4AHUA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
155
structure length
153
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahuA00
3QO9A 4Z4EA 1I39A 3ZT1A 2Q3SA 2Z1IA 1BGXT 4LH5A 4N5SA 5KRTA 3BGRA 3OJUA 4FJHA 2OPQA 2PY5A 4JLHA 3TAMA 2XRIA 1WNSA 3ZSYA 4IFVA 4E89A 1CZ9A 3TAFA 3K5MA 5KGWA 1WSIA 3CFPA 2HHXA 2PYLA 1TK0A 2B6AA 3DI6A 3KKRA 3OYFA 3MXJA 3NFAA 4DF4A 1QSLA 2BDPA 4B9LA 4FYDA 4ELUA 4DSJA 4I9QA 4QOZB 4DFKA 1ASWA 2YKMA 3MEEA 4FVMA 1S1UA 4CEQA 2D0CA 3HVRA 3MEGA 4OLBA 5FRMA 1KVAA 3VQ4A 1D8YA 4CFDA 1JXBA 2YNFA 4LY7A 1TGOA 1SL0A 4N76A 2KW4A 4KTZA 3LWMA 3B6OA 1EKEA 1TK8A 4Z0UA 1L3VA 1N6QA 5FDLA 1T05A 4CF2A 4OVLA 4B8AB 1REVA 4DLGA 1NK5A 3ZSOA 5J2PA 1VSDA 1S5JA 3NF6A 5KI6A 4BE2A 1FKPA 1U04A 1RT4A 1U47A 3AO5A 5CYMA 4FZZA 4M3WA 1J5OA 4HUEA 4Q5VA 1G15A 1WLJA 3AO1A 3SQ2A 2OPSA 4CFBA 3VQ7A 3TANA 3DRPA 4CJVA 4YNQA 3V1RA 1VSEA 4CJ5A 4ZTFA 3O3FA 5J2QA 1L5UA 4FZYA 4CEAA 3RTVA 3V9UA 4FJ9A 2D0BA 1IH7A 4CIEA 1YTUA 1SL2A 1JL1A 1RT3A 2VG6A 4DTXA 3QERA 4CJSA 1RTHA 4KKOA 4DSIA 3O4QA 1WSJA 1HMVA 1YTAA 2E6LA 2X6NA 3HT3A 4FLTA 4FLWA 2ZD1A 4KI4A 2VG7A 3ZT4A 3OJSA 3PX6A 3LWLA 3O4NA 3IRXA 3UIQA 4HCBA 4FJGA 1KCFA 1LWFA 1TKXA 1BHLA 4I2QA 4K8XA 3VQQA 1A5XA 3SQ0A 3AVGA 2G8VA 4FJKA 1LAVA 3HO1A 4DG1A 1NK4A 4O0JA 4CJLA 3AVLA 4J2DA 4CJPA 1RT1A 3MAQA 3PV8A 5E41A 4QCLA 3S3NA 3DLHA 1KRPA 2OA8A 4WE1A 2DFHA 4W5TA 1UA1A 4C8KA 1SV5A 3VA0A 2HHQA 3VQBA 1GOAA 3QEIA 1J54A 1IO2A 1TL3A 2HNZA 2RN2A 4FM1A 2WONA 4FJ8A 4JRQA 3AA5X 3WNFA 4FJ5A 4DSLA 2IGIA 2G8FA 3V1OA 2FBXA 1U48A 3C6UA 4FJMA 4CK2A 4HVJA 3RMBA 4CEEA 4HHTA 3OYNA 1LAWA 4LH4A 4KRFA 1FXXA 2IOCA 4CF8A 4Z4CA 4HTUA 1K6YA 5I3UA 4DSFA 2G8HA 3G0ZA 3CM6A 3NF9A 3MXMA 4M45A 3SQ1A 2W42A 4ZTJA 3CFRA 4F3OA 1TK5A 1F21A 3DYAA 1NK6A 3NF7A 1VSIA 4KREA 4CEZA 3QEXA 1CXQA 3AVJA 4FK0A 4FW2A 1L3SA 4JS5A 5FRNA 3MECA 3LALA 2D5RA 4DTRA 2XY7A 1A5WA 2ATQA 3C95A 1W9HA 1O1WA 5CZ2A 5K14A 3OYHA 3L2RA 4DSKA 2X74A 4DF8A 4OGCA 3TWHA 4DLEA 3AA4A 2O4GA 1NK7A 3HL8A 1NK0A 3MEDA 3QINA 2HHVA 2IC3A 3VQDA 4CECA 1U4BA 4CFCA 1HNVA 3DRRA 3KLHA 1KLMA 4ZHRA 1S9GA 1QTMA 2B4JA 2O4IA 1L3UA 4I7FA 1B9FA 4AHVA 1YVUA 2HNYA 3OYMA 1IKWA 2X78A 1TV6A 3NDKA 1KFDA 3DOLA 3VQ6A 3KJVA 1QHTA 2YNGA 3ALYA 3KTQA 3ULDA 1S1XA 3SV3A 1X9MA 4NCBA 1IKXA 1DLOA 1WSHA 4OKJA 5CYQA 1NJWA 4KHYA 4CIFA 3VQPA 3EYZA 4FLXA 1S1TA 2I5JA 5I42A 4Z4FA 4E7LA 2VG5A 4AHCA 5SZTA 4Q0BA 3MXIA 2E6MA 3K5LA 1JLFA 3VQ8A 1S1WA 4ELVA 3U3GA 1I3AA 1RDAA 4C8MA 2BANA 3TAQA 4CEDA 1DTTA 4J2AA 5HRNA 4NYFA 3KK2A 1BIZA 1T7PA 4HCCA 3RRGA 3WNHA 3PX4A 3KLEA 2HHWA 1B92A 3ZSWA 4CGDA 2BE2A 2ZE2A 3OYKA 1NKEA 3TR8A 4CEOA 4CHPA 4UQGA 3DLBA 1Z25A 3KKSA 3OYEA 2GV9A 4CIGA 3KLFA 4E1MA 2XO7A 4CF1A 4KHNA 2ITGA 2E4LA 3OS1A 3RRHA 1XI1A 3P1GA 2Z1JA 1RTJA 3HP9A 3M8SA 3NGZA 3OS2A 3OYJA 4DU1A 4DTUA 3LP2A 4CK1A 3LAKA 3NH2A 1CXUA 2HMIA 2FBVA 4C8OA 1HQEA 4BDZA 4FCYA 1NJYA 2AJQA 3OVNA 3NCIA 5HBMA 3IS9A 1RBTA 1YT3A 4DS4A 1UA0A 2F96A 5C25A 3CYMA 3NH1A 3L2QA 4OKKA 1QS4A 4W5OA 3L3VA 3K57A 3S9HA 1BI4B 2DFEA 4C8LA 3QLHA 3SNNA 3T1AA 3V9XA 3ASMA 3OYIA 3DMJA 3PO4A 2R7YA 4M3UA 1J9AA 3SCXA 1JKHA 1VSLA 3C94A 4CJTA 4BDYA 5KGXA 1RT6A 2KQ2A 3QETA 1JLQA 2IAJA 3SZ2A 2OPPA 1RDBA 4CJUA 1VSMA 2YNIA 3OYBA 3LP0A 3F73A 2A1RA 3F9KA 3H08A 2P5OA 3VQEA 1S9EA 4NCAA 4KI6A 4E7IA 2VWKA 3HP6A 1XHXA 2XY5A 3TI0A 1IKYA 3ZSXA 4CE9A 1Z26A 4E7JA 3DLKA 1RBRA 2JGUA 2EHGA 5C42A 4F3TA 3ZT2A 4DSEA 1X1PA 3QIOA 4O0IA 3SJJA 4KHUA 1JLCA 3HPHA 3L2UA 3VQCA 5CY4A 1C0UA 1C1CA 3V4IA 3AVNA 3E01A 4FLZA 2Y1JA 3B6PA 1JLGA 4BE0A 3K5NA 3O3GA 4FK4A 4B9UA 4B9SA 4KHQA 4O5BA 1S6PA 3HPGA 4CEFA 4DTNA 3LZJA 3SYZA 3NH0A 3NHGA 3JSMA 4DTMA 3CM5A 4FK2A 4Z4GA 4N56A 4M41A 1TKDA 3HXMA 3NE6A 4DQRA 4OPJA 4N41A 3HM9A 3RWUA 1SKSA 2HW3A 2KTQA 4KHSA 3NGYA 4YFUA 4AHRA 1RDCA 1HYSA 4OPKA 1KVBA 4DU3A 1EX4A 2XY6A 2D0AA 4F2SA 3T3FA 3DLRA 1S1VA 3O3HA 3HSTB 1UAXA 1UOCA 3HPOA 3QIPA 1RTDA 3AA3A 3PUFA 1XWLA 2F8TA 4FXDA 4CJWA 4DTPA 1JLEA 3ZSRA 1HYZA 1RCHA 4RW8A 2YV0X 3D45A 1BQMA 5T7BA 1WAFA 1C1BA 3LP3A 4MQ3A 4KAZA 3SUPA 4W5RA 3QNNA 1Q8IA 1RBUA 4Z4IA 4CERA 4F2RA 4LSLA 4TSXA 3DLGA 1BI4A 4O4GA 4RG8A 3VQ5A 4CJEA 4CJFA 3V9SA 1D5AA 4DQPA 4B9MA 4FZXC 1Q9XA 4OKEA 4IDKA 4IG0A 1U45A 4PA1A 4PQUA 3ZT3A 1GOCA 3A2FA 2F8SA 4CK3A 2XY8A 5HRSA 1JLBA 1KVCA 3AVBA 3OYGA 1ZBHA 1TAUA 4E1NA 3THVA 3ITHA 1RBVA 5KTQA 3EZ5A 3L3UA 1X9SA 1RT5A 3AA2A 3ISNC 3LANA 3KD1E 4EZ9A 4KB1A 4M3XA 2DTUA 1NKCA 3D0PA 3G10A 3S3OA 4FLUA 1ITGA 1Y97A 4FJJA 4KPYA 3M8QA 4CGJA 5JS1A 3U6FA 2HB5A 1C0TA 1RT7A 1L3TA 4ICLA 1C1AA 4H4OA 4H8KA 3AVFA 1ZBFA 4DQIA 1FK9A 4FLVA 4DTOA 2KZZA 3JYTA 3ZT0A 1RT2A 4KTWA 3PY8A 4KB0A 1LWCA 5HRRA 2EX3A 5KRSA 3CFOA 4AH9A 3TAPA 2PYJA 4M3YA 4OGEA 4F4KA 1B9DA 3OYLA 1X9WA 4CHQA 4FJNA 2OZMA 3HK2A 2VWJA 3RR8A 3LP1A 4DTJA 4PUOA 1TVRA 2FC0A 4C8NA 5SWMA 4W5QA 4FJIA 3PX0A 3V9ZA 3V6DA 3TAGA 1TKTA 2FBYA 4JS4A 4M42A 4M3TA 4BE1A 3DM2A 5J2NA 1QQCA 2WOMA 4CF9A 4L8RB 4DS5A 2RF2A 2IDOA 4HUFA 2P1JA 1ZYQA 3LPUA 3NF8A 3C6TA 3AVCA 4I9LA 3QESA 1WSEA 2NUBA 4AHSA 2YNHA 2X6SA 2Z1GA 1HQUA 1VK0A 4OLAA 2YHAA 5FROA 1EXQA 1LWEA 3QEWA 3AVKA 3M8RA 4LD0A 4DQSA 3CQ8A 3AVIA 1LV5A 3SUQA 1LW0A 4AHTA 2HNDA 3V9WA 3TABA 3V1QA 4KFBA 3KD5E 1MU2A 1HNIA 3HYFA 1T03A 4ELTA 1RBSA 4FW1A 4NYNA 2JLEA 4BDPA 1BIUA 4KHWA 3VN5A 1A5VA 3KLIA 3OYDA 3I8DA 5DK5A 3KK1A 2IS3A 4PWDA 4BACA 4ID1A 1KTQA 4LSNA 3AO3A 1EP4A 3OYCA 3BDPA 3SV4A 5J2MA 3T19A 5DMRA 1NJZA 2OPRA 4KTQA 1RILA 1VSFA 2G8UA 2ZQBA 4B08A 4E0DA 1GOBA 4CF0A 2GBZA 1SKRA 3M8PA 4BWJA 4GW6A 1D9FA 3AVAA 1T8EA 1Q9YA 3SUNA 4EZ6A 2RKIA 4CJQA 4Y1DA 3K58A 4QAGA 1HJRA 2XHBA 4CJ4A 3L2WA 1U49A 3AO4A 1ZBIA 1ZBUA 4CHNA 4RW7A 5HRPA 1EETA 3KIOA 3I0RA 3NGIA 2A1SA 4CJKA 4H4MA 4DU4A 4IBNA 4AHUA 4CCHA 2DFFA 2HHTA 3RR7A 1NJXA 1NOZA 3HVTA 1VRUA 2P5GA 4B9VA 4FJXA 2HVHA 3ZSQA 1NOYA 1ASVA 3ZSVA 1WAJA 3LAMA 4K8ZA 2Z1HA 2BGGA 1BCOA 1BL3A 1WN7A 3CG7A 3VA3A 1VSKA 4DFMA 3SUOA 1DTQA 4HUGA 4CGIA 1KLNA 1HYVA 4IKFA 4DMNA 3IAYA 3SI6A 5HROA 3P83D 1ASUA 4CJ3A 1C6VA 2ETJA 3AVMA 4EP5A 4FM2A 1SL1A 5JS2A 4CGGA 2PZSA 1QSSA 2B5JA 4DTSA 1UWBA 4JRPA 1VSJA 1BCMA 3FFIA 2FBTA 4KV8A 3L2VA 3L8BA 4CGHA 1LW2A 4Y1CA 1VSHA 3OS0A 1NKBA 3K2PA 4FM0A 4MFBA 4B9NA 4M3ZA 3OY9A 4RW6A 3HJFA 3TAEA 1C0MA 4NCGA 1BISA 1KFSA 4F8RA 1IG9A 5D3GA 1CLQA 1S6QA 1R0AA 4B9TA 4O55A 4B8CA 1CZBA 2QXFA 4GMJB 4DFJA 2Y1IA 2G8KA 2QKKA 2OZSA 4EP4A 3NBPA 2LSNA 3OYAA 4FJ7A 4GVMA 4E7HA 4DFPA 2OYQA 2YHBA 2HHSA 2KFNA 4RW9A 3U3YA 3AV9A 3K5OA 1QE1A 1TL1A 4M3RA 4IG3A 1TAQA 1J53A 1N5YA 3NAEA 1TKZA 3P5JA 3SQ4A 2QKBA 4CGFA 4FLYA 3PO5A 3ZSZA 3AO2A 3S3MA 4I2PA 4Z4HA 3SPZA 3QEPA 1W0HA 3IG1A 1HRHA 2P51A 2YKNA 3DRSA 1WSFA 4N47A 2GUIA 4CFAA 1D9DA 1RNHA 3VQAA 3LDSA 4BWMA 1SUQA 4PY5A 4R5PA 1SKWA 3SPYA 1RTIA 4E7KA 1NK9A 2DY4A 3QEVA 3WNEA 2RPIA 5EU7A 3TARA 2KFZA 1HPZA 3V81A 1QSYA 3WNGA 4DWIA 3KK3A 1NK8A 1RDDA 4CJRA 4XIUA 4J2EA 5J1EA 3EY1A 2G8IA 3I0SA 1BQNA 1JL2A 1WSGA 4IFYA 5C24A 3DLEA 1FKOA 4CHOA 5HP1A 1XC9A 1KSPA 3RMCA 1IKVA 4KO0A 3ZCMA 4E19A 3K59A 4E3SA 1JLAA 4CEBA 3KLGA 3RMDA 3RMAA 4G1QA 3LZIA 2G8WA 4W5NA 4CHYA 1ZBLA 1VRTA 2HHUA 1JXEA 3AVHA 3LPTA 4O44A 4ID5A 3DOKA 4DQQA 4AILC 4FJLA 4CHZA 1XHZA 2KZMA 2QK9A 3VQ9A 3QNOA 4RW4A 4J2BA 4CESA 5HLFA 2HVIA 5CZ1A 4OJRA 4B3OA
chains in the Genus database with same CATH superfamily
2UXCK 1I39A 1BGXT 1QZ6A 2KHOA 2P9IB 4JLHA 2ZWHA 3TAMA 2XRIA 2O8CA 3ZSYA 5KGWA 3CFPA 2HHXA 3DI6A 2BDPA 4B9LA 4FPBA 1OVQA 4R79A 4GV9A 4I9QA 3CCLN 4QOZB 2YKMA 4UY8O 4DV4K 4CEQA 2D0CA 4JKEA 5FRMA 4I6MB 3SBTA 3WEEA 2E2PA 1TGOA 4BC5A 3CD6N 4N76A 1E4GT 2Q31A 1TK8A 4LF5K 5FDLA 1S5JA 2ITMA 5TKYA 4CZIA 1EWQA 1HLUA 4M3WA 1G15A 4A5AA 3AO1A 5LJVA 3DRPA 1L5UA 4ZTFA 4CJ5A 4FZYA 2FF3B 3THYA 3ID8A 3RTVA 4FJ9A 4CIEA 4CI6A 5AQLA 1JL1A 4M7XA 1YITN 1RTHA 1YAGA 4KKOA 3MN9A 1WSJA 4BRFA 2E6LA 2X6NA 4FLTA 3IDHA 4FLWA 4KI4A 3ZT4A 4QS7A 3LWLA 1Q7YO 3O4NA 3VEVA 4H03B 3DLLL 3ZLJA 1M90O 4I2QA 4BRAA 3BZKA 3SQ0A 4DG1A 4EIAA 4K43A 3PV8A 2P9IA 3AARA 1BUPA 2DFHA 5LJWA 4C8KA 2OTJN 3VA0A 2HHQA 3EEQA 4JHDB 3A5NC 4FJ8A 2WONA 5AFUA 4JRQA 3AA5X 3WNFA 3SMSA 3VENA 4DSLA 3V1OA 1U48A 5AQQA 5LMNK 3OYNA 4LH4A 3WXKA 3TTDA 1FXXA 3R6MA 3NF9A 1OH7A 3I56N 4CBUA 4KH5A 1BA1A 2O8BB 3CCUN 4KREA 3MX2A 4CBWA 4JI6K 5FRNA 2D5RA 1W9HA 1O1WA 3L2RA 2E8AA 4LF9K 2Q36A 4DSKA 3TWHA 1NK7A 1GLJO 3ENOA 1HNVA 3DRRA 1HPMA 1KLMA 1L3UA 4I7FA 4BRLA 2UXBK 3CMEN 3NDKA 2QXLA 1QHTA 2YNGA 3O08A 3R9PA 3M3ZA 3ULDA 4KHYA 1NJWA 3N4QA 4B9QA 5C0YA 4Q0BA 4B1UB 3MXIA 3TSUA 4DHYA 4C8MA 4NYFA 3QB0A 3KK2A 1T7PA 4HCCA 3RRGA 3WXIA 4JHDA 4KH6A 3ZSWA 3KWGA 2E5LK 3TR8A 3VEXA 3OYEA 2GV9A 2XO7A 3DAWA 3J7ZO 2ITGA 3RRHA 1XI1A 1RTJA 1DGKN 3HP9A 3H1QA 3WXLA 1E4FT 3CC2N 4RCHA 1CXUA 2HMIA 1WOQA 4C8OA 3O1BA 1NJYA 3OVNA 3IS9A 1YT3A 4L3QA 2O8BA 5AZIB 1ZXOA 2VQFK 2NZTA 1X3NA 2A5XA 4ILJA 1ZBSA 3SCXA 1LOTB 1VSLA 3O1WA 4H0OA 2E2NA 4BGBA 3QETA 3SZ2A 1VSMA 2YNIA 4G9ZA 2P9NA 4NCAA 4E7IA 2FXUA 1NGCA 4LFAK 2I7NA 1OH8A 2QI2A 3PLAA 4DSEA 3SJJA 3A8YA 3O9UA 2Y1JA 3B6PA 4BE0A 3O3GA 4FK4A 4B9UA 4B9SA 2P9KA 4CEFA 3TPQA 2D0PA 2YHXA 3CM5A 4JKDA 4BQLA 3HXMA 1P90A 2IVPA 4OPJA 1TKDA 1ZC6A 3HM9A 2HHHK 3A5OC 2KTQA 3TSPA 3CPWM 3NMUA 1P8ZA 3NGYA 1RDCA 3U9DA 3T3FA 1S1VA 1BG3A 3NVMA 1UOCA 4CZHA 2E20A 4RTFD 4XH4A 2HBLA 3TTCA 3M1FA 3VEWA 5T7BA 4OPAA 5AZIA 3SUPA 4FWQA 4Z4IA 1NBWA 3HRGA 4LSLA 4CJFA 4DQPA 4B9MA 1Q9XA 4IG0A 4PQUA 2HBMA 4BRHA 2XY8A 4JK7A 4O5FA 1ATRA 4IO8A 3OYGA 3O6WA 4E1NA 3ITHA 3AAQA 4CD3A 4EZ9A 3LANA 3ISNC 4FLUA 1L3TA 2RHKA 4ICLA 1C1AA 2O8DA 4DQIA 4M7YA 2QEXN 3A0IX 3MN5A 3ZT0A 1S22A 4KTWA 4FSVA 4NXNK 5KRSA 2EX3A 4M3YA 4F4KA 1B9DA 2O8FB 3BF3A 3DWLA 2ZJPL 2VWJA 4PUOA 3G25A 5SWMA 3V6DA 4M42A 4M3TA 4BE1A 3DM2A 1QQCA 5GINA 2RF2A 4IJNA 4HUFA 2P1JA 1ZYQA 3NF8A 3C6TA 3L0QA 3QESA 1WSEA 2NUBA 4AHSA 4H0XB 2X6SA 1VK0A 1HQUA 4OLAA 4EFHA 4DKWA 4DV6K 1NGDA 3CQ8A 1LV5A 3SUQA 3J80O 2BH1A 4KFBA 4EHTA 1XC3A 1T3VA 1LCUA 5AQRA 4CZJA 4ELTA 2P9UB 4KHWA 3OYDA 5DK5A 4DV0K 3AO3A 1EP4A 4YOYA 3D2FB 3BDPA 3O4WA 3T19A 2OPRA 2G8UA 2ZQBA 2V52B 1GOBA 4C23A 1SKRA 2GEMA 3AVAA 1U6ZA 1IV0A 4AF1A 3DXKA 3K9KA 4XH5A 2Q2RA 2WUSA 1JCEA 2WTUA 1NGJA 1YVNA 2XHBA 4CJ4A 3EKSA 4ISGA 5HRPA 1EETA 1HKBA 3KIOA 1Z6RA 3I0RA 2PAVA 4H4MA 4DU4A 1GLEG 4IBNA 4CCHA 2HVHA 5AZJA 3HVTA 4FJXA 4DQ8A 1NOYA 1BL3A 4DFMA 1VSKA 4DMNA 5EY4A 3P83D 1C6VA 5BPLA 3AVMA 4WCEL 3C0BA 4CGGA 2YCHA 1QSSA 2B5JA 4CVNE 2Q1NA 2Q0RA 1NGIA 1C0GA 2A6AA 3WXMB 1GLBG 3OS0A 1S72N 3SAHA 4WQ4A 4RW6A 1C0MA 1GLFO 1IG9A 3U8XA 4O55A 4OX9K 4OPHA 2QXFA 1VQ9N 2OZSA 3NBPA 4FJ7A 4JI5K 4YORA 1NGAA 3U3YA 1QE1A 1WBBA 5GAEP 1TAQA 1J53A 1TKZA 3SQ4A 4CGFA 3ZSZA 1JJ2M 5EX5A 3QEPA 5GIPA 3LDSA 4DR2K 3AGKA 1RTIA 5C12A 1K9MO 3WNEA 1H1VA 3THWB 1FW6A 5IT9O 4FWLA 2FSKA 3RVCA 4CJRA 4J2EA 3ATUA 4X66K 1O13A 1IKVA 4Z94A 2HBJA 3K59A 4E3SA 4CBXA 3KLGA 3RMDA 3RMAA 3LZIA 4W5NA 1ZBLA 3VEYA 4FJLA 3WUHA 4J8FA 2QK9A 3VQ9A 2QTDA 4JKBA 3CXCM 4IDHA 2Z1IA 5M1OA 4N5SA 3BGRA 3OJUA 2PY5A 2NRTA 4Z4EA 4BRPA 4E89A 3CCRN 1W97L 1CZ9A 2B6AA 1QSLA 2A42A 3CJ9A 4DFKA 4U67L 1D8YA 4CFDA 4LY7A 2YNFA 1SZ2A 5JMVA 5AQWA 4KTZA 3MN6A 1HNZK 1L3VA 1TUUA 1T05A 4CF2A 1REVA 1TUYA 4DUYK 5J2PA 3D6RA 4EAHD 1U47A 3S41A 1WLJA 3SQ2A 3VQ7A 3O9TA 3V1RA 3FR0A 4YNQA 4CZEA 4WQ4C 1Q81O 1V4TA 3THWA 2UUCK 4DV1K 4CJSA 3G4SN 3O4QA 1YTAA 4YDUC 3HT3A 2ZD1A 4PKGA 4BVPA 1S3XA 4HCBA 3IRXA 4FVUA 1KCFA 1TKXA 2NRHA 4K8XA 1QVFM 1A5XA 5CR4A 4K25A 4GKKK 3QBWA 3SK3A 1KXPA 3AVLA 4J2DA 5E41A 3C6HA 4W5TA 5AQOA 4DV3K 1SV5A 1GOAA 1ATNA 1J54A 1IO2A 1TL3A 1YJ9N 2V51B 4FJ5A 3J8AA 4CK2A 5E84A 4CEEA 1LAWA 2G8HA 4JKFA 3ZEUB 3CM6A 3CJBA 4FWNA 3CFRA 3DYAA 5AR0A 3IFRA 2E1YA 3QEXA 3GBTA 1L3SA 4JI7K 3O5BA 2XY7A 3H1VX 5HL7L 1DKGD 4OGCA 4DLEA 4WFBL 4IJAA 1NK0A 2NNWA 3MEDA 1U4BA 4CECA 4CFCA 3KLHA 4ZHRA 1QTMA 2B4JA 4AHVA 1B9FA 1IKWA 2X78A 3VQ6A 3ZETA 3PIPL 3KTQA 1NGGA 4IOCL 1IBLK 1S1XA 3SV3A 1X9MA 1DLOA 2GX9A 1GLLO 3VQPA 4CIFA 5KPZA 3EYZA 1S1TA 1VQ5N 4Z4FA 4E7LA 5AQHA 4AHCA 3HOTA 5SZTA 3J81O 3I8BA 4BR4A 1JLFA 5EOYA 5BRHA 4ELVA 2GTDA 3K9JA 1RDAA 2BANA 1DTTA 4LF6K 3TTFA 3WNHA 3PX4A 1B92A 1CZAN 4CGDA 1NKEA 1Z25A 4CF1A 4BVOA 3OS1A 3P1GA 2IVNA 3WQTA 4DTUA 1N33K 3NGZA 3LP2A 3ZEUA 5LMUK 4BDZA 4FCYA 2AJQA 1SQKA 2NRRA 5C25A 3NH1A 3S9HA 4W5OA 3L3VA 4C8LA 2UU9K 3V9XA 3OYIA 3DMJA 1JKHA 3MCAB 3T69A 4CJTA 4BDYA 1NGFA 1Y64A 4CZFA 2UUBK 2KQ2A 3ZX2A 1IBKK 3UKUB 4CJUA 1QHAA 2P5OA 3H08A 3VQEA 1S9EA 2KLAA 3HP6A 1XHXA 2QWMA 1IKYA 4E7JA 3CERA 4BROA 2JGUA 5ELZA 5C42A 3VGLA 1N32K 3FZLA 4KHUA 1JLCA 4BG9A 3HPHA 4CZKA 3VQCA 2ASPA 3A5LC 4IFEA 4KHQA 4HTLA 4DTNA 3HPGA 3SYZA 3E1YA 2VYPA 3NHGA 3VGMA 3CCSN 4Z4GA 2D4WA 4PHTX 3RWUA 3J7AP 1SKSA 2HW3A 1QQMA 4YFUA 1VQON 5KPRA 4OPKA 5AQJA 1KVBA 3DXMB 3DLRA 3HSCA 1EO1A 4I6MA 3HSTB 3HPOA 1VQPN 3QIPA 3B8AX 1XWLA 1MA9B 4JKCA 3BY5A 2QM1A 4DR4K 1JLEA 3ZSRA 1HYZA 2W6KA 1BQMA 1WAFA 3LP3A 4BR2A 1NM1A 4WFAL 4W5RA 1Q8IA 1RBUA 3DJCA 4CERA 5CE3A 4MO4A 3DLGA 3VQ5A 4FZXC 4CJEA 2YJFA 3MX5A 3H3OB 3ZT3A 1GOCA 1R59O 3A2FA 4CK3A 1TAUA 3UKUA 3WQUA 1RBVA 3KVGA 4M3XA 4KB1A 3KD1E 4DR7K 4V19S 1NKCA 1VQMN 1KAXA 4B1YB 3G10A 1Y97A 4C1NK 5JLHA 5JS1A 1C0TA 1RT7A 3H6EA 5KQ8A 4H4OA 4H8KA 4IEIA 1FK9A 3U9ZA 4FLVA 4DTOA 4KB0A 3PY8A 1LWCA 4AH9A 5LY3A 3ULEB 3BUZB 1NGEA 3AAPA 1X9WA 3UKRB 4Y0WA 3HOSA 3LP1A 4CJ7A 1TVRA 2FC0A 3BF1A 5CHIA 5C15A 3VPZA 4JS4A 5J2NA 4DS5A 3CC7N 3UB5A 3LPUA 1YJWN 3AVCA 3JXUA 3KWIA 2F9TA 2Z1GA 2NRVA 3CJ7A 4DR6K 4YOVA 5FROA 1MDUB 1EXQA 3QEWA 3M8RA 3MK6A 4ISFA 2OANA 3CCMN 3IKMA 3TABA 1HNIA 1RBSA 4FW1A 4NYNA 3SAFA 1BIUA 3M5RA 3VN5A 3AGRA 3I8DA 4PWDA 3MCPA 3SV4A 5J2MA 1XNRK 5AQMA 1RILA 4H0YB 4BY9C 4CF0A 3QFUA 3LDNA 1FJGK 3UE5A 3SJHA 1EWRA 1RFQA 3O9RA 1HJOA 4PKIA 4CJQA 3CJ1A 2FSNA 1U49A 1ZBIA 1ZBUA 4RW7A 2F9WA 3FFKB 4FO0A 4CJKA 3E66A 4B3RK 3ULEA 4AHUA 2HHTA 3UKRA 3RR7A 1NJXA 3ZSQA 5FPNA 2O8EB 1HUXA 3VA3A 5BR9A 3GOIA 3CCVN 2ZJRL 2HSTA 2Q97A 1VQLN 3OBWA 2ETJA 1MWMA 2UYTA 2F4VK 3I55N 1NMNA 3SLCA 4FWRA 2FBTA 3L2VA 3L8BA 1LW2A 1VSHA 3EE9A 4LF4K 5AQTA 1X9JA 3ZX0A 3HJFA 3TAEA 4NCGA 1BISA 4F8RA 1S6QA 1XUPO 4FPAA 5FPEA 1IJJA 1CZBA 4GMJB 4GVMA 4E7HA 2HHSA 2YHBA 2KFNA 2IIRA 4BC2A 3AV9A 1W7AA 4M3RA 2WFBA 3NAEA 3P5JA 4FLYA 3AO2A 4B3MK 4I2PA 4Z4HA 5FPDA 1BOTO 3IG1A 2P51A 1WSFA 4CFAA 4DR5K 1RNHA 1SUQA 4PY5A 3ENBA 3O9SA 1KD1O 2E2QA 3QEVA 5EU7A 4XH1A 4B1VA 3V81A 4DWIA 1NK8A 1RDDA 5H1SQ 4XIUA 5J1EA 3EY1A 1JL2A 5C24A 5I9EB 5M1FA 1XC9A 3ZCMA 4E19A 4IO9L 2GELA 5AQYA 5BRDA 4CHYA 3LPTA 3VMFB 4O44A 5DM7L 4YHHK 2FLOA 4RW4A 4J2BA 1NU0A 3CI5A 5CZ1A 4OLBA 3QO9A 2OPQA 1WNSA 3TAFA 4IFVA 2BTFA 5A2QO 1NLVA 3KKRA 3MXJA 3NFAA 1GLAG 4ISEA 4DF4A 4ELUA 5AQIA 1S1UA 3HVRA 3C7NB 1KVAA 2ZGYA 3CETA 5AQSA 4JKAA 4K42A 4NB4A 1SL0A 1EKEA 1N6QA 5AQGA 4IEEA 4MDAA 4DLGA 3OW2M 1VSDA 3NF6A 5KI6A 5AQKA 1U04A 3AO5A 3MMVA 5CYMA 4FZZA 1J5OA 4Q5VA 2P9PB 3LM2A 4CFBA 3TANA 3QBXA 4FWMA 1VSEA 1ILYA 5J2QA 4PL8A 1IH7A 1YTUA 1SL2A 4DSIA 2O8FA 3CPEA 4YY3K 1OH6A 3GL1A 2WC9A 2VG7A 3OJSA 3BEXA 2YHYA 2W41A 4B1ZA 1BHLA 3VQQA 5F2RA 3AVGA 4BRMA 1YHQN 4FJKA 1LAVA 5EVZA 4O0JA 2BUPA 1N34K 4CJLA 4CJPA 1RT1A 3MAQA 3DLHA 4DUZK 1KRPA 4JKHA 1UA1A 1Q18A 4JI8K 1C0FA 4A57A 2RN2A 2V7YA 4FM1A 3GG4A 3D2EB 2IGIA 2P9UA 4FJMA 3MWTA 2IOCA 4CF8A 5GIOA 3C7NA 1K6YA 4HTUA 4DSFA 3D2FA 3HI0A 3MXMA 4M45A 3SQ1A 2W42A 4ZTJA 4F3OA 3FZMA 1NK6A 3NF7A 1VSIA 2ZM6K 1CXQA 4JS5A 5BN8A 3EL2A 3FZHA 2UXDK 3C95A 1M1KO 5CZ2A 2JWLA 3OYHA 2P9PA 4DF8A 3AA4A 2O4GA 3HL8A 3QINA 4JK9A 1S9GA 3VEOA 3VTIA 1YUWA 3OBYA 5AJ3K 3E9PA 1MWKA 1TV6A 1KFDA 3ALYA 3HZ6A 1IKXA 5AQNA 1WSHA 4OKJA 3CHWA 5I42A 2VG5A 2E6MA 1NMDA 2NRZA 3L6QA 3U3GA 4JKGB 1VQNN 1K73O 3C6AA 1HNXK 1BIZA 3FZKA 4EHUA 3KLEA 2BE2A 5AQUA 4CEOA 4CHPA 4JAXA 4UQGA 3DLBA 4GKJK 3KKSA 4K0KK 4CW7B 2Z1JA 5BR8K 3M8SA 4KBOA 1QVGM 4DR3K 4CK1A 3CJAA 3LAKA 3NH2A 2FBVA 4GVEA 1HQEA 4B1XB 5JVGL 3NCIA 5HBMA 1UA0A 1RBTA 4DS4A 4BRDA 2WBNA 3CYMA 3L2QA 1QS4A 1BI4B 1JCGA 3SNNA 3U4LA 4M3UA 1J9AA 1RT6A 1JLQA 3CQXA 4ILHA 2OPPA 4BR7A 3F73A 1N8RO 3F9KA 4DV7K 2VWKA 3TI0A 4CE9A 3ZSXA 3DLKA 1RBRA 1XQSC 3ZT2A 4BC4A 3CJCA 1X1PA 4O0IA 3M6GA 3L2UA 3P4IA 5CY4A 4LFCK 1C1CA 3E01A 4BRNA 4BRQA 1JLGA 3K5NA 3LZJA 3IMXA 3SMPA 3A5MC 3R8EA 3NH0A 3JSMA 2QWPA 4IZ9A 4FK2A 4N56A 2EWSA 4JK8A 4N41A 2AA4A 2VGNA 4NLBA 3MDQA 4MDBA 1RGIA 5ADXH 4CZLA 5AFUH 3O80A 4FWKA 4AHRA 1HYSA 4DU3A 1BWFO 1EX4A 2D0AA 4F2SA 2P9LB 3O3HA 2QWNA 4FXDA 3PSFA 3PUFA 4H0VB 4DB3A 4QS9A 4JI2K 3P31A 3C65A 2CGLA 5KQDA 1VQ8N 2PBDA 2HMPA 1RCHA 5F1XA 1V4SA 4MQ3A 3JS6A 4F2RA 3V9SA 1BI4A 4RG8A 4H5TA 3N4PA 1D5AA 4NLCA 3WEEB 5HRSA 1JLBA 2NRXA 1VQ7N 3VF2A 1X9SA 3L3UA 4NCBA 3AA2A 3EO3A 5M1KA 3AY9A 2DTUA 2CH6A 3D0PA 3S3OA 1ITGA 4JI1K 4FWPA 3VGKA 4KPYA 4C1NI 2HB5A 4AM7A 3EKUA 1NGBA 4LFBK 4BRIA 2KZZA 5HRRA 2PYJA 3QICA 4FJNA 2OZMA 3RR8A 3IUCA 4DTJA 3GDQA 1QZ5A 3PX0A 3TAGA 4LF7K 2FBYA 4CF9A 3CMAN 3HTVA 3F2KA 5MLCQ 4I9LA 2QWRA 1D4XA 4B3TK 2P9LA 4FWOA 4B1WB 2D0OA 2YHAA 2AP1A 4A2AA 2QWQA 4LF8K 2CGKA 4AHTA 3MN7A 2ZJQL 3HYFA 1T03A 1T44A 4B3SK 4IWVA 5AQPA 1NWKA 4BDPA 3W3DA 3KLIA 4WF9L 1VQKN 4BACA 4CD1A 4ID1A 4A5BA 1KTQA 4LSNA 3K0SA 3OYCA 3R1XA 4BR9A 1VSFA 4E0DA 2GBZA 4BGAA 3G6EN 1SAZA 1T6CA 4BWJA 3T1YK 1D9FA 1T8EA 3LDPA 1KAZA 1Q9YA 1QQOA 3SUNA 2RKIA 5FLXO 4K41A 3K58A 4QAGA 4KH4A 5BN9A 3L2WA 3AO4A 2P9SB 3O9QA 3P39A 3NGIA 1G99A 3L4IA 1NOZA 1VRUA 3CCEN 2YHWA 3FGUA 1ASVA 3LAMA 2Z1HA 2IVOA 3SUOA 1DTQA 2DPNA 3IAYA 3LDQA 5BPNA 2FSJA 3SI6A 5HROA 3QFPA 1SL1A 2YX6A 5JS2A 2A40A 4U7BA 3KHYA 2PZSA 4DTSA 1UWBA 1YI2N 1BCMA 3CF5L 5M1PA 4KV8A 3P38A 3KK7A 4Y1CA 4GY2B 3K2PA 4FM0A 4H0PA 4GV6A 5ADXA 2JWKA 5D3GA 4JI0K 1R0AA 4B9TA 4B8CA 4A59A 5B8HA 2QKKA 2Y1IA 1OH5A 2LSNA 4MLHA 3K5OA 1TL1A 2VGMA 3R3LA 1N5YA 2QKBA 2HBKA 5F0XA 3T1HK 2W6LA 1W0HA 5AQZA 5EXWA 3DRSA 4N47A 5C2FA 1D9DA 3PIOL 1VQ4N 3OHRA 4BWMA 3SPYA 1NK9A 2DY4A 2KFZA 2RPIA 1HX1A 1KAYA 1HPZA 1QSYA 1XNQK 4BRCA 3KK3A 2P9SA 2QWOA 2G8IA 1Z05A 2P9NB 1BQNA 1WSGA 5JICA 4IFYA 5HP1A 1KSPA 2H3GX 3RMCA 1JLAA 4G1QA 2G8WA 2HHUA 1VRTA 2F7TA 4DQQA 3DOKA 4AILC 3EN9A 4CHZA 1GLCG 2KZMA 4BR5A 4CESA 4IOAL 2HVIA 1VAZA 4B3OA 3DXMA 2J4RA 4GNIA 3ZT1A 2Q3SA 4LC9B 2P9KB 4LH5A 5KRTA 4H0TB 4FJHA 3W0LA 2VCPA 3VOVA 3K5MA 1WSIA 2PYLA 1TK0A 3OYFA 2UUAK 4FYDA 4JD2B 4BREA 4DSJA 1ASWA 1BDGA 3MEEA 4FVMA 3MEGA 3EZWA 1ESVA 3VQ4A 1JXBA 5GAGP 2KW4A 1DEJA 3LWMA 1NNEA 5E26A 3VTHA 3B6OA 4Z0UA 5TKWA 4OVLA 5AQXA 3VEZA 4B8AB 4MLEA 1NG9A 1NK5A 3ZSOA 5LL6Z 1KC8O 2D1KA 4BE2A 5BREA 1FKPA 3BP8A 2VQEK 1RT4A 3BZCA 4HUEA 2OPSA 2YJEA 4CJVA 3O3FA 4CEAA 5M1NA 3V9UA 2D0BA 5M1QA 4GV3A 3FZFA 1RT3A 3LDOA 2VG6A 4DTXA 3QERA 2ASMA 5HOOA 1HMVA 4X62K 2E1ZA 3PX6A 5IWAK 4PL7A 4QS8A 3UIQA 1ATSA 1LWFA 4FJGA 2O8DB 3OTOK 1EQYA 2G8VA 3HO1A 1NK4A 4AQYK 1K8AO 2CH5A 4QCLA 3S3NA 2OA8A 4WE1A 1VHXA 3TSQA 2GWKA 3VQBA 3QEIA 4JI3K 4WQ5A 2HNZA 1NGHA 3GE1A 4JD2A 3NVKA 2YI1A 2G8FA 2FBXA 3C6UA 3T7ZA 4HVJA 3RMBA 4IXCA 4HHTA 4KRFA 4Z4CA 5I3UA 1E3MA 3G0ZA 4NXMK 1BU6O 4JEPA 1TK5A 1F21A 3ID6A 4X65K 4CEZA 3AVJA 3H46O 4FK0A 3THXB 4FW2A 3MECA 3LALA 4DTRA 1A5WA 2ATQA 2Q0UA 5K14A 3TU5A 2X74A 2OTLN 4E1JA 2KKZA 2HHVA 2IC3A 3VQDA 1HR0K 2O4IA 2E2OA 4H5WA 1YVUA 3Q7CA 2HNYA 5AQFA 4X64K 3OYMA 3DOLA 3KJVA 3VESA 2O8EA 3DXKB 4WYBA 5CYQA 4FLXA 2I5JA 1DT9A 3K5LA 2VWBA 5FPMA 3VQ8A 1S1WA 3HBTA 1I3AA 5AZJB 3TAQA 4J2AA 4CEDA 4CZMA 5HRNA 3FLCO 3CC4N 4BG8A 2HHWA 3VERA 3SBGA 2ZE2A 3OYKA 4A2BA 1YF5L 4A61A 1OKJA 3KLFA 1YJNN 4CIGA 4E1MA 3MWPA 4KHNA 2E4LA 2ASOA 4YOWA 3OS2A 3OYJA 4DU1A 4YOUA 4YOTA 3VETA 2F96A 4DV5K 4H5NA 3K57A 1BO5O 4PKHA 2HOEA 4OKKA 2DFEA 3THXA 3QLHA 3T1AA 3ASMA 3WT0A 3PO4A 2R7YA 4BR0A 3HM8A 3C94A 4ILGB 5KGXA 4DCHA 5JVHL 4WQ5C 2RE2A 2IAJA 3ZYYX 1RDBA 3OYBA 3LP0A 2A1RA 4YOXA 4KI6A 1YXQA 5GAHP 2XY5A 1Z26A 5KPTA 2EHGA 4JI4K 4F3TA 2PFUA 2HF4A 3QIOA 4FOEA 3JAMO 1HKGA 1C0UA 3ATVA 3V4IA 3AVNA 4JN4A 4FLZA 2A3ZA 4O5BA 1S6PA 1HNWK 1W2BM 3H3NO 4DTMA 4M41A 3NE6A 4DQRA 1WUAA 3D7EO 4KHSA 3FE1A 2XY6A 1K8KB 1T6DA 4FOIA 1UAXA 4XEIA 2GWJA 2F8TA 1RTDA 3AA3A 1VQ6N 4CJWA 4DTPA 4O8KA 1U2VB 4RW8A 2YV0X 3D45A 1C1BA 2W40A 4KAZA 3QNNA 4FWSA 4TSXA 2FF6A 2NRWA 4O4GA 1NJIO 5BPMA 5BRFA 2ZF5O 4OKEA 4IDKA 1U45A 4PA1A 3WXJA 5GADP 4YDUA 1IBMK 2F8SA 3QMLA 1KVCA 3AVBA 4AM6A 1Q86O 1ZBHA 3THVA 4BRKA 4BQZA 5KTQA 3EZ5A 1X3MA 1RT5A 4OO1J 4FL9A 4FJJA 3LM9A 3VF4A 1BA0A 3M8QA 4CGJA 1RDWX 3U6FA 2HF3A 1WBDA 3AVFA 1ZBFA 4IOXA 3JYTA 1RT2A 4BC3A 4F9OA 3CFOA 3TAPA 4OGEA 3OYLA 4CHQA 3HK2A 3ZX3A 1TYQB 4C8NA 4W5QA 4FJIA 3V9ZA 1TKTA 1Q82O 2WOMA 4L8RB 2IDOA 4NO7A 3D2EA 3L4QA 1K8KA 3EE8A 2YNHA 3LDLA 3Q7BA 4WFNL 1LWEA 3AVKA 4LD0A 2QA4N 4DQSA 3SAGA 3AVIA 5C10A 1U2VA 1LW0A 3V9WA 2HNDA 5JLFA 3V1QA 3KZBA 4MO5A 1XMOK 3KD5E 1MU2A 3VF6A 1QQNA 4JV5K 2OCEA 2JLEA 1A5VA 1YIJN 2NLXA 3KK1A 2IS3A 3E9OA 4RWTA 5C2DA 3F9MA 3H45C 5DMRA 1HKCA 4JNEA 1NJZA 4KTQA 4B08A 2E88A 1J5EK 3M8PA 4GW6A 1WB9A 2QWLA 4CZGA 4EZ6A 3CCQN 4H5VA 4Y1DA 1HJRA 4A62A 4CHNA 3CIPA 5AQVA 2A1SA 3I33A 3ENHA 2DFFA 4JKGA 4B9VA 2P5GA 3ZETB 3CQYA 3ZSVA 1WAJA 4K8ZA 3RSEB 2BGGA 1BCOA 1TYQA 1WN7A 3CG7A 2QW9A 4HUGA 3PSIA 4CGIA 1HYVA 1KLNA 4IKFA 3J7YP 3OA9A 4BRGA 1ASUA 4CJ3A 4FM2A 4EP5A 1RDUA 1KQSM 4KHPK 2CGJA 4JRPA 1VSJA 3F5TA 3FFIA 2O8CB 1XMQK 4CGHA 2I7PA 1NKBA 4B9NA 1J6ZA 4MFBA 4JYAK 4M3ZA 3OY9A 1KFSA 1I94K 1CLQA 3QDKA 4DFJA 2G8KA 4EP4A 3OYAA 5DM6L 4DFPA 2OYQA 1GLDG 4RW9A 4IG3A 3PO5A 2GUPA 3S3MA 3SPZA 2ZGZA 3LL3A 1HRHA 2YKNA 1N36K 2GUIA 4DV2K 3VQAA 1SS6A 4R5PA 3CCJN 1SKWA 4E7KA 3G71N 2A41A 3THYB 3TARA 3WNGA 1IG8A 3I0SA 3DLEA 1FKOA 4CHOA 4O8UA 4KO0A 4DR1K 4CEBA 3RSEA 1JXEA 3AVHA 4H5RA 4ID5A 4M63C 3O8MA 1XHZA 1OVYA 3QNOA 2V7ZA 3E9LA 1JCFA 4HWIA 5HLFA 4OJRA
chains in the Genus database with same CATH topology
3QO9A 4Z4EA 1I39A 3ZT1A 2Q3SA 2Z1IA 1BGXT 4LH5A 4N5SA 5KRTA 3BGRA 3OJUA 4FJHA 2OPQA 2PY5A 4JLHA 3TAMA 2XRIA 1WNSA 3ZSYA 4IFVA 4E89A 1CZ9A 3TAFA 3K5MA 5KGWA 1WSIA 3CFPA 2HHXA 2PYLA 1TK0A 2B6AA 3DI6A 3KKRA 3OYFA 3MXJA 3NFAA 4DF4A 1QSLA 2BDPA 4B9LA 4FYDA 4ELUA 4DSJA 4I9QA 4QOZB 4DFKA 1ASWA 2YKMA 3MEEA 4FVMA 1S1UA 4CEQA 2D0CA 3HVRA 3MEGA 4OLBA 5FRMA 1KVAA 3VQ4A 1D8YA 4CFDA 1JXBA 2YNFA 4LY7A 1TGOA 1SL0A 4N76A 2KW4A 4KTZA 3LWMA 3B6OA 1EKEA 1TK8A 4Z0UA 1L3VA 1N6QA 5FDLA 1T05A 4CF2A 4OVLA 4B8AB 1REVA 4DLGA 1NK5A 3ZSOA 5J2PA 1VSDA 1S5JA 3NF6A 5KI6A 4BE2A 1FKPA 1U04A 1RT4A 1U47A 3AO5A 5CYMA 4FZZA 4M3WA 1J5OA 4HUEA 4Q5VA 1G15A 1WLJA 3AO1A 3SQ2A 2OPSA 4CFBA 3VQ7A 3TANA 3DRPA 4CJVA 4YNQA 3V1RA 1VSEA 4CJ5A 4ZTFA 3O3FA 5J2QA 1L5UA 4FZYA 4CEAA 3RTVA 3V9UA 4FJ9A 2D0BA 1IH7A 4CIEA 1YTUA 1SL2A 1JL1A 1RT3A 2VG6A 4DTXA 3QERA 4CJSA 1RTHA 4KKOA 4DSIA 3O4QA 1WSJA 1HMVA 1YTAA 2E6LA 2X6NA 3HT3A 4FLTA 4FLWA 2ZD1A 4KI4A 2VG7A 3ZT4A 3OJSA 3PX6A 3LWLA 3O4NA 3IRXA 3UIQA 4HCBA 4FJGA 1KCFA 1LWFA 1TKXA 1BHLA 4I2QA 4K8XA 3VQQA 1A5XA 3SQ0A 3AVGA 2G8VA 4FJKA 1LAVA 3HO1A 4DG1A 1NK4A 4O0JA 4CJLA 3AVLA 4J2DA 4CJPA 1RT1A 3MAQA 3PV8A 5E41A 4QCLA 3S3NA 3DLHA 1KRPA 2OA8A 4WE1A 2DFHA 4W5TA 1UA1A 4C8KA 1SV5A 3VA0A 2HHQA 3VQBA 1GOAA 3QEIA 1J54A 1IO2A 1TL3A 2HNZA 2RN2A 4FM1A 2WONA 4FJ8A 4JRQA 3AA5X 3WNFA 4FJ5A 4DSLA 2IGIA 2G8FA 3V1OA 2FBXA 1U48A 3C6UA 4FJMA 4CK2A 4HVJA 3RMBA 4CEEA 4HHTA 3OYNA 1LAWA 4LH4A 4KRFA 1FXXA 2IOCA 4CF8A 4Z4CA 4HTUA 1K6YA 5I3UA 4DSFA 2G8HA 3G0ZA 3CM6A 3NF9A 3MXMA 4M45A 3SQ1A 2W42A 4ZTJA 3CFRA 4F3OA 1TK5A 1F21A 3DYAA 1NK6A 3NF7A 1VSIA 4KREA 4CEZA 3QEXA 1CXQA 3AVJA 4FK0A 4FW2A 1L3SA 4JS5A 5FRNA 3MECA 3LALA 2D5RA 4DTRA 2XY7A 1A5WA 2ATQA 3C95A 1W9HA 1O1WA 5CZ2A 5K14A 3OYHA 3L2RA 4DSKA 2X74A 4DF8A 4OGCA 3TWHA 4DLEA 3AA4A 2O4GA 1NK7A 3HL8A 1NK0A 3MEDA 3QINA 2HHVA 2IC3A 3VQDA 4CECA 1U4BA 4CFCA 1HNVA 3DRRA 3KLHA 1KLMA 4ZHRA 1S9GA 1QTMA 2B4JA 2O4IA 1L3UA 4I7FA 1B9FA 4AHVA 1YVUA 2HNYA 3OYMA 1IKWA 2X78A 1TV6A 3NDKA 1KFDA 3DOLA 3VQ6A 3KJVA 1QHTA 2YNGA 3ALYA 3KTQA 3ULDA 1S1XA 3SV3A 1X9MA 4NCBA 1IKXA 1DLOA 1WSHA 4OKJA 5CYQA 1NJWA 4KHYA 4CIFA 3VQPA 3EYZA 4FLXA 1S1TA 2I5JA 5I42A 4Z4FA 4E7LA 2VG5A 4AHCA 5SZTA 4Q0BA 3MXIA 2E6MA 3K5LA 1JLFA 3VQ8A 1S1WA 4ELVA 3U3GA 1I3AA 1RDAA 4C8MA 2BANA 3TAQA 4CEDA 1DTTA 4J2AA 5HRNA 4NYFA 3KK2A 1BIZA 1T7PA 4HCCA 3RRGA 3WNHA 3PX4A 3KLEA 2HHWA 1B92A 3ZSWA 4CGDA 2BE2A 2ZE2A 3OYKA 1NKEA 3TR8A 4CEOA 4CHPA 4UQGA 3DLBA 1Z25A 3KKSA 3OYEA 2GV9A 4CIGA 3KLFA 4E1MA 2XO7A 4CF1A 4KHNA 2ITGA 2E4LA 3OS1A 3RRHA 1XI1A 3P1GA 2Z1JA 1RTJA 3HP9A 3M8SA 3NGZA 3OS2A 3OYJA 4DU1A 4DTUA 3LP2A 4CK1A 3LAKA 3NH2A 1CXUA 2HMIA 2FBVA 4C8OA 1HQEA 4BDZA 4FCYA 1NJYA 2AJQA 3OVNA 3NCIA 5HBMA 3IS9A 1RBTA 1YT3A 4DS4A 1UA0A 2F96A 5C25A 3CYMA 3NH1A 3L2QA 4OKKA 1QS4A 4W5OA 3L3VA 3K57A 3S9HA 1BI4B 2DFEA 4C8LA 3QLHA 3SNNA 3T1AA 3V9XA 3ASMA 3OYIA 3DMJA 3PO4A 2R7YA 4M3UA 1J9AA 3SCXA 1JKHA 1VSLA 3C94A 4CJTA 4BDYA 5KGXA 1RT6A 2KQ2A 3QETA 1JLQA 2IAJA 3SZ2A 2OPPA 1RDBA 4CJUA 1VSMA 2YNIA 3OYBA 3LP0A 3F73A 2A1RA 3F9KA 3H08A 2P5OA 3VQEA 1S9EA 4NCAA 4KI6A 4E7IA 2VWKA 3HP6A 1XHXA 2XY5A 3TI0A 1IKYA 3ZSXA 4CE9A 1Z26A 4E7JA 3DLKA 1RBRA 2JGUA 2EHGA 5C42A 4F3TA 3ZT2A 4DSEA 1X1PA 3QIOA 4O0IA 3SJJA 4KHUA 1JLCA 3HPHA 3L2UA 3VQCA 5CY4A 1C0UA 1C1CA 3V4IA 3AVNA 3E01A 4FLZA 2Y1JA 3B6PA 1JLGA 4BE0A 3K5NA 3O3GA 4FK4A 4B9UA 4B9SA 4KHQA 4O5BA 1S6PA 3HPGA 4CEFA 4DTNA 3LZJA 3SYZA 3NH0A 3NHGA 3JSMA 4DTMA 3CM5A 4FK2A 4Z4GA 4N56A 4M41A 1TKDA 3HXMA 3NE6A 4DQRA 4OPJA 4N41A 3HM9A 3RWUA 1SKSA 2HW3A 2KTQA 4KHSA 3NGYA 4YFUA 4AHRA 1RDCA 1HYSA 4OPKA 1KVBA 4DU3A 1EX4A 2XY6A 2D0AA 4F2SA 3T3FA 3DLRA 1S1VA 3O3HA 3HSTB 1UAXA 1UOCA 3HPOA 3QIPA 1RTDA 3AA3A 3PUFA 1XWLA 2F8TA 4FXDA 4CJWA 4DTPA 1JLEA 3ZSRA 1HYZA 1RCHA 4RW8A 2YV0X 3D45A 1BQMA 5T7BA 1WAFA 1C1BA 3LP3A 4MQ3A 4KAZA 3SUPA 4W5RA 3QNNA 1Q8IA 1RBUA 4Z4IA 4CERA 4F2RA 4LSLA 4TSXA 3DLGA 1BI4A 4O4GA 4RG8A 3VQ5A 4CJEA 4CJFA 3V9SA 1D5AA 4DQPA 4B9MA 4FZXC 1Q9XA 4OKEA 4IDKA 4IG0A 1U45A 4PA1A 4PQUA 3ZT3A 1GOCA 3A2FA 2F8SA 4CK3A 2XY8A 5HRSA 1JLBA 1KVCA 3AVBA 3OYGA 1ZBHA 1TAUA 4E1NA 3THVA 3ITHA 1RBVA 5KTQA 3EZ5A 3L3UA 1X9SA 1RT5A 3AA2A 3ISNC 3LANA 3KD1E 4EZ9A 4KB1A 4M3XA 2DTUA 1NKCA 3D0PA 3G10A 3S3OA 4FLUA 1ITGA 1Y97A 4FJJA 4KPYA 3M8QA 4CGJA 5JS1A 3U6FA 2HB5A 1C0TA 1RT7A 1L3TA 4ICLA 1C1AA 4H4OA 4H8KA 3AVFA 1ZBFA 4DQIA 1FK9A 4FLVA 4DTOA 2KZZA 3JYTA 3ZT0A 1RT2A 4KTWA 3PY8A 4KB0A 1LWCA 5HRRA 2EX3A 5KRSA 3CFOA 4AH9A 3TAPA 2PYJA 4M3YA 4OGEA 4F4KA 1B9DA 3OYLA 1X9WA 4CHQA 4FJNA 2OZMA 3HK2A 2VWJA 3RR8A 3LP1A 4DTJA 4PUOA 1TVRA 2FC0A 4C8NA 5SWMA 4W5QA 4FJIA 3PX0A 3V9ZA 3V6DA 3TAGA 1TKTA 2FBYA 4JS4A 4M42A 4M3TA 4BE1A 3DM2A 5J2NA 1QQCA 2WOMA 4CF9A 4L8RB 4DS5A 2RF2A 2IDOA 4HUFA 2P1JA 1ZYQA 3LPUA 3NF8A 3C6TA 3AVCA 4I9LA 3QESA 1WSEA 2NUBA 4AHSA 2YNHA 2X6SA 2Z1GA 1HQUA 1VK0A 4OLAA 2YHAA 5FROA 1EXQA 1LWEA 3QEWA 3AVKA 3M8RA 4LD0A 4DQSA 3CQ8A 3AVIA 1LV5A 3SUQA 1LW0A 4AHTA 2HNDA 3V9WA 3TABA 3V1QA 4KFBA 3KD5E 1MU2A 1HNIA 3HYFA 1T03A 4ELTA 1RBSA 4FW1A 4NYNA 2JLEA 4BDPA 1BIUA 4KHWA 3VN5A 1A5VA 3KLIA 3OYDA 3I8DA 5DK5A 3KK1A 2IS3A 4PWDA 4BACA 4ID1A 1KTQA 4LSNA 3AO3A 1EP4A 3OYCA 3BDPA 3SV4A 5J2MA 3T19A 5DMRA 1NJZA 2OPRA 4KTQA 1RILA 1VSFA 2G8UA 2ZQBA 4B08A 4E0DA 1GOBA 4CF0A 2GBZA 1SKRA 3M8PA 4BWJA 4GW6A 1D9FA 3AVAA 1T8EA 1Q9YA 3SUNA 4EZ6A 2RKIA 4CJQA 4Y1DA 3K58A 4QAGA 1HJRA 2XHBA 4CJ4A 3L2WA 1U49A 3AO4A 1ZBIA 1ZBUA 4CHNA 4RW7A 5HRPA 1EETA 3KIOA 3I0RA 3NGIA 2A1SA 4CJKA 4H4MA 4DU4A 4IBNA 4AHUA 4CCHA 2DFFA 2HHTA 3RR7A 1NJXA 1NOZA 3HVTA 1VRUA 2P5GA 4B9VA 4FJXA 2HVHA 3ZSQA 1NOYA 1ASVA 3ZSVA 1WAJA 3LAMA 4K8ZA 2Z1HA 2BGGA 1BCOA 1BL3A 1WN7A 3CG7A 3VA3A 1VSKA 4DFMA 3SUOA 1DTQA 4HUGA 4CGIA 1KLNA 1HYVA 4IKFA 4DMNA 3IAYA 3SI6A 5HROA 3P83D 1ASUA 4CJ3A 1C6VA 2ETJA 3AVMA 4EP5A 4FM2A 1SL1A 5JS2A 4CGGA 2PZSA 1QSSA 2B5JA 4DTSA 1UWBA 4JRPA 1VSJA 1BCMA 3FFIA 2FBTA 4KV8A 3L2VA 3L8BA 4CGHA 1LW2A 4Y1CA 1VSHA 3OS0A 1NKBA 3K2PA 4FM0A 4MFBA 4B9NA 4M3ZA 3OY9A 4RW6A 3HJFA 3TAEA 1C0MA 4NCGA 1BISA 1KFSA 4F8RA 1IG9A 5D3GA 1CLQA 1S6QA 1R0AA 4B9TA 4O55A 4B8CA 1CZBA 2QXFA 4GMJB 4DFJA 2Y1IA 2G8KA 2QKKA 2OZSA 4EP4A 3NBPA 2LSNA 3OYAA 4FJ7A 4GVMA 4E7HA 4DFPA 2OYQA 2YHBA 2HHSA 2KFNA 4RW9A 3U3YA 3AV9A 3K5OA 1QE1A 1TL1A 4M3RA 4IG3A 1TAQA 1J53A 1N5YA 3NAEA 1TKZA 3P5JA 3SQ4A 2QKBA 4CGFA 4FLYA 3PO5A 3ZSZA 3AO2A 3S3MA 4I2PA 4Z4HA 3SPZA 3QEPA 1W0HA 3IG1A 1HRHA 2P51A 2YKNA 3DRSA 1WSFA 4N47A 2GUIA 4CFAA 1D9DA 1RNHA 3VQAA 3LDSA 4BWMA 1SUQA 4PY5A 4R5PA 1SKWA 3SPYA 1RTIA 4E7KA 1NK9A 2DY4A 3QEVA 3WNEA 2RPIA 5EU7A 3TARA 2KFZA 1HPZA 3V81A 1QSYA 3WNGA 4DWIA 3KK3A 1NK8A 1RDDA 4CJRA 4XIUA 4J2EA 5J1EA 3EY1A 2G8IA 3I0SA 1BQNA 1JL2A 1WSGA 4IFYA 5C24A 3DLEA 1FKOA 4CHOA 5HP1A 1XC9A 1KSPA 3RMCA 1IKVA 4KO0A 3ZCMA 4E19A 3K59A 4E3SA 1JLAA 4CEBA 3KLGA 3RMDA 3RMAA 4G1QA 3LZIA 2G8WA 4W5NA 4CHYA 1ZBLA 1VRTA 2HHUA 1JXEA 3AVHA 3LPTA 4O44A 4ID5A 3DOKA 4DQQA 4AILC 4FJLA 4CHZA 1XHZA 2KZMA 2QK9A 3VQ9A 3QNOA 4RW4A 4J2BA 4CESA 5HLFA 2HVIA 5CZ1A 4OJRA 4B3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO9 A;  4Z4E A;  1I39 A;  3ZT1 A;  2Q3S A;  2Z1I A;  1BGX T;  4LH5 A;  4N5S A;  5KRT A;  3BGR A;  3OJU A;  4FJH A;  2OPQ A;  2PY5 A;  4JLH A;  3TAM A;  2XRI A;  1WNS A;  3ZSY A;  4IFV A;  4E89 A;  1CZ9 A;  3TAF A;  3K5M A;  5KGW A;  1WSI A;  3CFP A;  2HHX A;  2PYL A;  1TK0 A;  2B6A A;  3DI6 A;  3KKR A;  3OYF A;  3MXJ A;  3NFA A;  4DF4 A;  1QSL A;  2BDP A;  4B9L A;  4FYD A;  4ELU A;  4DSJ A;  4I9Q A;  4QOZ B;  4DFK A;  1ASW A;  2YKM A;  3MEE A;  4FVM A;  1S1U A;  4CEQ A;  2D0C A;  3HVR A;  3MEG A;  4OLB A;  5FRM A;  1KVA A;  3VQ4 A;  1D8Y A;  4CFD A;  1JXB A;  2YNF A;  4LY7 A;  1TGO A;  1SL0 A;  4N76 A;  2KW4 A;  4KTZ A;  3LWM A;  3B6O A;  1EKE A;  1TK8 A;  4Z0U A;  1L3V A;  1N6Q A;  5FDL A;  1T05 A;  4CF2 A;  4OVL A;  4B8A B;  1REV A;  4DLG A;  1NK5 A;  3ZSO A;  5J2P A;  1VSD A;  1S5J A;  3NF6 A;  5KI6 A;  4BE2 A;  1FKP A;  1U04 A;  1RT4 A;  1U47 A;  3AO5 A;  5CYM A;  4FZZ A;  4M3W A;  1J5O A;  4HUE A;  4Q5V A;  1G15 A;  1WLJ A;  3AO1 A;  3SQ2 A;  2OPS A;  4CFB A;  3VQ7 A;  3TAN A;  3DRP A;  4CJV A;  4YNQ A;  3V1R A;  1VSE A;  4CJ5 A;  4ZTF A;  3O3F A;  5J2Q A;  1L5U A;  4FZY A;  4CEA A;  3RTV A;  3V9U A;  4FJ9 A;  2D0B A;  1IH7 A;  4CIE A;  1YTU A;  1SL2 A;  1JL1 A;  1RT3 A;  2VG6 A;  4DTX A;  3QER A;  4CJS A;  1RTH A;  4KKO A;  4DSI A;  3O4Q A;  1WSJ A;  1HMV A;  1YTA A;  2E6L A;  2X6N A;  3HT3 A;  4FLT A;  4FLW A;  2ZD1 A;  4KI4 A;  2VG7 A;  3ZT4 A;  3OJS A;  3PX6 A;  3LWL A;  3O4N A;  3IRX A;  3UIQ A;  4HCB A;  4FJG A;  1KCF A;  1LWF A;  1TKX A;  1BHL A;  4I2Q A;  4K8X A;  3VQQ A;  1A5X A;  3SQ0 A;  3AVG A;  2G8V A;  4FJK A;  1LAV A;  3HO1 A;  4DG1 A;  1NK4 A;  4O0J A;  4CJL A;  3AVL A;  4J2D A;  4CJP A;  1RT1 A;  3MAQ A;  3PV8 A;  5E41 A;  4QCL A;  3S3N A;  3DLH A;  1KRP A;  2OA8 A;  4WE1 A;  2DFH A;  4W5T A;  1UA1 A;  4C8K A;  1SV5 A;  3VA0 A;  2HHQ A;  3VQB A;  1GOA A;  3QEI A;  1J54 A;  1IO2 A;  1TL3 A;  2HNZ A;  2RN2 A;  4FM1 A;  2WON A;  4FJ8 A;  4JRQ A;  3AA5 X;  3WNF A;  4FJ5 A;  4DSL A;  2IGI A;  2G8F A;  3V1O A;  2FBX A;  1U48 A;  3C6U A;  4FJM A;  4CK2 A;  4HVJ A;  3RMB A;  4CEE A;  4HHT A;  3OYN A;  1LAW A;  4LH4 A;  4KRF A;  1FXX A;  2IOC A;  4CF8 A;  4Z4C A;  4HTU A;  1K6Y A;  5I3U A;  4DSF A;  2G8H A;  3G0Z A;  3CM6 A;  3NF9 A;  3MXM A;  4M45 A;  3SQ1 A;  2W42 A;  4ZTJ A;  3CFR A;  4F3O A;  1TK5 A;  1F21 A;  3DYA A;  1NK6 A;  3NF7 A;  1VSI A;  4KRE A;  4CEZ A;  3QEX A;  1CXQ A;  3AVJ A;  4FK0 A;  4FW2 A;  1L3S A;  4JS5 A;  5FRN A;  3MEC A;  3LAL A;  2D5R A;  4DTR A;  2XY7 A;  1A5W A;  2ATQ A;  3C95 A;  1W9H A;  1O1W A;  5CZ2 A;  5K14 A;  3OYH A;  3L2R A;  4DSK A;  2X74 A;  4DF8 A;  4OGC A;  3TWH A;  4DLE A;  3AA4 A;  2O4G A;  1NK7 A;  3HL8 A;  1NK0 A;  3MED A;  3QIN A;  2HHV A;  2IC3 A;  3VQD A;  4CEC A;  1U4B A;  4CFC A;  1HNV A;  3DRR A;  3KLH A;  1KLM A;  4ZHR A;  1S9G A;  1QTM A;  2B4J A;  2O4I A;  1L3U A;  4I7F A;  1B9F A;  4AHV A;  1YVU A;  2HNY A;  3OYM A;  1IKW A;  2X78 A;  1TV6 A;  3NDK A;  1KFD A;  3DOL A;  3VQ6 A;  3KJV A;  1QHT A;  2YNG A;  3ALY A;  3KTQ A;  3ULD A;  1S1X A;  3SV3 A;  1X9M A;  4NCB A;  1IKX A;  1DLO A;  1WSH A;  4OKJ A;  5CYQ A;  1NJW A;  4KHY A;  4CIF A;  3VQP A;  3EYZ A;  4FLX A;  1S1T A;  2I5J A;  5I42 A;  4Z4F A;  4E7L A;  2VG5 A;  4AHC A;  5SZT A;  4Q0B A;  3MXI A;  2E6M A;  3K5L A;  1JLF A;  3VQ8 A;  1S1W A;  4ELV A;  3U3G A;  1I3A A;  1RDA A;  4C8M A;  2BAN A;  3TAQ A;  4CED A;  1DTT A;  4J2A A;  5HRN A;  4NYF A;  3KK2 A;  1BIZ A;  1T7P A;  4HCC A;  3RRG A;  3WNH A;  3PX4 A;  3KLE A;  2HHW A;  1B92 A;  3ZSW A;  4CGD A;  2BE2 A;  2ZE2 A;  3OYK A;  1NKE A;  3TR8 A;  4CEO A;  4CHP A;  4UQG A;  3DLB A;  1Z25 A;  3KKS A;  3OYE A;  2GV9 A;  4CIG A;  3KLF A;  4E1M A;  2XO7 A;  4CF1 A;  4KHN A;  2ITG A;  2E4L A;  3OS1 A;  3RRH A;  1XI1 A;  3P1G A;  2Z1J A;  1RTJ A;  3HP9 A;  3M8S A;  3NGZ A;  3OS2 A;  3OYJ A;  4DU1 A;  4DTU A;  3LP2 A;  4CK1 A;  3LAK A;  3NH2 A;  1CXU A;  2HMI A;  2FBV A;  4C8O A;  1HQE A;  4BDZ A;  4FCY A;  1NJY A;  2AJQ A;  3OVN A;  3NCI A;  5HBM A;  3IS9 A;  1RBT A;  1YT3 A;  4DS4 A;  1UA0 A;  2F96 A;  5C25 A;  3CYM A;  3NH1 A;  3L2Q A;  4OKK A;  1QS4 A;  4W5O A;  3L3V A;  3K57 A;  3S9H A;  1BI4 B;  2DFE A;  4C8L A;  3QLH A;  3SNN A;  3T1A A;  3V9X A;  3ASM A;  3OYI A;  3DMJ A;  3PO4 A;  2R7Y A;  4M3U A;  1J9A A;  3SCX A;  1JKH A;  1VSL A;  3C94 A;  4CJT A;  4BDY A;  5KGX A;  1RT6 A;  2KQ2 A;  3QET A;  1JLQ A;  2IAJ A;  3SZ2 A;  2OPP A;  1RDB A;  4CJU A;  1VSM A;  2YNI A;  3OYB A;  3LP0 A;  3F73 A;  2A1R A;  3F9K A;  3H08 A;  2P5O A;  3VQE A;  1S9E A;  4NCA A;  4KI6 A;  4E7I A;  2VWK A;  3HP6 A;  1XHX A;  2XY5 A;  3TI0 A;  1IKY A;  3ZSX A;  4CE9 A;  1Z26 A;  4E7J A;  3DLK A;  1RBR A;  2JGU A;  2EHG A;  5C42 A;  4F3T A;  3ZT2 A;  4DSE A;  1X1P A;  3QIO A;  4O0I A;  3SJJ A;  4KHU A;  1JLC A;  3HPH A;  3L2U A;  3VQC A;  5CY4 A;  1C0U A;  1C1C A;  3V4I A;  3AVN A;  3E01 A;  4FLZ A;  2Y1J A;  3B6P A;  1JLG A;  4BE0 A;  3K5N A;  3O3G A;  4FK4 A;  4B9U A;  4B9S A;  4KHQ A;  4O5B A;  1S6P A;  3HPG A;  4CEF A;  4DTN A;  3LZJ A;  3SYZ A;  3NH0 A;  3NHG A;  3JSM A;  4DTM A;  3CM5 A;  4FK2 A;  4Z4G A;  4N56 A;  4M41 A;  1TKD A;  3HXM A;  3NE6 A;  4DQR A;  4OPJ A;  4N41 A;  3HM9 A;  3RWU A;  1SKS A;  2HW3 A;  2KTQ A;  4KHS A;  3NGY A;  4YFU A;  4AHR A;  1RDC A;  1HYS A;  4OPK A;  1KVB A;  4DU3 A;  1EX4 A;  2XY6 A;  2D0A A;  4F2S A;  3T3F A;  3DLR A;  1S1V A;  3O3H A;  3HST B;  1UAX A;  1UOC A;  3HPO A;  3QIP A;  1RTD A;  3AA3 A;  3PUF A;  1XWL A;  2F8T A;  4FXD A;  4CJW A;  4DTP A;  1JLE A;  3ZSR A;  1HYZ A;  1RCH A;  4RW8 A;  2YV0 X;  3D45 A;  1BQM A;  5T7B A;  1WAF A;  1C1B A;  3LP3 A;  4MQ3 A;  4KAZ A;  3SUP A;  4W5R A;  3QNN A;  1Q8I A;  1RBU A;  4Z4I A;  4CER A;  4F2R A;  4LSL A;  4TSX A;  3DLG A;  1BI4 A;  4O4G A;  4RG8 A;  3VQ5 A;  4CJE A;  4CJF A;  3V9S A;  1D5A A;  4DQP A;  4B9M A;  4FZX C;  1Q9X A;  4OKE A;  4IDK A;  4IG0 A;  1U45 A;  4PA1 A;  4PQU A;  3ZT3 A;  1GOC A;  3A2F A;  2F8S A;  4CK3 A;  2XY8 A;  5HRS A;  1JLB A;  1KVC A;  3AVB A;  3OYG A;  1ZBH A;  1TAU A;  4E1N A;  3THV A;  3ITH A;  1RBV A;  5KTQ A;  3EZ5 A;  3L3U A;  1X9S A;  1RT5 A;  3AA2 A;  3ISN C;  3LAN A;  3KD1 E;  4EZ9 A;  4KB1 A;  4M3X A;  2DTU A;  1NKC A;  3D0P A;  3G10 A;  3S3O A;  4FLU A;  1ITG A;  1Y97 A;  4FJJ A;  4KPY A;  3M8Q A;  4CGJ A;  5JS1 A;  3U6F A;  2HB5 A;  1C0T A;  1RT7 A;  1L3T A;  4ICL A;  1C1A A;  4H4O A;  4H8K A;  3AVF A;  1ZBF A;  4DQI A;  1FK9 A;  4FLV A;  4DTO A;  2KZZ A;  3JYT A;  3ZT0 A;  1RT2 A;  4KTW A;  3PY8 A;  4KB0 A;  1LWC A;  5HRR A;  2EX3 A;  5KRS A;  3CFO A;  4AH9 A;  3TAP A;  2PYJ A;  4M3Y A;  4OGE A;  4F4K A;  1B9D A;  3OYL A;  1X9W A;  4CHQ A;  4FJN A;  2OZM A;  3HK2 A;  2VWJ A;  3RR8 A;  3LP1 A;  4DTJ A;  4PUO A;  1TVR A;  2FC0 A;  4C8N A;  5SWM A;  4W5Q A;  4FJI A;  3PX0 A;  3V9Z A;  3V6D A;  3TAG A;  1TKT A;  2FBY A;  4JS4 A;  4M42 A;  4M3T A;  4BE1 A;  3DM2 A;  5J2N A;  1QQC A;  2WOM A;  4CF9 A;  4L8R B;  4DS5 A;  2RF2 A;  2IDO A;  4HUF A;  2P1J A;  1ZYQ A;  3LPU A;  3NF8 A;  3C6T A;  3AVC A;  4I9L A;  3QES A;  1WSE A;  2NUB A;  4AHS A;  2YNH A;  2X6S A;  2Z1G A;  1HQU A;  1VK0 A;  4OLA A;  2YHA A;  5FRO A;  1EXQ A;  1LWE A;  3QEW A;  3AVK A;  3M8R A;  4LD0 A;  4DQS A;  3CQ8 A;  3AVI A;  1LV5 A;  3SUQ A;  1LW0 A;  4AHT A;  2HND A;  3V9W A;  3TAB A;  3V1Q A;  4KFB A;  3KD5 E;  1MU2 A;  1HNI A;  3HYF A;  1T03 A;  4ELT A;  1RBS A;  4FW1 A;  4NYN A;  2JLE A;  4BDP A;  1BIU A;  4KHW A;  3VN5 A;  1A5V A;  3KLI A;  3OYD A;  3I8D A;  5DK5 A;  3KK1 A;  2IS3 A;  4PWD A;  4BAC A;  4ID1 A;  1KTQ A;  4LSN A;  3AO3 A;  1EP4 A;  3OYC A;  3BDP A;  3SV4 A;  5J2M A;  3T19 A;  5DMR A;  1NJZ A;  2OPR A;  4KTQ A;  1RIL A;  1VSF A;  2G8U A;  2ZQB A;  4B08 A;  4E0D A;  1GOB A;  4CF0 A;  2GBZ A;  1SKR A;  3M8P A;  4BWJ A;  4GW6 A;  1D9F A;  3AVA A;  1T8E A;  1Q9Y A;  3SUN A;  4EZ6 A;  2RKI A;  4CJQ A;  4Y1D A;  3K58 A;  4QAG A;  1HJR A;  2XHB A;  4CJ4 A;  3L2W A;  1U49 A;  3AO4 A;  1ZBI A;  1ZBU A;  4CHN A;  4RW7 A;  5HRP A;  1EET A;  3KIO A;  3I0R A;  3NGI A;  2A1S A;  4CJK A;  4H4M A;  4DU4 A;  4IBN A;  4AHU A;  4CCH A;  2DFF A;  2HHT A;  3RR7 A;  1NJX A;  1NOZ A;  3HVT A;  1VRU A;  2P5G A;  4B9V A;  4FJX A;  2HVH A;  3ZSQ A;  1NOY A;  1ASV A;  3ZSV A;  1WAJ A;  3LAM A;  4K8Z A;  2Z1H A;  2BGG A;  1BCO A;  1BL3 A;  1WN7 A;  3CG7 A;  3VA3 A;  1VSK A;  4DFM A;  3SUO A;  1DTQ A;  4HUG A;  4CGI A;  1KLN A;  1HYV A;  4IKF A;  4DMN A;  3IAY A;  3SI6 A;  5HRO A;  3P83 D;  1ASU A;  4CJ3 A;  1C6V A;  2ETJ A;  3AVM A;  4EP5 A;  4FM2 A;  1SL1 A;  5JS2 A;  4CGG A;  2PZS A;  1QSS A;  2B5J A;  4DTS A;  1UWB A;  4JRP A;  1VSJ A;  1BCM A;  3FFI A;  2FBT A;  4KV8 A;  3L2V A;  3L8B A;  4CGH A;  1LW2 A;  4Y1C A;  1VSH A;  3OS0 A;  1NKB A;  3K2P A;  4FM0 A;  4MFB A;  4B9N A;  4M3Z A;  3OY9 A;  4RW6 A;  3HJF A;  3TAE A;  1C0M A;  4NCG A;  1BIS A;  1KFS A;  4F8R A;  1IG9 A;  5D3G A;  1CLQ A;  1S6Q A;  1R0A A;  4B9T A;  4O55 A;  4B8C A;  1CZB A;  2QXF A;  4GMJ B;  4DFJ A;  2Y1I A;  2G8K A;  2QKK A;  2OZS A;  4EP4 A;  3NBP A;  2LSN A;  3OYA A;  4FJ7 A;  4GVM A;  4E7H A;  4DFP A;  2OYQ A;  2YHB A;  2HHS A;  2KFN A;  4RW9 A;  3U3Y A;  3AV9 A;  3K5O A;  1QE1 A;  1TL1 A;  4M3R A;  4IG3 A;  1TAQ A;  1J53 A;  1N5Y A;  3NAE A;  1TKZ A;  3P5J A;  3SQ4 A;  2QKB A;  4CGF A;  4FLY A;  3PO5 A;  3ZSZ A;  3AO2 A;  3S3M A;  4I2P A;  4Z4H A;  3SPZ A;  3QEP A;  1W0H A;  3IG1 A;  1HRH A;  2P51 A;  2YKN A;  3DRS A;  1WSF A;  4N47 A;  2GUI A;  4CFA A;  1D9D A;  1RNH A;  3VQA A;  3LDS A;  4BWM A;  1SUQ A;  4PY5 A;  4R5P A;  1SKW A;  3SPY A;  1RTI A;  4E7K A;  1NK9 A;  2DY4 A;  3QEV A;  3WNE A;  2RPI A;  5EU7 A;  3TAR A;  2KFZ A;  1HPZ A;  3V81 A;  1QSY A;  3WNG A;  4DWI A;  3KK3 A;  1NK8 A;  1RDD A;  4CJR A;  4XIU A;  4J2E A;  5J1E A;  3EY1 A;  2G8I A;  3I0S A;  1BQN A;  1JL2 A;  1WSG A;  4IFY A;  5C24 A;  3DLE A;  1FKO A;  4CHO A;  5HP1 A;  1XC9 A;  1KSP A;  3RMC A;  1IKV A;  4KO0 A;  3ZCM A;  4E19 A;  3K59 A;  4E3S A;  1JLA A;  4CEB A;  3KLG A;  3RMD A;  3RMA A;  4G1Q A;  3LZI A;  2G8W A;  4W5N A;  4CHY A;  1ZBL A;  1VRT A;  2HHU A;  1JXE A;  3AVH A;  3LPT A;  4O44 A;  4ID5 A;  3DOK A;  4DQQ A;  4AIL C;  4FJL A;  4CHZ A;  1XHZ A;  2KZM A;  2QK9 A;  3VQ9 A;  3QNO A;  4RW4 A;  4J2B A;  4CES A;  5HLF A;  2HVI A;  5CZ1 A;  4OJR A;  4B3O A; 
#chains in the Genus database with same CATH topology
 2UXC K;  1I39 A;  1BGX T;  1QZ6 A;  2KHO A;  2P9I B;  4JLH A;  2ZWH A;  3TAM A;  2XRI A;  2O8C A;  3ZSY A;  5KGW A;  3CFP A;  2HHX A;  3DI6 A;  2BDP A;  4B9L A;  4FPB A;  1OVQ A;  4R79 A;  4GV9 A;  4I9Q A;  3CCL N;  4QOZ B;  2YKM A;  4UY8 O;  4DV4 K;  4CEQ A;  2D0C A;  4JKE A;  5FRM A;  4I6M B;  3SBT A;  3WEE A;  2E2P A;  1TGO A;  4BC5 A;  3CD6 N;  4N76 A;  1E4G T;  2Q31 A;  1TK8 A;  4LF5 K;  5FDL A;  1S5J A;  2ITM A;  5TKY A;  4CZI A;  1EWQ A;  1HLU A;  4M3W A;  1G15 A;  4A5A A;  3AO1 A;  5LJV A;  3DRP A;  1L5U A;  4ZTF A;  4CJ5 A;  4FZY A;  2FF3 B;  3THY A;  3ID8 A;  3RTV A;  4FJ9 A;  4CIE A;  4CI6 A;  5AQL A;  1JL1 A;  4M7X A;  1YIT N;  1RTH A;  1YAG A;  4KKO A;  3MN9 A;  1WSJ A;  4BRF A;  2E6L A;  2X6N A;  4FLT A;  3IDH A;  4FLW A;  4KI4 A;  3ZT4 A;  4QS7 A;  3LWL A;  1Q7Y O;  3O4N A;  3VEV A;  4H03 B;  3DLL L;  3ZLJ A;  1M90 O;  4I2Q A;  4BRA A;  3BZK A;  3SQ0 A;  4DG1 A;  4EIA A;  4K43 A;  3PV8 A;  2P9I A;  3AAR A;  1BUP A;  2DFH A;  5LJW A;  4C8K A;  2OTJ N;  3VA0 A;  2HHQ A;  3EEQ A;  4JHD B;  3A5N C;  4FJ8 A;  2WON A;  5AFU A;  4JRQ A;  3AA5 X;  3WNF A;  3SMS A;  3VEN A;  4DSL A;  3V1O A;  1U48 A;  5AQQ A;  5LMN K;  3OYN A;  4LH4 A;  3WXK A;  3TTD A;  1FXX A;  3R6M A;  3NF9 A;  1OH7 A;  3I56 N;  4CBU A;  4KH5 A;  1BA1 A;  2O8B B;  3CCU N;  4KRE A;  3MX2 A;  4CBW A;  4JI6 K;  5FRN A;  2D5R A;  1W9H A;  1O1W A;  3L2R A;  2E8A A;  4LF9 K;  2Q36 A;  4DSK A;  3TWH A;  1NK7 A;  1GLJ O;  3ENO A;  1HNV A;  3DRR A;  1HPM A;  1KLM A;  1L3U A;  4I7F A;  4BRL A;  2UXB K;  3CME N;  3NDK A;  2QXL A;  1QHT A;  2YNG A;  3O08 A;  3R9P A;  3M3Z A;  3ULD A;  4KHY A;  1NJW A;  3N4Q A;  4B9Q A;  5C0Y A;  4Q0B A;  4B1U B;  3MXI A;  3TSU A;  4DHY A;  4C8M A;  4NYF A;  3QB0 A;  3KK2 A;  1T7P A;  4HCC A;  3RRG A;  3WXI A;  4JHD A;  4KH6 A;  3ZSW A;  3KWG A;  2E5L K;  3TR8 A;  3VEX A;  3OYE A;  2GV9 A;  2XO7 A;  3DAW A;  3J7Z O;  2ITG A;  3RRH A;  1XI1 A;  1RTJ A;  1DGK N;  3HP9 A;  3H1Q A;  3WXL A;  1E4F T;  3CC2 N;  4RCH A;  1CXU A;  2HMI A;  1WOQ A;  4C8O A;  3O1B A;  1NJY A;  3OVN A;  3IS9 A;  1YT3 A;  4L3Q A;  2O8B A;  5AZI B;  1ZXO A;  2VQF K;  2NZT A;  1X3N A;  2A5X A;  4ILJ A;  1ZBS A;  3SCX A;  1LOT B;  1VSL A;  3O1W A;  4H0O A;  2E2N A;  4BGB A;  3QET A;  3SZ2 A;  1VSM A;  2YNI A;  4G9Z A;  2P9N A;  4NCA A;  4E7I A;  2FXU A;  1NGC A;  4LFA K;  2I7N A;  1OH8 A;  2QI2 A;  3PLA A;  4DSE A;  3SJJ A;  3A8Y A;  3O9U A;  2Y1J A;  3B6P A;  4BE0 A;  3O3G A;  4FK4 A;  4B9U A;  4B9S A;  2P9K A;  4CEF A;  3TPQ A;  2D0P A;  2YHX A;  3CM5 A;  4JKD A;  4BQL A;  3HXM A;  1P90 A;  2IVP A;  4OPJ A;  1TKD A;  1ZC6 A;  3HM9 A;  2HHH K;  3A5O C;  2KTQ A;  3TSP A;  3CPW M;  3NMU A;  1P8Z A;  3NGY A;  1RDC A;  3U9D A;  3T3F A;  1S1V A;  1BG3 A;  3NVM A;  1UOC A;  4CZH A;  2E20 A;  4RTF D;  4XH4 A;  2HBL A;  3TTC A;  3M1F A;  3VEW A;  5T7B A;  4OPA A;  5AZI A;  3SUP A;  4FWQ A;  4Z4I A;  1NBW A;  3HRG A;  4LSL A;  4CJF A;  4DQP A;  4B9M A;  1Q9X A;  4IG0 A;  4PQU A;  2HBM A;  4BRH A;  2XY8 A;  4JK7 A;  4O5F A;  1ATR A;  4IO8 A;  3OYG A;  3O6W A;  4E1N A;  3ITH A;  3AAQ A;  4CD3 A;  4EZ9 A;  3LAN A;  3ISN C;  4FLU A;  1L3T A;  2RHK A;  4ICL A;  1C1A A;  2O8D A;  4DQI A;  4M7Y A;  2QEX N;  3A0I X;  3MN5 A;  3ZT0 A;  1S22 A;  4KTW A;  4FSV A;  4NXN K;  5KRS A;  2EX3 A;  4M3Y A;  4F4K A;  1B9D A;  2O8F B;  3BF3 A;  3DWL A;  2ZJP L;  2VWJ A;  4PUO A;  3G25 A;  5SWM A;  3V6D A;  4M42 A;  4M3T A;  4BE1 A;  3DM2 A;  1QQC A;  5GIN A;  2RF2 A;  4IJN A;  4HUF A;  2P1J A;  1ZYQ A;  3NF8 A;  3C6T A;  3L0Q A;  3QES A;  1WSE A;  2NUB A;  4AHS A;  4H0X B;  2X6S A;  1VK0 A;  1HQU A;  4OLA A;  4EFH A;  4DKW A;  4DV6 K;  1NGD A;  3CQ8 A;  1LV5 A;  3SUQ A;  3J80 O;  2BH1 A;  4KFB A;  4EHT A;  1XC3 A;  1T3V A;  1LCU A;  5AQR A;  4CZJ A;  4ELT A;  2P9U B;  4KHW A;  3OYD A;  5DK5 A;  4DV0 K;  3AO3 A;  1EP4 A;  4YOY A;  3D2F B;  3BDP A;  3O4W A;  3T19 A;  2OPR A;  2G8U A;  2ZQB A;  2V52 B;  1GOB A;  4C23 A;  1SKR A;  2GEM A;  3AVA A;  1U6Z A;  1IV0 A;  4AF1 A;  3DXK A;  3K9K A;  4XH5 A;  2Q2R A;  2WUS A;  1JCE A;  2WTU A;  1NGJ A;  1YVN A;  2XHB A;  4CJ4 A;  3EKS A;  4ISG A;  5HRP A;  1EET A;  1HKB A;  3KIO A;  1Z6R A;  3I0R A;  2PAV A;  4H4M A;  4DU4 A;  1GLE G;  4IBN A;  4CCH A;  2HVH A;  5AZJ A;  3HVT A;  4FJX A;  4DQ8 A;  1NOY A;  1BL3 A;  4DFM A;  1VSK A;  4DMN A;  5EY4 A;  3P83 D;  1C6V A;  5BPL A;  3AVM A;  4WCE L;  3C0B A;  4CGG A;  2YCH A;  1QSS A;  2B5J A;  4CVN E;  2Q1N A;  2Q0R A;  1NGI A;  1C0G A;  2A6A A;  3WXM B;  1GLB G;  3OS0 A;  1S72 N;  3SAH A;  4WQ4 A;  4RW6 A;  1C0M A;  1GLF O;  1IG9 A;  3U8X A;  4O55 A;  4OX9 K;  4OPH A;  2QXF A;  1VQ9 N;  2OZS A;  3NBP A;  4FJ7 A;  4JI5 K;  4YOR A;  1NGA A;  3U3Y A;  1QE1 A;  1WBB A;  5GAE P;  1TAQ A;  1J53 A;  1TKZ A;  3SQ4 A;  4CGF A;  3ZSZ A;  1JJ2 M;  5EX5 A;  3QEP A;  5GIP A;  3LDS A;  4DR2 K;  3AGK A;  1RTI A;  5C12 A;  1K9M O;  3WNE A;  1H1V A;  3THW B;  1FW6 A;  5IT9 O;  4FWL A;  2FSK A;  3RVC A;  4CJR A;  4J2E A;  3ATU A;  4X66 K;  1O13 A;  1IKV A;  4Z94 A;  2HBJ A;  3K59 A;  4E3S A;  4CBX A;  3KLG A;  3RMD A;  3RMA A;  3LZI A;  4W5N A;  1ZBL A;  3VEY A;  4FJL A;  3WUH A;  4J8F A;  2QK9 A;  3VQ9 A;  2QTD A;  4JKB A;  3CXC M;  4IDH A;  2Z1I A;  5M1O A;  4N5S A;  3BGR A;  3OJU A;  2PY5 A;  2NRT A;  4Z4E A;  4BRP A;  4E89 A;  3CCR N;  1W97 L;  1CZ9 A;  2B6A A;  1QSL A;  2A42 A;  3CJ9 A;  4DFK A;  4U67 L;  1D8Y A;  4CFD A;  4LY7 A;  2YNF A;  1SZ2 A;  5JMV A;  5AQW A;  4KTZ A;  3MN6 A;  1HNZ K;  1L3V A;  1TUU A;  1T05 A;  4CF2 A;  1REV A;  1TUY A;  4DUY K;  5J2P A;  3D6R A;  4EAH D;  1U47 A;  3S41 A;  1WLJ A;  3SQ2 A;  3VQ7 A;  3O9T A;  3V1R A;  3FR0 A;  4YNQ A;  4CZE A;  4WQ4 C;  1Q81 O;  1V4T A;  3THW A;  2UUC K;  4DV1 K;  4CJS A;  3G4S N;  3O4Q A;  1YTA A;  4YDU C;  3HT3 A;  2ZD1 A;  4PKG A;  4BVP A;  1S3X A;  4HCB A;  3IRX A;  4FVU A;  1KCF A;  1TKX A;  2NRH A;  4K8X A;  1QVF M;  1A5X A;  5CR4 A;  4K25 A;  4GKK K;  3QBW A;  3SK3 A;  1KXP A;  3AVL A;  4J2D A;  5E41 A;  3C6H A;  4W5T A;  5AQO A;  4DV3 K;  1SV5 A;  1GOA A;  1ATN A;  1J54 A;  1IO2 A;  1TL3 A;  1YJ9 N;  2V51 B;  4FJ5 A;  3J8A A;  4CK2 A;  5E84 A;  4CEE A;  1LAW A;  2G8H A;  4JKF A;  3ZEU B;  3CM6 A;  3CJB A;  4FWN A;  3CFR A;  3DYA A;  5AR0 A;  3IFR A;  2E1Y A;  3QEX A;  3GBT A;  1L3S A;  4JI7 K;  3O5B A;  2XY7 A;  3H1V X;  5HL7 L;  1DKG D;  4OGC A;  4DLE A;  4WFB L;  4IJA A;  1NK0 A;  2NNW A;  3MED A;  1U4B A;  4CEC A;  4CFC A;  3KLH A;  4ZHR A;  1QTM A;  2B4J A;  4AHV A;  1B9F A;  1IKW A;  2X78 A;  3VQ6 A;  3ZET A;  3PIP L;  3KTQ A;  1NGG A;  4IOC L;  1IBL K;  1S1X A;  3SV3 A;  1X9M A;  1DLO A;  2GX9 A;  1GLL O;  3VQP A;  4CIF A;  5KPZ A;  3EYZ A;  1S1T A;  1VQ5 N;  4Z4F A;  4E7L A;  5AQH A;  4AHC A;  3HOT A;  5SZT A;  3J81 O;  3I8B A;  4BR4 A;  1JLF A;  5EOY A;  5BRH A;  4ELV A;  2GTD A;  3K9J A;  1RDA A;  2BAN A;  1DTT A;  4LF6 K;  3TTF A;  3WNH A;  3PX4 A;  1B92 A;  1CZA N;  4CGD A;  1NKE A;  1Z25 A;  4CF1 A;  4BVO A;  3OS1 A;  3P1G A;  2IVN A;  3WQT A;  4DTU A;  1N33 K;  3NGZ A;  3LP2 A;  3ZEU A;  5LMU K;  4BDZ A;  4FCY A;  2AJQ A;  1SQK A;  2NRR A;  5C25 A;  3NH1 A;  3S9H A;  4W5O A;  3L3V A;  4C8L A;  2UU9 K;  3V9X A;  3OYI A;  3DMJ A;  1JKH A;  3MCA B;  3T69 A;  4CJT A;  4BDY A;  1NGF A;  1Y64 A;  4CZF A;  2UUB K;  2KQ2 A;  3ZX2 A;  1IBK K;  3UKU B;  4CJU A;  1QHA A;  2P5O A;  3H08 A;  3VQE A;  1S9E A;  2KLA A;  3HP6 A;  1XHX A;  2QWM A;  1IKY A;  4E7J A;  3CER A;  4BRO A;  2JGU A;  5ELZ A;  5C42 A;  3VGL A;  1N32 K;  3FZL A;  4KHU A;  1JLC A;  4BG9 A;  3HPH A;  4CZK A;  3VQC A;  2ASP A;  3A5L C;  4IFE A;  4KHQ A;  4HTL A;  4DTN A;  3HPG A;  3SYZ A;  3E1Y A;  2VYP A;  3NHG A;  3VGM A;  3CCS N;  4Z4G A;  2D4W A;  4PHT X;  3RWU A;  3J7A P;  1SKS A;  2HW3 A;  1QQM A;  4YFU A;  1VQO N;  5KPR A;  4OPK A;  5AQJ A;  1KVB A;  3DXM B;  3DLR A;  3HSC A;  1EO1 A;  4I6M A;  3HST B;  3HPO A;  1VQP N;  3QIP A;  3B8A X;  1XWL A;  1MA9 B;  4JKC A;  3BY5 A;  2QM1 A;  4DR4 K;  1JLE A;  3ZSR A;  1HYZ A;  2W6K A;  1BQM A;  1WAF A;  3LP3 A;  4BR2 A;  1NM1 A;  4WFA L;  4W5R A;  1Q8I A;  1RBU A;  3DJC A;  4CER A;  5CE3 A;  4MO4 A;  3DLG A;  3VQ5 A;  4FZX C;  4CJE A;  2YJF A;  3MX5 A;  3H3O B;  3ZT3 A;  1GOC A;  1R59 O;  3A2F A;  4CK3 A;  1TAU A;  3UKU A;  3WQU A;  1RBV A;  3KVG A;  4M3X A;  4KB1 A;  3KD1 E;  4DR7 K;  4V19 S;  1NKC A;  1VQM N;  1KAX A;  4B1Y B;  3G10 A;  1Y97 A;  4C1N K;  5JLH A;  5JS1 A;  1C0T A;  1RT7 A;  3H6E A;  5KQ8 A;  4H4O A;  4H8K A;  4IEI A;  1FK9 A;  3U9Z A;  4FLV A;  4DTO A;  4KB0 A;  3PY8 A;  1LWC A;  4AH9 A;  5LY3 A;  3ULE B;  3BUZ B;  1NGE A;  3AAP A;  1X9W A;  3UKR B;  4Y0W A;  3HOS A;  3LP1 A;  4CJ7 A;  1TVR A;  2FC0 A;  3BF1 A;  5CHI A;  5C15 A;  3VPZ A;  4JS4 A;  5J2N A;  4DS5 A;  3CC7 N;  3UB5 A;  3LPU A;  1YJW N;  3AVC A;  3JXU A;  3KWI A;  2F9T A;  2Z1G A;  2NRV A;  3CJ7 A;  4DR6 K;  4YOV A;  5FRO A;  1MDU B;  1EXQ A;  3QEW A;  3M8R A;  3MK6 A;  4ISF A;  2OAN A;  3CCM N;  3IKM A;  3TAB A;  1HNI A;  1RBS A;  4FW1 A;  4NYN A;  3SAF A;  1BIU A;  3M5R A;  3VN5 A;  3AGR A;  3I8D A;  4PWD A;  3MCP A;  3SV4 A;  5J2M A;  1XNR K;  5AQM A;  1RIL A;  4H0Y B;  4BY9 C;  4CF0 A;  3QFU A;  3LDN A;  1FJG K;  3UE5 A;  3SJH A;  1EWR A;  1RFQ A;  3O9R A;  1HJO A;  4PKI A;  4CJQ A;  3CJ1 A;  2FSN A;  1U49 A;  1ZBI A;  1ZBU A;  4RW7 A;  2F9W A;  3FFK B;  4FO0 A;  4CJK A;  3E66 A;  4B3R K;  3ULE A;  4AHU A;  2HHT A;  3UKR A;  3RR7 A;  1NJX A;  3ZSQ A;  5FPN A;  2O8E B;  1HUX A;  3VA3 A;  5BR9 A;  3GOI A;  3CCV N;  2ZJR L;  2HST A;  2Q97 A;  1VQL N;  3OBW A;  2ETJ A;  1MWM A;  2UYT A;  2F4V K;  3I55 N;  1NMN A;  3SLC A;  4FWR A;  2FBT A;  3L2V A;  3L8B A;  1LW2 A;  1VSH A;  3EE9 A;  4LF4 K;  5AQT A;  1X9J A;  3ZX0 A;  3HJF A;  3TAE A;  4NCG A;  1BIS A;  4F8R A;  1S6Q A;  1XUP O;  4FPA A;  5FPE A;  1IJJ A;  1CZB A;  4GMJ B;  4GVM A;  4E7H A;  2HHS A;  2YHB A;  2KFN A;  2IIR A;  4BC2 A;  3AV9 A;  1W7A A;  4M3R A;  2WFB A;  3NAE A;  3P5J A;  4FLY A;  3AO2 A;  4B3M K;  4I2P A;  4Z4H A;  5FPD A;  1BOT O;  3IG1 A;  2P51 A;  1WSF A;  4CFA A;  4DR5 K;  1RNH A;  1SUQ A;  4PY5 A;  3ENB A;  3O9S A;  1KD1 O;  2E2Q A;  3QEV A;  5EU7 A;  4XH1 A;  4B1V A;  3V81 A;  4DWI A;  1NK8 A;  1RDD A;  5H1S Q;  4XIU A;  5J1E A;  3EY1 A;  1JL2 A;  5C24 A;  5I9E B;  5M1F A;  1XC9 A;  3ZCM A;  4E19 A;  4IO9 L;  2GEL A;  5AQY A;  5BRD A;  4CHY A;  3LPT A;  3VMF B;  4O44 A;  5DM7 L;  4YHH K;  2FLO A;  4RW4 A;  4J2B A;  1NU0 A;  3CI5 A;  5CZ1 A;  4OLB A;  3QO9 A;  2OPQ A;  1WNS A;  3TAF A;  4IFV A;  2BTF A;  5A2Q O;  1NLV A;  3KKR A;  3MXJ A;  3NFA A;  1GLA G;  4ISE A;  4DF4 A;  4ELU A;  5AQI A;  1S1U A;  3HVR A;  3C7N B;  1KVA A;  2ZGY A;  3CET A;  5AQS A;  4JKA A;  4K42 A;  4NB4 A;  1SL0 A;  1EKE A;  1N6Q A;  5AQG A;  4IEE A;  4MDA A;  4DLG A;  3OW2 M;  1VSD A;  3NF6 A;  5KI6 A;  5AQK A;  1U04 A;  3AO5 A;  3MMV A;  5CYM A;  4FZZ A;  1J5O A;  4Q5V A;  2P9P B;  3LM2 A;  4CFB A;  3TAN A;  3QBX A;  4FWM A;  1VSE A;  1ILY A;  5J2Q A;  4PL8 A;  1IH7 A;  1YTU A;  1SL2 A;  4DSI A;  2O8F A;  3CPE A;  4YY3 K;  1OH6 A;  3GL1 A;  2WC9 A;  2VG7 A;  3OJS A;  3BEX A;  2YHY A;  2W41 A;  4B1Z A;  1BHL A;  3VQQ A;  5F2R A;  3AVG A;  4BRM A;  1YHQ N;  4FJK A;  1LAV A;  5EVZ A;  4O0J A;  2BUP A;  1N34 K;  4CJL A;  4CJP A;  1RT1 A;  3MAQ A;  3DLH A;  4DUZ K;  1KRP A;  4JKH A;  1UA1 A;  1Q18 A;  4JI8 K;  1C0F A;  4A57 A;  2RN2 A;  2V7Y A;  4FM1 A;  3GG4 A;  3D2E B;  2IGI A;  2P9U A;  4FJM A;  3MWT A;  2IOC A;  4CF8 A;  5GIO A;  3C7N A;  1K6Y A;  4HTU A;  4DSF A;  3D2F A;  3HI0 A;  3MXM A;  4M45 A;  3SQ1 A;  2W42 A;  4ZTJ A;  4F3O A;  3FZM A;  1NK6 A;  3NF7 A;  1VSI A;  2ZM6 K;  1CXQ A;  4JS5 A;  5BN8 A;  3EL2 A;  3FZH A;  2UXD K;  3C95 A;  1M1K O;  5CZ2 A;  2JWL A;  3OYH A;  2P9P A;  4DF8 A;  3AA4 A;  2O4G A;  3HL8 A;  3QIN A;  4JK9 A;  1S9G A;  3VEO A;  3VTI A;  1YUW A;  3OBY A;  5AJ3 K;  3E9P A;  1MWK A;  1TV6 A;  1KFD A;  3ALY A;  3HZ6 A;  1IKX A;  5AQN A;  1WSH A;  4OKJ A;  3CHW A;  5I42 A;  2VG5 A;  2E6M A;  1NMD A;  2NRZ A;  3L6Q A;  3U3G A;  4JKG B;  1VQN N;  1K73 O;  3C6A A;  1HNX K;  1BIZ A;  3FZK A;  4EHU A;  3KLE A;  2BE2 A;  5AQU A;  4CEO A;  4CHP A;  4JAX A;  4UQG A;  3DLB A;  4GKJ K;  3KKS A;  4K0K K;  4CW7 B;  2Z1J A;  5BR8 K;  3M8S A;  4KBO A;  1QVG M;  4DR3 K;  4CK1 A;  3CJA A;  3LAK A;  3NH2 A;  2FBV A;  4GVE A;  1HQE A;  4B1X B;  5JVG L;  3NCI A;  5HBM A;  1UA0 A;  1RBT A;  4DS4 A;  4BRD A;  2WBN A;  3CYM A;  3L2Q A;  1QS4 A;  1BI4 B;  1JCG A;  3SNN A;  3U4L A;  4M3U A;  1J9A A;  1RT6 A;  1JLQ A;  3CQX A;  4ILH A;  2OPP A;  4BR7 A;  3F73 A;  1N8R O;  3F9K A;  4DV7 K;  2VWK A;  3TI0 A;  4CE9 A;  3ZSX A;  3DLK A;  1RBR A;  1XQS C;  3ZT2 A;  4BC4 A;  3CJC A;  1X1P A;  4O0I A;  3M6G A;  3L2U A;  3P4I A;  5CY4 A;  4LFC K;  1C1C A;  3E01 A;  4BRN A;  4BRQ A;  1JLG A;  3K5N A;  3LZJ A;  3IMX A;  3SMP A;  3A5M C;  3R8E A;  3NH0 A;  3JSM A;  2QWP A;  4IZ9 A;  4FK2 A;  4N56 A;  2EWS A;  4JK8 A;  4N41 A;  2AA4 A;  2VGN A;  4NLB A;  3MDQ A;  4MDB A;  1RGI A;  5ADX H;  4CZL A;  5AFU H;  3O80 A;  4FWK A;  4AHR A;  1HYS A;  4DU3 A;  1BWF O;  1EX4 A;  2D0A A;  4F2S A;  2P9L B;  3O3H A;  2QWN A;  4FXD A;  3PSF A;  3PUF A;  4H0V B;  4DB3 A;  4QS9 A;  4JI2 K;  3P31 A;  3C65 A;  2CGL A;  5KQD A;  1VQ8 N;  2PBD A;  2HMP A;  1RCH A;  5F1X A;  1V4S A;  4MQ3 A;  3JS6 A;  4F2R A;  3V9S A;  1BI4 A;  4RG8 A;  4H5T A;  3N4P A;  1D5A A;  4NLC A;  3WEE B;  5HRS A;  1JLB A;  2NRX A;  1VQ7 N;  3VF2 A;  1X9S A;  3L3U A;  4NCB A;  3AA2 A;  3EO3 A;  5M1K A;  3AY9 A;  2DTU A;  2CH6 A;  3D0P A;  3S3O A;  1ITG A;  4JI1 K;  4FWP A;  3VGK A;  4KPY A;  4C1N I;  2HB5 A;  4AM7 A;  3EKU A;  1NGB A;  4LFB K;  4BRI A;  2KZZ A;  5HRR A;  2PYJ A;  3QIC A;  4FJN A;  2OZM A;  3RR8 A;  3IUC A;  4DTJ A;  3GDQ A;  1QZ5 A;  3PX0 A;  3TAG A;  4LF7 K;  2FBY A;  4CF9 A;  3CMA N;  3HTV A;  3F2K A;  5MLC Q;  4I9L A;  2QWR A;  1D4X A;  4B3T K;  2P9L A;  4FWO A;  4B1W B;  2D0O A;  2YHA A;  2AP1 A;  4A2A A;  2QWQ A;  4LF8 K;  2CGK A;  4AHT A;  3MN7 A;  2ZJQ L;  3HYF A;  1T03 A;  1T44 A;  4B3S K;  4IWV A;  5AQP A;  1NWK A;  4BDP A;  3W3D A;  3KLI A;  4WF9 L;  1VQK N;  4BAC A;  4CD1 A;  4ID1 A;  4A5B A;  1KTQ A;  4LSN A;  3K0S A;  3OYC A;  3R1X A;  4BR9 A;  1VSF A;  4E0D A;  2GBZ A;  4BGA A;  3G6E N;  1SAZ A;  1T6C A;  4BWJ A;  3T1Y K;  1D9F A;  1T8E A;  3LDP A;  1KAZ A;  1Q9Y A;  1QQO A;  3SUN A;  2RKI A;  5FLX O;  4K41 A;  3K58 A;  4QAG A;  4KH4 A;  5BN9 A;  3L2W A;  3AO4 A;  2P9S B;  3O9Q A;  3P39 A;  3NGI A;  1G99 A;  3L4I A;  1NOZ A;  1VRU A;  3CCE N;  2YHW A;  3FGU A;  1ASV A;  3LAM A;  2Z1H A;  2IVO A;  3SUO A;  1DTQ A;  2DPN A;  3IAY A;  3LDQ A;  5BPN A;  2FSJ A;  3SI6 A;  5HRO A;  3QFP A;  1SL1 A;  2YX6 A;  5JS2 A;  2A40 A;  4U7B A;  3KHY A;  2PZS A;  4DTS A;  1UWB A;  1YI2 N;  1BCM A;  3CF5 L;  5M1P A;  4KV8 A;  3P38 A;  3KK7 A;  4Y1C A;  4GY2 B;  3K2P A;  4FM0 A;  4H0P A;  4GV6 A;  5ADX A;  2JWK A;  5D3G A;  4JI0 K;  1R0A A;  4B9T A;  4B8C A;  4A59 A;  5B8H A;  2QKK A;  2Y1I A;  1OH5 A;  2LSN A;  4MLH A;  3K5O A;  1TL1 A;  2VGM A;  3R3L A;  1N5Y A;  2QKB A;  2HBK A;  5F0X A;  3T1H K;  2W6L A;  1W0H A;  5AQZ A;  5EXW A;  3DRS A;  4N47 A;  5C2F A;  1D9D A;  3PIO L;  1VQ4 N;  3OHR A;  4BWM A;  3SPY A;  1NK9 A;  2DY4 A;  2KFZ A;  2RPI A;  1HX1 A;  1KAY A;  1HPZ A;  1QSY A;  1XNQ K;  4BRC A;  3KK3 A;  2P9S A;  2QWO A;  2G8I A;  1Z05 A;  2P9N B;  1BQN A;  1WSG A;  5JIC A;  4IFY A;  5HP1 A;  1KSP A;  2H3G X;  3RMC A;  1JLA A;  4G1Q A;  2G8W A;  2HHU A;  1VRT A;  2F7T A;  4DQQ A;  3DOK A;  4AIL C;  3EN9 A;  4CHZ A;  1GLC G;  2KZM A;  4BR5 A;  4CES A;  4IOA L;  2HVI A;  1VAZ A;  4B3O A;  3DXM A;  2J4R A;  4GNI A;  3ZT1 A;  2Q3S A;  4LC9 B;  2P9K B;  4LH5 A;  5KRT A;  4H0T B;  4FJH A;  3W0L A;  2VCP A;  3VOV A;  3K5M A;  1WSI A;  2PYL A;  1TK0 A;  3OYF A;  2UUA K;  4FYD A;  4JD2 B;  4BRE A;  4DSJ A;  1ASW A;  1BDG A;  3MEE A;  4FVM A;  3MEG A;  3EZW A;  1ESV A;  3VQ4 A;  1JXB A;  5GAG P;  2KW4 A;  1DEJ A;  3LWM A;  1NNE A;  5E26 A;  3VTH A;  3B6O A;  4Z0U A;  5TKW A;  4OVL A;  5AQX A;  3VEZ A;  4B8A B;  4MLE A;  1NG9 A;  1NK5 A;  3ZSO A;  5LL6 Z;  1KC8 O;  2D1K A;  4BE2 A;  5BRE A;  1FKP A;  3BP8 A;  2VQE K;  1RT4 A;  3BZC A;  4HUE A;  2OPS A;  2YJE A;  4CJV A;  3O3F A;  4CEA A;  5M1N A;  3V9U A;  2D0B A;  5M1Q A;  4GV3 A;  3FZF A;  1RT3 A;  3LDO A;  2VG6 A;  4DTX A;  3QER A;  2ASM A;  5HOO A;  1HMV A;  4X62 K;  2E1Z A;  3PX6 A;  5IWA K;  4PL7 A;  4QS8 A;  3UIQ A;  1ATS A;  1LWF A;  4FJG A;  2O8D B;  3OTO K;  1EQY A;  2G8V A;  3HO1 A;  1NK4 A;  4AQY K;  1K8A O;  2CH5 A;  4QCL A;  3S3N A;  2OA8 A;  4WE1 A;  1VHX A;  3TSQ A;  2GWK A;  3VQB A;  3QEI A;  4JI3 K;  4WQ5 A;  2HNZ A;  1NGH A;  3GE1 A;  4JD2 A;  3NVK A;  2YI1 A;  2G8F A;  2FBX A;  3C6U A;  3T7Z A;  4HVJ A;  3RMB A;  4IXC A;  4HHT A;  4KRF A;  4Z4C A;  5I3U A;  1E3M A;  3G0Z A;  4NXM K;  1BU6 O;  4JEP A;  1TK5 A;  1F21 A;  3ID6 A;  4X65 K;  4CEZ A;  3AVJ A;  3H46 O;  4FK0 A;  3THX B;  4FW2 A;  3MEC A;  3LAL A;  4DTR A;  1A5W A;  2ATQ A;  2Q0U A;  5K14 A;  3TU5 A;  2X74 A;  2OTL N;  4E1J A;  2KKZ A;  2HHV A;  2IC3 A;  3VQD A;  1HR0 K;  2O4I A;  2E2O A;  4H5W A;  1YVU A;  3Q7C A;  2HNY A;  5AQF A;  4X64 K;  3OYM A;  3DOL A;  3KJV A;  3VES A;  2O8E A;  3DXK B;  4WYB A;  5CYQ A;  4FLX A;  2I5J A;  1DT9 A;  3K5L A;  2VWB A;  5FPM A;  3VQ8 A;  1S1W A;  3HBT A;  1I3A A;  5AZJ B;  3TAQ A;  4J2A A;  4CED A;  4CZM A;  5HRN A;  3FLC O;  3CC4 N;  4BG8 A;  2HHW A;  3VER A;  3SBG A;  2ZE2 A;  3OYK A;  4A2B A;  1YF5 L;  4A61 A;  1OKJ A;  3KLF A;  1YJN N;  4CIG A;  4E1M A;  3MWP A;  4KHN A;  2E4L A;  2ASO A;  4YOW A;  3OS2 A;  3OYJ A;  4DU1 A;  4YOU A;  4YOT A;  3VET A;  2F96 A;  4DV5 K;  4H5N A;  3K57 A;  1BO5 O;  4PKH A;  2HOE A;  4OKK A;  2DFE A;  3THX A;  3QLH A;  3T1A A;  3ASM A;  3WT0 A;  3PO4 A;  2R7Y A;  4BR0 A;  3HM8 A;  3C94 A;  4ILG B;  5KGX A;  4DCH A;  5JVH L;  4WQ5 C;  2RE2 A;  2IAJ A;  3ZYY X;  1RDB A;  3OYB A;  3LP0 A;  2A1R A;  4YOX A;  4KI6 A;  1YXQ A;  5GAH P;  2XY5 A;  1Z26 A;  5KPT A;  2EHG A;  4JI4 K;  4F3T A;  2PFU A;  2HF4 A;  3QIO A;  4FOE A;  3JAM O;  1HKG A;  1C0U A;  3ATV A;  3V4I A;  3AVN A;  4JN4 A;  4FLZ A;  2A3Z A;  4O5B A;  1S6P A;  1HNW K;  1W2B M;  3H3N O;  4DTM A;  4M41 A;  3NE6 A;  4DQR A;  1WUA A;  3D7E O;  4KHS A;  3FE1 A;  2XY6 A;  1K8K B;  1T6D A;  4FOI A;  1UAX A;  4XEI A;  2GWJ A;  2F8T A;  1RTD A;  3AA3 A;  1VQ6 N;  4CJW A;  4DTP A;  4O8K A;  1U2V B;  4RW8 A;  2YV0 X;  3D45 A;  1C1B A;  2W40 A;  4KAZ A;  3QNN A;  4FWS A;  4TSX A;  2FF6 A;  2NRW A;  4O4G A;  1NJI O;  5BPM A;  5BRF A;  2ZF5 O;  4OKE A;  4IDK A;  1U45 A;  4PA1 A;  3WXJ A;  5GAD P;  4YDU A;  1IBM K;  2F8S A;  3QML A;  1KVC A;  3AVB A;  4AM6 A;  1Q86 O;  1ZBH A;  3THV A;  4BRK A;  4BQZ A;  5KTQ A;  3EZ5 A;  1X3M A;  1RT5 A;  4OO1 J;  4FL9 A;  4FJJ A;  3LM9 A;  3VF4 A;  1BA0 A;  3M8Q A;  4CGJ A;  1RDW X;  3U6F A;  2HF3 A;  1WBD A;  3AVF A;  1ZBF A;  4IOX A;  3JYT A;  1RT2 A;  4BC3 A;  4F9O A;  3CFO A;  3TAP A;  4OGE A;  3OYL A;  4CHQ A;  3HK2 A;  3ZX3 A;  1TYQ B;  4C8N A;  4W5Q A;  4FJI A;  3V9Z A;  1TKT A;  1Q82 O;  2WOM A;  4L8R B;  2IDO A;  4NO7 A;  3D2E A;  3L4Q A;  1K8K A;  3EE8 A;  2YNH A;  3LDL A;  3Q7B A;  4WFN L;  1LWE A;  3AVK A;  4LD0 A;  2QA4 N;  4DQS A;  3SAG A;  3AVI A;  5C10 A;  1U2V A;  1LW0 A;  3V9W A;  2HND A;  5JLF A;  3V1Q A;  3KZB A;  4MO5 A;  1XMO K;  3KD5 E;  1MU2 A;  3VF6 A;  1QQN A;  4JV5 K;  2OCE A;  2JLE A;  1A5V A;  1YIJ N;  2NLX A;  3KK1 A;  2IS3 A;  3E9O A;  4RWT A;  5C2D A;  3F9M A;  3H45 C;  5DMR A;  1HKC A;  4JNE A;  1NJZ A;  4KTQ A;  4B08 A;  2E88 A;  1J5E K;  3M8P A;  4GW6 A;  1WB9 A;  2QWL A;  4CZG A;  4EZ6 A;  3CCQ N;  4H5V A;  4Y1D A;  1HJR A;  4A62 A;  4CHN A;  3CIP A;  5AQV A;  2A1S A;  3I33 A;  3ENH A;  2DFF A;  4JKG A;  4B9V A;  2P5G A;  3ZET B;  3CQY A;  3ZSV A;  1WAJ A;  4K8Z A;  3RSE B;  2BGG A;  1BCO A;  1TYQ A;  1WN7 A;  3CG7 A;  2QW9 A;  4HUG A;  3PSI A;  4CGI A;  1HYV A;  1KLN A;  4IKF A;  3J7Y P;  3OA9 A;  4BRG A;  1ASU A;  4CJ3 A;  4FM2 A;  4EP5 A;  1RDU A;  1KQS M;  4KHP K;  2CGJ A;  4JRP A;  1VSJ A;  3F5T A;  3FFI A;  2O8C B;  1XMQ K;  4CGH A;  2I7P A;  1NKB A;  4B9N A;  1J6Z A;  4MFB A;  4JYA K;  4M3Z A;  3OY9 A;  1KFS A;  1I94 K;  1CLQ A;  3QDK A;  4DFJ A;  2G8K A;  4EP4 A;  3OYA A;  5DM6 L;  4DFP A;  2OYQ A;  1GLD G;  4RW9 A;  4IG3 A;  3PO5 A;  2GUP A;  3S3M A;  3SPZ A;  2ZGZ A;  3LL3 A;  1HRH A;  2YKN A;  1N36 K;  2GUI A;  4DV2 K;  3VQA A;  1SS6 A;  4R5P A;  3CCJ N;  1SKW A;  4E7K A;  3G71 N;  2A41 A;  3THY B;  3TAR A;  3WNG A;  1IG8 A;  3I0S A;  3DLE A;  1FKO A;  4CHO A;  4O8U A;  4KO0 A;  4DR1 K;  4CEB A;  3RSE A;  1JXE A;  3AVH A;  4H5R A;  4ID5 A;  4M63 C;  3O8M A;  1XHZ A;  1OVY A;  3QNO A;  2V7Z A;  3E9L A;  1JCF A;  4HWI A;  5HLF A;  4OJR A; 
#chains in the Genus database with same CATH homology
 3QO9 A;  4Z4E A;  1I39 A;  3ZT1 A;  2Q3S A;  2Z1I A;  1BGX T;  4LH5 A;  4N5S A;  5KRT A;  3BGR A;  3OJU A;  4FJH A;  2OPQ A;  2PY5 A;  4JLH A;  3TAM A;  2XRI A;  1WNS A;  3ZSY A;  4IFV A;  4E89 A;  1CZ9 A;  3TAF A;  3K5M A;  5KGW A;  1WSI A;  3CFP A;  2HHX A;  2PYL A;  1TK0 A;  2B6A A;  3DI6 A;  3KKR A;  3OYF A;  3MXJ A;  3NFA A;  4DF4 A;  1QSL A;  2BDP A;  4B9L A;  4FYD A;  4ELU A;  4DSJ A;  4I9Q A;  4QOZ B;  4DFK A;  1ASW A;  2YKM A;  3MEE A;  4FVM A;  1S1U A;  4CEQ A;  2D0C A;  3HVR A;  3MEG A;  4OLB A;  5FRM A;  1KVA A;  3VQ4 A;  1D8Y A;  4CFD A;  1JXB A;  2YNF A;  4LY7 A;  1TGO A;  1SL0 A;  4N76 A;  2KW4 A;  4KTZ A;  3LWM A;  3B6O A;  1EKE A;  1TK8 A;  4Z0U A;  1L3V A;  1N6Q A;  5FDL A;  1T05 A;  4CF2 A;  4OVL A;  4B8A B;  1REV A;  4DLG A;  1NK5 A;  3ZSO A;  5J2P A;  1VSD A;  1S5J A;  3NF6 A;  5KI6 A;  4BE2 A;  1FKP A;  1U04 A;  1RT4 A;  1U47 A;  3AO5 A;  5CYM A;  4FZZ A;  4M3W A;  1J5O A;  4HUE A;  4Q5V A;  1G15 A;  1WLJ A;  3AO1 A;  3SQ2 A;  2OPS A;  4CFB A;  3VQ7 A;  3TAN A;  3DRP A;  4CJV A;  4YNQ A;  3V1R A;  1VSE A;  4CJ5 A;  4ZTF A;  3O3F A;  5J2Q A;  1L5U A;  4FZY A;  4CEA A;  3RTV A;  3V9U A;  4FJ9 A;  2D0B A;  1IH7 A;  4CIE A;  1YTU A;  1SL2 A;  1JL1 A;  1RT3 A;  2VG6 A;  4DTX A;  3QER A;  4CJS A;  1RTH A;  4KKO A;  4DSI A;  3O4Q A;  1WSJ A;  1HMV A;  1YTA A;  2E6L A;  2X6N A;  3HT3 A;  4FLT A;  4FLW A;  2ZD1 A;  4KI4 A;  2VG7 A;  3ZT4 A;  3OJS A;  3PX6 A;  3LWL A;  3O4N A;  3IRX A;  3UIQ A;  4HCB A;  4FJG A;  1KCF A;  1LWF A;  1TKX A;  1BHL A;  4I2Q A;  4K8X A;  3VQQ A;  1A5X A;  3SQ0 A;  3AVG A;  2G8V A;  4FJK A;  1LAV A;  3HO1 A;  4DG1 A;  1NK4 A;  4O0J A;  4CJL A;  3AVL A;  4J2D A;  4CJP A;  1RT1 A;  3MAQ A;  3PV8 A;  5E41 A;  4QCL A;  3S3N A;  3DLH A;  1KRP A;  2OA8 A;  4WE1 A;  2DFH A;  4W5T A;  1UA1 A;  4C8K A;  1SV5 A;  3VA0 A;  2HHQ A;  3VQB A;  1GOA A;  3QEI A;  1J54 A;  1IO2 A;  1TL3 A;  2HNZ A;  2RN2 A;  4FM1 A;  2WON A;  4FJ8 A;  4JRQ A;  3AA5 X;  3WNF A;  4FJ5 A;  4DSL A;  2IGI A;  2G8F A;  3V1O A;  2FBX A;  1U48 A;  3C6U A;  4FJM A;  4CK2 A;  4HVJ A;  3RMB A;  4CEE A;  4HHT A;  3OYN A;  1LAW A;  4LH4 A;  4KRF A;  1FXX A;  2IOC A;  4CF8 A;  4Z4C A;  4HTU A;  1K6Y A;  5I3U A;  4DSF A;  2G8H A;  3G0Z A;  3CM6 A;  3NF9 A;  3MXM A;  4M45 A;  3SQ1 A;  2W42 A;  4ZTJ A;  3CFR A;  4F3O A;  1TK5 A;  1F21 A;  3DYA A;  1NK6 A;  3NF7 A;  1VSI A;  4KRE A;  4CEZ A;  3QEX A;  1CXQ A;  3AVJ A;  4FK0 A;  4FW2 A;  1L3S A;  4JS5 A;  5FRN A;  3MEC A;  3LAL A;  2D5R A;  4DTR A;  2XY7 A;  1A5W A;  2ATQ A;  3C95 A;  1W9H A;  1O1W A;  5CZ2 A;  5K14 A;  3OYH A;  3L2R A;  4DSK A;  2X74 A;  4DF8 A;  4OGC A;  3TWH A;  4DLE A;  3AA4 A;  2O4G A;  1NK7 A;  3HL8 A;  1NK0 A;  3MED A;  3QIN A;  2HHV A;  2IC3 A;  3VQD A;  4CEC A;  1U4B A;  4CFC A;  1HNV A;  3DRR A;  3KLH A;  1KLM A;  4ZHR A;  1S9G A;  1QTM A;  2B4J A;  2O4I A;  1L3U A;  4I7F A;  1B9F A;  4AHV A;  1YVU A;  2HNY A;  3OYM A;  1IKW A;  2X78 A;  1TV6 A;  3NDK A;  1KFD A;  3DOL A;  3VQ6 A;  3KJV A;  1QHT A;  2YNG A;  3ALY A;  3KTQ A;  3ULD A;  1S1X A;  3SV3 A;  1X9M A;  4NCB A;  1IKX A;  1DLO A;  1WSH A;  4OKJ A;  5CYQ A;  1NJW A;  4KHY A;  4CIF A;  3VQP A;  3EYZ A;  4FLX A;  1S1T A;  2I5J A;  5I42 A;  4Z4F A;  4E7L A;  2VG5 A;  4AHC A;  5SZT A;  4Q0B A;  3MXI A;  2E6M A;  3K5L A;  1JLF A;  3VQ8 A;  1S1W A;  4ELV A;  3U3G A;  1I3A A;  1RDA A;  4C8M A;  2BAN A;  3TAQ A;  4CED A;  1DTT A;  4J2A A;  5HRN A;  4NYF A;  3KK2 A;  1BIZ A;  1T7P A;  4HCC A;  3RRG A;  3WNH A;  3PX4 A;  3KLE A;  2HHW A;  1B92 A;  3ZSW A;  4CGD A;  2BE2 A;  2ZE2 A;  3OYK A;  1NKE A;  3TR8 A;  4CEO A;  4CHP A;  4UQG A;  3DLB A;  1Z25 A;  3KKS A;  3OYE A;  2GV9 A;  4CIG A;  3KLF A;  4E1M A;  2XO7 A;  4CF1 A;  4KHN A;  2ITG A;  2E4L A;  3OS1 A;  3RRH A;  1XI1 A;  3P1G A;  2Z1J A;  1RTJ A;  3HP9 A;  3M8S A;  3NGZ A;  3OS2 A;  3OYJ A;  4DU1 A;  4DTU A;  3LP2 A;  4CK1 A;  3LAK A;  3NH2 A;  1CXU A;  2HMI A;  2FBV A;  4C8O A;  1HQE A;  4BDZ A;  4FCY A;  1NJY A;  2AJQ A;  3OVN A;  3NCI A;  5HBM A;  3IS9 A;  1RBT A;  1YT3 A;  4DS4 A;  1UA0 A;  2F96 A;  5C25 A;  3CYM A;  3NH1 A;  3L2Q A;  4OKK A;  1QS4 A;  4W5O A;  3L3V A;  3K57 A;  3S9H A;  1BI4 B;  2DFE A;  4C8L A;  3QLH A;  3SNN A;  3T1A A;  3V9X A;  3ASM A;  3OYI A;  3DMJ A;  3PO4 A;  2R7Y A;  4M3U A;  1J9A A;  3SCX A;  1JKH A;  1VSL A;  3C94 A;  4CJT A;  4BDY A;  5KGX A;  1RT6 A;  2KQ2 A;  3QET A;  1JLQ A;  2IAJ A;  3SZ2 A;  2OPP A;  1RDB A;  4CJU A;  1VSM A;  2YNI A;  3OYB A;  3LP0 A;  3F73 A;  2A1R A;  3F9K A;  3H08 A;  2P5O A;  3VQE A;  1S9E A;  4NCA A;  4KI6 A;  4E7I A;  2VWK A;  3HP6 A;  1XHX A;  2XY5 A;  3TI0 A;  1IKY A;  3ZSX A;  4CE9 A;  1Z26 A;  4E7J A;  3DLK A;  1RBR A;  2JGU A;  2EHG A;  5C42 A;  4F3T A;  3ZT2 A;  4DSE A;  1X1P A;  3QIO A;  4O0I A;  3SJJ A;  4KHU A;  1JLC A;  3HPH A;  3L2U A;  3VQC A;  5CY4 A;  1C0U A;  1C1C A;  3V4I A;  3AVN A;  3E01 A;  4FLZ A;  2Y1J A;  3B6P A;  1JLG A;  4BE0 A;  3K5N A;  3O3G A;  4FK4 A;  4B9U A;  4B9S A;  4KHQ A;  4O5B A;  1S6P A;  3HPG A;  4CEF A;  4DTN A;  3LZJ A;  3SYZ A;  3NH0 A;  3NHG A;  3JSM A;  4DTM A;  3CM5 A;  4FK2 A;  4Z4G A;  4N56 A;  4M41 A;  1TKD A;  3HXM A;  3NE6 A;  4DQR A;  4OPJ A;  4N41 A;  3HM9 A;  3RWU A;  1SKS A;  2HW3 A;  2KTQ A;  4KHS A;  3NGY A;  4YFU A;  4AHR A;  1RDC A;  1HYS A;  4OPK A;  1KVB A;  4DU3 A;  1EX4 A;  2XY6 A;  2D0A A;  4F2S A;  3T3F A;  3DLR A;  1S1V A;  3O3H A;  3HST B;  1UAX A;  1UOC A;  3HPO A;  3QIP A;  1RTD A;  3AA3 A;  3PUF A;  1XWL A;  2F8T A;  4FXD A;  4CJW A;  4DTP A;  1JLE A;  3ZSR A;  1HYZ A;  1RCH A;  4RW8 A;  2YV0 X;  3D45 A;  1BQM A;  5T7B A;  1WAF A;  1C1B A;  3LP3 A;  4MQ3 A;  4KAZ A;  3SUP A;  4W5R A;  3QNN A;  1Q8I A;  1RBU A;  4Z4I A;  4CER A;  4F2R A;  4LSL A;  4TSX A;  3DLG A;  1BI4 A;  4O4G A;  4RG8 A;  3VQ5 A;  4CJE A;  4CJF A;  3V9S A;  1D5A A;  4DQP A;  4B9M A;  4FZX C;  1Q9X A;  4OKE A;  4IDK A;  4IG0 A;  1U45 A;  4PA1 A;  4PQU A;  3ZT3 A;  1GOC A;  3A2F A;  2F8S A;  4CK3 A;  2XY8 A;  5HRS A;  1JLB A;  1KVC A;  3AVB A;  3OYG A;  1ZBH A;  1TAU A;  4E1N A;  3THV A;  3ITH A;  1RBV A;  5KTQ A;  3EZ5 A;  3L3U A;  1X9S A;  1RT5 A;  3AA2 A;  3ISN C;  3LAN A;  3KD1 E;  4EZ9 A;  4KB1 A;  4M3X A;  2DTU A;  1NKC A;  3D0P A;  3G10 A;  3S3O A;  4FLU A;  1ITG A;  1Y97 A;  4FJJ A;  4KPY A;  3M8Q A;  4CGJ A;  5JS1 A;  3U6F A;  2HB5 A;  1C0T A;  1RT7 A;  1L3T A;  4ICL A;  1C1A A;  4H4O A;  4H8K A;  3AVF A;  1ZBF A;  4DQI A;  1FK9 A;  4FLV A;  4DTO A;  2KZZ A;  3JYT A;  3ZT0 A;  1RT2 A;  4KTW A;  3PY8 A;  4KB0 A;  1LWC A;  5HRR A;  2EX3 A;  5KRS A;  3CFO A;  4AH9 A;  3TAP A;  2PYJ A;  4M3Y A;  4OGE A;  4F4K A;  1B9D A;  3OYL A;  1X9W A;  4CHQ A;  4FJN A;  2OZM A;  3HK2 A;  2VWJ A;  3RR8 A;  3LP1 A;  4DTJ A;  4PUO A;  1TVR A;  2FC0 A;  4C8N A;  5SWM A;  4W5Q A;  4FJI A;  3PX0 A;  3V9Z A;  3V6D A;  3TAG A;  1TKT A;  2FBY A;  4JS4 A;  4M42 A;  4M3T A;  4BE1 A;  3DM2 A;  5J2N A;  1QQC A;  2WOM A;  4CF9 A;  4L8R B;  4DS5 A;  2RF2 A;  2IDO A;  4HUF A;  2P1J A;  1ZYQ A;  3LPU A;  3NF8 A;  3C6T A;  3AVC A;  4I9L A;  3QES A;  1WSE A;  2NUB A;  4AHS A;  2YNH A;  2X6S A;  2Z1G A;  1HQU A;  1VK0 A;  4OLA A;  2YHA A;  5FRO A;  1EXQ A;  1LWE A;  3QEW A;  3AVK A;  3M8R A;  4LD0 A;  4DQS A;  3CQ8 A;  3AVI A;  1LV5 A;  3SUQ A;  1LW0 A;  4AHT A;  2HND A;  3V9W A;  3TAB A;  3V1Q A;  4KFB A;  3KD5 E;  1MU2 A;  1HNI A;  3HYF A;  1T03 A;  4ELT A;  1RBS A;  4FW1 A;  4NYN A;  2JLE A;  4BDP A;  1BIU A;  4KHW A;  3VN5 A;  1A5V A;  3KLI A;  3OYD A;  3I8D A;  5DK5 A;  3KK1 A;  2IS3 A;  4PWD A;  4BAC A;  4ID1 A;  1KTQ A;  4LSN A;  3AO3 A;  1EP4 A;  3OYC A;  3BDP A;  3SV4 A;  5J2M A;  3T19 A;  5DMR A;  1NJZ A;  2OPR A;  4KTQ A;  1RIL A;  1VSF A;  2G8U A;  2ZQB A;  4B08 A;  4E0D A;  1GOB A;  4CF0 A;  2GBZ A;  1SKR A;  3M8P A;  4BWJ A;  4GW6 A;  1D9F A;  3AVA A;  1T8E A;  1Q9Y A;  3SUN A;  4EZ6 A;  2RKI A;  4CJQ A;  4Y1D A;  3K58 A;  4QAG A;  1HJR A;  2XHB A;  4CJ4 A;  3L2W A;  1U49 A;  3AO4 A;  1ZBI A;  1ZBU A;  4CHN A;  4RW7 A;  5HRP A;  1EET A;  3KIO A;  3I0R A;  3NGI A;  2A1S A;  4CJK A;  4H4M A;  4DU4 A;  4IBN A;  4AHU A;  4CCH A;  2DFF A;  2HHT A;  3RR7 A;  1NJX A;  1NOZ A;  3HVT A;  1VRU A;  2P5G A;  4B9V A;  4FJX A;  2HVH A;  3ZSQ A;  1NOY A;  1ASV A;  3ZSV A;  1WAJ A;  3LAM A;  4K8Z A;  2Z1H A;  2BGG A;  1BCO A;  1BL3 A;  1WN7 A;  3CG7 A;  3VA3 A;  1VSK A;  4DFM A;  3SUO A;  1DTQ A;  4HUG A;  4CGI A;  1KLN A;  1HYV A;  4IKF A;  4DMN A;  3IAY A;  3SI6 A;  5HRO A;  3P83 D;  1ASU A;  4CJ3 A;  1C6V A;  2ETJ A;  3AVM A;  4EP5 A;  4FM2 A;  1SL1 A;  5JS2 A;  4CGG A;  2PZS A;  1QSS A;  2B5J A;  4DTS A;  1UWB A;  4JRP A;  1VSJ A;  1BCM A;  3FFI A;  2FBT A;  4KV8 A;  3L2V A;  3L8B A;  4CGH A;  1LW2 A;  4Y1C A;  1VSH A;  3OS0 A;  1NKB A;  3K2P A;  4FM0 A;  4MFB A;  4B9N A;  4M3Z A;  3OY9 A;  4RW6 A;  3HJF A;  3TAE A;  1C0M A;  4NCG A;  1BIS A;  1KFS A;  4F8R A;  1IG9 A;  5D3G A;  1CLQ A;  1S6Q A;  1R0A A;  4B9T A;  4O55 A;  4B8C A;  1CZB A;  2QXF A;  4GMJ B;  4DFJ A;  2Y1I A;  2G8K A;  2QKK A;  2OZS A;  4EP4 A;  3NBP A;  2LSN A;  3OYA A;  4FJ7 A;  4GVM A;  4E7H A;  4DFP A;  2OYQ A;  2YHB A;  2HHS A;  2KFN A;  4RW9 A;  3U3Y A;  3AV9 A;  3K5O A;  1QE1 A;  1TL1 A;  4M3R A;  4IG3 A;  1TAQ A;  1J53 A;  1N5Y A;  3NAE A;  1TKZ A;  3P5J A;  3SQ4 A;  2QKB A;  4CGF A;  4FLY A;  3PO5 A;  3ZSZ A;  3AO2 A;  3S3M A;  4I2P A;  4Z4H A;  3SPZ A;  3QEP A;  1W0H A;  3IG1 A;  1HRH A;  2P51 A;  2YKN A;  3DRS A;  1WSF A;  4N47 A;  2GUI A;  4CFA A;  1D9D A;  1RNH A;  3VQA A;  3LDS A;  4BWM A;  1SUQ A;  4PY5 A;  4R5P A;  1SKW A;  3SPY A;  1RTI A;  4E7K A;  1NK9 A;  2DY4 A;  3QEV A;  3WNE A;  2RPI A;  5EU7 A;  3TAR A;  2KFZ A;  1HPZ A;  3V81 A;  1QSY A;  3WNG A;  4DWI A;  3KK3 A;  1NK8 A;  1RDD A;  4CJR A;  4XIU A;  4J2E A;  5J1E A;  3EY1 A;  2G8I A;  3I0S A;  1BQN A;  1JL2 A;  1WSG A;  4IFY A;  5C24 A;  3DLE A;  1FKO A;  4CHO A;  5HP1 A;  1XC9 A;  1KSP A;  3RMC A;  1IKV A;  4KO0 A;  3ZCM A;  4E19 A;  3K59 A;  4E3S A;  1JLA A;  4CEB A;  3KLG A;  3RMD A;  3RMA A;  4G1Q A;  3LZI A;  2G8W A;  4W5N A;  4CHY A;  1ZBL A;  1VRT A;  2HHU A;  1JXE A;  3AVH A;  3LPT A;  4O44 A;  4ID5 A;  3DOK A;  4DQQ A;  4AIL C;  4FJL A;  4CHZ A;  1XHZ A;  2KZM A;  2QK9 A;  3VQ9 A;  3QNO A;  4RW4 A;  4J2B A;  4CES A;  5HLF A;  2HVI A;  5CZ1 A;  4OJR A;  4B3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...