5CYQA

Hiv-1 reverse transcriptase complexed with 4-bromopyrazole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
548
structure length
548
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Rapid experimental SAD phasing and hot-spot identification with halogenated fragments.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 154
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5cyqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5cyqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cyqA05
2UVUA 3QIPB 4FLZA 2J6TA 1RT2B 5HP1B 4CFCA 5KGXA 1RA7A 3DLRA 3VQ6A 2AGPA 3FQLA 1S1UB 4RNHA 3AA5X 1ZTTA 3BQ1A 3ISND 2CJQA 4I7FA 3AVJA 1KVAA 2YKNB 1SKSA 2XRIA 3MEGA 4JV0A 3HVTA 2OZSA 3K5NA 4F3TA 4Q0BA 4OKEA 4DL5A 2FBXA 4URQU 1XR7A 1B9DA 1RCHA 3PV8A 3FDSA 1C0MA 4NLSA 2W9BB 4OPKA 4DF8A 2HNZB 3CDEA 1NNDA 3QESA 3G0ZA 4ZVHA 1RT6A 4RW6A 3MR2A 3KLEB 3VQSA 4DTNA 4DFJA 3SI6A 3DM2B 1BI4B 4WZMA 3OYDA 1C0UB 4AHTA 1S9GB 3VQ8A 2AWZA 4QWDA 1CLQA 3G6VA 3RMDA 1U4BA 3VA3A 3KLGA 4PWDB 2HHSA 1BQNB 4ZP6A 3OJUA 3EZ5A 4RZRA 1WSIA 4CERA 1TV6A 3WNHA 5KFEA 2GUIA 2IJFA 1ASWA 2OPSA 4TN2A 4C8MA 4M41A 4TY9A 3KOAA 3G86A 4IH5A 4W5OA 4QWAA 3KLIB 3NF7A 4BE2A 3PW0A 2D3ZA 4DQIA 4CESA 3TQ1A 3JYTA 4LQ3A 1L3TA 3GIJA 4F3OA 4FXDA 1RTJB 3ITHB 2GBZA 2YNIA 4OPJA 1IKXB 4JRPA 4RG8A 2QXFA 4CGJA 1S1TA 2YNGB 3LWLA 4FS1A 2V4RA 2HWIA 4ID1A 3F73A 1TL1B 3DDKA 3H2LA 4AH9A 4IDKA 4YR3A 1NK5A 4DTRA 3ZCMA 4B9VA 1O1WA 4J9SA 1X9MA 4H4OB 4FBTA 1RT5B 1JLFB 2RDIA 3I8DA 2W7OA 1HNIA 4CGIA 2OPQA 1YT3A 4IOBA 4DSIA 2WONA 3DRPB 3LP1A 1BL3A 1VK0A 4K4UA 1NK4A 1BIUA 4J2BA 5C25B 1S1WA 3MXMA 4EYHB 3BQ2A 5KFQA 4G1QA 4M3RA 3NKYA 3V9WA 4U7CA 3RTVA 2XHBA 3HL8A 3UR0A 2YNHA 4ZPCA 1JXEA 3RWUA 3ZT3A 3HO1A 4B3OA 4DS4A 3DLEA 4EO6A 3CG7A 4ECSA 3E01B 1S0NA 5K14B 1KFDA 1GOCA 3V6JA 2IM1A 1SUQB 5KG4A 3RB3A 5KRTA 2DFFA 1UWBA 4KB1A 4FK0A 3K2PA 3SUQA 3NBPB 4FLWA 3NMAA 4O44A 3AVIA 1SH2A 3RAXA 4KFBA 4LSLA 3BJYA 4CJEA 1IKVA 3HKWA 1WNSA 2VG6B 2C28A 3DOKB 4DG1A 2GIRA 4GMJB 2XI2A 4CIGA 2D7SA 4I2QA 4MFBB 5F8JA 4U6PA 4ZPDA 2UUTA 5J1EA 3DYAA 1SL0A 3IG1A 3NGYA 3OYJA 5KFNA 3V4IA 3DOLB 3MTKA 2HNYB 2HHXA 3GIMA 4J9KA 1NOZA 1QE1B 1T03B 3JSMB 1LW0A 1NK7A 3QEIA 4DLGA 4PUOA 4EP5A 3HSTB 3KLFB 4FM0A 4FJIA 5KFKA 4RW4B 4TQSA 4CIEA 3OHAA 3OLAA 3EYZA 4NLRA 3DRRA 4XPEA 4KHQA 3MR3A 1D8YA 1VSKA 2B5JB 1JL2A 3D5MA 3PW5A 3MEEA 2RKIB 3T5HA 3OYAA 1T05B 5EDWA 1HNVA 2WOMB 4BWJA 4IG0A 4E89A 5KG7A 1NJZA 1W25A 4ELTA 2UUWA 1RDDA 5J2NA 4K4TA 5JS2A 1S49A 3LPTA 2HB5A 1TKXA 4EP4A 4Z4FA 3BDPA 3N6MA 2YHAA 2DFEA 1C0TB 2ASLA 4CEFA 5HBMA 1JLEA 3FFIA 3OS2A 4KREA 3CVKA 4IR9A 5C5JA 1RTHB 4O3QA 4C8NA 2KFZA 2E9RX 4ZPBA 4K4WA 1Z4UA 2E9ZA 1D9FA 4DSJA 3CJ0A 3CDUA 1WN7A 4URSA 1TKTB 3KLHB 3RB0A 1FK9A 5DLFA 4FCYA 2F96A 3SI8A 3U3GA 1XHXA 5KFGA 5FRNA 1QS4A 1I39A 2RF2B 4KI6A 1LWCB 4IFVA 3ISNC 4K4XA 3V1OA 3FRZA 2E6LA 5EUHA 3SZ2A 2FVSA 3TAEA 1S6QA 4H4MA 4MK7A 1BCOA 4L8RB 5F9LA 2GV9A 2EX3A 2OA8A 4I7FB 1ITGA 1LAVA 1NKEA 3G6XA 3MEGB 3TVKA 4XIUA 2G8FA 5KT4A 3H08A 3SNNA 4DTMA 4Q0BB 4J9LA 4WE1A 3PX4A 3V9ZA 3VQ5A 1EX4A 3ZSOA 4J9MA 1FKOB 1MU2A 4CF9A 1K6YA 3BQ0A 4Q8EA 3CWJA 1JX4A 2JGUA 4K4ZA 1TL3A 4DQSA 3BR9A 4RW6B 4E7LA 3SUOA 2G8IA 1ZETA 3M8QA 4CEZA 3KKSA 1IM4A 2X78A 3RBDA 4JS4A 3LAMA 1KFSA 1A5XA 3KLGB 4YFUA 5KG0A 4ID5A 5CYQA 3V9XA 3MFIA 5KFBA 1F21A 4KPYA 1NJYA 3AVNA 4KHUA 1HQUA 4FVMA 2OPSB 3SUPA 3I0SA 1OS5A 4LH5A 2FLNA 3I5CA 1JLBA 4HTUA 4DTUA 4FJGA 5HLFB 2XC9A 1WSFA 4JLHA 3HJFA 1BGXT 4HUGA 1FXXA 3FQKA 4WFYA 2FJXA 3T5LA 4GW6A 5DQIA 4M3YA 4DWIA 3I0RB 3H98A 4RW8A 4DU4A 1X9WA 3M9MB 2A1SA 3ZT4A 4Q5VA 4NLYA 4NLUA 1S1TB 3C95A 1RAJA 3OYFA 4B9MA 3CJ3A 4ECXA 4DL7A 4BDZA 1RDBA 1S0MA 4IDKB 1HYSB 2JEGA 1N6QA 4CHNA 1C1CA 4J9OA 3OYHA 4DL3A 3Q8RB 3K5MA 3QIDA 3SYZA 1JLGB 2OH2A 3OS1A 3UQSA 3AA3A 4EBDA 2PY5A 1B9FA 1VRUA 1HNIB 1GX6A 5DLGA 4WXWA 4ECWA 3AVCA 2EHGA 3OSPA 3SV3A 2BDPA 1I3AA 3SV4A 3QEPA 1S1WB 1REVA 4ECQA 3AA4A 1TK0A 1XR6A 4IFYA 4ICLA 2X6SA 2JLEA 1LWFA 2YNHB 4Z0UA 5HRPA 3IS9A 4O3RA 2W9AA 4OL8A 3OYIA 4CGFA 2PZSA 2FC0A 4KO0A 4Y2CA 3LP2A 1VSHA 4NLGA 1UWBB 4IQXA 4ECUA 3CM5A 3OYMA 3MECA 1KRPA 4O44B 1B92A 3NAIA 4KFBB 3SJJA 4AHRA 1IKVB 4K50A 4TY8A 5KG3A 3ZSWA 4M3WA 4DG1B 2FVQA 3UPFA 1CZBA 2V9WA 2KFNA 4I2QB 4ZVFA 3KK2A 1T94A 4IKFA 1MMLA 4R5PB 4GVMA 2I5JA 4QOZB 4DFKA 5KT6A 3DYAB 3IG1B 3TAMA 2IM2A 2F8EX 3V4IB 4PY5A 3C6TA 5DG9A 3ALYA 3PJXA 1JXBA 4FBUA 4LD0A 2IC3A 1NJWA 3NF8A 4O5BA 3KIOA 3TANA 1N5YB 3ZT1A 4CJQA 4FZYA 5L1IA 5KFSA 3G6YA 2IOCA 3U6FA 1DTTA 4CJUA 4FS2A 3M8PA 2IAJA 4W5TA 1SKRA 3H4DA 3KHGA 1N4LA 4NCGA 5DG8A 4Q44A 3GQCA 4TLRA 4KHWA 2ZKUA 2KQ2A 3AVLA 3DRSA 3EPIA 2OPRA 3DRRB 2P51A 4FZZA 1L5UA 4K4VA 4O4GA 2BE2B 2WHOA 3MF5A 3TAGA 3GYNA 4GC6A 4NZ0A 3MEEB 3Q8SB 5EU7A 1D5AA 2W8LA 1LW2A 1T7PA 2HMIA 4IG0B 1KLMA 3V6DA 2D41A 3ZSYA 4N76A 4Y2AA 3BSOA 4F4YA 1WSJA 1DLOB 5J2NB 2XY6A 3CFPA 1ASUA 1HQEB 4TYAA 5KT7A 1HPZA 3GIKA 3NAEA 4TQRA 5KFHA 4NLPA 1TKXB 1Q8IA 4HCCA 3AO4A 1XWLA 3KK1A 4M42A 2D0CA 3PO4A 1RNHA 3FFIB 4AHCA 3AVGA 2W9CB 1S4FA 4PA1A 3VQ9A 2WRMA 5J2MA 2B6AA 4DU3A 1C1BB 3M8RA 5FDLA 4XO0A 4NLWA 2HHWA 4Q45A 2W42A 2ATQA 4KTZA 1TKZA 4CJFA 2X6NA 2ETJA 3OYKA 3GV8B 4KTWA 4LQ9A 4CEDA 1JL1A 1JLCA 5I42B 5KTQA 1S6QB 3E51A 1XR5A 2AJQA 1IKYA 2HW3A 2OPPA 4R8UA 1RTIB 5DGAA 2ASDA 2RPIA 2FJWA 5DMRA 4DL4A 2J6SA 4KHMA 4QW9A 3NGZA 2HHVA 2QKBA 3DI6A 4DTSA 3QZ8A 1VSMA 4M3TA 3OYCA 2YKMA 2XY5A 3SQ1A 5KFLA 4KHRA 5L9XA 3CJ5A 1RT3A 4RUCA 3CFRA 1S0OA 3TAQA 1MU2B 1ZBHA 5KFVA 1TAUA 2ZD1A 5L1KA 2X74A 1EETB 4X2BA 4DTOA 1HARA 1TL3B 4OGEA 4CFDA 4CE9A 3RMAA 5J2PA 3AVMA 4DQPA 3M8QB 4FK2A 4Z4IA 4RW7A 2IJNA 3QEWA 1KHWA 3UIQA 1I6JA 4ZP7A 1BQMA 1VSJA 5SWMA 4RNMA 4ID5B 2NUBA 3NHGA 4Q8FA 3KHHA 4F2RA 5HRSA 3ZT2A 2XY7A 1CSJA 2UVVA 1HQUB 2LSNA 2G8WA 1JXLA 4EBEA 3NCIA 4HVJA 2RDJA 5HROA 3I0SB 2IDOA 3M9NB 3HVAA 4DQQA 1D1UA 2C2DA 4DFMA 4CEBA 5CZ1A 5DG7A 2BR0A 3DLGB 1IKWA 4RW8B 2YHBA 2BQRA 3PZPA 4BDYA 3AVAA 3IGNA 4I2PB 1C1AA 4LSNB 3HVWA 4CJRA 3BGRB 2HNDA 1N6QB 5CYMA 5C42A 3T3FA 4JUZA 1RDCA 2VG7B 1VSLA 3QLHB 3BSAA 3SCXA 1VRUB 2IM3A 2GC8A 2FBVA 1C2PA 1L3VA 3RB6A 2VA2A 3CDWA 3MXJA 4HUEA 4ZHRA 5DQHA 3OHBA 1REVB 3KJVA 2ILZA 4CHOA 2QE5A 4FLVA 4OGCA 1JLQB 2R2SA 4ICLB 3O3HA 2YNFA 4FZXC 3IS9B 4Y34A 4EYIB 3TAPA 4O0JA 1J5OA 4ED6A 4MH8A 3AVFA 3LP2B 3IGVA 4F8RA 4WXOA 1S9EA 3ZSZA 3VQQA 4ZVEA 3MEDB 5HRNA 3GV7B 2E4LA 4OKJA 3QERA 2FVPA 3ZSXA 4KHYA 2G8HA 4RNNA 3Q8QB 3IAYA 3O3FA 3OL7A 4E7HA 4FJMA 1RT2A 3KK2B 5HP1A 3VN5A 1KVBA 2R8IA 2JEIA 4CGGA 1XHZA 1S1UA 1S6PB 1J54A 1A5VA 1SKWA 3TARA 3ZT0A 5F8HA 1U04A 4DLEA 4ECVA 2YKNA 3C6TB 4EO8A 2B4JA 5KFRA 2IA6A 3K5LA 3OL9A 4CJSA 2IC3B 2BANA 4B9LA 3PY8A 4O4RA 3RMCA 4KTQA 4F4KA 3QEVA 1QAIA 2R2RA 4J9NA 4QW8A 4IG3B 2V0NA 5KG2A 4CEAA 4BDPA 3N6NA 3HHKA 3HYFA 1RTDA 5CZ2A 1S10A 2P5OA 3IN5A 4CJ3A 4CF0A 2G8UA 3AVKA 3BREA 1RBRA 5KFTA 4NCGB 4M95A 4N56A 3EY1A 3TAFA 2JC1A 5KFJA 2J6UA 1ZBFA 4IRCA 3DRSB 4YR2A 4WYWA 5EWGA 3HK2A 4QWEA 4IR1A 2ZE2A 3MR5A 1BCMA 1C0UA 1TP7A 3MAQA 1TGOA 3WNGA 2R8GA 3V9SA 4PWDA 4E7JA 1BQNA 2XI3A 4RUAA 3L2WA 2KZMA 4MK8A 4JV2A 5F8LA 3DLHA 1XI1A 1YTAA 4AHUA 2HMIB 4I9QA 1KLMB 3V6DB 3HVTB 4CHPA 5KI6A 1RBSA 3CIZA 4O3NA 3TI0A 3KHLA 4DTXA 1RBVA 4CJWA 2DPJA 1HPZB 2AX1A 3D0PA 4ZP9A 1RYRA 4KRFA 3KD5E 3Q8PB 4OKKA 4FW2A 2VG5A 4DS5A 3KK1B 3L8BA 3HVRA 1K1QA 1RT6B 2HHUA 3HPOA 5J2MB 3CJ2A 2YNGA 2B6AB 3RR8A 4NRTA 4OLBA 4CHZA 5FDLB 1SH3A 4B08A 3K58A 3WNFA 1WSEA 4ED8A 1RT5A 1BHLA 1TKZB 1W0HA 3UDLA 1YVFA 1TV6B 4ZP8A 2XGQA 4FYDA 3SQ2A 4XPCA 4F4WA 3KKRA 4ZPAA 4KAIA 1A5WA 3S3OA 2V4QA 4NLQA 4RU9A 3SFUA 3PW7A 1JLCB 4CJ4A 3SUNA 1RDRA 1S5JA 2HVIA 2WCXA 4URGA 5J2QA 1IKYB 3JYTB 3QO9A 3RB4A 4Z4CA 1UA1A 1N48A 4RW9A 2OPPB 4R8UB 4OLAA 2HHQA 2YNIB 3VQPA 2P5GA 1S48A 4CJTA 3QIOA 3SQ4A 4JS5A 2DFHA 3NBPA 4LY7A 1RT3B 2F8SA 3V81A 3TABA 2ZD1B 3B6PA 2PYLA 1RT1A 4BACA 4B8AB 3VQ4A 2E9TA 2VG6A 1R0AA 3N6LA 3QEXA 3GV5B 3SFGA 3O3GA 5J2PB 3T1AA 3H40A 2UVRA 2OPQB 4R0EA 4CJKA 1D0EA 4RW7B 1RA6A 2WONB 3LP1B 1TVRA 3PR4A 3LALA 1BQMB 4G1QB 3S3NA 3LP0A 3KK3A 1RILA 1VSDA 1JLAA 2Y1IA 3DOLA 2FLPA 5E41A 2R2UA 4IH6A 3ZSQA 3M9OB 1IO2A 1QE1A 3RRHA 1T03A 4B3OB 4BWMA 4IRDA 3DLEB 3HP9A 4J9RA 5HROB 4EZ9A 1TQLA 1G15A 1VRTA 4DFPA 4DF4A 1RBTA 3QNOA 4O3OA 5T14A 5KG1A 4C8OA 4H8KA 3KLVA 4RW4A 4B8CA 2D0BA 4ELUA 1IKWB 1WAJA 4LSLB 1ZYQA 4KI4A 1L3SA 2FJVA 2HWHA 5KT3A 3AVBA 4KKOA 2B5JA 2HVHA 5KFWA 2IBKA 2HNDB 1SL1A 3K59A 5J1EB 5KFOA 5C42B 4GC7A 4ECTA 2WOMA 3AA2A 3F9KA 3CM6A 4CJPA 1NHVA 3LDSA 2IGIA 1EXQA 1LW0B 1KHVA 2JEFA 1GOAA 4ZHRB 4PUOB 1T8EA 3D45A 1X1PA 3P83D 2G8VA 1X9SA 2YNFB 1DTQA 5DQGA 3L2RA 1CXQA 4E19A 1C0TA 4KB7A 1QSSA 3RBEA 3MXIA 3EZUA 3CFOA 2D5RA 2Q3SA 5FROA 1S9EB 5F8GA 3I5BA 4FJXA 4W5QA 3V6KA 4N5SA 1WNEA 3OS0A 2O4IA 3V6HA 1WAFA 1NJXA 1RBUA 2BQ3A 4TYBA 4PQUA 1TKTA 4B9SA 3QZ7A 3VQCA 1HNVB 1TK5A 3LZIA 5C24A 2I1RA 1S97A 2RF2A 1LWCA 3GIIA 3G10A 1ZBUA 3L2QA 3DMJA 4NLOA 3D28A 3ZSRA 4ECYA 4Y1CA 5FRMA 4DL2A 3LP3A 4KB0A 4BE1A 2QV6A 1UAXA 4FK4A 3KMSA 4NCBA 2XWYA 2O5DA 4CIFA 5I3UA 5HBMB 1JLEB 2FBYA 4FJNA 2VA3A 4CGDA 2BANB 2Z1GA 4ZTJA 4F4XA 3SPZA 3KTQA 4ED3A 2R8JA 2AX0A 1RTDB 4QAGA 1L3UA 1FKOA 5F8MA 4O3PA 2AU0A 4FJ7A 4Z4GA 4HUFA 2Z1IA 4NLVA 1FK9B 3B6OA 4IBNA 4M3XA 4FJKA 2ZE2B 4JV1A 2OYQA 4IFVB 2XO7A 3OJSA 3H4BA 1KLNA 4K4SA 4H4MB 1Y97A 3OSNA 5CY4A 5KG5A 4MK9A 1GX5A 1U48A 3L3UA 4M3UA 4G3IA 4E3SA 1WLJA 3CO9A 3BSNA 4NRUA 2D0AA 1QSYA 3RAQA 4WE1B 1QQCA 3PVXA 3PW4A 3C94A 5KGWA 4CF2A 1YTUA 4HKQA 5HLFA 1W9HA 3V1RA 1Q9YA 3IRXA 3P5JA 1RDAA 4CJVA 4YNQA 1NKBA 4FJLA 4CEOA 1KTQA 1FKPA 1XC9A 4KV8A 3I0RA 2VG5B 1S1XA 1SV5A 5F8NA 4DSEA 3VQAA 4ZTFA 2VWJA 3VQ7A 2A1RA 5T7BA 5KFUA 3HPGA 1HYSA 4W5NA 3NAHA 5KFFA 4C8KA 3DLBA 1ZBIA 4ED1A 4FJ8A 1RT4A 4DQRA 5D3GA 3KHRA 1JLGA 3EPGA 1TAQA 5CYQB 3OVNA 4J9PA 2ZQBA 3NF9A 3NH1A 3K57A 2OZMA 3GILA 4FJHA 2DTUA 3OL6A 1TKDA 4CEEA 3RMBA 4AHSA 4IKAA 5KT2A 2XY8A 2AGOA 3P1GA 1YVUA 2O4GA 1NHUA 1JLBB 4YQWA 3NH0A 1K1SA 3ZSVA 5F8IA 1NKCA 3VQBA 2C2RA 1LAWA 4M3ZA 1Z25A 5J2QB 1S1VA 1U49A 3QO9B 1KCFA 3PX0A 4RNOA 4RW9B 1T3NA 4E0DA 1GOBA 3OYBA 5KFZA 1NK9A 2R2TA 1BIZA 2XCAA 2KZZA 2BRKA 1WSGA 3C6UA 4HHTA 2QK9A 3V81B 1C1CB 1JKHA 5KG6A 4BE0A 1HMVA 4N47A 4F50A 3NL0A 1RT1B 4CGHA 3LANA 3DLKA 2C2EA 3THVA 1LV5A 4ZMMA 1R0AB 4FLYA 3MR6A 2FBTA 4I9LA 5HRRA 4B9TA 5DK5A 1J9AA 3HM9A 2R8KA 2C22A 3LZJA 1NK8A 1RYSA 3ASMA 4R5PA 1NK0A 2PYJA 1TVRB 3VQDA 1Q9XA 3PJWA 1RT7A 3LP0B 3KK3B 3L3VA 2QKKA 2BRLA 1JLAB 4WZQA 2FLLA 2UVWA 3LPUA 4IFYB 1JIHA 1LWFB 3U3YA 3QGIA 1EP4A 3FSIA 3T5KA 3O4QA 4KO0B 4LH4A 4FLUA 4FW1A 1N5YA 2F8TA 1BISA 4QCLA 2W8KA 4EBCA 1LWEA 4IH7A 1VRTB 3TWHA 4B9UA 4CK1A 4M94A 3MECB 1QTMA 1KVCA 4OJRA 1NK6A 2W7PA 4ED2A 4YP3A 4TY8B 4J2EA 4MIAA 3MFHA 2R8HA 4KKOB 5EWFA 4DTPA 4FLXA 3QIPA 2BE2A 4CHYA 3NE6A 3OYNA 2JC0A 2I5JB 3NF6A 1QSLA 3AO3A 4ED7A 5KRSA 3TAMB 4CK2A 2FVRA 5KFYA 1VSIA 4FJ5A 2HHTA 2KTQA 4DTJA 1DLOA 4FLTA 1HJRA 1HQEA 2RN2A 4DSFA 1DTTB 4NYFA 3M8PB 2IAJB 4DSKA 1DTQB 3AVHA 3H5YA 5KFMA 2W9BA 3RR7A 2HNZA 2XGPA 4NYNA 2WK4A 2W9CA 3KLEA 1J53A 2OPRB 3DM2A 3S3MA 4KSEB 1C1BA 1BI4A 3H59A 1NOYA 4O4GB 4OVLA 1S9GA 4F4ZA 1UOCA 4O3SA 4W5RA 2AGQA 2R7YA 4PQUB 4KHSA 1LW2B 1TK8A 3NH2A 4WFZA 2EC0A 4QWBA 3I5AA 5C24B 2BQUA 3HP6A 4Z4EA 3SQ0A 2IMWP 4C8LA 1N56A 3DMJB 4DMNA 4E7KA 5I42A 4E1NA 4JRQA 3KLIA 5KT5A 4O0IA 4B9NA 2JEJA 3K5OA 3PUFA 5KFPA 2Z1JA 3QYYA 3CQ8A 3PHEA 3RRGA 1QHTA 3OY9A 2DPIA 3CJ4A 5I3UB 1RTJA 1RTIA 5DGBA 1ZBLA 3ITHA 2Y1JA 4DL6A 4UQGA 1IKXA 2XCPA 4N41A 3PO5A 5JUMA 1TL1A 1WSHA 4CJLA 4Q43A 2B43A 3LAKA 4MKAA 1VSFA 4DEZA 3KNAA 1EETA 3M8SA 4QWCA 4M45A 4TXSA 4H4OA 4K4YA 2D3UA 1JLFA 4AILC 1IG9A 5EWEA 1S9FA 4J9QA 3DRPA 2KW4A 3HXMA 2E6MA 3AO5A 2DY4A 4CJ5A 5C25A 1QUVA 1Z26A 3QGHA 4O55A 4MQ3A 4CEQA 2YV0X 2GIQA 1CZ9A 1U09A 4ECRA 4FM1A 3O4NA 4KBIA 4YMEA 3E01A 4J2DA 5K14A 1SUQA 4MIBA 3DI6B 5L1JA 4YR0A 2ATLA 3ICLA 4RNFA 5KFXA 1HRHA 2YKMB 4NCAA 4FM2A 3IRXB 1ZTWA 3T19A 5JXSA 3VA0A 4F2SA 3OYGA 1SH0A 1FKPB 2CKWA 4KV8B 3DLGA 1S1XB 1SV5B 2WTFA 4IRKA 3V1QA 3OLBA 3DOKA 4CK3A 3QGGA 2IM0A 4K8XA 4QPXA 2FVCA 4CFAA 1U47A 4MFBA 2IS3A 4I2PA 4MKBA 4DSLA 4LSNA 3BGRA 3H5UA 3SPYA 4CECA 1RT4B 5D3GB 4E7IA 2VG7A 1QAJA 3QLHA 4WFXA 2HNYA 4TSXA 3T5JA 4HCBA 4CFBA 5KFCA 3V9UA 3VQEA 3JSMA 4ED0A 3HT3A 4CF8A 3WNEA 5JS1A 4NYZA 4FJ9A 2VWKA 5F9NA 4ZVGA 2HAIA 3HPHA 3NGIA 1JLQA 3CYMA 1KSPA 1S1VB 3KLFA 3L2UA 3OYEA 4KE5A 3ULDA 4AHVA 3AO1A 4EZ6A 4NLDA 1HYVA 1C6VA 3BSCA 3QETA 5KFAA 2ALZA 1ASVA 3KMQA 4Y3CA 5KFIA 3MEDA 3H5XA 1VSEA 3C6UB 3AO2A 2ASJA 2G8KA 4DU1A 4EEYA 1JKHB 4ELVA 4E1MA 2P1JA 3LWMA 2RKIA 1HMVB 1U45A 5CYMB 1HYZA 5SZTA 3DLKB 1D9DA 4FJJA 1T05A 2WB4A 3QINA 3QNNA 1UA0A 3H5SA 5L1LA 4CCHA 2BGGA 1IH7A 3PR5B 3NGDA 4HYKA 4ECZA 1S6PA 3KJVB 3OL8A 1RT7B 3TR8A 5KFDA 4J2AA 4CHQA 4K8ZA 1EKEA 4Z4HA 1EP4B 4WYLA 2ILYA 1J5OB 3A2FA 2ITGA 3KD1E 1CXUA 1RTHA 4IG3A 1LWEB 1SL2A 3NFAA 4NLXA 4KHNA 3L2VA 2AQ4A 4CF1A 4Y1DA 4H54A 3PX6A 2Z1HA 3KLHA 3AV9A 3OYLA 3S9HA 3PW2A 4NLTA 4KAZA 3NDKA
chains in the Genus database with same CATH superfamily
2UVUA 3MX5A 3ISZA 4CFCA 5KGXA 5A0YB 4QIEA 3FQLA 3S41A 3AA5X 1ZTTA 3BQ1A 3ISND 1MSWD 2I9SA 4I7FA 4MAKA 1SKSA 3GYXB 2CQGA 3HVTA 3C0BA 3FBCA 3A8IA 4DL5A 2FBXA 1KWMA 3C14B 3QSYB 1XR7A 1QQOA 2RS8A 1RCHA 3FVYA 3FDSA 4K5SA 3HZEA 1BC6A 4RPFA 1NNDA 3CXCM 3QESA 4JKDA 3VQTA 1RT6A 4BC5A 5AQQA 4NMXA 4DX7A 2RJZA 2ZWPA 1KVIA 1C0UB 4AHTA 4XH1A 4QWDA 3G6VA 3RMDA 3H1VX 5CAAA 3VA3A 2P9SB 4TLQA 5LL6Z 4J9UE 1BQNB 3W65A 3OR1B 1U1NA 2VQFF 1WC6A 4B3MF 2NPIA 4K7QA 3DOMA 3O9SA 4USJC 5A8WB 2UV8G 3THXA 2QTDA 3E2EA 1VIXA 3GFHA 4DV6K 2UUCF 3KLIB 2K2PA 2P9NB 3PYDA 4DQIA 1UFWA 3QSIA 3B4MA 2VH7A 1FXDA 4DV7K 4DUZF 2RU3A 4LF6K 3KJQB 4ZCMA 4ZITA 2NRVA 2GBZA 2NXNA 3SXLA 2O8BB 5F3ZA 1NWKA 4CGJA 4DU7A 3POTA 2YNGB 3LWLA 4FS1A 4ID1A 1TL7B 3F73A 4OLOA 2IYIA 3I56N 4DTRA 2LDIA 5DDOC 1HFEL 4NA2A 2HFUA 4H4OB 1RT5B 3DLJA 3GWCA 3CCSS 4CGIA 2VOPA 1YT3A 4IOBA 4F26A 4JV5J 2WONA 1VK0A 3BKUA 5GAEI 2QC3A 4S0MA 5KFQA 4G1QA 2ZBIA 3L0QA 3NKYA 1IBMK 3NLCA 3HL8A 4L75A 2YX7A 4ZPCA 1Z2ZA 3VF4A 3ZT3A 1DJ0A 1JK9B 4B3OA 1TR0A 2I0XA 5H1SV 5K14B 3V6JA 3KJFB 3AFGA 3RB3A 4LF5K 5IZHA 1UWBA 1RCXB 3IBCB 4FK0A 2LXFA 2CG4A 3C66A 4K2XA 4FF4A 4BGBA 4GKKK 3CCUS 4O44A 1E4FT 3P38A 2ABYA 3CJRA 3O1BA 4USVA 1KEKA 2LU2A 5HMWA 4U9RA 5D4PA 2XI2A 2D7SA 5DZ6A 2YJFA 1A6LA 4U6PA 1VC6A 3SAGA 2CQ0A 2IYGA 3ZTQA 5J1EA 5EVZA 3NGYA 1GMVA 1SJ1A 3V4IA 5I4MA 3MTKA 4BR7A 3AXKA 2HNYB 3QJJA 3VOVA 1M5SA 2GVZB 4J9KA 4FPRA 4PYDA 3TA2A 5D4OA 3KYLA 1QE1B 1KTVA 1NK7A 2A40A 4CW7B 3D7SB 2IPOB 2MKYA 3U1LA 4YOTA 1R7IA 4X84A 1YJTA 2C1EB 4YB5A 4IEEA 5LMUJ 1Y0HA 4DPOA 5AT1B 4RW4B 2EFOA 1KR4A 2B5JB 1K47A 2V63A 4RWXA 1VLYA 4UUXA 1EARA 3PHTA 4C6AA 2Q36A 2RKIB 3T5HA 4M7XA 2VGMA 1T05B 5ETLA 5BYSA 2WOMB 3OR2B 2P9IB 2ZHOA 4JI2F 5KG7A 1HX1A 1H6KX 5AZIB 3ZETA 1RDDA 2HBRB 5J2NA 1MN9A 5JS2A 1P27B 1TKXA 4WQ4A 4EP4A 1NNEA 1IQTA 5BPLA 4PXEA 4RUBA 1C0TB 2DNKA 3D7EO 1CJUB 1V9OA 1WC5A 1CQNA 4KREA 3CVKA 2A6OA 1HWLA 5C5JA 3NXZA 2GHWA 2KFZA 3QWUA 2HIQA 5IM0B 4DSJA 3CDUA 4DR6J 2ACYA 1DQAA 2FYXA 3KLHB 5AR0A 2F96A 3SI8A 5KFGA 4B02A 5DDRC 2VJUA 2BBEA 1LWCB 1V6HA 1AFJA 3JQMA 4AQYK 1Y3KA 3EGZA 2LQ9A 4GVBA 1U1MA 5EUHA 1SQGA 2UXBF 2FVSA 2OI2A 2Y8YA 1B99A 2O67A 5F9LA 3AODA 1LAVA 2K7JA 3MEGB 2RQCA 4XIUA 5KT4A 4B3SF 4DTMA 1FFGB 4GV6A 3AQOA 1FWLA 4J9LA 1YJRA 2BEFA 4PG5A 3PRVA 1RFQA 1WDTA 2UXCK 1R31A 4P7VA 5BXIA 1K6YA 1KDNA 4Q8EA 2JGUA 4DR1J 3HI9A 3SUOA 4GKJF 1IWGA 3AB4B 2IVYA 4JI0F 3KLGB 1JCGA 3R3LA 1IBKK 1NJYA 3J81Y 3AVNA 4FVMA 4QS8A 1OS5A 2AP6A 4LH5A 3I5CA 1JLBA 4HTUA 4F02A 2I7NA 4Y2IA 1BGXT 3HJFA 2OTJS 4HUGA 1FXXA 3WT0A 3SBMA 4DKWA 3H98A 4RW8A 4DU4A 1CQMA 2LQJA 3M9MB 3EGWB 2ZFHA 4Q5VA 4NLYA 4NLUA 1S1TB 3C95A 5ELZA 1RAJA 3CJ3A 3B4DA 4ECXA 5BYRA 2BKOA 4BDZA 1RDBA 2CPFA 3UVJA 5FD1A 4PRFA 2CNNB 2JEGA 2A5XA 4CHNA 4J9OA 3OYHA 1JJ2M 2JLFA 3T7ZA 1VQLN 1JLGB 2P9LA 4I6WA 3W8PA 3CC2N 1B9FA 4U67Q 3QWPA 2VWBA 2DNHA 4NMLA 1ZBSA 4CYUA 3SV4A 3QEPA 1ATNA 2EFNA 1S1WB 5EXWA 3AA4A 4IFYA 2YNHB 5HRPA 4X4VA 4O8UA 2I2YA 2W9AA 4RKUC 3OYIA 4M8LA 4CGFA 4XH4A 3NRBA 4KO0A 1HHQA 3SBTA 4NLGA 2V67A 1OYDA 1VQNN 2MQPA 2NUUG 2MLYA 1YKWA 3CCMN 3G87A 4JKCA 1FTCA 1UL3A 1B92A 3GG4A 3HRGA 4AHRA 1CJKA 1U0HA 4K50A 3VGKA 3MZIA 5DDPC 2UZAA 2FVQA 1X4AA 3ILIA 1CZBA 1WC3A 1KQGB 4ZVFA 4IXCA 4R5PB 4GVMA 4DR2F 4MMOA 5KT6A 2FD2A 3P5BP 5AQPA 4PG7A 4PY5A 3C6TA 3C16A 1U1PA 2XSJA 4ZJOA 1JXBA 2IC3A 4O5BA 4CJQA 1JWWA 4IEIA 5HJXA 4NZ6A 4ANCA 3D3BJ 1NXIA 3DDIA 3I55N 3VZIA 1SJFA 2YCHA 4NCGA 4Q44A 3GQCA 5DDQC 2ZKUA 2YHYA 5LXYA 2GUPA 3QMQA 2HVDA 2WVFA 4FZZA 4Y0WA 4O4GA 4JK9A 4XH5A 4LRFA 3M1VA 4CO4A 2V7YA 4AM7A 3QB0A 3QBCA 4F9OA 1RADB 5EU7A 2KU7A 3DRYA 3ZX3A 4U95A 5LJWA 3MMCA 4IG0B 2MLXA 2D41A 1GEHA 1YBTA 4HI1A 4F3MA 3NY0A 3GIKA 3BR8A 1PC5A 3D3CJ 4OJGA 1MLAA 4HCCA 2HZCA 1FNOA 4M42A 3D0GE 4ERDA 4EK2A 2ASYA 1RNHA 2RHSB 1FA0A 2HK2A 2WRMA 2WAQD 4OYIA 1QUPA 2HBMA 2E5IA 4F0MA 3F5TA 4NLWA 1VQ9N 2I38A 2HHWA 5M2PA 4Q45A 2NYIA 1N32J 1KBRA 1NSAA 2ETJA 1XNQK 4KTWA 2WSCC 3W2VA 4RBVA 4CEDA 3UD5A 2OD6A 2CQ3A 2FZGB 2RIJA 1JL1A 3AQPA 2R4FA 1ZOTA 3CD5A 1RACB 1PAEX 4NYOA 2AJQA 2ZHAA 2HW3A 4HDHA 4K25A 2OPPA 2CVEA 5M1KA 2OELA 4DL4A 4QW9A 3N0VA 3NGZA 2HHVA 2QKBA 2OEJA 3CJ9A 1M5KC 4EUVA 2YKMA 1PYSB 2FZKB 5C2DA 3KVGA 2ZITA 4RUCA 3CFRA 1ZBHA 3DDNA 1NGBA 4WK3A 5EN1A 1U2RA 4CFDA 2Q66A 3RMAA 4OYZA 5CCMA 5J2PA 2KL8A 2MTLA 1CVJA 2W6KA 1RZMA 3L95X 3QEWA 1I6JA 4ZP7A 2H4YB 2J7UA 1C4CA 3WZ0A 1WELA 3M5RA 1PBUA 2XY7A 3CXCR 1HNXK 2UVVA 1HQUB 3UCUP 1GMWA 3W3DA 3ZTRA 3JSRA 3D2FB 1NJIT 2IDOA 3I0SB 1B0VA 3EZOA 2ROGA 4LIWA 1NDLA 4CEBA 5CZ1A 4CD1A 5DG7A 2BR0A 3N4QA 4PQAA 4X65F 1HR0F 1HI1A 2LQ8A 2O8FA 1M5VC 3JTNA 3D66A 2ADCA 3BGRB 2HNDA 1N6QB 2AJ4A 3UKUB 4M5DB 3T3FA 3MURP 1URRA 1Y4ZB 3TZXA 3UI3A 2MQQA 5A6PA 4Q7AA 3BV8A 3ZZZA 1K8AO 3WXKA 3CB4A 4GKJJ 2NRTA 5IFMA 4HUEA 4ZHRA 4FKYA 3CMQA 3QRQA 4CHOA 4JI0J 5B0CA 4KHPK 3O3HA 3TJ8A 4FZXC 3R2CJ 3IS9B 1J5OA 4ED6A 3OW2M 3AVFA 4NXMF 2ZH9A 3WXLA 1S9EA 3I31A 3JAMO 3ZSZA 5SUHA 2DHHA 3MUVP 4GVEA 5HRNA 3GV7B 1GLBG 2FVPA 4FF3A 2G8HA 3L09A 2VYPA 2RE2A 3O3FA 3OL7A 3H3NO 4FJMA 3ULHA 3VN5A 1KVBA 3JTPA 3PLAA 3FZHA 2JEIA 4MLEA 1A0OB 1S6PB 1RHKB 1J54A 1SKWA 3TARA 2CDRB 2E20A 2NLXA 3UW1A 5DM6L 1AZSA 4EO8A 1PYOB 2B4JA 1EB0A 3M2RA 1EAYC 3AJDA 1YRTA 4Q2LA 2HRTA 2E66A 3ZZUA 2DIVA 2BANA 3GL1A 3C14A 1QAIA 2R2RA 1NMDA 1N33J 1N52B 2RT3A 2B9EA 4DV0K 4CJ3A 1NB7A 3AVKA 3TAFA 3KUEA 3HK2A 3VGTA 2HS0A 3R8YA 2WBNA 5IV4A 2VC1A 4OX6A 2W2QP 3MR5A 1C0UA 2KRBA 2CPJA 2ZH5A 1QAXA 2HBZB 2R8GA 1QLNA 4LFBF 1BQNA 4RUAA 4KH0B 4A59A 3GIRA 8AT1B 1U2CA 1XI1A 1O13A 4EIAA 3RAMA 3GR0A 5LMNJ 2EWHA 4DV4F 5A8WA 4DV1K 4CZHA 1VC0A 4M5MA 4ISGA 4O3NA 1RWKB 4DTXA 1RBVA 4CJWA 1RYRA 4KRFA 2GX8A 1T02A 3Q8PB 3NMUA 3KK1B 3MM6B 1K1QA 2HHUA 4I6YA 1RAAB 2Z58B 3MI7X 3HPOA 2YNGA 3LDPA 1SH3A 3IKMA 3FBBA 4WKRA 4OHVA 1WSEA 4WFBL 4ED8A 2K1RA 1RT5A 1BHLA 3T9ZA 1JJCB 3VTHA 4JI7K 4FYDA 3SQ2A 4F4WA 2CJYB 1HWKA 4NLQA 3QT8A 2W2NP 1J5EK 1MW7A 3N28A 3IO1A 1RDRA 4X64J 2DH8A 1PGZA 2WTUA 3R5AA 4X66J 4DHVA 4Z4CA 1N48A 4RW9A 4CD3A 4OLAA 4DR4F 5FLXY 3NEKA 1HD1A 3R5BA 3A8KA 4CJTA 4IUFA 5ADZA 5GAEU 3KG0A 3NVKA 3WC2A 3RW7A 4JS5A 3CCSN 3O9QA 2PGCA 3C65A 3V81A 3TABA 3MN6A 2V6AA 2ZD1B 2Y1LB 3P8BB 5GAGP 2HQ3A 3GV5B 3T1AA 3IR6B 3H40A 2BYCA 3CF5L 4CJKA 1RA6A 5LSLA 3I9V9 1YQHA 3EUNA 3J7ZT 3U9ZA 2VQEJ 1WF0A 1VSDA 1JLAA 3CEDA 4FNIA 5IOLA 2X1GA 4KGXB 5E41A 1KD1O 2NSBA 3ZSQA 3M9OB 4YY3F 1IO2A 2G2YA 1QE1A 1OMSA 4BWMA 3HZGA 4IRDA 3DLEB 4ZJQA 2QMWA 4P6QA 3VF6A 4EZ9A 4JYAF 1TQLA 1G15A 2ZUAA 1VRTA 1REGX 4O0NA 4DFPA 4Q2MA 4OV1A 2DRAA 3QNOA 5KG1A 4H8KA 4KBOA 4RW4A 4B8CA 1RWMB 1GLFO 2ZZTA 1L3SA 2HWHA 1N36F 2DNNA 1IN0A 4CNYA 2GTDA 3P6YC 1RE1B 4ZVRB 5C10A 3SAHA 2B5JA 2HVHA 2UV8A 1RHJB 1ZZNA 1H7XA 2CWKA 5H9EK 2PEBA 4AYBD 3F0NA 4DX6A 1B7YB 2WOMA 4ECTA 5H9FJ 2QSWA 4CJPA 2P9IA 2IVPA 3LDSA 4CBXA 1LW0B 1KHVA 2CH6A 1B3TA 3H1QA 1T8EA 3EKUA 3D45A 3JAMY 3T1HK 1JJ2R 2A41A 3L2RA 1CXQA 4FN5A 1C0TA 4KB7A 1QSSA 3RBEA 3MXIA 1U0SA 4ANDA 3H7HB 2D5RA 2QLBB 2O1PA 1OKJA 4OX9F 1WNEA 4LRDA 3GP9A 4P7TA 1WAFA 5ETKA 3ATVA 2YKPA 4OHXA 2UUAF 3ZZYA 3VQCA 3MEKA 2VC0A 2EG1A 3D54A 1X31C 1TU0B 4X65J 1NGAA 3J80U 2AYEA 5JVGL 1LWCA 2O8DB 3CE8A 1HNZK 2B9YA 3L2QA 4OX7A 3OXFA 1EQMA 1NDPA 1G1XA 4W90B 4Y1CA 4KB0A 3FZBA 2QV6A 3BP8A 2NZCA 4FK4A 2XWYA 5I3UA 1PCAA 4LF4F 5F0XA 2B4VA 3LGMA 2ZBQA 3MM7B 3E1YA 2W4CA 2Z1GA 4BR2A 4ZTJA 1OQ3A 1O6XA 1RTZA 1GQEA 1CC7A 2RDDA 3D6TB 3MCOA 4QAGA 5BPNA 2Y0SD 3EMTA 4HDGA 2VASA 2ZGYA 1J27A 1UZHA 4DU8A 2V8GA 3H42A 1EQYA 4DV5F 1VQ5S 3G8TA 1RWOB 1URNA 1X4CA 4GO7X 4ILJA 4CNZA 2Z30B 3OJSA 1SC4B 3F56A 2HQFA 2A1BA 4H4MB 1Y97A 4F3QA 1WKJA 2J0QD 5TKWA 4YOEA 4MK9A 3CCES 4OZJA 1GX5A 1U48A 2Q1NA 2GO8A 3GONA 3M6VA 2GMHA 3HJVA 1MWKA 2ZJQL 3H0PA 3BSNA 4NRUA 4HTLA 3CPEA 5KGWA 2YJEA 4CF2A 4JI5F 4YNQA 1NKBA 3SSQA 1KTQA 1XC9A 5IWAK 1LXNA 3IBFB 2B8PA 3T1YF 3THWB 3TR5A 3OT9A 2G9OA 2HMPA 2DXDA 4AXJA 3HBTA 4JI4F 2A1RA 2ASOA 4HR2A 3ZXWA 4C8KA 5KFFA 3DLBA 1N34J 4N8NA 1FWKA 1UFKA 1UETA 3MMBB 1JLGA 1TAQA 5CYQB 3OVNA 2D0OA 3NF9A 2DXFA 3K57A 2OTJN 2DTUA 3OL6A 1TKDA 2XY8A 3CMAS 2AGOA 2ASPA 3TTCA 2O4GA 1NHUA 1R0CB 4YQWA 3ZSVA 5F8IA 1Z25A 3CJ7A 1KCFA 4N77A 3PX0A 4ISFA 2DY1A 3VEXA 4QJVA 4FWKA 3NOCA 2XCAA 4R0JA 1W26A 2E1AA 1H74A 2KZZA 2BJ1A 2R7TA 2BRKA 3C6UA 1HBNB 2BJ8A 4RBTA 1XMOJ 2OO4A 4GO5X 4ILGB 5KG6A 4BE0A 3H45C 1HMVA 1V4TA 1I94K 4F50A 2DGOA 2IHR1 2BMBA 4M5GA 5HRRA 4B9TA 3BKFA 3GDQA 3WQUA 2X1BA 4U8YA 1Q18A 2PMHA 2PYJA 1RYSA 4R5PA 3DLLL 3VQDA 1Q9XA 1R8HA 3NNHA 2QKKA 1OH8A 4FL9A 1G4CA 3FJ2A 3OUYA 1IQZA 1EP4A 2KYZA 4WQ4C 2KB2A 3MMJA 3O4QA 3J7AP 3KDNA 3LM2A 2ZM6J 1Q7YT 2F8TA 1HBMB 1BISA 2W8KA 1YZ6A 1Q16B 2HLUA 3FEZA 4CM0A 4H5RA 1VQ8S 4HH0A 4JBCA 1UW9A 2DNYA 4OJRA 1NK6A 4ED2A 2E44A 4TY8B 3MFHA 1I3OB 4FYYB 5EWFA 3M4XA 3X3UA 2LA4A 4WCEL 3QIPA 6AT1B 2QFJA 4FPIA 3OYNA 2I5JB 3A5LC 3ZC4A 1KD1T 4ED7A 3TAMB 3KG1A 3DGPB 1XNRJ 4CK2A 2FVRA 2AZ3A 1X4BA 4LFAF 4U96A 2R42A 1P90A 4FJ5A 4NXNF 2ROPA 3A8EA 4JI8K 2QWRA 3CSKA 2AZ1A 5GVQA 2OIHA 2DGXA 2DNMA 1Z1ZA 1YJUA 3AVHA 3T41A 2HNZA 5AE2A 1RBLA 2WK4A 1D09B 1FFWB 3KLEA 1B70B 4DR3K 4NWBA 2RU9A 5BR8F 4DJBA 1BI4A 3H59A 4QYZJ 2A3ZA 3CCJS 2KXHA 3HOTA 1S9GA 3RSEB 4HVZA 2FF3B 1ITPA 2X7IA 2EI5A 1LW2B 1KNZA 4WFZA 1VQMN 5C15A 3I5AA 5C24B 4Z4EA 5IQQA 3OW2R 2IMWP 1I5OB 3TJAA 4Z37A 2DRBA 4DMNA 1SPBP 5HMXA 4B9NA 3K5OA 1HNWJ 4ISEA 5KFPA 4OO1J 1KQKA 3O80A 3EGNA 2UYTA 4CLZA 4J90A 3FR0A 1RTJA 5DGBA 3ITHA 5A76A 1IKXA 2XCPA 3M7VA 3PO5A 1WSHA 4CJLA 4Q43A 1XMQJ 2EKYA 3KWMA 2XMMA 4DEZA 4L74A 3Q86A 3M8SA 4M45A 1TUUA 1P6TA 1JLFA 3EJMA 1IG9A 2EPIA 4QR0A 2GQQA 5K9FA 1VHXA 3HXMA 2KW4A 3NCQA 3CCWA 4BS2A 4K2JA 3QGHA 4MQ3A 2ZF5O 2Z0GA 3FBFA 2Z2LA 2UUAJ 3B8HA 4WK1A 3VAJA 3O4NA 4OI2A 4P52A 4C3MA 4YMEA 3MUTP 4FYVB 3TUJC 1WOSA 1BD6A 2YHWA 4MIBA 1VQ7N 3DI6B 3BYPA 4YR0A 3SLCA 4RNFA 3QFHA 1YVNA 3S1TA 1N88A 2XHCA 2BE9B 3IRXB 1AFIA 5JXSA 1UEUA 4F2SA 1WUAA 2CKWA 4KV8B 1SV5B 2N3OA 2WTFA 1FHTA 4IRKA 4LFCF 3V1QA 4PKIA 4CFAA 1FJGF 1U47A 4MFBA 4C7QA 3CI5A 4FO0A 3BGRA 4DXLA 1NSQA 4X4QA 2BW2A 3TVZA 4ZN3A 3IRWP 2W6LA 4TSXA 3MK6A 4HCBA 3VVTA 3VQEA 4PKHA 1KOHA 4NYZA 5F9NA 3HPHA 3KLFA 4K59A 5AQRA 4BC4A 4G6VB 1IBLK 4KE5A 4AHVA 3AO1A 1QHAA 4NLDA 4IOAQ 5EOYA 2D74B 2VPXB 1HQ2A 4NPOA 1Y5IB 2P9GA 2RD5C 3HSZA 3VVUA 4JI5J 2G8KA 3LWMA 2VFSA 1HYZA 5D15A 3DLKB 1DURA 1D9DA 1RAIB 3A3OB 3QINA 5GIPA 3EO3A 5HO4A 2BGGA 1XEZA 4Y2KA 1VOMA 4FP9A 1S6PA 1OPZA 2GJ2A 3D6MB 2Z56B 1A9NB 5GAHI 1VRQC 1VC5A 2ILYA 3TW0A 2IRYA 2QMUB 1CXUA 1NPPA 2V51B 1YJVA 3TZYA 1SL2A 1T11A 3CIMA 4NLXA 1FO1A 3UB5A 3L2VA 4DR5F 2MQNA 3PX6A 2Z1HA 3AV9A 2KVIA 3S9HA 5D8HB 2CZ4A 2QWPA 1NPKA 4KAZA 3NDKA 4FLZA 1NG9A 1RT2B 4W98A 3DLRA 2LP4A 4NI2B 4JI3J 3AVJA 1KVAA 1UJ5A 3N79A 3L6QA 4JV0A 3A5MC 2AJ0A 3K5NA 4F3TA 4Q0BA 3AARA 1VQSA 3VAFA 4A2AA 4YOVA 4ENOA 3TTFA 5H1SQ 3ONQA 4X4SA 4BRPA 2O8CB 3QNWB 5CD4A 1YSJA 4EGLA 3OTOF 2E1ZA 2QI2A 3DRXA 2P2CB 1X0PA 4LR7A 3MR2A 3VQSA 2PEHA 4PWWA 1CJVB 2NQPA 1S12A 4M1KA 3LW5C 4PWDB 1LEOA 5IV3A 3EZ5A 4UW2A 2WVCA 1WSIA 3TA0A 1G6BA 2GUIA 4WKYA 3LL3A 4BR5A 4YB6A 3M6GA 3TVYA 4TY9A 2MKIA 1CEZA 2FF6A 4IH5A 4QWAA 2J0XA 3RJMB 4BE2A 4LBHA 4CESA 3VAGA 4J8FA 3VF0B 3KG4A 1L3TA 4LQ3A 4F3OA 4XK8C 2GS8A 4FXDA 1KAZA 3BN7A 4BRLA 2LKZA 2MQMA 3P31A 4UT4A 4C0HA 2AYMA 4DV6J 1TL1B 3H2LA 3VEZA 2ZEJA 2F65A 1NK5A 4P72A 4KH6A 3ZCMA 4DV7J 4RTFD 4J9SA 2GVDB 3I8DA 2W7OA 2P9CA 1Y7PA 1HNIA 4HTIA 2Y0BB 2KM8C 4DSIA 1LKZA 1NZAA 1PJ6A 3DRPB 1BL3A 1BIUA 1SKUB 5C25B 4NX9A 3ZLJA 1RGIA 4DUYK 4U7CA 2J9DA 2XHBA 1YRUA 3UR0A 2BA9A 1JXEA 5AJ3K 4NEYA 2JX2A 3G71S 3OTCA 4XTTA 3DLEA 3CG7A 5LT5A 2ZZMA 4LVOP 1GOCA 2IM1A 2DFFA 2B0GA 1XN9A 3K2PA 5T7LB 3O8WA 4HLBA 4E8UA 1CULB 1TMJA 1IBMJ 3GCXP 1WF1A 5B0GA 1H72C 4KFBA 3BJYA 3FEYB 3PIPL 3FUYA 1K8KB 4V19X 1FWPA 3UCGA 2KYXA 2C28A 1M1HA 2ALYB 3QRRA 4DG1A 4JKFA 3U4LA 6FD1A 4GMJB 4LF5J 1GFWB 4DR7F 1WKKA 4TU9A 1CS4A 3VF2A 4CZGA 3P3DA 1SL0A 3MGJA 4GKKJ 1Q81O 2Q97A 3TUZC 1YTYA 4QBUA 1VMBA 2HHXA 3C2PA 1NOZA 1SBRA 5CHCB 3JSMB 1LW0A 3VESA 3SSRA 3QEIA 3N01A 4NOHA 3DXMB 2M88A 3AD7C 2OCEA 4ETXA 1FRLA 4CO5A 3K7RA 4XDCA 4FJIA 1RU1A 1Y00A 4PPDA 2E7XA 3OHAA 3EYZA 1G7CB 2RRAA 4F4AA 2OTLS 3SAFA 4XPEA 3KXDA 3FBEA 2G0JA 4NB4A 3M3ZA 4CLWA 4LF1A 3BUZB 3MEEA 2YBVA 3K8WA 1E6VA 4KH5A 4CI0B 3Q8YA 4LF7K 5E3QA 2ZJPL 2J5AA 1NJZA 4ELTA 2UUWA 3QAEA 2A2CA 2P9KB 1BU6O 2AP1A 1BLUA 3KHYA 2ASMA 2H4WB 3LPTA 4I1TA 1EHWA 2YHAA 2ATCB 3HHDA 1NM2A 3I4HX 3MM7A 1FXRA 1X5OA 3W61A 3O5BA 1RTHB 3CJTA 5IT9O 2NRWA 4FVCA 2FUG9 3QFUA 1MROA 2E9ZA 1D9FA 3CJ0A 5KAKA 3Q83A 1N8RO 1TKTB 1NH7A 2F9WA 1T44A 2J8AA 4CLUA 1XHXA 3WXIA 4L73A 2CH5A 4KI6A 3ISNC 4FXVA 2E1CA 4H4MA 4MK7A 2QG9B 2ZGZA 2QTWA 4Z2XA 1VQKS 2NREA 4BHQA 2ROEA 2OA8A 3T6JA 4I7FB 3ZX0A 2O8EA 1ITGA 1AXQA 2MYFA 3D4JA 4PXDA 3TVKA 1F3FA 3H08A 1PSDA 3M1FA 4IOCQ 2HRYA 4P9SA 4ETZA 4AQYJ 3PX4A 3D2EA 2L9NA 2ZVIA 3AH6A 4JD2B 3VQ5A 1VQ5N 3GB0A 1VK8A 3ZSOA 2GMJA 1MU2A 1G99A 4CF9A 3BQ0A 2N4DA 1Q86T 1JX4A 2CQHA 1R8CA 1TL3A 4RX6A 5HL7Q 3CCEN 2ZH7A 1WOQA 5D0GA 2V8DA 4K8RA 2X78A 4JS4A 1KFSA 2XBPA 1A5XA 2UXCJ 1T9UA 3MMBA 2M8DB 4ID5A 3EGVA 5CYQA 3MFIA 4DUTA 5KFBA 3MM9B 3CPWR 3BZQA 1KOOA 3DOMB 2AV5A 4YHHK 4A8SA 3THXB 2QW9A 2FLNA 4C4WA 5ADXA 3ETMA 3FQKA 3T5LA 2FJXA 4KGMA 3M30A 1IBKJ 3I0RB 1OWXA 4W4MA 5AQUA 5ETTA 2QYCA 3POTB 4B3TF 4B9MA 9RUBA 2WUSA 4B17A 3DXKA 2QWOA 2PFUA 3PFOA 1S0MA 1HBNA 4MYUA 5A6WA 1HYSB 2CG8A 2ZBCA 3K5MA 3CMAN 3HKZD 3SYZA 3O44A 1YAGA 2HHHK 3OS1A 3CD0A 3W5YA 3OTOJ 3AA3A 3VWSA 4EBDA 5AQFA 2V5HG 1VRUA 1FD2A 5B0AA 1GX6A 1OH7A 3SV3A 5ETQA 2XYPB 1REVA 4OPAA 3RZAA 4QOTA 1H2TZ 1WBBA 1XR6A 2GWJA 4ICLA 2Z2ZA 1IBCB 2ACMA 5D78A 2E8AA 2PZSA 4RUHA 5D0RA 1UWBB 1MWQA 4ECUA 1S79A 4WWSA 2IBOA 2UXDK 5ETOA 4QS9A 3OYMA 2VFUA 3D0HE 5B08A 2RQ4A 4ZIWA 1HJOA 1ELOA 2YH0A 4PG6A 4O44B 3NAIA 4DZ6A 1PYTA 4TY8A 5KG3A 4M3WA 2RMLA 1D8ZA 3HHLB 4UQTA 3FZLA 2CQ1A 2KFNA 3LGHA 3KK2A 1T94A 4BBYA 2KHDA 2I5JA 4DFKA 3UNYA 2ZC4A 2VPYB 2EK6A 3TAMA 2JVRA 3V4IB 4CH1A 5DG9A 3U02A 1VQ8N 3VETA 2J0WA 4LD0A 2DJWA 1NJWA 3K5PA 1UFLA 3ZT1A 4FZYA 1X8DA 5KFSA 3G6YA 3BF4A 3U6FA 2YWHA 4ZLNA 3B6BA 4CJUA 1U2VA 1E4GT 1SKRA 4DV3F 4PG4A 1KN6A 3FZKA 4NASA 1HLWA 1K73O 2WW4A 4WFAQ 3MF5A 1SXLA 3GYNA 2ZH6A 3RSEA 3HI0A 4OI4A 3OBIA 1D5AA 1Z2LA 2N7CA 2W8LA 1LW2A 3U1NA 2CADA 2HMIA 3PCOB 4OI1A 3TQEA 2XMKA 4AD6A 3TUIC 3ZSYA 1MWZA 2QGFB 4Y2AA 2DY9A 3ZETB 4OLPA 3HF5A 1DLOB 2YWEA 3JQKA 5J2NB 3LDOA 3NAEA 1ILYA 3K9KA 5KFHA 3J7YP 5K5MA 1TKXB 4CH0S 5I3PA 3CCJN 3FCWA 3AJ2A 2G13A 2BACA 2KT5A 2D0CA 5E84A 3PFEA 2PT0A 3UO0A 3VQ9A 4UOHA 3J81U 5J2MA 3JXUA 3OBWA 2FPHX 2B6AA 2QWLA 4DU3A 2XS5A 3FMBA 1ULRA 4KIAA 2UUBK 2L3MA 4BRHA 5HMYA 2A6AA 2C42A 1RWXB 2H5JB 1U6ZA 2X6NA 3OYKA 1FVQA 4F04B 3HSCA 5JVHL 1I51B 4JI1K 4GVBB 2V8VA 2WBRA 1IJJA 4EHTA 5I42B 2BUNA 3KDOA 1GLLO 3JB9k 3V2UC 1IKYA 4AL7A 1VBXA 5IT0A 4I6MB 1Y9OA 1XTZA 2GZOA 3M6WA 2KXFA 2RPIA 1XNQJ 1RAGB 5HVFA 4BRGA 4LSZB 2O3DA 3DI6A 2FXUA 2N3LA 3QZ8A 1H2VZ 5KFLA 2W1BA 2CPXA 3CJ5A 1O5JA 3TAQA 5KFVA 5L1KA 2X74A 3OVSA 2F4VK 1EETB 4H5VA 3DGVA 1WJ9A 2MKCA 4WFBQ 4CE9A 2XLJA 2GO9A 4I4BA 1H1VA 2CJBA 4MDBA 4FK2A 3C46A 4Z4IA 4RW7A 2AA4A 4WU2A 3UIQA 1VSJA 4CZLA 5SWMA 1VCTA 4M5KA 3NHGA 2MZRA 2DNLA 3AGKA 2VJVA 4KGZB 2P9PA 3N5FA 4CO1A 2G8WA 1GNKA 4EBEA 4OHYA 4WBFA 5B8HA 2RDJA 5HROA 1H7WA 3IUCA 4AM6A 3HVAA 4CIOA 5E3CA 4OZ1A 4BCAA 4JI6F 2C2DA 2E5LK 4DFMA 2DB1A 2QN6B 4RW8B 2A6MA 3NGTA 1BUXA 2YKAA 1HNXJ 5M1FA 3WQPA 1RUSA 2CPDA 3IAM9 3UVJB 3AVAA 4I2PB 4GY2B 5GAEP 2VBXA 5C42A 4DQ8A 1T3OA 1CBKA 2CIMA 3E8OA 3BSAA 3JXOA 2BKNA 2IM3A 1EX8A 2DR9A 1CZAN 1NLVA 3RB6A 3MXJA 4CBWA 4IWVA 2QE5A 2EFVA 4OGCA 3BDEA 1Q79A 3UE2A 3Q89A 2YNFA 4H0XB 4EYIB 2DEJA 3U8XA 1TUVA 4DPUA 4F8RA 4WXOA 3AY0A 1RU2A 2QA1A 5C2GA 3K0SA 2KO1A 3MEDB 4U7BA 4KHPJ 3A13A 4OKJA 5GAHU 1U8SA 1ZC6A 2HZAA 4X4NA 4K42A 1CJKB 1U0HB 4LF8F 4LF9K 2W41A 5LM7E 1W7AA 1X5PA 1RT2A 2HK3A 1QD1A 3CGIA 3PEJA 1UVIA 3R9PA 2XZDB 3ZT0A 5F8HA 3DXBA 4DLEA 4LBPA 4MJKA 2KKHA 3C6TB 3C16B 4EHUA 2XSJB 5KFRA 2CJAA 1B64A 5G4DA 2PMWA 2IC3B 4CH7A 4CO2A 2R7RA 4F4KA 2MQOA 4BDPA 3HHKA 3HYFA 5CZ2A 2DTJA 2P5OA 4A46A 3IN5A 4A8YA 1DHMA 2FY1A 4B3RF 4PEOA 3T6BA 1Y5LB 4NCGB 4M95A 4N56A 3CC4S 3TU5A 5KFJA 1BA0A 4WYWA 2ZC3A 1F3VA 4LIRA 3J8AA 4JV5F 4QWEA 1T6DA 2ZNZA 2X3DA 1BCMA 1TP7A 4XEIA 3M1VB 4M7YA 3WNGA 1U1OA 3V9SA 4PWDA 2BZ2A 4E7JA 3D1HA 2XI3A 4X62K 2RHQB 4ZPTR 4MK8A 2FGOA 1WG1A 5F8LA 4CLYA 4K0KK 3MMCB 4I9QA 1K44A 3MXHP 1YHQS 1VDHA 4CHPA 3RUBL 1S0VA 1GLJO 5KI6A 1RBSA 3KHLA 2AX1A 2GMLA 4MLHA 3AT1B 4BC3A 1FFSB 3O9RA 4BREA 2VG5A 1QQNA 1E6YB 3MCMA 3MWBA 3Q2TC 2R7OA 1K73T 2XZTB 4DV1J 1HBUA 3CJ2A 3RR8A 1VQOS 3W60A 2QL9B 4B08A 3K58A 3H3OB 1R0BG 1TFWA 1AUDA 1RWUA 1BMQB 3A12A 4JB8B 1TV6B 2XGQA 1YK9A 2OEKA 2AEJA 3W2VB 2R7QA 1UMJA 4FOIA 2V4QA 5C7PA 2W24A 4RU9A 3PW7A 1F0XA 1P9YA 2ZJRL 3CJQA 2HVIA 5LMUF 3N9UC 1X4GA 4URGA 4H0TB 3JYTB 3OFGA 2EFQA 2CJXB 2LDYA 2I6WA 2OPPB 1HBOA 3O8MA 3GBTA 4JI7J 1VK3A 2NZ4A 3ULEB 2U1AA 3VQPA 2W01A 3G9CA 3H8YA 3SQ4A 1J5EJ 2DFHA 2W2OP 3S6EA 4LY7A 3MDQA 2F8SA 2XS7A 1MMDA 2PYLA 3CCTA 3NMRA 4BACA 2VQFK 3VQ4A 2E9TA 2PI4A 1R0AA 3QEXA 2CQBA 4B3MK 5J2PB 2OPQB 3OVBA 1ZXOA 4R0EA 3TSUA 1SAZA 3LP1B 2BOAA 3R8EA 3G71N 2PO4A 1TVRA 2UUCK 2WW8A 2DEIA 1OSCA 3KK3A 4FPAA 5AQLA 4BRFA 3CERA 3HULA 4DUZK 2R2UA 3GJTB 2Y8WA 2KJWA 3W63A 2APOA 3B8AX 3BH6B 2G1DA 3QT7A 5M1PA 2NXUA 1H38A 2E5JA 3TJ9A 3BO3A 3LPYA 4QU7A 1RBTA 4DR6F 1U1RA 3M8ZA 3KLVA 2V2KA 4LR9A 2IY5B 1X7VA 4ELUA 4QYRA 4BVOA 1U7LA 2CFXA 3A5NC 2EVZA 4G65A 2XTJP 2GELA 3TEGA 2O8FB 2B56A 4F67A 3MCPA 5JLHA 1RDUA 2AJ2A 2IBKA 3BF1A 2HNDB 2DHXA 5KFOA 4BY9C 1RBOB 3MPWA 5B7WA 3AA2A 3CM6A 4H5TA 4DI6A 3X1LB 1K9MO 5ETRA 4ZHRB 4PUOB 2DT9A 1DQ9A 5EY4A 5H9EJ 3P83D 2G8VA 2DGTA 5DQGA 3WDOA 4DR1F 3MPYA 5AQZA 4ED5A 3EZUA 4P73A 2PC6A 1S9EB 5F8GA 1QY7A 3I5BA 4FJXA 4N5SA 4KH4A 3OS0A 4A8KA 1SB6A 3V6HA 4OMFG 4ZS6A 3LM9A 3T1HJ 4TYBA 4PQUA 2HRUA 1FT8A 1TKTA 4B9SA 4J37A 2YKQA 5THWA 1HNVB 2VODA 4OI6A 3LZIA 3R1XA 4A4JA 5G0RA 4UF4A 2IDLA 1XJWB 4P2XA 4NLOA 4F36A 2DBBA 1UVJA 2OD4A 4ECYA 4DL2A 2Q0RA 3RU0A 1U8WA 3KMSA 1AZSB 1RP5A 2PMZD 2O5DA 4CIFA 2ZBPA 1LFWA 4HHHA 3M2RB 4C11A 4IO8A 2BW7A 2K06A 2V9KA 3OVAA 2XZWA 4KR0B 1JLEB 4CGDA 2BANB 2PA8D 4DCOB 4NLBA 3KTQA 1HNZJ 4JD2A 5E33A 1EKSA 4HT7A 2EK1A 1HHTP 5KOWA 4O3PA 2AU0A 2QZ8A 2HHPA 4NLVA 3IFRA 4JI2K 5ETSA 3M2VA 5FLXU 3CMES 1SJQA 4FJKA 4JV1A 2OYQA 5F1XA 2XO7A 2K3KA 1H2UX 2HFSA 2OFHX 1XUPO 3OSNA 2LFVA 3D6RA 3C7NA 3MM9A 1Q78A 4LF8J 2IA0A 4M3UA 3PXGa 2DHSA 4G3IA 3VENA 4PKDB 1WLJA 2QA4G 3CO9A 2OHDA 1QSYA 2WB1D 4RU2A 4J5OA 1FNMA 4WE1B 1QQCA 3PW4A 3C94A 4TU7A 3V1RA 3J81O 3P5JA 1RDAA 2FQQB 4CEOA 2H3EB 1NLKL 1FKPA 2P9UA 3I0RA 5U47A 2C3OA 1SJ4P 3OFEA 2WBMA 3EE3A 2DGWA 3UWTA 4DSEA 3KZBA 2VWJA 3D0IE 2R7XA 1HYSA 3NAHA 1ZBIA 2UXBK 3AD8C 4ED1A 2G1HA 4FJ8A 4DQRA 5D3GA 3AD9C 3CJKA 4B3RJ 4Y6IA 3OQ2A 5IWAJ 3EPGA 4U67L 2K1RB 4J9PA 3NH1A 1YBUA 3K89A 4B3SK 4D3HA 1NEEA 2V50A 3G4SN 4IKAA 5KT2A 3QQCD 4BRQA 3KUHA 5FPMA 2M5YA 1NKCA 3TSPA 5FIIA 3VQBA 1B4SA 1LAWA 1R6YA 4M3ZA 1S1VA 3HT0A 2XB2D 4B1WB 4RNOA 4RW9B 1T3NA 4E0DA 3PKYA 3JSYA 5KFZA 3SMZA 3WX4A 2R2TA 1BIZA 4LVNP 4GKJK 1WC4A 3TRGA 1VQ6S 4WIIA 1RXOB 1WSGA 1BXNA 4DL0C 4HHTA 4BQZA 4DMZA 3V81B 5K8PA 4CZCA 1JKHA 2B3TB 4CLFA 4E98A 2BKPA 4N47A 3H6EA 3LANA 5A2QO 2CGJA 3JAMU 1LV5A 5K8OA 1T0TV 3R1LA 4V19J 3MR6A 3HHLA 3TZZA 1J9AA 2R8KA 3MM5B 1MDUB 1NK0A 4I0WA 2XWXA 3WBZA 1Q8BA 1RT7A 2B9XA 2BRLA 1F6TA 1JLAB 4WZQA 1XIQA 2FLLA 1I94J 1LWFB 2QL5B 2K3IA 2HSEB 4ITSA 3U3YA 1YJNS 1IXKA 5LY3A 2ZH3A 3ELHA 2FY8A 4FW1A 4QIWD 1LWEA 2LECA 2J76E 2QEXS 4IH7A 1VRTB 3TWHA 3MECB 5F0WA 3CCLS 1N32F 1KVCA 2W7PA 3CCVS 1F9HA 1WORA 4YDDB 4WPAA 1TUWA 4J2EA 3W3SA 4YORA 2HOEA 4DTPA 2IVMA 4FLXA 1NRKA 3ADAC 2YVSA 3VEOA 2VL1A 2JC0A 4L6V3 1YITS 2X1FA 2HQDA 3AO3A 2R9LA 3FMWA 2H48B 2ZH8A 2NS1B 3MUMP 3CUNA 4FVUA 2PIIA 2FJDB 1DLOA 3RG6A 4FLTA 1HJRA 5AXMA 3CQYA 1DTTB 3DKDA 3U1MA 3BGFA 2W9BA 2HGLA 2NCKL 1J53A 2OPRB 3DM2A 1BWFO 4JI8J 2J7WA 1A7GE 1FERA 4DR2K 1UOCA 1LOTB 1HL6A 1TK8A 1U2FA 5TKYA 3ZZPA 2V7ZA 1Q53A 1AB8A 1K9MT 2EBEA 3P5TL 1S22A 2EC0A 4QWBA 1QVFM 2MY8A 1DARA 4E7KA 3HM8A 5I42A 4E1NA 4O0IA 3J7A1 3QYYA 4ES1A 3PHEA 4I6MA 3RRGA 5HOOA 4PWUA 3VEYA 2VB6A 5I3UB 3ID6A 1ZBLA 3J80Y 4YOUA 2HBLA 3EXCX 4UQGA 4ZN1A 3MMVA 2YPZA 1JB0C 4USUA 2F8MA 4Z7CA 1NJIO 1Z05A 1NSKL 2MMYA 2B43A 3SDEA 3LAKA 1RB0A 4MKAA 1SIZA 2DVIA 1EETA 1SC1B 4QWCA 3WQTA 4TXSA 1TUYA 1WUUA 1LNQA 2GHVC 2CWXA 5EWEA 4B1YB 3O5TB 1GLCG 1RHRB 1N5TA 4YOXA 2J0SD 2E6MA 3GE1A 2DY4A 2FGCA 2N82B 4LR8A 1NM1A 2GIQA 2KG1A 2YV0X 1CZ9A 5BR9A 4HWIA 4FM1A 3US5A 3TO8A 3E01A 1SUQA 4I64A 4KY3A 1YLXA 5KFXA 4FXWA 4NCAA 1ZTWA 3L7UA 3IWNC 3OYGA 4F7VA 2DNRA 2F1FA 2FZCB 5DZ7A 3JSBA 3DOKA 1ZS6A 4CK3A 3EEQA 2VBYA 4K8XA 4QPXA 5F0UA 2Q31A 3IR7B 2MQ8A 4CZIA 4I2PA 4BG8A 3SPYA 3H5UA 2A18A 4A61A 2VPWB 4LRCA 4E7IA 1XK8A 1LXJA 4WFXA 3TA1A 2Z8QA 2O66A 1ZZFA 4ED0A 4QR2A 3HT3A 2J8SA 3S8SA 3VPZA 4CZEA 4C97A 1N33F 1UPPA 4RBUA 1VJWA 1JQGA 4LBIA 3NGIA 1UW4A 4KT0C 1LWXA 2FDNA 1MMNA 4JKHA 3ILOA 4HEA9 1VLOA 1D3WA 3C19A 1C6VA 2E88A 3QETA 5A2QY 5AQOA 2FJAB 2PD1A 3UFCX 1BWVA 4YOYA 5KFIA 3MEDA 3H5XA 3R6GB 3C6UB 1NDKA 4DPYA 3W7BA 3R7BB 1SS6A 4ELVA 1HMVB 1IBLJ 3QBXA 4K43A 3PSFA 2BJ7A 5LMNF 2CQ4A 5L1LA 2UU9F 1RWVB 2F7VA 3PR5B 1BOTO 4ECZA 2RRBA 2HURA 2IIHA 3KJVB 3OL8A 2MZTA 2NPFA 1HUXA 3CW2C 2R7UA 2OSRA 3H2VE 1GLAG 3OUYB 1EP4B 4KJIA 2NRXA 3EKSA 2MEWA 4X65K 1HR0K 1FDBA 5E0OA 3UE5A 3PTWA 3VERA 4GV3A 3NFAA 1NGFA 4CF1A 3BM7A 1B7FA 4Y1DA 4H54A 4OJ1A 4A8QA 1SQFA 3BH7B 2NRRA 3QIPB 3N4PA 2J6TA 2Q43A 3SIPB 4X64F 1RA7A 3VQ6A 1TELA 4RNHA 1V4SA 2HVEA 2HSTA 3FRYA 5B0EA 4GMKA 4F0KA 4X66F 3E3XA 1S57A 2YKNB 3PIOL 2OZSA 2HKEA 4OKEA 3CC4N 4NXMK 2YI1A 3CIPA 2BUPA 1FDAA 1T9TA 2V2ZA 4MIWA 1TL4A 1UVKA 4NLSA 4DF8A 4OPKA 2HNZB 1E6YA 5GINA 4ZVHA 4RW6A 4YEAA 4USKA 3KLEB 4CLKA 4DTNA 3GJRB 4C3LA 5K8MA 3NNCA 1BI4B 3OYDA 2VQEF 1S9GB 1QTNB 2OP5A 1U4BA 1YHQN 2VDIA 4ZP6A 3EX7B 4H0PA 4RL1A 1TV6A 5KFEA 5AQNA 2OPSA 4TN2A 2HBKA 5ETVA 3L9ZA 5KQDA 3IDHA 3AXMA 2KLAA 4ED4A 2QL7B 5F41A 1GTEA 5CH7B 4TNOA 4W5OA 3NF7A 1S6OA 2D3ZA 3J7ZO 4PG8A 3JYTA 1O0PA 5HN0A 4WFNL 4DHYA 1RTJB 3ITHB 3ULEA 2YWWA 2ZBRA 2GGPA 4OPJA 1IKXB 1VHFA 2L08A 4QPTA 2ZWHA 1YI2N 2WC9A 3FLCO 3MOJB 3DDKA 1RHQB 4AH9A 4IDKA 5FLXO 4YR3A 3O1WA 3LDNA 4A5BA 2V94A 4LFBK 1HI8A 1KKHA 2M9KA 2VBZA 4NYPA 1X9MA 1RAEB 4MKVA 2F5GA 1JLFB 3I33A 3EVOA 2OPQA 4DV4K 2CUYA 4OZ2A 1NGIA 2FC9A 3LP1A 1VBKA 1VQLS 1Q1KA 3MXMA 3BQ2A 5E3PA 3RTVA 2VFVA 2B9WA 1XBWA 3HO1A 2C2NA 2IRXA 3VAMA 3TYTA 4EO6A 3ENOA 4ECSA 1KFDA 1MG7A 5KRTA 4WF9Q 3SUQA 3NBPB 2GIFA 1RBAA 4DUYJ 3NMAA 1WSVA 1RLDA 2AHOB 8ATCB 1R8BA 2R7VA 3ET6B 3RAXA 4B9QA 1IKVA 3HKWA 5AJ3J 3NP5A 2AD9A 1WNSA 4WQ5A 3QT6A 2MKHA 3ENQA 4CWBA 1X4DA 5E3AA 2GIRA 4I2QA 4MFBB 5F8JA 2YWKA 2YWFA 2HAFA 4ZPDA 2PI5A 3DYAA 2LQBA 2YQ0A 1GLDG 3IG1A 1R8PA 3HTVA 2CPEA 3W9JA 4DR4K 3R5GA 2Z4PA 1T03B 1PC4A 3A3NB 3BN4A 2OSQA 4PUOA 2G0CA 2MSSA 3HSTB 3KLFB 4FM0A 2R7WA 5GMDA 5KFKA 1GXLA 4TQSA 3ENWA 4CIEA 3GPAA 1UVNA 2M4MA 4NLRA 4B1XB 1H73A 3DRRA 5HQ8A 4KHQA 1RLCL 1VSKA 3I55S 3P96A 1S59A 5KPZA 3D5MA 3PW5A 4C98A 3OYAA 7AT1B 2V2VA 1PJ5A 1WF2A 3VAKA 4Z94A 5EDWA 5ETMA 1HNVA 3LO3A 4UZBA 4E89A 2XO6A 4YY3K 3D6FB 4BR0A 3EVMA 1FDNA 1W25A 4ZDNA 4PZVA 4JYAK 4QYZK 3FCVA 4K4TA 2VF3A 4C23A 2IVFB 2DR5A 3PRDA 4Z4FA 3N6MA 3RBZA 2G2OA 4CEFA 3RVCA 1N36K 2B7CB 1JLEA 3FFIA 1H0HB 2HIYA 3IR5B 4LF7J 3MCNA 4IR9A 2HGNA 4GRSA 1N0UA 4J9VA 1X4FA 1N34F 4ZPBA 4K4WA 2VICA 3MPUB 1FJEB 1SI9A 3P49B 1FDDA 5M2UA 4URSA 4OI3A 3TSQA 4DPTA 2AT1B 4JNEA 1QS4A 3DNCA 1M5PC 3MCSA 4K4XA 3FRZA 3HHNB 3SK3A 3SZ2A 2GX9A 4NE9C 3TAEA 1S6QA 3FCHA 3ZEUA 4L8RB 1RAOA 4EI2A 2GV9A 2EX3A 2Z2MA 1E3MA 3VGVA 1GMWD 1UAWA 2WZ1A 2G8FA 2NZTA 3SNNA 4Q0BB 1KXPA 2UU9J 4WE1A 2LXIA 4OX9K 1XMOF 1IUJA 2DISA 2LEBA 2M7SA 1RJJA 3CMEN 1G2EA 4P75A 4P71A 2JLGA 2UUAK 5A8RA 3QFPA 3BR9A 2AF6A 3B82A 4E7LA 4AF1A 2M2BA 4YB1P 3M8QA 5DM7Q 1IM4A 2HEKA 2VKZG 1CPZA 1Q95G 4USTA 3RBDA 3LAMA 3AAPA 5BPMA 4YFUA 5KG0A 4P2MA 3V9XA 1F21A 3IMQJ 4K5RA 2JWNA 4KHUA 1VQPS 4LF4K 3NCPA 2ZM6F 3R97A 3QJPA 2WFBA 3SUPA 4Y28C 2P6TA 4C8ZA 4LT6A 2XC9A 2DH7A 2W4DA 3IFEA 5DQIA 4DWIA 1RKIA 3MX2A 3TTDA 1X9WA 1TFYA 4ZA1A 4DV5K 4YHHJ 2OJ3A 3MD1A 1JCFA 1QVFR 4H4KA 3OXGA 5JMNA 3CHWA 3OYFA 3G82A 1FRJA 3GG0A 4DL7A 1Q7YO 3EXYA 5HVHA 1YWXA 4DL3A 3Q8RB 2B51A 3FSYA 3QIDA 4MT1A 1XNRF 5M2RA 3UQSA 2PY5A 1HNIB 1JNRB 3TP2A 2BH1A 2EW9A 5DLGA 2OLWA 4ZVOB 1JXVA 1FRKA 3OSPA 3VAHA 3MM5A 2EFGA 2FSJA 1R89A 2OGUA 2Y3YA 4JI5K 2CQPA 2RB7A 1TK0A 1LWFA 4Z0UA 2HHHJ 3UR3C 3MN7A 1BE4A 4OL8A 2L9DA 3CCUN 3T1YK 2XNQA 4Y2CA 3LP2A 1VSHA 2RAQA 4AL5A 2E2OA 2EBGA 4IQXA 4JI4K 3D1QA 1KQSM 2KI2A 3FSXA 3MECA 4KFBB 3SJJA 1NGEA 3ZSWA 1HW9A 2KXNB 1M1KO 4DG1B 4AUKA 4JKEA 3UPFA 3NCRA 2V9WA 5CD4H 1PO6A 3W2WA 1MMLA 2VGNA 1CS4B 4QOZB 1HNWF 4B1ZA 2IM2A 2F8EX 2QEXN 3VGMA 3PG9A 3PJXA 4FBUA 3CCLN 3BEGB 5HQMA 4JK7A 1YX2A 2DGSA 5AQMA 1P9QC 5AE1A 3NVMA 1XMQF 1SC6A 3J7YI 1DTTA 4FS2A 5JJBA 4JP8A 3I4PA 3KHGA 1N4LA 4E2FB 5DG8A 2Q6BA 1YITN 4KHWA 3DRSA 3M8WA 4JHDA 2HS4A 2LU1A 3DU5A 2OPRA 5BN8A 2B8QA 2P51A 3AGRA 1EO1A 4C2MA 4K4VA 4QR1A 3W0LA 2BE2B 1B0PA 4IDHA 4GC6A 3VCDA 4NZ0A 3FK4A 1Q0NA 3UN2A 3MEEB 3V5RA 4E1JA 3HDSA 5JICA 1E6VB 4B1UB 4DX8H 2ZWOA 5J1PA 3E9PA 1KLMA 4CM2A 3V6DA 5GAHP 2K8GA 5ETPA 4N76A 2OKQA 3BSOA 2M70A 2ZH2A 1WSJA 3TPQA 4FKXA 3CFPA 1ASUA 4TYAA 1HPZA 2WSEC 3MR7A 5GADI 1VIOA 3CJ1A 2GAGC 4CLPA 1XWLA 3GE9A 2EXUA 3PO4A 2D3OR 2W9CB 4O5FA 4QIVA 1F5CA 1BQXA 3MPDA 3DFEA 5FDLA 4XO0A 1MROB 3A5OC 2OAUA 1R6VA 2ATQA 3VHQA 4L3NA 1TKZA 5BREA 4LFAK 2QO3A 2QLXA 3EWGA 4NXNK 2GW8A 1JLCA 2CZ9A 1RABB 2YHXA 3MWTA 3SQOP 1XR5A 2UUBJ 3EN9A 3Q7CA 2O8EB 3PNIA 4R8UA 1S3XA 2ASDA 2FJWA 2ITMA 2J6SA 4KHMA 3IMXA 3U9DA 1FRHA 1NGJA 4ZPWR 4JI1J 5BR8K 1VSMA 4M3TA 3D2EB 3OYCA 2XY5A 3SQ1A 4KHRA 5L9XA 1RT3A 1S0OA 1MU2B 1TAUA 4FWQA 4X2BA 1TL3B 4OGEA 1F60B 3A0IX 3AVMA 4DQPA 1YUWA 4CDIA 1IG8A 1KONA 1RWPB 1UWAA 2IJNA 3SCJE 1RAFB 5LJ3Y 3HHLC 2F8HA 5J1NA 1RHUB 5MLCV 1BQMA 3TUPA 3DWLA 1YGYA 3AA9A 4RNMA 2ZJRQ 3KFWX 4ID5B 2NUBA 2F4VJ 4Q8FA 2DNGA 3KHHA 3C6AA 3ZT2A 3F9MA 1YXQA 2LSNA 1SJRA 2H3GX 2PBDA 2MB0B 3ZNJ1 4M5NA 4DQQA 1D1UA 1ZM2A 1NGCA 4IOAL 3M30B 4OZ0A 3DLGB 1IKWA 3V4MA 2HS3A 1EIYB 2YHBA 3ZZOA 1NMNA 4Y00A 5FPEA 2FLOA 3DXKB 3IGNA 1IM6A 4CJRA 2V4JA 3HLUA 2E5LJ 4JI3F 4JUZA 1RDCA 3L7OA 1VRUB 3NWRA 2DR6A 2VA2A 3NNAA 3CDWA 3EE9A 2B4OA 2ZUGA 5DQHA 3OHBA 3HSDA 1REVB 3KJVA 2ILZA 3BGOP 4FLVA 5HK4A 4PL7A 2R2SA 5RUBA 4ICLB 4DCHA 4BRAA 3RBXA 3A1YG 4O0JA 2XMTA 1TMMA 3B54A 4LFCK 3A4TA 2Y9HA 4WP8A 5DETA 4CBUA 1FJGK 4OZ5A 5HAOA 5LJVA 4WP3A 3S7RA 3FZ2A 1VQ4S 4KHYA 3A8YA 3GOIA 5IT9U 1NZ8A 2F4FA 3Q24A 2DNZA 1PJ7A 2GWKA 3KK2B 3HD2A 2M0GB 4CGGA 2HFNA 4OZ3A 1A5VA 1ZAWA 2A2DA 2BXJA 2YKNA 4LF9J 3PYGA 2E7VA 2MSTA 1IR1A 1GT8A 4H5NA 1ZH5A 3OL9A 4CJSA 4HTJA 2GJIA 3IP0A 3UN3A 3PY8A 4DV6F 4KTQA 3K8VA 4QW8A 4IG3B 2V0NA 5KG2A 4CEAA 4PHTX 5AFUA 1NU0A 1RTDA 4BGAA 3LOUA 3IWLA 2AYBA 1U2VB 2COLA 4NO7A 4DV7F 4CF0A 1OO0B 2KN4A 3BREA 1RBRA 4LF6F 3EY1A 2J6UA 1M1KT 2DNQA 5B0DA 3OV7A 5ADXH 3J7Z5 4JKGA 4BROA 4ES3A 2ZE2A 4CTAB 2BX6A 4NLCA 1TGOA 2YX6A 2DHGA 2VU5A 3L2WA 1WOPA 3QRPA 3DLHA 4AHUA 2HMIB 1IV0A 4A8MP 5FJ4A 3SEOA 2DPJA 4FWNA 3D0PA 1IBMF 4X62J 4Y65A 3GSIA 3KD5E 4OKKA 1RCOB 4DR5K 4K0KJ 4DS5A 1KVKA 1KC8T 3WC0A 4NA1A 1XC3A 4A48A 5J2MB 4LF5F 2B6AB 1KVJA 4NRTA 1XQIA 2IMOA 3QDKA 4GKKF 3WNFA 2WSFC 1RQ0A 1FE4A 2F9TA 2VHGA 1W0HA 3OFFA 1YVFA 2D69A 2KVQE 4ZP8A 4WTYA 4ZPAA 2LMIA 4O23A 1A5WA 3LPEA 4FYXB 1S6UA 2NRZA 4IO9L 3BZCA 3M2UB 4CJ4A 3SUNA 1S5JA 3KK7A 2WCXA 5J2QA 1IKYB 3QO9A 3RB4A 3SCKE 5A8KA 4HACA 1UA1A 3OTOK 1Y11A 2HHQA 2YNIB 2P5GA 3G8SA 1MWYA 3L7PA 3VALA 3NBPA 3R5CA 5LXRA 3P39A 3ZX2A 3AY9A 4UUWA 3ZTPA 5IT4A 1YIJS 3B6PA 3ET6A 1CC8A 1RT1A 4WYBA 1FI4A 2EWSA 3FGVA 2BE7D 3O3GA 3PYEA 2CZVC 3LUYA 2D9PA 1D0EA 4RW7B 3PR4A 3LALA 3LP0A 2GCFA 1WI6A 5T41A 2QLJB 2VQFJ 4QIGA 1OH6A 4IYQA 1OQ6A 2P9PB 4QIFA 4B3MJ 1T03A 3HP9A 2RVJA 4DCJB