3QLHA

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase,hydrolase/inhibitor
molecule keywords reverse transcriptase/ribonuclease H
total genus 144
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qlhA05
1HNIB 2HNZB 2Z1HA 4IG0A 4FJIA 1LW0A 4LY7A 4CJUA 2OZSA 4E3SA 2WONA 3QEXA 2VA3A 2IC3B 4PY5A 3ZSYA 3AA2A 2KZMA 1L3TA 1ZTWA 3T5HA 4HCBA 1RTHA 3MF5A 3G6XA 4MIBA 3ICLA 4WYWA 3K5OA 4KKOB 4IG0B 3PO5A 1WSEA 5F8LA 2IA6A 3UQSA 1SKWA 1C1CB 2IJNA 3CQ8A 2HNYA 2R8HA 3VQPA 2VWJA 3C94A 3SUNA 3ITHA 4RUAA 4CK1A 3LZJA 3K57A 1S1WA 1CXQA 3HVAA 1DLOA 3H08A 4IRCA 4M95A 3TARA 4EEYA 2HHUA 4E1MA 3WNEA 3OS1A 3ZSQA 3MR2A 3DRRA 3LAMA 3D0PA 4AHTA 3LP3A 3LWLA 4CHYA 1NK5A 4M3WA 2B6AA 1UA0A 4Y34A 4ZVGA 4CEEA 3I8DA 1FXXA 3EZUA 2YKMA 4IFYB 4CIEA 3DRSA 4KHUA 1NK8A 2J6SA 3PW2A 1SL1A 4EYHB 3QZ7A 4NLTA 3HJFA 3M8PA 4NLVA 5K14A 3B6OA 3ZSOA 1KVBA 2IM0A 4LD0A 4RW4B 2I5JA 3LP2B 1RDBA 4TSXA 3OYCA 4O3QA 3WNFA 3M9OB 5I42A 5KFDA 4IH7A 4M45A 1GX5A 3MEEA 3O4NA 4IH6A 3QGIA 3OS0A 3KLIA 1BL3A 2G8IA 2JC1A 3M8SA 4UQGA 1QE1B 4B9VA 3UR0A 2HMIB 2FBXA 3IS9B 4FZYA 4F3OA 1RBSA 4CHNA 4IKAA 4M3ZA 3KNAA 3F73A 4DLEA 1SH2A 1LW2A 1JLQA 4RW8A 1RA7A 3E01B 5CY4A 3VQ6A 3CJ4A 1D9DA 5J2NA 3T3FA 4DSIA 3NCIA 3BQ0A 4MK8A 1C1BB 3K59A 3MECA 1C0UB 2IBKA 1QE1A 3IN5A 2HMIA 3HPHA 5JS2A 3V1OA 3LPTA 3P1GA 1SL0A 1XHZA 4OGEA 3OYHA 4NLGA 1FK9A 2XO7A 3AO2A 2W7PA 4DF4A 2XI2A 2JEJA 3AVLA 2JEFA 1IG9A 2BRLA 4B8AB 3V1QA 4DTPA 4H4OA 4Q0BA 2UVVA 2A1SA 4JLHA 4Y2AA 1EETA 1VRTA 3BSAA 1LAVA 1NK9A 4FJMA 4ECRA 5JXSA 1S6PA 4KI6A 1C1AA 4ED1A 2ASDA 1ASVA 4CJPA 3V81A 4OLBA 5HRNA 3L2QA 1SKRA 2IJFA 1S1UB 2QKBA 1K1QA 2W7OA 4CEQA 3C6UA 3V9UA 5J2MA 4AHUA 1JIHA 2W8LA 5T14A 4E1NA 1RBVA 3QIDA 3RRGA 1T05B 4TXSA 1Y97A 1R0AA 1JKHB 3QINA 5KTQA 4JRQA 1X9SA 5CYMB 3KIOA 2E9ZA 4J9OA 4RNHA 3KLFB 3ZT3A 4QWBA 1TVRB 1IKWA 2C2DA 4XIUA 3RMCA 3NAIA 1EKEA 1JLGA 4BDYA 3CWJA 4JV1A 2IS3A 4AILC 3Q8SB 2F8EX 3FFIA 3OL7A 4CJ5A 3OYDA 1BQNA 3OJUA 5EWEA 3SUOA 2IDOA 2ZE2B 3PJWA 4CEAA 5F8HA 4LQ9A 3K5LA 1OS5A 4DL7A 4O4GA 2G8WA 2XWYA 3KLFA 4JS5A 1TVRA 4NLUA 4O3NA 1SUQB 2R2RA 4IFYA 4CGFA 5KT4A 1JLGB 4LH4A 1NKEA 3IRXA 5KFSA 5JUMA 1RYSA 2YHAA 3AO4A 4O0IA 1U47A 2C2EA 3PUFA 2HW3A 4DTXA 4PQUA 1VSKA 3IAYA 3DYAB 3KK3B 1NKBA 3VQ8A 2I5JB 5KFHA 1RT2B 2OPSB 2VG6B 2WRMA 1VK0A 3OYIA 3ISNC 4YNQA 1JLBB 2OYQA 3AVKA 4B9TA 3DM2B 3AVMA 4KAZA 2HHVA 3KK3A 2AGOA 5KFGA 3HL8A 1WAJA 4IRKA 3NHGA 4XO0A 1TKTA 3L2RA 2RDJA 1RT2A 1UWBA 1W25A 3OYMA 4ZTFA 3PW7A 4FJHA 3MEGA 3KHRA 4ZP9A 4RNOA 4I2QA 1IKYA 2V4QA 1NKCA 1FKPB 4FJ5A 3LAKA 4CGHA 5KFVA 5F8GA 4F2SA 1YTAA 2BANB 2AWZA 3BGRB 3N6LA 2FVSA 5C42A 2KFZA 1WSFA 4KBIA 1TAQA 4AHCA 1ZTTA 3CJ2A 4AHVA 3JSMB 4B9LA 4WFYA 4I2QB 3BDPA 2W9BB 1BQMB 3HP6A 1TKXB 2DFHA 4FLYA 4CJRA 3RAQA 1S97A 2FBVA 1S9GB 1KVCA 2XY8A 3LP0A 4CJ4A 5C42B 1TKZB 1VSMA 3ZT0A 3RB4A 3L2UA 2E6LA 4URSA 1SH0A 4FBUA 4DTNA 3JSMA 2QE5A 1S4FA 3OVNA 1NK0A 2BE2B 3KLEA 4KHYA 1JL1A 4J9PA 1NOYA 3GYNA 1S6PB 1U04A 1TKXA 3ASMA 1KRPA 1VSJA 5L9XA 3LP0B 3I5BA 2G8HA 1TKZA 4M3RA 4FLTA 1NK4A 1IKXA 4FZZA 1S1UA 4KHRA 4KTWA 1NHUA 3PR4A 3WNGA 1QSSA 1S6QB 3HVTA 5L1LA 5KFBA 3RB0A 3T1AA 4CFDA 1S1VB 5KG6A 4F4KA 2Q3SA 2Y1JA 3BR9A 3ZSWA 4YR3A 1T05A 4KPYA 1KFSA 1RTJA 1TL1A 2OPPA 1HMVA 4R0EA 2X78A 4C8OA 3CG7A 3GQCA 4ZVHA 1KTQA 3SZ2A 2IMWP 1MU2B 3DI6A 3SV3A 4IRDA 1HARA 1S6QA 3HVTB 3PY8A 5SZTA 1XWLA 2P51A 2XRIA 1ZETA 4FW1A 2IOCA 1HYVA 1BQNB 3VQQA 2OPPB 4J9LA 2KFNA 1RT5B 4Z4CA 1BIUA 4CEFA 4NYFA 2IM2A 3H5YA 4G3IA 1MU2A 2EHGA 2HHTA 4JV0A 1VSFA 1TQLA 3CFOA 1VSIA 2E9TA 3IRXB 1D9FA 3SI8A 4NRUA 1HQUA 3AVFA 3NGIA 1N6QA 4XPCA 2FBTA 4CEZA 3OYAA 2QV6A 3AVCA 3CDEA 3UIQA 3TI0A 2BQ3A 2ASJA 4CJQA 5DGAA 1DTQA 5F9LA 5KG2A 1RCHA 1VSLA 5HRPA 4CJ3A 4JUZA 2VG7A 4OPJA 3GIKA 4EO8A 1B9FA 3SCXA 3DM2A 1XC9A 2ITGA 1S5JA 1W0HA 3RR7A 4DS4A 5CZ1A 1J54A 1N48A 1ITGA 1IKVA 1IH7A 1UOCA 2E9RX 1IM4A 3NF9A 4FJ7A 3KJVA 1TGOA 4ID5B 3QEIA 4CF8A 4DSLA 4ZHRA 1IKYB 2QKKA 1FKPA 3BREA 3VQAA 4CF9A 2OZMA 4CHQA 4Y2CA 3GV7B 4ECXA 2F8SA 5KFEA 4LQ3A 5J2QA 4J9KA 1WN7A 4CGGA 5KFRA 2FVCA 4DF8A 3V6DB 3V9WA 3T5LA 2OPQB 3QNOA 1KCFA 4ZHRB 1RT7B 4DTMA 4DU3A 2RF2A 4DTRA 1LWFA 4DL4A 4N76A 3V4IB 2YKNA 3NGYA 3HVRA 3FQKA 4DFJA 3D28A 5C25A 3L2WA 3MFHA 4DWIA 1RT4A 1HNVB 2G8FA 2WCXA 4MFBB 4DMNA 4K8XA 3GV5B 4OL8A 2YNHA 3TAGA 1LV5A 3O4QA 4DU4A 1VSEA 1XI1A 3H40A 1QAIA 4QW8A 2BE2A 3KLEB 4DL3A 2DPJA 1WSHA 3NKYA 1HQEA 3OL8A 2D0AA 1RBRA 3N6NA 5KT7A 2D3UA 3K2PA 4CF1A 4Z4HA 1HNVA 1NK6A 4CHPA 4B9NA 4MFBA 5KT6A 1WAFA 5D3GB 2DY4A 3AVJA 3VQ7A 3DLEA 4FJJA 3QLHA 4RW6A 3U3YA 4J9MA 4ED8A 4Z4FA 1MMLA 2NUBA 4YFUA 3MXMA 4FLWA 2FLLA 3CYMA 4B8CA 1L5UA 4ZP7A 1TP7A 1YVFA 1ZBIA 3K5NA 4Z0UA 5I3UA 4FK4A 5KFWA 3CJ0A 3T5KA 3KLHB 4AH9A 5HROB 3RMDA 3CJ5A 4O3SA 4NYZA 5D3GA 2FBYA 4CGDA 4Q8FA 1RTDA 3DLEB 5C24A 3LDSA 3SFGA 1EX4A 3AA5X 1NNDA 4CEBA 1T7PA 4CERA 3MEDB 2W9CA 1Z25A 4LSLB 2WHOA 1QAJA 3FRZA 4TYBA 1J9AA 3KLHA 2Y1IA 5HROA 2YHBA 4ECWA 5J2PA 4QAGA 1G15A 1U48A 2VG5B 1RTDB 3SUPA 4K4UA 1RILA 4E7HA 3HPOA 5DLFA 3ZSVA 2CKWA 4OJRA 4F3TA 3TR8A 1TV6A 1HYSA 1C2PA 3DRPB 2PYJA 3VQ4A 4YP3A 4DFKA 3H59A 3NDKA 1ASUA 4LSLA 4W5RA 1S1TB 4URGA 4R5PB 5KFYA 4FW2A 3OYEA 4WE1B 2FVRA 3S3MA 2UVUA 1RDCA 4BE1A 3PO4A 4NCGA 2C28A 1RA6A 4FVMA 2R2SA 1D1UA 1K1SA 1EP4B 4Q45A 2JEIA 5DLGA 3V9ZA 3RBDA 1LAWA 3LANA 2DFEA 4FJ8A 3DMJB 4C8KA 4DSEA 4FJ9A 2KZZA 3P83D 1RTHB 5CZ2A 5CYQB 1IO2A 3VQSA 5KFOA 4K4VA 3KJVB 1HJRA 4ECSA 3PR5B 1QTMA 4NCGB 4J2EA 3N6MA 3KOAA 3LALA 4BE2A 1REVB 3QO9B 4CEOA 4GC6A 1YTUA 4OVLA 4FJKA 3S3OA 2YNGB 1RT3A 2HNYB 3LPUA 4HYKA 2XCAA 1RTIA 2GC8A 1JX4A 4Q5VA 5F8IA 1DLOB 3PHEA 1REVA 2P5GA 1U49A 2WOMB 4U7CA 4O3PA 4FK0A 2HVIA 3TAPA 4PWDA 2XY5A 4KV8B 4ED3A 3UDLA 4O4RA 4LH5A 2ETJA 3CVKA 2UUTA 3KK1A 4M94A 2B4JA 1SKSA 4KHQA 4R8UA 3AA3A 4KB1A 1TK8A 3B6PA 5KFFA 4ECYA 1Q8IA 4PUOA 2O4GA 3SJJA 3DLGA 5HRRA 3OYFA 3HYFA 4HHTA 4CGJA 2WOMA 1C0MA 4CGIA 2GIQA 2XGQA 2ZD1B 2AGQA 4ZVFA 4F4XA 2D3ZA 2GUIA 3ZT1A 1J5OA 3QEVA 3CM6A 4B9MA 4QCLA 3K5MA 4I7FA 4F50A 1I3AA 3KLGA 3AO3A 3V6HA 1RYRA 2HHQA 3PJXA 4ED0A 4KO0A 2HWHA 4PUOB 3HHKA 1ZBHA 2HWIA 3H4BA 2Z1JA 3GIJA 2IM3A 4DTUA 2ZD1A 3OSPA 1L3VA 4Q43A 4CHZA 4CCHA 1JL2A 4I7FB 2BQRA 2AX1A 4JV2A 2D5RA 2CJQA 2FLPA 4RW8B 3E01A 4BWMA 4FM1A 3SYZA 3SFUA 1CSJA 4I2PA 5KFMA 3DOLA 5J1EB 5EWFA 3KMQA 1T03A 2UUWA 3T5JA 3C6TA 4FM2A 1C1BA 4FLXA 3G0ZA 3OYKA 4CEDA 3AVHA 5KT5A 3PW4A 5J2PB 1S9FA 4K4WA 4WFXA 2BR0A 5EDWA 3M8QB 4KRFA 4NLXA 4FS2A 1TV6B 5KT3A 1XHXA 1JXEA 2X74A 3HT3A 3HK2A 1T03B 3C6TB 3OS2A 4CJWA 4O55A 4ZPBA 3KK2B 3H5UA 4R5PA 1KSPA 1Z26A 4WE1A 3BJYA 4H4OB 4Q0BB 3PZPA 4CESA 1I39A 4EBDA 3RWUA 1Z4UA 3KKSA 1ASWA 4FCYA 3NH0A 1EP4A 4FM0A 4KHWA 2XI3A 3MR6A 4DQIA 3NAHA 2J6UA 3L3UA 3SQ1A 3VA3A 4IFVA 3FQLA 4ELVA 4O3OA 3KK2A 2EX3A 2R8JA 4URQU 1NJWA 5HRSA 5EWGA 4RU9A 2P1JA 2AJQA 2HNZA 4H8KA 1RNHA 3O3GA 2HHWA 4ED7A 3DLKB 1S9EA 5E41A 4DS5A 4I9LA 4HCCA 4FS1A 4NLWA 4CJFA 5DG9A 3MXJA 2P5OA 1R0AB 3D5MA 2FVQA 3NBPA 3VQDA 5DQIA 1QHTA 2B6AB 1IKWB 2YKMB 2HHXA 1X1PA 1TKDA 3QGGA 3QESA 4F4YA 2B5JB 1C1CA 3M8PB 2WB4A 3HP9A 4PWDB 1C0TA 4TY8B 3NGZA 4Y3CA 2ATQA 4OPKA 3RB3A 1XR6A 1SV5B 4C8MA 3V9SA 2KQ2A 3V1RA 3PV8A 4H54A 5F8JA 3LWMA 1RT1A 4QWCA 4AHRA 1WNEA 3KLVA 2R2UA 2B5JA 3I5CA 4IBNA 2DPIA 4DL5A 5KFCA 1RBUA 3H5SA 2FJWA 3OYGA 2ILYA 5DGBA 4NZ0A 1HPZA 4NLDA 1CLQA 4CF2A 3DRSB 3V6JA 2WTFA 1RT6B 4E7KA 1JLBA 4M3TA 3QNNA 5K14B 1C0UA 2DTUA 4RW4A 3TANA 3LP2A 5KFJA 4RG8A 2AQ4A 4TQSA 3HPGA 4NLRA 5L1JA 2FJXA 1FK9B 1RT6A 3S9HA 2D0CA 2AU0A 4ECZA 4I2PB 3Q8RB 4ZTJA 1ZYQA 3MEEB 5KG7A 5FDLA 4DG1A 1RAJA 1VSDA 3PW0A 4AHSA 2ZKUA 2C2RA 3O3HA 3D45A 1QS4A 4J9NA 4B9SA 3H5XA 5KRSA 4OKKA 3ZSRA 3T19A 3DOKB 4MKBA 2G8KA 1N56A 1I6JA 1X9MA 4H4MA 4Z4GA 2YV0X 1A5WA 2XHBA 4G1QA 4DSKA 1RDAA 3AVGA 4EP4A 3V81B 4KHSA 4CIGA 3EPIA 5KI6A 4J2DA 3VN5A 3ZCMA 3OY9A 2F96A 1HNIA 5KFKA 4ECTA 1LW0B 3OYLA 1ZBFA 3DOKA 4KFBA 1BGXT 4IFVB 1S1XB 3ULDA 3I0RA 2JEGA 4ZMMA 3TAFA 1O1WA 4IKFA 3QZ8A 2PZSA 4CFCA 1JLCB 1IKXB 1JLFA 2BRKA 1QSLA 4B9UA 4E7JA 1DTTB 2HB5A 3L3VA 1VRTB 5HLFA 4KKOA 3QEPA 3DLKA 4QWEA 5F8NA 1S1VA 4KFBB 2G8VA 1WLJA 5KFAA 3OYNA 1BI4B 1BHLA 3I0RB 1BCOA 4W5QA 3WNHA 4NLQA 1B92A 3NBPB 4IDKA 1FKOB 3CDWA 3CO9A 3TAQA 4FZXC 1JLCA 3ITHB 1Q9XA 2A1RA 1SUQA 3DI6B 4KB0A 3C6UB 3EPGA 4MK7A 4K8ZA 4QOZB 3MXIA 4FJGA 5EUHA 3QIOA 4NCAA 4OKEA 3SQ0A 3MR3A 3OL6A 3DRRB 1BI4A 4PQUB 4KTQA 2Z1GA 3NFAA 1JKHA 4EBCA 1GOAA 5CYMA 4IDKB 4CJTA 4DQSA 1J53A 5T7BA 1FKOA 4FXDA 4FYDA 3OL9A 4B3OB 4WZQA 4TN2A 2ALZA 4KE5A 4QW9A 3LZIA 4TLRA 3C95A 1N6QB 3AVNA 2ZQBA 4M42A 1GX6A 3PX6A 4J2AA 3MAQA 2ZE2A 4IOBA 1A5XA 4ECUA 4DFMA 4CF0A 3G6VA 4K4YA 4Z4IA 1Q9YA 1RDDA 3U3GA 4B3OA 1YT3A 1N5YB 4CJSA 4MIAA 1HPZB 3LP1A 1X9WA 3KHLA 3JYTB 5I42B 1ZBUA 4E7IA 1WSIA 1CZBA 4X2BA 4BDZA 3KLIB 2YNIA 3IG1B 3HSTB 3CFRA 2GIRA 2BANA 1N4LA 2V4RA 3THVA 1IKVB 4NLSA 2J6TA 3IS9A 3CM5A 3ZT4A 4DQRA 1A5VA 2BGGA 2OPSA 1WNSA 2X6NA 4ID5A 1LW2B 5KG0A 2JC0A 2HAIA 4DU1A 1VRUA 4M3UA 1CZ9A 1L3UA 2JLEA 2X6SA 4ZPAA 4E19A 1D0EA 4RNFA 4ED6A 4ZPCA 2LSNA 4EYIB 1KHVA 3BQ1A 1TKTB 3EZ5A 4M3XA 2BQUA 3M8RA 4DEZA 4WXOA 3MEGB 3QERA 1RDRA 2RKIB 1S0MA 1RT7A 1HRHA 1QQCA 1VRUB 2D41A 2OPRA 2RF2B 3P5JA 4K4TA 1U09A 3V4IA 1SH3A 4H4MB 1GOCA 4F8RA 5KG5A 1TL3A 3U6FA 3NF6A 2G8UA 4L8RB 1JLEA 3GIIA 3KKRA 2AX0A 5KFNA 1EETB 4KTZA 4DQPA 1XR5A 4BDPA 5DQHA 2RKIA 2O5DA 1BQMA 4O44B 3AVBA 1S1XA 3BQ2A 3Q8PB 3S3NA 1S9GA 3RAXA 4DQQA 3ISND 1JLAA 1VSHA 1JLEB 4WFZA 4Y1CA 1JLFB 3KD5E 5DK5A 1DTTA 4BWJA 4FLVA 1NJZA 4WZMA 4DLGA 5HLFB 5J2MB 5KFXA 1NJYA 2R8KA 3CJ3A 3SQ2A 4O44A 3NAEA 4YR2A 2C22A 2F8TA 4EP5A 3VQCA 3RRHA 1SL2A 4HVJA 2HNDA 4MKAA 4HUGA 5DG8A 3OYBA 4NYNA 4RNMA 2V9WA 2D0BA 2XGPA 4FLZA 4CIFA 4I9QA 5F9NA 3FFIB 3PW5A 3CDUA 1CXUA 4EO6A 2XCPA 1TL1B 2PY5A 1HMVB 2R8GA 2HVHA 4O4GB 4FJXA 3MTKA 1BISA 4DTSA 2VG5A 5KG3A 1LWCB 1NJXA 1XR7A 4CHOA 4CJLA 2W42A 4JRPA 4KSEB 4ID1A 3DLRA 3NH1A 4QWAA 3RR8A 3VQEA 2D7SA 3DDKA 3G10A 3QETA 3KTQA 3DYAA 4JS4A 1KLNA 2FVPA 2KW4A 4DL6A 2RN2A 3TAMA 3KHHA 5KRTA 4IQXA 1ZBLA 5KT2A 4J9RA 2BDPA 4O3RA 1BCMA 4RUCA 4NLPA 1LWCA 3RB6A 2VG6A 1N5YA 1NHVA 1W9HA 3QGHA 3QIPB 5KFZA 4QPXA 3LP1B 1D8YA 3JYTA 3O3FA 1HQUB 3H4DA 4OLAA 3CFPA 4HKQA 4N56A 1UAXA 1S10A 2YNIB 3IG1A 4ZVEA 4K4ZA 4ECQA 3TAMB 4RW9B 4GMJB 4FK2A 5HP1B 3VQ5A 1UWBB 1TAUA 3V6DA 4FJNA 2OPQA 3QIPA 4CK2A 3L2VA 4KHNA 4F4ZA 3SPZA 1T94A 4W5NA 5KFLA 3QO9A 1LWFB 4M3YA 4DTOA 4GC7A 1LWEB 5F8MA 2YNGA 1RT3B 2ATLA 3BGRA 3NMAA 4RW7B 3DLBA 5KFUA 4IG3B 4YQWA 4GW6A 4RW9A 1RTIB 4FBTA 4CK3A 3I0SB 2ASLA 4M41A 3BSNA 4MQ3A 4FLUA 4CFAA 3AA4A 4CJVA 2OPRB 2W9BA 2VA2A 2R8IA 1BIZA 3TAEA 3L8BA 5J2QB 2OA8A 1TL3B 4RW7A 3KK1B 1C6VA 5DQGA 4BE0A 1S48A 2XY7A 3OHBA 1KVAA 5JS1A 3DLGB 2OH2A 4K4XA 3I5AA 5FRNA 4K4SA 4TY9A 1EXQA 3E51A 4KREA 1S0OA 2YKNB 3MFIA 3MR5A 1L3SA 4Y1DA 3OHAA 4RZRA 3V9XA 3AO5A 1JLAB 4IR1A 3DLHA 4NLOA 2O4IA 4ZP6A 4CE9A 2YNFB 1S0NA 1QUVA 3ZSZA 4PA1A 3HM9A 4EZ9A 3M9MB 3OYJA 4YMEA 3NH2A 3GV8B 5L1KA 1HQEB 2E4LA 1NOZA 4NCBA 1RTJB 3NF8A 5KFPA 3A2FA 3QEWA 4W5TA 4ELUA 2YNFA 4K50A 2XC9A 2HNDB 1YVUA 2AGPA 4KI4A 3QLHB 2GV9A 4N47A 3F9KA 3FDSA 2R2TA 4KHMA 1F21A 4BACA 3PX4A 5I3UB 4O0JA 3KMSA 4CJKA 2QK9A 4DFPA 1RT5A 1JXBA 1TK5A 1KFDA 3NE6A 1WSGA 3G86A 4KAIA 3NGDA 3M8QA 3KD1E 2B43A 3KHGA 3OSNA 3MEDA 1S49A 5KG4A 1K6YA 4DTJA 4ICLA 2FLNA 1KLMA 4NLYA 3OLBA 4WYLA 3ALYA 3EYZA 4C8LA 1DTQB 4J9QA 3TABA 2VG7B 3UPFA 5SWMA 4QWDA 1U45A 2FC0A 2EC0A 3SUQA 2WK4A 1HYSB 5KGXA 4Z4EA 5DG7A 3IGVA 1T3NA 5KFQA 1KHWA 3V6KA 3HXMA 4ICLB 1RBTA 4C8NA 4B08A 3HO1A 3AVIA 4N41A 3OJSA 4ELTA 5HP1A 1JXLA 3RBEA 2DFFA 4Q8EA 2IM1A 3BSOA 4DSFA 2GBZA 3TVKA 4F2RA 4E7LA 3M9NB 5FROA 1S9EB 4Q44A 4ZP8A 4ZPDA 3RTVA 5KGWA 4KV8A 4W5OA 1LWEA 2E6MA 3SPYA 3DMJA 3Q8QB 3VQBA 5DMRA 4TQRA 3HKWA 5CYQA 2R7YA 4IG3A 4CECA 1QSYA 3I0SA 1S1WB 4U6PA 1HYZA 3TWHA 3ZT2A 4KB7A 5KG1A 2IAJA 1C0TB 1T8EA 3SV4A 4TY8A 1WSJA 2RPIA 5C25B 2XY6A 2QXFA 4N5SA 1J5OB 1SV5A 1RT4B 3ZSXA 4XPEA 4O5BA 4MH8A 1TK0A 3KLGB 4J9SA 3NL0A 3GILA 4HUEA 5HBMA 2YNHB 3RMAA 4KO0B 1RT1B 1NK7A 3SNNA 5KFTA 4LSNB 4RNNA 4IR9A 2IAJB 2Z1IA 1U4BA 3H98A 4MK9A 2W9AA 5FRMA 3CIZA 2W8KA 1GOBA 3BSCA 3AVAA 4E0DA 3HVWA 5KFIA 4R8UB 2PYLA 2HHSA 3TQ1A 5HBMB 4RW6B 3EY1A 4E89A 3AV9A 4FJLA 2FJVA 4F4WA 4YR0A 4HUFA 4LSNA 4DL2A 2V0NA 5C5JA 3OLAA 4OGCA 3G6YA 3RMBA 2KTQA 3SI6A 5L1IA 1B9DA 4HTUA 4EBEA 3AO1A 5C24B 4TYAA 4J2BA 1JLQB 2VWKA 3PVXA 4WXWA 5J2NB 5FDLB 4DG1B 1D5AA 5EU7A 2W9CB 3QYYA 3VA0A 3MECB 2IGIA 2UVWA 3FSIA 1UA1A 4ED2A 3PX0A 4GVMA 3NF7A 4EZ6A 2WONB 2JGUA 4OKJA 4NRTA 2IC3A 3DOLB 5J1EA 3DRPA 2RDIA 3H2LA 2I1RA 3SQ4A 4DSJA 4IH5A 4G1QB 3GIMA 4CJEA 3K58A 1S1TA 1KLMB 2ILZA 3IGNA 4CFBA 2UVRA 4ECVA 3VQ9A
chains in the Genus database with same CATH superfamily
3M2UA 1WHYA 2Z1HA 2ATCB 2VBYA 2QA4G 4FJIA 3J7AP 2BJDA 4IO8A 3ONQA 4CJUA 3VVTA 2YWGA 3OW2R 2WONA 4PY5A 1CJKA 3ZSYA 3W2VB 1RWXB 4JI2J 3TWZA 1R0BG 3NNCA 4BRFA 4NA2A 1OVYA 4MIBA 2UXDJ 3ICLA 1FJ7A 3ID6A 2RD5C 3PO5A 5C2CA 4HLBA 5H9EJ 4JHDB 3LGMA 1SKWA 7FDRA 4I6MB 1HL6A 5CAAA 2I9SA 2A3ZA 4BR2A 2R7OA 4LF5J 3SUNA 1T95A 2CGLA 3K57A 1S1WA 1CXQA 2VL1A 3PKYA 1HX1A 2DISA 4EEYA 2HHUA 4N8OA 5HN0A 4DR1J 1GAOA 1KOOA 2C3PA 4DHVA 3ZSQA 4HACA 3N5BA 5CYJA 1X5SA 1RBLA 4DV6F 2MZ1A 4A59A 2A0FB 1NK5A 4CHYA 5HAOA 1BMQB 4M3WA 2YX6A 3W9IA 4CEEA 3FBFA 3EX7B 4IFYB 4DCHA 2MKHA 3QBXA 5BXIA 2ADCA 2J6SA 4C97A 2NRRA 1OH7A 4IWVA 5HANA 2ZC4A 1UVJA 4NLVA 2MQMA 3MN9A 3TA1A 1IN0A 3NLCA 3FMBA 3QFWA 4ZS6A 4QS7A 4CBXA 5KFDA 5C10A 5KPZA 4P2SA 1GX5A 1ZOTA 3LPEA 3VTHA 3T1HJ 1NM1A 3M8SA 3HSGA 3VAGA 2HMIB 1HWIA 4IKAA 1M5SA 3UR3C 1JLQA 4RW8A 3VQ6A 2EC2A 2KT5A 1D9DA 2J0SD 3UW1A 3HHNB 1JWWA 1GLDG 3IM8A 4AXIA 3OXLA 5GMEA 1QE1A 3P39A 5TKYA 4WF9Q 2HFZA 4ED5A 2IRYA 1OPZA 1AT1B 1XHZA 3NEKA 3ENOA 2XHWA 4LRCA 3W9HA 3A1YG 2BACA 3V1QA 4H4OA 4BQLA 4CZMA 2AYBA 4F4AA 2CPZA 4DR1F 1VRTA 3BSAA 4A8SA 1LAVA 4FJMA 3ZZRA 5BR9A 4ECRA 2BV3A 2XMKA 1S6PA 5ETQA 4KI6A 3CJ7A 1CJKB 4LBHA 3SCKE 3CIPA 1VQ5N 2GAGC 1ASVA 3MWTA 4JYAF 1WHXA 3L2QA 3D9BA 3B8AX 2QMXA 4CEQA 2E1PA 1NU4A 5J2MA 4O5FA 1JIHA 1Z2LA 3VGKA 1N33J 4E1NA 3QT6A 3AAQA 3RRGA 2PMWA 5ETRA 4F3QA 5BN8A 3DXKA 2RIJA 3F9MA 2M8DB 5KTQA 5LSLA 4K5RA 2MEWA 2E9ZA 1HHSA 3M8WA 5A76A 3ZT3A 4QWBA 2JRSA 1P1TA 2J9CA 2Q0RA 3MPDA 2IS3A 3DFEA 2F8EX 4CW7B 2QEXS 1WTBA 3NVKA 3J7AN 5IXUA 2ROEA 3SUOA 4I0WA 2QJ3A 4DL7A 2GVZB 2IVPA 3BZQA 3MDFA 2NREA 4NB4A 4JS5A 5E2QA 3A8YA 1S72N 2ZH1A 2LMIA 3QRQA 2CGJA 2R2RA 4IFYA 4LC9B 2GWJA 4LH4A 4MLHA 1NKEA 5HMWA 2GEMA 4O0IA 2C2EA 1CJUA 4DTXA 2QLBB 1V4SA 4LT6A 3VCDA 4X4PA 2MZJA 2VICA 2OPSB 5M1PA 3THWA 2HSEB 2XYGB 3WEEA 4YNQA 1JLBB 4B9TA 4KAZA 4OI4A 5LMNJ 4H0PA 2J7UA 2HBZB 3KK3A 1UFWA 2EW9A 1WF2A 1SI9A 5KFGA 1YLXA 3HL8A 2A2DA 2DPNA 3T6BA 2OMLA 4XO0A 1TKTA 3CJ8A 3L2RA 1H3DA 4AQYJ 1J5EF 4JV5K 3FZKA 4DCOB 2QA4S 1NKCA 3M4XA 4USHA 3LAKA 4CGHA 2VKRA 8AT1B 1T6DA 3N6LA 3IFRA 5C42A 1WSFA 1TAQA 4KBIA 4AHCA 1ZTTA 3CJ2A 2YJFA 3MUMP 4B9LA 4WFYA 4I2QB 3BEGB 4BC7A 2W9BB 3HP6A 2QWLA 3ZX2A 1TKXB 1AZSB 4XEIA 2DFHA 8RUCA 1S97A 2RQ4A 1R0CB 3X3UA 4JKHA 3LP0A 5A8WA 2LEBA 3ZT0A 4FL9A 3L2UA 3QDKA 4K59A 1HNWF 3JSMA 2F7VA 1YI2S 3MM8A 3X1LB 2AJ1A 1JL1A 1FW6A 1ICEB 2QWQA 3CERA 4V19J 2QT7A 3GYNA 1S6PB 1U04A 3PEHA 3EXYA 4OZJA 5HL7L 4KH4A 2FJEB 5D77A 4FLTA 2NXCA 4ZN3A 8ATCB 4DV5F 4RBUA 4KTWA 2HRUA 5KFBA 4Q2MA 4C1NK 2RQKA 4F4KA 4EMDA 2Q3SA 3BR9A 3ZSWA 2OPPA 1HMVA 4BGBA 2XMTA 4JI5J 3GQCA 4DDFA 3B8HA 5IQQA 1TL4A 5L9NA 1YVNA 4IRDA 3HVTB 3PY8A 5SZTA 5IT9O 2P51A 2QRRA 2XRIA 1ZETA 1R27B 2QZ8A 4DR7F 2IOCA 3VQQA 1CULB 4J9LA 1NNEA 2KFNA 2XLIA 4Z4CA 2ZGYA 3H5YA 4DV0K 1MU2A 2E9TA 4NRUA 3M6UA 3AVFA 1EWQA 2JSXA 2YH1A 1CJUB 1YBAA 4CEZA 2WB1D 3AVCA 2K06A 1TUYA 4RLEA 3TI0A 3CJAA 2ASJA 1DTQA 5F9LA 5KG2A 1BXNA 3C14B 2VG7A 1RWWB 2Y0SD 3H6EA 2P9PB 4OI6A 1B9FA 4UQTA 3QT5A 5AXMA 4MKYA 4CT9A 3L4IA 3KUEA 1S5JA 2NZTA 5CZ1A 1UOCA 1BUPA 1IM4A 4E1JA 2ZH3A 2HQ3A 3D0HE 3SMSA 3K89A 3UVJA 4FWSA 4CF8A 4GKKK 3C15B 1C0GA 3VQAA 2UUBJ 4CF9A 2J8SA 2OZMA 4ECXA 4Z7CA 1ACMB 4DR7K 2F8SA 1GMWA 4ETZA 2MGZB 3CCLS 1GXTA 2FVCA 3MM7B 4USJC 2Q31A 3U27A 1KBRA 3V6DB 3ZYYX 4LF6K 4DV2J 2DH9A 3QNOA 2MKSA 3BO4A 3TW0A 2XMAA 4DTMA 5DM7Q 4DU3A 4DV0J 2RF2A 4DTRA 1LWFA 4PR6A 4DL4A 4C48A 2YHWA 3V4IB 2UU9K 1KNZA 3OTOJ 3LDPA 1F5CA 3MFHA 4DWIA 2R7XA 1RT4A 5AQVA 4JI7J 2G8FA 4NX9A 2WCXA 1RGVA 1ZBTA 3AQOA 3DRXA 3GV5B 4IUFA 4OL8A 2VBZA 3TAGA 3O4QA 3MM8B 1XI1A 1CS4A 1QAIA 3H40A 3LL3A 1QVGR 2DPJA 3CJ1A 1HQEA 2V8HA 3N6NA 5KT7A 2D3UA 3MR7A 1SS6A 4CF1A 2DNGA 1AUSL 4LR7A 2OD4A 2QM1A 2PFFB 4MMOA 4B9NA 3MX5A 3AVJA 3DLEA 2LYVA 3U3YA 1ZM2A 4ED8A 1MMLA 2NUBA 3MXMA 3OFEA 4FLWA 2X7IA 1F9HA 1L5UA 1YVFA 2FJDB 3NCRA 5A8RA 3TUIC 1DGKN 3OUYA 5HROB 3RMDA 2DXDA 3GBTA 5D3GA 1U8WA 4Q8FA 1RTDA 2FDNA 4MAKA 3SFGA 3AA5X 1T7PA 1KP6A 4CERA 1QJHA 2OEKA 4B3SJ 5BJRA 1MN7A 4I6WA 3CW2C 4QAGA 3BY5A 2VG5B 2D9OA 3SUPA 4X64K 2K8GA 5M2UA 3RZAA 1M90T 1HYSA 3MDQA 2PYJA 3NGUA 4DFKA 4DU8A 1ASUA 3W8GA 1QM9A 2H54B 4OIXA 5LJWA 1X4DA 5E3CA 1Y5LB 4NCGA 5A2QY 1RA6A 2JWNA 3I31A 3VESA 3VGUA 3UD4P 3HHLA 4C8YA 1K1SA 2JEIA 2QA1A 1HBNB 4HTLA 1RFQA 5DLGA 3GP9A 3QICA 3T1YK 1VHFA 2DFEA 1YK9A 3OTBA 1RTHB 4BLGA 4IJAA 3SAGA 5TKWA 3N6MA 4GKJK 3LALA 4OZ2A 1VDHA 4JI1F 3FCWA 3QO9B 1MG7A 1CZAN 2POKA 1VK3A 4PPDA 2DJWA 4DV3K 3K0SA 3ZTPA 2HYIB 2C3UA 2UUBF 4A8OA 4WTYA 1I5OB 1PYSB 3SXLA 4U7CA 4O3PA 4PWDA 4LIWA 4UOCA 3UDLA 4LH5A 3MGJA 3TJAA 1Y0HA 2E5JA 3CVKA 5C12A 2C2ZB 4PKGA 1NH8A 2KG1A 1SKSA 4KHQA 4R8UA 4JI0K 3H2UB 4B1ZA 3HULA 2AJ2A 3SJJA 1FT8A 3DLGA 3D1OA 5HRRA 2IVYA 2AP6A 3PIOQ 2AGQA 3ZT1A 1J5OA 3Q23A 4NXNF 3CM6A 3QWPA 2YWEA 3P5BP 2R7UA 3AO3A 1DRZA 3G2XA 2N4CA 3V6HA 3ET6A 4C2MA 4ED0A 5E5NA 4KO0A 3VMFB 1JJCB 2Z1JA 1UEUA 3CJRA 2OD6A 1KQSR 4WF9L 4AL7A 3WC0A 4ZJOA 2BH1A 4CHZA 3OUYB 2G0IA 2K1RB 4LF7F 4QJVA 1GLFO 4YORA 1OH6A 4BWMA 4KYZA 4I2PA 1WUAA 3IAM9 3KMQA 4QIEA 5K8NA 1U7LA 1NWKA 1CPZA 3G0ZA 3GOIA 4P2MA 2HFVA 3THYB 1S9FA 1VJWA 1ZC6A 3MD1A 4K4WA 3FEYB 4BHQA 4CH7A 3ZETB 1VI7A 2NS1B 5KT3A 3OTCA 1XHXA 2X74A 3HT3A 2CQGA 4EFHA 3C6TB 5CCMA 1XMQK 4O55A 3R2DJ 4ZPBA 3H5UA 4Z94A 5ADZA 4ISEA 4CBUA 4Q0BB 5F0UA 4CESA 3RWUA 3N28A 5I3PA 3NH0A 4KHWA 2XI3A 3MR6A 3L3UA 4YHHF 3SQ1A 3PYDA 3QWUA 2FD2A 1SJ1A 4USVA 4WTOB 3LOUA 3PYFA 2MQNA 2R8JA 1NJWA 1B7FA 2AJQA 1RNHA 4LFCK 2P9KA 3JSYA 1NDKA 1F5AA 5IS2A 4JI7K 5E41A 3C8YA 4HDHA 4I9LA 3BUZB 5DG9A 4CLYA 1FRHA 3MXJA 2P5OA 1R0AB 5LMNF 2FVQA 3VQDA 2F9DA 1QHTA 2AMCB 2HHXA 3HI0A 3QGGA 2CWXA 1DBDA 1J5EJ 3HMJG 1IBKF 1C1CA 3HP9A 5AFUA 4PWDB 3MOJB 1WHWA 4TY8B 4Y3CA 1VR6A 4C8MA 3DWLA 1RHKB 3LWMA 1RT1A 1T9TA 3TU5A 3BGLA 5E84A 4AHRA 4K7QA 3Q7CA 1FD8A 3R7NB 1N5VA 3CD0A 4IBNA 2DPIA 4DL5A 1XMOF 3TSPA 9ATCB 5AQLA 4WQ4A 1B3TA 3OYGA 2ILYA 3DKDA 3AD7C 1RWVB 1HBOA 4CF2A 4BBYA 3V6JA 5I4MA 2WTFA 3CT9A 3G8QA 2QEXN 2DGXA 4M3TA 5LXYA 3PNIA 4LFBK 2OSRA 3UDCA 3TANA 4TQSA 1F60B 4ILMA 4NA1A 3OVBA 5HMZA 1RT6A 2D0CA 3MWBA 1YUWA 4I2PB 3Q8RB 3I56S 5KG7A 5FDLA 2QLJB 2R9LA 3PW0A 3RAMA 3RW7A 3CCMS 4JI3J 5KRSA 1PIEA 3PFEA 2RRNA 3I32A 1FFSB 2OELA 3A12A 1N56A 1I6JA 2RAQA 1OH8A 3CCRN 4Z4GA 2AJ4A 3CDAA 1RDAA 3EZWA 4EP4A 5KI6A 4J2DA 2V7ZA 1S72S 3VN5A 3THXB 4DPOA 3ZCMA 1HNIA 3RBXA 1LW0B 2BEFA 3R3LA 4MO4A 1U1RA 3OFFA 1FDBA 3POTA 1H98A 1S1XB 3HZEA 2P9LA 1ZM4A 1R8BA 4UF4A 1O1WA 2PZSA 1CQNA 1MMDA 1JLCB 1IKXB 3PIOL 2HFOA 4WK1A 4E7JA 1DTTB 1Q78A 3CETA 5HLFA 4LF5K 1RJJA 2D1KA 1GH8A 4M5DA 4KFBB 4HI2A 1X4EA 2CPYA 4CNZA 1D9AA 2CFXA 4W5QA 2P9GA 3WNHA 4Z37A 5M1NA 1B92A 3G8SA 1U6BA 2GQCA 2OP5A 3J7YU 1FKOB 3CDWA 4FZXC 1JCFA 3H90A 3C6UB 4HR2A 1NB7A 1IR1A 3MXIA 4H5NA 5EUHA 2VPXB 3DAWA 3OL6A 2V2VA 1N54B 2Z1GA 3NFAA 1JKHA 1GOAA 2RILA 4DQSA 4FYDA 4B3OB 4TN2A 3TSUA 4OV6A 1VQOS 1WDTA 4QW9A 2NR0A 2J9DE 3LPYA 1RZMA 3CPWM 3D4JA 3TYTA 4DFMA 3AJDA 1MLAA 2JWLA 4Z4IA 1Q9YA 3JQMA 4JI8J 1HJOA 4YOEA 3JTNA 1X9WA 3KHLA 4FYVB 5I42B 2WBMA 2W6LA 3VEXA 3DLLL 3CCRS 1DJ0A 3MURP 2NPFA 3KWIA 4H0YB 5AZIB 3HD1A 3QAEA 3KLIB 1FJCA 1NMDA 3HSTB 3CCUN 4DV5J 4USMA 3THVA 1IKVB 2J6TA 2OFGX 2BGGA 1RCXB 3CJ9A 1LW2B 2GNKA 5CR4A 2DNLA 4TLQA 4DU1A 4M3UA 2ZVSA 1L3UA 2OGUA 4PKIA 4CZIA 1MROB 2NRZA 1NMEB 4HH0A 3BYPA 2JNJA 1E6YA 4M5NA 1BOTO 4EYIB 4EUVA 3GTYX 4WXOA 2ZWPA 3OA9A 2RKIB 1HRHA 2VFRA 1NBEB 2DRBA 4ALZA 4FYYB 4ZVUB 1NGFA 4PQAA 3UDVA 1TL3A 5AT1B 3U6FA 4PG8A 3GIIA 3KKRA 2ZHBA 5HATA 1EETB 4KTZA 1U6FA 1Q1KA 3KUGA 4I69A 2AV5A 5J1NA 1MWQA 2CUYA 1BQMA 4O44B 1P27B 2Z56B 1S1XA 4XK8C 1UW4A 4H0OA 1S9GA 3EDQB 4NI2A 4YY3J 3CC7S 3VEOA 1RKJA 1JLEB 4WFZA 5AQXA 5ETKA 2B4PA 1DTTA 2IPOB 4QYZJ 5HLFB 4AL6A 4G1IA 2YKOA 2R8KA 4K2XA 3DGPB 3ZXWA 2R7SA 5DDOC 3GFZA 5C2FA 1CULA 4CZHA 4AQYF 3ZTQA 1H2VZ 4EP5A 1WBDA 3VQCA 4I4BA 1SL2A 3QJJA 4NYNA 1RUSA 1YBUA 2V9WA 4WK3A 2VDHA 5F9NA 1C0FA 2P8IA 4DV3F 2HURA 2A1BA 1CXUA 4HH1A 2PY5A 4NL5A 1RSCA 4O4GB 3H25A 3GFXA 2AP1A 1WDDA 4P71A 4DTSA 5KG3A 3EL2A 4CHOA 1JNZB 4CJLA 1REGX 2W42A 5EX3A 3WBZA 2P5VA 3QFPA 1WC4A 2ZH5A 3NH1A 4CT8A 3VQEA 3OV7A 4LFBJ 3DDKA 3G10A 1CLFA 3W66A 3KTQA 1F3VA 3DYAA 1HKAA 3T41A 4WU3A 2BX6A 1ZBLA 5KT2A 3HZGA 2HBJA 2O8FB 5BREA 4RUCA 1LWCA 1RHQB 1KS2A 1XEZA 1W9HA 4TNOA 5KFZA 3C15A 4ZLNA 2B9YA 4KRWA 2PT0A 1ESVA 4QIVA 4K4ZA 4PG5A 4ECQA 3FZ2A 3MM7A 4GMJB 4FK2A 4P7VA 1PBAA 2IMOA 3FR0A 3VQ5A 1UWBB 4JAXA 4BRDA 3V6DA 4ZCKA 3LDNA 3N0VA 1H7XA 3CCSS 2CQIA 1AXQA 4W5NA 1SC4B 1LWFB 1WJ9A 1YQHA 3RYLA 1T11A 2DGOA 1YDLA 1PJ5A 3A5OC 3DLBA 4PYDA 4YDUC 4ILHA 3HT0A 2M52A 5GAEI 1VQ6N 4M7XA 1IWAA 2QWPA 4DR6F 4CZFA 4CFAA 3AA4A 2GAHC 2ZH9A 2IHR1 2M0GB 3L8BA 1TL3B 4K43A 4RW7A 1U6ZA 2E5LF 1AUDA 1C6VA 1H72C 4BE0A 3NWGA 1KVAA 1XTZA 3BN7A 3MMBA 4ZIWA 2PA3A 3VWSA 2MQLA 1OSDA 4TY9A 1FX2A 1HD1A 3MCMA 2YKNB 3WXMB 2P9CA 3MFIA 3HTVA 2LXFA 4NI2B 3GE9A 4NLOA 1MMNA 4Y2IA 4CE9A 2AYGA 2X1FA 2P9NB 3MOZA 5ETOA 4EZ9A 2E7VA 4LR9A 2FHOB 2OKQA 2OO4A 3SSQA 2Q2RA 3W5YA 3R6GB 3L09A 1RU2A 4ZKAA 4U96A 1MNEA 4C8ZA 2GV1A 3DGPA 3CCWA 1M5PC 5KFPA 3W61A 3N4WA 3EGWB 2YNFA 3DN9A 3VF0B 3L9ZA 2AGPA 2B9XA 2R2TA 3ZNJ1 2YX7A 1HNWK 4EIAA 3TUJC 2DNZA 1N5SA 4C23A 2QK9A 4OHVA 3NE6A 3IR6B 4KAIA 4PXEA 3HHLB 3KHGA 3MEDA 5KQDA 1T6CA 4DV5K 4F0MA 5IC6B 2FLNA 1PGZA 1SAZA 2QC3A 2EFVA 4WYLA 4XTTA 3EYZA 1HW8A 4BGAA 4C7QA 1QVGM 5SWMA 1OH5A 5GMDA 2G2OA 1XNQK 4DHYA 1KHWA 5KOXA 3HXMA 2AYMA 1VOMA 4IYQA 2KKHA 4C8NA 4QBUA 3SJHA 4LF8F 2DFFA 3S6EA 3BSOA 4DSFA 1K9MO 1WKJA 1S9EB 3CDBA 1T9UA 4Q44A 4YB1P 1FNXH 3FBCA 3CJKB 4W5OA 2CJXB 3Q8QB 4LF8J 2HRYA 4TQRA 3PCOB 2G4BA 5G4DA 1KWMA 3CB4A 1VQKS 4AM6A 2QL5B 5LJ3Y 1HYZA 1G4CA 2XS2A 2G0CA 1URNA 1WSJA 2RPIA 5C25B 1J2VA 4N5SA 1J5OB 2OAUA 3CMEN 4JKGA 4LF6F 4MH8A 4OYIA 3E66A 4J9SA 2YNHB 3MMBB 4OJHA 1XNQF 4KO0B 2LP4A 4CH1A 4B1UB 4IR9A 1VQNS 2IAJB 2WAQD 5BR8F 3CCZA 5SUHA 2YPZA 3OTOK 4X4RA 2OEJA 2DNYA 3K5PA 1FWLA 5LMUF 3NNHA 2UUAK 5HBMB 2YQ3A 3EY1A 1JXVA 4PHTX 4E89A 3TSQA 1TYQA 4YR0A 3D2EB 4EI2A 1Q5VA 4DL2A 1RAAB 3OLAA 5M1QA 3N5FA 4WIIA 1RU1A 3SI6A 1HUXA 2FIUA 5L1IA 1M1HA 1NGIA 4EBEA 3AO1A 4BRHA 4A61A 1FDDA 5J2NB 1D5AA 3OR1A 1HBUB 2CJAA 5M2RA 1NUEA 5EU7A 4DV6K 4X62J 4DR2K 3QYYA 5ETMA 2XSJB 3VGSA 3FSIA 4MO5A 4GO7X 4BRIA 3QBCA 4LF4F 1Y3KA 3VAKA 1VBYA 4OKJA 4OHYA 3AODA 3DOLB 4DMZA 2O8EB 3L4BC 2ILZA 3IGNA 4K0KK 1RWNB 3M6XA 3MN7A 2VBXA 4IG0A 4LJMA 2VA3A 2IC3B 3I56N 3AA2A 2KZMA 1L3TA 4I68A 2GGPA 1ZTWA 3T5HA 2O8CA 1VQKN 4HCBA 2M7SA 1YBTA 2NSBA 3MF5A 4AUKA 4ZA1A 3U9DA 4I6AA 1Q8BA 2DK2A 2Z57B 3MMAB 1KQSM 2GJFA 3ZX3A 5F8LA 2IA6A 1C1CB 2CDRB 2IJNA 5ETSA 1Z05A 3CQ8A 1WHVA 3J7A1 2R8HA 3P4UB 2ITMA 1OO0B 2VWJA 3C94A 3O9SA 2DNMA 1DLOA 4IRCA 4M95A 2KN4A 3O6QA 2ZOMA 4JHDA 5KAKA 1ZS6A 3HKZD 4ZPVR 4ZVTB 4AHTA 3LP3A 1MWZA 3LWLA 3CTRA 2B6AA 2BMBA 5IC4B 3BP8A 1FXXA 2OEMA 2UXDK 1IBCB 5F2RA 4DV3J 4CIEA 4KHUA 3HOSA 1Z1ZA 1SL1A 1HLWA 1URRA 3QZ7A 1ELOA 3DRYA 5IV3A 3FZMA 3HJFA 3M2VA 4ZPTR 3B6OA 3WQPA 1U26A 2YHYA 3A8JA 2I2YA 2I5JA 4NMLA 1SPBP 3OYCA 4YDXA 2NRXA 3U4LA 2DCUB 4M45A 1RDUA 3M30A 2LDYA 3O4NA 2NNWA 3KWMA 1F9FA 1BL3A 2PO4A 2E20A 4C4WA 1B7YB 3MX2A 1PSDA 5LOQA 5DM6L 4B9VA 3IS9B 4OZ5A 2QWRA 1ZAWA 2DHXA 4X65J 4Y65A 3F73A 2J0QD 4KQZA 3CJBA 4PAAA 1N8RT 3E01B 3AA9A 3KDOA 5J2NA 2YBVA 1V4TA 4M1KA 3T3FA 2V4JB 2E1YA 3NCIA 3BQ0A 2HGMA 4GNIA 4FWNA 3L3CA 4L6V3 3EM1A 1C0UB 4E8UA 3U02A 5D15A 2IBKA 3THXA 2HMIA 2PDAA 1HNZJ 1LQ9A 1WG1A 1ZA1B 1CQMA 2QIFA 3MK6A 3LPTA 4JKEA 3OYHA 4NLGA 3H20A 3AO2A 5ADXA 3POTB 2BUPA 2Z2MA 2JEFA 3CPWR 3NS6A 2Y1RI 3CCLN 4H0VB 2XNQA 1ZXOA 5HO4A 5AQTA 4Y2AA 2CZ9A 3FKBA 1YHQS 1HI0P 3C66A 1ATNA 4KHPJ 5JXSA 4ED1A 3T7ZA 3R1HA 1Y5IB 4DPTA 4A2BA 2IJFA 2BJ7A 5IV4A 3C6UA 3V9UA 3BO2A 3SAHA 2W8LA 3HHDA 3MMAA 2OTJS 2K3IA 1WACA 2MHNA 3EEQA 1Y9OA 1T05B 3H3OB 5DO2A 1JKHB 3LW5C 4JRQA 4J9OA 1M0SA 3C16A 3KLFB 2AEFA 3CJQA 1TVRB 2HQFA 1DKGD 4ATNA 2BJ8A 2HVDA 3Q8SB 3FFIA 2CJ9A 3OYDA 2UU9F 4OYAA 5FIIA 2O8DB 1BQNA 3PJWA 2C1EB 3K5LA 1OS5A 2G8WA 2XWYA 3P4IA 4NLUA 4LF6J 4PG7A 2BA9A 1EQ0A 1EX8A 2FQQB 3IRXA 2DIVA 3R97A 5KFSA 2YHAA 2HW3A 5AZJA 1SIZA 5AQQA 4PQUA 3NGSA 2XMWA 2E88A 4NMXA 1K8KB 4FDFA 3VQ8A 5BPMA 2I5JB 4DUYF 1Q53A 4NPOA 2VG6B 2WRMA 1GLEG 2C2MB 3HSJA 2KDOA 4F0KA 3OYIA 3ISNC 2OANA 2WBRA 2YKAA 4HWIA 3AVMA 1VRQC 5IWAK 4LVOP 4ZOSA 4EK2A 2AGOA 4D3HA 4P7TA 1FF2A 1WAJA 6AT1B 1Q7YT 2AHOB 4TKTA 1R59O 3FZLA 4A47A 2WSCC 1BLUA 1NJIT 1W25A 3EGVA 2UXCJ 1YJNS 4FJHA 1VQMS 2E5GA 2DY1A 4ZP9A 5CZVA 3L7OA 3RSEB 4B17A 4KPCA 1D3WA 2V4JA 4CD1A 2VHGA 5BYSA 4QIFA 4E98A 1O13A 4F2SA 4OYOA 1IG8A 2BANB 3BGRB 2HEKA 2KFZA 4BR5A 3WIUA 5LY3A 2QLFB 1Y4ZB 3BDPA 1BQMB 2XMUA 2KT2A 4DV7J 3NMUA 3FK4A 2DIUA 3W60A 1S9GB 5F3TA 1G1XA 2WW4A 5C42B 1TKZB 4LF9K 3N01A 4ES2A 4UUXA 2QE5A 5B0BA 4KHYA 4J9PA 2M2BA 4Y0FA 4A8WA 2FGCA 2FZCB 3HBTA 4OYZA 1TKXA 1KXPA 3DC2A 2BTFA 1VQ6S 1WC6A 5DZ6A 1HR0J 4PL7A 3LP0B 3I5BA 1VFJA 2KT3A 4FVCA 5A8WB 4A8YA 4QPTA 5JMVA 3W7BA 1KN6A 5A6PA 2I38A 4FZZA 3TZZA 1YGYA 1S6QB 3D0GE 1N5QA 5HMXA 1VC5A 1S1VB 2BYCA 2Y1JA 2D3O1 1B70B 1NSAA 3IXQA 4CLPA 1T05A 3ATVA 4KPYA 3VEVA 3HHEA 2D9PA 2CJKA 4XH4A 4P10A 4ZVHA 1KTQA 5EHHA 4WKRA 3GCWP 3SV3A 4W98A 3D3CJ 1HARA 1NGJA 1TUWA 4BC3A 2HWTA 1NJIO 2HGLA 4F67A 4K25A 1T3VA 3I4PA 4GVEA 1HYVA 1BQNB 5E0OA 4BROA 2OPPB 1VBZA 1PC5A 2CADA 2VU5A 4ZVOB 4NYFA 3G8TA 3TZWA 2V7YA 3LDLA 4JI0F 4I64A 1IBKJ 3BH6B 1VSFA 3CFOA 4DR6K 3QQCD 3IRXB 2ZHOA 2ACYA 5M1OA 5IQ6A 3MM5A 3ILOA 4XPCA 3CXCM 4D3GA 1P8ZA 2F9TA 3F0NA 1K8KA 3KG1A 1QTNB 2BQ3A 4DZ6A 2P6SA 4AE5A 4CJQA 1RCHA 3PIPQ 1VSLA 5HRPA 2KH9A 4JUZA 4CJ3A 4NOHA 2FHJD 4DOZA 4EO8A 2EXUA 1YZ7A 1RI7A 2UUAF 1GXUA 1WC3A 4PZVA 1N48A 1ITGA 2WZ1A 2UUCF 1IH7A 2EKYA 4KGXB 3LUYA 1PAEX 4YOVA 4FJ7A 1TGOA 3O9QA 4QIGA 4ID5B 3QEIA 3D0IE 4BR9A 3C14A 4B3RK 2VFSA 1XNRK 3TEGA 4DSLA 4ZHRA 1HHTP 2P9PA 3RSEA 4QR0A 3BREA 2UXBF 4A8QA 3SAFA 2VFVA 1WOSA 5KFEA 3BBFA 2VD3A 3MAHA 4N8NA 1WN7A 4CGGA 4RU2A 1GQEA 2P9SB 3WXLA 1M90O 1YIJN 4ETXA 2P9UB 4H0XB 3V9WA 3BN4A 2FZKB 1KCFA 1RT7B 2B56A 3V5RA 1U1QA 2V5HG 2YKNA 4LF7K 4DFJA 2RQCA 2A6OA 4M63A 2MGZA 2KM8C 1I94K 4XAKA 1Z2ZA 1HNVB 1N32F 4E2FB 4UY8T 3P3DA 5HMYA 1SJRA 4MFBB 3C65A 3IR5B 2A10A 2HBRB 4QR1A 1VSEA 1NGEA 4QW8A 1WSHA 3OL8A 1CJVA 2JHEA 2LVWA 1RBRA 1IBLK 5FD1A 3CF5L 3K2PA 4L73A 1R8PA 2ZVIA 4Z4HA 1FCAA 4CHPA 2B8PA 2LU1A 2DY4A 4KH6A 1GXLA 4U7UD 4RW6A 2MYFA 4WFBQ 4YFUA 5HVGA 3BM7A 4HEA9 1UVLA 4JB8B 2O3DA 3G25A 1PO6A 3K5NA 3W63A 1NSKL 4RTFD 1NDPA 3HHLC 4AH9A 5AQOA 2D0OA 2A41A 2KJVA 2HFSA 4NYZA 4DR1K 5B8HA 3DLEB 5C24A 2KVQE 3LDSA 1NNDA 4AQYK 3MEDB 2F9WA 4PCQA 3WC2A 4LSLB 3UKRB 4TYBA 2N3LA 2Y1IA 5HROA 2HBYB 5J2PA 2QFJA 1IVZA 1RTDB 1S77D 4ISFA 2PI5A 3HPOA 2D3OR 4OJRA 1T9YA 3AJ1A 4M8LA 1Q7LB 5A2QO 4JKAA 3MM5B 3PHTA 3VQ4A 3H59A 1CJTA 1U2CA 1UPMB 4W5RA 1UVIA 1HWLA 2E1MC 4R5PB 4FW2A 3MAAA 4ZK7M 2UVUA 1RDCA 1IBKK 4BE1A 1VQYA 3D66A 2C28A 1D1UA 3AARA 4M5LA 3R27A 2ZOFA 3V9ZA 2QX0A 2CG4A 3RBDA 5KQ8A 4BRMA 2GQ2A 2RB7A 3MPWA 3LANA 1R43A 2UV8A 4WWSA 4FJ9A 2KZZA 4PL8A 1X60A 5KFOA 2HBQB 3QT8A 1HJRA 4ECSA 3PR5B 1QTMA 4NCGB 3KOAA 3M6WA 4EU0A 1UAWA 1S3XA 4BE2A 1NGDA 2Q1NA 2HPUA 1FFWB 1QQNA 1YTUA 4I6MA 3S3OA 2L08A 1RT3A 3LPUA 4CWBA 1X9JA 1RTIA 1JX4A 4C3KA 1RQ0A 1WD6A 1X4HA 3Q89A 3GJSB 2NQPA 3PFOA 4U67Q 3QSYB 2V51B 2P5GA 2WOMB 4PRFA 2HVIA 3TAPA 2XY5A 4KV8B 2KU7A 4WFBL 3KK1A 3W5ZA 4M94A 2B4JA 1XK8A 1BA1A 5M2PA 2VQFK 3R8YA 4KB1A 4H4KA 5E3QA 4ECYA 2J76E 4PUOA 2O4GA 2LCWA 2XLJA 3J81U 2DTJA 3HYFA 4HHTA 4CGIA 1P9YA 2GIQA 3E9PA 2ZD1B 1L3KA 1T9VA 2NXNA 4UOHA 2D3ZA 2GUIA 2KG0A 2AF6A 2JLGA 4QCLA 4JKDA 1W26A 1I3AA 3CCTA 1FVQA 5FJ4A 1RYRA 2HHQA 3PJXA 2HVEA 2HWHA 2FSJA 3R9PA 1ZAVA 3HHKA 3NP5A 3WZ0A 1FXLA 2IM3A 2BW2A 4DR2J 2ZKTA 3OR1B 5I3QA 4GO5X 4R0JA 3CQXA 1M5HA 2EG2A 2O01C 1QY7A 2V69A 2BE7D 3IM9A 1QAYA 2AX1A 1GLAG 2CJQA 1TL7A 2MLXA 5JLHA 1TL5A 1AA1B 1PJ6A 1QUPA 3M8YA 1XMBA 3F41A 4RW8B 5HVHA 4FM1A 1ULRA 2CWKA 4FP9A 3DOLA 3W5XA 2L3MA 1T03A 2UUWA 2R42A 1H2TZ 4JI7F 1K73T 1RXOB 4CEDA 1RWMB 2YXLA 4AFFA 5J2PB 2JFDA 3CJCA 2KYXA 2KB2A 5EDWA 4WPAA 3M8QB 5K9FA 5AQGA 4F0HA 4BRLA 1DQ8A 2KVIA 2C2KB 2CDQA 1JXEA 2RHSB 3AY9A 3ZFVA 2KLAA 2GGPB 3UD5A 3KNGA 1R6YA 4X84A 3KK2B 4R5PA 1XNQJ 3MAAB 2Y8WA 3BJYA 3D7EO 4H4OB 1I39A 4EBDA 2KHDA 2F4VJ 4U8VA 3KDNA 3H42A 1ASWA 3GG0A 1WKKA 1F0XA 3CCUS 1LNQA 3NAHA 3L95X 3JS9A 5G0RB 2B9WA 2CGKA 3EE8A 2BZ2A 5DM7L 3JSBA 2JOQA 2DVIA 4URQU 4DV7F 4ILLA 5F1XA 4RU9A 5EVZA 1TTHB 2HNZA 2YKPA 5D8HB 2FSKA 4H8KA 2HVZA 2HHWA 4ED7A 1BE4A 4CZLA 1X3NA 4HCCA 4FS1A 2Z4PA 3WT0A 3C19A 1O0PA 2NXEA 3SMPA 2VIHA 1VQ9N 4XDCA 5DQIA 2B6AB 5B7WA 3IO1A 1QZ6A 1VBKA 1X1PA 4FWMA 2EFGA 1LXNA 2QXLA 3OVAA 2E66A 5B0EA 1C0TA 4F02A 3OXGA 3IC1A 3NGZA 4OPKA 4M5GA 3RB3A 1SV5B 3PYEA 2IYGA 1YJVA 2KQ2A 4BR4A 4QS9A 3V1RA 2A5XA 3KJFB 4I1TA 5F8JA 4IOXA 4QWCA 4BRQA 2Z2LA 1WNEA 4IZ9A 2R2UA 3M30B 4JI6J 2CPDA 4YDDB 3R5GA 2V63A 1R7IA 5AQSA 5K8PA 2CZVC 3EUNA 3H5SA 1QZ5A 2FJWA 5F0WA 4DV2K 2HG4A 2IDEA 1CLQA 4FPRA 1KQGB 2M9KA 1F2GA 2Z8QA 2YWHA 3AGKA 3EKSA 1JLBA 2A6MA 4DBQA 5HQLA 3CCMN 1KAXA 4U7UK 5K14B 4IO1A 1C0UA 3JS6A 2DTUA 4Y6IA 3LP2A 4NLRA 3QRRA 5AJ3K 2FJXA 1HBOB 3CULA 3SCIE 1N36K 3S9HA 2AU0A 4ECZA 1ZYQA 1RAJA 5GAEP 2COLA 1VSDA 3HDSA 3O8WA 4AHSA 2L9DA 2ZKUA 3O3HA 3BH7B 3G6ES 3D45A 3G9CA 4Y0WA 3H5XA 3SQGA 4FVUA 3T19A 2XMVA 1F9EB 3DU5A 1V3ZA 2YV0X 3SBTA 3K8VA 1A5WA 2Z30B 2VASA 3PACA 2G2ZA 1SC1B 3ELHA 4OV1A 2XTJP 3OY9A 2MDAA 2E1AA 4ECTA 3A5LC 1ZBFA 1K47A 5G0RA 3ULDA 2B4UA 3GFHA 2HOEA 3UD3P 4IKFA 3QZ8A 2UUCJ 1JLFA 1X0PA 1S4EA 1QSLA 1VMBA 4B9UA 4F3MA 5D0EA 1UJ6A 4KKOA 3BGOP 3D6RA 4QWEA 1RDWX 3OYNA 1BI4B 3WDOA 1BHLA 4NLQA 5AQHA 3C0BA 1C4CA 3CO9A 4OI1A 1VQ8S 1WC5A 1JLCA 3ITHB 3IMQJ 2F9JA 4P75A 4KB0A 1U2FA 3EPGA 1VQ4N 4HTIA 3ID8A 3BBCA 1YI2N 4JI2K 2RQMA 4NEZA 3OD2A 3SQ0A 3HHLD 3DRRB 4CD3A 4PQUB 2IRUA 2ASOA 4OX9F 2PE8A 2BW7A 1J53A 1FKOA 4GV6A 2QTDA 3OL9A 5DDPC 4WZQA 3A4TA 1S12A 4UY85 3M05A 1HI8A 3PJ9A 2OHDA 2QN6B 2ZQBA 4M42A 1GX6A 1P9QC 2HHPA 3HX9A 2ZE2A 4ECUA 1OVQA 4AL5A 1RDDA 4B3OA 2AYEA 3CSKA 2FPHX 5AJ3J 3ETMA 5D6GA 4JI6F 1ZBUA 1WSIA 3ZC4A 2ZDPA 2R3VA 3CUNA 3CFRA 4F26A 4FXWA 2BANA 4B3TK 2GJIA 1X5PA 4C0HA 3CM5A 3D6HB 4KR0B 1M1GA 3BPDA 1WNSA 2X6NA 1RE1B 1VRUA 1ZPVA 2NSCA 1CZ9A 5A0YB 4N77A 2YKQA 5AZIA 4E19A 1D0EA 3M5RA 5D0GA 1WUUA 3R2CJ 3OBIA 1BWEA 2CQCA 2VZ9A 1IXKA 5ADXH 2VODA 3BR8A 4M3XA 3M8RA 3N79A 3MEGB 2ZH6A 3QERA 1RDRA 5F0XA 3VF4A 3CCSN 2RF2B 4X64F 4K4TA 3V4IA 1SH3A 2V2QA 3KXDA 3CXCR 4F8RA 5KG5A 1VC6A 5LMNK 3ZNUA 2OTLN 2AX0A 4ANDA 3ENHA 5KFNA 1CEZA 1XR5A 1CS4B 5DQHA 4IJNA 2RKIA 2ZJQL 1Q95G 1JJ2R 2BABA 1KEKA 3BQ2A 2OIHA 4DV1K 3CCJS 5C0YA 1JLAA 1VSHA 2YQ1A 2ZBQA 3A8EA 3R6LB 5GAHU 3ULHA 4Y1CA 1JLFB 1SQFA 4BWJA 1FEHA 3O1WA 5DJBA 4DLGA 3HF5A 4DU7A 4X4OA 3NY0A 4O44A 4LVNP 3MZIA 3IA0A 4DR2F 1GLJO 1BUXA 3ENQA 1Q82O 2H4WB 3LTOA 2UXCF 3D6FB 4OHWA 2F8TA 3FCVA 4W90B 3RRHA 3UN5A 3D68A 3OYBA 2D0BA 2XGPA 2B51A 4FLZA 4B1WB 4B1YB 2BJ9A 3PIPL 2MKKA 3FE1A 2GX8A 1TL1B 3AAPA 1IV0A 5K8OA 1TUUA 1NHKL 1Q81T 3ATUA 3CO0P 1SXLA 3MTKA 4CLUA 2VG5A 4DUYJ 4RJVA 3CC7N 3SK3A 1FERA 3V4MA 2NLWA 4YB6A 2R7WA 1B64A 3QNWB 4QWAA 3RR8A 3W62A 3MM9B 4DUZF 4K0KJ 3QETA 4CP5A 3UN2A 4JS4A 2FVPA 4DR5K 4DL0C 2GMLA 2RN2A 3TP2A 4J91A 3KHHA 5HSPA 5IWAJ 4J9RA 4OPHA 5EY4A 2CVIA 2MZQA 2N7CA 1IBLF 4NLPA 4ILGB 1RABB 1D8YA 4KHPF 1WKLA 1HQUB 4DUYK 3H4DA 1HBNA 3CFPA 3SCJE 1HHQA 4DI6A 4B3SK 1S10A 1FFGB 4DR3F 5ETLA 1S57A 1TFYA 4PG4A 4A46A 2XB2D 2P9UA 2RSQA 2DO0A 5J1PA 1YRUA 4KHNA 1T94A 1WEXA 4X64J 4BG8A 1H0HB 3QO9A 2DNRA 4P9SA 5A0YA 1LFWA 1CC7A 5F8MA 2GHPA 2A40A 4IG3B 3OR2B 4GW6A 2MB0B 5EOYA 4IO9L 4C3LA 1TUVA 1SCJB 4FBTA 2HHHF 5A2QU 3AQPA 3I0SB 2Y9HA 2WW8A 4M41A 5FPDA 3SEOA 4MQ3A 4CJVA 2YHXA 3FMWA 2VA2A 1BIZA 2LQJA 2R7VA 3ZZYA 5J2QB 3EICA 3LM2A 1DEJA 3MEKA 3FSXA 1KVKA 2E2PA 3K9KA 3SQOP 4B02A 5JS1A 1LEOA 3DLGB 4K4XA 4CJ7A 2Q97A 4KREA 4UY8O 2XSFA 3MR5A 4BQZA 2FC8A 4RZRA 3V9XA 1JLAB 4IR1A 2O4IA 2RS8A 4ZP6A 3EVOA 1VQPS 2MLYA 1S0NA 1QUVA 5GAGU 3AA8A 2V9KA 3ZSZA 2AT1B 2PGCA 3M9MB 3ET6B 4YMEA 2CQ3A 3AXMA 3TZXA 4JKBA 3NH2A 3GV8B 3R7BB 5L1KA 5AQKA 1FDNA 2E4LA 3E1YA 1NOZA 4NCBA 1VQLN 2X3DA 4KGMA 1RTJB 3NF8A 3UKRA 2EFNA 3A2FA 2QWMA 1FXRA 3W64A 2WC9A 3HLUA 2AJFE 1X5TA 1A9NB 4KI4A 2GV9A 3G71S 1KONA 2ZGZA 3F9KA 4DR4J 4CLKA 5GAHI 3CD5A 4KHMA 4OHZA 1K8AT 4LF8K 1UEVA 4HHJA 5I3UB 4O0JA 3KMSA 4CZJA 1RT5A 2DNNA 3R7SB 1JXBA 4BC9A 4DV7K 1WSGA 1WI6A 3G86A 2VONA 3NGTA 3GMGA 2APOA 1VYAA 3PSFA 2B43A 4ZVPB 1J27A 2DNQA 3OFGA 3OSNA 3MM9A 1MSWD 2VH7A 2QA2A 5ETNA 3T1HK 4BCAA 1DARA 4NLYA 2IYIA 5C2DA 2A42A 3BYRA 1NZ8A 3UE2A 3TABA 3UPFA 1WI8A 4QWDA 1U45A 2DR5A 3CCEN 1FRJA 5L38A 3AHPA 2X51A 5KFQA 1YJ9S 3V6KA 3ADAC 4EGLA 3DCAA 3CQYA 3AVIA 1N52B 1JXLA 3RBEA 4Q8EA 2IM1A 3O9RA 1U02A 2P9KB 3M9NB 2JFKA 3B82A 2ZWHA 3RTVA 5KGWA 4DR3K 1RCOB 3O9UA 4KV8A 4DCJB 2E6MA 3DMJA 2HBKA 3HKWA 4PYAA 2N4DA 4IG3A 4PWUA 2VGNA 4X62F 1QSYA 3I0SA 2ZZNA 3KG0A 2RVJA 2NRVA 2B0GA 3ZT2A 2VQFJ 4KJIA 4DV1J 3CCVS 5DRKA 4TU7A 1T8EA 4WFAQ 1X3MA 1TU0B 4TY8A 3EXCX 4DN0A 3BKTA 3UCGA 4GKJJ 4BG9A 3KYLA 1HLUA 2D4WA 5JVHQ 2XM3A 1RT1B 2OTJN 4OLPA 3SNNA 1UWAA 4LSNB 1DT9A 1U4BA 2XMJA 4LF4K 3OT9A 5FRMA 4LF7J 1PC4A 1FNOA 1EARA 4JKGB 3CMAS 5KFIA 3MMCA 2PYLA 2HHSA 3NS5A 4NZ6A 1N33K 4CLLA 1U1LA 1UZHA 4DR4F 2MQPA 5GMKa 1IBMJ 2XS7A 3AV9A 3VV2B 4J8FA 4A5BA 2XNRA 1OKJA 3AJ2A 2E29A 3IBWA 1YXQA 5D4PA 2V0NA 5C5JA 3S1TA 4CLSA 3UO0A 1Y3JA 2DHGA 4L3QA 2KTQA 1R6VA 3DHWC 4FYWB 2BOPA 1J6ZA 2X1GA 3OQ2A 1P1LA 3D2EA 2MMYA 5FDLB 2CQ1A 4RUHA 1HKCA 2F7TA 2W9CB 2D74B 2VUGA 2IGIA 2ACMA 1UTAA 3IUCA 3NWRA 3PX0A 3RJMB 2MQQA 2HS3A 7AT1B 5H9FJ 4WCEQ 4EZ6A 1I3OB 3SSSA 4YB5A 2JGUA 4P52A 5J1EA 2RDIA 3DRPA 1QQMA 1BC6A 2LFVA 3GYGA 4IH5A 1S1TA 1FA0A 2XSJA 2M5YA 3US5A 1PG5B 4FNHA 4ECVA 4IOAL 2VC0A 4X4TA 1O5JA 3GSDA 2OJ3A 3K0JA 1HNIB 2HNZB 3L4QA 1LW0A 3HI9A 4LY7A 4ES1A 2OZSA 4E3SA 3QEXA 5FLXU 3A8KA 2FHMA 4DV2F 3TZYA 2VC1A 4X4QA 1TR0A 3VENA 4CO1A 3ZZOA 2QSFA 5D0HA 3QRPA 4KH5A 4NYOA 1KC8T 3S7RA 4IG0B 2MZSA 2EK1A 1WSEA 3J7YI 2XG8A 2QL9B 4M5DB 3D2WA 5AR0A 2ZM6F 2AZ1A 1B4SA 2HNYA 3F56A 1IJEB 1JJ4A 4DUZJ 1NDCA 2BKPA 2FY1A 3W3SA 3EVWA 4CK1A 4USUA 4CIOA 3O6WA 5GAGP 2W24A 5AQWA 3Q8YA 4M5MA 3TARA 3UDEA 3SLCA 3WNEA 2V94A 2M3DA 3OS1A 5T41A 2D69A 3LAMA 2L9WA 4GKKF 1H1VA 2BKNA 3NCQA 4PXDA 2GO8A 4Y34A 4ZVGA 3I8DA 2LDIA 2YKMA 3B4MA 1T44A 1NK8A 3PW2A 2PD1A 4EYHB 4JI8F 3ZZUA 5K14A 3ZSOA 3GR1A 2DNPA 2EEYA 1QVFR 2RDDA 3G82B 1CG2A 3LP2B 3U1MA 1NPPA 4CYUB 1Y10A 4TSXA 1RGIA 2LA6A 2ZM6K 1S5ZA 4O3QA 3MWPA 3M9OB 2KXNB 1SZ2A 4LF9J 2B4OA 5I42A 4IH7A 5DDQC 4K0KF 1Q81O 3M2VB 3H3NO 3QGIA 3ILIA 3KLIA 2MY7A 2H3GX 3DU6A 4UQGA 3GL1A 6FDRA 4ILRA 3UR0A 4FZYA 4CHNA 4M3ZA 3KNAA 4DLEA 4OLOA 1LW2A 5AXKA 3GSIA 2BOAA 1EO1A 1VQ5S 1NSPA 1YAGA 1N32K 1BDGA 4WFNL 1XIQA 1C1BB 1WG4A 1ATSA 3AY0A 3GYXB 2G0JA 2HKEA 3HPHA 4O8KA 5JS2A 3V1OA 3TJ8A 3P1GA 1SL0A 4OGEA 2C3OA 5BRFA 1FK9A 3JAMO 2PEBA 2W7PA 4DF4A 2XI2A 3NGKA 3AVLA 3D6TB 3A0IX 1T9XA 2EK6A 3IAS9 1IG9A 1SQGA 5GINA 3IMXA 1EETA 4F36A 2PC6A 1V5VA 3ZEUA 2D0PA 3NNAA 2JLFA 3OTOF 1X4CA 1UKUA 4B1XB 1NGHA 2ZJQQ 4OLBA 1GLBG 4QZVB 2Y8YA 2BKOA 5HRNA 4S0MA 1X4GA 2VWBA 1SKRA 3CNQP 3TJ9A 3VEZA 2EFPA 1S1UB 1HWUA 2QKBA 2W7OA 4IEEA 5T14A 1RBVA 3QIDA 3AH6A 3KUHA 2DR8A 4IOAQ 3KJNB 4TXSA 1K8AO 2V8DA 4X4UA 1X9SA 3FBBA 1IBMF 1ZA2B 4OYBA 4RNHA 2YPYA 1IKWA 2C2DA 4XIUA 1DQ9A 1TUGB 1JLGA 2H65B 3CWJA 4JV1A 1F3FA 2DNHA 4CJ5A 3LH2S 4LFAJ 4K8RA 5EWEA 4JOUA 2IDOA 2ZE2B 1G99A 4O4GA 3KLFA 1TVRA 1VISA 4O3NA 1U8SA 3J80Y 1E3MA 1VAZA 5KT4A 1RBOB 2KJWA 3F5TA 3AT1B 1EWRA 3GU0A 2HK3A 2G1HA 3BBBA 2ZC3A 1RYSA 1Q8KA 3A5NC 3AO4A 2H51B 3PUFA 5D4LA 2O8DA 4OPAA 1VSKA 2QMUB 1Q86O 3IAYA 3DYAB 2EBEA 2HAFA 3G82A 3ILLA 4CYUA 1WF0A 1RT2B 2W6KA 2RNEA 4J90A 1YRXA 5AXNA 4R25A 2HF4A 4ZLLA 2P9IB 3ZZTA 2XYPB 4OX7A 3AVKA 3DM2B 2VPWB 4TU8A 3D6MB 4MIWA 4IRKA 1HW9A 1HWKA 2VDIA 4ZTFA 1UWBA 3S8SA 2DCLA 4HTJA 3A5MC 2E5LJ 3MEGA 3KHRA 3BS9A 5AQNA 2V4QA 1IKYA 2G9OA 3HJVA 3CPEA 4KGKA 3FCHA 5KFVA 1YTAA 2AWZA 3QFUA 5AE2A 3J80U 5E26A 1EJ7L 4EWTA 2QFIA 2ZH7A 3QJPA 5EX0A 5BN9A 3J81j 4ZLPA 2CPXA 3M3ZA 3FJ2A 4ZN1A 2Q6BA 2LXUA 4FLYA 4CJRA 3RAQA 2FBVA 4A8FA 1RHUB 1HKGA 3UKUB 1HNWJ 4CJ4A 2HZAA 3K9JA 5AQFA 1VSMA 4FOEA 2E6LA 5CD4H 4URSA 4FBUA 4DTNA 1FVSA 1Q79A 3E2EA 1S4FA 3OVNA 1NK0A 3KLEA 1NOYA 5EN1A 4CM0A 3TTCA 3I9ZA 1CVJA 2M88A 3ASMA 3P6YC 2MXYA 1XMQF 3R1LA 2BUNA 5L9XA 4CLFA 5HJYA 2G8HA 1TKZA 1NK4A 3FBEA 2WVFA 1S1UA 2R4FA 4KHRA 4AXJA 2OLWA 3CMES 2RRAA 2Q1LA 5L1LA 2V34A 5E33A 1JJHA 4Y00A 2OSQA 4F25A 1IUJA 1BG3A 4NE9C 1RWUA 4JI5K 1TL1A 4R0EA 2X78A 2JVOA 4ITSA 4C8OA 3QB0A 2IDLA 3CG7A 2A2CA 5L46A 3SZ2A 2PBDA 1BU6O 2ASPA 2VFTA 4DPXA 2W25A 3DI6A 4LSZB 1WELA 1UPPA 2UUCK 1S6QA 1XWLA 3NGRA 1Q82T 1TZ0A 3H2VE 4ENOA 3RRKA 1NBWA 2BJ1A 4DV4J 4DX8H 4AD6A 2ALYB 2ZZTA 1OJ4A 4OYPA 2MJNA 1YSJA 4WU2A 3FGUA 2ZZMA 1OQ6A 2YWKA 4PXBA 4XH5A 4G3IA 2IA0A 4P2XA 2HHTA 4JV0A 3QMLA 4MYTA 3D1QA 1HQUA 3GZ7A 1N6QA 2XHCA 3ZTOA 4NZ7A 4A48A 4CI6A 4FF4A 3OYAA 4WCEL 1SBRA 2GX9A 3CDEA 3UIQA 1MW7A 3F44A 1PBUA 4QYRA 4BRNA 1IM6A 1RACB 1HR0F 3KHYA 4ER8A 4LIRA 4OPJA 3I87A 3SCXA 3DM2A 1KD1T 1N33F 2ITGA 2VPYB 3RR7A 4DS4A 1J54A 4USIA 2E9RX 2FUG9 4OZLA 2I0XA 3BF1A 1Q86T 1IKYB 2U2FA 2HS0A 4Y2CA 3GV7B 3ZTRA 3IDHA 4HHHA 5J2QA 4J9KA 4IEIA 3KWGA 5KFRA 2ZF5O 5JVGQ 3MHYA 4DF8A 2OPQB 2EFQA 4ZHRB 2KYZA 1ZBSA 2MZTA 1NXIA 2DNOA 2DY9A 4RX6A 3FQKA 3D28A 4CI0B 5ITHA 3H7HB 1JCGA 5C25A 1XMOK 1P6TA 5JVHL 2HGNA 5RUBA 3L7UA 2YNHA 3Q86A 4J5OA 4DUTA 3KLEB 4DL3A 1DY3A 1M5OC 3Q2TC 1S76D 2FB0A 3ILJA 2GMHA 2HMPA 3PRVA 4DUZK 2Z2ZA 3PRDA 2OMOA 2QYGA 2WVCA 1RAFB 4DX5A 1HNVA 4MFBA 2CPHA 2M8HA 3IWLA 1BWFO 2ADBA 5M1KA 4J9MA 4JD2B 4OZNA 3E9LA 4Z4FA 4FKYA 2GCFA 3TA2A 3CYMA 4ZP7A 5LJ5Y 4JN4A 1ZBIA 5B0CA 3AB2B 3DHXA 1VBXA 5I3UA 1W2IA 3T5KA 3KLHB 3JAMU 3CJ5A 3E8OA 4BVPA 1AB8A 3IR7B 1N5TA 3R1XA 1KKHA 3C7NB 3WIVA 1EX4A 5ETTA 4CEBA 2UXCK 3TO8A 3VGVA 3VETA 1YJ9N 4QU7A 4CZGA 1HBUA 1WOQA 2YWWA 2WHOA 1FTCA 2DD8S 4ANCA 1QAJA 3FVYA 4M5IA 5B08A 3PEJA 1UETA 1HD0A 1KC8O 2IY5B 1G15A 4JKFA 5LM7E 2DGTA 4JI4F 4O8UA 4BREA 3ZSVA 2CKWA 4F3TA 3TR8A 2QA4N 2HBMA 1OY6A 1C2PA 1XMQJ 3J81Y 1OSCA 4YP3A 4Z7YA 3H46O 2ZJPL 3TRGA 4LSLA 2O8EA 1Y11A 5KFYA 2HQGA 4DX6A 1O8BA 3Q24A 4FVMA 2R2SA 3VAMA 4Q45A 1EP4B 1FHTA 1YIJS 2XZTB 2B8QA 2GHVC 4X62K 3GFYA 4FJ8A 4X66J 3DMJB 2V8PA 4DSEA 3HSCA 3U9ZA 1D8ZA 3O08A 5AQUA 3U7JA 1IO2A 2CPJA 1PILA 2ZBPA 2ROGA 5EX5A 4DR6J 3NMRA 3CD6S 1REVB 4YHHJ 1FE4A 3DXMB 4GC6A 4OHXA 1FNMA 1S7IA 1SJ3P 2CQDA 2YNGB 4FZVA 2ROPA 2YH0A 2C3YA 1BWVA 1VLOA 3K2YA 4AYBD 2XCAA 2AD9A 3A3NB 1Y00A 4CO5A 2GC8A 4JI4K 2GW8A 4QOTA 1J5EK 1DLOB 2B9EA 2IBOA 3RU0A 1DQAA 1WSRA 3PHEA 3SBGA 1U49A 4CM2A 4FSVA 3IBCB 2QO3A 1UVMA 4FO0A 3O2IA 4O4RA 2DR7A 2ETJA 5GADP 3OBWA 2I8EA 5C7PA 4IDHA 4WJBA 4ZPWR 3MMCB 2H48B 1MWMA 3AA3A 1HNXJ 3B6PA 4FPIA 5KFFA 5K5MA 2WOMA 3TNVA 1NH7A 5T7LA 2OFHX 4ZVFA 3VAFA 4F4XA 2KKZA 3QEVA 2MQ8A 2BVZA 9RUBA 4I7FA 2UV8G 2IIRA 3KLGA 2GJ2A 4JK8A 4JP8A 2VJUA 4IO9Q 1NLVA 4GMKA 4A62A 4PUOB 3N4PA 4OQJA 5GADI 1ZBHA 3H4BA 4X4NA 3GIJA 1S6UA 4X4VA 5JMNA 2ZD1A 3OSPA 1JL2A 2BQRA 2D5RA 2KO1A 4H03B 1K73O 4LRBA 4UTGA 1FWKA 4WIQA 3SIPB 3E01A 4LMZA 2W1BA 1GFWB 2ABYA 2HLUA 4V19X 3H0PA 4M5HA 5J1EB 3C6HA 1K9MT 3LDQA 4FM2A 2FC9A 4RWWA 2HFNA 4A8MP 2DRDA 2C42A 5KT5A 4MLEA 1NPRA 4WFXA 1K0VA 2BR0A 4A57A 2F8MA 4IOCL 3B54A 4ERDA 4NLXA 5CH7B 1XNRF 1KAZA 3HK2A 1T03B 1ZZFA 3GJRB 4FYXB 4NA3A 3OS2A 4CJWA 4OX9J 2AKWB 3BPSP 1Z26A 3BEXA 3PZPA 3W2WA 2WSFC 4NXMK 4OZ3A 4FCYA 2DGQA 1EP4A 4DQIA 4M5JA 2J6UA 3Q8VA 3R5BA 4ELVA 5IT0A 1X4AA 3DDNA 3KK2A 2EX3A 1M5KC 5HI7A 2MQOA 5HRSA 5EWGA 3M2RA 1YKWA 3DLJA 4YOYA 3O3GA 1AYEA 1JQGA 4DS5A 1W97L 3DXMA 3QAUA 4NLWA 3D5MA 3HM8A 2CG8A 3NBPA 4LF1A 2V2KA 4B9QA 2AEMA 2YKMB 2QWNA 4K2JA 3QESA 4X66F 2B5JB 4G1PA 2WB4A 1UJ4A 4FPBA 4BR0A 1IBLJ 3Q83A 2ATQA 4DR5F 2LECA 2DH7A 4LF4J 3V9SA 4B3RJ 4H54A 3CC4S 3TUPA 2LU2A 3MCSA 3O1LA 2YY3A 1UP1A 3H45C 4JI0J 4OYWA 2PA8D 3B78A