3QLHA

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase/ribonuclease H
molecule tags Transferase,hydrolase/inhibitor
source organism Human immunodeficiency virus type 1
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
total genus 144
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qlhA05
2G8IA 1HQEB 1FKPB 3KTQA 1YVUA 1KHVA 4CJKA 3OS0A 1J5OA 1S1UA 4FLTA 3M9MB 3QINA 3AVBA 1SH2A 4AHSA 4DU4A 1RTJB 3WNHA 2IAJA 2ILYA 2PYJA 3TANA 4JV2A 4Q5VA 1REVA 2J6TA 3BREA 1S0NA 5J1EA 4XPEA 2RPIA 2KTQA 2QK9A 4DWIA 2KW4A 2OA8A 4DQIA 2YNFA 3NH2A 5KRSA 4CJFA 3GIKA 3ZSYA 4DSFA 4DU1A 1BL3A 1F21A 1RDBA 1S1WB 3BSOA 3IS9B 4EZ9A 2A1RA 3RB3A 4O0IA 3HPOA 3VQBA 1KVBA 3NMAA 4NCBA 1NJXA 4GMJB 5KFBA 2FBVA 4W5NA 3IG1A 2AJQA 4M3TA 4YR0A 1BISA 2WB4A 4H4OA 3RMDA 1TVRA 3HP9A 3SFUA 3GQCA 1TKXA 2PZSA 1GX6A 4O44B 4CJLA 1TAUA 3ZT0A 5CYMB 3HYFA 5JS2A 4TLRA 5I42B 4TYBA 4PWDA 5JUMA 3CJ5A 3K58A 4RNMA 2JC0A 3OYEA 2HNYB 3LP1B 3Q8RB 3MAQA 4F8RA 4Y34A 3HVTB 3KLEB 3GILA 3BQ1A 4KFBB 4IFVA 3NCIA 4TY8A 2QKKA 2HHVA 1VSLA 5HRRA 2VG5A 2E9RX 3M8QB 5KFTA 3V6HA 1RTHB 4ECZA 3PY8A 1RYSA 4B9NA 5KI6A 2G8KA 2YKNB 3LZIA 3EY1A 3CO9A 3NBPA 3KLGA 4RW7B 2O5DA 2JLEA 4ID5A 5KFDA 2BANB 1RT2B 3HVWA 5K14A 5F8GA 4DTJA 3OHBA 2ILZA 4LQ9A 3T3FA 2E6LA 2UVUA 2DFEA 3QNOA 4O3QA 3UPFA 1VSJA 1NKEA 5I42A 3CJ4A 5HROB 4EO8A 4Z4FA 3HL8A 1KCFA 4K4TA 4KB1A 3SFGA 4J2BA 4F2SA 1Z4UA 3VQEA 1BGXT 2JGUA 4DL2A 4EP4A 4FJ8A 4K8ZA 4NZ0A 5DLFA 1A5VA 3OYGA 3V1RA 4KRFA 2VG5B 1YTAA 3HXMA 1HARA 4EO6A 3HKWA 4AHCA 3LWMA 3PW2A 3D45A 1RTDA 2DPIA 3AO2A 5KG2A 2F8SA 3PJWA 3FDSA 1NK8A 2XWYA 3I5BA 4Q8FA 3VQSA 5F8NA 3FRZA 2AWZA 4CJSA 4WXWA 4YMEA 3V6KA 4MK7A 4E89A 3OYKA 1NK7A 3I8DA 3LDSA 1S1UB 3VQ5A 3KHRA 2ASJA 3NL0A 2IM2A 4ZMMA 3CM5A 1QTMA 2ZD1B 1RT6B 3VQ6A 1DTTB 1HQEA 4QW8A 5FDLA 2G8UA 2FVRA 1VSMA 3RR8A 1TP7A 1L3SA 4I7FB 4AH9A 5KG3A 4CFDA 2QV6A 4ZTFA 1LAVA 4KBIA 2Y1JA 4CHPA 1KFDA 4DS5A 1N48A 3I5AA 3KLFB 1EETA 2XY6A 4K4WA 3RB6A 3M8PA 3KLHB 1KHWA 1JL1A 2FLPA 4NYFA 5KFGA 4RNOA 1TKXB 2XHBA 1NK5A 2E9TA 4Q0BA 2E9ZA 3QGHA 3P83D 3DM2A 4K8XA 5KFZA 2GUIA 1SKRA 2D5RA 3NFAA 4PWDB 2PY5A 1DLOA 1HNIA 4I9LA 4HTUA 1ASUA 3RB4A 4HUFA 2IGIA 4WFXA 5HRNA 4FK2A 4HUEA 3NBPB 2ITGA 4W5TA 3IS9A 4JV0A 5CYQB 2XI2A 1RBRA 3AVKA 2D0BA 2R8GA 4BDZA 4KAIA 4O0JA 1RTHA 2KFZA 3L8BA 2UUTA 3K2PA 2V0NA 1DTQA 4KI6A 5KFLA 4CEOA 1S1XB 4ZPBA 4CIFA 1RBVA 5T14A 3KJVA 2HMIB 3TAFA 4WYWA 1TKTA 2BQ3A 3TWHA 2DY4A 4M42A 2WCXA 1GOBA 4PUOA 5DGAA 4B8CA 1IKVB 1SUQB 4H4MB 4RNFA 4Q8EA 1XI1A 1TAQA 3MR3A 4W5OA 3CJ3A 3NAIA 3AO1A 3SI6A 5DK5A 4L8RB 4KB0A 3CFPA 1WSJA 2JEFA 4FYDA 4U7CA 4H4OB 1N56A 3ZSOA 4KHNA 4ED8A 1R0AA 3OHAA 1J54A 3AVMA 4RUCA 2XC9A 4PQUA 4QOZB 4QWEA 2X6NA 4FJGA 3VQ7A 3HVAA 3T1AA 4FM1A 3VN5A 5KRTA 3AA2A 3AV9A 1UWBB 4NCGA 4ECVA 1C1BA 2B5JA 1JLEB 4DFKA 2JEJA 2EHGA 3PW5A 1EP4A 1T94A 3HJFA 1CSJA 1WSEA 3KK2A 4J9NA 3KNAA 1VSIA 3G6VA 1HNIB 2IDOA 3DLKA 3TQ1A 3E51A 1K1SA 2AGQA 1R0AB 2W9CB 3SV4A 4ED3A 3QLHB 3JYTB 3BSCA 2I5JA 3QEIA 1I39A 4J2EA 1X9SA 3WNEA 3TARA 1TK5A 1XHXA 3O3GA 4IG0A 1BHLA 2UVRA 3V9ZA 3DLKB 2VWJA 4RW6A 4K50A 1NJWA 4LSLB 5KG6A 2Z1JA 2AU0A 4CJRA 4R0EA 3MR5A 5KFIA 5EUHA 2HMIA 5L1LA 3OS2A 3CG7A 2KZMA 5F8MA 4WZMA 3L2VA 1NOYA 1S1XA 4F3TA 5KG7A 4DTXA 2EC0A 4PQUB 2CKWA 1LW0A 1UA1A 4OGCA 1BQNA 4TY9A 3RMCA 3O4NA 1RT3B 1S1TB 2G8HA 3OYFA 3JYTA 3V6DB 4ECQA 4UQGA 4QWCA 4MKBA 4CERA 1BCMA 4M3YA 2P5GA 3C6UA 5L1KA 2UUWA 3KLFA 5DG8A 4NLVA 4ZP7A 1HJRA 2HNZB 3T5LA 4E7JA 2YHAA 4IFYB 4KHWA 1YVFA 1C0MA 1C0UB 4KTWA 3ISNC 5KT6A 4NLUA 2V4RA 1JLAB 3MEGB 2OH2A 3KOAA 1TKZB 1N6QB 4OJRA 4CGJA 1C1CB 4E0DA 2VG6A 4CEFA 2FVSA 5KFYA 3DYAA 1IKWB 5C24A 3DRPA 3QO9A 2XRIA 4NLXA 4LSLA 4OKJA 3K5OA 5DQGA 1YT3A 4M3RA 4ICLB 3KMSA 4KHUA 2C28A 4K4SA 2ATLA 4ZHRA 1Q9XA 3KJVB 4KV8A 4IOBA 1Y97A 2D0AA 3V81A 4DL5A 1WSHA 1U45A 3DOKB 2QKBA 1VRUA 4ELUA 1UOCA 3M8PB 3KLHA 4KHMA 3NGDA 3QGIA 4Z4GA 1YTUA 4FLXA 1I3AA 1TL1A 4CEEA 2XY8A 3E01A 4FLYA 4NRUA 3T5JA 1HPZA 5KT7A 2FLLA 3GV7B 1RT1B 3OYHA 1RT6A 1O1WA 3GIJA 3IAYA 1BIUA 1SL0A 1T03A 1SV5B 3MXIA 3FFIA 2R2UA 2BDPA 1X1PA 2W9BB 2HHQA 4IDKB 3DLHA 1EETB 2E4LA 2B4JA 5CZ1A 4X2BA 1JLCA 1ZTWA 4Q44A 1C0TA 3OJSA 3AVGA 4YNQA 4FZYA 4EYHB 1KRPA 1U47A 4TN2A 4CF9A 4DTNA 3LAMA 1T03B 3MEDA 3KLIA 4Y2CA 2UVWA 1NKCA 2OPQB 4TY8B 3HP6A 4ID5B 3CM6A 3DRRA 3ZT4A 4BWMA 4IKFA 4M3WA 2X74A 3OSPA 2HHTA 1QHTA 3AVIA 3RBDA 3DLGB 2D3UA 5KFJA 2R7YA 1QSSA 4CF1A 4XPCA 5FRNA 3CFOA 4FJXA 3NH0A 1Z26A 5J2NB 1TV6B 1MU2A 1IG9A 4RUAA 1KLMA 1LW2B 5KFXA 3OJUA 4OKEA 4DTSA 3SNNA 1NK9A 4I2QA 4ZPAA 1RTDB 1RTIA 4ZPCA 1SV5A 2RDJA 3VQ9A 1S49A 4ZHRB 3SQ2A 1IKXA 2BANA 3TR8A 5J2NA 4ZP9A 5KFKA 2X78A 2YNGB 2IM1A 3RMBA 4E7KA 2IJNA 2XGQA 4EYIB 1JXLA 4Z4HA 3K57A 4KKOB 1JLGB 1HYVA 5J2QA 1W25A 3OYLA 4M45A 4B9MA 2OPQA 1B92A 2Q3SA 5F8LA 3QIOA 3QESA 4DL7A 3HVTA 3SYZA 3C6TB 4Q43A 2VG7B 4KPYA 4DTUA 1L3UA 2ETJA 4H8KA 3RBEA 3KK3B 1C1AA 1TKDA 1RNHA 3MFIA 3V9WA 5C24B 3S3OA 2IAJB 3OVNA 1QQCA 3QEWA 2R8HA 4PA1A 4IQXA 3OYCA 2Z1HA 3K5MA 1ZYQA 3DRRB 5SWMA 1QAJA 5F9LA 1C6VA 3VQ8A 3PX4A 4FBUA 3MFHA 2R2TA 1S1VA 5KFWA 2FC0A 3KLEA 1SKWA 3I0SB 2VA3A 1C0UA 4ED2A 1EX4A 4DSLA 4HCBA 4KHYA 2WRMA 1TGOA 5KFVA 3PW4A 1JX4A 4R8UA 2VG6B 4MK9A 4N47A 3QETA 1S9GB 1HYZA 5KFQA 1S4FA 5F9NA 1N6QA 1VSDA 3SV3A 4IH6A 3KLIB 4W5QA 4C8KA 3RMAA 1TVRB 3T5KA 2RF2A 2XO7A 1RT3A 2XY5A 4KV8B 4KSEB 4HUGA 4DQPA 4GC6A 1LW2A 1KLMB 1NK4A 1HRHA 3P1GA 2YNHB 3DOLB 1NK0A 1J53A 4N56A 3OYBA 5J1EB 3QZ7A 4FXDA 1S9FA 5KG1A 2C2DA 3H2LA 1RT1A 1BI4B 5D3GA 3DRPB 5KT2A 1JXEA 3FSIA 3JSMA 1EP4B 1JL2A 4AHVA 1TL3A 4R5PB 4N41A 4B9SA 3E01B 1C1BB 3ZT1A 3O4QA 1J5OB 5HRPA 3VQQA 1K6YA 1SL2A 3F73A 3EPIA 2IA6A 1JLAA 3HHKA 2HHWA 2FVCA 4B9UA 1WSGA 4QCLA 4Q45A 3QLHA 5E41A 1OS5A 1S0OA 1WNEA 2QE5A 4NYZA 3B6PA 5EDWA 2JC1A 5KG0A 1LWFA 5HBMA 1SL1A 4IG3B 3O3HA 4F3OA 3OL7A 3A2FA 4E1MA 4O3OA 1S1TA 4E19A 2ZKUA 1ZBUA 3T5HA 4CFCA 1BQNB 4CEBA 1CXUA 3OYAA 5HP1B 1D8YA 3ZSZA 2OPRA 1KVAA 3OL8A 3SCXA 1UAXA 4WFZA 5EWEA 1VSHA 1WNSA 4R5PA 1JLEA 2YHBA 4FJNA 2Y1IA 3LP2A 3KKRA 1Z25A 1LWFB 4LH5A 3GIMA 3IN5A 1RT7A 4OPJA 3SQ4A 2GIRA 4O4RA 2EX3A 3SUOA 3DOLA 1N5YA 4FJ7A 3KD1E 3OLAA 4J9MA 3QGGA 4ZVEA 5DLGA 3NF6A 3ZSVA 1JLFB 3G10A 3M9OB 2J6SA 2FBXA 3G6YA 1RT7B 4MH8A 4OPKA 3ITHA 1WAJA 2HNDB 1U48A 3MR6A 3LP2B 1MMLA 4I2PA 3UDLA 3AO3A 5I3UA 3OYIA 3V9UA 3KK1A 1QUVA 3GV5B 3PO5A 4CGDA 4OLAA 4C8MA 3TI0A 4NLOA 3NDKA 2BRKA 4DTOA 4MKAA 1ZBFA 1VSKA 2FJWA 3AVNA 3D5MA 3H59A 2C2RA 5KT4A 4CJPA 2PYLA 3S3MA 1RDDA 4YR2A 4H4MA 4YP3A 3V1OA 3KKSA 4B08A 4QWDA 1BI4A 4KTZA 4AHUA 4JS4A 3ITHB 4IRCA 3DMJB 4I9QA 3PX0A 3K59A 3GIIA 4M3ZA 3PVXA 4CK2A 3SQ1A 4CHYA 5L1JA 1DTQB 2V9WA 5C42A 3CQ8A 1UA0A 3ICLA 4CK1A 4DF8A 1K1QA 3KHGA 5EU7A 4M95A 1S6PA 4C8LA 4NLWA 4IG3A 1HYSA 4CGFA 3UIQA 4ECTA 4I2PB 5HBMB 3I0SA 4WZQA 2OZMA 5DGBA 3MR2A 3V4IB 3G86A 4FK4A 4CGGA 2HB5A 1RYRA 3BR9A 1FK9B 3C6TA 4RW9B 3DLRA 2D41A 1N5YB 5FROA 4RZRA 3K5LA 2HHUA 1LWEB 5J2MB 1MU2B 4RW8B 3QERA 1I6JA 1XR5A 3QYYA 3DLEB 4ECUA 5JXSA 3QIPB 4DL4A 1Q9YA 4OLBA 4DTMA 2B5JB 1S9EA 3NKYA 1VRTA 2C2EA 1JKHA 1DLOB 5HP1A 5KFHA 4CEAA 1DTTA 1IKXB 4K4YA 1D9FA 4MQ3A 1SH0A 3NGZA 4CJVA 4QWAA 2DFFA 3LP1A 2OPSA 3AA5X 4J2DA 2GV9A 4ZVGA 1S9GA 3M8RA 3KHLA 2R8KA 3PHEA 3H4BA 1KFSA 3LPUA 1NKBA 4FW2A 3LWLA 4QW9A 2R2SA 2WOMA 4KO0B 4M41A 3AVHA 1QAIA 2YKNA 4GVMA 4I2QB 3SUPA 2WONA 1NJZA 1GX5A 3RRHA 1KSPA 1U04A 2IMWP 4JRPA 4AHTA 4CJWA 4IFVB 4O4GA 5KFUA 3ZT3A 4DLEA 2RN2A 4G3IA 3SPYA 4IH7A 1RAJA 3JSMB 1S6QA 2OPPB 2CJQA 3QIPA 4LY7A 4J9QA 2YNGA 2IS3A 4ED0A 5CYMA 5F8IA 4FLUA 1JLBA 2NUBA 3QZ8A 4CJTA 3UQSA 3FFIB 4DF4A 2HAIA 3OL6A 1C0TB 5KT5A 3VQAA 4FVMA 1RT2A 4B9VA 4FM2A 1KVCA 3VQPA 4KHSA 3G0ZA 3Q8QB 1NOZA 3AA3A 2FJVA 1S1WA 1TL1B 3MXJA 5HROA 4M94A 5FDLB 4K4ZA 1U09A 3AVLA 3NH1A 1LWEA 5J2MA 1WLJA 3OYNA 4FLWA 3V81B 4CJ5A 3ISND 3HT3A 4CHZA 3SUNA 4F4XA 4CFBA 4F4ZA 3KHHA 3IRXB 4HVJA 1NHUA 1JLCB 3V4IA 1T7PA 3DI6B 2F8TA 3H40A 3H5YA 3CYMA 1D9DA 2AX0A 4NCAA 4DLGA 2W9BA 4Y1CA 4Y3CA 4KB7A 4CGHA 3OYMA 3GYNA 4N76A 1RBUA 3NAHA 3THVA 3PX6A 3PO4A 4DU3A 4ECRA 2BE2A 1RA7A 1QE1B 2WONB 4K4UA 3FQKA 3H5XA 4NRTA 2AGPA 4IKAA 1HPZB 1RDCA 4N5SA 2V4QA 1NHVA 2YNIA 3CFRA 1C1CA 3C6UB 4C8OA 3B6OA 1D5AA 4FJJA 3V9XA 2YV0X 4YR3A 3KIOA 5KFMA 2DFHA 1LWCA 4HKQA 1VRUB 5DQIA 1HMVA 2WK4A 3MECA 4O3NA 1WAFA 1RT5A 2IM0A 3HPGA 3ZSXA 2XCPA 4KTQA 4JLHA 4Z0UA 3AVCA 4E1NA 4G1QA 2AQ4A 2W9AA 5C5JA 4KREA 2G8FA 4IRKA 3OL9A 2B6AA 4TYAA 1XR7A 2HWIA 5F8JA 4B3OB 5CY4A 1KTQA 4E7LA 1TK0A 3AVJA 4DTRA 3NF9A 4O3SA 4CF0A 3EZUA 3AVAA 4LSNA 3CWJA 2VWKA 4OVLA 4Y2AA 2F8EX 4F50A 4CF2A 4RW6B 4FJKA 2RDIA 4DL6A 3PJXA 1NJYA 4LH4A 2YNFB 5KT3A 4RW4A 3FQLA 1CZBA 4CJEA 5KGXA 3MXMA 3OY9A 1J9AA 3BJYA 3UR0A 3KK1B 1EXQA 4WFYA 4J2AA 4ID1A 2HW3A 1SKSA 2HNDA 1REVB 4PUOB 2A1SA 1JLFA 2HVIA 4WE1A 1WSIA 3V6DA 3HO1A 1FK9A 4FZZA 4B9TA 4HYKA 3LPTA 1ZBLA 3ALYA 3AO4A 3DRSB 4IFYA 3LZJA 5I3UB 4FJMA 1JLQB 5KFSA 3S9HA 2R2RA 4H54A 4URGA 4JUZA 4CCHA 5EWFA 1TKZA 2RKIB 3MTKA 1U4BA 1XWLA 2J6UA 4IR9A 3DM2B 5KG4A 4CIEA 4CJQA 2KZZA 4FW1A 2ASDA 1A5WA 4KHRA 3RRGA 4JRQA 2HHSA 3I5CA 2KQ2A 4DFMA 2G8WA 3TAMB 4CIGA 3QEVA 1JLQA 3G6XA 3SUQA 3VA3A 1HYSB 4M3UA 1ZTTA 4BACA 2W8KA 4IBNA 5EWGA 4J9RA 3V6JA 4CHQA 5D3GB 4M3XA 2I1RA 4ECWA 5C42B 1L3TA 3V1QA 4CEDA 3HSTB 4C8NA 2D7SA 3TAQA 4F4KA 1X9WA 2RF2B 1SUQA 3RAXA 3BQ0A 2B6AB 2XY7A 4Z4CA 2HHXA 3TAPA 2IC3B 2YNHA 2W8LA 2P51A 4MFBA 2IBKA 3ULDA 1HMVB 1XC9A 2OPRB 4DSEA 5HLFA 2GC8A 2ZD1A 4ZPDA 3TAGA 3N6MA 4HHTA 4LSNB 3TVKA 1JLGA 1ASVA 2WTFA 2WHOA 2HWHA 4Z4IA 4RG8A 1UWBA 3DRSA 3I0RA 5C25A 4CHNA 2FVQA 1QE1A 4FJHA 3NF7A 2R8IA 4G1QB 2DPJA 3QEXA 4NLRA 1HQUB 1ITGA 4CK3A 3PR4A 2VG7A 4NYNA 1D1UA 1CLQA 4RW4B 3RR7A 3HM9A 4JV1A 5K14B 3PV8A 1L3VA 3OLBA 1BQMA 3L2WA 2DTUA 3LP0B 5KFCA 4CJ3A 3ZCMA 3Q8SB 4EBCA 4CJ4A 2FVPA 2D3ZA 3GV8B 3CDUA 4IH5A 2QXFA 4DSJA 3DI6A 1LV5A 4R8UB 1S6QB 3KLVA 5KFNA 4NCGB 5KFOA 4DG1B 3CIZA 4ECSA 4F4WA 3WNGA 4RU9A 4TXSA 4J9LA 2BRLA 3K5NA 4CESA 1IKYB 1RT4B 4FLZA 3NGIA 3KD5E 5L1IA 1S1VB 2XGPA 3T19A 4KAZA 4RNNA 4FLVA 2VA2A 4NLPA 3M8SA 1GOAA 3ZSWA 4FM0A 5DG9A 1D0EA 4KKOA 4EBEA 3Q8PB 4E3SA 3VQ4A 4U6PA 1SH3A 2IJFA 4BE1A 2OYQA 3CJ2A 1B9FA 3HK2A 3PR5B 3WNFA 4E7IA 3LANA 1XR6A 3KK3A 2FBYA 2OPPA 4FZXC 2E6MA 1TKTB 1N4LA 1EKEA 2OPSB 4MIBA 1IH7A 3H98A 3OS1A 1RT5B 4BE2A 3IGVA 3MECB 4I7FA 5T7BA 1T05B 5J2PB 1JLBB 2FLNA 1WSFA 1RBSA 1LWCB 5DQHA 3L2QA 1FKOA 4XO0A 1RDAA 4Y1DA 3SJJA 4B9LA 1JKHB 2BQRA 1VSEA 3M9NB 4CF8A 3ZSRA 5J2QB 4DFPA 4OL8A 1TL3B 4IRDA 4DSIA 5L9XA 3O3FA 5JS1A 5KFFA 3DLEA 2FJXA 1IM4A 3QEPA 2G8VA 2AGOA 5KFEA 5KFAA 4DMNA 3NE6A 4MK8A 4ELVA 3CJ0A 4KFBA 5HRSA 3BGRA 4EZ6A 2ZE2B 1RTIB 3LAKA 4ELTA 4BDYA 1RA6A 2YKMB 4CEZA 2WOMB 1RILA 3EYZA 4CECA 1TV6A 4ECYA 3S3NA 4FS1A 4NLTA 4NLQA 4YQWA 2FBTA 5KG5A 3DLGA 3QNNA 3KLGB 1RTJA 4EEYA 4RW7A 3BSAA 2ATQA 1VK0A 3CVKA 3RTVA 2BQUA 4HCCA 1GOCA 1NNDA 4BWJA 4DEZA 3M8QA 3DDKA 3ZT2A 4O3RA 4LQ3A 3BQ2A 4FJIA 1T05A 5J2PA 2Z1IA 1S5JA 4CEQA 1RT4A 3P5JA 2ZE2A 3L3VA 4QAGA 3C95A 2HNYA 2P5OA 4ICLA 4ED6A 3H5SA 3SZ2A 4DFJA 4TQRA 1BCOA 3QO9B 3I0RB 5C25B 3HVRA 4F2RA 1RCHA 3EPGA 4O44A 3L3UA 4FJ9A 3IRXA 3BSNA 1T8EA 4AILC 4GW6A 1S0MA 3ASMA 3BGRB 4O4GB 4URSA 4PY5A 1FKPA 1IO2A 3OYJA 3CDEA 4URQU 3PZPA 1G15A 3RWUA 4DG1A 4MFBB 1JXBA 4KO0A 3HPHA 3TABA 3MF5A 4O55A 4EP5A 3U3GA 1CZ9A 1ZBIA 1QSYA 2LSNA 4IDKA 3N6LA 3IGNA 4O5BA 3AVFA 2YKMA 4DSKA 4EBDA 1HQUA 1ZETA 2O4GA 4OGEA 4DQSA 2X6SA 2W9CA 2F96A 4NLSA 4B8AB 1S10A 4J9KA 4Z4EA 2JEGA 4ED1A 4E7HA 2GBZA 3AO5A 1IKYA 1VRTB 1JIHA 4WYLA 4QPXA 3DYAB 5KFPA 3NGYA 1S97A 3OYDA 1C2PA 1U49A 4XIUA 2XCAA 1BIZA 1S6PB 3SPZA 3NF8A 2ASLA 3TAMA 4FJLA 4ZVHA 1QS4A 1L5UA 1FKOB 4K4XA 4NLDA 2ALZA 4CJUA 1HNVA 5HLFB 3RAQA 3MEDB 4IG0B 1BQMB 3DOKA 2I5JB 1S9EB 3VQDA 2Z1GA 4WE1B 4F4YA 2XI3A 1B9DA 1RBTA 3D28A 4DTPA 1ZBHA 4FS2A 1FXXA 3H08A 4KI4A 3VQCA 1NK6A 1IKWA 2W7OA 4RW8A 4FK0A 4GC7A 1ASWA 4RW9A 2D0CA 2HVHA 3LP3A 2C22A 4ZVFA 5FRMA 3H4DA 4J9PA 4OKKA 4RNHA 3MEEA 4TQSA 4J9OA 5SZTA 2BR0A 1HNVB 4ZP8A 3IG1B 3PUFA 2ZQBA 3V9SA 4LD0A 5CYQA 3LALA 3NHGA 1Q8IA 4O3PA 3TAEA 4CFAA 5DMRA 5DG7A 4MIAA 1QSLA 3KMQA 2OZSA 1RDRA 4NLGA 3ZSQA 3D0PA 3LP0A 1W9HA 3MEGA 4AHRA 4J9SA 4WXOA 4CHOA 4FCYA 3NAEA 4ZP6A 2UVVA 4CE9A 3U6FA 4ZTJA 3F9KA 4NLYA 5KFRA 4DL3A 2RKIA 3PW0A 4QWBA 3CDWA 3DMJA 4YFUA 1IKVA 3EZ5A 2B43A 2W42A 2O4IA 4CGIA 3KK2B 3BDPA 1KLNA 4BDPA 3L2UA 4FJ5A 3U3YA 1TQLA 1S48A 4B3OA 2W7PA 5F8HA 2IOCA 1VSFA 5KGWA 3SI8A 2KFNA 3RB0A 3AA4A 2BE2B 2GIQA 4FBTA 3MEEB 1LW0B 4BE0A 2JEIA 4TSXA 1LAWA 1CXQA 5CZ2A 4DQRA 4Q0BB 3SQ0A 2AX1A 3QIDA 4DQQA 3OSNA 3L2RA 2HNZA 2R8JA 1W0HA 2IC3A 4JS5A 1T3NA 3H5UA 4K4VA 4ECXA 1A5XA 2YNIB 1WN7A 4W5RA 4KE5A 2P1JA 1X9MA 3VA0A 4ED7A 1XHZA 3PW7A 3DLBA 5KTQA 3C94A 2IM3A 4DS4A 1TK8A 2BGGA 4KHQA 3N6NA 4IR1A
chains in the Genus database with same CATH superfamily
5IQ6A 4BRGA 4CJKA 4USMA 1KVKA 1S1UA 4BR7A 2XYGB 2ASMA 4A8WA 2IAJA 2CQ3A 4Q5VA 1VQ8S 1QDUB 2NR0A 1YRUA 3VVTA 3MMAB 2KTQA 2J0QD 1TL7B 2P9UA 4DWIA 2KW4A 1R8CA 2D9PA 3QNWB 2F9DA 4DPTA 4FYVB 4BVOA 3CCMN 4LFBF 4NL5A 1O0PA 4ANEA 1RDBA 4DV1K 2PAVA 3IS9B 4M7XA 4E2FB 4O0IA 3SMPA 1Y5IB 3PLAA 5JLFA 1KVBA 4FF2A 4GMJB 1WC0A 2AJQA 1V9OA 4ZIWA 3KDOA 4YR0A 4PL8A 4J7CA 1Q81T 1NGIA 3ZX0A 2WB4A 3UKRB 2DRBA 3Q2TC 2YHYA 3RMDA 3ID8A 1F3FA 3GQCA 1ESVA 3C7NB 1HLWA 1MMDA 1TAUA 4LFBK 4TLRA 2U2FA 3IWXA 1RTZA 3IC1A 1BQXA 3VZIA 2JC0A 1CJVB 1XUPO 2V68A 2NUUG 3CCMS 3Q8RB 3WT0A 2HVZA 3ZZPA 1X31C 5BYSA 5BXIA 3KLEB 1GLAG 4DUTA 1U2VA 5LL6d 4TY8A 1KQKA 4X66F 4ZJQA 2HHVA 2QKKA 2E9RX 2YKPA 5KFTA 3WX4A 3F44A 1W2BM 1YJNN 1HD0A 1RZMA 2R3VA 3EY1A 2QG9B 3KLGA 4RW7B 1SVDA 1I94K 1NGDA 3CD6S 1Y11A 4JI5J 1KR4A 2DNLA 4AL5A 2ZJQL 3HVWA 2MSSA 5F8GA 4CBUA 3OHBA 1CC8A 2IIRA 4RLEA 2CVIA 3NS5A 2LCWA 4M8LA 1NKEA 2KFYA 3HL8A 3KG1A 4J2BA 2H1YA 1HPMA 3VQEA 4NO7A 5HSPA 2LXFA 1VBKA 4EP4A 3PSIA 3C19A 2HLTA 1A5VA 3OYGA 1H98A 2VG5B 5AXNA 1HARA 1N36F 2CNOB 2KKZA 3D45A 1RTDA 3TRGA 4AD6A 2V4JA 3AO2A 4KT0C 2I7NA 3I5BA 4Q8FA 2IVPA 1V6HA 2AWZA 4ZCKA 3ZZZA 1U1RA 3FFKB 4WP8A 1VQOS 3I8DA 3KHRA 3CPWR 2IM2A 1YITS 1KQSR 3CM5A 5FPEA 3FZKA 1P1TA 4WQ4C 3U1LA 3JAMY 2VDIA 1VSMA 1U1MA 2UUAK 5FPDA 1Y64A 4CFDA 4JI6K 1LAVA 2Y1JA 4NA1A 1KFDA 1N48A 3Q8VA 2CPYA 2VBYA 2WFBA 1EETA 1WHWA 5DM7L 4DV0J 3JTPA 4LF2A 3I32A 3PFOA 2ZWPA 1YJRA 2NRHA 2N4CA 4OX7A 3D9BA 4Q0BA 3FZBA 4KRWA 1WBBA 2GIFA 2E1AA 4PWDB 2PY5A 4OX6A 2YQ3A 4HTUA 4HUFA 4DV4K 4CLFA 1VQ6N 3NVMA 3ZC4A 2G0JA 4W5TA 4Y0FA 4JV0A 1VJWA 3SXLA 3CC2S 3IA0A 2G4BA 4KAIA 1ILYA 2O8FA 2VFUA 2CPHA 2Z2YB 2UUTA 4C23A 4LUBA 2WBNA 1KD1T 1S1XB 8ATCB 3VPZA 3OW2M 5T14A 1SKUB 3TAFA 1TKTA 4M5MA 4JI7F 2K8GA 1H3DA 5DGAA 1IKVB 2WSEC 2O66A 4M5DA 1XK8A 5EVZA 3GR0A 2IJRA 2QL7B 1XNRJ 1H72C 3ZETB 1N56A 4H4OB 4OX9F 4HTIA 2XS2A 5HL7Q 4F67A 3BGUA 2UUBF 2RU9A 3MM5A 2X6NA 2V2VA 5ADXH 3I4HX 4M5KA 3DCAA 2K2PA 1M5KC 1UWBB 3HJFA 2LU2A 4OFZA 2V7YA 3G6VA 1C0GA 2IDOA 3KNGA 1PKUA 1WACA 2DY1A 1FX2A 5BPNA 3ZFVA 4ED3A 3QLHB 3P39A 4F25A 3THXA 3QEIA 4J2EA 1X9SA 2ZWHA 3WNEA 3TARA 3DAWA 3HTVA 3V9ZA 3E8OA 4P52A 3WQTA 2VWJA 4LSLB 4JK9A 4RU2A 3MR5A 4F36A 5KFIA 5CZXA 4DUZF 5U47A 2HMIA 1XMQK 2MQNA 2HVDA 5F8MA 2DO0A 3KKFA 2EFVA 1YLXA 1VQNN 2CKWA 1K8AO 4OGCA 4TY9A 1S12A 1BY9A 4LF6J 4UQGA 5FPMA 2JWKA 4CERA 1BCMA 4YOWA 2BJ9A 1VISA 3C6UA 1D09B 1SJRA 1NXIA 2B9WA 5IV3A 4IO8A 1XNQF 5HN0A 2NRTA 4E7JA 1YVFA 1K73T 4IYQA 4H03B 3ISNC 3EE3A 1JLAB 3MEGB 5HMYA 3J7ZT 3JTOA 2Y1LB 1ICEB 1Z2LA 1C1CB 2O8EB 4AXIA 4E0DA 1FDNA 4UOGA 3CXCM 4CEFA 4PAAA 2P9NB 1HKAA 2XSJB 2YKQA 1IKWB 4L3QA 3QO9A 2CJ9A 2XM3A 3VF2A 1I1GA 1OY6A 1KWMA 1Y3JA 1PG5B 2C28A 1Q9XA 4KV8A 3K0SA 3G8TA 2ZJPL 2XG8A 2QKBA 3QFHA 2Z56B 3LDLA 4ELUA 2J5AA 1E6YB 4DR4F 1UOCA 2FSJA 1H0HB 3BKTA 4KHMA 2JSXA 3F9MA 4FLXA 1I3AA 2Y1RI 3F41A 4CEEA 4FLYA 1HPZA 4CT8A 4RKUC 4QIEA 1BXNA 1VQ7N 1U0HA 3LO3A 1PJ7A 2VB6A 4M5GA 2W2QP 1O1WA 3CJRA 5SUHA 2MJUA 1SV5B 2EC2A 2WW4A 2OCEA 3FFIA 3OUYB 1X4BA 3ZZUA 2W9BB 5AZJA 5A6WA 2HHQA 1EETB 1FEEA 2E4LA 1UFKA 5CZ1A 2WB1D 3EL2A 3ATUA 1KRPA 2V4JB 4QOTA 4CF9A 4NA3A 4DTNA 4DV3K 3QB0A 1ZM9A 1CJKB 3MTJA 4Y2CA 1NKCA 4ES1A 3Q0AA 4OLOA 4MMOA 4ID5B 3DRRA 2V2KA 4CLTA 2YHXA 3OSPA 1HR0K 3C2PA 1HI0P 3AVIA 1I51B 2PSZA 1QSSA 3CFOA 1TV6B 1H1VA 5EN1A 1EIYB 5KFXA 3C65A 1YTYA 3M8ZA 2AEJA 3VF0B 1RTDB 1LFPA 1Y7PA 3MGJA 1OJ4A 3FRYA 3SQ2A 3TR8A 2X78A 4PWWA 1WG5A 2YNGB 3RMBA 4E7KA 3L9ZA 1JXLA 3EXCX 4KKOB 3GCWP 1OWXA 1DY3A 1W25A 5KPTA 1N8RO 3OYLA 1BO5O 4M45A 4WF9L 2ZDPA 3CQYA 1KAXA 3A1YG 1LXJA 1N8RT 1XMOF 5F8LA 1FERA 1S4EA 3QESA 4DL7A 3R9PA 4KPYA 3LGMA 3UB5A 2I8EA 1M5HA 3EVMA 3W9HA 3D67A 4JI1J 3RBEA 3KK3B 5CQGA 2VU5A 3B8HA 2VHGA 4C8YA 3VGTA 1VC6A 1QQCA 3T1HK 2JLFA 2CJAA 1FJGF 4IQXA 1UAWA 3AD7C 3OYCA 3DN9A 4CNZA 5SWMA 3HRGA 4RUBA 5KFWA 1SKWA 3I0SB 4UZBA 2QFIA 3PXGa 3ZZTA 4ED2A 3PW4A 1JX4A 4XH5A 3QMLA 5FLXO 4N47A 1HYZA 2FHJA 1RWXB 1S4FA 5F9NA 5CA5A 1VR6A 3KLIB 4C8KA 4W5QA 1H7WA 2W1BA 3T5KA 2RF2A 2YWEA 3A8EA 4KSEB 2RHKA 1HRHA 4X62F 5FIIA 3OVAA 5EY4A 4FXDA 3H2LA 1RT1A 2V63A 1BI4B 5M1PA 3R7NB 4C3MA 3DRPB 1OSDA 3KHYA 2JH3A 4QPTA 1JL2A 1TUWA 3C14B 5J1PA 3W5ZA 1K6YA 3LQVA 2AZ1A 2P9PB 4B9UA 3RSEB 1WSGA 2VODA 1M5PC 4QCLA 4Q45A 5E41A 3HZGA 1GEHA 1KP6A 3DHWC 2JC1A 1PAUB 5EGYA 5HBMA 5D15A 1SL1A 4P72A 3AJDA 4ZVSB 1QM9A 4IG3B 3G87A 3O3HA 2BH1A 3W2WB 4O3OA 1H38A 4CFCA 2F65A 2PE8A 4UY8T 5GAHI 2KRBA 5HP1B 4PQAA 2OPRA 3OL8A 5E0OA 4AQYJ 1C4AA 2FZGB 2HZCA 1JLEA 4HT5A 2W2PP 1QQOA 2H4YB 3AGKA 3IN5A 4K43A 4O4RA 1GLLO 2NRRA 3DOLA 1NAQA 4B3MK 5CD4H 2EG2A 2RUGA 1K9MT 2EFQA 1K8KA 3PCOB 3AD9C 2XZWA 4IQMA 1YF5L 2J6SA 2GA7A 5I3QA 2FBXA 2J8AA 5AQZA 1HWLA 1U48A 1X8DA 3UDLA 4U96A 1GNKA 3V9UA 2HSEB 1HBUA 3PO5A 3JAMU 2QYGA 2QT7A 4C8MA 2ZBCA 4YDXA 1UW4A 3QDKA 3A5NC 4MKAA 1M5OC 1VSKA 4C98A 2CIMA 2FJWA 5AQGA 3AVNA 1KQFB 2QTDA 4DV2K 5KT4A 1X7VA 2MLYA 4Y00A 3D2FB 4OYMA 2VQEK 4QWDA 4KTZA 4YEAA 2MZSA 4JS4A 4IRCA 3DMJB 2V69A 1OYDA 5HAOA 2V9KA 3PX0A 3OBIA 2KN4A 4X65K 4PPDA 2G9OA 5L1JA 4PL7A 2V9WA 4A8XA 5C42A 2V5HG 2VONA 4Z2XA 2EWSA 5HOOA 3KHGA 4L74A 2HBJA 3W3DA 4B3RF 2E7WA 4I1TA 2C2ZB 3UIQA 3IKMA 2QA2A 1VOMA 2IVFB 2XLKA 2OZMA 5DGBA 5GINA 4NMLA 1B7FA 4FK4A 4A8FA 4RX6A 3CCRS 1RK8A 4HTLA 3SCIE 5F41A 3TO8A 3MM6A 1RADB 3H1VX 1N5YB 3TUZC 4RZRA 5D0EA 1MU2B 4CQ1A 1XMOJ 2HOEA 1NGFA 4BR5A 2VL1A 1DKGD 3CE8A 4ECUA 4IEIA 4M1KA 3SQOP 4DL4A 4ISFA 1Q9YA 3G2XA 1B0VA 2O8CB 3CCSN 5ITHA 2C2EA 4ZCIA 1JKHA 1DLOB 4KH5A 5AQJA 4ILJA 1DTTA 1IKXB 1EARA 2H5IB 3EDRB 1SH0A 2YX6A 3FKBA 2CXEA 4CJVA 4E8UA 5B0BA 4QWAA 3A12A 2DFFA 1QVGR 3LDPA 2OPSA 3V5RA 4QJVA 2GV9A 1HBOA 3M6XA 2MHNA 3S6EA 1NKBA 2DR6A 3LWLA 1KBRA 2F8MA 4MDBA 3ADAC 1RWKB 1AYEA 3Q8YA 1NJZA 3RRHA 2A0FB 2V51B 4B3TK 2LEAA 4JRPA 3VHQA 1Y0HA 4BCAA 2QSFA 3CCTA 5T41A 1IUJA 2BZ2A 4G3IA 3SPYA 3VAIA 3M2VB 4HEA9 3THYA 3D7EO 3JSMB 4H0PA 4DV5K 2CJQA 4PCQA 2N3OA 4FLUA 2V67A 2LEBA 1JLBA 5F3TA 1YAGA 3QZ8A 2P6SA 1U8SA 4USUA 3ZZ0A 5KT5A 4B9VA 1RT2A 3UDCA 4FM2A 1DGKN 3HFVA 5LJWA 4QS7A 2UXCK 4KHSA 3G0ZA 4M63C 5GAHU 4IO9L 3M2VA 2ALYB 4C7QA 2BKPA 4WFNL 5HROA 5AQXA 2DITA 1U09A 3NOGA 4EHTA 3NH1A 1LWEA 1WLJA 2HGNA 2GO8A 3V81B 4CHZA 1VQ4S 4F4ZA 5AQQA 4OI1A 4HVJA 2HZAA 1OH7A 3FUYA 4BC4A 4IOAL 2VQFK 4NCAA 3F56A 3U27A 4DLGA 2AYGA 2W9BA 5AZJB 3LA0A 2W41A 1QQMA 4Y1CA 4ZVOB 1WTBA 3GYNA 2QW9A 2HQIA 1C0FA 4NE9C 4DV5J 1HKBA 3FQKA 3D3CJ 3V2UC 3EX7B 2KRRA 4IO1A 3MOZA 5L46A 4BRAA 1HPZB 4NYOA 1NCLA 3I4PA 3B6OA 1D5AA 4NI2A 4OV1A 1RWNB 2DFHA 1LWCA 4HKQA 2GZOA 1F6TA 3GCXP 4V19S 3BZCA 1RT5A 1YJUA 4OHYA 2UXBK 1RWOB 3ZSXA 1VQMN 2JHEA 4KTQA 3CCLN 1H2UX 3B78A 3AVCA 2W9AA 2V8PA 2G8FA 1ZXOA 4UQTA 2RAQA 5HMXA 1XR7A 1SIZA 2B4OA 3DXBA 2L3MA 5G0RB 5AZIB 3UVJA 2QWNA 4DTRA 3NF9A 4FWSA 4AL6A 5D4LA 5C2FA 2FJDB 2G2ZA 4LF5K 1OPIA 2W01A 4A2AA 2YQ1A 4AM6A 4FJKA 2RDIA 4QIWD 3BGLA 4FWQA 4RJVA 4QQBA 2VQFJ 1VRQC 1WORA 3BJYA 1EXQA 4BGAA 2HW3A 4ZVQB 1LFWA 1REVB 2GJFA 5HVFA 4CW7B 3R7BB 1DRZA 4WWSA 2E2QA 1U1NA 4WE1A 2KU7A 2P9IA 3H45C 4KIAA 2Q79A 1ZBLA 5C0YA 1T9YA 2E20A 3GB0A 4GY2B 1BUPA 3UE5A 3LZJA 3BN7A 4JV5F 3MAAA 5THWA 1SB6A 1UWAA 4ZLLA 3TZZA 1JLQB 3S9HA 2ZHAA 3MMBB 4A57A 4JUZA 3K7RA 1GMWA 4DR4K 2RKIB 3MTKA 1XWLA 4M5LA 4CIEA 4CJQA 4FW1A 2IDEA 1UVMA 1UTAA 2HHSA 4JRQA 3TVZA 4F04B 4K0KF 4DFMA 1UKUA 3CCSS 3KK7A 3TOQA 4DR7K 1GMUA 3EKUA 4NB4A 2C2OB 3QEVA 4CZHA 1GLDG 1T3VA 4BY9C 5K8PA 3J81Y 4MO5A 5C2GA 1O13A 4G6VB 4QZVB 1YZ6A 3CCJN 3V1QA 4CEDA 4NZ6A 4BVPA 4B1WB 3FMBA 4F4KA 2CNKB 1DJ0A 3QRQA 3MUTP 1N88A 1UVNA 2B51A 2YH0A 4ANCA 2H4WB 2J0WA 1VGYA 1FRXA 4DV0F 2XY7A 2HHXA 4H5VA 3GONA 2ZJRQ 4X62K 3J80Y 2P51A 4MFBA 2IBKA 1DFDA 1XC9A 3I8BA 3IM8A 4RWXA 5T7LA 3MN5A 4FSVA 4JN4A 2ZD1A 5KAKA 4LFCK 2NSBA 3NG8A 3TAGA 2DVIA 3AQOA 1WWHA 4LSNB 3TVKA 2HWHA 4RG8A 2FHMA 5C25A 3MDQA 1K0VA 4YOYA 1HNXF 4G1QB 3GU0A 1NMEB 5H1SV 2CZ9A 3PR4A 2NXCA 2VG7A 3SBTA 2BKOA 5K14B 3PV8A 3OLBA 4BRMA 1V4SA 5ETTA 2MQOA 2PD1A 3ZCMA 1VIOA 2D3ZA 3GV8B 4DSJA 4IJAA 1VQ5N 1LV5A 4JI0F 3PIPL 5KFNA 5KFOA 4ECSA 1CULA 2FQQB 3RSEA 3K5NA 2BRLA 4CESA 4FLZA 3KD5E 5L1IA 3QGPA 4EWTA 2HFNA 2XGPA 3RW7A 1GXUA 2OIHA 2A3ZA 1B64A 3Q8PB 5H9EK 1ATSA 2Y8WA 4BE1A 3R97A 4YY3F 1B9FA 1W97L 5A76A 2FHKA 4TLQA 3WNFA 3VWSA 4DN9A 3LANA 1VDHA 3UFCX 2HWTA 1FW6A 1XR6A 1MA9B 5IM0A 3BYPA 2OPPA 1EKEA 4Z37A 2OPSB 4C97A 4LFCJ 2QWLA 1E3MA 4MAKA 1E6VB 2K7JA 1RT5B 5HANA 3TPQA 1CS4A 4C2MA 1T05B 5J2PB 3HF5A 1MNEA 3A0IX 3SBMA 1LWCB 2GX8A 3CMQA 1SJ4P 3M9NB 4IZ9A 1WJ9A 3P3DA 4JK7A 2XYHB 4DFPA 1TL3B 2OD4A 4IRDA 4P7VA 3A13A 2E2NA 5ETLA 5D77A 4G1IA 1FFGB 1FTCA 2A40A 4MK8A 1OVQA 3WC2A 1CEZA 2D1CA 3EDQB 4UOHA 3VGUA 4ELTA 1TMJA 4CZGA 4BDYA 4CEZA 1W7AA 3CJCA 3OA9A 4CECA 2F1FA 4LF7F 4FYXB 3S3NA 1MROB 3RUBL 1RTJA 3C7NA 1U8WA 2P9NA 3J7YU 2ATQA 1VK0A 2B4PA 4B3SF 2NYHA 1JK9B 2BQUA 4HCCA 1V5VA 3M30A 4LF8K 1MDUB 2D4WA 5IWAJ 1FE0A 4BWJA 3DDKA 4UUXA 2JWNA 4LQ3A 2AYMA 3RAMA 1RT4A 2CZ4A 3P5JA 3C95A 3D2EA 2EVZA 2RRBA 1S6OA 1X3NA 1EAYC 1ATNA 1UCNA 2XYPB 2MEWA 1D4XA 4DV5F 1R8PA 4O44A 1OMSA 4XDCA 2Z30B 2H65B 1T8EA 1WDTA 1UJ5A 3D6RA 3QATA 2O01C 4AILC 4GW6A 2O8DB 4FXWA 3BB5A 3W1YC 4URSA 4PY5A 3MEKA 1IO2A 4GV3A 3CDEA 4URQU 4QYRA 3PZPA 5AFUH 5LOQA 1FRHA 1JXBA 1NJIT 3U9ZA 3L7UA 1HFEL 3TABA 3IAS9 3R5BA 1WOQA 4WBFA 4EP5A 4C48A 1CZ9A 4KH1B 4IDKA 1TFYA 3IGNA 4Y65A 3AVFA 2YKMA 1ZM2A 1IBMJ 2FJBB 3DLJA 4OHVA 3QRRA 3IWLA 4RUHA 4GKKF 1Q81O 5BRDA 4ZPWR 3IFEA 2O4GA 2KB2A 2F96A 2W9CA 3G4SS 4J9KA 2Y3YA 4LRFA 3THWA 4Z4EA 3BUZB 2VCPA 2A42A 3R7SB 1UZDA 4DR3J 2GBZA 1IKYA 1VRTB 4ZVTB 1JIHA 5C12A 3V4MA 3D68A 3NGYA 3ETMA 3POTA 1C2PA 1U49A 3THYB 2XCAA 2BJ3A 3TAMA 4FJLA 2VIHA 5DJBA 1FKOB 4NLDA 5TKYA 4IG0B 1FE4A 1BQMB 3ULHA 3O5BA 2WSFC 2AP1A 4F4YA 1UVLA 1KD1O 4M5NA 2MHEA 1B9DA 4X4RA 2BW7A 3D28A 3D7SB 4B3MF 5JJBA 4KI4A 3VQCA 3M32B 1IKWA 1WI8A 3DU5A 1NM2A 4B9QA 4L72B 5H9FJ 1ASWA 2Y0SD 3DU6A 2QWMA 2HVHA 2D0CA 2GHPA 5GAEU 2LQ8A 4OKKA 4U7BA 4F02A 2BR0A 4QR1A 4ZP8A 3V9SA 3O1BA 4GKKJ 3EICA 2AJ4A 1B0TA 3TAEA 2GQ2A 4LF9K 4DR5F 5IC4B 4CFAA 1QSLA 4IOCL 3IR7B 1YJWN 2GVDB 3ZSQA 3MEGA 4AHRA 4J9SA 3VAGA 2Q43A 3K8VA 2K3KA 3M05A 3IUCA 3ENQA 2UVVA 2QA4N 4ZTJA 5KFRA 1NGCA 2ZC3A 1YI2S 3CF5Q 3EZ5A 2HG4A 1IBKF 2C42A 4GVEA 3BDPA 1ZBTA 3I33A 2QLXA 2CH6A 1S48A 2HKEA 2ZVSA 4X65F 2W7PA 2ZJRL 1WC3A 1VSFA 5KGWA 3KUHA 2BE2B 1OYEA 1BG3A 1LAWA 3NRBA 2Y8YA 2Y0BB 3I56S 4R0JA 2ROGA 1PC4A 2HNZA 1W0HA 1KC8O 3X1LB 1T3NA 1VQ4N 2DO4A 2AJFE 5BYRA 4ECXA 1A5XA 3WX8A 2YNIB 4N8NA 3AB2B 3M2UB 3D54A 4ED7A 3UE2A 3PW7A 3DLBA 3FR0A 3C94A 5D4OA 4X64F 3R6GB 4DS4A 3CCVS 1U2CA 1RCOB 3AOAA 2DGSA 3KTQA 2HMPA 4USIA 3LPYA 3UDVA 2KHCA 3C8YA 3QINA 3GE1A 4AHSA 1RTJB 2GUPA 1VYAA 2MQPA 2KT3A 5AE3A 3TANA 1REVA 2QRRA 4KPCA 3EGWB 5J1EA 4KYZA 4XPEA 3SDEB 1H73A 1NMNA 3A5OC 2OA8A 2G1DA 5E3AA 2BUNA 4KH0B 3G82B 3NH2A 4DR4J 1SC3B 4KGKA 4BR9A 5E84A 1YBAA 2H9ZA 4PR6A 2KVQE 3SAGA 4FWRA 1X4HA 4H0OA 3HPOA 4RPFA 3UD3P 4KHPK 4NCBA 3O8MA 4P7TA 5KFBA 3TZWA 2ZH4A 2FBVA 4W5NA 5ETQA 3W65A 3UI3A 1N36K 3AT1B 1BISA 2YX4A 2HQGA 4MYUA 2VYPA 5B0GA 4TU7A 1SC1B 2O8BB 1TVRA 1XIQA 2KH9A 4DUYJ 5AQVA 4CJLA 1C4CA 2MYFA 4LRBA 2PI4A 5CYMB 3HYFA 4IOXA 5JS2A 2HBKA 2OEMA 1SXLA 1XTZA 2OGUA 3CJ5A 3OYEA 4GKJF 3LP1B 4CLLA 4BC3A 5GAEP 1DARA 4F8RA 3C16B 3SIPB 4WKYA 1HNXK 2HRUA 3GILA 3BQ1A 4IFVA 3VEZA 2B8PA 2D69A 3NCIA 4FN5A 2VG5A 4WCEL 3M8QB 3V6HA 1RTHB 3PY8A 1RYSA 3NS7B 4B9NA 2YKNB 1E4FT 3LZIA 3NBPA 1HWJA 2P9SB 3BYRA 2JLEA 4ID5A 3CD0A 5LSLA 2BANB 3GP9A 5E33A 4RO0A 4DOZA 4PWUA 3BKFA 2O8BA 2ILZA 3T3FA 1JB0C 4NMXA 4DV0K 3QNOA 1R8AA 1VSJA 4PXCA 3CJ4A 3NNHA 4EO8A 2L9NA 3J7AN 2UU9F 4KB1A 2IVYA 2BKNA 4F2SA 1Z4UA 1Y10A 4YDUA 4BC9A 3IRWP 2JGUA 2DHAA 2JL9A 4K8ZA 2NREA 4K8RA 1FDAA 1U2VB 3PW2A 5C2CA 2WVFA 1D9AA 2FUG9 2J7KA 5KG2A 1NO8A 3GJQB 4HH0A 3V6KA 3EWGA 1CQNA 3MPYA 4WFNQ 3CCZA 4K59A 1ULRA 2EFPA 5M1QA 3VQ5A 3NL0A 4ZMMA 1QTMA 2ZD1B 3VQ6A 1DTTB 3JSBA 3S1TA 4QW8A 5FDLA 5GAGP 2FVRA 3C6AA 3PSFA 2QV6A 3GIRA 1MWKA 4KBIA 5DM6Q 1VHXA 3I5AA 3CCQS 2V52B 2V8DA 3O1LA 2NRXA 3RB6A 3M8PA 1KHWA 2VJUA 4OI6A 4H0TB 4OI4A 4NEYA 4NXMJ 1NK5A 4H0VB 2E9TA 2E9ZA 3QGHA 3DM2A 2YX1A 4K8XA 3P5BP 1DLOA 3MX2A 2R7OA 3QJJA 4FK2A 4MYTA 2DNOA 4WP9A 3IS9A 1RBRA 1X4DA 2ZJQQ 4E1JA 4YDUC 4CI0B 4BLGA 2JJ4D 2V0NA 1G1XA 4LFAF 5A0YB 1RBVA 4LF4F 1M90O 1KOOA 3KJVA 2HMIB 3AJ1A 4DR1K 4BRDA 2DY4A 5AQSA 2HFUA 4OJGA 2F5GA 2WCXA 4ZKAA 1GOBA 3M5RA 4B8CA 3H0PA 4U9RA 1SUQB 2RS8A 4RNFA 1XI1A 1TAQA 4W5OA 3CJ3A 4MO4A 4K5SA 4CP5A 1JCGA 1G4CA 2Y9HA 4CBXA 4DN0A 1WSJA 2JEFA 3GFZA 4FYDA 4F0KA 3CI5A 2CFXA 4FWKA 4ED8A 3OHAA 3AVMA 1MSWD 4N8OA 1M1HA 1CG2A 3R3LA 3HVAA 5KRTA 3AV9A 4Y2MA 1NGEA 1JLEB 2EHGA 3EZWA 2P5VA 1FI4A 2H5JB 2CJBA 3KK2A 1UJ6A 1VSIA 3ZEUB 5ADXA 1IBLJ 4FOEA 5JVGQ 2B9EA 5K9FA 3E51A 3HSDA 3BSCA 2I5JA 3QJLA 1I39A 5K8OA 2V94A 3O3GA 5BJRA 1UMJA 3K89A 1BHLA 2UVRA 1NJWA 4K50A 5KG6A 3C66A 2M5YA 2AU0A 3DNCA 2AMCB 2QM1A 4R0EA 1OH8A 1AROP 3H90A 4WF9Q 2CDRB 5IT0A 2I6WA 4JK8A 3ET6A 2KZMA 3FZMA 1Q95G 3L2VA 1NOYA 4DTXA 3ETOA 2ZOFA 1V4TA 3F0NA 1LW0A 5ETSA 3RMCA 1AZSB 3CCES 3RBZA 2G8HA 4ECQA 3EVWA 4MKBA 2XZDB 4M3YA 2R42A 2UUWA 4NLVA 3D0IE 4ZP7A 1HJRA 2HNZB 2VPZB 5F0XA 2B3TB 3OR1A 3WIUA 4BQZA 4KHWA 1C0MA 1C0UB 4LSZB 1WF0A 4CJ7A 1E4GT 2P9PA 1XNQJ 2DGTA 3G8QA 2XNRA 4LF9F 4OJRA 4ZCMA 4A8SA 4CGJA 7FDRA 4CLZA 4DR6K 2V8GA 4ETZA 1OH5A 4HHUA 2DHSA 2DNZA 3DYAA 4JP8A 2XRIA 4CLWA 4NLXA 1HI1A 2X1BA 2MZQA 1F9FA 4KHUA 1Q5VA 3MX5A 2FYXA 1JXVA 4ZCLA 2I38A 1KAZA 2CWXA 3V81A 4V19X 2XQCA 5E2QA 3M8PB 3NGDA 2NPFA 3ZNJ1 1YTUA 1UETA 1TL1A 2KG0A 4D3GA 4DXLA 4NRUA 1DBDA 3CD5A 2HS3A 3T5JA 4YORA 3CC4N 4JKHA 3OVBA 3ZNUA 3CEDA 5KT7A 3GV7B 2DBBA 4HVZA 3MM5B 3IAYA 2CRLA 1NPRA 2DKOB 1GLCG 4WK3A 3MN6A 2PFUA 5LSOA 3ENHA 2ZH1A 3VAKA 5KPRA 3O2IA 3W2VA 4P6QA 3J80U 4ZJOA 2B4JA 4X2BA 4WFBL 1JLCA 1DQAA 2UUBJ 4P2MA 4YNQA 3MCOA 3ZYYX 4FZYA 1U47A 1RHRB 1PGZA 2BV3A 3CC2N 2RHSB 2CQ2A 3W7BA 3LAMA 1AB8A 3MEDA 2DB1A 3KDNA 3AAQA 4HWIA 3HP6A 4ID8A 5BR8J 4M3WA 2C3OA 5ETMA 4HI2A 1QHTA 3PIOL 3RBDA 3D0GE 3DLGB 3UVJB 4GKJJ 5HVHA 3M4XA 1Z26A 1U0SA 4ZLJA 3W62A 1MU2A 4RUAA 1KLMA 3ATVA 3OJUA 1WOPA 4DUYF 3SNNA 1NK9A 4I2QA 1RWWB 1RTIA 2RDJA 3VQ9A 1S49A 4ZHRB 3H1QA 1IKXA 5J2NA 4M5HA 1ZA2B 3JSRA 2K3IA 2IM1A 2IJNA 3HDSA 2KJWA 2AD9A 4KY3A 1JLGB 1HYVA 5J2QA 1QVFR 1HWUA 2AJ1A 2ZZMA 3MUVP 4B9MA 1KN6A 1B92A 2Q3SA 1CJKA 3QBXA 1RE1B 3HVTA 3CPEA 2H54B 3SYZA 4Q43A 2VG7B 1ZZFA 1E6VA 3MD1A 4WTYA 2E5JA 3FMWA 5IM0B 2OFHX 3IBCB 1RKJA 2VQFF 1TKDA 1VBYA 5ELZA 1TL5A 5DZ7A 3V9WA 5C24B 3S3OA 2IAJB 4JI6J 3FZLA 4LR9A 3QEWA 1DAXA 2IVNA 2R8HA 3HOTA 1FHTA 3TUPA 2MY7A 1VHFA 1ZYQA 1YWXA 1QAJA 5AFUA 3NWRA 3VQ8A 2RSQA 2R2TA 2FC0A 1HI8A 1HWIA 4LJMA 1FVQA 1EX4A 4AFFA 4DSLA 3GJSB 5HL7L 5KFVA 4MK9A 3QETA 3KWIA 2RIJA 1MG7A 4BBYA 4JYAJ 1RWVB 4WIQA 1IBCB 3RMAA 2CDQA 1TVRB 1WHVA 2XY5A 3R2CJ 4JI5K 4KV8B 1SJQA 4DQPA 4GC6A 1LW2A 3P1GA 2YNHB 3DOLB 4CO1A 4N56A 1J53A 3MWTA 2O1PA 5GIOA 5J1EB 3OYBA 3QZ7A 3FEZA 2AV5A 2C2MB 1YJ9S 4CO5A 4BQLA 2AF6A 1EQ0A 4YB6A 2ZBIA 5D3GA 1P9QC 3BP8A 5GVQA 2FJEB 3FSIA 2GGPB 3JSMA 5GADI 3GJTB 1TL3A 4N41A 1HW8A 2H3GX 1QTNB 3EEQA 1C1BB 3MM9A 2D0OA 3VQQA 3W0LA 4FPBA 3OR2A 1SL2A 3EPIA 4OHWA 2IA6A 1S22A 1X4GA 3ENWA 2N82B 5AQUA 1OS5A 1Q0NA 2LMIA 1WNEA 4NYZA 3QFUA 3B6PA 1LWFA 3VOVA 3UKUA 4LBHA 3DWLA 4J37A 2V2QA 5AQTA 4MIWA 1RAHB 3NY0A 4FYYB 4E19A 3T5HA 3JAMO 5AQYA 2CJYB 3CC7S 2V34A 1GH8A 5HMZA 1CXUA 2W7AA 2RUSA 2BX6A 2OI2A 3KZBA 3SCXA 2B9XA 1FEHA 1VSHA 2MKYA 1WNSA 4R5PA 5AQHA 2CJXB 4X4UA 3VESA 1M1GA 2E5LJ 2YHBA 3LP2A 2DXFA 2Q1NA 3KKRA 2IIHA 1CLFA 1YIJS 1QVFM 4LH5A 3GIMA 5CCLA 4OPJA 4FXVA 2GIRA 2EX3A 1N5YA 3NS6A 4FJ7A 1CBKA 3QQCD 1VQON 3FZHA 4UY8O 1UEUA 3QGGA 3NF6A 4JBCA 3M9OB 2OKQA 1NH8A 2KHDA 1HNWJ 4QYZK 1GLJO 2HNDB 3QFPA 4EI2A 3LP2B 1MMLA 3DJCA 1T9WA 1IM6A 5I3UA 3OYIA 1QUVA 3GV5B 4PXEA 3UD4P 1XMOK 4OLAA 3J7ZO 2PFFB 2VQEJ 4GNIA 5TKWA 3QT7A 3TI0A 4NLOA 4DV4J 2PGCA 4RR5A 2F4VJ 2BRKA 1K9MO 1XEZA 2DIVA 3ENOA 4X65J 3IR5B 3RZAA 1K0TA 4DTOA 1ZBFA 4GV6A 2QWQA 2CWKA 2FZCB 2KXNB 4CJPA 5CZVA 1RDDA 1XNQK 4C3KA 2M70A 1IBMF 2L9WA 3OTOK 3OV7A 4B08A 3JQMA 4N77A 2C2KB 2H3EB 1N32K 2SXLA 4EFHA 1SCJB 4X4QA 2YY3A 1U1LA 1NBEB 1UFWA 1J5EJ 2DCLA 3ICLA 4A8YA 4CK1A 1NNEA 1K1QA 1QQNA 3U7JA 5EU7A 4ITSA 4C0OC 2FB0A 1JJHA 1XNRK 2VBWA 4UTGA 4RCHA 4BC2A 1VJQA 1RJJA 4PZVA 4IG3A 1HYSA 4GVBA 2D3OR 4ECTA 2R7TA 3ULEB 2JVOA 3G86A 4CGGA 1S7IA 4OI2A 1RYRA 1Y00A 2ZBQA 4RW9B 1FX4A 2CG4A 2HHUA 2WVBA 3LPEA 2LU1A 4NXNF 1I6JA 3QYYA 4B3MJ 4O8UA 3DLEB 3U4LA 3I96A 5GMEA 3BF4A 4OLBA 4F3MA 2NRWA 5M2PA 2YHWA 1VRTA 5AQOA 5HP1A 4CEAA 2IPOB 4K4YA 1D9FA 3OTOJ 3NGZA 1XMQJ 2VOOA 4NPOA 1T9UA 2PA8D 5BPLA 5E26A 5M1NA 2CNLB 1REGX 3J7A1 3M8RA 2R8KA 2DGVA 3MUMP 3VV2B 4QW9A 1Q16B 4M41A 3CF5L 2OTJS 1T11A 1R6VA 4GVMA 1W26A 4I2QB 1YGYA 3SCKE 1GX5A 2IMWP 2FLOA 2F8HA 1FD8A 4IFVB 2X1GA 3A8KA 4JNEA 2M8DB 4B1XB 4JKBA 2RN2A 1HBNA 4OX9K 1RAJA 3D3BJ 2F7TA 3QIPA 3PHTA 3GBTA 4ED0A 2W25A 4TKTA 2VFTA 1LOTB 2NUBA 3G82A 5HJYA 3FFIB 1G99A 1AFIA 4NEZA 5GADU 3QPIA 1C0TB 2JNJA 4ES2A 4MDAA 2DIUA 2BE7D 4FVMA 3NEKA 1LKZA 4CZIA 1HBOB 2QLFB 1JJ2R 3Q8QB 3AA3A 4QU6A 4KGMA 3CJQA 4MT1A 4M94A 1S79A 5LJVA 4XAKA 3R3TA 2D0PA 4ZOSA 4YB1P 4FLWA 1O6XA 1ZS6A 3L7OA 4CJ5A 1PSDA 3HT3A 2FY1A 2R4FA 2HLUA 4JKGB 3CD7A 3PIOQ 1HJOA 2F8TA 4CWBA 1D9DA 2AX0A 3R6MA 2XSJA 4LRAA 3K0JA 4CZKA 3R5JB 3NP5A 2CQIA 2GS8A 3G25A 4N76A 2RDDA 1OH6A 1ZPWX 1RBUA 4DU3A 4ECRA 2BE2A 1RA7A 5IT9U 1QE1B 3MK6A 2WONB 2KI2A 3H5XA 4NRTA 2AGPA 3DC2A 4N5SA 3W8PA 3CFRA 4NYPA 2YV0X 4YR3A 1H2TZ 2E7XA 3KIOA 5KFMA 3ENAA 1HMVA 4O3NA 1UPPA 4IEEA 2LYVA 2IM0A 2EKYA 3VTIA 2XCPA 4DCJB 2AQ4A 2GHWA 3N5FA 4LF7K 1WC1A 4KREA 1YRXA 4XK8C 2OP5A 1U1OA 1HD1A 1RABB 3HHDA 2A1BA 2EBEA 4E7LA 2I7PA 1TK0A 1QUPA 1B70B 4O3SA 1N33J 2BUPA 4DV6F 3SSQA 5MAOA 4Y2AA 4CF2A 2VDHA 4RW6B 3CJ8A 4C0BA 3PJXA 1KVJA 1NSPA 4LH4A 3J81O 2YNFB 5KT3A 1YJNS 1NDKA 5K8NA 2XLJA 3FQLA 2AYBA 2DNKA 4BHQA 1IQTA 3MXMA 3CSKA 2IBOA 3KK1B 3N79A 4WFYA 4CZLA 1VQ9N 3CTRA 1SKSA 3WXIA 2AZ3A 2IYGA 4DJBA 1RGIA 1WKKA 3MMVA 1JLFA 1WSVA 2HVIA 3TSQA 3CJKB 4K2JA 3E9OA 1NSQA 3ZZOA 4B9TA 4YOVA 4HYKA 5KQDA 3T1HJ 3LUYA 3ALYA 4K7QA 4ILMA 2FF6A 2BJDA 2HFOA 3DRSB 3CJKA 4M7YA 2QX0A 3F2KA 4U67L 5I3UB 5KFSA 2FZKB 4CCHA 5L39A 1RLCL 4PG7A 3MHYA 3M6WA 5KG4A 1RDWX 2KZZA 2W4PA 1G3OA 1A5WA 4PYDA 1WEXA 3I5CA 1EKSA 3KYLA 1OPZA 3NLCA 3TAMB 1ITPA 2Q97A 1VQPS 2ZDOA 1Q1KA 3G6XA 3SUQA 3UWTA 2KT2A 3CHWA 3PYFA 4BACA 2HFSA 2W8KA 4IBNA 5EWGA 3SLCA 2BBEA 5GMKa 4DV7F 3WC0A 4J9RA 2W2OP 1FWKA 2I1RA 5A8WB 1X4CA 2F3JA 4ECWA 1JNZB 5C42B 1DURA 1L3TA 3HSTB 4C8NA 3P45B 2KKHA 1WOOA 1YXQA 2W24A 2RF2B 2MQ8A 1X5PA 3FSYA 4K41A 1S7HA 1N36J 1SUQA 3FNNA 4F4AA 3RAXA 2R9LA 2B6AB 1EHWA 4Z4CA 4NA2A 3TAPA 2IC3B 1Z6RA 1P1LA 2ROPA 3M8YA 4DUYK 2Q0RA 3THXB 2UUCF 3CQXA 5HLFA 4I56A 1PYTA 4WQ5A 1JLGA 2WTFA 5M1KA 3THPA 3EKSA 1UWBA 2VUGA 3ILOA 4OV6A 3L6QA 3DDIA 3UKUB 1QE1A 4FJHA 4DCPB 4DI6A 2YI1A 2Z58B 1U6ZA 4B1ZA 4NLRA 1OQ3A 1D1UA 2VKRA 2DTUA 1GXLA 4P2XA 4FOIA 3ZXWA 3NMRA 4GMKA 5D4NA 1WB9A 4CJ4A 2QZ8A 3CDUA 2M3DA 5A8KB 4LF4K 5FD1A 3GFYA 2V2ZA 3MN9A 3M1VB 4DG1B 1J2VA 2UUCJ 3WNGA 3PKMA 2RT3A 2VPXB 2PIIA 4P75A 4USHA 1KONA 4RNNA 2VA2A 4NLPA 3OQ2A 3WUHA 3ZSWA 5KQ8A 4LF8J 3R2DJ 1D0EA 5E3PA 4JD2A 5D4PA 4EBEA 2QLWA 1SH3A 2OYQA 3CJ2A 5BR9A 3IO1A 3AOBA 1F9EB 3Q89A 2XTJP 2CQGA 2FBYA 1RHQB 2E6MA 3GFXA 2D74B 5DM7Q 2LXIA 4HR2A 3H98A 4DPYA 3CETA 3Q24A 3BO3A 3OS1A 2WVEA 5T7BA 4I7FA 2FDNA 5F1XA 2DNYA 1TYQB 3TA2A 1LXNA 4I4BA 3QT5A 1CC7A 4XO0A 4B9LA 3FGUA 1F0XA 4DV6K 3ZSRA 2YCHA 3MPUB 2VC1A 1PO6A 3M1FA 3AY0A 4PABA 3O3FA 5JS1A 2IFXA 1OSCA 2FJXA 2JDJA 1IM4A 3QEPA 3VZHA 5F0WA 1OQ6A 1PILA 2Q31A 3CJ0A 5HRSA 4OYWA 3UW1A 2YBVA 3IR6B 2L41A 2YKMB 2WOMB 3EYZA 4ECYA 5JMVA 3PDNA 3I55N 4NLTA 2BJ8A 3EUNA 4EK2A 1Z2ZA 4LF6K 1K73O 3KWMA 4EEYA 4OZ5A 3BSAA 2WVCA 2QL9B 4YY3J 2CPIA 4JI2J 2DNGA 3LM2A 3IWNC 1GOCA 5M1OA 1NNDA 4DU8A 3IFRA 3M8QA 5DETA 4RL1A 3BQ2A 3VR1A 4FJIA 2A10A 2RE1A 2Z1IA 2E5HA 4QIFA 2HZVA 4CI6A 4C9DA 1H7XA 3L3VA 2VASA 2RH3A 2EXUA 2P5OA 4YN3B 3SZ2A 5HO4A 5BRFA 3VEWA 4TQRA 1B99A 3QO9B 3MM7B 4R25A 1RCHA 1Q7YO 2QTWA 4MJKA 2M7SA 3IRXA 2HHHF 4DV6J 4B1YB 1S0MA 2J4RA 1FKPA 3OYJA 1RWMB 4Q2LA 9RUBA 1IR0A 3D2WA 3E3XA 2UXBJ 4MFBB 3CDBA 5IV4A 4B3TJ 2HBYB 1WHXA 2WZ1A 3M8WA 4B02A 3U3GA 2OMLA 5HQMA 1ZBIA 1QSYA 2AEMA 3N6LA 4JB8B 5IT9O 4O5BA 4B1VA 3CMAS 3BH6B 2YWWA 2H51B 3MM6B 3P49B 4CZJA 3FSXA 1ZETA 4WIIA 3EGZA 4OGEA 2X6SA 3GR1A 3VGMA 4B8AB 1S10A 4F0HA 2J7WA 2A2CA 3AO5A 1FRJA 3ZEUA 4QPXA 3TP2A 4XIUA 1YDLA 3CO0P 2HF3A 1S6PB 1N5VA 3JQKA 4KGXB 2A6MA 5B09A 4V1Ak 1L5UA 4K4XA 2ALZA 3CNQP 4CJUA 1HNVA 5EX5A 5HLFB 1G6BA 2GV1A 3DOKA 1SI9A 4DX7A 2LQ9A 3G8SA 2Z1GA 2OSRA 2QA4G 4WYBA 1CJVA 4PPZA 5JLHA 2CAJA 4ZPVR 4C8ZA 1NDCA 4FK0A 4CZCA 2POKA 2R7SA 3RJMB 4RW9A 2L48A 2ZVIA 3BDEA 4ZPTR 3J80O 5FRMA 1P8GA 2D1KA 3ENBA 2PT0A 3FJ2A 4IFEA 1HNVB 3PUFA 2DHGA 2ZQBA 3J8AA 4KC5A 4LD0A 2PC6A 2NNWA 1X60A 4CYUB 3OHRA 1HA1A 1Q8IA 4BRIA 3PIPQ 1CJTB 2L9DA 3VGSA 1RDRA 4F9OA 4WXOA 4CHOA 2DNMA 4FCYA 3X3UA 3NAEA 1UJ4A 3PTWA 4WFBQ 4CZEA 3F9KA 1SAZA 3R27A 4JHDB 3VMFB 4NLYA 4DL3A 3PW0A 1IKVA 2XZTB 1IBMK 1LQ9A 2W42A 2CQHA 1M1KT 3AA9A 3R6LB 1KLNA 2VICA 3L2UA 1TQLA 3CC7N 2BW2A 4PKIA 2K1RA 4C1NI 4ZVRB 4OLPA 3AA4A 2GIQA 4FBTA 3MEEB 1LW0B 3WBZA 4BE0A 4TSXA 3OVSA 4U8YA 4AE5A 1FNMA 2AX1A 3QIDA 3SBGA 2GWKA 2VBZA 2R8JA 1V3SA 3KUEA 4L75A 1V5IB 4ZITA 3J7YI 4PG5A 1WN7A 4W5RA 4KE5A 2P1JA 1XHZA 2P9LA 1OO0B 4OYBA 4BR0A 2IM3A 3P96A 3N9UC 2ZM6F 1TK8A 2BGGA 5KOXA 4IR1A 2OAUA 2G8IA 1FKPB 1U7LA 4FLTA 3RU0A 2HBZB 4K2XA 3AVBA 4DU4A 4CTAA 2ILYA 4EU0A 2LECA 3AXMA 3BEXA 4CO2A 1S0NA 1SC4B 2EK1A 2D9OA 1TUGB 4BS2A 4JI1F 2QK9A 3LOUA 2DXDA 2YNFA 3H3OB 3O9TA 4UZCA 3ZSYA 1T6CA 4HH1A 2DNHA 1IBKJ 1LCUA 1F21A 2ZH7A 1S1WB 1KNZA 4EZ9A 2A1RA 3RB3A 5H9EJ 4BRKA 3NMAA 2QMXA 4LF1A 1NJXA 3IG1A 4ISGA 3OPKA 4H4OA 4DR5J 2O8DA 3JQJA 1TKXA 1WUUA 2DY9A 1GX6A 4M5DB 4O44B 5CCMA 2XS7A 1NG9A 1F5BA 3G71N 1BU6O 1BUXA 5I42B 4TYBA 1HUXA 2QN6B 3QT6A 3OFHA 3K58A 4H0XB 2OEKA 2HNYB 3MAQA 1EQMA 1P6TA 2GMHA 2FY8A 3MCAB 3MZIA 4ECZA 2KM8C 1CQMA 2G8KA 2XMTA 2B7BB 2RU3A 3PRBA 3CO9A 5ADZA 1R3NA 3TVYA 4WFAQ 2Q1LA 1EZZB 1VBXA 2Q6CA 2RJZA 3MOJB 5KFDA 2P9CA 1WUAA 1SBRA 4DTJA 2UVUA 4BRCA 5D8HB 4O3QA 2NS1B 4KR0B 5I42A 3B82A 4Z4FA 1KCFA 1I5OB 4Y6IA 1VIXA 4DR1F 2QMWA 2KHOA 1BGXT 4CM2A 2IVOA 1N54B 4FJ8A 4PHTX 4NZ0A 5DLFA 5LMNK 3V1RA 4KRFA 1YTAA 3HXMA 4EO6A 3HKWA 3LWMA 4AHCA 2FF3B 1S99A 1HQ2A 2ZM6K 1AT1B 2HQFA 2F8SA 2IRYA 3PJWA 3FDSA 3T7ZA 2XWYA 3U1NA 3HM8A 2VFRA 1QZ5A 5F8NA 3FRZA 2QIFA 3OYKA 1VFJA 1JCFA 5BN8A 2A6OA 2YX7A 1B4SA 4I6YA 2ZNYA 2CGLA 1HBNB 1S1UB 2Q2RA 1QAXA 4W92B 1RT6B 2RRAA 4NZ7A 1L3SA 4I7FB 4AH9A 1CULB 1UVKA 3QAEA 4PXBA 3CJAA 5A2QO 3HHLA 4CHPA 4C6AA 1RWUA 1JJ2M 2BEFA 2XY6A 4K4WA 1E6YA 1JL1A 2MQLA 2J9CA 4RNOA 3HHEA 3SMZA 1I94J 1FTRA 3ENVA 4FP9A 4LF6F 1T44A 3P83D 4CIOA 2CNNB 5KFZA 1NB7A 3CCVN 1SKRA 2D5RA 3NFAA 4J90A 2FHOB 1ASUA 4YHHF 2IGIA 4OZ3A 4WFXA 3CIPA 3FCHA 4CH0S 1SC6A 1U24A 1FDBA 3GFHA 3TSPA 2XI2A 2HBRB 4AL7A 4BC5A 2XMVA 4V19J 1R59O 2D0BA 4BDZA 4O0JA 1VK8A 5CYJA 4QIVA 3K2PA 2VFVA 3Q22A 5KFLA 3OTBA 4CEOA 4ZPBA 1IJEB 3HD2A 3PM9A 2VOPA 2QL5B 1NGJA 2JWLA 1HL6A 3GSDA 4WYWA 2BQ3A 3TWHA 4TU8A 4M42A 4PUOA 2DHXA 1RAAB 2QGFB 1QLNA 4H4MB 2BM1A 1NU4A 4HDGA 5BN9A 4L8RB 3Q83A 4KB0A 3EN9A 3CC4S 4KHNA 3HHLC 1RACB 4A8MP 3OBWA 4QOZB 4QWEA 5KPZA 5LM7E 3SJHA 4FJGA 3BPDA 2YVSA 2N7YA 4G9ZA 4LF5F 4FM1A 2E66A 2ERRA 3BPSP 4OQJA 3PW5A 2KJVA 1EP4A 1T94A 1XJWB 3TX0A 1CSJA 4J9NA 2E7VA 1HNIB 4G1PA 3DLKA 2ZH8A 3DLLL 2HHPA 3TQ1A 4JKDA 4JI7J 2P9EA 1R0AB 2W9CB 3CCEN 1LNQA 2P9IB 3NGUA 2NCKL 3EJMA 1MWMA 3BGFA 1TK5A 5GAGU 4JI0J 2P9KA 3MMAA 2R7WA 3DLKB 4RW6A 4FZVA 2Z1JA 2ZBRA 5BR8F 4I6AA 1FFWB 2DGXA 2NQPA 4CJRA 1CJUB 1UW9A 2N4DA 1VAZA 4RBUA 4A46A 3OS2A 1KTVA 2VGNA 4F3TA 2ACYA 1GLEG 4YB5A 2DISA 3R8YA 1BQNA 3O08A 5CE3A 1RT3B 1ZPVA 2GNKA 4CRJA 3OYFA 2VF3A 3AD8C 4A8KA 4FL9A 5HJXA 2RVJA 1M1KO 3GYGA 1KQGB 4DKWA 3KLFA 1S6UA 3D2FA 3UO0A 3T5LA 4JI8J 4DR1J 1S72S 3O9SA 4KTWA 2KYXA 2WVDA 5D0HA 4XEIA 4NLUA 3AXKA 2V4RA 3CDAA 2NZTA 2ZJPQ 3C15A 3DXSX 1Q86T 3KOAA 1PJ6A 1N6QB 1G7CB 3UCGA 5D0GA 4K25A 2VG6A 5KFYA 4W90B 1WC6A 1TU0B 1TFWA 2Z57B 3K5OA 1YT3A 4M3RA 3KMSA 3BO2A 4K4SA 2B4UA 2ATLA 4KHPJ 2MQMA 1L3KA 4ZJLA 4IOBA 2D0AA 1M5VC 5M2UA 3GG1A 2XNQA 1FJGJ 3QGIA 3SK3A 1H2VZ 4UY85 3CJ9A 6FDRA 2GX9A 4RWTA 1S0VA 3E01A 4CYUA 3NWGA 2J8SA 1RHMB 1YKWA 4JI3K 4AF1A 1RT6A 3GIJA 3GZ7A 1UPMB 2ZHBA 1T03A 4P71A 3GG0A 5H9FK 4EIAA 1XERA 4CO4A 3MXIA 2RRNA 5F2RA 1U1KA 2BDPA 1IWAA 5M1FA 4WU2A 3ILJA 2HQ3A 4IDKB 2FTRA 4PG8A 3MMCB 3HZEA 4I67A 3RRKA 1FFSB 1ZTWA 3OJSA 2MKKA 3AVGA 2E1ZA 3N0VA 1NGAA 5GIPA 4GKJK 1RAEB 3VAMA 4EYHB 4TN2A 1KKHA 3ID6A 2AKWB 1T03B 3KLIA 2UVWA 3WEEA 1TYQA 3ZX2A 3BS9A 4H0YB 1WBDA 3QT8A 3IMQJ 4BRFA 1VHIA 2X51A 4BWMA 3N28A 4EUVA 2X74A 2HHTA 4ALZA 5M2RA 4XPCA 4I6WA 3T6JA 5GAEI 5FRNA 4DR7J 4YHHK 2VQEF 4FJXA 5J2NB 4XDDA 5EXWA 4OJ1A 1IG9A 4X64K 1IBLF 3CB4A 4ZVPB 1VQ8N 1SV5A 2DGQA 5D78A 3UNGC 5KFKA 3M6GA 1T0TV 2ZM6J 4DPUA 3UD5A 4OX8A 1NM1A 3IAM9 3LL3A 2GVZA 5F3ZA 4JD2B 4LF7J 2Z2ZA 3VGLA 2CQDA 3HI0A 1IBKK 2OPQA 2F4FA 4LFBJ 1RDUA 3BH7B 3QIOA 3CJTA 3C6TB 5AQNA 4IOCQ 2MSTA 3FCWA 1YJ9N 2ETJA 3W63A 3AHPA 1NMDA 2G2OA 4TU9A 4ZLPA 3DHXA 1C1AA 3MFIA 3TTCA 3NGSA 2YTCA 3AAWB 2J9EA 1EQYA 4OIXA 4PA1A 3MCPA 1S76D 3AB4B 2Z1HA 1YBTA 2CQBA 2WC9A 5F9LA 1C6VA 3IBWA 2LA4A 4NLBA 3UKRA 1NDLA 3PX4A 4DR6F 4DPXA 4FBUA 2XO6A 3MFHA 1PBAA 1ELOA 1Q82T 4C0HA 3KLEA 5MLCQ 1LK7A 3NGKA 4ZVUB 4YS2A 2QFJA 4HCBA 4KHYA 2GVZB 2QO3A 2WRMA 4DZ6A 4Q2MA 3ZX3A 2ASOA 4WPAA 3VENA 1GTEA 1S9GB 1WEYA 3HSJA 1AUSL 3SV3A 1APSA 4IH6A 3BO4A 1FT8A 3BBCA 2E5LK 4ETXA 4PKHA 1RT3A 1FJCA 2PN6A 1LWXA 3QBWA 1KQSM 3RW6A 4PYAA 3FC9A 3GL1A 4KGZB 1S9FA 5A8RA 3RBXA 1JXEA 3E1YA 1EP4B 1FO1A 2AP6A 4R5PB 4B9SA 3A5MC 3ZT1A 3T41A 2FJAB 5IXUA 3W9IA 1JJCB 1MWZA 3BKUA 3DDNA 4CDIA 4FF3A 3TSUA 4KHPF 1PIEA 2YPZA 1X9JA 1HNXJ 3QLHA 1HBUB 1PC5A 4XH1A 1T9XA 2QE5A 4L76A 4DV7J 2GVDA 4OZNA 2Z0GA 2OFGX 2IY5B 1R0BG 4F3OA 2F9TA 2C3UA 3A2FA 4JI1K 2YJEA 1EJ7L 1S1TA 4HACB 1ZBUA 3DKDA 2EWHA 1SQGA 1Y4ZB 1JQGA 2C3MA 3OYAA 2HFVA 1Y5NB 1D8YA 3H25A 3CCRN 5EWEA 4BR4A 3T1YJ 1SQFA 5A8KA 2Y1IA 1DQ9A 2JX2A 1Z25A 3QWPA 1IVZA 4JI3F 1LWFB 4O8KA 4B3TF 2V6AA 5AQMA 3KD1E 1YJWS 4FVUA 2GQCA 3OLAA 4ZVEA 3ZSVA 2Z2MA 4BRQA 1JLFB 5AE1A 4HI1A 1ACMB 3G6YA 4MH8A 4OPKA 3ITHA 2OMOA 3K8WA 4GVLA 4ISEA 4HDHA 1RP5A 1WAJA 3MR6A 4NASA 2HGMA 4I2PA 3O5TB 3AO3A 2OLWA 3MWBA 3KK1A 2EBGA 3FLCO 1ROFA 4CGDA 3OT9A 3LDQA 1Q8KA 6FD1A 3NDKA 1FXDA 3AFGA 2HIYA 3BGOP 2FPHX 3T69A 3B6BA 1SJFA 2C3YA 2UUCK 4CO0A 3D5MA 2C2RA 2PYLA 1KDNA 2RQMA 1S59A 3QFWA 5IFMA 4YR2A 4YP3A 3V1OA 3KKSA 1BI4A 4PKDB 5C7PA 4WK1A 2DNPA 1ZA1B 2HHHK 3CCUS 4M3ZA 4DR2J 4CK2A 4DV2J 1T9VA 4CHYA 1DTQB 3ZZRA 1NU0A 3CQ8A 2JOQA 1WSRA 1QVGM 2CA9A 4DF8A 1ZZNA 1MW7A 4N7TA 4M95A 1LK5A 3AAPA 1S6PA 4XTTA 2V8VA 5A6PA 2FXUA 3H6EA 1Q5YA 4C8LA 2BJ1A 6AT1B 2ZH2A 3WDOA 2DK2A 1I3OB 2HBMA 5DDOC 1IR1A 3O44A 3CW2C 3THTA 3I0SA 2F40A 1HX1A 4WZQA 3TYTA 2OEJA 2CQ1A 3MR2A 3V4IB 1BA0A 3CUNA 4P74A 4U67Q 2HB5A 3DLRA 2CG8A 2R7XA 5FROA 4M5IA 4YOTA 3K5LA 5J2MB 1A9NB 4RW8B 3QERA 2A3JA 3I31A 5E3RA 2MPUA 1VMBA 5GAGI 1NLKL 5JVHQ 3NVKA 5BYQA 1QHAA 3VAFA 3NKYA 3VEVA 1LEOA 5KFHA 4MQ3A 3LGHA 4L3NA 4DR3K 4LF8F 1DZ5A 5AQRA 1BWFO 2M2BA 3O3LA 4AT1B 4WU3A 4BROA 3AA5X 4J2DA 2GGPA 2HSTA 4MKYA 1YK9A 3CCJS 3PHEA 1KFSA 4FW2A 4ERDA 5E3QA 4KO0B 5LSRA 1QAIA 4CD1A 3CXCR 1IWGA 3H7HB 2E44A 3BEGB 1KSPA 4HLBA 1U04A 1GMVA 2HRTA 1YUWA 4O4GA 4DLEA 1YJ7A 1J5EK 1RFQA 4IH7A 3J7YP 1YIJN 3OFGA 1S6QA 2OPPB 2GMJA 1KOHA 2W4CA 3IM9A 4J9QA 2YNGA 2IS3A 4B17A 3W5YA 4DR6J 4S0MA 4DBQA 2HK2A 2BACA 4CJTA 3UQSA 5LXYA 1PJ5A 2AW0A 2HAIA 4DF4A 1U6FA 1Q53A 2CPFA 2XMWA 4LVOP 3VQAA 2CH5A 2J0XA 3M6VA 3JB9k 1KVCA 4ZIVA 3WXLA 4WFAL 2P2CB 2P9SA 1NOZA 1FF2A 3H20A 1S1WA 2BA9A 1TL1B 1R0CB 3Q7BA 1MMNA 4K4ZA 5C10A 1SZ2A 2X1AA 3AVLA 2X3DA 5LT5A 4USVA