5CYQA

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
548
structure length
548
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 154
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cyqA05
1GX5A 4ZVEA 1RNHA 1RT4A 4FJ8A 3OL9A 1SV5B 2YKNB 3PX4A 3NFAA 3V1OA 2WHOA 4ECTA 4H4MA 2D0BA 2OPQB 2E9TA 3KKSA 1BQNB 3DMJA 4QW9A 1OS5A 4H54A 1HQEB 2IGIA 4ELVA 3ZSVA 4FLZA 1D9FA 5HLFA 3P83D 1WSGA 1ASWA 2Z1GA 3ZT2A 4OGCA 3V4IA 3SUPA 4RW9A 4HCCA 5FDLA 1EKEA 1Z26A 3I5BA 5KFRA 3H5SA 1Q9YA 1X9MA 4M95A 4Y3CA 3SJJA 4DU3A 1S1WA 4XO0A 3OYNA 4YR0A 4J9OA 4ZVHA 4FBUA 4GW6A 4CJ4A 5D3GA 4E7LA 4PA1A 4J2BA 4CGHA 3M8RA 3KNAA 5CYQA 2FJVA 1SH3A 2BANB 4YMEA 3KOAA 5JS1A 4FLWA 3FFIB 2WOMB 1ZBLA 2F8EX 1KFDA 1JLFB 4EP4A 4NCGA 2JEIA 2A1SA 2IDOA 3SQ0A 4KHRA 2AGQA 1BI4A 1NK8A 4Z4FA 4IR9A 4FVMA 2GUIA 3RB3A 3AO3A 4NLUA 3VQ9A 2W8LA 4KREA 1S1TA 3KJVB 3SQ2A 1TKTB 1T03B 5J2MB 5J2QA 1T05B 3N6MA 1LWEA 4G1QB 2IM1A 3OS1A 3RB0A 3AVLA 1NKBA 4O44B 4CEBA 3VQDA 3KK2B 4ZPAA 1XI1A 1RYSA 4HCBA 4FCYA 4URSA 1KCFA 3SCXA 1S9EA 5JUMA 3CJ0A 3AA5X 4KBIA 2HHWA 3C6UB 4I7FA 4CJVA 2W9BA 3OY9A 3OYCA 4M3YA 2VG6B 2OPPA 5KFTA 1MU2A 1JX4A 4H4OB 4IQXA 2CJQA 1TKXB 4ECWA 2YNGB 5SZTA 4RW6B 3L8BA 1RBVA 2D41A 4DQRA 1WN7A 3NH2A 5I3UB 1VSLA 1VSIA 2DY4A 1TKZB 3DLGB 2VA2A 3MECA 1DLOA 3OS2A 1KHVA 1IKVA 4FLTA 1D9DA 3LAKA 3OS0A 3PR5B 2XCAA 2D3ZA 4DL7A 3EZUA 2FC0A 1B92A 4Z4IA 4ZVGA 1IKXB 3MEEB 3P5JA 3DRSB 3LAMA 2V4QA 1VSKA 1XR7A 2XI3A 3S3NA 1QSSA 1KLNA 5KG6A 4LSLA 1CZ9A 4AHVA 2AGOA 2P5GA 3KK3B 4IR1A 4ED3A 4WYWA 3OYFA 4TY9A 4FJ7A 4B9LA 2FVQA 5DMRA 1C6VA 3V6DA 1LW0B 4KKOA 1VRTA 1RTDB 2VG5B 1RA7A 2E9RX 2IC3A 4E89A 1GOBA 5DGAA 1EETB 2EC0A 3KLEA 4FW2A 4DTJA 4NLXA 3VQ6A 4MFBB 4J9PA 3OJSA 3KLIB 3IG1B 4FJ5A 2BQUA 4FK2A 1TL1A 4EO6A 3CDUA 4M3WA 2BQ3A 4Z4CA 4F2RA 3M8PA 3QEWA 2OZMA 3ZSQA 2BGGA 3AA3A 2Y1JA 4FJHA 1BISA 1FKPB 2YKMA 1N56A 4DQSA 4E7KA 4O4GB 2JGUA 4M42A 3PW2A 5K14A 4CEQA 1C1BB 1S9EB 5J1EA 1BIZA 2ATQA 3AVAA 5J2PA 2X6SA 4YNQA 1XHZA 2OA8A 4Z4EA 3THVA 3NGIA 1C0UB 3TR8A 3MF5A 3CJ3A 4AHCA 4ID5A 4MKBA 3AVMA 5DQHA 4IKAA 3PY8A 4O3QA 4HUGA 1S9GA 1DLOB 5KI6A 4Q44A 4O3PA 3G6XA 5F9NA 1KHWA 4IG3B 4F4ZA 2WONB 3I0SA 2E6MA 2ETJA 1RTJB 3OYLA 3BJYA 1JL2A 3KLHA 3KHRA 4U6PA 4DTXA 1HYSA 3T1AA 1T94A 3LZJA 1NK9A 1C1CA 2HAIA 3L3UA 4QWAA 3LDSA 4KAZA 5EDWA 4FK0A 1UWBB 4RW7A 4NLTA 2HMIB 3VA0A 2B5JB 4BDZA 3ITHA 3L2RA 4JRPA 4KV8B 1VRTB 2RDIA 3EPIA 5L1LA 2ILYA 2ASLA 4O3RA 4TLRA 1U47A 3AO4A 4F4WA 4WZQA 4AHTA 4M3RA 3NAIA 1JLQA 2KQ2A 3CQ8A 3DM2A 2IOCA 1NNDA 4ZMMA 3T5JA 3DOKA 3DI6B 2O4IA 4MQ3A 4URGA 4HUEA 1JLBA 2ZD1B 3FRZA 3V9XA 4CJKA 1RTHA 2AWZA 3Q8QB 3ZT3A 4B9SA 5L9XA 4C8MA 4E7HA 1VK0A 1HNVB 1HNIB 5J1EB 4OL8A 5J2PB 5CZ2A 3GIIA 4NRTA 3O3HA 1FK9A 4FJLA 1LWFB 3U3YA 5KFNA 1A5VA 4I2QA 3HXMA 1S0OA 3H98A 3DOLB 3HVTB 5HRSA 3OHAA 2GBZA 4CIFA 3L2VA 4LQ9A 4RUCA 3HO1A 3KLGA 4ED7A 3FDSA 5F8MA 2QV6A 4E3SA 5KFCA 4CJUA 1ZTTA 2R2TA 1JLCA 3QIPA 5I42B 5KT5A 4FLVA 1WSJA 2BQRA 3Q8RB 2XGPA 3VQ4A 4WYLA 1ASVA 3MEDB 1NHVA 2FLPA 1QSLA 3KK1B 4R8UA 4DLGA 3FSIA 2V4RA 2YNHB 3IS9B 1TK8A 4CF1A 4HTUA 4DFJA 2FBVA 3ZSYA 3PV8A 4UQGA 4BACA 3ZCMA 4ZPCA 2HNZB 1S0NA 1L5UA 1SV5A 3JSMB 2YKNA 4CHPA 4K4VA 2GV9A 2XRIA 2OPQA 5HRPA 3V81B 1BHLA 4B9NA 3BSAA 4MH8A 1N48A 3O3GA 1L3TA 4Q8EA 3PUFA 4ZHRA 3C95A 4O55A 2C2RA 5EUHA 3MTKA 3LP0B 3HK2A 2QKBA 3OYIA 4DG1B 5DLGA 4RUAA 1BCOA 3AO2A 2X74A 1S97A 4CF2A 4JRQA 4QWDA 1CSJA 4AHSA 4DTOA 1IKYA 5KT4A 3NGZA 4W5RA 4FJKA 3TAFA 5SWMA 4DQIA 2D5RA 3NCIA 4Q43A 1QQCA 3HKWA 1TK5A 2BANA 4KFBB 3HPHA 4YFUA 2ZE2B 5KFIA 4PWDB 2R2RA 1ZETA 2WOMA 3TWHA 1JLFA 4CJTA 3C6TB 4CIEA 1NK7A 5FRMA 4ZP6A 1XWLA 4DS5A 4DSIA 2AU0A 1SH0A 4MIBA 5JS2A 3U3GA 1UA1A 1QHTA 4FZYA 1RDDA 3PX6A 4WZMA 1BCMA 3SPZA 3KJVA 2XC9A 4W5QA 4I9LA 3CFPA 1TKTA 4J9LA 3DDKA 5J2MA 3GQCA 4B9TA 2W42A 4G1QA 1LAVA 1VSFA 5EU7A 3HP6A 3ALYA 3GIKA 3Q8SB 4NLWA 2FVRA 2G8VA 4J2AA 4EO8A 3EYZA 4R8UB 1KLMB 3RMAA 1JLEB 4O44A 4Y1CA 5KT6A 4K4SA 5KFJA 3NAEA 3QZ7A 3CM6A 4WFXA 4DQQA 4MK9A 3O4QA 2KTQA 3DYAB 3KD1E 4KSEB 4M3UA 4JLHA 3I0RB 3N6LA 3GILA 3C6UA 4OJRA 2V9WA 3AVNA 3F73A 3NE6A 2VG6A 4C8NA 4H4OA 1IKWB 4KHMA 4FW1A 4K4TA 5KG3A 2X78A 1TKXA 5J2NA 1GOCA 2YNGA 4RW6A 2Z1JA 4JV0A 1YT3A 4RU9A 3H59A 5I3UA 3OYBA 1TKZA 3DLGA 4KB1A 4ZHRB 3RMCA 3QEXA 2HW3A 3GIJA 4DL4A 3CWJA 4ZP8A 3CVKA 4MK8A 1Q9XA 3TVKA 4O0JA 3S9HA 3GV8B 1WAJA 1SKRA 1IG9A 1WLJA 3OSNA 5HRRA 4TXSA 1C0TB 5C24B 1EP4B 1F21A 1IKXA 3MEEA 2B6AB 3DRSA 1IKYB 4N56A 4XPCA 2HHUA 3BQ1A 4ID1A 3KMQA 5F8HA 4ECXA 3K57A 1JXEA 1KVCA 3KK3A 3DRRB 4CEAA 2BR0A 2BRLA 3PVXA 2AJQA 3VQAA 4OKJA 4OLBA 1LW0A 2FJWA 1QUVA 3I5AA 1RTDA 2VG5A 2AX1A 1JLAB 1I39A 1ZBUA 1RT3B 4Y2AA 3SI6A 4PY5A 3RAQA 1RT2A 5KFHA 3DLKB 1EETA 4B9MA 3QETA 4EZ6A 3OSPA 2P51A 3K5OA 4E19A 4MFBA 3T5HA 4K4WA 5T7BA 3KLIA 2W8KA 4L8RB 3IG1A 3AO5A 2G8HA 3H5YA 2YHBA 5C5JA 1RCHA 4WE1B 1TP7A 3QERA 2FVPA 3IRXB 3M8QB 4DFKA 3KTQA 4KTZA 4KHWA 3OYDA 3AVFA 3VN5A 4CFBA 4F4KA 1FKPA 4CCHA 4KI4A 3LP2A 4O4GA 1J5OB 4DWIA 1TL3B 4J9RA 4OGEA 2IM0A 1C1BA 4N41A 3OL8A 3L2WA 1YTAA 3MEGB 4C8KA 2I5JB 5KG2A 1S6QB 3AA2A 4YQWA 1LAWA 3PJWA 1XC9A 1C0UA 3ISNC 5J2NB 4FYDA 1QE1B 4CGJA 1N6QA 5KRSA 3KLVA 3N6NA 4RNHA 5FROA 2DPIA 3HP9A 5DQGA 1TK0A 2P1JA 3CFOA 1L3SA 4KTWA 3V9ZA 1UOCA 3NMAA 4RNFA 4O0IA 3SUOA 3NDKA 3K58A 4K4XA 1RBTA 3PW5A 4B9VA 3ZSZA 4QCLA 4IG3A 4IRDA 2WONA 4FXDA 4K50A 4F4XA 3NGYA 2R8IA 1RTJA 4DTUA 4JV2A 1KSPA 3QEVA 3HM9A 3E01B 3CM5A 4NZ0A 4DL6A 3DRPB 4B3OB 4CJ5A 4CJWA 3V6JA 2G8IA 4DFPA 3M9OB 5KGXA 1WNSA 4BDPA 2XWYA 1UWBA 2HMIA 2B5JA 3ZSXA 4XPEA 4CK3A 4CEOA 4ECQA 4KB7A 3QO9B 1RTIA 2Y1IA 3BGRB 5KFMA 4KV8A 1RDBA 4NLDA 3CDWA 4QPXA 4E0DA 1RT2B 3ISND 4W5TA 4CF0A 3AVKA 3BSOA 4DU4A 3SZ2A 1S1VB 4NLPA 4Y2CA 4O3NA 4U7CA 5DG8A 1NJWA 2XY6A 1C1AA 2JEGA 2G8KA 1VSMA 3DI6A 1BGXT 4FS1A 2C2EA 2KW4A 1HQUB 4BE0A 1BL3A 2QK9A 3HPGA 4IRCA 3EZ5A 4DTNA 2ZD1A 1ZBHA 2ZKUA 4CEZA 2RN2A 3HL8A 1Q8IA 3LP2B 5KFWA 4J9QA 5JXSA 4KHYA 4Z4GA 1NJZA 3KHLA 1HNVA 1HNIA 4NLOA 3DLRA 3AA4A 1HYZA 2FBXA 3DLBA 4ECYA 1EX4A 3G6VA 1LWFA 1HMVB 2J6TA 4Y34A 3A2FA 4EYHB 1RBSA 3HYFA 1N6QB 4K8XA 3DOLA 4ICLB 2CKWA 1TKDA 2F96A 3HVTA 3QESA 4DL3A 5L1KA 4IKFA 3AVIA 4K8ZA 4FJJA 4FJNA 1LW2A 1EXQA 1W0HA 1JLGB 2V0NA 4Q0BB 3NF8A 1HJRA 5I42A 1FKOB 5KFUA 3SV4A 3SFGA 2D0CA 3MEDA 4FM2A 5C42B 4E1NA 4Z0UA 3V1QA 1VRUB 3KK1A 2D3UA 3G0ZA 1XR5A 4CGDA 3FQLA 2YNHA 1ZTWA 3IS9A 2YNFB 4DSJA 3G10A 3SI8A 5KG4A 5KRTA 1RTIB 1S1XB 2HNZA 4N76A 2HNYB 3JSMA 3KD5E 5KFEA 2P5OA 4QWCA 1IM4A 4KI6A 3SNNA 4YR3A 4AILC 3QINA 5C25B 5CZ1A 3V81A 1LV5A 1RT6B 2ILZA 3RRGA 5DG9A 3IAYA 3HVAA 3C94A 2EX3A 5KFOA 3PJXA 4BE2A 5KFZA 3ULDA 3RTVA 3ICLA 3QYYA 3QEIA 3LP0A 5KFFA 2WK4A 4CEDA 4DG1A 2PYJA 3T3FA 4ZP9A 1XHXA 1Z25A 3O4NA 3QIOA 2IS3A 4Q8FA 2IAJB 4IH6A 1VSEA 4NCBA 2DPJA 5L1JA 2C22A 2FVSA 3HHKA 1IH7A 3D45A 3JYTB 2AX0A 2D0AA 1KTQA 3SQ1A 3CG7A 4E1MA 2G8WA 3P1GA 4I2PB 1NJYA 5KG5A 3OYMA 4KHSA 4ED0A 3LALA 3UPFA 4GVMA 2IM3A 3K59A 1UA0A 4ECUA 3L2QA 4GC6A 1JKHB 1RYRA 4ZTFA 3NF6A 4K4ZA 2IJNA 4KFBA 1D0EA 2IBKA 2ZE2A 2I1RA 3RR8A 2RPIA 4PWDA 4RNMA 5KT2A 2FLLA 1K1SA 1B9FA 3H4DA 1RDAA 1WNEA 5KFAA 3C6TA 4ELTA 1GOAA 1HPZB 2A1RA 3DLEB 1W9HA 5L1IA 2W7PA 1RAJA 2IJFA 1HARA 1LW2B 3RMBA 3OYKA 4R5PB 5F8LA 3K2PA 4FJMA 1WAFA 5HP1B 4M3TA 4CECA 3KHHA 4OKKA 4DSEA 4CE9A 1RT1B 4FJ9A 3VQPA 4EP5A 1S48A 1S1UB 1KLMA 1JLEA 4DQPA 4FLUA 4J9KA 2G8UA 4IOBA 4CHYA 2F8TA 1DTTB 3ASMA 3VQQA 3D5MA 3LP1B 3DYAA 2W7OA 1TV6B 1K6YA 3K5MA 3LPUA 3H5UA 1JIHA 3I0RA 4MK7A 1RT7A 4IG0B 2HVIA 1IKWA 3D0PA 4JV1A 3GV7B 3SYZA 3T5LA 1YVFA 4F2SA 1A5XA 4NLYA 2R2UA 5F8JA 1S6PB 4LD0A 4CESA 3SUQA 3SUNA 3WNGA 4ECVA 3QLHA 1O1WA 3UQSA 3NF7A 3ZSWA 3QZ8A 4C8OA 4TYBA 5FRNA 5T14A 3KLFB 4EYIB 3MXJA 4CERA 4K4YA 4DS4A 1C0TA 5C24A 1EP4A 4C8LA 2B6AA 4J9NA 3SFUA 5DG7A 3HSTB 4DU1A 2ASJA 3OYAA 3RR7A 2E6LA 2W9CA 2GC8A 2FJXA 3WNHA 2RKIB 3OYJA 5KT7A 4KTQA 5HROB 4B08A 3DRRA 4OKEA 3MXMA 4IBNA 2BE2B 1J9AA 4CF8A 4TY8B 3PO5A 4HUFA 3Q8PB 1N5YB 1JLAA 3TANA 1RT3A 3AVCA 4AHRA 4OPKA 3DLKA 5KFBA 4ZTJA 3ZT0A 4KE5A 4J2DA 4RW8B 4B8CA 1HYVA 1REVA 4Q45A 1LWCB 4HVJA 4MKAA 3LWMA 2DFEA 4M3ZA 2VG7A 3MAQA 1U49A 2KFNA 2HWIA 4ZVFA 4WE1A 4ED1A 2HVHA 4LSNB 1SKSA 3IRXA 1D5AA 4FJIA 4IFVB 1YTUA 3M8QA 4KO0B 1I3AA 3QGIA 1CXUA 4NLSA 1X9WA 3SV3A 4RNNA 1T7PA 4QWBA 4F50A 3TAQA 1J54A 1J5OA 4FJGA 2QXFA 1VSHA 1TL3A 2IMWP 5KFLA 2BDPA 3MEGA 1RT7B 2I5JA 1S6QA 4URQU 4O3OA 5KG1A 2RF2B 4CJEA 4EBDA 4NLQA 3H2LA 1RT5B 1S49A 3IGVA 4B8AB 1QE1A 1TQLA 5KFYA 1C2PA 5F8IA 4J9SA 4EEYA 2AGPA 2WB4A 2HHSA 3QLHB 4N5SA 2R2SA 2JEJA 1WSHA 2GIRA 4YR2A 4GC7A 4KAIA 4KHUA 4HYKA 3OHBA 4CJFA 1DTQB 4XIUA 3NAHA 1S10A 2OPRB 2ZQBA 2FBTA 3MR3A 1GX6A 1RBRA 3HVRA 3IN5A 4NRUA 4I9QA 4BDYA 4NLVA 3E01A 3TAMB 4DTPA 4RW4B 3DRPA 2W9CB 2YNIA 3NH0A 4B3OA 2JC0A 2XY8A 1ZBFA 5KFSA 4KRFA 4M41A 4JS5A 2ITGA 4FS2A 3QGGA 2DTUA 3QO9A 1SUQB 2UVVA 3BGRA 4AH9A 2D7SA 4ED2A 3K5LA 3NBPA 1R0AB 2R7YA 4BWMA 3SPYA 1RILA 2OPSB 2R8HA 1SKWA 1QAJA 1REVB 1QAIA 3UDLA 4IRKA 4ZP7A 4IFYB 3MR5A 1S1VA 4ZPDA 2XO7A 3CDEA 2B43A 3TI0A 2VG7B 5KFPA 1WSFA 2RDJA 4FLXA 1HQUA 5KFKA 1NKEA 3WNEA 5HBMB 5KGWA 1U04A 3DLHA 2FLNA 5EWEA 2QKKA 4CGGA 3GV5B 2W9AA 5DGBA 3V9WA 3BQ0A 3MR6A 1KVAA 3V9UA 5KFDA 3ZT1A 1QSYA 3KIOA 1BQMA 1D1UA 3ZSOA 3AVBA 3BSCA 1UAXA 4CJRA 3VQBA 1SH2A 1HMVA 2XY5A 5CYMB 4KB0A 1MMLA 4Q5VA 3LWLA 4CIGA 4ICLA 1RT4B 4AHUA 4G3IA 3OYEA 4NYZA 2J6UA 1BIUA 3GIMA 3QNNA 1J53A 4H4MB 2ATLA 1VSJA 1U4BA 1JLGA 3VQ8A 4Q0BA 3VQSA 2X6NA 3DMJB 1NK0A 4NCAA 5F8GA 1FKOA 4HHTA 3MFIA 4CJSA 3KMSA 5C42A 1L3UA 5HLFB 1SL2A 1VRUA 2YNIB 4RNOA 3V4IB 1YVUA 4RW9B 5FDLB 3RBDA 1S5JA 4CK2A 2YNFA 4YP3A 1KRPA 3I8DA 2PY5A 3TQ1A 4CK1A 4KPYA 1S1XA 1S1WB 2HNYA 3B6OA 4CHQA 3NBPB 2KZMA 2B4JA 4B9UA 3RBEA 3LANA 5D3GB 2UUTA 4OLAA 4NYNA 4JS4A 4CF9A 5C25A 3TARA 5CYQB 2AQ4A 1RT6A 1XR6A 3RB4A 3NL0A 2HHVA 4LH4A 3ZT4A 3NHGA 2ASDA 4O5BA 2HB5A 3L2UA 3SQ4A 4NCGB 5KG7A 3G86A 4Z4HA 2O5DA 1BI4B 3S3OA 1CZBA 3M9MB 4DSLA 2IAJA 1X1PA 3LPTA 4FLYA 2HNDA 4WXOA 4DSKA 3TAPA 1S1TB 3JYTA 1L3VA 2FBYA 4I2PA 5J2QB 1LWEB 3S3MA 2R8KA 3KHGA 1W25A 2Z1HA 1BQMB 1TVRA 1JKHA 4FBTA 3QIDA 1NK5A 4CHNA 4DSFA 5EWFA 4FZZA 1SL1A 4ZPBA 2XY7A 4DLEA 4FJXA 1QTMA 3G6YA 2R8JA 1TAQA 3MFHA 4OPJA 3D28A 5CY4A 2R8GA 4O3SA 1WSEA 2ALZA 2UUWA 4E7IA 3F9KA 1HPZA 4I7FB 2W9BB 3DLEA 2OPPB 1MU2B 1D8YA 3FQKA 1JXLA 2WTFA 2UVUA 5F8NA 4H8KA 1FXXA 4E7JA 4IDKA 1U48A 4R5PA 3CIZA 3PZPA 4CJLA 5HP1A 4FM0A 1G15A 4DTRA 5DLFA 1WSIA 5KFGA 4OVLA 1RT1A 1NK4A 2E9ZA 3MECB 4WXWA 1S1UA 2JEFA 1IKVB 2HWHA 4HKQA 4QWEA 2C28A 3AVGA 3EY1A 4RG8A 3I5CA 4EBEA 4CFCA 1C0MA 1ASUA 2VWKA 1DTTA 3LP1A 2F8SA 1TV6A 2C2DA 1KFSA 3NKYA 4J9MA 1S0MA 4DL2A 2WCXA 4WFYA 4IG0A 3PR4A 3TAGA 3CO9A 4LSLB 3RAXA 4W5NA 1VSDA 3TABA 3KKRA 2DFHA 4ECSA 3RB6A 3B6PA 3T19A 1RBUA 1Z4UA 4PUOA 3IGNA 1RDRA 3QNOA 1S6PA 4LH5A 4LY7A 3OL6A 3OLBA 3V6DB 1NK6A 4KKOB 4BWJA 3ZSRA 2UVRA 3WNFA 2IC3B 3QGHA 1IO2A 4F4YA 3H5XA 1ZBIA 3KLEB 5KFVA 3KLFA 1RA6A 4DFMA 2HNDB 3V9SA 3HJFA 2XCPA 3RWUA 4PQUA 2DFFA 4FZXC 3HVWA 2XGQA 1TL1B 2GIQA 3OVNA 3PHEA 3VQEA 3M8PB 1TVRB 4LQ3A 4O4RA 4TYAA 2RKIA 5KG0A 4K4UA 4M45A 3CJ5A 2YKMB 1JL1A 5HROA 3M8SA 3HT3A 3U6FA 2FVCA 4F8RA 2BE2A 4TY8A 5K14B 2JC1A 3MR2A 2NUBA 2VA3A 4TQRA 1CXQA 1N5YA 4CFAA 3PX0A 1NHUA 4W5OA 3CYMA 5E41A 4RW8A 4WFZA 2E4LA 3EPGA 4IDKB 3BREA 4MIAA 1SL0A 1LWCA 4CGFA 4ID5B 4M3XA 3BSNA 3PW7A 2PYLA 5EWGA 4NYFA 3L3VA 4LSNA 1S9GB 5KT3A 4IFVA 2XI2A 3V1RA 4KO0A 2LSNA 3AVJA 1NOZA 1K1QA 4EZ9A 5KFQA 3I0SB 4NLGA 4CHOA 4JUZA 3NF9A 3H08A 2BRKA 3V6KA 3VQCA 3UIQA 4ED6A 4CEFA 3KLHB 1NKCA 3AV9A 2JLEA 1HYSB 3QEPA 4NLRA 4CHZA 4DEZA 1C1CB 2RF2A 1X9SA 1ITGA 3RMDA 3M9NB 2EHGA 1RT5A 2YHAA 4QAGA 4ECZA 4QOZB 4RW7B 1KVBA 4PUOB 3CJ4A 1T8EA 1N4LA 3ITHB 3GYNA 3UR0A 5DK5A 2G8FA 1TAUA 3CJ2A 2O4GA 2HHXA 4CFDA 1S4FA 3NH1A 5F9LA 5DQIA 4DF8A 4FK4A 4J2EA 3HPOA 4X2BA 2YV0X 1BQNA 1I6JA 3OYGA 3OYHA 1DTQA 2IM2A 4ED8A 1CLQA 2OPRA 2KZZA 1JLQB 1HQEA 4PQUB 3DM2B 3TAMA 2HHQA 3PW4A 4RW4A 3DOKB 2XHBA 4ECRA 3BR9A 4EBCA 4M94A 4N47A 3OLAA 1JLBB 1JXBA 3NGDA 2KFZA 3LZIA 3MXIA 2HHTA 3AO1A 3PO4A 3PW0A 3H4BA 1QS4A 1RTHB 2WRMA 4CJQA 4GMJB 4BE1A 3CFRA 1RDCA 3O3FA 1SUQA 1R0AA 2Q3SA 3TAEA 2UVWA 1TGOA 4TSXA 1FK9B 2OPSA 4Y1DA 1S9FA 4IH5A 4CJ3A 3VQ7A 4CGIA 2J6SA 1NJXA 5KTQA 4IFYA 3FFIA 4I2QB 1NOYA 4TQSA 3E51A 3BQ2A 3AVHA 1Y97A 4KHNA 1HRHA 4R0EA 3BDPA 1U45A 1ZYQA 3V6HA 3VA3A 3KLGB 1T3NA 4DMNA 5HBMA 1B9DA 1A5WA 4CJPA 4F3OA 4CEEA 4QW8A 3H40A 1JLCB 3QIPB 2VWJA 3RRHA 4DTSA 3T5KA 3K5NA 2OZSA 4TN2A 4ELUA 1T03A 1T05A 4RZRA 3OJUA 4KHQA 4FM1A 1U09A 2OYQA 2Z1IA 3LP3A 4DF4A 4DL5A 3VQ5A 4DTMA 3OL7A 5KFXA 3KK2A 2OH2A 2IA6A 5CYMA 5HRNA 4F3TA 4IH7A 2PZSA 2QE5A
chains in the Genus database with same CATH superfamily
3KNGA 1KQSM 1GX5A 4CRJA 1HHTP 1SV5B 1S0VA 2WHOA 1TL4A 2F9DA 5CD4A 2D0BA 3KKSA 1N33K 3CUNA 2XQCA 4JB8B 4FSVA 4JI4J 3ETOA 5ETRA 2P9IB 4F3QA 2RQMA 3C46A 3GZ7A 2F8MA 4ELVA 3IAM9 1WSGA 1ASWA 2V51B 1GLBG 3ZT2A 1VQ9N 4F3MA 2UUCJ 3W2WB 4HCCA 1Z26A 1AUSL 3MD3A 5KFRA 1U1OA 3WIVA 3D1OA 2AZ1A 3SJJA 1I94K 4DU3A 5D0RA 1S1WA 3UN2A 2RDDA 4GW6A 2PMHA 2DGXA 2KJWA 2JVOA 5IWAF 4YHHJ 1GMWD 2QC3A 3UKRB 3RW6A 3J80U 2BANB 4UUWA 2XMWA 5H9EJ 4FLWA 3DCAA 2V8PA 1LWXA 1K9MO 1WC4A 2QMXA 2F8EX 3OPKA 4NCGA 2J8AA 3DXSX 5AQWA 2VBZA 3TPQA 4W4MA 3SQ0A 4KHRA 1VQYA 1QVFM 2CQ4A 2POKA 3M6WA 2AYEA 3RB3A 3VQ9A 2HHHF 4FVUA 3RUBL 5KOWA 2WSFC 3UFCX 1FFWB 2IVFB 3UW1A 2XM3A 2UXBJ 3CXCR 2E7WA 3CD0A 3WXLA 1EWQA 3G9CA 2MJUA 3RSEA 5AQUA 3VQDA 4FN5A 2E29A 2Z2LA 4WF9Q 4AUKA 4FCYA 2H3EB 2BJ8A 2PO4A 1S9EA 3CJ0A 1F9HA 4KBIA 3C6UB 4I7FA 4CJVA 3OY9A 3BP8A 3U9DA 1GNKA 3IC1A 5SZTA 1RBVA 4QIGA 1WN7A 5E5NA 3HJVA 3OXFA 5BRDA 4JI0J 2DY4A 1TKZB 4JKGB 4CZEA 2VA2A 2D4WA 3PRBA 2GQ2A 1CG2A 2BJDA 1D9DA 4HDGA 1FJGK 3PR5B 3MM8B 2L3MA 4C4WA 1B92A 2FC0A 1ZPWX 4OJ3A 2G13A 4GV9A 4DUYK 1SJ3P 1XR7A 3M8WA 2ZDOA 3Q7CA 2AGOA 2EK1A 4TY9A 4B9LA 2FVQA 3TA2A 5BN9A 2RS8A 4KKOA 2EI5A 2VG5B 1RA7A 3QT6A 2QA4S 1G7CB 3ILIA 2QI2A 2DVIA 4KHPJ 1SBRA 1NGIA 3JB9k 1KC8T 1RABB 1N32K 2NNWA 3SBMA 2NZ4A 1TL1A 3CDUA 4HT7A 2BQ3A 1SQKA 2BGGA 3J7YU 3AA3A 2CJYB 2JZ5A 1N56A 4E7KA 4B3TF 3SMSA 4KH0B 4M42A 1HBMB 3PW2A 3VPZA 2ZHAA 1S9EB 4DKWA 1KOHA 2E44A 4YNQA 4LT6A 3POTB 3M1VA 3THVA 3NGIA 2ZBIA 1BHNA 3MF5A 2GX8A 2ROEA 1WC3A 4OZ3A 2MKHA 5DDRC 5DQHA 3PSFA 1LCUA 1S72N 1MMNA 2V67A 1AA1B 2WONB 3SJHA 1RTJB 4AFFA 1XC3A 1JJ2R 3OYLA 4FOEA 2HBMA 3KHRA 3ILLA 2J7WA 4U6PA 1H2TZ 4K5SA 5D6GA 1O51A 3T1AA 1T94A 1VR6A 1C1CA 4HHJA 3L3UA 4FK0A 1UWBB 4Z94A 3SCLE 2B5JB 4BDZA 4X4SA 1HWUA 1R0BG 3A0IX 3F5TA 4OHWA 1U47A 2KO1A 4M3RA 4JI7F 1OVQA 1VHFA 2CDRB 1JJ4A 1KBRA 3O9TA 4DV3K 4DV2F 1KAXA 3R9PA 2ZWHA 4MQ3A 4URGA 4ZLLA 2L48A 5A8KB 1GEHA 4CM2A 4DX7A 3VERA 4QS7A 4B3SK 4B9SA 1OO0B 3LA0A 4CYUA 2W2MP 3NNHA 2CJ9A 2WBNA 2CQPA 2OFGX 2CPJA 1RWUA 3H1QA 5I4MA 1KD1T 4U8VA 5AQRA 2DXEA 3GCXP 2PFDA 5GAGP 2E1AA 4DR4J 1Q8KA 3H98A 4J90A 1MSWD 1FVQA 4JI4K 5ADXH 5HRSA 3FMWA 4KJIA 1EQ0A 4MMOA 3OHAA 4CIFA 2V9KA 3CCTA 4LQ9A 2DR6A 2CQ0A 3KJFB 2V8VA 5F8MA 2QV6A 1U6BA 4E3SA 1VQMN 5KFCA 3MUVP 1PJ7A 2P9GA 2CJBA 1VRQC 1M0SA 4LF4F 2P9KA 5AZJB 4H0PA 3GJSB 1JLCA 2B7BB 1WSJA 5CCMA 1FE4A 4DV1J 2BQRA 1RWNB 3VQ4A 1YJVA 4WYLA 1VQKS 1ASVA 5MLCV 2NXJA 2B9EA 1HL6A 1H7WA 2MMYA 4XDDA 3W5XA 2R9LA 2IFXA 1SQFA 4CF1A 4BRFA 2FBVA 4HTJA 2CZ4A 4UQGA 1GTHA 2ZJRQ 3NS6A 5LMNJ 1Y10A 4DV0F 4ZPCA 5H9EK 1S0NA 3NP5A 5GADU 2YKNA 4K4VA 2GV9A 1N54B 4EK2A 3VF4A 4B9NA 1BHLA 2VQFJ 4LF1A 3BSAA 1YUWA 1UWAA 3H42A 1N48A 2QFJA 3U1NA 4E8UA 4Q8EA 3C95A 4V19J 2QKBA 3GJRB 3CCWA 2UXBK 3QSIA 1FEEA 3JTOA 1WEYA 2E1ZA 3W65A 4QWDA 4GKJF 4AHSA 1P27B 2ZH9A 4O0NA 3D54A 3I82A 3QICA 2EK6A 4IOXA 4CZJA 2A3ZA 5B08A 2D5RA 3NCIA 1QQCA 5C0YA 1BD6A 1WHVA 4PZVA 4LUBA 5HANA 3C16B 3TTDA 2HRYA 2WOMA 5IT0A 2PI5A 5FRMA 3E9PA 1RAIB 3CCES 2HZVA 4BRCA 1SH0A 4MIBA 5JS2A 1QHTA 4F7VA 2DNQA 3PX6A 5ETKA 3KJVA 2I0XA 2XC9A 3DDKA 3RW7A 2OKQA 4NX9A 3Q8SB 4KGKA 4ANDA 5B8HA 4J2AA 2F7TA 2LDIA 4TU9A 2V63A 4NE9C 5H1SV 3RMAA 4O44A 2E5JA 5KT6A 4K4SA 1TYQB 1MN9A 1S3XA 3LOUA 2P9UB 4MK9A 3O4QA 2KTQA 2AEFA 5AFUH 2WZ1A 3KD1E 4A8YA 3F73A 2RILA 1RHKB 3L95X 1MA9B 4KHMA 5B0AA 4FW1A 2K7KA 3KG4A 5KG3A 3QWUA 2X78A 1TKXA 4RW6A 5F0WA 2Z1JA 3H90A 2ZF5O 3OYBA 3VF2A 4O8KA 4KB1A 1M5HA 2CQGA 1X4DA 3RMCA 1MROB 3CWJA 1RWXB 3KUHA 5A0YA 3CVKA 4MK8A 4O0JA 3GV8B 1WAJA 5CR4A 1IG9A 3W66A 1VFJA 5HRRA 3B82A 5IQ6A 4TXSA 1X4CA 1WORA 1F21A 2Z2MA 2B6AB 3DRSA 1N88A 4XPCA 3BO4A 3NCRA 2B51A 3PDNA 2NXCA 3FSXA 3Q2TC 3HTVA 4JHDA 3UE2A 3SBGA 5BRFA 3CCUS 4USKA 1TTHB 3DRRB 2BR0A 3UE5A 1WG5A 3VQAA 4OLBA 1I39A 4IYQA 1Q7YT 1PYSB 1YJWN 3AQPA 3QDKA 2P51A 4JYAF 4E19A 4OI6A 3CJSA 3D3BJ 1PILA 5C5JA 8ATCB 4LFBF 1TP7A 3IRXB 2HMPA 3M8QB 2H65B 4JD2A 3ZTSA 2MEWA 1RP5A 4CFBA 4F4KA 1GLCG 3O3LA 3H3NO 4O4GA 3W61A 1KP6A 4QPTA 1YG0A 4FP9A 4NA1A 1C1BA 5LMUJ 2AYGA 1S6QB 4QYZJ 4JEPA 4I68A 2EFQA 4YQWA 1LAWA 2ZC4A 1C0UA 1RU2A 4DOZA 4FYDA 4NMLA 5G0RA 3KLVA 4RNHA 2DPIA 1R31A 1TK0A 1WC0A 1CS4B 3CFOA 1HKAA 1UOCA 1NDLA 1OMSA 1Y4ZB 4AYBD 5A0YB 1CJVB 4W98A 5C2GA 3A8EA 4RR5A 4AM7A 2GEMA 1U2VA 3TOQA 3VAGA 1FRLA 4IRDA 5G4DA 1DQAA 3NGYA 4DTUA 4JV2A 2LQ9A 4NXMJ 2B4VA 4NZ0A 4DL6A 2Y1LB 2MY7A 5T7LB 4PCQA 4X4PA 3GBTA 4B3OB 3HCXA 3PYDA 3M9OB 3WIUA 1UVMA 3EX7B 4CQ1A 4KC5A 1QAYA 3AD8C 3OFEA 1TFWA 4CEOA 1RCOB 5BR8F 3GONA 2OFHX 1RTIA 2P9SB 3BGRB 2NREA 2M8DB 2GO8A 4KV8A 3G8SA 3CDWA 2B9YA 1RAEB 3NXZA 2HFVA 2YI1A 3BPSP 2UXDF 4RBTA 2P6SA 3SZ2A 4C9DA 5DM7Q 3VEOA 2UUAJ 4O3NA 3KG0A 3W8PA 2ZUAA 2RQCA 2G9OA 2ZOFA 1NPPA 2GNKA 4BE0A 2QK9A 4DV6J 3CC4N 2YX4A 3MAAA 2ZD1A 3GCWP 1ZBHA 1LEOA 2ZKUA 1KVKA 2B7CB 4OX9F 1TL7A 3IBFB 3RZAA 5KFWA 4J9QA 1MMDA 4JP8A 2QSWA 1YHQN 1VQ5S 2JJ4D 2QWNA 4Z2XA 1SJ4P 3ENQA 5LMNK 1LK5A 3GOIA 3LUYA 5GMEA 4ECYA 4HL9A 3G6VA 1RZMA 5K8OA 3MM9A 3MPVA 1ROFA 3HYFA 3DOLA 2CZVC 4ICLB 1RBLA 2CKWA 4Q7AA 1TKDA 2VQFK 4DI6A 4U7UK 4DL3A 3AVIA 2XMVA 4BROA 4FJNA 3R8EA 3OBWA 2HZAA 1EXQA 1U2VB 2V2KA 1W0HA 4Q0BB 2VFTA 1S22A 4GNIA 4JKBA 1XNQJ 1WF1A 3BKTA 1VOMA 3SV4A 3MEDA 4CH7A 5EVZA 2F3JA 1N0UA 1GMUA 5CABA 3J7YP 1VRUB 3G71N 3BGFA 3G0ZA 3CF5L 1YWXA 3GE1A 2YNHA 1Q86O 2GGPA 3AFGA 4EFHA 2F8HA 1HR0J 1FWLA 3H25A 1N8RT 1RTIB 4ZPWR 2HNZA 1Q82T 2W2OP 4J91A 4FNIA 3MX2A 3KD5E 3TSUA 2P5OA 4QWCA 1IM4A 4YR3A 3V81A 4OV1A 4LR9A 3IAYA 1FVSA 4H03B 4E2FB 3I55S 4TU8A 4BE2A 2H5JB 5KFZA 4WFNQ 3LP0A 5BPLA 1U1RA 3O9RA 4DG1A 2PYJA 4ZP9A 1XHXA 3O4NA 3MAAB 2QXLA 4Q8FA 5GAGI 1VSEA 2X1AA 4NCBA 2HQCA 1VK3A 5L1JA 1HHQA 3FEYB 5JVGL 3CJ7A 3HHKA 3D45A 3JYTB 1QAXA 2GWKA 4C8ZA 2D0AA 2V2VA 3SQ1A 4E1MA 1NJYA 4I2PB 1WKLA 1VQ7N 1FW6A 3UPFA 4GVMA 2GMLA 4WIIA 4ECUA 4CTAA 2EFVA 2IVYA 2HGNA 1HI1A 3RR8A 4A59A 3Q23A 4PWDA 4NI2A 1NO8A 3D3CJ 4HLBA 4DR6J 5KFAA 3C6TA 3JXUA 1HPZB 2BJ7A 2A1RA 2LQ5A 3DLEB 5L1IA 1RAJA 2IJFA 5F8LA 3K2PA 4F4AA 4CECA 3KHHA 5D8HB 4UZCA 2YWGA 1M1KT 4JAXA 5CE3A 2KHDA 4XH4A 3WX8A 4ZPVR 1P6TA 4J9KA 1Y11A 3DGPA 3PTWA 4YS2A 1DTTB 4E98A 3DYAA 1KQSR 3GFXA 3LPUA 3H5UA 1RK8A 3D7EO 1JIHA 4DN9A 2B8PA 1F0XA 4MK7A 2QA1A 2HHHJ 4F2SA 2DY9A 4NLYA 4DDFA 1HX1A 1KONA 3CD6S 1O1WA 4IXCA 1LXNA 1J5EF 5AXMA 2Q79A 1IBMJ 4YB5A 1ZM9A 2VZ9A 2HK2A 1H6KX 4CO4A 3TWZA 4J9NA 4NLCA 3SFUA 3IMQJ 2O1PA 5H9FK 4ISGA 3RR7A 5HI7A 2E6LA 1NGCA 1K8KA 1RDUA 2RKIB 3Q0AA 5DDPC 5DDOC 3FVYA 3N9UC 4QYZK 4CP5A 2EFPA 2JSXA 2ZJQQ 1C4CA 2IYIA 4OKEA 4IBNA 1J9AA 1Y00A 2NRRA 3CCUN 1N5YB 1NAQA 4QZVB 2VHGA 4GKKF 3A3PB 1QVFR 3HHLA 4ZTJA 2EFOA 4KE5A 4RW8B 2G0IA 4Q45A 4ZS6A 1SVDA 1JCFA 3WXKA 2CPYA 1WEZA 4MKAA 4IFEA 3U7JA 1CJUA 2ALYB 1U49A 2HWIA 4LMZA 2HURA 4ZVFA 4NXMK 3NOCA 2HVHA 1D5AA 4DUZJ 3TUPA 4ISFA 3SV3A 4QWBA 3TAQA 2QXFA 2ZNZA 1Y0HA 2IMWP 1DURA 1R8BA 1VS3A 2IRXA 1F5AA 2B4PA 2BDPA 2IIHA 2IRYA 1PBAA 3V2UC 4RBUA 3CMES 2NRHA 5KG1A 4BC5A 1EWRA 4WWSA 1GLJO 4ETZA 5FPNA 4PG7A 4F0KA 4A61A 4B3RK 4N5SA 2JEJA 5D4LA 2UUAK 1RWWB 2JVRA 3J81U 4WCEL 4HYKA 4YUDA 1KR4A 2QJ3A 3QMQA 1DTQB 3MOJB 3QGPA 1DRZA 2IVPA 4BDYA 4DHYA 4NLVA 3ZTOA 3E01A 4DR7J 4PABA 3RRKA 4JKFA 4FWRA 2BVZA 1IBKK 1NGHA 2GO9A 3R6MA 2VOOA 4IWVA 3OUYA 3R5DA 5KFSA 1KVJA 2HBLA 4M41A 1P1LA 4JS5A 4KH6A 2ZHOA 3ZEUA 5ETSA 2DTUA 3QO9A 1B0VA 2BACA 4AH9A 3JAMU 2R4FA 1YI2N 1QLNA 3K5LA 1WTBA 2EKNA 2D0OA 3NBPA 5CH7B 3AD7C 4BWMA 3SPYA 2BKNA 3C66A 3DXBA 2R8HA 1VMBA 4PXBA 4BRLA 2HLUA 4DX8H 4DCPB 2X1BA 4YDXA 4IRKA 5C2FA 5GMDA 4B1VA 2UU9J 1WSFA 2RRBA 1V3ZA 2E8AA 1HQUA 4J5OA 1Y5IB 5KGWA 1U02A 4LRDA 3CCVS 4BC2A 4ZA1A 2PT0A 4CGGA 2OHDA 2W9AA 2W7AA 2GAHC 2A42A 1HR0K 1PC5A 3V9UA 3ZSOA 4C1NK 2IJRA 2J7KA 4QIVA 1S5ZA 2VC1A 1HMVA 2XY5A 4LIRA 3H6EA 3VTIA 4P2SA 1WJ9A 3WQUA 1RT4B 3FR0A 2VIHA 1BG3A 3D66A 3M3ZA 2ATLA 3GG1A 2ABYA 1T02A 1NDPA 2CGLA 1LOTB 2J0XA 1JLGA 3VQ8A 3VQSA 3FNNA 4WU2A 3A1YG 4NCAA 1VQ4S 1HD0A 2RSQA 3JTPA 2A0FB 3E2EA 3PHTA 4JI2F 2JRSA 2MKJA 3MFIA 2XZDB 5HLFB 4K0KF 5FDLB 2VPXB 5BJRA 4FL9A 3ZEUB 2HGMA 2ZDPA 3I8DA 3TQ1A 4JI5F 3HD2A 5GAEU 2WVDA 3EGNA 5AZIA 5D77A 3SDEA 4DPYA 3NBPB 2KZMA 3MM5A 1B0PA 2UUTA 4GMKA 1NZ8A 4USJC 3LPYA 3TARA 5TKWA 1RT6A 1XR6A 3LDNA 3U1LA 5AE3A 3ID6A 5F1XA 1SB6A 1HNZJ 3FGUA 5AQQA 2H4YB 5DO2A 1PIEA 4I6WA 2Q2RA 1RAAB 2DEJA 5AQFA 2R7UA 1AT1B 2O5DA 3S3OA 3NRBA 4CI6A 3B4MA 2LXUA 5IWAK 2BA9A 3IA0A 2HNDA 4DSKA 4QS8A 1M5OC 5E33A 4WYBA 1L3VA 1NEEA 5J2QB 3S3MA 1YGYA 2R8KA 2QTDA 3LDQA 5K5MA 4WKYA 4HHUA 2EG2A 1VCTA 2CQCA 2ZM6F 4FBTA 4FF3A 3EGVA 1YSJA 2OMLA 4DSFA 1W7WA 4USTA 1IUJA 4K42A 1NGEA 5IFMA 3IRWP 2XYHB 2DGVA 1VK8A 5J1PA 2R8JA 2HHHK 3D28A 2DNLA 2BW7A 4O3SA 1WSEA 1Q81O 2JX2A 3A8JA 4JI6F 2OPPB 1MU2B 3FQKA 1FXXA 4EIAA 3Q8UA 1PJ6A 3PZPA 1AUDA 4CJLA 2AJFE 1GMWA 1NRKA 4OV6A 3AD9C 5HL7Q 4DTRA 4CZCA 1EARA 3T7ZA 1WI8A 4HEA9 1NK4A 3RBZA 1VQNS 1S1UA 4EU0A 1IKVB 3AVGA 3THPA 1JJCB 4FYXB 4Z7CA 1CEZA 4CFCA 3CJKB 2VWKA 5AQNA 3S7RA 2QWLA 2F8SA 4MT1A 1TV6A 2YJEA 2K3KA 2OIHA 2WCXA 1QZ5A 2JNJA 1DY3A 3MM5B 4B1XB 5DM6L 4LSLB 1HWKA 2HFSA 4I0WA 4ECSA 3RB6A 2OSRA 4GY2B 3KJQB 1HBUB 5F0XA 1M5KC 3IFRA 1NK6A 4CJ7A 3ZSRA 3WNFA 3ENBA 4C3MA 5AJ3F 5E3AA 3VAIA 3CD6N 4YDUA 5I9EB 4DUZK 3OR2A 1RA6A 2HOEA 3WC0A 1RKJA 2HNDB 3W64A 2E5LF 2XCPA 1FRIA 2OGUA 4FZXC 2M5YA 5C10A 3HVWA 3EUNA 2VGNA 2XHWA 4PL7A 2GZOA 3VQEA 3M8PB 3DOMA 3D2EA 1TUGB 4DCJB 3AODA 1CC7A 4KGVB 1HKGA 3UDEA 2SXLA 1KQGB 2Q66A 3EICA 3A5NC 4ZLNA 2KM8C 2BE2A 4TY8A 2JC1A 2OD6A 3C6HA 1X0PA 2DCLA 1H2VZ 3M2VA 2Q3PA 3D0HE 1QJHA 3UKUA 1HBNB 2E4LA 4MIAA 2B3TB 1LWCA 2R7TA 1Q7LB 3MM6B 3SIPB 4CLWA 3TUJC 4M3XA 4KGMA 3BSNA 4ZVSB 2C2OB 5LXRA 3PIOL 2IVMA 4M5DA 5IM0A 3IBCB 3L3VA 4MDAA 2D0PA 1NOZA 1K1QA 5FD1A 1AYEA 3V6KA 1PKUA 2QL7B 3GYGA 3VEVA 3HI9A 3IMXA 2DR5A 4XTTA 5AQPA 5CHIA 3QEPA 5CXTA 3DFEA 1NCLA 3G8TA 1JWWA 1UAWA 2B0GA 5ITHA 2OANA 2RF2A 4ED5A 2IMOA 5AQXA 3SEOA 4QOZB 3O2IA 1WHWA 2DGSA 1KVBA 1UEKA 3ITHB 1XQIA 3M8ZA 4C48A 1S4FA 3BV8A 4CBXA 5F9LA 2UU9K 3U4LA 3A8YA 4ZCLA 2PEHA 4X2BA 1FO1A 1R8CA 1WWHA 1BQNA 3OYGA 2M3DA 3VZIA 4ED8A 4EWTA 4CLZA 2NYIA 1G6BA 2HPUA 4PR6A 1JLQB 2MDAA 1UP1A 3PACA 1HNXF 2V34A 1UZDA 2QA4G 4RW4A 3T1YF 4OX6A 1CULA 4EBCA 4OLOA 4N47A 1Y9OA 3NWRA 1KTVA 3NGDA 2KFZA 4X65F 1I5OB 5JLFA 3AO1A 2WRMA 4BE1A 4CD3A 1U26A 3CD5A 3O3FA 3MN9A 2FZCB 4A8WA 1DQ8A 5BN8A 4Y2MA 4CDIA 4LRAA 4TSXA 1FK9B 2OPSA 2CWKA 3VQ7A 3ZC4A 1LKZA 1WDTA 1D3WA 4IFYA 3FFIA 2GVZB 1VQLS 2EC2A 2HAFA 3BDPA 5KPZA 2MYFA 3AAQA 3KLGB 4EAHD 4P72A 1A5WA 3VGMA 1RWKB 4CEEA 4BR4A 3H40A 5K8MA 3K5NA 4ELUA 5FLXU 4ITSA 1T05A 2NCKL 1Y7PA 1W26A 2HIYA 1U09A 2RD5C 4HH1A 3LP3A 2X3GA 2MKIA 4PG6A 4UY8O 2BE7D 2WSEC 2BKOA 3KK2A 4M63C 1G2EA 1CJTA 4R25A 2PGCA 5CYMA 1V3RA 5HRNA 3EXYA 2V8DA 3CCQN 4CLPA 3OL9A 3KVGA 2RIJA 1KDNA 3PX4A 1Y3KA 4H4MA 2EFNA 2ACMA 3SQOP 2E9TA 5LSOA 4M5HA 1X9JA 1BQNB 1ZH5A 2QLXA 1WUAA 1OS5A 4H54A 3ZZUA 2EW9A 3MMBA 1D9FA 2GJ2A 2Z1GA 4DV0K 5HK4A 3SUPA 2VB6A 5CQGA 2HFOA 4RW9A 1F3FA 3PM9A 3OR1B 1Q95G 4UZBA 3I5BA 3H5SA 3K5PA 5JMNA 3IBWA 4Y3CA 4XO0A 2CNKB 2CPEA 4YR0A 4J9OA 1WOQA 2N4DA 5CD4H 4E7LA 2CPDA 1T6DA 2WVBA 4CGHA 3M8RA 3KXDA 5CYQA 2FJVA 2UP1A 2DHGA 3FFIB 1UZHA 1X7VA 3PJ9A 4A46A 4EP4A 2JEIA 1C0FA 2P9NA 3BH6B 1NK8A 3N4WA 4NLUA 4JOUA 2WVFA 4FWPA 4HDHA 2YHWA 1TKTB 3A8IA 5J2MB 1T05B 3N6MA 1LWEA 2KU7A 5RUBA 4ZJOA 5M1OA 2VD3A 1IWGA 3L09A 1GK8A 2G2OA 4CLFA 5ETMA 3KK2B 1HBOB 4ZPAA 3UB5A 4BRQA 5AQJA 2WAQD 4QR1A 1Y5LB 4BQZA 4HCBA 2H51B 2VC0A 4URSA 4LF6F 1RB0A 3SCXA 3D2FA 2JL9A 4PG4A 4FOIA 2AP1A 4M3YA 2W9BA 3AB2B 2VG6B 5KFTA 5M1KA 2D1CA 5A2QU 2CJKA 3MCOA 3VEZA 3WQPA 3TU5A 2YNGB 1DBDA 3L8BA 4F0MA 1VSLA 1VSIA 1ZA1B 3D9BA 3DLGB 3GB0A 2ZH1A 1DLOA 3S6EA 5CZXA 5LY3A 2DH8A 2HG4A 4N7TA 3PNIA 4FLTA 3CC7N 3J81j 4ZKAA 3OS0A 1X4FA 1VQNN 1Y5NB 4Z4IA 4ZVGA 2FF3B 3MEEB 4J9UE 4NMXA 4HH0A 3LAMA 2LYVA 4R0JA 5EX0A 3HULA 4LF7F 3S3NA 1KLNA 1EQYA 1H72C 5KG6A 2PN6A 5HJXA 4QU6A 1JCGA 4N8OA 3ZYYX 3OYFA 4ED3A 4WYWA 2UV8G 3KUEA 5DMRA 1VRTA 3M8YA 4UOFA 2E9RX 1ATRA 2IC3A 3KWGA 1GOBA 2QFIA 5KAKA 4OYBA 3RU0A 3KLEA 3ENAA 4FW2A 3U1MA 5BYSA 3CPWM 4NLXA 4QS9A 3VQ6A 4MFBB 4EFAC 3KLIB 4JK7A 2YKPA 4CZFA 4FK2A 2RHSB 2GVDA 3K2YA 3QEWA 1RLDA 4LVNP 4X62F 3ZSQA 3R1LA 3OTOJ 1YZ6A 2Y1JA 4FJHA 1VBKA 3M6VA 2MQQA 4ZVRB 4UT4A 2WVCA 2JGUA 4Q2LA 2ZH2A 1G1XA 5K14A 4PPZA 3VAKA 1UJ4A 4MJKA 3EWGA 1FA0A 3AVAA 5J2PA 2B9XA 5D0EA 2X6SA 1XHZA 4LIWA 3LO3A 1NUEA 4Z4EA 4LFBK 3NG8A 1DT9A 4X4UA 3VGUA 1RXOB 1CZAN 4AHCA 4ID5A 2ZJRL 2EFGA 2UUBJ 4O3QA 5ETNA 4HUGA 1DLOB 4DPTA 3G6XA 1KHWA 3OVAA 5LJ3Y 2DRDA 4IG3B 4FYWB 3M30A 2XLKA 2E6MA 2ETJA 4ILHA 4GVEA 3GFZA 3KLHA 2VKZG 4RX6A 3VALA 3GLJA 1NK9A 5HQLA 2N82B 4KAZA 3P4UB 5EDWA 1V9OA 4DN0A 3MDQA 4NLTA 1U6ZA 4MDBA 3MPWA 4OZNA 1NDCA 3L2RA 1VRTB 2RDIA 5L1LA 2P2CB 3N5FA 4TLRA 2XZTB 4F4WA 1J2VA 3THYB 1YJNN 2GMHA 2MGZB 3MCPA 2E5GA 3DM2A 2IOCA 4ZVOB 3MPUB 1DKGD 4ZMMA 1WBBA 4ATNA 3DI6B 4JI8J 3OW2M 5BR8K 1D4XA 1N36J 1JLBA 1M5SA 4XEIA 1RTHA 4DPWA 3HI0A 5HMYA 1IJJA 4C8MA 2UXDK 4OMFG 3Q89A 1HNVB 3MCSA 5J2PB 2WFBA 3MZIA 5EGYA 2U1AA 1LWFB 3U3YA 4OZ2A 3A3NB 2UZAA 1F9FA 1A5VA 4I2QA 3HXMA 2DNMA 4OX9K 1S0OA 1YIJS 4UW2A 1SJQA 3HVTB 4KGXB 2BTFA 1N0VC 2GBZA 2YHYA 1VQLN 3FGVA 3C19A 3L6QA 2NRZA 4DV7F 1ZTTA 3I56S 2P9LB 4PHTX 3QIPA 3PRVA 1EB0A 5I42B 4FLVA 3MD1A 2DIVA 2LEBA 1YRTA 2UXCJ 2FLPA 1OH7A 3KK1B 2Q0UA 3H0PA 3HZGA 2V4RA 3HSCA 3CIPA 1TK8A 4HTUA 4DFJA 3LTOA 5LJVA 3KJNB 1JJ2M 3N28A 1CC8A 2ZH7A 2EBEA 4BACA 4B1UB 2W2NP 3KFWX 1L5UA 4KRWA 3NWGA 2ZUGA 2VFRA 3WT0A 3W3SA 2OPQA 3BEXA 1G3OA 2RRAA 1NM2A 2YX1A 1Q8LA 1GXUA 4MH8A 4AQYJ 4NWBA 3O3GA 1X5OA 3HDSA 5EUHA 3MTKA 2O8CA 4KQZA 1BCOA 3CF5Q 2X74A 1S97A 2XMUA 4CF2A 3BS9A 3MPDA 3J81Y 4DR3J 1B70B 2HIQA 2PBDA 1QDUB 3K9JA 3MUMP 2VV5A 2LEPA 1RHJB 3DXKB 1Q78A 3R7NB 2YX7A 2I9SA 5U47A 1VBXA 3IUCA 5SWMA 3HHDA 3K8WA 4Q43A 2KH9A 3HKWA 1BXNA 2LXIA 4KFBB 4CH1A 3HPHA 2ZE2B 2R2RA 4JI2J 1ZETA 3CO0P 1JLFA 2IDEA 5DJBA 4CIEA 1NK7A 3THWB 2O8FB 3OFFA 5THWA 1WB9A 4NZ6A 2XULA 4HI2A 1AROP 2MLZA 5JVGQ 1FJCA 3SPZA 3GFHA 2V2QA 3CFPA 4B9TA 4J9LA 5HMWA 2W2QP 2W42A 4G1QA 1EQMA 1LAVA 3HP6A 4OYZA 4X84A 2G8VA 2GHPA 5KQDA 4RBVA 3C3LA 5KFJA 3ENOA 4LBPA 2NRTA 3A5LC 2JDJA 5HVHA 3G6ES 3BB5A 4KSEB 1NSKL 4M3UA 1FJEB 3I0RB 4RPFA 1F9EB 2HEKA 2V9WA 2H3GX 3NE6A 4H4OA 4DR1J 2MQPA 1R89A 3DGVA 5HATA 4JV0A 4HR2A 5I3UA 1HQ2A 4WQ4A 4OHVA 3KWMA 3CJRA 4UF4A 4ZP8A 2MZTA 4NPOA 1Y3JA 1Q9XA 2GHWA 3TVKA 3O8WA 1CVJA 4C1NI 2NR0A 3RAMA 1RBAA 3O6WA 1RUSA 3OTOK 3BZKA 3QPIA 2NZTA 3VAMA 1XMOF 2GELA 1C0TB 5C24B 2BM1A 3HX9A 1IKXA 4N56A 4NOHA 2HHUA 1U2RA 3A12A 4P7VA 1I3OB 1KXPA 4ID1A 4K8RA 3JSYA 4QQBA 1WF0A 2DGTA 4IJNA 1HNWJ 2V4JB 3T9ZA 5F8HA 1T9WA 4ECXA 3EM1A 2ZC3A 4ZOSA 1KVCA 3KK3A 4CEAA 3AGKA 3OBYA 3NS7B 4JI1F 3ZETB 2XG8A 2AJQA 1Q0NA 1VQ6S 1YXQA 1LW0A 3I5AA 1RTDA 1ZBUA 1RT3B 1M1HA 5LXYA 3EL2A 3BUZB 1RT2A 1EETA 4B9MA 2UUBK 4KH4A 4B1WB 2OUGA 3T5HA 2KKZA 2W8KA 3I8BA 3IG1A 1X4AA 1BO5O 3VR1A 3H5YA 4TVAB 2FC9A 2D3O1 4WE1B 2XLIA 1T3VA 4V19S 4KHWA 3KTQA 4KTZA 3OYDA 3EDQB 1FKPA 4KI4A 4H0XB 3NMRA 1Q4RA 1TL3B 2W41A 4J9RA 1KS2A 1WD6A 1IBLF 3QFPA 3OL8A 1YTAA 3MEGB 4C8KA 3CMQA 2I5JB 1DEJA 3AA2A 1XMQF 3CCSS 5B0GA 1M90T 4JK8A 1WI6A 4A62A 1XK8A 3FC9A 5EOYA 2XEXA 2Q97A 3GSIA 5KRSA 5DQGA 4A2BA 1P8ZA 4GRSA 4KTWA 3V9ZA 1SI9A 3NMAA 4O0IA 4JNEA 4JI8K 4ALZA 4QCLA 3ZSZA 1NGFA 1K44A 1N36K 4K50A 4F4XA 4LFCJ 3SSRA 2H48B 3QEVA 4L76A 2MZSA 3HM9A 4BR7A 3NGSA 3OBIA 1VHXA 3I33A 4ES3A 2K06A 2QMWA 2DNOA 4YN3B 2C2KB 3NOGA 4DFPA 2CJXB 4BDPA 1HI0P 1U2FA 3OFGA 2XWYA 2HMIA 1XNRJ 4ZITA 4KB7A 2OP5A 2BBEA 4E0DA 3M2RA 4WCEQ 1RT2B 3ISND 2QLJB 3AVKA 2CXEA 4M7YA 3CCLN 4DU4A 2O8EA 1S1VB 5HAOA 3SAFA 4U7CA 1VI7A 4CLYA 4C0HA 2XY6A 1C1AA 3R27A 2JEGA 1VSMA 1N33J 4FS1A 2C2EA 2KW4A 3HPGA 3EZ5A 4K5RA 2M52A 3A5MC 4DTNA 1UMJA 4C23A 2UXCK 2VQEF 1LK7A 3VENA 3TNVA 3R9LA 4PG5A 1J6ZA 1NJZA 2V2ZA 1HNIA 4ILGB 5EX5A 7FDRA 1HYZA 2MQ8A 3NMUA 3NVKA 2NRVA 2ACYA 3A2FA 2QLFB 2DO4A 5DDQC 1EIYB 1FJ7A 4AQYK 5KOXA 1SJRA 4IKFA 5I3PA 4K8ZA 1UL3A 3GU0A 2V0NA 4B9QA 5CYJA 2OO4A 2DTJA 1RISA 3NEKA 4IDHA 3R1XA 3ENWA 3HM8A 4JI3J 1Q8BA 3SFGA 5C42B 4E1NA 4KR0B 4UQTA 3V1QA 3TUIC 2D3UA 4LREA 2AV5A 1FI4A 4M5NA 3FQLA 3IS9A 2DD8S 3M7VA 2XTJP 2DJWA 2P9CA 3G10A 2KT2A 3O1WA 3SI8A 3HHLD 1X0FA 2HNYB 3SMZA 3JSMA 3I9V9 3VCDA 4JI2K 4PXCA 4WTYA 5KFEA 4PWUA 3SQGB 2J0SD 3QJJA 5MAOA 3MCAB 5C25B 2VBWA 4K0KK 1T9XA 5DG9A 4P10A 3CJTA 3P6YC 5GAGU 1UVLA 5M1PA 2E7VA 3T9NA 3ULDA 3K0JA 3PKYA 3ICLA 3QYYA 3QEIA 3L7UA 2VU5A 2QWOA 3S01A 4CEDA 2O8BB 3T3FA 3M4XA 1F2HA 5ELZA 3QIOA 1YITS 2IAJB 4IH6A 3LM9A 4AF1A 2FC8A 2FZGB 2C22A 3DN9A 1WKKA 1RCXB 4PQAA 2O8DA 1FRJA 2PC6A 4JV5F 4KHSA 3OYMA 3FEXB 2VPZB 2IM3A 1HA1A 3OVBA 4BR0A 5FPEA 1UA0A 3VWSA 1U1PA 4KY3A 2RHQB 3NF6A 2IJNA 2YHXA 3CCRS 3AB4B 1WHYA 3GYXB 4ZVTB 2MHEA 2LQ8A 1B9FA 2AKWB 2KFYA 3QWPA 1GOAA 1WTFA 1IBCB 1W9HA 1NBEB 2XS7A 1RADB 1E6VB 2GCFA 4BC7A 4B17A 3RMBA 4R5PB 2ZM6K 4FJMA 4B1YB 1WAFA 5HP1B 3THXA 2GUPA 2PEBA 2QWRA 5E84A 1U1QA 4DSEA 1RT1B 4N8NA 2I2YA 4U7BA 1RGIA 4FJ9A 2L9NA 1KLMA 3CJCA 1JLEA 2DHHA 2AF6A 2YTCA 1KVIA 2NRXA 2F8TA 3ASMA 2XHCA 3D5MA 3LP1B 2EXUA 2PI4A 1XTZA 3QBXA 2DHXA 2F9TA 1K8AO 1BWEA 3G6EN 1IKWA 3D7SB 4H5TA 2PA3A 1I94F 4DPXA 1A5XA 2R2UA 5F8JA 1S6PB 3P49B 4LD0A 3SUNA 1SXLA 2KDOA 3NF7A 1RQ0A 3O1BA 1FT8A 4OHZA 2FTRA 1IV0A 3QZ8A 1KEKA 4WFBL 4D3HA 1H3DA 4LF9J 5AQSA 4TYBA 5FRNA 4IZ9A 4ES2A 1BU6O 4K4YA 4DS4A 1EP4A 1VGYA 3ONQA 4DU1A 3OYAA 3GR0A 2W9CA 2GC8A 4U9RA 3W60A 3MN6A 5DM6Q 1KAZA 2O3DA 3WNHA 3OYJA 2Q6CA 3AOAA 3M2UA 3ZXWA 5AJ3K 2XB2D 1RJJA 2DNGA 1NH8A 4DQ8A 5L39A 4YB7A 1NU4A 3PO5A 1YK9A 4HUFA 3U8XA 3ZNJ1 2VDIA 1NH7A 4BRPA 1FRMA 3GR1A 1JLAA 3WQTA 5AQIA 3DLKA 2V8GA 1E6YA 2IIRA 1G4CA 4Y2IA 1HYVA 1REVA 5BXIA 2XWXA 5BRHA 3E66A 2Q1NA 4M3ZA 3UCGA 4LFCK 4LF5F 2XMJA 4K41A 4GO7X 4LSNB 3LL3A 4KO0B 1NB7A 2OLWA 1I3AA 3QGIA 1CXUA 4NLSA 3JQKA 1X9WA 1T7PA 4L3QA 4BVOA 2KB2A 1J5OA 4DV3J 2WW8A 1OPIA 5KFLA 4P52A 5LL6Z 1CJKA 1DZ5A 1OKJA 1FJGF 2DNZA 4FXVA 1VIXA 4NLQA 1S49A 4LFAJ 1QE1A 5EX3A 4F67A 1C2PA 3CMAN 4J9SA 1RHMB 4EEYA 2XSFA 4DUYF 3I32A 2WB4A 3E9OA 3PIOQ 4DL0C 3M5RA 4KH5A 5DETA 2N3OA 2ADCA 4PKIA 4JKHA 1ESVA 1F3VA 4CJFA 3O5BA 4X4TA 1M90O 4XIUA 2OPRB 2NZCA 4JBCA 1MWQA 3ZZYA 2F40A 4I9QA 2E66A 1CQNA 4DTPA 2YQ0A 3DRPA 3QBCA 1N5VA 1H38A 2W9CB 2XY8A 5F3ZA 3LW5C 1VQPN 3VETA 1YZ7A 1PAEX 4PRFA 1N32F 4PXEA 3CC2S 3JS6A 5GVQA 4LJMA 4FZVA 3U27A 2MHNA 2D7SA 4QOTA 2VF3A 4I6MB 3DHXA 3MI7X 2WBMA 1QAJA 1REVB 2GHVC 3CPWR 1QAIA 2O01C 4ZP7A 3M6UA 2XO7A 3P8BB 2FDNA 3BY5A 1X3MA 4YY3J 3TI0A 1B7YB 3O80A 5KFKA 1NKEA 4JI3K 3WNEA 5HBMB 1U04A 2CIMA 1IR1A 3DLHA 2QKKA 4BBYA 4A2AA 5HL7L 4YB1P 1ZBTA 2HFNA 3CJBA 5D0GA 3HSJA 1QSYA 1VQ8S 1WBDA 2OTJN 1D1UA 3R7SB 3ZZ0A 3AVBA 5E3QA 4X66F 5I3QA 4KB0A 2E88A 2CG4A 2ZKTA 1PAUB 4CIGA 4M8LA 2UYTA 2BEFA 2W6KA 3TJ9A 4BY9C 4NYZA 2J6UA 4DR2F 2N3LA 1BIUA 2ZZMA 1PBUA 5ETTA 1UW9A 2RT3A 1XIQA 5F8GA 3M6XA 1FD2A 1FKOA 2CNNB 2AA4A 1M1GA 1UPMB 4UOHA 1SL2A 4CD1A 1YVUA 3EE8A 3K0SA 3RBDA 3DLJA 4FF1A 1P90A 2FYXA 4LF8F 2YNFA 4YP3A 2P9PA 1KRPA 4EMDA 1CLFA 1XN9A 1MWKA 1S1XA 1S1WB 2ZITA 3B6OA 4U7UD 2CNLB 2LECA 4CHQA 4OLAA 4NYNA 4JS4A 4B3SF 4HT5A 2DNHA 2CGJA 2YKQA 4XDCA 3NHGA 2ASDA 2XMKA 2GWJA 1U0HA 4NCGB 2RE1A 3D0IE 1R59O 5KG7A 3IR7B 3OW2R 1ZPVA 5IT9Y 3UD5A 1Q1KA 5AE2A 1CZBA 1S7HA 4DSLA 1X1PA 1NJIO 3LPTA 3QNWB 3BO3A 4FLYA 4CO0A 3TAPA 4JI4F 1YQHA 2LU2A 3OTBA 4FPAA 1YITN 3UD3P 1JNRB 1W25A 2Z1HA 5ETQA 5D4OA 4K25A 2JFDA 4KPCA 3RSEB 1YJRA 2OJ3A 1JKHA 2UUCF 3QIDA 1NK5A 1H7XA 5JMVA 4OJGA 4FZZA 1SL1A 2MLYA 4I56A 1WELA 3MFHA 2ERRA 3NGKA 4M5LA 2R8GA 4BRHA 2BUPA 3CCRN 4I7FB 3T41A 1JXLA 1FDBA 3VESA 2WTFA 2UVUA 4YHHF 2OTLS 1R3NA 2HS4A 3ZX3A 1RWOB 4LF9K 1G15A 2L41A 1GFWB 5LJWA 3I87A 5HO4A 2HBJA 4HKQA 4QWEA 2C28A 2F4VJ 1MWZA 4RG8A 4EBEA 2BH1A 1C0MA 1ASUA 4J37A 1M5VC 4QIEA 3NKYA 4DL2A 2UXBF 3PFOA 4WFYA 2AZ3A 4IG0A 3PR4A 3QT8A 4OYPA 1JMTA 2FD2A 4FVCA 3BM7A 3T19A 4C11A 1SC4B 3IGNA 1RDRA 3GJTB 5AQOA 4LY7A 3FFKB 3OLBA 3C14A 4CT9A 4KKOB 1U0HB 2GW8A 3A4TA 3WZ0A 3D1QA 3AT1B 4WBFA 3J7Z5 4F4YA 3H5XA 3Q7BA 4LF7K 2P5VA 3EDRB 5KFVA 3TZWA 2XYPB 3KLFA 3R5GA 4DFMA 3LM2A 1IQTA 3V9SA 3O8MA 4USVA 3FK4A 4PQUA 2DFFA 1Q16B 4JI0F 2BJ1A 5DS7A 1TL1B 3QFHA 3BN4A 4IEIA 1SQGA 5KG0A 4K4UA 4M45A 5HROA 3M8SA 2HVEA 4HWIA 4F8RA 1SC1B 2DGQA 2IDLA 2KHCA 2ZGYA 4LFAK 3MR2A 2NUBA 4BRKA 2R42A 4TQRA 4B3MF 1NHUA 4W5OA 2KYZA 3CYMA 2FSKA 4X62K 4WFZA 2DGWA 3M1VB 4ZN3A 3EPGA 5TKYA 4CGFA 4YOTA 2HBQB 3MPYA 3ZLJA 4ZLJA 4FYVB 4IFVA 2VJUA 3P39A 5KFQA 4KHPF 1EO1A 3W1YC 4NXNJ 1DQ9A 2LQBA 2BRKA 4JI1J 2FSJA 3H08A 3VQCA 3CB4A 3UIQA 4ED6A 4CEFA 3AV9A 2JLEA 4CZMA 3ISZA 4P2XA 4DEZA 1C1CB 1I1GA 1X9SA 1ITGA 2FXUA 1B99A 3TX8A 2KRBA 1RT5A 2ZH4A 2AJ2A 2FJDB 2J8SA 4YORA 1DJ0A 2HLTA 2O4GA 5IOLA 4YY3K 2QEXN 2JLFA 4CVNE 1YBUA 4DF8A 4J2EA 3G8QA 4A8OA 1EKRA 1I6JA 2LXFA 5L46A 2IM2A 4C2MA 1CLQA 3F44A 1BOTO 2KZZA 4YOEA 1HQEA 2LQJA 4PQUB 1WG1A 1ZOTA 3TAMA 2I7PA 2XHBA 4ECRA 3OLAA 4R79A 5M2UA 2O66A 1XERA 3PW0A 4MKVA 4CJQA 2F9WA 3TJAA 2DCUB 2KHOA 3CFRA 4CYUB 5E7OB 1ATSA 1FDNA 2DY1A 1SUQA 5CZVA 2IYGA 4ZPTR 4OI1A 1R0AA 4FPBA 1FRKA 3CC2N 3TJ8A 1TGOA 5BPNA 3PKMA 4CGIA 1NJXA 3QT5A 1A9NB 4PL8A 3NVMA 4BRIA 1NOYA 3CDAA 3AJ1A 1HRHA 4P2MA 2K1RA 1FXDA 1U45A 1ZYQA 3P45B 3VA3A 1T3NA 1CPZA 4DMNA 4CO3A 2EWSA 1F5BA 3EZOA 1HW8A 2P9KB 2J5AA 1JLCB 5EXWA 4DTSA 4BRGA 2OZSA 1T03A 4ENOA 3OJUA 4KHQA 4FM1A 1BDGA 3OV7A 3QRRA 5IXUA 1KQKA 1SC6A 3OVSA 5KFXA 1AFJA 2LKZA 2OH2A 4G6VB 2IA6A 4H5NA 2A41A 1VQ8N 4RUBA 2DISA 2QE5A 4FPIA 1RNHA 1F1BB 2YKNB 3NFAA 3V1OA 2C42A 4ECTA 5LL6d 2VQEJ 2NSCA 1WSVA 3DWLA 3DMJA 2MJNA 4ANEA 4QW9A 2NPIA 4DR4F 2L9WA 1HQEB 3IM8A 1YBTA 3L4QA 4PKGA 4C98A 1YRUA 3P83D 1UEUA 4DR5J 3V4IA 4BRMA 1T0TV 5IC4B 2XS2A 1EKEA 4DV5J 1X60A 2J0WA 4M95A 1SKUB 3ENHA 5E3RA 2F4FA 1U1MA 4DV1F 1V4TA 2FPHX 4ZVHA 5A8RA 1RAGB 3HSGA 4FBUA 4CJ4A 5D3GA 1VQSA 3EKSA 4FXWA 4PA1A 4J2BA 3VF0B 1SH3A 2WOMB 5LMNF 1KFDA 4OO1J 2M7SA 1NXIA 2AGQA 1BI4A 4ZCMA 1MWYA 4FVMA 2K7JA 4IR9A 3A5OC 4H0TB 2PD1A 2AD9A 3H45C 2GUIA 3AO3A 2FIUA 2VQFF 5AQZA 2F4VK 1S1TA 3KJVB 3O9UA 2QA4N 5A8WA 3SQ2A 1T03B 1NGBA 2BX6A 3PEHA 1MN7A 3UCZP 2IM1A 2ZH8A 3RB0A 3JQMA 4O44B 3N01A 4A4JA 2NXEA 4ANCA 3VAHA 5H9FJ 4ZCIA 2OMOA 2KXFA 3DAWA 3O6QA 1AXQA 3AAWB 3D2WA 2AHOB 1KC8O 4M5GA 3PLAA 5JUMA 1BY9A 3VAJA 3F0NA 2MZJA 3AA5X 3H3OB 3W7BA 3F56A 4IQXA 3CJAA 4PAAA 1UVKA 1TKXB 4PPDA 4ECWA 4RW6B 3PG9A 2D41A 4DQRA 3NH2A 1X4HA 3D6RA 1FESA 2G0CA 3UVJA 2OTLN 3R8YA 1U2CA 1I51B 3MECA 2GJIA 3QAUA 1RU1A 4PYAA 1K9MT 2ZNYA 3LAKA 5JJBA 4CW7B 2XCAA 4DL7A 2ZH3A 3SSQA 3P5JA 3DRSB 2HSEB 2XLJA 2BJEA 1VSKA 1QSSA 3EN9A 3G82A 4JHDB 1CZ9A 3ET6A 4AHVA 3AGRA 4FJ7A 2VWBA 1C6VA 3ULEA 1RWVB 3V6DA 2YWKA 5AT1B 4CZIA 4IO1A 5D15A 1UTAA 3MN5A 5DGAA 2KRRA 4NB4A 4DTJA 3TVYA 1T3OA 4B3RJ 3OJSA 1X31C 2UV8A 4NA2A 2FJBB 2V69A 4JKEA 1URNA 3P96A 2BQUA 5A8WB 4NXNK 4QIWD 4JI1K 4M3WA 4Z4CA 3D1HA 2MSTA 2OZMA 2KXNB 2VH7A 2RH3A 4JD2B 1DGKN 1BISA 2YKMA 3TYTA 2QLBB 4O4GB 1TFYA 3C0BA 3EGWB 1IBKJ 1YJTA 1C1BB 1R7IA 4K43A 5J1EA 3ID8A 3EXCX 4A8QA 4A57A 2OA8A 1C0UB 4U96A 3TR8A 2RJZA 3CJ3A 5G0RB 3W9HA 2NRWA 1U1KA 3VVTA 4IKAA 1BWFO 1S6UA 4KGZB 3OXGA 1S9GA 5KI6A 4O3PA 4MO4A 1S6OA 3C15A 4BG9A 1RAOA 1XMQK 4F4ZA 1KD1O 3I0SA 4KH1B 1RHRB 1FXRA 3BJYA 2ZFHA 3D4JA 3R5AA 1MNEA 1XMBA 4DTXA 4QU7A 1HYSA 2NLXA 4L75A 2HAIA 1R8HA 1VQKN 3FCVA 4RW7A 3VA0A 3KDNA 4Y6IA 5ETVA 3SCJE 3DXMA 1KAYA 4OIXA 5LMUF 4LF5J 2MZ1A 4JRPA 4KV8B 1N5TA 1B0TA 4CM0A 3EPIA 2ILYA 4OZ1A 3VQTA 1VC5A 3AO4A 3Q22A 2A3JA 1PG5B 4AHTA 2FF6A 2VONA 3MCNA 4O23A 4OZ0A 3NAIA 4OQJA 3MMAA 2KQ2A 1NNDA 3DOKA 5JVHQ 4HUEA 2YWHA 1XUPO 3R5JB 3CPEA 4FWSA 2ZD1B 1OYEA 3FRZA 3DDNA 2XZWA 1TL7B 2E2QA 5HVGA 3FCHA 3FZFA 5SUHA 2E1PA 4NXMF 2Y3YA 1GLFO 5J1EB 3W9JA 2JWLA 2AYMA 2QTWA 2A1BA 4FJLA 5T41A 3WDOA 2BOAA 3MM9B 5IS2A 2VQEK 3D0GE 3M32A 2VOPA 3DOLB 1S72S 4NA3A 3GL1A 2LCWA 5IV3A 2HS0A 1JJHA 1AW0A 2R7QA 3HO1A 4ED7A 4RUCA 3FDSA 3OXLA 4DR5K 2R2TA 2Z30B 1SCJB 2KG0A 3PSIA 3CCEN 5KT5A 4DV5K 2UUAF 3D6MB 5F2RA 3GWCA 3MEDB 1NHVA 2MPUA 1W2IA 5IWAJ 1QSLA 4DLGA 3J7AP 3FSIA 4DV6F 3CI5A 3ZZZA 2YNHB 1S77D 1HUXA 3PV8A 3ZSYA 3VEYA 2GGPB 3E9LA 3W63A 2WTUA 2ZBCA 3ZCMA 2FHJD 1VQOS 2W01A 5DRKA 2ZJPL 2HNZB 1LOUA 1SV5A 5LM7E 4CHPA 2XRIA 3X3UA 2J9DA 3V81B 2DNYA 2P9IA 1OWXA 4WP8A 1L3TA 1KKHA 1N34F 4ZHRA 3VGTA 2C2RA 3LP0B 2HQFA 4IOCL 4DG1B 1AB8A 4GV6A 3W2WA 3MWTA 1Z1ZA 4JRQA 4OJHA 2HSTA 1JQGA 4U67L 2QWMA 2GMJA 4CO1A 1XNQF 5KT4A 2DITA 4FJKA 5K9FA 2J7UA 4DQIA 2YH1A 1H98A 4CTAB 1TK5A 4Z37A 3TW0A 3UKRA 3IR5B 2BANA 2DR8A 4PWDB 2PA8D 4C6AA 1HR0F 4NI2B 3TWHA 1MDUB 3GDQA 4CJTA 3C6TB 2RMLA 4DZ6A 1XWLA 3H46O 4DSIA 3I31A 4J9VA 4AL6A 4IQMA 4WZMA 3H1VX 2J9DE 5EY4A 4W5QA 3J80Y 4LVOP 5EU7A 4MYUA 3ALYA 3Q86A 3GIKA 4PYDA 1NZAA 3ELHA 3WHIA 4CO2A 4EO8A 2E5HA 3EYZA 2FGCA 4OI2A 2FLOA 4WQ5C 4Y1CA 1QM9A 2V50A 3QZ7A 4YEAA 1Q7YO 3DGPB 1NM1A 3BF3A 3DYAB 3GILA 3C6UA 4OJRA 1GLLO 3AVNA 4K4TA 1GOCA 5J2NA 2QX0A 3K7RA 4K2XA 1ACMB 3H59A 1AZSA 2A10A 1TKZA 4JKGA 3UO0A 4ZHRB 2K8GA 4DL4A 4DR6F 3GIJA 1YJ9S 3QT7A 3S9HA 5B0BA 1SKRA 2CPZA 4IO9L 3VF6A 3AY0A 4B3TJ 3MM8A 3E1YA 2I7NA 3J7ZT 3CTRA 4BVPA 3EEQA 4RWTA 4PWWA 3CJ9A 1UW4A 4OLPA 3PXGa 3BQ1A 3R2DJ 1K8KB 2CQDA 1IJFB 1VLOA 2U2FA 3KMQA 3K57A 2HBKA 3L4BC 2PIIA 1VJWA 4OKJA 3FEZA 2V7YA 2VG5A 2AX1A 2CPHA 2Q0RA 4PY5A 3RAQA 3CSKA 3HHLB 5KFHA 2KI2A 4WFBQ 4LR7A 4YOUA 2FY8A 3QETA 4DU8A 3OSPA 3K5OA 1PO6A 4DX5A 4K4WA 2XNQA 3UNYA 3AO5A 3CJ1A 3CW2C 2YHBA 1CJUB 1RCHA 4V1Ak 3QERA 4CT8A 2FVPA 4AXIA 3FBEA 1CQMA 3J8AA 1IBMF 1P9YA 1H73A 4CCHA 4J7CA 2YJFA 3LP2A 3UN3A 4DWIA 1HBMA 3WXIA 4NEYA 3DDIA 9ATCB 2IM0A 3TZZA 4N41A 3SSSA 4ZVUB 3L2WA 4WU3A 2B9WA 2GS8A 5KG2A 3POTA 4LF5K 5CCLA 1XC9A 4JI7J 1VQ5N 3JS9A 5J2NB 1PSDA 1O6XA 1NHKL 2OSQA 1N6QA 4QIFA 3M1FA 5FROA 1AZSB 4RO0A 3HP9A 3TTCA 2P1JA 4DV2J 3Q8YA 1L3SA 1HLUA 4RNFA 4H4KC 2NLWA 2RUGA 3NDKA 5IT9O 4NL5A 3K58A 4BS2A 3VAFA 4B9VA 2WONA 4FXDA 2JWKA 2YKAA 1RTJA 1VC0A 2CQ1A 1ZM4A 4LR8A 4G9ZA 3E01B 2CADA 4B3MJ 1BLUA 4CJ5A 1EAYC 4CJWA 2ZOGA 3V6JA 3TEGA 3OUYB 3MK6A 4DUZF 5KGXA 2IBOA 3CQYA 2JHEA 2YCHA 1UWBA 5AQVA 5LSRA 2B5JA 2D3OR 3ZSXA 4XPEA 3BZQA 4ECQA 1YJWS 3QO9B 3VGLA 2Y1IA 2H5EA 1RDBA 4JKDA 4NLDA 3J7AN 2QWPA 2MKYA 4W5TA 4LF4J 3F41A 3BSOA 3NCQA 1FNXH 1FXLA 5C2CA 4XH1A 3OTEA 5HOOA 1NJWA 5L38A 3K17A 3ZX0A 1N8RO 1HQUB 1BL3A 4IRCA 1Q82O 3T6BA 3I55N 5A8KA 4BHQA 2K3IA 1WOPA 4CEZA 1F2GA 5KQ8A 4G65A 2RN2A 3HL8A 3LP2B 2W4CA 4P73A 4Z4GA 4DV0J 3KHLA 3L0QA 4M7XA 2XSJA 4DR7F 1WC5A 3CQXA 1H74A 2DKOB 2VICA 1TUWA 2XMTA 2C3OA 1HMVB 4K59A 2E5IA 4Y34A 2PSZA 1RBSA 1N6QB 4K8XA 1GLAG 3SAGA 2F96A 3QESA 1ZBSA 4F02A 4OX7A 2F9JA 2XMMA 5L1KA 1RTZA 2L08A 2ZOMA 4FJJA 1LW2A 1IWAA 3O5TB 2FHMA 1JLGB 4GKJJ 3NF8A 4X66K 3MWPA 5AZJA 1X8DA 1HJRA 2J76E 2V6AA 2DNPA 1FX2A 2D0CA 2UU9F 4Z0UA 5GAHP 2CQBA 2KVQE 4DR2K 3NLCA 3WXJA 3QATA 4CGDA 1ZTWA 4DSJA 5KG4A 4WQ4C 3C2PA 4YDDB 3QJPA 4N76A 5AZIB 3SDEB 4OHYA 2VFSA 2DHSA 4RKUC 4KI6A 4X4OA 1VQON 4CLTA 4AILC 1M1KO 5CZ1A 3W9IA 1RT6B 3HVAA 1YJUA 3C94A 3R5BA 2EX3A 4RL1A 4LF8K 3CC4S 4C3KA 3RTVA 2F1FA 2A6AA 2F5GA 3BF1A 4A8FA 5KFFA 2WK4A 1FNOA 1HLWA 1JB0C 2DNNA 3IO1A 1YHQS 3TTFA 1HKBA 2QA2A 4DBQA 1VBYA 3FZMA 2AX0A 1ZAXA 2G8WA 1PYOB 4QJVA 2RQ4A 2XSJB 5B0DA 4ED0A 3LALA 3L2QA 4UY85 3G87A 4GC6A 3G2XA 3H7HB 2MXYA 2W6LA 2RVJA 1D0EA 2VODA 3C16A 2DPNA 2I1RA 2RPIA 1IXKA 3A13A 5KT2A 1RDAA 2BUNA 2IA0A 1QQOA 4UOGA 1NNEA 4FWLA 4HVZA 5AQGA 2Z4PA 1Q86T 3R6GB 3FCWA 1ZAWA 1HARA 1LW2B 1IQZA 3OYKA 2UUCK 3G71S 2MZQA 1HNZF 1NSQA 1MLAA 4B3TK 4B1ZA 1VISA 3S41A 3VQPA 4EP5A 1S1UB 2ZVSA 4FLUA 5D0HA 4P75A 1TYQA 1U8WA 3R6LB 4KYZA 2G8UA 1BE4A 4IOBA 4WFAL 3A8KA 2P9UA 4YHHK 4DCOB 3QFWA 1TV6B 3K5MA 3FBBA 4H5RA 4QYRA 4JV1A 4JYAJ 1XQSC 2COLA 2DRAA 3KYLA 1YVFA 5AR0A 3CMEN 2HQIA 4OFZA 4OYIA 4LSZB 2R7OA 4CESA 2ZZTA 4ECVA 3QLHA 1QVGM 3T69A 4LFBJ 1MROA 4C97A 1UFKA 3GP9A 3CGIA 2HZCA 2M4MA 4C8OA 1NGGA 1V5IB 2Z56B 3OR2B 1VQ7S 1KWMA 1YJ9N 2BV3A 1VAZA 2KN4A 2XO6A 4C8LA 5GIPA