5CYQA

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
548
structure length
548
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 154
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cyqA05
4HUEA 3PY8A 1NJXA 1U48A 5HRPA 2JLEA 3QZ8A 2FLNA 4K4VA 1D0EA 1W25A 2YHBA 3C6TB 1W0HA 4RUAA 1J9AA 4NRUA 3MEDA 1QSLA 4DFKA 3V9UA 3ZT0A 1S6PA 5L1LA 1WSFA 5K14B 4EP5A 4ED1A 3L8BA 2D3UA 2DFFA 3JYTB 3EYZA 2OPPB 3KJVA 1T03A 1RILA 3AVBA 3OYIA 2KZZA 1TKZA 2FBTA 2XHBA 5KFIA 1K1QA 1HMVA 2FVSA 2UVRA 5FDLB 2HAIA 1SV5A 4DL3A 4CEFA 3QERA 2WB4A 1GX6A 4M3XA 4DFMA 3ITHA 2E9ZA 4I2PB 5J2PB 2B4JA 4U7CA 4O3OA 3QESA 5KFZA 3KLGB 2HWIA 4B9VA 3VQ8A 3DRRB 4Z4GA 3TR8A 1JLEA 2C2RA 4E89A 3PUFA 3IS9B 3TAGA 3SUPA 2IBKA 4B3OA 3VQEA 3NKYA 4ZP9A 2DFEA 3OLAA 1DLOB 2VG6A 3AA4A 4JRPA 4DF8A 3QIPA 3DI6A 2I5JA 4BWJA 4IG0A 5I42A 4CFCA 3DMJA 3HT3A 3CDUA 1U45A 2FJVA 4KB1A 4PUOB 4K50A 3PW4A 5KFLA 3CVKA 3DLGB 2B5JA 1B92A 4KSEB 5DG9A 4W5NA 1JLAA 5T14A 2WOMB 4FZXC 3HVRA 4CHYA 1N6QB 4EO8A 1S4FA 1HYVA 1RT5A 4MK8A 1JLQA 3KLIB 3OYJA 3RAQA 4EP4A 2BR0A 4DLGA 2IAJA 2KTQA 5I3UB 4Y1DA 1VSIA 3GQCA 3FDSA 2FLLA 4DTXA 4WYLA 1EETA 5CYQA 1TV6B 2G8VA 5CYMA 3LP2B 2GUIA 3DOLA 5J1EB 1VSKA 2D0BA 4KI6A 3PW5A 2YNHA 1S6QA 1LWFB 2O5DA 2HNYA 4RW6A 3OSPA 2P51A 4FJIA 2XCPA 4OPKA 4ED0A 4W5RA 3PO5A 2PY5A 5KG5A 4RNFA 2VA3A 1S1WA 3BREA 4MIBA 4J2EA 4FJJA 3OYBA 3PX0A 4KKOA 4NLGA 3MR3A 3O4QA 2IGIA 3PW7A 3KD5E 2B43A 5KFNA 5KFKA 3H40A 2IJFA 3V1RA 4PY5A 4CJRA 2P5OA 5JXSA 1RDAA 2VWJA 1F21A 4W5TA 3C6UA 3DM2A 4AHSA 4IDKB 4YR0A 3QEXA 3DLBA 1KSPA 1TK0A 2W9BB 3G86A 3DLRA 4ZVHA 4ZHRB 5C42A 4NYZA 3KLHB 3TQ1A 2FC0A 5F8HA 4MKAA 3L2UA 3SJJA 4NZ0A 3TABA 2Z1JA 1HNVA 2R2TA 4CJWA 4CE9A 4G1QB 2AGOA 2R8JA 5C25B 3KIOA 2UVVA 1TGOA 1S1TB 2ASDA 4H4OA 4GC7A 4TYBA 1VSDA 3G6YA 1S9FA 3PJWA 1NK8A 2AX1A 1T94A 5HBMB 4I2QA 5SWMA 3S3OA 1L3SA 2G8WA 1JLCA 3KTQA 4O3QA 5KGXA 1IKYB 1NK0A 4CHZA 1LW0B 4UQGA 4IBNA 4CHNA 3V1OA 3SCXA 3EY1A 4M95A 3I0RB 1ZTWA 3K5NA 3V81A 2YKMB 1CZBA 4J9NA 4NCBA 1C1CB 3CWJA 3OHBA 2AGQA 4CJUA 1HRHA 1VK0A 4Q0BA 2OPPA 4BDPA 2E6LA 4AHVA 2IDOA 4OL8A 5HRRA 3SFGA 3LZJA 1DTQA 3F9KA 1TKXA 4I7FB 3OVNA 4RNNA 1TKTA 4I2PA 2YNFA 1KTQA 2XY8A 4NCAA 1QHTA 3NGDA 2BRLA 2HHUA 4KBIA 2V4RA 4ZTJA 4E1MA 1NHUA 2HW3A 2FBVA 1S9GB 1FK9B 2Z1HA 4FVMA 1TKDA 1RTIB 4FCYA 3IN5A 1QSSA 1BQNB 3ZSXA 2BE2B 3VQPA 1T8EA 3RB3A 2C2EA 3MAQA 4CEBA 4QWDA 3D5MA 4BDZA 4IKFA 1DLOA 4R8UA 1S49A 4EO6A 3PX6A 1TK8A 1X9SA 4FLTA 3OS0A 3M9OB 4CFAA 1HJRA 3MXIA 1XR7A 3BSOA 1SL1A 4FS1A 3KD1E 4PUOA 5DQGA 4ECRA 2BQ3A 1L5UA 5EU7A 1KRPA 4CIGA 4BE2A 1S1VA 4DMNA 1QQCA 4DL5A 1L3VA 4F50A 1U04A 2OPSB 2HVIA 1DTTA 4NYFA 3K2PA 1FKOB 3T5HA 2WOMA 1RNHA 3BR9A 3VQBA 1Q8IA 1N6QA 4YQWA 4M41A 2HVHA 3H4BA 2DTUA 4KFBA 1NJZA 2F96A 1KLMB 1WSHA 3LDSA 4NLDA 2F8EX 4FJKA 3KLIA 2ATLA 1VSJA 1RT3A 1WNSA 3CG7A 3AVKA 2QKKA 4NLWA 3HP6A 1S9EA 2E4LA 3K5OA 4EZ9A 1RT4B 3NL0A 3QGIA 4B8AB 4TQRA 4CGJA 4CJSA 4E7LA 4O44A 3MFHA 3OJSA 2HHQA 3TAFA 3VQSA 5J1EA 3KKSA 4IH7A 4FW1A 1LWFA 2XI3A 5FRMA 1NK9A 1J53A 4IH6A 3OL7A 4E7JA 1NK6A 4TLRA 4EEYA 1ZTTA 4CESA 1SUQB 3DLKB 1VRTB 1A5XA 4DTRA 2XGPA 2OZMA 4YNQA 4CHQA 1RT6B 5F8IA 4Y2AA 5EWGA 3NBPB 3OL9A 4O0IA 4M3UA 3DRPB 3BQ0A 3RB0A 3FQLA 5KFJA 3TAMB 2JEGA 1SH3A 4OGCA 2EC0A 2RN2A 1JLFB 4KHNA 1NK4A 4H8KA 1RTHB 5HROB 2VG5B 3K57A 1SH2A 4RW9B 4IDKA 3UPFA 4OGEA 3LANA 1D1UA 2WK4A 3NAEA 3KLHA 2HHSA 3O3HA 1U4BA 4NLYA 1Z26A 3OYMA 4M3YA 4J9KA 4G1QA 4Y34A 4DTJA 1U49A 1HYSB 1X9MA 4LSNB 4WE1B 3LPUA 4DQSA 2J6SA 3KHHA 5DG8A 4NLQA 3IAYA 1BQMB 1ZBLA 4J9RA 3L3VA 3BGRA 5HBMA 3AO5A 3TWHA 5KT3A 4I9LA 1C0UA 5F8JA 1C1AA 4DQQA 2OH2A 1HYZA 1IKYA 1S10A 3NGIA 3P83D 3DYAA 3NCIA 1C0TB 4XPCA 1WAFA 4DU4A 3A2FA 5DQHA 2R2UA 1KLNA 3I0RA 5CY4A 3CJ3A 5EDWA 1IKWA 3CIZA 5FRNA 4E3SA 3H5SA 4Z0UA 1RT1B 3VQ5A 4ICLA 2YKMA 3GIKA 2RF2B 4CEZA 1KHWA 4FJGA 2IM0A 4DTNA 1S97A 2QE5A 3C94A 4QCLA 4W5OA 2W8LA 3SQ1A 1R0AB 4FJ7A 1L3UA 4M94A 4PWDA 2X6SA 1REVB 4CCHA 3SI8A 2UUTA 4CF2A 2WRMA 4CJVA 4ED3A 3PV8A 2G8UA 3MEEB 3ALYA 4YMEA 5CZ2A 2HMIB 2W9CB 3HVTB 4KTQA 1MU2A 3N6LA 4KE5A 4URSA 5KFSA 1ZBIA 3GV5B 2P1JA 3TAEA 1TK5A 3E01A 2ZE2B 4IOBA 3L3UA 1YTAA 5HP1B 3PR5B 1EXQA 2QK9A 3I0SB 1FK9A 1N56A 4QPXA 2VWKA 1RTIA 3CYMA 3MXJA 1BQNA 3JSMB 4KO0B 3RRHA 3GILA 4U6PA 5KG1A 2A1SA 2X74A 2IJNA 3C95A 4F2RA 3KKRA 4CEOA 3OS2A 3CM5A 2FJXA 4FBTA 5L1KA 4XO0A 4CK1A 3I5AA 4E7KA 2EHGA 1TVRB 2RPIA 3HM9A 1T7PA 1JLGB 5FROA 1HQEB 4AHRA 3O4NA 4B9MA 3T19A 1WSJA 1Q9YA 2ZD1B 4DLEA 2PYJA 2OPRB 2OPSA 1TL1B 2VG7A 3KLVA 4XIUA 1FKOA 3M9NB 1CZ9A 4MQ3A 1KLMA 1EP4B 2AX0A 1LW2A 1WSEA 4KTWA 2W9AA 1LWCB 3ICLA 3HVAA 1RBRA 5EWFA 1IH7A 1RT4A 4C8NA 4ED8A 5KG7A 3OHAA 1UWBB 5T7BA 5KT5A 4RUCA 2W42A 1YTUA 4DSIA 4LD0A 5KT4A 3RWUA 5KFWA 3PVXA 4W5QA 4HUGA 1C2PA 1O1WA 3LP3A 4DL7A 4O4GA 3CJ2A 1KFDA 2ITGA 1CXUA 4CFDA 1XR6A 4WXWA 4YFUA 3DLKA 1SKRA 4WFYA 4WFZA 3EZ5A 4ZPBA 3VA3A 2F8SA 3P5JA 2VA2A 3V9XA 1RT6A 2YKNB 4O3SA 4RNHA 1S1XB 4K4SA 1HNIB 3NAHA 3WNGA 1RDRA 4CHPA 4EYHB 2X78A 2W8KA 1N4LA 3MEGA 2FVRA 2WHOA 3PJXA 4B9LA 2OPQA 1HPZB 1RTHA 4LSLB 2XWYA 2VG5A 4RW9A 4CECA 3ZSYA 2BANB 4IFVB 4DSJA 3TANA 3KK2B 4DU3A 3GV7B 1NHVA 4DSKA 3HK2A 3FSIA 1IKXB 1I39A 5C5JA 3MECB 2YNGA 5KG2A 3BJYA 3VQ7A 4EZ6A 3SI6A 3MXMA 3RRGA 1S0NA 4LH5A 1HYSA 1RT7B 4LSNA 4WE1A 1BIUA 3KMQA 4K8XA 4R5PB 3AVMA 4B8CA 3QEPA 4E1NA 2ASJA 3DRSB 1TAQA 4CEAA 3IGNA 4Q8FA 1BQMA 1S1UB 4ZVGA 4KAIA 4BE0A 2UVWA 3RR7A 3KK1B 4WFXA 3AVIA 4LQ9A 1L3TA 2E9TA 5KFOA 1C0TA 2PZSA 1Y97A 4CFBA 4O4RA 4LH4A 3QLHB 2UUWA 2GIQA 4KV8B 2GC8A 4MH8A 3G0ZA 4TYAA 5KFBA 3AO3A 2RDIA 1BI4B 2HNDB 1RT1A 2YNIA 1Q9XA 2RF2A 2IM1A 3MFIA 2UVUA 1RTDA 4NCGB 3D45A 4L8RB 1SKWA 4CGIA 1KHVA 3AVJA 4R0EA 3O3FA 1ZBHA 3T1AA 1REVA 3QETA 2RKIB 2ETJA 1VRUB 3AO1A 3RAXA 3KMSA 5KFYA 3MEEA 3G6XA 1D8YA 3BSCA 2HMIA 2W9CA 2ALZA 5J2NB 3SNNA 3HVTA 3GV8B 3NMAA 5EWEA 3KLEB 1TQLA 3U3YA 3L2QA 1BCOA 3N6MA 3QZ7A 2ZE2A 1D9DA 2AWZA 3V1QA 5HP1A 3LPTA 3OY9A 4CHOA 3QNOA 4KRFA 3LP1A 4CJ3A 4DL6A 2BQRA 1HARA 1C0MA 1C1BB 4ECYA 4NLVA 1JXBA 4PQUB 4KO0A 1QE1B 3HP9A 3C6TA 3PHEA 4ZP7A 4CIEA 1RDBA 4CGDA 3AVHA 5J2MB 4K4UA 4Z4HA 4RG8A 5K14A 5KT7A 3VN5A 1RDDA 4B9SA 5J2QB 2B6AB 4ELTA 4NLUA 1W9HA 1RYSA 4WZMA 3JYTA 1TVRA 4IFYB 4DTSA 3RBEA 2O4IA 3EZUA 3P1GA 2AJQA 1Z4UA 2IMWP 4O5BA 3VQDA 4F3OA 2OPRA 5EUHA 3F73A 2KW4A 4IR9A 5FDLA 5KFPA 4F3TA 4ELVA 4ZTFA 3M8PB 1EP4A 4OKJA 2JC0A 3OYAA 5CZ1A 5J2PA 2JEFA 5KFFA 4O3RA 4F8RA 4AHCA 3KLGA 2R2SA 3Q8PB 4C8MA 3NHGA 4F2SA 3DRRA 3V4IB 1UWBA 3IG1B 4Z4FA 1JL2A 1KFSA 3MR5A 4IG3B 3IS9A 3Q8RB 1NOZA 2ATQA 4ZPCA 1D9FA 3GIIA 4J9PA 4ED2A 4N56A 4Q5VA 3S3MA 1UA1A 4Z4IA 2YHAA 3ZSOA 1YVUA 3H5XA 2OZSA 2IC3B 1GOCA 3QO9B 3KOAA 3M8RA 3SV4A 1RT2B 1RA6A 2IS3A 2IA6A 4IR1A 3HJFA 2Q3SA 4CF0A 4FLYA 3UR0A 1ITGA 4M3TA 2A1RA 2W7PA 4FJ8A 3NAIA 1ASWA 3T5KA 3DLGA 3CQ8A 4DFJA 4ECWA 4ECSA 3ASMA 3MEDB 3UDLA 1S1XA 1HNIA 1S6PB 3AO2A 1RBSA 2R7YA 1X1PA 1SL2A 4KI4A 3H59A 4HYKA 1LWEB 3HO1A 4CEDA 4DS4A 1GOBA 4LSLA 1ZETA 5I3UA 1QS4A 4DU1A 1TKZB 4JRQA 4LQ3A 4IFVA 4HKQA 3WNFA 3KK2A 5KFEA 2WTFA 4QW9A 3OL6A 1TV6A 1SV5B 4O55A 1KVAA 1IKXA 3QGGA 3LP2A 1FXXA 3V6HA 4J2BA 4DQPA 4IKAA 1NKCA 4KHQA 3SYZA 3H98A 2LSNA 5DG7A 3CJ5A 2IOCA 3DDKA 3AVGA 4DQIA 3M8SA 2DPIA 3QEVA 4KB0A 3DRSA 2D7SA 3RB6A 3G10A 3NDKA 1IKVB 3K59A 1B9FA 1S1UA 4NLSA 4B08A 1SH0A 2E9RX 3OYFA 2D41A 4AH9A 2VG6B 4CEEA 3HPGA 4J9LA 2I5JB 1J5OB 1S0OA 5I42B 3VQ4A 3DMJB 5KG4A 3BQ2A 3RMCA 1OS5A 3SV3A 3OYEA 1EX4A 3B6PA 2V0NA 4B9UA 4O3PA 2R8HA 4KV8A 2BDPA 1BI4A 4BWMA 2DY4A 2ZKUA 1UA0A 3FQKA 3D28A 1ASVA 2W9BA 4NCGA 3CJ4A 4ZHRA 4KPYA 4FJHA 3B6OA 3RB4A 4NLTA 1RT5B 1YT3A 1JLQB 1QUVA 5KFTA 1XWLA 3SUNA 5F9LA 3VQ9A 5F8MA 1BCMA 3NF9A 3OS1A 3PR4A 1UAXA 4FLXA 2CJQA 5DLFA 1Z25A 3WNHA 5C25A 1EETB 4FZZA 3MR2A 4Q43A 1S1TA 5CYQB 1IO2A 1I3AA 3KLEA 3DLHA 4FJLA 5CYMB 3WNEA 4RW7B 1GX5A 1U09A 2FBYA 2CKWA 2YNHB 2ASLA 3CFPA 1U47A 3SQ2A 4HUFA 1GOAA 4HCBA 2HNZB 3H4DA 2HNYB 4TXSA 1ZBFA 4XPEA 3H5YA 4J9MA 4FM2A 3BSAA 4TN2A 1C1BA 1UOCA 1LW0A 4PQUA 1RBVA 4JV2A 2XGQA 4EBEA 4LY7A 3UIQA 4FYDA 1KVCA 3SPZA 2J6UA 2GIRA 4QW8A 2G8FA 4WZQA 4F4YA 2B6AA 3ISNC 5JS1A 1C1CA 4IFYA 3CM6A 3V6DB 4TY9A 2DFHA 4FJMA 4DS5A 1S0MA 5DK5A 4ZPDA 4KTZA 2W7OA 3C6UB 1RBUA 3DM2B 4I7FA 3PW2A 4OKKA 4ECZA 2FVPA 3VQCA 4M45A 5D3GB 1LV5A 5C42B 4J2DA 4OLBA 1BIZA 4OLAA 4ID5B 1T05B 4JV0A 4FM1A 4FJ9A 3SQ4A 5DLGA 4KHWA 4HVJA 3V4IA 3NF7A 1BHLA 3IG1A 4FLZA 1S9GA 3AVCA 4IG3A 3TAPA 2Z1IA 5HRSA 2BE2A 4NLOA 4M3ZA 4H4OB 4KHYA 4E19A 1QSYA 1JXEA 4I2QB 2IC3A 3QO9A 1RYRA 1RT2A 4CF1A 4BE1A 5E41A 1JLCB 2X6NA 4JS5A 2XC9A 1B9DA 3AO4A 3BQ1A 1XI1A 1TL3B 2IM2A 4CJKA 4B9NA 4TY8B 4ED6A 4MFBB 1N5YB 4KREA 3O3GA 3DOKB 3MR6A 4FK0A 3V81B 3HVWA 2AGPA 4NRTA 3RMAA 2RDJA 3QINA 4DSFA 4TQSA 4HTUA 3Q8SB 1LWEA 1NK5A 1JKHB 4B9TA 4Q0BB 3NH0A 1HQUB 3HKWA 2Z1GA 4ZP6A 4QWCA 3V9WA 3T3FA 4KHRA 1DTQB 3KK3B 5KFUA 1TKXB 5KFHA 4H4MB 4IQXA 3OYHA 4N76A 5KRSA 1VSLA 1WSGA 2G8IA 4DG1B 3LAKA 1TKTB 2YNFB 2I1RA 4BACA 4DF4A 1TAUA 3S3NA 3HL8A 3RMBA 4IRDA 1J54A 1X9WA 5KFRA 2Y1JA 4DWIA 4CJFA 3T5JA 3LWMA 3AA5X 4E7IA 1SUQA 1VRTA 2JC1A 2C22A 1K6YA 1IKVA 2D0AA 1JIHA 2XCAA 5KGWA 3KHRA 4R8UB 5DGAA 4URGA 3NBPA 3ZT3A 1J5OA 2R2RA 4K4TA 3TI0A 3DRPA 3S9HA 1RDCA 4RU9A 2J6TA 3ISND 3TAMA 3NF6A 1VSFA 3FFIB 1D5AA 1SKSA 1JLFA 1S1VB 5JS2A 4KAZA 4RNMA 5HROA 2BRKA 2OYQA 4CJLA 1DTTB 4J9QA 3BSNA 5KFAA 4CK2A 4OVLA 4NLRA 4KFBB 4IRKA 5KFGA 4DSLA 4CIFA 4HCCA 5DMRA 1RT3B 3ZCMA 4DTPA 5HRNA 3CFOA 2EX3A 3IRXB 3CO9A 1S9EB 4TSXA 3ZT2A 1RAJA 3NH2A 3OYCA 4O44B 3TVKA 4AHUA 4NYNA 3OYNA 1QAIA 4QAGA 3OSNA 1NJWA 4RW7A 2XRIA 5L1IA 3GIMA 3NE6A 2D3ZA 4Y2CA 2HNZA 3H2LA 1XR5A 4DL2A 1BISA 1NKEA 4J2AA 3HSTB 1LAWA 1WLJA 4YR2A 3K5LA 3RMDA 5KFCA 3SUQA 4ED7A 4KHUA 2HB5A 2KZMA 1C6VA 2WONB 4M42A 3Q8QB 4ZPAA 2KFZA 3V6DA 5L1JA 3L2VA 1R0AA 4CF8A 3HPHA 5HLFB 4FK2A 4IRCA 1K1SA 3HHKA 3D0PA 3K5MA 3OYKA 3V9SA 4N47A 4MK7A 3VQ6A 4FK4A 3BDPA 5D3GA 5DGBA 3GYNA 4ID5A 1T05A 2HHXA 2R8GA 3NH1A 1NKBA 4CERA 2OA8A 3I0SA 5F9NA 1NJYA 3OYDA 5L9XA 5JUMA 1RCHA 3VQQA 4CJTA 2KQ2A 4QOZB 5DQIA 2GV9A 3JSMA 1IM4A 5C24B 3EPGA 3OYGA 4HHTA 4WXOA 4QWBA 2KFNA 2AU0A 4CGGA 4DTOA 3NGZA 3BGRB 2R8KA 1TP7A 4CEQA 4ZVEA 3L2RA 2NUBA 4ECXA 3QNNA 1C0UB 5KTQA 5KG6A 3ZT1A 2QXFA 4K4YA 3H08A 4I9QA 1CXQA 3DYAB 4RW4B 1JLBB 1TL3A 1JLGA 4ECUA 1HQEA 4TY8A 3AV9A 3KHGA 3M8QB 4CJPA 4K4ZA 4DTUA 5F8LA 5KFQA 2ZD1A 4MFBA 1N5YA 1IKWB 3ZSZA 3DOKA 3TAQA 2HHVA 1TL1A 1RA7A 3LZIA 4ICLB 3ULDA 3LP0B 3CDWA 1I6JA 3SUOA 3KLFB 4GVMA 1JKHA 3G6VA 3AVAA 4GMJB 4N41A 2ILZA 4QWAA 1RTJB 1HQUA 3DLEB 3T5LA 1LWCA 3SPYA 3ZT4A 4ZVFA 4PWDB 2HWHA 4JUZA 1T3NA 4FLUA 3K58A 5KG3A 3KK3A 2FVCA 4ECQA 3AVNA 2QKBA 2HHWA 1WSIA 4H4MA 4JLHA 4FW2A 4FLWA 4CK3A 3AVLA 2GBZA 4FLVA 4JV1A 4DG1A 4URQU 1MU2B 3PZPA 4C8LA 3RBDA 3E01B 1XHXA 4YR3A 5F8GA 2D0CA 4C8OA 4AHTA 1FKPB 3AA3A 3KNAA 4Z4EA 4CJQA 1VSMA 1SL0A 4RW8B 3ZSWA 3QIOA 3H5UA 2PYLA 5KFMA 1ASUA 2JEIA 3AA2A 2XY5A 3OYLA 2YKNA 4EYIB 5KFXA 2XO7A 3MF5A 4CJ5A 3SQ0A 3HYFA 4NLXA 3M9MB 4ECTA 5KI6A 3U6FA 4OJRA 3V9ZA 4GC6A 5KT6A 3PW0A 4OPJA 4WYWA 3FFIA 1QAJA 4Q8EA 2FBXA 4GW6A 1HPZA 4IH5A 3I5BA 3KJVB 3NF8A 3IGVA 1T03B 3QGHA 2BANA 2VG7B 4JS4A 1HMVB 2JEJA 4N5SA 3GIJA 5KFDA 4M3RA 3MTKA 2FLPA 1XHZA 1JX4A 4MK9A 3ZSVA 1LW2B 2JGUA 3ITHB 4FS2A 4H54A 3CJ0A 3MECA 3ZSQA 1JXLA 3V6JA 3IRXA 1KVBA 4BDYA 1RT7A 2BGGA 1LAVA 1JLEB 4PA1A 4FJNA 4R5PA 1YVFA 1NOYA 5KFVA 1JL1A 4B3OB 3HPOA 2HHTA 3SFUA 3ZSRA 1NK7A 4O4GB 4F4XA 1ZBUA 3KK1A 3NGYA 4KHSA 1RBTA 2XY6A 3QIPB 3L2WA 3DI6B 4IG0B 4CJEA 3PO4A 1G15A 4FZYA 3THVA 4ZP8A 3LWLA 5KRTA 3QLHA 3N6NA 4EBCA 4CGFA 4Y3CA 4CJ4A 4M3WA 4J9OA 2HNDA 1NNDA 2B5JB 4NLPA 4DL4A 1WN7A 1A5WA 1JLAB 3I5CA 2YV0X 3LAMA 3FRZA 2WONA 4K4WA 1S5JA 4CF9A 3I8DA 4KHMA 4CGHA 4Q45A 1N48A 1XC9A 3MEGB 5HLFA 5SZTA 2OPQB 2RKIA 1VRUA 2IAJB 3TARA 2BQUA 2WCXA 3V6KA 2R8IA 5F8NA 4DEZA 4F4KA 3PX4A 5J2NA 4RZRA 3CFRA 3KHLA 1QTMA 3RTVA 2ZQBA 1S48A 4G3IA 3DOLB 4KB7A 2V4QA 2YNGB 1S6QB 4RNOA 2XY7A 4FBUA 4RW6B 4X2BA 4Y1CA 1KCFA 2C2DA 3VA0A 4DTMA 3QYYA 1QE1A 4K4XA 5C24A 3HXMA 1S1WB 1EKEA 3UQSA 4EBDA 1WNEA 1WAJA 2AQ4A 4Z4CA 3AVFA 2DPJA 4DSEA 3LALA 4KKOB 2XI2A 2Y1IA 5J2MA 3QIDA 4DFPA 2G8KA 5J2QA 4RW4A 2F8TA 1JLBA 4E7HA 1A5VA 2P5GA 1MMLA 2ILYA 4YP3A 4ID1A 3M8QA 2V9WA 2E6MA 1CSJA 4FM0A 3RR8A 1ZYQA 2FJWA 4ZMMA 1VSEA 2YNIB 5KT2A 3LP0A 3U3GA 3SZ2A 1IG9A 4FXDA 1BL3A 3M8PA 3KLFA 4AILC 1RTDB 2C28A 3OLBA 4F4ZA 3QEWA 1RTJA 3DLEA 3NFAA 4ECVA 4ELUA 1HNVB 1BGXT 2QV6A 4QWEA 3CDEA 3OL8A 4DQRA 5KG0A 4O0JA 3OJUA 2G8HA 4MIAA 2D5RA 2IM3A 4F4WA 3QEIA 4Q44A 2O4GA 1VSHA 4FJ5A 4K8ZA 4C8KA 4O3NA 3E51A 1CLQA 3VQAA 4J9SA 4FJXA 1FKPA 3EPIA 2FVQA 3LP1B 4MKBA 4E0DA 4RW8A 4OKEA
chains in the Genus database with same CATH superfamily
3I4PA 4HUEA 4BRLA 3BF4A 5IWAK 4CZFA 1U48A 3DC2A 5BYQA 4DV6K 3AXMA 2YWFA 2YHBA 1W25A 3QT5A 2G2ZA 4RUAA 1GK8A 3KUEA 3D6RA 2IDLA 3MEDA 2YPZA 3DU6A 4OYIA 3V9UA 1FRKA 4ED1A 4G65A 4PWUA 2AIRB 3JYTB 5D6GA 1N32K 3J7YI 4IWVA 2OPPB 1OPZA 1KVKA 3LH2S 3AVBA 2E5IA 2UUCJ 3MN5A 4CZEA 3W2WB 5BN8A 2DXEA 3ZZPA 2JFKA 1CS4A 4CEFA 4M3XA 4MKYA 3ITHA 5DDPC 3UVJA 1SJ3P 2PI4A 2PN6A 4USWA 1SQEA 4CD1A 1RBAA 2HWIA 2XZTB 4B9VA 4JI0K 3VQ8A 3TR8A 4OZNA 1JLEA 4LF1A 2BACA 3IS9B 2AT1B 4K25A 3ZZ0A 2XQCA 3OXGA 4WFAL 2VQFF 4BWJA 5I42A 4U67Q 3QWPA 1U45A 3WQUA 4USKA 3SMPA 3J80Y 3H0PA 3R1HA 5KFLA 3CVKA 3P49B 2B5JA 1WOOA 1IVZA 5T41A 2BJ7A 5T14A 2WOMB 3HVRA 3QBCA 1YSJA 4EO8A 2VZ9A 4WU2A 2ZBCA 2VD3A 1RT5A 2E8AA 1RAHB 2ALYB 1RWUA 3DRYA 5AE2A 2BR0A 1TTHB 2AF6A 1IBMK 1UCNA 1VSIA 4IO1A 1U2CA 3E3XA 4ZCLA 1QM9A 3FDSA 2FLLA 4DR3F 1EJ7L 4WKYA 4FYYB 1V5IB 2YQ3A 4XDCA 2ZJRL 4KI6A 2D0BA 3J8AA 2YNHA 1HW8A 1GLAG 2O5DA 3R5DA 4DV5F 3OSPA 2G2YA 4FJIA 2XCPA 4N77A 3R7NB 1ZM4A 1XUPO 4DR7J 2ZBQA 2H51B 2PY5A 5KG5A 1ZPVA 4RNFA 2DNQA 1S1WA 4MIBA 4J2EA 1KQSR 2ZH3A 1Z2ZA 3ILOA 2KRBA 2BTFA 3US5A 1QHAA 2IGIA 2KT2A 3QSIA 3OTEA 4BR7A 3KD5E 2B43A 2Y0SD 2RQCA 5KFKA 3H40A 4IXCA 5JLFA 5F41A 4ANEA 2R7SA 4PY5A 4CJRA 3C15B 3A8EA 5JXSA 1RDAA 4JEPA 3FVYA 1V5VA 4RBVA 3DKDA 1WHYA 3C6UA 3DM2A 3AAQA 3RW7A 3FGVA 2QLWA 4YR0A 2DEIA 4O5FA 4ZVHA 5F3ZA 4H4KC 4NYZA 2OEJA 3L2UA 1VLYA 4JN4A 2YX7A 3TABA 2Z4PA 3H20A 4ILRA 2ZEJA 1AB8A 1OYDA 5C25B 4FWKA 1TGOA 2ZJPQ 4ZLJA 4DPUA 1VSDA 4GVBA 5BYRA 2AJ0A 5HBMB 4JYAJ 2E5LJ 2BOPA 1PC5A 5DZ7A 4CHZA 4UQGA 4FPRA 4IBNA 1KP6A 4CH0S 4IO8A 1FVSA 1LWXA 4LRFA 1IR1A 4DU7A 3UCUP 4CQ1A 3C66A 3BS9A 2YKMB 3OW2M 2NPIA 3U02A 1YIJN 1N0UA 2CQ1A 4FDFA 4KHPK 2GMJA 3P31A 3ILIA 1HRHA 2DRAA 4BDPA 1IM6A 4AHVA 4OL8A 1SQGA 1VQ8N 3E8OA 4B3MF 4MTPA 1TKXA 2ZH2A 4C2MA 5F0WA 4NLBA 1HUXA 1ATNA 4C11A 3MUVP 1QHTA 5KQ8A 2BRLA 3FK4A 4ZTJA 4P52A 4A61A 1FCAA 1PYOB 2CGJA 1CG2A 2GFFA 2HW3A 1ZM3A 1WC5A 4JV5K 3R6GB 4DR6K 3ADAC 1GLDG 4LF4K 1RTIB 1QSSA 3ONQA 1HBNA 4QWDA 1ZAWA 4ILGB 4EAHD 1GFWB 2Z2LA 1XMOF 4EO6A 1D09B 1HHSA 2FY8A 1X9SA 4FLTA 3CJTA 4CFAA 3MXIA 3AJ2A 3KD1E 1PAUB 2VJVA 1M5VC 2BQ3A 1P6TA 3FC9A 5EU7A 4DUZF 4JI5J 4ZVRB 1S1VA 1OJ4A 1WORA 3AY9A 3MMAA 2HVIA 3A0IX 3BN7A 3T5HA 4X4OA 5GINA 3G4SN 4HEA9 4ZLLA 3H4BA 2F96A 4DR1K 4FJKA 1UTAA 2HS3A 3S6EA 3MM6B 1VSJA 4DR2J 3AVKA 4J5OA 1YHQN 1U0SA 3HP6A 3TZYA 4EZ9A 2HQCA 3QGIA 4B8AB 4LRDA 2ZF5O 4LF7F 4CJSA 2KXNB 3HI9A 4LF6F 2FJEB 5J1EA 4IH7A 1LEOA 3Q83A 3MMCA 4H0PA 3M6GA 3BBFA 1NK9A 1J53A 4IH6A 4QPTA 1CC8A 4OHYA 1IQTA 4WKRA 2M9KA 2M5YA 3DLKB 2CQBA 3CC7N 4ZJOA 3VCDA 2QTWA 2XGPA 2OZMA 1WG5A 2BVZA 3VR1A 5F8IA 4FYWB 5C7PA 3NBPB 4O0IA 4NXMF 3H1QA 3TAMB 2QJ3A 2JEGA 2BX6A 2GZOA 1NGHA 4B3RK 4LF8F 4KHNA 1NK4A 5IXUA 2CQCA 1RTHB 5HROB 4RW9B 2CQPA 4AL7A 2OGUA 4OV1A 4GVEA 2JWLA 3SCLE 4E8UA 5ADXH 3KLHA 4F0KA 3DHXA 1WACA 5AJ3J 1HKGA 2V69A 2XMWA 3M8ZA 3DXBA 2GAGC 3M32A 1ITPA 3SSSA 5AZJB 4LSNB 3D2EB 4F02A 4CZGA 3W2VA 5DG8A 2DPNA 2E5HA 4M5IA 3B4MA 3BEXA 1HNWJ 4ZVPB 3L3VA 3BGRA 4USJC 2DNGA 3TWHA 4A8XA 4JI1K 4DV1J 1C1AA 3C7NB 4I6YA 2KRRA 3NCIA 4BR9A 2L9NA 3CJ3A 4AFFA 2WB1D 1B64A 5MLCQ 1GLLO 3U9ZA 3R5GA 4ICLA 3FUYA 3GIKA 1KHWA 3C2PA 5AQYA 4DTNA 2QE5A 4ILMA 1T6DA 3LL3A 2IRUA 4PKDB 1NSPA 2HBLA 2AJ2A 2P9IB 4GKKF 2VQEF 3C19A 4CF2A 2WRMA 5AQHA 2NUHA 2HHHK 1YG0A 5A8WB 3HVTB 1ZBIA 5JLHA 3GV5B 2NXNA 3HRGA 4G1PA 4FWOA 4IOBA 3OFEA 4DV4F 1HX1A 5CHIA 1EX8A 5ETPA 2NXJA 3N0VA 2AJ1A 3CPWM 2MKCA 3CYMA 4USMA 1FJGF 3QFPA 3RRHA 1TFYA 1D3WA 1OPIA 3J7YP 2L48A 1WC1A 4U6PA 2H1YA 3SDEA 2YPYA 5IT9U 4H0YB 2X74A 2IJNA 3C95A 5C15A 4CLYA 3UKUB 5L1KA 4E7KA 3OR1B 1TVRB 2OO4A 2P9UA 1QDUB 1UVMA 3T19A 1WSJA 3CCMS 2OPRB 1TL1B 4ZCKA 2XZDB 2FY1A 1FKOA 4LFBK 4MQ3A 1HBOB 1LW2A 2NSBA 1FVQA 1U2RA 4Y0FA 3A3OB 3UN5A 3HVAA 5KPRA 1IH7A 2OJ3A 4ED8A 3F5TA 2HZVA 1H0HB 1WC6A 2MSSA 3F44A 2VBXA 2W42A 1YTUA 2P9KB 2KYXA 4HUGA 3R3LA 3R9LA 4FWSA 3TSUA 3CJ2A 1U2VA 1CXUA 5FPEA 1XR6A 2KXFA 4WXWA 4YEAA 3ZXWA 4WCEL 5B8HA 4ZPBA 3I82A 2F8SA 1J6ZA 4YB7A 1NCLA 1UVNA 2F40A 2L08A 2X1GA 5GIOA 1P9QC 3WNGA 3VAKA 4CHPA 3D6FB 2BW2A 5IOLA 4EYHB 5FPMA 4ZDNA 4FKXA 6FDRA 4F4AA 3IWXA 2UV8G 3MEGA 2WHOA 3DN9A 1K44A 3ZEUA 2VG5A 1R3NA 1PGZA 2PBDA 4E1JA 2O01C 1NPRA 3TANA 3KK2B 3GV7B 2J9EA 1QQMA 4HWIA 2RNEA 3GG0A 1IKXB 1CJVB 2VQFJ 5B09A 4YHHK 1R8CA 3NNAA 2HZCA 3VQ7A 1A9NB 3SI6A 2W2PP 4BGBA 1NSKL 1O8BA 4FSVA 3OHRA 4ZK7M 4WE1A 5A6PA 1U2FA 4B8CA 2GGPA 4KGXB 4OFZA 3AQOA 2EEYA 1U24A 2OUGA 1WB9A 4JI8J 2QL7B 4QIWD 2K7JA 1XQSC 4PXCA 3GSDA 3DCAA 5AZIA 1UFLA 5BXIA 1Y97A 2RSQA 3H2UB 3QLHB 4DR3J 1FJEB 1B0TA 2DH9A 1LXJA 2GIQA 4ANCA 5JJBA 4BC7A 3FZLA 4IOAL 2HS0A 2RDIA 2BKNA 2HNDB 3DDNA 2BW7A 3G6EN 2EI5A 1Q9XA 1SZ2A 1W97L 1RU1A 2IM1A 5DM6L 4LIWA 4DV5J 4DV7J 1SKWA 4QU7A 1FWPA 4TU9A 3QETA 3JAMY 4LR9A 2U1AA 3SAFA 3EICA 4K41A 3MEEA 2ACYA 3DGVA 2YKQA 2W9CA 3CULA 2GX8A 5EWEA 3BGLA 3KLEB 3U3YA 5BPLA 3RRKA 1I3OB 3N6MA 1ZZFA 2DYAA 5HP1A 2HFVA 2OKQA 2Z57B 1LFPA 2IJRA 2LU2A 2FXUA 4LVNP 3UB5A 4Q7AA 2AYMA 4DL6A 1QZ5A 2RH3A 5B0CA 1FE4A 4PQUB 3GCXP 1QE1B 3HP9A 3P3DA 3C6TA 4CIEA 1RDBA 3SIPB 3FCHA 4B17A 2ZZTA 1R59O 2B6AB 1F6TA 4NLUA 5H9EJ 1W9HA 4WZMA 3B6BA 1TL5A 3RBEA 3EZUA 1NGCA 4JI2F 4O5BA 3Q89A 5M1OA 3GZ7A 2A18A 1HNZJ 5CZ1A 2IMOA 4L3QA 1RWXB 4QS9A 2RE1A 1H7WA 2Y3YA 2V6AA 1WWHA 1S7IA 2NUUG 3IG1B 1JL2A 3MR5A 4IG3B 1HR0K 3KWMA 4ZPCA 1D9FA 1M1HA 4N56A 1HBMB 3CJAA 4RR5A 5HMZA 2BABA 4DPOA 2DEJA 1PJ5A 1BA1A 3A8YA 4L73A 3A12A 3OTOK 2OZSA 2MMYA 1GOCA 3QO9B 1VI7A 2H5IB 3L3CA 2VFUA 2Q3SA 4B3MJ 5AQOA 4CF0A 2HKEA 1Y0HA 1ITGA 4PRFA 2W7PA 1MLAA 1ASWA 3DLGA 4P72A 4TNOA 1S5ZA 3MEDB 3OD2A 1FRLA 1HNIA 1IBKJ 4JB8B 3AO2A 1RBSA 3RVCA 1X1PA 2LU1A 4KI4A 1JWWA 4PCQA 1H73A 4DCJB 2LYVA 2EFQA 1GXUA 4E98A 4DS4A 3TO8A 1DAXA 2PIIA 4ILJA 4LSLA 3ZX0A 1FFWB 3LGNA 1JJ2M 4JRQA 4LQ3A 2QLXA 2ZKTA 2J0SD 2WVCA 1XMOJ 4X62F 1CS4B 1NDPA 1FESA 2ZHOA 3LP2A 3V6HA 3UVJB 4BG9A 3G9CA 2J7UA 4IOXA 5DG7A 3HDSA 2PE8A 1KQKA 4K2XA 3KUGA 3QEVA 1Y3JA 3G25A 3NGRA 5HN0A 3CDBA 1H74A 3KZBA 1IKVB 3K59A 3IDHA 1B9FA 1S1UA 1SH0A 3JB9k 1IJJA 5FPNA 2QTDA 4JI6K 4AH9A 2D1CA 1DQAA 1S0OA 5I42B 4BRHA 3R9PA 1EX4A 1QVGM 3B6PA 2V0NA 4LF7J 4O3PA 4YDUC 4PXBA 3N5FA 4F67A 3MM5A 1ELOA 1UAWA 4QU6A 3LDPA 3FE1A 2MQLA 2BDPA 1PG5B 4BWMA 5GAEI 3ZX2A 1UA0A 4LFAK 4AL6A 4A8OA 5IT0A 4NCGA 3CJ4A 4ZHRA 1X4HA 3D2FA 2Q79A 1RT5B 2ZOMA 3TW0A 3W9JA 3VQ9A 4A47A 3NS7B 2VH7A 1Z25A 1KAZA 1YK9A 1I3AA 3DLHA 2EPIA 4LSZB 1N88A 2WW8A 4LFCF 4LF9K 3WNEA 4LT6A 3IAM9 2YNHB 4KIAA 1UWAA 1A7GE 4HUFA 2W40A 3H4DA 3H5YA 4R0JA 4BR5A 1F3FA 4I4BA 2ZJQQ 3BSAA 5FJ4A 4TN2A 4A8KA 1C1BA 2BKOA 1FF2A 1HD0A 4U67L 1SJ1A 4FYDA 1FRIA 4GMKA 3SPZA 2G8FA 4DV2F 2FHOB 5EGYA 2QSWA 1BO5O 4IFYA 3CM6A 2GVZB 2DFHA 3BR8A 4FJMA 4K0KK 1ZBSA 1SAZA 4KTZA 1QVFM 3C6UB 2JVOA 3PW2A 3DM2B 1YLXA 1U26A 2BKPA 2F9DA 5I3PA 4OKKA 3NS6A 3QNWB 2FVPA 4M45A 1FJ7A 2HURA 1BIZA 3QMLA 1BA0A 3U8XA 2YWEA 2LP4A 4FJ9A 3SQ4A 3VVTA 1XTZA 1YJ9S 4HVJA 3NF7A 1IBLK 1RU2A 2D3OR 1S9GA 4FWLA 1SPBP 5J1NA 5HRSA 3QGPA 2IVPA 5CHCB 4A57A 3PTWA 4ZN3A 3D0HE 3GFXA 4OLOA 2DR6A 2YKOA 4KHYA 4E19A 4LBPA 3WXJA 2DVIA 1XNRK 3DWLA 1RYRA 4GKKJ 2HFZA 4C8YA 1FXLA 1XI1A 2CFXA 1TL3B 3VEYA 2VFVA 3BH6B 2YX4A 4QS7A 4DUYJ 2LMIA 2CGKA 1N5YB 3DOKB 4JHDA 1RLCL 4E2FB 3HVWA 4K5RA 2AGPA 4X66F 2XMTA 3RMAA 2Q2RA 1LWEA 4TU7A 4B9TA 1ZPWX 2YCHA 4K59A 3HKWA 2O3DA 1WI8A 5E0OA 1FJGJ 4QWCA 2HRTA 3T3FA 4CYUB 1TKXB 5CD4A 4N76A 3OYHA 4NE9C 1VSLA 5KRSA 3SBMA 1WSGA 2G8IA 4P73A 2I1RA 1TAUA 4RWTA 4UQTA 5E84A 2AYGA 3RMBA 1T11A 2Y1JA 2ZJPL 4IEEA 3LWMA 1VQNS 3Q86A 1NH8A 1VRTA 1WELA 1M90O 1X3NA 2VOPA 2BUNA 3VENA 5M2PA 5A6WA 3MN7A 3KHRA 2E88A 2Z56B 2HSTA 5IM0A 2R2RA 3TOQA 1Q81O 3S9HA 4CZCA 2K2PA 3D66A 4OI3A 3ISND 3UKRB 1Y5LB 4NO7A 4UOCA 3HM8A 1D5AA 1SKSA 1JLFA 1S1VB 3HSGA 3TEHB 2I6WA 2CJ9A 2AEFA 3MMAB 4CJLA 4GNIA 1K8KA 4UW2A 1GT8A 4X65K 2ZH4A 2YTCA 4CK2A 4JI3F 3FBFA 2MJUA 4FP9A 2JFDA 4CIFA 2H48B 1V3SA 3BH7B 4DTPA 3CFOA 2XMUA 1VQKN 1ZC6A 2B9EA 3CO9A 1ZM9A 3NH2A 2ZC3A 2CH5A 4KGVB 3TVKA 3R5BA 1NJWA 2NZ4A 1WC3A 3GIMA 3MMCB 3ILLA 2D3ZA 4CO0A 4RL1A 3H2LA 4DL2A 2VHGA 1B99A 3V4MA 5HAOA 1BDGA 2RVJA 3PCOB 1NLVA 1LAWA 1WLJA 2H3EB 4TU8A 3QRPA 4WQ5C 3OFHA 2MQPA 3SUQA 4B3RF 2XMJA 2KZMA 2WONB 3FMWA 3CXCM 1TUUA 1WC0A 4EHUA 1R0AA 4CF8A 2FSKA 3P96A 2E5GA 4OZ2A 5GADI 4B3SF 3HPHA 3TVZA 2LQ8A 4P2SA 1GLBG 1AA1B 3V9SA 4MK7A 1CJKA 4ZIVA 1VBKA 2DK2A 1T05A 3I9V9 2EC2A 1VC5A 1N34F 2CJYB 4CERA 4P2FA 3OYDA 2IRYA 2OFGX 2KQ2A 4PQAA 2CRLA 2XZWA 5C24B 2RUSA 4BGAA 3RBZA 4DR5K 3LPYA 4CGGA 3NGZA 3CCTA 3BGRB 2R8KA 4M1KA 2RT3A 2KO1A 4OZ0A 3L2RA 3WBZA 5AE3A 3WIVA 1HWJA 4NI2B 5E3CA 1DQ9A 5HO4A 2QXFA 3CERA 4I9QA 1CXQA 4RW4B 1R43A 2QZ8A 2ZHAA 4I6MA 3IFRA 3CC2N 3W62A 1HQEA 4TY8A 3MUTP 2PT0A 3D0GE 2P9PB 2UUAF 2XSJB 4ICLB 3WXLA 3SUOA 1BMQB 3KLFB 4GVMA 5C2DA 4Y2KA 1JKHA 1F60B 4JI4K 1JCFA 3SQOP 4RKUC 1X3MA 4GMJB 1HQUA 1SIZA 3ZT4A 2ASOA 2HHWA 3AVNA 2FVCA 2QKBA 4H4MA 4JLHA 4CK3A 3AVLA 4F0MA 4DG1A 3KFWX 4HLBA 3N79A 3OVBA 4C8LA 2VC1A 2R9LA 1DBDA 5T7LB 2AEMA 5GAGU 1FKPB 3HHDA 3LA0A 1VSMA 5LJ3Y 1SL0A 5HL7Q 3ZSWA 2BEFA 2PFDA 3H5UA 1YVNA 2WAQD 3IO1A 1X4CA 1EWRA 3AA2A 1URNA 2IVMA 3CO0P 2YKNA 3SDEB 1YJRA 4WFBQ 3D67A 2AP6A 5AQSA 2ROPA 3M9MB 1X4EA 4ECTA 2IA0A 5BRFA 4F26A 5KI6A 3FZHA 4GC6A 3PW0A 3IMQJ 4LFBF 1UFKA 3FFIA 1QAJA 1WHWA 2FBXA 2QL5B 1EWQA 3KJVB 3NF8A 1Q5YA 3IGVA 4DL0C 3ZETA 2UUBK 2MLYA 3CCMN 3RSEB 3QT7A 4LJMA 1UVLA 1FXRA 3GIJA 5KFDA 4M3RA 2FLPA 4X4QA 2PDAA 1YITS 4MK9A 1LW2B 3ENVA 1Q8LA 2WVFA 5AQGA 3ULEA 3WT0A 4DCPB 3GOIA 3MR7A 4C0OC 3HHEA 5I9EB 2D69A 1NOYA 3CB4A 4P71A 1JL1A 2O8DA 2GHWA 2AW0A 3ZX3A 1VQMS 3HPOA 2HHTA 2A6OA 2C3PA 1KVJA 5K8NA 3SFUA 4RUBA 1ZBUA 3KK1A 2KVIA 2ZC4A 1RBTA 2XY6A 3PSFA 4JI7F 3LTOA 3JAMU 3W3SA 3N6NA 1VQ9N 4JI0J 4Y3CA 4M3WA 4J9OA 3LDOA 1X31C 5M1QA 3W5XA 1WN7A 1OYEA 1A5WA 3I5CA 2O66A 4OX9K 1S5JA 1WOPA 4KHMA 3L6QA 1KC8T 3MEGB 2V4JA 5HLFA 3J81O 2E7WA 1VRUA 2RJZA 5DZ6A 2D9PA 2K7KA 1N8RO 1CPZA 2WCXA 2NRRA 3QQCD 1S77D 4LR7A 2CZ4A 3T9ZA 1OKJA 3FCWA 4ALZA 1S99A 4YOVA 2XY7A 1YJ7A 1SQFA 3C8YA 4PEOA 4RW6B 4X2BA 3W66A 3VA0A 4DTMA 4EIAA 5FIIA 2XMMA 1KD1O 2OFHX 1RHUB 3TZZA 1WJ9A 3JS9A 1UFWA 4IYQA 3SQGB 3HXMA 4EBDA 3VGMA 4Z4CA 1YQHA 1YRTA 3QIDA 2IVNA 2DTJA 3C16B 4WF9Q 3CCRN 1H6KX 2F8TA 1JLBA 1XMBA 1X5OA 1WBBA 1BWEA 4YP3A 4ID1A 3M8QA 2V9WA 4PPDA 3O9SA 4M5GA 2LQ5A 4ZMMA 1VSEA 5KT2A 3LP0A 4FXDA 2XHCA 2H5EA 2UXBK 3M8PA 4TKTA 5L8RC 4GO7X 1XMQK 2MZSA 2LXFA 1RTJA 3MPVA 3TUJC 1VMBA 4M5JA 3BKFA 3LPEA 3WZ0A 3CCSS 4PYDA 3P4IA 4AL5A 4ZJQA 1RHKB 4QIGA 1REGX 2D5RA 4DV2J 2IM3A 1RP5A 2DGOA 4Q44A 2WVBA 4QYZK 2A40A 4O3NA 3E51A 1CLQA 3VQAA 4PG8A 2EBEA 2H4YB 4MKBA 2CJKA 3H3NO 3ZNUA 3PRBA 1NJXA 5HRPA 2JLEA 1RBLA 3PIPQ 3QZ8A 4K4VA 3C6TB 3ZZYA 1W0HA 1PCAA 3Q7CA 3GJTB 1PIEA 3CHWA 5LMNF 1S6PA 1KVIA 4NPOA 1EQ0A 2RAQA 2FGOA 5LJWA 4OX6A 3L8BA 4OQJA 1B7YB 4OYWA 1FFGB 2FIUA 1N8RT 3OYIA 5KFIA 1K1QA 1HMVA 2NCKL 3GU0A 4HDHA 3DJCA 2FVSA 3M2VA 2HAIA 5B08A 1SV5A 1Y4ZB 1VQLN 4Y28C 3BYPA 3VGUA 4I2PB 2DNPA 4U9RA 2B4JA 1DFDA 3FLCO 5IT4A 5DRKA 4LRBA 1R6YA 2BJ1A 4L3KA 4IO9Q 2DCLA 3A5LC 1KD1T 3TAGA 3PRVA 4AM6A 2X51A 3M4XA 2IBKA 3VQEA 1RHRB 4ZP9A 4L3NA 1YAGA 4CLWA 3I32A 1DLOB 5LL6Z 4GV6A 4DF8A 5AT1B 4KC5A 1AFJA 3HT3A 3UNGC 1Y9OA 4HT7A 4PUOB 4M7XA 1GMUA 3VGSA 4FVCA 2UU9F 4K50A 3JQMA 2WBMA 4RWWA 5AFUH 4CO1A 4IJNA 1B3TA 3DLGB 1AZSB 4JV5J 4DR6J 1B92A 2DBBA 1NRKA 4LF4J 3DDIA 4W5NA 1JLAA 2M88A 2XTJP 3PG9A 4FZXC 1R0CB 2FB0A 4CHYA 1N6QB 4OYXA 1SQKA 4MK8A 3CJ9A 3KLIB 1B7FA 2R7XA 4EP4A 4DLGA 3CMAN 4YUDA 2KTQA 1U6ZA 4DTXA 4WYLA 1EETA 3QFUA 2PSZA 2PMWA 3LP2B 3DOLA 3QFWA 1LWFB 5IV3A 2C3UA 2C2KB 4DR1J 1PSDA 3ET6A 2R4FA 4JI6F 1TYQA 4ED0A 2MQOA 4DN9A 2N82B 3BREA 4JI3J 4FJJA 4B1ZA 3BN4A 5GADP 4KKOA 3MR3A 3CCES 4WBFA 1I94K 2FZCB 3MCOA 4TLQA 2N4CA 3V1RA 2P5OA 2GTDA 4YB1P 3MM5B 2VWJA 3ID8A 3W3DA 1F21A 1RAAB 4IDKB 3QEXA 9RUBA 2R7QA 1KSPA 1T6CA 4ZHRB 5C42A 1QAYA 4BQLA 1RHQB 1BOTO 3TQ1A 2FC0A 5F8HA 2KI2A 3SJJA 1Q16B 4BG8A 3M6WA 2W25A 1RACB 2P9EA 4G1QB 1N33F 1NZ8A 2R8JA 4B3RJ 3Q8VA 2Q31A 5M2UA 3L4QA 4TYBA 4XDDA 2XNQA 5TKYA 3UI3A 3G6YA 1EQMA 3VF4A 3MK6A 3PJWA 1NK8A 4OI0A 1QVFR 1E6YB 1T94A 4I2QA 5SWMA 5LMUF 3S3OA 2G8WA 4M5NA 1YGYA 3QICA 4O3QA 2HSEB 3ENOA 3M5RA 2SXLA 4X4TA 3SCXA 3LQVA 2W7AA 1OY8A 3LM2A 4I6WA 1ZTWA 2MXYA 3V2UC 1IN0A 4NCBA 4KYZA 4OJHA 3BY5A 1RCXB 4ENOA 5KOXA 2OPPA 1EARA 4JD2A 2C3MA 4JI1J 4NB4A 2KXHA 2IDOA 5HRRA 2FYXA 2IY5B 3PLAA 4U7BA 3DNCA 4LRCA 4CZJA 3W2WA 4AQYF 2P9LA 3SXLA 3OVNA 4HL9A 1IBLF 3D0IE 4RNNA 1NGGA 1HKCA 3CCWA 1KNZA 4M63C 3G8TA 4CLPA 4KBIA 1VQ5N 1V4SA 2ZJRQ 1OH8A 5HVHA 1YJ9N 3BO3A 2P6TA 1S9GB 4M8LA 2UUAJ 2GW8A 1MW7A 4FVMA 2Z1HA 1HW9A 4F3MA 1TKDA 1K47A 1U02A 3IN5A 3BZCA 1BQNB 2FJBB 4DCOB 4FL9A 1T8EA 3O1BA 5AQMA 4CEBA 3Q23A 1MMNA 1XJWB 3SLCA 4BDZA 3AGKA 2F4VK 1VC6A 1GLCG 1S49A 2HHHJ 2ZJQL 1TK8A 1KONA 1UP1A 2VCPA 3ISZA 3D68A 5A2QU 3BSOA 1M5KC 1HJRA 1T95A 3ZTSA 3LDLA 1EIYB 2R3VA 3T41A 2A5XA 4DMNA 1H2UX 1L3VA 4F50A 4JHDB 1R31A 2O1PA 4H5RA 2WOMA 1RNHA 5C12A 3VQBA 2UXDK 4K43A 4OPAA 4Y00A 4YQWA 2DTUA 5FLXO 4KFBA 1NJZA 1KLMB 2RRBA 1VC0A 3QJJA 4HTIA 5IS2A 2F8EX 2MKKA 2ATLA 2N7YA 3VGLA 4V19J 4WFNQ 3P38A 5AR0A 2QA4N 1PC4A 4OX7A 1RT4B 3NL0A 2GV1A 4Q2LA 2EVZA 4TQRA 4CGJA 3MFHA 3OJSA 3HFVA 3VQSA 3MCPA 4FW1A 3B4DA 3CJ8A 3M6VA 4LFBJ 2YWKA 3M05A 1HIYA 2MB0B 2MLZA 3ETMA 2D4WA 4EEYA 1U1MA 1VRTB 3RYLA 3FSXA 3CD7A 3MOJB 5HJYA 1DURA 5EXWA 2MKSA 5CZXA 3RW6A 4M5LA 2Y1LB 5DETA 4Y2AA 4BS2A 5EWGA 4M5MA 3M2RB 3BQ0A 3L0QA 3FQLA 4EWTA 2HQ3A 2A3JA 1HPMA 3C15A 1VR6A 2RN2A 4Y0WA 3VZHA 1JLFB 4K7QA 2QWNA 1MA9B 3WQPA 3W65A 1K8KB 1P1TA 4A8QA 2QT7A 4NXNF 1VBYA 3MMJA 2MY8A 4YOEA 1AXQA 4P2XA 4JI7J 2W2NP 2HHSA 4C1NI 1V4TA 3VPZA 1U4BA 1KQSM 3WDOA 1Z26A 4M3YA 2W4PA 3NOGA 1HYSB 1X9MA 1SC3B 3AB2B 4DQSA 2YH0A 1AFIA 2J6SA 4NLQA 2BJ9A 2W41A 2DCUB 4EFHA 4QIFA 4ISGA 5HBMA 5KT3A 5HATA 4I9LA 5DDRC 3A5OC 5F8JA 4DV3K 1S10A 4BR2A 4RJVA 1C0TB 1WAFA 5K20B 4ZCIA 5CR4A 1RDUA 4GO5X 4E3SA 4Z0UA 1RT1B 3VQ5A 2YKMA 2G0JA 1YIJS 4FJGA 2FDNA 1S97A 4H5VA 4QCLA 2W6KA 3C94A 5AQIA 4W5OA 2EWHA 5BR8K 5ETNA 1HJOA 2W8LA 1A0OB 1R0AB 5HMYA 4M94A 4PWDA 1VQ8S 2X6SA 3AD9C 1XQIA 1EQYA 5LXRA 3C3LA 3PV8A 2G8UA 4KGKA 1TR0A 4F25A 1SB6A 4HVZA 1F5CA 1MU2A 3L7UA 4URSA 3ZZRA 1OH6A 1DY3A 2N4DA 1RCOB 3L3UA 1YTAA 1KQGB 3NRBA 4YOUA 1PJ6A 4RPFA 2B51A 5B0GA 2KKZA 2HS4A 1N56A 1RTIA 1EZZB 2V2VA 4KO0B 3VAFA 3OXFA 3JS6A 2UUCF 4A46A 5HANA 3E9OA 2KYZA 3HSJA 1CJTB 5GAHI 2OI2A 4OZ5A 3ENWA 3KKRA 2ZWPA 3TA1A 2FJXA 3LM9A 4DHVA 4XO0A 4CK1A 3L7OA 2EHGA 1T7PA 4DUTA 4I6MB 3J7AP 3G87A 3O6QA 1HQEB 4AHRA 2CUYA 4MYUA 5IZHA 1Q9YA 4DLEA 4IUFA 3KLVA 3G4SS 3MUMP 3GMGA 2RIJA 4KH0B 1EP4B 1FD8A 1S12A 2OMLA 2F3JA 4ZVOB 3MM6A 4F36A 4BC5A 4J7CA 4OYAA 3QT6A 1OIAA 2GMLA 2QX0A 1RISA 2MZQA 1UWBB 4NEYA 3K0JA 4RUCA 5LMNJ 1CQNA 1JQGA 4DSIA 1RHMB 5KT4A 5J1PA 3ZZOA 2W24A 2J0QD 1NGEA 2H54B 1H7XA 2NQPA 2M8DB 2HYIB 3Q7BA 1KFDA 3HZ6A 2ITGA 1NDKA 3LW5C 3CC7S 4YFUA 3DLKA 3A8JA 4WFYA 1X60A 3EZ5A 1FTRA 4M5HA 3P5JA 3V9XA 1HR0J 2YKNB 3OTDA 4RNHA 1S1XB 5C10A 3NAHA 1HWIA 3TPQA 5LSRA 4OYMA 4G9ZA 2OHDA 1EKRA 3PRDA 2NREA 1QZ6A 2FVRA 4B9LA 5K9FA 1RTHA 1VGYA 2B7CB 3EGWB 4DR7F 4RW9A 4CECA 3ZSYA 3GP9A 4DPTA 4ZITA 3GYGA 3HTVA 3IAS9 2LEAA 2VOOA 5IQ6A 3VV2B 3TZXA 2DR9A 2P9NB 1TU0B 3RRGA 1SJFA 5U47A 3MD3A 4LSNA 3ZTQA 3KMQA 3D2EA 1TFWA 3VTHA 3AVMA 4RU2A 2ASJA 3DRSB 3B8AX 2XB2D 3IGNA 4P7TA 2O8DB 2BV3A 2DHXA 4ZN1A 1BY9A 4ZVGA 4BE0A 1NG9A 5HL7L 3OVSA 2WZ1A 3KK1B 2HBYB 4R25A 2GVDB 2E9TA 4LBIA 1YRXA 4JNEA 2OLWA 4OX9F 4CFBA 4O4RA 4WFBL 3PFEA 4KV8B 3G0ZA 5E33A 1BI4B 2K06A 3CJRA 4CH1A 1JNZB 2UVUA 1RTDA 3CCLS 3D45A 3O5BA 4LREA 1KQFB 4JI6J 4CGIA 3NCRA 3O3FA 5G0RB 2V4JB 2G1HA 2P9IA 3FGUA 1VRUB 3LO3A 4CZIA 1NZAA 3IFEA 3RAXA 3AO1A 3KMSA 5KFYA 3G96A 2RB7A 3G6XA 3WX8A 3X1LB 2HQDA 5A8WA 4UY8T 3SNNA 2XYPB 3HVTA 3NMAA 4AYBD 3H6EA 2ATCB 3ZFVA 2CQ2A 3L2QA 1P27B 1D9DA 1TMJA 3OY9A 3V1QA 2E1ZA 3LPTA 1GLEG 4CHOA 1M5SA 1WKLA 1SS6A 3GFZA 2RHKA 1HARA 3A13A 3OXLA 4NMXA 4NLVA 3PHEA 4ZP7A 1TUYA 1D8ZA 3HFZB 1UVIA 3KXDA 3AVHA 2VV5A 4RG8A 4BREA 3RU0A 1NM1A 4FXVA 2DGXA 5K14A 3VN5A 1RDDA 3AARA 1SCJB 1T9UA 3OR1A 1TVRA 4DTSA 4RCHA 1GTHA 3P1GA 4IDHA 3IC1A 2EG2A 2YXLA 4M5DB 1Z4UA 4ISEA 1Q53A 4BRGA 3H8YA 2OPRA 2KM8B 5EUHA 1HNXK 1W2BR 2KW4A 1YZ6A 1T02A 3M8PB 4CZKA 4OKJA 5JVHQ 1HBOA 5LMUJ 3M6UA 3MAAB 1NJIO 4OI2A 3TUIC 4Q2MA 5J2PA 3BPDA 4FF1A 3GPAA 3I9ZA 4F8RA 4AHCA 4FPIA 3KLGA 3Q8PB 3V4IB 5LY3A 3NVKA 2W2QP 4JI5F 3CCSN 3Q8RB 2ATQA 3IKMA 4K0KJ 4BBYA 4MDAA 2P9KA 2CJAA 3S3MA 1UA1A 5HOOA 5ETVA 4PG6A 2HRUA 1YVUA 1DARA 3H5XA 2IC3B 3M8RA 3KOAA 3SV4A 1RT2B 1RA6A 4F04B 4CT9A 3FSYA 4DR2F 3CCUN 2D3O1 2A1RA 2DNYA 2E1RA 5DDOC 1IBLJ 2QFJA 4AE5A 5ETOA 3GR0A 4WF9L 3ASMA 4KGMA 3E2EA 1S6PB 3N4QA 2VUGA 1Y10A 2R7YA 3THXA 1SL2A 1YTYA 3D7EO 3KYLA 1XNRJ 3I6PA 3HO1A 3NNHA 1ZETA 4DU1A 2OTLN 1ILYA 1WOSA 4ETZA 1NB7A 3WNFA 3KK2A 2WTFA 4QW9A 2HBKA 2CA9A 3M2VB 1TV6A 1SV5B 4K5SA 4CW7B 2ZBPA 1IKXA 1CJVA 4JBCA 1FXXA 2NSCA 4OV6A 2V8GA 3H98A 3MAHA 3AHPA 3NMUA 3CJ5A 1H3DA 4BQZA 3J81Y 2IOCA 2A1BA 2DPIA 2XMAA 2V7ZA 2D7SA 2DNRA 5KQDA 3NDKA 4CNZA 1SC6A 4NLSA 3J7Z5 3MN9A 3OYFA 4CO4A 5CA5A 2V94A 4PL7A 1S22A 3MPYA 3VAGA 4FNHA 2LA4A 4J9LA 1J5OB 1QQOA 3PIPL 3BQ2A 4BRDA 3UD4P 3OYEA 5AXLA 4I64A 1VQON 2AKWB 3UFCX 2F8MA 2Q97A 2IYGA 4OI4A 3FFKB 5AXNA 3UCGA 3G6ES 3P4UB 3FJ2A 4F0HA 3FQKA 3D28A 1ASVA 2W9BA 4JYAK 1H38A 1HNWF 2E5LK 3CCJN 2VKRA 3CJCA 1AUDA 1T44A 1YT3A 3NGTA 1RHJB 1UAXA 2CJQA 3WNHA 1EETB 1N54B 3MR2A 4FZZA 4Q43A 3VGKA 1IO2A 3NWGA 5GMEA 2OP5A 3KLEA 4OLPA 4RW7B 4HT5A 2V63A 1U09A 2ZGYA 4FPAA 2MQNA 2EK6A 1U47A 1GOAA 2HNZB 3TTDA 1ZBFA 2MKJA 1TYQB 4J9MA 1SIWB 2MZJA 3P5TL 2M2BA 2XBPA 1I94F 1LW0A 4PQUA 2FZGB 4JV2A 4EBEA 2RE2A 4FF4A 2NR0A 5F0XA 2J6UA 2RMLA 2Z2YB 4QW8A 4WZQA 2GNKA 2COLA 2B6AA 4CLKA 2IDEA 3OUYB 4LVOP 1C1CA 2NLXA 3TSQA 3GJRB 4ID8A 5EX5A 1JJHA 4EUVA 4GV3A 4DX7A 5K5MA 2W7OA 1JK9B 3IWLA 4I7FA 5LSLA 4ECZA 5DM7Q 2BM0A 4NOHA 3H7HB 5C42B 1SBRA 4FM1A 3KUHA 1XBWA 2B3TB 2CPXA 4FF2A 3IG1A 3HD1A 4FLZA 5D15A 3AVCA 4IG3A 1Q95G 2QG9B 4NA1A 4N7TA 2V5HG 4M3ZA 1HBMA 2VBYA 3CPEA 4CLTA 5KAKA 4FPBA 5B0DA 1T3OA 5DJBA 1JXEA 2PC6A 4I2QB 4HHHA 3QO9A 1XNQK 5E41A 4JS5A 2XC9A 4Z37A 3SCKE 3BQ1A 1JMTA 3W0LA 2HWTA 2GELA 1NO8A 1RE1B 1YJWN 3O3GA 3MR6A 1DQ8A 4FK0A 2MZTA 3BO4A 1PAEX 2RDJA 4WPAA 4DR5J 4DSFA 3Q8SB 3EGVA 1NK5A 4BC3A 3PEJA 4OYZA 4USTA 3BF3A 1Q86O 4JD2B 4ZP6A 1OY9A 5KFUA 2P9LB 2MGZA 3GR1A 3PHTA 2UYTA 4BACA 3PACA 2YBVA 4QBUA 1MMDA 5HQMA 1NMNA 3O9TA 4JI4J 3W8GA 1HQ2A 3AA5X 4MJKA 1CVJA 4E7IA 3ZO7A 1KTVA 1Y00A 3AFGA 1K6YA 2ZH5A 1IKVA 3VF2A 1NWKA 1T3VA 5ETSA 4URGA 3Q8YA 1VQSA 3ZT3A 2VDIA 4FNIA 5AJ3K 3TI0A 3F9MA 2JLGA 1VSFA 3NP5A 5AQTA 2BRKA 1YUWA 2G1DA 4J9QA 5KFAA 2X3DA 3NCQA 4KFBB 5KFGA 4JI8F 2OTJN 2CYYA 2HGNA 3BP8A 2MHEA 4DV1K 1P9YA 3CC4N 5HRNA 3GE1A 7FDRA 1VJQA 5CYJA 1QUPA 4BCAA 4QQBA 2NXEA 4C7QA 1VK8A 2VIHA 1CC7A 5L9NA 3ZT2A 3IR5B 2Q1LA 3OYCA 4C97A 1HWUA 4QAGA 3ZZZA 3EZWA 5L1IA 3NE6A 1HD1A 2OEKA 4Y2CA 2IBOA 2VGNA 2V51B 4DV7F 1BISA 2HQIA 3C14A 5F3TA 2QEXN 3HSTB 5CABA 3K5LA 4B1YB 2CPIA 3RMDA 1ZZNA 2FHKA 1DZ5A 3HULA 3IP0A 1YBUA 4GV9A 2GHVC 2GVZA 4ZPAA 1WOQA 3L2VA 1Q86T 3R27A 4I68A 2HQGA 4C0HA 2JX2A 4ER8A 4I1TA 7FD1A 3DOMB 4N47A 1OWXA 2K8GA 2DNNA 2JLFA 4UY85 3BDPA 1MG7A 1V3RA 5DGBA 1YI2S 4WFNL 3T1YF 3GYNA 5AXMA 2CNLB 2HHXA 1VS3A 2JNJA 4ZPWR 4LUBA 3NH1A 1NKBA 4OX9J 3I0SA 5FPDA 4GY2B 2VYPA 5JUMA 4DR4K 1BUPA 1NGBA 4QOZB 2GV9A 2MZ1A 3NY0A 1FNOA 1F9FA 3H1VX 4HHTA 3WXKA 4WXOA 4QWBA 2KFNA 2P9GA 4QYRA 1TP7A 1NU0A 2E2QA 1HNZF 1GLFO 4PR6A 2M7SA 2P9SA 4ECXA 2HBQB 4X4PA 3ZT1A 3H08A 1TL3A 2V67A 1S59A 3AV9A 1PBAA 3BB5A 5B0EA 2ZD1A 1N5YA 2QMWA 3DOKA 3F41A 3NMRA 5LM7E 4ZOSA 3CDWA 4WIQA 2VWBA 1I6JA 1OY6A 3MDFA 1K73T 1NB2A 3I55N 3CCQN 3A3PB 2R42A 4N41A 3DLEB 3T5LA 1D4XA 4S0MA 4PWDB 6FD1A 2HFNA 4CYUA 3CJQA 3TUPA 4EMDA 1MWYA 2CG8A 4URQU 1MU2B 3ULHA 5FD1A 5FLXY 2UXBJ 4CLZA 1IBKF 1KBRA 1XHXA 2PA8D 4J9VA 4A8SA 2H3GX 3O5TB 4AHTA 5K8OA 1XMQJ 1HWKA 3E9PA 1Q5VA 4RW8B 1GMVA 1CEZA 2PYLA 2VASA 3HHLC 5KFMA 1FA0A 5BRDA 3HSCA 2EBGA 2XY5A 2KDOA 2VQFK 1M5OC 3B54A 1Q79A 5ETTA 3GIRA 3HYFA 1E3MA 4OJRA 2A2DA 2B8QA 3UKRA 1PKUA 4QYZJ 2J9CA 4OPJA 3KVGA 1U0HB 1HPZA 1H2TZ 2B8PA 4IH5A 2BM1A 3O8WA 1T03B 4DX5A 3QGHA 3GDQA 1RWKB 4JS4A 3QMQA 3THTA 3MTKA 4PKIA 3A8IA 3LDNA 2K3IA 4FS2A 1YJTA 4H54A 3OVAA 3CJ0A 3MECA 2LEPA 1VQKS 1JXLA 3UR3C 1SJQA 2ZM6K 4DR3K 1RT7A 3W64A 1ZH5A 3WEEB 1LAVA 4R5PA 1GNKA 2Q43A 2PD1A 4B3OB 1T9YA 4DV5K 3ZSRA 2LLZA 1WSVA 4OJ1A 5BN9A 2N3LA 3QIPB 3L2WA 3DI6B 3F56A 4IG0B 2CAJA 3CMEN 3PO4A 1G15A 4BRPA 4MMOA 2HVZA 2XYGB 2EKNA 4ZP8A 2QWLA 2C1EB 4W90B 3LWLA 5L38A 4CJ4A 5HSPA 4DL4A 3B8HA 3SSRA 1FE0A 1GXLA 2YV0X 1S6OA 2WONA 4CF9A 2HF4A 4Q45A 2VU5A 1N48A 3MURP 1XC9A 2FD2A 3RZAA 2IAJB 4CJ7A 2YJEA 5K8PA 2I8EA 3V6KA 2R8IA 1MWMA 5ADZA 5J2NA 3L09A 1KAXA 1UVJA 2LCWA 2ZQBA 1S48A 4KQZA 3VQTA 2YY3A 4KB7A 2DRDA 1X8DA 4PZVA 5H9EK 4FVUA 4FWMA 2WC9A 1S6QB 1IUJA 2LEBA 4WP3A 3C0BA 1KCFA 4DZDA 1VYAA 3K0SA 2NZCA 3D7SB 5C24A 1UPMB 1T9XA 1I1GA 1EKEA 3L9ZA 1WNEA 2AQ4A 2HBMA 2KLAA 2M8HA 3AVFA 1UKUA 2RQMA 3LALA 2XI2A 3CMQA 4QJVA 1UZDA 2I0XA 4NI2A 3FBCA 2QSFA 3C6HA 1ACMB 4RW4A 1LK5A 3CC2S 2JJ4D 4E7HA 1A5VA 4I69A 2E6MA 2P9PA 3FZMA 3U9DA 4FM0A 2O8CB 3DLLQ 1ZYQA 1ATSA 2XSJA 2DNMA 3MTJA 4CT8A 1IG9A 4A62A 2RRNA 3K7RA 4W92B 3KLFA 1RTDB 5D4NA 1ATRA 1E4GT 3PKYA 1F5BA 3DXSX 3CCLN 3QEWA 1P8ZA 3H3OB 2CDQA 1NBEB 4DV0K 1I94J 4B3MK 2PFFB 4ECVA 1ZM2A 4JP8A 1HNVB 1BGXT 2BA9A 4QWEA 5D77A 4YDDB 1OO0B 4DQRA 4X64F 4BRQA 3OJUA 4DUYF 1FWLA 4K8ZA 1M5PC 4WU3A 5T7LA 4CDIA 3D1QA 2DITA 4UZCA 4CI0B 1FKPA 3PDNA 3EPIA 1NHKL 5M1PA 5BPNA 2HMPA 4OKEA 3FMBA 1SI9A 3ZNJ1 1XMOK 3NGKA 2RHSB 1J9AA 1V6HA 4NRUA 1CLFA 3WIUA 1Y3KA 1QSLA 3P45B 1RGVA 5K14B 4DU8A 3NG8A 4DUZK 2D3UA 2DFFA 3GFHA 3J81U 4DZ6A 3KJVA 1R7IA 1TKZA 2FBTA 3RSEA 2RS8A 2XHBA 3RJMB 3WC2A 3L4IA 2DHAA 3JXUA 2Z0GA 2EWSA 5J2PB 5E26A 1WKJA 4U7CA 1KKHA 3HX9A 2POKA 5AQXA 2HZAA 3KLGB 3FBBA 4LF6K 3Q8UA 5D4PA 2GIFA 3PUFA 2UXCF 3SUPA 2VICA 3NKYA 3QWUA 2NZTA 1FNMA 2VG6A 3HF5A 1NH7A 3NCPA 3AA4A 4JRPA 4MIWA 2ACMA 2U2FA 2QWQA 1H1VA 2ZITA 1VQ9S 3PW4A 3R8YA 2JVRA 4CO2A 4EK2A 3BBCA 1NU4A 4NXMK 5DG9A 4JKAA 4USVA 2RQ4A 3THXB 3CJKA 1RDWX 4FO0A 5AQZA 2KJWA 1VJWA 4LF8K 2BE9B 4ZVUB 3ATVA 1UVKA 4BRKA 5HK4A 1XC3A 3K9KA 1HLWA 2J76E 3NXZA 2MKIA 5JVHL 4Y1DA 1KN6A 3GQCA 3CJBA 1VQ6N 2HIQA 2HAFA 5CYQA 1TV6B 2G8VA 2DNLA 3VGTA 2FTRA 2GUIA 5GAGI 4Z94A 2APOA 2HEKA 2UXDJ 4RW6A 4C8ZA 2P51A 1IJFB 1DHMA 4W5RA 3PO5A 3SQGA 5CE3A 4CZLA 3PX0A 2ZFHA 3O4QA 1E4FT 3O8MA 3PW7A 3KG4A 4KY3A 3CCRS 3C16A 2A3ZA 5KFNA 5G4DA 1W2IA 4NLCA 2CPHA 2B4PA 2M0GB 5JICA 1FTCA 1RB0A 2F63A 1ZA2B 4H4KA 3A5MC 2H9ZA 3MMBB 4W5TA 5EX3A 1YWXA 4AHSA 1UETA 3R1XA 2A10A 3DLBA 4HH0A 2W9BB 2ZGZA 3G86A 3DLRA 1CJUB 4GKKK 1IBCB 2F9WA 2VQEK 2JSXA 2P5VA 2R2TA 3SMZA 2V8HA 4NYOA 1M1GA 1ZOTA 1NUEA 2AGOA 1J5EK 4CO3A 2KN4A 4L75A 4NZ7A 4QOTA 1H2VZ 4QR0A 4GC7A 2K1RB 3EXCX 3RUBL 4DV4K 1NBWA 4I0WA 4X4SA 5EY4A 2AX1A 1MSWD 3W7BA 1DEJA 4G6VB 1RBOB 3O6WA 2Q1NA 2MYFA 1JLCA 4KJIA 4C3LA 3KTQA 4UF4A 5KGXA 1IKYB 3DXMB 3ENHA 1LW0B 4P6QA 2DXFA 4CHNA 4M95A 3I0RB 3T1YJ 3K5NA 3I8BA 3V81A 2NS1B 2XSFA 3D2WA 1G3OA 1C1CB 3OHBA 4CJUA 1VK0A 4Q0BA 3L7PA 4U8VA 2WBNA 1WD6A 4DV3J 1EO1A 1RAGB 2FSJA 1UPPA 3F9KA 4I7FB 1VQLS 3MHYA 3HBTA 4H03B 2B4OA 4U8YA 4I2PA 2YNFA 3CETA 2UZAA 4NCAA 2HHUA 2V4RA 1RWVB 2Q0RA 1CQMA 3K9JA 3J80U 3OBYA 4U7UD 3IR6B 1LK7A 2IIRA 1FK9B 5A8KA 4FCYA 3MWTA 3VQPA 2XS7A 3RB3A 3MAQA 5DS7A 4B1XB 3E66A 3D5MA 4P10A 5IWAF 3CTRA 2ZH8A 4DV6F 1DLOA 4R8UA 1NEEA 3VAJA 2YJFA 2IPOB 1LQ9A 3M9OB 4CRJA 1XR7A 2YX6A 4PUOA 1G1XA 5DQGA 5IC6B 4A8FA 3HT0A 2P2CB 1KRPA 4BE2A 1AZSA 1N32F 4UOFA 1QQCA 4H0OA 4YB6A 2OPSB 2IVFB 3K2PA 4HH1A 1YZ7A 4PKHA 1N6QA 4M41A 2HVHA 2I7PA 1WSHA 4NLDA 1HHQA 3KLIA 2OSQA 3CMAS 5AQKA 1WNSA 2QKKA 5DM7L 1YDLA 4NLWA 4YY3K 2OELA 2E4LA 3K5OA 3WX4A 5ETKA 3ID6A 2E1YA 2MGZB 4E7LA 4JI0F 2Q6CA 2HHQA 3FKBA 3KKSA 1BU6O 1VDHA 1LWFA 3DHWC 5FRMA 3OL7A 5IC4B 1NM2A 1T9TA 1S3XA 5SUHA 4TLRA 1B4SA 4DB3A 2VC0A 1A5XA 3SMSA 2Y1RI 2HHPA 2V8VA 5BR9A 2M3DA 1RT6B 1N5SA 3S7RA 2NRZA 4M3UA 3GG1A 3TP2A 4U95A 1M0SA 5KFJA 1EKSA 1SH3A 4OGCA 2J7WA 3KG1A 3K57A 1SH2A 2J4RA 2CH6A 2AJFE 4IDKA 3CT9A 3SCJE 2AD9A 2PGCA 1IBMF 4OGEA 2O8FA 3LANA 3NAEA 2WK4A 4I6AA 3R6LB 4NA2A 3H25A 1X5TA 1S72N 3O3HA 3OYMA 4J9KA 3CI5A 4G1QA 3EGNA 3N28A 4Y34A 4IOCQ 4DTJA 1E6VA 2C2ZB 2M52A 4ZVSB 1D9AA 1B0PA 3LPUA 4BC9A 3O9UA 1U1NA 4AM7A 1LCUA 1YJNN 2DHSA 1BQMB 1ZBLA 1E6YA 3FZKA 4C0BA 3O80A 4V19S 2ADBA 1C0UA 4DQQA 2OH2A 5HVGA 1HYZA 2J7KA 3C14B 3EVOA 4PWWA 3NGIA 3QDKA 4B9QA 5L46A 2C2OB 2V9KA 4DU4A 5DQHA 3THYB 3W8PA 1KLNA 5EDWA 1IKWA 3CIZA 3AOCA 1VIXA 2V7YA 2RF2B 3QB0A 5AQUA 4OIXA 3W5ZA 2GQ2A 3ENAA 4LBHA 5H1SV 3O1WA 1JJCB 4JI2K 5HQ8A 1BC6A 1BD6A 4DDFA 1NLKL 2EFOA 4FJ7A 2KB2A 1REVB 4CCHA 3SI8A 3L4BC 2KT5A 2C42A 2HVDA 2W2OP 1QD1A 4ED3A 2KH9A 5D8HB 1C4AA 3ALYA 2HMIB 4KTQA 3N6LA 2P1JA 1YI2N 2E1AA 3TAEA 2AZ1A 2FZKB 1TK5A 2ZE2B 3TA2A 2QWMA 3H2VE 1VQ5S 1NSAA 3PR5B 3MCNA 1EXQA 2BMBA 3I0SB 4WK1A 4QPXA 2VWKA 2GA7A 1BQNA 3Q2SC 4R79A 2A42A 2V2QA 3GILA 3R2CJ 1R8HA 2KJVA 2D1KA 3M30B 5KG1A 4CEOA 2P9SB 3OS2A 4CWBA 4FBTA 3I5AA 5AXKA 2RPIA 3HM9A 5FROA 2HK2A 3EMTA 4X64J 4KHPF 3O4NA 4RLEA 3MCSA 2ZD1B 2PYJA 1U1PA 3M9NB 4CBXA 2J9DA 2QA4G 1TUGB 1KLMA 2AX0A 3BZKA 5H9FK 1S4EA 4KTWA 3ILJA 1QLNA 2QA4S 1MN7A 5EWFA 1RT4A 3O9QA 2X1AA 4C8NA 4X62K 3G8SA 3OHAA 2ZHBA 2F1FA 1NMEB 1WDDA 4FWPA 2CQIA 4JV5F 1QJHA 4D3HA 4DR6F 4LD0A 4LF4F 1HNXJ 4OZ1A 2CPEA 2MLXA 1BWFO 2GQQA 1F9HA 3U4LA 4O4GA 3PYDA 3IM8A 2IVOA 2AJ4A 3HKZD 1WSRA 1NGJA 1N5QA 1O51A 3Q24A 2DKOB 4CVNE 2FSNA 1SKRA 1HA1A 3VTIA 4IEIA 4WFZA 1YJVA 2BBEA 5A0YA 3VA3A 2CQ4A 3CUNA 3CD6N 3Q2TC 4O3SA 3M2RA 4FWNA 2M4MA 1RWWB 3PM9A 2W2MP 2W8KA 1N4LA 4DR1F 3PJXA 5GAGP 2E1CA 5JVGQ 2UXCJ 1HPZB 5BYSA 2FC9A 2CPDA 4IFVB 4DSJA 4QIEA 4DU3A 1VBXA 2ZM6F 1Q0NA 1RJJA 2QC3A 4DSKA 3OR2B 1I39A 2GJIA 5C5JA 1RABB 3MECB 1GAOA 3MD1A 3H46O 3BJYA 5KG2A 5GMKa 4WQ4A 3MXMA 4GRSA 1S0NA 3MM7B 1T9WA 1HYSA 1Q1KA 1RT7B 3D1HA 2YHXA 4LFCK 1BIUA 1SVDA 4R5PB 3NVMA 3QEPA 4E1NA 1TAQA 4CEAA 4YOWA 1FXDA 3D54A 2QW9A 1SKUB 4WFXA 4LQ9A 5A2QO 4UOGA 4K42A 4B02A 2ZVIA 1WF2A 2OCEA 1M1KO 1C0TA 5GAHU 2KG0A 2PZSA 2MJNA 1NNEA 4CM0A 2UUWA 5CQGA 3O9RA 4TYAA 1IXKA 4DV2K 4WIIA 4I67A 4WYBA 1RT1A 1HFEL 2CQ0A 3MFIA 2CQHA 3K8WA 3T6JA 3FZBA 3AVJA 4R0EA 4Y6IA 1ZBHA 2ETJA 2P9CA 2KU7A 2VODA 3GONA 1MDUB 2GMHA 1D8YA 2ALZA 5J2NB 4PABA 3N9UC 3GV8B 2F65A 1TQLA 2YQ1A 3QZ7A 5KOWA 1MWQA 2AWZA 2BJ3A 3GBTA 3QNOA 3AGRA 1XEZA 4KRFA 4CJ3A 3GSIA 1W7WA 2BQRA 4IZ9A 1PILA 1C0MA 4JI1F 1JXBA 4KO0A 4O8KA 5ADXA 2QLFB 2QWRA 5ETLA 2DNOA 4QZVB 1CJTA 4CGDA 5CD4H 4LIRA 2WVDA 4EGLA 3IR7B 5HJXA 2DO4A 4ELTA 1RYSA 2O4IA 3U7JA 1GH8A 4OHWA 3FNNA 4F3OA 4X66K 2GCFA 4DV0F 1AW0A 5E5NA 3DFEA 2G4BA 4IR9A 5FDLA 5KFPA 4F3TA 3VGVA 4ZTFA 2B7BB 1EP4A 1V9OA 3VAIA 4GKJK 2JC0A 3TJ8A 3OYAA 2HHHF 3KJQB 4CI6A 1KC8O 1HI0P 5KFFA 2NXUA 2B4VA 2R2SA 3NHGA 3DRRA 1UWBA 4Z4FA 1HBUB 1KFSA 1NOZA 3GIIA 4ED2A 4X4NA 2XMVA 1FHTA 2BE7D 4Z4IA 2E2OA 4ATNA 2YHAA 4DOZA 2D0OA 3UNYA 1WG4A 2IS3A 2IA6A 1M1KT 3A3NB 2YX1A 5DDQC 4PG5A 1FWKA 4FLYA 4IFEA 3UR0A 2PMZD 2FHMA 2HVEA 3T5KA 2LQJA 1U6FA 3CQ8A 4ECWA 2XNRA 5IQQA 3JXOA 1S1XA 2E1PA 2KHDA 1R0BG 4ETXA 4HYKA 4ES1A 3DLLL 2Z58B 2OEMA 4OMFG 3S41A 3T1HK 1XNQJ 3TX0A 3TQEA 1GOBA 2I38A 3HOSA 2MTLA 5I3UA 1QS4A 2EG1A 1U1OA 1TKZB 3MXHP 4HKQA 4JI3K 5IWAJ 4DV6J 4O55A 1KVAA 4ZLPA 5IFMA 3QGGA 5HQLA 1P90A 1ZXOA 4J2BA 2QA1A 1NKCA 4KHQA 3SYZA 2P9NA 4J91A 2M70A 3V5RA 3DDKA 2J9DE 3AVGA 5CH7B 3M8SA 1N32J 3K2YA 3R1LA 2W6LA 2HLUA 1TMMA 2MQQA 3DRSA 4PL8A 3G10A 2YQ0A 4KRWA 2QYGA 1N5VA 2D41A 3M1VA 4YDUA 2VG6B 4CTAA 2CQ3A 3HPGA 2DR7A 2GVDA 4WP8A 5I4MA 4N8NA 5KG4A 3RMCA 3JQKA 1NDCA 2I9SA 4W4MA 3FEZA 4B9UA 2ZNYA 3UDEA 4LF5K 2XLJA 2F7VA 2R8HA 4KV8A 2EK1A 1BI4A 3NWRA 2DY4A 2KKHA 3QAEA 4OHXA 3CJKB 1X4FA 4B3SK 1MWZA 4DBQA 1OSCA 3BKUA