4KV8A

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV Reverse transcriptase P66
total genus 152
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kv8A05
5CY4A 2G8UA 3UDLA 5DQIA 1HQUA 3A2FA 2Z1JA 4KHWA 2E9ZA 1Q8IA 1RDCA 4DTUA 5J2QB 4DQPA 4E7JA 2IM1A 2X74A 3OHBA 3S3NA 3S9HA 3MF5A 4EO8A 4ZVGA 1T7PA 2XRIA 1GOCA 3V9SA 3CG7A 4F2RA 1S5JA 3DM2B 2I5JB 2BE2A 4F4WA 1JXBA 4K4WA 3QIPB 3IS9B 4CF9A 4F8RA 3V9UA 2XHBA 1S1WA 2FLNA 2P5GA 1JLQB 3PR4A 3PW2A 4YMEA 4RW6B 3L8BA 1XHZA 5C24B 2WOMB 3OYKA 5C25B 4HVJA 3SYZA 1U09A 3I0RB 4HKQA 3V1RA 3QEPA 1C0UA 1XR6A 4HUFA 3IG1B 3LANA 3NAEA 2EX3A 1HMVB 1W9HA 2FLPA 2ILYA 4CESA 4M3TA 2RKIB 1CXQA 3AV9A 1S9FA 3NBPB 3Q8SB 4ZPBA 4CHYA 5J1EB 2Y1IA 2E9TA 3E51A 4GMJB 2F8TA 2ZD1B 4KV8B 3D45A 3RB0A 1QE1B 3D0PA 3GV5B 3JSMA 1S6PA 1N56A 4M41A 1SL0A 1W25A 2J6SA 4K50A 4KAZA 3G86A 4DS4A 4I7FA 4FM0A 3V9WA 4NYNA 4KREA 5KT6A 4URSA 4FJLA 3NDKA 2BQRA 3RB6A 3T1AA 1U47A 1IKYA 3LZIA 4NCGA 4Y2CA 2EHGA 2D0AA 1DTTA 3QERA 1VRTA 2VG5A 2DPIA 3C6UB 4EBEA 1WSGA 3BGRB 2YKMA 4KHUA 3LP2B 5KFBA 4DL4A 4QAGA 4N56A 2UVVA 2O4GA 4CFDA 3OS0A 5T7BA 4DFPA 3UR0A 3MR2A 3DYAB 1WNSA 3HKWA 3ZSYA 2FBVA 1ZBUA 2O4IA 3PHEA 1C1CA 5KG3A 4F3TA 3CIZA 3TABA 5J2PA 2V0NA 4TQRA 5KFGA 4B9MA 4KPYA 4ZHRB 3KK3B 1N5YA 1NNDA 2AWZA 3UPFA 3M9OB 1ZBHA 1JLAB 4B9VA 1SH2A 4E7IA 4O3PA 1SV5B 2E6MA 4K4ZA 1NK7A 3KHGA 3BSCA 1U49A 3HSTB 3F9KA 5K14A 4NCBA 1VSEA 3KK3A 1N5YB 4ECZA 5DK5A 3GIKA 4I7FB 2IC3B 1SH0A 4W5QA 1C6VA 1RDBA 4W5RA 3OYHA 3E01B 3TAPA 1RT1B 2YV0X 3FSIA 5DQGA 4ZPDA 2R2RA 3OJSA 4CJWA 3L2VA 2XWYA 2IAJB 1C0MA 4H4OA 1K1QA 3IGVA 2W8LA 4KHYA 1IKWA 3ZSVA 4Z4GA 4RW9B 3TANA 1IM4A 3M9NB 3BR9A 2WCXA 2FVCA 1TKZB 3DLRA 3FFIB 5CZ2A 3NF6A 4MFBA 2D5RA 1QSSA 3K5MA 4PWDB 4NLQA 3OJUA 5F8MA 2OYQA 1WN7A 1WNEA 5KGXA 3P1GA 4CGDA 5C24A 4L8RB 4CJ5A 2G8IA 2BQ3A 3UIQA 3CJ4A 1JLGB 2HAIA 4F4YA 4CEBA 5EWFA 3BQ0A 3BGRA 1XHXA 5KI6A 4M3UA 1RT4A 2V4RA 1D9DA 3KK2A 2C2EA 1RTIB 4H4MB 1DTTB 3G6XA 5FROA 4FJXA 4FM2A 3ISND 4IH5A 3Q8PB 5DGBA 5DGAA 4C8LA 2OPSB 2O5DA 3I5CA 1X9WA 1NJYA 3ZSQA 1HNVB 4KHNA 4BDZA 3KMQA 4FK4A 3D5MA 4FZZA 4NLRA 2YNGB 4KFBB 1QSLA 3JYTB 4FLXA 4M3WA 2X6NA 2FBYA 3L3VA 1GX5A 1NOZA 1YVUA 1HNIA 4TLRA 2JEJA 3DRSA 3RMDA 3HVTB 3VA0A 4W5NA 1RT7B 2VG6B 4IG3B 5D3GA 5KFLA 1TKXB 4DU4A 1DLOB 3MAQA 4J9QA 2W8KA 4J9RA 4KKOA 2F8SA 4QW8A 3AVBA 3RB4A 4KTZA 2HVHA 2KQ2A 1IKVA 2XY7A 2AX0A 1TV6B 3B6OA 4CJ4A 2BQUA 4B3OB 3PR5B 1J54A 4MK7A 4FBTA 4G1QB 3PW4A 4CIFA 5FRNA 3DI6B 3E01A 3H5XA 2XGPA 2ZQBA 4RW8A 1OS5A 3L2QA 4DTSA 2FJVA 4GC7A 3T5JA 3PZPA 2GIQA 3THVA 2D0CA 4KSEB 3G10A 4LSNA 4J9LA 3NFAA 2AU0A 3SQ4A 4RW9A 2G8HA 2HHVA 3ZT1A 5CYQA 3V6DA 1CXUA 4E7HA 4PQUB 3G6YA 1BIZA 4B9UA 3H5UA 1FKPB 4CERA 1HYSA 2OZMA 2RN2A 3CM5A 2D7SA 1S1TA 3L2WA 1BQMA 4DEZA 2UUWA 2C22A 3M8PA 3QO9A 4Y1DA 4KI4A 4B9TA 3AA4A 3OL9A 3I0SA 1R0AB 3QLHA 3NL0A 1KVAA 3S3MA 2VG5B 3ZT4A 3BSAA 4F4XA 3FQLA 2IGIA 5HLFA 4NLDA 3KLEA 1TVRB 3BQ2A 4IFVA 2J6UA 3ZSOA 4O4RA 1ZBFA 4JRQA 3NH0A 5KRTA 3D28A 1EX4A 4AH9A 4AHRA 2RF2A 1RT2B 4QWEA 3TQ1A 4RW4A 3OYLA 4FYDA 3OYJA 4IG0A 3HPOA 2PYJA 1JL1A 4DLGA 2W7PA 3K5OA 3QLHB 3SUPA 1A5XA 3IRXA 3TAGA 3AVIA 3KMSA 1J9AA 4K4VA 4Z4FA 1KFDA 3HVAA 1UOCA 4CK3A 3MFIA 1RTHA 4TYAA 5KG5A 1N6QA 5FDLB 3BREA 4Z0UA 1FK9B 4FJ8A 1TK0A 3MEEA 5I42B 4YNQA 2BANB 1S10A 4XO0A 3L3UA 4PQUA 3RWUA 1JLBA 3V6DB 4DTXA 1RDRA 5KG7A 1Z4UA 4Q44A 4KE5A 1KLMA 3CM6A 2KW4A 3QGGA 4MK9A 4JV2A 4CJ3A 4H8KA 3SZ2A 2R8GA 3KTQA 1LWEA 3WNFA 2I5JA 3V6HA 1WSIA 4NCGB 3T5KA 2XO7A 1JIHA 1ASWA 3QO9B 3KLIB 4K4TA 4LH4A 1JLCA 3DLKA 3AVMA 3RR7A 2B43A 4HHTA 4DL3A 4IRCA 4M95A 4KB1A 1NOYA 2HNYA 4IRKA 4ID1A 3TWHA 3H08A 4MIAA 1UWBB 1RA7A 1S49A 3IG1A 1YTUA 5HRPA 4MKBA 4LD0A 1BL3A 2Z1HA 5EU7A 2WOMA 4CJFA 4NLOA 2YNHB 2Y1JA 4CEOA 1C0UB 4ECXA 4AHTA 3OS1A 4NLGA 1S1VA 2NUBA 1KHWA 4EZ9A 1LW2B 4Z4HA 3LP0B 5HP1B 2KFZA 3KLIA 1C0TB 1JLFA 3AO1A 2R2TA 3M8RA 4J2EA 4J2DA 3PY8A 3HJFA 3CFOA 1TP7A 4K4SA 5KRSA 1VSLA 4NRTA 2VG7B 3RR8A 1NKCA 3KKRA 3PJWA 3IS9A 1D8YA 4FCYA 4N47A 1BQNB 3KLHA 2IOCA 4CEDA 1BIUA 4F2SA 1S1UA 4FJJA 1C2PA 3RMBA 2FVQA 5KT5A 3KJVA 1EKEA 3VQ8A 5KFFA 2XY5A 1TKTB 3SPYA 1S0OA 1GX6A 4FJ5A 1SKSA 2R8IA 1DTQB 5HP1A 2GV9A 1NK9A 3KHRA 2R2SA 2FVPA 4O4GA 3KK1B 4PUOA 5KTQA 4CGIA 5J2MB 5KGWA 4MKAA 3PJXA 3M8QA 1IKXB 1NJWA 3SJJA 1KVBA 3G0ZA 5C42B 1WSEA 2B5JA 3PUFA 2AJQA 4K4YA 3NCIA 4CJQA 4J2BA 4FS2A 4Y34A 4ZVFA 2IJFA 2OPRA 3VQBA 5HLFB 3NF9A 1JLBB 2XI2A 1VSFA 3OYIA 5I42A 5DMRA 3SUOA 3MFHA 4ED6A 4K4XA 1CZ9A 3QNNA 2J6TA 1X9MA 3AA2A 4O55A 4HUEA 3ISNC 1VRUA 2JEFA 1KLMB 4DSFA 2QKBA 2XY8A 1QAIA 2R8HA 4J9OA 4LQ3A 1JKHA 2IDOA 3OYBA 4ZMMA 4NLSA 4CEZA 3DYAA 4CJSA 1TQLA 5F9LA 4M3XA 4FM1A 1S9GA 4Q45A 1NK6A 4DFKA 2FJWA 4NLWA 2BRKA 4AHCA 1LW0B 3KHHA 3P5JA 3V9ZA 3QEWA 5JXSA 3CJ3A 3HO1A 3V9XA 3HK2A 3RMCA 5KFHA 4KB0A 2KTQA 5KFPA 2AQ4A 5F9NA 4G3IA 3QZ8A 5EDWA 3HL8A 1U45A 1VSIA 1VSDA 3HXMA 2W9CA 4IG0B 4R8UB 2WTFA 1ZETA 3AVNA 1WAJA 1I39A 4H54A 1Z25A 1XWLA 1S1XA 1JL2A 1VSJA 4IH7A 3VQSA 4FJMA 1IKVB 5T14A 4J2AA 4MIBA 2R7YA 1WSFA 3HM9A 2RKIA 4IKFA 5KG4A 4QW9A 1CZBA 4DLEA 4YP3A 1VRTB 2HB5A 4DSEA 2G8FA 2HHWA 2IBKA 3TI0A 2E6LA 3O4QA 5KFIA 1IKXA 3UQSA 4BE1A 1FKOA 4K4UA 4OKEA 3O3FA 1TGOA 2PY5A 2QXFA 4FLZA 1RTJB 4RW7B 2DY4A 4Y2AA 3MECB 4LSLB 4E7KA 4KI6A 3SFGA 2PZSA 1HRHA 4LQ9A 3QIPA 1QS4A 3M8QB 4O3SA 1B9FA 2OPQB 3VQ4A 3OSPA 1KFSA 1DLOA 4C8OA 5J1EA 4NRUA 2YKNA 3DRRA 4NLVA 2VWKA 3K5LA 4U7CA 3HVWA 4O3NA 4CEEA 3K58A 2GUIA 1L3UA 4IR1A 1XC9A 3TR8A 1TKTA 1BHLA 3KLGB 3KKSA 2BGGA 3KD1E 3GILA 3SV4A 3JYTA 4KV8A 3LP0A 1ZTWA 3AVLA 4YR0A 4DU3A 4C8KA 5KG2A 3BJYA 3FDSA 2HNYB 2VG6A 1K1SA 1HNIB 2AGOA 4Z4IA 1A5WA 3V81B 5KFSA 3H40A 1LW2A 4I2PA 4CJKA 4UQGA 3F73A 4O0IA 2WHOA 4KHRA 3RAQA 3ITHA 2IM2A 1BI4A 3ITHB 1BI4B 4BDPA 1LAWA 4FJ9A 1NK5A 4CGGA 1GOAA 3BSOA 1TL3B 4IR9A 4ELTA 4Q8FA 4AHVA 4FJGA 5KFYA 1BGXT 4I9QA 3CJ0A 5F8HA 4Q5VA 2ETJA 3SNNA 3KLFB 4CCHA 3DRPB 1RTIA 5EWEA 1F21A 3M8SA 4EO6A 1RDAA 2IMWP 4DQQA 1LV5A 2YNGA 4KFBA 1Q9XA 4XPCA 3PW5A 2YNIB 5I3UB 3V1OA 3QZ7A 3NE6A 4DFMA 2JEIA 1RT4B 4LSLA 3OLBA 1RYRA 2PYLA 3VQ9A 4KTWA 2IAJA 4FLWA 4O44B 3ZSZA 2BDPA 5HRRA 4BACA 4QCLA 4WFXA 5KG1A 5J2NA 2EC0A 4FJHA 3ICLA 4E3SA 1N4LA 5FRMA 1IKWB 2RPIA 2ZE2B 1RT6B 4C8NA 4R5PB 1W0HA 3GIJA 3DLKB 4ID5A 1NK8A 2KFNA 2B6AB 4IFYA 3WNGA 1YT3A 3ZSRA 5HROA 4R8UA 2LSNA 3LPTA 1VRUB 4M94A 3V1QA 1RT3B 2OPPA 1HQEA 2YKMB 3QGHA 3Q8QB 1RT1A 1S0MA 1LWEB 3FFIA 2ALZA 4O3RA 4EBCA 1HARA 4CJVA 4IDKB 3PW0A 2P51A 2RF2B 4FW1A 4URGA 3OSNA 2BANA 3OS2A 2R2UA 3VQCA 4DQRA 1HYVA 1ZTTA 3TAQA 4M45A 3SI8A 5HROB 4RNNA 3I8DA 3MR6A 1U4BA 3JSMB 4CFBA 3ALYA 4CHQA 1HQEB 5KFXA 4WYWA 4DSIA 1KRPA 2I1RA 4DWIA 4YFUA 1D9FA 2CKWA 4RNOA 3GV8B 4OPKA 4WZQA 3LP1A 4CEQA 4OPJA 3MR3A 2Z1IA 2UVRA 2YNFB 3LAMA 1J53A 4M3RA 3MXIA 4ZTFA 1QHTA 4N41A 2XGQA 1R0AA 4OGCA 5KFNA 4RW8B 3RAXA 4DG1A 2HVIA 3SUNA 5KFQA 4F50A 4WE1A 4CK2A 2F96A 2ZD1A 4F3OA 4FLYA 1TAQA 5CYQB 1TV6A 4CJRA 4ECYA 5F8LA 3HHKA 3N6MA 4EEYA 4LY7A 5KT4A 3GIIA 3LWLA 4KTQA 4CHZA 2E4LA 1O1WA 2UVUA 4M3ZA 4IOBA 4CHNA 1RT3A 2YNIA 3FRZA 3NAHA 4E1MA 2B6AA 3AVHA 4K8ZA 4DFJA 5F8NA 4E89A 1TL3A 4I2PB 1UAXA 1UA0A 3DLGB 1UA1A 2YHAA 1S1TB 1KVCA 3QETA 3MEDA 4TYBA 4KO0B 1QE1A 1Q9YA 3ASMA 3VQEA 1X1PA 1SL2A 2P5OA 2D0BA 3DOLA 1J5OB 4QPXA 4TY9A 3ZSWA 3LZJA 5KFZA 2ASJA 3MEGB 1HNVA 4FK0A 3CDUA 1JLFB 5KFOA 3T5LA 1NHUA 1JX4A 4W5OA 4BE0A 4QOZB 4NYFA 4CHOA 1HMVA 5KFRA 4CFCA 3CWJA 1ASVA 2BR0A 4ED8A 3M9MB 3AO3A 2XY6A 1B9DA 1S1UB 1U48A 3KLFA 5E41A 4ECTA 3K57A 2KZZA 1NJXA 1HQUB 4KHMA 2JEGA 5KFDA 3U3YA 3SI6A 2E9RX 3K59A 3PV8A 5KT3A 3B6PA 4CECA 2GC8A 4M42A 4WE1B 3CFPA 1K6YA 3MEDB 4OKKA 3PX0A 4GC6A 3KK2B 1C0TA 4MFBB 2VWJA 1X9SA 3CDEA 3VA3A 3CFRA 1RDDA 3DOKA 3AVAA 4TXSA 4TN2A 3NGZA 3U3GA 3WNHA 4DSLA 1JXLA 4PWDA 2OPQA 4BE2A 2YNHA 2RDJA 3OYGA 3I5BA 3GYNA 3KLGA 4X2BA 3OVNA 3NF7A 3OYFA 1T8EA 2W9CB 3NMAA 5FDLA 4RZRA 1SH3A 2AX1A 1S9EA 4ELVA 3H5YA 3V4IB 4NLYA 3ULDA 2D3UA 1S1XB 3VQAA 4E1NA 3DMJB 1RA6A 4FVMA 4CJEA 4H4OB 2VA3A 3AVFA 4QWDA 3VN5A 4EYHB 2HNZB 1G15A 5L1KA 2FLLA 1JLAA 3OYEA 4QWCA 2W42A 2P1JA 5CYMB 4B8CA 4FLUA 5JS2A 3VQPA 2HHUA 2W9AA 1RBRA 4RW4B 2R8JA 4Q0BA 1FXXA 4RNHA 1IG9A 4TY8A 3NH2A 3MTKA 5L1IA 4ID5B 3OL8A 1I3AA 3V4IA 3H2LA 3DLEB 3N6NA 3TVKA 1VSHA 3H4DA 4IDKA 4CGJA 4WFZA 2VA2A 4HCCA 3CO9A 3KHLA 2YNFA 4Z4CA 4O0JA 1REVA 1IKYB 3SV3A 4J9NA 3H4BA 4ECSA 2ZKUA 3PO4A 3DOKB 4FK2A 3I5AA 5KFUA 2UVWA 4FZXC 1BQMB 2HHXA 4CJPA 1RYSA 3OHAA 4JS4A 3NGDA 1D0EA 5J2PB 2HWIA 1RT5B 3SQ1A 4ECWA 1FKPA 4AILC 3M8PB 4KAIA 2C28A 1WSJA 3SQ0A 3AVJA 3NKYA 1LWFB 4ECVA 5DG8A 3SQ2A 1SL1A 4JS5A 2HHQA 4E7LA 1LW0A 3QIOA 4N5SA 5KFVA 4EBDA 1T94A 1XI1A 1T03A 3U6FA 1Z26A 3QINA 4NCAA 3HT3A 2OPRB 5DG7A 1QAJA 1L3VA 5JUMA 2HWHA 3G6VA 2XI3A 1NJZA 1VSMA 4FJIA 4CJTA 3HVTA 1JLQA 3RBDA 3MEGA 1KLNA 1EXQA 2C2DA 3CDWA 1J5OA 2UUTA 3HPHA 3RRHA 3NHGA 2X78A 3PO5A 2A1RA 3OLAA 3ZT0A 4RW6A 4RU9A 2R8KA 1HPZB 4OL8A 4KHSA 1S6QB 1GOBA 2JC1A 3O3HA 4IG3A 1Y97A 3NGYA 3GIMA 2X6SA 3PW7A 4OKJA 2WONB 1HYZA 2JLEA 3SFUA 3HVRA 1S1VB 2W9BA 3LP3A 1S6QA 1L5UA 3OYAA 3DOLB 2BRLA 1TKXA 4TQSA 1S6PB 2FVSA 2ASDA 4H4MA 2BE2B 2DTUA 4Y3CA 1S48A 3FQKA 2V4QA 3NH1A 5J2MA 4KB7A 5HBMA 4PY5A 4KHQA 1LAVA 1KSPA 3T5HA 3LPUA 2VG7A 1HJRA 5J2QA 1I6JA 1D1UA 1TL1A 3H98A 2IA6A 3BQ1A 4DF4A 3MR5A 3QGIA 4FJKA 4CE9A 3PX6A 2ASLA 1VSKA 3VQ6A 3SPZA 4IRDA 4CIEA 1EETA 2HNDA 5HRNA 1RT7A 2HMIA 1CLQA 3KLHB 1XR7A 2V9WA 2FBTA 2G8WA 3AVCA 4FJ7A 5F8GA 1ITGA 4ZP9A 1RBSA 1NKEA 4RNMA 4ECRA 1RTDA 4LH5A 4CF8A 4Z4EA 3T19A 3K5NA 4EP4A 3O3GA 3HYFA 1T3NA 4KO0A 3OYNA 1NK4A 1IH7A 4EP5A 2B4JA 1RT5A 4B9NA 4O3OA 4DTPA 3IN5A 4DMNA 1T03B 4ZP6A 4NZ0A 2XCPA 3CYMA 2FJXA 4NYZA 2ATLA 1ASUA 3AA5X 3RTVA 1ZBLA 1L3TA 3HP6A 5L9XA 4RUCA 4FZYA 4CIGA 1LWFA 2A1SA 4U6PA 4IQXA 2WB4A 3QESA 1RAJA 4CEFA 4OLBA 3LAKA 4WFYA 1YVFA 4PA1A 3ZT2A 1RBTA 4I2QA 1N48A 1RTHB 3N6LA 4NLUA 4CEAA 4CHPA 2YHBA 2HW3A 4DTJA 1QUVA 3OYMA 4CF1A 4DL2A 3BSNA 2WRMA 3L2UA 3C6TA 1FKOB 1FK9A 1TVRA 5C5JA 4GVMA 4ZP8A 1REVB 3CJ2A 3RBEA 4DG1B 3LALA 1YTAA 4DTRA 4CK1A 1SKWA 3TAMB 1LWCA 4BWMA 3EYZA 4MQ3A 4FW2A 3I0SB 3DDKA 2RDIA 3Q8RB 1NHVA 3OL6A 4KBIA 4DTMA 4HUGA 2ATQA 2XC9A 1TK5A 1L3SA 4Q0BB 1S97A 2B5JB 1RT6A 4DQIA 2QE5A 4DL7A 4ECQA 1N6QB 3HP9A 3RMAA 4J9PA 4HTUA 2OPPB 3C6TB 5SWMA 2HHTA 4CFAA 3EY1A 1SUQB 3NBPA 4TSXA 1RBVA 3OYDA 5J2NB 4N76A 1BISA 3AVKA 5I3UA 3DI6A 2W7OA 5KFCA 3DLEA 3I0RA 2ITGA 4B9LA 2OH2A 3OL7A 3AVGA 3VQQA 4GW6A 3IGNA 3KIOA 3DLHA 5L1LA 1S1WB 1RBUA 1S9EB 5CYMA 1CSJA 3ZSXA 1TKDA 4JLHA 1QTMA 4KKOB 4NLXA 4QWBA 1JLEA 3QYYA 1NK0A 4ZTJA 4FLVA 2GIRA 4FXDA 2D3ZA 3VQDA 3DMJA 4NLTA 1MU2A 4URQU 3NF8A 4HCBA 3QEIA 1BQNA 4J9MA 4MH8A 4B9SA 5EWGA 4W5TA 3OY9A 4EZ6A 1C1BB 2G8VA 4O5BA 2IM3A 4YR2A 1D5AA 4BDYA 3S3OA 4K8XA 5HRSA 1A5VA 1HYSB 1EP4B 4Q8EA 4BWJA 5EUHA 2DPJA 3EPIA 3DRPA 5KFAA 3KD5E 4CF0A 5KFKA 4RNFA 1C1BA 1RTDB 3V6JA 3CVKA 2W9BB 3C94A 2JC0A 4LSNB 3DLGA 4WXWA 3OYCA 5KFWA 5DG9A 1WLJA 4JV0A 3MECA 2C2RA 5F8JA 1TL1B 4ICLA 2WONA 4CJLA 3CQ8A 2HMIB 4JUZA 3DLBA 4YR3A 3DRSB 4XPEA 4ZVEA 1XR5A 3LWMA 3QNOA 4Y1CA 2HNDB 1HPZA 3KJVB 4G1QA 4ED2A 4QWAA 5C25A 5KFJA 4AHUA 4B08A 5KT2A 3V81A 1JLGA 3MXJA 3QEVA 3H5SA 1WSHA 3QEXA 5HBMB 2FC0A 3AO2A 3AA3A 2CJQA 4ZPCA 3H59A 3CJ5A 2IS3A 2OA8A 3DM2A 3TARA 3L2RA 1KCFA 3BDPA 5F8IA 4ED3A 3EPGA 4ED7A 4E0DA 4F4ZA 4NLPA 4J9SA 4JRPA 3P83D 3GV7B 4ECUA 4ICLB 4FBUA 1NKBA 1TKZA 1JLCB 3V6KA 5KFTA 3HPGA 1MU2B 3TAFA 2Z1GA 1SUQA 1TK8A 2YKNB 3DRRB 4WXOA 2FVRA 1JLEB 4DSKA 1RTJA 4RW7A 4WZMA 1RNHA 5KG0A 1RCHA 2OZSA 1ZYQA 1T05B 5DLFA 1EP4A 4RG8A 3ZCMA 4CGFA 4IKAA 2JGUA 1BCOA 4DL5A 3VQ5A 4I9LA 4FLTA 2G8KA 1ZBIA 2GBZA 1KTQA 1S4FA 2OPSA 4E19A 1IO2A 2ILZA 4WYLA 1JKHB 3MEEB 4DF8A 1B92A 4RUAA 4EYIB 4IBNA 4OJRA 4CF2A 3NGIA 4ZVHA 4OGEA 3LDSA 4IH6A 3QIDA 4ZP7A 4YQWA 3PVXA 4J9KA 5JS1A 2DFFA 5CZ1A 2XCAA 5L1JA 4DQSA 1S9GB 1SV5A 5KFEA 3EZUA 4IFYB 4FJNA 4KRFA 4ELUA 3IAYA 3IRXB 2FBXA 3T3FA 4TY8B 1MMLA 1LWCB 1S0NA 4R5PA 2QK9A 2QV6A 3RRGA 4DL6A 3KOAA 4O3QA 1C1AA 1RT2A 4XIUA 2IC3A 3C95A 3EZ5A 5DQHA 2WK4A 4DU1A 3ZT3A 3LP1B 4Q43A 5DLGA 3AO5A 4ED0A 4O4GB 4IFVB 3KK1A 4PUOB 5SZTA 3MXMA 5KG6A 1C1CB 3AO4A 3PX4A 4M3YA 4DTOA 1DTQA 4ED1A 4HYKA 4ZHRA 3TAMA 4B8AB 3WNEA 3C6UA 4DS5A 5K14B 4CJUA 2IJNA 2QKKA 2HNZA 4AHSA 2AGQA 4FS1A 3KLEB 1TAUA 4JV1A 4C8MA 1T05A 1KHVA 3KNAA 4R0EA 2Q3SA 4MK8A 3SUQA 4DTNA 4O44A 1EETB 2KZMA 5KFMA 1JXEA 3O4NA 4F4KA 1U04A 5D3GB 2DFHA 4CGHA 4ZPAA 2AGPA 4B3OA 1RILA 2HHSA 4DSJA 3KLVA 2D41A 2F8EX 4OLAA 2ZE2A 1QQCA 5KT7A 3TAEA 1QSYA 3GQCA 3SCXA 1VK0A 5C42A 3RB3A 2DFEA 1BCMA 3LP2A 3VQ7A 2IM0A 4I2QB 3NAIA 3K2PA 1SKRA 1WAFA 1UWBA 4OVLA
chains in the Genus database with same CATH superfamily
3M2RA 4Y28C 3MM7A 3WQPA 1BY9A 2Z1JA 2KB2A 4DTUA 4DQPA 5JMNA 4E7JA 2O3DA 1XJWB 3S3NA 1REGX 2NRTA 1KKHA 3DXSX 2LXUA 3CG7A 5LL6Z 2KG0A 1OY8A 5F0XA 2QEXN 2BE2A 3CMQA 4PQAA 4F4WA 3FCVA 4IUFA 3A8KA 2UV8A 3IS9B 2UXCJ 4ZPVR 4DX6A 3V9UA 3PR4A 4YMEA 3L6QA 1JQGA 1U09A 4DPYA 3AD7C 3I0RB 3NGTA 1XR6A 2OELA 3WQTA 3CD6S 5K9FA 1Q8LA 2FLPA 2ILYA 3D7SB 2F63A 2RKIB 1TFWA 3MM9A 4Z2XA 3CCSN 1YJ9S 1LOTB 2Y1IA 1HNWJ 2F8TA 3TW0A 4DV0K 2ZD1B 3RB0A 3R5CA 5AQYA 4X4NA 3JSMA 2EWHA 3IBWA 1JCFA 4WFAQ 3J81U 4DV2K 2VBXA 3PDNA 4DV6F 1GK8A 1ULRA 3RB6A 3T1AA 1U47A 3CJKB 3LZIA 1HBMB 1DTTA 5LT5A 4PXDA 3BGRB 2YKMA 3LP2B 3VESA 3QJLA 2O4GA 3UR0A 3MR2A 3DYAB 4KHPK 1FNOA 3HKWA 3GJQB 3PHEA 4F3TA 4A5BA 3TABA 2V0NA 1X5PA 1LQ9A 2YKQA 5B08A 1XEZA 2CPDA 1WOOA 4WPAA 4JB8B 2QWNA 3KK3B 1N5YA 1JLAB 2HMPA 1NH7A 2KKHA 3QBXA 3VGUA 3ZXWA 1HKBA 1YITN 1U49A 4ZK7M 2FHJD 1VSEA 5AE2A 4W5QA 4DBQA 1N36F 2E7VA 3PHTA 4PPZA 1N88A 1XC3A 1DQ9A 5ETSA 2R2RA 3OJSA 2LQJA 3JAMU 2VZ9A 1C0MA 2W8LA 3EZWA 2B4VA 4KHYA 4EIAA 4ILJA 4V19J 2OAUA 1YJ7A 2EBGA 3BR9A 3NRBA 1TKZB 2NYHA 4FVCA 3CUNA 3UNGC 4PWDB 1KP6A 4NX9A 2WFBA 2J0SD 2Z2MA 2MHEA 4CGDA 1OSDA 3BDEA 5HN0A 4CJ5A 2DEJA 4OX9J 2BQ3A 2GX9A 2N4CA 3CJ4A 3MUTP 2F4VJ 2O8BB 1JLGB 1YF5L 5D4PA 4A48A 5EWFA 4DR2J 4YOVA 2JVRA 1RT4A 2V4RA 4U95A 3N79A 2ZH8A 2QA1A 2OSRA 4BVPA 2FB0A 4ANEA 4YDUC 2Q0RA 3OQ2A 4FM2A 3ISND 1PBUA 3C14B 5DGBA 3PYDA 4LF8J 2FSKA 1NJYA 1SZ2A 4KHNA 4BDZA 4DR3K 1HQ2A 3LTOA 3GE1A 2YNGB 1NM2A 2F4FA 3J7YP 2HK2A 5DM6L 3ZZZA 2X6NA 2VJUA 2FBYA 4BQLA 2DR6A 1FRKA 5G4DA 3RMDA 1NO8A 4X66F 4DR4K 3HVTB 2PSZA 5D4LA 2VBZA 4W5NA 3MM7B 2VG6B 4U8VA 2CPXA 1HPMA 3I87A 5KFLA 4J9QA 5EX5A 4KKOA 2G4BA 2E1PA 2QA2A 3I32A 2JNJA 3ZX0A 3RB4A 1YDLA 2HBRB 3QWUA 2NPIA 2HVHA 4AM7A 3FNNA 4OJHA 2AX0A 3B6OA 2CZ9A 4AQYF 4B3OB 4OYXA 2L41A 3WDOA 3M1FA 1DARA 1J54A 3EDQB 3QFHA 3LOUA 3PW4A 3H5XA 3CD7A 1IWAA 3THXB 3DN9A 2D0CA 4KSEB 4LSNA 1GXUA 4BG9A 1TL4A 2G8HA 3ZT1A 3HHLC 5CYQA 4YY3K 1CXUA 2ROPA 2GJIA 2Z2ZA 4CVNE 3G6YA 4QS8A 1Z2LA 3MPVA 4CERA 5BR8J 5B0FA 2PFUA 2RN2A 2DO4A 1NSQA 3KG0A 2OANA 4DEZA 2HIYA 3UFCX 4QYRA 3CO0P 3M8PA 3MD1A 3CJRA 5TKYA 2CQ1A 1IR1A 2CADA 4V1Ak 3L7PA 3Q24A 3O9QA 4C1NK 2W7AA 4LRCA 3S3MA 3K9KA 1FXLA 3BSAA 2VD3A 4F4XA 4GO7X 1VQ4S 4CBXA 1FVSA 3M8YA 5AQIA 5FD1A 3KLEA 2ROGA 4IFVA 3THWA 2AZ3A 1V4TA 2VQFK 3HJVA 1S7HA 5HMXA 2DPNA 5E3CA 3VMFB 2OFGX 4DCHA 3NY0A 1Y10A 3K5OA 1YJVA 1LFWA 2N7YA 3CMAN 3AVIA 2KI2A 1VQSA 4K4VA 2YJFA 2QN6B 2M52A 1KFDA 3EXYA 3MFIA 2IYGA 4DPXA 3HMJG 1VQ7S 1Q81O 1FDBA 4ZCLA 1EO1A 3CJQA 1VQKN 4GVBA 4Z0UA 3VEOA 2BANB 3RWUA 1UW9A 5FLXO 4Q44A 3VEYA 4WFNL 3W2WA 1PJ5A 1XMQK 3PLAA 2R8GA 1OH8A 3V6HA 4LUBA 5LM7E 2W2QP 1WSIA 3H42A 2O8FA 1R43A 3T5KA 3CNQP 4USIA 2M88A 4O0NA 3AVMA 3B78A 1FX2A 3PFOA 3TWHA 4BGAA 1UWBB 2R3VA 4MKBA 4ISGA 5EU7A 5AE3A 4CJFA 4F26A 1GLLO 1DBDA 2J0WA 1K0VA 4HHUA 1PYOB 4OYZA 1M1KT 1LWXA 2ZVIA 4Z4HA 5HP1B 5GMKa 3KLIA 5F1XA 1JLFA 4A8FA 2R2TA 5HK4A 1OYEA 4Y0FA 3UD3P 4CRJA 2APOA 4ISEA 2HK3A 2VG7B 1U2FA 4H5TA 1NKCA 1RAGB 5CHCB 4B3SJ 3PJWA 2VIHA 2YWEA 5HI7A 1S22A 3CERA 3O44A 3RMBA 3QRPA 3WQUA 2PI4A 5KT5A 4MO4A 1DJ0A 2F8HA 1JCEA 1YLXA 3EE9A 1Q4RA 3J81j 3P31A 1SKSA 2R8IA 2FHKA 3GFYA 2GV9A 1K0TA 4ZS6A 4ZN1A 1WUAA 2FVPA 2H5JB 4WP9A 1M5PC 3UKUB 1HR0K 5J1NA 2O8FB 3O80A 1NZAA 3PJXA 2GUPA 1P6TA 2RU3A 1IKXB 2HFUA 2MKHA 3ENHA 5FPMA 4DR2F 2UUAK 3PUFA 1KNZA 3O5BA 3MN7A 3NCIA 3CD6N 2GFFA 4OX9F 4PABA 3MOZA 2JZ5A 5AZJB 3M8WA 3OR2B 4QPTA 1GLDG 2OPRA 3NF9A 5LJVA 2XI2A 3CCSS 4OLPA 3OYIA 5DMRA 4DR7F 1YJUA 2Q1NA 2ZBQA 4A47A 3AA2A 4HUEA 1YK9A 1NSKL 2IVPA 4YOUA 1RHQB 3UNYA 1JCGA 2QMUB 3B82A 5M2UA 4JI3K 3HI9A 5ETTA 2FJWA 1ZXOA 2BRKA 4GKJJ 3V9ZA 1OMSA 4CDIA 5JXSA 1LK5A 1E6VA 1IBKF 3D4JA 1VIOA 2HF3A 3GSIA 3AHPA 1DY3A 3TNVA 2MYFA 3ENQA 1CC7A 1VQLN 1TFYA 1U2RA 3HL8A 4YB1P 4IG0B 4R8UB 2OMLA 4KC5A 2WTFA 1KQKA 3AVNA 3CEDA 1Z25A 1XTZA 2H5EA 4BRIA 1S1XA 3UE5A 1VSJA 4IH7A 3MDQA 1XIQA 2JWLA 1IKVB 2O67A 1IN0A 2R7YA 1WSFA 3MK6A 3HM9A 4PHTX 5H9FK 5HQMA 5HJYA 2ZHBA 2G8FA 3TI0A 3O4QA 5KFIA 4ZPTR 3G4SS 1NXIA 1FKOA 4K4UA 1RWNB 1N52B 2Z2LA 4Y2AA 4UUWA 3K0JA 3TA1A 4JI6J 1HKGA 4KI6A 1Q7LB 2GELA 2GNKA 3Q2SC 2BXJA 1W7AA 4LC9B 1R6VA 4HH0A 2MZQA 6FD1A 4FNHA 1B9FA 5DM7L 3DGPA 1NG9A 4C8OA 5J1EA 4JK7A 1UJ4A 2VWKA 2NZTA 3K5LA 4CD1A 4HLBA 2VPYB 3MWTA 2HWTA 4MJKA 3W64A 1TKTA 4GVEA 1IBMJ 2BGGA 1RAOA 4GV6A 1P1TA 2IYIA 3GILA 3SV4A 4CZKA 1T9YA 1M5KC 2RQMA 3LP0A 3AVLA 2Y3YA 4YR0A 2PO4A 4C8KA 5KG2A 1WC3A 1WG5A 4NB4A 4G65A 1YBTA 3BN7A 1M5HA 3V81B 2MDAA 4UQGA 2WHOA 4KHRA 1Y0HA 1FEHA 3D1QA 4KHPJ 2DD8S 1GOAA 1S4EA 4P10A 1ZPVA 1ATNA 4IR9A 4KRWA 1TU0B 4B1YB 4OZ2A 4YUDA 4Q5VA 4KR0B 2LU2A 1FFSB 2CXEA 3DRPB 3M8SA 1LV5A 1LK7A 2IBOA 1VQMN 2EFOA 2PI5A 5I3UB 3QZ7A 2HBQB 1SJ3P 3J80U 4OV6A 5IC6B 1U1PA 4NLCA 1HNZF 4CLPA 2QI2A 4UF4A 1QTNB 2FGOA 3GTYX 5G0RB 2IAJA 2DNGA 3AB4B 4RJVA 4HI2A 3HZEA 4HDGA 3ICLA 2CIMA 4DR6J 5A0YB 1ATSA 5CHIA 5GIPA 2OGUA 5SUHA 3OFFA 2JRSA 3P39A 2GGPA 1WHWA 2XMWA 2NYIA 4ILGB 1U0HA 2DYAA 1YT3A 2IIRA 1CULB 4R8UA 1R27B 2D69A 4PG4A 3MXHP 4ZVRB 2IDLA 2VFVA 1GTHA 1KBRA 1HARA 4CJVA 4YB5A 2GZOA 2RF2B 2MQMA 4URGA 2D3O1 3VQCA 4WFNQ 5C10A 5HROB 3ZFVA 1U4BA 4DUZK 3IA0A 2MZ1A 1U26A 4WYWA 1U8WA 3MGJA 4JV5K 1K73O 4YFUA 1D9FA 2CKWA 1YRUA 4XH4A 4AL7A 4OPKA 4WZQA 4BY9C 3LP1A 2VJVA 4OPJA 2Z1IA 3LAMA 1J53A 5M1OA 2ZKTA 1R0AA 2XGQA 5KFNA 1RUSA 3GFHA 2BEFA 3SUNA 5KFQA 4G9ZA 2MY8A 4WE1A 3UCUP 1VQ4N 3PKMA 3VAIA 4CD3A 2F96A 1RAFB 4FLYA 2UZAA 2NZCA 5CYQB 3ZZOA 4DV3J 2KT2A 4MMOA 4CHZA 2LECA 2AYBA 1O1WA 4IOBA 3G6ES 3H2UB 1Q95G 3RVCA 1U2VA 1M0SA 2C3PA 2M4MA 3NAHA 4JHDB 2EKNA 2RAQA 3CCLN 4DFJA 2J8AA 1BWVA 3CMEN 3G8TA 1EWRA 3L4IA 1S0VA 2YHAA 1VQ9S 5CZVA 4OPAA 1S1TB 1BHNA 2MSTA 4B1XB 4R25A 2VBWA 4DV2J 5BPLA 4JKHA 1Z2ZA 3VQEA 1AXQA 2GCFA 2D0BA 1UZHA 1J5OB 3ZSWA 3DLLQ 5KFZA 2WUSA 3JB9k 3T5LA 3MAHA 1U1RA 1MG7A 4NYFA 4CHOA 3GBTA 1ASVA 1N34J 4NLBA 3AO3A 3DLJA 2CQDA 2W01A 4CO4A 3ZLJA 2XY6A 1B9DA 2VGNA 3KLFA 3K57A 1Y64A 2CPEA 1RHUB 5KFDA 1XMBA 1Q0NA 2AEJA 2HZAA 4CM0A 3MEKA 3HM8A 3SI6A 4LBIA 4ZDNA 3I33A 3VVTA 3PV8A 4M42A 2QLJB 2F7VA 2KFYA 5GADU 4GC6A 3OVSA 2ZH1A 2ADCA 4JAXA 1ZC6A 2VWJA 2ZZNA 2AA4A 4FL9A 3CDEA 3VA3A 3CFRA 5GINA 1QM9A 1N8RO 3UCZP 3MX5A 1KAZA 1D3WA 2BJ3A 4DV5K 2BBEA 2FJBB 1WI8A 3OFGA 3ZNUA 3VPZA 1YJ9N 3GYNA 1S7IA 1IBMF 3OVNA 5AQGA 1LXNA 4X4OA 2VWBA 5A6PA 3NMAA 5FDLA 3J7ZT 4IO1A 2QTDA 4BC7A 3H5YA 3CULA 1UPMB 4E1NA 2QMWA 4YHHK 4TU9A 3ILOA 4H4OB 2VA3A 3EGVA 4H0XB 2FLLA 1JLAA 2W42A 4CYUB 2ZBIA 2ACMA 1ZOTA 4B8CA 3BZCA 1HBOA 2LCWA 2HHUA 1RBRA 2XULA 4RNHA 5DETA 1I3AA 2HQGA 3H2LA 4PG8A 2F40A 3N6NA 3IBFB 2V2KA 3P6YC 5BYRA 1RU1A 4A8SA 3DU5A 4IDKA 2VFTA 1ZA1B 4CW7B 1WUUA 3VERA 3AAWB 1IKYB 1OQ6A 1XK8A 3SV3A 2W2OP 3FVYA 2ZKUA 3PO4A 3I5AA 1N5QA 2W4CA 1FE4A 1PC5A 2GVZA 4U9RA 2HHXA 4CJPA 1RYSA 2VBYA 2AIRB 3OHAA 3AOBA 5J2PB 2HWIA 3SQ1A 3RAMA 2E5GA 2UV8G 4FPBA 2LA6A 4DV0J 1FKPA 2CGKA 2GO8A 4CLZA 3M8PB 3CCWA 2Y1RI 3M5RA 2OEJA 2HFOA 1H98A 5DG8A 1SL1A 4K41A 4E7LA 4PPDA 4N5SA 1T94A 4GV9A 4X84A 4P9SA 3U6FA 2F65A 3QINA 2DGWA 3NGRA 4D3HA 2DCLA 3V4MA 2GGPB 2MY7A 4LRFA 4J9VA 5JUMA 1FJCA 1NJZA 4FJIA 1S59A 4CJTA 2E1MC 1JLQA 3FC9A 5MAOA 2FZCB 1KLNA 2GWKA 2B4OA 1SIZA 2U2FA 3EICA 2UUTA 2NXJA 3GG0A 3DXKA 2D0PA 1A9NB 4ES3A 3OLAA 3A5OC 5GAHU 4KHSA 1QUPA 4F25A 3ISZA 3NGYA 1NDCA 3GIMA 3PW7A 1KC8T 2BE7D 2UXBF 2UUBJ 4GRSA 3SFUA 4J91A 2E5LF 3J7A1 2HBMA 3QICA 1R0CB 3D6HB 2YHXA 2ZC4A 4TQSA 4H4MA 2BE2B 2VPWB 3J7AN 2DTUA 1S48A 3FQKA 2V4QA 3N28A 4KB7A 5HBMA 4WIIA 2DR9A 3IFEA 1K9MO 1I6JA 2C3UA 2RJZA 3TZZA 1D1UA 1T44A 1TL1A 3R7NB 2IA6A 1KAXA 4K2JA 4DF4A 3E8OA 2E1ZA 2LA4A 3VGMA 3PX6A 2ASLA 1RHRB 1VSKA 4IRDA 1EETA 1U2VB 2FJEB 4DX8H 2YPZA 3KLHB 1H7XA 1WG1A 1XR7A 4LJMA 2G8WA 1K8KA 1RBSA 2GQCA 4CF8A 2LDYA 3BYRA 3CJCA 2QWOA 4YB6A 2V34A 4JI1F 3HYFA 4M5DA 4FXVA 1T3NA 4KO0A 3OYNA 2MB0B 1IH7A 1T02A 3C8YA 2B4JA 4B9NA 4DTPA 3W7BA 3IM9A 5D4NA 1HBUB 2M9KA 4DV3K 2Q43A 1LWFA 2FHOB 3M1VA 3CPWR 4NXNK 4K43A 4OLBA 2IPOB 3EGNA 4WFYA 4PA1A 3ZT2A 1VJWA 5JVGL 1N48A 4JI2K 4LF9F 4Z37A 3N6LA 4NLUA 4CEAA 4K25A 1BA1A 4CHPA 3K17A 4LFAJ 1QUVA 2E88A 4F0HA 1VISA 2ZJRL 3I9ZA 2UUAJ 4DL2A 3HFZB 1VQMS 3BEGB 3GCXP 4HEA9 5LL6d 4M7YA 2HEKA 1X4GA 1IBLJ 3G8QA 1LEOA 3C0BA 3E9PA 3FUYA 1YTAA 1SKWA 1YAGA 3TAMB 4JKCA 1WD6A 3FR0A 4FW2A 4X62J 3A3NB 5C2CA 1RCOB 2CPHA 1NHVA 3N9UC 5AXLA 2W6KA 4KH4A 2G0IA 2XC9A 1X4EA 4IEEA 3TQEA 5C2GA 4Q0BB 1XMOF 1S97A 2XS2A 2B5JB 4WKYA 3TTDA 5B0EA 1S5ZA 2UUCF 4J9PA 1HL6A 3R8EA 5SWMA 4C97A 2BJ1A 4FOIA 4B9QA 4RO0A 4AL5A 3S41A 4LF4K 3G25A 4Z94A 3AVKA 3LM9A 5I3UA 2OFHX 2XZTB 2W7OA 3G96A 3W8PA 1UTAA 5I4MA 4UY8T 1H0HB 3OL7A 3F9MA 3IGNA 3KIOA 4C8ZA 3MPWA 3BEXA 4LREA 2Y0BB 4OX8A 5D0RA 2H48B 3VV2B 4LF7F 2QL9B 3H45C 1QTMA 4QWBA 3PXGa 7FD1A 3QYYA 2KJWA 4ZTJA 1V3SA 4FXDA 4NLTA 1MU2A 4URQU 4NXNJ 9ATCB 3NF8A 2X1FA 4HCBA 3A8IA 3OTOF 1BQNA 2FJDB 4BRLA 2MZJA 5EWGA 4B9SA 2VDIA 3L09A 2ZJPQ 4USKA 4O5BA 2L9NA 4EUVA 4K8XA 5K8OA 1HYSB 2V8GA 4MYUA 3EPIA 4TU7A 3KD5E 2RHKA 3V6JA 4YDDB 2W9BB 3OTCA 3C94A 2JC0A 3DLGA 5KFWA 5DG9A 1JXVA 1VQ9N 5F8JA 1TL1B 4KBOA 4CJLA 2HMIB 4XPEA 3LWMA 2HNDB 3KJVB 3MM8B 2NUHA 1RXOB 4QWAA 3QEVA 3H5SA 1LCUA 4ILHA 4NPOA 3VAMA 2CJQA 4ZPCA 3CJ5A 1YWXA 2OA8A 3DM2A 1BE4A 2CVIA 4CT8A 2YTCA 3S8SA 4F4ZA 2LQ5A 1J5EK 5B0BA 3FGVA 1FX4A 1TKZA 1VQ5N 2D1CA 3H20A 2ZUGA 3ZNJ1 5KFTA 2P9UA 5EY4A 4FWPA 1A6LA 3DRRB 3PIPQ 1FHTA 2CDQA 4DSKA 2HYIB 3EX7B 1KOOA 2OZSA 1EP4A 3U7JA 5K5MA 4JBCA 4FWLA 1QHAA 4XTTA 2J0QD 2J9CA 4DV0F 2C3OA 1CS4B 4DL5A 2JGUA 2QRRA 4RL1A 1T9VA 1KTQA 2OPSA 4CZHA 5FPNA 4E19A 1IO2A 2ILZA 4CLLA 3MEEB 3A0IX 4DF8A 4EYIB 4OJRA 4DL0C 3QIDA 2V2QA 1FNXH 1DAXA 1OYDA 2VPXB 3GLJA 2I8EA 4DQSA 1IBLK 2KXHA 1IJFB 3F56A 1DEJA 4FJNA 4ELUA 3KNGA 2FBXA 2Y1LB 4BRKA 1B0VA 1DURA 2P6TA 3PEJA 4U7UD 2M5YA 5AQKA 1Y5LB 2RDDA 1APSA 3RRGA 4CTAB 5KQ8A 2RS8A 3LP1B 3AO5A 1TELA 1NH8A 4ED0A 5BREA 5A2QO 4O4GB 4IFVB 3MXMA 3SMZA 4DPUA 1IR2A 3AO4A 2AMCB 3FGUA 3CF5Q 4ZHRA 4X64J 5D4OA 1NGBA 1W26A 2W25A 2YKPA 3FZLA 1FEEA 1N54B 4LF1A 2Z8QA 4JI7K 2LEBA 3VEZA 3RW6A 4DR5K 2QKKA 2AGQA 3KLEB 1X4CA 1HWUA 4X4SA 2OP5A 5B0DA 4DR3J 5HATA 3W66A 1P27B 4WJBA 4IJAA 4R0EA 4P2MA 3TWZA 3KJQB 3E2EA 4RBUA 2WZ1A 2G0JA 4WF9Q 4DCJB 1WKKA 2M70A 2QZ8A 3DLLL 4F4KA 1VRQC 2ZWHA 4IOCQ 2B8QA 2DITA 2AGPA 2HAFA 2WSCC 3A8EA 3GIRA 3DWLA 2ABYA 2F8EX 3GQCA 1VK0A 4BS2A 4W90B 5E3AA 3QAEA 3VQ7A 2IM0A 1FERA 4JI5K 2D0OA 3MN9A 1VMBA 2W6LA 2O1PA 3T1YJ 1GLAG 3TVZA 1SKRA 5U47A 1NJIT 3US5A 2HVEA 1F5CA 1CPZA 1UWBA 4LIRA 1FRJA 2VDHA 3VGTA 4U7BA 3M2UB 4LSZB 4ATNA 1JJHA 3ZTQA 1QVGM 2AW0A 3QJPA 1MN9A 1RWWB 3W5ZA 1T0TV 1GOCA 4P72A 3V9SA 2LEPA 3W9JA 1YHQN 4OJ1A 4OQJA 1XMQF 3L95X 3T9ZA 2ZM6J 1DHMA 4K4WA 3QIPB 3IDHA 2L08A 4DPOA 4CF9A 1TL7B 4V19X 2DNYA 2P5GA 1CLFA 3BBFA 2F1FA 3ETOA 3L8BA 5AQXA 4QIWD 4HKQA 1NRKA 3VAJA 3V1RA 1C0UA 3DOMB 3IG1B 3L7UA 3LANA 4OI6A 2EX3A 1HMVB 1W9HA 3CW2C 5DJBA 1C0FA 3OV7A 1S9FA 4CHYA 2HRTA 4KV8B 3QSYB 1RLCL 2XMTA 3D45A 2QC3A 1XQSC 4HTJA 1N56A 1O13A 2I9SA 2ATCB 1JNZB 3VENA 4L76A 4X4TA 1W25A 2J6SA 4K50A 3ENVA 3G86A 4NXMK 3ZZPA 2VFRA 4NYNA 3PIOQ 3E3XA 4URSA 2HBKA 2ZGZA 5AFUA 1YJWS 1PJ7A 2A3JA 4NCGA 2VG5A 1VQLS 3Q86A 5DS7A 3C6UB 2UU9F 4JKFA 3DKDA 5M1KA 3IAS9 5KFBA 2DNZA 3HSDA 4PL8A 4NYPA 4DL4A 4NXMJ 4F3QA 2VF3A 4RR5A 7FDRA 5T7BA 2MKKA 2J9DE 2H9ZA 3MPUB 3RSEA 1ZBUA 5A6WA 1C1CA 2V94A 5AE1A 4WIQA 1X9JA 4TQRA 4C3KA 4ZHRB 1NNDA 4I69A 3UPFA 4AL6A 1SH2A 3CC7S 1B7FA 3QT8A 4GMKA 1RCXB 4E7IA 1SV5B 3TSQA 2E6MA 1SC1B 1AYEA 1XQIA 2IHR1 3BSCA 4OI4A 3KHGA 4K4ZA 4KH1B 3KK3A 1N5YB 4ECZA 4DCOB 3RUBL 2IC3B 4GKKK 5LMNK 1EB0A 1C6VA 4JD2A 5L38A 3OYHA 4X66K 3TAPA 1YBUA 3WXKA 4IDHA 2MQ8A 1RT1B 3KUGA 1KXPA 3T1HF 4CJWA 5GMDA 3L2VA 2HPUA 1TYQB 1IKWA 1IM4A 2BKNA 5IQQA 3DDNA 3DLRA 5CZ2A 4B02A 3ULEB 4MFBA 1CJTA 5LMUJ 4J37A 1N33K 3VF0B 4ES1A 1M5OC 3HSCA 1O0PA 1BOTO 3OJUA 4FPIA 2PFDA 4I6AA 4F4AA 3GFXA 2MHNA 3VWSA 2G8IA 2XZDB 2W40A 3B54A 3UIQA 3WC2A 3AJDA 2HAIA 4CEBA 2CA9A 2BH1A 3BGRA 1XHXA 4M3UA 1LXJA 1TMJA 4P7VA 4U7UK 4DX5A 2C2EA 1QAXA 1RTIB 2DKOB 4H4MB 3FK4A 3ILJA 3ENBA 1S12A 5AZJA 4OZNA 3GPAA 4C8LA 1ZZNA 1VBYA 1UKUA 4NE9C 3MMJA 4KFBB 1QSLA 4FLXA 2CYYA 1GX5A 1ZM9A 5KOWA 3CXCM 2W4PA 1YVUA 1HNIA 5AXKA 1GMWA 4HTLA 1OIAA 1YZ7A 3LGHA 2UUCJ 3HCXA 4C7QA 2DR8A 2NRVA 1SJRA 1F9EB 2DISA 4FF4A 4RX6A 1TKXB 3CDBA 1DLOB 3MAQA 1NGAA 2LMIA 2M0GB 2DHGA 2BJEA 3AVBA 4KTZA 1UFLA 4CWBA 2KQ2A 1G2EA 1TV6B 1CVJA 2V50A 4RWXA 4OO1J 1Q79A 3OBIA 4FBTA 4G1QB 3CC2S 1F9HA 3KG4A 1EWQA 4FZVA 2ZQBA 1OS5A 2DH7A 4EI2A 1VQKS 4GC7A 1GLCG 3THVA 2NNWA 3G10A 1GH8A 2RS2A 4J9LA 4EWTA 2AU0A 2G13A 1VQOS 2ZH2A 4JHDA 3SIPB 1BD6A 3V6DA 4E7HA 2A0FB 1BIZA 1NZ8A 4DDFA 4DR1F 4FYVB 4H03B 4KHPF 1HYSA 4YDXA 2OZMA 3CM5A 1S1TA 2JX2A 3OW2R 2KO1A 2D1KA 2R7RA 2UUWA 1S3XA 4C11A 2YX7A 4XDDA 3ZTOA 2XMUA 1KC8O 1WORA 4KI4A 2CPFA 2VQEF 3AA4A 3PSIA 3OL9A 4X66J 2EK1A 2HVDA 2XWXA 3KJNB 3TR5A 1X31C 3KFWX 5M1PA 4A4JA 2OJ3A 3LDNA 1I51B 1YGYA 2ZFHA 4WQ4A 3JSRA 5GAHP 1TVRB 2MQLA 2F9TA 2J6UA 3ZSOA 3JS9A 1ZBFA 4IEIA 4JRQA 3ZX3A 2Q6BA 2P9LA 5KRTA 2VUGA 3MCPA 1EX4A 4AHRA 1ZBTA 3LPEA 2OI2A 2G2ZA 3MMAA 4FYDA 3OYJA 3HPOA 4ZVOB 2NZ4A 2DVIA 2P9SB 3VF4A 2E66A 3AY9A 3IRXA 3CCES 3TAGA 2J8SA 2R7QA 3KMSA 3GSDA 1FXRA 3M05A 2LQBA 2P9UB 3MPYA 1VFJA 3HVAA 1UOCA 4CK3A 1VQ8N 2UXBJ 1N6QA 5ETVA 3BREA 2F9JA 4I1TA 3C65A 4OYWA 4C0OC 3QT7A 1FK9B 1TK0A 5I42B 1AUDA 4XO0A 2ZWOA 1CJVB 2F5GA 4LR9A 1RDRA 5DDPC 2E2NA 1KLMA 2KW4A 7AT1B 3SZ2A 3KTQA 3PIPL 1OH7A 4X65J 1Y11A 1LWEA 2I5JA 5A8KB 4P75A 1BUXA 1AB8A 2E7XA 2LKZA 3EJMA 5EOYA 2FC8A 2AJFE 2EEYA 5CE3A 3DLKA 4PCQA 3FE1A 2B43A 4CJ7A 3F44A 4KB1A 2HNYA 4IRKA 4ID1A 2YWWA 1RA7A 1S49A 4JI4K 3IG1A 2QGFB 5HRPA 1DRZA 1NAQA 1BL3A 2YNHB 1HHSA 2NRZA 3AJ2A 2HG4A 3QGPA 1WBDA 3MTJA 2CNKB 1CQMA 1S1VA 1U1NA 5F0WA 2YWKA 2XNRA 3VOVA 2YH1A 4QIEA 2B51A 2NCKL 5KPRA 4J2EA 2XG8A 2KLAA 3PY8A 4K4SA 5KRSA 3CF5L 1KQSR 4AQYK 3BY5A 4DJBA 1FWPA 4A57A 2NR0A 2WAQD 5A8RB 3KLHA 1U0SA 3K5PA 1SI9A 5I3QA 4F2SA 1S1UA 1C2PA 2FVQA 3CIMA 3O6QA 4ERDA 5BN8A 2DEIA 3BH6B 5KFFA 1TKTB 3DXBA 1DTQB 3OFHA 3O08A 1F2GA 2K1RB 3C3LA 1RB0A 3OXFA 3P5TL 5BR8K 3NS6A 1BU6O 3KK1B 4PUOA 5KTQA 1KVJA 1VQ8S 5J2MB 5KGWA 4MKAA 1HNWF 4M5MA 3M8QA 3SEOA 4CBUA 4WTYA 2VOPA 3EVMA 3G82B 1V3ZA 1KVBA 1RWXB 2QJ3A 4JI4J 2B5JA 2AJQA 2KN4A 1Q5YA 4CJQA 5KAKA 4O23A 4FS2A 4Y34A 1TUUA 3DHWC 4JI2J 4Y0WA 2IJFA 4WU3A 1HA1A 4A8WA 2YVSA 4BR9A 1DQAA 3UD4P 4U96A 1FWLA 1U7LA 3DXKB 3PEHA 4OPHA 3RYLA 1CZ9A 4CZIA 5H1SQ 2J6TA 1VRUA 1KLMB 2QKBA 5EX0A 4OYIA 1B7YB 2WB1D 1JKHA 3D3BJ 3EE3A 2IDOA 3OYBA 4JYAK 1WEZA 3SBGA 4NLSA 4CEZA 4CJSA 1UJ5A 3L0QA 3FZHA 3OR1B 2ASMA 1S9GA 2A6AA 2H54B 1QY7A 1ZA2B 4NLWA 4UZBA 4L72B 3P5JA 4UY8O 3QEWA 5LJ5Y 2DY9A 1VHXA 3RMCA 2KTQA 5KFPA 2HFZA 1EQMA 3THWB 5F9NA 4LBHA 3D6FB 3HXMA 3CJ8A 2E5IA 3NXZA 3OR2A 3R27A 4X62F 1IQTA 3SBTA 1HJOA 2Q2RA 2XM3A 1VBXA 1FDDA 1LKZA 2O8CA 5T14A 2HHHJ 1B4SA 4DR2K 4IKFA 4LF5J 2CJKA 4QW9A 4DLEA 4EAHD 4YP3A 3CJAA 1NMDA 2HHWA 4OI1A 1SC4B 3LL3A 5EX3A 4OKEA 8AT1B 1U1QA 4OZ5A 2V52B 2PY5A 2QXFA 2KVIA 4RW7B 2OLWA 5L39A 4LSLB 4HR2A 3WIUA 3OVBA 1YIJN 2DNMA 3QIPA 2GVDA 1QS4A 4CLYA 2JJ4D 1X7VA 3MN5A 1FD8A 1H6KX 4Y2KA 3HSZA 3OSPA 3D2EA 2P9PA 4ZJQA 5AQOA 1KFSA 4FWOA 4NRUA 2YKNA 5LY3A 1X0PA 4F02A 3KHYA 3HVWA 4WP8A 1ESVA 2GUIA 3H46O 4IR1A 1QZ6A 1KONA 2E29A 3KKSA 4PR6A 2YH0A 4BBYA 3JYTA 2GX8A 1ZTWA 1LFPA 2DGOA 3FDSA 1K1SA 1XNQF 5DRKA 1FESA 4Z4IA 4GV3A 2QXLA 4H0OA 5KFSA 3GONA 3TTFA 1LW2A 4CJKA 1R8PA 3F73A 4O0IA 1YBAA 2LP4A 4Z7CA 3KJFB 3ITHA 4C4WA 1BI4B 4M63C 1UVLA 4BDPA 1LAWA 1AROP 5GIOA 1GQEA 3MD3A 1VQ7N 2RHQB 1TL3B 4AM6A 4OHWA 4ELTA 4AHVA 4FJGA 1UEKA 1BGXT 3H2VE 3W65A 2UXDJ 3MCOA 4OZ1A 1M90T 3EGZA 4LF6F 2PA8D 3KLFB 4CCHA 1RTIA 2BJDA 2PC6A 4EO6A 4DQQA 2IMWP 3EKSA 1VHFA 2DT9A 2YNIB 3OFEA 1T95A 2BUPA 5A8WA 3HHLB 4ZJLA 4FPRA 2RE2A 1RYRA 2PYLA 3UKRB 2IFXA 3FEYB 2P9PB 3ZSZA 1HKCA 4WFXA 4FNIA 2A41A 3A5MC 1VK3A 2HFSA 3AARA 1D8ZA 1HLWA 4E3SA 1N4LA 1Q8BA 4BG8A 5FRMA 2ZE2B 1RT6B 3D9BA 1HI1A 1W0HA 3NOCA 5DDQC 2O8EB 3GIJA 2V67A 1WEXA 2AV5A 2DCUB 3EKUA 2GEMA 4MT1A 3BF3A 3ZSRA 1FTCA 3WUHA 3EVOA 4DV5J 1F6TA 3D2WA 3CCQS 4UOHA 2YKMB 4A8QA 5CD4A 2NSBA 5CQGA 2Z0GA 3MMAB 1U1LA 4P74A 2AHOB 4FW1A 4AT1B 3ETMA 2BANA 2ZJRQ 2ZVSA 2CQ0A 4XK8C 4DQRA 3I8BA 3BBCA 3SI8A 4RNNA 1XNQJ 2EXUA 3I8DA 3JSMB 5F2RA 3ALYA 4CLUA 2DNLA 5KFXA 1HWLA 1NBEB 1G6BA 4DSIA 2HQ3A 2X3GA 3CCMN 4OIXA 4TU8A 1VC6A 4RNOA 1R8HA 3MR3A 2YNFB 4X4QA 4M3RA 4ZTFA 2XLKA 4N41A 3O9RA 4OGCA 1NDKA 3RAXA 3EZOA 1Q86T 4F50A 1UVJA 3ZZRA 1TAQA 4CJRA 1X4FA 4ECYA 5F8LA 4EEYA 5JVGQ 1X0FA 4CZLA 2E4LA 2UVUA 4M3ZA 1RT3A 2V4JB 2HBZB 1PSDA 4M1KA 3AVHA 4GY2B 4QU6A 1M1KO 2QFIA 4E89A 2UUCK 2V7YA 1UAXA 3MMCA 4UT4A 1W2BR 2HF4A 3NLCA 4Q2LA 1UA1A 3JAMY 2PEHA 5AR0A 4Y2IA 3JSYA 1QQNA 3RJMB 3QETA 4IOAL 3J81O 3BGUA 2HFVA 1QE1A 1Q9YA 1FRXA 3DRXA 5GAEI 2EFVA 1SL2A 1SJQA 2P5OA 3DOLA 3EO3A 4QPXA 4TY9A 5B7WA 3LZJA 1RAEB 3MR7A 1VQ5S 2ASJA 2RNEA 5AXMA 3VEWA 5KFOA 1FW6A 4W5OA 1S57A 3WXIA 3CC4N 3MN6A 2ZBRA 1HMVA 4DOZA 4CFCA 2BR0A 4IO9L 2DXFA 1Q5VA 2XEXA 4NO7A 3H6EA 3FEZA 2OHDA 1S1UB 1U48A 2E5LK 4ECTA 1IWGA 4CI6A 2BKPA 5CA5A 1W7WA 2YCHA 4USVA 2QEXS 2CJXB 2MLXA 3ZX2A 3B6PA 2IVOA 2GC8A 3CFPA 2JFDA 3OTOK 4H4KA 2P6SA 5A2QY 4NYOA 4MFBB 1CJTB 2AF6A 1X9SA 4NA3A 1RDDA 3AVAA 4TN2A 4DSLA 4X4RA 3NGKA 1F0XA 2Q1LA 1PILA 2YNHA 4A8OA 2DK2A 3RGIA 2UP1A 1HBNB 3HZGA 5IT0A 3TZXA 4JKAA 1PJ6A 3KLGA 4X2BA 1HIYA 3WXJA 2DGTA 3OYFA 2W9CB 4CZCA 1SH3A 1S9EA 4YY3F 3V4IB 3ULDA 1S1XB 5HMZA 3VQAA 3VTHA 4X64F 4B3MK 3LUYA 3CE8A 4GVLA 4CJEA 3AVFA 3VN5A 3WXLA 4EYHB 5GMEA 1G15A 1AFIA 3ENOA 3OYEA 1WOPA 4FYYB 3TX8A 2FLOA 5JS2A 3CCVN 1RWOB 1NPRA 2R8JA 3IUCA 5BRHA 2VODA 3NH2A 2HGLA 5L1IA 5M1QA 4HT5A 1BO5O 3V4IA 2QLWA 2HSEB 5EXWA 1R6YA 1QLNA 1VSHA 3RW7A 3HT0A 3CO9A 2YY3A 2YNFA 1NCLA 4OYAA 5LMNF 3M6XA 1TUVA 4I67A 2FUG9 1HD1A 2B9YA 4C2MA 2UXCF 3DOKB 4FK2A 1J6ZA 2PBDA 2FQQB 5ADZA 5KFUA 3AB2B 3JTPA 1IJJA 1S72N 1NLKL 4BRPA 3NGDA 4EK2A 1D0EA 3T69A 3R7SB 4AILC 3F0NA 4LIWA 3W2VA 2C28A 4JN4A 2QMXA 2YJEA 3SQ0A 2NXEA 3AVJA 1TUWA 3U1MA 4M5GA 4JS5A 5KFVA 1XI1A 3T6BA 3MMVA 1Z26A 3MCMA 4WBFA 3KWMA 3PJ9A 1ZBSA 4RKUC 1QAJA 1L3VA 2WVBA 3HVTA 3C46A 2IRXA 1ZPWX 2HGMA 3WHIA 2ZM6K 2V5HG 1OWXA 3CDWA 2YX4A 1ZS6A 4OZLA 4ZVUB 5BYQA 4QQBA 1PYTA 4PKIA 4K5SA 3ZT0A 3G8SA 4A62A 1HPZB 3Q83A 4OL8A 2JC1A 2AP1A 3M2VA 3J8AA 1Y97A 1V5VA 2WONB 3A3OB 3AD9C 2JLEA 3HVRA 1S1VB 4OHVA 1WSVA 2P9EA 1MWZA 3CJ1A 3OYAA 4BRNA 5D78A 1HNZK 2FVSA 1EHWA 1N5VA 4DZDA 3NH1A 1IQZA 4C23A 4WFAL 1SPBP 1U1MA 4PY5A 1OKJA 2I38A 2CH5A 1HJRA 3MR5A 2M2BA 2OTJN 4CE9A 4QIFA 6AT1B 2HNDA 2OO4A 1RT7A 2HMIA 2FBTA 2FF3B 3THTA 2P2CB 1NKEA 4LH5A 4LF7J 4Z4EA 3TEGA 4JI3J 3T19A 4FF3A 3O3GA 3H1QA 5DZ7A 3UN5A 4PL7A 1M5SA 1NGFA 5C0YA 2QA4S 2A6OA 2HRUA 2PFFB 1T03B 2GVZB 4NZ0A 3CYMA 2ADBA 4NYZA 1NU0A 4LF4F 3HFKA 2KRRA 3ZTRA 5DDOC 3RTVA 3E66A 1L3TA 5L9XA 4RUCA 1R3NA 1S79A 3CJ9A 2WB4A 3QESA 4CEFA 3GWCA 4BGBA 4DUYF 3EMTA 1RBTA 2GJ2A 1KS2A 3UB5A 2YHBA 4DTJA 4CZJA 2HBLA 5LSLA 4QR0A 3PRBA 3CC7N 2WRMA 1G99A 1B0TA 1TVRA 5C5JA 5L9NA 3RBEA 4P7TA 1VLOA 1SCJB 3EYZA 1QVFM 2WVFA 5HL7L 4LF4J 3JSBA 2J9DA 3IO1A 3I0SB 2GHVC 2GW8A 1E6YA 2RDIA 3Q8RB 4DTMA 2N82B 4J7CA 4HUGA 2ATQA 1JNRB 3RBZA 5HSPA 3OT9A 2MQOA 2NQPA 3GMGA 1H73A 1RT6A 5JVHL 5LXRA 3RMAA 1F1BB 4I6WA 4HTUA 2OPPB 1N32J 2HHTA 3OD2A 3EWGA 2GAHC 2KYZA 2UU9K 3EY1A 1SB6A 5JMVA 4LF5K 3BZQA 1RFQA 3SAHA 3NBPA 4TSXA 3M8ZA 3OYDA 1WOSA 1XNRF 3U4LA 2QO3A 4CO3A 5HMYA 3VAHA 2OSQA 3QFUA 3FBEA 2VFUA 5KFCA 2ITGA 4FVUA 3AVGA 1SKUB 3U9DA 4GW6A 1VQYA 4U67L 2OMOA 2QW9A 1RBUA 1V3RA 1MNEA 3KUEA 2D4WA 3VTIA 4ENOA 3O9TA 4DR5F 1TKDA 4CH0S 4JI4F 1NK0A 1VQPN 4OHYA 4FLVA 2GIRA 4WCEQ 2KVQE 2D3ZA 2R7XA 5EVZA 2K06A 4ZCMA 4USUA 2QWMA 3CJTA 4NMLA 3QEIA 4I0WA 2HHHF 4MH8A 2CJBA 4W5TA 1YKWA 1FFWB 3KDOA 1OJ4A 3OY9A 1AZSA 4QOTA 1C1BB 3J80O 4AFFA 2IM3A 1D5AA 5A76A 3KDNA 3TZYA 3DRPA 1OSCA 1FA0A 5KFAA 2ZJPL 4CF0A 5A8RA 3OTBA 1XMOK 5JLFA 1P8ZA 4LSNB 4WXWA 1WLJA 3MECA 4QYZK 1SIWB 2AT1B 1R7IA 4ZIVA 4ZVEA 1SQFA 3CT9A 5HOOA 4ED2A 3Q2TC 5C25A 5KFJA 2LFVA 1YVNA 4JI1K 4X4PA 3MXJA 2AJ2A 5ELZA 2MKCA 4LF8K 3MDFA 3HBTA 1QZ5A 3QEXA 5HBMB 3AO2A 2IJRA 1DZ5A 3IXQA 3P8BB 3BDPA 2HBJA 4DV4K 3OXLA 2EFNA 3EPGA 1VJQA 4BR4A 4ED7A 4E0DA 1VC0A 2FY8A 4J9SA 3I55N 3VHQA 1HI0P 2D74B 4ICLB 1EZZB 1NKBA 4J90A 1D09B 2W2MP 1TK8A 4WXOA 2FVRA 4M8LA 4CNZA 1KQFB 3QSIA 4RW7A 4WZMA 3PACA 4A2AA 3M3ZA 1WF0A 3QJJA 2BW2A 2V51B 3JQJA 2WW4A 3R97A 4FLTA 3Q7BA 3QFWA 1S4FA 4WYLA 4W92B 1B92A 2PE8A 3M7VA 4MO5A 4IBNA 3P3DA 4OGEA 3LDSA 3F2KA 4IH6A 2G2OA 5CD4H 4J9KA 4BRAA 1C4CA 2DFFA 3MM6B 5JS1A 1S9GB 3GG4A 2RILA 2E5LJ 4IFYB 2QX0A 3TUZC 3T3FA 4PZVA 5IQ6A 4TY8B 1MMLA 2ZBPA 1LWCB 4PAAA 4R5PA 1T3OA 2K8GA 1K44A 4P52A 1DGKN 2B3TB 2WBRA 3VZHA 4A8MP 1YQHA 2Q36A 4DL6A 4O8UA 3KOAA 1C1AA 5AQHA 4OHZA 2B9EA 3C95A 4OYPA 4M5LA 2ROEA 3M6GA 4Q43A 3NNHA 2H3EB 1VLYA 5E33A 2A3ZA 5KG6A 2YXLA 3MAAB 4K42A 4M3YA 4NZ6A 1DTQA 4ED1A 1M90O 4HWIA 2NXCA 5AQPA 3VF2A 2QT7A 2KHDA 3W8GA 3G82A 4FPAA 4AF1A 1YZ6A 3CCVS 1FNMA 2K3IA 3PRDA 3AOCA 3JTNA 4FS1A 3VEVA 2YHWA 4L3NA 2E8AA 3OVAA 1EQYA 1CJKA 4FWKA 1Y00A 4E2FB 4DTNA 1EETB 1MWYA 1V6HA 3O4NA 3LQVA 1U04A 5D3GB 1VC5A 4CGHA 1O8BA 1X3MA 3HD1A 2D41A 4OLAA 2ZE2A 1QQCA 4LRDA 1OO0B 4X4VA 4AUKA 3SCXA 4B1WB 1SXLA 1BCMA 2KXFA 4LFCJ 3LP2A 1HFEL 3BKFA 9RUBA 4I2QB 3NAIA 1QD1A 1FJGF 1YUWA 5FIIA 3K2PA 3HI0A 3SQOP 2ZJQL 4LF6J 4EBDA 4OVLA 1FRMA 2LQ8A 5DQIA 3A2FA 1R59O 2KM8C 1U6FA 2KL8A 2E9ZA 1RDCA 1G7CB 2BA9A 3BGLA 3KUHA 2X74A 3O1BA 3OHBA 3S9HA 3MF5A 1RGIA 1BMQB 4ZVGA 5C15A 4MDBA 1T6DA 2XRIA 3FLCO 2M7SA 4DV3F 3DM2B 2I5JB 2X3DA 1KQSM 1XBWA 5L46A 2QIFA 1LNQA 4YS2A 2OIHA 2XHBA 3NEKA 1JLQB 2CQBA 2OCEA 4L75A 1XHZA 5C24B 3OYKA 4HVJA 3SYZA 1MLAA 2O66A 1UMJA 4HUFA 5LJ3Y 3U02A 4BRGA 3NAEA 4M3TA 4XH1A 5D6GA 4PG5A 4RCHA 5JICA 2VQEJ 3NBPB 3Q8SB 3OXGA 2H5IB 4P71A 2E9TA 1F3FA 1WEYA 3I56S 3T1HK 3WT0A 3T6JA 1NU4A 5BR9A 1S6PA 2ZH4A 3PM9A 1XNRJ 4X65K 4LFBK 2YKOA 1SL0A 4HHHA 4DS4A 4I7FA 3V9WA 4NOHA 4N7TA 1N33F 1YTYA 1WF2A 2VICA 4C98A 1IKYA 3CXCR 3LM2A 4Y2CA 2F4VF 2D0AA 3HOTA 1VRTA 2DPIA 4EGLA 5C12A 1T3VA 4KHUA 4DR6F 4YB7A 2VB6A 1T9UA 4N56A 1QVGR 2UVVA 4CFDA 3PCOB 1N0VC 1WC4A 4ZLJA 1WNSA 1RI7A 5FLXU 3ZSYA 3ONQA 5BYSA 3CIZA 5IV4A 1R89A 4B9MA 3R6LB 4AXJA 3MCSA 1RTZA 2J9EA 2Z30B 2RIJA 4B9VA 3NCRA 4C6AA 1W2BM 1TTHB 1H72C 3LGNA 4DUTA 2BW7A 4O3PA 4HH1A 4P2XA 3HSTB 4NCBA 3F9KA 4KIAA 5MLCQ 4C11B 1I3OB 3ADAC 3O6WA 3GIKA 4I7FB 1SH0A 2DIUA 3AA8A 2IY5B 3FEXB 1WC5A 4JI7F 3E01B 1G4CA 3NMRA 3FSIA 1F2HA 4ZPDA 3FZ2A 3DAWA 2GMHA 4TLQA 4IOXA 3FFKB 4H4OA 1K1QA 5HL7Q 3H0PA 2OTLN 2P9NA 3ZSVA 4RW9B 5ETPA 1H1VA 3NCQA 2FVCA 3OW2M 3FFIB 2A2DA 1RWKB 3S7RA 1U25A 1CULA 1FD2A 2MZRA 2VC0A 4NLQA 5F8MA 3UO0A 1WN7A 2VGMA 5C24A 4L8RB 1M1HA 2W2NP 4KT0C 4KJIA 2FY1A 2BUNA 3MX2A 1U6ZA 2FD2A 2LU1A 3BQ0A 2AYEA 5KI6A 1D9DA 3KK2A 5M2PA 1PYSB 5LMUF 1WDTA 5FROA 4FJXA 4IH5A 4FOEA 2POKA 4DR1K 3CETA 2LVWA 2O5DA 3GU0A 3AD8C 4DQ8A 1X9WA 4WWSA 3WBZA 1HNVB 4OI3A 4FK4A 1J5EF 3D5MA 4FZZA 3JYTB 3GG1A 2FTRA 3L3VA 3IR5B 2FSJA 2EVZA 3BF4A 3TJ8A 3KYLA 5AJ3J 3W5XA 1I94F 1S76D 4KYZA 3VA0A 4HT7A 3BZKA 2ZWPA 3VETA 4IG3B 5D3GA 3WZ0A 2CQGA 2W8KA 4J9RA 2F8SA 2C3YA 1U2CA 3J7AP 3HHEA 1QAYA 4B3TJ 2ZZMA 3R2DJ 4DB3A 2XY7A 4CJ4A 2WVDA 2BQUA 1GMVA 3AXKA 3PR5B 4H5RA 4ES2A 4MK7A 4NXMF 4A2BA 3BO4A 5DZ6A 1N36J 5CYJA 4CIFA 2XGPA 3FZFA 5LSOA 1SQGA 3PZPA 4H5VA 1NBWA 3EUNA 3QT5A 3C14A 1U8SA 2GHPA 3NFAA 3SQ4A 1NUEA 2LLZA 4C1NI 2HS4A 4B9UA 1Q16B 3H5UA 3SSRA 3T41A 1BWEA 2D7SA 4B3TF 2ZOFA 4WK3A 2VL1A 1J2VA 1X4BA 5DDRC 5M2RA 5CABA 3H3NO 2C22A 3IC1A 3QO9A 1BWFO 4OI0A 4Y1DA 2Q3PA 3QWPA 3FBFA 5IC4B 3QRQA 2E2OA 4LMZA 1YI2N 3NL0A 1KVAA 4LF6K 3R7BB 2VG5B 3FQLA 4WF9L 2P9NB 5AQVA 3IMQJ 1NGDA 4O4RA 2J7KA 3D28A 3D2FA 2RF2A 4ILMA 4QWEA 4RW4A 3OYLA 4IG0A 1SVDA 1HD0A 3O1LA 4DLGA 4JYAF 4E8UA 2W7PA 1VOMA 3G71N 4K8RA 2QYGA 1GLJO 4F67A 1A5XA 2ZGYA 2E1CA 1IUJA 3LGMA 4OZ3A 4PKHA 5G0RA 2QL5B 4JI5F 5CAAA 4O5FA 2XYGB 1ZZFA 3UN2A 1YJWN 1HLUA 1WC1A 4CTAA 3THXA 4DR5J 1UL3A 3I82A 2IDEA 3M30A 3U1LA 1SC3B 3MEEA 1N5SA 1S10A 1JLBA 4YOEA 1PC4A 3THYB 3W61A 4DTXA 3BM7A 5KG7A 3AXMA 4MLHA 4USJC 3IBCB 3LF0A 3QGGA 4JV2A 1VQNS 4CJ3A 1KDNA 1F5AA 2DR7A 3OTEA 4XAKA 1HBMA 3DFEA 2Z2YB 1HNWK 2R9LA 2SXLA 3FSYA 4K4TA 4LH4A 1JLCA 4LF7K 1VBKA 4HHTA 4L74A 4IRCA 5A8WB 1WC6A 1BDGA 1NOYA 1EX8A 4MIAA 4F3MA 1FI4A 3NP5A 3BS9A 4LD0A 4HHJA 2ZOMA 1N34F 2GS8A 2CQIA 1EQ0A 2Y1JA 2XMAA 1C0UB 3DOMA 3SK3A 3MHYA 1NGCA 4TKTA 4UW2A 1RDWX 2NUBA 5I9EB 2RT3A 4EZ9A 4W4MA 3EGWB 3C16B 2I7PA 2GMLA 4OX7A 2VQFJ 3M8RA 2CH6A 4J2DA 1JJ4A 2Q79A 1TP7A 1S6OA 4CIOA 1YHQS 2XMJA 4QZVB 1VSLA 2AZ1A 4NRTA 4QU7A 1AA1B 2QSFA 1H3DA 3I4HX 3IS9A 3M2UA 2IOCA 3H3OB 4CEDA 4FJJA 2O01C 1NPPA 3KJVA 1EKEA 2IMOA 3TX0A 3OUYB 3VQ8A 3Q8YA 3SPYA 1S0OA 1U1OA 1Z05A 2N7CA 3TUPA 4F7VA 4FJ5A 4JK9A 5HP1A 4A8KA 3L3CA 2R2SA 1N0UA 4O4GA 2MLYA 3I96A 3I56N 1NJWA 3NVKA 3FMWA 1UZDA 3MM5A 3SJJA 3G0ZA 1NB2A 5C42B 1WSEA 3HULA 1WELA 2E2QA 4K4YA 2PT0A 1UAWA 4ZVFA 1RAIB 5HLFB 2XSJB 1VSFA 5I42A 3CCMS 3SUOA 3MFHA 5HAOA 4K4XA 2IIHA 1YJRA 3QNNA 1X9MA 4O55A 2GVDB 4B3RF 2YWHA 3ISNC 3TVYA 2HZVA 2JEFA 4DSFA 2XY8A 3L7OA 3DU6A 2V2VA 2EKYA 3C66A 4ZMMA 3Q0AA 1FJ7A 2FDNA 3DYAA 4ISFA 4ID8A 4DU7A 1TQLA 4CH1A 5F9LA 2C2OB 2BJ7A 4M3XA 4Q45A 1NK6A 5M1NA 2BM0A 3NNAA 3SCIE 5HJXA 5D0GA 1X4DA 4AHCA 1LW0B 4ETXA 4DV1F 3CDAA 1S77D 3K9JA 3V9XA 3O8MA 2XTJP 4KB0A 4P6QA 3IFRA 4G3IA 3QZ8A 2DGQA 3BO3A 3THPA 1U45A 1VSIA 1VSDA 1SJ4P 2RQ4A 2BOAA 2YQ0A 1ZETA 4ZKAA 1SBRA 2YHYA 1CEZA 5LJWA 4FWQA 4ANCA 3PG9A 1HHTP 1XWLA 4G1IA 2CPIA 1PO6A 1IXKA 4WQ4C 1T9TA 2E1YA 2DHAA 2FF6A 2VPZB 3H8YA 5HQ8A 4J2AA 4KGZB 3BGOP 2RKIA 1Q1KA 1OH5A 2RQCA 5KG4A 2XLJA 3OBYA 4DSEA 2HB5A 3E1YA 3QBWA 1IKXA 4KH5A 3MUVP 3O4WA 3UQSA 2NSCA 4BE1A 3O3FA 2K1RA 2UXDF 1N33J 4E7KA 4JKGA 4PXEA 2MXYA 2CNOB 3DXMB 1HRHA 2F8MA 4LQ9A 2BTFA 1SC6A 3M8QB 2HHHK 4O3SA 3KKFA 2DBBA 1ZH5A 2Q0UA 1OPZA 2FHJA 1UVKA 1VDHA 1DLOA 1X8DA 2NRXA 4QS9A 4B3RJ 4ALZA 4FDFA 2ACYA 4NLVA 1Q8KA 2DHXA 2QWRA 4CEEA 4O3NA 4C8YA 1L3UA 4WQ5C 5ETNA 4MYTA 1XC9A 3TR8A 4DHYA 1KOHA 1Y4ZB 1BHLA 3KLGB 5M1FA 5ETOA 3KD1E 3M4XA 2QM1A 1NMNA 4KV8A 4JI8F 2JOQA 3BN4A 3BJYA 2C2NA 2R7UA 2AGOA 1K8KB 1A5WA 1ROFA 4FN5A 4BLGA 4MDAA 3H40A 2CQ2A 2XMVA 4KH6A 5ADXA 4LF8F 3RAQA 1NDLA 4JYAJ 3EM1A 2BKOA 4KGVB 1RE1B 3J80Y 5IV3A 5BR8F 2XS5A 1NK5A 3PYEA 4CLTA 3BSOA 4N8OA 2HLUA 4BREA 4QIVA 4Q8FA 3R1HA 5KFYA 4I9QA 3KZBA 5E3PA 1IJEB 1YJTA 5K8PA 3SNNA 3CMES 1EKSA 1F21A 1GT8A 3FKBA 2YNGA 1IM6A 4DZ6A 4JD2B 5A2QU 3V1OA 4LFCF 4JKGB 3NE6A 2X7IA 2C2ZB 3WC0A 2JEIA 3OLBA 3QT6A 2JLGA 3ZZ0A 3VQ9A 1HNXK 4O44B 4FKYA 2HS0A 2V4JA 3ZEUB 3D3CJ 4NEYA 4QCLA 2HLTA 2NXUA 3QMLA 5J2NA 4FJHA 4CM2A 2RPIA 2NUUG 2R7SA 4C8NA 3TP2A 4R5PB 4OJGA 3BUZB 4UQTA 4HACB 3DLKB 1IBKJ 5FLXY 2W4DA 2KDOA 2KFNA 2C2KB 4IFYA 3Q23A 3WNGA 3W0LA 2LSNA 1VRUB 4M94A 3V1QA 1RT3B 2A6MA 4B3SK 1XNQK 3GR1A 3Q8QB 2KHOA 1RT1A 3CJBA 1S0MA 1LWEB 3FFIA 3P45B 4EBCA 3PW0A 1VI7A 2XBPA 4OJ3A 2P51A 3ZTSA 3TPQA 4ZCIA 3OSNA 1URRA 4X62K 2R2UA 1T11A 2QLBB 1HYVA 3MI7X 1ZTTA 2J7WA 2BOPA 3TAQA 2CGJA 4M45A 3MR6A 4PXCA 4CFBA 1WKLA 3N4WA 4YY3J 3FCWA 1YRXA 2BABA 2V9KA 1JJ2R 2O8DA 2P5VA 2I1RA 3RU0A 4DWIA 1OVYA 1RWPB 3EN9A 2PN6A 1VBZA 2AKWB 5D0EA 2UVRA 1RQ0A 3BP8A 5GAGI 2B7BB 3PYGA 4CZGA 2YQ3A 4F3OA 2XHWA 3DHXA 4BRMA 3SJHA 3N6MA 1JJ2M 3QPIA 5KT4A 2V8VA 2W2PP 3OPKA 1T9XA 2FIUA 1Q81T 4CHNA 5E2QA 2CAJA 3UI3A 5AQQA 2D9OA 1SJFA 2N3LA 2B6AA 1GLEG 4DKWA 2HQIA 5IWAK 5F8NA 1K8AO 1TL3A 5E26A 2X1BA 1IVZA 3T7ZA 5KQDA 3MEDA 4TYBA 4Q7AA 1TUYA 3Q22A 1RBOB 2RRBA 5GAHI 3P5BP 3ET6A 1GMUA 1ZM2A 3G87A 4FK0A 3MEGB 1HNVA 1VK8A 2QWLA 4P2FA 2HSTA 1NHUA 3LDPA 4DR1J 4BE0A 2P9GA 3B6BA 4QOZB 2DIVA 8RUCA 3QNWB 3A4TA 3IR6B 2PDAA 3MM8A 3N01A 3G9CA 1PBAA 3W63A 3M6VA 1SQKA 5E41A 1NJXA 5L8RC 3DRYA 4KHMA 2JEGA 4OLOA 5TKWA 5FJ4A 1VIXA 3W1YC 3U3YA 1C4AA 2N3OA 5KT3A 3O9SA 2NLWA 1X5OA 5CZXA 2KKZA 3MEDB 4BC9A 1CJUB 4OKKA 4ANDA