3QLHA

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,hydrolase/inhibitor
molecule keywords reverse transcriptase/ribonuclease H
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 144
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qlhA05
2XWYA 1RTDA 1RAJA 3M8PA 3CFOA 2PY5A 4E7IA 1KFDA 3AA5X 4M3UA 1GOAA 1RYSA 1N5YB 3NH1A 4O4GA 5KFRA 4CEDA 1TK0A 4DQPA 4KFBA 3S3MA 3I5AA 5DQGA 1I6JA 4URSA 5KT2A 1ZBFA 4DFMA 3UDLA 1KTQA 1VSHA 1EETB 2QXFA 2IM0A 1BISA 1RA7A 4LSLB 1S49A 1NK4A 3C6TA 4MK7A 4RNFA 3MXJA 1NHVA 3PX0A 4MKAA 5L1JA 5E41A 1KLMB 2W9BA 4HKQA 1S1WB 3OJUA 2VWKA 4I9LA 4CFCA 4ZTFA 2HNYB 2AGPA 2OPQB 3OYAA 5KG7A 3CM6A 2HWIA 4J9OA 1JLAA 1XR5A 3D0PA 3OL6A 3PW0A 4F4XA 5CYQA 4TYAA 4MFBA 5HRSA 5KRTA 4HHTA 1N6QB 1S4FA 4YFUA 2IGIA 4CJ4A 1NKCA 4IG3A 3O4NA 4M3WA 3HP9A 1RTIA 1TVRB 3PO5A 3K5LA 5T7BA 3NCIA 3SQ1A 4OL8A 3KLGB 1SKRA 4CEQA 1LWEB 1TAUA 3AV9A 2IC3A 2ASDA 4EP4A 3DI6B 2E9TA 2VA3A 1QE1B 4G1QB 4M3RA 1T05A 2DFEA 3PR5B 4FK2A 1NNDA 3LANA 1D5AA 3HKWA 5JXSA 2W8LA 1T03A 2AX0A 4PA1A 3DOKB 2ASJA 4CJTA 1S6QB 4CIEA 4DG1B 3OYMA 3SZ2A 4TN2A 2R8HA 4HYKA 4CHYA 3PX4A 4JV2A 4ECYA 4NRUA 1QUVA 5KFJA 2DPJA 4B3OA 2XGQA 4F3OA 3G6XA 2BRLA 3V6HA 4Y2AA 4DLGA 4M3TA 3MEGA 4I7FA 1Z25A 3OL9A 3V9ZA 2P5GA 4YMEA 1WN7A 3AO1A 5HP1A 3ZSXA 3BQ0A 2C2RA 3KKSA 3TR8A 4DL2A 4ZHRB 4CIFA 4ID5B 3G0ZA 2F8EX 4DFPA 4J9SA 4JRQA 3SFGA 1IKWA 5C24B 3NF9A 3SJJA 4Z0UA 4GMJB 1VSEA 1KVBA 4C8NA 5HRRA 1ZBHA 3T19A 4CFBA 3OL8A 3VQ9A 1IO2A 4DSJA 4TYBA 1BIUA 3QLHB 4RZRA 3CG7A 3MFIA 4IRCA 4YNQA 3OHAA 2WK4A 3EPIA 4E19A 3CVKA 3M8PB 3NAHA 5EU7A 4ZVGA 3MEDA 3QETA 3M9MB 2AU0A 4K4UA 4DWIA 3V9UA 2YNIA 4IFVA 4O4GB 4PWDA 2G8KA 3RAXA 3WNHA 1UWBA 4KFBB 4O3PA 3RTVA 3PR4A 3O3HA 4O0JA 2HMIA 1GX5A 3ALYA 4DL4A 1J54A 2QK9A 4CJWA 3LP0B 2BR0A 1HQEA 1SV5A 4EEYA 4BE1A 1UA1A 4YP3A 3BR9A 4IG0A 5KFCA 4YQWA 4ED0A 2X6NA 3I0SB 1KVCA 1A5VA 4K50A 1RDAA 3DLEB 1WAFA 4RNNA 2R8GA 4FJ5A 3TAMA 2PYLA 3K57A 1JL1A 1HPZA 2QE5A 4ELUA 3L2QA 5DGBA 3BREA 2FBTA 4Q8EA 3B6PA 5CYQB 4K4WA 2ZD1A 4JS4A 4MFBB 3DYAA 3TI0A 3M9NB 4IG3B 1X9WA 4M94A 1VSIA 3H5YA 4KSEB 1L3UA 3V1QA 3LAKA 4F2SA 2B5JA 3AVHA 4CK3A 5KG5A 2IC3B 3OYNA 3KOAA 1CXQA 1T05B 5KFAA 2OPRB 4FLUA 4B8AB 3F9KA 2HW3A 2IDOA 4CF9A 4F4YA 3V81B 3DRSA 1LAWA 2YV0X 3KHGA 1NK6A 1C0TB 4LY7A 2FLPA 5CYMA 3HPOA 3IN5A 1XHXA 1S0MA 1HJRA 2YNFA 2G8VA 3KK1A 4B3OB 4DQQA 4CF2A 4Q45A 5I42A 2R8KA 3VQ8A 4Y1CA 2Y1JA 1LW0B 5KFHA 4FXDA 4NLPA 3MEGB 2FBYA 4FZXC 4FW1A 3PVXA 2KZZA 4WFXA 4JS5A 4DU3A 5HP1B 4K8XA 2KW4A 5KFFA 4Q5VA 1KHVA 3C6UA 2HWHA 5KT6A 4FJLA 2RF2B 4AHVA 4ZP9A 1JLCA 4FVMA 1NK0A 2BANA 4CEBA 1IKWB 4JV1A 4M45A 2CKWA 1X1PA 5C42A 2IOCA 3CIZA 4IQXA 4AHTA 3DMJA 1VRUA 3QYYA 3TVKA 5KFBA 3GIKA 1SUQA 2R2UA 4ZP6A 3HVWA 4W5RA 4QWCA 5KT5A 3V1RA 1RA6A 1N48A 2A1SA 4JUZA 3I5CA 1BQMB 1S97A 1U4BA 3DM2A 4I2PA 4OGCA 2W9AA 3RRGA 2F8SA 1LWFA 3OLAA 2W8KA 4B9NA 4J2AA 2YNIB 4IFVB 4OGEA 4PWDB 1UWBB 4ELTA 4KB7A 4TQSA 2HMIB 1Q9YA 4DTPA 4E0DA 1BHLA 2I1RA 3ZT3A 2XI3A 4O3SA 1B92A 1SV5B 1T3NA 4DU1A 1S1TA 2C2DA 2G8UA 2JEIA 2YNHA 1FKPA 2OPPA 4HUGA 2WCXA 2FVPA 4CK2A 4RNMA 2WTFA 1HPZB 1VRTA 5DQHA 2R2RA 3QIDA 1FKOB 1F21A 4DTXA 4XO0A 2OZMA 1S9EA 4Q8FA 2ZD1B 2RKIA 3DYAB 1G15A 3Q8SB 3MXMA 2RN2A 2WONA 1R0AA 4ECXA 1S9FA 3AVAA 4M3XA 1FK9A 3AA4A 1C0UA 2OZSA 5KFDA 2WHOA 4CE9A 1LV5A 1ZYQA 4Y1DA 3K5MA 5J2QB 2ETJA 5F8MA 2ASLA 3VQPA 3I8DA 2B6AA 1QSSA 1U49A 4LQ3A 4CGGA 3OSPA 1VK0A 1CZBA 5KFUA 3IRXB 4OLBA 3OYHA 1FXXA 3SUOA 2J6TA 3H5XA 3MEEA 1RBSA 1U48A 3L3VA 2XHBA 4FJNA 1HQUA 5KT3A 5CYMB 1JLQA 1HRHA 4CEEA 2YNFB 4ID1A 3KK1B 2JEJA 3M8QA 3HL8A 3BGRA 1EP4A 1RCHA 3GYNA 2OH2A 2ITGA 1RT2A 3KMSA 1A5XA 1HNIA 5KFGA 2DPIA 4HUFA 4KHWA 1BQNA 1RBRA 1W0HA 2JEGA 4C8LA 3TQ1A 1RTJA 3C6UB 4FBUA 4NYFA 1JLCB 3BQ1A 1IKXB 4Z4CA 2BANB 2X6SA 3NDKA 1C2PA 3T5LA 3IAYA 4TXSA 2X78A 1NJXA 4DSLA 3AVIA 5J2NA 1TL3A 2F96A 3DMJB 1VRUB 1ZETA 3BSCA 2RDIA 1DLOA 4BWMA 2FVSA 2ATQA 4KTZA 3G10A 5KFWA 2Y1IA 4E1NA 3DM2B 5FRNA 3ASMA 4FJHA 3KLHA 2ATLA 2AX1A 4E1MA 4OJRA 1LWFB 1J53A 1O1WA 2VA2A 1BL3A 1IKYB 3MF5A 4R0EA 3EZUA 4NRTA 4RW6A 4CJEA 1SL0A 2GC8A 1RTHB 1REVA 1RYRA 4LH5A 3VQCA 3KK2A 1HYSB 5KFLA 4FJJA 2IAJA 1J9AA 3JSMA 4QWBA 1BI4A 3KLEA 3LAMA 4W5QA 4DFJA 4Q43A 1QSYA 3AO2A 1WAJA 1S1TB 2V4QA 2XY8A 3DLBA 3TWHA 2YNHB 5C25A 5L1IA 3VQQA 5KRSA 1C1BA 2OPPB 3H5SA 4Y3CA 1EKEA 3RMAA 4ZVFA 3KHLA 5KFMA 4C8KA 4WYLA 3P5JA 1RT6A 5HRPA 4F50A 3UIQA 1VRTB 4IR9A 2Q3SA 3AVBA 2G8FA 3CJ5A 1S9EB 4CK1A 2RKIB 2YKNA 4DTRA 3N6MA 1ASVA 2FVCA 3VQAA 5F9NA 2AGQA 3OYLA 4J2BA 3DOLA 3AVCA 1FK9B 4X2BA 1C0UB 4KKOB 1JLEA 1Z4UA 1KFSA 4BWJA 2QKBA 3E01A 4CECA 3PUFA 3ITHA 4K4ZA 4HCBA 1WLJA 3OS0A 4BDZA 3NF8A 2YKMA 4KV8B 4EO8A 2UVVA 3I0RA 4KRFA 2B6AB 4U6PA 2W7OA 3U6FA 2FJVA 4HVJA 4ED8A 3ZT4A 4CHNA 3UPFA 3BQ2A 1KHWA 1WSGA 2IMWP 2GIQA 1HQUB 2KFNA 3Q8PB 5L1KA 4CIGA 2W9CA 4O3NA 3NFAA 4ED2A 3V4IA 5KT4A 4ECVA 3LP2A 5JS1A 3U3YA 1TKTB 3BGRB 4AHUA 1EP4B 1A5WA 4CCHA 1RT2B 2P5OA 3KLFA 4OLAA 4J9NA 1HNIB 4FM0A 1CXUA 3RR8A 1TL1A 5KFNA 1BQNB 4NLOA 3SV3A 3PY8A 2C2EA 4TQRA 3VA3A 4KHRA 3SUQA 3VQDA 3OL7A 1RTJB 5KFSA 5JUMA 1JL2A 3NE6A 3GV8B 2B4JA 3NMAA 4CERA 1NK8A 4QPXA 1NK5A 2E4LA 2AJQA 1S1UA 3GILA 3OSNA 5J2NB 4IDKB 4PQUB 5F8JA 1TL3B 1BIZA 4FBTA 2DFFA 2E9RX 1DLOB 3H40A 4ZP8A 3BSOA 4MIAA 1S6PA 1ZBUA 4ZPCA 3LWLA 2ILYA 5F9LA 4FCYA 4DQSA 2ILZA 1UAXA 4BDYA 5KFKA 2XCPA 3KLHB 1NJWA 3DRPB 3L8BA 5HBMA 3OY9A 2FVQA 2D3UA 2P51A 1KLNA 4XPCA 3CDUA 4B9SA 4KB0A 3BJYA 3CFPA 3H4DA 1REVB 3KK2B 4TY8B 3L2UA 3SPZA 1S0OA 4ZPBA 1KSPA 4O5BA 3L3UA 2PYJA 3JSMB 1BI4B 3KLEB 3AA2A 3QEPA 2D3ZA 1K6YA 1RTDB 4QWDA 4ED1A 4RG8A 3M8RA 5C25B 1C1BB 5J2MA 1NK7A 1JXEA 5HROA 3VQ4A 4FK0A 2HB5A 4IFYA 1YT3A 4CJSA 3L2VA 3QIOA 1C1CA 2IS3A 4B8CA 3KK3A 4CJFA 4NLSA 2XI2A 3H59A 1RT6B 2OYQA 4IH5A 3K5OA 4KHQA 4N56A 2EC0A 1XR7A 4G3IA 2AQ4A 1RT1A 4O4RA 4LH4A 4FW2A 4DSKA 3GIJA 4MKBA 2YKNB 2D5RA 5F8HA 1HNVA 5KFVA 1Z26A 3BSNA 1K1QA 3C6TB 3DOLB 2BQ3A 3RMBA 4NLYA 1JXBA 4KHUA 4J9RA 4YR0A 4KHNA 2O4IA 2B43A 3NAIA 3LALA 2WB4A 4NZ0A 2W9BB 4CJ3A 5SZTA 3ITHB 1XHZA 1C0MA 4K4YA 4O3RA 4FJGA 4M3ZA 2YKMB 5J1EA 2YHAA 1IG9A 4O44A 1RDRA 3CO9A 3CDWA 3S3NA 2DY4A 1JLAB 3V9SA 4BACA 3ZSZA 1XR6A 3CJ3A 1RNHA 3IG1A 1TKXA 4J9LA 2G8IA 4NYNA 4AH9A 4EO6A 2W9CB 1QHTA 5F8LA 2XGPA 2VG7A 3V4IB 1RTIB 2VG5A 4FJKA 4GVMA 2HNZA 2RDJA 1TV6A 5KT7A 4M42A 4LSNA 3EZ5A 3PJWA 1SH2A 3QINA 3EYZA 3PX6A 3PW4A 4B9LA 3HSTB 3KLFB 4PY5A 3FQKA 1T03B 1S1XA 1TL1B 4CHQA 2KFZA 2FBXA 2KQ2A 4CEOA 4CJLA 2Z1HA 4RW7A 3OYFA 3G6YA 4DLEA 4H4OA 3QEXA 1ASWA 4O0IA 5FRMA 1TAQA 2E9ZA 2DTUA 4B9TA 2BE2A 4UQGA 1CSJA 4CJRA 2HHWA 4FZYA 1MMLA 4FJXA 4I7FB 4Y2CA 1N56A 4RW4A 1RBTA 2GUIA 3LDSA 4CHPA 1X9SA 1YTUA 1KCFA 3F73A 4HTUA 3EPGA 1LW2A 4ZMMA 3OYCA 4WE1A 1KRPA 5HBMB 3ZSQA 3V6DA 3NHGA 2V9WA 3N6LA 2HHUA 3UQSA 3TARA 3MECA 4Y34A 3KIOA 4KAIA 4NLVA 2A1RA 3NL0A 1GX6A 5CY4A 4EZ6A 4CFDA 5DK5A 2BGGA 2I5JA 3MEDB 5KFPA 4DMNA 1EX4A 5DLFA 2VG6A 2D0BA 1SH0A 5HROB 4DTNA 4IFYB 1C1CB 3KK3B 4H4MA 3OYGA 4KHYA 3O4QA 1NKEA 3MR6A 4BDPA 1RBVA 1JLBA 3WNFA 3NGIA 1Q8IA 1RT1B 1HQEB 1XWLA 4C8MA 4CJQA 3DLGA 3QZ7A 5J2PA 1HNVB 4NYZA 4IG0B 3QO9A 4KE5A 1JX4A 3QESA 1D9FA 4ICLA 1VSFA 4NLGA 4ECUA 3TAMB 3RRHA 1EXQA 2D0CA 3NAEA 5J1EB 4WXWA 3RBDA 1S9GA 4O44B 3K58A 1I3AA 1TGOA 3FSIA 1U04A 3ULDA 4RW8A 4DF4A 4CJKA 3VQ5A 4B9VA 4E7HA 4NCGA 1QSLA 4FYDA 4FS1A 2UVWA 3IG1B 1TKXB 4MK8A 3RB4A 4MH8A 2R8IA 2VG7B 3DLHA 1TKDA 5KTQA 4NLUA 2B5JB 4CFAA 2HNZB 4FJMA 1TV6B 2R8JA 3CJ0A 3AVGA 3TAGA 4FK4A 4BE2A 4LSLA 4E89A 4KI4A 3HJFA 4W5NA 3HK2A 3TABA 1KVAA 4J9QA 1KLMA 1S1WA 3DRSB 1BCOA 4FLYA 5HLFA 2C28A 3KNAA 3O3FA 1D0EA 3TAQA 2WOMA 4H4OB 2GIRA 1WSJA 3DRRA 3PJXA 5I42B 2E6LA 2BE2B 2FJWA 1HMVA 3S3OA 2JC0A 4K4TA 3H2LA 4EYIB 4R8UA 3KMQA 1TVRA 3G86A 3HO1A 4RW4B 4DQIA 5KFIA 4TY9A 1SKSA 3KLGA 3H4BA 4WFYA 1QS4A 2IJNA 1LW2B 4IOBA 3ZT0A 4WE1B 4M41A 4FLTA 4TLRA 4JLHA 4YR2A 3V6DB 2JEFA 3IS9A 4CF1A 2FC0A 2XY7A 2FLLA 4F2RA 5C42B 4Z4HA 3MECB 3AVJA 3VQBA 3LP1A 3MFHA 4RW9A 3NF7A 1SUQB 3RMDA 1D8YA 2V4RA 4IBNA 3SPYA 3WNGA 1RT5A 4NLWA 3PW5A 3GIMA 2XCAA 4ZVHA 4H54A 3PW2A 3HVTA 4I2PB 2I5JB 4DL6A 3PO4A 5FDLA 4FS2A 5EWEA 3OVNA 1Y97A 2OA8A 3OLBA 2AWZA 4Q44A 4K4VA 4H4MB 1J5OA 4B9UA 4QW8A 4ZHRA 1ZTWA 2IA6A 4JV0A 2YNGA 3OYJA 2HHQA 1D9DA 5KG4A 1NJZA 3SI8A 1OS5A 3DLGB 3NH0A 1LWCA 1IKVA 2UUTA 3RR7A 4H8KA 4ED7A 3LZIA 3QO9B 1FKPB 3ZSOA 4KO0A 1K1SA 1IM4A 1RDCA 4FJIA 4RNOA 4DQRA 3V9WA 3GIIA 1TK8A 4TSXA 4DF8A 1S9GB 4M3YA 4QAGA 4CEFA 4CGIA 4DL7A 3H5UA 4URGA 5CZ2A 5FROA 4RW8B 2BDPA 1N4LA 3HYFA 4NCGB 3PW7A 3KLIA 2FBVA 2WONB 1R0AB 1C6VA 4KB1A 4KI6A 3QEVA 3H98A 3BSAA 2DFHA 3ZT2A 4ZVEA 3ZSYA 5KG1A 4EYHB 5HRNA 3IGVA 2PZSA 3LP0A 3TAFA 4PUOA 1WSEA 3ZCMA 1JXLA 3RWUA 3LWMA 2HVHA 3AO5A 2V0NA 3I0SA 4OVLA 4NCBA 4EBEA 2UVRA 3QZ8A 3DLEA 5KG3A 3MEEB 4B08A 4LD0A 2XO7A 1YVFA 1NOYA 3T1AA 5F8IA 4NLXA 4NCAA 5HLFB 1BGXT 4HCCA 1VSLA 3V6JA 1JLQB 3K2PA 2WOMB 4DS5A 2OPSA 3M8QB 4KHMA 3MR3A 3L2WA 3DRRB 2W7PA 2X74A 4FLVA 4OKKA 1HMVB 1WSHA 4KAZA 4QW9A 4R8UB 1HARA 2Z1IA 3K5NA 2KZMA 1S10A 3T5HA 3OS1A 3HP6A 1S5JA 3TAPA 4E7LA 3HXMA 4CJUA 3KJVA 5KGXA 2OPRA 4K4SA 1S0NA 4FJ7A 3ICLA 1W25A 3SQ2A 3CYMA 1C1AA 3IS9B 5KI6A 3MAQA 3V81A 2UUWA 1RT3A 1C0TA 1U09A 4CGHA 2CJQA 5L1LA 3CDEA 3KD5E 3LP1B 4QWAA 4DTUA 4RW9B 5SWMA 3RMCA 4ZTJA 3KKRA 4J2EA 3HPGA 1RT5B 4MIBA 2R2SA 1LW0A 1D1UA 3HVTB 3GQCA 2HVIA 4ECZA 5FDLB 4IR1A 3V1OA 1ASUA 3AVLA 4WZQA 4FM2A 4AILC 3KD1E 4XPEA 2HHSA 1S1VA 4RW6B 4WZMA 3OYEA 3SUNA 4EP5A 1J5OB 1TQLA 1SL2A 5EDWA 3K59A 2IM2A 2RF2A 4I9QA 5KFXA 4FZZA 2YNGB 1GOBA 3UR0A 2IAJB 4OKJA 5DGAA 3SNNA 3AA3A 3OJSA 1LWCB 3EY1A 4CHOA 2FJXA 1IKVB 2IM1A 4O3QA 3ZT1A 2ZQBA 4Q0BA 4DTMA 4ZPAA 3FDSA 3RB0A 3NGZA 2HHTA 4KO0B 1IH7A 3FFIA 1CZ9A 5C5JA 2RPIA 4CGDA 4AHRA 1BQMA 3SYZA 1NKBA 2D0AA 4Z4GA 4MK9A 3NH2A 4L8RB 3VQ7A 4ED6A 2XC9A 3OS2A 2EHGA 4IH6A 1RT7A 4DEZA 2R2TA 1JKHA 3RB6A 3MR5A 4EZ9A 3KLIB 1WSFA 4ZPDA 4DSIA 3THVA 1U47A 4J2DA 4N47A 1SH3A 1JLEB 3E01B 3DLKA 4NLDA 1JLFA 3CM5A 3CQ8A 4HUEA 4PUOB 4FJ9A 4DSEA 3CJ2A 3AVNA 4R5PA 5DG9A 3I0RB 5K14A 4N76A 3ZSWA 4OPKA 5I3UA 3PZPA 2QKKA 3O3GA 3RBEA 5DLGA 3AO4A 1VSMA 2BRKA 4J9MA 2BQRA 1SKWA 3SQ4A 2D7SA 3RAQA 4DTJA 4WFZA 3ISNC 3T5JA 2ZE2A 3M8SA 1FKOA 2XY6A 5JS2A 3DLRA 1L3VA 3LP2B 1T94A 2OPSB 2IBKA 3HHKA 1BCMA 5KG2A 1L5UA 4W5OA 3VQSA 4KHSA 3NBPA 1LAVA 4CGFA 3D45A 3A2FA 4K4XA 4IRDA 4E3SA 1RBUA 5KG0A 4DS4A 4CEZA 1NOZA 4CJVA 5DQIA 4DL3A 1MU2A 4CJ5A 2Z1JA 5J2QA 3OHBA 2IM3A 2G8HA 4WYWA 1WSIA 1ZBIA 3OYKA 2P1JA 3KJVB 1Q9XA 1DTQA 3IRXA 3Q8RB 5DG7A 2FLNA 1RDBA 1S1UB 4FLWA 2AGOA 2O5DA 4OPJA 4DTOA 1RT3B 4IH7A 4F8RA 4DU4A 3PHEA 1UA0A 1S6PB 3JYTA 3NGDA 4KREA 2O4GA 3RB3A 4DSFA 3L2RA 2C22A 1ZBLA 4FLZA 4QCLA 4ELVA 3FQLA 3TANA 1X9MA 2EX3A 2WRMA 3U3GA 4FM1A 3NGYA 3QEWA 2GV9A 2XRIA 3GV5B 5KG6A 2R7YA 3VQ6A 1S1VB 1L3TA 4RU9A 3B6OA 4NLRA 4KBIA 3IGNA 2HHXA 4CEAA 4KTQA 1IKXA 1UOCA 1W9HA 3ISND 3KHHA 3V6KA 3OYBA 4M95A 3CJ4A 3BDPA 3SUPA 1RT4A 4Q0BB 4GC6A 3QIPA 1RILA 4ECQA 5KFYA 4FJ8A 1S48A 3PV8A 4EBCA 5J2MB 4CESA 3P83D 3FFIB 3MR2A 2ALZA 2HHVA 5D3GA 5KFOA 1L3SA 2NUBA 2J6SA 4URQU 2IJFA 4J9PA 2BQUA 3MXIA 2HNDA 4OKEA 4ECSA 2LSNA 1RT7B 3SQ0A 1DTTA 1JKHB 4IKAA 4U7CA 3VQEA 4J9KA 3ZSVA 1CLQA 1IKYA 1XC9A 1RDDA 3S9HA 4I2QA 3WNEA 1TKZA 4DTSA 3QNOA 1RTHA 1HYSA 4F3TA 3C94A 4WXOA 2YHBA 3KHRA 3DLKB 2GBZA 1JLGA 1JLFB 4BE0A 3LZJA 3CFRA 3HVAA 4CF8A 4R5PB 5K14B 4RUAA 4QWEA 5I3UB 1TK5A 4B9MA 4F4ZA 1N5YA 4MQ3A 4ECRA 4CJPA 4F4KA 5F8GA 5EWFA 2Z1GA 3M9OB 3CWJA 3KTQA 4CHZA 2ZE2B 4ED3A 3OYIA 3D28A 3G6VA 2VG5B 4ECWA 5EUHA 3NF6A 1YTAA 3AVMA 4CGJA 1QAJA 1TP7A 1EETA 3LPTA 3VN5A 4LSNB 3MTKA 3D5MA 4LQ9A 4Z4IA 3NBPB 1QTMA 3VA0A 4DFKA 2E6MA 3AO3A 1T7PA 4E7KA 4KKOA 4EBDA 1MU2B 3V9XA 1S1XB 4KTWA 2HNYA 1B9FA 2HAIA 2OPQA 4KV8A 4JRPA 1NK9A 1XI1A 2FVRA 1VSKA 4C8OA 5KFZA 4RW7B 5CZ1A 2W42A 2XY5A 1DTQB 5KFQA 3QGHA 2JLEA 1N6QA 5L9XA 4NLTA 4ECTA 2QV6A 1HYVA 1YVUA 3NKYA 4RUCA 4NLQA 3HT3A 3P1GA 1B9DA 4FLXA 3SI6A 3JYTB 3QERA 1ZTTA 1VSJA 3DDKA 1LWEA 4Z4EA 4GW6A 1TKTA 5DG8A 3ZSRA 4XIUA 3DI6A 3T3FA 2JC1A 1VSDA 3N6NA 1QE1A 4G1QA 2D41A 2F8TA 3QGGA 4Z4FA 3AVKA 4E7JA 3QGIA 3HPHA 2J6UA 3LPUA 3DOKA 3T5KA 3C95A 1JIHA 1S6QA 3FRZA 1SL1A 4DG1A 4AHCA 3KLVA 1WNEA 4F4WA 3HVRA 5KFTA 3H08A 2ZKUA 4YR3A 5T14A 4QOZB 1HYZA 1RT4B 4GC7A 4IDKA 3QIPB 4IRKA 4KPYA 3HM9A 3QEIA 4PQUA 5EWGA 2VG6B 3TAEA 3GV7B 4N5SA 1GOCA 3OYDA 5DMRA 5D3GB 4W5TA 4DL5A 1QAIA 3E51A 1WNSA 1I39A 4ID5A 1JLBB 2JGUA 2HNDB 1QQCA 3QNNA 3I5BA 4RNHA 5C24A 4K8ZA 3DRPA 1NHUA 4O55A 2VWJA 5KGWA 4AHSA 3SFUA 1NJYA 4IKFA 1DTTB 3SCXA 5J2PB 5F8NA 1T8EA 1U45A 1ITGA 4I2QB 2G8WA 1TKZB 4ZP7A 3AVFA 5KFEA 2KTQA 3QLHA 4ICLB 3LP3A 4TY8A 4O3OA 2UVUA 3Q8QB 4N41A 3SV4A 1JLGB 4CF0A
chains in the Genus database with same CATH superfamily
2YWHA 3FZMA 5AXKA 4KH6A 4PKIA 5IT4A 1RAJA 3R7NB 4I1TA 4PXEA 1GOAA 1N5YB 4O4GA 1E4FT 2OCEA 4HT5A 3DXMA 4DQPA 3CDBA 2GMJA 1EIYB 3WX4A 4JK9A 1X8DA 5DQGA 1NGBA 1I6JA 2VH7A 1M0SA 5FLXO 1KTQA 1IBLF 2ZBIA 4LSLB 3WBZA 1NK4A 1Y0HA 3D54A 4RNFA 3MXJA 3UFCX 3KJFB 4V19S 4LT6A 1VK8A 3I55S 2EG2A 1RWUA 2FZCB 2VWKA 4I9LA 2B3TB 1RISA 3OYAA 2HWIA 4J9OA 4OX6A 3D0PA 3W9HA 3PW0A 4FO0A 4TYAA 3H3OB 1N6QB 2FDNA 2VODA 4UOFA 3O4NA 4FWKA 3AD7C 5CD4H 2E2OA 1RTIA 2Y1RI 3K5LA 1OH5A 2XHWA 1TAUA 4OL8A 2HSTA 1HX1A 3C14A 4PQAA 4FK2A 3PR5B 2VHGA 2HBKA 4NE9C 5JXSA 2DY9A 1RUSA 4DQ8A 1T03A 3K0SA 2E1ZA 1FKAF 2ASJA 6FDRA 5JJBA 1F2GA 4X4NA 4A8XA 4LRFA 2R8HA 3CJTA 4JV2A 2ZUAA 3RGIA 2BA9A 4K2XA 4NRUA 1QUVA 2XGQA 2JDJA 1N5SA 3MCAB 2BW7A 3J81U 3CJAA 2BE7D 4WK1A 2DNNA 3IKMA 5GIOA 3HFVA 2J9CA 3CJ8A 1Z25A 4PHTX 1AT1B 1I3OB 3CUNA 4DUZK 3WEEA 1WN7A 1UETA 3SCLE 2KL8A 4CIFA 2P6TA 4ID5B 3G0ZA 2F8EX 1TL7B 4RTFD 4Z0UA 5LSRA 4GMJB 1VSEA 4M5LA 3WQPA 3T19A 2UUAK 1SQKA 1S72N 2CUYA 1IO2A 2NLXA 4TYBA 2ZF5O 4YNQA 3OW2R 4LIRA 4ISFA 1P8GA 2WK4A 3EPIA 1MMNA 3CVKA 2OTJN 4J91A 4JI7K 3VQTA 2KLAA 3M8PB 4ZVGA 1HNZJ 4DR1K 1RWNB 5E3RA 4BR0A 1VQ9N 4IFVA 2PFDA 1GLJO 2CPFA 4DL4A 2QLXA 1FVSA 4H5RA 3W64A 3EE3A 2PT0A 3BR9A 2BBEA 4IG0A 1XQIA 1KVCA 4K50A 3C46A 4K25A 2CPHA 5HL7L 1G6BA 5BYQA 5BR8J 1WAFA 3KG1A 1KD1O 1JL1A 1HPZA 5GAGU 5A8WB 4KGZB 2UU9J 1NSKL 3UCGA 5AQLA 1N33K 4Q8EA 5GIPA 1UAWA 5CYJA 4X4OA 4MAKA 2LKZA 1VSIA 2P5VA 1JMTA 1N5TA 3OT9A 3V1QA 4F2SA 4LF7K 2UZAA 5JLHA 5HL7Q 1CXQA 1I94F 4C48A 3ADAC 4M5KA 4JI2K 4FLUA 1AROP 2I7NA 2RS8A 4ALZA 2HW3A 3QJPA 1BXNA 2ZM6K 1N32F 1KQSM 3ETOA 3HRGA 1SC6A 4LY7A 4RUBA 2QMXA 1V3SA 2A6MA 5HN0A 2QMUB 3KK1A 4B3OB 2G8VA 4LR7A 2QA4N 4L72B 3WXKA 4Q45A 4PG8A 2R8KA 3VQ8A 2H4YB 2V2VA 4FXDA 4Y00A 3CCVN 3RBXA 4J5OA 2V67A 2UUBK 2DYAA 2LDYA 4DX6A 5LMNK 4Z2XA 5A2QU 2KG0A 1VQ4N 5KFFA 2KW4A 2V34A 4USMA 5GADU 4FVMA 2XMWA 1IKWB 3OTEA 3HM8A 5IWAK 3EICA 2F4VK 5EVZA 1H0HB 2VQFJ 1X1PA 2V51B 3CC7S 3US5A 4IQXA 4AHTA 3DMJA 1Q8KA 2DRAA 1D3WA 3GIKA 5I9EB 2NPFA 3G6ES 5AXNA 1S59A 4JUZA 2EFPA 3VEYA 2ZVIA 4OGCA 2QSWA 3RRGA 4X65K 2F8SA 2HPUA 1NAQA 1Q79A 3OLAA 2F1FA 3M32A 1BUPA 4LF2A 2KB2A 1P9QC 4KB7A 3RAMA 3MM8B 1VIOA 2A3JA 3GWCA 2ALYB 2XHCA 1MWKA 4O3SA 1WOOA 2XLIA 2O8FA 4Y28C 3ULHA 3JS6A 1SV5B 2C2DA 4ZCLA 4Z7CA 2YNHA 3QT8A 4HUGA 2WCXA 3NCQA 2FVPA 3LPEA 2HFVA 1NPRA 1WEZA 4WBFA 5GMDA 5DQHA 4PG4A 1NBEB 2DB1A 3M05A 2QEXS 3O3LA 1FJGF 4ZCMA 2RKIA 3DYAB 3A3NB 3M8YA 4MDBA 1U1KA 3Q8SB 4FNIA 1QVFM 1R0AA 1S9FA 2EFNA 3CCTA 5KFDA 5CCLA 2Z30B 1FE4A 3H2UB 2FYXA 1GLEG 2W4DA 4AL6A 4CO1A 5LXRA 5AQRA 4C0OC 2ZNYA 3VQPA 3JQJA 5AQZA 1VK0A 1KVIA 3OYHA 1ZBTA 1WTBA 3H5XA 1U48A 1WSVA 1BWEA 1HQUA 1EZZB 5KT3A 1CJTA 4C23A 1FW6A 2Q3PA 4DB3A 1QHAA 3M2UA 2ZGYA 3ZO7A 3ULEA 1NGAA 1RT2A 3GFYA 2W6LA 4KR0B 2IBOA 1Q5YA 1SI9A 1XEZA 2XS5A 1TFYA 2XNRA 4BRIA 4KHWA 2QRRA 2JSXA 1ZOTA 1W0HA 1R27B 4C8LA 1XMBA 4RWXA 3TQ1A 3L7PA 2E5GA 2CQBA 4LRDA 1OIAA 2A10A 1R31A 4NYFA 1JLCB 3QBWA 4FKYA 4ZOSA 2X78A 3W2VB 1NJXA 4DSLA 2V69A 4NPOA 3AVIA 2GVZB 2FSJA 4ZJOA 1Q4RA 2F96A 1HNXJ 3BSCA 1H7XA 2OSRA 3PM9A 5THWA 2DNLA 1N5QA 1IJEB 5KFWA 5H9EJ 4E1NA 4A5AA 4WFAL 2HHHJ 4LVOP 2ATLA 1VIXA 2AX1A 3ET6A 1W7WA 4OJRA 3MN6A 1N8RT 4R0EA 3EZUA 5C15A 2DNRA 4ILJA 1REVA 5TKWA 1CBKA 4YOUA 4FJJA 4HI1A 3QJJA 2K7JA 7FD1A 4QYZK 3F41A 4DFJA 2GHWA 5GAGI 4JI5K 4L3KA 1HQ2A 3PDNA 1RACB 5C25A 4WFAQ 4DUZF 1C1BA 2OPPB 4G1IA 1MN7A 2W2MP 4HVZA 1OPZA 3CMQA 3S01A 1ILYA 4DOZA 4C8KA 2QW9A 4ZVQB 2YWKA 3P5JA 5HRPA 1CULB 2BM0A 1B0PA 2J7UA 2Q3SA 2L3MA 2VYPA 1ZPVA 1DJ0A 1S9EB 5C2CA 4X4QA 2UUAF 4B3TK 4B3RK 3VQAA 1R6YA 3OYLA 4J2BA 3LDLA 1C0UB 5I4MA 3AT1B 1T11A 1T9UA 1NG9A 1KFSA 3E01A 4AYBD 4IJAA 3PUFA 3F56A 3VR1A 1I5OB 5BPNA 3AXKA 3TP2A 4JI7F 2VWBA 3SMSA 2GHPA 2UVVA 2WFBA 1ZM9A 3Q8VA 1QQMA 3I0RA 4U6PA 4DR1F 4CHNA 4ILLA 2WAQD 2GIQA 2W4CA 3MM7B 1F60B 1HNWK 3OFGA 4NMLA 1U0SA 1BG3A 3B8AX 2R9LA 4DCJB 3LP2A 4LFBJ 3BGRB 5ADXH 4AHUA 3G8QA 3M6UA 4CCHA 2Y9HA 2NRRA 5A2QO 3TZZA 2P5OA 1G3OA 5GADI 4A8WA 3LF0A 4DUYK 2EPIA 1FVQA 3ONQA 4TLQA 1CXUA 3P5TL 4LFCJ 3CXCM 1TL1A 4K59A 1BQNB 3RUBL 3DC2A 2GJ2A 3VQDA 1N33F 1AFJA 3NE6A 1KAZA 1NK8A 4I68A 4M5HA 1Q8BA 4XH1A 3HJVA 5KAKA 5DDRC 3MN9A 4HHHA 2RE2A 2BACA 3HF5A 1TL3B 5F8JA 4LF7F 2DFFA 3ZZRA 1TUGB 2M7SA 2ILYA 3MCNA 5F9LA 5DDPC 4FCYA 2M5YA 2QO3A 4DR3K 5KFKA 3S8SA 3KLHB 4ZPWR 5IC6B 2CQ2A 5DDQC 2ZM6F 5AQSA 4I56A 2HBZB 2R3VA 2LVWA 3M30B 3QSYB 1U8WA 2D3UA 2NXUA 1KLNA 4XPCA 3PXGa 4KB0A 2QTWA 1ZBSA 5AQPA 4C9DA 1SJRA 4TY8B 1OQ6A 3HHLD 4O5BA 5H9FK 2WSEC 2D9PA 2D3ZA 4Y6IA 2XZDB 3MUTP 4OYOA 3E3XA 4CIOA 1LQ9A 2UUBF 1NK7A 1PYTA 3GZ7A 5LMNF 3VQ4A 4GKJJ 1CC8A 2HB5A 1YT3A 2BJ3A 4CJFA 1ZZNA 2W2PP 1NB2A 4OJ1A 1RT6B 1R43A 4N56A 2EC0A 2VUGA 3EWGA 2DR7A 1J5EJ 5IWAF 2AHOB 2AQ4A 2F4VF 4O4RA 3GIJA 1CJVA 2GVDA 2XMMA 3LOUA 1V3RA 3RMBA 1SC3B 2O4IA 1MWQA 1SIZA 2WB4A 5CQGA 4CJ3A 1XHZA 1C0MA 3TUPA 2IHR1 2EWHA 5AE1A 2MQ8A 1FJ7A 5J1EA 4X4SA 4NZ6A 1IG9A 4LF4J 1E6YA 2DY4A 5AQFA 4X65F 3TUZC 4DV3J 2RAQA 1XR6A 3CJ3A 2FC9A 4A48A 4PAAA 1ZH5A 4J9LA 2G8IA 4NYNA 4AH9A 2W9CB 3ZLJA 2MYFA 2XGPA 3V4IB 1RTIB 3DAWA 4NXMK 5M1PA 3H8YA 1HWKA 1TV6A 3R8YA 3CHWA 1S57A 5KT7A 3EZ5A 2YI1A 3BUZB 3PJWA 4KGMA 2YKAA 1SH2A 1JQGA 1YI2S 2VASA 3ID8A 3HSTB 5B0GA 1HWIA 1T03B 1S1XA 4ZCIA 1BU6O 2CPYA 5IC4B 2PMZD 4PCQA 2FHMA 1SPBP 1U8SA 2V2ZA 2HK3A 4RW7A 3J81j 3G6YA 3ENAA 1UP1A 4BRCA 2HMPA 2I9SA 1TAQA 2QFJA 3L4IA 2DTUA 1WF1A 1HI0P 4FJXA 3QFPA 4DV0J 1N56A 4DV7J 3D2FA 3WEEB 4BVPA 3MD1A 3LDSA 1RB0A 2RUGA 1X9SA 1KCFA 1LW2A 3CMAS 4C3LA 3MAAB 1VDHA 3M6XA 4ZLNA 2DNOA 3V4MA 3NHGA 2F7VA 4IOCL 1U0HA 3TARA 4P2XA 4AL7A 3KIOA 2H48B 4GKKJ 4A62A 3V5RA 2X1AA 3BPDA 3B6BA 2M8HA 2CVEA 3GG1A 2OJ3A 4WFNL 3JAMY 2VJUA 4EZ6A 4U96A 3BM7A 1HD0A 2BE9B 5IM0B 5DK5A 2BGGA 4OZNA 2I5JA 5KFPA 4BRLA 2W2NP 1SH0A 5HROB 4CZCA 4DCOB 1C1CB 3O9QA 3GLJA 3BBBA 4DDFA 3MR6A 1RBVA 4IOCQ 3I56S 1CS4A 1Q8IA 4C8MA 4CJQA 1NSPA 2NRHA 2LEBA 5J2PA 2DNZA 2R4FA 2NLWA 4IG0B 4WFNQ 1WI6A 4DV5J 2D0OA 1VSFA 3AHPA 3RRHA 4LF9K 4DPWA 2J0WA 4YDXA 2MXYA 3RBDA 1MA9B 4LBPA 4OI4A 3FSIA 1U04A 2WBMA 4B9VA 4P2SA 1AFIA 4NCGA 1RXOB 4WIIA 3TA0A 2P6SA 3H42A 4L74A 3J80Y 3CCMS 4MH8A 3FRYA 1MWZA 1NM2A 4NLUA 4CFAA 4E98A 3CD5A 1NCLA 5CZXA 5B0CA 3MCSA 3CC4S 5LJ3Y 3S41A 4JI5F 4FK4A 3M2VA 1N34K 2HBJA 2ZBPA 5AQIA 4WQ4A 1S1WA 1BCOA 2DEJA 2N3OA 4FLYA 2HFZA 4CLSA 1DURA 5AJ3F 3MMCA 3BF4A 3TAQA 5FD1A 2QWNA 1RE1B 4L76A 4B3TF 3TJ9A 4B3RF 1HBMA 2JC0A 4K4TA 1YJTA 3OFFA 2D4WA 4R8UA 3CDAA 2R7TA 3R8EA 2XMKA 5E3AA 4TY9A 3MWTA 1EB0A 4F3MA 2BH1A 3J7A1 4ZITA 4IOBA 5ETTA 3IDHA 1OY8A 3NGUA 2G1DA 4ZVPB 2DCLA 3CIMA 4YR2A 3V6DB 1F0XA 3J7AN 5IT9U 4F2RA 2ROEA 4Z4HA 1VBXA 3MECB 1X0FA 3AVJA 2A2DA 3G71N 1D8YA 2V4RA 4IBNA 3SPYA 4CLLA 3C65A 4NLWA 3PW5A 1Y3JA 4H54A 3PW2A 1OVQA 5GAHU 2ZBQA 3L95X 2H3EB 1UWAA 4DUYF 1VC0A 1ITPA 3ZEUA 4FS2A 1RAOA 3OVNA 2OA8A 3OLBA 3IM8A 3EGWB 2AWZA 1FNMA 3JTNA 2FGCA 3G96A 1VBZA 4K4VA 3H1VX 3DDIA 4B9UA 3T9NA 1FDBA 1YBUA 4QW8A 4DCPB 4ZHRA 4JD2A 2WW4A 1FHTA 1D9DA 3LA0A 3DRYA 5T41A 4WQ5C 3SI8A 3DXKA 3NH0A 1DQAA 2BKPA 3GSIA 4A8SA 4NWBA 1HHSA 3CC2S 3QO9B 2E7WA 2FLOA 1UPPA 3CB4A 3ZSOA 3KUHA 1IM4A 1RDCA 4FJIA 2FSKA 2YX6A 3HULA 3V9WA 4DR3F 2NXJA 4CLTA 4DL7A 4NX9A 5FROA 2XWXA 3SCJE 4RW8B 4C11B 2C2ZB 3ILIA 1HBUA 4A8YA 3I32A 3C8YA 5DZ6A 2UV8G 4H03B 3TX0A 3HYFA 1YJUA 3KLIA 1Z05A 2FBVA 1R0AB 1C6VA 4WK3A 3G8TA 1JCGA 3ZSYA 4BREA 1R6VA 3IGVA 3LP0A 4PUOA 1WSEA 3ZX3A 1SBRA 2RD5C 3ZCMA 4DV6J 1JXLA 4OI3A 3RWUA 2K06A 3CNQP 1VQ7N 1EX8A 2V0NA 5E5NA 3IBCB 3VOVA 2UVRA 3QZ8A 1N36K 2ZJQL 4NZ7A 2DO4A 4FDFA 4H0OA 4EFAC 4X64F 4I0WA 1FD2A 2JLGA 1CJTB 3ZZPA 1BGXT 3MCPA 4FVUA 3K7RA 4I6WA 1W97L 4BR2A 2WOMB 4DS5A 5M2PA 1EKRA 3M2UB 2W7PA 4JYAJ 3ULEB 3KG0A 2PD1A 1W2BM 2DNMA 1WSHA 4KAZA 4OYZA 1PGZA 5LJ5Y 2Z1IA 4X4UA 2JX2A 1S10A 3T5HA 3OS1A 2IRYA 2GWKA 4E7LA 3HXMA 2ZH5A 2ZJQQ 3D7EO 4CJUA 3GFHA 4RPFA 2A1BA 5KGXA 3ZYYX 2OPRA 3ENOA 1YJNS 5KQDA 2B51A 5KOWA 1C1AA 4AQYK 1FRHA 1WDTA 3V81A 3FSXA 3IBFB 2UUWA 1RDUA 2W01A 4KGVB 1C0TA 1U09A 2WVBA 1C4CA 4BGAA 2BJDA 2MHEA 2RQCA 5B0EA 3O6QA 5L1LA 3HHDA 2RU3A 4QWAA 4DTUA 4ZTJA 3KKRA 4J2EA 4DR2J 4MIBA 1LW0A 3HVTB 4FYVB 3E1YA 2HVIA 3CD0A 4IR1A 3ET6B 3V1OA 2QLFB 5IXUA 2ZJPQ 4WZQA 4FM2A 4AILC 1UJ5A 1P27B 1HKCA 4ZIVA 1RU2A 3OR1B 3OYEA 3IBWA 1SL2A 3LDQA 4FZZA 2YNGB 4NB4A 3UR0A 5EY4A 2XEXA 1NMNA 4DR7K 4X66K 1IKVB 3FDSA 5HANA 2J8AA 2HHTA 4KO0B 1IBKK 2OGUA 3FFIA 2RE1A 1U1RA 4BHQA 1T9WA 3U4LA 1BQMA 3SYZA 3A8YA 4Z4GA 4MK9A 1RFQA 4A2BA 3NH2A 4NI2A 2QWMA 4ED6A 4IH6A 4BC5A 2FHKA 1JKHA 2KHDA 3MR5A 1FESA 3HD2A 4JI1J 2ASYA 2DNHA 3IWLA 2KM8B 4DBQA 3E01B 3UKRA 3DLKA 4NLDA 4BR5A 2CYYA 3CJ2A 2AV5A 2UXCJ 1GMVA 1C0GA 5DG9A 3I0RB 1FEHA 2UXDK 4OPKA 5I3UA 1TMMA 3A5MC 4YEAA 3UD4P 2QKKA 4OI6A 5DLGA 3AODA 1VSMA 1UEKA 4USIA 4J9MA 2D7SA 4EI2A 4DTJA 4WFZA 3J7YU 2ZE2A 2OIHA 1WOQA 2K2PA 4C8ZA 1FKOA 1CG2A 1D8ZA 3IWXA 3CGIA 1L3VA 3LP2B 3BN4A 2OPSB 2F8HA 3I55N 4NA2A 1WEXA 5KG2A 3MHYA 2BKOA 4UY8O 3IMXA 1M5PC 1RAFB 2VV5A 2OO4A 4M5NA 3VAFA 4LF9F 3TYTA 4CJVA 4HTLA 1JWWA 3OHBA 2G8HA 2IRXA 2Y3YA 1KQFB 4WYWA 2HHPA 3OYKA 2P1JA 3OVAA 2IIRA 4I4BA 3Q8RB 3GE9A 2FLNA 4QZVB 2Y0SD 2O8DA 2VGNA 4ZA1A 4DTOA 5GAHI 4H4KA 4U8VA 3PHEA 5M1FA 1SJQA 3NGDA 5K8NA 2O4GA 1VHXA 1BO5O 1N34F 1AA1B 3L2RA 2C22A 4FLZA 2RNEA 3PYDA 1N88A 3FLCO 1UKUA 3TO8A 2EX3A 3TTDA 3QEWA 2DVIA 2XRIA 1RP5A 4XK8C 3RU0A 4P75A 1S1VB 2GFFA 1LFWA 4CO5A 1KOOA 4KBIA 4OIXA 3HMJG 3O8WA 1CLFA 4CEAA 2PI4A 1UOCA 1YJWS 3KHHA 1GLBG 2EEYA 1RT4A 2MKHA 1F9HA 3QIPA 1RILA 3K9KA 2HF4A 4ZVSB 4DN0A 4CESA 1PJ6A 3MR2A 2ALZA 5KFOA 3GU0A 1L3SA 2NUBA 2J6SA 1WOPA 4MLHA 4J9PA 2BQUA 1WB9A 4ECSA 3QMQA 5L46A 2LSNA 3OUYA 2FQQB 3D66A 4IOXA 1RT7B 3ZSVA 1G7CB 1BWFO 4I2QA 1S7HA 3WNEA 2ZHAA 3D1HA 4DTSA 2C3UA 5GMEA 2X1GA 4ANDA 4WXOA 1JLGA 1JLFB 3LDNA 4TKTA 2DXEA 1A9NB 5AZJA 2LMIA 4E8UA 3I31A 2P9IA 2NSCA 2G9OA 2EFQA 2QX0A 4F4ZA 3MTJA 4MQ3A 4ECRA 2DGOA 2KJWA 4CJPA 5EWFA 2NXNA 2YQ3A 3CWJA 4ENOA 5EUHA 1T6CA 1TP7A 6FD1A 3LPTA 2E7XA 4LQ9A 4Z4IA 3L3CA 1NDCA 1QTMA 4O5FA 4CZFA 2WC9A 1WG5A 3GR0A 2XMJA 4KKOA 2E1YA 1GLCG 1MU2B 1S1XB 1B9FA 4NO7A 2H4WB 3UN3A 1NK9A 3EDRB 2K3IA 4USVA 5KFZA 4RW7B 1WSRA 5HOOA 2D9OA 4OZ3A 1DTQB 2AMCB 2VC0A 2B9YA 5MLCQ 4YN3B 5L9XA 2CWXA 4ECTA 1ATRA 4IO9L 1MG7A 1HKAA 2HKEA 2XQCA 3JYTB 2B9XA 1VSJA 2LP4A 1RWWB 1TKTA 2IYIA 3DI6A 3KG4A 1DAXA 3NS6A 1N36F 4JKEA 4KYZA 1K0VA 3T5KA 1JIHA 4H5NA 3JXOA 4U7UK 4AHCA 5EX5A 2KYXA 2VBYA 4F4WA 5HQ8A 2QSFA 3HVRA 5KFTA 2P9SB 2B4UA 2XO6A 2FJEB 2K3KA 4GC7A 4IDKA 2HFSA 3IFEA 1YITN 1Q8LA 1HJOA 3TAEA 3GV7B 3OYDA 2ZOFA 4W5TA 1M90O 3E51A 1I39A 5JMVA 3JSYA 2HNDB 3CC7N 4RNHA 4K8ZA 3DRPA 3SFUA 4FL9A 1NJYA 3U9ZA 3SCXA 3G6EN 5J2PB 4DV4F 4L73A 5ETVA 3CPWM 4PKDB 1NH8A 3A8EA 2UVUA 2ZZNA 4CNYA 4WIQA 3SV4A 5HQMA 4CF0A 2XWYA 3J7YI 2GX9A 4I6MA 1KFDA 3SDEA 4YHHK 4OI1A 1RYSA 3NH1A 3EXYA 4UQTA 4PYAA 4AM6A 1TK0A 4KFBA 1T95A 2YWGA 5H1SV 3I5AA 3AFGA 4OZ0A 2C3MA 4URSA 4QBUA 2VOOA 4DR7F 4X66F 3R1LA 4DFMA 3EN9A 3UNGC 4USJC 1RA7A 1S49A 3A13A 3C6TA 1IBKF 1HBOB 4M7XA 3MN7A 4OX7A 5BN9A 3HSDA 2QEXN 3ENHA 1S1WB 2HNYB 3I4HX 3MPUB 2OPQB 3N79A 1JLAA 1TU0B 2YY3A 3OL6A 3SMZA 4F4XA 5CYQA 4DPYA 5BREA 5KRTA 2IGIA 4IG3A 2EKYA 4HT7A 3RBZA 3HHLC 2F7TA 3U9DA 1FWPA 3FEZA 2BUNA 1LWEB 3TR5A 3AQPA 2UXDF 1FTRA 4K8RA 3HOSA 2DCUB 4G1QB 3W2WA 1T05A 1BLUA 4JI6F 1A0OB 4ZLJA 3OTBA 1NZAA 5ETPA 1URNA 2W8LA 3DOKB 3A1YG 4MT1A 4CIEA 2KXHA 1RCOB 4DG1B 5HVGA 3MUMP 3OYMA 5BXIA 4HYKA 3CCVS 3CW2C 5KFJA 1HBNA 2DPJA 1T0TV 3D67A 4Y2AA 1X31C 4XDCA 3WX8A 2ZOMA 3C66A 4J37A 3QAUA 3MEGA 3AOAA 3W5YA 1KS2A 3CF5Q 3QMLA 3D6HB 4YMEA 1DQ8A 1XNQK 1M1HA 1X4DA 3OTDA 2ZH6A 5HP1A 3CCLS 3BKTA 3BQ0A 4DL2A 4ZHRB 3SQGA 2W2QP 3BKFA 3FVYA 4JRQA 5D8HB 5C24B 3NF9A 1WJ9A 2MSTA 1KVBA 2EXUA 4C8NA 5FLXY 1M5VC 1ICEB 2ATCB 4CFBA 3VTIA 3D1OA 4WP3A 5JVGQ 3QLHB 4C4WA 4TU9A 2W4PA 4NXNJ 4E19A 4BLGA 3NAHA 2E2PA 1HBUB 4BR4A 3A12A 3H25A 4G9ZA 1H1VA 4K4UA 2YNIA 4G1PA 2BM1A 4PWDA 4UY8T 3WNHA 2KT3A 2KRRA 1UWBA 1M1KT 1MSWD 3RTVA 3JSBA 3PR4A 4P52A 3L6QA 1GX5A 2N3LA 1J54A 4RX6A 2QK9A 4ZPVR 4CJWA 2BABA 1T3VA 3VAMA 3LP0B 1S0VA 1HQEA 1H2TZ 4BE1A 3E66A 4P73A 2JWLA 2NRXA 2V94A 2R7VA 4DCHA 1YJRA 5KFCA 4Q7AA 1RDAA 1F9FA 2KO1A 3UCZP 4RNNA 4X4TA 2R8GA 4FJ5A 3JAMO 3LGNA 3K57A 2QE5A 4ELUA 3L2QA 4EU0A 1VI7A 3FGVA 3VGVA 1B64A 3ZTRA 2IDEA 2E7VA 2HBRB 2VDHA 1YJVA 5ADZA 3BDEA 4YOVA 4HWIA 4MFBB 5FJ4A 2VICA 3VAHA 1TELA 4BC4A 1VQNS 3BEXA 3H5YA 1NB7A 3ENBA 3CCQS 2B5JA 2OFHX 2R7QA 1H38A 3R1XA 4CK3A 2GNKA 2ZJRL 1TUYA 3JXUA 4U7UD 5KG5A 2IC3B 3OYNA 5LSOA 4DR6J 3SBMA 2OPRB 2MKIA 2PMHA 2Q97A 3F9KA 5FPNA 1GMUA 4HEA9 5C2DA 2IDOA 4F4YA 3W3SA 3V81B 3DRSA 4I6AA 2EBGA 1GXUA 2OEKA 4F36A 1C0TB 3CJKA 2FLPA 5CYMA 4DPTA 1K73T 2G0IA 5A0YB 3HPOA 3K2YA 3U27A 1XHXA 4HL9A 1HJRA 2YNFA 1FJGJ 2LEAA 1NDLA 5I42A 2Y1JA 4KC5A 1LW0B 3J80O 1SVDA 5KFHA 5KPRA 2ZJRQ 2F9TA 1FEEA 2FBYA 3HZ6A 3WXMB 4WFXA 1S4EA 1TMJA 2CJXB 2XB2D 4K8XA 5F2RA 4Q5VA 4FJLA 2HWHA 3AB2B 5KT6A 2P9GA 4ZP9A 4IDHA 1NK0A 2BANA 2GGPA 5AQTA 4JV1A 4P10A 5JICA 1IUJA 2E5HA 4MYUA 3CIZA 2IOCA 1WOSA 2HGLA 3SIPB 3MMBA 3TVKA 4FWOA 3EMTA 2PI5A 3DNCA 2R2UA 4W5RA 3HVWA 2ZGZA 4ER8A 3RW7A 4QWCA 2GQQA 3H2VE 3DN9A 3V1RA 1RA6A 2CQDA 3THYB 3AOCA 1BQMB 1U4BA 1FNXH 4IYQA 4NI2B 2VKRA 3CCRS 2DEIA 4B9NA 2ZHOA 5GADP 2VC1A 5GINA 2K1RA 2RRBA 4ELTA 4C8YA 1V4TA 2HMIB 3JS9A 4HR2A 1GXTA 3ZT3A 4EWTA 1WKLA 1LK7A 3N4QA 2L9WA 3EJMA 4M5GA 1T3NA 2OKQA 3WUHA 4DU1A 1S1TA 4CH1A 5JLFA 2P9EA 3KWGA 3DU6A 3Q8YA 1IWGA 1FXDA 4KRWA 5EX3A 3GCWP 2O8BB 4O0NA 1OH6A 3CIPA 1VRTA 1SC1B 2GAHC 2VFSA 1FKOB 2NUUG 3KK7A 1AZSA 1IR1A 2ZD1B 4F0KA 3W62A 1G15A 3MEKA 4A8FA 4M3XA 1FK9A 2OZSA 4USHA 3BBFA 3WQUA 4P71A 1LXNA 4LBHA 9ATCB 2V8DA 2ETJA 2HRYA 1YRUA 4WP8A 2ASLA 3W7BA 4YY3J 2FJBB 4YHHF 4JKHA 1QSSA 1U49A 4CGGA 1CZBA 4OLBA 4DU8A 3FFKB 3SUOA 1TYQB 3THWA 3MEEA 3L3VA 2XHBA 1DZ5A 2WB1D 4GVBA 1ROFA 1MLAA 3TJ8A 1YI2N 2ZWHA 1HRHA 4OQJA 4IWVA 2CQ0A 2AJ1A 3HL8A 2RS2A 1EP4A 1V5IB 3GYNA 4QS7A 3P31A 5BR8K 3VEXA 2ITGA 1V4SA 1A5XA 5FIIA 3NEKA 4RUHA 3OBIA 2CPZA 2BJEA 2EK6A 4BCAA 1OY9A 1UL3A 2UU9K 1HNIA 2X7IA 4KH0B 4JI7J 5D0EA 2NRZA 4B3MK 5C2GA 4DR1J 1RTJA 3C6UB 4NLCA 2CXEA 2YQ1A 3BQ1A 4JKCA 4B3SK 1VQOS 3NDKA 4B1XB 3MMVA 3S6EA 4Z94A 5EGYA 2GEMA 2RHQB 5F3ZA 3Q7CA 1IVZA 2P9NB 3BV8A 3FUYA 2Z2MA 1VRUB 3CMAN 1ZETA 2RDIA 1DLOA 3J7ZT 3AAPA 4KTZA 4O8KA 1IN0A 3TA2A 5C0YA 4D3GA 3DM2B 3HSZA 3CCJS 3UD3P 3OUYB 3P4IA 4E1MA 1LWFB 4KT0C 1J53A 3DOMB 4JBCA 3QPIA 2QYCA 1SL0A 2Z0GA 1M1GA 1N33J 3T7ZA 3PYFA 2KVIA 3KK2A 1LKZA 1QY7A 1J9AA 1T44A 2E2QA 1BI4A 3KLEA 3LAMA 4W5QA 1IV0A 4Q43A 1AUDA 3AO2A 4MYTA 3IFRA 2J9DE 2RDDA 3TWHA 5HVFA 3VQQA 4C0HA 3I56N 1XNQF 1EKEA 2XSJA 1PC4A 2IIHA 4JI2J 4ITSA 2Q36A 1SS6A 1NRKA 4LF6J 4F50A 2VQFK 4TVAB 3TUJC 4IR9A 2OANA 3J81Y 2G8FA 2B8PA 3MR7A 1XBWA 4CK1A 2ZDPA 3O1BA 4WF9L 1UW4A 3O9SA 2FVCA 3VAIA 3ZFVA 3AVCA 1B0TA 4X2BA 2I8EA 1FNOA 4KKOB 2H65B 1JLEA 1Z4UA 2QKBA 4BWJA 2DR9A 1PKUA 4CECA 2MLZA 4OYBA 4EGLA 4ZVRB 4K4ZA 3OS0A 1YG0A 2NCKL 4EO8A 2B6AB 1U1QA 1JK9B 4B1UB 3CCMN 4ED8A 3ZT4A 5CAAA 3GOIA 3QBCA 3BQ2A 1ZC6A 1KHWA 2V8HA 1WSGA 1FA0A 3WC2A 1BD6A 3O1WA 3CC4N 3EGZA 5FPEA 1R8BA 2YPZA 2X51A 1ZAXA 4WF9Q 2APOA 2ZWPA 5E3CA 5HK4A 5KT4A 2YPYA 2AW0A 4ECVA 1NGGA 2KYZA 3MWPA 1Q7YT 1TKTB 3DDNA 1AXQA 2DISA 1BE4A 4CYUB 5D4NA 2AEFA 3H90A 1AYEA 2H9ZA 3ISZA 2V52B 5E3PA 3SV3A 1QD1A 3PY8A 2R7WA 2C2EA 4KHRA 4X65J 5KFSA 1VLYA 3NMAA 2AYEA 2JFDA 3TEHB 2QA4G 2E4LA 1ZZFA 3GILA 2HWTA 5J2NB 4IDKB 4LFAK 2JL9A 2ZHBA 1ATNA 2E9RX 3BSOA 1HW8A 3IR7B 1S6PA 2QM1A 4DQSA 2EFOA 3AA8A 1UAXA 5E0OA 5B0AA 4H5WA 1VQSA 2PGCA 1NJWA 4BRFA 3NCRA 1BWVA 3DRPB 3NMUA 5HBMA 5HQLA 1MW7A 4FF1A 3OY9A 4EHUA 2LQBA 4J7CA 2P51A 3B78A 1WC5A 2BOAA 1H7WA 3BJYA 3H4DA 3SSRA 2GTDA 3L2UA 2YBVA 3SXLA 3JSMB 4R25A 1K6YA 3AAWB 1CJKB 4GVLA 4ED1A 4RG8A 5M1NA 3TWZA 4JI0K 2JRSA 1DARA 4CP5A 3SEOA 3L0QA 5CD4A 1JXEA 4OI0A 4FK0A 2LQ9A 2IS3A 2P9PA 1R8PA 3KK3A 2XI2A 3T1YK 3PIPL 3CC2N 2V4JA 5BR9A 1SJ3P 4UZCA 1RT1A 1HNXK 4DSKA 4PXCA 2YKNB 4JP8A 5F8HA 1Z26A 3BSNA 3C6TB 2EBEA 3DOLB 4NLYA 2HHHK 4J9RA 5A2QY 2NNWA 3LDOA 4OX8A 4KHNA 1QDUB 1VJWA 3NAIA 1RHUB 2B43A 5SZTA 3GONA 3ITHB 4G65A 4M3ZA 4K4YA 4O3RA 2CJBA 2YKMB 2YHAA 2UXBK 3CDWA 2GX8A 1JLAB 4BACA 4ES2A 3PIPQ 5DJBA 3ZSZA 1H72C 2A5XA 3IG1A 1TKXA 3OBWA 1QHTA 1F1BB 7FDRA 1GQEA 1JJCB 2GUPA 2HGMA 2VG5A 4GVMA 3P39A 2RDJA 1HWJA 2F5GA 3FZKA 5C2FA 1OJ4A 3PCOB 3W2WB 2MY7A 4CTAA 4JHDA 1UFWA 2HS0A 4Z37A 4B9LA 3KLFB 2CJ9A 1IM6A 3OXGA 4I6YA 2KFZA 3FEYB 2ZITA 3R27A 2KQ2A 3IAM9 4CJLA 2SXLA 1RBAA 2VB6A 4H4OA 1VRQC 1ASWA 4M63C 5FRMA 2E9ZA 4CLYA 3AGKA 2BE2A 1CSJA 3G8SA 2HHWA 5IZHA 2BJ9A 4QYZJ 1YJNN 4Y2CA 4RW4A 4LRBA 4MTPA 1RBTA 5BYRA 4JI5J 4CHPA 1H6KX 3I82A 4Y2MA 3DGVA 3OR2A 3EPGA 2QG9B 3PYGA 3VEWA 1GH8A 3P38A 2YKOA 5D78A 3AA9A 1NGEA 2FXUA 2Z2LA 3ZZOA 4OPAA 4V1Ak 2FUG9 3MMAB 3D3CJ 4R0JA 4B3RJ 1GX6A 3M5RA 1YKWA 3T41A 5BR8F 2QL7B 4LFCK 3UKUA 3MD3A 2YX4A 3OW2M 2OSQA 2UU9F 1EX4A 1EAYC 2VG6A 1S12A 2D0BA 2F9JA 1KN6A 8AT1B 4DTNA 2F4FA 4IFYB 4A8MP 4RJVA 3SAHA 1YX2A 4H4MA 2N7CA 5GMKa 4KHYA 4BRMA 1H2VZ 2MGZB 1X4EA 4O23A 3IWNC 3WNFA 3NGIA 1QQNA 1HQEB 3UNYA 2IY5B 1HNWJ 1HNVB 4XDDA 2Y0BB 3OTCA 3R5GA 4WP9A 1D9FA 4ICLA 3UCUP 4ECUA 4OX9J 2KT2A 1VQ5S 3NAEA 2WW8A 3ILOA 4O44B 3K58A 1XMQJ 1R7IA 1VGYA 3ULDA 2GV1A 1I94K 2DH8A 4CJKA 3FBCA 2KHCA 2KH9A 3IR6B 2O8CA 2Z56B 2G2OA 4FYDA 1B70B 2IA0A 1R0CB 2DRDA 1GNKA 2VG7B 3PRBA 1TKDA 9RUBA 5KTQA 2B5JB 3PFEA 3U8XA 2HNZB 2DGQA 4GKJK 2A6AA 4BE2A 3FE1A 1XERA 3UI3A 3OFEA 4W5NA 3A8KA 3HK2A 2X1FA 1JCEA 1KVAA 1IQTA 1KLMA 1LK5A 1X4AA 1KDNA 3DRSB 4M5MA 2ZBCA 1U1OA 2VQFF 2C28A 4FN5A 1U2VB 1W2BR 5ETMA 4CM0A 3DRRA 3PJXA 5I42B 1NGFA 4C7QA 3S3OA 1HMVA 4C97A 1V3ZA 3H2LA 1FRKA 4EYIB 2GJIA 3G86A 3HO1A 4WKRA 1HL6A 2YJFA 2E1AA 1Y10A 1SKSA 2O3DA 1WC6A 4WFYA 5DO2A 5JMNA 1WORA 1JJ2R 3CCSS 2F8MA 3MGJA 4WE1B 2GGPB 4M41A 5HMXA 2QL9B 3N28A 3VCDA 2FC0A 1Y5IB 2XY7A 2GQCA 2XMTA 5LJVA 3D68A 4PR6A 3LP1A 3MFHA 3RMDA 2ZBRA 1YUWA 3WNGA 1U2CA 3EO3A 5HO4A 3GIMA 3VF4A 2DR8A 4UW2A 4DL6A 5HATA 3PO4A 1SQGA 2HK2A 2P9KA 1FJEB 4WYBA 2C2KB 2RH3A 1ZM3A 1Y7PA 1N52B 3VPZA 1J5OA 3VHQA 2D3O1 2IA6A 3OYJA 1KAYA 1EKSA 1KXPA 3DLGB 4DV0K 4DV7K 2CPDA 1PCAA 3KUEA 1TFWA 2VF3A 3HSGA 4LFAF 4NXMJ 3OQ2A 1SZ2A 3LZIA 5CCMA 3LPYA 1FI4A 4PG5A 1GAOA 5GAHP 2CQ1A 3BF1A 3BGLA 4WQ5A 2N4CA 4MKYA 1S9GB 4IOAL 5AXLA 1LOUA 3CQYA 4CGIA 1HFEL 4URGA 5CZ2A 3O5BA 1AZSB 4QU6A 3QFUA 3PW7A 1S6OA 3F2KA 4KB1A 4KI6A 1GK8A 5L8RC 2DFHA 4ISEA 1NMDA 4ZVEA 3ZETA 3SK3A 3BP8A 5CE3A 1PBUA 2CFXA 3FNNA 1RADB 4JI0F 3TSQA 3CCUS 2HVHA 3I0SA 2AA4A 4IOAQ 3MM6A 3DLEA 3O44A 5KG3A 3MEEB 3ID6A 2P9LA 4LD0A 3T1YF 1YVFA 3VGKA 4DR4K 5HLFB 4BRQA 1S7IA 2VFVA 2QN6B 3S7RA 1HNXF 3K2PA 3KWMA 4K42A 3L2WA 3WXLA 3GJQB 4FLVA 2HHHF 1WHVA 1VMBA 1WKKA 2H3GX 5FPDA 3EZWA 4CO0A 4FF3A 3HP6A 2UXBF 1S5JA 3TAPA 2LXUA 2HEKA 3KJVA 3VENA 1DY3A 2NYHA 4QOTA 3ICLA 3SQ2A 1S6UA 3IS9B 3WQTA 3GSDA 5KI6A 4CDIA 3MAQA 2CIMA 2RILA 5K5MA 3TSPA 1UVIA 2OEMA 2CJQA 3FR0A 3HLUA 4A57A 4RW9B 3RMCA 1X4FA 4BRKA 3HPGA 2O8EB 3I96A 1RT5B 3C15B 5U47A 1UFLA 3O8MA 1NMEB 3DGPB 3BEGB 3GQCA 4FWRA 1W26A 1RWMB 1Y5NB 5FDLB 4BR7A 2LU1A 4JN4A 3PG9A 1P90A 5K8PA 4XPEA 2HHSA 3U02A 1ZPWX 4UZBA 4JI8J 3MX2A 3SUNA 4I9QA 4Y2KA 1GOBA 3LH2S 1DEJA 4OKJA 5DGAA 3SNNA 3AA3A 3G82B 1LWCB 3MM5B 4O3QA 3O5TB 4ZPAA 1NSQA 1CJUB 1WBDA 1N34J 2DH9A 4CGDA 3GYGA 5ADXA 5ETOA 1MWYA 4NEYA 4BRGA 4P7TA 2XC9A 3SAFA 3OS2A 2EHGA 2ACMA 2DXDA 1BUXA 2QLWA 5AQKA 1PC5A 2EI5A 2HLTA 2J0QD 2DIVA 3THVA 4J2DA 4N47A 1YZ7A 1SH3A 1JLEB 3BY5A 4TU8A 4UUXA 1RBLA 3CM5A 4LFCF 2MTLA 3M1VA 4R5PA 3ZTPA 2CH5A 2A40A 3Q2SC 1D4XA 3PZPA 4WTYA 2VONA 3DFEA 1SAZA 2BRKA 3WT0A 3MURP 1LWXA 1K8KA 2XLKA 1UVKA 2XY6A 3C16B 1RWVB 5A8RA 1VR6A 4CWBA 3THXA 2DJWA 3UO0A 1UVMA 2IBKA 2F63A 1BCMA 2NQPA 4W5OA 3H3NO 5LMUJ 4KHSA 3NBPA 3VESA 4CZIA 1LAVA 1X3MA 2HVDA 1RSCA 3D45A 2VOPA 4K4XA 4DHYA 4IRDA 4PYDA 4E3SA 1RBUA 1WUAA 5T7LA 1TL4A 4CEZA 2NRTA 2RMLA 1BA1A 1NOZA 4CJ5A 5J2QA 4ANCA 2J7WA 2IM3A 3WXJA 3RRKA 2XYPB 4OYPA 2X1BA 3KVGA 1UZHA 2BUPA 4JK8A 4QR1A 2LA6A 3ZXWA 4FOEA 4USWA 1UFKA 2R7RA 1Q18A 1RDBA 1O6XA 2EFGA 5L39A 3GPAA 4DV6K 1RT3B 1Q1KA 1UA0A 1S6PB 4KREA 1TL5A 4GKJF 1OPIA 1RHRB 3RB3A 1JNRB 2FC8A 2CVIA 2PIIA 4YB7A 4ELVA 3FQLA 5C7PA 4CZHA 4RWTA 4FM1A 2HGNA 3KUGA 4F9OA 1L3TA 4RU9A 3B6OA 3GJTB 5F41A 4JYAK 2ZFHA 1D9AA 1YITS 3EGVA 3TTFA 1W9HA 5B09A 1T02A 1IWAA 3V6KA 3CJ4A 3CCLN 4Q0BB 1NUEA 4ECQA 5KFYA 2DY1A 1S48A 1PG5B 2DR6A 2HHVA 2BKNA 3K89A 2U1AA 1XMOJ 2V4JB 3HZEA 4QQBA 5L38A 1N36J 4BROA 3POTB 4ZIWA 4L75A 3VQEA 4J9KA 1CLQA 1IKYA 1XC9A 3I9ZA 3J8AA 1XQSC 2V50A 1VBKA 3H45C 3CE8A 3FBFA 2GBZA 3TVYA 3P4UB 3CCES 3QGPA 4A47A 3CFRA 5K14B 2GA7A 4RUAA 3BBCA 3TNVA 2QA2A 5IT9Y 3CD6S 4EHTA 1N5YA 4OZ2A 4DHVA 3O6WA 3O1LA 3KTQA 3D28A 2VG5B 2VPYB 4AQYJ 2ZKTA 3L9ZA 1FCAA 4DV0F 4DV7F 1YTAA 2XLJA 2YWFA 4CGJA 1QAJA 3VA0A 1OMSA 4CTAB 4JHDB 1T7PA 2DRBA 4X84A 4EBDA 4ID8A 4DR5J 4DX7A 3TSUA 3V9XA 4KTWA 5HI7A 2HAIA 5AQQA 3M1FA 4JRPA 3CETA 1XI1A 2FVRA 1DT9A 1VSKA 1VQNN 4JI1K 4C8OA 2W42A 3CCQN 4CLPA 2JLEA 5ETKA 1N6QA 4X4RA 4NLTA 2BYCA 1YVUA 3HSCA 4FVCA 1WACA 3J81O 3HT3A 4DR7J 5RUBA 2WSCC 3QERA 4Z4EA 4GV6A 5DG8A 1FD8A 4XIUA 1IBKJ 2JC1A 3OR2B 4Z4FA 5AQOA 3A4TA 1YBAA 1YK9A 2E1CA 3LGMA 4YORA 3QGIA 4DR4F 2Z2ZA 3M6VA 3EL2A 3FRZA 2N82B 3KLVA 1WNEA 1VHFA 3VGMA 3H08A 5T14A 3QSIA 4G6VB 1YJ9S 4QOZB 3C6HA 3UKUB 1VK3A 3I9V9 1ESVA 3QEIA 4PKHA 2VG6B 3D6FB 4N5SA 5DMRA 5D3GB 2UXDJ 2HG4A 4N77A 2POKA 1FXLA 1EJ7L 1HR0J 2IVOA 4ID5A 3QRPA 2JGUA 1VBYA 1QQCA 3QNNA 3I5BA 1PILA 1JNZB 2PO4A 5D6GA 4ZKAA 1DTTB 2VBWA 3D1QA 3W3DA 2YXLA 4X4VA 1TKZB 4ZP7A 1CVJA 2KTQA 3UB5A 3AXMA 2AZ3A 2O01C 4OZ5A 4ICLB 3LP3A 3CCRN 3NLCA 2DHSA 1IBCB 1RTDA 1AUSL 2GQ2A 3AJ1A 3M8PA 2D0PA 3Q2TC 3AY9A 3BYRA 1GLAG 4WFBL 4CO4A 3MXHP 5KFRA 4A2AA 4CEDA 3NS5A 3QWUA 4V19J 3S3MA 5ETRA 3GJSB 3PKYA 3AGRA 3LW5C 5KT2A 5AJ3K 1PJ7A 4DXLA 1O5JA 3B4MA 4CVNE 1EETB 4P7VA 2QXFA 3KNGA 2CDQA 2LECA 1QVGR 5MLCV 2FJAB 3AOBA 4MK7A 3BZKA 5HMYA 5L1JA 3AAQA 3UWTA 2VZ9A 1KLMB 3OJUA 1HLWA 1KEKA 4WFBQ 4PKGA 2Q6CA 2D74B 5KG7A 5A8WA 3CM6A 4ZLLA 1XR5A 4X4PA 1I51B 1VC6A 4CT8A 1Q16B 4HHTA 1S4FA 3PTWA 3BS9A 1NKCA 4R79A 3BH6B 4M3WA 3HP9A 2YWEA 2QZ8A 1QTNB 4CEQA 5GVQA 4EP4A 1OSDA 2E9TA 1VQKS 1QE1B 2Z4PA 2VA3A 2QXLA 4M3RA 2C3YA 2B4VA 2WVDA 1NNDA 3LANA 2CNOB 1D5AA 2CZ4A 1XNRK 1PSDA 1YJ7A 2VFTA 2YKPA 3HKWA 1VQPS 3IO1A 3HHLA 3D2EB 2PA8D 3EEQA 2NZTA 5B8HA 3M2RB 1WG4A 3WIUA 2JH3A 3IAS9 1S6QB 3O2IA 3SZ2A 2QMWA 4CHYA 2ERRA 2W7AA 5HJYA 2B8QA 4B3OA 1T9VA 3BGFA 3G6XA 3IR5B 2ZH1A 2BRLA 3V6HA 4M3TA 2PC6A 4B1ZA 1NBWA 3KWIA 2MHNA 2UUCK 2VIHA 1FXRA 4HACA 3OL9A 1VQON 4LRCA 4OZJA 5A6PA 1K8AO 2XULA 3AO1A 3ZSXA 4ERDA 3C7NB 3KKSA 3TR8A 4JKFA 2L9DA 1RAAB 1F5BA 3SCIE 1RTZA 3W9IA 4J9SA 4DV2J 1IKWA 3SJJA 1RABB 2KI2A 3GL1A 5HRRA 2OD6A 4DV6F 2A3ZA 5A8KB 3O4WA 3N4WA 2YVSA 3UVJB 3CCJN 3OL8A 3VQ9A 4DSJA 1BIUA 3FZFA 3MFIA 3OHAA 3KKFA 4OV6A 3AD8C 1KD1T 4P72A 2HQ3A 4UF4A 3QDKA 1IG8A 3QWPA 4GO7X 3RYLA 1G1XA 4P2MA 3M9MB 3QETA 2F3JA 3V9UA 4NYPA 4O4GB 3DXMB 2G8KA 3RAXA 3H7HB 4JYAF 4O3PA 3O3HA 2Y1LB 4X64K 3ZETB 1S3XA 1OKJA 3ILLA 2BR0A 4Y65A 1SV5A 4EEYA 4YP3A 1U1PA 4PG6A 4YQWA 2X6NA 3WIVA 3I0SB 2DHGA 4GMKA 4FKXA 2XBPA 3DLEB 3E8OA 3TAMA 5DGBA 3HFKA 5CH7B 1KQKA 3B8HA 5J1PA 1Z2ZA 1NO8A 3E2EA 2FBTA 4H5VA 3DYAA 1REGX 1NLVA 3TI0A 5DZ7A 1GMWD 2HRTA 3M9NB 3E9LA 2NUHA 2ZUGA 5FLXU 3P45B 4M94A 2IJRA 4KSEB 3MUVP 1L3UA 1FX4A 4LF8J 3AVHA 2V2QA 3D0HE 3C14B 2V9KA 1OVYA 3KOAA 5KFAA 4WKYA 2OAUA 2XYHB 4DN9A 3O9TA 2W6KA 1NU0A 4F3QA 4CF9A 2E88A 2UYTA 2VPWB 5GAEU 1X3NA 1X4HA 3H0PA 4YB5A 3MPVA 3PSIA 4DQQA 4CF2A 4B1YB 4LF1A 5LJWA 2AJ2A 2KT5A 2ZC4A 3GJRB 1H98A 2B4PA 1RAHB 2MJNA 4ZVUB 4JI1F 2LQ5A 2V6AA 4AHVA 2PN6A 1JLCA 1QJHA 3OHRA 3W2VA 2CKWA 4UOHA 2CZVC 5ITHA 2GVZA 2ABYA 2PEBA 5C42A 3U7JA 4CI6A 3SAGA 4PL7A 2KRBA 3QYYA 5KFBA 3BYPA 2HURA 2A1SA 1PO6A 1S97A 2RSQA 3VGSA 2ZZTA 4OHYA 1H3DA 2W9AA 3OBYA 2IVNA 2W1BA 1FERA 1FX2A 2J0XA 2EG1A 3EM1A 4J2AA 4A5BA 4IFVB 1O51A 4TQSA 3T9ZA 1Q9YA 4DTPA 1QQOA 1BHLA 5B08A 2I1RA 3D4JA 4A59A 2HZCA 4OJHA 4KPCA 1SQFA 4OYWA 2G8UA 2JEIA 4OYIA 4A61A 3EDQB 1FKPA 2OPPA 1VQMS 1X4GA 3HHNB 4OV1A 1NSAA 4XTTA 5AFUH 1QAXA 4CBUA 4RNMA 2WTFA 1HPZB 3AH6A 2HQIA 1NGIA 1K8KB 2R2RA 1F21A 4DTXA 4XO0A 2OZMA 1S9EA 4LRAA 3THXB 3W0LA 4Q8FA 4L6V3 4JV5J 4E2FB 2RN2A 3AVAA 4NXNK 1C0UA 3N4PA 4B1VA 3R5AA 3THPA 3IRWP 1LV5A 2HFNA 5H1SQ 1ZYQA 1FDNA 4Y1DA 4CLZA 5J2QB 3K5MA 3QT5A 1UZDA 3SCKE 5F8MA 3O08A 3BZQA 2CDRB 3I8DA 5KFUA 2V7ZA 2GZOA 2J6TA 1RBSA 4KH4A 5F0XA 4FJNA 3LQVA 3MM7A 4AL5A 2QLBB 3NP5A 3TU5A 5AQWA 2YX7A 2EW9A 3OD2A 4FP9A 4ID1A 3KK1B 3QNWB 2JEJA 3SLCA 2B0GA 1Q95G 1UEVA 5LL6d 3BGRA 3KJNB 1S5ZA 2OH2A 2C3OA 3R1HA 1TUWA 3KMSA 1MDUB 1J27A 2DGUA 2DK2A 2EVZA 2WSFC 3CULA 5KFGA 1YGYA 2DPIA 2DBBA 1BQNA 1RBRA 2JWKA 5E33A 1X60A 3H46O 3SMPA 4F02A 4FBUA 1NGHA 3W5ZA 1WDDA 4Z4CA 3IAYA 3EE9A 4TXSA 3R7SB 1L3KA 3ATVA 1TL3A 2A42A 3GBTA 3DMJB 4JB8B 4DR6K 4BWMA 1WC4A 2C2OB 2FVSA 1CPZA 2ATQA 3G10A 4F25A 5FRNA 3ASMA 1XNRF 4FJHA 4XH4A 3KLHA 3SBGA 4Q2MA 1P8ZA 2EK1A 1OH7A 1N5VA 3M30A 2VA2A 1JJ4A 3M32B 1IKYB 4RW6A 4CJEA 1NGJA 1RYRA 4LH5A 4B1WB 1B0VA 3C6AA 2O8FB 5EXWA 3TVZA 2ZH9A 1WAJA 2UUCF 2V4QA 2XY8A 3W65A 3GFZA 1AW0A 2M4MA 2YNHB 5L1IA 4Y3CA 3FGUA 4IQMA 4PWUA 4ZVFA 6AT1B 5IQ6A 3KHLA 4WYLA 2A6OA 1RT6A 2WUSA 2DNYA 4K5SA 4KHPJ 1N8RO 2RKIB 4DTRA 2FHJD 1VQ5N 5F9NA 2AGQA 2Z8QA 3G87A 3MM9A 4HI2A 1FWLA 2XYGB 1NPKA 4W4MA 4HCBA 2ZVSA 3O9RA 3NF8A 1NEEA 4NA1A 3R3TA 5GAEI 3I4PA 4KRFA 2NRWA 2L41A 2W7OA 3U6FA 2FJVA 4W92B 4F0HA 4Q2LA 1CQMA 2RQ4A 4IXCA 1HQUB 1NXIA 4FWLA 2W9CA 4O3NA 1RLDA 4ED2A 3V4IA 3ZX0A 3ENQA 1QM9A 2W25A 3B82A 1K8AT 2MSSA 5JS1A 3U3YA 4OHVA 2GO9A 3M6WA 4FZVA 1A5WA 1RT2B 2KU7A 3FBBA 2KG1A 3VETA 2B7CB 2XTJP 1VFJA 4OLAA 4J90A 2ASMA 4FWMA 2QI2A 4J9NA 3BGOP 2QWLA 3RR8A 4DZDA 3W8GA 4AXJA 5KFNA 2CQ4A 4NLOA 2DH7A 2HZVA 2H51B 3VA3A 2AP1A 1QUPA 2DIUA 1JL2A 2ZJPL 3P5BP 3NNCA 4CERA 3HDSA 1HW9A 3FCWA 1RWPB 2J76E 1NLKL 3OVBA 1EO1A 4DV4K 4K0KK 3VAJA 1JJHA 2V63A 4YY3K 3CCSN 2YH0A 2VQEJ 5AQYA 4ZP8A 5ETLA 3R9PA 2GELA 2Z2YB 3DXBA 3CJ7A 2MQOA 3F9MA 2ROPA 2ILZA 3LM2A 1KC8O 3FJ2A 4KY3A 3MAAA 3GYXB 2FD2A 3UDVA 1HUXA 4CBWA 4AXIA 1K47A 3UE5A 4UTGA 3VEOA 1REVB 1XJWB 4IUFA 4ATNA 1SJ1A 4ZPBA 5AQMA 4M7YA 2M70A 3QEPA 1RTDB 1LCUA 1X5PA 2AIRB 2DNKA 5IM0A 4QWDA 3M8RA 1WTFA 5AZIA 3U1MA 5C25B 4HH0A 4XAKA 1C1BB 1F2HA 4H0PA 5HROA 3L2VA 1C1CA 2K8GA 2LXFA 4LF5J 4NLSA 3H59A 3PIOL 1YAGA 2OMOA 4G3IA 4DU7A 4P9SA 4NEZA 1NGDA 4LH4A 4FW2A 4OI2A 4MKBA 3EGNA 2F9DA 1K1QA 3KHYA 2YH1A 2BQ3A 2AJ0A 1JXBA 3MN5A 2QL5B 2K7KA 3LALA 4NZ0A 2I6WA 5LT5A 4X62J 3TJAA 1OQ3A 3CO9A 1VOMA 2G1HA 3S3NA 2MMYA 3TZXA 3PIOQ 4JI6K 4B3MJ 1YRXA 1RNHA 4B3SJ 3CCUN 5F8LA 5AE2A 3GCXP 2CPIA 4CD1A 2QFIA 4M42A 4LSNA 4EAHD 3VVTA 3A3OB 4LF6K 2NSBA 2MQMA 3PX6A 3PW4A 3HHLB 3T69A 2CADA 2FZKB 1TL1B 3GP9A 1QAYA 1WWHA 2M3DA 2FBXA 3OYFA 5BRHA 4M5JA 5IT9O 4DLEA 4O0IA 1RWOB 4FSVA 4B9TA 4NXNF 4UQGA 4BVOA 2MQLA 2OLWA 4CJRA 2DNQA 4FZYA 4HACB 2HFOA 4WWSA 1IBMK 3R6GB 3ZNUA 4RKUC 2DPNA 1CC7A 3EVWA 4M63A 1X5TA 2YHYA 2KFYA 1YTUA 3F73A 1HHTP 4F4AA 4MDAA 3OYCA 1KRPA 2NXEA 4RU2A 3UDEA 2HVZA 1VLOA 3ZSQA 3V6DA 1KNZA 2W41A 3RG6A 2MDAA 3N6LA 3CCWA 2HHUA 1RCXB 3W60A 1RAGB 4YB1P 3MECA 1ELOA 1FRIA 1M5HA 1U2FA 4KAIA 4NLVA 2A1RA 1EARA 4DPXA 3IUCA 3G25A 3PNIA 1Q0NA 4WU2A 4CFDA 4ES1A 1KAXA 3VERA 4HTIA 4DMNA 3SQOP 2IYGA 2HBLA 3AB4B 2DHAA 3W66A 5BRFA 3O4QA 1JLBA 3M8ZA 1KKHA 4DV1K 2LU2A 1CJVB 1X5SA 2MY8A 2GVDB 4NYZA 4M5IA 3QO9A 1JX4A 4DR6F 3QESA 2CQIA 4QIWD 2E5LJ 3ZC4A 3TAMB 4IFEA 1EXQA 3A5LC 4RWWA 5J1EB 3VVUA 3OTOJ 1I3AA 1E6YB 2JLFA 4K41A 2DT9A 4AE5A 1NM1A 1VQ6S 2R42A 4C11A 4RW8A 2BXJA 2LEPA 4DF4A 2E66A 2KN4A 3VQ5A 2H1YA 3L7UA 5B0BA 2NPIA 1IR0A 2KJVA 3BGUA 2CH6A 4PXDA 5DM7L 1TV6B 2HQGA 2R8JA 3CJ0A 1F5CA 3AVGA 3TAGA 4LFAJ 1DKGD 2M52A 2D1CA 4QR2A 2AF6A 2ASPA 1HI8A 4CZJA 4KI4A 1ZM2A 3HCXA 3K17A 1U1MA 2BX6A 2DHHA 2V8VA 4J9QA 1RK8A