1WSIA

Crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGAGHPENERCNELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
source organism Escherichia coli
molecule tags Hydrolase
total genus 45
structure length 152
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsiA00
3I0SA 3OYCA 1VSJA 4DSJA 2ZD1A 5HRRA 4TSXA 3SPZA 1U45A 4KTQA 1S6QA 3NHGA 3VQBA 3ZT1A 4CJSA 3M8SA 4KKOA 4G1QA 4CEQA 1X9MA 4CFCA 2PYLA 4IG3A 1N5YA 3L2RA 2X74A 4FJGA 3NFAA 3VQQA 1RCHA 2XY5A 1T8EA 1IH7A 3NF6A 2QXFA 5CYQA 4BACA 1CXUA 4CIFA 2GV9A 4KHYA 1X9SA 4FJLA 3RMBA 1UA1A 3S9HA 2Z1JA 1KTQA 4PY5A 3ZSVA 3KLGA 3FFIA 2WONA 3VQEA 1KFDA 4ICLA 2YHAA 1JXBA 2NUBA 3OJUA 3PY8A 5J2PA 2KFZA 1U48A 4DU1A 1JKHA 1HYSA 4DU4A 4E7LA 4E7IA 3DRSA 4OKEA 4O44A 3SV3A 4Z0UA 2RPIA 3LPUA 1L3SA 4LSNA 1DTQA 4MQ3A 4HVJA 4B9LA 4FJ8A 3O4QA 2HVIA 2IDOA 4DWIA 3QEWA 4DS4A 4CEEA 1DLOA 1TKTA 3JSMA 3V9WA 4E7KA 3AA5X 2LSNA 4CHPA 2RKIA 4FJ5A 4QCLA 3K5OA 1RT6A 4FLVA 1SKRA 1HYVA 4KHQA 2OZMA 3MXJA 3O3FA 1ZBHA 4JRQA 4Q0BA 4CF9A 4F2RA 1C1AA 4B08A 5HP1A 3AVBA 1HNVA 4R5PA 4K8ZA 2FBXA 3LAKA 3LDSA 3RR8A 3WNHA 4DQPA 4ID1A 1J5OA 3KK2A 2KZZA 1C0TA 2XHBA 4BE1A 3VQ7A 1Q9XA 2Y1JA 1JLQA 4E0DA 3QEVA 4DTSA 1RDBA 3TAFA 3OS2A 4K8XA 3AVCA 3I0RA 3NBPA 3SQ0A 1Q9YA 2D0CA 5CYMA 1L3VA 4DSKA 1C1CA 2YKMA 3KK1A 3TAQA 3VQ6A 3AA4A 5SZTA 3O3HA 4CJKA 4L8RB 4OKJA 4CJWA 2KTQA 2KFNA 1HNIA 1S1XA 2VG7A 1EX4A 3QINA 1LW0A 1TKZA 3ZT4A 4W5OA 3U6FA 3HPHA 2W42A 2HMIA 1A5VA 1FKOA 4B9TA 2OPPA 1CZBA 3OS1A 5D3GA 1RTDA 2HW3A 5CZ2A 4AHRA 1BL3A 3DM2A 1TK8A 4E19A 4HHTA 3QLHA 4JLHA 4CHYA 3ULDA 4C8LA 5HLFA 4KREA 4DU3A 1SKSA 2ATQA 4FJHA 1NKBA 4WE1A 4I7FA 3TABA 2QKKA 3RMAA 4KB0A 1ZBUA 3KTQA 1SV5A 1F21A 3TAMA 1KCFA 3JYTA 1IO2A 2Z1GA 1WLJA 2RF2A 3IS9A 3L2WA 4FLUA 3AVIA 5KGWA 5KRSA 3EY1A 5KTQA 4DFJA 4FXDA 3DMJA 1XHXA 4N56A 4J2EA 4GVMA 3HPGA 2IAJA 4NCGA 4FJJA 5FDLA 1Z26A 1RDDA 2HVHA 1RT1A 1B92A 3L2UA 4AHUA 4KHSA 4CJTA 1Z25A 4C8OA 3BGRA 3DOKA 4N41A 4LH4A 2P51A 3QNNA 4FW1A 3OJSA 3SPYA 2AJQA 4OPKA 1SKWA 1ZYQA 3D45A 1KLMA 1WNSA 3L3UA 3S3MA 3LALA 4KRFA 4IFYA 1T03A 3QESA 1DTTA 3DLHA 4M3XA 3M8PA 4BDZA 3SYZA 2JGUA 1D9FA 5J2NA 3NCIA 1IKVA 1JLGA 1LWCA 3AVMA 3L2QA 1QTMA 1W9HA 3DYAA 2ZE2A 2P5OA 3D0PA 1MU2A 4ZTFA 1WSJA 3V1OA 5FRNA 4JS5A 4EZ6A 3V9XA 4AHCA 2E4LA 3ZT2A 4FK0A 1EP4A 4CFBA 2YNIA 4OPJA 1RTIA 4DMNA 4ELUA 3AV9A 3KKSA 3NF8A 3VQ8A 5E41A 3V1RA 3PX6A 4O5BA 3QNOA 1U49A 2FBTA 1RTHA 3QO9A 2HNDA 1J54A 2G8KA 2G8VA 4DTRA 4F4KA 1JLCA 1WSIA 4FZXC 3OYFA 4B8AB 1RT5A 3CFPA 4KI4A 4CF8A 3TAGA 2BDPA 3P1GA 3ITHA 3AO1A 1S6PA 5J2QA 1NJZA 1EXQA 2Q3SA 1SL2A 4KO0A 1GOAA 3NE6A 1G15A 4DG1A 4E1NA 4DQSA 1UWBA 2I5JA 2XRIA 3MEEA 2OYQA 5CZ1A 3WNGA 3SNNA 3HM9A 4JRPA 1SUQA 4FJ7A 4Z4EA 4HUFA 4KFBA 2HNZA 4I2PA 3KLEA 4DTJA 1RBUA 1NK0A 3S3OA 1NJWA 4KTWA 3AO4A 3VQAA 3KKRA 1TK5A 2QK9A 4DLEA 1JXEA 1EKEA 3OYBA 4M3YA 4Z4IA 2DFFA 2VG5A 3AVAA 4CHOA 4M3TA 4C8NA 3V9ZA 4CF2A 4LY7A 4CJEA 1HYZA 3OYDA 1D8YA 4HCCA 3T3FA 4ZTJA 3MXIA 2IC3A 1VRUA 4CK2A 2Z1IA 3SCXA 4CJQA 1QSSA 4HCBA 1KSPA 3M8RA 3OYLA 1KFSA 4CHNA 1NKCA 2VG6A 3ALYA 3CFRA 2X6SA 1BCMA 4PWDA 2X6NA 3NGZA 2IGIA 2YNHA 4FW2A 1CXQA 4IBNA 2HHXA 3SQ1A 1TAUA 1NOZA 3HXMA 3K5MA 4FYDA 1WAJA 1HRHA 1QQCA 3NGYA 4KAZA 4AH9A 3LANA 2Z1HA 4CGJA 4CJPA 4KHUA 4Z4HA 2FBVA 4CCHA 1A5WA 3NH2A 4RG8A 4M3UA 3F9KA 4M3ZA 1B9FA 3ISNC 4CJ5A 3UIQA 5J2MA 4FJIA 3A2FA 3SUQA 3IRXA 3AA2A 4IDKA 3MEDA 3NDKA 3PO4A 2YKNA 4CGDA 4H4OA 1EETA 1L3TA 1HMVA 2WOMA 2HNYA 3L2VA 3OY9A 1C0MA 1U04A 1HPZA 3CFOA 1JLAA 3OYHA 1RT4A 1XWLA 3T19A 4OKKA 3TWHA 5I42A 2Y1IA 2YNGA 1VSFA 4F2SA 5KRTA 1GOCA 4PQUA 1RNHA 3QIOA 4FLZA 1FKPA 5HRPA 4DLGA 1SL1A 3HP9A 2F8SA 2YNFA 2BGGA 2ZQBA 4CESA 1JLFA 4EP5A 4BWMA 4OGEA 1I3AA 3HL8A 3AO2A 5I3UA 1S5JA 3DRRA 1L5UA 1TKDA 4BDPA 4FJ9A 2F8TA 2GUIA 1VK0A 3C95A 3P83D 4OJRA 4I9LA 2P1JA 1TVRA 3AVFA 4O4GA 4DF4A 1B9DA 3ZSQA 4F3OA 1BIUA 3TAPA 1QSLA 3G0ZA 1FXXA 4FLXA 2XY7A 4C8KA 1IKYA 4CHQA 4DSLA 1CLQA 1W0HA 1WAFA 1RTJA 4MFBA 1YTUA 1X1PA 4CEAA 1JLEA 3K58A 3VQ9A 4DTOA 4DTPA 3AVJA 3CYMA 3DI6A 1J53A 1KVBA 4AHSA 2G8FA 1RBVA 4AHVA 4W5QA 3RTVA 3TARA 4GW6A 1FK9A 3ZT0A 3ZCMA 3QEXA 4M41A 4CECA 3RMDA 2QKBA 2O4IA 4YNQA 2E6LA 4NYNA 3MECA 1SL0A 4CEOA 4DSFA 2OZSA 1RT3A 1TV6A 3OYNA 1RT2A 4J2BA 4CK1A 3DLEA 1RBTA 4J2AA 4HUGA 3TI0A 2DFHA 2P5GA 4RW8A 3B6PA 1A5XA 4CJLA 1QSYA 1NJXA 4Z4GA 3CQ8A 3U3YA 4FCYA 3B6OA 1VSMA 3NH1A 1S1WA 2B5JA 1QHTA 4Z4CA 1HQUA 4OLAA 1K6YA 3MAQA 4B9NA 4XIUA 1HJRA 3LZJA 3AO3A 3K2PA 4CGGA 4KB1A 3THVA 4KPYA 4CGHA 5CY4A 1LW2A 3PO5A 3AA3A 4M45A 2IOCA 2ETJA 1JL2A 3DRPA 4RW7A 4CGIA 1WSGA 3LP3A 1TK0A 3OYEA 3SUNA 4ZHRA 4KHNA 3LAMA 2DY4A 4UQGA 4FLTA 3V9UA 4DQQA 1TGOA 3VN5A 3E01A 4CEDA 3VQPA 2G8HA 4EZ9A 3QERA 2HB5A 4DTUA 3RMCA 3MXMA 3VQCA 3IG1A 3VQDA 3OS0A 1UA0A 4CHZA 3V9SA 3AVHA 3I8DA 3DLBA 3ZSOA 3OYMA 4DSEA 3HK2A 3AVNA 1S9GA 4CK3A 4B9UA 3VQ4A 4O0JA 2OPSA 4Y1DA 4AHTA 4E1MA 4CJRA 3LP1A 4ID5A 1VSIA 4LH5A 3C6TA 3ZSXA 1ZBLA 4FM1A 2FBYA 1QE1A 4E89A 3T1AA 3WNEA 1YTAA 1D9DA 4CERA 4ELVA 3V6DA 1NK9A 1TAQA 4IG0A 3LWLA 3QETA 4FJKA 3MEGA 2B6AA 1R0AA 4CFDA 2BE2A 2OPQA 3LWMA 4HTUA 1IG9A 4KV8A 1BCOA 1RT7A 4OLBA 5KI6A 4JS4A 5T7BA 2KW4A 4B8CA 3SQ2A 4FZZA 1O1WA 1NOYA 4DQIA 4FJMA 1VSEA 4CJVA 4FZYA 4LSLA 3DLKA 4B9SA 1ITGA 2PZSA 3SQ4A 2F96A 3AVGA 1LWEA 4M3RA 3VQ5A 4DFKA 2E6MA 4I9QA 4RW9A 3RWUA 4NCBA 1VSKA 3DLGA 1RDCA 1YT3A 3U3GA 3HO1A 2BANA 3V4IA 5FROA 1WSHA 4RW6A 3O3GA 2PYJA 2EX3A 2HHVA 2GBZA 4OVLA 3K5LA 1WSEA 4KHWA 3OYJA 3TANA 3SI6A 3SZ2A 1Q8IA 3KD1E 1NK5A 4F3TA 1L3UA 1BISA 2JLEA 3CM6A 2HHQA 2R7YA 4E3SA 3CM5A 1KVAA 1BQNA 3ASMA 1TL3A 3TR8A 3HPOA 4RW4A 1RDAA 3OYAA 1XC9A 4M3WA 5DK5A 4IFVA 4NYFA 4KTZA 3VA0A 3CG7A 3SUPA 3HYFA 1U4BA 3NGIA 3NH0A 2VWJA 3DOLA 4DSIA 4W5NA 2D0AA 4OGCA 5J1EA 1S1VA 3F73A 3C94A 2XY6A 3EZ5A 1XHZA 1NJYA 2G8UA 4B9VA 3TAEA 4FJNA 4B9MA 1HQEA 4BWJA 3KK3A 1NK6A 4FJXA 4H8KA 2DTUA 1BI4B 4W5TA 3HT3A 2FC0A 2KZMA 1QS4A 2D5RA 5HRNA 1C0UA 2ITGA 3OYKA 1KLNA 4IKFA 3QEIA 3NF9A 5C24A 1NK8A 4CIEA 4QOZB 5C42A 4FM2A 3OYIA 4J2DA 1KVCA 1XI1A 4N76A 5JS2A 1C6VA 1WSFA 3KLHA 3KD5E 1REVA 4DS5A 2YV0X 4CJUA 3PV8A 1NKEA 2HHWA 1Y97A 3LPTA 3P5JA 4N47A 4AILC 4BE2A 4FM0A 3HJFA 3K59A 3OYGA 4CFAA 1BHLA 4BE0A 3LP0A 3RRGA 1IKXA 3BDPA 2O4GA 1TKXA 3KIOA 2KQ2A 3SV4A 3ZSWA 4FLYA 4CJFA 4Q5VA 1LV5A 1UOCA 5K14A 3SUOA 4C8MA 3EYZA 1ZBFA 2A1RA 4ELTA 3V81A 3LP2A 3NAEA 2B4JA 1JL1A 4M42A 3HSTB 3WNFA 4BDYA 4CIGA 5HRSA 3L3VA 4DFMA 1VRTA 4FLWA 3KJVA 3V1QA 3O4NA 4CGFA 2OA8A 3RRHA 2DFEA 4Z4FA 1YVUA 1RBRA 3KLFA 3VA3A 5FRMA 4DF8A 2HHSA 3AVLA 1VSDA 3OVNA 4GMJB 4CE9A 3M8QA 1WN7A 2X78A 1J9AA 4QAGA 2HHUA 1UAXA 1VSHA 2G8IA 3H08A 4KI6A 4LD0A 1S1TA 1T05A 1T7PA 4DTXA 2XY8A 3NF7A 2D0BA 5C25A 4NCAA 2RN2A 4Y1CA 4DTMA 1GOBA 4HUEA 4W5RA 3ZT3A 1S1UA 1BI4A 3PX0A 4PUOA 4CJ3A 3HVRA 5SWMA 4FK2A 1IKWA 3RR7A 5DMRA 1VSLA 4CJ4A 2YHBA 1KRPA 5HBMA 1CZ9A 2XO7A 3ZSZA 2PY5A 5JS1A 1ZBIA 4O55A 1N6QA 3AO5A 2OPRA 4FVMA 5EU7A 1ASUA 3QEPA 2EHGA 4CEFA 4E7JA 2IS3A 1RBSA 5KGXA 1X9WA 3AVKA 1BQMA 5HROA 2G8WA 3L8BA 1LAWA 3DLRA 4CF1A 3KLIA 3IAYA 1S9EA 3G10A 4PA1A 3ZSRA 3K57A 4DQRA 1JLBA 3SJJA 4B3OA 3C6UA 1RILA 3HVTA 3S3NA 1C1BA 3PX4A 4CF0A 4EP4A 1NK4A 1ASVA 3LZIA 3PUFA 4FK4A 3ZSYA 3K5NA 2A1SA 4E7HA 3QIPA 1LAVA 4F8RA 3HP6A 1ASWA 1LWFA 4I2QA 4O0IA 2HHTA 4YFUA 1BGXT 4H4MA 1D5AA 4DFPA 1U47A 1NK7A 1TL1A 1BIZA 4CEZA 4N5SA 2VWKA 1I39A 4CEBA 4DTNA
chains in the Genus database with same CATH superfamily
4A62A 3WXIA 4JV5K 4KTQA 3ZT1A 4KKOA 4G1QA 2QWRA 4RCHA 1X9MA 2PYLA 1U6ZA 2X74A 1RGIA 3NFAA 4H5TA 3WXJA 1CXUA 5DM6L 2P9PA 3WXLA 3RMBA 1UA1A 3EZWA 4BRDA 3FFIA 3PY8A 1JXBA 4WF9L 3DRSA 1YJWN 4B9LA 4LSNA 4HVJA 4FJ8A 3LDNA 2P9SB 1MA9B 3F2KA 4DS4A 2UYTA 3OA9A 2LSNA 4QCLA 1RT6A 3O3FA 3RSEA 1C1AA 4B08A 4DR6K 1HNVA 1SQKA 1M90O 1C0TA 2P9IB 2FF6A 2Y1JA 3OBYA 3NBPA 3ULEA 5CYMA 5FLXO 4YOWA 3CIPA 5F0XA 1Q18A 4H5RA 1S1XA 2D0OA 1LW0A 3FLCO 4F9OA 3HPHA 2W42A 1N34K 3J81O 1RTDA 4AHRA 3QLHA 1NGIA 4JLHA 4XH5A 4CHYA 4KREA 3DWLA 1HNZK 2ATQA 3HZ6A 2QKKA 4JI1K 1SV5A 1F21A 3TSUA 1IO2A 2Z1GA 4DFJA 1WBBA 4A57A 3DMJA 4WQ5C 4J2EA 3HPGA 2UUCK 1Z26A 3O8MA 3L2UA 1HKBA 1Z25A 1M1KO 2AJQA 4DKWA 4FWNA 5LMNK 3MWPA 1WNSA 3SBGA 3VERA 4RTFD 5J2NA 3NCIA 4OPHA 2ZE2A 2P5OA 1MU2A 4X64K 3N4PA 5FRNA 2OTLN 4EZ6A 3T1HK 4DMNA 5LL6Z 3NF8A 2Q0RA 4JI3K 1RT5A 3CFPA 4KI4A 4CF8A 3MWTA 3G6EN 3P1GA 3AO1A 1S6PA 5E84A 2Q3SA 2QM1A 4K25A 4KO0A 3CJCA 4E1NA 2YHXA 5GINA 4CZHA 2I5JA 2HBJA 4BRPA 1U2VA 4NXMK 2QTDA 4PL8A 4A59A 3SNNA 4FJ7A 4Z4EA 4BVOA 4DTJA 5AQUA 2UXBK 3AO4A 1C0FA 2QK9A 1EKEA 4Z4IA 2IVPA 4JKGA 4M3TA 3V9ZA 5AQQA 3TTDA 1HYZA 3CCEN 3ZEUA 2IC3A 1S22A 1QSSA 3K9KA 3CPWM 3J7AP 3OYLA 1KFSA 1BU6O 3CFRA 4BGBA 1WOQA 4AQYK 2X6NA 4FW2A 5CE3A 1CXQA 1TAUA 3C65A 1NOZA 1WAJA 3H1QA 4KH5A 1T3VA 4KHPK 3LANA 2HBMA 4KHUA 1A5WA 4DV0K 2GEMA 3F9KA 5KPRA 4M3ZA 3A2FA 5AQOA 3IRXA 4IDKA 2V7YA 3LM9A 3PO4A 2YKNA 4H4OA 2BTFA 2HNYA 4PL7A 2D0PA 4FO0A 2YNGA 1OKJA 4JKFA 5KRTA 1X3MA 4PQUA 1NGFA 3QIOA 3ZX3A 4CZGA 4CZEA 1JLFA 1L5UA 1S5JA 4FJ9A 2GUIA 1VK0A 3C95A 4JKHA 4CBWA 2Q1NA 3ZETB 4I9LA 3RVCA 2P1JA 1BIUA 3TAPA 3PIOL 1CLQA 5JLFA 1WAFA 3ZX2A 4MFBA 1X1PA 4FWQA 4CEAA 4DTOA 4AHSA 4W5QA 3RTVA 1ESVA 4GW6A 1FK9A 1IJJA 3ZT0A 3I8BA 2VQEK 3QEXA 3BUZB 3RMDA 1Z05A 4YNQA 1SL0A 2JWLA 4CEOA 3OYNA 3O08A 4GVEA 4HUGA 2P9NA 2DFHA 4CJLA 4Z4GA 4FCYA 1QHTA 2P9IA 3EE9A 3EO3A 4OLAA 3AO3A 4CGGA 2Q2RA 2V52B 3THVA 5CY4A 4YY3K 4KPYA 4M45A 5AQFA 4GKKK 2D1KA 4UQGA 4FPAA 4CEDA 3E01A 3VQPA 3A0IX 3QERA 3MXMA 4CHZA 3V9SA 3AVHA 3VOVA 3HK2A 3AVNA 4CK3A 4B9UA 4AHTA 2FF3B 3ZSXA 1BWFO 4E89A 3T1AA 3WNEA 4CERA 5ADXH 3V6DA 1P90A 1TAQA 3M6GA 1R0AA 4JYAK 4CFDA 1IG9A 2CGKA 3LWMA 1BCOA 1RT7A 2YHYA 1NLVA 4OLBA 5KI6A 2GTDA 3CETA 4AF1A 2KW4A 3SQ2A 3GL1A 4NB4A 4DQIA 3PIPL 4EIAA 4X62K 3KVGA 3DLKA 1ITGA 2OANA 2PZSA 2F96A 1LWEA 3HBTA 2ZJQL 4IEEA 4QS7A 1RDCA 3V4IA 1JJ2M 5FROA 3MN6A 4H5WA 2P9KB 1QHAA 2PYJA 2EX3A 2GBZA 2O8DB 3SZ2A 4F3TA 3JXUA 4H0OA 2R7YA 1KVAA 1RDAA 3VA0A 4DHYA 3CD6N 2D0AA 4F2RA 5J1EA 2G8UA 2NRHA 3TAEA 2UU9K 4MDBA 2ITMA 4FWOA 4H8KA 2OTJN 4B1XB 3HT3A 1JCEA 3CERA 2D5RA 5HRNA 1C0UA 3QEIA 1IV0A 5C24A 3OYIA 4J2DA 1WSFA 3VEVA 3KD5E 1REVA 4FM0A 3VEXA 4BE0A 5LJWA 1T6DA 2QW9A 3HRGA 2E2OA 3KIOA 2KQ2A 2NRZA 2GX9A 4CJFA 1LV5A 3MN7A 3SUOA 4H03B 3UKRB 3NAEA 2B4JA 3H6EA 4BDYA 2Q0UA 1K8KB 3VENA 1RDWX 3CC4N 3B8AX 3O4NA 2GUPA 2YX6A 5E26A 1HKCA 3QBWA 1YVUA 3VA3A 5FRMA 3CCVN 1NMNA 3AVLA 4LF9K 4JAXA 3D2FB 4DUZK 3CI5A 3VESA 4LC9B 4HWIA 4CD3A 1YJNN 2G8IA 1IG8A 3A5OC 3MN5A 4DV4K 2IVOA 4Z94A 1T7PA 4DTXA 2XY8A 3NF7A 5C25A 2WTUA 4NCAA 2HOEA 2D4WA 4IOXA 3VF6A 1GOBA 4DTMA 4W5RA 4IO8A 4WQ4C 1IKWA 1YHQN 4CJ4A 4NLBA 1KRPA 2XO7A 5JS1A 2E1YA 2HHHK 4O55A 2EHGA 3ZETA 4CEFA 2IS3A 1RBSA 5KGXA 2QI2A 3DLRA 4CF1A 4PA1A 3K57A 3SJJA 4B3OA 3HVTA 4RWTA 3S3NA 4BRIA 4JKCA 4EP4A 1NK4A 1ASVA 2O8CB 3VGMA 2E2PA 3K5NA 4F8RA 4ILJA 1NGEA 3ENOA 1BGXT 4BQLA 5JICA 1NK7A 1QZ6A 1BIZA 4CEZA 3CC7N 3VETA 4DV2K 3OYCA 3SPZA 4EAHD 3O1WA 3VQBA 4CJSA 3M8SA 1YXQA 3EE8A 5HL7L 4LF7K 4CFCA 4IG3A 1N5YA 5EX5A 3L2RA 4WFBL 4JD2A 3VQQA 1IH7A 4LFCK 5AZIB 4CIFA 2EWSA 1X9SA 4B1VA 4BREA 4PY5A 3ZSVA 4JKEA 5KQDA 4DV7K 1YIJN 2WONA 3VQEA 5AFUH 1ATSA 2YHAA 2NUBA 1K73O 1BA0A 3A5LC 3EN9A 4DU4A 4YOVA 3SV3A 3CJBA 3WXKA 4DWIA 4PHTX 1Z6RA 3D7EO 4E7KA 5AQHA 1ZXOA 4FLVA 2OZMA 3MXJA 2YI1A 3CHWA 3T69A 4K0KK 3AVBA 2FBXA 3LAKA 3RR8A 4DR4K 3KK2A 2KZZA 4BVPA 4CZFA 5BR9A 1RDBA 4K8XA 3AVCA 3ENHA 3ID8A 2D0CA 2YKMA 3VEWA 3KK1A 3AA4A 5FPMA 5SZTA 4I6MA 2KTQA 1HNIA 2VG7A 1EX4A 4BR9A 3QINA 3M1FA 3AY9A 3U6FA 1A5VA 1FKOA 4B9TA 1VQMN 4DV5K 5CZ2A 2A40A 2P9KA 3DM2A 3W0LA 4CZJA 1TK8A 3W3DA 2P9UA 4DU3A 2E20A 4FJHA 4B1UB 1NKBA 4I7FA 1U2VB 1KAZA 2PFUA 3TAMA 1KCFA 4CZMA 3JYTA 1WLJA 5KRSA 4FWPA 3EY1A 4FXDA 4DR7K 4BC4A 4J8FA 5FDLA 1RDDA 3I33A 1NM1A 4AHUA 4NXNK 3AGKA 4O8KA 4LH4A 2P51A 3QNNA 4FW1A 2ZGZA 4IFYA 3DLHA 4BDZA 4H0TB 3SYZA 2JGUA 1LWCA 3L2QA 1V4SA 1EWQA 3DYAA 4M7XA 4IJAA 3D0PA 4KH6A 1Q7YO 4ZTFA 1RFQA 1WSJA 3V1OA 1HLUA 4FK0A 1EP4A 4B1ZA 4E1JA 5C10A 1VQ5N 3PX6A 4LFAK 3IKMA 4A61A 4BROA 3QNOA 1RTHA 3QO9A 1J54A 1ATNA 4FZXC 5AQWA 4YDUC 4YOTA 4B8AB 1VQ9N 3TAGA 2BDPA 3UKRA 1SL2A 1EXQA 4IWVA 1UWBA 1K8KA 2XRIA 4GY2B 5CZ1A 4K43A 3HM9A 4JRPA 4KFBA 1NK0A 1RBUA 3MCPA 4KTWA 3D2FA 3CJ9A 3OYBA 5ELZA 2DFFA 4CHOA 4C8NA 3FGUA 3VMFB 3O9SA 1D8YA 3C7NB 3SCXA 4CK2A 4HCBA 5M1OA 1KSPA 1K9MO 3ALYA 1NWKA 4PWDA 3NGZA 4CVNE 5FPNA 3U8XA 4AM7A 5C12A 3THXA 5AQKA 1HRHA 3NGYA 4JKBA 4KAZA 4AH9A 2P9NB 4CGJA 3QBXA 5AJ3K 1XC3A 2FBVA 3C6AA 1B9FA 5GADP 3UIQA 2O8CA 5J2MA 3SUQA 1OVYA 3AA2A 3NDKA 4CGDA 2WOMA 3L0QA 3OY9A 3CFOA 3OYHA 1GLBG 4A2AA 1VSFA 4FLZA 2ASPA 2WC9A 2F8SA 2ZQBA 4CESA 4EP5A 5I3UA 4BWMA 3CQYA 4BDPA 4H5NA 1DKGD 1WBDA 3O9TA 5AZIA 4XH1A 4JK7A 2A41A 2O8FB 1B9DA 1C0GA 1QSLA 3G25A 3TTFA 3M5RA 1FXXA 4FLXA 3MN9A 4DTPA 3DJCA 1KVBA 2G8FA 3TARA 3JS6A 3E9PA 4M41A 4NLCA 4CECA 2QKBA 1WUAA 2RHKA 2O4IA 4JI0K 1QVFM 1O13A 2OZSA 2ASOA 1RT2A 5JLHA 2NRVA 3DLEA 5AQXA 1S3XA 2P5GA 4RW8A 1A5XA 1QSYA 5I9EB 3U3YA 1VSMA 3NH1A 3SMPA 2V51B 4K41A 3MAQA 4XEIA 2GWJA 4XIUA 2VYPA 3K2PA 4CGHA 1LW2A 5A2QO 3PO5A 3AA3A 2IOCA 4RW7A 2WBNA 1TK0A 3SUNA 4KHNA 3C0BA 3LAMA 3VN5A 3PLAA 4IXCA 4DTUA 3RMCA 3IG1A 4QS8A 5IWAK 4UY8O 3THWA 3CQXA 3OYMA 1VAZA 1XNRK 4CJRA 1SZ2A 4Y1DA 3LDPA 3LP1A 3MX2A 4ID5A 4JI2K 3AARA 4BC2A 2FBYA 1QE1A 5JVGL 1D9DA 4ELVA 4FJKA 3QETA 3LWLA 3MEGA 4ISEA 3H3NO 4X65K 2OPQA 5T7BA 4B8CA 3FZKA 3OTOK 4MLHA 4FWMA 4B3MK 1T44A 4LSLA 4U7BA 3J80O 3VQ5A 3AVGA 4M3RA 2E5LK 4DFKA 1NNEA 1VSKA 3DLGA 1YT3A 1FJGK 3DLLL 2BANA 1WSHA 4OVLA 1WSEA 4KHWA 3SJHA 1KQSM 1KXPA 3CM6A 3CCJN 3CM5A 3HPOA 1BQNA 1U45A 1TL3A 4Z4FA 4KH4A 4IFVA 4NYFA 3CG7A 4IEIA 4W5NA 2XY6A 1NJYA 4B9VA 3EZ5A 2QWQA 1TUUA 4B9MA 3KK3A 1NK6A 3C6HA 2DTUA 1ILYA 4W5TA 2E88A 1OVQA 5AQPA 2ZWHA 4CIEA 5C42A 4FM2A 3L4QA 1KVCA 5LJVA 5JS2A 3KLHA 2YV0X 4CJUA 3LPTA 5AQLA 3HJFA 4N47A 2YHWA 3C7NA 4LF6K 3LP0A 3RRGA 3UB5A 3CF5L 3AAQA 3BY5A 2O8BB 3SV4A 3ZSWA 4FLYA 4Q5VA 4IOCL 4C8MA 1ZBFA 3U9ZA 4MO5A 3HSTB 3WNFA 3EL2A 5BPMA 3O9UA 3L3VA 3P38A 4DFMA 1VRTA 1NG9A 2HF3A 2YCHA 5GAGP 3RRHA 2DFEA 2HHSA 3KLFA 3LM2A 1J6ZA 2HSTA 4H0VB 1VSDA 4JD2B 4DR5K 4WFAL 3I56N 5F1XA 1WN7A 2X78A 1NGHA 3R1XA 4JI4K 4Y0WA 3H08A 4KI6A 3BZKA 4FWKA 3VEYA 3DXMB 2IVNA 3ZT3A 4PUOA 4CJ3A 1YF5L 5SWMA 3HSCA 1BG3A 5DMRA 1VSLA 4BRAA 4K42A 5HBMA 1CZ9A 3ZSZA 2UUBK 1IBLK 3THYB 1GLLO 3SMSA 4E7JA 2A5XA 1X9WA 2O8FA 3AVKA 1BQMA 5HROA 3L8BA 4BR7A 3ZSRA 1GLJO 4DQRA 1JLBA 1RILA 3MX5A 3VF2A 2FSKA 2QWOA 1ZBSA 4O8UA 4CF0A 3LZIA 3BZCA 4FK4A 1MWKA 2A1SA 1LAVA 3NMUA 1ASWA 1LWFA 4M63C 2QWMA 3N4QA 4DFPA 2VWKA 3CCMN 4CEBA 3TABA 4I6MB 3I0SA 1XQSC 4DSJA 2ZD1A 5HRRA 4BY9C 3NHGA 2CGJA 2QWNA 4B3TK 3BEXA 4FJGA 2HF4A 3VTHA 3U9DA 4BACA 2QXFA 3LDQA 2P9UB 4FJLA 2O8EB 3S9HA 2Z1JA 2HBLA 3KLGA 2NRWA 1KFDA 3H46O 3J7YP 5J2PA 2KFZA 1U48A 4DU1A 1JKHA 1HYSA 1SS6A 5IT9O 4OKEA 4Z0UA 1L3SA 1DTQA 2OCEA 4MQ3A 2IDOA 3QEWA 4CEEA 1DLOA 1NGGA 3JSMA 3V9WA 1LOTB 3AA5X 4FJ5A 1ZBHA 4HTLA 1GLFO 5EXWA 3O9RA 5HP1A 3D6RA 4R5PA 1XNQK 3LDSA 4DQPA 1J5OA 3CMEN 4XH4A 2XHBA 3KK7A 3VQ7A 1Q9XA 3J7ZO 3QEVA 3TAFA 3JAMO 3OS2A 3I0RA 4GNIA 4MO4A 1Q9YA 4DSKA 1L3VA 3TAQA 3O3HA 4L8RB 2W40A 1S72N 4OKJA 4CJWA 2KFNA 3G71N 3A5MC 1TKZA 4W5OA 1HJOA 2HMIA 3OS1A 2F9TA 3T7ZA 5D3GA 1NBWA 2VCPA 4JNEA 3NVKA 3LL3A 4DR1K 5EOYA 3HM8A 3ULDA 4C8LA 5HLFA 4PKIA 3MDQA 4KBOA 4WE1A 3KHYA 3RMAA 1ZBUA 3KTQA 2KZMA 4FLUA 3IS9A 5KTQA 1XHXA 4N56A 4GVMA 2IAJA 4JKAA 4NCGA 4FJJA 1QZ5A 3EKSA 2HVHA 1RT1A 1B92A 3BGRA 4N41A 2HMPA 3OJSA 4OPKA 1QQNA 3L3UA 4KRFA 3QESA 1LCUA 4DV1K 3M8PA 3HI0A 1JLGA 1Q86O 1QTMA 1W9HA 3THXB 3VGKA 5BPLA 3SAHA 5M1QA 3V9XA 5GAHP 2IIRA 3ZT2A 3CC2N 4CFBA 2YNIA 4O5FA 5TKYA 5E41A 3VQ8A 5C0YA 3V1RA 4O5BA 2HNDA 2G8KA 2O8BA 2G8VA 4DTRA 4F4KA 1JLCA 4FVUA 5AQIA 1KAYA 1W97L 5M1NA 4G9ZA 3D2EB 3ITHA 3OW2M 5J2QA 3VTIA 1GOAA 3NE6A 3MEEA 3WNGA 2KHOA 1SUQA 2HNZA 4I2PA 3KLEA 3S3OA 1NJWA 3VQAA 3KKRA 1TK5A 5AZJB 1JXEA 4DLEA 3AAPA 4BR5A 4CZLA 1BO5O 4DCHA 2V7ZA 2VG5A 3AVAA 3GG4A 3ZX0A 3MK6A 3ENBA 3VF4A 3OYDA 4HCCA 1IBMK 3VEZA 3DXMA 3MXIA 4CBXA 2UXCK 3OBWA 4CJQA 4WQ5A 3CCUN 5KPTA 1CZAN 4ISGA 4BG8A 3P4IA 4CHNA 1NKCA 2X6SA 1BCMA 4FOIA 2IGIA 2YNHA 4IBNA 4H5VA 3SQ1A 2YJEA 3HXMA 3K5MA 3THYA 4FYDA 3KWGA 2CGLA 1ZC6A 5BRHA 1QQCA 3BF3A 4EFHA 3DAWA 4CJPA 4MDAA 2E1ZA 2YJFA 4CCHA 1YVNA 4JI6K 1N32K 4CJ5A 1X9JA 4FPBA 5BPNA 3CJ7A 3MEDA 2FLOA 5LY3A 1EETA 1L3TA 2J4RA 1HPZA 1RT4A 4OKKA 1YAGA 2FSJA 1N36K 2E2NA 2JWKA 1RNHA 1FKPA 5HRPA 4DLGA 2BGGA 4CI6A 3THWB 1I3AA 1TKDA 4CD1A 4OJRA 2WUSA 4JK8A 1TVRA 3AVFA 2O8EA 4FWSA 5AR0A 4F3OA 3G0ZA 1IKYA 1XMOK 1VHXA 1YTUA 3K58A 3VQ9A 3AVJA 3CYMA 3DI6A 1NGBA 4LFBK 1J53A 1RBVA 3MMVA 4FWRA 4NYNA 3J8AA 3MECA 4JN4A 3E9OA 2NZTA 4J2BA 4CK1A 4WCEL 1RBTA 4J2AA 3MCAB 1VQON 3TI0A 4AM6A 2ZJRL 3CQ8A 2B5JA 5TKWA 2VQFK 1HQUA 3E9LA 3HTVA 4KB1A 2Q97A 2P9LB 3BF1A 3U4LA 5GIOA 2ETJA 1JL2A 3OYEA 4ZHRA 2DY4A 1D4XA 4FLTA 3V9UA 4DQQA 4A2BA 2G8HA 5AQSA 2HB5A 3I8DA 5AQMA 1DEJA 4BC3A 4DSEA 1S9GA 5M1PA 4O0JA 2OPSA 4LH5A 3C6TA 1ZBLA 4FM1A 4IDHA 1VQ4N 4B1YB 1X3NA 4IG0A 3QICA 1SAZA 3I55N 4HTUA 4YOYA 4JS4A 4FOEA 1VSEA 3DXKB 1NMDA 2WFBA 1KD1O 4B9SA 3FZFA 4JKDA 2E6MA 3WEEA 3QFUA 3RWUA 3ATUA 2ZGYA 3R6MA 3CCSN 3O3GA 3R8EA 3K5LA 2FSNA 1XUPO 3O80A 1EQYA 3OYJA 1Q8IA 1OH6A 3KD1E 5CR4A 2VGNA 2JLEA 3CXCM 4E3SA 1HPMA 3ASMA 4OPAA 1XC9A 4R79A 4KTZA 3A8YA 4IJNA 1T6CA 1U4BA 4H0PA 4QS9A 3NGIA 4DSIA 1XHZA 5GAEP 3D2EA 3C94A 4FJNA 2F9WA 4FJXA 1GLCG 5EY4A 3LDLA 1QS4A 1KLNA 2ITGA 3WQUA 2UUAK 3ZYYX 3NF9A 4IZ9A 4CBUA 3SAGA 4CJ7A 5AZJA 5C15A 1XI1A 1C6VA 2NRRA 4DS5A 1NKEA 1Y97A 5AQTA 4BE2A 4DV6K 2W41A 4ILHA 4CFAA 3OYGA 1IKXA 1I94K 3BDPA 1TKXA 2QA4N 1HNWK 5K14A 3EYZA 2A1RA 2QEXN 3LP2A 5C2DA 2I7PA 4CIGA 4BRCA 4JI7K 5HRSA 4DV3K 3Q7CA 2NRTA 1E4GT 4B1WB 4FLWA 1HR0K 1VQPN 3V1QA 1NGJA 4BR0A 2OA8A 1RBRA 1NGCA 4H0XB 1QVGM 3H1VX 3QMLA 3OVNA 4QAGA 1J9AA 2HHUA 1UAXA 5M1KA 4DR3K 2ZJPL 4LF8K 4LD0A 4GKJK 1NGDA 1T05A 5F2RA 3R3LA 4JEPA 1YUWA 2NNWA 3S41A 1BI4A 3HVRA 3RR7A 5FPEA 3O1BA 2YHBA 4L3QA 3TTCA 2PY5A 1TYQA 3M3ZA 4BRNA 1N6QA 2OPRA 5EU7A 1ASUA 2G8WA 1BDGA 4BC5A 1LAWA 3IAYA 1S9EA 2HHXA 4YOXA 3Q7BA 3ZSYA 4E7HA 4I2QA 3QB0A 1KAXA 3P39A 2HHTA 4ILGB 4H4MA 1TL1A 4JI8K 1I39A 2NLXA 3SAFA 1VSJA 4LF5K 4TSXA 2CH5A 3CPEA 5FPDA 1S6QA 1JCFA 3WT0A 4CEQA 5CHIA 1RCHA 2XY5A 1T8EA 3NF6A 2P9LA 5CYQA 3GOIA 4KHYA 2GV9A 3H45C 1KTQA 1OH5A 4B3RK 4ICLA 3OJUA 1VQKN 5AQGA 4E7LA 4E7IA 4JI5K 3UE5A 4O44A 2RPIA 3LPUA 4EHUA 3O4QA 2HVIA 4YHHK 1TKTA 4CHPA 2RKIA 1NJIO 3K5OA 3BP8A 4KHQA 1SKRA 1HYVA 4Q0BA 4JRQA 4CF9A 4FSVA 4WQ4A 4K8ZA 3WNHA 4ID1A 4JHDA 5EVZA 4U67L 4BE1A 3K0SA 4CW7B 1JLQA 4E0DA 4DTSA 2A6AA 3SQ0A 4IOAL 1C1CA 3QFPA 3DXKA 3VQ6A 4CJKA 2Q31A 4GV3A 4EHTA 4DUYK 2ZF5O 3WUHA 3ZT4A 1N8RO 2OPPA 1CZBA 2HW3A 3PSIA 1R59O 1BL3A 4FWLA 4E19A 4HHTA 3UKUB 5M1FA 4C1NI 1SKSA 1MWMA 1OH8A 4KB0A 2NRXA 2RF2A 3FE1A 3L2WA 3AVIA 5KGWA 1OH7A 1FW6A 3T1YK 2P9SA 4A5AA 4CJTA 4KHSA 4C8OA 3DOKA 3PSFA 4JK9A 3SPYA 5AQVA 1SKWA 1ZYQA 3D45A 1KLMA 3CJ1A 3ID6A 3S3MA 3LALA 1T03A 1DTTA 4M3XA 3FFKB 3FZLA 1GLDG 1D9FA 1IKVA 3AVMA 2VWBA 2W6KA 3F5TA 4WFNL 4WYBA 5AQRA 4JS5A 4AHCA 2E4LA 3IUCA 1W7AA 4OPJA 1RTIA 1J5EK 4ELUA 3AV9A 3KKSA 4C1NK 1Q81O 4BRLA 4BR4A 1JCGA 3ATVA 2FBTA 1U49A 2BUPA 1WSIA 5JMVA 3OYFA 1NGAA 2GELA 1K8AO 1GLEG 4X66K 1NJZA 1G15A 4DG1A 4DQSA 1QQOA 3CJAA 2OYQA 1GLAG 4HUFA 1HKGA 1BUPA 1VQ6N 5BN8A 2F4VK 5GIPA 4B3SK 3EKUA 4CF2A 2AA4A 4LY7A 2CH6A 4CJEA 3AGRA 5LMUK 3T3FA 4ZTJA 3GDQA 1VRUA 2Z1IA 1MDUB 2E2QA 3M8RA 2VG6A 1QQMA 2BH1A 1IBKK 2GWKA 1Q82O 2RE2A 2Z1HA 4Z4HA 2PAVA 1E4FT 3NH2A 4RG8A 4M3UA 2DPNA 4DB3A 3ISNC 3E1YA 4FJIA 1BOTO 2HBKA 3NVMA 1HMVA 3L2VA 3F9MA 1C0MA 1U04A 1JLAA 1XWLA 3T19A 3TWHA 5I42A 2Y1IA 3VEOA 4F2SA 1GOCA 1SL1A 3HP9A 2YNFA 4YDUA 4YOUA 4OGEA 3HL8A 4C8KA 3AO2A 2F8TA 3DRRA 2I7NA 1YJ9N 3P83D 4V19S 4BRGA 3P31A 4OO1J 3TSQA 4O4GA 4DF4A 3ZSQA 1VQNN 3G4SN 1Y64A 2XY7A 5H1SQ 3SLCA 4B9QA 4CHQA 1YI2N 1W0HA 4DSLA 1BA1A 1EWRA 1RTJA 3KWIA 2QWLA 1JLEA 5C2FA 5AQJA 1HNXK 4AHVA 2E8AA 4NO7A 3ZCMA 4BQZA 3SBTA 1E3MA 4A5BA 2E6LA 1HX1A 4DSFA 1RT3A 4IFEA 1TV6A 1YITN 3B6PA 2W6LA 1NJXA 3WEEB 1VQ8N 3B6OA 1S1WA 3A5NC 4Z4CA 1K6YA 4BG9A 4B9NA 3LZJA 1HJRA 3SK3A 5BN9A 4YORA 5KQ8A 5ADXA 1TUYA 2P9PB 3CCQN 3WXMB 3DRPA 4CGIA 1WSGA 3LP3A 4BGAA 1TGOA 2UXDK 4EZ9A 5BRFA 3VQCA 3VQDA 3OS0A 2KKZA 1UA0A 3GBTA 3DLBA 1NU0A 3ZSOA 3ZLJA 1H1VA 3UKUA 3VQ4A 1G99A 4E1MA 3L6QA 1VSIA 4DR2K 3RSEB 1YTAA 3KZBA 1NK9A 5KPZA 3TSPA 2B6AA 4M7YA 4PKGA 2BE2A 4KV8A 4CZIA 2A3ZA 4FZZA 3ULEB 1O1WA 4BRQA 1NOYA 3OHRA 3CCRN 4FJMA 4CJVA 1XMQK 4FZYA 3SQ4A 4I9QA 4RW9A 4NCBA 3HO1A 3U3GA 3R9PA 4RW6A 2HHVA 4OX9K 3TANA 3SI6A 5BR8K 1NK5A 4H0YB 1L3UA 1BISA 2HHQA 5AQNA 3TR8A 4RW4A 3OYAA 4M3WA 5DK5A 3QDKA 3H3OB 3SUPA 3CCLN 3HYFA 3NH0A 2VWJA 3DOLA 4OGCA 2H3GX 3F73A 1S1VA 2AP1A 4CZKA 4PKHA 3FZHA 5BRDA 2Q36A 1HQEA 3FZMA 4BWJA 1BI4B 4C23A 2QWPA 2FC0A 3OYKA 4IKFA 3VGLA 4DQ8A 1TYQB 1NK8A 4QOZB 1VQLN 3IDHA 4N76A 3PV8A 2HHWA 5BREA 3P5JA 4AILC 3HOTA 3K59A 1DGKN 1BHLA 2KLAA 4BRHA 3L4IA 2ZM6K 5AQYA 5B8HA 2O4GA 2QXLA 3E66A 1EO1A 1WB9A 2VGMA 1UOCA 4ELTA 3V81A 2O8DA 1JL1A 4M42A 4ISFA 3HOSA 4GV9A 3KJVA 2ASMA 4CGFA 3IMXA 1RDUA 1DT9A 3O4WA 5HOOA 4DF8A 3CMAN 4GMJB 4CE9A 3M8QA 1VSHA 4JKGB 5JVHL 2PBDA 3EEQA 1W2BM 5DM7L 1S1TA 2FXUA 3K9JA 4BR2A 2D0BA 3IFRA 3ZEUB 2RN2A 4Y1CA 4HUEA 1V4TA 1S1UA 3PX0A 5MLCQ 3O6WA 4FK2A 3LDOA 3TPQA 4IO9L 1ZBIA 3O5BA 3AO5A 4FVMA 1N33K 3QEPA 1ATRA 1P8ZA 4LF4K 3WQTA 3KLIA 3TU5A 3G10A 1KC8O 3FR0A 1HUXA 3C6UA 4BRKA 1C1BA 3VPZA 4GV6A 3O9QA 3PX4A 2A42A 4JHDB 3PUFA 1VQ7N 2F7TA 4FL9A 3QIPA 5AQZA 4BRFA 3GE1A 3HP6A 4O0IA 4YFUA 5AFUA 1D5AA 4MLEA 1U47A 4N5SA 4M3YA 4BRMA 4DTNA
chains in the Genus database with same CATH topology
3I0SA 3OYCA 1VSJA 4DSJA 2ZD1A 5HRRA 4TSXA 3SPZA 1U45A 4KTQA 1S6QA 3NHGA 3VQBA 3ZT1A 4CJSA 3M8SA 4KKOA 4G1QA 4CEQA 1X9MA 4CFCA 2PYLA 4IG3A 1N5YA 3L2RA 2X74A 4FJGA 3NFAA 3VQQA 1RCHA 2XY5A 1T8EA 1IH7A 3NF6A 2QXFA 5CYQA 4BACA 1CXUA 4CIFA 2GV9A 4KHYA 1X9SA 4FJLA 3RMBA 1UA1A 3S9HA 2Z1JA 1KTQA 4PY5A 3ZSVA 3KLGA 3FFIA 2WONA 3VQEA 1KFDA 4ICLA 2YHAA 1JXBA 2NUBA 3OJUA 3PY8A 5J2PA 2KFZA 1U48A 4DU1A 1JKHA 1HYSA 4DU4A 4E7LA 4E7IA 3DRSA 4OKEA 4O44A 3SV3A 4Z0UA 2RPIA 3LPUA 1L3SA 4LSNA 1DTQA 4MQ3A 4HVJA 4B9LA 4FJ8A 3O4QA 2HVIA 2IDOA 4DWIA 3QEWA 4DS4A 4CEEA 1DLOA 1TKTA 3JSMA 3V9WA 4E7KA 3AA5X 2LSNA 4CHPA 2RKIA 4FJ5A 4QCLA 3K5OA 1RT6A 4FLVA 1SKRA 1HYVA 4KHQA 2OZMA 3MXJA 3O3FA 1ZBHA 4JRQA 4Q0BA 4CF9A 4F2RA 1C1AA 4B08A 5HP1A 3AVBA 1HNVA 4R5PA 4K8ZA 2FBXA 3LAKA 3LDSA 3RR8A 3WNHA 4DQPA 4ID1A 1J5OA 3KK2A 2KZZA 1C0TA 2XHBA 4BE1A 3VQ7A 1Q9XA 2Y1JA 1JLQA 4E0DA 3QEVA 4DTSA 1RDBA 3TAFA 3OS2A 4K8XA 3AVCA 3I0RA 3NBPA 3SQ0A 1Q9YA 2D0CA 5CYMA 1L3VA 4DSKA 1C1CA 2YKMA 3KK1A 3TAQA 3VQ6A 3AA4A 5SZTA 3O3HA 4CJKA 4L8RB 4OKJA 4CJWA 2KTQA 2KFNA 1HNIA 1S1XA 2VG7A 1EX4A 3QINA 1LW0A 1TKZA 3ZT4A 4W5OA 3U6FA 3HPHA 2W42A 2HMIA 1A5VA 1FKOA 4B9TA 2OPPA 1CZBA 3OS1A 5D3GA 1RTDA 2HW3A 5CZ2A 4AHRA 1BL3A 3DM2A 1TK8A 4E19A 4HHTA 3QLHA 4JLHA 4CHYA 3ULDA 4C8LA 5HLFA 4KREA 4DU3A 1SKSA 2ATQA 4FJHA 1NKBA 4WE1A 4I7FA 3TABA 2QKKA 3RMAA 4KB0A 1ZBUA 3KTQA 1SV5A 1F21A 3TAMA 1KCFA 3JYTA 1IO2A 2Z1GA 1WLJA 2RF2A 3IS9A 3L2WA 4FLUA 3AVIA 5KGWA 5KRSA 3EY1A 5KTQA 4DFJA 4FXDA 3DMJA 1XHXA 4N56A 4J2EA 4GVMA 3HPGA 2IAJA 4NCGA 4FJJA 5FDLA 1Z26A 1RDDA 2HVHA 1RT1A 1B92A 3L2UA 4AHUA 4KHSA 4CJTA 1Z25A 4C8OA 3BGRA 3DOKA 4N41A 4LH4A 2P51A 3QNNA 4FW1A 3OJSA 3SPYA 2AJQA 4OPKA 1SKWA 1ZYQA 3D45A 1KLMA 1WNSA 3L3UA 3S3MA 3LALA 4KRFA 4IFYA 1T03A 3QESA 1DTTA 3DLHA 4M3XA 3M8PA 4BDZA 3SYZA 2JGUA 1D9FA 5J2NA 3NCIA 1IKVA 1JLGA 1LWCA 3AVMA 3L2QA 1QTMA 1W9HA 3DYAA 2ZE2A 2P5OA 3D0PA 1MU2A 4ZTFA 1WSJA 3V1OA 5FRNA 4JS5A 4EZ6A 3V9XA 4AHCA 2E4LA 3ZT2A 4FK0A 1EP4A 4CFBA 2YNIA 4OPJA 1RTIA 4DMNA 4ELUA 3AV9A 3KKSA 3NF8A 3VQ8A 5E41A 3V1RA 3PX6A 4O5BA 3QNOA 1U49A 2FBTA 1RTHA 3QO9A 2HNDA 1J54A 2G8KA 2G8VA 4DTRA 4F4KA 1JLCA 1WSIA 4FZXC 3OYFA 4B8AB 1RT5A 3CFPA 4KI4A 4CF8A 3TAGA 2BDPA 3P1GA 3ITHA 3AO1A 1S6PA 5J2QA 1NJZA 1EXQA 2Q3SA 1SL2A 4KO0A 1GOAA 3NE6A 1G15A 4DG1A 4E1NA 4DQSA 1UWBA 2I5JA 2XRIA 3MEEA 2OYQA 5CZ1A 3WNGA 3SNNA 3HM9A 4JRPA 1SUQA 4FJ7A 4Z4EA 4HUFA 4KFBA 2HNZA 4I2PA 3KLEA 4DTJA 1RBUA 1NK0A 3S3OA 1NJWA 4KTWA 3AO4A 3VQAA 3KKRA 1TK5A 2QK9A 4DLEA 1JXEA 1EKEA 3OYBA 4M3YA 4Z4IA 2DFFA 2VG5A 3AVAA 4CHOA 4M3TA 4C8NA 3V9ZA 4CF2A 4LY7A 4CJEA 1HYZA 3OYDA 1D8YA 4HCCA 3T3FA 4ZTJA 3MXIA 2IC3A 1VRUA 4CK2A 2Z1IA 3SCXA 4CJQA 1QSSA 4HCBA 1KSPA 3M8RA 3OYLA 1KFSA 4CHNA 1NKCA 2VG6A 3ALYA 3CFRA 2X6SA 1BCMA 4PWDA 2X6NA 3NGZA 2IGIA 2YNHA 4FW2A 1CXQA 4IBNA 2HHXA 3SQ1A 1TAUA 1NOZA 3HXMA 3K5MA 4FYDA 1WAJA 1HRHA 1QQCA 3NGYA 4KAZA 4AH9A 3LANA 2Z1HA 4CGJA 4CJPA 4KHUA 4Z4HA 2FBVA 4CCHA 1A5WA 3NH2A 4RG8A 4M3UA 3F9KA 4M3ZA 1B9FA 3ISNC 4CJ5A 3UIQA 5J2MA 4FJIA 3A2FA 3SUQA 3IRXA 3AA2A 4IDKA 3MEDA 3NDKA 3PO4A 2YKNA 4CGDA 4H4OA 1EETA 1L3TA 1HMVA 2WOMA 2HNYA 3L2VA 3OY9A 1C0MA 1U04A 1HPZA 3CFOA 1JLAA 3OYHA 1RT4A 1XWLA 3T19A 4OKKA 3TWHA 5I42A 2Y1IA 2YNGA 1VSFA 4F2SA 5KRTA 1GOCA 4PQUA 1RNHA 3QIOA 4FLZA 1FKPA 5HRPA 4DLGA 1SL1A 3HP9A 2F8SA 2YNFA 2BGGA 2ZQBA 4CESA 1JLFA 4EP5A 4BWMA 4OGEA 1I3AA 3HL8A 3AO2A 5I3UA 1S5JA 3DRRA 1L5UA 1TKDA 4BDPA 4FJ9A 2F8TA 2GUIA 1VK0A 3C95A 3P83D 4OJRA 4I9LA 2P1JA 1TVRA 3AVFA 4O4GA 4DF4A 1B9DA 3ZSQA 4F3OA 1BIUA 3TAPA 1QSLA 3G0ZA 1FXXA 4FLXA 2XY7A 4C8KA 1IKYA 4CHQA 4DSLA 1CLQA 1W0HA 1WAFA 1RTJA 4MFBA 1YTUA 1X1PA 4CEAA 1JLEA 3K58A 3VQ9A 4DTOA 4DTPA 3AVJA 3CYMA 3DI6A 1J53A 1KVBA 4AHSA 2G8FA 1RBVA 4AHVA 4W5QA 3RTVA 3TARA 4GW6A 1FK9A 3ZT0A 3ZCMA 3QEXA 4M41A 4CECA 3RMDA 2QKBA 2O4IA 4YNQA 2E6LA 4NYNA 3MECA 1SL0A 4CEOA 4DSFA 2OZSA 1RT3A 1TV6A 3OYNA 1RT2A 4J2BA 4CK1A 3DLEA 1RBTA 4J2AA 4HUGA 3TI0A 2DFHA 2P5GA 4RW8A 3B6PA 1A5XA 4CJLA 1QSYA 1NJXA 4Z4GA 3CQ8A 3U3YA 4FCYA 3B6OA 1VSMA 3NH1A 1S1WA 2B5JA 1QHTA 4Z4CA 1HQUA 4OLAA 1K6YA 3MAQA 4B9NA 4XIUA 1HJRA 3LZJA 3AO3A 3K2PA 4CGGA 4KB1A 3THVA 4KPYA 4CGHA 5CY4A 1LW2A 3PO5A 3AA3A 4M45A 2IOCA 2ETJA 1JL2A 3DRPA 4RW7A 4CGIA 1WSGA 3LP3A 1TK0A 3OYEA 3SUNA 4ZHRA 4KHNA 3LAMA 2DY4A 4UQGA 4FLTA 3V9UA 4DQQA 1TGOA 3VN5A 3E01A 4CEDA 3VQPA 2G8HA 4EZ9A 3QERA 2HB5A 4DTUA 3RMCA 3MXMA 3VQCA 3IG1A 3VQDA 3OS0A 1UA0A 4CHZA 3V9SA 3AVHA 3I8DA 3DLBA 3ZSOA 3OYMA 4DSEA 3HK2A 3AVNA 1S9GA 4CK3A 4B9UA 3VQ4A 4O0JA 2OPSA 4Y1DA 4AHTA 4E1MA 4CJRA 3LP1A 4ID5A 1VSIA 4LH5A 3C6TA 3ZSXA 1ZBLA 4FM1A 2FBYA 1QE1A 4E89A 3T1AA 3WNEA 1YTAA 1D9DA 4CERA 4ELVA 3V6DA 1NK9A 1TAQA 4IG0A 3LWLA 3QETA 4FJKA 3MEGA 2B6AA 1R0AA 4CFDA 2BE2A 2OPQA 3LWMA 4HTUA 1IG9A 4KV8A 1BCOA 1RT7A 4OLBA 5KI6A 4JS4A 5T7BA 2KW4A 4B8CA 3SQ2A 4FZZA 1O1WA 1NOYA 4DQIA 4FJMA 1VSEA 4CJVA 4FZYA 4LSLA 3DLKA 4B9SA 1ITGA 2PZSA 3SQ4A 2F96A 3AVGA 1LWEA 4M3RA 3VQ5A 4DFKA 2E6MA 4I9QA 4RW9A 3RWUA 4NCBA 1VSKA 3DLGA 1RDCA 1YT3A 3U3GA 3HO1A 2BANA 3V4IA 5FROA 1WSHA 4RW6A 3O3GA 2PYJA 2EX3A 2HHVA 2GBZA 4OVLA 3K5LA 1WSEA 4KHWA 3OYJA 3TANA 3SI6A 3SZ2A 1Q8IA 3KD1E 1NK5A 4F3TA 1L3UA 1BISA 2JLEA 3CM6A 2HHQA 2R7YA 4E3SA 3CM5A 1KVAA 1BQNA 3ASMA 1TL3A 3TR8A 3HPOA 4RW4A 1RDAA 3OYAA 1XC9A 4M3WA 5DK5A 4IFVA 4NYFA 4KTZA 3VA0A 3CG7A 3SUPA 3HYFA 1U4BA 3NGIA 3NH0A 2VWJA 3DOLA 4DSIA 4W5NA 2D0AA 4OGCA 5J1EA 1S1VA 3F73A 3C94A 2XY6A 3EZ5A 1XHZA 1NJYA 2G8UA 4B9VA 3TAEA 4FJNA 4B9MA 1HQEA 4BWJA 3KK3A 1NK6A 4FJXA 4H8KA 2DTUA 1BI4B 4W5TA 3HT3A 2FC0A 2KZMA 1QS4A 2D5RA 5HRNA 1C0UA 2ITGA 3OYKA 1KLNA 4IKFA 3QEIA 3NF9A 5C24A 1NK8A 4CIEA 4QOZB 5C42A 4FM2A 3OYIA 4J2DA 1KVCA 1XI1A 4N76A 5JS2A 1C6VA 1WSFA 3KLHA 3KD5E 1REVA 4DS5A 2YV0X 4CJUA 3PV8A 1NKEA 2HHWA 1Y97A 3LPTA 3P5JA 4N47A 4AILC 4BE2A 4FM0A 3HJFA 3K59A 3OYGA 4CFAA 1BHLA 4BE0A 3LP0A 3RRGA 1IKXA 3BDPA 2O4GA 1TKXA 3KIOA 2KQ2A 3SV4A 3ZSWA 4FLYA 4CJFA 4Q5VA 1LV5A 1UOCA 5K14A 3SUOA 4C8MA 3EYZA 1ZBFA 2A1RA 4ELTA 3V81A 3LP2A 3NAEA 2B4JA 1JL1A 4M42A 3HSTB 3WNFA 4BDYA 4CIGA 5HRSA 3L3VA 4DFMA 1VRTA 4FLWA 3KJVA 3V1QA 3O4NA 4CGFA 2OA8A 3RRHA 2DFEA 4Z4FA 1YVUA 1RBRA 3KLFA 3VA3A 5FRMA 4DF8A 2HHSA 3AVLA 1VSDA 3OVNA 4GMJB 4CE9A 3M8QA 1WN7A 2X78A 1J9AA 4QAGA 2HHUA 1UAXA 1VSHA 2G8IA 3H08A 4KI6A 4LD0A 1S1TA 1T05A 1T7PA 4DTXA 2XY8A 3NF7A 2D0BA 5C25A 4NCAA 2RN2A 4Y1CA 4DTMA 1GOBA 4HUEA 4W5RA 3ZT3A 1S1UA 1BI4A 3PX0A 4PUOA 4CJ3A 3HVRA 5SWMA 4FK2A 1IKWA 3RR7A 5DMRA 1VSLA 4CJ4A 2YHBA 1KRPA 5HBMA 1CZ9A 2XO7A 3ZSZA 2PY5A 5JS1A 1ZBIA 4O55A 1N6QA 3AO5A 2OPRA 4FVMA 5EU7A 1ASUA 3QEPA 2EHGA 4CEFA 4E7JA 2IS3A 1RBSA 5KGXA 1X9WA 3AVKA 1BQMA 5HROA 2G8WA 3L8BA 1LAWA 3DLRA 4CF1A 3KLIA 3IAYA 1S9EA 3G10A 4PA1A 3ZSRA 3K57A 4DQRA 1JLBA 3SJJA 4B3OA 3C6UA 1RILA 3HVTA 3S3NA 1C1BA 3PX4A 4CF0A 4EP4A 1NK4A 1ASVA 3LZIA 3PUFA 4FK4A 3ZSYA 3K5NA 2A1SA 4E7HA 3QIPA 1LAVA 4F8RA 3HP6A 1ASWA 1LWFA 4I2QA 4O0IA 2HHTA 4YFUA 1BGXT 4H4MA 1D5AA 4DFPA 1U47A 1NK7A 1TL1A 1BIZA 4CEZA 4N5SA 2VWKA 1I39A 4CEBA 4DTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0S A;  3OYC A;  1VSJ A;  4DSJ A;  2ZD1 A;  5HRR A;  4TSX A;  3SPZ A;  1U45 A;  4KTQ A;  1S6Q A;  3NHG A;  3VQB A;  3ZT1 A;  4CJS A;  3M8S A;  4KKO A;  4G1Q A;  4CEQ A;  1X9M A;  4CFC A;  2PYL A;  4IG3 A;  1N5Y A;  3L2R A;  2X74 A;  4FJG A;  3NFA A;  3VQQ A;  1RCH A;  2XY5 A;  1T8E A;  1IH7 A;  3NF6 A;  2QXF A;  5CYQ A;  4BAC A;  1CXU A;  4CIF A;  2GV9 A;  4KHY A;  1X9S A;  4FJL A;  3RMB A;  1UA1 A;  3S9H A;  2Z1J A;  1KTQ A;  4PY5 A;  3ZSV A;  3KLG A;  3FFI A;  2WON A;  3VQE A;  1KFD A;  4ICL A;  2YHA A;  1JXB A;  2NUB A;  3OJU A;  3PY8 A;  5J2P A;  2KFZ A;  1U48 A;  4DU1 A;  1JKH A;  1HYS A;  4DU4 A;  4E7L A;  4E7I A;  3DRS A;  4OKE A;  4O44 A;  3SV3 A;  4Z0U A;  2RPI A;  3LPU A;  1L3S A;  4LSN A;  1DTQ A;  4MQ3 A;  4HVJ A;  4B9L A;  4FJ8 A;  3O4Q A;  2HVI A;  2IDO A;  4DWI A;  3QEW A;  4DS4 A;  4CEE A;  1DLO A;  1TKT A;  3JSM A;  3V9W A;  4E7K A;  3AA5 X;  2LSN A;  4CHP A;  2RKI A;  4FJ5 A;  4QCL A;  3K5O A;  1RT6 A;  4FLV A;  1SKR A;  1HYV A;  4KHQ A;  2OZM A;  3MXJ A;  3O3F A;  1ZBH A;  4JRQ A;  4Q0B A;  4CF9 A;  4F2R A;  1C1A A;  4B08 A;  5HP1 A;  3AVB A;  1HNV A;  4R5P A;  4K8Z A;  2FBX A;  3LAK A;  3LDS A;  3RR8 A;  3WNH A;  4DQP A;  4ID1 A;  1J5O A;  3KK2 A;  2KZZ A;  1C0T A;  2XHB A;  4BE1 A;  3VQ7 A;  1Q9X A;  2Y1J A;  1JLQ A;  4E0D A;  3QEV A;  4DTS A;  1RDB A;  3TAF A;  3OS2 A;  4K8X A;  3AVC A;  3I0R A;  3NBP A;  3SQ0 A;  1Q9Y A;  2D0C A;  5CYM A;  1L3V A;  4DSK A;  1C1C A;  2YKM A;  3KK1 A;  3TAQ A;  3VQ6 A;  3AA4 A;  5SZT A;  3O3H A;  4CJK A;  4L8R B;  4OKJ A;  4CJW A;  2KTQ A;  2KFN A;  1HNI A;  1S1X A;  2VG7 A;  1EX4 A;  3QIN A;  1LW0 A;  1TKZ A;  3ZT4 A;  4W5O A;  3U6F A;  3HPH A;  2W42 A;  2HMI A;  1A5V A;  1FKO A;  4B9T A;  2OPP A;  1CZB A;  3OS1 A;  5D3G A;  1RTD A;  2HW3 A;  5CZ2 A;  4AHR A;  1BL3 A;  3DM2 A;  1TK8 A;  4E19 A;  4HHT A;  3QLH A;  4JLH A;  4CHY A;  3ULD A;  4C8L A;  5HLF A;  4KRE A;  4DU3 A;  1SKS A;  2ATQ A;  4FJH A;  1NKB A;  4WE1 A;  4I7F A;  3TAB A;  2QKK A;  3RMA A;  4KB0 A;  1ZBU A;  3KTQ A;  1SV5 A;  1F21 A;  3TAM A;  1KCF A;  3JYT A;  1IO2 A;  2Z1G A;  1WLJ A;  2RF2 A;  3IS9 A;  3L2W A;  4FLU A;  3AVI A;  5KGW A;  5KRS A;  3EY1 A;  5KTQ A;  4DFJ A;  4FXD A;  3DMJ A;  1XHX A;  4N56 A;  4J2E A;  4GVM A;  3HPG A;  2IAJ A;  4NCG A;  4FJJ A;  5FDL A;  1Z26 A;  1RDD A;  2HVH A;  1RT1 A;  1B92 A;  3L2U A;  4AHU A;  4KHS A;  4CJT A;  1Z25 A;  4C8O A;  3BGR A;  3DOK A;  4N41 A;  4LH4 A;  2P51 A;  3QNN A;  4FW1 A;  3OJS A;  3SPY A;  2AJQ A;  4OPK A;  1SKW A;  1ZYQ A;  3D45 A;  1KLM A;  1WNS A;  3L3U A;  3S3M A;  3LAL A;  4KRF A;  4IFY A;  1T03 A;  3QES A;  1DTT A;  3DLH A;  4M3X A;  3M8P A;  4BDZ A;  3SYZ A;  2JGU A;  1D9F A;  5J2N A;  3NCI A;  1IKV A;  1JLG A;  1LWC A;  3AVM A;  3L2Q A;  1QTM A;  1W9H A;  3DYA A;  2ZE2 A;  2P5O A;  3D0P A;  1MU2 A;  4ZTF A;  1WSJ A;  3V1O A;  5FRN A;  4JS5 A;  4EZ6 A;  3V9X A;  4AHC A;  2E4L A;  3ZT2 A;  4FK0 A;  1EP4 A;  4CFB A;  2YNI A;  4OPJ A;  1RTI A;  4DMN A;  4ELU A;  3AV9 A;  3KKS A;  3NF8 A;  3VQ8 A;  5E41 A;  3V1R A;  3PX6 A;  4O5B A;  3QNO A;  1U49 A;  2FBT A;  1RTH A;  3QO9 A;  2HND A;  1J54 A;  2G8K A;  2G8V A;  4DTR A;  4F4K A;  1JLC A;  1WSI A;  4FZX C;  3OYF A;  4B8A B;  1RT5 A;  3CFP A;  4KI4 A;  4CF8 A;  3TAG A;  2BDP A;  3P1G A;  3ITH A;  3AO1 A;  1S6P A;  5J2Q A;  1NJZ A;  1EXQ A;  2Q3S A;  1SL2 A;  4KO0 A;  1GOA A;  3NE6 A;  1G15 A;  4DG1 A;  4E1N A;  4DQS A;  1UWB A;  2I5J A;  2XRI A;  3MEE A;  2OYQ A;  5CZ1 A;  3WNG A;  3SNN A;  3HM9 A;  4JRP A;  1SUQ A;  4FJ7 A;  4Z4E A;  4HUF A;  4KFB A;  2HNZ A;  4I2P A;  3KLE A;  4DTJ A;  1RBU A;  1NK0 A;  3S3O A;  1NJW A;  4KTW A;  3AO4 A;  3VQA A;  3KKR A;  1TK5 A;  2QK9 A;  4DLE A;  1JXE A;  1EKE A;  3OYB A;  4M3Y A;  4Z4I A;  2DFF A;  2VG5 A;  3AVA A;  4CHO A;  4M3T A;  4C8N A;  3V9Z A;  4CF2 A;  4LY7 A;  4CJE A;  1HYZ A;  3OYD A;  1D8Y A;  4HCC A;  3T3F A;  4ZTJ A;  3MXI A;  2IC3 A;  1VRU A;  4CK2 A;  2Z1I A;  3SCX A;  4CJQ A;  1QSS A;  4HCB A;  1KSP A;  3M8R A;  3OYL A;  1KFS A;  4CHN A;  1NKC A;  2VG6 A;  3ALY A;  3CFR A;  2X6S A;  1BCM A;  4PWD A;  2X6N A;  3NGZ A;  2IGI A;  2YNH A;  4FW2 A;  1CXQ A;  4IBN A;  2HHX A;  3SQ1 A;  1TAU A;  1NOZ A;  3HXM A;  3K5M A;  4FYD A;  1WAJ A;  1HRH A;  1QQC A;  3NGY A;  4KAZ A;  4AH9 A;  3LAN A;  2Z1H A;  4CGJ A;  4CJP A;  4KHU A;  4Z4H A;  2FBV A;  4CCH A;  1A5W A;  3NH2 A;  4RG8 A;  4M3U A;  3F9K A;  4M3Z A;  1B9F A;  3ISN C;  4CJ5 A;  3UIQ A;  5J2M A;  4FJI A;  3A2F A;  3SUQ A;  3IRX A;  3AA2 A;  4IDK A;  3MED A;  3NDK A;  3PO4 A;  2YKN A;  4CGD A;  4H4O A;  1EET A;  1L3T A;  1HMV A;  2WOM A;  2HNY A;  3L2V A;  3OY9 A;  1C0M A;  1U04 A;  1HPZ A;  3CFO A;  1JLA A;  3OYH A;  1RT4 A;  1XWL A;  3T19 A;  4OKK A;  3TWH A;  5I42 A;  2Y1I A;  2YNG A;  1VSF A;  4F2S A;  5KRT A;  1GOC A;  4PQU A;  1RNH A;  3QIO A;  4FLZ A;  1FKP A;  5HRP A;  4DLG A;  1SL1 A;  3HP9 A;  2F8S A;  2YNF A;  2BGG A;  2ZQB A;  4CES A;  1JLF A;  4EP5 A;  4BWM A;  4OGE A;  1I3A A;  3HL8 A;  3AO2 A;  5I3U A;  1S5J A;  3DRR A;  1L5U A;  1TKD A;  4BDP A;  4FJ9 A;  2F8T A;  2GUI A;  1VK0 A;  3C95 A;  3P83 D;  4OJR A;  4I9L A;  2P1J A;  1TVR A;  3AVF A;  4O4G A;  4DF4 A;  1B9D A;  3ZSQ A;  4F3O A;  1BIU A;  3TAP A;  1QSL A;  3G0Z A;  1FXX A;  4FLX A;  2XY7 A;  4C8K A;  1IKY A;  4CHQ A;  4DSL A;  1CLQ A;  1W0H A;  1WAF A;  1RTJ A;  4MFB A;  1YTU A;  1X1P A;  4CEA A;  1JLE A;  3K58 A;  3VQ9 A;  4DTO A;  4DTP A;  3AVJ A;  3CYM A;  3DI6 A;  1J53 A;  1KVB A;  4AHS A;  2G8F A;  1RBV A;  4AHV A;  4W5Q A;  3RTV A;  3TAR A;  4GW6 A;  1FK9 A;  3ZT0 A;  3ZCM A;  3QEX A;  4M41 A;  4CEC A;  3RMD A;  2QKB A;  2O4I A;  4YNQ A;  2E6L A;  4NYN A;  3MEC A;  1SL0 A;  4CEO A;  4DSF A;  2OZS A;  1RT3 A;  1TV6 A;  3OYN A;  1RT2 A;  4J2B A;  4CK1 A;  3DLE A;  1RBT A;  4J2A A;  4HUG A;  3TI0 A;  2DFH A;  2P5G A;  4RW8 A;  3B6P A;  1A5X A;  4CJL A;  1QSY A;  1NJX A;  4Z4G A;  3CQ8 A;  3U3Y A;  4FCY A;  3B6O A;  1VSM A;  3NH1 A;  1S1W A;  2B5J A;  1QHT A;  4Z4C A;  1HQU A;  4OLA A;  1K6Y A;  3MAQ A;  4B9N A;  4XIU A;  1HJR A;  3LZJ A;  3AO3 A;  3K2P A;  4CGG A;  4KB1 A;  3THV A;  4KPY A;  4CGH A;  5CY4 A;  1LW2 A;  3PO5 A;  3AA3 A;  4M45 A;  2IOC A;  2ETJ A;  1JL2 A;  3DRP A;  4RW7 A;  4CGI A;  1WSG A;  3LP3 A;  1TK0 A;  3OYE A;  3SUN A;  4ZHR A;  4KHN A;  3LAM A;  2DY4 A;  4UQG A;  4FLT A;  3V9U A;  4DQQ A;  1TGO A;  3VN5 A;  3E01 A;  4CED A;  3VQP A;  2G8H A;  4EZ9 A;  3QER A;  2HB5 A;  4DTU A;  3RMC A;  3MXM A;  3VQC A;  3IG1 A;  3VQD A;  3OS0 A;  1UA0 A;  4CHZ A;  3V9S A;  3AVH A;  3I8D A;  3DLB A;  3ZSO A;  3OYM A;  4DSE A;  3HK2 A;  3AVN A;  1S9G A;  4CK3 A;  4B9U A;  3VQ4 A;  4O0J A;  2OPS A;  4Y1D A;  4AHT A;  4E1M A;  4CJR A;  3LP1 A;  4ID5 A;  1VSI A;  4LH5 A;  3C6T A;  3ZSX A;  1ZBL A;  4FM1 A;  2FBY A;  1QE1 A;  4E89 A;  3T1A A;  3WNE A;  1YTA A;  1D9D A;  4CER A;  4ELV A;  3V6D A;  1NK9 A;  1TAQ A;  4IG0 A;  3LWL A;  3QET A;  4FJK A;  3MEG A;  2B6A A;  1R0A A;  4CFD A;  2BE2 A;  2OPQ A;  3LWM A;  4HTU A;  1IG9 A;  4KV8 A;  1BCO A;  1RT7 A;  4OLB A;  5KI6 A;  4JS4 A;  5T7B A;  2KW4 A;  4B8C A;  3SQ2 A;  4FZZ A;  1O1W A;  1NOY A;  4DQI A;  4FJM A;  1VSE A;  4CJV A;  4FZY A;  4LSL A;  3DLK A;  4B9S A;  1ITG A;  2PZS A;  3SQ4 A;  2F96 A;  3AVG A;  1LWE A;  4M3R A;  3VQ5 A;  4DFK A;  2E6M A;  4I9Q A;  4RW9 A;  3RWU A;  4NCB A;  1VSK A;  3DLG A;  1RDC A;  1YT3 A;  3U3G A;  3HO1 A;  2BAN A;  3V4I A;  5FRO A;  1WSH A;  4RW6 A;  3O3G A;  2PYJ A;  2EX3 A;  2HHV A;  2GBZ A;  4OVL A;  3K5L A;  1WSE A;  4KHW A;  3OYJ A;  3TAN A;  3SI6 A;  3SZ2 A;  1Q8I A;  3KD1 E;  1NK5 A;  4F3T A;  1L3U A;  1BIS A;  2JLE A;  3CM6 A;  2HHQ A;  2R7Y A;  4E3S A;  3CM5 A;  1KVA A;  1BQN A;  3ASM A;  1TL3 A;  3TR8 A;  3HPO A;  4RW4 A;  1RDA A;  3OYA A;  1XC9 A;  4M3W A;  5DK5 A;  4IFV A;  4NYF A;  4KTZ A;  3VA0 A;  3CG7 A;  3SUP A;  3HYF A;  1U4B A;  3NGI A;  3NH0 A;  2VWJ A;  3DOL A;  4DSI A;  4W5N A;  2D0A A;  4OGC A;  5J1E A;  1S1V A;  3F73 A;  3C94 A;  2XY6 A;  3EZ5 A;  1XHZ A;  1NJY A;  2G8U A;  4B9V A;  3TAE A;  4FJN A;  4B9M A;  1HQE A;  4BWJ A;  3KK3 A;  1NK6 A;  4FJX A;  4H8K A;  2DTU A;  1BI4 B;  4W5T A;  3HT3 A;  2FC0 A;  2KZM A;  1QS4 A;  2D5R A;  5HRN A;  1C0U A;  2ITG A;  3OYK A;  1KLN A;  4IKF A;  3QEI A;  3NF9 A;  5C24 A;  1NK8 A;  4CIE A;  4QOZ B;  5C42 A;  4FM2 A;  3OYI A;  4J2D A;  1KVC A;  1XI1 A;  4N76 A;  5JS2 A;  1C6V A;  1WSF A;  3KLH A;  3KD5 E;  1REV A;  4DS5 A;  2YV0 X;  4CJU A;  3PV8 A;  1NKE A;  2HHW A;  1Y97 A;  3LPT A;  3P5J A;  4N47 A;  4AIL C;  4BE2 A;  4FM0 A;  3HJF A;  3K59 A;  3OYG A;  4CFA A;  1BHL A;  4BE0 A;  3LP0 A;  3RRG A;  1IKX A;  3BDP A;  2O4G A;  1TKX A;  3KIO A;  2KQ2 A;  3SV4 A;  3ZSW A;  4FLY A;  4CJF A;  4Q5V A;  1LV5 A;  1UOC A;  5K14 A;  3SUO A;  4C8M A;  3EYZ A;  1ZBF A;  2A1R A;  4ELT A;  3V81 A;  3LP2 A;  3NAE A;  2B4J A;  1JL1 A;  4M42 A;  3HST B;  3WNF A;  4BDY A;  4CIG A;  5HRS A;  3L3V A;  4DFM A;  1VRT A;  4FLW A;  3KJV A;  3V1Q A;  3O4N A;  4CGF A;  2OA8 A;  3RRH A;  2DFE A;  4Z4F A;  1YVU A;  1RBR A;  3KLF A;  3VA3 A;  5FRM A;  4DF8 A;  2HHS A;  3AVL A;  1VSD A;  3OVN A;  4GMJ B;  4CE9 A;  3M8Q A;  1WN7 A;  2X78 A;  1J9A A;  4QAG A;  2HHU A;  1UAX A;  1VSH A;  2G8I A;  3H08 A;  4KI6 A;  4LD0 A;  1S1T A;  1T05 A;  1T7P A;  4DTX A;  2XY8 A;  3NF7 A;  2D0B A;  5C25 A;  4NCA A;  2RN2 A;  4Y1C A;  4DTM A;  1GOB A;  4HUE A;  4W5R A;  3ZT3 A;  1S1U A;  1BI4 A;  3PX0 A;  4PUO A;  4CJ3 A;  3HVR A;  5SWM A;  4FK2 A;  1IKW A;  3RR7 A;  5DMR A;  1VSL A;  4CJ4 A;  2YHB A;  1KRP A;  5HBM A;  1CZ9 A;  2XO7 A;  3ZSZ A;  2PY5 A;  5JS1 A;  1ZBI A;  4O55 A;  1N6Q A;  3AO5 A;  2OPR A;  4FVM A;  5EU7 A;  1ASU A;  3QEP A;  2EHG A;  4CEF A;  4E7J A;  2IS3 A;  1RBS A;  5KGX A;  1X9W A;  3AVK A;  1BQM A;  5HRO A;  2G8W A;  3L8B A;  1LAW A;  3DLR A;  4CF1 A;  3KLI A;  3IAY A;  1S9E A;  3G10 A;  4PA1 A;  3ZSR A;  3K57 A;  4DQR A;  1JLB A;  3SJJ A;  4B3O A;  3C6U A;  1RIL A;  3HVT A;  3S3N A;  1C1B A;  3PX4 A;  4CF0 A;  4EP4 A;  1NK4 A;  1ASV A;  3LZI A;  3PUF A;  4FK4 A;  3ZSY A;  3K5N A;  2A1S A;  4E7H A;  3QIP A;  1LAV A;  4F8R A;  3HP6 A;  1ASW A;  1LWF A;  4I2Q A;  4O0I A;  2HHT A;  4YFU A;  1BGX T;  4H4M A;  1D5A A;  4DFP A;  1U47 A;  1NK7 A;  1TL1 A;  1BIZ A;  4CEZ A;  4N5S A;  2VWK A;  1I39 A;  4CEB A;  4DTN A; 
#chains in the Genus database with same CATH topology
 4A62 A;  3WXI A;  4JV5 K;  4KTQ A;  3ZT1 A;  4KKO A;  4G1Q A;  2QWR A;  4RCH A;  1X9M A;  2PYL A;  1U6Z A;  2X74 A;  1RGI A;  3NFA A;  4H5T A;  3WXJ A;  1CXU A;  5DM6 L;  2P9P A;  3WXL A;  3RMB A;  1UA1 A;  3EZW A;  4BRD A;  3FFI A;  3PY8 A;  1JXB A;  4WF9 L;  3DRS A;  1YJW N;  4B9L A;  4LSN A;  4HVJ A;  4FJ8 A;  3LDN A;  2P9S B;  1MA9 B;  3F2K A;  4DS4 A;  2UYT A;  3OA9 A;  2LSN A;  4QCL A;  1RT6 A;  3O3F A;  3RSE A;  1C1A A;  4B08 A;  4DR6 K;  1HNV A;  1SQK A;  1M90 O;  1C0T A;  2P9I B;  2FF6 A;  2Y1J A;  3OBY A;  3NBP A;  3ULE A;  5CYM A;  5FLX O;  4YOW A;  3CIP A;  5F0X A;  1Q18 A;  4H5R A;  1S1X A;  2D0O A;  1LW0 A;  3FLC O;  4F9O A;  3HPH A;  2W42 A;  1N34 K;  3J81 O;  1RTD A;  4AHR A;  3QLH A;  1NGI A;  4JLH A;  4XH5 A;  4CHY A;  4KRE A;  3DWL A;  1HNZ K;  2ATQ A;  3HZ6 A;  2QKK A;  4JI1 K;  1SV5 A;  1F21 A;  3TSU A;  1IO2 A;  2Z1G A;  4DFJ A;  1WBB A;  4A57 A;  3DMJ A;  4WQ5 C;  4J2E A;  3HPG A;  2UUC K;  1Z26 A;  3O8M A;  3L2U A;  1HKB A;  1Z25 A;  1M1K O;  2AJQ A;  4DKW A;  4FWN A;  5LMN K;  3MWP A;  1WNS A;  3SBG A;  3VER A;  4RTF D;  5J2N A;  3NCI A;  4OPH A;  2ZE2 A;  2P5O A;  1MU2 A;  4X64 K;  3N4P A;  5FRN A;  2OTL N;  4EZ6 A;  3T1H K;  4DMN A;  5LL6 Z;  3NF8 A;  2Q0R A;  4JI3 K;  1RT5 A;  3CFP A;  4KI4 A;  4CF8 A;  3MWT A;  3G6E N;  3P1G A;  3AO1 A;  1S6P A;  5E84 A;  2Q3S A;  2QM1 A;  4K25 A;  4KO0 A;  3CJC A;  4E1N A;  2YHX A;  5GIN A;  4CZH A;  2I5J A;  2HBJ A;  4BRP A;  1U2V A;  4NXM K;  2QTD A;  4PL8 A;  4A59 A;  3SNN A;  4FJ7 A;  4Z4E A;  4BVO A;  4DTJ A;  5AQU A;  2UXB K;  3AO4 A;  1C0F A;  2QK9 A;  1EKE A;  4Z4I A;  2IVP A;  4JKG A;  4M3T A;  3V9Z A;  5AQQ A;  3TTD A;  1HYZ A;  3CCE N;  3ZEU A;  2IC3 A;  1S22 A;  1QSS A;  3K9K A;  3CPW M;  3J7A P;  3OYL A;  1KFS A;  1BU6 O;  3CFR A;  4BGB A;  1WOQ A;  4AQY K;  2X6N A;  4FW2 A;  5CE3 A;  1CXQ A;  1TAU A;  3C65 A;  1NOZ A;  1WAJ A;  3H1Q A;  4KH5 A;  1T3V A;  4KHP K;  3LAN A;  2HBM A;  4KHU A;  1A5W A;  4DV0 K;  2GEM A;  3F9K A;  5KPR A;  4M3Z A;  3A2F A;  5AQO A;  3IRX A;  4IDK A;  2V7Y A;  3LM9 A;  3PO4 A;  2YKN A;  4H4O A;  2BTF A;  2HNY A;  4PL7 A;  2D0P A;  4FO0 A;  2YNG A;  1OKJ A;  4JKF A;  5KRT A;  1X3M A;  4PQU A;  1NGF A;  3QIO A;  3ZX3 A;  4CZG A;  4CZE A;  1JLF A;  1L5U A;  1S5J A;  4FJ9 A;  2GUI A;  1VK0 A;  3C95 A;  4JKH A;  4CBW A;  2Q1N A;  3ZET B;  4I9L A;  3RVC A;  2P1J A;  1BIU A;  3TAP A;  3PIO L;  1CLQ A;  5JLF A;  1WAF A;  3ZX2 A;  4MFB A;  1X1P A;  4FWQ A;  4CEA A;  4DTO A;  4AHS A;  4W5Q A;  3RTV A;  1ESV A;  4GW6 A;  1FK9 A;  1IJJ A;  3ZT0 A;  3I8B A;  2VQE K;  3QEX A;  3BUZ B;  3RMD A;  1Z05 A;  4YNQ A;  1SL0 A;  2JWL A;  4CEO A;  3OYN A;  3O08 A;  4GVE A;  4HUG A;  2P9N A;  2DFH A;  4CJL A;  4Z4G A;  4FCY A;  1QHT A;  2P9I A;  3EE9 A;  3EO3 A;  4OLA A;  3AO3 A;  4CGG A;  2Q2R A;  2V52 B;  3THV A;  5CY4 A;  4YY3 K;  4KPY A;  4M45 A;  5AQF A;  4GKK K;  2D1K A;  4UQG A;  4FPA A;  4CED A;  3E01 A;  3VQP A;  3A0I X;  3QER A;  3MXM A;  4CHZ A;  3V9S A;  3AVH A;  3VOV A;  3HK2 A;  3AVN A;  4CK3 A;  4B9U A;  4AHT A;  2FF3 B;  3ZSX A;  1BWF O;  4E89 A;  3T1A A;  3WNE A;  4CER A;  5ADX H;  3V6D A;  1P90 A;  1TAQ A;  3M6G A;  1R0A A;  4JYA K;  4CFD A;  1IG9 A;  2CGK A;  3LWM A;  1BCO A;  1RT7 A;  2YHY A;  1NLV A;  4OLB A;  5KI6 A;  2GTD A;  3CET A;  4AF1 A;  2KW4 A;  3SQ2 A;  3GL1 A;  4NB4 A;  4DQI A;  3PIP L;  4EIA A;  4X62 K;  3KVG A;  3DLK A;  1ITG A;  2OAN A;  2PZS A;  2F96 A;  1LWE A;  3HBT A;  2ZJQ L;  4IEE A;  4QS7 A;  1RDC A;  3V4I A;  1JJ2 M;  5FRO A;  3MN6 A;  4H5W A;  2P9K B;  1QHA A;  2PYJ A;  2EX3 A;  2GBZ A;  2O8D B;  3SZ2 A;  4F3T A;  3JXU A;  4H0O A;  2R7Y A;  1KVA A;  1RDA A;  3VA0 A;  4DHY A;  3CD6 N;  2D0A A;  4F2R A;  5J1E A;  2G8U A;  2NRH A;  3TAE A;  2UU9 K;  4MDB A;  2ITM A;  4FWO A;  4H8K A;  2OTJ N;  4B1X B;  3HT3 A;  1JCE A;  3CER A;  2D5R A;  5HRN A;  1C0U A;  3QEI A;  1IV0 A;  5C24 A;  3OYI A;  4J2D A;  1WSF A;  3VEV A;  3KD5 E;  1REV A;  4FM0 A;  3VEX A;  4BE0 A;  5LJW A;  1T6D A;  2QW9 A;  3HRG A;  2E2O A;  3KIO A;  2KQ2 A;  2NRZ A;  2GX9 A;  4CJF A;  1LV5 A;  3MN7 A;  3SUO A;  4H03 B;  3UKR B;  3NAE A;  2B4J A;  3H6E A;  4BDY A;  2Q0U A;  1K8K B;  3VEN A;  1RDW X;  3CC4 N;  3B8A X;  3O4N A;  2GUP A;  2YX6 A;  5E26 A;  1HKC A;  3QBW A;  1YVU A;  3VA3 A;  5FRM A;  3CCV N;  1NMN A;  3AVL A;  4LF9 K;  4JAX A;  3D2F B;  4DUZ K;  3CI5 A;  3VES A;  4LC9 B;  4HWI A;  4CD3 A;  1YJN N;  2G8I A;  1IG8 A;  3A5O C;  3MN5 A;  4DV4 K;  2IVO A;  4Z94 A;  1T7P A;  4DTX A;  2XY8 A;  3NF7 A;  5C25 A;  2WTU A;  4NCA A;  2HOE A;  2D4W A;  4IOX A;  3VF6 A;  1GOB A;  4DTM A;  4W5R A;  4IO8 A;  4WQ4 C;  1IKW A;  1YHQ N;  4CJ4 A;  4NLB A;  1KRP A;  2XO7 A;  5JS1 A;  2E1Y A;  2HHH K;  4O55 A;  2EHG A;  3ZET A;  4CEF A;  2IS3 A;  1RBS A;  5KGX A;  2QI2 A;  3DLR A;  4CF1 A;  4PA1 A;  3K57 A;  3SJJ A;  4B3O A;  3HVT A;  4RWT A;  3S3N A;  4BRI A;  4JKC A;  4EP4 A;  1NK4 A;  1ASV A;  2O8C B;  3VGM A;  2E2P A;  3K5N A;  4F8R A;  4ILJ A;  1NGE A;  3ENO A;  1BGX T;  4BQL A;  5JIC A;  1NK7 A;  1QZ6 A;  1BIZ A;  4CEZ A;  3CC7 N;  3VET A;  4DV2 K;  3OYC A;  3SPZ A;  4EAH D;  3O1W A;  3VQB A;  4CJS A;  3M8S A;  1YXQ A;  3EE8 A;  5HL7 L;  4LF7 K;  4CFC A;  4IG3 A;  1N5Y A;  5EX5 A;  3L2R A;  4WFB L;  4JD2 A;  3VQQ A;  1IH7 A;  4LFC K;  5AZI B;  4CIF A;  2EWS A;  1X9S A;  4B1V A;  4BRE A;  4PY5 A;  3ZSV A;  4JKE A;  5KQD A;  4DV7 K;  1YIJ N;  2WON A;  3VQE A;  5AFU H;  1ATS A;  2YHA A;  2NUB A;  1K73 O;  1BA0 A;  3A5L C;  3EN9 A;  4DU4 A;  4YOV A;  3SV3 A;  3CJB A;  3WXK A;  4DWI A;  4PHT X;  1Z6R A;  3D7E O;  4E7K A;  5AQH A;  1ZXO A;  4FLV A;  2OZM A;  3MXJ A;  2YI1 A;  3CHW A;  3T69 A;  4K0K K;  3AVB A;  2FBX A;  3LAK A;  3RR8 A;  4DR4 K;  3KK2 A;  2KZZ A;  4BVP A;  4CZF A;  5BR9 A;  1RDB A;  4K8X A;  3AVC A;  3ENH A;  3ID8 A;  2D0C A;  2YKM A;  3VEW A;  3KK1 A;  3AA4 A;  5FPM A;  5SZT A;  4I6M A;  2KTQ A;  1HNI A;  2VG7 A;  1EX4 A;  4BR9 A;  3QIN A;  3M1F A;  3AY9 A;  3U6F A;  1A5V A;  1FKO A;  4B9T A;  1VQM N;  4DV5 K;  5CZ2 A;  2A40 A;  2P9K A;  3DM2 A;  3W0L A;  4CZJ A;  1TK8 A;  3W3D A;  2P9U A;  4DU3 A;  2E20 A;  4FJH A;  4B1U B;  1NKB A;  4I7F A;  1U2V B;  1KAZ A;  2PFU A;  3TAM A;  1KCF A;  4CZM A;  3JYT A;  1WLJ A;  5KRS A;  4FWP A;  3EY1 A;  4FXD A;  4DR7 K;  4BC4 A;  4J8F A;  5FDL A;  1RDD A;  3I33 A;  1NM1 A;  4AHU A;  4NXN K;  3AGK A;  4O8K A;  4LH4 A;  2P51 A;  3QNN A;  4FW1 A;  2ZGZ A;  4IFY A;  3DLH A;  4BDZ A;  4H0T B;  3SYZ A;  2JGU A;  1LWC A;  3L2Q A;  1V4S A;  1EWQ A;  3DYA A;  4M7X A;  4IJA A;  3D0P A;  4KH6 A;  1Q7Y O;  4ZTF A;  1RFQ A;  1WSJ A;  3V1O A;  1HLU A;  4FK0 A;  1EP4 A;  4B1Z A;  4E1J A;  5C10 A;  1VQ5 N;  3PX6 A;  4LFA K;  3IKM A;  4A61 A;  4BRO A;  3QNO A;  1RTH A;  3QO9 A;  1J54 A;  1ATN A;  4FZX C;  5AQW A;  4YDU C;  4YOT A;  4B8A B;  1VQ9 N;  3TAG A;  2BDP A;  3UKR A;  1SL2 A;  1EXQ A;  4IWV A;  1UWB A;  1K8K A;  2XRI A;  4GY2 B;  5CZ1 A;  4K43 A;  3HM9 A;  4JRP A;  4KFB A;  1NK0 A;  1RBU A;  3MCP A;  4KTW A;  3D2F A;  3CJ9 A;  3OYB A;  5ELZ A;  2DFF A;  4CHO A;  4C8N A;  3FGU A;  3VMF B;  3O9S A;  1D8Y A;  3C7N B;  3SCX A;  4CK2 A;  4HCB A;  5M1O A;  1KSP A;  1K9M O;  3ALY A;  1NWK A;  4PWD A;  3NGZ A;  4CVN E;  5FPN A;  3U8X A;  4AM7 A;  5C12 A;  3THX A;  5AQK A;  1HRH A;  3NGY A;  4JKB A;  4KAZ A;  4AH9 A;  2P9N B;  4CGJ A;  3QBX A;  5AJ3 K;  1XC3 A;  2FBV A;  3C6A A;  1B9F A;  5GAD P;  3UIQ A;  2O8C A;  5J2M A;  3SUQ A;  1OVY A;  3AA2 A;  3NDK A;  4CGD A;  2WOM A;  3L0Q A;  3OY9 A;  3CFO A;  3OYH A;  1GLB G;  4A2A A;  1VSF A;  4FLZ A;  2ASP A;  2WC9 A;  2F8S A;  2ZQB A;  4CES A;  4EP5 A;  5I3U A;  4BWM A;  3CQY A;  4BDP A;  4H5N A;  1DKG D;  1WBD A;  3O9T A;  5AZI A;  4XH1 A;  4JK7 A;  2A41 A;  2O8F B;  1B9D A;  1C0G A;  1QSL A;  3G25 A;  3TTF A;  3M5R A;  1FXX A;  4FLX A;  3MN9 A;  4DTP A;  3DJC A;  1KVB A;  2G8F A;  3TAR A;  3JS6 A;  3E9P A;  4M41 A;  4NLC A;  4CEC A;  2QKB A;  1WUA A;  2RHK A;  2O4I A;  4JI0 K;  1QVF M;  1O13 A;  2OZS A;  2ASO A;  1RT2 A;  5JLH A;  2NRV A;  3DLE A;  5AQX A;  1S3X A;  2P5G A;  4RW8 A;  1A5X A;  1QSY A;  5I9E B;  3U3Y A;  1VSM A;  3NH1 A;  3SMP A;  2V51 B;  4K41 A;  3MAQ A;  4XEI A;  2GWJ A;  4XIU A;  2VYP A;  3K2P A;  4CGH A;  1LW2 A;  5A2Q O;  3PO5 A;  3AA3 A;  2IOC A;  4RW7 A;  2WBN A;  1TK0 A;  3SUN A;  4KHN A;  3C0B A;  3LAM A;  3VN5 A;  3PLA A;  4IXC A;  4DTU A;  3RMC A;  3IG1 A;  4QS8 A;  5IWA K;  4UY8 O;  3THW A;  3CQX A;  3OYM A;  1VAZ A;  1XNR K;  4CJR A;  1SZ2 A;  4Y1D A;  3LDP A;  3LP1 A;  3MX2 A;  4ID5 A;  4JI2 K;  3AAR A;  4BC2 A;  2FBY A;  1QE1 A;  5JVG L;  1D9D A;  4ELV A;  4FJK A;  3QET A;  3LWL A;  3MEG A;  4ISE A;  3H3N O;  4X65 K;  2OPQ A;  5T7B A;  4B8C A;  3FZK A;  3OTO K;  4MLH A;  4FWM A;  4B3M K;  1T44 A;  4LSL A;  4U7B A;  3J80 O;  3VQ5 A;  3AVG A;  4M3R A;  2E5L K;  4DFK A;  1NNE A;  1VSK A;  3DLG A;  1YT3 A;  1FJG K;  3DLL L;  2BAN A;  1WSH A;  4OVL A;  1WSE A;  4KHW A;  3SJH A;  1KQS M;  1KXP A;  3CM6 A;  3CCJ N;  3CM5 A;  3HPO A;  1BQN A;  1U45 A;  1TL3 A;  4Z4F A;  4KH4 A;  4IFV A;  4NYF A;  3CG7 A;  4IEI A;  4W5N A;  2XY6 A;  1NJY A;  4B9V A;  3EZ5 A;  2QWQ A;  1TUU A;  4B9M A;  3KK3 A;  1NK6 A;  3C6H A;  2DTU A;  1ILY A;  4W5T A;  2E88 A;  1OVQ A;  5AQP A;  2ZWH A;  4CIE A;  5C42 A;  4FM2 A;  3L4Q A;  1KVC A;  5LJV A;  5JS2 A;  3KLH A;  2YV0 X;  4CJU A;  3LPT A;  5AQL A;  3HJF A;  4N47 A;  2YHW A;  3C7N A;  4LF6 K;  3LP0 A;  3RRG A;  3UB5 A;  3CF5 L;  3AAQ A;  3BY5 A;  2O8B B;  3SV4 A;  3ZSW A;  4FLY A;  4Q5V A;  4IOC L;  4C8M A;  1ZBF A;  3U9Z A;  4MO5 A;  3HST B;  3WNF A;  3EL2 A;  5BPM A;  3O9U A;  3L3V A;  3P38 A;  4DFM A;  1VRT A;  1NG9 A;  2HF3 A;  2YCH A;  5GAG P;  3RRH A;  2DFE A;  2HHS A;  3KLF A;  3LM2 A;  1J6Z A;  2HST A;  4H0V B;  1VSD A;  4JD2 B;  4DR5 K;  4WFA L;  3I56 N;  5F1X A;  1WN7 A;  2X78 A;  1NGH A;  3R1X A;  4JI4 K;  4Y0W A;  3H08 A;  4KI6 A;  3BZK A;  4FWK A;  3VEY A;  3DXM B;  2IVN A;  3ZT3 A;  4PUO A;  4CJ3 A;  1YF5 L;  5SWM A;  3HSC A;  1BG3 A;  5DMR A;  1VSL A;  4BRA A;  4K42 A;  5HBM A;  1CZ9 A;  3ZSZ A;  2UUB K;  1IBL K;  3THY B;  1GLL O;  3SMS A;  4E7J A;  2A5X A;  1X9W A;  2O8F A;  3AVK A;  1BQM A;  5HRO A;  3L8B A;  4BR7 A;  3ZSR A;  1GLJ O;  4DQR A;  1JLB A;  1RIL A;  3MX5 A;  3VF2 A;  2FSK A;  2QWO A;  1ZBS A;  4O8U A;  4CF0 A;  3LZI A;  3BZC A;  4FK4 A;  1MWK A;  2A1S A;  1LAV A;  3NMU A;  1ASW A;  1LWF A;  4M63 C;  2QWM A;  3N4Q A;  4DFP A;  2VWK A;  3CCM N;  4CEB A;  3TAB A;  4I6M B;  3I0S A;  1XQS C;  4DSJ A;  2ZD1 A;  5HRR A;  4BY9 C;  3NHG A;  2CGJ A;  2QWN A;  4B3T K;  3BEX A;  4FJG A;  2HF4 A;  3VTH A;  3U9D A;  4BAC A;  2QXF A;  3LDQ A;  2P9U B;  4FJL A;  2O8E B;  3S9H A;  2Z1J A;  2HBL A;  3KLG A;  2NRW A;  1KFD A;  3H46 O;  3J7Y P;  5J2P A;  2KFZ A;  1U48 A;  4DU1 A;  1JKH A;  1HYS A;  1SS6 A;  5IT9 O;  4OKE A;  4Z0U A;  1L3S A;  1DTQ A;  2OCE A;  4MQ3 A;  2IDO A;  3QEW A;  4CEE A;  1DLO A;  1NGG A;  3JSM A;  3V9W A;  1LOT B;  3AA5 X;  4FJ5 A;  1ZBH A;  4HTL A;  1GLF O;  5EXW A;  3O9R A;  5HP1 A;  3D6R A;  4R5P A;  1XNQ K;  3LDS A;  4DQP A;  1J5O A;  3CME N;  4XH4 A;  2XHB A;  3KK7 A;  3VQ7 A;  1Q9X A;  3J7Z O;  3QEV A;  3TAF A;  3JAM O;  3OS2 A;  3I0R A;  4GNI A;  4MO4 A;  1Q9Y A;  4DSK A;  1L3V A;  3TAQ A;  3O3H A;  4L8R B;  2W40 A;  1S72 N;  4OKJ A;  4CJW A;  2KFN A;  3G71 N;  3A5M C;  1TKZ A;  4W5O A;  1HJO A;  2HMI A;  3OS1 A;  2F9T A;  3T7Z A;  5D3G A;  1NBW A;  2VCP A;  4JNE A;  3NVK A;  3LL3 A;  4DR1 K;  5EOY A;  3HM8 A;  3ULD A;  4C8L A;  5HLF A;  4PKI A;  3MDQ A;  4KBO A;  4WE1 A;  3KHY A;  3RMA A;  1ZBU A;  3KTQ A;  2KZM A;  4FLU A;  3IS9 A;  5KTQ A;  1XHX A;  4N56 A;  4GVM A;  2IAJ A;  4JKA A;  4NCG A;  4FJJ A;  1QZ5 A;  3EKS A;  2HVH A;  1RT1 A;  1B92 A;  3BGR A;  4N41 A;  2HMP A;  3OJS A;  4OPK A;  1QQN A;  3L3U A;  4KRF A;  3QES A;  1LCU A;  4DV1 K;  3M8P A;  3HI0 A;  1JLG A;  1Q86 O;  1QTM A;  1W9H A;  3THX B;  3VGK A;  5BPL A;  3SAH A;  5M1Q A;  3V9X A;  5GAH P;  2IIR A;  3ZT2 A;  3CC2 N;  4CFB A;  2YNI A;  4O5F A;  5TKY A;  5E41 A;  3VQ8 A;  5C0Y A;  3V1R A;  4O5B A;  2HND A;  2G8K A;  2O8B A;  2G8V A;  4DTR A;  4F4K A;  1JLC A;  4FVU A;  5AQI A;  1KAY A;  1W97 L;  5M1N A;  4G9Z A;  3D2E B;  3ITH A;  3OW2 M;  5J2Q A;  3VTI A;  1GOA A;  3NE6 A;  3MEE A;  3WNG A;  2KHO A;  1SUQ A;  2HNZ A;  4I2P A;  3KLE A;  3S3O A;  1NJW A;  3VQA A;  3KKR A;  1TK5 A;  5AZJ B;  1JXE A;  4DLE A;  3AAP A;  4BR5 A;  4CZL A;  1BO5 O;  4DCH A;  2V7Z A;  2VG5 A;  3AVA A;  3GG4 A;  3ZX0 A;  3MK6 A;  3ENB A;  3VF4 A;  3OYD A;  4HCC A;  1IBM K;  3VEZ A;  3DXM A;  3MXI A;  4CBX A;  2UXC K;  3OBW A;  4CJQ A;  4WQ5 A;  3CCU N;  5KPT A;  1CZA N;  4ISG A;  4BG8 A;  3P4I A;  4CHN A;  1NKC A;  2X6S A;  1BCM A;  4FOI A;  2IGI A;  2YNH A;  4IBN A;  4H5V A;  3SQ1 A;  2YJE A;  3HXM A;  3K5M A;  3THY A;  4FYD A;  3KWG A;  2CGL A;  1ZC6 A;  5BRH A;  1QQC A;  3BF3 A;  4EFH A;  3DAW A;  4CJP A;  4MDA A;  2E1Z A;  2YJF A;  4CCH A;  1YVN A;  4JI6 K;  1N32 K;  4CJ5 A;  1X9J A;  4FPB A;  5BPN A;  3CJ7 A;  3MED A;  2FLO A;  5LY3 A;  1EET A;  1L3T A;  2J4R A;  1HPZ A;  1RT4 A;  4OKK A;  1YAG A;  2FSJ A;  1N36 K;  2E2N A;  2JWK A;  1RNH A;  1FKP A;  5HRP A;  4DLG A;  2BGG A;  4CI6 A;  3THW B;  1I3A A;  1TKD A;  4CD1 A;  4OJR A;  2WUS A;  4JK8 A;  1TVR A;  3AVF A;  2O8E A;  4FWS A;  5AR0 A;  4F3O A;  3G0Z A;  1IKY A;  1XMO K;  1VHX A;  1YTU A;  3K58 A;  3VQ9 A;  3AVJ A;  3CYM A;  3DI6 A;  1NGB A;  4LFB K;  1J53 A;  1RBV A;  3MMV A;  4FWR A;  4NYN A;  3J8A A;  3MEC A;  4JN4 A;  3E9O A;  2NZT A;  4J2B A;  4CK1 A;  4WCE L;  1RBT A;  4J2A A;  3MCA B;  1VQO N;  3TI0 A;  4AM6 A;  2ZJR L;  3CQ8 A;  2B5J A;  5TKW A;  2VQF K;  1HQU A;  3E9L A;  3HTV A;  4KB1 A;  2Q97 A;  2P9L B;  3BF1 A;  3U4L A;  5GIO A;  2ETJ A;  1JL2 A;  3OYE A;  4ZHR A;  2DY4 A;  1D4X A;  4FLT A;  3V9U A;  4DQQ A;  4A2B A;  2G8H A;  5AQS A;  2HB5 A;  3I8D A;  5AQM A;  1DEJ A;  4BC3 A;  4DSE A;  1S9G A;  5M1P A;  4O0J A;  2OPS A;  4LH5 A;  3C6T A;  1ZBL A;  4FM1 A;  4IDH A;  1VQ4 N;  4B1Y B;  1X3N A;  4IG0 A;  3QIC A;  1SAZ A;  3I55 N;  4HTU A;  4YOY A;  4JS4 A;  4FOE A;  1VSE A;  3DXK B;  1NMD A;  2WFB A;  1KD1 O;  4B9S A;  3FZF A;  4JKD A;  2E6M A;  3WEE A;  3QFU A;  3RWU A;  3ATU A;  2ZGY A;  3R6M A;  3CCS N;  3O3G A;  3R8E A;  3K5L A;  2FSN A;  1XUP O;  3O80 A;  1EQY A;  3OYJ A;  1Q8I A;  1OH6 A;  3KD1 E;  5CR4 A;  2VGN A;  2JLE A;  3CXC M;  4E3S A;  1HPM A;  3ASM A;  4OPA A;  1XC9 A;  4R79 A;  4KTZ A;  3A8Y A;  4IJN A;  1T6C A;  1U4B A;  4H0P A;  4QS9 A;  3NGI A;  4DSI A;  1XHZ A;  5GAE P;  3D2E A;  3C94 A;  4FJN A;  2F9W A;  4FJX A;  1GLC G;  5EY4 A;  3LDL A;  1QS4 A;  1KLN A;  2ITG A;  3WQU A;  2UUA K;  3ZYY X;  3NF9 A;  4IZ9 A;  4CBU A;  3SAG A;  4CJ7 A;  5AZJ A;  5C15 A;  1XI1 A;  1C6V A;  2NRR A;  4DS5 A;  1NKE A;  1Y97 A;  5AQT A;  4BE2 A;  4DV6 K;  2W41 A;  4ILH A;  4CFA A;  3OYG A;  1IKX A;  1I94 K;  3BDP A;  1TKX A;  2QA4 N;  1HNW K;  5K14 A;  3EYZ A;  2A1R A;  2QEX N;  3LP2 A;  5C2D A;  2I7P A;  4CIG A;  4BRC A;  4JI7 K;  5HRS A;  4DV3 K;  3Q7C A;  2NRT A;  1E4G T;  4B1W B;  4FLW A;  1HR0 K;  1VQP N;  3V1Q A;  1NGJ A;  4BR0 A;  2OA8 A;  1RBR A;  1NGC A;  4H0X B;  1QVG M;  3H1V X;  3QML A;  3OVN A;  4QAG A;  1J9A A;  2HHU A;  1UAX A;  5M1K A;  4DR3 K;  2ZJP L;  4LF8 K;  4LD0 A;  4GKJ K;  1NGD A;  1T05 A;  5F2R A;  3R3L A;  4JEP A;  1YUW A;  2NNW A;  3S41 A;  1BI4 A;  3HVR A;  3RR7 A;  5FPE A;  3O1B A;  2YHB A;  4L3Q A;  3TTC A;  2PY5 A;  1TYQ A;  3M3Z A;  4BRN A;  1N6Q A;  2OPR A;  5EU7 A;  1ASU A;  2G8W A;  1BDG A;  4BC5 A;  1LAW A;  3IAY A;  1S9E A;  2HHX A;  4YOX A;  3Q7B A;  3ZSY A;  4E7H A;  4I2Q A;  3QB0 A;  1KAX A;  3P39 A;  2HHT A;  4ILG B;  4H4M A;  1TL1 A;  4JI8 K;  1I39 A;  2NLX A;  3SAF A;  1VSJ A;  4LF5 K;  4TSX A;  2CH5 A;  3CPE A;  5FPD A;  1S6Q A;  1JCF A;  3WT0 A;  4CEQ A;  5CHI A;  1RCH A;  2XY5 A;  1T8E A;  3NF6 A;  2P9L A;  5CYQ A;  3GOI A;  4KHY A;  2GV9 A;  3H45 C;  1KTQ A;  1OH5 A;  4B3R K;  4ICL A;  3OJU A;  1VQK N;  5AQG A;  4E7L A;  4E7I A;  4JI5 K;  3UE5 A;  4O44 A;  2RPI A;  3LPU A;  4EHU A;  3O4Q A;  2HVI A;  4YHH K;  1TKT A;  4CHP A;  2RKI A;  1NJI O;  3K5O A;  3BP8 A;  4KHQ A;  1SKR A;  1HYV A;  4Q0B A;  4JRQ A;  4CF9 A;  4FSV A;  4WQ4 A;  4K8Z A;  3WNH A;  4ID1 A;  4JHD A;  5EVZ A;  4U67 L;  4BE1 A;  3K0S A;  4CW7 B;  1JLQ A;  4E0D A;  4DTS A;  2A6A A;  3SQ0 A;  4IOA L;  1C1C A;  3QFP A;  3DXK A;  3VQ6 A;  4CJK A;  2Q31 A;  4GV3 A;  4EHT A;  4DUY K;  2ZF5 O;  3WUH A;  3ZT4 A;  1N8R O;  2OPP A;  1CZB A;  2HW3 A;  3PSI A;  1R59 O;  1BL3 A;  4FWL A;  4E19 A;  4HHT A;  3UKU B;  5M1F A;  4C1N I;  1SKS A;  1MWM A;  1OH8 A;  4KB0 A;  2NRX A;  2RF2 A;  3FE1 A;  3L2W A;  3AVI A;  5KGW A;  1OH7 A;  1FW6 A;  3T1Y K;  2P9S A;  4A5A A;  4CJT A;  4KHS A;  4C8O A;  3DOK A;  3PSF A;  4JK9 A;  3SPY A;  5AQV A;  1SKW A;  1ZYQ A;  3D45 A;  1KLM A;  3CJ1 A;  3ID6 A;  3S3M A;  3LAL A;  1T03 A;  1DTT A;  4M3X A;  3FFK B;  3FZL A;  1GLD G;  1D9F A;  1IKV A;  3AVM A;  2VWB A;  2W6K A;  3F5T A;  4WFN L;  4WYB A;  5AQR A;  4JS5 A;  4AHC A;  2E4L A;  3IUC A;  1W7A A;  4OPJ A;  1RTI A;  1J5E K;  4ELU A;  3AV9 A;  3KKS A;  4C1N K;  1Q81 O;  4BRL A;  4BR4 A;  1JCG A;  3ATV A;  2FBT A;  1U49 A;  2BUP A;  1WSI A;  5JMV A;  3OYF A;  1NGA A;  2GEL A;  1K8A O;  1GLE G;  4X66 K;  1NJZ A;  1G15 A;  4DG1 A;  4DQS A;  1QQO A;  3CJA A;  2OYQ A;  1GLA G;  4HUF A;  1HKG A;  1BUP A;  1VQ6 N;  5BN8 A;  2F4V K;  5GIP A;  4B3S K;  3EKU A;  4CF2 A;  2AA4 A;  4LY7 A;  2CH6 A;  4CJE A;  3AGR A;  5LMU K;  3T3F A;  4ZTJ A;  3GDQ A;  1VRU A;  2Z1I A;  1MDU B;  2E2Q A;  3M8R A;  2VG6 A;  1QQM A;  2BH1 A;  1IBK K;  2GWK A;  1Q82 O;  2RE2 A;  2Z1H A;  4Z4H A;  2PAV A;  1E4F T;  3NH2 A;  4RG8 A;  4M3U A;  2DPN A;  4DB3 A;  3ISN C;  3E1Y A;  4FJI A;  1BOT O;  2HBK A;  3NVM A;  1HMV A;  3L2V A;  3F9M A;  1C0M A;  1U04 A;  1JLA A;  1XWL A;  3T19 A;  3TWH A;  5I42 A;  2Y1I A;  3VEO A;  4F2S A;  1GOC A;  1SL1 A;  3HP9 A;  2YNF A;  4YDU A;  4YOU A;  4OGE A;  3HL8 A;  4C8K A;  3AO2 A;  2F8T A;  3DRR A;  2I7N A;  1YJ9 N;  3P83 D;  4V19 S;  4BRG A;  3P31 A;  4OO1 J;  3TSQ A;  4O4G A;  4DF4 A;  3ZSQ A;  1VQN N;  3G4S N;  1Y64 A;  2XY7 A;  5H1S Q;  3SLC A;  4B9Q A;  4CHQ A;  1YI2 N;  1W0H A;  4DSL A;  1BA1 A;  1EWR A;  1RTJ A;  3KWI A;  2QWL A;  1JLE A;  5C2F A;  5AQJ A;  1HNX K;  4AHV A;  2E8A A;  4NO7 A;  3ZCM A;  4BQZ A;  3SBT A;  1E3M A;  4A5B A;  2E6L A;  1HX1 A;  4DSF A;  1RT3 A;  4IFE A;  1TV6 A;  1YIT N;  3B6P A;  2W6L A;  1NJX A;  3WEE B;  1VQ8 N;  3B6O A;  1S1W A;  3A5N C;  4Z4C A;  1K6Y A;  4BG9 A;  4B9N A;  3LZJ A;  1HJR A;  3SK3 A;  5BN9 A;  4YOR A;  5KQ8 A;  5ADX A;  1TUY A;  2P9P B;  3CCQ N;  3WXM B;  3DRP A;  4CGI A;  1WSG A;  3LP3 A;  4BGA A;  1TGO A;  2UXD K;  4EZ9 A;  5BRF A;  3VQC A;  3VQD A;  3OS0 A;  2KKZ A;  1UA0 A;  3GBT A;  3DLB A;  1NU0 A;  3ZSO A;  3ZLJ A;  1H1V A;  3UKU A;  3VQ4 A;  1G99 A;  4E1M A;  3L6Q A;  1VSI A;  4DR2 K;  3RSE B;  1YTA A;  3KZB A;  1NK9 A;  5KPZ A;  3TSP A;  2B6A A;  4M7Y A;  4PKG A;  2BE2 A;  4KV8 A;  4CZI A;  2A3Z A;  4FZZ A;  3ULE B;  1O1W A;  4BRQ A;  1NOY A;  3OHR A;  3CCR N;  4FJM A;  4CJV A;  1XMQ K;  4FZY A;  3SQ4 A;  4I9Q A;  4RW9 A;  4NCB A;  3HO1 A;  3U3G A;  3R9P A;  4RW6 A;  2HHV A;  4OX9 K;  3TAN A;  3SI6 A;  5BR8 K;  1NK5 A;  4H0Y B;  1L3U A;  1BIS A;  2HHQ A;  5AQN A;  3TR8 A;  4RW4 A;  3OYA A;  4M3W A;  5DK5 A;  3QDK A;  3H3O B;  3SUP A;  3CCL N;  3HYF A;  3NH0 A;  2VWJ A;  3DOL A;  4OGC A;  2H3G X;  3F73 A;  1S1V A;  2AP1 A;  4CZK A;  4PKH A;  3FZH A;  5BRD A;  2Q36 A;  1HQE A;  3FZM A;  4BWJ A;  1BI4 B;  4C23 A;  2QWP A;  2FC0 A;  3OYK A;  4IKF A;  3VGL A;  4DQ8 A;  1TYQ B;  1NK8 A;  4QOZ B;  1VQL N;  3IDH A;  4N76 A;  3PV8 A;  2HHW A;  5BRE A;  3P5J A;  4AIL C;  3HOT A;  3K59 A;  1DGK N;  1BHL A;  2KLA A;  4BRH A;  3L4I A;  2ZM6 K;  5AQY A;  5B8H A;  2O4G A;  2QXL A;  3E66 A;  1EO1 A;  1WB9 A;  2VGM A;  1UOC A;  4ELT A;  3V81 A;  2O8D A;  1JL1 A;  4M42 A;  4ISF A;  3HOS A;  4GV9 A;  3KJV A;  2ASM A;  4CGF A;  3IMX A;  1RDU A;  1DT9 A;  3O4W A;  5HOO A;  4DF8 A;  3CMA N;  4GMJ B;  4CE9 A;  3M8Q A;  1VSH A;  4JKG B;  5JVH L;  2PBD A;  3EEQ A;  1W2B M;  5DM7 L;  1S1T A;  2FXU A;  3K9J A;  4BR2 A;  2D0B A;  3IFR A;  3ZEU B;  2RN2 A;  4Y1C A;  4HUE A;  1V4T A;  1S1U A;  3PX0 A;  5MLC Q;  3O6W A;  4FK2 A;  3LDO A;  3TPQ A;  4IO9 L;  1ZBI A;  3O5B A;  3AO5 A;  4FVM A;  1N33 K;  3QEP A;  1ATR A;  1P8Z A;  4LF4 K;  3WQT A;  3KLI A;  3TU5 A;  3G10 A;  1KC8 O;  3FR0 A;  1HUX A;  3C6U A;  4BRK A;  1C1B A;  3VPZ A;  4GV6 A;  3O9Q A;  3PX4 A;  2A42 A;  4JHD B;  3PUF A;  1VQ7 N;  2F7T A;  4FL9 A;  3QIP A;  5AQZ A;  4BRF A;  3GE1 A;  3HP6 A;  4O0I A;  4YFU A;  5AFU A;  1D5A A;  4MLE A;  1U47 A;  4N5S A;  4M3Y A;  4BRM A;  4DTN A; 
#chains in the Genus database with same CATH homology
 3I0S A;  3OYC A;  1VSJ A;  4DSJ A;  2ZD1 A;  5HRR A;  4TSX A;  3SPZ A;  1U45 A;  4KTQ A;  1S6Q A;  3NHG A;  3VQB A;  3ZT1 A;  4CJS A;  3M8S A;  4KKO A;  4G1Q A;  4CEQ A;  1X9M A;  4CFC A;  2PYL A;  4IG3 A;  1N5Y A;  3L2R A;  2X74 A;  4FJG A;  3NFA A;  3VQQ A;  1RCH A;  2XY5 A;  1T8E A;  1IH7 A;  3NF6 A;  2QXF A;  5CYQ A;  4BAC A;  1CXU A;  4CIF A;  2GV9 A;  4KHY A;  1X9S A;  4FJL A;  3RMB A;  1UA1 A;  3S9H A;  2Z1J A;  1KTQ A;  4PY5 A;  3ZSV A;  3KLG A;  3FFI A;  2WON A;  3VQE A;  1KFD A;  4ICL A;  2YHA A;  1JXB A;  2NUB A;  3OJU A;  3PY8 A;  5J2P A;  2KFZ A;  1U48 A;  4DU1 A;  1JKH A;  1HYS A;  4DU4 A;  4E7L A;  4E7I A;  3DRS A;  4OKE A;  4O44 A;  3SV3 A;  4Z0U A;  2RPI A;  3LPU A;  1L3S A;  4LSN A;  1DTQ A;  4MQ3 A;  4HVJ A;  4B9L A;  4FJ8 A;  3O4Q A;  2HVI A;  2IDO A;  4DWI A;  3QEW A;  4DS4 A;  4CEE A;  1DLO A;  1TKT A;  3JSM A;  3V9W A;  4E7K A;  3AA5 X;  2LSN A;  4CHP A;  2RKI A;  4FJ5 A;  4QCL A;  3K5O A;  1RT6 A;  4FLV A;  1SKR A;  1HYV A;  4KHQ A;  2OZM A;  3MXJ A;  3O3F A;  1ZBH A;  4JRQ A;  4Q0B A;  4CF9 A;  4F2R A;  1C1A A;  4B08 A;  5HP1 A;  3AVB A;  1HNV A;  4R5P A;  4K8Z A;  2FBX A;  3LAK A;  3LDS A;  3RR8 A;  3WNH A;  4DQP A;  4ID1 A;  1J5O A;  3KK2 A;  2KZZ A;  1C0T A;  2XHB A;  4BE1 A;  3VQ7 A;  1Q9X A;  2Y1J A;  1JLQ A;  4E0D A;  3QEV A;  4DTS A;  1RDB A;  3TAF A;  3OS2 A;  4K8X A;  3AVC A;  3I0R A;  3NBP A;  3SQ0 A;  1Q9Y A;  2D0C A;  5CYM A;  1L3V A;  4DSK A;  1C1C A;  2YKM A;  3KK1 A;  3TAQ A;  3VQ6 A;  3AA4 A;  5SZT A;  3O3H A;  4CJK A;  4L8R B;  4OKJ A;  4CJW A;  2KTQ A;  2KFN A;  1HNI A;  1S1X A;  2VG7 A;  1EX4 A;  3QIN A;  1LW0 A;  1TKZ A;  3ZT4 A;  4W5O A;  3U6F A;  3HPH A;  2W42 A;  2HMI A;  1A5V A;  1FKO A;  4B9T A;  2OPP A;  1CZB A;  3OS1 A;  5D3G A;  1RTD A;  2HW3 A;  5CZ2 A;  4AHR A;  1BL3 A;  3DM2 A;  1TK8 A;  4E19 A;  4HHT A;  3QLH A;  4JLH A;  4CHY A;  3ULD A;  4C8L A;  5HLF A;  4KRE A;  4DU3 A;  1SKS A;  2ATQ A;  4FJH A;  1NKB A;  4WE1 A;  4I7F A;  3TAB A;  2QKK A;  3RMA A;  4KB0 A;  1ZBU A;  3KTQ A;  1SV5 A;  1F21 A;  3TAM A;  1KCF A;  3JYT A;  1IO2 A;  2Z1G A;  1WLJ A;  2RF2 A;  3IS9 A;  3L2W A;  4FLU A;  3AVI A;  5KGW A;  5KRS A;  3EY1 A;  5KTQ A;  4DFJ A;  4FXD A;  3DMJ A;  1XHX A;  4N56 A;  4J2E A;  4GVM A;  3HPG A;  2IAJ A;  4NCG A;  4FJJ A;  5FDL A;  1Z26 A;  1RDD A;  2HVH A;  1RT1 A;  1B92 A;  3L2U A;  4AHU A;  4KHS A;  4CJT A;  1Z25 A;  4C8O A;  3BGR A;  3DOK A;  4N41 A;  4LH4 A;  2P51 A;  3QNN A;  4FW1 A;  3OJS A;  3SPY A;  2AJQ A;  4OPK A;  1SKW A;  1ZYQ A;  3D45 A;  1KLM A;  1WNS A;  3L3U A;  3S3M A;  3LAL A;  4KRF A;  4IFY A;  1T03 A;  3QES A;  1DTT A;  3DLH A;  4M3X A;  3M8P A;  4BDZ A;  3SYZ A;  2JGU A;  1D9F A;  5J2N A;  3NCI A;  1IKV A;  1JLG A;  1LWC A;  3AVM A;  3L2Q A;  1QTM A;  1W9H A;  3DYA A;  2ZE2 A;  2P5O A;  3D0P A;  1MU2 A;  4ZTF A;  1WSJ A;  3V1O A;  5FRN A;  4JS5 A;  4EZ6 A;  3V9X A;  4AHC A;  2E4L A;  3ZT2 A;  4FK0 A;  1EP4 A;  4CFB A;  2YNI A;  4OPJ A;  1RTI A;  4DMN A;  4ELU A;  3AV9 A;  3KKS A;  3NF8 A;  3VQ8 A;  5E41 A;  3V1R A;  3PX6 A;  4O5B A;  3QNO A;  1U49 A;  2FBT A;  1RTH A;  3QO9 A;  2HND A;  1J54 A;  2G8K A;  2G8V A;  4DTR A;  4F4K A;  1JLC A;  1WSI A;  4FZX C;  3OYF A;  4B8A B;  1RT5 A;  3CFP A;  4KI4 A;  4CF8 A;  3TAG A;  2BDP A;  3P1G A;  3ITH A;  3AO1 A;  1S6P A;  5J2Q A;  1NJZ A;  1EXQ A;  2Q3S A;  1SL2 A;  4KO0 A;  1GOA A;  3NE6 A;  1G15 A;  4DG1 A;  4E1N A;  4DQS A;  1UWB A;  2I5J A;  2XRI A;  3MEE A;  2OYQ A;  5CZ1 A;  3WNG A;  3SNN A;  3HM9 A;  4JRP A;  1SUQ A;  4FJ7 A;  4Z4E A;  4HUF A;  4KFB A;  2HNZ A;  4I2P A;  3KLE A;  4DTJ A;  1RBU A;  1NK0 A;  3S3O A;  1NJW A;  4KTW A;  3AO4 A;  3VQA A;  3KKR A;  1TK5 A;  2QK9 A;  4DLE A;  1JXE A;  1EKE A;  3OYB A;  4M3Y A;  4Z4I A;  2DFF A;  2VG5 A;  3AVA A;  4CHO A;  4M3T A;  4C8N A;  3V9Z A;  4CF2 A;  4LY7 A;  4CJE A;  1HYZ A;  3OYD A;  1D8Y A;  4HCC A;  3T3F A;  4ZTJ A;  3MXI A;  2IC3 A;  1VRU A;  4CK2 A;  2Z1I A;  3SCX A;  4CJQ A;  1QSS A;  4HCB A;  1KSP A;  3M8R A;  3OYL A;  1KFS A;  4CHN A;  1NKC A;  2VG6 A;  3ALY A;  3CFR A;  2X6S A;  1BCM A;  4PWD A;  2X6N A;  3NGZ A;  2IGI A;  2YNH A;  4FW2 A;  1CXQ A;  4IBN A;  2HHX A;  3SQ1 A;  1TAU A;  1NOZ A;  3HXM A;  3K5M A;  4FYD A;  1WAJ A;  1HRH A;  1QQC A;  3NGY A;  4KAZ A;  4AH9 A;  3LAN A;  2Z1H A;  4CGJ A;  4CJP A;  4KHU A;  4Z4H A;  2FBV A;  4CCH A;  1A5W A;  3NH2 A;  4RG8 A;  4M3U A;  3F9K A;  4M3Z A;  1B9F A;  3ISN C;  4CJ5 A;  3UIQ A;  5J2M A;  4FJI A;  3A2F A;  3SUQ A;  3IRX A;  3AA2 A;  4IDK A;  3MED A;  3NDK A;  3PO4 A;  2YKN A;  4CGD A;  4H4O A;  1EET A;  1L3T A;  1HMV A;  2WOM A;  2HNY A;  3L2V A;  3OY9 A;  1C0M A;  1U04 A;  1HPZ A;  3CFO A;  1JLA A;  3OYH A;  1RT4 A;  1XWL A;  3T19 A;  4OKK A;  3TWH A;  5I42 A;  2Y1I A;  2YNG A;  1VSF A;  4F2S A;  5KRT A;  1GOC A;  4PQU A;  1RNH A;  3QIO A;  4FLZ A;  1FKP A;  5HRP A;  4DLG A;  1SL1 A;  3HP9 A;  2F8S A;  2YNF A;  2BGG A;  2ZQB A;  4CES A;  1JLF A;  4EP5 A;  4BWM A;  4OGE A;  1I3A A;  3HL8 A;  3AO2 A;  5I3U A;  1S5J A;  3DRR A;  1L5U A;  1TKD A;  4BDP A;  4FJ9 A;  2F8T A;  2GUI A;  1VK0 A;  3C95 A;  3P83 D;  4OJR A;  4I9L A;  2P1J A;  1TVR A;  3AVF A;  4O4G A;  4DF4 A;  1B9D A;  3ZSQ A;  4F3O A;  1BIU A;  3TAP A;  1QSL A;  3G0Z A;  1FXX A;  4FLX A;  2XY7 A;  4C8K A;  1IKY A;  4CHQ A;  4DSL A;  1CLQ A;  1W0H A;  1WAF A;  1RTJ A;  4MFB A;  1YTU A;  1X1P A;  4CEA A;  1JLE A;  3K58 A;  3VQ9 A;  4DTO A;  4DTP A;  3AVJ A;  3CYM A;  3DI6 A;  1J53 A;  1KVB A;  4AHS A;  2G8F A;  1RBV A;  4AHV A;  4W5Q A;  3RTV A;  3TAR A;  4GW6 A;  1FK9 A;  3ZT0 A;  3ZCM A;  3QEX A;  4M41 A;  4CEC A;  3RMD A;  2QKB A;  2O4I A;  4YNQ A;  2E6L A;  4NYN A;  3MEC A;  1SL0 A;  4CEO A;  4DSF A;  2OZS A;  1RT3 A;  1TV6 A;  3OYN A;  1RT2 A;  4J2B A;  4CK1 A;  3DLE A;  1RBT A;  4J2A A;  4HUG A;  3TI0 A;  2DFH A;  2P5G A;  4RW8 A;  3B6P A;  1A5X A;  4CJL A;  1QSY A;  1NJX A;  4Z4G A;  3CQ8 A;  3U3Y A;  4FCY A;  3B6O A;  1VSM A;  3NH1 A;  1S1W A;  2B5J A;  1QHT A;  4Z4C A;  1HQU A;  4OLA A;  1K6Y A;  3MAQ A;  4B9N A;  4XIU A;  1HJR A;  3LZJ A;  3AO3 A;  3K2P A;  4CGG A;  4KB1 A;  3THV A;  4KPY A;  4CGH A;  5CY4 A;  1LW2 A;  3PO5 A;  3AA3 A;  4M45 A;  2IOC A;  2ETJ A;  1JL2 A;  3DRP A;  4RW7 A;  4CGI A;  1WSG A;  3LP3 A;  1TK0 A;  3OYE A;  3SUN A;  4ZHR A;  4KHN A;  3LAM A;  2DY4 A;  4UQG A;  4FLT A;  3V9U A;  4DQQ A;  1TGO A;  3VN5 A;  3E01 A;  4CED A;  3VQP A;  2G8H A;  4EZ9 A;  3QER A;  2HB5 A;  4DTU A;  3RMC A;  3MXM A;  3VQC A;  3IG1 A;  3VQD A;  3OS0 A;  1UA0 A;  4CHZ A;  3V9S A;  3AVH A;  3I8D A;  3DLB A;  3ZSO A;  3OYM A;  4DSE A;  3HK2 A;  3AVN A;  1S9G A;  4CK3 A;  4B9U A;  3VQ4 A;  4O0J A;  2OPS A;  4Y1D A;  4AHT A;  4E1M A;  4CJR A;  3LP1 A;  4ID5 A;  1VSI A;  4LH5 A;  3C6T A;  3ZSX A;  1ZBL A;  4FM1 A;  2FBY A;  1QE1 A;  4E89 A;  3T1A A;  3WNE A;  1YTA A;  1D9D A;  4CER A;  4ELV A;  3V6D A;  1NK9 A;  1TAQ A;  4IG0 A;  3LWL A;  3QET A;  4FJK A;  3MEG A;  2B6A A;  1R0A A;  4CFD A;  2BE2 A;  2OPQ A;  3LWM A;  4HTU A;  1IG9 A;  4KV8 A;  1BCO A;  1RT7 A;  4OLB A;  5KI6 A;  4JS4 A;  5T7B A;  2KW4 A;  4B8C A;  3SQ2 A;  4FZZ A;  1O1W A;  1NOY A;  4DQI A;  4FJM A;  1VSE A;  4CJV A;  4FZY A;  4LSL A;  3DLK A;  4B9S A;  1ITG A;  2PZS A;  3SQ4 A;  2F96 A;  3AVG A;  1LWE A;  4M3R A;  3VQ5 A;  4DFK A;  2E6M A;  4I9Q A;  4RW9 A;  3RWU A;  4NCB A;  1VSK A;  3DLG A;  1RDC A;  1YT3 A;  3U3G A;  3HO1 A;  2BAN A;  3V4I A;  5FRO A;  1WSH A;  4RW6 A;  3O3G A;  2PYJ A;  2EX3 A;  2HHV A;  2GBZ A;  4OVL A;  3K5L A;  1WSE A;  4KHW A;  3OYJ A;  3TAN A;  3SI6 A;  3SZ2 A;  1Q8I A;  3KD1 E;  1NK5 A;  4F3T A;  1L3U A;  1BIS A;  2JLE A;  3CM6 A;  2HHQ A;  2R7Y A;  4E3S A;  3CM5 A;  1KVA A;  1BQN A;  3ASM A;  1TL3 A;  3TR8 A;  3HPO A;  4RW4 A;  1RDA A;  3OYA A;  1XC9 A;  4M3W A;  5DK5 A;  4IFV A;  4NYF A;  4KTZ A;  3VA0 A;  3CG7 A;  3SUP A;  3HYF A;  1U4B A;  3NGI A;  3NH0 A;  2VWJ A;  3DOL A;  4DSI A;  4W5N A;  2D0A A;  4OGC A;  5J1E A;  1S1V A;  3F73 A;  3C94 A;  2XY6 A;  3EZ5 A;  1XHZ A;  1NJY A;  2G8U A;  4B9V A;  3TAE A;  4FJN A;  4B9M A;  1HQE A;  4BWJ A;  3KK3 A;  1NK6 A;  4FJX A;  4H8K A;  2DTU A;  1BI4 B;  4W5T A;  3HT3 A;  2FC0 A;  2KZM A;  1QS4 A;  2D5R A;  5HRN A;  1C0U A;  2ITG A;  3OYK A;  1KLN A;  4IKF A;  3QEI A;  3NF9 A;  5C24 A;  1NK8 A;  4CIE A;  4QOZ B;  5C42 A;  4FM2 A;  3OYI A;  4J2D A;  1KVC A;  1XI1 A;  4N76 A;  5JS2 A;  1C6V A;  1WSF A;  3KLH A;  3KD5 E;  1REV A;  4DS5 A;  2YV0 X;  4CJU A;  3PV8 A;  1NKE A;  2HHW A;  1Y97 A;  3LPT A;  3P5J A;  4N47 A;  4AIL C;  4BE2 A;  4FM0 A;  3HJF A;  3K59 A;  3OYG A;  4CFA A;  1BHL A;  4BE0 A;  3LP0 A;  3RRG A;  1IKX A;  3BDP A;  2O4G A;  1TKX A;  3KIO A;  2KQ2 A;  3SV4 A;  3ZSW A;  4FLY A;  4CJF A;  4Q5V A;  1LV5 A;  1UOC A;  5K14 A;  3SUO A;  4C8M A;  3EYZ A;  1ZBF A;  2A1R A;  4ELT A;  3V81 A;  3LP2 A;  3NAE A;  2B4J A;  1JL1 A;  4M42 A;  3HST B;  3WNF A;  4BDY A;  4CIG A;  5HRS A;  3L3V A;  4DFM A;  1VRT A;  4FLW A;  3KJV A;  3V1Q A;  3O4N A;  4CGF A;  2OA8 A;  3RRH A;  2DFE A;  4Z4F A;  1YVU A;  1RBR A;  3KLF A;  3VA3 A;  5FRM A;  4DF8 A;  2HHS A;  3AVL A;  1VSD A;  3OVN A;  4GMJ B;  4CE9 A;  3M8Q A;  1WN7 A;  2X78 A;  1J9A A;  4QAG A;  2HHU A;  1UAX A;  1VSH A;  2G8I A;  3H08 A;  4KI6 A;  4LD0 A;  1S1T A;  1T05 A;  1T7P A;  4DTX A;  2XY8 A;  3NF7 A;  2D0B A;  5C25 A;  4NCA A;  2RN2 A;  4Y1C A;  4DTM A;  1GOB A;  4HUE A;  4W5R A;  3ZT3 A;  1S1U A;  1BI4 A;  3PX0 A;  4PUO A;  4CJ3 A;  3HVR A;  5SWM A;  4FK2 A;  1IKW A;  3RR7 A;  5DMR A;  1VSL A;  4CJ4 A;  2YHB A;  1KRP A;  5HBM A;  1CZ9 A;  2XO7 A;  3ZSZ A;  2PY5 A;  5JS1 A;  1ZBI A;  4O55 A;  1N6Q A;  3AO5 A;  2OPR A;  4FVM A;  5EU7 A;  1ASU A;  3QEP A;  2EHG A;  4CEF A;  4E7J A;  2IS3 A;  1RBS A;  5KGX A;  1X9W A;  3AVK A;  1BQM A;  5HRO A;  2G8W A;  3L8B A;  1LAW A;  3DLR A;  4CF1 A;  3KLI A;  3IAY A;  1S9E A;  3G10 A;  4PA1 A;  3ZSR A;  3K57 A;  4DQR A;  1JLB A;  3SJJ A;  4B3O A;  3C6U A;  1RIL A;  3HVT A;  3S3N A;  1C1B A;  3PX4 A;  4CF0 A;  4EP4 A;  1NK4 A;  1ASV A;  3LZI A;  3PUF A;  4FK4 A;  3ZSY A;  3K5N A;  2A1S A;  4E7H A;  3QIP A;  1LAV A;  4F8R A;  3HP6 A;  1ASW A;  1LWF A;  4I2Q A;  4O0I A;  2HHT A;  4YFU A;  1BGX T;  4H4M A;  1D5A A;  4DFP A;  1U47 A;  1NK7 A;  1TL1 A;  1BIZ A;  4CEZ A;  4N5S A;  2VWK A;  1I39 A;  4CEB A;  4DTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...