4KV8A

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase P66
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 152
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kv8A05
4O4RA 1JL1A 3MEDB 4G3IA 3EPGA 3H5YA 3DRSB 2HWIA 5F8LA 1NNDA 2E6MA 3OYKA 1RTIB 3ZSOA 5DG8A 4DU4A 1EX4A 3VQPA 3VQDA 4F4YA 4Y2CA 3OSNA 2B5JB 1KCFA 2XY7A 4N41A 1C0UA 2FLPA 2X78A 3OYNA 4CHZA 4ED8A 1JLQB 4F4XA 4B9TA 4J9QA 3CDUA 1RTHB 4URSA 1Y97A 1KSPA 5KGWA 4ID5A 2D7SA 2HNDA 4KB0A 1RT5B 4RW9B 3WNHA 3MR5A 1Z25A 3V9WA 1ZBFA 1Q9XA 2FJWA 1U09A 2HWHA 4LY7A 3QO9B 3L2UA 1RTJA 3RMDA 4RNNA 3K58A 3K5MA 3PUFA 4JV1A 1S6QB 3PW7A 1J5OA 4KBIA 3E51A 3M9NB 3RWUA 2AGOA 3CYMA 2NUBA 4DTUA 2WHOA 2BE2A 4C8OA 2W9AA 4JLHA 3PX0A 3HL8A 4DFJA 4FJMA 2R2RA 3KK1A 1TKZB 3RB4A 3V1OA 2AQ4A 3P83D 1KFSA 1ASWA 1SV5A 3RTVA 3QGHA 2B4JA 5KFZA 3SFUA 2OPPA 3AV9A 3PR5B 3L2QA 1EKEA 2X6SA 5CYQA 5KG2A 4JV2A 3MFIA 2ZKUA 1TKTA 1JLBB 5CYMB 5HLFA 3QEIA 2AJQA 3CFPA 4NLUA 3H40A 1DLOB 2IM1A 3VQBA 3RR8A 3M8PB 2EX3A 3LPTA 4LSLA 1TVRB 3MTKA 5F8IA 4IG3B 3VQ4A 4IDKB 4FVMA 2ZQBA 3QIDA 4BE0A 2OPRB 4QWAA 2ZD1A 2FLLA 3KMSA 4R5PA 1XHZA 3Q8QB 2BQ3A 3O4QA 4QWEA 3QINA 1O1WA 4CJUA 2HW3A 3QEXA 4HUEA 3HP6A 3HVWA 4EYIB 3MECA 4E7JA 3TAGA 4CCHA 1T05B 4CHYA 4ZHRB 2W9BB 2R8HA 1NK5A 4FJGA 1B9DA 4CF0A 2RDJA 3I5CA 4E7LA 4Q8EA 4IBNA 4DL3A 4FLUA 2QKKA 4ZPAA 3NAEA 4YP3A 1C1CA 2R8JA 3WNGA 4XO0A 3AVJA 1RYRA 4FLVA 2GIRA 4CJSA 3CM5A 3DYAA 3LALA 2R2SA 4B3OA 2WCXA 5EWFA 2I5JA 2VG6B 3ZSWA 5EWEA 4WXOA 3I8DA 3VQ8A 4I7FB 3V81B 3OYHA 1HJRA 4ICLB 2XI3A 3DLKA 4NLPA 3SUPA 3QZ7A 3H98A 1JLFA 4M3UA 4I9QA 2E4LA 5KFSA 2HHWA 3RAQA 4O3QA 1S9GA 4J2DA 3DI6B 3AVKA 4QWDA 1QAJA 4ECQA 4K4YA 5HBMA 4E1NA 2KFZA 1HPZA 4M41A 3CJ2A 4CK2A 1SL2A 4TXSA 1CXUA 3HO1A 4LQ9A 1FKOA 1IKXA 2D0BA 3LP0A 1NJZA 1HYSA 1NK7A 4O44B 2C2EA 3KD1E 3MEDA 2YKMB 2J6UA 2UVVA 1WAJA 5DGAA 3DRSA 1YTAA 1SL0A 3IRXB 4RUAA 4M45A 4CIEA 1RTIA 4CEFA 2ILYA 4M3WA 3JYTB 3AVLA 4Q5VA 3T5JA 1ZYQA 3RBDA 4FLZA 2B5JA 1S1TA 2R2UA 1I39A 1TAUA 2PYJA 5KFAA 4M3RA 2E9ZA 3NGDA 5KFWA 4ZPCA 1UAXA 3KLIB 1HMVB 3BSCA 1I3AA 2B6AB 4ELUA 1KFDA 1RNHA 4E89A 3OYEA 2R8KA 4CF1A 1RT5A 4JUZA 4FJ9A 3GV5B 5KT5A 1IKWB 3V9SA 4DTJA 2GBZA 5I3UA 4FLYA 1S6QA 2VA2A 4LSNB 1UA1A 3MEEA 4DFPA 4EO8A 2C28A 2D5RA 2G8FA 3DMJB 2XY8A 3KLEB 1LWEB 1L5UA 3DRRB 1GX6A 5D3GA 3PJXA 1JKHB 2YKNA 3UQSA 1TKZA 4Z4HA 1S6PB 2HVHA 3ULDA 4CJTA 4HYKA 3V4IB 5KFLA 4CIFA 1EXQA 1XR5A 5J1EA 4K50A 4X2BA 3CDEA 2OA8A 4CFBA 3LZJA 2OH2A 1JLBA 1KLNA 1HYZA 3M8PA 2D3ZA 1OS5A 2O4GA 1WSGA 1TVRA 4FJJA 4NCAA 4E7HA 4IDKA 4FBTA 4W5NA 1TL1B 4WFZA 3M8QB 1CZBA 2OPRA 3CDWA 5CZ1A 3C6TB 3CJ3A 1ZETA 3U3YA 1QS4A 3K59A 4E1MA 5KGXA 3C6UA 2G8VA 4MFBB 4CJ5A 4AHRA 3BDPA 1TAQA 4WZQA 1ITGA 2BANA 3AO1A 1VSLA 2ITGA 4IRDA 2IAJA 4DSKA 2W8LA 2YNIB 5KFEA 4DTSA 1T05A 2ETJA 1EP4A 4RW4B 2YV0X 3L3UA 4ZHRA 4PQUB 2W9BA 3BR9A 2FVRA 1BCMA 4F8RA 4KKOB 1BIZA 3BJYA 3DLRA 4ECUA 5C25A 2XCPA 1FXXA 3SQ1A 3NKYA 1G15A 3T1AA 3OHAA 4CFAA 4DLGA 2HHVA 5JUMA 3SNNA 2HNYB 3OSPA 4I7FA 4FJKA 4DL7A 3OYCA 1RDRA 3Q8RB 3NFAA 4KHWA 4ICLA 2GIQA 3IGVA 4JV0A 3NHGA 4NLOA 2YNFB 3HXMA 3HYFA 4NCGB 4CF9A 3KLGB 4YR0A 3JSMB 3AVMA 4ED6A 4CGHA 2E9RX 3PZPA 2XY5A 3DI6A 4NLDA 1S9EB 4MIBA 4TY9A 3A2FA 3OYIA 1NKCA 3CQ8A 4AHVA 1KTQA 2FVCA 3QGIA 1S1WB 3PY8A 1RT7B 1B9FA 2KFNA 1N4LA 3OL8A 4DSEA 1J54A 2PY5A 1CZ9A 2ASDA 3MXJA 4CEAA 3PW2A 3CG7A 4CK1A 2D0CA 2HMIB 2HHQA 4O44A 4WZMA 4ZVGA 4KTQA 2BR0A 3AVBA 4QWCA 2YKMA 4FYDA 4K4UA 2OPSB 4Q8FA 3D28A 2VWKA 4FJ8A 3IRXA 3LP2B 1JLCB 2HNZA 4R8UA 3AVCA 1B92A 1ZTTA 4CEBA 4DS5A 3JYTA 3CFOA 4AHSA 1RDBA 2DTUA 1LWFB 1K1SA 1C1BA 4OKKA 4LQ3A 4DTMA 4FK0A 5KFVA 3CVKA 4IRKA 5HP1B 4O3SA 2IC3B 4FJ7A 3H5UA 4FLTA 3KLIA 1HMVA 3MXIA 5KFRA 4B08A 2Q3SA 1W0HA 3AA2A 5FRMA 4PY5A 2IBKA 3FDSA 5KG4A 1Z4UA 3QEVA 3SPYA 4CJQA 5HRRA 3DLGA 4NYZA 5KFFA 1JL2A 4ELTA 2VA3A 2KW4A 1IKWA 1XR7A 2IA6A 1T03A 1U47A 3D5MA 2UVWA 1RYSA 5KRSA 2Y1IA 4OGEA 4LSNA 4B9SA 1DTQB 5J2PB 4KHQA 1TKXB 3NF9A 4CJPA 3DMJA 1IKYB 3KLEA 3RR7A 3KD5E 4EBDA 4DLEA 4K4VA 3QZ8A 4RNFA 4BACA 1Q9YA 4O3NA 5KFPA 1T7PA 1XR6A 3E01B 3EYZA 4HUGA 5KG1A 2W8KA 1RBTA 1U48A 3CJ4A 4BE1A 4KHSA 3ZT3A 4DFMA 4DG1B 1SH3A 2HVIA 3QIOA 5J2NB 3V4IA 3TANA 3WNEA 2HHXA 1BQMB 1REVB 3DOKB 3ZT2A 3D0PA 2BDPA 1RTDB 3NCIA 3SCXA 2IM3A 2XC9A 5KG6A 4RNHA 4LD0A 1QE1B 4DQIA 3IN5A 3NGYA 4ZP6A 1S5JA 4NYFA 5L1LA 4ECYA 5KT7A 3KJVB 3DLEB 2FLNA 4CGIA 4DSJA 3SUQA 1WLJA 3QLHB 2ATQA 4CECA 2IM2A 3HKWA 3QNOA 3HVTA 5EU7A 1N56A 3C6TA 3VQCA 2WK4A 4I2QB 4MFBA 4NCBA 4FS2A 1XWLA 3NL0A 4CJWA 2JEIA 2RKIB 1LW2B 4CEZA 2GC8A 5C24B 2YNIA 2JGUA 2JLEA 1SKWA 4RW4A 4KSEB 3K57A 4PQUA 5DQIA 3SYZA 4KKOA 3IS9B 5KFGA 1QSYA 3NMAA 1S1UA 2IDOA 4MKAA 4HTUA 3T5LA 1RT1B 3C95A 4BDPA 1QAIA 1LAVA 3H5XA 1SKSA 2QE5A 4NZ0A 2XRIA 1Q8IA 3VQ7A 4J9LA 2EHGA 4R0EA 4TN2A 1LWCA 2ZE2B 3HPHA 4TYBA 4AHTA 2HNYA 3HPOA 3HP9A 2JEJA 4ZTJA 4H4OB 5KG5A 1L3UA 1U04A 1T94A 4MH8A 1QSLA 4OPKA 2J6TA 4NCGA 4MIAA 3SJJA 4C8LA 3HK2A 5JS2A 3MEGA 3ITHA 3L3VA 4KFBA 3JSMA 1BGXT 3AO4A 3TQ1A 4FLXA 3ZSQA 1S9EA 1VSEA 1YTUA 3VQSA 3HPGA 4IOBA 5F8HA 1NK4A 1S1WA 4DEZA 5KFOA 4AHCA 3T5HA 3AVAA 4IFVB 4FBUA 2YHAA 2HMIA 2UUTA 2F96A 2J6SA 3HM9A 2G8UA 4F2SA 2XO7A 1RT3A 1NJYA 3ISND 3FQKA 2ILZA 3TAFA 2OPSA 3NH1A 1S0NA 4KHYA 1EETA 2YNGB 3LP1A 5HROA 3QIPB 2W7OA 4O55A 1LWFA 1WSJA 5KTQA 5T14A 1RT6B 2V0NA 3V6DA 3OYAA 2VG5A 5CZ2A 4K4WA 2VG7B 5HP1A 2A1RA 2XHBA 2IC3A 5DMRA 1UWBB 3LWLA 3M9MB 3KLFB 5C5JA 4KV8B 1WNEA 1GOBA 4ECRA 5KFYA 3VA3A 4AILC 2G8WA 1SH2A 3OL7A 3Q8SB 3BSOA 2JEGA 4NLYA 2HHTA 1BQNB 1QHTA 4QWBA 2V4RA 4DL4A 1WAFA 3C94A 1BI4A 3OYMA 4QW8A 1DTQA 5J2PA 4HCBA 1RDAA 4W5OA 1JLEA 1TKXA 1RAJA 2DFHA 4AHUA 4N47A 3SI6A 1IKYA 1VSDA 3I0SB 4F4ZA 4JRQA 1L3TA 4FK4A 3FFIB 5EDWA 1WSEA 3E01A 1HNIB 2Z1JA 1F21A 4FM2A 4DG1A 5FROA 3KKRA 4F2RA 4EZ6A 1REVA 3DOKA 1RTDA 2G8IA 2ALZA 1NHVA 3TABA 3FRZA 1QE1A 2WONB 2WOMB 1RBRA 4DSLA 4O3OA 4O3RA 2XCAA 4OL8A 2V4QA 1W25A 3LDSA 4ZMMA 4TLRA 3V9XA 4Q45A 1ZBIA 4DL2A 1QSSA 3KJVA 3DLEA 4NLTA 2PYLA 3QLHA 2KZMA 4W5QA 4FW2A 5L1IA 3PO5A 4FLWA 4Z4GA 4CHQA 3QYYA 1KHVA 4I2QA 3FQLA 1X1PA 4KHNA 2AGQA 1VSHA 1JXEA 3N6MA 2GUIA 3H4DA 4ELVA 5DG9A 3QNNA 1JLQA 2P5OA 5KFTA 1JIHA 4IH7A 2WB4A 3UIQA 3NAHA 1RTHA 3CJ5A 3IS9A 1VSIA 4RW9A 1JX4A 1NOYA 5I42B 3I5BA 3VQ6A 1RT1A 5J2MB 4ED7A 3KIOA 4CERA 3PX6A 1L3VA 3QO9A 5DQHA 4O3PA 1VK0A 3NGZA 3BQ2A 4K4XA 1YT3A 4IR1A 1RDDA 4Q0BB 3G6XA 3K5OA 4NLVA 4NYNA 1S0OA 5KFJA 4ECTA 3RB6A 4U7CA 1S48A 4CE9A 2A1SA 4BDYA 3H4BA 4O4GB 2BGGA 1RBUA 4Z0UA 2VWJA 4CEQA 5KG7A 4GW6A 3S9HA 3IG1B 1U49A 4KI6A 4J2AA 3GYNA 3DOLB 4B8CA 4EO6A 4KAIA 1A5VA 3AVNA 4ZPBA 3MR3A 3AA5X 3K5LA 4M3TA 2X6NA 3OHBA 1S10A 3BGRB 4CHNA 3LAKA 1SKRA 2AU0A 3NH0A 4FZZA 4IFVA 5CYMA 4DWIA 1TK8A 4RUCA 1S1VB 2W7PA 4YQWA 3KOAA 1DLOA 1TV6B 4EBEA 2BRLA 3UDLA 4IG3A 1NK0A 4NLWA 3BQ1A 5F9LA 4K4SA 4N5SA 3B6PA 4CJKA 3WNFA 2YNGA 3QETA 1SL1A 5HRPA 1S9FA 4HCCA 1RT6A 3OYDA 2E9TA 5KFBA 2XY6A 3TAPA 4C8NA 3OYFA 4EP5A 2VG7A 4PUOB 3V1RA 4BE2A 1NK6A 4IKFA 3MAQA 3KLFA 4KV8A 3U3GA 4B9VA 3ICLA 4RU9A 4M3XA 1S49A 4G1QB 3CM6A 5L9XA 1BQNA 3IGNA 3PX4A 4AH9A 3OL9A 2XGQA 4O0IA 2R2TA 2E6LA 3OVNA 1NOZA 2VG6A 3RMAA 3I0RB 1D0EA 2WRMA 3TI0A 3DDKA 3P1GA 2OZMA 3V81A 3GQCA 4DU1A 4DTPA 3I0SA 3O3FA 4JRPA 1IM4A 4IG0B 1GOAA 3Q8PB 3H5SA 3AVIA 3T5KA 5KT3A 3KHGA 1RTJB 4MKBA 3FFIA 5EUHA 4ID1A 3TAMB 3SQ4A 1HQEB 5JXSA 1VRTB 4YNQA 2I1RA 4WFYA 1J5OB 2AX1A 5KFCA 2AWZA 4OKEA 1FKPB 1IH7A 4ZP7A 3F9KA 4KAZA 2BQRA 3RAXA 4XPCA 1KLMB 1D1UA 4O0JA 2WONA 2WOMA 1HQUB 4RW7B 2YNHB 4KHRA 4F3OA 4FM1A 2QV6A 1ZBHA 2HHSA 4FJXA 4CJ4A 1SV5B 4H4MB 4CFCA 3HVAA 4NRTA 1XI1A 1RT2B 5CYQB 2LSNA 2ATLA 1NJXA 1LW0B 3F73A 5HLFB 4FJ5A 2W9CB 1N6QB 3ZSVA 4GC7A 1TGOA 3S3OA 1K1QA 1C0TB 1NK8A 3ZSZA 1UA0A 5FDLB 5C42B 4OGCA 3TWHA 3KKSA 4R5PB 2B6AA 2FC0A 4KHUA 4E7KA 4Z4EA 2D3UA 4CJEA 3RB0A 3NBPB 3NF7A 1JLGB 1VSFA 5I42A 4DF4A 3NF6A 3OL6A 5F8GA 1BISA 3MECB 5T7BA 3SUOA 3IAYA 1R0AB 4NLGA 4Q0BA 1T3NA 2O4IA 3KHRA 4RW8B 3GV7B 4LH5A 3HSTB 1A5WA 1Z26A 3KHLA 1LWEA 3OLBA 3DRRA 4OVLA 4DMNA 4O4GA 4FJHA 3RBEA 1JKHA 4HHTA 2QKBA 3SZ2A 2JC0A 4W5TA 5F8NA 3DYAB 5KFKA 3IG1A 1S6PA 3H2LA 4IQXA 2FBXA 4KTWA 3DOLA 2WTFA 2C22A 5KRTA 4F3TA 3UR0A 4ED3A 3PR4A 1S0MA 3N6NA 4J2BA 4J9PA 3BGRA 3QEPA 3VA0A 3O3HA 3LZIA 4NRUA 1TV6A 4NLXA 3NE6A 5HBMB 3K5NA 4CJRA 1QUVA 4JS4A 1TL1A 1ZBUA 3M8QA 2GV9A 3QEWA 2BQUA 4K4TA 4DFKA 1FK9B 3CIZA 1CLQA 4H54A 1IKVB 4HUFA 2FBTA 4DQQA 3VQAA 2F8TA 3ZCMA 2FJVA 3ZT0A 2QXFA 4BWMA 1RDCA 4CJVA 2RF2B 4FJLA 4CESA 4CGJA 4PUOA 4B9NA 5L1KA 2Z1GA 3V1QA 2IMWP 3ALYA 1XHXA 1JLAB 3NF8A 3AO3A 3KHHA 2AX0A 2DPIA 1S1TB 1D8YA 1NHUA 4G1QA 1NK9A 5DGBA 1YVFA 4HVJA 3L8BA 4B9LA 4KPYA 4IRCA 3I0RA 4KO0B 4ZTFA 4XPEA 3THVA 2B43A 3KK3B 4IKAA 4IG0A 4IFYB 4Z4FA 1SUQB 1WSHA 2YNFA 5I3UB 1TL3B 4FS1A 3KLGA 3TAMA 1VSMA 1HQEA 3NGIA 1VRTA 4DSFA 5KT6A 4M95A 3PW0A 4TY8B 3V6JA 3MXMA 3MEEB 2UVUA 4PWDB 1TKDA 1FKPA 4K8XA 3M9OB 3PV8A 3NDKA 1RT7A 5D3GB 1KLMA 2P1JA 5F8MA 2YKNB 3PO4A 1MU2B 4J9OA 1HQUA 1JXBA 4RW7A 2YNHA 3D45A 5KFDA 3LP3A 1RA6A 4CHOA 5HRSA 2ASLA 2IOCA 4OLBA 1KVAA 4EYHB 3NH2A 5J1EB 2OPQB 3EY1A 4H4MA 5SWMA 1RT2A 4RW6B 3LP2A 1JLCA 3OLAA 1LW0A 5DK5A 4E3SA 4TQSA 2FBVA 4BDZA 2R7YA 4K4ZA 3OY9A 2IJNA 3I5AA 2W9CA 1N6QA 1D5AA 2Z1IA 4B9UA 3HJFA 4ECVA 2FVQA 2CJQA 4CEOA 4Z4CA 1WSIA 1C0TA 5FDLA 4DSIA 5C42A 3KLHB 3M8RA 3T19A 4DTOA 1LV5A 3RRHA 3EZUA 4I9LA 4DTXA 4KRFA 1KVCA 3ZT4A 3AA3A 3C6UB 4DU3A 3DLBA 4YFUA 5KFIA 2AGPA 4NLSA 1MMLA 1LAWA 2YHBA 2BANB 4CF2A 3NBPA 1JLGA 3LPUA 2IAJB 4N56A 3GIJA 4I2PB 3EZ5A 5K14B 1DTTB 1I6JA 1EP4B 3G10A 1R0AA 1IG9A 4CJFA 2FBYA 4Y1DA 1BHLA 3L2RA 4TQRA 4RW8A 4Q43A 3G0ZA 3DM2B 1WSFA 3ISNC 3TVKA 3SPZA 5C25B 1S1XB 1RT4B 3OS1A 3RMCA 2G8KA 1D9DA 4GMJB 4KE5A 4ZVFA 4FXDA 3ZSXA 3L2VA 2BRKA 3B6OA 3H08A 3VQQA 5J2NA 1CSJA 3GIKA 1QQCA 4E7IA 4RNOA 4M3ZA 1BQMA 4ECXA 5KFMA 1IO2A 3TAQA 4DL5A 3AVHA 3BSAA 4FW1A 3TR8A 3OJUA 1KVBA 3AVGA 1ZTWA 4OKJA 4J9NA 3BREA 4DQSA 3RB3A 3GV8B 4DL6A 3ASMA 3SUNA 1W9HA 1C1AA 4OJRA 4B8AB 4CGDA 1HNVB 3SV4A 4Q44A 4F4WA 2D41A 3ZT1A 1RCHA 4QPXA 2HHUA 3KK2B 5KG0A 2UVRA 4C8MA 3N6LA 2C2DA 3SI8A 1FK9A 1KRPA 1IKVA 3P5JA 1HRHA 5EWGA 3DRPB 4DQPA 5DQGA 4J9RA 2OYQA 3G86A 4CEEA 4DQRA 2RKIA 1LW2A 1J53A 4E19A 3VQEA 3CJ0A 1S97A 2RF2A 2QK9A 2DPJA 5C24A 3O4NA 2RN2A 5KI6A 5KFXA 3K2PA 2HNZB 4R8UB 5J2QB 4NLQA 1BL3A 1VRUB 4WYWA 3CWJA 3AA4A 1VSKA 1JLAA 4MQ3A 3OJSA 3KNAA 1N5YB 5DLFA 2DY4A 1C1BB 3VQ5A 4ED0A 4ZP8A 2HAIA 4ECSA 4URGA 2JC1A 1T8EA 3EPIA 3PVXA 1X9SA 4M42A 4KO0A 4CGFA 2Y1JA 2ZE2A 3LAMA 4CIGA 1HARA 4PA1A 4ZVEA 3OS0A 4W5RA 4QCLA 5DLGA 3KK3A 4H4OA 4FJIA 3DLGB 4K8ZA 4IFYA 5DG7A 2IJFA 3V9ZA 4GVMA 5F8JA 1SUQA 5E41A 2V9WA 2OZSA 1T03B 4MK9A 1TL3A 3OYJA 2FVPA 3RMBA 3QGGA 5KFQA 1NKEA 4QAGA 4TY8A 4EBCA 3AO2A 3HHKA 4PWDA 4CJLA 3OYGA 4WE1B 4Y1CA 3TARA 3GILA 4U6PA 1WNSA 4HKQA 4IR9A 2P51A 1MU2A 3PHEA 4CGGA 4DTNA 1C6VA 2X74A 4TYAA 1RBVA 4IH6A 1SH0A 4H8KA 4M94A 2KQ2A 1UOCA 5L1JA 1J9AA 1NJWA 4KI4A 1WN7A 3UPFA 1BCOA 3L2WA 4KHMA 3MR6A 4KB1A 2OPQA 4YMEA 1A5XA 3CFRA 5KT2A 2XGPA 4L8RB 4J9SA 4RW6A 3SQ2A 3QESA 1N48A 2C2RA 4ED2A 4RG8A 2HB5A 3QIPA 3CO9A 4DF8A 2XI2A 4KB7A 5JS1A 4F4KA 3DLHA 3PJWA 2ASJA 2F8EX 1GX5A 4OPJA 1ZBLA 4RNMA 1RILA 2Z1HA 3KLVA 1S4FA 1X9WA 3KLHA 4CHPA 3KTQA 3HVTB 1UWBA 4CK3A 1XC9A 2R8IA 3O3GA 3QERA 3GIIA 1YVUA 1TP7A 3KMQA 4FK2A 4DS4A 1C0UB 4ED1A 4I2PA 5K14A 4O5BA 1DTTA 4J9MA 3ZSYA 2IS3A 4Y34A 4DTRA 4WFXA 1KHWA 3G6VA 4J9KA 4ID5B 4YR3A 3DM2A 1S1UB 2HNDB 4Y2AA 1CXQA 1TQLA 1S1XA 2UUWA 3HT3A 4CF8A 1RT4A 1K6YA 1HNIA 4FZXC 1RBSA 3PW5A 1ASUA 1LWCB 2IM0A 1GOCA 4WXWA 4GC6A 4EP4A 2R8GA 2RDIA 4ZVHA 3SV3A 1U4BA 1QTMA 4EZ9A 3V6KA 4B9MA 2BE2B 3FSIA 3BQ0A 2RPIA 3VQ9A 3MEGB 3ITHB 4KFBB 3KK1B 4CJ3A 4UQGA 3HVRA 3V6HA 2G8HA 3PW4A 4QOZB 1JXLA 1HNVA 3OYLA 1VSJA 5HRNA 3KK2A 2OPPB 4Z4IA 3T3FA 5F9NA 3S3MA 4OLAA 3NAIA 4FM0A 1TKTB 3OS2A 4QW9A 3AVFA 3DRPA 2FJXA 4CFDA 4FCYA 2KTQA 4LSLB 1RT3B 2F8SA 5KG3A 3V9UA 2KZZA 3M8SA 4E0DA 4RZRA 4M3YA 1EETB 5J2QA 1VRUA 2ZD1B 2EC0A 4JS5A 3LP1B 5HROB 3TAEA 2FVSA 4ECZA 4LH4A 5KT4A 4C8KA 1N5YA 4FZYA 4CEDA 4FJNA 3MR2A 2DFFA 1L3SA 1ASVA 3V6DB 1RA7A 5J2MA 3LANA 4J2EA 2VG5B 2IGIA 2O5DA 5KFNA 5FRNA 4WYLA 3GIMA 4MK7A 3BSNA 1BIUA 3SQ0A 4YR2A 1C2PA 1C1CB 1TK5A 4Y3CA 3G6YA 1NKBA 3S3NA 4B3OB 2DFEA 2I5JB 1BI4B 5CY4A 4TSXA 1JLEB 4ZP9A 4KREA 4WE1A 3U6FA 3DLKB 5SZTA 3AO5A 4KTZA 4MK8A 3ZSRA 3VN5A 4EEYA 3LWMA 1JLFB 4NLRA 1HYVA 3OYBA 2PZSA 1U45A 5KFHA 4N76A 4ZPDA 4F50A 4IH5A 1S9GB 1S1VA 1D9FA 1TK0A 1C0MA 2CKWA 2P5GA 3MF5A 1X9MA 1HPZB 4BWJA 5KFUA 2XWYA 2W42A 4ECWA 2JEFA 4XIUA 3MFHA 4URQU 3RRGA 3H59A 1FKOB 1IKXB 3SFGA 2D0AA 3LP0B 1HYSB
chains in the Genus database with same CATH superfamily
4BRCA 2P9NA 2AT1B 1KDNA 4Z37A 2WTUA 2G2ZA 3DRSB 1IR2A 4ZS6A 1NNDA 2A18A 4M1KA 3F2KA 1OQ3A 1RAGB 2CADA 2DISA 4LMZA 3VQPA 4WFBQ 4Y2CA 2GA7A 2NXCA 3OYNA 1JLQB 1RBLA 4DDFA 2ALYB 4URSA 3MCOA 1KSPA 2D7SA 3HHLD 1BOTO 2GV1A 3WNHA 3FE1A 1ZBFA 3MM6B 4C98A 3WXKA 4DR7J 3JTPA 2KJVA 1YRTA 3BM7A 4JV1A 3PW7A 1VQ9S 3TYTA 3TZYA 3EX7B 3BBCA 1SJ4P 2ZWOA 1FVSA 3I6PA 1N34K 2ZM6F 1RWWB 3MCMA 4JLHA 3OT9A 3JTOA 2R2RA 1S79A 3LOUA 1I1GA 2E44A 2J9EA 4LFBF 3QSYB 1VC0A 1MROA 2C2KB 3CJKA 1QQOA 2OMOA 3ZZPA 5KFZA 3ENQA 2OPPA 1EKEA 1Q5VA 5KG2A 2MHNA 5CYMB 2B51A 3ZTSA 1CBKA 4EU0A 3BZKA 3HRGA 1DLOB 1BC6A 4I67A 5H1SQ 1ZA1B 2WUSA 2RIJA 3MI7X 4OI0A 1N5SA 2QGFB 3Q8VA 2MKJA 4BE0A 4QWAA 2ZD1A 1WC3A 3Q8QB 2BQ3A 1Q7YT 3O4QA 1GEHA 4CJUA 2VFVA 2DGQA 3CJ7A 3PIPL 4YB6A 4B1ZA 2J8AA 1FDDA 4CCHA 4ZVSB 5CCLA 4H5TA 2YKOA 2V8DA 2W9BB 3P6YC 1B9DA 4CF0A 4BQZA 2XBPA 2E1RA 1CS4A 4IBNA 2QKKA 4JI2J 1C1CA 2MQMA 3U1MA 2XMVA 4U8VA 1RYRA 2NRVA 2RD5C 2GIRA 1VHFA 4CJSA 2WZ1A 3DYAA 3LALA 2R2SA 2I5JA 3HFZB 4H5VA 4YDUC 3OQ2A 1Y9OA 1YI2S 5E3PA 5THWA 1YGYA 2QFJA 4DV3J 1FHTA 3S41A 3NVMA 4NLPA 3GFZA 1WC6A 3CF5Q 4I9QA 3CDAA 2GX9A 2HQGA 1KD1T 2Q3PA 3FKBA 1Q8KA 2WBMA 4OPHA 4QWDA 3VAIA 2ZF5O 4MAKA 5AQIA 5EVZA 4K4YA 4E1NA 3AA8A 2UP1A 4BR2A 1XMQF 3EM1A 3DAWA 1UAWA 5A2QY 1SL2A 1HIYA 1CXUA 2D0BA 3OHRA 4XEIA 3G82A 2BM1A 2CDQA 1FRXA 3QJPA 3KD1E 3MEDA 3IDHA 1NXIA 4GVBB 2J6UA 1RU2A 1RKJA 4RUAA 3WXJA 4CIEA 2ILYA 2R7SA 3C65A 3JYTB 4B9QA 1GNKA 3AVLA 3T5JA 4WCEQ 4GKJK 4C11A 3RBDA 2LXFA 4WU2A 2ZBCA 2V67A 2EWSA 4NI2A 1YQHA 3LDLA 2DO0A 2R2UA 1I39A 2VZ9A 4WFNL 4CM2A 2B3TB 2CYYA 2PYJA 3NGDA 3MMBA 1WDTA 4FF4A 1HMVB 2A5XA 1SQFA 1RNHA 3ZLJA 4E89A 2R8KA 1V9OA 1JMTA 4OI2A 3FR0A 3ETMA 2OTJN 2BM0A 4H03B 5L38A 4LF6F 4HWIA 1HBNB 4DV7K 2DNGA 3MEEA 4DFPA 2C28A 4OZLA 3DMJB 1KN6A 1H2TZ 2FIUA 2QMXA 1S72N 2VODA 3CIPA 1JKHB 1Z6RA 1S0VA 2G0CA 4P72A 4ZIVA 4HI2A 3UQSA 2DR7A 1YJVA 1XNRF 4ES1A 1S6PB 4B1WB 5F0XA 3AAWB 5AQOA 2YQ3A 4JNEA 1U26A 3L7UA 2DNQA 2OH2A 3CETA 5JVHL 5A0YB 4YY3K 2MKIA 1KLNA 4X62F 2D3ZA 1OS5A 4YHHK 1ATNA 2O4GA 1TVRA 3C6HA 4E7HA 3N0VA 3AOAA 2H3GX 2VYPA 4F3MA 1TL1B 5CYJA 1O5JA 2NZCA 2OPRA 1CZBA 1U6BA 1ZETA 3U3YA 4NZ7A 5AQTA 3C6UA 2HLTA 1ITGA 3DLLQ 2JRSA 3QRPA 4IRDA 2COLA 4BRNA 2VC1A 1OH6A 1T9XA 1EQ0A 2CPZA 3L3UA 4ZHRA 3I96A 4ZCKA 3KNGA 3ZZYA 3QICA 3D2FA 3BR9A 1BCMA 4F8RA 4KKOB 2WC9A 1BIZA 5D0RA 2VPWB 2E5GA 4XDDA 1KBRA 4WFAQ 4PRFA 4IEEA 3UVJB 3VEWA 4WK1A 4X65K 5IWAJ 1H3DA 5JUMA 1FESA 2FLOA 2QM1A 4I7FA 3CJ8A 4FJKA 1RDRA 3W2VB 2GIQA 4DJBA 4AFFA 2W2QP 4A62A 4OO1J 4JV0A 1GH8A 4I69A 4QR2A 3HXMA 5GINA 3CC4N 4ES2A 4CF9A 4YR0A 2ADBA 3AVMA 2E9RX 4DV5K 3NOGA 2XY5A 3DI6A 2YJFA 3VEYA 4TY9A 1NGAA 3PY8A 1C0FA 1YUWA 3OL8A 4M7YA 4CTAA 4HACB 4OX6A 2ASDA 2J7UA 3CG7A 5HATA 2DNNA 2KYXA 4O8UA 2XSFA 3IWNC 2HHQA 2RU9A 4O44A 1GK8A 4ZVGA 3O1BA 2QT7A 3O9QA 4IUFA 3AVBA 4QWCA 2R9LA 2YKMA 1VBKA 2OPSB 3CD5A 5BPLA 4FJ8A 4R8UA 4WFBL 5GAHI 4AHSA 2FGOA 2DTUA 1DARA 3POTB 1LWFB 1K1SA 2D1KA 3R6LB 3CCSN 2ROGA 2Y8WA 4LQ3A 3HJVA 1VQKN 1TUGB 4O3SA 4FJ7A 2IVYA 2V8HA 3KLIA 3J80O 3FJ2A 5M2UA 4BLGA 3AGKA 4LF9J 3HBTA 1Q1KA 5FRMA 4PY5A 3QEVA 1MG7A 1Z4UA 3U27A 3AD7C 4CJQA 1DFDA 4NYZA 5M1KA 5KFFA 1XR7A 1T9UA 2IA6A 1YDLA 3H8YA 3ULEA 2WFBA 4OGEA 1DTQB 2RQKA 1TKXB 2HHHK 1WF1A 1IKYB 1KWMA 2NRTA 2ZJPL 2QA1A 4BACA 2DNOA 1VMBA 1Q9YA 1LK5A 1PG5B 4OJ1A 5KG1A 3TP2A 2DGWA 3JAMY 3ZT3A 3THXB 4LF7J 1NZ8A 2HVIA 4JKBA 3ID6A 1NGFA 3WNEA 1WEYA 2HHXA 3RYLA 1REVB 3D0PA 4DV2F 3CD6N 3D1HA 3US5A 3SCXA 4JI7K 3TZZA 1QE1B 4HHJA 2B9YA 2V5HG 3DC2A 1OVQA 1WOPA 4DR6J 2XLKA 2FHKA 1MDUB 3SUQA 1WOQA 3LGNA 2ATQA 2WAQD 3OTOF 2Q66A 3HVTA 3C6TA 5KOXA 1VQ7S 2XSJB 1K8KB 2Y0SD 2WK4A 2DHXA 4ILJA 4I2QB 3O3LA 2YWEA 2MSTA 4OJGA 2JVOA 1U8SA 2O8CB 1WELA 5ADXH 1XMOK 4NLCA 3FGVA 3H42A 3K57A 3D6MB 5DQIA 3BF4A 1S57A 1KQGB 4MKAA 4LRCA 4HTUA 1RT1B 1PBUA 1VHIA 3C95A 2W4DA 2XWXA 4X4UA 3H5XA 3KUEA 4OHZA 2QE5A 2MJUA 2ZNZA 3WQPA 3VQ7A 2XZDB 4J9LA 2EHGA 1Q18A 1WBDA 1PILA 1UKUA 1LWCA 3HPHA 4AHTA 1NUEA 5ADZA 2XNRA 3HPOA 5I3PA 1WHVA 4OX8A 3BGFA 2LQBA 5HO4A 4MH8A 1X5PA 3HK2A 3MEGA 2GMJA 3D67A 1BGXT 3DXKA 3CQXA 3VQSA 4IOBA 1H7WA 1IBLF 4Y0WA 2ZZNA 2BUNA 4FBUA 2Q36A 2HMIA 1GLCG 2OMLA 4F2SA 3FQKA 4IO9Q 2ILZA 2FSKA 3TAFA 4C0HA 4CD1A 1UVKA 5EY4A 3WUHA 4WCEL 2YNGB 3KDNA 4RU2A 4A8WA 4O55A 1WSJA 4OZNA 5T14A 4Y0FA 1CQMA 1N88A 3V6DA 2ADCA 2AZ1A 2G0IA 3OYAA 3KG4A 4KQZA 1IXKA 4ZVOB 2XHBA 5DMRA 5H9FK 4Z7CA 5C5JA 3UNYA 1XIQA 4ECRA 5KFYA 4PG8A 1U2VA 1BA0A 4AILC 3OL7A 3IKMA 3BSOA 2XMUA 2R7VA 1BQNB 3EXYA 1QHTA 2V4RA 4NXNK 1BI4A 3A5LC 1XK8A 5J2PA 2KI2A 4W5OA 1JLEA 4OX9J 2YPZA 4N47A 3SI6A 1O51A 4JRQA 1QVFM 1HR0J 4YUDA 1N34F 1XNQK 3EVOA 1Q8BA 4PZVA 3E01A 3THTA 4QQBA 1R59O 3D6HB 3CJ9A 2C2MB 3I56N 4F0HA 5CZVA 4FM2A 2DY9A 2AJ4A 4BS2A 4K2JA 3K9KA 4ZITA 3FZLA 4WKYA 1RTDA 2UU9K 1ZAXA 4B1VA 1T3VA 2E66A 1P9QC 2WOMB 1WEZA 4DSLA 2KG0A 2V4QA 1W25A 2OTLN 1QZ5A 1C4AA 4TLRA 3A0IX 1ZBIA 5AQUA 3DLEA 2CQIA 3TTFA 2VBWA 1R8PA 1GLBG 3QLHA 3J7ZT 4C3KA 4W5QA 4PYDA 3KG1A 5L1IA 3R8EA 3JSRA 3DLLL 3BP8A 4AT1B 3N6MA 1TYQA 2GUIA 1U2CA 3G8TA 1EKRA 1C0GA 2CPDA 3QQCD 3UIQA 3CB4A 3N4PA 1RTHA 1B70B 2M8HA 4OZ1A 5ETQA 3OUYA 4WFAL 1VSIA 1F9EB 2M7SA 4NX9A 1R0CB 4RW9A 1NOYA 4FYVB 1CJUA 3DN9A 3I5BA 2YKQA 3Q8YA 2E8AA 2C2ZB 4ED7A 3QWPA 3KIOA 1L3VA 4ZPVR 2MZRA 3AGRA 5ETMA 3TW0A 5A8WB 1Q82O 3OTEA 2B8PA 3CCWA 2FSNA 4DR1J 5KFJA 3NEKA 2F40A 3GR1A 4U7CA 1QY7A 3FK4A 2A1SA 4Z0UA 4PKGA 4FKXA 3GSDA 4AM6A 3S9HA 3T6JA 1U49A 2KRBA 1PKUA 3GR0A 2K7JA 3FZFA 1JQGA 4OLPA 3MR3A 3AA5X 5HMXA 4XAKA 2X6NA 3FBEA 3OHBA 3CJSA 1RBAA 2EFOA 4CHNA 4JI4J 4HTLA 3IFEA 5GAEI 4YQWA 3KOAA 3NVKA 4EBEA 2DCUB 4B3MJ 3IAM9 1NEEA 2IRUA 5AQRA 4IG3A 4DUZK 5F9LA 3GWCA 1RE1B 4N5SA 5TKYA 4CJKA 1HX1A 4ISEA 3J7YU 1S9FA 2ZVIA 3K9JA 1NDPA 1EKSA 2W01A 4GKJF 4X4PA 4UY8O 4JI8K 5HVGA 1NK6A 4IKFA 3Q7BA 2RVJA 4QS9A 2DVIA 3BO3A 1NJIT 3GP9A 3HZGA 4M3XA 5F0UA 3ET6A 3PX4A 3ZO7A 2E6LA 3OVNA 3ISZA 1D0EA 1H74A 5L46A 4DV7F 1UVJA 3P1GA 2OZMA 3V81A 2V2QA 1F5CA 1NSAA 4DU1A 2DJWA 1WHXA 2UUAF 1IM4A 3Q8PB 3HZ6A 4EAHD 1VIXA 1Z2ZA 3T5KA 3KHGA 3MPVA 4ID1A 3TAMB 5JXSA 2NRWA 3NS7B 2IYIA 1J5OB 1B99A 3UFCX 2KVQE 3AARA 4CZKA 4KGXB 1KLMB 2EVZA 3ZNJ1 4O0JA 4WIQA 2QV6A 1ZBHA 2HHSA 2I7NA 3PYEA 2K8GA 1S59A 4CJ4A 5ELZA 1DQAA 4AQYK 3HVAA 1PIEA 5CYQB 1NJXA 3FCHA 3THWB 5HLFB 4FJ5A 2W9CB 2F9DA 1N6QB 4GC7A 1X4AA 5LMUK 2NXNA 2E1PA 1RAIB 3ZSZA 1SIZA 1FNMA 4R5PB 2FC0A 3EL2A 4KHUA 5F1XA 4Z4EA 3OTBA 2QA4S 1NGEA 4M63A 1QVGR 3RB0A 4RWXA 2VBYA 4P71A 1RHRB 4JI0F 1HNZF 3LM2A 5T7BA 1R0AB 3MPDA 2R7RA 1VGYA 2O8EA 5IM0A 4DV4J 3FUYA 4X4QA 3BS9A 4LH5A 1QAYA 1XBWA 1A5WA 4YOVA 3DRRA 4AF1A 5LOQA 4A48A 1WACA 3KWGA 3ILJA 4O4GA 4MJKA 5HVHA 4WF9Q 3RBEA 2GCFA 4JI6F 3SZ2A 3O8MA 2BZ2A 1EIYB 1I94F 3IG1A 1UVIA 5AE1A 4M5HA 3H2LA 4IQXA 2PO4A 3DOLA 2RQCA 2WTFA 1KOOA 2VOPA 3UKRB 5KRTA 1CJKA 4F3TA 2CQGA 1WBBA 3RBZA 1S0MA 1FWKA 4J2BA 3QEPA 2O01C 3GYXB 2RT3A 3EEQA 4DPWA 3NNCA 1MN9A 1J6ZA 4IO9L 1TV6A 4LIRA 2CZVC 2K06A 4NLXA 3NE6A 4JS4A 1YK9A 3ZTQA 1FJCA 2BQUA 3W66A 3UCZP 1CLQA 4CNYA 1OY8A 2FBTA 2QMWA 3VQAA 2F8TA 1FRJA 2FJVA 2OJ3A 2QXFA 3BYRA 1KAYA 2ZBIA 1YJ7A 2H4YB 4PUOA 4B9NA 1EQMA 4BCAA 5DM6Q 3MM8B 3UD5A 4M5MA 2G9OA 2JWNA 2O67A 1QAXA 3D7SB 3MM9B 1XHXA 1JLAB 3J81U 3AO3A 3KHHA 1RDWX 3ZZ0A 3HD2A 3MM7B 2DPIA 1RWPB 3MPYA 5DGBA 1YVFA 3M6GA 2YHXA 3IUCA 3SAFA 4B9LA 4LF5F 3I0RA 1DZ5A 4ZTFA 1NWKA 3THVA 1NMDA 2HHHF 2BJ3A 4IFYB 3VR1A 5C2CA 1U1KA 1U0HB 3ILLA 1HQEA 1VSMA 2AV5A 1P6TA 1VRTA 4DSFA 5KT6A 2HQFA 2VKRA 1TZ0A 1VQ4N 3AD8C 2CJAA 1TKDA 4A8QA 3PV8A 3SCKE 4KBOA 4OV1A 2UV8A 2P1JA 4ILMA 5F8MA 2YKNB 3PO4A 1SIWB 4MYTA 1JXBA 2YNHA 3D45A 1DKGD 1RA6A 1O13A 3L7PA 2IOCA 1KVAA 4OHVA 2GJ2A 3K17A 3CCJN 3NH2A 2OPQB 2F9WA 2Q1LA 2KU7A 3LP2A 4OI1A 3VAKA 3L6QA 3HJFA 1D5AA 4B3SJ 4Z4CA 3M2VB 1C0TA 2KO1A 3JTNA 4DSIA 3HFVA 1LV5A 3NRBA 3EZUA 2EW9A 4DR4J 2CQ2A 2D4WA 2VASA 3C15B 2WVCA 4P9SA 3AA3A 2O66A 3F44A 1MMLA 2P9LA 3R1HA 1R3NA 1LNQA 1JLGA 4JI5K 4I2PB 5CAAA 4OZ2A 3FMWA 1DTTB 5AZIB 5BN9A 1I6JA 1VQMS 4MO4A 3DJCA 3L4IA 1H72C 1WSVA 4Y1DA 4FF2A 4TQRA 3G0ZA 3MDFA 1WSFA 5J1NA 1XTZA 2ATCB 4Y2KA 2GFFA 3WC0A 2Z2LA 2V52B 3W5YA 4GMJB 4KE5A 4DPUA 1ZH5A 4ZVFA 1RHMB 3C16A 1YITS 3VEXA 5J2NA 5FPMA 4E7IA 2D3OR 2W40A 4M3ZA 4A8YA 4DHYA 3CD0A 2W2MP 5KFMA 2FPHX 3W7BA 1GAOA 4FW1A 1HBMA 1KVBA 3AVGA 3HSJA 4J9NA 3GV8B 1WC0A 2E1AA 5ETKA 2H3EB 1C1AA 1U1QA 4CGDA 4A57A 1HNVB 3FC9A 1R8CA 3OW2R 4QPXA 1RAHB 3KK2B 1YTYA 2CH5A 2A6MA 5IT9O 2UVRA 5B0FA 4H0XB 2R7OA 3VV2B 3DXMB 2HKEA 3JXOA 2A0FB 5D15A 1CULB 1S97A 5C24A 2RSQA 1K8AO 5CD4A 4WYWA 2KYZA 2AJFE 3SSRA 4KIAA 1F9FA 2XMKA 4IYQA 1FE4A 3N01A 4PKDB 2HAIA 4I1TA 4URGA 2W4CA 1X9SA 1V4TA 3LAMA 2RH3A 3GIRA 1RCXB 4QCLA 1M0SA 5FLXY 2Z30B 4BRLA 1TTHB 2F1FA 2GVDB 4USMA 3MUVP 4FJIA 1HHSA 1S77D 1SUQA 4RR5A 1T03B 4IXCA 4I68A 2EBEA 4MK9A 1TL3A 1IBMK 1XNQF 4I6AA 2GHVC 3A3PB 4EBCA 5HMZA 4PWDA 3AY9A 2O1PA 5M2RA 2QN6B 2KLAA 1ROFA 3GILA 1WNSA 1FRKA 3NOCA 2UU9F 1C6VA 3LUYA 3MCAB 1SH0A 1UOCA 1J2VA 3A5MC 1BCOA 4KHMA 4X65J 4KRWA 4KB1A 1A5XA 3CFRA 4L8RB 2Y3YA 4CLSA 4CLPA 2CQBA 2D74B 4L76A 4IO8A 5JS1A 2YWHA 2P9NB 5B8HA 3PJWA 2ASJA 2Z1HA 4LBPA 3OR2A 3KLHA 2KM8B 4U7BA 3I33A 4X4SA 3V2UC 4RJVA 2FZCB 3UN3A 4KGVB 4O8KA 4C0OC 1RWOB 4UF4A 4A8MP 2DXDA 3LF0A 5K14A 4O5BA 1QJHA 3PG9A 4J9MA 1K73O 2IS3A 1H6KX 4B1XB 4TNOA 4Y34A 1GFWB 2GAGC 1SC4B 3G6VA 1OKJA 1X0PA 4YR3A 1T6CA 1OY6A 4WF9L 1TQLA 1S1XA 1KP6A 1WC1A 4ZVUB 3JSYA 3P8BB 2NRRA 2PBDA 3FBBA 1SJQA 1K6YA 4C2MA 1PO6A 1Q4RA 1RBSA 1ASUA 1G7CB 4JKGA 1VQNN 2PFDA 3VF4A 4B9MA 3BQ0A 2QWOA 2RPIA 2WSCC 3L7OA 3ITHB 4KFBB 3SMZA 1ZZFA 1YX2A 1BG3A 1MROB 1VQ8S 3HM8A 3CJKB 3K7RA 3M6WA 4C23A 2DR8A 3OYLA 2MMYA 2OPPB 4DUZF 4FM0A 4WYBA 2I38A 2HMPA 4QW9A 3DRPA 2FJXA 5IOLA 4IO1A 4IOCQ 3CCVN 4CFDA 4CO3A 3OVSA 4YOTA 1RT3B 3NWGA 5SUHA 5DM6L 3M8SA 3R5BA 4ZIWA 4RZRA 1NHKL 2J9DE 1F5AA 2ZD1B 3LP1B 1DAXA 4JI8F 2QL5B 5BN8A 3TAEA 2DEJA 4L72B 4PYAA 4ECZA 4C8KA 5KT4A 4JI7J 3B8AX 4CEDA 3T1YK 1TL7B 3UB5A 2DFFA 4IZ9A 1ASVA 2M52A 3U02A 2AYMA 2CVIA 4WQ4C 3SAHA 5CH7B 3GIMA 4NLBA 1VDHA 2YY3A 2LDYA 3W9IA 4OI4A 1CS4B 4YR2A 1C2PA 1C1CB 4OLOA 1PYTA 3I9ZA 4A4JA 3C7NA 2I5JB 2B9EA 3WBZA 1JJ2R 4OYOA 1XMOJ 1HBUA 2VBXA 1N32K 2VKZG 4K2XA 2AYBA 5E0OA 3A8EA 4ZN3A 2Q1NA 3AOBA 4N76A 1DY3A 3N4WA 4ZLNA 2JWKA 4ZPDA 1D9FA 4BC7A 3ZX2A 3AJ2A 3EGWB 3SAGA 2MDAA 1P1TA 3N28A 1X9MA 4AQYF 2DNZA 4P2XA 4ILHA 1LKZA 5LSOA 1HL6A 1NDKA 3ENWA 1SS6A 4BY9C 3N6NA 4O4RA 1JL1A 4I56A 4UUWA 4WKRA 3MEDB 3QFWA 3L3CA 3H5YA 3VGKA 3E9OA 2E6MA 3OYKA 2UUCK 5DG8A 4DU4A 2BH1A 3M2RA 4F4YA 4C11B 3VCDA 3OSNA 4DUYK 1NSQA 4LF1A 2NRHA 4BRPA 4H0VB 1KCFA 1KAZA 4NI2B 4CHZA 4ED8A 4F4XA 1OH5A 1KR4A 1X31C 3MMBB 2AJ1A 4DUTA 4DU7A 4ZA1A 1HW9A 5G0RA 3UN5A 5C2FA 3GG0A 3VAFA 1SI9A 4ID5A 1KAXA 4FXWA 1W26A 1D3WA 2HNDA 3C2PA 3R5GA 1IG8A 4OQJA 2HWHA 3MOJB 3QO9B 3L2UA 1RTJA 1J5EJ 5F3ZA 2GZOA 4AXIA 3CTRA 2C3OA 2RILA 3UI3A 1FJGF 2BJ9A 1HBOA 1WI8A 1X4EA 4JYAF 3EGVA 3E51A 3RWUA 1EAYC 4YOEA 1AROP 1VK8A 2KXNB 2NUBA 4DTUA 2WHOA 4A8SA 3U7JA 2BE2A 4C1NI 2N4CA 2W9AA 3PX0A 3HL8A 4GV6A 3RB4A 4HTIA 3AHPA 2AQ4A 3P83D 4G9ZA 3PYGA 1KFSA 1SV5A 3RTVA 4NXNJ 2B4JA 3T9NA 5KQDA 2NCKL 4KPCA 2YWWA 4USJC 3SFUA 2CPIA 2J5AA 3EKUA 3PR5B 3L2QA 4JKEA 2ZOFA 3MFIA 1TKTA 4E1JA 3QEIA 3CFPA 4NLUA 3CPEA 2IM1A 3RR8A 3VQBA 2HS0A 3FMBA 1TVRB 2WSFC 3IXQA 2B4PA 3GLJA 4FVMA 2FZKB 3QIDA 2OPRB 1EO1A 1P8GA 1S3XA 3CXCM 1XHZA 1LK7A 5A76A 3DRYA 2ZGZA 4BC4A 3QEXA 5EXWA 1E6YA 3HP6A 3HVWA 4EYIB 1HLUA 2P9UA 2CDRB 4ZHRB 1WDDA 2UXCF 2KXFA 2R8HA 1NK5A 5GAGI 3I5CA 4E7LA 4Q8EA 3TZXA 1R8AA 4FLUA 4C9DA 1T02A 4ZPAA 3QDKA 4RX6A 2R8JA 3CULA 2DB1A 4FF3A 3CCTA 2HFVA 1Q7YO 4H5WA 4NL5A 3CM5A 4CP5A 2V4JB 2O3DA 2VG6B 2KH9A 5KOWA 4PCQA 3ZSWA 4EHUA 2PA8D 4I7FB 1PAEX 3PYFA 4YDXA 3SSQA 1N33J 1HWUA 3OYHA 3QMLA 3CPWM 3SUPA 3QZ7A 2H51B 1K0TA 2GAHC 5DDPC 4M3UA 2EG2A 3RAQA 4O3QA 3DOMB 3AY0A 3GPAA 3DI6B 3MCNA 3D4JA 5IC6B 1QAJA 3FEYB 4FWNA 1PJ6A 1F2GA 4M41A 1F0XA 3CJ2A 1XJWB 4QS7A 2V34A 4FZVA 4B3RJ 3CCEN 4HT5A 2OTJS 1WI6A 3EXCX 3SCJE 4O44B 4H4KA 3VQTA 1UETA 1G2EA 4BRAA 2YKMB 3Q0AA 1KD1O 1ICEB 2BOAA 2UVVA 3JXUA 1WAJA 5DGAA 1SL0A 1T0TV 1S72S 2JH3A 4M45A 4CEFA 3QNWB 5AQWA 1HQ2A 2GS8A 4G65A 4B17A 2PA3A 2GVZB 2B5JA 2VV5A 3R3LA 5AQQA 1S1TA 2MTLA 3C14A 2D0OA 2BOPA 3E9PA 2G2OA 3MK6A 5KFWA 4ZPCA 2QTWA 3KLIB 3BSCA 1NGCA 2DHSA 5LJ3Y 1B64A 3FZMA 3GV5B 1T44A 3D6FB 4DTJA 3I8BA 5I3UA 2JL9A 4K5SA 2YWFA 3ULEB 1UA1A 1NB7A 2IHR1 3C8YA 2D5RA 2G8FA 1UJ4A 1OPIA 1G4CA 5D3GA 2QWLA 3W1YC 2C3MA 2E1MC 4C3LA 5FPDA 4HYKA 1V4SA 4RWTA 5KFLA 1RGIA 1XR5A 3PYDA 3J8AA 2JLFA 2HBZB 4QIEA 2AP6A 4CFBA 4IOCL 1M5KC 1JLBA 3R1XA 1X5OA 2DH9A 4PG5A 3M8PA 2KFYA 4FJJA 4NCAA 4IDKA 4OYPA 4FBTA 3P45B 2DIUA 2CJKA 1SBRA 3C6TB 3CJ3A 3J7YI 1OIAA 2ZH7A 1HI0P 3CC4S 4CJ5A 4AHRA 2V7YA 2P9EA 2BANA 3AXKA 1VSLA 2B7CB 2YX4A 2P9SA 4DSKA 2W8LA 4DTSA 1T05A 2ETJA 2X7IA 2YV0X 4LIWA 1Q16B 3A5NC 2DNLA 2CPHA 3H20A 4KGMA 3BJYA 3DLRA 5C25A 4M5IA 4UZCA 2MGZA 3NKYA 2G2YA 3T1AA 5LMUJ 1R31A 3MPUB 1ATRA 4CFAA 2HHVA 3O4WA 3SNNA 1YG0A 5CXTA 4DL7A 2AYEA 3H0PA 2V9KA 3FSXA 3OYCA 2ASMA 3Q83A 4UW2A 3CCSS 5GIPA 2Y1RI 4J9UE 2EKNA 3KLGB 1VQKS 2NYIA 3UD3P 1UFLA 2ZEJA 2LECA 2H65B 5ETLA 4MIBA 2NXEA 3OYIA 4LF8F 1EQYA 1PJ7A 5K8OA 4DSEA 3D2EA 2OD6A 4DR5F 1CZ9A 3MXJA 4CEAA 1X3NA 3PW2A 1BDGA 3GMGA 3X1LB 4CK1A 2HMIB 3MAAA 2M70A 2E7XA 4FYDA 2OHDA 3QBWA 2E5JA 4Q8FA 3D28A 3IRXA 2HNZA 9RUBA 4H5NA 1B0VA 1Q86T 3PIOQ 4IOXA 5A2QO 4X4OA 4OKKA 3TA2A 5IWAK 3DCAA 1WWHA 2ZH1A 4FK0A 1ULRA 4IRKA 4RLEA 3D2WA 3PKYA 3H5UA 3CD6S 1V5IB 3SJHA 5KFRA 2A3JA 5HOOA 4Z7YA 1KQFB 1JL2A 2CQHA 3K2YA 2HVZA 1IKWA 2BW7A 5CE3A 2CNKB 3TR5A 1MLAA 3D5MA 2YQ0A 4DV6K 2UVWA 3WEEA 1YF5L 1QD1A 1WEXA 4CLUA 3NNAA 5M1FA 5J2PB 1LXNA 4L3KA 3UR3C 4CI0B 1N8RT 2BXJA 4CJPA 2M9KA 3KLEA 3RR7A 4EBDA 5DZ7A 4K41A 1ACMB 3VEOA 1VOMA 3B4MA 4O3NA 1OPZA 1SJ1A 3KZBA 1QVGM 3E01B 3EYZA 4LFCF 3ZC4A 1RBTA 4KHSA 2KVIA 3M32A 2NLXA 3V4IA 1BQMB 3W8GA 4CT8A 3ZT2A 1RTDB 1T6DA 4ANCA 3O9TA 4CLWA 4RNHA 1BU6O 4LD0A 2KXHA 3QSIA 1H7XA 4DQIA 4HI1A 2X51A 3NGYA 2JFKA 4BR9A 3W3DA 3HLUA 5L1LA 4QS8A 4QR1A 3DLEB 2MPUA 2FLNA 5F41A 4CGIA 4DSJA 1WLJA 4PL7A 3QLHB 4CO5A 4LF9K 3NGKA 5EU7A 1N56A 2BMBA 2V6AA 3ENOA 1JXVA 1R6VA 5KAKA 2ASOA 3BY5A 1GXUA 3NL0A 2DGXA 2OEKA 4FP9A 1LW2B 1FT8A 4BR5A 3T1YF 2X3DA 2YNIA 1H2VZ 2RUSA 3PDNA 4RW4A 3U9ZA 2HSEB 2KHCA 1O6XA 4PQUA 3O5BA 4RWWA 3KUGA 4W90B 1V3RA 3OUYB 3T1HF 3NMAA 1S1UA 3AJ1A 2PAVA 4NB4A 3T5LA 2OP5A 1BWVA 3OTCA 1T95A 4JI1J 1UZHA 1MWYA 4LF7K 1LAVA 2OKQA 1SKSA 4NZ0A 2XRIA 1Q8IA 2XYPB 4B02A 4ZDNA 2DRAA 2HNYA 8ATCB 3HP9A 2O8DA 1N36F 2JEJA 4ZTJA 1L3UA 3G96A 2OELA 1Y64A 3SJJA 3R2CJ 1WOSA 5JS2A 3BGOP 4JI5J 2VQEF 4DR6K 1KQSR 3TQ1A 1Y5LB 2NXJA 3MGJA 4V1Ak 1YTUA 1VSEA 1HNWK 1JK9B 1WKJA 3M8YA 4DV1J 3MUTP 2XB2D 1S1WA 4DEZA 7FDRA 2Q97A 4AHCA 3EZOA 3TJ8A 1Z2LA 3KHYA 2AP1A 4BVOA 2G8UA 1DQ9A 4L75A 2QW9A 4QYZK 1RISA 4X4TA 3NH1A 3M30A 4P7TA 3I31A 2P9PA 4CM0A 4KHPK 5HROA 3D1OA 3QIPB 2W7OA 3I56S 4DUYF 1Y5IB 2V0NA 2Z58B 2VG5A 5CZ2A 1TMJA 2YI1A 1NZAA 2IC3A 2ZJRL 4LVOP 1UWBB 3LWLA 1M1GA 4NEZA 2QTDA 2W2OP 3MR7A 1IQZA 2OTLS 2B8QA 3GYGA 3HHLA 2G8WA 1FDBA 1QHAA 5BJRA 2JEGA 2XLJA 2HZVA 5GADU 4QWBA 5CQGA 2P2CB 1B7FA 4QW8A 1RDAA 1TR0A 1M5OC 1Y00A 2ZH8A 1OQ6A 1WSEA 2HBJA 1RAAB 2HEKA 5FROA 2B56A 3KKRA 2BBEA 5AQHA 1ZBSA 1ELOA 1RAEB 2ALZA 5DDQC 2UUAJ 2OAUA 3ZZOA 3NCRA 5MAOA 3FRZA 3PCOB 3C0BA 5MLCQ 3O44A 4CO4A 4O3RA 2XCAA 4OL8A 1VQYA 3LDSA 1N5VA 2L3MA 4CW7B 3IWXA 5AR0A 3CQYA 3V9XA 1IBMJ 1ZM9A 1QSSA 3KJVA 2FHMA 4NLTA 3R8YA 1S76D 2MKSA 3JAMO 5D0EA 3FZBA 4FW2A 1UCNA 3PO5A 4FLWA 4CHQA 3QYYA 2RDDA 2ZJQL 3T7ZA 3VPZA 4MLEA 2P9GA 4Y00A 4DR7F 3ELHA 3QNNA 1MWKA 1JLQA 3RBXA 2BTFA 2CNLB 5KFTA 3ZZTA 3CCMN 2OIHA 4OX9K 2A10A 3GG1A 3NAHA 3CJ5A 1F1BB 1HR0K 2MY8A 3J7ZO 3IS9A 1X4GA 4MO5A 4RBUA 1SJFA 5HQ8A 2D1CA 5J2MB 3GCWP 1ZXOA 4Q2LA 1VK0A 5A6PA 4OZJA 3PIPQ 3BQ2A 2E2OA 1YT3A 4IR1A 1NU4A 3UWTA 1RU1A 1RDDA 2O8EB 3K5OA 3G6XA 2OFGX 5IM0B 1OYDA 4USIA 1S0OA 4DCPB 4WWSA 2POKA 4CE9A 2CQCA 4P10A 4A8OA 3H4BA 2LU2A 4O4GB 2VWJA 4L3NA 1RTZA 3PSIA 3D0HE 3IG1B 2N4DA 1R43A 4X66J 4KI6A 1UEVA 5LL6Z 2WVDA 3DOLB 1U2RA 2HF4A 4KAIA 1A5VA 3AVNA 4JKCA 1CJKB 3K5LA 3TA0A 1HFEL 1S10A 4MT1A 4HEA9 5AQFA 1SKRA 2AU0A 2R42A 4K5RA 5CYMA 1TK8A 3KK7A 4RUCA 4JI6J 1S1VB 1DLOA 1TV6B 3TPQA 1I94J 2YWGA 2BRLA 3F9MA 3AB4B 1T3OA 4KY3A 3PIOL 3CMEN 1SL1A 1KXPA 1NGDA 3HZEA 4JI2F 5GADP 3VGUA 2HIQA 1K73T 3HCXA 3BO2A 1RT6A 2XMWA 3Q7CA 5AZJA 4Q7AA 2P6SA 5KFBA 2XY6A 1U1RA 4EP5A 4PUOB 5D78A 4BE2A 2MQQA 5ADXA 4M5DA 1RWMB 5B0DA 4KV8A 4DV3F 4B9VA 1FRLA 1QUPA 4RU9A 2XS2A 1DEJA 1NLKL 3CM6A 4GRSA 4W4MA 3ZTPA 2XGQA 3LPYA 4MDAA 4O0IA 1AYEA 2R2TA 2X1GA 2YXLA 2RRAA 3RMAA 3I0RB 2WRMA 1MN7A 3QMQA 2K2PA 2GJIA 2JDJA 3CW2C 3PEHA 3I0SA 4JI4K 2X3GA 5DZ6A 3S7RA 1E4GT 2PFFB 5KT3A 5EUHA 4MKBA 3FFIA 1OO0B 1HQEB 4B3MK 4A8KA 1VRTB 4WFYA 2AX1A 2FF3B 3BF1A 5CA5A 2ZOMA 1A6LA 1IH7A 4ZP7A 3F9KA 2DCLA 1IR0A 2F4FA 5KPTA 3P38A 1ZA2B 1ZPVA 3MZIA 2WONA 4DMZA 2YNHB 4JKAA 3E9LA 2DGVA 3TUPA 4CVNE 2G13A 1XI1A 2HGMA 4F4AA 2ABYA 3VAHA 3QRRA 3R9LA 2LSNA 2B4VA 3QT5A 2DNHA 3F73A 2G1DA 1AFJA 2XLIA 4GVEA 2E7VA 1N32J 1YZ7A 1Q8LA 3QAUA 3ZSVA 3WIVA 5DJBA 4NPOA 1K1QA 4J90A 4H5RA 1C0TB 2VUGA 4Q2MA 3KKSA 4WQ5A 4E7KA 2D3UA 4RBTA 2A41A 3EUNA 1JLGB 5I42A 3EN9A 5F8GA 1BISA 3MECB 3ENBA 3SUOA 2CQPA 4H0OA 4QIFA 3AD9C 2AKWB 1HBNA 1Y10A 4Q0BA 4BREA 3M4XA 1H1VA 2UUCJ 3CC7N 5BXIA 3NCQA 4QBUA 4DR3K 4JD2A 1JKHA 4HHTA 2I7PA 1IQTA 3C16B 1CC8A 1S6PA 4O5FA 4KTWA 4PXEA 3BV8A 1ZBTA 4ED3A 3QT8A 3GDQA 1PYSB 2UXDK 1YKWA 2BW2A 3BDEA 5A0YA 4NRUA 2WVFA 2PMHA 2ACMA 3CIMA 1EWRA 4ZJLA 4QU7A 5HBMB 3IAS9 4AL5A 4KH1B 4CJRA 1QUVA 1JNRB 1TL1A 1SVDA 2CPXA 2GV9A 3QEWA 5AQLA 3CIZA 4AL7A 4ISFA 3ZCMA 3P96A 2C3YA 2OFHX 1RDCA 1VQ4S 1MWQA 4FJLA 4CESA 2F4VK 4DV4K 5IWAF 3JQKA 1JCFA 1U02A 5L1KA 3J7AP 2FJEB 3V1QA 4BHQA 5E33A 3ILIA 1UW4A 1AT1B 1CJTA 3DLJA 2BYCA 2AX0A 3HI9A 1D8YA 4G1QA 2DIVA 3RSEA 3TUIC 4CLTA 3CCJS 2CGLA 4HVJA 3L8BA 4EK2A 4HR2A 2QLBB 2EBGA 4JP8A 4XPEA 4PG4A 2GEMA 4FVCA 3WZ0A 4ZPWR 4Z4FA 2RE1A 1SUQB 2ZUAA 1TL3B 3SMPA 4FS1A 2BKPA 4F04B 2X1AA 4M95A 3PW0A 1U1OA 1H73A 4PWDB 3M9OB 1URNA 2VF3A 2CNOB 5F2RA 5FPEA 2CG4A 1VBYA 2ZJPQ 3VENA 1HQUA 1E6VB 6AT1B 4RW7A 5KFDA 2ZH9A 3MDQA 1GLJO 1I3OB 3LP3A 5HRSA 4OPAA 2OUGA 2GWJA 3NGUA 4QR0A 4OLBA 1S12A 4EYHB 3EMTA 2BJ7A 3MCPA 5J1EB 3EY1A 4ENOA 4FO0A 4H4MA 1IWGA 1RKIA 4CZJA 1BUXA 5SWMA 1RT2A 2YPYA 3H7HB 2NZ4A 3OLAA 3HHDA 4LF9F 3CEDA 5DK5A 4E3SA 2R7YA 3OY9A 4P74A 4LUBA 4GO5X 3POTA 4ECVA 2FVQA 4IEIA 4NMLA 1UPPA 5FDLA 3OR2B 5C42A 3KLHB 2GTDA 1YLXA 5AJ3K 2DH8A 4DU3A 1DRZA 4V19S 2UZAA 4NLSA 4CF2A 3I32A 3QPIA 2LCWA 2IAJB 4N56A 4J8FA 5K14B 4P2MA 1EP4B 4LF7F 1HWJA 4AL6A 3MMCB 2FBYA 1X0FA 2ZH3A 4R0JA 3J81Y 1BHLA 1SQGA 3QGPA 3L2RA 4RW8A 4PL8A 1B0TA 3SPZA 3MM5B 1S1XB 1HNXK 4EMDA 2R7QA 4LF4K 3BEXA 3CCLN 3OS1A 1WC4A 3RMCA 1D9DA 4DR6F 3ZSXA 1RCOB 2BRKA 2K3IA 2Z56B 5LMNK 3VQQA 3DGPB 4ECXA 2DR5A 3GU0A 1RHQB 3TAQA 4LFAJ 3AVHA 5E3RA 3V4MA 1ZTWA 2VJVA 4OKJA 2J4RA 4B3SK 1VQ5N 1KVJA 3ASMA 2HVDA 3SUNA 2YTCA 3MD1A 4DR4K 1V6HA 4LJMA 2HHUA 2PN6A 3BPDA 2N3OA 1SQKA 2U1AA 4C8MA 2C2DA 4PKHA 4HHUA 3SI8A 1K8KA 4CO1A 2IRYA 1IKVA 1U1NA 3P5JA 5EWGA 3DRPB 4L3QA 5B7WA 2OYQA 2FXUA 4EWTA 4DQRA 4E19A 3ZETA 1KTVA 2F9JA 4UOFA 2QLXA 2QK9A 2FC8A 2HRTA 3O4NA 2RN2A 5KI6A 5KFXA 3K2PA 4BVPA 2PGCA 2L9WA 3DWLA 2EKYA 1VSKA 3CSKA 4MQ3A 2CH6A 4CJ7A 1FX4A 5JICA 5ETSA 1QLNA 3MD3A 4LRAA 2DY4A 1C1BB 3SCIE 3G2XA 2C42A 3BUZB 4ZP8A 1T8EA 1HKAA 3F0NA 4V19X 3P4IA 1GMUA 4KO0A 4CGFA 2Y1JA 1MWZA 4PA1A 1NAQA 3OS0A 4KGZB 2HGLA 4BC5A 3DLGB 4WPAA 4K8ZA 2IJFA 4KH0B 5F8JA 5E41A 4USUA 2CUYA 3BH6B 1EWQA 1RBOB 2YX7A 2FVPA 4J5OA 3QGGA 3H45C 4AUKA 3SCLE 1TELA 4QAGA 2VFSA 3BKFA 3H25A 4OMFG 1HBUB 2HS4A 2AA4A 2GW8A 3TARA 4Y1CA 1UWAA 2QWNA 4U6PA 1URRA 2XO6A 2X1FA 2P51A 2F65A 2PIIA 1MU2A 2KT3A 2VBZA 3PHEA 1VFJA 4CGGA 4DTNA 1X7VA 2CFXA 1EB0A 2X74A 4TYAA 4JI3K 4H8KA 3MAHA 5GVQA 2E2PA 5L1JA 3UPFA 3SSSA 2QI2A 2ZWHA 2E5LK 2HAFA 2NPFA 2MYFA 3OFEA 2Q2RA 3HOSA 3D7EO 3MCSA 2VFRA 4ED2A 4RG8A 3PRBA 4KB7A 3CJAA 1IUJA 2VONA 4YN3B 3EE8A 3FNNA 2F8EX 2VH7A 1S4FA 1NSPA 1V5VA 3WIUA 1VQNS 3KTQA 2HQIA 4IOAL 4OX9F 1MW7A 2UYTA 3GIIA 3M2RB 3BZCA 4UT4A 2J7KA 1TP7A 4ISGA 2CQ4A 4NOHA 1IJJA 1BHNA 4WFXA 5G0RB 2W2PP 2LEPA 3DXBA 4C48A 4J9KA 4ID5B 4IFEA 3DM2A 2HNDB 4Y2AA 3MMVA 1CXQA 3CCVS 1P27B 2GQQA 1W97L 3RU0A 1WTBA 1PCAA 1BWFO 3CI5A 3AQPA 4IQMA 1IBCB 2E29A 2ROPA 2VPXB 1GOCA 4H0TB 4EP4A 2F63A 2ZH6A 2QWMA 3EWGA 3IP0A 2AHOB 1U6FA 2BE2B 3FSIA 4IJAA 4OJHA 1U1MA 4B3TJ 2VD3A 4AXJA 5FJ4A 2CQ0A 3V6HA 1Y4ZB 4M63C 2R7XA 1SCJB 1JXLA 4DV6J 4OX7A 3Q8UA 5LY3A 1VSJA 5HRNA 1K9MT 2RNEA 1OMSA 3T3FA 1GXTA 3VVUA 1FD8A 5BR8F 1TKTB 3KKFA 3N9UC 2EFQA 1LQ9A 5GAHU 2EFPA 2NR0A 5B0BA 2KTQA 2ZC3A 4DB3A 1FRHA 2KZZA 1SPBP 1EETB 1WKLA 4JS5A 1YXQA 5HJXA 4DR1F 1HI8A 2FVSA 1RAFB 5IV3A 2MEWA 2H48B 1QDUB 4FZYA 1FKAF 2XMTA 4FJNA 1L3SA 1E6YB 4J2EA 2IGIA 4MKYA 3VTHA 4F02A 5FRNA 4WYLA 3LDOA 3X3UA 1GTEA 1RWNB 3BSNA 3SQ0A 5CR4A 3MHYA 4JI4F 2DGUA 2CZ4A 2LDIA 4Y3CA 3R7NB 5CCMA 1EJ7L 1NKBA 5AQKA 3VOVA 5BYRA 4B3MF 5D8HB 4FWPA 5CY4A 2HF3A 4TSXA 2UXCJ 2MLXA 4ZP9A 4WE1A 3U6FA 3AT1B 2BJ8A 4FYWB 4YOYA 4KTZA 1AZSA 4F3QA 2PEBA 2JVRA 2RHSB 4ZN1A 4CBUA 3OYBA 5FLXO 1U45A 2LU1A 1TK0A 2P9IA 1RHJB 2LYVA 4LR7A 4BWJA 3ZZUA 2XWYA 3DNCA 4ER8A 1SAZA 1P8ZA 3R97A 3U1LA 2D0AA 4NA3A 3PJ9A 2VQFJ 3J7A1 2DHAA 1HNWJ 5F8LA 2DKOB 2CJXB 2H4WB 3ZSOA 3TJAA 2UUBF 3VQDA 2EC2A 5BPNA 4I6MB 4BRKA 1X5TA 2CQ3A 3DDNA 2B5JB 2MLZA 2PD1A 4CLKA 4N41A 1VHXA 1W7AA 1FVQA 4CH7A 4B9TA 3MUMP 1MNEA 4J9QA 3GE9A 2CNNB 1WG1A 3CDUA 5LXYA 4QYZJ 3IM9A 1ZOTA 3K5PA 4DXLA 1VRQC 2H9ZA 2GUPA 4FWRA 2HGNA 1A7GE 2YCHA 4KHPJ 3MR5A 1Z25A 1R7IA 4P2SA 3V9WA 4PEOA 3VTIA 3RMDA 4RNNA 2O8BB 3PUFA 1RQ0A 4FYXB 1RWUA 2BE7D 1J5OA 4DPXA 5AFUH 3CYMA 1WUAA 3C66A 5GAHP 2KN4A 2E1YA 5DS7A 3CMQA 4DFJA 2A6OA 1Q81T 2QLFB 3LW5C 3T6BA 2A42A 3OR1A 3V1OA 1S5ZA 1PSDA 1PGZA 5LXRA 4J37A 4W92B 3O1LA 2A3ZA 1O8BA 2BKNA 3QGHA 3J80U 1WOOA 3O2IA 2IVOA 2MB0B 3ZX0A 3AV9A 4DPOA 2QX0A 1QQNA 2X6SA 3PSFA 5CYQA 3EDRB 1JLBB 5HLFA 1M1HA 3M1FA 2Y0BB 3OD2A 4BR0A 4KJIA 3M8PB 1G3OA 4JBCA 3LPTA 5F8IA 5HQMA 4IDKB 2C1EB 4BR4A 2AF6A 2YQ1A 1NM1A 1Q95G 2FLLA 4FWOA 3NGSA 4CYUB 3KMSA 4R5PA 2D9PA 2HRUA 3M6XA 4RCHA 4QWEA 3QINA 2KT5A 1O1WA 2HW3A 1J5EK 2YX1A 3A12A 2P9SB 2XHCA 1S6UA 1XN9A 3UCGA 2CWKA 1T05B 3B78A 1VBZA 2QYGA 3EE9A 3CCES 2RDJA 2B0GA 3ILOA 3CJRA 4YP3A 1U0SA 1YAGA 1NPRA 4XO0A 4K7QA 3WNGA 2ZNYA 2MGZB 1KC8T 4FLVA 3PRVA 2VCPA 4LF6K 1X9JA 4JHDA 2WCXA 1B4SA 3DHXA 5EWEA 2UXBJ 4WXOA 3I8DA 4DPTA 3VQ8A 4YDDB 3H2VE 5C2GA 3WHIA 2BUPA 3LDQA 2XI3A 3DLKA 1T9TA 3H98A 2HRYA 1ZZNA 2LMIA 2E4LA 2FHOB 1H38A 2HHWA 1XNRK 4J2DA 3TTDA 2MQLA 3AVKA 2LEBA 2J7WA 1OVYA 1SKUB 2KFZA 4JK8A 4ZVPB 4TXSA 1RP5A 5D4OA 1P1LA 3HO1A 1FKOA 1IKXA 1AXQA 4X62K 3LP0A 3MAAB 1Z05A 1NK7A 2I0XA 2C2EA 2QWPA 4YB5A 1JCEA 3GSIA 1HHQA 3IRXB 4LF8J 3MM8A 1RTIA 3G4SN 2M4MA 2ZFHA 3FSYA 1CZAN 4Q5VA 3LL3A 2OANA 1ZYQA 4DR5J 4FLZA 4M5JA 3QFUA 3MM7A 3FEXB 1HLWA 4LBIA 3EO3A 4M3RA 4LRDA 4NEYA 1N33K 1UAXA 1I3AA 2B6AB 4ELUA 2P5VA 1KFDA 3OYEA 4F67A 1RT5A 2GWKA 3HSCA 2J9DA 5KT5A 1IKWB 2NZTA 4F9OA 1D9AA 2H5EA 2LEAA 3WEEB 4FLYA 1VQLN 1S6QA 2L9NA 4JAXA 3M6VA 5A8RA 4EO8A 3M1VA 2GX8A 2JHEA 2J0QD 4U95A 3KLEB 3OV7A 2XY8A 4B3RK 1LWEB 1L5UA 1GX6A 3PJXA 5EGYA 2JJ4D 5F3TA 1Q78A 2YKNA 4QJVA 4YOUA 1TKZA 2KG1A 4B3SF 2D3O1 2RE2A 4Z4HA 1E3MA 3QJJA 5GAEU 2HVHA 3AH6A 4CJTA 3F5TA 3V4IB 4CIFA 1EXQA 4DR4F 3P5TL 4ATNA 4K50A 4X2BA 4BRGA 3CDEA 2PFUA 3LZJA 2LA6A 2A40A 1WSGA 3THYA 4FWQA 4Y28C 5K5MA 1GMWD 4W5NA 4WFZA 2MKYA 3M8QB 5CZ1A 2JFDA 5BREA 2DNRA 5AQMA 5KGXA 4EGLA 1WG4A 2LQ8A 4X84A 5ITHA 4GKKJ 2R7WA 4F36A 4A61A 2YNIB 4I6WA 3M6UA 4BR7A 4RW4B 3Q2TC 2IPOB 4PQUB 2QL9B 3HOTA 2H1YA 3RUBL 2KKZA 3NGRA 3SBTA 1Y7PA 3JS9A 2IVPA 1Y11A 8RUCA 3VESA 5E26A 1G15A 4PWUA 2HNYB 3OSPA 2NQPA 2O8DB 3Q8RB 1FRMA 3DKDA 4ICLA 4X4VA 2M2BA 3IGVA 1CJVB 3NHGA 2QFIA 4XH4A 4NLOA 4BC9A 2V94A 3TSUA 2YNFB 3O5TB 2ZH2A 3QAEA 5G4DA 4CGHA 3PZPA 3P3DA 1YJNN 4NLDA 5HMYA 1WG5A 5KQ8A 3A2FA 2XYHB 1NKCA 1KTQA 1LWXA 2FVCA 4NMXA 3CC2N 1S1WB 4M7XA 1RT7B 2KFNA 1U25A 3UKUA 4ILRA 5HI7A 3DXMA 3BGLA 5IQQA 5IC4B 4DR3J 2D0CA 1HD1A 4QU6A 4YY3F 4WZMA 1CULA 5B0EA 4KTQA 4YHHF 2BR0A 3TU5A 1VLOA 2UV8G 3OTOK 2M88A 3M30B 2AEMA 2VWKA 1C4CA 1JLCB 2P9PB 3VGTA 3AVCA 5BRFA 1B92A 2QZ8A 4DS5A 3CFOA 5BR9A 2P8IA 1HHTP 1RDBA 2UXDJ 1VC5A 4PPZA 5GMEA 3LTOA 5KFVA 2XHWA 2JOQA 2IC3B 3TVZA 4B08A 2Q3SA 1W0HA 4D3HA 2IBKA 3FDSA 5KG4A 3D6TB 1HKGA 5GAEP 4ELTA 2VA3A 1Q86O 2KW4A 1T03A 1U47A 3UO0A 5KPRA 4EI2A 4U67Q 5KRSA 2Y1IA 4CO0A 6FD1A 4CH0S 3SQGA 3N5FA 4LSNA 4B9SA 2F4VJ 4X65F 1WB9A 2HS3A 4ZOSA 3ID8A 3N4QA 3NF9A 3PRDA 3R5CA 3D3CJ 3GL1A 4KH5A 3KD5E 2H54B 4DLEA 4PABA 4CLLA 1M5HA 4RNFA 5HJYA 1YBTA 4MYUA 2EPIA 1BUPA 4OJ3A 1IBKJ 3NP5A 4BE1A 1NO8A 4DV5F 4DFMA 1E4FT 1YBAA 3WQTA 4P73A 2ZZMA 4M5LA 3SDEB 3D6RA 3P31A 1S7IA 2ZDPA 1N8RO 2XMJA 3IN5A 5D4PA 2YHYA 3ENHA 4ZP6A 1S5JA 3F41A 1NMNA 4OHWA 3I55N 5GMKa 3GFHA 1YJWN 3KJVB 2RHKA 2N82B 3O9UA 1BD6A 3B8HA 3D0IE 4CECA 2IM2A 2G1HA 3HKWA 5H9EJ 3VVTA 3WDOA 5E84A 4EFAC 4MFBA 1NPKA 4CJWA 2RKIB 1FJ7A 2PMWA 3JSBA 1M5SA 4OYZA 2JLEA 1QZ6A 4U7UK 1SKWA 4KSEB 1KNZA 3R27A 3VEVA 3FEZA 3SYZA 1VLYA 2DITA 2OO4A 5AE2A 3IS9B 2F8MA 1QSYA 2IDOA 2ZDOA 4ZPTR 4WP3A 1R27B 1AW0A 3MXHP 4R0EA 3KJFB 3NLCA 2ZE2B 1UZDA 2Q31A 3CJTA 4HVZA 1ATSA 4H4OB 5LL6d 5AJ3J 5KG5A 4BRHA 2W4PA 1U04A 2RRNA 1T9YA 4X64J 1RAOA 5FIIA 4OPKA 2J6TA 4NCGA 4C8LA 3WT0A 3J7Z5 2IVFB 3ITHA 1IV0A 4KFBA 3JSMA 3AO4A 2CG8A 3HMJG 4NXMJ 1S9EA 3TUZC 3BZQA 1NK4A 4DZDA 1YRUA 1GLLO 3T5HA 3OPKA 4JI7F 2L08A 3AVAA 1HNXJ 2YHAA 3CCUN 1F5BA 4LF4J 1LFWA 2J6SA 4B1UB 2XO7A 1RT3A 2HK3A 1RJJA 3CJ1A 4OYBA 4K0KJ 5LSLA 4BC3A 5LMNJ 2P9CA 3NXZA 2R3VA 3LP1A 3O8WA 3W61A 1V3SA 2CIMA 4JI1K 3FLCO 1TL7A 1RT6B 3G6EN 5AZJB 4G1IA 4MKVA 2L9DA 4ERDA 1NGIA 2B4OA 4K4WA 1NDCA 4PG7A 4Y2IA 5HP1A 1XMOF 2MQOA 3L0QA 4M5DB 2AJ0A 5ETTA 4KV8B 1XQSC 4UQTA 1AUDA 4NA2A 3V5RA 1FCAA 1SH2A 3Q8SB 3B54A 2HHTA 3VWSA 1AB8A 1WAFA 4DV1K 3FZKA 3C94A 4HCBA 4H4KC 4UOCA 4JV5J 4PPDA 1RADB 3R2DJ 2DFHA 1VSDA 5GIOA 3I0SB 4F4ZA 1RWKB 3EZWA 1L3TA 1WC5A 3FFIB 4YOWA 5EDWA 1P90A 1HNIB 4NE9C 3CCMS 2RAQA 3ZEUB 2V2ZA 2YX6A 4DG1A 2P6TA 3T9ZA 1LOUA 2V2VA 1TUWA 3OBIA 1R89A 3DOKA 2DGSA 3ZNUA 2XS7A 3GJRB 1U24A 2RB7A 3TABA 2WONB 3QWUA 1HWIA 3H46O 2MJNA 1Q7LB 4Q45A 4DL2A 1D8ZA 3G9CA 1LXJA 2QMUB 2KZMA 4AD6A 3M8WA 4Z4GA 2CGJA 4DV0J 2IVNA 3FQLA 4QYRA 4A47A 4KHNA 2DY1A 1TUYA 2AGQA 1OSDA 1VSHA 5HK4A 3H4DA 4ELVA 1J5EF 4JI3J 2D0PA 3R6GB 5HMWA 2DEIA 2P5OA 2WBNA 1UL3A 1VQ6N 3R5AA 4IH7A 3SIPB 5M2PA 2E5LJ 4FXVA 5I4MA 3AQOA 2MLYA 3NG8A 1WKKA 1JX4A 2DR9A 4BBYA 5I42B 2JSXA 4A46A 3E3XA 3KWMA 3PX6A 2E5HA 3QO9A 2H5IB 5DQHA 5BPMA 2QO3A 5JVGQ 4NXNF 4Q0BB 4NLVA 3CMES 3G71N 5A8KA 4NYNA 2UUAK 2K1RA 4GY2B 5K9FA 1S48A 9ATCB 1CPZA 4BDYA 4ZCMA 1RBUA 4JD2B 2PI4A 4CEQA 3SBGA 4GW6A 2XG8A 3KG0A 1FERA 1FWLA 2BE9B 4B8CA 4CWBA 4ZPBA 5K8MA 1VIOA 2MXYA 3S8SA 3LAKA 2FDNA 2MY7A 5KPZA 2MKHA 4IFVA 4CH1A 4DWIA 3P5BP 1S99A 2W7PA 1F3VA 2Z57B 3FBCA 3AAQA 2VPYB 3VZIA 1FD2A 3BQ1A 3RGIA 4W98A 4K4SA 3H1VX 4LT6A 3AB2B 3B6PA 3WNFA 5MLCV 3QETA 1VBXA 5HRPA 4GVLA 2GJFA 1HA1A 5AE3A 3A3NB 5JLHA 2E9TA 1M90O 2CJ9A 4DR2J 3TAPA 3TQEA 2VG7A 3ZZZA 1N33F 3KLFA 1NU0A 1CJTB 3ICLA 3VMFB 2QA2A 4CNZA 4U67L 4C0BA 1S49A 4G1QB 5L9XA 1HNZK 1WUUA 4JI0K 4MLHA 3RSEB 3IGNA 3BEGB 3FGUA 4X66K 4AH9A 3CCRN 2DHGA 2V4JA 2DPNA 1NOZA 2VG6A 4G6VB 3DDKA 3GQCA 5IT9U 4XH5A 4DTPA 3O3FA 4JRPA 3PXGa 5M1PA 4B3RF 2APOA 1GOAA 3RJMB 4OYWA 3H5SA 4JI6K 2J8SA 4RO0A 2FJBB 4FKYA 4RL1A 1I94K 3TTCA 3DOMA 1YJ9N 2I1RA 2GMHA 4RUHA 1NRKA 4X4RA 5D0HA 4OKEA 3FZHA 2F9TA 3ZXWA 4OZ5A 2YKPA 3RAXA 5AXLA 4XPCA 2BX6A 4P2FA 4M5NA 3M05A 1BA1A 1IJEB 2CJYB 1HQUB 4RW7B 4F3OA 3VETA 4S0MA 2LFVA 4BRDA 1KEKA 4H4MB 1GLEG 4CFCA 3CC7S 4RPFA 1RT2B 1K44A 1BWEA 1OY9A 2ZM6J 1NLVA 1D4XA 4ZK7M 2GVZA 2V51B