4E1NA 4K8ZA 3MXJA 5C25A 3RMCA 4CFBA 1REVA 4E89A 5HRSA 1N5YA 3OVNA 3TABA 5K14A 3VQ9A 3OS2A 1B92A 1CZBA 2Z1IA 3V9XA 4B9NA 4M42A 1Z25A 2ETJA 1HQUA 1L3UA 4DSIA 3THVA 3OYIA 2YKNA 1L3TA 4FM1A 1S5JA 4K8XA 4DTSA 3SQ2A 3OYKA 2G8KA 2G8FA 3F9KA 2BGGA 4I9LA 3HP9A 2DFHA 2HNDA 4KV8A 3CFOA 3OY9A 3PY8A 3I8DA 4M3ZA 4O55A 1S1VA 3HXMA 3G10A 4KFBA 1CZ9A 3SUQA 3LPTA 4FJMA 3SYZA 4XIUA 1ZBIA 4RW6A 1D9FA 1VRUA 3LDSA 3LZJA 4DS4A 5J2QA 3DOKA 3VQCA 4IG0A 3U6FA 1BGXT 3LP3A 3QNOA 2B5JA 3S3OA 1VSKA 4B9VA 4PY5A 3OYMA 4W5NA 4CEAA 5JS2A 4B8CA 3QEWA 3VQQA 2XY5A 3SV4A 3OJUA 3QINA 2ZE2A 3SI6A 1C1CA 2FBTA 2IS3A 4Z4FA 2F8TA 1VSFA 3QEPA 4CF8A 3C6UA 4IG3A 2GBZA 2HW3A 1XHXA 1KVAA 3QERA 1U4BA 3S9HA 4CJPA 1SKWA 3LAKA 2VG6A 1T05A 2G8IA 4G1QA 4DFMA 3LWLA 1IKYA 2IC3A 1L3SA 1KLNA 4B9LA 2XY6A 4FZZA 1JLFA 1B9FA 4M3WA 4M3YA 3IG1A 3AO4A 1VSMA 4CGHA 1RT6A 2LSNA 1QTMA 2BANA 4I9QA 4FXDA 1IG9A 3F73A 3PO4A 3ZT1A 2BE2A 1C1BA 4MFBA 5J2MA 5C42A 4JS4A 4BE2A 4DU1A 4CEEA 4KTQA 4LD0A 2GV9A 4TSXA 1VK0A 3O4QA 4DQRA
chains in the Genus database with same CATH superfamily
2E1ZA 3CCMN 1QZ5A 3NDKA 2EHGA 2IVPA 3LDOA 3E9OA 1U45A 4CW7B 1TUYA 1B9DA 2YNIA 3ZEUB 3ASMA 4FJKA 1Q9XA 5IWAK 4Z4IA 1RTHA 3A5MC 1TVRA 3SBTA 2GWKA 4CEOA 4F9OA 3THXB 4AH9A 3SQ4A 1BQNA 3ULEB 2QXFA 3SV3A 1RDBA 3MN5A 3O5BA 4PWDA 2XO7A 5FPEA 4IFEA 2P5OA 4H4MA 4A2BA 4BC4A 3TANA 2XY8A 3PSFA 3ID6A 3HPOA 3LDPA 1U47A 4LF8K 1HJRA 3G0ZA 1Z05A 4DTMA 2Y1JA 4OGEA 2GUPA 3CCQN 1S1WA 1RT2A 1NJZA 1S6QA 3L4QA 3HYFA 3V1RA 3OYEA 3HVTA 4JS5A 4FVMA 1OH8A 2X6NA 2ZF5O 3LDNA 4JI3K 1Z26A 1YJWN 4RW9A 3J7ZO 3KZBA 1JCEA 1S72N 3FR0A 3CHWA 3F5TA 1SL1A 4DG1A 4FPBA 5LJVA 2QKKA 4CERA 3VERA 3O3HA 2G8WA 1D9DA 4PKIA 2ATQA 3R8EA 3HL8A 5JVGL 1D5AA 2E6LA 3NVKA 2KFZA 2QWQA 4B9SA 4N5SA 1L3VA 3L2VA 5AQQA 2OYQA 2W6LA 4BR2A 1C0TA 4DLEA 1DTTA 1QQCA 3CJCA 1OH7A 4CK3A 4CJQA 4H0YB 1V4SA 3ZSVA 1WBDA 4CBWA 4O8KA 4BRAA 1WSEA 3H6EA 1GLEG 5CHIA 4DV1K 4FJ7A 4FK4A 3O9SA 3MK6A 5CR4A 5HRNA 5BPNA 2FC0A 1Q82O 2A41A 1VSLA 4IFVA 5MLCQ 4FO0A 4CJUA 4JI8K 1KVCA 3KKSA 3MEDA 1J9AA 2P9SB 4ELUA 4YNQA 1VHXA 1YUWA 4I7FA 4OKJA 3AA5X 4CZIA 3OS0A 2KQ2A 2KTQA 4J2BA 3THYA 5CYMA 2A1RA 3SUNA 4IJAA 4GVEA 2YNFA 2QTDA 2F96A 5AQKA 3OYBA 4M63C 1IKXA 3QO9A 4FW1A 4N76A 3I0RA 5HP1A 2I5JA 1J54A 2WC9A 2YI1A 3FZMA 2V51B 3SAGA 1RBSA 3O9QA 3G6EN 3VPZA 4CIGA 2NRVA 2RF2A 4IZ9A 2P9UB 2W42A 3Q7BA 3KIOA 1UA1A 3E66A 2YHAA 4O4GA 2HSTA 3ZLJA 3VF6A 1N33K 3GDQA 4JK8A 4M41A 2PFUA 4CGFA 2QA4N 3V1OA 4BGBA 4Y0WA 3L8BA 2QWLA 1T6CA 4FLVA 1VSIA 3VEYA 1ASWA 4Z0UA 4R79A 1SZ2A 3P4IA 4BRKA 4K43A 3K2PA 3TU5A 3K5LA 5AQZA 5EU7A 3VQBA 1QSSA 2O4IA 1KFSA 4FSVA 1GLFO 3M8SA 1NJXA 4BG8A 2OPQA 1XQSC 3DJCA 3F9MA 4LH5A 3KLGA 1TK5A 5E84A 3SQ1A 3L6QA 4PHTX 3TSPA 4I6MA 3FLCO 4FVUA 3SZ2A 3LALA 3DYAA 4RCHA 1WAFA 5JLFA 3SNNA 1KAZA 1J5EK 2UXBK 5EY4A 1DTQA 4K41A 4BVPA 2PYJA 3VQAA 4BREA 4AQYK 4DR5K 5EOYA 4M3XA 2P9KB 3OYNA 2VQFK 1WNSA 4JKGA 3VA0A 3K5NA 2OZSA 4NLCA 2O8EA 3CCVN 4CD1A 4DQ8A 3ZCMA 1KAYA 1RTJA 1W9HA 2PBDA 3SPYA 4BDPA 3V9WA 3SAFA 3HBTA 3NF7A 1QSYA 4AHRA 1EKEA 3H3OB 3JSMA 1ZBUA 3HT3A 4IEEA 4BE1A 4B9UA 4OPAA 2NUBA 3M1FA 4J2EA 1TKTA 1HKGA 4B1ZA 3T1YK 2UU9K 1EWRA 2CH6A 2HBLA 1RBVA 3O3GA 1QVGM 4JD2B 1IKVA 4LF9K 3TARA 1CXQA 3UKUA 4FW2A 3KD1E 1Y64A 3LAMA 3QFPA 5KPTA 2ASMA 3U9ZA 2DTUA 2X6SA 2UXCK 2VCPA 3T3FA 3V9SA 4JI6K 5KPRA 2P1JA 2J4RA 1JLEA 2D1KA 3NF8A 1RBTA 3CC7N 3DM2A 5GINA 3J8AA 2X74A 1SL2A 2DY4A 5EVZA 4E7HA 3OHRA 2D0OA 3ZSRA 4PL7A 1RTDA 4B3SK 3S3NA 1BU6O 3O9TA 4MDBA 4JI4K 4X66K 1HQEA 4H5TA 4ID5A 3O80A 4JRQA 2X78A 2E5LK 1ZXOA 3R1XA 5JMVA 4CJLA 3OYLA 5H1SQ 3TAQA 2Y1IA 3QMLA 1HR0K 2QI2A 4CJVA 3DXKB 3DOLA 3ISNC 3I33A 1X3NA 4O0JA 4GKKK 4FLUA 2QK9A 3WNHA 5E41A 4B1VA 1NWKA 1LWFA 1S9EA 4YOVA 3CPWM 2ZWHA 1BA1A 1T03A 5EXWA 2XY7A 4FJNA 2Q97A 4WQ5A 3AV9A 4B9TA 4GV6A 3OBYA 3CJAA 4BRNA 1KTQA 4FWQA 3T19A 4DR4K 1NG9A 3D2EB 3IRXA 1TL1A 3W0LA 1MDUB 3O9UA 3DRPA 5FPMA 2FBXA 4ISEA 3MECA 1T44A 4IFYA 3LPUA 5HBMA 4CJRA 4JYAK 1RBUA 4H4OA 3HO1A 1IBKK 4FWNA 4K42A 3QETA 4KB0A 1KAXA 3K5OA 2HHVA 1U2VA 3V9ZA 4CJ4A 4F4KA 3LL3A 1BA0A 2CGKA 3C7NA 5CE3A 3PO5A 4LF6K 3FGUA 5SWMA 1M1KO 1ESVA 5HRSA 4CJ7A 5K14A 4DR7K 3V9XA 4B9NA 4KH4A 4DSIA 2I7NA 3K9JA 3OYIA 4FM1A 1BG3A 3OYKA 4CBXA 2G8FA 2BGGA 4I9LA 4KV8A 5BN9A 4O55A 1S1VA 3VEXA 4YY3K 4FJMA 2QWOA 3U6FA 4K8XA 3QNOA 2YHYA 4CEAA 3ENBA 4B8CA 3QEWA 4Z4FA 2ZE2A 2FBTA 2F8TA 2E2NA 3IKMA 3THWA 2VG6A 1VQPN 4WQ4C 5AR0A 4DFMA 4BVOA 2XY6A 4FZZA 1JLFA 4I6MB 4BR0A 1RT6A 2LSNA 1QTMA 2BANA 3THXA 3ZT1A 4JKHA 3MWTA 3MWPA 4YOWA 2AA4A 4TSXA 1JCGA 3SLCA 4JI2K 4DSJA 3MCPA 4Q5VA 1QQMA 4CZGA 4CIFA 2P9NB 2YHWA 3ZYYX 4DTRA 3AVFA 4HUGA 1X3MA 1YJ9N 1TGOA 1RILA 4H5VA 2ZJPL 2HHQA 1IG8A 2KZMA 4DB3A 1XNRK 5I3UA 3AARA 3VQ6A 4CGDA 3QESA 1JXEA 3UIQA 1VQLN 3VQ4A 3SPZA 4PQUA 4LFCK 5ADXA 3C94A 4CGIA 1T6DA 3O3FA 3E9LA 3WXMB 3O8MA 1XI1A 3CD6N 1D8YA 5M1KA 3RRHA 3N4QA 3OYGA 3CJBA 1NKBA 3AY9A 3NBPA 1BCOA 3U8XA 3JXUA 1NNEA 4O44A 1VQ8N 4B3OA 1VSEA 3PUFA 2OTJN 3TAEA 1SV5A 2YNGA 4CK2A 4ELVA 4NYNA 2VQEK 5HROA 5GAHP 2B6AA 3ZX3A 2OA8A 3FE1A 3PX4A 5B8HA 3TTFA 5M1OA 3TAPA 3AVKA 1EQYA 4DV0K 4CF0A 3QEXA 1JLAA 1NK7A 3OA9A 4BC3A 2HBJA 1KCFA 3B6OA 1JKHA 1C1AA 2HBKA 4CEQA 1R0AA 3VENA 1RT1A 1OH6A 2P9LA 4QS9A 4RW7A 2VGNA 5ADXH 1TYQA 4IBNA 4KPYA 1C0FA 4GV9A 2E8AA 2KZZA 4JAXA 3B8AX 1W7AA 4OVLA 5E26A 2IVNA 3HM9A 3DLKA 2OPSA 1RDAA 3MN9A 3B6PA 5GIPA 2Q2RA 5AQTA 4HUFA 2KFNA 4Q0BA 4DU4A 1NGAA 1ZBHA 3C95A 2QWPA 4CHYA 3QFUA 2FBVA 1CZAN 4NB4A 2UUBK 3L2WA 2BDPA 5CY4A 1A5XA 2A6AA 3VTHA 4CJEA 3PX6A 2A5XA 4IDKA 3VQPA 3NAEA 3PX0A 1WLJA 4NCBA 4DWIA 5GAGP 1VAZA 2V7YA 1NBWA 3MMVA 3AVLA 4CJTA 3U9DA 3MAQA 4ILGB 4AILC 1QHTA 3EE9A 4FM0A 4JI0K 5KRTA 3DXMA 3KK1A 3G71N 1M90O 1EX4A 1BHLA 3OYHA 3M8RA 4YDUA 5BPMA 2VWKA 4B3TK 4FWSA 4FLWA 4DCHA 4BY9C 4FJJA 1QQOA 2XHBA 1UWBA 3AVAA 4FWOA 4N47A 1GLBG 3DWLA 3GE1A 5J2PA 2IIRA 3NGIA 4JI5K 5AQNA 4DV2K 5AFUH 2RPIA 1VQON 3CCRN 3FZFA 5CZ2A 1KD1O 1WB9A 2E2QA 1LCUA 4CEFA 3SQ0A 4KHQA 4CF2A 3IAYA 1RNHA 1NMNA 4ZTJA 3RRGA 1HPMA 2ZGYA 1VSHA 4PKHA 3VMFB 4F3OA 1RDUA 1VQMN 3OTOK 4A59A 4ELTA 5AQHA 1DLOA 5FROA 4AHVA 4CFAA 2IGIA 3G4SN 3SK3A 4CEZA 1YTUA 5KRSA 1BISA 3P38A 3TPQA 5HRPA 4WQ4A 4DMNA 5M1NA 4NCGA 2HHWA 4JI1K 1NGFA 4ZTFA 3QNNA 3VQEA 3JAMO 5AFUA 3VGLA 3CCLN 2FLOA 5LL6Z 5F0XA 5LMNK 4FJIA 3RMAA 4CESA 1RDCA 1HNXK 1JL2A 5BPLA 5KGXA 4Z4EA 1RGIA 2R7YA 3R9PA 2OPPA 3R3LA 3H3NO 4J2DA 1U04A 3LP1A 4BE0A 4QOZB 3SUPA 1KSPA 4KHUA 4XEIA 4FWRA 1XMQK 4ICLA 3WXKA 4FOEA 4CEBA 4F2RA 3VTIA 4A2AA 1S1UA 3KK3A 1O1WA 5D3GA 3DLEA 1F21A 4CCHA 1IO2A 3RTVA 2HHSA 3WT0A 4AHTA 4BRDA 4HCBA 1RT7A 1YF5L 1X9WA 1JLGA 1TKZA 3E1YA 4O5BA 4FPAA 3G25A 3ID8A 4Z4HA 3JS6A 4WFAL 2G8VA 4EHTA 3NVMA 4FOIA 3M8PA 3WXLA 3ALYA 1GOAA 2BTFA 3A8YA 3ZT3A 2P9PA 4O5FA 5AQPA 1IBMK 5AQJA 4BQLA 2VG7A 5AQYA 4H0XB 3TTDA 4C8KA 3SUOA 4CHPA 1NJWA 1FKPA 3CQ8A 3D0PA 2E6MA 3V1QA 2JLEA 4BWMA 4A62A 2P9UA 3VQ7A 4JKGB 3DLLL 3ZSOA 1BL3A 1YHQN 2NZTA 5TKWA 3L2RA 3GL1A 3M6GA 3WNGA 4B3MK 2JWLA 4C8NA 1FK9A 4HWIA 2B4JA 3HRGA 1OVQA 4CE9A 1Q81O 3NFAA 3SMSA 1VQ9N 2AP1A 2OTLN 3C0BA 4R5PA 3FZLA 3NGYA 3CM5A 3LDLA 3VA3A 2DPNA 2FSKA 1DGKN 3O1BA 4GMJB 3V4IA 3AGKA 3A5LC 3MX5A 4EZ9A 3UKRB 3SBGA 4KRFA 4UQGA 2HBMA 5FPNA 3NH0A 4IOAL 4B1UB 1UA0A 3WXJA 2YCHA 4DUYK 4KB1A 3KHYA 3WUHA 3IMXA 4BWJA 1QSLA 3J7YP 2KW4A 4H03B 3EKSA 4FLYA 1NK9A 3ZX0A 4BRQA 4KBOA 4FJLA 2G8UA 1T7PA 4LF7K 4ISGA 3TWHA 3T7ZA 2O8BA 4ZHRA 1Y97A 1GLJO 1RT3A 3LZIA 3TSQA 4CIEA 3HSTB 1G15A 2ITMA 4YDUC 3OYFA 3VESA 5AQMA 4Z94A 4BR9A 3CF5L 4E3SA 5LY3A 2Q0UA 1VQ6N 4JKEA 2HHXA 5JS1A 2ITGA 4Y1DA 4FM2A 4GW6A 4M45A 4GKJK 3OS1A 3BZCA 2Z1GA 4JKFA 4LFAK 4DV6K 3EEQA 5C25A 3T69A 1N5YA 3TABA 2CGJA 1BO5O 2RE2A 4A5BA 3WXIA 3OS2A 4X62K 1B92A 1CZBA 3A5OC 3GG4A 4M42A 1Z25A 3CPEA 4DR1K 2W40A 2O8FB 1NLVA 1NGDA 5LMUK 3SQ2A 2G8KA 3CERA 3F9KA 3CFOA 3OY9A 3PY8A 3DXMB 3SYZA 4RW6A 1VRUA 3LDSA 5J2QA 3LP3A 3OYMA 4W5NA 4IOCL 1D4XA 3SV4A 2O8DB 3QINA 4OO1J 1C1CA 4IJNA 3QEPA 5C15A 4IG3A 2HW3A 1XHXA 3QERA 1S3XA 4CJPA 4B1YB 2GWJA 2F9TA 2G8IA 1T05A 4KH5A 4G1QA 2IC3A 2NRTA 1NM1A 4CGHA 4AM7A 5KQDA 1IG9A 3F73A 2BE2A 5J2MA 4MFBA 4BC2A 3D6RA 2V7ZA 4JS4A 4BE2A 1JCFA 4CEEA 1JJ2M 4LD0A 1EO1A 4DQRA 1GLCG 3L0QA 3ULEA 2Q36A 3LWMA 5HL7L 3WQUA 4E7KA 1JXBA 3D7EO 3WNFA 3FFIA 1CXUA 3VF2A 4DR6K 4AHSA 2P9LB 4BRCA 4KTWA 1IJJA 3U3YA 3QICA 4YORA 4JEPA 4FJGA 2KLAA 3VEOA 2ZJRL 5KI6A 4B8AB 1WN7A 3AVNA 2I7PA 4N41A 2HOEA 2O8BB 3K58A 4CJSA 3VQDA 1W2BM 1S6PA 3NH2A 1RDDA 4EZ6A 1W0HA 3IUCA 2HVIA 3VGKA 1BIUA 4FJXA 5A2QO 3A0IX 2YNHA 4MQ3A 1Q86O 4MO4A 1A5VA 1S9GA 3FFKB 5AQFA 4BR7A 4DF4A 3O6WA 4DTUA 4G9ZA 3P5JA 1JLCA 4RTFD 1BDGA 3HZ6A 2NRWA 1ITGA 3P31A 1RBRA 1W97L 3BEXA 3ZT4A 3OJSA 3K59A 3DXKA 5HOOA 4GVMA 1U6ZA 2P9SA 4CZFA 4CHOA 2QM1A 4CHQA 3KK2A 2D0CA 1NGBA 2Z1HA 5J2NA 3VF4A 4MLHA 4LF5K 1UOCA 4BRMA 3PV8A 4WCEL 4BROA 3V6DA 2QWNA 4CHNA 4FJHA 4E0DA 4F8RA 3H46O 4I2PA 1J53A 4FYDA 2CH5A 4WYBA 4JKCA 3MDQA 3ZT0A 3R6MA 4DFJA 3WQTA 3K0SA 3ZSXA 4PUOA 3O08A 5C24A 1SKSA 4FLTA 1C0MA 5C0YA 3H08A 4LY7A 3VETA 1X1PA 1C0UA 2H3GX 4CGJA 4HHTA 4OJRA 4RG8A 4DV7K 3C65A 3CG7A 1KVBA 2W41A 5BR8K 4DSKA 4IWVA 3DI6A 1H1VA 4ILJA 2P5GA 3PIPL 3C7NB 1Z6RA 2P9IA 3C6AA 1RT5A 1LAVA 3L2QA 4OLBA 2FF6A 4FJ9A 2ZM6K 3KVGA 1RDWX 1DEJA 2E2PA 4H0OA 2VWJA 1N8RO 5CYQA 4H5WA 4KHSA 1DT9A 3EL2A 1ASVA 1NK4A 1XMOK 4C1NI 2ASPA 4KTZA 5AZIB 3KD5E 4O8UA 3D2EA 1K6YA 1XC9A 3ULDA 3CQYA 5BRDA 2A40A 3H1QA 4CFCA 1C0GA 5GAEP 1VSJA 1HNIA 1K8AO 3I0SA 2D0AA 3K57A 4HTUA 1TK8A 1WBBA 4DHYA 3KJVA 4EIAA 1NK8A 4FJ8A 4U67L 3DRSA 2NRHA 2NRZA 2VG5A 2O8CB 3MEGA 3ZETA 2VYPA 4CECA 1QZ6A 2IAJA 5HRRA 2EX3A 4KO0A 3EZ5A 3WNEA 3AAPA 3MXIA 4DSLA 4B1XB 1FW6A 4QAGA 5AQVA 2F7TA 1A5WA 2A42A 1L5UA 5KTQA 3KLFA 1LW0A 4Y1CA 4CJKA 4NO7A 3AA4A 4RW4A 4DQQA 4A61A 4AM6A 3KLIA 2YJEA 3CCJN 4IOXA 3GOIA 3EN9A 1HNVA 3RSEB 2XRIA 4KREA 4KHYA 1O13A 4Z4CA 4KKOA 5BN8A 1GLLO 3O4NA 2Q31A 4X65K 2QW9A 4U7BA 5C12A 3AVMA 4KHNA 3W3DA 3WEEA 3ZX2A 3K5MA 3D2FB 3IS9A 1T3VA 4ID1A 3HSCA 3S3MA 1NJYA 4JKBA 4QCLA 4BRPA 4FK2A 1ATRA 4CF9A 4IKFA 5F2RA 5JICA 1FKOA 1NGIA 2ZD1A 1NKCA 3GBTA 4BACA 5IT9O 3HTVA 3RSEA 3SJHA 1YITN 4H0TB 3CMAN 2EWSA 4OKKA 4BQZA 3MCAB 3QIPA 3DRRA 4HCCA 3MN6A 1RCHA 3ITHA 2E4LA 4A5AA 3RVCA 1ZYQA 3CFPA 1NK6A 1TL3A 2D5RA 1OH5A 5FRNA 5AQGA 1WSHA 1ASUA 4ISFA 4CD3A 3D45A 2P9PB 3IFRA 1JL1A 4JNEA 4H5NA 3VQ5A 2QWRA 3KLHA 1LV5A 4GV3A 5AQIA 2GELA 1BQMA 3AO5A 5LJWA 1E4FT 4M3TA 2O8CA 1XNQK 1MWMA 1GLAG 1TUUA 1S1XA 2FSJA 4MLEA 1SKRA 1TAUA 1WSIA 2HHTA 4KI6A 2BH1A 4PKGA 4WFNL 3HJFA 5AZIA 5I9EB 3A2FA 4EHUA 2Z1JA 4CJ3A 2PY5A 3CFRA 4CBUA 1Q9YA 1TKXA 4CJWA 3LM9A 1IH7A 1NMDA 2IVOA 3L3UA 1Q8IA 3C6TA 4J2AA 4KH6A 3DMJA 4DTJA 2E88A 4OPJA 4HTLA 2P9IB 3HM8A 3PIOL 3ZSQA 1HRHA 1WSFA 3HPHA 4JHDA 1EP4A 1TV6A 3U3GA 4H0PA 1LW2A 2DFFA 4BDYA 4JLHA 4QS8A 3LANA 4YOYA 1RTIA 4M3RA 3VEZA 4N56A 5AQUA 2FF3B 3OYJA 1EETA 1R59O 5BR9A 3OYCA 4FZXC 3HP6A 2HMPA 2OCEA 3CJ7A 2HVHA 1C6VA 3LDQA 2O4GA 3NF6A 1HKBA 4OPHA 1BIZA 3ATVA 3AO2A 2NRRA 4CFDA 3T1AA 2E2OA 1SUQA 5BREA 4OGCA 1KQSM 3AVCA 1HYSA 2GTDA 5FPDA 1KLMA 3U4LA 2FSNA 2V52B 1P8ZA 1GOBA 3TAMA 2P9NA 3ZT2A 3KWGA 4FWLA 3SJJA 1MU2A 3M5RA 4E1NA 3FZHA 4JKDA 4CFBA 1REVA 1Q7YO 3QBXA 3NMUA 3OVNA 3THYB 3I8BA 2FXUA 3VQ9A 3VEVA 5FLXO 1OKJA 4NXNK 5C2DA 2ETJA 3THVA 1S5JA 4H0VB 4DTSA 4NLBA 2E20A 2DFHA 2HNDA 4M3ZA 3CIPA 1CZ9A 4FWMA 3SUQA 3LPTA 2PAVA 4XIUA 3EO3A 1NGHA 4YOXA 3LZJA 4DS4A 3DOKA 3VQCA 4NCAA 3S3OA 2B5JA 1E3MA 4B9VA 4PY5A 2HF3A 4IXCA 3VQQA 2XY5A 3SI6A 1YJNN 2IS3A 1VSFA 3SAHA 3C6UA 2ASOA 1KXPA 1KVAA 1U4BA 3L4IA 4LF4K 3LAKA 4XH1A 1IKYA 3D2FA 1L3SA 1X9JA 5EX5A 4M3WA 4M3YA 3IG1A 1VSMA 3VEWA 4K0KK 4I9QA 3OW2M 3P39A 3PO4A 5C42A 1ATSA 3ATUA 4DU1A 2GV9A 4NXMK 4JK9A 2HMIA 3BGRA 1TK0A 1BWFO 4JI7K 3HOSA 2YKMA 2KKZA 2D0PA 3VOVA 1HPZA 1VSDA 3PSIA 4MDAA 3ZSWA 2QWMA 3J80O 4IO8A 5JLHA 3AO3A 1U2VB 1S1TA 5DMRA 3QDKA 3RWUA 4KAZA 2YV0X 4W5OA 1K8KA 5C10A 4DTOA 4CJFA 2VGMA 4DQIA 4LSNA 3LM2A 3THWB 3J81O 3ZETB 3L3VA 1IKWA 3AA2A 4C8LA 1TYQB 5BRHA 2QEXN 3V9UA 5CZ1A 1HYZA 4RWTA 3VQ8A 3A5NC 4E7JA 3CYMA 3AAQA 4J8FA 3H45C 3CJ9A 4DFPA 3KTQA 4L8RB 1VQ7N 2WTUA 3MEEA 4BR5A 3KKRA 4DQSA 2G8HA 3TAGA 3RMBA 5DK5A 4MO5A 4YOUA 4GNIA 4PA1A 4BRLA 4XH4A 1WSGA 5AQSA 1RT4A 4DKWA 3CC4N 3AVBA 4H8KA 4W5TA 4I2QA 5GIOA 3NCIA 1Q18A 3I56N 3EZWA 1NK0A 4B1WB 2HB5A 4GY2B 3AVIA 4OPKA 3QB0A 4DSFA 4FCYA 5AQRA 1BI4A 4E19A 4CEDA 1HKCA 1NOYA 5I42A 4B9MA 4CHZA 5AQOA 2GX9A 2IOCA 2OPRA 4DV5K 1N32K 2OANA 3EE8A 3LP0A 3FZKA 1NOZA 4A57A 4ILHA 1HYVA 4K25A 1LAWA 1HUXA 1KRPA 1BCMA 3DLHA 2QXLA 3JYTA 1ZBLA 3I55N 3HPGA 3UE5A 3CJ1A 3ZEUA 1IV0A 1VQKN 4L3QA 2HHHK 5KQ8A 3NGZA 1YIJN 3IDHA 5BRFA 2YJFA 3O1WA 2NRXA 3RR7A 1JLQA 1X9MA 3VGMA 4YFUA 3MXMA 4DLGA 3CC2N 3OYDA 3EYZA 1K9MO 3BF3A 4V19S 1I94K 2QKBA 5J1EA 1OVYA 4CI6A 5F1XA 1NGGA 5M1QA 3UKRA 3NH1A 1EXQA 1I39A 4EFHA 4X64K 3OYAA 2P9KA 3VN5A 4DFKA 1ILYA 2IDOA 4BRIA 3Q7CA 2OZMA 2HHUA 2HNZA 1LWCA 4WQ5C 4DU3A 4FWPA 4E1MA 3KWIA 2FBYA 4BDZA 3N4PA 3QEVA 4KI4A 4JHDB 4BR4A 3KLEA 3CXCM 5DM7L 3SMPA 3O4WA 4Z4GA 3AVHA 4E1JA 4HUEA 1WAJA 1X9SA 2D0BA 1ZC6A 1K8KB 1QS4A 3T1HK 4CF1A 1LWEA 4DTNA 3TR8A 4C8OA 4YHHK 4BRGA 5C2FA 1EWQA 1G99A 3QBWA 4M7XA 2JGUA 4JKAA 4DTXA 1FJGK 4EP4A 1BUPA 3J7AP 1NGJA 3EY1A 1YVNA 2Q3SA 4W5RA 1HMVA 2RN2A 4DTPA 4LSLA 3P83D 3AVJA 5AZJA 5KGWA 3MN7A 1J5OA 5SZTA 2F4VK 3HK2A 3TAFA 1N36K 4IEIA 2HNYA 4C8MA 1JLBA 2YHBA 4AHUA 4CZHA 4DF8A 2YHXA 4CZEA 4DQPA 4DUZK 1VQ5N 4FLZA 1TKDA 4W5QA 2GUIA 2P51A 1NK5A 2AJQA 3AO1A 2O8DA 4EP5A 5KPZA 1NGCA 3HI0A 4BRFA 1U49A 3CQXA 2RHKA 3KK7A 3PLAA 3V81A 1WUAA 4FJ5A 1HJOA 1HLUA 4BRHA 3DAWA 4JN4A 4DSEA 3WEEB 4CK1A 3CCUN 1XUPO 2D4WA 4LH4A 2NLXA 3M3ZA 4DV3K 1CLQA 1HNWK 4CGGA 1K73O 2O8FA 3MX2A 3QLHA 3ZSYA 1BOTO 3NE6A 3BDPA 2WONA 4WE1A 1LOTB 5FRMA 2GEMA 4CZMA 2WOMA 2VWBA 1MA9B 4AF1A 1WSJA 1NKEA 2E1YA 3AVGA 5HLFA 1ZBSA 1SL0A 2ZQBA 3CM6A 4YOTA 2Q0RA 4LC9B 2UYTA 2A1SA 4QS7A 1S22A 4BC5A 5DM6L 3UKUB 3QIOA 1XHZA 1J6ZA 4OKEA 2YX6A 4CZKA 1NJIO 2CGLA 4FLXA 1N6QA 2KHOA 1T8EA 3UB5A 2NNWA 3S41A 3K9KA 4RW8A 4B9QA 3SCXA 1QHAA 1KC8O 1BI4B 1YTAA 2ZJQL 4KHWA 4OLAA 4FL9A 1KFDA 3P1GA 1HX1A 4HVJA 4JV5K 4E7LA 3LP2A 3DLBA 3HVRA 1VQNN 3M8QA 1I3AA 5JVHL 3F2KA 4JD2A 5AQLA 2RKIA 4OX9K 1DKGD 4IDHA 3BUZB 3QEIA 3TTCA 1U48A 3BZKA 1XWLA 4BGAA 2O8EB 3RR8A 1YXQA 3ENOA 4JRPA 1WOQA 1YT3A 3ENHA 4F3TA 4CZLA 5T7BA 3CMEN 1QE1A 3BF1A 3CETA 1UAXA 2PYLA 3RMDA 4WF9L 3DLGA 4LFBK 1ZBFA 1GOCA 5FDLA 4FZYA 4B3RK 4DS5A 1RFQA 3DLRA 3E01A 1FXXA 5M1FA 4DR2K 4FK0A 1YI2N 4F2SA 4DV4K 1TAQA 4KHPK 4AHCA 5TKYA 2PZSA 3NHGA 2DFEA 4M7YA 3NF9A 5AZJB 1NU0A 4B08A 2WUSA 4E7IA 1VRTA 2A3ZA 4O0IA 1VQ4N 1YAGA 1N34K 1HNZK 3CCEN 2F8SA 3CCSN 4CJ5A 4M3UA 4C1NK 1V4TA 1YVUA 3ZSZA 2HF4A 3L2UA 1E4GT 4JK7A 1QVFM 4BG9A 3BY5A 1P90A 2WFBA 3AA3A 3O9RA 3TI0A 3OBWA 4NYFA 3E9PA 5AQWA 4K8ZA 3MXJA 5AQXA 3RMCA 2W6KA 3AGRA 1ATNA 4E89A 3EKUA 3H1VX 1SAZA 2UXDK 2Z1IA 3HOTA 4EAHD 1L3UA 1HQUA 2UUAK 2YKNA 1L3TA 1XC3A 2BUPA 2Q1NA 3HP9A 3CI5A 1SS6A 3I8DA 3BP8A 3HXMA 3G10A 1NGEA 4KFBA 5AJ3K 4UY8O 1ZBIA 4WFBL 1D9FA 1SQKA 4IG0A 1BGXT 1VSKA 5ELZA 2F9WA 4C23A 5JS2A 1QQNA 3OJUA 4IO9L 5M1PA 4CF8A 2JWKA 2GBZA 3C6HA 1MWKA 3S9HA 1SKWA 3LWLA 1KLNA 4CZJA 4B9LA 1B9FA 4XH5A 2ZGZA 3AO4A 2UUCK 4DR3K 4FXDA 2WBNA 1C1BA 1IBLK 4FWKA 5GADP 1GLDG 4CVNE 4PL8A 4H5RA 4KTQA 3TSUA 1VK0A 3O4QA
chains in the Genus database with same CATH topology
2HMIA 3LWMA 4E7KA 4DSJA 1JXBA 3NDKA 2EHGA 4Q5VA 3BGRA 1TK0A 3WNFA 2YKMA 4CIFA 1U45A 3FFIA 1CXUA 1HPZA 1B9DA 1VSDA 4AHSA 2YNIA 3ZSWA 4DTRA 3AVFA 4KTWA 3ASMA 4FJKA 3AO3A 1Q9XA 3U3YA 4Z4IA 4HUGA 1S1TA 1RTHA 5DMRA 3RWUA 4KAZA 4FJGA 1TVRA 2YV0X 4W5OA 1TGOA 1RILA 4CEOA 5KI6A 2HHQA 2KZMA 4B8AB 1WN7A 4AH9A 4DTOA 3SQ4A 3AVNA 1BQNA 4CJFA 4N41A 5I3UA 4CGDA 3VQ6A 3UIQA 3QESA 1JXEA 2QXFA 3SV3A 4DQIA 1RDBA 4LSNA 3VQ4A 3K58A 3SPZA 4PQUA 3L3VA 3VQDA 4CJSA 4PWDA 2XO7A 1IKWA 1S6PA 3AA2A 3C94A 4CGIA 3NH2A 3O3FA 1RDDA 2P5OA 4H4MA 4C8LA 4EZ6A 1XI1A 1W0HA 1D8YA 2HVIA 1BIUA 3V9UA 4FJXA 3TANA 2XY8A 2YNHA 3RRHA 4MQ3A 5CZ1A 3OYGA 1A5VA 1S9GA 1HYZA 3HPOA 1NKBA 3VQ8A 4DF4A 1U47A 3NBPA 4E7JA 1BCOA 3CYMA 1HJRA 4DTUA 3G0ZA 4DFPA 3KTQA 4L8RB 3P5JA 4O44A 1JLCA 4DTMA 3MEEA 4B3OA 1VSEA 2Y1JA 3PUFA 4OGEA 3TAEA 3KKRA 4DQSA 1S1WA 1SV5A 2YNGA 4CK2A 1ITGA 4ELVA 4NYNA 1RT2A 1RBRA 5HROA 1NJZA 2G8HA 2B6AA 3ZT4A 3TAGA 5DK5A 3RMBA 2OA8A 1S6QA 3PX4A 3OJSA 3HYFA 3V1RA 3K59A 4PA1A 3OYEA 3HVTA 4GVMA 4CHOA 3KK2A 4CHQA 1WSGA 4JS5A 3TAPA 3AVKA 2D0CA 2Z1HA 4FVMA 5J2NA 1RT4A 3QEXA 2X6NA 3AVBA 4CF0A 4H8KA 1JLAA 4W5TA 1Z26A 1NK7A 1UOCA 3PV8A 4RW9A 4I2QA 3NCIA 1NK0A 1KCFA 3B6OA 1JKHA 3V6DA 1C1AA 2HB5A 4CEQA 4CHNA 3AVIA 1R0AA 4OPKA 1SL1A 4E0DA 4DG1A 4F8RA 4DSFA 4FCYA 1RT1A 4CERA 2QKKA 1BI4A 4E19A 3O3HA 4CEDA 4RW7A 2G8WA 4I2PA 1J53A 4IBNA 5I42A 1NOYA 1D9DA 4CHZA 4B9MA 4FYDA 4KPYA 2ATQA 2IOCA 3HL8A 2OPRA 2KZZA 1D5AA 3ZT0A 4NCAA 3LP0A 4DFJA 1NOZA 2E6LA 3ZSXA 1HYVA 4OVLA 4PUOA 2KFZA 1LAWA 5C24A 3HM9A 1SKSA 1KRPA 4B9SA 3DLKA 1BCMA 4N5SA 4FLTA 2OPSA 3DLHA 1L3VA 1RDAA 1C0MA 3L2VA 3JYTA 1ZBLA 2OYQA 3H08A 3B6PA 1C0TA 4HUFA 4DLEA 1DTTA 3HPGA 4LY7A 1QQCA 1X1PA 4Q0BA 2KFNA 1C0UA 4CGJA 4DU4A 1ZBHA 4HHTA 3C95A 4CK3A 4CHYA 2FBVA 4OJRA 4RG8A 4CJQA 3CG7A 3L2WA 2BDPA 5CY4A 3ZSVA 1A5XA 1KVBA 3NGZA 4CJEA 4DSKA 3PX6A 4IDKA 3DI6A 2P5GA 3VQPA 3NAEA 3PX0A 1WLJA 4NCBA 1WSEA 3RR7A 4DWIA 4OLAA 4FJ7A 1JLQA 1X9MA 4FK4A 4YFUA 3AVLA 1RT5A 3MXMA 1LAVA 3L2QA 4CJTA 5HRNA 3MAQA 4AILC 4OLBA 2FC0A 4DLGA 4FJ9A 3OYDA 3EYZA 1QHTA 1VSLA 4IFVA 4FM0A 2DY4A 5KRTA 3KK1A 2QKBA 4CJUA 5J1EA 1EX4A 2VWJA 1BHLA 3OYHA 3M8RA 1KVCA 3KKSA 5CYQA 3MEDA 1J9AA 4KHSA 4ELUA 1ASVA 2VWKA 4YNQA 1NK4A 4FLWA 4I7FA 4OKJA 3NH1A 4KTZA 3AA5X 1EXQA 1I39A 2KQ2A 3OS0A 1K6YA 3OYAA 3KD5E 3VN5A 4DFKA 1XC9A 4FJJA 2KTQA 3ULDA 4J2BA 2XHBA 1UWBA 3AVAA 2IDOA 5CYMA 4N47A 2A1RA 2OZMA 3SUNA 2HHUA 2HNZA 5J2PA 1LWCA 3NGIA 4CFCA 4DU3A 1VSJA 1HNIA 2YNFA 2F96A 4E1MA 2FBYA 3OYBA 4BDZA 3QEVA 3I0SA 2D0AA 3K57A 4KI4A 4HTUA 1IKXA 3QO9A 4FW1A 1TK8A 4N76A 3I0RA 2RPIA 5HP1A 2I5JA 1J54A 3KJVA 3KLEA 5CZ2A 1NK8A 4FJ8A 1RBSA 3DRSA 4CEFA 2VG5A 4CIGA 3MEGA 3SQ0A 4KHQA 2RF2A 4CECA 4CF2A 2IAJA 5HRRA 2EX3A 4KO0A 3IAYA 2W42A 3EZ5A 1RNHA 3KIOA 1UA1A 4Z4GA 3WNEA 4ZTJA 2YHAA 4O4GA 3AVHA 4HUEA 3MXIA 1WAJA 3RRGA 1X9SA 2D0BA 4DSLA 1VSHA 1QS4A 4F3OA 4QAGA 4CF1A 1LWEA 4M41A 3TR8A 4DTNA 4C8OA 1A5WA 4CGFA 3V1OA 1L5UA 5KTQA 3KLFA 1LW0A 3L8BA 4ELTA 2JGUA 4Y1CA 4DTXA 1DLOA 5FROA 4CJKA 3AA4A 1VSIA 4AHVA 1ASWA 4EP4A 4RW4A 4Z0UA 4CFAA 4FLVA 2IGIA 4DQQA 3KLIA 3EY1A 4CEZA 1YTUA 3K2PA 3K5LA 2Q3SA 5EU7A 5KRSA 3VQBA 1QSSA 2O4IA 4W5RA 1KFSA 1BISA 1HNVA 1HMVA 2XRIA 5HRPA 3M8SA 4KREA 4DMNA 2RN2A 4NCGA 1NJXA 4DTPA 2OPQA 4KHYA 2HHWA 4Z4CA 4LSLA 3P83D 3AVJA 4KKOA 5KGWA 4ZTFA 4LH5A 3KLGA 1TK5A 3O4NA 5SZTA 3QNNA 3HK2A 3VQEA 4FJHA 3AVMA 3TAFA 3SQ1A 4KHNA 2HNYA 4C8MA 1JLBA 2YHBA 4AHUA 3K5MA 3SZ2A 3LALA 3DYAA 4DF8A 3RMAA 4CESA 1J5OA 4DQPA 1RDCA 4FJIA 1JL2A 3IS9A 4ID1A 3S3MA 4FLZA 1NJYA 1TKDA 5KGXA 4Z4EA 4W5QA 1WAFA 2GUIA 3SNNA 2P51A 2R7YA 1NK5A 2OPPA 1DTQA 4QCLA 4FK2A 4CF9A 2AJQA 4J2DA 3AO1A 4IKFA 2PYJA 3VQAA 4EP5A 1U04A 3LP1A 4BE0A 4QOZB 1FKOA 4M3XA 3OYNA 3SUPA 2ZD1A 1U49A 1KSPA 1WNSA 4KHUA 1NKCA 3VA0A 3V81A 4BACA 4ICLA 3K5NA 4CEBA 2OZSA 4FJ5A 4F2RA 3ZCMA 1RTJA 1S1UA 1W9HA 3KK3A 3SPYA 4BDPA 4DSEA 3V9WA 4CK1A 1O1WA 5D3GA 3DLEA 3NF7A 1F21A 4LH4A 4OKKA 1CLQA 1QSYA 4AHRA 4CCHA 4CGGA 1EKEA 1IO2A 3RTVA 2HHSA 4AHTA 3JSMA 1ZBUA 3DRRA 3QIPA 3QLHA 3HT3A 4BE1A 4B9UA 1RT7A 4HCCA 2NUBA 4HCBA 3ZSYA 4J2EA 1TKTA 3NE6A 1X9WA 1JLGA 1TKZA 4O5BA 3BDPA 2WONA 4WE1A 4Z4HA 5FRMA 1RBVA 3O3GA 1RCHA 3ITHA 2WOMA 2E4LA 1IKVA 1ZYQA 2G8VA 3M8PA 3ALYA 3TARA 1GOAA 1CXQA 3CFPA 1WSJA 4FW2A 1TL3A 3AVGA 2D5RA 3ZT3A 5HLFA 1NKEA 1SL0A 3KD1E 3LAMA 5FRNA 2VG7A 2ZQBA 2DTUA 2X6SA 4C8KA 3SUOA 1WSHA 3CM6A 4CHPA 1NJWA 1ASUA 3T3FA 3D45A 3V9SA 1JL1A 1FKPA 2A1SA 3CQ8A 3D0PA 2E6MA 2P1JA 3QIOA 3V1QA 3VQ5A 1XHZA 1JLEA 2JLEA 3NF8A 4OKEA 4BWMA 3KLHA 1LV5A 1RBTA 3VQ7A 3DM2A 4FLXA 1BQMA 3AO5A 4M3TA 3ZSOA 1N6QA 1BL3A 1T8EA 2X74A 3L2RA 1SL2A 4RW8A 3SCXA 1S1XA 3WNGA 4KHWA 1BI4B 1YTAA 1FK9A 4C8NA 4E7HA 1NK6A 2B4JA 1KFDA 3P1GA 1SKRA 4HVJA 1TAUA 3ZSRA 4E7LA 1RTDA 1WSIA 3LP2A 3S3NA 3DLBA 2HHTA 4CE9A 3HVRA 4KI6A 3HJFA 3NFAA 3M8QA 1I3AA 3A2FA 4R5PA 1HQEA 3NGYA 2Z1JA 3CM5A 4CJ3A 2PY5A 2RKIA 3CFRA 4ID5A 3VA3A 4JRQA 2X78A 4GMJB 3QEIA 1U48A 1Q9YA 1TKXA 3V4IA 1XWLA 4CJWA 4CJLA 3OYLA 1IH7A 3TAQA 3RR8A 2Y1IA 3L3UA 4CJVA 3DOLA 1Q8IA 3C6TA 3ISNC 4JRPA 4EZ9A 1YT3A 4KRFA 4J2AA 4F3TA 3DMJA 4DTJA 4O0JA 4OPJA 5T7BA 1QE1A 4UQGA 2PYLA 1UAXA 4FLUA 3NH0A 2QK9A 3RMDA 3WNHA 5E41A 3ZSQA 1UA0A 3DLGA 1WSFA 3HPHA 1HRHA 1ZBFA 1EP4A 1TV6A 3U3GA 1GOCA 5FDLA 4FZYA 1LWFA 1S9EA 1LW2A 2DFFA 4BDYA 4DS5A 4KB1A 1T03A 3DLRA 3E01A 4JLHA 2XY7A 1FXXA 3LANA 1RTIA 4BWJA 4M3RA 4N56A 1QSLA 4FJNA 4FK0A 3AV9A 4B9TA 4F2SA 1TAQA 2KW4A 1KTQA 3T19A 4AHCA 3OYJA 4FLYA 1EETA 1NK9A 4FJLA 3OYCA 3NHGA 2DFEA 2PZSA 4FZXC 3HP6A 3IRXA 1TL1A 3NF9A 2G8UA 1T7PA 4B08A 1C6VA 2HVHA 3DRPA 2O4GA 3NF6A 3TWHA 2FBXA 4E7IA 1VRTA 1BIZA 3MECA 3AO2A 3LPUA 4IFYA 4O0IA 5HBMA 4CJRA 4ZHRA 1Y97A 2F8SA 1RBUA 1RT3A 3T1AA 4CFDA 4CIEA 3LZIA 1SUQA 3HSTB 4H4OA 1G15A 4OGCA 4CJ5A 4M3UA 3HO1A 3AVCA 3OYFA 1YVUA 3QETA 3ZSZA 3L2UA 4KB0A 1HYSA 3K5OA 2HHVA 1KLMA 3V9ZA 4E3SA 4CJ4A 4F4KA 2HHXA 5JS1A 3AA3A 3TI0A 1GOBA 2ITGA 4Y1DA 3TAMA 4FM2A 3PO5A 4GW6A 3ZT2A 4M45A 4NYFA 3OS1A 2Z1GA 5SWMA 3SJJA 1MU2A 4E1NA 4K8ZA 3MXJA 5C25A 3RMCA 4CFBA 1REVA 4E89A 5HRSA 1N5YA 3OVNA 3TABA 5K14A 3VQ9A 3OS2A 1B92A 1CZBA 2Z1IA 3V9XA 4B9NA 4M42A 1Z25A 2ETJA 1HQUA 1L3UA 4DSIA 3THVA 3OYIA 2YKNA 1L3TA 4FM1A 1S5JA 4K8XA 4DTSA 3SQ2A 3OYKA 2G8KA 2G8FA 3F9KA 2BGGA 4I9LA 3HP9A 2DFHA 2HNDA 4KV8A 3CFOA 3OY9A 3PY8A 3I8DA 4M3ZA 4O55A 1S1VA 3HXMA 3G10A 4KFBA 1CZ9A 3SUQA 3LPTA 4FJMA 3SYZA 4XIUA 1ZBIA 4RW6A 1D9FA 1VRUA 3LDSA 3LZJA 4DS4A 5J2QA 3DOKA 3VQCA 4IG0A 3U6FA 1BGXT 3LP3A 3QNOA 2B5JA 3S3OA 1VSKA 4B9VA 4PY5A 3OYMA 4W5NA 4CEAA 5JS2A 4B8CA 3QEWA 3VQQA 2XY5A 3SV4A 3OJUA 3QINA 2ZE2A 3SI6A 1C1CA 2FBTA 2IS3A 4Z4FA 2F8TA 1VSFA 3QEPA 4CF8A 3C6UA 4IG3A 2GBZA 2HW3A 1XHXA 1KVAA 3QERA 1U4BA 3S9HA 4CJPA 1SKWA 3LAKA 2VG6A 1T05A 2G8IA 4G1QA 4DFMA 3LWLA 1IKYA 2IC3A 1L3SA 1KLNA 4B9LA 2XY6A 4FZZA 1JLFA 1B9FA 4M3WA 4M3YA 3IG1A 3AO4A 1VSMA 4CGHA 1RT6A 2LSNA 1QTMA 2BANA 4I9QA 4FXDA 1IG9A 3F73A 3PO4A 3ZT1A 2BE2A 1C1BA 4MFBA 5J2MA 5C42A 4JS4A 4BE2A 4DU1A 4CEEA 4KTQA 4LD0A 2GV9A 4TSXA 1VK0A 3O4QA 4DQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMI A;  3LWM A;  4E7K A;  4DSJ A;  1JXB A;  3NDK A;  2EHG A;  4Q5V A;  3BGR A;  1TK0 A;  3WNF A;  2YKM A;  4CIF A;  1U45 A;  3FFI A;  1CXU A;  1HPZ A;  1B9D A;  1VSD A;  4AHS A;  2YNI A;  3ZSW A;  4DTR A;  3AVF A;  4KTW A;  3ASM A;  4FJK A;  3AO3 A;  1Q9X A;  3U3Y A;  4Z4I A;  4HUG A;  1S1T A;  1RTH A;  5DMR A;  3RWU A;  4KAZ A;  4FJG A;  1TVR A;  2YV0 X;  4W5O A;  1TGO A;  1RIL A;  4CEO A;  5KI6 A;  2HHQ A;  2KZM A;  4B8A B;  1WN7 A;  4AH9 A;  4DTO A;  3SQ4 A;  3AVN A;  1BQN A;  4CJF A;  4N41 A;  5I3U A;  4CGD A;  3VQ6 A;  3UIQ A;  3QES A;  1JXE A;  2QXF A;  3SV3 A;  4DQI A;  1RDB A;  4LSN A;  3VQ4 A;  3K58 A;  3SPZ A;  4PQU A;  3L3V A;  3VQD A;  4CJS A;  4PWD A;  2XO7 A;  1IKW A;  1S6P A;  3AA2 A;  3C94 A;  4CGI A;  3NH2 A;  3O3F A;  1RDD A;  2P5O A;  4H4M A;  4C8L A;  4EZ6 A;  1XI1 A;  1W0H A;  1D8Y A;  2HVI A;  1BIU A;  3V9U A;  4FJX A;  3TAN A;  2XY8 A;  2YNH A;  3RRH A;  4MQ3 A;  5CZ1 A;  3OYG A;  1A5V A;  1S9G A;  1HYZ A;  3HPO A;  1NKB A;  3VQ8 A;  4DF4 A;  1U47 A;  3NBP A;  4E7J A;  1BCO A;  3CYM A;  1HJR A;  4DTU A;  3G0Z A;  4DFP A;  3KTQ A;  4L8R B;  3P5J A;  4O44 A;  1JLC A;  4DTM A;  3MEE A;  4B3O A;  1VSE A;  2Y1J A;  3PUF A;  4OGE A;  3TAE A;  3KKR A;  4DQS A;  1S1W A;  1SV5 A;  2YNG A;  4CK2 A;  1ITG A;  4ELV A;  4NYN A;  1RT2 A;  1RBR A;  5HRO A;  1NJZ A;  2G8H A;  2B6A A;  3ZT4 A;  3TAG A;  5DK5 A;  3RMB A;  2OA8 A;  1S6Q A;  3PX4 A;  3OJS A;  3HYF A;  3V1R A;  3K59 A;  4PA1 A;  3OYE A;  3HVT A;  4GVM A;  4CHO A;  3KK2 A;  4CHQ A;  1WSG A;  4JS5 A;  3TAP A;  3AVK A;  2D0C A;  2Z1H A;  4FVM A;  5J2N A;  1RT4 A;  3QEX A;  2X6N A;  3AVB A;  4CF0 A;  4H8K A;  1JLA A;  4W5T A;  1Z26 A;  1NK7 A;  1UOC A;  3PV8 A;  4RW9 A;  4I2Q A;  3NCI A;  1NK0 A;  1KCF A;  3B6O A;  1JKH A;  3V6D A;  1C1A A;  2HB5 A;  4CEQ A;  4CHN A;  3AVI A;  1R0A A;  4OPK A;  1SL1 A;  4E0D A;  4DG1 A;  4F8R A;  4DSF A;  4FCY A;  1RT1 A;  4CER A;  2QKK A;  1BI4 A;  4E19 A;  3O3H A;  4CED A;  4RW7 A;  2G8W A;  4I2P A;  1J53 A;  4IBN A;  5I42 A;  1NOY A;  1D9D A;  4CHZ A;  4B9M A;  4FYD A;  4KPY A;  2ATQ A;  2IOC A;  3HL8 A;  2OPR A;  2KZZ A;  1D5A A;  3ZT0 A;  4NCA A;  3LP0 A;  4DFJ A;  1NOZ A;  2E6L A;  3ZSX A;  1HYV A;  4OVL A;  4PUO A;  2KFZ A;  1LAW A;  5C24 A;  3HM9 A;  1SKS A;  1KRP A;  4B9S A;  3DLK A;  1BCM A;  4N5S A;  4FLT A;  2OPS A;  3DLH A;  1L3V A;  1RDA A;  1C0M A;  3L2V A;  3JYT A;  1ZBL A;  2OYQ A;  3H08 A;  3B6P A;  1C0T A;  4HUF A;  4DLE A;  1DTT A;  3HPG A;  4LY7 A;  1QQC A;  1X1P A;  4Q0B A;  2KFN A;  1C0U A;  4CGJ A;  4DU4 A;  1ZBH A;  4HHT A;  3C95 A;  4CK3 A;  4CHY A;  2FBV A;  4OJR A;  4RG8 A;  4CJQ A;  3CG7 A;  3L2W A;  2BDP A;  5CY4 A;  3ZSV A;  1A5X A;  1KVB A;  3NGZ A;  4CJE A;  4DSK A;  3PX6 A;  4IDK A;  3DI6 A;  2P5G A;  3VQP A;  3NAE A;  3PX0 A;  1WLJ A;  4NCB A;  1WSE A;  3RR7 A;  4DWI A;  4OLA A;  4FJ7 A;  1JLQ A;  1X9M A;  4FK4 A;  4YFU A;  3AVL A;  1RT5 A;  3MXM A;  1LAV A;  3L2Q A;  4CJT A;  5HRN A;  3MAQ A;  4AIL C;  4OLB A;  2FC0 A;  4DLG A;  4FJ9 A;  3OYD A;  3EYZ A;  1QHT A;  1VSL A;  4IFV A;  4FM0 A;  2DY4 A;  5KRT A;  3KK1 A;  2QKB A;  4CJU A;  5J1E A;  1EX4 A;  2VWJ A;  1BHL A;  3OYH A;  3M8R A;  1KVC A;  3KKS A;  5CYQ A;  3MED A;  1J9A A;  4KHS A;  4ELU A;  1ASV A;  2VWK A;  4YNQ A;  1NK4 A;  4FLW A;  4I7F A;  4OKJ A;  3NH1 A;  4KTZ A;  3AA5 X;  1EXQ A;  1I39 A;  2KQ2 A;  3OS0 A;  1K6Y A;  3OYA A;  3KD5 E;  3VN5 A;  4DFK A;  1XC9 A;  4FJJ A;  2KTQ A;  3ULD A;  4J2B A;  2XHB A;  1UWB A;  3AVA A;  2IDO A;  5CYM A;  4N47 A;  2A1R A;  2OZM A;  3SUN A;  2HHU A;  2HNZ A;  5J2P A;  1LWC A;  3NGI A;  4CFC A;  4DU3 A;  1VSJ A;  1HNI A;  2YNF A;  2F96 A;  4E1M A;  2FBY A;  3OYB A;  4BDZ A;  3QEV A;  3I0S A;  2D0A A;  3K57 A;  4KI4 A;  4HTU A;  1IKX A;  3QO9 A;  4FW1 A;  1TK8 A;  4N76 A;  3I0R A;  2RPI A;  5HP1 A;  2I5J A;  1J54 A;  3KJV A;  3KLE A;  5CZ2 A;  1NK8 A;  4FJ8 A;  1RBS A;  3DRS A;  4CEF A;  2VG5 A;  4CIG A;  3MEG A;  3SQ0 A;  4KHQ A;  2RF2 A;  4CEC A;  4CF2 A;  2IAJ A;  5HRR A;  2EX3 A;  4KO0 A;  3IAY A;  2W42 A;  3EZ5 A;  1RNH A;  3KIO A;  1UA1 A;  4Z4G A;  3WNE A;  4ZTJ A;  2YHA A;  4O4G A;  3AVH A;  4HUE A;  3MXI A;  1WAJ A;  3RRG A;  1X9S A;  2D0B A;  4DSL A;  1VSH A;  1QS4 A;  4F3O A;  4QAG A;  4CF1 A;  1LWE A;  4M41 A;  3TR8 A;  4DTN A;  4C8O A;  1A5W A;  4CGF A;  3V1O A;  1L5U A;  5KTQ A;  3KLF A;  1LW0 A;  3L8B A;  4ELT A;  2JGU A;  4Y1C A;  4DTX A;  1DLO A;  5FRO A;  4CJK A;  3AA4 A;  1VSI A;  4AHV A;  1ASW A;  4EP4 A;  4RW4 A;  4Z0U A;  4CFA A;  4FLV A;  2IGI A;  4DQQ A;  3KLI A;  3EY1 A;  4CEZ A;  1YTU A;  3K2P A;  3K5L A;  2Q3S A;  5EU7 A;  5KRS A;  3VQB A;  1QSS A;  2O4I A;  4W5R A;  1KFS A;  1BIS A;  1HNV A;  1HMV A;  2XRI A;  5HRP A;  3M8S A;  4KRE A;  4DMN A;  2RN2 A;  4NCG A;  1NJX A;  4DTP A;  2OPQ A;  4KHY A;  2HHW A;  4Z4C A;  4LSL A;  3P83 D;  3AVJ A;  4KKO A;  5KGW A;  4ZTF A;  4LH5 A;  3KLG A;  1TK5 A;  3O4N A;  5SZT A;  3QNN A;  3HK2 A;  3VQE A;  4FJH A;  3AVM A;  3TAF A;  3SQ1 A;  4KHN A;  2HNY A;  4C8M A;  1JLB A;  2YHB A;  4AHU A;  3K5M A;  3SZ2 A;  3LAL A;  3DYA A;  4DF8 A;  3RMA A;  4CES A;  1J5O A;  4DQP A;  1RDC A;  4FJI A;  1JL2 A;  3IS9 A;  4ID1 A;  3S3M A;  4FLZ A;  1NJY A;  1TKD A;  5KGX A;  4Z4E A;  4W5Q A;  1WAF A;  2GUI A;  3SNN A;  2P51 A;  2R7Y A;  1NK5 A;  2OPP A;  1DTQ A;  4QCL A;  4FK2 A;  4CF9 A;  2AJQ A;  4J2D A;  3AO1 A;  4IKF A;  2PYJ A;  3VQA A;  4EP5 A;  1U04 A;  3LP1 A;  4BE0 A;  4QOZ B;  1FKO A;  4M3X A;  3OYN A;  3SUP A;  2ZD1 A;  1U49 A;  1KSP A;  1WNS A;  4KHU A;  1NKC A;  3VA0 A;  3V81 A;  4BAC A;  4ICL A;  3K5N A;  4CEB A;  2OZS A;  4FJ5 A;  4F2R A;  3ZCM A;  1RTJ A;  1S1U A;  1W9H A;  3KK3 A;  3SPY A;  4BDP A;  4DSE A;  3V9W A;  4CK1 A;  1O1W A;  5D3G A;  3DLE A;  3NF7 A;  1F21 A;  4LH4 A;  4OKK A;  1CLQ A;  1QSY A;  4AHR A;  4CCH A;  4CGG A;  1EKE A;  1IO2 A;  3RTV A;  2HHS A;  4AHT A;  3JSM A;  1ZBU A;  3DRR A;  3QIP A;  3QLH A;  3HT3 A;  4BE1 A;  4B9U A;  1RT7 A;  4HCC A;  2NUB A;  4HCB A;  3ZSY A;  4J2E A;  1TKT A;  3NE6 A;  1X9W A;  1JLG A;  1TKZ A;  4O5B A;  3BDP A;  2WON A;  4WE1 A;  4Z4H A;  5FRM A;  1RBV A;  3O3G A;  1RCH A;  3ITH A;  2WOM A;  2E4L A;  1IKV A;  1ZYQ A;  2G8V A;  3M8P A;  3ALY A;  3TAR A;  1GOA A;  1CXQ A;  3CFP A;  1WSJ A;  4FW2 A;  1TL3 A;  3AVG A;  2D5R A;  3ZT3 A;  5HLF A;  1NKE A;  1SL0 A;  3KD1 E;  3LAM A;  5FRN A;  2VG7 A;  2ZQB A;  2DTU A;  2X6S A;  4C8K A;  3SUO A;  1WSH A;  3CM6 A;  4CHP A;  1NJW A;  1ASU A;  3T3F A;  3D45 A;  3V9S A;  1JL1 A;  1FKP A;  2A1S A;  3CQ8 A;  3D0P A;  2E6M A;  2P1J A;  3QIO A;  3V1Q A;  3VQ5 A;  1XHZ A;  1JLE A;  2JLE A;  3NF8 A;  4OKE A;  4BWM A;  3KLH A;  1LV5 A;  1RBT A;  3VQ7 A;  3DM2 A;  4FLX A;  1BQM A;  3AO5 A;  4M3T A;  3ZSO A;  1N6Q A;  1BL3 A;  1T8E A;  2X74 A;  3L2R A;  1SL2 A;  4RW8 A;  3SCX A;  1S1X A;  3WNG A;  4KHW A;  1BI4 B;  1YTA A;  1FK9 A;  4C8N A;  4E7H A;  1NK6 A;  2B4J A;  1KFD A;  3P1G A;  1SKR A;  4HVJ A;  1TAU A;  3ZSR A;  4E7L A;  1RTD A;  1WSI A;  3LP2 A;  3S3N A;  3DLB A;  2HHT A;  4CE9 A;  3HVR A;  4KI6 A;  3HJF A;  3NFA A;  3M8Q A;  1I3A A;  3A2F A;  4R5P A;  1HQE A;  3NGY A;  2Z1J A;  3CM5 A;  4CJ3 A;  2PY5 A;  2RKI A;  3CFR A;  4ID5 A;  3VA3 A;  4JRQ A;  2X78 A;  4GMJ B;  3QEI A;  1U48 A;  1Q9Y A;  1TKX A;  3V4I A;  1XWL A;  4CJW A;  4CJL A;  3OYL A;  1IH7 A;  3TAQ A;  3RR8 A;  2Y1I A;  3L3U A;  4CJV A;  3DOL A;  1Q8I A;  3C6T A;  3ISN C;  4JRP A;  4EZ9 A;  1YT3 A;  4KRF A;  4J2A A;  4F3T A;  3DMJ A;  4DTJ A;  4O0J A;  4OPJ A;  5T7B A;  1QE1 A;  4UQG A;  2PYL A;  1UAX A;  4FLU A;  3NH0 A;  2QK9 A;  3RMD A;  3WNH A;  5E41 A;  3ZSQ A;  1UA0 A;  3DLG A;  1WSF A;  3HPH A;  1HRH A;  1ZBF A;  1EP4 A;  1TV6 A;  3U3G A;  1GOC A;  5FDL A;  4FZY A;  1LWF A;  1S9E A;  1LW2 A;  2DFF A;  4BDY A;  4DS5 A;  4KB1 A;  1T03 A;  3DLR A;  3E01 A;  4JLH A;  2XY7 A;  1FXX A;  3LAN A;  1RTI A;  4BWJ A;  4M3R A;  4N56 A;  1QSL A;  4FJN A;  4FK0 A;  3AV9 A;  4B9T A;  4F2S A;  1TAQ A;  2KW4 A;  1KTQ A;  3T19 A;  4AHC A;  3OYJ A;  4FLY A;  1EET A;  1NK9 A;  4FJL A;  3OYC A;  3NHG A;  2DFE A;  2PZS A;  4FZX C;  3HP6 A;  3IRX A;  1TL1 A;  3NF9 A;  2G8U A;  1T7P A;  4B08 A;  1C6V A;  2HVH A;  3DRP A;  2O4G A;  3NF6 A;  3TWH A;  2FBX A;  4E7I A;  1VRT A;  1BIZ A;  3MEC A;  3AO2 A;  3LPU A;  4IFY A;  4O0I A;  5HBM A;  4CJR A;  4ZHR A;  1Y97 A;  2F8S A;  1RBU A;  1RT3 A;  3T1A A;  4CFD A;  4CIE A;  3LZI A;  1SUQ A;  3HST B;  4H4O A;  1G15 A;  4OGC A;  4CJ5 A;  4M3U A;  3HO1 A;  3AVC A;  3OYF A;  1YVU A;  3QET A;  3ZSZ A;  3L2U A;  4KB0 A;  1HYS A;  3K5O A;  2HHV A;  1KLM A;  3V9Z A;  4E3S A;  4CJ4 A;  4F4K A;  2HHX A;  5JS1 A;  3AA3 A;  3TI0 A;  1GOB A;  2ITG A;  4Y1D A;  3TAM A;  4FM2 A;  3PO5 A;  4GW6 A;  3ZT2 A;  4M45 A;  4NYF A;  3OS1 A;  2Z1G A;  5SWM A;  3SJJ A;  1MU2 A;  4E1N A;  4K8Z A;  3MXJ A;  5C25 A;  3RMC A;  4CFB A;  1REV A;  4E89 A;  5HRS A;  1N5Y A;  3OVN A;  3TAB A;  5K14 A;  3VQ9 A;  3OS2 A;  1B92 A;  1CZB A;  2Z1I A;  3V9X A;  4B9N A;  4M42 A;  1Z25 A;  2ETJ A;  1HQU A;  1L3U A;  4DSI A;  3THV A;  3OYI A;  2YKN A;  1L3T A;  4FM1 A;  1S5J A;  4K8X A;  4DTS A;  3SQ2 A;  3OYK A;  2G8K A;  2G8F A;  3F9K A;  2BGG A;  4I9L A;  3HP9 A;  2DFH A;  2HND A;  4KV8 A;  3CFO A;  3OY9 A;  3PY8 A;  3I8D A;  4M3Z A;  4O55 A;  1S1V A;  3HXM A;  3G10 A;  4KFB A;  1CZ9 A;  3SUQ A;  3LPT A;  4FJM A;  3SYZ A;  4XIU A;  1ZBI A;  4RW6 A;  1D9F A;  1VRU A;  3LDS A;  3LZJ A;  4DS4 A;  5J2Q A;  3DOK A;  3VQC A;  4IG0 A;  3U6F A;  1BGX T;  3LP3 A;  3QNO A;  2B5J A;  3S3O A;  1VSK A;  4B9V A;  4PY5 A;  3OYM A;  4W5N A;  4CEA A;  5JS2 A;  4B8C A;  3QEW A;  3VQQ A;  2XY5 A;  3SV4 A;  3OJU A;  3QIN A;  2ZE2 A;  3SI6 A;  1C1C A;  2FBT A;  2IS3 A;  4Z4F A;  2F8T A;  1VSF A;  3QEP A;  4CF8 A;  3C6U A;  4IG3 A;  2GBZ A;  2HW3 A;  1XHX A;  1KVA A;  3QER A;  1U4B A;  3S9H A;  4CJP A;  1SKW A;  3LAK A;  2VG6 A;  1T05 A;  2G8I A;  4G1Q A;  4DFM A;  3LWL A;  1IKY A;  2IC3 A;  1L3S A;  1KLN A;  4B9L A;  2XY6 A;  4FZZ A;  1JLF A;  1B9F A;  4M3W A;  4M3Y A;  3IG1 A;  3AO4 A;  1VSM A;  4CGH A;  1RT6 A;  2LSN A;  1QTM A;  2BAN A;  4I9Q A;  4FXD A;  1IG9 A;  3F73 A;  3PO4 A;  3ZT1 A;  2BE2 A;  1C1B A;  4MFB A;  5J2M A;  5C42 A;  4JS4 A;  4BE2 A;  4DU1 A;  4CEE A;  4KTQ A;  4LD0 A;  2GV9 A;  4TSX A;  1VK0 A;  3O4Q A;  4DQR A; 
#chains in the Genus database with same CATH topology
 2E1Z A;  3CCM N;  1QZ5 A;  3NDK A;  2EHG A;  2IVP A;  3LDO A;  3E9O A;  1U45 A;  4CW7 B;  1TUY A;  1B9D A;  2YNI A;  3ZEU B;  3ASM A;  4FJK A;  1Q9X A;  5IWA K;  4Z4I A;  1RTH A;  3A5M C;  1TVR A;  3SBT A;  2GWK A;  4CEO A;  4F9O A;  3THX B;  4AH9 A;  3SQ4 A;  1BQN A;  3ULE B;  2QXF A;  3SV3 A;  1RDB A;  3MN5 A;  3O5B A;  4PWD A;  2XO7 A;  5FPE A;  4IFE A;  2P5O A;  4H4M A;  4A2B A;  4BC4 A;  3TAN A;  2XY8 A;  3PSF A;  3ID6 A;  3HPO A;  3LDP A;  1U47 A;  4LF8 K;  1HJR A;  3G0Z A;  1Z05 A;  4DTM A;  2Y1J A;  4OGE A;  2GUP A;  3CCQ N;  1S1W A;  1RT2 A;  1NJZ A;  1S6Q A;  3L4Q A;  3HYF A;  3V1R A;  3OYE A;  3HVT A;  4JS5 A;  4FVM A;  1OH8 A;  2X6N A;  2ZF5 O;  3LDN A;  4JI3 K;  1Z26 A;  1YJW N;  4RW9 A;  3J7Z O;  3KZB A;  1JCE A;  1S72 N;  3FR0 A;  3CHW A;  3F5T A;  1SL1 A;  4DG1 A;  4FPB A;  5LJV A;  2QKK A;  4CER A;  3VER A;  3O3H A;  2G8W A;  1D9D A;  4PKI A;  2ATQ A;  3R8E A;  3HL8 A;  5JVG L;  1D5A A;  2E6L A;  3NVK A;  2KFZ A;  2QWQ A;  4B9S A;  4N5S A;  1L3V A;  3L2V A;  5AQQ A;  2OYQ A;  2W6L A;  4BR2 A;  1C0T A;  4DLE A;  1DTT A;  1QQC A;  3CJC A;  1OH7 A;  4CK3 A;  4CJQ A;  4H0Y B;  1V4S A;  3ZSV A;  1WBD A;  4CBW A;  4O8K A;  4BRA A;  1WSE A;  3H6E A;  1GLE G;  5CHI A;  4DV1 K;  4FJ7 A;  4FK4 A;  3O9S A;  3MK6 A;  5CR4 A;  5HRN A;  5BPN A;  2FC0 A;  1Q82 O;  2A41 A;  1VSL A;  4IFV A;  5MLC Q;  4FO0 A;  4CJU A;  4JI8 K;  1KVC A;  3KKS A;  3MED A;  1J9A A;  2P9S B;  4ELU A;  4YNQ A;  1VHX A;  1YUW A;  4I7F A;  4OKJ A;  3AA5 X;  4CZI A;  3OS0 A;  2KQ2 A;  2KTQ A;  4J2B A;  3THY A;  5CYM A;  2A1R A;  3SUN A;  4IJA A;  4GVE A;  2YNF A;  2QTD A;  2F96 A;  5AQK A;  3OYB A;  4M63 C;  1IKX A;  3QO9 A;  4FW1 A;  4N76 A;  3I0R A;  5HP1 A;  2I5J A;  1J54 A;  2WC9 A;  2YI1 A;  3FZM A;  2V51 B;  3SAG A;  1RBS A;  3O9Q A;  3G6E N;  3VPZ A;  4CIG A;  2NRV A;  2RF2 A;  4IZ9 A;  2P9U B;  2W42 A;  3Q7B A;  3KIO A;  1UA1 A;  3E66 A;  2YHA A;  4O4G A;  2HST A;  3ZLJ A;  3VF6 A;  1N33 K;  3GDQ A;  4JK8 A;  4M41 A;  2PFU A;  4CGF A;  2QA4 N;  3V1O A;  4BGB A;  4Y0W A;  3L8B A;  2QWL A;  1T6C A;  4FLV A;  1VSI A;  3VEY A;  1ASW A;  4Z0U A;  4R79 A;  1SZ2 A;  3P4I A;  4BRK A;  4K43 A;  3K2P A;  3TU5 A;  3K5L A;  5AQZ A;  5EU7 A;  3VQB A;  1QSS A;  2O4I A;  1KFS A;  4FSV A;  1GLF O;  3M8S A;  1NJX A;  4BG8 A;  2OPQ A;  1XQS C;  3DJC A;  3F9M A;  4LH5 A;  3KLG A;  1TK5 A;  5E84 A;  3SQ1 A;  3L6Q A;  4PHT X;  3TSP A;  4I6M A;  3FLC O;  4FVU A;  3SZ2 A;  3LAL A;  3DYA A;  4RCH A;  1WAF A;  5JLF A;  3SNN A;  1KAZ A;  1J5E K;  2UXB K;  5EY4 A;  1DTQ A;  4K41 A;  4BVP A;  2PYJ A;  3VQA A;  4BRE A;  4AQY K;  4DR5 K;  5EOY A;  4M3X A;  2P9K B;  3OYN A;  2VQF K;  1WNS A;  4JKG A;  3VA0 A;  3K5N A;  2OZS A;  4NLC A;  2O8E A;  3CCV N;  4CD1 A;  4DQ8 A;  3ZCM A;  1KAY A;  1RTJ A;  1W9H A;  2PBD A;  3SPY A;  4BDP A;  3V9W A;  3SAF A;  3HBT A;  3NF7 A;  1QSY A;  4AHR A;  1EKE A;  3H3O B;  3JSM A;  1ZBU A;  3HT3 A;  4IEE A;  4BE1 A;  4B9U A;  4OPA A;  2NUB A;  3M1F A;  4J2E A;  1TKT A;  1HKG A;  4B1Z A;  3T1Y K;  2UU9 K;  1EWR A;  2CH6 A;  2HBL A;  1RBV A;  3O3G A;  1QVG M;  4JD2 B;  1IKV A;  4LF9 K;  3TAR A;  1CXQ A;  3UKU A;  4FW2 A;  3KD1 E;  1Y64 A;  3LAM A;  3QFP A;  5KPT A;  2ASM A;  3U9Z A;  2DTU A;  2X6S A;  2UXC K;  2VCP A;  3T3F A;  3V9S A;  4JI6 K;  5KPR A;  2P1J A;  2J4R A;  1JLE A;  2D1K A;  3NF8 A;  1RBT A;  3CC7 N;  3DM2 A;  5GIN A;  3J8A A;  2X74 A;  1SL2 A;  2DY4 A;  5EVZ A;  4E7H A;  3OHR A;  2D0O A;  3ZSR A;  4PL7 A;  1RTD A;  4B3S K;  3S3N A;  1BU6 O;  3O9T A;  4MDB A;  4JI4 K;  4X66 K;  1HQE A;  4H5T A;  4ID5 A;  3O80 A;  4JRQ A;  2X78 A;  2E5L K;  1ZXO A;  3R1X A;  5JMV A;  4CJL A;  3OYL A;  5H1S Q;  3TAQ A;  2Y1I A;  3QML A;  1HR0 K;  2QI2 A;  4CJV A;  3DXK B;  3DOL A;  3ISN C;  3I33 A;  1X3N A;  4O0J A;  4GKK K;  4FLU A;  2QK9 A;  3WNH A;  5E41 A;  4B1V A;  1NWK A;  1LWF A;  1S9E A;  4YOV A;  3CPW M;  2ZWH A;  1BA1 A;  1T03 A;  5EXW A;  2XY7 A;  4FJN A;  2Q97 A;  4WQ5 A;  3AV9 A;  4B9T A;  4GV6 A;  3OBY A;  3CJA A;  4BRN A;  1KTQ A;  4FWQ A;  3T19 A;  4DR4 K;  1NG9 A;  3D2E B;  3IRX A;  1TL1 A;  3W0L A;  1MDU B;  3O9U A;  3DRP A;  5FPM A;  2FBX A;  4ISE A;  3MEC A;  1T44 A;  4IFY A;  3LPU A;  5HBM A;  4CJR A;  4JYA K;  1RBU A;  4H4O A;  3HO1 A;  1IBK K;  4FWN A;  4K42 A;  3QET A;  4KB0 A;  1KAX A;  3K5O A;  2HHV A;  1U2V A;  3V9Z A;  4CJ4 A;  4F4K A;  3LL3 A;  1BA0 A;  2CGK A;  3C7N A;  5CE3 A;  3PO5 A;  4LF6 K;  3FGU A;  5SWM A;  1M1K O;  1ESV A;  5HRS A;  4CJ7 A;  5K14 A;  4DR7 K;  3V9X A;  4B9N A;  4KH4 A;  4DSI A;  2I7N A;  3K9J A;  3OYI A;  4FM1 A;  1BG3 A;  3OYK A;  4CBX A;  2G8F A;  2BGG A;  4I9L A;  4KV8 A;  5BN9 A;  4O55 A;  1S1V A;  3VEX A;  4YY3 K;  4FJM A;  2QWO A;  3U6F A;  4K8X A;  3QNO A;  2YHY A;  4CEA A;  3ENB A;  4B8C A;  3QEW A;  4Z4F A;  2ZE2 A;  2FBT A;  2F8T A;  2E2N A;  3IKM A;  3THW A;  2VG6 A;  1VQP N;  4WQ4 C;  5AR0 A;  4DFM A;  4BVO A;  2XY6 A;  4FZZ A;  1JLF A;  4I6M B;  4BR0 A;  1RT6 A;  2LSN A;  1QTM A;  2BAN A;  3THX A;  3ZT1 A;  4JKH A;  3MWT A;  3MWP A;  4YOW A;  2AA4 A;  4TSX A;  1JCG A;  3SLC A;  4JI2 K;  4DSJ A;  3MCP A;  4Q5V A;  1QQM A;  4CZG A;  4CIF A;  2P9N B;  2YHW A;  3ZYY X;  4DTR A;  3AVF A;  4HUG A;  1X3M A;  1YJ9 N;  1TGO A;  1RIL A;  4H5V A;  2ZJP L;  2HHQ A;  1IG8 A;  2KZM A;  4DB3 A;  1XNR K;  5I3U A;  3AAR A;  3VQ6 A;  4CGD A;  3QES A;  1JXE A;  3UIQ A;  1VQL N;  3VQ4 A;  3SPZ A;  4PQU A;  4LFC K;  5ADX A;  3C94 A;  4CGI A;  1T6D A;  3O3F A;  3E9L A;  3WXM B;  3O8M A;  1XI1 A;  3CD6 N;  1D8Y A;  5M1K A;  3RRH A;  3N4Q A;  3OYG A;  3CJB A;  1NKB A;  3AY9 A;  3NBP A;  1BCO A;  3U8X A;  3JXU A;  1NNE A;  4O44 A;  1VQ8 N;  4B3O A;  1VSE A;  3PUF A;  2OTJ N;  3TAE A;  1SV5 A;  2YNG A;  4CK2 A;  4ELV A;  4NYN A;  2VQE K;  5HRO A;  5GAH P;  2B6A A;  3ZX3 A;  2OA8 A;  3FE1 A;  3PX4 A;  5B8H A;  3TTF A;  5M1O A;  3TAP A;  3AVK A;  1EQY A;  4DV0 K;  4CF0 A;  3QEX A;  1JLA A;  1NK7 A;  3OA9 A;  4BC3 A;  2HBJ A;  1KCF A;  3B6O A;  1JKH A;  1C1A A;  2HBK A;  4CEQ A;  1R0A A;  3VEN A;  1RT1 A;  1OH6 A;  2P9L A;  4QS9 A;  4RW7 A;  2VGN A;  5ADX H;  1TYQ A;  4IBN A;  4KPY A;  1C0F A;  4GV9 A;  2E8A A;  2KZZ A;  4JAX A;  3B8A X;  1W7A A;  4OVL A;  5E26 A;  2IVN A;  3HM9 A;  3DLK A;  2OPS A;  1RDA A;  3MN9 A;  3B6P A;  5GIP A;  2Q2R A;  5AQT A;  4HUF A;  2KFN A;  4Q0B A;  4DU4 A;  1NGA A;  1ZBH A;  3C95 A;  2QWP A;  4CHY A;  3QFU A;  2FBV A;  1CZA N;  4NB4 A;  2UUB K;  3L2W A;  2BDP A;  5CY4 A;  1A5X A;  2A6A A;  3VTH A;  4CJE A;  3PX6 A;  2A5X A;  4IDK A;  3VQP A;  3NAE A;  3PX0 A;  1WLJ A;  4NCB A;  4DWI A;  5GAG P;  1VAZ A;  2V7Y A;  1NBW A;  3MMV A;  3AVL A;  4CJT A;  3U9D A;  3MAQ A;  4ILG B;  4AIL C;  1QHT A;  3EE9 A;  4FM0 A;  4JI0 K;  5KRT A;  3DXM A;  3KK1 A;  3G71 N;  1M90 O;  1EX4 A;  1BHL A;  3OYH A;  3M8R A;  4YDU A;  5BPM A;  2VWK A;  4B3T K;  4FWS A;  4FLW A;  4DCH A;  4BY9 C;  4FJJ A;  1QQO A;  2XHB A;  1UWB A;  3AVA A;  4FWO A;  4N47 A;  1GLB G;  3DWL A;  3GE1 A;  5J2P A;  2IIR A;  3NGI A;  4JI5 K;  5AQN A;  4DV2 K;  5AFU H;  2RPI A;  1VQO N;  3CCR N;  3FZF A;  5CZ2 A;  1KD1 O;  1WB9 A;  2E2Q A;  1LCU A;  4CEF A;  3SQ0 A;  4KHQ A;  4CF2 A;  3IAY A;  1RNH A;  1NMN A;  4ZTJ A;  3RRG A;  1HPM A;  2ZGY A;  1VSH A;  4PKH A;  3VMF B;  4F3O A;  1RDU A;  1VQM N;  3OTO K;  4A59 A;  4ELT A;  5AQH A;  1DLO A;  5FRO A;  4AHV A;  4CFA A;  2IGI A;  3G4S N;  3SK3 A;  4CEZ A;  1YTU A;  5KRS A;  1BIS A;  3P38 A;  3TPQ A;  5HRP A;  4WQ4 A;  4DMN A;  5M1N A;  4NCG A;  2HHW A;  4JI1 K;  1NGF A;  4ZTF A;  3QNN A;  3VQE A;  3JAM O;  5AFU A;  3VGL A;  3CCL N;  2FLO A;  5LL6 Z;  5F0X A;  5LMN K;  4FJI A;  3RMA A;  4CES A;  1RDC A;  1HNX K;  1JL2 A;  5BPL A;  5KGX A;  4Z4E A;  1RGI A;  2R7Y A;  3R9P A;  2OPP A;  3R3L A;  3H3N O;  4J2D A;  1U04 A;  3LP1 A;  4BE0 A;  4QOZ B;  3SUP A;  1KSP A;  4KHU A;  4XEI A;  4FWR A;  1XMQ K;  4ICL A;  3WXK A;  4FOE A;  4CEB A;  4F2R A;  3VTI A;  4A2A A;  1S1U A;  3KK3 A;  1O1W A;  5D3G A;  3DLE A;  1F21 A;  4CCH A;  1IO2 A;  3RTV A;  2HHS A;  3WT0 A;  4AHT A;  4BRD A;  4HCB A;  1RT7 A;  1YF5 L;  1X9W A;  1JLG A;  1TKZ A;  3E1Y A;  4O5B A;  4FPA A;  3G25 A;  3ID8 A;  4Z4H A;  3JS6 A;  4WFA L;  2G8V A;  4EHT A;  3NVM A;  4FOI A;  3M8P A;  3WXL A;  3ALY A;  1GOA A;  2BTF A;  3A8Y A;  3ZT3 A;  2P9P A;  4O5F A;  5AQP A;  1IBM K;  5AQJ A;  4BQL A;  2VG7 A;  5AQY A;  4H0X B;  3TTD A;  4C8K A;  3SUO A;  4CHP A;  1NJW A;  1FKP A;  3CQ8 A;  3D0P A;  2E6M A;  3V1Q A;  2JLE A;  4BWM A;  4A62 A;  2P9U A;  3VQ7 A;  4JKG B;  3DLL L;  3ZSO A;  1BL3 A;  1YHQ N;  2NZT A;  5TKW A;  3L2R A;  3GL1 A;  3M6G A;  3WNG A;  4B3M K;  2JWL A;  4C8N A;  1FK9 A;  4HWI A;  2B4J A;  3HRG A;  1OVQ A;  4CE9 A;  1Q81 O;  3NFA A;  3SMS A;  1VQ9 N;  2AP1 A;  2OTL N;  3C0B A;  4R5P A;  3FZL A;  3NGY A;  3CM5 A;  3LDL A;  3VA3 A;  2DPN A;  2FSK A;  1DGK N;  3O1B A;  4GMJ B;  3V4I A;  3AGK A;  3A5L C;  3MX5 A;  4EZ9 A;  3UKR B;  3SBG A;  4KRF A;  4UQG A;  2HBM A;  5FPN A;  3NH0 A;  4IOA L;  4B1U B;  1UA0 A;  3WXJ A;  2YCH A;  4DUY K;  4KB1 A;  3KHY A;  3WUH A;  3IMX A;  4BWJ A;  1QSL A;  3J7Y P;  2KW4 A;  4H03 B;  3EKS A;  4FLY A;  1NK9 A;  3ZX0 A;  4BRQ A;  4KBO A;  4FJL A;  2G8U A;  1T7P A;  4LF7 K;  4ISG A;  3TWH A;  3T7Z A;  2O8B A;  4ZHR A;  1Y97 A;  1GLJ O;  1RT3 A;  3LZI A;  3TSQ A;  4CIE A;  3HST B;  1G15 A;  2ITM A;  4YDU C;  3OYF A;  3VES A;  5AQM A;  4Z94 A;  4BR9 A;  3CF5 L;  4E3S A;  5LY3 A;  2Q0U A;  1VQ6 N;  4JKE A;  2HHX A;  5JS1 A;  2ITG A;  4Y1D A;  4FM2 A;  4GW6 A;  4M45 A;  4GKJ K;  3OS1 A;  3BZC A;  2Z1G A;  4JKF A;  4LFA K;  4DV6 K;  3EEQ A;  5C25 A;  3T69 A;  1N5Y A;  3TAB A;  2CGJ A;  1BO5 O;  2RE2 A;  4A5B A;  3WXI A;  3OS2 A;  4X62 K;  1B92 A;  1CZB A;  3A5O C;  3GG4 A;  4M42 A;  1Z25 A;  3CPE A;  4DR1 K;  2W40 A;  2O8F B;  1NLV A;  1NGD A;  5LMU K;  3SQ2 A;  2G8K A;  3CER A;  3F9K A;  3CFO A;  3OY9 A;  3PY8 A;  3DXM B;  3SYZ A;  4RW6 A;  1VRU A;  3LDS A;  5J2Q A;  3LP3 A;  3OYM A;  4W5N A;  4IOC L;  1D4X A;  3SV4 A;  2O8D B;  3QIN A;  4OO1 J;  1C1C A;  4IJN A;  3QEP A;  5C15 A;  4IG3 A;  2HW3 A;  1XHX A;  3QER A;  1S3X A;  4CJP A;  4B1Y B;  2GWJ A;  2F9T A;  2G8I A;  1T05 A;  4KH5 A;  4G1Q A;  2IC3 A;  2NRT A;  1NM1 A;  4CGH A;  4AM7 A;  5KQD A;  1IG9 A;  3F73 A;  2BE2 A;  5J2M A;  4MFB A;  4BC2 A;  3D6R A;  2V7Z A;  4JS4 A;  4BE2 A;  1JCF A;  4CEE A;  1JJ2 M;  4LD0 A;  1EO1 A;  4DQR A;  1GLC G;  3L0Q A;  3ULE A;  2Q36 A;  3LWM A;  5HL7 L;  3WQU A;  4E7K A;  1JXB A;  3D7E O;  3WNF A;  3FFI A;  1CXU A;  3VF2 A;  4DR6 K;  4AHS A;  2P9L B;  4BRC A;  4KTW A;  1IJJ A;  3U3Y A;  3QIC A;  4YOR A;  4JEP A;  4FJG A;  2KLA A;  3VEO A;  2ZJR L;  5KI6 A;  4B8A B;  1WN7 A;  3AVN A;  2I7P A;  4N41 A;  2HOE A;  2O8B B;  3K58 A;  4CJS A;  3VQD A;  1W2B M;  1S6P A;  3NH2 A;  1RDD A;  4EZ6 A;  1W0H A;  3IUC A;  2HVI A;  3VGK A;  1BIU A;  4FJX A;  5A2Q O;  3A0I X;  2YNH A;  4MQ3 A;  1Q86 O;  4MO4 A;  1A5V A;  1S9G A;  3FFK B;  5AQF A;  4BR7 A;  4DF4 A;  3O6W A;  4DTU A;  4G9Z A;  3P5J A;  1JLC A;  4RTF D;  1BDG A;  3HZ6 A;  2NRW A;  1ITG A;  3P31 A;  1RBR A;  1W97 L;  3BEX A;  3ZT4 A;  3OJS A;  3K59 A;  3DXK A;  5HOO A;  4GVM A;  1U6Z A;  2P9S A;  4CZF A;  4CHO A;  2QM1 A;  4CHQ A;  3KK2 A;  2D0C A;  1NGB A;  2Z1H A;  5J2N A;  3VF4 A;  4MLH A;  4LF5 K;  1UOC A;  4BRM A;  3PV8 A;  4WCE L;  4BRO A;  3V6D A;  2QWN A;  4CHN A;  4FJH A;  4E0D A;  4F8R A;  3H46 O;  4I2P A;  1J53 A;  4FYD A;  2CH5 A;  4WYB A;  4JKC A;  3MDQ A;  3ZT0 A;  3R6M A;  4DFJ A;  3WQT A;  3K0S A;  3ZSX A;  4PUO A;  3O08 A;  5C24 A;  1SKS A;  4FLT A;  1C0M A;  5C0Y A;  3H08 A;  4LY7 A;  3VET A;  1X1P A;  1C0U A;  2H3G X;  4CGJ A;  4HHT A;  4OJR A;  4RG8 A;  4DV7 K;  3C65 A;  3CG7 A;  1KVB A;  2W41 A;  5BR8 K;  4DSK A;  4IWV A;  3DI6 A;  1H1V A;  4ILJ A;  2P5G A;  3PIP L;  3C7N B;  1Z6R A;  2P9I A;  3C6A A;  1RT5 A;  1LAV A;  3L2Q A;  4OLB A;  2FF6 A;  4FJ9 A;  2ZM6 K;  3KVG A;  1RDW X;  1DEJ A;  2E2P A;  4H0O A;  2VWJ A;  1N8R O;  5CYQ A;  4H5W A;  4KHS A;  1DT9 A;  3EL2 A;  1ASV A;  1NK4 A;  1XMO K;  4C1N I;  2ASP A;  4KTZ A;  5AZI B;  3KD5 E;  4O8U A;  3D2E A;  1K6Y A;  1XC9 A;  3ULD A;  3CQY A;  5BRD A;  2A40 A;  3H1Q A;  4CFC A;  1C0G A;  5GAE P;  1VSJ A;  1HNI A;  1K8A O;  3I0S A;  2D0A A;  3K57 A;  4HTU A;  1TK8 A;  1WBB A;  4DHY A;  3KJV A;  4EIA A;  1NK8 A;  4FJ8 A;  4U67 L;  3DRS A;  2NRH A;  2NRZ A;  2VG5 A;  2O8C B;  3MEG A;  3ZET A;  2VYP A;  4CEC A;  1QZ6 A;  2IAJ A;  5HRR A;  2EX3 A;  4KO0 A;  3EZ5 A;  3WNE A;  3AAP A;  3MXI A;  4DSL A;  4B1X B;  1FW6 A;  4QAG A;  5AQV A;  2F7T A;  1A5W A;  2A42 A;  1L5U A;  5KTQ A;  3KLF A;  1LW0 A;  4Y1C A;  4CJK A;  4NO7 A;  3AA4 A;  4RW4 A;  4DQQ A;  4A61 A;  4AM6 A;  3KLI A;  2YJE A;  3CCJ N;  4IOX A;  3GOI A;  3EN9 A;  1HNV A;  3RSE B;  2XRI A;  4KRE A;  4KHY A;  1O13 A;  4Z4C A;  4KKO A;  5BN8 A;  1GLL O;  3O4N A;  2Q31 A;  4X65 K;  2QW9 A;  4U7B A;  5C12 A;  3AVM A;  4KHN A;  3W3D A;  3WEE A;  3ZX2 A;  3K5M A;  3D2F B;  3IS9 A;  1T3V A;  4ID1 A;  3HSC A;  3S3M A;  1NJY A;  4JKB A;  4QCL A;  4BRP A;  4FK2 A;  1ATR A;  4CF9 A;  4IKF A;  5F2R A;  5JIC A;  1FKO A;  1NGI A;  2ZD1 A;  1NKC A;  3GBT A;  4BAC A;  5IT9 O;  3HTV A;  3RSE A;  3SJH A;  1YIT N;  4H0T B;  3CMA N;  2EWS A;  4OKK A;  4BQZ A;  3MCA B;  3QIP A;  3DRR A;  4HCC A;  3MN6 A;  1RCH A;  3ITH A;  2E4L A;  4A5A A;  3RVC A;  1ZYQ A;  3CFP A;  1NK6 A;  1TL3 A;  2D5R A;  1OH5 A;  5FRN A;  5AQG A;  1WSH A;  1ASU A;  4ISF A;  4CD3 A;  3D45 A;  2P9P B;  3IFR A;  1JL1 A;  4JNE A;  4H5N A;  3VQ5 A;  2QWR A;  3KLH A;  1LV5 A;  4GV3 A;  5AQI A;  2GEL A;  1BQM A;  3AO5 A;  5LJW A;  1E4F T;  4M3T A;  2O8C A;  1XNQ K;  1MWM A;  1GLA G;  1TUU A;  1S1X A;  2FSJ A;  4MLE A;  1SKR A;  1TAU A;  1WSI A;  2HHT A;  4KI6 A;  2BH1 A;  4PKG A;  4WFN L;  3HJF A;  5AZI A;  5I9E B;  3A2F A;  4EHU A;  2Z1J A;  4CJ3 A;  2PY5 A;  3CFR A;  4CBU A;  1Q9Y A;  1TKX A;  4CJW A;  3LM9 A;  1IH7 A;  1NMD A;  2IVO A;  3L3U A;  1Q8I A;  3C6T A;  4J2A A;  4KH6 A;  3DMJ A;  4DTJ A;  2E88 A;  4OPJ A;  4HTL A;  2P9I B;  3HM8 A;  3PIO L;  3ZSQ A;  1HRH A;  1WSF A;  3HPH A;  4JHD A;  1EP4 A;  1TV6 A;  3U3G A;  4H0P A;  1LW2 A;  2DFF A;  4BDY A;  4JLH A;  4QS8 A;  3LAN A;  4YOY A;  1RTI A;  4M3R A;  3VEZ A;  4N56 A;  5AQU A;  2FF3 B;  3OYJ A;  1EET A;  1R59 O;  5BR9 A;  3OYC A;  4FZX C;  3HP6 A;  2HMP A;  2OCE A;  3CJ7 A;  2HVH A;  1C6V A;  3LDQ A;  2O4G A;  3NF6 A;  1HKB A;  4OPH A;  1BIZ A;  3ATV A;  3AO2 A;  2NRR A;  4CFD A;  3T1A A;  2E2O A;  1SUQ A;  5BRE A;  4OGC A;  1KQS M;  3AVC A;  1HYS A;  2GTD A;  5FPD A;  1KLM A;  3U4L A;  2FSN A;  2V52 B;  1P8Z A;  1GOB A;  3TAM A;  2P9N A;  3ZT2 A;  3KWG A;  4FWL A;  3SJJ A;  1MU2 A;  3M5R A;  4E1N A;  3FZH A;  4JKD A;  4CFB A;  1REV A;  1Q7Y O;  3QBX A;  3NMU A;  3OVN A;  3THY B;  3I8B A;  2FXU A;  3VQ9 A;  3VEV A;  5FLX O;  1OKJ A;  4NXN K;  5C2D A;  2ETJ A;  3THV A;  1S5J A;  4H0V B;  4DTS A;  4NLB A;  2E20 A;  2DFH A;  2HND A;  4M3Z A;  3CIP A;  1CZ9 A;  4FWM A;  3SUQ A;  3LPT A;  2PAV A;  4XIU A;  3EO3 A;  1NGH A;  4YOX A;  3LZJ A;  4DS4 A;  3DOK A;  3VQC A;  4NCA A;  3S3O A;  2B5J A;  1E3M A;  4B9V A;  4PY5 A;  2HF3 A;  4IXC A;  3VQQ A;  2XY5 A;  3SI6 A;  1YJN N;  2IS3 A;  1VSF A;  3SAH A;  3C6U A;  2ASO A;  1KXP A;  1KVA A;  1U4B A;  3L4I A;  4LF4 K;  3LAK A;  4XH1 A;  1IKY A;  3D2F A;  1L3S A;  1X9J A;  5EX5 A;  4M3W A;  4M3Y A;  3IG1 A;  1VSM A;  3VEW A;  4K0K K;  4I9Q A;  3OW2 M;  3P39 A;  3PO4 A;  5C42 A;  1ATS A;  3ATU A;  4DU1 A;  2GV9 A;  4NXM K;  4JK9 A;  2HMI A;  3BGR A;  1TK0 A;  1BWF O;  4JI7 K;  3HOS A;  2YKM A;  2KKZ A;  2D0P A;  3VOV A;  1HPZ A;  1VSD A;  3PSI A;  4MDA A;  3ZSW A;  2QWM A;  3J80 O;  4IO8 A;  5JLH A;  3AO3 A;  1U2V B;  1S1T A;  5DMR A;  3QDK A;  3RWU A;  4KAZ A;  2YV0 X;  4W5O A;  1K8K A;  5C10 A;  4DTO A;  4CJF A;  2VGM A;  4DQI A;  4LSN A;  3LM2 A;  3THW B;  3J81 O;  3ZET B;  3L3V A;  1IKW A;  3AA2 A;  4C8L A;  1TYQ B;  5BRH A;  2QEX N;  3V9U A;  5CZ1 A;  1HYZ A;  4RWT A;  3VQ8 A;  3A5N C;  4E7J A;  3CYM A;  3AAQ A;  4J8F A;  3H45 C;  3CJ9 A;  4DFP A;  3KTQ A;  4L8R B;  1VQ7 N;  2WTU A;  3MEE A;  4BR5 A;  3KKR A;  4DQS A;  2G8H A;  3TAG A;  3RMB A;  5DK5 A;  4MO5 A;  4YOU A;  4GNI A;  4PA1 A;  4BRL A;  4XH4 A;  1WSG A;  5AQS A;  1RT4 A;  4DKW A;  3CC4 N;  3AVB A;  4H8K A;  4W5T A;  4I2Q A;  5GIO A;  3NCI A;  1Q18 A;  3I56 N;  3EZW A;  1NK0 A;  4B1W B;  2HB5 A;  4GY2 B;  3AVI A;  4OPK A;  3QB0 A;  4DSF A;  4FCY A;  5AQR A;  1BI4 A;  4E19 A;  4CED A;  1HKC A;  1NOY A;  5I42 A;  4B9M A;  4CHZ A;  5AQO A;  2GX9 A;  2IOC A;  2OPR A;  4DV5 K;  1N32 K;  2OAN A;  3EE8 A;  3LP0 A;  3FZK A;  1NOZ A;  4A57 A;  4ILH A;  1HYV A;  4K25 A;  1LAW A;  1HUX A;  1KRP A;  1BCM A;  3DLH A;  2QXL A;  3JYT A;  1ZBL A;  3I55 N;  3HPG A;  3UE5 A;  3CJ1 A;  3ZEU A;  1IV0 A;  1VQK N;  4L3Q A;  2HHH K;  5KQ8 A;  3NGZ A;  1YIJ N;  3IDH A;  5BRF A;  2YJF A;  3O1W A;  2NRX A;  3RR7 A;  1JLQ A;  1X9M A;  3VGM A;  4YFU A;  3MXM A;  4DLG A;  3CC2 N;  3OYD A;  3EYZ A;  1K9M O;  3BF3 A;  4V19 S;  1I94 K;  2QKB A;  5J1E A;  1OVY A;  4CI6 A;  5F1X A;  1NGG A;  5M1Q A;  3UKR A;  3NH1 A;  1EXQ A;  1I39 A;  4EFH A;  4X64 K;  3OYA A;  2P9K A;  3VN5 A;  4DFK A;  1ILY A;  2IDO A;  4BRI A;  3Q7C A;  2OZM A;  2HHU A;  2HNZ A;  1LWC A;  4WQ5 C;  4DU3 A;  4FWP A;  4E1M A;  3KWI A;  2FBY A;  4BDZ A;  3N4P A;  3QEV A;  4KI4 A;  4JHD B;  4BR4 A;  3KLE A;  3CXC M;  5DM7 L;  3SMP A;  3O4W A;  4Z4G A;  3AVH A;  4E1J A;  4HUE A;  1WAJ A;  1X9S A;  2D0B A;  1ZC6 A;  1K8K B;  1QS4 A;  3T1H K;  4CF1 A;  1LWE A;  4DTN A;  3TR8 A;  4C8O A;  4YHH K;  4BRG A;  5C2F A;  1EWQ A;  1G99 A;  3QBW A;  4M7X A;  2JGU A;  4JKA A;  4DTX A;  1FJG K;  4EP4 A;  1BUP A;  3J7A P;  1NGJ A;  3EY1 A;  1YVN A;  2Q3S A;  4W5R A;  1HMV A;  2RN2 A;  4DTP A;  4LSL A;  3P83 D;  3AVJ A;  5AZJ A;  5KGW A;  3MN7 A;  1J5O A;  5SZT A;  2F4V K;  3HK2 A;  3TAF A;  1N36 K;  4IEI A;  2HNY A;  4C8M A;  1JLB A;  2YHB A;  4AHU A;  4CZH A;  4DF8 A;  2YHX A;  4CZE A;  4DQP A;  4DUZ K;  1VQ5 N;  4FLZ A;  1TKD A;  4W5Q A;  2GUI A;  2P51 A;  1NK5 A;  2AJQ A;  3AO1 A;  2O8D A;  4EP5 A;  5KPZ A;  1NGC A;  3HI0 A;  4BRF A;  1U49 A;  3CQX A;  2RHK A;  3KK7 A;  3PLA A;  3V81 A;  1WUA A;  4FJ5 A;  1HJO A;  1HLU A;  4BRH A;  3DAW A;  4JN4 A;  4DSE A;  3WEE B;  4CK1 A;  3CCU N;  1XUP O;  2D4W A;  4LH4 A;  2NLX A;  3M3Z A;  4DV3 K;  1CLQ A;  1HNW K;  4CGG A;  1K73 O;  2O8F A;  3MX2 A;  3QLH A;  3ZSY A;  1BOT O;  3NE6 A;  3BDP A;  2WON A;  4WE1 A;  1LOT B;  5FRM A;  2GEM A;  4CZM A;  2WOM A;  2VWB A;  1MA9 B;  4AF1 A;  1WSJ A;  1NKE A;  2E1Y A;  3AVG A;  5HLF A;  1ZBS A;  1SL0 A;  2ZQB A;  3CM6 A;  4YOT A;  2Q0R A;  4LC9 B;  2UYT A;  2A1S A;  4QS7 A;  1S22 A;  4BC5 A;  5DM6 L;  3UKU B;  3QIO A;  1XHZ A;  1J6Z A;  4OKE A;  2YX6 A;  4CZK A;  1NJI O;  2CGL A;  4FLX A;  1N6Q A;  2KHO A;  1T8E A;  3UB5 A;  2NNW A;  3S41 A;  3K9K A;  4RW8 A;  4B9Q A;  3SCX A;  1QHA A;  1KC8 O;  1BI4 B;  1YTA A;  2ZJQ L;  4KHW A;  4OLA A;  4FL9 A;  1KFD A;  3P1G A;  1HX1 A;  4HVJ A;  4JV5 K;  4E7L A;  3LP2 A;  3DLB A;  3HVR A;  1VQN N;  3M8Q A;  1I3A A;  5JVH L;  3F2K A;  4JD2 A;  5AQL A;  2RKI A;  4OX9 K;  1DKG D;  4IDH A;  3BUZ B;  3QEI A;  3TTC A;  1U48 A;  3BZK A;  1XWL A;  4BGA A;  2O8E B;  3RR8 A;  1YXQ A;  3ENO A;  4JRP A;  1WOQ A;  1YT3 A;  3ENH A;  4F3T A;  4CZL A;  5T7B A;  3CME N;  1QE1 A;  3BF1 A;  3CET A;  1UAX A;  2PYL A;  3RMD A;  4WF9 L;  3DLG A;  4LFB K;  1ZBF A;  1GOC A;  5FDL A;  4FZY A;  4B3R K;  4DS5 A;  1RFQ A;  3DLR A;  3E01 A;  1FXX A;  5M1F A;  4DR2 K;  4FK0 A;  1YI2 N;  4F2S A;  4DV4 K;  1TAQ A;  4KHP K;  4AHC A;  5TKY A;  2PZS A;  3NHG A;  2DFE A;  4M7Y A;  3NF9 A;  5AZJ B;  1NU0 A;  4B08 A;  2WUS A;  4E7I A;  1VRT A;  2A3Z A;  4O0I A;  1VQ4 N;  1YAG A;  1N34 K;  1HNZ K;  3CCE N;  2F8S A;  3CCS N;  4CJ5 A;  4M3U A;  4C1N K;  1V4T A;  1YVU A;  3ZSZ A;  2HF4 A;  3L2U A;  1E4G T;  4JK7 A;  1QVF M;  4BG9 A;  3BY5 A;  1P90 A;  2WFB A;  3AA3 A;  3O9R A;  3TI0 A;  3OBW A;  4NYF A;  3E9P A;  5AQW A;  4K8Z A;  3MXJ A;  5AQX A;  3RMC A;  2W6K A;  3AGR A;  1ATN A;  4E89 A;  3EKU A;  3H1V X;  1SAZ A;  2UXD K;  2Z1I A;  3HOT A;  4EAH D;  1L3U A;  1HQU A;  2UUA K;  2YKN A;  1L3T A;  1XC3 A;  2BUP A;  2Q1N A;  3HP9 A;  3CI5 A;  1SS6 A;  3I8D A;  3BP8 A;  3HXM A;  3G10 A;  1NGE A;  4KFB A;  5AJ3 K;  4UY8 O;  1ZBI A;  4WFB L;  1D9F A;  1SQK A;  4IG0 A;  1BGX T;  1VSK A;  5ELZ A;  2F9W A;  4C23 A;  5JS2 A;  1QQN A;  3OJU A;  4IO9 L;  5M1P A;  4CF8 A;  2JWK A;  2GBZ A;  3C6H A;  1MWK A;  3S9H A;  1SKW A;  3LWL A;  1KLN A;  4CZJ A;  4B9L A;  1B9F A;  4XH5 A;  2ZGZ A;  3AO4 A;  2UUC K;  4DR3 K;  4FXD A;  2WBN A;  1C1B A;  1IBL K;  4FWK A;  5GAD P;  1GLD G;  4CVN E;  4PL8 A;  4H5R A;  4KTQ A;  3TSU A;  1VK0 A;  3O4Q A; 
#chains in the Genus database with same CATH homology
 2HMI A;  3LWM A;  4E7K A;  4DSJ A;  1JXB A;  3NDK A;  2EHG A;  4Q5V A;  3BGR A;  1TK0 A;  3WNF A;  2YKM A;  4CIF A;  1U45 A;  3FFI A;  1CXU A;  1HPZ A;  1B9D A;  1VSD A;  4AHS A;  2YNI A;  3ZSW A;  4DTR A;  3AVF A;  4KTW A;  3ASM A;  4FJK A;  3AO3 A;  1Q9X A;  3U3Y A;  4Z4I A;  4HUG A;  1S1T A;  1RTH A;  5DMR A;  3RWU A;  4KAZ A;  4FJG A;  1TVR A;  2YV0 X;  4W5O A;  1TGO A;  1RIL A;  4CEO A;  5KI6 A;  2HHQ A;  2KZM A;  4B8A B;  1WN7 A;  4AH9 A;  4DTO A;  3SQ4 A;  3AVN A;  1BQN A;  4CJF A;  4N41 A;  5I3U A;  4CGD A;  3VQ6 A;  3UIQ A;  3QES A;  1JXE A;  2QXF A;  3SV3 A;  4DQI A;  1RDB A;  4LSN A;  3VQ4 A;  3K58 A;  3SPZ A;  4PQU A;  3L3V A;  3VQD A;  4CJS A;  4PWD A;  2XO7 A;  1IKW A;  1S6P A;  3AA2 A;  3C94 A;  4CGI A;  3NH2 A;  3O3F A;  1RDD A;  2P5O A;  4H4M A;  4C8L A;  4EZ6 A;  1XI1 A;  1W0H A;  1D8Y A;  2HVI A;  1BIU A;  3V9U A;  4FJX A;  3TAN A;  2XY8 A;  2YNH A;  3RRH A;  4MQ3 A;  5CZ1 A;  3OYG A;  1A5V A;  1S9G A;  1HYZ A;  3HPO A;  1NKB A;  3VQ8 A;  4DF4 A;  1U47 A;  3NBP A;  4E7J A;  1BCO A;  3CYM A;  1HJR A;  4DTU A;  3G0Z A;  4DFP A;  3KTQ A;  4L8R B;  3P5J A;  4O44 A;  1JLC A;  4DTM A;  3MEE A;  4B3O A;  1VSE A;  2Y1J A;  3PUF A;  4OGE A;  3TAE A;  3KKR A;  4DQS A;  1S1W A;  1SV5 A;  2YNG A;  4CK2 A;  1ITG A;  4ELV A;  4NYN A;  1RT2 A;  1RBR A;  5HRO A;  1NJZ A;  2G8H A;  2B6A A;  3ZT4 A;  3TAG A;  5DK5 A;  3RMB A;  2OA8 A;  1S6Q A;  3PX4 A;  3OJS A;  3HYF A;  3V1R A;  3K59 A;  4PA1 A;  3OYE A;  3HVT A;  4GVM A;  4CHO A;  3KK2 A;  4CHQ A;  1WSG A;  4JS5 A;  3TAP A;  3AVK A;  2D0C A;  2Z1H A;  4FVM A;  5J2N A;  1RT4 A;  3QEX A;  2X6N A;  3AVB A;  4CF0 A;  4H8K A;  1JLA A;  4W5T A;  1Z26 A;  1NK7 A;  1UOC A;  3PV8 A;  4RW9 A;  4I2Q A;  3NCI A;  1NK0 A;  1KCF A;  3B6O A;  1JKH A;  3V6D A;  1C1A A;  2HB5 A;  4CEQ A;  4CHN A;  3AVI A;  1R0A A;  4OPK A;  1SL1 A;  4E0D A;  4DG1 A;  4F8R A;  4DSF A;  4FCY A;  1RT1 A;  4CER A;  2QKK A;  1BI4 A;  4E19 A;  3O3H A;  4CED A;  4RW7 A;  2G8W A;  4I2P A;  1J53 A;  4IBN A;  5I42 A;  1NOY A;  1D9D A;  4CHZ A;  4B9M A;  4FYD A;  4KPY A;  2ATQ A;  2IOC A;  3HL8 A;  2OPR A;  2KZZ A;  1D5A A;  3ZT0 A;  4NCA A;  3LP0 A;  4DFJ A;  1NOZ A;  2E6L A;  3ZSX A;  1HYV A;  4OVL A;  4PUO A;  2KFZ A;  1LAW A;  5C24 A;  3HM9 A;  1SKS A;  1KRP A;  4B9S A;  3DLK A;  1BCM A;  4N5S A;  4FLT A;  2OPS A;  3DLH A;  1L3V A;  1RDA A;  1C0M A;  3L2V A;  3JYT A;  1ZBL A;  2OYQ A;  3H08 A;  3B6P A;  1C0T A;  4HUF A;  4DLE A;  1DTT A;  3HPG A;  4LY7 A;  1QQC A;  1X1P A;  4Q0B A;  2KFN A;  1C0U A;  4CGJ A;  4DU4 A;  1ZBH A;  4HHT A;  3C95 A;  4CK3 A;  4CHY A;  2FBV A;  4OJR A;  4RG8 A;  4CJQ A;  3CG7 A;  3L2W A;  2BDP A;  5CY4 A;  3ZSV A;  1A5X A;  1KVB A;  3NGZ A;  4CJE A;  4DSK A;  3PX6 A;  4IDK A;  3DI6 A;  2P5G A;  3VQP A;  3NAE A;  3PX0 A;  1WLJ A;  4NCB A;  1WSE A;  3RR7 A;  4DWI A;  4OLA A;  4FJ7 A;  1JLQ A;  1X9M A;  4FK4 A;  4YFU A;  3AVL A;  1RT5 A;  3MXM A;  1LAV A;  3L2Q A;  4CJT A;  5HRN A;  3MAQ A;  4AIL C;  4OLB A;  2FC0 A;  4DLG A;  4FJ9 A;  3OYD A;  3EYZ A;  1QHT A;  1VSL A;  4IFV A;  4FM0 A;  2DY4 A;  5KRT A;  3KK1 A;  2QKB A;  4CJU A;  5J1E A;  1EX4 A;  2VWJ A;  1BHL A;  3OYH A;  3M8R A;  1KVC A;  3KKS A;  5CYQ A;  3MED A;  1J9A A;  4KHS A;  4ELU A;  1ASV A;  2VWK A;  4YNQ A;  1NK4 A;  4FLW A;  4I7F A;  4OKJ A;  3NH1 A;  4KTZ A;  3AA5 X;  1EXQ A;  1I39 A;  2KQ2 A;  3OS0 A;  1K6Y A;  3OYA A;  3KD5 E;  3VN5 A;  4DFK A;  1XC9 A;  4FJJ A;  2KTQ A;  3ULD A;  4J2B A;  2XHB A;  1UWB A;  3AVA A;  2IDO A;  5CYM A;  4N47 A;  2A1R A;  2OZM A;  3SUN A;  2HHU A;  2HNZ A;  5J2P A;  1LWC A;  3NGI A;  4CFC A;  4DU3 A;  1VSJ A;  1HNI A;  2YNF A;  2F96 A;  4E1M A;  2FBY A;  3OYB A;  4BDZ A;  3QEV A;  3I0S A;  2D0A A;  3K57 A;  4KI4 A;  4HTU A;  1IKX A;  3QO9 A;  4FW1 A;  1TK8 A;  4N76 A;  3I0R A;  2RPI A;  5HP1 A;  2I5J A;  1J54 A;  3KJV A;  3KLE A;  5CZ2 A;  1NK8 A;  4FJ8 A;  1RBS A;  3DRS A;  4CEF A;  2VG5 A;  4CIG A;  3MEG A;  3SQ0 A;  4KHQ A;  2RF2 A;  4CEC A;  4CF2 A;  2IAJ A;  5HRR A;  2EX3 A;  4KO0 A;  3IAY A;  2W42 A;  3EZ5 A;  1RNH A;  3KIO A;  1UA1 A;  4Z4G A;  3WNE A;  4ZTJ A;  2YHA A;  4O4G A;  3AVH A;  4HUE A;  3MXI A;  1WAJ A;  3RRG A;  1X9S A;  2D0B A;  4DSL A;  1VSH A;  1QS4 A;  4F3O A;  4QAG A;  4CF1 A;  1LWE A;  4M41 A;  3TR8 A;  4DTN A;  4C8O A;  1A5W A;  4CGF A;  3V1O A;  1L5U A;  5KTQ A;  3KLF A;  1LW0 A;  3L8B A;  4ELT A;  2JGU A;  4Y1C A;  4DTX A;  1DLO A;  5FRO A;  4CJK A;  3AA4 A;  1VSI A;  4AHV A;  1ASW A;  4EP4 A;  4RW4 A;  4Z0U A;  4CFA A;  4FLV A;  2IGI A;  4DQQ A;  3KLI A;  3EY1 A;  4CEZ A;  1YTU A;  3K2P A;  3K5L A;  2Q3S A;  5EU7 A;  5KRS A;  3VQB A;  1QSS A;  2O4I A;  4W5R A;  1KFS A;  1BIS A;  1HNV A;  1HMV A;  2XRI A;  5HRP A;  3M8S A;  4KRE A;  4DMN A;  2RN2 A;  4NCG A;  1NJX A;  4DTP A;  2OPQ A;  4KHY A;  2HHW A;  4Z4C A;  4LSL A;  3P83 D;  3AVJ A;  4KKO A;  5KGW A;  4ZTF A;  4LH5 A;  3KLG A;  1TK5 A;  3O4N A;  5SZT A;  3QNN A;  3HK2 A;  3VQE A;  4FJH A;  3AVM A;  3TAF A;  3SQ1 A;  4KHN A;  2HNY A;  4C8M A;  1JLB A;  2YHB A;  4AHU A;  3K5M A;  3SZ2 A;  3LAL A;  3DYA A;  4DF8 A;  3RMA A;  4CES A;  1J5O A;  4DQP A;  1RDC A;  4FJI A;  1JL2 A;  3IS9 A;  4ID1 A;  3S3M A;  4FLZ A;  1NJY A;  1TKD A;  5KGX A;  4Z4E A;  4W5Q A;  1WAF A;  2GUI A;  3SNN A;  2P51 A;  2R7Y A;  1NK5 A;  2OPP A;  1DTQ A;  4QCL A;  4FK2 A;  4CF9 A;  2AJQ A;  4J2D A;  3AO1 A;  4IKF A;  2PYJ A;  3VQA A;  4EP5 A;  1U04 A;  3LP1 A;  4BE0 A;  4QOZ B;  1FKO A;  4M3X A;  3OYN A;  3SUP A;  2ZD1 A;  1U49 A;  1KSP A;  1WNS A;  4KHU A;  1NKC A;  3VA0 A;  3V81 A;  4BAC A;  4ICL A;  3K5N A;  4CEB A;  2OZS A;  4FJ5 A;  4F2R A;  3ZCM A;  1RTJ A;  1S1U A;  1W9H A;  3KK3 A;  3SPY A;  4BDP A;  4DSE A;  3V9W A;  4CK1 A;  1O1W A;  5D3G A;  3DLE A;  3NF7 A;  1F21 A;  4LH4 A;  4OKK A;  1CLQ A;  1QSY A;  4AHR A;  4CCH A;  4CGG A;  1EKE A;  1IO2 A;  3RTV A;  2HHS A;  4AHT A;  3JSM A;  1ZBU A;  3DRR A;  3QIP A;  3QLH A;  3HT3 A;  4BE1 A;  4B9U A;  1RT7 A;  4HCC A;  2NUB A;  4HCB A;  3ZSY A;  4J2E A;  1TKT A;  3NE6 A;  1X9W A;  1JLG A;  1TKZ A;  4O5B A;  3BDP A;  2WON A;  4WE1 A;  4Z4H A;  5FRM A;  1RBV A;  3O3G A;  1RCH A;  3ITH A;  2WOM A;  2E4L A;  1IKV A;  1ZYQ A;  2G8V A;  3M8P A;  3ALY A;  3TAR A;  1GOA A;  1CXQ A;  3CFP A;  1WSJ A;  4FW2 A;  1TL3 A;  3AVG A;  2D5R A;  3ZT3 A;  5HLF A;  1NKE A;  1SL0 A;  3KD1 E;  3LAM A;  5FRN A;  2VG7 A;  2ZQB A;  2DTU A;  2X6S A;  4C8K A;  3SUO A;  1WSH A;  3CM6 A;  4CHP A;  1NJW A;  1ASU A;  3T3F A;  3D45 A;  3V9S A;  1JL1 A;  1FKP A;  2A1S A;  3CQ8 A;  3D0P A;  2E6M A;  2P1J A;  3QIO A;  3V1Q A;  3VQ5 A;  1XHZ A;  1JLE A;  2JLE A;  3NF8 A;  4OKE A;  4BWM A;  3KLH A;  1LV5 A;  1RBT A;  3VQ7 A;  3DM2 A;  4FLX A;  1BQM A;  3AO5 A;  4M3T A;  3ZSO A;  1N6Q A;  1BL3 A;  1T8E A;  2X74 A;  3L2R A;  1SL2 A;  4RW8 A;  3SCX A;  1S1X A;  3WNG A;  4KHW A;  1BI4 B;  1YTA A;  1FK9 A;  4C8N A;  4E7H A;  1NK6 A;  2B4J A;  1KFD A;  3P1G A;  1SKR A;  4HVJ A;  1TAU A;  3ZSR A;  4E7L A;  1RTD A;  1WSI A;  3LP2 A;  3S3N A;  3DLB A;  2HHT A;  4CE9 A;  3HVR A;  4KI6 A;  3HJF A;  3NFA A;  3M8Q A;  1I3A A;  3A2F A;  4R5P A;  1HQE A;  3NGY A;  2Z1J A;  3CM5 A;  4CJ3 A;  2PY5 A;  2RKI A;  3CFR A;  4ID5 A;  3VA3 A;  4JRQ A;  2X78 A;  4GMJ B;  3QEI A;  1U48 A;  1Q9Y A;  1TKX A;  3V4I A;  1XWL A;  4CJW A;  4CJL A;  3OYL A;  1IH7 A;  3TAQ A;  3RR8 A;  2Y1I A;  3L3U A;  4CJV A;  3DOL A;  1Q8I A;  3C6T A;  3ISN C;  4JRP A;  4EZ9 A;  1YT3 A;  4KRF A;  4J2A A;  4F3T A;  3DMJ A;  4DTJ A;  4O0J A;  4OPJ A;  5T7B A;  1QE1 A;  4UQG A;  2PYL A;  1UAX A;  4FLU A;  3NH0 A;  2QK9 A;  3RMD A;  3WNH A;  5E41 A;  3ZSQ A;  1UA0 A;  3DLG A;  1WSF A;  3HPH A;  1HRH A;  1ZBF A;  1EP4 A;  1TV6 A;  3U3G A;  1GOC A;  5FDL A;  4FZY A;  1LWF A;  1S9E A;  1LW2 A;  2DFF A;  4BDY A;  4DS5 A;  4KB1 A;  1T03 A;  3DLR A;  3E01 A;  4JLH A;  2XY7 A;  1FXX A;  3LAN A;  1RTI A;  4BWJ A;  4M3R A;  4N56 A;  1QSL A;  4FJN A;  4FK0 A;  3AV9 A;  4B9T A;  4F2S A;  1TAQ A;  2KW4 A;  1KTQ A;  3T19 A;  4AHC A;  3OYJ A;  4FLY A;  1EET A;  1NK9 A;  4FJL A;  3OYC A;  3NHG A;  2DFE A;  2PZS A;  4FZX C;  3HP6 A;  3IRX A;  1TL1 A;  3NF9 A;  2G8U A;  1T7P A;  4B08 A;  1C6V A;  2HVH A;  3DRP A;  2O4G A;  3NF6 A;  3TWH A;  2FBX A;  4E7I A;  1VRT A;  1BIZ A;  3MEC A;  3AO2 A;  3LPU A;  4IFY A;  4O0I A;  5HBM A;  4CJR A;  4ZHR A;  1Y97 A;  2F8S A;  1RBU A;  1RT3 A;  3T1A A;  4CFD A;  4CIE A;  3LZI A;  1SUQ A;  3HST B;  4H4O A;  1G15 A;  4OGC A;  4CJ5 A;  4M3U A;  3HO1 A;  3AVC A;  3OYF A;  1YVU A;  3QET A;  3ZSZ A;  3L2U A;  4KB0 A;  1HYS A;  3K5O A;  2HHV A;  1KLM A;  3V9Z A;  4E3S A;  4CJ4 A;  4F4K A;  2HHX A;  5JS1 A;  3AA3 A;  3TI0 A;  1GOB A;  2ITG A;  4Y1D A;  3TAM A;  4FM2 A;  3PO5 A;  4GW6 A;  3ZT2 A;  4M45 A;  4NYF A;  3OS1 A;  2Z1G A;  5SWM A;  3SJJ A;  1MU2 A;  4E1N A;  4K8Z A;  3MXJ A;  5C25 A;  3RMC A;  4CFB A;  1REV A;  4E89 A;  5HRS A;  1N5Y A;  3OVN A;  3TAB A;  5K14 A;  3VQ9 A;  3OS2 A;  1B92 A;  1CZB A;  2Z1I A;  3V9X A;  4B9N A;  4M42 A;  1Z25 A;  2ETJ A;  1HQU A;  1L3U A;  4DSI A;  3THV A;  3OYI A;  2YKN A;  1L3T A;  4FM1 A;  1S5J A;  4K8X A;  4DTS A;  3SQ2 A;  3OYK A;  2G8K A;  2G8F A;  3F9K A;  2BGG A;  4I9L A;  3HP9 A;  2DFH A;  2HND A;  4KV8 A;  3CFO A;  3OY9 A;  3PY8 A;  3I8D A;  4M3Z A;  4O55 A;  1S1V A;  3HXM A;  3G10 A;  4KFB A;  1CZ9 A;  3SUQ A;  3LPT A;  4FJM A;  3SYZ A;  4XIU A;  1ZBI A;  4RW6 A;  1D9F A;  1VRU A;  3LDS A;  3LZJ A;  4DS4 A;  5J2Q A;  3DOK A;  3VQC A;  4IG0 A;  3U6F A;  1BGX T;  3LP3 A;  3QNO A;  2B5J A;  3S3O A;  1VSK A;  4B9V A;  4PY5 A;  3OYM A;  4W5N A;  4CEA A;  5JS2 A;  4B8C A;  3QEW A;  3VQQ A;  2XY5 A;  3SV4 A;  3OJU A;  3QIN A;  2ZE2 A;  3SI6 A;  1C1C A;  2FBT A;  2IS3 A;  4Z4F A;  2F8T A;  1VSF A;  3QEP A;  4CF8 A;  3C6U A;  4IG3 A;  2GBZ A;  2HW3 A;  1XHX A;  1KVA A;  3QER A;  1U4B A;  3S9H A;  4CJP A;  1SKW A;  3LAK A;  2VG6 A;  1T05 A;  2G8I A;  4G1Q A;  4DFM A;  3LWL A;  1IKY A;  2IC3 A;  1L3S A;  1KLN A;  4B9L A;  2XY6 A;  4FZZ A;  1JLF A;  1B9F A;  4M3W A;  4M3Y A;  3IG1 A;  3AO4 A;  1VSM A;  4CGH A;  1RT6 A;  2LSN A;  1QTM A;  2BAN A;  4I9Q A;  4FXD A;  1IG9 A;  3F73 A;  3PO4 A;  3ZT1 A;  2BE2 A;  1C1B A;  4MFB A;  5J2M A;  5C42 A;  4JS4 A;  4BE2 A;  4DU1 A;  4CEE A;  4KTQ A;  4LD0 A;  2GV9 A;  4TSX A;  1VK0 A;  3O4Q A;  4DQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...