4KV8A

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase P66
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 152
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kv8A05
3V4IA 2BANA 3GYNA 4CJ3A 2G8WA 3VQ7A 2AGPA 3L2QA 1JLCB 2XY6A 2VG5B 3CVKA 1S6PB 3ZSWA 2DFHA 4FZYA 1KLMB 3BSNA 3V6JA 2CKWA 3N6NA 1DTTB 3SPZA 4K4UA 3NKYA 5KFZA 1FKPB 1XHXA 2XI3A 4TN2A 1RA7A 2C22A 2OZMA 3K59A 3TWHA 3AVAA 4NCBA 3BGRA 4DMNA 1X9MA 4GC6A 3PR5B 4Z4EA 5C42B 4F50A 3KMQA 4ECZA 4NLUA 1FK9B 2GC8A 3KHGA 4YR0A 2XY7A 4IR1A 2W8KA 3SQ2A 2C2RA 1EKEA 4CEOA 1WSIA 4MK9A 2VG7A 5DQIA 3NH2A 1VRUB 1B9FA 4B8CA 1ZBIA 3MR2A 1RTDA 2F96A 3BQ1A 2FVPA 3PV8A 1JKHA 1L3TA 5EDWA 3DRSB 2QV6A 2WOMB 1ZYQA 5EUHA 4KFBB 5EWGA 4IFVB 3QO9A 3VQ8A 4O55A 3LP1A 2JLEA 4GC7A 2VWJA 4DL5A 2DTUA 1S1VB 5KT6A 1NNDA 4R0EA 1EETB 4CGIA 3QERA 3V81A 2G8HA 1QAIA 3QIDA 1RTIB 5KG0A 2ZKUA 4ID1A 4H4MB 3KLGA 4KHRA 4CEDA 2DFFA 2F8EX 4KHQA 5JUMA 1NHVA 1NK0A 5HRNA 1VK0A 4HUFA 4KV8A 3SUPA 2BQ3A 1KTQA 1LWCA 4CEEA 2YKMB 4AHSA 4IBNA 4RW8B 2IC3B 1QS4A 1WLJA 3M8QA 4KTWA 3GQCA 1S1TB 1WSGA 2OPSA 5KT7A 1MMLA 1JXBA 4O4GA 3BSOA 4KREA 4BWMA 4ID5B 1CSJA 5KFWA 1DTQB 3DLKB 4I7FB 2JEGA 3AVLA 4KKOA 3CQ8A 1T94A 3OYLA 4ZVFA 3VQ6A 2VG5A 5KFXA 3NE6A 1WN7A 4QOZB 5L9XA 4CF1A 1KLMA 4FK4A 2A1SA 4M41A 4MFBA 2WCXA 3EY1A 3O4QA 4ED1A 4QWDA 1IKWA 3E01B 4C8LA 1SKSA 1HJRA 3LP0A 4FJ5A 2J6UA 4Z4FA 4NCGB 5KFOA 3IG1A 3IN5A 1HNVB 4Y2AA 4LSNA 1QSSA 4H8KA 3SZ2A 3GILA 3NHGA 1G15A 3F73A 4M42A 1S1UA 1RYSA 1T03A 3SFGA 3NCIA 3SJJA 3S3MA 2JEJA 1TL3A 1C6VA 4K4XA 4TQSA 4RZRA 3ZSXA 4J2BA 1LV5A 4O3PA 2B5JB 2WB4A 3PZPA 3H40A 2YV0X 4RG8A 4NLRA 2XCAA 2V4QA 4FM2A 2RF2B 5F8MA 3BQ2A 5I42B 3DRSA 3RB3A 1KFDA 3VQPA 4KFBA 2UUTA 4KAZA 4AHUA 3LP2A 3T5KA 3QEPA 2YNIB 1RYRA 4CEAA 3RBEA 3AVBA 2BDPA 1BQNA 3LALA 1RTIA 4M3UA 3JYTB 1TQLA 1SV5B 5KG3A 3OYHA 4DLGA 3ZT2A 3LAKA 5KFLA 3KTQA 2R2UA 4B9VA 3PJWA 3EPIA 2HMIB 3DLRA 3PR4A 1U09A 4ED7A 3LPTA 3PX4A 4DTOA 3B6OA 4CIEA 1GOCA 3NF8A 2ILYA 2OH2A 2Y1JA 4JUZA 4M3YA 1LWFB 1LW2B 3T5LA 3Q8QB 4ID5A 3AVMA 4IG0B 3DYAA 4I7FA 1RBUA 4CJLA 3NFAA 4HUGA 4ECSA 3HL8A 3DLHA 1U4BA 1JLBB 3L8BA 1EXQA 4K8XA 3PUFA 3PJXA 3TAFA 3L3VA 3ISNC 4I2PB 4EBDA 4GW6A 2AWZA 4FJIA 3KLEA 1X9WA 1S4FA 1TV6A 3KHLA 2HHVA 4CJWA 3AVCA 4DLEA 4TLRA 2V9WA 1S9GB 4TY9A 2W7PA 2R2SA 1RBSA 4WE1B 1Q8IA 4KHSA 1RTJA 4FJNA 1JLFB 1U48A 2I5JB 4NLDA 4NLGA 3PX6A 1C0MA 4H54A 3KKSA 4BE0A 4KSEB 2R8IA 5FROA 4MQ3A 3M9NB 5KRTA 3HP9A 2P5OA 4O0JA 2YKNB 2UVUA 5L1JA 1HPZA 4IFYB 5DQHA 3NGZA 4CK3A 4DG1A 3SUQA 5I42A 1S1XB 2V4RA 1TKTA 3GV5B 4K4VA 2C2EA 4CHYA 3TARA 3B6PA 4ZPCA 3H5XA 2YNHB 4JS5A 3JSMB 3H08A 3FQKA 1ZBHA 2W7OA 1B92A 4ELVA 2W9BB 5KT3A 3KJVB 2UVRA 4DS5A 4CFAA 5KT5A 1HYZA 4F4XA 2AX0A 3D5MA 4ZPDA 2BE2B 4B9MA 1TK8A 1BQMA 4ED2A 4OPJA 3MTKA 1LAVA 3NMAA 4LY7A 4ECVA 2R7YA 4RW4B 2GUIA 4CJRA 1CZ9A 3H98A 3MECA 1WAFA 3AVGA 4LH4A 4CJVA 4M94A 2GBZA 5KT2A 1T7PA 4FJJA 3AA5X 4RW7B 5CZ1A 3L3UA 1RT7B 1LWFA 3S3OA 3NBPA 4NLSA 1LW2A 3FQLA 4LH5A 3G6VA 4IG0A 4K4YA 3SUNA 3V1OA 4NLTA 5I3UB 1C2PA 3OL8A 1HNIA 1QSYA 1TKXB 1RAJA 4CJ5A 4FXDA 5KFFA 3AO3A 3TR8A 1XR7A 4HUEA 4AHVA 1T05B 1RT1B 1GOAA 2BRLA 3QETA 1RT4B 1NK8A 4HCBA 3PW0A 4URSA 3AA3A 1WSJA 2DPIA 4WE1A 4CJEA 5C24A 3VQ9A 3T3FA 3SI8A 1B9DA 1DLOA 4DQPA 2X6NA 3LPUA 4RNFA 2I5JA 4B9LA 4Q8FA 3OYDA 1A5XA 4E1NA 3A2FA 1D1UA 2RPIA 4CJTA 1KLNA 4F4YA 4ZVHA 1JL1A 3LWLA 2Z1HA 2YKNA 3CJ5A 3VQCA 4IFYA 1TK5A 4M3WA 3IGNA 4WFZA 5EWFA 3QEXA 1C0TB 1LWEB 2G8KA 4DU3A 3I0SB 2J6SA 3KK3B 3C6UA 3KK1B 3TI0A 3SV3A 2ATQA 4RNNA 4CHPA 4ED6A 1F21A 4KAIA 3GV7B 1IH7A 3KK2A 5DGBA 2W9AA 3D45A 4ZVGA 4YFUA 1KHVA 4ED8A 3KLHB 2YNFB 1K6YA 4LQ3A 4PY5A 2OPPA 3SCXA 1X9SA 3IS9B 5HRRA 3V6HA 3NF7A 3HT3A 2HNDB 5DLFA 3AVFA 3CJ3A 2FJVA 1JLAA 3HVWA 3G6YA 2G8VA 1VRTB 4DFPA 5J2MB 4N47A 1BCMA 1RT7A 2IAJA 1Z25A 5JS1A 4K4WA 5HLFA 1N4LA 4FLUA 3SPYA 2DY4A 1T8EA 3L2WA 1WSEA 3OS0A 5KFEA 5KG4A 1N48A 4E89A 3LZJA 2HHTA 2FVCA 1FKOB 4JLHA 1KSPA 3UPFA 1XR5A 4MKBA 1T05A 4KO0B 2Z1IA 1W9HA 4PQUB 2JC1A 4WFYA 2C28A 4DSEA 3V1RA 3NAHA 1JLQB 4RUCA 4R8UB 4W5OA 4FJMA 4O4RA 4LD0A 4E7IA 1NK4A 3VQ4A 4E1MA 1W0HA 2GV9A 5KFDA 2NUBA 4FJLA 3T1AA 2YNGB 4DL6A 1TVRA 2IM3A 4OKJA 1RT2B 3RTVA 4EYIB 1SKRA 3DRPB 3H2LA 4LSLB 1LWEA 4KHYA 3CFPA 3I0SA 4IKFA 1C1BB 3V6KA 1L3VA 3KK3A 3MXMA 3DLGB 1FXXA 4OKEA 1EX4A 4CHNA 4FJ8A 4Q45A 5CYQA 1IKVB 1S6QB 3DOKB 1S0OA 4O0IA 2V0NA 5KT4A 3LAMA 3AVKA 4NZ0A 4DS4A 2OPQB 1EP4B 2IMWP 3FFIA 3IS9A 3FDSA 3NGYA 4CFCA 4TY8A 2HNDA 3VQQA 3NDKA 1C1AA 2VG6B 2XGPA 3AO4A 4FM1A 2ITGA 4DF8A 4AH9A 2FVSA 3SQ4A 3IRXB 3MEEA 1S49A 3VA3A 5KRSA 3DM2A 4H4OB 3PY8A 1D9FA 2OYQA 3ZT1A 1QE1A 2D0AA 3HVTB 4FBTA 4CEFA 3ISND 4Q0BB 1S1WB 2B6AB 4J2DA 3DI6B 4DTUA 4M45A 1TK0A 1S9EB 4J2AA 3N6MA 4DU4A 1FKOA 3ZSVA 4NLPA 4KTZA 3PVXA 3G0ZA 3DLBA 4ZPBA 2ASDA 3OYBA 3OS1A 3WNFA 4HKQA 3SUOA 4FJ7A 5HRSA 4NLYA 2EX3A 2RKIA 2CJQA 2Q3SA 5KTQA 4PQUA 1VSFA 1UWBB 3UR0A 2B43A 1WNEA 3Q8RB 3PHEA 4I2QB 3HPHA 4R8UA 3HXMA 2IDOA 3SV4A 2WONB 1LW0A 4CJPA 2F8TA 3TQ1A 3DDKA 4EP5A 4RW9B 4WXWA 2YNGA 1HARA 3DRRB 1WSHA 4MIAA 4F2SA 4Y2CA 4KB7A 3S9HA 4JV2A 3AVJA 4FLTA 4ECWA 2QE5A 3MXJA 1ZETA 1TGOA 1WNSA 5KFRA 3KLVA 4FLWA 3OYEA 5DLGA 4LSLA 1JLCA 1GX6A 1KCFA 1TAUA 1C1BA 1S6PA 1SL2A 4M3ZA 3KHHA 3I5AA 3OSNA 3HVRA 1DTTA 3UQSA 1ZTTA 4KBIA 1FKPA 4CERA 1L3UA 2W9CB 4KHUA 1IKVA 4G1QB 2HAIA 2IJNA 2ALZA 1UA0A 4AHRA 2D7SA 1X1PA 3RWUA 4O3NA 2OPQA 1EP4A 5CZ2A 5C42A 2HB5A 3V9XA 1RNHA 4BE2A 2XY5A 4JRQA 3MF5A 1L3SA 3FRZA 1RDDA 1FK9A 4CK1A 4E19A 1NKCA 4ZVEA 3NF6A 4JS4A 4FM0A 2UVVA 1IKYB 4DL2A 3U6FA 1VRUA 5KGXA 4IH6A 5J2QB 3TABA 4DF4A 4J9NA 2OZSA 2WOMA 4H4OA 4IFVA 3CJ2A 3SNNA 4ECQA 2B6AA 4B9NA 4KB1A 4FJGA 4ZMMA 1S1VA 1SH3A 1EETA 2HHUA 4C8KA 3RAXA 2VA2A 4YMEA 1TKZB 2R8JA 3NH1A 5KFIA 2FBXA 2XO7A 2A1RA 3PO5A 4H4MA 3LZIA 3QLHB 3RB4A 4OPKA 2HVIA 4AILC 5J2PB 4QW8A 3MEGB 3VQEA 4CJ4A 2ZQBA 4I2QA 3K2PA 4CCHA 1BISA 3Q8PB 3TAQA 4RW6B 2YKMA 3WNGA 3OLBA 1YVUA 4TQRA 1D8YA 3VQDA 4ICLB 4RW8A 3OSPA 2IC3A 4JV1A 1CXQA 3BSAA 3DRRA 2AJQA 5F8GA 1S1TA 4CF2A 3L2VA 1NJZA 4PUOB 1J5OB 3TAPA 3LANA 3AA2A 3VA0A 1DTQA 3DLKA 4FJ9A 3QGGA 4M3TA 4J9QA 3QEVA 4MIBA 3DLEB 3GIKA 5HRPA 3M8PB 1QAJA 3RB6A 3ZSQA 3ZSOA 2IM0A 5KG1A 1K1QA 2UUWA 4M95A 3H5UA 1GOBA 2GIRA 3MR5A 3ASMA 1ZTWA 5KFVA 4NYFA 5C5JA 4IDKB 3E01A 4O44B 3MFHA 4X2BA 5HBMB 3AA4A 3KD1E 4IH7A 1JX4A 3ICLA 4G1QA 4IH5A 4NCGA 1YVFA 3NGDA 1HNVA 4IKAA 4ZTJA 5DQGA 4CGJA 3K57A 4O3RA 2FVQA 3CDWA 4J9RA 2IGIA 2BRKA 4NCAA 4Y34A 4W5NA 4BDZA 4PA1A 1J9AA 2IM2A 2B5JA 4J9SA 2KZZA 1NKEA 1RBRA 4DL7A 4OVLA 4E7HA 4EBEA 3BJYA 2J6TA 1NJWA 2RF2A 4J9LA 3I0RB 1YT3A 4ECYA 4DTRA 5J2QA 1SUQB 5KFGA 1D9DA 3MEDB 1N5YB 4N41A 4QWBA 2YNIA 5F8JA 4EBCA 3RBDA 4IRCA 1HQEB 1D5AA 1A5VA 1NHUA 3MR3A 4K8ZA 4DEZA 3WNHA 3TAGA 2I1RA 2D0CA 2XCPA 1TKZA 3JYTA 1SV5A 3HKWA 4ZTFA 2AX1A 5J2PA 4ED0A 5CYMB 2HMIA 1W25A 1KVBA 4FVMA 4TSXA 4J2EA 3MEGA 1KHWA 4NLVA 4URQU 4RW6A 3IAYA 3MR6A 1NJXA 3HPOA 4WZQA 4KB0A 2C2DA 4PUOA 2R8GA 3K58A 4DQQA 5KG6A 5HROB 5KG7A 4BDYA 5FRNA 3OYFA 4DL4A 2B4JA 3CM6A 4HYKA 4K4ZA 4I9QA 2PY5A 3NL0A 1JLBA 1N6QB 3KLIB 4Q8EA 1RA6A 1HQUB 4I2PA 4J9PA 1RDRA 4CESA 3C95A 4DSKA 4IDKA 5HP1B 4KHNA 5HBMA 3VQSA 4EZ9A 3RMBA 4L8RB 4FLZA 1S9GA 3T5JA 4M3XA 2AU0A 3H5SA 2RN2A 4QWCA 1S97A 1JLGB 5DG7A 4QPXA 1JLFA 5K14B 4MH8A 1HYVA 3CM5A 1IO2A 1U04A 3I5BA 5KFMA 4TXSA 2QK9A 2HW3A 2FJXA 4ELTA 3OHAA 3AO2A 2JEFA 1HRHA 3LDSA 1Q9YA 5T7BA 4DTPA 5FDLB 5J1EB 1IKXB 4ZHRB 1JXLA 1RILA 2IM1A 4NRTA 1ASUA 4F3OA 3KLFB 3G6XA 3HYFA 1S1XA 2E9ZA 3MEDA 2WRMA 2ZD1B 1QUVA 1XC9A 3OY9A 4FJHA 3T5HA 4O3OA 3HM9A 2YNHA 4DFKA 3JSMA 1VSHA 4Q43A 1BIZA 4N76A 3QINA 3DOLB 3V4IB 2BANB 2W9BA 3HVAA 3KJVA 4CIGA 4LQ9A 1REVB 2KTQA 5E41A 3KMSA 5F8IA 3M8SA 1ZBLA 2BE2A 5KFUA 5KFKA 1BI4B 2IJFA 3HO1A 5CYMA 4HCCA 4CF0A 4BACA 4RW4A 3RMAA 4F4WA 4F4KA 4HTUA 4K4TA 2Y1IA 4TYBA 4IOBA 4OLBA 4IRKA 3M8RA 1NOYA 4ED3A 3AO1A 4RW7A 5DK5A 3L2RA 1NK6A 3QIOA 3SQ0A 3BGRB 3FSIA 3OYGA 4CGHA 3U3YA 4WYWA 5KFNA 3CG7A 4Q5VA 3OYKA 5I3UA 1YTUA 4KPYA 3NAIA 4O3QA 2LSNA 1JXEA 4Y1CA 4MK7A 5D3GB 4ZP8A 3H5YA 1TKXA 3D28A 1N6QA 2VA3A 2R2TA 3MAQA 3S3NA 5KGWA 2O5DA 3ZT0A 4KHWA 2VG7B 1TL1B 5KFTA 3OL7A 4AHTA 2ILZA 4MKAA 3H59A 4WFXA 1BL3A 4JRPA 1RT1A 1KRPA 4XPEA 1JKHB 4UQGA 3CIZA 1RT4A 4W5QA 3QO9B 3CO9A 4YNQA 1BCOA 1BGXT 3HK2A 3OL9A 2BGGA 1U45A 2RDIA 3OYNA 3OLAA 4OLAA 3V81B 1S48A 5DMRA 3D0PA 4Z0UA 3AV9A 3KLGB 3RR8A 3NH0A 4O5BA 3ZSYA 3V9SA 2OA8A 2BQUA 2PYLA 4NLXA 2IBKA 4KTQA 5KFAA 4KV8B 3OYCA 4FYDA 3CFRA 3QNOA 1C0TA 2ZD1A 4CEQA 3U3GA 4IR9A 3IGVA 3TVKA 3KK1A 3SFUA 1RDCA 4O4GB 2R2RA 4CK2A 2XY8A 3I8DA 1XI1A 3K5NA 3L2UA 1REVA 5KFHA 4QW9A 4KKOB 2EC0A 4N5SA 1U47A 1T3NA 1C0UB 3OYJA 4Z4IA 4C8MA 2XC9A 5KI6A 3KLHA 2YNFA 1VSLA 4FCYA 5L1LA 4FJKA 1BI4A 2AGQA 2UVWA 2R8KA 2X6SA 4MFBB 3QIPB 4B3OB 4YR3A 2P51A 3SI6A 1IKWB 3O4NA 3LP0B 3V9WA 2E6MA 4E7JA 1UA1A 3OYAA 2XRIA 4E7LA 1VRTA 3IG1B 4ECUA 5J2MA 4LSNB 3KKRA 5JS2A 1VSMA 3K5LA 1UOCA 1S1UB 1T03B 5EWEA 1IM4A 3RB0A 1RBTA 2BR0A 1ASVA 1TL3B 3BQ0A 4IRDA 4NLQA 4XIUA 3H4BA 5D3GA 2D3ZA 3ULDA 1QQCA 5F8HA 1ITGA 3ZSZA 3GIIA 4PWDB 4JV0A 2E9TA 1TL1A 3OHBA 5KFBA 2FVRA 5KG5A 4KO0A 1UAXA 3GV8B 4U7CA 5KFJA 1LAWA 1JIHA 3LP2B 4KHMA 4DSIA 3C6TB 1JLQA 3O3FA 3UIQA 1BQNB 3AO5A 2ZE2B 5F9NA 2KZMA 4TYAA 2PZSA 4Y3CA 1JLEB 2AQ4A 1VSIA 2YHBA 3MXIA 4ECXA 3RMDA 2YHAA 4NRUA 4KI6A 1NKBA 4GVMA 3RRGA 2ATLA 4KRFA 2E4LA 4Z4GA 5J2NB 4CIFA 1RT2A 1Z26A 3DRPA 2KFZA 3ZT3A 4F2RA 3PW5A 4RU9A 4CFDA 4I9LA 4ZP7A 4K4SA 4CE9A 5SZTA 3CDEA 5FRMA 2HNYB 4CEZA 2P1JA 3DLGA 4BDPA 2HHQA 3DYAB 2HVHA 1J54A 1S6QA 3DOKA 4ELUA 1C0UA 2WTFA 4MK8A 2O4GA 4Z4CA 1YTAA 2Z1GA 4K50A 1U49A 3QIPA 3Q8SB 1MU2B 4B3OA 3CYMA 4QCLA 4CHZA 3OJSA 3KLEB 4FK0A 2FBYA 2P5GA 1R0AB 2VG6A 1TV6B 2QXFA 4CJQA 4C8NA 2FLPA 3CWJA 2IA6A 2F8SA 1CLQA 3RR7A 4CJUA 2X74A 2HHWA 5T14A 3P83D 1RTJB 4U6PA 3IRXA 3GIJA 4G3IA 1SH0A 4RNHA 1CZBA 5KFPA 4WXOA 2JEIA 4CJFA 4DU1A 3V9UA 3HSTB 3HVTA 2XWYA 4Q0BA 1S1WA 1TP7A 3DI6A 4DTNA 1ZBFA 1RT3B 3ITHB 1ASWA 3QEIA 1S9EA 4PWDA 4DL3A 4OKKA 1HPZB 1OS5A 5KFYA 3QGHA 3UDLA 4DG1B 3QNNA 3THVA 3PX0A 1TKTB 4XO0A 4QWAA 1TKDA 1S5JA 3MFIA 1UWBA 1O1WA 4QWEA 4F3TA 1L5UA 4FK2A 3C6TA 3AVNA 5EU7A 3LWMA 2XHBA 2WONA 1I6JA 2D0BA 2ZE2A 3EYZA 1RBVA 5KFQA 3V6DB 1S9FA 4RW9A 1JLEA 2BQRA 1BQMB 2HWIA 4CF8A 4DQRA 1HYSB 4CJSA 5J2NA 3MECB 4CHQA 1QHTA 1RT6B 4AHCA 3V9ZA 3N6LA 4DTMA 4NLWA 4J9OA 4M3RA 1ZBUA 3NBPB 2HNYA 3VQBA 2Z1JA 4HHTA 1C1CB 4Z4HA 4J9KA 2W9CA 1NJYA 4BWJA 2KQ2A 1HNIB 4W5TA 3PW2A 1CXUA 3LP3A 3K5MA 2WK4A 2ETJA 1MU2A 1KVCA 2E9RX 3CJ0A 4QAGA 1R0AA 3AVHA 4DSLA 1RDAA 5F9LA 1NOZA 4DQIA 3HP6A 3VN5A 2JGUA 4CEBA 4WZMA 4FS1A 1IKYA 4ECRA 2G8IA 5C24B 3BSCA 4O3SA 1WAJA 1DLOB 4N56A 2DFEA 1A5WA 3SQ1A 3PO4A 1XHZA 3H4DA 2G8UA 3OL6A 2ASLA 4Y1DA 1N56A 3RAQA 4HVJA 3VQAA 4E0DA 3ZCMA 4NYNA 2XI2A 1RT3A 3ITHA 5F8LA 3QZ8A 1VSJA 1SKWA 4EYHB 4YR2A 4DTXA 3DMJB 1JL2A 2WHOA 4EEYA 3QLHA 4FLYA 1RTHB 1SL1A 1QTMA 5C25B 4CGGA 3C6UB 1Z4UA 3OVNA 4C8OA 4E3SA 3QGIA 1XWLA 3HHKA 4FZXC 3NAEA 3KHRA 4B9TA 1Q9XA 5SWMA 3KK2B 1NK9A 4ICLA 3V6DA 3GIMA 1S0MA 4OL8A 3HPGA 2G8FA 2OPPB 3RMCA 1HYSA 1J5OA 4FZZA 1J53A 2FLNA 1K1SA 4URGA 3O3HA 4CHOA 2IOCA 3TAMB 3OS2A 1JLAB 4ECTA 1RT6A 2FBVA 2VWKA 3DLEA 3KNAA 3M8PA 3I5CA 3NF9A 1TAQA 4OJRA 3HJFA 2IAJB 3RRHA 4F8RA 2R8HA 5HLFB 1C1CA 3G86A 4O44A 2OPRB 3E51A 3CJ4A 1XR6A 2D3UA 4FLVA 4FJXA 1IG9A 4GMJB 4B8AB 4IG3B 4ZP9A 3M9OB 3KD5E 3QEWA 1S0NA 4EP4A 1GX5A 3F9KA 1RT5B 4FLXA 5L1IA 4FBUA 2HNZB 4YQWA 1SH2A 2HHXA 3VQ5A 3WNEA 1BIUA 1NK7A 4DSFA 3I0RA 4XPCA 4YP3A 4IQXA 5CY4A 1SUQA 5KFSA 1N5YA 5L1KA 4R5PB 4EO6A 2FBTA 3KIOA 2O4IA 2DPJA 4RUAA 4ZP6A 3TAEA 1HMVB 1TVRB 3EPGA 4DTSA 4Q44A 1HQEA 3KOAA 2X78A 4OGEA 1VSKA 5F8NA 4CFBA 1SL0A 3CFOA 2E6LA 3DMJA 4DFJA 4CGDA 1D0EA 3M9MB 1RTHA 3T19A 3ZT4A 5C25A 3QYYA 3QZ7A 1Y97A 3PW4A 4FW1A 3BREA 4BE1A 4RNMA 3OYIA 3P1GA 4CECA 4E7KA 5CYQB 4WYLA 1VSDA 4CF9A 3O3GA 5DGAA 2GIQA 4OGCA 4DQSA 4NLOA 3FFIB 3PW7A 4KI4A 1WSFA 4TY8B 3V1QA 3SYZA 4DWIA 5HROA 4RNOA 3NGIA 2QKBA 5DG8A 1BHLA 1VSEA 3TAMA 4B9SA 2FC0A 4EO8A 4DFMA 1KFSA 4EZ6A 3KLIA 1RCHA 2W42A 1QSLA 1HQUA 3ALYA 3K5OA 3C94A 4NYZA 3MEEB 5HP1A 1RTDB 1S10A 4B9UA 3AVIA 2OPRA 3OYMA 3DM2B 1NK5A 3TANA 1QE1B 5KFCA 3LP1B 2D41A 2PYJA 5DG9A 1JLGA 4IG3A 3P5JA 3BR9A 5K14A 5KG2A 1KVAA 2EHGA 2JC0A 4KE5A 3OJUA 2KW4A 2RKIB 2D5RA 1RT5A 4F4ZA 4FW2A 3ZSRA 2XGQA 1I3AA 2FLLA 2AGOA 2HNZA 2ASJA 5FDLA 4ZPAA 5J1EA 1IKXA 4ZHRA 4CGFA 4DTJA 2QKKA 4DSJA 2FJWA 2RDJA 4FS2A 3KLFA 1LWCB 4J9MA 1LW0B 2HWHA 4CJKA 3CDUA 1I39A 2KFNA 4R5PA 3BDPA 3QESA 1RDBA 4W5RA 3EZUA 4B08A 5JXSA 3M8QB 2IS3A 1HMVA 2OPSB 3G10A 2HHSA 2W8LA 3EZ5A 3DOLA
chains in the Genus database with same CATH superfamily
5IT4A 3V4IA 3B4MA 2G8WA 2AGPA 3T1YJ 3V4MA 3CVKA 3B4DA 3CDBA 4QIVA 2DFHA 3L0QA 4FZYA 1UVMA 2CKWA 1DTTB 1H2TZ 2NYHA 4K4UA 3NKYA 5H9FK 1NBEB 2PA3A 1SPBP 1XHXA 2XI3A 2ZBIA 3EO3A 4P2SA 3TWHA 4NCBA 3AVAA 1GLEG 3GLJA 4F50A 3B6BA 3SLCA 3JSRA 3KHGA 2XY7A 4LMZA 4AL6A 4IR1A 2F7VA 3SQ2A 1EKEA 3FEZA 3QAUA 4CEOA 1VS3A 1WSIA 2UXBF 5DQIA 3W8GA 4FF4A 4QJVA 4B8CA 2VPZB 1HWJA 3M32A 3BQ1A 2FVPA 3A1YG 3R8EA 4G1PA 4H5TA 1ZYQA 4OYMA 3WC2A 5EWGA 1NUEA 1S1VB 3H7HB 4CGIA 3EDRB 3F0NA 4TLQA 1J5EJ 4OYIA 3KLGA 4KHRA 4A57A 4CEDA 4IZ9A 2F8EX 4KHPF 4KHQA 3IR6B 4B1XB 4OV1A 3CJTA 4HUFA 5L9NA 1YSJA 5DM6Q 1K0VA 1KTQA 2M0GB 4CEEA 5M1FA 2YKMB 4AHSA 2ZVSA 1X9JA 2HVEA 3ENAA 3MM9A 2HZCA 4RW8B 2LECA 2IC3B 1WLJA 1A6LA 5KPRA 2ZJPL 1VRQC 2OEMA 1WSGA 3D7SB 1X7VA 3HTVA 3P45B 4C0BA 1JXBA 4BC5A 3CCLN 3DCAA 1UWAA 2H5JB 4I7FB 2JEGA 1IBLK 1F2HA 1T94A 3NE6A 4USWA 3NGRA 4CO1A 3MUMP 4QOZB 5ETSA 4FK4A 3HMJG 4M41A 1HNZF 5H1SQ 2NSBA 3O4QA 4X65K 4C8LA 2F4VF 5A8KA 3K7RA 2JVRA 3CD6N 3IG1A 4OJ3A 3HRGA 3IN5A 4HLBA 4PWWA 3G71S 4P2MA 4H8KA 3R2DJ 5BRDA 2J9DE 4A48A 3NHGA 5AQNA 2MXYA 2OJ3A 3SFGA 2CH5A 3S3MA 2XMVA 2FUG9 1DQ8A 3HHLD 2P9PA 4J90A 4J2BA 3Q89A 3M2RA 3V2UC 4DU8A 1GMWA 2YWEA 3BQ2A 4FWQA 3R8YA 1HNXK 4KFBA 4DR2J 4ZN3A 4KAZA 3G87A 2SXLA 4Y2KA 1NGEA 5KOXA 2DNYA 1KKHA 2PD1A 3HDSA 1BQNA 4A8YA 2YKPA 1RTIA 2CUYA 2CWXA 4M3UA 4LF2A 5KG3A 4DLGA 4MO4A 4BC7A 2EBEA 4B9VA 3JAMU 3PJWA 3DLRA 2HMIB 2NRTA 3IFEA 4NI2B 4RLEA 1QZ6A 4J5OA 4CIEA 2QYCA 3FSXA 3GFXA 3NS6A 4GV3A 3LO3A 5AXLA 1T9XA 4M3YA 3TTDA 4ZDNA 2YXLA 3CGIA 3Q8QB 4NZ7A 4IG0B 2XSJA 3FZBA 4DR5K 2CDRB 1OY6A 3QPIA 2X1FA 1U4BA 1JLBB 5IQQA 2FLOA 3G6EN 3ISNC 1S0VA 2GGPB 2DHSA 4EFHA 2RILA 1PBUA 1XIQA 3KLEA 2PGCA 2LEPA 2QI2A 4AXIA 4JKEA 1TV6A 3OTOJ 2MY7A 5IWAF 1BC6A 5DDQC 3CUNA 2OMOA 4LF5K 4WE1B 1XNQK 4A8QA 2E5IA 2RQKA 3IWLA 4CWBA 1AA1B 1FW6A 4ZCKA 1JLFB 1N33J 2IFXA 3SCIE 5CCMA 1VBZA 3JTNA 1X4CA 4DN0A 1VQPN 4UF4A 5IT9Y 3KKSA 4KSEB 4MQ3A 3AD7C 1R31A 5F3TA 2UVUA 4LUBA 4BREA 4BRIA 1SI9A 2A42A 4CK3A 5I42A 4DDFA 1N5VA 2V4RA 1YJWN 1TKTA 3I4HX 4K4VA 2C2EA 3QT5A 2ZWOA 2IRUA 4JP8A 4CHYA 4ZPCA 2YNHB 3U02A 3JSMB 3WXJA 1J6ZA 4BG8A 1NEEA 2W9BB 3KJVB 4DS5A 4YOYA 1Q0NA 2DCLA 1OVYA 3P5BP 2KO1A 3VGTA 1PJ6A 1TK8A 2VC1A 1BE4A 4ECVA 4CJRA 5CH7B 2K8GA 3S01A 1CZ9A 4YEAA 2FSKA 3AVGA 3SBMA 4FPIA 4M94A 2M5YA 4RW7B 1R6VA 4ZCIA 1RT7B 1LWFA 2COLA 3NBPA 3NGTA 4CLLA 3VZIA 3BZKA 2QWPA 1T3VA 1VR6A 3G6VA 3R6GB 4C3MA 2DPNA 3R3LA 3TOQA 1TKXB 3ILIA 4LREA 3OR1B 1NRKA 5KFFA 3TR8A 2ZBRA 5AZIA 4AHVA 1GOAA 3QB0A 3O4WA 4HCBA 4K42A 2EFPA 5GAEU 1WSJA 4FN5A 1JNZB 5AFUA 4CJEA 2VC0A 3T3FA 3SI8A 4QU7A 1X4FA 2L41A 1B9DA 2QA4N 1CLFA 4DQPA 5J1PA 3D7EO 5GMKa 4B9LA 4Z94A 3BGFA 3A2FA 8RUCA 1K47A 2RPIA 3WUHA 1W7AA 4F4YA 5K8MA 3LWLA 2Z1HA 3VQCA 1TK5A 5D8HB 2FZKB 4B3MF 4OX9K 2NREA 3I0SB 1VC0A 4PABA 1QZ5A 1VLOA 1Y00A 5K9FA 3IO1A 4LRDA 4ED6A 3R5DA 4PG5A 1IH7A 2ADBA 5ETMA 2ZDOA 5DGBA 2W9AA 3TUPA 3DRXA 1NH8A 2ROGA 3PEJA 2QEXN 1K9MT 2OPPA 4TU8A 1X9SA 4OYOA 1WHWA 4KGKA 4A8WA 3V6HA 4R0JA 2HNDB 3HVWA 2VQEJ 3K2YA 1YIJN 4LRFA 5J2MB 1BCMA 2YCHA 4K43A 3MEKA 3CJKA 1N4LA 4BVPA 3VF6A 2XS7A 3SPYA 5G0RA 4QS8A 3L2WA 3OS0A 1QAXA 1FE0A 2GMLA 5KFEA 5KG4A 1CJUB 2HRYA 1VQNN 1ZBSA 4QIWD 3OFFA 1JK9B 1WDTA 3LZJA 2W7AA 3R5JB 4JLHA 4MKBA 4W98A 2Z1IA 1UEKA 2P9IA 4K5RA 3OD2A 4PR6A 3IR5B 2D0PA 2HFNA 2F40A 2DGUA 4DV7K 4YY3F 3R5CA 3V1RA 1JLQB 3LGNA 1YKWA 4OYZA 2NS1B 4FJMA 4P2FA 1B3TA 4O4RA 4LD0A 5LJ3Y 4JI2J 1WF2A 3VQ4A 1U2RA 5DDRC 4FJLA 1HI0P 3T1AA 2YNGB 4PCQA 4H0VB 1XNRK 1Y3KA 1TVRA 2P6SA 1OH6A 1SKUB 5C2FA 5EX0A 1HI8A 1XMQF 1SKRA 4GKJK 2WVCA 1T9VA 3OUYA 3KK3A 4WPAA 4CD1A 1F5CA 3MXMA 1BD6A 4X4VA 1U02A 2OFGX 2MKCA 4CHNA 4XEIA 2V0NA 5KT4A 4OYPA 2VASA 1NWKA 4HH1A 3IA0A 3PFOA 3AVKA 1EP4B 2J7UA 3O6WA 3FDSA 2V9KA 4CFCA 1N8RT 4DR4K 3BN4A 1U0HB 4ZVSB 2VFVA 4BBYA 3AO4A 1U1QA 5GAHP 2E5JA 2EG1A 2UUCJ 4B3TK 3MM6B 5FPMA 3MM8B 1OKJA 2OELA 5LMNK 2O8EA 4G1IA 2L9NA 1S49A 3VA3A 1NDKA 1DURA 3RGIA 3ISND 4Q0BB 4K5SA 1W7WA 4DTUA 1YZ6A 2IDLA 3AAWB 3W64A 4DU4A 3ZSVA 4KTZA 3PVXA 1OY9A 1SQEA 2QXLA 4FJ7A 4NLYA 3I82A 3H46O 1FRLA 2P9NB 4U7BA 2JSXA 5FIIA 2B43A 2MEWA 1WNEA 3PHEA 3UR3C 3HXMA 3THXB 3SQGB 1OQ3A 3J7YP 1MLAA 1Q81O 3O08A 3I4PA 5FPDA 1I51B 3IP0A 3L7UA 1K8AO 3DRRB 1IBKK 4MIAA 1Q86O 1RHRB 4FF3A 4KB7A 3S9HA 3AVJA 4WTOB 1FE4A 1MROA 1KQSR 1WNSA 5KFRA 3I96A 3FFKB 3OYEA 1JLCA 4PG6A 7FD1A 4UZBA 4ZK7M 3W9IA 5EN1A 3KHHA 3OSNA 2PMZD 1ZTTA 4KBIA 4KY3A 2ZZTA 3K8WA 4DR1K 2L3MA 4G1QB 2IJNA 3E9PA 1N36F 2UU9J 1S22A 4O3NA 2OPQA 5CZ2A 4WQ4C 5C42A 1IVZA 1IBMF 2FC8A 1RDDA 1FK9A 4J8FA 5ITHA 2DGSA 4A8FA 4OLOA 2JLFA 2CZ4A 4ZVUB 1TL7A 2W2PP 3MDFA 4DL2A 3CF5L 4UOGA 3QJJA 3TABA 2Q31A 3H90A 2WOMA 4H4OA 2RHSB 3CJ2A 2XWXA 4KB1A 2MTLA 4ZMMA 4DR7J 2VWBA 1SH3A 1EETA 2DR9A 2HHUA 3CPEA 3GE1A 2IVFB 2A3JA 1TKZB 1GXTA 4KGVB 1JWWA 2FBXA 4H4MA 3TA1A 2KHOA 4HACA 4WF9Q 3MCAB 3FZMA 2VDHA 2O1PA 5GIOA 3H6EA 2ZQBA 2JFDA 3TAQA 3WNGA 1GLFO 1D8YA 1LOTB 1LQ9A 1HWUA 3VQDA 2RUSA 1CXQA 3N01A 1S1TA 4DV0K 3G6ES 1IV0A 5CD4H 1NJZA 4H4KC 4PUOB 4I64A 3L2VA 3PRDA 2DEIA 3LQVA 1KAXA 2D3O1 1UAWA 2JWKA 4CJ7A 4J9QA 3QEVA 4DV4K 4JI1F 3M8PB 5EGYA 3ENBA 1X4GA 2IM0A 5KG1A 1K1QA 2UUWA 3H5UA 5E0OA 2RJZA 4LBHA 4DUZK 4NYFA 4F04B 4J9UE 2BOPA 3MFHA 4IH7A 4B1YB 3ICLA 2KU7A 5JVHQ 5E84A 1VQPS 2RB7A 2ZJQQ 5HI7A 2FXUA 1AFJA 1FJ7A 2E66A 2LDIA 1PAEX 4LF4K 1SJ3P 3D6RA 1P90A 4IJAA 1NMNA 5AQQA 4Y34A 4J9SA 2KZZA 1NKEA 1RHJB 5E26A 1FDBA 4EBEA 3BJYA 3KVGA 1K73O 2VBYA 4DTRA 5J2QA 1SUQB 3GFZA 3ONQA 5D0GA 3MEDB 1VMBA 5KFGA 4LF7F 3DJCA 3NVMA 1V3SA 3POTA 1JJ2R 3ZTSA 2VJUA 2ZWHA 1YJUA 4EBCA 5M2RA 1GLDG 1D5AA 5C12A 3TAGA 3EDQB 1KXPA 2D0CA 5H9FJ 1RU1A 4X4UA 3T9ZA 4LVOP 2KT3A 3IUCA 2J8AA 3V5RA 5J2PA 3MM7A 5CYMB 1KHWA 3TVZA 4QYZK 4FNIA 4URQU 2KXNB 1R7IA 4XH4A 1NJXA 4WZQA 1DFDA 2C2DA 4L74A 4C3LA 1FDAA 4FVUA 1IXKA 3JSBA 3BO2A 3K58A 5AR0A 4JI3K 1NXIA 4FWRA 4WIQA 5FRNA 2IVPA 1MMDA 4DL4A 3SJHA 4HYKA 3M05A 4G6VB 1U1KA 5D4PA 2AKWB 5AXNA 2VF3A 2HRUA 1RA6A 3HSJA 4I2PA 2QA4S 3D6FB 2V8DA 1RWNB 3BKUA 4ID8A 4FLZA 3GJQB 1S9GA 3MN6A 3C3LA 2AU0A 2XTJP 2RN2A 3VR1A 4K7QA 1FO1A 2HHHK 1M90T 1YHQN 1T9YA 1JLGB 2DNLA 4NMLA 3CM5A 2LDYA 1IO2A 3EM1A 5KFMA 2AHOB 2J7WA 4TXSA 5LY3A 2QK9A 4LF8K 5BR8K 2PN6A 2H5EA 3EEQA 3ETOA 3AO2A 3HM8A 4OZ5A 1GQEA 3WX4A 2DNMA 3KLFB 4CM0A 4LF1A 1T6CA 3SAGA 2ZD1B 4FJHA 5B8HA 4M1KA 2KG1A 4DFKA 3DAWA 2QEXS 3WX8A 2E2NA 4QU6A 5KAKA 3V4IB 4P6QA 2PC6A 4LQ9A 3HLUA 2Q1LA 5F8IA 2V63A 3JQMA 2D74B 1BI4B 4LF9K 3HO1A 4Y65A 1UL3A 5CQGA 4ZIVA 5IZHA 1HD1A 4OX7A 4RW4A 4I1TA 4HTUA 4TYBA 1LK5A 2KB2A 4OLBA 3M8RA 1TU0B 3CPWM 4MJKA 1Q7LB 3FGUA 3LF0A 1UETA 2ZGYA 4B3RJ 4CGHA 3UCGA 5KFNA 3GSDA 2LFVA 3GL1A 5I3UA 4KPYA 3NAIA 4O3QA 3W1YC 2E5LJ 2R7UA 4FOEA 3CXCM 3ENHA 1VQMS 1N6QA 3S3NA 1QVGR 3ZT0A 5KFTA 2ILZA 3M32B 4DR6J 2KL8A 3QGPA 1KRPA 3W5ZA 1RT4A 4Z7CA 1Q95G 4JOUA 4BRGA 3GZ7A 3CIMA 1OPZA 2OTJN 4YNQA 3X3UA 3HK2A 3OL9A 2GEMA 1U45A 4X64F 3TUIC 2J0XA 3CE8A 4OLAA 1S48A 3KUEA 4H5RA 3AV9A 3KLGB 3RR8A 5LT5A 3NH0A 4OJHA 3ZSYA 2OA8A 4L3QA 2ZH5A 4F0HA 1W2BR 2HBQB 1KWMA 2MPUA 1NJIT 2H48B 5AQTA 3D3BJ 3U3GA 3IGVA 4BC9A 3W65A 1NM2A 2R2RA 4CK2A 3DU5A 5DDPC 3I8DA 4ZLJA 4J91A 3K5NA 3GFYA 5LSOA 1REVA 2NSCA 3KZBA 1YVNA 1T3NA 3OYJA 1HNWK 3KLHA 2W25A 2JZ5A 4OZLA 2UXDJ 2QC3A 4FJKA 1UP1A 2R8KA 3T6BA 3CQXA 3QIPB 5DM7Q 3FC9A 3HFZB 4A8SA 1XNQJ 1N54B 3FJ2A 3O4NA 2CG8A 2E6MA 3O3LA 1P6TA 4IOCL 2XRIA 5GAGP 2UV8G 3IG1B 2E1MC 3Q0AA 1VBYA 3LA0A 3MMCB 5JS2A 1IJEB 1RBTA 4XIUA 4OYBA 3H4BA 1BDGA 3KWGA 3EGVA 3ULDA 2P9PB 3M2RB 3ZSZA 4USJC 3CC4N 4PWDB 1TL1A 1N32F 3W9HA 2HBKA 3ENVA 4DPWA 2FHMA 4KO0A 5EX5A 3GV8B 4U7CA 3OR2A 2NRXA 4Y0WA 2HQCA 5E3QA 3A8YA 5ETLA 3C6TB 3C6AA 4X84A 2VODA 2UXBK 1BQNB 1N88A 4P74A 2ZE2B 3CNQP 2P9KA 5CAAA 2PZSA 2XMJA 1HHSA 4LFCF 4KI6A 5ADXH 1RT2A 3WDOA 5AZJA 5EX3A 1HUXA 1UPPA 2F9DA 3BZQA 4AUKA 2KFZA 3K17A 5SZTA 2DRBA 2MZRA 3O9SA 2DR7A 1Y5NB 1QHAA 3DLGA 4KHPK 4M5JA 1J54A 3DOKA 4M5HA 3MAHA 3VOVA 1C0UA 3QSYB 4X66J 5F41A 2E29A 3T6JA 2MGZA 1YTAA 1D4XA 2XZWA 2VKZG 2Z1GA 1MU2B 3TWZA 2NNWA 4QCLA 4NE9C 3KLEB 4YDXA 1KOHA 2E88A 1R0AB 1TV6B 1WACA 2QXFA 1RADB 3VAKA 2R7WA 4JI5J 3G82A 2RRAA 1FERA 1EJ7L 3AXMA 3ULHA 2CH6A 3GIJA 3CO0P 2EK6A 3T69A 3CJCA 1FXLA 3GE9A 3EZWA 5HMZA 3O5TB 1OSCA 3W60A 1PILA 1X5PA 3HVTA 3PHTA 2XWYA 2F4VK 3DI6A 5BRFA 1VQSA 3QEIA 1S9EA 1EWQA 4DL3A 4KBOA 1SIZA 4OKKA 2G13A 1DJ0A 1YDLA 2DH7A 3THVA 3QNNA 1TKTB 2XMTA 4WP8A 3MFIA 2GMHA 1UZDA 1O1WA 5AQKA 4D3HA 4FK2A 4JI7J 1HR0J 2NXJA 1XC3A 1X3MA 3B82A 1I6JA 2D0BA 4BQLA 3I56S 2RNEA 3EYZA 2ZBPA 1OPIA 5KFQA 1JLEA 4U96A 5HAOA 3G9CA 3CCUN 1T0TV 3OVSA 1WBBA 2EEYA 4CO2A 3H2VE 1TFYA 5J2NA 1QHTA 5IV4A 2EKNA 1R27B 4P10A 2P9SA 3QSIA 3QBWA 2M8DB 2EFVA 1ZBUA 2AA4A 3NBPB 2GA7A 1C1CB 4ZVTB 1GTEA 4J9KA 2W9CA 3ZNJ1 3CMQA 4HWIA 4JV5J 2YWKA 4W5TA 1CXUA 2F9JA 2YH1A 3PIPQ 2ETJA 1KONA 2QMWA 2E9RX 3DXMA 2I7PA 1RWPB 4OZ0A 2KXFA 2RT3A 1F9EB 3HP6A 2JGUA 4FS1A 2G8IA 1ZM2A 3AOBA 4C6AA 1FRXA 1WAJA 2AEMA 1WG1A 4JYAJ 3VGSA 3M6VA 4H0OA 4KH4A 3H4DA 3OL6A 4Y1DA 4E0DA 5C15A 4NYNA 5JLFA 3ITHA 5IWAK 1MG7A 1BWVA 3W3DA 3QZ8A 1VSJA 3A3OB 3O9RA 1UFWA 3FR0A 3DMJB 1QTMA 5C25B 1KQKA 4CGGA 4C8OA 4E3SA 1XWLA 1SQKA 3HHKA 4CBUA 3W7BA 4FZXC 2CNNB 4N8OA 4KH5A 4LJMA 3NAEA 4JI6J 1WELA 1NK9A 1U7LA 2HBYB 1KC8O 3HPGA 2G8FA 1DQAA 2OPPB 2DBBA 1HYSA 1J53A 2XG8A 3SBGA 2GVZB 1UVIA 3D66A 2ALYB 4K41A 3TAMB 1DHMA 2HS3A 4ECTA 2VIHA 3B8AX 3KNAA 5LMNJ 2CGKA 2MDAA 2RHKA 4ILGB 2ZJPQ 3NF9A 2POKA 3R7NB 3RRHA 3O6QA 2R8HA 4TVAB 2QX0A 3CJKB 1ZBTA 3NP5A 3BEXA 4L3KA 5G0RB 1VQLN 2APOA 2IPOB 4EIAA 1VIXA 3E51A 1JQGA 3WXKA 1U25A 2D3UA 3S6EA 3R5AA 3D2EA 2BVZA 5AJ3J 1BXNA 1PGZA 4GMJB 4B8AB 1EZZB 4IG3B 1TL4A 3BP8A 1HBMA 4ZP9A 4LC9B 3KD5E 2QL9B 2P9IB 3DOMB 1RT5B 5L46A 4DCPB 3A13A 2HNZB 1AXQA 1SH2A 1ZM9A 1VBXA 1BIUA 3CCMS 3PYFA 4YP3A 3GCXP 5DM6L 3QBCA 1N5YA 5L1KA 1KNZA 2ZH8A 3ENWA 2O4IA 4C1NK 2NUUG 4RUAA 4ZP6A 3C15B 4OI4A 5A2QU 3O8MA 3BV8A 1TVRB 4DTSA 4FYXB 4Q44A 3QICA 2A41A 5A0YA 2HAFA 3CMES 4OGEA 3WC0A 1QVFR 5F8NA 4CFBA 1RQ0A 2K7KA 3TSPA 5A8WA 3HFKA 3LPEA 1RTHA 3T19A 2P9GA 2MZJA 4DR1J 5MLCV 3OUYB 3QZ7A 3J7A1 1Y97A 2CJXB 4FW1A 1X4EA 3P1GA 4E7KA 1GMUA 2PAVA 1G99A 4WYLA 2Q1NA 5GADP 3DDIA 5JVGL 1T02A 3SDEB 3MCNA 3O3GA 2UUBF 4DQSA 3TSUA 5M1PA 4KI4A 5HROA 4RNOA 2WFBA 2U2FA 1TUUA 2F7TA 1BHLA 3J80O 3Q8VA 3NEKA 3MPUB 4WFNL 4ILJA 2CQ4A 3KLIA 2OTJS 3WBZA 5BN9A 1RI7A 2GHPA 3K5OA 3DC2A 3QWUA 3VEYA 2IY5B 4P52A 2Q6BA 2O8EB 1RTDB 2BW2A 4ANDA 3AVIA 4CI6A 3OYMA 1K8KB 3TR5A 1QQMA 3CW2C 1NZAA 2MQMA 3VF0B 1FVSA 2PYJA 3W3SA 1J2VA 3ZFVA 4JEPA 1MWZA 3BR9A 1DEJA 5CXTA 1T11A 1LXJA 2WVFA 1IBCB 3OJUA 2XGQA 2P9UA 2AGOA 4RBUA 3ZTRA 3LL3A 3U4LA 3K0SA 1IKXA 2QKKA 4DV0J 2RDJA 5AQZA 4FS2A 1Z2LA 3WEEA 3M8YA 4CJKA 1RISA 3QESA 1U8WA 4P71A 1CQMA 4NPOA 4E98A 3A0IX 3F9MA 5C2GA 4DV4J 3EZ5A 2V4JA 3DOLA 1MROB 3RVCA 3GYNA 1U6ZA 2KRRA 4YY3K 2QZ8A 3VQ7A 4YDUA 1QAYA 1JLCB 3H3NO 2VG5B 3TW0A 3ZSWA 3D6TB 4LRCA 1CBKA 1ULRA 1TUGB 2B51A 2HIQA 3MCSA 4I67A 3M1VB 1PSDA 1EWRA 2A6AA 3K59A 1WF0A 4WJBA 5LMUJ 1XMQK 5CHIA 3CCTA 1X9MA 4BS2A 2WZ1A 5C42B 3CC4S 4USMA 1FK9B 1U1RA 4YR0A 2QLJB 1H38A 1EAYC 4X4SA 3VGMA 3FCHA 3JB9k 5FD1A 3DHXA 4MK9A 1ZBIA 3MR2A 2A40A 2HFZA 1NBWA 1N34K 3HSGA 2O67A 3DRSB 3I55S 2WOMB 5EUHA 2KJWA 4WU3A 4O55A 4DV6F 3J81U 2JLEA 4GC7A 2VWJA 3Q22A 1WEYA 2DTUA 2CPFA 1RBAA 1EETB 3V81A 2G8HA 1QAIA 3QIDA 2BV3A 5KG0A 4H4MB 3M4XA 1N52B 1WHYA 2ASYA 4HACB 4HHJA 1IJFB 2GAHC 3VF2A 1NHVA 5HRNA 3IR7B 3SUPA 2BQ3A 1LWCA 4K0KF 4A62A 1QS4A 3M8QA 3F41A 4KTWA 3GQCA 1S1TB 2OPSA 5KT7A 1MMLA 5FLXU 3BSOA 4IEEA 4KREA 1S72N 4ID5B 2VD3A 3BO3A 4IOXA 2NZ4A 2GO8A 3CQ8A 1FFSB 4ZVFA 5AQGA 1CZAN 5L9XA 4CF1A 3EY1A 2KRBA 4QWDA 1IKWA 3EGNA 5AXMA 1HJRA 2HHHJ 2YQ1A 1YK9A 2E1CA 2J6UA 3E1YA 1S4EA 4Y2AA 2DRDA 3G8QA 3SZ2A 2VU5A 4FWNA 4GKKF 4YHHF 1G15A 2XMWA 1S1UA 1RYSA 3IMXA 3NCIA 4K2JA 2Y1LB 1QM9A 1TL3A 1C6VA 2CQGA 2FHJD 3AQOA 3ZSXA 4RX6A 2U1AA 4HDGA 2HFUA 1N36K 3ZO7A 4QPTA 4RG8A 3LW5C 1SC1B 4NLRA 2XCAA 2V4QA 4FM2A 2WSFC 3TUJC 1YITN 5F8MA 1WC4A 1OMSA 1IBMK 2VQFF 3P5TL 3VQPA 2LXUA 2UUTA 1WEZA 3POTB 1YQHA 2XHWA 3BBBA 4OLPA 3CCUS 3QEPA 4HH0A 1WC0A 4C9DA 4CEAA 3P31A 1B70B 1SBRA 3LALA 2B4UA 3ZT2A 3GTYX 3LM9A 3FBFA 2R2UA 5K20B 2VFUA 3MM7B 3EPIA 2V51B 1H7WA 4HHUA 2C1EB 1U09A 3LPTA 5M1OA 4XTTA 3VAJA 3B6OA 4K2XA 3NF8A 2ILYA 3O8WA 2Y1JA 1K8AT 2QWLA 3SSQA 3AQPA 1LW2B 3T5LA 3DKDA 3MUTP 2FF6A 3DYAA 4I7FA 1FNMA 2KYXA 3U7JA 1MSWD 1RBUA 4CJLA 3NFAA 1FJGJ 3MDQA 5AQPA 4ECSA 3HL8A 2ZM6J 3OTEA 1BG3A 4H03B 3IXQA 4I2PB 2OD6A 4ALZA 2XBPA 2GIFA 4FJIA 4EI2A 2NLWA 1T9UA 1X9WA 1S4FA 2HHVA 2GJIA 4F0KA 2V9WA 1S9GB 2W7PA 5ETVA 1RAEB 3QT7A 3KJQB 2CPZA 1Q8IA 4KHSA 4IXCA 5HN0A 4JI1K 5F0UA 3RZAA 1FESA 1U2FA 1U48A 4NLDA 4NLGA 2CPXA 3PX6A 5GAHI 4H54A 4BE0A 1Y11A 2R8IA 5FROA 3QAEA 4DU7A 2KVQE 3M9NB 4Z37A 4O0JA 4CDIA 1CEZA 1UVKA 3EE9A 2V8PA 3W5YA 4B1WB 5DQHA 4FXWA 1WOPA 3SUQA 4MYUA 2W4CA 1NU4A 4UY85 3H5XA 3FEYB 3MR7A 3VEXA 4DBQA 3FQKA 1FVQA 9RUBA 4ELVA 1B92A 1HNWJ 3A8JA 2BJ7A 2M4MA 4DCJB 4GV6A 4ZJOA 4C23A 2RDDA 4WQ5A 4F4XA 3D5MA 1JNRB 4LF7K 4B9MA 4JKAA 4OPJA 3NCPA 3NMAA 2R4FA 1K9MO 3RG6A 1WBDA 1YXQA 4RW4B 3I32A 5ETOA 1E6YA 1VQLS 3BPDA 4KRWA 5KT2A 2ZC4A 4FJJA 2LA6A 3HD2A 3I8BA 3PXGa 5CZ1A 3L3UA 4NLSA 1NLVA 4MT1A 3FQLA 4IG0A 1GMWD 5I3UB 4QIEA 1C2PA 3G25A 1HNIA 1QSYA 3NVKA 4DPXA 3C8YA 3WIVA 5F1XA 2KM8C 3THYA 3M8WA 4KH6A 4CJ5A 4FXDA 1WG4A 1RLDA 3AO3A 2DH9A 1T05B 1H0HB 2GZOA 2BRLA 3QETA 2B0GA 1RT4B 2B8QA 3DWLA 2DPIA 4DR2F 4CZHA 4WE1A 2KHDA 3VQ9A 5B0DA 1DLOA 4FSVA 4OPAA 2P2CB 1VYAA 2FIUA 1A5XA 2DGWA 3G96A 5L38A 3MPWA 1KLNA 2PA8D 2DK2A 1P27B 3D2WA 5EWFA 5JJBA 5GIPA 2J6SA 2HFSA 1WC3A 1GFWB 4CT9A 2IMOA 1U6FA 1ZA2B 2VKRA 3SV3A 2ATQA 4RNNA 2JX2A 5JICA 3SSSA 3LDQA 4KAIA 2UZAA 3NS5A 1OVQA 3IFRA 3N0VA 4YFUA 3KLHB 5TKYA 3GP9A 4C0HA 3SCXA 3S8SA 1V6HA 5HRRA 5E3PA 5DLFA 4ZPTR 1N8RO 2RU9A 2YJEA 3CMAN 3G6YA 2HKEA 4NWBA 2KXHA 2G8VA 3OTOF 3BY5A 4N47A 1VIOA 2LP4A 2ZH2A 1RT7A 3PDNA 1YI2N 1Z25A 5HLFA 4ZPVR 4FLUA 1WSEA 1E4GT 4HI2A 4MMOA 1N48A 1N33F 5B0GA 1P9YA 2F3JA 4U9RA 1FWLA 3EL2A 4W92B 2HHTA 3OR1A 2PFFB 3NMRA 1KSPA 2ZOMA 4C3KA 1XR5A 3HZEA 2W4PA 4KO0B 3KJFB 3MPVA 3EE3A 2AP6A 3OR2B 3TZZA 2NQPA 2A2CA 3Q8UA 3KG4A 5IT9O 2J9EA 4WF9L 2QTDA 2VGMA 1T9WA 4E7IA 2DNGA 4E1MA 2P9KB 1W0HA 1PAUB 5HQLA 4CZIA 3Q86A 2GQ2A 4DL6A 4XH1A 2G1HA 2JOQA 5DS7A 4HTJA 5IC6B 2GX9A 1BWFO 1QTNB 1RT2B 3KJNB 3RTVA 2XLJA 2W40A 4KHYA 2YTCA 3CFPA 3I0SA 4IKFA 1YJTA 2OKQA 4BCAA 4GVBB 2HBMA 2N4CA 2AEFA 5F3ZA 4BRCA 2CQ2A 3DLGB 2PT0A 4B17A 4OKEA 4FJ8A 1Y4ZB 4Q45A 5CYQA 3DOKB 1S0OA 2QG9B 4IEIA 3LAMA 4C48A 3GR0A 1IQZA 4DS4A 2ZJQL 3M2VA 2MGZB 3FFIA 3R1HA 2A10A 4TY8A 2HNDA 2WTUA 2XGPA 5AE2A 5M1NA 2K1RB 2YVSA 2V5HG 3G82B 4XK8C 4JI4J 3SQ4A 1PG5B 3CCEN 3IAM9 1W2IA 3DM2A 5BYQA 4YOWA 3GJTB 3ZT1A 1QE1A 3HVTB 3OBYA 4FBTA 2HMPA 4CEFA 2ZH7A 4P2XA 3VENA 3DI6B 2DGXA 5G4DA 2GV1A 1TK0A 1S9EB 4ZVRB 3DLBA 3A5LC 3ZX2A 3OYBA 3UNGC 2HLTA 5HRSA 2IYGA 5KTQA 4C8YA 3MCPA 1UVJA 4TNOA 2JNJA 5L8RC 2FD2A 2FJDB 1FCAA 2CPEA 3U1MA 3CJ8A 4GV9A 5AE1A 1YF5L 1QDUB 4I2QB 2W1BA 2BJ1A 3SV4A 2K2PA 2MYFA 3TZXA 2F8TA 1N32K 1Q79A 1UW9A 4YUDA 4WXWA 2YNGA 1HARA 1R43A 4J7CA 4JV2A 1KN6A 1O8BA 1PBAA 3A5MC 4I6MB 4CLPA 4LSZB 2P9SB 1TAUA 3C66A 2VQEF 3I5AA 1ZZNA 3HVRA 1IWAA 2X1AA 1KD1T 4LFCK 3CTRA 4DPYA 4NA3A 3MMVA 1A9NB 1L3UA 1O51A 2W9CB 1YTYA 4B3SJ 4BC4A 4KHUA 2HAIA 3AJDA 3FEXB 1D8ZA 1LOUA 4WFAL 1X1PA 1SC6A 3RWUA 1M5OC 4K25A 1EP4A 2I6WA 2XY5A 3FRZA 1YITS 2ROPA 1U0HA 4CK1A 3HOTA 1Y5LB 2HBRB 4M63A 4ITSA 4PKGA 4FM0A 2HYIB 2HGMA 3VEWA 5I3QA 2DY9A 4Z7YA 4USUA 3TX8A 5KGXA 2W2NP 4J9NA 4OJ1A 4U8VA 5THWA 4IFVA 4OI6A 3SNNA 4ECQA 2LCWA 4Y2MA 1B7FA 5H9EK 1Q18A 1RUSA 4DI6A 3AA9A 3U27A 5E3AA 3EMTA 5CD4A 1OH8A 3OW2R 3RAXA 2DEJA 2VA2A 2R8JA 5AQHA 3NH1A 3PO5A 5CR4A 4WFBQ 1KAZA 5LJWA 2HVIA 1F9FA 4AILC 1VQYA 5GINA 3MEGB 4CJ4A 1SC3B 1RDUA 3K2PA 1BISA 3R27A 3THXA 1EQMA 3ZNUA 2QWQA 3SQGA 4RW6B 1YVUA 4B02A 1WOOA 3DRRA 4RU2A 3GOIA 3SAHA 4CF2A 4LF6J 5BR9A 4OZ1A 3K9KA 1DTQA 4FJ9A 4M3TA 2PEHA 2O8FA 3GIKA 3AGRA 1QAJA 2OUGA 1G4CA 5CA5A 2ZZNA 4M95A 2UUCF 3MR5A 3Q23A 1S5ZA 5KFVA 3T7ZA 2HIYA 3E01A 3KXDA 2BX6A 1T95A 2KVIA 4Y2IA 3VCDA 4G1QA 1W26A 1YVFA 1RHKB 3MOJB 4WP9A 3CHWA 1R89A 3D2EB 4GVEA 4CZGA 5DQGA 3K57A 3CXCR 1M90O 5GAEI 2YWWA 1SAZA 1HBMB 4J9RA 4IOCQ 3G8SA 2BRKA 5ETNA 3HJVA 4ENOA 4MO5A 2GO9A 4W5NA 4A59A 1F6TA 1O0PA 2W01A 2B5JA 4OVLA 4E7HA 1VHIA 1NJWA 3I6PA 1YT3A 3PYEA 4E8UA 1N5YB 3HHEA 2KT2A 2YQ3A 4YY3J 2AYMA 4QWBA 3Q24A 5HOOA 3N79A 2DGQA 2YNIA 2FTRA 1M1GA 1X4BA 5A0YB 2W6KA 4DEZA 2I1RA 2XCPA 1TKZA 1MWMA 1R8HA 3JYTA 1SV5A 3TO8A 4FWSA 5A8WB 4ZTFA 1T9TA 2W6LA 2AX1A 2DGVA 4FVMA 4RWXA 4CW7B 5LXRA 3G2XA 4NLVA 5DM7L 1X3NA 3OT9A 1HFEL 3IAYA 3HPOA 4RJVA 3M3ZA 5LM7E 5BXIA 4WU2A 5IOLA 4PUOA 3W63A 2DNOA 4DQQA 5HROB 4CYUA 2HRTA 3OYFA 1H2VZ 2D69A 2B4JA 2HPUA 4K4ZA 3GPAA 1N34J 2GCFA 3KLIB 2M8HA 4Q8EA 1Y64A 2B9XA 3H45C 2LEBA 4CESA 3SK3A 4Y00A 4BRLA 4KHNA 2HHPA 2G4BA 1UZHA 4FDFA 3FZFA 3RMBA 1M5VC 3GBTA 1B99A 5DG7A 1T44A 2WVEA 5D4LA 1FTCA 5U47A 1HYVA 2QTWA 5A8RA 3UKUB 1UEUA 3I5BA 1EX8A 1VDHA 2XULA 4AL7A 3QJPA 2DNNA 4ELTA 2P9UB 3OHAA 2JEFA 4AXJA 1HRHA 3LDSA 1IKXB 3JTOA 3WEEB 3BKTA 3MEDA 2E9ZA 2UXCF 1NMDA 1NJIO 1QUVA 1XC9A 3R9PA 2VFRA 3T5HA 3CCRN 3NGUA 1VSHA 1WOSA 4P72A 2V4JB 3QINA 3UE5A 3DOLB 3G8TA 3ADAC 1N5SA 3D54A 2Y0SD 3CMAS 2KTQA 3KMSA 1TUYA 3M8SA 3I31A 1ZBLA 3LDNA 4CZEA 5KFUA 2DY1A 3AY9A 1NPRA 5CYMA 2MSTA 1FRMA 1YI2S 3O44A 4BR5A 4K4TA 1NB7A 2Y1IA 1HKCA 3SMSA 3SCJE 1RP5A 3WZ0A 4YOEA 3IMQJ 2E8AA 3LGMA 1NK6A 3AJ2A 1RWXB 3FSIA 5ETPA 2H3EB 2NRHA 2JH3A 4FYYB 4ZKAA 2QFIA 3MOZA 3CG7A 4Q5VA 5EVZA 2ZOGA 2N7YA 2Z8QA 5BPMA 2LSNA 2ZKTA 1JXEA 4BRQA 4PL7A 3R6MA 4ZP8A 3H5YA 4KR0B 2VA3A 5C2DA 3MAQA 3R5GA 2NPIA 4A5AA 2BJ3A 5FLXO 1YRXA 2UUBK 5HVFA 4WFXA 2AYGA 5B08A 1ZS6A 2MZSA 5HQMA 1BO5O 3VTIA 5KQ8A 1AT1B 1BCOA 1BGXT 1VBKA 2BH1A 3D2FA 2E1PA 2MZTA 7AT1B 3OLAA 2DHXA 3V81B 5DMRA 4FWMA 3U9ZA 1MN9A 1OWXA 3DLJA 3DXKA 2BQUA 3TJ9A 2RQCA 2PYLA 4NLXA 3N9UC 3ZZZA 4KTQA 3K5PA 2MHEA 1R8CA 3FNNA 1C0TA 2ZD1A 4CEQA 2LQ8A 4L3NA 4IR9A 2B7CB 3TVKA 4PKIA 3AB2B 3U1LA 3UW1A 2ASPA 3KK1A 1RDCA 3P49B 4PHTX 2FQQB 3C65A 2OCEA 2M52A 1Q5VA 2CWKA 3THPA 4QW9A 1VHXA 4UT4A 3THTA 4N5SA 2JJ4D 3BM7A 1G3OA 1U47A 3LDOA 4X62K 4Z4IA 2MLYA 4C8MA 2XC9A 5KI6A 2YNFA 4FCYA 5L1LA 1BI4A 4WWSA 2GTDA 3CC7N 2GAGC 4B3OB 4LFAJ 3PIPL 3QFHA 4YR3A 2P51A 3SI6A 3DDNA 1IKWB 1I94J 3NMUA 5AXKA 4JI1J 4E7JA 5JLHA 3E2EA 4E7LA 3L09A 1RXOB 2EBGA 4GRSA 3QFUA 4JI0J 2B9WA 2DIVA 1VSMA 1UOCA 3C19A 3T1HJ 1S1UB 4IJNA 2FC9A 4CQ1A 4DUYJ 4OFZA 3U8XA 2EG2A 2XB2D 1ASVA 1ZM4A 4M5KA 1TL3B 1X0PA 3ID8A 5I9EB 2LLZA 3BQ0A 4NLBA 2J0WA 1QQCA 2C3OA 4M5GA 1ITGA 3GIIA 4JV0A 4JB8B 2C3MA 5KFBA 2DITA 5KG5A 4EU0A 1LNQA 5ADXA 2ZHAA 2O8BA 1TMMA 3P4IA 5BYSA 1L3KA 1HW8A 2E5GA 4LF7J 4F26A 5M2PA 4DPUA 4TYAA 5HVGA 4NO7A 2XYHB 4Y3CA 3OTBA 1VSIA 2E1YA 2YHAA 2V2KA 3RRGA 2NYIA 4DV6K 4CNYA 2ATLA 4KRFA 1TUWA 1BMQB 1HJOA 2E4LA 3O80A 2Q2RA 3GU0A 3ZT3A 4RU9A 3PKYA 3MMBA 4K4SA 4CE9A 2WVBA 3CQYA 5BPLA 2HNYB 2BZ2A 2QIFA 5HJXA 4B3RF 3DYAB 2Y0BB 1SJRA 4DX7A 1F2GA 4M5IA 4DJBA 2E5LF 2GS8A 2H51B 4MK8A 4K0KK 4CVNE 4Z4CA 1WTFA 4K50A 1U49A 3QIPA 2GVDB 3OJSA 4CHZA 4FK0A 2FBYA 5JVGQ 3VEVA 4DR6F 2EFNA 2FLPA 3CWJA 2IA6A 4YOXA 2W4DA 2P8IA 2X74A 5T14A 1MA9B 3P83D 3MMCA 4U6PA 4QS7A 3JQJA 1RJJA 3MAAB 4P7TA 4WXOA 4WFNQ 4A61A 4CJFA 3V9UA 4DX5A 2V8VA 5HMYA 1S1WA 1SXLA 4DTNA 2MKYA 3O1LA 1RT3B 4PWDA 3VAFA 2FJAB 3KWIA 5KFYA 1GXLA 3CB4A 3QGHA 4YHHK 4GKKK 3UDLA 3NCQA 4BY9C 1UJ4A 2BABA 2YWGA 2XZTB 4YB6A 1UWBA 4F3TA 4DMZA 1L5UA 3C6TA 4HL9A 4USVA 3DHWC 3ENQA 2WONA 3CCJS 2ZE2A 4V1Ak 1RBVA 2ZZMA 1S9FA 4OIXA 2VQFK 1S12A 5AQSA 4V19S 2GX8A 2UXDF 1NGHA 2AW0A 1E6YB 2KH9A 1XNQF 1RTZA 4CLYA 3N6LA 4WTYA 1RGVA 3UNYA 4NLWA 3W9JA 3H20A 4J9OA 1TL5A 2VFTA 2Z1JA 1WI8A 3LH2S 1YG0A 1VJWA 3FCWA 2CXEA 2A3ZA 3W66A 1D3WA 1HNIB 6FDRA 2IVYA 2C2NA 2QA4G 3LP3A 3S1TA 3THYB 2PMWA 2WK4A 4LIRA 2L08A 2LVWA 1MU2A 2HVZA 2ASMA 3H8YA 2DXEA 3CJ0A 3LDLA 1R0AA 3Q2SC 1RDAA 5F9LA 4DV5J 3RU0A 1NOZA 4FF1A 1YJVA 3J81j 1IKYA 5KOWA 3K0JA 5E3RA 3BSCA 5CYJA 5IM0B 1DLOB 4W90B 4N56A 2DFEA 1U24A 1A5WA 4ZCLA 3PO4A 3SQ1A 4DOZA 3JSYA 2G8UA 1N56A 4JK7A 3VQAA 4BHQA 5C2CA 3ZCMA 4ISFA 2XI2A 3I87A 3R9LA 5CCLA 2DHHA 1DGKN 2M2BA 2V50A 1SKWA 3ZZRA 4EYHB 4DTXA 4OYWA 4PAAA 4UOFA 2VV5A 3M6WA 1JL2A 2HQDA 4EEYA 3QLHA 5J1NA 1KQSM 4FLYA 3CJQA 1EKSA 4YORA 2RQ4A 3NNAA 4GMKA 2FJBB 1WDDA 3QGIA 3IM8A 1S57A 2RRNA 1GLLO 2WUSA 1GMVA 1Q9XA 3HFVA 1IR1A 3FMBA 4DV1J 1K0TA 4BR9A 4OL8A 4OV6A 3VAGA 3RMCA 4X66F 4FZZA 2FLNA 1HI1A 2O8DB 1YJ7A 4URGA 2AZ3A 3BYPA 2FDNA 3OS2A 3CD7A 1PC5A 3CCQN 3DLEA 4L73A 2MKSA 2UUAJ 3JAMY 1M5SA 1TAQA 4EGLA 4OJRA 2IRXA 1IR2A 3HJFA 4JI5F 4F8RA 1NGFA 1S7IA 5HLFB 1C1CA 3BEGB 2GHVC 4OX6A 2OPRB 5BN8A 3CJ4A 1PYOB 1Q82T 1IG9A 2OP5A 3UB5A 4A4JA 1ZOTA 4GY2B 5GMEA 2IVMA 1YAGA 2OANA 2ZHOA 1WSRA 2V7ZA 1S0NA 4EP4A 1GX5A 2B7BB 3EKUA 3EUNA 1RWUA 2Y8YA 3CEDA 4XAKA 3AOAA 4ZN1A 4YQWA 4OPHA 2LEAA 4F3QA 4JI7F 1M5HA 5GAGU 1HR0F 4XPCA 5CY4A 5KFSA 3BS9A 6FD1A 3WXIA 4EO6A 2DPJA 4NXNJ 2V7YA 2J76E 2NRRA 2R7SA 1HMVB 3EPGA 1ILYA 4OHXA 4DR2K 1HQEA 2RE1A 4L75A 3DMJA 2DXDA 2LXIA 2Q97A 3ZT4A 5C25A 1Q1KA 3PW4A 4BC3A 4EMDA 4PG7A 4RNMA 2EFQA 3AD8C 4Q2MA 5CYQB 1RB0A 2QMXA 1VSDA 2QWOA 4CF9A 3NRBA 2QRRA 4JK8A 4OGCA 2BJEA 4JV5F 2HQFA 3M2VB 3FFIB 2ZUGA 2MKKA 1HW9A 1Q16B 3FBCA 1WSFA 4TY8B 3SYZA 3V1QA 2GVZA 1VQKS 1VSEA 3TAMA 3VESA 1C0FA 2FY1A 2I7NA 2EKYA 3CDAA 2CQ1A 1ZH5A 2QWMA 2CQ3A 1VC6A 1VQ9N 3NLCA 1I3OB 3NGKA 4KQZA 1R8PA 4FWPA 3NOCA 3DM2B 1OQ6A 1NK5A 2OMLA 3TANA 4JYAF 2D1CA 5BYRA 1QE1B 5AT1B 3LP1B 3CIPA 4EFAC 5LSRA 3OTOK 3ZZPA 4IG3A 4JKCA 2VYPA 3P5JA 5EXWA 5K14A 2ZBCA 2EHGA 1QJHA 4V19X 2HBLA 2KW4A 3DOMA 2D5RA 1RT5A 5AQXA 2E7WA 1N33K 2HNZA 4ZPWR 1RAHB 4FP9A 2HG4A 3OTDA 5FDLA 5J1EA 4ZHRA 4J9MA 3CDUA 4ILRA 1I39A 2KFNA 4RUHA 4JI6F 1BUPA 2V2ZA 4U67L 5JXSA 1FI4A 3C15A 2FPHX 2IS3A 4KC5A 3GDQA 1VQ7N 4NXMJ 2BANA 2VL1A 2NR0A 1UEVA 1UJ5A 3UN5A 1KVKA 2ZOFA 2XY6A 3I33A 2ITMA 5LMNF 1KLMB 3V6JA 3N6NA 1RWKB 1WEXA 3SPZA 3ET6A 3BGOP 4H0PA 5KFZA 2GHWA 4QZVB 2Y8WA 4TN2A 4F25A 3KK7A 4A8MP 2C22A 2OZMA 3SDEA 5DDOC 2HSEB 5AJ3F 4Z4EA 3OBIA 3VV2B 3GR1A 4M5NA 2B9YA 2KT5A 3HOSA 2GC8A 4DR3F 1ZM3A 4KH0B 3NOGA 4ZITA 1SCJB 1F0XA 4NL5A 3AB4B 4XDDA 2ADCA 3NH2A 1WORA 1IWGA 1RTDA 2F96A 3S7RA 1I5OB 4BGAA 4DV3J 3PV8A 3QBXA 1JKHA 1K8KA 1L3TA 5EDWA 2R7TA 1RU2A 2QLBB 3ILOA 4IFVB 3QO9A 3VQ8A 5AQMA 1CQNA 5DO2A 2R7RA 3UDEA 3PM9A 2Q6CA 1LK7A 2CZVC 1TUVA 2C42A 2Z58B 3UO0A 2D4WA 3MN7A 1NGAA 3PTWA 3P4UB 3KG1A 5AE3A 1X5TA 3CCLS 2AJ1A 1BWEA 2F8MA 3J80U 2H9ZA 4DV2J 2GJ2A 4AFFA 4CZKA 1YZ7A 3D0IE 4BWMA 1CSJA 1KVIA 1H1VA 1DTQB 1U2VA 2R42A 3AVLA 2O8FB 2AT1B 2VG5A 3B54A 3CD6S 4YOUA 5AQIA 1WN7A 5F0XA 1JJHA 2A1SA 1RBOB 5CABA 2WCXA 1XMOF 3GSIA 3M1VA 1CC8A 4H0XB 3E01B 1YJRA 2FB0A 1F5BA 1WHVA 4DL0C 1QSSA 4FKXA 3RUBL 2VQEK 5B0EA 3B78A 1PKUA 3DGPA 1NCLA 2RRBA 1SJFA 2JEJA 3L3CA 3BO4A 4K4XA 3DXSX 4LRBA 1URNA 3THWA 1VI7A 3AXKA 3G71N 1RHQB 2B5JB 3PZPA 4GO7X 3H40A 1O5JA 2X51A 2EI5A 2YV0X 5D15A 3DRSA 2W2MP 3PYGA 5D0EA 1KFDA 1W2BM 1NDPA 4AHUA 2YX7A 2K3IA 4FYWB 3LP2A 3CJSA 3T5KA 2XNQA 3CT9A 4WP3A 2YNIB 4YDDB 1RYRA 3RBEA 3AVBA 3C16A 2BDPA 3MWTA 4CP5A 1CJVA 3JYTB 3FZ2A 1TQLA 1SV5B 2N82B 3W2VA 1FWKA 5KFLA 3KTQA 1CJTA 4ED7A 4CT8A 4C4WA 1CVJA 2MMYA 1HKGA 4NEYA 3WQTA 4IO8A 2ZH9A 2OH2A 3ZZTA 3TRGA 4CZMA 3BYRA 5LMUF 3HULA 2RMLA 3VPZA 3J80Y 4ID5A 3QMQA 4CYUB 3H25A 3QWPA 4QIGA 1UKUA 2IYIA 3ZX3A 2RUGA 4HUGA 1NDLA 2CQCA 4UOCA 3L8BA 4ISGA 4K8XA 3PJXA 5HL7L 1HHTP 4FPAA 4EBDA 3FCVA 4CLKA 1BA1A 3QJLA 3Q7BA 1HIYA 4H5NA 4CJWA 3HI0A 2R2SA 2ZJRQ 1RBSA 2YX4A 1MWYA 2YHXA 1R0CB 2UUCK 2XS2A 5GADU 2Z30B 2I5JB 1GT8A 5A8RB 5MLCQ 1YJWS 1C0MA 3PSFA 2RVJA 1G6BA 2AIRB 5KRTA 3HP9A 4C7QA 1H6KX 2YKNB 5L1JA 1HPZA 4IFYB 3NGZA 4UY8T 1RWOB 2F65A 3GV5B 1LXNA 3GFHA 3B6PA 1SVDA 2JFKA 1ZBHA 4X62J 2W7OA 3QRRA 1RAOA 1RWVB 5KT3A 3IWNC 2Z2MA 4CFAA 2AD9A 5KT5A 1HYZA 3CCQS 1S7HA 3CC2N 5DZ6A 4ZPDA 1FWPA 1BQMA 1LAVA 4LY7A 2GQCA 2R7YA 4S0MA 4CH0S 3H98A 2JHEA 1AUSL 4CIOA 4CJVA 2GBZA 5C0YA 2FZCB 2HHHF 3AA5X 3L4IA 4AM7A 2XMKA 3S3OA 1FX2A 4KPCA 1LW2A 5T7LA 3EKSA 4WBFA 3SUNA 3V1OA 4A47A 2MLZA 2A18A 4NLTA 3WIUA 2P9LB 1NHKL 2OO4A 1KP6A 4R25A 4E2FB 2YY3A 4CBXA 4WFAQ 1BA0A 3PW0A 3LPYA 5L39A 3E9LA 4NYOA 2HGLA 5C24A 3D2FB 1KTVA 4IWVA 4RPFA 3RAMA 4C98A 3LPUA 2F5GA 2BBEA 4RNFA 2R7XA 2GWKA 3OYDA 1D1UA 1REGX 1VAZA 3DXKB 1B0TA 3CJ5A 2PEBA 3TJAA 1FF2A 3NS7B 1C0TB 1LWEB 1IBLJ 3C6UA 3KK1B 5FJ4A 3UDCA 2EW9A 5DETA 3SBTA 3GV7B 1NU0A 4ZLNA 3KK2A 4X65J 1KHVA 1YIJS 2YNFB 2UXCK 1FJGF 4PY5A 2ZM6F 3IS9B 3NF7A 3HT3A 3ATUA 5GVQA 4FOIA 1CULB 3CJ3A 2FJVA 3FGVA 1JLAA 2N4DA 4UUXA 3GB0A 1VQNS 2BXJA 2A5XA 1FXRA 4DFPA 3OFEA 4ZS6A 3R3TA 2IAJA 4CM2A 1X31C 5JS1A 1V9OA 2MZQA 2DY4A 4J9VA 3OVBA 7FDRA 4E89A 4GKKJ 1QD1A 4GO5X 4X4NA 2FVCA 1HNXJ 4O23A 1JJCB 1FKOB 3RSEB 3NNHA 4I68A 1T05A 3QRPA 3PNIA 3BKFA 2O8BB 4PQUB 2A6MA 4BQZA 2JLGA 4ZVQB 4FKYA 4WFBL 2YWHA 2C28A 4DSEA 1HBUA 2DYAA 3VAHA 1VQ7S 4R8UB 2YPYA 1Y0HA 1HNWF 1O6XA 2QGFB 2BE9B 3HSDA 2BTFA 5KFDA 2NUBA 4PKHA 1WD6A 3MD1A 2HZVA 4M63C 3A8IA 2JDJA 3BGLA 1N5TA 1E3MA 3TJ8A 4LR7A 3F56A 2DNKA 3H2LA 4LSLB 3M8ZA 3MTJA 3A5NC 2LQ5A 1C1BB 3MMBB 2CPHA 4DR5J 4XH5A 3ZC4A 1NGGA 1KD1O 1DQ9A 4FXVA 1IR0A 1IKVB 4O0IA 2ASOA 3D1OA 1M1KT 2NXEA 4BR7A 2E7XA 1DBDA 4ZLLA 3NGYA 3AOCA 3NY0A 4LF5J 2CQBA 3VQQA 3NDKA 2Z56B 1C1AA 5HJYA 4FM1A 3T9NA 2ITGA 3D1HA 4DF8A 2RH3A 2FVSA 3MEEA 4DHVA 3LOUA 4A2BA 1QLNA 4PYAA 2HFVA 5M1QA 4QR2A 3DLLQ 3ILJA 2OYQA 2AJ0A 3TX0A 1AW0A 1CG2A 1S1WB 1TELA 4I6AA 2B6AB 4J2DA 4JK9A 2BUNA 3NNCA 3G0ZA 4JKDA 1UFKA 4ZPBA 2ASDA 2CJKA 3SUOA 1FFGB 2VCPA 2EX3A 2Q3SA 1RAIB 5E2QA 3SMPA 1VSFA 3VEOA 1QVFM 1UWBB 1SS6A 2Q36A 3Q8RB 1RHMB 3HPHA 2NXCA 4MYTA 2WONB 1HL6A 3M2UB 3DDKA 4EP5A 4F2SA 4Y2CA 3HHDA 4LR9A 3JXUA 1FT8A 3MXJA 4RKUC 3IBWA 1Q4RA 3MMAA 1BOTO 3LM2A 1HWLA 3KLVA 4FLWA 2BM1A 3A4TA 1GX6A 2CIMA 1S6PA 1SL2A 3CETA 1G7CB 4GVBA 4FWKA 2BM0A 3UQSA 1FKPA 4XDCA 3LDPA 4A8KA 1SB6A 3GMGA 4ILHA 1UA0A 1LFWA 4AHRA 2D7SA 3HCXA 4GNIA 4Z2XA 3EN9A 5IT9U 1GLAG 2HB5A 1YBAA 3V9XA 1RNHA 5M1KA 4BE2A 4JRQA 3AGKA 2KI2A 2X3GA 4P73A 4M7YA 1KVJA 1NKCA 4E19A 4ZVEA 3C14A 4B3RK 2K1RA 4M8LA 2PFDA 1IKYB 1H73A 3VTHA 2CA9A 3U6FA 1TYQB 2E5LK 1VRUA 2RD5C 2PFUA 3NWGA 3TEGA 1HNZK 4IH6A 4DF4A 2DGOA 1MDUB 2OZSA 2CPJA 1PJ7A 1V5VA 4FL9A 1YJ9N 5E3CA 5K5MA 3ILLA 2M70A 4DR6K 4OX9J 4ETZA 4DUTA 2H3GX 4CD3A 5JMVA 2WW4A 3UD5A 1FHTA 4JD2A 2LQBA 4C8KA 4YMEA 3P39A 1SJQA 2XO7A 2A1RA 3QLHB 4ETXA 3RB4A 3SQOP 3NXZA 1HBNB 4FWLA 4AF1A 4I2QA 3NG8A 4OI0A 3Q8PB 3MI7X 2GJFA 3ZEUA 2ZGZA 4ISEA 4EK2A 3OSPA 3TU5A 4JV1A 2AJQA 3BSAA 3RW6A 3FRYA 1F9HA 3H1QA 2G0CA 2YH0A 1OYDA 3LANA 2F8HA 3VA0A 4F4AA 3DLKA 3QGGA 1R59O 4I6MA 5M2UA 3DLEB 4Y6IA 4DCHA 1DARA 4DQ8A 1GEHA 3D4JA 1GOBA 2GIRA 3ASMA 1OH7A 1ZTWA 1ACMB 4LFBF 3UN2A 5HMWA 4IDKB 1OYEA 4I6YA 4JI4F 4QOTA 4X2BA 5HBMB 1VCTA 4LT6A 2UXDK 2EVZA 5C10A 1RACB 4NCGA 2D9OA 3NGDA 1HNVA 4IKAA 2MKHA 2CDQA 4ZTJA 2FVQA 3MCMA 2GNKA 4DV7J 2AYEA 2RU3A 3KKFA 1KQFB 1Y3JA 3BF1A 4NCAA 4MKYA 4BDZA 4PA1A 1J9AA 2VHGA 2DO4A 1RBRA 2J6TA 4YB1P 2RF2A 3KYLA 1WC5A 4J9LA 4IO1A 1XNRJ 4ECYA 4AT1B 4ZA1A 3VAMA 4BR0A 4N41A 3C7NB 3CC2S 1QQOA 3U9DA 3VETA 3TEHB 3HD1A 2DO0A 3G4SN 4GKJJ 2RS8A 2Q0UA 4IRCA 1HQEB 1A5VA 1NHUA 3MR3A 4K8ZA 2BEFA 1NGJA 5IT0A 4M5DA 1FNXH 2OHDA 2CQIA 5AQUA 2MKIA 3HKWA 4ZVPB 3B8HA 4QQBA 4FNHA 2MQ8A 4AYBD 1ZPVA 4YS2A 4TSXA 1W25A 1VLYA 3RW7A 3ZLJA 3MEGA 5HVHA 5A6PA 3KNGA 2O8CA 4RW6A 2FSNA 4B3SF 3TZYA 4ER8A 4DR4J 3RJMB 2A6OA 3TTFA 3CERA 1HBOA 3JTPA 3QT8A 5KG6A 4B3TJ 4BDYA 5KG7A 2XMAA 4CLTA 3H1VX 5DZ7A 4MKVA 5IC4B 2PI4A 3IM9A 3TNVA 4I9QA 4QIFA 3NL0A 4FO0A 4AQYF 2BACA 1H74A 2J8SA 2DVIA 1RDRA 3C95A 4DSKA 1YHQS 3DU6A 2WSEC 2VGNA 4CBWA 4DN9A 3UCUP 4U7UK 4WCEL 4X66K 3W61A 3UN3A 3CULA 4PWUA 5RUBA 3T5JA 5AQVA 2E1AA 3EVOA 2NRZA 3H5SA 1F60B 2FHKA 1JJ4A 4JI5K 4F9OA 5K14B