5CYQA

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
548
structure length
548
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 154
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cyqA05
1RT5A 1D0EA 4TY8B 4CEBA 3DRPA 4OPJA 3HO1A 4CEFA 3BGRA 2OPRB 2W9AA 4CJFA 4M41A 3L2QA 4QW9A 3DOKB 3AVJA 1XI1A 4CHPA 1L3UA 3LP0A 4CHNA 2B4JA 4IDKB 2HWHA 1QHTA 2FC0A 4CFCA 1WN7A 4HUEA 5CY4A 3CJ4A 3KKRA 5HBMA 3VQ8A 3RR7A 2FJXA 1RAJA 2J6TA 3G6YA 4KTWA 2GUIA 4ICLA 4DQPA 4F3OA 5J1EB 4DTMA 3VQPA 5KFCA 1S0OA 1KHWA 1HYVA 3K5LA 1CZ9A 4RU9A 3HVTB 3M8QA 4ECXA 3NBPB 1RT7B 4KI6A 1CZBA 3KJVB 3MFIA 4CEDA 2QK9A 4LH4A 1CXUA 1B9FA 2HMIB 2R8JA 4H8KA 1S49A 2J6SA 1RT6A 4HUFA 2CKWA 2IGIA 3LP2A 4O4GA 4B9NA 5DMRA 1UWBA 4NLWA 4IRCA 3ZSZA 1JLFA 4E7KA 2VG5A 3H5YA 1JKHA 3IRXA 2G8WA 3DLEB 3LWLA 2WOMA 2JGUA 3N6MA 2OH2A 2IDOA 1LV5A 2HW3A 1WAJA 1RT4B 3HVRA 1QSSA 1NKCA 1BQNB 3U3YA 1YTAA 4IH5A 2C22A 3VQ9A 3UDLA 1X9WA 3PO5A 3OYNA 4O0JA 4NLSA 3RRGA 4M45A 1J9AA 1NK0A 3JYTA 4NZ0A 4FK4A 4FJGA 3VA3A 3AVNA 3DM2A 4NLTA 4Z4CA 3RWUA 4FJ8A 4F8RA 3LPUA 3KD5E 1REVB 5FRMA 4CF2A 4U7CA 4K4WA 4ECZA 5FRNA 4TYAA 5J2NA 3OYHA 3OYDA 3GIKA 4DLEA 4FM2A 4Q45A 3HYFA 4Y3CA 2W8LA 3CDEA 1Z4UA 3MEGA 3EYZA 4KAIA 4BE2A 1D1UA 2UUTA 2FVRA 1IKXA 4KV8B 3PVXA 4GC6A 3CJ0A 4UQGA 1LWFB 3CM6A 4AHUA 2FBXA 4CEOA 1JKHB 1SKRA 4KKOA 1WSEA 3IN5A 5HRRA 4E1NA 4F4KA 5KT5A 3NH0A 4AILC 3U6FA 4H54A 5KFEA 3DRSB 3LP3A 2BE2A 1C0UB 3KTQA 3HM9A 1R0AB 4W5OA 3SPZA 2BR0A 1K1SA 1IM4A 5KG3A 4KFBA 4Y2AA 3GIJA 3OJUA 1KHVA 2ASLA 4DQSA 4O44B 3KLGB 5DQGA 2XC9A 1W9HA 4O3RA 4FLUA 4ZP8A 4TQSA 3LP0B 4ED7A 3K5OA 1KLMB 3NCIA 2YKMB 3T5JA 2AX1A 3QLHA 5F8NA 3MF5A 4KREA 3OS1A 1JXLA 1BHLA 4NLXA 3CFRA 1S1XB 3AO3A 4Q44A 4RW7A 4KHYA 4F4XA 3UPFA 3TAQA 3BR9A 1I3AA 3Q8PB 1RNHA 2IAJB 2G8UA 2OPQA 1T3NA 2JEIA 4I9QA 1QE1A 4N47A 2YKNA 3TAFA 2RKIA 1BGXT 1CLQA 3FFIA 4HHTA 2HNYA 3L2UA 1RTIA 3LWMA 4XPCA 1UWBB 1A5WA 1HPZB 1K6YA 5I42B 2ZE2A 3PW5A 2VG6A 1U48A 4DEZA 3MECB 1S97A 2ITGA 3CYMA 4G1QB 4DL3A 2RPIA 3EZ5A 3SUQA 3S9HA 3T1AA 4NLPA 2OPQB 2R7YA 3T19A 2NUBA 4J9NA 4ZHRB 2ASDA 4KB7A 4CHOA 1QUVA 1S6QA 1SH3A 4NYNA 1FK9B 5F8JA 4DL5A 3ZT2A 4M3YA 1S1VB 2WONA 3V4IB 4OKEA 3BQ0A 1F21A 1HJRA 3DOLA 3TAGA 3DLEA 2AGQA 4QCLA 1RT3A 1B9DA 5SZTA 3NHGA 3T3FA 4NLYA 1S4FA 4KHNA 4Y2CA 1WNEA 3FRZA 3OSPA 1XC9A 3LALA 3UQSA 3AVMA 2IAJA 4M95A 4ZP9A 5CZ2A 4MQ3A 1ASUA 2R8GA 1W0HA 2GBZA 1LWEA 2XCAA 4EYHB 1U4BA 4E0DA 4FJ9A 5L1IA 3ZSOA 1T03B 1N5YA 5JS1A 2YNFA 3OLAA 2CJQA 4CERA 4DS5A 4QOZB 4CJ3A 4BE1A 2W7OA 3GYNA 4B9UA 1HQEB 2YNHA 4AHSA 4FJNA 3S3MA 3ZT3A 2AGOA 4EO8A 4OVLA 4CJQA 3OYGA 2XY8A 4K4XA 1NK7A 3SCXA 4F3TA 1HYZA 1DTTB 1XWLA 3K59A 3NGZA 2X78A 3ICLA 5F8MA 1ZBLA 4DL7A 1IO2A 1VK0A 3T5LA 3OY9A 3DRRB 4C8OA 3NL0A 3OS0A 4QAGA 5KRSA 3IGVA 2KZZA 2V9WA 3NF7A 3VQ5A 1RTIB 3SV4A 3JYTB 1DLOA 5C25B 3JSMA 1RT1A 3MXMA 1KLNA 3KMQA 1QS4A 3HJFA 3V9WA 4K4TA 1XHZA 2HVIA 3IAYA 4CFAA 3OYBA 3RTVA 4ZTFA 4HKQA 2IBKA 1BQNA 4JLHA 2UVUA 3V6DA 1QQCA 2B5JB 3PJWA 4JUZA 3SI6A 1XR5A 4CGHA 3G86A 3FSIA 2G8KA 2HNZB 3QNNA 4FXDA 3V9SA 2F8TA 4PQUB 3QZ8A 4E7LA 3H4DA 3VN5A 1SV5A 3TAMA 3KHGA 4K4SA 3AVCA 4C8LA 2ILYA 3PW0A 5DQIA 4WE1B 2E9TA 2B43A 2Z1IA 1DTQB 5I3UB 4O4GB 4M3TA 2R8KA 1S9EB 3DLKA 4OJRA 2IM0A 2AWZA 1RDBA 4MH8A 5DG7A 4YR3A 2P1JA 4DMNA 3KHLA 2FLLA 4JRQA 1HYSB 2XO7A 2IOCA 3CJ3A 1VSDA 4CEEA 4WE1A 1KRPA 3AA3A 4LSLB 4DTUA 1K1QA 5FDLA 4DSEA 3H40A 4B9SA 4CJVA 3SFUA 4ECSA 1GOAA 2GIQA 2HHSA 4KBIA 5KRTA 1N6QA 4BE0A 4LH5A 3VA0A 4KO0A 4XO0A 4CGIA 2IM3A 4W5RA 4JV0A 4CGGA 3H5UA 2XI3A 4CFBA 1X9SA 3ASMA 1JLEA 1VRTB 4FJHA 4CF0A 4FZYA 1J53A 4KHRA 1LW0B 2X6NA 4X2BA 3BSNA 1KTQA 2IMWP 4DTNA 3OHBA 4IG3B 1FXXA 1NK8A 2ILZA 4RNMA 3GQCA 4IRKA 4F2RA 2R8HA 1NKBA 4K4YA 1S1VA 2YKMA 2G8IA 2HHVA 3D45A 4F4YA 1QTMA 4ZVFA 3NGDA 1TP7A 2Q3SA 1C2PA 3H59A 5HLFB 4O5BA 4CEQA 1TVRB 4IR9A 1NK4A 3DDKA 3KK1A 4PUOA 4R0EA 4FBUA 3GV7B 1UAXA 3ZSQA 4JV1A 4B08A 3V9ZA 1R0AA 4HYKA 1JLBA 2KZMA 1SV5B 1RT1B 4RG8A 4G1QA 3I5CA 2DPJA 1S6PA 1HNIB 2ALZA 4CHQA 3SYZA 1ZYQA 3KJVA 2HNDB 2BQ3A 2P5GA 3DRRA 3OYLA 3KLHB 2GV9A 3OYMA 3RMCA 2RDJA 3RB6A 3DLKB 4AH9A 4IG0A 2D0CA 4DTSA 4J9SA 1SH2A 3LAMA 2X6SA 1ITGA 3LPTA 4O3OA 1YTUA 3RRHA 3V81A 1EKEA 1RBVA 2HNZA 3ISND 2IM1A 4IH6A 4NCAA 3CDWA 2YNGB 4MIBA 2DFFA 4TQRA 5KT4A 2EHGA 1CSJA 4FCYA 2YNIB 4NLGA 1L3SA 4H4MA 1TK5A 2D0BA 2V4QA 2QKKA 3Q8QB 5KI6A 1S48A 5C42B 3S3NA 5KFZA 3KKSA 4QW8A 4Q0BB 3I0RA 4BWMA 4O3QA 1VSHA 3P5JA 3PUFA 2JEJA 2OYQA 1EP4B 4CJ4A 2PYLA 2Z1HA 5KFSA 2HHXA 3MFHA 4EBCA 4LD0A 4DTXA 4IBNA 3M8PB 3GV5B 5EWEA 3ZT4A 4DSJA 3SUOA 4K8XA 4KO0B 4LY7A 4DSFA 3CO9A 1LWFA 3DMJA 4N5SA 4EBDA 2KTQA 4ELUA 3DM2B 4LSNB 4KAZA 3HHKA 4CJWA 4IKFA 3N6LA 4DTRA 1KVBA 1TK0A 1VRUB 2XY6A 3PW2A 1GOBA 4DLGA 5KT3A 3TAEA 1XR7A 2A1SA 2KFZA 1S1XA 1S9FA 4K8ZA 4DFJA 1S1UB 4IG3A 3KK1B 3DOKA 4PUOB 4ZVEA 3TANA 2HWIA 1KVAA 3H2LA 4F4WA 1RT2A 3RMDA 4AHCA 1TQLA 1FKOA 4Q43A 1RBUA 3VQEA 4WZQA 2IM2A 1TL1A 3QO9A 4B3OA 1L3VA 5D3GB 3MR3A 3MEDB 4HCCA 3FFIB 1BQMA 4H4MB 5D3GA 5F9NA 1RYSA 4KRFA 4E89A 2Z1JA 3PW4A 4CJ5A 5HROB 4CE9A 3CJ2A 3NAHA 4RW6B 3C6UA 2R2SA 3TAMB 3QEPA 4FLYA 4ED3A 2UVWA 3HP9A 4TY9A 4B9MA 3AVFA 2ZD1A 4XPEA 3CJ5A 4WYWA 3LZJA 3O3GA 1SL0A 2W9BA 1EX4A 2P5OA 3SFGA 4EBEA 2O4GA 2BQRA 4O55A 1VSEA 3V4IA 4K4UA 2ZQBA 1U49A 3HXMA 4O0IA 3QYYA 3BSOA 1RBSA 2HNDA 2BANB 4OGCA 1TV6A 4W5TA 3F73A 3H08A 3M9OB 3SJJA 3AO5A 5KFRA 5KG7A 2BE2B 1VRUA 5KG4A 4KHSA 5I3UA 4B9LA 4DFPA 1C6VA 1JLCB 2OPSA 4R5PB 2JC0A 3BSAA 3LP1B 4RNFA 1T8EA 2XGPA 2W9BB 1ZBHA 3AA4A 3I5AA 4KTQA 3NAEA 1IH7A 3QEWA 4ZPDA 1WLJA 1TKTA 4CIFA 1J54A 3IG1B 3RMBA 2B6AA 4DQIA 4NRUA 5JXSA 4FM0A 4J9RA 2P51A 3HVWA 5KFQA 3CG7A 1ASVA 3NMAA 3L3UA 4JV2A 4PQUA 4DG1A 5J2PA 5DK5A 3NGIA 4EO6A 2W9CB 1UA1A 4RW9A 3FQKA 1W25A 3RB0A 5KFGA 4FJ7A 3P83D 2FVCA 1HYSA 3UR0A 2FJWA 4FZZA 4IFYB 3SPYA 4CK3A 4CJPA 4E19A 3KLHA 2RDIA 3NGYA 4RNHA 3AO4A 2B5JA 1HQUA 4IR1A 2FLNA 1NK5A 5C5JA 1BIZA 1RDCA 3I0SB 2I5JB 3E01A 3A2FA 4PY5A 4W5NA 3VQQA 4Z4FA 1S1UA 5CYMA 4F50A 4YR2A 1JLCA 4R5PA 5KFTA 4F2SA 3KIOA 3DLHA 5KG1A 2UVVA 4DFKA 2E9RX 1T7PA 4KKOB 3NF6A 5DLFA 2J6UA 2FBYA 2G8VA 4TN2A 3QGHA 3B6PA 3PY8A 3V1OA 2OPPA 4Z0UA 5DGAA 2RKIB 4MFBA 4JRPA 3HPGA 2AGPA 2FVSA 4H4OB 1TKZB 3ZCMA 1TKXB 1QSLA 3QIPA 2XWYA 3H5XA 1TGOA 2FVPA 1KFSA 3PR4A 4YMEA 3MR5A 4DG1B 4CJLA 3LANA 2HHWA 4AHTA 2D0AA 3SQ2A 4O3SA 1C1BA 4J9QA 1FKPA 3C6UB 4CJRA 4ECUA 5C25A 3T5KA 5KFMA 4RUCA 2VG7A 4NLQA 5EWGA 1C1BB 1O1WA 3D28A 2YNIA 2YNFB 1TAUA 1VSIA 5CYQA 4TSXA 5KFBA 4FK2A 1N4LA 4JS4A 1C1CB 1NJZA 1S6PB 3V6JA 3DOLB 4FJJA 2IC3B 5KGWA 1LW2A 4J9KA 3LP2B 2HB5A 3EPIA 5J2MA 5HP1B 1JLFB 1GOCA 4CF9A 1KFDA 1ZBFA 1RT4A 2XHBA 4KTZA 1RA7A 2RF2B 1Q9XA 1MU2A 3LDSA 3PW7A 1A5VA 4ECQA 3MR2A 3BQ2A 1JLGA 3MECA 5KFNA 4YNQA 3OVNA 3L2RA 5FDLB 2JC1A 3THVA 2WONB 1RYRA 1SKWA 4WXWA 2OPPB 5JUMA 2BDPA 2BANA 3WNGA 3DYAA 5J2MB 5HP1A 3E01B 2ZE2B 4ED1A 2LSNA 1ZTTA 4CK1A 3KK2A 4RW7B 5KT2A 3D5MA 3KOAA 3BSCA 1RTDA 1JLEB 1SUQB 1JIHA 1IKVA 4HUGA 2XRIA 4O3PA 5KFDA 5L1JA 4DL2A 1GX5A 4ED8A 1YVFA 3QERA 4GC7A 3L3VA 3SQ4A 5KT6A 4NRTA 2UVRA 1L5UA 1S1WB 3BREA 3VQSA 3DI6A 4RNOA 4FJXA 3G6VA 4URSA 1T03A 1N5YB 4RW8B 1WAFA 2E6MA 4RW6A 3DRPB 2A1RA 4IKAA 3G0ZA 3TABA 1RDDA 2FLPA 4RW8A 4MKBA 3O3FA 5KFUA 5T14A 1I39A 4I9LA 3K57A 1N48A 1CXQA 3C6TA 3ZSWA 4FLVA 1TL1B 3QO9B 3V1QA 5DGBA 3QEVA 1S6QB 4O4RA 3O4QA 4JS5A 3NKYA 3C94A 1ZTWA 4J9OA 3WNHA 4J2DA 1WNSA 4CJKA 4EZ6A 4MIAA 2HNYB 2IA6A 5KFIA 4KHQA 2AX0A 1RTJA 4ECTA 3BDPA 3ISNC 3QGIA 4RUAA 1TV6B 4QWCA 5I42A 4DF4A 1S1TB 3B6OA 4DU1A 4DWIA 1LAWA 1XR6A 4DTJA 3TI0A 3MEEA 5KG6A 4N76A 4M3WA 4TXSA 1X1PA 3KLIB 4CF1A 2VA2A 1IKYA 2JEGA 1J5OA 4E7JA 3OYCA 4MK9A 2JEFA 5KFAA 4LQ3A 4Z4EA 3C95A 3CVKA 1RTJB 3RB3A 4HVJA 4DU4A 3QINA 4ZTJA 4CF8A 3K5MA 5DG9A 4WYLA 5CYMB 3S3OA 3CDUA 4F4ZA 2W9CA 2EC0A 1L3TA 4J2AA 4ELTA 3RMAA 3HT3A 3G10A 2DPIA 4FLWA 4ZPBA 4IFVA 2W8KA 4FS1A 5KFVA 4M3XA 1LWEB 3RR8A 1BCMA 5CYQB 5KT7A 3M9NB 3ZSVA 1BISA 2G8FA 4E7HA 1IG9A 3CIZA 3I8DA 3FQLA 2YHBA 4FJLA 2KQ2A 3NE6A 4FLXA 4M3ZA 3DI6B 4WFZA 2YV0X 4FW1A 5JS2A 3OYKA 4URQU 4GVMA 3DLBA 2D3UA 4FYDA 3KLIA 3HVTA 3NAIA 3M9MB 3SQ1A 2HHTA 3IS9B 1NJXA 4KHUA 4DSIA 4IQXA 4FK0A 2RN2A 1JLGB 2BRKA 4QWAA 3MEGB 2HHQA 2FBVA 5K14A 5J2QA 5KFPA 1QSYA 2VA3A 3ITHB 4DFMA 3KD1E 4IRDA 1LWCB 4FJIA 5J2QB 3I0RB 5HBMB 1I6JA 3HVAA 3QEIA 1HPZA 2WHOA 1C0TB 1RA6A 5J1EA 1HMVA 4I7FB 3L2WA 4LSNA 2V0NA 1WSIA 4HCBA 3RAQA 3D0PA 3PX4A 4MKAA 1N56A 3CQ8A 1KCFA 3SUNA 2Y1JA 2VG7B 1Q9YA 4J2BA 4B9VA 4Q8FA 1WSHA 3AVHA 1FKPB 4YQWA 4ZP6A 3KLGA 3N6NA 3ZSRA 1C1AA 4IOBA 4OPKA 4M3RA 1KLMA 3I5BA 1WSFA 3HSTB 1S9GA 3OL8A 4YFUA 3V6HA 1S0NA 4WFYA 1NKEA 1VSKA 4BDYA 3QESA 1Z25A 1JLQB 4K4VA 3CFOA 1C0MA 3NDKA 1QAIA 3AA5X 3AVGA 3V81B 2VWJA 3NBPA 2C2EA 3PX0A 3LP1A 3L8BA 5EWFA 1DLOB 3U3GA 3VQ7A 4Y34A 3F9KA 3VQ6A 3DLGA 2QE5A 3PZPA 1JX4A 2QV6A 2D7SA 4CJEA 1TL3A 1JLBB 4WFXA 1Y97A 1T05B 4H4OA 4CIEA 4OKKA 4RW4B 4WXOA 4NCGA 1U45A 1RBTA 4CFDA 4M94A 4ZVGA 3QIPB 5HLFA 1JXEA 1XHXA 3TVKA 3KLVA 4PA1A 2AQ4A 3IG1A 3ZSYA 4DL4A 4BACA 4ED0A 1RDRA 2DTUA 2XI2A 2ASJA 3TR8A 4KE5A 2QXFA 4RNNA 3NF8A 4E7IA 1IKYB 2X74A 4E1MA 5KFHA 5KG2A 1HQEA 1EETB 3PHEA 4NYZA 5KG0A 4B8AB 4TLRA 4ED2A 5C24B 4KPYA 3HKWA 3KK3A 5HRPA 2OPRA 3RBEA 4CGDA 2F8EX 2I1RA 3VQCA 2XCPA 2E9ZA 4CIGA 4ZPCA 3RBDA 3SUPA 3QNOA 2WOMB 3WNFA 5F8GA 4CJSA 4FLZA 5DLGA 4KB1A 2FVQA 1U09A 4K50A 1OS5A 1KVCA 2WCXA 1RILA 4RW9B 2ATQA 3KNAA 3TAPA 4MK8A 5KG5A 4WZMA 1DTTA 1IKWB 1IKXB 4KV8A 1G15A 1BI4B 2WK4A 5KFFA 1JLAA 2AJQA 2B6AB 3OYEA 3HPOA 1JL1A 5HRNA 3ITHA 4KB0A 2PZSA 4FBTA 4CJUA 2R8IA 1SL2A 1NOZA 4U6PA 2G8HA 2I5JA 1RTDB 5EU7A 3DRSA 2OPSB 4QPXA 4ZVHA 2OZMA 1S1TA 1QAJA 3M8QB 4AHRA 3ZT0A 1ASWA 4GW6A 2O5DA 2JLEA 3MXIA 1JLAB 4YP3A 1GX6A 1VSLA 4Z4GA 2IJFA 4I2QA 4DSLA 3NH2A 2Z1GA 4EEYA 2IC3A 1T05A 3VQAA 1RT7A 4DS4A 3QGGA 1EP4A 3MEDA 4E3SA 4Q5VA 2D3ZA 5KFKA 3QZ7A 3C6TB 4KHMA 2DY4A 4LQ9A 1VSFA 1FKOB 4K4ZA 2RF2A 3QIOA 3KMSA 4DF8A 3SNNA 2W42A 1DTQA 1B92A 4ED6A 1LAVA 4Z4HA 1ZETA 1HNVB 1N6QB 1S1WA 4J2EA 1VSMA 1LW2B 3HK2A 1IKWA 1HNVA 1TKXA 2R2UA 2BRLA 3DYAB 4DTPA 4OGEA 3UIQA 4Z4IA 2C28A 2WB4A 5KGXA 4FJKA 1UOCA 3PX6A 4PWDB 5F8LA 3AO1A 2BGGA 4ZHRA 3EZUA 2Y1IA 3AA2A 4EYIB 3LAKA 4CECA 3T5HA 1IKVB 4CEAA 3KK3B 3OSNA 1Q8IA 4BDPA 3DMJB 3OL6A 4ZPAA 5J2NB 3VQDA 3BQ1A 4QWDA 1KSPA 4B9TA 4ID5A 5F8IA 4ECWA 2D41A 3AVIA 3SQ0A 3GV8B 3V1RA 2OZSA 3MTKA 5CZ1A 3AVBA 5KFLA 3HL8A 1WSJA 1QE1B 4R8UB 1U04A 3IGNA 4IDKA 4G3IA 5C42A 3KLEB 4R8UA 4CGFA 3EPGA 3RAXA 1S9GB 2YHAA 5HROA 4C8MA 3QLHB 1RT5B 4TY8A 1RCHA 4QWEA 3BGRB 4FJ5A 3WNEA 1NHUA 4YR0A 4L8RB 2KFNA 5KFYA 1C0TA 3V9XA 3PV8A 3AVAA 3AVLA 3LZIA 4OLAA 2R2TA 2IS3A 3ZSXA 2QKBA 3HPHA 3OLBA 1LW0A 4OLBA 1NNDA 1FK9A 1JL2A 3KLFA 4N41A 1ZBUA 4NLRA 4RW4A 5DG8A 3SI8A 2PY5A 5T7BA 4J9PA 5DQHA 3ZT1A 1TAQA 1NK6A 2C2RA 4NLDA 3K2PA 2VWKA 3SZ2A 1NK9A 2FBTA 3GIIA 1TKDA 3IS9A 1SH0A 5L1LA 2YKNB 3HP6A 3H98A 1S0MA 2ZD1B 4FVMA 3QETA 4IFYA 4TYBA 4DL6A 3PR5B 4NLVA 2BQUA 5KFXA 1RT6B 4NLUA 1NOYA 2PYJA 3KLEA 4NCGB 3O3HA 3MAQA 3ULDA 4RZRA 2KW4A 2DFHA 4KSEB 3ALYA 2FJVA 4IH7A 4ECYA 2VG6B 1D8YA 4CHZA 1D5AA 1YVUA 4ECVA 1UA0A 1RTHA 4I2PB 4PWDA 1NJWA 4C8NA 1ZBIA 5EDWA 4NLOA 5F9LA 3MXJA 3TQ1A 4EZ9A 3M8SA 4ID5B 1SUQA 3K5NA 2V4RA 4DSKA 4NYFA 3V9UA 1TK8A 3P1GA 2GC8A 1BI4A 3OL9A 1U47A 1TKTB 5F8HA 2EX3A 1VSJA 4CEZA 1BQMB 1RTHB 3NFAA 4ZMMA 3IRXB 4ID1A 1D9FA 1LWCA 4O3NA 3QEXA 1HMVB 4FS2A 2D5RA 3K58A 4FW2A 4EP5A 1RDAA 4Q8EA 3OJSA 4URGA 3L2VA 4M3UA 3AO2A 4O44A 3PJXA 1J5OB 1NJYA 1HNIA 1HARA 5L9XA 4I2QB 3H5SA 1D9DA 3JSMB 2WRMA 1REVA 4J9LA 4DU3A 3VQ4A 3KLFB 4HTUA 5K14B 4Q0BA 2DFEA 4ELVA 4J9MA 4DQQA 2ETJA 3TWHA 1HQUB 4DTOA 5KFJA 4AHVA 4Y1CA 3BJYA 1TVRA 2O4IA 4CJTA 4CHYA 4NCBA 4IFVB 3MEEB 4I2PA 2F96A 1MU2B 2XY5A 2YNGA 3PO4A 3KHHA 2HVHA 5E41A 4C8KA 2HHUA 4EP4A 4KFBB 3TARA 3OYIA 1S5JA 4OL8A 1S10A 3CFPA 5C24A 1TL3B 1SL1A 4KHWA 3MR6A 2ATLA 1JXBA 4FM1A 3DLGB 1TKZA 3I0SA 4CESA 2E4LA 1C1CA 3V6DB 4BDZA 4N56A 3AVKA 2W7PA 3EY1A 4FJMA 3CWJA 3E51A 4MFBB 3RB4A 3QIDA 4I7FA 4B3OB 4CK2A 1BL3A 1YT3A 3KK2B 4GMJB 3V6KA 3OYJA 4W5QA 1BCOA 1S9EA 4LSLA 4CCHA 1JLQA 3OL7A 4CGJA 1RT2B 3GIMA 4OKJA 1C0UA 3M8PA 3AV9A 2OA8A 1MMLA 5L1KA 3DLRA 2AU0A 1SKSA 3OYFA 5FROA 1HRHA 2VG5B 5J2PB 3NF9A 3G6XA 2R2RA 1WSGA 4KI4A 2UUWA 4BWJA 1EETA 2WTFA 4M42A 4IG0B 1BIUA 5KFWA 2HAIA 4Y1DA 3FDSA 4DQRA 1NHVA 4ICLB 1RBRA 1T94A 2C2DA 5KFOA 5KTQA 3M8RA 5SWMA 2ZKUA 3O4NA 3OHAA 2XY7A 2E6LA 4ECRA 1X9MA 3GILA 5HRSA 4MK7A 4XIUA 3OS2A 3Q8RB 1A5XA 5EUHA 2HMIA 3CM5A 2GIRA 4ZP7A 2YNHB 1EXQA 4FZXC 1VRTA 3KHRA 1Z26A 4QWBA 4FLTA 3H4BA 3OYAA 3Q8SB 2XGQA 2F8SA 3SV3A 2IJNA 1RT3B 3NH1A 3VQBA 4B8CA
chains in the Genus database with same CATH superfamily
1RT5A 3DRPA 4OPJA 3BM7A 3HOSA 3DOMA 2NXNA 2A3ZA 3L2QA 3TOQA 1B70B 1C0FA 4JOUA 5E3QA 4HHJA 1NM1A 4IDKB 2YBVA 1YJVA 2HWHA 4CFCA 2BJ9A 4D3GA 3AQPA 2GS8A 3S7RA 1EKRA 3ENWA 4NEYA 3R5BA 2FJXA 2J6TA 3G6YA 2HFVA 4DPWA 2GUIA 4DQPA 4F3OA 1KTVA 3EICA 4H0OA 3VQPA 1WOPA 4G9ZA 1P8ZA 2CJAA 5F1XA 4ECXA 1RT7B 4KI6A 3OW2M 1CZBA 4MJKA 3KJVB 2CQBA 2QK9A 4LH4A 1CXUA 1B9FA 3KVGA 2Q43A 1CULB 5C12A 1WI6A 2IBOA 1N0VC 2N7CA 2CKWA 4CO3A 1HA1A 4I0WA 4B9NA 5DMRA 3OBYA 3ZSZA 4NXNJ 3CCQN 1RDWX 3K17A 4F0MA 2FUG9 3VEYA 3BYRA 2UXBK 2OD6A 4QU7A 3LWLA 4IO8A 4GKKK 2FHMA 3D66A 5D0EA 5HJXA 4N8OA 1JJHA 4RWTA 2IDOA 3CC4S 3CJKB 2DNQA 1RT4B 3QFPA 3M6UA 1RB0A 4LF9K 1QAXA 1GNKA 5AQLA 3U02A 2XMVA 2NPIA 3WQUA 1PC5A 3FC9A 3F0NA 4IH5A 3HT0A 4ITSA 3JS9A 3FVYA 3VF6A 3PO5A 4NLSA 1UFWA 4NZ0A 1KQKA 1VC6A 3ZZZA 5IT9U 2AEJA 3P49B 3RWUA 4ZS6A 4F8RA 5HI7A 1X4CA 1HNXF 2DGXA 4L3KA 5FLXY 4IO9Q 5FRMA 4CF2A 3G82A 4K4WA 1HNZF 4TYAA 3G8QA 2XSFA 4DLEA 1V5IB 2UXDK 3KJFB 1E4FT 1RWMB 1D1UA 3THWA 2FVRA 1IKXA 3FCHA 2OSQA 3T7ZA 2NRTA 2U2FA 4CT8A 4O5FA 3CM6A 5ETTA 2FBXA 4CEOA 3PRBA 3DRYA 4GY2B 4KKOA 5ETQA 3NH0A 3A8IA 3DXKA 5F0UA 5ADZA 3DRSB 2E5HA 4QOTA 1C0UB 1UTAA 4W5OA 4OZ3A 1OYDA 1GLJO 5KG3A 4Y2AA 2MQMA 1E6VA 4QYZJ 2PDAA 4O3RA 4FLUA 4ZP8A 2IRXA 2Y0BB 4MIWA 1VLOA 1KLMB 4LRAA 2AX1A 3EX7B 2NQPA 3M6XA 1FA0A 2APOA 2IJRA 4GV3A 1BHLA 2DNLA 3HJVA 3AO3A 4UOCA 3FZBA 4CZFA 4KHYA 2JVOA 2E29A 2GQ2A 3IUCA 1KOOA 3OXLA 1LOTB 2G8UA 1ZXOA 1T3NA 4USKA 2JEIA 3OR1B 1EQ0A 4N47A 2POKA 4CD1A 1CLQA 3FFIA 4U7BA 3THYA 2EG2A 2GFFA 2MLXA 1SI9A 1HPZB 2JJ4D 1K6YA 3CCJN 2FZKB 1ZH5A 3PW5A 2CVIA 4Y00A 3G6ES 1YAGA 4DCOB 3EZ5A 1KAZA 3S9HA 4R25A 4Y28C 3T1AA 1YSJA 4WIQA 2R7YA 3T19A 1NGAA 1Z2ZA 4ZHRB 2ASDA 1YZ7A 3TRGA 4CHOA 4NPOA 1KP6A 2AV5A 2MKKA 3V4IB 1F21A 2RT3A 1N32K 2GWKA 2O3DA 3TAGA 4QCLA 3TJAA 3LDOA 3BH6B 1M90T 3O2IA 3T3FA 2W6KA 3UQSA 1NPPA 3G71N 4M95A 5IXUA 1ASUA 3HLUA 2R8GA 2GBZA 1BQXA 1LWEA 5KQ8A 4EYHB 1U4BA 3BEGB 4FJ9A 3ZSOA 1T03B 1MSWD 2WFBA 2Z56B 1IG8A 2C2OB 2CJQA 3OLAA 5CR4A 1TU0B 4DQ8A 5DM6L 4QOZB 1UPPA 3BZKA 3GYNA 4B9UA 2RAQA 2MB0B 4AHSA 3ZETA 1V3RA 3S3MA 1S12A 3KDOA 3ZT3A 4EO8A 3A13A 1DRZA 4A57A 4A8SA 4OPHA 2GJFA 2XY8A 4K4XA 4QIEA 2HAFA 4R79A 2LDYA 1DTTB 3NS6A 2X78A 2BACA 1Q78A 5BN9A 1H72C 3OV7A 2KT2A 2GVZA 4DL7A 1IO2A 3ET6B 3T5LA 3DRRB 3D67A 3QRQA 3LGMA 1VQPS 2FYXA 5KRSA 2MQOA 3JYTB 1MDUB 1YIJN 2UXCJ 1RT1A 3MM5A 1IR1A 4FVCA 3SLCA 4F67A 1KNZA 1KLNA 2IRYA 4BQLA 2KVIA 3HJFA 3V9WA 4K4TA 1XHZA 2HVIA 2XG8A 1TUWA 4X62K 4K7QA 2L9NA 1BQNA 2WSEC 4JLHA 4WKYA 1QQCA 1Q79A 4CGHA 3G86A 1QAYA 2V34A 4TKTA 2C1EB 2HNZB 4FXDA 3PG9A 3GDQA 3A8EA 3DXBA 1AXQA 5BJRA 2ROGA 3VN5A 3TAMA 3MXHP 4U67L 2H5IB 2AKWB 5DQIA 3GMGA 1IQZA 2B43A 2RRAA 2AEMA 5LMUJ 2FF3B 3NVMA 4M3TA 4H4KC 4OJRA 5ETVA 3P8BB 2QWMA 2DNNA 4JB8B 4B3MF 3DHXA 2I9SA 3KHLA 3ZZOA 1HYSB 2XO7A 2FJDB 3CJ3A 3G87A 4LSLB 3CCMS 3C19A 5FDLA 3I56S 3MMJA 4FPAA 4CJVA 4ECSA 2L3MA 1WI8A 4GVEA 5AQNA 5HJYA 2I38A 3NY0A 2MKSA 4KBIA 1MROA 1R31A 2CJKA 2HSTA 2N4DA 3M1FA 4TU8A 3TP2A 4JV0A 4P10A 3H5UA 4CFBA 1X9SA 4CLTA 2HGLA 1JLEA 3CMEN 1F5BA 4KHRA 4N77A 2YWKA 4R0JA 3L7UA 4OZJA 1E4GT 3OHBA 4M1KA 3R8EA 1NKBA 2YKMA 2HHVA 3D45A 3A5OC 1CEZA 4ZVFA 4LBPA 2FXUA 1TP7A 1WF1A 1OH7A 2P6SA 4ZITA 4KHPJ 2IVPA 1TVRB 2MQ8A 2J8SA 4PUOA 1OO0B 3WXIA 1HKBA 4B08A 3CJ7A 2YVSA 4RUBA 5U47A 1S6PA 4CHQA 1Y7PA 3SYZA 2WUSA 2P5GA 1U1LA 4GVBB 1OH5A 1UEUA 3OYLA 3O9TA 3CTRA 3RMCA 7FDRA 3ZX0A 1NGCA 3DLKB 3HFVA 2X6SA 1U1RA 1H1VA 1ITGA 3LPTA 3BKUA 2LLZA 2DH8A 1A0OB 3NGSA 4LF5K 2IM1A 2UUAJ 5DZ6A 4UF4A 3QGPA 3BO3A 5MAOA 4NCAA 2L9DA 2A2DA 3HF5A 1LWXA 4MIBA 3PYGA 5KT4A 2EHGA 4ILJA 5HN0A 2JX2A 1CSJA 4ZK7M 2YNIB 2EKNA 2X7IA 2A1BA 5KI6A 3DGPA 3WXJA 3KKSA 4XK8C 4QW8A 3CERA 1YF5L 2NZ4A 3PUFA 5BYRA 2GMLA 2GHVC 4M7YA 4O23A 4LFAJ 2HQCA 4EBCA 4LD0A 5H1SQ 4IBNA 5E2QA 5EWEA 2DR5A 3SUOA 1RBAA 1VISA 4IO1A 1FRIA 4P2SA 1ZS6A 1WWHA 4DR4F 5DDOC 2IVYA 5HO4A 3ENVA 4N5SA 2DRAA 1CZAN 3WX4A 2YCHA 2EC2A 2XY6A 3PW2A 1S1XA 4BRFA 1S1UB 3NCQA 1KVAA 3H2LA 4F4WA 3RMDA 2P9LB 3DFEA 4OX9K 3M2UB 4Q43A 3CF5Q 3QFUA 3X1LB 5DM7Q 1U0SA 1TL1A 3QO9A 4B3OA 3W5YA 4OFZA 3MR3A 3MEDB 1NMDA 4JHDA 3MOJB 3AOCA 2UXCF 4JBCA 2GTDA 3PW4A 4CJ5A 2VC1A 3OR2A 4X64F 2HBRB 1YHQS 2R2SA 1TMMA 1G7CB 1VCTA 4FLYA 3HKZD 2UVWA 3U1NA 3TZWA 3IKMA 4I67A 4AYBD 5LSRA 4RBTA 4XTTA 3AVFA 2ZD1A 4XPEA 3CETA 2OMOA 1SL0A 2W9BA 4KRWA 2P5OA 3QT5A 3P38A 2E1AA 1LEOA 3CCUS 4EBEA 2ZQBA 3K7RA 1HW8A 1RBSA 1H3DA 4EFAC 1TV6A 4MLEA 2PN6A 4OQJA 3H08A 3SJJA 3MPVA 4ZN1A 2UU9F 4KHSA 3LDPA 4B9LA 3A0IX 3MR7A 2JC0A 3BSAA 2GQQA 2C2MB 2LA4A 1UVJA 1T8EA 1H2UX 1GLCG 3PSFA 4DCHA 1ZBHA 2DXEA 3AA4A 2D9OA 1N33K 5E3AA 2F9TA 1M0SA 2P9EA 3NAEA 4RX6A 1N8RO 1NLVA 1VI7A 1TKTA 4P2FA 4NRUA 2P51A 2LEPA 3NMAA 4DV6K 4DG1A 5J2PA 4RL1A 3E66A 2W9CB 4ES3A 1IWAA 2XS5A 1JMTA 1SKUB 4PAAA 5KFGA 2UV8A 4ANCA 3TVZA 3DOMB 4DR1K 1HYSA 4FYYB 3UR0A 2E1CA 4FZZA 4IFYB 5DJBA 3SPYA 5C2DA 1S99A 1PIEA 2GVDB 1WEZA 2C2ZB 4DBQA 4RNHA 2HF3A 4HACA 2B5JA 1OY6A 4IR1A 2MDAA 4B3MJ 1Q18A 2DCUB 5BRFA 4QU6A 4BBYA 4PY5A 4GVBA 4Z4FA 3JB9k 2R7QA 2CUYA 4LIWA 2MQLA 1VJQA 4F50A 4H0TB 2AIRB 4R5PA 3S6EA 2QMUB 4NXMJ 3KIOA 1YIJS 1RAOA 5KG1A 2UVVA 2DEJA 2BVZA 3I31A 4X84A 2E9RX 1T7PA 4EWTA 5DLFA 2B9EA 2G8VA 2ITMA 2E1MC 2WVFA 4Z0UA 4JRPA 3LPYA 3EMTA 1XUPO 2AGPA 3T1YF 3ZCMA 5BYQA 3CIMA 1TGOA 1KFSA 3PR4A 2HFSA 4DR1J 1YLXA 4ZVSB 2QGFB 3GLJA 3EKUA 1VQ9N 4WCEL 4ILMA 4YOVA 1VQMN 4CLYA 2HVEA 3F56A 4RUCA 2CGKA 2VG7A 4OX7A 5EWGA 2AYBA 2Y8WA 4NYPA 2JOQA 3D28A 3LM9A 1KDNA 2GVZB 4P71A 1B0PA 4FK2A 4JS4A 2XZDB 3IMXA 2ZJQL 2ZM6F 1JCEA 1LW2A 3H1QA 1JLFB 2KHOA 1DZ5A 1KFDA 2MKCA 2W2OP 1OPZA 4KTZA 2J0SD 1HR0K 1Q9XA 2XLJA 5LXYA 1T9TA 3PW7A 2HZCA 2ZOMA 3WQPA 3MR2A 3TX8A 3MECA 1P1TA 3OXFA 3Q2SC 1RYRA 1XC3A 8ATCB 1U2VB 2OPPB 3CUNA 2BANA 2KVQE 1Q95G 4DR2J 3DYAA 1SIWB 1RAIB 1GLAG 4L72B 3B6BA 4PG5A 2D1KA 4CK1A 2H4WB 2QM1A 5GMKa 1Q16B 1JIHA 3CMES 1IKVA 5BR8J 4HUGA 4HDGA 4HACB 4DI6A 5L1JA 2CQGA 1M90O 1FDAA 3MCPA 1Q53A 3CJSA 1Q81T 3LL3A 2A6MA 2FF6A 5A6WA 3NG8A 3TTDA 1N5YB 1GMWA 4RW8B 1WAFA 2E6MA 1J27A 1OY9A 3PEHA 1FRJA 1OY8A 3NNAA 2HFUA 4RW8A 2O66A 4MKBA 3RSEA 4J91A 2R7UA 2RS8A 3MHYA 4FWMA 2HSEB 5DGBA 2N3OA 3QEVA 3O4QA 3CE8A 3NKYA 2NXEA 2MZ1A 3Q7CA 2ZC3A 3H25A 1WNSA 4CJKA 2CNOB 1FJCA 4BRCA 2DR8A 1RTJA 4PYDA 4O0NA 3H90A 4PG4A 1TV6B 2ZM6K 3M2VB 4A2BA 3M8WA 1UVKA 2HQFA 4FPRA 4BC7A 3QPIA 5JVGL 8AT1B 3O80A 4M3WA 2QO3A 4M5GA 5BPLA 2IY5B 3HHLB 4CYUB 3OYCA 1KQGB 2BW7A 4MK9A 5KFAA 3R6MA 2ZH2A 3A8KA 1TL5A 3C95A 5HAOA 5BRDA 4HVJA 1WF2A 2F1FA 3L4QA 3QINA 4CF8A 3CCZA 4DMZA 4W92B 1D09B 4F4ZA 2W9CA 2EFVA 2IFXA 4NXMK 1RZMA 3AHPA 5T41A 4LR9A 2CPDA 4JI6F 1TFWA 4ELTA 3HT3A 2DPIA 3I87A 4ZPBA 3EJMA 2OTJS 3CJTA 2ASMA 3Q23A 4FS1A 3QQCD 5KFVA 4CLZA 1BCMA 1IVZA 3IAS9 5KT7A 1SC3B 4NA2A 3D0IE 2DBBA 2O8DB 3ZSVA 3FGUA 1RHMB 1FD2A 1L3KA 5E3PA 4FJLA 2KQ2A 5LSLA 4OHYA 3NE6A 4M3ZA 3MD1A 3VESA 6FDRA 2DITA 3DLBA 4F4AA 4OHVA 2KJWA 4FYDA 4NEZA 3SQ1A 2F5GA 1BDGA 3GCWP 4ZCMA 2RN2A 2PC6A 1JLGB 2BRKA 1RU2A 1VAZA 1G1XA 5KFPA 1JJ4A 1YX2A 3ITHB 1SQEA 5EX3A 1TYQB 4FOEA 3WDOA 1ZM9A 5HBMB 1I6JA 1ZOTA 3HVAA 1WUUA 2WHOA 2C3YA 3EDQB 5B0EA 1HMVA 3MM6B 5GADU 1DBDA 3MTJA 3RAQA 4OJGA 1F9HA 4PPDA 5BR9A 3J81O 4QS8A 2Y1JA 1NM2A 2GCFA 1WSHA 5CZXA 1Q86T 4ZP6A 3N6NA 3ZSRA 4AFFA 4O8UA 1KLMA 3I5BA 3RAMA 4UY85 3CJKA 2NCKL 3CCES 4PCQA 4BDYA 2RSQA 4WFAQ 5AE3A 3ATVA 4K4VA 5CA5A 1C0MA 1MLAA 2R7RA 2VWJA 4C7QA 1D8ZA 2GIFA 5EWFA 5LY3A 3VQ6A 3DLGA 1SC6A 2QE5A 2BE7D 2D7SA 4CJEA 2M7SA 1NGFA 3VENA 5GINA 3ZTSA 4NCGA 1RBTA 1N5VA 3A12A 5CCMA 1T11A 1N32J 1JXEA 2NYIA 2FIUA 1XHXA 4FNHA 3KFWX 3QSIA 4X4PA 4PA1A 2H9ZA 4P52A 3MPUB 3KHYA 4BACA 4ED0A 1RDRA 2XI2A 2ASJA 3TR8A 4KE5A 1LOUA 3BGLA 2X3GA 4YDDB 3MUTP 1YI2S 1ZA2B 3O08A 2VH7A 1HQEA 2H48B 3HULA 4ISEA 1WJ9A 1HW9A 3Q0AA 4C0HA 5ELZA 3KK3A 3UE2A 2GX9A 2GJ2A 2XCPA 3M2RA 3SUPA 3I96A 1X4DA 2WOMB 2XNRA 2FC9A 5TKYA 4CJSA 5ETMA 4KB1A 4B3TF 3W66A 2FVQA 3WUHA 4BS2A 1KVCA 1RILA 1S0VA 1WC0A 3ENAA 3R7BB 1NGGA 1JLAA 3IWNC 2AJQA 1NLKL 1J6ZA 4QIFA 4DUZF 5CABA 2VQFJ 1JJCB 1REGX 3M3ZA 2XSJB 4ZCKA 1WKJA 2VD3A 3IM9A 4C8YA 5EU7A 1EARA 1W26A 2MKHA 1R8CA 1ASWA 2D0PA 1HNXK 2E2OA 5C0YA 2JLEA 1DFDA 2BOPA 2WVDA 5DS7A 1T9YA 2IJFA 4X62F 3JSYA 3WZ0A 4I64A 3NH2A 3M30A 2P9SA 2IC3A 5GAGP 1RT7A 4N8NA 3QGGA 1ZBSA 1D9AA 3VZIA 2D3ZA 5KFKA 2VPWB 4C3LA 3BGFA 1VSFA 3NEKA 5GAHP 2RF2A 1KKHA 5LOQA 5K8OA 1I94F 2J9DA 4ZJQA 1N6QB 2E2PA 3ZNUA 2B8PA 4J2EA 1Q8BA 1VSMA 2NUUG 1HNVA 1TKXA 2BRLA 3DYAB 4OI2A 4QS7A 1MWMA 3MM9A 4ZJLA 1WKLA 2O8BA 2WB4A 1OH8A 3DC2A 3BN7A 2QL9B 1UOCA 4X4QA 2BMBA 1TL7A 4PWDB 1VQOS 2ZWOA 1RACB 2FD2A 2F8MA 1FDNA 1T6DA 4LF9J 2N3LA 4JI0F 1PO6A 4DUYF 3H2UB 1P9QC 4P73A 3UN2A 2B7CB 4OYMA 1JJ2M 3OSNA 3W7BA 1NCLA 4AXJA 1EQYA 3DMJB 4HR2A 3UCZP 1NB7A 5J2NB 3VQDA 3TTFA 3BQ1A 3C0BA 4ID5A 2B9YA 3W9HA 3AVIA 3GV8B 3V1RA 5A0YB 3SAGA 2DGSA 3AVBA 4K5SA 5CH7B 4TVAB 5ETRA 3ILJA 1WSJA 4R8UB 1K8KA 1U04A 3IGNA 5DETA 1YTYA 4OJ1A 3OTCA 1RAHB 1AZSB 4G3IA 3Q8VA 5C42A 4R8UA 4CGFA 4UZBA 3J7YI 2F40A 3KKFA 2D3OR 4OO1J 1HNWF 1S9GB 5J1NA 2YWGA 2YHAA 3FBFA 1SQFA 3QLHB 3W2VB 2DD8S 4TY8A 4A62A 3EO3A 3BGRB 4FJ5A 1NHUA 3GR0A 4YR0A 1C0TA 3GP9A 2RNEA 3AVAA 2R2TA 2QYGA 3RBXA 2B4OA 2QT7A 2PMHA 1IR0A 3O9RA 3OLBA 5CZVA 1LW0A 2R9LA 1SJ3P 1NNDA 1KBRA 2DGQA 4RW4A 2PY5A 4FF4A 4J9PA 5T7BA 2HQIA 4H0XB 5DQHA 3ZT1A 5BXIA 1NK6A 3TSQA 4YB7A 2C2RA 3K2PA 2VBYA 4U96A 3SQGA 2CIMA 2DGVA 4NXNF 4JKEA 2O8BB 3H98A 4IFYA 3PR5B 4C98A 2BQUA 3NXZA 2C2KB 2MHNA 4NLUA 1VQ4N 2P9UA 3M32A 4YY3F 1VK8A 1XTZA 4DV4J 5EN1A 4B3RF 4IH7A 5I4MA 3H45C 2G0JA 2N7YA 2AJFE 3P5TL 2NRHA 3M8YA 3U8XA 1RTHA 1S77D 4PWDA 4V19S 2FHOB 5F9LA 4GKJJ 4EZ9A 1BOTO 1P6TA 4WFNQ 4DOZA 3K5NA 4U8YA 2BM0A 4GO7X 3P1GA 5LSOA 5GAEU 1BI4A 1N36F 1TKTB 1CLFA 4CEZA 4C48A 2M88A 5FPDA 1ELOA 1X7VA 1K0TA 3KDNA 2QLXA 2DJWA 4I68A 5IZHA 2RE2A 3M5RA 1TUUA 3PKMA 4FS2A 1VOMA 1OIAA 2V6AA 1UVIA 2K8GA 3OJSA 4M3UA 3BPSP 5AFUA 1B4SA 5E84A 2ZH1A 4RTFD 2IYIA 2M9KA 1NJYA 5D15A 1HARA 1U24A 5L9XA 4RUHA 1SC1B 4LFCF 5IOLA 3ZYYX 3KLFB 1H73A 4HTUA 3QDKA 5K14B 3O6QA 1G2EA 4DQQA 4BROA 3TWHA 2NLXA 1YQHA 3UKUB 2O4IA 2AMCB 4CHYA 4FWNA 1MU2B 4ZLNA 3H2VE 3VGLA 3KHHA 2ZH4A 3TARA 1S10A 2ZM6J 3ENBA 1TL3B 3IWXA 1URRA 2FJAB 1TKZA 1UVLA 2JH3A 5I3QA 2W7PA 3EY1A 1S6OA 3E51A 3DJCA 2LQBA 3QIDA 1KQFB 4GRSA 2A40A 2CPFA 1RT2B 1HBMB 2BEFA 3D6TB 3DLRA 4JI8J 1SKSA 4CZHA 5FROA 2QA2A 5J2PB 3ZEUB 4KI4A 2YPYA 4IG0B 1S4EA 5D8HB 3MI7X 1NHVA 1PC4A 2ZKUA 4A8XA 4H5NA 3OTOJ 4M5NA 2CDRB 4ECRA 2LU1A 3THWB 3P45B 3IDHA 3MWTA 1VQ6N 1BXNA 4K5RA 3CM5A 4USUA 2ZH6A 2J5AA 1EXQA 1NO8A 3OFGA 1VRTA 4AQYF 3I82A 1HL6A 2BOAA 3G82B 2O8CB 1RT3B 1T3OA 4DV3F 4LRCA 1D0EA 4CEBA 2H54B 4KGMA 1FX2A 4CEFA 2OPRB 4CJFA 3FZLA 3DOKB 2E5IA 3LA0A 3CC7N 1YZ6A 1L3UA 4JI4J 4FP9A 3OR2B 3QNWB 4O8KA 1K9MT 1M1HA 4HUEA 5M2UA 2V69A 2ZBRA 3UD5A 2RB7A 5AQZA 4FYVB 4ICLA 2VKRA 1RHKB 2CQIA 5KFCA 4OI3A 3CJQA 1KHWA 1HYVA 3HTVA 1CZ9A 4RU9A 3M8QA 4M5MA 4OI6A 2IDLA 4CEDA 1S72S 1VQNN 2CJXB 3ZX3A 1OQ3A 2Y0SD 4H8KA 3FBBA 3K8VA 3D2EA 2J6SA 2ZH8A 2IGIA 3IFRA 3LP2A 4O4GA 3EE9A 3GSDA 1BLUA 4NLWA 2R4FA 4EFHA 5F2RA 3QRPA 3H5YA 3THTA 3WHIA 1E3MA 4PWUA 1DY3A 1XNQF 2O8FB 2MTLA 2XS7A 2JGUA 3SMPA 2OH2A 1LV5A 2CRLA 3Q89A 4YY3J 3HVRA 1QSSA 2DHHA 4NLBA 1YJ9S 2C22A 4DR5F 3AARA 3ZC4A 4H5RA 4M45A 4A2AA 4FJGA 2OMLA 4XH1A 3LPUA 5AQFA 3NCPA 4H0YB 2FSJA 2QYCA 4U67Q 1Q81O 1NMNA 3GIKA 2I0XA 2ZBPA 3JXUA 4FM2A 3JAMU 1NH8A 2V8VA 3HYFA 1T6CA 2W8LA 5FPNA 4KAIA 4JI7J 4B3RJ 3CJ0A 1FWLA 2VDIA 3Q2TC 4UQGA 3KNGA 5FLXU 3MUMP 2ALYB 4Y2MA 1JKHB 5ETNA 4ES1A 1SKRA 4FVUA 1WSEA 3IN5A 1H38A 4FKYA 1NGJA 3LP3A 2BE2A 2NXCA 1Y5NB 4Y2IA 3KTQA 3I56N 3K9KA 4J5OA 2BR0A 3PIPL 1RBOB 1FRKA 3K2YA 3UD3P 2DY9A 1KD1O 2YQ1A 2V7ZA 4DV1F 3KLGB 5DQGA 4TQSA 4JD2B 3O5BA 2VBZA 3VGSA 2E2QA 3S01A 2GEMA 2YKMB 2BJEA 4JKHA 1R89A 5F8NA 4YHHF 3CFRA 5IS2A 1CS4B 4F4XA 3UPFA 1PYTA 5I3PA 4K2JA 3BF3A 4Z7YA 2IAJB 2RHQB 3CD6N 2J9EA 5C7PA 1QE1A 5B0DA 4LFCJ 2RD5C 4FSVA 2WW8A 3SQOP 1APSA 4HHTA 3M32B 3L2UA 1R7IA 3CCVS 3LWMA 2LFVA 1UWBB 3W3DA 1XNRF 1KWMA 3FMWA 4U7UK 4DEZA 1VQ8S 2ITGA 4NO7A 4DL3A 2H3EB 4DXLA 5A8KA 2V8HA 1BHNA 2GWJA 1PYSB 5RUBA 5LM7E 4KB7A 2C3OA 1S5ZA 4NYNA 2A0FB 4DL5A 4DU8A 2IVOA 2V2VA 1AFJA 4M3YA 1S1VB 3IR7B 4CO4A 3DOLA 2DGOA 3DLEA 1YITS 2DXFA 2K7JA 4M7XA 4NLYA 1GMWD 4KHNA 2C3MA 3BPDA 1N32F 2Q1NA 1WNEA 5M2PA 3LALA 1HX1A 2IAJA 3RSEB 2ZH5A 3CCRS 3EGZA 3JSBA 3EGWB 2ZHAA 1RADB 4E0DA 4CZMA 4BHQA 2EFPA 1N5YA 1U6FA 1U0HA 2H5EA 3R2DJ 2RMLA 3W60A 2FSNA 4ZVRB 1C4AA 5H1SV 1VBKA 4LF4K 4DV1K 1GLBG 1BMQB 3AXKA 4J90A 1SQKA 2YNHA 1MN9A 4BR7A 4G1PA 5D0HA 4FDFA 1ROFA 1XMQF 4WU3A 4OVLA 4CJQA 2OO4A 3OYGA 1F2HA 1H2VZ 3SCXA 3E2EA 4F9OA 1XWLA 3NGZA 2F8HA 2UXBF 2WW4A 3AB4B 1GTEA 4OYXA 1ZBLA 4GNIA 3OY9A 4IOAQ 5LJ5Y 3VALA 3VV2B 2DISA 3OS0A 2KZZA 4BR5A 2V9WA 4ZLLA 3NF7A 3VQ5A 1RCOB 2HVZA 1W7WA 3R1LA 5A8WB 5C25B 2VQFF 1WOSA 2ZDPA 4IUFA 3MN6A 4TNOA 1UKUA 1UP1A 4FXVA 1GK8A 5AZIA 1KQSM 3ETMA 1GXTA 3C7NB 2ZBCA 2JFDA 3RTVA 1SIZA 4CM2A 1BC6A 3KZBA 2QW9A 4X4RA 2B5JB 3POTA 4JUZA 2W25A 1RCXB 4NZ7A 3P31A 3G9CA 5CQGA 3FE1A 3QNNA 1TL4A 4PABA 2FGOA 4PQUB 3QZ8A 3BH7B 4E7LA 1NGHA 3H4DA 4FO0A 4M5KA 2LEBA 2VU5A 2MLYA 4KGVB 3PW0A 4WE1B 1CPZA 3D54A 1HUXA 4PKDB 5AJ3K 1KOHA 4EU0A 3UDVA 1RDBA 5AQGA 1FCAA 3HBTA 2R42A 4NI2A 3W64A 3OPKA 3E9LA 2P1JA 1WEYA 4U9RA 1NH7A 2FLLA 2QLJB 1VSDA 2FY8A 4CEEA 1RUSA 3I55N 4CLWA 4DTUA 1HBOB 4DSEA 4B9SA 5D77A 1F5AA 3MMVA 3PYFA 4ILHA 1GOAA 4JP8A 2GIQA 4J9UE 1X4BA 2OANA 3P39A 4G6VB 3AAWB 1N6QA 3HHLC 2FHJD 3HI0A 2ACYA 4KO0A 1IBLF 4AUKA 2F7VA 2GO8A 2QSWA 4CGGA 2M5YA 4BR9A 2XI3A 3RG6A 1IXKA 3ASMA 3LF0A 3AXMA 3W63A 1VRTB 4XEIA 4FJHA 4CF0A 4IO9L 1J53A 3UWTA 2X6NA 1VYAA 3BSNA 3NGUA 2VQFK 4BC5A 2OKQA 2ROEA 3NMUA 2PIIA 2IMWP 4DTNA 1G99A 1PG5B 2R7TA 4IG3B 4BR4A 2HVDA 4NA3A 4RNMA 4F2RA 4NXMF 2R8HA 4K4YA 2Z57B 4BRGA 1V3ZA 2PD1A 2Z2LA 2Q3SA 3CCLN 3A4TA 3H59A 1PSDA 1Y9OA 4XH4A 2K1RA 3RZAA 3FCWA 2CNLB 1UAXA 4X65F 1M5VC 3ZSQA 4PR6A 3V9ZA 3U1MA 1PILA 4RG8A 2VODA 4G1QA 2QLBB 1WG5A 2D4WA 4BG9A 2VZ9A 4OV1A 1I5OB 2UXDJ 1QVFR 1ZYQA 7AT1B 4HHUA 1X4GA 3KLHB 2VDHA 1U8SA 2ROPA 3VGVA 2RDJA 3RB6A 4YHHJ 4AH9A 4CZIA 2LECA 4IG0A 4DTSA 3GOIA 1SH2A 1W2BM 4RJVA 1HWUA 2Y8YA 1RBVA 5AZIB 3ISND 2IIRA 2OUGA 3CDWA 5MLCQ 2DFFA 4TQRA 3J80O 2M3DA 1D4XA 4FCYA 3FEZA 2V4QA 2D0BA 2QKKA 1U6BA 1WHWA 2HIQA 3A3PB 3S3NA 5KFZA 1NGDA 3CW2C 4TU9A 3IFEA 3I0RA 3AOBA 4OZ5A 4DV4F 4O3QA 3CPWM 4ZLJA 3OFFA 1EP4B 2PYLA 2Z1HA 5GVQA 1RWPB 4JI5F 1RFQA 4XDDA 5AXNA 4W98A 3GG4A 4H5TA 4KO0B 1N36J 3BUZB 4DSFA 5SUHA 1T44A 1FI4A 3W61A 3Q24A 2K7KA 3CO9A 1LWFA 1BU6O 4EBDA 3DM2B 4KT0C 1NGIA 3N6LA 2X1GA 1VRUB 1YGYA 3W2WB 1HNZK 4MAKA 5LMNK 4QR1A 1S9FA 4K8ZA 1YJNS 4WTYA 2ZHBA 4IG3A 1M1GA 4PUOB 4ER8A 4PG8A 3VR1A 2P2CB 3H20A 4X65K 3J80U 1RT2A 5L9NA 4ZPWR 5IWAJ 2A6OA 1FKOA 1NSAA 1RAAB 4OPAA 1FVQA 4HCCA 2DKOB 4OMFG 5D3GA 4C9DA 3U4LA 5HROB 4CE9A 3CJ2A 2YWWA 4RW6B 3H42A 4NLCA 3SCKE 4GV9A 4ED3A 2B9WA 4UY8T 4YOUA 4UUXA 3R5GA 4B9MA 1C4CA 3CJ5A 4B3MK 3NOCA 1TTHB 3SFGA 4EHUA 4O55A 1VSEA 2KKHA 2JFKA 2DHAA 5JVHL 3HZGA 2BANB 4OGCA 2CQ0A 3PFOA 3M9OB 3AO5A 5KG7A 1WC6A 3NRBA 1FKAF 4ANDA 4DFPA 4CRJA 2AJ4A 1JLCB 2OPSA 1HBUA 1UL3A 3LP1B 2FTRA 1CJUA 4WFBQ 2UU9K 3QT7A 3IA0A 3QATA 3O9UA 1IR2A 5HOOA 1IH7A 4ZPDA 2KXNB 1CC7A 2CG4A 3O9QA 2B6AA 1RHQB 5JXSA 4J9RA 3CG7A 1ASVA 3HHEA 5JMVA 3C6AA 4JV2A 3P4IA 5K8MA 5DK5A 3A3OB 3EXCX 2HHPA 3RB0A 4OHWA 2R3VA 4FJ7A 1UPMB 3C46A 3I9ZA 2FJWA 1YJRA 4C0OC 4U95A 1MNEA 2HEKA 2XEXA 2RDIA 3AO4A 4EIAA 2M0GB 4RWXA 3OTBA 2N82B 3T6BA 1WBBA 4UUWA 4JI3J 4W5NA 1S3XA 5A8RB 5CYMA 4W90B 2VFSA 3C65A 4LF8K 1S6UA 4F2SA 5E7OB 2L41A 4JV5K 3VAMA 4DFKA 3GJRB 3QGHA 3FZ2A 3LOUA 2OPPA 1ZM2A 2ZOGA 3SBMA 4MFBA 5EVZA 2GGPA 2N4CA 3VVTA 5LJ3Y 4DR3K 5J1PA 4QR0A 2FVSA 6AT1B 2P9IA 4OLPA 1TKXB 3QIPA 3H5XA 3UFCX 4DUYK 1LKZA 5C10A 4UW2A 3WIVA 4YMEA 4DG1B 5IQ6A 4CH7A 2D0AA 3SQ2A 2CWKA 1C1BA 1FKPA 3C6UB 4A5AA 4ECUA 3T5KA 2MY8A 1T95A 2H65B 5KFMA 1FNMA 4NLQA 3M7VA 4DJBA 4JYAF 5CYQA 5KFBA 2ZOFA 1N4LA 3FUYA 1C1CB 3DOLB 4FJJA 2IC3B 1HNZJ 2XS2A 3UCUP 3CPEA 4J9KA 3LP2B 5GIPA 5ADXH 2XYGB 1GQEA 2V2KA 4FNIA 5HP1B 1GOCA 4CF9A 1ZBFA 2RF2B 4ZA1A 4JI7F 3K5PA 3H46O 2A10A 3BQ2A 1FXDA 3THVA 2M8HA 4YORA 1SKWA 4WXWA 2I8EA 3R5JB 4DUYJ 2BDPA 2JWNA 3EVMA 1ATSA 3NGRA 3D1QA 3CMAS 3E01B 1N88A 3KK2A 4NB4A 5KT2A 4FXWA 3D5MA 1Y00A 3W62A 1FT8A 3EN9A 2QL7B 3CI5A 2QZ8A 1NGBA 1RK8A 3BS9A 2AZ1A 1YVFA 3QERA 3B4DA 3THYB 1KS2A 1E6YA 1XK8A 3CCSS 1RAEB 4DR7F 3VQSA 3TSPA 1T03A 2QSFA 4RW6A 3CCLS 2A1RA 3TABA 3PIOQ 1T0TV 3GSIA 1RAGB 1I39A 3PIOL 4YUDA 3W8PA 4I9LA 2XWXA 4JS5A 1ZTWA 2DHSA 2X1AA 2CDQA 3MM7A 1HJOA 4MIAA 2HNYB 3FRYA 2RE1A 3MPYA 5KFIA 1M1KO 4IEIA 1RDUA 4Y2KA 5DDQC 1X5PA 1YBTA 4DU1A 5IFMA 3F41A 2F65A 3TQEA 1XR6A 4DTJA 3MEEA 3FR0A 5G4DA 4TXSA 3EL2A 5C15A 2UV8G 1J5OA 2QMXA 1N34J 2EFGA 3QBCA 5E3CA 1RI7A 4HT5A 3HM8A 1AB8A 5FLXO 4L75A 3J7Z5 1A6LA 5L46A 1H0HB 1V6HA 4MKYA 4LF7F 5DG9A 4WYLA 2YX4A 1ZPWX 3ENQA 2QA1A 2DNMA 2EC0A 3KJNB 4FPBA 4P7VA 3RMAA 3G10A 4LFCK 2UP1A 4DL0C 1HBNB 4L74A 2DIUA 2VICA 2HRYA 3ILIA 2BABA 4F25A 4PKGA 1BISA 3NWGA 2MJNA 2DRDA 3CIZA 2OTLS 3FQLA 1E6YB 1SCJB 3DWLA 3TJ9A 4AM6A 3J81j 2R7SA 3DI6B 4LBIA 4FW1A 5JS2A 1F0XA 4URQU 2K3KA 3OD2A 3TR5A 4PZVA 3H6EA 2CQDA 4P2XA 1VQON 2AJ0A 5HL7L 1G3OA 3D6FB 1X31C 4X66K 1SZ2A 2BJ7A 1VQLN 2QL5B 5J2QA 2P9LA 1QSYA 2KL8A 1YJTA 2V2ZA 4IRDA 4FJIA 2WBRA 1S59A 4USVA 2OCEA 2OGUA 1A9NB 3BBBA 2MQQA 5J1EA 4I7FB 1FX4A 4RBVA 3MEKA 2CPXA 2DNOA 4J8FA 1N56A 2RJZA 5GAEI 3N28A 1RWXB 2L08A 3WEEB 1FKPB 5A2QO 3CC2S 2DVIA 4GKKF 4YFUA 3OL8A 3EKSA 1HLWA 1HR0F 1S0NA 2ZJRQ 3QESA 5A2QY 3CFOA 2BTFA 5AQYA 3AA5X 3AVGA 3GONA 4MO5A 3NBPA 5B8HA 1URNA 2C2EA 5HMYA 1DLOB 5C2CA 3U3GA 3FZMA 2BUPA 3VQ7A 2QWRA 3F9KA 4MLHA 2QA4N 2P9NB 1JX4A 3TZYA 1TL3A 3GJQB 1NWKA 4EHTA 1JLBB 4IXCA 4C8ZA 4OKKA 2UXCK 3WBZA 4RW4B 4WXOA 4ZVGA 2W2MP 3TWZA 5HLFA 4HTIA 5A8RA 4JKBA 3TVKA 3KLVA 1UJ6A 1KONA 1X5SA 3IG1A 2AYMA 2Q6CA 4DL4A 1Q7YT 3TUIC 1WUAA 3K0SA 3UKUA 2X74A 3ZZTA 5KFHA 4JYAJ 2HOEA 3OUYA 5F41A 4ED5A 2WC9A 1BO5O 1DQ8A 4PPZA 3PHEA 3KWIA 4NYZA 5KG0A 4TLRA 4ED2A 5C24B 5EY4A 3A5MC 4MDBA 3LGHA 1ATNA 2Y3YA 2JNJA 3FKBA 5FD1A 3RBEA 2F8EX 3TX0A 1CG2A 4DUTA 2A5XA 4CIGA 4Q7AA 4ZPCA 4PG7A 4LF8J 2BW2A 4OI1A 3QNOA 4DV3J 5F8GA 2ZZTA 1VBZA 4K50A 1OJ4A 1OS5A 5ETOA 5AJ3J 3G6EN 1N33F 4PWWA 1IBKK 4C6AA 1YJWS 3KNAA 5CAAA 3TAPA 3MCAB 4MK8A 1Q0NA 5JVGQ 1DTTA 4KV8A 1Y64A 2RH3A 1RWVB 2COLA 1BI4B 2WK4A 3C15A 2LQ8A 2B6AB 3GWCA 3IP0A 2Z2YB 2B4VA 5IT9Y 5HRNA 3HSJA 1NDLA 2PZSA 1AT1B 2CJBA 2JRSA 2FJBB 2RUSA 1RTDB 4YN3B 5BREA 2OPSB 2DCLA 3TNVA 3VCDA 4QPXA 3ULEB 4A61A 4AHRA 3ZT0A 5L8RC 1YBAA 4GW6A 1WC3A 4YP3A 1GX6A 1ZPVA 3RW7A 1VSLA 5E33A 4CO0A 3BO2A 1ZAVA 2Z1GA 1ZM3A 3M2VA 1T05A 5FJ4A 4WQ4A 2VPXB 2OLWA 1LNQA 2HBQB 4Q5VA 4DV0F 3H1VX 2H1YA 2MSTA 4YDXA 3CULA 1IUJA 4RO0A 2DY4A 1MMDA 1VHXA 4ZCIA 1FKOB 2YHYA 4K4ZA 3QIOA 3KMSA 3SNNA 2W42A 3AGKA 4ED6A 1LAVA 2XMWA 1NSKL 4B3SK 1JCGA 3J7AP 1HWJA 3MMBB 4Y0WA 2IVMA 3ZTRA 2CQ2A 3MMCB 1LW2B 2PAVA 2VC0A 2R2UA 3DXMB 1RWKB 5HQ8A 1VQ7N 4PKIA 5AQOA 2E5GA 4Z4IA 3UIQA 5KGXA 4FJKA 3G2XA 2RQKA 2BJDA 2VPYB 2M8DB 1GMUA 1YJ7A 2KYZA 3OVSA 2BGGA 3OTOF 4ZHRA 2Y1IA 3WC0A 3AA2A 2EVZA 3LAKA 4CECA 4C97A 4B3TJ 1IKVB 4CEAA 1Y5IB 1EO1A 4FYXB 1K8KB 5AXKA 1Y0HA 1F5CA 3PLAA 4F3QA 3QMLA 3CCSN 5H9EK 3NGTA 3RUBL 4B9TA 4H0VB 2B51A 4OX6A 3IR5B 2LU2A 2IPOB 5D0RA 1Z1ZA 4V1Ak 4AL7A 2Z2ZA 5CZ1A 4PG6A 1Q7LB 5B09A 2NNWA 3MWBA 1XNRK 2NUHA 3ENOA 1VQSA 1QE1B 3N79A 1RU1A 3U9DA 3T9ZA 1CJKB 4CI0B 3WEEA 1OVQA 2XMUA 4J7CA 2QWNA 1MWZA 2DK2A 3ZETB 3C14A 4GKJK 5HROA 5KOXA 1U1NA 4C8MA 2O8FA 3MM9B 1JB0C 4L8RB 5KFYA 2RUGA 4OLAA 2ABYA 3CCMN 2QKBA 2J76E 3K8WA 4Y0FA 1NDKA 2JZ5A 1K73O 2RVJA 1Z2LA 2VWKA 2QTWA 1NK9A 3L9ZA 1XMOF 3GIIA 1A7GE 1FEHA 3DN9A 5L1LA 1XNRJ 3UDCA 3MD3A 1S0MA 4LF5J 1KAXA 2ZD1B 3QETA 4TYBA 4DL6A 2DGUA 4CNZA 4NLVA 2FB0A 4IQMA 2DH7A 5F0WA 1NOYA 3KLEA 3MAQA 3ULDA 1HI8A 1TMJA 3ID8A 3TUPA 4KSEB 3C16B 4ECYA 5AR0A 1D8YA 1D5AA 5K9FA 3M1VA 3NWRA 5LJVA 1VQ4S 1EQMA 1QVGR 2AP1A 2JDJA 2E88A 3TQ1A 3M8SA 3A8YA 4HH1A 1SUQA 1VR6A 1VQ5S 4DUZK 5A6PA 4NYFA 2CADA 1TK8A 3O5TB 3FZHA 3CNQP 1VBYA 4BCAA 2FY1A 5E5NA 2EX3A 1VSJA 4DR2F 4IOAL 2IHR1 2E7WA 3NFAA 4DZDA 1KEKA 3NP5A 4ID1A 5BPMA 1HMVB 3MM6A 1HI0P 3K58A 4DV7K 4Q8EA 2QX0A 4URGA 1M5KC 2X1FA 4HH0A 4KR0B 2Y1RI 2MKIA 3D2EB 3QJLA 4I2QB 4CP5A 3JSMB 1REVA 4C3KA 4DU3A 4C23A 3QT8A 3VQ4A 3B4MA 4ELVA 2CPEA 2HRUA 5ADXA 4DR6J 2BM1A 1HQUB 4JKGA 2QIFA 1IWGA 1B0VA 5AJ3F 3CJBA 3JSRA 2OEKA 4NCBA 4DPOA 3MEEB 3QMQA 2XY5A 1X5TA 3LTOA 3AJ2A 1WSRA 2W40A 3PO4A 5E41A 2HHUA 2YKPA 4WP8A 3DU5A 4OL8A 2DHXA 3GJSB 1E6VB 1BWEA 4ZIVA 3DLGB 3I0SA 2PFUA 1UW4A 3QICA 2EEYA 4CESA 4N56A 3AVKA 1ILYA 4X4UA 4FJMA 2Z8QA 4DN0A 3CWJA 1WORA 2ZGZA 2ZH7A 1GLEG 4B3OB 3W5XA 1BL3A 3KK2B 3ADAC 3OYJA 1CQMA 3ZZPA 1U2RA 1WHXA 1U02A 3N5FA 2IVNA 4LSLA 3UE5A 4OYWA 2G0CA 1SC4B 2LKZA 3M8PA 2AU0A 3OYFA 2AA4A 3N01A 1NJIT 2YX6A 2B8QA 2W2QP 5GAEP 2F4VF 1WSGA 3T1HJ 2LQ9A 1EETA 4BWJA 5KFWA 3PYDA 4DR2K 1J5EJ 4F0HA 4Y1DA 3CCJS 5B0FA 2YJFA 2DPNA 1JNZB 4DQRA 2PEHA 5KFOA 1Y3JA 5SWMA 4CBUA 1PCAA 2VBXA 1U0HB 3GILA 4M63C 4MK7A 3OS2A 1NZ8A 3V2UC 1A5XA 4LF6J 2GAHC 3R97A 3AB2B 1LK7A 2YNHB 1W2IA 4FZXC 5K5MA 1RTZA 4QWBA 1HFEL 1YITN 4DR4J 3L6QA 1XN9A 4HT7A 2RILA 4A8FA 3NH1A 4CTAB 3VQBA 1K0VA 3WXMB 2VF3A 4B8CA 3QJPA 2FGCA 3DAWA 1TFYA 5H9FJ 5IT0A 3C14B 3KG1A 5GMEA 4M41A 4QW9A 3AVJA 1XI1A 4JV5F 2EG1A 3LP0A 2B4JA 2FHKA 2HHHF 1VIXA 2ZJPQ 4U7UD 1M5HA 3CJ4A 5HBMA 3MAAB 4CH0S 4F7VA 1RAJA 4KTWA 3VWSA 3D2FA 1F60B 4DTMA 4GV6A 3PIPQ 3LGNA 4Z7CA 4KQZA 1PGZA 3HVTB 2WB1D 3MCNA 2A42A 2GAGC 3R8YA 4B3RK 2HMIB 4FOIA 4HUFA 2SXLA 3IC1A 2HPUA 1UWBA 2VFRA 4JI1J 3H3OB 4E7KA 2VG5A 2IDEA 3HZEA 5JICA 2VPZB 2J0WA 4USTA 2DH9A 2Q1LA 5AXLA 2XMKA 3TUZC 3DLEB 1WKKA 4X4TA 4OI4A 3J8AA 3UR3C 5HL7Q 4WPAA 3N6MA 3FEXB 2OI2A 2AYGA 2HW3A 1WAJA 1OSCA 1R3NA 2PEBA 1RHRB 3N9UC 3PTWA 3MMBA 1VHFA 3BF4A 4DV6F 3OYNA 3PACA 1OSDA 2KHDA 2G1DA 2QI2A 3JYTA 2QWPA 3SMSA 5B0AA 3VA3A 4ILGB 3AVNA 2DRBA 2Z2MA 4B1ZA 2CNKB 2CPHA 4B17A 4ZDNA 5J2NA 4WP3A 3OYHA 3OYDA 5AQTA 9ATCB 1OKJA 5HATA 4ETXA 4Q45A 4Y3CA 3RYLA 1VQ9S 4JI2J 1X60A 1Z4UA 3MEGA 3EYZA 4BE2A 4KV8B 3RVCA 2BKPA 4GC6A 3KUGA 1IJFB 5AQJA 4I6YA 3O6WA 4Z94A 2EFOA 4FZVA 4M5HA 2XHCA 4F4KA 3OA9A 5HRRA 4DHYA 4E1NA 4AT1B 2V52B 5KFEA 2KRBA 3MDQA 3L3CA 5BR8K 1R0AB 2RRBA 1FJGF 1K1SA 1IM4A 3T1YK 4KFBA 4USHA 4EK2A 4DQSA 2CG8A 2ASLA 3UB5A 3TEGA 3CQXA 2XC9A 1W9HA 1YWXA 2R7OA 3D7SB 4YDUA 1D3WA 4DZ6A 1QVFM 4ISFA 3MX5A 3QLHA 3W2VA 3MDFA 5AQHA 1K47A 2UUBJ 3MOZA 4X66J 1TR0A 2HFZA 3TAQA 3BR9A 2CQ4A 7FD1A 3R5AA 4LF6K 1I3AA 3Q8PB 4FKXA 2Q0UA 2KRRA 5EOYA 4I9QA 2VGMA 2YKNA 1EWQA 2RKIA 1BGXT 2FQQB 4E8UA 2V8PA 1VHIA 1HNWK 5GMDA 3CJ1A 2UUCF 5BPNA 1N0UA 5I42B 2ZE2A 4FF2A 2VG6A 1NNEA 3MECB 3CYMA 3C66A 3AD8C 3SUQA 3AY0A 5BYSA 2FLOA 2NUBA 4WYBA 5JLHA 4P9SA 3D6RA 1U1OA 1LQ9A 4C0BA 1QUVA 1S6QA 4UY8O 1FK9B 3ZT2A 2HQGA 4CLFA 4OKEA 3BQ0A 2QWOA 2NRVA 2IIHA 1RT3A 3N0VA 1V4SA 1B9DA 5SZTA 5K8NA 3VEVA 1NPKA 2HG4A 4LVNP 1Q8LA 1UW9A 4NX9A 5DDPC 3OSPA 2ZVIA 1Q4RA 3OQ2A 1XC9A 3I4HX 4ZP9A 4MQ3A 1CJVA 1WDDA 2XCAA 2XTJP 2XLIA 4WQ4C 3SBTA 4KGZB 4CERA 4DS5A 5AQXA 1WBDA 2KFYA 2W7OA 1TELA 4YS2A 4A8OA 2BH1A 3PNIA 4JYAK 3O3LA 1VQKN 2ERRA 1RJJA 2MZTA 1BD6A 4B02A 3O1BA 2DNHA 4F3TA 4BC9A 1HYZA 3K59A 3W0LA 2NXJA 1XNQK 4ILRA 1EAYC 1NJIO 2ZJPL 2BBEA 2PFFB 4C8OA 3NL0A 3Q8YA 4DPUA 4CM0A 3MWPA 3IGVA 1BA0A 3Q7BA 2BV3A 1DLOA 3JSMA 3SIPB 5AXMA 3VF4A 3CC4N 2AP6A 1QS4A 4WFNL 1N5QA 2XHWA 2EK1A 3AA9A 3ILOA 3IAYA 3FZFA 1IBMF 4OJHA 2B4UA 4ZTFA 4HKQA 3BKTA 4QPTA 2QEXN 2UVUA 2LXFA 3PJWA 3SI6A 2YKOA 5M1FA 3AD7C 3FSIA 3DXSX 4I1TA 2G8KA 3MM8A 3VGUA 1R6YA 2XMJA 3V9SA 2W01A 4BVOA 3HOTA 3AVCA 1VBXA 1Q7YO 4CBXA 1JQGA 2Z1IA 1IJJA 1DTQB 3JTPA 4IZ9A 4O4GB 1YRTA 1JCFA 2W41A 3IBCB 3MM7B 1NGEA 2IM0A 3F9MA 2PGCA 2PE8A 3CJ9A 2OFHX 2OFGX 1LK5A 2BZ2A 4L6V3 2QG9B 3VMFB 4JRQA 1HBOA 2YKQA 1F2GA 4WE1A 4DR6K 2FSKA 5LXRA 4RR5A 2CH5A 4OZLA 3SCLE 1X0FA 2BE9B 4RPFA 5AQQA 3GZ7A 1N54B 5KRTA 2I7PA 4BE0A 4OYIA 3VA0A 2RHKA 4AL5A 2IM3A 3QT6A 2UXBJ 3Q86A 3QSYB 2W4CA 2I6WA 4USIA 2ZVSA 1WB9A 4FZYA 5K20B 2XO6A 4X2BA 4YOXA 1EKSA 4KPCA 1KTQA 2RQ4A 1Z6RA 1ESVA 2CQCA 1CQNA 1HWLA 2DEIA 2VIHA 3IO1A 1FXXA 1NK8A 4CD3A 2ILZA 1MROB 3GQCA 1VQNS 4LRBA 2QXLA 1S72N 4B1YB 3RU0A 1S1VA 4IJAA 2G8IA 5GADI 4F4YA 5DRKA 2KO1A 3FSYA 2IVFB 3B78A 1HHTP 3ZZ0A 3LUYA 4CEQA 4DV3K 2JLFA 1NK4A 1Q82O 3DDKA 2P9IB 4EAHD 4R0EA 2PA8D 3O4WA 2NSCA 3GV7B 1IJEB 3GYXB 2QA4G 2CZ9A 5HVGA 2KZMA 3KYLA 2BYCA 4DV0K 3I5CA 2DPJA 4JAXA 1AUSL 1X5OA 3GL1A 3KJVA 2DIVA 3QBXA 2Q6BA 3SMZA 3OYMA 3OBIA 3SXLA 3ULHA 2MHEA 1RWUA 1FRLA 1U2CA 2DYAA 3I4PA 4BRNA 3VAIA 4AM7A 1EKEA 5THWA 5IWAK 4BR0A 2HNZA 4IH6A 5D6GA 2YNGB 4LUBA 2B7BB 1FVSA 1X4AA 2IYGA 1B0TA 1YVNA 4NLGA 1L3SA 4JI4K 1KC8O 5C42B 4YB1P 2E1RA 3SSRA 4B3TK 4IDHA 4PL8A 2FHJA 5EGYA 1VSHA 3P5JA 2JEJA 2OYQA 3HDSA 4K2XA 5M2RA 2R7WA 1ZC6A 2W2PP 3J7YP 4EI2A 5KFSA 4DTXA 4OX8A 3GV5B 4AQYJ 4DSJA 4DR5K 2K06A 3NCRA 3VTIA 1SJFA 4K8XA 3QRRA 5JLFA 3EWGA 2CNNB 3DMJA 2HGMA 2XMMA 2JWLA 2GGPB 4ELUA 3UCGA 4LSNB 3D2WA 4KAZA 1H6KX 3HHKA 4CLSA 3THXA 4IKFA 3BGOP 3CMAN 4ZLPA 1KVBA 4ZIWA 2KYXA 2O01C 4MYUA 1GOBA 5KT3A 1IM6A 2A1SA 4DUZJ 2YXLA 4DFJA 3KK1B 1WTFA 5DDRC 2MLZA 4ZVEA 3P4UB 3TANA 1ICEB 3JS6A 4AHCA 3BBFA 1TQLA 1RBUA 3R9PA 1FXLA 4BRKA 1HKCA 3OW2R 3VETA 1U26A 1L3VA 1NU0A 4I4BA 4M5IA 1FD8A 4F0KA 3B54A 3MN9A 4H4MB 1ZZNA 4KRFA 1NXIA 4E89A 1WC1A 4TLQA 4X62J 5B0GA 3C6UA 3TAMB 2ADCA 3QEPA 2MKYA 4KH6A 3CCUN 1RGIA 4H03B 5KAKA 3HP9A 4TY9A 5HSPA 1R8HA 3O3GA 4KIAA 2AW0A 1TZ0A 4BY9C 2BQRA 1QZ6A 1U49A 3HXMA 3MAAA 4O0IA 3QYYA 3W2WA 2HNDA 5CD4A 3TA2A 4W5TA 4PXDA 1IN0A 2KJVA 2ZDOA 1YDLA 3JQKA 2BE2B 3F5TA 2HS4A 5KG4A 5IT4A 1C6VA 2DO4A 3FGVA 2ZBQA 2MXYA 2X1BA 4RNFA 2XGPA 2W9BB 2GELA 4DR3J 2HWTA 1NB2A 5B0BA 1MWKA 3AFGA 5AT1B 1MWQA 2CFXA 3QEWA 1WLJA 5AQIA 1HLUA 2F3JA 2MGZA 4GMKA 3M2RB 3IG1B 3RMBA 4QS9A 1M1KT 5C2FA 3UN5A 2PT0A 4UTGA 4ZJOA 4LREA 2ZNYA 4K59A 2B0GA 4EO6A 1UA1A 4XH5A 1WACA 3BZCA 3IR6B 2FVCA 2RDDA 2A6AA 4DV1J 2F9DA 1DAXA 2KXFA 1WHYA 8RUCA 4M5DA 3EUNA 4E19A 4F36A 3KLHA 3NGYA 4XAKA 2CJYB 1KVIA 1HQUA 3F2KA 1JXVA 3U9ZA 2HK3A 5C5JA 1BIZA 1S7IA 1RDCA 2OTLN 3DDIA 3MAHA 3VQQA 3BBCA 3VHQA 3H7HB 3P96A 4YR2A 1HNWJ 4QQBA 1JLCA 2ZH3A 1RABB 4YB6A 1QHAA 3ZZYA 3NF6A 4BVPA 5B0CA 3B6PA 1F3VA 5LMUK 2Z30B 1B7YB 3PRDA 3G4SS 4NXNK 5H9FK 3PRVA 3SSQA 1V4TA 4K41A 4GKKJ 3D3CJ 4NYOA 3BDEA 5CHIA 4CJLA 3LANA 3HCXA 5ITHA 3D68A 2P9NA 4DR5J 5M1QA 5D0GA 4CJRA 1BA1A 3FLCO 2YX7A 1O1WA 2KH9A 2YNFB 1VSIA 2G2YA 2MMYA 4CNYA 5HMZA 4B9QA 1VQMS 2XBPA 4JK9A 3V6JA 3EDRB 4JI5K 4RCHA 2F4VK 4FWLA 1U8WA 1X9JA 5J2MA 4QR2A 2XHBA 4ANEA 3CB4A 1I3OB 1A5VA 4ECQA 2QWQA 4HI2A 4HTLA 5IT9O 1JLGA 1JK9B 2O8CA 4YNQA 3L2RA 4GKJF 2JC1A 2J7UA 2L48A 2XZTB 2WONB 5AQWA 3M2UA 2ASOA 2CA9A 5AQUA 1QUPA 3PDNA 1NG9A 2KXHA 3WNGA 2VONA 3GIRA 5J2MB 1RKIA 1UMJA 2HURA 4CZKA 5CYJA 3I8BA 2ZE2B 5L38A 3KUHA 4RW7B 3BSCA 1VGYA 1SUQB 2QRRA 1Y4ZB 3JQJA 3D1HA 4KGKA 4LT6A 1GX5A 4ED8A 1EIYB 3OFEA 3SQ4A 1J5EK 3MPWA 5KT6A 2UVRA 4JI0J 2E1YA 4X4VA 4CWBA 1S1WB 2HYIB 2ADBA 3R3LA 2HHHK 3BREA 3DI6A 2CWXA 4FJXA 5K8PA 4RLEA 3CQYA 3DRPB 4BRPA 1ZA1B 2U1AA 2E66A 5FPMA 1QTNB 3DRXA 3K57A 1N48A 3C6TA 3SAHA 4IJNA 3ZSWA 4FLVA 1TL1B 3QO9B 3V1QA 1S6QB 3C94A 3ZO7A 4J9OA 3DXKB 3V4MA 4CIOA 3VAFA 3HHDA 3VEOA 3WNHA 4KBOA 4J2DA 2UUBK 3VF2A 2HK2A 3TZZA 4EZ6A 3US5A 3CCTA 4JI1K 3FEYB 2IMOA 4ECTA 5ETPA 3ISNC 1Q8KA 4RUAA 4QWCA 3B8AX 3VGTA 5I42A 3D3BJ 4DF4A 4X4NA 1S1TB 3B6OA 1LAWA 3TI0A 2I7NA 5KG6A 4N76A 1RP5A 4AE5A 1NSPA 2NZTA 1U1MA 2CVEA 4PXEA 1IKYA 2NRWA 1SB6A 4E7JA 2HS3A 2Z4PA 4CZCA 2JEFA 4LQ3A 4JI8F 5EX5A 3M4XA 3CVKA 3VTHA 1RTJB 1DQAA 2NYHA 3RB3A 4CH1A 2AJ2A 5AQMA 4ZTJA 1OWXA 4PKHA 1VK3A 4G65A 3K5MA 2AD9A 1Q86O 2V5HG 3SJHA 2P9GA 3S3OA 4DV2F 4JKFA 3A3NB 4WKRA 4ZPTR 4FF1A 5EXWA 2F63A 2W8KA 2P9PA 3BF1A 3L4BC 2BA9A 5L39A 4M3XA 2UZAA