4KV8A

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV Reverse transcriptase P66
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 152
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kv8A05
4LSNA 4F2SA 2YNFB 3AA2A 4JUZA 4CEFA 4E3SA 3VN5A 1LAWA 3QGHA 5EWEA 5F8HA 4YNQA 2EC0A 3QIPB 1SUQA 1TKZB 1XR6A 3KJVB 3QINA 2WCXA 1RTDA 4FM0A 3ASMA 3TR8A 1NK6A 3ZSZA 2YHAA 1N48A 2D3ZA 4EBCA 3CJ0A 3B6OA 2B5JB 3SUNA 3VA3A 1UWBB 4ECTA 4MIBA 3LWLA 4HHTA 4NLUA 4CGJA 1XWLA 3BREA 4RU9A 4ECXA 4J2DA 3IRXB 3QIDA 3RB6A 3M8RA 4ZVEA 3T5JA 4M41A 2OPPA 4NYZA 4OKJA 4DTJA 2Z1JA 1NNDA 3ZT4A 3QO9A 4HUFA 2KFZA 2E6LA 4CF8A 1VSMA 3OYIA 3U3YA 1O1WA 2RDJA 4DL6A 2A1SA 2HNZA 3NF7A 4KO0B 1VSHA 4Y1CA 1NK8A 4Z4CA 4E7JA 3PO4A 1TK5A 4TN2A 4K50A 3PW4A 3GILA 1JL2A 3ZT0A 4M3ZA 3VA0A 1NOYA 3DI6A 2IM2A 2C2EA 3RB3A 4E89A 3BSOA 1CXUA 1SKSA 4O3NA 5KG5A 4Q8EA 1NK7A 1ZBHA 4OLAA 1JKHA 3TAEA 4MKAA 3LPTA 4NLXA 4J9MA 3KMQA 3NKYA 4NCAA 1YTAA 2AQ4A 1T03B 3QESA 1HQEA 1BQMA 2XY6A 4DTNA 1KSPA 3AVHA 5KTQA 2C28A 4RW4B 1U47A 4F8RA 2YNGB 1D9DA 3VQQA 1Q9XA 3KNAA 4DFMA 4IFYA 1VSIA 3MEGB 3OYDA 4BACA 4KV8A 4O3QA 1ZYQA 4EO8A 2P51A 1Z4UA 1KFSA 1RNHA 1VSLA 1X9SA 1KLMA 4K4VA 4C8NA 4YMEA 4M3WA 4ZPAA 4Q45A 3DMJA 3KHRA 1LWEB 1NKBA 1QE1A 3ZSVA 3V9UA 3T5KA 1FKOB 3BSAA 3ZSQA 2RF2A 3L3VA 3UQSA 4LD0A 4FJ8A 5KFNA 3TABA 3SPZA 2AX0A 1YTUA 5KFRA 1NHVA 1YT3A 1RT3A 3KLGA 3AVAA 1HJRA 2HMIA 1RBTA 2IMWP 4CHQA 2B6AA 3KLEB 4KHUA 3MXIA 4WYLA 4DFPA 3MEEB 3RBEA 1LW2A 2R2UA 1CZ9A 1HYVA 1QSLA 1SH2A 3LWMA 4C8OA 3PX6A 4ED2A 1QAJA 2WK4A 5KT3A 4BDPA 3PV8A 1SV5B 1N5YA 3SUOA 2ATQA 1IKYB 1S6PA 3NFAA 1S9EB 3AA3A 5HRSA 5KI6A 1BISA 4M45A 2G8IA 3PX4A 2HNYB 1BCOA 4CCHA 3NGYA 2J6TA 4BWMA 1S1UB 1JL1A 3G10A 2KFNA 2AJQA 4IRCA 2FVRA 1WSJA 4E1NA 5KG1A 5KFAA 4M3XA 3P1GA 4AHTA 3OYNA 4B9UA 2XGPA 2ASDA 2HHUA 3DYAA 2BANB 1ZBLA 5KFKA 3V6DA 4RW8A 3ULDA 1RTHA 3SFGA 3NMAA 3FSIA 4F4YA 4G3IA 3DLHA 2FVQA 4OKKA 1SUQB 3VQ9A 4BDYA 3SPYA 1RTIA 4Z0UA 4CJ4A 4W5QA 4N41A 4FK4A 1RTDB 3FQKA 1RT5A 5KFVA 3TAQA 4M3UA 1U09A 3T5HA 4I2QA 2IC3B 2V9WA 3DM2A 1KLNA 1KHVA 2QKBA 5CYQA 4J9LA 3SQ1A 3MFHA 3D28A 2ZD1A 2OPPB 3H59A 3L2VA 2ASLA 3DRPB 2IAJA 3QEXA 5KFQA 3CJ4A 2HHXA 4FM2A 2WRMA 2VG7A 2OPSA 2KQ2A 1WAJA 1UAXA 4CFDA 1RT2A 3RAXA 4GMJB 2D41A 4Z4HA 3MECA 4OPKA 4FJ5A 1TK0A 1TKTA 2V0NA 3RMCA 3KHHA 3LP2A 2LSNA 1DLOB 3AVJA 4OPJA 5L1KA 1HMVB 3V81B 4K4UA 3DI6B 3VQDA 4FZYA 4OGEA 2D0AA 1N6QB 1IG9A 4DL2A 1JLFA 4DQSA 4DS5A 4FJLA 2HHWA 4XPEA 2RPIA 2DPIA 4O4RA 1S4FA 3HL8A 3G0ZA 3QIPA 1CSJA 2FJXA 3V9XA 1L3VA 3PHEA 2F8EX 3T1AA 1BQMB 1HQEB 4MK7A 3QEVA 3M8PB 2D7SA 1HNIA 1FXXA 3KJVA 3PJWA 3K57A 2ZE2A 3PW2A 1NK5A 2JEIA 2FVCA 2B5JA 2HWHA 2YV0X 5DG8A 2Y1JA 4Q43A 1UWBA 4CHZA 1BCMA 4JS5A 3H4BA 3P5JA 2DFEA 4NCGA 1XR5A 2WHOA 4DQRA 5HBMB 4EBEA 3KHLA 4TQRA 5FROA 4KFBA 3H40A 3H2LA 1NKCA 3KLFB 2I1RA 1NJZA 1NKEA 4QWEA 3SQ2A 4TSXA 4PUOB 2V4QA 3UPFA 3CYMA 4KRFA 3D5MA 5F9NA 3TAFA 3OYEA 1WLJA 4J9PA 3HJFA 2VA3A 1ZETA 3LPUA 1RT3B 4M3RA 4B9TA 5FRMA 4CJLA 4NLQA 4CHYA 4ZVFA 3KD1E 2B6AB 4EZ6A 4B9NA 3I5BA 5KFJA 4WXWA 2G8HA 2WOMA 1WNSA 2KTQA 3PZPA 1RYRA 3VQ7A 3HM9A 3CJ2A 2XY7A 1LW2B 3NGZA 3S9HA 5F8JA 5CY4A 1F21A 2BDPA 2HVHA 1XR7A 2JEFA 2AWZA 3L2WA 2OYQA 4FJNA 2WTFA 5KFHA 1RBSA 4AHUA 3OJSA 4XIUA 1S6QB 1D1UA 3KLIB 1N5YB 4TY8A 5KFEA 2FLPA 4CF9A 5C42B 4AILC 1JLAB 2IS3A 3VQBA 5CZ1A 4JRPA 1HNVA 4ELTA 4IG3B 4EEYA 2XY5A 4O5BA 1QSYA 3SQ0A 1HPZA 3K5NA 3C94A 5KG2A 1VRUA 3WNFA 1A5VA 1SL2A 2UUWA 3AVMA 4K8XA 4IRKA 3BSNA 3AO5A 2KZMA 2AGQA 3OYHA 4DLEA 1RT6B 1S1XB 1FKOA 4ECZA 1B92A 4F4WA 3N6NA 4Y1DA 4RW9B 1QS4A 5SWMA 4U7CA 3NF8A 5KT6A 4LQ3A 4ZPCA 3G6XA 3DYAB 4BE1A 1RTHB 3KLEA 4NYNA 4DL4A 3O3FA 1RYSA 3MEDA 4KHYA 2YNHB 1WSGA 3MEEA 4OJRA 3GV5B 3I5CA 4KHRA 1RT5B 4C8MA 5DGAA 2G8WA 1BI4B 2W42A 2HHTA 5T14A 2O4GA 2UVWA 3THVA 3WNGA 4I2QB 4RW6B 3T3FA 4YR3A 1XHZA 1UOCA 2RDIA 3NGDA 4J9RA 1ASUA 1OS5A 1IKYA 2XCAA 2GC8A 1TAUA 2E4LA 4RNOA 3LAKA 3NH0A 4PWDA 1T7PA 3ZSWA 5KFLA 3OY9A 2PYLA 4J2BA 1REVA 2VG7B 1EP4A 3SFUA 2GUIA 3V1RA 4KB0A 5KFSA 5HLFA 3DDKA 4PQUB 2Z1IA 1RT2B 3H4DA 2WONA 3RWUA 2BQRA 4O55A 1LW0B 3LP2B 4FBUA 1JLBB 1FK9B 3F73A 5L1IA 2VG6B 2HB5A 4ECRA 3WNHA 3C6TB 4O3PA 4URGA 1K1QA 4ECQA 2BANA 1JLFB 2W8LA 2FLLA 2YNIA 2FC0A 2OZMA 4KE5A 3V6HA 3N6MA 4NLPA 5DGBA 2JGUA 1HNIB 1JLQA 4EZ9A 2FJWA 4Z4GA 4PY5A 2ZE2B 4F4ZA 2X6NA 3N6LA 5EDWA 4HUEA 1KVBA 1XHXA 2R7YA 1S48A 3QGIA 5DLGA 4CIGA 3L3UA 4NCGB 1JX4A 3V9SA 4IBNA 2IC3A 1ZBIA 2GIQA 1Y97A 3HP6A 3Q8QB 4ZMMA 3WNEA 1U04A 1JXBA 2G8KA 4RNMA 1A5XA 5KFFA 4ECUA 4KFBB 4R5PA 4DSFA 2OPRB 4IH6A 3DRPA 4CJTA 4E7LA 1HARA 4KB7A 1D8YA 5KFBA 2R8IA 4CECA 4WFZA 2RN2A 3E51A 1RA7A 4FLYA 1ASWA 4NZ0A 1S10A 3LDSA 5FDLA 1S9FA 3NF9A 1X9MA 1C0UB 3AV9A 1SH0A 2E9TA 1X1PA 4B3OB 2J6SA 1DLOA 1KVCA 3IS9B 4J2AA 1HMVA 3V81A 2G8FA 5FRNA 2X78A 3K59A 2WOMB 1N6QA 4K4ZA 3CM6A 4N76A 4GW6A 4ELVA 1DTTA 3G86A 2R8GA 4DU4A 4B9SA 5J2NB 3AVBA 2GBZA 5HROA 2R8KA 5JUMA 3M8PA 4KSEB 4WFYA 3V6JA 5KT5A 3HVAA 5JXSA 4NRUA 4E7KA 1I39A 5KFZA 2IM3A 4TY8B 3RBDA 3OL7A 4CGFA 3SV3A 1NOZA 3T19A 1WSHA 4W5NA 3SYZA 2HW3A 3FQLA 3B6PA 3RTVA 4MFBA 1EX4A 5HBMA 1TK8A 4FLWA 3RRHA 1HNVB 1J53A 4QCLA 1HPZB 1D0EA 4K8ZA 2DFHA 4FLUA 1VRUB 3KLFA 4DQPA 3BSCA 1S9GA 3DLRA 1IKVA 5KG6A 2JEGA 4RG8A 2E9ZA 4PUOA 3LZIA 1C1CA 4QPXA 3VQ8A 4KKOA 1C0TB 2YKNA 3T5LA 1S5JA 2ASJA 3RR7A 1SKRA 4KHMA 2FVPA 3MFIA 3VQ5A 1TAQA 2W9CA 3MEDB 3JSMA 3K58A 1MU2B 2YHBA 4N5SA 3PX0A 2BQ3A 2BGGA 3GIIA 1BIZA 2P5GA 3G6VA 4DSKA 4EBDA 3VQCA 3HYFA 4KHQA 2I5JB 2W9BB 2XO7A 5J2PB 5SZTA 3IG1A 3SJJA 1S6QA 1GX5A 3KLIA 1IKXB 1KHWA 5KT2A 3QETA 5C42A 3HPHA 4J2EA 4FJIA 4IG0A 4KTZA 1SL1A 1JLAA 2R2TA 4PWDB 2DPJA 5HRRA 3MTKA 5JS2A 4IG3A 4FJKA 1JXLA 3BDPA 5JS1A 4FZXC 1REVB 1EP4B 5HLFB 1RT7B 3L2UA 4CJ3A 5J1EB 3RB0A 4KREA 3DLGA 4CJEA 1RT6A 1S1XA 3RMBA 4MK8A 2WONB 1T05A 4O3RA 3OYKA 1U49A 1S1VB 3H5YA 4DQQA 3ITHB 4RW9A 4JRQA 3ICLA 4TYAA 2R8HA 3VQPA 1IM4A 4U6PA 4I9LA 1T8EA 3G6YA 4FLXA 1KCFA 2YNIB 1LWCB 4KAIA 2AU0A 3DOKB 3GIMA 1GOBA 1HQUB 4O3SA 2FLNA 4JLHA 2YNHA 4J9SA 4K4TA 1JLQB 2BE2B 3JYTA 2UVUA 1BI4A 1KRPA 1WN7A 1Z25A 1RDRA 2VWKA 4GVMA 1B9FA 1ZBUA 5KFOA 1XI1A 2C22A 4RW6A 1QQCA 3AVIA 3I0RB 2E6MA 4PA1A 4IRDA 2HHVA 4H54A 4J9KA 4KPYA 5L1JA 3H08A 3RR8A 2OPQA 3OVNA 3AA5X 2DTUA 2JC0A 1FKPB 3OL8A 4NYFA 4R5PB 1LWFB 2BQUA 4WXOA 2R2SA 5KT4A 5KFTA 5C24B 4OL8A 2G8UA 3CDEA 1TKDA 3TANA 4Y2CA 3FFIA 3EPIA 1NK9A 3BQ0A 4LY7A 4DLGA 5KFCA 3C95A 4TXSA 5KFMA 3L8BA 4B08A 5FDLB 4R0EA 4PQUA 1J9AA 3EZ5A 1C6VA 5KG0A 3QEWA 3EYZA 4MK9A 1LW0A 4FM1A 4FW2A 4M42A 1EKEA 3DOLB 4ZTJA 1GX6A 4EYHB 1QTMA 3D45A 1JLBA 1FK9A 3DLBA 2G8VA 2KW4A 2VG6A 4CE9A 3L2QA 3O4QA 2E9RX 3PVXA 2FVSA 3C6TA 4Q0BA 1X9WA 4DSJA 1DTTB 3HVTB 4DG1B 3KD5E 3OSPA 4DEZA 1C0MA 1YVFA 4FJJA 5HROB 3SQ4A 3QERA 2B43A 4DWIA 3CDWA 1L3SA 3ZSOA 1C1BB 5EWFA 3V4IB 1WNEA 1L5UA 3M9NB 4F2RA 3BGRB 4FCYA 1TL1A 2HHQA 4CF0A 1LV5A 4FK2A 2UVRA 2UVVA 4RZRA 4MFBB 1BIUA 5DG7A 1W25A 2VG5B 4RNFA 3CM5A 4CF1A 2OPRA 2DY4A 4DS4A 2YKMA 4CJSA 1S9GB 1IKVB 4CGDA 4KHWA 4Y34A 4I7FB 3MXMA 4JV1A 5E41A 5K14B 1C1CB 5C5JA 4FJ9A 4KKOB 2A1RA 4FLTA 1C0UA 2HNDA 2YKNB 4FBTA 3MR5A 1J54A 4B3OA 4ECVA 2AGPA 3IS9A 3AO1A 1NJWA 3CFRA 1A5WA 3V6KA 3IAYA 2W9CB 3JSMB 3AVFA 4CJVA 3F9KA 1SL0A 4DL5A 4QWDA 3OYJA 3DLKA 4Q5VA 4MH8A 5J2NA 3PO5A 3H5UA 3RRGA 4ICLB 2XY8A 4F4XA 1K6YA 3AO4A 1HRHA 2XHBA 4Z4IA 4F50A 2PYJA 3IG1B 3S3MA 3H98A 3QLHA 4CK2A 3CDUA 3RMDA 1WSFA 4HTUA 4CFBA 4IG0B 4TQSA 4NLYA 1RAJA 1JLCA 4FS1A 3RMAA 1TL3A 4FLVA 3Q8SB 3CG7A 4ED0A 4QW9A 3V9ZA 4HCBA 3Q8PB 3V1QA 3KK3B 4CHPA 4CEDA 3NCIA 3DLGB 2DFFA 4ID1A 3GIKA 1W9HA 3BQ2A 1T05B 1IO2A 4WZQA 1C0TA 1TGOA 1KTQA 3PJXA 4URSA 4QWCA 1VSEA 3LP0B 4NRTA 5F8IA 1RDAA 4FYDA 5CYMA 4I2PB 5I3UB 2QKKA 3LP3A 2FJVA 4DTOA 4C8KA 4B9MA 5F9LA 4WYWA 1RT1B 4ZVGA 2FBYA 1RCHA 2IA6A 4GC7A 4O0IA 4EYIB 3OS1A 3NAIA 3SI8A 4O0JA 4K4XA 1L3UA 1MU2A 5DLFA 4DSLA 3JYTB 3VQ6A 4YFUA 3EPGA 1RT4A 3QGGA 4QAGA 5KRTA 4FLZA 3MR2A 3K2PA 2I5JA 2W9BA 3AVCA 5J2PA 4DF8A 3KTQA 3NL0A 4W5RA 3OHBA 3HT3A 4IKAA 3TARA 1IKXA 2OPQB 1N56A 1RILA 3I0SA 2VA2A 3I8DA 4CEBA 4CGHA 3CIZA 1HYSA 4CEEA 4ZHRB 1TV6A 4F4KA 3FFIB 4FJGA 4AHVA 1Q8IA 1RT7A 1W0HA 5J1EA 4TYBA 4FK0A 3UIQA 3H5XA 2XRIA 3NDKA 4CF2A 1JXEA 4H4OA 4MKBA 4QWBA 3M9MB 5F8MA 4O44B 1S1TA 2HWIA 1S1VA 3SCXA 4CJPA 3ITHA 4CK3A 4E0DA 3PW7A 4O3OA 1WAFA 3QNNA 4H8KA 3VQEA 2CKWA 4Q0BB 2ILYA 4OVLA 3ISND 2F8TA 5HP1A 3HVRA 2D0BA 3AVKA 4KB1A 1LWCA 3DOKA 5J2QB 1VSFA 3U3GA 3OYCA 3LP1A 1LAVA 1HQUA 4FJMA 4N47A 4K4SA 2BR0A 5EUHA 2NUBA 2BE2A 1TQLA 1J5OA 5KFXA 4M94A 4CEZA 3NGIA 1IH7A 4AHSA 3M8SA 1ZTTA 2P5OA 3LAMA 4ED3A 3PY8A 2QE5A 1TL1B 3I0RA 4TY9A 1T94A 4LQ9A 3Q8RB 4CHNA 4DL3A 3OJUA 1FKPA 5HRNA 4J9OA 4J9NA 3BR9A 3KLVA 1LWFA 5CZ2A 1R0AA 3K5OA 1RBUA 2YKMB 2ZQBA 5C24A 4IDKB 3E01A 3OS0A 1MMLA 3QZ7A 3M9OB 2XI3A 4CEQA 3O3GA 3C6UB 2Q3SA 2F8SA 2XC9A 2HNDB 4NLOA 5I42B 3MR3A 4CEAA 3KKSA 3DOLA 5DMRA 1BQNB 5F8LA 3TVKA 2ATLA 4Z4FA 4DU1A 4E7HA 3TAGA 3OYBA 4B9VA 1UA1A 4LH5A 1TP7A 1I3AA 3TQ1A 3HVTA 4DG1A 4IFVB 3AO3A 3DLKB 3OHAA 2FBTA 2PY5A 1TVRB 2R2RA 4XO0A 3PUFA 2R8JA 4FW1A 5C25B 1D9FA 4OLBA 5KFDA 4HCCA 2OH2A 4NLDA 1VSKA 1JIHA 1C1BA 3LZJA 4IKFA 4X2BA 3V4IA 3QLHB 3NAHA 2W7OA 2F96A 3BGRA 4DFKA 5F8NA 4FJXA 1S1WB 4RW7B 2IJNA 3IGNA 3M8QB 1JLCB 3SNNA 1QHTA 1TL3B 1T3NA 3KMSA 2IDOA 2VG5A 1TKXA 5DG9A 3HP9A 3S3OA 4LH4A 4KBIA 4F3TA 4CESA 3FRZA 2D5RA 4LSLA 4RUCA 2QV6A 3TWHA 4I7FA 4ECYA 3TAMB 4WE1B 5K14A 2ETJA 1U48A 3MXJA 4E19A 4ID5B 4MIAA 4NLGA 4N56A 4YQWA 4OGCA 4HVJA 4CEOA 2VWJA 4WFXA 5CYMB 2IJFA 2OZSA 4URQU 3SUQA 3S3NA 4M95A 3L2RA 2W8KA 4JV0A 3RB4A 2D3UA 1NK4A 3TAPA 1S0OA 4R8UB 4CJKA 4ZPDA 4K4YA 4O4GB 1RT4B 5J2MB 1QAIA 2RKIA 4ICLA 3MR6A 4J9QA 3OS2A 2W7PA 1WSEA 4ED8A 1C1AA 2IM0A 1VRTB 2IBKA 3GV8B 2ILZA 5DQHA 4ZP7A 4CJFA 3P83D 3V1OA 3MAQA 3KOAA 3I0SB 4KTQA 3D0PA 1HYSB 5L9XA 4WZMA 3DRRA 1UA0A 4ZP8A 4NLRA 1YVUA 1S97A 2B4JA 1ASVA 1TV6B 2HHSA 4DTPA 4UQGA 4AHRA 4EP4A 3OYAA 4YR2A 2Z1HA 3KK3A 4BE0A 5D3GA 1KFDA 4H4OB 4G1QB 4NLTA 5DQIA 1Z26A 1S1TB 3CWJA 2Z1GA 3CFPA 1JLEB 4KHNA 4H4MA 3QYYA 5DK5A 4CFCA 3LP0A 4I2PA 1ITGA 5I3UA 4IR9A 5HP1B 1EETB 2X6SA 4B8CA 1RDDA 3DLEA 4DTMA 1RT1A 5KGXA 4DQIA 4DSIA 3KK1B 5KFYA 3LP1B 1JLGB 1RTJA 3H5SA 4ZVHA 1HYZA 3NBPB 2C2DA 3CJ3A 1RBVA 4BDZA 3OLBA 4FJHA 4QWAA 1J5OB 3DRSA 3V9WA 1U4BA 4LSNB 4BWJA 3ZT2A 3IGVA 1S0MA 4L8RB 1RDBA 3QZ8A 4FXDA 4EO6A 4FVMA 1BL3A 4C8LA 4ZTFA 4CJQA 2QK9A 2KZZA 3MF5A 4KI4A 4Y2AA 3OYGA 1R0AB 4ZHRA 3A2FA 4ZPBA 3K5LA 4IQXA 2IGIA 3E01B 2GIRA 5KRSA 3CFOA 3QEPA 4DMNA 3LALA 2XGQA 4IOBA 3ALYA 4OKEA 3KK2A 3PW5A 2BRKA 1RDCA 1NK0A 4CERA 4O44A 3QO9B 1BGXT 4ED7A 3KLHA 4DFJA 4ED6A 3AVNA 4KHSA 2EX3A 4CIEA 2HNZB 2FBVA 4M3TA 4Z4EA 3ZCMA 1IKWA 4Q8FA 5J2QA 4IR1A 2AX1A 3CO9A 2PZSA 3HSTB 1DTQA 1GOAA 3QEIA 3ZSXA 4RUAA 3GIJA 1B9DA 4DTUA 4NCBA 5HRPA 2YNFA 3VQAA 5EU7A 4IH5A 2QXFA 4W5OA 2GV9A 1JKHB 5KFWA 4FZZA 4ZP9A 1VSJA 4DTXA 1TKZA 4DL7A 3OL6A 3SI6A 4ED1A 1TKXB 4FS2A 3CQ8A 4JV2A 4B8AB 3O3HA 5F8GA 4IDKA 4IFYB 4LSLB 3CJ5A 4KTWA 3OL9A 2ITGA 4FJ7A 4RNHA 4CJUA 4KV8B 2XCPA 4Y3CA 2HAIA 3SZ2A 3IRXA 4DTRA 1SKWA 3C6UA 3IN5A 1KLMB 4HYKA 5KG4A 5I42A 4DF4A 1KVAA 2IOCA 4ELUA 4K4WA 3K5MA 1BQNA 3DMJB 3KHGA 2X74A 1I6JA 1QE1B 1NHUA 4HUGA 4M3YA 3ZT3A 1L3TA 4QW8A 2RF2B 4EP5A 4KO0A 1K1SA 4GC6A 5KT7A 1RA6A 4IFVA 2XWYA 4E1MA 1TVRA 3KLGB 1RBRA 2HMIB 5EWGA 3LANA 5C25A 2RKIB 5T7BA 3HXMA 2CJQA 4XPCA 4MQ3A 3HPOA 2JLEA 3NH2A 1GOCA 1WSIA 3ZSYA 4CGGA 3OYLA 5KFGA 4YP3A 3TI0A 4AH9A 2ZKUA 2BRLA 4IH7A 1QSSA 4YR0A 3HKWA 1T03A 1S1WA 4ZP6A 3OYMA 4RW7A 3DRRB 2AGOA 2JC1A 1CZBA 3HO1A 3M8QA 2WB4A 3QNOA 4CIFA 5KFUA 1BHLA 4RW4A 1NJXA 3HK2A 2YNGA 3NHGA 2O4IA 1ZTWA 3BJYA 3UDLA 4CJRA 1EXQA 1S6PB 5D3GB 2ALZA 1C2PA 2OA8A 3MEGA 4W5TA 3TAMA 4WE1A 4RNNA 4ID5A 3CVKA 4H4MB 2UUTA 2JEJA 3NH1A 1QUVA 3VQ4A 4CFAA 3OYFA 3VQSA 1LWEA 3EY1A 3DLEB 3GYNA 5KFIA 4Q44A 4KI6A 3AA4A 2Y1IA 1RTJB 4NLVA 4DTSA 4QOZB 1VK0A 3HVWA 4R8UA 2XI2A 4TLRA 2D0CA 4NLWA 3PR4A 4CJWA 3U6FA 3OLAA 3DRSB 4O4GA 1CLQA 3NAEA 5J2MA 3ZT1A 3KIOA 1XC9A 3HPGA 3V6DB 1ZBFA 4RW8B 4NLSA 5KFPA 3RAQA 2IM1A 1SH3A 1Q9YA 1CXQA 5KG3A 2HVIA 3I5AA 4BE2A 1VRTA 4I9QA 5KG7A 1RTIB 3BQ1A 4ECWA 1S0NA 2O5DA 4ECSA 1G15A 3PR5B 4E7IA 3SUPA 4F3OA 3UR0A 3FDSA 3HHKA 4AHCA 3KKRA 2J6UA 3DM2B 3NE6A 1SV5A 5CYQB 5KGWA 2ZD1B 3QIOA 3AVGA 3KK2B 4JS4A 5DQGA 3GQCA 4B9LA 1S9EA 4DSEA 4CK1A 4G1QA 3ISNC 2EHGA 2IAJB 2P1JA 1N4LA 1JLEA 3ZSRA 3KLHB 1NJYA 1VSDA 1U45A 2HNYA 3AO2A 1D5AA 2OPSB 3EZUA 3SV4A 3PW0A 4DU3A 1EETA 4CGIA 1IKWB 3O4NA 1S1UA 2W9AA 4KAZA 5L1LA 3MECB 3KK1A 1TKTB 4CHOA 2C2RA 1JLGA 4HKQA 3NBPA 3GV7B 2FBXA 1DTQB 3AVLA 1S49A 2V4RA 3OSNA 4CJ5A 3NF6A
chains in the Genus database with same CATH superfamily
5AE2A 3J7Z5 3ENOA 4CEFA 2UZAA 3W8PA 1VK8A 4YNQA 3QIPB 3D2EA 4JK7A 1P1TA 2QX0A 4AM6A 2KJVA 3ASMA 3TR8A 3ZSZA 2D3ZA 3QSYB 3VA3A 2DYAA 3LWLA 1TUYA 2H65B 1HX1A 3IRXB 3QIDA 2OPPA 4Y00A 4TLQA 1UVLA 4DTJA 3CSKA 2YBVA 3GU0A 4LF4F 2E6LA 4CF8A 2IY5B 3RBXA 4BRGA 1NJIO 2A1SA 4LSZB 3NF7A 3KG0A 4IOCL 4Z4CA 4E7JA 1YJWN 1TK5A 4H0YB 3WHIA 1FVQA 4M3ZA 3VA0A 2WW8A 3WXLA 1FE4A 3D2FB 2C2EA 1R3NA 4A5AA 1UEVA 3W9HA 5CD4A 2PFFB 4OLAA 4USHA 4FWRA 2OTLS 3C7NB 1PC4A 4J9MA 1RHRB 4NI2A 3NKYA 4NCAA 1YTAA 5RUBA 3QESA 2XY6A 3MEKA 4CDIA 4DTNA 5E0OA 3TRGA 2AV5A 1QDUB 4F8RA 2GMHA 5AFUH 4LBIA 1D9DA 1OYEA 3DCAA 3VQQA 1NSKL 2X3DA 4DFMA 4IFYA 5EN1A 2Y8YA 3GBTA 4FNIA 4WQ5C 4L3QA 4BACA 4O3QA 1NBEB 3VTHA 4EO8A 2P51A 1Z4UA 1RNHA 1X9SA 1BA0A 4IO8A 2QWNA 4K4VA 4D3GA 4YMEA 1MWQA 2DR6A 3NCRA 4FYXB 4HL9A 3O1WA 3KHRA 3ZSVA 2EFVA 4V19X 1FKOB 3EE3A 2WUSA 3BSAA 3J7YU 1JK9B 2P9GA 4CD1A 3MCNA 3UO0A 5KFRA 1HJRA 1E6YB 2HMIA 2AW0A 2HGMA 1RBTA 3QMQA 5A2QO 2DNLA 3HX9A 2YWKA 2BJ9A 2W24A 5GMDA 2B9EA 2CNOB 4J37A 4DFPA 3J7ZO 3GOIA 1LW2A 3A1YG 1HYVA 1SH2A 1SXLA 3PX6A 1QAJA 4FWMA 2WK4A 4BDPA 3PV8A 3LO3A 1FXLA 4O8KA 3TPQA 3NFAA 1S9EB 1X5OA 4ZJQA 2CIMA 3AA3A 5HRSA 4YY3F 1BISA 3CJQA 3J80O 3W61A 2BABA 1FESA 3G87A 4I6AA 4HHUA 4BWMA 1JL1A 2AJQA 3CJRA 4IRCA 2DD8S 1EZZB 3E8OA 5KG1A 1UVMA 5KFAA 2VBZA 3MCAB 2ZFHA 3MX5A 2LEBA 3KJQB 3H25A 4DU8A 5KFKA 3V6DA 4RW8A 1RTHA 4MYTA 3SFGA 3NMAA 3WX8A 5GIOA 4G3IA 3GJRB 1SUQB 3VQ9A 4P6QA 3DLLQ 4N41A 4F3MA 3VESA 5C0YA 4ZJOA 1RTDB 5ETVA 1CC7A 1RT5A 3FQKA 1RHJB 2V2VA 3BZKA 3TA1A 4K2XA 5MAOA 4MT1A 3PG9A 2BOPA 4WTOB 4DV7K 5AR0A 3OBWA 3MFHA 3HD2A 1CJTA 1HA1A 1VQ9S 4G65A 2ASLA 1KAYA 5D15A 4ED5A 3DRPB 3O6WA 2D1CA 2ZVIA 3CJ8A 3S7RA 4ES1A 2DNQA 3MZIA 2HHXA 4RCHA 4FM2A 4F3QA 4DV7J 1UAXA 2D9OA 4ZLLA 1LOTB 3RAXA 1LK7A 4XK8C 3MECA 1TK0A 1TKTA 2CNNB 3R1HA 1T02A 1Y00A 3KHHA 4ERDA 4CNYA 2VZ9A 3WIUA 3AXKA 1U2RA 2ASYA 2ATCB 3BN4A 4NLCA 3DI6B 2Z56B 3PSIA 2D0AA 4DL2A 2BJ7A 3VGVA 1VQ5S 3KWGA 4DQSA 4DS5A 4FJLA 3IDHA 4WF9Q 4O4RA 1S4FA 2GQ2A 1Q81T 3G0ZA 1CSJA 2FJXA 1M1HA 3O08A 2PA8D 1ZBTA 2V7ZA 2GX9A 1FXXA 3R97A 3KJVA 3M2UA 2ZBQA 3R5CA 3LDLA 4QS7A 2Y1JA 4Q43A 2XO6A 1QZ5A 2RQCA 4USVA 2X1BA 1Y64A 3VGUA 5BYSA 4Y6IA 2WHOA 1XMOK 1RB0A 3FGUA 3FBEA 5FROA 2QFJA 3H40A 3H2LA 1K8KB 1NKCA 3SQ2A 2J7WA 4PUOB 2V4QA 3UPFA 3CYMA 5EOYA 1XQSC 4CO4A 3THXA 4DV7F 4JKFA 4LF7K 3T9ZA 2E2OA 2ZJRQ 4J9PA 2VA3A 3M6VA 4RWTA 5FRMA 3UE2A 2PI5A 5BYRA 4X64K 5BR8K 1U1MA 2KKHA 2B6AB 4OHVA 4B9NA 3CULA 2WOMA 3GJTB 3PZPA 1RYRA 3VQ7A 3HM9A 2Y1RI 3H2UB 2XY7A 1ULRA 4LF7J 4C0HA 4C8ZA 4GVLA 5F8JA 5CY4A 1F21A 2IDLA 1XR7A 2AWZA 3L2WA 2F7VA 4DB3A 2HFZA 2XS7A 4X64J 1IJFB 3G71S 1FT8A 3FC9A 5BR8J 3OTOK 3OJSA 1RBSA 1S6QB 1RU1A 2D3O1 1M5HA 1V4SA 5C42B 1VRQC 1ZZNA 4AILC 4UOHA 2IS3A 2MB0B 2O01C 2Y8WA 4ZVQB 2XSJB 4EEYA 2XY5A 3OXLA 3SQ0A 2CQ4A 1T9VA 2CJ9A 3OVSA 4JKGA 2C2KB 2HS0A 4YDUA 3HT0A 1Q82T 4K8XA 3BSNA 2AGQA 3OYHA 1S1XB 4W92B 3G4SN 4OZ2A 3CJKB 3IRWP 2G0CA 4DR1K 4KGMA 1XMOF 3AXMA 5M2RA 2L3MA 3N6NA 4L3KA 4Y1DA 1WUAA 3E3XA 3BEXA 3IBCB 5SWMA 2A6AA 3B6BA 1XK8A 2DCUB 3NF8A 3G6XA 4NYNA 4DL4A 2CJXB 1RWKB 3RUBL 5AQFA 3KNGA 4BS2A 4MDAA 4DR1J 2YNHB 1AUSL 4HTJA 2E1RA 1RFQA 5DGAA 1KQSM 2G8WA 2W42A 3WT0A 2ZJPQ 2H3GX 2HBYB 1RAEB 4I2QB 3VHQA 3CCUN 4CBWA 3NGDA 1HKBA 1IKYA 3U9ZA 2CUYA 2PEHA 2J76E 3Q89A 4J7CA 2MQ8A 2FZGB 3P5TL 2VOOA 2Q0RA 2BM1A 5CCMA 2MMYA 2OEKA 4IOXA 2LYVA 1NU4A 3FE1A 3LUYA 3OTOF 4QS8A 3PKYA 2VG7B 1EP4A 4KB0A 3DDKA 1HBNB 3OD2A 5M2PA 2ASOA 4C3MA 2MHEA 3RWUA 4O55A 3WIVA 3LP2B 3E9LA 2O8CA 2CPYA 1N33F 2RRBA 4ECRA 3WNHA 3C6TB 2FLOA 3O5BA 2W6KA 4O3PA 3VV2B 4ECQA 2CWKA 1RWUA 5AE3A 1WTFA 3D1QA 2YNIA 1W97L 2FC0A 2VPZB 2B0GA 2UUBK 4USKA 3V6HA 2A1BA 4CM2A 4DR1F 4A46A 1H38A 5LSOA 1YTYA 4X4UA 2FJWA 4Z4GA 1M90O 4F4ZA 2YKAA 2ZBPA 2RHKA 5LMNK 1Y0HA 4FVUA 5D6GA 2VQEF 1Y97A 3HP6A 2UUBJ 4L72B 3NOCA 3JQJA 4UY8T 1JNZB 3CCEN 5GAGI 2G8KA 4ECUA 4DSFA 3Q7CA 3H7HB 3SSSA 2V69A 4OYOA 4ISGA 2J9EA 3GCXP 4CECA 2RN2A 1RA7A 1NAQA 2W01A 4OJGA 1ASWA 4NZ0A 1X7VA 2C1EB 2XYGB 2P9UA 4CT9A 1X9MA 2DPNA 5FD1A 4EFHA 3F0NA 2DNYA 4U7UK 1BC6A 4A62A 2J6SA 3QFUA 5D0EA 3MOZA 4KQZA 1KVCA 1TL7B 3R27A 4X4RA 4A47A 3A8KA 3K59A 1T44A 3ENWA 4GW6A 4ELVA 1YVNA 3GTYX 1T9WA 5B0FA 2EFQA 1GLLO 2P9PA 5J2NB 4U67Q 5HROA 4CZFA 4P73A 2R8KA 2P9IB 3M8PA 2F3JA 5F0WA 2AYMA 3V6JA 1UEUA 2F4VF 2L9DA 4OYPA 1ICEB 1LK5A 5A0YB 3J7AN 4UW2A 4CGFA 1YBTA 2UUBF 4QYZK 3T19A 3RRHA 1J53A 1HWJA 4QCLA 5H9FK 5BPLA 1MNEA 1VISA 3K9JA 2C3YA 4ZLPA 1N34K 3C15B 3V2UC 1RWXB 1NZ8A 4FYWB 1VGYA 3TVYA 4RG8A 2E2QA 5LMNF 3CUNA 5KQ8A 2VFTA 1LFPA 2ASPA 5GMKa 3QFWA 4QYZJ 1FFGB 3MMAB 1HBOA 1S5JA 5C2DA 2OI2A 4BRLA 2ASJA 3RR7A 5H9FJ 4FPIA 4JOUA 1N34J 4FYVB 4C0OC 2ERRA 2W9CA 3IBFB 3MEDB 2YHBA 4N5SA 2GCFA 2BQ3A 3DRXA 1HWLA 3GIIA 2V8VA 1BIZA 1B70B 3G6VA 1H74A 5C2GA 1HPMA 4EBDA 3E9OA 4FPAA 2YWHA 3D4JA 5J2PB 2C2ZB 3K9KA 3FR0A 1KS2A 3IG1A 2UV8A 2CZ9A 3QJPA 3MM7B 1Q7YT 4FJIA 2HBZB 1CJUA 4CJ7A 4DV6J 3IAM9 3D7SB 4WIIA 4B02A 1T3VA 2OELA 5JS2A 3UKRA 3W2VA 3MM6A 3K2YA 1JXLA 1EX8A 3NWRA 2DHHA 1OY9A 2HZVA 3DC2A 1RT7B 5LXRA 5J1EB 4WPAA 2XBPA 3DLGA 3RB0A 4CJEA 1RT6A 1T6DA 3RMBA 2WONB 3R9LA 3FK4A 2QWRA 2DNRA 1E6VA 3L3CA 3IWXA 1U49A 3CB4A 1S1VB 5ADXA 4DQQA 1WF2A 3ITHB 3UNYA 1KTVA 1IM4A 1N34F 4U6PA 2C3PA 1T8EA 4N8OA 5DDRC 1LWCB 4I1TA 2AU0A 3DOKB 1BDGA 2F65A 1GOBA 1HQUB 3W3SA 2RIJA 3WC0A 3HMJG 3GPAA 1HKGA 1VAZA 4BRCA 3GJSB 5IM0A 4CLTA 1BI4A 4GKKF 1WN7A 1RDRA 5A76A 4GVMA 4JI7K 2ZH2A 1IWAA 3W64A 1QQCA 2F9TA 1ZM3A 3I0RB 2CQPA 4PA1A 2N3OA 4YOYA 1N8RT 2HHVA 2FB0A 4H54A 4J9KA 3SDEB 2V51B 3H08A 3RR8A 2OPQA 1XEZA 2DEIA 1FKPB 3OL8A 2QA4G 1T11A 2MY8A 4FYYB 1EWRA 3MPYA 1Q78A 1PILA 5C24B 4JI7J 3CDEA 3TANA 5E84A 3FFIA 3BPDA 1NK9A 3BQ0A 2M7SA 2JH3A 2KG1A 3AOAA 2X1AA 3L8BA 4PQUA 3EZ5A 2BBEA 3FZBA 3QEWA 2XMWA 4FW2A 1EKEA 4EYHB 3D45A 4DHYA 5H1SQ 2KW4A 4CE9A 3O4QA 3B8AX 2BV3A 4QS9A 3CMEN 3CCWA 1VQON 2CDQA 2B9WA 1FWLA 1PJ5A 3M6GA 3MCPA 3I56N 4AL6A 3OSPA 1SIZA 2P2CB 4H4KC 2MKJA 3HRGA 3BH6B 4UZBA 1KDNA 3O2IA 4G9ZA 1QUPA 4AXJA 3FMWA 1ZOTA 3S8SA 2RS2A 1FRKA 4ZS6A 1GXUA 1L5UA 4FK2A 1K9MT 4H03B 2UVVA 4MFBB 1BIUA 3CERA 5E5NA 2A6MA 2VG5B 3CM5A 3THTA 3D9BA 3QAEA 1GQEA 1S9GB 1IKVB 4JI7F 4CGDA 4KHWA 2CNLB 3ZLJA 2V4JA 1FVSA 4IO9L 4I7FB 5K14B 4QJVA 5C5JA 4KKOB 1JJ2M 2YKNB 1YSJA 4FBTA 2RE1A 3MR5A 2J0QD 2AGPA 3IS9A 3I4HX 2KT2A 3BYRA 1WJ9A 1NJWA 2J7KA 1A5WA 2K3IA 3V6KA 3HHLA 1S99A 3JSMB 1SL0A 2UUAK 2NPFA 3OYJA 2F4FA 2XMJA 1XMQF 3T9NA 3BF3A 3G8SA 1PIEA 2WSFC 2CJAA 4F4XA 1S5ZA 3AO4A 1YJ9N 4XTTA 2KI2A 3PYGA 3VEWA 4M5NA 2DK2A 4DV1K 3CQYA 2O8FA 3S3MA 3TU5A 3P3DA 3H98A 1PGZA 1ZAXA 2UUAJ 2QA4N 2AEJA 2HQDA 4FWNA 4TQSA 4NLYA 3MCMA 1RAJA 1JLCA 4FS1A 1T9YA 3ATVA 4FWLA 4BROA 4ED0A 4QW9A 3V9ZA 3UN3A 4RBUA 6FD1A 1NO8A 4DV2K 3F44A 3NCIA 1H73A 3D3CJ 4M5MA 3O9RA 2DFFA 4AYBD 4BRKA 1OWXA 1IR1A 2M0GB 2QMWA 4QWCA 2CRLA 5F8IA 4NRTA 4YS2A 4I2PB 2C2MB 3VWSA 2FJVA 4DTOA 4B9MA 3M8WA 1SQGA 1RT1B 4HVZA 2AJ1A 4DV2J 4CO1A 2QM1A 4O0JA 3UNGC 2V8GA 3D6RA 3JYTB 5FIIA 2DXFA 4A8XA 3K2PA 4NA3A 3DU5A 2W9BA 3AVCA 3EVOA 1NG9A 2LCWA 5B0EA 4IKAA 3I8DA 1B0PA 3A4TA 1NJIT 4CEBA 4CEEA 1HYSA 4CGHA 2OD6A 3MN9A 5L46A 5TKWA 3ENBA 1SPBP 1GTEA 4F4KA 1ESVA 2KRBA 4FJGA 3A5LC 2MY7A 5L39A 1Q8IA 4DV1F 3EN9A 1KAZA 4TYBA 4FK0A 2XRIA 3NDKA 1SJQA 3ZZYA 3NRBA 3BKTA 3PJ9A 4BRQA 1YUWA 3C6AA 4CJPA 4B1WB 4I4BA 4YOTA 2BYCA 2H1YA 4Q0BB 2B3TB 2E1PA 4C7QA 2ACYA 5HP1A 4G1PA 4OLPA 1HKAA 3HVRA 4OJHA 4E1JA 4YB5A 1GLFO 4BRMA 1FF2A 2VC0A 2GMJA 2YKPA 1RI7A 1LAVA 2NXJA 5DDQC 5BRHA 4K4SA 5M1PA 3NLCA 4WFBL 2BE2A 4IFEA 4ZVRB 2YTCA 4OZ0A 2VJVA 1M5SA 4DR5F 2P5OA 1X4HA 1VBYA 1D4XA 4XDDA 1EWQA 4J9VA 1TU0B 3GZ7A 4YORA 1C0FA 2M8HA 3Q86A 4PPDA 2RRNA 4A2AA 3KLVA 2VKZG 1R0AA 3K5OA 1YJVA 2E7XA 5E33A 3OS0A 4C98A 4M8LA 2R7VA 3R6LB 3GWCA 3TUIC 4CEQA 3O3GA 2F8SA 2HYIB 5I42B 4Y28C 1X4BA 4CEAA 1TL4A 5GADU 3J7ZT 4ZCLA 5F8LA 1XIQA 4NMLA 2GELA 2QEXN 4DU1A 2Q79A 2VWBA 3O80A 4M5DA 3TQ1A 4DG1A 2K8GA 2I2YA 3OHAA 3OVBA 2PY5A 3F9MA 4HCCA 4NEYA 1NB2A 1FHTA 2OKQA 1JIHA 3LZJA 5F0UA 3QLHB 4UQTA 2W7OA 3T7ZA 4NASA 4JD2B 3CD5A 3RSEB 4JKAA 4IYQA 2KYZA 3SCLE 1S1WB 2RDDA 4RW7B 2IJNA 4F02A 1AA1B 1HWIA 4JHDB 2YQ0A 3KYLA 4L73A 3RBZA 5FPMA 2OTJS 2ETJA 3MM9A 3MXJA 1CC8A 4N56A 1WG1A 3UE5A 4CEOA 1VQPN 4OYIA 3FGVA 2OZSA 4M95A 3K8WA 2DRDA 1YRUA 1EKSA 3RG6A 1R89A 3D0GE 1B7FA 2LVWA 4R8UB 2FZKB 4GO7X 4FPBA 3MURP 4BC2A 5M1KA 4K4YA 5ETNA 3MR6A 3D6FB 3NMUA 2W7PA 4PEOA 4ED8A 1OH7A 1NZAA 1GLJO 1YI2N 3ZX2A 3LGNA 4JKHA 3NNHA 1LEOA 4CJFA 3V1OA 2DNZA 4PXBA 3KOAA 3I0SB 2MXYA 3EE9A 1OJ4A 2DR7A 1ASVA 2MKIA 1N32K 2HHSA 1FFWB 4DTPA 4OHXA 4UQGA 5AQVA 4EP4A 1JMTA 3OYAA 2HS4A 2DNOA 1PBUA 3SQGA 4JB8B 5D3GA 3ENQA 4D3HA 3AGKA 5DQIA 3T1HK 1S1TB 1JLEB 3RVCA 4KHNA 3QYYA 1S7HA 1ITGA 4H0OA 2P9NA 4MKYA 3H1QA 4DTMA 1JLGB 3H5SA 3NBPB 4OMFG 3CJ3A 3I33A 3T1HJ 1Y5NB 4QWAA 1R6YA 1J5OB 3FZKA 5JVHQ 4HI1A 2JL9A 4NZ7A 2NCKL 5DZ6A 2UYTA 2XULA 4H5WA 1YRXA 2E5HA 2Z58B 4OZ1A 3WXJA 4C8LA 1P8ZA 3MF5A 1Z2ZA 5ETPA 2DGTA 4ZPBA 4CZMA 2ZHBA 1VQ6S 3FEZA 3E01B 3VENA 2DNPA 5KRSA 1HL6A 4DMNA 1TUVA 1LNQA 4OKEA 2F8MA 2RQ4A 4LRDA 4FOIA 3FEYB 2MGZA 2XSFA 1BGXT 3AVNA 4FKXA 2P9LA 4KHSA 1F3FA 3AAQA 3DWLA 1N32F 2HNZB 2FBVA 3ENHA 2O8BB 2Y3YA 1IKWA 2RAQA 3WZ0A 5ADXH 1SB6A 1LOUA 2BEFA 3TTDA 1DTQA 1HBMB 3NGRA 1GOAA 3T1HF 2LQBA 4LREA 1QTNB 1RUSA 3ZSXA 3PEJA 5B0GA 4YB6A 2BKPA 2YNFA 3D6HB 4IH5A 3J7A1 2XLIA 4NXMK 3ZEUA 3VEVA 2AEMA 4ZP9A 3CMQA 2C2OB 2ZWOA 4FVCA 4PXEA 4PG8A 4C2MA 3CXCR 4FS2A 2CPZA 1FRLA 4PWUA 5GMEA 4BC3A 4B8AB 1FFSB 2Y0BB 4YHHF 2CQDA 1R7IA 3A8IA 2X1GA 4IDKA 4NX9A 5F8GA 3AA8A 2PE8A 3CJ5A 4KTWA 4RNHA 4NXMJ 1IJJA 1N5SA 4Z94A 3C6UA 5C2CA 3IN5A 1QVGR 1KLMB 5EHHA 5KG4A 3OUYA 5A8KB 1N5QA 1BQNA 3ZT3A 4USUA 1UVJA 2RF2B 1IQZA 4EP5A 3GFXA 4KO0A 2LXUA 2XWYA 5D4PA 3KLGB 2PN6A 5JMVA 1VQ5N 2MQPA 3LANA 3G8TA 1R27B 4OX7A 2JX2A 4XPCA 1BU6O 2OJ3A 5HL7L 1GOCA 1U2FA 4FF4A 4C3LA 3TI0A 3PIPL 2ZKUA 4IH7A 4UZCA 3JAMY 3MPWA 1T03A 1F5BA 4CLWA 3VPZA 4ZN1A 2AGOA 3M8QA 2Z8QA 3B4DA 2DGSA 3WXMB 2D0PA 2YVSA 1BHLA 2IRYA 1NJXA 1HW8A 3M2VA 2VFUA 2O4IA 1X8DA 4YEAA 2ALZA 4CNZA 2OA8A 3FZHA 2NYHA 4NXMF 4DI6A 5HANA 3SMPA 1AYEA 1B64A 5LT5A 2R7QA 2UUTA 2JEJA 4MTPA 4BRDA 1LWEA 5B8HA 4OX6A 1M90T 2ZUAA 5KFIA 4B3MK 4DXLA 4QOZB 2GVDB 4BLGA 4TLRA 4B1YB 4NLWA 3DRSB 3FEXB 5J2MA 5KOWA 1BE4A 4DX5A 4NLSA 3RAQA 1Q9YA 2RSQA 1CXQA 2AP6A 4CTAB 1WTBA 3EDRB 4KH5A 4B3MJ 1VRTA 1V6HA 1RTIB 1GTHA 3G71N 1HBUA 1WHVA 1X4CA 1G15A 1NGIA 4CBXA 4WCEL 4JYAK 2XG8A 3SCKE 1R8CA 3FDSA 2QT7A 2I7NA 2J6UA 1N36K 3MWPA 1UPPA 1W7AA 3QIOA 4AQYF 2ACMA 5DQGA 4DSEA 4G1QA 3ISNC 5IV3A 3B4MA 2P1JA 4JYAJ 1JCGA 1VHIA 2XYPB 2HBRB 3KLHB 2JDJA 1NJYA 4LR8A 2HNYA 3CDAA 4QIVA 3J7YP 1Q53A 1N36J 3O4NA 1S1UA 2W9AA 2PA3A 3U1LA 4CHOA 3PYDA 3C14A 3PKMA 3SMZA 2LFVA 2MEWA 4YOUA 2GO9A 2ZZTA 3NF6A 4LSNA 1R6VA 2UUCK 5FLXY 2E5LF 1PJ7A 1Y11A 2YWFA 3UDCA 1WC4A 1LAWA 1TYQA 3CPWR 3HCXA 3QGHA 5EWEA 1OPZA 4BY9C 4HTIA 4FPRA 4B3MF 1WF0A 3M30B 1XR6A 5D0GA 4EHTA 2MYFA 2B4VA 1HLUA 1U1NA 4EBCA 3JTNA 1BY9A 3SUNA 4EHUA 1R59O 4MIBA 5IT9Y 2K2PA 4NLUA 4BR9A 1XWLA 2RQKA 3VVUA 4V1Ak 2ALYB 3C16A 4KGZB 2GEMA 2FJDB 2C3MA 4NYZA 3P31A 1NNDA 4J90A 4OV1A 2XB2D 3B8HA 2JWKA 4JYAF 3QO9A 3CJAA 2LQ5A 4FWQA 1V3ZA 5AQHA 1VSMA 2GAHC 4DL6A 3UCZP 3MM5A 1N36F 1VSHA 5A8WB 3PO4A 2HBLA 2DGWA 3QB0A 4LF5K 3PW4A 3GILA 2P9SA 1EQMA 2IPOB 2KJWA 1MW7A 1SQFA 2IM2A 2PC6A 2NXNA 2V68A 3KJNB 2NREA 3THWB 2CZ4A 1NK7A 4Q8EA 3CF5Q 2MKYA 4N8NA 1JKHA 1NWKA 3NCQA 3KMQA 3QSIA 4LF5J 4YUDA 1HQEA 1BQMA 5AQPA 3AVHA 5MLCV 2ROGA 2UXBK 1VI7A 1U47A 4LIWA 2UUCF 2YNGB 3CJ1A 3KNAA 2HEKA 1VSIA 1EAYC 3O5TB 5I9EB 3OYDA 1ZYQA 1H7XA 3GE9A 4OJ1A 1TZ0A 3Q83A 1NXIA 5GAEP 4M3WA 3CJBA 4ZPAA 3DMJA 1NKBA 3CHWA 3V9UA 3ID8A 4LF2A 1RDWX 3G9CA 3OXGA 3L3VA 3EGZA 4BQZA 4FJ8A 2ZBCA 1OY6A 1ATNA 2QL9B 2GGPA 3KHYA 3AH6A 4BR7A 1Q4RA 1LKZA 2R7OA 3ZZPA 2GJFA 2DT9A 3DHWC 1U7LA 1REGX 4LF5F 1CZ9A 4R79A 4C8OA 4YDDB 4ED2A 1U26A 4H0PA 1TMJA 2V2QA 2YXLA 1Y5LB 1H98A 5M1NA 1S6PA 4RJVA 3TJAA 4I64A 4M45A 1SC3B 3SSRA 2NXUA 4AXIA 2UXBF 1NU0A 3PX4A 2QA1A 3N4WA 5LJVA 3THYB 1ZM4A 3GFHA 5L9NA 2ZBRA 2FVRA 1HHSA 2OLWA 3UB5A 5AZJA 5DM6Q 5DM7L 4HEA9 4M3XA 4AHTA 2XGPA 2KFYA 2ASDA 3NEKA 3DYAA 2BANB 2ZNYA 5K8MA 4DCPB 3TEGA 4CYUB 1RP5A 1HNWK 3L9ZA 4F4YA 3DLHA 4OKKA 5IWAK 3EKSA 1W2BR 3SPYA 1ELOA 4W5QA 4CJ4A 3HOSA 2AHOB 1O6XA 4KH4A 5KFVA 1QLNA 2ZOGA 3VEOA 4CLKA 2FQQB 2H48B 2BJ3A 1CJVA 4CLSA 3IR6B 2QG9B 5B0BA 3I9V9 3AA9A 1HNWJ 2G1DA 2V9WA 1EKRA 1ITPA 5IWAJ 2QKBA 4J9LA 2XHWA 3D28A 2WW4A 2OPPB 3L2VA 3OW2R 2LU1A 3U7JA 2BW2A 1AZSB 4LF8F 1K0VA 2JRSA 2YX7A 3E2EA 4ITSA 3HSJA 2WRMA 2OPSA 2O8EB 3MDQA 2HF3A 1E4GT 4TKTA 1M5OC 1B4SA 3FBFA 2LSNA 1DLOB 2MZRA 3BO2A 3AVJA 3V81B 4Z37A 2HRYA 3WQUA 2QL7B 2PFUA 4QR2A 1WBDA 1JLFA 3PRBA 3QJJA 2VF3A 4XPEA 3SAHA 3QIPA 2V67A 4PG5A 4NI2B 3PHEA 2QTWA 1Q86O 4IQMA 3PJWA 3T41A 3VAJA 1VJWA 3CJSA 1DEJA 1T6CA 3IA0A 1LXNA 2FVCA 3EZOA 2MQOA 1YK9A 5BRDA 4WK3A 1BCMA 3P5JA 2DFEA 2CJKA 3FZFA 4DQRA 2KU7A 2KN4A 1NPRA 2FF3B 4C4WA 1WC6A 2QL5B 2IIRA 3IAS9 4EBEA 4U7UD 3KHLA 2MKSA 3D1OA 2EW9A 2A2CA 1KVKA 4CH7A 2P9EA 2CPJA 3KLFB 1NJZA 3QT5A 4BR4A 2WC9A 2QWMA 2OO4A 4KRFA 2CVIA 3QNWB 3DU6A 3D5MA 3R3LA 4A8WA 1VLYA 4M3RA 4DV4K 3NS7B 1FRXA 4WFNL 1UVNA 4NLQA 4CHYA 1YITN 3JAMO 4EZ6A 5KFJA 4WXWA 2G4BA 1UW9A 1YQHA 3CJ2A 2FSJA 1S59A 1LW2B 3C7NA 3NGZA 2QFIA 3F5TA 4DV4J 3OR1A 1VS3A 3X3UA 2PO4A 2OYQA 4JI8K 4C11A 4XIUA 3AD7C 5D4NA 3KLIB 2DHSA 2FLPA 1UETA 4CF9A 2BMBA 2W7AA 3S6EA 5AE1A 4AE5A 1UTAA 4JI8J 3C94A 2A2DA 3KUHA 5KG2A 1J6ZA 1NGHA 5C7PA 1SL2A 4PKHA 1YRTA 2RD5C 3G82B 5AXNA 3FMBA 1FKOA 3PFOA 1VQNN 3CCZA 1NDCA 1RAFB 2HHPA 4O0NA 4BRFA 1QS4A 3D3BJ 3ETOA 4BCAA 3R2DJ 1JB0C 5BYQA 1X4FA 2VL1A 1RTHB 5AQZA 5ETRA 1P6TA 3SEOA 1B0TA 1WSGA 4BC9A 1RT5B 4DV4F 1XMBA 3WNGA 2P9KA 3CEDA 4CWBA 9RUBA 2G0JA 4CO5A 2OCEA 4XH1A 1ASUA 1XUPO 2XCAA 6AT1B 1U0HA 2JWLA 2E4LA 5U47A 3AD9C 3NH0A 5DS7A 4PWDA 3Q8YA 2AT1B 3OHRA 4RR5A 4ZJLA 3UFCX 4HTLA 1AFJA 3CCES 5KFLA 4JI8F 3OY9A 4LFCF 4GMKA 1REVA 4OI6A 2XMVA 1WC5A 1IBKK 3F2KA 2Z1IA 1H6KX 1O5JA 3P39A 3L95X 2V94A 1DQ9A 2BQRA 1LW0B 4EAHD 3KG1A 5KPRA 2LQ9A 1CVJA 3ZTQA 2JOQA 4FBUA 1JLBB 1RWPB 3C66A 4B17A 3MWBA 4URGA 2FLLA 2Q31A 3GIRA 1IBKJ 2KXFA 1RBAA 4B3RK 4QIWD 2ZH3A 2QLFB 4N7TA 2LMIA 1GMVA 3M8ZA 1JLQA 4EZ9A 3M2UB 4PY5A 2X6NA 1UJ6A 1VQ4S 1X9JA 5EDWA 1ZM2A 4OI3A 4HUEA 1RACB 1CBKA 2V8HA 5DLGA 4CIGA 3L3UA 3V9SA 4IBNA 4TNOA 4B3RJ 1ZBIA 3Q8QB 5B0AA 3HFVA 5AQGA 1PYSB 4RNMA 2VYPA 4R5PA 2OPRB 3LM2A 4IH6A 2J8SA 3DRPA 4ILGB 3PXGa 4E7LA 3VGKA 5KFBA 4DR4F 1S10A 5FDLA 4DV0K 3NF9A 3AV9A 5B0DA 2E9TA 1NGCA 4QR0A 4LRBA 1N88A 3DDNA 3BUZB 2QLJB 4K5SA 5FRNA 4LBPA 2X78A 1F9EB 3DOMB 2WOMB 3CM6A 2FC8A 1IBKF 4DV0J 1F5AA 2Z2LA 3VR1A 2P9CA 2UXCF 1VIXA 2ZHOA 4JKCA 3P38A 1K8AO 4KSEB 4IOCQ 4IO1A 5JXSA 4NRUA 4E7KA 4ZIVA 5KFZA 2YX6A 1P27B 4NB4A 1CULB 3OL7A 3A8EA 3SV3A 2J7UA 1NOZA 1WSHA 4W5NA 3SYZA 4DR2K 3RTVA 4FLWA 1Y9OA 5IQQA 4FLUA 5CQGA 2IVYA 4DQPA 4BR0A 1FTRA 3QRQA 2JEGA 4M5HA 4PUOA 3FZMA 3EDQB 1C1CA 4QPXA 2WVBA 3DGPB 3TX0A 5GAHU 1C0TB 3T5LA 3KZBA 4ZPVR 4FSVA 2Z4PA 1SKRA 4PL7A 1GAOA 2OSQA 3L7OA 2D1KA 3KFWX 2FVPA 4I6MA 8AT1B 3VQ5A 3M3ZA 4C1NK 3H1VX 1A6LA 3UD4P 1NM1A 1WEYA 1Q8BA 1HLWA 4LRCA 2NRTA 2P5GA 2POKA 4DSKA 2A6OA 2AYBA 2GNKA 3BBBA 2ZH5A 9ATCB 3VZIA 2Q1LA 2QSWA 4KHQA 1QAXA 1WUUA 2RS8A 2I5JB 4A8OA 5SZTA 2K3KA 2EWSA 3SJJA 1S6QA 2KYXA 5B08A 4MLEA 1GX5A 4DX7A 1IKXB 2VCPA 5LM7E 4JNEA 5A2QY 5C42A 3HPHA 4J2EA 4ILMA 3LF0A 2FJEB 1SL1A 2YI1A 1YG0A 2YJFA 2EG2A 2OTJN 3MTKA 2VH7A 2VJUA 4FJKA 4JI2K 3CJCA 3CGIA 1EP4B 1PC5A 1WHWA 4CJ3A 3W63A 4KREA 1S1XA 1F60B 3JSRA 1UWAA 3CJKA 3LOUA 1OQ3A 4FXVA 4OFZA 4O3RA 2O8CB 4DR2F 2DGUA 1X60A 3H5YA 3TQEA 3RRKA 3UVJB 5KAKA 2R8HA 4JI2J 1DQ8A 3R5GA 4BHQA 1RAAB 4FLXA 4YOVA 2YNIB 3J80Y 3FSXA 2NUUG 4FKYA 1YLXA 1ZAWA 4KGVB 2FLNA 3CMES 4JLHA 2YNHA 1VQOS 2CQCA 4K4TA 1U2VB 3I56S 4OJ3A 2UVUA 1KRPA 2VGNA 4DOZA 1DARA 3EMTA 4RUHA 4H5RA 1ZBUA 5KFOA 1XI1A 2GHVC 1EIYB 1SAZA 4WKYA 5L1JA 2QWPA 2X51A 2DTUA 4A8MP 4ANCA 3J7YI 1K0TA 1ZC6A 2I38A 1LWFB 2QMUB 4LF1A 2E1YA 2R2SA 4FWPA 2Y0SD 4LY7A 3MAAB 5KFCA 2JVOA 4WP3A 3R7BB 1J9AA 2P9UB 1C6VA 3R1LA 4DN9A 3FCWA 2JJ4D 3UKUB 3DOLB 4ZTJA 1GX6A 4M5LA 3DLBA 1Y7PA 4M5IA 3CJ9A 3CCSN 4E8UA 3CTRA 3L2QA 1Q7YO 2E9RX 4AD6A 4JI2F 1NBWA 2FVSA 3C6TA 2HQGA 4F0KA 1I94K 4CLZA 4BRHA 5DDPC 4DSJA 4DUZK 5AQQA 5K8PA 3HVTB 2Q43A 2E1AA 3CD0A 3I4PA 2MKCA 4DEZA 1C0MA 5HROB 3SQ4A 3QERA 1GT8A 3CDWA 4GRSA 3ET6B 4A8SA 1L3SA 1IV0A 2QGFB 3KG4A 1C1BB 5EWFA 3QAUA 1I94J 1SVDA 4MDBA 3V4IB 3UCGA 3IWLA 1WNEA 4DUZJ 3A8JA 1RWWB 4DR6K 4F2RA 3IMQJ 5L38A 4FCYA 1YJ9S 4PKGA 4CF0A 1G4CA 1RU2A 2R7UA 4JI6K 4RZRA 2HS3A 3P5BP 4RNFA 2V9KA 2QA4S 4CZIA 3TSUA 4NL5A 2DY4A 3MXHP 2YKMA 3MM8B 3OA9A 2G1HA 3PNIA 5F0XA 4F9OA 3MXMA 4AL7A 4DR6J 4JV1A 1NM2A 4W90B 5IQ6A 1L3KA 2LLZA 4JI6J 4FLTA 1HBOB 4PXCA 1J54A 1DJ0A 1N8RO 2LU2A 4BG8A 3IAYA 2W9CB 3POTB 2A0FB 2HKEA 2ZOMA 1HHQA 5ETQA 3VOVA 1FJCA 2VGMA 3DLKA 4Q5VA 5J2NA 3PO5A 5HQLA 1E4FT 4A57A 2P9IA 1K6YA 3QWUA 1HRHA 1TTHB 2L08A 5K5MA 4Z4IA 3ONQA 3W7BA 2ZH1A 2PYJA 3IG1B 1SKUB 1I94F 3J81U 5GAEI 1FRIA 1GXTA 2W2MP 3RMDA 5A0YA 1WC1A 3NP5A 4HTUA 4CFBA 1Y10A 5AQOA 2OAUA 2XMUA 1BXNA 4FLVA 2QYCA 1M0SA 3W2VB 3MM6B 3GONA 3Q8SB 3CG7A 1F0XA 4WWSA 2CPEA 3C15A 3Q8PB 5LY3A 3V1QA 3KK3B 3CXCM 4CEDA 3O1LA 3PIOL 3DLGB 2VOPA 4DR6F 1VLOA 1E6VB 3BR8A 1WHYA 5AT1B 2ZH9A 3ULEB 2D74B 2K7KA 4JI6F 3N0VA 2F1FA 4OYMA 4WKRA 1F9HA 3MMAA 2DRAA 5GADP 2G2ZA 1KTQA 3PJXA 4FYDA 4KGKA 1QVGM 5I3UB 5IFMA 2PSZA 2M4MA 3MUTP 3IUCA 4JI1J 4DMZA 1YWXA 2PBDA 4EYIB 3OS1A 3NAIA 4J91A 3AAWB 4P2FA 2CG8A 3HHNB 1MSWD 5DLFA 4DSLA 2B8QA 2E1MC 1DGKN 3VQ6A 3QGGA 4QAGA 5KRTA 4C9DA 3L4BC 2Z57B 4HACA 5J2PA 3SCJE 2HSTA 4DF8A 3MM7A 3OHBA 3TARA 2OPQB 1N56A 2CZVC 4DQ8A 1RILA 4I6WA 4IOAL 4DUYF 2ZJQL 5FLXU 2GFFA 1V4TA 4LF4K 1VQLS 4ZHRB 4OX8A 2VBXA 2M2BA 4GV3A 2VODA 4CZGA 3FFIB 1PCAA 5H1SV 2E44A 4FZVA 2EK1A 1J5EK 4AHVA 2YKQA 4ZLJA 1RT7A 5J1EA 3HFKA 1YBUA 4HR2A 3VGMA 4CF2A 5ETLA 4H4OA 4QWBA 3M05A 5F8MA 2GQCA 3PYFA 4LF4J 1S1VA 2WTUA 3IMXA 3ITHA 1ATSA 5AJ3F 4O3OA 3IC1A 3VQEA 2L41A 2CKWA 2F8TA 2HAFA 3AVKA 4LFAK 4KPCA 1LWCA 3DOKA 1KBRA 3OYCA 3BDEA 3U3GA 1HQUA 3LDQA 4M7YA 2BR0A 4I56A 3SIPB 2XTJP 1Q8LA 4CEZA 1IH7A 2COLA 4ALZA 3M8SA 1ZTTA 3LAMA 4LFAJ 3I9ZA 3I0RA 4TY9A 3PDNA 1T94A 2D3OR 4CHNA 3SDEA 4BRPA 3UCUP 4X4PA 1FKPA 5HRNA 1R8AA 2Q36A 4PKDB 2ZQBA 5C24A 1W7WA 2XNRA 3I87A 3ENVA 3M9OB 2XI3A 3TVKA 4AF1A 2LDIA 1F9FA 3NOGA 3OYBA 2VDHA 4XH4A 1UA1A 1VQ8S 1YJUA 4I68A 3K5PA 3RW7A 1VQPS 1Y3JA 4JP8A 3GCWP 1J5EF 1I3AA 1P90A 4IFVB 3AO3A 1TVRB 2CQIA 2Q0UA 1BD6A 2R8JA 4FW1A 5C25B 1D9FA 5EX3A 2KVQE 5KFDA 2H54B 1WKLA 1IBLF 1HR0F 4NLDA 3CD6N 5HQ8A 4JI5F 4XDCA 4X2BA 4LFAF 2F96A 5C15A 1X5PA 2B56A 5F8NA 3RU0A 4YY3K 2JVRA 1HI1A 1YI2S 3CPWM 1JLCB 2VG5A 3GMGA 1NNEA 5DG9A 3WQPA 4DPWA 2ABYA 4KBIA 3TTFA 2HIQA 4CESA 1EARA 4LSLA 1MLAA 4I7FA 4ECYA 3TAMB 4NPOA 5K14A 1WHXA 4E19A 4ID5B 4YY3J 4NMXA 4X4TA 1NLKL 4ZVSB 4YQWA 1GEHA 1H7WA 2VWJA 4WFXA 3BO4A 2IJFA 3L2RA 1QZ6A 4KIAA 3RB4A 4JV0A 1NDPA 2D3UA 4M1KA 5DDOC 2KT3A 1FKAF 5BPNA 1WC0A 4ZPDA 1VJQA 4O4GB 2GS8A 1TELA 3P4UB 1K47A 1QAIA 4WP9A 1PSDA 1G1XA 1WI6A 2NSCA 4NE9C 2IBKA 2ILZA 5DQHA 4ZP7A 3A3NB 2XMMA 3MAQA 1WF1A 3D0PA 1HYSB 2PD1A 4CLYA 3VAFA 5DETA 3M7VA 3ELHA 1UA0A 1VQ7S 4NLRA 1YVUA 2NS1B 3MUVP 1R43A 4JV5K 1SCJB 4K7QA 2JLFA 1D3WA 4BC5A 1KFDA 3M8YA 3Q23A 2XM3A 3B82A 3UWTA 4NLTA 1ZS6A 3JSYA 2AJ4A 2Q3PA 2Q66A 3CWJA 3CFPA 3BS9A 3HI9A 4AM7A 4CFCA 1H0HB 4I2PA 1Q86T 2V52B 5HP1B 5IV4A 1EETB 2ZZMA 1RT1A 4CT8A 5KFYA 4H0TB 4ZVHA 2W4PA 4BDZA 1Z2LA 1U4BA 3D6MB 2KXNB 4BGBA 1XNQF 1TFWA 3W9JA 1S0MA 3BPSP 4PL8A 1RDBA 4EO6A 4GO5X 1BL3A 3SQOP 4CJQA 5FJ4A 4A8FA 1HD1A 2ZVSA 5HMXA 3OYGA 1R0AB 5JVGL 3CC2N 2CH5A 2YQ1A 3NVKA 1CJKB 2ZH8A 1MROB 3CFOA 1IN0A 3LALA 1UCNA 3A5OC 3ALYA 3PW5A 3OQ2A 2BRKA 1RDCA 1RAOA 3OR2B 2YHXA 3LA0A 2QSFA 3PM9A 4DFJA 4LC9B 4JV5F 4C0BA 1ZH5A 4DL0C 2HVDA 4M3TA 4Z4EA 3OV7A 2YWWA 3TP2A 3G2XA 4ETXA 3CCVN 1NB7A 3HSTB 3W66A 4DX6A 3M2RB 4USMA 1QAYA 1NGEA 4DTUA 1RAHB 2IVNA 1V9OA 2CQBA 2NLWA 5F2RA 1HD0A 4BQLA 4OI0A 2GV9A 1BUPA 2ZOFA 2M8DB 1I51B 4FZZA 3U4LA 1YJ7A 4DTXA 1TKZA 4DL7A 3DNCA 4LF6F 1R0CB 2E1CA 1Z6RA 3OL6A 3SI6A 2Q6CA 3P8BB 2FHJD 4ISEA 1W2BM 3QRPA 4Q2MA 2UV8G 3CCLS 2ZGZA 5EVZA 3CD7A 4Y2IA 2QWOA 2DNMA 1U1LA 2YHYA 2VASA 3VAGA 4KV8B 1D9AA 2BUPA 3MM9B 3N4PA 2A3ZA 4Z7CA 4DTRA 5I42A 3TYTA 4DF4A 4ELUA 5HK4A 5CH7B 2X74A 1QE1B 5AQMA 3OW2M 4M3YA 1KAXA 2HMPA 2NXEA 4KHPF 3SAFA 3U8XA 1WEXA 4UT4A 4BGAA 1RCOB 1XMOJ 5AQNA 1K1SA 1Q8KA 1X3NA 4X4VA 5GINA 1FJ7A 4U8YA 3Q2SC 4IO9Q 3HXMA 4OZJA 3HPOA 3ZX0A 2ZBIA 3TUJC 4CGGA 3OYLA 4ZVOB 5KFGA 4YP3A 1VBXA 4JI0K 5IOLA 4JD2A 1FERA 3RSEA 3LM9A 1S1WA 3OYMA 4RW7A 2RU9A 2JC1A 1CZBA 3HO1A 2WB4A 1QQNA 3FNNA 4RW4A 2NUHA 4JHDA 1SZ2A 1V3RA 4ZK7M 5D3GB 4JI0J 3MEGA 3VGLA 4USIA 3OBIA 4P7VA 2ADBA 2KKZA 4YB7A 1N33K 4PABA 4A2BA 2PMZD 3VAHA 2BH1A 2CPXA 4EGLA 3OTOJ 1FE0A 3VQSA 1FDDA 3R3TA 4MIWA 3GYNA 4EK2A 2L9WA 3LDOA 3HVWA 4R8UA 1B3TA 1N33J 2V2KA 3PR4A 1NLVA 5K8OA 2P6TA 3NAEA 4EU0A 2GVZB 3I8BA 5M1OA 2LA6A 4HLBA 4DHVA 2IYGA 1ZBFA 5KFPA 1ZAVA 2VQEK 2VIHA 1DAXA 3I5AA 1VC5A 4ECWA 1S0NA 2O5DA 2FDNA 3THPA 4CH1A 3EEQA 3SUPA 4F3OA 3UR0A 2H4WB 4AHCA 3KKRA 2VQEJ 3DM2B 1SV5A 5CYQB 4UF4A 4XEIA 2ZD1B 3CC7N 2RJZA 4B9LA 4JI0F 4A4JA 3A0IX 4CK1A 1BQXA 2IAJB 1IBMF 2HFSA 2HGNA 1N4LA 2CQ0A 4DPYA 1JLEA 2WSEC 1U45A 3WDOA 2DGVA 1D5AA 3EZUA 1K8AT 2ZH7A 2VONA 2MZTA 4DDFA 4CGIA 1IKWB 1G7CB 4KAZA 3W60A 2E2NA 1YJTA 2C2RA 1JLGA 5H9EK 1JJ4A 2R7SA 3SCIE 2HRTA 3NBPA 2C3OA 3GV7B 1DTQB 2W4CA 1S49A 2DNGA 3OSNA 1NCLA 2BJ1A 2VBYA 3QT6A 2NR0A 3QGPA 4CJ5A 2F4VK 5FPEA 1FRJA 2YNFB 2MTLA 4JUZA 3AA2A 4E3SA 3AB4B 3VN5A 3IM8A 3FUYA 5F8HA 2VICA 3ZEUB 5AFUA 5IC4B 1P1LA 5H9EJ 2NRVA 1I5OB 2YHAA 1N48A 3CJ0A 1UFWA 2B5JB 2F4VJ 2CPDA 1UWBB 3HHEA 4HHTA 2JLGA 4DR7K 3R5AA 2HZAA 4WFBQ 4RU9A 1XQIA 3LL3A 3NGUA 1RKIA 3OUYB 3AOCA 2RQMA 2FF6A 3JXUA 4OKJA 2CADA 1QQMA 3ZT4A 2B9YA 4HUFA 3BV8A 5LMNJ 3U3YA 5G0RB 1O1WA 4ZA1A 2LQ8A 2HNZA 4KO0B 4Y1CA 3LPEA 4M5KA 1CLFA 1DQAA 1UFLA 1JL2A 3ZT0A 4WU3A 1RE1B 1SIWB 3N5BA 1HBMA 4DN0A 3PHTA 3R1XA 3RB3A 3AODA 1SKSA 3NY0A 1URRA 4O3NA 5KG5A 2QZ8A 2KB2A 1ZBHA 1VQ4N 3EUNA 1WC3A 4MKAA 3LPTA 4NLXA 5A8RA 1Q7LB 2DHXA 4Q7AA 1T03B 1RADB 4L3NA 1A0OB 1FNXH 3H3NO 1KSPA 1ILYA 3J81j 3TSPA 2Y1LB 1HW9A 1GXLA 2A5XA 2G9OA 4PQAA 3ISZA 1KR4A 3O9UA 4ANDA 2K1RB 1KLMA 4DX8H 4C8NA 2KDOA 5A8KA 1PYOB 4Q45A 1CS4B 3DXMA 2MQQA 4X62K 1LWEB 1UJ4A 4CZHA 5A2QU 5HMWA 2VPXB 3T5KA 2RF2A 4H5NA 3UQSA 4DR7F 4LD0A 1FRMA 3TABA 3SPZA 3HSGA 2AX0A 1YTUA 1YT3A 1RT3A 3KLGA 3AVAA 4GKKK 3WEEA 2VD3A 2R9LA 4X62J 1VR6A 4CHQA 1IR2A 3KLEB 2Q1NA 3MXIA 4ILLA 3HI0A 2EVZA 3TVZA 2G0IA 5HATA 2O8DA 5D78A 3MEEB 1U02A 4P72A 3RBEA 1KXPA 3W8GA 1RSCA 3WUHA 4LBHA 1QSLA 3LWMA 4GKKJ 1OMSA 3IBWA 5CD4H 4K41A 3D0IE 5KT3A 3I6PA 5GADI 3ETMA 1TUWA 1N5YA 4CI6A 2EG1A 2ATQA 3RAMA 4EUVA 1H1VA 2APOA 3MMBB 3TR5A 3SBGA 2FGOA 5KI6A 3FVYA 1IJEB 1OIAA 2HNYB 1YIJS 4FOEA 4CCHA 2DNHA 3D68A 3NGYA 1S1UB 3A12A 3G10A 2N4DA 2PAVA 4ZN3A 1DRZA 3MD1A 1F1BB 3KVGA 4E1NA 3P1GA 3HM8A 3OYNA 1M1KO 5ETKA 4PCQA 1KWMA 5CA5A 3O9QA 1R31A 2HIYA 3DDIA 2KHOA 1ZBLA 4X62F 2R7TA 3CCRS 3EVWA 3FSIA 4CTAA 3QDKA 3HF5A 3VETA 4BDYA 2DR9A 5J1NA 3ZZOA 1RTIA 2BKNA 1F2GA 1KKHA 4YOXA 4FK4A 5AZIA 3TAQA 3M1VB 1RGIA 5AXMA 4LMZA 4GNIA 1U09A 2KG0A 2DHAA 4RLEA 2IC3B 2IVMA 1WOOA 4ZCIA 1KLNA 4MYUA 3CIMA 2OP5A 1BWVA 4U8VA 3H59A 5K9FA 2DXDA 3I32A 3Q2TC 2V2ZA 4Y2MA 5CXTA 3QEXA 2ZEJA 3CJ4A 3Q24A 3PYEA 2DIVA 2NPIA 2KQ2A 1WAJA 3I55N 3MM5B 4CFDA 1RT2A 3A3OB 3FJ2A 2D41A 4Z4HA 1XMQK 4FJ5A 3ZNJ1 2P9SB 3GYXB 2E5JA 1T0TV 2DITA 4OPJA 5L1KA 1HMVB 4K4UA 5BPMA 4FZYA 3QBCA 1ZZFA 1N6QB 2N82B 1Y4ZB 2LEPA 2HBKA 1TMMA 2RPIA 2DPIA 1YITS 4IJAA 2OHDA 3EL2A 3HL8A 4I0WA 4H0XB 1XMQJ 3V9XA 1L3VA 1PKUA 3T1AA 1BQMB 1HQEB 4MK7A 3QEVA 1HI8A 2D7SA 1HNIA 4KH6A 3K57A 2V8PA 2ZE2A 3PW2A 2JEIA 1R8HA 4JKBA 2PDAA 2HWHA 5DG8A 2Z2YB 3ZC4A 4JS5A 3H4BA 4NCGA 1XR5A 3O9SA 2VU5A 5AQYA 3RJMB 1X4EA 2O67A 5HBMB 4U96A 4TQRA 1BWEA 4KFBA 3T1YK 3AQOA 2I1RA 2BOAA 4CO3A 3EE8A 3ATUA 4G6VB 3Q7BA 4TSXA 3VCDA 2FC9A 2DTJA 3W5ZA 5A8WA 2JNJA 2AP1A 2OFGX 3OYEA 3LPUA 2RH3A 1VQNS 3TUZC 2VC1A 4CJLA 3T1YJ 1GLCG 5C12A 4ZVFA 3Q0AA 3S1TA 3KD1E 1FJGK 2CAJA 4DV5F 2G8HA 2E5GA 2KTQA 1P9QC 1RLDA 3THWA 4NA1A 1U1RA 5CAAA 2DR5A 2M52A 5HVFA 2ZWHA 4P74A 1NEEA 2HBQB 1MWZA 8RUCA 4CP5A 1DFDA 4CI0B 2HVHA 2EXUA 2JEFA 2HLTA 5D4OA 4FJNA 2HQ3A 3VGTA 1FJGJ 5IXUA 5KFHA 4AHUA 5LJWA 1D1UA 2R7RA 4TY8A 3H2VE 5KFEA 3NG8A 2XZWA 4CZKA 4WYBA 2RUSA 3RGIA 1D09B 1JLAB 2O66A 2QLBB 3VQBA 5CZ1A 4JRPA 1HNVA 5HL7Q 3TWZA 4IG3B 4OHZA 4O5BA 1QSYA 1HPZA 1YJRA 1VRUA 1A5VA 4FL9A 2UUWA 3B54A 3BKUA 4DV1J 4AUKA 3PIPQ 4IRKA 2KZMA 2FUG9 5DRKA 3HSZA 4OI1A 4ECZA 2ZDOA 5AZJB 2GJIA 2FYXA 4F4WA 2VB6A 4RW9B 3DHXA 1NH8A 4LQ3A 3T1YF 4DR5K 3DYAB 2MZ1A 1H2VZ 3VEYA 4BE1A 1X5TA 3DN9A 3O3FA 4K42A 5HVHA 1UW4A 2DH8A 1MN7A 3GV5B 4O23A 4C8MA 4DPXA 1W26A 2HHTA 2UVWA 3THVA 4DR5J 4U9RA 1H2TZ 3OTDA 3S41A 1FJGF 4RW6B 4YB1P 4FWKA 1OH6A 2KH9A 4YR3A 2FXUA 2YHWA 2IFXA 1UOCA 5EY4A 3W9IA 4UUXA 1OS5A 3FCHA 3P96A 4U95A 1TAUA 1KP6A 4A8QA 3U9DA 3LAKA 1VC6A 2ZUGA 3GFZA 2XS2A 1T7PA 2R4FA 2J9CA 2QI2A 3CETA 4J2BA 1F3VA 3V1RA 5HLFA 4CZCA 4F67A 4CO0A 4WCEQ 3H4DA 5GAHP 4B3TF 1KN6A 1MWKA 1FK9B 1Y3KA 3CC4N 4F25A 2VG6B 2HB5A 1Q79A 5D0RA 4LT6A 2BANA 1XN9A 1JLFB 2W8LA 3TUPA 4CYUA 2VFRA 4PHTX 3WQTA 3N6MA 2WVCA 4NLPA 4BG9A 1PJ6A 2CA9A 5DGBA 2JGUA 2MQMA 3ZYYX 2EFPA 3N6LA 3Q8UA 1HHTP 3NNAA 1F5CA 2R7YA 2H3EB 4FF2A 2SXLA 1JX4A 1KNZA 3PTWA 1VQLN 2GIQA 5ETSA 3SSQA 4NOHA 1P8GA 4M63C 1N54B 2LQJA 2OMOA 2I9SA 1A5XA 5KFFA 4KT0C 3A5NC 4JAXA 1AZSA 4LIRA 2DJWA 2ASMA 1HARA 1MWMA 4OI4A 5G4DA 2O8EA 1V5VA 1S9FA 4C1NI 1C0UB 2H5IB 2J9DE 1XJWB 1SI9A 4B3OB 4X4QA 1DLOA 4YOWA 3HHDA 3V81A 5E26A 2M88A 2HGLA 4AL5A 2BX6A 4K4ZA 4N76A 4ED4A 1RQ0A 1DTTA 2R8GA 4DU4A 1BLUA 2R7XA 1UVIA 4Y0FA 2GBZA 3M1FA 3OR1B 5JUMA 2QJ3A 4WFYA 5KT5A 3HVAA 4M5JA 4C11B 3AY0A 1I39A 2IVPA 3RBDA 1IQTA 4DR3K 1XTZA 4V19J 3DXKB 2KHCA 3B6PA 1Q18A 5EXWA 1GNKA 1OO0B 3C2PA 3KLFA 2U2FA 4F0MA 3RZAA 3DLRA 2OD4A 5KG6A 3UDVA 2FPHX 1RAIB 3UD5A 4K2JA 3G25A 2ZC4A 2W40A 3LZIA 3TSQA 4DR3J 2E20A 1FEEA 2HQIA 2PT0A 3VQ8A 3BKFA 3EO3A 1VQ8N 1BHNA 2MLZA 4ID8A 5E3PA 4QQBA 3WBZA 2HBMA 3T6BA 4CH0S 3I31A 1KQKA 3KWIA 4KHMA 4J9UE 4LR9A 1QQOA 3CJ7A 3GB0A 1MU2B 3M6UA 3ZNUA 2BGGA 5EGYA 3DXBA 4CLLA 3D1HA 3LTOA 4R25A 3HYFA 3TW0A 2P9KB 2H5JB 4F26A 2L48A 3KLIA 1G3OA 3HHLD 5KT2A 3QETA 1U0HB 4IG0A 4KTZA 4ZVUB 4PWDB 2CJBA 3L7PA 3H3OB 4DZ6A 5JS1A 4FZXC 1PG5B 4QOTA 1REVB 4FWOA 3L2UA 3G82A 2OMLA 2WBRA 4JI4K 4Z7YA 4DR3F 3M4XA 5LSRA 1T05A 1WORA 3D54A 1SJ3P 5T7LA 2CWXA 4A48A 4JRQA 2ZH6A 1N32J 4TYAA 2DGXA 2GWJA 3IKMA 3VQPA 4I9LA 3G6YA 2UXDK 1KCFA 4WQ4C 1SJFA 2I0XA 3CCSS 3MWTA 4JI4J 3AD8C 1RAGB 2U1AA 1JLQB 2NRXA 3JB9k 2XMTA 1BA1A 4YHHK 1B9FA 3BF1A 3P49B 4FO0A 5AQRA 3EKUA 2Q2RA 2UXDJ 4ZIWA 5HN0A 2E6MA 5DM7Q 1KVIA 3G8QA 1VQ7N 3OBYA 1WEZA 3HSDA 2DEJA 2DHGA 2W4DA 2MZQA 3BO3A 4NYFA 4R5PB 2EKYA 4WXOA 4J5OA 5GAEU 3OT9A 2G8UA 3CPEA 4YHHJ 1TKDA 2BE7D 4QIGA 4I67A 4DLGA 1UEKA 3DRYA 3C95A 4TXSA 5FDLB 2MLXA 5KG0A 3FSYA 4WFAQ 4MK9A 4KR0B 1LW0A 3JQKA 4M42A 2ZH4A 1JLBA 1FEHA 3C3LA 1XERA 2G8VA 2MJNA 3PVXA 1X9WA 5F41A 1X4DA 2KM8B 4JI4F 3W62A 2VFVA 3MX2A 1KOOA 4FJJA 3R9PA 4DWIA 3BP8A 3ZSOA 4LF9K 4HH1A 1WOQA 5THWA 1S0VA 2P5VA 2UXDF 3BGRB 2HHQA 1TL1A 1NMEB 2GW8A 2ZKTA 4NEZA 4PAAA 3K0SA 2UVRA 1BOTO 4AFFA 3H90A 4WQ5A 5DG7A 3GR0A 5B7WA 3LQVA 4QU7A 2OPRA 4I6YA 3GSIA 4LF9J 2J5AA 5E41A 2GO8A 1C1CB 4FJ9A 4GY2B 1WOPA 2A1RA 4K0KK 3ZZ0A 2HNDA 1MA9B 1S3XA 2BVZA 2J0XA 3OFHA 5LOQA 1Q0NA 1BUXA 4RTFD 2GX8A 2F8HA 4OZ5A 3AO1A 4I6MB 5M2UA 3DOMA 3AVFA 4CJVA 3F9KA 3ZZZA 3FLCO 4QWDA 3MPUB 1N0VC 2QMXA 4Y2KA 4K0KJ 4IDHA 2F5GA 3PSFA 3Q22A 4ICLB 2XYHB 4F50A 4RX6A 5GVQA 2VBWA 4AQYK 4CLFA 3CDUA 2I6WA 2O3DA 1WSFA 1CULA 4WFNQ 1SC1B 3CCLN 1B99A 2ZF5O