4AHUA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
155
structure length
153
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahuA00
3SV4A 1S1XA 1ZYQA 4DTPA 1LAWA 3AVCA 1S1VA 1BCOA 3QEWA 1TK0A 3OYNA 3RR7A 3LALA 3PX4A 4IKFA 4F2RA 5I42A 1KVCA 3AO1A 4KAZA 3TWHA 1KCFA 4L8RB 2XY5A 1NK4A 3AVFA 1JLGA 2IS3A 4H4OA 1TV6A 3V1OA 2Z1GA 4DTJA 3AVIA 1U04A 4O44A 1TL3A 4BWJA 3DLEA 2P5OA 3I0RA 1VSMA 4FJNA 4NCGA 2E4LA 2D5RA 4C8LA 4OKJA 4O0JA 3QNOA 1SUQA 4CIFA 4DTNA 1ZBLA 2VG7A 3ASMA 3C95A 3T3FA 3VA3A 5JS2A 4OVLA 2QXFA 4FJ5A 3HJFA 3L3UA 3OYKA 4B9NA 2DY4A 5HBMA 4QCLA 4ZTJA 5E41A 3QEVA 1RDAA 1T03A 1JL2A 1C0MA 2ITGA 3ZT4A 4CGFA 4HCCA 1TKZA 3M8PA 3T1AA 3OY9A 1IKYA 3B6OA 4AH9A 4JS4A 1RILA 2P5GA 5FRNA 1VSLA 2HHUA 3C6TA 4ZTFA 3M8SA 4HHTA 3OYLA 1BQNA 1S1TA 1L5UA 4DS5A 4DFMA 3TR8A 1VSIA 4CEAA 1BL3A 3ZT3A 3VQ4A 3LZIA 1J9AA 4FXDA 3AVJA 3AO3A 1NK6A 4CE9A 1UAXA 1Q9YA 1HRHA 1IH7A 2Z1IA 1BISA 3M8QA 3NGYA 3OYEA 4AHCA 1EKEA 1ASUA 3HP9A 3O4QA 3QESA 4J2BA 4KI4A 4DQRA 1QSLA 3TAPA 5D3GA 1TKTA 2W42A 4O5BA 5KRTA 3O3HA 3TAMA 3PO5A 1BIUA 4DTUA 3SUOA 4W5NA 5K14A 1QSYA 3IRXA 1L3TA 4EP5A 3AO5A 3EYZA 5SZTA 4O0IA 4B9SA 1WLJA 1U47A 1CLQA 4ZHRA 1LAVA 3C94A 1U48A 3HPOA 1XHZA 3V9ZA 4I9LA 1SKRA 1XHXA 1DTQA 2EHGA 3QERA 3PX0A 3JYTA 3QEPA 4E7HA 4CHZA 1SL0A 4AHRA 4NCAA 3VQAA 3VN5A 1LWFA 3LP0A 3QIOA 3S3OA 1VSHA 1TKXA 5J2NA 1I3AA 3T19A 1U4BA 4NYFA 1ZBIA 3VQCA 1U45A 2YNHA 5FDLA 4CHNA 4ELUA 1HMVA 4DFJA 3KLHA 2KTQA 1DTTA 4CJPA 3LANA 3ZSQA 4CJQA 4CEEA 4HCBA 1RT2A 1NJYA 2OZMA 3NF9A 4ID1A 1QTMA 4OKKA 3RMDA 4FJHA 4CJEA 2D0BA 2HVIA 1EXQA 3I0SA 2HNZA 1NK5A 2F8TA 3ZSOA 1RNHA 5C24A 2P51A 4M3WA 1WAJA 2DFFA 3K57A 1B92A 4IG0A 4DU1A 2R7YA 2Y1IA 1HNIA 3PY8A 4OLBA 3ZT2A 2HVHA 1N5YA 3LAKA 5KGWA 2HB5A 2DFEA 5EU7A 3WNEA 4AHUA 3DLRA 5KTQA 3KLEA 3TAFA 1NK8A 1T7PA 2IGIA 3DI6A 2IDOA 1TL1A 4FK4A 3K2PA 1RBTA 3QO9A 4W5OA 2YNFA 2OYQA 1LWCA 4R5PA 3KLFA 1IKVA 1UOCA 3BGRA 4J2DA 4PY5A 3SNNA 1NJWA 3MEDA 1JLQA 5HRSA 4FW2A 2XO7A 5C42A 4G1QA 4DSLA 1XC9A 3TABA 3DOLA 2HNDA 4H4MA 2ZQBA 3THVA 4J2AA 1JXBA 3RMAA 3RRHA 5CYQA 2RN2A 1RDCA 3AVMA 1Q9XA 4FJXA 2G8UA 3VQEA 3D45A 3AVHA 1SKWA 2G8IA 1JL1A 3OYBA 4KB0A 2OPPA 3SQ0A 2PYJA 1VRUA 3K5MA 3ZSVA 1NJZA 3VQ6A 3PUFA 4DTOA 4Z4CA 2BDPA 3OYDA 2OA8A 3CYMA 1KVBA 4KTQA 3ZSRA 2E6LA 1TAQA 2GV9A 3DMJA 4CECA 3S3NA 4F3OA 3SPYA 2HHQA 4CJ5A 3TANA 1W9HA 5J1EA 4YFUA 2JLEA 1WSFA 3DLKA 4N56A 1RTDA 4FLVA 4OPJA 4RW4A 1JLBA 4KKOA 1LW0A 1REVA 3WNFA 1TGOA 1KTQA 4CJWA 4M3ZA 4KHNA 1VSKA 1KSPA 4O55A 1WSHA 2FC0A 4CCHA 3P1GA 3LDSA 3RR8A 4F8RA 3L2QA 5FROA 1J53A 3HO1A 4AHTA 4CIEA 3S9HA 3AO4A 3A2FA 4QAGA 4CJ3A 2OZSA 3HSTB 4WE1A 3KKRA 1SKSA 5HRRA 3WNHA 4CHOA 3LWLA 4FJKA 3F9KA 3LP1A 2RF2A 3IS9A 3P83D 3NF8A 1EX4A 3ALYA 4CFAA 5C25A 3OYHA 1C0UA 3V9WA 1N6QA 4HVJA 2OPQA 2A1SA 1ITGA 3DRSA 3ZT1A 3HVTA 3ZSYA 4BE0A 4C8MA 3OYGA 3U3YA 4FK0A 3CG7A 4CF0A 3V9SA 1SL1A 3SPZA 4LSNA 1X1PA 4RW8A 3HPGA 4DSKA 3AA2A 4FW1A 4B9MA 1RT1A 2YKNA 4FVMA 1J5OA 3PO4A 4DQPA 2HHTA 3HXMA 2XY7A 4HUGA 1I39A 1QS4A 2XY6A 1T05A 2BANA 3OYIA 4B3OA 3SYZA 4CGJA 3QEIA 3V81A 3KD1E 4PUOA 1DLOA 1ZBFA 3SJJA 4KPYA 2YKMA 3K5LA 4HUEA 4CJLA 4DSFA 3C6UA 3DYAA 2I5JA 3K5OA 3SUQA 4DU3A 1S1WA 4DMNA 3UIQA 1X9WA 4QOZB 4E1MA 1RCHA 3VQQA 1RBUA 1NK9A 4OJRA 3ZSZA 4DQIA 2G8FA 4ELTA 4B8AB 1FKPA 2IOCA 3DM2A 4N5SA 4CJUA 4E7LA 5KGXA 1BIZA 1RTJA 3P5JA 3HYFA 1KLNA 3TARA 4BDPA 2B5JA 4Z0UA 1RBVA 3H08A 2VG6A 2WOMA 4W5TA 3G10A 4DTRA 2PYLA 1HJRA 1BI4B 3EZ5A 1CZBA 1XWLA 1YTUA 3LP3A 1S6PA 3ZCMA 1IG9A 4IFVA 4LD0A 4LY7A 3MXJA 4CFCA 1LV5A 4BE1A 3OYFA 3ZT0A 3G0ZA 4FZYA 1VSFA 2LSNA 3VQPA 5CZ2A 4E7KA 1TVRA 1LWEA 3K59A 3NGIA 2X6NA 3SV3A 4M3XA 2G8HA 1WAFA 3MXIA 1UA0A 4TSXA 2Y1JA 3AO2A 3NFAA 3OJSA 3AV9A 4KHSA 3K58A 3HT3A 3QETA 4CEDA 4N41A 3TAGA 4HTUA 5FRMA 4E19A 3V1QA 4CGDA 2YHAA 2O4IA 5JS1A 4DQQA 4DF8A 2NUBA 4DFKA 4E0DA 4IDKA 3SQ1A 4ICLA 4CF9A 3HM9A 3QEXA 4Z4IA 1HQUA 1JLEA 2QKBA 2Z1HA 3KD5E 3O4NA 3V4IA 4EZ9A 1NOZA 1QE1A 3VA0A 2QK9A 3KK2A 1S9EA 3VQ9A 2E6MA 3QINA 1TK5A 4BACA 4LH4A 4K8ZA 2HHVA 4W5RA 1BGXT 3KIOA 1S5JA 2GUIA 1RT4A 4KV8A 4XIUA 4B9UA 5HROA 1JLFA 4IFYA 4C8OA 4FZZA 2BGGA 1QQCA 3SI6A 1JXEA 2O4GA 3IG1A 4FJ8A 5I3UA 2GBZA 1F21A 1JKHA 4DFPA 4OGCA 2OPRA 3EY1A 1S1UA 1FK9A 4CK1A 3NGZA 4CEFA 5J2MA 2OPSA 4PQUA 4CJTA 1RDDA 3WNGA 4DLEA 4F3TA 4FLTA 2X6SA 4M41A 4DSEA 2YNGA 1B9FA 2X78A 4AHSA 3DLBA 4ELVA 4DLGA 4FJMA 3VQ5A 1RTIA 4CF2A 2KFNA 4FZXC 3KLIA 3L2RA 3ULDA 1SV5A 1GOAA 3NF7A 3OVNA 3KLGA 2G8WA 1NKCA 3AVKA 1X9SA 3OS0A 5T7BA 3OS1A 4E7JA 3OJUA 3OS2A 3AVLA 1QSSA 1TAUA 3LAMA 2DFHA 1UA1A 1TK8A 1HYVA 4PA1A 3SZ2A 4Z4EA 1VSDA 3ITHA 4IG3A 2B6AA 1C1AA 2FBYA 4PWDA 2DTUA 4CIGA 1ASVA 5CY4A 4E3SA 3AVBA 4DWIA 3LPUA 1J54A 3HK2A 2KFZA 4Z4FA 4RW7A 3HL8A 3NH2A 2YV0X 1WN7A 1O1WA 4JLHA 4AHVA 4BDZA 2HNYA 1NK0A 1FXXA 4CHPA 2XRIA 4E89A 2XY8A 3NH0A 1C1CA 3M8RA 3U3GA 3PV8A 3TI0A 4DSJA 4RG8A 4KHUA 4KREA 2HHSA 4JRPA 2VWJA 1KLMA 3B6PA 3OYJA 1IKWA 4CGIA 4FK2A 4FJIA 4CJKA 5KI6A 5SWMA 3AA5X 4Z4GA 1BI4A 2EX3A 3I8DA 1RT6A 2ZE2A 1Q8IA 1VSEA 4FJLA 4M3UA 4UQGA 1U49A 4NYNA 1ZBUA 3ISNC 3OYMA 4CESA 1ZBHA 1C0TA 3OYCA 3SQ4A 1T8EA 4Y1DA 3LP2A 4DS4A 3MEEA 3L8BA 4FJGA 3KKSA 1Z26A 1VK0A 2D0CA 2Z1JA 1L3UA 1RTHA 2FBVA 1L3SA 3KK3A 3K5NA 4FLWA 1R0AA 1VRTA 3CQ8A 4OGEA 3OYAA 3KK1A 3F73A 4O4GA 1RT7A 4KTZA 2YHBA 3VQ7A 4DG1A 4MQ3A 2PZSA 1HYSA 1WSGA 2B4JA 4FM0A 3S3MA 5DMRA 3VQDA 4DU4A 3AA4A 1RT5A 4NCBA 1FKOA 4CJFA 2G8KA 4CEQA 4B8CA 4FLUA 4FCYA 3NDKA 1EP4A 1RT3A 3SUPA 1QHTA 4IBNA 4CFBA 1BQMA 4N76A 3E01A 1JLCA 2KQ2A 1D9DA 4Z4HA 4KTWA 2F96A 1CXQA 1WNSA 4DTMA 1KVAA 3TAQA 1KRPA 4EP4A 1BCMA 4FJ7A 4I7FA 5HP1A 1C1BA 4CJ4A 1MU2A 4CEBA 3MXMA 4KI6A 2HHWA 3V9XA 4FLYA 3JSMA 4CJSA 4RW9A 4FJJA 2VG5A 4CHQA 4M3RA 3MECA 1XI1A 1D9FA 4CJRA 3NBPA 1ASWA 2ZD1A 4I9QA 1YVUA 3SUNA 4CJVA 1Z25A 4I2PA 4BDYA 3U6FA 2BE2A 3NCIA 4E1NA 2HMIA 1K6YA 3NE6A 3RMCA 4DQSA 3DLHA 4KO0A 4KHYA 3QIPA 1LW2A 2QKKA 3AVNA 1JLAA 3KTQA 4H8KA 3NH1A 1CXUA 2KZMA 3O3GA 4Y1CA 4F4KA 3L3VA 1S9GA 1NKEA 3L2UA 1RBSA 4CEOA 5HRPA 3CFPA 1HPZA 3DOKA 2ETJA 1YT3A 2IC3A 4M45A 4DTXA 1KFDA 2WONA 3NF6A 3MAQA 4J2EA 2VWKA 1GOBA 4N47A 3L2WA 2FBXA 1NKBA 4B9TA 4M42A 1SL2A 1TKDA 3RRGA 3AA3A 1IO2A 1WSJA 4CERA 3LWMA 4I2QA 4CGGA 2RKIA 1UWBA 2A1RA 3TAEA 3HPHA 4CF1A 2P1JA 4GVMA 4FLXA 1NOYA 3CFOA 1B9DA 1HQEA 1EETA 3QLHA 4ID5A 2G8VA 1A5WA 4BWMA 3RWUA 1BHLA 3RTVA 4W5QA 4K8XA 1Y97A 1YTAA 4KB1A 4FM2A 1RBRA 1WSEA 4KHWA 2YNIA 1HYZA 4KFBA 4C8NA 4CGHA 3ZSWA 4CEZA 3LZJA 4OKEA 1NK7A 4JRQA 1CZ9A 3DRPA 1X9MA 4E7IA 3D0PA 4FYDA 4JS5A 3SCXA 4MFBA 4GMJB 4C8KA 1VSJA 2ATQA 3V1RA 4OPKA 2Q3SA 5HLFA 4F2SA 3RMBA 5J2PA 4OLAA 3NHGA 1S6QA 1HNVA 2IAJA 3VQ8A 3CM5A 4B9VA 2X74A 3O3FA 3V6DA 4FLZA 4M3YA 2KZZA 5DK5A 1RDBA 4KRFA 2FBTA 2JGUA 2RPIA 3LPTA 3ZSXA 4B08A 2XHBA 2AJQA 4YNQA 1A5VA 3VQBA 3AVGA 5CYMA 3KJVA 4DSIA 3DRRA 4HUFA 4BE2A 4FM1A 2F8SA 2KW4A 3AVAA 3HVRA 4CFDA 1D5AA 5CZ1A 1L3VA 3NAEA 1G15A 4LH5A 1A5XA 5KRSA 1C6VA 4CK2A 1NJXA 4DTSA 5HRNA 4M3TA 4CHYA 1IKXA 4GW6A 4LSLA 3FFIA 3CFRA 3CM6A 3DLGA 5J2QA 4Q5VA 3HP6A 2D0AA 4DF4A 3SQ2A 4EZ6A 1D8YA 1WSIA 3QNNA 1W0HA 3MEGA 4RW6A 4AILC 4FJ9A 3V9UA 3BDPA 4KHQA 4Q0BA 2HHXA 2PY5A 4B9LA 3L2VA 3IAYA 1GOCA 1KFSA 4CK3A 3PX6A 2HW3A 4CF8A
chains in the Genus database with same CATH superfamily
4JI8K 4A5BA 1S22A 3AVCA 3BEXA 2P9PB 1OVYA 1OVQA 5I42A 1KVCA 4CZHA 4KAZA 4BQLA 1N8RO 1NK4A 1JLGA 3WQTA 4DTJA 1U04A 5AQKA 1TL3A 4BR2A 3I0RA 2NLXA 2WBNA 2A40A 2E4LA 3T69A 3QNOA 1OH7A 4CIFA 3CMAN 3ASMA 4RCHA 3C95A 3T3FA 1HJOA 4KH5A 3CETA 2CGJA 3FE1A 2GTDA 3O1WA 4ZTJA 1X3MA 1T03A 3BZCA 4HCCA 1X3NA 4JKHA 1IKYA 1M90O 4JS4A 1KAZA 2O8BB 4IEEA 3M8SA 4HHTA 3HM8A 1S1TA 1N34K 4CEAA 1BL3A 4DR3K 4X64K 1IBKK 2YJEA 1Q9YA 1IH7A 3OYEA 1HR0K 4A2BA 1EKEA 3HP9A 3QESA 4J2BA 2GEMA 4MO4A 5D3GA 5CE3A 1BIUA 3WXIA 1QSYA 1BDGA 4B9SA 1LAVA 3C94A 3HPOA 5LL6Z 5C10A 1DTQA 3QEPA 1SL0A 2YCHA 1T44A 2A5XA 3VN5A 3LP0A 1IG8A 5J2NA 3T19A 1U4BA 3PIOL 1NGIA 3AAQA 4UY8O 4ELUA 2KTQA 4WQ4C 4CJPA 3LANA 4CJQA 5AQHA 2OZMA 2O8EB 4GV3A 1G99A 4L3QA 1CZAN 4DV7K 5C24A 3GDQA 4B3TK 1WOQA 3K57A 2QWMA 4DU1A 4IG0A 2R7YA 3CCMN 4FOEA 4QS8A 3SMPA 2HVHA 1TL1A 1MA9B 2I7NA 2YNFA 2YHYA 4FL9A 2HMPA 3CJBA 4FW2A 5C42A 1YJ9N 4G1QA 4DSLA 3ULEA 2ZQBA 2P9SA 3RMAA 2RN2A 1RDCA 3AVMA 4H0VB 4FPBA 5DM7L 4B3RK 2G8IA 1JL1A 3OYBA 4KB0A 2OPPA 4GNIA 1ILYA 3VQ6A 1NGHA 4PKGA 3CYMA 1KVBA 3D2FB 1TAQA 4CECA 4F3OA 3SPYA 4M7YA 2P9IA 5AQIA 3CHWA 5JLHA 1WSFA 3VENA 4FLVA 4OPJA 3R6MA 1TGOA 3C7NA 3B8AX 3WNFA 4CJWA 4CZLA 3VERA 1VSKA 4PL8A 4CCHA 2Q31A 3CJ1A 3L2QA 1J53A 3HO1A 5KPRA 4AHTA 3S9HA 3E9PA 3A2FA 1J6ZA 3HSTB 4BR5A 3WNHA 4CHOA 2NRHA 4FJKA 4BQZA 2HBKA 3F9KA 3EE8A 1Q81O 5C25A 1C0UA 3V9WA 1N6QA 2OPQA 5BR8K 3ZSYA 4BE0A 3ID8A 4C8MA 4CZGA 4FK0A 1SL1A 4RW8A 1ZBSA 5BRDA 2QWOA 3D6RA 4BR7A 3AA2A 1RT1A 3AY9A 3VEYA 4HUGA 5AJ3K 2XY6A 1T05A 4JKDA 2OCEA 4CGJA 3QEIA 3SJJA 3K5LA 4JK9A 2H3GX 1S1WA 3W0LA 4V19S 2HSTA 4E1MA 1DT9A 4CBWA 4A57A 4DHYA 2G8FA 4LF5K 4CJUA 3DXKB 4E7LA 1BIZA 1RTJA 3P5JA 1KLNA 4FWLA 2B5JA 1RBVA 2VG6A 3MK6A 3OHRA 5BPLA 3EZ5A 1CZBA 4H5VA 1IG9A 2A3ZA 4LY7A 2P9PA 3ZT0A 3G0ZA 1YIJN 5CZ2A 1TVRA 2O8DA 4BRHA 2X6NA 3CJAA 3CCQN 3HOSA 3QICA 3UKRB 4CEDA 4HTUA 5C2FA 3M3ZA 4H0YB 4DQQA 4DF8A 1MDUB 4IDKA 4KBOA 5ADXA 1JLEA 2Z1HA 4K43A 2UU9K 2QK9A 1S9EA 3VPZA 4YORA 3QINA 1TK5A 4CBUA 1WB9A 4LH4A 4BRPA 4W5RA 3VEVA 1BGXT 2GX9A 4BG9A 1S5JA 1RT4A 4KV8A 3THYB 1NJIO 4C8OA 2VGNA 2ZM6K 1JXEA 5I3UA 4DFPA 5F1XA 4F9OA 2HBMA 5AQUA 4PQUA 2F7TA 3WNGA 4DLEA 2P9NB 2X6SA 3U8XA 2YNGA 1B9FA 4AHSA 2KFNA 3KLIA 3ULDA 1SV5A 1GOAA 1ZXOA 3OVNA 1X9SA 3OS0A 3QFPA 4RTFD 2A6AA 2OANA 4E7JA 4LF7K 1QSSA 2NRWA 1UA1A 3SZ2A 3ITHA 2D0OA 3CD6N 3CMEN 5CY4A 3MX2A 3VMFB 3RSEB 3NH2A 5ADXH 4BDZA 1O1WA 1DEJA 3J8AA 1NK0A 4CHPA 3TI0A 2XY8A 4ILGB 3PV8A 3U3GA 4FOIA 4KHUA 4IWVA 4BGAA 1KLMA 4CGIA 2FSJA 4OX9K 3R1XA 5KI6A 4Z4GA 1BI4A 1ATSA 3SAGA 3HTVA 1RT6A 1Q8IA 3L0QA 3P31A 1U49A 1ZBHA 3SQ4A 1T8EA 3QFUA 5AQFA 4PKHA 1HKCA 3LP2A 4FWSA 3KKSA 2CGLA 3VEXA 1R0AA 1VRTA 3F73A 4O4GA 1RT7A 5EXWA 5BN8A 1NGGA 2B4JA 5DMRA 4DU4A 4NCBA 4JD2B 2G8KA 4B8CA 4FLUA 2UUAK 3NDKA 1QHTA 3WEEA 3E01A 3TPQA 2E5LK 3O9TA 1D9DA 3MCAB 1WNSA 3A5NC 3TAQA 5HP1A 4GY2B 1GLDG 2GUPA 3JSMA 4CJSA 2QI2A 2P9KB 3GL1A 4CHQA 4CJRA 1ASWA 1NGBA 3Q7CA 5AQLA 4B3SK 3KTQA 3AVNA 2KZMA 1NU0A 4Y1CA 1P90A 1LCUA 3ATUA 3CFPA 4JAXA 3AGRA 2WONA 4RWTA 3L2WA 4B9TA 4BREA 1NGAA 3RRGA 3AA3A 4JHDB 1WSJA 1JJ2M 3EO3A 2RKIA 4H5NA 3DAWA 4JD2A 4CF1A 3VGMA 2Q1NA 1WUAA 1NOYA 1B9DA 3QLHA 4ID5A 2G8VA 4BWMA 1HKGA 4K8XA 4CW7B 1SZ2A 1YTAA 2NRRA 3BP8A 2UYTA 4CEZA 3LZJA 3H1QA 4JRQA 4JS5A 1FW6A 2ATQA 3I55N 5J2PA 1HNVA 2HBJA 2PBDA 1YXQA 4FLZA 5DK5A 1RDBA 4KRFA 2FBTA 2JGUA 2NRXA 5LMNK 4YNQA 5E26A 3VQBA 5AQRA 4DSIA 4HUFA 2F8SA 2KW4A 4YOWA 4CFDA 1G15A 2QWPA 5AQZA 3HI0A 4M3TA 4BC4A 4LSLA 3CFRA 3I8BA 3HP6A 3RSEA 1D8YA 4FJ9A 4AILC 3D2EA 3MN7A 5LMUK 4KHQA 3C65A 2PY5A 1P8ZA 3IAYA 3LDQA 4CK3A 3LDLA 2ASPA 3C7NB 1S1XA 1S1VA 1BCOA 2FSNA 3QEWA 3OYNA 3LALA 3PX4A 3CJCA 4H03B 4ISGA 3ULEB 3AO1A 4A5AA 2IS3A 3V1OA 2Z1GA 2E2NA 3AVIA 3DLEA 5HOOA 2NZTA 1VSMA 3EZWA 4B3MK 1EWQA 4NCGA 2D5RA 4C8LA 1SUQA 3QMLA 1ZBLA 4FJ5A 2Q0UA 4OVLA 2QXFA 5JS2A 3OYKA 5E41A 1Q86O 1OH5A 3CQXA 3PIPL 4CGFA 3CPWM 3M8PA 1M1KO 4AH9A 3VOVA 1RILA 5FRNA 4FO0A 5I9EB 3VEZA 3C6TA 4ZTFA 3O4WA 3BF3A 3OYLA 1BQNA 4DV1K 3VQ4A 3MN6A 1VQLN 3UKUB 3AVJA 3J80O 1NK6A 5TKYA 1IJJA 3CJ9A 2WTUA 1BOTO 3NGYA 5CHIA 3O4QA 3O9QA 3BF1A 1RGIA 3TAPA 4YOTA 1TKTA 3O3HA 1L3TA 3CCVN 2HF4A 5SZTA 1WLJA 2UXDK 2OTJN 3DLLL 3V9ZA 3GG4A 4IOXA 3PX0A 3QERA 3FZMA 1LWFA 1VSHA 1HMVA 2FXUA 1S72N 4B1UB 2FF6A 4C23A 3IKMA 4HCBA 1RT2A 1QTMA 4OKKA 3IUCA 4XEIA 1HLUA 1R59O 4MO5A 5AFUA 3OA9A 2HNZA 1VQKN 3ZSOA 1RNHA 2P51A 3O1BA 2DFFA 2Y1IA 3LM9A 4OLBA 4FPAA 5KGWA 3WNEA 5EU7A 3A8YA 4BR4A 3DLRA 3TAFA 1NK8A 4FK4A 1RBTA 4W5OA 1T6DA 1EQYA 4R5PA 2E20A 4J2DA 3BGRA 3CXCM 4DR4K 1QZ6A 4KHPK 4PY5A 3SNNA 3HRGA 1JLQA 3AGKA 5M1OA 4FWNA 3DOLA 2HNDA 3THVA 4J2AA 4FJXA 1Q9XA 2G8UA 5IWAK 1XC3A 5GIPA 3J81O 3H6EA 2UUCK 1VRUA 3ZSVA 1QVFM 4DTOA 2E2OA 4Z4CA 1Q7YO 4IDHA 2VQFK 3ZSRA 2E6LA 5C12A 5DM6L 2GV9A 2HHQA 4CJ5A 1J5EK 5J1EA 4K42A 2JLEA 4N56A 3CPEA 1LW0A 3A0IX 4JN4A 4FWKA 1WSHA 3SLCA 5FROA 1BWFO 3NVMA 4QAGA 4JEPA 4A2AA 4G9ZA 3KKRA 2E88A 4IFEA 3D7EO 4EFHA 5HRRA 3LWLA 3K0SA 1KAXA 3LP1A 3P83D 4JI6K 2V7YA 3NF8A 1EX4A 2VGMA 2RHKA 2YHWA 3ALYA 4JKGA 4CFAA 3THYA 1IBLK 2JWLA 4BRFA 3DRSA 1Q18A 3AAPA 5JVHL 4JI3K 3SPZA 1BU6O 1X1PA 4LSNA 3M1FA 5AQOA 4DSKA 4GV9A 4FW1A 2HHTA 4FVMA 1J5OA 2ITMA 5HL7L 1I39A 4DKWA 1VQPN 2BANA 3KD1E 1TUUA 3C0BA 3N4QA 3QDKA 4B1XB 1OH8A 1K8AO 3C6UA 5EY4A 3VTHA 3SUQA 4JI7K 1SS6A 4FWPA 3EEQA 4QOZB 3EKSA 4AM6A 3I56N 1GLCG 1EO1A 4N5SA 1KXPA 5F2RA 1VQNN 3CERA 3TARA 4Z0UA 1XNQK 1YTUA 1BA0A 3LP3A 1S6PA 3ZCMA 4IFVA 4LD0A 4CFCA 2AA4A 2LSNA 4BGBA 1QZ5A 4E7KA 3EN9A 1WAFA 3MXIA 3OJSA 3T7ZA 4N41A 4E19A 5LJVA 1NGDA 4CGDA 5JS1A 5AQWA 3ZX2A 4K0KK 2ZJRL 4DFKA 4CF9A 1YJNN 4BRIA 1HQUA 1JCFA 3KWGA 2D4WA 3KD5E 4EZ9A 2ZWHA 3KK2A 4BACA 2HHVA 4JKBA 4LC9B 2YI1A 2W6KA 3CCJN 4YOYA 1QQMA 2O4GA 4FJ8A 1F21A 4H5WA 1XQSC 5J2MA 2OPSA 1NG9A 4CJTA 1RDDA 4M41A 4DSEA 2X78A 4FJMA 4X65K 4DLGA 1WBBA 3NF7A 4EAHD 2E1YA 1IV0A 1NKCA 4FSVA 3AVKA 3CI5A 5FLXO 1H1VA 3OS1A 4PA1A 3ENBA 1OH6A 2B6AA 4B9QA 1C1AA 2FBYA 4BC2A 3FZKA 3KWIA 4CIGA 3T1YK 3LPUA 2KFZA 1NLVA 4I6MA 1BUPA 4RW7A 4X66K 4Z4FA 2YV0X 2HNYA 2VWBA 2UXCK 1C1CA 4KREA 4JRPA 2O8FB 2VWJA 1X9JA 2FF3B 4FJIA 3OBYA 1KD1O 3GOIA 2EX3A 3I8DA 2ZE2A 4GV6A 4UQGA 4BRGA 3ISNC 5IT9O 2F4VK 1C0TA 2UUBK 4BRKA 4DV6K 4DS4A 4QS9A 1Z26A 1V4TA 4JKEA 1RTHA 2FBVA 2QXLA 3KK3A 4FLWA 3SAHA 4OGEA 3OYAA 3KK1A 3I33A 1YJWN 1WSGA 4FM0A 3TTCA 3AA4A 4BVOA 5AQGA 1FKOA 3WT0A 3CCUN 4FCYA 5M1QA 4DV3K 3VTIA 3P4IA 3SUPA 4N76A 1JLCA 2KQ2A 4LFCK 4EP4A 1BCMA 2VQEK 1E4GT 4CJ4A 1K9MO 2HHWA 4ISEA 3ZEUA 1K8KB 4RW9A 2P9KA 5AQPA 3ZETB 4M3RA 4WF9L 1XI1A 1D9FA 3NBPA 5KPTA 2ZD1A 3VF2A 2ASOA 4CJVA 2BE2A 2HMIA 1N33K 4KHYA 4DQSA 3THXA 3DWLA 1O13A 4JKAA 3L3VA 3L2UA 1HX1A 4CEOA 3DOKA 3FLCO 4YY3K 5B8HA 2VWKA 5AQQA 2FBXA 2GWJA 3WXMB 1TKDA 4CERA 4FWRA 2A1RA 5M1FA 3HPHA 4FWQA 2JWKA 3H45C 2NRVA 4NXMK 3RWUA 1HPMA 2F9TA 3RTVA 4W5QA 3O9RA 3ZYYX 1RBRA 4KHWA 4C8NA 3ZSWA 4FWOA 4FYDA 3DRPA 4E7IA 3A5LC 3D0PA 3HBTA 1VSJA 1U6ZA 3BUZB 3V1RA 2Q3SA 4C1NK 4F2SA 3RMBA 4OLAA 2WC9A 3WUHA 2IAJA 3VQ8A 5F0XA 3CM5A 3V6DA 2KZZA 4NXNK 3LM2A 2RPIA 3E9OA 2QA4N 3G25A 1A5VA 2QWRA 5CYMA 3KJVA 4AQYK 1GLFO 4CZFA 4LH5A 3NAEA 4CZKA 4GW6A 4GKKK 1KC8O 2OTLN 4DF4A 1SAZA 1WSIA 2O8FA 1W0HA 3MEGA 4AF1A 5LJWA 4IO9L 2HHHK 1VHXA 3BZKA 1KFSA 3L6QA 4DTNA 1D4XA 3S41A 2CH6A 3P39A 4M7XA 4IKFA 5M1NA 4BVPA 3TWHA 1QVGM 2XY5A 3D2FA 4H4OA 2QWLA 5BPMA 2PFUA 4JV5K 4IJNA 2QEXN 4YOXA 3MX5A 1HKBA 2VG7A 3VA3A 3G6EN 3L3UA 3HJFA 4B9NA 2DY4A 4QCLA 3QEVA 1JL2A 5MLCQ 1Z6RA 3ZT4A 1TKZA 3T1AA 3B6OA 4E1JA 2P5GA 5JLFA 1VQ9N 1L5UA 1TYQA 4DS5A 3TR8A 4YDUC 3ZT3A 1J9AA 1LOTB 3AO3A 1E3MA 4CE9A 4FVUA 3FZHA 4KH6A 3R3LA 4JKGB 3DXMB 4NB4A 4AHCA 1ASUA 2IIRA 1QSLA 1N32K 5EOYA 2F9WA 2W42A 1K8KA 4O5BA 3TAMA 2EWSA 4W5NA 4DTUA 5K14A 3H1VX 3KVGA 3F9MA 4A61A 4O0IA 1CLQA 4ZHRA 3T1HK 1U48A 1SKRA 1BG3A 1XHZA 4I9LA 3J7YP 2P9UA 1VAZA 3JYTA 5GINA 4E7HA 4CHZA 4NCAA 3VQAA 2P9IB 3S3OA 3QB0A 4JI1K 4NYFA 1ATRA 4CHNA 5AQMA 3VGLA 1YUWA 3MWTA 4CEEA 2FSKA 1NJYA 2O8DB 3NF9A 4FJHA 1HUXA 3VF6A 2HVIA 1EXQA 3SAFA 3L4IA 1U2VB 2F8TA 5AQTA 2W40A 3C6HA 3WXKA 1B92A 1IBMK 5M1KA 4DV5K 5BRHA 4J8FA 1N5YA 2YJFA 3LAKA 3MN5A 5GADP 2HB5A 3LL3A 2DFEA 5KTQA 3KLEA 1T7PA 3DI6A 3K2PA 3O9SA 3E9LA 1IKVA 3PLAA 3MEDA 3J7ZO 3O9UA 3TABA 4H4MA 1JXBA 3RRHA 3FZLA 3VQEA 3D45A 3AVHA 3CCRN 5CR4A 4YHHK 2ZGYA 3SQ0A 4BR9A 2O8CA 1NJZA 4JKFA 2BDPA 1FJGK 3OYDA 2A42A 3S3NA 4BRAA 3TANA 1W9HA 4YFUA 4K25A 2W41A 5TKWA 4ILHA 1TUYA 4XH1A 4KHNA 4B1ZA 2FC0A 3P1GA 4CZEA 4WFAL 3LDSA 2PAVA 3RR8A 3E66A 3OTOK 3AARA 4CIEA 2IVNA 3AO4A 4CJ3A 4JI4K 2HF3A 4PL7A 2RF2A 4LF9K 3OYHA 4IOAL 4IZ9A 3OYGA 4A59A 3HSCA 5FPDA 3CG7A 5FPEA 5AQVA 3CF5L 4B9MA 4H0XB 2YKNA 2QWQA 3HXMA 2XY7A 4BRQA 2NNWA 4BY9C 1NMNA 3SYZA 4PUOA 1DLOA 1ZBFA 4A62A 4KPYA 4HUEA 4DSFA 3K5OA 4BG8A 2P9LB 3ZETA 3UIQA 1X9WA 1RCHA 5E84A 3CC7N 4ELTA 1VQ6N 2O8BA 4B8AB 1FKPA 3DM2A 3VEWA 5AQNA 4BDPA 3O6WA 3O8MA 3F2KA 1TYQB 4W5TA 3G10A 1BI4B 4EHTA 1EWRA 3CIPA 2O8CB 3MXJA 4IEIA 3ENHA 3VQPA 1VQON 1LWEA 3K59A 3NGIA 3SV3A 4M3XA 4CZMA 2G8HA 3O80A 1UA0A 4TSXA 4BRMA 3AO2A 3NFAA 4M63C 3AV9A 1XMOK 4O8KA 3HT3A 2VCPA 5FRMA 2O4IA 3V1QA 1VQ5N 3IFRA 4B1YB 4ICLA 3SQ1A 3JS6A 4Z4IA 2QKBA 3FFKB 3GE1A 3O4NA 2UXBK 1NOZA 3VA0A 3VQ9A 2E6MA 2E2QA 4JI5K 3CCLN 3KIOA 2GUIA 4B9UA 4IFYA 4FZZA 1QQCA 3ENOA 3IG1A 2GBZA 3EY1A 1S1UA 4CK1A 3NGZA 2ZGZA 4F3TA 2YHXA 1SQKA 5BR9A 4FWMA 1W2BM 3H46O 3L2RA 4FZXC 4MDAA 3L4QA 3KLGA 2G8WA 4DV2K 1NGFA 5EVZA 3U4LA 3OJUA 3OS2A 3AVLA 1QQNA 1VQ8N 1ESVA 4Z4EA 1NM1A 2YX6A 1VSDA 4IG3A 4DV0K 4DR2K 4LFAK 2DTUA 1ASVA 4E3SA 4CJ7A 1J54A 3HK2A 3FR0A 4JLHA 1GLEG 1FXXA 4ISFA 3M8RA 4DSJA 4RG8A 3B6PA 4DQ8A 3OYJA 3WXJA 4CJKA 4AM7A 4YOVA 1VSEA 4FJLA 4JHDA 4NYNA 3OYMA 4CESA 3OYCA 4O8UA 4Y1DA 1NGJA 4QS7A 3J7AP 2IVOA 4WYBA 2V51B 2Z1JA 3K5NA 1HNXK 1NGCA 4YOUA 2YHBA 4WCEL 4DG1A 4MQ3A 3FZFA 3S3MA 3VQDA 4OPHA 1RT5A 3THWA 1VQ4N 4CEQA 1EP4A 1BQMA 2KHOA 4DUZK 4IOCL 4KTWA 2F96A 1CXQA 4DTMA 4I7FA 1MU2A 3EE9A 5AZIB 4FJJA 2VG5A 3MECA 3VETA 2I7PA 4Z94A 4I9QA 1YVUA 3SUNA 1Z25A 4I2PA 4BDYA 2GWKA 3U6FA 3NCIA 3NE6A 3RMCA 4LF6K 5AQJA 1LW2A 2QKKA 4H8KA 3NH1A 3DJCA 3MMVA 3SJHA 4FJ7A 5HRPA 1HPZA 4DTXA 4M45A 2Q0RA 3NF6A 3MAQA 4J2EA 5GAHP 4PHTX 4N47A 1GOBA 3UB5A 4M42A 1NKBA 2J4RA 3ZX3A 4I2QA 4O5FA 1UWBA 1YVNA 3THWB 2P1JA 4GVMA 4FLXA 1A5WA 3Q7BA 1BHLA 3EL2A 4MDBA 4FM2A 3KHYA 1W97L 1HYZA 2YNIA 4KFBA 4CBXA 4CGHA 5GAGP 2P9UB 4H0OA 4OKEA 1X9MA 1CZ9A 4MLHA 5HLFA 4WQ5C 2KKZA 3E1YA 2QW9A 3H3OB 3MWPA 4B9VA 1C0GA 2X74A 4NO7A 3O3FA 4CVNE 2XHBA 3ZSXA 3NVKA 1C0FA 4B08A 2AJQA 3DXMA 4GVEA 1KAYA 3AVGA 1VQ7N 3DRRA 4FM1A 3HVRA 2CGKA 5CZ1A 5KQ8A 1QQOA 1A5XA 5KRSA 5AZIA 4CK2A 1IKXA 3CCSN 3SBTA 3CM6A 3DLGA 2D1KA 1YITN 2D0AA 3SQ2A 4EZ6A 3QNNA 1HNWK 3V9UA 3OBWA 3CCEN 3L2VA 1NWKA 1GOCA 3PX6A 4CF8A 2P9NA 3SV4A 1ZYQA 4DTPA 1LAWA 1I94K 2ZF5O 1TK0A 4BRLA 3RR7A 4F2RA 5A2QO 3TSQA 1KCFA 4L8RB 4IJAA 3AVFA 3MCPA 4WQ4A 1TV6A 4O44A 4BWJA 5BRFA 2P5OA 1E4FT 3IMXA 4FJNA 5KPZA 5KQDA 4OKJA 4O0JA 5JICA 3LDPA 3TTFA 3THXB 1GLLO 1S3XA 5HBMA 4MLEA 4YDUA 1RDAA 4H0PA 1C0MA 2ITGA 3OY9A 4DR5K 1VSLA 2HHUA 5M1PA 1YI2N 4DFMA 1VSIA 5C0YA 5JMVA 3QBWA 3LZIA 4FXDA 4U67L 1V4SA 1MWMA 1UAXA 1HRHA 4NLCA 2Z1IA 1BISA 3M8QA 4KI4A 4DQRA 4B1WB 5KRTA 3PO5A 3OW2M 3SUOA 3IRXA 3TU5A 4EP5A 3AO5A 3EYZA 1U47A 1Z05A 3LDNA 4BROA 1XHXA 3KK7A 2EHGA 1JCEA 4X62K 4AHRA 3CC4N 5AQYA 3IDHA 3QIOA 1TKXA 1I3AA 2V52B 1ZBIA 4EIAA 3VQCA 1U45A 2YNHA 5FDLA 4DFJA 3KLHA 5JVGL 1DTTA 4DUYK 3ZSQA 4ID1A 3RMDA 4CJEA 2D0BA 3I0SA 3M5RA 1NK5A 4KH4A 4M3WA 1WAJA 1HNIA 3PY8A 3ZT2A 2P9SB 1BA1A 1RDUA 1QHAA 2BTFA 4AHUA 2IGIA 2IDOA 3DXKA 3QO9A 2OYQA 2O8EA 1LWCA 5FPNA 4BR0A 3KLFA 1UOCA 3TTDA 3VEOA 1NJWA 3SBGA 4BRCA 2QTDA 3R8EA 2NRZA 5HRSA 2XO7A 5C2DA 5AQXA 3MN9A 1XC9A 3WEEB 5CYQA 4JI0K 5AFUH 4H0TB 3ZLJA 1SKWA 3VF4A 2PYJA 3K5MA 3PUFA 5BN9A 2Q97A 5BREA 2OA8A 1YAGA 2RE2A 4KTQA 3HOTA 3DMJA 4K41A 4LFBK 3K9KA 2FLOA 4LF4K 3DLKA 2KLAA 4XH4A 1RTDA 4RW4A 1JLBA 4KKOA 1REVA 2ZJPL 1KTQA 4M3ZA 1KSPA 4O55A 4F8RA 4DV4K 1RFQA 5ELZA 2OZSA 4CZJA 3W3DA 3P38A 4WE1A 5BPNA 2HOEA 1SKSA 3VESA 3IS9A 5AZJB 4HVJA 1ATNA 2A1SA 1ITGA 3M6GA 3HVTA 3ZT1A 3U3YA 4GKJK 3V9SA 4Y0WA 4CF0A 2Q2RA 3HPGA 3R9PA 3PSFA 3PO4A 4DQPA 5LY3A 4IXCA 1QS4A 2AP1A 4B3OA 1DKGD 3OYIA 3V81A 2E8AA 1NBWA 3RVCA 3BY5A 1U2VA 2YKMA 3WQUA 4CJLA 2E1ZA 3DYAA 2I5JA 2P9LA 4DU3A 4DMNA 1KQSM 3ID6A 3ZEUB 2BH1A 4BRDA 2ZJQL 4DR6K 3VQQA 1RBUA 4EHUA 1Y64A 3UE5A 1NK9A 4OJRA 3ZSZA 4DQIA 2IOCA 3SK3A 3HZ6A 4DCHA 5KGXA 3HYFA 3A5MC 2WUSA 3LDOA 3H08A 2WOMA 2PYLA 4WQ5A 4DTRA 1HJRA 1XWLA 4XH5A 1LV5A 4BE1A 3OYFA 4FZYA 1VSFA 4DR1K 1XMQK 3KZBA 4PKIA 2Y1JA 4KHSA 2E2PA 2VYPA 3K58A 3QETA 3TAGA 2DPNA 2YHAA 3MDQA 2NUBA 3G71N 4E0DA 2Q36A 3HM9A 3QEXA 5GAEP 4OPAA 3V4IA 3JAMO 1QE1A 4JK8A 4K8ZA 1T6CA 2D0PA 4XIUA 3A5OC 5HROA 1JLFA 2BGGA 4CZIA 3SI6A 5AZJA 3TSUA 2CH5A 4U7BA 1JKHA 4OGCA 2OPRA 1FK9A 4CEFA 4FLTA 3ATVA 4ELVA 4DB3A 3DLBA 4DR7K 3VQ5A 1GLAG 1RTIA 4CF2A 3FGUA 4NLBA 1YHQN 3F5TA 5T7BA 3VGKA 3LAMA 2DFHA 5EX5A 1TK8A 1HYVA 4BRNA 4PWDA 1DGKN 3EKUA 4DWIA 3AVBA 3WXLA 3U9DA 1YF5L 3HL8A 1NNEA 3JXUA 4JKCA 1WN7A 4AHVA 4E89A 3NH0A 2XRIA 3U9ZA 2HHSA 3N4PA 1IKWA 4FK2A 3CJ7A 4ILJA 5SWMA 3AA5X 1XUPO 4BC5A 4M3UA 3NMUA 1ZBUA 1WBDA 4WFBL 1OKJA 3MEEA 3L8BA 4FJGA 1GLJO 1VK0A 2D0CA 1L3UA 1L3SA 4CI6A 2QM1A 2HW3A 3CQ8A 3K9JA 4KTZA 3CQYA 4BC3A 3VQ7A 2PZSA 1HYSA 4IO8A 4R79A 2GELA 4CJFA 5AQSA 1RT3A 4IBNA 4CFBA 4WFNL 1GLBG 2A41A 4HWIA 4Z4HA 2QWNA 1KVAA 1KRPA 1C1BA 3G4SN 4CEBA 3MXMA 4KI6A 3ZX0A 3V9XA 4FLYA 2BUPA 1XNRK 4H5RA 3TSPA 3PSIA 1N36K 4CD3A 2NRTA 3DLHA 4E1NA 1K6YA 4KO0A 3QIPA 3O08A 1JLAA 1NGEA 1CXUA 3O3GA 4F4KA 1NKEA 1S9GA 1RBSA 4CD1A 5FPMA 2ETJA 1YT3A 2IC3A 4C1NI 1KFDA 3CC2N 1NMDA 1SL2A 3QBXA 1ZC6A 1IO2A 2W6LA 3LWMA 2ASMA 4CGGA 4JI2K 3GBTA 1K73O 3TAEA 3CFOA 1HQEA 3SMSA 1EETA 2WFBA 5C15A 1Y97A 2HBLA 4KB1A 1WSEA 1NK7A 1TAUA 3SCXA 1W7AA 4MFBA 4GMJB 4C8KA 4OPKA 1HNZK 3C6AA 3NHGA 1S6QA 1JCGA 1RDWX 1BO5O 3O5BA 5H1SQ 4LF8K 4M3YA 4HTLA 3LPTA 1MWKA 5AR0A 4BE2A 4H5TA 3AVAA 4B1VA 1D5AA 2IVPA 1L3VA 3UKUA 4JYAK 4JNEA 1C6VA 1NJXA 4DTSA 5HRNA 1Q82O 4CHYA 4JK7A 3FFIA 5J2QA 4Q5VA 2V7ZA 4OO1J 4I6MB 3H3NO 4RW6A 1VQMN 3UKRA 3D2EB 3BDPA 5GIOA 4Q0BA 2HHXA 4B9LA 1T3VA
chains in the Genus database with same CATH topology
3SV4A 1S1XA 1ZYQA 4DTPA 1LAWA 3AVCA 1S1VA 1BCOA 3QEWA 1TK0A 3OYNA 3RR7A 3LALA 3PX4A 4IKFA 4F2RA 5I42A 1KVCA 3AO1A 4KAZA 3TWHA 1KCFA 4L8RB 2XY5A 1NK4A 3AVFA 1JLGA 2IS3A 4H4OA 1TV6A 3V1OA 2Z1GA 4DTJA 3AVIA 1U04A 4O44A 1TL3A 4BWJA 3DLEA 2P5OA 3I0RA 1VSMA 4FJNA 4NCGA 2E4LA 2D5RA 4C8LA 4OKJA 4O0JA 3QNOA 1SUQA 4CIFA 4DTNA 1ZBLA 2VG7A 3ASMA 3C95A 3T3FA 3VA3A 5JS2A 4OVLA 2QXFA 4FJ5A 3HJFA 3L3UA 3OYKA 4B9NA 2DY4A 5HBMA 4QCLA 4ZTJA 5E41A 3QEVA 1RDAA 1T03A 1JL2A 1C0MA 2ITGA 3ZT4A 4CGFA 4HCCA 1TKZA 3M8PA 3T1AA 3OY9A 1IKYA 3B6OA 4AH9A 4JS4A 1RILA 2P5GA 5FRNA 1VSLA 2HHUA 3C6TA 4ZTFA 3M8SA 4HHTA 3OYLA 1BQNA 1S1TA 1L5UA 4DS5A 4DFMA 3TR8A 1VSIA 4CEAA 1BL3A 3ZT3A 3VQ4A 3LZIA 1J9AA 4FXDA 3AVJA 3AO3A 1NK6A 4CE9A 1UAXA 1Q9YA 1HRHA 1IH7A 2Z1IA 1BISA 3M8QA 3NGYA 3OYEA 4AHCA 1EKEA 1ASUA 3HP9A 3O4QA 3QESA 4J2BA 4KI4A 4DQRA 1QSLA 3TAPA 5D3GA 1TKTA 2W42A 4O5BA 5KRTA 3O3HA 3TAMA 3PO5A 1BIUA 4DTUA 3SUOA 4W5NA 5K14A 1QSYA 3IRXA 1L3TA 4EP5A 3AO5A 3EYZA 5SZTA 4O0IA 4B9SA 1WLJA 1U47A 1CLQA 4ZHRA 1LAVA 3C94A 1U48A 3HPOA 1XHZA 3V9ZA 4I9LA 1SKRA 1XHXA 1DTQA 2EHGA 3QERA 3PX0A 3JYTA 3QEPA 4E7HA 4CHZA 1SL0A 4AHRA 4NCAA 3VQAA 3VN5A 1LWFA 3LP0A 3QIOA 3S3OA 1VSHA 1TKXA 5J2NA 1I3AA 3T19A 1U4BA 4NYFA 1ZBIA 3VQCA 1U45A 2YNHA 5FDLA 4CHNA 4ELUA 1HMVA 4DFJA 3KLHA 2KTQA 1DTTA 4CJPA 3LANA 3ZSQA 4CJQA 4CEEA 4HCBA 1RT2A 1NJYA 2OZMA 3NF9A 4ID1A 1QTMA 4OKKA 3RMDA 4FJHA 4CJEA 2D0BA 2HVIA 1EXQA 3I0SA 2HNZA 1NK5A 2F8TA 3ZSOA 1RNHA 5C24A 2P51A 4M3WA 1WAJA 2DFFA 3K57A 1B92A 4IG0A 4DU1A 2R7YA 2Y1IA 1HNIA 3PY8A 4OLBA 3ZT2A 2HVHA 1N5YA 3LAKA 5KGWA 2HB5A 2DFEA 5EU7A 3WNEA 4AHUA 3DLRA 5KTQA 3KLEA 3TAFA 1NK8A 1T7PA 2IGIA 3DI6A 2IDOA 1TL1A 4FK4A 3K2PA 1RBTA 3QO9A 4W5OA 2YNFA 2OYQA 1LWCA 4R5PA 3KLFA 1IKVA 1UOCA 3BGRA 4J2DA 4PY5A 3SNNA 1NJWA 3MEDA 1JLQA 5HRSA 4FW2A 2XO7A 5C42A 4G1QA 4DSLA 1XC9A 3TABA 3DOLA 2HNDA 4H4MA 2ZQBA 3THVA 4J2AA 1JXBA 3RMAA 3RRHA 5CYQA 2RN2A 1RDCA 3AVMA 1Q9XA 4FJXA 2G8UA 3VQEA 3D45A 3AVHA 1SKWA 2G8IA 1JL1A 3OYBA 4KB0A 2OPPA 3SQ0A 2PYJA 1VRUA 3K5MA 3ZSVA 1NJZA 3VQ6A 3PUFA 4DTOA 4Z4CA 2BDPA 3OYDA 2OA8A 3CYMA 1KVBA 4KTQA 3ZSRA 2E6LA 1TAQA 2GV9A 3DMJA 4CECA 3S3NA 4F3OA 3SPYA 2HHQA 4CJ5A 3TANA 1W9HA 5J1EA 4YFUA 2JLEA 1WSFA 3DLKA 4N56A 1RTDA 4FLVA 4OPJA 4RW4A 1JLBA 4KKOA 1LW0A 1REVA 3WNFA 1TGOA 1KTQA 4CJWA 4M3ZA 4KHNA 1VSKA 1KSPA 4O55A 1WSHA 2FC0A 4CCHA 3P1GA 3LDSA 3RR8A 4F8RA 3L2QA 5FROA 1J53A 3HO1A 4AHTA 4CIEA 3S9HA 3AO4A 3A2FA 4QAGA 4CJ3A 2OZSA 3HSTB 4WE1A 3KKRA 1SKSA 5HRRA 3WNHA 4CHOA 3LWLA 4FJKA 3F9KA 3LP1A 2RF2A 3IS9A 3P83D 3NF8A 1EX4A 3ALYA 4CFAA 5C25A 3OYHA 1C0UA 3V9WA 1N6QA 4HVJA 2OPQA 2A1SA 1ITGA 3DRSA 3ZT1A 3HVTA 3ZSYA 4BE0A 4C8MA 3OYGA 3U3YA 4FK0A 3CG7A 4CF0A 3V9SA 1SL1A 3SPZA 4LSNA 1X1PA 4RW8A 3HPGA 4DSKA 3AA2A 4FW1A 4B9MA 1RT1A 2YKNA 4FVMA 1J5OA 3PO4A 4DQPA 2HHTA 3HXMA 2XY7A 4HUGA 1I39A 1QS4A 2XY6A 1T05A 2BANA 3OYIA 4B3OA 3SYZA 4CGJA 3QEIA 3V81A 3KD1E 4PUOA 1DLOA 1ZBFA 3SJJA 4KPYA 2YKMA 3K5LA 4HUEA 4CJLA 4DSFA 3C6UA 3DYAA 2I5JA 3K5OA 3SUQA 4DU3A 1S1WA 4DMNA 3UIQA 1X9WA 4QOZB 4E1MA 1RCHA 3VQQA 1RBUA 1NK9A 4OJRA 3ZSZA 4DQIA 2G8FA 4ELTA 4B8AB 1FKPA 2IOCA 3DM2A 4N5SA 4CJUA 4E7LA 5KGXA 1BIZA 1RTJA 3P5JA 3HYFA 1KLNA 3TARA 4BDPA 2B5JA 4Z0UA 1RBVA 3H08A 2VG6A 2WOMA 4W5TA 3G10A 4DTRA 2PYLA 1HJRA 1BI4B 3EZ5A 1CZBA 1XWLA 1YTUA 3LP3A 1S6PA 3ZCMA 1IG9A 4IFVA 4LD0A 4LY7A 3MXJA 4CFCA 1LV5A 4BE1A 3OYFA 3ZT0A 3G0ZA 4FZYA 1VSFA 2LSNA 3VQPA 5CZ2A 4E7KA 1TVRA 1LWEA 3K59A 3NGIA 2X6NA 3SV3A 4M3XA 2G8HA 1WAFA 3MXIA 1UA0A 4TSXA 2Y1JA 3AO2A 3NFAA 3OJSA 3AV9A 4KHSA 3K58A 3HT3A 3QETA 4CEDA 4N41A 3TAGA 4HTUA 5FRMA 4E19A 3V1QA 4CGDA 2YHAA 2O4IA 5JS1A 4DQQA 4DF8A 2NUBA 4DFKA 4E0DA 4IDKA 3SQ1A 4ICLA 4CF9A 3HM9A 3QEXA 4Z4IA 1HQUA 1JLEA 2QKBA 2Z1HA 3KD5E 3O4NA 3V4IA 4EZ9A 1NOZA 1QE1A 3VA0A 2QK9A 3KK2A 1S9EA 3VQ9A 2E6MA 3QINA 1TK5A 4BACA 4LH4A 4K8ZA 2HHVA 4W5RA 1BGXT 3KIOA 1S5JA 2GUIA 1RT4A 4KV8A 4XIUA 4B9UA 5HROA 1JLFA 4IFYA 4C8OA 4FZZA 2BGGA 1QQCA 3SI6A 1JXEA 2O4GA 3IG1A 4FJ8A 5I3UA 2GBZA 1F21A 1JKHA 4DFPA 4OGCA 2OPRA 3EY1A 1S1UA 1FK9A 4CK1A 3NGZA 4CEFA 5J2MA 2OPSA 4PQUA 4CJTA 1RDDA 3WNGA 4DLEA 4F3TA 4FLTA 2X6SA 4M41A 4DSEA 2YNGA 1B9FA 2X78A 4AHSA 3DLBA 4ELVA 4DLGA 4FJMA 3VQ5A 1RTIA 4CF2A 2KFNA 4FZXC 3KLIA 3L2RA 3ULDA 1SV5A 1GOAA 3NF7A 3OVNA 3KLGA 2G8WA 1NKCA 3AVKA 1X9SA 3OS0A 5T7BA 3OS1A 4E7JA 3OJUA 3OS2A 3AVLA 1QSSA 1TAUA 3LAMA 2DFHA 1UA1A 1TK8A 1HYVA 4PA1A 3SZ2A 4Z4EA 1VSDA 3ITHA 4IG3A 2B6AA 1C1AA 2FBYA 4PWDA 2DTUA 4CIGA 1ASVA 5CY4A 4E3SA 3AVBA 4DWIA 3LPUA 1J54A 3HK2A 2KFZA 4Z4FA 4RW7A 3HL8A 3NH2A 2YV0X 1WN7A 1O1WA 4JLHA 4AHVA 4BDZA 2HNYA 1NK0A 1FXXA 4CHPA 2XRIA 4E89A 2XY8A 3NH0A 1C1CA 3M8RA 3U3GA 3PV8A 3TI0A 4DSJA 4RG8A 4KHUA 4KREA 2HHSA 4JRPA 2VWJA 1KLMA 3B6PA 3OYJA 1IKWA 4CGIA 4FK2A 4FJIA 4CJKA 5KI6A 5SWMA 3AA5X 4Z4GA 1BI4A 2EX3A 3I8DA 1RT6A 2ZE2A 1Q8IA 1VSEA 4FJLA 4M3UA 4UQGA 1U49A 4NYNA 1ZBUA 3ISNC 3OYMA 4CESA 1ZBHA 1C0TA 3OYCA 3SQ4A 1T8EA 4Y1DA 3LP2A 4DS4A 3MEEA 3L8BA 4FJGA 3KKSA 1Z26A 1VK0A 2D0CA 2Z1JA 1L3UA 1RTHA 2FBVA 1L3SA 3KK3A 3K5NA 4FLWA 1R0AA 1VRTA 3CQ8A 4OGEA 3OYAA 3KK1A 3F73A 4O4GA 1RT7A 4KTZA 2YHBA 3VQ7A 4DG1A 4MQ3A 2PZSA 1HYSA 1WSGA 2B4JA 4FM0A 3S3MA 5DMRA 3VQDA 4DU4A 3AA4A 1RT5A 4NCBA 1FKOA 4CJFA 2G8KA 4CEQA 4B8CA 4FLUA 4FCYA 3NDKA 1EP4A 1RT3A 3SUPA 1QHTA 4IBNA 4CFBA 1BQMA 4N76A 3E01A 1JLCA 2KQ2A 1D9DA 4Z4HA 4KTWA 2F96A 1CXQA 1WNSA 4DTMA 1KVAA 3TAQA 1KRPA 4EP4A 1BCMA 4FJ7A 4I7FA 5HP1A 1C1BA 4CJ4A 1MU2A 4CEBA 3MXMA 4KI6A 2HHWA 3V9XA 4FLYA 3JSMA 4CJSA 4RW9A 4FJJA 2VG5A 4CHQA 4M3RA 3MECA 1XI1A 1D9FA 4CJRA 3NBPA 1ASWA 2ZD1A 4I9QA 1YVUA 3SUNA 4CJVA 1Z25A 4I2PA 4BDYA 3U6FA 2BE2A 3NCIA 4E1NA 2HMIA 1K6YA 3NE6A 3RMCA 4DQSA 3DLHA 4KO0A 4KHYA 3QIPA 1LW2A 2QKKA 3AVNA 1JLAA 3KTQA 4H8KA 3NH1A 1CXUA 2KZMA 3O3GA 4Y1CA 4F4KA 3L3VA 1S9GA 1NKEA 3L2UA 1RBSA 4CEOA 5HRPA 3CFPA 1HPZA 3DOKA 2ETJA 1YT3A 2IC3A 4M45A 4DTXA 1KFDA 2WONA 3NF6A 3MAQA 4J2EA 2VWKA 1GOBA 4N47A 3L2WA 2FBXA 1NKBA 4B9TA 4M42A 1SL2A 1TKDA 3RRGA 3AA3A 1IO2A 1WSJA 4CERA 3LWMA 4I2QA 4CGGA 2RKIA 1UWBA 2A1RA 3TAEA 3HPHA 4CF1A 2P1JA 4GVMA 4FLXA 1NOYA 3CFOA 1B9DA 1HQEA 1EETA 3QLHA 4ID5A 2G8VA 1A5WA 4BWMA 3RWUA 1BHLA 3RTVA 4W5QA 4K8XA 1Y97A 1YTAA 4KB1A 4FM2A 1RBRA 1WSEA 4KHWA 2YNIA 1HYZA 4KFBA 4C8NA 4CGHA 3ZSWA 4CEZA 3LZJA 4OKEA 1NK7A 4JRQA 1CZ9A 3DRPA 1X9MA 4E7IA 3D0PA 4FYDA 4JS5A 3SCXA 4MFBA 4GMJB 4C8KA 1VSJA 2ATQA 3V1RA 4OPKA 2Q3SA 5HLFA 4F2SA 3RMBA 5J2PA 4OLAA 3NHGA 1S6QA 1HNVA 2IAJA 3VQ8A 3CM5A 4B9VA 2X74A 3O3FA 3V6DA 4FLZA 4M3YA 2KZZA 5DK5A 1RDBA 4KRFA 2FBTA 2JGUA 2RPIA 3LPTA 3ZSXA 4B08A 2XHBA 2AJQA 4YNQA 1A5VA 3VQBA 3AVGA 5CYMA 3KJVA 4DSIA 3DRRA 4HUFA 4BE2A 4FM1A 2F8SA 2KW4A 3AVAA 3HVRA 4CFDA 1D5AA 5CZ1A 1L3VA 3NAEA 1G15A 4LH5A 1A5XA 5KRSA 1C6VA 4CK2A 1NJXA 4DTSA 5HRNA 4M3TA 4CHYA 1IKXA 4GW6A 4LSLA 3FFIA 3CFRA 3CM6A 3DLGA 5J2QA 4Q5VA 3HP6A 2D0AA 4DF4A 3SQ2A 4EZ6A 1D8YA 1WSIA 3QNNA 1W0HA 3MEGA 4RW6A 4AILC 4FJ9A 3V9UA 3BDPA 4KHQA 4Q0BA 2HHXA 2PY5A 4B9LA 3L2VA 3IAYA 1GOCA 1KFSA 4CK3A 3PX6A 2HW3A 4CF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV4 A;  1S1X A;  1ZYQ A;  4DTP A;  1LAW A;  3AVC A;  1S1V A;  1BCO A;  3QEW A;  1TK0 A;  3OYN A;  3RR7 A;  3LAL A;  3PX4 A;  4IKF A;  4F2R A;  5I42 A;  1KVC A;  3AO1 A;  4KAZ A;  3TWH A;  1KCF A;  4L8R B;  2XY5 A;  1NK4 A;  3AVF A;  1JLG A;  2IS3 A;  4H4O A;  1TV6 A;  3V1O A;  2Z1G A;  4DTJ A;  3AVI A;  1U04 A;  4O44 A;  1TL3 A;  4BWJ A;  3DLE A;  2P5O A;  3I0R A;  1VSM A;  4FJN A;  4NCG A;  2E4L A;  2D5R A;  4C8L A;  4OKJ A;  4O0J A;  3QNO A;  1SUQ A;  4CIF A;  4DTN A;  1ZBL A;  2VG7 A;  3ASM A;  3C95 A;  3T3F A;  3VA3 A;  5JS2 A;  4OVL A;  2QXF A;  4FJ5 A;  3HJF A;  3L3U A;  3OYK A;  4B9N A;  2DY4 A;  5HBM A;  4QCL A;  4ZTJ A;  5E41 A;  3QEV A;  1RDA A;  1T03 A;  1JL2 A;  1C0M A;  2ITG A;  3ZT4 A;  4CGF A;  4HCC A;  1TKZ A;  3M8P A;  3T1A A;  3OY9 A;  1IKY A;  3B6O A;  4AH9 A;  4JS4 A;  1RIL A;  2P5G A;  5FRN A;  1VSL A;  2HHU A;  3C6T A;  4ZTF A;  3M8S A;  4HHT A;  3OYL A;  1BQN A;  1S1T A;  1L5U A;  4DS5 A;  4DFM A;  3TR8 A;  1VSI A;  4CEA A;  1BL3 A;  3ZT3 A;  3VQ4 A;  3LZI A;  1J9A A;  4FXD A;  3AVJ A;  3AO3 A;  1NK6 A;  4CE9 A;  1UAX A;  1Q9Y A;  1HRH A;  1IH7 A;  2Z1I A;  1BIS A;  3M8Q A;  3NGY A;  3OYE A;  4AHC A;  1EKE A;  1ASU A;  3HP9 A;  3O4Q A;  3QES A;  4J2B A;  4KI4 A;  4DQR A;  1QSL A;  3TAP A;  5D3G A;  1TKT A;  2W42 A;  4O5B A;  5KRT A;  3O3H A;  3TAM A;  3PO5 A;  1BIU A;  4DTU A;  3SUO A;  4W5N A;  5K14 A;  1QSY A;  3IRX A;  1L3T A;  4EP5 A;  3AO5 A;  3EYZ A;  5SZT A;  4O0I A;  4B9S A;  1WLJ A;  1U47 A;  1CLQ A;  4ZHR A;  1LAV A;  3C94 A;  1U48 A;  3HPO A;  1XHZ A;  3V9Z A;  4I9L A;  1SKR A;  1XHX A;  1DTQ A;  2EHG A;  3QER A;  3PX0 A;  3JYT A;  3QEP A;  4E7H A;  4CHZ A;  1SL0 A;  4AHR A;  4NCA A;  3VQA A;  3VN5 A;  1LWF A;  3LP0 A;  3QIO A;  3S3O A;  1VSH A;  1TKX A;  5J2N A;  1I3A A;  3T19 A;  1U4B A;  4NYF A;  1ZBI A;  3VQC A;  1U45 A;  2YNH A;  5FDL A;  4CHN A;  4ELU A;  1HMV A;  4DFJ A;  3KLH A;  2KTQ A;  1DTT A;  4CJP A;  3LAN A;  3ZSQ A;  4CJQ A;  4CEE A;  4HCB A;  1RT2 A;  1NJY A;  2OZM A;  3NF9 A;  4ID1 A;  1QTM A;  4OKK A;  3RMD A;  4FJH A;  4CJE A;  2D0B A;  2HVI A;  1EXQ A;  3I0S A;  2HNZ A;  1NK5 A;  2F8T A;  3ZSO A;  1RNH A;  5C24 A;  2P51 A;  4M3W A;  1WAJ A;  2DFF A;  3K57 A;  1B92 A;  4IG0 A;  4DU1 A;  2R7Y A;  2Y1I A;  1HNI A;  3PY8 A;  4OLB A;  3ZT2 A;  2HVH A;  1N5Y A;  3LAK A;  5KGW A;  2HB5 A;  2DFE A;  5EU7 A;  3WNE A;  4AHU A;  3DLR A;  5KTQ A;  3KLE A;  3TAF A;  1NK8 A;  1T7P A;  2IGI A;  3DI6 A;  2IDO A;  1TL1 A;  4FK4 A;  3K2P A;  1RBT A;  3QO9 A;  4W5O A;  2YNF A;  2OYQ A;  1LWC A;  4R5P A;  3KLF A;  1IKV A;  1UOC A;  3BGR A;  4J2D A;  4PY5 A;  3SNN A;  1NJW A;  3MED A;  1JLQ A;  5HRS A;  4FW2 A;  2XO7 A;  5C42 A;  4G1Q A;  4DSL A;  1XC9 A;  3TAB A;  3DOL A;  2HND A;  4H4M A;  2ZQB A;  3THV A;  4J2A A;  1JXB A;  3RMA A;  3RRH A;  5CYQ A;  2RN2 A;  1RDC A;  3AVM A;  1Q9X A;  4FJX A;  2G8U A;  3VQE A;  3D45 A;  3AVH A;  1SKW A;  2G8I A;  1JL1 A;  3OYB A;  4KB0 A;  2OPP A;  3SQ0 A;  2PYJ A;  1VRU A;  3K5M A;  3ZSV A;  1NJZ A;  3VQ6 A;  3PUF A;  4DTO A;  4Z4C A;  2BDP A;  3OYD A;  2OA8 A;  3CYM A;  1KVB A;  4KTQ A;  3ZSR A;  2E6L A;  1TAQ A;  2GV9 A;  3DMJ A;  4CEC A;  3S3N A;  4F3O A;  3SPY A;  2HHQ A;  4CJ5 A;  3TAN A;  1W9H A;  5J1E A;  4YFU A;  2JLE A;  1WSF A;  3DLK A;  4N56 A;  1RTD A;  4FLV A;  4OPJ A;  4RW4 A;  1JLB A;  4KKO A;  1LW0 A;  1REV A;  3WNF A;  1TGO A;  1KTQ A;  4CJW A;  4M3Z A;  4KHN A;  1VSK A;  1KSP A;  4O55 A;  1WSH A;  2FC0 A;  4CCH A;  3P1G A;  3LDS A;  3RR8 A;  4F8R A;  3L2Q A;  5FRO A;  1J53 A;  3HO1 A;  4AHT A;  4CIE A;  3S9H A;  3AO4 A;  3A2F A;  4QAG A;  4CJ3 A;  2OZS A;  3HST B;  4WE1 A;  3KKR A;  1SKS A;  5HRR A;  3WNH A;  4CHO A;  3LWL A;  4FJK A;  3F9K A;  3LP1 A;  2RF2 A;  3IS9 A;  3P83 D;  3NF8 A;  1EX4 A;  3ALY A;  4CFA A;  5C25 A;  3OYH A;  1C0U A;  3V9W A;  1N6Q A;  4HVJ A;  2OPQ A;  2A1S A;  1ITG A;  3DRS A;  3ZT1 A;  3HVT A;  3ZSY A;  4BE0 A;  4C8M A;  3OYG A;  3U3Y A;  4FK0 A;  3CG7 A;  4CF0 A;  3V9S A;  1SL1 A;  3SPZ A;  4LSN A;  1X1P A;  4RW8 A;  3HPG A;  4DSK A;  3AA2 A;  4FW1 A;  4B9M A;  1RT1 A;  2YKN A;  4FVM A;  1J5O A;  3PO4 A;  4DQP A;  2HHT A;  3HXM A;  2XY7 A;  4HUG A;  1I39 A;  1QS4 A;  2XY6 A;  1T05 A;  2BAN A;  3OYI A;  4B3O A;  3SYZ A;  4CGJ A;  3QEI A;  3V81 A;  3KD1 E;  4PUO A;  1DLO A;  1ZBF A;  3SJJ A;  4KPY A;  2YKM A;  3K5L A;  4HUE A;  4CJL A;  4DSF A;  3C6U A;  3DYA A;  2I5J A;  3K5O A;  3SUQ A;  4DU3 A;  1S1W A;  4DMN A;  3UIQ A;  1X9W A;  4QOZ B;  4E1M A;  1RCH A;  3VQQ A;  1RBU A;  1NK9 A;  4OJR A;  3ZSZ A;  4DQI A;  2G8F A;  4ELT A;  4B8A B;  1FKP A;  2IOC A;  3DM2 A;  4N5S A;  4CJU A;  4E7L A;  5KGX A;  1BIZ A;  1RTJ A;  3P5J A;  3HYF A;  1KLN A;  3TAR A;  4BDP A;  2B5J A;  4Z0U A;  1RBV A;  3H08 A;  2VG6 A;  2WOM A;  4W5T A;  3G10 A;  4DTR A;  2PYL A;  1HJR A;  1BI4 B;  3EZ5 A;  1CZB A;  1XWL A;  1YTU A;  3LP3 A;  1S6P A;  3ZCM A;  1IG9 A;  4IFV A;  4LD0 A;  4LY7 A;  3MXJ A;  4CFC A;  1LV5 A;  4BE1 A;  3OYF A;  3ZT0 A;  3G0Z A;  4FZY A;  1VSF A;  2LSN A;  3VQP A;  5CZ2 A;  4E7K A;  1TVR A;  1LWE A;  3K59 A;  3NGI A;  2X6N A;  3SV3 A;  4M3X A;  2G8H A;  1WAF A;  3MXI A;  1UA0 A;  4TSX A;  2Y1J A;  3AO2 A;  3NFA A;  3OJS A;  3AV9 A;  4KHS A;  3K58 A;  3HT3 A;  3QET A;  4CED A;  4N41 A;  3TAG A;  4HTU A;  5FRM A;  4E19 A;  3V1Q A;  4CGD A;  2YHA A;  2O4I A;  5JS1 A;  4DQQ A;  4DF8 A;  2NUB A;  4DFK A;  4E0D A;  4IDK A;  3SQ1 A;  4ICL A;  4CF9 A;  3HM9 A;  3QEX A;  4Z4I A;  1HQU A;  1JLE A;  2QKB A;  2Z1H A;  3KD5 E;  3O4N A;  3V4I A;  4EZ9 A;  1NOZ A;  1QE1 A;  3VA0 A;  2QK9 A;  3KK2 A;  1S9E A;  3VQ9 A;  2E6M A;  3QIN A;  1TK5 A;  4BAC A;  4LH4 A;  4K8Z A;  2HHV A;  4W5R A;  1BGX T;  3KIO A;  1S5J A;  2GUI A;  1RT4 A;  4KV8 A;  4XIU A;  4B9U A;  5HRO A;  1JLF A;  4IFY A;  4C8O A;  4FZZ A;  2BGG A;  1QQC A;  3SI6 A;  1JXE A;  2O4G A;  3IG1 A;  4FJ8 A;  5I3U A;  2GBZ A;  1F21 A;  1JKH A;  4DFP A;  4OGC A;  2OPR A;  3EY1 A;  1S1U A;  1FK9 A;  4CK1 A;  3NGZ A;  4CEF A;  5J2M A;  2OPS A;  4PQU A;  4CJT A;  1RDD A;  3WNG A;  4DLE A;  4F3T A;  4FLT A;  2X6S A;  4M41 A;  4DSE A;  2YNG A;  1B9F A;  2X78 A;  4AHS A;  3DLB A;  4ELV A;  4DLG A;  4FJM A;  3VQ5 A;  1RTI A;  4CF2 A;  2KFN A;  4FZX C;  3KLI A;  3L2R A;  3ULD A;  1SV5 A;  1GOA A;  3NF7 A;  3OVN A;  3KLG A;  2G8W A;  1NKC A;  3AVK A;  1X9S A;  3OS0 A;  5T7B A;  3OS1 A;  4E7J A;  3OJU A;  3OS2 A;  3AVL A;  1QSS A;  1TAU A;  3LAM A;  2DFH A;  1UA1 A;  1TK8 A;  1HYV A;  4PA1 A;  3SZ2 A;  4Z4E A;  1VSD A;  3ITH A;  4IG3 A;  2B6A A;  1C1A A;  2FBY A;  4PWD A;  2DTU A;  4CIG A;  1ASV A;  5CY4 A;  4E3S A;  3AVB A;  4DWI A;  3LPU A;  1J54 A;  3HK2 A;  2KFZ A;  4Z4F A;  4RW7 A;  3HL8 A;  3NH2 A;  2YV0 X;  1WN7 A;  1O1W A;  4JLH A;  4AHV A;  4BDZ A;  2HNY A;  1NK0 A;  1FXX A;  4CHP A;  2XRI A;  4E89 A;  2XY8 A;  3NH0 A;  1C1C A;  3M8R A;  3U3G A;  3PV8 A;  3TI0 A;  4DSJ A;  4RG8 A;  4KHU A;  4KRE A;  2HHS A;  4JRP A;  2VWJ A;  1KLM A;  3B6P A;  3OYJ A;  1IKW A;  4CGI A;  4FK2 A;  4FJI A;  4CJK A;  5KI6 A;  5SWM A;  3AA5 X;  4Z4G A;  1BI4 A;  2EX3 A;  3I8D A;  1RT6 A;  2ZE2 A;  1Q8I A;  1VSE A;  4FJL A;  4M3U A;  4UQG A;  1U49 A;  4NYN A;  1ZBU A;  3ISN C;  3OYM A;  4CES A;  1ZBH A;  1C0T A;  3OYC A;  3SQ4 A;  1T8E A;  4Y1D A;  3LP2 A;  4DS4 A;  3MEE A;  3L8B A;  4FJG A;  3KKS A;  1Z26 A;  1VK0 A;  2D0C A;  2Z1J A;  1L3U A;  1RTH A;  2FBV A;  1L3S A;  3KK3 A;  3K5N A;  4FLW A;  1R0A A;  1VRT A;  3CQ8 A;  4OGE A;  3OYA A;  3KK1 A;  3F73 A;  4O4G A;  1RT7 A;  4KTZ A;  2YHB A;  3VQ7 A;  4DG1 A;  4MQ3 A;  2PZS A;  1HYS A;  1WSG A;  2B4J A;  4FM0 A;  3S3M A;  5DMR A;  3VQD A;  4DU4 A;  3AA4 A;  1RT5 A;  4NCB A;  1FKO A;  4CJF A;  2G8K A;  4CEQ A;  4B8C A;  4FLU A;  4FCY A;  3NDK A;  1EP4 A;  1RT3 A;  3SUP A;  1QHT A;  4IBN A;  4CFB A;  1BQM A;  4N76 A;  3E01 A;  1JLC A;  2KQ2 A;  1D9D A;  4Z4H A;  4KTW A;  2F96 A;  1CXQ A;  1WNS A;  4DTM A;  1KVA A;  3TAQ A;  1KRP A;  4EP4 A;  1BCM A;  4FJ7 A;  4I7F A;  5HP1 A;  1C1B A;  4CJ4 A;  1MU2 A;  4CEB A;  3MXM A;  4KI6 A;  2HHW A;  3V9X A;  4FLY A;  3JSM A;  4CJS A;  4RW9 A;  4FJJ A;  2VG5 A;  4CHQ A;  4M3R A;  3MEC A;  1XI1 A;  1D9F A;  4CJR A;  3NBP A;  1ASW A;  2ZD1 A;  4I9Q A;  1YVU A;  3SUN A;  4CJV A;  1Z25 A;  4I2P A;  4BDY A;  3U6F A;  2BE2 A;  3NCI A;  4E1N A;  2HMI A;  1K6Y A;  3NE6 A;  3RMC A;  4DQS A;  3DLH A;  4KO0 A;  4KHY A;  3QIP A;  1LW2 A;  2QKK A;  3AVN A;  1JLA A;  3KTQ A;  4H8K A;  3NH1 A;  1CXU A;  2KZM A;  3O3G A;  4Y1C A;  4F4K A;  3L3V A;  1S9G A;  1NKE A;  3L2U A;  1RBS A;  4CEO A;  5HRP A;  3CFP A;  1HPZ A;  3DOK A;  2ETJ A;  1YT3 A;  2IC3 A;  4M45 A;  4DTX A;  1KFD A;  2WON A;  3NF6 A;  3MAQ A;  4J2E A;  2VWK A;  1GOB A;  4N47 A;  3L2W A;  2FBX A;  1NKB A;  4B9T A;  4M42 A;  1SL2 A;  1TKD A;  3RRG A;  3AA3 A;  1IO2 A;  1WSJ A;  4CER A;  3LWM A;  4I2Q A;  4CGG A;  2RKI A;  1UWB A;  2A1R A;  3TAE A;  3HPH A;  4CF1 A;  2P1J A;  4GVM A;  4FLX A;  1NOY A;  3CFO A;  1B9D A;  1HQE A;  1EET A;  3QLH A;  4ID5 A;  2G8V A;  1A5W A;  4BWM A;  3RWU A;  1BHL A;  3RTV A;  4W5Q A;  4K8X A;  1Y97 A;  1YTA A;  4KB1 A;  4FM2 A;  1RBR A;  1WSE A;  4KHW A;  2YNI A;  1HYZ A;  4KFB A;  4C8N A;  4CGH A;  3ZSW A;  4CEZ A;  3LZJ A;  4OKE A;  1NK7 A;  4JRQ A;  1CZ9 A;  3DRP A;  1X9M A;  4E7I A;  3D0P A;  4FYD A;  4JS5 A;  3SCX A;  4MFB A;  4GMJ B;  4C8K A;  1VSJ A;  2ATQ A;  3V1R A;  4OPK A;  2Q3S A;  5HLF A;  4F2S A;  3RMB A;  5J2P A;  4OLA A;  3NHG A;  1S6Q A;  1HNV A;  2IAJ A;  3VQ8 A;  3CM5 A;  4B9V A;  2X74 A;  3O3F A;  3V6D A;  4FLZ A;  4M3Y A;  2KZZ A;  5DK5 A;  1RDB A;  4KRF A;  2FBT A;  2JGU A;  2RPI A;  3LPT A;  3ZSX A;  4B08 A;  2XHB A;  2AJQ A;  4YNQ A;  1A5V A;  3VQB A;  3AVG A;  5CYM A;  3KJV A;  4DSI A;  3DRR A;  4HUF A;  4BE2 A;  4FM1 A;  2F8S A;  2KW4 A;  3AVA A;  3HVR A;  4CFD A;  1D5A A;  5CZ1 A;  1L3V A;  3NAE A;  1G15 A;  4LH5 A;  1A5X A;  5KRS A;  1C6V A;  4CK2 A;  1NJX A;  4DTS A;  5HRN A;  4M3T A;  4CHY A;  1IKX A;  4GW6 A;  4LSL A;  3FFI A;  3CFR A;  3CM6 A;  3DLG A;  5J2Q A;  4Q5V A;  3HP6 A;  2D0A A;  4DF4 A;  3SQ2 A;  4EZ6 A;  1D8Y A;  1WSI A;  3QNN A;  1W0H A;  3MEG A;  4RW6 A;  4AIL C;  4FJ9 A;  3V9U A;  3BDP A;  4KHQ A;  4Q0B A;  2HHX A;  2PY5 A;  4B9L A;  3L2V A;  3IAY A;  1GOC A;  1KFS A;  4CK3 A;  3PX6 A;  2HW3 A;  4CF8 A; 
#chains in the Genus database with same CATH topology
 4JI8 K;  4A5B A;  1S22 A;  3AVC A;  3BEX A;  2P9P B;  1OVY A;  1OVQ A;  5I42 A;  1KVC A;  4CZH A;  4KAZ A;  4BQL A;  1N8R O;  1NK4 A;  1JLG A;  3WQT A;  4DTJ A;  1U04 A;  5AQK A;  1TL3 A;  4BR2 A;  3I0R A;  2NLX A;  2WBN A;  2A40 A;  2E4L A;  3T69 A;  3QNO A;  1OH7 A;  4CIF A;  3CMA N;  3ASM A;  4RCH A;  3C95 A;  3T3F A;  1HJO A;  4KH5 A;  3CET A;  2CGJ A;  3FE1 A;  2GTD A;  3O1W A;  4ZTJ A;  1X3M A;  1T03 A;  3BZC A;  4HCC A;  1X3N A;  4JKH A;  1IKY A;  1M90 O;  4JS4 A;  1KAZ A;  2O8B B;  4IEE A;  3M8S A;  4HHT A;  3HM8 A;  1S1T A;  1N34 K;  4CEA A;  1BL3 A;  4DR3 K;  4X64 K;  1IBK K;  2YJE A;  1Q9Y A;  1IH7 A;  3OYE A;  1HR0 K;  4A2B A;  1EKE A;  3HP9 A;  3QES A;  4J2B A;  2GEM A;  4MO4 A;  5D3G A;  5CE3 A;  1BIU A;  3WXI A;  1QSY A;  1BDG A;  4B9S A;  1LAV A;  3C94 A;  3HPO A;  5LL6 Z;  5C10 A;  1DTQ A;  3QEP A;  1SL0 A;  2YCH A;  1T44 A;  2A5X A;  3VN5 A;  3LP0 A;  1IG8 A;  5J2N A;  3T19 A;  1U4B A;  3PIO L;  1NGI A;  3AAQ A;  4UY8 O;  4ELU A;  2KTQ A;  4WQ4 C;  4CJP A;  3LAN A;  4CJQ A;  5AQH A;  2OZM A;  2O8E B;  4GV3 A;  1G99 A;  4L3Q A;  1CZA N;  4DV7 K;  5C24 A;  3GDQ A;  4B3T K;  1WOQ A;  3K57 A;  2QWM A;  4DU1 A;  4IG0 A;  2R7Y A;  3CCM N;  4FOE A;  4QS8 A;  3SMP A;  2HVH A;  1TL1 A;  1MA9 B;  2I7N A;  2YNF A;  2YHY A;  4FL9 A;  2HMP A;  3CJB A;  4FW2 A;  5C42 A;  1YJ9 N;  4G1Q A;  4DSL A;  3ULE A;  2ZQB A;  2P9S A;  3RMA A;  2RN2 A;  1RDC A;  3AVM A;  4H0V B;  4FPB A;  5DM7 L;  4B3R K;  2G8I A;  1JL1 A;  3OYB A;  4KB0 A;  2OPP A;  4GNI A;  1ILY A;  3VQ6 A;  1NGH A;  4PKG A;  3CYM A;  1KVB A;  3D2F B;  1TAQ A;  4CEC A;  4F3O A;  3SPY A;  4M7Y A;  2P9I A;  5AQI A;  3CHW A;  5JLH A;  1WSF A;  3VEN A;  4FLV A;  4OPJ A;  3R6M A;  1TGO A;  3C7N A;  3B8A X;  3WNF A;  4CJW A;  4CZL A;  3VER A;  1VSK A;  4PL8 A;  4CCH A;  2Q31 A;  3CJ1 A;  3L2Q A;  1J53 A;  3HO1 A;  5KPR A;  4AHT A;  3S9H A;  3E9P A;  3A2F A;  1J6Z A;  3HST B;  4BR5 A;  3WNH A;  4CHO A;  2NRH A;  4FJK A;  4BQZ A;  2HBK A;  3F9K A;  3EE8 A;  1Q81 O;  5C25 A;  1C0U A;  3V9W A;  1N6Q A;  2OPQ A;  5BR8 K;  3ZSY A;  4BE0 A;  3ID8 A;  4C8M A;  4CZG A;  4FK0 A;  1SL1 A;  4RW8 A;  1ZBS A;  5BRD A;  2QWO A;  3D6R A;  4BR7 A;  3AA2 A;  1RT1 A;  3AY9 A;  3VEY A;  4HUG A;  5AJ3 K;  2XY6 A;  1T05 A;  4JKD A;  2OCE A;  4CGJ A;  3QEI A;  3SJJ A;  3K5L A;  4JK9 A;  2H3G X;  1S1W A;  3W0L A;  4V19 S;  2HST A;  4E1M A;  1DT9 A;  4CBW A;  4A57 A;  4DHY A;  2G8F A;  4LF5 K;  4CJU A;  3DXK B;  4E7L A;  1BIZ A;  1RTJ A;  3P5J A;  1KLN A;  4FWL A;  2B5J A;  1RBV A;  2VG6 A;  3MK6 A;  3OHR A;  5BPL A;  3EZ5 A;  1CZB A;  4H5V A;  1IG9 A;  2A3Z A;  4LY7 A;  2P9P A;  3ZT0 A;  3G0Z A;  1YIJ N;  5CZ2 A;  1TVR A;  2O8D A;  4BRH A;  2X6N A;  3CJA A;  3CCQ N;  3HOS A;  3QIC A;  3UKR B;  4CED A;  4HTU A;  5C2F A;  3M3Z A;  4H0Y B;  4DQQ A;  4DF8 A;  1MDU B;  4IDK A;  4KBO A;  5ADX A;  1JLE A;  2Z1H A;  4K43 A;  2UU9 K;  2QK9 A;  1S9E A;  3VPZ A;  4YOR A;  3QIN A;  1TK5 A;  4CBU A;  1WB9 A;  4LH4 A;  4BRP A;  4W5R A;  3VEV A;  1BGX T;  2GX9 A;  4BG9 A;  1S5J A;  1RT4 A;  4KV8 A;  3THY B;  1NJI O;  4C8O A;  2VGN A;  2ZM6 K;  1JXE A;  5I3U A;  4DFP A;  5F1X A;  4F9O A;  2HBM A;  5AQU A;  4PQU A;  2F7T A;  3WNG A;  4DLE A;  2P9N B;  2X6S A;  3U8X A;  2YNG A;  1B9F A;  4AHS A;  2KFN A;  3KLI A;  3ULD A;  1SV5 A;  1GOA A;  1ZXO A;  3OVN A;  1X9S A;  3OS0 A;  3QFP A;  4RTF D;  2A6A A;  2OAN A;  4E7J A;  4LF7 K;  1QSS A;  2NRW A;  1UA1 A;  3SZ2 A;  3ITH A;  2D0O A;  3CD6 N;  3CME N;  5CY4 A;  3MX2 A;  3VMF B;  3RSE B;  3NH2 A;  5ADX H;  4BDZ A;  1O1W A;  1DEJ A;  3J8A A;  1NK0 A;  4CHP A;  3TI0 A;  2XY8 A;  4ILG B;  3PV8 A;  3U3G A;  4FOI A;  4KHU A;  4IWV A;  4BGA A;  1KLM A;  4CGI A;  2FSJ A;  4OX9 K;  3R1X A;  5KI6 A;  4Z4G A;  1BI4 A;  1ATS A;  3SAG A;  3HTV A;  1RT6 A;  1Q8I A;  3L0Q A;  3P31 A;  1U49 A;  1ZBH A;  3SQ4 A;  1T8E A;  3QFU A;  5AQF A;  4PKH A;  1HKC A;  3LP2 A;  4FWS A;  3KKS A;  2CGL A;  3VEX A;  1R0A A;  1VRT A;  3F73 A;  4O4G A;  1RT7 A;  5EXW A;  5BN8 A;  1NGG A;  2B4J A;  5DMR A;  4DU4 A;  4NCB A;  4JD2 B;  2G8K A;  4B8C A;  4FLU A;  2UUA K;  3NDK A;  1QHT A;  3WEE A;  3E01 A;  3TPQ A;  2E5L K;  3O9T A;  1D9D A;  3MCA B;  1WNS A;  3A5N C;  3TAQ A;  5HP1 A;  4GY2 B;  1GLD G;  2GUP A;  3JSM A;  4CJS A;  2QI2 A;  2P9K B;  3GL1 A;  4CHQ A;  4CJR A;  1ASW A;  1NGB A;  3Q7C A;  5AQL A;  4B3S K;  3KTQ A;  3AVN A;  2KZM A;  1NU0 A;  4Y1C A;  1P90 A;  1LCU A;  3ATU A;  3CFP A;  4JAX A;  3AGR A;  2WON A;  4RWT A;  3L2W A;  4B9T A;  4BRE A;  1NGA A;  3RRG A;  3AA3 A;  4JHD B;  1WSJ A;  1JJ2 M;  3EO3 A;  2RKI A;  4H5N A;  3DAW A;  4JD2 A;  4CF1 A;  3VGM A;  2Q1N A;  1WUA A;  1NOY A;  1B9D A;  3QLH A;  4ID5 A;  2G8V A;  4BWM A;  1HKG A;  4K8X A;  4CW7 B;  1SZ2 A;  1YTA A;  2NRR A;  3BP8 A;  2UYT A;  4CEZ A;  3LZJ A;  3H1Q A;  4JRQ A;  4JS5 A;  1FW6 A;  2ATQ A;  3I55 N;  5J2P A;  1HNV A;  2HBJ A;  2PBD A;  1YXQ A;  4FLZ A;  5DK5 A;  1RDB A;  4KRF A;  2FBT A;  2JGU A;  2NRX A;  5LMN K;  4YNQ A;  5E26 A;  3VQB A;  5AQR A;  4DSI A;  4HUF A;  2F8S A;  2KW4 A;  4YOW A;  4CFD A;  1G15 A;  2QWP A;  5AQZ A;  3HI0 A;  4M3T A;  4BC4 A;  4LSL A;  3CFR A;  3I8B A;  3HP6 A;  3RSE A;  1D8Y A;  4FJ9 A;  4AIL C;  3D2E A;  3MN7 A;  5LMU K;  4KHQ A;  3C65 A;  2PY5 A;  1P8Z A;  3IAY A;  3LDQ A;  4CK3 A;  3LDL A;  2ASP A;  3C7N B;  1S1X A;  1S1V A;  1BCO A;  2FSN A;  3QEW A;  3OYN A;  3LAL A;  3PX4 A;  3CJC A;  4H03 B;  4ISG A;  3ULE B;  3AO1 A;  4A5A A;  2IS3 A;  3V1O A;  2Z1G A;  2E2N A;  3AVI A;  3DLE A;  5HOO A;  2NZT A;  1VSM A;  3EZW A;  4B3M K;  1EWQ A;  4NCG A;  2D5R A;  4C8L A;  1SUQ A;  3QML A;  1ZBL A;  4FJ5 A;  2Q0U A;  4OVL A;  2QXF A;  5JS2 A;  3OYK A;  5E41 A;  1Q86 O;  1OH5 A;  3CQX A;  3PIP L;  4CGF A;  3CPW M;  3M8P A;  1M1K O;  4AH9 A;  3VOV A;  1RIL A;  5FRN A;  4FO0 A;  5I9E B;  3VEZ A;  3C6T A;  4ZTF A;  3O4W A;  3BF3 A;  3OYL A;  1BQN A;  4DV1 K;  3VQ4 A;  3MN6 A;  1VQL N;  3UKU B;  3AVJ A;  3J80 O;  1NK6 A;  5TKY A;  1IJJ A;  3CJ9 A;  2WTU A;  1BOT O;  3NGY A;  5CHI A;  3O4Q A;  3O9Q A;  3BF1 A;  1RGI A;  3TAP A;  4YOT A;  1TKT A;  3O3H A;  1L3T A;  3CCV N;  2HF4 A;  5SZT A;  1WLJ A;  2UXD K;  2OTJ N;  3DLL L;  3V9Z A;  3GG4 A;  4IOX A;  3PX0 A;  3QER A;  3FZM A;  1LWF A;  1VSH A;  1HMV A;  2FXU A;  1S72 N;  4B1U B;  2FF6 A;  4C23 A;  3IKM A;  4HCB A;  1RT2 A;  1QTM A;  4OKK A;  3IUC A;  4XEI A;  1HLU A;  1R59 O;  4MO5 A;  5AFU A;  3OA9 A;  2HNZ A;  1VQK N;  3ZSO A;  1RNH A;  2P51 A;  3O1B A;  2DFF A;  2Y1I A;  3LM9 A;  4OLB A;  4FPA A;  5KGW A;  3WNE A;  5EU7 A;  3A8Y A;  4BR4 A;  3DLR A;  3TAF A;  1NK8 A;  4FK4 A;  1RBT A;  4W5O A;  1T6D A;  1EQY A;  4R5P A;  2E20 A;  4J2D A;  3BGR A;  3CXC M;  4DR4 K;  1QZ6 A;  4KHP K;  4PY5 A;  3SNN A;  3HRG A;  1JLQ A;  3AGK A;  5M1O A;  4FWN A;  3DOL A;  2HND A;  3THV A;  4J2A A;  4FJX A;  1Q9X A;  2G8U A;  5IWA K;  1XC3 A;  5GIP A;  3J81 O;  3H6E A;  2UUC K;  1VRU A;  3ZSV A;  1QVF M;  4DTO A;  2E2O A;  4Z4C A;  1Q7Y O;  4IDH A;  2VQF K;  3ZSR A;  2E6L A;  5C12 A;  5DM6 L;  2GV9 A;  2HHQ A;  4CJ5 A;  1J5E K;  5J1E A;  4K42 A;  2JLE A;  4N56 A;  3CPE A;  1LW0 A;  3A0I X;  4JN4 A;  4FWK A;  1WSH A;  3SLC A;  5FRO A;  1BWF O;  3NVM A;  4QAG A;  4JEP A;  4A2A A;  4G9Z A;  3KKR A;  2E88 A;  4IFE A;  3D7E O;  4EFH A;  5HRR A;  3LWL A;  3K0S A;  1KAX A;  3LP1 A;  3P83 D;  4JI6 K;  2V7Y A;  3NF8 A;  1EX4 A;  2VGM A;  2RHK A;  2YHW A;  3ALY A;  4JKG A;  4CFA A;  3THY A;  1IBL K;  2JWL A;  4BRF A;  3DRS A;  1Q18 A;  3AAP A;  5JVH L;  4JI3 K;  3SPZ A;  1BU6 O;  1X1P A;  4LSN A;  3M1F A;  5AQO A;  4DSK A;  4GV9 A;  4FW1 A;  2HHT A;  4FVM A;  1J5O A;  2ITM A;  5HL7 L;  1I39 A;  4DKW A;  1VQP N;  2BAN A;  3KD1 E;  1TUU A;  3C0B A;  3N4Q A;  3QDK A;  4B1X B;  1OH8 A;  1K8A O;  3C6U A;  5EY4 A;  3VTH A;  3SUQ A;  4JI7 K;  1SS6 A;  4FWP A;  3EEQ A;  4QOZ B;  3EKS A;  4AM6 A;  3I56 N;  1GLC G;  1EO1 A;  4N5S A;  1KXP A;  5F2R A;  1VQN N;  3CER A;  3TAR A;  4Z0U A;  1XNQ K;  1YTU A;  1BA0 A;  3LP3 A;  1S6P A;  3ZCM A;  4IFV A;  4LD0 A;  4CFC A;  2AA4 A;  2LSN A;  4BGB A;  1QZ5 A;  4E7K A;  3EN9 A;  1WAF A;  3MXI A;  3OJS A;  3T7Z A;  4N41 A;  4E19 A;  5LJV A;  1NGD A;  4CGD A;  5JS1 A;  5AQW A;  3ZX2 A;  4K0K K;  2ZJR L;  4DFK A;  4CF9 A;  1YJN N;  4BRI A;  1HQU A;  1JCF A;  3KWG A;  2D4W A;  3KD5 E;  4EZ9 A;  2ZWH A;  3KK2 A;  4BAC A;  2HHV A;  4JKB A;  4LC9 B;  2YI1 A;  2W6K A;  3CCJ N;  4YOY A;  1QQM A;  2O4G A;  4FJ8 A;  1F21 A;  4H5W A;  1XQS C;  5J2M A;  2OPS A;  1NG9 A;  4CJT A;  1RDD A;  4M41 A;  4DSE A;  2X78 A;  4FJM A;  4X65 K;  4DLG A;  1WBB A;  3NF7 A;  4EAH D;  2E1Y A;  1IV0 A;  1NKC A;  4FSV A;  3AVK A;  3CI5 A;  5FLX O;  1H1V A;  3OS1 A;  4PA1 A;  3ENB A;  1OH6 A;  2B6A A;  4B9Q A;  1C1A A;  2FBY A;  4BC2 A;  3FZK A;  3KWI A;  4CIG A;  3T1Y K;  3LPU A;  2KFZ A;  1NLV A;  4I6M A;  1BUP A;  4RW7 A;  4X66 K;  4Z4F A;  2YV0 X;  2HNY A;  2VWB A;  2UXC K;  1C1C A;  4KRE A;  4JRP A;  2O8F B;  2VWJ A;  1X9J A;  2FF3 B;  4FJI A;  3OBY A;  1KD1 O;  3GOI A;  2EX3 A;  3I8D A;  2ZE2 A;  4GV6 A;  4UQG A;  4BRG A;  3ISN C;  5IT9 O;  2F4V K;  1C0T A;  2UUB K;  4BRK A;  4DV6 K;  4DS4 A;  4QS9 A;  1Z26 A;  1V4T A;  4JKE A;  1RTH A;  2FBV A;  2QXL A;  3KK3 A;  4FLW A;  3SAH A;  4OGE A;  3OYA A;  3KK1 A;  3I33 A;  1YJW N;  1WSG A;  4FM0 A;  3TTC A;  3AA4 A;  4BVO A;  5AQG A;  1FKO A;  3WT0 A;  3CCU N;  4FCY A;  5M1Q A;  4DV3 K;  3VTI A;  3P4I A;  3SUP A;  4N76 A;  1JLC A;  2KQ2 A;  4LFC K;  4EP4 A;  1BCM A;  2VQE K;  1E4G T;  4CJ4 A;  1K9M O;  2HHW A;  4ISE A;  3ZEU A;  1K8K B;  4RW9 A;  2P9K A;  5AQP A;  3ZET B;  4M3R A;  4WF9 L;  1XI1 A;  1D9F A;  3NBP A;  5KPT A;  2ZD1 A;  3VF2 A;  2ASO A;  4CJV A;  2BE2 A;  2HMI A;  1N33 K;  4KHY A;  4DQS A;  3THX A;  3DWL A;  1O13 A;  4JKA A;  3L3V A;  3L2U A;  1HX1 A;  4CEO A;  3DOK A;  3FLC O;  4YY3 K;  5B8H A;  2VWK A;  5AQQ A;  2FBX A;  2GWJ A;  3WXM B;  1TKD A;  4CER A;  4FWR A;  2A1R A;  5M1F A;  3HPH A;  4FWQ A;  2JWK A;  3H45 C;  2NRV A;  4NXM K;  3RWU A;  1HPM A;  2F9T A;  3RTV A;  4W5Q A;  3O9R A;  3ZYY X;  1RBR A;  4KHW A;  4C8N A;  3ZSW A;  4FWO A;  4FYD A;  3DRP A;  4E7I A;  3A5L C;  3D0P A;  3HBT A;  1VSJ A;  1U6Z A;  3BUZ B;  3V1R A;  2Q3S A;  4C1N K;  4F2S A;  3RMB A;  4OLA A;  2WC9 A;  3WUH A;  2IAJ A;  3VQ8 A;  5F0X A;  3CM5 A;  3V6D A;  2KZZ A;  4NXN K;  3LM2 A;  2RPI A;  3E9O A;  2QA4 N;  3G25 A;  1A5V A;  2QWR A;  5CYM A;  3KJV A;  4AQY K;  1GLF O;  4CZF A;  4LH5 A;  3NAE A;  4CZK A;  4GW6 A;  4GKK K;  1KC8 O;  2OTL N;  4DF4 A;  1SAZ A;  1WSI A;  2O8F A;  1W0H A;  3MEG A;  4AF1 A;  5LJW A;  4IO9 L;  2HHH K;  1VHX A;  3BZK A;  1KFS A;  3L6Q A;  4DTN A;  1D4X A;  3S41 A;  2CH6 A;  3P39 A;  4M7X A;  4IKF A;  5M1N A;  4BVP A;  3TWH A;  1QVG M;  2XY5 A;  3D2F A;  4H4O A;  2QWL A;  5BPM A;  2PFU A;  4JV5 K;  4IJN A;  2QEX N;  4YOX A;  3MX5 A;  1HKB A;  2VG7 A;  3VA3 A;  3G6E N;  3L3U A;  3HJF A;  4B9N A;  2DY4 A;  4QCL A;  3QEV A;  1JL2 A;  5MLC Q;  1Z6R A;  3ZT4 A;  1TKZ A;  3T1A A;  3B6O A;  4E1J A;  2P5G A;  5JLF A;  1VQ9 N;  1L5U A;  1TYQ A;  4DS5 A;  3TR8 A;  4YDU C;  3ZT3 A;  1J9A A;  1LOT B;  3AO3 A;  1E3M A;  4CE9 A;  4FVU A;  3FZH A;  4KH6 A;  3R3L A;  4JKG B;  3DXM B;  4NB4 A;  4AHC A;  1ASU A;  2IIR A;  1QSL A;  1N32 K;  5EOY A;  2F9W A;  2W42 A;  1K8K A;  4O5B A;  3TAM A;  2EWS A;  4W5N A;  4DTU A;  5K14 A;  3H1V X;  3KVG A;  3F9M A;  4A61 A;  4O0I A;  1CLQ A;  4ZHR A;  3T1H K;  1U48 A;  1SKR A;  1BG3 A;  1XHZ A;  4I9L A;  3J7Y P;  2P9U A;  1VAZ A;  3JYT A;  5GIN A;  4E7H A;  4CHZ A;  4NCA A;  3VQA A;  2P9I B;  3S3O A;  3QB0 A;  4JI1 K;  4NYF A;  1ATR A;  4CHN A;  5AQM A;  3VGL A;  1YUW A;  3MWT A;  4CEE A;  2FSK A;  1NJY A;  2O8D B;  3NF9 A;  4FJH A;  1HUX A;  3VF6 A;  2HVI A;  1EXQ A;  3SAF A;  3L4I A;  1U2V B;  2F8T A;  5AQT A;  2W40 A;  3C6H A;  3WXK A;  1B92 A;  1IBM K;  5M1K A;  4DV5 K;  5BRH A;  4J8F A;  1N5Y A;  2YJF A;  3LAK A;  3MN5 A;  5GAD P;  2HB5 A;  3LL3 A;  2DFE A;  5KTQ A;  3KLE A;  1T7P A;  3DI6 A;  3K2P A;  3O9S A;  3E9L A;  1IKV A;  3PLA A;  3MED A;  3J7Z O;  3O9U A;  3TAB A;  4H4M A;  1JXB A;  3RRH A;  3FZL A;  3VQE A;  3D45 A;  3AVH A;  3CCR N;  5CR4 A;  4YHH K;  2ZGY A;  3SQ0 A;  4BR9 A;  2O8C A;  1NJZ A;  4JKF A;  2BDP A;  1FJG K;  3OYD A;  2A42 A;  3S3N A;  4BRA A;  3TAN A;  1W9H A;  4YFU A;  4K25 A;  2W41 A;  5TKW A;  4ILH A;  1TUY A;  4XH1 A;  4KHN A;  4B1Z A;  2FC0 A;  3P1G A;  4CZE A;  4WFA L;  3LDS A;  2PAV A;  3RR8 A;  3E66 A;  3OTO K;  3AAR A;  4CIE A;  2IVN A;  3AO4 A;  4CJ3 A;  4JI4 K;  2HF3 A;  4PL7 A;  2RF2 A;  4LF9 K;  3OYH A;  4IOA L;  4IZ9 A;  3OYG A;  4A59 A;  3HSC A;  5FPD A;  3CG7 A;  5FPE A;  5AQV A;  3CF5 L;  4B9M A;  4H0X B;  2YKN A;  2QWQ A;  3HXM A;  2XY7 A;  4BRQ A;  2NNW A;  4BY9 C;  1NMN A;  3SYZ A;  4PUO A;  1DLO A;  1ZBF A;  4A62 A;  4KPY A;  4HUE A;  4DSF A;  3K5O A;  4BG8 A;  2P9L B;  3ZET A;  3UIQ A;  1X9W A;  1RCH A;  5E84 A;  3CC7 N;  4ELT A;  1VQ6 N;  2O8B A;  4B8A B;  1FKP A;  3DM2 A;  3VEW A;  5AQN A;  4BDP A;  3O6W A;  3O8M A;  3F2K A;  1TYQ B;  4W5T A;  3G10 A;  1BI4 B;  4EHT A;  1EWR A;  3CIP A;  2O8C B;  3MXJ A;  4IEI A;  3ENH A;  3VQP A;  1VQO N;  1LWE A;  3K59 A;  3NGI A;  3SV3 A;  4M3X A;  4CZM A;  2G8H A;  3O80 A;  1UA0 A;  4TSX A;  4BRM A;  3AO2 A;  3NFA A;  4M63 C;  3AV9 A;  1XMO K;  4O8K A;  3HT3 A;  2VCP A;  5FRM A;  2O4I A;  3V1Q A;  1VQ5 N;  3IFR A;  4B1Y B;  4ICL A;  3SQ1 A;  3JS6 A;  4Z4I A;  2QKB A;  3FFK B;  3GE1 A;  3O4N A;  2UXB K;  1NOZ A;  3VA0 A;  3VQ9 A;  2E6M A;  2E2Q A;  4JI5 K;  3CCL N;  3KIO A;  2GUI A;  4B9U A;  4IFY A;  4FZZ A;  1QQC A;  3ENO A;  3IG1 A;  2GBZ A;  3EY1 A;  1S1U A;  4CK1 A;  3NGZ A;  2ZGZ A;  4F3T A;  2YHX A;  1SQK A;  5BR9 A;  4FWM A;  1W2B M;  3H46 O;  3L2R A;  4FZX C;  4MDA A;  3L4Q A;  3KLG A;  2G8W A;  4DV2 K;  1NGF A;  5EVZ A;  3U4L A;  3OJU A;  3OS2 A;  3AVL A;  1QQN A;  1VQ8 N;  1ESV A;  4Z4E A;  1NM1 A;  2YX6 A;  1VSD A;  4IG3 A;  4DV0 K;  4DR2 K;  4LFA K;  2DTU A;  1ASV A;  4E3S A;  4CJ7 A;  1J54 A;  3HK2 A;  3FR0 A;  4JLH A;  1GLE G;  1FXX A;  4ISF A;  3M8R A;  4DSJ A;  4RG8 A;  3B6P A;  4DQ8 A;  3OYJ A;  3WXJ A;  4CJK A;  4AM7 A;  4YOV A;  1VSE A;  4FJL A;  4JHD A;  4NYN A;  3OYM A;  4CES A;  3OYC A;  4O8U A;  4Y1D A;  1NGJ A;  4QS7 A;  3J7A P;  2IVO A;  4WYB A;  2V51 B;  2Z1J A;  3K5N A;  1HNX K;  1NGC A;  4YOU A;  2YHB A;  4WCE L;  4DG1 A;  4MQ3 A;  3FZF A;  3S3M A;  3VQD A;  4OPH A;  1RT5 A;  3THW A;  1VQ4 N;  4CEQ A;  1EP4 A;  1BQM A;  2KHO A;  4DUZ K;  4IOC L;  4KTW A;  2F96 A;  1CXQ A;  4DTM A;  4I7F A;  1MU2 A;  3EE9 A;  5AZI B;  4FJJ A;  2VG5 A;  3MEC A;  3VET A;  2I7P A;  4Z94 A;  4I9Q A;  1YVU A;  3SUN A;  1Z25 A;  4I2P A;  4BDY A;  2GWK A;  3U6F A;  3NCI A;  3NE6 A;  3RMC A;  4LF6 K;  5AQJ A;  1LW2 A;  2QKK A;  4H8K A;  3NH1 A;  3DJC A;  3MMV A;  3SJH A;  4FJ7 A;  5HRP A;  1HPZ A;  4DTX A;  4M45 A;  2Q0R A;  3NF6 A;  3MAQ A;  4J2E A;  5GAH P;  4PHT X;  4N47 A;  1GOB A;  3UB5 A;  4M42 A;  1NKB A;  2J4R A;  3ZX3 A;  4I2Q A;  4O5F A;  1UWB A;  1YVN A;  3THW B;  2P1J A;  4GVM A;  4FLX A;  1A5W A;  3Q7B A;  1BHL A;  3EL2 A;  4MDB A;  4FM2 A;  3KHY A;  1W97 L;  1HYZ A;  2YNI A;  4KFB A;  4CBX A;  4CGH A;  5GAG P;  2P9U B;  4H0O A;  4OKE A;  1X9M A;  1CZ9 A;  4MLH A;  5HLF A;  4WQ5 C;  2KKZ A;  3E1Y A;  2QW9 A;  3H3O B;  3MWP A;  4B9V A;  1C0G A;  2X74 A;  4NO7 A;  3O3F A;  4CVN E;  2XHB A;  3ZSX A;  3NVK A;  1C0F A;  4B08 A;  2AJQ A;  3DXM A;  4GVE A;  1KAY A;  3AVG A;  1VQ7 N;  3DRR A;  4FM1 A;  3HVR A;  2CGK A;  5CZ1 A;  5KQ8 A;  1QQO A;  1A5X A;  5KRS A;  5AZI A;  4CK2 A;  1IKX A;  3CCS N;  3SBT A;  3CM6 A;  3DLG A;  2D1K A;  1YIT N;  2D0A A;  3SQ2 A;  4EZ6 A;  3QNN A;  1HNW K;  3V9U A;  3OBW A;  3CCE N;  3L2V A;  1NWK A;  1GOC A;  3PX6 A;  4CF8 A;  2P9N A;  3SV4 A;  1ZYQ A;  4DTP A;  1LAW A;  1I94 K;  2ZF5 O;  1TK0 A;  4BRL A;  3RR7 A;  4F2R A;  5A2Q O;  3TSQ A;  1KCF A;  4L8R B;  4IJA A;  3AVF A;  3MCP A;  4WQ4 A;  1TV6 A;  4O44 A;  4BWJ A;  5BRF A;  2P5O A;  1E4F T;  3IMX A;  4FJN A;  5KPZ A;  5KQD A;  4OKJ A;  4O0J A;  5JIC A;  3LDP A;  3TTF A;  3THX B;  1GLL O;  1S3X A;  5HBM A;  4MLE A;  4YDU A;  1RDA A;  4H0P A;  1C0M A;  2ITG A;  3OY9 A;  4DR5 K;  1VSL A;  2HHU A;  5M1P A;  1YI2 N;  4DFM A;  1VSI A;  5C0Y A;  5JMV A;  3QBW A;  3LZI A;  4FXD A;  4U67 L;  1V4S A;  1MWM A;  1UAX A;  1HRH A;  4NLC A;  2Z1I A;  1BIS A;  3M8Q A;  4KI4 A;  4DQR A;  4B1W B;  5KRT A;  3PO5 A;  3OW2 M;  3SUO A;  3IRX A;  3TU5 A;  4EP5 A;  3AO5 A;  3EYZ A;  1U47 A;  1Z05 A;  3LDN A;  4BRO A;  1XHX A;  3KK7 A;  2EHG A;  1JCE A;  4X62 K;  4AHR A;  3CC4 N;  5AQY A;  3IDH A;  3QIO A;  1TKX A;  1I3A A;  2V52 B;  1ZBI A;  4EIA A;  3VQC A;  1U45 A;  2YNH A;  5FDL A;  4DFJ A;  3KLH A;  5JVG L;  1DTT A;  4DUY K;  3ZSQ A;  4ID1 A;  3RMD A;  4CJE A;  2D0B A;  3I0S A;  3M5R A;  1NK5 A;  4KH4 A;  4M3W A;  1WAJ A;  1HNI A;  3PY8 A;  3ZT2 A;  2P9S B;  1BA1 A;  1RDU A;  1QHA A;  2BTF A;  4AHU A;  2IGI A;  2IDO A;  3DXK A;  3QO9 A;  2OYQ A;  2O8E A;  1LWC A;  5FPN A;  4BR0 A;  3KLF A;  1UOC A;  3TTD A;  3VEO A;  1NJW A;  3SBG A;  4BRC A;  2QTD A;  3R8E A;  2NRZ A;  5HRS A;  2XO7 A;  5C2D A;  5AQX A;  3MN9 A;  1XC9 A;  3WEE B;  5CYQ A;  4JI0 K;  5AFU H;  4H0T B;  3ZLJ A;  1SKW A;  3VF4 A;  2PYJ A;  3K5M A;  3PUF A;  5BN9 A;  2Q97 A;  5BRE A;  2OA8 A;  1YAG A;  2RE2 A;  4KTQ A;  3HOT A;  3DMJ A;  4K41 A;  4LFB K;  3K9K A;  2FLO A;  4LF4 K;  3DLK A;  2KLA A;  4XH4 A;  1RTD A;  4RW4 A;  1JLB A;  4KKO A;  1REV A;  2ZJP L;  1KTQ A;  4M3Z A;  1KSP A;  4O55 A;  4F8R A;  4DV4 K;  1RFQ A;  5ELZ A;  2OZS A;  4CZJ A;  3W3D A;  3P38 A;  4WE1 A;  5BPN A;  2HOE A;  1SKS A;  3VES A;  3IS9 A;  5AZJ B;  4HVJ A;  1ATN A;  2A1S A;  1ITG A;  3M6G A;  3HVT A;  3ZT1 A;  3U3Y A;  4GKJ K;  3V9S A;  4Y0W A;  4CF0 A;  2Q2R A;  3HPG A;  3R9P A;  3PSF A;  3PO4 A;  4DQP A;  5LY3 A;  4IXC A;  1QS4 A;  2AP1 A;  4B3O A;  1DKG D;  3OYI A;  3V81 A;  2E8A A;  1NBW A;  3RVC A;  3BY5 A;  1U2V A;  2YKM A;  3WQU A;  4CJL A;  2E1Z A;  3DYA A;  2I5J A;  2P9L A;  4DU3 A;  4DMN A;  1KQS M;  3ID6 A;  3ZEU B;  2BH1 A;  4BRD A;  2ZJQ L;  4DR6 K;  3VQQ A;  1RBU A;  4EHU A;  1Y64 A;  3UE5 A;  1NK9 A;  4OJR A;  3ZSZ A;  4DQI A;  2IOC A;  3SK3 A;  3HZ6 A;  4DCH A;  5KGX A;  3HYF A;  3A5M C;  2WUS A;  3LDO A;  3H08 A;  2WOM A;  2PYL A;  4WQ5 A;  4DTR A;  1HJR A;  1XWL A;  4XH5 A;  1LV5 A;  4BE1 A;  3OYF A;  4FZY A;  1VSF A;  4DR1 K;  1XMQ K;  3KZB A;  4PKI A;  2Y1J A;  4KHS A;  2E2P A;  2VYP A;  3K58 A;  3QET A;  3TAG A;  2DPN A;  2YHA A;  3MDQ A;  2NUB A;  3G71 N;  4E0D A;  2Q36 A;  3HM9 A;  3QEX A;  5GAE P;  4OPA A;  3V4I A;  3JAM O;  1QE1 A;  4JK8 A;  4K8Z A;  1T6C A;  2D0P A;  4XIU A;  3A5O C;  5HRO A;  1JLF A;  2BGG A;  4CZI A;  3SI6 A;  5AZJ A;  3TSU A;  2CH5 A;  4U7B A;  1JKH A;  4OGC A;  2OPR A;  1FK9 A;  4CEF A;  4FLT A;  3ATV A;  4ELV A;  4DB3 A;  3DLB A;  4DR7 K;  3VQ5 A;  1GLA G;  1RTI A;  4CF2 A;  3FGU A;  4NLB A;  1YHQ N;  3F5T A;  5T7B A;  3VGK A;  3LAM A;  2DFH A;  5EX5 A;  1TK8 A;  1HYV A;  4BRN A;  4PWD A;  1DGK N;  3EKU A;  4DWI A;  3AVB A;  3WXL A;  3U9D A;  1YF5 L;  3HL8 A;  1NNE A;  3JXU A;  4JKC A;  1WN7 A;  4AHV A;  4E89 A;  3NH0 A;  2XRI A;  3U9Z A;  2HHS A;  3N4P A;  1IKW A;  4FK2 A;  3CJ7 A;  4ILJ A;  5SWM A;  3AA5 X;  1XUP O;  4BC5 A;  4M3U A;  3NMU A;  1ZBU A;  1WBD A;  4WFB L;  1OKJ A;  3MEE A;  3L8B A;  4FJG A;  1GLJ O;  1VK0 A;  2D0C A;  1L3U A;  1L3S A;  4CI6 A;  2QM1 A;  2HW3 A;  3CQ8 A;  3K9J A;  4KTZ A;  3CQY A;  4BC3 A;  3VQ7 A;  2PZS A;  1HYS A;  4IO8 A;  4R79 A;  2GEL A;  4CJF A;  5AQS A;  1RT3 A;  4IBN A;  4CFB A;  4WFN L;  1GLB G;  2A41 A;  4HWI A;  4Z4H A;  2QWN A;  1KVA A;  1KRP A;  1C1B A;  3G4S N;  4CEB A;  3MXM A;  4KI6 A;  3ZX0 A;  3V9X A;  4FLY A;  2BUP A;  1XNR K;  4H5R A;  3TSP A;  3PSI A;  1N36 K;  4CD3 A;  2NRT A;  3DLH A;  4E1N A;  1K6Y A;  4KO0 A;  3QIP A;  3O08 A;  1JLA A;  1NGE A;  1CXU A;  3O3G A;  4F4K A;  1NKE A;  1S9G A;  1RBS A;  4CD1 A;  5FPM A;  2ETJ A;  1YT3 A;  2IC3 A;  4C1N I;  1KFD A;  3CC2 N;  1NMD A;  1SL2 A;  3QBX A;  1ZC6 A;  1IO2 A;  2W6L A;  3LWM A;  2ASM A;  4CGG A;  4JI2 K;  3GBT A;  1K73 O;  3TAE A;  3CFO A;  1HQE A;  3SMS A;  1EET A;  2WFB A;  5C15 A;  1Y97 A;  2HBL A;  4KB1 A;  1WSE A;  1NK7 A;  1TAU A;  3SCX A;  1W7A A;  4MFB A;  4GMJ B;  4C8K A;  4OPK A;  1HNZ K;  3C6A A;  3NHG A;  1S6Q A;  1JCG A;  1RDW X;  1BO5 O;  3O5B A;  5H1S Q;  4LF8 K;  4M3Y A;  4HTL A;  3LPT A;  1MWK A;  5AR0 A;  4BE2 A;  4H5T A;  3AVA A;  4B1V A;  1D5A A;  2IVP A;  1L3V A;  3UKU A;  4JYA K;  4JNE A;  1C6V A;  1NJX A;  4DTS A;  5HRN A;  1Q82 O;  4CHY A;  4JK7 A;  3FFI A;  5J2Q A;  4Q5V A;  2V7Z A;  4OO1 J;  4I6M B;  3H3N O;  4RW6 A;  1VQM N;  3UKR A;  3D2E B;  3BDP A;  5GIO A;  4Q0B A;  2HHX A;  4B9L A;  1T3V A; 
#chains in the Genus database with same CATH homology
 3SV4 A;  1S1X A;  1ZYQ A;  4DTP A;  1LAW A;  3AVC A;  1S1V A;  1BCO A;  3QEW A;  1TK0 A;  3OYN A;  3RR7 A;  3LAL A;  3PX4 A;  4IKF A;  4F2R A;  5I42 A;  1KVC A;  3AO1 A;  4KAZ A;  3TWH A;  1KCF A;  4L8R B;  2XY5 A;  1NK4 A;  3AVF A;  1JLG A;  2IS3 A;  4H4O A;  1TV6 A;  3V1O A;  2Z1G A;  4DTJ A;  3AVI A;  1U04 A;  4O44 A;  1TL3 A;  4BWJ A;  3DLE A;  2P5O A;  3I0R A;  1VSM A;  4FJN A;  4NCG A;  2E4L A;  2D5R A;  4C8L A;  4OKJ A;  4O0J A;  3QNO A;  1SUQ A;  4CIF A;  4DTN A;  1ZBL A;  2VG7 A;  3ASM A;  3C95 A;  3T3F A;  3VA3 A;  5JS2 A;  4OVL A;  2QXF A;  4FJ5 A;  3HJF A;  3L3U A;  3OYK A;  4B9N A;  2DY4 A;  5HBM A;  4QCL A;  4ZTJ A;  5E41 A;  3QEV A;  1RDA A;  1T03 A;  1JL2 A;  1C0M A;  2ITG A;  3ZT4 A;  4CGF A;  4HCC A;  1TKZ A;  3M8P A;  3T1A A;  3OY9 A;  1IKY A;  3B6O A;  4AH9 A;  4JS4 A;  1RIL A;  2P5G A;  5FRN A;  1VSL A;  2HHU A;  3C6T A;  4ZTF A;  3M8S A;  4HHT A;  3OYL A;  1BQN A;  1S1T A;  1L5U A;  4DS5 A;  4DFM A;  3TR8 A;  1VSI A;  4CEA A;  1BL3 A;  3ZT3 A;  3VQ4 A;  3LZI A;  1J9A A;  4FXD A;  3AVJ A;  3AO3 A;  1NK6 A;  4CE9 A;  1UAX A;  1Q9Y A;  1HRH A;  1IH7 A;  2Z1I A;  1BIS A;  3M8Q A;  3NGY A;  3OYE A;  4AHC A;  1EKE A;  1ASU A;  3HP9 A;  3O4Q A;  3QES A;  4J2B A;  4KI4 A;  4DQR A;  1QSL A;  3TAP A;  5D3G A;  1TKT A;  2W42 A;  4O5B A;  5KRT A;  3O3H A;  3TAM A;  3PO5 A;  1BIU A;  4DTU A;  3SUO A;  4W5N A;  5K14 A;  1QSY A;  3IRX A;  1L3T A;  4EP5 A;  3AO5 A;  3EYZ A;  5SZT A;  4O0I A;  4B9S A;  1WLJ A;  1U47 A;  1CLQ A;  4ZHR A;  1LAV A;  3C94 A;  1U48 A;  3HPO A;  1XHZ A;  3V9Z A;  4I9L A;  1SKR A;  1XHX A;  1DTQ A;  2EHG A;  3QER A;  3PX0 A;  3JYT A;  3QEP A;  4E7H A;  4CHZ A;  1SL0 A;  4AHR A;  4NCA A;  3VQA A;  3VN5 A;  1LWF A;  3LP0 A;  3QIO A;  3S3O A;  1VSH A;  1TKX A;  5J2N A;  1I3A A;  3T19 A;  1U4B A;  4NYF A;  1ZBI A;  3VQC A;  1U45 A;  2YNH A;  5FDL A;  4CHN A;  4ELU A;  1HMV A;  4DFJ A;  3KLH A;  2KTQ A;  1DTT A;  4CJP A;  3LAN A;  3ZSQ A;  4CJQ A;  4CEE A;  4HCB A;  1RT2 A;  1NJY A;  2OZM A;  3NF9 A;  4ID1 A;  1QTM A;  4OKK A;  3RMD A;  4FJH A;  4CJE A;  2D0B A;  2HVI A;  1EXQ A;  3I0S A;  2HNZ A;  1NK5 A;  2F8T A;  3ZSO A;  1RNH A;  5C24 A;  2P51 A;  4M3W A;  1WAJ A;  2DFF A;  3K57 A;  1B92 A;  4IG0 A;  4DU1 A;  2R7Y A;  2Y1I A;  1HNI A;  3PY8 A;  4OLB A;  3ZT2 A;  2HVH A;  1N5Y A;  3LAK A;  5KGW A;  2HB5 A;  2DFE A;  5EU7 A;  3WNE A;  4AHU A;  3DLR A;  5KTQ A;  3KLE A;  3TAF A;  1NK8 A;  1T7P A;  2IGI A;  3DI6 A;  2IDO A;  1TL1 A;  4FK4 A;  3K2P A;  1RBT A;  3QO9 A;  4W5O A;  2YNF A;  2OYQ A;  1LWC A;  4R5P A;  3KLF A;  1IKV A;  1UOC A;  3BGR A;  4J2D A;  4PY5 A;  3SNN A;  1NJW A;  3MED A;  1JLQ A;  5HRS A;  4FW2 A;  2XO7 A;  5C42 A;  4G1Q A;  4DSL A;  1XC9 A;  3TAB A;  3DOL A;  2HND A;  4H4M A;  2ZQB A;  3THV A;  4J2A A;  1JXB A;  3RMA A;  3RRH A;  5CYQ A;  2RN2 A;  1RDC A;  3AVM A;  1Q9X A;  4FJX A;  2G8U A;  3VQE A;  3D45 A;  3AVH A;  1SKW A;  2G8I A;  1JL1 A;  3OYB A;  4KB0 A;  2OPP A;  3SQ0 A;  2PYJ A;  1VRU A;  3K5M A;  3ZSV A;  1NJZ A;  3VQ6 A;  3PUF A;  4DTO A;  4Z4C A;  2BDP A;  3OYD A;  2OA8 A;  3CYM A;  1KVB A;  4KTQ A;  3ZSR A;  2E6L A;  1TAQ A;  2GV9 A;  3DMJ A;  4CEC A;  3S3N A;  4F3O A;  3SPY A;  2HHQ A;  4CJ5 A;  3TAN A;  1W9H A;  5J1E A;  4YFU A;  2JLE A;  1WSF A;  3DLK A;  4N56 A;  1RTD A;  4FLV A;  4OPJ A;  4RW4 A;  1JLB A;  4KKO A;  1LW0 A;  1REV A;  3WNF A;  1TGO A;  1KTQ A;  4CJW A;  4M3Z A;  4KHN A;  1VSK A;  1KSP A;  4O55 A;  1WSH A;  2FC0 A;  4CCH A;  3P1G A;  3LDS A;  3RR8 A;  4F8R A;  3L2Q A;  5FRO A;  1J53 A;  3HO1 A;  4AHT A;  4CIE A;  3S9H A;  3AO4 A;  3A2F A;  4QAG A;  4CJ3 A;  2OZS A;  3HST B;  4WE1 A;  3KKR A;  1SKS A;  5HRR A;  3WNH A;  4CHO A;  3LWL A;  4FJK A;  3F9K A;  3LP1 A;  2RF2 A;  3IS9 A;  3P83 D;  3NF8 A;  1EX4 A;  3ALY A;  4CFA A;  5C25 A;  3OYH A;  1C0U A;  3V9W A;  1N6Q A;  4HVJ A;  2OPQ A;  2A1S A;  1ITG A;  3DRS A;  3ZT1 A;  3HVT A;  3ZSY A;  4BE0 A;  4C8M A;  3OYG A;  3U3Y A;  4FK0 A;  3CG7 A;  4CF0 A;  3V9S A;  1SL1 A;  3SPZ A;  4LSN A;  1X1P A;  4RW8 A;  3HPG A;  4DSK A;  3AA2 A;  4FW1 A;  4B9M A;  1RT1 A;  2YKN A;  4FVM A;  1J5O A;  3PO4 A;  4DQP A;  2HHT A;  3HXM A;  2XY7 A;  4HUG A;  1I39 A;  1QS4 A;  2XY6 A;  1T05 A;  2BAN A;  3OYI A;  4B3O A;  3SYZ A;  4CGJ A;  3QEI A;  3V81 A;  3KD1 E;  4PUO A;  1DLO A;  1ZBF A;  3SJJ A;  4KPY A;  2YKM A;  3K5L A;  4HUE A;  4CJL A;  4DSF A;  3C6U A;  3DYA A;  2I5J A;  3K5O A;  3SUQ A;  4DU3 A;  1S1W A;  4DMN A;  3UIQ A;  1X9W A;  4QOZ B;  4E1M A;  1RCH A;  3VQQ A;  1RBU A;  1NK9 A;  4OJR A;  3ZSZ A;  4DQI A;  2G8F A;  4ELT A;  4B8A B;  1FKP A;  2IOC A;  3DM2 A;  4N5S A;  4CJU A;  4E7L A;  5KGX A;  1BIZ A;  1RTJ A;  3P5J A;  3HYF A;  1KLN A;  3TAR A;  4BDP A;  2B5J A;  4Z0U A;  1RBV A;  3H08 A;  2VG6 A;  2WOM A;  4W5T A;  3G10 A;  4DTR A;  2PYL A;  1HJR A;  1BI4 B;  3EZ5 A;  1CZB A;  1XWL A;  1YTU A;  3LP3 A;  1S6P A;  3ZCM A;  1IG9 A;  4IFV A;  4LD0 A;  4LY7 A;  3MXJ A;  4CFC A;  1LV5 A;  4BE1 A;  3OYF A;  3ZT0 A;  3G0Z A;  4FZY A;  1VSF A;  2LSN A;  3VQP A;  5CZ2 A;  4E7K A;  1TVR A;  1LWE A;  3K59 A;  3NGI A;  2X6N A;  3SV3 A;  4M3X A;  2G8H A;  1WAF A;  3MXI A;  1UA0 A;  4TSX A;  2Y1J A;  3AO2 A;  3NFA A;  3OJS A;  3AV9 A;  4KHS A;  3K58 A;  3HT3 A;  3QET A;  4CED A;  4N41 A;  3TAG A;  4HTU A;  5FRM A;  4E19 A;  3V1Q A;  4CGD A;  2YHA A;  2O4I A;  5JS1 A;  4DQQ A;  4DF8 A;  2NUB A;  4DFK A;  4E0D A;  4IDK A;  3SQ1 A;  4ICL A;  4CF9 A;  3HM9 A;  3QEX A;  4Z4I A;  1HQU A;  1JLE A;  2QKB A;  2Z1H A;  3KD5 E;  3O4N A;  3V4I A;  4EZ9 A;  1NOZ A;  1QE1 A;  3VA0 A;  2QK9 A;  3KK2 A;  1S9E A;  3VQ9 A;  2E6M A;  3QIN A;  1TK5 A;  4BAC A;  4LH4 A;  4K8Z A;  2HHV A;  4W5R A;  1BGX T;  3KIO A;  1S5J A;  2GUI A;  1RT4 A;  4KV8 A;  4XIU A;  4B9U A;  5HRO A;  1JLF A;  4IFY A;  4C8O A;  4FZZ A;  2BGG A;  1QQC A;  3SI6 A;  1JXE A;  2O4G A;  3IG1 A;  4FJ8 A;  5I3U A;  2GBZ A;  1F21 A;  1JKH A;  4DFP A;  4OGC A;  2OPR A;  3EY1 A;  1S1U A;  1FK9 A;  4CK1 A;  3NGZ A;  4CEF A;  5J2M A;  2OPS A;  4PQU A;  4CJT A;  1RDD A;  3WNG A;  4DLE A;  4F3T A;  4FLT A;  2X6S A;  4M41 A;  4DSE A;  2YNG A;  1B9F A;  2X78 A;  4AHS A;  3DLB A;  4ELV A;  4DLG A;  4FJM A;  3VQ5 A;  1RTI A;  4CF2 A;  2KFN A;  4FZX C;  3KLI A;  3L2R A;  3ULD A;  1SV5 A;  1GOA A;  3NF7 A;  3OVN A;  3KLG A;  2G8W A;  1NKC A;  3AVK A;  1X9S A;  3OS0 A;  5T7B A;  3OS1 A;  4E7J A;  3OJU A;  3OS2 A;  3AVL A;  1QSS A;  1TAU A;  3LAM A;  2DFH A;  1UA1 A;  1TK8 A;  1HYV A;  4PA1 A;  3SZ2 A;  4Z4E A;  1VSD A;  3ITH A;  4IG3 A;  2B6A A;  1C1A A;  2FBY A;  4PWD A;  2DTU A;  4CIG A;  1ASV A;  5CY4 A;  4E3S A;  3AVB A;  4DWI A;  3LPU A;  1J54 A;  3HK2 A;  2KFZ A;  4Z4F A;  4RW7 A;  3HL8 A;  3NH2 A;  2YV0 X;  1WN7 A;  1O1W A;  4JLH A;  4AHV A;  4BDZ A;  2HNY A;  1NK0 A;  1FXX A;  4CHP A;  2XRI A;  4E89 A;  2XY8 A;  3NH0 A;  1C1C A;  3M8R A;  3U3G A;  3PV8 A;  3TI0 A;  4DSJ A;  4RG8 A;  4KHU A;  4KRE A;  2HHS A;  4JRP A;  2VWJ A;  1KLM A;  3B6P A;  3OYJ A;  1IKW A;  4CGI A;  4FK2 A;  4FJI A;  4CJK A;  5KI6 A;  5SWM A;  3AA5 X;  4Z4G A;  1BI4 A;  2EX3 A;  3I8D A;  1RT6 A;  2ZE2 A;  1Q8I A;  1VSE A;  4FJL A;  4M3U A;  4UQG A;  1U49 A;  4NYN A;  1ZBU A;  3ISN C;  3OYM A;  4CES A;  1ZBH A;  1C0T A;  3OYC A;  3SQ4 A;  1T8E A;  4Y1D A;  3LP2 A;  4DS4 A;  3MEE A;  3L8B A;  4FJG A;  3KKS A;  1Z26 A;  1VK0 A;  2D0C A;  2Z1J A;  1L3U A;  1RTH A;  2FBV A;  1L3S A;  3KK3 A;  3K5N A;  4FLW A;  1R0A A;  1VRT A;  3CQ8 A;  4OGE A;  3OYA A;  3KK1 A;  3F73 A;  4O4G A;  1RT7 A;  4KTZ A;  2YHB A;  3VQ7 A;  4DG1 A;  4MQ3 A;  2PZS A;  1HYS A;  1WSG A;  2B4J A;  4FM0 A;  3S3M A;  5DMR A;  3VQD A;  4DU4 A;  3AA4 A;  1RT5 A;  4NCB A;  1FKO A;  4CJF A;  2G8K A;  4CEQ A;  4B8C A;  4FLU A;  4FCY A;  3NDK A;  1EP4 A;  1RT3 A;  3SUP A;  1QHT A;  4IBN A;  4CFB A;  1BQM A;  4N76 A;  3E01 A;  1JLC A;  2KQ2 A;  1D9D A;  4Z4H A;  4KTW A;  2F96 A;  1CXQ A;  1WNS A;  4DTM A;  1KVA A;  3TAQ A;  1KRP A;  4EP4 A;  1BCM A;  4FJ7 A;  4I7F A;  5HP1 A;  1C1B A;  4CJ4 A;  1MU2 A;  4CEB A;  3MXM A;  4KI6 A;  2HHW A;  3V9X A;  4FLY A;  3JSM A;  4CJS A;  4RW9 A;  4FJJ A;  2VG5 A;  4CHQ A;  4M3R A;  3MEC A;  1XI1 A;  1D9F A;  4CJR A;  3NBP A;  1ASW A;  2ZD1 A;  4I9Q A;  1YVU A;  3SUN A;  4CJV A;  1Z25 A;  4I2P A;  4BDY A;  3U6F A;  2BE2 A;  3NCI A;  4E1N A;  2HMI A;  1K6Y A;  3NE6 A;  3RMC A;  4DQS A;  3DLH A;  4KO0 A;  4KHY A;  3QIP A;  1LW2 A;  2QKK A;  3AVN A;  1JLA A;  3KTQ A;  4H8K A;  3NH1 A;  1CXU A;  2KZM A;  3O3G A;  4Y1C A;  4F4K A;  3L3V A;  1S9G A;  1NKE A;  3L2U A;  1RBS A;  4CEO A;  5HRP A;  3CFP A;  1HPZ A;  3DOK A;  2ETJ A;  1YT3 A;  2IC3 A;  4M45 A;  4DTX A;  1KFD A;  2WON A;  3NF6 A;  3MAQ A;  4J2E A;  2VWK A;  1GOB A;  4N47 A;  3L2W A;  2FBX A;  1NKB A;  4B9T A;  4M42 A;  1SL2 A;  1TKD A;  3RRG A;  3AA3 A;  1IO2 A;  1WSJ A;  4CER A;  3LWM A;  4I2Q A;  4CGG A;  2RKI A;  1UWB A;  2A1R A;  3TAE A;  3HPH A;  4CF1 A;  2P1J A;  4GVM A;  4FLX A;  1NOY A;  3CFO A;  1B9D A;  1HQE A;  1EET A;  3QLH A;  4ID5 A;  2G8V A;  1A5W A;  4BWM A;  3RWU A;  1BHL A;  3RTV A;  4W5Q A;  4K8X A;  1Y97 A;  1YTA A;  4KB1 A;  4FM2 A;  1RBR A;  1WSE A;  4KHW A;  2YNI A;  1HYZ A;  4KFB A;  4C8N A;  4CGH A;  3ZSW A;  4CEZ A;  3LZJ A;  4OKE A;  1NK7 A;  4JRQ A;  1CZ9 A;  3DRP A;  1X9M A;  4E7I A;  3D0P A;  4FYD A;  4JS5 A;  3SCX A;  4MFB A;  4GMJ B;  4C8K A;  1VSJ A;  2ATQ A;  3V1R A;  4OPK A;  2Q3S A;  5HLF A;  4F2S A;  3RMB A;  5J2P A;  4OLA A;  3NHG A;  1S6Q A;  1HNV A;  2IAJ A;  3VQ8 A;  3CM5 A;  4B9V A;  2X74 A;  3O3F A;  3V6D A;  4FLZ A;  4M3Y A;  2KZZ A;  5DK5 A;  1RDB A;  4KRF A;  2FBT A;  2JGU A;  2RPI A;  3LPT A;  3ZSX A;  4B08 A;  2XHB A;  2AJQ A;  4YNQ A;  1A5V A;  3VQB A;  3AVG A;  5CYM A;  3KJV A;  4DSI A;  3DRR A;  4HUF A;  4BE2 A;  4FM1 A;  2F8S A;  2KW4 A;  3AVA A;  3HVR A;  4CFD A;  1D5A A;  5CZ1 A;  1L3V A;  3NAE A;  1G15 A;  4LH5 A;  1A5X A;  5KRS A;  1C6V A;  4CK2 A;  1NJX A;  4DTS A;  5HRN A;  4M3T A;  4CHY A;  1IKX A;  4GW6 A;  4LSL A;  3FFI A;  3CFR A;  3CM6 A;  3DLG A;  5J2Q A;  4Q5V A;  3HP6 A;  2D0A A;  4DF4 A;  3SQ2 A;  4EZ6 A;  1D8Y A;  1WSI A;  3QNN A;  1W0H A;  3MEG A;  4RW6 A;  4AIL C;  4FJ9 A;  3V9U A;  3BDP A;  4KHQ A;  4Q0B A;  2HHX A;  2PY5 A;  4B9L A;  3L2V A;  3IAY A;  1GOC A;  1KFS A;  4CK3 A;  3PX6 A;  2HW3 A;  4CF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...