1WSIA

Crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGAGHPENERCNELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
source organism Escherichia coli
molecule tags Hydrolase
total genus 45
structure length 152
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsiA00
3KJVA 4AHRA 2KFNA 4DTPA 2KFZA 1GOCA 3NH2A 2XY6A 3I8DA 3LP1A 2OZMA 2HHXA 3DLKA 2PY5A 1RBVA 3OYNA 3IAYA 2HW3A 3LZIA 1NKCA 3CM6A 3AVBA 3LANA 3NF7A 3AO1A 3ZCMA 4CERA 4N56A 4JS4A 4CEBA 3SPZA 1BIZA 4FW2A 2D0BA 2HNDA 4FCYA 1QHTA 3KK2A 2BE2A 1TKZA 1KFSA 4KHQA 4CK2A 1Z25A 3KLFA 2X78A 4DLEA 4LH4A 3FFIA 4CIFA 1UA0A 4FM0A 4FK4A 4FW1A 4AHTA 3RMAA 4ELTA 4F2RA 4CHOA 3HO1A 3BDPA 3QEIA 1RT3A 4CIGA 1NOYA 1JXEA 1RTJA 3TAEA 1SKSA 5SWMA 1D8YA 1WSGA 3AA2A 3U6FA 5J1EA 4QOZB 3ISNC 1S9GA 1SUQA 3HXMA 3ZSYA 4C8NA 1BIUA 5HRNA 3JSMA 1HYVA 1TGOA 3LDSA 1RT6A 1U49A 3KLGA 3HJFA 2B6AA 2DTUA 2HVIA 3AA5X 3K5LA 3QNNA 1CLQA 4FLZA 3DRSA 1VSLA 4FZZA 4YFUA 3TANA 3V1RA 2YNFA 3K58A 4ELVA 3QERA 1BHLA 3S3NA 4O44A 3NF9A 2HHVA 1L3UA 3VQDA 2VWJA 3CG7A 3K5NA 1MU2A 3OYDA 3AV9A 4W5QA 4KRFA 4ZTJA 4I2PA 4CEQA 1VRUA 1ZBUA 1BQNA 4CFAA 3SPYA 4K8ZA 1WLJA 3EY1A 1TK8A 4Z4FA 1XC9A 1Q9YA 5CYMA 4I2QA 3NBPA 4W5RA 3KLHA 4DU4A 1C0MA 3KIOA 4ID5A 2YKMA 4R5PA 4EP5A 4IDKA 4DQRA 1C0UA 1VSHA 1NK0A 1LV5A 4I9QA 1LW2A 4Z4EA 2HHUA 1WAFA 3PO5A 1VSDA 3ZT0A 4CEFA 4DF4A 1EKEA 1JLGA 3QEVA 2YNHA 3TAGA 4CJEA 1IO2A 1EETA 3ITHA 4O55A 3ZSRA 1VSFA 3DOLA 4FJKA 3WNGA 2DFFA 3RMBA 1HQEA 2G8WA 4CFBA 4FJGA 1RNHA 2YKNA 1DTQA 4CJRA 3RRHA 2Y1JA 4OJRA 3L2WA 3OS0A 3HPHA 4JRQA 4BDPA 4IBNA 5JS1A 4N76A 4E7JA 1VSEA 1JLBA 3M8RA 3WNEA 3LAMA 4O0IA 3L2QA 4FK0A 1D9DA 1BI4B 4M3WA 2HHQA 1T05A 1LWCA 3LZJA 2G8FA 3NH1A 4M3TA 2P51A 4CEZA 4AHCA 3AVKA 1TAUA 1VSIA 4CGDA 2VG7A 3TAQA 4DF8A 3NDKA 4CHNA 5J2PA 3AO3A 3V9XA 1K6YA 1RT7A 4LH5A 1S6QA 1HMVA 3VQBA 4DU3A 3DLEA 2XRIA 1J9AA 2IDOA 3C94A 3S3MA 1BL3A 2O4GA 3UIQA 4CEAA 1BISA 3DLHA 1UOCA 3HYFA 4KFBA 3E01A 4C8MA 4FYDA 3V9SA 3DRRA 3K2PA 1TK0A 4DSLA 3KLEA 2HHSA 2O4IA 2YNGA 4B8CA 3PO4A 1KLNA 4KV8A 4Y1DA 3WNHA 1NK8A 3C6UA 4Z0UA 2RPIA 1ITGA 2Y1IA 4W5TA 4CEEA 4DSKA 3PX4A 5C24A 5J2QA 2X6NA 5J2NA 3VQ8A 2HB5A 4O4GA 2OPSA 1RT5A 4FJNA 3IS9A 3SV4A 2Q3SA 3PX0A 3SNNA 4BE2A 3VQ9A 1A5XA 4FLWA 1NJXA 3KD5E 4H8KA 1C0TA 1WSHA 1HQUA 1C1BA 1S1XA 4KHNA 4FJ8A 1YTUA 4CJVA 1JL2A 3KKRA 4H4MA 3DI6A 1L3TA 1RBSA 2P5GA 3KK3A 4J2BA 3LALA 3K59A 3CM5A 2OPRA 4DU1A 3QESA 1R0AA 1T8EA 4M3ZA 3VQ5A 4LD0A 3OYAA 3S9HA 3SV3A 3QO9A 2PYJA 4AHSA 1RT2A 3OYBA 3QIPA 3RR7A 3MEEA 1TAQA 2P1JA 4RW8A 1Q9XA 2RF2A 2DFEA 4KHYA 4IKFA 4B9LA 3V9ZA 2E6LA 1XWLA 3QLHA 3HPOA 2R7YA 1HRHA 2WONA 3AVGA 3T3FA 1CZ9A 2ATQA 3OY9A 3DYAA 3NCIA 5FRNA 2Z1JA 3JYTA 3T1AA 1X9WA 4N41A 3L2UA 3B6PA 4F8RA 1WN7A 3O4QA 3VQAA 4AHVA 1BQMA 1IG9A 3V1QA 4CK1A 4O5BA 3VQQA 1SL1A 1WSEA 1CZBA 3RTVA 4FJ5A 4CJSA 4DWIA 1REVA 1IKXA 1TKTA 3VQ6A 1QSLA 4G1QA 4BE0A 3OJUA 3G10A 4HUEA 4DG1A 3LPUA 3CFRA 2OA8A 2XY7A 3NHGA 4Z4IA 3O3GA 4MFBA 1L3SA 3NF6A 4HVJA 4CIEA 3C95A 3VQ7A 3OYFA 1ZBLA 2B4JA 1NK5A 1JLAA 2KW4A 3TAPA 4FLTA 1JXBA 2WOMA 3T19A 2JLEA 4HTUA 3I0RA 4K8XA 4OPKA 1WSIA 1EP4A 3A2FA 2D0AA 3M8PA 1HNVA 4FJHA 2F96A 3RMDA 1RTDA 4CGGA 3ZSZA 3SCXA 1BI4A 1F21A 1HNIA 3ZT4A 4CJWA 4C8LA 1HYZA 4E7HA 1S1WA 5HRSA 3SQ4A 5KRTA 4CGFA 1C6VA 3ZSQA 5DK5A 1C1AA 5C42A 1FK9A 4I9LA 4CJ5A 3SUQA 2ZE2A 3AA4A 4WE1A 1WNSA 1C1CA 2IAJA 2ITGA 3MEGA 4KKOA 3SQ2A 3SQ0A 5FDLA 4DSJA 1RBUA 4KHSA 2HNYA 4CEDA 1VRTA 1TKXA 1Q8IA 4JLHA 4OGEA 2EHGA 4FJ9A 3ZT2A 3HPGA 2ZQBA 4ZHRA 3RRGA 4CJUA 4KB0A 4LSLA 1UAXA 3HP9A 1NJZA 3OYEA 1J54A 4DSFA 3THVA 4GW6A 3OVNA 4PUOA 2XY8A 5KGXA 3K5OA 2IOCA 3ZSVA 5SZTA 1HJRA 2QK9A 4ID1A 3L3VA 4CESA 4DMNA 2HNZA 1UA1A 1RILA 1IKWA 4RW6A 1A5VA 1J53A 1WAJA 2HMIA 4FJMA 5J2MA 4CJ4A 2KTQA 4CHQA 2KZMA 4N5SA 3LWMA 2OPPA 2RKIA 1TVRA 3C6TA 4DTXA 4Z4GA 1DLOA 3VN5A 2HVHA 1KLMA 3VQCA 4CF1A 4M3YA 4ICLA 1W9HA 3V4IA 4OLAA 4CF8A 4DTMA 1EX4A 1JLFA 3TR8A 5K14A 2HHWA 4CJ3A 3OYLA 4FZYA 1A5WA 4GMJB 3SUPA 5I42A 1N6QA 5CZ2A 5E41A 3VA3A 4TSXA 4OLBA 2KZZA 1NJYA 4FM2A 4AHUA 2XO7A 4CE9A 4FJJA 3MAQA 4KTZA 3L2RA 3PUFA 5KTQA 4OPJA 4JS5A 4EZ6A 4PY5A 4E89A 3F73A 3OS1A 4CHZA 4OKEA 4PA1A 1X1PA 4E1NA 4XIUA 2BGGA 4QCLA 4NYFA 2BDPA 1BCMA 2P5OA 4B9NA 2FBYA 1CXQA 4BWMA 3I0SA 1SL2A 4Y1CA 4FK2A 4NCAA 4KHUA 4HCBA 1I3AA 1RTIA 4E19A 3NFAA 4CJPA 1HPZA 4CHYA 2XHBA 3OYIA 1SKRA 1FXXA 1BCOA 3IRXA 3LP0A 4LY7A 4F3OA 4M3UA 2BANA 3M8QA 4CCHA 1IKYA 3HVTA 1D9FA 4GVMA 4OKKA 4OVLA 1T03A 3ALYA 3ASMA 1J5OA 2G8VA 4FJXA 3SUOA 4CHPA 4KO0A 4B9TA 3RWUA 4DTRA 2I5JA 1NK7A 4KREA 1VK0A 4CF0A 3F9KA 1QS4A 3AVAA 4J2EA 4N47A 4KI6A 2Z1IA 4IG0A 5DMRA 2B5JA 3H08A 1SV5A 3HL8A 3LAKA 2KQ2A 2QXFA 4E3SA 4KTQA 1IKVA 2FBVA 4RW4A 3KK1A 4FLYA 3DLRA 4HUFA 4DTOA 1SL0A 3HSTB 4DTSA 1NKEA 1Y97A 2DFHA 3AO5A 3AVLA 3V6DA 1JLQA 4CGJA 4FLXA 3MXMA 4EP4A 3SI6A 3NE6A 1U4BA 3U3YA 4AILC 1RDCA 2FBTA 2G8HA 1D5AA 1S1TA 1XHXA 3SYZA 4FJ7A 1CXUA 4BWJA 1YTAA 4KAZA 4CGHA 3KTQA 2F8TA 1VSMA 4MQ3A 4W5OA 4DSEA 4B08A 4DLGA 4B9MA 1YVUA 3BGRA 3K5MA 3QINA 1G15A 3LWLA 3ZSXA 1LAWA 1KFDA 3AVMA 2OYQA 3L3UA 3O3HA 4CF9A 1RT4A 1U04A 4KHWA 4BE1A 4M45A 4DFPA 4RW7A 3HT3A 1S5JA 3OYKA 2YHBA 5C25A 3NAEA 2GBZA 1TKDA 3KD1E 2NUBA 3MECA 4EZ9A 4OGCA 1HYSA 3AVJA 4J2AA 5I3UA 4DTUA 3ZT3A 2PYLA 4E7LA 3QEWA 4DQSA 1Z26A 1NOZA 5KGWA 4DTNA 2GUIA 3D0PA 2IC3A 4BDYA 1O1WA 3OYGA 1QSYA 1RDAA 3TARA 3SJJA 1SKWA 3IG1A 5HRPA 3LPTA 1TL1A 5CZ1A 4JRPA 3DRPA 4E7IA 3PV8A 1RT1A 1T7PA 3QEXA 4BDZA 3MXJA 1KVCA 1QSSA 5FRMA 1ASWA 4ZTFA 4PQUA 1NK4A 1B9DA 2FBXA 3VQ4A 4ELUA 1FKPA 4FXDA 4B9SA 3KLIA 3ZT1A 4CGIA 1KTQA 3AVIA 3M8SA 1KCFA 3MEDA 3QNOA 4CJFA 1TV6A 4M42A 3CYMA 4IFVA 1QQCA 5EU7A 2YHAA 3AO2A 4CFDA 1YT3A 2X74A 3P1GA 4CF2A 1IH7A 5HRRA 5T7BA 4FLVA 1RBRA 2IS3A 2ZD1A 1JLEA 4H4OA 1ZBIA 3DOKA 1TK5A 2Z1HA 4HUGA 1S9EA 3AA3A 3DM2A 4I7FA 3AO4A 3HP6A 3V9UA 2ETJA 3V9WA 2OZSA 1U48A 4UQGA 3OYCA 3OYJA 3NF8A 3HM9A 1X9SA 3AVCA 2RN2A 2QKBA 4E7KA 5FROA 3U3GA 1L5UA 1KRPA 2JGUA 4KB1A 3S3OA 4FM1A 1VSKA 1I39A 3SQ1A 3CQ8A 1LWFA 3VQPA 1S1VA 1VSJA 1NKBA 1N5YA 3HK2A 4B8AB 1NJWA 3SUNA 4CJQA 5D3GA 4DS5A 1GOBA 1RBTA 3V1OA 4QAGA 2AJQA 1FKOA 4CFCA 5KI6A 5HBMA 3NH0A 3HVRA 4B9VA 4M3RA 4CJKA 1B92A 3TAMA 4CK3A 4FJLA 4F3TA 4KPYA 2VG5A 4HCCA 4Q0BA 2FC0A 2E6MA 2Z1GA 3LP3A 4CJLA 2A1RA 3QEPA 3VA0A 3NGYA 1B9FA 3V81A 4NCGA 4DQIA 2EX3A 2W42A 2YNIA 1NK9A 1ASUA 3NGIA 3DLBA 4LSNA 4C8KA 3O3FA 4DSIA 1DTTA 3OS2A 3OYHA 4C8OA 4Q5VA 1QE1A 4DFMA 4L8RB 3AVNA 3B6OA 3L2VA 4DFJA 3TAFA 3AVHA 4NYNA 1QTMA 1NK6A 4FZXC 4KI4A 4DTJA 3P5JA 3EZ5A 4FJIA 2E4LA 4B3OA 3TWHA 1KVBA 5JS2A 5KRSA 3OYMA 4Z4CA 1U47A 4M41A 4B9UA 5CYQA 4DS4A 3G0ZA 3AVFA 1JL1A 4AH9A 3KKSA 3ZSOA 4FLUA 3QETA 4PWDA 5HROA 2LSNA 4IG3A 4HHTA 3SZ2A 5CY4A 3L8BA 3VQEA 4M3XA 3NGZA 5HP1A 2D5RA 1KSPA 1S6PA 4OKJA 3ZSWA 4BACA 1ZBFA 1GOAA 3ULDA 1RTHA 4O0JA 3PX6A 1LWEA 3P83D 2HHTA 3LP2A 1RDBA 3PY8A 1RDDA 4IFYA 3WNFA 4DQPA 2VG6A 1KVAA 3RR8A 3OJSA 1ASVA 2GV9A 2QKKA 2IGIA 4CECA 2G8KA 1JLCA 3TI0A 3CFPA 4RG8A 1TL3A 4FVMA 2PZSA 1S1UA 1LAVA 3RMCA 3D45A 2G8IA 3EYZA 1EXQA 4F4KA 1UWBA 2D0CA 3CFOA 1ZYQA 5HLFA 1XHZA 3DLGA 2DY4A 1JKHA 2OPQA 4Z4HA 4RW9A 3QIOA 1W0HA 2X6SA 4W5NA 1BGXT 2G8UA 2YV0X 1XI1A 2VWKA 1WSJA 2A1SA 2XY5A 4DQQA 3DMJA 4E0DA 4CEOA 1U45A 1L3VA 4F2SA 3MXIA 1X9MA 1WSFA 3TABA 4NCBA 1ZBHA 2F8SA 1LW0A 4E1MA 3K57A 4YNQA 1RCHA 4CJTA 4DFKA 3O4NA 4J2DA 4KTWA
chains in the Genus database with same CATH superfamily
3KJVA 2KFZA 2KFNA 4JI6K 5F0XA 1GOCA 5DM6L 2XY6A 5E84A 3I8DA 3D2EB 3IAYA 3OYNA 4JS4A 4CERA 1FJGK 4CEBA 3SPZA 1Y64A 2UUAK 1W7AA 3KK2A 1Z25A 2X78A 4LH4A 4FW1A 4AHTA 3RMAA 2UU9K 5F2RA 3BDPA 2W6LA 5J1EA 3ISNC 1SUQA 3OHRA 5HRNA 1HYVA 1RT6A 5AZIB 1GLEG 4C1NK 3N4QA 1CLQA 1NBWA 3DRSA 4FZZA 2YNFA 1VQKN 4ELVA 4BRKA 2O8CA 3S3NA 3QICA 3QFUA 3QMLA 3CF5L 3K5NA 3AV9A 4W5QA 4ZTJA 3TSQA 3THXA 2HOEA 2ZJQL 3THYB 3CPEA 1BQNA 4Z4FA 4BQZA 3T7ZA 3GL1A 5CYMA 4FPBA 3NBPA 4W5RA 3IUCA 4R5PA 2YKMA 1S22A 2ZGZA 4EP5A 1I94K 2QWLA 1SS6A 1K8KA 1LW2A 2HHUA 3THWB 1WAFA 3PO5A 3QEVA 1D4XA 2P9SA 3DOLA 3CCUN 3VMFB 3WEEA 4FJGA 3RRHA 2Y1JA 2FF6A 4BDPA 4N76A 1JJ2M 1VSEA 2JWLA 3WNEA 1Z6RA 2E8AA 4FK0A 2IIRA 1T05A 2QW9A 4FOIA 3WXJA 3DXKA 4M3TA 4CEZA 4AHCA 5J2PA 1NGHA 1K6YA 4LH5A 4ISFA 3VQBA 1VQ4N 1TUUA 3C94A 4GV3A 4CEAA 3DLHA 4FWQA 4K41A 4FYDA 3K9JA 2CGKA 3KLEA 4UY8O 2HHSA 5FPDA 2QXLA 1KLNA 2QWOA 1ITGA 5ADXA 4LF5K 5C24A 2X6NA 3VQ8A 4O4GA 2OPSA 4M7XA 1BU6O 3PX0A 3KD5E 2A3ZA 4H5WA 3A0IX 4CJVA 1JL2A 3ZETB 3KK3A 3K59A 3D6RA 4M3ZA 3O9SA 3HOTA 3OYAA 1K9MO 4EHTA 3SV3A 3QO9A 4BG8A 2CH5A 4AHSA 4LF9K 1RT2A 1YAGA 5BN8A 4KHYA 2P9PB 3ENHA 3WXLA 3V9ZA 5AZIA 2WONA 2A40A 4NLBA 3ZX2A 3OY9A 2ATQA 3CCLN 3DYAA 2QI2A 2Z1JA 4F8RA 2HBLA 4G9ZA 5JICA 1QQNA 4BRHA 3EN9A 3V1QA 1R59O 1WSEA 3RTVA 4CJSA 1IKXA 1TKTA 4NB4A 2E5LK 4BE0A 3OJUA 4DG1A 1ATNA 1U2VB 3HTVA 3CFRA 4U7BA 3AARA 1L3SA 4HVJA 1E3MA 3THWA 3VQ7A 3CIPA 1RDUA 1JXBA 4OPKA 3A2FA 2D0AA 1N36K 2F96A 1K8AO 3A5LC 4CZFA 2GTDA 4E7HA 1XMQK 3JS6A 1C6VA 3VGKA 2ZE2A 3AA4A 2A5XA 4WE1A 1T3VA 4B1WB 4DSJA 3MEGA 4KKOA 5FDLA 1RBUA 4CEDA 1C0FA 1YIJN 1Q18A 2NZTA 3PSFA 2P9KB 3C65A 1IBKK 1UAXA 3THVA 4GW6A 4LFBK 2IOCA 3O1BA 3ZSVA 1HJRA 3H3NO 1UA1A 1IKWA 3SJHA 2HMIA 1WAJA 2KZMA 3ZETA 4N5SA 1TVRA 5BR8K 4Z4GA 2VCPA 4OLAA 4M3YA 2WC9A 1VHXA 2QTDA 4BC2A 3V4IA 1EX4A 3VF6A 3ZEUB 4HWIA 3HBTA 2ZWHA 1A5WA 5CZ2A 2I7PA 1ZBSA 1N32K 2P9PA 4AHUA 2XO7A 3JAMO 4FJJA 1YVNA 3L2RA 3BZCA 5HL7L 1V4SA 4CHZA 2ZGYA 1HNWK 4E1NA 2BGGA 5AQMA 4NYFA 3CERA 1YF5L 3O1WA 3TTDA 2FBYA 2J4RA 4JKFA 1QZ6A 2O8FB 5AQVA 1SL2A 4Y1CA 5AQTA 3UB5A 1YITN 1BWFO 5M1PA 4NCAA 2A6AA 4BR9A 3TSUA 4DCHA 4E19A 4CJPA 2XHBA 1FXXA 3IRXA 4F3OA 3LP0A 1OVYA 1EWRA 3I33A 1BG3A 4CCHA 3HVTA 3IDHA 1D9FA 2YHYA 1WOQA 4OVLA 4OKKA 4DR4K 2QEXN 3ASMA 4MLHA 4JKEA 4CHPA 3E9LA 2CGJA 4KREA 4DTRA 1VK0A 3F9KA 2QA4N 2F9WA 2VQEK 2B5JA 4KTQA 1IKVA 1QZ5A 3AVLA 1XUPO 4Z94A 4FLXA 2ASMA 3FZMA 2KHOA 3SI6A 1U4BA 2A42A 3BZKA 2P9KA 3HI0A 3SYZA 4FJ7A 1X3MA 1NGCA 4BWJA 4KAZA 1NJIO 2A41A 4MQ3A 4YOXA 4B9MA 4DLGA 4A61A 4K43A 3FR0A 3QINA 3LWLA 3L3UA 4CF9A 1O13A 4DFPA 4RW7A 1NGFA 3NAEA 3KD1E 4BR7A 2E2OA 3ZEUA 4DQSA 5KGWA 2NRVA 5KPRA 4BDYA 1QSYA 1S72N 2NNWA 5HRPA 1Q81O 2H3GX 3DRPA 3PV8A 3SAHA 4BDZA 4B3MK 1B9DA 3S41A 1FKPA 4FXDA 4B9SA 1KCFA 3QNOA 4CJFA 3H45C 2O8FA 3C0BA 4H0OA 4IFVA 1NMNA 3AO2A 1GLAG 3P1GA 1IH7A 5HRRA 1T6DA 2IS3A 2E1YA 4IZ9A 1JLEA 4K0KK 1YJNN 1TK5A 1S9EA 3DM2A 5M1NA 3AO4A 3VENA 2YJFA 3HP6A 3NVKA 2YI1A 4RTFD 3SAGA 3OYCA 3HM9A 4JYAK 3AVCA 3F5TA 3RVCA 3WUHA 1L5UA 3S3OA 3O6WA 4FM1A 3LM9A 1I39A 5EX5A 3CQ8A 1LWFA 2Q36A 3P39A 4O8UA 4PKIA 1T6CA 4GV9A 1WBDA 1GOBA 1RBTA 4GNIA 3LM2A 4JK9A 4QAGA 3WQTA 4CFCA 4A5AA 1ATRA 3NH0A 4M3RA 4KPYA 2E6MA 4DUYK 3SMSA 4CBXA 3VA0A 5LJWA 4H0TB 3NGIA 5FPMA 4C8KA 3OS2A 1HR0K 1W97L 3L2VA 3TAFA 3AVHA 1QTMA 1NK6A 2D1KA 4DUZK 2E4LA 4B3OA 3TWHA 3O5BA 4M63C 4M41A 5CYQA 4DS4A 4I6MB 3QETA 4AH9A 3KKSA 2E2QA 4IG3A 4HHTA 3L8BA 1KSPA 4AF1A 4DV7K 1YJ9N 1GOAA 2HHTA 5BRFA 4DV1K 3KK7A 3M1FA 4FWMA 2IGIA 5KPZA 2G8KA 1NGDA 2GUPA 4RG8A 2PZSA 4FVMA 5KQDA 3RMCA 4H5TA 2G8IA 1QQMA 5EVZA 5AR0A 2DY4A 1JKHA 3J7YP 4H03B 3QIOA 1N33K 1BOTO 1LOTB 2FF3B 3MK6A 1X9JA 1EQYA 1XI1A 1YXQA 2A1SA 4PKGA 3AY9A 4DQQA 3Q7CA 1U45A 3C6AA 2W40A 4X62K 3TABA 4NCBA 4CJ7A 4B1YB 1LW0A 4E1MA 3K57A 1RCHA 3EL2A 4J2DA 3RSEB 4DTPA 3AAQA 5AZJB 4IJNA 3HRGA 1RBVA 4CI6A 1NKCA 4N56A 1JCEA 3AO1A 1YUWA 1TKZA 2BE2A 1KFSA 3IKMA 4CIFA 4FM0A 4F2RA 4CHOA 2FSJA 3QEIA 2UUCK 1NOYA 1NG9A 4BRGA 1SZ2A 5JVHL 1D8YA 1WSGA 3AA2A 3U6FA 4QOZB 4A2AA 3ZSYA 3DLBA 1BIUA 3JSMA 1U49A 2QWPA 3O9QA 3HJFA 3K5LA 3VESA 4FLZA 4JHDB 1N34K 4OX9K 4EAHD 4O44A 3NF9A 1MDUB 2HHVA 1IV0A 2VWJA 5MLCQ 2FLOA 4JI3K 4BRNA 5JVGL 4KRFA 5FPEA 1VRUA 4K8ZA 3SPYA 2Q1NA 1TK8A 4LF6K 4I6MA 4I2QA 3KLHA 3CCRN 1C0MA 5BREA 1C0UA 1LV5A 2VQFK 4Z4EA 1VSDA 3ZT0A 3TAGA 1IO2A 3ITHA 3FE1A 4O55A 4PL8A 3ZSRA 2DFFA 2G8WA 1DTQA 3ENBA 4CJRA 5JS1A 4OJRA 3L2WA 3HPHA 4BR0A 4IBNA 4E1JA 3M8RA 4O0IA 1D9DA 2F4VK 4IEEA 4B3TK 1LWCA 3TU5A 3AVKA 3AO3A 3V9XA 2E2PA 1RT7A 4DU3A 1S6QA 1VQLN 2XRIA 2IDOA 1BL3A 1UOCA 3V9SA 4JKAA 4JI7K 2O4IA 2YNGA 3DAWA 2RPIA 4CEEA 1QVFM 1K8KB 5AZJA 4FSVA 2HB5A 5AQUA 1RT5A 4MO5A 3QBXA 4Y0WA 3SV4A 4BE2A 3VQ9A 1A5XA 1NJXA 4H8KA 1WSHA 1HQUA 1C1BA 3E9PA 3WEEB 3CC4N 4H4MA 5AQQA 4BVPA 4J2BA 4DU1A 5BPMA 3MWTA 4DQ8A 1VQ7N 3MEEA 1TAQA 1QHAA 2P1JA 4RW8A 3TTCA 4IKFA 4XH1A 3HPOA 4EHUA 3NCIA 5FRNA 5AQSA 3PLAA 1J5EK 3JYTA 3T1AA 4N41A 3L2UA 3B6PA 1WN7A 3O4QA 3CETA 4JKDA 4CK1A 1SL1A 4DWIA 1REVA 1QSLA 4H5NA 3G10A 4HUEA 3LPUA 3J81O 1BUPA 1GLDG 4JKGA 3W0LA 5KPTA 4IOXA 2ZJPL 3O3GA 4Z4IA 4MFBA 2HBKA 3C95A 3BY5A 3HSCA 3DJCA 1JLAA 3TAPA 4FLTA 3BP8A 2JLEA 3I0RA 4JNEA 4K8XA 1WSIA 1EP4A 1NGIA 4FJHA 2QWMA 5C2DA 1RTDA 4DV2K 3SCXA 3KWGA 1ZXOA 4C8LA 1YI2N 4IDHA 5A2QO 4YOUA 5HRSA 3KVGA 4CGFA 2ASOA 1FK9A 3UKUB 3G71N 2GX9A 1C1CA 3CXCM 4KHSA 3ID8A 2HNYA 4BC4A 1QQOA 1Q8IA 3CQXA 4OGEA 3OTOK 3J7AP 3W3DA 2ZQBA 5AQOA 4ZHRA 3RRGA 3M3ZA 2Q31A 4KB0A 4V19S 4NXMK 3FZFA 3OYEA 1J54A 3WQUA 4DSFA 3OVNA 4PUOA 2XY8A 3DLLL 2RE2A 3K5OA 3L4QA 1GLBG 3L3VA 4DMNA 1S3XA 2CGLA 1RILA 1A5VA 4FJMA 4CJ4A 2O8EA 4CHQA 5BR9A 3LWMA 3C6TA 4O5FA 1NGJA 4ICLA 1W9HA 4JKHA 4DTMA 4CJ3A 1BDGA 4KBOA 4GMJB 4FZYA 3VA3A 3FLCO 3MAQA 3OW2M 4JS5A 5KTQA 4OPJA 4PY5A 1HLUA 4RWTA 3E1YA 3F73A 2QWRA 3MCAB 4QCLA 2BDPA 1BCMA 3MN6A 2P5OA 2I7NA 3T69A 4BC5A 5C10A 1CXQA 4NO7A 4HCBA 3ZLJA 3NFAA 1SKRA 4LY7A 1IKYA 1IJJA 4GVMA 3SUOA 4WYBA 3F9MA 2P9NB 1NK7A 4J2EA 1NWKA 4KI6A 2O8BA 3HL8A 4R79A 3BUZB 3UKUA 3ZX3A 3HSTB 1NKEA 2DFHA 3LL3A 4H0XB 1OH6A 3ENOA 3SAFA 4AILC 1S1TA 1XHXA 2V7ZA 1YTAA 4CGHA 3KTQA 2QWNA 4W5OA 4DSEA 1YVUA 1SAZA 3VGMA 4IWVA 1RGIA 3ZSXA 3G25A 1KFDA 2OYQA 1RT4A 4BE1A 4M45A 1IBLK 1S5JA 1TKDA 2YHBA 5C25A 2GWKA 4OGCA 3VPZA 2GWJA 2PYLA 2W41A 3BF1A 4KHPK 3CJBA 4DTNA 2NRWA 3CCJN 4CZJA 3OYGA 1RDAA 3TARA 3SJJA 3IG1A 5CZ1A 1TL1A 2WTUA 1HKGA 3O9RA 1QSSA 4PQUA 1NK4A 2PAVA 2YX6A 3M8SA 3AVIA 3QB0A 2IVNA 3E9OA 1QQCA 5EU7A 1YT3A 4FOEA 2X74A 3E66A 5C0YA 4JK8A 4BG9A 4CF2A 3O9TA 4BREA 1ZBIA 2Z1HA 4HUGA 3AA3A 4I7FA 3V9UA 3ZYYX 2P9LA 3C6HA 3OYJA 1GLCG 5EXWA 3MN9A 2RN2A 5FROA 3T1HK 4A2BA 2P9NA 1NKBA 1NJWA 3V1OA 2AJQA 2FSKA 4OO1J 4B9VA 3TAMA 2W6KA 2VG5A 2FC0A 4LC9B 4CJLA 4IOCL 3CHWA 1B9FA 3CCVN 4DQIA 1NK9A 5ADXH 4CD3A 5LY3A 2UYTA 1DTTA 1ZC6A 4DFMA 5LL6Z 4NYNA 5M1OA 5GAHP 1KAXA 4CW7B 4DR6K 2FXUA 3P5JA 3EZ5A 4B9UA 2VGMA 1JL1A 2HMPA 3SZ2A 4ISEA 5F1XA 3ID6A 1VQNN 1S6PA 4OKJA 3ZSWA 4O0JA 1LWEA 3GDQA 3PY8A 2EWSA 1KVAA 3RR8A 1RDWX 3L6QA 4WF9L 1TL3A 3CD6N 1S1UA 1LAVA 3D45A 3EYZA 1EXQA 4F4KA 3CI5A 1XHZA 2ASPA 2OPQA 4X66K 2X6SA 3EKSA 3QDKA 4AQYK 2YV0X 3MMVA 1WSJA 4YDUC 4E0DA 4CEOA 3MXIA 1X9MA 2HSTA 4IOAL 4AHRA 4IO9L 3NH2A 3SBTA 2OZMA 3FGUA 2HHXA 2PY5A 4B3RK 3AVBA 3LANA 3NF7A 4MDBA 2RHKA 4FW2A 2D0BA 3KLFA 5TKYA 5AFUH 4A5BA 4FK4A 4B1UB 2UUBK 4BC3A 3HO1A 2QM1A 4CIGA 3UKRA 1SKSA 4BY9C 4L3QA 4RCHA 4BR5A 2OTLN 5AQGA 2BTFA 3KLGA 3TPQA 2B6AA 4JV5K 2DTUA 4H0PA 4BGBA 3QNNA 1VSLA 3V1RA 3K58A 4CZLA 1KAYA 2E20A 3VTHA 1BHLA 3CC7N 1L3UA 3VQDA 5ELZA 3OYDA 4CEQA 1ZBUA 4LF8K 3R9PA 1Q9YA 2Q0RA 5GAEP 4LFCK 3VF4A 5GADP 4FWSA 4YORA 1LCUA 4IDKA 4DQRA 1VSHA 4NXNK 4DF4A 5FLXO 4CJEA 4FJKA 3RMBA 1HQEA 4CFBA 1RNHA 2YKNA 4IO8A 3CPWM 4K42A 3OS0A 4JRQA 4DR1K 4DR5K 4E7JA 3EO3A 5I9EB 5M1KA 3L2QA 3LAMA 5IWAK 1BI4B 4ISGA 2HHQA 1Q7YO 2Q97A 3NH1A 2P51A 4BR4A 5BRHA 4ILHA 4XH5A 1OH5A 4JD2B 4CGDA 4CHNA 3H3OB 3DLEA 1J9AA 3N4PA 2O4GA 1BISA 4KFBA 3E01A 1K73O 4MDAA 1TYQB 1TK0A 1HJOA 3MWPA 4Y1DA 3WNHA 3HM8A 3C6UA 4Z0UA 2Y1IA 4JKCA 4DSKA 3I8BA 3PX4A 1Q86O 2UXBK 5J2NA 3ULEB 3K9KA 3SNNA 3CJCA 1E4GT 2Q0UA 2V52B 3R1XA 2HF4A 1C0TA 3VEZA 4FJ8A 3U9DA 3KKRA 1RBSA 4LF4K 3CM5A 1R0AA 3UE5A 4YOTA 3LDQA 3OYBA 4BGAA 3RR7A 1Q9XA 1NGEA 4ILGB 4B9LA 1XWLA 3QLHA 3C7NA 5CHIA 1VQ6N 5CR4A 3VEXA 3I55N 1X9WA 1BQMA 5H1SQ 3VQQA 3WXIA 1CZBA 4FJ5A 3IMXA 5AJ3K 3PIOL 3VQ6A 4YOWA 4G1QA 2OA8A 3NHGA 1DKGD 5BRDA 5DM7L 2B4JA 4IFEA 1NK5A 1XC3A 4FL9A 3T19A 2PFUA 4DV0K 3M8PA 1HNVA 4WQ5A 3RMDA 4CZMA 1VQMN 1BI4A 1HYZA 1S1WA 5KRTA 4JD2A 3ZSQA 1C1AA 5C42A 4I9LA 2PBDA 4CJ5A 2P9UB 3G4SN 3SUQA 1M1KO 2OTJN 5AQPA 1U6ZA 3ATVA 2YHWA 2EHGA 4FJ9A 1TYQA 3ZT2A 3VEOA 4WQ4A 4QS8A 4B1ZA 4JKGB 2V51B 1NJZA 4BRQA 3ULEA 5SZTA 2QK9A 2NLXA 4ID1A 3NMUA 2HNZA 2NRZA 1BA0A 4RW6A 4FWPA 5LJVA 5J2MA 2KTQA 2OPPA 2RKIA 4DTXA 1DLOA 3JXUA 4CF1A 3VQCA 1JLFA 3TR8A 3A5NC 2HHWA 3OYLA 4WQ5C 5I42A 4MO4A 1NJYA 4FM2A 1KQSM 4CE9A 1OVQA 4KTZA 3KHYA 3VEWA 4GVEA 3OS1A 4OKEA 3DWLA 4PA1A 1NLVA 2UXCK 1JCFA 3O80A 1KC8O 3I0SA 4FWKA 4WQ4C 4FK2A 3CMAN 3AGRA 1I3AA 3MN5A 1NGBA 3CCMN 3M8QA 2O8EB 3TTFA 3ALYA 1J5OA 2G8VA 5AQNA 3CQYA 4FJXA 2ITMA 1NU0A 2NRTA 4KO0A 5AQJA 3P4IA 1T44A 2I5JA 4CF0A 1IBMK 1OH8A 4N47A 1P90A 2Z1IA 4IG0A 5DMRA 3H08A 1SQKA 3AAPA 3LAKA 4H5VA 2KQ2A 2QXFA 4BRLA 2FBVA 2O8DB 4FLYA 2P9UA 4DTOA 2KKZA 3R3LA 3VEYA 4DTSA 5C15A 4BVOA 4FWRA 3AO5A 2WUSA 2QWQA 3H1VX 4CGJA 4EP4A 5JMVA 3U3YA 3NVMA 4EFHA 1RDCA 3G6EN 2FBTA 1WBBA 2G8HA 1D5AA 4CBUA 1VSMA 4FWNA 3D7EO 2CH6A 3TSPA 5GIPA 3BGRA 2E88A 3K5MA 4QS9A 3AVMA 3O3HA 4DR3K 1U04A 4KHWA 3HT3A 3OYKA 2GBZA 3L0QA 4EZ9A 3AVJA 3CJ1A 3QEWA 4FO0A 2O8BB 3MN7A 1NOZA 1O1WA 3VOVA 3LPTA 4DHYA 1T7PA 4E7IA 3KZBA 1RT1A 3QEXA 4C1NI 4O8KA 1KVCA 5FRMA 2HBJA 2FBXA 3VQ4A 4ELUA 3KLIA 3ZT1A 4CGIA 4YHHK 3MEDA 4FWOA 2AP1A 4M42A 3D2FA 3CJAA 4NLCA 4BR2A 3O4WA 1FW6A 4FLVA 5T7BA 4YY3K 4H4OA 3A8YA 3V9WA 4UQGA 2YJEA 3NF8A 1XNQK 1X9SA 2QKBA 3U3GA 1HKBA 3BEXA 3HK2A 4B8AB 1YJWN 1HNXK 3SUNA 4CJQA 3FZKA 5D3GA 4DS5A 1FKOA 3CC2N 1ESVA 1JCGA 3HVRA 4CK3A 1B92A 2O8DA 2D0OA 3KWIA 4F3TA 3MDQA 3VETA 4Q0BA 3LP3A 4JI2K 2A1RA 3QEPA 3NGYA 4WCEL 3V81A 4NCGA 3J80O 4B3SK 2W42A 2YNIA 3H46O 4OPAA 1ASUA 1KAZA 3O3FA 4C8OA 4IJAA 4Q5VA 3EE8A 1QE1A 3AGKA 4MLEA 3AVNA 4L8RB 4DFJA 3J8AA 4FZXC 2P9LB 4FJIA 1KVBA 4H0YB 5JS2A 3OYMA 4WFNL 5BPNA 1YHQN 3AVFA 4BRMA 1ILYA 5CY4A 2ZM6K 4M3XA 5HOOA 4DKWA 4QS7A 5KQ8A 3D2EA 4YOYA 4BACA 1HPMA 1ZBFA 3T1YK 2E2NA 5LMNK 1WUAA 1RTHA 3ULDA 3P83D 1RDBA 4IFYA 4DQPA 4K25A 3OJSA 2QKKA 2GV9A 3OBWA 1IG8A 4BRDA 4CECA 4JI4K 1WB9A 4A57A 2WFBA 4FVUA 3CFOA 1ZYQA 4GV6A 4A59A 1NGAA 2VWKA 2ZF5O 4F2SA 2JWKA 1WSFA 1ATSA 3FZHA 4KTWA 3THYA 4KH5A 1J6ZA 3LP1A 3DLKA 2HW3A 1XQSC 3LZIA 3CM6A 3ZCMA 1BIZA 3VGLA 4FCYA 2HNDA 1QHTA 3OBYA 4BRPA 4KHQA 5AQYA 4CK2A 4DLEA 2NRHA 3FFIA 2WBNA 1UA0A 3LDOA 1VAZA 2VGNA 4DV4K 4ELTA 1RT3A 1JXEA 1RTJA 3TAEA 5SWMA 3EE9A 1S9GA 3HXMA 3LDSA 4C8NA 1TGOA 3LDLA 2HVIA 3AA5X 5JLFA 4BRCA 4YFUA 3TANA 5AFUA 3QERA 3CG7A 1MU2A 4I2PA 4CFAA 3J7ZO 1WLJA 3EY1A 1XC9A 4DU4A 3KIOA 4ID5A 1VQPN 1VQ9N 1NK0A 3CCQN 4I9QA 3IFRA 4CEFA 1EKEA 1JLGA 2YNHA 1EETA 1VSFA 3WNGA 3UKRB 3M6GA 4CZHA 1DT9A 1KXPA 1DEJA 1JLBA 4M3WA 5BPLA 1NNEA 3I56N 3LZJA 2G8FA 1HX1A 4YDUA 2YHXA 4BQLA 4BRFA 1TAUA 1VSIA 5GIOA 2VG7A 3TAQA 4B1VA 4DF8A 3NDKA 3WXKA 1HMVA 3S3MA 3UIQA 3U8XA 3WT0A 3HYFA 4C8MA 4A62A 2NRRA 3DRRA 3K2PA 4DSLA 2FSNA 4B8CA 3PO4A 4KV8A 1NK8A 4W5TA 4AM6A 5J2QA 1GLFO 1U2VA 4FJNA 3IS9A 2Q3SA 4FLWA 4KHNA 4AM7A 1S1XA 2AA4A 1YTUA 3PSIA 3HOSA 3DI6A 3R8EA 1L3TA 2P5GA 3LALA 4PHTX 1QVGM 3QESA 2OPRA 1T8EA 3VQ5A 4LD0A 2D4WA 3HZ6A 3A5OC 3S9HA 2PYJA 1E4FT 5M1QA 3QIPA 2RF2A 3R6MA 2DFEA 2E6LA 2R7YA 1HRHA 3AVGA 3T3FA 1CZ9A 1HKCA 3SBGA 1GLJO 1HUXA 4J8FA 3VQAA 4AHVA 2HF3A 1IG9A 1OKJA 4O5BA 1CZAN 3DXMB 3B8AX 4X64K 4U67L 1G99A 2XY7A 4H0VB 3FZLA 2BH1A 4M7YA 1H1VA 2F7TA 3NF6A 1BA1A 4CIEA 5AQLA 3OYFA 1ZBLA 1W2BM 2KW4A 2WOMA 2UXDK 4HTUA 4DFKA 4ILJA 5C2FA 2YCHA 4JN4A 4CGGA 3VERA 3H6EA 3ZSZA 1F21A 1HNIA 3ZT4A 4CJWA 3C7NB 3SQ4A 4LF7K 4XEIA 4DV6K 5DK5A 4JKBA 1OH7A 1WNSA 2IAJA 2ITGA 3ATUA 5C12A 3SQ2A 3SQ0A 1V4TA 4DV5K 1VRTA 1TKXA 1TUYA 4JLHA 4JK7A 1HNZK 3VTIA 3U4LA 3HPGA 4LFAK 4KH4A 3QFPA 4CJUA 5AQZA 4LSLA 3HP9A 3SMPA 4F9OA 2GELA 4GKKK 5KGXA 2ZJRL 2Q2RA 3H1QA 4CESA 3K0SA 5AQXA 1M90O 1J53A 1NMDA 4BROA 2KLAA 4JI8K 3VN5A 2HVHA 3MX2A 1KLMA 5GAGP 4CF8A 5TKWA 5K14A 4H5RA 3GG4A 3SLCA 3SUPA 1N6QA 3U9ZA 5E41A 4TSXA 4OLBA 2KZZA 3VF2A 3GBTA 3PUFA 4EZ6A 3GOIA 4E89A 4DV3K 1X1PA 5B8HA 4XIUA 4B9NA 2NRXA 1GLLO 3BF3A 1X3NA 3DXMA 3LDNA 4BWMA 4X65K 1N8RO 4FPAA 2BUPA 4KHUA 4JI1K 1RTIA 2E1ZA 1HPZA 4CHYA 3OYIA 1KD1O 1BCOA 4DR2K 4M3UA 5EY4A 1BO5O 2BANA 3LDPA 1T03A 4WFBL 1P8ZA 5FPNA 1XMOK 2IVPA 4B9TA 3RWUA 4DR7K 1QS4A 3AVAA 4EIAA 5AQFA 4CZGA 4WFAL 5JLHA 1SV5A 4E3SA 1NM1A 1MWMA 4CD1A 4RW4A 3KK1A 1SL0A 3DLRA 4HUFA 4JI5K 1Y97A 1DGKN 3CMEN 3V6DA 1JLQA 3GE1A 3O9UA 3CCSN 3MXMA 1VQ8N 3NE6A 3FFKB 4IXCA 2V7YA 3SK3A 2F9TA 5LMUK 1CXUA 1VQ5N 2GEMA 2F8TA 2VWBA 3WXMB 4B08A 5CE3A 1G15A 4PKHA 1LAWA 3VEVA 4PL7A 3P38A 2D0PA 4JI0K 2NUBA 1RFQA 3MECA 1HYSA 4J2AA 5I3UA 4DTUA 3ZT3A 2OANA 4E7LA 1Z26A 3EZWA 2GUIA 3D0PA 1VQON 2IC3A 5AQHA 1SKWA 4JRPA 3P31A 3O8MA 4CBWA 5BN9A 3MXJA 1ASWA 4ZTFA 1Z05A 3M5RA 4CVNE 1KTQA 4OPHA 4JAXA 1TV6A 3CYMA 2YHAA 4CFDA 2DPNA 2P9IB 5AQWA 1RBRA 2ZD1A 4YOVA 3DOKA 4KH6A 4DB3A 2ETJA 2OZSA 1U48A 4E7KA 1KRPA 4KB1A 2JGUA 1VSKA 3SQ1A 3VQPA 1S1VA 1VSJA 3OA9A 1N5YA 3CJ7A 5EOYA 4C23A 4CZEA 4HTLA 5M1FA 3F2KA 5KI6A 5HBMA 4FJLA 4CJKA 4GKJK 4HCCA 4B9QA 2Z1GA 3ZX0A 4IEIA 2EX3A 3D2FB 3EEQA 4LSNA 4DSIA 3OYHA 2OCEA 2O8CB 3B6OA 3EKUA 4GY2B 1XNRK 4XH4A 4KI4A 4DTJA 5AQIA 3MX5A 4B1XB 3THXB 5KRSA 1Q82O 3O08A 4CZKA 4Z4CA 1U47A 1EO1A 3G0ZA 4PWDA 4FLUA 3ZSOA 5HROA 2LSNA 3Q7BA 3VQEA 3RSEA 3NGZA 5HP1A 2D5RA 3PIPL 3L4IA 1NGGA 3A5MC 1MA9B 2P9SB 3PX6A 5AQRA 3LP2A 1RDDA 5E26A 3WNFA 2VG6A 5AQKA 1ASVA 4JEPA 2VYPA 1JLCA 4CZIA 3TI0A 3CFPA 1C0GA 1EWQA 1UWBA 2D0CA 3DXKB 5HLFA 3DLGA 4Z4HA 5GINA 5IT9O 4RW9A 2IVOA 1W0HA 4W5NA 1BGXT 2G8UA 2P9IA 2XY5A 3DMJA 3MCPA 3CCEN 1L3VA 4JHDA 4BRIA 4FWLA 3CJ9A 2HHHK 1ZBHA 2HBMA 2F8SA 4BRAA 4YNQA 4CJTA 1MWKA 3O4NA 3QBWA
chains in the Genus database with same CATH topology
3KJVA 4AHRA 2KFNA 4DTPA 2KFZA 1GOCA 3NH2A 2XY6A 3I8DA 3LP1A 2OZMA 2HHXA 3DLKA 2PY5A 1RBVA 3OYNA 3IAYA 2HW3A 3LZIA 1NKCA 3CM6A 3AVBA 3LANA 3NF7A 3AO1A 3ZCMA 4CERA 4N56A 4JS4A 4CEBA 3SPZA 1BIZA 4FW2A 2D0BA 2HNDA 4FCYA 1QHTA 3KK2A 2BE2A 1TKZA 1KFSA 4KHQA 4CK2A 1Z25A 3KLFA 2X78A 4DLEA 4LH4A 3FFIA 4CIFA 1UA0A 4FM0A 4FK4A 4FW1A 4AHTA 3RMAA 4ELTA 4F2RA 4CHOA 3HO1A 3BDPA 3QEIA 1RT3A 4CIGA 1NOYA 1JXEA 1RTJA 3TAEA 1SKSA 5SWMA 1D8YA 1WSGA 3AA2A 3U6FA 5J1EA 4QOZB 3ISNC 1S9GA 1SUQA 3HXMA 3ZSYA 4C8NA 1BIUA 5HRNA 3JSMA 1HYVA 1TGOA 3LDSA 1RT6A 1U49A 3KLGA 3HJFA 2B6AA 2DTUA 2HVIA 3AA5X 3K5LA 3QNNA 1CLQA 4FLZA 3DRSA 1VSLA 4FZZA 4YFUA 3TANA 3V1RA 2YNFA 3K58A 4ELVA 3QERA 1BHLA 3S3NA 4O44A 3NF9A 2HHVA 1L3UA 3VQDA 2VWJA 3CG7A 3K5NA 1MU2A 3OYDA 3AV9A 4W5QA 4KRFA 4ZTJA 4I2PA 4CEQA 1VRUA 1ZBUA 1BQNA 4CFAA 3SPYA 4K8ZA 1WLJA 3EY1A 1TK8A 4Z4FA 1XC9A 1Q9YA 5CYMA 4I2QA 3NBPA 4W5RA 3KLHA 4DU4A 1C0MA 3KIOA 4ID5A 2YKMA 4R5PA 4EP5A 4IDKA 4DQRA 1C0UA 1VSHA 1NK0A 1LV5A 4I9QA 1LW2A 4Z4EA 2HHUA 1WAFA 3PO5A 1VSDA 3ZT0A 4CEFA 4DF4A 1EKEA 1JLGA 3QEVA 2YNHA 3TAGA 4CJEA 1IO2A 1EETA 3ITHA 4O55A 3ZSRA 1VSFA 3DOLA 4FJKA 3WNGA 2DFFA 3RMBA 1HQEA 2G8WA 4CFBA 4FJGA 1RNHA 2YKNA 1DTQA 4CJRA 3RRHA 2Y1JA 4OJRA 3L2WA 3OS0A 3HPHA 4JRQA 4BDPA 4IBNA 5JS1A 4N76A 4E7JA 1VSEA 1JLBA 3M8RA 3WNEA 3LAMA 4O0IA 3L2QA 4FK0A 1D9DA 1BI4B 4M3WA 2HHQA 1T05A 1LWCA 3LZJA 2G8FA 3NH1A 4M3TA 2P51A 4CEZA 4AHCA 3AVKA 1TAUA 1VSIA 4CGDA 2VG7A 3TAQA 4DF8A 3NDKA 4CHNA 5J2PA 3AO3A 3V9XA 1K6YA 1RT7A 4LH5A 1S6QA 1HMVA 3VQBA 4DU3A 3DLEA 2XRIA 1J9AA 2IDOA 3C94A 3S3MA 1BL3A 2O4GA 3UIQA 4CEAA 1BISA 3DLHA 1UOCA 3HYFA 4KFBA 3E01A 4C8MA 4FYDA 3V9SA 3DRRA 3K2PA 1TK0A 4DSLA 3KLEA 2HHSA 2O4IA 2YNGA 4B8CA 3PO4A 1KLNA 4KV8A 4Y1DA 3WNHA 1NK8A 3C6UA 4Z0UA 2RPIA 1ITGA 2Y1IA 4W5TA 4CEEA 4DSKA 3PX4A 5C24A 5J2QA 2X6NA 5J2NA 3VQ8A 2HB5A 4O4GA 2OPSA 1RT5A 4FJNA 3IS9A 3SV4A 2Q3SA 3PX0A 3SNNA 4BE2A 3VQ9A 1A5XA 4FLWA 1NJXA 3KD5E 4H8KA 1C0TA 1WSHA 1HQUA 1C1BA 1S1XA 4KHNA 4FJ8A 1YTUA 4CJVA 1JL2A 3KKRA 4H4MA 3DI6A 1L3TA 1RBSA 2P5GA 3KK3A 4J2BA 3LALA 3K59A 3CM5A 2OPRA 4DU1A 3QESA 1R0AA 1T8EA 4M3ZA 3VQ5A 4LD0A 3OYAA 3S9HA 3SV3A 3QO9A 2PYJA 4AHSA 1RT2A 3OYBA 3QIPA 3RR7A 3MEEA 1TAQA 2P1JA 4RW8A 1Q9XA 2RF2A 2DFEA 4KHYA 4IKFA 4B9LA 3V9ZA 2E6LA 1XWLA 3QLHA 3HPOA 2R7YA 1HRHA 2WONA 3AVGA 3T3FA 1CZ9A 2ATQA 3OY9A 3DYAA 3NCIA 5FRNA 2Z1JA 3JYTA 3T1AA 1X9WA 4N41A 3L2UA 3B6PA 4F8RA 1WN7A 3O4QA 3VQAA 4AHVA 1BQMA 1IG9A 3V1QA 4CK1A 4O5BA 3VQQA 1SL1A 1WSEA 1CZBA 3RTVA 4FJ5A 4CJSA 4DWIA 1REVA 1IKXA 1TKTA 3VQ6A 1QSLA 4G1QA 4BE0A 3OJUA 3G10A 4HUEA 4DG1A 3LPUA 3CFRA 2OA8A 2XY7A 3NHGA 4Z4IA 3O3GA 4MFBA 1L3SA 3NF6A 4HVJA 4CIEA 3C95A 3VQ7A 3OYFA 1ZBLA 2B4JA 1NK5A 1JLAA 2KW4A 3TAPA 4FLTA 1JXBA 2WOMA 3T19A 2JLEA 4HTUA 3I0RA 4K8XA 4OPKA 1WSIA 1EP4A 3A2FA 2D0AA 3M8PA 1HNVA 4FJHA 2F96A 3RMDA 1RTDA 4CGGA 3ZSZA 3SCXA 1BI4A 1F21A 1HNIA 3ZT4A 4CJWA 4C8LA 1HYZA 4E7HA 1S1WA 5HRSA 3SQ4A 5KRTA 4CGFA 1C6VA 3ZSQA 5DK5A 1C1AA 5C42A 1FK9A 4I9LA 4CJ5A 3SUQA 2ZE2A 3AA4A 4WE1A 1WNSA 1C1CA 2IAJA 2ITGA 3MEGA 4KKOA 3SQ2A 3SQ0A 5FDLA 4DSJA 1RBUA 4KHSA 2HNYA 4CEDA 1VRTA 1TKXA 1Q8IA 4JLHA 4OGEA 2EHGA 4FJ9A 3ZT2A 3HPGA 2ZQBA 4ZHRA 3RRGA 4CJUA 4KB0A 4LSLA 1UAXA 3HP9A 1NJZA 3OYEA 1J54A 4DSFA 3THVA 4GW6A 3OVNA 4PUOA 2XY8A 5KGXA 3K5OA 2IOCA 3ZSVA 5SZTA 1HJRA 2QK9A 4ID1A 3L3VA 4CESA 4DMNA 2HNZA 1UA1A 1RILA 1IKWA 4RW6A 1A5VA 1J53A 1WAJA 2HMIA 4FJMA 5J2MA 4CJ4A 2KTQA 4CHQA 2KZMA 4N5SA 3LWMA 2OPPA 2RKIA 1TVRA 3C6TA 4DTXA 4Z4GA 1DLOA 3VN5A 2HVHA 1KLMA 3VQCA 4CF1A 4M3YA 4ICLA 1W9HA 3V4IA 4OLAA 4CF8A 4DTMA 1EX4A 1JLFA 3TR8A 5K14A 2HHWA 4CJ3A 3OYLA 4FZYA 1A5WA 4GMJB 3SUPA 5I42A 1N6QA 5CZ2A 5E41A 3VA3A 4TSXA 4OLBA 2KZZA 1NJYA 4FM2A 4AHUA 2XO7A 4CE9A 4FJJA 3MAQA 4KTZA 3L2RA 3PUFA 5KTQA 4OPJA 4JS5A 4EZ6A 4PY5A 4E89A 3F73A 3OS1A 4CHZA 4OKEA 4PA1A 1X1PA 4E1NA 4XIUA 2BGGA 4QCLA 4NYFA 2BDPA 1BCMA 2P5OA 4B9NA 2FBYA 1CXQA 4BWMA 3I0SA 1SL2A 4Y1CA 4FK2A 4NCAA 4KHUA 4HCBA 1I3AA 1RTIA 4E19A 3NFAA 4CJPA 1HPZA 4CHYA 2XHBA 3OYIA 1SKRA 1FXXA 1BCOA 3IRXA 3LP0A 4LY7A 4F3OA 4M3UA 2BANA 3M8QA 4CCHA 1IKYA 3HVTA 1D9FA 4GVMA 4OKKA 4OVLA 1T03A 3ALYA 3ASMA 1J5OA 2G8VA 4FJXA 3SUOA 4CHPA 4KO0A 4B9TA 3RWUA 4DTRA 2I5JA 1NK7A 4KREA 1VK0A 4CF0A 3F9KA 1QS4A 3AVAA 4J2EA 4N47A 4KI6A 2Z1IA 4IG0A 5DMRA 2B5JA 3H08A 1SV5A 3HL8A 3LAKA 2KQ2A 2QXFA 4E3SA 4KTQA 1IKVA 2FBVA 4RW4A 3KK1A 4FLYA 3DLRA 4HUFA 4DTOA 1SL0A 3HSTB 4DTSA 1NKEA 1Y97A 2DFHA 3AO5A 3AVLA 3V6DA 1JLQA 4CGJA 4FLXA 3MXMA 4EP4A 3SI6A 3NE6A 1U4BA 3U3YA 4AILC 1RDCA 2FBTA 2G8HA 1D5AA 1S1TA 1XHXA 3SYZA 4FJ7A 1CXUA 4BWJA 1YTAA 4KAZA 4CGHA 3KTQA 2F8TA 1VSMA 4MQ3A 4W5OA 4DSEA 4B08A 4DLGA 4B9MA 1YVUA 3BGRA 3K5MA 3QINA 1G15A 3LWLA 3ZSXA 1LAWA 1KFDA 3AVMA 2OYQA 3L3UA 3O3HA 4CF9A 1RT4A 1U04A 4KHWA 4BE1A 4M45A 4DFPA 4RW7A 3HT3A 1S5JA 3OYKA 2YHBA 5C25A 3NAEA 2GBZA 1TKDA 3KD1E 2NUBA 3MECA 4EZ9A 4OGCA 1HYSA 3AVJA 4J2AA 5I3UA 4DTUA 3ZT3A 2PYLA 4E7LA 3QEWA 4DQSA 1Z26A 1NOZA 5KGWA 4DTNA 2GUIA 3D0PA 2IC3A 4BDYA 1O1WA 3OYGA 1QSYA 1RDAA 3TARA 3SJJA 1SKWA 3IG1A 5HRPA 3LPTA 1TL1A 5CZ1A 4JRPA 3DRPA 4E7IA 3PV8A 1RT1A 1T7PA 3QEXA 4BDZA 3MXJA 1KVCA 1QSSA 5FRMA 1ASWA 4ZTFA 4PQUA 1NK4A 1B9DA 2FBXA 3VQ4A 4ELUA 1FKPA 4FXDA 4B9SA 3KLIA 3ZT1A 4CGIA 1KTQA 3AVIA 3M8SA 1KCFA 3MEDA 3QNOA 4CJFA 1TV6A 4M42A 3CYMA 4IFVA 1QQCA 5EU7A 2YHAA 3AO2A 4CFDA 1YT3A 2X74A 3P1GA 4CF2A 1IH7A 5HRRA 5T7BA 4FLVA 1RBRA 2IS3A 2ZD1A 1JLEA 4H4OA 1ZBIA 3DOKA 1TK5A 2Z1HA 4HUGA 1S9EA 3AA3A 3DM2A 4I7FA 3AO4A 3HP6A 3V9UA 2ETJA 3V9WA 2OZSA 1U48A 4UQGA 3OYCA 3OYJA 3NF8A 3HM9A 1X9SA 3AVCA 2RN2A 2QKBA 4E7KA 5FROA 3U3GA 1L5UA 1KRPA 2JGUA 4KB1A 3S3OA 4FM1A 1VSKA 1I39A 3SQ1A 3CQ8A 1LWFA 3VQPA 1S1VA 1VSJA 1NKBA 1N5YA 3HK2A 4B8AB 1NJWA 3SUNA 4CJQA 5D3GA 4DS5A 1GOBA 1RBTA 3V1OA 4QAGA 2AJQA 1FKOA 4CFCA 5KI6A 5HBMA 3NH0A 3HVRA 4B9VA 4M3RA 4CJKA 1B92A 3TAMA 4CK3A 4FJLA 4F3TA 4KPYA 2VG5A 4HCCA 4Q0BA 2FC0A 2E6MA 2Z1GA 3LP3A 4CJLA 2A1RA 3QEPA 3VA0A 3NGYA 1B9FA 3V81A 4NCGA 4DQIA 2EX3A 2W42A 2YNIA 1NK9A 1ASUA 3NGIA 3DLBA 4LSNA 4C8KA 3O3FA 4DSIA 1DTTA 3OS2A 3OYHA 4C8OA 4Q5VA 1QE1A 4DFMA 4L8RB 3AVNA 3B6OA 3L2VA 4DFJA 3TAFA 3AVHA 4NYNA 1QTMA 1NK6A 4FZXC 4KI4A 4DTJA 3P5JA 3EZ5A 4FJIA 2E4LA 4B3OA 3TWHA 1KVBA 5JS2A 5KRSA 3OYMA 4Z4CA 1U47A 4M41A 4B9UA 5CYQA 4DS4A 3G0ZA 3AVFA 1JL1A 4AH9A 3KKSA 3ZSOA 4FLUA 3QETA 4PWDA 5HROA 2LSNA 4IG3A 4HHTA 3SZ2A 5CY4A 3L8BA 3VQEA 4M3XA 3NGZA 5HP1A 2D5RA 1KSPA 1S6PA 4OKJA 3ZSWA 4BACA 1ZBFA 1GOAA 3ULDA 1RTHA 4O0JA 3PX6A 1LWEA 3P83D 2HHTA 3LP2A 1RDBA 3PY8A 1RDDA 4IFYA 3WNFA 4DQPA 2VG6A 1KVAA 3RR8A 3OJSA 1ASVA 2GV9A 2QKKA 2IGIA 4CECA 2G8KA 1JLCA 3TI0A 3CFPA 4RG8A 1TL3A 4FVMA 2PZSA 1S1UA 1LAVA 3RMCA 3D45A 2G8IA 3EYZA 1EXQA 4F4KA 1UWBA 2D0CA 3CFOA 1ZYQA 5HLFA 1XHZA 3DLGA 2DY4A 1JKHA 2OPQA 4Z4HA 4RW9A 3QIOA 1W0HA 2X6SA 4W5NA 1BGXT 2G8UA 2YV0X 1XI1A 2VWKA 1WSJA 2A1SA 2XY5A 4DQQA 3DMJA 4E0DA 4CEOA 1U45A 1L3VA 4F2SA 3MXIA 1X9MA 1WSFA 3TABA 4NCBA 1ZBHA 2F8SA 1LW0A 4E1MA 3K57A 4YNQA 1RCHA 4CJTA 4DFKA 3O4NA 4J2DA 4KTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJV A;  4AHR A;  2KFN A;  4DTP A;  2KFZ A;  1GOC A;  3NH2 A;  2XY6 A;  3I8D A;  3LP1 A;  2OZM A;  2HHX A;  3DLK A;  2PY5 A;  1RBV A;  3OYN A;  3IAY A;  2HW3 A;  3LZI A;  1NKC A;  3CM6 A;  3AVB A;  3LAN A;  3NF7 A;  3AO1 A;  3ZCM A;  4CER A;  4N56 A;  4JS4 A;  4CEB A;  3SPZ A;  1BIZ A;  4FW2 A;  2D0B A;  2HND A;  4FCY A;  1QHT A;  3KK2 A;  2BE2 A;  1TKZ A;  1KFS A;  4KHQ A;  4CK2 A;  1Z25 A;  3KLF A;  2X78 A;  4DLE A;  4LH4 A;  3FFI A;  4CIF A;  1UA0 A;  4FM0 A;  4FK4 A;  4FW1 A;  4AHT A;  3RMA A;  4ELT A;  4F2R A;  4CHO A;  3HO1 A;  3BDP A;  3QEI A;  1RT3 A;  4CIG A;  1NOY A;  1JXE A;  1RTJ A;  3TAE A;  1SKS A;  5SWM A;  1D8Y A;  1WSG A;  3AA2 A;  3U6F A;  5J1E A;  4QOZ B;  3ISN C;  1S9G A;  1SUQ A;  3HXM A;  3ZSY A;  4C8N A;  1BIU A;  5HRN A;  3JSM A;  1HYV A;  1TGO A;  3LDS A;  1RT6 A;  1U49 A;  3KLG A;  3HJF A;  2B6A A;  2DTU A;  2HVI A;  3AA5 X;  3K5L A;  3QNN A;  1CLQ A;  4FLZ A;  3DRS A;  1VSL A;  4FZZ A;  4YFU A;  3TAN A;  3V1R A;  2YNF A;  3K58 A;  4ELV A;  3QER A;  1BHL A;  3S3N A;  4O44 A;  3NF9 A;  2HHV A;  1L3U A;  3VQD A;  2VWJ A;  3CG7 A;  3K5N A;  1MU2 A;  3OYD A;  3AV9 A;  4W5Q A;  4KRF A;  4ZTJ A;  4I2P A;  4CEQ A;  1VRU A;  1ZBU A;  1BQN A;  4CFA A;  3SPY A;  4K8Z A;  1WLJ A;  3EY1 A;  1TK8 A;  4Z4F A;  1XC9 A;  1Q9Y A;  5CYM A;  4I2Q A;  3NBP A;  4W5R A;  3KLH A;  4DU4 A;  1C0M A;  3KIO A;  4ID5 A;  2YKM A;  4R5P A;  4EP5 A;  4IDK A;  4DQR A;  1C0U A;  1VSH A;  1NK0 A;  1LV5 A;  4I9Q A;  1LW2 A;  4Z4E A;  2HHU A;  1WAF A;  3PO5 A;  1VSD A;  3ZT0 A;  4CEF A;  4DF4 A;  1EKE A;  1JLG A;  3QEV A;  2YNH A;  3TAG A;  4CJE A;  1IO2 A;  1EET A;  3ITH A;  4O55 A;  3ZSR A;  1VSF A;  3DOL A;  4FJK A;  3WNG A;  2DFF A;  3RMB A;  1HQE A;  2G8W A;  4CFB A;  4FJG A;  1RNH A;  2YKN A;  1DTQ A;  4CJR A;  3RRH A;  2Y1J A;  4OJR A;  3L2W A;  3OS0 A;  3HPH A;  4JRQ A;  4BDP A;  4IBN A;  5JS1 A;  4N76 A;  4E7J A;  1VSE A;  1JLB A;  3M8R A;  3WNE A;  3LAM A;  4O0I A;  3L2Q A;  4FK0 A;  1D9D A;  1BI4 B;  4M3W A;  2HHQ A;  1T05 A;  1LWC A;  3LZJ A;  2G8F A;  3NH1 A;  4M3T A;  2P51 A;  4CEZ A;  4AHC A;  3AVK A;  1TAU A;  1VSI A;  4CGD A;  2VG7 A;  3TAQ A;  4DF8 A;  3NDK A;  4CHN A;  5J2P A;  3AO3 A;  3V9X A;  1K6Y A;  1RT7 A;  4LH5 A;  1S6Q A;  1HMV A;  3VQB A;  4DU3 A;  3DLE A;  2XRI A;  1J9A A;  2IDO A;  3C94 A;  3S3M A;  1BL3 A;  2O4G A;  3UIQ A;  4CEA A;  1BIS A;  3DLH A;  1UOC A;  3HYF A;  4KFB A;  3E01 A;  4C8M A;  4FYD A;  3V9S A;  3DRR A;  3K2P A;  1TK0 A;  4DSL A;  3KLE A;  2HHS A;  2O4I A;  2YNG A;  4B8C A;  3PO4 A;  1KLN A;  4KV8 A;  4Y1D A;  3WNH A;  1NK8 A;  3C6U A;  4Z0U A;  2RPI A;  1ITG A;  2Y1I A;  4W5T A;  4CEE A;  4DSK A;  3PX4 A;  5C24 A;  5J2Q A;  2X6N A;  5J2N A;  3VQ8 A;  2HB5 A;  4O4G A;  2OPS A;  1RT5 A;  4FJN A;  3IS9 A;  3SV4 A;  2Q3S A;  3PX0 A;  3SNN A;  4BE2 A;  3VQ9 A;  1A5X A;  4FLW A;  1NJX A;  3KD5 E;  4H8K A;  1C0T A;  1WSH A;  1HQU A;  1C1B A;  1S1X A;  4KHN A;  4FJ8 A;  1YTU A;  4CJV A;  1JL2 A;  3KKR A;  4H4M A;  3DI6 A;  1L3T A;  1RBS A;  2P5G A;  3KK3 A;  4J2B A;  3LAL A;  3K59 A;  3CM5 A;  2OPR A;  4DU1 A;  3QES A;  1R0A A;  1T8E A;  4M3Z A;  3VQ5 A;  4LD0 A;  3OYA A;  3S9H A;  3SV3 A;  3QO9 A;  2PYJ A;  4AHS A;  1RT2 A;  3OYB A;  3QIP A;  3RR7 A;  3MEE A;  1TAQ A;  2P1J A;  4RW8 A;  1Q9X A;  2RF2 A;  2DFE A;  4KHY A;  4IKF A;  4B9L A;  3V9Z A;  2E6L A;  1XWL A;  3QLH A;  3HPO A;  2R7Y A;  1HRH A;  2WON A;  3AVG A;  3T3F A;  1CZ9 A;  2ATQ A;  3OY9 A;  3DYA A;  3NCI A;  5FRN A;  2Z1J A;  3JYT A;  3T1A A;  1X9W A;  4N41 A;  3L2U A;  3B6P A;  4F8R A;  1WN7 A;  3O4Q A;  3VQA A;  4AHV A;  1BQM A;  1IG9 A;  3V1Q A;  4CK1 A;  4O5B A;  3VQQ A;  1SL1 A;  1WSE A;  1CZB A;  3RTV A;  4FJ5 A;  4CJS A;  4DWI A;  1REV A;  1IKX A;  1TKT A;  3VQ6 A;  1QSL A;  4G1Q A;  4BE0 A;  3OJU A;  3G10 A;  4HUE A;  4DG1 A;  3LPU A;  3CFR A;  2OA8 A;  2XY7 A;  3NHG A;  4Z4I A;  3O3G A;  4MFB A;  1L3S A;  3NF6 A;  4HVJ A;  4CIE A;  3C95 A;  3VQ7 A;  3OYF A;  1ZBL A;  2B4J A;  1NK5 A;  1JLA A;  2KW4 A;  3TAP A;  4FLT A;  1JXB A;  2WOM A;  3T19 A;  2JLE A;  4HTU A;  3I0R A;  4K8X A;  4OPK A;  1WSI A;  1EP4 A;  3A2F A;  2D0A A;  3M8P A;  1HNV A;  4FJH A;  2F96 A;  3RMD A;  1RTD A;  4CGG A;  3ZSZ A;  3SCX A;  1BI4 A;  1F21 A;  1HNI A;  3ZT4 A;  4CJW A;  4C8L A;  1HYZ A;  4E7H A;  1S1W A;  5HRS A;  3SQ4 A;  5KRT A;  4CGF A;  1C6V A;  3ZSQ A;  5DK5 A;  1C1A A;  5C42 A;  1FK9 A;  4I9L A;  4CJ5 A;  3SUQ A;  2ZE2 A;  3AA4 A;  4WE1 A;  1WNS A;  1C1C A;  2IAJ A;  2ITG A;  3MEG A;  4KKO A;  3SQ2 A;  3SQ0 A;  5FDL A;  4DSJ A;  1RBU A;  4KHS A;  2HNY A;  4CED A;  1VRT A;  1TKX A;  1Q8I A;  4JLH A;  4OGE A;  2EHG A;  4FJ9 A;  3ZT2 A;  3HPG A;  2ZQB A;  4ZHR A;  3RRG A;  4CJU A;  4KB0 A;  4LSL A;  1UAX A;  3HP9 A;  1NJZ A;  3OYE A;  1J54 A;  4DSF A;  3THV A;  4GW6 A;  3OVN A;  4PUO A;  2XY8 A;  5KGX A;  3K5O A;  2IOC A;  3ZSV A;  5SZT A;  1HJR A;  2QK9 A;  4ID1 A;  3L3V A;  4CES A;  4DMN A;  2HNZ A;  1UA1 A;  1RIL A;  1IKW A;  4RW6 A;  1A5V A;  1J53 A;  1WAJ A;  2HMI A;  4FJM A;  5J2M A;  4CJ4 A;  2KTQ A;  4CHQ A;  2KZM A;  4N5S A;  3LWM A;  2OPP A;  2RKI A;  1TVR A;  3C6T A;  4DTX A;  4Z4G A;  1DLO A;  3VN5 A;  2HVH A;  1KLM A;  3VQC A;  4CF1 A;  4M3Y A;  4ICL A;  1W9H A;  3V4I A;  4OLA A;  4CF8 A;  4DTM A;  1EX4 A;  1JLF A;  3TR8 A;  5K14 A;  2HHW A;  4CJ3 A;  3OYL A;  4FZY A;  1A5W A;  4GMJ B;  3SUP A;  5I42 A;  1N6Q A;  5CZ2 A;  5E41 A;  3VA3 A;  4TSX A;  4OLB A;  2KZZ A;  1NJY A;  4FM2 A;  4AHU A;  2XO7 A;  4CE9 A;  4FJJ A;  3MAQ A;  4KTZ A;  3L2R A;  3PUF A;  5KTQ A;  4OPJ A;  4JS5 A;  4EZ6 A;  4PY5 A;  4E89 A;  3F73 A;  3OS1 A;  4CHZ A;  4OKE A;  4PA1 A;  1X1P A;  4E1N A;  4XIU A;  2BGG A;  4QCL A;  4NYF A;  2BDP A;  1BCM A;  2P5O A;  4B9N A;  2FBY A;  1CXQ A;  4BWM A;  3I0S A;  1SL2 A;  4Y1C A;  4FK2 A;  4NCA A;  4KHU A;  4HCB A;  1I3A A;  1RTI A;  4E19 A;  3NFA A;  4CJP A;  1HPZ A;  4CHY A;  2XHB A;  3OYI A;  1SKR A;  1FXX A;  1BCO A;  3IRX A;  3LP0 A;  4LY7 A;  4F3O A;  4M3U A;  2BAN A;  3M8Q A;  4CCH A;  1IKY A;  3HVT A;  1D9F A;  4GVM A;  4OKK A;  4OVL A;  1T03 A;  3ALY A;  3ASM A;  1J5O A;  2G8V A;  4FJX A;  3SUO A;  4CHP A;  4KO0 A;  4B9T A;  3RWU A;  4DTR A;  2I5J A;  1NK7 A;  4KRE A;  1VK0 A;  4CF0 A;  3F9K A;  1QS4 A;  3AVA A;  4J2E A;  4N47 A;  4KI6 A;  2Z1I A;  4IG0 A;  5DMR A;  2B5J A;  3H08 A;  1SV5 A;  3HL8 A;  3LAK A;  2KQ2 A;  2QXF A;  4E3S A;  4KTQ A;  1IKV A;  2FBV A;  4RW4 A;  3KK1 A;  4FLY A;  3DLR A;  4HUF A;  4DTO A;  1SL0 A;  3HST B;  4DTS A;  1NKE A;  1Y97 A;  2DFH A;  3AO5 A;  3AVL A;  3V6D A;  1JLQ A;  4CGJ A;  4FLX A;  3MXM A;  4EP4 A;  3SI6 A;  3NE6 A;  1U4B A;  3U3Y A;  4AIL C;  1RDC A;  2FBT A;  2G8H A;  1D5A A;  1S1T A;  1XHX A;  3SYZ A;  4FJ7 A;  1CXU A;  4BWJ A;  1YTA A;  4KAZ A;  4CGH A;  3KTQ A;  2F8T A;  1VSM A;  4MQ3 A;  4W5O A;  4DSE A;  4B08 A;  4DLG A;  4B9M A;  1YVU A;  3BGR A;  3K5M A;  3QIN A;  1G15 A;  3LWL A;  3ZSX A;  1LAW A;  1KFD A;  3AVM A;  2OYQ A;  3L3U A;  3O3H A;  4CF9 A;  1RT4 A;  1U04 A;  4KHW A;  4BE1 A;  4M45 A;  4DFP A;  4RW7 A;  3HT3 A;  1S5J A;  3OYK A;  2YHB A;  5C25 A;  3NAE A;  2GBZ A;  1TKD A;  3KD1 E;  2NUB A;  3MEC A;  4EZ9 A;  4OGC A;  1HYS A;  3AVJ A;  4J2A A;  5I3U A;  4DTU A;  3ZT3 A;  2PYL A;  4E7L A;  3QEW A;  4DQS A;  1Z26 A;  1NOZ A;  5KGW A;  4DTN A;  2GUI A;  3D0P A;  2IC3 A;  4BDY A;  1O1W A;  3OYG A;  1QSY A;  1RDA A;  3TAR A;  3SJJ A;  1SKW A;  3IG1 A;  5HRP A;  3LPT A;  1TL1 A;  5CZ1 A;  4JRP A;  3DRP A;  4E7I A;  3PV8 A;  1RT1 A;  1T7P A;  3QEX A;  4BDZ A;  3MXJ A;  1KVC A;  1QSS A;  5FRM A;  1ASW A;  4ZTF A;  4PQU A;  1NK4 A;  1B9D A;  2FBX A;  3VQ4 A;  4ELU A;  1FKP A;  4FXD A;  4B9S A;  3KLI A;  3ZT1 A;  4CGI A;  1KTQ A;  3AVI A;  3M8S A;  1KCF A;  3MED A;  3QNO A;  4CJF A;  1TV6 A;  4M42 A;  3CYM A;  4IFV A;  1QQC A;  5EU7 A;  2YHA A;  3AO2 A;  4CFD A;  1YT3 A;  2X74 A;  3P1G A;  4CF2 A;  1IH7 A;  5HRR A;  5T7B A;  4FLV A;  1RBR A;  2IS3 A;  2ZD1 A;  1JLE A;  4H4O A;  1ZBI A;  3DOK A;  1TK5 A;  2Z1H A;  4HUG A;  1S9E A;  3AA3 A;  3DM2 A;  4I7F A;  3AO4 A;  3HP6 A;  3V9U A;  2ETJ A;  3V9W A;  2OZS A;  1U48 A;  4UQG A;  3OYC A;  3OYJ A;  3NF8 A;  3HM9 A;  1X9S A;  3AVC A;  2RN2 A;  2QKB A;  4E7K A;  5FRO A;  3U3G A;  1L5U A;  1KRP A;  2JGU A;  4KB1 A;  3S3O A;  4FM1 A;  1VSK A;  1I39 A;  3SQ1 A;  3CQ8 A;  1LWF A;  3VQP A;  1S1V A;  1VSJ A;  1NKB A;  1N5Y A;  3HK2 A;  4B8A B;  1NJW A;  3SUN A;  4CJQ A;  5D3G A;  4DS5 A;  1GOB A;  1RBT A;  3V1O A;  4QAG A;  2AJQ A;  1FKO A;  4CFC A;  5KI6 A;  5HBM A;  3NH0 A;  3HVR A;  4B9V A;  4M3R A;  4CJK A;  1B92 A;  3TAM A;  4CK3 A;  4FJL A;  4F3T A;  4KPY A;  2VG5 A;  4HCC A;  4Q0B A;  2FC0 A;  2E6M A;  2Z1G A;  3LP3 A;  4CJL A;  2A1R A;  3QEP A;  3VA0 A;  3NGY A;  1B9F A;  3V81 A;  4NCG A;  4DQI A;  2EX3 A;  2W42 A;  2YNI A;  1NK9 A;  1ASU A;  3NGI A;  3DLB A;  4LSN A;  4C8K A;  3O3F A;  4DSI A;  1DTT A;  3OS2 A;  3OYH A;  4C8O A;  4Q5V A;  1QE1 A;  4DFM A;  4L8R B;  3AVN A;  3B6O A;  3L2V A;  4DFJ A;  3TAF A;  3AVH A;  4NYN A;  1QTM A;  1NK6 A;  4FZX C;  4KI4 A;  4DTJ A;  3P5J A;  3EZ5 A;  4FJI A;  2E4L A;  4B3O A;  3TWH A;  1KVB A;  5JS2 A;  5KRS A;  3OYM A;  4Z4C A;  1U47 A;  4M41 A;  4B9U A;  5CYQ A;  4DS4 A;  3G0Z A;  3AVF A;  1JL1 A;  4AH9 A;  3KKS A;  3ZSO A;  4FLU A;  3QET A;  4PWD A;  5HRO A;  2LSN A;  4IG3 A;  4HHT A;  3SZ2 A;  5CY4 A;  3L8B A;  3VQE A;  4M3X A;  3NGZ A;  5HP1 A;  2D5R A;  1KSP A;  1S6P A;  4OKJ A;  3ZSW A;  4BAC A;  1ZBF A;  1GOA A;  3ULD A;  1RTH A;  4O0J A;  3PX6 A;  1LWE A;  3P83 D;  2HHT A;  3LP2 A;  1RDB A;  3PY8 A;  1RDD A;  4IFY A;  3WNF A;  4DQP A;  2VG6 A;  1KVA A;  3RR8 A;  3OJS A;  1ASV A;  2GV9 A;  2QKK A;  2IGI A;  4CEC A;  2G8K A;  1JLC A;  3TI0 A;  3CFP A;  4RG8 A;  1TL3 A;  4FVM A;  2PZS A;  1S1U A;  1LAV A;  3RMC A;  3D45 A;  2G8I A;  3EYZ A;  1EXQ A;  4F4K A;  1UWB A;  2D0C A;  3CFO A;  1ZYQ A;  5HLF A;  1XHZ A;  3DLG A;  2DY4 A;  1JKH A;  2OPQ A;  4Z4H A;  4RW9 A;  3QIO A;  1W0H A;  2X6S A;  4W5N A;  1BGX T;  2G8U A;  2YV0 X;  1XI1 A;  2VWK A;  1WSJ A;  2A1S A;  2XY5 A;  4DQQ A;  3DMJ A;  4E0D A;  4CEO A;  1U45 A;  1L3V A;  4F2S A;  3MXI A;  1X9M A;  1WSF A;  3TAB A;  4NCB A;  1ZBH A;  2F8S A;  1LW0 A;  4E1M A;  3K57 A;  4YNQ A;  1RCH A;  4CJT A;  4DFK A;  3O4N A;  4J2D A;  4KTW A; 
#chains in the Genus database with same CATH topology
 3KJV A;  2KFZ A;  2KFN A;  4JI6 K;  5F0X A;  1GOC A;  5DM6 L;  2XY6 A;  5E84 A;  3I8D A;  3D2E B;  3IAY A;  3OYN A;  4JS4 A;  4CER A;  1FJG K;  4CEB A;  3SPZ A;  1Y64 A;  2UUA K;  1W7A A;  3KK2 A;  1Z25 A;  2X78 A;  4LH4 A;  4FW1 A;  4AHT A;  3RMA A;  2UU9 K;  5F2R A;  3BDP A;  2W6L A;  5J1E A;  3ISN C;  1SUQ A;  3OHR A;  5HRN A;  1HYV A;  1RT6 A;  5AZI B;  1GLE G;  4C1N K;  3N4Q A;  1CLQ A;  1NBW A;  3DRS A;  4FZZ A;  2YNF A;  1VQK N;  4ELV A;  4BRK A;  2O8C A;  3S3N A;  3QIC A;  3QFU A;  3QML A;  3CF5 L;  3K5N A;  3AV9 A;  4W5Q A;  4ZTJ A;  3TSQ A;  3THX A;  2HOE A;  2ZJQ L;  3THY B;  3CPE A;  1BQN A;  4Z4F A;  4BQZ A;  3T7Z A;  3GL1 A;  5CYM A;  4FPB A;  3NBP A;  4W5R A;  3IUC A;  4R5P A;  2YKM A;  1S22 A;  2ZGZ A;  4EP5 A;  1I94 K;  2QWL A;  1SS6 A;  1K8K A;  1LW2 A;  2HHU A;  3THW B;  1WAF A;  3PO5 A;  3QEV A;  1D4X A;  2P9S A;  3DOL A;  3CCU N;  3VMF B;  3WEE A;  4FJG A;  3RRH A;  2Y1J A;  2FF6 A;  4BDP A;  4N76 A;  1JJ2 M;  1VSE A;  2JWL A;  3WNE A;  1Z6R A;  2E8A A;  4FK0 A;  2IIR A;  1T05 A;  2QW9 A;  4FOI A;  3WXJ A;  3DXK A;  4M3T A;  4CEZ A;  4AHC A;  5J2P A;  1NGH A;  1K6Y A;  4LH5 A;  4ISF A;  3VQB A;  1VQ4 N;  1TUU A;  3C94 A;  4GV3 A;  4CEA A;  3DLH A;  4FWQ A;  4K41 A;  4FYD A;  3K9J A;  2CGK A;  3KLE A;  4UY8 O;  2HHS A;  5FPD A;  2QXL A;  1KLN A;  2QWO A;  1ITG A;  5ADX A;  4LF5 K;  5C24 A;  2X6N A;  3VQ8 A;  4O4G A;  2OPS A;  4M7X A;  1BU6 O;  3PX0 A;  3KD5 E;  2A3Z A;  4H5W A;  3A0I X;  4CJV A;  1JL2 A;  3ZET B;  3KK3 A;  3K59 A;  3D6R A;  4M3Z A;  3O9S A;  3HOT A;  3OYA A;  1K9M O;  4EHT A;  3SV3 A;  3QO9 A;  4BG8 A;  2CH5 A;  4AHS A;  4LF9 K;  1RT2 A;  1YAG A;  5BN8 A;  4KHY A;  2P9P B;  3ENH A;  3WXL A;  3V9Z A;  5AZI A;  2WON A;  2A40 A;  4NLB A;  3ZX2 A;  3OY9 A;  2ATQ A;  3CCL N;  3DYA A;  2QI2 A;  2Z1J A;  4F8R A;  2HBL A;  4G9Z A;  5JIC A;  1QQN A;  4BRH A;  3EN9 A;  3V1Q A;  1R59 O;  1WSE A;  3RTV A;  4CJS A;  1IKX A;  1TKT A;  4NB4 A;  2E5L K;  4BE0 A;  3OJU A;  4DG1 A;  1ATN A;  1U2V B;  3HTV A;  3CFR A;  4U7B A;  3AAR A;  1L3S A;  4HVJ A;  1E3M A;  3THW A;  3VQ7 A;  3CIP A;  1RDU A;  1JXB A;  4OPK A;  3A2F A;  2D0A A;  1N36 K;  2F96 A;  1K8A O;  3A5L C;  4CZF A;  2GTD A;  4E7H A;  1XMQ K;  3JS6 A;  1C6V A;  3VGK A;  2ZE2 A;  3AA4 A;  2A5X A;  4WE1 A;  1T3V A;  4B1W B;  4DSJ A;  3MEG A;  4KKO A;  5FDL A;  1RBU A;  4CED A;  1C0F A;  1YIJ N;  1Q18 A;  2NZT A;  3PSF A;  2P9K B;  3C65 A;  1IBK K;  1UAX A;  3THV A;  4GW6 A;  4LFB K;  2IOC A;  3O1B A;  3ZSV A;  1HJR A;  3H3N O;  1UA1 A;  1IKW A;  3SJH A;  2HMI A;  1WAJ A;  2KZM A;  3ZET A;  4N5S A;  1TVR A;  5BR8 K;  4Z4G A;  2VCP A;  4OLA A;  4M3Y A;  2WC9 A;  1VHX A;  2QTD A;  4BC2 A;  3V4I A;  1EX4 A;  3VF6 A;  3ZEU B;  4HWI A;  3HBT A;  2ZWH A;  1A5W A;  5CZ2 A;  2I7P A;  1ZBS A;  1N32 K;  2P9P A;  4AHU A;  2XO7 A;  3JAM O;  4FJJ A;  1YVN A;  3L2R A;  3BZC A;  5HL7 L;  1V4S A;  4CHZ A;  2ZGY A;  1HNW K;  4E1N A;  2BGG A;  5AQM A;  4NYF A;  3CER A;  1YF5 L;  3O1W A;  3TTD A;  2FBY A;  2J4R A;  4JKF A;  1QZ6 A;  2O8F B;  5AQV A;  1SL2 A;  4Y1C A;  5AQT A;  3UB5 A;  1YIT N;  1BWF O;  5M1P A;  4NCA A;  2A6A A;  4BR9 A;  3TSU A;  4DCH A;  4E19 A;  4CJP A;  2XHB A;  1FXX A;  3IRX A;  4F3O A;  3LP0 A;  1OVY A;  1EWR A;  3I33 A;  1BG3 A;  4CCH A;  3HVT A;  3IDH A;  1D9F A;  2YHY A;  1WOQ A;  4OVL A;  4OKK A;  4DR4 K;  2QEX N;  3ASM A;  4MLH A;  4JKE A;  4CHP A;  3E9L A;  2CGJ A;  4KRE A;  4DTR A;  1VK0 A;  3F9K A;  2QA4 N;  2F9W A;  2VQE K;  2B5J A;  4KTQ A;  1IKV A;  1QZ5 A;  3AVL A;  1XUP O;  4Z94 A;  4FLX A;  2ASM A;  3FZM A;  2KHO A;  3SI6 A;  1U4B A;  2A42 A;  3BZK A;  2P9K A;  3HI0 A;  3SYZ A;  4FJ7 A;  1X3M A;  1NGC A;  4BWJ A;  4KAZ A;  1NJI O;  2A41 A;  4MQ3 A;  4YOX A;  4B9M A;  4DLG A;  4A61 A;  4K43 A;  3FR0 A;  3QIN A;  3LWL A;  3L3U A;  4CF9 A;  1O13 A;  4DFP A;  4RW7 A;  1NGF A;  3NAE A;  3KD1 E;  4BR7 A;  2E2O A;  3ZEU A;  4DQS A;  5KGW A;  2NRV A;  5KPR A;  4BDY A;  1QSY A;  1S72 N;  2NNW A;  5HRP A;  1Q81 O;  2H3G X;  3DRP A;  3PV8 A;  3SAH A;  4BDZ A;  4B3M K;  1B9D A;  3S41 A;  1FKP A;  4FXD A;  4B9S A;  1KCF A;  3QNO A;  4CJF A;  3H45 C;  2O8F A;  3C0B A;  4H0O A;  4IFV A;  1NMN A;  3AO2 A;  1GLA G;  3P1G A;  1IH7 A;  5HRR A;  1T6D A;  2IS3 A;  2E1Y A;  4IZ9 A;  1JLE A;  4K0K K;  1YJN N;  1TK5 A;  1S9E A;  3DM2 A;  5M1N A;  3AO4 A;  3VEN A;  2YJF A;  3HP6 A;  3NVK A;  2YI1 A;  4RTF D;  3SAG A;  3OYC A;  3HM9 A;  4JYA K;  3AVC A;  3F5T A;  3RVC A;  3WUH A;  1L5U A;  3S3O A;  3O6W A;  4FM1 A;  3LM9 A;  1I39 A;  5EX5 A;  3CQ8 A;  1LWF A;  2Q36 A;  3P39 A;  4O8U A;  4PKI A;  1T6C A;  4GV9 A;  1WBD A;  1GOB A;  1RBT A;  4GNI A;  3LM2 A;  4JK9 A;  4QAG A;  3WQT A;  4CFC A;  4A5A A;  1ATR A;  3NH0 A;  4M3R A;  4KPY A;  2E6M A;  4DUY K;  3SMS A;  4CBX A;  3VA0 A;  5LJW A;  4H0T B;  3NGI A;  5FPM A;  4C8K A;  3OS2 A;  1HR0 K;  1W97 L;  3L2V A;  3TAF A;  3AVH A;  1QTM A;  1NK6 A;  2D1K A;  4DUZ K;  2E4L A;  4B3O A;  3TWH A;  3O5B A;  4M63 C;  4M41 A;  5CYQ A;  4DS4 A;  4I6M B;  3QET A;  4AH9 A;  3KKS A;  2E2Q A;  4IG3 A;  4HHT A;  3L8B A;  1KSP A;  4AF1 A;  4DV7 K;  1YJ9 N;  1GOA A;  2HHT A;  5BRF A;  4DV1 K;  3KK7 A;  3M1F A;  4FWM A;  2IGI A;  5KPZ A;  2G8K A;  1NGD A;  2GUP A;  4RG8 A;  2PZS A;  4FVM A;  5KQD A;  3RMC A;  4H5T A;  2G8I A;  1QQM A;  5EVZ A;  5AR0 A;  2DY4 A;  1JKH A;  3J7Y P;  4H03 B;  3QIO A;  1N33 K;  1BOT O;  1LOT B;  2FF3 B;  3MK6 A;  1X9J A;  1EQY A;  1XI1 A;  1YXQ A;  2A1S A;  4PKG A;  3AY9 A;  4DQQ A;  3Q7C A;  1U45 A;  3C6A A;  2W40 A;  4X62 K;  3TAB A;  4NCB A;  4CJ7 A;  4B1Y B;  1LW0 A;  4E1M A;  3K57 A;  1RCH A;  3EL2 A;  4J2D A;  3RSE B;  4DTP A;  3AAQ A;  5AZJ B;  4IJN A;  3HRG A;  1RBV A;  4CI6 A;  1NKC A;  4N56 A;  1JCE A;  3AO1 A;  1YUW A;  1TKZ A;  2BE2 A;  1KFS A;  3IKM A;  4CIF A;  4FM0 A;  4F2R A;  4CHO A;  2FSJ A;  3QEI A;  2UUC K;  1NOY A;  1NG9 A;  4BRG A;  1SZ2 A;  5JVH L;  1D8Y A;  1WSG A;  3AA2 A;  3U6F A;  4QOZ B;  4A2A A;  3ZSY A;  3DLB A;  1BIU A;  3JSM A;  1U49 A;  2QWP A;  3O9Q A;  3HJF A;  3K5L A;  3VES A;  4FLZ A;  4JHD B;  1N34 K;  4OX9 K;  4EAH D;  4O44 A;  3NF9 A;  1MDU B;  2HHV A;  1IV0 A;  2VWJ A;  5MLC Q;  2FLO A;  4JI3 K;  4BRN A;  5JVG L;  4KRF A;  5FPE A;  1VRU A;  4K8Z A;  3SPY A;  2Q1N A;  1TK8 A;  4LF6 K;  4I6M A;  4I2Q A;  3KLH A;  3CCR N;  1C0M A;  5BRE A;  1C0U A;  1LV5 A;  2VQF K;  4Z4E A;  1VSD A;  3ZT0 A;  3TAG A;  1IO2 A;  3ITH A;  3FE1 A;  4O55 A;  4PL8 A;  3ZSR A;  2DFF A;  2G8W A;  1DTQ A;  3ENB A;  4CJR A;  5JS1 A;  4OJR A;  3L2W A;  3HPH A;  4BR0 A;  4IBN A;  4E1J A;  3M8R A;  4O0I A;  1D9D A;  2F4V K;  4IEE A;  4B3T K;  1LWC A;  3TU5 A;  3AVK A;  3AO3 A;  3V9X A;  2E2P A;  1RT7 A;  4DU3 A;  1S6Q A;  1VQL N;  2XRI A;  2IDO A;  1BL3 A;  1UOC A;  3V9S A;  4JKA A;  4JI7 K;  2O4I A;  2YNG A;  3DAW A;  2RPI A;  4CEE A;  1QVF M;  1K8K B;  5AZJ A;  4FSV A;  2HB5 A;  5AQU A;  1RT5 A;  4MO5 A;  3QBX A;  4Y0W A;  3SV4 A;  4BE2 A;  3VQ9 A;  1A5X A;  1NJX A;  4H8K A;  1WSH A;  1HQU A;  1C1B A;  3E9P A;  3WEE B;  3CC4 N;  4H4M A;  5AQQ A;  4BVP A;  4J2B A;  4DU1 A;  5BPM A;  3MWT A;  4DQ8 A;  1VQ7 N;  3MEE A;  1TAQ A;  1QHA A;  2P1J A;  4RW8 A;  3TTC A;  4IKF A;  4XH1 A;  3HPO A;  4EHU A;  3NCI A;  5FRN A;  5AQS A;  3PLA A;  1J5E K;  3JYT A;  3T1A A;  4N41 A;  3L2U A;  3B6P A;  1WN7 A;  3O4Q A;  3CET A;  4JKD A;  4CK1 A;  1SL1 A;  4DWI A;  1REV A;  1QSL A;  4H5N A;  3G10 A;  4HUE A;  3LPU A;  3J81 O;  1BUP A;  1GLD G;  4JKG A;  3W0L A;  5KPT A;  4IOX A;  2ZJP L;  3O3G A;  4Z4I A;  4MFB A;  2HBK A;  3C95 A;  3BY5 A;  3HSC A;  3DJC A;  1JLA A;  3TAP A;  4FLT A;  3BP8 A;  2JLE A;  3I0R A;  4JNE A;  4K8X A;  1WSI A;  1EP4 A;  1NGI A;  4FJH A;  2QWM A;  5C2D A;  1RTD A;  4DV2 K;  3SCX A;  3KWG A;  1ZXO A;  4C8L A;  1YI2 N;  4IDH A;  5A2Q O;  4YOU A;  5HRS A;  3KVG A;  4CGF A;  2ASO A;  1FK9 A;  3UKU B;  3G71 N;  2GX9 A;  1C1C A;  3CXC M;  4KHS A;  3ID8 A;  2HNY A;  4BC4 A;  1QQO A;  1Q8I A;  3CQX A;  4OGE A;  3OTO K;  3J7A P;  3W3D A;  2ZQB A;  5AQO A;  4ZHR A;  3RRG A;  3M3Z A;  2Q31 A;  4KB0 A;  4V19 S;  4NXM K;  3FZF A;  3OYE A;  1J54 A;  3WQU A;  4DSF A;  3OVN A;  4PUO A;  2XY8 A;  3DLL L;  2RE2 A;  3K5O A;  3L4Q A;  1GLB G;  3L3V A;  4DMN A;  1S3X A;  2CGL A;  1RIL A;  1A5V A;  4FJM A;  4CJ4 A;  2O8E A;  4CHQ A;  5BR9 A;  3LWM A;  3C6T A;  4O5F A;  1NGJ A;  4ICL A;  1W9H A;  4JKH A;  4DTM A;  4CJ3 A;  1BDG A;  4KBO A;  4GMJ B;  4FZY A;  3VA3 A;  3FLC O;  3MAQ A;  3OW2 M;  4JS5 A;  5KTQ A;  4OPJ A;  4PY5 A;  1HLU A;  4RWT A;  3E1Y A;  3F73 A;  2QWR A;  3MCA B;  4QCL A;  2BDP A;  1BCM A;  3MN6 A;  2P5O A;  2I7N A;  3T69 A;  4BC5 A;  5C10 A;  1CXQ A;  4NO7 A;  4HCB A;  3ZLJ A;  3NFA A;  1SKR A;  4LY7 A;  1IKY A;  1IJJ A;  4GVM A;  3SUO A;  4WYB A;  3F9M A;  2P9N B;  1NK7 A;  4J2E A;  1NWK A;  4KI6 A;  2O8B A;  3HL8 A;  4R79 A;  3BUZ B;  3UKU A;  3ZX3 A;  3HST B;  1NKE A;  2DFH A;  3LL3 A;  4H0X B;  1OH6 A;  3ENO A;  3SAF A;  4AIL C;  1S1T A;  1XHX A;  2V7Z A;  1YTA A;  4CGH A;  3KTQ A;  2QWN A;  4W5O A;  4DSE A;  1YVU A;  1SAZ A;  3VGM A;  4IWV A;  1RGI A;  3ZSX A;  3G25 A;  1KFD A;  2OYQ A;  1RT4 A;  4BE1 A;  4M45 A;  1IBL K;  1S5J A;  1TKD A;  2YHB A;  5C25 A;  2GWK A;  4OGC A;  3VPZ A;  2GWJ A;  2PYL A;  2W41 A;  3BF1 A;  4KHP K;  3CJB A;  4DTN A;  2NRW A;  3CCJ N;  4CZJ A;  3OYG A;  1RDA A;  3TAR A;  3SJJ A;  3IG1 A;  5CZ1 A;  1TL1 A;  2WTU A;  1HKG A;  3O9R A;  1QSS A;  4PQU A;  1NK4 A;  2PAV A;  2YX6 A;  3M8S A;  3AVI A;  3QB0 A;  2IVN A;  3E9O A;  1QQC A;  5EU7 A;  1YT3 A;  4FOE A;  2X74 A;  3E66 A;  5C0Y A;  4JK8 A;  4BG9 A;  4CF2 A;  3O9T A;  4BRE A;  1ZBI A;  2Z1H A;  4HUG A;  3AA3 A;  4I7F A;  3V9U A;  3ZYY X;  2P9L A;  3C6H A;  3OYJ A;  1GLC G;  5EXW A;  3MN9 A;  2RN2 A;  5FRO A;  3T1H K;  4A2B A;  2P9N A;  1NKB A;  1NJW A;  3V1O A;  2AJQ A;  2FSK A;  4OO1 J;  4B9V A;  3TAM A;  2W6K A;  2VG5 A;  2FC0 A;  4LC9 B;  4CJL A;  4IOC L;  3CHW A;  1B9F A;  3CCV N;  4DQI A;  1NK9 A;  5ADX H;  4CD3 A;  5LY3 A;  2UYT A;  1DTT A;  1ZC6 A;  4DFM A;  5LL6 Z;  4NYN A;  5M1O A;  5GAH P;  1KAX A;  4CW7 B;  4DR6 K;  2FXU A;  3P5J A;  3EZ5 A;  4B9U A;  2VGM A;  1JL1 A;  2HMP A;  3SZ2 A;  4ISE A;  5F1X A;  3ID6 A;  1VQN N;  1S6P A;  4OKJ A;  3ZSW A;  4O0J A;  1LWE A;  3GDQ A;  3PY8 A;  2EWS A;  1KVA A;  3RR8 A;  1RDW X;  3L6Q A;  4WF9 L;  1TL3 A;  3CD6 N;  1S1U A;  1LAV A;  3D45 A;  3EYZ A;  1EXQ A;  4F4K A;  3CI5 A;  1XHZ A;  2ASP A;  2OPQ A;  4X66 K;  2X6S A;  3EKS A;  3QDK A;  4AQY K;  2YV0 X;  3MMV A;  1WSJ A;  4YDU C;  4E0D A;  4CEO A;  3MXI A;  1X9M A;  2HST A;  4IOA L;  4AHR A;  4IO9 L;  3NH2 A;  3SBT A;  2OZM A;  3FGU A;  2HHX A;  2PY5 A;  4B3R K;  3AVB A;  3LAN A;  3NF7 A;  4MDB A;  2RHK A;  4FW2 A;  2D0B A;  3KLF A;  5TKY A;  5AFU H;  4A5B A;  4FK4 A;  4B1U B;  2UUB K;  4BC3 A;  3HO1 A;  2QM1 A;  4CIG A;  3UKR A;  1SKS A;  4BY9 C;  4L3Q A;  4RCH A;  4BR5 A;  2OTL N;  5AQG A;  2BTF A;  3KLG A;  3TPQ A;  2B6A A;  4JV5 K;  2DTU A;  4H0P A;  4BGB A;  3QNN A;  1VSL A;  3V1R A;  3K58 A;  4CZL A;  1KAY A;  2E20 A;  3VTH A;  1BHL A;  3CC7 N;  1L3U A;  3VQD A;  5ELZ A;  3OYD A;  4CEQ A;  1ZBU A;  4LF8 K;  3R9P A;  1Q9Y A;  2Q0R A;  5GAE P;  4LFC K;  3VF4 A;  5GAD P;  4FWS A;  4YOR A;  1LCU A;  4IDK A;  4DQR A;  1VSH A;  4NXN K;  4DF4 A;  5FLX O;  4CJE A;  4FJK A;  3RMB A;  1HQE A;  4CFB A;  1RNH A;  2YKN A;  4IO8 A;  3CPW M;  4K42 A;  3OS0 A;  4JRQ A;  4DR1 K;  4DR5 K;  4E7J A;  3EO3 A;  5I9E B;  5M1K A;  3L2Q A;  3LAM A;  5IWA K;  1BI4 B;  4ISG A;  2HHQ A;  1Q7Y O;  2Q97 A;  3NH1 A;  2P51 A;  4BR4 A;  5BRH A;  4ILH A;  4XH5 A;  1OH5 A;  4JD2 B;  4CGD A;  4CHN A;  3H3O B;  3DLE A;  1J9A A;  3N4P A;  2O4G A;  1BIS A;  4KFB A;  3E01 A;  1K73 O;  4MDA A;  1TYQ B;  1TK0 A;  1HJO A;  3MWP A;  4Y1D A;  3WNH A;  3HM8 A;  3C6U A;  4Z0U A;  2Y1I A;  4JKC A;  4DSK A;  3I8B A;  3PX4 A;  1Q86 O;  2UXB K;  5J2N A;  3ULE B;  3K9K A;  3SNN A;  3CJC A;  1E4G T;  2Q0U A;  2V52 B;  3R1X A;  2HF4 A;  1C0T A;  3VEZ A;  4FJ8 A;  3U9D A;  3KKR A;  1RBS A;  4LF4 K;  3CM5 A;  1R0A A;  3UE5 A;  4YOT A;  3LDQ A;  3OYB A;  4BGA A;  3RR7 A;  1Q9X A;  1NGE A;  4ILG B;  4B9L A;  1XWL A;  3QLH A;  3C7N A;  5CHI A;  1VQ6 N;  5CR4 A;  3VEX A;  3I55 N;  1X9W A;  1BQM A;  5H1S Q;  3VQQ A;  3WXI A;  1CZB A;  4FJ5 A;  3IMX A;  5AJ3 K;  3PIO L;  3VQ6 A;  4YOW A;  4G1Q A;  2OA8 A;  3NHG A;  1DKG D;  5BRD A;  5DM7 L;  2B4J A;  4IFE A;  1NK5 A;  1XC3 A;  4FL9 A;  3T19 A;  2PFU A;  4DV0 K;  3M8P A;  1HNV A;  4WQ5 A;  3RMD A;  4CZM A;  1VQM N;  1BI4 A;  1HYZ A;  1S1W A;  5KRT A;  4JD2 A;  3ZSQ A;  1C1A A;  5C42 A;  4I9L A;  2PBD A;  4CJ5 A;  2P9U B;  3G4S N;  3SUQ A;  1M1K O;  2OTJ N;  5AQP A;  1U6Z A;  3ATV A;  2YHW A;  2EHG A;  4FJ9 A;  1TYQ A;  3ZT2 A;  3VEO A;  4WQ4 A;  4QS8 A;  4B1Z A;  4JKG B;  2V51 B;  1NJZ A;  4BRQ A;  3ULE A;  5SZT A;  2QK9 A;  2NLX A;  4ID1 A;  3NMU A;  2HNZ A;  2NRZ A;  1BA0 A;  4RW6 A;  4FWP A;  5LJV A;  5J2M A;  2KTQ A;  2OPP A;  2RKI A;  4DTX A;  1DLO A;  3JXU A;  4CF1 A;  3VQC A;  1JLF A;  3TR8 A;  3A5N C;  2HHW A;  3OYL A;  4WQ5 C;  5I42 A;  4MO4 A;  1NJY A;  4FM2 A;  1KQS M;  4CE9 A;  1OVQ A;  4KTZ A;  3KHY A;  3VEW A;  4GVE A;  3OS1 A;  4OKE A;  3DWL A;  4PA1 A;  1NLV A;  2UXC K;  1JCF A;  3O80 A;  1KC8 O;  3I0S A;  4FWK A;  4WQ4 C;  4FK2 A;  3CMA N;  3AGR A;  1I3A A;  3MN5 A;  1NGB A;  3CCM N;  3M8Q A;  2O8E B;  3TTF A;  3ALY A;  1J5O A;  2G8V A;  5AQN A;  3CQY A;  4FJX A;  2ITM A;  1NU0 A;  2NRT A;  4KO0 A;  5AQJ A;  3P4I A;  1T44 A;  2I5J A;  4CF0 A;  1IBM K;  1OH8 A;  4N47 A;  1P90 A;  2Z1I A;  4IG0 A;  5DMR A;  3H08 A;  1SQK A;  3AAP A;  3LAK A;  4H5V A;  2KQ2 A;  2QXF A;  4BRL A;  2FBV A;  2O8D B;  4FLY A;  2P9U A;  4DTO A;  2KKZ A;  3R3L A;  3VEY A;  4DTS A;  5C15 A;  4BVO A;  4FWR A;  3AO5 A;  2WUS A;  2QWQ A;  3H1V X;  4CGJ A;  4EP4 A;  5JMV A;  3U3Y A;  3NVM A;  4EFH A;  1RDC A;  3G6E N;  2FBT A;  1WBB A;  2G8H A;  1D5A A;  4CBU A;  1VSM A;  4FWN A;  3D7E O;  2CH6 A;  3TSP A;  5GIP A;  3BGR A;  2E88 A;  3K5M A;  4QS9 A;  3AVM A;  3O3H A;  4DR3 K;  1U04 A;  4KHW A;  3HT3 A;  3OYK A;  2GBZ A;  3L0Q A;  4EZ9 A;  3AVJ A;  3CJ1 A;  3QEW A;  4FO0 A;  2O8B B;  3MN7 A;  1NOZ A;  1O1W A;  3VOV A;  3LPT A;  4DHY A;  1T7P A;  4E7I A;  3KZB A;  1RT1 A;  3QEX A;  4C1N I;  4O8K A;  1KVC A;  5FRM A;  2HBJ A;  2FBX A;  3VQ4 A;  4ELU A;  3KLI A;  3ZT1 A;  4CGI A;  4YHH K;  3MED A;  4FWO A;  2AP1 A;  4M42 A;  3D2F A;  3CJA A;  4NLC A;  4BR2 A;  3O4W A;  1FW6 A;  4FLV A;  5T7B A;  4YY3 K;  4H4O A;  3A8Y A;  3V9W A;  4UQG A;  2YJE A;  3NF8 A;  1XNQ K;  1X9S A;  2QKB A;  3U3G A;  1HKB A;  3BEX A;  3HK2 A;  4B8A B;  1YJW N;  1HNX K;  3SUN A;  4CJQ A;  3FZK A;  5D3G A;  4DS5 A;  1FKO A;  3CC2 N;  1ESV A;  1JCG A;  3HVR A;  4CK3 A;  1B92 A;  2O8D A;  2D0O A;  3KWI A;  4F3T A;  3MDQ A;  3VET A;  4Q0B A;  3LP3 A;  4JI2 K;  2A1R A;  3QEP A;  3NGY A;  4WCE L;  3V81 A;  4NCG A;  3J80 O;  4B3S K;  2W42 A;  2YNI A;  3H46 O;  4OPA A;  1ASU A;  1KAZ A;  3O3F A;  4C8O A;  4IJA A;  4Q5V A;  3EE8 A;  1QE1 A;  3AGK A;  4MLE A;  3AVN A;  4L8R B;  4DFJ A;  3J8A A;  4FZX C;  2P9L B;  4FJI A;  1KVB A;  4H0Y B;  5JS2 A;  3OYM A;  4WFN L;  5BPN A;  1YHQ N;  3AVF A;  4BRM A;  1ILY A;  5CY4 A;  2ZM6 K;  4M3X A;  5HOO A;  4DKW A;  4QS7 A;  5KQ8 A;  3D2E A;  4YOY A;  4BAC A;  1HPM A;  1ZBF A;  3T1Y K;  2E2N A;  5LMN K;  1WUA A;  1RTH A;  3ULD A;  3P83 D;  1RDB A;  4IFY A;  4DQP A;  4K25 A;  3OJS A;  2QKK A;  2GV9 A;  3OBW A;  1IG8 A;  4BRD A;  4CEC A;  4JI4 K;  1WB9 A;  4A57 A;  2WFB A;  4FVU A;  3CFO A;  1ZYQ A;  4GV6 A;  4A59 A;  1NGA A;  2VWK A;  2ZF5 O;  4F2S A;  2JWK A;  1WSF A;  1ATS A;  3FZH A;  4KTW A;  3THY A;  4KH5 A;  1J6Z A;  3LP1 A;  3DLK A;  2HW3 A;  1XQS C;  3LZI A;  3CM6 A;  3ZCM A;  1BIZ A;  3VGL A;  4FCY A;  2HND A;  1QHT A;  3OBY A;  4BRP A;  4KHQ A;  5AQY A;  4CK2 A;  4DLE A;  2NRH A;  3FFI A;  2WBN A;  1UA0 A;  3LDO A;  1VAZ A;  2VGN A;  4DV4 K;  4ELT A;  1RT3 A;  1JXE A;  1RTJ A;  3TAE A;  5SWM A;  3EE9 A;  1S9G A;  3HXM A;  3LDS A;  4C8N A;  1TGO A;  3LDL A;  2HVI A;  3AA5 X;  5JLF A;  4BRC A;  4YFU A;  3TAN A;  5AFU A;  3QER A;  3CG7 A;  1MU2 A;  4I2P A;  4CFA A;  3J7Z O;  1WLJ A;  3EY1 A;  1XC9 A;  4DU4 A;  3KIO A;  4ID5 A;  1VQP N;  1VQ9 N;  1NK0 A;  3CCQ N;  4I9Q A;  3IFR A;  4CEF A;  1EKE A;  1JLG A;  2YNH A;  1EET A;  1VSF A;  3WNG A;  3UKR B;  3M6G A;  4CZH A;  1DT9 A;  1KXP A;  1DEJ A;  1JLB A;  4M3W A;  5BPL A;  1NNE A;  3I56 N;  3LZJ A;  2G8F A;  1HX1 A;  4YDU A;  2YHX A;  4BQL A;  4BRF A;  1TAU A;  1VSI A;  5GIO A;  2VG7 A;  3TAQ A;  4B1V A;  4DF8 A;  3NDK A;  3WXK A;  1HMV A;  3S3M A;  3UIQ A;  3U8X A;  3WT0 A;  3HYF A;  4C8M A;  4A62 A;  2NRR A;  3DRR A;  3K2P A;  4DSL A;  2FSN A;  4B8C A;  3PO4 A;  4KV8 A;  1NK8 A;  4W5T A;  4AM6 A;  5J2Q A;  1GLF O;  1U2V A;  4FJN A;  3IS9 A;  2Q3S A;  4FLW A;  4KHN A;  4AM7 A;  1S1X A;  2AA4 A;  1YTU A;  3PSI A;  3HOS A;  3DI6 A;  3R8E A;  1L3T A;  2P5G A;  3LAL A;  4PHT X;  1QVG M;  3QES A;  2OPR A;  1T8E A;  3VQ5 A;  4LD0 A;  2D4W A;  3HZ6 A;  3A5O C;  3S9H A;  2PYJ A;  1E4F T;  5M1Q A;  3QIP A;  2RF2 A;  3R6M A;  2DFE A;  2E6L A;  2R7Y A;  1HRH A;  3AVG A;  3T3F A;  1CZ9 A;  1HKC A;  3SBG A;  1GLJ O;  1HUX A;  4J8F A;  3VQA A;  4AHV A;  2HF3 A;  1IG9 A;  1OKJ A;  4O5B A;  1CZA N;  3DXM B;  3B8A X;  4X64 K;  4U67 L;  1G99 A;  2XY7 A;  4H0V B;  3FZL A;  2BH1 A;  4M7Y A;  1H1V A;  2F7T A;  3NF6 A;  1BA1 A;  4CIE A;  5AQL A;  3OYF A;  1ZBL A;  1W2B M;  2KW4 A;  2WOM A;  2UXD K;  4HTU A;  4DFK A;  4ILJ A;  5C2F A;  2YCH A;  4JN4 A;  4CGG A;  3VER A;  3H6E A;  3ZSZ A;  1F21 A;  1HNI A;  3ZT4 A;  4CJW A;  3C7N B;  3SQ4 A;  4LF7 K;  4XEI A;  4DV6 K;  5DK5 A;  4JKB A;  1OH7 A;  1WNS A;  2IAJ A;  2ITG A;  3ATU A;  5C12 A;  3SQ2 A;  3SQ0 A;  1V4T A;  4DV5 K;  1VRT A;  1TKX A;  1TUY A;  4JLH A;  4JK7 A;  1HNZ K;  3VTI A;  3U4L A;  3HPG A;  4LFA K;  4KH4 A;  3QFP A;  4CJU A;  5AQZ A;  4LSL A;  3HP9 A;  3SMP A;  4F9O A;  2GEL A;  4GKK K;  5KGX A;  2ZJR L;  2Q2R A;  3H1Q A;  4CES A;  3K0S A;  5AQX A;  1M90 O;  1J53 A;  1NMD A;  4BRO A;  2KLA A;  4JI8 K;  3VN5 A;  2HVH A;  3MX2 A;  1KLM A;  5GAG P;  4CF8 A;  5TKW A;  5K14 A;  4H5R A;  3GG4 A;  3SLC A;  3SUP A;  1N6Q A;  3U9Z A;  5E41 A;  4TSX A;  4OLB A;  2KZZ A;  3VF2 A;  3GBT A;  3PUF A;  4EZ6 A;  3GOI A;  4E89 A;  4DV3 K;  1X1P A;  5B8H A;  4XIU A;  4B9N A;  2NRX A;  1GLL O;  3BF3 A;  1X3N A;  3DXM A;  3LDN A;  4BWM A;  4X65 K;  1N8R O;  4FPA A;  2BUP A;  4KHU A;  4JI1 K;  1RTI A;  2E1Z A;  1HPZ A;  4CHY A;  3OYI A;  1KD1 O;  1BCO A;  4DR2 K;  4M3U A;  5EY4 A;  1BO5 O;  2BAN A;  3LDP A;  1T03 A;  4WFB L;  1P8Z A;  5FPN A;  1XMO K;  2IVP A;  4B9T A;  3RWU A;  4DR7 K;  1QS4 A;  3AVA A;  4EIA A;  5AQF A;  4CZG A;  4WFA L;  5JLH A;  1SV5 A;  4E3S A;  1NM1 A;  1MWM A;  4CD1 A;  4RW4 A;  3KK1 A;  1SL0 A;  3DLR A;  4HUF A;  4JI5 K;  1Y97 A;  1DGK N;  3CME N;  3V6D A;  1JLQ A;  3GE1 A;  3O9U A;  3CCS N;  3MXM A;  1VQ8 N;  3NE6 A;  3FFK B;  4IXC A;  2V7Y A;  3SK3 A;  2F9T A;  5LMU K;  1CXU A;  1VQ5 N;  2GEM A;  2F8T A;  2VWB A;  3WXM B;  4B08 A;  5CE3 A;  1G15 A;  4PKH A;  1LAW A;  3VEV A;  4PL7 A;  3P38 A;  2D0P A;  4JI0 K;  2NUB A;  1RFQ A;  3MEC A;  1HYS A;  4J2A A;  5I3U A;  4DTU A;  3ZT3 A;  2OAN A;  4E7L A;  1Z26 A;  3EZW A;  2GUI A;  3D0P A;  1VQO N;  2IC3 A;  5AQH A;  1SKW A;  4JRP A;  3P31 A;  3O8M A;  4CBW A;  5BN9 A;  3MXJ A;  1ASW A;  4ZTF A;  1Z05 A;  3M5R A;  4CVN E;  1KTQ A;  4OPH A;  4JAX A;  1TV6 A;  3CYM A;  2YHA A;  4CFD A;  2DPN A;  2P9I B;  5AQW A;  1RBR A;  2ZD1 A;  4YOV A;  3DOK A;  4KH6 A;  4DB3 A;  2ETJ A;  2OZS A;  1U48 A;  4E7K A;  1KRP A;  4KB1 A;  2JGU A;  1VSK A;  3SQ1 A;  3VQP A;  1S1V A;  1VSJ A;  3OA9 A;  1N5Y A;  3CJ7 A;  5EOY A;  4C23 A;  4CZE A;  4HTL A;  5M1F A;  3F2K A;  5KI6 A;  5HBM A;  4FJL A;  4CJK A;  4GKJ K;  4HCC A;  4B9Q A;  2Z1G A;  3ZX0 A;  4IEI A;  2EX3 A;  3D2F B;  3EEQ A;  4LSN A;  4DSI A;  3OYH A;  2OCE A;  2O8C B;  3B6O A;  3EKU A;  4GY2 B;  1XNR K;  4XH4 A;  4KI4 A;  4DTJ A;  5AQI A;  3MX5 A;  4B1X B;  3THX B;  5KRS A;  1Q82 O;  3O08 A;  4CZK A;  4Z4C A;  1U47 A;  1EO1 A;  3G0Z A;  4PWD A;  4FLU A;  3ZSO A;  5HRO A;  2LSN A;  3Q7B A;  3VQE A;  3RSE A;  3NGZ A;  5HP1 A;  2D5R A;  3PIP L;  3L4I A;  1NGG A;  3A5M C;  1MA9 B;  2P9S B;  3PX6 A;  5AQR A;  3LP2 A;  1RDD A;  5E26 A;  3WNF A;  2VG6 A;  5AQK A;  1ASV A;  4JEP A;  2VYP A;  1JLC A;  4CZI A;  3TI0 A;  3CFP A;  1C0G A;  1EWQ A;  1UWB A;  2D0C A;  3DXK B;  5HLF A;  3DLG A;  4Z4H A;  5GIN A;  5IT9 O;  4RW9 A;  2IVO A;  1W0H A;  4W5N A;  1BGX T;  2G8U A;  2P9I A;  2XY5 A;  3DMJ A;  3MCP A;  3CCE N;  1L3V A;  4JHD A;  4BRI A;  4FWL A;  3CJ9 A;  2HHH K;  1ZBH A;  2HBM A;  2F8S A;  4BRA A;  4YNQ A;  4CJT A;  1MWK A;  3O4N A;  3QBW A; 
#chains in the Genus database with same CATH homology
 3KJV A;  4AHR A;  2KFN A;  4DTP A;  2KFZ A;  1GOC A;  3NH2 A;  2XY6 A;  3I8D A;  3LP1 A;  2OZM A;  2HHX A;  3DLK A;  2PY5 A;  1RBV A;  3OYN A;  3IAY A;  2HW3 A;  3LZI A;  1NKC A;  3CM6 A;  3AVB A;  3LAN A;  3NF7 A;  3AO1 A;  3ZCM A;  4CER A;  4N56 A;  4JS4 A;  4CEB A;  3SPZ A;  1BIZ A;  4FW2 A;  2D0B A;  2HND A;  4FCY A;  1QHT A;  3KK2 A;  2BE2 A;  1TKZ A;  1KFS A;  4KHQ A;  4CK2 A;  1Z25 A;  3KLF A;  2X78 A;  4DLE A;  4LH4 A;  3FFI A;  4CIF A;  1UA0 A;  4FM0 A;  4FK4 A;  4FW1 A;  4AHT A;  3RMA A;  4ELT A;  4F2R A;  4CHO A;  3HO1 A;  3BDP A;  3QEI A;  1RT3 A;  4CIG A;  1NOY A;  1JXE A;  1RTJ A;  3TAE A;  1SKS A;  5SWM A;  1D8Y A;  1WSG A;  3AA2 A;  3U6F A;  5J1E A;  4QOZ B;  3ISN C;  1S9G A;  1SUQ A;  3HXM A;  3ZSY A;  4C8N A;  1BIU A;  5HRN A;  3JSM A;  1HYV A;  1TGO A;  3LDS A;  1RT6 A;  1U49 A;  3KLG A;  3HJF A;  2B6A A;  2DTU A;  2HVI A;  3AA5 X;  3K5L A;  3QNN A;  1CLQ A;  4FLZ A;  3DRS A;  1VSL A;  4FZZ A;  4YFU A;  3TAN A;  3V1R A;  2YNF A;  3K58 A;  4ELV A;  3QER A;  1BHL A;  3S3N A;  4O44 A;  3NF9 A;  2HHV A;  1L3U A;  3VQD A;  2VWJ A;  3CG7 A;  3K5N A;  1MU2 A;  3OYD A;  3AV9 A;  4W5Q A;  4KRF A;  4ZTJ A;  4I2P A;  4CEQ A;  1VRU A;  1ZBU A;  1BQN A;  4CFA A;  3SPY A;  4K8Z A;  1WLJ A;  3EY1 A;  1TK8 A;  4Z4F A;  1XC9 A;  1Q9Y A;  5CYM A;  4I2Q A;  3NBP A;  4W5R A;  3KLH A;  4DU4 A;  1C0M A;  3KIO A;  4ID5 A;  2YKM A;  4R5P A;  4EP5 A;  4IDK A;  4DQR A;  1C0U A;  1VSH A;  1NK0 A;  1LV5 A;  4I9Q A;  1LW2 A;  4Z4E A;  2HHU A;  1WAF A;  3PO5 A;  1VSD A;  3ZT0 A;  4CEF A;  4DF4 A;  1EKE A;  1JLG A;  3QEV A;  2YNH A;  3TAG A;  4CJE A;  1IO2 A;  1EET A;  3ITH A;  4O55 A;  3ZSR A;  1VSF A;  3DOL A;  4FJK A;  3WNG A;  2DFF A;  3RMB A;  1HQE A;  2G8W A;  4CFB A;  4FJG A;  1RNH A;  2YKN A;  1DTQ A;  4CJR A;  3RRH A;  2Y1J A;  4OJR A;  3L2W A;  3OS0 A;  3HPH A;  4JRQ A;  4BDP A;  4IBN A;  5JS1 A;  4N76 A;  4E7J A;  1VSE A;  1JLB A;  3M8R A;  3WNE A;  3LAM A;  4O0I A;  3L2Q A;  4FK0 A;  1D9D A;  1BI4 B;  4M3W A;  2HHQ A;  1T05 A;  1LWC A;  3LZJ A;  2G8F A;  3NH1 A;  4M3T A;  2P51 A;  4CEZ A;  4AHC A;  3AVK A;  1TAU A;  1VSI A;  4CGD A;  2VG7 A;  3TAQ A;  4DF8 A;  3NDK A;  4CHN A;  5J2P A;  3AO3 A;  3V9X A;  1K6Y A;  1RT7 A;  4LH5 A;  1S6Q A;  1HMV A;  3VQB A;  4DU3 A;  3DLE A;  2XRI A;  1J9A A;  2IDO A;  3C94 A;  3S3M A;  1BL3 A;  2O4G A;  3UIQ A;  4CEA A;  1BIS A;  3DLH A;  1UOC A;  3HYF A;  4KFB A;  3E01 A;  4C8M A;  4FYD A;  3V9S A;  3DRR A;  3K2P A;  1TK0 A;  4DSL A;  3KLE A;  2HHS A;  2O4I A;  2YNG A;  4B8C A;  3PO4 A;  1KLN A;  4KV8 A;  4Y1D A;  3WNH A;  1NK8 A;  3C6U A;  4Z0U A;  2RPI A;  1ITG A;  2Y1I A;  4W5T A;  4CEE A;  4DSK A;  3PX4 A;  5C24 A;  5J2Q A;  2X6N A;  5J2N A;  3VQ8 A;  2HB5 A;  4O4G A;  2OPS A;  1RT5 A;  4FJN A;  3IS9 A;  3SV4 A;  2Q3S A;  3PX0 A;  3SNN A;  4BE2 A;  3VQ9 A;  1A5X A;  4FLW A;  1NJX A;  3KD5 E;  4H8K A;  1C0T A;  1WSH A;  1HQU A;  1C1B A;  1S1X A;  4KHN A;  4FJ8 A;  1YTU A;  4CJV A;  1JL2 A;  3KKR A;  4H4M A;  3DI6 A;  1L3T A;  1RBS A;  2P5G A;  3KK3 A;  4J2B A;  3LAL A;  3K59 A;  3CM5 A;  2OPR A;  4DU1 A;  3QES A;  1R0A A;  1T8E A;  4M3Z A;  3VQ5 A;  4LD0 A;  3OYA A;  3S9H A;  3SV3 A;  3QO9 A;  2PYJ A;  4AHS A;  1RT2 A;  3OYB A;  3QIP A;  3RR7 A;  3MEE A;  1TAQ A;  2P1J A;  4RW8 A;  1Q9X A;  2RF2 A;  2DFE A;  4KHY A;  4IKF A;  4B9L A;  3V9Z A;  2E6L A;  1XWL A;  3QLH A;  3HPO A;  2R7Y A;  1HRH A;  2WON A;  3AVG A;  3T3F A;  1CZ9 A;  2ATQ A;  3OY9 A;  3DYA A;  3NCI A;  5FRN A;  2Z1J A;  3JYT A;  3T1A A;  1X9W A;  4N41 A;  3L2U A;  3B6P A;  4F8R A;  1WN7 A;  3O4Q A;  3VQA A;  4AHV A;  1BQM A;  1IG9 A;  3V1Q A;  4CK1 A;  4O5B A;  3VQQ A;  1SL1 A;  1WSE A;  1CZB A;  3RTV A;  4FJ5 A;  4CJS A;  4DWI A;  1REV A;  1IKX A;  1TKT A;  3VQ6 A;  1QSL A;  4G1Q A;  4BE0 A;  3OJU A;  3G10 A;  4HUE A;  4DG1 A;  3LPU A;  3CFR A;  2OA8 A;  2XY7 A;  3NHG A;  4Z4I A;  3O3G A;  4MFB A;  1L3S A;  3NF6 A;  4HVJ A;  4CIE A;  3C95 A;  3VQ7 A;  3OYF A;  1ZBL A;  2B4J A;  1NK5 A;  1JLA A;  2KW4 A;  3TAP A;  4FLT A;  1JXB A;  2WOM A;  3T19 A;  2JLE A;  4HTU A;  3I0R A;  4K8X A;  4OPK A;  1WSI A;  1EP4 A;  3A2F A;  2D0A A;  3M8P A;  1HNV A;  4FJH A;  2F96 A;  3RMD A;  1RTD A;  4CGG A;  3ZSZ A;  3SCX A;  1BI4 A;  1F21 A;  1HNI A;  3ZT4 A;  4CJW A;  4C8L A;  1HYZ A;  4E7H A;  1S1W A;  5HRS A;  3SQ4 A;  5KRT A;  4CGF A;  1C6V A;  3ZSQ A;  5DK5 A;  1C1A A;  5C42 A;  1FK9 A;  4I9L A;  4CJ5 A;  3SUQ A;  2ZE2 A;  3AA4 A;  4WE1 A;  1WNS A;  1C1C A;  2IAJ A;  2ITG A;  3MEG A;  4KKO A;  3SQ2 A;  3SQ0 A;  5FDL A;  4DSJ A;  1RBU A;  4KHS A;  2HNY A;  4CED A;  1VRT A;  1TKX A;  1Q8I A;  4JLH A;  4OGE A;  2EHG A;  4FJ9 A;  3ZT2 A;  3HPG A;  2ZQB A;  4ZHR A;  3RRG A;  4CJU A;  4KB0 A;  4LSL A;  1UAX A;  3HP9 A;  1NJZ A;  3OYE A;  1J54 A;  4DSF A;  3THV A;  4GW6 A;  3OVN A;  4PUO A;  2XY8 A;  5KGX A;  3K5O A;  2IOC A;  3ZSV A;  5SZT A;  1HJR A;  2QK9 A;  4ID1 A;  3L3V A;  4CES A;  4DMN A;  2HNZ A;  1UA1 A;  1RIL A;  1IKW A;  4RW6 A;  1A5V A;  1J53 A;  1WAJ A;  2HMI A;  4FJM A;  5J2M A;  4CJ4 A;  2KTQ A;  4CHQ A;  2KZM A;  4N5S A;  3LWM A;  2OPP A;  2RKI A;  1TVR A;  3C6T A;  4DTX A;  4Z4G A;  1DLO A;  3VN5 A;  2HVH A;  1KLM A;  3VQC A;  4CF1 A;  4M3Y A;  4ICL A;  1W9H A;  3V4I A;  4OLA A;  4CF8 A;  4DTM A;  1EX4 A;  1JLF A;  3TR8 A;  5K14 A;  2HHW A;  4CJ3 A;  3OYL A;  4FZY A;  1A5W A;  4GMJ B;  3SUP A;  5I42 A;  1N6Q A;  5CZ2 A;  5E41 A;  3VA3 A;  4TSX A;  4OLB A;  2KZZ A;  1NJY A;  4FM2 A;  4AHU A;  2XO7 A;  4CE9 A;  4FJJ A;  3MAQ A;  4KTZ A;  3L2R A;  3PUF A;  5KTQ A;  4OPJ A;  4JS5 A;  4EZ6 A;  4PY5 A;  4E89 A;  3F73 A;  3OS1 A;  4CHZ A;  4OKE A;  4PA1 A;  1X1P A;  4E1N A;  4XIU A;  2BGG A;  4QCL A;  4NYF A;  2BDP A;  1BCM A;  2P5O A;  4B9N A;  2FBY A;  1CXQ A;  4BWM A;  3I0S A;  1SL2 A;  4Y1C A;  4FK2 A;  4NCA A;  4KHU A;  4HCB A;  1I3A A;  1RTI A;  4E19 A;  3NFA A;  4CJP A;  1HPZ A;  4CHY A;  2XHB A;  3OYI A;  1SKR A;  1FXX A;  1BCO A;  3IRX A;  3LP0 A;  4LY7 A;  4F3O A;  4M3U A;  2BAN A;  3M8Q A;  4CCH A;  1IKY A;  3HVT A;  1D9F A;  4GVM A;  4OKK A;  4OVL A;  1T03 A;  3ALY A;  3ASM A;  1J5O A;  2G8V A;  4FJX A;  3SUO A;  4CHP A;  4KO0 A;  4B9T A;  3RWU A;  4DTR A;  2I5J A;  1NK7 A;  4KRE A;  1VK0 A;  4CF0 A;  3F9K A;  1QS4 A;  3AVA A;  4J2E A;  4N47 A;  4KI6 A;  2Z1I A;  4IG0 A;  5DMR A;  2B5J A;  3H08 A;  1SV5 A;  3HL8 A;  3LAK A;  2KQ2 A;  2QXF A;  4E3S A;  4KTQ A;  1IKV A;  2FBV A;  4RW4 A;  3KK1 A;  4FLY A;  3DLR A;  4HUF A;  4DTO A;  1SL0 A;  3HST B;  4DTS A;  1NKE A;  1Y97 A;  2DFH A;  3AO5 A;  3AVL A;  3V6D A;  1JLQ A;  4CGJ A;  4FLX A;  3MXM A;  4EP4 A;  3SI6 A;  3NE6 A;  1U4B A;  3U3Y A;  4AIL C;  1RDC A;  2FBT A;  2G8H A;  1D5A A;  1S1T A;  1XHX A;  3SYZ A;  4FJ7 A;  1CXU A;  4BWJ A;  1YTA A;  4KAZ A;  4CGH A;  3KTQ A;  2F8T A;  1VSM A;  4MQ3 A;  4W5O A;  4DSE A;  4B08 A;  4DLG A;  4B9M A;  1YVU A;  3BGR A;  3K5M A;  3QIN A;  1G15 A;  3LWL A;  3ZSX A;  1LAW A;  1KFD A;  3AVM A;  2OYQ A;  3L3U A;  3O3H A;  4CF9 A;  1RT4 A;  1U04 A;  4KHW A;  4BE1 A;  4M45 A;  4DFP A;  4RW7 A;  3HT3 A;  1S5J A;  3OYK A;  2YHB A;  5C25 A;  3NAE A;  2GBZ A;  1TKD A;  3KD1 E;  2NUB A;  3MEC A;  4EZ9 A;  4OGC A;  1HYS A;  3AVJ A;  4J2A A;  5I3U A;  4DTU A;  3ZT3 A;  2PYL A;  4E7L A;  3QEW A;  4DQS A;  1Z26 A;  1NOZ A;  5KGW A;  4DTN A;  2GUI A;  3D0P A;  2IC3 A;  4BDY A;  1O1W A;  3OYG A;  1QSY A;  1RDA A;  3TAR A;  3SJJ A;  1SKW A;  3IG1 A;  5HRP A;  3LPT A;  1TL1 A;  5CZ1 A;  4JRP A;  3DRP A;  4E7I A;  3PV8 A;  1RT1 A;  1T7P A;  3QEX A;  4BDZ A;  3MXJ A;  1KVC A;  1QSS A;  5FRM A;  1ASW A;  4ZTF A;  4PQU A;  1NK4 A;  1B9D A;  2FBX A;  3VQ4 A;  4ELU A;  1FKP A;  4FXD A;  4B9S A;  3KLI A;  3ZT1 A;  4CGI A;  1KTQ A;  3AVI A;  3M8S A;  1KCF A;  3MED A;  3QNO A;  4CJF A;  1TV6 A;  4M42 A;  3CYM A;  4IFV A;  1QQC A;  5EU7 A;  2YHA A;  3AO2 A;  4CFD A;  1YT3 A;  2X74 A;  3P1G A;  4CF2 A;  1IH7 A;  5HRR A;  5T7B A;  4FLV A;  1RBR A;  2IS3 A;  2ZD1 A;  1JLE A;  4H4O A;  1ZBI A;  3DOK A;  1TK5 A;  2Z1H A;  4HUG A;  1S9E A;  3AA3 A;  3DM2 A;  4I7F A;  3AO4 A;  3HP6 A;  3V9U A;  2ETJ A;  3V9W A;  2OZS A;  1U48 A;  4UQG A;  3OYC A;  3OYJ A;  3NF8 A;  3HM9 A;  1X9S A;  3AVC A;  2RN2 A;  2QKB A;  4E7K A;  5FRO A;  3U3G A;  1L5U A;  1KRP A;  2JGU A;  4KB1 A;  3S3O A;  4FM1 A;  1VSK A;  1I39 A;  3SQ1 A;  3CQ8 A;  1LWF A;  3VQP A;  1S1V A;  1VSJ A;  1NKB A;  1N5Y A;  3HK2 A;  4B8A B;  1NJW A;  3SUN A;  4CJQ A;  5D3G A;  4DS5 A;  1GOB A;  1RBT A;  3V1O A;  4QAG A;  2AJQ A;  1FKO A;  4CFC A;  5KI6 A;  5HBM A;  3NH0 A;  3HVR A;  4B9V A;  4M3R A;  4CJK A;  1B92 A;  3TAM A;  4CK3 A;  4FJL A;  4F3T A;  4KPY A;  2VG5 A;  4HCC A;  4Q0B A;  2FC0 A;  2E6M A;  2Z1G A;  3LP3 A;  4CJL A;  2A1R A;  3QEP A;  3VA0 A;  3NGY A;  1B9F A;  3V81 A;  4NCG A;  4DQI A;  2EX3 A;  2W42 A;  2YNI A;  1NK9 A;  1ASU A;  3NGI A;  3DLB A;  4LSN A;  4C8K A;  3O3F A;  4DSI A;  1DTT A;  3OS2 A;  3OYH A;  4C8O A;  4Q5V A;  1QE1 A;  4DFM A;  4L8R B;  3AVN A;  3B6O A;  3L2V A;  4DFJ A;  3TAF A;  3AVH A;  4NYN A;  1QTM A;  1NK6 A;  4FZX C;  4KI4 A;  4DTJ A;  3P5J A;  3EZ5 A;  4FJI A;  2E4L A;  4B3O A;  3TWH A;  1KVB A;  5JS2 A;  5KRS A;  3OYM A;  4Z4C A;  1U47 A;  4M41 A;  4B9U A;  5CYQ A;  4DS4 A;  3G0Z A;  3AVF A;  1JL1 A;  4AH9 A;  3KKS A;  3ZSO A;  4FLU A;  3QET A;  4PWD A;  5HRO A;  2LSN A;  4IG3 A;  4HHT A;  3SZ2 A;  5CY4 A;  3L8B A;  3VQE A;  4M3X A;  3NGZ A;  5HP1 A;  2D5R A;  1KSP A;  1S6P A;  4OKJ A;  3ZSW A;  4BAC A;  1ZBF A;  1GOA A;  3ULD A;  1RTH A;  4O0J A;  3PX6 A;  1LWE A;  3P83 D;  2HHT A;  3LP2 A;  1RDB A;  3PY8 A;  1RDD A;  4IFY A;  3WNF A;  4DQP A;  2VG6 A;  1KVA A;  3RR8 A;  3OJS A;  1ASV A;  2GV9 A;  2QKK A;  2IGI A;  4CEC A;  2G8K A;  1JLC A;  3TI0 A;  3CFP A;  4RG8 A;  1TL3 A;  4FVM A;  2PZS A;  1S1U A;  1LAV A;  3RMC A;  3D45 A;  2G8I A;  3EYZ A;  1EXQ A;  4F4K A;  1UWB A;  2D0C A;  3CFO A;  1ZYQ A;  5HLF A;  1XHZ A;  3DLG A;  2DY4 A;  1JKH A;  2OPQ A;  4Z4H A;  4RW9 A;  3QIO A;  1W0H A;  2X6S A;  4W5N A;  1BGX T;  2G8U A;  2YV0 X;  1XI1 A;  2VWK A;  1WSJ A;  2A1S A;  2XY5 A;  4DQQ A;  3DMJ A;  4E0D A;  4CEO A;  1U45 A;  1L3V A;  4F2S A;  3MXI A;  1X9M A;  1WSF A;  3TAB A;  4NCB A;  1ZBH A;  2F8S A;  1LW0 A;  4E1M A;  3K57 A;  4YNQ A;  1RCH A;  4CJT A;  4DFK A;  3O4N A;  4J2D A;  4KTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...