4B8CA

Nuclease module of the yeast ccr4-not complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
280
structure length
267
Chain Sequence
PIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/cell cycle
molecule keywords POLY(A) RIBONUCLEASE POP2
total genus 85
structure length 267
sequence length 280
chains with identical sequence C, E, F
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b8cA00
3WNGA 5C24A 3DI6A 4CHZA 4HUEA 2FBTA 1EP4A 2IS3A 3A2FA 3FFIA 3LP1A 5J2PA 1U04A 2XY5A 3TANA 3AVJA 4FJKA 1B9FA 1C0MA 4PQUA 3OYLA 2F96A 4Z4IA 5KTQA 2VWJA 3KLGA 1CLQA 1REVA 4IFYA 2YNFA 4F3OA 2DTUA 2D0BA 2ETJA 3P1GA 4IDKA 5HRPA 1EX4A 3PUFA 1WSGA 2HHQA 1ASVA 1YVUA 4CGFA 4I9QA 1LAWA 1S1XA 3OY9A 4E0DA 4OGEA 1KTQA 3RMBA 3QETA 1XI1A 4HUGA 4FJJA 3QO9A 1QSYA 2ITGA 2ZQBA 1X1PA 1TAQA 3MECA 3IAYA 4FJHA 3DOKA 4AHCA 3SPZA 4KAZA 3OYNA 4BDYA 1X9WA 2G8WA 4B9MA 2G8HA 3QLHA 4I2QA 2P1JA 2VG5A 3RR8A 3V9UA 3RTVA 3ZSVA 1JKHA 1S6QA 3NDKA 1JXEA 1K6YA 1TL3A 5T7BA 3CFPA 1XHZA 3AA2A 3L2RA 1ZYQA 4ID5A 3NHGA 1Q9YA 4B9VA 4KHSA 4FK2A 1JLEA 1NKBA 3DM2A 1JLQA 1RDCA 4J2DA 3QEWA 3LAKA 3OYBA 1TKDA 1RTJA 4E19A 4DSKA 4DQQA 2X74A 2B5JA 4FJGA 2OPPA 3HVTA 4ELVA 1RBUA 3C95A 2E4LA 1A5WA 3KLFA 2B4JA 4BWJA 2IGIA 1CZ9A 1WAFA 4Y1DA 3KK2A 4FM1A 1D5AA 4CERA 1FXXA 1S1TA 4BE1A 3C6UA 4CF8A 4CGIA 2YHAA 4OKEA 4IG3A 4FLTA 5HLFA 4UQGA 3L3UA 4IFVA 3ALYA 3OYEA 3PX4A 2F8TA 4DTPA 1NJWA 4FLYA 2ZD1A 3O3GA 3V9XA 2YKNA 4FW1A 4CK2A 3NBPA 3V6DA 4CF9A 4E7IA 4DSIA 4CHQA 4L8RB 3SUQA 4J2BA 3WNFA 3K59A 3V9ZA 3KK3A 1L3TA 3NFAA 2KW4A 2Z1JA 3HVRA 1QTMA 2PYJA 4BACA 4FJ5A 3NGZA 3HYFA 4KB0A 4OVLA 1RCHA 1HQUA 3LPUA 5DMRA 3CFRA 4W5OA 1B92A 4FM0A 4DFJA 2FBVA 1S1UA 3K5LA 2HHSA 3SV3A 4AHTA 1RDBA 1HYSA 3CQ8A 2FBXA 4Z4HA 3AO5A 4O55A 4M3RA 4CJEA 3O3HA 3TAQA 1R0AA 5KRTA 1TKZA 1VRUA 4DQRA 2HNYA 1I3AA 4BDZA 3PV8A 4Q5VA 3D0PA 1IKVA 1QQCA 4DTNA 3VQPA 2QK9A 3NAEA 1BQMA 1RT7A 3THVA 3DLHA 3RWUA 3ZT0A 1EKEA 3RRHA 1LW2A 1JXBA 3OS2A 4B9SA 4KHUA 4AHRA 1EXQA 5DK5A 3OYMA 3U3YA 3NF8A 3QINA 4O0IA 3AVIA 4AHVA 3HSTB 3MXMA 2KZMA 3MEDA 4FCYA 2BANA 3TAEA 1L3VA 3KTQA 1UA0A 4DTUA 3SCXA 3TAFA 3PY8A 3QEIA 4BWMA 3DRRA 4CJRA 4DLGA 4B9LA 3AVBA 5D3GA 3SQ1A 4CK1A 5KGWA 4B8CA 3LANA 4CHNA 4ICLA 2VG6A 2P5GA 4OKJA 2XY6A 3DOLA 1ZBHA 4W5QA 3RRGA 3VQ5A 3TI0A 4HUFA 2E6MA 5K14A 4EP5A 1T03A 3ZSRA 1J53A 4CF2A 1RDAA 4FLWA 1YTUA 1JLCA 4FJIA 3OYIA 3QEVA 4FVMA 3V9WA 2YNHA 3V81A 4FXDA 3HPGA 4M3TA 1O1WA 4HVJA 1WSJA 3B6PA 1IH7A 4DSLA 4KPYA 1T8EA 3V1RA 1HYZA 4ELUA 1FK9A 4PWDA 3L2UA 1C1CA 1YTAA 5JS1A 3L2QA 3TAGA 4IKFA 3OYHA 2XO7A 3LZIA 3LZJA 1WSHA 3LWMA 1U49A 1C1AA 3KLEA 3L3VA 4OLBA 4PUOA 4OKKA 2X6SA 4CEAA 3CYMA 2JLEA 5FROA 1QSLA 3M8QA 2HHXA 3NH0A 4CJUA 1D9FA 4RG8A 1HQEA 3DYAA 4ID1A 4CK3A 3HM9A 2D0CA 4CIFA 4W5NA 1VSMA 4B9TA 1JLGA 2XY7A 1IO2A 1J9AA 2IOCA 2ZE2A 1BISA 3AO1A 3CM5A 4ZHRA 1RDDA 3TABA 3DLEA 5FRMA 3L2VA 2D5RA 4H8KA 2HHVA 1ASWA 3E01A 3OJSA 4EZ6A 1LAVA 1WLJA 3KIOA 4HCBA 1BCMA 3QIOA 3L2WA 2VWKA 2XRIA 1VSKA 2D0AA 3VQ6A 3OYDA 3M8SA 1NK8A 2VG7A 1U4BA 4KHQA 2FBYA 4IBNA 2IAJA 3HXMA 3PO5A 2AJQA 3TR8A 3M8RA 3AVFA 4N47A 1TK5A 4CF0A 5I42A 1BI4B 2OA8A 2G8IA 2OPQA 3RMCA 2RPIA 4BE0A 1QE1A 4Z4CA 2O4IA 1F21A 4E7LA 2XHBA 4O0JA 4Z4FA 1S9GA 5CYQA 1JLFA 3K5OA 5FDLA 1DTTA 3KLIA 3VQQA 1LWEA 5JS2A 3SYZA 4FJLA 1A5XA 1GOBA 3T1AA 2OZSA 2O4GA 1VSEA 1KFSA 1EETA 1NK6A 3HL8A 4E7JA 3AO4A 4YNQA 2DFHA 1WSEA 1L3UA 4FZXC 4KREA 1VSHA 3OYFA 3NGIA 3P83D 1TL1A 1KVBA 4J2EA 2IC3A 4AILC 1SL2A 4YFUA 3S3MA 4FJXA 1KLMA 1BCOA 3OYJA 1HNIA 3CM6A 4JS4A 4JRQA 1HMVA 4OJRA 1HYVA 4E89A 1Z25A 4KFBA 4CFDA 1C0UA 2KZZA 1G15A 1BIZA 4KKOA 3SQ2A 2HHWA 4NYNA 1SV5A 3B6OA 4KI6A 3HJFA 3CG7A 1T05A 2EX3A 3ZSOA 3KLHA 1NK4A 1SUQA 3I0SA 1BI4A 3S3OA 4M3YA 3PO4A 3S9HA 4O5BA 2B6AA 4AH9A 1U45A 2X6NA 3SQ0A 2G8UA 3LP0A 4CGHA 4DWIA 4JLHA 4FYDA 3AO3A 2BE2A 4TSXA 1RT1A 3TAMA 1NJXA 4B9UA 3OYGA 4I2PA 3TAPA 5KI6A 1B9DA 4G1QA 1TGOA 2PY5A 1DLOA 1JLBA 3G0ZA 2HHUA 5J1EA 4DF4A 4F2RA 5EU7A 3VQDA 2XY8A 3IRXA 3AVKA 1FKOA 3CFOA 4MFBA 3K2PA 4N56A 4Y1CA 3AO2A 3ZT3A 4CIEA 4DF8A 4DTOA 4DFKA 1VSDA 3K58A 4ELTA 4CJVA 3NF6A 2HVIA 1ZBIA 2YKMA 2RKIA 3C6TA 3LP3A 1S1WA 1ZBLA 2QKKA 3AA3A 1XWLA 2HNZA 3LALA 2WOMA 1LV5A 1RBRA 2OYQA 4M3UA 2FC0A 3DMJA 3KKSA 4H4MA 4I9LA 3HP9A 4RW4A 2QXFA 4M45A 3HPOA 1S1VA 5CY4A 3AVNA 3O3FA 3ULDA 2PZSA 5CZ2A 4C8MA 1RT6A 3ZSZA 4CEFA 4FZYA 4F2SA 2Y1IA 1J54A 1LWCA 4OLAA 2DFFA 2RN2A 3HPHA 3NGYA 4ZTJA 3K5MA 4M3XA 1TVRA 3OJUA 3KKRA 3OVNA 4O44A 1U48A 4HHTA 4CGDA 3ZSYA 3S3NA 2BGGA 4FM2A 1KFDA 3AVLA 5FRNA 4LD0A 1TK0A 1VSFA 3KK1A 3U6FA 4DQPA 3MEGA 1KCFA 1I39A 4CEBA 4E1NA 4LSNA 1XHXA 3ZSWA 4JS5A 1Z26A 4ZTFA 2GBZA 4N5SA 1X9SA 4KI4A 1KSPA 2HHTA 2Y1JA 3LP2A 1RTIA 1IKWA 4CEDA 1UOCA 4DSJA 4Q0BA 1RT3A 4FW2A 3QEXA 3I8DA 4CESA 4DTRA 1CZBA 3V4IA 4K8XA 2HB5A 3IS9A 1ZBFA 2GV9A 1IG9A 1C1BA 3G10A 3SUPA 4RW8A 4RW7A 3T19A 4LH4A 4CGJA 4RW9A 4E1MA 3QIPA 3F73A 1Q9XA 4KB1A 5HRSA 3D45A 4OGCA 3QNNA 4NCBA 2YNGA 4K8ZA 1Q8IA 2R7YA 1J5OA 3ZCMA 3VN5A 3NF9A 4M3ZA 3U3GA 2I5JA 2HW3A 3K57A 4GW6A 1IKYA 2OPRA 4FJ9A 4CJ3A 3KD5E 3QEPA 4OPJA 1CXQA 3JYTA 4CHYA 2EHGA 4DLEA 2GUIA 2DY4A 3HO1A 4FJMA 2RF2A 1A5VA 4M41A 1SL0A 4R5PA 1ZBUA 3DRPA 2G8FA 4CHPA 3KJVA 4DQSA 1GOCA 3VQCA 4CHOA 4W5TA 4FJNA 4O4GA 5SWMA 3MXIA 5HROA 4GVMA 3AVGA 3BGRA 1KLNA 1HPZA 3LDSA 3SUNA 2G8VA 4CEOA 4KTZA 4RW6A 3VA0A 1JL2A 1S9EA 2P51A 3ZT1A 5I3UA 2JGUA 3MAQA 4NYFA 3V1QA 1NK5A 3HP6A 4F8RA 3ISNC 4KRFA 4WE1A 3NF7A 3QNOA 2PYLA 4DFPA 1TAUA 4GMJB 1T7PA 1WSIA 4KHYA 2E6LA 1NKEA 4N41A 2W42A 2KFNA 2ATQA 4JRPA 4CJKA 4N76A 4CJPA 4CJSA 1SKRA 3VQ8A 1RT5A 3VA3A 3QERA 1HJRA 3O4NA 3AA5X 4CJTA 3PX0A 2OPSA 3SUOA 1QSSA 5CZ1A 4HCCA 1NOYA 4DS5A 4CJQA 4CJWA 2YHBA 4DU4A 1L3SA 1DTQA 3NH1A 4CJFA 3DLKA 3SV4A 5J2NA 4CGGA 3SQ4A 1QS4A 3TWHA 4KTQA 1X9MA 3DLGA 4PY5A 4AHUA 2YV0X 3M8PA 4CECA 3UIQA 3L8BA 4E7KA 3RMDA 1NK7A 2KQ2A 3ITHA 3ZT2A 4XIUA 3EY1A 1BL3A 1BGXT 1RBSA 4KO0A 4DTXA 3NE6A 1WAJA 4LH5A 2HVHA 3ASMA 4CIGA 3V1OA 3SZ2A 4DQIA 4FLXA 1NK9A 1BQNA 4QCLA 1D9DA 1N6QA 2A1RA 3NH2A 3T3FA 4H4OA 2A1SA 3AV9A 4CEEA 5C25A 5HRNA 3VQ4A 4DU1A 4NCAA 2KTQA 2F8SA 3P5JA 3OYKA 3SJJA 1D8YA 4CEZA 4M3WA 4BDPA 1RT2A 4F3TA 1BHLA 3JSMA 3VQBA 2HMIA 1SKWA 3DRSA 1VRTA 1JL1A 1VK0A 4Z4EA 1SL1A 4EZ9A 1ITGA 4KV8A 4FLVA 5HBMA 1S6PA 5CYMA 3ZT4A 3MXJA 2OZMA 4CJ5A 3NCIA 3ZSQA 1L5UA 4KTWA 4QAGA 1RTHA 1MU2A 1JLAA 1S5JA 1Y97A 3AVMA 4CJLA 3LWLA 4CFAA 3KD1E 1WN7A 3VQAA 1YT3A 2IDOA 1VSLA 4DFMA 2KFZA 2HNDA 4FLUA 3WNEA 2BDPA 1LW0A 1W0HA 2G8KA 4C8OA 3IG1A 1RBTA 1NJYA 1UAXA 2Z1IA 4Z0UA 3PX6A 3TARA 4LSLA 4DTJA 3SPYA 3VQ7A 1CXUA 4CFCA 4DU3A 4CE9A 4BE2A 3H08A 1BIUA 4IG0A 4DS4A 4I7FA 5C42A 4OPKA 2LSNA 1XC9A 4QOZB 1N5YA 1SKSA 3AA4A 4C8LA 4EP4A 4C8NA 3SNNA 1RILA 3HT3A 4B08A 3I0RA 1RBVA 3RR7A 3SI6A 1LWFA 5HP1A 4DMNA 5HRRA 5J2MA 1KRPA 3OS1A 1UA1A 4FJ8A 3O4QA 5E41A 2Z1HA 4FK0A 1UWBA 3ZSXA 4DSFA 4M42A 2DFEA 3VQ9A 3BDPA 1VSJA 3F9KA 2P5OA 2Z1GA 4KHWA 4KHNA 1C6VA 4AHSA 2QKBA 3OS0A 4F4KA 1NOZA 1KVCA 3AVCA 4DTMA 4E7HA 4Z4GA 1ASUA 1GOAA 1NJZA 1NKCA 2X78A 3LAMA 4DG1A 3EZ5A 1IKXA 1TKTA 3VQEA 4FK4A 4E3SA 1TV6A 4FJ7A 4FZZA 1QHTA 3K5NA 4B9NA 2YNIA 1NK0A 4W5RA 5KRSA 4MQ3A 4CF1A 3QESA 3RMAA 1HNVA 1RTDA 4CFBA 4DTSA 3AVHA 4LY7A 4B3OA 3EYZA 3AVAA 4CJ4A 4CEQA 3DLRA 4PA1A 3OYAA 4C8KA 4J2AA 4DSEA 1HRHA 3DLBA 5KGXA 3HK2A 1FKPA 3MEEA 1TK8A 3WNHA 3V9SA 1WSFA 1C0TA 5SZTA 4CCHA 3C94A 2NUBA 4NCGA 1RNHA 1VSIA 1RT4A 2Q3SA 4HTUA 4FLZA 3LPTA 1WNSA 1W9HA 2WONA 1TKXA 3OYCA 5J2QA 1KVAA 1U47A 4B8AB
chains in the Genus database with same CATH superfamily
3TTFA 3MWPA 1DGKN 4R79A 3QFUA 3FFIA 4FJKA 4BRLA 3CC2N 4IZ9A 1B9FA 1W97L 3ULEA 5AQUA 3VETA 5LMUK 4Z94A 4DR4K 2Q36A 2YNFA 4H5VA 3P1GA 4BR5A 3WXJA 5HRPA 4BR4A 4GVEA 2PAVA 3PUFA 1YVUA 4CGFA 4B1UB 1LAWA 3E9PA 4E0DA 2P9IB 5B8HA 5LJVA 3VF6A 3RMBA 4HUGA 1NBWA 2ZWHA 2NRZA 2ITGA 3MECA 1TAQA 3IAYA 3DOKA 3SPZA 1NJIO 4M3WA 4I2QA 5AQIA 3RSEA 3RTVA 3DXMA 1JKHA 1S6QA 1ZYQA 1Q9YA 4B9VA 4H0PA 3NHGA 1Y64A 1JLEA 1NKBA 3DM2A 1JLQA 3OYBA 1RTJA 2B5JA 1GLDG 2OPPA 2FSKA 3CJ7A 3ID8A 4ELVA 3VEZA 1OH5A 2IGIA 5AJ3K 1WAFA 4FM1A 3O9SA 4BE1A 4LF7K 1VQPN 4Y0WA 2YX6A 5AFUA 4FLTA 1Z05A 3CERA 3A5NC 5CHIA 5KPRA 3OYEA 2F8TA 4FLYA 3O3GA 3WNFA 3KK3A 3NFAA 2KW4A 4YOUA 3DXMB 3HYFA 5AQXA 1HQUA 3R3LA 1K8KB 1XMOK 1HYSA 1KAZA 3O08A 4A2BA 3O3HA 4O55A 4CJEA 1R0AA 1GLAG 3EZWA 2F7TA 1U2VB 1QZ5A 2D1KA 5EX5A 1IKVA 1QQCA 3JXUA 2CH6A 1Q86O 1WUAA 5AQYA 3DLHA 1JXBA 1T44A 5KQDA 2QWNA 2E2PA 3AVIA 4AHVA 2UXDK 3MEDA 4CZKA 2BANA 4FCYA 3KTQA 1E4FT 3QICA 3PY8A 3LDPA 1NMDA 1TUYA 4B9LA 3AARA 2D4WA 5KGWA 3LANA 4BROA 2VG6A 3VQ5A 4HUFA 5K14A 3SAGA 3ENHA 5AQOA 5AQPA 1RDAA 1JLCA 1U2VA 3QEVA 5AQWA 3V81A 2YNHA 2OTLN 4FXDA 1QQOA 4HVJA 1WSJA 3B6PA 4X66K 4DSLA 4V19S 2O8CB 3V1RA 1YTAA 3OYHA 3LZIA 1FJGK 4OX9K 4BRPA 3EO3A 3KLEA 1HR0K 3ZYYX 4PUOA 4OKKA 2X6SA 3DLLL 4CEAA 3CMEN 2JLEA 3HRGA 2P9NB 3GBTA 4DR6K 1HQEA 2V51B 3TTCA 4B3TK 3MMVA 4M7YA 3VTIA 1Q81O 2A42A 2D0CA 3ENOA 4DQ8A 2YHYA 3CM5A 2NZTA 1RDDA 4FWKA 2HHVA 3E01A 1WLJA 3KIOA 1BCMA 1HKCA 4JNEA 2NRRA 2XRIA 4IO8A 1N32K 3M8SA 2ZM6K 1NK8A 1MDUB 2VG7A 4KHQA 2V7ZA 4IBNA 3TR8A 1MWKA 4N47A 3SAHA 4BC3A 2OA8A 2OPQA 4WQ4C 5BN8A 4PL8A 4FWNA 4DR7K 1HPMA 2F9TA 4Z4FA 3O5BA 4CZMA 1JLFA 1DTTA 4AM6A 1LWEA 4CW7B 1GOBA 3THWB 3FZLA 2O4GA 1HKGA 4YNQA 3OYFA 2P9KA 2IC3A 4AILC 4GV6A 4CBXA 5IT9O 4ISEA 3LM2A 4KFBA 1HJOA 3MN7A 1Z6RA 1SV5A 2GEMA 2EX3A 1NK4A 2IVNA 3D2FA 3S3OA 4CJ7A 4M3YA 3S9HA 4QS7A 2B6AA 4F9OA 3ZEUA 4CGHA 4JLHA 5C15A 4H0TB 1TUUA 5KI6A 4G1QA 1JLBA 3G0ZA 3HSCA 3VGKA 2XY8A 3CFOA 3K2PA 1EWRA 1T6DA 1BO5O 3AO2A 1ZXOA 3ZT3A 3A0IX 4JHDA 4DTOA 4BGBA 3CIPA 3IKMA 3QFPA 1RBRA 3TSQA 3KKSA 4I9LA 3OTOK 2QXFA 1YIJN 1C0FA 3AGKA 3AVNA 3ULDA 4NXMK 5CZ2A 1T3VA 1RT6A 3ZSZA 2D0OA 3CPWM 4FZYA 5C0YA 4PKIA 4ZTJA 3QBXA 4JEPA 3T1HK 4CGDA 3MEGA 4E1NA 1XHXA 3I55N 2GWKA 4J8FA 1YHQN 1VQ8N 1YF5L 2GBZA 1X9SA 1YVNA 4KI4A 3BF3A 1KSPA 3J8AA 1IKWA 4CEDA 1UOCA 3CCVN 3G4SN 3I8DA 4K8XA 3S41A 1CZBA 4DR5K 5BR8K 1ZBFA 3G10A 2P9UB 4CGJA 1YAGA 3D45A 3CJBA 3J7YP 5AQHA 4JKAA 5JICA 2VQEK 2HW3A 4JKBA 3E66A 4FJ9A 4CJ3A 3KD5E 2HBJA 4NO7A 1BU6O 2BTFA 3QEPA 3NVMA 5TKWA 4CHYA 4FL9A 2E2QA 3HO1A 3P38A 1NGGA 3L0QA 4H0OA 4FWMA 3QMLA 4AF1A 3WUHA 4CD1A 4CHPA 1ESVA 4XEIA 1KD1O 4CHOA 3VQCA 5M1QA 4O4GA 3MXIA 5HROA 4BR2A 1S9EA 2P51A 3MAQA 4KH5A 4F8RA 5H1SQ 2P9UA 4DFPA 3ZX0A 1WSIA 4KHYA 1NKEA 4DR3K 4JRPA 2NNWA 1N36K 4CJTA 3PX0A 3FE1A 3SUOA 3GOIA 4BRQA 4U67L 1QSSA 3CJCA 1WOQA 4CJWA 1L3SA 3ID6A 1DTQA 2QWQA 3P39A 4B1ZA 4WFNL 5AZJB 4IJNA 3VENA 4CGGA 3TWHA 3SQ4A 5FPNA 2O8FB 3DJCA 3UIQA 2I7NA 3EY1A 2V7YA 1H1VA 3NE6A 4BR9A 3IDHA 3ASMA 3V1OA 4DQIA 4FLXA 4E1JA 1TYQA 4JYAK 4CEEA 1N33K 5HRNA 3VQ4A 2GTDA 4DV2K 3SJJA 4WF9L 2HMIA 1QQNA 3J80O 2NRXA 4EZ9A 1ITGA 4FLVA 1NGCA 4IJAA 5HBMA 3ZT4A 4PHTX 4RWTA 3ZSQA 1L5UA 3FFKB 4CFAA 4A2AA 3HZ6A 1WN7A 4BRGA 3VQAA 2IDOA 1VSLA 1XNRK 1W0HA 3VF2A 3PSFA 1NGBA 3U8XA 3PX6A 3CC7N 3R6MA 4U7BA 3VQ7A 4CFCA 3H08A 3TU5A 3G71N 4IG0A 4I7FA 4HTLA 5C42A 1S72N 1XC9A 3C6AA 3E9LA 3AA4A 1BUPA 3SNNA 5FPEA 3I0RA 1RBVA 5MLCQ 5J2MA 3CD6N 1V4TA 3O1BA 5CR4A 2Z1HA 1UWBA 3ZSXA 2QWRA 1VSJA 3I8BA 4KHNA 2QKBA 3OS0A 1KVCA 4BC2A 3K0SA 1NKCA 3WXLA 4DG1A 4DV7K 2YI1A 2A5XA 3K5NA 4MO5A 3Q7BA 1HUXA 3RMAA 4OPAA 5C10A 3UKUA 3AVAA 4CJ4A 4CEQA 4PA1A 4C8KA 4J2AA 3DLBA 5KGXA 1FKPA 3MEEA 5JLFA 3WNHA 1U6ZA 4C23A 5AFUH 1VSIA 4FWSA 1RT4A 4HTUA 3LPTA 3OYCA 1KVAA 2NLXA 1U47A 4KH4A 4CZJA 3DI6A 4HUEA 4JI2K 3R9PA 1P90A 3EKSA 2XY5A 4FO0A 1CZAN 5KTQA 2ASPA 2VYPA 3CC4N 3I33A 1EX4A 1ASVA 2QI2A 3QETA 1XI1A 4FJJA 4NLCA 1QSYA 2ZQBA 4A59A 1X1PA 4FJHA 3C0BA 4KAZA 3OYNA 3L4IA 3M3ZA 2CGKA 3CFPA 2G8IA 4KHSA 3L2RA 1VQ4N 3L4QA 3LAKA 4BC4A 1TKDA 4JK8A 5M1NA 4DQQA 3HVTA 4BQLA 1EO1A 3CF5L 4IDHA 4WQ5C 1CZ9A 1KQSM 1D5AA 1FXXA 4IEIA 3C6UA 4CF8A 4CGIA 2YHAA 4IG3A 5HLFA 4UQGA 3PX4A 4IFVA 3ALYA 3V6DA 3V9XA 4CK2A 4CF9A 4L8RB 4CHQA 3DXKA 4MLEA 3SUQA 4J2BA 3K59A 3HVRA 4NXNK 1QTMA 3D2EA 2PYJA 3SAFA 3NGZA 4BG8A 4KB0A 4MO4A 3CFRA 4DFJA 1S1UA 3K5LA 2FXUA 4JKGB 3EEQA 4IXCA 4G9ZA 4M3RA 3TAQA 1VRUA 3PV8A 4Q5VA 3D0PA 3R1XA 4DTNA 2A41A 3VQPA 2Q2RA 3RWUA 3ZT0A 1EKEA 3RRHA 1LW2A 3OS2A 4K25A 3CCLN 3RSEB 4AHRA 1X3NA 4WFAL 4O0IA 3MXMA 3WXIA 3TAEA 1L3VA 1UA0A 3QEIA 4BWMA 3DRRA 3H46O 4B8CA 4CHNA 4OKJA 5GAGP 4W5QA 3TI0A 4WQ5A 2E6MA 4GNIA 4EP5A 1BA1A 1J53A 2E1ZA 1X9JA 4DV4K 1O1WA 4B3RK 3A8YA 1IH7A 4DB3A 1HYZA 5AQTA 1WSHA 3T69A 2UU9K 4OLBA 3LM9A 1RGIA 4LFCK 1V4SA 4MLHA 4A5BA 2OCEA 2HHXA 3GDQA 4EFHA 1D9FA 5ADXH 4CZHA 3DYAA 2AA4A 4CK3A 5AQLA 2HMPA 4W5NA 4B9TA 1JLGA 2WTUA 4ZHRA 3TABA 3KWGA 3OA9A 3UE5A 3KVGA 1LAVA 4M63C 2VWKA 3HI0A 4LF9K 1K73O 1U4BA 3KWIA 3HXMA 2IAJA 3PO5A 2AJQA 4H5RA 1TK5A 5I42A 4JI0K 1BI4B 3RMCA 2RPIA 4KBOA 4BE0A 4Z4CA 2ZJPL 3J81O 1F21A 4E7LA 4C1NK 3O8MA 3K5OA 2ZJQL 1A5XA 3ENBA 3T1AA 3H1VX 1KFSA 3T7ZA 2DFHA 1WSEA 1L3UA 3NGIA 1KVBA 4J2EA 2O8CA 5AR0A 4JKFA 5HL7L 4FJXA 2Q97A 1KLMA 2BH1A 4FSVA 4JS4A 1Z25A 1G15A 3SQ2A 2HHWA 3L6QA 3B6OA 4KI6A 4DKWA 3KLHA 1IG8A 1BI4A 4OPHA 4JN4A 3SQ0A 2E2NA 2G8UA 4BGAA 1NGHA 4FYDA 3TAMA 4JI8K 4B9UA 2KHOA 5AQFA 1TGOA 1DLOA 4BRHA 5E26A 3VQDA 4Y1CA 3SJHA 4CIEA 4XH1A 3K58A 4CJVA 3NF6A 2HVIA 4XH4A 1BA0A 1ZBIA 2RKIA 3C6TA 1S1WA 2QKKA 4H0YB 2OYQA 3DMJA 4M45A 3HP9A 4C8MA 3E1YA 1J54A 1LWCA 1NGIA 4OLAA 2RN2A 4ILJA 2GUPA 3K5MA 4L3QA 4M3XA 3JS6A 3OVNA 1U48A 2CGLA 3BEXA 3SK3A 3U6FA 1I39A 4LSNA 1Z26A 3LDOA 4ZTFA 2Q31A 4GV9A 3CI5A 3F9MA 3LP2A 3V4IA 5F2RA 1LOTB 2HB5A 1IG9A 4H0XB 4CI6A 4CZLA 2QXLA 4RW7A 4UY8O 1Q9XA 3QNNA 1GLJO 4OGCA 4M3ZA 3VN5A 3U3GA 4EAHD 4GW6A 5M1PA 4JK9A 1CXQA 3JYTA 4DLEA 3CMAN 5GAHP 4JHDB 2RF2A 3T1YK 1ZBUA 2NRTA 3CPEA 4BRMA 1GOCA 2G8VA 4GVMA 5F1XA 2QM1A 4CEOA 4KTZA 4RW6A 3VGLA 1SAZA 4NYFA 3QDKA 1NK5A 4KRFA 3BY5A 4WE1A 1TAUA 1XC3A 3CCSN 3WEEB 5BPLA 1R59O 3EE9A 2UXCK 1GLFO 1RT5A 3VA3A 3QERA 1HJRA 3O4NA 2OPSA 1VQON 3LDLA 2E5LK 4DU4A 2F9WA 4JI5K 3DLKA 3DLGA 4PY5A 4GKJK 3M8PA 4OO1J 4YY3K 1NK7A 2O8DB 4XIUA 1MA9B 3O9QA 4KO0A 4CIGA 3VMFB 5BREA 3HM8A 4H0VB 1NK9A 4DV5K 1BQNA 3ATVA 3PLAA 3NH2A 4WQ4A 2P9PA 5C25A 4NCAA 2KTQA 1QHAA 1XQSC 1D8YA 5FPMA 3UKRA 4DHYA 2FF6A 1VK0A 2V52B 4KV8A 4WYBA 2QWPA 1KC8O 1WBBA 1S6PA 3CCEN 2W6KA 4GY2B 3NCIA 4QAGA 1RTHA 4IOXA 1JLAA 1Y97A 1NLVA 3TSPA 1YT3A 4DFMA 2KFZA 3WNEA 3LDQA 3ZETB 2G8KA 3Q7CA 1JCFA 3ZX2A 3IG1A 1RBTA 4IWVA 2P9SA 3FR0A 3A5OC 2P9PB 1MWMA 3O4WA 4DU3A 1J5EK 3EN9A 4FOIA 4OPKA 3I56N 3DAWA 5GIOA 1SKSA 4C8LA 2O8FA 3HTVA 4JKHA 4B08A 2ASMA 2YJEA 5HP1A 2QWLA 3MDQA 3N4QA 4DSFA 4M42A 3VQ9A 3BDPA 5AQNA 3F9KA 4K43A 3CQXA 3VESA 2P5OA 4KHWA 1C6VA 3AVCA 3FZMA 3ULEB 4E7HA 1GOAA 4DTMA 1NNEA 5BPMA 3LAMA 3EZ5A 3EKUA 1TKTA 5E84A 1K9MO 3KK7A 1TV6A 4FJ7A 3FGUA 3OHRA 4CF1A 2P9IA 4CFBA 4BRKA 3EYZA 3DLRA 3OYAA 1EWQA 3P31A 2QEXN 2PFUA 3HK2A 2P9LB 3V9SA 2NRVA 1C0TA 5BRDA 3DWLA 4B1XB 1QZ6A 5J2QA 1TKXA 4B8AB 4JKEA 3CCQN 3WNGA 5C24A 3ZX3A 2FBTA 2IS3A 3LP1A 3N4PA 1NGAA 4PQUA 3OYLA 3C7NB 3HBTA 4Z4IA 3U4LA 2VWJA 1QQMA 2CGJA 2D0BA 2ETJA 2WUSA 4FWOA 4IDKA 3MK6A 3KZBA 4BRDA 3AAPA 5AQVA 3SLCA 3SBTA 1WSGA 2HHQA 4H03B 2P9LA 1S1XA 3OY9A 4IOCL 2ITMA 4LC9B 5BPNA 4GV3A 5AQSA 1K8KA 4AHCA 4BDYA 2G8WA 2G8HA 3QLHA 2P1JA 3ZSVA 3WQTA 3NDKA 1K6YA 5T7BA 3AA2A 4FK2A 3UKUB 1RDCA 4J2DA 3QEWA 1S22A 2KKZA 2X74A 4FJGA 1RBUA 3C95A 2E4LA 1A5WA 5FPDA 3KLFA 4CBUA 5AQJA 1NU0A 2EWSA 3TTDA 4FOEA 5M1OA 1S1TA 2AP1A 3CJ9A 4DTPA 2Q1NA 1NJWA 2ZD1A 4FW1A 4YORA 3CCRN 4E7IA 1OVQA 1DEJA 1L3TA 1IBKK 3D6RA 3CJAA 4FJ5A 4OVLA 1RCHA 4W5OA 1B92A 4FM0A 2FBVA 4MDAA 5M1FA 2ZGYA 2UXBK 2HHSA 4AHTA 1YJNN 2FBXA 4Z4HA 5GIPA 3AO5A 5KRTA 1TKZA 1I3AA 3KHYA 4B3MK 1P8ZA 2GELA 1BQMA 1GLLO 1RT7A 3THVA 3RVCA 3J7ZO 4B9SA 3NF8A 3QINA 2HBMA 2KZMA 4LFBK 4YOXA 1VQMN 4O8KA 3W0LA 3E9OA 5AZIA 4DTUA 3SCXA 2HOEA 4CK1A 4A5AA 2XY6A 1ZBHA 3RRGA 3IMXA 5F0XA 1T03A 3ZSRA 4FJIA 5EXWA 3OYIA 3V9WA 4FWPA 4XH5A 4JI1K 1ATSA 4M3TA 4KPYA 4PWDA 3L2UA 4JAXA 5JS1A 3JAMO 2XO7A 3LZJA 1U49A 1C1AA 3BZKA 3CYMA 5BRFA 3M8QA 1QSLA 3NH0A 4JKGA 4BVPA 2OTJN 2Q0RA 4K42A 3AGRA 4JI3K 1IO2A 2IOCA 2ZE2A 1BISA 2QWMA 5AQMA 3L2VA 4FWRA 4H8KA 1ASWA 4EZ6A 4HCBA 3D2FB 4A61A 5I9EB 1GLBG 3OYDA 4O8UA 1NM1A 4ILHA 2UUAK 1DKGD 1VQNN 3MWTA 3M8RA 1RDWX 4CF0A 1YITN 3VTHA 1NG9A 3UB5A 4BRNA 2O4IA 2XHBA 5CYQA 1KAYA 2UYTA 5FDLA 2FLOA 3SYZA 4FJLA 4DR1K 3B8AX 1EETA 4FZXC 4PL7A 1OH7A 3P83D 1Q7YO 4PKHA 1BCOA 3CM6A 4JRQA 1QVGM 3LL3A 1HYVA 4KKOA 3M1FA 3HJFA 2OANA 2DPNA 4B1YB 4O5BA 1U45A 2X6NA 3EL2A 4DWIA 1XNQK 2IVOA 3WXMB 2VGMA 3AO3A 4TSXA 1VQ9N 3C6HA 1NJXA 1OH6A 3VEOA 3TAPA 1NMNA 2PY5A 2HHUA 2FSNA 5J1EA 4DF4A 3IRXA 3AVKA 1FKOA 4MFBA 2FF3B 4N56A 4LF5K 3GG4A 4IFEA 4ELTA 2P9SB 3H3NO 4BC5A 3AA3A 3LALA 2HNZA 2WOMA 3PSIA 3CCUN 2FC0A 4EHTA 2YCHA 4BVOA 1S1VA 4X65K 3O3FA 4CEFA 4F2SA 1HNXK 5HOOA 2DFFA 3HPHA 4FPAA 3CETA 1ILYA 3OJUA 1VQ5N 3ZSYA 5AQQA 5FRNA 1TK0A 1VSFA 1NGDA 2QW9A 3KK1A 4DQPA 1KCFA 4CEBA 1K8AO 3QBWA 4YOTA 3ZSWA 4JS5A 4DV1K 2HBLA 1BWFO 1RTIA 3QEXA 4CESA 3O9RA 1VHXA 1C1BA 2ZGZA 4RW8A 1OH8A 3T19A 4E1MA 4LH4A 1HKBA 3F73A 3QIPA 4QS9A 4C1NI 4NCBA 1O13A 4K8ZA 1Q8IA 3TPQA 3NF9A 3K57A 2OPRA 3VEYA 1EQYA 2EHGA 4FWLA 2GUIA 2DY4A 4YOVA 2FSJA 2E88A 4FJMA 1A5VA 2E8AA 3QB0A 1SL0A 4YOWA 5DM7L 2G8FA 3F5TA 3KJVA 5SWMA 1KLNA 2NRWA 1NWKA 3VA0A 3ZT1A 1OKJA 2HF4A 3MN6A 3ISNC 2PYLA 3NF7A 2RE2A 4JI7K 1DT9A 4BG9A 4N41A 2W42A 2KFNA 3CJ1A 1BOTO 4CJKA 4N76A 4CJSA 1SKRA 3AA5X 2I7PA 4BREA 1NOYA 1YUWA 4CJQA 4WFBL 4DS5A 1VQ7N 4LF6K 3O9TA 2YHBA 2UUBK 1SZ2A 3NH1A 4CJFA 3SV4A 3GL1A 3U9ZA 1QS4A 5FLXO 1X3MA 4IOAL 4CECA 4NLBA 3L8BA 3RMDA 2KQ2A 3ZT2A 1RBSA 1WAJA 4LH5A 5AQRA 3WXKA 2D0PA 2A1RA 1N34K 2JWLA 4KHPK 4H4OA 3AV9A 4DU1A 3O6WA 3M6GA 2F8SA 3P5JA 5EY4A 4BDPA 1RT2A 3K9KA 4F3TA 5LMNK 2OZMA 3MXJA 4YHHK 4KTWA 1S5JA 4CJLA 4NB4A 4EIAA 1FW6A 2HF3A 4FLUA 2BDPA 5JVHL 2VGNA 1SS6A 4C8OA 4LF4K 4H5TA 1NJYA 1UAXA 4Z0UA 3HOTA 3SPYA 1CXUA 4JD2B 1YJ9N 4DS4A 3THYA 5CE3A 5TKYA 1TYQB 3M5RA 4RTFD 4K41A 1RILA 3MCAB 3RR7A 3SI6A 5HRRA 4FJ8A 3AY9A 3IFRA 5E41A 4MDBA 3A5LC 5AQGA 3TSUA 1D4XA 5AZIB 2Z1GA 4F4KA 4Z4GA 1NJZA 3G6EN 3VQEA 4FK4A 4E3SA 4JK7A 4FZZA 4B9NA 3UKRB 4W5RA 4DV3K 1YJWN 5EVZA 4DTSA 4LY7A 5C2FA 1HRHA 1XMQK 1TK8A 1NGEA 1WSFA 1VQLN 1JCGA 4YDUC 4CCHA 3C94A 4NCGA 1RNHA 3AAQA 2E2OA 3ZETA 3CQYA 1ZBSA 3CHWA 5IWAK 4CHZA 1EP4A 3A2FA 4CBWA 3BUZB 5J2PA 1U04A 3TANA 3AVJA 2ZJRL 1C0MA 3IUCA 2F96A 3KLGA 1CLQA 1REVA 4IFYA 2IVPA 4F3OA 2DTUA 4BRCA 4I6MA 3DXKB 2RHKA 4I9QA 4OGEA 1KTQA 4ISFA 3QO9A 4O5FA 5LY3A 1X9WA 4B9MA 3RR8A 2VG5A 3V9UA 5LL6Z 5DM6L 1JXEA 1XHZA 1TL3A 4ID5A 3D7EO 4BQZA 3FZFA 3NMUA 5KPTA 1NGJA 5C2DA 4X64K 4E19A 4DSKA 4GKKK 2B4JA 4BWJA 4Y1DA 3KK2A 4CERA 4B1WB 4I6MB 4OKEA 4YOYA 1T6CA 1HNWK 3L3UA 1GLEG 3O1WA 3GE1A 4DSIA 2YKNA 3NBPA 3VPZA 4RCHA 3V9ZA 1M90O 1KXPA 2Z1JA 5AQZA 4BACA 1RDUA 2GWJA 3LPUA 4QS8A 5DMRA 3MN5A 3OW2M 3FZHA 4HWIA 3SV3A 1RDBA 4BY9C 3CQ8A 2O8BA 4B9QA 1IV0A 3WQUA 2A6AA 4DQRA 2HNYA 4BDZA 3VF4A 3VEWA 2QK9A 3NAEA 4KHUA 1EXQA 5DK5A 3OYMA 3U3YA 3R8EA 4M7XA 1JCEA 2NRHA 3HSTB 4CVNE 1G99A 1J6ZA 3O9UA 1VQ6N 3TAFA 4DLGA 4CJRA 3AVBA 4JI6K 5D3GA 3SQ1A 4ICLA 2P5GA 3DOLA 5EOYA 3D2EB 2W40A 2O8BB 4A62A 4CF2A 1YTUA 4FLWA 4DUZK 4IEEA 5KQ8A 2H3GX 4FVMA 1S3XA 3F2KA 3HPGA 4BR7A 4A57A 3BF1A 3FZKA 3VOVA 1T8EA 4ELUA 1FK9A 1C1CA 3L2QA 3TAGA 4IKFA 3LWMA 3L3VA 2O8EB 2GX9A 5FROA 4CJUA 4RG8A 3ZEUB 4ID1A 2UUCK 3HM9A 4CIFA 1VSMA 2XY7A 1J9AA 2BUPA 3AO1A 2QTDA 5FRMA 3DLEA 3MX2A 2D5RA 4DV0K 3OJSA 1W2BM 2HHHK 4CD3A 3QIOA 3L2WA 1VSKA 2D0AA 3VQ6A 1GLCG 3ATUA 5BRHA 2FBYA 4BRFA 3AVFA 3C65A 4PKGA 5ELZA 3ZLJA 3VEXA 1QVFM 5GADP 3K9JA 5M1KA 3NVKA 1N8RO 1QE1A 4K0KK 2JWKA 4O0JA 3CCJN 1S9GA 4YDUA 1E3MA 3KLIA 4FPBA 3VQQA 4CZGA 5JS2A 2OZSA 3O80A 1VSEA 4JKCA 1NK6A 3HL8A 4E7JA 3AO4A 4KREA 1XUPO 1VSHA 1TL1A 4LF8K 1SL2A 4YFUA 1ATRA 3S3MA 3H1QA 1E4GT 3OYJA 1HNIA 2QWOA 1HMVA 4OJRA 4E89A 4DR2K 4CFDA 2KZZA 1C0UA 2YHWA 1BIZA 4NYNA 4JI4K 3CG7A 1T05A 3BZCA 3ZSOA 1SUQA 3I0SA 3PO4A 4AH9A 3LP0A 4ISGA 2BE2A 1RT1A 5ADXA 3VEVA 3MX5A 3OYGA 4I2PA 1B9DA 2PBDA 4F2RA 5EU7A 3SMPA 2A40A 4DF8A 3CXCM 1Q82O 4AQYK 4DFKA 1VSDA 2E1YA 2YKMA 3OBYA 3LP3A 1ZBLA 4KH6A 1XWLA 1LV5A 4M3UA 4JD2A 4H4MA 4RW4A 2PZSA 3HPOA 3U9DA 5CY4A 3THYB 2HHTA 1W7AA 2Y1IA 1C0GA 2YJFA 3NGYA 3LDNA 1TVRA 3KKRA 1RFQA 4O44A 3PIPL 4HHTA 3S3NA 2BGGA 4FM2A 1KFDA 3AVLA 4LD0A 1M1KO 4FVUA 4N5SA 5AZJA 2Y1JA 4Q0BA 4DSJA 4CZFA 1RT3A 4FW2A 1IBLK 4DTRA 3CCMN 2CH5A 1YI2N 3IS9A 4ILGB 2GV9A 3OBWA 3SUPA 4JKDA 3FLCO 4KB1A 4RW9A 3J7AP 5HRSA 1NGFA 2YNGA 4BRAA 2R7YA 1J5OA 1Q18A 3ZCMA 5JMVA 2E20A 2I5JA 5AQKA 1IKYA 1JJ2M 4OPJA 1WB9A 2P9NA 4CZIA 4M41A 4AM7A 4R5PA 3DRPA 4DQSA 4W5TA 4FJNA 1BDGA 5GAEP 3AVGA 3BGRA 1HPZA 3LDSA 3SUNA 1KAXA 3EE8A 1JL2A 5I3UA 2JGUA 3V1QA 3HP6A 3QNOA 4GMJB 1HLUA 1T7PA 2E6LA 2ATQA 5LJWA 4CJPA 4DV6K 3VQ8A 1WBDA 4HCCA 5CZ1A 1IBMK 3SBGA 5C12A 2W6LA 5J2NA 4KTQA 1X9MA 4AHUA 4BR0A 2YV0X 1ATNA 4DCHA 2YHXA 4E7KA 3THWA 3ITHA 1BL3A 1BGXT 4DTXA 1BG3A 1IJJA 2HVHA 2P9KB 3SZ2A 4IO9L 4QCLA 4JV5K 1D9DA 1N6QA 2VCPA 4FWQA 3T3FA 2A1SA 5GINA 3W3DA 3OYKA 5A2QO 1OVYA 4CEZA 1BHLA 3JSMA 3VQBA 1SKWA 3DRSA 1VRTA 1JL1A 4Z4EA 1SL1A 3WEEA 5CYMA 4CJ5A 3SMSA 1MU2A 4B1VA 1VQKN 3AVMA 3LWLA 4WCEL 3MN9A 3KD1E 2ZF5O 3H3OB 1YXQA 2WC9A 2HNDA 4B3SK 3A5MC 1LW0A 2A3ZA 2HSTA 5BN9A 2WFBA 3G25A 3TARA 2Z1IA 2O8DA 4LSLA 3HOSA 4DTJA 1I94K 3THXA 2Q0UA 4CE9A 4BE2A 1BIUA 4H5WA 2LSNA 4QOZB 1N5YA 2KLAA 1LCUA 1SQKA 4EP4A 4C8NA 4CZEA 3HT3A 1LWFA 4DMNA 1KRPA 5JLHA 3OS1A 1UA1A 3O4QA 4FK0A 2DFEA 2W41A 2WBNA 3H45C 3WT0A 4AHSA 1NOZA 4DUYK 3C7NA 1ASUA 4LFAK 2X78A 3VGMA 1IKXA 2VQFK 1QHTA 2YNIA 4EHUA 1NK0A 5KRSA 3PIOL 4MQ3A 3QESA 3THXB 1HNVA 1RTDA 3MCPA 3AVHA 4B3OA 2IIRA 5BR9A 2J4RA 4DSEA 3BP8A 5JVGL 4X62K 1ZC6A 2VWBA 3P4IA 4H5NA 1HX1A 5SZTA 2ASOA 2F4VK 2QA4N 3VERA 2NUBA 4BRIA 1HNZK 2HBKA 2Q3SA 2O8EA 4FLZA 1WNSA 1W9HA 2WONA 3H6EA 1VAZA 5KPZA
chains in the Genus database with same CATH topology
3WNGA 5C24A 3DI6A 4CHZA 4HUEA 2FBTA 1EP4A 2IS3A 3A2FA 3FFIA 3LP1A 5J2PA 1U04A 2XY5A 3TANA 3AVJA 4FJKA 1B9FA 1C0MA 4PQUA 3OYLA 2F96A 4Z4IA 5KTQA 2VWJA 3KLGA 1CLQA 1REVA 4IFYA 2YNFA 4F3OA 2DTUA 2D0BA 2ETJA 3P1GA 4IDKA 5HRPA 1EX4A 3PUFA 1WSGA 2HHQA 1ASVA 1YVUA 4CGFA 4I9QA 1LAWA 1S1XA 3OY9A 4E0DA 4OGEA 1KTQA 3RMBA 3QETA 1XI1A 4HUGA 4FJJA 3QO9A 1QSYA 2ITGA 2ZQBA 1X1PA 1TAQA 3MECA 3IAYA 4FJHA 3DOKA 4AHCA 3SPZA 4KAZA 3OYNA 4BDYA 1X9WA 2G8WA 4B9MA 2G8HA 3QLHA 4I2QA 2P1JA 2VG5A 3RR8A 3V9UA 3RTVA 3ZSVA 1JKHA 1S6QA 3NDKA 1JXEA 1K6YA 1TL3A 5T7BA 3CFPA 1XHZA 3AA2A 3L2RA 1ZYQA 4ID5A 3NHGA 1Q9YA 4B9VA 4KHSA 4FK2A 1JLEA 1NKBA 3DM2A 1JLQA 1RDCA 4J2DA 3QEWA 3LAKA 3OYBA 1TKDA 1RTJA 4E19A 4DSKA 4DQQA 2X74A 2B5JA 4FJGA 2OPPA 3HVTA 4ELVA 1RBUA 3C95A 2E4LA 1A5WA 3KLFA 2B4JA 4BWJA 2IGIA 1CZ9A 1WAFA 4Y1DA 3KK2A 4FM1A 1D5AA 4CERA 1FXXA 1S1TA 4BE1A 3C6UA 4CF8A 4CGIA 2YHAA 4OKEA 4IG3A 4FLTA 5HLFA 4UQGA 3L3UA 4IFVA 3ALYA 3OYEA 3PX4A 2F8TA 4DTPA 1NJWA 4FLYA 2ZD1A 3O3GA 3V9XA 2YKNA 4FW1A 4CK2A 3NBPA 3V6DA 4CF9A 4E7IA 4DSIA 4CHQA 4L8RB 3SUQA 4J2BA 3WNFA 3K59A 3V9ZA 3KK3A 1L3TA 3NFAA 2KW4A 2Z1JA 3HVRA 1QTMA 2PYJA 4BACA 4FJ5A 3NGZA 3HYFA 4KB0A 4OVLA 1RCHA 1HQUA 3LPUA 5DMRA 3CFRA 4W5OA 1B92A 4FM0A 4DFJA 2FBVA 1S1UA 3K5LA 2HHSA 3SV3A 4AHTA 1RDBA 1HYSA 3CQ8A 2FBXA 4Z4HA 3AO5A 4O55A 4M3RA 4CJEA 3O3HA 3TAQA 1R0AA 5KRTA 1TKZA 1VRUA 4DQRA 2HNYA 1I3AA 4BDZA 3PV8A 4Q5VA 3D0PA 1IKVA 1QQCA 4DTNA 3VQPA 2QK9A 3NAEA 1BQMA 1RT7A 3THVA 3DLHA 3RWUA 3ZT0A 1EKEA 3RRHA 1LW2A 1JXBA 3OS2A 4B9SA 4KHUA 4AHRA 1EXQA 5DK5A 3OYMA 3U3YA 3NF8A 3QINA 4O0IA 3AVIA 4AHVA 3HSTB 3MXMA 2KZMA 3MEDA 4FCYA 2BANA 3TAEA 1L3VA 3KTQA 1UA0A 4DTUA 3SCXA 3TAFA 3PY8A 3QEIA 4BWMA 3DRRA 4CJRA 4DLGA 4B9LA 3AVBA 5D3GA 3SQ1A 4CK1A 5KGWA 4B8CA 3LANA 4CHNA 4ICLA 2VG6A 2P5GA 4OKJA 2XY6A 3DOLA 1ZBHA 4W5QA 3RRGA 3VQ5A 3TI0A 4HUFA 2E6MA 5K14A 4EP5A 1T03A 3ZSRA 1J53A 4CF2A 1RDAA 4FLWA 1YTUA 1JLCA 4FJIA 3OYIA 3QEVA 4FVMA 3V9WA 2YNHA 3V81A 4FXDA 3HPGA 4M3TA 1O1WA 4HVJA 1WSJA 3B6PA 1IH7A 4DSLA 4KPYA 1T8EA 3V1RA 1HYZA 4ELUA 1FK9A 4PWDA 3L2UA 1C1CA 1YTAA 5JS1A 3L2QA 3TAGA 4IKFA 3OYHA 2XO7A 3LZIA 3LZJA 1WSHA 3LWMA 1U49A 1C1AA 3KLEA 3L3VA 4OLBA 4PUOA 4OKKA 2X6SA 4CEAA 3CYMA 2JLEA 5FROA 1QSLA 3M8QA 2HHXA 3NH0A 4CJUA 1D9FA 4RG8A 1HQEA 3DYAA 4ID1A 4CK3A 3HM9A 2D0CA 4CIFA 4W5NA 1VSMA 4B9TA 1JLGA 2XY7A 1IO2A 1J9AA 2IOCA 2ZE2A 1BISA 3AO1A 3CM5A 4ZHRA 1RDDA 3TABA 3DLEA 5FRMA 3L2VA 2D5RA 4H8KA 2HHVA 1ASWA 3E01A 3OJSA 4EZ6A 1LAVA 1WLJA 3KIOA 4HCBA 1BCMA 3QIOA 3L2WA 2VWKA 2XRIA 1VSKA 2D0AA 3VQ6A 3OYDA 3M8SA 1NK8A 2VG7A 1U4BA 4KHQA 2FBYA 4IBNA 2IAJA 3HXMA 3PO5A 2AJQA 3TR8A 3M8RA 3AVFA 4N47A 1TK5A 4CF0A 5I42A 1BI4B 2OA8A 2G8IA 2OPQA 3RMCA 2RPIA 4BE0A 1QE1A 4Z4CA 2O4IA 1F21A 4E7LA 2XHBA 4O0JA 4Z4FA 1S9GA 5CYQA 1JLFA 3K5OA 5FDLA 1DTTA 3KLIA 3VQQA 1LWEA 5JS2A 3SYZA 4FJLA 1A5XA 1GOBA 3T1AA 2OZSA 2O4GA 1VSEA 1KFSA 1EETA 1NK6A 3HL8A 4E7JA 3AO4A 4YNQA 2DFHA 1WSEA 1L3UA 4FZXC 4KREA 1VSHA 3OYFA 3NGIA 3P83D 1TL1A 1KVBA 4J2EA 2IC3A 4AILC 1SL2A 4YFUA 3S3MA 4FJXA 1KLMA 1BCOA 3OYJA 1HNIA 3CM6A 4JS4A 4JRQA 1HMVA 4OJRA 1HYVA 4E89A 1Z25A 4KFBA 4CFDA 1C0UA 2KZZA 1G15A 1BIZA 4KKOA 3SQ2A 2HHWA 4NYNA 1SV5A 3B6OA 4KI6A 3HJFA 3CG7A 1T05A 2EX3A 3ZSOA 3KLHA 1NK4A 1SUQA 3I0SA 1BI4A 3S3OA 4M3YA 3PO4A 3S9HA 4O5BA 2B6AA 4AH9A 1U45A 2X6NA 3SQ0A 2G8UA 3LP0A 4CGHA 4DWIA 4JLHA 4FYDA 3AO3A 2BE2A 4TSXA 1RT1A 3TAMA 1NJXA 4B9UA 3OYGA 4I2PA 3TAPA 5KI6A 1B9DA 4G1QA 1TGOA 2PY5A 1DLOA 1JLBA 3G0ZA 2HHUA 5J1EA 4DF4A 4F2RA 5EU7A 3VQDA 2XY8A 3IRXA 3AVKA 1FKOA 3CFOA 4MFBA 3K2PA 4N56A 4Y1CA 3AO2A 3ZT3A 4CIEA 4DF8A 4DTOA 4DFKA 1VSDA 3K58A 4ELTA 4CJVA 3NF6A 2HVIA 1ZBIA 2YKMA 2RKIA 3C6TA 3LP3A 1S1WA 1ZBLA 2QKKA 3AA3A 1XWLA 2HNZA 3LALA 2WOMA 1LV5A 1RBRA 2OYQA 4M3UA 2FC0A 3DMJA 3KKSA 4H4MA 4I9LA 3HP9A 4RW4A 2QXFA 4M45A 3HPOA 1S1VA 5CY4A 3AVNA 3O3FA 3ULDA 2PZSA 5CZ2A 4C8MA 1RT6A 3ZSZA 4CEFA 4FZYA 4F2SA 2Y1IA 1J54A 1LWCA 4OLAA 2DFFA 2RN2A 3HPHA 3NGYA 4ZTJA 3K5MA 4M3XA 1TVRA 3OJUA 3KKRA 3OVNA 4O44A 1U48A 4HHTA 4CGDA 3ZSYA 3S3NA 2BGGA 4FM2A 1KFDA 3AVLA 5FRNA 4LD0A 1TK0A 1VSFA 3KK1A 3U6FA 4DQPA 3MEGA 1KCFA 1I39A 4CEBA 4E1NA 4LSNA 1XHXA 3ZSWA 4JS5A 1Z26A 4ZTFA 2GBZA 4N5SA 1X9SA 4KI4A 1KSPA 2HHTA 2Y1JA 3LP2A 1RTIA 1IKWA 4CEDA 1UOCA 4DSJA 4Q0BA 1RT3A 4FW2A 3QEXA 3I8DA 4CESA 4DTRA 1CZBA 3V4IA 4K8XA 2HB5A 3IS9A 1ZBFA 2GV9A 1IG9A 1C1BA 3G10A 3SUPA 4RW8A 4RW7A 3T19A 4LH4A 4CGJA 4RW9A 4E1MA 3QIPA 3F73A 1Q9XA 4KB1A 5HRSA 3D45A 4OGCA 3QNNA 4NCBA 2YNGA 4K8ZA 1Q8IA 2R7YA 1J5OA 3ZCMA 3VN5A 3NF9A 4M3ZA 3U3GA 2I5JA 2HW3A 3K57A 4GW6A 1IKYA 2OPRA 4FJ9A 4CJ3A 3KD5E 3QEPA 4OPJA 1CXQA 3JYTA 4CHYA 2EHGA 4DLEA 2GUIA 2DY4A 3HO1A 4FJMA 2RF2A 1A5VA 4M41A 1SL0A 4R5PA 1ZBUA 3DRPA 2G8FA 4CHPA 3KJVA 4DQSA 1GOCA 3VQCA 4CHOA 4W5TA 4FJNA 4O4GA 5SWMA 3MXIA 5HROA 4GVMA 3AVGA 3BGRA 1KLNA 1HPZA 3LDSA 3SUNA 2G8VA 4CEOA 4KTZA 4RW6A 3VA0A 1JL2A 1S9EA 2P51A 3ZT1A 5I3UA 2JGUA 3MAQA 4NYFA 3V1QA 1NK5A 3HP6A 4F8RA 3ISNC 4KRFA 4WE1A 3NF7A 3QNOA 2PYLA 4DFPA 1TAUA 4GMJB 1T7PA 1WSIA 4KHYA 2E6LA 1NKEA 4N41A 2W42A 2KFNA 2ATQA 4JRPA 4CJKA 4N76A 4CJPA 4CJSA 1SKRA 3VQ8A 1RT5A 3VA3A 3QERA 1HJRA 3O4NA 3AA5X 4CJTA 3PX0A 2OPSA 3SUOA 1QSSA 5CZ1A 4HCCA 1NOYA 4DS5A 4CJQA 4CJWA 2YHBA 4DU4A 1L3SA 1DTQA 3NH1A 4CJFA 3DLKA 3SV4A 5J2NA 4CGGA 3SQ4A 1QS4A 3TWHA 4KTQA 1X9MA 3DLGA 4PY5A 4AHUA 2YV0X 3M8PA 4CECA 3UIQA 3L8BA 4E7KA 3RMDA 1NK7A 2KQ2A 3ITHA 3ZT2A 4XIUA 3EY1A 1BL3A 1BGXT 1RBSA 4KO0A 4DTXA 3NE6A 1WAJA 4LH5A 2HVHA 3ASMA 4CIGA 3V1OA 3SZ2A 4DQIA 4FLXA 1NK9A 1BQNA 4QCLA 1D9DA 1N6QA 2A1RA 3NH2A 3T3FA 4H4OA 2A1SA 3AV9A 4CEEA 5C25A 5HRNA 3VQ4A 4DU1A 4NCAA 2KTQA 2F8SA 3P5JA 3OYKA 3SJJA 1D8YA 4CEZA 4M3WA 4BDPA 1RT2A 4F3TA 1BHLA 3JSMA 3VQBA 2HMIA 1SKWA 3DRSA 1VRTA 1JL1A 1VK0A 4Z4EA 1SL1A 4EZ9A 1ITGA 4KV8A 4FLVA 5HBMA 1S6PA 5CYMA 3ZT4A 3MXJA 2OZMA 4CJ5A 3NCIA 3ZSQA 1L5UA 4KTWA 4QAGA 1RTHA 1MU2A 1JLAA 1S5JA 1Y97A 3AVMA 4CJLA 3LWLA 4CFAA 3KD1E 1WN7A 3VQAA 1YT3A 2IDOA 1VSLA 4DFMA 2KFZA 2HNDA 4FLUA 3WNEA 2BDPA 1LW0A 1W0HA 2G8KA 4C8OA 3IG1A 1RBTA 1NJYA 1UAXA 2Z1IA 4Z0UA 3PX6A 3TARA 4LSLA 4DTJA 3SPYA 3VQ7A 1CXUA 4CFCA 4DU3A 4CE9A 4BE2A 3H08A 1BIUA 4IG0A 4DS4A 4I7FA 5C42A 4OPKA 2LSNA 1XC9A 4QOZB 1N5YA 1SKSA 3AA4A 4C8LA 4EP4A 4C8NA 3SNNA 1RILA 3HT3A 4B08A 3I0RA 1RBVA 3RR7A 3SI6A 1LWFA 5HP1A 4DMNA 5HRRA 5J2MA 1KRPA 3OS1A 1UA1A 4FJ8A 3O4QA 5E41A 2Z1HA 4FK0A 1UWBA 3ZSXA 4DSFA 4M42A 2DFEA 3VQ9A 3BDPA 1VSJA 3F9KA 2P5OA 2Z1GA 4KHWA 4KHNA 1C6VA 4AHSA 2QKBA 3OS0A 4F4KA 1NOZA 1KVCA 3AVCA 4DTMA 4E7HA 4Z4GA 1ASUA 1GOAA 1NJZA 1NKCA 2X78A 3LAMA 4DG1A 3EZ5A 1IKXA 1TKTA 3VQEA 4FK4A 4E3SA 1TV6A 4FJ7A 4FZZA 1QHTA 3K5NA 4B9NA 2YNIA 1NK0A 4W5RA 5KRSA 4MQ3A 4CF1A 3QESA 3RMAA 1HNVA 1RTDA 4CFBA 4DTSA 3AVHA 4LY7A 4B3OA 3EYZA 3AVAA 4CJ4A 4CEQA 3DLRA 4PA1A 3OYAA 4C8KA 4J2AA 4DSEA 1HRHA 3DLBA 5KGXA 3HK2A 1FKPA 3MEEA 1TK8A 3WNHA 3V9SA 1WSFA 1C0TA 5SZTA 4CCHA 3C94A 2NUBA 4NCGA 1RNHA 1VSIA 1RT4A 2Q3SA 4HTUA 4FLZA 3LPTA 1WNSA 1W9HA 2WONA 1TKXA 3OYCA 5J2QA 1KVAA 1U47A 4B8AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNG A;  5C24 A;  3DI6 A;  4CHZ A;  4HUE A;  2FBT A;  1EP4 A;  2IS3 A;  3A2F A;  3FFI A;  3LP1 A;  5J2P A;  1U04 A;  2XY5 A;  3TAN A;  3AVJ A;  4FJK A;  1B9F A;  1C0M A;  4PQU A;  3OYL A;  2F96 A;  4Z4I A;  5KTQ A;  2VWJ A;  3KLG A;  1CLQ A;  1REV A;  4IFY A;  2YNF A;  4F3O A;  2DTU A;  2D0B A;  2ETJ A;  3P1G A;  4IDK A;  5HRP A;  1EX4 A;  3PUF A;  1WSG A;  2HHQ A;  1ASV A;  1YVU A;  4CGF A;  4I9Q A;  1LAW A;  1S1X A;  3OY9 A;  4E0D A;  4OGE A;  1KTQ A;  3RMB A;  3QET A;  1XI1 A;  4HUG A;  4FJJ A;  3QO9 A;  1QSY A;  2ITG A;  2ZQB A;  1X1P A;  1TAQ A;  3MEC A;  3IAY A;  4FJH A;  3DOK A;  4AHC A;  3SPZ A;  4KAZ A;  3OYN A;  4BDY A;  1X9W A;  2G8W A;  4B9M A;  2G8H A;  3QLH A;  4I2Q A;  2P1J A;  2VG5 A;  3RR8 A;  3V9U A;  3RTV A;  3ZSV A;  1JKH A;  1S6Q A;  3NDK A;  1JXE A;  1K6Y A;  1TL3 A;  5T7B A;  3CFP A;  1XHZ A;  3AA2 A;  3L2R A;  1ZYQ A;  4ID5 A;  3NHG A;  1Q9Y A;  4B9V A;  4KHS A;  4FK2 A;  1JLE A;  1NKB A;  3DM2 A;  1JLQ A;  1RDC A;  4J2D A;  3QEW A;  3LAK A;  3OYB A;  1TKD A;  1RTJ A;  4E19 A;  4DSK A;  4DQQ A;  2X74 A;  2B5J A;  4FJG A;  2OPP A;  3HVT A;  4ELV A;  1RBU A;  3C95 A;  2E4L A;  1A5W A;  3KLF A;  2B4J A;  4BWJ A;  2IGI A;  1CZ9 A;  1WAF A;  4Y1D A;  3KK2 A;  4FM1 A;  1D5A A;  4CER A;  1FXX A;  1S1T A;  4BE1 A;  3C6U A;  4CF8 A;  4CGI A;  2YHA A;  4OKE A;  4IG3 A;  4FLT A;  5HLF A;  4UQG A;  3L3U A;  4IFV A;  3ALY A;  3OYE A;  3PX4 A;  2F8T A;  4DTP A;  1NJW A;  4FLY A;  2ZD1 A;  3O3G A;  3V9X A;  2YKN A;  4FW1 A;  4CK2 A;  3NBP A;  3V6D A;  4CF9 A;  4E7I A;  4DSI A;  4CHQ A;  4L8R B;  3SUQ A;  4J2B A;  3WNF A;  3K59 A;  3V9Z A;  3KK3 A;  1L3T A;  3NFA A;  2KW4 A;  2Z1J A;  3HVR A;  1QTM A;  2PYJ A;  4BAC A;  4FJ5 A;  3NGZ A;  3HYF A;  4KB0 A;  4OVL A;  1RCH A;  1HQU A;  3LPU A;  5DMR A;  3CFR A;  4W5O A;  1B92 A;  4FM0 A;  4DFJ A;  2FBV A;  1S1U A;  3K5L A;  2HHS A;  3SV3 A;  4AHT A;  1RDB A;  1HYS A;  3CQ8 A;  2FBX A;  4Z4H A;  3AO5 A;  4O55 A;  4M3R A;  4CJE A;  3O3H A;  3TAQ A;  1R0A A;  5KRT A;  1TKZ A;  1VRU A;  4DQR A;  2HNY A;  1I3A A;  4BDZ A;  3PV8 A;  4Q5V A;  3D0P A;  1IKV A;  1QQC A;  4DTN A;  3VQP A;  2QK9 A;  3NAE A;  1BQM A;  1RT7 A;  3THV A;  3DLH A;  3RWU A;  3ZT0 A;  1EKE A;  3RRH A;  1LW2 A;  1JXB A;  3OS2 A;  4B9S A;  4KHU A;  4AHR A;  1EXQ A;  5DK5 A;  3OYM A;  3U3Y A;  3NF8 A;  3QIN A;  4O0I A;  3AVI A;  4AHV A;  3HST B;  3MXM A;  2KZM A;  3MED A;  4FCY A;  2BAN A;  3TAE A;  1L3V A;  3KTQ A;  1UA0 A;  4DTU A;  3SCX A;  3TAF A;  3PY8 A;  3QEI A;  4BWM A;  3DRR A;  4CJR A;  4DLG A;  4B9L A;  3AVB A;  5D3G A;  3SQ1 A;  4CK1 A;  5KGW A;  4B8C A;  3LAN A;  4CHN A;  4ICL A;  2VG6 A;  2P5G A;  4OKJ A;  2XY6 A;  3DOL A;  1ZBH A;  4W5Q A;  3RRG A;  3VQ5 A;  3TI0 A;  4HUF A;  2E6M A;  5K14 A;  4EP5 A;  1T03 A;  3ZSR A;  1J53 A;  4CF2 A;  1RDA A;  4FLW A;  1YTU A;  1JLC A;  4FJI A;  3OYI A;  3QEV A;  4FVM A;  3V9W A;  2YNH A;  3V81 A;  4FXD A;  3HPG A;  4M3T A;  1O1W A;  4HVJ A;  1WSJ A;  3B6P A;  1IH7 A;  4DSL A;  4KPY A;  1T8E A;  3V1R A;  1HYZ A;  4ELU A;  1FK9 A;  4PWD A;  3L2U A;  1C1C A;  1YTA A;  5JS1 A;  3L2Q A;  3TAG A;  4IKF A;  3OYH A;  2XO7 A;  3LZI A;  3LZJ A;  1WSH A;  3LWM A;  1U49 A;  1C1A A;  3KLE A;  3L3V A;  4OLB A;  4PUO A;  4OKK A;  2X6S A;  4CEA A;  3CYM A;  2JLE A;  5FRO A;  1QSL A;  3M8Q A;  2HHX A;  3NH0 A;  4CJU A;  1D9F A;  4RG8 A;  1HQE A;  3DYA A;  4ID1 A;  4CK3 A;  3HM9 A;  2D0C A;  4CIF A;  4W5N A;  1VSM A;  4B9T A;  1JLG A;  2XY7 A;  1IO2 A;  1J9A A;  2IOC A;  2ZE2 A;  1BIS A;  3AO1 A;  3CM5 A;  4ZHR A;  1RDD A;  3TAB A;  3DLE A;  5FRM A;  3L2V A;  2D5R A;  4H8K A;  2HHV A;  1ASW A;  3E01 A;  3OJS A;  4EZ6 A;  1LAV A;  1WLJ A;  3KIO A;  4HCB A;  1BCM A;  3QIO A;  3L2W A;  2VWK A;  2XRI A;  1VSK A;  2D0A A;  3VQ6 A;  3OYD A;  3M8S A;  1NK8 A;  2VG7 A;  1U4B A;  4KHQ A;  2FBY A;  4IBN A;  2IAJ A;  3HXM A;  3PO5 A;  2AJQ A;  3TR8 A;  3M8R A;  3AVF A;  4N47 A;  1TK5 A;  4CF0 A;  5I42 A;  1BI4 B;  2OA8 A;  2G8I A;  2OPQ A;  3RMC A;  2RPI A;  4BE0 A;  1QE1 A;  4Z4C A;  2O4I A;  1F21 A;  4E7L A;  2XHB A;  4O0J A;  4Z4F A;  1S9G A;  5CYQ A;  1JLF A;  3K5O A;  5FDL A;  1DTT A;  3KLI A;  3VQQ A;  1LWE A;  5JS2 A;  3SYZ A;  4FJL A;  1A5X A;  1GOB A;  3T1A A;  2OZS A;  2O4G A;  1VSE A;  1KFS A;  1EET A;  1NK6 A;  3HL8 A;  4E7J A;  3AO4 A;  4YNQ A;  2DFH A;  1WSE A;  1L3U A;  4FZX C;  4KRE A;  1VSH A;  3OYF A;  3NGI A;  3P83 D;  1TL1 A;  1KVB A;  4J2E A;  2IC3 A;  4AIL C;  1SL2 A;  4YFU A;  3S3M A;  4FJX A;  1KLM A;  1BCO A;  3OYJ A;  1HNI A;  3CM6 A;  4JS4 A;  4JRQ A;  1HMV A;  4OJR A;  1HYV A;  4E89 A;  1Z25 A;  4KFB A;  4CFD A;  1C0U A;  2KZZ A;  1G15 A;  1BIZ A;  4KKO A;  3SQ2 A;  2HHW A;  4NYN A;  1SV5 A;  3B6O A;  4KI6 A;  3HJF A;  3CG7 A;  1T05 A;  2EX3 A;  3ZSO A;  3KLH A;  1NK4 A;  1SUQ A;  3I0S A;  1BI4 A;  3S3O A;  4M3Y A;  3PO4 A;  3S9H A;  4O5B A;  2B6A A;  4AH9 A;  1U45 A;  2X6N A;  3SQ0 A;  2G8U A;  3LP0 A;  4CGH A;  4DWI A;  4JLH A;  4FYD A;  3AO3 A;  2BE2 A;  4TSX A;  1RT1 A;  3TAM A;  1NJX A;  4B9U A;  3OYG A;  4I2P A;  3TAP A;  5KI6 A;  1B9D A;  4G1Q A;  1TGO A;  2PY5 A;  1DLO A;  1JLB A;  3G0Z A;  2HHU A;  5J1E A;  4DF4 A;  4F2R A;  5EU7 A;  3VQD A;  2XY8 A;  3IRX A;  3AVK A;  1FKO A;  3CFO A;  4MFB A;  3K2P A;  4N56 A;  4Y1C A;  3AO2 A;  3ZT3 A;  4CIE A;  4DF8 A;  4DTO A;  4DFK A;  1VSD A;  3K58 A;  4ELT A;  4CJV A;  3NF6 A;  2HVI A;  1ZBI A;  2YKM A;  2RKI A;  3C6T A;  3LP3 A;  1S1W A;  1ZBL A;  2QKK A;  3AA3 A;  1XWL A;  2HNZ A;  3LAL A;  2WOM A;  1LV5 A;  1RBR A;  2OYQ A;  4M3U A;  2FC0 A;  3DMJ A;  3KKS A;  4H4M A;  4I9L A;  3HP9 A;  4RW4 A;  2QXF A;  4M45 A;  3HPO A;  1S1V A;  5CY4 A;  3AVN A;  3O3F A;  3ULD A;  2PZS A;  5CZ2 A;  4C8M A;  1RT6 A;  3ZSZ A;  4CEF A;  4FZY A;  4F2S A;  2Y1I A;  1J54 A;  1LWC A;  4OLA A;  2DFF A;  2RN2 A;  3HPH A;  3NGY A;  4ZTJ A;  3K5M A;  4M3X A;  1TVR A;  3OJU A;  3KKR A;  3OVN A;  4O44 A;  1U48 A;  4HHT A;  4CGD A;  3ZSY A;  3S3N A;  2BGG A;  4FM2 A;  1KFD A;  3AVL A;  5FRN A;  4LD0 A;  1TK0 A;  1VSF A;  3KK1 A;  3U6F A;  4DQP A;  3MEG A;  1KCF A;  1I39 A;  4CEB A;  4E1N A;  4LSN A;  1XHX A;  3ZSW A;  4JS5 A;  1Z26 A;  4ZTF A;  2GBZ A;  4N5S A;  1X9S A;  4KI4 A;  1KSP A;  2HHT A;  2Y1J A;  3LP2 A;  1RTI A;  1IKW A;  4CED A;  1UOC A;  4DSJ A;  4Q0B A;  1RT3 A;  4FW2 A;  3QEX A;  3I8D A;  4CES A;  4DTR A;  1CZB A;  3V4I A;  4K8X A;  2HB5 A;  3IS9 A;  1ZBF A;  2GV9 A;  1IG9 A;  1C1B A;  3G10 A;  3SUP A;  4RW8 A;  4RW7 A;  3T19 A;  4LH4 A;  4CGJ A;  4RW9 A;  4E1M A;  3QIP A;  3F73 A;  1Q9X A;  4KB1 A;  5HRS A;  3D45 A;  4OGC A;  3QNN A;  4NCB A;  2YNG A;  4K8Z A;  1Q8I A;  2R7Y A;  1J5O A;  3ZCM A;  3VN5 A;  3NF9 A;  4M3Z A;  3U3G A;  2I5J A;  2HW3 A;  3K57 A;  4GW6 A;  1IKY A;  2OPR A;  4FJ9 A;  4CJ3 A;  3KD5 E;  3QEP A;  4OPJ A;  1CXQ A;  3JYT A;  4CHY A;  2EHG A;  4DLE A;  2GUI A;  2DY4 A;  3HO1 A;  4FJM A;  2RF2 A;  1A5V A;  4M41 A;  1SL0 A;  4R5P A;  1ZBU A;  3DRP A;  2G8F A;  4CHP A;  3KJV A;  4DQS A;  1GOC A;  3VQC A;  4CHO A;  4W5T A;  4FJN A;  4O4G A;  5SWM A;  3MXI A;  5HRO A;  4GVM A;  3AVG A;  3BGR A;  1KLN A;  1HPZ A;  3LDS A;  3SUN A;  2G8V A;  4CEO A;  4KTZ A;  4RW6 A;  3VA0 A;  1JL2 A;  1S9E A;  2P51 A;  3ZT1 A;  5I3U A;  2JGU A;  3MAQ A;  4NYF A;  3V1Q A;  1NK5 A;  3HP6 A;  4F8R A;  3ISN C;  4KRF A;  4WE1 A;  3NF7 A;  3QNO A;  2PYL A;  4DFP A;  1TAU A;  4GMJ B;  1T7P A;  1WSI A;  4KHY A;  2E6L A;  1NKE A;  4N41 A;  2W42 A;  2KFN A;  2ATQ A;  4JRP A;  4CJK A;  4N76 A;  4CJP A;  4CJS A;  1SKR A;  3VQ8 A;  1RT5 A;  3VA3 A;  3QER A;  1HJR A;  3O4N A;  3AA5 X;  4CJT A;  3PX0 A;  2OPS A;  3SUO A;  1QSS A;  5CZ1 A;  4HCC A;  1NOY A;  4DS5 A;  4CJQ A;  4CJW A;  2YHB A;  4DU4 A;  1L3S A;  1DTQ A;  3NH1 A;  4CJF A;  3DLK A;  3SV4 A;  5J2N A;  4CGG A;  3SQ4 A;  1QS4 A;  3TWH A;  4KTQ A;  1X9M A;  3DLG A;  4PY5 A;  4AHU A;  2YV0 X;  3M8P A;  4CEC A;  3UIQ A;  3L8B A;  4E7K A;  3RMD A;  1NK7 A;  2KQ2 A;  3ITH A;  3ZT2 A;  4XIU A;  3EY1 A;  1BL3 A;  1BGX T;  1RBS A;  4KO0 A;  4DTX A;  3NE6 A;  1WAJ A;  4LH5 A;  2HVH A;  3ASM A;  4CIG A;  3V1O A;  3SZ2 A;  4DQI A;  4FLX A;  1NK9 A;  1BQN A;  4QCL A;  1D9D A;  1N6Q A;  2A1R A;  3NH2 A;  3T3F A;  4H4O A;  2A1S A;  3AV9 A;  4CEE A;  5C25 A;  5HRN A;  3VQ4 A;  4DU1 A;  4NCA A;  2KTQ A;  2F8S A;  3P5J A;  3OYK A;  3SJJ A;  1D8Y A;  4CEZ A;  4M3W A;  4BDP A;  1RT2 A;  4F3T A;  1BHL A;  3JSM A;  3VQB A;  2HMI A;  1SKW A;  3DRS A;  1VRT A;  1JL1 A;  1VK0 A;  4Z4E A;  1SL1 A;  4EZ9 A;  1ITG A;  4KV8 A;  4FLV A;  5HBM A;  1S6P A;  5CYM A;  3ZT4 A;  3MXJ A;  2OZM A;  4CJ5 A;  3NCI A;  3ZSQ A;  1L5U A;  4KTW A;  4QAG A;  1RTH A;  1MU2 A;  1JLA A;  1S5J A;  1Y97 A;  3AVM A;  4CJL A;  3LWL A;  4CFA A;  3KD1 E;  1WN7 A;  3VQA A;  1YT3 A;  2IDO A;  1VSL A;  4DFM A;  2KFZ A;  2HND A;  4FLU A;  3WNE A;  2BDP A;  1LW0 A;  1W0H A;  2G8K A;  4C8O A;  3IG1 A;  1RBT A;  1NJY A;  1UAX A;  2Z1I A;  4Z0U A;  3PX6 A;  3TAR A;  4LSL A;  4DTJ A;  3SPY A;  3VQ7 A;  1CXU A;  4CFC A;  4DU3 A;  4CE9 A;  4BE2 A;  3H08 A;  1BIU A;  4IG0 A;  4DS4 A;  4I7F A;  5C42 A;  4OPK A;  2LSN A;  1XC9 A;  4QOZ B;  1N5Y A;  1SKS A;  3AA4 A;  4C8L A;  4EP4 A;  4C8N A;  3SNN A;  1RIL A;  3HT3 A;  4B08 A;  3I0R A;  1RBV A;  3RR7 A;  3SI6 A;  1LWF A;  5HP1 A;  4DMN A;  5HRR A;  5J2M A;  1KRP A;  3OS1 A;  1UA1 A;  4FJ8 A;  3O4Q A;  5E41 A;  2Z1H A;  4FK0 A;  1UWB A;  3ZSX A;  4DSF A;  4M42 A;  2DFE A;  3VQ9 A;  3BDP A;  1VSJ A;  3F9K A;  2P5O A;  2Z1G A;  4KHW A;  4KHN A;  1C6V A;  4AHS A;  2QKB A;  3OS0 A;  4F4K A;  1NOZ A;  1KVC A;  3AVC A;  4DTM A;  4E7H A;  4Z4G A;  1ASU A;  1GOA A;  1NJZ A;  1NKC A;  2X78 A;  3LAM A;  4DG1 A;  3EZ5 A;  1IKX A;  1TKT A;  3VQE A;  4FK4 A;  4E3S A;  1TV6 A;  4FJ7 A;  4FZZ A;  1QHT A;  3K5N A;  4B9N A;  2YNI A;  1NK0 A;  4W5R A;  5KRS A;  4MQ3 A;  4CF1 A;  3QES A;  3RMA A;  1HNV A;  1RTD A;  4CFB A;  4DTS A;  3AVH A;  4LY7 A;  4B3O A;  3EYZ A;  3AVA A;  4CJ4 A;  4CEQ A;  3DLR A;  4PA1 A;  3OYA A;  4C8K A;  4J2A A;  4DSE A;  1HRH A;  3DLB A;  5KGX A;  3HK2 A;  1FKP A;  3MEE A;  1TK8 A;  3WNH A;  3V9S A;  1WSF A;  1C0T A;  5SZT A;  4CCH A;  3C94 A;  2NUB A;  4NCG A;  1RNH A;  1VSI A;  1RT4 A;  2Q3S A;  4HTU A;  4FLZ A;  3LPT A;  1WNS A;  1W9H A;  2WON A;  1TKX A;  3OYC A;  5J2Q A;  1KVA A;  1U47 A;  4B8A B; 
#chains in the Genus database with same CATH topology
 3TTF A;  3MWP A;  1DGK N;  4R79 A;  3QFU A;  3FFI A;  4FJK A;  4BRL A;  3CC2 N;  4IZ9 A;  1B9F A;  1W97 L;  3ULE A;  5AQU A;  3VET A;  5LMU K;  4Z94 A;  4DR4 K;  2Q36 A;  2YNF A;  4H5V A;  3P1G A;  4BR5 A;  3WXJ A;  5HRP A;  4BR4 A;  4GVE A;  2PAV A;  3PUF A;  1YVU A;  4CGF A;  4B1U B;  1LAW A;  3E9P A;  4E0D A;  2P9I B;  5B8H A;  5LJV A;  3VF6 A;  3RMB A;  4HUG A;  1NBW A;  2ZWH A;  2NRZ A;  2ITG A;  3MEC A;  1TAQ A;  3IAY A;  3DOK A;  3SPZ A;  1NJI O;  4M3W A;  4I2Q A;  5AQI A;  3RSE A;  3RTV A;  3DXM A;  1JKH A;  1S6Q A;  1ZYQ A;  1Q9Y A;  4B9V A;  4H0P A;  3NHG A;  1Y64 A;  1JLE A;  1NKB A;  3DM2 A;  1JLQ A;  3OYB A;  1RTJ A;  2B5J A;  1GLD G;  2OPP A;  2FSK A;  3CJ7 A;  3ID8 A;  4ELV A;  3VEZ A;  1OH5 A;  2IGI A;  5AJ3 K;  1WAF A;  4FM1 A;  3O9S A;  4BE1 A;  4LF7 K;  1VQP N;  4Y0W A;  2YX6 A;  5AFU A;  4FLT A;  1Z05 A;  3CER A;  3A5N C;  5CHI A;  5KPR A;  3OYE A;  2F8T A;  4FLY A;  3O3G A;  3WNF A;  3KK3 A;  3NFA A;  2KW4 A;  4YOU A;  3DXM B;  3HYF A;  5AQX A;  1HQU A;  3R3L A;  1K8K B;  1XMO K;  1HYS A;  1KAZ A;  3O08 A;  4A2B A;  3O3H A;  4O55 A;  4CJE A;  1R0A A;  1GLA G;  3EZW A;  2F7T A;  1U2V B;  1QZ5 A;  2D1K A;  5EX5 A;  1IKV A;  1QQC A;  3JXU A;  2CH6 A;  1Q86 O;  1WUA A;  5AQY A;  3DLH A;  1JXB A;  1T44 A;  5KQD A;  2QWN A;  2E2P A;  3AVI A;  4AHV A;  2UXD K;  3MED A;  4CZK A;  2BAN A;  4FCY A;  3KTQ A;  1E4F T;  3QIC A;  3PY8 A;  3LDP A;  1NMD A;  1TUY A;  4B9L A;  3AAR A;  2D4W A;  5KGW A;  3LAN A;  4BRO A;  2VG6 A;  3VQ5 A;  4HUF A;  5K14 A;  3SAG A;  3ENH A;  5AQO A;  5AQP A;  1RDA A;  1JLC A;  1U2V A;  3QEV A;  5AQW A;  3V81 A;  2YNH A;  2OTL N;  4FXD A;  1QQO A;  4HVJ A;  1WSJ A;  3B6P A;  4X66 K;  4DSL A;  4V19 S;  2O8C B;  3V1R A;  1YTA A;  3OYH A;  3LZI A;  1FJG K;  4OX9 K;  4BRP A;  3EO3 A;  3KLE A;  1HR0 K;  3ZYY X;  4PUO A;  4OKK A;  2X6S A;  3DLL L;  4CEA A;  3CME N;  2JLE A;  3HRG A;  2P9N B;  3GBT A;  4DR6 K;  1HQE A;  2V51 B;  3TTC A;  4B3T K;  3MMV A;  4M7Y A;  3VTI A;  1Q81 O;  2A42 A;  2D0C A;  3ENO A;  4DQ8 A;  2YHY A;  3CM5 A;  2NZT A;  1RDD A;  4FWK A;  2HHV A;  3E01 A;  1WLJ A;  3KIO A;  1BCM A;  1HKC A;  4JNE A;  2NRR A;  2XRI A;  4IO8 A;  1N32 K;  3M8S A;  2ZM6 K;  1NK8 A;  1MDU B;  2VG7 A;  4KHQ A;  2V7Z A;  4IBN A;  3TR8 A;  1MWK A;  4N47 A;  3SAH A;  4BC3 A;  2OA8 A;  2OPQ A;  4WQ4 C;  5BN8 A;  4PL8 A;  4FWN A;  4DR7 K;  1HPM A;  2F9T A;  4Z4F A;  3O5B A;  4CZM A;  1JLF A;  1DTT A;  4AM6 A;  1LWE A;  4CW7 B;  1GOB A;  3THW B;  3FZL A;  2O4G A;  1HKG A;  4YNQ A;  3OYF A;  2P9K A;  2IC3 A;  4AIL C;  4GV6 A;  4CBX A;  5IT9 O;  4ISE A;  3LM2 A;  4KFB A;  1HJO A;  3MN7 A;  1Z6R A;  1SV5 A;  2GEM A;  2EX3 A;  1NK4 A;  2IVN A;  3D2F A;  3S3O A;  4CJ7 A;  4M3Y A;  3S9H A;  4QS7 A;  2B6A A;  4F9O A;  3ZEU A;  4CGH A;  4JLH A;  5C15 A;  4H0T B;  1TUU A;  5KI6 A;  4G1Q A;  1JLB A;  3G0Z A;  3HSC A;  3VGK A;  2XY8 A;  3CFO A;  3K2P A;  1EWR A;  1T6D A;  1BO5 O;  3AO2 A;  1ZXO A;  3ZT3 A;  3A0I X;  4JHD A;  4DTO A;  4BGB A;  3CIP A;  3IKM A;  3QFP A;  1RBR A;  3TSQ A;  3KKS A;  4I9L A;  3OTO K;  2QXF A;  1YIJ N;  1C0F A;  3AGK A;  3AVN A;  3ULD A;  4NXM K;  5CZ2 A;  1T3V A;  1RT6 A;  3ZSZ A;  2D0O A;  3CPW M;  4FZY A;  5C0Y A;  4PKI A;  4ZTJ A;  3QBX A;  4JEP A;  3T1H K;  4CGD A;  3MEG A;  4E1N A;  1XHX A;  3I55 N;  2GWK A;  4J8F A;  1YHQ N;  1VQ8 N;  1YF5 L;  2GBZ A;  1X9S A;  1YVN A;  4KI4 A;  3BF3 A;  1KSP A;  3J8A A;  1IKW A;  4CED A;  1UOC A;  3CCV N;  3G4S N;  3I8D A;  4K8X A;  3S41 A;  1CZB A;  4DR5 K;  5BR8 K;  1ZBF A;  3G10 A;  2P9U B;  4CGJ A;  1YAG A;  3D45 A;  3CJB A;  3J7Y P;  5AQH A;  4JKA A;  5JIC A;  2VQE K;  2HW3 A;  4JKB A;  3E66 A;  4FJ9 A;  4CJ3 A;  3KD5 E;  2HBJ A;  4NO7 A;  1BU6 O;  2BTF A;  3QEP A;  3NVM A;  5TKW A;  4CHY A;  4FL9 A;  2E2Q A;  3HO1 A;  3P38 A;  1NGG A;  3L0Q A;  4H0O A;  4FWM A;  3QML A;  4AF1 A;  3WUH A;  4CD1 A;  4CHP A;  1ESV A;  4XEI A;  1KD1 O;  4CHO A;  3VQC A;  5M1Q A;  4O4G A;  3MXI A;  5HRO A;  4BR2 A;  1S9E A;  2P51 A;  3MAQ A;  4KH5 A;  4F8R A;  5H1S Q;  2P9U A;  4DFP A;  3ZX0 A;  1WSI A;  4KHY A;  1NKE A;  4DR3 K;  4JRP A;  2NNW A;  1N36 K;  4CJT A;  3PX0 A;  3FE1 A;  3SUO A;  3GOI A;  4BRQ A;  4U67 L;  1QSS A;  3CJC A;  1WOQ A;  4CJW A;  1L3S A;  3ID6 A;  1DTQ A;  2QWQ A;  3P39 A;  4B1Z A;  4WFN L;  5AZJ B;  4IJN A;  3VEN A;  4CGG A;  3TWH A;  3SQ4 A;  5FPN A;  2O8F B;  3DJC A;  3UIQ A;  2I7N A;  3EY1 A;  2V7Y A;  1H1V A;  3NE6 A;  4BR9 A;  3IDH A;  3ASM A;  3V1O A;  4DQI A;  4FLX A;  4E1J A;  1TYQ A;  4JYA K;  4CEE A;  1N33 K;  5HRN A;  3VQ4 A;  2GTD A;  4DV2 K;  3SJJ A;  4WF9 L;  2HMI A;  1QQN A;  3J80 O;  2NRX A;  4EZ9 A;  1ITG A;  4FLV A;  1NGC A;  4IJA A;  5HBM A;  3ZT4 A;  4PHT X;  4RWT A;  3ZSQ A;  1L5U A;  3FFK B;  4CFA A;  4A2A A;  3HZ6 A;  1WN7 A;  4BRG A;  3VQA A;  2IDO A;  1VSL A;  1XNR K;  1W0H A;  3VF2 A;  3PSF A;  1NGB A;  3U8X A;  3PX6 A;  3CC7 N;  3R6M A;  4U7B A;  3VQ7 A;  4CFC A;  3H08 A;  3TU5 A;  3G71 N;  4IG0 A;  4I7F A;  4HTL A;  5C42 A;  1S72 N;  1XC9 A;  3C6A A;  3E9L A;  3AA4 A;  1BUP A;  3SNN A;  5FPE A;  3I0R A;  1RBV A;  5MLC Q;  5J2M A;  3CD6 N;  1V4T A;  3O1B A;  5CR4 A;  2Z1H A;  1UWB A;  3ZSX A;  2QWR A;  1VSJ A;  3I8B A;  4KHN A;  2QKB A;  3OS0 A;  1KVC A;  4BC2 A;  3K0S A;  1NKC A;  3WXL A;  4DG1 A;  4DV7 K;  2YI1 A;  2A5X A;  3K5N A;  4MO5 A;  3Q7B A;  1HUX A;  3RMA A;  4OPA A;  5C10 A;  3UKU A;  3AVA A;  4CJ4 A;  4CEQ A;  4PA1 A;  4C8K A;  4J2A A;  3DLB A;  5KGX A;  1FKP A;  3MEE A;  5JLF A;  3WNH A;  1U6Z A;  4C23 A;  5AFU H;  1VSI A;  4FWS A;  1RT4 A;  4HTU A;  3LPT A;  3OYC A;  1KVA A;  2NLX A;  1U47 A;  4KH4 A;  4CZJ A;  3DI6 A;  4HUE A;  4JI2 K;  3R9P A;  1P90 A;  3EKS A;  2XY5 A;  4FO0 A;  1CZA N;  5KTQ A;  2ASP A;  2VYP A;  3CC4 N;  3I33 A;  1EX4 A;  1ASV A;  2QI2 A;  3QET A;  1XI1 A;  4FJJ A;  4NLC A;  1QSY A;  2ZQB A;  4A59 A;  1X1P A;  4FJH A;  3C0B A;  4KAZ A;  3OYN A;  3L4I A;  3M3Z A;  2CGK A;  3CFP A;  2G8I A;  4KHS A;  3L2R A;  1VQ4 N;  3L4Q A;  3LAK A;  4BC4 A;  1TKD A;  4JK8 A;  5M1N A;  4DQQ A;  3HVT A;  4BQL A;  1EO1 A;  3CF5 L;  4IDH A;  4WQ5 C;  1CZ9 A;  1KQS M;  1D5A A;  1FXX A;  4IEI A;  3C6U A;  4CF8 A;  4CGI A;  2YHA A;  4IG3 A;  5HLF A;  4UQG A;  3PX4 A;  4IFV A;  3ALY A;  3V6D A;  3V9X A;  4CK2 A;  4CF9 A;  4L8R B;  4CHQ A;  3DXK A;  4MLE A;  3SUQ A;  4J2B A;  3K59 A;  3HVR A;  4NXN K;  1QTM A;  3D2E A;  2PYJ A;  3SAF A;  3NGZ A;  4BG8 A;  4KB0 A;  4MO4 A;  3CFR A;  4DFJ A;  1S1U A;  3K5L A;  2FXU A;  4JKG B;  3EEQ A;  4IXC A;  4G9Z A;  4M3R A;  3TAQ A;  1VRU A;  3PV8 A;  4Q5V A;  3D0P A;  3R1X A;  4DTN A;  2A41 A;  3VQP A;  2Q2R A;  3RWU A;  3ZT0 A;  1EKE A;  3RRH A;  1LW2 A;  3OS2 A;  4K25 A;  3CCL N;  3RSE B;  4AHR A;  1X3N A;  4WFA L;  4O0I A;  3MXM A;  3WXI A;  3TAE A;  1L3V A;  1UA0 A;  3QEI A;  4BWM A;  3DRR A;  3H46 O;  4B8C A;  4CHN A;  4OKJ A;  5GAG P;  4W5Q A;  3TI0 A;  4WQ5 A;  2E6M A;  4GNI A;  4EP5 A;  1BA1 A;  1J53 A;  2E1Z A;  1X9J A;  4DV4 K;  1O1W A;  4B3R K;  3A8Y A;  1IH7 A;  4DB3 A;  1HYZ A;  5AQT A;  1WSH A;  3T69 A;  2UU9 K;  4OLB A;  3LM9 A;  1RGI A;  4LFC K;  1V4S A;  4MLH A;  4A5B A;  2OCE A;  2HHX A;  3GDQ A;  4EFH A;  1D9F A;  5ADX H;  4CZH A;  3DYA A;  2AA4 A;  4CK3 A;  5AQL A;  2HMP A;  4W5N A;  4B9T A;  1JLG A;  2WTU A;  4ZHR A;  3TAB A;  3KWG A;  3OA9 A;  3UE5 A;  3KVG A;  1LAV A;  4M63 C;  2VWK A;  3HI0 A;  4LF9 K;  1K73 O;  1U4B A;  3KWI A;  3HXM A;  2IAJ A;  3PO5 A;  2AJQ A;  4H5R A;  1TK5 A;  5I42 A;  4JI0 K;  1BI4 B;  3RMC A;  2RPI A;  4KBO A;  4BE0 A;  4Z4C A;  2ZJP L;  3J81 O;  1F21 A;  4E7L A;  4C1N K;  3O8M A;  3K5O A;  2ZJQ L;  1A5X A;  3ENB A;  3T1A A;  3H1V X;  1KFS A;  3T7Z A;  2DFH A;  1WSE A;  1L3U A;  3NGI A;  1KVB A;  4J2E A;  2O8C A;  5AR0 A;  4JKF A;  5HL7 L;  4FJX A;  2Q97 A;  1KLM A;  2BH1 A;  4FSV A;  4JS4 A;  1Z25 A;  1G15 A;  3SQ2 A;  2HHW A;  3L6Q A;  3B6O A;  4KI6 A;  4DKW A;  3KLH A;  1IG8 A;  1BI4 A;  4OPH A;  4JN4 A;  3SQ0 A;  2E2N A;  2G8U A;  4BGA A;  1NGH A;  4FYD A;  3TAM A;  4JI8 K;  4B9U A;  2KHO A;  5AQF A;  1TGO A;  1DLO A;  4BRH A;  5E26 A;  3VQD A;  4Y1C A;  3SJH A;  4CIE A;  4XH1 A;  3K58 A;  4CJV A;  3NF6 A;  2HVI A;  4XH4 A;  1BA0 A;  1ZBI A;  2RKI A;  3C6T A;  1S1W A;  2QKK A;  4H0Y B;  2OYQ A;  3DMJ A;  4M45 A;  3HP9 A;  4C8M A;  3E1Y A;  1J54 A;  1LWC A;  1NGI A;  4OLA A;  2RN2 A;  4ILJ A;  2GUP A;  3K5M A;  4L3Q A;  4M3X A;  3JS6 A;  3OVN A;  1U48 A;  2CGL A;  3BEX A;  3SK3 A;  3U6F A;  1I39 A;  4LSN A;  1Z26 A;  3LDO A;  4ZTF A;  2Q31 A;  4GV9 A;  3CI5 A;  3F9M A;  3LP2 A;  3V4I A;  5F2R A;  1LOT B;  2HB5 A;  1IG9 A;  4H0X B;  4CI6 A;  4CZL A;  2QXL A;  4RW7 A;  4UY8 O;  1Q9X A;  3QNN A;  1GLJ O;  4OGC A;  4M3Z A;  3VN5 A;  3U3G A;  4EAH D;  4GW6 A;  5M1P A;  4JK9 A;  1CXQ A;  3JYT A;  4DLE A;  3CMA N;  5GAH P;  4JHD B;  2RF2 A;  3T1Y K;  1ZBU A;  2NRT A;  3CPE A;  4BRM A;  1GOC A;  2G8V A;  4GVM A;  5F1X A;  2QM1 A;  4CEO A;  4KTZ A;  4RW6 A;  3VGL A;  1SAZ A;  4NYF A;  3QDK A;  1NK5 A;  4KRF A;  3BY5 A;  4WE1 A;  1TAU A;  1XC3 A;  3CCS N;  3WEE B;  5BPL A;  1R59 O;  3EE9 A;  2UXC K;  1GLF O;  1RT5 A;  3VA3 A;  3QER A;  1HJR A;  3O4N A;  2OPS A;  1VQO N;  3LDL A;  2E5L K;  4DU4 A;  2F9W A;  4JI5 K;  3DLK A;  3DLG A;  4PY5 A;  4GKJ K;  3M8P A;  4OO1 J;  4YY3 K;  1NK7 A;  2O8D B;  4XIU A;  1MA9 B;  3O9Q A;  4KO0 A;  4CIG A;  3VMF B;  5BRE A;  3HM8 A;  4H0V B;  1NK9 A;  4DV5 K;  1BQN A;  3ATV A;  3PLA A;  3NH2 A;  4WQ4 A;  2P9P A;  5C25 A;  4NCA A;  2KTQ A;  1QHA A;  1XQS C;  1D8Y A;  5FPM A;  3UKR A;  4DHY A;  2FF6 A;  1VK0 A;  2V52 B;  4KV8 A;  4WYB A;  2QWP A;  1KC8 O;  1WBB A;  1S6P A;  3CCE N;  2W6K A;  4GY2 B;  3NCI A;  4QAG A;  1RTH A;  4IOX A;  1JLA A;  1Y97 A;  1NLV A;  3TSP A;  1YT3 A;  4DFM A;  2KFZ A;  3WNE A;  3LDQ A;  3ZET B;  2G8K A;  3Q7C A;  1JCF A;  3ZX2 A;  3IG1 A;  1RBT A;  4IWV A;  2P9S A;  3FR0 A;  3A5O C;  2P9P B;  1MWM A;  3O4W A;  4DU3 A;  1J5E K;  3EN9 A;  4FOI A;  4OPK A;  3I56 N;  3DAW A;  5GIO A;  1SKS A;  4C8L A;  2O8F A;  3HTV A;  4JKH A;  4B08 A;  2ASM A;  2YJE A;  5HP1 A;  2QWL A;  3MDQ A;  3N4Q A;  4DSF A;  4M42 A;  3VQ9 A;  3BDP A;  5AQN A;  3F9K A;  4K43 A;  3CQX A;  3VES A;  2P5O A;  4KHW A;  1C6V A;  3AVC A;  3FZM A;  3ULE B;  4E7H A;  1GOA A;  4DTM A;  1NNE A;  5BPM A;  3LAM A;  3EZ5 A;  3EKU A;  1TKT A;  5E84 A;  1K9M O;  3KK7 A;  1TV6 A;  4FJ7 A;  3FGU A;  3OHR A;  4CF1 A;  2P9I A;  4CFB A;  4BRK A;  3EYZ A;  3DLR A;  3OYA A;  1EWQ A;  3P31 A;  2QEX N;  2PFU A;  3HK2 A;  2P9L B;  3V9S A;  2NRV A;  1C0T A;  5BRD A;  3DWL A;  4B1X B;  1QZ6 A;  5J2Q A;  1TKX A;  4B8A B;  4JKE A;  3CCQ N;  3WNG A;  5C24 A;  3ZX3 A;  2FBT A;  2IS3 A;  3LP1 A;  3N4P A;  1NGA A;  4PQU A;  3OYL A;  3C7N B;  3HBT A;  4Z4I A;  3U4L A;  2VWJ A;  1QQM A;  2CGJ A;  2D0B A;  2ETJ A;  2WUS A;  4FWO A;  4IDK A;  3MK6 A;  3KZB A;  4BRD A;  3AAP A;  5AQV A;  3SLC A;  3SBT A;  1WSG A;  2HHQ A;  4H03 B;  2P9L A;  1S1X A;  3OY9 A;  4IOC L;  2ITM A;  4LC9 B;  5BPN A;  4GV3 A;  5AQS A;  1K8K A;  4AHC A;  4BDY A;  2G8W A;  2G8H A;  3QLH A;  2P1J A;  3ZSV A;  3WQT A;  3NDK A;  1K6Y A;  5T7B A;  3AA2 A;  4FK2 A;  3UKU B;  1RDC A;  4J2D A;  3QEW A;  1S22 A;  2KKZ A;  2X74 A;  4FJG A;  1RBU A;  3C95 A;  2E4L A;  1A5W A;  5FPD A;  3KLF A;  4CBU A;  5AQJ A;  1NU0 A;  2EWS A;  3TTD A;  4FOE A;  5M1O A;  1S1T A;  2AP1 A;  3CJ9 A;  4DTP A;  2Q1N A;  1NJW A;  2ZD1 A;  4FW1 A;  4YOR A;  3CCR N;  4E7I A;  1OVQ A;  1DEJ A;  1L3T A;  1IBK K;  3D6R A;  3CJA A;  4FJ5 A;  4OVL A;  1RCH A;  4W5O A;  1B92 A;  4FM0 A;  2FBV A;  4MDA A;  5M1F A;  2ZGY A;  2UXB K;  2HHS A;  4AHT A;  1YJN N;  2FBX A;  4Z4H A;  5GIP A;  3AO5 A;  5KRT A;  1TKZ A;  1I3A A;  3KHY A;  4B3M K;  1P8Z A;  2GEL A;  1BQM A;  1GLL O;  1RT7 A;  3THV A;  3RVC A;  3J7Z O;  4B9S A;  3NF8 A;  3QIN A;  2HBM A;  2KZM A;  4LFB K;  4YOX A;  1VQM N;  4O8K A;  3W0L A;  3E9O A;  5AZI A;  4DTU A;  3SCX A;  2HOE A;  4CK1 A;  4A5A A;  2XY6 A;  1ZBH A;  3RRG A;  3IMX A;  5F0X A;  1T03 A;  3ZSR A;  4FJI A;  5EXW A;  3OYI A;  3V9W A;  4FWP A;  4XH5 A;  4JI1 K;  1ATS A;  4M3T A;  4KPY A;  4PWD A;  3L2U A;  4JAX A;  5JS1 A;  3JAM O;  2XO7 A;  3LZJ A;  1U49 A;  1C1A A;  3BZK A;  3CYM A;  5BRF A;  3M8Q A;  1QSL A;  3NH0 A;  4JKG A;  4BVP A;  2OTJ N;  2Q0R A;  4K42 A;  3AGR A;  4JI3 K;  1IO2 A;  2IOC A;  2ZE2 A;  1BIS A;  2QWM A;  5AQM A;  3L2V A;  4FWR A;  4H8K A;  1ASW A;  4EZ6 A;  4HCB A;  3D2F B;  4A61 A;  5I9E B;  1GLB G;  3OYD A;  4O8U A;  1NM1 A;  4ILH A;  2UUA K;  1DKG D;  1VQN N;  3MWT A;  3M8R A;  1RDW X;  4CF0 A;  1YIT N;  3VTH A;  1NG9 A;  3UB5 A;  4BRN A;  2O4I A;  2XHB A;  5CYQ A;  1KAY A;  2UYT A;  5FDL A;  2FLO A;  3SYZ A;  4FJL A;  4DR1 K;  3B8A X;  1EET A;  4FZX C;  4PL7 A;  1OH7 A;  3P83 D;  1Q7Y O;  4PKH A;  1BCO A;  3CM6 A;  4JRQ A;  1QVG M;  3LL3 A;  1HYV A;  4KKO A;  3M1F A;  3HJF A;  2OAN A;  2DPN A;  4B1Y B;  4O5B A;  1U45 A;  2X6N A;  3EL2 A;  4DWI A;  1XNQ K;  2IVO A;  3WXM B;  2VGM A;  3AO3 A;  4TSX A;  1VQ9 N;  3C6H A;  1NJX A;  1OH6 A;  3VEO A;  3TAP A;  1NMN A;  2PY5 A;  2HHU A;  2FSN A;  5J1E A;  4DF4 A;  3IRX A;  3AVK A;  1FKO A;  4MFB A;  2FF3 B;  4N56 A;  4LF5 K;  3GG4 A;  4IFE A;  4ELT A;  2P9S B;  3H3N O;  4BC5 A;  3AA3 A;  3LAL A;  2HNZ A;  2WOM A;  3PSI A;  3CCU N;  2FC0 A;  4EHT A;  2YCH A;  4BVO A;  1S1V A;  4X65 K;  3O3F A;  4CEF A;  4F2S A;  1HNX K;  5HOO A;  2DFF A;  3HPH A;  4FPA A;  3CET A;  1ILY A;  3OJU A;  1VQ5 N;  3ZSY A;  5AQQ A;  5FRN A;  1TK0 A;  1VSF A;  1NGD A;  2QW9 A;  3KK1 A;  4DQP A;  1KCF A;  4CEB A;  1K8A O;  3QBW A;  4YOT A;  3ZSW A;  4JS5 A;  4DV1 K;  2HBL A;  1BWF O;  1RTI A;  3QEX A;  4CES A;  3O9R A;  1VHX A;  1C1B A;  2ZGZ A;  4RW8 A;  1OH8 A;  3T19 A;  4E1M A;  4LH4 A;  1HKB A;  3F73 A;  3QIP A;  4QS9 A;  4C1N I;  4NCB A;  1O13 A;  4K8Z A;  1Q8I A;  3TPQ A;  3NF9 A;  3K57 A;  2OPR A;  3VEY A;  1EQY A;  2EHG A;  4FWL A;  2GUI A;  2DY4 A;  4YOV A;  2FSJ A;  2E88 A;  4FJM A;  1A5V A;  2E8A A;  3QB0 A;  1SL0 A;  4YOW A;  5DM7 L;  2G8F A;  3F5T A;  3KJV A;  5SWM A;  1KLN A;  2NRW A;  1NWK A;  3VA0 A;  3ZT1 A;  1OKJ A;  2HF4 A;  3MN6 A;  3ISN C;  2PYL A;  3NF7 A;  2RE2 A;  4JI7 K;  1DT9 A;  4BG9 A;  4N41 A;  2W42 A;  2KFN A;  3CJ1 A;  1BOT O;  4CJK A;  4N76 A;  4CJS A;  1SKR A;  3AA5 X;  2I7P A;  4BRE A;  1NOY A;  1YUW A;  4CJQ A;  4WFB L;  4DS5 A;  1VQ7 N;  4LF6 K;  3O9T A;  2YHB A;  2UUB K;  1SZ2 A;  3NH1 A;  4CJF A;  3SV4 A;  3GL1 A;  3U9Z A;  1QS4 A;  5FLX O;  1X3M A;  4IOA L;  4CEC A;  4NLB A;  3L8B A;  3RMD A;  2KQ2 A;  3ZT2 A;  1RBS A;  1WAJ A;  4LH5 A;  5AQR A;  3WXK A;  2D0P A;  2A1R A;  1N34 K;  2JWL A;  4KHP K;  4H4O A;  3AV9 A;  4DU1 A;  3O6W A;  3M6G A;  2F8S A;  3P5J A;  5EY4 A;  4BDP A;  1RT2 A;  3K9K A;  4F3T A;  5LMN K;  2OZM A;  3MXJ A;  4YHH K;  4KTW A;  1S5J A;  4CJL A;  4NB4 A;  4EIA A;  1FW6 A;  2HF3 A;  4FLU A;  2BDP A;  5JVH L;  2VGN A;  1SS6 A;  4C8O A;  4LF4 K;  4H5T A;  1NJY A;  1UAX A;  4Z0U A;  3HOT A;  3SPY A;  1CXU A;  4JD2 B;  1YJ9 N;  4DS4 A;  3THY A;  5CE3 A;  5TKY A;  1TYQ B;  3M5R A;  4RTF D;  4K41 A;  1RIL A;  3MCA B;  3RR7 A;  3SI6 A;  5HRR A;  4FJ8 A;  3AY9 A;  3IFR A;  5E41 A;  4MDB A;  3A5L C;  5AQG A;  3TSU A;  1D4X A;  5AZI B;  2Z1G A;  4F4K A;  4Z4G A;  1NJZ A;  3G6E N;  3VQE A;  4FK4 A;  4E3S A;  4JK7 A;  4FZZ A;  4B9N A;  3UKR B;  4W5R A;  4DV3 K;  1YJW N;  5EVZ A;  4DTS A;  4LY7 A;  5C2F A;  1HRH A;  1XMQ K;  1TK8 A;  1NGE A;  1WSF A;  1VQL N;  1JCG A;  4YDU C;  4CCH A;  3C94 A;  4NCG A;  1RNH A;  3AAQ A;  2E2O A;  3ZET A;  3CQY A;  1ZBS A;  3CHW A;  5IWA K;  4CHZ A;  1EP4 A;  3A2F A;  4CBW A;  3BUZ B;  5J2P A;  1U04 A;  3TAN A;  3AVJ A;  2ZJR L;  1C0M A;  3IUC A;  2F96 A;  3KLG A;  1CLQ A;  1REV A;  4IFY A;  2IVP A;  4F3O A;  2DTU A;  4BRC A;  4I6M A;  3DXK B;  2RHK A;  4I9Q A;  4OGE A;  1KTQ A;  4ISF A;  3QO9 A;  4O5F A;  5LY3 A;  1X9W A;  4B9M A;  3RR8 A;  2VG5 A;  3V9U A;  5LL6 Z;  5DM6 L;  1JXE A;  1XHZ A;  1TL3 A;  4ID5 A;  3D7E O;  4BQZ A;  3FZF A;  3NMU A;  5KPT A;  1NGJ A;  5C2D A;  4X64 K;  4E19 A;  4DSK A;  4GKK K;  2B4J A;  4BWJ A;  4Y1D A;  3KK2 A;  4CER A;  4B1W B;  4I6M B;  4OKE A;  4YOY A;  1T6C A;  1HNW K;  3L3U A;  1GLE G;  3O1W A;  3GE1 A;  4DSI A;  2YKN A;  3NBP A;  3VPZ A;  4RCH A;  3V9Z A;  1M90 O;  1KXP A;  2Z1J A;  5AQZ A;  4BAC A;  1RDU A;  2GWJ A;  3LPU A;  4QS8 A;  5DMR A;  3MN5 A;  3OW2 M;  3FZH A;  4HWI A;  3SV3 A;  1RDB A;  4BY9 C;  3CQ8 A;  2O8B A;  4B9Q A;  1IV0 A;  3WQU A;  2A6A A;  4DQR A;  2HNY A;  4BDZ A;  3VF4 A;  3VEW A;  2QK9 A;  3NAE A;  4KHU A;  1EXQ A;  5DK5 A;  3OYM A;  3U3Y A;  3R8E A;  4M7X A;  1JCE A;  2NRH A;  3HST B;  4CVN E;  1G99 A;  1J6Z A;  3O9U A;  1VQ6 N;  3TAF A;  4DLG A;  4CJR A;  3AVB A;  4JI6 K;  5D3G A;  3SQ1 A;  4ICL A;  2P5G A;  3DOL A;  5EOY A;  3D2E B;  2W40 A;  2O8B B;  4A62 A;  4CF2 A;  1YTU A;  4FLW A;  4DUZ K;  4IEE A;  5KQ8 A;  2H3G X;  4FVM A;  1S3X A;  3F2K A;  3HPG A;  4BR7 A;  4A57 A;  3BF1 A;  3FZK A;  3VOV A;  1T8E A;  4ELU A;  1FK9 A;  1C1C A;  3L2Q A;  3TAG A;  4IKF A;  3LWM A;  3L3V A;  2O8E B;  2GX9 A;  5FRO A;  4CJU A;  4RG8 A;  3ZEU B;  4ID1 A;  2UUC K;  3HM9 A;  4CIF A;  1VSM A;  2XY7 A;  1J9A A;  2BUP A;  3AO1 A;  2QTD A;  5FRM A;  3DLE A;  3MX2 A;  2D5R A;  4DV0 K;  3OJS A;  1W2B M;  2HHH K;  4CD3 A;  3QIO A;  3L2W A;  1VSK A;  2D0A A;  3VQ6 A;  1GLC G;  3ATU A;  5BRH A;  2FBY A;  4BRF A;  3AVF A;  3C65 A;  4PKG A;  5ELZ A;  3ZLJ A;  3VEX A;  1QVF M;  5GAD P;  3K9J A;  5M1K A;  3NVK A;  1N8R O;  1QE1 A;  4K0K K;  2JWK A;  4O0J A;  3CCJ N;  1S9G A;  4YDU A;  1E3M A;  3KLI A;  4FPB A;  3VQQ A;  4CZG A;  5JS2 A;  2OZS A;  3O80 A;  1VSE A;  4JKC A;  1NK6 A;  3HL8 A;  4E7J A;  3AO4 A;  4KRE A;  1XUP O;  1VSH A;  1TL1 A;  4LF8 K;  1SL2 A;  4YFU A;  1ATR A;  3S3M A;  3H1Q A;  1E4G T;  3OYJ A;  1HNI A;  2QWO A;  1HMV A;  4OJR A;  4E89 A;  4DR2 K;  4CFD A;  2KZZ A;  1C0U A;  2YHW A;  1BIZ A;  4NYN A;  4JI4 K;  3CG7 A;  1T05 A;  3BZC A;  3ZSO A;  1SUQ A;  3I0S A;  3PO4 A;  4AH9 A;  3LP0 A;  4ISG A;  2BE2 A;  1RT1 A;  5ADX A;  3VEV A;  3MX5 A;  3OYG A;  4I2P A;  1B9D A;  2PBD A;  4F2R A;  5EU7 A;  3SMP A;  2A40 A;  4DF8 A;  3CXC M;  1Q82 O;  4AQY K;  4DFK A;  1VSD A;  2E1Y A;  2YKM A;  3OBY A;  3LP3 A;  1ZBL A;  4KH6 A;  1XWL A;  1LV5 A;  4M3U A;  4JD2 A;  4H4M A;  4RW4 A;  2PZS A;  3HPO A;  3U9D A;  5CY4 A;  3THY B;  2HHT A;  1W7A A;  2Y1I A;  1C0G A;  2YJF A;  3NGY A;  3LDN A;  1TVR A;  3KKR A;  1RFQ A;  4O44 A;  3PIP L;  4HHT A;  3S3N A;  2BGG A;  4FM2 A;  1KFD A;  3AVL A;  4LD0 A;  1M1K O;  4FVU A;  4N5S A;  5AZJ A;  2Y1J A;  4Q0B A;  4DSJ A;  4CZF A;  1RT3 A;  4FW2 A;  1IBL K;  4DTR A;  3CCM N;  2CH5 A;  1YI2 N;  3IS9 A;  4ILG B;  2GV9 A;  3OBW A;  3SUP A;  4JKD A;  3FLC O;  4KB1 A;  4RW9 A;  3J7A P;  5HRS A;  1NGF A;  2YNG A;  4BRA A;  2R7Y A;  1J5O A;  1Q18 A;  3ZCM A;  5JMV A;  2E20 A;  2I5J A;  5AQK A;  1IKY A;  1JJ2 M;  4OPJ A;  1WB9 A;  2P9N A;  4CZI A;  4M41 A;  4AM7 A;  4R5P A;  3DRP A;  4DQS A;  4W5T A;  4FJN A;  1BDG A;  5GAE P;  3AVG A;  3BGR A;  1HPZ A;  3LDS A;  3SUN A;  1KAX A;  3EE8 A;  1JL2 A;  5I3U A;  2JGU A;  3V1Q A;  3HP6 A;  3QNO A;  4GMJ B;  1HLU A;  1T7P A;  2E6L A;  2ATQ A;  5LJW A;  4CJP A;  4DV6 K;  3VQ8 A;  1WBD A;  4HCC A;  5CZ1 A;  1IBM K;  3SBG A;  5C12 A;  2W6L A;  5J2N A;  4KTQ A;  1X9M A;  4AHU A;  4BR0 A;  2YV0 X;  1ATN A;  4DCH A;  2YHX A;  4E7K A;  3THW A;  3ITH A;  1BL3 A;  1BGX T;  4DTX A;  1BG3 A;  1IJJ A;  2HVH A;  2P9K B;  3SZ2 A;  4IO9 L;  4QCL A;  4JV5 K;  1D9D A;  1N6Q A;  2VCP A;  4FWQ A;  3T3F A;  2A1S A;  5GIN A;  3W3D A;  3OYK A;  5A2Q O;  1OVY A;  4CEZ A;  1BHL A;  3JSM A;  3VQB A;  1SKW A;  3DRS A;  1VRT A;  1JL1 A;  4Z4E A;  1SL1 A;  3WEE A;  5CYM A;  4CJ5 A;  3SMS A;  1MU2 A;  4B1V A;  1VQK N;  3AVM A;  3LWL A;  4WCE L;  3MN9 A;  3KD1 E;  2ZF5 O;  3H3O B;  1YXQ A;  2WC9 A;  2HND A;  4B3S K;  3A5M C;  1LW0 A;  2A3Z A;  2HST A;  5BN9 A;  2WFB A;  3G25 A;  3TAR A;  2Z1I A;  2O8D A;  4LSL A;  3HOS A;  4DTJ A;  1I94 K;  3THX A;  2Q0U A;  4CE9 A;  4BE2 A;  1BIU A;  4H5W A;  2LSN A;  4QOZ B;  1N5Y A;  2KLA A;  1LCU A;  1SQK A;  4EP4 A;  4C8N A;  4CZE A;  3HT3 A;  1LWF A;  4DMN A;  1KRP A;  5JLH A;  3OS1 A;  1UA1 A;  3O4Q A;  4FK0 A;  2DFE A;  2W41 A;  2WBN A;  3H45 C;  3WT0 A;  4AHS A;  1NOZ A;  4DUY K;  3C7N A;  1ASU A;  4LFA K;  2X78 A;  3VGM A;  1IKX A;  2VQF K;  1QHT A;  2YNI A;  4EHU A;  1NK0 A;  5KRS A;  3PIO L;  4MQ3 A;  3QES A;  3THX B;  1HNV A;  1RTD A;  3MCP A;  3AVH A;  4B3O A;  2IIR A;  5BR9 A;  2J4R A;  4DSE A;  3BP8 A;  5JVG L;  4X62 K;  1ZC6 A;  2VWB A;  3P4I A;  4H5N A;  1HX1 A;  5SZT A;  2ASO A;  2F4V K;  2QA4 N;  3VER A;  2NUB A;  4BRI A;  1HNZ K;  2HBK A;  2Q3S A;  2O8E A;  4FLZ A;  1WNS A;  1W9H A;  2WON A;  3H6E A;  1VAZ A;  5KPZ A; 
#chains in the Genus database with same CATH homology
 3WNG A;  5C24 A;  3DI6 A;  4CHZ A;  4HUE A;  2FBT A;  1EP4 A;  2IS3 A;  3A2F A;  3FFI A;  3LP1 A;  5J2P A;  1U04 A;  2XY5 A;  3TAN A;  3AVJ A;  4FJK A;  1B9F A;  1C0M A;  4PQU A;  3OYL A;  2F96 A;  4Z4I A;  5KTQ A;  2VWJ A;  3KLG A;  1CLQ A;  1REV A;  4IFY A;  2YNF A;  4F3O A;  2DTU A;  2D0B A;  2ETJ A;  3P1G A;  4IDK A;  5HRP A;  1EX4 A;  3PUF A;  1WSG A;  2HHQ A;  1ASV A;  1YVU A;  4CGF A;  4I9Q A;  1LAW A;  1S1X A;  3OY9 A;  4E0D A;  4OGE A;  1KTQ A;  3RMB A;  3QET A;  1XI1 A;  4HUG A;  4FJJ A;  3QO9 A;  1QSY A;  2ITG A;  2ZQB A;  1X1P A;  1TAQ A;  3MEC A;  3IAY A;  4FJH A;  3DOK A;  4AHC A;  3SPZ A;  4KAZ A;  3OYN A;  4BDY A;  1X9W A;  2G8W A;  4B9M A;  2G8H A;  3QLH A;  4I2Q A;  2P1J A;  2VG5 A;  3RR8 A;  3V9U A;  3RTV A;  3ZSV A;  1JKH A;  1S6Q A;  3NDK A;  1JXE A;  1K6Y A;  1TL3 A;  5T7B A;  3CFP A;  1XHZ A;  3AA2 A;  3L2R A;  1ZYQ A;  4ID5 A;  3NHG A;  1Q9Y A;  4B9V A;  4KHS A;  4FK2 A;  1JLE A;  1NKB A;  3DM2 A;  1JLQ A;  1RDC A;  4J2D A;  3QEW A;  3LAK A;  3OYB A;  1TKD A;  1RTJ A;  4E19 A;  4DSK A;  4DQQ A;  2X74 A;  2B5J A;  4FJG A;  2OPP A;  3HVT A;  4ELV A;  1RBU A;  3C95 A;  2E4L A;  1A5W A;  3KLF A;  2B4J A;  4BWJ A;  2IGI A;  1CZ9 A;  1WAF A;  4Y1D A;  3KK2 A;  4FM1 A;  1D5A A;  4CER A;  1FXX A;  1S1T A;  4BE1 A;  3C6U A;  4CF8 A;  4CGI A;  2YHA A;  4OKE A;  4IG3 A;  4FLT A;  5HLF A;  4UQG A;  3L3U A;  4IFV A;  3ALY A;  3OYE A;  3PX4 A;  2F8T A;  4DTP A;  1NJW A;  4FLY A;  2ZD1 A;  3O3G A;  3V9X A;  2YKN A;  4FW1 A;  4CK2 A;  3NBP A;  3V6D A;  4CF9 A;  4E7I A;  4DSI A;  4CHQ A;  4L8R B;  3SUQ A;  4J2B A;  3WNF A;  3K59 A;  3V9Z A;  3KK3 A;  1L3T A;  3NFA A;  2KW4 A;  2Z1J A;  3HVR A;  1QTM A;  2PYJ A;  4BAC A;  4FJ5 A;  3NGZ A;  3HYF A;  4KB0 A;  4OVL A;  1RCH A;  1HQU A;  3LPU A;  5DMR A;  3CFR A;  4W5O A;  1B92 A;  4FM0 A;  4DFJ A;  2FBV A;  1S1U A;  3K5L A;  2HHS A;  3SV3 A;  4AHT A;  1RDB A;  1HYS A;  3CQ8 A;  2FBX A;  4Z4H A;  3AO5 A;  4O55 A;  4M3R A;  4CJE A;  3O3H A;  3TAQ A;  1R0A A;  5KRT A;  1TKZ A;  1VRU A;  4DQR A;  2HNY A;  1I3A A;  4BDZ A;  3PV8 A;  4Q5V A;  3D0P A;  1IKV A;  1QQC A;  4DTN A;  3VQP A;  2QK9 A;  3NAE A;  1BQM A;  1RT7 A;  3THV A;  3DLH A;  3RWU A;  3ZT0 A;  1EKE A;  3RRH A;  1LW2 A;  1JXB A;  3OS2 A;  4B9S A;  4KHU A;  4AHR A;  1EXQ A;  5DK5 A;  3OYM A;  3U3Y A;  3NF8 A;  3QIN A;  4O0I A;  3AVI A;  4AHV A;  3HST B;  3MXM A;  2KZM A;  3MED A;  4FCY A;  2BAN A;  3TAE A;  1L3V A;  3KTQ A;  1UA0 A;  4DTU A;  3SCX A;  3TAF A;  3PY8 A;  3QEI A;  4BWM A;  3DRR A;  4CJR A;  4DLG A;  4B9L A;  3AVB A;  5D3G A;  3SQ1 A;  4CK1 A;  5KGW A;  4B8C A;  3LAN A;  4CHN A;  4ICL A;  2VG6 A;  2P5G A;  4OKJ A;  2XY6 A;  3DOL A;  1ZBH A;  4W5Q A;  3RRG A;  3VQ5 A;  3TI0 A;  4HUF A;  2E6M A;  5K14 A;  4EP5 A;  1T03 A;  3ZSR A;  1J53 A;  4CF2 A;  1RDA A;  4FLW A;  1YTU A;  1JLC A;  4FJI A;  3OYI A;  3QEV A;  4FVM A;  3V9W A;  2YNH A;  3V81 A;  4FXD A;  3HPG A;  4M3T A;  1O1W A;  4HVJ A;  1WSJ A;  3B6P A;  1IH7 A;  4DSL A;  4KPY A;  1T8E A;  3V1R A;  1HYZ A;  4ELU A;  1FK9 A;  4PWD A;  3L2U A;  1C1C A;  1YTA A;  5JS1 A;  3L2Q A;  3TAG A;  4IKF A;  3OYH A;  2XO7 A;  3LZI A;  3LZJ A;  1WSH A;  3LWM A;  1U49 A;  1C1A A;  3KLE A;  3L3V A;  4OLB A;  4PUO A;  4OKK A;  2X6S A;  4CEA A;  3CYM A;  2JLE A;  5FRO A;  1QSL A;  3M8Q A;  2HHX A;  3NH0 A;  4CJU A;  1D9F A;  4RG8 A;  1HQE A;  3DYA A;  4ID1 A;  4CK3 A;  3HM9 A;  2D0C A;  4CIF A;  4W5N A;  1VSM A;  4B9T A;  1JLG A;  2XY7 A;  1IO2 A;  1J9A A;  2IOC A;  2ZE2 A;  1BIS A;  3AO1 A;  3CM5 A;  4ZHR A;  1RDD A;  3TAB A;  3DLE A;  5FRM A;  3L2V A;  2D5R A;  4H8K A;  2HHV A;  1ASW A;  3E01 A;  3OJS A;  4EZ6 A;  1LAV A;  1WLJ A;  3KIO A;  4HCB A;  1BCM A;  3QIO A;  3L2W A;  2VWK A;  2XRI A;  1VSK A;  2D0A A;  3VQ6 A;  3OYD A;  3M8S A;  1NK8 A;  2VG7 A;  1U4B A;  4KHQ A;  2FBY A;  4IBN A;  2IAJ A;  3HXM A;  3PO5 A;  2AJQ A;  3TR8 A;  3M8R A;  3AVF A;  4N47 A;  1TK5 A;  4CF0 A;  5I42 A;  1BI4 B;  2OA8 A;  2G8I A;  2OPQ A;  3RMC A;  2RPI A;  4BE0 A;  1QE1 A;  4Z4C A;  2O4I A;  1F21 A;  4E7L A;  2XHB A;  4O0J A;  4Z4F A;  1S9G A;  5CYQ A;  1JLF A;  3K5O A;  5FDL A;  1DTT A;  3KLI A;  3VQQ A;  1LWE A;  5JS2 A;  3SYZ A;  4FJL A;  1A5X A;  1GOB A;  3T1A A;  2OZS A;  2O4G A;  1VSE A;  1KFS A;  1EET A;  1NK6 A;  3HL8 A;  4E7J A;  3AO4 A;  4YNQ A;  2DFH A;  1WSE A;  1L3U A;  4FZX C;  4KRE A;  1VSH A;  3OYF A;  3NGI A;  3P83 D;  1TL1 A;  1KVB A;  4J2E A;  2IC3 A;  4AIL C;  1SL2 A;  4YFU A;  3S3M A;  4FJX A;  1KLM A;  1BCO A;  3OYJ A;  1HNI A;  3CM6 A;  4JS4 A;  4JRQ A;  1HMV A;  4OJR A;  1HYV A;  4E89 A;  1Z25 A;  4KFB A;  4CFD A;  1C0U A;  2KZZ A;  1G15 A;  1BIZ A;  4KKO A;  3SQ2 A;  2HHW A;  4NYN A;  1SV5 A;  3B6O A;  4KI6 A;  3HJF A;  3CG7 A;  1T05 A;  2EX3 A;  3ZSO A;  3KLH A;  1NK4 A;  1SUQ A;  3I0S A;  1BI4 A;  3S3O A;  4M3Y A;  3PO4 A;  3S9H A;  4O5B A;  2B6A A;  4AH9 A;  1U45 A;  2X6N A;  3SQ0 A;  2G8U A;  3LP0 A;  4CGH A;  4DWI A;  4JLH A;  4FYD A;  3AO3 A;  2BE2 A;  4TSX A;  1RT1 A;  3TAM A;  1NJX A;  4B9U A;  3OYG A;  4I2P A;  3TAP A;  5KI6 A;  1B9D A;  4G1Q A;  1TGO A;  2PY5 A;  1DLO A;  1JLB A;  3G0Z A;  2HHU A;  5J1E A;  4DF4 A;  4F2R A;  5EU7 A;  3VQD A;  2XY8 A;  3IRX A;  3AVK A;  1FKO A;  3CFO A;  4MFB A;  3K2P A;  4N56 A;  4Y1C A;  3AO2 A;  3ZT3 A;  4CIE A;  4DF8 A;  4DTO A;  4DFK A;  1VSD A;  3K58 A;  4ELT A;  4CJV A;  3NF6 A;  2HVI A;  1ZBI A;  2YKM A;  2RKI A;  3C6T A;  3LP3 A;  1S1W A;  1ZBL A;  2QKK A;  3AA3 A;  1XWL A;  2HNZ A;  3LAL A;  2WOM A;  1LV5 A;  1RBR A;  2OYQ A;  4M3U A;  2FC0 A;  3DMJ A;  3KKS A;  4H4M A;  4I9L A;  3HP9 A;  4RW4 A;  2QXF A;  4M45 A;  3HPO A;  1S1V A;  5CY4 A;  3AVN A;  3O3F A;  3ULD A;  2PZS A;  5CZ2 A;  4C8M A;  1RT6 A;  3ZSZ A;  4CEF A;  4FZY A;  4F2S A;  2Y1I A;  1J54 A;  1LWC A;  4OLA A;  2DFF A;  2RN2 A;  3HPH A;  3NGY A;  4ZTJ A;  3K5M A;  4M3X A;  1TVR A;  3OJU A;  3KKR A;  3OVN A;  4O44 A;  1U48 A;  4HHT A;  4CGD A;  3ZSY A;  3S3N A;  2BGG A;  4FM2 A;  1KFD A;  3AVL A;  5FRN A;  4LD0 A;  1TK0 A;  1VSF A;  3KK1 A;  3U6F A;  4DQP A;  3MEG A;  1KCF A;  1I39 A;  4CEB A;  4E1N A;  4LSN A;  1XHX A;  3ZSW A;  4JS5 A;  1Z26 A;  4ZTF A;  2GBZ A;  4N5S A;  1X9S A;  4KI4 A;  1KSP A;  2HHT A;  2Y1J A;  3LP2 A;  1RTI A;  1IKW A;  4CED A;  1UOC A;  4DSJ A;  4Q0B A;  1RT3 A;  4FW2 A;  3QEX A;  3I8D A;  4CES A;  4DTR A;  1CZB A;  3V4I A;  4K8X A;  2HB5 A;  3IS9 A;  1ZBF A;  2GV9 A;  1IG9 A;  1C1B A;  3G10 A;  3SUP A;  4RW8 A;  4RW7 A;  3T19 A;  4LH4 A;  4CGJ A;  4RW9 A;  4E1M A;  3QIP A;  3F73 A;  1Q9X A;  4KB1 A;  5HRS A;  3D45 A;  4OGC A;  3QNN A;  4NCB A;  2YNG A;  4K8Z A;  1Q8I A;  2R7Y A;  1J5O A;  3ZCM A;  3VN5 A;  3NF9 A;  4M3Z A;  3U3G A;  2I5J A;  2HW3 A;  3K57 A;  4GW6 A;  1IKY A;  2OPR A;  4FJ9 A;  4CJ3 A;  3KD5 E;  3QEP A;  4OPJ A;  1CXQ A;  3JYT A;  4CHY A;  2EHG A;  4DLE A;  2GUI A;  2DY4 A;  3HO1 A;  4FJM A;  2RF2 A;  1A5V A;  4M41 A;  1SL0 A;  4R5P A;  1ZBU A;  3DRP A;  2G8F A;  4CHP A;  3KJV A;  4DQS A;  1GOC A;  3VQC A;  4CHO A;  4W5T A;  4FJN A;  4O4G A;  5SWM A;  3MXI A;  5HRO A;  4GVM A;  3AVG A;  3BGR A;  1KLN A;  1HPZ A;  3LDS A;  3SUN A;  2G8V A;  4CEO A;  4KTZ A;  4RW6 A;  3VA0 A;  1JL2 A;  1S9E A;  2P51 A;  3ZT1 A;  5I3U A;  2JGU A;  3MAQ A;  4NYF A;  3V1Q A;  1NK5 A;  3HP6 A;  4F8R A;  3ISN C;  4KRF A;  4WE1 A;  3NF7 A;  3QNO A;  2PYL A;  4DFP A;  1TAU A;  4GMJ B;  1T7P A;  1WSI A;  4KHY A;  2E6L A;  1NKE A;  4N41 A;  2W42 A;  2KFN A;  2ATQ A;  4JRP A;  4CJK A;  4N76 A;  4CJP A;  4CJS A;  1SKR A;  3VQ8 A;  1RT5 A;  3VA3 A;  3QER A;  1HJR A;  3O4N A;  3AA5 X;  4CJT A;  3PX0 A;  2OPS A;  3SUO A;  1QSS A;  5CZ1 A;  4HCC A;  1NOY A;  4DS5 A;  4CJQ A;  4CJW A;  2YHB A;  4DU4 A;  1L3S A;  1DTQ A;  3NH1 A;  4CJF A;  3DLK A;  3SV4 A;  5J2N A;  4CGG A;  3SQ4 A;  1QS4 A;  3TWH A;  4KTQ A;  1X9M A;  3DLG A;  4PY5 A;  4AHU A;  2YV0 X;  3M8P A;  4CEC A;  3UIQ A;  3L8B A;  4E7K A;  3RMD A;  1NK7 A;  2KQ2 A;  3ITH A;  3ZT2 A;  4XIU A;  3EY1 A;  1BL3 A;  1BGX T;  1RBS A;  4KO0 A;  4DTX A;  3NE6 A;  1WAJ A;  4LH5 A;  2HVH A;  3ASM A;  4CIG A;  3V1O A;  3SZ2 A;  4DQI A;  4FLX A;  1NK9 A;  1BQN A;  4QCL A;  1D9D A;  1N6Q A;  2A1R A;  3NH2 A;  3T3F A;  4H4O A;  2A1S A;  3AV9 A;  4CEE A;  5C25 A;  5HRN A;  3VQ4 A;  4DU1 A;  4NCA A;  2KTQ A;  2F8S A;  3P5J A;  3OYK A;  3SJJ A;  1D8Y A;  4CEZ A;  4M3W A;  4BDP A;  1RT2 A;  4F3T A;  1BHL A;  3JSM A;  3VQB A;  2HMI A;  1SKW A;  3DRS A;  1VRT A;  1JL1 A;  1VK0 A;  4Z4E A;  1SL1 A;  4EZ9 A;  1ITG A;  4KV8 A;  4FLV A;  5HBM A;  1S6P A;  5CYM A;  3ZT4 A;  3MXJ A;  2OZM A;  4CJ5 A;  3NCI A;  3ZSQ A;  1L5U A;  4KTW A;  4QAG A;  1RTH A;  1MU2 A;  1JLA A;  1S5J A;  1Y97 A;  3AVM A;  4CJL A;  3LWL A;  4CFA A;  3KD1 E;  1WN7 A;  3VQA A;  1YT3 A;  2IDO A;  1VSL A;  4DFM A;  2KFZ A;  2HND A;  4FLU A;  3WNE A;  2BDP A;  1LW0 A;  1W0H A;  2G8K A;  4C8O A;  3IG1 A;  1RBT A;  1NJY A;  1UAX A;  2Z1I A;  4Z0U A;  3PX6 A;  3TAR A;  4LSL A;  4DTJ A;  3SPY A;  3VQ7 A;  1CXU A;  4CFC A;  4DU3 A;  4CE9 A;  4BE2 A;  3H08 A;  1BIU A;  4IG0 A;  4DS4 A;  4I7F A;  5C42 A;  4OPK A;  2LSN A;  1XC9 A;  4QOZ B;  1N5Y A;  1SKS A;  3AA4 A;  4C8L A;  4EP4 A;  4C8N A;  3SNN A;  1RIL A;  3HT3 A;  4B08 A;  3I0R A;  1RBV A;  3RR7 A;  3SI6 A;  1LWF A;  5HP1 A;  4DMN A;  5HRR A;  5J2M A;  1KRP A;  3OS1 A;  1UA1 A;  4FJ8 A;  3O4Q A;  5E41 A;  2Z1H A;  4FK0 A;  1UWB A;  3ZSX A;  4DSF A;  4M42 A;  2DFE A;  3VQ9 A;  3BDP A;  1VSJ A;  3F9K A;  2P5O A;  2Z1G A;  4KHW A;  4KHN A;  1C6V A;  4AHS A;  2QKB A;  3OS0 A;  4F4K A;  1NOZ A;  1KVC A;  3AVC A;  4DTM A;  4E7H A;  4Z4G A;  1ASU A;  1GOA A;  1NJZ A;  1NKC A;  2X78 A;  3LAM A;  4DG1 A;  3EZ5 A;  1IKX A;  1TKT A;  3VQE A;  4FK4 A;  4E3S A;  1TV6 A;  4FJ7 A;  4FZZ A;  1QHT A;  3K5N A;  4B9N A;  2YNI A;  1NK0 A;  4W5R A;  5KRS A;  4MQ3 A;  4CF1 A;  3QES A;  3RMA A;  1HNV A;  1RTD A;  4CFB A;  4DTS A;  3AVH A;  4LY7 A;  4B3O A;  3EYZ A;  3AVA A;  4CJ4 A;  4CEQ A;  3DLR A;  4PA1 A;  3OYA A;  4C8K A;  4J2A A;  4DSE A;  1HRH A;  3DLB A;  5KGX A;  3HK2 A;  1FKP A;  3MEE A;  1TK8 A;  3WNH A;  3V9S A;  1WSF A;  1C0T A;  5SZT A;  4CCH A;  3C94 A;  2NUB A;  4NCG A;  1RNH A;  1VSI A;  1RT4 A;  2Q3S A;  4HTU A;  4FLZ A;  3LPT A;  1WNS A;  1W9H A;  2WON A;  1TKX A;  3OYC A;  5J2Q A;  1KVA A;  1U47 A;  4B8A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...