4KV8A

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase P66
molecule tags Transferase
source organism Hiv-1 m:b_hxb2r
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
total genus 152
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kv8A05
1U45A 4FJGA 1ASVA 1ZBFA 2PYJA 4R0EA 3T3FA 3VQPA 3CFRA 4PWDA 1JXBA 3OVNA 1Z25A 3BREA 3AVBA 4NYFA 3DOKB 3HP6A 4O0IA 1VSMA 3ZSYA 1KHVA 5KG0A 2GC8A 1S1TB 4EO8A 1JIHA 5KFUA 4Z4CA 4DFMA 1S48A 1S1VA 3PX4A 4CJLA 2IM1A 3QGGA 3DLKA 4TXSA 4ZP9A 4KAZA 3FDSA 2W42A 1KFDA 4CECA 4RW9A 1JLBB 1ZBLA 1C6VA 4OKEA 4DTRA 1RT1A 3BSAA 3OLAA 5FDLB 3OL8A 4ED0A 5L9XA 4FJKA 4J2EA 2WHOA 1C1BA 4JV2A 3PO4A 3TAPA 2AWZA 1HQEB 3N6NA 2QXFA 2FVPA 2V0NA 1TL1A 3EPGA 3MR5A 1S1TA 4KB0A 1RILA 1ITGA 5DG9A 4J2DA 4F4ZA 1IKYA 4KSEB 4CJPA 3QLHB 3OJSA 4WE1A 1CXUA 4O3OA 2D0BA 1HYSA 2X6SA 5K14A 4M3ZA 2XY7A 1LW0A 3MEDA 4Y2AA 2D7SA 2C2RA 4CCHA 1RT6A 3LPTA 5J2QA 1RBTA 3ZSWA 4UQGA 3LAKA 3CDEA 4ZPCA 4KRFA 3GV8B 3EYZA 4ECSA 3ZT0A 3V81A 3K5NA 4NRTA 3B6PA 5FDLA 2AX0A 3PW5A 3IRXA 2IA6A 4EO6A 2VG7B 4CEZA 1C1BB 3OSPA 4RW7A 1RDRA 4TN2A 2C22A 2JGUA 4FJ8A 3V6HA 1S9EA 1CZBA 4DSJA 1ASWA 4RUCA 1HNIA 2FLNA 2RKIB 4DU4A 5KFTA 4WXWA 1BIUA 4O3NA 3VQDA 3DLEB 3DRSB 1L3VA 4U6PA 1RCHA 1U04A 4OVLA 1DTQB 5C25A 4W5NA 1KLMB 3LP2A 5JUMA 3FFIB 3HYFA 3C6UA 4M3YA 5E41A 2WCXA 5D3GB 4CJUA 1NHUA 4ECZA 2WK4A 4J2BA 1NK4A 4DF4A 1S1UB 1N6QB 1EETB 4FLUA 3SYZA 4CGDA 4CHNA 2AQ4A 3AVFA 2FJVA 3AVKA 3MEEB 3KNAA 2G8VA 2E9ZA 4IR1A 2YNIA 2R2SA 3L2QA 4DSEA 5HRNA 2ATLA 3SQ1A 3MR3A 2HW3A 4RNFA 1LWCB 4RNHA 2HVIA 2AGPA 1BIZA 3AO5A 1S1UA 1N6QA 2PY5A 4C8MA 4O55A 3G6VA 2B43A 3GV5B 1SKRA 2IDOA 3AVJA 4CEFA 5C25B 4URGA 4ELTA 1JLFA 4HYKA 2WONB 4NLVA 3KJVA 2IOCA 1RT5A 1JX4A 2DFFA 5L1KA 1FKPA 1LWCA 5J2NA 4J9KA 3NGIA 3TVKA 3DLBA 2IS3A 1GX6A 1TVRA 5KG1A 3GILA 4H4OB 4DFJA 4CJRA 5C5JA 5CYQA 3SUNA 1QAJA 5JXSA 3L2VA 4MK7A 4CEAA 3TI0A 2ASLA 2ZD1B 3RBDA 3KHGA 3KLFB 1UWBB 2P1JA 2JEFA 3DLGA 4DSLA 1HPZA 1I3AA 3PO5A 5SWMA 1L5UA 3L3UA 3LP0A 3LWMA 4CFDA 3VA3A 1ZYQA 1ASUA 3G86A 4TY8A 3AVCA 4E3SA 5J2PB 5KGXA 4FK0A 2YV0X 2WTFA 4MFBB 4DL2A 2FVQA 4RG8A 2HVHA 2OPPB 2FBYA 5C24B 1X1PA 1S9FA 4O3SA 2BRLA 5FRNA 2FVSA 3VN5A 4N5SA 3U6FA 3PR4A 1XHZA 3LP0B 4CIGA 1CSJA 2B6AA 4DQSA 3D45A 5T14A 3MECB 1G15A 3VQ9A 2ZE2A 4CJFA 3MXIA 5EUHA 2YNGA 5KFMA 1HJRA 1KVAA 3PX0A 3V6DB 2A1SA 3DLGB 3KLHB 4NCGA 3KK3A 3PW0A 4DQQA 3H5SA 4FW1A 3LP1A 4HKQA 2JEGA 2R8JA 1R0AA 4RW8B 3NAHA 2FBXA 1ZBIA 2ZQBA 3C94A 1DTTB 4R5PA 1HNIB 4PQUA 4K50A 5KT5A 3QIDA 4DSKA 2D0CA 4ED8A 2YNHB 3NF7A 3KK3B 3I0SB 4NZ0A 4CFCA 2QV6A 1BI4A 1TKTB 4KO0B 3RR8A 4FJJA 4M3WA 1S5JA 4AHRA 1FK9A 3HO1A 3OL9A 1WLJA 4O4GA 2OH2A 1CLQA 3TAQA 1NKBA 4PUOB 2P51A 3OYNA 4ECYA 1KVCA 3MF5A 4CFAA 4DL7A 1C1CB 3SV4A 1TL3B 4Q0BA 2C2DA 5C24A 4B9TA 3I0SA 1RTHB 3NCIA 1UA0A 4L8RB 4LSLA 1VSLA 2FC0A 1LAWA 3RAQA 5J1EA 4RW4A 4FLXA 4PQUB 3OYKA 3T5KA 3SCXA 2IGIA 4W5QA 4B9LA 3EZ5A 1W0HA 1BI4B 4CJVA 4B9MA 1C0UA 3OYDA 4KREA 3K59A 2XRIA 3IG1A 4TYBA 3PZPA 1BL3A 2CKWA 4TLRA 3DYAB 3TABA 1HQEA 5KFOA 3AA5X 2IBKA 4CE9A 3PW7A 4F2RA 1EP4A 3UDLA 4J9SA 3EZUA 1SUQA 2UUTA 5CZ2A 1VRTA 1RT7A 2BE2A 2Z1IA 3P1GA 3L2UA 1HMVA 4NLRA 2E4LA 4E0DA 4YR3A 4FK4A 4FZZA 2I1RA 3ZSQA 4KV8A 4TY9A 2VWKA 3PY8A 3KLIA 1LWFA 3SJJA 4CEQA 3MFHA 3KK1A 2JEJA 1WN7A 3PX6A 4M95A 1WSEA 2X74A 2FJWA 1C1AA 3DLHA 3H98A 1VSJA 2E6MA 3OYEA 4I2PA 2EHGA 4C8KA 4FK2A 4URQU 4ZPDA 5CZ1A 3V6JA 4F4WA 4ID5A 2IMWP 3DLRA 1QQCA 1TKZB 4M42A 3SQ0A 2HAIA 4RW6A 2BE2B 4XPCA 4F4YA 2P5OA 2VG7A 3MEEA 4HTUA 4FM0A 2AJQA 2Y1JA 3GIIA 1RTHA 3KK1B 3SI8A 4DLEA 1TK5A 5J2QB 1S10A 1B9DA 1WAFA 2E6LA 2R2TA 3HVRA 4CERA 3RB0A 3WNHA 4HHTA 4LSNB 4MK8A 3VQAA 5F8IA 4Q8FA 5KTQA 2RKIA 3I5AA 1HNVA 4OJRA 1MMLA 2XY8A 4CJTA 1S9GA 1SUQB 3KHRA 4FBUA 3NMAA 2BR0A 4PA1A 1NJYA 4O4RA 3NH0A 1DLOA 4X2BA 5KT7A 1TQLA 3D28A 2VG5B 1N5YA 4IH6A 3PW4A 2PYLA 3ZSOA 4RW9B 4N76A 3CIZA 2VA3A 3VQ5A 4KKOA 5J2MB 1JLAB 1X9WA 3K5OA 2OZMA 3T1AA 1IKWB 4XPEA 1S1WB 2W9CA 5KFHA 1L3SA 1RA7A 4Q45A 3MTKA 4CEEA 2KFZA 3DLKB 3MAQA 4KB1A 1TKXA 3V1RA 3QO9B 3WNGA 3L3VA 1J9AA 4WYLA 1S1VB 4HUFA 4DL6A 5KG4A 2E9TA 3MR6A 4EBEA 3M8QB 4FJMA 1SH2A 1QE1B 1RT3A 1Y97A 4CK3A 5KFWA 1VRUB 4DSFA 4WFZA 5FROA 4FLYA 3QESA 1IO2A 1QSLA 4E7KA 4FJIA 4AH9A 1KLMA 1LW2A 2DFHA 4KHWA 3E51A 3MXMA 4NLGA 2BQRA 3QEWA 5L1LA 3SPYA 2QKKA 3V9ZA 1TVRB 1NK8A 5KG3A 5C42B 1S1XB 1BHLA 4IFVA 2W9BB 1S4FA 4ZVHA 3IS9B 3M9MB 2KZMA 3SNNA 3DRRA 1SL1A 4DG1B 3OS2A 3ZSZA 2E9RX 2X6NA 3VA0A 4MQ3A 2GIRA 4XO0A 2Y1IA 2B5JB 3H4DA 2IAJA 1D9DA 1RT4A 1B9FA 2R7YA 4KHMA 2IC3A 4RUAA 1RDAA 4C8LA 3HVWA 2WRMA 3ASMA 3QINA 1A5XA 3TANA 4QPXA 1HRHA 3CJ2A 4J9RA 5KFNA 1RBUA 3U3YA 2IM0A 1WSFA 2YNIB 4FVMA 1RT4B 3GQCA 2W7PA 3EPIA 3O4QA 3V4IB 4FS1A 4RNNA 2FBTA 4CHPA 4M45A 1S0OA 5HROA 5K14B 2HHTA 1SL2A 1TK0A 3NGDA 4OGEA 3VQ7A 3D0PA 3RRHA 1HYVA 1IH7A 2RF2B 1UA1A 2KTQA 4O5BA 4QWEA 3QZ7A 3GIJA 3ZT3A 3HL8A 5KT6A 4HUGA 3NAEA 2HWHA 4NLSA 4PY5A 1KHWA 3NAIA 3S3OA 4BDYA 1DTQA 1LW2B 1UAXA 4KI6A 1RT2B 4Z4IA 4ZMMA 4K4XA 5HRSA 4IKFA 5I42A 3PVXA 2WB4A 2FLLA 4OPJA 1D5AA 4NLXA 3BQ2A 3S9HA 3H5YA 1TKDA 3VQQA 4DTOA 4J9PA 3CDWA 4IRDA 3IN5A 4FCYA 4FJLA 4CFBA 3KLIB 5C42A 3RTVA 4LSLB 4RU9A 3TQ1A 4PUOA 3NE6A 4OL8A 3I8DA 3HXMA 3ZSVA 3DRPA 3SUPA 3KOAA 5F8HA 4DTPA 3V6DA 3KLEA 1XI1A 2IM2A 3FQKA 5KG7A 2HNYA 3CG7A 3QEVA 3PJWA 4QAGA 1JKHB 3NH2A 3QGHA 5KT2A 5KRSA 1Q9YA 4E1NA 3DYAA 3LP3A 2IJFA 1I39A 1I6JA 3RB3A 4ED7A 3O3GA 5CYQB 3QYYA 4NYZA 4OKJA 3QIOA 4KHQA 3E01A 2HHWA 2IJNA 2QK9A 4BDZA 1WSGA 4H4OA 1UWBA 3VQ4A 5SZTA 5J2NB 4KI4A 3NL0A 4CK2A 2VG6A 4K4ZA 3Q8PB 1K1QA 5EDWA 3KHLA 4MKBA 1QSSA 3OL7A 3LZJA 4Z4GA 3LZIA 4NLOA 1S6QA 1MU2B 4MIAA 3DRPB 4YMEA 3M9OB 4QW9A 1SKSA 3G10A 3JYTB 3OYJA 2Q3SA 3SFGA 3HP9A 1IKXA 3O3FA 1MU2A 1K6YA 1WNSA 4ECQA 5KFFA 2D3ZA 2ASJA 3K5LA 2YKMB 2Z1HA 5F8GA 5KG5A 1TKTA 4IRKA 4ZPBA 5F8LA 4M41A 4DTJA 4WZMA 3G6XA 3DI6B 2HWIA 3OSNA 2FVCA 2XHBA 4TQRA 4RW8A 3SUQA 4FLZA 1FKPB 4LY7A 2HHVA 2EX3A 4LD0A 4CEDA 1HQUB 3H08A 4IFYA 4KHYA 2D5RA 4IG0A 2UVRA 3M8PA 3BDPA 3TAMB 4F4KA 2NUBA 3I0RB 4QW8A 4F3TA 3VQ6A 4C8OA 2J6TA 4DFPA 1NJWA 2WOMB 5KFXA 4B9UA 2ATQA 2BQ3A 4CESA 4QWCA 3DDKA 1Q9XA 1ZBUA 1K1SA 3OHBA 1GOCA 4DTSA 1RTDB 2XGPA 5F8NA 2X78A 4JS4A 2GBZA 2HNDB 4E7LA 2YNFA 1DLOB 1FK9B 4QOZB 4DTXA 1S6PA 1REVA 4KKOB 3HT3A 4CGGA 1FKOA 3H5XA 4DL3A 4B8CA 3OYFA 4MIBA 4MFBA 4ELUA 1N5YB 3QGIA 3NF9A 4JV0A 4J9LA 2FVRA 3OY9A 4HUEA 5KFDA 3Q8SB 3V9UA 3C6TB 1RAJA 3QNNA 3K58A 3VQBA 5HLFB 4GMJB 4CF9A 3FQLA 5KFSA 3TAEA 2F8SA 3NGYA 3KD1E 4KHNA 2HHUA 1XHXA 3DLEA 3DRSA 4DU1A 4CHYA 1T03A 3DM2B 3PR5B 1D8YA 3QZ8A 4ECUA 4ZP8A 4CEBA 2DY4A 2UVVA 3T5LA 4FJHA 2HMIB 1F21A 3N6MA 4WYWA 2R8KA 3M8QA 2XCPA 4DL4A 1SV5A 3P5JA 3TR8A 4GW6A 2RDIA 4FLVA 4CJKA 3PJXA 1IKYB 4C8NA 3THVA 4BE0A 2ASDA 4LSNA 4H4MB 3M9NB 4CGJA 4Q0BB 4IH7A 5CY4A 3AO2A 3OYHA 3NBPA 2G8KA 4DS4A 1JLAA 4Y34A 4KHSA 4O44A 4KHRA 1NK9A 3MR2A 1YT3A 1JLBA 4Y1CA 1S9EB 1FKOB 2VG5A 3NDKA 4DU3A 1S97A 5KG2A 4RW6B 3AA3A 3NBPB 3VQEA 4KTZA 2HNDA 2OYQA 1LV5A 3ITHA 3ZCMA 3QEXA 4IFVB 1BISA 4E1MA 1NKCA 2VA2A 4WE1B 3N6LA 4G1QB 4N56A 1VK0A 1J54A 5HP1A 3TAFA 1SL0A 4I9LA 4EP4A 5KG6A 3K2PA 3MFIA 1RTIB 4I2QA 3OL6A 4FLWA 1TL1B 5KFGA 4M3UA 1RBVA 2D3UA 4DQRA 1NK7A 1HYSB 4QWDA 5JS2A 4LQ9A 3MXJA 2V4RA 4CJQA 1NJZA 5HROB 4B9VA 4JLHA 3OLBA 4AILC 3QERA 3CFOA 1OS5A 4MK9A 4GC7A 2DFEA 4TY8B 4FLTA 1RBSA 3O3HA 3RMAA 3OHAA 2B5JA 4F4XA 3LWLA 4B08A 1HPZB 2G8HA 3ISND 2IC3B 1RA6A 4AHSA 1JLCB 3QNOA 2IAJB 3L8BA 1IKWA 4MH8A 4URSA 4YFUA 4DTUA 1J53A 4BWMA 4OPKA 4JRQA 3P83D 1BCMA 4FJNA 4EYHB 2RDJA 4BE2A 5KFZA 4F50A 4DMNA 1QSYA 2GV9A 5KFAA 3OS1A 4KE5A 3ITHB 4IBNA 3L2RA 4JS5A 3H4BA 3KJVB 3OYIA 1JL1A 4O0JA 1BQNA 1S0NA 4O3QA 3CJ4A 4CF8A 1RTJA 4R8UA 4HVJA 4Q44A 3HHKA 4K4UA 5DG7A 5KFPA 4DF8A 2G8FA 3VQCA 4HCBA 1T05A 4BE1A 4LQ3A 4CHQA 1KCFA 3A2FA 4GVMA 4Y3CA 2YKMA 4H8KA 3LPUA 1QUVA 3CFPA 3GYNA 3RBEA 3RWUA 4YP3A 4WFXA 2DPJA 3Q8RB 3M8PB 2YHBA 4BDPA 1BGXT 4YQWA 4NLTA 5KFKA 3B6OA 2JLEA 4B8AB 2OPRB 5HRPA 2LSNA 1RDBA 1TL3A 4NLQA 4ECTA 5D3GA 3RMCA 4AHUA 1L3TA 1U09A 4FM1A 3LP1B 1XR7A 3ZT4A 1WAJA 3OYAA 2C28A 4NCGB 3KK2A 1Z4UA 2ILYA 3BSOA 5I42B 3G0ZA 4RNOA 2XY5A 4B3OA 1DTTA 4R5PB 4KBIA 4KHUA 2DTUA 4G3IA 4K4SA 2XI3A 4FM2A 4DQIA 1TAUA 3C6UB 1QS4A 4W5RA 4B3OB 4FJ5A 3Q8QB 3SPZA 4FS2A 3ALYA 2HNYB 4OLBA 1X9SA 3RB6A 3CJ3A 3QEPA 1D9FA 3S3NA 3JSMA 1JLGB 1U47A 1HARA 2YNGB 3AVGA 3F9KA 4K8XA 3QIPA 5KT4A 3KK2B 3H2LA 3CDUA 4IDKA 1N56A 4K8ZA 1L3UA 2HHXA 3LDSA 1W25A 2XY6A 1YVUA 3NKYA 4WXOA 4KTWA 5I3UB 1QTMA 4DSIA 4FJ9A 4NRUA 3C6TA 4KB7A 2O5DA 2R8GA 3OYGA 1YTUA 4WZQA 4CJSA 4I7FB 3MECA 3SQ2A 1VSEA 5KFJA 1VSDA 4CK1A 3S3MA 4EZ6A 4W5OA 1ZBHA 2XGQA 4IDKB 3H40A 3KLFA 4K4TA 1YTAA 1IKXB 2D0AA 4KV8B 3JSMB 3VQ8A 4DL5A 1RT1B 2DPIA 2AU0A 4J9MA 4QCLA 2OPQB 1SV5B 1ZTWA 1RYSA 5F9LA 1U49A 5KI6A 4KPYA 3T19A 3DOLA 4NLPA 5HRRA 2W7OA 1LWEA 4DFKA 3IG1B 2CJQA 4FW2A 1NK5A 4ECWA 3KLHA 5DG8A 2BANA 5EWGA 2GUIA 5HBMA 4GC6A 1T8EA 2RF2A 2HB5A 2R2UA 5J1EB 3RB4A 3CYMA 5KFLA 2EC0A 3KLEB 4Z4FA 4ZTJA 3M8RA 4Q5VA 4RW7B 1C1CA 1TKZA 2XI2A 3VQSA 4CIFA 1C0TB 3V1OA 4RW4B 4EBCA 1TV6A 4EYIB 4BACA 4I2PB 3L2WA 3HVAA 4O44B 1TV6B 1KSPA 3OS0A 3AO1A 4E7JA 1S49A 2ZKUA 3V9WA 3F73A 3SI6A 3I0RA 3CJ5A 1XR6A 2F8TA 3V1QA 2KQ2A 3AVHA 3I5BA 2XWYA 4RZRA 2XO7A 1S6QB 2G8WA 5L1JA 1RT7B 2I5JA 2ETJA 4FYDA 1JLEB 1LW0B 3BJYA 3HPOA 4TQSA 3D5MA 2O4GA 4KFBA 3H5UA 4ZHRB 1EP4B 4ZVEA 2O4IA 2ITGA 1NOZA 4W5TA 4NCAA 4JUZA 4O4GB 1KFSA 1QAIA 3PV8A 2W8LA 3BQ1A 4NLWA 5DQGA 3BGRB 1QE1A 1RT3B 3DI6A 4ZP6A 3AVMA 3PHEA 4NLUA 1WNEA 5KGWA 4E89A 1C0UB 5HP1B 1A5VA 4NCBA 2J6UA 1LWEB 4AHCA 4QWBA 4Y1DA 2F96A 1GOBA 3K5MA 4IFYB 1QHTA 2HHQA 3U3GA 3HKWA 2AGOA 4ED2A 1BCOA 3RMBA 5T7BA 1IKVA 4IQXA 1S1WA 1BQMA 5L1IA 5EWEA 4Q8EA 5DMRA 1S1XA 3WNEA 3KLGB 1WSJA 3AVIA 3AVAA 1ZTTA 3BR9A 4YR2A 1EKEA 4N47A 2J6SA 5DQIA 4OGCA 3NH1A 4IRCA 1WSIA 2B6AB 3IRXB 3QO9A 4NLYA 5KFQA 5HBMB 1N48A 3V9XA 2HHSA 4CEOA 2UUWA 3KLGA 3KIOA 3V9SA 3PW2A 3GIMA 5CYMB 1BQMB 1T3NA 1TAQA 4OLAA 2ILZA 3RRGA 2R8HA 3LALA 3KHHA 1D1UA 2OPSB 4CGIA 3MEDB 4OKKA 3IGNA 3AA4A 2VWJA 3NHGA 4ID1A 1T05B 1HNVB 1C0TA 1TK8A 4ICLA 3QLHA 1FXXA 3CWJA 1WSHA 1R0AB 4MKAA 3NFAA 2HMIA 5CYMA 3ICLA 3SZ2A 3IAYA 1O1WA 5KFYA 4K4WA 3K57A 3SV3A 3IGVA 4KTQA 1Z26A 3ZT1A 3KLVA 4ICLB 4N41A 2W9AA 3FFIA 4IOBA 2ZD1A 1SH0A 2D41A 4ZTFA 1TKXB 3HSTB 3G6YA 4ZHRA 4QWAA 4CJWA 2AX1A 4FJ7A 4IG3B 1VRUA 3LANA 2W9CB 4M94A 3HM9A 1HYZA 2A1RA 4ID5B 3O4NA 4RNMA 5JS1A 1S9GB 2WONA 5KFCA 3M8SA 5KT3A 3ISNC 4DG1A 1U4BA 1VSKA 1KTQA 2V9WA 4FJXA 2W9BA 3QIPB 2JC0A 3SQ4A 3HPHA 3UQSA 1S6PB 3KMQA 1IM4A 4ZVGA 1RNHA 4FXDA 5DLFA 3CVKA 4J9OA 1KVBA 5DLGA 3V4IA 3KKRA 3QEIA 4PWDB 3BSCA 4ZVFA 2FLPA 4G1QA 3H59A 1SH3A 3TARA 4ZPAA 3LP2B 4FZXC 4Q43A 2RN2A 1RTIA 4I2QB 5DGAA 4DQPA 2UVWA 3KKSA 1YVFA 4DTMA 3V6KA 2Z1GA 4Y2CA 1VRTB 1BQNB 4F2SA 2GIQA 3AVLA 3RMDA 3NF6A 3UPFA 3CM6A 3DM2A 4Z4HA 2F8EX 4ZP7A 4CJ5A 4LH4A 1T7PA 4DEZA 1UOCA 3DRRB 4CHOA 1NK0A 4ED6A 3AV9A 3HPGA 4B9SA 2IM3A 3FSIA 4NLDA 3T5HA 5J2MA 4I9QA 3TAGA 4KAIA 2BRKA 1VSHA 1RT5B 4CJ3A 2HNZB 3HK2A 5DQHA 2XCAA 3KMSA 2OPQA 1VSIA 3OYCA 1RDCA 1XC9A 4E7HA 3IS9A 1NNDA 2XC9A 3GIKA 3OYBA 3NF8A 1A5WA 3V81B 1LAVA 4YR0A 3ZSRA 3OYLA 4AHVA 4CF1A 1EX4A 1IKVB 5EWFA 3UR0A 2OZSA 4E19A 1S0MA 2KW4A 3NGZA 5DGBA 4TYAA 4EZ9A 5DK5A 3KD5E 2YKNA 4ELVA 2R2RA 4M3TA 3GV7B 3ZSXA 4FZYA 1RT2A 4JV1A 5EU7A 3HVTB 1NJXA 4B9NA 1VSFA 3E01B 2JEIA 2G8UA 1JLQA 3AO3A 3EY1A 3MEGB 5F9NA 4LH5A 4HCCA 1T03B 1JLCA 1TP7A 3KTQA 1B92A 2FBVA 4ECXA 3RAXA 3AO4A 3CQ8A 1JLEA 4DTNA 3RR7A 2BANB 1J5OB 3BQ0A 3I5CA 3HJFA 5KFRA 2BDPA 4R8UB 2KZZA 1C2PA 1NHVA 3JYTA 2R8IA 2OPPA 2P5GA 3C95A 1W9HA 1RDDA 4CHZA 4IKAA 5KFIA 4CF2A 5F8MA 1KLNA 1CXQA 4J9QA 4DLGA 5FRMA 3QETA 2OPRA 1NOYA 1JXEA 1IG9A 1JLFB 2YHAA 2VG6B 2HNZA 4DWIA 3BSNA 3OJUA 4Z4EA 3LAMA 4WFYA 3MEGA 1Q8IA 4CIEA 3CO9A 4IG3A 3AA2A 3WNFA 2YNHA 5I3UA 2Z1JA 2ZE2B 4ED1A 4IH5A 1RTDA 1NKEA 1J5OA 4ECVA 4K4YA 4I7FA 3TWHA 2G8IA 3CM5A 1LWFB 4H54A 4CGFA 2UVUA 4O3RA 3TAMA 2W8KA 4E7IA 2I5JB 2FJXA 3T5JA 4M3XA 2ALZA 1ZETA 3BGRA 1XWLA 4CJ4A 4JRPA 1XR5A 1GX5A 4AHTA 1NK6A 3DOLB 4F3OA 2V4QA 2AGQA 2OPSA 1JLQB 1JKHA 1CZ9A 2YKNB 1RTJB 5J2PA 4M3RA 5F8JA 4EBDA 1U48A 4J2AA 2JC1A 1GOAA 1RBRA 2QE5A 5KFEA 2BGGA 3HVTA 1SKWA 3SUOA 4K4VA 4XIUA 2BQUA 4ECRA 4CGHA 1HMVB 3OYMA 1D0EA 2RPIA 3FRZA 3DMJB 4NYNA 4TSXA 4KFBB 4CJEA 1JL2A 3ULDA 2OA8A 4EEYA 4FBTA 1REVB 4F8RA 3PUFA 4IR9A 2YNFB 3SFUA 5KFVA 4EP5A 5KRTA 4YNQA 1C0MA 4ED3A 1RYRA 4O3PA 3DMJA 2B4JA 4H4MA 1EXQA 1RT6B 1EETA 2QKBA 3DOKA 3ZT2A 1JXLA 1KRPA 2C2EA 2WOMA 1HQUA 1T94A 3CJ0A 4J9NA 1TGOA 4KO0A 5HLFA 5KFBA 4Z0UA 4DS5A 1X9MA 2PZSA 3UIQA 1JLGA 1N4LA 4BWJA 4U7CA 3AVNA 4IG0B 2KFNA 4CF0A
chains in the Genus database with same CATH superfamily
2RHQB 3A3NB 1ZBFA 5GAGP 4M5JA 1BA0A 3CFRA 4JI0J 5A76A 4OI3A 4PWDA 1RGIA 2YY3A 2CAJA 3OVNA 5ADXA 2HGMA 2NRVA 4DUZK 1Z2ZA 4EO8A 3MMBA 2OTJS 1QZ6A 5IC6B 1S1VA 4P7VA 3NS7B 2A41A 4TXSA 3C46A 2ZJPQ 4BR5A 2CGKA 4OKEA 4M1KA 1Q7YO 1GMWD 3BSAA 1VLOA 4C48A 4OI4A 4PHTX 2H3GX 1RAAB 5GAEU 4FJKA 1WUAA 1BWFO 3GPAA 3M6XA 5C2DA 2QX0A 1WKKA 2ACMA 2YBVA 5A8RA 3R5BA 1VQNN 1J6ZA 3GR0A 4B3MF 5C7PA 5K8OA 2E1CA 4CJPA 2DNGA 3OJSA 4U7UD 4Z2XA 1HQ2A 2D0BA 1HYSA 4E1JA 3IMQJ 2XY7A 3QSIA 3MEDA 2D7SA 4CCHA 4X65K 4DUYK 4UQGA 2PFFB 1OPIA 2MLXA 1JJ2R 2JHEA 3IUCA 3ZT0A 5K9FA 3CMAS 4OX8A 3Q23A 3PW5A 3IRXA 2PI5A 3A13A 2R7UA 1UETA 4CEZA 1C1BB 1BLUA 1X4AA 4CLTA 2CRLA 1F9EB 4F26A 3HLUA 1ZZFA 4FWKA 1RDRA 3TYTA 4YN3B 4TN2A 4YHHF 1B7YB 1F0XA 4XDCA 1HNIA 4DU4A 5KFTA 5D0RA 4DR2J 3DLEB 1IR2A 2XNRA 3NCQA 1RCHA 1U04A 2F4VJ 4CZLA 4W5NA 5EN1A 4PQAA 9RUBA 5RUBA 1OKJA 2NRXA 2G0CA 4NA2A 1YJTA 1UPPA 3QRQA 3U1NA 1S1UB 2X51A 5D8HB 2XMJA 4GY2B 4Z94A 2FJVA 3AVKA 5IM0A 4ED4A 4ZLPA 1FNMA 4DSEA 1X3NA 3G9CA 5HRNA 3U9DA 5IS2A 3CGIA 1C0GA 3SQ1A 4E2FB 1CEZA 3BBCA 2VC0A 2AGPA 3AO5A 4C8MA 2NRTA 2YHWA 5A2QO 1L3KA 2NLWA 3GV5B 2ADBA 4CEFA 3KVGA 2OANA 3T1HK 1SPBP 4HYKA 4ZVSB 2HFVA 2QT7A 2CZ9A 4Y2KA 1JX4A 2CNOB 4PEOA 1FT8A 3R27A 2IS3A 1GX6A 3M2RA 5KG1A 1VIXA 4H4OB 4DFJA 2VGNA 3EXCX 2ROGA 4CEAA 2WVDA 3TI0A 2ASLA 4C97A 3VEYA 5LSRA 4ZLJA 1XMQJ 1FNOA 3KXDA 3SBTA 2HSTA 3DHXA 1IJEB 4CLSA 1GTHA 2E29A 4YB6A 1N36F 3MD1A 5AE1A 1KQSR 3K9JA 2QMUB 3UDEA 2GGPA 3DKDA 3E9LA 1RTZA 5J2PB 1ZM3A 2CGJA 1K0TA 4DL2A 2FVQA 3VAFA 2OPPB 5G0RB 5BRHA 3JXUA 3O3LA 4O3SA 4L75A 2FVSA 3VN5A 5HATA 1W97L 2HWTA 2M88A 3U6FA 3LP0B 1XQSC 2EBGA 3MM8B 3MECB 2ZE2A 5M1OA 3BYRA 5KFMA 4PWUA 2A1SA 4CT9A 3KLHB 2XSJA 3T1HF 2E20A 1EO1A 4HKQA 2XSJB 1M5VC 3N5BA 3R9LA 4YOEA 4RW8B 4FF2A 2ZQBA 4R5PA 5C0YA 4ILLA 1HNIB 1J27A 3QIDA 3VF4A 4ED8A 2YNHB 1XMQF 1P27B 2NSBA 2EK1A 3LL3A 1BI4A 3UKRB 3RR8A 3W5YA 4M3WA 4B3SF 2FY8A 3OL9A 2FZCB 2XQCA 2C2OB 2OH2A 3CCLN 4WPAA 2P51A 3OYNA 3BDEA 4ECYA 2CJ9A 1RWKB 4WJBA 1VHXA 4CFAA 2ZEJA 3SV4A 2IFXA 2V6AA 4Q0BA 5AQXA 1VSLA 4AL6A 1Q8KA 1RISA 2CG8A 4FLXA 2ZWOA 3HI9A 5LL6Z 1FCAA 3SCXA 1UMJA 1J5EK 1W0HA 2QWRA 2BE9B 3MOZA 3K59A 4IZ9A 4YDUC 2CKWA 4TLRA 2W6LA 1Z1ZA 3FEYB 3PKYA 4UY8O 3V2UC 3GWCA 3UDLA 4J9SA 5I3PA 5LSLA 4CLLA 1SUQA 2UUTA 1KQSM 1VRTA 1RT7A 2CPYA 2BE2A 3ZZOA 3MM7A 5BR9A 3L2UA 1NZ8A 4A46A 4DXLA 1WJ9A 2QC3A 2Q2RA 3PY8A 4P2MA 3KLIA 2ZOMA 1LWFA 4CEQA 3VAHA 1WN7A 4GO7X 2PBDA 3PX6A 4M95A 2FJWA 1YJVA 2GZOA 4DKWA 3CJ9A 5LMUK 4ZPDA 4EU0A 3EUNA 1Y00A 4F4WA 4ID5A 2IMWP 1QQCA 1TKZB 1U1PA 3IWNC 3GJSB 3CETA 3ONQA 1SXLA 5JVHQ 4WF9Q 3MEEA 1Q1KA 4FM0A 1JK9B 1SAZA 2LKZA 2DIVA 3UB5A 2FLOA 4LIRA 2ASOA 1W2IA 3SI8A 4DLEA 2D3OR 4BY9C 3HMJG 4LFCK 1WHXA 3AB4B 1TK5A 1XTZA 5J2QB 4DV2F 1B9DA 4C98A 2E6LA 4LF7J 3TUZC 2R2TA 4X66J 3HVRA 3CCVS 1GLCG 3RB0A 1GLBG 3PM9A 4LSNB 5DS7A 4MK8A 2X7IA 5HVGA 3U9ZA 5JVGL 3R7BB 2R42A 2RKIA 3I5AA 4YDDB 2FGCA 3SDEA 2NUHA 2GMHA 1WTFA 2J8AA 1WC5A 2V8PA 4H0YB 1SUQB 3NMAA 4FNIA 4F67A 2VG5B 4IH6A 1RE1B 4N76A 2V34A 1N33F 2MSSA 4L72B 4OHVA 3ET6B 1N5VA 1FWKA 3VQ5A 1X9WA 1N5SA 4YB1P 2XYGB 1QUPA 1CULB 4OX6A 1S1WB 4W92B 4ZVQB 2KFZA 4CEEA 3NGSA 3DLKB 1TKXA 4YDUA 3WNGA 2CPFA 1S6UA 2QLXA 3SAGA 1WORA 4WYLA 2QM1A 4A48A 5AZIB 4DL6A 2JWNA 3NMUA 1KOOA 4AXIA 4FYWB 1HKAA 2K3KA 3M8QB 8ATCB 1RT3A 1HWIA 3JTOA 4CK3A 3ILIA 1VRUB 3OFEA 2DCUB 1MA9B 3QESA 4DV7J 2P9IA 3QATA 1HR0K 4CZHA 3BN4A 1QSLA 3TSPA 3CD5A 2O8BB 4O5FA 5CA5A 4FWRA 5GAGI 3QEWA 5AZJA 3MMCB 3K9KA 3SPYA 2QKKA 4LFCJ 3P38A 2YI1A 5GMEA 3M9MB 4HDHA 1NM2A 2KZMA 4IEEA 3VA0A 3S7RA 2U1AA 3KZBA 4U7UK 1SC6A 2CVIA 3WEEA 1WHYA 3W66A 3WX4A 2FSKA 2WRMA 4CYUB 4XAKA 1HRHA 3ZC4A 2LU2A 1SB6A 1DKGD 4IO9L 5KFNA 1RBUA 3G6EN 1RT4B 1SQKA 2W7PA 3EPIA 2CQCA 3V4IB 3THXB 4FS1A 4RNNA 1KVIA 1HBOB 3E1YA 1B99A 2V7YA 3HD2A 4ZPVR 1DQ8A 2CGLA 1NGDA 2OP5A 3NGDA 4OGEA 2GGPB 2HYIB 2XLIA 2RF2B 4O5BA 3K8VA 4YOVA 4H0OA 4WP3A 2BTFA 2HWHA 1SIZA 1KNZA 4PY5A 2B9WA 1RT2B 3FC9A 1KXPA 2NSCA 2ZH2A 4K0KF 4HTJA 5HRSA 1OSCA 2WB4A 4B1XB 3F9MA 1D5AA 3E9PA 2B8QA 4A5AA 1R8BA 3WT0A 2P9NB 4CLUA 1VK3A 1REGX 4DTOA 5IQQA 1W2BM 3CDWA 4FPAA 2CH5A 4XH4A 2MHEA 5E84A 3EZOA 4LSLB 4RU9A 5AFUH 3S8SA 3ZSVA 3QAEA 3VCDA 2G9OA 1YJNS 1RAOA 5GIPA 1X5TA 4C23A 4AM7A 5T41A 3FQKA 4UT4A 1RLCL 3R2CJ 3IBWA 4TLQA 4LMZA 4V19J 2B9YA 4ZVOB 3NH2A 3MMAB 4DQ8A 5KRSA 4FYYB 3DYAA 4OQJA 3LP3A 2HK2A 3ATUA 2GAGC 2Q3PA 2BKPA 4ED7A 5LJ3Y 3QIOA 3E01A 4YHHK 2IJNA 4BDZA 1EWRA 5SZTA 1XNRK 5J2NB 2R7TA 4CK2A 4V1Ak 1FFWB 3Q8PB 3D0HE 2QL5B 1OYDA 2JNJA 4BQZA 1S6QA 4MIAA 5GIOA 3DRPB 4YMEA 3GU0A 4WK3A 4QW9A 3W9IA 3N9UC 1S12A 1WOPA 2RIJA 3K0SA 1O8BA 4ALZA 4ECQA 2I0XA 2OEMA 5KFFA 1S6OA 2D3ZA 3A8JA 3MM5A 4LUBA 2VODA 1SJFA 2J0WA 1QM9A 4K8RA 1M1GA 5F8GA 2RS2A 1ITPA 2E88A 3SBGA 4EAHD 3AGRA 4ZPBA 2I7PA 4M41A 4B3RJ 4DTJA 4DR4J 5HSPA 3RUBL 2HWIA 1TR0A 3E9OA 4TQRA 4FLZA 1FKPB 2LP4A 4LD0A 4CEDA 1HQUB 4P6QA 4HTIA 1U1RA 3I55N 2FYXA 1VQLS 1WKJA 3ENBA 1WF2A 4DR7K 4LBIA 3PSIA 2RUSA 1DURA 3BDPA 3AGKA 2BABA 2OFGX 3B8HA 1S7HA 3SK3A 3UN3A 1CJTB 1NJWA 2WZ1A 1XEZA 3M6UA 1NNEA 3OHBA 5F8NA 4CTAA 2X78A 4CWBA 4JI1J 5ELZA 2R7SA 3CIPA 2KO1A 2YNFA 3EE8A 4DTXA 1VQYA 4KKOB 3HT3A 3AQOA 3OXFA 1M1KT 3H5XA 4MO4A 1X4GA 2LA6A 4LRFA 3D6MB 4JAXA 1N5YB 3F5TA 1NGAA 4ERDA 2FVRA 4WU3A 1R8PA 5KFDA 2NRHA 2RS8A 3VAIA 1E6VB 2B7CB 4UY8T 3VQBA 4RL1A 3P49B 3JSBA 2GQCA 2OGUA 3BB5A 3KD1E 4KHNA 2HHUA 1XHXA 1FW6A 2VOPA 1HX1A 5IT4A 4ZP8A 1FJ7A 2UVVA 2LQ5A 3HHLB 4EI2A 1WOQA 3CCZA 2MZ1A 1F21A 2HMIB 4WYWA 3M8QA 3G71S 1NXIA 3E8OA 4GW6A 4L74A 2KDOA 1W7AA 2CQ3A 3ZYYX 1HR0J 3MMVA 4NLCA 2XM3A 4H4MB 3U27A 1GLEG 5KPZA 4ZLLA 1AT1B 1LEOA 4QS9A 2LEPA 3OYHA 1VFJA 1BXNA 1Q16B 4Y34A 3BKUA 1U0SA 4O44A 6FDRA 2APOA 2RD5C 3O1LA 3MR2A 4Y1CA 1S9EB 1YVNA 1RHMB 2RSQA 5B09A 1TU0B 3NDKA 3VGVA 3VAGA 3WEEB 2YX7A 4P73A 2DNQA 3OXLA 3VQEA 2QA2A 3ELHA 3NRBA 1S22A 3PCOB 4OI0A 3S1TA 4I69A 4YS2A 5E33A 2Z4PA 3GSIA 4G1QB 1MN9A 2ATCB 4QZVB 4C3KA 5HP1A 1SL0A 3TAFA 3K2PA 4I2QA 2AYGA 1W26A 2DGOA 2H4YB 1QY7A 4DQRA 1NO8A 1NK7A 4LQ9A 2V4RA 4CJQA 2AJFE 4KH4A 5HROB 4B9VA 2QLWA 4WKYA 3OLBA 2NRRA 3Q7CA 4LF7K 4GC7A 4TY8B 2AJ1A 3VZHA 2HBRB 3O3HA 4F4XA 5LOQA 2EFPA 4DPWA 1HPZB 3ISND 2PO4A 2X3GA 1N0UA 3LDQA 1DFDA 3L8BA 4BCAA 1J53A 1RCOB 2W2OP 4CRJA 1HBMB 4ZJQA 2N4CA 4EYHB 2RDJA 3ZTSA 3PHTA 1MWKA 2QFJA 1KAYA 2LDYA 1H6KX 1IG8A 3ITHB 4IBNA 2W2MP 1PAUB 3H4BA 3CCUN 4AL5A 5AT1B 4B1WB 3CJ4A 1RTJA 1V9OA 2G8FA 3VQCA 3I56N 3WQUA 4NASA 2G13A 1BE4A 1F2GA 2HFNA 4Y3CA 1AROP 3C14A 1Q82O 1HWKA 1QUVA 2XNQA 2V52B 2D9PA 1RHUB 3RBEA 4YP3A 3BV8A 3SBMA 2QA4G 3Q8RB 1NBWA 2JRSA 1ZC6A 1UVKA 3AY9A 1CVJA 4RBTA 4BDPA 4YB7A 4JI6K 4DV2K 1SQGA 5E5NA 4DR7F 5KFKA 2JLEA 3DC2A 1X5PA 1TL3A 5ADZA 4AHUA 3MCSA 3C15A 4DV4K 3WZ0A 4BG8A 2VJUA 1DEJA 1ZM9A 3BBFA 2VPWB 1Z4UA 3G0ZA 4DN9A 2KRBA 4R5PB 1VQNS 1MW7A 4OJ3A 2DTUA 4G3IA 4K4SA 1OQ6A 4USMA 2LA4A 1QDUB 3MX2A 2HSEB 3D4JA 3W62A 4BS2A 3GG4A 2QO3A 4GV6A 1TL5A 4QIVA 2K1RA 3O4WA 4DX6A 5AQHA 3OVBA 2NYHA 3IBCB 3QIPA 1SCJB 3CO0P 4IDKA 5HQMA 2YWEA 2CQ2A 4E98A 1L3UA 3POTA 2XY6A 1YVUA 3C15B 3NKYA 2DB1A 4GVBA 5I3UB 3H7HB 5H9EJ 4PRFA 3SAHA 2MJNA 4Y65A 4FKXA 4DU8A 3OYGA 4LF1A 1FJGF 1YTUA 2D0OA 4CJSA 5KFJA 5JLFA 2ZOFA 3S3MA 4EZ6A 1Y4ZB 1P8GA 3VAKA 1NLKL 4PCQA 1FWLA 3K2YA 1YTAA 2D0AA 4KV8B 1YIJS 2QTDA 3TVZA 1RT1B 5JICA 2AU0A 2GTDA 1VQPN 5AQTA 3FFKB 1SV5B 2HHHF 4LF7F 2ZBIA 2MJUA 3VQTA 1RWNB 4NLPA 4JYAJ 4ETXA 5BXIA 7FD1A 4DFKA 3IG1B 2DD8S 4CZFA 2CJQA 4DUYJ 2BANA 4NYPA 1FDBA 3GIRA 5LXYA 5J1EB 3RB4A 2B8PA 1UEVA 2ZH3A 3D1HA 4LF2A 1E6YA 5LT5A 2J9CA 4PG7A 1TKZA 2L08A 1CPZA 3A1YG 4K25A 3QBCA 1N8RO 3ULHA 4BRQA 2D4WA 3L2WA 3HVAA 3PIOQ 1RWOB 2QA4N 3SI6A 2YWWA 1XR6A 3I5BA 3AQPA 3AAWB 2XTJP 3D3CJ 3W64A 4FYDA 1LW0B 1WWHA 4UUXA 3RRKA 3HPOA 2O4GA 3H5UA 4B3TF 1EP4B 4ZVEA 2IDLA 5IWAJ 4NCAA 4O4GB 1QAIA 4OI2A 3SXLA 2AT1B 4UOFA 4FP9A 1UZHA 3PEJA 1RP5A 3SEOA 3PHEA 4E89A 4LF6J 4JI7K 2J6UA 3TTDA 5LMUJ 1OJ4A 4DR4K 2HHQA 2FHJA 3GZ7A 2MQLA 1IKVA 1S1WA 1YJ9N 4X66K 1S1XA 1GMVA 3R5CA 2W2QP 4H5NA 1WSJA 1GFWB 3AVAA 5A8RB 1IR0A 1EKEA 4OX9J 4I64A 1T9VA 3IO1A 2HVZA 3ENWA 5GVQA 2NPIA 3OW2R 2HHSA 3V9SA 1QVFR 2M52A 1T95A 3PW2A 2GFFA 4K2XA 2MKHA 2VYPA 2DHAA 3P5TL 3IGNA 3AA4A 3FBEA 1C0TA 3VTIA 1FRLA 1FXXA 3CWJA 5ETOA 2E1MC 3FR0A 4USHA 3NCRA 2KB2A 1FO1A 4NX9A 5BPLA 2DGXA 4TVAB 5AZJB 3I9V9 1XNRJ 1CJKB 2P5VA 4DPYA 3EKSA 4BG9A 2O1PA 2LDIA 4IOBA 2ZD1A 2P6SA 2RQCA 3DGPB 1CJKA 4ZTFA 4CD3A 5A0YA 4CJWA 1F60B 3W5XA 4IG3B 1VRUA 2RRBA 3NS6A 2UXCF 2NQPA 4M94A 2HBMA 1HYZA 3J80U 4LREA 2YHYA 4M5IA 3IR5B 3O4NA 1IBKK 5KFCA 3CDAA 4GNIA 4DG1A 1NGIA 5F0XA 5ADXH 3FGVA 4GO5X 3BPSP 3ZZ0A 4IUFA 4ZVGA 3L9ZA 1CULA 1WD6A 3J81j 3RAMA 3KKRA 2UV8G 2W4CA 4C1NK 2RRAA 4G65A 1SH3A 3LP2B 2A42A 4Q43A 3N0VA 1QAXA 5DGAA 1YVFA 1X4EA 3PYEA 2Z1GA 1HBNB 2IBOA 2R7VA 1FFSB 3UPFA 2GS8A 4DV3F 1S72N 4WKRA 4RBVA 4LH4A 4MT1A 3FZHA 3DRRB 1E4FT 3T6BA 3PFEA 3AV9A 3ZX2A 4B9SA 2IM3A 3O5BA 1SC4B 5JMNA 2MY7A 1S4EA 1WB9A 2BRKA 4P2SA 4CJ3A 2G2YA 2HNZB 2HLUA 3N5FA 5LJWA 2XCAA 3KMSA 2OPQA 1VSIA 2X1FA 4MDAA 4ILGB 4E7HA 3QT8A 1CJUA 1QVFM 3GIKA 2XLKA 2EFNA 3M8WA 3RBZA 3V81B 1LAVA 4YR0A 3IM9A 1RAIB 4P2XA 2D9OA 1IKVB 3UR0A 3LGMA 4E19A 1S0MA 5DGBA 4EZ9A 1FTRA 3OUYB 1IBMJ 5HJXA 4FZYA 3W7BA 1APSA 3HVTB 1SKUB 1VSFA 3O6QA 3X3UA 3SSRA 2JEIA 3EX7B 5HMZA 4F4AA 1JLQA 1GLFO 3AO3A 1R7IA 2YKQA 5F9NA 1T03B 2DR8A 3G96A 4WBFA 5M1QA 1JLEA 4DTNA 2O8FB 3EVWA 1HFEL 3I5CA 2DNHA 4WP8A 3HJFA 5GAGU 1ZXOA 3MDFA 2KZZA 4ANDA 1N5QA 1AUSL 2OPPA 4EHTA 4CNZA 5F8MA 4DLGA 4X84A 5D77A 3HF5A 1JLFB 2HNZA 1AFIA 1SC1B 3ZEUB 3CMAN 5M2PA 2AEMA 4Z4EA 2KH9A 3LAMA 4PG8A 1Q8LA 2HBJA 4DR3F 4CIEA 3FCHA 4IG3A 2ZE2B 4ED1A 4IH5A 4USIA 1NKEA 8RUCA 5CR4A 1J5OA 1LWFB 3O9TA 1PYSB 4QIWD 5B0CA 3FK4A 1QLNA 2DPNA 3A5LC 4JRPA 1XR5A 3NOGA 4A8XA 4AHTA 2ZHOA 5FPDA 4KH1B 1URNA 4UOGA 3WXKA 1VQ9N 4F3OA 1UKUA 2AGQA 2OPSA 1JLQB 2YKNB 2BH1A 5AE3A 1FE4A 1ZA1B 3LA0A 2ZZMA 2Z2YB 1U48A 2JC1A 3OBIA 2VOOA 1A7GE 2EKNA 3HVTA 1GLAG 4C2MA 4CGHA 5AQYA 4NXMJ 3MWTA 2P2CB 3FRZA 3L95X 1N36K 3KYLA 3DMJB 1FA0A 2RH3A 5ETSA 3PLAA 4EEYA 2AF6A 4HL9A 2VHGA 1YZ6A 1REVB 2XS7A 3OA9A 4F8RA 2M8HA 3KHYA 4OPAA 3PUFA 1VQPS 4BRCA 1RHKB 5B7WA 2DH8A 1RYRA 2PMWA 2ZC3A 3IFRA 2RRNA 4OYIA 2QKBA 3DOKA 2E66A 4JI8J 3SMZA 3DXMB 2WOMA 1HQUA 4F36A 3CJ0A 1Y5NB 2R7XA 3D2WA 1NJIT 4KO0A 4KY3A 4Z0UA 2PZSA 1N4LA 1HNZK 3THTA 4GV3A 4FPIA 3HHLA 1JJ4A 2QSWA 2PYJA 3CTRA 4BC2A 1HHTP 1K44A 3C16B 4HTLA 1KN6A 3PEHA 1KR4A 2NRZA 4QJVA 1Z25A 3AVBA 1KHVA 3ZO7A 3OTDA 1KS2A 2XWXA 2HFOA 4Z4CA 4OIXA 1Q18A 1UVMA 3W63A 4DUZJ 4DFMA 2QMWA 4DN0A 1IBKJ 1VGYA 2M7SA 3PX4A 3NCPA 4CJLA 3CJKA 4KAZA 4CECA 3CJRA 3H20A 4DTRA 4BRKA 5BR8K 1RT1A 3BPDA 2KHCA 1VQ4S 4BVOA 3OL8A 1RADB 4ED0A 4M5MA 4AQYF 1M5HA 4J2EA 1GXTA 3PO4A 4CH7A 2HPUA 3QBXA 4NOHA 3PYDA 1UFKA 2QXFA 2V0NA 3DWLA 2NS1B 3C7NB 1S1TA 1S79A 3FSXA 2YWHA 1ITGA 5IV4A 3QT6A 3L7UA 4F4ZA 4M7XA 1IKYA 4KSEB 1AZSB 1UVLA 4B3MJ 4WE1A 3CNQP 3R8EA 3LPTA 4H5WA 2UXDF 2KVIA 2ZC4A 1N8RT 1TZ0A 3CDEA 3EYZA 4ECSA 3K5NA 3V81A 1N54B 1FERA 3ET6A 1FFGB 2AV5A 1HUXA 1R6VA 3G25A 1RDWX 3H46O 1X31C 4NA1A 4LF4J 3HD1A 3DFEA 2ZM6K 2HMPA 4DX7A 4TU8A 2B4OA 4WQ4A 3CERA 2JGUA 1WBDA 3TW0A 3T7ZA 2JVOA 3V5RA 4FJ8A 3MR7A 1CZBA 4X64K 1ASWA 1DJ0A 4BGAA 3C6HA 3M8ZA 4BR2A 2OJ3A 3D2EB 2VQFK 1BIUA 3DRSB 1YQHA 4UOHA 2HBZB 1N33J 5CYJA 2YH1A 5LY3A 4JI0K 5AQGA 4AYBD 1OPZA 2POKA 3CC2N 3HYFA 3C6UA 2HBLA 1UJ4A 5D3GB 2HFZA 1NHUA 5H1SV 4FOEA 1NK4A 3GCWP 1JMTA 3PIPQ 4DF4A 3MPUB 4OFZA 4I0WA 3AVFA 1PG5B 3S01A 3QDKA 3SQOP 4IR1A 4ZOSA 2KKZA 4M5LA 2VQEJ 3KFWX 1HW9A 3MR3A 3BGOP 4RNFA 4RNHA 2HVIA 1G3OA 5K8PA 1BIZA 5AQVA 1N6QA 3CPWR 5CD4A 3LO3A 3G6VA 3ZTPA 3HHEA 3AVJA 5AQMA 4CO1A 3G82B 5C25B 3M2VA 4CH1A 4ELTA 3CF5L 1EQMA 4DL0C 2ZH6A 3AD9C 2RDDA 2JFDA 1KQGB 1RT5A 2IOCA 2KRRA 1LWCA 5J2NA 1IN0A 3NGIA 3HCXA 2ZFHA 3GILA 4J7CA 1TUWA 3Q83A 3D67A 5C5JA 5CYQA 3SUNA 4QR0A 5ETTA 5JXSA 4DR7J 1ZZNA 5A2QY 2ZD1B 3IC1A 3KHGA 3KLFB 1UWBB 2BVZA 1WTBA 1S3XA 2D1CA 2GA7A 1S77D 2JEFA 1LKZA 1FRIA 1FDNA 4QS7A 4DSLA 4ZVUB 1I3AA 3PO5A 3AOAA 5SWMA 2ASMA 5BJRA 1R8HA 3LP0A 4PWWA 1ZYQA 3VA3A 1FEHA 3QFPA 2OTLN 1GTEA 4WTYA 2VFRA 5KGXA 4FK0A 4IDHA 1YDLA 1WC6A 1ZA2B 1IM6A 2KKHA 2P9CA 4M63C 4OX9F 1YJ7A 1S9FA 2VQFJ 2AEJA 5BRDA 2FZKB 4NLBA 3NVMA 4CIGA 1CSJA 3A4TA 2XLJA 1X3MA 3OVSA 1G15A 2QLJB 2P9KB 5K8NA 5GAHI 3FE1A 4LF4F 2VPZB 5EUHA 2YNGA 1RHQB 2OLWA 4LF9K 3UE2A 1HJRA 1KVAA 2DNOA 1Q79A 4NCGA 1PIEA 1KC8T 1HLWA 1OH8A 1VDHA 2R8JA 1VBKA 1ZBIA 3C94A 2DY1A 1DTTB 2K2PA 2AYMA 4PQUA 5KT5A 4DSKA 3TRGA 2J9EA 3SQGA 4A57A 2Z30B 3G8SA 5F41A 2GX8A 4H03B 3I0SB 3SAFA 2H5JB 1IBMK 4NZ0A 1ILYA 2QV6A 1OO0B 1S5JA 4J91A 3L0QA 5TKWA 1CLQA 1HI0P 3CPWM 4AQYJ 4PUOB 3QQCD 4LF5K 1EARA 2HIYA 2QLFB 2JVRA 3MXHP 2WBRA 3G8TA 3MMBB 4ZLNA 4L8RB 3A5NC 1RTHB 1UA0A 4LSLA 1LAWA 3RAQA 5J1EA 1FRJA 3FBFA 3OFHA 3O1BA 4AL7A 3U1MA 4PQUB 1U1KA 2ASPA 2HHPA 2GIFA 1J2VA 5IT9U 4I6WA 4B9LA 4NE9C 2GO8A 4F02A 1BI4B 2V4JA 2VFVA 2UUCK 4KREA 3KJFB 4A8FA 2K7JA 3IG1A 2RHKA 2MZJA 2VFTA 1BL3A 5DM7Q 3DYAB 1LWXA 2F63A 2JJ4D 3T6JA 4DU7A 3G6ES 1ZPWX 3AA5X 3MGJA 2BOAA 1IR1A 4JBCA 4CE9A 4F2RA 3EZUA 5H9FJ 3EE9A 1PGZA 2I9SA 3P31A 2BEFA 4ANEA 3P1GA 4HLBA 1Y11A 1HMVA 1VR6A 4NLRA 4E0DA 4M5NA 2I1RA 3BKFA 3ZSQA 3M6VA 3THYB 3KJNB 1WSEA 1QAYA 3FMBA 3L4IA 1VSJA 4I2PA 2EHGA 4C8KA 4URQU 3NG8A 3V6JA 2IYGA 4LR9A 4JHDB 4M42A 1ZS6A 4DHYA 4CT8A 2O8DB 2HAIA 2P5OA 2F8HA 4CO0A 3CJ8A 2R7OA 3GIIA 2E5LF 3B8AX 4UUWA 3V4MA 2HZVA 1VQ4N 1H72C 1YI2S 2COLA 4QU7A 2CJXB 1FDAA 4MKVA 2IVPA 2DGUA 1S10A 3WXJA 1IQTA 1DAXA 3JS9A 3BO3A 2ZJQQ 3FKBA 2LVWA 3DGPA 4AT1B 2P9SA 5F8IA 4Q8FA 1YX2A 3OW2M 2FTRA 3AXKA 3D2EA 1XBWA 4OJRA 2ZKTA 3CMES 1NMDA 1FRMA 2XY8A 4B3SJ 4Y2IA 3M2RB 4PA1A 4QBUA 4O4RA 2MZSA 2YX6A 2YXLA 2QXLA 2PYLA 4M7YA 2BV3A 2AMCB 4NYOA 2KM8B 2VA3A 4KKOA 1U02A 5J2MB 2ZNZA 1WC0A 3K5OA 4I6MB 2BX6A 3FRYA 4RBUA 1HKGA 3FBCA 1IKWB 2Q0UA 2P9LB 5BN9A 1RA7A 4WU2A 2ZJQL 3NWRA 1K0VA 3JSRA 1PYOB 1GLDG 1FX4A 4ID8A 4ZKAA 4EBEA 3P45B 4HDGA 2OD6A 3SLCA 3CJTA 5T7LA 4WFZA 5FROA 3VZIA 1N34F 4DOZA 5HVHA 1K47A 5B0BA 4H5TA 3NP5A 3LDLA 1KLMA 1LW2A 5CD4H 2BQRA 1WEZA 4TU9A 4RJVA 2IIHA 4KC5A 4M5GA 4CO4A 3GYXB 1NK8A 3GFYA 2DEIA 2PEHA 3VF0B 4IEIA 1SL1A 4DG1B 4HI1A 2B4PA 2D0PA 1NGBA 2LQJA 3P6YC 1K73T 2AKWB 4DCJB 3NGTA 4A2BA 2GIRA 3VAMA 2Y1IA 4C0OC 1YBAA 2AJ4A 1D9DA 3VMFB 2R7YA 2IC3A 1RABB 4RUAA 2H48B 4M5HA 1U0HB 3TANA 1CC8A 3CCRN 3TUPA 1NEEA 2GNKA 2Q97A 3U3YA 2MKKA 1WSFA 4LFBJ 3O4QA 4HH0A 4DPUA 2D1KA 4NXMF 4F3QA 4CHPA 2MY8A 1LOTB 3UO0A 4M45A 1HKBA 1SL2A 2FD2A 3UVJB 3D0PA 1HYVA 3DXKB 3I56S 1QQMA 2A3ZA 4HUGA 3NAEA 4DV0F 2DXEA 3FLCO 1KHWA 4I67A 1BUXA 3MM6A 3NAIA 4BDYA 1DTQA 2XMWA 4A8QA 4Z4IA 1B0PA 4P7TA 4ZMMA 1WBBA 2F4VK 3PRVA 5I42A 3E3XA 4B1YB 4OPJA 3D2FA 3ZZYA 3C2PA 2PA3A 2EG1A 2ZVSA 3H2UB 3S9HA 4KH0B 3VQQA 2V67A 4IRDA 3IN5A 2CDRB 4FCYA 1W2BR 4FJLA 3KLIB 4DR2F 3NE6A 4PUOA 1AA1B 2HS0A 3WXIA 3HXMA 1NH8A 3DRPA 5GADP 3EMTA 5F8HA 5BPMA 3TJAA 3EJMA 5GMKa 4O23A 3V6DA 3KLEA 1XI1A 2M3DA 2L41A 2HNYA 3CG7A 3CB4A 4QAGA 1JKHB 5I3QA 5KT2A 2Z56B 4H0VB 2O8EA 1I6JA 3ENHA 3C65A 3D9BA 3ILOA 2WFBA 1VQ7N 4NYZA 4ZPTR 2VKRA 4KHQA 2HHWA 2QK9A 4LVOP 4LBHA 1LFPA 1X4BA 3PACA 2BJ3A 3MURP 1WSGA 2CQGA 1UWBA 3VQ4A 3P3DA 3ID6A 3AXMA 3NY0A 3NL0A 2IVYA 2VG6A 5EDWA 4MKBA 3TX8A 2DNLA 3OL7A 2ZJRQ 3LZJA 4NLOA 2F7TA 3HULA 2GMJA 3G82A 2EPIA 1SKSA 3G10A 2JH3A 3MM9A 3O1WA 4L73A 3OYJA 1WOOA 3SFGA 3HX9A 1IKXA 1K8AT 1WNSA 3DJCA 2P9GA 1IJJA 2D3O1 3VGKA 1Y3KA 4C6AA 2YKMB 2Z1HA 4NMXA 4DR5J 2GJFA 1TKTA 3Q7BA 4IRKA 4OPHA 1PKUA 3GJQB 3G6XA 4LF9F 3RZAA 2VDIA 3HFZB 2FVCA 3VEOA 4OYMA 2XHBA 4RW8A 3SUQA 1I51B 3TOQA 4LY7A 3QJJA 4J5OA 2E2OA 1VQ5N 3H08A 3C16A 4IFYA 2HGNA 2FZGB 1MSWD 4PXBA 2QA4S 4IG0A 1ACMB 3M8PA 2GMLA 3TAMB 1E3MA 4PL8A 2WVEA 3GYGA 3I0RB 4DV1F 3PXGa 4F3TA 1QQOA 5IT9Y 3VQ6A 1B70B 2WOMB 5KFXA 4P10A 4DR6F 2ATQA 2E2PA 2A2DA 4QWCA 1Q9XA 1ZBUA 2P9PB 1GOCA 2JLGA 4DTSA 2CQHA 2GBZA 2RJZA 4OV1A 1YF5L 2VBXA 4LBPA 4JKHA 3QGPA 5MLCV 4DPOA 1REVA 4RKUC 4TKTA 2Q79A 1V5VA 3D6TB 3MMCA 4NXNK 1Q78A 1ELOA 1R59O 3CUNA 4IWVA 4B8CA 3OYFA 2HRYA 2MPUA 4MIBA 1EX8A 1UFWA 3I4HX 3NF9A 2B3TB 3IAM9 4J9LA 4JKEA 3UE5A 4HUEA 3QWPA 2PA8D 3GFZA 3V9UA 3QNNA 1FEEA 1U1OA 3GFHA 3D2FB 3C0BA 4GMJB 4WIQA 4CF9A 1U25A 1VQ8S 1R8AA 3DLEA 1HHSA 2DGSA 4WQ5C 2W4PA 2KYXA 3Q0AA 3QZ8A 1KVKA 3H3NO 4CEBA 2DY4A 2NREA 4DR5K 3T9NA 2DT9A 3CQXA 2R8KA 3AT1B 2XCPA 3CQYA 4FSVA 4CQ1A 3P5JA 4FDFA 4FLVA 1IKYB 4C8NA 2ASDA 4FOIA 4CYUA 5HK4A 2RB7A 1YGYA 2CQ0A 3B54A 1T11A 3DNCA 4CGJA 1KAZA 4Q0BB 4RCHA 4RU2A 4IH7A 3NBPA 1JLAA 7FDRA 2J4RA 4QR1A 1NK9A 1VIOA 3LOUA 3IWLA 5FD1A 3JXOA 4R25A 1JLBA 2WUSA 4IOAL 3BZKA 1ATNA 2Q43A 1LXJA 3PDNA 1LNQA 2IRUA 2KU7A 1D9AA 2N4DA 3F44A 1WHWA 4X64F 4PPDA 4RWTA 1CJVA 1NKCA 3TA0A 1T44A 4WE1B 1WI6A 4F3MA 3VF6A 3OT9A 4EP4A 4JK7A 1RTIB 3OL6A 4CBUA 4M3UA 2D3UA 3TWZA 1WG1A 4ZCMA 4QWDA 3MXJA 4U8VA 5C12A 5HAOA 1NSKL 1S76D 2ZH5A 4JLHA 4DZ6A 4AILC 1KEKA 3L4QA 3CFOA 1D09B 1PC5A 5FLXU 3HDSA 3KUHA 2FJAB 4JI6J 3RMAA 2B5JA 4B08A 1EB0A 4AHSA 4CLZA 3VETA 1I94J 3GLJA 2A18A 2EW9A 2VQEK 1IKWA 2V5HG 4YFUA 2AP1A 3DU5A 4OPKA 5AXNA 3FZLA 3MTJA 2NR0A 3P83D 1F5CA 3OR1A 5A8WA 3CHWA 3MAHA 4F50A 4DMNA 1D3WA 3OS1A 4KE5A 1BO5O 3L2RA 3CD6N 3OYIA 1T9YA 3QT7A 4O3QA 4Q44A 2CZ4A 4K4UA 3QRRA 4DF8A 1JQGA 3VGTA 3A2FA 4F0HA 1WG4A 2YWKA 2YKMA 4DR5F 4H8KA 3LPUA 3GYNA 4FWQA 3BH7B 3RWUA 4DJBA 2H54B 5AR0A 5E2QA 4BVPA 4LF4K 4OYWA 2HVEA 4NLTA 4J90A 3MMJA 4B8AB 2V7ZA 2GEMA 4A61A 3CXCM 3T1HJ 1X9JA 1L3TA 2Q1NA 1XIQA 2KM8C 1Q86O 4FM1A 3LP1B 2C28A 3KK2A 3BSOA 5I42B 3BH6B 4RNOA 1DTTA 4AM6A 1RWVB 2XI3A 4DQIA 2VCPA 1QS4A 4W5RA 2ZH8A 2M70A 2PI4A 1BUPA 2DGQA 4YOYA 4OHYA 2BJ9A 4GKKJ 3ALYA 2HNYB 1UW9A 1XERA 4X66F 3QEPA 1D9FA 3S3NA 2KHDA 5EX0A 3VERA 1N5TA 5D4PA 5CABA 2YNGB 2FC9A 3DXKA 3AVGA 4K8XA 2B9XA 3H2LA 3BF3A 1K8KB 4BHQA 1N56A 2HHXA 2BBEA 1W25A 2Q6CA 2LFVA 3HHDA 4DSIA 4NRUA 4NPOA 4KB7A 3CCJN 3IM8A 4ZPWR 3W3SA 3SQ2A 4X65F 2AIRB 1R43A 1R3NA 3TA2A 1N34K 3LGHA 2ZH1A 3CCSS 1HA1A 2WC9A 2HURA 4LJMA 3H40A 2RUGA 4K4TA 5JVHL 1NDPA 2BW2A 1IKXB 1XMOK 2KXFA 4DL5A 2DPIA 3UFCX 1YITS 2F9DA 4NI2B 1ZTWA 1RYSA 5F9LA 1G99A 3OFFA 1U49A 1BU6O 1RI7A 4KPYA 5KI6A 3T19A 5HRRA 2FSJA 1LWEA 1ULRA 5E26A 4ECWA 1A6LA 5DG8A 3HZ6A 1VQSA 2QA1A 4LR7A 3M6GA 2GUIA 3TR5A 1SJQA 5B0AA 4G1PA 2RF2A 4GC6A 3D68A 4IOCL 3OR1B 1DQAA 4NO7A 4L3NA 3RGIA 5DDRC 4Z4FA 4ZTJA 1F9HA 2ERRA 2Z2LA 4Q5VA 2C2KB 4BR7A 1E6VA 2XI2A 2LQBA 3GR1A 1C0TB 4RW4B 4OI1A 4EYIB 2XO6A 4BACA 1ZM4A 3OS0A 3MPYA 3AO1A 1S49A 3RSEB 3W2VA 3I0RA 2F8TA 1IXKA 3OHRA 3TTCA 5EHHA 2XWYA 2G8WA 2ETJA 2LEBA 2ITGA 4GV9A 4W5TA 5IV3A 4JUZA 4UTGA 2N82B 4KQZA 5DQGA 1QE1A 3G4SN 3EO3A 4NLUA 4YUDA 2F4VF 2NXUA 2MMYA 2E1RA 3TA1A 1XMOJ 1A5VA 4AHCA 2GWJA 3LW5C 4Y1DA 2VWBA 1VYAA 1P9QC 1Y9OA 3K5MA 3WBZA 5L8RC 4CZJA 1QHTA 3U3GA 1N34J 4QYZK 2AGOA 4FPRA 1BCOA 1T6DA 1FESA 3RMBA 3TEHB 1YSJA 1JXVA 2MHNA 1BQMA 5EWEA 4Q8EA 1YJWS 3KLGB 3AVIA 1N36J 2XBPA 1ZTTA 2X1BA 1JNRB 3BR9A 4YR2A 3DDNA 4N47A 3P8BB 1GMWA 1HLUA 4MTPA 1WSIA 4PYDA 4NLYA 5HBMB 2WW8A 4X65J 4Q2MA 1YJUA 2GVDB 4CEOA 3KDOA 3KIOA 3MN7A 1H74A 5CYMB 1T3NA 1TAQA 2ILZA 1ZH5A 4AE5A 2R8HA 3LALA 1V3RA 1RWWB 3OR2B 2SXLA 2ZM6F 3VGMA 2EWHA 2DGTA 1HNVB 1TK8A 2PIIA 1P6TA 1WSHA 1RBLA 2Z8QA 4JI8F 3NFAA 2HMIA 1SQFA 2A6AA 3ICLA 2CJBA 4K4WA 1Q82T 5EY4A 3R97A 1Q5YA 4JNEA 5GAHP 2WVCA 1Z26A 4CO2A 1O51A 2O67A 1RWUA 4DUYF 3FFIA 3CCQS 2HQDA 1OWXA 4OZ0A 3JTNA 2QEXN 1RHRB 4KGMA 4ZHRA 2W2PP 4FJ7A 1LK5A 3LANA 4JI3F 2YKAA 4OJHA 2MKSA 3HM9A 4CM0A 4RNMA 3U7JA 5JS1A 2WONA 5KT3A 1YG0A 3DOMB 1Q95G 1VSKA 2RQKA 1KTQA 2V9WA 3EVMA 3QIPB 2JC0A 3JQKA 1U24A 3AHPA 3IMXA 3UQSA 4A62A 3NNAA 2CQPA 4JI8K 3HKZD 4M5DA 3DLJA 4J9OA 2BJ7A 1QHAA 5DLGA 3V4IA 3THXA 3DN9A 5BR8F 4CVNE 1YRTA 3DGVA 4G1QA 1AB8A 2Y8WA 3H59A 2EFGA 2YX1A 1NRKA 5IOLA 1Y3JA 2UVWA 1O0PA 4DTMA 1T3OA 3AJ2A 1VRTB 1BQNB 3QBWA 3N4QA 5D0EA 1JNZB 4BRNA 1E4GT 5LMUF 1V6HA 4D3HA 3MM8A 2M5YA 5K8MA 1M5OC 4DB3A 4NLDA 3T5HA 5DM6L 1GEHA 2AZ3A 1KD1O 3VV2B 1VSHA 1Y10A 4DR4F 5E3QA 3OYCA 3R2DJ 4H0PA 1X8DA 1NNDA 5L39A 3NF8A 3OBYA 2ZITA 2P9IB 1KP6A 1A5WA 1OIAA 1AYEA 3ZSRA 5AXMA 2G2ZA 1FJCA 1EX4A 5D78A 2E5LK 2E7XA 1FXDA 3NGZA 3NXZA 1RDUA 1ZBSA 1VQON 4FZVA 2YKNA 4KPCA 2FDNA 5A2QU 3GV7B 4M3TA 2XULA 4JV1A 4KJIA 4JI4K 1NJXA 3ATVA 4MLHA 2VGMA 4C3LA 4KR0B 2LMIA 3R3TA 2G8UA 1DZ5A 4DV7K 3DRXA 5A6WA 4LH5A 2O3DA 4LF5J 1B92A 3AJDA 4X4OA 1ROFA 3CEDA 3RAXA 1RBAA 3VVTA 3IFEA 3RR7A 4KHPK 1XUPO 3BQ0A 1SI9A 3BP8A 1PAEX 4P71A 3UR3C 2QFIA 3M32A 5CAAA 1F2HA 8AT1B 3C95A 2C2MB 4IKAA 5KFIA 4CF2A 3QETA 2OPRA 2JZ5A 3HT0A 3KUEA 1IG9A 2VG6B 3RBXA 3W2WB 2BJDA 3OJUA 2UUAF 3OTCA 3HM8A 3HHNB 2M9KA 3B4DA 3SMPA 4X62K 2KXHA 5I3UA 3J8AA 4O8UA 3TZWA 1RTDA 3T1YF 2V63A 5K5MA 1EIYB 3GG1A 4I7FA 3O9RA 4DZDA 4P74A 4H54A 1AUDA 2UVUA 3BN7A 3TAMA 1FTCA 2ZJPL 4DV2J 1TUVA 4Y0WA 4USVA 3AOCA 5M1FA 1M1KO 4CJ4A 5D0HA 1Q86T 1C4AA 2EK6A 1NK6A 1JCFA 2V4QA 4JKDA 4N8NA 1JKHA 2ROPA 4NEYA 2OD4A 1U1LA 1RTJB 2YVSA 4A2AA 5F8JA 4EBDA 2FJBB 5D15A 2QE5A 3GTYX 4XK8C 1SKWA 2BQUA 2WAQD 1MROB 2KJWA 3JB9k 3OYMA 1D0EA 2YPZA 4E8UA 2RPIA 5FLXO 2E5IA 3HSDA 1U2CA 2IPOB 1JL2A 2ABYA 3ULDA 3NGUA 3TSQA 2OA8A 4LF8J 4JEPA 4IR9A 2YNFB 4Y28C 5KFVA 2V2QA 4YNQA 1DQ9A 2DHGA 3SDEB 3DMJA 2B4JA 3MCAB 1EXQA 1Y7PA 5A6PA 1RT6B 3W5ZA 1WKLA 3ZT2A 2F7VA 1KRPA 2G0IA 1Y64A 1FJGJ 1WI8A 3TZYA 2CG4A 4DS5A 2UYTA 1JWWA 1JB0C 1Q7LB 4BWJA 4U7CA 3AVNA 2KFNA 4FJGA 4USJC 4IJNA 3GMGA 4ENOA 3VF2A 3VQPA 2I8EA 1AFJA 2NXNA 5CHCB 3EICA 3R6LB 4NYFA 2KLAA 3I8BA 3FZMA 2GC8A 1S1TB 3M8YA 1JIHA 5GMDA 4UF4A 4BR4A 1EKSA 3JQJA 4F7VA 2MLYA 4WCEQ 2IM1A 3QGGA 1RJJA 4ZP9A 4GKJJ 4EFHA 1F6TA 3OTOK 4FN5A 2W42A 1KFDA 4ZDNA 4RW9A 3TX0A 1J5EJ 1C6VA 3K5PA 3O8WA 5L9NA 2VPXB 2VBWA 3P5BP 2EC2A 2H1YA 5L9XA 3S6EA 2PC6A 2W1BA 2YTCA 4ILMA 3S41A 5HOOA 3HHLC 2AA4A 1C1BA 1CJVB 5B0FA 3TAPA 2AWZA 1U2VA 2P9SB 3N6NA 3BR8A 2FVPA 1YJWN 1C0FA 2O01C 3HI0A 1TL1A 4LRBA 4ISFA 4Q7AA 3R5JB 2GJ2A 1RILA 1XNQJ 3X1LB 3QFUA 4J2DA 3QLHB 2G4BA 2QYCA 4I68A 5K14A 4M3ZA 4LIWA 2JLFA 2YKOA 1HNXJ 1VQMN 4Y2AA 1LOUA 1RT6A 1NM1A 2HRUA 3G71N 3BS9A 4MAKA 5M2UA 2YKPA 3LAKA 2HQCA 4KRFA 3GV8B 2VDHA 2Q6BA 5BREA 4NRTA 2VICA 3MUVP 2FF3B 5EOYA 5FDLA 2YPYA 3G8QA 2B7BB 1DARA 1FNXH 2LEAA 1RACB 2VG7B 3AD8C 5H9EK 2IRYA 1ATRA 1IBCB 3DCAA 1FRXA 3PNIA 2DR5A 2GVZA 4W4MA 3Q89A 1VQMS 2W41A 1WDTA 4DSJA 4RUCA 2FLNA 3W3DA 4CDIA 4WXWA 4JYAF 3VQDA 1L3VA 2GQ2A 4U6PA 3QFHA 4OVLA 4RTFD 1G2EA 1KLMB 1NB7A 4K2JA 3VGSA 4QIEA 3SJHA 3CCMN 4M3YA 5ETLA 3TUJC 5E41A 5CE3A 4CZCA 3J7ZO 4PKIA 1EETB 2CPJA 2E5JA 4CGDA 2AQ4A 4HHJA 3MEEB 5BYSA 3KNAA 1MWMA 2E9ZA 3L09A 3L2QA 1RFQA 2ATLA 3CD0A 2HW3A 2HHHK 1U8SA 4PG4A 1S1UA 2H5EA 2PY5A 4RLEA 3Q86A 1F9FA 4WF9L 2P9UB 4X62J 2EWSA 3KNGA 4BC3A 2W01A 1WEXA 1JLFA 1FVSA 1BWVA 1Q4RA 5CZXA 4B3RK 1TFYA 5L1KA 3I4PA 4J9KA 3TVKA 3DLBA 2BW7A 1HBOA 2YCHA 1TVRA 1V3SA 1IWGA 2MKJA 2AYBA 1FD8A 4CJRA 2IJRA 1QAJA 4DUTA 2Y9HA 3CCSN 3RBDA 4XEIA 3R1LA 2P1JA 4WFNL 2OCEA 5IXUA 3TSUA 1HPZA 4P2FA 3A5OC 2OMOA 1L5UA 3L3UA 1UJ5A 1FRKA 3LWMA 3BUZB 3VTHA 2DKOB 4CFDA 2G0JA 4M63A 1IUJA 3G86A 2P9KA 4TY8A 1KKHA 2FHMA 5AE2A 1PJ7A 3W9JA 2WTFA 4B3MK 4MFBB 1B64A 2HVHA 4RG8A 2FBYA 2PN6A 5C24B 4DV4F 2BRLA 1T9UA 4N5SA 5DZ7A 3PR4A 1XHZA 4HT5A 3AY0A 4DQSA 3D45A 1I3OB 3WC0A 5T14A 4RO0A 3HBTA 3VQ9A 5F3ZA 3ZXWA 3HSCA 3IR7B 3PX0A 2M4MA 3V6DB 3ISZA 1HIYA 5IWAF 3DLGB 1RGVA 1XMOF 3KK3A 4CO5A 1EHWA 3PW0A 4DQQA 3CMQA 4C9DA 1NMNA 4FWPA 2VONA 3LP1A 2ZBQA 4FW1A 5AQQA 1JJHA 1MG7A 2JEGA 2EFOA 1R0AA 3NAHA 2FBXA 3WIUA 3UNGC 5D6GA 2GQQA 2HOEA 2FB0A 1G7CB 3UCZP 3VESA 2MTLA 4CFCA 2X1GA 4AFFA 1TKTB 4KO0B 4FJJA 2VFSA 1FK9A 1YKWA 2ALYB 2BMBA 3ZNUA 3GE9A 1NKBA 1YJNN 2GW8A 4ES1A 1HD1A 2UUAJ 3OTBA 3HSJA 4C4WA 4ZVPB 3MM9B 2WTUA 1C1CB 4HWIA 5ETKA 2CIMA 3O6WA 2AHOB 3PRBA 2C2DA 4B9TA 2WVBA 3NCIA 5BYQA 3THWB 3CD6S 2FC0A 1WC3A 4PZVA 5MAOA 2Z58B 2KVQE 1F3FA 1X4HA 3T5KA 4JK8A 2IGIA 2KT3A 3EZ5A 1GLLO 3I87A 4CJVA 4B9MA 4Q2LA 4BC4A 1I94F 4EHUA 3MM7B 1VQOS 4CZIA 1DBDA 3TABA 2OELA 1Q53A 1ZOTA 1NG9A 4JI3K 2IBKA 2DNKA 4CI0B 1EP4A 1YTYA 1T9WA 1U1QA 3TQEA 1O5JA 3K89A 1U26A 2Z1IA 4WQ4C 3A3PB 2OO4A 1HNWJ 2Q66A 2AJ2A 2JFKA 4FZZA 4KV8A 4TY9A 2VWKA 4Z37A 1TUYA 2J7KA 2JEJA 4K0KK 2GWKA 2U2FA 3DLHA 1PJ6A 2XSFA 4DV0J 4FK2A 3ENVA 1KONA 1BQXA 4YOUA 3DLRA 3RSEA 3QPIA 3SQ0A 2BE2B 4XPCA 1UJ6A 2HIQA 2AJQA 2HQGA 2MQQA 4ZCKA 5IC4B 2IVFB 1RTHA 3KK1B 1QTNB 1UP1A 1VISA 2RAQA 4RWWA 1MDUB 1WAFA 3ZTRA 2E1PA 1SJ4P 2Y3YA 3SCLE 4CERA 1CBKA 4AF1A 2ZBRA 4HHTA 1H2VZ 1WG5A 2C3MA 3M30B 4JKBA 3VQAA 1R8CA 4TNOA 5GAEP 4KYZA 1MMLA 4K5RA 1P90A 1HBNA 3MN5A 3OTEA 4ES2A 3ZFVA 1S9GA 1NJYA 5AQRA 3NH0A 1VQ6N 3B4MA 3D6RA 2BXJA 3ZSOA 5L46A 3E66A 2AYEA 3CIZA 3QWUA 4CW7B 5DDOC 2OZMA 2DR7A 3T1AA 4PR6A 4YOTA 4FWSA 4XPEA 5L38A 3CCQN 2K06A 2XB2D 3AARA 4Q45A 3MTKA 2N3OA 3CJKB 3MAQA 4KB1A 1CJUB 3V1RA 3QO9B 5BYRA 4DV7F 4JKCA 1J9AA 1S1VB 4HUFA 2BJ8A 3O08A 5KG4A 2E8AA 2E9TA 4JV5J 2V51B 4ZIVA 1Z6RA 7AT1B 1X4CA 3VENA 1U1MA 3FCVA 2QEXS 1GAOA 4FJMA 2R9LA 1SH2A 3GBTA 3G4SS 3CCTA 4DSFA 1VC0A 3CCUS 4E7KA 4DX5A 4B1ZA 2DFHA 3SIPB 4KHWA 3E51A 4NLGA 2CDQA 5L1LA 1D8ZA 2FUG9 3R1XA 4A47A 1TVRB 4J8FA 5C42B 1S1XB 5DO2A 1BHLA 3Q8VA 2MZQA 2W9BB 1S4FA 2B0GA 4QR2A 4ZVHA 2DY9A 3SNNA 5ETQA 2DISA 2B4UA 2E9RX 4ZN3A 4MQ3A 4XO0A 3NNCA 2GHPA 2LXIA 2IAJA 5EGYA 2OUGA 4KHMA 3MCOA 2DRDA 1VC6A 3NMRA 3QINA 1A5XA 5IWAK 2MGZB 4FF3A 1NZAA 4BC7A 4CLKA 2C42A 4RX6A 2A6MA 4X4RA 4J9RA 5EVZA 2IM0A 4FVMA 3GQCA 2QYGA 3K7RA 1WF0A 4MLEA 3CE8A 2FBTA 4A5BA 3EVOA 1S0OA 3N01A 4FWOA 3C66A 1TK0A 3VQ7A 5KOWA 2KTQA 3BKTA 3QZ7A 3GIJA 4X64J 5LMNJ 2W24A 2QWMA 1M5KC 4MYUA 1EQ0A 4NLSA 1CQNA 3UWTA 2J0XA 5D4LA 3TP2A 1LW2B 4KI6A 1VAZA 1R89A 2DCLA 1IBLF 4YOWA 2NZCA 1HW8A 4K4XA 4BLGA 1KBRA 3PVXA 3GFXA 3SCJE 4ILJA 1P1LA 1GXUA 4S0MA 3BQ2A 2ZWHA 1U8WA 3FJ2A 3H5YA 2Z57B 4J9PA 2FQQB 2V8VA 2C1EB 4CFBA 5C42A 1H0HB 3RTVA 3RYLA 3TQ1A 3RW6A 2GCFA 4KGZB 4OZ2A 4OL8A 3I8DA 3EL2A 1YK9A 3SUPA 2R7RA 1VCTA 1K9MO 3KOAA 1MMNA 2KHOA 3CW2C 4USWA 2IM2A 5KG7A 3W61A 2BKOA 3QEVA 3GE1A 2ITMA 1RKIA 3QGHA 1Q7YT 1Q9YA 3CJBA 2ZM6J 5AJ3J 1WC1A 2DRAA 3RB3A 4JI7F 2VD3A 4ZA1A 3O3GA 4PXCA 5CYQB 1DT9A 3VGUA 3M5RA 3EM1A 2HS4A 1VQLN 2JSXA 2YQ1A 3R5DA 2PDAA 2UUBK 4H4OA 1NGFA 3DXMA 3TEGA 4KI4A 2EFVA 3HOTA 3P4IA 1UVIA 3CC7S 4K4ZA 4H4KC 3PRDA 1QSSA 2UP1A 4Z4GA 1NSPA 3ZTQA 5GAHU 1MU2B 3G2XA 1FXLA 1TYQB 3ZX0A 3M9OB 3JYTB 5CCMA 3O3FA 3M32B 1K6YA 3T1YJ 3EZWA 2ASJA 3EGZA 3GCXP 1ZPVA 5C2GA 1QZ5A 2DNNA 3GSDA 2ASYA 4HT7A 2MQ8A 3HZEA 4J9VA 5KG5A 3EGWB 4OO1J 3GJTB 2Z0GA 3H3OB 2QWOA 1WUUA 4CBXA 2QWNA 3ZTOA 2P9PA 5E3AA 1LQ9A 4LRDA 4DR2K 4X4SA 2EX3A 4A8KA 3UCUP 3ADAC 3CI5A 1XMBA 2K1RB 3Q8YA 4BRMA 3FZBA 2OEJA 1GH8A 2M0GB 4F4KA 5GINA 2NUBA 4QW8A 2UUBF 2ZOGA 2MZRA 4NZ6A 1IBMF 5H1SQ 1CS4A 1NPKA 4K43A 5FPMA 5DDPC 5IT9O 3DDKA 2HLTA 3NEKA 1UW4A 2CFXA 2XGPA 4JS4A 3F56A 3US5A 4ANCA 4PXEA 4E7LA 3JAMU 4ZVRB 1PSDA 1GMUA 6AT1B 2VKZG 4QOZB 3LDNA 1S6PA 3L6QA 2HZCA 3ZEUA 1G4CA 4CGGA 1TYQA 1FKOA 4A8MP 4DL3A 1MLAA 4RWXA 4YEAA 5E3PA 4ELUA 1X60A 1HL6A 5HQ8A 5THWA 4OLPA 3W1YC 4ZCIA 1GNKA 3Q8SB 4U8YA 1RAJA 1VRQC 4Y00A 3H1QA 4A4JA 1X5OA 5GAEI 1M5PC 2PE8A 2L48A 2YJFA 3FQLA 4GKJF 3M1VA 4Z7YA 4QS8A 3TAEA 1G6BA 2F8SA 2ZZNA 2W40A 3DRSA 2WW4A 2ZGZA 2LLZA 1T03A 3DM2B 1D8YA 5LJ5Y 5HQLA 4AXJA 3QJLA 3B78A 2J9DE 1F5BA 2MSTA 3MPDA 4C11B 2RDIA 1KTVA 3JQMA 4CJKA 3FUYA 3PJXA 5F0UA 4DV3J 1U0HA 4LSNA 2HFSA 2XS2A 2CQ1A 2QRRA 2O8DA 5JJBA 4OX7A 3AO2A 2G8KA 2CWXA 4DS4A 4KHSA 2PT0A 4KHRA 1M90T 4LT6A 2YHXA 2MXYA 1NAQA 1ZBTA 2XHCA 1FKOB 2VG5A 3CC7N 3P4UB 4DU3A 2F40A 6FD1A 5AJ3F 3NBPB 4H5RA 4KTZA 4NB4A 3H1VX 2ZH9A 3A12A 4WFBL 3QEXA 5ITHA 1BISA 4E1MA 3EDRB 4BBYA 3N6LA 4F04B 3UDVA 5AQZA 4N56A 4I6AA 4IO8A 5AQSA 1J54A 4I9LA 5B0EA 1TL1B 5KFGA 2DHHA 2PFDA 1K9MT 4LFBF 3AOBA 3LDPA 2A1BA 1TFWA 2AD9A 1NJZA 4CI6A 2MZTA 3NGKA 4LRAA 4MMOA 3HOSA 1YZ7A 4DPXA 2QWLA 2CUYA 2QZ8A 1RLDA 3QERA 1OS5A 4MK9A 2DFEA 2EXUA 4FLTA 2HAFA 1RBSA 2B9EA