5CYQA

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
548
structure length
548
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 154
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cyqA05
1ZBFA 2JGUA 1RILA 4ELVA 3DOLA 4ZTJA 3ISNC 4KHNA 4CJWA 4OJRA 3V9UA 4CJFA 4Q0BB 4CEOA 4DU1A 2JEGA 3QLHB 3ZSQA 4F2SA 2X78A 3KLGB 2Z1HA 4FLWA 2OZMA 5EDWA 3BGRB 3MXJA 4DQQA 1SKSA 4H4OB 5CYMA 3KK2A 4H4OA 2HNZA 5CYMB 4RW4B 3M8SA 1TKXA 4CGFA 1RBSA 3AVHA 1CLQA 3I8DA 4MIBA 2BE2A 1IM4A 4ED7A 4CF1A 1S9FA 3NHGA 4W5TA 4TQSA 4ED1A 3DLKB 3KJVB 5E41A 4FBUA 2OA8A 1J9AA 2ZE2B 3K2PA 3KKRA 4DEZA 4O4GA 3IN5A 3H08A 3RTVA 1KLNA 1BQMA 2VWJA 3HVTA 4BDPA 2AX1A 1Z25A 4FW2A 4ECSA 4IG3B 3UR0A 1ZBUA 4O3SA 1DLOB 5F8GA 4ED8A 1LW2B 4ECXA 3KD1E 4O0JA 1HQEA 4TN2A 4R5PA 3PW4A 5HRPA 2YKMB 3DOKB 1B9DA 1SKWA 2AGQA 3I5CA 3NCIA 1RT7A 3CWJA 3L3UA 2W7PA 5FDLB 3QESA 2ITGA 4ECRA 5C42A 3K59A 5KFKA 3V6JA 2FBXA 3NFAA 4JS4A 3CJ3A 4CEEA 3WNHA 4C8NA 1TKDA 2VG6A 1BCOA 5FROA 4KO0A 5HROA 3BQ1A 3ITHB 2OPPA 4F50A 3AVAA 1DTQB 4W5OA 3PX6A 4CJPA 3BJYA 4DTSA 3H5SA 3T1AA 3UQSA 4M45A 2O4IA 3DRSA 1WNSA 4IQXA 1VSFA 4R5PB 5KT7A 4RUAA 1KFDA 2XGQA 2XC9A 4ELUA 2ASJA 1NK0A 4IG3A 4OLBA 3OSNA 3SI8A 4DSIA 3CM5A 2IC3B 2B5JA 3IAYA 2OPRA 1QSSA 3QIPA 4ED3A 4IDKB 4ECVA 1G15A 4KI6A 2OPQB 1RBRA 2YNFB 3KHRA 4FYDA 4TY8A 2WHOA 3O4NA 1RT6A 2F8EX 4FJNA 4Z4IA 4RG8A 3GIMA 2X6NA 2HAIA 3M8QB 4E19A 3OLAA 3UDLA 1C1CB 4KHWA 3FQLA 3NBPB 4URQU 1C2PA 4CJTA 1HPZA 4DFMA 3T5KA 3L8BA 3ZT3A 4DTUA 4K4YA 4NLWA 4DFKA 3KLEB 4F4WA 3NH2A 2GIRA 1C0UA 1JLBB 3LP1A 4KPYA 3C6UB 1VSMA 3KLFB 5CYQA 4FW1A 4QAGA 5KGWA 4CIEA 3QNOA 1XC9A 3IRXA 1BQNB 4CIGA 4RW6B 3MR3A 4LY7A 2IAJA 4N56A 2R2TA 4ZMMA 4EZ6A 1BIUA 3V4IA 4J9MA 2UVWA 2R8HA 2C28A 2BQ3A 4GC7A 1Q9YA 2R8IA 5DK5A 4RNMA 3AA4A 4DLEA 3SUQA 3H59A 3NF7A 3QEIA 4AHRA 1R0AA 2V4QA 2OPSA 3PJWA 2YNHA 3C94A 1YT3A 1NK6A 3CFOA 1DTQA 2O4GA 1EETB 3PV8A 2Y1JA 1TV6A 3ZSRA 5KG6A 1C1BA 3THVA 4J9SA 2VG5B 3JYTB 3DLEB 2JEIA 3JSMB 2Z1JA 4R8UB 3OYKA 1S1XB 3BDPA 2ASLA 1JIHA 2AQ4A 1C0TB 1RT1B 1NHUA 5KFOA 1JLCA 3OJSA 3VQ6A 1GOCA 4HUEA 5KG2A 4BWMA 4PA1A 4CHZA 1LAVA 4LD0A 3KLIA 3TAFA 4BE0A 3K58A 4F4ZA 3FRZA 3EY1A 3NBPA 3S3OA 5KT3A 1JXBA 1QS4A 1UA0A 2JEJA 1SH3A 1GX5A 2UVVA 4RW9B 1S1UA 1X1PA 4O0IA 1KFSA 2G8IA 5J2PA 4F3TA 4K8ZA 2FVCA 1VSLA 1D9DA 4NLPA 1MU2B 3RR7A 4CF2A 1T94A 3H40A 4ZPBA 4I7FB 1WSEA 4RNNA 3TAPA 2IGIA 4DL7A 5F9LA 4Z4EA 3M9MB 4OL8A 4K4SA 3KLFA 2QV6A 2ATQA 1XHXA 3GILA 1RT4B 5KFZA 4O55A 3BGRA 4CJKA 3KHHA 1RTJA 2IBKA 4J2AA 2IM3A 5KFEA 1TK0A 2HHTA 3MEDB 3NAEA 3LZIA 1WSGA 3OYCA 4TQRA 4J9NA 3FFIA 3G6XA 2BR0A 2ZKUA 2IS3A 4K4WA 4HKQA 1WAFA 4YQWA 3QEXA 3AA2A 1XR7A 1KLMB 1K1SA 1IKXB 2CKWA 3SV4A 3TAQA 1RA6A 3HPHA 1S0OA 1EX4A 2XRIA 2GIQA 1HNIA 3RB6A 1TVRB 2YNHB 4KV8A 2KW4A 3PX0A 3BQ0A 3GIJA 3DYAA 3TANA 1JLEA 1RTHB 1S1VA 1ASWA 3RBDA 2PY5A 1S9GB 3PVXA 1CXQA 3C6TB 3O4QA 4FS1A 4M41A 5L1LA 1U04A 4CF8A 3EYZA 2YNIA 4YFUA 1LWEB 3VQ9A 3CJ2A 3L2VA 1NJZA 4E89A 2PZSA 4CFAA 5DQHA 1N6QB 3O3HA 1HNVA 1VRTB 1SH2A 3QEPA 3ISND 3AVFA 4DSFA 4TY9A 2QXFA 4DQPA 2RN2A 3QGHA 1BCMA 1C0MA 4DTJA 4RU9A 5KG4A 3OHAA 4FK0A 2W7OA 2RKIA 4ZP9A 3OLBA 4CJUA 3H5XA 3V1OA 1KRPA 1WSIA 4Q8FA 1X9MA 3T3FA 3KKSA 4ZPCA 5DQIA 3QO9B 4IFVB 2XI3A 1JLQA 2Y1IA 1HYVA 1QUVA 4RNHA 1WNEA 4LH5A 4FM0A 3HVWA 1RBTA 1QQCA 5J2MA 4FJIA 1RT2B 4KHQA 3CDEA 3E51A 4HCCA 1R0AB 4OVLA 1SUQA 5SZTA 2RPIA 5KFQA 2XO7A 3DOLB 3L2WA 5J1EB 4IOBA 1KCFA 2IM0A 4C8OA 2FJWA 4IH7A 4F4XA 1S6QB 5F8HA 3TAMB 1D0EA 2GBZA 4AH9A 1UOCA 1NNDA 3PW2A 3HSTB 2WB4A 4RUCA 1HNVB 3I5AA 3VQPA 3EZ5A 3PHEA 2UVUA 2X6SA 1VRUB 5KFMA 2G8VA 2B6AA 2V9WA 3KLIB 2R2RA 3IS9B 3U6FA 3PX4A 3AO1A 2IA6A 2YKNA 3V1QA 3OHBA 4W5NA 4M3TA 3NH1A 4GW6A 4CJ4A 3KLHA 4O44A 1KVBA 1RT2A 1TKZB 1JLAA 1KHVA 2I5JA 3IGNA 1ZTTA 1BGXT 5HLFB 1TL3B 3N6MA 1S0MA 3QGGA 1MMLA 4I2PA 4NRTA 3V9XA 3M8RA 1ZETA 4DSLA 3BR9A 2FVPA 2VA2A 3LDSA 1NHVA 3LP2A 3MFIA 1ITGA 1JL1A 5C25A 5KFFA 1CSJA 2G8HA 4QW9A 3DLRA 2XCAA 3BSAA 1NKCA 4O3QA 3BREA 5L1IA 1NK4A 3B6PA 4CJQA 3H4BA 3KLGA 5D3GA 4DTMA 5JS1A 4KTZA 3CFRA 5D3GB 3DMJB 2E6LA 4YMEA 5EWEA 3I0RA 2DFEA 2W9BB 4CJ5A 1L3SA 3RAQA 2EX3A 2XHBA 4RZRA 4O3OA 2YV0X 4O4GB 3V9WA 1ZBHA 4RW9A 4FJHA 4WE1B 1A5VA 3ZSXA 4DSJA 2IC3A 1F21A 1NKBA 1IKXA 5KFCA 3TAMA 2ALZA 2D0AA 4NLYA 4H4MA 1HYSB 4JV0A 2AU0A 4U6PA 4MKAA 4KE5A 1LW0A 4FLYA 3NKYA 4RW8B 1C0UB 4H8KA 4CK2A 3GQCA 3KMQA 3SV3A 2BDPA 1A5XA 1S9EB 3WNEA 2AWZA 3G6YA 1C0TA 1RT1A 4FLVA 1JL2A 4AHTA 2YNGB 1JLCB 2J6UA 3MXIA 4NCGB 4KHMA 1HPZB 2IMWP 4O4RA 4NYZA 1LWEA 4BE1A 5KFLA 2QE5A 4TSXA 1S0NA 2G8KA 2GUIA 2UVRA 4CGGA 4M3ZA 4FJKA 1LWCB 2G8UA 4OKKA 3FFIB 5JUMA 3TWHA 3CO9A 3I0SA 2UUWA 4KFBB 4HUFA 4B3OB 2WK4A 4J9LA 4DL3A 3KLHB 1TKZA 2BANB 3AVNA 3OL7A 1IO2A 4NZ0A 3G10A 4KHUA 1RT4A 4QWEA 4U7CA 3DDKA 3QEWA 4B8AB 1QHTA 3CYMA 5J2NB 1HQEB 4B9VA 4Q5VA 4FBTA 4AILC 4KKOA 2JC0A 2BGGA 5J2NA 4CJEA 4CJVA 2QKKA 4CJSA 3QNNA 4HHTA 4WXWA 4FJ8A 5SWMA 3L3VA 3QIOA 2J6TA 3NH0A 1S1TA 3OYBA 3OSPA 1BQNA 3FDSA 4Q44A 4QWCA 4ZVGA 4IKFA 4CGHA 1U47A 2HNDA 5J1EA 3V81A 4W5RA 4R8UA 1C1CA 5EWFA 5KG1A 1S5JA 1TK5A 1EETA 4Z4CA 5F8LA 1RT6B 1Q8IA 3RMAA 3DLBA 5KFPA 4FZZA 1L3UA 1C1AA 2D0BA 3NAIA 5HRRA 1JLQB 3F9KA 5KGXA 4MK7A 1RT7B 4RNOA 2YKNB 1BISA 2RDIA 3OYLA 1KHWA 2W9CA 1IKWB 2XWYA 2E6MA 3GV8B 4ED2A 1NJYA 1L3TA 4NLDA 4WYWA 2YNIB 4B8CA 3H98A 3F73A 3NF9A 4DL6A 1RTHA 1S1VB 5KFUA 3RWUA 5KT2A 1RBUA 4CGDA 4YP3A 3SNNA 3MR5A 1W25A 4DG1B 3OS2A 1KVAA 4DS4A 4DU4A 1K1QA 1NKEA 5DGBA 4K4VA 1J5OA 3VA3A 4O3RA 3I5BA 4GC6A 1TK8A 4ID5B 4CHPA 3N6LA 2HMIB 3SQ0A 2FLLA 1BL3A 1W9HA 1SL0A 4EO8A 1JKHA 1RDAA 4RW4A 3MF5A 4CFCA 2OYQA 5KI6A 1EP4A 1D5AA 4FVMA 1N48A 1ASVA 3P5JA 2A1SA 2C2DA 4J2BA 4B3OA 4O44B 5EUHA 4RW7B 3SI6A 3OYIA 4CHYA 4F2RA 4DFJA 5I42B 2D5RA 2C2RA 2FJVA 5HRSA 1S10A 4AHSA 1HMVA 4ED0A 4Q45A 4H4MB 1HYSA 5HP1B 3DLEA 1LW0B 4KB1A 3ZSVA 4M95A 2NUBA 4DLGA 3OL6A 1KSPA 3HVTB 3SPYA 1RCHA 2R8KA 4M3RA 4FM2A 4LSNB 1CZBA 1X9WA 3AVIA 2OPQA 4CESA 4AHCA 3CDWA 4OGCA 4YNQA 1S1TB 4CJLA 4M94A 2YKMA 2DTUA 5KRSA 4I9QA 4CEAA 1RTIA 3I0RB 4LSLB 4KSEB 1BI4A 3AV9A 1L5UA 4F4KA 3MR2A 4ECTA 3H5UA 2B6AB 3RMBA 4JRPA 1RTDA 1SV5A 2WCXA 1BQMB 3RB0A 3KIOA 1NJWA 1I3AA 1RYRA 4GMJB 2BQUA 3DRSB 1HNIB 4Q43A 3PW0A 1FKPB 3DLKA 2HNYB 2BQRA 4JV1A 3IGVA 2GV9A 3A2FA 5CY4A 1VRTA 4KFBA 4DQSA 5F8NA 4IR1A 4BDYA 2JC1A 1X9SA 4ICLB 1HARA 3HJFA 3VN5A 4TYBA 5I42A 3MEDA 3MEEA 1TQLA 5FRNA 4Y3CA 3ZSYA 3EPIA 1Y97A 4IDKA 2FLPA 3RMDA 3HXMA 2KTQA 5HBMA 4ZVHA 3AVMA 4K50A 1RTJB 4E7HA 2AJQA 2OPSB 3SUOA 1EP4B 2R7YA 2Z1GA 3LP3A 3KMSA 4ZP8A 3TABA 4Q8EA 3V6KA 4PUOA 2HMIA 4ID5A 1YTUA 3LP0B 4ECQA 3C6TA 2BANA 2ZD1B 2E9ZA 4DF8A 3VQ7A 4ZP7A 4J9RA 1WLJA 5DLFA 3CJ0A 1D9FA 1TVRA 1NK9A 3RAXA 5L1KA 1S4FA 1D1UA 4DQRA 1GOBA 2IJNA 4HUGA 4ZVFA 3HYFA 3DRRA 3DMJA 3HP9A 2UUTA 1I6JA 4M42A 1RDDA 3LALA 4Y1DA 5KFGA 1SKRA 3OL8A 2W9BA 1VSDA 2W9CB 1SUQB 3HM9A 3SPZA 2LSNA 1LW2A 3AO5A 1S9GA 3TI0A 5DQGA 4NYFA 5KFWA 2HNZB 3CM6A 1S9EA 4LSLA 1RTIB 2Q3SA 4EZ9A 1IKVB 3V9ZA 1U48A 4HYKA 4QOZB 3QZ7A 4ELTA 4QCLA 5F8IA 4NCAA 4WFZA 1KLMA 4OKEA 4CK1A 2P5OA 3AA5X 4WZMA 3NAHA 4CCHA 1FKPA 3OS1A 2RF2A 1NOYA 1BHLA 3MEGB 1JLBA 1VSHA 4DWIA 5JXSA 3DLGA 3S9HA 1QAIA 4QWDA 4ECWA 3AVBA 4TLRA 3HVRA 1RT3A 2D7SA 3Q8SB 2HHQA 4Y2CA 5L9XA 4CIFA 3QO9A 4IFVA 4DTPA 5EWGA 3NGYA 3OYGA 2JEFA 2YHBA 3RB3A 4FJ7A 4DTOA 4KHSA 1Z26A 4ZPAA 1XR6A 4CEZA 3V9SA 2V0NA 2O5DA 3MECA 4DL4A 2GC8A 1JXEA 4C8KA 4DU3A 4YR0A 1FK9A 1C6VA 2B5JB 1T03B 4YR2A 3CJ4A 4KRFA 3JSMA 5DG7A 1QTMA 4DSEA 4DG1A 1N6QA 3VQDA 1WAJA 3LPTA 3OYFA 3O3FA 1N5YB 4F3OA 1LWCA 1TKXB 4NLGA 4Z4HA 1J54A 1T05A 3Q8PB 4J9PA 4KBIA 4JRQA 4I2QA 1QE1A 2BRLA 4HTUA 2RKIB 4ID1A 5KFHA 3SQ2A 5KT6A 3DRPA 4MH8A 3SZ2A 2FLNA 3VA0A 2ATLA 3CDUA 4CHQA 4KREA 3OJUA 4LQ9A 3TVKA 3LPUA 4K8XA 3HK2A 3L2QA 2E9RX 3BQ2A 3ITHA 3PZPA 2OPPB 3HPGA 2HHVA 3OYEA 3G6VA 4CEQA 4ZPDA 1ASUA 2KFNA 4KB0A 2ASDA 2F8TA 4EBCA 1YVUA 5DG9A 3QEVA 3HKWA 1DLOA 4M3WA 4K4ZA 1JLFA 4LQ3A 1LAWA 3AO2A 3VQBA 4OKJA 4NLVA 2YNFA 3D28A 4EYIB 1NJXA 1UWBB 1GOAA 3C95A 4CK3A 5KTQA 3RRGA 4NLTA 4CHNA 3ICLA 4AHUA 3HVAA 3U3GA 2D0CA 4PY5A 3VQCA 3H2LA 1KTQA 5KG3A 1SV5B 2IM2A 1T7PA 3KD5E 5F8MA 3FQKA 4M3XA 3ASMA 1SL2A 4FJ5A 4CEDA 4J9KA 3NF6A 4CGIA 5DLGA 3DYAB 3GV7B 1JLEB 5KG0A 2QKBA 2RF2B 2IJFA 5CZ1A 4B08A 3DLHA 3MEEB 4WZQA 3TAEA 4Q0BA 3QZ8A 4LSNA 5CYQB 4NCBA 1RDRA 2C22A 3V6DA 5HP1A 4DMNA 4FLZA 1VSJA 5CZ2A 3DI6B 1MU2A 1C1BB 1TL3A 3ZSZA 1YVFA 1VSEA 1XHZA 1WN7A 4XPEA 2EHGA 3V1RA 4G1QB 4RW7A 1TP7A 2E9TA 2W8LA 4EP5A 4FLTA 5KFYA 3LWMA 4NCGA 4OGEA 1B9FA 1N56A 5KFNA 4DQIA 4KB7A 2HVHA 1S48A 2B43A 4KHRA 4ZVEA 3DM2B 3RB4A 5J2QA 1BI4B 3MFHA 3CIZA 4PWDB 3TAGA 4H54A 1N5YA 1T05B 4IRCA 4KV8B 3OYDA 3DRRB 2R8JA 4MQ3A 3HL8A 4FJLA 3L2UA 3HHKA 4EO6A 5K14B 4WYLA 3T5HA 5C24A 5K14A 4ED6A 4K4UA 4BWJA 3LAKA 1IG9A 2DPJA 4BACA 4FZXC 4FK4A 1HYZA 2PYJA 1DTTA 2P51A 1HMVB 1UWBA 3ZT2A 2QK9A 1S1WB 4JS5A 4F8RA 2PYLA 4R0EA 3K5LA 3L2RA 4K4XA 1EKEA 5KFTA 2RDJA 3AVJA 1ZTWA 1D8YA 1HQUB 1RDBA 5HBMB 4E3SA 4RW8A 2IDOA 1HQUA 1IKYB 2OZSA 1NK5A 3AVKA 2VG6B 5KFAA 3RBEA 2KZMA 2FBVA 2FVSA 4B9LA 2DFHA 2DFFA 3ZT0A 4E1NA 3QERA 1QSLA 2WTFA 3V81B 1TAUA 3MAQA 4JLHA 3KJVA 3MTKA 3BSCA 5JS2A 2ZE2A 4GVMA 4NLRA 1W0HA 4N5SA 5HLFA 2KFZA 4CEFA 4CFDA 1FKOB 4B9UA 1U09A 2WOMA 1BIZA 1RT5B 1RTDB 4C8LA 1XR5A 3G0ZA 3BSNA 1IKWA 2FJXA 4JV2A 3CQ8A 4KKOB 4EEYA 3UIQA 4N47A 2IM1A 3S3MA 1WSFA 2XY8A 4X2BA 2WONA 3E01A 4ECYA 5I3UB 1REVB 3SFUA 2R2UA 1SL1A 4J9QA 4W5QA 2IAJB 4IR9A 3SFGA 2ZQBA 1TL1B 1EXQA 3WNFA 5F8JA 2ILYA 5KT4A 4FLUA 3OS0A 3SUNA 1JLFB 4FLXA 2F96A 3MEGA 2HVIA 3RR8A 1LV5A 4FM1A 4E7IA 3QETA 1I39A 3K5MA 2HWIA 3VQSA 4FZYA 4PWDA 2AX0A 4F4YA 4XPCA 3SQ4A 4BDZA 4B9TA 3TARA 4IBNA 3NGDA 3ZCMA 3KK3B 3GV5B 4NRUA 1U45A 4DTRA 3S3NA 4AHVA 3OYAA 4O3PA 3T5JA 4KAIA 3BSOA 3OYMA 1T3NA 3T5LA 4HVJA 2G8FA 2JLEA 4I7FA 1XWLA 4OPKA 4MFBB 3Q8RB 4KTQA 5KFSA 5FRMA 1YTAA 5EU7A 3M8QA 3PW5A 1TL1A 2FBYA 1ZYQA 4IFYB 3D45A 3FSIA 1GX6A 3VQ8A 3QIPB 4NLOA 3E01B 3CFPA 4BE2A 4ZHRA 3KK1A 3NF8A 4Y1CA 3ZT4A 4KI4A 1TKTA 3M9OB 4ZP6A 3MECB 3HPOA 3D0PA 4I9LA 3TQ1A 1QAJA 4Y2AA 4J2DA 1IH7A 4IH6A 1A5WA 3IG1A 4PUOB 1U4BA 2XI2A 2WOMB 3MR6A 1RT5A 4FS2A 1NK7A 2P1JA 3HT3A 4EBEA 1VK0A 4PQUA 2XCPA 5F9NA 2J6SA 2YHAA 2X74A 2DY4A 4NYNA 4Y34A 3P1GA 2B4JA 4M3YA 3OY9A 3C6UA 1RBVA 3T19A 2KQ2A 2HNYA 1VSKA 3PUFA 3V6DB 5J2PB 4IKAA 4DSKA 4KAZA 5KRTA 1HJRA 1VSIA 3KHLA 4C8MA 4B9SA 2OH2A 1Q9XA 3VQ4A 1WSJA 1IKVA 1UAXA 5C42B 1CXUA 4TXSA 1JX4A 3LZJA 3NL0A 5KG7A 3SJJA 4KTWA 2D41A 2F8SA 4J2EA 4IRDA 3OYHA 3UPFA 5J2QB 2KZZA 3ALYA 2FVQA 3QIDA 1U49A 3VQQA 4URSA 3V4IB 4N41A 4Z4GA 2HHUA 4QPXA 3KK3A 2Z1IA 1ZBIA 3Q8QB 4EBDA 3VQEA 3DLGB 1FKOA 2BE2B 4CEBA 4CECA 3M9NB 1B92A 2ZD1A 5KFVA 1JXLA 1S6QA 3KOAA 1XI1A 4WFXA 1LWFB 3QGIA 3AVCA 3KNAA 1T8EA 3KLVA 4MK8A 5KFIA 3GIIA 4G3IA 1JLGA 4FJMA 3B6OA 4NLQA 4DF4A 5HRNA 3H5YA 2HWHA 5KFDA 3KK2B 3V6HA 2HHXA 5FDLA 3SCXA 2VWKA 4E0DA 2HB5A 4KO0B 5HROB 4JUZA 3HO1A 3IS9A 4KHYA 3QLHA 4DL5A 4CJRA 1JKHB 1RYSA 4URGA 2XY6A 2HHSA 3QINA 4ECZA 4ZTFA 1VRUA 4IG0A 1O1WA 2BRKA 5T14A 4OPJA 4WXOA 4ECUA 4IRKA 1WSHA 3HP6A 1RNHA 4E7LA 5KT5A 1RDCA 2HW3A 3AVLA 4WE1A 3KHGA 3U3YA 4DTNA 1S1UB 4QWAA 2V4RA 1KVCA 1Z4UA 4EYHB 3N6NA 3PY8A 5KG5A 4FK2A 2I5JB 2C2EA 3RRHA 2VA3A 1N4LA 1FK9B 3SQ1A 3ZSOA 2WONB 4QWBA 3RMCA 1TAQA 1JLGB 2W42A 3OYNA 3OYJA 4NLSA 3PJXA 3PW7A 3ULDA 2FVRA 2AGOA 4E7KA 1S1WA 4MFBA 1K6YA 4FJJA 1RT3B 3LAMA 2ETJA 3NGZA 4YR3A 4NLXA 1S6PA 4DS5A 4IFYA 4OLAA 5C25B 4QW8A 2XY5A 3P83D 2I1RA 4RW6A 1ZBLA 2VG5A 3JYTA 4MKBA 4CF9A 4DTXA 4IG0B 5KFRA 2WRMA 2IOCA 2DPIA 4EP4A 3M8PB 1NOZA 4MIAA 4L8RB 3LP1B 3EZUA 4UQGA 3M8PA 4TYAA 1J53A 4Z0UA 4RNFA 4TY8B 3K5NA 2XY7A 3H4DA 4FJ9A 4FJXA 1JLAB 4NLUA 3KLEA 1CZ9A 3PR4A 2VG7A 4PQUB 3DOKA 1HRHA 3G86A 1NK8A 3NMAA 4G1QA 3AVGA 3DRPB 2P5GA 4FJGA 1SH0A 3AA3A 3NGIA 1RAJA 1LWFA 3CG7A 3OVNA 3GIKA 2XGPA 1S97A 3O3GA 3KTQA 3OL9A 2HNDB 3K5OA 3IRXB 2W8KA 5I3UA 4DL2A 3EPGA 4XIUA 2CJQA 3VQ5A 1S6PB 2D3UA 2R8GA 2EC0A 2OPRB 2AGPA 3ZT1A 3LANA 3AO3A 3DM2A 3WNGA 4XO0A 4MK9A 4B9MA 4O3NA 4O5BA 3LWLA 5J2MB 1IKYA 2FBTA 3AO4A 2HHWA 3CJ5A 3NE6A 4J9OA 3D5MA 3GYNA 4FXDA 3PO5A 5KFJA 1QSYA 3ZSWA 3PO4A 1S1XA 3QYYA 3SUPA 4N76A 2E4LA 4CFBA 4B9NA 3LP2B 1FXXA 3TR8A 1TGOA 4DFPA 4CERA 5C5JA 4CJ3A 4E1MA 4CF0A 4I2PB 2FC0A 3KK1B 4M3UA 4ICLA 5T7BA 1TV6B 1REVA 1J5OB 3PR5B 1S49A 5DMRA 1T03A 2G8WA 2YNGA 2D3ZA 1UA1A 3IG1B 2W9AA 4Z4FA 4WFYA 5L1JA 4CHOA 1RA7A 3LP0A 5KFBA 3NDKA 3VQAA 2A1RA 1QE1B 4I2QB 4E7JA 2VG7B 1DTTB 4ZHRB 1TKTB 1OS5A 2R2SA 5KFXA 2ILZA 3CVKA 1L3VA 4HCBA 5C24B 4CE9A 4LH4A 3K57A 4K4TA 5DG8A 4CGJA 4FCYA 4IH5A 3I0SB 3SYZA 3DI6A 5DGAA 3MXMA
chains in the Genus database with same CATH superfamily
3DOLA 1YG0A 1I3OB 1NGHA 4ZTJA 2PI4A 4CJFA 2YWKA 2GMLA 2OANA 3M6UA 2OLWA 3ZSQA 4FLWA 2OZMA 4A2AA 4RCHA 2BX6A 4WFBL 4H4OB 2R7UA 4H4OA 1NMEB 5BPMA 3CCJS 1RBSA 5HAOA 3AVHA 2V8GA 2E5LK 2ABYA 3MWPA 2XZDB 2A6MA 1OQ3A 2J76E 1VQ4N 4W5TA 2ZZMA 2X1GA 4TQSA 4XEIA 4ED1A 4ED4A 4BRKA 2ZE2B 3IM9A 4DEZA 2E7XA 3RTVA 1KLNA 3Q89A 1F2GA 5IM0A 3QSYB 4BDPA 2R7VA 2BJ7A 4IG3B 1ZBUA 4CM2A 2QWRA 2W4PA 5HQMA 2XMMA 2WBRA 1N34K 2FDNA 3CNQP 4CLKA 1WKLA 1EHWA 4TN2A 2YKMB 1SKWA 4FF4A 2YI1A 1PYSB 3QT8A 3HZ6A 2YJEA 4J91A 1RT7A 3L3UA 2ZUGA 4LF5K 1DKGD 2WVDA 3QESA 4ECRA 3K59A 3I6PA 3GFHA 3J7A1 3PACA 2LDYA 4C1NK 2HKEA 5KPZA 1WC6A 3CJ3A 4QZVB 3WNHA 2KHCA 3JS6A 2BM1A 2WB1D 3W66A 3FBCA 4KO0A 5HROA 2OPPA 3NGKA 1DTQB 1VLYA 2IIRA 5IT9O 3H5SA 3T1AA 2CQGA 2WBMA 1TTHB 4IOCQ 4B3MJ 4IQXA 3PG9A 4CRJA 2QL9B 3I4PA 2A0FB 1F9HA 3O9UA 3TZWA 3ZX2A 2RE2A 3DXMB 3Q22A 4LREA 3A8YA 2IC3B 3GDQA 5M1QA 3FUYA 3ZLJA 3I33A 1G15A 2HBKA 4RLEA 1RBRA 2YNFB 3HHLB 3AAWB 3U1MA 1XMQJ 1X5OA 2UP1A 4Z4IA 3AD9C 2X6NA 4LF7F 2HS4A 2IRYA 2GNKA 5B09A 1C1CB 3FQLA 1RWUA 1C2PA 1HPZA 1KQFB 3CJSA 5IC4B 3B54A 4JI6J 3ZT3A 3NNAA 2XG8A 3OHRA 1BDGA 4CLWA 3NH2A 3ULEB 3M2UA 3POTA 3GIRA 3VEZA 4OX6A 1VGYA 2IDLA 3J81O 4BBYA 1YZ7A 5HVFA 5FPNA 3C6UB 3CJQA 2QC3A 1HUXA 1VHIA 3G8QA 3KLFB 1BC6A 2W7AA 1N5VA 2PMHA 4CIEA 2DRAA 3O5BA 4JI0J 4LY7A 1T9VA 3W62A 2IAJA 1SIWB 4KRWA 4OX9F 2IDEA 3S7RA 3BKTA 3EEQA 1YLXA 2BQ3A 2KYZA 1Q9YA 2W24A 3NG8A 4RNMA 4DLEA 2EFVA 3AAPA 3H59A 4ALZA 1UVKA 3QEIA 3AGKA 4CZEA 1QJHA 4ILHA 1S4EA 2VJVA 2OPSA 3W9HA 1YRTA 3ZETA 3C94A 2KI2A 1QQMA 3KHYA 2KVQE 2B9WA 1T9YA 2V8DA 2VCPA 4AQYJ 3EZOA 3DLEB 4ITSA 2B4UA 2NRTA 4FWMA 2B4OA 1YJUA 3E66A 4I6MB 3CO0P 3BR8A 1C0TB 2OSRA 5ETVA 2OEKA 2I0XA 2WFBA 1WOPA 1NMNA 3MDFA 3LDPA 4NA1A 3M8YA 4LC9B 1FVSA 1RWWB 3R5CA 2G1DA 2KH9A 4CHZA 2E1CA 1UVLA 1LAVA 5HVHA 3KLIA 2ZH7A 3TQEA 1IBLJ 2UVVA 2DNGA 4RW9B 1U0SA 3OTBA 4O0IA 1SJQA 2DRBA 5IC6B 3CD6S 4NLPA 1HWKA 1MU2B 4OYXA 4DV4F 3RR7A 3K9KA 8ATCB 2QA4N 2IGIA 4JI5K 1WBDA 4OL8A 3A3OB 2FUG9 4K4SA 3KLFA 3M30B 2DNHA 1PIEA 3D0GE 3GILA 2ZHBA 1TYQA 1YJTA 5KFZA 3D1QA 1RTJA 2VL1A 2WUSA 5JVGL 1BWVA 1Q5YA 3MEDB 3GG4A 3OYCA 1Q7YO 4J9NA 1RLDA 3FFIA 4DMZA 2WW8A 4K4WA 5JLHA 2CZVC 3UN5A 1G1XA 1WAFA 4YQWA 3IO1A 4FVUA 2N3LA 3CTRA 2P9IB 2XRIA 2RAQA 1FFGB 1HNIA 2CJ9A 3WC0A 2YNHB 4KV8A 3BZQA 2HZVA 1PILA 2Y1RI 4PG4A 1RTHB 1S1VA 1RHUB 3C6TB 4CF8A 5DZ6A 4RL1A 5ADXH 4EWTA 3VQ9A 3TU5A 3AJDA 2PZSA 1S99A 1HNXJ 2IA0A 2DNKA 3QGHA 4DTJA 4RU9A 5KG4A 3IWXA 4ZP9A 3OLBA 5HQLA 3A12A 2Q2RA 3J80O 1GLLO 3PRVA 2I7NA 3O2IA 4NLBA 1OY6A 3KNGA 1X9MA 3T3FA 1FX4A 5HK4A 2Y9HA 2XMWA 1JLQA 2Y1IA 4B3SF 4LH5A 4O8UA 2OSQA 1GTEA 5DM6L 1RBTA 3D2FA 2DRDA 1WOQA 4FJIA 1RT2B 5T41A 1ZPVA 3S8SA 4HCCA 2VZ9A 4OVLA 2CPXA 2KFYA 3C2PA 1VC5A 5KFQA 1KCFA 3ILIA 4Y2IA 3M32B 4BLGA 1S6QB 2B4VA 5F8HA 3TAMB 1D0EA 1VQMN 4WIQA 1RXOB 1NNDA 4KHPF 3J7ZT 1RU1A 5M1PA 2LP4A 3OW2M 2W25A 2ZH9A 2EG2A 3EZ5A 4MMOA 2UVUA 2X6SA 1VRUB 3P49B 1XIQA 1RE1B 2G8VA 1GH8A 3KLIB 1EQMA 4PG5A 3IS9B 3R6MA 3PX4A 3AO1A 2IA6A 2YKNA 3V1QA 2V67A 3OHBA 3C16A 3NH1A 4GW6A 5BR8J 2VH7A 2VICA 2OD6A 4CZMA 1P8GA 1AFJA 3W0LA 1ZC6A 1TL3B 3N6MA 1S0MA 2O3DA 4H4KA 4LF6K 4H0YB 2FVPA 3LDSA 1WHWA 1PBUA 5AFUA 4CLFA 3MFIA 3CCQN 3GR0A 2OHDA 4OZ1A 3T1HF 2G8HA 3VTIA 2PT0A 2KHDA 4IEEA 4CH0S 4WP9A 2FHMA 3PKMA 3BEGB 4K2XA 4MKVA 4KTZA 3KDNA 5D3GB 5CYJA 1F3VA 2UXBK 1CULA 3I0RA 2DFEA 4CJ5A 1WF2A 4TKTA 2YX1A 2EX3A 4ERDA 4RZRA 1E6YB 1RWPB 1RFQA 4EFAC 5EY4A 2DB1A 1HI1A 2BABA 4RW9A 2KRBA 1KC8T 4USHA 2VQFF 2RT3A 3CB4A 2HF3A 3CCEN 2IC3A 1F1BB 1NKBA 1IKXA 1IXKA 4JV0A 1N52B 3W65A 4C97A 1SJ3P 1FRLA 3H20A 1PAEX 3NKYA 3I31A 1T9UA 2OMLA 1YJNS 4H8KA 3EJMA 4CK2A 3SV3A 3KMQA 1T9TA 1A5XA 3MURP 5E2QA 2YNGB 1GXTA 3MXIA 4NCGB 4KHMA 4USJC 4JI5J 4O4RA 2O8BA 1KS2A 2FZGB 2CYYA 3AFGA 4C48A 3W5ZA 4BE1A 5KFLA 4K43A 2QE5A 2DR9A 2GUIA 2QLJB 3H6EA 4ZDNA 2EFGA 2HRUA 2BM0A 3TWHA 2IBOA 2UUWA 3MEKA 1Z2ZA 3EWGA 3I56N 3H3NO 4B3OB 2WSCC 2WK4A 4J9LA 3MMJA 1UEVA 4HEA9 1DGKN 4ILRA 3AVNA 2A5XA 4JKHA 2V2QA 2YQ3A 2AEMA 2ZBPA 3QEWA 1U26A 4PRFA 3X1LB 5J2NB 1VQON 4DR7K 3JAMY 4KKOA 1YRXA 2Q6CA 4AILC 4CJSA 4DQ8A 3L3VA 3QIOA 2L41A 1TYQB 3OSPA 3PCOB 3ULHA 5L38A 1TMJA 4QWCA 3P96A 3UCGA 4ZVGA 5ADZA 5AQRA 1U47A 2HNDA 1F2HA 3PYDA 4JI1F 4AXIA 5EWFA 1Y9OA 5KG1A 1S5JA 3ATVA 4DV1F 4Z4CA 2HBLA 1RT6B 1Q8IA 3G6ES 2A41A 1L3UA 3BGOP 2LQ5A 1VOMA 1FEHA 3KZBA 2D0BA 4NO7A 1JLQB 1QZ6A 1RT7B 4DV3K 4RNOA 1KHWA 2W9CA 3ZTSA 2XWYA 4D3GA 2YNIB 3F73A 1FXLA 3A5OC 3J81U 1YBTA 1CS4B 4FVCA 3CCLS 4DL6A 5KT2A 1RBUA 1HHTP 3SNNA 5TKWA 1KVAA 4DUTA 3BF1A 4C4WA 4B3RF 1J5OA 5KOXA 4JKGB 4CHPA 5DS7A 1BL3A 1FXRA 4EO8A 2EC2A 3TZXA 4RW4A 2X51A 3MF5A 2VQFK 2OYQA 2MGZB 2X1FA 1IBLF 2EBGA 2QM1A 3BGLA 4DR1F 2C2DA 4B3OA 5EUHA 4EGLA 1X4CA 5GADU 4RW7B 3OYIA 4CHYA 5LL6Z 5HRSA 3PM9A 5BRHA 1E3MA 2E7VA 3IRWP 3ZSVA 4M95A 2BW2A 1MWKA 1KSPA 1RCHA 2V69A 1Z1ZA 1YITN 2IMOA 3U4LA 4J37A 3QT6A 1X9WA 3SBGA 4AE5A 2ZH6A 3CDWA 3PYFA 3CC7S 1S1TB 4CJLA 4M94A 1XC3A 4LFBF 3L4BC 4FF3A 2LLZA 4WQ5A 3R1LA 4LSLB 4M5IA 2N7YA 4LFCK 4DZDA 4F4KA 3WT0A 3HSDA 3H5UA 3SAHA 2XZWA 2WCXA 2HMPA 4B17A 4DPOA 1NJWA 3DRSB 1VHFA 1E6YA 2XMTA 3OFFA 2GV9A 3A2FA 2F9JA 4QYRA 2FF3B 3R6LB 1YHQN 5F8NA 2JC1A 4P10A 1MA9B 3W8PA 3MEDA 4OIXA 1ULRA 3A8JA 4HDGA 3OBWA 4GO7X 2ZNYA 3IWNC 4GV3A 4GV6A 4DBQA 3GG0A 2V51B 2GFFA 2UZAA 1RAEB 3PIOQ 2VODA 3SUOA 2R7YA 2MY7A 2VGNA 3TABA 1FRXA 3N01A 4CP5A 5LXRA 4CO5A 2FPHX 3C6TA 4WP3A 2ZD1B 3SQGA 4A5AA 3E8OA 4DV3F 5DLFA 2LEAA 3OTEA 1FEEA 5KQDA 2FTRA 3G6EN 3R3TA 2UUTA 4OFZA 4OZ0A 4M42A 1RDDA 1X5SA 1SKRA 4LSZB 2V2KA 3OL8A 2BMBA 2W9CB 3VGKA 3VAGA 2XLKA 1OQ6A 4LIWA 3FMWA 4C23A 4XK8C 2A3ZA 3F2KA 2HQIA 4P73A 2FSKA 1XTZA 3OV7A 1RTIB 2Q3SA 4Y28C 1T9XA 1IKVB 4BRPA 1U48A 4HYKA 4ISEA 5D78A 3M7VA 4WFZA 3T9NA 4NI2A 2KXHA 2P5OA 4E2FB 2NXUA 3AA5X 2ZBQA 2BOPA 4KJIA 3OS1A 2D69A 2RF2A 3MAHA 1FJ7A 3MEGB 4AM6A 1WUUA 4ZPTR 4Z94A 2I9SA 3DLGA 3S9HA 1VLOA 1HWUA 3AVBA 3HVRA 2D7SA 4X64K 2K8GA 2V9KA 1HFEL 3MM7B 4Y2CA 5L9XA 4CIFA 3OYGA 3RB3A 1AW0A 4KHSA 3DC2A 1Z26A 3NS7B 1CJVA 3VGLA 1E4GT 2AEFA 4IOCL 2E1AA 2GJFA 1HLWA 4C8YA 4QIEA 4DL4A 1CVJA 3NY0A 2HVEA 4FWQA 1NZ8A 3ENOA 1H1VA 4YDUA 2B5JB 1F6TA 2RQCA 3JSMA 4CNZA 4C9DA 4DSEA 2F4VF 2KDOA 3ZEUA 3HMJG 3C7NA 1TKXB 4Z4HA 1T05A 2Q36A 4KBIA 4I2QA 4CLYA 3SQ2A 5KT6A 3TO8A 3UVJB 3CJBA 2ATLA 4CHQA 2CIMA 4OPHA 4K8XA 3HK2A 4PL7A 3L2QA 3ITHA 5B7WA 3E2EA 3OYEA 2PFFB 2CPIA 2OMOA 3ET6B 4PZVA 2YHWA 3W1YC 2ASDA 4K25A 3B82A 2EBEA 1DLOA 4LQ3A 1LAWA 2JH3A 4ES2A 4OKJA 2YNFA 4EYIB 1NJXA 2HOEA 1HW9A 1RHRB 1HPMA 1AT1B 2HBZB 1VC0A 3VF4A 4CK3A 2DNLA 3FCHA 1FI4A 4CHNA 4JI2J 2MHNA 1ATRA 1Q86O 5EOYA 3K7RA 3CIMA 1QVFR 1JCEA 5LJ5Y 3ISZA 5GINA 3S1TA 3SBTA 3DDNA 5T7LB 5IS2A 1NXIA 3GZ7A 2BE7D 1APSA 4IO1A 4DUZJ 2YKAA 1V3SA 1N5TA 3C46A 4DV7K 3M2UB 4CGIA 5DLGA 4OI1A 3DYAB 4OJHA 2CQBA 2MEWA 5KG0A 2QKBA 2RF2B 1VISA 5CZ1A 4LBIA 3QFHA 1U1NA 4CLUA 3F0NA 4B3TK 4Q0BA 3WXIA 1NLKL 5CYQB 2W4DA 5HP1A 4DMNA 1C1BB 1JNZB 1RTZA 1TL3A 2IYGA 1WN7A 2HFVA 4XPEA 2EHGA 4G1QB 4RW7A 3VEYA 2F7TA 1NJIT 3ZYYX 3SCJE 3TEHB 1RDWX 5KFYA 3LWMA 4OGEA 1B9FA 1N56A 4KHPK 2HRYA 2BOAA 1ZBTA 4DCPB 3QBXA 4ZCLA 3MFHA 1FTRA 5K9FA 1SQEA 2UU9F 5BN8A 1FDNA 4H54A 1B7YB 4CW7B 4P52A 3A5NC 1K8KA 3A5MC 5FIIA 5M2PA 4WYLA 1JJ2M 1DY3A 1ATNA 1Z6RA 1K73T 2V6AA 3LAKA 3JAMU 4BACA 1WDTA 4LF5J 2ZC3A 4UY8T 3K2YA 1UZHA 4KPCA 1UWBA 4BC5A 4JS5A 2HWTA 4F8RA 3UKUB 3DLLQ 4K4XA 2NS1B 5DDQC 2ZM6F 2AYGA 1ZTWA 4CQ1A 5ETTA 4J5OA 1RDBA 2ASMA 1OWXA 2IDOA 4X64J 2DGOA 4PPDA 4HH1A 1NK5A 1OPZA 5DM7Q 4BC2A 1SCJB 4WQ4A 5D0GA 2FVSA 4ZVQB 4B9LA 3FJ2A 2O8CB 3QWUA 2JVRA 4JLHA 3O9SA 2ZE2A 3UKRA 2ZVIA 3M2VB 5GAGU 4N5SA 5HLFA 2OELA 1DJ0A 3NVMA 4FNHA 2HLUA 3QRPA 3O6WA 2J8SA 1XR5A 3V4MA 2J9DA 2ZBCA 4EEYA 2IM1A 3FGUA 1JMTA 5HJYA 2GX8A 4C6AA 2XY8A 4ZLNA 2WONA 1OH8A 2QO3A 3JXOA 2BVZA 1WG4A 5BRFA 1U8WA 3NVKA 2IAJB 1UFLA 5HVGA 4IR9A 3AA8A 4DR6J 2D9OA 5BRDA 2BJEA 2G0JA 4UTGA 4DZ6A 1V3ZA 2HVIA 4F4AA 4NXNF 1LV5A 4PABA 3MPWA 4USIA 2IFXA 3K5MA 3T1YF 3VQSA 2LQ8A 4PWDA 3ENWA 2WVCA 3LDQA 5J1NA 3KK3B 4NRUA 1U6BA 1G3OA 1NGJA 2AKWB 1H2TZ 4AHVA 1YJRA 3OYAA 4O3PA 2VBWA 2U1AA 2DKOB 2HBYB 3EVOA 3T5JA 3TRGA 3TTFA 1FRJA 1GLCG 1T3NA 3T5LA 3KFWX 1UVIA 4U7BA 4IO9L 4KTQA 3IP0A 3FNNA 3CEDA 5AT1B 4UOGA 2GZOA 3JTNA 4ZVOB 1B0VA 1HI8A 3ZZPA 2KG0A 3AD8C 2GS8A 2P6TA 3W3SA 1VBZA 1HBUB 2VV5A 2MZ1A 3Q0AA 3HHLA 5I3PA 3E01B 2A6OA 3KK1A 2A18A 5K8PA 4WJBA 1F5BA 1RU2A 4Y2AA 1HWJA 2JNJA 2DR8A 1SC1B 5D4NA 3WEEB 2V4JA 1HA1A 2WOMB 3WXMB 4MO5A 4CZGA 1X0FA 4FS2A 2UUAK 2XWXA 2A2DA 2HPUA 4KHPJ 4PQUA 2XCPA 1U6FA 5KAKA 1P1TA 2YHAA 4EHUA 3S6EA 4LR8A 4HTJA 2B4JA 2Y8WA 3C6UA 1WI6A 2KQ2A 1QAXA 3EMTA 3QB0A 5FPEA 5CZVA 2HNYA 3PUFA 1M5HA 1ZAXA 2GUPA 3FZMA 4DSKA 3ZNJ1 4KAZA 1X4EA 1VSIA 3KHLA 4C8MA 4V19S 2OH2A 4PHTX 2VONA 4Z7CA 1CXUA 4TXSA 5KG7A 3BZKA 3SJJA 3JQJA 1GLBG 2F8SA 4CBWA 4CD3A 4JK9A 2HFOA 3PSFA 4YHHJ 3NLCA 5AR0A 1RADB 2FHJA 2H5JB 3GJSB 2UUCK 3TX8A 3BY5A 3Q8UA 3KK3A 4EBDA 4ZOSA 2BE2B 5CD4H 1B92A 1YJVA 2BXJA 4ETZA 2AD9A 1XI1A 1XNQK 3KNAA 4MK8A 2CA9A 3FRYA 3M3ZA 4G3IA 4BC3A 3NCPA 3O8WA 4OX7A 1SC3B 3CC7N 2KB2A 4PEOA 4BS2A 1TUVA 2HWHA 2HHXA 2YKOA 2VWKA 1CPZA 3O9RA 4E0DA 3HO1A 5GMEA 3K5PA 1V6HA 4KHYA 3QLHA 2QYGA 4QU6A 1MDUB 1R0BG 3FE1A 4BRGA 1S12A 3CJRA 2HHSA 1HKAA 1Y3JA 2ZOGA 4ZTFA 3CGIA 4OPJA 1I94F 3BM7A 3MGJA 3N4QA 1WHXA 2G2YA 2EKNA 1Q81O 4P2FA 1U24A 5AQQA 2B7BB 5K5MA 2FGOA 5KG5A 2YJFA 4UOHA 5DDPC 4FDFA 1CEZA 4PG7A 3D0IE 1WHVA 4QWBA 4KH0B 3TJAA 1JLGB 5AZJB 3OYNA 4GY2B 4NLSA 1OH6A 3PW7A 4RO0A 1UVJA 5C7PA 2XYGB 4ZPVR 1H7XA 3MCNA 3PIPL 2WBNA 3I96A 1EWRA 3TJ8A 1T95A 4YR3A 3AODA 3HT0A 1S6PA 4NOHA 2YQ0A 4DS5A 3CQXA 2PAVA 2NR0A 2XY5A 2I1RA 4RW6A 1NU0A 2VG5A 3RZAA 3UVJA 3THYB 1B70B 4LFAJ 2DGTA 1GLDG 2MB0B 3M8PB 3LP1B 4TYAA 1BLUA 1CJTB 3K5NA 2MYFA 4AFFA 2CDRB 4M5LA 5AQLA 3H4DA 2WSEC 1FCAA 2F9TA 4NLCA 4NLUA 1RAAB 1CZ9A 3PR4A 2D74B 2DNNA 3OVSA 3NMAA 1Y5IB 1YDLA 4G1QA 4KYZA 3CD6N 4I67A 2E5HA 1FE0A 1VIXA 1N34J 1RAJA 3BF3A 1LWFA 2QSWA 5LMUF 3VEWA 3MMBB 2HNDB 3IRXB 2W8KA 4DL2A 3EPGA 4WPAA 4CZJA 4L73A 2CJQA 1S6PB 2ASOA 2R8GA 2EC0A 5K20B 2OPRB 1GTHA 3GSIA 2Y8YA 2X7IA 4J8FA 3DM2A 3MMAB 5D0RA 2JWLA 5F0UA 1IKYA 2FBTA 4A4JA 3OTDA 2HHWA 3CJ5A 5H1SQ 1RQ0A 3NE6A 2RIJA 2QZ8A 1J2VA 3GYNA 4FXDA 3CCZA 3JQKA 2GJIA 1VK3A 4ZA1A 2HBJA 3VEXA 1S1XA 2XMUA 4B1VA 1FXXA 1TFYA 1TGOA 1RWXB 4CJ3A 1H2VZ 2FC0A 3UCZP 4ILLA 4M3UA 3T1YJ 5GAHP 4ZJOA 3QNWB 1W2IA 4X4UA 3N9UC 3M6VA 4CIOA 3PR5B 1ZAWA 5DMRA 1KOHA 1T03A 4DI6A 3RAMA 2YNGA 2D3ZA 2HHHF 2W1BA 1RAFB 3CDAA 1TR0A 3UO0A 3MM9A 1RA7A 2C1EB 2DH7A 5IQ6A 2HK2A 4DR2F 4MLHA 1NGGA 4RBVA 5EX3A 3TTDA 1F9EB 2A1RA 2PC6A 1QE1B 2XMVA 2RHKA 2VG7B 1DTTB 5HMXA 4CYUB 3OD2A 1N5SA 1OS5A 2J9CA 4X62F 1L3VA 2D0PA 4QIGA 4TU8A 1YTYA 3FLCO 1KQSM 3K57A 1HHSA 4CGJA 2GHVC 2ZKTA 1VQ8N 3D0HE 3DI6A 1T9WA 4QYZK 1Q7LB 2CVEA 5C12A 1Y5NB 3ISNC 4KHNA 4OJRA 3VWSA 5E7OB 3KWGA 3ZZRA 2K2PA 1BXNA 4DU1A 3D3CJ 3VGMA 5EDWA 2CFXA 1HBOB 1LNQA 1SKSA 2L08A 1YHQS 1VYAA 3NGTA 2HNZA 4RW4B 2AJFE 3M8SA 2RDDA 4CGFA 3ZTRA 2FHOB 3EKSA 3I8DA 2BA9A 3MM9B 5JVHL 4MIBA 3J81j 1NPPA 3O08A 4ED7A 1RAGB 4CF1A 3NHGA 3TTCA 3DLKB 4LR7A 4FBUA 2OA8A 4IOXA 1QUPA 2B9YA 2E5LF 3IN5A 2MKHA 3UD3P 2N3OA 4HT5A 5AFUH 2G9OA 3G8TA 3UR0A 4O3SA 2CPJA 1IBMJ 3VAIA 1M5OC 4FNIA 1HQEA 2Q1LA 5HRPA 1GLAG 2ZJPQ 1B9DA 5BR9A 3NCIA 4UY8O 5FDLB 2ITGA 4K59A 4OYMA 5HO4A 2WVFA 2C2OB 3T7ZA 3NFAA 3N4WA 2AV5A 3H90A 2VFUA 1ESVA 4C8NA 2VG6A 4LVNP 3ITHB 4IOAQ 3PX6A 2A3JA 4CO1A 4DR4F 4DPUA 3D2FB 2V8HA 2O4IA 4PWWA 4BR4A 4USMA 2QFIA 1VSFA 4DR5K 4R5PB 1KFDA 5ITHA 1VS3A 1D8ZA 1EO1A 4JI2K 2ASJA 1AROP 3P39A 4FOIA 1F3FA 4LF6J 4I0WA 1D9AA 4DSIA 3HHDA 2B5JA 3O1WA 3IAYA 3BO4A 2DIUA 3QIPA 4ED3A 4IDKB 2OPQB 3LDLA 2ZWOA 3QSIA 4QIWD 2PEBA 1V4TA 2FC9A 4MAKA 2GWJA 1P9YA 3O4NA 4FJNA 1AZSA 3GU0A 3GIMA 2MLZA 3PTWA 2W01A 5LMNK 4IZ9A 3CCJN 1Q86T 5G0RA 1RACB 4URQU 4XH1A 2VPWB 4DFMA 1XUPO 3T5KA 3EE3A 2UUBK 4K4YA 4NLWA 4DFKA 5AQMA 4M1KA 2GIRA 1C0UA 3WEEA 3IWLA 3U7JA 1VSMA 3R8YA 1SAZA 4JB8B 4FW1A 3CCVS 5GVQA 2HIYA 2BZ2A 1N32J 4FP9A 1WC3A 3SLCA 4CIGA 2HVZA 4N56A 5A6PA 5EX0A 4ZMMA 4K0KJ 2R8HA 2C28A 4M5KA 4RWTA 4RX6A 3IKMA 1PYTA 3MN6A 1DQ8A 1GMUA 5GADI 2MJNA 4AHRA 1R0AA 3UKRB 3MM7A 4KH6A 3PJWA 2ROGA 3OT9A 1YT3A 1NK6A 2IHR1 5FPDA 1WDDA 4KGZB 1TV6A 2P9IA 1VDHA 5IXUA 1PO6A 2FYXA 4DCHA 4JKEA 5KG6A 1PC5A 3SAFA 3E9PA 2XSJA 1QTNB 4C3KA 2NUUG 2OFHX 3JYTB 3FC9A 4FYYB 3A4TA 3JSMB 2ITMA 2BUNA 2Z1JA 2FHJD 2MTLA 4R8UB 3FEZA 3OYKA 1S1XB 2ASLA 2AQ4A 1RT1B 3OJSA 3VGVA 2KM8B 4M5DB 1SXLA 4NXMJ 2YWHA 4F67A 4DU7A 4HH0A 1WEXA 1NGDA 2Y3YA 4LD0A 2L9DA 4PL8A 4F4ZA 2HF4A 3R5JB 3EY1A 1Q82O 4NEZA 3AB2B 2RHQB 5L46A 5KT3A 3LDOA 1FJGF 1Q7YT 1HNWK 1X1PA 3LPEA 4EHTA 1KFSA 1KNZA 2G8IA 2R7WA 3WDOA 2FQQB 3U1LA 4F3TA 4K8ZA 2FVCA 1GMVA 4MDBA 1VSLA 4XTTA 4CF2A 1QDUB 1BHNA 1T94A 1BG3A 3FEYB 2CGLA 2JDJA 4D3HA 3C0BA 2DO0A 3TAPA 2PE8A 5AQPA 4Z4EA 3M9MB 5AE3A 4IYQA 2VFSA 2M8DB 2LU1A 2QV6A 3G82A 3KG0A 2ZZTA 1M1GA 3M6GA 2OGUA 2GGPB 3PDNA 4G1PA 4O55A 4M5MA 3KHHA 2IBKA 1KEKA 1UETA 3LZIA 3VAHA 1IVZA 1WUAA 2BR0A 3MCPA 5KQ8A 1KLMB 4AYBD 3TAQA 3Q8VA 3RSEB 3RBZA 1K0TA 3RB6A 3PHTA 1YZ6A 1GMWA 2KW4A 4B3SJ 4A8XA 4WFBQ 3BQ0A 3SMZA 3IR7B 3HX9A 1ASWA 1U1QA 3RBDA 4YOVA 1IM6A 1S9GB 2N7CA 3O4QA 1CJUA 5MLCQ 2XTJP 4U96A 4H5WA 4OZ2A 5BPNA 1NJZA 1WWHA 4E89A 3O3HA 5DQHA 1VRTB 1SH2A 1U1RA 1QQOA 3QEPA 2PA8D 4Y0WA 3AVFA 2FIUA 2EVZA 4DSFA 4TY9A 2QXFA 2RN2A 1C0MA 4FK0A 3H5XA 5BREA 2DT9A 1WSIA 4Q8FA 1IBLK 4IO9Q 3THYA 2H9ZA 3GYXB 3MPUB 5DQIA 4KH4A 4NX9A 1QUVA 4RNHA 4ZN3A 1WNEA 4FM0A 4IJNA 4X62J 2W2NP 1XN9A 3HVWA 2KU7A 5DZ7A 1VQ6S 4KHQA 4RBTA 4CDIA 2ACMA 4ZCIA 1SUQA 2JL9A 2RPIA 3GOIA 2XO7A 5E33A 4IOBA 5ETSA 3LL3A 2MZTA 4HT7A 2IM0A 2FJWA 1EB0A 4F4XA 4U9RA 1EKSA 3BH7B 2ROEA 1GQEA 3MN9A 1UOCA 2YXLA 4LF4J 3PW2A 1VQKS 2WB4A 3VQPA 1GT8A 3MPDA 5KFMA 3O80A 3OVAA 2GQCA 1WC1A 2B6AA 2V9WA 2ZNZA 2R2RA 2QT7A 3R3LA 3A0IX 3U6FA 5HSPA 4M5GA 2VYPA 2YCHA 4M3TA 3R97A 1E4FT 2HQGA 1YKWA 2W41A 1TKZB 4GKKJ 4K5SA 5ETQA 4DR6F 3UD5A 3VENA 1FWKA 1OSCA 4NZ7A 3VGUA 2VUGA 1ZETA 3PEHA 1VQ9S 2KT3A 2VA2A 2WAQD 4NA2A 3QJLA 1ITGA 5KFFA 1CSJA 2G2OA 2LXIA 2XCAA 2V7ZA 1NK4A 2YX6A 4CJQA 3W61A 1GLEG 4DTMA 5JS1A 1XNQF 1YJ9S 3H3OB 5AQYA 3DMJB 1M1KO 1T11A 2XHBA 3HHEA 4FWSA 3V9WA 2ZVSA 3VZIA 1YITS 4WE1B 4K41A 2C42A 3ZSXA 2IRXA 2E1YA 5KFCA 3TAMA 2ALZA 1YRUA 1HYSB 1G99A 2AU0A 4KE5A 1IWAA 3GMGA 3QT5A 2O8FA 2CJKA 3WQUA 3PXGa 1C0UB 5ETOA 1HQ2A 3IMQJ 4JI0K 2YKPA 2AWZA 4B3RK 4FZVA 2IVNA 4FLVA 3MMVA 4B1WB 4AHTA 2J6UA 2GHPA 2IMWP 3ZNUA 1MN9A 3IM8A 3GFZA 2G8KA 2UVRA 4FJKA 5E3RA 4DV5K 5JUMA 3CO9A 2CAJA 2DK2A 4CZHA 2HQCA 4L76A 2UUBJ 1X5TA 4HUFA 1HD1A 2NZ4A 2GWKA 1O51A 3CPWR 3GYGA 3KLHB 2E5GA 3ENBA 2BANB 3GFXA 5L9NA 4PYAA 3O44A 4DUZK 2MGZA 5A8WA 2RD5C 3OXGA 3M2RB 1QHTA 4U8YA 1M5PC 3Q23A 4FBTA 2JC0A 1V5IB 4PXDA 2ACYA 4FJ8A 2J7UA 2KM8C 2DHGA 4M7YA 2DHXA 4F04B 1UCNA 1BQNA 3FDSA 2M70A 4IKFA 2HIQA 1LOUA 3NMUA 3NGSA 2ZC4A 3V81A 4AM7A 4R8UA 4B3MK 1HHQA 1M90T 1VQNS 3W7BA 1C1CA 2DHHA 2OEJA 4A59A 3FBBA 1TK5A 1U2FA 3FZLA 1EETA 2X3GA 1YBUA 2H65B 2NXJA 1HBNA 3KWMA 3RMAA 4JK8A 4FZZA 4CTAB 4RJVA 5AQGA 1C1AA 4YOYA 2VFTA 5HRRA 3EN9A 1CC8A 2GVZB 3UDVA 5KGXA 1D4XA 1VQSA 4MK7A 4H0PA 2YKNB 2RDIA 3OYLA 4U8VA 2UU9J 2KXFA 1GNKA 4DR3F 1W7AA 2RQ4A 3GV8B 3CW2C 1NJYA 3H98A 3NF9A 4ZIVA 4PG8A 5KFUA 3RWUA 3G4SN 1R27B 4CGDA 4YP3A 4R0JA 3VA3A 1RISA 3CC2S 4DHVA 2HAFA 1TK8A 1YAGA 2GJ2A 3A8KA 3SQ0A 2FLLA 1W9HA 4X65F 5RUBA 3CCTA 2CZ9A 3A5LC 2HYIB 1EP4A 1D5AA 1ASVA 4ES1A 1AYEA 1KTVA 4TU7A 5AQUA 1RAIB 2VOOA 4O44B 1CQMA 4I69A 3SI6A 4TVAB 1Q0NA 4OYBA 3S01A 2C2RA 3MMCB 4FSVA 4BRIA 4AHSA 2A2CA 4H4MB 2PSZA 5HP1B 3DLEA 3ENVA 3CSKA 4DLGA 3OL6A 4M63A 1WOOA 1J27A 2E2QA 1FWPA 4M3RA 1XMOF 3Q24A 3QT7A 3P3DA 4WCEL 4CESA 4JYAF 4P7VA 4OGCA 4AHCA 3HFKA 3PRBA 5KRSA 2F7VA 2PFDA 2LFVA 4CEAA 2KN4A 4ECTA 3G71S 2N82B 2B6AB 3M6XA 3R8EA 1NDKA 2ADBA 2CWXA 1C4AA 2AEJA 2IVOA 3LGMA 4X84A 1URNA 3EICA 1PSDA 4GMJB 1YI2S 1HNIB 1FKPB 4OI3A 5LMNJ 1VRTA 2ZM6K 4BDYA 4ZVTB 3HJFA 1PJ7A 3VN5A 4ZITA 3OW2R 2EK1A 2EW9A 4W90B 5I42A 1TQLA 5FRNA 3EL2A 1B0PA 1FWLA 3EPIA 1Y97A 1TMMA 4WF9L 5HBMA 4ZVHA 3T41A 3AVMA 2DY9A 1RTJB 5CAAA 2AZ1A 2VDIA 3WZ0A 4AQYK 1VIOA 3A1YG 2Z1GA 1RWKB 3DN9A 1XNQJ 4JI6K 2ALYB 1R89A 4Q8EA 2HMIA 1A0OB 4WP8A 1VQNN 4PG6A 3VQ7A 4ZP7A 3PRDA 3FKBA 3CJ0A 4FPIA 1SQKA 3RAXA 1CBKA 1HR0K 3T1HJ 2IJNA 2K06A 3GLJA 4HUGA 3K89A 3DMJA 3LALA 1G2EA 1FW6A 3KYLA 2W9BA 4O5FA 1U6ZA 3NMRA 3SPZA 2LSNA 5CR4A 1AXQA 1S9GA 1K73O 3IC1A 2RSQA 4ED5A 2NXCA 4NYFA 4OJGA 3JSYA 5KFWA 3R1HA 3CM6A 1S9EA 1FO1A 1HBMA 1ZA2B 2C2MB 3WQPA 5A2QO 1S5ZA 1KAZA 3NCRA 3QZ7A 4ELTA 4QCLA 1UTAA 3MMAA 4OKEA 3D6TB 3OXFA 2J8AA 2JLGA 4WZMA 3US5A 4RU2A 1HL6A 5BJRA 4OI4A 4QU7A 2V94A 4C11B 1NOYA 1JLBA 2WSFC 3SIPB 3M6WA 5AQZA 2B0GA 5JXSA 2XYHB 5K8NA 1Y11A 4DTPA 5EWGA 2VFRA 1VC6A 2MQ8A 1Q1KA 1TL7B 4JYAK 3CCMN 2CH5A 3GSDA 3TJ9A 4DV1K 5A8KA 4DU3A 1FK9A 3NGUA 3BN4A 2PN6A 3B78A 2VB6A 4KRFA 5DG7A 5LSLA 4E1JA 1WAJA 1ACMB 2YWWA 4LT6A 3O3FA 3ENHA 2UUAJ 5IT9U 1N5YB 1LWCA 4NLGA 1CC7A 4JRQA 4J9PA 4M5JA 5AQOA 5AQTA 2RKIB 3CD0A 4HTIA 4MH8A 5AQIA 1RHQB 2CQCA 3U27A 4L3QA 3LPUA 2ASYA 1OPIA 3HPGA 8RUCA 4FF1A 2CG8A 4CEQA 4FO0A 4ZPDA 3NNCA 3NOGA 4KB0A 4HTLA 1C0FA 2FSNA 3HKWA 1ZZNA 4PKHA 4K4ZA 2GAHC 4NLVA 3VQTA 2XB2D 6FDRA 4YS2A 4ZN1A 2XS2A 1GOAA 5KTQA 2ZITA 4TNOA 1A6LA 5C2CA 4AHUA 1VQLS 3AQOA 2D0CA 4DX5A 3H2LA 2R7QA 2UUCJ 2ZOMA 1HNWJ 1T7PA 3H7HB 3FQKA 2CPZA 3TUIC 1NSKL 2CJYB 2QWPA 1LFPA 3D6RA 4M3XA 4YHHF 3ZX0A 3CF5L 3EXCX 3UN3A 2VKRA 3DLHA 4WZQA 3TAEA 5ETKA 1RDRA 2C22A 3LUYA 2FLOA 1SQGA 3V6DA 4OJ1A 1VSJA 3RG6A 5CZ2A 3DI6B 4BROA 3N79A 4DUYF 3V1RA 3FCWA 2AJ4A 2ZM6J 5LOQA 3EDQB 3THWA 3CJ8A 2W8LA 1VQ5N 4NCGA 1DQAA 2V4JB 3R27A 4LFBJ 5KFNA 4DQIA 2O8FB 8AT1B 3IAS9 1VBXA 4KB7A 4OYIA 1S48A 2B43A 3C14B 3DM2B 5DDRC 3DHWC 1U0HB 5KPTA 4P2SA 1JJ2R 1I51B 1N5YA 4FKXA 2CJBA 3ZZTA 4X4TA 3OYDA 2VKZG 2R8JA 2LA6A 3TA2A 3L2UA 3BB5A 5M2RA 4EO6A 2OEMA 1DBDA 5K14A 1IG9A 1T0TV 3CDBA 4QS8A 2E20A 3M1FA 4BC7A 3UNYA 5H9FJ 4FPBA 2QK9A 1S1WB 1VQ4S 2PYLA 5KFTA 5FPMA 3ILJA 1FJGK 2RDJA 3MM5B 2CQDA 3EUNA 4E3SA 2XHWA 3AVKA 3Q86A 1SJRA 3RBEA 2C2KB 5BR8K 2KZMA 2YH1A 2QFJA 4C0HA 3LM9A 3LO3A 3D66A 3ZT0A 4E1NA 5IM0B 2R7XA 4OZ5A 3V81B 1WBBA 4WBFA 4LF8K 3BV8A 4NLRA 4WTYA 1FKOB 2VU5A 3H1QA 1RWVB 2RQKA 3G0ZA 2FJXA 2JHEA 1V3RA 3IMXA 4JV2A 3CQ8A 4KKOB 2M7SA 4WFAQ 5KPRA 3DGVA 3CJCA 5DM7L 3PJ9A 3HHLD 1SVDA 1IBMK 1WC0A 4ECYA 3SFUA 2R2UA 2DJWA 3OR2A 4W5QA 2UXCK 4YB7A 1N0VC 5H9EK 4JI3K 2DGUA 1LKZA 4EI2A 1EXQA 5F8JA 2ILYA 2QRRA 4FLUA 3SUNA 3CJKA 4I6AA 1CZAN 3DU6A 3MX5A 3RR8A 4BVPA 2LU2A 3JTPA 1I39A 2K1RA 4FZYA 4F4YA 4XPCA 3ULEA 2EI5A 2QA4G 2Z2YB 3ZCMA 1SI9A 4WK1A 1P6TA 5IWAK 3VHQA 2EFOA 4DN0A 2P9SB 4USTA 3JSRA 4DV2K 1VQPN 3UKUA 4A5BA 3O9QA 2BJ9A 4HVJA 2JLEA 1EKRA 2ZH4A 1XMQK 4FKYA 3CC2N 4I7FA 1XWLA 4JI7K 5KFSA 1U1OA 5FRMA 2HK3A 2EWHA 4OI0A 4KH5A 2FBYA 3PW5A 1SJ1A 5D15A 4ZVPB 1VQ9N 4S0MA 3QIPB 4NLOA 1NGCA 1YIJS 5CH7B 3NF8A 4KI4A 2Q1NA 4IEIA 4CO0A 3D0PA 1KXPA 3TQ1A 4J2DA 1IH7A 1A5WA 4IH6A 2AYBA 1GLFO 4PUOB 1U4BA 3MR6A 1Q4RA 4ZPWR 2P9EA 1M5SA 5GIPA 3CCMS 2P1JA 3HT3A 4PQAA 5MAOA 3SSQA 3H0PA 2X74A 1VHXA 2W4CA 1NJIO 1TU0B 2QMWA 2QG9B 3KK7A 4MT1A 1VSKA 3KJNB 4W98A 4P6QA 2QA4S 3FR0A 5BPLA 3C6AA 1HJRA 2GGPA 5BR8F 4B9SA 5GADP 3FZFA 3VQ4A 1IKVA 3BO3A 2I38A 5A8KB 4HDHA 2JWNA 2F1FA 1QM9A 4IRDA 3OYHA 5J2QB 3QWPA 2KZZA 3ALYA 3QIDA 2JJ4D 1RKIA 2WVEA 1B64A 4B1XB 4URSA 3V4IB 5B0BA 3W9IA 4Z4GA 4FF2A 4QPXA 1K9MO 1QQNA 4CZKA 2VQFJ 1MN7A 1MMNA 3DLGB 4QR1A 4WU2A 3F44A 1Q78A 1FKOA 7AT1B 2MJUA 2IIHA 2PGCA 4CECA 3M9NB 4GMKA 3BGFA 4F3MA 2NPIA 4LR9A 4YOEA 2AMCB 5BN9A 1B3TA 1JLGA 4GKJF 3DU5A 4DF4A 2DXDA 3BKFA 2P9NB 1HIYA 5KFDA 3LGNA 5FDLA 1XMOK 3SCXA 2GA7A 3RW6A 2OTJN 2FJEB 2NUHA 4CJRA 1JKHB 2P8IA 4OI2A 4URGA 2XY6A 4ECZA 2DITA 1HBNB 1VRUA 2CNLB 2GW8A 3WBZA 4IG0A 1X4DA 2Y0BB 4WXOA 4W92B 1WSHA 2JOQA 4C0OC 3MTJA 2W2OP 5KT5A 3AVLA 3KHGA 3W2VA 4DR5F 2V4RA 1JCGA 1Y7PA 3BF4A 3FK4A 2I5JB 4WIIA 1N4LA 3ZSOA 2NRRA 2WONB 1TAQA 4B3MF 3ULDA 1H98A 2GVDA 1UJ4A 1RT3B 4DV6J 2RUGA 2JVOA 3D6HB 3O3LA 4MKBA 2CH6A 4CF9A 2ZJPL 3GONA 4CZCA 4ER8A 4DTXA 5KFRA 5AJ3K 4EP4A 3NGRA 3PFOA 4X4SA 3HHNB 4L8RB 4JV5F 3HBTA 3MAAB 4RNFA 4TY8B 4Q2LA 2XY7A 2YX7A 3JB9k 3BH6B 2CUYA 2NZCA 3CCLN 4EU0A 4F26A 1JLAB 4AD6A 2W6LA 5IV3A 4CLPA 2VG7A 3DOKA 2Q79A 1NK8A 1VMBA 4FJGA 1R6VA 3AA3A 1S59A 3D9BA 4G9ZA 1ZXOA 4AT1B 1H73A 1OSDA 3CQYA 3KTQA 3K5OA 3WX8A 4ZCKA 5I3UA 4XIUA 1PYOB 3K0JA 4GVBA 4Y0FA 1XK8A 2IVMA 2GTDA 2FSJA 5FLXO 1LWXA 3HKZD 4YB5A 4WKYA 2MZSA 1SKUB 3ZT1A 4BRQA 3TYTA 4XO0A 4MK9A 3PIOL 1MW7A 5J2MB 4MYTA 2NYHA 3A3PB 5JVGQ 1R8AA 4J9OA 3DXSX 1XEZA 5KFJA 2QWMA 1M0SA 2J7WA 3PO4A 2LXFA 3SJHA 2WW4A 4PYDA 3SUPA 5KOWA 2E4LA 4CFBA 1FD2A 4B9NA 2UXDK 1PCAA 2ZH2A 3KK1B 3HRGA 1DURA 2M52A 4M7XA 2O66A 5LJWA 4ICLA 5T7BA 2VHGA 1REVA 1S49A 4MJKA 2QW9A 2MZQA 3HFVA 3KG1A 3IG1B 2W9AA 4BHQA 4Z4FA 1YBAA 2CPDA 2Y0SD 4ZVSB 2D1KA 3LP0A 4HACB 4I64A 1GMWD 2MDAA 1YGYA 4DR3J 4E7JA 3IA0A 2QWNA 2HHHK 3ADAC 2B7CB 4I6YA 2P2CB 5CE3A 5C24B 3TP2A 4CE9A 2IRUA 4GVEA 3FMBA 3PEJA 2MQLA 2OIHA 2PI5A 2HG4A 3SYZA 5DGAA 3MXMA 5LT5A 4PAAA 2JGUA 3LGHA 5D0HA 1RILA 4ELVA 4YN3B 3M05A 3H2UB 2RJZA 4L3NA 3V9UA 3I8BA 4AF1A 3M4XA 4L72B 3QLHB 1OVYA 2Z1HA 4JKDA 5BXIA 4DQQA 2FF6A 1JQGA 5CYMA 1VAZA 5AXLA 5CYMB 1N33K 3FZ2A 1VQKN 5F3TA 1BWFO 4OYZA 4EFHA 1CLQA 3BEXA 5T7LA 2Q6BA 2QMXA 5JICA 3UDEA 5D77A 2RRNA 2BE2A 4CLTA 1S9FA 3ZZYA 5IWAJ 3N28A 1VRQC 4K7QA 5E41A 1XQIA 1J9AA 1RWMB 3K2PA 1AA1B 1TELA 4O4GA 1GXLA 3IAM9 1ELOA 2BUPA 3CJTA 4FPAA 4FW2A 4ECSA 3BS9A 1SZ2A 3I87A 1DLOB 3VGSA 2KG1A 4ECXA 1BA0A 4O0JA 4YY3K 2ZJQL 4QPTA 3PW4A 4R5PA 1I94K 3OBIA 2QI2A 4BR9A 3I5CA 3CWJA 4RR5A 4F7VA 5C42A 1Y3KA 2DVIA 2DD8S 5KFKA 3R7BB 3JTOA 3MR7A 5IV4A 2FBXA 3IBCB 4JS4A 1MWMA 2ZH3A 4Y2MA 4F0HA 1IR0A 2AJ0A 3CMQA 4BRNA 2VC0A 3CETA 3AVAA 2B4PA 4W5OA 4DTSA 4FYWB 2KL8A 4LFAK 3TZYA 1RB0A 1HNWF 2O67A 1N36K 2IVYA 1TL7A 3W2WA 3G96A 4ELUA 1VQ7N 1NK0A 4IG3A 3CUNA 2B9XA 3OSNA 5EHHA 1KVIA 3HSGA 3GP9A 1FFSB 1HBUA 3CM5A 2OPRA 1QSSA 1Q16B 5BYSA 2OD4A 3HSCA 1XBWA 2FC8A 4KI6A 4DR7J 4PKDB 3KHRA 2WHOA 1RT6A 2UUAF 3J7YI 1NGIA 2NLXA 4E19A 2W6KA 4KHWA 3LA0A 3OPKA 4X4PA 2MQMA 4LRCA 2ZH5A 1T6DA 2QSFA 3W5XA 4DTUA 2BJ8A 1DZ5A 2DGWA 2HGMA 2BJ1A 4UOFA 1R8PA 4KT0C 2LEPA 1U25A 3AXMA 2NREA 3G71N 4PR6A 2RUSA 3M1VB 4FYXB 5A2QU 4GV9A 4OZNA 3OFGA 5CYQA 1T02A 1BWEA 3GFYA 2E66A 1P1LA 2Q3PA 3MPVA 3IRXA 1F60B 4ILMA 1BQNB 4RW6B 3MR3A 2VQEK 1HBMB 3LDNA 4EZ6A 3V4IA 3V5RA 5GAEU 4OHZA 4GC7A 2R8IA 1RAOA 5GAEI 3NF7A 1LOTB 3FFKB 4RWWA 2V4QA 2YNHA 3PSIA 4OZ3A 2MQNA 3CFOA 1DTQA 4QR2A 4JI4K 1KOOA 3PV8A 2Y1JA 5M1OA 4DV4J 1GAOA 3QGPA 1X31C 4A8WA 3THVA 2IJRA 3O1BA 4J9SA 5I9EB 2R42A 1NWKA 2JEIA 1E6VA 3Q2SC 1NHUA 5IQQA 3H45C 2EXUA 3GJRB 2H4YB 4HUEA 3I4HX 4BWMA 1U1KA 1HR0J 1UFKA 1RHKB 2P9NA 1RKJA 3EX7B 2B51A 3AA9A 4PA1A 2DIVA 2F8MA 2X1AA 3CCRS 2XMAA 3K58A 1OYEA 1RWNB 2PMWA 3HI0A 3S3OA 1JXBA 4JKGA 1QS4A 2JEJA 1GX5A 2HBMA 1S1UA 3CT9A 1N36F 5LMUJ 3KJQB 5G4DA 3L4IA 3VPZA 2FY8A 2H5EA 2M2BA 2NZTA 3H40A 2CG4A 3M8ZA 2PDAA 4ZPBA 3L95X 3M1VA 4DL7A 3I9V9 1IBKJ 3D1OA 2ATQA 4QQBA 3VAFA 1XHXA 2Z8QA 2ZEJA 4DR1J 1ZM3A 3BGRA 1UWAA 3MUVP 1S0VA 1HNXF 3CC4S 4J2AA 2IM3A 3ONQA 3L3CA 2YX4A 2HHTA 1K44A 3NAEA 2PEHA 2ZFHA 3DOMA 1NDLA 1BUPA 1VQYA 4CD1A 2DNRA 3VEOA 2IS3A 3L0QA 4HKQA 3CI5A 1UL3A 4QIVA 2KXNB 3QEXA 1XR7A 1WD6A 1K1SA 1RCXB 1NHKL 3C15B 2AA4A 3U9ZA 3SV4A 1RA6A 4NMXA 4QJVA 3HPHA 5HL7L 1S0OA 4C3MA 1EX4A 3CCES 1TVRB 2E1RA 3GIJA 3DYAA 3TANA 4L6V3 3DGPA 2E1PA 4HI1A 2XHCA 3RYLA 2MQQA 3DKDA 1SQFA 1CXQA 3K8VA 1T3VA 2CNKB 3AXKA 4RBUA 5CZXA 2YNIA 3EYZA 1VQPS 2O8DA 4YFUA 3W8GA 1LWEB 3L2VA 1KWMA 5EGYA 2M4MA 1N6QB 1HNVA 5AE1A 4W4MA 4CO2A 5C10A 4EK2A 4C2MA 4DQPA 1KD1O 1WB9A 2W7OA 4CJUA 1X9JA 3V1OA 1FX2A 2QTDA 2IYIA 4NXNJ 4AL5A 4B02A 3KKSA 2FB0A 4ZPCA 1IBMF 2V8VA 3QO9B 4IFVB 1S76D 4A61A 5JMVA 3U02A 1HYVA 4RWXA 1FD8A 1VI7A 1F0XA 1VQMS 4DV5F 3H8YA 4YDXA 3B6BA 2YH0A 5J2MA 3RJMB 4CTAA 1FRMA 3AT1B 3CDEA 2MZJA 1R0AB 4WFNQ 5AZJA 2V34A 4OYPA 2HQDA 1K0VA 5SZTA 1OY8A 4BRAA 4PXBA 1IBKK 4UW2A 4V19X 2GBZA 2Q0RA 5IWAF 2UV8G 3TUJC 3PYEA 3QATA 3HSTB 1V5VA 4RUCA 1HNVB 3I5AA 1D3WA 1URRA 4BG8A 3DXMA 4OQJA 1NB7A 5GAHU 4H0TB 5FLXU 3FCVA 2HZCA 2P9SA 1U1MA 1Q8LA 2FZKB 3HHLC 3BO2A 1KVBA 1KHVA 2I5JA 3IGNA 1ZTTA 1TL4A 1BGXT 3AQPA 3M2VA 5ETLA 3QGGA 3THXA 2EFPA 1MSWD 1WOSA 2H1YA 1LXJA 2RH3A 4DSLA 4ZVRB 5F1XA 3BR9A 3CJ1A 4GVLA 4PKGA 1NMDA 2KYXA 1JL1A 4JKAA 4M8LA 5C25A 1R8CA 4KR0B 1MNEA 1N32F 4LRDA 2GCFA 4BREA 1YJ7A 2QLFB 1CJVB 2JZ5A 1NKCA 3MD3A 4X66J 4C3LA 3BREA 5L1IA 3G87A 4LRFA 3R2DJ 3B6PA 1ZZFA 3H4BA 3G8SA 3G82B 3CC4N 3N4PA 5D3GA 3VZHA 1KQGB 3CFRA 4C0BA 5B0GA 4YMEA 2ZF5O 4C98A 1YVNA 1U2VA 4UQTA 3RAQA 2CPFA 1EJ7L 2N4CA 2HZAA 5AQWA 4LF9F 4O3OA 3J7YP 4H5VA 1NDCA 1ZBHA 4FJHA 4BR5A 5IOLA 3WXKA 4OX9J 4A8MP 5EN1A 1Q81T 2KJVA 3P4IA 3LW5C 3D7SB 4NYOA 3PIPQ 4MKAA 1FERA 4FLYA 1BD6A 3BUZB 4RW8B 3SDEA 4CZLA 3MN5A 1S9EB 2AP6A 3WNEA 3G6YA 1RT1A 3HULA 2BE9B 4LJMA 4YOTA 1HPZB 4N77A 4DJBA 1FDAA 4M63C 5E0OA 4TSXA 1S0NA 1UJ6A 4DV4K 2ROPA 4RUHA 3NXZA 2I7PA 1LWCB 1KC8O 3FFIB 4MYUA 3I0SA 3P38A 3IXQA 4JI2F 2GIFA 4DL3A 3G9CA 2DTJA 2B56A 3G10A 4QOTA 1RT4A 4QWEA 4U7CA 3L9ZA 4X4OA 2VOPA 4B8AB 1HQEB 4B9VA 5DDOC 1S7IA 2CQ0A 1F9FA 3VF2A 5J2NA 4CJEA 4CJVA 4HHTA 4OYAA 3JXUA 4WXWA 5SWMA 2J6TA 3AJ2A 4XAKA 1S1TA 4WF9Q 2PD1A 3OYBA 4JI5F 4JD2A 2V2ZA 1N36J 4CVNE 1UEUA 2A42A 1M5KC 2QA1A 5J1EA 4UOCA 4W5RA 4I6MA 1U1PA 3NP5A 3C66A 2M88A 1NU4A 1Q18A 5KFPA 1YIJN 2QX0A 4ISGA 3NAIA 3N0VA 1H2UX 3F9KA 2CQ2A 3Q7CA 4P74A 4IQMA 2F4VK 1M90O 1BISA 4OHXA 1IKWB 3ZO7A 3J80Y 1HR0F 2E6MA 1L3TA 3VMFB 3KG4A 2VJUA 4B8CA 2CQHA 1RTHA 1S1VB 4C7QA 4FXWA 2DR5A 3HCXA 1RABB 3MR5A 2V52B 4DS4A 3P8BB 1J5EJ 3DDIA 1NKEA 1WJ9A 4A2BA 2HURA 4K4VA 4O3RA 5HQ8A 3ETMA 2NCKL 5AQXA 4ID5B 2AYEA 3CCWA 1SL0A 2XYPB 3KKFA 1EIYB 1IJJA 3FSXA 2RRAA 5B0EA 1RDAA 4YB1P 4U67L 5ADXA 2EKYA 4FVMA 3GE1A 2MKKA 3QAUA 1N48A 3P5JA 2A1SA 1IJFB 4J2BA 4Z37A 3C15A 4ZJQA 5LXYA 4DFJA 1J5EK 4LFAF 2D5RA 3F56A 4DUYK 2FJVA 1S10A 1I1GA 5LSRA 3H25A 1R59O 2NUBA 4DV7F 3HVTB 2R8KA 4FM2A 4LSNB 4NPOA 4IXCA 1CZBA 4I4BA 5DJBA 1J5EF 2OPQA 3AVIA 3OUYA 4JD2B 4DCOB 4F0MA 2VIHA 1NH8A 4KSEB 3CXCR 1P90A 1BI4A 1L5UA 3AV9A 5SUHA 5MLCV 3QBWA 4WFNL 2K3IA 2VBYA 3CJ9A 4JRPA 1MROB 1RTDA 4A62A 3RB0A 2D0OA 3KIOA 2ZDOA 1HNZK 1I3AA 3CCUS 3DLKA 2HNYB 4JV1A 4P2MA 3IGVA 5E3CA 4JEPA 4KFBA 4KBOA 2YPZA 4NYPA 3R7SB 4ICLB 1FRIA 1SC6A 5JVHQ 3SK3A 2NRHA 4TYBA 2NNWA 3MEEA 4Y3CA 2FY1A 1SJFA 3WHIA 4BQLA 1KQKA 3RMDA 2RRBA 2KTQA 4M5DA 4CLZA 2H4WB 4DR4J 4K50A 1Q5VA 4NL5A 2I2YA 1OO0B 2C3PA 4U67Q 2OPSB 4Y65A 1SJ4P 3RUBL 1EP4B 1Y5LB 1WORA 2G2ZA 3LP3A 4ZP8A 2J7KA 4PUOA 3V6KA 5IT4A 1IWGA 4ID5A 4ECQA 1QZ5A 2BANA 2E9ZA 3I55N 4OJ3A 3QQCD 1WLJA 1D9FA 3V2UC 2MMYA 1Y4ZB 1S4FA 3BKUA 1YJWN 1D1UA 4DQRA 3OTOJ 4MIWA 4YHHK 3HYFA 3DRRA 3HP9A 4Y1DA 5KFGA 1CULB 4J7CA 1ZM2A 3GJTB 1VSDA 2DXFA 1NGFA 4EIAA 1SUQB 2CJXB 3HM9A 5ETNA 1N5QA 5ETRA 1KP6A 3H2VE 3LPYA 1LW2A 3WXJA 5CHIA 3AO5A 4DN9A 3TI0A 4JI3F 4HHHA 1UVNA 4KY3A 3J7AN 2V63A 1NGAA 1KVJA 2DNQA 1S22A 1KQSR 5DRKA 5F8IA 4NCAA 1REGX 3C65A 1KLMA 2NRZA 4LRBA 2NPFA 1FKPA 1F5CA 3WX4A 3K8WA 3QJPA 3THXB 4BR2A 2QMUB 1O0PA 4DWIA 1KBRA 3CJAA 2H54B 1QAIA 4IO8A 1CLFA 2MPUA 4V19J 3MM5A 2J0XA 2L9WA 3QO9A 4IFVA 1J6ZA 3NGYA 4X66F 4JI1K 2JEFA 2YHBA 4FJ7A 4DTOA 3THPA 5IZHA 4ZPAA 3JAMO 1XR6A 5JMNA 3CD7A 2CQ4A 2VQEJ 2GVDB 4GRSA 4CM0A 3VOVA 3K9JA 3V9SA 2V0NA 3MECA 5BYQA 3DFEA 2GC8A 4YR0A 3MWBA 1C6VA 4DHYA 3HOSA 4DR7F 1HW8A 3M8WA 4YR2A 2XS7A 1LFWA 1T6CA 1QTMA 1N6QA 2QL5B 3VQDA 1YJ9N 5CCMA 3OYFA 3CPWM 1KR4A 4F3OA 1J54A 3UE5A 3A3NB 3Q8PB 4HTUA 4N8OA 1S72S 2J0WA 4WQ5C 4TU9A 3VA0A 5A0YA 4LF6F 4KREA 2CXEA 3OJUA 2EK6A 1R6YA 2JRSA 2Q43A 3BQ2A 2Q31A 7FD1A 3PZPA 2HHVA 1CJTA 4LF8F 2KFNA 1LEOA 2KLAA 5ETPA 3CJ7A 4EBCA 3UDCA 1Q79A 2XQCA 4M3WA 1JLFA 1IN0A 4A46A 2COLA 3FVYA