1WSIA

Crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGAGHPENERCNELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
source organism Escherichia coli
total genus 45
structure length 152
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsiA00
4N41A 1A5XA 3KLIA 1CZBA 1BQNA 2ZE2A 3JYTA 3VQAA 1QE1A 2FBTA 4PUOA 2HB5A 3DLKA 4CGFA 1BHLA 1NKBA 3OYEA 1SL0A 1C1CA 4J2AA 4DS5A 4CJ5A 3QEWA 3SPYA 2IC3A 2IOCA 3DRSA 4N5SA 1T8EA 4O44A 4W5RA 1HQEA 3ISNC 5C42A 1S1TA 3LWLA 4IFYA 3OS0A 4GMJB 1TGOA 4CGGA 3HXMA 3PX0A 1QTMA 3CFRA 1WAFA 1S6PA 3FFIA 3VQ6A 3LZJA 4FJHA 2P51A 3V1RA 3LDSA 2YNIA 3ZT4A 4FZXC 1VSLA 4DTSA 2QKKA 2PYJA 4CECA 4Z4CA 3UIQA 3ALYA 3QINA 4JRQA 4E3SA 3SJJA 4I9LA 4NCGA 3M8RA 3E01A 1TKZA 1HPZA 3V9WA 4CJWA 2I5JA 1VSHA 1TKDA 3HL8A 1TV6A 3NHGA 4FM2A 4MFBA 3QEVA 4QCLA 1LW2A 1T7PA 2HHSA 4O5BA 1TL3A 3SUQA 3TI0A 2G8KA 4CEBA 4DFMA 4KB0A 3HSTB 1F21A 4IG3A 3G10A 1RBUA 5CZ2A 4HVJA 3NFAA 3AVKA 3OY9A 3NCIA 5KGXA 3SYZA 4DTPA 1QQCA 4FW2A 4DFPA 3I0RA 1ASUA 1NK5A 4KTWA 3V9SA 1S5JA 1HNIA 3V9ZA 3OYFA 1HYZA 1SKRA 3NH2A 1JL2A 1T05A 5KI6A 1XHZA 1L3TA 1KVCA 2YNFA 4JS4A 3WNGA 3C6TA 3PX4A 1BISA 1C0UA 3DMJA 3M8PA 3O3FA 3LP1A 1NK8A 1VRUA 4B08A 1RT2A 4DLEA 5SWMA 3LAKA 3HT3A 2BDPA 3DLHA 4HCCA 2HHTA 4F3TA 2F8TA 1S1VA 3SUNA 2DY4A 3OYLA 2D5RA 4WE1A 4RG8A 4DFKA 4KHQA 3JSMA 1JXEA 4CK2A 4HUEA 2GBZA 4CHZA 2DFFA 3D0PA 4ELUA 4PQUA 4IBNA 3VQ5A 4DLGA 2E6MA 4KRFA 2O4IA 2HHWA 1HMVA 4DTMA 2OPQA 3AVFA 1LV5A 1JLCA 4CGJA 2PZSA 1LWEA 5EU7A 1IKXA 4I7FA 2JLEA 3PY8A 4E7JA 2VWKA 1CXUA 3OYKA 4QOZB 1SKSA 1FKPA 4O0JA 4M3WA 1XHXA 1VSJA 4CHOA 3S9HA 1O1WA 1J5OA 1RTDA 3HK2A 4Q0BA 4FYDA 4CGHA 3DOLA 3ZSZA 3CQ8A 3QEIA 2WOMA 4FJKA 3TAQA 1UWBA 2OPRA 4DG1A 4FLZA 4JRPA 1C0TA 2BE2A 3BGRA 4OVLA 4N56A 1XC9A 1NJXA 3QEXA 3RWUA 3TAFA 3ZSXA 4CIGA 3SUPA 1NOYA 2WONA 1ZBHA 5JS2A 4DFJA 3EYZA 2ATQA 4PA1A 3ZCMA 4CEEA 2HHQA 4LD0A 3AVCA 3LANA 1J9AA 3HJFA 2KTQA 1RDBA 4MQ3A 3L2RA 1D9FA 3BDPA 3U6FA 1RT6A 1YTAA 4B8CA 4CJLA 5CYQA 3V6DA 1EX4A 5HBMA 4CFAA 3B6OA 3AO4A 1NJYA 2E6LA 1RT1A 2VG7A 2R7YA 4KAZA 4E19A 1LWFA 5K14A 1D5AA 2X6SA 3VQQA 2FC0A 5C24A 4CJEA 3DYAA 3OYBA 4BE1A 1XI1A 4C8OA 4CCHA 4DSKA 3AVHA 3V81A 4FJMA 4M3UA 1ZBIA 3KJVA 3DI6A 1S1WA 4CF8A 1ITGA 3OYAA 4E7IA 4B9UA 2X74A 4W5QA 1WLJA 1SKWA 1S9GA 2X78A 2KZZA 1WSFA 4Z0UA 5HRPA 3ULDA 3SQ2A 1HNVA 1FXXA 1TL1A 1BIZA 4KFBA 4KO0A 4H8KA 3RRHA 3TARA 1UAXA 3P5JA 4AHCA 3SV3A 4CE9A 1ASWA 3KTQA 1IKVA 3AVMA 1IKYA 4J2BA 4W5NA 2D0AA 1JXBA 3VQ4A 1Z25A 2YHBA 3ITHA 1WNSA 4AHRA 1EKEA 3MXIA 4KHSA 3QIOA 1TK0A 1DTTA 2P5GA 3HP6A 1KVAA 1RTHA 3T3FA 4NCBA 4EZ6A 1YTUA 4CIEA 5CYMA 2YNHA 1VSMA 3NAEA 4DU4A 3LWMA 4AILC 1QSLA 4HUGA 1RT5A 1NKEA 1L5UA 4B9TA 4C8KA 1TKXA 3HVRA 3DM2A 3AVAA 4CJQA 1BIUA 3ZSRA 1D9DA 2AJQA 1LAVA 3HM9A 1QHTA 1X9MA 1JLBA 2XY6A 4KPYA 4CF9A 4DU3A 4FJ8A 4GVMA 1I3AA 4L8RB 4IFVA 1S9EA 3DLRA 4M3YA 1TVRA 2B5JA 4ZTFA 4YNQA 4N76A 2ZQBA 1UOCA 3VQDA 4O55A 3NH0A 4NCAA 1WSGA 2OZSA 4K8ZA 1VSEA 3CYMA 3V4IA 2HHVA 1BQMA 3DLGA 4CHQA 1JLFA 1WSIA 2PY5A 2X6NA 4OPJA 4BWJA 3O3GA 3M8QA 3K58A 4RW4A 4FJ5A 3NBPA 4F2RA 2G8IA 4NYFA 3L2VA 1GOCA 1J53A 4CJ4A 1U49A 3AO2A 3H08A 1KLNA 4M3TA 4OLBA 3PO5A 1N5YA 4DQIA 1KRPA 4DTJA 1NK6A 3EY1A 2B4JA 4ELTA 4O4GA 3OYIA 4QAGA 3OVNA 1L3UA 2VWJA 1RT4A 1L3VA 4FJJA 3T19A 2HVHA 3KK1A 3P83D 4CEQA 3MEGA 4ELVA 4RW9A 3VQ8A 2VG6A 3NGZA 2YKMA 2B6AA 4DMNA 2KQ2A 2FBXA 1VSKA 3KLEA 4FLXA 4CJKA 3MEDA 3RMCA 4PWDA 2OZMA 3KK2A 2A1SA 1BGXT 2G8FA 4OPKA 4F4KA 5HP1A 2G8UA 4FZZA 3P1GA 2A1RA 4OKJA 4C8NA 1TK5A 3RR7A 3OYNA 1W9HA 1W0HA 3QIPA 3V1OA 4M3XA 2BGGA 2DTUA 1REVA 2OPSA 3AVJA 3PUFA 1C0MA 4BDPA 1JLGA 3QNOA 4KHWA 4B3OA 2RKIA 5KRTA 3K57A 5J2MA 4RW8A 3AVNA 1QS4A 3G0ZA 2RN2A 4OGCA 2IGIA 3L2WA 1NK4A 1RT3A 2RF2A 4E1NA 4DF4A 3IAYA 4G1QA 4M42A 2ITGA 3QEPA 2OYQA 4FJLA 2KFNA 3AA4A 3KIOA 3NF9A 3VA0A 3HO1A 1Z26A 3PO4A 2E4LA 2YV0X 4CF0A 5J1EA 2P1JA 4DSIA 4KI4A 3ZSYA 4CK1A 3K5OA 3S3OA 3DLBA 3QO9A 1RDCA 4DSLA 5D3GA 1HYSA 2NUBA 4HUFA 4DQRA 4H4MA 3ZT2A 1UA0A 1S6QA 1SL2A 1HYVA 2PYLA 4W5TA 1A5WA 4CHYA 3KD5E 1JLAA 4EZ9A 4YFUA 1RT7A 3SI6A 1EP4A 3KK3A 4DTXA 2FBVA 1RILA 5KGWA 1ZBUA 3NF7A 3D45A 2QK9A 1NOZA 2KW4A 4HTUA 3L3VA 2HMIA 4FJ9A 3O4NA 1TAUA 4EP5A 4DWIA 3NGIA 2XY8A 5FRNA 3MXMA 3L3UA 3CG7A 3SQ0A 2GUIA 4LH5A 3M8SA 3KLFA 1ZBFA 4I2PA 3TAGA 2D0CA 2EHGA 1QSYA 2Q3SA 4CEFA 4E0DA 1VSDA 4Z4HA 4CJFA 1GOAA 1WN7A 4E89A 3SUOA 2G8WA 3TR8A 3KKSA 4CF2A 4DU1A 3V9XA 1N6QA 4FK0A 1JLQA 3LZIA 2QKBA 2O4GA 2OPPA 4B9NA 1X9SA 2HNYA 1RDAA 2XY5A 4ZHRA 4DF8A 5HLFA 3ZSOA 3V1QA 3ZSWA 3VQEA 4Y1CA 4FM0A 1ZYQA 3A2FA 2G8VA 4AHVA 2XHBA 2FBYA 4I9QA 3HPHA 1U04A 3K2PA 4OKKA 1IKWA 1SUQA 4ID1A 3TWHA 3TAMA 3C94A 4R5PA 3TANA 4BE0A 1XWLA 4FLTA 1B9DA 4C8LA 3PX6A 1B92A 3K5MA 1LAWA 1VSIA 1IO2A 4H4OA 3I0SA 4ID5A 4B8AB 4KKOA 2DFEA 5C25A 4DSFA 4FJIA 4J2DA 4E7HA 1EXQA 4E1MA 1J54A 1S1UA 3AO1A 3AVBA 5KTQA 2YNGA 1RDDA 2EX3A 4CJTA 2Z1GA 4KHUA 1LWCA 1RBSA 2IS3A 4KTQA 1JL1A 3ASMA 2LSNA 4LSLA 2Z1JA 1X1PA 4BWMA 4M45A 4FLYA 3K5LA 4KHNA 2RPIA 2YHAA 3HYFA 1DLOA 1BCOA 4UQGA 3MAQA 4M3RA 1HJRA 4CJPA 3RMBA 1G15A 3DRRA 3SPZA 3AVGA 4LH4A 1D8YA 1CLQA 2F96A 4BDZA 1RTIA 4FJ7A 1RNHA 4KTZA 3L2QA 1X9WA 3ZT1A 3F73A 3SCXA 4FW1A 4AHUA 3AV9A 4DQQA 4Z4FA 3EZ5A 4CIFA 5CY4A 1IH7A 2Y1IA 3SQ1A 1BL3A 4OKEA 4K8XA 3CM6A 1JKHA 1RBVA 3OYCA 1CZ9A 3AVIA 3OJUA 4DTNA 1KFSA 3HPOA 4FK4A 1KVBA 2XY7A 1ASVA 3SNNA 4DSJA 1TAQA 3IRXA 5KRSA 4DTRA 4FZYA 3NF8A 3OYJA 3LPTA 3ZT0A 2OA8A 2YKNA 4JS5A 3HPGA 4IG0A 3T1AA 4Z4GA 3S3NA 3NDKA 4CJ3A 4CK3A 1TK8A 1C1BA 1Q8IA 1RBTA 2D0BA 4RW7A 3OS2A 4DTOA 5HRRA 3NGYA 4E7LA 3KD1E 4HCBA 5DK5A 4J2EA 1C6VA 2XO7A 1S1XA 3RR8A 3TAPA 2HHXA 5FROA 4BDYA 3QNNA 4OJRA 1Y97A 4CGDA 4HHTA 2QXFA 3RTVA 1U45A 2G8HA 3OJSA 5JS1A 3KLHA 1RTJA 3LALA 3SQ4A 4CGIA 3TABA 4KI6A 3AO5A 4GW6A 1YVUA 3QETA 3VQCA 1MU2A 3K59A 2HVIA 3C6UA 2ZD1A 3AVLA 5DMRA 5T7BA 3SZ2A 3LP2A 1RCHA 2Z1HA 4KREA 3RRGA 3AA2A 2XRIA 1WAJA 2Y1JA 4KHYA 2GV9A 3K5NA 2HW3A 4DS4A 5J2QA 3VQPA 3O4QA 4BE2A 3VQ7A 1NK0A 3LAMA 4F2SA 3AA3A 2W42A 1HQUA 1BCMA 3DRPA 3I8DA 4FLVA 3THVA 1WSHA 2JGUA 3VN5A 4FJXA 1FKOA 4CFDA 5I42A 1KSPA 2KZMA 3LP0A 3KLGA 5FDLA 3HVTA 4EP4A 1HRHA 4CHNA 3F9KA 1U47A 5E41A 1JLEA 3NF6A 3TAEA 3DLEA 3WNFA 4B9LA 4O0IA 1K6YA 2HNZA 3WNEA 4CJUA 3OYGA 4ZTJA 1VSFA 1B9FA 4DQSA 3AA5X 3LPUA 3LP3A 3B6PA 4NYNA 3ZT3A 4CFCA 4CJSA 1VRTA 4CJVA 4CF1A 2P5OA 4Z4EA 5HROA 1ZBLA 1TKTA 4CEAA 1WSEA 3QLHA 4AHTA 5SZTA 1KTQA 3RMAA 2VG5A 2Z1IA 1GOBA 2KFZA 3CM5A 1I39A 1DTQA 1KLMA 3U3YA 1NJWA 4DQPA 5I3UA 3ZSQA 1KCFA 3MECA 3VQ9A 4PY5A 1C1AA 3OYDA 4B9MA 4CHPA 3CFOA 3SV4A 1NKCA 1SL1A 4Z4IA 1KFDA 1VK0A 2IDOA 3O3HA 4TSXA 3MEEA 3U3GA 3L2UA 3HP9A 4BACA 4DSEA 4F3OA 2F8SA 4KV8A 3V9UA 3QERA 3DOKA 1WSJA 4ICLA 3PV8A 4IDKA 5HRNA 4Q5VA 4AH9A 1BI4A 1Q9XA 4CEZA 4LSNA 3QESA 5CZ1A 3VQBA 3C95A 3CFPA 5J2NA 3AO3A 4KB1A 5J2PA 4FJGA 4W5OA 4M41A 1L3SA 1SV5A 4FJNA 1NJZA 1U48A 1U4BA 1BI4B 4FVMA 3MXJA 3S3MA 4B9VA 2BANA 3OS1A 2DFHA 4CERA 4FXDA 1R0AA 4CEDA 1T03A 1RBRA 1CXQA 1LW0A 4CEOA 3NE6A 1IG9A 3IS9A 4B9SA 4XIUA 4CJRA 4C8MA 4F8RA 1FK9A 2ETJA 5HRSA 1NK9A 5FRMA 4LY7A 3OYHA 3VA3A 1EETA 4CFBA 1UA1A 4FCYA 4JLHA 1YT3A 4N47A 1NK7A 3ZSVA 4FLUA 1Q9YA 4IKFA 4FK2A 4OLAA 1QSSA 1A5VA 2HNDA 4OGEA 4RW6A 4I2QA 3KKRA 4Y1DA 3WNHA 4FM1A 4AHSA 4DTUA 4M3ZA 2IAJA 4FLWA 2HHUA 4CESA 3IG1A 3L8BA 4E7KA 3RMDA 3OYMA 3NH1A
chains in the Genus database with same CATH superfamily
3EZWA 4N41A 1BQNA 3VQAA 2ZJRL 3E9LA 4MO5A 1BHLA 1NGDA 4BRGA 1HJOA 1C1CA 3J80O 1WUAA 1HQEA 3ISNC 1S1TA 2E2OA 3HXMA 1QTMA 2ASPA 3CFRA 1WAFA 4FJHA 4DHYA 2P51A 1TYQA 2YNIA 3ZT4A 4DTSA 2QKKA 3CCRN 4ILGB 2IIRA 4IJAA 4Z4CA 5BN9A 3ALYA 4E3SA 4JRQA 1VQLN 3SJJA 1ZC6A 2WBNA 4FWQA 5E84A 1TV6A 3NHGA 4JI5K 4MFBA 4QCLA 1LW2A 3CD6N 3A5MC 3TI0A 4DFMA 4KB0A 5AQSA 3SAGA 3OY9A 1HX1A 3NFAA 3A5OC 3BF3A 1NK5A 1QQCA 4KTWA 1S5JA 3HZ6A 4CI6A 1JL2A 3MK6A 1T05A 3OTOK 1L3TA 3PX4A 3JXUA 4YOYA 3MN5A 3NVMA 4B08A 3HT3A 3DLHA 4KH6A 3SUNA 2DY4A 3OYLA 5JVHL 3FLCO 5C2DA 4KHQA 1OH6A 4M63C 1G99A 4IBNA 3O9QA 2WTUA 5KQ8A 4BR2A 3OBWA 2OPQA 1LV5A 4CGJA 1JCEA 4I7FA 2W40A 3THXB 3PY8A 2VWKA 1SZ2A 4CZHA 1SKSA 1NGGA 1J5OA 4M3WA 3S9HA 4FYDA 3NMUA 4CGHA 3DOLA 3FZMA 3ZSZA 2WOMA 3TAQA 3I8BA 3WUHA 4DR1K 4JRPA 5C10A 3QEXA 3ZSXA 4CIGA 3D2FB 2WONA 1ZBHA 4DFJA 4PA1A 3LANA 3L2RA 4G9ZA 2UYTA 1RT6A 4CJLA 3J7YP 2JWKA 3KHYA 3THWB 2R7YA 4KAZA 4E19A 3RSEA 2UXCK 1D5AA 3OYBA 3V81A 3P31A 5AQYA 3KJVA 4H0TB 3DI6A 1S1WA 4DV2K 4B9UA 1NNEA 2ZWHA 3MX2A 1S9GA 4Z0UA 5HRPA 5TKYA 2HHHK 3EE9A 1E3MA 2I7PA 4H8KA 4AHCA 3KTQA 1QZ5A 1JXBA 4K0KK 3MWTA 4QS9A 4C1NI 4AHRA 1WNSA 4X64K 3MXIA 1TK0A 1M1KO 1DTTA 3HP6A 1RTHA 3T3FA 4BRHA 4WCEL 3NAEA 3LWMA 5KPZA 1TKXA 3DM2A 1SQKA 3AVAA 4NLCA 3HSCA 1MWKA 1JLBA 4JHDA 4FJ8A 4L8RB 2VGNA 4IFVA 3DLRA 4Y0WA 2B5JA 3NH0A 2OZSA 4K8ZA 1VSEA 2HHVA 4JI8K 3QMLA 1JLFA 2I7NA 1NGAA 1NGEA 1TYQB 4OPJA 2GUPA 3O3GA 3K58A 4FJ5A 2BUPA 2G8IA 2O8CA 1GOCA 1J53A 1KLNA 1KRPA 2FSJA 3D6RA 2E1ZA 5BRDA 4O4GA 2H3GX 2VWJA 3VF4A 3KWGA 4L3QA 4ELVA 2NRTA 3QFPA 4DR4K 2YKMA 2FBXA 4FLXA 2YCHA 3O9UA 2P9SB 4LFCK 2YJFA 4JKCA 1YF5L 2G8UA 3P1GA 4C8NA 1W9HA 4BR4A 3AVJA 4PKGA 5AQNA 3FFKB 1HNXK 1NM1A 1BO5O 2RKIA 5J2MA 4RW8A 1QS4A 1VHXA 2E1YA 5I9EB 3L2WA 5DM6L 4E1NA 2F4VK 4YY3K 3VA0A 3HO1A 3PO4A 2YV0X 4CF0A 1E4GT 2VCPA 4M7XA 3S3OA 3K5OA 4DSLA 3QO9A 1RDCA 3PSFA 4HUFA 1QQNA 4H4MA 4NLBA 4DQRA 5F1XA 1Q82O 3R3LA 1RT7A 4BG9A 2FBVA 1RILA 1NJIO 3NF7A 3D45A 1NOZA 4HTUA 3VF6A 4FJ9A 3G71N 3CCJN 3DLLL 4CZKA 2UUAK 2HSTA 3L3UA 3SQ0A 1KC8O 2GUIA 4CD1A 1QSYA 1WOQA 4CEFA 1WN7A 3HTVA 3KKSA 4JKFA 4DU1A 4FK0A 3RSEB 3KZBA 4H5NA 1Q7YO 2OPPA 5B8HA 2HNYA 1RDAA 5AZJB 4ZHRA 4LF5K 3ZSOA 3CQYA 3L0QA 3E9PA 4XH1A 3HRGA 1IKWA 1SUQA 3TWHA 5FPMA 4R5PA 4BE0A 1B9DA 1IBLK 4C8LA 3O4WA 3W3DA 3K5MA 3QICA 2UU9K 4H4OA 4B8AB 4J2DA 4DSFA 4H5RA 4E7HA 3SBTA 2YNGA 2EX3A 2Z1GA 4KHUA 4JI2K 1RBSA 1J6ZA 1JL1A 3ASMA 4KTQA 4DR7K 4KHNA 2RPIA 3HYFA 1DLOA 4UQGA 4JV5K 3SPZA 1BU6O 2J4RA 4BDZA 1RTIA 3L2QA 1YHQN 1X9WA 4CIFA 1WB9A 1HR0K 5BR8K 2Y1IA 3AGRA 4JI3K 5AQVA 3SQ1A 1BL3A 1JKHA 2F9TA 3OJUA 1KFSA 1ASVA 3FE1A 4EHTA 3C7NA 3LPTA 3ZT0A 4O8UA 2OA8A 4JI0K 4MLHA 4GV9A 2QWMA 1OVYA 3HPGA 2YHXA 2BTFA 2O8CB 1TUUA 1TK8A 4CK3A 1Q8IA 4PKIA 2F9WA 4E7LA 4J2EA 2HHXA 5AQKA 2XO7A 4WQ4C 3CCVN 4BDYA 3QNNA 4CGDA 1Y97A 4HHTA 2G8HA 2QXFA 5AJ3K 1U45A 2OCEA 3OJSA 3KLHA 2D0PA 3BZKA 2ZGYA 3TABA 1VQON 3EO3A 4KI6A 3QETA 3VQCA 1YIJN 3C6UA 5T7BA 3SZ2A 3I33A 4CZJA 4HWIA 5J2QA 4F2SA 3LAMA 3N4QA 3AA3A 5HL7L 2WFBA 4M3UA 4FLVA 2JGUA 4FWRA 3OA9A 5M1FA 2NRRA 3BZCA 4BVPA 1HUXA 5JVGL 1B9FA 4DTXA 3LP3A 3B6PA 3ZT3A 4CFCA 4CJVA 2UXBK 1VQ8N 2KHOA 4CZIA 1WSEA 5H1SQ 4DUZK 1DTQA 1S3XA 1KLMA 5AQHA 1NJWA 1OVQA 3MECA 3OYDA 4BR5A 4B9MA 4CHPA 4UY8O 4B1XB 1NMDA 2IDOA 3O3HA 4TSXA 3U3GA 3AGKA 3VGKA 4EHUA 3L2UA 4F3OA 4ILJA 4ICLA 3VETA 5HRNA 3CF5L 1BI4A 3MCPA 3ID8A 5J2NA 4NO7A 1HKCA 2YI1A 5J2PA 2HBLA 5EY4A 4H5WA 3FZLA 2W41A 1NJZA 1U48A 2O8FA 3OS1A 4FOIA 2OANA 1RBRA 4KH5A 3TSPA 1IG9A 2Q97A 3IS9A 4BGAA 4C8MA 4F8RA 2ETJA 5HRSA 5AZIA 3OYHA 1VAZA 1EETA 4CFBA 1UA1A 4FCYA 3ZEUA 3ZSVA 2FF6A 4FLUA 1Q9YA 4IKFA 3RWUA 2HNDA 3TAGA 4DTUA 3KKRA 5HOOA 4YOWA 4AHSA 4FLWA 4CESA 4QS7A 4R79A 3NH1A 1CZBA 3T69A 2ZE2A 4H5TA 3JYTA 3VERA 5JICA 4PUOA 3L6QA 4CGFA 1NKBA 4LFAK 3PIOL 4J2AA 2EWSA 3O8MA 5GAGP 4N5SA 2FF3B 3VEZA 4W5RA 5C42A 4GMJB 1TGOA 3PX0A 1OH7A 5CE3A 3VQ6A 3V1RA 3LDSA 4BRFA 4FZXC 1NGHA 2AA4A 2QXLA 3UIQA 4MLEA 4NCGA 3M8RA 4BGBA 3MN7A 1HPZA 2VGMA 4LC9B 2I5JA 3C7NB 3J7AP 3QEVA 3D2EA 5LJVA 3SUQA 2OTJN 1F21A 2P9NB 3AVKA 3SYZA 4CW7B 4DTPA 5KPRA 4FW2A 4AF1A 4DFPA 3K0SA 4PL8A 1QVGM 4JI4K 1IBMK 1HYZA 1SKRA 1IV0A 2YX6A 4FWLA 5KI6A 3UKUA 1VQNN 3VEVA 2E5LK 3WNGA 3C6TA 1BISA 3O3FA 5M1QA 1VRUA 4HCCA 1NU0A 2HHTA 2F8TA 5LMNK 5EOYA 2D5RA 2CGLA 4WE1A 4RG8A 3JSMA 1JXEA 2GBZA 3CMAN 4IFEA 2DFFA 4CHZA 3D0PA 3THYA 4ELUA 4PQUA 2E6MA 1E4FT 5BPLA 4DR3K 1JLCA 4BY9C 2PZSA 1K9MO 1IKXA 4BG8A 4E7JA 3OYKA 4Q0BA 3AAPA 3HK2A 3LM9A 3VESA 4WQ4A 2Q0UA 3K9KA 3GL1A 1C0TA 3BGRA 4DV6K 5AFUH 5EXWA 4CEEA 3THWA 2O8DA 2KTQA 1RDBA 1HNZK 1D9FA 3O1BA 3ULEA 3BDPA 3U6FA 1V4SA 5CYQA 1NJYA 2E6LA 1RT1A 3FR0A 1MA9B 1LWFA 2QKBA 2X6SA 5C24A 4BE1A 1ZBIA 4FJMA 4CCHA 3AVHA 2QWLA 1HKGA 4WFNL 1ITGA 5AQPA 2NRXA 2O8FB 2KZZA 3WXIA 3ULDA 4CE9A 3AVMA 1VQ5N 5AZIB 2YHBA 3ITHA 3ZEUB 3CQXA 1YTUA 2CGKA 5CYMA 3RVCA 3G6EN 3CJAA 3QFUA 3HVRA 5AFUA 4JYAK 5JMVA 2AJQA 3VENA 1LAVA 3HM9A 4H0YB 5AQUA 2XY6A 2IVNA 1I3AA 2E2QA 2A6AA 5E26A 4NXMK 4YNQA 3R9PA 3O9RA 4N76A 2ZQBA 4O55A 2CH6A 1WSGA 1X3NA 3CYMA 5LY3A 2WUSA 3DLGA 4CHQA 1QHAA 1GLEG 3CCLN 1N34K 1WSIA 4BRLA 4RW4A 4F2RA 4FO0A 4NYFA 3L2VA 3AO2A 4M3TA 4DQIA 2IVOA 3U9ZA 5JLHA 1MDUB 4ELTA 3KWIA 2NNWA 3OVNA 1RT4A 3D2EB 2P9SA 4J8FA 3P83D 4IOXA 2VG6A 4JKGA 2B6AA 4B1YB 1IBKK 4GY2B 4WFAL 2HBJA 3UKUB 2A1SA 1BGXT 2Q2RA 5BPMA 3MDQA 3H46O 1I94K 2A1RA 3RR7A 2AP1A 3OYNA 2BGGA 1REVA 2OPSA 4A2BA 1C0MA 1XMOK 3IUCA 2NZTA 4B3OA 5KRTA 3THYB 2IGIA 4IWVA 2RF2A 3IAYA 4G1QA 2O8BA 2ITGA 4FJLA 4GNIA 3U4LA 4A59A 1Z26A 5J1EA 4DSIA 2P1JA 1GLFO 4KI4A 2NUBA 3A5NC 1S6QA 1UA0A 4W5TA 4B1WB 1JLAA 4YFUA 4K41A 2E2NA 5KGWA 4CZFA 3DWLA 2E8AA 2QK9A 4JK8A 4H5VA 1NGJA 2O8DB 1TAUA 3PIPL 4EP5A 5AQQA 3NGIA 3ULEB 5AZJA 4LH5A 3KLFA 1ZBFA 2D0CA 2Q3SA 4I6MA 4IO8A 1GOAA 2UXDK 2G8WA 3TR8A 4FWNA 4B1VA 4XEIA 4CF2A 3G4SN 3V9XA 1N6QA 1JLQA 3LZIA 4EIAA 2O4GA 3BF1A 1SS6A 5HLFA 3ZSWA 3O80A 3IMXA 5FLXO 3A2FA 4KHPK 2XHBA 3WXLA 2FBYA 2NRVA 1ATNA 4GKJK 3K2PA 4OKKA 1T3VA 1D4XA 5GADP 3C94A 5KPTA 3M3ZA 4XH5A 1B92A 1LAWA 1IO2A 4ID5A 3MN6A 4OX9K 3CJ1A 4FJKA 4E1MA 5KTQA 3AVBA 5AQZA 4C1NK 4CJTA 3O9TA 4NB4A 1LWCA 4LSLA 4BWMA 4JNEA 1X1PA 2JWLA 4M45A 3MAQA 4V19S 3RMBA 1CLQA 3AVGA 3CPEA 5M1PA 3ZT1A 1P8ZA 4DQQA 4DUYK 3DXKA 4Z4FA 3EZ5A 4GV3A 3UKRB 3GBTA 3TSUA 1CZ9A 1W7AA 2QM1A 3HPOA 1KVBA 2NRWA 4LF7K 5AQWA 1TAQA 4DTRA 4JS5A 3T1AA 3H1QA 1N36K 4BR7A 3NDKA 5HRRA 3NGYA 5DK5A 3RR8A 4DV0K 4OJRA 4DV4K 3UE5A 3K9JA 4BREA 3WXMB 4CBXA 3FZHA 4CGIA 1DEJA 4IEEA 3LP2A 4JKGB 4BQZA 2Z1HA 1LOTB 1RDUA 4KREA 3SAHA 1WAJA 1YITN 4KHYA 2GV9A 5AQFA 1RGIA 3VQPA 2RHKA 1HPMA 3ENBA 1NK0A 1WBDA 1HQUA 3DRPA 3I8DA 1WSHA 4CFDA 1BA1A 4B3TK 3KLGA 5FDLA 3HVTA 5M1KA 4CHNA 5E41A 3VTIA 4CZLA 4O0IA 1K6YA 1FJGK 4CJUA 2QW9A 4NYNA 4HUGA 4CJSA 4CF1A 2O8BB 5FPDA 5HROA 1TKTA 4AHTA 5A2QO 2VG5A 3VEXA 3U3YA 4DQPA 3ZSQA 3ATUA 3VQ9A 2GELA 4LFBK 1NKCA 3SV4A 1SL1A 2ZJPL 3MEEA 1EQYA 4EAHD 3QERA 5LL6Z 3DOKA 1WSJA 4Q5VA 1OH8A 1Q18A 1Q9XA 4JKDA 2D0OA 3SBGA 1T6DA 4BRPA 3CFPA 3IFRA 4M41A 5AQTA 4BRQA 4A5BA 1JCGA 3H3NO 1L3SA 4I6MB 3ENOA 3CHWA 3MXJA 1QZ6A 2DFHA 4JI6K 4CERA 4FXDA 3EL2A 3WQTA 1LW0A 4A5AA 4B9SA 3VEYA 4CJRA 1DGKN 4XH4A 3PSIA 1ILYA 4JKHA 3MX5A 1YT3A 4OLAA 2YHWA 3W0LA 1A5VA 4OGEA 4RW6A 4Y1DA 4FM1A 4M3ZA 2V51B 3OYMA 4ISGA 4IOCL 1QE1A 3VGMA 2FBTA 2GEMA 1YXQA 1NGIA 2DPNA 4A2AA 3OYEA 2ZF5O 4PKHA 4DS5A 3SPYA 2IC3A 3DRSA 3HM8A 3CC2N 3M1FA 4IFYA 5BPNA 4CGGA 3DXKB 3FFIA 1S6PA 5IT9O 2PYJA 1ZBSA 4CECA 2P9NA 4JN4A 1GLLO 3E01A 3M5RA 2P9PA 5GIOA 4CJWA 1VSHA 5KQDA 1VQPN 1TKDA 3HL8A 4FM2A 1GLJO 2HHSA 1TL3A 2G8KA 2QWNA 4O5FA 4CEBA 3HSTB 3G10A 1RBUA 4HVJA 3C6AA 1EWRA 1ASUA 1C0GA 3OYFA 4WQ5C 3NH2A 3BP8A 3EKSA 1XHZA 2GTDA 4JS4A 1C0UA 4FWSA 1RT2A 1Z05A 4DLEA 3J7ZO 3LAKA 3CCMN 4F3TA 1XUPO 2A41A 3LDPA 4BRMA 1BUPA 4CK2A 5C12A 2ASOA 4OPHA 1XNRK 4DTMA 3SLCA 1RFQA 2IVPA 3ZETA 2HF4A 1LWEA 4FPAA 2HOEA 4QOZB 1FKPA 1XHXA 1VSJA 4CHOA 1RTDA 1O1WA 5AQOA 2VYPA 3CQ8A 3JS6A 1UWBA 3CCQN 3O1WA 4DV7K 2BE2A 4OVLA 1KAZA 2E2PA 3SUPA 5JS2A 2YHYA 2HHQA 2ATQA 3ZCMA 4LD0A 1NLVA 3O08A 4YDUC 4DV1K 4B8CA 4CD3A 3V6DA 1EX4A 5HBMA 4B3SK 4CFAA 4BRDA 3BEXA 5BN8A 1R59O 3DYAA 2NLXA 1KQSM 4BR0A 1NWKA 3OYAA 4BRCA 2X74A 4W5QA 1WSFA 3TPQA 1HNVA 3GE1A 4YOVA 4IO9L 1BIZA 4KO0A 3RRHA 3OHRA 2ZJQL 3TARA 1UAXA 3P5JA 1ASWA 3LDOA 1IKVA 3P4IA 4AM7A 3VQ4A 1Z25A 4IDHA 3VGLA 4KHSA 1EKEA 3QIOA 1KVAA 3VOVA 4EZ6A 4AM6A 4CJ7A 3CJBA 1NKEA 4B9TA 4C8KA 5MLCQ 5GINA 4IOAL 1BIUA 3CXCM 3I56N 1VQKN 3ZSRA 2QWOA 1GLCG 4CF9A 1GLBG 3B8AX 1S9EA 4M3YA 3ZYYX 3T1HK 4GV6A 1UOCA 4NCAA 3GDQA 3V4IA 1KAYA 5AQRA 2PY5A 2QI2A 1N33K 2X6NA 5ADXH 4BWJA 3M8QA 3NBPA 3GOIA 1O13A 3TTDA 3H08A 3WXJA 3PO5A 4DTJA 2P9PB 4A62A 4BC4A 2B4JA 5CHIA 1P90A 4QAGA 4E1JA 3QBWA 4U67L 2HVHA 3KK1A 4CEQA 3MEGA 3VQ8A 4LF9K 3WXKA 2QWRA 1V4TA 4PWDA 4CJKA 3MEDA 3RMCA 3SMSA 2OZMA 3CJ9A 5JLFA 2G8FA 4OPKA 2Q1NA 4F4KA 3E66A 3FZKA 4FZZA 1W0HA 3QIPA 4FWOA 3V1OA 4BDPA 1JLGA 4OPAA 3QNOA 3TTCA 3U9DA 3CIPA 4KHWA 3P39A 2QEXN 4IZ9A 1IJJA 1IG8A 2V7ZA 4OGCA 3C65A 2PAVA 1X3MA 3BY5A 3CJCA 4M42A 3QEPA 5AR0A 2GX9A 3ZETB 2OYQA 3AA4A 3NF9A 1EWQA 1ZXOA 4CK1A 4DKWA 1HYSA 5ADXA 1A5WA 3KD5E 4WQ5A 1BWFO 3J8AA 1C0FA 5GAEP 1GLDG 1T44A 3D7EO 3L3VA 2HMIA 4JK9A 4H0PA 3MXMA 3CG7A 3M8SA 1NMNA 2EHGA 1VSDA 4CJFA 4E89A 1BG3A 4IEIA 5IWAK 3J81O 2VQFK 3N4PA 3ZX0A 3U8XA 1X9SA 2KLAA 4B9NA 4IJNA 3V1QA 3I55N 3VQEA 4AHVA 1U04A 4JI7K 1T6CA 4ID1A 3G25A 3TAMA 3TANA 3LL3A 4FLTA 1VSIA 3I0SA 4KKOA 2DFEA 3HJFA 2NRHA 3ZX2A 1RDDA 4K42A 2A5XA 1YVNA 4FLYA 3K5LA 2YHAA 1BCOA 4M3RA 1G15A 4X65K 4LH4A 3WEEA 4FJ7A 3UKRA 4MO4A 2QA4N 4FW1A 4AHUA 5BR9A 1JCFA 1IH7A 3IDHA 4K8XA 3MN9A 1N32K 3CM6A 4EFHA 5ELZA 1RBVA 2CH5A 1K8AO 4IXCA 3ID6A 4DTNA 4FK4A 1TUYA 4WFBL 4FZYA 4DSJA 3NF8A 3OYJA 2FSNA 2YKNA 5FPEA 4IG0A 4YHHK 4CJ3A 5AQIA 1C1BA 2D0BA 3OS2A 2Q0RA 2VQEK 4DTOA 4HCBA 1C6VA 1GLAG 4X66K 2PBDA 3TTFA 4X62K 1ESVA 1RTJA 3H3OB 3LALA 4GW6A 1YVUA 4YOTA 1HKBA 1MU2A 3K59A 2HVIA 3AVLA 1QQMA 3DXMA 3AA2A 5AQMA 2Y1JA 3K5NA 3LM2A 2HW3A 3BUZB 3O4QA 4BE2A 3C6HA 3CCUN 4BC5A 1BCMA 3THVA 1K8KA 4FJXA 3VN5A 4WYBA 1U6ZA 4EP4A 1HRHA 4BRKA 1YJ9N 2O8EA 1JLEA 5BRHA 3NF6A 3TAEA 3WNFA 4FVUA 4HTLA 3H45C 3WNEA 3OYGA 4ZTJA 1VSFA 3AA5X 3AARA 4Z4EA 1ZBLA 5EVZA 5SZTA 4BROA 1WBBA 3RMAA 1KTQA 2Z1IA 5GIPA 3MWPA 3CM5A 1Q81O 2E20A 1HNWK 5I3UA 2HMPA 4PY5A 1Z6RA 3LDNA 4Z4IA 1VK0A 1YI2N 4BACA 4DSEA 3HP9A 2F8SA 4KV8A 4IDKA 5DM7L 4AH9A 2F7TA 4FWPA 5F2RA 4CEZA 4LSNA 3QESA 3VQBA 2V52B 3C95A 3AO3A 1H1VA 4W5OA 3Q7CA 1SV5A 4BQLA 3O5BA 1U4BA 4FVMA 3S3MA 4B9VA 2BANA 1R0AA 4CEDA 1T03A 1CXQA 3NE6A 3R6MA 1NGBA 1FK9A 1YJWN 1NK9A 3CC4N 4N47A 1NK7A 3P38A 4FK2A 4KBOA 4K43A 1YUWA 1QSSA 4I2QA 5AQLA 2D1KA 2HHUA 4E7KA 2KKZA 3IG1A 3L8BA 3RMDA 1A5XA 3KLIA 4YORA 5AQXA 4YOXA 2QWPA 4H0VB 3KK7A 2ZGZA 2HB5A 3DLKA 1S72N 4CZMA 2P9UB 1SL0A 3FGUA 4CJ5A 3QEWA 3WEEB 2IOCA 1T8EA 4ISEA 4O44A 3CETA 4A57A 3LWLA 3OS0A 3MCAB 3LZJA 1VSLA 5EX5A 4JK7A 1VQ7N 4JAXA 3OBYA 3QINA 1FW6A 4FWKA 4I9LA 3CI5A 1TKZA 3V9WA 5LMUK 1T7PA 4O5BA 4BRIA 1S22A 4IG3A 4BC3A 5CZ2A 1TK5A 3NCIA 1NGFA 5KGXA 1VQ9N 3I0RA 3F5TA 3V9SA 1HNIA 5BRFA 3V9ZA 2QWQA 1KVCA 2YNFA 3CCEN 3H1VX 3DMJA 3M8PA 3LP1A 1NK8A 2Q36A 3DXMB 3MMVA 5SWMA 5C2FA 2FSKA 1S1VA 4H0XB 4MDBA 3A8YA 3R8EA 4DFKA 4HUEA 3F2KA 3VQ5A 3QDKA 4DLGA 4KRFA 4MDAA 3EE8A 1K8KB 2O4IA 1HMVA 4KH4A 3AVFA 4JI1K 5EU7A 4B3RK 2JLEA 2O8EB 3JAMO 1CXUA 4AQYK 3SK3A 4O0JA 1BDGA 4O8KA 1KAXA 3SMPA 3PLAA 3QEIA 1KD1O 1X9JA 5F0XA 2OPRA 4DG1A 2E88A 4FLZA 4N56A 1NJXA 1XC9A 3TAFA 1ATRA 3Q7BA 1NOYA 4FSVA 3EYZA 4ISFA 3AVCA 1J9AA 4YOUA 4MQ3A 2BH1A 3E9OA 2W6LA 1YTAA 3ATVA 4JKAA 3EN9A 3B6OA 3AO4A 4DV5K 1K73O 2VG7A 5K14A 3VQQA 4CJEA 4C8OA 2FC0A 1XI1A 4DSKA 4LF4K 2OTLN 3E1YA 4CF8A 4E7IA 2P9LA 3ZX3A 2A3ZA 1XMQK 1WLJA 1SKWA 2HBMA 2X78A 2D4WA 2P9IA 3SQ2A 1FXXA 3T1YK 1TL1A 4KFBA 1Q86O 3HOTA 2CGJA 3SV3A 4J2BA 4W5NA 1IKYA 2D0AA 4QS8A 5C15A 1J5EK 1JJ2M 2P5GA 3WQUA 4NCBA 3ENHA 4CIEA 2YNHA 1VSMA 4F9OA 4DU4A 4AILC 1QSLA 1L5UA 1RT5A 4GVEA 4FL9A 4CJQA 3S41A 1D9DA 1QHTA 2FXUA 4JD2A 4RWTA 3CPWM 1X9MA 2UUBK 4KPYA 4DU3A 4GVMA 4DR6K 4CBUA 1TVRA 4ZTFA 3FZFA 3CJ7A 3VQDA 4JHDB 1BQMA 3C0BA 1RDWX 3AAQA 1OKJA 1U2VA 4M7YA 4BVOA 1U49A 4CJ4A 1YAGA 4OLBA 1N5YA 1NK6A 4H0OA 3EY1A 3L4QA 4BRAA 2P9KA 4DB3A 3OYIA 1L3UA 4FJJA 1EO1A 1L3VA 3T19A 4RW9A 2V7YA 3NGZA 2ASMA 5FPNA 4DMNA 2KQ2A 3KLEA 1VSKA 3LDLA 5LJWA 1QQOA 3KK2A 1W97L 5HP1A 5C0YA 4OKJA 2DTUA 3F9MA 4M3XA 3PUFA 4BRNA 3H6EA 4ILHA 5AQGA 3K57A 3AVNA 3G0ZA 2RN2A 4FPBA 4DR2K 1NK4A 1RT3A 3T7ZA 3M6GA 4DF4A 1YJNN 1BA0A 2KFNA 1BOTO 3KIOA 2E4LA 3ZSYA 3DLBA 5D3GA 3ZT2A 1SL2A 3A5LC 1HYVA 2PYLA 3HOSA 4CHYA 4EZ9A 1XC3A 3SI6A 4DQ8A 1EP4A 3DJCA 3KK3A 5TKWA 1ZBUA 3O9SA 3OW2M 3LDQA 3QBXA 3TSQA 2KW4A 4B1ZA 3O4NA 4Z94A 4A61A 4DWIA 2UUCK 2XY8A 5FRNA 5M1OA 4I2PA 4H03B 4E0DA 4Z4HA 2PFUA 3SUOA 1XQSC 3CERA 3VEOA 3KVGA 1VQMN 1N8RO 2XY5A 4DF8A 4Y1CA 3DAWA 4FM0A 1ZYQA 2G8VA 2P9LB 4I9QA 4LF8K 3HPHA 1MWMA 2P9IB 1XWLA 4JKBA 3PX6A 3VTHA 1OH5A 3UB5A 3VMFB 4OO1J 4PHTX 5C25A 4FJIA 1EXQA 1J54A 1S1UA 3AO1A 1LCUA 3HI0A 1XNQK 1NGCA 2W6KA 2IS3A 1DT9A 2LSNA 2Z1JA 1VQ6N 3NVKA 3IKMA 3SJHA 1HJRA 2NRZA 4CJPA 3DRRA 1D8YA 3CC7N 2F96A 4DR5K 3EEQA 1RNHA 4KTZA 4LF6K 4JD2B 4CZEA 3F73A 3SCXA 3AV9A 5CY4A 2Q31A 4OKEA 3OYCA 3AVIA 1Y64A 3CCSN 1KXPA 5AQJA 4FOEA 2XY7A 3SNNA 5KRSA 3IRXA 4GKKK 1U2VB 3R1XA 4RCHA 3TU5A 4Z4GA 3S3NA 1RBTA 4RW7A 5M1NA 2HHWA 3KD1E 1S1XA 3TAPA 5FROA 4BR9A 5JS1A 4CZGA 3RTVA 2P9KB 4K25A 4B3MK 3SQ4A 3AO5A 3VEWA 2ZD1A 5DMRA 1RCHA 4B9QA 3RRGA 2XRIA 1DKGD 4DS4A 3VQ7A 3L4IA 3EKUA 2W42A 1VQ4N 4C23A 1FKOA 1KSPA 5I42A 2KZMA 3SAFA 3LP0A 3CMEN 1NBWA 3F9KA 1U47A 4JEPA 3THXA 4DCHA 3DLEA 4B9LA 2HNZA 2FLOA 3O6WA 4DQSA 3LPUA 4FWMA 1VRTA 1M90O 2P5OA 2GWJA 3AY9A 4CEAA 3QLHA 3WT0A 2KFZA 1GOBA 1W2BM 3D2FA 3ZLJA 1I39A 3GG4A 4CBWA 1SAZA 1KCFA 2ZM6K 1HLUA 1C1AA 3CFOA 5GAHP 4BC2A 1KFDA 3VPZA 1CZAN 4NXNK 3V9UA 3QB0A 3PV8A 3HBTA 4U7BA 2GWKA 1NG9A 4B1UB 4CVNE 2VWBA 5CZ1A 2HF3A 4KB1A 4FJGA 2HBKA 2A42A 4WF9L 2YJEA 4FJNA 2WC9A 1BI4B 3VF2A 4CEOA 1QVFM 4XIUA 1ATSA 4PL7A 5CR4A 2QTDA 5FRMA 4LY7A 4DV3K 3VA3A 2BDPA 4JKEA 4JLHA 4RTFD 4YDUA 2A40A 3A0IX 3WNHA 2ITMA 5BREA 2IAJA 2P9UA 2RE2A
chains in the Genus database with same CATH topology
4N41A 1A5XA 3KLIA 1CZBA 1BQNA 2ZE2A 3JYTA 3VQAA 1QE1A 2FBTA 4PUOA 2HB5A 3DLKA 4CGFA 1BHLA 1NKBA 3OYEA 1SL0A 1C1CA 4J2AA 4DS5A 4CJ5A 3QEWA 3SPYA 2IC3A 2IOCA 3DRSA 4N5SA 1T8EA 4O44A 4W5RA 1HQEA 3ISNC 5C42A 1S1TA 3LWLA 4IFYA 3OS0A 4GMJB 1TGOA 4CGGA 3HXMA 3PX0A 1QTMA 3CFRA 1WAFA 1S6PA 3FFIA 3VQ6A 3LZJA 4FJHA 2P51A 3V1RA 3LDSA 2YNIA 3ZT4A 4FZXC 1VSLA 4DTSA 2QKKA 2PYJA 4CECA 4Z4CA 3UIQA 3ALYA 3QINA 4JRQA 4E3SA 3SJJA 4I9LA 4NCGA 3M8RA 3E01A 1TKZA 1HPZA 3V9WA 4CJWA 2I5JA 1VSHA 1TKDA 3HL8A 1TV6A 3NHGA 4FM2A 4MFBA 3QEVA 4QCLA 1LW2A 1T7PA 2HHSA 4O5BA 1TL3A 3SUQA 3TI0A 2G8KA 4CEBA 4DFMA 4KB0A 3HSTB 1F21A 4IG3A 3G10A 1RBUA 5CZ2A 4HVJA 3NFAA 3AVKA 3OY9A 3NCIA 5KGXA 3SYZA 4DTPA 1QQCA 4FW2A 4DFPA 3I0RA 1ASUA 1NK5A 4KTWA 3V9SA 1S5JA 1HNIA 3V9ZA 3OYFA 1HYZA 1SKRA 3NH2A 1JL2A 1T05A 5KI6A 1XHZA 1L3TA 1KVCA 2YNFA 4JS4A 3WNGA 3C6TA 3PX4A 1BISA 1C0UA 3DMJA 3M8PA 3O3FA 3LP1A 1NK8A 1VRUA 4B08A 1RT2A 4DLEA 5SWMA 3LAKA 3HT3A 2BDPA 3DLHA 4HCCA 2HHTA 4F3TA 2F8TA 1S1VA 3SUNA 2DY4A 3OYLA 2D5RA 4WE1A 4RG8A 4DFKA 4KHQA 3JSMA 1JXEA 4CK2A 4HUEA 2GBZA 4CHZA 2DFFA 3D0PA 4ELUA 4PQUA 4IBNA 3VQ5A 4DLGA 2E6MA 4KRFA 2O4IA 2HHWA 1HMVA 4DTMA 2OPQA 3AVFA 1LV5A 1JLCA 4CGJA 2PZSA 1LWEA 5EU7A 1IKXA 4I7FA 2JLEA 3PY8A 4E7JA 2VWKA 1CXUA 3OYKA 4QOZB 1SKSA 1FKPA 4O0JA 4M3WA 1XHXA 1VSJA 4CHOA 3S9HA 1O1WA 1J5OA 1RTDA 3HK2A 4Q0BA 4FYDA 4CGHA 3DOLA 3ZSZA 3CQ8A 3QEIA 2WOMA 4FJKA 3TAQA 1UWBA 2OPRA 4DG1A 4FLZA 4JRPA 1C0TA 2BE2A 3BGRA 4OVLA 4N56A 1XC9A 1NJXA 3QEXA 3RWUA 3TAFA 3ZSXA 4CIGA 3SUPA 1NOYA 2WONA 1ZBHA 5JS2A 4DFJA 3EYZA 2ATQA 4PA1A 3ZCMA 4CEEA 2HHQA 4LD0A 3AVCA 3LANA 1J9AA 3HJFA 2KTQA 1RDBA 4MQ3A 3L2RA 1D9FA 3BDPA 3U6FA 1RT6A 1YTAA 4B8CA 4CJLA 5CYQA 3V6DA 1EX4A 5HBMA 4CFAA 3B6OA 3AO4A 1NJYA 2E6LA 1RT1A 2VG7A 2R7YA 4KAZA 4E19A 1LWFA 5K14A 1D5AA 2X6SA 3VQQA 2FC0A 5C24A 4CJEA 3DYAA 3OYBA 4BE1A 1XI1A 4C8OA 4CCHA 4DSKA 3AVHA 3V81A 4FJMA 4M3UA 1ZBIA 3KJVA 3DI6A 1S1WA 4CF8A 1ITGA 3OYAA 4E7IA 4B9UA 2X74A 4W5QA 1WLJA 1SKWA 1S9GA 2X78A 2KZZA 1WSFA 4Z0UA 5HRPA 3ULDA 3SQ2A 1HNVA 1FXXA 1TL1A 1BIZA 4KFBA 4KO0A 4H8KA 3RRHA 3TARA 1UAXA 3P5JA 4AHCA 3SV3A 4CE9A 1ASWA 3KTQA 1IKVA 3AVMA 1IKYA 4J2BA 4W5NA 2D0AA 1JXBA 3VQ4A 1Z25A 2YHBA 3ITHA 1WNSA 4AHRA 1EKEA 3MXIA 4KHSA 3QIOA 1TK0A 1DTTA 2P5GA 3HP6A 1KVAA 1RTHA 3T3FA 4NCBA 4EZ6A 1YTUA 4CIEA 5CYMA 2YNHA 1VSMA 3NAEA 4DU4A 3LWMA 4AILC 1QSLA 4HUGA 1RT5A 1NKEA 1L5UA 4B9TA 4C8KA 1TKXA 3HVRA 3DM2A 3AVAA 4CJQA 1BIUA 3ZSRA 1D9DA 2AJQA 1LAVA 3HM9A 1QHTA 1X9MA 1JLBA 2XY6A 4KPYA 4CF9A 4DU3A 4FJ8A 4GVMA 1I3AA 4L8RB 4IFVA 1S9EA 3DLRA 4M3YA 1TVRA 2B5JA 4ZTFA 4YNQA 4N76A 2ZQBA 1UOCA 3VQDA 4O55A 3NH0A 4NCAA 1WSGA 2OZSA 4K8ZA 1VSEA 3CYMA 3V4IA 2HHVA 1BQMA 3DLGA 4CHQA 1JLFA 1WSIA 2PY5A 2X6NA 4OPJA 4BWJA 3O3GA 3M8QA 3K58A 4RW4A 4FJ5A 3NBPA 4F2RA 2G8IA 4NYFA 3L2VA 1GOCA 1J53A 4CJ4A 1U49A 3AO2A 3H08A 1KLNA 4M3TA 4OLBA 3PO5A 1N5YA 4DQIA 1KRPA 4DTJA 1NK6A 3EY1A 2B4JA 4ELTA 4O4GA 3OYIA 4QAGA 3OVNA 1L3UA 2VWJA 1RT4A 1L3VA 4FJJA 3T19A 2HVHA 3KK1A 3P83D 4CEQA 3MEGA 4ELVA 4RW9A 3VQ8A 2VG6A 3NGZA 2YKMA 2B6AA 4DMNA 2KQ2A 2FBXA 1VSKA 3KLEA 4FLXA 4CJKA 3MEDA 3RMCA 4PWDA 2OZMA 3KK2A 2A1SA 1BGXT 2G8FA 4OPKA 4F4KA 5HP1A 2G8UA 4FZZA 3P1GA 2A1RA 4OKJA 4C8NA 1TK5A 3RR7A 3OYNA 1W9HA 1W0HA 3QIPA 3V1OA 4M3XA 2BGGA 2DTUA 1REVA 2OPSA 3AVJA 3PUFA 1C0MA 4BDPA 1JLGA 3QNOA 4KHWA 4B3OA 2RKIA 5KRTA 3K57A 5J2MA 4RW8A 3AVNA 1QS4A 3G0ZA 2RN2A 4OGCA 2IGIA 3L2WA 1NK4A 1RT3A 2RF2A 4E1NA 4DF4A 3IAYA 4G1QA 4M42A 2ITGA 3QEPA 2OYQA 4FJLA 2KFNA 3AA4A 3KIOA 3NF9A 3VA0A 3HO1A 1Z26A 3PO4A 2E4LA 2YV0X 4CF0A 5J1EA 2P1JA 4DSIA 4KI4A 3ZSYA 4CK1A 3K5OA 3S3OA 3DLBA 3QO9A 1RDCA 4DSLA 5D3GA 1HYSA 2NUBA 4HUFA 4DQRA 4H4MA 3ZT2A 1UA0A 1S6QA 1SL2A 1HYVA 2PYLA 4W5TA 1A5WA 4CHYA 3KD5E 1JLAA 4EZ9A 4YFUA 1RT7A 3SI6A 1EP4A 3KK3A 4DTXA 2FBVA 1RILA 5KGWA 1ZBUA 3NF7A 3D45A 2QK9A 1NOZA 2KW4A 4HTUA 3L3VA 2HMIA 4FJ9A 3O4NA 1TAUA 4EP5A 4DWIA 3NGIA 2XY8A 5FRNA 3MXMA 3L3UA 3CG7A 3SQ0A 2GUIA 4LH5A 3M8SA 3KLFA 1ZBFA 4I2PA 3TAGA 2D0CA 2EHGA 1QSYA 2Q3SA 4CEFA 4E0DA 1VSDA 4Z4HA 4CJFA 1GOAA 1WN7A 4E89A 3SUOA 2G8WA 3TR8A 3KKSA 4CF2A 4DU1A 3V9XA 1N6QA 4FK0A 1JLQA 3LZIA 2QKBA 2O4GA 2OPPA 4B9NA 1X9SA 2HNYA 1RDAA 2XY5A 4ZHRA 4DF8A 5HLFA 3ZSOA 3V1QA 3ZSWA 3VQEA 4Y1CA 4FM0A 1ZYQA 3A2FA 2G8VA 4AHVA 2XHBA 2FBYA 4I9QA 3HPHA 1U04A 3K2PA 4OKKA 1IKWA 1SUQA 4ID1A 3TWHA 3TAMA 3C94A 4R5PA 3TANA 4BE0A 1XWLA 4FLTA 1B9DA 4C8LA 3PX6A 1B92A 3K5MA 1LAWA 1VSIA 1IO2A 4H4OA 3I0SA 4ID5A 4B8AB 4KKOA 2DFEA 5C25A 4DSFA 4FJIA 4J2DA 4E7HA 1EXQA 4E1MA 1J54A 1S1UA 3AO1A 3AVBA 5KTQA 2YNGA 1RDDA 2EX3A 4CJTA 2Z1GA 4KHUA 1LWCA 1RBSA 2IS3A 4KTQA 1JL1A 3ASMA 2LSNA 4LSLA 2Z1JA 1X1PA 4BWMA 4M45A 4FLYA 3K5LA 4KHNA 2RPIA 2YHAA 3HYFA 1DLOA 1BCOA 4UQGA 3MAQA 4M3RA 1HJRA 4CJPA 3RMBA 1G15A 3DRRA 3SPZA 3AVGA 4LH4A 1D8YA 1CLQA 2F96A 4BDZA 1RTIA 4FJ7A 1RNHA 4KTZA 3L2QA 1X9WA 3ZT1A 3F73A 3SCXA 4FW1A 4AHUA 3AV9A 4DQQA 4Z4FA 3EZ5A 4CIFA 5CY4A 1IH7A 2Y1IA 3SQ1A 1BL3A 4OKEA 4K8XA 3CM6A 1JKHA 1RBVA 3OYCA 1CZ9A 3AVIA 3OJUA 4DTNA 1KFSA 3HPOA 4FK4A 1KVBA 2XY7A 1ASVA 3SNNA 4DSJA 1TAQA 3IRXA 5KRSA 4DTRA 4FZYA 3NF8A 3OYJA 3LPTA 3ZT0A 2OA8A 2YKNA 4JS5A 3HPGA 4IG0A 3T1AA 4Z4GA 3S3NA 3NDKA 4CJ3A 4CK3A 1TK8A 1C1BA 1Q8IA 1RBTA 2D0BA 4RW7A 3OS2A 4DTOA 5HRRA 3NGYA 4E7LA 3KD1E 4HCBA 5DK5A 4J2EA 1C6VA 2XO7A 1S1XA 3RR8A 3TAPA 2HHXA 5FROA 4BDYA 3QNNA 4OJRA 1Y97A 4CGDA 4HHTA 2QXFA 3RTVA 1U45A 2G8HA 3OJSA 5JS1A 3KLHA 1RTJA 3LALA 3SQ4A 4CGIA 3TABA 4KI6A 3AO5A 4GW6A 1YVUA 3QETA 3VQCA 1MU2A 3K59A 2HVIA 3C6UA 2ZD1A 3AVLA 5DMRA 5T7BA 3SZ2A 3LP2A 1RCHA 2Z1HA 4KREA 3RRGA 3AA2A 2XRIA 1WAJA 2Y1JA 4KHYA 2GV9A 3K5NA 2HW3A 4DS4A 5J2QA 3VQPA 3O4QA 4BE2A 3VQ7A 1NK0A 3LAMA 4F2SA 3AA3A 2W42A 1HQUA 1BCMA 3DRPA 3I8DA 4FLVA 3THVA 1WSHA 2JGUA 3VN5A 4FJXA 1FKOA 4CFDA 5I42A 1KSPA 2KZMA 3LP0A 3KLGA 5FDLA 3HVTA 4EP4A 1HRHA 4CHNA 3F9KA 1U47A 5E41A 1JLEA 3NF6A 3TAEA 3DLEA 3WNFA 4B9LA 4O0IA 1K6YA 2HNZA 3WNEA 4CJUA 3OYGA 4ZTJA 1VSFA 1B9FA 4DQSA 3AA5X 3LPUA 3LP3A 3B6PA 4NYNA 3ZT3A 4CFCA 4CJSA 1VRTA 4CJVA 4CF1A 2P5OA 4Z4EA 5HROA 1ZBLA 1TKTA 4CEAA 1WSEA 3QLHA 4AHTA 5SZTA 1KTQA 3RMAA 2VG5A 2Z1IA 1GOBA 2KFZA 3CM5A 1I39A 1DTQA 1KLMA 3U3YA 1NJWA 4DQPA 5I3UA 3ZSQA 1KCFA 3MECA 3VQ9A 4PY5A 1C1AA 3OYDA 4B9MA 4CHPA 3CFOA 3SV4A 1NKCA 1SL1A 4Z4IA 1KFDA 1VK0A 2IDOA 3O3HA 4TSXA 3MEEA 3U3GA 3L2UA 3HP9A 4BACA 4DSEA 4F3OA 2F8SA 4KV8A 3V9UA 3QERA 3DOKA 1WSJA 4ICLA 3PV8A 4IDKA 5HRNA 4Q5VA 4AH9A 1BI4A 1Q9XA 4CEZA 4LSNA 3QESA 5CZ1A 3VQBA 3C95A 3CFPA 5J2NA 3AO3A 4KB1A 5J2PA 4FJGA 4W5OA 4M41A 1L3SA 1SV5A 4FJNA 1NJZA 1U48A 1U4BA 1BI4B 4FVMA 3MXJA 3S3MA 4B9VA 2BANA 3OS1A 2DFHA 4CERA 4FXDA 1R0AA 4CEDA 1T03A 1RBRA 1CXQA 1LW0A 4CEOA 3NE6A 1IG9A 3IS9A 4B9SA 4XIUA 4CJRA 4C8MA 4F8RA 1FK9A 2ETJA 5HRSA 1NK9A 5FRMA 4LY7A 3OYHA 3VA3A 1EETA 4CFBA 1UA1A 4FCYA 4JLHA 1YT3A 4N47A 1NK7A 3ZSVA 4FLUA 1Q9YA 4IKFA 4FK2A 4OLAA 1QSSA 1A5VA 2HNDA 4OGEA 4RW6A 4I2QA 3KKRA 4Y1DA 3WNHA 4FM1A 4AHSA 4DTUA 4M3ZA 2IAJA 4FLWA 2HHUA 4CESA 3IG1A 3L8BA 4E7KA 3RMDA 3OYMA 3NH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N41 A;  1A5X A;  3KLI A;  1CZB A;  1BQN A;  2ZE2 A;  3JYT A;  3VQA A;  1QE1 A;  2FBT A;  4PUO A;  2HB5 A;  3DLK A;  4CGF A;  1BHL A;  1NKB A;  3OYE A;  1SL0 A;  1C1C A;  4J2A A;  4DS5 A;  4CJ5 A;  3QEW A;  3SPY A;  2IC3 A;  2IOC A;  3DRS A;  4N5S A;  1T8E A;  4O44 A;  4W5R A;  1HQE A;  3ISN C;  5C42 A;  1S1T A;  3LWL A;  4IFY A;  3OS0 A;  4GMJ B;  1TGO A;  4CGG A;  3HXM A;  3PX0 A;  1QTM A;  3CFR A;  1WAF A;  1S6P A;  3FFI A;  3VQ6 A;  3LZJ A;  4FJH A;  2P51 A;  3V1R A;  3LDS A;  2YNI A;  3ZT4 A;  4FZX C;  1VSL A;  4DTS A;  2QKK A;  2PYJ A;  4CEC A;  4Z4C A;  3UIQ A;  3ALY A;  3QIN A;  4JRQ A;  4E3S A;  3SJJ A;  4I9L A;  4NCG A;  3M8R A;  3E01 A;  1TKZ A;  1HPZ A;  3V9W A;  4CJW A;  2I5J A;  1VSH A;  1TKD A;  3HL8 A;  1TV6 A;  3NHG A;  4FM2 A;  4MFB A;  3QEV A;  4QCL A;  1LW2 A;  1T7P A;  2HHS A;  4O5B A;  1TL3 A;  3SUQ A;  3TI0 A;  2G8K A;  4CEB A;  4DFM A;  4KB0 A;  3HST B;  1F21 A;  4IG3 A;  3G10 A;  1RBU A;  5CZ2 A;  4HVJ A;  3NFA A;  3AVK A;  3OY9 A;  3NCI A;  5KGX A;  3SYZ A;  4DTP A;  1QQC A;  4FW2 A;  4DFP A;  3I0R A;  1ASU A;  1NK5 A;  4KTW A;  3V9S A;  1S5J A;  1HNI A;  3V9Z A;  3OYF A;  1HYZ A;  1SKR A;  3NH2 A;  1JL2 A;  1T05 A;  5KI6 A;  1XHZ A;  1L3T A;  1KVC A;  2YNF A;  4JS4 A;  3WNG A;  3C6T A;  3PX4 A;  1BIS A;  1C0U A;  3DMJ A;  3M8P A;  3O3F A;  3LP1 A;  1NK8 A;  1VRU A;  4B08 A;  1RT2 A;  4DLE A;  5SWM A;  3LAK A;  3HT3 A;  2BDP A;  3DLH A;  4HCC A;  2HHT A;  4F3T A;  2F8T A;  1S1V A;  3SUN A;  2DY4 A;  3OYL A;  2D5R A;  4WE1 A;  4RG8 A;  4DFK A;  4KHQ A;  3JSM A;  1JXE A;  4CK2 A;  4HUE A;  2GBZ A;  4CHZ A;  2DFF A;  3D0P A;  4ELU A;  4PQU A;  4IBN A;  3VQ5 A;  4DLG A;  2E6M A;  4KRF A;  2O4I A;  2HHW A;  1HMV A;  4DTM A;  2OPQ A;  3AVF A;  1LV5 A;  1JLC A;  4CGJ A;  2PZS A;  1LWE A;  5EU7 A;  1IKX A;  4I7F A;  2JLE A;  3PY8 A;  4E7J A;  2VWK A;  1CXU A;  3OYK A;  4QOZ B;  1SKS A;  1FKP A;  4O0J A;  4M3W A;  1XHX A;  1VSJ A;  4CHO A;  3S9H A;  1O1W A;  1J5O A;  1RTD A;  3HK2 A;  4Q0B A;  4FYD A;  4CGH A;  3DOL A;  3ZSZ A;  3CQ8 A;  3QEI A;  2WOM A;  4FJK A;  3TAQ A;  1UWB A;  2OPR A;  4DG1 A;  4FLZ A;  4JRP A;  1C0T A;  2BE2 A;  3BGR A;  4OVL A;  4N56 A;  1XC9 A;  1NJX A;  3QEX A;  3RWU A;  3TAF A;  3ZSX A;  4CIG A;  3SUP A;  1NOY A;  2WON A;  1ZBH A;  5JS2 A;  4DFJ A;  3EYZ A;  2ATQ A;  4PA1 A;  3ZCM A;  4CEE A;  2HHQ A;  4LD0 A;  3AVC A;  3LAN A;  1J9A A;  3HJF A;  2KTQ A;  1RDB A;  4MQ3 A;  3L2R A;  1D9F A;  3BDP A;  3U6F A;  1RT6 A;  1YTA A;  4B8C A;  4CJL A;  5CYQ A;  3V6D A;  1EX4 A;  5HBM A;  4CFA A;  3B6O A;  3AO4 A;  1NJY A;  2E6L A;  1RT1 A;  2VG7 A;  2R7Y A;  4KAZ A;  4E19 A;  1LWF A;  5K14 A;  1D5A A;  2X6S A;  3VQQ A;  2FC0 A;  5C24 A;  4CJE A;  3DYA A;  3OYB A;  4BE1 A;  1XI1 A;  4C8O A;  4CCH A;  4DSK A;  3AVH A;  3V81 A;  4FJM A;  4M3U A;  1ZBI A;  3KJV A;  3DI6 A;  1S1W A;  4CF8 A;  1ITG A;  3OYA A;  4E7I A;  4B9U A;  2X74 A;  4W5Q A;  1WLJ A;  1SKW A;  1S9G A;  2X78 A;  2KZZ A;  1WSF A;  4Z0U A;  5HRP A;  3ULD A;  3SQ2 A;  1HNV A;  1FXX A;  1TL1 A;  1BIZ A;  4KFB A;  4KO0 A;  4H8K A;  3RRH A;  3TAR A;  1UAX A;  3P5J A;  4AHC A;  3SV3 A;  4CE9 A;  1ASW A;  3KTQ A;  1IKV A;  3AVM A;  1IKY A;  4J2B A;  4W5N A;  2D0A A;  1JXB A;  3VQ4 A;  1Z25 A;  2YHB A;  3ITH A;  1WNS A;  4AHR A;  1EKE A;  3MXI A;  4KHS A;  3QIO A;  1TK0 A;  1DTT A;  2P5G A;  3HP6 A;  1KVA A;  1RTH A;  3T3F A;  4NCB A;  4EZ6 A;  1YTU A;  4CIE A;  5CYM A;  2YNH A;  1VSM A;  3NAE A;  4DU4 A;  3LWM A;  4AIL C;  1QSL A;  4HUG A;  1RT5 A;  1NKE A;  1L5U A;  4B9T A;  4C8K A;  1TKX A;  3HVR A;  3DM2 A;  3AVA A;  4CJQ A;  1BIU A;  3ZSR A;  1D9D A;  2AJQ A;  1LAV A;  3HM9 A;  1QHT A;  1X9M A;  1JLB A;  2XY6 A;  4KPY A;  4CF9 A;  4DU3 A;  4FJ8 A;  4GVM A;  1I3A A;  4L8R B;  4IFV A;  1S9E A;  3DLR A;  4M3Y A;  1TVR A;  2B5J A;  4ZTF A;  4YNQ A;  4N76 A;  2ZQB A;  1UOC A;  3VQD A;  4O55 A;  3NH0 A;  4NCA A;  1WSG A;  2OZS A;  4K8Z A;  1VSE A;  3CYM A;  3V4I A;  2HHV A;  1BQM A;  3DLG A;  4CHQ A;  1JLF A;  1WSI A;  2PY5 A;  2X6N A;  4OPJ A;  4BWJ A;  3O3G A;  3M8Q A;  3K58 A;  4RW4 A;  4FJ5 A;  3NBP A;  4F2R A;  2G8I A;  4NYF A;  3L2V A;  1GOC A;  1J53 A;  4CJ4 A;  1U49 A;  3AO2 A;  3H08 A;  1KLN A;  4M3T A;  4OLB A;  3PO5 A;  1N5Y A;  4DQI A;  1KRP A;  4DTJ A;  1NK6 A;  3EY1 A;  2B4J A;  4ELT A;  4O4G A;  3OYI A;  4QAG A;  3OVN A;  1L3U A;  2VWJ A;  1RT4 A;  1L3V A;  4FJJ A;  3T19 A;  2HVH A;  3KK1 A;  3P83 D;  4CEQ A;  3MEG A;  4ELV A;  4RW9 A;  3VQ8 A;  2VG6 A;  3NGZ A;  2YKM A;  2B6A A;  4DMN A;  2KQ2 A;  2FBX A;  1VSK A;  3KLE A;  4FLX A;  4CJK A;  3MED A;  3RMC A;  4PWD A;  2OZM A;  3KK2 A;  2A1S A;  1BGX T;  2G8F A;  4OPK A;  4F4K A;  5HP1 A;  2G8U A;  4FZZ A;  3P1G A;  2A1R A;  4OKJ A;  4C8N A;  1TK5 A;  3RR7 A;  3OYN A;  1W9H A;  1W0H A;  3QIP A;  3V1O A;  4M3X A;  2BGG A;  2DTU A;  1REV A;  2OPS A;  3AVJ A;  3PUF A;  1C0M A;  4BDP A;  1JLG A;  3QNO A;  4KHW A;  4B3O A;  2RKI A;  5KRT A;  3K57 A;  5J2M A;  4RW8 A;  3AVN A;  1QS4 A;  3G0Z A;  2RN2 A;  4OGC A;  2IGI A;  3L2W A;  1NK4 A;  1RT3 A;  2RF2 A;  4E1N A;  4DF4 A;  3IAY A;  4G1Q A;  4M42 A;  2ITG A;  3QEP A;  2OYQ A;  4FJL A;  2KFN A;  3AA4 A;  3KIO A;  3NF9 A;  3VA0 A;  3HO1 A;  1Z26 A;  3PO4 A;  2E4L A;  2YV0 X;  4CF0 A;  5J1E A;  2P1J A;  4DSI A;  4KI4 A;  3ZSY A;  4CK1 A;  3K5O A;  3S3O A;  3DLB A;  3QO9 A;  1RDC A;  4DSL A;  5D3G A;  1HYS A;  2NUB A;  4HUF A;  4DQR A;  4H4M A;  3ZT2 A;  1UA0 A;  1S6Q A;  1SL2 A;  1HYV A;  2PYL A;  4W5T A;  1A5W A;  4CHY A;  3KD5 E;  1JLA A;  4EZ9 A;  4YFU A;  1RT7 A;  3SI6 A;  1EP4 A;  3KK3 A;  4DTX A;  2FBV A;  1RIL A;  5KGW A;  1ZBU A;  3NF7 A;  3D45 A;  2QK9 A;  1NOZ A;  2KW4 A;  4HTU A;  3L3V A;  2HMI A;  4FJ9 A;  3O4N A;  1TAU A;  4EP5 A;  4DWI A;  3NGI A;  2XY8 A;  5FRN A;  3MXM A;  3L3U A;  3CG7 A;  3SQ0 A;  2GUI A;  4LH5 A;  3M8S A;  3KLF A;  1ZBF A;  4I2P A;  3TAG A;  2D0C A;  2EHG A;  1QSY A;  2Q3S A;  4CEF A;  4E0D A;  1VSD A;  4Z4H A;  4CJF A;  1GOA A;  1WN7 A;  4E89 A;  3SUO A;  2G8W A;  3TR8 A;  3KKS A;  4CF2 A;  4DU1 A;  3V9X A;  1N6Q A;  4FK0 A;  1JLQ A;  3LZI A;  2QKB A;  2O4G A;  2OPP A;  4B9N A;  1X9S A;  2HNY A;  1RDA A;  2XY5 A;  4ZHR A;  4DF8 A;  5HLF A;  3ZSO A;  3V1Q A;  3ZSW A;  3VQE A;  4Y1C A;  4FM0 A;  1ZYQ A;  3A2F A;  2G8V A;  4AHV A;  2XHB A;  2FBY A;  4I9Q A;  3HPH A;  1U04 A;  3K2P A;  4OKK A;  1IKW A;  1SUQ A;  4ID1 A;  3TWH A;  3TAM A;  3C94 A;  4R5P A;  3TAN A;  4BE0 A;  1XWL A;  4FLT A;  1B9D A;  4C8L A;  3PX6 A;  1B92 A;  3K5M A;  1LAW A;  1VSI A;  1IO2 A;  4H4O A;  3I0S A;  4ID5 A;  4B8A B;  4KKO A;  2DFE A;  5C25 A;  4DSF A;  4FJI A;  4J2D A;  4E7H A;  1EXQ A;  4E1M A;  1J54 A;  1S1U A;  3AO1 A;  3AVB A;  5KTQ A;  2YNG A;  1RDD A;  2EX3 A;  4CJT A;  2Z1G A;  4KHU A;  1LWC A;  1RBS A;  2IS3 A;  4KTQ A;  1JL1 A;  3ASM A;  2LSN A;  4LSL A;  2Z1J A;  1X1P A;  4BWM A;  4M45 A;  4FLY A;  3K5L A;  4KHN A;  2RPI A;  2YHA A;  3HYF A;  1DLO A;  1BCO A;  4UQG A;  3MAQ A;  4M3R A;  1HJR A;  4CJP A;  3RMB A;  1G15 A;  3DRR A;  3SPZ A;  3AVG A;  4LH4 A;  1D8Y A;  1CLQ A;  2F96 A;  4BDZ A;  1RTI A;  4FJ7 A;  1RNH A;  4KTZ A;  3L2Q A;  1X9W A;  3ZT1 A;  3F73 A;  3SCX A;  4FW1 A;  4AHU A;  3AV9 A;  4DQQ A;  4Z4F A;  3EZ5 A;  4CIF A;  5CY4 A;  1IH7 A;  2Y1I A;  3SQ1 A;  1BL3 A;  4OKE A;  4K8X A;  3CM6 A;  1JKH A;  1RBV A;  3OYC A;  1CZ9 A;  3AVI A;  3OJU A;  4DTN A;  1KFS A;  3HPO A;  4FK4 A;  1KVB A;  2XY7 A;  1ASV A;  3SNN A;  4DSJ A;  1TAQ A;  3IRX A;  5KRS A;  4DTR A;  4FZY A;  3NF8 A;  3OYJ A;  3LPT A;  3ZT0 A;  2OA8 A;  2YKN A;  4JS5 A;  3HPG A;  4IG0 A;  3T1A A;  4Z4G A;  3S3N A;  3NDK A;  4CJ3 A;  4CK3 A;  1TK8 A;  1C1B A;  1Q8I A;  1RBT A;  2D0B A;  4RW7 A;  3OS2 A;  4DTO A;  5HRR A;  3NGY A;  4E7L A;  3KD1 E;  4HCB A;  5DK5 A;  4J2E A;  1C6V A;  2XO7 A;  1S1X A;  3RR8 A;  3TAP A;  2HHX A;  5FRO A;  4BDY A;  3QNN A;  4OJR A;  1Y97 A;  4CGD A;  4HHT A;  2QXF A;  3RTV A;  1U45 A;  2G8H A;  3OJS A;  5JS1 A;  3KLH A;  1RTJ A;  3LAL A;  3SQ4 A;  4CGI A;  3TAB A;  4KI6 A;  3AO5 A;  4GW6 A;  1YVU A;  3QET A;  3VQC A;  1MU2 A;  3K59 A;  2HVI A;  3C6U A;  2ZD1 A;  3AVL A;  5DMR A;  5T7B A;  3SZ2 A;  3LP2 A;  1RCH A;  2Z1H A;  4KRE A;  3RRG A;  3AA2 A;  2XRI A;  1WAJ A;  2Y1J A;  4KHY A;  2GV9 A;  3K5N A;  2HW3 A;  4DS4 A;  5J2Q A;  3VQP A;  3O4Q A;  4BE2 A;  3VQ7 A;  1NK0 A;  3LAM A;  4F2S A;  3AA3 A;  2W42 A;  1HQU A;  1BCM A;  3DRP A;  3I8D A;  4FLV A;  3THV A;  1WSH A;  2JGU A;  3VN5 A;  4FJX A;  1FKO A;  4CFD A;  5I42 A;  1KSP A;  2KZM A;  3LP0 A;  3KLG A;  5FDL A;  3HVT A;  4EP4 A;  1HRH A;  4CHN A;  3F9K A;  1U47 A;  5E41 A;  1JLE A;  3NF6 A;  3TAE A;  3DLE A;  3WNF A;  4B9L A;  4O0I A;  1K6Y A;  2HNZ A;  3WNE A;  4CJU A;  3OYG A;  4ZTJ A;  1VSF A;  1B9F A;  4DQS A;  3AA5 X;  3LPU A;  3LP3 A;  3B6P A;  4NYN A;  3ZT3 A;  4CFC A;  4CJS A;  1VRT A;  4CJV A;  4CF1 A;  2P5O A;  4Z4E A;  5HRO A;  1ZBL A;  1TKT A;  4CEA A;  1WSE A;  3QLH A;  4AHT A;  5SZT A;  1KTQ A;  3RMA A;  2VG5 A;  2Z1I A;  1GOB A;  2KFZ A;  3CM5 A;  1I39 A;  1DTQ A;  1KLM A;  3U3Y A;  1NJW A;  4DQP A;  5I3U A;  3ZSQ A;  1KCF A;  3MEC A;  3VQ9 A;  4PY5 A;  1C1A A;  3OYD A;  4B9M A;  4CHP A;  3CFO A;  3SV4 A;  1NKC A;  1SL1 A;  4Z4I A;  1KFD A;  1VK0 A;  2IDO A;  3O3H A;  4TSX A;  3MEE A;  3U3G A;  3L2U A;  3HP9 A;  4BAC A;  4DSE A;  4F3O A;  2F8S A;  4KV8 A;  3V9U A;  3QER A;  3DOK A;  1WSJ A;  4ICL A;  3PV8 A;  4IDK A;  5HRN A;  4Q5V A;  4AH9 A;  1BI4 A;  1Q9X A;  4CEZ A;  4LSN A;  3QES A;  5CZ1 A;  3VQB A;  3C95 A;  3CFP A;  5J2N A;  3AO3 A;  4KB1 A;  5J2P A;  4FJG A;  4W5O A;  4M41 A;  1L3S A;  1SV5 A;  4FJN A;  1NJZ A;  1U48 A;  1U4B A;  1BI4 B;  4FVM A;  3MXJ A;  3S3M A;  4B9V A;  2BAN A;  3OS1 A;  2DFH A;  4CER A;  4FXD A;  1R0A A;  4CED A;  1T03 A;  1RBR A;  1CXQ A;  1LW0 A;  4CEO A;  3NE6 A;  1IG9 A;  3IS9 A;  4B9S A;  4XIU A;  4CJR A;  4C8M A;  4F8R A;  1FK9 A;  2ETJ A;  5HRS A;  1NK9 A;  5FRM A;  4LY7 A;  3OYH A;  3VA3 A;  1EET A;  4CFB A;  1UA1 A;  4FCY A;  4JLH A;  1YT3 A;  4N47 A;  1NK7 A;  3ZSV A;  4FLU A;  1Q9Y A;  4IKF A;  4FK2 A;  4OLA A;  1QSS A;  1A5V A;  2HND A;  4OGE A;  4RW6 A;  4I2Q A;  3KKR A;  4Y1D A;  3WNH A;  4FM1 A;  4AHS A;  4DTU A;  4M3Z A;  2IAJ A;  4FLW A;  2HHU A;  4CES A;  3IG1 A;  3L8B A;  4E7K A;  3RMD A;  3OYM A;  3NH1 A; 
#chains in the Genus database with same CATH topology
 3EZW A;  4N41 A;  1BQN A;  3VQA A;  2ZJR L;  3E9L A;  4MO5 A;  1BHL A;  1NGD A;  4BRG A;  1HJO A;  1C1C A;  3J80 O;  1WUA A;  1HQE A;  3ISN C;  1S1T A;  2E2O A;  3HXM A;  1QTM A;  2ASP A;  3CFR A;  1WAF A;  4FJH A;  4DHY A;  2P51 A;  1TYQ A;  2YNI A;  3ZT4 A;  4DTS A;  2QKK A;  3CCR N;  4ILG B;  2IIR A;  4IJA A;  4Z4C A;  5BN9 A;  3ALY A;  4E3S A;  4JRQ A;  1VQL N;  3SJJ A;  1ZC6 A;  2WBN A;  4FWQ A;  5E84 A;  1TV6 A;  3NHG A;  4JI5 K;  4MFB A;  4QCL A;  1LW2 A;  3CD6 N;  3A5M C;  3TI0 A;  4DFM A;  4KB0 A;  5AQS A;  3SAG A;  3OY9 A;  1HX1 A;  3NFA A;  3A5O C;  3BF3 A;  1NK5 A;  1QQC A;  4KTW A;  1S5J A;  3HZ6 A;  4CI6 A;  1JL2 A;  3MK6 A;  1T05 A;  3OTO K;  1L3T A;  3PX4 A;  3JXU A;  4YOY A;  3MN5 A;  3NVM A;  4B08 A;  3HT3 A;  3DLH A;  4KH6 A;  3SUN A;  2DY4 A;  3OYL A;  5JVH L;  3FLC O;  5C2D A;  4KHQ A;  1OH6 A;  4M63 C;  1G99 A;  4IBN A;  3O9Q A;  2WTU A;  5KQ8 A;  4BR2 A;  3OBW A;  2OPQ A;  1LV5 A;  4CGJ A;  1JCE A;  4I7F A;  2W40 A;  3THX B;  3PY8 A;  2VWK A;  1SZ2 A;  4CZH A;  1SKS A;  1NGG A;  1J5O A;  4M3W A;  3S9H A;  4FYD A;  3NMU A;  4CGH A;  3DOL A;  3FZM A;  3ZSZ A;  2WOM A;  3TAQ A;  3I8B A;  3WUH A;  4DR1 K;  4JRP A;  5C10 A;  3QEX A;  3ZSX A;  4CIG A;  3D2F B;  2WON A;  1ZBH A;  4DFJ A;  4PA1 A;  3LAN A;  3L2R A;  4G9Z A;  2UYT A;  1RT6 A;  4CJL A;  3J7Y P;  2JWK A;  3KHY A;  3THW B;  2R7Y A;  4KAZ A;  4E19 A;  3RSE A;  2UXC K;  1D5A A;  3OYB A;  3V81 A;  3P31 A;  5AQY A;  3KJV A;  4H0T B;  3DI6 A;  1S1W A;  4DV2 K;  4B9U A;  1NNE A;  2ZWH A;  3MX2 A;  1S9G A;  4Z0U A;  5HRP A;  5TKY A;  2HHH K;  3EE9 A;  1E3M A;  2I7P A;  4H8K A;  4AHC A;  3KTQ A;  1QZ5 A;  1JXB A;  4K0K K;  3MWT A;  4QS9 A;  4C1N I;  4AHR A;  1WNS A;  4X64 K;  3MXI A;  1TK0 A;  1M1K O;  1DTT A;  3HP6 A;  1RTH A;  3T3F A;  4BRH A;  4WCE L;  3NAE A;  3LWM A;  5KPZ A;  1TKX A;  3DM2 A;  1SQK A;  3AVA A;  4NLC A;  3HSC A;  1MWK A;  1JLB A;  4JHD A;  4FJ8 A;  4L8R B;  2VGN A;  4IFV A;  3DLR A;  4Y0W A;  2B5J A;  3NH0 A;  2OZS A;  4K8Z A;  1VSE A;  2HHV A;  4JI8 K;  3QML A;  1JLF A;  2I7N A;  1NGA A;  1NGE A;  1TYQ B;  4OPJ A;  2GUP A;  3O3G A;  3K58 A;  4FJ5 A;  2BUP A;  2G8I A;  2O8C A;  1GOC A;  1J53 A;  1KLN A;  1KRP A;  2FSJ A;  3D6R A;  2E1Z A;  5BRD A;  4O4G A;  2H3G X;  2VWJ A;  3VF4 A;  3KWG A;  4L3Q A;  4ELV A;  2NRT A;  3QFP A;  4DR4 K;  2YKM A;  2FBX A;  4FLX A;  2YCH A;  3O9U A;  2P9S B;  4LFC K;  2YJF A;  4JKC A;  1YF5 L;  2G8U A;  3P1G A;  4C8N A;  1W9H A;  4BR4 A;  3AVJ A;  4PKG A;  5AQN A;  3FFK B;  1HNX K;  1NM1 A;  1BO5 O;  2RKI A;  5J2M A;  4RW8 A;  1QS4 A;  1VHX A;  2E1Y A;  5I9E B;  3L2W A;  5DM6 L;  4E1N A;  2F4V K;  4YY3 K;  3VA0 A;  3HO1 A;  3PO4 A;  2YV0 X;  4CF0 A;  1E4G T;  2VCP A;  4M7X A;  3S3O A;  3K5O A;  4DSL A;  3QO9 A;  1RDC A;  3PSF A;  4HUF A;  1QQN A;  4H4M A;  4NLB A;  4DQR A;  5F1X A;  1Q82 O;  3R3L A;  1RT7 A;  4BG9 A;  2FBV A;  1RIL A;  1NJI O;  3NF7 A;  3D45 A;  1NOZ A;  4HTU A;  3VF6 A;  4FJ9 A;  3G71 N;  3CCJ N;  3DLL L;  4CZK A;  2UUA K;  2HST A;  3L3U A;  3SQ0 A;  1KC8 O;  2GUI A;  4CD1 A;  1QSY A;  1WOQ A;  4CEF A;  1WN7 A;  3HTV A;  3KKS A;  4JKF A;  4DU1 A;  4FK0 A;  3RSE B;  3KZB A;  4H5N A;  1Q7Y O;  2OPP A;  5B8H A;  2HNY A;  1RDA A;  5AZJ B;  4ZHR A;  4LF5 K;  3ZSO A;  3CQY A;  3L0Q A;  3E9P A;  4XH1 A;  3HRG A;  1IKW A;  1SUQ A;  3TWH A;  5FPM A;  4R5P A;  4BE0 A;  1B9D A;  1IBL K;  4C8L A;  3O4W A;  3W3D A;  3K5M A;  3QIC A;  2UU9 K;  4H4O A;  4B8A B;  4J2D A;  4DSF A;  4H5R A;  4E7H A;  3SBT A;  2YNG A;  2EX3 A;  2Z1G A;  4KHU A;  4JI2 K;  1RBS A;  1J6Z A;  1JL1 A;  3ASM A;  4KTQ A;  4DR7 K;  4KHN A;  2RPI A;  3HYF A;  1DLO A;  4UQG A;  4JV5 K;  3SPZ A;  1BU6 O;  2J4R A;  4BDZ A;  1RTI A;  3L2Q A;  1YHQ N;  1X9W A;  4CIF A;  1WB9 A;  1HR0 K;  5BR8 K;  2Y1I A;  3AGR A;  4JI3 K;  5AQV A;  3SQ1 A;  1BL3 A;  1JKH A;  2F9T A;  3OJU A;  1KFS A;  1ASV A;  3FE1 A;  4EHT A;  3C7N A;  3LPT A;  3ZT0 A;  4O8U A;  2OA8 A;  4JI0 K;  4MLH A;  4GV9 A;  2QWM A;  1OVY A;  3HPG A;  2YHX A;  2BTF A;  2O8C B;  1TUU A;  1TK8 A;  4CK3 A;  1Q8I A;  4PKI A;  2F9W A;  4E7L A;  4J2E A;  2HHX A;  5AQK A;  2XO7 A;  4WQ4 C;  3CCV N;  4BDY A;  3QNN A;  4CGD A;  1Y97 A;  4HHT A;  2G8H A;  2QXF A;  5AJ3 K;  1U45 A;  2OCE A;  3OJS A;  3KLH A;  2D0P A;  3BZK A;  2ZGY A;  3TAB A;  1VQO N;  3EO3 A;  4KI6 A;  3QET A;  3VQC A;  1YIJ N;  3C6U A;  5T7B A;  3SZ2 A;  3I33 A;  4CZJ A;  4HWI A;  5J2Q A;  4F2S A;  3LAM A;  3N4Q A;  3AA3 A;  5HL7 L;  2WFB A;  4M3U A;  4FLV A;  2JGU A;  4FWR A;  3OA9 A;  5M1F A;  2NRR A;  3BZC A;  4BVP A;  1HUX A;  5JVG L;  1B9F A;  4DTX A;  3LP3 A;  3B6P A;  3ZT3 A;  4CFC A;  4CJV A;  2UXB K;  1VQ8 N;  2KHO A;  4CZI A;  1WSE A;  5H1S Q;  4DUZ K;  1DTQ A;  1S3X A;  1KLM A;  5AQH A;  1NJW A;  1OVQ A;  3MEC A;  3OYD A;  4BR5 A;  4B9M A;  4CHP A;  4UY8 O;  4B1X B;  1NMD A;  2IDO A;  3O3H A;  4TSX A;  3U3G A;  3AGK A;  3VGK A;  4EHU A;  3L2U A;  4F3O A;  4ILJ A;  4ICL A;  3VET A;  5HRN A;  3CF5 L;  1BI4 A;  3MCP A;  3ID8 A;  5J2N A;  4NO7 A;  1HKC A;  2YI1 A;  5J2P A;  2HBL A;  5EY4 A;  4H5W A;  3FZL A;  2W41 A;  1NJZ A;  1U48 A;  2O8F A;  3OS1 A;  4FOI A;  2OAN A;  1RBR A;  4KH5 A;  3TSP A;  1IG9 A;  2Q97 A;  3IS9 A;  4BGA A;  4C8M A;  4F8R A;  2ETJ A;  5HRS A;  5AZI A;  3OYH A;  1VAZ A;  1EET A;  4CFB A;  1UA1 A;  4FCY A;  3ZEU A;  3ZSV A;  2FF6 A;  4FLU A;  1Q9Y A;  4IKF A;  3RWU A;  2HND A;  3TAG A;  4DTU A;  3KKR A;  5HOO A;  4YOW A;  4AHS A;  4FLW A;  4CES A;  4QS7 A;  4R79 A;  3NH1 A;  1CZB A;  3T69 A;  2ZE2 A;  4H5T A;  3JYT A;  3VER A;  5JIC A;  4PUO A;  3L6Q A;  4CGF A;  1NKB A;  4LFA K;  3PIO L;  4J2A A;  2EWS A;  3O8M A;  5GAG P;  4N5S A;  2FF3 B;  3VEZ A;  4W5R A;  5C42 A;  4GMJ B;  1TGO A;  3PX0 A;  1OH7 A;  5CE3 A;  3VQ6 A;  3V1R A;  3LDS A;  4BRF A;  4FZX C;  1NGH A;  2AA4 A;  2QXL A;  3UIQ A;  4MLE A;  4NCG A;  3M8R A;  4BGB A;  3MN7 A;  1HPZ A;  2VGM A;  4LC9 B;  2I5J A;  3C7N B;  3J7A P;  3QEV A;  3D2E A;  5LJV A;  3SUQ A;  2OTJ N;  1F21 A;  2P9N B;  3AVK A;  3SYZ A;  4CW7 B;  4DTP A;  5KPR A;  4FW2 A;  4AF1 A;  4DFP A;  3K0S A;  4PL8 A;  1QVG M;  4JI4 K;  1IBM K;  1HYZ A;  1SKR A;  1IV0 A;  2YX6 A;  4FWL A;  5KI6 A;  3UKU A;  1VQN N;  3VEV A;  2E5L K;  3WNG A;  3C6T A;  1BIS A;  3O3F A;  5M1Q A;  1VRU A;  4HCC A;  1NU0 A;  2HHT A;  2F8T A;  5LMN K;  5EOY A;  2D5R A;  2CGL A;  4WE1 A;  4RG8 A;  3JSM A;  1JXE A;  2GBZ A;  3CMA N;  4IFE A;  2DFF A;  4CHZ A;  3D0P A;  3THY A;  4ELU A;  4PQU A;  2E6M A;  1E4F T;  5BPL A;  4DR3 K;  1JLC A;  4BY9 C;  2PZS A;  1K9M O;  1IKX A;  4BG8 A;  4E7J A;  3OYK A;  4Q0B A;  3AAP A;  3HK2 A;  3LM9 A;  3VES A;  4WQ4 A;  2Q0U A;  3K9K A;  3GL1 A;  1C0T A;  3BGR A;  4DV6 K;  5AFU H;  5EXW A;  4CEE A;  3THW A;  2O8D A;  2KTQ A;  1RDB A;  1HNZ K;  1D9F A;  3O1B A;  3ULE A;  3BDP A;  3U6F A;  1V4S A;  5CYQ A;  1NJY A;  2E6L A;  1RT1 A;  3FR0 A;  1MA9 B;  1LWF A;  2QKB A;  2X6S A;  5C24 A;  4BE1 A;  1ZBI A;  4FJM A;  4CCH A;  3AVH A;  2QWL A;  1HKG A;  4WFN L;  1ITG A;  5AQP A;  2NRX A;  2O8F B;  2KZZ A;  3WXI A;  3ULD A;  4CE9 A;  3AVM A;  1VQ5 N;  5AZI B;  2YHB A;  3ITH A;  3ZEU B;  3CQX A;  1YTU A;  2CGK A;  5CYM A;  3RVC A;  3G6E N;  3CJA A;  3QFU A;  3HVR A;  5AFU A;  4JYA K;  5JMV A;  2AJQ A;  3VEN A;  1LAV A;  3HM9 A;  4H0Y B;  5AQU A;  2XY6 A;  2IVN A;  1I3A A;  2E2Q A;  2A6A A;  5E26 A;  4NXM K;  4YNQ A;  3R9P A;  3O9R A;  4N76 A;  2ZQB A;  4O55 A;  2CH6 A;  1WSG A;  1X3N A;  3CYM A;  5LY3 A;  2WUS A;  3DLG A;  4CHQ A;  1QHA A;  1GLE G;  3CCL N;  1N34 K;  1WSI A;  4BRL A;  4RW4 A;  4F2R A;  4FO0 A;  4NYF A;  3L2V A;  3AO2 A;  4M3T A;  4DQI A;  2IVO A;  3U9Z A;  5JLH A;  1MDU B;  4ELT A;  3KWI A;  2NNW A;  3OVN A;  1RT4 A;  3D2E B;  2P9S A;  4J8F A;  3P83 D;  4IOX A;  2VG6 A;  4JKG A;  2B6A A;  4B1Y B;  1IBK K;  4GY2 B;  4WFA L;  2HBJ A;  3UKU B;  2A1S A;  1BGX T;  2Q2R A;  5BPM A;  3MDQ A;  3H46 O;  1I94 K;  2A1R A;  3RR7 A;  2AP1 A;  3OYN A;  2BGG A;  1REV A;  2OPS A;  4A2B A;  1C0M A;  1XMO K;  3IUC A;  2NZT A;  4B3O A;  5KRT A;  3THY B;  2IGI A;  4IWV A;  2RF2 A;  3IAY A;  4G1Q A;  2O8B A;  2ITG A;  4FJL A;  4GNI A;  3U4L A;  4A59 A;  1Z26 A;  5J1E A;  4DSI A;  2P1J A;  1GLF O;  4KI4 A;  2NUB A;  3A5N C;  1S6Q A;  1UA0 A;  4W5T A;  4B1W B;  1JLA A;  4YFU A;  4K41 A;  2E2N A;  5KGW A;  4CZF A;  3DWL A;  2E8A A;  2QK9 A;  4JK8 A;  4H5V A;  1NGJ A;  2O8D B;  1TAU A;  3PIP L;  4EP5 A;  5AQQ A;  3NGI A;  3ULE B;  5AZJ A;  4LH5 A;  3KLF A;  1ZBF A;  2D0C A;  2Q3S A;  4I6M A;  4IO8 A;  1GOA A;  2UXD K;  2G8W A;  3TR8 A;  4FWN A;  4B1V A;  4XEI A;  4CF2 A;  3G4S N;  3V9X A;  1N6Q A;  1JLQ A;  3LZI A;  4EIA A;  2O4G A;  3BF1 A;  1SS6 A;  5HLF A;  3ZSW A;  3O80 A;  3IMX A;  5FLX O;  3A2F A;  4KHP K;  2XHB A;  3WXL A;  2FBY A;  2NRV A;  1ATN A;  4GKJ K;  3K2P A;  4OKK A;  1T3V A;  1D4X A;  5GAD P;  3C94 A;  5KPT A;  3M3Z A;  4XH5 A;  1B92 A;  1LAW A;  1IO2 A;  4ID5 A;  3MN6 A;  4OX9 K;  3CJ1 A;  4FJK A;  4E1M A;  5KTQ A;  3AVB A;  5AQZ A;  4C1N K;  4CJT A;  3O9T A;  4NB4 A;  1LWC A;  4LSL A;  4BWM A;  4JNE A;  1X1P A;  2JWL A;  4M45 A;  3MAQ A;  4V19 S;  3RMB A;  1CLQ A;  3AVG A;  3CPE A;  5M1P A;  3ZT1 A;  1P8Z A;  4DQQ A;  4DUY K;  3DXK A;  4Z4F A;  3EZ5 A;  4GV3 A;  3UKR B;  3GBT A;  3TSU A;  1CZ9 A;  1W7A A;  2QM1 A;  3HPO A;  1KVB A;  2NRW A;  4LF7 K;  5AQW A;  1TAQ A;  4DTR A;  4JS5 A;  3T1A A;  3H1Q A;  1N36 K;  4BR7 A;  3NDK A;  5HRR A;  3NGY A;  5DK5 A;  3RR8 A;  4DV0 K;  4OJR A;  4DV4 K;  3UE5 A;  3K9J A;  4BRE A;  3WXM B;  4CBX A;  3FZH A;  4CGI A;  1DEJ A;  4IEE A;  3LP2 A;  4JKG B;  4BQZ A;  2Z1H A;  1LOT B;  1RDU A;  4KRE A;  3SAH A;  1WAJ A;  1YIT N;  4KHY A;  2GV9 A;  5AQF A;  1RGI A;  3VQP A;  2RHK A;  1HPM A;  3ENB A;  1NK0 A;  1WBD A;  1HQU A;  3DRP A;  3I8D A;  1WSH A;  4CFD A;  1BA1 A;  4B3T K;  3KLG A;  5FDL A;  3HVT A;  5M1K A;  4CHN A;  5E41 A;  3VTI A;  4CZL A;  4O0I A;  1K6Y A;  1FJG K;  4CJU A;  2QW9 A;  4NYN A;  4HUG A;  4CJS A;  4CF1 A;  2O8B B;  5FPD A;  5HRO A;  1TKT A;  4AHT A;  5A2Q O;  2VG5 A;  3VEX A;  3U3Y A;  4DQP A;  3ZSQ A;  3ATU A;  3VQ9 A;  2GEL A;  4LFB K;  1NKC A;  3SV4 A;  1SL1 A;  2ZJP L;  3MEE A;  1EQY A;  4EAH D;  3QER A;  5LL6 Z;  3DOK A;  1WSJ A;  4Q5V A;  1OH8 A;  1Q18 A;  1Q9X A;  4JKD A;  2D0O A;  3SBG A;  1T6D A;  4BRP A;  3CFP A;  3IFR A;  4M41 A;  5AQT A;  4BRQ A;  4A5B A;  1JCG A;  3H3N O;  1L3S A;  4I6M B;  3ENO A;  3CHW A;  3MXJ A;  1QZ6 A;  2DFH A;  4JI6 K;  4CER A;  4FXD A;  3EL2 A;  3WQT A;  1LW0 A;  4A5A A;  4B9S A;  3VEY A;  4CJR A;  1DGK N;  4XH4 A;  3PSI A;  1ILY A;  4JKH A;  3MX5 A;  1YT3 A;  4OLA A;  2YHW A;  3W0L A;  1A5V A;  4OGE A;  4RW6 A;  4Y1D A;  4FM1 A;  4M3Z A;  2V51 B;  3OYM A;  4ISG A;  4IOC L;  1QE1 A;  3VGM A;  2FBT A;  2GEM A;  1YXQ A;  1NGI A;  2DPN A;  4A2A A;  3OYE A;  2ZF5 O;  4PKH A;  4DS5 A;  3SPY A;  2IC3 A;  3DRS A;  3HM8 A;  3CC2 N;  3M1F A;  4IFY A;  5BPN A;  4CGG A;  3DXK B;  3FFI A;  1S6P A;  5IT9 O;  2PYJ A;  1ZBS A;  4CEC A;  2P9N A;  4JN4 A;  1GLL O;  3E01 A;  3M5R A;  2P9P A;  5GIO A;  4CJW A;  1VSH A;  5KQD A;  1VQP N;  1TKD A;  3HL8 A;  4FM2 A;  1GLJ O;  2HHS A;  1TL3 A;  2G8K A;  2QWN A;  4O5F A;  4CEB A;  3HST B;  3G10 A;  1RBU A;  4HVJ A;  3C6A A;  1EWR A;  1ASU A;  1C0G A;  3OYF A;  4WQ5 C;  3NH2 A;  3BP8 A;  3EKS A;  1XHZ A;  2GTD A;  4JS4 A;  1C0U A;  4FWS A;  1RT2 A;  1Z05 A;  4DLE A;  3J7Z O;  3LAK A;  3CCM N;  4F3T A;  1XUP O;  2A41 A;  3LDP A;  4BRM A;  1BUP A;  4CK2 A;  5C12 A;  2ASO A;  4OPH A;  1XNR K;  4DTM A;  3SLC A;  1RFQ A;  2IVP A;  3ZET A;  2HF4 A;  1LWE A;  4FPA A;  2HOE A;  4QOZ B;  1FKP A;  1XHX A;  1VSJ A;  4CHO A;  1RTD A;  1O1W A;  5AQO A;  2VYP A;  3CQ8 A;  3JS6 A;  1UWB A;  3CCQ N;  3O1W A;  4DV7 K;  2BE2 A;  4OVL A;  1KAZ A;  2E2P A;  3SUP A;  5JS2 A;  2YHY A;  2HHQ A;  2ATQ A;  3ZCM A;  4LD0 A;  1NLV A;  3O08 A;  4YDU C;  4DV1 K;  4B8C A;  4CD3 A;  3V6D A;  1EX4 A;  5HBM A;  4B3S K;  4CFA A;  4BRD A;  3BEX A;  5BN8 A;  1R59 O;  3DYA A;  2NLX A;  1KQS M;  4BR0 A;  1NWK A;  3OYA A;  4BRC A;  2X74 A;  4W5Q A;  1WSF A;  3TPQ A;  1HNV A;  3GE1 A;  4YOV A;  4IO9 L;  1BIZ A;  4KO0 A;  3RRH A;  3OHR A;  2ZJQ L;  3TAR A;  1UAX A;  3P5J A;  1ASW A;  3LDO A;  1IKV A;  3P4I A;  4AM7 A;  3VQ4 A;  1Z25 A;  4IDH A;  3VGL A;  4KHS A;  1EKE A;  3QIO A;  1KVA A;  3VOV A;  4EZ6 A;  4AM6 A;  4CJ7 A;  3CJB A;  1NKE A;  4B9T A;  4C8K A;  5MLC Q;  5GIN A;  4IOA L;  1BIU A;  3CXC M;  3I56 N;  1VQK N;  3ZSR A;  2QWO A;  1GLC G;  4CF9 A;  1GLB G;  3B8A X;  1S9E A;  4M3Y A;  3ZYY X;  3T1H K;  4GV6 A;  1UOC A;  4NCA A;  3GDQ A;  3V4I A;  1KAY A;  5AQR A;  2PY5 A;  2QI2 A;  1N33 K;  2X6N A;  5ADX H;  4BWJ A;  3M8Q A;  3NBP A;  3GOI A;  1O13 A;  3TTD A;  3H08 A;  3WXJ A;  3PO5 A;  4DTJ A;  2P9P B;  4A62 A;  4BC4 A;  2B4J A;  5CHI A;  1P90 A;  4QAG A;  4E1J A;  3QBW A;  4U67 L;  2HVH A;  3KK1 A;  4CEQ A;  3MEG A;  3VQ8 A;  4LF9 K;  3WXK A;  2QWR A;  1V4T A;  4PWD A;  4CJK A;  3MED A;  3RMC A;  3SMS A;  2OZM A;  3CJ9 A;  5JLF A;  2G8F A;  4OPK A;  2Q1N A;  4F4K A;  3E66 A;  3FZK A;  4FZZ A;  1W0H A;  3QIP A;  4FWO A;  3V1O A;  4BDP A;  1JLG A;  4OPA A;  3QNO A;  3TTC A;  3U9D A;  3CIP A;  4KHW A;  3P39 A;  2QEX N;  4IZ9 A;  1IJJ A;  1IG8 A;  2V7Z A;  4OGC A;  3C65 A;  2PAV A;  1X3M A;  3BY5 A;  3CJC A;  4M42 A;  3QEP A;  5AR0 A;  2GX9 A;  3ZET B;  2OYQ A;  3AA4 A;  3NF9 A;  1EWQ A;  1ZXO A;  4CK1 A;  4DKW A;  1HYS A;  5ADX A;  1A5W A;  3KD5 E;  4WQ5 A;  1BWF O;  3J8A A;  1C0F A;  5GAE P;  1GLD G;  1T44 A;  3D7E O;  3L3V A;  2HMI A;  4JK9 A;  4H0P A;  3MXM A;  3CG7 A;  3M8S A;  1NMN A;  2EHG A;  1VSD A;  4CJF A;  4E89 A;  1BG3 A;  4IEI A;  5IWA K;  3J81 O;  2VQF K;  3N4P A;  3ZX0 A;  3U8X A;  1X9S A;  2KLA A;  4B9N A;  4IJN A;  3V1Q A;  3I55 N;  3VQE A;  4AHV A;  1U04 A;  4JI7 K;  1T6C A;  4ID1 A;  3G25 A;  3TAM A;  3TAN A;  3LL3 A;  4FLT A;  1VSI A;  3I0S A;  4KKO A;  2DFE A;  3HJF A;  2NRH A;  3ZX2 A;  1RDD A;  4K42 A;  2A5X A;  1YVN A;  4FLY A;  3K5L A;  2YHA A;  1BCO A;  4M3R A;  1G15 A;  4X65 K;  4LH4 A;  3WEE A;  4FJ7 A;  3UKR A;  4MO4 A;  2QA4 N;  4FW1 A;  4AHU A;  5BR9 A;  1JCF A;  1IH7 A;  3IDH A;  4K8X A;  3MN9 A;  1N32 K;  3CM6 A;  4EFH A;  5ELZ A;  1RBV A;  2CH5 A;  1K8A O;  4IXC A;  3ID6 A;  4DTN A;  4FK4 A;  1TUY A;  4WFB L;  4FZY A;  4DSJ A;  3NF8 A;  3OYJ A;  2FSN A;  2YKN A;  5FPE A;  4IG0 A;  4YHH K;  4CJ3 A;  5AQI A;  1C1B A;  2D0B A;  3OS2 A;  2Q0R A;  2VQE K;  4DTO A;  4HCB A;  1C6V A;  1GLA G;  4X66 K;  2PBD A;  3TTF A;  4X62 K;  1ESV A;  1RTJ A;  3H3O B;  3LAL A;  4GW6 A;  1YVU A;  4YOT A;  1HKB A;  1MU2 A;  3K59 A;  2HVI A;  3AVL A;  1QQM A;  3DXM A;  3AA2 A;  5AQM A;  2Y1J A;  3K5N A;  3LM2 A;  2HW3 A;  3BUZ B;  3O4Q A;  4BE2 A;  3C6H A;  3CCU N;  4BC5 A;  1BCM A;  3THV A;  1K8K A;  4FJX A;  3VN5 A;  4WYB A;  1U6Z A;  4EP4 A;  1HRH A;  4BRK A;  1YJ9 N;  2O8E A;  1JLE A;  5BRH A;  3NF6 A;  3TAE A;  3WNF A;  4FVU A;  4HTL A;  3H45 C;  3WNE A;  3OYG A;  4ZTJ A;  1VSF A;  3AA5 X;  3AAR A;  4Z4E A;  1ZBL A;  5EVZ A;  5SZT A;  4BRO A;  1WBB A;  3RMA A;  1KTQ A;  2Z1I A;  5GIP A;  3MWP A;  3CM5 A;  1Q81 O;  2E20 A;  1HNW K;  5I3U A;  2HMP A;  4PY5 A;  1Z6R A;  3LDN A;  4Z4I A;  1VK0 A;  1YI2 N;  4BAC A;  4DSE A;  3HP9 A;  2F8S A;  4KV8 A;  4IDK A;  5DM7 L;  4AH9 A;  2F7T A;  4FWP A;  5F2R A;  4CEZ A;  4LSN A;  3QES A;  3VQB A;  2V52 B;  3C95 A;  3AO3 A;  1H1V A;  4W5O A;  3Q7C A;  1SV5 A;  4BQL A;  3O5B A;  1U4B A;  4FVM A;  3S3M A;  4B9V A;  2BAN A;  1R0A A;  4CED A;  1T03 A;  1CXQ A;  3NE6 A;  3R6M A;  1NGB A;  1FK9 A;  1YJW N;  1NK9 A;  3CC4 N;  4N47 A;  1NK7 A;  3P38 A;  4FK2 A;  4KBO A;  4K43 A;  1YUW A;  1QSS A;  4I2Q A;  5AQL A;  2D1K A;  2HHU A;  4E7K A;  2KKZ A;  3IG1 A;  3L8B A;  3RMD A;  1A5X A;  3KLI A;  4YOR A;  5AQX A;  4YOX A;  2QWP A;  4H0V B;  3KK7 A;  2ZGZ A;  2HB5 A;  3DLK A;  1S72 N;  4CZM A;  2P9U B;  1SL0 A;  3FGU A;  4CJ5 A;  3QEW A;  3WEE B;  2IOC A;  1T8E A;  4ISE A;  4O44 A;  3CET A;  4A57 A;  3LWL A;  3OS0 A;  3MCA B;  3LZJ A;  1VSL A;  5EX5 A;  4JK7 A;  1VQ7 N;  4JAX A;  3OBY A;  3QIN A;  1FW6 A;  4FWK A;  4I9L A;  3CI5 A;  1TKZ A;  3V9W A;  5LMU K;  1T7P A;  4O5B A;  4BRI A;  1S22 A;  4IG3 A;  4BC3 A;  5CZ2 A;  1TK5 A;  3NCI A;  1NGF A;  5KGX A;  1VQ9 N;  3I0R A;  3F5T A;  3V9S A;  1HNI A;  5BRF A;  3V9Z A;  2QWQ A;  1KVC A;  2YNF A;  3CCE N;  3H1V X;  3DMJ A;  3M8P A;  3LP1 A;  1NK8 A;  2Q36 A;  3DXM B;  3MMV A;  5SWM A;  5C2F A;  2FSK A;  1S1V A;  4H0X B;  4MDB A;  3A8Y A;  3R8E A;  4DFK A;  4HUE A;  3F2K A;  3VQ5 A;  3QDK A;  4DLG A;  4KRF A;  4MDA A;  3EE8 A;  1K8K B;  2O4I A;  1HMV A;  4KH4 A;  3AVF A;  4JI1 K;  5EU7 A;  4B3R K;  2JLE A;  2O8E B;  3JAM O;  1CXU A;  4AQY K;  3SK3 A;  4O0J A;  1BDG A;  4O8K A;  1KAX A;  3SMP A;  3PLA A;  3QEI A;  1KD1 O;  1X9J A;  5F0X A;  2OPR A;  4DG1 A;  2E88 A;  4FLZ A;  4N56 A;  1NJX A;  1XC9 A;  3TAF A;  1ATR A;  3Q7B A;  1NOY A;  4FSV A;  3EYZ A;  4ISF A;  3AVC A;  1J9A A;  4YOU A;  4MQ3 A;  2BH1 A;  3E9O A;  2W6L A;  1YTA A;  3ATV A;  4JKA A;  3EN9 A;  3B6O A;  3AO4 A;  4DV5 K;  1K73 O;  2VG7 A;  5K14 A;  3VQQ A;  4CJE A;  4C8O A;  2FC0 A;  1XI1 A;  4DSK A;  4LF4 K;  2OTL N;  3E1Y A;  4CF8 A;  4E7I A;  2P9L A;  3ZX3 A;  2A3Z A;  1XMQ K;  1WLJ A;  1SKW A;  2HBM A;  2X78 A;  2D4W A;  2P9I A;  3SQ2 A;  1FXX A;  3T1Y K;  1TL1 A;  4KFB A;  1Q86 O;  3HOT A;  2CGJ A;  3SV3 A;  4J2B A;  4W5N A;  1IKY A;  2D0A A;  4QS8 A;  5C15 A;  1J5E K;  1JJ2 M;  2P5G A;  3WQU A;  4NCB A;  3ENH A;  4CIE A;  2YNH A;  1VSM A;  4F9O A;  4DU4 A;  4AIL C;  1QSL A;  1L5U A;  1RT5 A;  4GVE A;  4FL9 A;  4CJQ A;  3S41 A;  1D9D A;  1QHT A;  2FXU A;  4JD2 A;  4RWT A;  3CPW M;  1X9M A;  2UUB K;  4KPY A;  4DU3 A;  4GVM A;  4DR6 K;  4CBU A;  1TVR A;  4ZTF A;  3FZF A;  3CJ7 A;  3VQD A;  4JHD B;  1BQM A;  3C0B A;  1RDW X;  3AAQ A;  1OKJ A;  1U2V A;  4M7Y A;  4BVO A;  1U49 A;  4CJ4 A;  1YAG A;  4OLB A;  1N5Y A;  1NK6 A;  4H0O A;  3EY1 A;  3L4Q A;  4BRA A;  2P9K A;  4DB3 A;  3OYI A;  1L3U A;  4FJJ A;  1EO1 A;  1L3V A;  3T19 A;  4RW9 A;  2V7Y A;  3NGZ A;  2ASM A;  5FPN A;  4DMN A;  2KQ2 A;  3KLE A;  1VSK A;  3LDL A;  5LJW A;  1QQO A;  3KK2 A;  1W97 L;  5HP1 A;  5C0Y A;  4OKJ A;  2DTU A;  3F9M A;  4M3X A;  3PUF A;  4BRN A;  3H6E A;  4ILH A;  5AQG A;  3K57 A;  3AVN A;  3G0Z A;  2RN2 A;  4FPB A;  4DR2 K;  1NK4 A;  1RT3 A;  3T7Z A;  3M6G A;  4DF4 A;  1YJN N;  1BA0 A;  2KFN A;  1BOT O;  3KIO A;  2E4L A;  3ZSY A;  3DLB A;  5D3G A;  3ZT2 A;  1SL2 A;  3A5L C;  1HYV A;  2PYL A;  3HOS A;  4CHY A;  4EZ9 A;  1XC3 A;  3SI6 A;  4DQ8 A;  1EP4 A;  3DJC A;  3KK3 A;  5TKW A;  1ZBU A;  3O9S A;  3OW2 M;  3LDQ A;  3QBX A;  3TSQ A;  2KW4 A;  4B1Z A;  3O4N A;  4Z94 A;  4A61 A;  4DWI A;  2UUC K;  2XY8 A;  5FRN A;  5M1O A;  4I2P A;  4H03 B;  4E0D A;  4Z4H A;  2PFU A;  3SUO A;  1XQS C;  3CER A;  3VEO A;  3KVG A;  1VQM N;  1N8R O;  2XY5 A;  4DF8 A;  4Y1C A;  3DAW A;  4FM0 A;  1ZYQ A;  2G8V A;  2P9L B;  4I9Q A;  4LF8 K;  3HPH A;  1MWM A;  2P9I B;  1XWL A;  4JKB A;  3PX6 A;  3VTH A;  1OH5 A;  3UB5 A;  3VMF B;  4OO1 J;  4PHT X;  5C25 A;  4FJI A;  1EXQ A;  1J54 A;  1S1U A;  3AO1 A;  1LCU A;  3HI0 A;  1XNQ K;  1NGC A;  2W6K A;  2IS3 A;  1DT9 A;  2LSN A;  2Z1J A;  1VQ6 N;  3NVK A;  3IKM A;  3SJH A;  1HJR A;  2NRZ A;  4CJP A;  3DRR A;  1D8Y A;  3CC7 N;  2F96 A;  4DR5 K;  3EEQ A;  1RNH A;  4KTZ A;  4LF6 K;  4JD2 B;  4CZE A;  3F73 A;  3SCX A;  3AV9 A;  5CY4 A;  2Q31 A;  4OKE A;  3OYC A;  3AVI A;  1Y64 A;  3CCS N;  1KXP A;  5AQJ A;  4FOE A;  2XY7 A;  3SNN A;  5KRS A;  3IRX A;  4GKK K;  1U2V B;  3R1X A;  4RCH A;  3TU5 A;  4Z4G A;  3S3N A;  1RBT A;  4RW7 A;  5M1N A;  2HHW A;  3KD1 E;  1S1X A;  3TAP A;  5FRO A;  4BR9 A;  5JS1 A;  4CZG A;  3RTV A;  2P9K B;  4K25 A;  4B3M K;  3SQ4 A;  3AO5 A;  3VEW A;  2ZD1 A;  5DMR A;  1RCH A;  4B9Q A;  3RRG A;  2XRI A;  1DKG D;  4DS4 A;  3VQ7 A;  3L4I A;  3EKU A;  2W42 A;  1VQ4 N;  4C23 A;  1FKO A;  1KSP A;  5I42 A;  2KZM A;  3SAF A;  3LP0 A;  3CME N;  1NBW A;  3F9K A;  1U47 A;  4JEP A;  3THX A;  4DCH A;  3DLE A;  4B9L A;  2HNZ A;  2FLO A;  3O6W A;  4DQS A;  3LPU A;  4FWM A;  1VRT A;  1M90 O;  2P5O A;  2GWJ A;  3AY9 A;  4CEA A;  3QLH A;  3WT0 A;  2KFZ A;  1GOB A;  1W2B M;  3D2F A;  3ZLJ A;  1I39 A;  3GG4 A;  4CBW A;  1SAZ A;  1KCF A;  2ZM6 K;  1HLU A;  1C1A A;  3CFO A;  5GAH P;  4BC2 A;  1KFD A;  3VPZ A;  1CZA N;  4NXN K;  3V9U A;  3QB0 A;  3PV8 A;  3HBT A;  4U7B A;  2GWK A;  1NG9 A;  4B1U B;  4CVN E;  2VWB A;  5CZ1 A;  2HF3 A;  4KB1 A;  4FJG A;  2HBK A;  2A42 A;  4WF9 L;  2YJE A;  4FJN A;  2WC9 A;  1BI4 B;  3VF2 A;  4CEO A;  1QVF M;  4XIU A;  1ATS A;  4PL7 A;  5CR4 A;  2QTD A;  5FRM A;  4LY7 A;  4DV3 K;  3VA3 A;  2BDP A;  4JKE A;  4JLH A;  4RTF D;  4YDU A;  2A40 A;  3A0I X;  3WNH A;  2ITM A;  5BRE A;  2IAJ A;  2P9U A;  2RE2 A; 
#chains in the Genus database with same CATH homology
 4N41 A;  1A5X A;  3KLI A;  1CZB A;  1BQN A;  2ZE2 A;  3JYT A;  3VQA A;  1QE1 A;  2FBT A;  4PUO A;  2HB5 A;  3DLK A;  4CGF A;  1BHL A;  1NKB A;  3OYE A;  1SL0 A;  1C1C A;  4J2A A;  4DS5 A;  4CJ5 A;  3QEW A;  3SPY A;  2IC3 A;  2IOC A;  3DRS A;  4N5S A;  1T8E A;  4O44 A;  4W5R A;  1HQE A;  3ISN C;  5C42 A;  1S1T A;  3LWL A;  4IFY A;  3OS0 A;  4GMJ B;  1TGO A;  4CGG A;  3HXM A;  3PX0 A;  1QTM A;  3CFR A;  1WAF A;  1S6P A;  3FFI A;  3VQ6 A;  3LZJ A;  4FJH A;  2P51 A;  3V1R A;  3LDS A;  2YNI A;  3ZT4 A;  4FZX C;  1VSL A;  4DTS A;  2QKK A;  2PYJ A;  4CEC A;  4Z4C A;  3UIQ A;  3ALY A;  3QIN A;  4JRQ A;  4E3S A;  3SJJ A;  4I9L A;  4NCG A;  3M8R A;  3E01 A;  1TKZ A;  1HPZ A;  3V9W A;  4CJW A;  2I5J A;  1VSH A;  1TKD A;  3HL8 A;  1TV6 A;  3NHG A;  4FM2 A;  4MFB A;  3QEV A;  4QCL A;  1LW2 A;  1T7P A;  2HHS A;  4O5B A;  1TL3 A;  3SUQ A;  3TI0 A;  2G8K A;  4CEB A;  4DFM A;  4KB0 A;  3HST B;  1F21 A;  4IG3 A;  3G10 A;  1RBU A;  5CZ2 A;  4HVJ A;  3NFA A;  3AVK A;  3OY9 A;  3NCI A;  5KGX A;  3SYZ A;  4DTP A;  1QQC A;  4FW2 A;  4DFP A;  3I0R A;  1ASU A;  1NK5 A;  4KTW A;  3V9S A;  1S5J A;  1HNI A;  3V9Z A;  3OYF A;  1HYZ A;  1SKR A;  3NH2 A;  1JL2 A;  1T05 A;  5KI6 A;  1XHZ A;  1L3T A;  1KVC A;  2YNF A;  4JS4 A;  3WNG A;  3C6T A;  3PX4 A;  1BIS A;  1C0U A;  3DMJ A;  3M8P A;  3O3F A;  3LP1 A;  1NK8 A;  1VRU A;  4B08 A;  1RT2 A;  4DLE A;  5SWM A;  3LAK A;  3HT3 A;  2BDP A;  3DLH A;  4HCC A;  2HHT A;  4F3T A;  2F8T A;  1S1V A;  3SUN A;  2DY4 A;  3OYL A;  2D5R A;  4WE1 A;  4RG8 A;  4DFK A;  4KHQ A;  3JSM A;  1JXE A;  4CK2 A;  4HUE A;  2GBZ A;  4CHZ A;  2DFF A;  3D0P A;  4ELU A;  4PQU A;  4IBN A;  3VQ5 A;  4DLG A;  2E6M A;  4KRF A;  2O4I A;  2HHW A;  1HMV A;  4DTM A;  2OPQ A;  3AVF A;  1LV5 A;  1JLC A;  4CGJ A;  2PZS A;  1LWE A;  5EU7 A;  1IKX A;  4I7F A;  2JLE A;  3PY8 A;  4E7J A;  2VWK A;  1CXU A;  3OYK A;  4QOZ B;  1SKS A;  1FKP A;  4O0J A;  4M3W A;  1XHX A;  1VSJ A;  4CHO A;  3S9H A;  1O1W A;  1J5O A;  1RTD A;  3HK2 A;  4Q0B A;  4FYD A;  4CGH A;  3DOL A;  3ZSZ A;  3CQ8 A;  3QEI A;  2WOM A;  4FJK A;  3TAQ A;  1UWB A;  2OPR A;  4DG1 A;  4FLZ A;  4JRP A;  1C0T A;  2BE2 A;  3BGR A;  4OVL A;  4N56 A;  1XC9 A;  1NJX A;  3QEX A;  3RWU A;  3TAF A;  3ZSX A;  4CIG A;  3SUP A;  1NOY A;  2WON A;  1ZBH A;  5JS2 A;  4DFJ A;  3EYZ A;  2ATQ A;  4PA1 A;  3ZCM A;  4CEE A;  2HHQ A;  4LD0 A;  3AVC A;  3LAN A;  1J9A A;  3HJF A;  2KTQ A;  1RDB A;  4MQ3 A;  3L2R A;  1D9F A;  3BDP A;  3U6F A;  1RT6 A;  1YTA A;  4B8C A;  4CJL A;  5CYQ A;  3V6D A;  1EX4 A;  5HBM A;  4CFA A;  3B6O A;  3AO4 A;  1NJY A;  2E6L A;  1RT1 A;  2VG7 A;  2R7Y A;  4KAZ A;  4E19 A;  1LWF A;  5K14 A;  1D5A A;  2X6S A;  3VQQ A;  2FC0 A;  5C24 A;  4CJE A;  3DYA A;  3OYB A;  4BE1 A;  1XI1 A;  4C8O A;  4CCH A;  4DSK A;  3AVH A;  3V81 A;  4FJM A;  4M3U A;  1ZBI A;  3KJV A;  3DI6 A;  1S1W A;  4CF8 A;  1ITG A;  3OYA A;  4E7I A;  4B9U A;  2X74 A;  4W5Q A;  1WLJ A;  1SKW A;  1S9G A;  2X78 A;  2KZZ A;  1WSF A;  4Z0U A;  5HRP A;  3ULD A;  3SQ2 A;  1HNV A;  1FXX A;  1TL1 A;  1BIZ A;  4KFB A;  4KO0 A;  4H8K A;  3RRH A;  3TAR A;  1UAX A;  3P5J A;  4AHC A;  3SV3 A;  4CE9 A;  1ASW A;  3KTQ A;  1IKV A;  3AVM A;  1IKY A;  4J2B A;  4W5N A;  2D0A A;  1JXB A;  3VQ4 A;  1Z25 A;  2YHB A;  3ITH A;  1WNS A;  4AHR A;  1EKE A;  3MXI A;  4KHS A;  3QIO A;  1TK0 A;  1DTT A;  2P5G A;  3HP6 A;  1KVA A;  1RTH A;  3T3F A;  4NCB A;  4EZ6 A;  1YTU A;  4CIE A;  5CYM A;  2YNH A;  1VSM A;  3NAE A;  4DU4 A;  3LWM A;  4AIL C;  1QSL A;  4HUG A;  1RT5 A;  1NKE A;  1L5U A;  4B9T A;  4C8K A;  1TKX A;  3HVR A;  3DM2 A;  3AVA A;  4CJQ A;  1BIU A;  3ZSR A;  1D9D A;  2AJQ A;  1LAV A;  3HM9 A;  1QHT A;  1X9M A;  1JLB A;  2XY6 A;  4KPY A;  4CF9 A;  4DU3 A;  4FJ8 A;  4GVM A;  1I3A A;  4L8R B;  4IFV A;  1S9E A;  3DLR A;  4M3Y A;  1TVR A;  2B5J A;  4ZTF A;  4YNQ A;  4N76 A;  2ZQB A;  1UOC A;  3VQD A;  4O55 A;  3NH0 A;  4NCA A;  1WSG A;  2OZS A;  4K8Z A;  1VSE A;  3CYM A;  3V4I A;  2HHV A;  1BQM A;  3DLG A;  4CHQ A;  1JLF A;  1WSI A;  2PY5 A;  2X6N A;  4OPJ A;  4BWJ A;  3O3G A;  3M8Q A;  3K58 A;  4RW4 A;  4FJ5 A;  3NBP A;  4F2R A;  2G8I A;  4NYF A;  3L2V A;  1GOC A;  1J53 A;  4CJ4 A;  1U49 A;  3AO2 A;  3H08 A;  1KLN A;  4M3T A;  4OLB A;  3PO5 A;  1N5Y A;  4DQI A;  1KRP A;  4DTJ A;  1NK6 A;  3EY1 A;  2B4J A;  4ELT A;  4O4G A;  3OYI A;  4QAG A;  3OVN A;  1L3U A;  2VWJ A;  1RT4 A;  1L3V A;  4FJJ A;  3T19 A;  2HVH A;  3KK1 A;  3P83 D;  4CEQ A;  3MEG A;  4ELV A;  4RW9 A;  3VQ8 A;  2VG6 A;  3NGZ A;  2YKM A;  2B6A A;  4DMN A;  2KQ2 A;  2FBX A;  1VSK A;  3KLE A;  4FLX A;  4CJK A;  3MED A;  3RMC A;  4PWD A;  2OZM A;  3KK2 A;  2A1S A;  1BGX T;  2G8F A;  4OPK A;  4F4K A;  5HP1 A;  2G8U A;  4FZZ A;  3P1G A;  2A1R A;  4OKJ A;  4C8N A;  1TK5 A;  3RR7 A;  3OYN A;  1W9H A;  1W0H A;  3QIP A;  3V1O A;  4M3X A;  2BGG A;  2DTU A;  1REV A;  2OPS A;  3AVJ A;  3PUF A;  1C0M A;  4BDP A;  1JLG A;  3QNO A;  4KHW A;  4B3O A;  2RKI A;  5KRT A;  3K57 A;  5J2M A;  4RW8 A;  3AVN A;  1QS4 A;  3G0Z A;  2RN2 A;  4OGC A;  2IGI A;  3L2W A;  1NK4 A;  1RT3 A;  2RF2 A;  4E1N A;  4DF4 A;  3IAY A;  4G1Q A;  4M42 A;  2ITG A;  3QEP A;  2OYQ A;  4FJL A;  2KFN A;  3AA4 A;  3KIO A;  3NF9 A;  3VA0 A;  3HO1 A;  1Z26 A;  3PO4 A;  2E4L A;  2YV0 X;  4CF0 A;  5J1E A;  2P1J A;  4DSI A;  4KI4 A;  3ZSY A;  4CK1 A;  3K5O A;  3S3O A;  3DLB A;  3QO9 A;  1RDC A;  4DSL A;  5D3G A;  1HYS A;  2NUB A;  4HUF A;  4DQR A;  4H4M A;  3ZT2 A;  1UA0 A;  1S6Q A;  1SL2 A;  1HYV A;  2PYL A;  4W5T A;  1A5W A;  4CHY A;  3KD5 E;  1JLA A;  4EZ9 A;  4YFU A;  1RT7 A;  3SI6 A;  1EP4 A;  3KK3 A;  4DTX A;  2FBV A;  1RIL A;  5KGW A;  1ZBU A;  3NF7 A;  3D45 A;  2QK9 A;  1NOZ A;  2KW4 A;  4HTU A;  3L3V A;  2HMI A;  4FJ9 A;  3O4N A;  1TAU A;  4EP5 A;  4DWI A;  3NGI A;  2XY8 A;  5FRN A;  3MXM A;  3L3U A;  3CG7 A;  3SQ0 A;  2GUI A;  4LH5 A;  3M8S A;  3KLF A;  1ZBF A;  4I2P A;  3TAG A;  2D0C A;  2EHG A;  1QSY A;  2Q3S A;  4CEF A;  4E0D A;  1VSD A;  4Z4H A;  4CJF A;  1GOA A;  1WN7 A;  4E89 A;  3SUO A;  2G8W A;  3TR8 A;  3KKS A;  4CF2 A;  4DU1 A;  3V9X A;  1N6Q A;  4FK0 A;  1JLQ A;  3LZI A;  2QKB A;  2O4G A;  2OPP A;  4B9N A;  1X9S A;  2HNY A;  1RDA A;  2XY5 A;  4ZHR A;  4DF8 A;  5HLF A;  3ZSO A;  3V1Q A;  3ZSW A;  3VQE A;  4Y1C A;  4FM0 A;  1ZYQ A;  3A2F A;  2G8V A;  4AHV A;  2XHB A;  2FBY A;  4I9Q A;  3HPH A;  1U04 A;  3K2P A;  4OKK A;  1IKW A;  1SUQ A;  4ID1 A;  3TWH A;  3TAM A;  3C94 A;  4R5P A;  3TAN A;  4BE0 A;  1XWL A;  4FLT A;  1B9D A;  4C8L A;  3PX6 A;  1B92 A;  3K5M A;  1LAW A;  1VSI A;  1IO2 A;  4H4O A;  3I0S A;  4ID5 A;  4B8A B;  4KKO A;  2DFE A;  5C25 A;  4DSF A;  4FJI A;  4J2D A;  4E7H A;  1EXQ A;  4E1M A;  1J54 A;  1S1U A;  3AO1 A;  3AVB A;  5KTQ A;  2YNG A;  1RDD A;  2EX3 A;  4CJT A;  2Z1G A;  4KHU A;  1LWC A;  1RBS A;  2IS3 A;  4KTQ A;  1JL1 A;  3ASM A;  2LSN A;  4LSL A;  2Z1J A;  1X1P A;  4BWM A;  4M45 A;  4FLY A;  3K5L A;  4KHN A;  2RPI A;  2YHA A;  3HYF A;  1DLO A;  1BCO A;  4UQG A;  3MAQ A;  4M3R A;  1HJR A;  4CJP A;  3RMB A;  1G15 A;  3DRR A;  3SPZ A;  3AVG A;  4LH4 A;  1D8Y A;  1CLQ A;  2F96 A;  4BDZ A;  1RTI A;  4FJ7 A;  1RNH A;  4KTZ A;  3L2Q A;  1X9W A;  3ZT1 A;  3F73 A;  3SCX A;  4FW1 A;  4AHU A;  3AV9 A;  4DQQ A;  4Z4F A;  3EZ5 A;  4CIF A;  5CY4 A;  1IH7 A;  2Y1I A;  3SQ1 A;  1BL3 A;  4OKE A;  4K8X A;  3CM6 A;  1JKH A;  1RBV A;  3OYC A;  1CZ9 A;  3AVI A;  3OJU A;  4DTN A;  1KFS A;  3HPO A;  4FK4 A;  1KVB A;  2XY7 A;  1ASV A;  3SNN A;  4DSJ A;  1TAQ A;  3IRX A;  5KRS A;  4DTR A;  4FZY A;  3NF8 A;  3OYJ A;  3LPT A;  3ZT0 A;  2OA8 A;  2YKN A;  4JS5 A;  3HPG A;  4IG0 A;  3T1A A;  4Z4G A;  3S3N A;  3NDK A;  4CJ3 A;  4CK3 A;  1TK8 A;  1C1B A;  1Q8I A;  1RBT A;  2D0B A;  4RW7 A;  3OS2 A;  4DTO A;  5HRR A;  3NGY A;  4E7L A;  3KD1 E;  4HCB A;  5DK5 A;  4J2E A;  1C6V A;  2XO7 A;  1S1X A;  3RR8 A;  3TAP A;  2HHX A;  5FRO A;  4BDY A;  3QNN A;  4OJR A;  1Y97 A;  4CGD A;  4HHT A;  2QXF A;  3RTV A;  1U45 A;  2G8H A;  3OJS A;  5JS1 A;  3KLH A;  1RTJ A;  3LAL A;  3SQ4 A;  4CGI A;  3TAB A;  4KI6 A;  3AO5 A;  4GW6 A;  1YVU A;  3QET A;  3VQC A;  1MU2 A;  3K59 A;  2HVI A;  3C6U A;  2ZD1 A;  3AVL A;  5DMR A;  5T7B A;  3SZ2 A;  3LP2 A;  1RCH A;  2Z1H A;  4KRE A;  3RRG A;  3AA2 A;  2XRI A;  1WAJ A;  2Y1J A;  4KHY A;  2GV9 A;  3K5N A;  2HW3 A;  4DS4 A;  5J2Q A;  3VQP A;  3O4Q A;  4BE2 A;  3VQ7 A;  1NK0 A;  3LAM A;  4F2S A;  3AA3 A;  2W42 A;  1HQU A;  1BCM A;  3DRP A;  3I8D A;  4FLV A;  3THV A;  1WSH A;  2JGU A;  3VN5 A;  4FJX A;  1FKO A;  4CFD A;  5I42 A;  1KSP A;  2KZM A;  3LP0 A;  3KLG A;  5FDL A;  3HVT A;  4EP4 A;  1HRH A;  4CHN A;  3F9K A;  1U47 A;  5E41 A;  1JLE A;  3NF6 A;  3TAE A;  3DLE A;  3WNF A;  4B9L A;  4O0I A;  1K6Y A;  2HNZ A;  3WNE A;  4CJU A;  3OYG A;  4ZTJ A;  1VSF A;  1B9F A;  4DQS A;  3AA5 X;  3LPU A;  3LP3 A;  3B6P A;  4NYN A;  3ZT3 A;  4CFC A;  4CJS A;  1VRT A;  4CJV A;  4CF1 A;  2P5O A;  4Z4E A;  5HRO A;  1ZBL A;  1TKT A;  4CEA A;  1WSE A;  3QLH A;  4AHT A;  5SZT A;  1KTQ A;  3RMA A;  2VG5 A;  2Z1I A;  1GOB A;  2KFZ A;  3CM5 A;  1I39 A;  1DTQ A;  1KLM A;  3U3Y A;  1NJW A;  4DQP A;  5I3U A;  3ZSQ A;  1KCF A;  3MEC A;  3VQ9 A;  4PY5 A;  1C1A A;  3OYD A;  4B9M A;  4CHP A;  3CFO A;  3SV4 A;  1NKC A;  1SL1 A;  4Z4I A;  1KFD A;  1VK0 A;  2IDO A;  3O3H A;  4TSX A;  3MEE A;  3U3G A;  3L2U A;  3HP9 A;  4BAC A;  4DSE A;  4F3O A;  2F8S A;  4KV8 A;  3V9U A;  3QER A;  3DOK A;  1WSJ A;  4ICL A;  3PV8 A;  4IDK A;  5HRN A;  4Q5V A;  4AH9 A;  1BI4 A;  1Q9X A;  4CEZ A;  4LSN A;  3QES A;  5CZ1 A;  3VQB A;  3C95 A;  3CFP A;  5J2N A;  3AO3 A;  4KB1 A;  5J2P A;  4FJG A;  4W5O A;  4M41 A;  1L3S A;  1SV5 A;  4FJN A;  1NJZ A;  1U48 A;  1U4B A;  1BI4 B;  4FVM A;  3MXJ A;  3S3M A;  4B9V A;  2BAN A;  3OS1 A;  2DFH A;  4CER A;  4FXD A;  1R0A A;  4CED A;  1T03 A;  1RBR A;  1CXQ A;  1LW0 A;  4CEO A;  3NE6 A;  1IG9 A;  3IS9 A;  4B9S A;  4XIU A;  4CJR A;  4C8M A;  4F8R A;  1FK9 A;  2ETJ A;  5HRS A;  1NK9 A;  5FRM A;  4LY7 A;  3OYH A;  3VA3 A;  1EET A;  4CFB A;  1UA1 A;  4FCY A;  4JLH A;  1YT3 A;  4N47 A;  1NK7 A;  3ZSV A;  4FLU A;  1Q9Y A;  4IKF A;  4FK2 A;  4OLA A;  1QSS A;  1A5V A;  2HND A;  4OGE A;  4RW6 A;  4I2Q A;  3KKR A;  4Y1D A;  3WNH A;  4FM1 A;  4AHS A;  4DTU A;  4M3Z A;  2IAJ A;  4FLW A;  2HHU A;  4CES A;  3IG1 A;  3L8B A;  4E7K A;  3RMD A;  3OYM A;  3NH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...