1WSIA

Crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGAGHPENERCNELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 45
structure length 152
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsiA00
1A5WA 1BISA 1ASVA 1D9FA 1BCMA 1JXBA 1U47A 2HHWA 3AVCA 1RBSA 4GW6A 4CJUA 2D0AA 4CK1A 4XIUA 5JS1A 1L3VA 1VSEA 2YNHA 1RDBA 3QETA 3DLRA 3L2RA 1X9MA 4KKOA 2OPRA 3U3GA 1BQNA 4FZYA 1IKXA 3QIOA 1D5AA 3AVHA 3V4IA 1YTUA 4AILC 1WLJA 1RT1A 4KFBA 3TI0A 1S5JA 2YV0X 3LP1A 4F2SA 5FRNA 4KHQA 1C0UA 3RR7A 1JLGA 3VQ5A 3K57A 2ZQBA 3V9UA 4E7IA 4F3TA 1KLNA 2NUBA 2DFFA 3ZCMA 1NOZA 4HTUA 5I42A 1YVUA 4CFDA 3DMJA 1JKHA 3MEGA 4GMJB 1ZBUA 3LP2A 3ZSZA 3KK1A 1JLCA 3K59A 4E7HA 4E7JA 3SYZA 1QQCA 2HB5A 4RW4A 1I3AA 3HO1A 4CHZA 2PY5A 4Q0BA 1L3SA 1WSHA 3NGYA 3I0RA 5J1EA 3SCXA 2IGIA 2QKKA 4QAGA 2XRIA 5EU7A 3VQ6A 4LY7A 1RBVA 3AVJA 2EX3A 1NK7A 4CHNA 3V9XA 1BHLA 3L2WA 2VG7A 5C42A 3SPZA 1T03A 3ZSWA 2HVIA 4NYNA 3NHGA 4Z4EA 4BE2A 3AVNA 4HVJA 3HXMA 2X78A 3ZT4A 2PYLA 3CM6A 3JSMA 2XY7A 4CK2A 4E19A 1RT3A 1JLFA 3PX4A 1IKVA 4DSKA 3VQ7A 5J2QA 1VRTA 3AVGA 2KFZA 1EKEA 2G8VA 4FJLA 1MU2A 1ZYQA 4E0DA 1XI1A 4CF9A 4Z4CA 3D0PA 4B08A 2FBVA 4W5RA 1NJXA 2E6LA 3ZSOA 3L2QA 3OYFA 3LPTA 5K14A 2FBXA 5DMRA 3VQAA 4ZHRA 4FLWA 4F8RA 3VA0A 1K6YA 4AHSA 4DTUA 1S6PA 4RW9A 3SQ0A 3TR8A 3DM2A 1UA0A 4DFPA 3AO5A 3C95A 4DF4A 1ZBLA 1NK8A 3OYJA 1I39A 1RBRA 3ZSQA 4CF1A 4J2BA 4J2EA 1FKOA 4KHSA 3SPYA 4FJ5A 3OY9A 3CFPA 3HYFA 2XY5A 4FZXC 5CY4A 4AHTA 4M3WA 4E3SA 3NGZA 4DLEA 4MFBA 1REVA 3IRXA 2AJQA 3EZ5A 4FJ7A 3HSTB 3DLGA 4CEOA 1WSIA 3PUFA 3C6TA 3SZ2A 5J2PA 2Y1JA 1ASWA 3HT3A 1NJYA 3QESA 1SL2A 4KTZA 4FK2A 4OPKA 1TKDA 2GUIA 5DK5A 3DOKA 4KB1A 3TAQA 2Z1HA 4B9LA 1JLEA 5KI6A 1G15A 1TGOA 4JRQA 4CJ4A 3K2PA 3KKSA 4DTPA 1QTMA 4OLBA 2YKMA 4DSIA 3RRGA 1TAQA 3DLEA 3NCIA 4J2DA 3MECA 1X9SA 4DFMA 4Z0UA 4DTJA 1N5YA 1BI4B 2ZD1A 4RW8A 3BDPA 3OYCA 3VQ8A 1TL1A 1RDAA 4WE1A 4LD0A 3V1RA 1HRHA 3MXJA 2I5JA 1J5OA 2HMIA 4JRPA 4J2AA 4L8RB 4FZZA 1LW2A 3HP9A 2IC3A 3CFRA 5I3UA 1VSLA 1JXEA 3VQQA 4CIEA 4CJPA 3M8RA 4CERA 3KKRA 1KFDA 4CGGA 4EZ9A 2RN2A 3SV4A 3B6PA 4DMNA 4HCCA 3NF9A 3HL8A 5D3GA 2D0BA 4W5TA 1L3UA 3LP0A 3O4QA 3ZSVA 4I2QA 4E7KA 1SL0A 4B9SA 1D8YA 4H4MA 3LALA 1Y97A 3ZT3A 4LSLA 2B4JA 1Q8IA 2HNDA 3E01A 4CE9A 4NYFA 2Y1IA 4Y1DA 3T19A 3KLIA 1JL1A 3HK2A 4DTXA 4CEAA 3EY1A 1JLAA 2G8IA 2QK9A 3AVKA 2G8WA 1RDDA 5CYMA 1S1XA 1WSEA 2LSNA 2P5GA 4O4GA 3QNNA 3L3VA 5KTQA 1R0AA 4KREA 1EP4A 4CF0A 4BWJA 3VA3A 3QEXA 3SQ1A 1C1CA 2FC0A 3HVTA 3DLHA 3O3FA 4BE1A 1SKWA 4OGCA 1U49A 4MQ3A 2Z1GA 3AO3A 4HCBA 1O1WA 4CFAA 4F4KA 1S9GA 4CJRA 1ASUA 4ELUA 2HNYA 1C1BA 3IG1A 4CF2A 4HUFA 3DLKA 3ALYA 1TK5A 4DLGA 3C6UA 3JYTA 4B8CA 1RT4A 4OKKA 3OS1A 3K5MA 4KV8A 1LAWA 1VSFA 3K5LA 3G0ZA 4JS4A 4CJKA 1UA1A 1NKBA 4NCAA 3DRSA 3OYHA 1KLMA 3HPHA 3O4NA 1X9WA 1T05A 4KI4A 2HVHA 4CECA 2VWJA 3L8BA 2BE2A 1KFSA 1ZBHA 4YNQA 3WNFA 4DSJA 3V9SA 4C8LA 1QHTA 1UWBA 5CZ2A 4CHOA 4DSFA 4FW1A 2E4LA 1KVAA 1CXQA 4M3ZA 4CEFA 4CGJA 3DRRA 4CCHA 3F73A 1Z26A 2JLEA 1N6QA 1HQEA 4B9NA 3LWMA 1GOBA 3TAFA 1X1PA 4CJSA 4FJGA 4ID1A 5C25A 1J54A 4B3OA 3V81A 2BDPA 3ZT0A 1NKCA 2HW3A 1TV6A 3ZSRA 1BL3A 4ICLA 3RR8A 4IG3A 3TWHA 1L3TA 4N5SA 4ZTJA 1SV5A 4DQSA 3RMAA 3AO1A 3RMBA 1SKSA 4M3UA 2YNFA 1B9DA 1C1AA 1BQMA 1GOAA 3OVNA 4H4OA 3LDSA 2HHVA 2YNGA 1FK9A 3OYBA 2QKBA 4QOZB 3QEPA 1L5UA 4BDYA 3T3FA 3HP6A 3KK3A 3ULDA 3LANA 4O0JA 2DFEA 4CJ3A 3KK2A 4CEDA 1T8EA 4DQPA 3VQDA 2KZMA 3VQPA 4FLVA 3TANA 2G8UA 3P83D 4LH5A 2O4IA 4CJWA 4FLZA 1FKPA 4KTWA 2RPIA 3IAYA 1TKXA 4Y1CA 5SWMA 5HBMA 3ZT2A 3ZT1A 4GVMA 3P5JA 4RG8A 3THVA 1ZBFA 1YTAA 4FYDA 3D45A 3KD5E 3AVFA 4IDKA 4OVLA 3MXIA 1VSDA 3AO2A 1S1TA 1BCOA 3BGRA 3O3HA 3SV3A 3NF8A 4CEZA 4E89A 3LWLA 4IKFA 4CJFA 3TAPA 3RWUA 4DTOA 4BDPA 3TAEA 3OJSA 3LPUA 3KLGA 1VSMA 3KD1E 3NF7A 3ZSXA 4CHYA 4IFVA 1U48A 3OS2A 1S9EA 1NJZA 3FFIA 4C8KA 4N56A 4FW2A 1BIZA 5CYQA 4KHWA 3VQCA 3PX0A 1LV5A 5JS2A 1UOCA 3RMDA 4N47A 2ATQA 3ASMA 4FLXA 4FK0A 3TAMA 2FBYA 3WNGA 1BIUA 1HQUA 2ETJA 3U3YA 4DF8A 1RTIA 1Q9XA 4CESA 2XHBA 1DTQA 3TARA 4H8KA 4DFKA 4KB0A 1LWCA 4KHYA 3LAMA 4KO0A 3ISNC 5HRNA 4FLYA 1IKWA 1WNSA 3U6FA 1RILA 1ITGA 1RBTA 1NJWA 1TVRA 2YHAA 4RW6A 3K5NA 4PQUA 4ID5A 4W5QA 4FJKA 3SUOA 1EX4A 4FJJA 3NFAA 3I0SA 4LH4A 2HHSA 3VQEA 3SQ2A 4FXDA 2DTUA 2ZE2A 2IS3A 2P51A 1S6QA 3VQ4A 4B9VA 4K8XA 4CHQA 1RTDA 4OKJA 2P5OA 1IH7A 3MEEA 3AVIA 3RRHA 1TKTA 2F8SA 2DY4A 3OYLA 4DU3A 3CYMA 4N76A 4KRFA 4ELVA 4CEEA 2IDOA 4KHUA 1RT2A 2YHBA 4CGDA 3SQ4A 1B9FA 1U45A 4FK4A 5KRSA 3PX6A 1C6VA 1JLQA 4BDZA 4FM1A 3KLHA 2E6MA 5J2MA 3L3UA 5FDLA 3QEVA 1NKEA 5KGWA 1KTQA 2HHQA 1B92A 2X74A 3DLBA 3OS0A 3OYIA 3NAEA 2Z1IA 4OKEA 4B9TA 3NH1A 1RTJA 4LSNA 1W9HA 4DTRA 2VG5A 3M8SA 3V9ZA 4CHPA 3NBPA 4C8MA 5HRSA 1NK6A 4CFBA 1DTTA 4M3YA 3HJFA 2G8HA 4EZ6A 3OJUA 5E41A 4AHVA 4M41A 3CQ8A 1RNHA 4E7LA 3S9HA 4DTSA 1KCFA 1RT6A 1UAXA 1C0TA 1DLOA 1S1UA 5C24A 1TAUA 4M45A 4DQIA 4CJTA 5CZ1A 4NCBA 1NK4A 3F9KA 4Z4HA 2RKIA 1XHZA 1J9AA 2VWKA 4JLHA 2G8KA 5KRTA 3DRPA 4C8OA 3NE6A 2D0CA 3AVBA 5KGXA 5HRRA 2PZSA 3SNNA 4NCGA 3HVRA 4FJIA 3VQ9A 3MEDA 3SI6A 3PY8A 1HPZA 3AVLA 3G10A 4CEQA 4CJLA 3UIQA 1WSGA 4CGFA 2Z1JA 4CJVA 4F2RA 2JGUA 2FBTA 1ZBIA 2XO7A 4TSXA 2GV9A 4Z4FA 2EHGA 1IG9A 3AA2A 4E1NA 3K58A 4HUEA 3CFOA 1BI4A 4CF8A 5HROA 4O0IA 5FRMA 3SJJA 3B6OA 4DG1A 3LP3A 3S3MA 4YFUA 3KIOA 3TAGA 3SUQA 1CZBA 2PYJA 1TL3A 2OZMA 1WN7A 4I9QA 3C94A 5FROA 1A5VA 2KTQA 4OJRA 2OPSA 3L2UA 3M8QA 3CM5A 3O3GA 1RBUA 4FJNA 4FJ8A 1FXXA 3KLFA 3I8DA 4B8AB 3KLEA 4B9UA 1SUQA 2HHTA 1KVCA 4OGEA 4UQGA 4DQRA 2QXFA 3V1OA 4CJEA 4FLTA 4ELTA 4KAZA 4M3XA 1S1WA 4CJQA 4DU1A 3AVMA 4CGHA 3SUPA 4FJMA 3AO4A 3AA3A 3WNHA 2B6AA 4F3OA 2OPPA 3V9WA 3NDKA 1J53A 4PY5A 4PA1A 1F21A 4FVMA 2VG6A 4IFYA 4M3RA 1SL1A 3QNOA 4KI6A 3H08A 3IS9A 5SZTA 3NGIA 1JLBA 4FLUA 3HM9A 4PWDA 4W5NA 2P1JA 1KSPA 1LAVA 4R5PA 3NH0A 1NOYA 2KQ2A 4CGIA 1W0HA 3LZJA 1KVBA 3OYGA 4OPJA 3OYNA 4AHUA 1RTHA 3QINA 4EP4A 4HHTA 4PUOA 2F8TA 2KFNA 1HJRA 4QCLA 1WSJA 5HLFA 3MAQA 4M3TA 2KW4A 1EETA 3S3NA 5T7BA 4Q5VA 1VK0A 3OYMA 3M8PA 4DU4A 4N41A 1NK9A 2X6NA 1U04A 2Q3SA 4CEBA 4FCYA 3SUNA 2HHUA 3P1GA 4CIFA 1NK5A 1RDCA 2A1SA 3K5OA 4O55A 4E1MA 3QEIA 1TK8A 4KHNA 1LWEA 4KPYA 4DTNA 1IO2A 1U4BA 1WSFA 4I7FA 3QERA 2KZZA 3HPGA 1QSYA 2OPQA 4Z4GA 1QE1A 2OA8A 3VN5A 1VSIA 3WNEA 3NF6A 2W42A 3LZIA 1IKYA 4FM2A 5HP1A 2A1RA 1VSHA 4I9LA 4FJHA 4DTMA 1CXUA 3OYAA 3MXMA 3V1QA 1TK0A 3KJVA 3KTQA 3V6DA 4AHCA 2R7YA 2G8FA 2ITGA 4CK3A 1XWLA 2RF2A 4CJ5A 3DOLA 1CLQA 1NK0A 1YT3A 4M42A 4O44A 4DFJA 4FJXA 4ZTFA 3T1AA 4IBNA 2OYQA 3QEWA 1HYSA 1A5XA 1KRPA 3ITHA 4CFCA 1QSLA 1RT5A 3OYKA 2F96A 1HYVA 4BE0A 4DSLA 4FJ9A 2WOMA 2X6SA 1HMVA 1LW0A 2YKNA 5HRPA 3AA5X 4W5OA 1S1VA 4BWMA 3AV9A 4JS5A 4O5BA 4B9MA 4AH9A 2BANA 1Q9YA 2YNIA 3NH2A 4Z4IA 2D5RA 3VQBA 1C0MA 4DS4A 3AA4A 3PV8A 4KTQA 3CG7A 3S3OA 3L2VA 1SKRA 1HNIA 3PO5A 1VRUA 1Z25A 2B5JA 1CZ9A 4C8NA 4CIGA 3OYEA 4DWIA 3QO9A 1QSSA 2BGGA 1RCHA 2XY6A 2HHXA 3QIPA 2HNZA 4RW7A 3RMCA 1TKZA 4DSEA 4I2PA 1LWFA 1WAFA 3OYDA 3TABA 4AHRA 1EXQA 1WAJA 1RT7A 3EYZA 1BGXT 3QLHA 2DFHA 1GOCA 2GBZA 3LAKA 3DI6A 1QS4A 5J2NA 4K8ZA 1T7PA 1XC9A 2IOCA 4IG0A 4EP5A 2XY8A 1XHXA 3ZSYA 4FM0A 4G1QA 1VSJA 4HUGA 4BACA 3PO4A 1HNVA 1JL2A 3HPOA 3AVAA 3DYAA 2WONA 4OLAA 4DQQA 2O4GA 4DS5A 1D9DA 1HYZA 3RTVA 2IAJA 2OZSA 1VSKA 3A2FA
chains in the Genus database with same CATH superfamily
1A5WA 1BISA 2HHWA 1BCMA 5GIOA 1KXPA 3D2FB 1RBSA 4CJUA 2D0AA 5JS1A 4DV5K 2YNHA 4HWIA 4B3RK 4GKJK 1JJ2M 2OPRA 3U3GA 2O8EA 3QIOA 3V4IA 3FZLA 2P9SA 1OKJA 1RT1A 2YV0X 4OPAA 5FRNA 4ISEA 3K57A 4JK7A 4E7IA 2NNWA 1KLNA 4KH5A 3ATUA 3ZCMA 1NOZA 4DV2K 4HTUA 5I42A 4BREA 1JKHA 3LP2A 3ZSZA 1JLCA 2A42A 4RW4A 2VCPA 1GLBG 3O9RA 3NGYA 3SCXA 2VWBA 4BC4A 4CD1A 4LY7A 1NK7A 5C12A 4CHNA 1BA0A 1HNWK 4C1NI 2VG7A 3UB5A 1NGCA 2NRRA 4DQ8A 3JSMA 2XY7A 4CK2A 3HM8A 1NU0A 4QS9A 3PX4A 2P9PA 4DV0K 3AVGA 2KFZA 1EKEA 1W7AA 3VGKA 5GADP 5LJVA 4CF9A 5BREA 3CF5L 3D0PA 1KQSM 4W5RA 2E6LA 3OYFA 3CXCM 3VQAA 3VA0A 1K6YA 1S6PA 1ATSA 3T1HK 4FWSA 1ZBLA 4J2EA 1I39A 1RBRA 2GELA 3ZSQA 4KHSA 4JKBA 3SPYA 3OY9A 3CFPA 3HYFA 2XY5A 4FZXC 1NGJA 1NMDA 1VHXA 1Q86O 4E3SA 4DLEA 4MFBA 3DLGA 4CEOA 3SZ2A 3C6TA 3HT3A 5AQNA 1NJYA 3QESA 3ENOA 4BG8A 3UKRB 4OPKA 1TKDA 5DK5A 4JD2B 4B1WB 3DOKA 4KB1A 3QMLA 4X66K 4B9LA 4DV3K 1EQYA 4IZ9A 3FZKA 4DSIA 3RRGA 1N34K 3WEEA 3DLEA 3NCIA 4J2DA 3MECA 3EE9A 5AQTA 4DFMA 4DTJA 1X9SA 2NZTA 2ZD1A 5F1XA 2QWLA 1TL1A 2O8BA 1RDAA 3GOIA 5ELZA 4BRHA 2HMIA 1U6ZA 4J2AA 2HHHK 4YOXA 3CFRA 3IFRA 3N4QA 3VQQA 3DXMA 4CIEA 3QICA 4C23A 2E2PA 3THWA 5M1NA 2RN2A 3SV4A 3EKSA 3NF9A 4BR7A 3G4SN 2UXCK 2D0BA 3LDPA 4X62K 4W5TA 1L3UA 4E7KA 3S41A 5FPEA 4FWKA 1D8YA 2E88A 3CC7N 4YOVA 3H45C 1HKCA 3ENHA 4OO1J 3T19A 5AFUH 2G8IA 1WBBA 2LSNA 5DM7L 1R0AA 4KREA 1EP4A 4LC9B 4BWJA 3SQ1A 1C1CA 3O3FA 1O13A 1XC3A 1SKWA 1J5EK 4DCHA 3A0IX 4CZLA 3AO3A 1O1WA 4CFAA 4F4KA 3NMUA 4B8CA 3OS1A 4FLVA 1UA1A 4KV8A 1VSFA 4CJKA 1X9WA 1KLMA 5AQZA 4KI4A 4JKAA 2O8FA 5FPNA 2KHOA 1OVQA 3L8BA 5C0YA 1KFSA 3WNFA 3V9SA 1QHTA 5M1FA 3CJCA 4GKKK 1HKBA 2A6AA 4NXNK 3R3LA 3LWMA 4WFAL 4ID1A 1J54A 4YDUA 4ISGA 4DKWA 3ZT0A 5AQKA 1L3TA 1I94K 3CJ1A 3JXUA 2V7ZA 1QQNA 3KWIA 4ZTJA 3OVNA 1FK9A 1HX1A 4YOTA 4BR0A 5F0XA 3HP6A 3KK3A 4CJ3A 1QQMA 3FR0A 3O6WA 3P83D 4LH5A 2O4IA 2O8EB 3VPZA 4AM6A 3HOTA 3PLAA 5BPMA 3ZT1A 5KPZA 1ZBFA 4IEIA 3KD5E 4IDKA 1VSDA 4F2RA 3CMEN 1M1KO 3LM9A 5AQLA 3KLGA 3KD1E 3OS2A 1NJZA 4C8KA 4N56A 3MWTA 4DB3A 4U67L 4WFNL 3EE8A 1W2BM 3H46O 5BPLA 1UOCA 1LV5A 2Q0UA 4K42A 4FLXA 3EZWA 3R1XA 4DF8A 4H8KA 5LY3A 4YOWA 4FLYA 1RILA 1RBTA 1NJWA 1TVRA 4K0KK 4PQUA 4W5QA 4FJKA 4FJJA 4JHDB 3VQEA 3SQ2A 2ZE2A 4K8XA 1BG3A 3FGUA 4OKJA 3MEEA 3VTIA 2DY4A 3M3ZA 3CYMA 4KRFA 4KHUA 1X3NA 4CGDA 5KRSA 3WXIA 4BRLA 1JLQA 5J2MA 3KLHA 5FDLA 3NVKA 1GLCG 5C15A 5AZIB 5BRFA 1W9HA 5GINA 4C8MA 1R59O 3A8YA 3TTCA 1NGEA 4DR2K 4NB4A 2G8HA 3M5RA 3CCRN 4M41A 2E1YA 1KCFA 1C0TA 4EHTA 1XHZA 2VWKA 2G8KA 4OX9K 3L6QA 4C8OA 3NE6A 2ZJQL 3E1YA 4LFCK 3MEDA 3PY8A 3AVLA 4CJLA 4H5NA 2W6KA 3UIQA 3BZKA 4DHYA 2FBTA 5M1PA 5TKWA 3CFOA 1TYQA 3C7NB 3B6OA 3P39A 3QFPA 4YFUA 4FWNA 3SUQA 2OZMA 1CZBA 4I9QA 1VQNN 3C94A 1VQLN 2OPSA 3MX5A 3CERA 1NG9A 3CC4N 3WXLA 3GE1A 1SUQA 5LMUK 2HHTA 4OGEA 4Z94A 4UQGA 4FLTA 4ELTA 3I33A 4DU1A 3SUPA 3AVMA 3C6HA 4FJMA 2B6AA 2OPPA 2QWPA 1J53A 1YHQN 1NNEA 3CJ9A 2VG6A 4KI6A 3AGRA 4FLUA 4W5NA 2P1JA 3I8BA 4R5PA 1X3MA 1Q81O 3QBWA 1KVBA 2HBMA 4WQ4C 3OYNA 1OVYA 4BR9A 2KW4A 1EETA 3S3NA 1VK0A 4MO4A 4JI6K 1NK9A 4CEBA 4X64K 4FCYA 2YHYA 3P1GA 4CIFA 1RDCA 2A1SA 3QEIA 3CC2N 1LWEA 2EWSA 4KPYA 4I7FA 3O9TA 4PKHA 2A5XA 5LJWA 1QSYA 4Z4GA 1VQKN 1HKGA 2W42A 3NF6A 3LZIA 5JLFA 3CCEN 3M6GA 2W40A 2A40A 1CXUA 4CVNE 3OYAA 1YAGA 1TK0A 1YI2N 4JKGA 3KTQA 1GLJO 4BRGA 4K25A 2R7YA 2RF2A 1XUPO 4EIAA 4IDHA 4JN4A 4ZTFA 3T1AA 1IV0A 3MN6A 3QEWA 4XH5A 1EO1A 1GLAG 1E4GT 4BE0A 1MDUB 4DSLA 2WOMA 2PBDA 2X6SA 3WT0A 2YKNA 4B9MA 4B1UB 4BWMA 2CH5A 4O5BA 3CPEA 2YNIA 3NH2A 4YORA 1C0GA 3VQBA 3CG7A 3S3OA 3L2VA 1HNIA 4LFBK 2B5JA 2HHXA 5E26A 3OYDA 4AHRA 2VQEK 1EXQA 3C65A 4A62A 4B1YB 3EYZA 3QLHA 2DFHA 2FF3B 2GBZA 2UUCK 5BN8A 5J2NA 2A3ZA 4A61A 3HTVA 2IOCA 1XC9A 1T7PA 3WQTA 3DAWA 4HUGA 2Q97A 3AVAA 4IO8A 2D0OA 1D9DA 4A2AA 3U9DA 5MLCQ 3UE5A 5KPTA 1VSKA 3A2FA 4GNIA 1ASVA 1L3VA 2QWMA 2ZJRL 4QS8A 3L2RA 1X9MA 4FZYA 3AARA 1D5AA 1YTUA 1WLJA 3Q7BA 1S5JA 3A5LC 3LP1A 3KVGA 2QA4N 1C0UA 1JLGA 3GG4A 4ILJA 4F3TA 5AQGA 1VQ8N 2NRXA 5EXWA 3MEGA 1OH8A 5AZJA 3U8XA 2P9UA 1QQCA 2VGMA 2PY5A 2QKKA 1WSHA 1DT9A 1NMNA 4QAGA 2XRIA 5EU7A 3VQ6A 2Q36A 1EWQA 2ZF5O 3TSQA 3L2WA 5IWAK 4NLBA 4AM7A 5C42A 3ZSWA 4NYNA 4IOXA 3HZ6A 3FFKB 3WUHA 3AVNA 4HVJA 2X78A 5EY4A 4E19A 1IKVA 3SAHA 4E0DA 1KD1O 4JI1K 1XI1A 2WBNA 5K14A 4ZHRA 4LF4K 2H3GX 4AHSA 4DTUA 4DR6K 3TR8A 4DFPA 3AO5A 1NK8A 4CF1A 1FKOA 4PHTX 3O80A 5CY4A 1S22A 3NGZA 3F5TA 5J2PA 1ASWA 1N8RO 3KZBA 3T7ZA 4KTZA 2CGKA 1NLVA 5KI6A 3KKSA 4DTPA 1QTMA 5FPDA 4FPAA 1BI4B 3OYCA 3VQ8A 3SJHA 3V1RA 1HRHA 2I5JA 3THYB 1NGGA 5AQIA 1YF5L 2ITMA 4L8RB 3ZLJA 3CI5A 2IC3A 1JXEA 3M8RA 4CERA 4CGGA 4EZ9A 1W97L 3B6PA 3BZCA 2QI2A 5D3GA 3ZSVA 4MLEA 1HJOA 2B4JA 2HNDA 2Y1IA 4CE9A 4NYFA 3RSEA 4Y1DA 3KLIA 1JL1A 2IVNA 3EY1A 4Y0WA 2GUPA 2P9KB 2O8FB 1RDDA 1S1XA 1WSEA 3QNNA 3L3VA 4JI7K 3VA3A 3ULEB 1X9JA 1WBDA 4OGCA 4H0PA 1XMQK 4MQ3A 3O4WA 5CR4A 3ZX3A 1D4XA 1ASUA 4ELUA 3IG1A 1C1BA 3DLKA 2QXLA 3C6UA 3K5MA 1LAWA 4CBXA 1NKBA 2HVHA 1LCUA 1ZBHA 4NXMK 3CCJN 1MWKA 1UWBA 4DSFA 4FW1A 2E4LA 1K8KA 1CXQA 3MK6A 4BR4A 4CGJA 3DRRA 3F73A 4DR7K 1HQEA 1GOBA 3TAFA 4H0XB 4RWTA 4FJGA 3VEWA 5C25A 2BDPA 3TSUA 1TV6A 3ZSRA 4JV5K 4ICLA 3MMVA 3RR8A 4BY9C 4IG3A 4CZGA 1SKSA 3AO1A 5JVHL 4H4OA 3LDSA 2HHVA 2JWLA 4AQYK 3GL1A 1L5UA 3BP8A 4F9OA 4O0JA 2DFEA 5CHIA 3KK2A 4H0OA 3SK3A 4DR3K 3QFUA 3TANA 2G8UA 3WEEB 1Q7YO 4KTWA 1P90A 2RPIA 4DR5K 3IAYA 2O8BB 3HI0A 1M90O 1S72N 3IUCA 1S1TA 1BCOA 3O3HA 3NF8A 3LWLA 1RDWX 1QVFM 3TAEA 2F9WA 3LPUA 4BQZA 1VSMA 4WFBL 3H1VX 3ZSXA 5E84A 1SQKA 4JD2A 4LF5K 4BR5A 1BIZA 4KHWA 1XNRK 3VQCA 5JS2A 2AP1A 3RMDA 4N47A 2ATQA 1XQSC 1BIUA 2ETJA 3U3YA 4KBOA 5DM6L 1Q9XA 4CESA 3LDQA 3LAMA 3O9UA 4RW6A 3K5NA 1GLDG 1EX4A 3NFAA 4FXDA 5ADXH 2DTUA 1S6QA 5ADXA 5AFUA 1RTDA 2P5OA 3EKUA 5EOYA 1TKTA 2F8SA 3ID8A 2HF4A 2QW9A 3O08A 1RT2A 4BRNA 3K0SA 4FK4A 3VEZA 4DR4K 3PX6A 1C6VA 4FM1A 2E6MA 3L3UA 3QEVA 5KGWA 1HNXK 1RTJA 4LSNA 3VESA 4BC2A 4DTRA 3M8SA 3V9ZA 4NLCA 1N32K 1NJIO 1FJGK 4AF1A 4CFBA 1FW6A 3CQ8A 4AHVA 1UAXA 4GV6A 1DLOA 4JI0K 5C24A 2YHXA 4WQ5A 5JLHA 4DQIA 4CJTA 2UXBK 1NK4A 3A5MC 4CZHA 2RKIA 2NRHA 3SNNA 4FJIA 3VETA 1YJNN 3VEXA 3G10A 4BQLA 5LMNK 4KH6A 4O5FA 1HLUA 2XO7A 2O8CB 1XMOK 4Z4FA 3AA2A 4CF8A 4DG1A 5JICA 3KIOA 3TAGA 2PYJA 2O8DB 5FROA 1A5VA 4JKHA 4OJRA 2UYTA 3M8QA 3O3GA 4YOUA 4FJNA 3EEQA 3ZEUA 3T1YK 4B9UA 3FZFA 4DQRA 4CJQA 1Y64A 3AA3A 4EHUA 1DKGD 1ATNA 3NDKA 1GLFO 3H1QA 2WC9A 4IFYA 4M3RA 3H08A 5SZTA 2W6LA 1JLBA 3HM9A 4PWDA 2HMPA 1NOYA 4CGIA 1W0HA 4DUYK 4AHUA 1RTHA 5AZIA 2KFNA 1JCFA 4HTLA 2YCHA 1VQON 1QVGM 4M3TA 3UKUB 3C0BA 5KQ8A 4Q5VA 3RVCA 3OYMA 2X6NA 4XH4A 3NVMA 4E1MA 3WXMB 1MA9B 1Q82O 5BRDA 4DTNA 1VQ9N 2RE2A 3ID6A 1E3MA 3TTFA 3WNEA 4FM2A 2A1RA 3N4PA 1IKYA 1GLEG 2Q31A 4EFHA 2PFUA 2P9NB 4KH4A 4IO9L 3A5OC 4M42A 4O44A 4DFJA 4FJXA 2OYQA 1A5XA 3CIPA 2NRWA 4MO5A 1QSLA 1RT5A 3OYKA 2F96A 3L4IA 1HYVA 3CCSN 3H3OB 2NLXA 4FJHA 3AA5X 1S1VA 1IG8A 3AV9A 3THXA 4AH9A 5AQQA 2D5RA 1VQ5N 4DS4A 3VEOA 2FLOA 3PV8A 1SKRA 3PO5A 1VRUA 1Z25A 4CIGA 3O1BA 4C8NA 2BGGA 1RCHA 3RMCA 1TKZA 5AQRA 4DSEA 1LWFA 1WAFA 2O8CA 4BVOA 3TABA 5AJ3K 4G9ZA 3LAKA 1GOCA 3JS6A 3DI6A 1BWFO 4CZMA 4EP5A 2XY8A 4A2BA 3ZSYA 4FM0A 4G1QA 1VSJA 3DYAA 4OLAA 4BROA 1RFQA 1HYZA 3O1WA 3RTVA 2IAJA 3ISNC 4XH1A 1D9FA 5I9EB 1JXBA 3AVCA 4H0YB 3CCLN 4GW6A 5AQHA 3CQYA 1RDBA 2FSKA 3QETA 1NWKA 1IKXA 4GV3A 4BVPA 4AILC 3TI0A 4KFBA 4J8FA 1YIJN 3RSEB 4JKCA 3RR7A 3VQ5A 2ZQBA 3D6RA 2NUBA 1VQ6N 2DFFA 3OW2M 4FPBA 1NBWA 4CFDA 3CMAN 4E7JA 1ZBUA 4E7HA 4X65K 1IJJA 3SYZA 3HO1A 4CHZA 1L3SA 1XNQK 3I0RA 1U2VA 1RBVA 3V9XA 1BHLA 3OTOK 2GWKA 1T03A 5C10A 2HVIA 3NHGA 4Z4EA 3SBGA 3HXMA 2PYLA 3CM6A 1JLFA 4DSKA 3VQ7A 4U7BA 5J2QA 3P31A 2G8VA 4FJLA 1MU2A 3O9SA 1NGHA 1ZYQA 2CGJA 2E2NA 4E1JA 2YX6A 3CCVN 4Z4CA 4PL7A 4B08A 2FBVA 3L2QA 4FLWA 5DMRA 1VQ4N 4F8RA 4GV9A 4JKEA 4RW9A 3SQ0A 3DM2A 4M7YA 4JI5K 3H3NO 3C95A 3PSIA 2QM1A 3ZETA 3OYJA 4J2BA 2YI1A 2YJFA 4A5BA 1HPMA 3IRXA 2AJQA 3EZ5A 4FJ7A 3HSTB 3R9PA 2CH6A 5JVGL 1SL2A 4FK2A 4IXCA 2Z1HA 1TGOA 4OLBA 3DXKA 1KAXA 3LM2A 3VGLA 5GAGP 4Z0UA 3D2EB 5AQOA 4WE1A 1J5OA 4JRPA 5F2RA 4JKFA 3IDHA 5I3UA 1VSLA 2ZGYA 2V51B 3KKRA 1C0FA 4DMNA 4HCCA 2FXUA 3HL8A 3O4QA 5EX5A 2OTLN 1SL0A 5H1SQ 3VF2A 4H4MA 1Y97A 3M1FA 1NGIA 3HK2A 4DTXA 4CEAA 1OH7A 2QK9A 3AVKA 1S3XA 4BRMA 5CYMA 2P5GA 2UU9K 5KTQA 4FWPA 2QWNA 4CF0A 3QEXA 3Q7CA 3PIPL 2RHKA 3HVTA 4BE1A 4YHHK 1U49A 4FWOA 1NGBA 2Z1GA 1S9GA 3QBXA 1K73O 3FZHA 1EWRA 2HNYA 4CF2A 4HUFA 1TK5A 1Z6RA 4LF6K 4DLGA 3JYTA 3K5LA 3G0ZA 4JS4A 5M1OA 3DRSA 1T05A 3E9OA 2BE2A 4FOEA 4YNQA 3W3DA 2P9IA 3A5NC 3D7EO 3VEYA 4C8LA 5CZ2A 1SAZA 4CHOA 2ASMA 4M3ZA 4CEFA 1E4FT 1Z26A 2JLEA 1X1PA 3P4IA 2PAVA 4IJAA 4CJSA 3CCMN 3V81A 1HUXA 3E66A 2YHWA 2HW3A 3P38A 3K9KA 3J7YP 1SV5A 3RMAA 4M3UA 4H5WA 3RMBA 2AA4A 3IMXA 4H03B 5AR0A 1GOAA 2YNGA 3GDQA 3OYBA 4LF8K 3T3FA 1BO5O 2GWJA 3THWB 1T8EA 4DQPA 1T6CA 3VQPA 4FLZA 1FKPA 4ISFA 1YJWN 1TKXA 4Y1CA 3U4LA 1QZ6A 4GVMA 3P5JA 4RG8A 4DV1K 1YTAA 3B8AX 4FYDA 3AVFA 3AO2A 1Z05A 3BGRA 3SV3A 4BGAA 3O8MA 4E89A 4IKFA 1QHAA 4CJFA 2IVPA 4DTOA 4A59A 2F7TA 3NF7A 3CCQN 4CHYA 3PSFA 4IFVA 1U48A 1IBMK 1S9EA 4NO7A 4CD3A 4FW2A 4DV6K 5CYQA 4B3TK 4YY3K 4FOIA 4R79A 3CHWA 4BRQA 3G71N 3ASMA 4FK0A 2Q2RA 3WNGA 1YXQA 2GTDA 2XHBA 1DTQA 4DFKA 3D2EA 4ILGB 1HR0K 1LWCA 2VGNA 5HRNA 1IKWA 2E8AA 3U6FA 1ITGA 4MLHA 4ID5A 4M63C 3CJ7A 4I6MA 5AZJB 3EN9A 4LH4A 2ZM6K 2HHSA 2ZGZA 2V7YA 2P51A 3TPQA 3VQ4A 4I6MB 4LF7K 1IH7A 2QTDA 3DXKB 4EAHD 3RRHA 1N33K 4DU3A 4N76A 5HOOA 4CEEA 2YHBA 3SQ4A 3ATVA 3L0QA 1K9MO 1T44A 2HHQA 1KTQA 2X74A 3DLBA 3LDNA 3OYIA 2GEMA 3NAEA 2Z1IA 3NH1A 2VG5A 5GAHP 1BUPA 5HRSA 4RTFD 1DTTA 3HJFA 4EZ6A 5E41A 3S9HA 1RNHA 1NGDA 4GY2B 1S1UA 1TAUA 5CZ1A 3F9KA 1VQPN 4Z4HA 1J9AA 4JLHA 1K8AO 3KHYA 2JWKA 3VERA 5KRTA 2D0CA 3AVBA 5KGXA 2PZSA 4NCGA 3HVRA 3VQ9A 4M7XA 1HPZA 3AY9A 4CZJA 1WSGA 4CZEA 3U9ZA 4CJVA 3CETA 2VYPA 5FPMA 3E9LA 2GV9A 4FWMA 3UKRA 4E1NA 4HUEA 1ZC6A 1BI4A 5GAEP 5HROA 3HRGA 5AQPA 2NRTA 3VEVA 3MN5A 1YITN 3S3MA 3VENA 3WQUA 1TL3A 4A57A 3G6EN 4FO0A 2KTQA 1V4TA 3L2UA 1FXXA 3T69A 3WXJA 3KLFA 4B1XB 3I8DA 3KLEA 3WXKA 1KVCA 3V1OA 3F9MA 4M3XA 1S1WA 4JHDA 3HSCA 4CGHA 2HBJA 3AO4A 3V9WA 4WQ4A 4PY5A 3QNOA 3IS9A 4O8KA 3J8AA 1WUAA 1KSPA 1LAVA 1DGKN 3J81O 3LZJA 4BR2A 3OYGA 2F8TA 4EP4A 3QINA 3ZYYX 4QCLA 1WSJA 4BRIA 2ZJPL 1NGFA 3MAQA 3LL3A 3KWGA 3TTDA 4DU4A 2HHUA 2Q3SA 4GVEA 4PKGA 3K5OA 3DJCA 4JEPA 4O55A 1GLLO 4KHPK 1U4BA 1WSFA 3OA9A 2GX9A 3HPGA 2OPQA 1QE1A 4WCEL 3VN5A 1VSIA 5AQVA 5HP1A 1VSHA 4I9LA 1SZ2A 4DTMA 3MXMA 3V1QA 2ITGA 4CK3A 4WQ5C 1NK0A 1YT3A 2OANA 3VTHA 5A2QO 3EL2A 4IBNA 1KRPA 4FL9A 4CFCA 4DR1K 4FJ9A 3C7NA 4FWLA 4W5OA 4JS5A 2W41A 1TUYA 2BANA 1Q9YA 4Z4IA 1C0MA 2P9PB 1CZ9A 3OYEA 4DWIA 4WF9L 2XY6A 1WOQA 4RW7A 2FSNA 1ATRA 4LFAK 3OBYA 4MDAA 5M1QA 2KLAA 2NRZA 4PL8A 1BGXT 1RGIA 1QS4A 3VOVA 4K8ZA 4IG0A 4K43A 3GBTA 4BACA 3PO4A 1HNVA 3L4QA 3HPOA 2WONA 2O4GA 4DS5A 2OZSA 3FLCO 4B3MK 5BPNA 4JKGB 1U47A 2HF3A 4CK1A 2WFBA 4XIUA 1VSEA 3DLRA 1QQOA 4KKOA 1BQNA 3BF1A 3AVHA 4IOAL 5C2FA 4MDBA 3SMSA 4F2SA 2D0PA 3R8EA 4KHQA 3V9UA 3VMFB 1YVUA 3DMJA 4GMJB 3K59A 3FE1A 3ZEUB 3KK1A 2HB5A 1I3AA 1ILYA 4Q0BA 5J1EA 2IGIA 4H0TB 3AVJA 3J80O 2EX3A 5KQDA 2WTUA 2CGLA 2E20A 1JCEA 3SPZA 1IBLK 1MWMA 4BGBA 2D4WA 3CQXA 2KKZA 4BE2A 3BY5A 3ZT4A 3LDLA 2F4VK 1RT3A 4FVUA 1VRTA 1T6DA 2Q0RA 3DLLL 4IEEA 4UY8O 4DV4K 4C1NK 2NRVA 3ZSOA 1NJXA 3LPTA 2FBXA 1NGAA 2HBKA 1KAZA 1UA0A 1ZBSA 4DF4A 5CE3A 2J4RA 4H0VB 4QS7A 4FJ5A 4CZFA 5BR8K 4IJNA 5EVZA 4AHTA 4WYBA 5FLXO 1REVA 2BH1A 2Y1JA 1WSIA 3PUFA 4B1ZA 1V4SA 3ULEA 2OCEA 2GUIA 4DUZK 3TAQA 1JLEA 1G15A 4JRQA 4CJ4A 3K2PA 2YKMA 1TAQA 4H5RA 1N5YA 3ENBA 4JAXA 4RW8A 3THXB 3BDPA 4LD0A 4LF9K 5M1KA 3MXJA 4FZZA 4JYAK 1LW2A 2P9KA 3HP9A 4DV7K 1OH5A 4CJPA 1JCGA 1KFDA 3O9QA 5AQUA 3DXMB 4K41A 3QB0A 3LP0A 3MCAB 4I2QA 4H5VA 5KPRA 4B9SA 3LALA 3C6AA 3ZT3A 4CBWA 4LSLA 1Q8IA 3E01A 5AQFA 2Q1NA 1JLAA 4CJ7A 1N36K 2UUBK 2G8WA 4O4GA 2E2OA 4CBUA 2FC0A 3DLHA 2HBLA 1DEJA 1BOTO 5BRHA 4HCBA 3MN9A 4IFEA 2QWRA 4BRDA 4CJRA 1SS6A 4BRFA 3TU5A 3TSPA 3ALYA 1RT4A 4OKKA 4M3WA 5AQYA 4V19S 3I56N 4NCAA 3OYHA 2P9IB 3HPHA 3O4NA 5B8HA 4CECA 2VWJA 2VQFK 5GIPA 4DSJA 1U2VB 4B3SK 1KVAA 5HL7L 4H5TA 3ZX0A 1N6QA 2HOEA 3MX2A 2A41A 1HNZK 4CCHA 4B9NA 4BRCA 3IKMA 3HBTA 4B3OA 1NKCA 1BL3A 3KK7A 4PKIA 2E5LK 3TWHA 4N5SA 4DQSA 2YNFA 1B9DA 1C1AA 1BQMA 4QOZB 2QKBA 3QEPA 4BDYA 3ULDA 3LANA 4BG9A 5BR9A 5BN9A 4CEDA 2KZMA 3VQDA 5C2DA 4CJWA 3SLCA 5SWMA 2P9LA 2IVOA 5HBMA 1TYQB 3ZT2A 3THVA 1YUWA 3D45A 4OVLA 3AAPA 4JNEA 3MXIA 1KAYA 4CEZA 4CZIA 4FWRA 3TAPA 4BDPA 3RWUA 3OJSA 3H6EA 3VF4A 1H1VA 3FFIA 2UUAK 3D2FA 3PX0A 3BF3A 3SMPA 2WUSA 3E9PA 3TAMA 3FZMA 2FBYA 5AQWA 1HQUA 4JK9A 1RTIA 3QDKA 3TARA 4KB0A 1LOTB 2ZWHA 4KHYA 4KO0A 3ZETB 1WNSA 5IT9O 2YHAA 4BRKA 3O5BA 3SUOA 4CZKA 3I0SA 1QZ5A 1RDUA 2IS3A 1YVNA 4B9VA 3CJAA 4CHQA 3AVIA 3OYLA 3EO3A 1WB9A 4ELVA 2UXDK 1VAZA 2IDOA 2V52B 1B9FA 1U45A 4JI8K 1Q18A 4BDZA 3THYA 1NKEA 1B92A 3AGKA 4RCHA 1CZAN 3OS0A 4B9TA 4OKEA 4JI3K 4L3QA 4JKDA 4CHPA 3NBPA 1NK6A 4M3YA 3G25A 4B9QA 3OJUA 2OTJN 4E7LA 1OH6A 4FWQA 1NM1A 4DTSA 1RT6A 2I7PA 4M45A 4NCBA 4XEIA 3BUZB 1IBKK 2QWQA 1BU6O 3DRPA 5HRRA 3ZX2A 3MCPA 3SI6A 4CEQA 4CGFA 2Z1JA 1K8KB 2JGUA 3MDQA 1ZBIA 4A5AA 4TSXA 2EHGA 4O8UA 1IG9A 3K58A 5AQJA 1VQMN 2ASPA 3I55N 4O0IA 5FRMA 3SJJA 1YJ9N 2BUPA 4BRPA 3LP3A 3SAFA 3LDOA 1WN7A 3HOSA 3W0LA 3CM5A 2P9UB 1RBUA 4JK8A 2I7NA 4FJ8A 4JI2K 4B8AB 2QXFA 4CJEA 4KAZA 3WNHA 4F3OA 4PA1A 5AQMA 3CJBA 1F21A 4FVMA 1SL1A 1T3VA 3NGIA 3MN7A 3NH0A 3VGMA 2DPNA 2KQ2A 2IIRA 4OPJA 4PUOA 4HHTA 1HJRA 1TUUA 4BC3A 4CI6A 3AAQA 5HLFA 3PIOL 5T7BA 3M8PA 4N41A 3SUNA 1U04A 1G99A 1NK5A 1TK8A 2ASOA 4KHNA 3DWLA 3BEXA 1IO2A 3QERA 2P9SB 3R6MA 2KZZA 3SAGA 2OA8A 4IOCL 2P9LB 4ILHA 3KJVA 3V6DA 3MWPA 2FF6A 4AHCA 1P8ZA 3K9JA 5AQXA 2G8FA 1KC8O 1XWLA 4CJ5A 3DOLA 4BRAA 1CLQA 4JI4K 2FSJA 1BA1A 1HYSA 3ITHA 3VF6A 2QEXN 1BDGA 1LW0A 1HMVA 5HRPA 5AQSA 1J6ZA 4CW7B 4BC5A 2HSTA 3AA4A 5JMVA 1VQ7N 4KTQA 5TKYA 3F2KA 4YDUC 3QO9A 1QSSA 3QIPA 2P9NA 2HNZA 3CPWM 4I2PA 3OBWA 3JAMO 1WAJA 4B1VA 1RT7A 3CCUN 1ESVA 2F9TA 3SBTA 2D1KA 1XHXA 4FSVA 4IWVA 2BTFA 3OHRA 4YOYA 2E2QA 5LL6Z 2O8DA 1JL2A 1ZXOA 2E1ZA 4DQQA 2YJEA 3CD6N 4OPHA 2QWOA 3J7ZO 3J7AP 3UKUA
chains in the Genus database with same CATH topology
1A5WA 1BISA 1ASVA 1D9FA 1BCMA 1JXBA 1U47A 2HHWA 3AVCA 1RBSA 4GW6A 4CJUA 2D0AA 4CK1A 4XIUA 5JS1A 1L3VA 1VSEA 2YNHA 1RDBA 3QETA 3DLRA 3L2RA 1X9MA 4KKOA 2OPRA 3U3GA 1BQNA 4FZYA 1IKXA 3QIOA 1D5AA 3AVHA 3V4IA 1YTUA 4AILC 1WLJA 1RT1A 4KFBA 3TI0A 1S5JA 2YV0X 3LP1A 4F2SA 5FRNA 4KHQA 1C0UA 3RR7A 1JLGA 3VQ5A 3K57A 2ZQBA 3V9UA 4E7IA 4F3TA 1KLNA 2NUBA 2DFFA 3ZCMA 1NOZA 4HTUA 5I42A 1YVUA 4CFDA 3DMJA 1JKHA 3MEGA 4GMJB 1ZBUA 3LP2A 3ZSZA 3KK1A 1JLCA 3K59A 4E7HA 4E7JA 3SYZA 1QQCA 2HB5A 4RW4A 1I3AA 3HO1A 4CHZA 2PY5A 4Q0BA 1L3SA 1WSHA 3NGYA 3I0RA 5J1EA 3SCXA 2IGIA 2QKKA 4QAGA 2XRIA 5EU7A 3VQ6A 4LY7A 1RBVA 3AVJA 2EX3A 1NK7A 4CHNA 3V9XA 1BHLA 3L2WA 2VG7A 5C42A 3SPZA 1T03A 3ZSWA 2HVIA 4NYNA 3NHGA 4Z4EA 4BE2A 3AVNA 4HVJA 3HXMA 2X78A 3ZT4A 2PYLA 3CM6A 3JSMA 2XY7A 4CK2A 4E19A 1RT3A 1JLFA 3PX4A 1IKVA 4DSKA 3VQ7A 5J2QA 1VRTA 3AVGA 2KFZA 1EKEA 2G8VA 4FJLA 1MU2A 1ZYQA 4E0DA 1XI1A 4CF9A 4Z4CA 3D0PA 4B08A 2FBVA 4W5RA 1NJXA 2E6LA 3ZSOA 3L2QA 3OYFA 3LPTA 5K14A 2FBXA 5DMRA 3VQAA 4ZHRA 4FLWA 4F8RA 3VA0A 1K6YA 4AHSA 4DTUA 1S6PA 4RW9A 3SQ0A 3TR8A 3DM2A 1UA0A 4DFPA 3AO5A 3C95A 4DF4A 1ZBLA 1NK8A 3OYJA 1I39A 1RBRA 3ZSQA 4CF1A 4J2BA 4J2EA 1FKOA 4KHSA 3SPYA 4FJ5A 3OY9A 3CFPA 3HYFA 2XY5A 4FZXC 5CY4A 4AHTA 4M3WA 4E3SA 3NGZA 4DLEA 4MFBA 1REVA 3IRXA 2AJQA 3EZ5A 4FJ7A 3HSTB 3DLGA 4CEOA 1WSIA 3PUFA 3C6TA 3SZ2A 5J2PA 2Y1JA 1ASWA 3HT3A 1NJYA 3QESA 1SL2A 4KTZA 4FK2A 4OPKA 1TKDA 2GUIA 5DK5A 3DOKA 4KB1A 3TAQA 2Z1HA 4B9LA 1JLEA 5KI6A 1G15A 1TGOA 4JRQA 4CJ4A 3K2PA 3KKSA 4DTPA 1QTMA 4OLBA 2YKMA 4DSIA 3RRGA 1TAQA 3DLEA 3NCIA 4J2DA 3MECA 1X9SA 4DFMA 4Z0UA 4DTJA 1N5YA 1BI4B 2ZD1A 4RW8A 3BDPA 3OYCA 3VQ8A 1TL1A 1RDAA 4WE1A 4LD0A 3V1RA 1HRHA 3MXJA 2I5JA 1J5OA 2HMIA 4JRPA 4J2AA 4L8RB 4FZZA 1LW2A 3HP9A 2IC3A 3CFRA 5I3UA 1VSLA 1JXEA 3VQQA 4CIEA 4CJPA 3M8RA 4CERA 3KKRA 1KFDA 4CGGA 4EZ9A 2RN2A 3SV4A 3B6PA 4DMNA 4HCCA 3NF9A 3HL8A 5D3GA 2D0BA 4W5TA 1L3UA 3LP0A 3O4QA 3ZSVA 4I2QA 4E7KA 1SL0A 4B9SA 1D8YA 4H4MA 3LALA 1Y97A 3ZT3A 4LSLA 2B4JA 1Q8IA 2HNDA 3E01A 4CE9A 4NYFA 2Y1IA 4Y1DA 3T19A 3KLIA 1JL1A 3HK2A 4DTXA 4CEAA 3EY1A 1JLAA 2G8IA 2QK9A 3AVKA 2G8WA 1RDDA 5CYMA 1S1XA 1WSEA 2LSNA 2P5GA 4O4GA 3QNNA 3L3VA 5KTQA 1R0AA 4KREA 1EP4A 4CF0A 4BWJA 3VA3A 3QEXA 3SQ1A 1C1CA 2FC0A 3HVTA 3DLHA 3O3FA 4BE1A 1SKWA 4OGCA 1U49A 4MQ3A 2Z1GA 3AO3A 4HCBA 1O1WA 4CFAA 4F4KA 1S9GA 4CJRA 1ASUA 4ELUA 2HNYA 1C1BA 3IG1A 4CF2A 4HUFA 3DLKA 3ALYA 1TK5A 4DLGA 3C6UA 3JYTA 4B8CA 1RT4A 4OKKA 3OS1A 3K5MA 4KV8A 1LAWA 1VSFA 3K5LA 3G0ZA 4JS4A 4CJKA 1UA1A 1NKBA 4NCAA 3DRSA 3OYHA 1KLMA 3HPHA 3O4NA 1X9WA 1T05A 4KI4A 2HVHA 4CECA 2VWJA 3L8BA 2BE2A 1KFSA 1ZBHA 4YNQA 3WNFA 4DSJA 3V9SA 4C8LA 1QHTA 1UWBA 5CZ2A 4CHOA 4DSFA 4FW1A 2E4LA 1KVAA 1CXQA 4M3ZA 4CEFA 4CGJA 3DRRA 4CCHA 3F73A 1Z26A 2JLEA 1N6QA 1HQEA 4B9NA 3LWMA 1GOBA 3TAFA 1X1PA 4CJSA 4FJGA 4ID1A 5C25A 1J54A 4B3OA 3V81A 2BDPA 3ZT0A 1NKCA 2HW3A 1TV6A 3ZSRA 1BL3A 4ICLA 3RR8A 4IG3A 3TWHA 1L3TA 4N5SA 4ZTJA 1SV5A 4DQSA 3RMAA 3AO1A 3RMBA 1SKSA 4M3UA 2YNFA 1B9DA 1C1AA 1BQMA 1GOAA 3OVNA 4H4OA 3LDSA 2HHVA 2YNGA 1FK9A 3OYBA 2QKBA 4QOZB 3QEPA 1L5UA 4BDYA 3T3FA 3HP6A 3KK3A 3ULDA 3LANA 4O0JA 2DFEA 4CJ3A 3KK2A 4CEDA 1T8EA 4DQPA 3VQDA 2KZMA 3VQPA 4FLVA 3TANA 2G8UA 3P83D 4LH5A 2O4IA 4CJWA 4FLZA 1FKPA 4KTWA 2RPIA 3IAYA 1TKXA 4Y1CA 5SWMA 5HBMA 3ZT2A 3ZT1A 4GVMA 3P5JA 4RG8A 3THVA 1ZBFA 1YTAA 4FYDA 3D45A 3KD5E 3AVFA 4IDKA 4OVLA 3MXIA 1VSDA 3AO2A 1S1TA 1BCOA 3BGRA 3O3HA 3SV3A 3NF8A 4CEZA 4E89A 3LWLA 4IKFA 4CJFA 3TAPA 3RWUA 4DTOA 4BDPA 3TAEA 3OJSA 3LPUA 3KLGA 1VSMA 3KD1E 3NF7A 3ZSXA 4CHYA 4IFVA 1U48A 3OS2A 1S9EA 1NJZA 3FFIA 4C8KA 4N56A 4FW2A 1BIZA 5CYQA 4KHWA 3VQCA 3PX0A 1LV5A 5JS2A 1UOCA 3RMDA 4N47A 2ATQA 3ASMA 4FLXA 4FK0A 3TAMA 2FBYA 3WNGA 1BIUA 1HQUA 2ETJA 3U3YA 4DF8A 1RTIA 1Q9XA 4CESA 2XHBA 1DTQA 3TARA 4H8KA 4DFKA 4KB0A 1LWCA 4KHYA 3LAMA 4KO0A 3ISNC 5HRNA 4FLYA 1IKWA 1WNSA 3U6FA 1RILA 1ITGA 1RBTA 1NJWA 1TVRA 2YHAA 4RW6A 3K5NA 4PQUA 4ID5A 4W5QA 4FJKA 3SUOA 1EX4A 4FJJA 3NFAA 3I0SA 4LH4A 2HHSA 3VQEA 3SQ2A 4FXDA 2DTUA 2ZE2A 2IS3A 2P51A 1S6QA 3VQ4A 4B9VA 4K8XA 4CHQA 1RTDA 4OKJA 2P5OA 1IH7A 3MEEA 3AVIA 3RRHA 1TKTA 2F8SA 2DY4A 3OYLA 4DU3A 3CYMA 4N76A 4KRFA 4ELVA 4CEEA 2IDOA 4KHUA 1RT2A 2YHBA 4CGDA 3SQ4A 1B9FA 1U45A 4FK4A 5KRSA 3PX6A 1C6VA 1JLQA 4BDZA 4FM1A 3KLHA 2E6MA 5J2MA 3L3UA 5FDLA 3QEVA 1NKEA 5KGWA 1KTQA 2HHQA 1B92A 2X74A 3DLBA 3OS0A 3OYIA 3NAEA 2Z1IA 4OKEA 4B9TA 3NH1A 1RTJA 4LSNA 1W9HA 4DTRA 2VG5A 3M8SA 3V9ZA 4CHPA 3NBPA 4C8MA 5HRSA 1NK6A 4CFBA 1DTTA 4M3YA 3HJFA 2G8HA 4EZ6A 3OJUA 5E41A 4AHVA 4M41A 3CQ8A 1RNHA 4E7LA 3S9HA 4DTSA 1KCFA 1RT6A 1UAXA 1C0TA 1DLOA 1S1UA 5C24A 1TAUA 4M45A 4DQIA 4CJTA 5CZ1A 4NCBA 1NK4A 3F9KA 4Z4HA 2RKIA 1XHZA 1J9AA 2VWKA 4JLHA 2G8KA 5KRTA 3DRPA 4C8OA 3NE6A 2D0CA 3AVBA 5KGXA 5HRRA 2PZSA 3SNNA 4NCGA 3HVRA 4FJIA 3VQ9A 3MEDA 3SI6A 3PY8A 1HPZA 3AVLA 3G10A 4CEQA 4CJLA 3UIQA 1WSGA 4CGFA 2Z1JA 4CJVA 4F2RA 2JGUA 2FBTA 1ZBIA 2XO7A 4TSXA 2GV9A 4Z4FA 2EHGA 1IG9A 3AA2A 4E1NA 3K58A 4HUEA 3CFOA 1BI4A 4CF8A 5HROA 4O0IA 5FRMA 3SJJA 3B6OA 4DG1A 3LP3A 3S3MA 4YFUA 3KIOA 3TAGA 3SUQA 1CZBA 2PYJA 1TL3A 2OZMA 1WN7A 4I9QA 3C94A 5FROA 1A5VA 2KTQA 4OJRA 2OPSA 3L2UA 3M8QA 3CM5A 3O3GA 1RBUA 4FJNA 4FJ8A 1FXXA 3KLFA 3I8DA 4B8AB 3KLEA 4B9UA 1SUQA 2HHTA 1KVCA 4OGEA 4UQGA 4DQRA 2QXFA 3V1OA 4CJEA 4FLTA 4ELTA 4KAZA 4M3XA 1S1WA 4CJQA 4DU1A 3AVMA 4CGHA 3SUPA 4FJMA 3AO4A 3AA3A 3WNHA 2B6AA 4F3OA 2OPPA 3V9WA 3NDKA 1J53A 4PY5A 4PA1A 1F21A 4FVMA 2VG6A 4IFYA 4M3RA 1SL1A 3QNOA 4KI6A 3H08A 3IS9A 5SZTA 3NGIA 1JLBA 4FLUA 3HM9A 4PWDA 4W5NA 2P1JA 1KSPA 1LAVA 4R5PA 3NH0A 1NOYA 2KQ2A 4CGIA 1W0HA 3LZJA 1KVBA 3OYGA 4OPJA 3OYNA 4AHUA 1RTHA 3QINA 4EP4A 4HHTA 4PUOA 2F8TA 2KFNA 1HJRA 4QCLA 1WSJA 5HLFA 3MAQA 4M3TA 2KW4A 1EETA 3S3NA 5T7BA 4Q5VA 1VK0A 3OYMA 3M8PA 4DU4A 4N41A 1NK9A 2X6NA 1U04A 2Q3SA 4CEBA 4FCYA 3SUNA 2HHUA 3P1GA 4CIFA 1NK5A 1RDCA 2A1SA 3K5OA 4O55A 4E1MA 3QEIA 1TK8A 4KHNA 1LWEA 4KPYA 4DTNA 1IO2A 1U4BA 1WSFA 4I7FA 3QERA 2KZZA 3HPGA 1QSYA 2OPQA 4Z4GA 1QE1A 2OA8A 3VN5A 1VSIA 3WNEA 3NF6A 2W42A 3LZIA 1IKYA 4FM2A 5HP1A 2A1RA 1VSHA 4I9LA 4FJHA 4DTMA 1CXUA 3OYAA 3MXMA 3V1QA 1TK0A 3KJVA 3KTQA 3V6DA 4AHCA 2R7YA 2G8FA 2ITGA 4CK3A 1XWLA 2RF2A 4CJ5A 3DOLA 1CLQA 1NK0A 1YT3A 4M42A 4O44A 4DFJA 4FJXA 4ZTFA 3T1AA 4IBNA 2OYQA 3QEWA 1HYSA 1A5XA 1KRPA 3ITHA 4CFCA 1QSLA 1RT5A 3OYKA 2F96A 1HYVA 4BE0A 4DSLA 4FJ9A 2WOMA 2X6SA 1HMVA 1LW0A 2YKNA 5HRPA 3AA5X 4W5OA 1S1VA 4BWMA 3AV9A 4JS5A 4O5BA 4B9MA 4AH9A 2BANA 1Q9YA 2YNIA 3NH2A 4Z4IA 2D5RA 3VQBA 1C0MA 4DS4A 3AA4A 3PV8A 4KTQA 3CG7A 3S3OA 3L2VA 1SKRA 1HNIA 3PO5A 1VRUA 1Z25A 2B5JA 1CZ9A 4C8NA 4CIGA 3OYEA 4DWIA 3QO9A 1QSSA 2BGGA 1RCHA 2XY6A 2HHXA 3QIPA 2HNZA 4RW7A 3RMCA 1TKZA 4DSEA 4I2PA 1LWFA 1WAFA 3OYDA 3TABA 4AHRA 1EXQA 1WAJA 1RT7A 3EYZA 1BGXT 3QLHA 2DFHA 1GOCA 2GBZA 3LAKA 3DI6A 1QS4A 5J2NA 4K8ZA 1T7PA 1XC9A 2IOCA 4IG0A 4EP5A 2XY8A 1XHXA 3ZSYA 4FM0A 4G1QA 1VSJA 4HUGA 4BACA 3PO4A 1HNVA 1JL2A 3HPOA 3AVAA 3DYAA 2WONA 4OLAA 4DQQA 2O4GA 4DS5A 1D9DA 1HYZA 3RTVA 2IAJA 2OZSA 1VSKA 3A2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5W A;  1BIS A;  1ASV A;  1D9F A;  1BCM A;  1JXB A;  1U47 A;  2HHW A;  3AVC A;  1RBS A;  4GW6 A;  4CJU A;  2D0A A;  4CK1 A;  4XIU A;  5JS1 A;  1L3V A;  1VSE A;  2YNH A;  1RDB A;  3QET A;  3DLR A;  3L2R A;  1X9M A;  4KKO A;  2OPR A;  3U3G A;  1BQN A;  4FZY A;  1IKX A;  3QIO A;  1D5A A;  3AVH A;  3V4I A;  1YTU A;  4AIL C;  1WLJ A;  1RT1 A;  4KFB A;  3TI0 A;  1S5J A;  2YV0 X;  3LP1 A;  4F2S A;  5FRN A;  4KHQ A;  1C0U A;  3RR7 A;  1JLG A;  3VQ5 A;  3K57 A;  2ZQB A;  3V9U A;  4E7I A;  4F3T A;  1KLN A;  2NUB A;  2DFF A;  3ZCM A;  1NOZ A;  4HTU A;  5I42 A;  1YVU A;  4CFD A;  3DMJ A;  1JKH A;  3MEG A;  4GMJ B;  1ZBU A;  3LP2 A;  3ZSZ A;  3KK1 A;  1JLC A;  3K59 A;  4E7H A;  4E7J A;  3SYZ A;  1QQC A;  2HB5 A;  4RW4 A;  1I3A A;  3HO1 A;  4CHZ A;  2PY5 A;  4Q0B A;  1L3S A;  1WSH A;  3NGY A;  3I0R A;  5J1E A;  3SCX A;  2IGI A;  2QKK A;  4QAG A;  2XRI A;  5EU7 A;  3VQ6 A;  4LY7 A;  1RBV A;  3AVJ A;  2EX3 A;  1NK7 A;  4CHN A;  3V9X A;  1BHL A;  3L2W A;  2VG7 A;  5C42 A;  3SPZ A;  1T03 A;  3ZSW A;  2HVI A;  4NYN A;  3NHG A;  4Z4E A;  4BE2 A;  3AVN A;  4HVJ A;  3HXM A;  2X78 A;  3ZT4 A;  2PYL A;  3CM6 A;  3JSM A;  2XY7 A;  4CK2 A;  4E19 A;  1RT3 A;  1JLF A;  3PX4 A;  1IKV A;  4DSK A;  3VQ7 A;  5J2Q A;  1VRT A;  3AVG A;  2KFZ A;  1EKE A;  2G8V A;  4FJL A;  1MU2 A;  1ZYQ A;  4E0D A;  1XI1 A;  4CF9 A;  4Z4C A;  3D0P A;  4B08 A;  2FBV A;  4W5R A;  1NJX A;  2E6L A;  3ZSO A;  3L2Q A;  3OYF A;  3LPT A;  5K14 A;  2FBX A;  5DMR A;  3VQA A;  4ZHR A;  4FLW A;  4F8R A;  3VA0 A;  1K6Y A;  4AHS A;  4DTU A;  1S6P A;  4RW9 A;  3SQ0 A;  3TR8 A;  3DM2 A;  1UA0 A;  4DFP A;  3AO5 A;  3C95 A;  4DF4 A;  1ZBL A;  1NK8 A;  3OYJ A;  1I39 A;  1RBR A;  3ZSQ A;  4CF1 A;  4J2B A;  4J2E A;  1FKO A;  4KHS A;  3SPY A;  4FJ5 A;  3OY9 A;  3CFP A;  3HYF A;  2XY5 A;  4FZX C;  5CY4 A;  4AHT A;  4M3W A;  4E3S A;  3NGZ A;  4DLE A;  4MFB A;  1REV A;  3IRX A;  2AJQ A;  3EZ5 A;  4FJ7 A;  3HST B;  3DLG A;  4CEO A;  1WSI A;  3PUF A;  3C6T A;  3SZ2 A;  5J2P A;  2Y1J A;  1ASW A;  3HT3 A;  1NJY A;  3QES A;  1SL2 A;  4KTZ A;  4FK2 A;  4OPK A;  1TKD A;  2GUI A;  5DK5 A;  3DOK A;  4KB1 A;  3TAQ A;  2Z1H A;  4B9L A;  1JLE A;  5KI6 A;  1G15 A;  1TGO A;  4JRQ A;  4CJ4 A;  3K2P A;  3KKS A;  4DTP A;  1QTM A;  4OLB A;  2YKM A;  4DSI A;  3RRG A;  1TAQ A;  3DLE A;  3NCI A;  4J2D A;  3MEC A;  1X9S A;  4DFM A;  4Z0U A;  4DTJ A;  1N5Y A;  1BI4 B;  2ZD1 A;  4RW8 A;  3BDP A;  3OYC A;  3VQ8 A;  1TL1 A;  1RDA A;  4WE1 A;  4LD0 A;  3V1R A;  1HRH A;  3MXJ A;  2I5J A;  1J5O A;  2HMI A;  4JRP A;  4J2A A;  4L8R B;  4FZZ A;  1LW2 A;  3HP9 A;  2IC3 A;  3CFR A;  5I3U A;  1VSL A;  1JXE A;  3VQQ A;  4CIE A;  4CJP A;  3M8R A;  4CER A;  3KKR A;  1KFD A;  4CGG A;  4EZ9 A;  2RN2 A;  3SV4 A;  3B6P A;  4DMN A;  4HCC A;  3NF9 A;  3HL8 A;  5D3G A;  2D0B A;  4W5T A;  1L3U A;  3LP0 A;  3O4Q A;  3ZSV A;  4I2Q A;  4E7K A;  1SL0 A;  4B9S A;  1D8Y A;  4H4M A;  3LAL A;  1Y97 A;  3ZT3 A;  4LSL A;  2B4J A;  1Q8I A;  2HND A;  3E01 A;  4CE9 A;  4NYF A;  2Y1I A;  4Y1D A;  3T19 A;  3KLI A;  1JL1 A;  3HK2 A;  4DTX A;  4CEA A;  3EY1 A;  1JLA A;  2G8I A;  2QK9 A;  3AVK A;  2G8W A;  1RDD A;  5CYM A;  1S1X A;  1WSE A;  2LSN A;  2P5G A;  4O4G A;  3QNN A;  3L3V A;  5KTQ A;  1R0A A;  4KRE A;  1EP4 A;  4CF0 A;  4BWJ A;  3VA3 A;  3QEX A;  3SQ1 A;  1C1C A;  2FC0 A;  3HVT A;  3DLH A;  3O3F A;  4BE1 A;  1SKW A;  4OGC A;  1U49 A;  4MQ3 A;  2Z1G A;  3AO3 A;  4HCB A;  1O1W A;  4CFA A;  4F4K A;  1S9G A;  4CJR A;  1ASU A;  4ELU A;  2HNY A;  1C1B A;  3IG1 A;  4CF2 A;  4HUF A;  3DLK A;  3ALY A;  1TK5 A;  4DLG A;  3C6U A;  3JYT A;  4B8C A;  1RT4 A;  4OKK A;  3OS1 A;  3K5M A;  4KV8 A;  1LAW A;  1VSF A;  3K5L A;  3G0Z A;  4JS4 A;  4CJK A;  1UA1 A;  1NKB A;  4NCA A;  3DRS A;  3OYH A;  1KLM A;  3HPH A;  3O4N A;  1X9W A;  1T05 A;  4KI4 A;  2HVH A;  4CEC A;  2VWJ A;  3L8B A;  2BE2 A;  1KFS A;  1ZBH A;  4YNQ A;  3WNF A;  4DSJ A;  3V9S A;  4C8L A;  1QHT A;  1UWB A;  5CZ2 A;  4CHO A;  4DSF A;  4FW1 A;  2E4L A;  1KVA A;  1CXQ A;  4M3Z A;  4CEF A;  4CGJ A;  3DRR A;  4CCH A;  3F73 A;  1Z26 A;  2JLE A;  1N6Q A;  1HQE A;  4B9N A;  3LWM A;  1GOB A;  3TAF A;  1X1P A;  4CJS A;  4FJG A;  4ID1 A;  5C25 A;  1J54 A;  4B3O A;  3V81 A;  2BDP A;  3ZT0 A;  1NKC A;  2HW3 A;  1TV6 A;  3ZSR A;  1BL3 A;  4ICL A;  3RR8 A;  4IG3 A;  3TWH A;  1L3T A;  4N5S A;  4ZTJ A;  1SV5 A;  4DQS A;  3RMA A;  3AO1 A;  3RMB A;  1SKS A;  4M3U A;  2YNF A;  1B9D A;  1C1A A;  1BQM A;  1GOA A;  3OVN A;  4H4O A;  3LDS A;  2HHV A;  2YNG A;  1FK9 A;  3OYB A;  2QKB A;  4QOZ B;  3QEP A;  1L5U A;  4BDY A;  3T3F A;  3HP6 A;  3KK3 A;  3ULD A;  3LAN A;  4O0J A;  2DFE A;  4CJ3 A;  3KK2 A;  4CED A;  1T8E A;  4DQP A;  3VQD A;  2KZM A;  3VQP A;  4FLV A;  3TAN A;  2G8U A;  3P83 D;  4LH5 A;  2O4I A;  4CJW A;  4FLZ A;  1FKP A;  4KTW A;  2RPI A;  3IAY A;  1TKX A;  4Y1C A;  5SWM A;  5HBM A;  3ZT2 A;  3ZT1 A;  4GVM A;  3P5J A;  4RG8 A;  3THV A;  1ZBF A;  1YTA A;  4FYD A;  3D45 A;  3KD5 E;  3AVF A;  4IDK A;  4OVL A;  3MXI A;  1VSD A;  3AO2 A;  1S1T A;  1BCO A;  3BGR A;  3O3H A;  3SV3 A;  3NF8 A;  4CEZ A;  4E89 A;  3LWL A;  4IKF A;  4CJF A;  3TAP A;  3RWU A;  4DTO A;  4BDP A;  3TAE A;  3OJS A;  3LPU A;  3KLG A;  1VSM A;  3KD1 E;  3NF7 A;  3ZSX A;  4CHY A;  4IFV A;  1U48 A;  3OS2 A;  1S9E A;  1NJZ A;  3FFI A;  4C8K A;  4N56 A;  4FW2 A;  1BIZ A;  5CYQ A;  4KHW A;  3VQC A;  3PX0 A;  1LV5 A;  5JS2 A;  1UOC A;  3RMD A;  4N47 A;  2ATQ A;  3ASM A;  4FLX A;  4FK0 A;  3TAM A;  2FBY A;  3WNG A;  1BIU A;  1HQU A;  2ETJ A;  3U3Y A;  4DF8 A;  1RTI A;  1Q9X A;  4CES A;  2XHB A;  1DTQ A;  3TAR A;  4H8K A;  4DFK A;  4KB0 A;  1LWC A;  4KHY A;  3LAM A;  4KO0 A;  3ISN C;  5HRN A;  4FLY A;  1IKW A;  1WNS A;  3U6F A;  1RIL A;  1ITG A;  1RBT A;  1NJW A;  1TVR A;  2YHA A;  4RW6 A;  3K5N A;  4PQU A;  4ID5 A;  4W5Q A;  4FJK A;  3SUO A;  1EX4 A;  4FJJ A;  3NFA A;  3I0S A;  4LH4 A;  2HHS A;  3VQE A;  3SQ2 A;  4FXD A;  2DTU A;  2ZE2 A;  2IS3 A;  2P51 A;  1S6Q A;  3VQ4 A;  4B9V A;  4K8X A;  4CHQ A;  1RTD A;  4OKJ A;  2P5O A;  1IH7 A;  3MEE A;  3AVI A;  3RRH A;  1TKT A;  2F8S A;  2DY4 A;  3OYL A;  4DU3 A;  3CYM A;  4N76 A;  4KRF A;  4ELV A;  4CEE A;  2IDO A;  4KHU A;  1RT2 A;  2YHB A;  4CGD A;  3SQ4 A;  1B9F A;  1U45 A;  4FK4 A;  5KRS A;  3PX6 A;  1C6V A;  1JLQ A;  4BDZ A;  4FM1 A;  3KLH A;  2E6M A;  5J2M A;  3L3U A;  5FDL A;  3QEV A;  1NKE A;  5KGW A;  1KTQ A;  2HHQ A;  1B92 A;  2X74 A;  3DLB A;  3OS0 A;  3OYI A;  3NAE A;  2Z1I A;  4OKE A;  4B9T A;  3NH1 A;  1RTJ A;  4LSN A;  1W9H A;  4DTR A;  2VG5 A;  3M8S A;  3V9Z A;  4CHP A;  3NBP A;  4C8M A;  5HRS A;  1NK6 A;  4CFB A;  1DTT A;  4M3Y A;  3HJF A;  2G8H A;  4EZ6 A;  3OJU A;  5E41 A;  4AHV A;  4M41 A;  3CQ8 A;  1RNH A;  4E7L A;  3S9H A;  4DTS A;  1KCF A;  1RT6 A;  1UAX A;  1C0T A;  1DLO A;  1S1U A;  5C24 A;  1TAU A;  4M45 A;  4DQI A;  4CJT A;  5CZ1 A;  4NCB A;  1NK4 A;  3F9K A;  4Z4H A;  2RKI A;  1XHZ A;  1J9A A;  2VWK A;  4JLH A;  2G8K A;  5KRT A;  3DRP A;  4C8O A;  3NE6 A;  2D0C A;  3AVB A;  5KGX A;  5HRR A;  2PZS A;  3SNN A;  4NCG A;  3HVR A;  4FJI A;  3VQ9 A;  3MED A;  3SI6 A;  3PY8 A;  1HPZ A;  3AVL A;  3G10 A;  4CEQ A;  4CJL A;  3UIQ A;  1WSG A;  4CGF A;  2Z1J A;  4CJV A;  4F2R A;  2JGU A;  2FBT A;  1ZBI A;  2XO7 A;  4TSX A;  2GV9 A;  4Z4F A;  2EHG A;  1IG9 A;  3AA2 A;  4E1N A;  3K58 A;  4HUE A;  3CFO A;  1BI4 A;  4CF8 A;  5HRO A;  4O0I A;  5FRM A;  3SJJ A;  3B6O A;  4DG1 A;  3LP3 A;  3S3M A;  4YFU A;  3KIO A;  3TAG A;  3SUQ A;  1CZB A;  2PYJ A;  1TL3 A;  2OZM A;  1WN7 A;  4I9Q A;  3C94 A;  5FRO A;  1A5V A;  2KTQ A;  4OJR A;  2OPS A;  3L2U A;  3M8Q A;  3CM5 A;  3O3G A;  1RBU A;  4FJN A;  4FJ8 A;  1FXX A;  3KLF A;  3I8D A;  4B8A B;  3KLE A;  4B9U A;  1SUQ A;  2HHT A;  1KVC A;  4OGE A;  4UQG A;  4DQR A;  2QXF A;  3V1O A;  4CJE A;  4FLT A;  4ELT A;  4KAZ A;  4M3X A;  1S1W A;  4CJQ A;  4DU1 A;  3AVM A;  4CGH A;  3SUP A;  4FJM A;  3AO4 A;  3AA3 A;  3WNH A;  2B6A A;  4F3O A;  2OPP A;  3V9W A;  3NDK A;  1J53 A;  4PY5 A;  4PA1 A;  1F21 A;  4FVM A;  2VG6 A;  4IFY A;  4M3R A;  1SL1 A;  3QNO A;  4KI6 A;  3H08 A;  3IS9 A;  5SZT A;  3NGI A;  1JLB A;  4FLU A;  3HM9 A;  4PWD A;  4W5N A;  2P1J A;  1KSP A;  1LAV A;  4R5P A;  3NH0 A;  1NOY A;  2KQ2 A;  4CGI A;  1W0H A;  3LZJ A;  1KVB A;  3OYG A;  4OPJ A;  3OYN A;  4AHU A;  1RTH A;  3QIN A;  4EP4 A;  4HHT A;  4PUO A;  2F8T A;  2KFN A;  1HJR A;  4QCL A;  1WSJ A;  5HLF A;  3MAQ A;  4M3T A;  2KW4 A;  1EET A;  3S3N A;  5T7B A;  4Q5V A;  1VK0 A;  3OYM A;  3M8P A;  4DU4 A;  4N41 A;  1NK9 A;  2X6N A;  1U04 A;  2Q3S A;  4CEB A;  4FCY A;  3SUN A;  2HHU A;  3P1G A;  4CIF A;  1NK5 A;  1RDC A;  2A1S A;  3K5O A;  4O55 A;  4E1M A;  3QEI A;  1TK8 A;  4KHN A;  1LWE A;  4KPY A;  4DTN A;  1IO2 A;  1U4B A;  1WSF A;  4I7F A;  3QER A;  2KZZ A;  3HPG A;  1QSY A;  2OPQ A;  4Z4G A;  1QE1 A;  2OA8 A;  3VN5 A;  1VSI A;  3WNE A;  3NF6 A;  2W42 A;  3LZI A;  1IKY A;  4FM2 A;  5HP1 A;  2A1R A;  1VSH A;  4I9L A;  4FJH A;  4DTM A;  1CXU A;  3OYA A;  3MXM A;  3V1Q A;  1TK0 A;  3KJV A;  3KTQ A;  3V6D A;  4AHC A;  2R7Y A;  2G8F A;  2ITG A;  4CK3 A;  1XWL A;  2RF2 A;  4CJ5 A;  3DOL A;  1CLQ A;  1NK0 A;  1YT3 A;  4M42 A;  4O44 A;  4DFJ A;  4FJX A;  4ZTF A;  3T1A A;  4IBN A;  2OYQ A;  3QEW A;  1HYS A;  1A5X A;  1KRP A;  3ITH A;  4CFC A;  1QSL A;  1RT5 A;  3OYK A;  2F96 A;  1HYV A;  4BE0 A;  4DSL A;  4FJ9 A;  2WOM A;  2X6S A;  1HMV A;  1LW0 A;  2YKN A;  5HRP A;  3AA5 X;  4W5O A;  1S1V A;  4BWM A;  3AV9 A;  4JS5 A;  4O5B A;  4B9M A;  4AH9 A;  2BAN A;  1Q9Y A;  2YNI A;  3NH2 A;  4Z4I A;  2D5R A;  3VQB A;  1C0M A;  4DS4 A;  3AA4 A;  3PV8 A;  4KTQ A;  3CG7 A;  3S3O A;  3L2V A;  1SKR A;  1HNI A;  3PO5 A;  1VRU A;  1Z25 A;  2B5J A;  1CZ9 A;  4C8N A;  4CIG A;  3OYE A;  4DWI A;  3QO9 A;  1QSS A;  2BGG A;  1RCH A;  2XY6 A;  2HHX A;  3QIP A;  2HNZ A;  4RW7 A;  3RMC A;  1TKZ A;  4DSE A;  4I2P A;  1LWF A;  1WAF A;  3OYD A;  3TAB A;  4AHR A;  1EXQ A;  1WAJ A;  1RT7 A;  3EYZ A;  1BGX T;  3QLH A;  2DFH A;  1GOC A;  2GBZ A;  3LAK A;  3DI6 A;  1QS4 A;  5J2N A;  4K8Z A;  1T7P A;  1XC9 A;  2IOC A;  4IG0 A;  4EP5 A;  2XY8 A;  1XHX A;  3ZSY A;  4FM0 A;  4G1Q A;  1VSJ A;  4HUG A;  4BAC A;  3PO4 A;  1HNV A;  1JL2 A;  3HPO A;  3AVA A;  3DYA A;  2WON A;  4OLA A;  4DQQ A;  2O4G A;  4DS5 A;  1D9D A;  1HYZ A;  3RTV A;  2IAJ A;  2OZS A;  1VSK A;  3A2F A; 
#chains in the Genus database with same CATH topology
 1A5W A;  1BIS A;  2HHW A;  1BCM A;  5GIO A;  1KXP A;  3D2F B;  1RBS A;  4CJU A;  2D0A A;  5JS1 A;  4DV5 K;  2YNH A;  4HWI A;  4B3R K;  4GKJ K;  1JJ2 M;  2OPR A;  3U3G A;  2O8E A;  3QIO A;  3V4I A;  3FZL A;  2P9S A;  1OKJ A;  1RT1 A;  2YV0 X;  4OPA A;  5FRN A;  4ISE A;  3K57 A;  4JK7 A;  4E7I A;  2NNW A;  1KLN A;  4KH5 A;  3ATU A;  3ZCM A;  1NOZ A;  4DV2 K;  4HTU A;  5I42 A;  4BRE A;  1JKH A;  3LP2 A;  3ZSZ A;  1JLC A;  2A42 A;  4RW4 A;  2VCP A;  1GLB G;  3O9R A;  3NGY A;  3SCX A;  2VWB A;  4BC4 A;  4CD1 A;  4LY7 A;  1NK7 A;  5C12 A;  4CHN A;  1BA0 A;  1HNW K;  4C1N I;  2VG7 A;  3UB5 A;  1NGC A;  2NRR A;  4DQ8 A;  3JSM A;  2XY7 A;  4CK2 A;  3HM8 A;  1NU0 A;  4QS9 A;  3PX4 A;  2P9P A;  4DV0 K;  3AVG A;  2KFZ A;  1EKE A;  1W7A A;  3VGK A;  5GAD P;  5LJV A;  4CF9 A;  5BRE A;  3CF5 L;  3D0P A;  1KQS M;  4W5R A;  2E6L A;  3OYF A;  3CXC M;  3VQA A;  3VA0 A;  1K6Y A;  1S6P A;  1ATS A;  3T1H K;  4FWS A;  1ZBL A;  4J2E A;  1I39 A;  1RBR A;  2GEL A;  3ZSQ A;  4KHS A;  4JKB A;  3SPY A;  3OY9 A;  3CFP A;  3HYF A;  2XY5 A;  4FZX C;  1NGJ A;  1NMD A;  1VHX A;  1Q86 O;  4E3S A;  4DLE A;  4MFB A;  3DLG A;  4CEO A;  3SZ2 A;  3C6T A;  3HT3 A;  5AQN A;  1NJY A;  3QES A;  3ENO A;  4BG8 A;  3UKR B;  4OPK A;  1TKD A;  5DK5 A;  4JD2 B;  4B1W B;  3DOK A;  4KB1 A;  3QML A;  4X66 K;  4B9L A;  4DV3 K;  1EQY A;  4IZ9 A;  3FZK A;  4DSI A;  3RRG A;  1N34 K;  3WEE A;  3DLE A;  3NCI A;  4J2D A;  3MEC A;  3EE9 A;  5AQT A;  4DFM A;  4DTJ A;  1X9S A;  2NZT A;  2ZD1 A;  5F1X A;  2QWL A;  1TL1 A;  2O8B A;  1RDA A;  3GOI A;  5ELZ A;  4BRH A;  2HMI A;  1U6Z A;  4J2A A;  2HHH K;  4YOX A;  3CFR A;  3IFR A;  3N4Q A;  3VQQ A;  3DXM A;  4CIE A;  3QIC A;  4C23 A;  2E2P A;  3THW A;  5M1N A;  2RN2 A;  3SV4 A;  3EKS A;  3NF9 A;  4BR7 A;  3G4S N;  2UXC K;  2D0B A;  3LDP A;  4X62 K;  4W5T A;  1L3U A;  4E7K A;  3S41 A;  5FPE A;  4FWK A;  1D8Y A;  2E88 A;  3CC7 N;  4YOV A;  3H45 C;  1HKC A;  3ENH A;  4OO1 J;  3T19 A;  5AFU H;  2G8I A;  1WBB A;  2LSN A;  5DM7 L;  1R0A A;  4KRE A;  1EP4 A;  4LC9 B;  4BWJ A;  3SQ1 A;  1C1C A;  3O3F A;  1O13 A;  1XC3 A;  1SKW A;  1J5E K;  4DCH A;  3A0I X;  4CZL A;  3AO3 A;  1O1W A;  4CFA A;  4F4K A;  3NMU A;  4B8C A;  3OS1 A;  4FLV A;  1UA1 A;  4KV8 A;  1VSF A;  4CJK A;  1X9W A;  1KLM A;  5AQZ A;  4KI4 A;  4JKA A;  2O8F A;  5FPN A;  2KHO A;  1OVQ A;  3L8B A;  5C0Y A;  1KFS A;  3WNF A;  3V9S A;  1QHT A;  5M1F A;  3CJC A;  4GKK K;  1HKB A;  2A6A A;  4NXN K;  3R3L A;  3LWM A;  4WFA L;  4ID1 A;  1J54 A;  4YDU A;  4ISG A;  4DKW A;  3ZT0 A;  5AQK A;  1L3T A;  1I94 K;  3CJ1 A;  3JXU A;  2V7Z A;  1QQN A;  3KWI A;  4ZTJ A;  3OVN A;  1FK9 A;  1HX1 A;  4YOT A;  4BR0 A;  5F0X A;  3HP6 A;  3KK3 A;  4CJ3 A;  1QQM A;  3FR0 A;  3O6W A;  3P83 D;  4LH5 A;  2O4I A;  2O8E B;  3VPZ A;  4AM6 A;  3HOT A;  3PLA A;  5BPM A;  3ZT1 A;  5KPZ A;  1ZBF A;  4IEI A;  3KD5 E;  4IDK A;  1VSD A;  4F2R A;  3CME N;  1M1K O;  3LM9 A;  5AQL A;  3KLG A;  3KD1 E;  3OS2 A;  1NJZ A;  4C8K A;  4N56 A;  3MWT A;  4DB3 A;  4U67 L;  4WFN L;  3EE8 A;  1W2B M;  3H46 O;  5BPL A;  1UOC A;  1LV5 A;  2Q0U A;  4K42 A;  4FLX A;  3EZW A;  3R1X A;  4DF8 A;  4H8K A;  5LY3 A;  4YOW A;  4FLY A;  1RIL A;  1RBT A;  1NJW A;  1TVR A;  4K0K K;  4PQU A;  4W5Q A;  4FJK A;  4FJJ A;  4JHD B;  3VQE A;  3SQ2 A;  2ZE2 A;  4K8X A;  1BG3 A;  3FGU A;  4OKJ A;  3MEE A;  3VTI A;  2DY4 A;  3M3Z A;  3CYM A;  4KRF A;  4KHU A;  1X3N A;  4CGD A;  5KRS A;  3WXI A;  4BRL A;  1JLQ A;  5J2M A;  3KLH A;  5FDL A;  3NVK A;  1GLC G;  5C15 A;  5AZI B;  5BRF A;  1W9H A;  5GIN A;  4C8M A;  1R59 O;  3A8Y A;  3TTC A;  1NGE A;  4DR2 K;  4NB4 A;  2G8H A;  3M5R A;  3CCR N;  4M41 A;  2E1Y A;  1KCF A;  1C0T A;  4EHT A;  1XHZ A;  2VWK A;  2G8K A;  4OX9 K;  3L6Q A;  4C8O A;  3NE6 A;  2ZJQ L;  3E1Y A;  4LFC K;  3MED A;  3PY8 A;  3AVL A;  4CJL A;  4H5N A;  2W6K A;  3UIQ A;  3BZK A;  4DHY A;  2FBT A;  5M1P A;  5TKW A;  3CFO A;  1TYQ A;  3C7N B;  3B6O A;  3P39 A;  3QFP A;  4YFU A;  4FWN A;  3SUQ A;  2OZM A;  1CZB A;  4I9Q A;  1VQN N;  3C94 A;  1VQL N;  2OPS A;  3MX5 A;  3CER A;  1NG9 A;  3CC4 N;  3WXL A;  3GE1 A;  1SUQ A;  5LMU K;  2HHT A;  4OGE A;  4Z94 A;  4UQG A;  4FLT A;  4ELT A;  3I33 A;  4DU1 A;  3SUP A;  3AVM A;  3C6H A;  4FJM A;  2B6A A;  2OPP A;  2QWP A;  1J53 A;  1YHQ N;  1NNE A;  3CJ9 A;  2VG6 A;  4KI6 A;  3AGR A;  4FLU A;  4W5N A;  2P1J A;  3I8B A;  4R5P A;  1X3M A;  1Q81 O;  3QBW A;  1KVB A;  2HBM A;  4WQ4 C;  3OYN A;  1OVY A;  4BR9 A;  2KW4 A;  1EET A;  3S3N A;  1VK0 A;  4MO4 A;  4JI6 K;  1NK9 A;  4CEB A;  4X64 K;  4FCY A;  2YHY A;  3P1G A;  4CIF A;  1RDC A;  2A1S A;  3QEI A;  3CC2 N;  1LWE A;  2EWS A;  4KPY A;  4I7F A;  3O9T A;  4PKH A;  2A5X A;  5LJW A;  1QSY A;  4Z4G A;  1VQK N;  1HKG A;  2W42 A;  3NF6 A;  3LZI A;  5JLF A;  3CCE N;  3M6G A;  2W40 A;  2A40 A;  1CXU A;  4CVN E;  3OYA A;  1YAG A;  1TK0 A;  1YI2 N;  4JKG A;  3KTQ A;  1GLJ O;  4BRG A;  4K25 A;  2R7Y A;  2RF2 A;  1XUP O;  4EIA A;  4IDH A;  4JN4 A;  4ZTF A;  3T1A A;  1IV0 A;  3MN6 A;  3QEW A;  4XH5 A;  1EO1 A;  1GLA G;  1E4G T;  4BE0 A;  1MDU B;  4DSL A;  2WOM A;  2PBD A;  2X6S A;  3WT0 A;  2YKN A;  4B9M A;  4B1U B;  4BWM A;  2CH5 A;  4O5B A;  3CPE A;  2YNI A;  3NH2 A;  4YOR A;  1C0G A;  3VQB A;  3CG7 A;  3S3O A;  3L2V A;  1HNI A;  4LFB K;  2B5J A;  2HHX A;  5E26 A;  3OYD A;  4AHR A;  2VQE K;  1EXQ A;  3C65 A;  4A62 A;  4B1Y B;  3EYZ A;  3QLH A;  2DFH A;  2FF3 B;  2GBZ A;  2UUC K;  5BN8 A;  5J2N A;  2A3Z A;  4A61 A;  3HTV A;  2IOC A;  1XC9 A;  1T7P A;  3WQT A;  3DAW A;  4HUG A;  2Q97 A;  3AVA A;  4IO8 A;  2D0O A;  1D9D A;  4A2A A;  3U9D A;  5MLC Q;  3UE5 A;  5KPT A;  1VSK A;  3A2F A;  4GNI A;  1ASV A;  1L3V A;  2QWM A;  2ZJR L;  4QS8 A;  3L2R A;  1X9M A;  4FZY A;  3AAR A;  1D5A A;  1YTU A;  1WLJ A;  3Q7B A;  1S5J A;  3A5L C;  3LP1 A;  3KVG A;  2QA4 N;  1C0U A;  1JLG A;  3GG4 A;  4ILJ A;  4F3T A;  5AQG A;  1VQ8 N;  2NRX A;  5EXW A;  3MEG A;  1OH8 A;  5AZJ A;  3U8X A;  2P9U A;  1QQC A;  2VGM A;  2PY5 A;  2QKK A;  1WSH A;  1DT9 A;  1NMN A;  4QAG A;  2XRI A;  5EU7 A;  3VQ6 A;  2Q36 A;  1EWQ A;  2ZF5 O;  3TSQ A;  3L2W A;  5IWA K;  4NLB A;  4AM7 A;  5C42 A;  3ZSW A;  4NYN A;  4IOX A;  3HZ6 A;  3FFK B;  3WUH A;  3AVN A;  4HVJ A;  2X78 A;  5EY4 A;  4E19 A;  1IKV A;  3SAH A;  4E0D A;  1KD1 O;  4JI1 K;  1XI1 A;  2WBN A;  5K14 A;  4ZHR A;  4LF4 K;  2H3G X;  4AHS A;  4DTU A;  4DR6 K;  3TR8 A;  4DFP A;  3AO5 A;  1NK8 A;  4CF1 A;  1FKO A;  4PHT X;  3O80 A;  5CY4 A;  1S22 A;  3NGZ A;  3F5T A;  5J2P A;  1ASW A;  1N8R O;  3KZB A;  3T7Z A;  4KTZ A;  2CGK A;  1NLV A;  5KI6 A;  3KKS A;  4DTP A;  1QTM A;  5FPD A;  4FPA A;  1BI4 B;  3OYC A;  3VQ8 A;  3SJH A;  3V1R A;  1HRH A;  2I5J A;  3THY B;  1NGG A;  5AQI A;  1YF5 L;  2ITM A;  4L8R B;  3ZLJ A;  3CI5 A;  2IC3 A;  1JXE A;  3M8R A;  4CER A;  4CGG A;  4EZ9 A;  1W97 L;  3B6P A;  3BZC A;  2QI2 A;  5D3G A;  3ZSV A;  4MLE A;  1HJO A;  2B4J A;  2HND A;  2Y1I A;  4CE9 A;  4NYF A;  3RSE A;  4Y1D A;  3KLI A;  1JL1 A;  2IVN A;  3EY1 A;  4Y0W A;  2GUP A;  2P9K B;  2O8F B;  1RDD A;  1S1X A;  1WSE A;  3QNN A;  3L3V A;  4JI7 K;  3VA3 A;  3ULE B;  1X9J A;  1WBD A;  4OGC A;  4H0P A;  1XMQ K;  4MQ3 A;  3O4W A;  5CR4 A;  3ZX3 A;  1D4X A;  1ASU A;  4ELU A;  3IG1 A;  1C1B A;  3DLK A;  2QXL A;  3C6U A;  3K5M A;  1LAW A;  4CBX A;  1NKB A;  2HVH A;  1LCU A;  1ZBH A;  4NXM K;  3CCJ N;  1MWK A;  1UWB A;  4DSF A;  4FW1 A;  2E4L A;  1K8K A;  1CXQ A;  3MK6 A;  4BR4 A;  4CGJ A;  3DRR A;  3F73 A;  4DR7 K;  1HQE A;  1GOB A;  3TAF A;  4H0X B;  4RWT A;  4FJG A;  3VEW A;  5C25 A;  2BDP A;  3TSU A;  1TV6 A;  3ZSR A;  4JV5 K;  4ICL A;  3MMV A;  3RR8 A;  4BY9 C;  4IG3 A;  4CZG A;  1SKS A;  3AO1 A;  5JVH L;  4H4O A;  3LDS A;  2HHV A;  2JWL A;  4AQY K;  3GL1 A;  1L5U A;  3BP8 A;  4F9O A;  4O0J A;  2DFE A;  5CHI A;  3KK2 A;  4H0O A;  3SK3 A;  4DR3 K;  3QFU A;  3TAN A;  2G8U A;  3WEE B;  1Q7Y O;  4KTW A;  1P90 A;  2RPI A;  4DR5 K;  3IAY A;  2O8B B;  3HI0 A;  1M90 O;  1S72 N;  3IUC A;  1S1T A;  1BCO A;  3O3H A;  3NF8 A;  3LWL A;  1RDW X;  1QVF M;  3TAE A;  2F9W A;  3LPU A;  4BQZ A;  1VSM A;  4WFB L;  3H1V X;  3ZSX A;  5E84 A;  1SQK A;  4JD2 A;  4LF5 K;  4BR5 A;  1BIZ A;  4KHW A;  1XNR K;  3VQC A;  5JS2 A;  2AP1 A;  3RMD A;  4N47 A;  2ATQ A;  1XQS C;  1BIU A;  2ETJ A;  3U3Y A;  4KBO A;  5DM6 L;  1Q9X A;  4CES A;  3LDQ A;  3LAM A;  3O9U A;  4RW6 A;  3K5N A;  1GLD G;  1EX4 A;  3NFA A;  4FXD A;  5ADX H;  2DTU A;  1S6Q A;  5ADX A;  5AFU A;  1RTD A;  2P5O A;  3EKU A;  5EOY A;  1TKT A;  2F8S A;  3ID8 A;  2HF4 A;  2QW9 A;  3O08 A;  1RT2 A;  4BRN A;  3K0S A;  4FK4 A;  3VEZ A;  4DR4 K;  3PX6 A;  1C6V A;  4FM1 A;  2E6M A;  3L3U A;  3QEV A;  5KGW A;  1HNX K;  1RTJ A;  4LSN A;  3VES A;  4BC2 A;  4DTR A;  3M8S A;  3V9Z A;  4NLC A;  1N32 K;  1NJI O;  1FJG K;  4AF1 A;  4CFB A;  1FW6 A;  3CQ8 A;  4AHV A;  1UAX A;  4GV6 A;  1DLO A;  4JI0 K;  5C24 A;  2YHX A;  4WQ5 A;  5JLH A;  4DQI A;  4CJT A;  2UXB K;  1NK4 A;  3A5M C;  4CZH A;  2RKI A;  2NRH A;  3SNN A;  4FJI A;  3VET A;  1YJN N;  3VEX A;  3G10 A;  4BQL A;  5LMN K;  4KH6 A;  4O5F A;  1HLU A;  2XO7 A;  2O8C B;  1XMO K;  4Z4F A;  3AA2 A;  4CF8 A;  4DG1 A;  5JIC A;  3KIO A;  3TAG A;  2PYJ A;  2O8D B;  5FRO A;  1A5V A;  4JKH A;  4OJR A;  2UYT A;  3M8Q A;  3O3G A;  4YOU A;  4FJN A;  3EEQ A;  3ZEU A;  3T1Y K;  4B9U A;  3FZF A;  4DQR A;  4CJQ A;  1Y64 A;  3AA3 A;  4EHU A;  1DKG D;  1ATN A;  3NDK A;  1GLF O;  3H1Q A;  2WC9 A;  4IFY A;  4M3R A;  3H08 A;  5SZT A;  2W6L A;  1JLB A;  3HM9 A;  4PWD A;  2HMP A;  1NOY A;  4CGI A;  1W0H A;  4DUY K;  4AHU A;  1RTH A;  5AZI A;  2KFN A;  1JCF A;  4HTL A;  2YCH A;  1VQO N;  1QVG M;  4M3T A;  3UKU B;  3C0B A;  5KQ8 A;  4Q5V A;  3RVC A;  3OYM A;  2X6N A;  4XH4 A;  3NVM A;  4E1M A;  3WXM B;  1MA9 B;  1Q82 O;  5BRD A;  4DTN A;  1VQ9 N;  2RE2 A;  3ID6 A;  1E3M A;  3TTF A;  3WNE A;  4FM2 A;  2A1R A;  3N4P A;  1IKY A;  1GLE G;  2Q31 A;  4EFH A;  2PFU A;  2P9N B;  4KH4 A;  4IO9 L;  3A5O C;  4M42 A;  4O44 A;  4DFJ A;  4FJX A;  2OYQ A;  1A5X A;  3CIP A;  2NRW A;  4MO5 A;  1QSL A;  1RT5 A;  3OYK A;  2F96 A;  3L4I A;  1HYV A;  3CCS N;  3H3O B;  2NLX A;  4FJH A;  3AA5 X;  1S1V A;  1IG8 A;  3AV9 A;  3THX A;  4AH9 A;  5AQQ A;  2D5R A;  1VQ5 N;  4DS4 A;  3VEO A;  2FLO A;  3PV8 A;  1SKR A;  3PO5 A;  1VRU A;  1Z25 A;  4CIG A;  3O1B A;  4C8N A;  2BGG A;  1RCH A;  3RMC A;  1TKZ A;  5AQR A;  4DSE A;  1LWF A;  1WAF A;  2O8C A;  4BVO A;  3TAB A;  5AJ3 K;  4G9Z A;  3LAK A;  1GOC A;  3JS6 A;  3DI6 A;  1BWF O;  4CZM A;  4EP5 A;  2XY8 A;  4A2B A;  3ZSY A;  4FM0 A;  4G1Q A;  1VSJ A;  3DYA A;  4OLA A;  4BRO A;  1RFQ A;  1HYZ A;  3O1W A;  3RTV A;  2IAJ A;  3ISN C;  4XH1 A;  1D9F A;  5I9E B;  1JXB A;  3AVC A;  4H0Y B;  3CCL N;  4GW6 A;  5AQH A;  3CQY A;  1RDB A;  2FSK A;  3QET A;  1NWK A;  1IKX A;  4GV3 A;  4BVP A;  4AIL C;  3TI0 A;  4KFB A;  4J8F A;  1YIJ N;  3RSE B;  4JKC A;  3RR7 A;  3VQ5 A;  2ZQB A;  3D6R A;  2NUB A;  1VQ6 N;  2DFF A;  3OW2 M;  4FPB A;  1NBW A;  4CFD A;  3CMA N;  4E7J A;  1ZBU A;  4E7H A;  4X65 K;  1IJJ A;  3SYZ A;  3HO1 A;  4CHZ A;  1L3S A;  1XNQ K;  3I0R A;  1U2V A;  1RBV A;  3V9X A;  1BHL A;  3OTO K;  2GWK A;  1T03 A;  5C10 A;  2HVI A;  3NHG A;  4Z4E A;  3SBG A;  3HXM A;  2PYL A;  3CM6 A;  1JLF A;  4DSK A;  3VQ7 A;  4U7B A;  5J2Q A;  3P31 A;  2G8V A;  4FJL A;  1MU2 A;  3O9S A;  1NGH A;  1ZYQ A;  2CGJ A;  2E2N A;  4E1J A;  2YX6 A;  3CCV N;  4Z4C A;  4PL7 A;  4B08 A;  2FBV A;  3L2Q A;  4FLW A;  5DMR A;  1VQ4 N;  4F8R A;  4GV9 A;  4JKE A;  4RW9 A;  3SQ0 A;  3DM2 A;  4M7Y A;  4JI5 K;  3H3N O;  3C95 A;  3PSI A;  2QM1 A;  3ZET A;  3OYJ A;  4J2B A;  2YI1 A;  2YJF A;  4A5B A;  1HPM A;  3IRX A;  2AJQ A;  3EZ5 A;  4FJ7 A;  3HST B;  3R9P A;  2CH6 A;  5JVG L;  1SL2 A;  4FK2 A;  4IXC A;  2Z1H A;  1TGO A;  4OLB A;  3DXK A;  1KAX A;  3LM2 A;  3VGL A;  5GAG P;  4Z0U A;  3D2E B;  5AQO A;  4WE1 A;  1J5O A;  4JRP A;  5F2R A;  4JKF A;  3IDH A;  5I3U A;  1VSL A;  2ZGY A;  2V51 B;  3KKR A;  1C0F A;  4DMN A;  4HCC A;  2FXU A;  3HL8 A;  3O4Q A;  5EX5 A;  2OTL N;  1SL0 A;  5H1S Q;  3VF2 A;  4H4M A;  1Y97 A;  3M1F A;  1NGI A;  3HK2 A;  4DTX A;  4CEA A;  1OH7 A;  2QK9 A;  3AVK A;  1S3X A;  4BRM A;  5CYM A;  2P5G A;  2UU9 K;  5KTQ A;  4FWP A;  2QWN A;  4CF0 A;  3QEX A;  3Q7C A;  3PIP L;  2RHK A;  3HVT A;  4BE1 A;  4YHH K;  1U49 A;  4FWO A;  1NGB A;  2Z1G A;  1S9G A;  3QBX A;  1K73 O;  3FZH A;  1EWR A;  2HNY A;  4CF2 A;  4HUF A;  1TK5 A;  1Z6R A;  4LF6 K;  4DLG A;  3JYT A;  3K5L A;  3G0Z A;  4JS4 A;  5M1O A;  3DRS A;  1T05 A;  3E9O A;  2BE2 A;  4FOE A;  4YNQ A;  3W3D A;  2P9I A;  3A5N C;  3D7E O;  3VEY A;  4C8L A;  5CZ2 A;  1SAZ A;  4CHO A;  2ASM A;  4M3Z A;  4CEF A;  1E4F T;  1Z26 A;  2JLE A;  1X1P A;  3P4I A;  2PAV A;  4IJA A;  4CJS A;  3CCM N;  3V81 A;  1HUX A;  3E66 A;  2YHW A;  2HW3 A;  3P38 A;  3K9K A;  3J7Y P;  1SV5 A;  3RMA A;  4M3U A;  4H5W A;  3RMB A;  2AA4 A;  3IMX A;  4H03 B;  5AR0 A;  1GOA A;  2YNG A;  3GDQ A;  3OYB A;  4LF8 K;  3T3F A;  1BO5 O;  2GWJ A;  3THW B;  1T8E A;  4DQP A;  1T6C A;  3VQP A;  4FLZ A;  1FKP A;  4ISF A;  1YJW N;  1TKX A;  4Y1C A;  3U4L A;  1QZ6 A;  4GVM A;  3P5J A;  4RG8 A;  4DV1 K;  1YTA A;  3B8A X;  4FYD A;  3AVF A;  3AO2 A;  1Z05 A;  3BGR A;  3SV3 A;  4BGA A;  3O8M A;  4E89 A;  4IKF A;  1QHA A;  4CJF A;  2IVP A;  4DTO A;  4A59 A;  2F7T A;  3NF7 A;  3CCQ N;  4CHY A;  3PSF A;  4IFV A;  1U48 A;  1IBM K;  1S9E A;  4NO7 A;  4CD3 A;  4FW2 A;  4DV6 K;  5CYQ A;  4B3T K;  4YY3 K;  4FOI A;  4R79 A;  3CHW A;  4BRQ A;  3G71 N;  3ASM A;  4FK0 A;  2Q2R A;  3WNG A;  1YXQ A;  2GTD A;  2XHB A;  1DTQ A;  4DFK A;  3D2E A;  4ILG B;  1HR0 K;  1LWC A;  2VGN A;  5HRN A;  1IKW A;  2E8A A;  3U6F A;  1ITG A;  4MLH A;  4ID5 A;  4M63 C;  3CJ7 A;  4I6M A;  5AZJ B;  3EN9 A;  4LH4 A;  2ZM6 K;  2HHS A;  2ZGZ A;  2V7Y A;  2P51 A;  3TPQ A;  3VQ4 A;  4I6M B;  4LF7 K;  1IH7 A;  2QTD A;  3DXK B;  4EAH D;  3RRH A;  1N33 K;  4DU3 A;  4N76 A;  5HOO A;  4CEE A;  2YHB A;  3SQ4 A;  3ATV A;  3L0Q A;  1K9M O;  1T44 A;  2HHQ A;  1KTQ A;  2X74 A;  3DLB A;  3LDN A;  3OYI A;  2GEM A;  3NAE A;  2Z1I A;  3NH1 A;  2VG5 A;  5GAH P;  1BUP A;  5HRS A;  4RTF D;  1DTT A;  3HJF A;  4EZ6 A;  5E41 A;  3S9H A;  1RNH A;  1NGD A;  4GY2 B;  1S1U A;  1TAU A;  5CZ1 A;  3F9K A;  1VQP N;  4Z4H A;  1J9A A;  4JLH A;  1K8A O;  3KHY A;  2JWK A;  3VER A;  5KRT A;  2D0C A;  3AVB A;  5KGX A;  2PZS A;  4NCG A;  3HVR A;  3VQ9 A;  4M7X A;  1HPZ A;  3AY9 A;  4CZJ A;  1WSG A;  4CZE A;  3U9Z A;  4CJV A;  3CET A;  2VYP A;  5FPM A;  3E9L A;  2GV9 A;  4FWM A;  3UKR A;  4E1N A;  4HUE A;  1ZC6 A;  1BI4 A;  5GAE P;  5HRO A;  3HRG A;  5AQP A;  2NRT A;  3VEV A;  3MN5 A;  1YIT N;  3S3M A;  3VEN A;  3WQU A;  1TL3 A;  4A57 A;  3G6E N;  4FO0 A;  2KTQ A;  1V4T A;  3L2U A;  1FXX A;  3T69 A;  3WXJ A;  3KLF A;  4B1X B;  3I8D A;  3KLE A;  3WXK A;  1KVC A;  3V1O A;  3F9M A;  4M3X A;  1S1W A;  4JHD A;  3HSC A;  4CGH A;  2HBJ A;  3AO4 A;  3V9W A;  4WQ4 A;  4PY5 A;  3QNO A;  3IS9 A;  4O8K A;  3J8A A;  1WUA A;  1KSP A;  1LAV A;  1DGK N;  3J81 O;  3LZJ A;  4BR2 A;  3OYG A;  2F8T A;  4EP4 A;  3QIN A;  3ZYY X;  4QCL A;  1WSJ A;  4BRI A;  2ZJP L;  1NGF A;  3MAQ A;  3LL3 A;  3KWG A;  3TTD A;  4DU4 A;  2HHU A;  2Q3S A;  4GVE A;  4PKG A;  3K5O A;  3DJC A;  4JEP A;  4O55 A;  1GLL O;  4KHP K;  1U4B A;  1WSF A;  3OA9 A;  2GX9 A;  3HPG A;  2OPQ A;  1QE1 A;  4WCE L;  3VN5 A;  1VSI A;  5AQV A;  5HP1 A;  1VSH A;  4I9L A;  1SZ2 A;  4DTM A;  3MXM A;  3V1Q A;  2ITG A;  4CK3 A;  4WQ5 C;  1NK0 A;  1YT3 A;  2OAN A;  3VTH A;  5A2Q O;  3EL2 A;  4IBN A;  1KRP A;  4FL9 A;  4CFC A;  4DR1 K;  4FJ9 A;  3C7N A;  4FWL A;  4W5O A;  4JS5 A;  2W41 A;  1TUY A;  2BAN A;  1Q9Y A;  4Z4I A;  1C0M A;  2P9P B;  1CZ9 A;  3OYE A;  4DWI A;  4WF9 L;  2XY6 A;  1WOQ A;  4RW7 A;  2FSN A;  1ATR A;  4LFA K;  3OBY A;  4MDA A;  5M1Q A;  2KLA A;  2NRZ A;  4PL8 A;  1BGX T;  1RGI A;  1QS4 A;  3VOV A;  4K8Z A;  4IG0 A;  4K43 A;  3GBT A;  4BAC A;  3PO4 A;  1HNV A;  3L4Q A;  3HPO A;  2WON A;  2O4G A;  4DS5 A;  2OZS A;  3FLC O;  4B3M K;  5BPN A;  4JKG B;  1U47 A;  2HF3 A;  4CK1 A;  2WFB A;  4XIU A;  1VSE A;  3DLR A;  1QQO A;  4KKO A;  1BQN A;  3BF1 A;  3AVH A;  4IOA L;  5C2F A;  4MDB A;  3SMS A;  4F2S A;  2D0P A;  3R8E A;  4KHQ A;  3V9U A;  3VMF B;  1YVU A;  3DMJ A;  4GMJ B;  3K59 A;  3FE1 A;  3ZEU B;  3KK1 A;  2HB5 A;  1I3A A;  1ILY A;  4Q0B A;  5J1E A;  2IGI A;  4H0T B;  3AVJ A;  3J80 O;  2EX3 A;  5KQD A;  2WTU A;  2CGL A;  2E20 A;  1JCE A;  3SPZ A;  1IBL K;  1MWM A;  4BGB A;  2D4W A;  3CQX A;  2KKZ A;  4BE2 A;  3BY5 A;  3ZT4 A;  3LDL A;  2F4V K;  1RT3 A;  4FVU A;  1VRT A;  1T6D A;  2Q0R A;  3DLL L;  4IEE A;  4UY8 O;  4DV4 K;  4C1N K;  2NRV A;  3ZSO A;  1NJX A;  3LPT A;  2FBX A;  1NGA A;  2HBK A;  1KAZ A;  1UA0 A;  1ZBS A;  4DF4 A;  5CE3 A;  2J4R A;  4H0V B;  4QS7 A;  4FJ5 A;  4CZF A;  5BR8 K;  4IJN A;  5EVZ A;  4AHT A;  4WYB A;  5FLX O;  1REV A;  2BH1 A;  2Y1J A;  1WSI A;  3PUF A;  4B1Z A;  1V4S A;  3ULE A;  2OCE A;  2GUI A;  4DUZ K;  3TAQ A;  1JLE A;  1G15 A;  4JRQ A;  4CJ4 A;  3K2P A;  2YKM A;  1TAQ A;  4H5R A;  1N5Y A;  3ENB A;  4JAX A;  4RW8 A;  3THX B;  3BDP A;  4LD0 A;  4LF9 K;  5M1K A;  3MXJ A;  4FZZ A;  4JYA K;  1LW2 A;  2P9K A;  3HP9 A;  4DV7 K;  1OH5 A;  4CJP A;  1JCG A;  1KFD A;  3O9Q A;  5AQU A;  3DXM B;  4K41 A;  3QB0 A;  3LP0 A;  3MCA B;  4I2Q A;  4H5V A;  5KPR A;  4B9S A;  3LAL A;  3C6A A;  3ZT3 A;  4CBW A;  4LSL A;  1Q8I A;  3E01 A;  5AQF A;  2Q1N A;  1JLA A;  4CJ7 A;  1N36 K;  2UUB K;  2G8W A;  4O4G A;  2E2O A;  4CBU A;  2FC0 A;  3DLH A;  2HBL A;  1DEJ A;  1BOT O;  5BRH A;  4HCB A;  3MN9 A;  4IFE A;  2QWR A;  4BRD A;  4CJR A;  1SS6 A;  4BRF A;  3TU5 A;  3TSP A;  3ALY A;  1RT4 A;  4OKK A;  4M3W A;  5AQY A;  4V19 S;  3I56 N;  4NCA A;  3OYH A;  2P9I B;  3HPH A;  3O4N A;  5B8H A;  4CEC A;  2VWJ A;  2VQF K;  5GIP A;  4DSJ A;  1U2V B;  4B3S K;  1KVA A;  5HL7 L;  4H5T A;  3ZX0 A;  1N6Q A;  2HOE A;  3MX2 A;  2A41 A;  1HNZ K;  4CCH A;  4B9N A;  4BRC A;  3IKM A;  3HBT A;  4B3O A;  1NKC A;  1BL3 A;  3KK7 A;  4PKI A;  2E5L K;  3TWH A;  4N5S A;  4DQS A;  2YNF A;  1B9D A;  1C1A A;  1BQM A;  4QOZ B;  2QKB A;  3QEP A;  4BDY A;  3ULD A;  3LAN A;  4BG9 A;  5BR9 A;  5BN9 A;  4CED A;  2KZM A;  3VQD A;  5C2D A;  4CJW A;  3SLC A;  5SWM A;  2P9L A;  2IVO A;  5HBM A;  1TYQ B;  3ZT2 A;  3THV A;  1YUW A;  3D45 A;  4OVL A;  3AAP A;  4JNE A;  3MXI A;  1KAY A;  4CEZ A;  4CZI A;  4FWR A;  3TAP A;  4BDP A;  3RWU A;  3OJS A;  3H6E A;  3VF4 A;  1H1V A;  3FFI A;  2UUA K;  3D2F A;  3PX0 A;  3BF3 A;  3SMP A;  2WUS A;  3E9P A;  3TAM A;  3FZM A;  2FBY A;  5AQW A;  1HQU A;  4JK9 A;  1RTI A;  3QDK A;  3TAR A;  4KB0 A;  1LOT B;  2ZWH A;  4KHY A;  4KO0 A;  3ZET B;  1WNS A;  5IT9 O;  2YHA A;  4BRK A;  3O5B A;  3SUO A;  4CZK A;  3I0S A;  1QZ5 A;  1RDU A;  2IS3 A;  1YVN A;  4B9V A;  3CJA A;  4CHQ A;  3AVI A;  3OYL A;  3EO3 A;  1WB9 A;  4ELV A;  2UXD K;  1VAZ A;  2IDO A;  2V52 B;  1B9F A;  1U45 A;  4JI8 K;  1Q18 A;  4BDZ A;  3THY A;  1NKE A;  1B92 A;  3AGK A;  4RCH A;  1CZA N;  3OS0 A;  4B9T A;  4OKE A;  4JI3 K;  4L3Q A;  4JKD A;  4CHP A;  3NBP A;  1NK6 A;  4M3Y A;  3G25 A;  4B9Q A;  3OJU A;  2OTJ N;  4E7L A;  1OH6 A;  4FWQ A;  1NM1 A;  4DTS A;  1RT6 A;  2I7P A;  4M45 A;  4NCB A;  4XEI A;  3BUZ B;  1IBK K;  2QWQ A;  1BU6 O;  3DRP A;  5HRR A;  3ZX2 A;  3MCP A;  3SI6 A;  4CEQ A;  4CGF A;  2Z1J A;  1K8K B;  2JGU A;  3MDQ A;  1ZBI A;  4A5A A;  4TSX A;  2EHG A;  4O8U A;  1IG9 A;  3K58 A;  5AQJ A;  1VQM N;  2ASP A;  3I55 N;  4O0I A;  5FRM A;  3SJJ A;  1YJ9 N;  2BUP A;  4BRP A;  3LP3 A;  3SAF A;  3LDO A;  1WN7 A;  3HOS A;  3W0L A;  3CM5 A;  2P9U B;  1RBU A;  4JK8 A;  2I7N A;  4FJ8 A;  4JI2 K;  4B8A B;  2QXF A;  4CJE A;  4KAZ A;  3WNH A;  4F3O A;  4PA1 A;  5AQM A;  3CJB A;  1F21 A;  4FVM A;  1SL1 A;  1T3V A;  3NGI A;  3MN7 A;  3NH0 A;  3VGM A;  2DPN A;  2KQ2 A;  2IIR A;  4OPJ A;  4PUO A;  4HHT A;  1HJR A;  1TUU A;  4BC3 A;  4CI6 A;  3AAQ A;  5HLF A;  3PIO L;  5T7B A;  3M8P A;  4N41 A;  3SUN A;  1U04 A;  1G99 A;  1NK5 A;  1TK8 A;  2ASO A;  4KHN A;  3DWL A;  3BEX A;  1IO2 A;  3QER A;  2P9S B;  3R6M A;  2KZZ A;  3SAG A;  2OA8 A;  4IOC L;  2P9L B;  4ILH A;  3KJV A;  3V6D A;  3MWP A;  2FF6 A;  4AHC A;  1P8Z A;  3K9J A;  5AQX A;  2G8F A;  1KC8 O;  1XWL A;  4CJ5 A;  3DOL A;  4BRA A;  1CLQ A;  4JI4 K;  2FSJ A;  1BA1 A;  1HYS A;  3ITH A;  3VF6 A;  2QEX N;  1BDG A;  1LW0 A;  1HMV A;  5HRP A;  5AQS A;  1J6Z A;  4CW7 B;  4BC5 A;  2HST A;  3AA4 A;  5JMV A;  1VQ7 N;  4KTQ A;  5TKY A;  3F2K A;  4YDU C;  3QO9 A;  1QSS A;  3QIP A;  2P9N A;  2HNZ A;  3CPW M;  4I2P A;  3OBW A;  3JAM O;  1WAJ A;  4B1V A;  1RT7 A;  3CCU N;  1ESV A;  2F9T A;  3SBT A;  2D1K A;  1XHX A;  4FSV A;  4IWV A;  2BTF A;  3OHR A;  4YOY A;  2E2Q A;  5LL6 Z;  2O8D A;  1JL2 A;  1ZXO A;  2E1Z A;  4DQQ A;  2YJE A;  3CD6 N;  4OPH A;  2QWO A;  3J7Z O;  3J7A P;  3UKU A; 
#chains in the Genus database with same CATH homology
 1A5W A;  1BIS A;  1ASV A;  1D9F A;  1BCM A;  1JXB A;  1U47 A;  2HHW A;  3AVC A;  1RBS A;  4GW6 A;  4CJU A;  2D0A A;  4CK1 A;  4XIU A;  5JS1 A;  1L3V A;  1VSE A;  2YNH A;  1RDB A;  3QET A;  3DLR A;  3L2R A;  1X9M A;  4KKO A;  2OPR A;  3U3G A;  1BQN A;  4FZY A;  1IKX A;  3QIO A;  1D5A A;  3AVH A;  3V4I A;  1YTU A;  4AIL C;  1WLJ A;  1RT1 A;  4KFB A;  3TI0 A;  1S5J A;  2YV0 X;  3LP1 A;  4F2S A;  5FRN A;  4KHQ A;  1C0U A;  3RR7 A;  1JLG A;  3VQ5 A;  3K57 A;  2ZQB A;  3V9U A;  4E7I A;  4F3T A;  1KLN A;  2NUB A;  2DFF A;  3ZCM A;  1NOZ A;  4HTU A;  5I42 A;  1YVU A;  4CFD A;  3DMJ A;  1JKH A;  3MEG A;  4GMJ B;  1ZBU A;  3LP2 A;  3ZSZ A;  3KK1 A;  1JLC A;  3K59 A;  4E7H A;  4E7J A;  3SYZ A;  1QQC A;  2HB5 A;  4RW4 A;  1I3A A;  3HO1 A;  4CHZ A;  2PY5 A;  4Q0B A;  1L3S A;  1WSH A;  3NGY A;  3I0R A;  5J1E A;  3SCX A;  2IGI A;  2QKK A;  4QAG A;  2XRI A;  5EU7 A;  3VQ6 A;  4LY7 A;  1RBV A;  3AVJ A;  2EX3 A;  1NK7 A;  4CHN A;  3V9X A;  1BHL A;  3L2W A;  2VG7 A;  5C42 A;  3SPZ A;  1T03 A;  3ZSW A;  2HVI A;  4NYN A;  3NHG A;  4Z4E A;  4BE2 A;  3AVN A;  4HVJ A;  3HXM A;  2X78 A;  3ZT4 A;  2PYL A;  3CM6 A;  3JSM A;  2XY7 A;  4CK2 A;  4E19 A;  1RT3 A;  1JLF A;  3PX4 A;  1IKV A;  4DSK A;  3VQ7 A;  5J2Q A;  1VRT A;  3AVG A;  2KFZ A;  1EKE A;  2G8V A;  4FJL A;  1MU2 A;  1ZYQ A;  4E0D A;  1XI1 A;  4CF9 A;  4Z4C A;  3D0P A;  4B08 A;  2FBV A;  4W5R A;  1NJX A;  2E6L A;  3ZSO A;  3L2Q A;  3OYF A;  3LPT A;  5K14 A;  2FBX A;  5DMR A;  3VQA A;  4ZHR A;  4FLW A;  4F8R A;  3VA0 A;  1K6Y A;  4AHS A;  4DTU A;  1S6P A;  4RW9 A;  3SQ0 A;  3TR8 A;  3DM2 A;  1UA0 A;  4DFP A;  3AO5 A;  3C95 A;  4DF4 A;  1ZBL A;  1NK8 A;  3OYJ A;  1I39 A;  1RBR A;  3ZSQ A;  4CF1 A;  4J2B A;  4J2E A;  1FKO A;  4KHS A;  3SPY A;  4FJ5 A;  3OY9 A;  3CFP A;  3HYF A;  2XY5 A;  4FZX C;  5CY4 A;  4AHT A;  4M3W A;  4E3S A;  3NGZ A;  4DLE A;  4MFB A;  1REV A;  3IRX A;  2AJQ A;  3EZ5 A;  4FJ7 A;  3HST B;  3DLG A;  4CEO A;  1WSI A;  3PUF A;  3C6T A;  3SZ2 A;  5J2P A;  2Y1J A;  1ASW A;  3HT3 A;  1NJY A;  3QES A;  1SL2 A;  4KTZ A;  4FK2 A;  4OPK A;  1TKD A;  2GUI A;  5DK5 A;  3DOK A;  4KB1 A;  3TAQ A;  2Z1H A;  4B9L A;  1JLE A;  5KI6 A;  1G15 A;  1TGO A;  4JRQ A;  4CJ4 A;  3K2P A;  3KKS A;  4DTP A;  1QTM A;  4OLB A;  2YKM A;  4DSI A;  3RRG A;  1TAQ A;  3DLE A;  3NCI A;  4J2D A;  3MEC A;  1X9S A;  4DFM A;  4Z0U A;  4DTJ A;  1N5Y A;  1BI4 B;  2ZD1 A;  4RW8 A;  3BDP A;  3OYC A;  3VQ8 A;  1TL1 A;  1RDA A;  4WE1 A;  4LD0 A;  3V1R A;  1HRH A;  3MXJ A;  2I5J A;  1J5O A;  2HMI A;  4JRP A;  4J2A A;  4L8R B;  4FZZ A;  1LW2 A;  3HP9 A;  2IC3 A;  3CFR A;  5I3U A;  1VSL A;  1JXE A;  3VQQ A;  4CIE A;  4CJP A;  3M8R A;  4CER A;  3KKR A;  1KFD A;  4CGG A;  4EZ9 A;  2RN2 A;  3SV4 A;  3B6P A;  4DMN A;  4HCC A;  3NF9 A;  3HL8 A;  5D3G A;  2D0B A;  4W5T A;  1L3U A;  3LP0 A;  3O4Q A;  3ZSV A;  4I2Q A;  4E7K A;  1SL0 A;  4B9S A;  1D8Y A;  4H4M A;  3LAL A;  1Y97 A;  3ZT3 A;  4LSL A;  2B4J A;  1Q8I A;  2HND A;  3E01 A;  4CE9 A;  4NYF A;  2Y1I A;  4Y1D A;  3T19 A;  3KLI A;  1JL1 A;  3HK2 A;  4DTX A;  4CEA A;  3EY1 A;  1JLA A;  2G8I A;  2QK9 A;  3AVK A;  2G8W A;  1RDD A;  5CYM A;  1S1X A;  1WSE A;  2LSN A;  2P5G A;  4O4G A;  3QNN A;  3L3V A;  5KTQ A;  1R0A A;  4KRE A;  1EP4 A;  4CF0 A;  4BWJ A;  3VA3 A;  3QEX A;  3SQ1 A;  1C1C A;  2FC0 A;  3HVT A;  3DLH A;  3O3F A;  4BE1 A;  1SKW A;  4OGC A;  1U49 A;  4MQ3 A;  2Z1G A;  3AO3 A;  4HCB A;  1O1W A;  4CFA A;  4F4K A;  1S9G A;  4CJR A;  1ASU A;  4ELU A;  2HNY A;  1C1B A;  3IG1 A;  4CF2 A;  4HUF A;  3DLK A;  3ALY A;  1TK5 A;  4DLG A;  3C6U A;  3JYT A;  4B8C A;  1RT4 A;  4OKK A;  3OS1 A;  3K5M A;  4KV8 A;  1LAW A;  1VSF A;  3K5L A;  3G0Z A;  4JS4 A;  4CJK A;  1UA1 A;  1NKB A;  4NCA A;  3DRS A;  3OYH A;  1KLM A;  3HPH A;  3O4N A;  1X9W A;  1T05 A;  4KI4 A;  2HVH A;  4CEC A;  2VWJ A;  3L8B A;  2BE2 A;  1KFS A;  1ZBH A;  4YNQ A;  3WNF A;  4DSJ A;  3V9S A;  4C8L A;  1QHT A;  1UWB A;  5CZ2 A;  4CHO A;  4DSF A;  4FW1 A;  2E4L A;  1KVA A;  1CXQ A;  4M3Z A;  4CEF A;  4CGJ A;  3DRR A;  4CCH A;  3F73 A;  1Z26 A;  2JLE A;  1N6Q A;  1HQE A;  4B9N A;  3LWM A;  1GOB A;  3TAF A;  1X1P A;  4CJS A;  4FJG A;  4ID1 A;  5C25 A;  1J54 A;  4B3O A;  3V81 A;  2BDP A;  3ZT0 A;  1NKC A;  2HW3 A;  1TV6 A;  3ZSR A;  1BL3 A;  4ICL A;  3RR8 A;  4IG3 A;  3TWH A;  1L3T A;  4N5S A;  4ZTJ A;  1SV5 A;  4DQS A;  3RMA A;  3AO1 A;  3RMB A;  1SKS A;  4M3U A;  2YNF A;  1B9D A;  1C1A A;  1BQM A;  1GOA A;  3OVN A;  4H4O A;  3LDS A;  2HHV A;  2YNG A;  1FK9 A;  3OYB A;  2QKB A;  4QOZ B;  3QEP A;  1L5U A;  4BDY A;  3T3F A;  3HP6 A;  3KK3 A;  3ULD A;  3LAN A;  4O0J A;  2DFE A;  4CJ3 A;  3KK2 A;  4CED A;  1T8E A;  4DQP A;  3VQD A;  2KZM A;  3VQP A;  4FLV A;  3TAN A;  2G8U A;  3P83 D;  4LH5 A;  2O4I A;  4CJW A;  4FLZ A;  1FKP A;  4KTW A;  2RPI A;  3IAY A;  1TKX A;  4Y1C A;  5SWM A;  5HBM A;  3ZT2 A;  3ZT1 A;  4GVM A;  3P5J A;  4RG8 A;  3THV A;  1ZBF A;  1YTA A;  4FYD A;  3D45 A;  3KD5 E;  3AVF A;  4IDK A;  4OVL A;  3MXI A;  1VSD A;  3AO2 A;  1S1T A;  1BCO A;  3BGR A;  3O3H A;  3SV3 A;  3NF8 A;  4CEZ A;  4E89 A;  3LWL A;  4IKF A;  4CJF A;  3TAP A;  3RWU A;  4DTO A;  4BDP A;  3TAE A;  3OJS A;  3LPU A;  3KLG A;  1VSM A;  3KD1 E;  3NF7 A;  3ZSX A;  4CHY A;  4IFV A;  1U48 A;  3OS2 A;  1S9E A;  1NJZ A;  3FFI A;  4C8K A;  4N56 A;  4FW2 A;  1BIZ A;  5CYQ A;  4KHW A;  3VQC A;  3PX0 A;  1LV5 A;  5JS2 A;  1UOC A;  3RMD A;  4N47 A;  2ATQ A;  3ASM A;  4FLX A;  4FK0 A;  3TAM A;  2FBY A;  3WNG A;  1BIU A;  1HQU A;  2ETJ A;  3U3Y A;  4DF8 A;  1RTI A;  1Q9X A;  4CES A;  2XHB A;  1DTQ A;  3TAR A;  4H8K A;  4DFK A;  4KB0 A;  1LWC A;  4KHY A;  3LAM A;  4KO0 A;  3ISN C;  5HRN A;  4FLY A;  1IKW A;  1WNS A;  3U6F A;  1RIL A;  1ITG A;  1RBT A;  1NJW A;  1TVR A;  2YHA A;  4RW6 A;  3K5N A;  4PQU A;  4ID5 A;  4W5Q A;  4FJK A;  3SUO A;  1EX4 A;  4FJJ A;  3NFA A;  3I0S A;  4LH4 A;  2HHS A;  3VQE A;  3SQ2 A;  4FXD A;  2DTU A;  2ZE2 A;  2IS3 A;  2P51 A;  1S6Q A;  3VQ4 A;  4B9V A;  4K8X A;  4CHQ A;  1RTD A;  4OKJ A;  2P5O A;  1IH7 A;  3MEE A;  3AVI A;  3RRH A;  1TKT A;  2F8S A;  2DY4 A;  3OYL A;  4DU3 A;  3CYM A;  4N76 A;  4KRF A;  4ELV A;  4CEE A;  2IDO A;  4KHU A;  1RT2 A;  2YHB A;  4CGD A;  3SQ4 A;  1B9F A;  1U45 A;  4FK4 A;  5KRS A;  3PX6 A;  1C6V A;  1JLQ A;  4BDZ A;  4FM1 A;  3KLH A;  2E6M A;  5J2M A;  3L3U A;  5FDL A;  3QEV A;  1NKE A;  5KGW A;  1KTQ A;  2HHQ A;  1B92 A;  2X74 A;  3DLB A;  3OS0 A;  3OYI A;  3NAE A;  2Z1I A;  4OKE A;  4B9T A;  3NH1 A;  1RTJ A;  4LSN A;  1W9H A;  4DTR A;  2VG5 A;  3M8S A;  3V9Z A;  4CHP A;  3NBP A;  4C8M A;  5HRS A;  1NK6 A;  4CFB A;  1DTT A;  4M3Y A;  3HJF A;  2G8H A;  4EZ6 A;  3OJU A;  5E41 A;  4AHV A;  4M41 A;  3CQ8 A;  1RNH A;  4E7L A;  3S9H A;  4DTS A;  1KCF A;  1RT6 A;  1UAX A;  1C0T A;  1DLO A;  1S1U A;  5C24 A;  1TAU A;  4M45 A;  4DQI A;  4CJT A;  5CZ1 A;  4NCB A;  1NK4 A;  3F9K A;  4Z4H A;  2RKI A;  1XHZ A;  1J9A A;  2VWK A;  4JLH A;  2G8K A;  5KRT A;  3DRP A;  4C8O A;  3NE6 A;  2D0C A;  3AVB A;  5KGX A;  5HRR A;  2PZS A;  3SNN A;  4NCG A;  3HVR A;  4FJI A;  3VQ9 A;  3MED A;  3SI6 A;  3PY8 A;  1HPZ A;  3AVL A;  3G10 A;  4CEQ A;  4CJL A;  3UIQ A;  1WSG A;  4CGF A;  2Z1J A;  4CJV A;  4F2R A;  2JGU A;  2FBT A;  1ZBI A;  2XO7 A;  4TSX A;  2GV9 A;  4Z4F A;  2EHG A;  1IG9 A;  3AA2 A;  4E1N A;  3K58 A;  4HUE A;  3CFO A;  1BI4 A;  4CF8 A;  5HRO A;  4O0I A;  5FRM A;  3SJJ A;  3B6O A;  4DG1 A;  3LP3 A;  3S3M A;  4YFU A;  3KIO A;  3TAG A;  3SUQ A;  1CZB A;  2PYJ A;  1TL3 A;  2OZM A;  1WN7 A;  4I9Q A;  3C94 A;  5FRO A;  1A5V A;  2KTQ A;  4OJR A;  2OPS A;  3L2U A;  3M8Q A;  3CM5 A;  3O3G A;  1RBU A;  4FJN A;  4FJ8 A;  1FXX A;  3KLF A;  3I8D A;  4B8A B;  3KLE A;  4B9U A;  1SUQ A;  2HHT A;  1KVC A;  4OGE A;  4UQG A;  4DQR A;  2QXF A;  3V1O A;  4CJE A;  4FLT A;  4ELT A;  4KAZ A;  4M3X A;  1S1W A;  4CJQ A;  4DU1 A;  3AVM A;  4CGH A;  3SUP A;  4FJM A;  3AO4 A;  3AA3 A;  3WNH A;  2B6A A;  4F3O A;  2OPP A;  3V9W A;  3NDK A;  1J53 A;  4PY5 A;  4PA1 A;  1F21 A;  4FVM A;  2VG6 A;  4IFY A;  4M3R A;  1SL1 A;  3QNO A;  4KI6 A;  3H08 A;  3IS9 A;  5SZT A;  3NGI A;  1JLB A;  4FLU A;  3HM9 A;  4PWD A;  4W5N A;  2P1J A;  1KSP A;  1LAV A;  4R5P A;  3NH0 A;  1NOY A;  2KQ2 A;  4CGI A;  1W0H A;  3LZJ A;  1KVB A;  3OYG A;  4OPJ A;  3OYN A;  4AHU A;  1RTH A;  3QIN A;  4EP4 A;  4HHT A;  4PUO A;  2F8T A;  2KFN A;  1HJR A;  4QCL A;  1WSJ A;  5HLF A;  3MAQ A;  4M3T A;  2KW4 A;  1EET A;  3S3N A;  5T7B A;  4Q5V A;  1VK0 A;  3OYM A;  3M8P A;  4DU4 A;  4N41 A;  1NK9 A;  2X6N A;  1U04 A;  2Q3S A;  4CEB A;  4FCY A;  3SUN A;  2HHU A;  3P1G A;  4CIF A;  1NK5 A;  1RDC A;  2A1S A;  3K5O A;  4O55 A;  4E1M A;  3QEI A;  1TK8 A;  4KHN A;  1LWE A;  4KPY A;  4DTN A;  1IO2 A;  1U4B A;  1WSF A;  4I7F A;  3QER A;  2KZZ A;  3HPG A;  1QSY A;  2OPQ A;  4Z4G A;  1QE1 A;  2OA8 A;  3VN5 A;  1VSI A;  3WNE A;  3NF6 A;  2W42 A;  3LZI A;  1IKY A;  4FM2 A;  5HP1 A;  2A1R A;  1VSH A;  4I9L A;  4FJH A;  4DTM A;  1CXU A;  3OYA A;  3MXM A;  3V1Q A;  1TK0 A;  3KJV A;  3KTQ A;  3V6D A;  4AHC A;  2R7Y A;  2G8F A;  2ITG A;  4CK3 A;  1XWL A;  2RF2 A;  4CJ5 A;  3DOL A;  1CLQ A;  1NK0 A;  1YT3 A;  4M42 A;  4O44 A;  4DFJ A;  4FJX A;  4ZTF A;  3T1A A;  4IBN A;  2OYQ A;  3QEW A;  1HYS A;  1A5X A;  1KRP A;  3ITH A;  4CFC A;  1QSL A;  1RT5 A;  3OYK A;  2F96 A;  1HYV A;  4BE0 A;  4DSL A;  4FJ9 A;  2WOM A;  2X6S A;  1HMV A;  1LW0 A;  2YKN A;  5HRP A;  3AA5 X;  4W5O A;  1S1V A;  4BWM A;  3AV9 A;  4JS5 A;  4O5B A;  4B9M A;  4AH9 A;  2BAN A;  1Q9Y A;  2YNI A;  3NH2 A;  4Z4I A;  2D5R A;  3VQB A;  1C0M A;  4DS4 A;  3AA4 A;  3PV8 A;  4KTQ A;  3CG7 A;  3S3O A;  3L2V A;  1SKR A;  1HNI A;  3PO5 A;  1VRU A;  1Z25 A;  2B5J A;  1CZ9 A;  4C8N A;  4CIG A;  3OYE A;  4DWI A;  3QO9 A;  1QSS A;  2BGG A;  1RCH A;  2XY6 A;  2HHX A;  3QIP A;  2HNZ A;  4RW7 A;  3RMC A;  1TKZ A;  4DSE A;  4I2P A;  1LWF A;  1WAF A;  3OYD A;  3TAB A;  4AHR A;  1EXQ A;  1WAJ A;  1RT7 A;  3EYZ A;  1BGX T;  3QLH A;  2DFH A;  1GOC A;  2GBZ A;  3LAK A;  3DI6 A;  1QS4 A;  5J2N A;  4K8Z A;  1T7P A;  1XC9 A;  2IOC A;  4IG0 A;  4EP5 A;  2XY8 A;  1XHX A;  3ZSY A;  4FM0 A;  4G1Q A;  1VSJ A;  4HUG A;  4BAC A;  3PO4 A;  1HNV A;  1JL2 A;  3HPO A;  3AVA A;  3DYA A;  2WON A;  4OLA A;  4DQQ A;  2O4G A;  4DS5 A;  1D9D A;  1HYZ A;  3RTV A;  2IAJ A;  2OZS A;  1VSK A;  3A2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...