5CYQA

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
548
structure length
548
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 154
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cyqA05
2KFZA 5CYQB 1LWCA 2ATLA 4CGGA 2B43A 2D0BA 3MXJA 1X1PA 3PUFA 2QKKA 1REVA 4NCGB 3I0SB 2IM0A 2UVRA 2X6NA 4JLHA 5D3GB 4YFUA 4CJTA 3KKSA 3SYZA 1U09A 2JC0A 2J6UA 5KFJA 3HXMA 4DSEA 3I8DA 1JXBA 2RDIA 3QYYA 2W7OA 5KFSA 4CEAA 1IKWA 3P83D 2AX0A 3GV5B 4Q8FA 2HHUA 1XHZA 2RKIA 4FK4A 4FXDA 5DQHA 1C1CB 1U48A 4M95A 5KI6A 5JUMA 1JLFB 4JUZA 3V6DB 4CK3A 1YT3A 4Z4FA 3NF7A 1NJYA 2E9RX 4RG8A 4M42A 3DMJB 2GC8A 2R8KA 1UWBA 4CJ4A 1YTUA 1GX5A 5KFLA 3N6MA 4ECUA 3TAFA 1HNVA 3TR8A 2HHXA 4QPXA 3AV9A 1VSEA 4BDYA 4ZPAA 1SKWA 4ELTA 4JS5A 1C0TA 2ILZA 1RBTA 1BQNA 1RDBA 4ED1A 1RTIA 2VA3A 4MK9A 4RNNA 3BSAA 3G6YA 3TABA 2A1RA 4ECZA 4CJQA 4KTWA 2WTFA 1NJWA 1T05B 3ZCMA 3VN5A 3CYMA 2OH2A 2RDJA 3ASMA 1XR7A 4K4ZA 2E6LA 4Y3CA 3NE6A 1C1BB 4DTOA 4JV1A 2V4RA 3GV7B 2OPQB 2R8GA 2YNHA 4AHUA 2BQUA 3AVFA 3TAMA 1Z25A 2B4JA 5DQGA 3IS9A 4W5OA 4IRKA 3PW7A 4NLWA 3NFAA 4EP5A 1RDRA 4CF9A 3PO4A 3EPGA 3DRSB 1UA1A 4QWBA 1XI1A 1T8EA 4I9QA 1C2PA 1ZETA 2B6AA 3V9UA 1HMVB 5EWGA 4NLGA 1NOYA 4DMNA 4CJLA 1JLBA 1O1WA 2D0CA 1FXXA 4LQ9A 1W25A 4F4WA 4QWEA 3V1RA 3M8RA 4CJVA 5HBMB 4CEBA 3G10A 1RT7A 3DLRA 4FJ9A 4RNOA 4IRCA 3H4DA 4HCCA 3OHBA 3WNEA 5J1EA 3KLEB 3BSCA 4CEEA 1WAFA 2D3ZA 3MXIA 4M3ZA 5C42A 3UR0A 1W0HA 1BI4B 3HVRA 4ED6A 3PW4A 3DRRB 1T03A 4KKOA 3KLFB 4MH8A 1G15A 4E3SA 5DG8A 2IM1A 4KFBB 1J5OA 4KBIA 1U49A 4BDZA 4O3RA 4J9KA 1B92A 4PUOA 3IAYA 2OZMA 2W9BA 5J2PB 5FDLA 1TL3A 5I42A 3CJ0A 4I2PA 3MEGB 2OPRB 4I7FA 1S6PA 4ECYA 3N6NA 4NYNA 1Q9XA 1N5YB 4O3PA 3MR2A 1RT1B 4XPEA 5KFZA 4DQPA 1KTQA 5F9LA 3MF5A 5EU7A 1EP4A 4MKBA 1FKOA 4J2BA 1SL2A 4IR9A 1BGXT 4CEOA 2BRKA 2IC3A 3MFHA 3EYZA 4F3TA 1RT5B 4NLRA 4O44A 4JV0A 5KG6A 3AVGA 5KFKA 1XC9A 5HP1A 1S1WA 1QSSA 1VSFA 2IBKA 5KFNA 3RB0A 3UIQA 4NYFA 3QESA 2W9CB 3I5BA 3K5MA 2ALZA 3PY8A 4FLXA 1L3TA 4ZVEA 3M9NB 2W9AA 2FVSA 2HMIA 3ZSVA 1DTTA 4DF8A 3NF8A 4KPYA 4W5RA 2KZMA 5DLFA 2P51A 4FVMA 2GUIA 5FRNA 3OYMA 3L2VA 1RBUA 5CZ1A 2VG5B 3UQSA 1NK0A 2GV9A 3OYDA 4RW6A 2IA6A 1JXLA 3LWLA 3RBDA 1RCHA 3L8BA 3PR4A 1BHLA 3RMCA 1QSLA 1WLJA 3BSOA 1TV6B 4K4WA 4I2QA 4LD0A 1RDAA 3K59A 2HWIA 5KT4A 3V4IB 3KK1A 1NHVA 2XC9A 4FJNA 4DSIA 1JLGB 3CQ8A 1BQMB 3EY1A 5HRRA 4CE9A 1UOCA 4TN2A 4MFBB 3IN5A 1JL2A 4TYBA 3MTKA 2I5JA 4KB7A 2XGQA 1YTAA 5KFEA 2HNZB 1D1UA 1EKEA 1HQUA 4CFCA 4KSEB 4CJPA 4GC7A 1NKBA 4NCBA 4Q44A 5KT3A 1WSFA 3CFOA 1RA6A 5KFCA 3FFIB 3FQKA 2YKMA 1RT2A 3N6LA 1XWLA 2FC0A 2R2RA 2JEGA 3IG1A 3OL7A 2RN2A 3OYKA 3QZ8A 1D9DA 3KLIA 4KI6A 3MECB 3TQ1A 4O4GA 3AO1A 3LAKA 4YR0A 5KFTA 3OYEA 4FCYA 4FLTA 4KHUA 2J6SA 4GVMA 3SFGA 2OPSA 2F96A 3CFRA 1TKTA 5KFMA 3C6TB 3AVNA 2ITGA 1OS5A 4WZMA 1N6QB 1NK6A 5KT6A 4JV2A 4DLEA 4E1NA 4BWJA 4O3SA 1JLQA 2WOMB 4H4MA 2WB4A 5K14B 1VSLA 2W8KA 1D5AA 4IKFA 3KKRA 2JEFA 1JXEA 4WFYA 4FJ7A 2RPIA 4Q8EA 1QAJA 2G8HA 3ZSOA 4DL4A 3NGZA 4CHZA 1IG9A 3K58A 3SJJA 1KRPA 4OLAA 2R2SA 1UAXA 3WNFA 3ISND 4OKKA 4QWCA 1GOCA 3NCIA 1RT3B 1ZTTA 1JLAB 2UUTA 4ZPCA 3I0RA 3OYHA 3CJ3A 3NBPB 1KSPA 3QIPA 2DFEA 4ZHRA 2R8IA 5EWFA 3KJVA 4HHTA 4TY8B 1DTQB 2G8FA 4M3UA 1RTHA 3QEVA 2IAJB 4KHNA 1HQEA 4WYLA 4N41A 2XCPA 2HVHA 4CF8A 3VQ5A 4RW7A 2CJQA 2V9WA 4GW6A 1ASVA 3UDLA 4TQRA 3E51A 1NK9A 3LP0A 4DSKA 1HYSB 4U7CA 3VQQA 4FJLA 3CM5A 4ZMMA 2JC1A 4CGHA 4KB1A 3WNHA 2E9TA 1RT4B 1SV5B 3RB4A 2YHAA 2AJQA 4Y2CA 4WYWA 3G6XA 4K4TA 1TGOA 2HWHA 1TL1B 4XIUA 2FVCA 3NKYA 2FVPA 4WZQA 5KGXA 3GYNA 3MR3A 4ECTA 3AVHA 3LANA 1YVFA 3OJSA 4EP4A 5DGAA 1S0MA 3QERA 3V81B 1VRUA 4U6PA 4BDPA 2OPPB 4BACA 3CFPA 4HKQA 1S48A 1VRTA 3KLHB 5JXSA 4RW8B 3AO4A 4J2EA 1S1UB 3M8PA 2B5JB 2HNDB 4OJRA 1LW2A 3VQ8A 3G6VA 1QAIA 4DQRA 1Z4UA 4J9RA 2FJXA 3SQ0A 1WSHA 3HK2A 1S9GB 5I3UA 3K57A 1HYSA 3QZ7A 1NNDA 3VQ4A 2Z1IA 3RRHA 1D8YA 2FJVA 3D0PA 4K50A 3Q8QB 3GILA 4ECVA 5J2NB 1S9FA 3DLKB 3JSMA 3NGYA 4DSFA 3SQ1A 3Q8RB 2XO7A 1RDCA 1LW0A 2YKNB 4HUEA 4ECSA 4Y2AA 1NKEA 1U45A 1SKRA 2JGUA 2CKWA 2G8WA 4DFMA 4QW8A 1LWCB 4EEYA 1TQLA 3OYIA 1REVB 4C8OA 1RDDA 3FDSA 3LWMA 4RW8A 4B08A 4FBUA 1GOAA 4Z4HA 4B9UA 4CK2A 1TVRA 1B9DA 5KFAA 4B3OA 5F8IA 3OS2A 4K4SA 2IJFA 1K1QA 4LSNA 2IGIA 4PWDA 3VQ7A 2FBYA 1IKWB 3QEWA 4EZ6A 3RR7A 2RKIB 4DU3A 4IH5A 4E1MA 4IG0A 5C25A 3AO2A 1S1XA 3DLBA 3KTQA 4NLXA 4Z0UA 4M45A 5DMRA 4DTSA 4QCLA 3BJYA 1RBVA 1UWBB 2OYQA 4YP3A 3ULDA 3RR8A 4LQ3A 3E01A 3PX0A 3PJXA 1T7PA 1HNVB 1IH7A 4NLVA 4F2RA 4Z4GA 4C8MA 1C0TB 3MFIA 2WK4A 1NK8A 3SNNA 3H98A 4Q0BA 1B9FA 1BQNB 2AGOA 4N5SA 4ZPBA 1RTIB 1C0MA 3H4BA 4TQSA 3VQDA 3KHHA 2QE5A 5DLGA 2ZE2A 1S4FA 4FJHA 3NGDA 3OYGA 2D7SA 3O3FA 5KT5A 3OS1A 3HM9A 4G1QA 4B9TA 4FJGA 4J9NA 4ZP8A 3H5SA 4TXSA 4DTPA 3G0ZA 2Q3SA 2YNHB 1LV5A 4J2DA 1S1TA 3TAMB 3ZSRA 3IS9B 5J2QB 4FK2A 4J9PA 4MIBA 4FJ5A 1S97A 1RNHA 3WNGA 4AHSA 3AO5A 4K4UA 1U4BA 3K2PA 3S3NA 3DOLA 2B6AB 1EETA 4CF2A 1SH2A 4B8CA 1ZTWA 4URGA 1JLBB 3LP1B 3L2WA 3JYTA 3TAQA 2GIQA 4C8NA 3V1OA 5KRTA 5KFHA 4FW1A 1RT7B 1VSDA 3D45A 4E7LA 4RU9A 3O3HA 3ZSZA 2VA2A 3H40A 1FKPA 5J1EB 4CIEA 3CIZA 1JLCA 3AVAA 4EBDA 3PVXA 1NJXA 5C42B 3S3MA 2D5RA 4WXWA 4M3RA 1ASWA 3MEEA 4KKOB 1T03B 1JLEA 4MIAA 5F8MA 2D3UA 5J2QA 1J5OB 4QAGA 4KI4A 4CJUA 4PUOB 3LZIA 3RWUA 2W9BB 3DLGA 5FDLB 4CFBA 4KTQA 1TL3B 2ZD1A 5I42B 2BE2A 4I2PB 4I7FB 1S6PB 5L1IA 1LWEA 3SZ2A 4E7IA 4KB0A 3KIOA 3UPFA 2NUBA 3T5KA 2G8UA 2P1JA 3CJ2A 3NF9A 2XHBA 3LP1A 1EP4B 4JRQA 4DL2A 1Q9YA 1FKOB 3CG7A 4IBNA 3MEDA 3PX4A 5EDWA 2IC3B 1S10A 4O44B 5KG4A 5HROA 4M94A 5HP1B 1S1WB 3HPGA 2HHVA 3BR9A 5KFRA 4RUAA 2Z1JA 2FLNA 3HO1A 1N48A 2R8HA 3Q8SB 4ED7A 2HMIB 1DTTB 4DLGA 4N76A 2R2UA 4R5PA 3LALA 3QNOA 3QLHA 1VSIA 2IS3A 4J9MA 1EX4A 4FW2A 4B8AB 2Z1GA 3ICLA 4RW6B 4PY5A 1TKZA 2BANA 5KG3A 3FQLA 3OYNA 4DFKA 5F8LA 3B6PA 1D0EA 1QSYA 4I2QB 5DQIA 4OLBA 4NLDA 4RUCA 4RNHA 1N56A 2Y1IA 4FJXA 4NLQA 1R0AA 4IQXA 3KK1B 4CJSA 1JL1A 4W5NA 4ECQA 2QK9A 4DSLA 3NH0A 2BRLA 2XWYA 2I5JB 2R8JA 3LP3A 4J9SA 3AA4A 5JS2A 1KHWA 4QW9A 3RB3A 5J2MA 2X74A 1HQUB 2X78A 3VQ9A 3NDKA 3CVKA 4HVJA 4Z4CA 5KGWA 2RF2A 2UVWA 4CFDA 2YKMB 3SV3A 1RT2B 4FLZA 1IKYA 4M3TA 2FLPA 3IG1B 2HAIA 5L1KA 3KLIB 2XY7A 1KVBA 1TAQA 4Y1DA 2IM3A 4IFVA 4O4GB 3QETA 3SUQA 3PJWA 3DRPA 3MR6A 2OPSB 4K8ZA 1MU2A 3PW2A 1TKTB 2WHOA 2KZZA 2FBXA 2HB5A 4DG1A 1BCMA 3GQCA 3FRZA 2YNFA 2WONA 3D5MA 3NH2A 3CDEA 2A1SA 3V1QA 1JLQB 4NLSA 5T14A 1L3UA 4H4MB 4OPKA 1CSJA 3CM6A 5KFQA 1ZYQA 1RT6A 1KCFA 1WAJA 4LH4A 1SH3A 2KQ2A 4NLTA 4FYDA 2Z1HA 1CZBA 1C6VA 4FJKA 1X9SA 2AGQA 5KTQA 5KFUA 1BCOA 3I0RB 3KK3A 1JKHA 2ILYA 3C6UA 5L1JA 3AA3A 4CHYA 4CGIA 3QIPB 3KMSA 5CYMA 5L1LA 3VQCA 4W5QA 4IFYA 4DQSA 3MXMA 1RA7A 4ZHRB 3KJVB 1TKXA 1RTHB 1HQEB 3QEPA 3TANA 1WSEA 4DFPA 5KFGA 3NAHA 4K4VA 4RW7B 1CXUA 1GX6A 4KRFA 3OSNA 1KHVA 1NJZA 4ID5A 3RAXA 2BQ3A 3LP0B 4IH6A 4NLOA 1IO2A 1ZBUA 5KFBA 1NK5A 4KREA 1IKVA 3SUNA 4KHRA 3L2QA 1QTMA 3OLAA 4IH7A 4XO0A 3QGGA 2W7PA 1BISA 1RBRA 4B9LA 1C0UA 4KHYA 5C5JA 4DTXA 4KO0A 3ZT1A 2P5OA 1WSGA 3BQ1A 3KLVA 3QO9A 2YHBA 4WXOA 1TK0A 4DU4A 1J53A 4CJKA 1VRUB 4X2BA 3NMAA 2UVUA 1A5XA 1VRTB 5KG2A 3M8PB 3IRXA 3P5JA 1JIHA 4RW9A 2R2TA 1LW2B 3ZT3A 4JS4A 3CJ4A 1I6JA 3L3VA 4ECWA 4ICLA 4DTJA 2YNGA 5I3UB 2W42A 2ATQA 4ELVA 3OYJA 3RBEA 3P1GA 4OGCA 1KLMA 3PZPA 4CCHA 1J9AA 1N4LA 1T94A 5KFOA 2XY6A 2AWZA 3DI6A 2O5DA 3JSMB 3DYAA 3SUOA 3HL8A 2KFNA 1LW0B 4ED0A 4IR1A 3KK2A 1KFDA 3HPOA 1ASUA 3SPZA 4E7KA 4ECRA 2PYLA 4CIFA 4K8XA 1EXQA 3TAPA 2XI2A 4O55A 2FLLA 4J9LA 4O3OA 4F3OA 3VQEA 1SUQA 4AHVA 1MMLA 1XR5A 2C2DA 2GBZA 3LP2A 4J9OA 1TVRB 4B3OB 1A5VA 2IOCA 1TKDA 2VG6A 4QWAA 4DF4A 3H5XA 4LSNB 1S1VA 1K1SA 1YVUA 4PWDB 4F50A 3SCXA 3HVTA 2C2EA 5HLFA 4O0IA 3BDPA 4DTUA 3OL8A 4YQWA 2QXFA 4IG0B 3U3YA 2ASJA 5C25B 4Z4IA 2VG7A 4LSLA 3SFUA 3SPYA 1S1XB 3LPUA 2DPJA 3H5YA 1QE1A 3M9MB 4J2AA 4WE1A 2XI3A 3V9ZA 3S3OA 4TY9A 2XRIA 3ZT2A 3E01B 3C95A 4KHQA 4YR2A 1VSMA 1RTDA 3KLGA 4EZ9A 2E6MA 4Q43A 2ZKUA 2ETJA 3TVKA 4CESA 2R7YA 4YMEA 1ZBLA 1UA0A 4CGFA 3OLBA 4PQUA 4Q0BB 3ISNC 3BGRA 4F4YA 3M8QA 3PHEA 4R8UA 2HHWA 3O3GA 3LDSA 3T5JA 1IKXA 3NGIA 4FJMA 3BREA 2ZE2B 1DLOA 5FROA 2FVRA 1XHXA 1QQCA 2HNYA 3Q8PB 3AVLA 4G1QB 4CFAA 1L3VA 3RMBA 1U04A 4Q45A 2O4IA 1S1TB 1HNIA 1T3NA 4B9MA 3NAIA 4AHCA 3THVA 2HW3A 4BE2A 3ZT0A 3VQAA 5HRPA 5L9XA 1WNEA 2YV0X 1HPZA 3MR5A 4RNMA 4IOBA 3QEIA 3DOLB 3SQ4A 1EETB 4E19A 2FVQA 2YNIA 1RBSA 2ASLA 3OYFA 4L8RB 1NK4A 2DFFA 3BSNA 3IGNA 3JYTB 2GIRA 3AVBA 3DDKA 4KV8A 2D41A 3DM2A 2OA8A 3F9KA 3H2LA 3GIIA 3ALYA 1RTJA 4FZXC 1QUVA 3M9OB 3RTVA 3T19A 3V9XA 1FKPB 5C24A 4DL6A 4RW4A 2O4GA 4KHSA 2G8IA 3DLEA 3KD1E 4DTRA 1JLCB 4B9NA 3DOKA 4IG3A 2ASDA 4OKJA 3MEEB 4YR3A 4FBTA 4C8LA 1JLEB 2C22A 2E9ZA 5F8JA 4ED2A 1S0OA 1U47A 3GIKA 5F8NA 3OVNA 1HYVA 3TAEA 4CJRA 3QGHA 3DLGB 4M41A 1SH0A 1VSKA 2ZD1B 3SV4A 2BE2B 1LWEB 3V6JA 4QWDA 4DWIA 1S9EA 3C94A 4Z4EA 5HRNA 1S6QA 1VSHA 5KFIA 4DS4A 4F2SA 3CO9A 3RRGA 3V6HA 3ITHA 3MEDB 1QS4A 4CEZA 2WCXA 2V0NA 4FS2A 2Y1JA 5CYQA 3I5AA 3ZSXA 3OL6A 5KG7A 2BGGA 4DL7A 3OYAA 3VQ6A 5HROB 2BR0A 4NCGA 3I0SA 5KFWA 1HYZA 5D3GA 4ZTJA 5DK5A 3EZ5A 3HHKA 3PW5A 3MAQA 1ZBHA 2WRMA 4CF1A 4R5PB 4E7JA 2F8TA 5DG9A 3QLHB 3AVCA 3D28A 2IDOA 3VA3A 1Z26A 1C1CA 3AVIA 1TKZB 4NLYA 2BANB 5F8HA 2J6TA 3RAQA 1J54A 1KVAA 1JLFA 1LAWA 3V6DA 3IGVA 4HTUA 4FZZA 3EZUA 4KHMA 3DMJA 4EO8A 4CGDA 2F8EX 3QINA 1SKSA 1ZBIA 3BQ2A 1R0AB 4M3YA 1F21A 2C28A 1TK5A 2IJNA 3TI0A 5KT7A 3NH1A 4FLVA 4ED3A 3NAEA 4H54A 3OSPA 4ELUA 1VSJA 2XCAA 5J2MB 5EWEA 2XY5A 4M3XA 1T05A 4CEQA 3NL0A 4CHOA 1BL3A 2RF2B 2DFHA 5SWMA 1TP7A 1IKYB 1C1BA 2QV6A 2OPQA 1Y97A 4EYIB 4IFVB 4HCBA 5JS1A 5KFFA 3HKWA 4CHQA 1S5JA 5DG7A 3DRPB 4TLRA 4EBCA 3I5CA 4FLUA 1W9HA 4DTNA 1MU2B 4DTMA 4PA1A 2OZSA 2HVIA 4DG1B 4OKEA 2F8SA 1WSIA 3SQ2A 2YNFB 4O5BA 3DRSA 2WONB 3T5HA 3NF6A 5SZTA 4JRPA 3OS0A 1HMVA 1FK9B 1CZ9A 3AVJA 3SUPA 4OL8A 2AX1A 2BQRA 1RT6B 2I1RA 4DQQA 4NRUA 5HBMA 4J9QA 1D9FA 2IMWP 1RILA 2PY5A 4I9LA 4E89A 2LSNA 4YNQA 1TK8A 1LWFB 4NCAA 3M8SA 3KLEA 3HT3A 1NOZA 3KK3B 1JKHB 4G3IA 3KHLA 3K5NA 3NHGA 3C6UB 4N56A 4O4RA 4ED8A 5CYMB 1RYSA 1BI4A 4IFYB 3F73A 2UVVA 3SI8A 3DRRA 4EYHB 4RZRA 4CJWA 3KLFA 2DTUA 2FBTA 1TKXB 4KFBA 1A5WA 5FRMA 5DGBA 1BIZA 4CEDA 5E41A 5CY4A 3PR5B 4HUFA 5KFYA 1I39A 4ZP6A 5J2PA 3OYCA 3MEGA 2OPRA 4ID5B 2JEJA 1N5YA 1FK9A 4W5TA 4DL5A 2QKBA 3OHAA 1RT1A 4FK0A 4CJ3A 2FJWA 1QHTA 1IKVB 4Y1CA 4OPJA 4DU1A 4O0JA 5EUHA 4CJ5A 3KD5E 1JX4A 2VWKA 2BDPA 1WSJA 5KFXA 5KFDA 2G8KA 1RT5A 3HYFA 1C0UB 1LWFA 3H5UA 4DFJA 3AA2A 3V9WA 4KO0B 4RNFA 3KOAA 3QO9B 3ZSYA 2W8LA 1HARA 2AGPA 2W9CA 3QIOA 3KHGA 4ZPDA 3L3UA 4ZTFA 4DL3A 3A2FA 5CZ2A 5T7BA 3H08A 4K4YA 4CJEA 3K5OA 3IRXB 2PZSA 2VG5A 1X9MA 1L3SA 4RW9B 4CHNA 5F9NA 4AHTA 4HYKA 4OVLA 5KFPA 1S49A 4ICLB 3K5LA 4CK1A 2YNGB 4Q5VA 4KTZA 4F8RA 2HHSA 2KW4A 3HP6A 2V4QA 1RAJA 3CDUA 4FM0A 3KMQA 2HHTA 1KLMB 4AH9A 1TV6A 4TYAA 1KLNA 3AVMA 1GOBA 4TSXA 3DI6B 2P5GA 3L2RA 3V4IA 3TWHA 3DYAB 3PO5A 2E4LA 3LPTA 4EO6A 1JLGA 1BQMA 4F4KA 4FS1A 3H59A 3KK2B 4FZYA 3T3FA 3CDWA 1CLQA 4KAZA 1TAUA 4MFBA 4BWMA 3U6FA 4IKAA 1RYRA 4H4OB 2DY4A 3SI6A 4LY7A 4FLWA 2HNZA 1S0NA 4IDKB 1SUQB 3OY9A 4CHPA 4ZVHA 1HRHA 3PV8A 1WNSA 3LP2B 5HRSA 3V9SA 3FFIA 2EHGA 2VG6B 2ZQBA 2D0AA 1S1VB 4BE0A 3HJFA 3G86A 4NLUA 3MECA 3AVKA 3HVTB 2X6SA 2JLEA 3OJUA 4CEFA 1NKCA 5KG5A 5HLFB 3VQSA 3AO3A 3LAMA 4CERA 4Y34A 3HPHA 3C6TA 1SL0A 3ZT4A 3RB6A 1I3AA 3HSTB 1N6QA 3DLHA 4E0DA 3QEXA 4URSA 2VG7B 4LSLB 3O4QA 4R0EA 5KT2A 4FJJA 3V6KA 1QE1B 2AQ4A 3HVAA 2WOMA 4WE1B 5K14A 3QIDA 3T5LA 1X9WA 1ITGA 4URQU 3PX6A 4FM1A 4H4OA 4WFZA 3GIJA 4CECA 1WN7A 4UQGA 2IM2A 1RTDB 3KLGB 5KRSA 3OYBA 4ECXA 1Q8IA 3AA5X 4IDKA 4O3NA 4ZVFA 1HJRA 4B9VA 1XR6A 3KHRA 1RT3A 1JLAA 4PQUB 3TARA 4M3WA 4NLPA 3BGRB 3M8QB 3NBPA 2AU0A 4R8UB 3VA0A 4HUGA 4FJIA 1IKXB 3FSIA 4ID1A 4CIGA 1DLOB 3CWJA 4KAIA 2FBVA 3ZSQA 3QGIA 2KTQA 3U3GA 1NK7A 2HNYB 4TY8A 1DTQA 2IAJA 3O4NA 2DPIA 3B6OA 1L5UA 4ZP7A 4CF0A 1HNIB 3QNNA 4ZP9A 4FLYA 3VQPA 3CJ5A 1BIUA 4LH5A 1SL1A 3OL9A 4ZVGA 1HPZB 1KVCA 1RT4A 1SV5A 4FJ8A 1CXQA 2VWJA 3VQBA 4NRTA 4CGJA 2YNIB 3ZSWA 3RMAA 1TL1A 2EC0A 4MK7A 3PW0A 4F4XA 4MQ3A 4FM2A 4KV8B 4MK8A 3DM2B 2XY8A 3HVWA 4IRDA 4OGEA 2UUWA 1ZBFA 1RTJB 4CJFA 4O3QA 3BQ0A 5KFVA 3RMDA 1NHUA 5KG1A 4NYZA 4AHRA 3V81A 1VK0A 2EX3A 3L2UA 1KFSA 5C24B 2C2RA 2HHQA 4RW4B 2OPPA 3DLEB 3KLHA 3T1AA 4BE1A 3GIMA 1S1UA 4E7HA 1IM4A 3DOKB 4IG3B 2B5JA 2HNDA 2XGPA 4DEZA 3S9HA 4AILC 3HP9A 2G8VA 5F8GA 2JEIA 4KE5A 4H8KA 1C1AA 1K6YA 2PYJA 1S9GA 3OYLA 3KNAA 4WFXA 4B9SA 4EBEA 4N47A 4K4XA 4XPCA 5KG0A 3EPIA 4KHWA 4GC6A 4DQIA 5J2NA 3LZJA 4NZ0A 1S9EB 3DLKA 4F4ZA 1S6QB 4MKAA 4DSJA 3TAGA 4DS5A 4GMJB 3GV8B 1LAVA 2YKNA 4QOZB 4C8KA 3ITHB
chains in the Genus database with same CATH superfamily
2KFZA 1VHFA 4PG8A 3O9SA 4QIWD 1EX8A 2ACYA 4CZMA 2D0BA 1X1PA 2HBMA 4NCGB 1N36J 2QT7A 3ZZ0A 1WG5A 1ATSA 1CQNA 1AA1B 5JLHA 3MMBA 1R0BG 3FBBA 5LL6Z 1U09A 2ZWOA 3HXMA 3I8DA 2JFKA 2VPZB 2RDIA 3QYYA 4DR4F 4IO1A 5KFSA 4CEAA 1BE4A 2MTLA 3HKZD 4OHXA 2RS2A 3PYDA 4JEPA 2HHUA 4JHDA 4FK4A 2PA3A 3OW2M 3Q0AA 2O3DA 1DQ9A 5CQGA 5JUMA 5GMDA 5F0UA 2J0QD 2RH3A 3ZZYA 1YT3A 2PA8D 2E9RX 4M42A 3DMJB 4CJ4A 1GX5A 3TA2A 5KFLA 3GJQB 1HNVA 2ROGA 1G4CA 4JYAJ 2HGLA 3VENA 4BDYA 1C0TA 3MR7A 3TO8A 2V7ZA 4UOHA 1RBTA 3EVOA 4NX9A 2ZJQQ 3K5PA 5DM7L 4ED1A 4NPOA 1NXIA 1OH7A 2WSEC 2FHKA 2A1RA 2WTUA 4OZ1A 4FKXA 1T05B 4L3KA 3ZCMA 3RJMB 4A8XA 3VTHA 3CYMA 3VHQA 2E6LA 3UN5A 2NXCA 2QEXS 4FO0A 3NE6A 3W3SA 2V4RA 2YNHA 1IUJA 1YAGA 5GVQA 3JTOA 5AJ3F 3RUBL 3RVCA 5LMNF 4W5OA 3PW7A 3FZFA 2P9LB 2ZBQA 1GXUA 3DRSB 4BQLA 1Q95G 1UTAA 1C2PA 3V9UA 2YHYA 2QLJB 1JLBA 1ZM3A 3NP5A 4LQ9A 4JI5K 5RUBA 5HVFA 4QWEA 3M8RA 5BN8A 2HBYB 4C8YA 4CO1A 4X4VA 4FWSA 2CG8A 3BY5A 2CPJA 4BRAA 3BSCA 2LEAA 4M3ZA 4ZCIA 3IAM9 5C42A 1GLFO 1W0HA 2V9KA 3HVRA 3NVKA 4LREA 3W60A 4MH8A 2IM1A 4DR7J 1J5OA 4KBIA 4JKBA 2OZMA 2V8DA 5I42A 1D4XA 1JJ2R 2F4VK 3NG8A 3CJ0A 4DV6F 4NZ6A 4NYNA 2E44A 1N5YB 1FNXH 1YF5L 2FSNA 4DQPA 1KTQA 3MF5A 3T41A 4NI2A 3O6WA 1I1GA 3SSQA 4KT0C 1T9YA 2IC3A 2BRKA 3BH6B 3TJAA 4F3TA 1PYOB 5KG6A 1YIJS 3AVGA 1QSSA 2IBKA 1T6CA 2KXFA 2BKNA 2DGUA 3D0GE 3UIQA 4DR5F 4NYFA 4K0KK 4RPFA 2HRUA 4M63C 4G6VB 2XMKA 4KPYA 2KZMA 4TKTA 4FVMA 2GUIA 1X7VA 5BYRA 5CCLA 2EK6A 1SZ2A 3DCAA 3DXMB 1TR0A 2A6AA 2IA6A 2EFQA 4OZ2A 5FLXY 3L8BA 4JI6F 2N4CA 3Q86A 5AXNA 2VQFF 4LD0A 3N4WA 1T9WA 2RE1A 2HWIA 2H65B 2HBKA 5BRHA 3EY1A 4BR2A 4HACA 1QVGR 3BUZB 1EQYA 2DNQA 3IN5A 3TU5A 4DBQA 4H5RA 5LOQA 1P8ZA 2XGQA 4DR4K 3R9PA 1D1UA 4CFCA 4CJPA 1CG2A 2JL9A 4GC7A 1FDDA 4NCBA 2R9LA 5KT3A 4JP8A 3NCPA 2NS1B 3FQKA 4LRAA 2R2RA 2JEGA 1TUUA 1SCJB 4NA3A 2SXLA 5HJXA 3QZ8A 3KLIA 4L76A 1N33F 4JI3K 3MECB 3J7AP 3AO1A 2J6SA 4F0KA 3VERA 2NUUG 3C6TB 2ITGA 2KVQE 4ES2A 4L75A 3JQKA 1ZM4A 4EU0A 1N6QB 3I33A 1BO5O 1NAQA 3DHWC 3HZGA 4JI5J 3G8TA 3OTDA 2BM1A 3VGUA 1WHYA 4O3SA 4X65F 5BRDA 2WOMB 1X4AA 1URRA 3HSJA 5K14B 2W8KA 2RPIA 1QAJA 2G8HA 4BCAA 1WKJA 3Q24A 2IVNA 4DL4A 5IC4B 4CHZA 1VJQA 3K58A 4DX5A 4IEEA 3SJJA 3WNFA 1GOCA 3THYA 2I0XA 2WVDA 3NCIA 1ZTTA 3QJLA 5FJ4A 1J27A 2CYYA 1OY9A 5GAHU 1RU2A 2V2KA 1UFLA 5EWFA 3TVYA 5AJ3K 3THTA 4I64A 5LMNK 1VOMA 2HBZB 1RLDA 2EEYA 4M3UA 3QEVA 4H4KC 4OHZA 2F4VJ 4A48A 3IR6B 2DHHA 4CZCA 1Z2ZA 4CF8A 2C2ZB 3VQ5A 4RW7A 2CJQA 5E0OA 3A1YG 3QMQA 1YRTA 3MMJA 3E51A 4FYWB 4WPAA 2NRZA 3VQQA 3L9ZA 4ZLJA 2JC1A 1G2EA 4NL5A 2WSFC 3WNHA 2E9TA 2E2OA 2YHAA 4WYWA 4K4TA 4KGZB 5A8WA 5BYSA 3ZTQA 2OGUA 2QRRA 4K0KJ 3AVHA 3HOSA 1N5VA 1S0MA 2UXBF 4AM7A 3EJMA 5DDQC 1ZA2B 4NXNK 3V81B 4OZ5A 4U6PA 4BACA 3CFPA 4CLSA 2CJBA 1U0SA 2Z4PA 3KLHB 4RW8B 3KUEA 1OJ4A 4B3SF 2RS8A 5AQQA 1K8KB 2A3ZA 1LW2A 4OV1A 3SQ0A 3HK2A 2EFGA 4R79A 2HQ3A 3R3LA 1SJ1A 5JLFA 3RRHA 5C2DA 5HI7A 1QVFR 3UVJB 3CHWA 3D0PA 3SQGA 3JSMA 4X64F 2IBOA 3NGYA 4DSFA 2F8HA 4KY3A 4HUEA 3HJVA 1RDCA 1LW0A 5AQWA 4ECSA 3SEOA 5M2RA 3FSYA 3PJ9A 4DR4J 2G8WA 2DGTA 3L7OA 1KD1T 4EEYA 1TQLA 3OYIA 1HPMA 3FDSA 3E9PA 3VMFB 1GOAA 3QBWA 4YDDB 2BYCA 4CK2A 1TL5A 1B9DA 5KFAA 4B3OA 5F8IA 4JI3J 5HMZA 1WG4A 2KYZA 1BWEA 4PWDA 4JI6K 4YDXA 2NREA 2FHJA 3OVAA 2K8GA 2GAGC 3MPUB 2VQFK 1KQSM 4FWRA 1UJ6A 1VQPN 2V2VA 3GYGA 2L41A 2KB2A 4NXMF 2DVIA 4IH5A 4IG0A 3GMGA 3CDBA 1YZ6A 1NGGA 2R7TA 3KTQA 4C3KA 2QJ3A 3GLJA 4M45A 4QCLA 4U96A 3MM6B 1NLVA 4YP3A 4ITSA 2HFSA 1ZPWX 3RR8A 1A6LA 4LMZA 3FZMA 1FE4A 1NGEA 2QWLA 1T7PA 3ETOA 1HBUB 4NLVA 4F2RA 4Z4GA 3EVWA 2DGXA 3B8AX 1D8ZA 3TA1A 1WELA 2J8AA 4ETXA 1B7FA 3T1HF 3QFUA 1QJHA 4BGAA 1N33K 5AJ3J 1C0MA 5LMNJ 4UZBA 2DCUB 3CJ1A 2ZE2A 3NGDA 1WUUA 2J9EA 3K17A 3UD3P 1OQ6A 3MMAA 3C3LA 4B17A 3H5SA 5CH7B 2G0JA 4TXSA 3G0ZA 4EGLA 4J2DA 1S1TA 2CFXA 4FWQA 3JS9A 3ZSRA 1KD1O 4X65K 5J2QB 3PLAA 4Y2IA 2FXUA 4O0NA 4FJ5A 2O1PA 1RNHA 2FC8A 5AQRA 2DR8A 2IHR1 2ZHOA 3S3NA 2K06A 5GADU 3DOLA 2B6AB 4USIA 1EETA 1HLUA 1SH2A 2AP6A 3BGUA 1RJJA 3LP1B 3CDAA 3L2WA 2GIQA 4C8NA 4ZK7M 3EUNA 4FW1A 2PFUA 3D45A 1U1QA 2VA2A 2GA7A 3MAHA 4DV6J 3NOCA 2J0SD 3FGUA 3NRBA 3PVXA 1NJXA 2G0CA 5GAEU 3S3MA 2RRAA 1HD1A 1ASWA 3MEEA 1T03B 4YN3B 4ZCKA 1JLEA 1IBMF 2HMPA 2Q0RA 3Q7CA 3H25A 3MPYA 3I4PA 4PUOB 2UU9F 3J7YI 2W9BB 5D0EA 1Y9OA 2APOA 1VQON 2ZD1A 5LJ5Y 2BE2A 1JJCB 3AQOA 3D1HA 4V19J 1S6PB 4AXJA 1LWEA 2VGNA 1XEZA 3UPFA 4DR5J 2P1JA 2DHSA 1UMJA 4JRQA 1FKOB 2UXBK 3MHYA 3PX4A 4CZEA 5GIPA 5BR8F 4BLGA 2DRDA 3FFKB 3EXYA 4ZCLA 4KGKA 4OI2A 5HROA 4B3SK 5HP1B 3KNGA 3HPGA 3BR9A 2MQLA 3BN4A 1BWVA 3HO1A 3NMUA 1VGYA 4JI6J 3P31A 5BN9A 2CG4A 3ZX0A 2VQFJ 3U02A 3QNOA 2NCKL 4RU2A 1ESVA 2O8EB 4YOXA 2OHDA 1VSIA 2UXCF 1UAWA 5IT0A 3GB0A 5JVHQ 1FWPA 1U2CA 2V7YA 1S57A 1QSYA 2QWMA 2VKZG 4NLDA 2KXNB 1AB8A 2P9CA 3D7SB 3OV7A 2Y1IA 3TTCA 1R0AA 1M1KT 5IM0B 3G8SA 1JL1A 2JWLA 3UKRA 2QK9A 4DU7A 4PZVA 1N33J 2H3EB 4NOHA 4AXIA 3SMSA 3NCRA 3LP3A 2GMJA 5HO4A 1Y5LB 3JSRA 3RB3A 1HQUB 4Y0WA 4BRQA 3CVKA 4M5IA 4WQ4C 4F0HA 2W2NP 4B1XB 4P7VA 4NXMK 5LM7E 4CFDA 2NXNA 3SV3A 2COLA 1RT2B 1WDDA 2X51A 1RXOB 3IG1B 4X65J 1GNKA 3OTBA 1WC0A 2XY7A 1KVBA 4Y1DA 4IFVA 4O4GB 3MAAA 3C16A 3SUQA 4I4BA 2DY9A 2IA0A 2QLWA 3PJWA 5C2GA 5ETNA 2OPSB 4K8ZA 2Q6BA 1EIYB 2C2NA 2WHOA 2KZZA 1N88A 3R2CJ 1BCMA 4CRJA 3GQCA 3TZXA 1NO8A 2N3LA 3CMES 2YNFA 2VUGA 4NZ7A 3NH2A 4BGBA 2QI2A 4FPIA 1Q16B 3ENWA 2HFZA 3JQMA 3T1HK 1KWMA 3CM6A 2D1KA 3ZZZA 2DNHA 2EBEA 1ZYQA 3EEQA 2E1ZA 2JX2A 2K1RB 1UVKA 5KTQA 5KFUA 3MM9B 5LXYA 1BCOA 1JKHA 4CHYA 3AAWB 4CGIA 3QIPB 5L1LA 4W5QA 4IFYA 4LF5F 4I6MA 4LF6F 4F26A 3PNIA 1M1KO 1HI1A 4A2AA 2KL8A 5KFGA 3LGNA 1CXUA 2CGLA 3SXLA 4IOAL 1SIWB 1BMQB 2QLXA 3A8JA 2UXBJ 3MUVP 1IO2A 4DV5K 5KFBA 1IKVA 2NRRA 3MN5A 3CCMN 3SUNA 4KHRA 5IWAK 4IH7A 4H0YB 3NGTA 4USWA 4B9LA 4B3SJ 1LCUA 2CQ1A 5HQLA 4U67L 2C3YA 4OYAA 3UKUB 2P5OA 4QS7A 3KLVA 4LT6A 2YHBA 4A2BA 3TQEA 4I69A 4WXOA 1TK0A 4RTFD 4LFCF 4CZHA 3ZFVA 1VRUB 1SC1B 2M8HA 4X2BA 3V4MA 4QS8A 3NMAA 2UU9K 4AL6A 2PDAA 3OR1A 5KG2A 1EQMA 4X64J 2K7JA 1JB0C 4MJKA 3AOAA 4ECWA 1DKGD 4NA2A 3OYJA 1LOUA 2HQDA 5JMVA 4L72B 1KLMA 3PZPA 4CCHA 4UUWA 4BR4A 1S7IA 2GQQA 2AWZA 1I3OB 2O5DA 4FL9A 1RKIA 3DYAA 2CDRB 2ZBIA 3B82A 4ILRA 4HHHA 2W4CA 4C97A 3TUJC 3EGVA 3KK2A 1KFDA 2CPFA 3TUPA 1YJUA 4LFBF 3VEOA 3AAQA 4CIFA 3A5OC 3K0SA 4CZGA 4OMFG 4WK1A 4DCOB 4O3OA 1NZAA 1HKBA 4F3OA 2KVIA 4NXMJ 2C2DA 1XQIA 3LP2A 4BC4A 2UXCK 3DC2A 4J8FA 2IOCA 3K7RA 3FCVA 5A0YA 4DF4A 1S1VA 2K7KA 5E3RA 4ZA1A 4HT7A 4JN4A 4W98A 3SCXA 5GMEA 3V5RA 1BOTO 4Y65A 2C2EA 2VCPA 3MM7B 3BDPA 2RNEA 4CD3A 2C42A 3AAPA 2XLIA 4KC5A 2G2ZA 2M4MA 3I96A 4YY3K 5E7OB 3PIPL 1Q86T 2VG7A 3M6GA 3SFUA 3T1HJ 1S1XB 2GVZB 3P5TL 4YOYA 1YI2N 4J2AA 2OKQA 4WE1A 1CC8A 1ZC6A 2AJ2A 4CLFA 5D4PA 2EFOA 2MQPA 1YSJA 4K8RA 4A8SA 1VSMA 2MGZA 1BUXA 1RTDA 3HCXA 3US5A 1MSWD 2JVOA 4DV0F 3A5NC 1WWHA 1UVJA 2ZKUA 4DI6A 1UA0A 4JKGB 1ZBLA 2RUSA 2DB1A 3OLBA 1K8AT 4BC2A 2NR0A 1RUSA 4R8UA 4OI4A 1CZAN 2IY5B 3BZCA 1SVDA 3KG1A 1HBOB 2RUGA 3D1OA 4IXCA 3A3PB 2E2NA 1OPIA 1UWAA 1X9JA 1UETA 1MW7A 2HSTA 2IMOA 4BC5A 2GQCA 2DNKA 1HNIA 4DV5J 3QATA 4B9MA 4AHCA 4BQZA 5IWAJ 8AT1B 2HW3A 1A9NB 1OVQA 3POTB 3KVGA 5C2FA 1MWQA 4BE2A 1ZAWA 5K8MA 1NMEB 2MZSA 2YV0X 2LYVA 3D6MB 2ZVSA 1R8CA 1J5EF 4X4OA 4ZJOA 4E19A 1N0VC 2FVQA 2YNIA 3IWLA 1RBSA 3OYFA 1NK4A 2DFFA 2FD2A 3IGNA 3ZX3A 3JYTB 2MSTA 2GIRA 3MGJA 4KV8A 2D41A 4QU6A 2AJ4A 3E9LA 2GO9A 4OZ0A 3F9KA 1XN9A 4NMLA 3IR5B 3ALYA 4FZXC 1QUVA 4NEZA 4EHTA 4LF5K 3FVYA 4LF6K 3HHDA 3RTVA 1ZH5A 3T19A 2UU9J 3W5YA 1X5PA 2DNMA 3WXIA 4RW4A 2O4GA 2FHOB 4KHSA 4A5AA 4LRDA 1JLCB 3D2EB 2JH3A 1GLDG 1E3MA 4OKJA 4FDFA 3ENOA 4FBTA 4X62F 3FZHA 2HF3A 3OFHA 3N5FA 1S0OA 1TTHB 4P10A 4ZPTR 3OVNA 2X1GA 3QJJA 3TAEA 3TOQA 2Q97A 5A6PA 1G3OA 2Q66A 3SV4A 4RUBA 2NNWA 3GG4A 2PD1A 3MXHP 3V6JA 3CGIA 1K8AO 3PYEA 4DWIA 2H51B 4DPXA 1XBWA 4Z4EA 3A8YA 5KFIA 3CO9A 5GAGP 3BH7B 2CUYA 3V6HA 1UP1A 2WCXA 4FS2A 1LXNA 5CD4A 3HSDA 1H6KX 3ZSXA 4B3MK 3BF3A 2UXCJ 4KH4A 3D6FB 4NCGA 2ASYA 1XMBA 2HLTA 4BS2A 1HIYA 5DK5A 1NH7A 3MAQA 2NRVA 2F5GA 2WRMA 4R5PB 5HVHA 2E7XA 4HHUA 3ILIA 4YY3J 1QUPA 4MTPA 1TU0B 1SJFA 2JVRA 3QQCD 3AVIA 5F8HA 4PWUA 2JWKA 1VC6A 4BY9C 3ILOA 1LAWA 4WBFA 4CZFA 3EKUA 4LFBK 1X0FA 4KHMA 3DMJA 4EO8A 2LEBA 3QRPA 3QINA 4DV1F 3BQ2A 4M3YA 1FRMA 3TI0A 3AA8A 2HWTA 4PKDB 1UEKA 3GONA 5F2RA 4QIEA 4H54A 2QA4G 5EOYA 2MKCA 3KK7A 4L6V3 3CW2C 3NS5A 5EWEA 2LXIA 3A0IX 2A2CA 2XEXA 1T05A 1X31C 2QYGA 1RHKB 1PJ7A 1UW4A 1TP7A 2JZ5A 2Q3PA 1VRQC 1R8AA 4BRMA 3NS6A 3ID6A 2YQ0A 3QT5A 4I56A 3JAMY 2KDOA 3MCSA 2DISA 4CHQA 2GX9A 3DRPB 4EBCA 3I5CA 2XMMA 1APSA 2RU9A 4DG1B 1X4EA 1NDPA 2KT2A 2P9LA 5DM6Q 3HLUA 4O5BA 3DRSA 4PKGA 1WHVA 4DV0K 3OS0A 2J0WA 5HQMA 5DDRC 2AJ1A 2BQRA 4LF5J 4LF6J 2I1RA 4KIAA 2ROPA 4J91A 2QSFA 5C15A 2IMWP 5B0EA 1RILA 3WIUA 1NPRA 4CI6A 3AARA 4JKEA 4YNQA 4NCAA 2UYTA 2W2QP 4G3IA 3KHLA 4N56A 3ZEUB 3I9V9 5CYMB 1RYSA 2UVVA 1MWZA 4QR0A 1YJ9N 4X4RA 4NLBA 4GO5X 4ZJLA 4Y28C 3FMBA 1RWVB 2EWHA 4CLWA 3SCLE 3OYCA 4JI2K 1FJ7A 1FEEA 3RGIA 2JEJA 5BXIA 1N5YA 1FK9A 1IBCB 1NGAA 3D3CJ 1FRJA 4CJ3A 2FJWA 4IWVA 4B1YB 3RBXA 1JX4A 4GKKK 2VFRA 3DJCA 4W90B 1WSJA 2OJ3A 1XK8A 4H5VA 3PXGa 2U2FA 3DRYA 1OY8A 1VQNN 3HYFA 2ASMA 1C0UB 1BXNA 1TFYA 1VQPS 2ZDPA 3KOAA 5D0RA 2MJUA 1E4FT 3HHEA 4J5OA 3ZSYA 3NOGA 3QIOA 3SCKE 2QG9B 5HQ8A 3WT0A 4GV9A 2V68A 4QIVA 2GS8A 2WW4A 3ELHA 2RD5C 4K4YA 2PZSA 3T9NA 4DV3F 4ZITA 4RW9B 3R5BA 3ZZTA 1X8DA 3DXMA 1YUWA 5KFPA 3J80Y 1S49A 2DGVA 2QMUB 4LFBJ 5SUHA 4Q5VA 1XUPO 4KTZA 2HHSA 3HP6A 1U7LA 3VAIA 2RHSB 2HHTA 4AH9A 2BXJA 4DL0C 2LQ9A 2O01C 2F7TA 3RW7A 3DI6B 4B1ZA 4IEIA 3PO5A 3QWPA 1RDUA 1FESA 1H3DA 4F4KA 4BC9A 2P2CB 2CXEA 3N5BA 3CDWA 2V67A 5I3QA 4FKYA 1TAUA 1UEVA 3U6FA 2CRLA 4H4OB 4C6AA 4CLYA 3SI6A 3AJDA 5ADZA 1IQTA 3IFEA 4IDKB 2NYHA 1SUQB 4P73A 2MQ8A 3PV8A 3A3NB 1WNSA 4MLEA 1YDLA 3DGPA 3MPWA 2BJ7A 3VGTA 2W4DA 2ZQBA 3EE3A 2D0AA 1F5AA 2JRSA 3MECA 1Q0NA 1OYDA 2BUPA 2BVZA 2QLBB 2UUAF 1P9YA 5AZIB 4Y34A 2KLAA 4DV0J 3C6TA 1Z6RA 5CE3A 1N6QA 3DLHA 4URSA 4I6AA 3RU0A 5EVZA 1JNZB 2GJFA 3V6KA 1QE1B 3F41A 3OFFA 2WOMA 1CC7A 5K14A 3QIDA 4N8OA 3T5LA 2OSQA 2ZJQL 4A8MP 4WFZA 3GIJA 2ZH4A 3OT9A 3W8GA 3SSSA 4UQGA 1WN7A 2GNKA 1FFSB 4F4AA 4ZVFA 3BYPA 1XR6A 1YRXA 1VQOS 3U8XA 4PPZA 2MQQA 3BGRB 5F41A 1FRLA 1NMDA 4OX9K 1U25A 3CCLN 3W63A 3CWJA 4YOWA 2HNYB 2XS2A 3ATVA 1YQHA 1MMDA 2HQGA 3B6OA 4JI2J 1OO0B 1F1BB 2LQ8A 3AOCA 3I9ZA 5B0DA 4KJIA 1NGDA 2PGCA 5D4LA 1D3WA 5E2QA 3KWGA 3FLCO 4ZP9A 3FNNA 2VQEF 3VQPA 1O13A 4A46A 2DBBA 3CJ5A 1WDTA 3KJQB 1BIUA 2BEFA 4LH5A 3OL9A 3MM8A 4ZVGA 5CABA 3QB0A 4P52A 1BY9A 4FJ8A 1RWMB 1Q81T 3W3DA 3LPEA 1UEUA 5DDOC 3FZ2A 5CD4H 5ADXA 5D78A 1CJTB 2RVJA 2XS7A 4X62J 4MQ3A 4FM2A 2VBZA 1Y10A 2UUWA 4NYZA 3V81A 1VQ8N 3DLEB 3KLHA 3T1AA 3HT0A 4Z2XA 2H5IB 4MO5A 2BOAA 3SCIE 1K8KA 1HKAA 4QYRA 4AILC 1Q18A 3PG9A 5F8GA 1WF2A 5K20B 9RUBA 3H3NO 1J6ZA 2NSBA 1UZHA 3UVJA 4A8YA 4LF4K 2E7WA 4UOFA 2XMAA 4RBVA 3T1YF 3LZJA 3DU5A 1S6QB 4DS5A 2RRBA 4PXCA 1LAVA 4XDCA 3ITHB 2DNOA 3C8YA 5CYQB 1BU6O 2J7WA 4FWKA 4B3RF 2ATLA 4PKHA 3PUFA 4J37A 2ATCB 3CSKA 8ATCB 2X6NA 4JLHA 2JDJA 2MZJA 5D3GB 2MQNA 1U24A 3T6JA 4PKIA 3G82B 2JC0A 5KFJA 2ZZTA 1JXBA 3MCMA 4K41A 1U2RA 4JI4F 1NDLA 3P83D 2IJRA 4DV1J 4JI7F 3CD6N 4Q8FA 3TZYA 1W97L 1T9VA 3ZO7A 2ZC4A 1GEHA 4FXDA 2V5HG 4NB4A 1EB0A 4HL9A 5JJBA 4WFBQ 1SJ4P 4DR2F 4I67A 4DJBA 2GC8A 3MM6A 1YTUA 1AW0A 3N6MA 2HEKA 3CXCR 1HBUA 2LU1A 2PN6A 1DRZA 3BYRA 4QPXA 3AV9A 1SKWA 4ELTA 5BPMA 2DNRA 1FT8A 2GO8A 3EMTA 4ALZA 4P2FA 2YCHA 2VA3A 3BSAA 1Y5NB 3G96A 3TABA 4ECZA 3VAKA 1FO1A 2G0IA 3TJ9A 4F9OA 3CCMS 2EBGA 1IBKF 2GHVC 2ZWHA 5M1NA 1C1BB 4CTAB 3HF5A 1Q7LB 4JV1A 3GV7B 2UV8A 4AHUA 3BF1A 3VQTA 3TTFA 3RSEB 5LY3A 1V3SA 1SXLA 3IM9A 4OX7A 3PHTA 5G0RB 1VLOA 2E1CA 4EP5A 3CCJN 4CF9A 3BB5A 2GHWA 2G2OA 4QWBA 1XI1A 3DDIA 4DN0A 4I9QA 4ER8A 1ZETA 2B6AA 2B4PA 1HMVB 4CJLA 1FXXA 1QM9A 5HATA 4F4WA 3NLCA 4CJVA 5HBMB 4CEBA 4WWSA 2DD8S 5A8KB 3D2WA 2BJDA 1DQAA 3WEEB 5CZVA 2IVYA 1Q4RA 2QA4N 4Q2MA 2NRTA 1WAFA 2D3ZA 1RISA 4KGMA 1SQEA 3UR0A 5AQXA 4ED6A 3BBCA 3PW4A 3IM8A 3CJ9A 3UCZP 1T03A 2VQEK 1YJTA 2O8DB 2A1BA 2MMYA 1UVMA 4M63A 4KFBB 3R5GA 9ATCB 4DV7F 2VGMA 2Z2LA 4BDZA 4C3LA 4PUOA 3IAYA 1NM2A 2W9BA 2CZ4A 5J2PB 2HS3A 5JICA 3S01A 1T9XA 2PMHA 1S6PA 1WEZA 4ECYA 4PR6A 2VBXA 3RW6A 4QYZJ 4HTIA 3MR2A 4XPEA 1S99A 5KFZA 3WHIA 3WC2A 4MKBA 1FKOA 2WSCC 3MWBA 1SL2A 4IR9A 4J2BA 4Y6IA 1BGXT 4CEOA 1MROB 3HSZA 3MFHA 4NLRA 3W5XA 3FBFA 4JV0A 4DV3J 5KFKA 4UQTA 5HP1A 5M1FA 1VSFA 1S12A 5M1PA 1HX1A 3QESA 1U1KA 3K5MA 3FCHA 2ALZA 5I9EB 1VQ7N 1L3TA 3M9NB 2FVSA 4W5RA 1YI2S 2QTDA 1V3RA 5JMNA 5FRNA 5AQYA 2FLOA 3Q8YA 1RBUA 2O8EA 3I82A 3UQSA 2GV9A 3T1YK 5G4DA 1S77D 1NPPA 4CM2A 3LWLA 3M6UA 3PR4A 1BHLA 3RMCA 1WLJA 2ABYA 1WOSA 5C0YA 1ZBSA 2VICA 5FPEA 4B3RK 3QRRA 3VEXA 1WOQA 4UUXA 2YWFA 3U9ZA 5IM0A 3H90A 1I94K 4RBUA 1IR0A 1NEEA 4GV6A 2EKNA 4CD1A 4TYBA 5CYJA 1JJ4A 1M5PC 4KB7A 1N54B 4JI4K 1EKEA 1HQUA 4QJVA 1NGBA 4OHWA 3CFOA 4BRLA 5KFCA 3FFIB 3M6WA 4LBPA 1RT2A 1XWLA 1K47A 3IG1A 2RN2A 3OYKA 1CQMA 4DQ8A 4O4GA 2G1HA 3LAKA 4YR0A 5KFTA 3HRGA 4AF1A 3IDHA 3OXFA 4ZVPB 4FCYA 4FLTA 1TUGB 2YWWA 4GVMA 3IO1A 2DHAA 1S5ZA 3SFGA 2OPSA 4BRCA 1KXPA 2F96A 3CFRA 2QXLA 4H4KA 3FBEA 5KFMA 3AVNA 1U8SA 4WZMA 3CPEA 3UNGC 2DHGA 2RHKA 1HA1A 1QAXA 4BWJA 3L6QA 2FJDB 2YWGA 2WB4A 4DUZK 3PM9A 3EGNA 2JEFA 1JXEA 2L9NA 2CWKA 1FHTA 3ZSOA 2IVPA 1IG9A 5AQSA 1KRPA 2E7VA 2K1RA 1IBKK 1FD2A 3MM9A 1VJWA 1IWAA 2OANA 1JLAB 3IWXA 3OYHA 3CJ3A 2VQEJ 1KSPA 2V4JB 4GV3A 4DPYA 3QIPA 3HTVA 2R8IA 1ICEB 3R6GB 2O8BB 1DEJA 4TY8B 1F2GA 2ASPA 2G8FA 3MWPA 2IAJB 3I87A 4N41A 2HVHA 2GTDA 2C3MA 2FHMA 2G9OA 5K8NA 5LMUF 1F3VA 4KHPK 2EPIA 3DLLQ 4DSKA 5D4NA 4ZMMA 2PO4A 4M8LA 4WK3A 3BKTA 1PYTA 1HNZF 2XHWA 2XS5A 4JV5K 2E1AA 4OI3A 1SC4B 5GMKa 3G6XA 3L4IA 3CCUN 1DFDA 4WKRA 5LJVA 3NKYA 3WXJA 3GYNA 4JI0F 3UKUA 2FJEB 3OJSA 4EP4A 5DGAA 5I3PA 1X4FA 4BG9A 4K5RA 2D1CA 2Q1LA 1VRUA 4DV7K 2OPPB 1S48A 3GFHA 2VOOA 3T1YJ 2RT3A 4UOGA 5CHIA 1S1UB 4PG5A 1OYEA 3W9JA 2DNGA 3AB4B 1SC3B 2HNDB 2MY8A 2HSEB 1N8RT 2WAQD 1QAIA 4DQRA 1KDNA 1Z4UA 2FZGB 1U26A 3VEWA 2ZBCA 4DOZA 4B3RJ 1YRUA 1S7HA 2ZJPQ 1NNDA 4DHVA 2Z1IA 3N9UC 2FJVA 1RWOB 2DNZA 1DZ5A 1JJHA 4NLCA 3SQ1A 4HDGA 3Q8RB 2YKNB 4EUVA 3LM2A 4CZLA 4Y2AA 1SKRA 2JGUA 4DFMA 3O1WA 4JI4J 3CJAA 1LWCB 2GVDB 3OBWA 1CULB 4USKA 4C8OA 1RDDA 3CCQN 2I7PA 4LVNP 2CQPA 2XZWA 3GDQA 2HFUA 3OS2A 3TRGA 4K4SA 4I68A 1VLYA 4FWLA 2IGIA 3VQ7A 5JVHL 1BG3A 3VZHA 1IKWB 2L48A 5HMYA 3MM7A 3MMAB 2MEWA 5TKWA 4DU3A 2LDIA 1OKJA 5ETPA 5CR4A 5GAGI 1S1XA 3DLBA 1AZSB 2GVZA 1Y0HA 5DMRA 1TL4A 3BJYA 2ZITA 1UWBB 4X4UA 1GLBG 2VBYA 3KG4A 2LQBA 1X4DA 3G4SN 1YJ9S 4Y2KA 3NMRA 1UFWA 3AJ2A 1IBKJ 3MMCB 1N8RO 5F1XA 5GAGU 3VETA 1RU1A 4JKGA 3MFIA 2CPXA 3HHLC 1NK8A 3SNNA 3TP2A 1BQNB 1B9FA 2AGOA 4N5SA 4ZPBA 4HH0A 1RTIB 3WIVA 2A3JA 2HZAA 2F9TA 2HS0A 1RWUA 3AGRA 2QE5A 4ANCA 5IFMA 1S4FA 1RADB 1V5VA 2FF6A 1HBOA 3OS1A 1A0OB 1GXLA 3HM9A 3J81Y 5D77A 4FJGA 3MCAB 4ZP8A 1X4GA 5H9FK 4DTPA 3P38A 4CH1A 3WUHA 3P4UB 3IS9B 4E8UA 1CBKA 4M5NA 2M52A 4MIBA 3R9LA 3D6RA 4MAKA 4OYBA 4PABA 2EK1A 2VYPA 4AHSA 1W7AA 2ZWPA 3AO5A 4HT5A 5E84A 1KC8T 2DNPA 2YWHA 1D9AA 3H3OB 4CF2A 3GPAA 4BR7A 5ETSA 1ZTWA 1ZAXA 3JYTA 1HBNB 2E5JA 3V1OA 4B1WB 3CCZA 3I55N 4DV7J 1VSDA 4NA1A 3ZSZA 4F04B 5J1EB 3G9CA 2PFFB 2WVEA 1JLCA 3AVAA 2E1MC 3D2EA 2CGKA 3LTOA 1YJNN 5LMUK 1VQ6N 1IJEB 2D5RA 1IQZA 4KKOB 2MQOA 2D3UA 4CJUA 2A6OA 5FDLB 2J9CA 4I7FB 1GLLO 3L7UA 3O4WA 3AHPA 2H5EA 5EHHA 3KIOA 2F9JA 1V5IB 1XMQF 3SIPB 1IVZA 1EP4B 4IBNA 3EE9A 3K8VA 3UWTA 5F3ZA 1S10A 1R27B 4O44B 3P4IA 5HJYA 2UP1A 4ISEA 3CNQP 1S1WB 3PTWA 3CF5Q 4RUAA 1H98A 3TPQA 4BRIA 4B1VA 3M1VB 1M5SA 1NG9A 1DTTB 1KC8O 4R5PA 1C4AA 1FRIA 5AQTA 3AXMA 2I38A 2PC6A 5LSLA 3DFEA 4FF1A 1X0PA 4UT4A 2WC9A 3FRYA 1FWKA 1H2UX 1IM6A 5D8HB 1V9OA 4J9MA 4FW2A 4B8AB 2YY3A 3ICLA 4RW6B 5DDPC 3GJTB 4W92B 3THXB 3FK4A 2CIMA 3CJKB 1QLNA 3IAS9 3OYNA 5F8LA 3BEXA 4LRBA 3OUYB 4I2QB 5DQIA 4OLBA 5AZJB 2ZDOA 4RNHA 1N56A 3HM8A 3CCLS 4IQXA 3CT9A 1DAXA 4LR8A 1U02A 3OW2R 2AEFA 4W5NA 4A4JA 1O0PA 2R7RA 4DSLA 3NH0A 1LXJA 1FI4A 4Z7YA 1MG7A 2VPWB 4F3QA 2BRLA 2I5JB 3X1LB 2R8JA 3AA4A 1KHWA 5CHCB 2X74A 4EWTA 5B09A 2X78A 2ZH1A 2F7VA 5KQDA 3EO3A 4I1TA 1NHKL 5H9FJ 5KGWA 5MLCV 1KBRA 4C1NK 1RAAB 4FLZA 1HHTP 1Y3KA 3OTEA 4YOVA 1GMVA 2HK2A 1TAQA 4N7TA 1HWKA 4I6MB 3QETA 4DDFA 3BN7A 3DRPA 4C4WA 2ZJRQ 3PW2A 1TKTB 2FBXA 2HB5A 1R7IA 4DG1A 3PCOB 3CD0A 1ZA1B 3MPDA 3NNAA 4EHUA 4WKYA 1R6VA 1VQ8S 1RDWX 5BYQA 1L3UA 4OPKA 2JWNA 4PXEA 2PBDA 3G6EN 2W7AA 1FEHA 3HBTA 1WAJA 4LH4A 1SH3A 2KQ2A 2XQCA 1C6VA 1G6BA 4FJKA 1XNQF 3SAFA 4CM0A 4BVPA 3GIRA 2IYIA 4I0WA 2DGQA 5LMUJ 3I0RB 3LQVA 2GWJA 3D9BA 4M5LA 5CYMA 2HBJA 3R2DJ 3C65A 1O8BA 1U6BA 2ZNYA 3D2FB 4NEYA 3KJVB 5DJBA 1HNZJ 2ZKTA 1RTHB 3UR3C 3QEPA 1T6DA 3R8YA 2FY1A 4K4VA 3TZWA 1KN6A 1R59O 4JI0J 2J9DA 2AHOB 3RAXA 4OFZA 3LP0B 1FTRA 3MURP 4IH6A 3HZ6A 1RQ0A 2LCWA 3P8BB 1NCLA 4DX6A 5D0HA 2VV5A 4XO0A 2BJEA 4QU7A 2X1FA 2KO1A 1KQGB 2CQBA 2HF4A 3C0BA 1C0UA 2LFVA 3P45B 4KHYA 5C5JA 3CD6S 3O8MA 4P2SA 1GQEA 3CUNA 1GH8A 4DMZA 1NNEA 4DU4A 3R1LA 3UI3A 1J53A 2V8GA 1R0CB 1XIQA 7FD1A 2CZ9A 2EC2A 1A5XA 2YX7A 1VRTB 4C7QA 4JKAA 4OQJA 1B3TA 1EZZB 5A0YB 1JIHA 3OR2B 1JK9B 4RW9A 1N5SA 1RP5A 4JS4A 1RBLA 1XMQK 2EVZA 3X3UA 3MDQA 4LRFA 3VF6A 3H7HB 4ELVA 2AEJA 3RBEA 1M5VC 2C3PA 1T94A 2XY6A 5LT5A 2B9EA 5E3AA 3TYTA 3O2IA 3DI6A 3BDEA 3SUOA 1REGX 2KFNA 4QQBA 4IR1A 4ED0A 2GMHA 2M8DB 2MYFA 2PYLA 1VISA 1EXQA 4ISGA 5HN0A 4DR1K 3TAPA 2XI2A 4DB3A 3SBTA 2NPIA 2IIHA 1FJGK 3UDEA 3GWCA 3VQEA 1SUQA 2BW7A 1KOOA 2YKPA 3LDNA 1A5VA 1TUVA 3CCJS 3HHLB 1RHJB 4RUHA 3H5XA 1K1SA 4Z37A 3D3BJ 3MWTA 3HFVA 4F50A 1YBTA 3J81j 3WX8A 5AZIA 3OL8A 2BKOA 1U2VB 5C25B 3LL3A 3SPYA 4YHHK 3H5YA 1WEYA 3ENQA 1VR6A 1QE1A 3M9MB 2QA4S 2KHOA 1IG8A 3V9ZA 4XDDA 5FLXO 3MI7X 3Q89A 4WIQA 4TY9A 2UUBF 2E1YA 1EQ0A 3ZT2A 1U1PA 4USMA 2D4WA 3C95A 4KHQA 4WFNQ 3ZZRA 2DH8A 2VDIA 5KAKA 4Q43A 4CESA 1RB0A 1V4TA 1FX4A 4CGFA 4Q0BB 4RL1A 1T44A 3ISNC 1Y3JA 3BGRA 4CW7B 3T5JA 1FXLA 3O9UA 1BDGA 4OPHA 4A8KA 4D3HA 1QQCA 1V4SA 2HNYA 1WC3A 1RHUB 3W9IA 4CFAA 1U04A 4Q45A 3Q23A 3C7NB 5DM6L 3AD8C 2L9WA 2Z2YB 2RQKA 4CLKA 3THVA 3ZETB 3E9OA 4OHYA 3D6HB 3CD5A 3C6HA 2VIHA 1VQ7S 1P1LA 2OSRA 3SQ4A 4DZDA 2ASLA 2PSZA 1CJTA 3BSNA 1W2BM 1UKUA 2JFDA 5B0AA 1BLUA 3GIIA 2KN4A 5THWA 3QRQA 1Z1ZA 3GE1A 3DLEA 1P8GA 4KRWA 3KD1E 4DTRA 4B9NA 3CJCA 1XMQJ 4FNHA 3CMAN 5IV3A 2BA9A 4USHA 2C22A 2JJ4D 4ED2A 3O9RA 3JTPA 2NXEA 3CJTA 4DCJB 2G13A 3DLGB 2M3DA 2OFHX 1NDCA 3GFYA 3L4QA 3W62A 4CI0B 2V51B 3C94A 3FE1A 1S6QA 4JI3F 1VSHA 5B7WA 2OTJN 4DS4A 3DXBA 2H4YB 2PI5A 2B8QA 4C8ZA 4UW2A 3RRGA 4DR1J 4LF1A 3ITHA 2RILA 2XSJB 1M0SA 1QS4A 1FJGJ 5CYQA 2JNJA 3LA0A 1SC6A 1H38A 3TSUA 3OL6A 5HL7Q 1FX2A 4DL7A 3OYAA 2BR0A 3Q8UA 3ZC4A 3IRWP 1KVIA 2VONA 1HYZA 5D3GA 3ZZPA 3CC4N 2GUPA 3HSGA 4FZVA 3HHKA 3G82A 4HR2A 2O8CB 4M5JA 4OI1A 4CF1A 4X4PA 2F8TA 1VBYA 3QLHB 5B0FA 2DYAA 1Z26A 2JLFA 1TKZB 4NLYA 1SBRA 1YK9A 3GU0A 3WQUA 3G2XA 3VVUA 2DHXA 4FPAA 3MD1A 1VHIA 1G7CB 2FB0A 2KRBA 5A6WA 4YOUA 1KQSR 3VAFA 4CGDA 1VC0A 3WX4A 5T7LB 1RAFB 5K8OA 1VQLN 2A6MA 1F21A 2E20A 2LVWA 2IJNA 5GIOA 4FLVA 4ED3A 2LP4A 1NBEB 4FVCA 3CCSN 4DU8A 2DT9A 5AT1B 4PWWA 1VSJA 4NASA 1PJ5A 2XCAA 5J2MB 1VQ5N 4WYBA 2XY5A 4CEQA 1W7WA 4CHOA 2DFHA 5SWMA 3BO4A 2HZCA 2RHQB 1C1BA 4KH0B 4K5SA 5AQFA 4CTAA 2CNOB 5EGYA 4N8NA 3VEZA 4EYIB 5JS1A 4HCBA 3CCUS 3RSEA 4NXNF 1S5JA 3QICA 2MKKA 4TLRA 1W9HA 4DTNA 1XNQJ 4DTMA 2V94A 2OZSA 2HVIA 2UUBK 5G0RA 3QMLA 4OKEA 1U6ZA 1WSIA 5KPRA 1U2FA 1T3VA 2WONB 2JHEA 2OAUA 1HMVA 1FK9B 1CZ9A 4IOXA 3SUPA 3CULA 1PG5B 4U8YA 1CJVB 4DUYK 5HBMA 4LJMA 3CQYA 1D9FA 5A8KA 2NQPA 4E89A 2LSNA 3ISZA 1TK8A 3WEEA 2VB6A 2AYBA 3OVSA 4OYWA 3OTOF 3C6UB 4TNOA 3SI8A 4EYHB 4RZRA 2O8DA 2FBTA 1TKXB 4KFBA 2F1FA 2VPXB 4OLOA 4CH0S 3O5BA 5DGBA 2DIUA 3MX2A 2VC1A 2W2MP 1YHQN 1SQGA 4CLTA 3PR5B 5KFYA 1I39A 4HUFA 5J2PA 1RWPB 5AQZA 3O8WA 2HLUA 4CZJA 3CCQS 4W5TA 4DL5A 3W2WB 3WXLA 4FK0A 4N77A 1F6TA 4CT9A 2HPUA 4MDBA 4NE9C 1SPBP 3KD5E 4FWMA 2BDPA 1X5TA 4FOEA 1MROA 1NSPA 1IXKA 5IOLA 3F0NA 2ERRA 4X4TA 3MN6A 3H5UA 4KO0B 4RNFA 5FIIA 1HNWF 3QO9B 1EWRA 2W8LA 3PRVA 1RK8A 4K42A 4C23A 1NB7A 5FPDA 4ZTFA 4DL3A 3A2FA 2O66A 2LA6A 2M5YA 5CZ2A 3GR1A 5T7BA 4PYDA 2IRYA 3H08A 3U9DA 4YB6A 3W64A 4CJEA 3FBCA 3DGPB 2YQ3A 3G4SS 3NNHA 3W65A 4AHTA 3VGLA 4MYUA 4ICLB 5FLXU 4CK1A 4LF9F 2YNGB 3GG1A 2ZEJA 3MMVA 1RFQA 2V4QA 1RAJA 3CJ7A 3CDUA 3A12A 1KLNA 1E6VB 3UCGA 4TSXA 2LA4A 4Z94A 1NU0A 3NEKA 3CC7N 2E4LA 4K43A 1FNOA 5M2UA 4FS1A 3H59A 3T3FA 5AQGA 2YBVA 1ZPVA 2KT3A 2DGSA 4IKAA 1NLKL 4C98A 1ZZFA 4FLWA 5D6GA 4HI2A 4CHPA 3AA9A 2HRTA 5HRSA 2ZOGA 5MAOA 4P6QA 3FFIA 2VG6B 4BE0A 3HJFA 3J7A1 2X6SA 2JLEA 2UUBJ 5HLFB 3VQSA 4MLHA 3LAMA 2D3O1 1ZZNA 3GL1A 2F3JA 4WTOB 3I55S 3HSTB 3DNCA 3AY9A 3QEXA 4RKUC 2R7UA 4OX6A 4DUYJ 1U0HB 4OPAA 2DKOB 4A8FA 1B99A 3EZOA 4FSVA 3MM8B 1ITGA 1VQ6S 5EY4A 2NRWA 1Y11A 3N0VA 2IM2A 2EFNA 5KRSA 3HHLD 5GAHP 4O3NA 2CNLB 4B9VA 4USUA 1JLAA 4PQUB 1AUDA 2ZH7A 4KH5A 3IWNC 3M8QB 2V4JA 1OY6A 3VA0A 1IKXB 3CCTA 4ID1A 1DLOB 1YG0A 3C66A 3ZSQA 3QGIA 2O8BA 5J1NA 3U3GA 4TY8A 2GFFA 2IAJA 4I6WA 3J7ZT 2DPIA 3KKFA 5KPZA 4J90A 4TLQA 1KKHA 3CXCM 2P9PB 4YORA 4CYUB 2Q36A 5AQNA 4G1IA 2WBRA 2E5IA 1SL1A 5KOXA 3OA9A 1HPZB 1KVCA 3CIPA 2VWJA 3VQBA 3ZSWA 2YI1A 1KR4A 5BR9A 2Z30B 2DRBA 4F4XA 3OTOK 3W5ZA 3DM2B 3HVWA 1WACA 4X4NA 4P74A 1RTJB 4CJFA 3M5RA 1EO1A 1S76D 3TUZC 5KFVA 3RMDA 1NHUA 2AD9A 4AHRA 4PEOA 5C24B 3RG6A 2C2RA 2OPPA 1FFWB 4D3GA 3BF4A 3GIMA 1S1UA 1IM4A 1KQFB 1UVNA 3DOKB 2HNDA 3QPIA 2HKEA 3H8YA 3LO3A 4HTLA 4TVAB 3TEGA 4KE5A 5EN1A 4GNIA 4U7UD 3IMXA 3R1HA 4A8WA 3KNAA 4EBEA 4K4XA 4XPCA 2QN6B 5KG0A 3EPIA 1HWLA 4O8UA 4NZ0A 1S59A 1S9EB 1FF2A 2WUSA 1WC5A 4MKAA 3TAGA 1T11A 4FN5A 3G71N 2ZF5O 4GMJB 3GV8B 2FYXA 2YKNA 1HNWK 1SB6A 3PIOL 3ATUA 2R7QA 2RDDA 4ANDA 3J7ZO 3SBGA 1LWCA 2CA9A 2GVDA 1CULA 1VQYA 2B43A 3MXJA 2QKKA 3I0SB 2LU2A 2W6LA 2IM0A 2DXDA 2HHHF 4CJTA 3KKSA 3SYZA 4KH6A 2J6UA 2B51A 1ZOTA 4WFAQ 4LF9K 3QT6A 2K3IA 1IKWA 3ZTOA 5HAOA 3UD5A 3OBYA 1NBWA 3CCEN 3GV5B 3G6ES 2RB7A 5JVGQ 1XHZA 5CZXA 2Y3YA 5DQHA 1U48A 4M95A 4PQAA 2A40A 1E6YB 1VIXA 2Q43A 4JUZA 3R6MA 3V6DB 1AZSA 1NJYA 3NF7A 3VALA 1GFWB 2R8KA 5HMXA 2H4WB 1UWBA 3HFKA 5CCMA 3OXGA 8RUCA 3TR8A 4NO7A 3MMCA 4K7QA 2HHXA 1VBKA 4ZPAA 1MN7A 4ISFA 4JS5A 1NGHA 4DV5F 2PMZD 1BQNA 2W4PA 4NXNJ 5E3QA 2XMVA 1RTIA 5IWAF 4RNNA 3LGMA 2Z0GA 3SK3A 1Q82T 2MJNA 2CQCA 1NJWA 4P2MA 1SJ3P 5H1SQ 5FD1A 1U1RA 4LR7A 3VN5A 1UJ4A 3KHYA 2P9UB 2OH2A 1NU4A 2RDJA 2XBPA 3ASMA 1OSCA 3L95X 1HD0A 1FCAA 2RRNA 1IJJA 2HFVA 2VL1A 1SIZA 2OPQB 1TZ0A 3UN2A 4LF2A 1ITPA 2BQUA 2RSQA 2Q0UA 2UZAA 3IS9A 1WKLA 5GADP 2A2DA 2QWQA 4NLWA 3H20A 3BP8A 1HJOA 1FJEB 1RDRA 3PO4A 3EPGA 2XTJP 1PCAA 4Y0FA 5L8RC 3OTOJ 5EWGA 1ULRA 4DMNA 2XYGB 1O1WA 2D0CA 4DXLA 4CLPA 1HBNA 3T7ZA 2QC3A 1SAZA 3OXLA 3J7YU 3G10A 3DLRA 4M5MA 5GAEP 4P75A 1VQ4N 1FXDA 2YQ1A 4IRCA 1PC4A 3E1YA 3PFOA 2KYXA 3H4DA 1B7YB 3AODA 4CQ1A 5J1EA 1LK7A 1WF1A 3FMWA 2KKHA 1HI0P 4RLEA 3UE5A 3IXQA 4KKOA 1RTZA 3KLFB 1RLCL 1B64A 5DG8A 3GFZA 3DLLL 1TYQB 3GG0A 4O3RA 4J9KA 1B92A 3WQTA 4CO0A 5FDLA 3MEGB 4I7FA 1AFIA 1Q9XA 1HNWJ 4DZ6A 4O3PA 1Q82O 1RT1B 2AYGA 5EU7A 1EP4A 3BGFA 5AQHA 3IA0A 3A5LC 1YBUA 3W2VB 1LNQA 4YY3F 1RT5B 4O44A 1UPPA 2M70A 1XC9A 1S1WA 5KFNA 3RB0A 2Q6CA 1RGVA 4LF9J 2W2OP 1RWWB 2ZH9A 3PSFA 4WP8A 4ZVEA 3M1VA 3LGHA 2W9AA 3ZSVA 1DTTA 4OLPA 2B9WA 2P51A 3SBMA 4L73A 2AT1B 3L2VA 2H48B 1N52B 5CZ1A 1NK0A 3CCVN 2YH0A 2VJVA 3OYDA 2RQMA 2IRUA 4RW6A 3CPWM 3THXA 4GKJK 2W40A 3IMQJ 1JXLA 1YJ7A 3RBDA 3BZQA 3CJKA 4RBTA 4BC3A 1QSLA 2HQIA 3OUYA 3IBCB 1TV6B 4V19X 1SQFA 4I2QA 5AZJA 1RDAA 1FNMA 2BBEA 2YPZA 3MCOA 4CO3A 3V4IB 4ES3A 2WVBA 1NHVA 4FJNA 1JLGB 1BQMB 3B4DA 3FGVA 2OCEA 2HHHK 1UOCA 2NZ4A 4TN2A 4MFBB 2ZH3A 1JL2A 2I5JA 4HLBA 1YTAA 2QL9B 1JWWA 2B4VA 3T9ZA 2N3OA 2NLXA 2Y0BB 2UUCK 4KSEB 5BJRA 1NKBA 4AD6A 3JSBA 1WSFA 1I5OB 1RA6A 1OQ3A 1N32K 4LBIA 3D67A 2ZUAA 1X4HA 2FC0A 1NRKA 2KHCA 4RWTA 1NGCA 4KI6A 1LWXA 3TQ1A 1AXQA 1NWKA 4KHUA 3KWMA 1RBAA 4DN9A 1TKTA 5KOWA 4LC9B 1OS5A 2AKWB 4BG8A 1NK6A 4JBCA 2PEBA 1FJCA 4HDHA 4JK7A 4Y00A 2KU7A 3KKRA 4WFYA 3RBZA 5AE1A 4FJ7A 4Q8EA 3CMAS 1WB9A 2WW8A 1HL6A 1H73A 4DV2F 1QD1A 4RO0A 1UAXA 3ISND 2OIHA 4OKKA 4QWCA 1S3XA 2DITA 1F5CA 1RT3B 2UUTA 3DU6A 2BJ8A 3I0RA 1F9EB 2Z2ZA 1WTBA 2W1BA 1FDAA 4KGVB 2V52B 3SDEB 4B02A 4C11B 3D2FA 4NWBA 2DNNA 4LF7F 4P7TA 3KJVA 4HHTA 4Y2MA 1DTQB 4B3MF 1RTHA 1VQKN 2DR6A 2XCPA 2ITMA 2VASA 4GW6A 4TQRA 3GE9A 4ZDNA 1NK9A 3HD1A 3LP0A 3EM1A 5F0WA 3JAMO 3CM5A 3CC4S 4TU9A 2DNLA 2MZTA 2DK2A 3EX7B 5CA5A 4Y2CA 3WC0A 4XIUA 4WZQA 3EL2A 4ECTA 3MR3A 5CXTA 4XH1A 1H72C 1KQKA 3L0QA 2J0XA 2M9KA 1PGZA 1JMTA 2I2YA 3OTCA 2KG1A 2P9IB 4BDPA 3H46O 2KKZA 4HKQA 1VRTA 5JXSA 3JQJA 3O3LA 5E26A 2B5JB 3OR2A 2LQJA 4GKJJ 4RWWA 4OJRA 3HI0A 2HK3A 4JKFA 4DV4F 1VQLS 1AUSL 2AV5A 2EG1A 3MN7A 3G6VA 2D74B 1VQSA 2VPYB 4J9RA 1GMWD 1V6HA 1WSHA 1F0XA 4PL8A 1S9GB 3K57A 1HYSA 3QZ7A 2GEMA 3D7EO 1IBLF 3CCSS 4C2MA 3VQ4A 1LKZA 3M2VB 2QX0A 3CIMA 3GILA 5J2NB 1VQ5S 1S9FA 2HHHJ 4GVBB 5B0BA 2MSSA 3AB2B 1OPZA 3ID8A 2XO7A 4DPWA 1U1NA 2XYHB 3TNVA 3CF5L 4ILHA 2CKWA 4H0VB 2UUCJ 3L7PA 2QZ8A 1WSVA 1YJRA 2F65A 3C19A 3HD2A 3CJBA 2CPHA 3R1XA 3M30B 2CPDA 5AQVA 1P6TA 1REVB 3B4MA 4WU3A 1N32J 3LWMA 3R5DA 4FBUA 4C3MA 4DR6F 2B3TB 3HHLA 2IJFA 3TUIC 3P6YC 2F9DA 3AXKA 2OI2A 4IJNA 2J76E 1HNXF 2W41A 2ZGZA 2RKIB 3WBZA 2VC0A 4E1MA 1U2VA 4CO5A 5C25A 4GMKA 1NSQA 4ILLA 2AJFE 3AO2A 2YX1A 4TU8A 2P6TA 4NLXA 1WF0A 1RBVA 3J80O 4EAHD 3BV8A 3ULDA 4ERDA 4ZVUB 2MB0B 5DETA 2BZ2A 1R43A 3PX0A 2P5VA 5AXMA 3PJXA 1QZ6A 5A2QO 4JI2F 1IH7A 4C8MA 2QFIA 3NGSA 4LFAK 1NDKA 1YHQS 2DCLA 2WK4A 3ZLJA 3H98A 4Q0BA 4JI8F 2J5AA 4F7VA 4KR0B 2HIQA 2CJYB 2F40A 4PG6A 2ZH2A 4GKKF 2ZGYA 3VQDA 3KHHA 3K0JA 4QIFA 3JTNA 3OYGA 2ZM6K 1Q86O 3O3FA 2ZJRL 4B9TA 1K44A 2MKYA 1T9UA 4CNYA 3MPVA 3C7NA 2MZ1A 1LV5A 2YKQA 4E1JA 2IPOB 3TAMB 4CO4A 1FA0A 4J9PA 4FWNA 3ZETA 5F3TA 3WNGA 2WBNA 4PG4A 4DPTA 3D1QA 1U4BA 1F2HA 3K2PA 1ZS6A 4DV2K 3VF4A 4ZS6A 4FXWA 3JXOA 3W61A 4B8CA 3EVMA 3IUCA 1N5TA 3TAQA 3CE8A 1BUPA 3U7JA 3HX9A 1RT7B 4LF7K 2H1YA 4RU9A 3O3HA 4DPOA 2QM1A 4OI6A 3H40A 2EI5A 3DXKB 4CIEA 3CIZA 4Q7AA 4EBDA 1VC5A 4BRGA 2A42A 4WXWA 4M3RA 4OYIA 3CC7S 2WB1D 4QAGA 3PRBA 3LZIA 3DLGA 4KTQA 4CFBA 1TL3B 2CQIA 2FZKB 2VKRA 4I2PB 1KAXA 2I8EA 5L1IA 3SZ2A 1IR1A 2JLGA 2R42A 1HWIA 3LPYA 3NF9A 2XHBA 1Q9YA 2G2YA 3VCDA 5AE2A 1OH6A 2XSJA 2XZTB 3O9TA 5EDWA 5EX3A 1Q79A 4USJC 4CWBA 1G99A 5KG4A 2EWSA 3W7BA 4LVOP 2PE8A 5D0GA 2YPYA 4DV4K 3U1MA 2DXFA 2HVZA 4PYAA 3VOVA 3HDSA 2HMIB 2O8CA 4OHVA 4DLGA 4N76A 4DX7A 1IBLK 3LALA 2FJBB 3QLHA 2OMLA 2NRHA 5IT4A 2IS3A 3WXKA 3I6PA 4EIAA 1TKZA 1FVQA 5KG3A 4OX9F 5T41A 2R3VA 1YLXA 4DFKA 1NGJA 1FDNA 4BHQA 2GELA 5T7LA 3HHNB 4FJXA 4MIWA 4NLQA 3QSYB 3MOJB 3KK1B 3H6EA 4CJSA 4A8QA 4LFAJ 4J7CA 2BX6A 2AYEA 4DR6K 1Y5IB 3W8PA 1B4SA 3E66A 2XWYA 2XNRA 4J9SA 2ZZNA 2UXDK 5JS2A 4QW9A 4OZ3A 4PXDA 5J2MA 2ZM6J 1X3NA 1SJRA 1HNXK 1Y7PA 4X66F 1WTFA 3M6VA 2YX6A 4Z4CA 4BC7A 4V19S 2UVWA 2YKMB 1RCXB 3R6LB 2HAIA 5L1KA 3JAMU 1N0UA 3NXZA 2CQ2A 3MR6A 1NGFA 2CJXB 4DV2J 3GZ7A 3FRZA 5H1SV 4B3TF 2ZZMA 2WONA 3D5MA 4FNIA 1UVLA 2OD6A 4WFNL 1AYEA 5BPLA 3HFZB 1B70B 1JLQB 1RAOA 3V1QA 5T14A 5AQJA 4H4MB 4JI8K 4F0MA 3IR7B 3BKFA 4LF7J 1CJVA 2D69A 5LJWA 4H5NA 1VDHA 4NLTA 2P9NB 2Z1HA 1CZBA 3D6TB 4B3MJ 2QA2A 4LF4F 3DKDA 4NMXA 1X9SA 2MZQA 4ILGB 4P71A 2XWXA 2AGQA 5E3CA 2GMLA 2EFPA 1XTZA 1UJ5A 3C6UA 2HBRB 4B9QA 3O9QA 3VQCA 2Z57B 3MXMA 1RA7A 4ZHRB 3G71S 4MMOA 1TKXA 1VBXA 1HQEB 1MLAA 3TANA 2AW0A 1R31A 2IVMA 2VWBA 4ZVOB 2FSJA 4MKVA 5IQ6A 3CJRA 4RWXA 2M0GB 3FZBA 2D3OR 3QWUA 4V1Ak 3OSNA 3VAJA 1NJZA 2AEMA 2E5LF 1NZ8A 2BQ3A 4NLOA 3W2WA 1X60A 1ZBUA 4ZVTB 1NK5A 5GAHI 2V69A 3L2QA 1QTMA 3ENHA 3OLAA 1H74A 3AGKA 4JD2B 2W7PA 3Q22A 2OUGA 3CCWA 3TA0A 1BISA 4JB8B 3N01A 1WBBA 4H0XB 5LJ3Y 1X4BA 2KT5A 1UW9A 2GGPB 2P9GA 4DV4J 3UB5A 3CCES 4KO0A 3ZT1A 4AQYF 3R8EA 1WSGA 3QO9A 4CH7A 5C12A 1IBLJ 3BGLA 4WF9Q 3BGOP