4AHUA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
155
structure length
153
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahuA00
1J9AA 4DMNA 4BWMA 4B08A 4W5QA 1JLGA 2E6MA 4KHYA 4BACA 4FCYA 4E7HA 4ID1A 4BDZA 1BI4A 3O3HA 1SL1A 4EZ9A 2IDOA 3F73A 1Z26A 3LP0A 3PUFA 4DLEA 3BDPA 1GOBA 3SUOA 3O4QA 3ZSWA 2X6NA 4NYNA 1RT3A 3DLEA 4Z4CA 3HVTA 3ZT1A 4PY5A 1Q9XA 3QIPA 3HSTB 4KI6A 4Z4FA 3NDKA 3KK1A 4IFYA 1QS4A 3KKRA 1L3TA 4F3TA 3C6UA 3L3UA 2O4IA 4CJWA 1SV5A 2OPPA 3TR8A 1BGXT 1CXQA 4HVJA 1WSGA 3NH2A 4DF8A 3RWUA 1B9FA 4H4MA 3FFIA 1S1XA 4OKJA 3QEVA 4DWIA 3QESA 4CEZA 3MEEA 2Y1JA 4TSXA 4PUOA 4E89A 3SPZA 4N41A 1JLEA 4HUEA 2XY7A 4JRQA 3KLHA 3D0PA 2IC3A 3NFAA 1NK6A 1NKEA 3V1OA 3AO5A 3NH1A 1R0AA 3VQQA 4HCBA 4M3WA 4IG0A 3OYAA 4FW2A 2QXFA 1BIZA 3MEGA 4CIEA 4E19A 2QKKA 4B9MA 4B9LA 4KHWA 1HYSA 3KLFA 4CEEA 4W5OA 3S3MA 1HRHA 4O55A 3ZT3A 1JLFA 3AO2A 3V9ZA 3UIQA 1QQCA 1WLJA 2HHQA 4FM1A 4F8RA 3ZT0A 4RG8A 2WONA 3SYZA 5SZTA 4EZ6A 2FC0A 3M8PA 5CYMA 4F2RA 1A5XA 3HPHA 4DSIA 3NGYA 1L5UA 3DRSA 3VQ4A 1TAQA 4GVMA 4PA1A 4ZTFA 3QEIA 2HB5A 3B6OA 4N56A 1SKWA 3NGIA 3MXMA 4CF9A 4DF4A 1FK9A 1S1TA 1U48A 3DLBA 4WE1A 3V4IA 1NK8A 5CY4A 1QE1A 3RMDA 3AVCA 2HNYA 4C8KA 4JLHA 4E7LA 3HJFA 2GUIA 4DTNA 2G8HA 2OPQA 4IFVA 2ETJA 1BI4B 4LH4A 1WSIA 3V9UA 1D9DA 5HRSA 1GOCA 3NE6A 4DSJA 4FW1A 3HL8A 4FJ7A 2RPIA 5CZ2A 3ZSRA 4DG1A 3DLKA 4RW7A 4CERA 3V9SA 2OZSA 4I9QA 4KRFA 1T8EA 2YNGA 1JLQA 4ELUA 1XHZA 3ZSOA 5E41A 4FZXC 4QOZB 4AHUA 4IDKA 3NHGA 1L3UA 4EP4A 3NAEA 2VG7A 2HHUA 4CJLA 3KD1E 3DLGA 2YKMA 3HYFA 4CGGA 1RTIA 3TAFA 3P1GA 3OYJA 1X9SA 1SUQA 2HHXA 3QEWA 4FVMA 1LAVA 3TI0A 1ASVA 5HRPA 3KLEA 4Z0UA 1J5OA 5HLFA 2D0BA 2OYQA 3IRXA 3M8QA 4CJ5A 4CJUA 4CK1A 3CQ8A 4BE1A 4DTMA 2WOMA 2BGGA 1ZBUA 4EP5A 2OPSA 4NCAA 4Z4HA 3K59A 4JS4A 1TV6A 2HHWA 1XI1A 1IKXA 4KTZA 4FJIA 1RT2A 2GV9A 2XHBA 4OVLA 1UWBA 4J2DA 1CZ9A 1WNSA 3KD5E 3T19A 2G8IA 3NH0A 2Y1IA 3S9HA 4M3TA 4FJNA 1U49A 1Z25A 4CEFA 4BE2A 4L8RB 4RW9A 1ZBIA 4CEOA 3V1RA 4CF2A 4ID5A 2YV0X 1IG9A 1FKPA 3SQ0A 4CGDA 3NF7A 4DFJA 3VA3A 1RBRA 4KB0A 1S6PA 1SL2A 4DU4A 3QINA 3LP1A 4M41A 5J2PA 4LD0A 1NJYA 3AO3A 3AVFA 3AVBA 4I2PA 4DU3A 4FJLA 2FBYA 4CECA 1X9MA 4B3OA 4CJPA 1I3AA 1EP4A 3ZT2A 4CJ4A 3I0RA 1BIUA 3AVKA 3P5JA 5EU7A 3TAQA 1U4BA 4GW6A 1IKWA 1RBTA 2P1JA 3SCXA 1U45A 2G8KA 1N5YA 1BISA 1RILA 5KI6A 4E1MA 2D0CA 3OYHA 3NF9A 3VQAA 1YT3A 2ZQBA 3AA4A 4BDYA 1J53A 4JRPA 1XC9A 2G8FA 4E0DA 1LWFA 3VQ6A 3OYFA 1W0HA 5K14A 3AO1A 4OKKA 2FBTA 3NBPA 4NCGA 3TARA 2HVIA 3DRRA 4E7IA 3DRPA 3P83D 3TAPA 4CEQA 3LWLA 3THVA 3IAYA 2KZMA 3KK3A 2FBVA 3K5MA 1EX4A 4J2AA 4FJXA 1LW0A 3SUNA 4B9TA 3NGZA 4JS5A 4ICLA 1JLAA 4FLTA 4CHNA 3V1QA 1NJZA 4ZTJA 3RR7A 4BDPA 3AVNA 3IG1A 2BDPA 4N47A 3HM9A 3V9XA 1HPZA 2B4JA 4OPJA 3SQ2A 1C6VA 3VQEA 3RTVA 1KFSA 1LWCA 3LAKA 1WSJA 3LP2A 3ZSYA 4Y1DA 4CHYA 4GMJB 5T7BA 1Q9YA 4Z4IA 1DTTA 4E7JA 3L2QA 1L3VA 4CJTA 1QSYA 1LWEA 4CGJA 4CJFA 1U04A 4FLVA 1EETA 4O44A 4CF0A 4DFMA 1TK0A 2OA8A 4FZYA 3E01A 1IKYA 2YNIA 3OJUA 2P5GA 1HMVA 1Y97A 4I2QA 3WNFA 2DFHA 4DTJA 4F3OA 1NKBA 4J2BA 1KVAA 2KFNA 2B5JA 1A5WA 3DLRA 4DFKA 1N6QA 4MQ3A 4ZHRA 3DMJA 2DY4A 1JL1A 4I9LA 2IS3A 2PYJA 2XY6A 1TVRA 4B9SA 3OJSA 1C0UA 4KV8A 4LH5A 4RW8A 4E1NA 2X78A 4RW4A 1RDBA 4OGCA 3ZSVA 5FDLA 4RW6A 3VQPA 3OYIA 1VSHA 4PWDA 1KCFA 1VSFA 2YHAA 3RR8A 1G15A 4IBNA 4DTUA 1VSKA 3AVGA 2GBZA 3OS2A 3OYGA 4DQSA 1TKDA 3LP3A 4IG3A 1KLNA 2D0AA 4CF1A 3EZ5A 4F2SA 3ZCMA 4FXDA 1LV5A 1HJRA 4HCCA 3RMBA 1KTQA 3JSMA 1RBVA 1BCOA 2XO7A 4DTSA 2Q3SA 1VSEA 3HT3A 1ZBHA 3LPUA 4AHSA 1B92A 1HYVA 5HP1A 1D8YA 1LAWA 4QCLA 4CK3A 3SJJA 3ALYA 2BANA 4LSNA 1NK4A 4FZZA 4NCBA 3S3OA 1VRTA 1S1UA 3ZSXA 4HUGA 3U3GA 3OYKA 3LZIA 3ISNC 3ZT4A 5I42A 4M3UA 2DTUA 1HQUA 3MAQA 1WSEA 3OYBA 3DM2A 3VQ7A 3VQBA 4CFCA 3OYLA 3LWMA 4FJGA 1T7PA 4OLAA 1YVUA 4DU1A 3WNHA 3TAEA 4OLBA 4FK4A 1JKHA 4KTWA 1VSLA 4DSKA 4OKEA 5FRNA 1TAUA 1RT1A 1EXQA 4F4KA 3F9KA 3D45A 1T03A 1TKZA 1RTHA 3T3FA 3C95A 3WNGA 3QEXA 2ITGA 4M45A 4CE9A 4CEAA 1RCHA 4FLXA 3V6DA 4N76A 5KRSA 4CFDA 3H08A 4J2EA 1UA0A 3L3VA 4CJQA 2HHVA 3O3FA 4HTUA 2ZE2A 1CXUA 3ULDA 4KAZA 1RT7A 3OVNA 2X6SA 4KI4A 2G8VA 5CZ1A 1RDAA 4B8AB 2PZSA 3SUQA 3LANA 1WN7A 4FM2A 2KTQA 1RNHA 1RDCA 2Z1IA 4ELVA 3C94A 4DQIA 4AHVA 3QETA 1UOCA 4I7FA 3PX0A 3QEPA 4Q0BA 1ITGA 3MECA 4CHPA 1RBUA 4CJRA 4K8XA 1BL3A 3AA5X 1NK5A 1BQMA 4AHTA 4CEBA 4KREA 3C6TA 1VRUA 1TL3A 2VG5A 4CJVA 3VQ5A 3OYMA 4FLWA 5JS2A 1TK5A 5CYQA 5HBMA 3CFPA 2A1RA 3KKSA 3KTQA 4CGIA 2VWJA 2O4GA 5D3GA 3CM6A 4G1QA 1ZBFA 2EX3A 1RDDA 1TKXA 4B8CA 4H8KA 4CHZA 4CIFA 4C8NA 5SWMA 2KQ2A 5HROA 4M3XA 4FYDA 2DFFA 4H4OA 4AHCA 1HQEA 2Z1HA 3VQDA 1WSHA 5DK5A 3L2WA 3CYMA 1JLBA 1C1BA 3M8SA 2IOCA 3QIOA 2HNDA 1O1WA 4O0IA 5C24A 2JLEA 3O3GA 4R5PA 3LPTA 1RT5A 2OPRA 1ASUA 5J2QA 3LDSA 2XY8A 4BE0A 3VN5A 3KJVA 4IKFA 2RKIA 2PYLA 3I8DA 3LAMA 2VG6A 1I39A 3OS0A 1EKEA 3TAGA 4B9VA 2EHGA 2XRIA 1WAFA 1B9DA 1W9HA 4N5SA 2LSNA 1NK0A 5JS1A 1KVBA 3G0ZA 2QK9A 4KTQA 2X74A 1S9GA 3OYDA 5C42A 3K5NA 2ATQA 1SKSA 4CCHA 2B6AA 2E6LA 1UAXA 4O0JA 3HO1A 1D5AA 4OGEA 3AVJA 1KRPA 3I0SA 1FXXA 3HVRA 3SV4A 4KHUA 5C25A 4PQUA 3OS1A 3PX4A 3ZSQA 4CK2A 1TGOA 1NOZA 3RMCA 1QSLA 3MXJA 4FJ8A 3WNEA 3NCIA 4O4GA 3AVMA 4M3RA 5FROA 4KO0A 3OYEA 3IS9A 2XY5A 2G8WA 1JL2A 3K58A 1NKCA 3OY9A 4C8LA 1T05A 4FLYA 2QKBA 1HYZA 3L2VA 3AA2A 3RRHA 5J2MA 3DI6A 4AILC 1DTQA 1XHXA 4W5RA 4OJRA 4DSEA 2I5JA 1S5JA 4DSLA 4W5TA 2DFEA 3NF6A 1RT6A 2RF2A 4CJ3A 1REVA 4DSFA 4HUFA 4FJMA 1QSSA 3KLIA 1ZBLA 1S9EA 2PY5A 5J2NA 1J54A 4HHTA 4CHOA 3SQ1A 1VSDA 2JGUA 1S6QA 3AVAA 1KSPA 3AO4A 3EY1A 3LZJA 3K5LA 4FLZA 4AHRA 3L2RA 4LSLA 3DOKA 2P5OA 1C0TA 4DQPA 4FJKA 3B6PA 3K5OA 2ZD1A 3CFOA 3HP6A 3RMAA 3HK2A 2HVHA 3CM5A 3ZSZA 1UA1A 1BQNA 1WSFA 1C1CA 2D5RA 3K2PA 3MEDA 3SI6A 4KPYA 4KHNA 1YTAA 4KFBA 3PY8A 5J1EA 3PV8A 2KW4A 4CJKA 2VWKA 4CJEA 4FK2A 1TK8A 3VQ9A 3HP9A 2YHBA 3JYTA 4O5BA 2G8UA 4FJ9A 4M3YA 3OYCA 1BCMA 1S1WA 3G10A 4E7KA 3K57A 3VA0A 1QTMA 4DQQA 5FRMA 1VSJA 3PX6A 3A2FA 1IKVA 4DLGA 1U47A 3AVHA 3QNOA 3L2UA 3CG7A 3SV3A 1X9WA 3OYNA 1BHLA 4FJ5A 1QHTA 4KHSA 2RN2A 4DFPA 1IO2A 1WAJA 1VSMA 4DTRA 5HRNA 2HHTA 1KFDA 4CEDA 4Q5VA 3MXIA 3RRGA 4Y1CA 1K6YA 1IH7A 2E4LA 3AVLA 3VQ8A 1C0MA 3M8RA 2F96A 3BGRA 3QNNA 4W5NA 3NF8A 1NK7A 3TAMA 3S3NA 3EYZA 3TABA 3DLHA 1YTUA 5I3UA 4KHQA 1SKRA 5KGWA 2P51A 3TWHA 4ELTA 2F8SA 4CGHA 1KVCA 4FM0A 5DMRA 3HXMA 3T1AA 4BWJA 3AV9A 4DTXA 5KTQA 3PO5A 1XWLA 4UQGA 4CHQA 3QERA 3KIOA 4CFAA 4M42A 4Z4GA 2FBXA 4DS5A 1RT4A 3ITHA 1D9FA 3PO4A 4B9UA 2IGIA 1NJXA 1VK0A 2NUBA 2Z1JA 3V81A 2YNHA 1FKOA 1VSIA 4CFBA 4DQRA 1Q8IA 5KRTA 1L3SA 4YNQA 1MU2A 3KK2A 1SL0A 3V9WA 4CESA 1DLOA 4KB1A 4MFBA 3AVIA 2W42A 4OPKA 1JXEA 3DYAA 4QAGA 2AJQA 4FJJA 2YKNA 3QLHA 1NJWA 4C8OA 4E3SA 3QO9A 1NK9A 2HHSA 4FLUA 3O4NA 4DTOA 1F21A 3AA3A 3SQ4A 1CLQA 2YNFA 3KLGA 3U3YA 1GOAA 1X1PA 3SUPA 3L8BA 3SNNA 1TL1A 4DTPA 1ASWA 2R7YA 4KKOA 4FJHA 1RTDA 4CJSA 2F8TA 3DOLA 4NYFA 3HPGA 2HNZA 3VQCA 4XIUA 1ZYQA 2Z1GA 3HPOA 2HMIA 2OZMA 1HNIA 4C8MA 1HNVA 4CIGA 3U6FA 4YFUA 1RTJA 1TKTA 5HRRA 4AH9A 3SZ2A 4LY7A 4B9NA 3ASMA 2HW3A 1RBSA 3SPYA 4CF8A 1LW2A 4Z4EA 1CZBA 4CGFA 1JLCA 5KGXA 3TANA 4K8ZA 4FK0A 1JXBA 1NOYA 2BE2A 1KLMA 2IAJA 1A5VA 2KFZA 2KZZA 4DS4A 1S1VA 2A1SA 4M3ZA 3LALA 1C1AA 3CFRA
chains in the Genus database with same CATH superfamily
4Z94A 1J9AA 5BR9A 5M1OA 4CBWA 4FCYA 3L6QA 4E7HA 1SL1A 3ZETB 5AQYA 3F73A 1Z26A 3LP0A 1GOBA 4M7XA 5BR8K 1T6CA 3O4QA 4DUZK 2X6NA 3AARA 1RT3A 3CCEN 3HSTB 3KK1A 3QICA 1HLUA 3OBWA 3LDQA 4B3MK 4H4MA 2EWSA 3FFIA 4EIAA 5AQRA 2A5XA 4CEZA 1GLAG 4N41A 5AQLA 4JI1K 2XY7A 4JRQA 2E8AA 2IC3A 3V1OA 1R0AA 3NH1A 1D4XA 4HCBA 4R79A 4FW2A 3G71N 3C65A 4IEIA 4E19A 2D1KA 5EVZA 1JJ2M 3V9ZA 3HOSA 3UIQA 3PSIA 3ULEA 4B1WB 4F8RA 5SZTA 3M8PA 4F2RA 1A5XA 4DSIA 1TAQA 5KQDA 4PA1A 4ZTFA 1SKWA 2HB5A 2HF4A 3QFPA 3FE1A 3NGIA 1FK9A 3DLBA 1NK8A 4GV6A 1KAYA 2OPQA 4B1ZA 1BI4B 3CCMN 4BRMA 4BR5A 3ZSRA 3DLKA 4RW7A 5JICA 4CERA 4KRFA 2Q31A 2VGMA 4FZXC 3T69A 4IDKA 1L3UA 4EP4A 3R3LA 4FVUA 2HHUA 3KD1E 2UUBK 1RTIA 2HHXA 3OYJA 1NGFA 2NNWA 4DV3K 2P9KA 4FVMA 3VEZA 2O8EA 2D0BA 3M8QA 4CJ5A 4BE1A 2WOMA 4EP5A 2OPSA 3K59A 1TV6A 4FJIA 1VQKN 2XHBA 4J2DA 3KD5E 1WNSA 2G8IA 3NH0A 1LCUA 3SMSA 1U49A 1Z25A 5AQOA 3IMXA 4JI8K 4L8RB 3LM2A 3O08A 1FKPA 3VA3A 1RBRA 4YOXA 3CJ9A 3ZEUA 2P9UA 3QINA 1VQ7N 3WEEB 4DV6K 1NJYA 3HBTA 3AVFA 3AVBA 4I2PA 4B3OA 4DR4K 1I3AA 3VGLA 3I0RA 1BIUA 1IBMK 3TAQA 4IJNA 4JI2K 4BGAA 5KQ8A 5EY4A 2A6AA 4BROA 4LFCK 4X64K 3NF9A 2ZQBA 3AA4A 5LL6Z 4CZJA 4BDYA 4JRPA 4LF9K 4K42A 3OYFA 2QWQA 2HVIA 3TARA 4LF4K 1ZXOA 2KZMA 3KK3A 4J2AA 1EX4A 4FJXA 5DM6L 1LW0A 1M1KO 3Q7CA 1S72N 4PKIA 1V4TA 3IG1A 2P9LB 3HM9A 1HPZA 1KFSA 3RTVA 3CJ7A 1MWKA 4GMJB 4MDBA 1LWEA 1TK0A 1KXPA 4DFMA 2P5GA 1Y97A 4J2BA 2Q0UA 1N6QA 4IDHA 4ZHRA 2CH6A 2IS3A 2OCEA 1C0UA 4LH5A 2VCPA 3AGRA 3ZSVA 4OGCA 4M63C 3OYIA 2O8BB 3TTCA 4A62A 3OS2A 2ASOA 1KLNA 3GG4A 4F2SA 3ZCMA 3HTVA 1LV5A 3CJAA 1HJRA 3A8YA 2XO7A 1ZBHA 2PBDA 2CGLA 3OA9A 2FSJA 4XEIA 4PL7A 1D8YA 1YIJN 3CMAN 3S3OA 1VRTA 4NCBA 3OYKA 3ZT4A 5AQUA 5I42A 3MAQA 4B1UB 3VQBA 3HM8A 1YVUA 5HOOA 3WNHA 4DU1A 4OLBA 4OPHA 4ISGA 5AZJB 4BRDA 1EXQA 1ATRA 5IT9O 1ILYA 3T3FA 2UYTA 3C95A 4M45A 4CE9A 5M1QA 3H08A 3L3VA 4CJQA 4B1XB 2ZE2A 1CXUA 4JYAK 3NVKA 3ULDA 1NGJA 4CBUA 4KAZA 2H3GX 3J81O 1Q7YO 1U2VB 2HBLA 5AQWA 4B8AB 5JLHA 3SUQA 4DR3K 3LANA 4FM2A 1RNHA 3C94A 2CH5A 3KVGA 2AP1A 3QEPA 3WXLA 4CJRA 1RBUA 1T6DA 1BQMA 4ILGB 5GIOA 4KREA 3C6TA 5M1NA 1VQ4N 1XNRK 4FLWA 5JS2A 1TK5A 5KPTA 2P9SB 5D3GA 3CM6A 1RDDA 1NGIA 3SJHA 4B8CA 5HROA 3THWA 1OVQA 2DFFA 4H4OA 1HQEA 2Z1HA 1HKBA 1WSHA 3VQDA 5AR0A 3HI0A 3QIOA 1GLJO 2V51B 1VQ8N 2WTUA 3O3GA 4KH6A 1ASUA 2OTLN 2VG6A 4BC5A 2EHGA 1HNZK 4M7YA 2LSNA 1NK0A 1KVBA 3G0ZA 4YOYA 4Y0WA 5C42A 1GLLO 4FWKA 2E88A 3DAWA 1D5AA 3AVJA 2QI2A 3CIPA 4PQUA 3ZSQA 4OPAA 4FJ8A 4KO0A 3U9ZA 3THYB 2XY5A 1JL2A 3CQYA 4DV5K 1DTQA 4W5RA 4IOAL 4NO7A 1RT6A 3MN6A 1QHAA 4CJ3A 3EO3A 3G4SN 1REVA 2HF3A 1S9EA 2PY5A 3GDQA 3ATVA 4CHOA 3VEXA 1OKJA 3AO4A 3CPEA 4FLZA 3P38A 4LSLA 2P5OA 2DPNA 3B6PA 3N4QA 3HK2A 3K2PA 2D5RA 1Q86O 4FL9A 2NRXA 1NGEA 2YHBA 1OH7A 4YOUA 4FJ9A 2O8DB 3CI5A 2HBKA 4DQQA 1VSJA 1I94K 3PX6A 3QNOA 2FSNA 3SAGA 3OYNA 1X9WA 4FJ5A 1QHTA 4WFBL 5EX5A 4DTRA 1KFDA 4V19S 3MXIA 3BGRA 4U67L 3NF8A 2FF3B 4DV0K 4DHYA 3TABA 1YTUA 5I3UA 1MWMA 3I33A 4FWQA 4DTXA 2GELA 1XWLA 4UQGA 1W7AA 4CFAA 5LMUK 5AJ3K 1OH8A 2ZJRL 4BRKA 2NUBA 1NWKA 4IOCL 2V7ZA 4C1NK 3THXB 1TUUA 4BRCA 3WT0A 4YNQA 1SL0A 5BN8A 3A5LC 5CR4A 1DLOA 4HTLA 1GLEG 1JXEA 3I56N 4C8OA 3J7YP 4DTOA 1GOAA 3DXKA 4GV3A 4FJHA 1ZC6A 2F8TA 2E2NA 3HPGA 1P8ZA 3ULEB 1HNVA 3U6FA 4AH9A 1YXQA 4FOEA 3KZBA 1TYQA 3ASMA 3DXMA 3CC7N 1LW2A 5AQSA 4Z4EA 5KGXA 1JLCA 3G6EN 4H5NA 5BPNA 3QB0A 5M1KA 5LJVA 4DUYK 2KZZA 2A1SA 4WQ4C 1YF5L 5E84A 5ADXH 4H0YB 4B08A 2ZGZA 1NGAA 1FJGK 1QVFM 4JD2B 1IBLK 1Z6RA 5C12A 4EZ9A 1R59O 2E2OA 2QEXN 3IDHA 3DLEA 4Z4CA 2UXBK 3HVTA 1E4GT 3NVMA 4MO4A 3NDKA 3KKRA 4RWTA 1L3TA 4F3TA 3C6UA 4PKHA 2QTDA 2O4IA 1BGXT 4DF8A 4GV9A 2GEMA 2P9KB 4OKJA 4ISFA 2O8EB 4E1JA 3HZ6A 2O8CA 4HUEA 3KLHA 1NKEA 3VQQA 5AQXA 4M3WA 4IG0A 3OYAA 2P9IA 2QXFA 1BIZA 2W41A 3U9DA 1HYSA 4B9LA 3CQXA 4W5OA 3T1HK 2HHHK 5C15A 1VQON 1HRHA 4O55A 1MDUB 3AO2A 4O8KA 1QQCA 1WLJA 5JVHL 3ZEUB 1O13A 4EZ6A 3HPHA 1Q81O 1NBWA 1L5UA 2YHXA 3O8MA 4FPAA 4CF9A 4BC2A 4DF4A 4WE1A 3V4IA 5TKWA 3MCPA 3AAQA 5CY4A 3HJFA 2GUIA 2G8HA 4IFVA 3V9UA 1D9DA 3J7AP 4DSJA 2RPIA 5CZ2A 3V9SA 3LDOA 4WQ5C 5AQMA 1JLQA 3BP8A 3ENBA 5E41A 3T1YK 1NMDA 4BY9C 5I9EB 3PIOL 3UKUA 1V4SA 2YKMA 3R6MA 3TAFA 3P1GA 4RTFD 4DV7K 3G25A 5JMVA 5HRPA 4LFAK 2YX6A 3OHRA 2OYQA 2BGGA 3A0IX 4JHDB 3MCAB 4NCAA 3OW2M 4Z4HA 2Q0RA 3SBGA 3ENOA 4OVLA 1UWBA 5CHIA 3T19A 3S9HA 4FJNA 4BE2A 1U6ZA 4RW9A 3SBTA 3SMPA 5FPDA 2Q1NA 5AZIB 2YV0X 3SQ0A 4CGDA 3NF7A 5IWAK 1S6PA 4LF8K 3LP1A 4M41A 1DGKN 4GY2B 4BGBA 4CECA 5BPMA 4CJ4A 3CCRN 3ZLJA 3AVKA 3P5JA 5EU7A 4YOVA 2P1JA 1U45A 1HUXA 1RILA 4JKBA 3OYHA 1XC9A 3VQ6A 3ID6A 1W0HA 3DLLL 3DRRA 3QBXA 3VF6A 3MX5A 3THVA 3IAYA 2YJFA 3SUNA 3DWLA 3NGZA 4B9TA 5KPZA 4JS5A 3FFKB 1NJZA 1SZ2A 2B4JA 1VQMN 4OPJA 3IFRA 5BN9A 3I55N 1NNEA 1LWCA 3VEWA 1Q9YA 4Y1DA 4CHYA 4Z4IA 1DTTA 3L2QA 5TKYA 3R9PA 4DKWA 1U04A 4FLVA 1EETA 5LJWA 4CF0A 4F3OA 3VESA 1EWRA 3P31A 1NKBA 5GIPA 3DMJA 1JL1A 1QQNA 3BF3A 2XY6A 4KV8A 4RW8A 4A57A 5FDLA 1KCFA 2WC9A 3CCJN 3E9LA 4DTUA 3AVGA 2GBZA 3OYGA 2QXLA 1TKDA 2D0AA 4FXDA 3THWB 3L4QA 1KAXA 3CJCA 1RBVA 4DTSA 2E1ZA 3S41A 4AHSA 1LAWA 2FLOA 3MWPA 5FPMA 4LSNA 1NK4A 5CE3A 1OH5A 3U3GA 3LZIA 3ISNC 4DR7K 4C1NI 4M3UA 1IV0A 2JWLA 1WSEA 3OYBA 3H3OB 3LWMA 3A5NC 1VHXA 1VSLA 4OKEA 3CJ1A 1TAUA 4F4KA 3D45A 1QQOA 1RTHA 2GTDA 3H1VX 3WNGA 3QEXA 4CEAA 5KRSA 4CFDA 1YITN 1KAZA 1UA0A 2GWJA 5AQHA 5GINA 2HHVA 4LF7K 4PL8A 4EHUA 4WYBA 3VTHA 3OVNA 5AQPA 5F0XA 4KI4A 2NRHA 4GNIA 1VQNN 2PZSA 4UY8O 5FLXO 5HL7L 4DQIA 3QETA 1UOCA 3GE1A 4I6MA 1QQMA 4JK7A 2O8FA 4CHPA 4K8XA 1BL3A 4GVEA 1P90A 4AHTA 1VRUA 2GWKA 5CYQA 2A42A 3KTQA 3KKSA 2VWJA 2O4GA 3M6GA 4CHZA 4H8KA 5SWMA 4A61A 5GADP 4M3XA 2KQ2A 4AHCA 5DK5A 2VQEK 1JLBA 4IO9L 2HNDA 2YHWA 4O0IA 3CC4N 5C24A 2JLEA 1RT5A 4EAHD 3I8DA 3LAMA 3Q7BA 1BO5O 2F9TA 1WAFA 2QK9A 3ZX2A 2VQFK 2X74A 1EWQA 4JKGA 3QMLA 1UAXA 3HO1A 4MLHA 1NU0A 3EL2A 1KRPA 5BRHA 4KHUA 3OS1A 4FSVA 1TGOA 4BR7A 3MXJA 3WNEA 3NCIA 1K8AO 4O4GA 2G8WA 4C8LA 3K58A 1T05A 1BUPA 4QS8A 4AILC 4LC9B 4F9OA 4DSEA 1S5JA 1NG9A 3CCUN 2QWLA 2RF2A 4MDAA 4IXCA 3M3ZA 5J2NA 4HHTA 1VSDA 2WFBA 3L2RA 3ZX0A 3DOKA 4DQPA 1C0TA 3CD6N 4PHTX 3HP6A 3TTDA 3DXKB 2HVHA 1UA1A 4C23A 4WFNL 2F9WA 3SI6A 4KFBA 3PY8A 5J1EA 4BVOA 2VWBA 4CJKA 2VWKA 1TK8A 3JYTA 4O5BA 1BCMA 3G10A 4E7KA 1QTMA 3VA0A 5FRMA 1Q82O 3DXMB 1SAZA 3O9TA 3EKUA 1BHLA 2P9NA 4KHSA 1IO2A 1WAJA 4WQ5A 3TSPA 3P39A 3TSQA 4JKAA 5HRNA 3FZMA 4H0OA 4Q5VA 1IH7A 2E4LA 3VQ8A 1YUWA 1C0MA 3TSUA 2VGNA 3JAMO 2ZGYA 4FOIA 4JI3K 3TAMA 3DLHA 2NRZA 5KGWA 3TWHA 2F8SA 4CGHA 4FM0A 3TTFA 3D6RA 5M1PA 3ZETA 4BRIA 3P4IA 4CHQA 3QERA 1FW6A 4Z4GA 4M42A 2FBXA 1H1VA 3PO4A 1OH6A 4B9UA 2IGIA 3CC2N 4YORA 1IG8A 4JNEA 3V81A 3D2EB 4CFBA 2E5LK 1L3SA 3V9WA 4CESA 1JCFA 2ASPA 4KB1A 4OPKA 2AJQA 3QO9A 3E1YA 3O4NA 1F21A 2P9IB 3SQ4A 1CLQA 3E66A 3CHWA 2HMPA 3U3YA 3SUPA 1X1PA 4IZ9A 3L8BA 3SNNA 4B3SK 1XMOK 4GKJK 4BR4A 4XH5A 5B8HA 1RTDA 4CJSA 1J5EK 3DOLA 3RWUA 1ZYQA 2Z1GA 3VEYA 4C8MA 4CIGA 4YFUA 5HRRA 3SZ2A 1C0FA 4LY7A 4DCHA 1K8KB 3VERA 3BEXA 1RDWX 2HW3A 2RE2A 2UU9K 1CZBA 3LDNA 4FK0A 4WCEL 1JXBA 4BRGA 2BE2A 3HOTA 3RSEA 2KFZA 3MK6A 4M3ZA 1C1AA 3FR0A 4DMNA 3CJBA 4BWMA 2NRVA 3WXIA 4W5QA 2E6MA 4ID1A 4IWVA 1BI4A 3O3HA 3PUFA 1HKCA 3CF5L 4NYNA 1Q9XA 3QIPA 4CZKA 4Z4FA 4KI6A 1QS4A 5AQFA 2OPPA 3FZHA 1WSGA 2A41A 1B9FA 3VGMA 3LDLA 4J8FA 3QEVA 4BQZA 1T3VA 2Y1JA 4TSXA 3SPZA 1JLEA 3CCVN 3AO5A 3DJCA 2QWPA 1DT9A 5C2DA 3MEGA 3I8BA 4B9MA 1CZAN 3KLFA 4CEEA 3BF1A 3S3MA 4CZFA 4G9ZA 2HHQA 1JLFA 1SQKA 4MO5A 4FM1A 2WONA 3SYZA 2F4VK 4PKGA 4DR5K 3NGYA 3WEEA 3JS6A 4GVMA 1XMQK 1N8RO 3B6OA 3JXUA 3MXMA 2WUSA 3WXMB 3VTIA 5ELZA 2E2PA 4KHPK 5M1FA 3RMDA 4C8KA 5EXWA 1WSIA 1BA0A 4CZIA 4BG8A 4FJ7A 4K41A 1WBDA 1YJNN 1BWFO 4I9QA 2E20A 2YNGA 3ZSOA 2YJEA 4BR2A 2NZTA 4QOZB 1HX1A 2P9LA 1HKGA 3DLGA 4B3TK 3QEWA 3CMEN 1ASVA 3KLEA 1J5OA 5HLFA 3CQ8A 4DQ8A 3L4IA 1ZBUA 3L0QA 1M90O 4OO1J 4KTZA 2GV9A 3VF2A 4BRNA 2NRTA 5C10A 1K73O 4M3TA 4H0VB 4CEFA 4CF2A 2KKZA 3C6HA 4ID5A 1IG9A 3WQTA 2QW9A 1SL2A 3K9KA 4FJLA 4DU3A 2FBYA 1X9MA 1QZ6A 3VMFB 4H5WA 4GW6A 1IKWA 1RBTA 2G8KA 3SCXA 3IUCA 1N5YA 1BDGA 4E1MA 2D0CA 3VQAA 4CBXA 1YT3A 1J53A 1LWFA 3AO1A 3NBPA 3H45C 3DRPA 3P83D 4A5BA 2QM1A 3LWLA 1X3MA 2YHYA 3KWIA 3V1QA 5GAGP 4H03B 3AVNA 4N47A 3V9XA 2HOEA 1C6VA 1Q18A 3VQEA 1N33K 3LAKA 3KHYA 1WSJA 4ELUA 5T7BA 2BTFA 4E7JA 3H46O 3C6AA 4CJTA 1QZ5A 4O44A 2OA8A 4BC3A 2UUAK 3E01A 1IKYA 2YNIA 3OJUA 4NXNK 3WQUA 1HMVA 3C7NA 4DTJA 2DFHA 4DV1K 1U2VA 2KFNA 3CETA 3DLRA 5LY3A 5AQIA 1Y64A 3WXJA 2O8FB 4I9LA 1TVRA 1NGCA 4B9SA 4E1NA 1RDBA 4KH5A 3VQPA 4PWDA 4FWPA 1QVGM 2YHAA 3RR8A 1G15A 2P9UB 4DQSA 4JN4A 2W40A 5LMNK 4HCCA 4MLEA 3RMBA 4H0TB 3JSMA 1BCOA 3MWTA 1VSEA 4FWOA 3VPZA 1HYVA 2D0PA 1VQLN 4QCLA 3SJJA 2BANA 3R8EA 4BRAA 1S1UA 1XUPO 3KWGA 4CZLA 2DTUA 1HQUA 3VQ7A 3C0BA 3OYLA 4FJGA 1T7PA 3E9OA 5BRFA 4FK4A 1JKHA 4JKGB 5FRNA 3SAFA 4DR6K 1RT1A 1TKZA 3VENA 2ITGA 4FLXA 4N76A 4J2EA 2FXUA 3O9SA 4JI4K 5DM7L 2YI1A 1NMNA 2G8VA 2NRWA 5CZ1A 2QWNA 2KTQA 1RDCA 2Z1IA 3CCSN 4ELVA 4AHVA 2UXDK 1HNXK 4BRFA 3RVCA 4I7FA 3VETA 4B9QA 3PX0A 4FO0A 3MECA 4JV5K 4Q0BA 1YVNA 3K0SA 1TL3A 3ENHA 2VG5A 3OYMA 3EZWA 5HBMA 3CFPA 4CD3A 2A1RA 4G1QA 2HSTA 4H5VA 1TKXA 3D7EO 4C8NA 4FYDA 3NMUA 2RHKA 3CYMA 2GX9A 3B8AX 2IOCA 1JCGA 3M8SA 4X62K 3O6WA 2OPRA 5J2QA 3LDSA 4IKFA 4BE0A 3VN5A 3KJVA 1HNWK 4B1VA 1EKEA 3TAGA 4B9VA 2XRIA 4ISEA 1B9DA 1GLBG 1W9HA 4IOXA 4AM6A 1W2BM 4KTQA 3OYDA 4CZEA 5F1XA 4CCHA 2B6AA 2E6LA 3D2FA 4OGEA 3H3NO 1FXXA 5AQVA 4JI0K 2ZF5O 3GOIA 3PX4A 4CK2A 3RMCA 1NOZA 3BY5A 3AVMA 3HSCA 4M3RA 5FROA 3IS9A 1NLVA 2QKBA 4DR2K 3RRHA 5J2MA 3DI6A 4JI5K 1XHXA 4BREA 2I5JA 4DSLA 4W5TA 1BOTO 5AQKA 4DSFA 4HUFA 4FJMA 1QSSA 4FWNA 2BH1A 3BZKA 4FWSA 3THXA 1J54A 2JGUA 2PAVA 4EFHA 2V7YA 3AVAA 1KSPA 4YDUC 3VGKA 3EY1A 3K5LA 2JWKA 4AHRA 4FJKA 3K5OA 4CZMA 5AQQA 1ATNA 5H1SQ 3KK7A 3CM5A 4QS9A 1BQNA 4KPYA 3HRGA 1YTAA 3GBTA 3PV8A 4FK2A 3J80O 3VQ9A 4QS7A 3UKRA 3OYCA 3J8AA 1S1WA 3AY9A 3SLCA 3OTOK 3A2FA 4DLGA 1U47A 3AVHA 3F9MA 3SV3A 4K43A 5AQTA 1YI2N 1BG3A 4JKCA 3RSEB 4A2AA 1T44A 2HHTA 3RRGA 3O5BA 1K6YA 4Y1CA 3AVLA 3M8RA 3QNNA 1NK7A 4JKEA 3S3NA 4KHQA 1SKRA 4ELTA 4AM7A 1KVCA 4JD2A 4NXMK 3HXMA 3AV9A 4BRLA 5AQGA 5KTQA 3TPQA 5BPLA 5JLFA 3CPWM 3KIOA 2UXCK 5AQNA 3ITHA 1D9FA 2Z1JA 3CCQN 3O4WA 1FKOA 4DQRA 1Q8IA 3KK2A 4MFBA 3AVIA 2W42A 2E1YA 2ASMA 2PFUA 4QAGA 3DYAA 5FPNA 4E3SA 4HWIA 1VQ6N 1TL1A 3O80A 3IKMA 1W97L 2W6KA 3CCLN 2HMIA 4BRQA 2HNZA 4WQ4A 2OZMA 4JEPA 4JKDA 1RTJA 1TKTA 1N32K 5JVGL 2QA4N 3PSFA 4YOWA 4H5TA 1IBKK 1RBSA 4CGFA 4K8ZA 3TANA 1KD1O 2FSKA 4WFAL 3LALA 3VOVA 3CFRA 4FWMA 2Q97A 4BR9A 1ZBSA 1EQYA 1JLGA 4KHYA 4BACA 4JKFA 4BDZA 3W3DA 2IDOA 3BDPA 2IVPA 4DLEA 1HR0K 3SUOA 1S22A 3ZSWA 4OX9K 1OVYA 2ZM6K 3ZT1A 1WB9A 4PY5A 4IFYA 4H5RA 1GLCG 3L3UA 4CJWA 1SV5A 3TR8A 1CXQA 4HVJA 3NH2A 1GLFO 1YHQN 1S1XA 4BR0A 4DWIA 3QESA 3MEEA 2QWRA 4PUOA 4E89A 2Q36A 2E2QA 4RCHA 3D0PA 3NFAA 1NK6A 1WOQA 4JHDA 3GL1A 3LDPA 5EOYA 4BRPA 3TU5A 5KPRA 4CIEA 2QKKA 4KHWA 3U4LA 2HBMA 4WF9L 3WUHA 3O9UA 3ZT3A 3U8XA 3MMVA 1NGHA 1TYQB 3ZT0A 5AZIA 4RG8A 2FC0A 5CYMA 3LM9A 4LF5K 3DRSA 3VQ4A 4NLCA 1DEJA 5AQZA 4XH4A 3K9JA 3QEIA 4CD1A 3MDQA 4N56A 4YY3K 2P9PA 1S1TA 4O5FA 1U48A 1X3NA 1QE1A 2HNYA 3AVCA 1K9MO 1NGBA 4JLHA 4E7LA 4DTNA 2ETJA 4CZGA 5MLCQ 4LH4A 1YAGA 4JI6K 5HRSA 1GOCA 3NE6A 4FW1A 3HL8A 2GUPA 3J7ZO 4KH4A 2VYPA 3R1XA 4DG1A 5ADXA 4ILJA 2KLAA 2OZSA 1VQ9N 1Z05A 2KHOA 3AGKA 1T8EA 1XHZA 3F5TA 2ZJPL 4YOTA 3VEVA 4AHUA 3NHGA 2BUPA 3NAEA 2VG7A 1JCEA 4CJLA 5AFUA 3HYFA 2D4WA 4CGGA 1X9SA 1SUQA 4DR1K 1LAVA 1SS6A 2F7TA 3TI0A 2O8CB 4Z0UA 4NB4A 4FWRA 3IRXA 4CJUA 3C7NB 4CK1A 4DTMA 4JS4A 1NJIO 2HHWA 1RGIA 1XI1A 1IKXA 1RT2A 2HBJA 1CZ9A 2Y1IA 1HJOA 1ZBIA 5GAEP 5C2FA 4CEOA 1S3XA 3V1RA 4H0PA 5BRDA 3ZYYX 2NLXA 4DFJA 4KB0A 3CXCM 4DU4A 3EN9A 5J2PA 4LD0A 4A59A 5E26A 3AO3A 2IIRA 4KBOA 4CJPA 3EKSA 1EP4A 3ZT2A 4H0XB 1U4BA 2QWOA 3EE8A 3H6EA 1BISA 4NLBA 4X65K 4YHHK 5KI6A 4CI6A 1NGGA 4E0DA 2G8FA 5K14A 4OKKA 2FBTA 4NCGA 4E7IA 3SK3A 3TAPA 1EO1A 4CEQA 1TUYA 3K5MA 2FBVA 4FLTA 4ICLA 1JLAA 4CHNA 4ZTJA 3RR7A 4BDPA 5BREA 4IEEA 2BDPA 3UKUB 3SQ2A 1J6ZA 4EHTA 1XNQK 3LP2A 3ZSYA 4B3RK 3H1QA 1MA9B 1L3VA 1QSYA 4CGJA 4CJFA 4YDUA 4FZYA 3WNFA 3FGUA 4I2QA 1KVAA 2B5JA 1A5WA 4DFKA 3PLAA 4MQ3A 2YCHA 3SAHA 2DY4A 1NGDA 2PYJA 2OTJN 2ZWHA 4CJ7A 3M5RA 3OJSA 3PO5A 3W0LA 2X78A 4RW4A 1X9JA 3ID8A 4JK8A 4RW6A 1VSHA 1VSFA 4IBNA 5AQJA 1VSKA 4BVPA 4BG9A 3LP3A 4IG3A 4CF1A 3MN5A 3EZ5A 1KTQA 3UB5A 2Q3SA 3HT3A 3LPUA 5HP1A 1B92A 1WBBA 5A2QO 4CK3A 3ALYA 4FZZA 3ZSXA 4HUGA 2ZJQL 3VEOA 3UE5A 3DM2A 1N34K 2ITMA 4CFCA 4OLAA 5C0YA 3TAEA 4KTWA 4DSKA 1DKGD 4BC4A 3D2FB 3F9KA 3BUZB 1T03A 1RCHA 3V6DA 2J4RA 3T7ZA 1E3MA 3O3FA 4HTUA 1ESVA 1RT7A 2X6SA 1RDAA 3VF4A 3QFUA 1WN7A 1IJJA 3MN9A 4AF1A 4IJAA 1ITGA 3AA5X 3O9QA 1NK5A 2D0OA 4CEBA 2O8BA 2V52B 4CJVA 4FPBA 3VQ5A 1KC8O 4CGIA 4O8UA 1ZBFA 4CW7B 2EX3A 4CIFA 4IO8A 4IFEA 1VQ5N 3L2WA 2FF6A 4K25A 1E4FT 1C1BA 3UKRB 2OANA 3FZKA 1O1WA 1VAZA 3F2KA 1RFQA 3LPTA 4R5PA 4X66K 2XY8A 2UUCK 2RKIA 2PYLA 1I39A 3N4PA 3OS0A 3EE9A 4ILHA 4N5SA 5JS1A 1BU6O 4GKKK 4LF6K 1G99A 1S9GA 4DB3A 3K5NA 2ATQA 1SKSA 4A5AA 5AZJA 3A5MC 4O0JA 3WXKA 3I0SA 3HVRA 3SV4A 5C25A 4JI7K 2W6LA 1QSLA 2QWMA 3M1FA 1YJ9N 4AQYK 3OYEA 1NKCA 3OY9A 4FLYA 1HYZA 3L2VA 3AA2A 5AFUH 4OJRA 4XH1A 2DFEA 3NF6A 4I6MB 1VQPN 1N36K 5F2RA 3D2EA 3KLIA 1ZBLA 4B1YB 4DV2K 3SQ1A 1S6QA 1LOTB 4A2BA 3LZJA 4FWLA 3OBYA 2A40A 2ZD1A 3CFOA 2P9SA 4JKHA 4L3QA 3RMAA 3ZSZA 1WSFA 2CGJA 1C1CA 3MEDA 4KHNA 1NM1A 4DV4K 2KW4A 4CJEA 3HP9A 3O1WA 3MX2A 2G8UA 4M3YA 3K57A 1IKVA 3L2UA 3CG7A 1K8KA 4LFBK 3ATUA 2RN2A 2A3ZA 4JAXA 4DFPA 1VSMA 4CEDA 3MN7A 4BRHA 2F96A 2Q2RA 3QDKA 1YJWN 4W5NA 4U7BA 2IVOA 2IVNA 3EYZA 4CZHA 2P51A 5DMRA 3T1AA 4BWJA 1GLDG 1WUAA 2I7PA 1HPMA 2CGKA 4BQLA 4CVNE 2WBNA 1RT4A 4DS5A 3THYA 3ZX3A 1NJXA 1VK0A 3FLCO 3FZLA 2YNHA 1VSIA 5KRTA 1MU2A 1KQSM 1XC3A 4FJJA 2YKNA 3QLHA 1NJWA 1NK9A 2HHSA 4FLUA 4K0KK 3A5OC 3AA3A 3EEQA 2YNFA 3O1BA 3KLGA 4DTPA 1ASWA 2R7YA 4KKOA 2NRRA 3E9PA 3FZFA 5GAHP 4JK9A 4XIUA 4NYFA 3CERA 3VQCA 3HPOA 3LL3A 1HNIA 3QBWA 2O8DA 5FPEA 1C0GA 3PIPL 4B9NA 2AA4A 1XQSC 1ATSA 2I7NA 2P9NB 3SPYA 4CF8A 3O9RA 1RDUA 1NOYA 2P9PB 1BA1A 1KLMA 2IAJA 1A5VA 3BZCA 4DS4A 1S1VA 3AAPA
chains in the Genus database with same CATH topology
1J9AA 4DMNA 4BWMA 4B08A 4W5QA 1JLGA 2E6MA 4KHYA 4BACA 4FCYA 4E7HA 4ID1A 4BDZA 1BI4A 3O3HA 1SL1A 4EZ9A 2IDOA 3F73A 1Z26A 3LP0A 3PUFA 4DLEA 3BDPA 1GOBA 3SUOA 3O4QA 3ZSWA 2X6NA 4NYNA 1RT3A 3DLEA 4Z4CA 3HVTA 3ZT1A 4PY5A 1Q9XA 3QIPA 3HSTB 4KI6A 4Z4FA 3NDKA 3KK1A 4IFYA 1QS4A 3KKRA 1L3TA 4F3TA 3C6UA 3L3UA 2O4IA 4CJWA 1SV5A 2OPPA 3TR8A 1BGXT 1CXQA 4HVJA 1WSGA 3NH2A 4DF8A 3RWUA 1B9FA 4H4MA 3FFIA 1S1XA 4OKJA 3QEVA 4DWIA 3QESA 4CEZA 3MEEA 2Y1JA 4TSXA 4PUOA 4E89A 3SPZA 4N41A 1JLEA 4HUEA 2XY7A 4JRQA 3KLHA 3D0PA 2IC3A 3NFAA 1NK6A 1NKEA 3V1OA 3AO5A 3NH1A 1R0AA 3VQQA 4HCBA 4M3WA 4IG0A 3OYAA 4FW2A 2QXFA 1BIZA 3MEGA 4CIEA 4E19A 2QKKA 4B9MA 4B9LA 4KHWA 1HYSA 3KLFA 4CEEA 4W5OA 3S3MA 1HRHA 4O55A 3ZT3A 1JLFA 3AO2A 3V9ZA 3UIQA 1QQCA 1WLJA 2HHQA 4FM1A 4F8RA 3ZT0A 4RG8A 2WONA 3SYZA 5SZTA 4EZ6A 2FC0A 3M8PA 5CYMA 4F2RA 1A5XA 3HPHA 4DSIA 3NGYA 1L5UA 3DRSA 3VQ4A 1TAQA 4GVMA 4PA1A 4ZTFA 3QEIA 2HB5A 3B6OA 4N56A 1SKWA 3NGIA 3MXMA 4CF9A 4DF4A 1FK9A 1S1TA 1U48A 3DLBA 4WE1A 3V4IA 1NK8A 5CY4A 1QE1A 3RMDA 3AVCA 2HNYA 4C8KA 4JLHA 4E7LA 3HJFA 2GUIA 4DTNA 2G8HA 2OPQA 4IFVA 2ETJA 1BI4B 4LH4A 1WSIA 3V9UA 1D9DA 5HRSA 1GOCA 3NE6A 4DSJA 4FW1A 3HL8A 4FJ7A 2RPIA 5CZ2A 3ZSRA 4DG1A 3DLKA 4RW7A 4CERA 3V9SA 2OZSA 4I9QA 4KRFA 1T8EA 2YNGA 1JLQA 4ELUA 1XHZA 3ZSOA 5E41A 4FZXC 4QOZB 4AHUA 4IDKA 3NHGA 1L3UA 4EP4A 3NAEA 2VG7A 2HHUA 4CJLA 3KD1E 3DLGA 2YKMA 3HYFA 4CGGA 1RTIA 3TAFA 3P1GA 3OYJA 1X9SA 1SUQA 2HHXA 3QEWA 4FVMA 1LAVA 3TI0A 1ASVA 5HRPA 3KLEA 4Z0UA 1J5OA 5HLFA 2D0BA 2OYQA 3IRXA 3M8QA 4CJ5A 4CJUA 4CK1A 3CQ8A 4BE1A 4DTMA 2WOMA 2BGGA 1ZBUA 4EP5A 2OPSA 4NCAA 4Z4HA 3K59A 4JS4A 1TV6A 2HHWA 1XI1A 1IKXA 4KTZA 4FJIA 1RT2A 2GV9A 2XHBA 4OVLA 1UWBA 4J2DA 1CZ9A 1WNSA 3KD5E 3T19A 2G8IA 3NH0A 2Y1IA 3S9HA 4M3TA 4FJNA 1U49A 1Z25A 4CEFA 4BE2A 4L8RB 4RW9A 1ZBIA 4CEOA 3V1RA 4CF2A 4ID5A 2YV0X 1IG9A 1FKPA 3SQ0A 4CGDA 3NF7A 4DFJA 3VA3A 1RBRA 4KB0A 1S6PA 1SL2A 4DU4A 3QINA 3LP1A 4M41A 5J2PA 4LD0A 1NJYA 3AO3A 3AVFA 3AVBA 4I2PA 4DU3A 4FJLA 2FBYA 4CECA 1X9MA 4B3OA 4CJPA 1I3AA 1EP4A 3ZT2A 4CJ4A 3I0RA 1BIUA 3AVKA 3P5JA 5EU7A 3TAQA 1U4BA 4GW6A 1IKWA 1RBTA 2P1JA 3SCXA 1U45A 2G8KA 1N5YA 1BISA 1RILA 5KI6A 4E1MA 2D0CA 3OYHA 3NF9A 3VQAA 1YT3A 2ZQBA 3AA4A 4BDYA 1J53A 4JRPA 1XC9A 2G8FA 4E0DA 1LWFA 3VQ6A 3OYFA 1W0HA 5K14A 3AO1A 4OKKA 2FBTA 3NBPA 4NCGA 3TARA 2HVIA 3DRRA 4E7IA 3DRPA 3P83D 3TAPA 4CEQA 3LWLA 3THVA 3IAYA 2KZMA 3KK3A 2FBVA 3K5MA 1EX4A 4J2AA 4FJXA 1LW0A 3SUNA 4B9TA 3NGZA 4JS5A 4ICLA 1JLAA 4FLTA 4CHNA 3V1QA 1NJZA 4ZTJA 3RR7A 4BDPA 3AVNA 3IG1A 2BDPA 4N47A 3HM9A 3V9XA 1HPZA 2B4JA 4OPJA 3SQ2A 1C6VA 3VQEA 3RTVA 1KFSA 1LWCA 3LAKA 1WSJA 3LP2A 3ZSYA 4Y1DA 4CHYA 4GMJB 5T7BA 1Q9YA 4Z4IA 1DTTA 4E7JA 3L2QA 1L3VA 4CJTA 1QSYA 1LWEA 4CGJA 4CJFA 1U04A 4FLVA 1EETA 4O44A 4CF0A 4DFMA 1TK0A 2OA8A 4FZYA 3E01A 1IKYA 2YNIA 3OJUA 2P5GA 1HMVA 1Y97A 4I2QA 3WNFA 2DFHA 4DTJA 4F3OA 1NKBA 4J2BA 1KVAA 2KFNA 2B5JA 1A5WA 3DLRA 4DFKA 1N6QA 4MQ3A 4ZHRA 3DMJA 2DY4A 1JL1A 4I9LA 2IS3A 2PYJA 2XY6A 1TVRA 4B9SA 3OJSA 1C0UA 4KV8A 4LH5A 4RW8A 4E1NA 2X78A 4RW4A 1RDBA 4OGCA 3ZSVA 5FDLA 4RW6A 3VQPA 3OYIA 1VSHA 4PWDA 1KCFA 1VSFA 2YHAA 3RR8A 1G15A 4IBNA 4DTUA 1VSKA 3AVGA 2GBZA 3OS2A 3OYGA 4DQSA 1TKDA 3LP3A 4IG3A 1KLNA 2D0AA 4CF1A 3EZ5A 4F2SA 3ZCMA 4FXDA 1LV5A 1HJRA 4HCCA 3RMBA 1KTQA 3JSMA 1RBVA 1BCOA 2XO7A 4DTSA 2Q3SA 1VSEA 3HT3A 1ZBHA 3LPUA 4AHSA 1B92A 1HYVA 5HP1A 1D8YA 1LAWA 4QCLA 4CK3A 3SJJA 3ALYA 2BANA 4LSNA 1NK4A 4FZZA 4NCBA 3S3OA 1VRTA 1S1UA 3ZSXA 4HUGA 3U3GA 3OYKA 3LZIA 3ISNC 3ZT4A 5I42A 4M3UA 2DTUA 1HQUA 3MAQA 1WSEA 3OYBA 3DM2A 3VQ7A 3VQBA 4CFCA 3OYLA 3LWMA 4FJGA 1T7PA 4OLAA 1YVUA 4DU1A 3WNHA 3TAEA 4OLBA 4FK4A 1JKHA 4KTWA 1VSLA 4DSKA 4OKEA 5FRNA 1TAUA 1RT1A 1EXQA 4F4KA 3F9KA 3D45A 1T03A 1TKZA 1RTHA 3T3FA 3C95A 3WNGA 3QEXA 2ITGA 4M45A 4CE9A 4CEAA 1RCHA 4FLXA 3V6DA 4N76A 5KRSA 4CFDA 3H08A 4J2EA 1UA0A 3L3VA 4CJQA 2HHVA 3O3FA 4HTUA 2ZE2A 1CXUA 3ULDA 4KAZA 1RT7A 3OVNA 2X6SA 4KI4A 2G8VA 5CZ1A 1RDAA 4B8AB 2PZSA 3SUQA 3LANA 1WN7A 4FM2A 2KTQA 1RNHA 1RDCA 2Z1IA 4ELVA 3C94A 4DQIA 4AHVA 3QETA 1UOCA 4I7FA 3PX0A 3QEPA 4Q0BA 1ITGA 3MECA 4CHPA 1RBUA 4CJRA 4K8XA 1BL3A 3AA5X 1NK5A 1BQMA 4AHTA 4CEBA 4KREA 3C6TA 1VRUA 1TL3A 2VG5A 4CJVA 3VQ5A 3OYMA 4FLWA 5JS2A 1TK5A 5CYQA 5HBMA 3CFPA 2A1RA 3KKSA 3KTQA 4CGIA 2VWJA 2O4GA 5D3GA 3CM6A 4G1QA 1ZBFA 2EX3A 1RDDA 1TKXA 4B8CA 4H8KA 4CHZA 4CIFA 4C8NA 5SWMA 2KQ2A 5HROA 4M3XA 4FYDA 2DFFA 4H4OA 4AHCA 1HQEA 2Z1HA 3VQDA 1WSHA 5DK5A 3L2WA 3CYMA 1JLBA 1C1BA 3M8SA 2IOCA 3QIOA 2HNDA 1O1WA 4O0IA 5C24A 2JLEA 3O3GA 4R5PA 3LPTA 1RT5A 2OPRA 1ASUA 5J2QA 3LDSA 2XY8A 4BE0A 3VN5A 3KJVA 4IKFA 2RKIA 2PYLA 3I8DA 3LAMA 2VG6A 1I39A 3OS0A 1EKEA 3TAGA 4B9VA 2EHGA 2XRIA 1WAFA 1B9DA 1W9HA 4N5SA 2LSNA 1NK0A 5JS1A 1KVBA 3G0ZA 2QK9A 4KTQA 2X74A 1S9GA 3OYDA 5C42A 3K5NA 2ATQA 1SKSA 4CCHA 2B6AA 2E6LA 1UAXA 4O0JA 3HO1A 1D5AA 4OGEA 3AVJA 1KRPA 3I0SA 1FXXA 3HVRA 3SV4A 4KHUA 5C25A 4PQUA 3OS1A 3PX4A 3ZSQA 4CK2A 1TGOA 1NOZA 3RMCA 1QSLA 3MXJA 4FJ8A 3WNEA 3NCIA 4O4GA 3AVMA 4M3RA 5FROA 4KO0A 3OYEA 3IS9A 2XY5A 2G8WA 1JL2A 3K58A 1NKCA 3OY9A 4C8LA 1T05A 4FLYA 2QKBA 1HYZA 3L2VA 3AA2A 3RRHA 5J2MA 3DI6A 4AILC 1DTQA 1XHXA 4W5RA 4OJRA 4DSEA 2I5JA 1S5JA 4DSLA 4W5TA 2DFEA 3NF6A 1RT6A 2RF2A 4CJ3A 1REVA 4DSFA 4HUFA 4FJMA 1QSSA 3KLIA 1ZBLA 1S9EA 2PY5A 5J2NA 1J54A 4HHTA 4CHOA 3SQ1A 1VSDA 2JGUA 1S6QA 3AVAA 1KSPA 3AO4A 3EY1A 3LZJA 3K5LA 4FLZA 4AHRA 3L2RA 4LSLA 3DOKA 2P5OA 1C0TA 4DQPA 4FJKA 3B6PA 3K5OA 2ZD1A 3CFOA 3HP6A 3RMAA 3HK2A 2HVHA 3CM5A 3ZSZA 1UA1A 1BQNA 1WSFA 1C1CA 2D5RA 3K2PA 3MEDA 3SI6A 4KPYA 4KHNA 1YTAA 4KFBA 3PY8A 5J1EA 3PV8A 2KW4A 4CJKA 2VWKA 4CJEA 4FK2A 1TK8A 3VQ9A 3HP9A 2YHBA 3JYTA 4O5BA 2G8UA 4FJ9A 4M3YA 3OYCA 1BCMA 1S1WA 3G10A 4E7KA 3K57A 3VA0A 1QTMA 4DQQA 5FRMA 1VSJA 3PX6A 3A2FA 1IKVA 4DLGA 1U47A 3AVHA 3QNOA 3L2UA 3CG7A 3SV3A 1X9WA 3OYNA 1BHLA 4FJ5A 1QHTA 4KHSA 2RN2A 4DFPA 1IO2A 1WAJA 1VSMA 4DTRA 5HRNA 2HHTA 1KFDA 4CEDA 4Q5VA 3MXIA 3RRGA 4Y1CA 1K6YA 1IH7A 2E4LA 3AVLA 3VQ8A 1C0MA 3M8RA 2F96A 3BGRA 3QNNA 4W5NA 3NF8A 1NK7A 3TAMA 3S3NA 3EYZA 3TABA 3DLHA 1YTUA 5I3UA 4KHQA 1SKRA 5KGWA 2P51A 3TWHA 4ELTA 2F8SA 4CGHA 1KVCA 4FM0A 5DMRA 3HXMA 3T1AA 4BWJA 3AV9A 4DTXA 5KTQA 3PO5A 1XWLA 4UQGA 4CHQA 3QERA 3KIOA 4CFAA 4M42A 4Z4GA 2FBXA 4DS5A 1RT4A 3ITHA 1D9FA 3PO4A 4B9UA 2IGIA 1NJXA 1VK0A 2NUBA 2Z1JA 3V81A 2YNHA 1FKOA 1VSIA 4CFBA 4DQRA 1Q8IA 5KRTA 1L3SA 4YNQA 1MU2A 3KK2A 1SL0A 3V9WA 4CESA 1DLOA 4KB1A 4MFBA 3AVIA 2W42A 4OPKA 1JXEA 3DYAA 4QAGA 2AJQA 4FJJA 2YKNA 3QLHA 1NJWA 4C8OA 4E3SA 3QO9A 1NK9A 2HHSA 4FLUA 3O4NA 4DTOA 1F21A 3AA3A 3SQ4A 1CLQA 2YNFA 3KLGA 3U3YA 1GOAA 1X1PA 3SUPA 3L8BA 3SNNA 1TL1A 4DTPA 1ASWA 2R7YA 4KKOA 4FJHA 1RTDA 4CJSA 2F8TA 3DOLA 4NYFA 3HPGA 2HNZA 3VQCA 4XIUA 1ZYQA 2Z1GA 3HPOA 2HMIA 2OZMA 1HNIA 4C8MA 1HNVA 4CIGA 3U6FA 4YFUA 1RTJA 1TKTA 5HRRA 4AH9A 3SZ2A 4LY7A 4B9NA 3ASMA 2HW3A 1RBSA 3SPYA 4CF8A 1LW2A 4Z4EA 1CZBA 4CGFA 1JLCA 5KGXA 3TANA 4K8ZA 4FK0A 1JXBA 1NOYA 2BE2A 1KLMA 2IAJA 1A5VA 2KFZA 2KZZA 4DS4A 1S1VA 2A1SA 4M3ZA 3LALA 1C1AA 3CFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9A A;  4DMN A;  4BWM A;  4B08 A;  4W5Q A;  1JLG A;  2E6M A;  4KHY A;  4BAC A;  4FCY A;  4E7H A;  4ID1 A;  4BDZ A;  1BI4 A;  3O3H A;  1SL1 A;  4EZ9 A;  2IDO A;  3F73 A;  1Z26 A;  3LP0 A;  3PUF A;  4DLE A;  3BDP A;  1GOB A;  3SUO A;  3O4Q A;  3ZSW A;  2X6N A;  4NYN A;  1RT3 A;  3DLE A;  4Z4C A;  3HVT A;  3ZT1 A;  4PY5 A;  1Q9X A;  3QIP A;  3HST B;  4KI6 A;  4Z4F A;  3NDK A;  3KK1 A;  4IFY A;  1QS4 A;  3KKR A;  1L3T A;  4F3T A;  3C6U A;  3L3U A;  2O4I A;  4CJW A;  1SV5 A;  2OPP A;  3TR8 A;  1BGX T;  1CXQ A;  4HVJ A;  1WSG A;  3NH2 A;  4DF8 A;  3RWU A;  1B9F A;  4H4M A;  3FFI A;  1S1X A;  4OKJ A;  3QEV A;  4DWI A;  3QES A;  4CEZ A;  3MEE A;  2Y1J A;  4TSX A;  4PUO A;  4E89 A;  3SPZ A;  4N41 A;  1JLE A;  4HUE A;  2XY7 A;  4JRQ A;  3KLH A;  3D0P A;  2IC3 A;  3NFA A;  1NK6 A;  1NKE A;  3V1O A;  3AO5 A;  3NH1 A;  1R0A A;  3VQQ A;  4HCB A;  4M3W A;  4IG0 A;  3OYA A;  4FW2 A;  2QXF A;  1BIZ A;  3MEG A;  4CIE A;  4E19 A;  2QKK A;  4B9M A;  4B9L A;  4KHW A;  1HYS A;  3KLF A;  4CEE A;  4W5O A;  3S3M A;  1HRH A;  4O55 A;  3ZT3 A;  1JLF A;  3AO2 A;  3V9Z A;  3UIQ A;  1QQC A;  1WLJ A;  2HHQ A;  4FM1 A;  4F8R A;  3ZT0 A;  4RG8 A;  2WON A;  3SYZ A;  5SZT A;  4EZ6 A;  2FC0 A;  3M8P A;  5CYM A;  4F2R A;  1A5X A;  3HPH A;  4DSI A;  3NGY A;  1L5U A;  3DRS A;  3VQ4 A;  1TAQ A;  4GVM A;  4PA1 A;  4ZTF A;  3QEI A;  2HB5 A;  3B6O A;  4N56 A;  1SKW A;  3NGI A;  3MXM A;  4CF9 A;  4DF4 A;  1FK9 A;  1S1T A;  1U48 A;  3DLB A;  4WE1 A;  3V4I A;  1NK8 A;  5CY4 A;  1QE1 A;  3RMD A;  3AVC A;  2HNY A;  4C8K A;  4JLH A;  4E7L A;  3HJF A;  2GUI A;  4DTN A;  2G8H A;  2OPQ A;  4IFV A;  2ETJ A;  1BI4 B;  4LH4 A;  1WSI A;  3V9U A;  1D9D A;  5HRS A;  1GOC A;  3NE6 A;  4DSJ A;  4FW1 A;  3HL8 A;  4FJ7 A;  2RPI A;  5CZ2 A;  3ZSR A;  4DG1 A;  3DLK A;  4RW7 A;  4CER A;  3V9S A;  2OZS A;  4I9Q A;  4KRF A;  1T8E A;  2YNG A;  1JLQ A;  4ELU A;  1XHZ A;  3ZSO A;  5E41 A;  4FZX C;  4QOZ B;  4AHU A;  4IDK A;  3NHG A;  1L3U A;  4EP4 A;  3NAE A;  2VG7 A;  2HHU A;  4CJL A;  3KD1 E;  3DLG A;  2YKM A;  3HYF A;  4CGG A;  1RTI A;  3TAF A;  3P1G A;  3OYJ A;  1X9S A;  1SUQ A;  2HHX A;  3QEW A;  4FVM A;  1LAV A;  3TI0 A;  1ASV A;  5HRP A;  3KLE A;  4Z0U A;  1J5O A;  5HLF A;  2D0B A;  2OYQ A;  3IRX A;  3M8Q A;  4CJ5 A;  4CJU A;  4CK1 A;  3CQ8 A;  4BE1 A;  4DTM A;  2WOM A;  2BGG A;  1ZBU A;  4EP5 A;  2OPS A;  4NCA A;  4Z4H A;  3K59 A;  4JS4 A;  1TV6 A;  2HHW A;  1XI1 A;  1IKX A;  4KTZ A;  4FJI A;  1RT2 A;  2GV9 A;  2XHB A;  4OVL A;  1UWB A;  4J2D A;  1CZ9 A;  1WNS A;  3KD5 E;  3T19 A;  2G8I A;  3NH0 A;  2Y1I A;  3S9H A;  4M3T A;  4FJN A;  1U49 A;  1Z25 A;  4CEF A;  4BE2 A;  4L8R B;  4RW9 A;  1ZBI A;  4CEO A;  3V1R A;  4CF2 A;  4ID5 A;  2YV0 X;  1IG9 A;  1FKP A;  3SQ0 A;  4CGD A;  3NF7 A;  4DFJ A;  3VA3 A;  1RBR A;  4KB0 A;  1S6P A;  1SL2 A;  4DU4 A;  3QIN A;  3LP1 A;  4M41 A;  5J2P A;  4LD0 A;  1NJY A;  3AO3 A;  3AVF A;  3AVB A;  4I2P A;  4DU3 A;  4FJL A;  2FBY A;  4CEC A;  1X9M A;  4B3O A;  4CJP A;  1I3A A;  1EP4 A;  3ZT2 A;  4CJ4 A;  3I0R A;  1BIU A;  3AVK A;  3P5J A;  5EU7 A;  3TAQ A;  1U4B A;  4GW6 A;  1IKW A;  1RBT A;  2P1J A;  3SCX A;  1U45 A;  2G8K A;  1N5Y A;  1BIS A;  1RIL A;  5KI6 A;  4E1M A;  2D0C A;  3OYH A;  3NF9 A;  3VQA A;  1YT3 A;  2ZQB A;  3AA4 A;  4BDY A;  1J53 A;  4JRP A;  1XC9 A;  2G8F A;  4E0D A;  1LWF A;  3VQ6 A;  3OYF A;  1W0H A;  5K14 A;  3AO1 A;  4OKK A;  2FBT A;  3NBP A;  4NCG A;  3TAR A;  2HVI A;  3DRR A;  4E7I A;  3DRP A;  3P83 D;  3TAP A;  4CEQ A;  3LWL A;  3THV A;  3IAY A;  2KZM A;  3KK3 A;  2FBV A;  3K5M A;  1EX4 A;  4J2A A;  4FJX A;  1LW0 A;  3SUN A;  4B9T A;  3NGZ A;  4JS5 A;  4ICL A;  1JLA A;  4FLT A;  4CHN A;  3V1Q A;  1NJZ A;  4ZTJ A;  3RR7 A;  4BDP A;  3AVN A;  3IG1 A;  2BDP A;  4N47 A;  3HM9 A;  3V9X A;  1HPZ A;  2B4J A;  4OPJ A;  3SQ2 A;  1C6V A;  3VQE A;  3RTV A;  1KFS A;  1LWC A;  3LAK A;  1WSJ A;  3LP2 A;  3ZSY A;  4Y1D A;  4CHY A;  4GMJ B;  5T7B A;  1Q9Y A;  4Z4I A;  1DTT A;  4E7J A;  3L2Q A;  1L3V A;  4CJT A;  1QSY A;  1LWE A;  4CGJ A;  4CJF A;  1U04 A;  4FLV A;  1EET A;  4O44 A;  4CF0 A;  4DFM A;  1TK0 A;  2OA8 A;  4FZY A;  3E01 A;  1IKY A;  2YNI A;  3OJU A;  2P5G A;  1HMV A;  1Y97 A;  4I2Q A;  3WNF A;  2DFH A;  4DTJ A;  4F3O A;  1NKB A;  4J2B A;  1KVA A;  2KFN A;  2B5J A;  1A5W A;  3DLR A;  4DFK A;  1N6Q A;  4MQ3 A;  4ZHR A;  3DMJ A;  2DY4 A;  1JL1 A;  4I9L A;  2IS3 A;  2PYJ A;  2XY6 A;  1TVR A;  4B9S A;  3OJS A;  1C0U A;  4KV8 A;  4LH5 A;  4RW8 A;  4E1N A;  2X78 A;  4RW4 A;  1RDB A;  4OGC A;  3ZSV A;  5FDL A;  4RW6 A;  3VQP A;  3OYI A;  1VSH A;  4PWD A;  1KCF A;  1VSF A;  2YHA A;  3RR8 A;  1G15 A;  4IBN A;  4DTU A;  1VSK A;  3AVG A;  2GBZ A;  3OS2 A;  3OYG A;  4DQS A;  1TKD A;  3LP3 A;  4IG3 A;  1KLN A;  2D0A A;  4CF1 A;  3EZ5 A;  4F2S A;  3ZCM A;  4FXD A;  1LV5 A;  1HJR A;  4HCC A;  3RMB A;  1KTQ A;  3JSM A;  1RBV A;  1BCO A;  2XO7 A;  4DTS A;  2Q3S A;  1VSE A;  3HT3 A;  1ZBH A;  3LPU A;  4AHS A;  1B92 A;  1HYV A;  5HP1 A;  1D8Y A;  1LAW A;  4QCL A;  4CK3 A;  3SJJ A;  3ALY A;  2BAN A;  4LSN A;  1NK4 A;  4FZZ A;  4NCB A;  3S3O A;  1VRT A;  1S1U A;  3ZSX A;  4HUG A;  3U3G A;  3OYK A;  3LZI A;  3ISN C;  3ZT4 A;  5I42 A;  4M3U A;  2DTU A;  1HQU A;  3MAQ A;  1WSE A;  3OYB A;  3DM2 A;  3VQ7 A;  3VQB A;  4CFC A;  3OYL A;  3LWM A;  4FJG A;  1T7P A;  4OLA A;  1YVU A;  4DU1 A;  3WNH A;  3TAE A;  4OLB A;  4FK4 A;  1JKH A;  4KTW A;  1VSL A;  4DSK A;  4OKE A;  5FRN A;  1TAU A;  1RT1 A;  1EXQ A;  4F4K A;  3F9K A;  3D45 A;  1T03 A;  1TKZ A;  1RTH A;  3T3F A;  3C95 A;  3WNG A;  3QEX A;  2ITG A;  4M45 A;  4CE9 A;  4CEA A;  1RCH A;  4FLX A;  3V6D A;  4N76 A;  5KRS A;  4CFD A;  3H08 A;  4J2E A;  1UA0 A;  3L3V A;  4CJQ A;  2HHV A;  3O3F A;  4HTU A;  2ZE2 A;  1CXU A;  3ULD A;  4KAZ A;  1RT7 A;  3OVN A;  2X6S A;  4KI4 A;  2G8V A;  5CZ1 A;  1RDA A;  4B8A B;  2PZS A;  3SUQ A;  3LAN A;  1WN7 A;  4FM2 A;  2KTQ A;  1RNH A;  1RDC A;  2Z1I A;  4ELV A;  3C94 A;  4DQI A;  4AHV A;  3QET A;  1UOC A;  4I7F A;  3PX0 A;  3QEP A;  4Q0B A;  1ITG A;  3MEC A;  4CHP A;  1RBU A;  4CJR A;  4K8X A;  1BL3 A;  3AA5 X;  1NK5 A;  1BQM A;  4AHT A;  4CEB A;  4KRE A;  3C6T A;  1VRU A;  1TL3 A;  2VG5 A;  4CJV A;  3VQ5 A;  3OYM A;  4FLW A;  5JS2 A;  1TK5 A;  5CYQ A;  5HBM A;  3CFP A;  2A1R A;  3KKS A;  3KTQ A;  4CGI A;  2VWJ A;  2O4G A;  5D3G A;  3CM6 A;  4G1Q A;  1ZBF A;  2EX3 A;  1RDD A;  1TKX A;  4B8C A;  4H8K A;  4CHZ A;  4CIF A;  4C8N A;  5SWM A;  2KQ2 A;  5HRO A;  4M3X A;  4FYD A;  2DFF A;  4H4O A;  4AHC A;  1HQE A;  2Z1H A;  3VQD A;  1WSH A;  5DK5 A;  3L2W A;  3CYM A;  1JLB A;  1C1B A;  3M8S A;  2IOC A;  3QIO A;  2HND A;  1O1W A;  4O0I A;  5C24 A;  2JLE A;  3O3G A;  4R5P A;  3LPT A;  1RT5 A;  2OPR A;  1ASU A;  5J2Q A;  3LDS A;  2XY8 A;  4BE0 A;  3VN5 A;  3KJV A;  4IKF A;  2RKI A;  2PYL A;  3I8D A;  3LAM A;  2VG6 A;  1I39 A;  3OS0 A;  1EKE A;  3TAG A;  4B9V A;  2EHG A;  2XRI A;  1WAF A;  1B9D A;  1W9H A;  4N5S A;  2LSN A;  1NK0 A;  5JS1 A;  1KVB A;  3G0Z A;  2QK9 A;  4KTQ A;  2X74 A;  1S9G A;  3OYD A;  5C42 A;  3K5N A;  2ATQ A;  1SKS A;  4CCH A;  2B6A A;  2E6L A;  1UAX A;  4O0J A;  3HO1 A;  1D5A A;  4OGE A;  3AVJ A;  1KRP A;  3I0S A;  1FXX A;  3HVR A;  3SV4 A;  4KHU A;  5C25 A;  4PQU A;  3OS1 A;  3PX4 A;  3ZSQ A;  4CK2 A;  1TGO A;  1NOZ A;  3RMC A;  1QSL A;  3MXJ A;  4FJ8 A;  3WNE A;  3NCI A;  4O4G A;  3AVM A;  4M3R A;  5FRO A;  4KO0 A;  3OYE A;  3IS9 A;  2XY5 A;  2G8W A;  1JL2 A;  3K58 A;  1NKC A;  3OY9 A;  4C8L A;  1T05 A;  4FLY A;  2QKB A;  1HYZ A;  3L2V A;  3AA2 A;  3RRH A;  5J2M A;  3DI6 A;  4AIL C;  1DTQ A;  1XHX A;  4W5R A;  4OJR A;  4DSE A;  2I5J A;  1S5J A;  4DSL A;  4W5T A;  2DFE A;  3NF6 A;  1RT6 A;  2RF2 A;  4CJ3 A;  1REV A;  4DSF A;  4HUF A;  4FJM A;  1QSS A;  3KLI A;  1ZBL A;  1S9E A;  2PY5 A;  5J2N A;  1J54 A;  4HHT A;  4CHO A;  3SQ1 A;  1VSD A;  2JGU A;  1S6Q A;  3AVA A;  1KSP A;  3AO4 A;  3EY1 A;  3LZJ A;  3K5L A;  4FLZ A;  4AHR A;  3L2R A;  4LSL A;  3DOK A;  2P5O A;  1C0T A;  4DQP A;  4FJK A;  3B6P A;  3K5O A;  2ZD1 A;  3CFO A;  3HP6 A;  3RMA A;  3HK2 A;  2HVH A;  3CM5 A;  3ZSZ A;  1UA1 A;  1BQN A;  1WSF A;  1C1C A;  2D5R A;  3K2P A;  3MED A;  3SI6 A;  4KPY A;  4KHN A;  1YTA A;  4KFB A;  3PY8 A;  5J1E A;  3PV8 A;  2KW4 A;  4CJK A;  2VWK A;  4CJE A;  4FK2 A;  1TK8 A;  3VQ9 A;  3HP9 A;  2YHB A;  3JYT A;  4O5B A;  2G8U A;  4FJ9 A;  4M3Y A;  3OYC A;  1BCM A;  1S1W A;  3G10 A;  4E7K A;  3K57 A;  3VA0 A;  1QTM A;  4DQQ A;  5FRM A;  1VSJ A;  3PX6 A;  3A2F A;  1IKV A;  4DLG A;  1U47 A;  3AVH A;  3QNO A;  3L2U A;  3CG7 A;  3SV3 A;  1X9W A;  3OYN A;  1BHL A;  4FJ5 A;  1QHT A;  4KHS A;  2RN2 A;  4DFP A;  1IO2 A;  1WAJ A;  1VSM A;  4DTR A;  5HRN A;  2HHT A;  1KFD A;  4CED A;  4Q5V A;  3MXI A;  3RRG A;  4Y1C A;  1K6Y A;  1IH7 A;  2E4L A;  3AVL A;  3VQ8 A;  1C0M A;  3M8R A;  2F96 A;  3BGR A;  3QNN A;  4W5N A;  3NF8 A;  1NK7 A;  3TAM A;  3S3N A;  3EYZ A;  3TAB A;  3DLH A;  1YTU A;  5I3U A;  4KHQ A;  1SKR A;  5KGW A;  2P51 A;  3TWH A;  4ELT A;  2F8S A;  4CGH A;  1KVC A;  4FM0 A;  5DMR A;  3HXM A;  3T1A A;  4BWJ A;  3AV9 A;  4DTX A;  5KTQ A;  3PO5 A;  1XWL A;  4UQG A;  4CHQ A;  3QER A;  3KIO A;  4CFA A;  4M42 A;  4Z4G A;  2FBX A;  4DS5 A;  1RT4 A;  3ITH A;  1D9F A;  3PO4 A;  4B9U A;  2IGI A;  1NJX A;  1VK0 A;  2NUB A;  2Z1J A;  3V81 A;  2YNH A;  1FKO A;  1VSI A;  4CFB A;  4DQR A;  1Q8I A;  5KRT A;  1L3S A;  4YNQ A;  1MU2 A;  3KK2 A;  1SL0 A;  3V9W A;  4CES A;  1DLO A;  4KB1 A;  4MFB A;  3AVI A;  2W42 A;  4OPK A;  1JXE A;  3DYA A;  4QAG A;  2AJQ A;  4FJJ A;  2YKN A;  3QLH A;  1NJW A;  4C8O A;  4E3S A;  3QO9 A;  1NK9 A;  2HHS A;  4FLU A;  3O4N A;  4DTO A;  1F21 A;  3AA3 A;  3SQ4 A;  1CLQ A;  2YNF A;  3KLG A;  3U3Y A;  1GOA A;  1X1P A;  3SUP A;  3L8B A;  3SNN A;  1TL1 A;  4DTP A;  1ASW A;  2R7Y A;  4KKO A;  4FJH A;  1RTD A;  4CJS A;  2F8T A;  3DOL A;  4NYF A;  3HPG A;  2HNZ A;  3VQC A;  4XIU A;  1ZYQ A;  2Z1G A;  3HPO A;  2HMI A;  2OZM A;  1HNI A;  4C8M A;  1HNV A;  4CIG A;  3U6F A;  4YFU A;  1RTJ A;  1TKT A;  5HRR A;  4AH9 A;  3SZ2 A;  4LY7 A;  4B9N A;  3ASM A;  2HW3 A;  1RBS A;  3SPY A;  4CF8 A;  1LW2 A;  4Z4E A;  1CZB A;  4CGF A;  1JLC A;  5KGX A;  3TAN A;  4K8Z A;  4FK0 A;  1JXB A;  1NOY A;  2BE2 A;  1KLM A;  2IAJ A;  1A5V A;  2KFZ A;  2KZZ A;  4DS4 A;  1S1V A;  2A1S A;  4M3Z A;  3LAL A;  1C1A A;  3CFR A; 
#chains in the Genus database with same CATH topology
 4Z94 A;  1J9A A;  5BR9 A;  5M1O A;  4CBW A;  4FCY A;  3L6Q A;  4E7H A;  1SL1 A;  3ZET B;  5AQY A;  3F73 A;  1Z26 A;  3LP0 A;  1GOB A;  4M7X A;  5BR8 K;  1T6C A;  3O4Q A;  4DUZ K;  2X6N A;  3AAR A;  1RT3 A;  3CCE N;  3HST B;  3KK1 A;  3QIC A;  1HLU A;  3OBW A;  3LDQ A;  4B3M K;  4H4M A;  2EWS A;  3FFI A;  4EIA A;  5AQR A;  2A5X A;  4CEZ A;  1GLA G;  4N41 A;  5AQL A;  4JI1 K;  2XY7 A;  4JRQ A;  2E8A A;  2IC3 A;  3V1O A;  1R0A A;  3NH1 A;  1D4X A;  4HCB A;  4R79 A;  4FW2 A;  3G71 N;  3C65 A;  4IEI A;  4E19 A;  2D1K A;  5EVZ A;  1JJ2 M;  3V9Z A;  3HOS A;  3UIQ A;  3PSI A;  3ULE A;  4B1W B;  4F8R A;  5SZT A;  3M8P A;  4F2R A;  1A5X A;  4DSI A;  1TAQ A;  5KQD A;  4PA1 A;  4ZTF A;  1SKW A;  2HB5 A;  2HF4 A;  3QFP A;  3FE1 A;  3NGI A;  1FK9 A;  3DLB A;  1NK8 A;  4GV6 A;  1KAY A;  2OPQ A;  4B1Z A;  1BI4 B;  3CCM N;  4BRM A;  4BR5 A;  3ZSR A;  3DLK A;  4RW7 A;  5JIC A;  4CER A;  4KRF A;  2Q31 A;  2VGM A;  4FZX C;  3T69 A;  4IDK A;  1L3U A;  4EP4 A;  3R3L A;  4FVU A;  2HHU A;  3KD1 E;  2UUB K;  1RTI A;  2HHX A;  3OYJ A;  1NGF A;  2NNW A;  4DV3 K;  2P9K A;  4FVM A;  3VEZ A;  2O8E A;  2D0B A;  3M8Q A;  4CJ5 A;  4BE1 A;  2WOM A;  4EP5 A;  2OPS A;  3K59 A;  1TV6 A;  4FJI A;  1VQK N;  2XHB A;  4J2D A;  3KD5 E;  1WNS A;  2G8I A;  3NH0 A;  1LCU A;  3SMS A;  1U49 A;  1Z25 A;  5AQO A;  3IMX A;  4JI8 K;  4L8R B;  3LM2 A;  3O08 A;  1FKP A;  3VA3 A;  1RBR A;  4YOX A;  3CJ9 A;  3ZEU A;  2P9U A;  3QIN A;  1VQ7 N;  3WEE B;  4DV6 K;  1NJY A;  3HBT A;  3AVF A;  3AVB A;  4I2P A;  4B3O A;  4DR4 K;  1I3A A;  3VGL A;  3I0R A;  1BIU A;  1IBM K;  3TAQ A;  4IJN A;  4JI2 K;  4BGA A;  5KQ8 A;  5EY4 A;  2A6A A;  4BRO A;  4LFC K;  4X64 K;  3NF9 A;  2ZQB A;  3AA4 A;  5LL6 Z;  4CZJ A;  4BDY A;  4JRP A;  4LF9 K;  4K42 A;  3OYF A;  2QWQ A;  2HVI A;  3TAR A;  4LF4 K;  1ZXO A;  2KZM A;  3KK3 A;  4J2A A;  1EX4 A;  4FJX A;  5DM6 L;  1LW0 A;  1M1K O;  3Q7C A;  1S72 N;  4PKI A;  1V4T A;  3IG1 A;  2P9L B;  3HM9 A;  1HPZ A;  1KFS A;  3RTV A;  3CJ7 A;  1MWK A;  4GMJ B;  4MDB A;  1LWE A;  1TK0 A;  1KXP A;  4DFM A;  2P5G A;  1Y97 A;  4J2B A;  2Q0U A;  1N6Q A;  4IDH A;  4ZHR A;  2CH6 A;  2IS3 A;  2OCE A;  1C0U A;  4LH5 A;  2VCP A;  3AGR A;  3ZSV A;  4OGC A;  4M63 C;  3OYI A;  2O8B B;  3TTC A;  4A62 A;  3OS2 A;  2ASO A;  1KLN A;  3GG4 A;  4F2S A;  3ZCM A;  3HTV A;  1LV5 A;  3CJA A;  1HJR A;  3A8Y A;  2XO7 A;  1ZBH A;  2PBD A;  2CGL A;  3OA9 A;  2FSJ A;  4XEI A;  4PL7 A;  1D8Y A;  1YIJ N;  3CMA N;  3S3O A;  1VRT A;  4NCB A;  3OYK A;  3ZT4 A;  5AQU A;  5I42 A;  3MAQ A;  4B1U B;  3VQB A;  3HM8 A;  1YVU A;  5HOO A;  3WNH A;  4DU1 A;  4OLB A;  4OPH A;  4ISG A;  5AZJ B;  4BRD A;  1EXQ A;  1ATR A;  5IT9 O;  1ILY A;  3T3F A;  2UYT A;  3C95 A;  4M45 A;  4CE9 A;  5M1Q A;  3H08 A;  3L3V A;  4CJQ A;  4B1X B;  2ZE2 A;  1CXU A;  4JYA K;  3NVK A;  3ULD A;  1NGJ A;  4CBU A;  4KAZ A;  2H3G X;  3J81 O;  1Q7Y O;  1U2V B;  2HBL A;  5AQW A;  4B8A B;  5JLH A;  3SUQ A;  4DR3 K;  3LAN A;  4FM2 A;  1RNH A;  3C94 A;  2CH5 A;  3KVG A;  2AP1 A;  3QEP A;  3WXL A;  4CJR A;  1RBU A;  1T6D A;  1BQM A;  4ILG B;  5GIO A;  4KRE A;  3C6T A;  5M1N A;  1VQ4 N;  1XNR K;  4FLW A;  5JS2 A;  1TK5 A;  5KPT A;  2P9S B;  5D3G A;  3CM6 A;  1RDD A;  1NGI A;  3SJH A;  4B8C A;  5HRO A;  3THW A;  1OVQ A;  2DFF A;  4H4O A;  1HQE A;  2Z1H A;  1HKB A;  1WSH A;  3VQD A;  5AR0 A;  3HI0 A;  3QIO A;  1GLJ O;  2V51 B;  1VQ8 N;  2WTU A;  3O3G A;  4KH6 A;  1ASU A;  2OTL N;  2VG6 A;  4BC5 A;  2EHG A;  1HNZ K;  4M7Y A;  2LSN A;  1NK0 A;  1KVB A;  3G0Z A;  4YOY A;  4Y0W A;  5C42 A;  1GLL O;  4FWK A;  2E88 A;  3DAW A;  1D5A A;  3AVJ A;  2QI2 A;  3CIP A;  4PQU A;  3ZSQ A;  4OPA A;  4FJ8 A;  4KO0 A;  3U9Z A;  3THY B;  2XY5 A;  1JL2 A;  3CQY A;  4DV5 K;  1DTQ A;  4W5R A;  4IOA L;  4NO7 A;  1RT6 A;  3MN6 A;  1QHA A;  4CJ3 A;  3EO3 A;  3G4S N;  1REV A;  2HF3 A;  1S9E A;  2PY5 A;  3GDQ A;  3ATV A;  4CHO A;  3VEX A;  1OKJ A;  3AO4 A;  3CPE A;  4FLZ A;  3P38 A;  4LSL A;  2P5O A;  2DPN A;  3B6P A;  3N4Q A;  3HK2 A;  3K2P A;  2D5R A;  1Q86 O;  4FL9 A;  2NRX A;  1NGE A;  2YHB A;  1OH7 A;  4YOU A;  4FJ9 A;  2O8D B;  3CI5 A;  2HBK A;  4DQQ A;  1VSJ A;  1I94 K;  3PX6 A;  3QNO A;  2FSN A;  3SAG A;  3OYN A;  1X9W A;  4FJ5 A;  1QHT A;  4WFB L;  5EX5 A;  4DTR A;  1KFD A;  4V19 S;  3MXI A;  3BGR A;  4U67 L;  3NF8 A;  2FF3 B;  4DV0 K;  4DHY A;  3TAB A;  1YTU A;  5I3U A;  1MWM A;  3I33 A;  4FWQ A;  4DTX A;  2GEL A;  1XWL A;  4UQG A;  1W7A A;  4CFA A;  5LMU K;  5AJ3 K;  1OH8 A;  2ZJR L;  4BRK A;  2NUB A;  1NWK A;  4IOC L;  2V7Z A;  4C1N K;  3THX B;  1TUU A;  4BRC A;  3WT0 A;  4YNQ A;  1SL0 A;  5BN8 A;  3A5L C;  5CR4 A;  1DLO A;  4HTL A;  1GLE G;  1JXE A;  3I56 N;  4C8O A;  3J7Y P;  4DTO A;  1GOA A;  3DXK A;  4GV3 A;  4FJH A;  1ZC6 A;  2F8T A;  2E2N A;  3HPG A;  1P8Z A;  3ULE B;  1HNV A;  3U6F A;  4AH9 A;  1YXQ A;  4FOE A;  3KZB A;  1TYQ A;  3ASM A;  3DXM A;  3CC7 N;  1LW2 A;  5AQS A;  4Z4E A;  5KGX A;  1JLC A;  3G6E N;  4H5N A;  5BPN A;  3QB0 A;  5M1K A;  5LJV A;  4DUY K;  2KZZ A;  2A1S A;  4WQ4 C;  1YF5 L;  5E84 A;  5ADX H;  4H0Y B;  4B08 A;  2ZGZ A;  1NGA A;  1FJG K;  1QVF M;  4JD2 B;  1IBL K;  1Z6R A;  5C12 A;  4EZ9 A;  1R59 O;  2E2O A;  2QEX N;  3IDH A;  3DLE A;  4Z4C A;  2UXB K;  3HVT A;  1E4G T;  3NVM A;  4MO4 A;  3NDK A;  3KKR A;  4RWT A;  1L3T A;  4F3T A;  3C6U A;  4PKH A;  2QTD A;  2O4I A;  1BGX T;  4DF8 A;  4GV9 A;  2GEM A;  2P9K B;  4OKJ A;  4ISF A;  2O8E B;  4E1J A;  3HZ6 A;  2O8C A;  4HUE A;  3KLH A;  1NKE A;  3VQQ A;  5AQX A;  4M3W A;  4IG0 A;  3OYA A;  2P9I A;  2QXF A;  1BIZ A;  2W41 A;  3U9D A;  1HYS A;  4B9L A;  3CQX A;  4W5O A;  3T1H K;  2HHH K;  5C15 A;  1VQO N;  1HRH A;  4O55 A;  1MDU B;  3AO2 A;  4O8K A;  1QQC A;  1WLJ A;  5JVH L;  3ZEU B;  1O13 A;  4EZ6 A;  3HPH A;  1Q81 O;  1NBW A;  1L5U A;  2YHX A;  3O8M A;  4FPA A;  4CF9 A;  4BC2 A;  4DF4 A;  4WE1 A;  3V4I A;  5TKW A;  3MCP A;  3AAQ A;  5CY4 A;  3HJF A;  2GUI A;  2G8H A;  4IFV A;  3V9U A;  1D9D A;  3J7A P;  4DSJ A;  2RPI A;  5CZ2 A;  3V9S A;  3LDO A;  4WQ5 C;  5AQM A;  1JLQ A;  3BP8 A;  3ENB A;  5E41 A;  3T1Y K;  1NMD A;  4BY9 C;  5I9E B;  3PIO L;  3UKU A;  1V4S A;  2YKM A;  3R6M A;  3TAF A;  3P1G A;  4RTF D;  4DV7 K;  3G25 A;  5JMV A;  5HRP A;  4LFA K;  2YX6 A;  3OHR A;  2OYQ A;  2BGG A;  3A0I X;  4JHD B;  3MCA B;  4NCA A;  3OW2 M;  4Z4H A;  2Q0R A;  3SBG A;  3ENO A;  4OVL A;  1UWB A;  5CHI A;  3T19 A;  3S9H A;  4FJN A;  4BE2 A;  1U6Z A;  4RW9 A;  3SBT A;  3SMP A;  5FPD A;  2Q1N A;  5AZI B;  2YV0 X;  3SQ0 A;  4CGD A;  3NF7 A;  5IWA K;  1S6P A;  4LF8 K;  3LP1 A;  4M41 A;  1DGK N;  4GY2 B;  4BGB A;  4CEC A;  5BPM A;  4CJ4 A;  3CCR N;  3ZLJ A;  3AVK A;  3P5J A;  5EU7 A;  4YOV A;  2P1J A;  1U45 A;  1HUX A;  1RIL A;  4JKB A;  3OYH A;  1XC9 A;  3VQ6 A;  3ID6 A;  1W0H A;  3DLL L;  3DRR A;  3QBX A;  3VF6 A;  3MX5 A;  3THV A;  3IAY A;  2YJF A;  3SUN A;  3DWL A;  3NGZ A;  4B9T A;  5KPZ A;  4JS5 A;  3FFK B;  1NJZ A;  1SZ2 A;  2B4J A;  1VQM N;  4OPJ A;  3IFR A;  5BN9 A;  3I55 N;  1NNE A;  1LWC A;  3VEW A;  1Q9Y A;  4Y1D A;  4CHY A;  4Z4I A;  1DTT A;  3L2Q A;  5TKY A;  3R9P A;  4DKW A;  1U04 A;  4FLV A;  1EET A;  5LJW A;  4CF0 A;  4F3O A;  3VES A;  1EWR A;  3P31 A;  1NKB A;  5GIP A;  3DMJ A;  1JL1 A;  1QQN A;  3BF3 A;  2XY6 A;  4KV8 A;  4RW8 A;  4A57 A;  5FDL A;  1KCF A;  2WC9 A;  3CCJ N;  3E9L A;  4DTU A;  3AVG A;  2GBZ A;  3OYG A;  2QXL A;  1TKD A;  2D0A A;  4FXD A;  3THW B;  3L4Q A;  1KAX A;  3CJC A;  1RBV A;  4DTS A;  2E1Z A;  3S41 A;  4AHS A;  1LAW A;  2FLO A;  3MWP A;  5FPM A;  4LSN A;  1NK4 A;  5CE3 A;  1OH5 A;  3U3G A;  3LZI A;  3ISN C;  4DR7 K;  4C1N I;  4M3U A;  1IV0 A;  2JWL A;  1WSE A;  3OYB A;  3H3O B;  3LWM A;  3A5N C;  1VHX A;  1VSL A;  4OKE A;  3CJ1 A;  1TAU A;  4F4K A;  3D45 A;  1QQO A;  1RTH A;  2GTD A;  3H1V X;  3WNG A;  3QEX A;  4CEA A;  5KRS A;  4CFD A;  1YIT N;  1KAZ A;  1UA0 A;  2GWJ A;  5AQH A;  5GIN A;  2HHV A;  4LF7 K;  4PL8 A;  4EHU A;  4WYB A;  3VTH A;  3OVN A;  5AQP A;  5F0X A;  4KI4 A;  2NRH A;  4GNI A;  1VQN N;  2PZS A;  4UY8 O;  5FLX O;  5HL7 L;  4DQI A;  3QET A;  1UOC A;  3GE1 A;  4I6M A;  1QQM A;  4JK7 A;  2O8F A;  4CHP A;  4K8X A;  1BL3 A;  4GVE A;  1P90 A;  4AHT A;  1VRU A;  2GWK A;  5CYQ A;  2A42 A;  3KTQ A;  3KKS A;  2VWJ A;  2O4G A;  3M6G A;  4CHZ A;  4H8K A;  5SWM A;  4A61 A;  5GAD P;  4M3X A;  2KQ2 A;  4AHC A;  5DK5 A;  2VQE K;  1JLB A;  4IO9 L;  2HND A;  2YHW A;  4O0I A;  3CC4 N;  5C24 A;  2JLE A;  1RT5 A;  4EAH D;  3I8D A;  3LAM A;  3Q7B A;  1BO5 O;  2F9T A;  1WAF A;  2QK9 A;  3ZX2 A;  2VQF K;  2X74 A;  1EWQ A;  4JKG A;  3QML A;  1UAX A;  3HO1 A;  4MLH A;  1NU0 A;  3EL2 A;  1KRP A;  5BRH A;  4KHU A;  3OS1 A;  4FSV A;  1TGO A;  4BR7 A;  3MXJ A;  3WNE A;  3NCI A;  1K8A O;  4O4G A;  2G8W A;  4C8L A;  3K58 A;  1T05 A;  1BUP A;  4QS8 A;  4AIL C;  4LC9 B;  4F9O A;  4DSE A;  1S5J A;  1NG9 A;  3CCU N;  2QWL A;  2RF2 A;  4MDA A;  4IXC A;  3M3Z A;  5J2N A;  4HHT A;  1VSD A;  2WFB A;  3L2R A;  3ZX0 A;  3DOK A;  4DQP A;  1C0T A;  3CD6 N;  4PHT X;  3HP6 A;  3TTD A;  3DXK B;  2HVH A;  1UA1 A;  4C23 A;  4WFN L;  2F9W A;  3SI6 A;  4KFB A;  3PY8 A;  5J1E A;  4BVO A;  2VWB A;  4CJK A;  2VWK A;  1TK8 A;  3JYT A;  4O5B A;  1BCM A;  3G10 A;  4E7K A;  1QTM A;  3VA0 A;  5FRM A;  1Q82 O;  3DXM B;  1SAZ A;  3O9T A;  3EKU A;  1BHL A;  2P9N A;  4KHS A;  1IO2 A;  1WAJ A;  4WQ5 A;  3TSP A;  3P39 A;  3TSQ A;  4JKA A;  5HRN A;  3FZM A;  4H0O A;  4Q5V A;  1IH7 A;  2E4L A;  3VQ8 A;  1YUW A;  1C0M A;  3TSU A;  2VGN A;  3JAM O;  2ZGY A;  4FOI A;  4JI3 K;  3TAM A;  3DLH A;  2NRZ A;  5KGW A;  3TWH A;  2F8S A;  4CGH A;  4FM0 A;  3TTF A;  3D6R A;  5M1P A;  3ZET A;  4BRI A;  3P4I A;  4CHQ A;  3QER A;  1FW6 A;  4Z4G A;  4M42 A;  2FBX A;  1H1V A;  3PO4 A;  1OH6 A;  4B9U A;  2IGI A;  3CC2 N;  4YOR A;  1IG8 A;  4JNE A;  3V81 A;  3D2E B;  4CFB A;  2E5L K;  1L3S A;  3V9W A;  4CES A;  1JCF A;  2ASP A;  4KB1 A;  4OPK A;  2AJQ A;  3QO9 A;  3E1Y A;  3O4N A;  1F21 A;  2P9I B;  3SQ4 A;  1CLQ A;  3E66 A;  3CHW A;  2HMP A;  3U3Y A;  3SUP A;  1X1P A;  4IZ9 A;  3L8B A;  3SNN A;  4B3S K;  1XMO K;  4GKJ K;  4BR4 A;  4XH5 A;  5B8H A;  1RTD A;  4CJS A;  1J5E K;  3DOL A;  3RWU A;  1ZYQ A;  2Z1G A;  3VEY A;  4C8M A;  4CIG A;  4YFU A;  5HRR A;  3SZ2 A;  1C0F A;  4LY7 A;  4DCH A;  1K8K B;  3VER A;  3BEX A;  1RDW X;  2HW3 A;  2RE2 A;  2UU9 K;  1CZB A;  3LDN A;  4FK0 A;  4WCE L;  1JXB A;  4BRG A;  2BE2 A;  3HOT A;  3RSE A;  2KFZ A;  3MK6 A;  4M3Z A;  1C1A A;  3FR0 A;  4DMN A;  3CJB A;  4BWM A;  2NRV A;  3WXI A;  4W5Q A;  2E6M A;  4ID1 A;  4IWV A;  1BI4 A;  3O3H A;  3PUF A;  1HKC A;  3CF5 L;  4NYN A;  1Q9X A;  3QIP A;  4CZK A;  4Z4F A;  4KI6 A;  1QS4 A;  5AQF A;  2OPP A;  3FZH A;  1WSG A;  2A41 A;  1B9F A;  3VGM A;  3LDL A;  4J8F A;  3QEV A;  4BQZ A;  1T3V A;  2Y1J A;  4TSX A;  3SPZ A;  1JLE A;  3CCV N;  3AO5 A;  3DJC A;  2QWP A;  1DT9 A;  5C2D A;  3MEG A;  3I8B A;  4B9M A;  1CZA N;  3KLF A;  4CEE A;  3BF1 A;  3S3M A;  4CZF A;  4G9Z A;  2HHQ A;  1JLF A;  1SQK A;  4MO5 A;  4FM1 A;  2WON A;  3SYZ A;  2F4V K;  4PKG A;  4DR5 K;  3NGY A;  3WEE A;  3JS6 A;  4GVM A;  1XMQ K;  1N8R O;  3B6O A;  3JXU A;  3MXM A;  2WUS A;  3WXM B;  3VTI A;  5ELZ A;  2E2P A;  4KHP K;  5M1F A;  3RMD A;  4C8K A;  5EXW A;  1WSI A;  1BA0 A;  4CZI A;  4BG8 A;  4FJ7 A;  4K41 A;  1WBD A;  1YJN N;  1BWF O;  4I9Q A;  2E20 A;  2YNG A;  3ZSO A;  2YJE A;  4BR2 A;  2NZT A;  4QOZ B;  1HX1 A;  2P9L A;  1HKG A;  3DLG A;  4B3T K;  3QEW A;  3CME N;  1ASV A;  3KLE A;  1J5O A;  5HLF A;  3CQ8 A;  4DQ8 A;  3L4I A;  1ZBU A;  3L0Q A;  1M90 O;  4OO1 J;  4KTZ A;  2GV9 A;  3VF2 A;  4BRN A;  2NRT A;  5C10 A;  1K73 O;  4M3T A;  4H0V B;  4CEF A;  4CF2 A;  2KKZ A;  3C6H A;  4ID5 A;  1IG9 A;  3WQT A;  2QW9 A;  1SL2 A;  3K9K A;  4FJL A;  4DU3 A;  2FBY A;  1X9M A;  1QZ6 A;  3VMF B;  4H5W A;  4GW6 A;  1IKW A;  1RBT A;  2G8K A;  3SCX A;  3IUC A;  1N5Y A;  1BDG A;  4E1M A;  2D0C A;  3VQA A;  4CBX A;  1YT3 A;  1J53 A;  1LWF A;  3AO1 A;  3NBP A;  3H45 C;  3DRP A;  3P83 D;  4A5B A;  2QM1 A;  3LWL A;  1X3M A;  2YHY A;  3KWI A;  3V1Q A;  5GAG P;  4H03 B;  3AVN A;  4N47 A;  3V9X A;  2HOE A;  1C6V A;  1Q18 A;  3VQE A;  1N33 K;  3LAK A;  3KHY A;  1WSJ A;  4ELU A;  5T7B A;  2BTF A;  4E7J A;  3H46 O;  3C6A A;  4CJT A;  1QZ5 A;  4O44 A;  2OA8 A;  4BC3 A;  2UUA K;  3E01 A;  1IKY A;  2YNI A;  3OJU A;  4NXN K;  3WQU A;  1HMV A;  3C7N A;  4DTJ A;  2DFH A;  4DV1 K;  1U2V A;  2KFN A;  3CET A;  3DLR A;  5LY3 A;  5AQI A;  1Y64 A;  3WXJ A;  2O8F B;  4I9L A;  1TVR A;  1NGC A;  4B9S A;  4E1N A;  1RDB A;  4KH5 A;  3VQP A;  4PWD A;  4FWP A;  1QVG M;  2YHA A;  3RR8 A;  1G15 A;  2P9U B;  4DQS A;  4JN4 A;  2W40 A;  5LMN K;  4HCC A;  4MLE A;  3RMB A;  4H0T B;  3JSM A;  1BCO A;  3MWT A;  1VSE A;  4FWO A;  3VPZ A;  1HYV A;  2D0P A;  1VQL N;  4QCL A;  3SJJ A;  2BAN A;  3R8E A;  4BRA A;  1S1U A;  1XUP O;  3KWG A;  4CZL A;  2DTU A;  1HQU A;  3VQ7 A;  3C0B A;  3OYL A;  4FJG A;  1T7P A;  3E9O A;  5BRF A;  4FK4 A;  1JKH A;  4JKG B;  5FRN A;  3SAF A;  4DR6 K;  1RT1 A;  1TKZ A;  3VEN A;  2ITG A;  4FLX A;  4N76 A;  4J2E A;  2FXU A;  3O9S A;  4JI4 K;  5DM7 L;  2YI1 A;  1NMN A;  2G8V A;  2NRW A;  5CZ1 A;  2QWN A;  2KTQ A;  1RDC A;  2Z1I A;  3CCS N;  4ELV A;  4AHV A;  2UXD K;  1HNX K;  4BRF A;  3RVC A;  4I7F A;  3VET A;  4B9Q A;  3PX0 A;  4FO0 A;  3MEC A;  4JV5 K;  4Q0B A;  1YVN A;  3K0S A;  1TL3 A;  3ENH A;  2VG5 A;  3OYM A;  3EZW A;  5HBM A;  3CFP A;  4CD3 A;  2A1R A;  4G1Q A;  2HST A;  4H5V A;  1TKX A;  3D7E O;  4C8N A;  4FYD A;  3NMU A;  2RHK A;  3CYM A;  2GX9 A;  3B8A X;  2IOC A;  1JCG A;  3M8S A;  4X62 K;  3O6W A;  2OPR A;  5J2Q A;  3LDS A;  4IKF A;  4BE0 A;  3VN5 A;  3KJV A;  1HNW K;  4B1V A;  1EKE A;  3TAG A;  4B9V A;  2XRI A;  4ISE A;  1B9D A;  1GLB G;  1W9H A;  4IOX A;  4AM6 A;  1W2B M;  4KTQ A;  3OYD A;  4CZE A;  5F1X A;  4CCH A;  2B6A A;  2E6L A;  3D2F A;  4OGE A;  3H3N O;  1FXX A;  5AQV A;  4JI0 K;  2ZF5 O;  3GOI A;  3PX4 A;  4CK2 A;  3RMC A;  1NOZ A;  3BY5 A;  3AVM A;  3HSC A;  4M3R A;  5FRO A;  3IS9 A;  1NLV A;  2QKB A;  4DR2 K;  3RRH A;  5J2M A;  3DI6 A;  4JI5 K;  1XHX A;  4BRE A;  2I5J A;  4DSL A;  4W5T A;  1BOT O;  5AQK A;  4DSF A;  4HUF A;  4FJM A;  1QSS A;  4FWN A;  2BH1 A;  3BZK A;  4FWS A;  3THX A;  1J54 A;  2JGU A;  2PAV A;  4EFH A;  2V7Y A;  3AVA A;  1KSP A;  4YDU C;  3VGK A;  3EY1 A;  3K5L A;  2JWK A;  4AHR A;  4FJK A;  3K5O A;  4CZM A;  5AQQ A;  1ATN A;  5H1S Q;  3KK7 A;  3CM5 A;  4QS9 A;  1BQN A;  4KPY A;  3HRG A;  1YTA A;  3GBT A;  3PV8 A;  4FK2 A;  3J80 O;  3VQ9 A;  4QS7 A;  3UKR A;  3OYC A;  3J8A A;  1S1W A;  3AY9 A;  3SLC A;  3OTO K;  3A2F A;  4DLG A;  1U47 A;  3AVH A;  3F9M A;  3SV3 A;  4K43 A;  5AQT A;  1YI2 N;  1BG3 A;  4JKC A;  3RSE B;  4A2A A;  1T44 A;  2HHT A;  3RRG A;  3O5B A;  1K6Y A;  4Y1C A;  3AVL A;  3M8R A;  3QNN A;  1NK7 A;  4JKE A;  3S3N A;  4KHQ A;  1SKR A;  4ELT A;  4AM7 A;  1KVC A;  4JD2 A;  4NXM K;  3HXM A;  3AV9 A;  4BRL A;  5AQG A;  5KTQ A;  3TPQ A;  5BPL A;  5JLF A;  3CPW M;  3KIO A;  2UXC K;  5AQN A;  3ITH A;  1D9F A;  2Z1J A;  3CCQ N;  3O4W A;  1FKO A;  4DQR A;  1Q8I A;  3KK2 A;  4MFB A;  3AVI A;  2W42 A;  2E1Y A;  2ASM A;  2PFU A;  4QAG A;  3DYA A;  5FPN A;  4E3S A;  4HWI A;  1VQ6 N;  1TL1 A;  3O80 A;  3IKM A;  1W97 L;  2W6K A;  3CCL N;  2HMI A;  4BRQ A;  2HNZ A;  4WQ4 A;  2OZM A;  4JEP A;  4JKD A;  1RTJ A;  1TKT A;  1N32 K;  5JVG L;  2QA4 N;  3PSF A;  4YOW A;  4H5T A;  1IBK K;  1RBS A;  4CGF A;  4K8Z A;  3TAN A;  1KD1 O;  2FSK A;  4WFA L;  3LAL A;  3VOV A;  3CFR A;  4FWM A;  2Q97 A;  4BR9 A;  1ZBS A;  1EQY A;  1JLG A;  4KHY A;  4BAC A;  4JKF A;  4BDZ A;  3W3D A;  2IDO A;  3BDP A;  2IVP A;  4DLE A;  1HR0 K;  3SUO A;  1S22 A;  3ZSW A;  4OX9 K;  1OVY A;  2ZM6 K;  3ZT1 A;  1WB9 A;  4PY5 A;  4IFY A;  4H5R A;  1GLC G;  3L3U A;  4CJW A;  1SV5 A;  3TR8 A;  1CXQ A;  4HVJ A;  3NH2 A;  1GLF O;  1YHQ N;  1S1X A;  4BR0 A;  4DWI A;  3QES A;  3MEE A;  2QWR A;  4PUO A;  4E89 A;  2Q36 A;  2E2Q A;  4RCH A;  3D0P A;  3NFA A;  1NK6 A;  1WOQ A;  4JHD A;  3GL1 A;  3LDP A;  5EOY A;  4BRP A;  3TU5 A;  5KPR A;  4CIE A;  2QKK A;  4KHW A;  3U4L A;  2HBM A;  4WF9 L;  3WUH A;  3O9U A;  3ZT3 A;  3U8X A;  3MMV A;  1NGH A;  1TYQ B;  3ZT0 A;  5AZI A;  4RG8 A;  2FC0 A;  5CYM A;  3LM9 A;  4LF5 K;  3DRS A;  3VQ4 A;  4NLC A;  1DEJ A;  5AQZ A;  4XH4 A;  3K9J A;  3QEI A;  4CD1 A;  3MDQ A;  4N56 A;  4YY3 K;  2P9P A;  1S1T A;  4O5F A;  1U48 A;  1X3N A;  1QE1 A;  2HNY A;  3AVC A;  1K9M O;  1NGB A;  4JLH A;  4E7L A;  4DTN A;  2ETJ A;  4CZG A;  5MLC Q;  4LH4 A;  1YAG A;  4JI6 K;  5HRS A;  1GOC A;  3NE6 A;  4FW1 A;  3HL8 A;  2GUP A;  3J7Z O;  4KH4 A;  2VYP A;  3R1X A;  4DG1 A;  5ADX A;  4ILJ A;  2KLA A;  2OZS A;  1VQ9 N;  1Z05 A;  2KHO A;  3AGK A;  1T8E A;  1XHZ A;  3F5T A;  2ZJP L;  4YOT A;  3VEV A;  4AHU A;  3NHG A;  2BUP A;  3NAE A;  2VG7 A;  1JCE A;  4CJL A;  5AFU A;  3HYF A;  2D4W A;  4CGG A;  1X9S A;  1SUQ A;  4DR1 K;  1LAV A;  1SS6 A;  2F7T A;  3TI0 A;  2O8C B;  4Z0U A;  4NB4 A;  4FWR A;  3IRX A;  4CJU A;  3C7N B;  4CK1 A;  4DTM A;  4JS4 A;  1NJI O;  2HHW A;  1RGI A;  1XI1 A;  1IKX A;  1RT2 A;  2HBJ A;  1CZ9 A;  2Y1I A;  1HJO A;  1ZBI A;  5GAE P;  5C2F A;  4CEO A;  1S3X A;  3V1R A;  4H0P A;  5BRD A;  3ZYY X;  2NLX A;  4DFJ A;  4KB0 A;  3CXC M;  4DU4 A;  3EN9 A;  5J2P A;  4LD0 A;  4A59 A;  5E26 A;  3AO3 A;  2IIR A;  4KBO A;  4CJP A;  3EKS A;  1EP4 A;  3ZT2 A;  4H0X B;  1U4B A;  2QWO A;  3EE8 A;  3H6E A;  1BIS A;  4NLB A;  4X65 K;  4YHH K;  5KI6 A;  4CI6 A;  1NGG A;  4E0D A;  2G8F A;  5K14 A;  4OKK A;  2FBT A;  4NCG A;  4E7I A;  3SK3 A;  3TAP A;  1EO1 A;  4CEQ A;  1TUY A;  3K5M A;  2FBV A;  4FLT A;  4ICL A;  1JLA A;  4CHN A;  4ZTJ A;  3RR7 A;  4BDP A;  5BRE A;  4IEE A;  2BDP A;  3UKU B;  3SQ2 A;  1J6Z A;  4EHT A;  1XNQ K;  3LP2 A;  3ZSY A;  4B3R K;  3H1Q A;  1MA9 B;  1L3V A;  1QSY A;  4CGJ A;  4CJF A;  4YDU A;  4FZY A;  3WNF A;  3FGU A;  4I2Q A;  1KVA A;  2B5J A;  1A5W A;  4DFK A;  3PLA A;  4MQ3 A;  2YCH A;  3SAH A;  2DY4 A;  1NGD A;  2PYJ A;  2OTJ N;  2ZWH A;  4CJ7 A;  3M5R A;  3OJS A;  3PO5 A;  3W0L A;  2X78 A;  4RW4 A;  1X9J A;  3ID8 A;  4JK8 A;  4RW6 A;  1VSH A;  1VSF A;  4IBN A;  5AQJ A;  1VSK A;  4BVP A;  4BG9 A;  3LP3 A;  4IG3 A;  4CF1 A;  3MN5 A;  3EZ5 A;  1KTQ A;  3UB5 A;  2Q3S A;  3HT3 A;  3LPU A;  5HP1 A;  1B92 A;  1WBB A;  5A2Q O;  4CK3 A;  3ALY A;  4FZZ A;  3ZSX A;  4HUG A;  2ZJQ L;  3VEO A;  3UE5 A;  3DM2 A;  1N34 K;  2ITM A;  4CFC A;  4OLA A;  5C0Y A;  3TAE A;  4KTW A;  4DSK A;  1DKG D;  4BC4 A;  3D2F B;  3F9K A;  3BUZ B;  1T03 A;  1RCH A;  3V6D A;  2J4R A;  3T7Z A;  1E3M A;  3O3F A;  4HTU A;  1ESV A;  1RT7 A;  2X6S A;  1RDA A;  3VF4 A;  3QFU A;  1WN7 A;  1IJJ A;  3MN9 A;  4AF1 A;  4IJA A;  1ITG A;  3AA5 X;  3O9Q A;  1NK5 A;  2D0O A;  4CEB A;  2O8B A;  2V52 B;  4CJV A;  4FPB A;  3VQ5 A;  1KC8 O;  4CGI A;  4O8U A;  1ZBF A;  4CW7 B;  2EX3 A;  4CIF A;  4IO8 A;  4IFE A;  1VQ5 N;  3L2W A;  2FF6 A;  4K25 A;  1E4F T;  1C1B A;  3UKR B;  2OAN A;  3FZK A;  1O1W A;  1VAZ A;  3F2K A;  1RFQ A;  3LPT A;  4R5P A;  4X66 K;  2XY8 A;  2UUC K;  2RKI A;  2PYL A;  1I39 A;  3N4P A;  3OS0 A;  3EE9 A;  4ILH A;  4N5S A;  5JS1 A;  1BU6 O;  4GKK K;  4LF6 K;  1G99 A;  1S9G A;  4DB3 A;  3K5N A;  2ATQ A;  1SKS A;  4A5A A;  5AZJ A;  3A5M C;  4O0J A;  3WXK A;  3I0S A;  3HVR A;  3SV4 A;  5C25 A;  4JI7 K;  2W6L A;  1QSL A;  2QWM A;  3M1F A;  1YJ9 N;  4AQY K;  3OYE A;  1NKC A;  3OY9 A;  4FLY A;  1HYZ A;  3L2V A;  3AA2 A;  5AFU H;  4OJR A;  4XH1 A;  2DFE A;  3NF6 A;  4I6M B;  1VQP N;  1N36 K;  5F2R A;  3D2E A;  3KLI A;  1ZBL A;  4B1Y B;  4DV2 K;  3SQ1 A;  1S6Q A;  1LOT B;  4A2B A;  3LZJ A;  4FWL A;  3OBY A;  2A40 A;  2ZD1 A;  3CFO A;  2P9S A;  4JKH A;  4L3Q A;  3RMA A;  3ZSZ A;  1WSF A;  2CGJ A;  1C1C A;  3MED A;  4KHN A;  1NM1 A;  4DV4 K;  2KW4 A;  4CJE A;  3HP9 A;  3O1W A;  3MX2 A;  2G8U A;  4M3Y A;  3K57 A;  1IKV A;  3L2U A;  3CG7 A;  1K8K A;  4LFB K;  3ATU A;  2RN2 A;  2A3Z A;  4JAX A;  4DFP A;  1VSM A;  4CED A;  3MN7 A;  4BRH A;  2F96 A;  2Q2R A;  3QDK A;  1YJW N;  4W5N A;  4U7B A;  2IVO A;  2IVN A;  3EYZ A;  4CZH A;  2P51 A;  5DMR A;  3T1A A;  4BWJ A;  1GLD G;  1WUA A;  2I7P A;  1HPM A;  2CGK A;  4BQL A;  4CVN E;  2WBN A;  1RT4 A;  4DS5 A;  3THY A;  3ZX3 A;  1NJX A;  1VK0 A;  3FLC O;  3FZL A;  2YNH A;  1VSI A;  5KRT A;  1MU2 A;  1KQS M;  1XC3 A;  4FJJ A;  2YKN A;  3QLH A;  1NJW A;  1NK9 A;  2HHS A;  4FLU A;  4K0K K;  3A5O C;  3AA3 A;  3EEQ A;  2YNF A;  3O1B A;  3KLG A;  4DTP A;  1ASW A;  2R7Y A;  4KKO A;  2NRR A;  3E9P A;  3FZF A;  5GAH P;  4JK9 A;  4XIU A;  4NYF A;  3CER A;  3VQC A;  3HPO A;  3LL3 A;  1HNI A;  3QBW A;  2O8D A;  5FPE A;  1C0G A;  3PIP L;  4B9N A;  2AA4 A;  1XQS C;  1ATS A;  2I7N A;  2P9N B;  3SPY A;  4CF8 A;  3O9R A;  1RDU A;  1NOY A;  2P9P B;  1BA1 A;  1KLM A;  2IAJ A;  1A5V A;  3BZC A;  4DS4 A;  1S1V A;  3AAP A; 
#chains in the Genus database with same CATH homology
 1J9A A;  4DMN A;  4BWM A;  4B08 A;  4W5Q A;  1JLG A;  2E6M A;  4KHY A;  4BAC A;  4FCY A;  4E7H A;  4ID1 A;  4BDZ A;  1BI4 A;  3O3H A;  1SL1 A;  4EZ9 A;  2IDO A;  3F73 A;  1Z26 A;  3LP0 A;  3PUF A;  4DLE A;  3BDP A;  1GOB A;  3SUO A;  3O4Q A;  3ZSW A;  2X6N A;  4NYN A;  1RT3 A;  3DLE A;  4Z4C A;  3HVT A;  3ZT1 A;  4PY5 A;  1Q9X A;  3QIP A;  3HST B;  4KI6 A;  4Z4F A;  3NDK A;  3KK1 A;  4IFY A;  1QS4 A;  3KKR A;  1L3T A;  4F3T A;  3C6U A;  3L3U A;  2O4I A;  4CJW A;  1SV5 A;  2OPP A;  3TR8 A;  1BGX T;  1CXQ A;  4HVJ A;  1WSG A;  3NH2 A;  4DF8 A;  3RWU A;  1B9F A;  4H4M A;  3FFI A;  1S1X A;  4OKJ A;  3QEV A;  4DWI A;  3QES A;  4CEZ A;  3MEE A;  2Y1J A;  4TSX A;  4PUO A;  4E89 A;  3SPZ A;  4N41 A;  1JLE A;  4HUE A;  2XY7 A;  4JRQ A;  3KLH A;  3D0P A;  2IC3 A;  3NFA A;  1NK6 A;  1NKE A;  3V1O A;  3AO5 A;  3NH1 A;  1R0A A;  3VQQ A;  4HCB A;  4M3W A;  4IG0 A;  3OYA A;  4FW2 A;  2QXF A;  1BIZ A;  3MEG A;  4CIE A;  4E19 A;  2QKK A;  4B9M A;  4B9L A;  4KHW A;  1HYS A;  3KLF A;  4CEE A;  4W5O A;  3S3M A;  1HRH A;  4O55 A;  3ZT3 A;  1JLF A;  3AO2 A;  3V9Z A;  3UIQ A;  1QQC A;  1WLJ A;  2HHQ A;  4FM1 A;  4F8R A;  3ZT0 A;  4RG8 A;  2WON A;  3SYZ A;  5SZT A;  4EZ6 A;  2FC0 A;  3M8P A;  5CYM A;  4F2R A;  1A5X A;  3HPH A;  4DSI A;  3NGY A;  1L5U A;  3DRS A;  3VQ4 A;  1TAQ A;  4GVM A;  4PA1 A;  4ZTF A;  3QEI A;  2HB5 A;  3B6O A;  4N56 A;  1SKW A;  3NGI A;  3MXM A;  4CF9 A;  4DF4 A;  1FK9 A;  1S1T A;  1U48 A;  3DLB A;  4WE1 A;  3V4I A;  1NK8 A;  5CY4 A;  1QE1 A;  3RMD A;  3AVC A;  2HNY A;  4C8K A;  4JLH A;  4E7L A;  3HJF A;  2GUI A;  4DTN A;  2G8H A;  2OPQ A;  4IFV A;  2ETJ A;  1BI4 B;  4LH4 A;  1WSI A;  3V9U A;  1D9D A;  5HRS A;  1GOC A;  3NE6 A;  4DSJ A;  4FW1 A;  3HL8 A;  4FJ7 A;  2RPI A;  5CZ2 A;  3ZSR A;  4DG1 A;  3DLK A;  4RW7 A;  4CER A;  3V9S A;  2OZS A;  4I9Q A;  4KRF A;  1T8E A;  2YNG A;  1JLQ A;  4ELU A;  1XHZ A;  3ZSO A;  5E41 A;  4FZX C;  4QOZ B;  4AHU A;  4IDK A;  3NHG A;  1L3U A;  4EP4 A;  3NAE A;  2VG7 A;  2HHU A;  4CJL A;  3KD1 E;  3DLG A;  2YKM A;  3HYF A;  4CGG A;  1RTI A;  3TAF A;  3P1G A;  3OYJ A;  1X9S A;  1SUQ A;  2HHX A;  3QEW A;  4FVM A;  1LAV A;  3TI0 A;  1ASV A;  5HRP A;  3KLE A;  4Z0U A;  1J5O A;  5HLF A;  2D0B A;  2OYQ A;  3IRX A;  3M8Q A;  4CJ5 A;  4CJU A;  4CK1 A;  3CQ8 A;  4BE1 A;  4DTM A;  2WOM A;  2BGG A;  1ZBU A;  4EP5 A;  2OPS A;  4NCA A;  4Z4H A;  3K59 A;  4JS4 A;  1TV6 A;  2HHW A;  1XI1 A;  1IKX A;  4KTZ A;  4FJI A;  1RT2 A;  2GV9 A;  2XHB A;  4OVL A;  1UWB A;  4J2D A;  1CZ9 A;  1WNS A;  3KD5 E;  3T19 A;  2G8I A;  3NH0 A;  2Y1I A;  3S9H A;  4M3T A;  4FJN A;  1U49 A;  1Z25 A;  4CEF A;  4BE2 A;  4L8R B;  4RW9 A;  1ZBI A;  4CEO A;  3V1R A;  4CF2 A;  4ID5 A;  2YV0 X;  1IG9 A;  1FKP A;  3SQ0 A;  4CGD A;  3NF7 A;  4DFJ A;  3VA3 A;  1RBR A;  4KB0 A;  1S6P A;  1SL2 A;  4DU4 A;  3QIN A;  3LP1 A;  4M41 A;  5J2P A;  4LD0 A;  1NJY A;  3AO3 A;  3AVF A;  3AVB A;  4I2P A;  4DU3 A;  4FJL A;  2FBY A;  4CEC A;  1X9M A;  4B3O A;  4CJP A;  1I3A A;  1EP4 A;  3ZT2 A;  4CJ4 A;  3I0R A;  1BIU A;  3AVK A;  3P5J A;  5EU7 A;  3TAQ A;  1U4B A;  4GW6 A;  1IKW A;  1RBT A;  2P1J A;  3SCX A;  1U45 A;  2G8K A;  1N5Y A;  1BIS A;  1RIL A;  5KI6 A;  4E1M A;  2D0C A;  3OYH A;  3NF9 A;  3VQA A;  1YT3 A;  2ZQB A;  3AA4 A;  4BDY A;  1J53 A;  4JRP A;  1XC9 A;  2G8F A;  4E0D A;  1LWF A;  3VQ6 A;  3OYF A;  1W0H A;  5K14 A;  3AO1 A;  4OKK A;  2FBT A;  3NBP A;  4NCG A;  3TAR A;  2HVI A;  3DRR A;  4E7I A;  3DRP A;  3P83 D;  3TAP A;  4CEQ A;  3LWL A;  3THV A;  3IAY A;  2KZM A;  3KK3 A;  2FBV A;  3K5M A;  1EX4 A;  4J2A A;  4FJX A;  1LW0 A;  3SUN A;  4B9T A;  3NGZ A;  4JS5 A;  4ICL A;  1JLA A;  4FLT A;  4CHN A;  3V1Q A;  1NJZ A;  4ZTJ A;  3RR7 A;  4BDP A;  3AVN A;  3IG1 A;  2BDP A;  4N47 A;  3HM9 A;  3V9X A;  1HPZ A;  2B4J A;  4OPJ A;  3SQ2 A;  1C6V A;  3VQE A;  3RTV A;  1KFS A;  1LWC A;  3LAK A;  1WSJ A;  3LP2 A;  3ZSY A;  4Y1D A;  4CHY A;  4GMJ B;  5T7B A;  1Q9Y A;  4Z4I A;  1DTT A;  4E7J A;  3L2Q A;  1L3V A;  4CJT A;  1QSY A;  1LWE A;  4CGJ A;  4CJF A;  1U04 A;  4FLV A;  1EET A;  4O44 A;  4CF0 A;  4DFM A;  1TK0 A;  2OA8 A;  4FZY A;  3E01 A;  1IKY A;  2YNI A;  3OJU A;  2P5G A;  1HMV A;  1Y97 A;  4I2Q A;  3WNF A;  2DFH A;  4DTJ A;  4F3O A;  1NKB A;  4J2B A;  1KVA A;  2KFN A;  2B5J A;  1A5W A;  3DLR A;  4DFK A;  1N6Q A;  4MQ3 A;  4ZHR A;  3DMJ A;  2DY4 A;  1JL1 A;  4I9L A;  2IS3 A;  2PYJ A;  2XY6 A;  1TVR A;  4B9S A;  3OJS A;  1C0U A;  4KV8 A;  4LH5 A;  4RW8 A;  4E1N A;  2X78 A;  4RW4 A;  1RDB A;  4OGC A;  3ZSV A;  5FDL A;  4RW6 A;  3VQP A;  3OYI A;  1VSH A;  4PWD A;  1KCF A;  1VSF A;  2YHA A;  3RR8 A;  1G15 A;  4IBN A;  4DTU A;  1VSK A;  3AVG A;  2GBZ A;  3OS2 A;  3OYG A;  4DQS A;  1TKD A;  3LP3 A;  4IG3 A;  1KLN A;  2D0A A;  4CF1 A;  3EZ5 A;  4F2S A;  3ZCM A;  4FXD A;  1LV5 A;  1HJR A;  4HCC A;  3RMB A;  1KTQ A;  3JSM A;  1RBV A;  1BCO A;  2XO7 A;  4DTS A;  2Q3S A;  1VSE A;  3HT3 A;  1ZBH A;  3LPU A;  4AHS A;  1B92 A;  1HYV A;  5HP1 A;  1D8Y A;  1LAW A;  4QCL A;  4CK3 A;  3SJJ A;  3ALY A;  2BAN A;  4LSN A;  1NK4 A;  4FZZ A;  4NCB A;  3S3O A;  1VRT A;  1S1U A;  3ZSX A;  4HUG A;  3U3G A;  3OYK A;  3LZI A;  3ISN C;  3ZT4 A;  5I42 A;  4M3U A;  2DTU A;  1HQU A;  3MAQ A;  1WSE A;  3OYB A;  3DM2 A;  3VQ7 A;  3VQB A;  4CFC A;  3OYL A;  3LWM A;  4FJG A;  1T7P A;  4OLA A;  1YVU A;  4DU1 A;  3WNH A;  3TAE A;  4OLB A;  4FK4 A;  1JKH A;  4KTW A;  1VSL A;  4DSK A;  4OKE A;  5FRN A;  1TAU A;  1RT1 A;  1EXQ A;  4F4K A;  3F9K A;  3D45 A;  1T03 A;  1TKZ A;  1RTH A;  3T3F A;  3C95 A;  3WNG A;  3QEX A;  2ITG A;  4M45 A;  4CE9 A;  4CEA A;  1RCH A;  4FLX A;  3V6D A;  4N76 A;  5KRS A;  4CFD A;  3H08 A;  4J2E A;  1UA0 A;  3L3V A;  4CJQ A;  2HHV A;  3O3F A;  4HTU A;  2ZE2 A;  1CXU A;  3ULD A;  4KAZ A;  1RT7 A;  3OVN A;  2X6S A;  4KI4 A;  2G8V A;  5CZ1 A;  1RDA A;  4B8A B;  2PZS A;  3SUQ A;  3LAN A;  1WN7 A;  4FM2 A;  2KTQ A;  1RNH A;  1RDC A;  2Z1I A;  4ELV A;  3C94 A;  4DQI A;  4AHV A;  3QET A;  1UOC A;  4I7F A;  3PX0 A;  3QEP A;  4Q0B A;  1ITG A;  3MEC A;  4CHP A;  1RBU A;  4CJR A;  4K8X A;  1BL3 A;  3AA5 X;  1NK5 A;  1BQM A;  4AHT A;  4CEB A;  4KRE A;  3C6T A;  1VRU A;  1TL3 A;  2VG5 A;  4CJV A;  3VQ5 A;  3OYM A;  4FLW A;  5JS2 A;  1TK5 A;  5CYQ A;  5HBM A;  3CFP A;  2A1R A;  3KKS A;  3KTQ A;  4CGI A;  2VWJ A;  2O4G A;  5D3G A;  3CM6 A;  4G1Q A;  1ZBF A;  2EX3 A;  1RDD A;  1TKX A;  4B8C A;  4H8K A;  4CHZ A;  4CIF A;  4C8N A;  5SWM A;  2KQ2 A;  5HRO A;  4M3X A;  4FYD A;  2DFF A;  4H4O A;  4AHC A;  1HQE A;  2Z1H A;  3VQD A;  1WSH A;  5DK5 A;  3L2W A;  3CYM A;  1JLB A;  1C1B A;  3M8S A;  2IOC A;  3QIO A;  2HND A;  1O1W A;  4O0I A;  5C24 A;  2JLE A;  3O3G A;  4R5P A;  3LPT A;  1RT5 A;  2OPR A;  1ASU A;  5J2Q A;  3LDS A;  2XY8 A;  4BE0 A;  3VN5 A;  3KJV A;  4IKF A;  2RKI A;  2PYL A;  3I8D A;  3LAM A;  2VG6 A;  1I39 A;  3OS0 A;  1EKE A;  3TAG A;  4B9V A;  2EHG A;  2XRI A;  1WAF A;  1B9D A;  1W9H A;  4N5S A;  2LSN A;  1NK0 A;  5JS1 A;  1KVB A;  3G0Z A;  2QK9 A;  4KTQ A;  2X74 A;  1S9G A;  3OYD A;  5C42 A;  3K5N A;  2ATQ A;  1SKS A;  4CCH A;  2B6A A;  2E6L A;  1UAX A;  4O0J A;  3HO1 A;  1D5A A;  4OGE A;  3AVJ A;  1KRP A;  3I0S A;  1FXX A;  3HVR A;  3SV4 A;  4KHU A;  5C25 A;  4PQU A;  3OS1 A;  3PX4 A;  3ZSQ A;  4CK2 A;  1TGO A;  1NOZ A;  3RMC A;  1QSL A;  3MXJ A;  4FJ8 A;  3WNE A;  3NCI A;  4O4G A;  3AVM A;  4M3R A;  5FRO A;  4KO0 A;  3OYE A;  3IS9 A;  2XY5 A;  2G8W A;  1JL2 A;  3K58 A;  1NKC A;  3OY9 A;  4C8L A;  1T05 A;  4FLY A;  2QKB A;  1HYZ A;  3L2V A;  3AA2 A;  3RRH A;  5J2M A;  3DI6 A;  4AIL C;  1DTQ A;  1XHX A;  4W5R A;  4OJR A;  4DSE A;  2I5J A;  1S5J A;  4DSL A;  4W5T A;  2DFE A;  3NF6 A;  1RT6 A;  2RF2 A;  4CJ3 A;  1REV A;  4DSF A;  4HUF A;  4FJM A;  1QSS A;  3KLI A;  1ZBL A;  1S9E A;  2PY5 A;  5J2N A;  1J54 A;  4HHT A;  4CHO A;  3SQ1 A;  1VSD A;  2JGU A;  1S6Q A;  3AVA A;  1KSP A;  3AO4 A;  3EY1 A;  3LZJ A;  3K5L A;  4FLZ A;  4AHR A;  3L2R A;  4LSL A;  3DOK A;  2P5O A;  1C0T A;  4DQP A;  4FJK A;  3B6P A;  3K5O A;  2ZD1 A;  3CFO A;  3HP6 A;  3RMA A;  3HK2 A;  2HVH A;  3CM5 A;  3ZSZ A;  1UA1 A;  1BQN A;  1WSF A;  1C1C A;  2D5R A;  3K2P A;  3MED A;  3SI6 A;  4KPY A;  4KHN A;  1YTA A;  4KFB A;  3PY8 A;  5J1E A;  3PV8 A;  2KW4 A;  4CJK A;  2VWK A;  4CJE A;  4FK2 A;  1TK8 A;  3VQ9 A;  3HP9 A;  2YHB A;  3JYT A;  4O5B A;  2G8U A;  4FJ9 A;  4M3Y A;  3OYC A;  1BCM A;  1S1W A;  3G10 A;  4E7K A;  3K57 A;  3VA0 A;  1QTM A;  4DQQ A;  5FRM A;  1VSJ A;  3PX6 A;  3A2F A;  1IKV A;  4DLG A;  1U47 A;  3AVH A;  3QNO A;  3L2U A;  3CG7 A;  3SV3 A;  1X9W A;  3OYN A;  1BHL A;  4FJ5 A;  1QHT A;  4KHS A;  2RN2 A;  4DFP A;  1IO2 A;  1WAJ A;  1VSM A;  4DTR A;  5HRN A;  2HHT A;  1KFD A;  4CED A;  4Q5V A;  3MXI A;  3RRG A;  4Y1C A;  1K6Y A;  1IH7 A;  2E4L A;  3AVL A;  3VQ8 A;  1C0M A;  3M8R A;  2F96 A;  3BGR A;  3QNN A;  4W5N A;  3NF8 A;  1NK7 A;  3TAM A;  3S3N A;  3EYZ A;  3TAB A;  3DLH A;  1YTU A;  5I3U A;  4KHQ A;  1SKR A;  5KGW A;  2P51 A;  3TWH A;  4ELT A;  2F8S A;  4CGH A;  1KVC A;  4FM0 A;  5DMR A;  3HXM A;  3T1A A;  4BWJ A;  3AV9 A;  4DTX A;  5KTQ A;  3PO5 A;  1XWL A;  4UQG A;  4CHQ A;  3QER A;  3KIO A;  4CFA A;  4M42 A;  4Z4G A;  2FBX A;  4DS5 A;  1RT4 A;  3ITH A;  1D9F A;  3PO4 A;  4B9U A;  2IGI A;  1NJX A;  1VK0 A;  2NUB A;  2Z1J A;  3V81 A;  2YNH A;  1FKO A;  1VSI A;  4CFB A;  4DQR A;  1Q8I A;  5KRT A;  1L3S A;  4YNQ A;  1MU2 A;  3KK2 A;  1SL0 A;  3V9W A;  4CES A;  1DLO A;  4KB1 A;  4MFB A;  3AVI A;  2W42 A;  4OPK A;  1JXE A;  3DYA A;  4QAG A;  2AJQ A;  4FJJ A;  2YKN A;  3QLH A;  1NJW A;  4C8O A;  4E3S A;  3QO9 A;  1NK9 A;  2HHS A;  4FLU A;  3O4N A;  4DTO A;  1F21 A;  3AA3 A;  3SQ4 A;  1CLQ A;  2YNF A;  3KLG A;  3U3Y A;  1GOA A;  1X1P A;  3SUP A;  3L8B A;  3SNN A;  1TL1 A;  4DTP A;  1ASW A;  2R7Y A;  4KKO A;  4FJH A;  1RTD A;  4CJS A;  2F8T A;  3DOL A;  4NYF A;  3HPG A;  2HNZ A;  3VQC A;  4XIU A;  1ZYQ A;  2Z1G A;  3HPO A;  2HMI A;  2OZM A;  1HNI A;  4C8M A;  1HNV A;  4CIG A;  3U6F A;  4YFU A;  1RTJ A;  1TKT A;  5HRR A;  4AH9 A;  3SZ2 A;  4LY7 A;  4B9N A;  3ASM A;  2HW3 A;  1RBS A;  3SPY A;  4CF8 A;  1LW2 A;  4Z4E A;  1CZB A;  4CGF A;  1JLC A;  5KGX A;  3TAN A;  4K8Z A;  4FK0 A;  1JXB A;  1NOY A;  2BE2 A;  1KLM A;  2IAJ A;  1A5V A;  2KFZ A;  2KZZ A;  4DS4 A;  1S1V A;  2A1S A;  4M3Z A;  3LAL A;  1C1A A;  3CFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...