3QLHA

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase/ribonuclease H
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase,hydrolase/inhibitor
total genus 144
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qlhA05
2ATQA 3QLHA 3LPUA 1C0UB 3TAPA 2KFNA 1KHVA 2KZZA 2IJNA 1VSEA 4FW2A 3KOAA 4KRFA 3PY8A 4M41A 4DL5A 3QLHB 3LZJA 1ZBUA 2KFZA 5KT2A 5L1JA 2OZMA 1CSJA 4F3OA 1Z4UA 4K4SA 3KLGB 4J9MA 2IC3B 3GV5B 1D8YA 1KVAA 1CLQA 2JEIA 3VN5A 1LWEB 1QSYA 4E3SA 5FROA 3V4IB 2UVUA 3ICLA 3QZ8A 4HKQA 1RT3A 4FLYA 3ISNC 4I7FB 3QGIA 1VRTA 1RT6B 5KGWA 4BDZA 3ALYA 2HHVA 1N5YB 3ZT2A 3I0RB 1HNVB 3DOKB 3AVCA 5KT3A 3MR2A 3GILA 1L3UA 4KHYA 1S0NA 3TAGA 4WE1B 3L2WA 4MK7A 2E6LA 3FQLA 2OH2A 1TVRB 3KLFB 1JLAA 2DFFA 3MF5A 3AA2A 4FJ7A 1N48A 3OYHA 4I9QA 4N41A 3MAQA 2AGOA 2HHQA 4Z4GA 3KK1B 1S97A 1I39A 3OYAA 2OPSA 3SV4A 4FCYA 3CYMA 4W5OA 4I2QB 4N47A 3TAEA 3RR7A 3ZT4A 5F8HA 4BE0A 1JLGA 4M3XA 2IDOA 2ETJA 1U45A 4ICLA 2C2RA 2R7YA 4CE9A 3IGVA 2Y1JA 3K5MA 2I5JB 3IG1A 3NF8A 4WXWA 5KG0A 4ICLB 2R2UA 1WSHA 4NLWA 1WLJA 4J2AA 2E6MA 1QAJA 2YHBA 4LSNA 1C1BA 3IG1B 4ECVA 1HMVB 2F8EX 4N5SA 3DLKB 3HVWA 5DQGA 4ZMMA 4FLWA 1RCHA 4ZPDA 4QAGA 4Q8FA 2B6AB 3OL6A 1JKHA 3O3HA 1IKWA 5HRNA 3O3GA 2OPQA 3MTKA 3SUOA 1JKHB 2GIRA 3PUFA 2YNHB 3MEGA 3GIKA 1N4LA 3ZCMA 1EX4A 3FFIB 1L3VA 3MEGB 1YVFA 1KLMA 3KK2B 3OVNA 3OHBA 2BRLA 2YV0X 3TVKA 3L3UA 2EC0A 1I3AA 1J9AA 3CWJA 4HUFA 4IH7A 5DG9A 2HHXA 4G3IA 4KTZA 4IG0A 4K4VA 4EZ6A 2YKNB 3I5BA 4MKAA 1X9MA 3NMAA 2P1JA 1EETA 1QE1A 3SQ1A 2YKMA 4KAIA 4ZTFA 3E01A 3RBDA 1JXEA 1HYSA 4CHYA 3EZUA 3ZT3A 1HNIA 3CJ2A 5HRRA 1UA0A 4RW8A 1RDRA 4HHTA 4KV8A 2W8KA 3OLBA 3PZPA 3S3OA 3NCIA 4FBTA 3OHAA 3QINA 3BREA 3TR8A 3HM9A 4XPEA 4CEOA 4RUCA 1LAWA 3SPZA 1WN7A 4CHOA 4LH5A 5J2QA 4B9UA 4ED1A 5I3UB 3ZT1A 4CIEA 2DY4A 3PW0A 2FVCA 2RKIA 4FK4A 2C28A 1QAIA 3KD5E 5KFCA 4J2BA 4EYHB 4GMJB 4CECA 3I0SA 4TLRA 3G10A 4AHCA 4C8MA 3V9UA 1RT5A 5F8GA 4OGCA 4E7JA 5KFUA 4X2BA 3F73A 3U3YA 1S10A 3FRZA 3SUPA 1RT5B 3V6HA 2D5RA 1S1XB 4OLAA 3DM2A 2X6NA 3LP1A 1S6PA 3KLEB 3IRXB 4Z4CA 3BGRB 3TAMB 3G0ZA 4O0IA 1T8EA 1JX4A 3DM2B 3MR3A 4KTWA 1FKOB 3BDPA 3EY1A 3LP2B 3D5MA 5KTQA 2KQ2A 4F4YA 2RF2B 4Y3CA 5F8MA 3T5HA 4Z4IA 4F3TA 3OSNA 3U6FA 5KFWA 2IGIA 1D9DA 3NGIA 5KG2A 2HMIB 3OYIA 4H54A 3PR5B 4KO0B 2IAJB 2C22A 4CESA 4URQU 4BWMA 2PY5A 4CHZA 1RTIA 4NYZA 3H2LA 1JLEA 4MKBA 4YP3A 4J9PA 4Z4FA 5E41A 1HQEA 4ZVGA 1NK6A 4ED0A 3Q8RB 3KMSA 3KLHB 2KW4A 4F2SA 3DMJA 5FRNA 5L1LA 1HQEB 3ZSZA 3PO4A 1IKYA 4PWDB 3DLEB 1JXLA 4CJ5A 4L8RB 3DMJB 5DGBA 2IJFA 4DSEA 2AQ4A 2ITGA 4IRDA 1GOCA 2VG7A 4O4GA 3AO4A 1JLFA 4ZVFA 3UR0A 1BL3A 5CYMA 4KB7A 4O4GB 4OLBA 2WTFA 3GIJA 1JLFB 3DLHA 5KFRA 4DWIA 3CFPA 5CYMB 3AVLA 3SV3A 3ULDA 2EHGA 3HKWA 4KTQA 1SUQB 5FDLA 5DLGA 3RMDA 2XY6A 2UVRA 4E1NA 1QTMA 2EX3A 5CZ2A 5FDLB 3T3FA 5KFGA 5C42A 2D7SA 3CJ3A 1ZBLA 4E0DA 4J9KA 4Q5VA 4NLUA 5KFNA 2G8UA 1NK0A 4DQPA 1HQUB 1RTHB 4EZ9A 2GC8A 4ECSA 1RBRA 1T03A 1QSLA 3HP6A 4TQRA 3PV8A 2HNDB 2VG5A 3PW2A 3IN5A 4JV2A 4PQUB 5J2MA 2E9TA 3ITHB 4FZZA 4ECWA 3A2FA 2ASJA 5DG7A 1A5VA 4CGIA 3KHGA 3JSMB 3MECB 2AWZA 2C2EA 4ZP6A 3QYYA 1SKRA 2V0NA 1ZYQA 4FJ8A 3MXJA 4NLQA 4AHTA 4CGDA 2B4JA 3QIPA 4DF8A 3CDUA 5CY4A 5KFZA 2YNGA 1N6QA 4NRUA 3QIOA 3OS1A 4GVMA 3QIPB 1VSIA 3LP3A 4B9MA 4CEQA 4FS2A 1ITGA 2YNGB 4OVLA 1TL1A 4ZHRA 5KFKA 3HP9A 4C8OA 1LWCA 4WFYA 1O1WA 1RBVA 1TL1B 4Q0BA 2Z1GA 2HVHA 4B3OA 1DTQB 3KK3B 3D28A 1S49A 1RYRA 3QEIA 4G1QB 4I9LA 1I6JA 4FJ9A 4JRQA 4R0EA 4DFPA 3TAQA 4EO6A 4FJJA 2FBVA 5HBMA 4EEYA 1LW2A 2IOCA 3HO1A 3H4BA 1JLCB 3HHKA 1LW2B 3RBEA 3DDKA 3AVJA 3KD1E 4GC7A 4W5NA 2XI2A 3PX0A 1NJWA 4HTUA 4QWBA 4CJUA 4Q45A 1BQNA 3KLVA 4DEZA 1S1TA 4CERA 5C5JA 3QEPA 4ZP9A 4CIFA 3QO9A 4N56A 1WSEA 3O4QA 4O44A 2DTUA 1S6QB 1RT7A 2XGQA 3PX4A 5HRSA 4ECXA 3H5XA 4FLUA 2FLNA 4KB0A 2YHAA 4Y34A 2FLPA 4ED8A 4O44B 2W9AA 1NJZA 3RMCA 3DRPB 3T1AA 1UWBB 2BQ3A 3ASMA 3EZ5A 3PW7A 3GIMA 1WSIA 4U6PA 4HUEA 3M9NB 3EYZA 2R8GA 4QW9A 5KFXA 3NL0A 3AVGA 4JRPA 3OYBA 3AVKA 3M8RA 1DTTA 2IBKA 2JC0A 1BI4A 4JV0A 3P83D 1KHWA 4F2RA 4IQXA 4EO8A 2KTQA 4EP4A 3CFOA 4AHRA 4EP5A 4FK0A 1FK9A 3CO9A 2FLLA 1YVUA 4DS5A 4CF1A 2UVWA 5KFBA 4KBIA 4F4ZA 3RR8A 1S1VB 1CZBA 4MK8A 3K5LA 1NK7A 3QETA 3PR4A 2PZSA 1C0UA 1S4FA 5KFAA 3LP0A 3V6DB 1RDBA 2XI3A 3D0PA 2A1RA 1BQMB 4MQ3A 4FJLA 5KFMA 3LP0B 3KLGA 3JYTB 2IC3A 5HROA 3K59A 4CJTA 2ALZA 4K8XA 1K1SA 2O4GA 4NCBA 4J9OA 3AO1A 1LWEA 3V4IA 5HROB 3Q8SB 4J9NA 2VA3A 3NHGA 4ED3A 4I7FA 2Z1IA 3RMBA 1RT6A 1KVCA 4IG3A 4FJKA 1L3SA 3KKRA 1SH3A 4NYNA 3AO5A 3LPTA 1N5YA 4QWAA 3I0RA 1HNVA 4LD0A 3T19A 3N6MA 3SI8A 3DOKA 3NDKA 4IG3B 2G8HA 4WE1A 4KHSA 1TV6B 3NFAA 2XHBA 1TKDA 1TVRA 3KLFA 5HLFA 5SZTA 4AHVA 5HP1B 4CFDA 1NJXA 5HLFB 1QUVA 4N76A 3KK1A 1J54A 5KG5A 1L5UA 3OYNA 4DTMA 1EKEA 4I2QA 3L2QA 4RNOA 3MFIA 2XO7A 3S9HA 2E4LA 1KFSA 1C6VA 1QSSA 1EXQA 4KSEB 3G6VA 4DG1A 4IDKB 3K58A 3BSAA 2I5JA 2B43A 1TKXA 2QKKA 2D41A 1YT3A 3OL7A 4J9RA 4ED2A 1RA6A 4DG1B 3V1QA 4DQSA 4CEZA 3OYKA 1TKXB 1RILA 3GV7B 1HMVA 2F96A 4CJSA 3RB6A 3ZT0A 1SKSA 3DLKA 4DL2A 2NUBA 4B9LA 3AO2A 1MU2B 2WONA 5KG6A 3OY9A 4CJEA 3OL9A 4DTXA 2W9CA 2B6AA 1NOYA 3T5JA 2VWKA 2WONB 3HJFA 3CJ5A 1U47A 2D0BA 2W9CB 1NK5A 4ECQA 4QCLA 1Q9YA 3VQCA 5L1IA 3FSIA 2YNHA 1JLQB 1R0AA 5KFIA 4LQ9A 2XC9A 3FFIA 1R0AB 4CJRA 4CJFA 3KK2A 4RW4A 1SH0A 1FKPA 2V9WA 2Z1JA 4B9TA 3HXMA 4FJGA 3NH1A 3HVAA 3AA3A 3DRRB 4DU1A 3ISND 3RTVA 4RW4B 1FKPB 3L8BA 4DTPA 4O3SA 2YKNA 1VSDA 4NCGA 1G15A 4DFMA 3H40A 4O3RA 1RBSA 3DI6A 4BWJA 4CGHA 4Y1DA 4NCGB 1S5JA 1WNSA 1L3TA 3DI6B 2F8SA 1TAUA 4KE5A 1LWFB 3QNNA 4FYDA 1SV5B 5KFSA 5J2PB 4O55A 2G8WA 2Y1IA 5KG7A 4PUOB 1TKTB 5KFTA 4BACA 3OYCA 1IH7A 3CIZA 4KPYA 4KHRA 3MXIA 4ELUA 1UA1A 4ECZA 4IFYB 1HPZB 4ZPBA 2C2DA 5I3UA 3DOLB 2GV9A 4K4TA 2AU0A 5F9NA 4MIBA 3CQ8A 4C8LA 1NOZA 3V9WA 3C94A 1RT4B 4DTJA 2DFEA 4DTOA 3OS2A 3E51A 4CEEA 1EP4B 2FVQA 2UVVA 4KI4A 3LWLA 2KZMA 4TN2A 3NE6A 1C0TA 2FJWA 2XY5A 4CJPA 3HT3A 3SCXA 4YR2A 2YNIB 1RBTA 3ZSWA 1C0TB 4DF4A 3DYAB 3KNAA 4RUAA 4EBCA 1S1XA 3HVRA 4FJMA 3G6XA 2FBYA 1NKBA 2Z1HA 3KLEA 3IRXA 2QXFA 1IKVA 1VSLA 3BGRA 3TAMA 4OJRA 3ZSYA 4B9VA 4ECTA 3LDSA 3P5JA 4DQRA 1FKOA 1ZETA 5K14A 5KT4A 3LP2A 3AV9A 1IKVB 1IKXA 4CFAA 2RF2A 1VK0A 3RB3A 2BQRA 4FLZA 5KFQA 3TANA 5K14B 4QWDA 1RT2B 1IKXB 3OLAA 4RW9B 4CEAA 4CJWA 4Z4HA 1BIZA 4OKEA 1LW0B 4Z0UA 3H98A 3DRSA 2HMIA 5KFDA 1QS4A 4FJIA 2FBXA 4KO0A 3VQPA 1ASWA 4EBEA 1SH2A 2IAJA 3VA3A 4K50A 4I2PB 3SNNA 4K8ZA 3DRSB 4OKJA 4FVMA 3BSCA 4IRCA 3PW4A 3IS9A 4YR0A 2CKWA 5KRTA 4J9SA 3KLHA 2XGPA 4Y1CA 2W42A 3GYNA 1T3NA 3IS9B 2UUTA 4WXOA 4DQIA 2FVPA 2ZD1A 2G8FA 4PWDA 2RDJA 3DLEA 5EDWA 3SFGA 3V9ZA 4CJLA 2ZE2B 1KLNA 4CFBA 1WSGA 4C8KA 2ZD1B 4RW7A 2HHUA 4XIUA 1VSJA 4OGEA 3HPHA 1U04A 4DSLA 3HK2A 3PJXA 4M3UA 4YMEA 4RW7B 4DQQA 1S48A 4IH5A 3V9SA 3ZSQA 4J9QA 1U49A 4F8RA 3TABA 2XCAA 1CZ9A 1SUQA 3VQ6A 3SUNA 2BE2B 5EUHA 5DG8A 1OS5A 5KT6A 5C24B 3CJ4A 3OS0A 5KRSA 1S1UB 4EYIB 3RWUA 2IM3A 1T05B 4B8CA 4Z4EA 5JXSA 1VSHA 2VG6B 3QESA 3PHEA 2WOMA 3VQ9A 4FM0A 1HQUA 4M95A 1RTHA 3WNHA 4AH9A 1NJYA 4XPCA 2WOMB 4CF8A 2HNDA 3KJVB 3K57A 1NK4A 3HPGA 3P1GA 2FJXA 4PQUA 1TP7A 4HCBA 3ITHA 2RN2A 1Q9XA 3KTQA 4BE1A 3LANA 2OZSA 4AHSA 2D0CA 3OJSA 4M3TA 4B9NA 4DS4A 2IA6A 3AO3A 4ZVEA 3WNEA 4FW1A 3ZSXA 4QWCA 3JSMA 3MECA 4BDYA 4R8UB 3MFHA 1C0MA 2GBZA 4E7IA 1RDCA 1TK5A 3CG7A 4W5RA 1VRUA 4RG8A 3QEWA 2DPIA 4B08A 4DLEA 2HHSA 2RDIA 3V1RA 4IRKA 3I8DA 2V4RA 2HB5A 1VRUB 3H5UA 4ECUA 3WNGA 4Y2AA 5KFOA 3CDEA 3NF9A 3TQ1A 4M3RA 2XY7A 3SJJA 4KB1A 4O3OA 4UQGA 1NK9A 4F4WA 3SQ4A 5EWEA 2R2TA 5J2NA 2R8JA 1FXXA 3K5OA 4E89A 2XCPA 1DTQA 1JLBB 3KK3A 3C6UB 5J2NB 4IR1A 4EBDA 3SI6A 4G1QA 4URGA 4YQWA 4CGFA 1RTDB 2AJQA 3TWHA 4NLOA 4CJ3A 4KHWA 4YNQA 3M8SA 1JLCA 4M3YA 1HARA 3RB4A 1BGXT 3AVIA 5KT7A 4ELVA 4ZP8A 3PO5A 5L1KA 3HSTB 5KGXA 4J2EA 4TQSA 5KG3A 4K4UA 2QKBA 3NBPB 4WZQA 2O4IA 2QV6A 2YNFA 1JIHA 4KHNA 4TXSA 1HJRA 3SYZA 5JUMA 2YNFB 3L2UA 4ZPAA 2J6SA 4K4XA 3LAMA 1S6QA 4FXDA 4M3WA 3V81A 2R8HA 3I5AA 4ECYA 3OYFA 4K4YA 3OYDA 4DU4A 1UAXA 2BGGA 4IH6A 4IBNA 3K5NA 3V81B 3HVTB 3DRPA 1D1UA 2DFHA 1UWBA 1TK8A 5D3GB 2OPRA 2AGQA 4NLRA 4DFKA 3V6JA 2OPRB 4Y2CA 2DPJA 2HHTA 1ZTWA 3MEEB 5JS2A 5DQHA 1Q8IA 3H5SA 2W9BA 2W7PA 1HRHA 3OYEA 4O3PA 2I1RA 4OPKA 3DLBA 2E9RX 1S1VA 2AX1A 4FM1A 2W9BB 4OKKA 4ID5B 3NGYA 3TAFA 3V6DA 4DLGA 1GOAA 1RT1B 1BQMA 1REVB 5I42A 4E19A 1NNDA 1TAQA 1ZTTA 4KREA 2AGPA 1J53A 2JEJA 1C1CB 3JYTA 5I42B 4NRTA 2F8TA 4YFUA 3KLIB 3H5YA 3OYMA 3DLRA 3VQQA 3M8PB 3MEDB 3ZSVA 5DQIA 2ZKUA 4FJ5A 4TY8B 4FBUA 2ILYA 5KFLA 2JEFA 4TSXA 1S9EB 3I5CA 3BSNA 3NH2A 5DMRA 1YTUA 4ELTA 2HNYB 1NHUA 4E7HA 3C6TA 4BE2A 1RDDA 3QGHA 2G8IA 2RPIA 3OYJA 3VQ8A 2VA2A 3V6KA 4NLVA 3OSPA 3C6TB 1RBUA 2WK4A 4NLDA 1BIUA 1RTJA 1TV6A 3SUQA 4HCCA 4CCHA 3VQAA 1XWLA 3LZIA 3QEXA 5HP1A 4DTUA 1RTJB 1WSJA 4RNMA 1WAJA 2D3UA 1D0EA 1Y97A 1VSKA 3UPFA 3KHHA 3CJ0A 3G6YA 4FJHA 3DLGA 1RT3B 3NAHA 3AVBA 3NGZA 3G86A 1VRTB 3D45A 1U09A 2Q3SA 3S3MA 4DSIA 3VQBA 4AHUA 4FZXC 3DLGB 3NAEA 1KCFA 5F8IA 2FVRA 1GX5A 3VQDA 4PA1A 4NCAA 4IDKA 2JLEA 4TYBA 1A5WA 4DSFA 5EWFA 2ATLA 2A1SA 4E1MA 4FLTA 3KHLA 1J5OA 1ZBFA 3IAYA 1KVBA 1JLAB 3MR5A 2HNZA 1J5OB 3EPGA 4K4ZA 2FBTA 4LSLA 1WAFA 1SL1A 4FJNA 4OL8A 5F8LA 1VSMA 1MU2A 1RA7A 4C8NA 2HNZB 4DTNA 5CZ1A 3U3GA 4LSLB 1JL2A 4MIAA 3K2PA 3M8QA 2OPSB 3OL8A 1ASVA 2LSNA 5KFJA 4NLGA 3ZSOA 4YR3A 3M9OB 2R2RA 5DLFA 4CEFA 1KFDA 4CF9A 4CHNA 3V9XA 3M8QB 2V4QA 1KSPA 4CFCA 1JLGB 1JLQA 4H4MA 5KG1A 4CK1A 1XHXA 1B9FA 4FZYA 3SFUA 1CXUA 4NYFA 4FLXA 3B6PA 4H4MB 1Z26A 3LWMA 3NGDA 1NK8A 4LSNB 1CXQA 1C1BB 4JV1A 5KFPA 3RMAA 3DRRA 4KI6A 4DU3A 1BHLA 4TY9A 4DMNA 3UDLA 1WSFA 4Q43A 4GC6A 5KFYA 4JUZA 1IKWB 1T94A 2OPQB 4URSA 2X74A 1LWFA 4XO0A 2D3ZA 4CK3A 1XR5A 2JEGA 4QOZB 1SV5A 5J2PA 2BQUA 1TQLA 4DFJA 3KHRA 4PUOA 1TKTA 3PVXA 1RAJA 5T14A 4FLVA 1KLMB 3GV8B 2IMWP 2QE5A 1GOBA 1C2PA 5KFVA 4RNHA 4CF2A 1F21A 3KKSA 4DTRA 4IFYA 1HPZA 4FJXA 1U48A 1WNEA 4QPXA 3DOLA 4IG0B 5KG4A 1EETB 1QE1B 1RYSA 4IR9A 2FC0A 2YKMB 1RT4A 3E01B 1HYSB 1QQCA 2OPPA 1TKZA 4NLTA 3LAKA 1HNIB 4MH8A 2FVSA 4FK2A 4ZVHA 4RW8B 2HWIA 1EP4A 4KKOA 2OPPB 1TKZB 2R8IA 3N6NA 4KV8B 1ZBIA 4HUGA 3ZSRA 2W7OA 3VQ7A 4WFXA 4KKOB 1BCOA 2YNIA 4CHPA 1U4BA 3DYAA 3Q8QB 4CJKA 5J2QB 3H08A 1XC9A 4E7LA 1HYZA 1IO2A 2WHOA 2JC1A 3QZ7A 1TK0A 4Q44A 5SWMA 2JGUA 1X1PA 2PYJA 1RDAA 2RKIB 4WYLA 3AVFA 3RB0A 2IM1A 2GIQA 1NKEA 3I0SB 5JS1A 3NF6A 4CGJA 1QHTA 1RT2A 3VQSA 3MR6A 4RW9A 4JLHA 3RRGA 4O3QA 3S3NA 1LW0A 3QERA 1X9WA 3PJWA 2WCXA 3AA4A 4RU9A 3L2VA 3AVMA 4I2PA 3BSOA 2HVIA 4F4KA 2BR0A 4H4OA 4M42A 4O3NA 2WRMA 4DSKA 5KT5A 4H4OB 3LP1B 5C25A 1S6PB 4K4WA 4DL3A 1T7PA 3UIQA 2P51A 5KFEA 4IFVA 4IKAA 5C25B 4BDPA 3FQKA 3VQ4A 4IKFA 2HWHA 1ASUA 2ZE2A 1W9HA 4IFVB 5KFFA 4QW8A 3OYLA 4WZMA 4M94A 1XR7A 4AILC 2R8KA 4PY5A 4WYWA 1S1WA 5FRMA 3PW5A 3QEVA 5F8NA 1W0HA 1S1WB 1RTIB 5DK5A 1JLEB 1MMLA 3GQCA 5T7BA 2BE2A 4CEDA 1VSFA 3O3FA 4DL7A 3BR9A 5C24A 2BRKA 3QIDA 1S1UA 1X9SA 3CDWA 1IKYB 1T05A 3RAXA 4MFBA 1SKWA 4CIGA 3N6LA 4CF0A 4QWEA 4J2DA 2VG6A 4OPJA 1W25A 2FJVA 4MFBB 4LY7A 4HYKA 1N56A 3GIIA 2VG7B 3SQ2A 4KHMA 2GUIA 4JS5A 2XRIA 1SL0A 2OYQA 3KJVA 5HRPA 3L3VA 1D5AA 4CJVA 5EU7A 3VA0A 1TGOA 4KHQA 3HYFA 2R2SA 4M3ZA 4KAZA 3B6OA 4DL6A 4IOBA 4R8UA 4O0JA 3VQ5A 4FM2A 2W8LA 2D0AA 4NZ0A 2G8KA 3Q8PB 4F4XA 2HW3A 4J9LA 5C42B 3BJYA 4ZTJA 4NLXA 4B9SA 2XY8A 1ZBHA 5J1EA 3NAIA 3O4NA 3CM6A 4WFZA 2IM2A 3F9KA 3AVNA 1T03B 3OYGA 3SZ2A 3AVAA 3KIOA 5J1EB 4TYAA 2X6SA 2VG5B 4MK9A 2BANA 1RNHA 2VWJA 3SQ0A 3V1OA 2WB4A 5J2MB 3T5LA 3WNFA 3PX6A 3AA5X 1IG9A 2BANB 1HYVA 4RNNA 5DGAA 1JLBA 4CHQA 3C6UA 4B8AB 4CEBA 2OA8A 3CVKA 4DSJA 5F9LA 3M9MB 3MXMA 1RTDA 1YTAA 3UQSA 4NLSA 4HVJA 1GX6A 2P5GA 3FDSA 4W5QA 2CJQA 1XHZA 4O5BA 3L2RA 2IS3A 1N6QB 3BQ2A 5CYQA 3CM5A 4R5PA 4LQ3A 4H8KA 1A5XA 2X78A 2B5JA 4CK2A 1K1QA 4DL4A 3C95A 1LV5A 4ZHRB 3NBPA 5CYQB 4R5PB 1LWCB 3LALA 2B5JB 5EWGA 4U7CA 4Q0BB 1NHVA 4ED6A 1S0MA 4KHUA 5L9XA 3TARA 4ZPCA 1C1AA 4B3OB 2O5DA 4Q8EA 3H4DA 1IM4A 4ZP7A 3VQEA 3IGNA 1S9GA 2ZQBA 4E7KA 2ILZA 1S9GB 4FS1A 1NKCA 5HBMB 3HVTA 2XWYA 3RAQA 4NLPA 4ED7A 4DTSA 2P5OA 3AVHA 5D3GA 1S0OA 4M45A 4RW6A 1XR6A 5KFHA 3HL8A 3NKYA 4JS4A 1SL2A 1Z25A 1S9FA 1XI1A 4RNFA 5F8JA 2HHWA 1JL1A 4RW6B 1K6YA 3H59A 2IM0A 2HAIA 1BQNB 3EPIA 1S1TB 3MEEA 4F50A 2J6UA 5KI6A 3OJUA 3QO9B 1BISA 4KFBA 3QGGA 1JXBA 1RT7B 4NLYA 4O4RA 1DLOA 3CFRA 3KMQA 4KFBB 2UUWA 1KRPA 4LH4A 1DLOB 4ID5A 2G8VA 1LAVA 3THVA 4ECRA 1RT1A 1REVA 1UOCA 3SPYA 2AX0A 2J6TA 4GW6A 3T5KA 1C1CA 1B92A 3BQ0A 3QNOA 2BDPA 1D9FA 4RZRA 3KLIA 1B9DA 4CGGA 3RRHA 4CJQA 2ASLA 2E9ZA 2ASDA 4ID1A 3M8PA 2PYLA 3MEDA 1DTTB 1BCMA 4TY8A 1BI4B 2QK9A 3TI0A 1TL3A 3NF7A 1S9EA 4CJ4A 3BQ1A 1FK9B 2HNYA 1TL3B 3HPOA 4W5TA 1KTQA 3NH0A
chains in the Genus database with same CATH superfamily
1Y10A 2GUPA 3OVAA 3X3UA 3GFHA 2KFNA 4LF8F 3PY8A 4M41A 4DL5A 1BG3A 3TOQA 3CF5L 5KT2A 4UY8T 2IC3B 1B7YB 4CZFA 3H1VX 3VN5A 3VPZA 1LXNA 5FROA 2UVUA 1VS3A 1P9QC 2ZJPQ 2PMHA 2V7ZA 1N34J 4WP9A 1UJ5A 3D0HE 1RU1A 5LXRA 3ZZYA 2MEWA 5H1SQ 1AB8A 4A5AA 3MM9A 3EM1A 2RHKA 3FBCA 3DOKB 5ETVA 5IQ6A 2VOPA 2B9WA 5B0EA 5C0YA 3MM9B 4KHYA 1QAXA 5AQVA 4Y28C 3L2WA 4ED4A 4MK7A 1HWJA 1FDAA 2EK1A 4LF8J 1JLAA 3CCMN 2WVCA 2E7VA 4HACA 2E5LF 2AGOA 3CCSN 4ZCLA 4ISFA 1S97A 3WXIA 2OPSA 2CXEA 2OMOA 5AJ3K 1IJJA 3ZT4A 4QR0A 5F8HA 2CFXA 2IDOA 2ETJA 3CXCM 2HRUA 2C2RA 3THXB 3OFHA 4X65J 3IGVA 2Y1JA 3NF8A 2XMTA 3SAHA 1E6YB 2R2UA 4NLCA 1WSHA 4LSNA 1C1BA 3G9CA 1QY7A 4ECVA 1HMVB 2V8DA 2Q6BA 2AEMA 2EFQA 3HVWA 5LJVA 4ZMMA 2QWLA 3AGKA 1GLBG 4ZPDA 2CWKA 2FSJA 3TTDA 4QAGA 3ZX2A 5LSOA 2E5LJ 2B6AB 4ANEA 1QQNA 3O3HA 4RTFD 1O6XA 3O3GA 3FR0A 3OR2A 5J1PA 4H0PA 2LQBA 1XJWB 3HX9A 4X4UA 2H4WB 4USHA 3NOGA 2ZHBA 3GFZA 2VZ9A 2BYCA 5I9EB 1UFWA 1HKBA 1X5TA 4USVA 1EX4A 1FWKA 2AHOB 1K44A 1X4AA 1HKGA 5GMDA 3OVNA 3OHBA 2EC0A 3E9OA 1J9AA 3CWJA 4DUZK 2WUSA 5AQJA 2HSTA 3PYFA 3D2FB 4IG0A 5LT5A 2O8DA 4K4VA 4M5DA 3SQOP 3NMAA 1QE1A 4I64A 2N7CA 5JVGQ 1RBAA 1HYSA 1HWIA 3W9JA 2DGSA 3CJ2A 5HRRA 2QEXS 2K3KA 2VHGA 4HHTA 4KV8A 2OCEA 5B0GA 3CD7A 4C4WA 3TSPA 1U1QA 1FVSA 3T6BA 4DN9A 1PGZA 2MZJA 3HJVA 4GNIA 1Y5NB 4LH5A 5J2QA 1TTHB 3JS6A 4AUKA 4GKKF 2GVZA 2LMIA 3RYLA 2CQGA 5G0RB 2YQ3A 2YQ0A 1CEZA 1Y3KA 3TJ9A 1QAIA 4LF8K 4EYHB 2M9KA 1I94F 4GMJB 4CECA 4WBFA 4P7VA 5BRDA 3FZHA 2CADA 3TU5A 5M1NA 3CCES 3VEZA 2XYHB 3QPIA 2F3JA 4YDDB 4HI1A 4BHQA 4C8MA 1WHXA 3V9UA 1RT5A 5F8GA 3Q7CA 1S6OA 4E7JA 4X2BA 2C2ZB 3U3YA 5C2FA 2MKIA 1RT5B 3V6HA 1S1XB 3GDQA 4ETXA 1DEJA 2L3MA 3L09A 3EWGA 1HR0J 2QFIA 3UE2A 1S6PA 4LRFA 4YEAA 4KHPF 1ULRA 3G0ZA 1T8EA 1WG1A 1X7VA 3MMVA 3PFOA 4YDXA 3K9JA 1FKOB 3VVTA 5CHIA 1RZMA 1JJHA 1I94J 2BKPA 3DNCA 4F3TA 4DR2F 5KG2A 3IMXA 2HMIB 2E5LK 2CZVC 1GXUA 4CESA 1J6ZA 3M6XA 4NYZA 5JVHL 5CR4A 3H2LA 1JLEA 3H42A 3OVSA 1EQYA 3DHWC 4Z4FA 4ZVGA 1NK6A 2E1YA 2KW4A 2C3OA 3IBCB 5FRNA 1VQ6N 1U26A 4IOCQ 1JXLA 2PD1A 1FNXH 5DETA 4KGMA 3IR7B 3W0LA 3C7NA 4IRDA 1FXDA 2BEFA 3MM7B 1HBNB 2KN4A 1SQEA 2UXBJ 2CQCA 3C7NB 5AQWA 1HBOA 4DR2J 3HTVA 2NPIA 5KFRA 2NZCA 3AVLA 1HBMA 1R89A 2KRRA 2JJ4D 1U6BA 4OZNA 3U7JA 1PYSB 3B8AX 2EWHA 4BCAA 1HBMB 2UVRA 4E1NA 1QTMA 3HF5A 2ROGA 3S8SA 5CZ2A 5ETSA 2H65B 3AA8A 1DARA 2YWKA 4LF5J 3CJ3A 1ZBLA 2BABA 2OUGA 4J9KA 2E5HA 5DRKA 3ENBA 2V8VA 1RTHB 1YSJA 4ECSA 1T03A 4TQRA 3CCUN 2VG5A 3VGKA 3EE8A 1LEOA 1NZAA 3EJMA 3LA0A 1HNZF 3MDQA 2N3OA 3CJTA 4OJ3A 4B1YB 4CGIA 1EWRA 2CJKA 3MECB 2C2EA 3QYYA 3SMZA 2NSCA 5F0UA 3MXJA 4AXJA 2WBNA 4MYTA 4C3MA 2CPJA 4CGDA 1SZ2A 2VB6A 4JB8B 2HRTA 1VQ9S 3CDUA 4L3NA 5F0XA 2YNGA 1N6QA 2OP5A 1CJUA 4WFBQ 1NLKL 5BPLA 1VSIA 1ROFA 4B9MA 1DFDA 2BMBA 1JCEA 1O0PA 2YNGB 4OVLA 4DX8H 4GKKK 2Y0SD 1YRUA 2LLZA 1LWCA 1WC0A 4H0YB 5FLXY 4WIIA 3CF5Q 1OQ3A 2R7SA 2H5IB 1VLOA 3M6GA 1I94K 2PIIA 4B3OA 3CJ9A 4F25A 3KXDA 3ETMA 3QEIA 5IXUA 4FKXA 2XB2D 4HH0A 4JRQA 3M05A 2Z30B 2DISA 1Q79A 2JVRA 3E9LA 1V4TA 4C0HA 4M5KA 2IOCA 4FWOA 3HO1A 2B7CB 3H4BA 3O1WA 1LK7A 4KJIA 2OANA 3TSUA 2NPFA 3AVJA 1Q5VA 1U6ZA 4DV6F 4KHPK 3PX0A 1ZAVA 3DDNA 2OTJS 4B3MJ 2AF6A 2X1GA 4ZJQA 4PL8A 4DEZA 3W64A 5AZIA 4K8RA 4O44A 2ZWPA 2XGQA 2PMWA 2FY1A 2Z58B 2UXBK 3H5XA 2FLNA 4KB0A 2YHAA 4K7QA 3AXMA 4Y34A 4DR2K 4O44B 3GE9A 1WF1A 3JAMO 3MCPA 4ITSA 3FK4A 3VAGA 3K0JA 4FZVA 5BRFA 3PW7A 2GX9A 4USKA 3ENHA 4HUEA 2JNJA 4PR6A 3MDFA 3TSQA 3OTOJ 3E2EA 4ZLJA 2G4BA 3OYBA 4PWWA 4LF5K 3P83D 2H4YB 4IQXA 1AA1B 2KTQA 1BC6A 2AEFA 2JOQA 3A5LC 1H38A 2FLLA 1HKCA 3FSYA 5KFBA 2CVEA 1J5EF 1S4FA 4H0OA 1BQMB 1UTAA 4MQ3A 1ZM9A 3B78A 4DR6F 3JSYA 2KG1A 3KLGA 1M5OC 5HROA 4NI2A 1K1SA 2O4GA 2DIVA 4J9OA 1LWEA 2V51B 3V4IA 5HROB 1W7WA 1YK9A 3T1YF 3NHGA 3J81U 2OMLA 4I7FA 2CAJA 1L3SA 2YH1A 3KKRA 3ENVA 3A8KA 2OLWA 4ZITA 3I0RA 1HNVA 3CJ8A 1VQKS 2QW9A 2G8HA 4DCPB 3J7Z5 3ILJA 3NFAA 1TKDA 2QLXA 2XHBA 1QUPA 1TVRA 5HLFA 5HVFA 2LCWA 3RW7A 4DR6J 1CBKA 4JKHA 5HLFB 4LREA 2VASA 4N76A 3KK1A 1J54A 2XS2A 2FZKB 2LXIA 4OYOA 1KVIA 1EKEA 1X4EA 5C10A 3CJAA 4BS2A 4RNOA 3MFIA 3W9IA 1KFSA 2F5GA 3NMRA 4DG1A 1U6FA 1URRA 3QRRA 2G2YA 3M4XA 2GEMA 2QKKA 1M1HA 3C66A 4J9RA 3I56N 5LM7E 4G1PA 4DG1B 4FNIA 4Z94A 3EGNA 4CEZA 2C2OB 1RILA 3ZT0A 1SKSA 3DLKA 3FUYA 4W4MA 2IVFB 4DL2A 4B9LA 4KQZA 2HBLA 2WONA 2M7SA 1DQ8A 3QMQA 4ZDNA 5KG6A 3OY9A 4CJEA 3OL9A 4TVAB 2E20A 3FEXB 2GV1A 2VWKA 2WONB 2ZWHA 4HHHA 2VDIA 3POTA 3RUBL 1HWLA 4D3HA 2WVDA 4DV6K 1FERA 1RDWX 3FFIA 2OGUA 1R6VA 2YQ1A 3R5AA 1EWQA 2KHOA 4FWRA 1T6CA 1NGGA 5EGYA 1KAYA 3DRRB 2GAGC 4U7UK 1RGIA 4OYPA 4KGZB 2RRBA 2FHKA 4Y1DA 3AJ1A 1ZZFA 1TAUA 4KE5A 3O9TA 1LWFB 4FYDA 4O55A 1QQMA 2CA9A 3M2RA 4RU2A 5KG7A 3OW2R 4H4KC 3OBIA 5KFTA 1VGYA 3FVYA 4PHTX 4OZJA 4I4BA 4CH0S 3CIZA 3WZ0A 5H9EJ 4PXEA 3QT6A 1UA1A 5LJ3Y 4OJHA 4ECZA 1HPZB 5I3UA 2O01C 3CMES 3ET6A 3CNQP 2DY1A 1W2BM 3SBMA 2VU5A 4MIBA 3O9SA 2VJUA 3CQ8A 1J5EK 5E3CA 3MD1A 3P38A 1NOZA 2JDJA 2V63A 4DTJA 5J1NA 3ENAA 4OZ0A 3V2UC 1RAFB 1B0PA 2XMVA 4DR6K 3R1XA 1KR4A 4TN2A 3OD2A 4E2FB 4F26A 1U8SA 1RKIA 4IJAA 2YNIB 1HJOA 3DXKA 3KHYA 1RBTA 3ZSWA 3J7ZO 2WSEC 3T1YK 1MWYA 4ZS6A 4RUAA 4EBCA 4K2JA 3DXKB 4Y6IA 2HQFA 2FBYA 3PCOB 4QU6A 4X62F 2Z1HA 3KLEA 1XNQF 3BGRA 2JZ5A 1X4BA 1Q7LB 3O1LA 5FIIA 3MWTA 5KT4A 2AIRB 1SC6A 2R7OA 4JOUA 2BQRA 2P9NB 4NOHA 5KFQA 2AMCB 2GHVC 1QM9A 1X31C 2XMKA 3C15B 3NCQA 4OKEA 1SI9A 4Z0UA 1N36F 3A3PB 1JWWA 1UJ4A 4KO0A 2IDEA 3ZLJA 1LNQA 1VOMA 4K50A 3VA3A 4WJBA 4I2PB 4K8ZA 2KT5A 4OKJA 1R8AA 5GAHU 2MKKA 2VKRA 5HQMA 1MA9B 1Y7PA 3ZZZA 4USMA 4YR0A 3KLHA 2V6AA 1XNQJ 4FXVA 3TUIC 1T3NA 3ID6A 3LDNA 2G8FA 3PRVA 4PWDA 3DLEA 5EDWA 3SFGA 1R59O 4CJLA 4WQ4C 1KLNA 1WSGA 2VONA 1VSJA 4ZVRB 4LF4F 4DSLA 4YMEA 4DQQA 4IO8A 3I55N 2HHHJ 4BVPA 3FGUA 3AFGA 3TABA 4LFCF 3HM8A 2XCAA 2MKYA 1CZ9A 1XK8A 3R3TA 2NRWA 3VQ6A 3OBYA 4KPCA 2BE2B 5KT6A 5C24B 3C2PA 3CE8A 3RWUA 1VQ7S 2IM3A 3PSIA 3TVYA 5JXSA 3TNVA 2VG6B 2XTJP 1U2VA 2DCUB 1HQUA 4M95A 3AY9A 4FL9A 4CBWA 3CCJS 1U2VB 4CW7B 3P1GA 3FEZA 4K5RA 1TP7A 3SMPA 3ITHA 1Y11A 1Q9XA 1DT9A 3EVOA 4AHSA 4M3TA 1OY9A 3AO3A 5AQQA 4ZVEA 4QWCA 4YOUA 4JKGA 1WI6A 4BDYA 1C0MA 4JI8F 1FD8A 3DLJA 3LL3A 1I1GA 4LMZA 3QEWA 1S7IA 3M30B 5C7PA 3DC2A 4LUBA 4B3SF 2E1CA 2M8HA 3PJ9A 4CZIA 4Y2AA 3CDEA 3K7RA 5GAHP 2EFPA 2XMAA 4UQGA 1NK9A 4RWXA 3NGRA 3CUNA 3ATVA 2QYCA 1ATNA 2MZRA 1BLUA 5M1KA 2J0QD 2A42A 4E89A 4DHYA 2GMLA 2CZ4A 3WQPA 1JLBB 3GR1A 1X0PA 3G25A 5D0RA 4URGA 5CH7B 4CGFA 1YJ9N 1RTDB 2AJQA 2CPZA 3GOIA 2YJFA 4U67L 2CZ9A 1KP6A 2MXYA 4KHWA 1DZ5A 2PDAA 2U2FA 3KDNA 3RB4A 1BGXT 1RU2A 3DDIA 2B9YA 2GMJA 4ZP8A 3HSTB 4J2EA 4X62K 2BJEA 1EHWA 2C3MA 1XNQK 2ROPA 2MGZA 5IS2A 1P8GA 6AT1B 1X5SA 2QV6A 1ESVA 1XN9A 4IYQA 2WSFC 1AZSA 4PKGA 3QRQA 2Z57B 3LGNA 4ZPAA 1AZSB 2B9EA 3V81A 3GFYA 3I5AA 5ELZA 1WSRA 4DU4A 1UAXA 4IH6A 3K5NA 1R8PA 1N36K 3V81B 2JVOA 3DRPA 1YBUA 5D4NA 3CJKA 4CLFA 1BQXA 4M7XA 5IM0A 2E1MC 4NLRA 5ADXH 1OIAA 4J91A 1NHKL 5IM0B 4Y2CA 4UZBA 4XTTA 1RHRB 2OKQA 4ZVOB 2UU9F 4ZLNA 2DPJA 4FXWA 4EWTA 3MEEB 5JS2A 3J7YP 2FJDB 1Q8IA 5DQHA 1FRIA 2LXFA 2W9BA 1LWXA 2E7WA 1HRHA 3Q8VA 4LF4K 2R7WA 1K9MT 4FF4A 4JV5F 5M1FA 1S1VA 1P27B 3VZHA 4FM1A 1YHQN 2W9BB 1OJ4A 4OKKA 3NGYA 1FO1A 3I32A 5FPNA 2L41A 2YX4A 3Q24A 1GOAA 2DHSA 4E19A 1ZTTA 2AGPA 3WEEA 1C1CB 1H2VZ 2R7RA 2HFVA 3EMTA 4OYMA 3DLRA 1IWGA 2LDIA 3M8PB 4USTA 5KPTA 1AUSL 2UU9J 1S9EB 4ILMA 3QT8A 1MDUB 1YTUA 1NHUA 2M4MA 3HFZB 3IBWA 4E7HA 3C6TA 1NGCA 2IVPA 3W3DA 5H9FJ 1N8RT 4DUYJ 4F0MA 4JV5J 3C6TB 2L08A 2OIHA 4NLDA 2LP4A 1TV6A 5GADI 5KOWA 5DO2A 3VQAA 1XWLA 3LZIA 1BMQB 2V50A 3QEXA 4PKIA 3S1TA 1WAJA 4JNEA 4JI8K 3E1YA 1VSKA 2NQPA 4DN0A 2E2PA 3CCMS 5HATA 4B3SK 2ZNZA 2UUCF 3HOSA 1VRTB 2MQPA 2Q3SA 3ZZRA 3CCSS 4BRAA 1UVKA 3NAEA 3ZETB 3HHDA 5F8IA 4NCAA 1FE4A 1N32J 4FPBA 5EWFA 3HSJA 2KXHA 4FLTA 4E1MA 2WVEA 2AJ2A 4I6MB 1OKJA 5B0CA 2ZJQQ 4FYVB 2FBTA 4F67A 5ETLA 4OL8A 3NCPA 1R8CA 1RA7A 3ZTOA 4C8NA 3VHQA 1JL2A 3K2PA 4DMZA 3M8QA 4CLPA 3OL8A 3VAHA 3ZSOA 2R2RA 5AQFA 3M8QB 3N5FA 2PC6A 1FEEA 1WSVA 1XHXA 4FZYA 3SFUA 4DXLA 2GJIA 4O5FA 4A48A 4FLXA 5AQPA 3B6PA 1Z26A 3U8XA 1W97L 3LWMA 2VV5A 4QQBA 2V67A 2OI2A 4JV1A 1M1KT 3RMAA 2E2NA 5T7LA 2QMUB 1F5CA 4DU3A 4OZ2A 2K7KA 2M2BA 2B4PA 3P49B 2KXFA 4JUZA 2CJXB 1IKWB 2N7YA 5RUBA 4RLEA 4XO0A 2JEGA 3WIUA 4FSVA 2ZJRL 3F2KA 3PEJA 4LSZB 1H74A 3EGVA 4DFJA 1T9XA 3KHRA 4ETZA 2DXDA 1TKTA 4FLVA 1KLMB 1ZA2B 2UU9K 3BGUA 3LGMA 4DV2F 1WDTA 2KDOA 1C2PA 4CF2A 3KKSA 1PBUA 2G0JA 4IFYA 4FJXA 1WNEA 4QPXA 3DOLA 5H9FK 4JV5K 2KYZA 3P45B 3LQVA 4IR9A 2M5YA 2FC0A 2YKMB 2CUYA 3E01B 1XBWA 1F3VA 1TKZA 3M6UA 4NLTA 1TMJA 4C8ZA 1EP4A 1NGFA 1TKZB 1ZBIA 3EVWA 4HUGA 5F1XA 2DNYA 4WFXA 1REGX 1BCOA 3DGPA 3MMBA 1NGJA 4DPOA 3TW0A 3DYAA 3Q8QB 3UN2A 4QBUA 4DPYA 4CJKA 3QWPA 1T3VA 1TUYA 1TL4A 4E7LA 1HYZA 1LFWA 3KNGA 3HI0A 4BC7A 2JC1A 3OXLA 1IBLF 1N32K 3TZWA 2PYJA 2KRBA 2MKHA 5BRHA 3E8OA 5AQYA 4OYWA 3RB0A 5ETPA 1BDGA 3VAFA 2DRBA 4RW9A 2MTLA 4KC5A 1K47A 1YG0A 1EQMA 4S0MA 4C11A 3AB2B 2WCXA 2FC8A 3BB5A 4LR7A 4DR3F 3ZTPA 1BHNA 4Y2IA 2Q31A 2DTJA 2A2CA 3AVMA 2HVIA 3O9QA 2UUCK 2F63A 4AFFA 3M8ZA 1XC3A 4K4WA 1IBLJ 4KBOA 4CLKA 3UIQA 1FRLA 2QL9B 4AQYJ 5A6WA 1Z1ZA 4H0TB 2NXNA 3IRWP 1NG9A 1VBYA 2FGOA 4PABA 3GJQB 5KFFA 4M5JA 1FFSB 1VQ6S 4H5VA 4AILC 2R8KA 3W8PA 2Z8QA 5DZ6A 4WYWA 1S1WA 3QEVA 4EUVA 2QWQA 3L3CA 1HLUA 1S1WB 2CJYB 1T11A 3C6AA 1DY3A 4P72A 1UFLA 1TL7A 1MMLA 4Y65A 2P9LA 2HGMA 4DV5J 1VSFA 4A8SA 2HS3A 3T41A 1TL7B 3H7HB 2BRKA 2ATCB 3P96A 4CH7A 1X9SA 1IKYB 1T05A 2IHR1 4MFBA 3TQEA 3RAXA 3F41A 4BRCA 4HT7A 4MFBB 3SEOA 4BR2A 2W6LA 5ADZA 3SQ2A 2D74B 2E88A 1U1MA 2ZBQA 3L7PA 4LF6J 3L3VA 5HRPA 1SVDA 5GAEU 3D6HB 4PYDA 1TUGB 3B6OA 2MQ8A 2QA4G 4HWIA 2YHYA 2DT9A 2KL8A 4C8YA 1Y00A 3GR0A 2BE9B 2QA4N 2J5AA 4NZ0A 8ATCB 1YJWS 2IVYA 2F7TA 4J9LA 5C42B 3UN5A 4ZTJA 2YXLA 2FSKA 4BBYA 4B9SA 4DV2K 3O4NA 4OPAA 3JQJA 1NGAA 4WQ5A 2BOAA 2IM2A 2YKPA 3KIOA 1WC4A 2XMWA 5L39A 1WB9A 3G8QA 2VWJA 3TO8A 4DV1J 2DGUA 3PX6A 2BJ7A 2VQEJ 1IG9A 3PLAA 5DGAA 4CHQA 1RTZA 3OPKA 3H8YA 4DOZA 2O8FA 5F9LA 1C4AA 3BEXA 2R9LA 1D09B 3FDSA 2FYXA 2CJQA 3L2RA 4LR9A 2XSFA 5FLXU 2HQGA 3BQ2A 1YJNN 3W5ZA 5F41A 3CJCA 2EW9A 4C3KA 4H8KA 1L3KA 3NG8A 1Z05A 4DL4A 1IBLK 3MMAA 4ZHRB 5BXIA 3NBPA 3A1YG 2V9KA 3MMAB 2B9XA 5AQSA 1NHVA 2RD5C 1HNWF 1S0MA 4MKVA 5AFUA 4KR0B 3J7AN 4C23A 1CVJA 2CQBA 2O5DA 1ZXOA 4Q8EA 3H4DA 1HI8A 2M0GB 1GMVA 3IGNA 1S9GA 5AQMA 5T41A 4PAAA 2ZQBA 1SKUB 1PG5B 4OYAA 2ILZA 1S9GB 4DR3K 5HBMB 5GAEP 3EO3A 4LF9F 5ETNA 4ES1A 1IWAA 4ZPWR 4DV5K 3RAQA 2FUG9 3AVHA 2E5JA 1U1NA 3WBZA 3OUYA 5A8KA 1QZ5A 1SL2A 1Z25A 3ZFVA 3OUYB 3H59A 4OI4A 4CT9A 1RISA 3EPIA 1VQ4N 1VAZA 1S1TB 1HNWJ 4F50A 2J6UA 1HD1A 5KI6A 3OJUA 4C1NK 3PXGa 3QO9B 1BISA 3QGGA 1QVFM 4FF3A 1X5OA 4NLYA 4J7CA 2Y0BB 3TVZA 2UUWA 1KRPA 3VERA 3WDOA 4LH4A 3HHNB 3GG4A 3F56A 4ES2A 1LAVA 3THVA 3CT9A 4LF9J 1G7CB 2AX0A 5F3TA 4CT8A 5DS7A 4JKDA 5MLCV 4M5NA 4UQTA 4RZRA 3IWLA 3KLIA 1U2FA 2RT3A 2Z2ZA 4CJQA 1ICEB 1ATSA 3JAMY 2IDLA 1BI4B 4CZMA 1ILYA 3BQ1A 2HNYA 1YJVA 1DBDA 3KJQB 2GIFA 3HPOA 1FE0A 2KZZA 2IJNA 4HVZA 2FLOA 2ZJRQ 3LZJA 2W2PP 5H1SV 1UVNA 4J9MA 3LF0A 3R1LA 1QSYA 2KYXA 5GINA 1TR0A 4FLYA 1FNOA 3ISNC 3QGIA 3BGFA 3ALYA 1N5YB 2RQ4A 3DHXA 4BR4A 3AVCA 3FEYB 4CZCA 4OFZA 4WE1B 2C3UA 1WELA 4JK9A 4LRCA 2OSRA 1A9NB 4PKHA 2OH2A 2W6KA 1FESA 2DFFA 4PKDB 2B4UA 4OHWA 1N48A 4PXBA 3I56S 4I9QA 2O8BB 4V19S 4N41A 2FSNA 2HHPA 2DK2A 3MAQA 2RJZA 2HHQA 1AFIA 2G2OA 3M32A 3SV4A 4DX7A 3CYMA 1YI2N 3RR7A 3K8VA 4FF1A 1IQZA 1YX2A 3K5MA 4IDHA 2I5JB 3IG1A 1WDDA 4DV0F 1HNWK 2VPWB 3HZGA 4J2AA 2YHBA 5LMNF 3IG1B 1U1LA 2HFNA 1RHQB 5DQGA 3WXJA 2JRSA 3DKDA 3CJ7A 2JWLA 1MROA 2W4CA 4IOXA 4LF9K 2BJ8A 4NEYA 3MTKA 1W7AA 1H6KX 2GIRA 3VEYA 4H5RA 2YNHB 2V4JA 4P52A 5IT9Y 1N4LA 3BV8A 4BGAA 4F7VA 4ILLA 2V4JB 2DXEA 2CPFA 2BRLA 2YV0X 3L3UA 4OIXA 1I3AA 1RAAB 1X0FA 5LMNJ 4IH7A 4HUFA 2EPIA 4I69A 4AL6A 2HHXA 4KTZA 1RACB 2GX8A 2HVEA 2VFUA 2GGPB 1EETA 3SQ1A 1Q86T 4ZTFA 2AZ3A 5E2QA 3EZUA 3S01A 3EGZA 4RW8A 2IYIA 1RDRA 4HTJA 3ID8A 3TYTA 4JK8A 3NCIA 3BREA 3HM9A 4XPEA 4HHJA 1BO5O 1K8KA 5BYSA 3MPVA 5E5NA 4D3GA 4AM7A 4DCOB 1VFJA 3O08A 2P9UA 4CIEA 2DY4A 4J9UE 2UYTA 1S57A 3CO0P 4GV6A 3PW0A 2RKIA 4FK4A 3QT7A 2C28A 5KFCA 2X1BA 3OQ2A 2C2MB 1MWQA 2HFOA 1NM2A 3UCZP 4ERDA 3I0SA 3G10A 4AHCA 4XK8C 2P9EA 1VQ8N 1N33F 5JMNA 2CPIA 1ZM2A 1WBDA 3D2EA 3RBZA 3F73A 2NNWA 4BG8A 1DHMA 2HGNA 1RWWB 3G82A 3D2EB 2DBBA 3DM2A 2X6NA 3OV7A 4Z7YA 3KUHA 3G71N 2HGLA 2QYGA 3TAMB 2PE8A 3DM2B 3MR3A 2DNLA 4KTWA 1CULA 5FPEA 3EY1A 3LP2B 3D5MA 3S41A 1UW4A 2KQ2A 5DM6L 3NMUA 4F4YA 2RF2B 2CVIA 1CULB 3UNGC 1Y9OA 5F8MA 3BP8A 4IQMA 4Z4IA 2R7VA 3EXYA 1PC4A 2OEKA 1P90A 3F0NA 5THWA 2GS8A 3C3LA 4F9OA 1NSPA 3OYIA 3DFEA 3OXFA 3IM8A 1RHMB 2A5XA 5TKWA 2XMJA 2DRAA 2CPHA 4J9PA 1FJ7A 2ZDOA 4YN3B 3I55S 3Q8RB 2V2ZA 3KMSA 4CZEA 2VYPA 3TZXA 2IIHA 2M3DA 3TUZC 2ADCA 5LJWA 1R6YA 4DV0K 2F4FA 2FB0A 5DGBA 1TFWA 2IJFA 5LMNK 1U1RA 4LBHA 2D4WA 2ITGA 1GOCA 3EXCX 5IT0A 2R4FA 3CDBA 1YRTA 3QATA 3UD5A 2HFUA 3O8WA 4ZVFA 1SB6A 1U0HB 1M5PC 3SQGB 4ILGB 3R6MA 2WTFA 3GIJA 2HVZA 3N0VA 2MPUA 2R7QA 2OD4A 1ZAWA 3ULDA 1SC1B 4KTQA 5DLGA 3MPDA 2XY6A 4GKJF 2P9PA 2EX3A 3T9ZA 4BQZA 2RILA 1WTBA 3FZKA 4L72B 3P6YC 4K25A 2N4DA 2D7SA 1D8ZA 1T9YA 2Q1LA 2HG4A 4OJGA 2P9PB 2RRAA 3PYDA 1OH6A 4E0DA 4B3RJ 1UVIA 4YHHJ 4ZOSA 4RUHA 1NK0A 4IOAQ 4EZ9A 2Q3PA 1S3XA 3PEHA 1QSLA 3HP6A 4YDUA 3TZZA 1RGVA 5CD4A 4JV2A 3DXBA 2VFRA 3GU0A 4CO1A 4PQUB 5J2MA 2E9TA 3N4PA 1RCOB 4FZZA 4ECWA 3M1VA 3PFEA 2P9KA 3W2VA 3KHGA 4HH1A 2AWZA 4DV4F 2DNRA 1VI7A 1ZYQA 2RU3A 3P5TL 1GLAG 4FJ8A 2P9KB 4NLQA 1AUDA 3R97A 4WKRA 3QSYB 4K43A 2E44A 5CY4A 4X4SA 2E1RA 3TEHB 4KGKA 1MSWD 3HFVA 1YJ9S 3LP3A 1TUWA 1TL1A 1RWOB 1X4HA 3HP9A 4LF1A 4Y00A 4WFYA 3BKFA 2W2MP 1TL1B 1WOOA 3NVMA 1ATRA 3T1HF 3BM7A 1DTQB 4G1QB 4I9LA 1NAQA 4PG7A 7FDRA 1N33K 2YVSA 2KM8C 4MO4A 4R0EA 4XAKA 2DR5A 1KQGB 5E33A 1ZZNA 3HCXA 3TAQA 3CCZA 2IVOA 3NGTA 2E1ZA 2V2VA 4BROA 1XMOF 4PQAA 2FZCB 3PYGA 2I9SA 1FF2A 1VJWA 3HHKA 3RBEA 3DDKA 2BVZA 4MTPA 4H0XB 3DGVA 1NJWA 4CJUA 3H46O 4X4VA 1B0TA 2E2QA 1BQNA 2D0PA 5C5JA 3EL2A 3R5JB 4N56A 3B4MA 4PCQA 3R8YA 1MMDA 2I7PA 5HRSA 4ECXA 3DXMA 4IEIA 2F4VF 2A2DA 5C2DA 3WUHA 3DXMB 1QLNA 2VODA 3T1AA 1OSCA 4QR2A 1XMOJ 3MMJA 1RABB 1GLCG 1JJCB 3GIMA 3BO4A 1U0SA 4U6PA 3M9NB 3FZFA 3EYZA 2QMXA 2R8GA 3U27A 1H0HB 2QO3A 3AVKA 1DTTA 3FZMA 1U1KA 4JV0A 4JD2B 1KHWA 4ZVSB 1RUSA 4AHRA 3SCIE 1FK9A 2HEKA 3CO9A 5C2CA 1LK5A 1Q86O 4WKYA 4CF1A 3RR8A 4KBIA 2O8CB 1CZBA 3PR4A 2F4VJ 1PCAA 1S59A 2PZSA 1VCTA 2ZH9A 4DV7F 1C0UA 4R79A 5KFAA 4OX9J 2XI3A 2KT2A 2X7IA 3JYTB 3OR1A 3K59A 4GKJK 4CJTA 4K8XA 2CPXA 3AO1A 1DJ0A 1U02A 2KI2A 3DOMB 3LW5C 1RT6A 3CCQN 4FJKA 4N8OA 4NYNA 4HLBA 4EMDA 2K3IA 4HT5A 4LD0A 1X3NA 3NDKA 3HMJG 1AW0A 2GWJA 4O8UA 3R9LA 2KU7A 3GMGA 2QGFB 3KLFA 3ISZA 4DV4K 3NXZA 3M8YA 1GEHA 2W24A 1KDNA 5KG5A 1L5UA 4DTMA 2HZVA 2KT3A 1QVGM 4I2QA 4JI6F 2XO7A 2G1HA 3CPEA 4B17A 3BO3A 2D1KA 4USIA 4RL1A 3FLCO 1EXQA 1YZ6A 4KSEB 4IDKB 3K58A 3IAM9 2VH7A 1RA6A 3V1QA 5GAGI 4C3LA 2B56A 2HK3A 1WHYA 4FVCA 4CJSA 2HBQB 3R5DA 1VBXA 3W66A 3JS9A 5ETOA 1VHIA 4DR1J 1MU2B 3AO2A 2A0FB 4RUBA 2W25A 4E98A 3MN5A 2FJAB 3VGVA 2OO4A 1NGBA 3T5JA 3HJFA 3CJ5A 1XMOK 1U47A 2D0BA 3GJRB 1Q9YA 4JK7A 2BOPA 3RG6A 2N4CA 2JWKA 4USUA 5B0DA 3UDCA 5L1IA 4JI6J 3H3NO 5LSRA 3CJBA 4HDGA 3KWMA 5DM6Q 1UZDA 2FC9A 4O0NA 4BRFA 4CJRA 4CJFA 1NJIT 2MDAA 2MZ1A 3KK2A 4RW4A 2W7AA 4NO7A 2V9WA 2CPEA 4LFAJ 4FJGA 4KGXB 3HVAA 2YKQA 5AZJA 3AA3A 4DU1A 4I6AA 3QAUA 4RW4B 1NDPA 3RTVA 2PSZA 1HHQA 3L8BA 2H54B 4O3SA 2F4VK 2YKNA 4NL5A 1G15A 2QTWA 3EUNA 3H40A 3C6HA 5EVZA 2DEJA 4BWJA 2DNMA 4CGHA 3ETOA 2VQFF 1SC4B 1S5JA 4MIWA 2ZDPA 1TYQB 3QNNA 3VENA 5KFSA 2UUBF 2G8WA 2Y1IA 5KAKA 4PUOB 2J0SD 1H7XA 5AQXA 1FRHA 1IH7A 1IR1A 4KPYA 1NU0A 1TL5A 3AOCA 5K20B 2CYYA 4BRHA 4MT1A 2QA2A 2O67A 4OZLA 4UUWA 4K0KF 1IN0A 4WK1A 3QB0A 4C8LA 2RHSB 2CNOB 1W2IA 4QIEA 5A0YB 5AQTA 3R6GB 4USWA 2XS5A 1VQON 4XH1A 3THTA 4ZVQB 3NE6A 1GAOA 4CJPA 5DDQC 2EWSA 5L8RC 5GMKa 5FPDA 1MN9A 5K8OA 2IA0A 4EAHD 3ZX0A 1PILA 1Q1KA 1UP1A 4FJMA 3C65A 5D0GA 3ZZPA 2CGJA 3IRXA 2GWKA 2QXFA 4AYBD 3HHLC 2BXJA 2DR7A 4B9VA 3BYPA 3ZSYA 4K0KJ 3JQMA 4DQRA 3P5JA 2G2ZA 2BUPA 2MHEA 3HT0A 1PC5A 1JJ4A 4ZLLA 3RB3A 2ADBA 1KQSR 5LOQA 1RT2B 3VR1A 1PIEA 1Q78A 3SDEA 5GAEI 4KH0B 5HSPA 1LW0B 1B0VA 4A59A 3DRSA 4M63A 4HHUA 1QS4A 3VQPA 1ASWA 2NLXA 2IAJA 1E3MA 3BZKA 3DRSB 1KKHA 4FVMA 4IRCA 4BY9C 4PPDA 1V3ZA 1EB0A 3PNIA 4AF1A 3TUPA 1N54B 4JI6K 2CKWA 3KDOA 3A0IX 4C98A 3BUZB 3SAFA 1R27B 2ZH5A 5TKYA 2FVPA 4JI0F 3NNAA 2FQQB 2XULA 1RB0A 3UNYA 4CWBA 5CABA 2UXDF 2HHUA 2MKJA 2Q0RA 3M2VA 3HK2A 3PJXA 4M3UA 4MLEA 1SPBP 4F8RA 4JP8A 3EICA 4U8VA 1M5KC 2HBKA 1SUQA 3MK6A 1SIZA 5DG8A 2WVBA 1X3MA 5KRSA 3TEGA 1KTVA 2RIJA 1ZM4A 4X64J 1EAYC 4B8CA 3CCWA 9RUBA 1VSHA 3GSIA 4IO9L 4JI0J 2QA4S 3QESA 2OAUA 3PHEA 3VQ9A 2ZUAA 1VQSA 4AH9A 2UXDJ 2B7BB 1NNEA 3CTRA 3WQTA 2E5IA 2HNDA 2NLWA 3VMFB 3B54A 1S72N 1PSDA 1OVYA 1X4FA 3R2DJ 4FPAA 1IV0A 3PDNA 4UOHA 1IR0A 4B9NA 4DS4A 2IA6A 2VQFK 3WNEA 2VF3A 4FW1A 3EVMA 2FY8A 3JSMA 3P8BB 4R8UB 3IDHA 3I6PA 2GBZA 2UUBK 2AZ1A 2ZHOA 2G9OA 4RG8A 3D2WA 1BUXA 4ZVTB 4B08A 3AODA 3BH7B 1VQPS 3I8DA 2HB5A 1DQ9A 3H5UA 1GLDG 5KFOA 3AB4B 4QS8A 1WHWA 4L74A 3NF9A 3TQ1A 1HBUB 4RR5A 5D4LA 1UVMA 3SJJA 4KB1A 1D4XA 5DDOC 1Y3JA 3SQ4A 4K0KK 1FI4A 1YJNS 2OTLS 3U1LA 5EWEA 3QAEA 2JWNA 4CLTA 1FXXA 1RKJA 3HBTA 3KK3A 3ELHA 3C6UB 3I9ZA 4CYUA 4EBDA 3SI6A 3W8GA 2P9GA 4YOWA 4YQWA 2B8QA 3I87A 3NEKA 3MX2A 4X4RA 5AJ3F 4NLOA 2VWBA 4A8OA 2K06A 3FBBA 2W01A 1JLCA 2CWXA 2R7TA 1HARA 4J8FA 2GMHA 2QXLA 3HHLB 3PO5A 3ILOA 1MWZA 5D0EA 4ZIWA 2RQMA 3AA9A 2YNFA 4CO4A 4IOCL 4KHNA 3D66A 4QZVB 4GO7X 1HJRA 3PACA 2DGVA 3UI3A 2YNFB 4O23A 3L2UA 1MG7A 3LAMA 1S6QA 2POKA 1E6VB 4K4YA 6FD1A 2BGGA 3QFUA 1VQ4S 4ILHA 4BVOA 5AR0A 5HL7Q 1X4CA 4ES3A 1K73O 1UWBA 1M5HA 5D3GB 3CC7S 2O8EA 2HAFA 2LYVA 1Q4RA 2AGQA 2W1BA 3RAMA 3BN4A 4DPXA 4OI2A 4QU7A 3FKBA 2YX1A 4JI0K 1ZTWA 3KFWX 4CJ7A 2GELA 2UXDK 2CNLB 2Q97A 4O3PA 2I1RA 1MN7A 1U1OA 4ID5B 3V6DA 4DLGA 2APOA 3CCVN 3JAMU 3KVGA 2J0XA 1N34F 3ZTQA 2LQ5A 1B64A 3H5YA 4K59A 4DI6A 3MOJB 3NNCA 3MEDB 4OJ1A 3HD1A 4FJ5A 4TY8B 1WUAA 4FBUA 3S6EA 5KFLA 4WFBL 3I5CA 4LRBA 3NH2A 2XWXA 3D7SB 1H1VA 2VJVA 4UOFA 5JJBA 3MM8A 2XNRA 3W1YC 5HQLA 4CP5A 1RDDA 2LU2A 2V8PA 3W5XA 3OYJA 4EK2A 1YAGA 3B6BA 3B8HA 3DXSX 1MNEA 2WK4A 5LJ5Y 1RTJA 3E66A 2I38A 2BX6A 1NBEB 2DR6A 3MURP 5HP1A 1RTJB 1WSJA 1Y97A 3NWRA 2CJAA 1RLDA 3CJ0A 3G6YA 1A0OB 4OMFG 2QWNA 4FJHA 3EDQB 2HK2A 4CBUA 3G86A 4JI4J 3MTJA 5E84A 3FGVA 4X65F 1U09A 3S3MA 3BBBA 3BPDA 4QYRA 4NE9C 2FVRA 3CETA 1GX5A 4PA1A 3G6ES 4A8KA 1JNZB 1NLVA 2ATLA 2ZM6J 3VVUA 1J5OA 2AW0A 1ZBFA 2DITA 1YDLA 3ZEUA 1KVBA 1JLAB 3MR5A 4I56A 3MWBA 1J5OB 3EPGA 4H0VB 4N8NA 1WAFA 4OYXA 4FJNA 4HACB 2AYBA 3VAIA 1G3OA 2HBYB 2ZBRA 2OPSB 3BKUA 2QLJB 3UB5A 2AYMA 5KFJA 1IQTA 5AQZA 4V1Ak 1ZBTA 4GRSA 4CEFA 1KFDA 3TX0A 4CF9A 4A2AA 2DEIA 2V4QA 3OVBA 3T7ZA 4CFCA 1JLQA 2B4VA 2LQ9A 4CK1A 3J7AP 4UOCA 3M3ZA 3NGDA 4LSNB 1C1BB 4CO5A 2F8MA 1P1LA 3OTEA 4CD1A 3DU6A 1Q81T 1VQ5N 1H2TZ 1RHUB 5IT9U 5KFYA 3UN3A 2E1AA 1Q95G 1T94A 4EI2A 1YIJN 3OR2B 2YI1A 3Q83A 2FHJD 4U7BA 1Y0HA 1SV5A 2LEAA 5J2PA 2KJVA 3HZ6A 4A5BA 3MD3A 1GNKA 2MKSA 4X4TA 3PVXA 4P71A 4YB5A 4JKEA 2QE5A 1GOBA 4KH1B 2IY5B 1CC7A 1N52B 4CLZA 4DTRA 4A8MP 3UKRA 1RHKB 1KC8O 2XS7A 1YJRA 1I3OB 4IG0B 5KG4A 1IBMJ 2O8DB 2V7YA 4M5DB 1IG8A 3UKRB 2E8AA 4NXMJ 1QE1B 2R3VA 3VGTA 3W60A 1RT4A 3MMCA 3W5YA 1HYSB 5IWAJ 3WX4A 5AQUA 4FK2A 2HWIA 4KKOA 3MMCB 4KV8B 1N34K 3ZSRA 5IV4A 1NSQA 2W7OA 3VQ7A 5L9NA 4KKOB 4NXNF 4XH5A 1Y5IB 4IO9Q 3QJLA 1HR0F 4YY3J 1BWVA 2DH8A 3A5OC 1U1PA 1GH8A 5J2QB 3CIMA 5EX3A 1XC9A 1O13A 3SK3A 3W61A 1OY6A 2GVZB 5SWMA 3W3SA 2CIMA 1X1PA 2VPYB 1Y4ZB 2FHJA 3JB9k 4ZVUB 4WYLA 3QRPA 3AVFA 4JYAF 2P9IA 2QLFB 2MJUA 2H5EA 2IM1A 4CNZA 4LC9B 3CCEN 1HPMA 1QHTA 3VQSA 4P2XA 4LFBF 3JQKA 1QQOA 2IVNA 3RRKA 4RBUA 1B7FA 4NXNJ 1H7WA 4MLHA 1V5VA 3BSOA 3HLUA 2BR0A 4C6AA 4WU2A 5F2RA 3MI7X 4DCHA 2G1DA 4X65K 2DVIA 4O3NA 4DSKA 1B99A 3CD6S 2YWEA 5C25A 1S6PB 3JTOA 1RWNB 1DRZA 2GTDA 1B3TA 5C25B 2EK6A 3FQKA 4IKFA 5DDRC 3LM2A 2HWHA 1ASUA 2ZE2A 1QTNB 1R8HA 4JYAJ 1X4GA 2UXBF 1W9HA 3NCRA 4QW8A 3OYLA 4WZMA 2QIFA 3UVJA 4M94A 4LFBJ 1FXRA 4PY5A 4OX6A 4GV9A 2CQ1A 3ZZOA 3VALA 4Y0WA 4QYZJ 5DK5A 1KN6A 2EKYA 1JLEB 4PXDA 5T7BA 3O2IA 4CEDA 2HS4A 4LF5F 3RJMB 1SJ3P 3QIDA 1S1UA 3CDWA 1GLFO 3CC2N 2FZGB 3N6LA 3WHIA 4CF0A 1MW7A 4QWEA 4J2DA 4CM0A 1W25A 1HX1A 1PJ5A 1VISA 1XQIA 3AOBA 4LY7A 2ASOA 1N56A 3MN9A 1IBMK 3KJVA 3Q86A 1D5AA 5ADXA 1HBOB 3VF0B 2I2YA 1TGOA 3VA0A 1SQGA 1PAEX 2EBGA 2GJFA 4KAZA 4DX5A 5I4MA 2K8GA 1GQEA 1K0VA 4O0JA 3VQ5A 1C0GA 4OI6A 2W8LA 3IM9A 2G8KA 2CPDA 1SJFA 3ZC4A 2HW3A 2NRTA 2OFHX 4YOEA 3CCRS 3ULEA 1V3RA 4PPZA 2NREA 2I7NA 1ZBHA 5J1EA 2NUUG 3NAIA 3IO1A 4M5LA 4Y2KA 3AVNA 1T03B 3SZ2A 3OYGA 5J1EB 4TYAA 3NP5A 4CD3A 2VG5B 4MDAA 3SLCA 3BGOP 4LF7J 3KG4A 4ID8A 4DSJA 4CZJA 3MXMA 1VQ9N 4NXNK 3J7ZT 1HR0K 2B0GA 1S76D 1N6QB 1CJUB 1GLEG 2XZTB 5CYQA 4B3MF 3P4IA 2B5JA 1K1QA 1LV5A 1JK9B 5CYQB 5I3PA 5MAOA 1LWCB 2B5JB 1R7IA 3R7SB 2XZDB 3R7NB 4U7CA 1P1TA 3VZIA 4JYAK 5L9XA 3LDLA 4B3OB 1N0VC 1QZ6A 1IM4A 4LFBK 1Q18A 1WF2A 5BYRA 4IWVA 4E7KA 1T9VA 4FPIA 2HZAA 4QYZK 3HVTA 2ZUGA 4K2XA 2QJ3A 2LEBA 4FWNA 4G1IA 3EDRB 3OTOF 1G6BA 1RAGB 4DTSA 4ED7A 2P5OA 4CI0B 1S0OA 2MHNA 4M7YA 4RW6A 3HL8A 1RQ0A 5D4PA 5F8JA 2XLKA 2QM1A 4NA2A 4DR7J 1JL1A 4RW6B 2CDQA 1K6YA 1FJGF 4H5WA 5KQ8A 2HAIA 1R3NA 1SQKA 2X3GA 5AZIB 1Q81O 1JJ2R 1DLOA 3CCLS 5LL6Z 3KMQA 1SC3B 4FF2A 1WOQA 2IVMA 1Q5YA 3A3OB 1DLOB 2QWRA 2FXUA 3THWA 2H48B 1WEYA 4M1KA 1RT1A 1REVA 3VEWA 4CZHA 3SPYA 4I6WA 3GYXB 3QBCA 2ACYA 3THWB 3T5KA 2L9WA 3CPWR 4UZCA 2DR8A 1QDUB 3IP0A 2BDPA 1XNRJ 4JI3J 4F3MA 3RRHA 2ASDA 4K42A 1T9TA 1BCMA 2AYEA 2QK9A 3Q89A 3NF7A 3MZIA 1FJGJ 2VGMA 1RP5A 1C0FA 1RXOB 1KTQA 2ATQA 4QIVA 3QLHA 3LPUA 3CCQS 2OFGX 3GCXP 3A12A 3TAPA 5AXNA 1KHVA 3I82A 3KOAA 1QD1A 3QLHB 4EHTA 5B0BA 5M1QA 5L1JA 2OZMA 1CSJA 3MN6A 4K4SA 3H1QA 3KLGB 2HIYA 4NI2B 3GV5B 1D8YA 3B4DA 1R0CB 1LWEB 3C14A 4E3SA 3ONQA 3V4IB 1UCNA 1RE1B 2DHGA 2Z4PA 1SQFA 1RT3A 2P2CB 4I7FB 1CLFA 2VFVA 1KAZA 2W2NP 2HWTA 4BDZA 3BN7A 4JHDA 1VQKN 3ZT2A 1CQNA 3I0RB 1HNVB 1F9FA 2DRDA 4RBVA 5KT3A 1YJUA 3GILA 3J8AA 1NH8A 1XEZA 4X84A 1O5JA 2RQCA 3TAGA 1KOHA 2XLIA 4LIRA 2E6LA 4WCEL 1T95A 3P3DA 3U1NA 1TVRB 2AEJA 3CJSA 1S77D 3MF5A 2QX0A 3CJ1A 2AJFE 1CS4A 5FJ4A 4Z4GA 3KK1B 1I39A 1E4FT 2DR9A 4BRLA 4N47A 2DGWA 2RH3A 4JN4A 4B3MK 4BE0A 1JLGA 5ITHA 2CQIA 4M3XA 2MQMA 1VHXA 3HSZA 3D67A 3F44A 3FSXA 2QWOA 4DR7K 4CE9A 3I31A 1D9AA 5KG0A 1GLJO 3VETA 1OYDA 2E6MA 1QAJA 3LOUA 5IT9O 4N5SA 2J8SA 3DLKB 3I96A 3LO3A 3A8YA 3AAPA 4FLWA 3ENOA 1FCAA 3TRGA 2Z2MA 2CQHA 1JKHA 3C16A 4KY3A 5HRNA 1FVQA 2OPQA 4MYUA 5BREA 3OTOK 3POTB 1JKHB 4WF9Q 1EZZB 2UV8G 1XNRK 2YCHA 4BRIA 4CO0A 2WW4A 3ZCMA 4GV3A 2L48A 3FFIB 1L3VA 5IT4A 1FJGK 5IOLA 4CTAA 1SBRA 2D0OA 1S5ZA 5K9FA 2NRXA 1FDBA 3MM5A 1WKKA 1WUUA 4EZ6A 3I5BA 4XDCA 2BUNA 4PZVA 3VOVA 3KG0A 2C1EB 4OHVA 4KAIA 3MM5B 1JXEA 3ZT3A 1HNIA 2PT0A 1K0TA 1BXNA 2IRUA 1VJQA 2W8KA 3AY0A 3PZPA 3M2RB 4CO2A 3S3OA 4FBTA 3OHAA 4A57A 3QINA 4CH1A 1NMEB 4LBIA 1LAWA 1R8BA 3SPZA 1WN7A 2MQOA 4CHOA 2X1AA 3CMEN 4B9UA 1XMQJ 5I3UB 3ZT1A 2I0XA 3ET6B 4H5NA 2Q6CA 2FVCA 5E3RA 4A47A 3NGSA 4QJVA 3IWXA 2CQDA 3UO0A 1U2RA 4TLRA 1T0TV 2OEMA 4DCJB 2ZJQL 1F9HA 4YOXA 5CAAA 2N82B 4OHXA 1F3FA 3ILIA 4X4PA 4HDHA 2DHAA 5D6GA 3SUPA 3VGSA 4C97A 4YB7A 2RSQA 2KH9A 4OLAA 1FRMA 5HI7A 4AL5A 3LP1A 3KLEB 3M1FA 4Z4CA 2NZ4A 3BGRB 1GK8A 4O0IA 4DR4J 5KTQA 2XSJA 3KUEA 3CXCR 4Y3CA 1HNXJ 1CJKA 3T5HA 2HHHF 1OH5A 3U6FA 5KFWA 1CPZA 2IGIA 1CJKB 4BC9A 1F0XA 2DKOB 4WYBA 2MQNA 2XLJA 3PR5B 4KO0B 2VUGA 1XUPO 2G0IA 3BR8A 2ZGYA 3U4LA 2PY5A 1AYEA 4PG8A 1RTIA 3H3OB 4MKBA 3UW1A 4YP3A 1HQEA 2UXCF 4ED0A 5HVHA 1RCXB 3KLHB 3VV2B 4JI2J 4F2SA 3R1HA 3DMJA 5L1LA 1HQEB 3ZSZA 4PWDB 3DLEB 2XNQA 4L8RB 3R5GA 3DMJB 2LA6A 4EIAA 2VG7A 2QMWA 3LM9A 4O4GA 1K8AO 3AO4A 4DU7A 3A8JA 1JLFA 4OX8A 2MSTA 1XMBA 1IBKJ 1D3WA 2VPZB 4KB7A 4O4GB 4OLBA 2HF4A 1JLFB 4AD6A 1MLAA 2H5JB 4BRDA 1RWXB 2DXFA 4V19X 3PHTA 4RKUC 3RMDA 3HFKA 4ZN1A 2EVZA 2UXCJ 5HK4A 5H9EK 3TR5A 2YHXA 2MZTA 4ALZA 2DY9A 3MCOA 4QS7A 4Q5VA 5KFNA 2YKAA 4DQPA 3OBWA 1HQUB 4MAKA 2A3ZA 5CCMA 4GMKA 3PV8A 2LQ8A 5A2QO 2E66A 3PW2A 3IN5A 3CMAN 2ASYA 4W92B 2P6TA 1DURA 3ITHB 4CBXA 3A2FA 1GFWB 5DG7A 1A5VA 4KH5A 4NPOA 1KNZA 1W26A 4JKGB 3SSQA 1VBZA 4ZP6A 1SKRA 2IRXA 5M2RA 1IR2A 4AHTA 4JBCA 3J7YU 5AQRA 2E5GA 3R3LA 4DF8A 1R31A 1UPPA 5KFZA 5D15A 1RLCL 1F1BB 3QIOA 1UVJA 4GVMA 3A13A 4CEQA 4L73A 1ITGA 4CLWA 2QI2A 1Q0NA 4U96A 2A40A 5KFKA 3Q2TC 2GQCA 3MCSA 2ZH7A 3IFEA 4TKTA 4LIWA 2HBRB 4EFAC 4Q0BA 4JEPA 3EKUA 1HNXK 3ZNUA 2A6AA 2ZWOA 3D28A 4A46A 1S49A 1RYRA 4FVUA 1I6JA 1CC8A 4FJ9A 3R9PA 4TNOA 4DL0C 2YWHA 4CI6A 3ATUA 4EEYA 1LW2A 3BBFA 4OQJA 5EHHA 2ZVIA 4NLBA 3I4PA 3PRBA 1LW2B 2VD3A 2MLZA 3KD1E 4GC7A 5D0HA 2BH1A 4WCEQ 4WK3A 2MGZB 3R8EA 4HTUA 4QWBA 1YITS 4Q45A 1HIYA 2HIQA 2NXCA 3KLVA 2KKZA 3GE1A 4CERA 3QEPA 1ZAXA 4ZP9A 1YTYA 4CIFA 1WSEA 3O4QA 1RT7A 3BZQA 2HHHK 4FLUA 1IBKK 3AOAA 2FLPA 4ED8A 2W9AA 1H73A 1UMJA 3VEOA 4DPTA 3DRPB 1PJ7A 3CJKB 3LH2S 3ASMA 2GW8A 1FFWB 2UXCK 5IC4B 3M2UA 3CCVS 3Q22A 2IBKA 2JC0A 3IWNC 4F2RA 4DUYF 2XM3A 4FK0A 1YVUA 3GPAA 2QSFA 2UVWA 4F4ZA 2DNPA 2Y1RI 2M88A 1S1VB 4QPTA 1NK7A 4MK8A 1WG5A 3QETA 5JLFA 5IQQA 2UP1A 5AQIA 1VRQC 2GAHC 3NS7B 1T6DA 1BY9A 3D0PA 2A1RA 1UEVA 3OW2M 4LVNP 3PM9A 5KFMA 3WEEB 4CZKA 2ALYB 2IC3A 2ALZA 2EXUA 1RI7A 2CG8A 2VKZG 3U9DA 4J9NA 2VBWA 4BR7A 4B1XB 1N32F 1KVCA 2BTFA 1SH3A 2ZF5O 3AGRA 3AO5A 3LPTA 4CZLA 5HN0A 1C4CA 4PG5A 3T19A 1VBKA 3N6MA 3DOKA 3SI8A 1H98A 3CGIA 4L3KA 4G9ZA 2QL7B 3FZLA 5B0FA 4KHSA 2RVJA 5KQDA 2Z56B 1TV6B 2QN6B 3IR5B 4NB4A 5SZTA 2CQ2A 4KGVB 3NRBA 1F5AA 4ZPVR 3M6WA 1NJXA 1V5IB 3K5PA 3O5TB 2QT7A 1C6VA 2P9SA 3G6VA 1HL6A 2GHWA 3THPA 3THXA 3BSAA 1TKXA 4WFAL 2P9SB 5E7OB 1E6YA 1YT3A 1TKXB 3GV7B 1HMVA 2NYHA 2F96A 3RB6A 4ZN3A 1NM1A 2NUBA 1OSDA 2YTCA 3US5A 3UFCX 3SBTA 5GADU 3G2XA 4DTXA 2W9CA 2B6AA 4NMXA 3GSDA 3WX8A 1NOYA 2W9CB 3J7A1 2PA8D 2D3O1 1VQ5S 1NRKA 4QCLA 2WTUA 3VQCA 4X4QA 3CDAA 5L46A 5KFIA 1YIJS 4LQ9A 2XC9A 3K9KA 3VWSA 3Q8YA 1WF0A 1FKPA 4J9VA 4EHUA 3WC2A 5T7LB 1FKPB 4WPAA 3D2FA 1PBAA 1JB0C 4NCGA 2QTDA 1CJTA 4O3RA 3HZEA 1XQSC 5AQKA 4Y0FA 4FP9A 4NCGB 1CJTB 3HSDA 1L3TA 1WNSA 5LY3A 2F8SA 3D4JA 2E7XA 3JXUA 4P9SA 3DRYA 3RW6A 1GXTA 1YWXA 1OVQA 4LJMA 1TKTB 2ZZTA 1OQ6A 4IEEA 4BACA 5CHCB 1Q82O 2B8PA 2PA3A 2U1AA 3DCAA 1Y64A 4DUYK 4UY85 2MY8A 1NWKA 4IFYB 3DOLB 2ZH6A 5G0RA 3U02A 2V69A 4CLLA 3LPEA 4K4TA 4WQ5C 2AU0A 5F9NA 2Q36A 1HA1A 4JKAA 3ULHA 2EG2A 2DFEA 4DTOA 3OS2A 3MOZA 3E51A 2RAQA 1EP4B 3HSGA 2UVVA 3LWLA 2KZMA 2VICA 3OFFA 1M0SA 4L3QA 4OHZA 2AJ1A 3SCXA 1YLXA 3FRYA 4OV1A 3DGPB 5GADP 4OZ5A 3MMBB 5C15A 4LBPA 3DYAB 9ATCB 4U95A 1WC3A 5K8MA 1S1XA 4FWSA 3HVRA 4AQYF 1NKBA 1IKVA 3JTNA 1VSLA 4OJRA 4ECTA 2VOOA 3LDSA 1OMSA 5E3QA 1FKOA 1ZETA 4CO3A 5K14A 3THYA 3AV9A 1IKVB 1IKXA 4GKKJ 4FLZA 2FJEB 1TU0B 3TANA 5K14B 4QWDA 3THYB 1GLLO 1WACA 2J9DE 1IKXB 3OLAA 3HSCA 4RW9B 5I3QA 4Z4HA 4C11B 3UWTA 3D7EO 3H98A 2HMIA 2ZNYA 2OSQA 3D6MB 4FJIA 3BO2A 4DV5F 3L7OA 2FBXA 1SH2A 1NXIA 3O44A 4GVBA 3SNNA 2HFZA 4TU8A 4GVBB 1A6LA 3LUYA 3Q8UA 3EKSA 2ZZMA 2XGPA 4QOTA 3K2YA 3O1BA 3T6JA 3GYNA 4R0JA 1OWXA 2UUTA 4WXOA 1VYAA 2ZD1A 2RDJA 3V9ZA 2N3LA 3V5RA 3ZX3A 4LF6F 4CFBA 4KHPJ 4C8KA 2ZD1B 1UPMB 1U04A 3SCKE 3CC2S 2VL1A 3MM7A 1HBNA 2JHEA 1GTEA 4TU9A 2KHDA 1S48A 4IH5A 3K0SA 4J9QA 1FJEB 4OPHA 4IO1A 4J90A 3UCGA 2X51A 1KOOA 2P9LB 3SUNA 3J80Y 5EUHA 2PMZD 1CJVA 1OS5A 2LVWA 2Y3YA 5ETMA 2D9OA 4EYIB 1CJVB 1YVNA 1T05B 1BWEA 2PO4A 2H3GX 5LMUF 1NCLA 1ZPVA 2WOMA 4FM0A 3WNHA 1RTHA 1NJYA 1P9YA 4DV1F 3BF1A 4XPCA 5SUHA 2VQEF 2ZH3A 3MUTP 2WOMB 3H0PA 3K57A 1NK4A 4CF8A 1J27A 1EKSA 4ZJLA 3PG9A 3EE9A 3CCUS 2YY3A 4HCBA 1WI8A 5D77A 3LANA 2GO8A 2D0CA 2VFTA 2QSWA 1W2BR 3ZSXA 3GONA 3MECA 4UY8O 1YJWN 1NH7A 3MFHA 4P2MA 1RDCA 1TK5A 3CG7A 4W5RA 2DPIA 1SS6A 1UWAA 4IRKA 3TZYA 1MWMA 4ECUA