3QLHA

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase,hydrolase/inhibitor
molecule keywords reverse transcriptase/ribonuclease H
total genus 144
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qlhA05
1I39A 2HHQA 3LDSA 4DFMA 1LW0A 3KLFA 3V1QA 3IGNA 3OS1A 1TK8A 5F8JA 3OJUA 4FK0A 1LWFA 5CYMA 2PY5A 4FM0A 4FVMA 2EX3A 1QSLA 1S9FA 1TQLA 4RW8A 2YNGA 1GOBA 3O3GA 3QLHB 2B6AB 4ECXA 1RT3A 3H59A 1LWCB 2IBKA 1BCMA 3BSCA 3KK1B 3UR0A 4O3RA 4O44B 4CGFA 5KFPA 2LSNA 2ZD1A 3P1GA 5KFFA 2W8KA 3EZ5A 1VRUB 3AO5A 3QZ7A 2AGPA 1BIZA 3CJ2A 3NF9A 3HM9A 5EU7A 1SUQB 4DSEA 1YTAA 4FW2A 3NGYA 3AVFA 4DFJA 1BQNA 3C6UA 2YKNA 4MFBA 3OL8A 2RF2B 2UUTA 4H54A 2E9RX 5KFUA 1JLEB 1RBVA 1FKPA 1FKPB 5KFOA 2F96A 2W9CA 1HQEB 5KT7A 4BWJA 4CK3A 5CYQA 5J2MB 1TK0A 3AVJA 4TXSA 1XHXA 3SFUA 4ECWA 3DLRA 2HNZA 3TAGA 1C1CB 5KFWA 3MTKA 2ZD1B 4R5PA 3LPTA 3KMSA 3SCXA 5KFNA 3ITHA 3MXMA 1CSJA 4WXOA 3RMAA 1TKDA 3QO9B 4HUEA 3AVAA 4DQQA 3NGIA 5C25A 3Q8SB 3ULDA 1SL0A 4K4UA 5FROA 2IMWP 4OKEA 5HLFB 3MEEB 1S1VA 4O3NA 5L1JA 1KCFA 5T14A 4RU9A 4ZP9A 2RDIA 2AGOA 1RT4B 2UVVA 4NYNA 4NCAA 4MKBA 4XPCA 4QPXA 3LALA 3NH0A 3QIDA 3BSOA 4DSIA 4ZP7A 4JRPA 3SUNA 4ECRA 5HROA 2VG6B 3HVWA 4HUFA 1RTDA 4G1QB 2V0NA 4CFBA 3CIZA 4CJVA 3C95A 4EZ6A 2HNDB 1LW2A 4KAIA 3HPHA 1TVRB 1HMVB 1QE1A 3QIPA 4N41A 1XHZA 1DLOB 1QAIA 1ZETA 2IC3B 5KRSA 4BE1A 2O4GA 4O44A 5HRNA 3KLIA 4IFYA 3NF7A 3SUOA 2D3ZA 1QUVA 2YNHA 4DQRA 3OSNA 4K4ZA 4TQSA 1FKOA 3S3OA 5L9XA 2GC8A 4E7IA 2GUIA 1WSGA 5KT3A 2B5JB 5I3UA 2WHOA 4E0DA 3NGDA 4IRKA 1VSKA 3LP3A 3MXIA 2HHTA 1QAJA 2YNIA 4HYKA 4FLUA 4KHUA 3DOKA 2AX0A 4MK9A 3G6XA 3SI6A 2FBTA 4KO0B 4ZP8A 4DQPA 2BRKA 2FLNA 4ECTA 2BE2B 4NLGA 4CEAA 4IFVA 1JLAA 4NCGA 4BDZA 3QERA 1VK0A 4EEYA 3RB0A 3ZT0A 4IR1A 2D7SA 3V4IB 3KD5E 5J2NB 4M3ZA 1X1PA 3LP0B 3H5YA 3QYYA 4FLVA 1HJRA 4KKOA 4J9OA 2IOCA 2DPJA 3OYCA 1BISA 4LD0A 1VRTB 3BSAA 1KFSA 3IS9A 3OYFA 1S0OA 4O4GA 3KKRA 3QLHA 1L3VA 4WFZA 2YV0X 2OPRB 4H4OB 1RT6A 4CHYA 3PR4A 3JYTB 2F8EX 4TLRA 3E01A 4ELVA 3HHKA 2W9BA 5K14B 3AVMA 2QV6A 3AVLA 4CJPA 2R2SA 4MIBA 3QGHA 4K4XA 1QTMA 3I0SB 4URQU 5KT2A 2GV9A 3NL0A 1KLNA 2FC0A 3NKYA 4ZPDA 1S1VB 3I5AA 3FSIA 2J6SA 3L3VA 5L1KA 1N56A 4TY8A 1S97A 1T7PA 1SH0A 4CJFA 3OYGA 3THVA 2YNHB 1JXEA 2X6NA 1NJYA 3JYTA 2DPIA 1HYVA 4HKQA 4RNMA 3HYFA 3ZCMA 3S3MA 3L3UA 3GIMA 4U6PA 4TSXA 4R5PB 1RDCA 4CF1A 4FZYA 1NJZA 1RTJA 4DLEA 1TAQA 1KSPA 3DM2B 2QKBA 3RRHA 2B4JA 1DTQA 4B3OB 3AVHA 1YTUA 4MH8A 1G15A 1S9GB 3OYJA 4FZZA 3ZT1A 1S9EA 3DYAA 4DTJA 4F8RA 1RA7A 4OGCA 4OLBA 2FJVA 3K58A 2IJFA 3BQ0A 4KBIA 3JSMB 4IFVB 4NCGB 4NLWA 1N48A 2KQ2A 1SKRA 1Q9YA 5F8LA 1RBUA 1KRPA 4KE5A 4URGA 3HSTB 4NLVA 1F21A 5FRNA 1TAUA 2HNYA 4Q5VA 1HRHA 3G86A 4AHVA 2F8SA 1TK5A 3PVXA 3OVNA 3DOKB 4EBEA 3QEPA 2VG6A 1WNSA 2G8VA 4K8XA 3O3FA 4I2QA 3NE6A 4OL8A 2D3UA 2OPSB 4DTRA 3KJVA 1N5YB 4LSNB 4LSNA 4WXWA 2RN2A 4CF2A 2W9AA 1O1WA 1K1SA 4CHNA 4JUZA 3GIJA 4BE2A 4Y1CA 2G8UA 1ITGA 1S1XB 4W5TA 2FVCA 1TKTB 4Q43A 3VQ5A 4DTXA 4FJMA 2WOMA 4FJJA 1VRTA 4IFYB 3DLKA 4NRTA 4IG0A 1TKTA 4IG0B 3K5OA 4DTNA 3SI8A 1A5XA 3OYBA 4PUOA 3VQSA 4K4VA 3LP0A 3DLGA 5C5JA 3LANA 2WCXA 2OZSA 4M3WA 2BRLA 2ALZA 1LWFB 2AQ4A 5KFMA 5I42A 3VQ7A 4JS4A 5F9NA 3U3YA 4LQ9A 2BQ3A 2FLLA 3C6TA 3TQ1A 4E19A 4F2SA 1S1WA 2HNZB 3IGVA 3PX6A 4KHMA 3CO9A 3VQ9A 4M95A 1T05B 2XCAA 3PW0A 5KG1A 4DG1B 4I9LA 3HP6A 3T5LA 4KHSA 4PUOB 4H4MA 2O5DA 4KB7A 4MIAA 4CEBA 4UQGA 4CHOA 2XI2A 4B9SA 4E1MA 2UVUA 1BI4A 4C8MA 2VA3A 3JSMA 4JV0A 3RMCA 5J2QB 2R8KA 1D0EA 4FJ9A 3UDLA 3V81B 3EPIA 1ZBIA 2OPPA 3NCIA 2Z1IA 4F50A 1JLBB 2FLPA 3CJ0A 3RBEA 3BDPA 1SL2A 1NKCA 4ZVEA 4EBCA 2D41A 4AILC 1S9GA 2IM0A 1BCOA 4IKFA 3IAYA 2X6SA 4KAZA 1RDRA 1NOYA 1RT5B 3G6YA 4MKAA 3Q8QB 2BGGA 3KK2B 4B08A 4TYAA 3VA3A 2YKMA 4K4TA 4RW9B 4EZ9A 4DEZA 3M8PA 3KLIB 4IDKA 5L1LA 2XGPA 4PWDA 3A2FA 5HRRA 2ZE2A 1D5AA 2E9TA 3C94A 4QAGA 4CF8A 5KGXA 5CY4A 1NOZA 3QETA 3DMJB 3O3HA 5FDLA 1SKWA 3CFOA 3SPYA 3CFPA 2GIRA 2D5RA 3H5UA 3I0RB 4E7KA 3EY1A 4N76A 4BE0A 5KFEA 2YNGB 2OPSA 1NK6A 4J9NA 5F8MA 1FK9B 4B9NA 3HO1A 4ECZA 2EHGA 4E89A 3BREA 5CZ1A 3KK1A 3QEXA 1HYSB 4KB0A 4F4XA 5DMRA 2AJQA 4DL3A 3NAEA 5HBMA 1EETB 1RT2A 2HMIB 4QCLA 3K2PA 4KV8A 1L5UA 3KIOA 1TL1B 4KTQA 4Q44A 3ALYA 1RTIB 1KTQA 1T8EA 1SUQA 4M42A 2IM3A 3ZT2A 3I5CA 2C28A 3HXMA 2BR0A 3DLKB 1KVBA 3L2WA 4J2BA 2IJNA 3OYMA 3NMAA 2J6TA 2JEFA 4KTWA 4K4SA 4G3IA 3BSNA 3GILA 2ILZA 3HPGA 1RT6B 1Q8IA 1W25A 1S1UB 2HWIA 1REVB 2O4IA 4Z0UA 3D5MA 1NK7A 3PR5B 4Y34A 1JLAB 2B6AA 1YVFA 1U04A 2G8KA 3ZSWA 1HNVA 5F9LA 5L1IA 4DSFA 2WK4A 4RG8A 3V1OA 4R0EA 2KTQA 3ZSQA 3V6KA 4PQUB 3ZSOA 4FLXA 1U49A 2PZSA 5F8NA 2QE5A 3AA3A 3KLGB 4BDPA 4NLQA 3NBPA 3DRRB 2XCPA 4CIFA 4Z4CA 4W5RA 3IS9B 4MQ3A 1HYZA 4KHYA 2IDOA 2ILYA 3QGGA 1X9MA 1GX5A 5E41A 4NYFA 3PHEA 3L2VA 2G8FA 3DOLA 4Q8FA 1QQCA 1JL1A 3SFGA 4C8NA 3VQQA 1T05A 4QWBA 1DTQB 4B3OA 4MK8A 1RTDB 4XIUA 3F73A 1NK4A 3KLHA 2HW3A 3OL6A 4DU3A 5KFKA 3T5HA 1BGXT 4NLUA 3M9NB 2KFNA 2B43A 4KHRA 2X74A 2BQUA 3SV3A 5F8IA 1VSHA 3H4BA 3NDKA 3KMQA 1U48A 4J9MA 3CFRA 4CFCA 1HNIB 5KG4A 4R8UB 3BJYA 1WLJA 2AWZA 4O3OA 1A5WA 4FLZA 3MEDB 1RTIA 2E6MA 3QNNA 5J1EA 1IM4A 4AHUA 4EYHB 3KHRA 2A1RA 4CHZA 4FJ7A 1RCHA 4W5OA 3V6DA 3I8DA 3PW4A 3SZ2A 4KO0A 2D0CA 2HHUA 4RW9A 4ECSA 3KKSA 1XR6A 3WNHA 1TL1A 4O3QA 1JLGB 3Q8PB 4CJWA 4F4KA 1RDBA 3VQ6A 3DRPB 3VQDA 4E3SA 4C8LA 1BQMB 5DG8A 4ID5B 2XGQA 2ASDA 1QHTA 1NJWA 1CZ9A 1RBTA 5KFCA 2I1RA 2NUBA 3MEGA 5DQIA 3KOAA 3MR6A 4CCHA 3G6VA 4F4WA 1JLQA 4RW6A 4K50A 1CXUA 4NLDA 3MEGB 4ECUA 4CEZA 2BE2A 4IG3B 5C24A 1S1WB 4IH7A 4OKJA 2W8LA 1HQEA 4FXDA 1LWCA 1WNEA 1DTTB 3QINA 4DSKA 4K4YA 4E7HA 4FYDA 1T3NA 1TKZA 2R8HA 2IAJA 1K6YA 4FLYA 1D9FA 4O4RA 1JKHA 1HARA 4DL5A 4ZVGA 3DLGB 1J5OA 4ZPCA 5KFQA 4FLTA 4QW9A 4YR2A 3GIIA 1JLFB 1BHLA 3IRXA 4CGHA 5DLFA 5C24B 5KG0A 4Q45A 3MXJA 4CJRA 2JC0A 1Z25A 1C1CA 3AVCA 1N6QB 4LSLA 2V4QA 3SUPA 5KI6A 1RTJB 5J2MA 2XWYA 4CEQA 5CYQB 4JRQA 3C6TB 2KZMA 1S6QA 3FRZA 4DTOA 4L8RB 4KHWA 1B92A 5KFXA 1JKHB 4EP5A 3EPGA 3VQBA 3VQCA 4PQUA 4ZP6A 3KTQA 1NKBA 2XRIA 4Y2CA 4B9TA 3CVKA 4Y1DA 4ICLA 2DFHA 3GQCA 3HPOA 1VSEA 1IKXB 4JLHA 5JS2A 3LZJA 1NK8A 3HVAA 1NHVA 3RB6A 4CJ4A 1VSMA 1JXBA 1D8YA 3MAQA 3KLFB 2IA6A 1XR5A 5KFAA 3PO4A 1Z4UA 4Z4FA 2QKKA 1OS5A 3RBDA 1S6PA 1ASVA 1S0MA 3LP2A 1KLMA 2I5JA 2QK9A 3D28A 3UPFA 1W9HA 3KJVB 2OA8A 1SKSA 3FFIA 1RYRA 4E1NA 4XO0A 1RA6A 4YQWA 4G1QA 4LY7A 4B9LA 2Z1GA 3P5JA 1N5YA 4AHSA 5KTQA 3T1AA 1GOCA 4FBUA 1IO2A 4FJ5A 5JXSA 3LZIA 4KI6A 5EWEA 1SH2A 3SNNA 2HAIA 4F3OA 4CEOA 3K5LA 2XY8A 2PYJA 2JC1A 2AU0A 3QGIA 4KTZA 1I6JA 3B6OA 4N56A 3HP9A 2HHXA 1TVRA 2IM2A 2HMIA 1C0UA 1JIHA 4FCYA 4J9KA 3V4IA 3RAXA 4FM1A 1NKEA 4CESA 3KLGA 2BQRA 3FDSA 4LH5A 3ZSXA 1NJXA 4CEEA 3K59A 3RRGA 4HHTA 2DY4A 4NLTA 1J54A 2VWJA 2YNFB 3OY9A 3SV4A 1HQUA 3OS0A 1LWEA 4M3YA 3RWUA 4WE1B 3F9KA 3AVKA 4CJEA 3C6UB 4MFBB 4RUCA 4N47A 4FJGA 4E7LA 3Q8RB 4DFKA 4LH4A 2XHBA 2FJWA 2WTFA 1WSHA 4RNNA 1JLFA 4C8OA 1XR7A 1NNDA 1C0TB 3RR8A 1EP4B 2BDPA 5C25B 2W9BB 1R0AA 1KHVA 3RAQA 2Z1JA 3DM2A 4B8CA 4HTUA 4IQXA 4YFUA 3V9XA 4GW6A 3QEVA 5KFDA 2WB4A 2OPQA 3ICLA 3PX4A 2ZE2B 4YR0A 5KFSA 3L2UA 3M8RA 1RT4A 4IDKB 3HJFA 2QXFA 4KPYA 4KFBA 5DG9A 1NK5A 2JLEA 5T7BA 1S6QB 4I7FA 3OSPA 4GVMA 2XY7A 5KFRA 4DS5A 3BGRB 4F4YA 4DF8A 3L2RA 3NHGA 4C8KA 3UIQA 3FQLA 1IG9A 2Y1IA 1Q9XA 5EWFA 3KK2A 3CG7A 1RDDA 4J9SA 3N6NA 1JLGA 3FFIB 2J6UA 3HK2A 2ATQA 1Z26A 1HYSA 2GBZA 1C1BB 3RB3A 3PO5A 1UA0A 2RKIB 3CM6A 1KFDA 4BDYA 5F8GA 1LW0B 5KFLA 4O55A 4CJUA 3OJSA 1NK9A 1QS4A 3PW2A 1RTHB 1ZBFA 1KHWA 4NLPA 4ID1A 5J1EB 3NGZA 2HB5A 4CGJA 3QZ8A 4M45A 1RT3B 2E6LA 4ZPBA 4OJRA 3RMBA 4RW8B 4KHNA 3NF8A 3G10A 3ZT4A 1WSJA 1C0MA 4CGGA 1UOCA 4M41A 1TP7A 2FVRA 3LP1B 2YHBA 3T3FA 3LPUA 1BQMA 4FS1A 4NZ0A 2RKIA 3PW5A 3BR9A 3DRPA 3LWMA 1S1TB 1MU2B 2UUWA 1HPZB 2G8WA 1HPZA 4ED7A 4NCBA 2IAJB 3WNFA 5HRSA 2UVRA 3WNEA 1GX6A 4FJKA 3E51A 2XY5A 3VN5A 2IS3A 3IRXB 3N6LA 4IR9A 1WAJA 4LQ3A 4OVLA 4RW6B 4DFPA 3SQ2A 5J2QA 4KRFA 2F8TA 3OYAA 1D1UA 3TAEA 4B9MA 3OYIA 2JEJA 4J9LA 4PY5A 4Y3CA 4DL6A 2CKWA 3SPZA 4XPEA 1WSFA 3DLEA 2C2DA 4I7FB 4ED2A 4Q8EA 4FS2A 1N6QA 3KLHB 3TAPA 3TI0A 4DL4A 5HROB 5HLFA 3OYDA 3KHHA 3VA0A 4CJ5A 2OPQB 3T19A 2X78A 2XI3A 1TKZB 2DTUA 1RT7B 3NH1A 3DYAB 1S5JA 4YMEA 2P5GA 3B6PA 1J5OB 1VSFA 4QWCA 4TN2A 5KFTA 1WSEA 2YHAA 2KW4A 3NF6A 3PW7A 3OHAA 3M9OB 4FLWA 4M3TA 2G8HA 4J2AA 2ITGA 4I2PA 3ZSYA 3OS2A 5DGBA 3TVKA 1VSDA 4FK4A 3CJ5A 1IKWB 4RNFA 4U7CA 2P51A 3DMJA 1D9DA 3BGRA 3MF5A 3IG1A 3IG1B 3CJ3A 4K4WA 4N5SA 4JV2A 4CJKA 3QESA 4IRCA 2VG5B 1I3AA 4Y2AA 1ASUA 2RPIA 1RYSA 4FJIA 5SZTA 4ZTFA 4Q0BA 2G8IA 4CJQA 4B9VA 1S9EB 3TWHA 3CM5A 3DLBA 1RTHA 1S1XA 4FK2A 2ATLA 2VWKA 3O4NA 4FM2A 2DFEA 4RUAA 3PJXA 3M8SA 1IKYA 3TARA 3K57A 5KFIA 3MEDA 4QOZB 2B5JA 2E9ZA 3PZPA 4F3TA 4WYLA 3VQEA 3M9MB 4DL2A 4JV1A 4FJLA 3TABA 1LAVA 4BACA 4TY9A 4ECYA 4WZQA 1ASWA 3AA2A 1MMLA 2R8IA 4HCCA 5HP1A 4ELUA 3LP1A 5C42A 2JEIA 4O5BA 4OPJA 1S10A 4WFXA 5KFHA 1VSIA 4BWMA 1X9SA 1K1QA 5KFBA 5DGAA 1C1BA 4CHQA 1SL1A 4B9UA 3AO4A 1RT7A 1JLCB 3G0ZA 4HUGA 3NAHA 5I3UB 4GC7A 3H4DA 1MU2A 1BQNB 1VSLA 1TKXA 4O3SA 4NYZA 1S1UA 2OYQA 1TL3A 4TYBA 3BQ1A 1QSSA 4CE9A 3DDKA 3H5SA 2XO7A 4NLYA 4W5QA 3AO1A 3T5KA 5DK5A 2OPRA 3KLVA 1J53A 1B9FA 3OL7A 1RT1A 4DS4A 5JUMA 2Z1HA 3I0SA 4EYIB 3QEWA 3DRRA 4CGDA 4KKOB 1HNVB 3TR8A 1RDAA 2ZKUA 3PUFA 2AX1A 4Z4GA 2KZZA 4OLAA 3EYZA 2YNFA 3NAIA 3AO2A 1SV5B 1U09A 3SYZA 3KLEB 1SH3A 1UAXA 2R8JA 5SWMA 4KI4A 3OYKA 2FVQA 1T03A 4X2BA 4NLXA 1EX4A 5KGWA 1IKVA 2OZMA 1IKWA 1NK0A 2I5JB 5KFJA 3DOLB 4QW8A 4I2PB 4CJSA 3RR7A 3HT3A 2VG7B 3AVBA 2OPPB 2HHSA 4J2EA 3SJJA 5J2PA 2WONA 3AVNA 2IM1A 3V9WA 4YP3A 4CIGA 4J9QA 1R0AB 4EP4A 4IRDA 3O4QA 1KLMB 5KRTA 2D0AA 1C6VA 3ITHB 1C1AA 1UWBA 4CERA 4CECA 1HMVA 1QE1B 1RBRA 3TANA 3H40A 2C2EA 4PWDB 4DSJA 3CJ4A 3ZSVA 4CK2A 1RT5A 3GV8B 5DQHA 3KHGA 3U3GA 4FJXA 4AHCA 3KNAA 4DTSA 4RW4B 1L3TA 2YKMB 5EUHA 3OYNA 5KG5A 1IKYB 4AHRA 4URSA 2Q3SA 3LWLA 4M3UA 2FBXA 1FKOB 4FJ8A 2HHVA 5D3GA 3V6HA 3LP2B 4WYWA 3U6FA 2JEGA 3OYHA 1FK9A 5F8HA 4CF0A 2HHWA 2BANB 4RZRA 4CJLA 3NH2A 2BANA 4ZMMA 4CHPA 4Q0BB 3DRSB 4CJ3A 3TAFA 1BIUA 4KV8B 1WN7A 4AH9A 2R2UA 3PV8A 5DLGA 1LAWA 4ZTJA 3SQ4A 3IN5A 1JXLA 5KT6A 4NLSA 5KFZA 3SQ0A 4ED6A 4YNQA 1IH7A 4IOBA 4ID5A 2V9WA 4E7JA 1JLCA 4KSEB 4TQRA 4CFAA 3VQPA 5I42B 2HNYB 3CWJA 4Z4IA 5KT5A 4ECVA 4ED1A 3RB4A 4IH6A 3H2LA 5KFYA 4OKKA 3H08A 2XC9A 3V6DB 1BI4B 1S0NA 1CXQA 4H4OA 2RF2A 2FVSA 1ZTWA 5HRPA 5C42B 1L3SA 1N4LA 4IG3A 4DWIA 3AVGA 5JS1A 5KG7A 5HP1B 3PX0A 3DLEB 4EO8A 3SUQA 4CIEA 2KFZA 3CDEA 4DG1A 3QIOA 5K14A 3OYEA 1W0HA 1S1TA 3OLBA 1VRUA 2ETJA 1RNHA 4WZMA 3V9UA 4J9RA 3S9HA 1X9WA 1B9DA 1JLEA 2ZQBA 4O0JA 3FQKA 5EDWA 1J9AA 4TY8B 1ZBLA 4O3PA 4JS5A 4DU4A 1ZYQA 3HVTA 2R7YA 4LSLB 3T5JA 3SQ1A 2HWHA 4K8ZA 4M3XA 2E4LA 3V81A 3OLAA 5FRMA 2VG7A 3RMDA 2W9CB 2WRMA 3MR5A 4CF9A 4PA1A 4ZVHA 3ZSZA 2P5OA 4HCBA 2FVPA 1EP4A 3V9SA 1IKVB 4NLRA 3NFAA 1VSJA 1S6PB 3H98A 3QEIA 1CZBA 3M8QB 1RBSA 3CDUA 3GV7B 2JGUA 4GMJB 2W7OA 4OGEA 4NLOA 1Y97A 4RW7B 1S48A 4DL7A 2FBVA 3N6MA 3MR3A 1HNIA 1RILA 2UVWA 1SV5A 2W42A 3KK3B 4CJTA 3BQ2A 3HVTB 4KFBB 1S49A 3V9ZA 2C2RA 4ECQA 4FBTA 4QWDA 4DLGA 4Z4EA 2DFFA 3K5MA 1KVAA 4CEDA 3MECB 3D0PA 4NRUA 2XY6A 4W5NA 4KREA 1U4BA 4QWAA 3HVRA 1TV6B 4J9PA 1JLQB 3DI6A 4FW1A 2P1JA 4ZHRA 2GIQA 4I2QB 2VG5A 5KG6A 3MR2A 4EBDA 2IC3A 5KG2A 4HVJA 3AV9A 4ZPAA 2PYLA 4KHQA 1LW2B 2HNDA 4IBNA 1CLQA 2FBYA 4FJHA 3EZUA 2ASLA 1U45A 3VQ8A 2FJXA 3HL8A 3HKWA 3AO3A 1ZBHA 1EETA 1RT2B 1C2PA 4RW4A 1ZTTA 2R8GA 5DQGA 3OYLA 3S3NA 5KFVA 3TAMA 1JX4A 2R2TA 4IH5A 5D3GB 5CYMB 5KT4A 2YNIB 1LV5A 3V6JA 4DTUA 2W7PA 4DSLA 1WAFA 3P83D 4YR3A 3L8BA 1TKXB 4O0IA 1BL3A 5CZ2A 1C0UB 1DTTA 4RNOA 3PY8A 4O4GB 2C22A 1REVA 3I5BA 3CYMA 3AVIA 1WSIA 1QSYA 3DRSA 4ZVFA 1XC9A 3DLHA 4DF4A 1GOAA 4WFYA 3OL9A 4MK7A 3KD1E 5HBMB 4CFDA 1EXQA 2HVHA 4H4MB 4ED8A 1JL2A 1YVUA 4J2DA 1T94A 2OH2A 4IKAA 1LWEB 4DQSA 1HQUB 3ISND 4FJNA 3NBPB 1XWLA 3D45A 3KLEA 5DG7A 1S4FA 3PJWA 4ELTA 3AA5X 1TL3B 4CGIA 3K5NA 4WE1A 3KHLA 4OPKA 2A1SA 3ZSRA 3UQSA 2YKNB 4GC6A 3ISNC 5EWGA 3TAQA 1NHUA 1C0TA 3V1RA 4CK1A 3E01B 3L2QA 3ZT3A 3MFHA 2WONB 1RT1B 2VA2A 4DQIA 4B8AB 4I9QA 3WNGA 4FZXC 3LAMA 1KVCA 2D0BA 2V4RA 3GIKA 4RNHA 4AHTA 1RAJA 4ZHRB 1UA1A 3QNOA 5J2PB 1DLOA 4R8UA 1IKXA 3MEEA 3QO9A 3GV5B 1XI1A 4DTMA 4ICLB 3VQ4A 2AGQA 3H5XA 4Z4HA 3RTVA 2Y1JA 5KG3A 2R2RA 3KK3A 3CDWA 1YT3A 5KFGA 1T03B 1U47A 4M94A 4ED3A 2ASJA 4ED0A 3AA4A 4CEFA 1TV6A 3CQ8A 3GYNA 4F2RA 4DU1A 2IGIA 3I0RA 2EC0A 4DTPA 4F4ZA 3TAMB 4KB1A 5FDLB 3M8QA 1JLBA 3MECA 3OHBA 1UWBB 1L3UA 2RDJA 3ASMA 4H8KA 4RW7A 1FXXA 3QIPB 1A5VA 3LAKA 3M8PB 2HVIA 3DI6B 1TGOA 4QWEA 3VQAA 1EKEA 2CJQA 4EO6A 2WOMB 5J2NA 4M3RA 3MFIA 4DMNA 1ZBUA
chains in the Genus database with same CATH superfamily
3DCAA 1ZH5A 3LDSA 3V2UC 1LK7A 3HZEA 3DN9A 4XK8C 3OJUA 3SBTA 3MCAB 2OLWA 1M5VC 1VQPN 1V5VA 2Z2ZA 1VQ5S 3CMQA 4BC9A 5AQOA 4RW8A 1IBLF 1GOBA 3O3GA 3HSZA 2B6AB 4ECXA 4PL7A 1LWCB 5FPMA 4NYPA 2FSJA 1ZBTA 4CGFA 2CNNB 4NEZA 4XEIA 3P1GA 2W8KA 3QZ7A 1Q5YA 1BIZA 3CJ2A 3O3LA 2C2NA 1SUQB 3E1YA 1R8AA 3ZZTA 3NGYA 5AZIB 4JKBA 2RF2B 2B4UA 3VPZA 1FJGJ 2E9RX 2M8HA 3AB2B 1CJVB 5KFOA 2F96A 2W9CA 2GZOA 3VWSA 4A5AA 2LA4A 1TK0A 5M2UA 3AVJA 1XHXA 4ITSA 2ZHBA 5IT0A 3TAGA 5KFWA 3LPTA 1GTHA 1VR6A 4I6WA 1OQ3A 3KMSA 3T1HF 4BR9A 5KFNA 1SJ4P 1SC1B 3OA9A 4CQ1A 4DQQA 5C25A 1FNXH 1AT1B 3EVMA 3A8KA 3THPA 1DEJA 1S1VA 1SQFA 2DHAA 1IBLJ 3BS9A 1ZM4A 4A61A 1RWKB 2AGOA 1HBUA 2RDIA 4X65J 2PI5A 1GXUA 3GLJA 4PXDA 4LRBA 4NYNA 2KU7A 1PBUA 4Y6IA 4BS2A 1VQLN 2XSJB 4DSIA 1VJQA 1MA9B 1TUGB 3CCQN 3A3PB 4ECRA 4GVEA 3VF2A 5K8MA 2VG6B 4IOCQ 3PM9A 5CD4A 4DR7J 3JS9A 2VQFJ 1B0PA 1RAIB 5LT5A 5FPNA 3MCSA 8AT1B 1TVRB 3QIPA 1XHZA 4LF6F 4ALZA 1ZETA 1DT9A 2O4GA 4O44A 1YUWA 1TUVA 2LXIA 4IFYA 2OTJN 4ZLPA 4DQRA 3FMBA 5L9XA 2Z58B 1MWMA 5KT3A 2P2CB 3NCQA 3BR8A 2B7BB 4DPOA 2O8FA 3AT1B 3DU5A 5I3UA 4E0DA 3P8BB 2HHTA 4ILJA 5AQYA 2GJ2A 3ISZA 1U6BA 3TSUA 2ZH5A 3QJPA 3CC7S 1K9MT 4DKWA 4KO0B 3NNCA 4BC5A 1DHMA 4ECTA 1RCXB 2RE2A 3OFHA 4CEAA 3PIOQ 3O1BA 1VK0A 1BU6O 4EEYA 4IO9L 3KJFB 1QQOA 4BR2A 3KD5E 4NZ6A 4M3ZA 3QFUA 5GIPA 3CCZA 3AQPA 2AJ0A 3I4HX 2DPJA 1R3NA 2GIFA 3D1OA 1REGX 3OYCA 2ZC4A 1HQ2A 1VRTB 3BSAA 3Q86A 4FYXB 1KFSA 3OYFA 3H2VE 5HK4A 4JI1J 1HW9A 2VH7A 1KQKA 4K2XA 5AXLA 2YWFA 3J7YP 1RT6A 1RABB 1EKRA 1FTRA 2AYGA 4DV7K 3QWUA 2W9BA 1K0VA 3ZZOA 3IM9A 2R2SA 4MIBA 2WW8A 1OVQA 1LFWA 3POTB 4K4XA 1NLKL 3I0SB 3BYPA 5KT2A 1BD6A 1AFJA 1NCLA 2AEJA 4CZIA 3NKYA 4ZPDA 2ADBA 3TQEA 1FRLA 3I5AA 1VGYA 2UUBK 3L6QA 1D8ZA 2J6SA 5HVGA 3L3VA 5L1KA 1N56A 4TY8A 1IWGA 4C98A 1T7PA 1YKWA 3DKDA 2QC3A 3MCPA 2X6NA 5IOLA 1NJYA 1I94K 4DJBA 4B3RK 1OWXA 4RNMA 4LF4F 1FDBA 1WD6A 3GIMA 4GRSA 4U6PA 1RDCA 4CF1A 4FZYA 1SAZA 1RTJA 2O8EA 4OYZA 4X4SA 1UW4A 1DTQA 3TOQA 1OY9A 2A2CA 2C3PA 5KAKA 1TUWA 4FZZA 2VFTA 4DTJA 4OGCA 2ZUAA 5L39A 3K58A 5LM7E 3BQ0A 4KBIA 4CWBA 1J5EJ 1MWYA 4IOAQ 3JSMB 1S76D 1Q9YA 4NLWA 1N48A 1SKRA 1SI9A 4OHYA 4RJVA 5LXRA 4XH1A 1OVYA 3MGJA 3IDHA 3FC9A 3N4WA 4URGA 3KG1A 1I3OB 1TAUA 2HNYA 4AT1B 4CLFA 2DCUB 4IO8A 4C48A 3DC2A 2FIUA 4K8XA 3H0PA 1HBMA 3MD1A 2OIHA 3NE6A 1OY6A 4DTRA 2O67A 4LR8A 4A8WA 4LSNB 4B1XB 4LSNA 4CF2A 4BVOA 2MZQA 1N52B 2NXEA 2HWTA 4Y1CA 2G8UA 4LIRA 2FVCA 1U8WA 1S79A 3VQ5A 4DTXA 1VRTA 5AT1B 4IFYB 4QOTA 5IT9O 2V52B 1EIYB 3KWIA 4IG0B 3K5OA 1V4SA 5A8WB 4USKA 5GMEA 3DLGA 2QFJA 3CJTA 1FX2A 3R7SB 2OZSA 2ALZA 1LWFB 1PBAA 5KFMA 3CJ8A 4BRQA 5F9NA 4JAXA 4LQ9A 1QJHA 1N33F 2HMPA 4PKHA 1WEXA 4E19A 4F2SA 4KHMA 3VQ9A 2Y0SD 3OFGA 2BJDA 2J9CA 3D67A 1NG9A 4RLEA 4DG1B 1UVNA 2JL9A 2MXYA 3T5LA 4JOUA 2L9DA 2O5DA 3CJRA 2NXCA 1KONA 3U7JA 4DU7A 4UQGA 7FDRA 3FUYA 3VEZA 4AXJA 3CJQA 1D0EA 4RCHA 4FJ9A 4BRIA 1UAWA 3CCLN 3R1LA 1UEKA 2EKYA 4PWUA 1C0FA 4FYYB 2V2KA 3RBEA 2JSXA 4C0OC 5JMNA 4EBCA 4AILC 2IM0A 4IKFA 3IAYA 2X6SA 3UVJA 2LQ5A 3PRDA 1NOYA 1HKAA 4MKAA 4K0KF 2M88A 3OXLA 3SMSA 1M5SA 4ZJQA 4EZ9A 1KVKA 4ZCLA 5L1LA 3QJJA 3M6WA 3G71N 4W98A 3LPEA 5HRRA 4BRGA 5AXKA 2N82B 1D5AA 2E9TA 4GO5X 3HHEA 2R7VA 3HBTA 4DR5F 4NLCA 3JTNA 1YI2S 3CXCR 3DMJB 2E2PA 3SPYA 2D5RA 3EY1A 5KFEA 4R79A 4JI2F 4K0KJ 1FK9B 3IMQJ 1PC5A 5FPEA 4E89A 3BREA 1HYSB 2WB1D 4YY3F 4DL3A 3NAEA 3J80U 4DI6A 4OI0A 1BE4A 4N77A 3TJ9A 3BB5A 1OKJA 4KV8A 3TP2A 1NLVA 5B0CA 1UVIA 3ENBA 1GAOA 3PACA 3ALYA 1RTIB 1KTQA 1TMMA 3WX8A 2KKHA 3MXHP 2GGPA 5IV4A 3L95X 4A2BA 3L2WA 2ROEA 2LU2A 3M2VB 4RWXA 4KTWA 4G3IA 2FYXA 1X4AA 2WFBA 1Q8IA 4CD3A 3BEGB 1S1UB 2V8PA 3AJ2A 3BY5A 4O23A 1N5VA 4Y34A 2B6AA 4DX5A 5E33A 1YVFA 1U04A 2JHEA 4OI6A 2YH1A 4TU7A 1VDHA 2G8KA 3WQUA 2KTQA 2VL1A 2ATCB 2CQ4A 1VHIA 2QE5A 1UW9A 1CULA 3CB4A 4DZ6A 4IEEA 2VQFK 3EVOA 4CIFA 4W5RA 3IS9B 1HYZA 3EL2A 4KHYA 1JJCB 3CCSS 3QGGA 5LL6d 4CO4A 2EPIA 1UJ4A 3OUYA 2L41A 3AOAA 4U7UD 2G8FA 1HNWK 2DNKA 1WKLA 3JAMU 2OSRA 3TW0A 2GQQA 1M1KT 2G1DA 3BGOP 4C23A 1S57A 4JI7F 2QA4G 1WG4A 1YJ9N 3HRGA 2NRHA 2O66A 3MCMA 2DYAA 3OPKA 2C42A 4DDFA 3U9DA 2E5IA 2MTLA 4FSVA 5KFKA 4NLUA 3C14A 2NPFA 2KFNA 4KHRA 1XQIA 3OTBA 5F8IA 3H4BA 2V50A 3PXGa 5KG4A 2KYXA 1QTNB 2V8VA 1X4HA 2QWOA 2AWZA 4O3OA 2DNHA 4DR1F 4JI6K 2F65A 4HHHA 1EZZB 3THWB 2E88A 4DV1J 1Z05A 2KXFA 4W5OA 4CLUA 5FLXY 4KO0A 2HHUA 4XTTA 5IWAJ 3C7NB 2AT1B 1JLGB 1YBAA 2VKRA 2DIUA 2MQPA 1RDBA 3DRPB 4OZ2A 3HLUA 4E3SA 2EG2A 1VQ5N 4ID5B 2XGQA 4UY8O 2ASDA 1QHTA 4C4WA 1NJWA 3KG0A 1RBTA 1FO1A 5KFCA 3OXGA 4FWSA 4CM2A 4FWLA 1JLQA 2L08A 3MEGB 1WEZA 1I94J 4ED4A 1T11A 3MR7A 2DGQA 4OKJA 1HQEA 2PA3A 1VIXA 4V1Ak 3A8JA 2B3TB 1MSWD 1HX1A 4IO1A 5K8PA 4W90B 3H2UB 3MMCA 1D9FA 4O4RA 1HARA 4ZVGA 2CG8A 2HBQB 4DCPB 2H4YB 2QG9B 2KJVA 1RZMA 3DJCA 4ZN1A 4QW9A 1JLFB 2ZBQA 2PA8D 4EU0A 2BJ8A 1XIQA 4UOCA 5C24B 1RU2A 5KG0A 5T7LB 2JC0A 3F41A 4NO7A 2LMIA 2V4QA 3FBFA 2KYZA 3H20A 2K3KA 1N34F 4Y00A 1Y4ZB 5E0OA 4OJGA 3FRZA 4R0JA 1NBEB 1B92A 3L7UA 3CJKB 1R6YA 1JKHB 3AH6A 4WQ5A 3VQCA 4GMKA 4WIQA 4PQUA 4ZP6A 3LOUA 1U6FA 3Q83A 2VB6A 4Y1DA 1PGZA 3M8YA 2DNMA 4PXBA 2DNQA 3HVAA 3CCQS 1JQGA 4DN0A 1IBMK 5CZVA 4ZCIA 4OLOA 1D8YA 1JMTA 1NGJA 2IA6A 5KFAA 2I6WA 4DV5F 4UT4A 2CIMA 4Z4FA 3RBDA 3SDEA 3GWCA 3LP2A 3L09A 4MIWA 3FR0A 1SKSA 1APSA 4E1NA 1RA6A 3G6ES 3UD3P 1XNRK 3IR5B 4A47A 4P52A 5KTQA 3T1AA 4LBHA 3OFEA 4NMLA 4FJ5A 3D2EA 1P90A 4QR0A 2JVRA 1XNQF 4KH6A 2IHR1 4LF7K 5IS2A 4KI6A 2YJEA 5EWEA 1SH2A 2K7KA 1HWIA 3FZHA 2MSSA 4OPAA 2JC1A 2MB0B 2AU0A 2W01A 1X8DA 4PG4A 4DMZA 1H7XA 3BP8A 4RWWA 3HP9A 5JVGL 3OTCA 3TZXA 1C0UA 1JIHA 4J9KA 2ASYA 5AQVA 4FM1A 1NKEA 3KLGA 3QWPA 3OFFA 2D9OA 1I94F 3I31A 3Q89A 1NJXA 3K59A 4CEEA 4JI4J 2YKAA 4HHTA 3MM9B 2VWJA 2BMBA 2FHJA 1XMQJ 3OY9A 1HQUA 2MZ1A 1LWEA 2LVWA 3F9KA 4B1ZA 3AVKA 5CCLA 2E8AA 2Y1LB 4FJGA 2QLWA 1YJWN 2XHBA 2FJWA 4CDIA 3DAWA 1S6OA 4FVCA 4YB6A 1UPMB 1EP4B 4U8YA 3HSGA 4UW2A 1BQXA 4B3SF 3CDAA 5C25B 4P72A 1R0AA 2KO1A 3VAJA 1HI1A 5ETTA 3VZHA 4K42A 2YWHA 3CDBA 4IQXA 2G2YA 2J7WA 3R3TA 4GW6A 2W40A 3HZ6A 1YITS 4OX7A 5KFDA 1YBTA 4I6MB 2HSEB 4J37A 1BUXA 1F3VA 2ACYA 3PX4A 3I8BA 5KFSA 2MKJA 1HKBA 1L3KA 4HHJA 4ANDA 3M8RA 2QXFA 3W61A 2EK6A 4EWTA 5DG9A 3HI9A 2QEXS 2B9XA 3SBMA 4I7FA 5KFRA 5BRDA 3PSFA 4CO0A 3FQLA 4KHPF 1Q9XA 5K20B 1HJOA 4DCOB 3MMJA 4ZVRB 3LDQA 5EN1A 2QW9A 3UCZP 3FFIB 3W7BA 4JKGB 2A6OA 5BXIA 1QHAA 1C1BB 4WK1A 2RKIB 1KFDA 3B4DA 5F8GA 2DKOB 4WQ4A 1KHWA 4NLPA 1FWKA 3NGZA 4ZVQB 1HNWF 4ZPBA 5AQJA 3NY0A 3OBYA 3WXJA 2BABA 1HNWJ 4JK7A 3G10A 3ZT4A 2M3DA 2HQ3A 4M41A 1FVQA 1TP7A 4YHHK 5CA5A 3SCJE 3A3NB 4FS1A 2ZM6K 4NZ0A 4HTIA 3DRPA 1S1TB 3GONA 4G6VB 2ROGA 2G8WA 1HPZB 3WNFA 4G65A 1NJIO 1KXPA 2UVRA 3WNEA 2L48A 1RJJA 2XYPB 3E51A 3EMTA 3A8IA 3GE9A 2APOA 4YHHF 1VQMS 3IRXB 2IS3A 3A8EA 4IR9A 1CS4B 2CAJA 1A9NB 3LDLA 4DFPA 5CR4A 1D9AA 4WBFA 5J2QA 4KRFA 3OYAA 3GZ7A 5FD1A 4B9MA 3TAEA 3OYIA 1LCUA 1OYEA 5HANA 3SQGA 4UZBA 4LIWA 2OMOA 4K5RA 2IVYA 3FZBA 3HD1A 3TI0A 2EKNA 1NGEA 2VFSA 3VA0A 2RNEA 3ILLA 2DTUA 2V51B 2HG4A 3QBXA 2P5GA 2P9KA 1VSFA 2FSNA 4C9DA 5BR8F 5D4OA 2KW4A 3SXLA 1RP5A 1JCGA 2F8MA 1HR0J 5DGBA 1FRIA 1IKWB 4RNFA 4DV0K 3GJTB 3M6GA 1AW0A 2HQIA 4DPWA 1IUJA 3JXUA 5A2QO 3CJ3A 2JVOA 2VQFF 1NGAA 1IV0A 2DITA 1FJ7A 4YDUA 1TL5A 2XG8A 2RPIA 3W3DA 2BX6A 3TO8A 5A8KB 5IC4B 4B9VA 2FZKB 3MHYA 2ZJQQ 1RTHA 1UVLA 1OYDA 1S1XA 3N0VA 1WSVA 4FM2A 2DFEA 4RUAA 3M8SA 3CE8A 3TARA 3NLCA 2K3IA 4HEA9 1NH7A 2H51B 3FEYB 1U2FA 2KT5A 4WYLA 2B56A 4E98A 4FJLA 4L73A 3EDQB 2IPOB 4N8NA 1WOSA 3PIPL 1ZBSA 2IRUA 3D1HA 3ID6A 1FTCA 1ASWA 1MMLA 5HP1A 3NMRA 2ZKTA 3CI5A 3CMAN 3DRYA 3KHYA 2GAHC 4OIXA 2ADCA 1S10A 1DGKN 3EKUA 4BWMA 5EY4A 4YDUC 5DM7L 1X9SA 1K1QA 1Q78A 3M32B 1AB8A 2PSZA 4CHQA 3CCEN 1SL1A 2KT2A 4B9UA 4HUGA 2XMWA 3NAHA 5I3UB 3ZZYA 1F9HA 1BQNB 1TKXA 4JV5F 1OQ6A 4MLHA 2NQPA 4CE9A 3H5SA 5H9FJ 3OR2B 2CVEA 4X65F 1S6UA 2YVSA 3T5KA 3OD2A 2OPRA 1J53A 1B9FA 1OH6A 4OFZA 4CI0B 2QLBB 3H3OB 5CHCB 4LF5J 2Z1HA 5ETQA 3W62A 1U2VB 1Q82O 4NI2A 4KKOB 1HNVB 5H9EK 2GNKA 1T9VA 3PUFA 5ITHA 2E1MC 2FGOA 1H2VZ 3NAIA 3R2DJ 1U09A 3OW2M 4FN5A 3W9JA 4P75A 2ZITA 5K8NA 2CYYA 3K9JA 1GLEG 2GAGC 2JLGA 3HSDA 1HNZK 4C3KA 3S1TA 2I5JB 2P9IA 4CW7B 1XK8A 3A0IX 2OPPB 3SJJA 2WONA 3AVNA 2E29A 4A8KA 4IRDA 3O4QA 1C6VA 3ITHB 1C1AA 4CERA 5D0RA 4PRFA 1HMVA 4QR1A 1RBRA 3H40A 2C2EA 2PGCA 1IJEB 4Q7AA 1RHRB 5LXYA 5HVFA 1RT5A 3KHGA 3U3GA 2CJXB 4DTSA 4AQYJ 5EUHA 3D4JA 4AHRA 4URSA 2FZCB 2E2QA 4DV3K 1FKOB 1G4CA 4KJIA 4WKYA 2GVDA 2EFQA 2HHVA 4DV7J 4E2FB 5D3GA 3ADAC 1RHMB 4AD6A 5HVHA 4OX9J 2RQ4A 3TWZA 4CF0A 3NH2A 4ZMMA 4CHPA 1KVJA 4FP9A 1WBBA 4UOFA 1VQ4S 1WN7A 5KPZA 1VQOS 2WSEC 1P9YA 4F4AA 3SQ4A 1K44A 3IN5A 1HBNA 4YNQA 3AAQA 2YWKA 4ID5A 3FSXA 1BHNA 2V9WA 2HGMA 3QT5A 4TQRA 4CFAA 1N33J 3L7OA 1D3WA 3HM8A 1Y10A 4CLSA 3JAMY 4KR0B 4DV6F 2HGNA 3BBFA 1S99A 5E5NA 1K9MO 1VQON 2RF2A 4KBOA 2XMVA 2RILA 5CAAA 1OO0B 4DWIA 2P9NA 4X66F 3VTHA 2Q31A 5HP1B 3NVMA 4MDBA 3QNWB 1M5PC 1N5SA 2QLXA 5AJ3F 2ZWOA 2VBYA 1VQ8N 2GVZA 2DGSA 2GVZB 2VU5A 4DG1A 4ZK7M 2XLKA 1FT8A 3OYEA 2ETJA 3PYDA 4YDDB 4J91A 3V9UA 4J9RA 4P74A 3RSEB 3GB0A 3FQKA 2CQGA 4TY8B 3HVTA 3T5JA 1VFJA 4M3XA 3OLAA 4WCEL 3MM5B 3MM5A 2W9CB 2Y3YA 4JI8J 2HF4A 5GADU 2HFNA 4ZVHA 2C2KB 3SQGB 2P5OA 1X0FA 2G0JA 1WSRA 1NSAA 2VASA 1S6PB 3MMAA 3QEIA 1CZBA 4AL5A 4CYUB 2HZVA 4PQAA 2OJ3A 2W7OA 4B1VA 1S48A 3J7YI 4YHHJ 2Q97A 3R1XA 3J7Z5 1D4XA 3BQ2A 4Z7CA 1S49A 2ZBIA 4W4MA 1NM2A 4FBTA 3PYGA 3CEDA 3W0LA 1IXKA 3K5MA 3HKZD 1KVAA 1NGIA 1V3ZA 4OZJA 4L74A 4DV4K 2QLJB 3G8TA 4BR4A 1YDLA 3C0BA 3WC2A 3W60A 3HVRA 1NM1A 1YRUA 5EHHA 2Y8YA 4H4KC 3L9ZA 1SJ1A 2IC3A 2GMLA 2VFUA 4ZPAA 2E2OA 2D1CA 3SSSA 4FJHA 4QIVA 1W26A 4F3MA 2FJXA 3HL8A 3HKWA 1NGCA 1RQ0A 3C3LA 4DR4K 1EETA 2DR7A 3UDVA 2CJ9A 2EWHA 4OX6A 3LQVA 3TAMA 3SMZA 3PIPQ 5D3GB 1F2GA 2R42A 4X4PA 3AXKA 4HI1A 1C0UB 5CZ2A 1DTTA 4RNOA 3FSYA 4M63A 3KG4A 1SJFA 1ATSA 3CYMA 4DB3A 2Q0RA 1WSIA 4ZCMA 3FCHA 3ZZ0A 2CZ9A 3ZXWA 3OL9A 2C1EB 3R8YA 3TSPA 3KD1E 2QSWA 4Z94A 1H6KX 4CP5A 5IV3A 4OYBA 1VQNN 4J2DA 2VQEK 2NS1B 1E6VB 1QVFR 2A6AA 4FJNA 4J8FA 3D45A 3O6WA 1H1VA 3KLEA 2OELA 1DURA 3AA5X 4X84A 2Y9HA 3J81Y 4DX6A 3KHLA 1U2RA 1RCOB 3ZSRA 2YKNB 3R9LA 2VV5A 2NXNA 5EWGA 5HMWA 1C0TA 5D0EA 1VQNS 1M5KC 1HIYA 3E01B 4JHDA 2KHCA 2KFYA 3J8AA 1RK8A 4KYZA 4JN4A 1RT1B 4DQIA 4B8AB 3MWBA 3S01A 2FJDB 1KVCA 2V4RA 4RNHA 3OT9A 4ZHRB 1UA1A 2BJ1A 1DLOA 2MKHA 2Q66A 5JVGQ 2Q36A 3MEEA 2KG1A 5A8RB 4ICLB 3VQ4A 2AGQA 3W65A 2LECA 4L3QA 2UXDK 2V67A 2R2RA 5FLXO 3KK3A 3CDWA 4PKIA 4ED3A 3A5OC 4ED0A 4KH1B 5IT4A 3CQ8A 2IGIA 3I96A 4F4ZA 2DGXA 4DV2K 4NE9C 1M90T 1MWQA 1WOPA 1OIAA 2LDYA 3M8QA 1R7IA 1LXNA 4Z37A 5IT9U 1UWBB 2UXDF 4H8KA 2QL7B 2FTRA 2JZ5A 1C4CA 1HNXK 5BYSA 2XMTA 2DBBA 3M8PB 3CUNA 3DI6B 2QX0A 4QWEA 3GYGA 4GO7X 1EKEA 1U1LA 2CJQA 4M3RA 1ELOA 1ESVA 2VJVA 4WFNL 2VZ9A 1LW0A 2N4CA 2CQ3A 1Q95G 4BHQA 5D8HB 5F8JA 4DL0C 4S0MA 1RB0A 2EW9A 3MN7A 4FM0A 4G1PA 1U2CA 3AY0A 1QSLA 4DPXA 3EGZA 4JKAA 3M2UB 1TQLA 3IMXA 2YNGA 2ZH1A 4LF8F 3FE1A 2IBKA 4UUWA 1Q8KA 3KK1B 5D4PA 1RU1A 5KFPA 3L3CA 2LSNA 3ZZZA 4YOTA 3R5DA 3ZZUA 3U02A 1N5QA 1B4SA 3A12A 4U67L 1AROP 2MQLA 1VIOA 4DSEA 4ATNA 2FHKA 4CTAB 5IZHA 4FW2A 3AVFA 2F63A 3OL8A 1GMWD 2HIQA 2AJFE 1CS4A 1RBVA 1FKPA 3W2WB 5AQKA 1U0HB 2ZOFA 1X5SA 2QXLA 4RO0A 2Q43A 5ETKA 1QQMA 4DHVA 5J2MB 2FHJD 4TXSA 3BBCA 3SFUA 4ECWA 1X9JA 3DLRA 2HNZA 3MTKA 3CT9A 3C66A 4DN9A 4EFHA 3SDEB 1HBOB 4LR7A 2ZOGA 4HVZA 1CSJA 3P6YC 1SL0A 1RWOB 4K4UA 3CPWM 2AF6A 2K1RA 4GY2B 2MQ8A 2IMWP 2JH3A 3VR1A 3MEEB 4B3RJ 4FKXA 3GFYA 5T14A 5CE3A 4RU9A 2UVVA 5ADZA 4XPCA 1QAXA 2YQ0A 1F0XA 3LALA 3J80O 1VQKS 3HFVA 4NA2A 4LF4K 1LK5A 3MI7X 2DHGA 3HVWA 4HUFA 1RTDA 2V0NA 4CJVA 2FHOB 5LMNK 1YAGA 1LW2A 4KAIA 1QE1A 1DLOB 4JBCA 2V34A 1Y3KA 4F26A 5C7PA 5HRNA 2HBZB 3KLIA 3NF7A 3SUOA 2RH3A 2D3ZA 4MO4A 3OSNA 1VQ9S 4TQSA 2NRRA 1TYQA 3S3OA 2GC8A 1K73T 2GHPA 3BF1A 2Z30B 1P1LA 3M30B 3ZEUA 3Q22A 1VSKA 3LP3A 1QAJA 4DR6F 4L75A 1IBMF 4FLUA 4KHUA 2ZH4A 1AUSL 4ISEA 1VQ6N 4ZP8A 4DQPA 2HAFA 2AW0A 3BKFA 4NLGA 1EB0A 3CJBA 1JLAA 3RB0A 3ZT0A 1HWKA 3W8GA 3IBWA 2E7XA 4IR1A 2D7SA 3V4IB 5F0XA 2MKKA 1X1PA 3JAMO 2LEBA 3Q24A 1HJRA 5BRFA 4YDXA 4LD0A 5AFUH 3NGUA 1ZXOA 3IS9A 2V63A 4P2MA 4O4GA 3KKRA 4LFAF 2DGWA 1L3VA 2YPYA 2OPRB 4H4OB 2NZ4A 3PR4A 3JYTB 2P8IA 2A40A 4TLRA 1CJKA 3GMGA 3PCOB 2HQCA 2Q6BA 2ZFHA 4PKGA 5JVHL 3G9CA 3P4UB 4M5IA 1X4FA 4URQU 1KLNA 1RBLA 2P6SA 3J80Y 3FSIA 2YHWA 1Q7YT 4CJFA 2YNHB 4DR4J 3UDCA 3AD7C 5GADP 1J2VA 1HYVA 3HYFA 5KOWA 3L3UA 4K43A 2KG0A 4R5PB 3G71S 3CERA 3CPEA 4IOCL 2QN6B 3NOGA 2A5XA 4B3OB 2B4JA 1H38A 2XYGB 1YTUA 1G15A 1S9GB 3FBEA 5ETRA 4JI4K 4M5LA 3DYAA 4OLBA 4CBXA 2FJVA 4PG5A 3LM2A 3FZ2A 3VHQA 4NCGB 3Q7CA 3KYLA 3F56A 3G4SS 1RBUA 1N5TA 4UQTA 3D1QA 2HLUA 1FFWB 4UOHA 1K8AT 3MUMP 4IDHA 5FRNA 4WJBA 2NRWA 1SJRA 2CQ1A 1WBDA 2HFOA 3W9IA 2E1YA 2XMKA 3CD0A 1X31C 1WNSA 4BRNA 5BRHA 4I2QA 4PYDA 2CDQA 4FPBA 3THXB 1VQ7N 4PKDB 1YIJN 1O1WA 3GIJA 4IO9Q 4JYAJ 2GTDA 3HHLA 1FEHA 4PYAA 3FEZA 4RX6A 4BROA 2ZZTA 1WWHA 2MZSA 2IYIA 2ZJPQ 4FJJA 1A0OB 4A48A 3I56N 3DLKA 1TKTA 4L3NA 3J81j 3RBZA 3SI8A 1A5XA 3VQSA 1KOOA 4K4VA 3LP0A 2KB2A 1PKUA 1EQMA 5CH7B 4M3WA 1F60B 1XTZA 2UXDJ 3FK4A 2DTJA 1CG2A 1MN7A 2OO4A 3U3YA 3C46A 3ATVA 3OQ2A 2DNRA 2BQ3A 2FLLA 3TQ1A 2F8HA 3FVYA 3IGVA 1Q5VA 2GX9A 2N3LA 3T1YK 3CO9A 2QTDA 3VAIA 3JTPA 3JSYA 2FHMA 3HHLC 3HP6A 3CJAA 2FJEB 4ES3A 5GAHU 4LFBJ 2HRUA 3H8YA 2AV5A 4USWA 2IBOA 4CTAA 4OHWA 1BI4A 4C8MA 2XMMA 4JD2B 5J2QB 3DOMB 2GA7A 4NA1A 4KGKA 1SC4B 1RHJB 2HRTA 3KK7A 4JI7K 1ZBIA 3M1VA 2OPPA 4ENOA 2Z1IA 5C12A 2J0XA 2DXFA 2VF3A 3OW2R 2V8GA 1S59A 1WKKA 4F50A 3BDPA 2K7JA 5BN9A 2UXBK 1U02A 2DR8A 3EGWB 3HFKA 1RT5B 5ETLA 2O8BA 2BGGA 3KK2B 4TYAA 2VC1A 4DEZA 2BE9B 1FWPA 3M8PA 1GTEA 3EN9A 4IDKA 2L9NA 4PWDA 3A2FA 3X1LB 2GVDB 3PRBA 1KDNA 4WU2A 4DV1K 3R5GA 3HI0A 4CF8A 4BCAA 3Q8YA 2GWJA 1NOZA 3O3HA 1GK8A 1SKWA 4WF9Q 1WOOA 2M2BA 1AZSA 5A2QY 3OR1B 4E7KA 3GR1A 4N76A 1N0UA 4BE0A 4YB1P 2YNGB 4IEIA 2OPSA 2BW7A 1NK6A 3HHLB 5F8MA 1YHQN 4QS8A 1T3VA 4KHPJ 3KK1A 3QEXA 4U95A 3MOZA 2VJUA 3LF0A 4B17A 2AJQA 3PRVA 3LUYA 3HOSA 1EETB 1YK9A 2HMIB 3BDEA 1X7VA 1O8BA 3EM1A 4Q44A 4DOZA 1T8EA 2P9EA 2IM3A 5EOYA 2H1YA 4PZVA 3ZT2A 4WFBQ 2C28A 3LA0A 3OTEA 2F9DA 1KVBA 1VC0A 4J2BA 3U1LA 4K4SA 2ILZA 1RT6B 4JI6F 1W25A 3UN5A 9RUBA 2IIRA 1KQFB 4YORA 2O4IA 4Z0UA 3K8VA 1RXOB 1UZHA 1DBDA 2OP5A 3ZSWA 5L1IA 1NEEA 5AQSA 2FXUA 2D3OR 3ZSQA 4LF4J 3K5PA 3ZSOA 4PXEA 3AA3A 3U1MA 4BDPA 3NBPA 3I33A 2MKIA 1NUEA 4DR7F 4Z4CA 4A62A 1YQHA 1YIJS 3MUTP 4OV1A 2P9UB 2H9ZA 1Y5NB 2ILYA 1X9MA 1GX5A 1VC6A 4ZVSB 3D6MB 4NYFA 3BPDA 2QA1A 2XEXA 1KQGB 5GAGI 2ZJRL 1E4GT 1QQCA 1UJ6A 4C1NK 3OHRA 2CJYB 1T05A 4CH7A 1DTQB 1X5OA 1YZ7A 1RTDB 4JNEA 3F73A 2ZDOA 2DH9A 1UPPA 4U7BA 3ET6A 3UNYA 2Z56B 4PEOA 1PO6A 2MQQA 1ULRA 1H74A 1G2EA 3M9NB 1DY3A 4J9MA 1FDNA 1NMNA 3CFRA 3HCXA 3BJYA 2MMYA 3CF5L 2P9IB 4MYTA 4OYWA 2QWLA 4AHUA 3WHIA 3I4PA 2A1BA 3A5LC 1NB7A 1XNRJ 2ZH2A 2MJNA 3I8DA 5TKYA 3BF4A 1QVGR 3GFXA 2D0CA 4RW9A 4DXLA 4ECSA 1VBKA 3KKSA 3QDKA 1RISA 1HI0P 3VQ6A 3ILIA 4LF7J 1J5EF 4OX9F 3DNCA 4MDAA 6FD1A 3TU5A 4HTJA 2I1RA 3IBCB 2NUBA 3MEGA 4A4JA 2C3OA 1Y0HA 2GGPB 3G6VA 2GX8A 5DS7A 3RG6A 1Z6RA 1ZZNA 2UXCK 2W8LA 3MCNA 4Y2MA 3NCRA 1DTTB 3TEHB 4DSKA 4FXVA 4E7HA 2GV1A 4RPFA 3JS6A 5KQDA 1QD1A 4LBIA 2MDAA 4ZKAA 5H1SQ 1KD1T 3M8ZA 5M1QA 2DO0A 5FJ4A 2K8GA 1XNRF 1S22A 5KFQA 1F1BB 3CCTA 1BHLA 3SAHA 1NHKL 4P71A 4I56A 4CRJA 2YHYA 2UXCF 1BO5O 4LSLA 3VETA 4K41A 1RTJB 4NXNF 5CYQB 2NZCA 3C6TB 4JRQA 1CJTB 4EHUA 4KHWA 4CO3A 4ISFA 5E3RA 2X7IA 3VQBA 3CXCM 3AAWB 2XRIA 4ICLA 2DFHA 3GQCA 1UP1A 2MGZB 2VOOA 1PCAA 5JS2A 1VQKN 4B02A 4A8YA 1VK3A 3CGIA 1ZA2B 3LZJA 1EAYC 2IVPA 2V5HG 3WUHA 3K8WA 4CJ4A 3N01A 1JXBA 2F9JA 2LFVA 3MAQA 1NGHA 3KLFB 2EVZA 3N4PA 5B08A 1X60A 2QKKA 4ETXA 3IXQA 1OS5A 1S6PA 1ASVA 3GCXP 3R27A 1YX2A 3D28A 3KJVB 3VEWA 3G82B 2OA8A 2WVEA 2DEJA 4QIGA 2MQOA 4DR3F 1P8GA 4G1QA 4LY7A 2Z1GA 1N5YA 1KD1O 1HFEL 4YOWA 3NS6A 4FBUA 3SAGA 2G13A 1FX4A 2HBJA 4M1KA 2W7AA 5JXSA 4WF9L 4ER8A 3ETOA 3PKYA 3M30A 4CEOA 3MM7A 3I87A 2E1CA 2XY8A 3WT0A 2PYJA 3E2EA 4DR3K 1IJFB 3QGIA 1YJVA 2GJFA 2W1BA 2Q1NA 1RHUB 2P9NB 2HHXA 2QFIA 4FNIA 3M6UA 3V4IA 1A7GE 1S7IA 3RAXA 4ES1A 4D3GA 3T6JA 2FUG9 4CESA 2BQRA 2BOPA 3FDSA 1JWWA 1Q81O 3MUVP 3RRGA 4LJMA 2DY4A 4NLTA 1J54A 3US5A 2CQCA 3BBBA 2GQCA 4WE1B 4CJEA 5MLCQ 2V94A 4X62K 4RUCA 4N47A 3T1HJ 4AM7A 4CLTA 2C3YA 4LH4A 4EGLA 2WTFA 3UN3A 2OCEA 3CCVN 1QZ6A 4LC9B 2LU1A 2BUPA 4BRCA 2BDPA 2A10A 1KHVA 3RAQA 2F7VA 3DM2A 4LT6A 4B8CA 3VGVA 5CHIA 4KGZB 3UE5A 2RS2A 2XMJA 2OPQA 3ICLA 2R7XA 1HR0K 4YR0A 3I9V9 1UL3A 3L2UA 4DV0J 3SCIE 1RFQA 1RT4A 1FW6A 4IDKB 5DDQC 3HJFA 4KPYA 3DOMA 1NK5A 4FF4A 5DDPC 2B9YA 4ETZA 3G82A 1TL7B 3FKBA 1S6QB 4DV1F 4M5DB 4HT5A 2XY7A 3IM8A 1GMUA 4X64K 2XS7A 4DPYA 1YJNS 4C8KA 3L2RA 4H4KA 2Y1IA 2CWXA 4BC4A 3AJ1A 1YJWS 4I69A 3KVGA 2VQEJ 2BEFA 2F7TA 2RU9A 1W2BM 1QAYA 2J6UA 2WC9A 3FZKA 3HK2A 2ATQA 2YWEA 1HBUB 2ZF5O 4DU8A 3BKTA 4EHTA 1FRKA 4EUVA 3CM6A 2CQ2A 3K89A 2YTCA 5F3TA 2UYTA 2Z57B 2ZGZA 1QS4A 3PW2A 4WFAQ 2HIYA 3TNVA 3QAEA 2P9GA 2NLWA 2CPYA 4A5BA 1ZAWA 3P39A 4CGJA 3QZ8A 2RQKA 4M45A 3GG1A 3EUNA 2NSCA 1VQ9N 3HHLD 1UKUA 4RW8B 4OQJA 1C0GA 4HR2A 4OMFG 4CO5A 3SJHA 1M0SA 1MW7A 2R3VA 4NZ7A 2YHBA 4I4BA 4M5HA 1SB6A 2CNOB 1BQMA 2BACA 4UTGA 2RKIA 1S0VA 1WF2A 1ROFA 2WW4A 1HBNB 1MU2B 1PG5B 2UUWA 2W6LA 1HNXF 1HPZA 2BOAA 4NCBA 1GX6A 4FJKA 3TX0A 2C2MB 3GJSB 2E1ZA 3GFHA 3VN5A 4USUA 1XMOF 1RAHB 2PAVA 4AUKA 2JFKA 4OVLA 3C65A 4BGAA 2ASOA 1N36F 6FDRA 2A3ZA 2JEJA 4DQ8A 2HGLA 4DL6A 3FMWA 2JX2A 4ANEA 3O8MA 4XPEA 1WSFA 3DLEA 2C2DA 4Q8EA 1VBZA 5EVZA 2O8CB 2BJ3A 3CCJN 4DL4A 3RW6A 3MX2A 2DISA 2R9LA 5HLFA 3OYDA 3KHHA 5ADXA 4DPTA 3KUHA 4LSZB 4X4QA 1TKZB 4WQ5C 2GMHA 1NSQA 5IWAF 5B09A 4YMEA 1JCFA 1XUPO 2GWKA 3UCUP 2ZBCA 4V19X 5KFTA 2CGLA 1EKSA 1EJ7L 3M1VB 1U1PA 3NF6A 4FLWA 3M9OB 4M3TA 3HD2A 2Q6CA 2YBVA 1F3FA 2CPIA 1RBAA 2RD5C 3FJ2A 3ZSYA 4BRKA 3G8QA 1VLYA 1D9DA 2AHOB 3BGRA 1RADB 3IG1A 4F7VA 1VQMN 4N5SA 2A6MA 4UF4A 4JV2A 3AHPA 1PSDA 1ASUA 5IFMA 4BG8A 5SZTA 4ZTFA 3ENWA 2O01C 2G8IA 1V4TA 4CJQA 2DNNA 2CZ4A 3DFEA 2ATLA 3S41A 1WTFA 3KUGA 4YB5A 4KT0C 4C8YA 2P9SB 2Q79A 3MPYA 5KFIA 4QOZB 3PZPA 4F3TA 3LO3A 3VQEA 3M9MB 4FL9A 1KWMA 4DL2A 4ED5A 2GO8A 3L4BC 2QSFA 4WZQA 3ZZPA 3AA2A 3D9BA 3TJ8A 2EFGA 1YI2N 4ELUA 3AD9C 1VYAA 4HH1A 2JEIA 4OZ1A 3VAKA 5AE2A 8RUCA 3AJDA 1VSIA 3TRGA 1CC7A 3BGUA 4P2XA 5KFBA 2U2FA 1C1BA 3E66A 3AO4A 1RT7A 1JLCB 3G0ZA 1ICEB 3N9UC 3MAAA 1VSLA 3Q2SC 4O3SA 2O3DA 3VGLA 1S1UA 4TYBA 1QSSA 2XO7A 1LFPA 4O0NA 2C2ZB 4IXCA 1B64A 4J9VA 3TZWA 4B3SJ 5I3QA 3N28A 3KLVA 2E20A 3LGHA 2VPWB 4OHVA 3LDPA 5FLXU 4CGDA 2A18A 2AIRB 2OTLS 3TR8A 2ZKUA 2YWGA 3BZQA 2HOEA 3B4MA 4OLAA 1SV5B 4FWQA 4DV6J 2J9DA 2VBXA 3KNGA 3P96A 5LSLA 2KN4A 1YXQA 4KI4A 2JFDA 4X2BA 1WI6A 4NLXA 2OAUA 5KGWA 2PDAA 2ZWHA 1U6ZA 1NK0A 4DV3F 5BREA 3RR7A 4CJSA 2PBDA 3HT3A 2VG7B 3E9OA 2HHSA 1UMJA 4J2EA 2KM8C 4NPOA 4CIGA 1R0AB 4KGVB 4FOEA 4CECA 4XDDA 3RW7A 3CSKA 4ANCA 4PWDB 4DSJA 3DXKB 4H0PA 4OI2A 2YCHA 2XZTB 3JSBA 2D9PA 1N8RO 5H1SV 2DH8A 4P10A 3KNAA 3WQTA 1ILYA 2XMAA 1FE0A 5KG5A 1IKYB 4V19S 2KVQE 3D2FB 1ZM9A 5G0RB 3R5AA 2GELA 1FXRA 3K7RA 3ZTSA 1HPMA 2HRYA 2OEKA 3QT8A 1AZSB 3F0NA 3D0IE 1NAQA 3THTA 3V6HA 1WG5A 2HFZA 4WYWA 2JEGA 3OBWA 5F8HA 5EX5A 4CJLA 4Q0BB 3DRSB 1BIUA 4KGMA 2MQMA 4AH9A 1GT8A 2R2UA 3PV8A 2JRSA 1SQGA 4CLZA 3K0JA 1YGYA 5KFZA 4CJ7A 3EE9A 5ADXH 4IOBA 5L38A 3IO1A 1NU4A 1QVGM 4OI3A 5I42B 2QYCA 5A76A 1UVMA 1E4FT 2AZ1A 5KT5A 4ECVA 2NXUA 2OGUA 4IH6A 3QFPA 4OKKA 3BKUA 5ETMA 2QIFA 3V6DB 4RBTA 1S0NA 4H4OA 4PG6A 1AA1B 1SIWB 4ZJLA 3WXMB 4LVOP 3AVGA 5JS1A 4WP8A 4OYMA 1N32K 4YOVA 1LQ9A 5B7WA 2KFZA 3P3DA 5HO4A 3BH7B 4P7TA 4MT1A 4BQLA 3IR7B 5K14A 2EFPA 3OLBA 4FYWB 2RU3A 4BRHA 4WZMA 1B9DA 1JLEA 3U1NA 3D6RA 3R5CA 2Z2MA 4JS5A 2Y1RI 2R7YA 4LSLB 5E3AA 3BEXA 2HWHA 2VDIA 5M1NA 1KEKA 2VG7A 2CVIA 3RMDA 2O8EB 1I51B 3ZC4A 1EP4A 1IKVB 4DR1K 1VSJA 4J7CA 3THYA 1WOQA 3M8QB 1RBSA 2YHXA 3QSIA 4OGEA 3QATA 4NLOA 1RILA 4Y0FA 3A13A 3SMPA 1SV5A 5D77A 2CNKB 4H5TA 4CJTA 3TTFA 3HVTB 3TTCA 2XTJP 4IFEA 3V9ZA 4IUFA 4ECQA 2AEMA 4QWDA 4DLGA 3ZNJ1 4Z4EA 1PIEA 3DHWC 4H0TB 2MPUA 3MECB 5L8RC 1W2IA 2PFFB 4B3MF 1HNXJ 2X1AA 2XY6A 1CLFA 4M5DA 1T02A 2KI2A 4KREA 4TNOA 2F4FA 1YRTA 1TV6B 1QUPA 4J9PA 1JLQB 3FBCA 4YY3J 2L3MA 4FW1A 3M5RA 5KG6A 2CZVC 3ZYYX 2R7TA 3TJAA 5KG2A 1BA1A 2PYLA 1LW2B 4CM0A 2HNDA 1KQSR 2AP6A 4CIOA 3D3CJ 4H5VA 3VQ8A 5E2QA 2F40A 3MX5A 4F0MA 1ZBHA 1HKCA 1RT2B 3BV8A 2R8GA 2YXLA 4CNYA 2QI2A 1E3MA 3S3NA 5KFVA 4CLWA 2L9WA 2YNIB 1LV5A 3V6JA 4M5JA 2XULA 3RAMA 4DTUA 3MPVA 2E7VA 1N36K 3L0QA 2FF6A 1TKXB 1MROA 1BL3A 2PT0A 3VAFA 2G2ZA 1WC1A 1FXLA 2A3JA 5JVHQ 4ZVFA 1XC9A 4DF4A 4CZKA 3KWGA 5FPDA 5HBMB 2W2QP 2UZAA 2VBWA 1EXQA 3P49B 2FB0A 4H4MB 1YVUA 4ILHA 1T94A 3W9HA 3NGSA 1LWEB 4DQSA 1B70B 2ZHAA 1QDUB 3BGLA 4FYVB 4ELTA 3K5NA 1H3DA 4CZJA 3QB0A 2V4JA 3IFRA 3UQSA 3RRKA 4AL6A 4OYPA 3MK6A 4CK1A 4M7XA 5E3CA 3L2QA 1RBOB 5LJVA 3MFHA 2WONB 1NSKL 2DGVA 3NWRA 4FZXC 2ALYB 3MN9A 3I32A 4K2JA 4BR0A 2ZC3A 3UI3A 1BC6A 4Q2LA 1DQ8A 4DUZK 3QO9A 1XI1A 3MTJA 5KG3A 3ZZRA 4EK2A 3NGKA 5ELZA 3Q8UA 2CQIA 4RBVA 4CEFA 1TV6A 3GYNA 2EC0A 4DTPA 5D15A 4ID8A 1XNQK 1MWKA 1RGIA 1R8CA 1JLBA 3W64A 1C4AA 2CUYA 1XEZA 1FXXA 2D1KA 3QIPB 5D78A 1X4GA 3VF0B 1QM9A 5M1FA 2Q1LA 2F4VK 4N7TA 3D54A 4KRWA 2HVIA 2DXDA 5AQHA 4EO6A 2WOMB 5J2NA 3C15B 1NZ8A 3MFIA 4YUDA 2HVEA 1EWQA 1I39A 3MMCB 4DFMA 4JKEA 2HQGA 2MLYA 2RUSA 1RKJA 3V1QA 3OS1A 2G1HA 4QYZJ 4FK0A 2GQ2A 2XYHB 1LWFA 5HAOA 2O8FB 4FVMA 2CJKA 2PN6A 1GLFO 1RAOA 2QO3A 1Y3JA 3VAGA 1S9FA 2HFSA 3QLHB 4CZFA 2EWSA 3BSCA 4OYOA 2OFHX 4O44B 1HL6A 1R43A 5C10A 1VRUB 3FEXB 3NS7B 3NF9A 3HM9A 4GV9A 4ZLNA 4AL7A 1CULB 3QMLA 2MGZA 1KOHA 1NXIA 2KVIA 3C6UA 2YKNA 4MFBA 3B8AX 3H25A 2ZJPL 2DCLA 5F0UA 4H54A 2DGTA 2ZEJA 4H0XB 5KFUA 3RSEA 3AGKA 1FKPB 3X3UA 4GKJF 3EZWA 4JI4F 3PLAA 1FDAA 1HQEB 5KT7A 3VGSA 4F02A 5LJWA 5CYQA 1KBRA 2YKPA 4OHXA 1C1CB 2QL9B 4R5PA 3SCXA 3AQOA 3LW5C 3ITHA 2Z8QA 4WXOA 4I6AA 3SAFA 3RMAA 3IC1A 4JHDB 4HUEA 4AE5A 3ULDA 2ZVSA 4OJHA 5FROA 2K1RB 5HLFB 1WC4A 1BY9A 1G1XA 2H5JB 5L1JA 3O9QA 1KCFA 1VS3A 1RT4B 1FRXA 1Z2ZA 1PYTA 2ACMA 2P5VA 3W5XA 4NCAA 3IBFB 1FI4A 4AF1A 4B3RF 3D7SB 4XH5A 3SUNA 1RWUA 2HZAA 4OZ5A 4FO0A 5HATA 3THWA 2BJ7A 4G1QB 4QJVA 2MLZA 3CIZA 3KJNB 2B8PA 3C95A 1TR0A 4EZ6A 3TUIC 4RU2A 5KPTA 1HMVB 2YX6A 2HYIB 1N32J 1K8AO 2IC3B 5KRSA 4BE1A 4QS9A 1G6BA 2UU9F 1KC8O 1CJUA 2YNHA 5GAGU 4DHYA 1FKOA 4U96A 2GUIA 4K0KK 3UW1A 4FPIA 3NGDA 3VTIA 4JYAK 2V7YA 1SCJB 1NDCA 4HYKA 5AQGA 1OH8A 3SI6A 2FBTA 4CZCA 2BRKA 1Q82T 4B3TK 2BE2B 4NCGA 4BDZA 3QERA 1XMBA 3P5TL 5U47A 4OYAA 3FGUA 1FA0A 2YWWA 2UU9J 3AD8C 3GTYX 4FLVA 1WACA 4K8RA 2BE7D 5AQTA 4QQBA 2ZJRQ 1S0OA 1FRJA 3QLHA 1JJHA 2W4DA 1S3XA 4JEPA 2PIIA 3VF6A 2P9LB 2F8EX 3GDQA 3E01A 2NYIA 4NB4A 3CJ9A 3N79A 3HHKA 3JQJA 4L3KA 5JLHA 5AQLA 3AXMA 2NNWA 2VWBA 4HHUA 2QV6A 3AVLA 3ZFVA 2WBMA 2EFOA 2O8CA 3VESA 1WC3A 5K9FA 3CHWA 1EX8A 1O6XA 1U2VA 2VQEF 1YZ6A 2MEWA 3CCJS 4DUTA 1G7CB 2CPJA 4LF1A 1S97A 1SH0A 3OYGA 3QFHA 3THVA 5F41A 3H7HB 2Q3PA 3JYTA 1Y5LB 4HKQA 1OPZA 4NXMK 2J9EA 2UUAF 5AQNA 4DLEA 1TAQA 1XBWA 4JI5J 2Y0BB 3CD5A 3CULA 2H3GX 4A57A 1LNQA 2QKBA 1FESA 2XSJA 1VMBA 2QMUB 3OYJA 4U7UK 1RA7A 3NWGA 2IJFA 3NP5A 1NPRA 4IFVB 2KQ2A 4H5RA 3P38A 4RR5A 1XQSC 3T1HK 3HSTB 3ULEA 1X0PA 4Q5VA 1HRHA 1N32F 4DV0F 1H72C 3G86A 2DNOA 2R7WA 3AFGA 3PVXA 4EBEA 2G8VA 2W25A 3O3FA 2Z2LA 3MPUB 1PJ7A 2D3UA 1U1NA 1W7AA 2OPSB 3SBGA 1N5YB 2GFFA 3ZTOA 4WXWA 4DR5J 2CH6A 2W9AA 3VGUA 4CHNA 5EX0A 2H3EB 3GOIA 1T44A 1ITGA 1ZPWX 2QWMA 1S1XB 5A2QU 2XZWA 2WOMA 2B4PA 1MG7A 3TA0A 3M3ZA 3JB9k 4BRPA 4PUOA 3J81U 1VQ4N 5C5JA 2VICA 2A0FB 1U0SA 3LANA 2P9UA 4ZVTB 2NLXA 1CJVA 2OANA 2DD8S 2HQFA 4DR2J 1FJGK 1S1WA 4HTLA 3PX6A 3ZX3A 4LRFA 2M5YA 1T05B 2XCAA 4C2MA 1RHQB 1A6LA 4I9LA 5GINA 4KHSA 4PUOB 4YN3B 3AB4B 2R7QA 4KB7A 4MIAA 2B9EA 5A8RA 4I64A 9ATCB 2AMCB 4CEBA 4K59A 2UVUA 3JQMA 4JV0A 1U24A 3RMCA 3MMBB 2R8KA 1SQEA 2OTLN 4D3HA 4XH4A 4TKTA 3V81B 5IXUA 3W2WA 3NCIA 1T9UA 2DGUA 1X5TA 5HQLA 1JLBB 3CJ0A 2R7RA 4E1JA 4X4NA 3MWTA 5BN8A 1SL2A 1NKCA 4NMXA 4ZVEA 2D41A 3H1VX 5E3PA 1NU0A 4KAZA 5ETPA 3N5FA 1RDRA 4H0OA 1RWMB 3G6YA 3Q8QB 4B08A 4BRDA 3DXKA 4JK9A 1IBMJ 4RW9B 4DCJB 1YWXA 4DR7K 3CC7N 2MHNA 3HJVA 4RWTA 2J7KA 2FC9A 5BR8J 3VF4A 3B6BA 4QAGA 2HBYB 2HHHF 5KGXA 5CY4A 3QETA 5FDLA 3OVBA 3CFOA 5CZXA 2JLFA 3H5UA 2EI5A 2J76E 5JICA 1MROB 3EGNA 1NMEB 2IJRA 1VCTA 4AQYF 2MZRA 4B9NA 2DR5A 1JXVA 2LKZA 2WVCA 4FOIA 2KH9A 5CZ1A 2HHHJ 4KB0A 3VGMA 1R59O 3SCLE 4F4XA 5DMRA 5HBMA 1ATRA 1RT2A 1BDGA 1SPBP 4QCLA 3K2PA 3DLJA 2DRDA 1GXTA 2DHXA 1TL1B 2MKSA 4KTQA 1FRHA 2Q0UA 4M42A 1SUQA 4LVNP 3I5CA 2BR0A 3DLKB 3WC0A 4H5WA 3MCOA 3NMAA 2J6TA 5AQRA 3CJ7A 2JWLA 3O4WA 1WUUA 1V3SA 2HWIA 3MWPA 1REVB 4LF2A 5DM6L 1NK7A 4JI1K 2E66A 3AGRA 4FWPA 5F9LA 3WQPA 2PMWA 3VOVA 4USMA 3U9ZA 2WK4A 4RG8A 4R0EA 2LEPA 3KLGB 5AQWA 4Y28C 1Q79A 1GLCG 4LF7F 2XBPA 4GVLA 1E6VA 1VHFA 3BPSP 4MQ3A 2YQ3A 3SLCA 3M2RB 1Y11A 3O9UA 5E41A 3DXSX 2W24A 5GADI 1HNZF 4LF8J 4ZIWA 2ZZMA 3L2VA 1YITN 1JL1A 3SFGA 1H2UX 4C8NA 5DDRC 3ZLJA 3MDQA 4M5NA 1YJ7A 4QWBA 3W5YA 4B3OA 2QTWA 4EFAC 4MK8A 2O8BB 2H5EA 4XIUA 1NK4A 3KLHA 3BH6B 1W2BR 4CZHA 3GSDA 3R5JB 3PJ9A 2AJ2A 3FZLA 4JKGA 1Q7LB 4N8OA 5BYQA 2BTFA 2B43A 1U1QA 1ZM2A 1VSHA 3O5TB 2EBEA 2EK1A 1OMSA 4CFCA 3DDNA 1SQKA 2B8QA 3CJCA 3D0HE 1WLJA 1F5BA 1KC8T 1A5WA 3QNNA 2E6MA 4FWMA 4PPDA 4B3SK 5J1EA 1IM4A 4U9RA 5B8HA 2VD3A 2KLAA 2R7SA 3CCUN 1RHKB 4CHZA 1P27B 1AYEA 4DV5K 1NPPA 3HOTA 3V6DA 2F9TA 2ZWPA 2AYMA 4YOUA 3HMJG 1ACMB 2LP4A 2M4MA 2R7OA 3ZTPA 2IVFB 3R5BA 2QGFB 5HMXA 3Q8PB 4CJWA 4F4KA 2COLA 1JJ4A 4IWVA 2QMXA 4B1YB 5DETA 4DR6J 2LYVA 4NASA 5IQQA 3OV7A 1OH7A 1LXJA 4C8LA 3K2YA 4C7QA 4WK3A 1R8BA 3ENHA 4QIWD 5AXNA 3T6BA 4P6QA 3LH2S 4B3TF 2OUGA 2FD2A 5DQIA 3KOAA 1Q53A 2V9KA 2GUPA 4BRAA 5TKWA 2ZH6A 2BVZA 3R7BB 1RAEB 4ECUA 5AJ3J 3T7ZA 4LR9A 3ID8A 4IH7A 1FD2A 3DGPB 2LQ8A 1LWCA 3B8HA 4Y2IA 4JI5K 5D6GA 5JMVA 5AZJA 2QA4N 1T3NA 1T6CA 4FLYA 3VV2B 1MMDA 2CNLB 3H3NO 1NGBA 4BRLA 4PG8A 1TUUA 3M05A 4WTOB 1CQNA 4ZPCA 2V7ZA 2C2OB 4YR2A 4Z7YA 1Y7PA 4J5OA 1O51A 4CGHA 3A1YG 2D0PA 5B0GA 2UUAK 4FZVA 1UEUA 4X4VA 4ILGB 1SBRA 1EWRA 1NDKA 3AVCA 1N6QB 3C16A 5KI6A 5J2MA 4CEQA 2PMHA 1S6QA 1E6YB 1EQ0A 5HN0A 1F9FA 4JP8A 4EP5A 3AAPA 1RTZA 1JK9B 1IVZA 3KTQA 4DR5K 1U1MA 4Y2CA 4B9TA 3CVKA 3ILOA 1R8PA 1B0VA 4HI2A 4ZS6A 4Q2MA 3PFOA 1O5JA 4CZLA 4JLHA 1BG3A 3MM6A 3PYFA 3O9RA 4WU3A 1CEZA 2QT7A 1VSMA 5CYJA 2ZH8A 1TL7A 2Z0GA 1XR5A 3PEHA 3AOBA 3W3SA 2DNPA 1KLMA 2QK9A 1Y5IB 1W9HA 1D09B 3R6MA 2Z4PA 3ZX2A 3G8SA 4XO0A 4O5FA 2WSCC 3O9SA 3P5JA 4DR2K 1P6TA 4AHSA 4JI3J 4DR4F 3VQTA 1IO2A 4HDHA 5GMDA 4LF6J 2J0SD 2RE1A 4BQZA 4KH0B 4P2SA 4F04B 3LZIA 3PG9A 4USJC 2HAIA 5A0YB 2NREA 4IOXA 1RE1B 4KTZA 3B6OA 1X4EA 2BH1A 3O08A 2R7UA 1XJWB 1TVRA 1VQSA 1ZAXA 4FCYA 3QICA 2DHSA 4XAKA 2BM0A 2JOQA 3CCUS 4M5GA 4Y0WA 1IR2A 4LH5A 2BKOA 2YNFB 3IWNC 5F1XA 2KHOA 1K8KB 4GV6A 1HD0A 2B9WA 3RWUA 5A0YA 2JDJA 3Q8RB 4DFKA 4I68A 1JLFA 1XR7A 4IQMA 1QZ5A 2CWKA 5AR0A 1NNDA 1C0TB 2X3DA 5M1PA 5HL7Q 2FLOA 2Z1JA 4P7VA 1CJKB 2IFXA 2AYEA 4I6MA 3E3XA 3CCRN 3IA0A 3V9XA 5THWA 5DO2A 2W41A 3G25A 5J1NA 2WB4A 2FGCA 2FJBB 3JQKA 2EC2A 2HVDA 3H45C 4M8LA 2J0WA 1N36J 4B3MJ 4KFBA 1DRZA 2N7CA 2JLEA 2GS8A 5EXWA 3S7RA 2VC0A 3NNAA 3UKRA 3MD3A 2IRYA 3M8WA 3UD5A 4DS5A 3ZETA 3BGRB 1GXLA 4CBWA 1OPIA 3SCKE 1IG9A 3O44A 1BUPA 3KKFA 3KK2A 1HHTP 2KRBA 4JI6J 3CG7A 4FWOA 1RWXB 3N6NA 1JLGA 1PILA 2FQQB 1VQPS 2F4VF 3MM6B 3IRWP 5IWAK 1WB9A 1UA0A 3VGTA 3D2EB 4Y65A 1LW0B 4O55A 3OJSA 1HWUA 2K06A 1Y00A 1F5CA 1ZBFA 1NH8A 3WEEA 5J1EB 3CMES 2FZGB 1JJ2M 4PAAA 3ZEUB 1RT3B 3R3LA 4WFBL 1TFYA 1NMDA 4LF8K 3I82A 1XMOK 4KHNA 5T41A 2I9SA 3C7NA 2ROPA 1FFGB 1C0MA 1UOCA 2DRBA 1WC5A 1AFIA 1GLDG 3L4IA 2FVRA 2AP1A 2WTUA 5GMKa 3T3FA 4FKYA 3E8OA 2N4DA 1ZPVA 3G2XA 3IUCA 3OTDA 2WBRA 5M2RA 3I6PA 2B7CB 2FDNA 4DPUA 1YSJA 4ED7A 1CZAN 1GLLO 1IQZA 2IIHA 5A8WA 2XY5A 4USVA 4LFCK 4DV7F 1XNQJ 4LQ3A