4B8CA

Nuclease module of the yeast ccr4-not complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
280
structure length
267
Chain Sequence
PIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/cell cycle
total genus 85
structure length 267
sequence length 280
chains with identical sequence C, E, F
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b8cA00
1HMVA 1TAQA 2YKNA 2B6AA 1L3SA 3KD5E 1S1UA 4RG8A 2Z1GA 2DTUA 4RW4A 4DSJA 3OYAA 1KLNA 3SUNA 5HBMA 1L3TA 1ZBFA 2RF2A 4CEEA 3SV3A 3SQ0A 1L3UA 3RR8A 4CEZA 4KV8A 2HHSA 4CFDA 3QNOA 1U47A 1T7PA 2PYLA 4KI4A 4BACA 3IG1A 4KFBA 3FFIA 1C1BA 2XO7A 1U48A 4PQUA 1S1XA 1UWBA 4J2DA 4OJRA 3ZT2A 1QSYA 3BDPA 4DU4A 4Z4IA 2YHAA 3ZT0A 4Y1DA 3DOKA 3SUPA 3AVFA 4CECA 3KTQA 1VRTA 4B3OA 4OGCA 3NBPA 4M3RA 1RDBA 4O4GA 3NF6A 4CFCA 1W0HA 2X6SA 4IG0A 1RT3A 2Q3SA 4DSLA 4F3OA 4H4MA 3ZSYA 3HPGA 4CF9A 4DU1A 3QETA 4E0DA 3MAQA 1R0AA 1S6PA 4BDZA 4MQ3A 1S1WA 4W5OA 4B08A 4CIFA 4DF8A 3IAYA 3P5JA 2P5OA 2P1JA 4OKJA 3OYNA 4M41A 2BANA 1ZYQA 1SL1A 1CLQA 1NOZA 4AHTA 4EZ6A 1WSFA 3VQ5A 3S3MA 3TWHA 4JRQA 3V9WA 1JXEA 4R5PA 1IKXA 4BDYA 2PZSA 3P83D 1BI4A 4FJNA 1HQUA 3L2UA 4Z4EA 4IBNA 1YT3A 1W9HA 2DFEA 4N76A 4OLBA 3QNNA 4CJVA 4CCHA 3V9XA 1WSIA 2ZD1A 2ZE2A 1TGOA 4ICLA 2OA8A 4CGJA 1JLGA 5EU7A 4DTUA 4RW8A 1C1CA 2IOCA 4Y1CA 4NCGA 5J2PA 3RMDA 3RMAA 1RCHA 3HM9A 3HT3A 4CEFA 4CJWA 1C0MA 1TK0A 2FBYA 1IKYA 4AHVA 3T3FA 2FBTA 3OYFA 3SNNA 1RT6A 1VSDA 2I5JA 1MU2A 2PYJA 3AVAA 4FJGA 1TK8A 3AVBA 1XWLA 2O4IA 2A1SA 1XI1A 1DLOA 4EZ9A 1EX4A 4M3UA 1BHLA 1RT4A 4RW9A 4AILC 5D3GA 3H08A 3MEEA 2D0BA 3U6FA 5I42A 3ZT4A 1VSJA 2G8WA 4CJPA 3L3UA 4CF2A 4E7IA 3S3NA 4F2RA 4ELVA 1QS4A 3V6DA 4ELUA 3MEGA 1RTIA 3K5LA 2XY5A 1HYSA 4PUOA 3BGRA 3KIOA 1HNVA 3VN5A 3V9ZA 1ZBIA 1VSKA 3B6PA 4DG1A 3VQCA 2HB5A 3V1OA 3AO3A 4B9MA 3VQQA 4CF0A 4OPJA 3O4NA 3TAFA 2Z1JA 3CM6A 4KO0A 4DFPA 3OYKA 3AA2A 3SQ4A 1IG9A 3QIPA 2HNYA 3ZSXA 4FJLA 3ZCMA 3AVHA 4CJEA 4IG3A 4YFUA 4B9UA 2P51A 2AJQA 4EP5A 3OYMA 4ZTJA 1SL2A 4CHOA 4KTQA 4W5TA 3CG7A 3QEXA 3NF7A 4Z4HA 3TARA 4QCLA 1C6VA 3KD1E 2KFNA 1TKDA 4QOZB 5HRNA 1C1AA 4HHTA 1QE1A 3LAKA 2XY7A 1X9SA 1LAVA 4LY7A 4M3WA 4F3TA 2F96A 3QIOA 5KRSA 2WOMA 4CJ3A 1UA1A 3EYZA 3AO4A 3AVLA 3DRPA 2B4JA 4Q0BA 5J1EA 1NJYA 1J9AA 2HHUA 1KFDA 4CJTA 1NJZA 4KI6A 2O4GA 2BGGA 4PWDA 5C24A 2HHQA 2BDPA 4DTSA 1VSIA 4FZZA 4CFAA 5KTQA 1GOBA 4KB0A 4CEAA 3CFRA 3RMBA 4CE9A 3NGYA 4DTNA 4B9LA 4DQPA 3K5NA 3VA3A 1KSPA 2IC3A 4B8CA 3LP1A 4AHCA 5CY4A 1EETA 4IDKA 4N47A 3RMCA 1EP4A 1WLJA 1RBRA 3V9UA 3AVIA 4OGEA 4HTUA 3HK2A 1IO2A 3HP9A 5E41A 2HW3A 4BE1A 3PUFA 1SKRA 3DLRA 4CEQA 5T7BA 4C8KA 2HVIA 4CJLA 1J53A 3NGIA 1RT7A 3DI6A 1DTQA 3VQBA 2D0CA 2DFHA 3T1AA 3AV9A 4YNQA 1RTDA 3HJFA 4H8KA 3LP3A 1U45A 4FJKA 2E6LA 4AHSA 3V81A 4DQQA 1RILA 1B92A 2IAJA 1G15A 1Z25A 2GBZA 2OPRA 3M8PA 4TSXA 1KTQA 3ZSOA 3V4IA 2Z1IA 1Y97A 3SV4A 1WSHA 4N5SA 2G8FA 4O0JA 3KKRA 4PY5A 1IH7A 4E89A 4HCCA 1S5JA 4QAGA 4I2QA 1QTMA 1BCOA 4CHQA 2F8TA 3LWLA 3OJSA 5HRRA 3TABA 2KW4A 4RW7A 4FVMA 5HP1A 1C0TA 4CEOA 3TI0A 4FJ9A 4FLXA 4NCBA 1A5XA 4ELTA 4M3XA 1JLQA 1T8EA 4I9QA 3VQ4A 1EKEA 3ISNC 1TVRA 3AVNA 1REVA 4LH5A 5J2NA 3VQ9A 3HP6A 4CGGA 4Q5VA 4PA1A 3OYEA 3HYFA 4CHYA 1CXUA 1QSLA 5FRMA 2PY5A 1C0UA 4E7JA 3K59A 3ITHA 3PO4A 4E7KA 1CZ9A 1JL2A 4E1NA 2QKBA 2E6MA 4CIEA 3LPUA 4NYNA 3AO2A 2QKKA 2F8SA 4FM0A 1TL3A 1TV6A 3ZSZA 3NCIA 3RRGA 3SJJA 4DSFA 4JRPA 4FW2A 3SUQA 4C8NA 1ASUA 2B5JA 3L8BA 4CF8A 4CFBA 4CHNA 4Z4FA 3KLHA 3G0ZA 2DFFA 3TAQA 3OYLA 5J2MA 4FJIA 1S1VA 3G10A 3IRXA 4CEDA 3DRSA 1QQCA 1VK0A 1WN7A 4CJFA 5KI6A 1T05A 2G8VA 1LWFA 1ZBLA 2IDOA 2YHBA 1NK5A 5CZ1A 4BWMA 1JXBA 4CJUA 3LDSA 1BISA 4CK2A 4IKFA 1UOCA 4FZYA 1KLMA 3C6UA 3DLGA 1S1TA 4UQGA 4KHSA 2Z1HA 5HRPA 4DS4A 1HRHA 1VSLA 3KLFA 1WAJA 1SKSA 4KHNA 3U3GA 2XHBA 4FLZA 4B9VA 1RNHA 3EZ5A 3SQ2A 4FK0A 3HPOA 3TAGA 1DTTA 1K6YA 4DQRA 4KAZA 5I3UA 1TKZA 3VQPA 3OY9A 4M45A 4B8AB 3KK3A 3SI6A 3ZSQA 3K2PA 3O3FA 4HCBA 4BE2A 3D45A 5FROA 2YNFA 3JYTA 3L2QA 2HHXA 1RDCA 4KHYA 1WSEA 4CESA 4DLGA 1WSJA 1HPZA 3WNGA 4CGHA 1RBVA 2VWJA 1RTJA 4O5BA 1O1WA 3LANA 1UAXA 4O55A 3VQDA 3TANA 3VQ8A 4C8OA 5FRNA 2G8HA 1D9FA 2G8UA 2DY4A 4CEBA 4CJ4A 3KLIA 4E1MA 3KK1A 1FKOA 1VSHA 1SKWA 1TK5A 3ULDA 3KJVA 1TAUA 5DMRA 2W42A 3HVRA 2P5GA 1HJRA 4M3YA 2VG7A 1S9EA 1B9FA 1RDDA 1LAWA 3HXMA 3K5OA 4WE1A 4B9NA 2XY8A 3NGZA 3V1RA 3I8DA 4HUEA 4FLTA 1Q9XA 1WNSA 3HO1A 2HVHA 1FK9A 1S9GA 4FXDA 1X1PA 1BIUA 1FXXA 1SV5A 3C6TA 4GW6A 4W5QA 1LV5A 3KKSA 1D8YA 3AVMA 4FW1A 4DU3A 3AVKA 3QEIA 4CK1A 3VQEA 1L3VA 3F73A 3QERA 3SYZA 1SL0A 3SQ1A 4CF1A 1J5OA 3RR7A 3EY1A 3AVJA 4HUFA 1WAFA 3VQAA 1ASVA 2X74A 1NK8A 1NKBA 3MECA 2LSNA 4CERA 2RN2A 1VRUA 5C25A 1JL1A 2OZMA 2ATQA 4C8LA 1D5AA 1XC9A 3OS2A 1RT2A 4DSEA 3OYCA 1BCMA 3V9SA 1SUQA 4MFBA 3VQ7A 3M8SA 3QESA 1JLBA 4CJRA 4N56A 1LWEA 3MXJA 3KLGA 4JLHA 1HYVA 4DLEA 4KHWA 4N41A 3TAMA 3M8QA 1N6QA 3O3GA 5SWMA 2VG6A 2YV0X 3NE6A 1LW0A 2IGIA 5JS2A 3DOLA 3PY8A 2HNZA 4NCAA 5FDLA 3CFPA 4B9SA 2FC0A 4GMJB 3LZJA 5CYQA 1U4BA 2JGUA 4ID1A 3S3OA 1J54A 3OYJA 2R7YA 4O44A 3KK2A 5CZ2A 3L2WA 2ZQBA 4F4KA 1Q9YA 4DTRA 1U04A 4JS4A 2KZMA 2X78A 1Q8IA 3OYBA 4ZTFA 1LW2A 3HL8A 5HLFA 3QLHA 1Z26A 4AH9A 2G8KA 4DTJA 1BI4B 1HYZA 4L8RB 1VSFA 1B9DA 1NK9A 3ALYA 3AVGA 3OJUA 3CYMA 2GUIA 4KKOA 3VQ6A 4FJMA 3AA3A 3O4QA 4FJJA 3AA5X 3OS0A 3NDKA 1X9MA 1JLCA 3O3HA 4FJHA 4CGFA 3K57A 1ZBUA 4Z4CA 3DLHA 1U49A 4DFMA 3I0RA 1ZBHA 2IS3A 2YNHA 3IS9A 4M3ZA 1RDAA 3HVTA 2RPIA 4BWJA 5KGXA 2HNDA 1BQNA 2EX3A 4BDPA 2OYQA 4Z4GA 2KTQA 3DMJA 4IFVA 3PX0A 3MXIA 4G1QA 3LZIA 3RRHA 1A5WA 4DSKA 4M3TA 1I39A 1NK0A 4DFJA 2Y1IA 3OYIA 4JS5A 3MXMA 1RTHA 3ZSVA 1JLFA 3NF9A 5JS1A 1GOAA 3LP2A 1NJWA 3SCXA 3A2FA 1I3AA 2QK9A 3DRRA 4AHUA 4B9TA 2VG5A 4KPYA 1XHZA 3NF8A 3ZSRA 3PO5A 3QEPA 4FJ5A 1QHTA 4FLWA 3F9KA 2GV9A 4DQIA 1IKWA 3OYDA 4LSNA 1VSEA 3LAMA 4FCYA 3NAEA 3QO9A 3L2RA 3ZT3A 4CJ5A 5HRSA 1YTUA 3C94A 3V1QA 4OPKA 3DLKA 1CXQA 3PX6A 4DFKA 2EHGA 3OS1A 3M8RA 1UA0A 4FJ7A 2A1RA 1JKHA 1YVUA 2X6NA 2ETJA 3MEDA 1KFSA 3SPZA 1RBSA 1BL3A 3QEWA 3RWUA 2OPPA 4LH4A 3CQ8A 4E7LA 3QEVA 2KQ2A 4NYFA 3KLEA 3LWMA 1XHXA 3HSTB 1TKXA 1BQMA 3JSMA 3K58A 4DTOA 1NKCA 4OLAA 4KHUA 3CM5A 3OYHA 3QINA 4DQSA 2Y1JA 4IFYA 3ZSWA 4GVMA 2KFZA 1S6QA 4FM2A 4W5NA 1HQEA 4LSLA 4OVLA 1FKPA 4OKEA 5KRTA 4DS5A 2YNGA 2E4LA 3SZ2A 3L2VA 3ZT1A 1BGXT 3ASMA 2XRIA 1X9WA 3NFAA 5C42A 4DTMA 4FJ8A 4DTXA 2JLEA 3C95A 2NUBA 4KB1A 2OPQA 4CGIA 1T03A 3WNEA 1L5UA 4ZHRA 3NH1A 3DYAA 2D5RA 1N5YA 4CJKA 4F2SA 1KVAA 2ITGA 1NKEA 1RT1A 4ID5A 4CGDA 3NH2A 2YKMA 2HHTA 1A5VA 2D0AA 1RT5A 4I7FA 2RKIA 2HMIA 4FJXA 2KZZA 1NJXA 4KREA 3AO1A 4DTPA 4DMNA 1WSGA 1VSMA 3TAEA 4K8ZA 4DF4A 2HHWA 4EP4A 4KTWA 3E01A 1KVCA 1JLEA 1YTAA 4BE0A 3D0PA 4HUGA 2HHVA 3I0SA 3PV8A 3VA0A 1NK4A 4FM1A 3OVNA 4XIUA 5SZTA 4J2BA 1RBTA 4J2EA 4K8XA 3LALA 1EXQA 3B6OA 1HNIA 1KCFA 1F21A 2XY6A 3DM2A 4AHRA 1D9DA 2BE2A 1IKVA 4E7HA 3CFOA 5DK5A 1BIZA 3AA4A 3DLBA 1KVBA 3NHGA 1KRPA 4F8RA 4I2PA 4Z0UA 1RBUA 3S9HA 1NOYA 2G8IA 3PX4A 5KGWA 3NH0A 3SPYA 3WNHA 4DWIA 4O0IA 4M42A 1JLAA 4E19A 3LPTA 4FLVA 4FK4A 4HVJA 1ASWA 3AVCA 3UIQA 3TAPA 3DLEA 4CHZA 3L3VA 1QSSA 3HPHA 4DSIA 4J2AA 4RW6A 2VWKA 3K5MA 3THVA 2FBXA 3P1GA 5HROA 3U3YA 5K14A 4OKKA 2FBVA 3WNFA 4CJQA 4C8MA 4CHPA 1NK7A 4KRFA 3AO5A 4W5RA 4CIGA 5CYMA 1LWCA 4E3SA 5J2QA 4FLUA 4CJSA 4LD0A 1ITGA 3OYGA 4FZXC 4H4OA 1GOCA 2OPSA 4FYDA 2OZSA 4KHQA 2WONA 4KTZA 3T19A 2QXFA 2YNIA 4I9LA 1NK6A 4FLYA 3LP0A 3TR8A 3RTVA 3SUOA 1CZBA 1TKTA 4FK2A 4CK3A 1TL1A
chains in the Genus database with same CATH superfamily
4LF6K 4JKHA 1ZC6A 4RW4A 2JWLA 4DR1K 5HBMA 1L3TA 1ZBFA 3H1QA 2HHSA 3RR8A 4KV8A 3QNOA 1T7PA 1U47A 2PYLA 5AZJB 4B1XB 4KFBA 4H0XB 1QHAA 3ZETB 1S1XA 1YIJN 3FZLA 2ASPA 3ULEA 1HKCA 2YHAA 3DOKA 3NBPA 5C12A 3NF6A 1W0HA 2X6SA 4IG0A 1GLAG 1SZ2A 3QETA 4MQ3A 4B08A 5AQIA 3IAYA 2P1JA 3OYNA 4B1WB 4QS7A 4AHTA 1WSFA 3TWHA 4DV7K 4CI6A 4FJNA 4FWOA 3MN6A 2UU9K 3CJ7A 4ISGA 3CCSN 4IBNA 4H5VA 4WQ4A 4PKHA 5B8HA 4N76A 3VERA 1WSIA 3F2KA 4JI5K 4K43A 4CGJA 5EU7A 1RGIA 4EIAA 5KPRA 4WQ5A 3T3FA 2PYJA 1VSDA 4LF4K 1XWLA 4GV9A 4JKBA 3ZT4A 1VSJA 3DXKA 4IEEA 2G8WA 3BF1A 4E7IA 1P8ZA 2E20A 1RTIA 3LL3A 3K5LA 1HNVA 3I8BA 3VN5A 3AY9A 3B6PA 3VQCA 3U9DA 4KO0A 4DFPA 1IG9A 3EZWA 3ZCMA 3AVHA 3LM9A 1HUXA 4IG3A 2FF6A 2P51A 4LF8K 4EP5A 3CF5L 3IKMA 4BR2A 3QEXA 2KFNA 4QOZB 4HHTA 5AQXA 1UA1A 3HRGA 3EYZA 4Q0BA 2O4GA 3THXA 4E1JA 2BDPA 2E88A 3CCJN 5KTQA 3CCQN 4DUYK 2HHHK 1N36K 3M6GA 4NO7A 3NGYA 4B9LA 1KSPA 3SAGA 3LP1A 5CY4A 5AQTA 4IDKA 4N47A 4YOYA 3R8EA 3RMCA 1WLJA 4XH1A 3V9UA 3AVIA 3HK2A 2HW3A 5EOYA 2O8CB 3DLRA 4LF9K 4CEQA 5T7BA 3FZMA 3VTIA 1BOTO 4YNQA 1U45A 2IVOA 1GLFO 1OKJA 2UUBK 4DQQA 2IAJA 2KHOA 4TSXA 3V4IA 4RCHA 3KKRA 1IH7A 4E89A 2VQFK 1QTMA 4J2AA 1C0TA 4CEOA 4IDHA 2IVPA 3IDHA 3VQ4A 3ISNC 1TVRA 5J2NA 1REVA 4LH5A 4DV1K 4B1UB 5EXWA 4H0VB 3DLLL 3OYEA 4ISEA 1QSLA 2RHKA 1C0UA 2V52B 1NM1A 2OANA 3IUCA 1RDWX 1IG8A 3LPUA 3AO2A 4NYNA 2QKKA 2F8SA 4FM0A 3OTOK 3NCIA 3RRGA 3SUQA 3BY5A 1ASUA 5BRDA 4BRMA 5LMNK 4DR3K 4DV0K 5AQGA 3EL2A 5J2MA 1WN7A 4CJFA 4YOUA 2G8VA 4FOIA 1LWFA 2W6KA 2IIRA 3LDSA 4CK2A 4B3SK 1S22A 3ATUA 3RSEA 4KHSA 2Z1HA 5HRPA 4NB4A 1WAJA 1QZ5A 3J7ZO 2UUAK 3A8YA 1GLJO 4Z94A 1K6YA 1TKZA 4M45A 3KK3A 5BN9A 5CR4A 3ZSQA 3UB5A 3O3FA 4HCBA 2P9NA 4RTFD 3JYTA 3BZKA 3L2QA 3SMPA 2HHXA 1WSEA 3VF4A 4JD2A 3H3OB 4CGHA 2VWJA 4K41A 3FR0A 4BGAA 3VQDA 5AQKA 2G8UA 4G9ZA 1VSHA 5I9EB 4A5BA 1D4XA 2YHXA 3SJHA 3P4IA 3KJVA 3QB0A 1S9EA 4J8FA 5BR9A 3O80A 3V1RA 3I8DA 4FLTA 1JCGA 1QZ6A 1FK9A 3BZCA 3SAHA 1X1PA 1BIUA 4GW6A 1N32K 3VQEA 3VTHA 3AAQA 3A5NC 2ATQA 2Q97A 1BCMA 3L6QA 1SUQA 3M8SA 2BH1A 1LWEA 3MXJA 3CC2N 4LF7K 1JCEA 3L4QA 4DLEA 1NGDA 4N41A 1VQKN 3O3GA 1OH7A 1EWQA 5JS2A 1KAXA 4GMJB 5M1OA 5FPMA 3MN5A 1YVNA 1J54A 3O9SA 5C2DA 1RDUA 1VQNN 3QFPA 3MDQA 1Q9YA 3G6EN 4JS4A 3BUZB 3MX5A 3CCEN 1Q8IA 3OYBA 1U6ZA 3CCVN 4AH9A 4CZIA 4FWNA 1BI4B 3QBXA 1K8KA 3AVGA 4KKOA 3O5BA 4FJJA 1X9MA 1Z6RA 1JLCA 3ID6A 2GELA 3C6HA 1DGKN 4H0TB 5TKYA 3O3HA 4DUZK 1ZBHA 1KAYA 4JI3K 2IS3A 2RPIA 5KGXA 2P9UB 3GE1A 1HNWK 3MXIA 4O5FA 4M63C 1NGCA 3LZIA 1I39A 4A62A 2NRXA 3HM8A 4YORA 2KKZA 3SCXA 3A2FA 3DRRA 2VG5A 3CI5A 4BRLA 1H1VA 3QEPA 3IMXA 1TYQA 4HTLA 2QWMA 3V1QA 2D4WA 4FPAA 1JKHA 2X6NA 3MEDA 4CD1A 3RWUA 2P9PA 3QMLA 3LWMA 1XHXA 3K58A 4OLAA 1BQMA 5C10A 4LFCK 3OYHA 3ZSWA 1S6QA 1HQEA 3VEOA 3QICA 1FKPA 4DS5A 2ASMA 5AZIB 4PKGA 4FJ8A 1BWFO 4BG9A 2OPQA 4CGIA 3FE1A 1T03A 5AQHA 4F2SA 4CZMA 2VCPA 1XMQK 4BR0A 1RT5A 2CGJA 4BR9A 4DMNA 1WSGA 5AFUA 4K8ZA 4NXMK 4BE0A 1YTAA 3D0PA 3O6WA 3CXCM 3THWB 4J2BA 1HR0K 5LJWA 3CJAA 3VEVA 4R79A 3B6OA 4ILJA 3ID8A 2XY6A 4AHRA 2CH5A 1BIZA 3AA4A 4I2PA 2UYTA 4Z0UA 1NOYA 4BC5A 1JLAA 4FWMA 3LPTA 2ZJPL 1QSSA 1NJIO 3FFKB 2F4VK 3K5MA 2FBXA 3P1GA 3CHWA 2GUPA 1JJ2M 3CC4N 5K14A 3AO5A 4CIGA 4FLUA 1FJGK 4LD0A 3OYGA 4FZXC 4H4OA 2W6LA 2OZSA 3DXMB 4MLHA 4JI4K 1GLLO 3D2FA 2YNIA 1NK6A 3SUOA 2WBNA 4DR2K 4CK3A 2FSNA 4BRCA 4WQ4C 3KD5E 2HMPA 2DTUA 2YHYA 1KLNA 2FLOA 1K9MO 1XNRK 4KI4A 4BACA 1XQSC 3IG1A 4WQ5C 3FFIA 4PQUA 1UWBA 4JKDA 4OJRA 1QSYA 4Z4IA 4DU4A 4K42A 4Y1DA 4CECA 5AR0A 4DV4K 4M3RA 4O4GA 3EEQA 2Q0RA 1ILYA 1SS6A 1IJJA 2Q3SA 2ZJRL 3PSFA 3MAQA 1R0AA 1OVYA 5C15A 3M5RA 5AQMA 3VF2A 2P5OA 1CLQA 2BUPA 3NMUA 4EZ6A 3L0QA 4JRQA 1IKXA 4BDYA 1OH5A 1DT9A 3L2UA 5AQVA 1VQ6N 2DFEA 1QVFM 1EQYA 4K25A 1NBWA 4CJVA 3V9XA 4BR7A 1TGOA 1JLGA 5AZJA 4DB3A 1C1CA 3RMDA 5J2PA 4CZJA 3RMAA 2Q1NA 2HBKA 1TK0A 2FBYA 4JKCA 2FBTA 2I5JA 1MU2A 1NMNA 5KPTA 1TK8A 3AVBA 1M90O 4M3UA 1DLOA 4EZ9A 4RW9A 4AILC 5D3GA 4H0PA 2JWKA 2GWKA 3S3NA 2P9SB 4X65K 4JK7A 4JKFA 3BGRA 4ILGB 5JLFA 1GLDG 1ZBIA 3V1OA 4C23A 3WQUA 3VQQA 3O4NA 3CM6A 3OYKA 3AA2A 2QWNA 3DWLA 3O4WA 1HKGA 3E9LA 4K0KK 1Q18A 3N4QA 4YFUA 2AJQA 5A2QO 3OYMA 1SL2A 4CHOA 4KTQA 4W5TA 4WCEL 3TARA 1QE1A 5AFUH 4F9OA 4M3WA 2F96A 3QIOA 1K8AO 5AQLA 3AVLA 2B4JA 5BPMA 1J9AA 4FVUA 1KFDA 4NLBA 1NJZA 3HSCA 2HHQA 4CFAA 3RMBA 1K73O 4BC4A 4CE9A 4PKIA 4DQPA 3K5NA 1X3NA 3ZEUA 4B8CA 4AHCA 4KHPK 1Q82O 1RBRA 1W97L 4HTUA 2NRTA 2QWRA 3WXLA 3PUFA 1SKRA 4O8UA 3NGIA 1HJOA 3HJFA 2W40A 2E6LA 4AHSA 1W2BM 1RILA 2VQEK 5M1PA 1Z25A 3WUHA 3ZSOA 2Z1IA 1VQLN 1WSHA 2G8FA 4PY5A 3AGKA 4QAGA 2F8TA 3OJSA 3TI0A 4BRFA 3OBYA 1JLQA 4M3XA 4IEIA 4JV5K 5FPEA 3VGLA 3AVNA 2P9KA 3VQ9A 4CGGA 4CZHA 2E8AA 1E4FT 3MWPA 4IJNA 3U8XA 5M1NA 1Q86O 5M1FA 5HOOA 4E7JA 3K59A 2O8CA 5LL6Z 4E7KA 2QKBA 2HF3A 1G99A 5JMVA 3UKRB 3C7NB 1TV6A 1KAZA 4DSFA 3AAPA 4C8NA 3L8BA 3VEXA 4CFBA 4CHNA 5LMUK 2F7TA 4FJIA 4CEDA 4I6MB 1OH6A 1VK0A 3WEEB 4B1ZA 3H1VX 3G25A 1JXBA 1BISA 1VQ8N 1KLMA 4H5WA 1S1TA 4YOXA 5AQRA 1VSLA 2ASOA 2XHBA 4FLZA 4B9VA 3SQ2A 1R59O 4FK0A 3TAGA 4DQRA 4MDBA 3SI6A 3K2PA 5BPLA 1U2VA 4BRPA 1RDCA 5AQZA 4KHYA 1J5EK 4DLGA 2NRVA 4HWIA 1RBVA 4O5BA 4ILHA 4C8OA 1HNZK 4CEBA 4YOTA 3KK1A 1ZBSA 1SKWA 2F9TA 3S41A 2VGNA 2VG7A 4JI1K 4DR5K 3OW2M 1LAWA 3HXMA 1BU6O 3K5OA 1Q9XA 4FXDA 1C0FA 1SV5A 3C6TA 5KQDA 3AVMA 4DU3A 2O8BB 3J7YP 2HBMA 1L3VA 1IV0A 4CF1A 1J5OA 3EY1A 4HUFA 2X74A 5EVZA 3MECA 4CERA 2Q2RA 5ELZA 1VRUA 4C8LA 4CD3A 1D5AA 3VQ7A 1JLBA 5BREA 4N56A 3T1HK 3KLGA 3A5OC 5JVHL 2E2PA 4A5AA 4UY8O 4KHWA 3ULEB 5AJ3K 3M8QA 3W3DA 1N6QA 1NU0A 5SWMA 2ZGYA 3NE6A 1LW0A 3WXKA 3OA9A 1Y64A 3ZX2A 3LZJA 1SQKA 2JGUA 1VQ7N 3S3OA 4O44A 3KK2A 5CZ2A 2QA4N 2ZQBA 1MA9B 4FWPA 2X78A 5ADXH 2O8FA 4CZLA 1ATNA 5AQPA 5HLFA 4DTJA 2CH6A 3VOVA 4IOAL 3FZFA 4JKGA 2A6AA 3VQ6A 4FJMA 3AA3A 1HNXK 3KHYA 3O4QA 3HOTA 4FJHA 3O9UA 4CGFA 1U49A 4DFMA 2YCHA 2YNHA 3IS9A 4M3ZA 3CJBA 3HVTA 4BWJA 2HNDA 1BQNA 2D0PA 2EX3A 4BDPA 2OYQA 4IFVA 5FPDA 4H5RA 1A5WA 3SBTA 4BRNA 4IZ9A 2Y1IA 3M1FA 2OTLN 1JLFA 3LP2A 3DXKB 1Q81O 3NF8A 4FJ5A 2QM1A 1QHTA 4DQIA 1FW6A 3QO9A 3L2RA 3ZT3A 2F9WA 4DFKA 3M8RA 2VWBA 4BG8A 4FJ7A 2ETJA 1KFSA 1RBSA 1BL3A 2E2QA 2OPPA 4LH4A 3D6RA 2NLXA 1NKCA 3RVCA 4BVOA 1WBDA 4KHUA 3QINA 4DQSA 2Y1JA 1BG3A 4GVMA 4FM2A 2P9UA 2KFZA 4IO8A 3QERA 5KRTA 2E4LA 3EO3A 3ZT1A 1BGXT 5C42A 4DTMA 4DTXA 1HLUA 2Q31A 1BUPA 1OH8A 3WXJA 2O8DB 4ZHRA 4CZKA 1KVAA 2ITGA 2PAVA 2YKMA 1A5VA 2D0AA 3F9MA 4I7FA 4FSVA 4FJXA 4KREA 4JI0K 4DTPA 4BRHA 4BRAA 1VSMA 1CZAN 4DF4A 3E01A 1KVCA 4X64K 1WB9A 1TUYA 2GWJA 4U7BA 3OVNA 5CHIA 1RBTA 4K8XA 3CJCA 1D9DA 3O1BA 2BE2A 5DK5A 3HBTA 4ISFA 3DLBA 3NHGA 5C0YA 1KRPA 4H5TA 5AZIA 4CBUA 3S9HA 4PL8A 3PX4A 3NH0A 3SPYA 4JI6K 5JICA 4E19A 2FF3B 3Q7BA 4CHZA 3LDPA 4DSIA 1HKBA 2VWKA 3THVA 5HROA 4OKKA 3WNFA 1WOQA 3H6EA 4CHPA 5CYMA 4CJSA 4AM7A 1NGFA 1GOCA 5IWAK 4FYDA 2PBDA 3C65A 1YI2N 2ZF5O 4FWKA 3RTVA 3THWA 1QS4A 1TKTA 3JS6A 5KGWA 1TL1A 1L3SA 1S1UA 4RG8A 3OYAA 2BTFA 3CIPA 3SV3A 4CEZA 2O8EB 4CFDA 2V7ZA 3TTFA 4BRKA 3DJCA 4BQLA 3N4PA 3PLAA 4OX9K 2P9IA 3ZT2A 2E2OA 3SUPA 3VGMA 3NVKA 4OGCA 3RSEB 4CFCA 3R3LA 3ZSYA 4E0DA 3FZHA 4BDZA 4CIFA 4DF8A 3FGUA 4OKJA 2UXCK 4M41A 1ZYQA 4CBWA 3VQ5A 2VGMA 4C1NK 3V9WA 5DM6L 2PZSA 2UXDK 5BRHA 1HQUA 2GX9A 4Z4EA 1XUPO 1YT3A 4IO9L 3KVGA 4YHHK 1W9HA 2OTJN 4CCHA 4LF5K 4IWVA 2ZE2A 1NWKA 5LY3A 4ICLA 4KH5A 1W7AA 2IOCA 3GBTA 1RCHA 4CEFA 4CJWA 1C0MA 4AHVA 3OYFA 2Q0UA 4FJGA 2O4IA 2A1SA 1XI1A 3L4IA 3G4SN 4X66K 4AQYK 3MEEA 5I42A 3U6FA 1BDGA 1SAZA 2QEXN 4BC2A 2GEMA 4CJPA 3L3UA 1O13A 4CF2A 4F2RA 1NGJA 4DV3K 3MEGA 2XY5A 1HYSA 4MDAA 4PUOA 1XMOK 3KIOA 4L3QA 1VSKA 3E1YA 4DG1A 3AO3A 4B9MA 2Z1JA 1VQ5N 3THYA 2QI2A 3G71N 3SQ4A 4EHUA 2HNYA 4FJLA 1NGGA 3R9PA 5HL7L 1RFQA 3MCAB 3VF6A 3LDOA 4Z4HA 3KD1E 1X9JA 4WFBL 1TKDA 2XY7A 3LAKA 5BR8K 4IFEA 4DV2K 1X9SA 4LY7A 3CPEA 3GL1A 3VEYA 5KRSA 2WOMA 4CJ3A 3C0BA 3AO4A 5J1EA 1NJYA 3TPQA 2BGGA 4PWDA 5C24A 1KXPA 5GINA 2WC9A 2VYPA 3TTCA 1GOBA 5F1XA 4EFHA 3TSQA 1K8KB 4DHYA 4B3MK 4WF9L 1EP4A 2QWPA 4YOVA 4OGEA 1IO2A 3HP9A 5E41A 4KH4A 4BRGA 1NMDA 3MK6A 1N34K 1J53A 1RT7A 3DI6A 3VQBA 3AV9A 4H8KA 4A57A 4FJKA 3TSPA 3V81A 1B92A 1G15A 5CE3A 2GBZA 2OPRA 1KTQA 2HF4A 3W0LA 3WXMB 4MLEA 3ENHA 3F5TA 3SV4A 3EKUA 4O0JA 3PIPL 1P90A 1NGHA 4I2QA 3UKUB 1BCOA 1VQ9N 2HHUA 3LWLA 3TABA 5HRRA 4FJ9A 4RW7A 4FVMA 1IBMK 4FLXA 2D0OA 4FL9A 1T8EA 3LM2A 1ZXOA 4JI2K 3HP6A 3D2EA 1LOTB 4CHYA 4Y0WA 5FRMA 2PY5A 2P9PB 3EN9A 3PO4A 2QW9A 1JL2A 4IOXA 2E6MA 3M3ZA 1YJWN 3JXUA 2DFFA 3TAQA 3CCUN 3OYLA 1KD1O 2I7PA 3G10A 4H03B 2OCEA 3ZETA 1YITN 2H3GX 1QQCA 1T05A 5KI6A 3J81O 4CVNE 2IDOA 4BWMA 2WTUA 1UOCA 3I55N 3C6UA 3DLGA 5BRFA 4UQGA 3QBWA 4B1VA 1SKSA 3HPOA 1V4TA 1DTTA 4KAZA 5I3UA 3E9OA 4YDUA 5E84A 4B8AB 1T44A 4BE2A 3D45A 4EAHD 5FROA 2YNFA 1QVGM 3DAWA 4CESA 2YX6A 1WSJA 1HPZA 4IXCA 4BREA 1RTJA 1O1WA 1UAXA 4O55A 3VQ8A 5FRNA 1D9FA 4FWQA 2DY4A 4V19S 1FKOA 4DR7K 4A2BA 3ULDA 5DMRA 2P5GA 1HJRA 4BVPA 1QQOA 1B9FA 1RDDA 4CBXA 4B9NA 3P39A 3NGZA 3HO1A 2HVHA 1S9GA 4GY2B 1FXXA 3KKSA 1NGAA 4FW1A 3QEIA 1SL0A 3SQ1A 1VQMN 3PIOL 3RR7A 3B8AX 1WAFA 1ASVA 1NK8A 1NKBA 4JK9A 2RE2A 1RT2A 1XC3A 3ZLJA 3QESA 4JNEA 1BA1A 1VHXA 1HYVA 4GKJK 5ADXA 2E5LK 5GAEP 2VG6A 2YV0X 4B3TK 2IGIA 4PL7A 1WUAA 3PY8A 2HNZA 3OBWA 1KC8O 4B9SA 4NCAA 5CYQA 4FWLA 4FWRA 5AQJA 3OYJA 3L2WA 1YHQN 2E2NA 3I33A 1LW2A 3HL8A 4JHDB 3HTVA 1HYZA 4JI8K 1B9DA 3U4LA 3ALYA 2YI1A 1NK9A 3MCPA 3OJUA 3VGKA 3OS0A 3NDKA 3K57A 4Z4CA 1C0GA 3EKSA 2ZM6K 3I56N 1E3MA 4XEIA 3CJ1A 3PX0A 3MMVA 2J4RA 4G1QA 3RRHA 3O9RA 4DSKA 3T7ZA 1QQNA 2HSTA 4JS5A 1RTHA 3ZSVA 5JS1A 1NJWA 1I3AA 3SBGA 2QK9A 2W41A 4JKEA 3ZSRA 3KZBA 3PO5A 4CJ7A 5GIOA 1IKWA 3OYDA 3LAMA 4FCYA 1YJNN 4CJ5A 2NRZA 5HRSA 3K9JA 3C94A 4WFNL 2DPNA 4LFAK 4H0YB 4AM6A 1CXQA 3PX6A 4CW7B 3JAMO 3OS1A 3KWIA 2A1RA 2ZJQL 3VPZA 2ITMA 3FZKA 3QEVA 2CGKA 2KQ2A 4NYFA 3HSTB 1TKXA 2KLAA 2ZWHA 4B9QA 3MX2A 4KH6A 4IFYA 3VENA 4W5NA 2QXLA 3CC7N 3CJ9A 4OVLA 1XNQK 3T69A 4A61A 2YNGA 3SZ2A 4MO4A 2XRIA 4JI7K 1BA0A 1X9WA 2JLEA 3C95A 2NUBA 5C2FA 3E9PA 1L5UA 3NH1A 2P9LB 3BF3A 1J6ZA 2Q36A 1RT1A 1N33K 4CGDA 2HHTA 2YHWA 2QWLA 3GG4A 2KZZA 2RKIA 2QWOA 3ATVA 1NJXA 3AO1A 3ZEUB 4NXNK 2HHWA 2NRWA 3O8MA 4HUGA 3VA0A 4FM1A 5SZTA 5F2RA 3IFRA 1HNIA 1VQPN 1F21A 1IKVA 4B3RK 3CFOA 4H0OA 5GADP 4F8RA 1KVBA 3EE8A 2G8IA 1JCFA 4DWIA 3WNHA 5AQSA 4M42A 4FLVA 1ATRA 3C6AA 1ASWA 3AVCA 4HVJA 3SAFA 3TAPA 2O8DA 3DLEA 3L3VA 4DQ8A 3HPHA 3O9TA 4RW6A 3EE9A 1TUUA 2FBVA 4CJQA 4C8MA 5JLHA 1LWCA 2HBJA 4E3SA 1YUWA 3CETA 1ITGA 3J7AP 2P9KB 4KBOA 2EWSA 4KHQA 4KTZA 5MLCQ 3T19A 2HBLA 2QXFA 3TR8A 4FK2A 3TU5A 1EO1A 1HMVA 1TAQA 1Z05A 2B6AA 2YKNA 4IOCL 2Z1GA 4DSJA 3SUNA 2E1ZA 2RF2A 4CEEA 3VETA 3SQ0A 1L3UA 3J80O 1LCUA 1C1BA 4CZEA 2XO7A 4JKAA 1U48A 1WBBA 4J2DA 3BDPA 3ZT0A 3AVFA 3KTQA 4QS9A 1VRTA 4B3OA 1RDBA 1T3VA 4A2AA 1RT3A 4DSLA 4F3OA 4H4MA 1NGBA 3CQYA 1HX1A 3HPGA 4CF9A 4DU1A 1S6PA 1S1WA 4W5OA 4BQZA 3P5JA 4XH5A 2BANA 1ATSA 2NNWA 1NOZA 3K9KA 1SL1A 4DV6K 3S3MA 5E26A 2A5XA 3P38A 1JXEA 4WYBA 4R5PA 3P83D 1BI4A 3VEZA 4A59A 1U2VB 2QWQA 4DKWA 3QNNA 2ZD1A 2O8EA 1YJ9N 5H1SQ 2OA8A 4DTUA 4RW8A 4Y1CA 4NCGA 3HM9A 3HT3A 3KWGA 1VAZA 1IKYA 1HPMA 1S72N 3SNNA 1VQON 1RT6A 3AVAA 4H5NA 1EX4A 1BHLA 1RT4A 5AQUA 3H08A 2D0BA 4ELVA 3V6DA 4ELUA 1NGEA 4GKKK 3THXB 5AQWA 3V9ZA 4AF1A 2YJFA 5FLXO 2HB5A 4CF0A 4BRDA 5AQFA 4OPJA 3MWTA 5AQYA 3TAFA 3MN7A 2D1KA 3QIPA 3ZSXA 5BPNA 4CJEA 4B9UA 1QQMA 3GDQA 3HI0A 4ZTJA 2YJEA 3LDQA 2UXBK 3CG7A 3O1WA 3NF7A 4EHTA 3CERA 4OPAA 1C6VA 1NGIA 5GAGP 4BGBA 4QCLA 4BRIA 5HRNA 1C1AA 4M7XA 2E1YA 3R1XA 1LAVA 4GV6A 4F3TA 5DM7L 2WUSA 4NLCA 5M1QA 5JVGL 3DRPA 3CCRN 5TKWA 4BROA 4CJTA 4KI6A 3K0SA 2NRHA 1M1KO 3CD6N 2O8FB 3A5LC 4DTSA 1VSIA 4FZZA 4KB0A 4CEAA 3CFRA 4DTNA 3VA3A 4CZFA 2IC3A 4JKGB 1EETA 3HZ6A 1V4SA 4BE1A 4C8KA 2HVIA 4CJLA 1DTQA 2D0CA 2DFHA 3T1AA 1RTDA 5GAHP 3LP3A 3AGRA 3H46O 3MN9A 3QDKA 3M8PA 1Y97A 1GLEG 4N5SA 2A40A 1X3MA 4HCCA 1S5JA 3VEWA 4CHQA 2KW4A 3CMAN 5HP1A 1EWRA 4NCBA 1A5XA 4ELTA 4I9QA 4DV5K 4X62K 1EKEA 2V7YA 5KPZA 4Q5VA 4PA1A 3DXMA 2FSKA 3HYFA 4LFBK 1NNEA 4YDUC 1CXUA 3WXIA 3SK3A 3ITHA 2UUCK 1CZ9A 3D7EO 4E1NA 5LJVA 1BO5O 1YXQA 4CIEA 2P9NB 1TL3A 3ZSZA 3SJJA 4JRPA 4FW2A 3ZX3A 4JD2B 2B5JA 4FPBA 4CF8A 4Z4FA 3KLHA 3G0ZA 1S1VA 3IRXA 3DRSA 3O9QA 3UKUA 1ZBLA 2YHBA 1NK5A 5CZ1A 3AARA 4CJUA 4JN4A 4IKFA 4FZYA 1DEJA 4MO5A 4DR4K 4GVEA 4DS4A 1HRHA 3KLFA 5AQNA 3VMFB 1VQ4N 1GLCG 4KHNA 3U3GA 1RNHA 3EZ5A 3TTDA 4JAXA 3VQPA 3OY9A 3KK7A 3SMSA 1NLVA 5BN8A 3HOSA 4OPHA 3E66A 5EX5A 1KQSM 3CPWM 3WNGA 1N8RO 3LANA 3TANA 2G8HA 5EY4A 3U9ZA 3KLIA 4CJ4A 4E1MA 1TK5A 1TAUA 2W42A 2I7NA 3HVRA 4M3YA 5F0XA 4WE1A 2XY8A 3ENBA 4HUEA 1WNSA 3H3NO 3T1YK 1LV5A 2P9SA 4W5QA 1D8YA 5AQOA 3AVKA 4CK1A 3PSIA 4IJAA 3F73A 3SYZA 3AVJA 3VQAA 2LSNA 1MWMA 2RN2A 2OZMA 5C25A 1JL1A 1XC9A 3OS2A 4DSEA 3OYCA 3V9SA 4JEPA 3BEXA 4MFBA 4CJRA 4BRQA 4JLHA 4JYAK 3WQTA 2P9IB 3TAMA 1MWKA 2QTDA 2V51B 2NRRA 3UE5A 5FPNA 3CCLN 3DOLA 3P31A 5FDLA 4CZGA 3CFPA 2FC0A 1U4BA 1MDUB 4B1YB 2ZGZA 4ID1A 2R7YA 4YOWA 3NVMA 3A5MC 3BP8A 1U04A 4DTRA 4F4KA 2KZMA 2A3ZA 4ZTFA 3QLHA 1Z26A 1TYQB 4LC9B 2G8KA 4L8RB 1VSFA 3A0IX 3CYMA 2GUIA 2A41A 1I94K 3AA5X 1ZBUA 4GNIA 3DLHA 4BR4A 3I0RA 3H45C 3CCMN 1RDAA 4DR6K 2KTQA 5KQ8A 4Z4GA 3DMJA 1IBKK 4M3TA 1NK0A 4DCHA 4DFJA 3OYIA 2FSJA 3MXMA 4C1NI 3NF9A 1GOAA 3ENOA 4B9TA 4AHUA 4KPYA 1XHZA 3QFUA 4XH4A 4BR5A 4FLWA 3F9KA 2GV9A 3ZYYX 4JHDA 4LSNA 1VSEA 3NAEA 2NZTA 1YTUA 2GTDA 5IT9O 3ZX0A 4OO1J 4OPKA 3DLKA 4FWSA 2EHGA 3R6MA 1UA0A 3THYB 1YVUA 3SPZA 3QEWA 3OHRA 3CQ8A 2IVNA 4E7LA 2PFUA 3KLEA 3JSMA 4DTOA 3Q7CA 3CM5A 3GOIA 3UKRA 3C7NA 4LSLA 3SLCA 2CGLA 4OKEA 3L2VA 2HOEA 3ASMA 4M7YA 3NFAA 1E4GT 4JK8A 4KB1A 3FLCO 3VESA 4I6MA 3WNEA 3WEEA 4GV3A 5M1KA 3DYAA 4BC3A 3CQXA 2D5RA 1N5YA 4CJKA 1NKEA 1IBLK 4ID5A 3NH2A 3LDLA 1T6DA 2HMIA 4RWTA 1YF5L 3TAEA 1NG9A 3CMEN 1DKGD 4KTWA 4EP4A 5GIPA 1JLEA 1T6CA 2HHVA 3D2FB 4PHTX 3I0SA 3PV8A 1NK4A 4XIUA 3LDNA 1YAGA 2A42A 4J2EA 3LALA 1EXQA 1S3XA 1KCFA 4O8KA 3DM2A 2AA4A 4E7HA 1OVQA 1RBUA 1ESVA 4O0IA 4FK4A 4QS8A 5AQQA 3O08A 3UIQA 2AP1A 1GLBG 2FXUA 1Q7YO 2P9LA 3U3YA 1NK7A 3WT0A 4KRFA 3J8AA 4W5RA 5J2QA 2WFBA 2OPSA 3TSUA 4FO0A 3D2EB 4YY3K 4BY9C 2WONA 4FOEA 2O8BA 4U67L 4I9LA 4FLYA 3LP0A 4WFAL 4OLBA 1CZBA
chains in the Genus database with same CATH topology
1HMVA 1TAQA 2YKNA 2B6AA 1L3SA 3KD5E 1S1UA 4RG8A 2Z1GA 2DTUA 4RW4A 4DSJA 3OYAA 1KLNA 3SUNA 5HBMA 1L3TA 1ZBFA 2RF2A 4CEEA 3SV3A 3SQ0A 1L3UA 3RR8A 4CEZA 4KV8A 2HHSA 4CFDA 3QNOA 1U47A 1T7PA 2PYLA 4KI4A 4BACA 3IG1A 4KFBA 3FFIA 1C1BA 2XO7A 1U48A 4PQUA 1S1XA 1UWBA 4J2DA 4OJRA 3ZT2A 1QSYA 3BDPA 4DU4A 4Z4IA 2YHAA 3ZT0A 4Y1DA 3DOKA 3SUPA 3AVFA 4CECA 3KTQA 1VRTA 4B3OA 4OGCA 3NBPA 4M3RA 1RDBA 4O4GA 3NF6A 4CFCA 1W0HA 2X6SA 4IG0A 1RT3A 2Q3SA 4DSLA 4F3OA 4H4MA 3ZSYA 3HPGA 4CF9A 4DU1A 3QETA 4E0DA 3MAQA 1R0AA 1S6PA 4BDZA 4MQ3A 1S1WA 4W5OA 4B08A 4CIFA 4DF8A 3IAYA 3P5JA 2P5OA 2P1JA 4OKJA 3OYNA 4M41A 2BANA 1ZYQA 1SL1A 1CLQA 1NOZA 4AHTA 4EZ6A 1WSFA 3VQ5A 3S3MA 3TWHA 4JRQA 3V9WA 1JXEA 4R5PA 1IKXA 4BDYA 2PZSA 3P83D 1BI4A 4FJNA 1HQUA 3L2UA 4Z4EA 4IBNA 1YT3A 1W9HA 2DFEA 4N76A 4OLBA 3QNNA 4CJVA 4CCHA 3V9XA 1WSIA 2ZD1A 2ZE2A 1TGOA 4ICLA 2OA8A 4CGJA 1JLGA 5EU7A 4DTUA 4RW8A 1C1CA 2IOCA 4Y1CA 4NCGA 5J2PA 3RMDA 3RMAA 1RCHA 3HM9A 3HT3A 4CEFA 4CJWA 1C0MA 1TK0A 2FBYA 1IKYA 4AHVA 3T3FA 2FBTA 3OYFA 3SNNA 1RT6A 1VSDA 2I5JA 1MU2A 2PYJA 3AVAA 4FJGA 1TK8A 3AVBA 1XWLA 2O4IA 2A1SA 1XI1A 1DLOA 4EZ9A 1EX4A 4M3UA 1BHLA 1RT4A 4RW9A 4AILC 5D3GA 3H08A 3MEEA 2D0BA 3U6FA 5I42A 3ZT4A 1VSJA 2G8WA 4CJPA 3L3UA 4CF2A 4E7IA 3S3NA 4F2RA 4ELVA 1QS4A 3V6DA 4ELUA 3MEGA 1RTIA 3K5LA 2XY5A 1HYSA 4PUOA 3BGRA 3KIOA 1HNVA 3VN5A 3V9ZA 1ZBIA 1VSKA 3B6PA 4DG1A 3VQCA 2HB5A 3V1OA 3AO3A 4B9MA 3VQQA 4CF0A 4OPJA 3O4NA 3TAFA 2Z1JA 3CM6A 4KO0A 4DFPA 3OYKA 3AA2A 3SQ4A 1IG9A 3QIPA 2HNYA 3ZSXA 4FJLA 3ZCMA 3AVHA 4CJEA 4IG3A 4YFUA 4B9UA 2P51A 2AJQA 4EP5A 3OYMA 4ZTJA 1SL2A 4CHOA 4KTQA 4W5TA 3CG7A 3QEXA 3NF7A 4Z4HA 3TARA 4QCLA 1C6VA 3KD1E 2KFNA 1TKDA 4QOZB 5HRNA 1C1AA 4HHTA 1QE1A 3LAKA 2XY7A 1X9SA 1LAVA 4LY7A 4M3WA 4F3TA 2F96A 3QIOA 5KRSA 2WOMA 4CJ3A 1UA1A 3EYZA 3AO4A 3AVLA 3DRPA 2B4JA 4Q0BA 5J1EA 1NJYA 1J9AA 2HHUA 1KFDA 4CJTA 1NJZA 4KI6A 2O4GA 2BGGA 4PWDA 5C24A 2HHQA 2BDPA 4DTSA 1VSIA 4FZZA 4CFAA 5KTQA 1GOBA 4KB0A 4CEAA 3CFRA 3RMBA 4CE9A 3NGYA 4DTNA 4B9LA 4DQPA 3K5NA 3VA3A 1KSPA 2IC3A 4B8CA 3LP1A 4AHCA 5CY4A 1EETA 4IDKA 4N47A 3RMCA 1EP4A 1WLJA 1RBRA 3V9UA 3AVIA 4OGEA 4HTUA 3HK2A 1IO2A 3HP9A 5E41A 2HW3A 4BE1A 3PUFA 1SKRA 3DLRA 4CEQA 5T7BA 4C8KA 2HVIA 4CJLA 1J53A 3NGIA 1RT7A 3DI6A 1DTQA 3VQBA 2D0CA 2DFHA 3T1AA 3AV9A 4YNQA 1RTDA 3HJFA 4H8KA 3LP3A 1U45A 4FJKA 2E6LA 4AHSA 3V81A 4DQQA 1RILA 1B92A 2IAJA 1G15A 1Z25A 2GBZA 2OPRA 3M8PA 4TSXA 1KTQA 3ZSOA 3V4IA 2Z1IA 1Y97A 3SV4A 1WSHA 4N5SA 2G8FA 4O0JA 3KKRA 4PY5A 1IH7A 4E89A 4HCCA 1S5JA 4QAGA 4I2QA 1QTMA 1BCOA 4CHQA 2F8TA 3LWLA 3OJSA 5HRRA 3TABA 2KW4A 4RW7A 4FVMA 5HP1A 1C0TA 4CEOA 3TI0A 4FJ9A 4FLXA 4NCBA 1A5XA 4ELTA 4M3XA 1JLQA 1T8EA 4I9QA 3VQ4A 1EKEA 3ISNC 1TVRA 3AVNA 1REVA 4LH5A 5J2NA 3VQ9A 3HP6A 4CGGA 4Q5VA 4PA1A 3OYEA 3HYFA 4CHYA 1CXUA 1QSLA 5FRMA 2PY5A 1C0UA 4E7JA 3K59A 3ITHA 3PO4A 4E7KA 1CZ9A 1JL2A 4E1NA 2QKBA 2E6MA 4CIEA 3LPUA 4NYNA 3AO2A 2QKKA 2F8SA 4FM0A 1TL3A 1TV6A 3ZSZA 3NCIA 3RRGA 3SJJA 4DSFA 4JRPA 4FW2A 3SUQA 4C8NA 1ASUA 2B5JA 3L8BA 4CF8A 4CFBA 4CHNA 4Z4FA 3KLHA 3G0ZA 2DFFA 3TAQA 3OYLA 5J2MA 4FJIA 1S1VA 3G10A 3IRXA 4CEDA 3DRSA 1QQCA 1VK0A 1WN7A 4CJFA 5KI6A 1T05A 2G8VA 1LWFA 1ZBLA 2IDOA 2YHBA 1NK5A 5CZ1A 4BWMA 1JXBA 4CJUA 3LDSA 1BISA 4CK2A 4IKFA 1UOCA 4FZYA 1KLMA 3C6UA 3DLGA 1S1TA 4UQGA 4KHSA 2Z1HA 5HRPA 4DS4A 1HRHA 1VSLA 3KLFA 1WAJA 1SKSA 4KHNA 3U3GA 2XHBA 4FLZA 4B9VA 1RNHA 3EZ5A 3SQ2A 4FK0A 3HPOA 3TAGA 1DTTA 1K6YA 4DQRA 4KAZA 5I3UA 1TKZA 3VQPA 3OY9A 4M45A 4B8AB 3KK3A 3SI6A 3ZSQA 3K2PA 3O3FA 4HCBA 4BE2A 3D45A 5FROA 2YNFA 3JYTA 3L2QA 2HHXA 1RDCA 4KHYA 1WSEA 4CESA 4DLGA 1WSJA 1HPZA 3WNGA 4CGHA 1RBVA 2VWJA 1RTJA 4O5BA 1O1WA 3LANA 1UAXA 4O55A 3VQDA 3TANA 3VQ8A 4C8OA 5FRNA 2G8HA 1D9FA 2G8UA 2DY4A 4CEBA 4CJ4A 3KLIA 4E1MA 3KK1A 1FKOA 1VSHA 1SKWA 1TK5A 3ULDA 3KJVA 1TAUA 5DMRA 2W42A 3HVRA 2P5GA 1HJRA 4M3YA 2VG7A 1S9EA 1B9FA 1RDDA 1LAWA 3HXMA 3K5OA 4WE1A 4B9NA 2XY8A 3NGZA 3V1RA 3I8DA 4HUEA 4FLTA 1Q9XA 1WNSA 3HO1A 2HVHA 1FK9A 1S9GA 4FXDA 1X1PA 1BIUA 1FXXA 1SV5A 3C6TA 4GW6A 4W5QA 1LV5A 3KKSA 1D8YA 3AVMA 4FW1A 4DU3A 3AVKA 3QEIA 4CK1A 3VQEA 1L3VA 3F73A 3QERA 3SYZA 1SL0A 3SQ1A 4CF1A 1J5OA 3RR7A 3EY1A 3AVJA 4HUFA 1WAFA 3VQAA 1ASVA 2X74A 1NK8A 1NKBA 3MECA 2LSNA 4CERA 2RN2A 1VRUA 5C25A 1JL1A 2OZMA 2ATQA 4C8LA 1D5AA 1XC9A 3OS2A 1RT2A 4DSEA 3OYCA 1BCMA 3V9SA 1SUQA 4MFBA 3VQ7A 3M8SA 3QESA 1JLBA 4CJRA 4N56A 1LWEA 3MXJA 3KLGA 4JLHA 1HYVA 4DLEA 4KHWA 4N41A 3TAMA 3M8QA 1N6QA 3O3GA 5SWMA 2VG6A 2YV0X 3NE6A 1LW0A 2IGIA 5JS2A 3DOLA 3PY8A 2HNZA 4NCAA 5FDLA 3CFPA 4B9SA 2FC0A 4GMJB 3LZJA 5CYQA 1U4BA 2JGUA 4ID1A 3S3OA 1J54A 3OYJA 2R7YA 4O44A 3KK2A 5CZ2A 3L2WA 2ZQBA 4F4KA 1Q9YA 4DTRA 1U04A 4JS4A 2KZMA 2X78A 1Q8IA 3OYBA 4ZTFA 1LW2A 3HL8A 5HLFA 3QLHA 1Z26A 4AH9A 2G8KA 4DTJA 1BI4B 1HYZA 4L8RB 1VSFA 1B9DA 1NK9A 3ALYA 3AVGA 3OJUA 3CYMA 2GUIA 4KKOA 3VQ6A 4FJMA 3AA3A 3O4QA 4FJJA 3AA5X 3OS0A 3NDKA 1X9MA 1JLCA 3O3HA 4FJHA 4CGFA 3K57A 1ZBUA 4Z4CA 3DLHA 1U49A 4DFMA 3I0RA 1ZBHA 2IS3A 2YNHA 3IS9A 4M3ZA 1RDAA 3HVTA 2RPIA 4BWJA 5KGXA 2HNDA 1BQNA 2EX3A 4BDPA 2OYQA 4Z4GA 2KTQA 3DMJA 4IFVA 3PX0A 3MXIA 4G1QA 3LZIA 3RRHA 1A5WA 4DSKA 4M3TA 1I39A 1NK0A 4DFJA 2Y1IA 3OYIA 4JS5A 3MXMA 1RTHA 3ZSVA 1JLFA 3NF9A 5JS1A 1GOAA 3LP2A 1NJWA 3SCXA 3A2FA 1I3AA 2QK9A 3DRRA 4AHUA 4B9TA 2VG5A 4KPYA 1XHZA 3NF8A 3ZSRA 3PO5A 3QEPA 4FJ5A 1QHTA 4FLWA 3F9KA 2GV9A 4DQIA 1IKWA 3OYDA 4LSNA 1VSEA 3LAMA 4FCYA 3NAEA 3QO9A 3L2RA 3ZT3A 4CJ5A 5HRSA 1YTUA 3C94A 3V1QA 4OPKA 3DLKA 1CXQA 3PX6A 4DFKA 2EHGA 3OS1A 3M8RA 1UA0A 4FJ7A 2A1RA 1JKHA 1YVUA 2X6NA 2ETJA 3MEDA 1KFSA 3SPZA 1RBSA 1BL3A 3QEWA 3RWUA 2OPPA 4LH4A 3CQ8A 4E7LA 3QEVA 2KQ2A 4NYFA 3KLEA 3LWMA 1XHXA 3HSTB 1TKXA 1BQMA 3JSMA 3K58A 4DTOA 1NKCA 4OLAA 4KHUA 3CM5A 3OYHA 3QINA 4DQSA 2Y1JA 4IFYA 3ZSWA 4GVMA 2KFZA 1S6QA 4FM2A 4W5NA 1HQEA 4LSLA 4OVLA 1FKPA 4OKEA 5KRTA 4DS5A 2YNGA 2E4LA 3SZ2A 3L2VA 3ZT1A 1BGXT 3ASMA 2XRIA 1X9WA 3NFAA 5C42A 4DTMA 4FJ8A 4DTXA 2JLEA 3C95A 2NUBA 4KB1A 2OPQA 4CGIA 1T03A 3WNEA 1L5UA 4ZHRA 3NH1A 3DYAA 2D5RA 1N5YA 4CJKA 4F2SA 1KVAA 2ITGA 1NKEA 1RT1A 4ID5A 4CGDA 3NH2A 2YKMA 2HHTA 1A5VA 2D0AA 1RT5A 4I7FA 2RKIA 2HMIA 4FJXA 2KZZA 1NJXA 4KREA 3AO1A 4DTPA 4DMNA 1WSGA 1VSMA 3TAEA 4K8ZA 4DF4A 2HHWA 4EP4A 4KTWA 3E01A 1KVCA 1JLEA 1YTAA 4BE0A 3D0PA 4HUGA 2HHVA 3I0SA 3PV8A 3VA0A 1NK4A 4FM1A 3OVNA 4XIUA 5SZTA 4J2BA 1RBTA 4J2EA 4K8XA 3LALA 1EXQA 3B6OA 1HNIA 1KCFA 1F21A 2XY6A 3DM2A 4AHRA 1D9DA 2BE2A 1IKVA 4E7HA 3CFOA 5DK5A 1BIZA 3AA4A 3DLBA 1KVBA 3NHGA 1KRPA 4F8RA 4I2PA 4Z0UA 1RBUA 3S9HA 1NOYA 2G8IA 3PX4A 5KGWA 3NH0A 3SPYA 3WNHA 4DWIA 4O0IA 4M42A 1JLAA 4E19A 3LPTA 4FLVA 4FK4A 4HVJA 1ASWA 3AVCA 3UIQA 3TAPA 3DLEA 4CHZA 3L3VA 1QSSA 3HPHA 4DSIA 4J2AA 4RW6A 2VWKA 3K5MA 3THVA 2FBXA 3P1GA 5HROA 3U3YA 5K14A 4OKKA 2FBVA 3WNFA 4CJQA 4C8MA 4CHPA 1NK7A 4KRFA 3AO5A 4W5RA 4CIGA 5CYMA 1LWCA 4E3SA 5J2QA 4FLUA 4CJSA 4LD0A 1ITGA 3OYGA 4FZXC 4H4OA 1GOCA 2OPSA 4FYDA 2OZSA 4KHQA 2WONA 4KTZA 3T19A 2QXFA 2YNIA 4I9LA 1NK6A 4FLYA 3LP0A 3TR8A 3RTVA 3SUOA 1CZBA 1TKTA 4FK2A 4CK3A 1TL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMV A;  1TAQ A;  2YKN A;  2B6A A;  1L3S A;  3KD5 E;  1S1U A;  4RG8 A;  2Z1G A;  2DTU A;  4RW4 A;  4DSJ A;  3OYA A;  1KLN A;  3SUN A;  5HBM A;  1L3T A;  1ZBF A;  2RF2 A;  4CEE A;  3SV3 A;  3SQ0 A;  1L3U A;  3RR8 A;  4CEZ A;  4KV8 A;  2HHS A;  4CFD A;  3QNO A;  1U47 A;  1T7P A;  2PYL A;  4KI4 A;  4BAC A;  3IG1 A;  4KFB A;  3FFI A;  1C1B A;  2XO7 A;  1U48 A;  4PQU A;  1S1X A;  1UWB A;  4J2D A;  4OJR A;  3ZT2 A;  1QSY A;  3BDP A;  4DU4 A;  4Z4I A;  2YHA A;  3ZT0 A;  4Y1D A;  3DOK A;  3SUP A;  3AVF A;  4CEC A;  3KTQ A;  1VRT A;  4B3O A;  4OGC A;  3NBP A;  4M3R A;  1RDB A;  4O4G A;  3NF6 A;  4CFC A;  1W0H A;  2X6S A;  4IG0 A;  1RT3 A;  2Q3S A;  4DSL A;  4F3O A;  4H4M A;  3ZSY A;  3HPG A;  4CF9 A;  4DU1 A;  3QET A;  4E0D A;  3MAQ A;  1R0A A;  1S6P A;  4BDZ A;  4MQ3 A;  1S1W A;  4W5O A;  4B08 A;  4CIF A;  4DF8 A;  3IAY A;  3P5J A;  2P5O A;  2P1J A;  4OKJ A;  3OYN A;  4M41 A;  2BAN A;  1ZYQ A;  1SL1 A;  1CLQ A;  1NOZ A;  4AHT A;  4EZ6 A;  1WSF A;  3VQ5 A;  3S3M A;  3TWH A;  4JRQ A;  3V9W A;  1JXE A;  4R5P A;  1IKX A;  4BDY A;  2PZS A;  3P83 D;  1BI4 A;  4FJN A;  1HQU A;  3L2U A;  4Z4E A;  4IBN A;  1YT3 A;  1W9H A;  2DFE A;  4N76 A;  4OLB A;  3QNN A;  4CJV A;  4CCH A;  3V9X A;  1WSI A;  2ZD1 A;  2ZE2 A;  1TGO A;  4ICL A;  2OA8 A;  4CGJ A;  1JLG A;  5EU7 A;  4DTU A;  4RW8 A;  1C1C A;  2IOC A;  4Y1C A;  4NCG A;  5J2P A;  3RMD A;  3RMA A;  1RCH A;  3HM9 A;  3HT3 A;  4CEF A;  4CJW A;  1C0M A;  1TK0 A;  2FBY A;  1IKY A;  4AHV A;  3T3F A;  2FBT A;  3OYF A;  3SNN A;  1RT6 A;  1VSD A;  2I5J A;  1MU2 A;  2PYJ A;  3AVA A;  4FJG A;  1TK8 A;  3AVB A;  1XWL A;  2O4I A;  2A1S A;  1XI1 A;  1DLO A;  4EZ9 A;  1EX4 A;  4M3U A;  1BHL A;  1RT4 A;  4RW9 A;  4AIL C;  5D3G A;  3H08 A;  3MEE A;  2D0B A;  3U6F A;  5I42 A;  3ZT4 A;  1VSJ A;  2G8W A;  4CJP A;  3L3U A;  4CF2 A;  4E7I A;  3S3N A;  4F2R A;  4ELV A;  1QS4 A;  3V6D A;  4ELU A;  3MEG A;  1RTI A;  3K5L A;  2XY5 A;  1HYS A;  4PUO A;  3BGR A;  3KIO A;  1HNV A;  3VN5 A;  3V9Z A;  1ZBI A;  1VSK A;  3B6P A;  4DG1 A;  3VQC A;  2HB5 A;  3V1O A;  3AO3 A;  4B9M A;  3VQQ A;  4CF0 A;  4OPJ A;  3O4N A;  3TAF A;  2Z1J A;  3CM6 A;  4KO0 A;  4DFP A;  3OYK A;  3AA2 A;  3SQ4 A;  1IG9 A;  3QIP A;  2HNY A;  3ZSX A;  4FJL A;  3ZCM A;  3AVH A;  4CJE A;  4IG3 A;  4YFU A;  4B9U A;  2P51 A;  2AJQ A;  4EP5 A;  3OYM A;  4ZTJ A;  1SL2 A;  4CHO A;  4KTQ A;  4W5T A;  3CG7 A;  3QEX A;  3NF7 A;  4Z4H A;  3TAR A;  4QCL A;  1C6V A;  3KD1 E;  2KFN A;  1TKD A;  4QOZ B;  5HRN A;  1C1A A;  4HHT A;  1QE1 A;  3LAK A;  2XY7 A;  1X9S A;  1LAV A;  4LY7 A;  4M3W A;  4F3T A;  2F96 A;  3QIO A;  5KRS A;  2WOM A;  4CJ3 A;  1UA1 A;  3EYZ A;  3AO4 A;  3AVL A;  3DRP A;  2B4J A;  4Q0B A;  5J1E A;  1NJY A;  1J9A A;  2HHU A;  1KFD A;  4CJT A;  1NJZ A;  4KI6 A;  2O4G A;  2BGG A;  4PWD A;  5C24 A;  2HHQ A;  2BDP A;  4DTS A;  1VSI A;  4FZZ A;  4CFA A;  5KTQ A;  1GOB A;  4KB0 A;  4CEA A;  3CFR A;  3RMB A;  4CE9 A;  3NGY A;  4DTN A;  4B9L A;  4DQP A;  3K5N A;  3VA3 A;  1KSP A;  2IC3 A;  4B8C A;  3LP1 A;  4AHC A;  5CY4 A;  1EET A;  4IDK A;  4N47 A;  3RMC A;  1EP4 A;  1WLJ A;  1RBR A;  3V9U A;  3AVI A;  4OGE A;  4HTU A;  3HK2 A;  1IO2 A;  3HP9 A;  5E41 A;  2HW3 A;  4BE1 A;  3PUF A;  1SKR A;  3DLR A;  4CEQ A;  5T7B A;  4C8K A;  2HVI A;  4CJL A;  1J53 A;  3NGI A;  1RT7 A;  3DI6 A;  1DTQ A;  3VQB A;  2D0C A;  2DFH A;  3T1A A;  3AV9 A;  4YNQ A;  1RTD A;  3HJF A;  4H8K A;  3LP3 A;  1U45 A;  4FJK A;  2E6L A;  4AHS A;  3V81 A;  4DQQ A;  1RIL A;  1B92 A;  2IAJ A;  1G15 A;  1Z25 A;  2GBZ A;  2OPR A;  3M8P A;  4TSX A;  1KTQ A;  3ZSO A;  3V4I A;  2Z1I A;  1Y97 A;  3SV4 A;  1WSH A;  4N5S A;  2G8F A;  4O0J A;  3KKR A;  4PY5 A;  1IH7 A;  4E89 A;  4HCC A;  1S5J A;  4QAG A;  4I2Q A;  1QTM A;  1BCO A;  4CHQ A;  2F8T A;  3LWL A;  3OJS A;  5HRR A;  3TAB A;  2KW4 A;  4RW7 A;  4FVM A;  5HP1 A;  1C0T A;  4CEO A;  3TI0 A;  4FJ9 A;  4FLX A;  4NCB A;  1A5X A;  4ELT A;  4M3X A;  1JLQ A;  1T8E A;  4I9Q A;  3VQ4 A;  1EKE A;  3ISN C;  1TVR A;  3AVN A;  1REV A;  4LH5 A;  5J2N A;  3VQ9 A;  3HP6 A;  4CGG A;  4Q5V A;  4PA1 A;  3OYE A;  3HYF A;  4CHY A;  1CXU A;  1QSL A;  5FRM A;  2PY5 A;  1C0U A;  4E7J A;  3K59 A;  3ITH A;  3PO4 A;  4E7K A;  1CZ9 A;  1JL2 A;  4E1N A;  2QKB A;  2E6M A;  4CIE A;  3LPU A;  4NYN A;  3AO2 A;  2QKK A;  2F8S A;  4FM0 A;  1TL3 A;  1TV6 A;  3ZSZ A;  3NCI A;  3RRG A;  3SJJ A;  4DSF A;  4JRP A;  4FW2 A;  3SUQ A;  4C8N A;  1ASU A;  2B5J A;  3L8B A;  4CF8 A;  4CFB A;  4CHN A;  4Z4F A;  3KLH A;  3G0Z A;  2DFF A;  3TAQ A;  3OYL A;  5J2M A;  4FJI A;  1S1V A;  3G10 A;  3IRX A;  4CED A;  3DRS A;  1QQC A;  1VK0 A;  1WN7 A;  4CJF A;  5KI6 A;  1T05 A;  2G8V A;  1LWF A;  1ZBL A;  2IDO A;  2YHB A;  1NK5 A;  5CZ1 A;  4BWM A;  1JXB A;  4CJU A;  3LDS A;  1BIS A;  4CK2 A;  4IKF A;  1UOC A;  4FZY A;  1KLM A;  3C6U A;  3DLG A;  1S1T A;  4UQG A;  4KHS A;  2Z1H A;  5HRP A;  4DS4 A;  1HRH A;  1VSL A;  3KLF A;  1WAJ A;  1SKS A;  4KHN A;  3U3G A;  2XHB A;  4FLZ A;  4B9V A;  1RNH A;  3EZ5 A;  3SQ2 A;  4FK0 A;  3HPO A;  3TAG A;  1DTT A;  1K6Y A;  4DQR A;  4KAZ A;  5I3U A;  1TKZ A;  3VQP A;  3OY9 A;  4M45 A;  4B8A B;  3KK3 A;  3SI6 A;  3ZSQ A;  3K2P A;  3O3F A;  4HCB A;  4BE2 A;  3D45 A;  5FRO A;  2YNF A;  3JYT A;  3L2Q A;  2HHX A;  1RDC A;  4KHY A;  1WSE A;  4CES A;  4DLG A;  1WSJ A;  1HPZ A;  3WNG A;  4CGH A;  1RBV A;  2VWJ A;  1RTJ A;  4O5B A;  1O1W A;  3LAN A;  1UAX A;  4O55 A;  3VQD A;  3TAN A;  3VQ8 A;  4C8O A;  5FRN A;  2G8H A;  1D9F A;  2G8U A;  2DY4 A;  4CEB A;  4CJ4 A;  3KLI A;  4E1M A;  3KK1 A;  1FKO A;  1VSH A;  1SKW A;  1TK5 A;  3ULD A;  3KJV A;  1TAU A;  5DMR A;  2W42 A;  3HVR A;  2P5G A;  1HJR A;  4M3Y A;  2VG7 A;  1S9E A;  1B9F A;  1RDD A;  1LAW A;  3HXM A;  3K5O A;  4WE1 A;  4B9N A;  2XY8 A;  3NGZ A;  3V1R A;  3I8D A;  4HUE A;  4FLT A;  1Q9X A;  1WNS A;  3HO1 A;  2HVH A;  1FK9 A;  1S9G A;  4FXD A;  1X1P A;  1BIU A;  1FXX A;  1SV5 A;  3C6T A;  4GW6 A;  4W5Q A;  1LV5 A;  3KKS A;  1D8Y A;  3AVM A;  4FW1 A;  4DU3 A;  3AVK A;  3QEI A;  4CK1 A;  3VQE A;  1L3V A;  3F73 A;  3QER A;  3SYZ A;  1SL0 A;  3SQ1 A;  4CF1 A;  1J5O A;  3RR7 A;  3EY1 A;  3AVJ A;  4HUF A;  1WAF A;  3VQA A;  1ASV A;  2X74 A;  1NK8 A;  1NKB A;  3MEC A;  2LSN A;  4CER A;  2RN2 A;  1VRU A;  5C25 A;  1JL1 A;  2OZM A;  2ATQ A;  4C8L A;  1D5A A;  1XC9 A;  3OS2 A;  1RT2 A;  4DSE A;  3OYC A;  1BCM A;  3V9S A;  1SUQ A;  4MFB A;  3VQ7 A;  3M8S A;  3QES A;  1JLB A;  4CJR A;  4N56 A;  1LWE A;  3MXJ A;  3KLG A;  4JLH A;  1HYV A;  4DLE A;  4KHW A;  4N41 A;  3TAM A;  3M8Q A;  1N6Q A;  3O3G A;  5SWM A;  2VG6 A;  2YV0 X;  3NE6 A;  1LW0 A;  2IGI A;  5JS2 A;  3DOL A;  3PY8 A;  2HNZ A;  4NCA A;  5FDL A;  3CFP A;  4B9S A;  2FC0 A;  4GMJ B;  3LZJ A;  5CYQ A;  1U4B A;  2JGU A;  4ID1 A;  3S3O A;  1J54 A;  3OYJ A;  2R7Y A;  4O44 A;  3KK2 A;  5CZ2 A;  3L2W A;  2ZQB A;  4F4K A;  1Q9Y A;  4DTR A;  1U04 A;  4JS4 A;  2KZM A;  2X78 A;  1Q8I A;  3OYB A;  4ZTF A;  1LW2 A;  3HL8 A;  5HLF A;  3QLH A;  1Z26 A;  4AH9 A;  2G8K A;  4DTJ A;  1BI4 B;  1HYZ A;  4L8R B;  1VSF A;  1B9D A;  1NK9 A;  3ALY A;  3AVG A;  3OJU A;  3CYM A;  2GUI A;  4KKO A;  3VQ6 A;  4FJM A;  3AA3 A;  3O4Q A;  4FJJ A;  3AA5 X;  3OS0 A;  3NDK A;  1X9M A;  1JLC A;  3O3H A;  4FJH A;  4CGF A;  3K57 A;  1ZBU A;  4Z4C A;  3DLH A;  1U49 A;  4DFM A;  3I0R A;  1ZBH A;  2IS3 A;  2YNH A;  3IS9 A;  4M3Z A;  1RDA A;  3HVT A;  2RPI A;  4BWJ A;  5KGX A;  2HND A;  1BQN A;  2EX3 A;  4BDP A;  2OYQ A;  4Z4G A;  2KTQ A;  3DMJ A;  4IFV A;  3PX0 A;  3MXI A;  4G1Q A;  3LZI A;  3RRH A;  1A5W A;  4DSK A;  4M3T A;  1I39 A;  1NK0 A;  4DFJ A;  2Y1I A;  3OYI A;  4JS5 A;  3MXM A;  1RTH A;  3ZSV A;  1JLF A;  3NF9 A;  5JS1 A;  1GOA A;  3LP2 A;  1NJW A;  3SCX A;  3A2F A;  1I3A A;  2QK9 A;  3DRR A;  4AHU A;  4B9T A;  2VG5 A;  4KPY A;  1XHZ A;  3NF8 A;  3ZSR A;  3PO5 A;  3QEP A;  4FJ5 A;  1QHT A;  4FLW A;  3F9K A;  2GV9 A;  4DQI A;  1IKW A;  3OYD A;  4LSN A;  1VSE A;  3LAM A;  4FCY A;  3NAE A;  3QO9 A;  3L2R A;  3ZT3 A;  4CJ5 A;  5HRS A;  1YTU A;  3C94 A;  3V1Q A;  4OPK A;  3DLK A;  1CXQ A;  3PX6 A;  4DFK A;  2EHG A;  3OS1 A;  3M8R A;  1UA0 A;  4FJ7 A;  2A1R A;  1JKH A;  1YVU A;  2X6N A;  2ETJ A;  3MED A;  1KFS A;  3SPZ A;  1RBS A;  1BL3 A;  3QEW A;  3RWU A;  2OPP A;  4LH4 A;  3CQ8 A;  4E7L A;  3QEV A;  2KQ2 A;  4NYF A;  3KLE A;  3LWM A;  1XHX A;  3HST B;  1TKX A;  1BQM A;  3JSM A;  3K58 A;  4DTO A;  1NKC A;  4OLA A;  4KHU A;  3CM5 A;  3OYH A;  3QIN A;  4DQS A;  2Y1J A;  4IFY A;  3ZSW A;  4GVM A;  2KFZ A;  1S6Q A;  4FM2 A;  4W5N A;  1HQE A;  4LSL A;  4OVL A;  1FKP A;  4OKE A;  5KRT A;  4DS5 A;  2YNG A;  2E4L A;  3SZ2 A;  3L2V A;  3ZT1 A;  1BGX T;  3ASM A;  2XRI A;  1X9W A;  3NFA A;  5C42 A;  4DTM A;  4FJ8 A;  4DTX A;  2JLE A;  3C95 A;  2NUB A;  4KB1 A;  2OPQ A;  4CGI A;  1T03 A;  3WNE A;  1L5U A;  4ZHR A;  3NH1 A;  3DYA A;  2D5R A;  1N5Y A;  4CJK A;  4F2S A;  1KVA A;  2ITG A;  1NKE A;  1RT1 A;  4ID5 A;  4CGD A;  3NH2 A;  2YKM A;  2HHT A;  1A5V A;  2D0A A;  1RT5 A;  4I7F A;  2RKI A;  2HMI A;  4FJX A;  2KZZ A;  1NJX A;  4KRE A;  3AO1 A;  4DTP A;  4DMN A;  1WSG A;  1VSM A;  3TAE A;  4K8Z A;  4DF4 A;  2HHW A;  4EP4 A;  4KTW A;  3E01 A;  1KVC A;  1JLE A;  1YTA A;  4BE0 A;  3D0P A;  4HUG A;  2HHV A;  3I0S A;  3PV8 A;  3VA0 A;  1NK4 A;  4FM1 A;  3OVN A;  4XIU A;  5SZT A;  4J2B A;  1RBT A;  4J2E A;  4K8X A;  3LAL A;  1EXQ A;  3B6O A;  1HNI A;  1KCF A;  1F21 A;  2XY6 A;  3DM2 A;  4AHR A;  1D9D A;  2BE2 A;  1IKV A;  4E7H A;  3CFO A;  5DK5 A;  1BIZ A;  3AA4 A;  3DLB A;  1KVB A;  3NHG A;  1KRP A;  4F8R A;  4I2P A;  4Z0U A;  1RBU A;  3S9H A;  1NOY A;  2G8I A;  3PX4 A;  5KGW A;  3NH0 A;  3SPY A;  3WNH A;  4DWI A;  4O0I A;  4M42 A;  1JLA A;  4E19 A;  3LPT A;  4FLV A;  4FK4 A;  4HVJ A;  1ASW A;  3AVC A;  3UIQ A;  3TAP A;  3DLE A;  4CHZ A;  3L3V A;  1QSS A;  3HPH A;  4DSI A;  4J2A A;  4RW6 A;  2VWK A;  3K5M A;  3THV A;  2FBX A;  3P1G A;  5HRO A;  3U3Y A;  5K14 A;  4OKK A;  2FBV A;  3WNF A;  4CJQ A;  4C8M A;  4CHP A;  1NK7 A;  4KRF A;  3AO5 A;  4W5R A;  4CIG A;  5CYM A;  1LWC A;  4E3S A;  5J2Q A;  4FLU A;  4CJS A;  4LD0 A;  1ITG A;  3OYG A;  4FZX C;  4H4O A;  1GOC A;  2OPS A;  4FYD A;  2OZS A;  4KHQ A;  2WON A;  4KTZ A;  3T19 A;  2QXF A;  2YNI A;  4I9L A;  1NK6 A;  4FLY A;  3LP0 A;  3TR8 A;  3RTV A;  3SUO A;  1CZB A;  1TKT A;  4FK2 A;  4CK3 A;  1TL1 A; 
#chains in the Genus database with same CATH topology
 4LF6 K;  4JKH A;  1ZC6 A;  4RW4 A;  2JWL A;  4DR1 K;  5HBM A;  1L3T A;  1ZBF A;  3H1Q A;  2HHS A;  3RR8 A;  4KV8 A;  3QNO A;  1T7P A;  1U47 A;  2PYL A;  5AZJ B;  4B1X B;  4KFB A;  4H0X B;  1QHA A;  3ZET B;  1S1X A;  1YIJ N;  3FZL A;  2ASP A;  3ULE A;  1HKC A;  2YHA A;  3DOK A;  3NBP A;  5C12 A;  3NF6 A;  1W0H A;  2X6S A;  4IG0 A;  1GLA G;  1SZ2 A;  3QET A;  4MQ3 A;  4B08 A;  5AQI A;  3IAY A;  2P1J A;  3OYN A;  4B1W B;  4QS7 A;  4AHT A;  1WSF A;  3TWH A;  4DV7 K;  4CI6 A;  4FJN A;  4FWO A;  3MN6 A;  2UU9 K;  3CJ7 A;  4ISG A;  3CCS N;  4IBN A;  4H5V A;  4WQ4 A;  4PKH A;  5B8H A;  4N76 A;  3VER A;  1WSI A;  3F2K A;  4JI5 K;  4K43 A;  4CGJ A;  5EU7 A;  1RGI A;  4EIA A;  5KPR A;  4WQ5 A;  3T3F A;  2PYJ A;  1VSD A;  4LF4 K;  1XWL A;  4GV9 A;  4JKB A;  3ZT4 A;  1VSJ A;  3DXK A;  4IEE A;  2G8W A;  3BF1 A;  4E7I A;  1P8Z A;  2E20 A;  1RTI A;  3LL3 A;  3K5L A;  1HNV A;  3I8B A;  3VN5 A;  3AY9 A;  3B6P A;  3VQC A;  3U9D A;  4KO0 A;  4DFP A;  1IG9 A;  3EZW A;  3ZCM A;  3AVH A;  3LM9 A;  1HUX A;  4IG3 A;  2FF6 A;  2P51 A;  4LF8 K;  4EP5 A;  3CF5 L;  3IKM A;  4BR2 A;  3QEX A;  2KFN A;  4QOZ B;  4HHT A;  5AQX A;  1UA1 A;  3HRG A;  3EYZ A;  4Q0B A;  2O4G A;  3THX A;  4E1J A;  2BDP A;  2E88 A;  3CCJ N;  5KTQ A;  3CCQ N;  4DUY K;  2HHH K;  1N36 K;  3M6G A;  4NO7 A;  3NGY A;  4B9L A;  1KSP A;  3SAG A;  3LP1 A;  5CY4 A;  5AQT A;  4IDK A;  4N47 A;  4YOY A;  3R8E A;  3RMC A;  1WLJ A;  4XH1 A;  3V9U A;  3AVI A;  3HK2 A;  2HW3 A;  5EOY A;  2O8C B;  3DLR A;  4LF9 K;  4CEQ A;  5T7B A;  3FZM A;  3VTI A;  1BOT O;  4YNQ A;  1U45 A;  2IVO A;  1GLF O;  1OKJ A;  2UUB K;  4DQQ A;  2IAJ A;  2KHO A;  4TSX A;  3V4I A;  4RCH A;  3KKR A;  1IH7 A;  4E89 A;  2VQF K;  1QTM A;  4J2A A;  1C0T A;  4CEO A;  4IDH A;  2IVP A;  3IDH A;  3VQ4 A;  3ISN C;  1TVR A;  5J2N A;  1REV A;  4LH5 A;  4DV1 K;  4B1U B;  5EXW A;  4H0V B;  3DLL L;  3OYE A;  4ISE A;  1QSL A;  2RHK A;  1C0U A;  2V52 B;  1NM1 A;  2OAN A;  3IUC A;  1RDW X;  1IG8 A;  3LPU A;  3AO2 A;  4NYN A;  2QKK A;  2F8S A;  4FM0 A;  3OTO K;  3NCI A;  3RRG A;  3SUQ A;  3BY5 A;  1ASU A;  5BRD A;  4BRM A;  5LMN K;  4DR3 K;  4DV0 K;  5AQG A;  3EL2 A;  5J2M A;  1WN7 A;  4CJF A;  4YOU A;  2G8V A;  4FOI A;  1LWF A;  2W6K A;  2IIR A;  3LDS A;  4CK2 A;  4B3S K;  1S22 A;  3ATU A;  3RSE A;  4KHS A;  2Z1H A;  5HRP A;  4NB4 A;  1WAJ A;  1QZ5 A;  3J7Z O;  2UUA K;  3A8Y A;  1GLJ O;  4Z94 A;  1K6Y A;  1TKZ A;  4M45 A;  3KK3 A;  5BN9 A;  5CR4 A;  3ZSQ A;  3UB5 A;  3O3F A;  4HCB A;  2P9N A;  4RTF D;  3JYT A;  3BZK A;  3L2Q A;  3SMP A;  2HHX A;  1WSE A;  3VF4 A;  4JD2 A;  3H3O B;  4CGH A;  2VWJ A;  4K41 A;  3FR0 A;  4BGA A;  3VQD A;  5AQK A;  2G8U A;  4G9Z A;  1VSH A;  5I9E B;  4A5B A;  1D4X A;  2YHX A;  3SJH A;  3P4I A;  3KJV A;  3QB0 A;  1S9E A;  4J8F A;  5BR9 A;  3O80 A;  3V1R A;  3I8D A;  4FLT A;  1JCG A;  1QZ6 A;  1FK9 A;  3BZC A;  3SAH A;  1X1P A;  1BIU A;  4GW6 A;  1N32 K;  3VQE A;  3VTH A;  3AAQ A;  3A5N C;  2ATQ A;  2Q97 A;  1BCM A;  3L6Q A;  1SUQ A;  3M8S A;  2BH1 A;  1LWE A;  3MXJ A;  3CC2 N;  4LF7 K;  1JCE A;  3L4Q A;  4DLE A;  1NGD A;  4N41 A;  1VQK N;  3O3G A;  1OH7 A;  1EWQ A;  5JS2 A;  1KAX A;  4GMJ B;  5M1O A;  5FPM A;  3MN5 A;  1YVN A;  1J54 A;  3O9S A;  5C2D A;  1RDU A;  1VQN N;  3QFP A;  3MDQ A;  1Q9Y A;  3G6E N;  4JS4 A;  3BUZ B;  3MX5 A;  3CCE N;  1Q8I A;  3OYB A;  1U6Z A;  3CCV N;  4AH9 A;  4CZI A;  4FWN A;  1BI4 B;  3QBX A;  1K8K A;  3AVG A;  4KKO A;  3O5B A;  4FJJ A;  1X9M A;  1Z6R A;  1JLC A;  3ID6 A;  2GEL A;  3C6H A;  1DGK N;  4H0T B;  5TKY A;  3O3H A;  4DUZ K;  1ZBH A;  1KAY A;  4JI3 K;  2IS3 A;  2RPI A;  5KGX A;  2P9U B;  3GE1 A;  1HNW K;  3MXI A;  4O5F A;  4M63 C;  1NGC A;  3LZI A;  1I39 A;  4A62 A;  2NRX A;  3HM8 A;  4YOR A;  2KKZ A;  3SCX A;  3A2F A;  3DRR A;  2VG5 A;  3CI5 A;  4BRL A;  1H1V A;  3QEP A;  3IMX A;  1TYQ A;  4HTL A;  2QWM A;  3V1Q A;  2D4W A;  4FPA A;  1JKH A;  2X6N A;  3MED A;  4CD1 A;  3RWU A;  2P9P A;  3QML A;  3LWM A;  1XHX A;  3K58 A;  4OLA A;  1BQM A;  5C10 A;  4LFC K;  3OYH A;  3ZSW A;  1S6Q A;  1HQE A;  3VEO A;  3QIC A;  1FKP A;  4DS5 A;  2ASM A;  5AZI B;  4PKG A;  4FJ8 A;  1BWF O;  4BG9 A;  2OPQ A;  4CGI A;  3FE1 A;  1T03 A;  5AQH A;  4F2S A;  4CZM A;  2VCP A;  1XMQ K;  4BR0 A;  1RT5 A;  2CGJ A;  4BR9 A;  4DMN A;  1WSG A;  5AFU A;  4K8Z A;  4NXM K;  4BE0 A;  1YTA A;  3D0P A;  3O6W A;  3CXC M;  3THW B;  4J2B A;  1HR0 K;  5LJW A;  3CJA A;  3VEV A;  4R79 A;  3B6O A;  4ILJ A;  3ID8 A;  2XY6 A;  4AHR A;  2CH5 A;  1BIZ A;  3AA4 A;  4I2P A;  2UYT A;  4Z0U A;  1NOY A;  4BC5 A;  1JLA A;  4FWM A;  3LPT A;  2ZJP L;  1QSS A;  1NJI O;  3FFK B;  2F4V K;  3K5M A;  2FBX A;  3P1G A;  3CHW A;  2GUP A;  1JJ2 M;  3CC4 N;  5K14 A;  3AO5 A;  4CIG A;  4FLU A;  1FJG K;  4LD0 A;  3OYG A;  4FZX C;  4H4O A;  2W6L A;  2OZS A;  3DXM B;  4MLH A;  4JI4 K;  1GLL O;  3D2F A;  2YNI A;  1NK6 A;  3SUO A;  2WBN A;  4DR2 K;  4CK3 A;  2FSN A;  4BRC A;  4WQ4 C;  3KD5 E;  2HMP A;  2DTU A;  2YHY A;  1KLN A;  2FLO A;  1K9M O;  1XNR K;  4KI4 A;  4BAC A;  1XQS C;  3IG1 A;  4WQ5 C;  3FFI A;  4PQU A;  1UWB A;  4JKD A;  4OJR A;  1QSY A;  4Z4I A;  4DU4 A;  4K42 A;  4Y1D A;  4CEC A;  5AR0 A;  4DV4 K;  4M3R A;  4O4G A;  3EEQ A;  2Q0R A;  1ILY A;  1SS6 A;  1IJJ A;  2Q3S A;  2ZJR L;  3PSF A;  3MAQ A;  1R0A A;  1OVY A;  5C15 A;  3M5R A;  5AQM A;  3VF2 A;  2P5O A;  1CLQ A;  2BUP A;  3NMU A;  4EZ6 A;  3L0Q A;  4JRQ A;  1IKX A;  4BDY A;  1OH5 A;  1DT9 A;  3L2U A;  5AQV A;  1VQ6 N;  2DFE A;  1QVF M;  1EQY A;  4K25 A;  1NBW A;  4CJV A;  3V9X A;  4BR7 A;  1TGO A;  1JLG A;  5AZJ A;  4DB3 A;  1C1C A;  3RMD A;  5J2P A;  4CZJ A;  3RMA A;  2Q1N A;  2HBK A;  1TK0 A;  2FBY A;  4JKC A;  2FBT A;  2I5J A;  1MU2 A;  1NMN A;  5KPT A;  1TK8 A;  3AVB A;  1M90 O;  4M3U A;  1DLO A;  4EZ9 A;  4RW9 A;  4AIL C;  5D3G A;  4H0P A;  2JWK A;  2GWK A;  3S3N A;  2P9S B;  4X65 K;  4JK7 A;  4JKF A;  3BGR A;  4ILG B;  5JLF A;  1GLD G;  1ZBI A;  3V1O A;  4C23 A;  3WQU A;  3VQQ A;  3O4N A;  3CM6 A;  3OYK A;  3AA2 A;  2QWN A;  3DWL A;  3O4W A;  1HKG A;  3E9L A;  4K0K K;  1Q18 A;  3N4Q A;  4YFU A;  2AJQ A;  5A2Q O;  3OYM A;  1SL2 A;  4CHO A;  4KTQ A;  4W5T A;  4WCE L;  3TAR A;  1QE1 A;  5AFU H;  4F9O A;  4M3W A;  2F96 A;  3QIO A;  1K8A O;  5AQL A;  3AVL A;  2B4J A;  5BPM A;  1J9A A;  4FVU A;  1KFD A;  4NLB A;  1NJZ A;  3HSC A;  2HHQ A;  4CFA A;  3RMB A;  1K73 O;  4BC4 A;  4CE9 A;  4PKI A;  4DQP A;  3K5N A;  1X3N A;  3ZEU A;  4B8C A;  4AHC A;  4KHP K;  1Q82 O;  1RBR A;  1W97 L;  4HTU A;  2NRT A;  2QWR A;  3WXL A;  3PUF A;  1SKR A;  4O8U A;  3NGI A;  1HJO A;  3HJF A;  2W40 A;  2E6L A;  4AHS A;  1W2B M;  1RIL A;  2VQE K;  5M1P A;  1Z25 A;  3WUH A;  3ZSO A;  2Z1I A;  1VQL N;  1WSH A;  2G8F A;  4PY5 A;  3AGK A;  4QAG A;  2F8T A;  3OJS A;  3TI0 A;  4BRF A;  3OBY A;  1JLQ A;  4M3X A;  4IEI A;  4JV5 K;  5FPE A;  3VGL A;  3AVN A;  2P9K A;  3VQ9 A;  4CGG A;  4CZH A;  2E8A A;  1E4F T;  3MWP A;  4IJN A;  3U8X A;  5M1N A;  1Q86 O;  5M1F A;  5HOO A;  4E7J A;  3K59 A;  2O8C A;  5LL6 Z;  4E7K A;  2QKB A;  2HF3 A;  1G99 A;  5JMV A;  3UKR B;  3C7N B;  1TV6 A;  1KAZ A;  4DSF A;  3AAP A;  4C8N A;  3L8B A;  3VEX A;  4CFB A;  4CHN A;  5LMU K;  2F7T A;  4FJI A;  4CED A;  4I6M B;  1OH6 A;  1VK0 A;  3WEE B;  4B1Z A;  3H1V X;  3G25 A;  1JXB A;  1BIS A;  1VQ8 N;  1KLM A;  4H5W A;  1S1T A;  4YOX A;  5AQR A;  1VSL A;  2ASO A;  2XHB A;  4FLZ A;  4B9V A;  3SQ2 A;  1R59 O;  4FK0 A;  3TAG A;  4DQR A;  4MDB A;  3SI6 A;  3K2P A;  5BPL A;  1U2V A;  4BRP A;  1RDC A;  5AQZ A;  4KHY A;  1J5E K;  4DLG A;  2NRV A;  4HWI A;  1RBV A;  4O5B A;  4ILH A;  4C8O A;  1HNZ K;  4CEB A;  4YOT A;  3KK1 A;  1ZBS A;  1SKW A;  2F9T A;  3S41 A;  2VGN A;  2VG7 A;  4JI1 K;  4DR5 K;  3OW2 M;  1LAW A;  3HXM A;  1BU6 O;  3K5O A;  1Q9X A;  4FXD A;  1C0F A;  1SV5 A;  3C6T A;  5KQD A;  3AVM A;  4DU3 A;  2O8B B;  3J7Y P;  2HBM A;  1L3V A;  1IV0 A;  4CF1 A;  1J5O A;  3EY1 A;  4HUF A;  2X74 A;  5EVZ A;  3MEC A;  4CER A;  2Q2R A;  5ELZ A;  1VRU A;  4C8L A;  4CD3 A;  1D5A A;  3VQ7 A;  1JLB A;  5BRE A;  4N56 A;  3T1H K;  3KLG A;  3A5O C;  5JVH L;  2E2P A;  4A5A A;  4UY8 O;  4KHW A;  3ULE B;  5AJ3 K;  3M8Q A;  3W3D A;  1N6Q A;  1NU0 A;  5SWM A;  2ZGY A;  3NE6 A;  1LW0 A;  3WXK A;  3OA9 A;  1Y64 A;  3ZX2 A;  3LZJ A;  1SQK A;  2JGU A;  1VQ7 N;  3S3O A;  4O44 A;  3KK2 A;  5CZ2 A;  2QA4 N;  2ZQB A;  1MA9 B;  4FWP A;  2X78 A;  5ADX H;  2O8F A;  4CZL A;  1ATN A;  5AQP A;  5HLF A;  4DTJ A;  2CH6 A;  3VOV A;  4IOA L;  3FZF A;  4JKG A;  2A6A A;  3VQ6 A;  4FJM A;  3AA3 A;  1HNX K;  3KHY A;  3O4Q A;  3HOT A;  4FJH A;  3O9U A;  4CGF A;  1U49 A;  4DFM A;  2YCH A;  2YNH A;  3IS9 A;  4M3Z A;  3CJB A;  3HVT A;  4BWJ A;  2HND A;  1BQN A;  2D0P A;  2EX3 A;  4BDP A;  2OYQ A;  4IFV A;  5FPD A;  4H5R A;  1A5W A;  3SBT A;  4BRN A;  4IZ9 A;  2Y1I A;  3M1F A;  2OTL N;  1JLF A;  3LP2 A;  3DXK B;  1Q81 O;  3NF8 A;  4FJ5 A;  2QM1 A;  1QHT A;  4DQI A;  1FW6 A;  3QO9 A;  3L2R A;  3ZT3 A;  2F9W A;  4DFK A;  3M8R A;  2VWB A;  4BG8 A;  4FJ7 A;  2ETJ A;  1KFS A;  1RBS A;  1BL3 A;  2E2Q A;  2OPP A;  4LH4 A;  3D6R A;  2NLX A;  1NKC A;  3RVC A;  4BVO A;  1WBD A;  4KHU A;  3QIN A;  4DQS A;  2Y1J A;  1BG3 A;  4GVM A;  4FM2 A;  2P9U A;  2KFZ A;  4IO8 A;  3QER A;  5KRT A;  2E4L A;  3EO3 A;  3ZT1 A;  1BGX T;  5C42 A;  4DTM A;  4DTX A;  1HLU A;  2Q31 A;  1BUP A;  1OH8 A;  3WXJ A;  2O8D B;  4ZHR A;  4CZK A;  1KVA A;  2ITG A;  2PAV A;  2YKM A;  1A5V A;  2D0A A;  3F9M A;  4I7F A;  4FSV A;  4FJX A;  4KRE A;  4JI0 K;  4DTP A;  4BRH A;  4BRA A;  1VSM A;  1CZA N;  4DF4 A;  3E01 A;  1KVC A;  4X64 K;  1WB9 A;  1TUY A;  2GWJ A;  4U7B A;  3OVN A;  5CHI A;  1RBT A;  4K8X A;  3CJC A;  1D9D A;  3O1B A;  2BE2 A;  5DK5 A;  3HBT A;  4ISF A;  3DLB A;  3NHG A;  5C0Y A;  1KRP A;  4H5T A;  5AZI A;  4CBU A;  3S9H A;  4PL8 A;  3PX4 A;  3NH0 A;  3SPY A;  4JI6 K;  5JIC A;  4E19 A;  2FF3 B;  3Q7B A;  4CHZ A;  3LDP A;  4DSI A;  1HKB A;  2VWK A;  3THV A;  5HRO A;  4OKK A;  3WNF A;  1WOQ A;  3H6E A;  4CHP A;  5CYM A;  4CJS A;  4AM7 A;  1NGF A;  1GOC A;  5IWA K;  4FYD A;  2PBD A;  3C65 A;  1YI2 N;  2ZF5 O;  4FWK A;  3RTV A;  3THW A;  1QS4 A;  1TKT A;  3JS6 A;  5KGW A;  1TL1 A;  1L3S A;  1S1U A;  4RG8 A;  3OYA A;  2BTF A;  3CIP A;  3SV3 A;  4CEZ A;  2O8E B;  4CFD A;  2V7Z A;  3TTF A;  4BRK A;  3DJC A;  4BQL A;  3N4P A;  3PLA A;  4OX9 K;  2P9I A;  3ZT2 A;  2E2O A;  3SUP A;  3VGM A;  3NVK A;  4OGC A;  3RSE B;  4CFC A;  3R3L A;  3ZSY A;  4E0D A;  3FZH A;  4BDZ A;  4CIF A;  4DF8 A;  3FGU A;  4OKJ A;  2UXC K;  4M41 A;  1ZYQ A;  4CBW A;  3VQ5 A;  2VGM A;  4C1N K;  3V9W A;  5DM6 L;  2PZS A;  2UXD K;  5BRH A;  1HQU A;  2GX9 A;  4Z4E A;  1XUP O;  1YT3 A;  4IO9 L;  3KVG A;  4YHH K;  1W9H A;  2OTJ N;  4CCH A;  4LF5 K;  4IWV A;  2ZE2 A;  1NWK A;  5LY3 A;  4ICL A;  4KH5 A;  1W7A A;  2IOC A;  3GBT A;  1RCH A;  4CEF A;  4CJW A;  1C0M A;  4AHV A;  3OYF A;  2Q0U A;  4FJG A;  2O4I A;  2A1S A;  1XI1 A;  3L4I A;  3G4S N;  4X66 K;  4AQY K;  3MEE A;  5I42 A;  3U6F A;  1BDG A;  1SAZ A;  2QEX N;  4BC2 A;  2GEM A;  4CJP A;  3L3U A;  1O13 A;  4CF2 A;  4F2R A;  1NGJ A;  4DV3 K;  3MEG A;  2XY5 A;  1HYS A;  4MDA A;  4PUO A;  1XMO K;  3KIO A;  4L3Q A;  1VSK A;  3E1Y A;  4DG1 A;  3AO3 A;  4B9M A;  2Z1J A;  1VQ5 N;  3THY A;  2QI2 A;  3G71 N;  3SQ4 A;  4EHU A;  2HNY A;  4FJL A;  1NGG A;  3R9P A;  5HL7 L;  1RFQ A;  3MCA B;  3VF6 A;  3LDO A;  4Z4H A;  3KD1 E;  1X9J A;  4WFB L;  1TKD A;  2XY7 A;  3LAK A;  5BR8 K;  4IFE A;  4DV2 K;  1X9S A;  4LY7 A;  3CPE A;  3GL1 A;  3VEY A;  5KRS A;  2WOM A;  4CJ3 A;  3C0B A;  3AO4 A;  5J1E A;  1NJY A;  3TPQ A;  2BGG A;  4PWD A;  5C24 A;  1KXP A;  5GIN A;  2WC9 A;  2VYP A;  3TTC A;  1GOB A;  5F1X A;  4EFH A;  3TSQ A;  1K8K B;  4DHY A;  4B3M K;  4WF9 L;  1EP4 A;  2QWP A;  4YOV A;  4OGE A;  1IO2 A;  3HP9 A;  5E41 A;  4KH4 A;  4BRG A;  1NMD A;  3MK6 A;  1N34 K;  1J53 A;  1RT7 A;  3DI6 A;  3VQB A;  3AV9 A;  4H8K A;  4A57 A;  4FJK A;  3TSP A;  3V81 A;  1B92 A;  1G15 A;  5CE3 A;  2GBZ A;  2OPR A;  1KTQ A;  2HF4 A;  3W0L A;  3WXM B;  4MLE A;  3ENH A;  3F5T A;  3SV4 A;  3EKU A;  4O0J A;  3PIP L;  1P90 A;  1NGH A;  4I2Q A;  3UKU B;  1BCO A;  1VQ9 N;  2HHU A;  3LWL A;  3TAB A;  5HRR A;  4FJ9 A;  4RW7 A;  4FVM A;  1IBM K;  4FLX A;  2D0O A;  4FL9 A;  1T8E A;  3LM2 A;  1ZXO A;  4JI2 K;  3HP6 A;  3D2E A;  1LOT B;  4CHY A;  4Y0W A;  5FRM A;  2PY5 A;  2P9P B;  3EN9 A;  3PO4 A;  2QW9 A;  1JL2 A;  4IOX A;  2E6M A;  3M3Z A;  1YJW N;  3JXU A;  2DFF A;  3TAQ A;  3CCU N;  3OYL A;  1KD1 O;  2I7P A;  3G10 A;  4H03 B;  2OCE A;  3ZET A;  1YIT N;  2H3G X;  1QQC A;  1T05 A;  5KI6 A;  3J81 O;  4CVN E;  2IDO A;  4BWM A;  2WTU A;  1UOC A;  3I55 N;  3C6U A;  3DLG A;  5BRF A;  4UQG A;  3QBW A;  4B1V A;  1SKS A;  3HPO A;  1V4T A;  1DTT A;  4KAZ A;  5I3U A;  3E9O A;  4YDU A;  5E84 A;  4B8A B;  1T44 A;  4BE2 A;  3D45 A;  4EAH D;  5FRO A;  2YNF A;  1QVG M;  3DAW A;  4CES A;  2YX6 A;  1WSJ A;  1HPZ A;  4IXC A;  4BRE A;  1RTJ A;  1O1W A;  1UAX A;  4O55 A;  3VQ8 A;  5FRN A;  1D9F A;  4FWQ A;  2DY4 A;  4V19 S;  1FKO A;  4DR7 K;  4A2B A;  3ULD A;  5DMR A;  2P5G A;  1HJR A;  4BVP A;  1QQO A;  1B9F A;  1RDD A;  4CBX A;  4B9N A;  3P39 A;  3NGZ A;  3HO1 A;  2HVH A;  1S9G A;  4GY2 B;  1FXX A;  3KKS A;  1NGA A;  4FW1 A;  3QEI A;  1SL0 A;  3SQ1 A;  1VQM N;  3PIO L;  3RR7 A;  3B8A X;  1WAF A;  1ASV A;  1NK8 A;  1NKB A;  4JK9 A;  2RE2 A;  1RT2 A;  1XC3 A;  3ZLJ A;  3QES A;  4JNE A;  1BA1 A;  1VHX A;  1HYV A;  4GKJ K;  5ADX A;  2E5L K;  5GAE P;  2VG6 A;  2YV0 X;  4B3T K;  2IGI A;  4PL7 A;  1WUA A;  3PY8 A;  2HNZ A;  3OBW A;  1KC8 O;  4B9S A;  4NCA A;  5CYQ A;  4FWL A;  4FWR A;  5AQJ A;  3OYJ A;  3L2W A;  1YHQ N;  2E2N A;  3I33 A;  1LW2 A;  3HL8 A;  4JHD B;  3HTV A;  1HYZ A;  4JI8 K;  1B9D A;  3U4L A;  3ALY A;  2YI1 A;  1NK9 A;  3MCP A;  3OJU A;  3VGK A;  3OS0 A;  3NDK A;  3K57 A;  4Z4C A;  1C0G A;  3EKS A;  2ZM6 K;  3I56 N;  1E3M A;  4XEI A;  3CJ1 A;  3PX0 A;  3MMV A;  2J4R A;  4G1Q A;  3RRH A;  3O9R A;  4DSK A;  3T7Z A;  1QQN A;  2HST A;  4JS5 A;  1RTH A;  3ZSV A;  5JS1 A;  1NJW A;  1I3A A;  3SBG A;  2QK9 A;  2W41 A;  4JKE A;  3ZSR A;  3KZB A;  3PO5 A;  4CJ7 A;  5GIO A;  1IKW A;  3OYD A;  3LAM A;  4FCY A;  1YJN N;  4CJ5 A;  2NRZ A;  5HRS A;  3K9J A;  3C94 A;  4WFN L;  2DPN A;  4LFA K;  4H0Y B;  4AM6 A;  1CXQ A;  3PX6 A;  4CW7 B;  3JAM O;  3OS1 A;  3KWI A;  2A1R A;  2ZJQ L;  3VPZ A;  2ITM A;  3FZK A;  3QEV A;  2CGK A;  2KQ2 A;  4NYF A;  3HST B;  1TKX A;  2KLA A;  2ZWH A;  4B9Q A;  3MX2 A;  4KH6 A;  4IFY A;  3VEN A;  4W5N A;  2QXL A;  3CC7 N;  3CJ9 A;  4OVL A;  1XNQ K;  3T69 A;  4A61 A;  2YNG A;  3SZ2 A;  4MO4 A;  2XRI A;  4JI7 K;  1BA0 A;  1X9W A;  2JLE A;  3C95 A;  2NUB A;  5C2F A;  3E9P A;  1L5U A;  3NH1 A;  2P9L B;  3BF3 A;  1J6Z A;  2Q36 A;  1RT1 A;  1N33 K;  4CGD A;  2HHT A;  2YHW A;  2QWL A;  3GG4 A;  2KZZ A;  2RKI A;  2QWO A;  3ATV A;  1NJX A;  3AO1 A;  3ZEU B;  4NXN K;  2HHW A;  2NRW A;  3O8M A;  4HUG A;  3VA0 A;  4FM1 A;  5SZT A;  5F2R A;  3IFR A;  1HNI A;  1VQP N;  1F21 A;  1IKV A;  4B3R K;  3CFO A;  4H0O A;  5GAD P;  4F8R A;  1KVB A;  3EE8 A;  2G8I A;  1JCF A;  4DWI A;  3WNH A;  5AQS A;  4M42 A;  4FLV A;  1ATR A;  3C6A A;  1ASW A;  3AVC A;  4HVJ A;  3SAF A;  3TAP A;  2O8D A;  3DLE A;  3L3V A;  4DQ8 A;  3HPH A;  3O9T A;  4RW6 A;  3EE9 A;  1TUU A;  2FBV A;  4CJQ A;  4C8M A;  5JLH A;  1LWC A;  2HBJ A;  4E3S A;  1YUW A;  3CET A;  1ITG A;  3J7A P;  2P9K B;  4KBO A;  2EWS A;  4KHQ A;  4KTZ A;  5MLC Q;  3T19 A;  2HBL A;  2QXF A;  3TR8 A;  4FK2 A;  3TU5 A;  1EO1 A;  1HMV A;  1TAQ A;  1Z05 A;  2B6A A;  2YKN A;  4IOC L;  2Z1G A;  4DSJ A;  3SUN A;  2E1Z A;  2RF2 A;  4CEE A;  3VET A;  3SQ0 A;  1L3U A;  3J80 O;  1LCU A;  1C1B A;  4CZE A;  2XO7 A;  4JKA A;  1U48 A;  1WBB A;  4J2D A;  3BDP A;  3ZT0 A;  3AVF A;  3KTQ A;  4QS9 A;  1VRT A;  4B3O A;  1RDB A;  1T3V A;  4A2A A;  1RT3 A;  4DSL A;  4F3O A;  4H4M A;  1NGB A;  3CQY A;  1HX1 A;  3HPG A;  4CF9 A;  4DU1 A;  1S6P A;  1S1W A;  4W5O A;  4BQZ A;  3P5J A;  4XH5 A;  2BAN A;  1ATS A;  2NNW A;  1NOZ A;  3K9K A;  1SL1 A;  4DV6 K;  3S3M A;  5E26 A;  2A5X A;  3P38 A;  1JXE A;  4WYB A;  4R5P A;  3P83 D;  1BI4 A;  3VEZ A;  4A59 A;  1U2V B;  2QWQ A;  4DKW A;  3QNN A;  2ZD1 A;  2O8E A;  1YJ9 N;  5H1S Q;  2OA8 A;  4DTU A;  4RW8 A;  4Y1C A;  4NCG A;  3HM9 A;  3HT3 A;  3KWG A;  1VAZ A;  1IKY A;  1HPM A;  1S72 N;  3SNN A;  1VQO N;  1RT6 A;  3AVA A;  4H5N A;  1EX4 A;  1BHL A;  1RT4 A;  5AQU A;  3H08 A;  2D0B A;  4ELV A;  3V6D A;  4ELU A;  1NGE A;  4GKK K;  3THX B;  5AQW A;  3V9Z A;  4AF1 A;  2YJF A;  5FLX O;  2HB5 A;  4CF0 A;  4BRD A;  5AQF A;  4OPJ A;  3MWT A;  5AQY A;  3TAF A;  3MN7 A;  2D1K A;  3QIP A;  3ZSX A;  5BPN A;  4CJE A;  4B9U A;  1QQM A;  3GDQ A;  3HI0 A;  4ZTJ A;  2YJE A;  3LDQ A;  2UXB K;  3CG7 A;  3O1W A;  3NF7 A;  4EHT A;  3CER A;  4OPA A;  1C6V A;  1NGI A;  5GAG P;  4BGB A;  4QCL A;  4BRI A;  5HRN A;  1C1A A;  4M7X A;  2E1Y A;  3R1X A;  1LAV A;  4GV6 A;  4F3T A;  5DM7 L;  2WUS A;  4NLC A;  5M1Q A;  5JVG L;  3DRP A;  3CCR N;  5TKW A;  4BRO A;  4CJT A;  4KI6 A;  3K0S A;  2NRH A;  1M1K O;  3CD6 N;  2O8F B;  3A5L C;  4DTS A;  1VSI A;  4FZZ A;  4KB0 A;  4CEA A;  3CFR A;  4DTN A;  3VA3 A;  4CZF A;  2IC3 A;  4JKG B;  1EET A;  3HZ6 A;  1V4S A;  4BE1 A;  4C8K A;  2HVI A;  4CJL A;  1DTQ A;  2D0C A;  2DFH A;  3T1A A;  1RTD A;  5GAH P;  3LP3 A;  3AGR A;  3H46 O;  3MN9 A;  3QDK A;  3M8P A;  1Y97 A;  1GLE G;  4N5S A;  2A40 A;  1X3M A;  4HCC A;  1S5J A;  3VEW A;  4CHQ A;  2KW4 A;  3CMA N;  5HP1 A;  1EWR A;  4NCB A;  1A5X A;  4ELT A;  4I9Q A;  4DV5 K;  4X62 K;  1EKE A;  2V7Y A;  5KPZ A;  4Q5V A;  4PA1 A;  3DXM A;  2FSK A;  3HYF A;  4LFB K;  1NNE A;  4YDU C;  1CXU A;  3WXI A;  3SK3 A;  3ITH A;  2UUC K;  1CZ9 A;  3D7E O;  4E1N A;  5LJV A;  1BO5 O;  1YXQ A;  4CIE A;  2P9N B;  1TL3 A;  3ZSZ A;  3SJJ A;  4JRP A;  4FW2 A;  3ZX3 A;  4JD2 B;  2B5J A;  4FPB A;  4CF8 A;  4Z4F A;  3KLH A;  3G0Z A;  1S1V A;  3IRX A;  3DRS A;  3O9Q A;  3UKU A;  1ZBL A;  2YHB A;  1NK5 A;  5CZ1 A;  3AAR A;  4CJU A;  4JN4 A;  4IKF A;  4FZY A;  1DEJ A;  4MO5 A;  4DR4 K;  4GVE A;  4DS4 A;  1HRH A;  3KLF A;  5AQN A;  3VMF B;  1VQ4 N;  1GLC G;  4KHN A;  3U3G A;  1RNH A;  3EZ5 A;  3TTD A;  4JAX A;  3VQP A;  3OY9 A;  3KK7 A;  3SMS A;  1NLV A;  5BN8 A;  3HOS A;  4OPH A;  3E66 A;  5EX5 A;  1KQS M;  3CPW M;  3WNG A;  1N8R O;  3LAN A;  3TAN A;  2G8H A;  5EY4 A;  3U9Z A;  3KLI A;  4CJ4 A;  4E1M A;  1TK5 A;  1TAU A;  2W42 A;  2I7N A;  3HVR A;  4M3Y A;  5F0X A;  4WE1 A;  2XY8 A;  3ENB A;  4HUE A;  1WNS A;  3H3N O;  3T1Y K;  1LV5 A;  2P9S A;  4W5Q A;  1D8Y A;  5AQO A;  3AVK A;  4CK1 A;  3PSI A;  4IJA A;  3F73 A;  3SYZ A;  3AVJ A;  3VQA A;  2LSN A;  1MWM A;  2RN2 A;  2OZM A;  5C25 A;  1JL1 A;  1XC9 A;  3OS2 A;  4DSE A;  3OYC A;  3V9S A;  4JEP A;  3BEX A;  4MFB A;  4CJR A;  4BRQ A;  4JLH A;  4JYA K;  3WQT A;  2P9I B;  3TAM A;  1MWK A;  2QTD A;  2V51 B;  2NRR A;  3UE5 A;  5FPN A;  3CCL N;  3DOL A;  3P31 A;  5FDL A;  4CZG A;  3CFP A;  2FC0 A;  1U4B A;  1MDU B;  4B1Y B;  2ZGZ A;  4ID1 A;  2R7Y A;  4YOW A;  3NVM A;  3A5M C;  3BP8 A;  1U04 A;  4DTR A;  4F4K A;  2KZM A;  2A3Z A;  4ZTF A;  3QLH A;  1Z26 A;  1TYQ B;  4LC9 B;  2G8K A;  4L8R B;  1VSF A;  3A0I X;  3CYM A;  2GUI A;  2A41 A;  1I94 K;  3AA5 X;  1ZBU A;  4GNI A;  3DLH A;  4BR4 A;  3I0R A;  3H45 C;  3CCM N;  1RDA A;  4DR6 K;  2KTQ A;  5KQ8 A;  4Z4G A;  3DMJ A;  1IBK K;  4M3T A;  1NK0 A;  4DCH A;  4DFJ A;  3OYI A;  2FSJ A;  3MXM A;  4C1N I;  3NF9 A;  1GOA A;  3ENO A;  4B9T A;  4AHU A;  4KPY A;  1XHZ A;  3QFU A;  4XH4 A;  4BR5 A;  4FLW A;  3F9K A;  2GV9 A;  3ZYY X;  4JHD A;  4LSN A;  1VSE A;  3NAE A;  2NZT A;  1YTU A;  2GTD A;  5IT9 O;  3ZX0 A;  4OO1 J;  4OPK A;  3DLK A;  4FWS A;  2EHG A;  3R6M A;  1UA0 A;  3THY B;  1YVU A;  3SPZ A;  3QEW A;  3OHR A;  3CQ8 A;  2IVN A;  4E7L A;  2PFU A;  3KLE A;  3JSM A;  4DTO A;  3Q7C A;  3CM5 A;  3GOI A;  3UKR A;  3C7N A;  4LSL A;  3SLC A;  2CGL A;  4OKE A;  3L2V A;  2HOE A;  3ASM A;  4M7Y A;  3NFA A;  1E4G T;  4JK8 A;  4KB1 A;  3FLC O;  3VES A;  4I6M A;  3WNE A;  3WEE A;  4GV3 A;  5M1K A;  3DYA A;  4BC3 A;  3CQX A;  2D5R A;  1N5Y A;  4CJK A;  1NKE A;  1IBL K;  4ID5 A;  3NH2 A;  3LDL A;  1T6D A;  2HMI A;  4RWT A;  1YF5 L;  3TAE A;  1NG9 A;  3CME N;  1DKG D;  4KTW A;  4EP4 A;  5GIP A;  1JLE A;  1T6C A;  2HHV A;  3D2F B;  4PHT X;  3I0S A;  3PV8 A;  1NK4 A;  4XIU A;  3LDN A;  1YAG A;  2A42 A;  4J2E A;  3LAL A;  1EXQ A;  1S3X A;  1KCF A;  4O8K A;  3DM2 A;  2AA4 A;  4E7H A;  1OVQ A;  1RBU A;  1ESV A;  4O0I A;  4FK4 A;  4QS8 A;  5AQQ A;  3O08 A;  3UIQ A;  2AP1 A;  1GLB G;  2FXU A;  1Q7Y O;  2P9L A;  3U3Y A;  1NK7 A;  3WT0 A;  4KRF A;  3J8A A;  4W5R A;  5J2Q A;  2WFB A;  2OPS A;  3TSU A;  4FO0 A;  3D2E B;  4YY3 K;  4BY9 C;  2WON A;  4FOE A;  2O8B A;  4U67 L;  4I9L A;  4FLY A;  3LP0 A;  4WFA L;  4OLB A;  1CZB A; 
#chains in the Genus database with same CATH homology
 1HMV A;  1TAQ A;  2YKN A;  2B6A A;  1L3S A;  3KD5 E;  1S1U A;  4RG8 A;  2Z1G A;  2DTU A;  4RW4 A;  4DSJ A;  3OYA A;  1KLN A;  3SUN A;  5HBM A;  1L3T A;  1ZBF A;  2RF2 A;  4CEE A;  3SV3 A;  3SQ0 A;  1L3U A;  3RR8 A;  4CEZ A;  4KV8 A;  2HHS A;  4CFD A;  3QNO A;  1U47 A;  1T7P A;  2PYL A;  4KI4 A;  4BAC A;  3IG1 A;  4KFB A;  3FFI A;  1C1B A;  2XO7 A;  1U48 A;  4PQU A;  1S1X A;  1UWB A;  4J2D A;  4OJR A;  3ZT2 A;  1QSY A;  3BDP A;  4DU4 A;  4Z4I A;  2YHA A;  3ZT0 A;  4Y1D A;  3DOK A;  3SUP A;  3AVF A;  4CEC A;  3KTQ A;  1VRT A;  4B3O A;  4OGC A;  3NBP A;  4M3R A;  1RDB A;  4O4G A;  3NF6 A;  4CFC A;  1W0H A;  2X6S A;  4IG0 A;  1RT3 A;  2Q3S A;  4DSL A;  4F3O A;  4H4M A;  3ZSY A;  3HPG A;  4CF9 A;  4DU1 A;  3QET A;  4E0D A;  3MAQ A;  1R0A A;  1S6P A;  4BDZ A;  4MQ3 A;  1S1W A;  4W5O A;  4B08 A;  4CIF A;  4DF8 A;  3IAY A;  3P5J A;  2P5O A;  2P1J A;  4OKJ A;  3OYN A;  4M41 A;  2BAN A;  1ZYQ A;  1SL1 A;  1CLQ A;  1NOZ A;  4AHT A;  4EZ6 A;  1WSF A;  3VQ5 A;  3S3M A;  3TWH A;  4JRQ A;  3V9W A;  1JXE A;  4R5P A;  1IKX A;  4BDY A;  2PZS A;  3P83 D;  1BI4 A;  4FJN A;  1HQU A;  3L2U A;  4Z4E A;  4IBN A;  1YT3 A;  1W9H A;  2DFE A;  4N76 A;  4OLB A;  3QNN A;  4CJV A;  4CCH A;  3V9X A;  1WSI A;  2ZD1 A;  2ZE2 A;  1TGO A;  4ICL A;  2OA8 A;  4CGJ A;  1JLG A;  5EU7 A;  4DTU A;  4RW8 A;  1C1C A;  2IOC A;  4Y1C A;  4NCG A;  5J2P A;  3RMD A;  3RMA A;  1RCH A;  3HM9 A;  3HT3 A;  4CEF A;  4CJW A;  1C0M A;  1TK0 A;  2FBY A;  1IKY A;  4AHV A;  3T3F A;  2FBT A;  3OYF A;  3SNN A;  1RT6 A;  1VSD A;  2I5J A;  1MU2 A;  2PYJ A;  3AVA A;  4FJG A;  1TK8 A;  3AVB A;  1XWL A;  2O4I A;  2A1S A;  1XI1 A;  1DLO A;  4EZ9 A;  1EX4 A;  4M3U A;  1BHL A;  1RT4 A;  4RW9 A;  4AIL C;  5D3G A;  3H08 A;  3MEE A;  2D0B A;  3U6F A;  5I42 A;  3ZT4 A;  1VSJ A;  2G8W A;  4CJP A;  3L3U A;  4CF2 A;  4E7I A;  3S3N A;  4F2R A;  4ELV A;  1QS4 A;  3V6D A;  4ELU A;  3MEG A;  1RTI A;  3K5L A;  2XY5 A;  1HYS A;  4PUO A;  3BGR A;  3KIO A;  1HNV A;  3VN5 A;  3V9Z A;  1ZBI A;  1VSK A;  3B6P A;  4DG1 A;  3VQC A;  2HB5 A;  3V1O A;  3AO3 A;  4B9M A;  3VQQ A;  4CF0 A;  4OPJ A;  3O4N A;  3TAF A;  2Z1J A;  3CM6 A;  4KO0 A;  4DFP A;  3OYK A;  3AA2 A;  3SQ4 A;  1IG9 A;  3QIP A;  2HNY A;  3ZSX A;  4FJL A;  3ZCM A;  3AVH A;  4CJE A;  4IG3 A;  4YFU A;  4B9U A;  2P51 A;  2AJQ A;  4EP5 A;  3OYM A;  4ZTJ A;  1SL2 A;  4CHO A;  4KTQ A;  4W5T A;  3CG7 A;  3QEX A;  3NF7 A;  4Z4H A;  3TAR A;  4QCL A;  1C6V A;  3KD1 E;  2KFN A;  1TKD A;  4QOZ B;  5HRN A;  1C1A A;  4HHT A;  1QE1 A;  3LAK A;  2XY7 A;  1X9S A;  1LAV A;  4LY7 A;  4M3W A;  4F3T A;  2F96 A;  3QIO A;  5KRS A;  2WOM A;  4CJ3 A;  1UA1 A;  3EYZ A;  3AO4 A;  3AVL A;  3DRP A;  2B4J A;  4Q0B A;  5J1E A;  1NJY A;  1J9A A;  2HHU A;  1KFD A;  4CJT A;  1NJZ A;  4KI6 A;  2O4G A;  2BGG A;  4PWD A;  5C24 A;  2HHQ A;  2BDP A;  4DTS A;  1VSI A;  4FZZ A;  4CFA A;  5KTQ A;  1GOB A;  4KB0 A;  4CEA A;  3CFR A;  3RMB A;  4CE9 A;  3NGY A;  4DTN A;  4B9L A;  4DQP A;  3K5N A;  3VA3 A;  1KSP A;  2IC3 A;  4B8C A;  3LP1 A;  4AHC A;  5CY4 A;  1EET A;  4IDK A;  4N47 A;  3RMC A;  1EP4 A;  1WLJ A;  1RBR A;  3V9U A;  3AVI A;  4OGE A;  4HTU A;  3HK2 A;  1IO2 A;  3HP9 A;  5E41 A;  2HW3 A;  4BE1 A;  3PUF A;  1SKR A;  3DLR A;  4CEQ A;  5T7B A;  4C8K A;  2HVI A;  4CJL A;  1J53 A;  3NGI A;  1RT7 A;  3DI6 A;  1DTQ A;  3VQB A;  2D0C A;  2DFH A;  3T1A A;  3AV9 A;  4YNQ A;  1RTD A;  3HJF A;  4H8K A;  3LP3 A;  1U45 A;  4FJK A;  2E6L A;  4AHS A;  3V81 A;  4DQQ A;  1RIL A;  1B92 A;  2IAJ A;  1G15 A;  1Z25 A;  2GBZ A;  2OPR A;  3M8P A;  4TSX A;  1KTQ A;  3ZSO A;  3V4I A;  2Z1I A;  1Y97 A;  3SV4 A;  1WSH A;  4N5S A;  2G8F A;  4O0J A;  3KKR A;  4PY5 A;  1IH7 A;  4E89 A;  4HCC A;  1S5J A;  4QAG A;  4I2Q A;  1QTM A;  1BCO A;  4CHQ A;  2F8T A;  3LWL A;  3OJS A;  5HRR A;  3TAB A;  2KW4 A;  4RW7 A;  4FVM A;  5HP1 A;  1C0T A;  4CEO A;  3TI0 A;  4FJ9 A;  4FLX A;  4NCB A;  1A5X A;  4ELT A;  4M3X A;  1JLQ A;  1T8E A;  4I9Q A;  3VQ4 A;  1EKE A;  3ISN C;  1TVR A;  3AVN A;  1REV A;  4LH5 A;  5J2N A;  3VQ9 A;  3HP6 A;  4CGG A;  4Q5V A;  4PA1 A;  3OYE A;  3HYF A;  4CHY A;  1CXU A;  1QSL A;  5FRM A;  2PY5 A;  1C0U A;  4E7J A;  3K59 A;  3ITH A;  3PO4 A;  4E7K A;  1CZ9 A;  1JL2 A;  4E1N A;  2QKB A;  2E6M A;  4CIE A;  3LPU A;  4NYN A;  3AO2 A;  2QKK A;  2F8S A;  4FM0 A;  1TL3 A;  1TV6 A;  3ZSZ A;  3NCI A;  3RRG A;  3SJJ A;  4DSF A;  4JRP A;  4FW2 A;  3SUQ A;  4C8N A;  1ASU A;  2B5J A;  3L8B A;  4CF8 A;  4CFB A;  4CHN A;  4Z4F A;  3KLH A;  3G0Z A;  2DFF A;  3TAQ A;  3OYL A;  5J2M A;  4FJI A;  1S1V A;  3G10 A;  3IRX A;  4CED A;  3DRS A;  1QQC A;  1VK0 A;  1WN7 A;  4CJF A;  5KI6 A;  1T05 A;  2G8V A;  1LWF A;  1ZBL A;  2IDO A;  2YHB A;  1NK5 A;  5CZ1 A;  4BWM A;  1JXB A;  4CJU A;  3LDS A;  1BIS A;  4CK2 A;  4IKF A;  1UOC A;  4FZY A;  1KLM A;  3C6U A;  3DLG A;  1S1T A;  4UQG A;  4KHS A;  2Z1H A;  5HRP A;  4DS4 A;  1HRH A;  1VSL A;  3KLF A;  1WAJ A;  1SKS A;  4KHN A;  3U3G A;  2XHB A;  4FLZ A;  4B9V A;  1RNH A;  3EZ5 A;  3SQ2 A;  4FK0 A;  3HPO A;  3TAG A;  1DTT A;  1K6Y A;  4DQR A;  4KAZ A;  5I3U A;  1TKZ A;  3VQP A;  3OY9 A;  4M45 A;  4B8A B;  3KK3 A;  3SI6 A;  3ZSQ A;  3K2P A;  3O3F A;  4HCB A;  4BE2 A;  3D45 A;  5FRO A;  2YNF A;  3JYT A;  3L2Q A;  2HHX A;  1RDC A;  4KHY A;  1WSE A;  4CES A;  4DLG A;  1WSJ A;  1HPZ A;  3WNG A;  4CGH A;  1RBV A;  2VWJ A;  1RTJ A;  4O5B A;  1O1W A;  3LAN A;  1UAX A;  4O55 A;  3VQD A;  3TAN A;  3VQ8 A;  4C8O A;  5FRN A;  2G8H A;  1D9F A;  2G8U A;  2DY4 A;  4CEB A;  4CJ4 A;  3KLI A;  4E1M A;  3KK1 A;  1FKO A;  1VSH A;  1SKW A;  1TK5 A;  3ULD A;  3KJV A;  1TAU A;  5DMR A;  2W42 A;  3HVR A;  2P5G A;  1HJR A;  4M3Y A;  2VG7 A;  1S9E A;  1B9F A;  1RDD A;  1LAW A;  3HXM A;  3K5O A;  4WE1 A;  4B9N A;  2XY8 A;  3NGZ A;  3V1R A;  3I8D A;  4HUE A;  4FLT A;  1Q9X A;  1WNS A;  3HO1 A;  2HVH A;  1FK9 A;  1S9G A;  4FXD A;  1X1P A;  1BIU A;  1FXX A;  1SV5 A;  3C6T A;  4GW6 A;  4W5Q A;  1LV5 A;  3KKS A;  1D8Y A;  3AVM A;  4FW1 A;  4DU3 A;  3AVK A;  3QEI A;  4CK1 A;  3VQE A;  1L3V A;  3F73 A;  3QER A;  3SYZ A;  1SL0 A;  3SQ1 A;  4CF1 A;  1J5O A;  3RR7 A;  3EY1 A;  3AVJ A;  4HUF A;  1WAF A;  3VQA A;  1ASV A;  2X74 A;  1NK8 A;  1NKB A;  3MEC A;  2LSN A;  4CER A;  2RN2 A;  1VRU A;  5C25 A;  1JL1 A;  2OZM A;  2ATQ A;  4C8L A;  1D5A A;  1XC9 A;  3OS2 A;  1RT2 A;  4DSE A;  3OYC A;  1BCM A;  3V9S A;  1SUQ A;  4MFB A;  3VQ7 A;  3M8S A;  3QES A;  1JLB A;  4CJR A;  4N56 A;  1LWE A;  3MXJ A;  3KLG A;  4JLH A;  1HYV A;  4DLE A;  4KHW A;  4N41 A;  3TAM A;  3M8Q A;  1N6Q A;  3O3G A;  5SWM A;  2VG6 A;  2YV0 X;  3NE6 A;  1LW0 A;  2IGI A;  5JS2 A;  3DOL A;  3PY8 A;  2HNZ A;  4NCA A;  5FDL A;  3CFP A;  4B9S A;  2FC0 A;  4GMJ B;  3LZJ A;  5CYQ A;  1U4B A;  2JGU A;  4ID1 A;  3S3O A;  1J54 A;  3OYJ A;  2R7Y A;  4O44 A;  3KK2 A;  5CZ2 A;  3L2W A;  2ZQB A;  4F4K A;  1Q9Y A;  4DTR A;  1U04 A;  4JS4 A;  2KZM A;  2X78 A;  1Q8I A;  3OYB A;  4ZTF A;  1LW2 A;  3HL8 A;  5HLF A;  3QLH A;  1Z26 A;  4AH9 A;  2G8K A;  4DTJ A;  1BI4 B;  1HYZ A;  4L8R B;  1VSF A;  1B9D A;  1NK9 A;  3ALY A;  3AVG A;  3OJU A;  3CYM A;  2GUI A;  4KKO A;  3VQ6 A;  4FJM A;  3AA3 A;  3O4Q A;  4FJJ A;  3AA5 X;  3OS0 A;  3NDK A;  1X9M A;  1JLC A;  3O3H A;  4FJH A;  4CGF A;  3K57 A;  1ZBU A;  4Z4C A;  3DLH A;  1U49 A;  4DFM A;  3I0R A;  1ZBH A;  2IS3 A;  2YNH A;  3IS9 A;  4M3Z A;  1RDA A;  3HVT A;  2RPI A;  4BWJ A;  5KGX A;  2HND A;  1BQN A;  2EX3 A;  4BDP A;  2OYQ A;  4Z4G A;  2KTQ A;  3DMJ A;  4IFV A;  3PX0 A;  3MXI A;  4G1Q A;  3LZI A;  3RRH A;  1A5W A;  4DSK A;  4M3T A;  1I39 A;  1NK0 A;  4DFJ A;  2Y1I A;  3OYI A;  4JS5 A;  3MXM A;  1RTH A;  3ZSV A;  1JLF A;  3NF9 A;  5JS1 A;  1GOA A;  3LP2 A;  1NJW A;  3SCX A;  3A2F A;  1I3A A;  2QK9 A;  3DRR A;  4AHU A;  4B9T A;  2VG5 A;  4KPY A;  1XHZ A;  3NF8 A;  3ZSR A;  3PO5 A;  3QEP A;  4FJ5 A;  1QHT A;  4FLW A;  3F9K A;  2GV9 A;  4DQI A;  1IKW A;  3OYD A;  4LSN A;  1VSE A;  3LAM A;  4FCY A;  3NAE A;  3QO9 A;  3L2R A;  3ZT3 A;  4CJ5 A;  5HRS A;  1YTU A;  3C94 A;  3V1Q A;  4OPK A;  3DLK A;  1CXQ A;  3PX6 A;  4DFK A;  2EHG A;  3OS1 A;  3M8R A;  1UA0 A;  4FJ7 A;  2A1R A;  1JKH A;  1YVU A;  2X6N A;  2ETJ A;  3MED A;  1KFS A;  3SPZ A;  1RBS A;  1BL3 A;  3QEW A;  3RWU A;  2OPP A;  4LH4 A;  3CQ8 A;  4E7L A;  3QEV A;  2KQ2 A;  4NYF A;  3KLE A;  3LWM A;  1XHX A;  3HST B;  1TKX A;  1BQM A;  3JSM A;  3K58 A;  4DTO A;  1NKC A;  4OLA A;  4KHU A;  3CM5 A;  3OYH A;  3QIN A;  4DQS A;  2Y1J A;  4IFY A;  3ZSW A;  4GVM A;  2KFZ A;  1S6Q A;  4FM2 A;  4W5N A;  1HQE A;  4LSL A;  4OVL A;  1FKP A;  4OKE A;  5KRT A;  4DS5 A;  2YNG A;  2E4L A;  3SZ2 A;  3L2V A;  3ZT1 A;  1BGX T;  3ASM A;  2XRI A;  1X9W A;  3NFA A;  5C42 A;  4DTM A;  4FJ8 A;  4DTX A;  2JLE A;  3C95 A;  2NUB A;  4KB1 A;  2OPQ A;  4CGI A;  1T03 A;  3WNE A;  1L5U A;  4ZHR A;  3NH1 A;  3DYA A;  2D5R A;  1N5Y A;  4CJK A;  4F2S A;  1KVA A;  2ITG A;  1NKE A;  1RT1 A;  4ID5 A;  4CGD A;  3NH2 A;  2YKM A;  2HHT A;  1A5V A;  2D0A A;  1RT5 A;  4I7F A;  2RKI A;  2HMI A;  4FJX A;  2KZZ A;  1NJX A;  4KRE A;  3AO1 A;  4DTP A;  4DMN A;  1WSG A;  1VSM A;  3TAE A;  4K8Z A;  4DF4 A;  2HHW A;  4EP4 A;  4KTW A;  3E01 A;  1KVC A;  1JLE A;  1YTA A;  4BE0 A;  3D0P A;  4HUG A;  2HHV A;  3I0S A;  3PV8 A;  3VA0 A;  1NK4 A;  4FM1 A;  3OVN A;  4XIU A;  5SZT A;  4J2B A;  1RBT A;  4J2E A;  4K8X A;  3LAL A;  1EXQ A;  3B6O A;  1HNI A;  1KCF A;  1F21 A;  2XY6 A;  3DM2 A;  4AHR A;  1D9D A;  2BE2 A;  1IKV A;  4E7H A;  3CFO A;  5DK5 A;  1BIZ A;  3AA4 A;  3DLB A;  1KVB A;  3NHG A;  1KRP A;  4F8R A;  4I2P A;  4Z0U A;  1RBU A;  3S9H A;  1NOY A;  2G8I A;  3PX4 A;  5KGW A;  3NH0 A;  3SPY A;  3WNH A;  4DWI A;  4O0I A;  4M42 A;  1JLA A;  4E19 A;  3LPT A;  4FLV A;  4FK4 A;  4HVJ A;  1ASW A;  3AVC A;  3UIQ A;  3TAP A;  3DLE A;  4CHZ A;  3L3V A;  1QSS A;  3HPH A;  4DSI A;  4J2A A;  4RW6 A;  2VWK A;  3K5M A;  3THV A;  2FBX A;  3P1G A;  5HRO A;  3U3Y A;  5K14 A;  4OKK A;  2FBV A;  3WNF A;  4CJQ A;  4C8M A;  4CHP A;  1NK7 A;  4KRF A;  3AO5 A;  4W5R A;  4CIG A;  5CYM A;  1LWC A;  4E3S A;  5J2Q A;  4FLU A;  4CJS A;  4LD0 A;  1ITG A;  3OYG A;  4FZX C;  4H4O A;  1GOC A;  2OPS A;  4FYD A;  2OZS A;  4KHQ A;  2WON A;  4KTZ A;  3T19 A;  2QXF A;  2YNI A;  4I9L A;  1NK6 A;  4FLY A;  3LP0 A;  3TR8 A;  3RTV A;  3SUO A;  1CZB A;  1TKT A;  4FK2 A;  4CK3 A;  1TL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...