4B8CA

Nuclease module of the yeast ccr4-not complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
280
structure length
267
Chain Sequence
PIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/cell cycle
molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 85
structure length 267
sequence length 280
chains with identical sequence C, E, F
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b8cA00
4BWMA 2A1RA 3V1OA 1RT3A 3AVHA 3IG1A 3U6FA 1HJRA 3JSMA 3VQ9A 2VG5A 3C6UA 1FKPA 4QCLA 1JKHA 2FBXA 2PZSA 1RNHA 3ALYA 3WNFA 1Q9XA 1VSDA 1BI4A 1Z26A 3NH0A 4CGFA 4FJ9A 4OKEA 4W5TA 4M42A 2XHBA 3MXIA 1SV5A 1SUQA 1YVUA 2HNZA 3SUQA 1Q9YA 3LALA 1S1VA 3VQAA 4LY7A 3PO5A 1JLEA 1VSFA 2YHAA 4DSIA 4IG3A 5KGWA 4CJ3A 2G8WA 2YHBA 1W9HA 3P83D 1QHTA 4CJTA 3FFIA 4B9MA 4E7KA 4DTNA 1S6PA 3QINA 3VQDA 1QE1A 3HM9A 3NF7A 4DQIA 2HHWA 5HP1A 1NK6A 1HRHA 2OYQA 4FJ8A 1BI4B 3B6OA 3HPHA 3KLIA 3KTQA 1Q8IA 1WAFA 2OPQA 1KLMA 1RDAA 1KCFA 3AO4A 4IKFA 1WNSA 1S1WA 3KLEA 4KREA 5FDLA 1DTTA 4CEFA 2G8VA 1K6YA 2IOCA 3NF8A 3PX4A 1KRPA 1U04A 4DSEA 1ZBLA 3OYKA 4KB1A 2F96A 4C8KA 1RDBA 4ZTFA 4B8AB 1D5AA 3ZT3A 4Z4IA 2OPSA 1J53A 1J9AA 3CM5A 4DQQA 3OYNA 4J2DA 4LH4A 4FK2A 4Z0UA 1BIUA 1C6VA 3HPGA 1NK5A 2OZSA 4HUGA 4M3YA 3V1RA 3VQBA 3OYMA 1G15A 3A2FA 4BDZA 1RBRA 3C94A 3OYGA 4B9UA 1LAVA 5HBMA 1VSLA 2ITGA 3TAPA 1BL3A 5J2NA 3HO1A 4FJKA 2HVHA 1VSHA 3LAMA 3PO4A 1HYVA 2DFHA 4YNQA 1TKZA 1TAQA 2YV0X 4DSFA 4BDPA 1C1AA 3QETA 2OA8A 3KJVA 4AHVA 1CZBA 4DQRA 1NKBA 2O4IA 3D0PA 1LWEA 1VRTA 1JLCA 4CHZA 5K14A 4DQSA 3L3VA 2G8KA 1TKTA 1TL3A 2B4JA 2WONA 3C95A 3SYZA 3SNNA 3S3MA 1TK5A 1UA1A 4DU3A 3B6PA 3VQCA 3PY8A 3HL8A 2LSNA 1KLNA 4LSNA 3TR8A 1VSMA 4IFVA 3OYLA 3LP1A 4PY5A 2KZZA 1UOCA 2HMIA 2B5JA 4ID5A 4L8RB 4FK0A 1NK9A 4KHNA 4KO0A 3KK2A 4C8LA 4B8CA 1VSKA 4AHSA 4BACA 5J2MA 5J2PA 1JXEA 4OGCA 4NYNA 1I39A 1KVAA 5JS2A 2ZQBA 4ID1A 2Z1HA 4K8ZA 1MU2A 3QESA 4DSLA 3DLEA 4AHCA 4FLTA 4B9SA 3C6TA 3TAMA 3VQ8A 3H08A 1Y97A 4CGJA 2X78A 4ELVA 1D9FA 2QKBA 1RT2A 1WSGA 2WOMA 1ZBFA 4CJRA 1D9DA 4KB0A 4CEEA 4EP4A 4DFPA 4CF9A 4CHQA 1XHZA 5J2QA 4CHOA 4J2EA 1BGXT 3AO1A 4FJNA 2HHVA 1IH7A 3QEPA 2X6NA 2Q3SA 1NOZA 2DFEA 2QKKA 4I2PA 3ZSVA 4GVMA 5KI6A 2P5GA 3K59A 4PWDA 4O5BA 4F3TA 3OYCA 3U3YA 4FLYA 2YNGA 4CGIA 4DG1A 1U49A 3LP2A 3LPUA 4EZ6A 2EHGA 1RILA 1JLFA 2P1JA 4KTZA 1SKSA 2PYJA 3K2PA 2VG6A 4KHQA 4F4KA 3QNNA 4BDYA 4K8XA 1RT1A 2F8SA 4CJSA 4FZYA 3SQ0A 4FJ5A 1UAXA 4KKOA 4CJQA 2ETJA 3ZT1A 4FJHA 3AO5A 3KD5E 1LW0A 1VK0A 4ZTJA 3AVMA 4R5PA 4XIUA 3VQQA 2KW4A 4M3TA 2JGUA 4DMNA 4FM2A 2HVIA 1TK0A 1S1TA 4Z4GA 3HJFA 1EP4A 4Z4HA 4F2SA 4FLUA 2A1SA 5CZ1A 4E3SA 1YTUA 1X9MA 3OYBA 3KD1E 3IAYA 2E4LA 2HHSA 1WN7A 1BQNA 4DTUA 2HNDA 4JS5A 5D3GA 4DSKA 2AJQA 1RT5A 3L2QA 1HNVA 1TV6A 3NF9A 4CJEA 4DU4A 4FJJA 5HLFA 1QSSA 1F21A 4I2QA 4FJGA 1QTMA 1RBUA 4CGGA 2W42A 3AO2A 4RW8A 3TWHA 3L2UA 1KSPA 4KAZA 3O4QA 1KVBA 3LPTA 4N47A 4DS5A 4FLVA 2DY4A 2HHUA 1EETA 3NGZA 3ZSWA 1U48A 2VWKA 4LH5A 1WSHA 4CEAA 3EY1A 4CJPA 4FVMA 4O4GA 1NJXA 1X9SA 3ISNC 3O3HA 3RMAA 4IFYA 4CK2A 3NGYA 4IDKA 2IDOA 1UA0A 3K58A 3QEXA 4EZ9A 4DTSA 2BGGA 1GOAA 3QIPA 4UQGA 3VQ6A 4W5QA 2D0CA 4AHRA 3TAGA 4KHUA 2ATQA 4KHWA 3QLHA 4CEDA 1QS4A 1KFDA 3V9ZA 1W0HA 1A5WA 5CZ2A 3SI6A 3OJUA 1RDDA 4I9LA 1EXQA 3K5NA 4KPYA 3O4NA 4RW4A 2HB5A 3AVJA 4CK3A 4E89A 3TI0A 3O3GA 4ELTA 1T03A 3ZT0A 3NDKA 3MAQA 1RTIA 4CFAA 3RMDA 1L3TA 4Y1DA 3ZSYA 1WAJA 3AO3A 1HPZA 5HRRA 4DTOA 1RDCA 1JL1A 4CEZA 2YKMA 4FLXA 3OYHA 3DRPA 3LAKA 2OPRA 4M41A 3K5MA 4OPKA 4E19A 5I42A 3MXJA 3AVCA 1VSIA 5KRTA 1XI1A 4OJRA 4GMJB 4DTJA 4Z4FA 4LSLA 4FJLA 2I5JA 3LANA 3IS9A 3SUOA 4AH9A 3NF6A 2YNIA 2ZE2A 5HRNA 2KTQA 4Q5VA 1U4BA 4TSXA 4NCAA 2IAJA 3BGRA 4DF4A 1FKOA 1FK9A 1IKWA 4O0JA 3CQ8A 4E7LA 3NBPA 1N5YA 3ZCMA 4C8OA 3DLGA 3WNGA 3TANA 1B9FA 2QXFA 4CHPA 4KFBA 3ULDA 1O1WA 4W5RA 4CGDA 2YKNA 1IO2A 4BE2A 3ZSQA 3RR7A 1DLOA 3M8SA 3DM2A 3K5LA 3SJJA 3CFOA 1WLJA 1T05A 1LW2A 4DLGA 3ITHA 4DWIA 4M3WA 4KHYA 3AVFA 2B6AA 1S1UA 3SCXA 1NKEA 4H4MA 2IGIA 3KKRA 2RN2A 3CG7A 4CEQA 1T8EA 2GBZA 3LZIA 2Y1JA 1SL2A 3RRGA 1REVA 5C25A 1RTDA 4OPJA 3SV3A 3P1GA 3KK1A 1U45A 1TK8A 1J5OA 3QNOA 2QK9A 3VQ5A 3SQ1A 3L2VA 2G8UA 3OY9A 4ELUA 1YT3A 3VN5A 3HT3A 2GUIA 4N5SA 4FJ7A 5HRPA 2FC0A 4OKKA 3OYAA 3G0ZA 4CCHA 1TKDA 3WNHA 1T7PA 3D45A 3LWLA 4E1MA 2KQ2A 3SV4A 1NK0A 5HROA 4HTUA 2RKIA 1ZYQA 3HVTA 5EU7A 3V81A 3EZ5A 4W5NA 4CJUA 3TABA 3SUPA 1BHLA 4EP5A 3L3UA 3V9UA 4H4OA 3VA0A 1RT6A 2EX3A 3DRSA 4B3OA 3NE6A 3OYIA 3F9KA 4N41A 1RBSA 1WSJA 2HNYA 3I8DA 3OVNA 4Y1CA 4DU1A 4FCYA 4JS4A 4AHTA 4CIEA 3S3OA 3LWMA 4KHSA 3OYDA 4F2RA 4IG0A 1SL1A 4M3UA 2O4GA 3I0RA 1C0TA 3HPOA 3HVRA 3MEGA 1S5JA 1ASUA 3KLHA 2BANA 3I0SA 3OJSA 1S9GA 4BE1A 3V6DA 1TAUA 1ZBIA 3NFAA 3RTVA 2XY5A 3RRHA 2PYLA 3MECA 1RTJA 4CF8A 4KTQA 3WNEA 3AA4A 4G1QA 1RBTA 1BQMA 4NCGA 3M8PA 4OVLA 4QAGA 3ZSRA 1A5VA 4W5OA 3AA5X 3LP0A 1A5XA 3KLGA 2VG7A 4CF2A 3PV8A 1LV5A 1HQUA 5FRNA 1ZBHA 3T19A 3LDSA 2HW3A 3DYAA 3M8QA 2Z1JA 3VQ7A 3VQEA 2HHXA 5T7BA 4FM1A 5CY4A 1RCHA 3TAQA 2JLEA 4E7IA 4CFCA 3SQ2A 1KVCA 4BWJA 5CYMA 4OLBA 4AHUA 4E7HA 2RF2A 4N56A 1NJYA 1WSFA 3L2RA 2G8IA 4J2AA 4FK4A 4CEOA 3ZT2A 4DTXA 3VQ4A 3OS2A 1Z25A 4CEBA 3VA3A 3MXMA 1GOCA 1LWCA 4FZXC 4JLHA 2HHQA 3HXMA 4CJKA 1WSEA 3M8RA 3PX0A 3MEDA 1JLGA 3ZSZA 2X74A 4M3RA 4CK1A 3NGIA 1NK7A 4FLZA 1JL2A 4O0IA 3NH2A 4DTPA 4FXDA 5JS1A 1JLAA 4CIGA 3V9XA 4NYFA 1C1CA 4I7FA 3NHGA 4KTWA 4B08A 1R0AA 1NK4A 2E6MA 1ITGA 3V9SA 3DLHA 3KIOA 4WE1A 4CHNA 1L3VA 1ASVA 5KGXA 1CXUA 4O55A 5KRSA 3NH1A 1SKRA 1L3SA 1NOYA 2G8FA 1C0MA 4RG8A 4CECA 4KV8A 1JXBA 3LP3A 4FZZA 4Z4EA 4PA1A 1L5UA 1XHXA 3TARA 4CF1A 3RWUA 5I3UA 1VRUA 1HMVA 1J54A 3P5JA 1VSJA 1UWBA 1LWFA 3AV9A 4CERA 3AVGA 3ZSXA 3O3FA 3DLKA 4GW6A 2XRIA 4FJIA 5SZTA 2FBVA 1BCMA 4BE0A 4I9QA 4M3ZA 4M45A 5J1EA 3ZSOA 4HUFA 3RR8A 4IBNA 3SQ4A 2DFFA 3OS0A 4CIFA 1NJWA 1RT4A 3U3GA 4J2BA 2KZMA 1KTQA 2E6LA 4QOZB 1QQCA 4HUEA 3TAEA 4LD0A 2VWJA 1U47A 3QEIA 4HHTA 3PX6A 3PUFA 1B92A 1BIZA 3AVLA 4CF0A 3CYMA 4CFDA 5C42A 4CGHA 3DLRA 3HYFA 3T3FA 3DI6A 1JLQA 1SL0A 2RPIA 2D5RA 3IRXA 1KFSA 1BISA 2P51A 2BE2A 4C8NA 4CJ4A 4HVJA 3SZ2A 3TAFA 1HYZA 3AVNA 3ZT4A 4E1NA 2NUBA 5KTQA 4E7JA 2FBTA 4HCBA 4NCBA 1EX4A 5E41A 3OYJA 5FROA 4CJFA 4RW7A 4FYDA 3KKSA 3QERA 4B9TA 4RW6A 4FLWA 1X9WA 4FM0A 4CJWA 4DLEA 1HNIA 3EYZA 4Q0BA 5SWMA 4FJMA 4B9NA 2XY8A 5DMRA 3RMBA 4PQUA 3HSTB 4ICLA 4OLAA 3V9WA 3K57A 3G10A 3AA3A 1LAWA 1XWLA 2X6SA 3NCIA 4MQ3A 1WSIA 2YNFA 1TGOA 3AVKA 3OS1A 1RBVA 2D0BA 4CHYA 4O44A 4M3XA 2F8TA 4ZHRA 4DS4A 3V4IA 3BDPA 3HK2A 2HHTA 4Z4CA 1DTQA 1VSEA 4CJLA 1QSYA 2FBYA 1X1PA 4DFKA 3DMJA 3NAEA 3RMCA 4C8MA 1FXXA 4N76A 5DK5A 4DFMA 1BCOA 1XC9A 4HCCA 3SUNA 1TL1A 3KK3A 3F73A 3THVA 2Y1IA 3DRRA 4OGEA 3L2WA 1S1XA 1HQEA 1EKEA 2BDPA 3OYFA 1GOBA 4KI4A 3K5OA 1N6QA 4FJXA 4CE9A 2YNHA 2OZMA 3JYTA 2KFNA 1S9EA 2IC3A 1JLBA 3CFPA 4DFJA 5FRMA 2P5OA 5C24A 1NJZA 1I3AA 3ASMA 4FW2A 3AVIA 1S6QA 4CFBA 4DF8A 2OPPA 4F8RA 2DTUA 2ZD1A 3MEEA 1C0UA 2D0AA 4CJVA 2XY6A 1D8YA 1QSLA 4B9VA 4DQPA 1CLQA 2R7YA 4FW1A 3SPZA 3QEVA 1HYSA 1IKYA 3OYEA 3DLBA 3KLFA 3UIQA 4CESA 1CXQA 3VQPA 1SKWA 2KFZA 3DOLA 3L8BA 1NK8A 3CM6A 2IS3A 1ASWA 3E01A 4RW9A 5HRSA 1IKVA 3AVBA 1L3UA 1IKXA 2XY7A 4B9LA 1RT7A 1YTAA 4F3OA 4PUOA 2G8HA 1TVRA 4DSJA 3HP6A 2PY5A 2XO7A 3HP9A 3T1AA 4AILC 3S3NA 2Z1GA 1ZBUA 3CFRA 3QO9A 3SPYA 3DOKA 1RTHA 5CYQA 3V1QA 4YFUA 1IG9A 1CZ9A 3QEWA 4DTMA 3QIOA 2Z1IA 4DTRA 1B9DA 4OKJA 4E0DA 1C1BA 4JRPA 2GV9A 3AVAA 3S9HA 4H8KA 4CJ5A 1NKCA 4KI6A 4KRFA 1TKXA 3LZJA 4JRQA 4MFBA 3AA2A
chains in the Genus database with same CATH superfamily
4X64K 2VG5A 4QCLA 1JKHA 2UXCK 4JN4A 1VSDA 4IO8A 3MWTA 4MO4A 4FJ9A 4W5TA 4M42A 2J4RA 2XHBA 3K9JA 1Q9YA 3ZLJA 3CC7N 2GELA 2A3ZA 1BA0A 2YHAA 3ZEUA 5AQWA 2G8WA 3C65A 1W9HA 3P83D 1QHTA 4CJTA 3FFIA 5KPRA 3D7EO 4E7KA 1S6PA 3HM9A 2HHWA 1HRHA 2OYQA 3B6OA 1XMOK 2OPQA 2A6AA 5EOYA 1Q7YO 4IKFA 1YJWN 3KLEA 5FDLA 4CEFA 2G8VA 1KRPA 3NF8A 2QWOA 1U04A 3ZEUB 5EXWA 3OYKA 4C8KA 4CZFA 4B8AB 1D5AA 4CBXA 4BRHA 4WFBL 1J9AA 1K8KB 4DQQA 4LH4A 1BIUA 5FLXO 4LF6K 4HUGA 3O8MA 3VQBA 3A2FA 3C94A 2ASOA 4B9UA 1LAVA 5HBMA 1BG3A 2ITGA 4OPHA 3HM8A 4FJKA 2E1ZA 3M6GA 1FW6A 2E1YA 4JI7K 4BDPA 4H5TA 1CZBA 5ADXA 2ZGZA 3FR0A 2G8KA 1HKCA 1TKTA 3SNNA 5AQZA 3CI5A 3KWGA 4H5VA 2UU9K 3LP1A 3FZKA 2HMIA 3D2EA 1NK9A 2ZWHA 4KO0A 4BACA 1JXEA 4NYNA 4DKWA 4LF9K 2ZQBA 2Z1HA 1MU2A 1QQOA 3BZCA 3H08A 2X78A 5JLFA 1D9FA 1RT2A 4BVOA 3D2EB 1D9DA 1LCUA 3Q7CA 4JNEA 4BRGA 2X6NA 4OX9K 4WQ5A 2QKKA 4I2PA 3R9PA 2IVNA 2E2NA 4O5BA 5BRHA 3OYCA 4FLYA 4CGIA 3LPUA 4EZ6A 2EHGA 1SKSA 2PYJA 1C0GA 5JMVA 2VG6A 4JI2K 4JKEA 4CJSA 1IBMK 3SQ0A 1KAXA 4K0KK 5KQDA 4KKOA 4DQ8A 4FJHA 3KD5E 3VF4A 1VK0A 4R5PA 5AQXA 3VQQA 2W6LA 4JI5K 4DMNA 3GG4A 4Z4GA 5AQIA 4F2SA 4FLUA 5CZ1A 4YOTA 5C2FA 4E3SA 4BR2A 1GLAG 4DTUA 1HX1A 5D3GA 3CETA 1HNVA 4R79A 4FJJA 1QSSA 4B1YB 2PBDA 3AAPA 4DS5A 1HLUA 3ZSWA 3G71N 5BPNA 1NJXA 1X9SA 4E1JA 3O3HA 2VYPA 2IDOA 1SAZA 3K58A 4DTSA 3TTFA 3VQ6A 3TAGA 4JKAA 4KHWA 3MK6A 1MWMA 4NLBA 3V9ZA 2Q36A 4I9LA 5HL7L 3GL1A 1XNRK 3O4NA 3THYA 4CZIA 3O3GA 3ZT0A 3NDKA 3MAQA 4CFAA 3F5TA 3ZSYA 1NJIO 1HPZA 2YKMA 3OYHA 3DRPA 3LAKA 3VF2A 5I42A 2Q0UA 4GMJB 4OJRA 4DTJA 1SS6A 4FJLA 2I5JA 3THYB 3SUOA 1YJ9N 1JCGA 5TKYA 4AH9A 3SAGA 4NCAA 2A5XA 4B1WB 2IAJA 4DF4A 4O0JA 3ENOA 1IKWA 3CQ8A 4E7LA 3IFRA 2UXDK 1BO5O 2HMPA 1B9FA 2QXFA 4EHTA 1DLOA 3M8SA 3DM2A 3CFOA 1T05A 4DLGA 2NRVA 1R59O 4DWIA 4M3WA 4KHYA 1NGJA 3SCXA 3CG7A 2CGKA 2UYTA 2ZM6K 3SV3A 3HRGA 3EE9A 3L2VA 3VEYA 5CR4A 1CZAN 3QBWA 5HRPA 2FC0A 4OKKA 4B1VA 1TKDA 4FWPA 1U2VA 2AA4A 3WNHA 3LWLA 4E1MA 2KQ2A 1VQMN 3A8YA 3A5MC 3TSPA 3EZ5A 3UB5A 4CJUA 3TABA 3CIPA 4A57A 3R6MA 3VA0A 4G9ZA 4B3OA 1U2VB 1NGFA 3F9KA 3WT0A 4FCYA 2HOEA 4IG0A 1SL1A 2O4GA 3I0RA 1C0TA 4H0YB 3HPOA 1ATSA 3O9RA 2BANA 3JS6A 3OJSA 1VQNN 5AQGA 2Q97A 3RRHA 4MO5A 2XY5A 4CF8A 5J2PA 1RBTA 4OVLA 4W5OA 3M8PA 3ZSRA 2XY6A 1NK7A 3M3ZA 3AA5X 3PV8A 4MDAA 1HQUA 4BROA 2HBLA 3MN6A 3M8QA 2HHXA 4FM1A 4L3QA 5CY4A 3CJ7A 4E7IA 1H1VA 5CYMA 3EN9A 4WCEL 1NJYA 1WSFA 3I56N 3VA3A 4JLHA 2D0PA 3KHYA 3CXCM 4DR5K 3E1YA 1JL2A 3FZHA 4O0IA 4FLZA 5H1SQ 2FF3B 5AQKA 1M1KO 4FXDA 3R1XA 2E5LK 4KTWA 4O5FA 2A40A 3SK3A 1R0AA 3ENHA 1NK4A 4KBOA 3V9SA 3KIOA 4WE1A 5M1KA 1QVGM 4DUZK 3L4QA 4CHNA 1ASVA 1CXUA 3NH1A 1SKRA 1C0MA 4RG8A 4CECA 4KV8A 3LP3A 5AQNA 4PA1A 1XHXA 3TARA 3RWUA 2ASMA 1VRUA 4IEIA 3A0IX 3O3FA 3AVGA 1BCMA 4CW7B 4HUFA 5AQFA 4DV0K 4IBNA 4DV6K 3S41A 4DR6K 3U3GA 3WEEA 4JKGA 1QQCA 3QEIA 4PL8A 3PUFA 3ZX2A 3ENBA 3CYMA 3LDNA 4CFDA 4CGHA 4BVPA 1JLQA 1BA1A 2D5RA 2P51A 3QFPA 4HVJA 2YJEA 3HSCA 4JI0K 3ZT4A 3WEEB 3MN7A 4JKGB 1BU6O 4GY2B 4NCBA 5KPTA 4CZEA 3KKSA 4CJWA 1HNIA 3EYZA 4FJMA 1QZ5A 1IBKK 4KH6A 1QZ6A 4YDUA 4OLAA 3G4SN 4BRIA 3K57A 3G10A 3AA3A 1LAWA 2D0BA 2F8TA 1OH7A 1YI2N 2P9SA 4DS4A 4JYAK 4HWIA 1VSEA 4C1NI 1FXXA 2JWKA 1W97L 2UUAK 2E2OA 3THVA 3K0SA 3DRRA 1EKEA 1S22A 2D4WA 3K5OA 2P9SB 2YNHA 3VETA 1S9EA 4U7BA 3CCUN 1E3MA 1I3AA 3CCJN 5M1OA 4CFBA 1GLJO 2OPPA 3MEEA 1QSLA 3TTDA 1CLQA 1N36K 3QEVA 1IKYA 2E8AA 2RE2A 1CXQA 3DOLA 1NK8A 5HRSA 1YTAA 2G8HA 2PY5A 2Z1GA 3V1QA 1IG9A 5AQYA 4BC3A 2W41A 1VQON 4E0DA 1C1BA 2GV9A 4CJ5A 1DT9A 1IV0A 4GVEA 2FSJA 4BWMA 2A1RA 2VGMA 2RHKA 3V1OA 2QI2A 3IG1A 3C6UA 1FKPA 4MLEA 4JK8A 1Q9XA 2P9KA 1BI4A 1Z26A 5AJ3K 4CGFA 4JHDA 4OKEA 1EWQA 1SV5A 1XNQK 3VQAA 4LY7A 3SAFA 1JLEA 4FO0A 4CZGA 5KGWA 3K9KA 4CJ3A 2YHYA 2YHBA 4FWSA 4PKHA 4EHUA 4B9QA 4DTNA 4DQIA 3VQDA 2QWPA 3TPQA 5HP1A 2P9KB 4RCHA 1NK6A 1BI4B 3BF3A 3HPHA 4B3MK 4JI3K 4JHDB 3VF6A 1KLMA 1ATNA 4YOWA 4KREA 1DTTA 3JXUA 4H0PA 4K43A 3LDOA 3PX4A 3KK7A 1ZBLA 4C1NK 3P39A 4Z4IA 4YOUA 2GWKA 2OPSA 4J2DA 2F7TA 5AQJA 4Z0UA 2OZSA 4FSVA 4DCHA 3OYMA 4QS8A 1VSLA 1K8AO 3WUHA 5AR0A 4JI4K 4X66K 3O9UA 1TAQA 4DSFA 3QETA 3SBGA 4BR5A 4AHVA 4DQRA 3D6RA 1NKBA 3D0PA 4CHZA 3L3VA 5EX5A 1LOTB 3T1YK 2IVPA 3S3MA 3FZMA 3PY8A 4RTFD 1VSMA 4WQ5C 1UOCA 3UKRA 1KAYA 4B8CA 5LJWA 4AF1A 4AHSA 5J2MA 3H1VX 1I39A 1KVAA 4ID1A 2NZTA 4K8ZA 3QESA 5AQUA 3DLEA 4AHCA 1OH5A 3VQ8A 2QKBA 1WSGA 4BG9A 2QWQA 1MWKA 4BRFA 1XHZA 4CHQA 3UKRB 5J2QA 1VQ6N 4CHOA 4IOAL 4J2EA 2HHVA 3QEPA 3HZ6A 3NMUA 1RDUA 2DFEA 2NRRA 2P5GA 3K59A 2VQEK 5MLCQ 3U3YA 2YNGA 3W0LA 4KTZA 2YJFA 4JI6K 4F4KA 4BDYA 4O8UA 4DR3K 1RT1A 1NBWA 2CH6A 4FZYA 4DR4K 3SBTA 4JD2A 3GDQA 3KVGA 3AO5A 4A5BA 4IZ9A 2WTUA 4M3TA 4LFBK 4FM2A 4Z4HA 2F9WA 3L0QA 1X9MA 3KD1E 4JD2B 4PHTX 2HHSA 2UXBK 1WN7A 1E4FT 4WYBA 4IXCA 4DSKA 1BOTO 1RT5A 1TV6A 4DU4A 4JEPA 1QTMA 4CGGA 3TWHA 3H6EA 1KSPA 3O4QA 1KVBA 4N47A 1DEJA 4FLVA 2O8FA 1U48A 4H5RA 3EY1A 4CJPA 4FVMA 4CD1A 3CC4N 4CK2A 4EZ9A 4A5AA 2BGGA 1GOAA 1K8KA 1VQ7N 4UQGA 4YHHK 5JVGL 3BP8A 1WB9A 2Q1NA 1QS4A 4BRDA 2O8FB 3VGMA 1NGBA 5FPMA 2H3GX 1A5WA 5CZ2A 3U8XA 1NGCA 3G25A 4KH5A 3K5NA 4KPYA 4OPAA 4LFAK 4CK3A 3HOSA 1T03A 3LM9A 1RTIA 3RMDA 4Y1DA 1WAJA 5F2RA 5BN8A 4WFNL 3VGLA 2QWLA 5HRRA 1RDCA 4ISGA 4FLXA 3K5MA 4E19A 5KRTA 1ILYA 3PSIA 4Z4FA 5FPEA 3CCQN 4LSLA 1HJOA 2YNIA 3O6WA 4Q5VA 2NLXA 1MDUB 2A42A 4CZHA 3ZCMA 3DLGA 3TANA 3ULDA 3J81O 3WXMB 2YKNA 4BE2A 1LW2A 1GLCG 4AM6A 3DWLA 4H4MA 2QA4N 3KKRA 2RN2A 1T8EA 3RRGA 1REVA 1RTDA 4LF8K 3P1GA 3KK1A 3H1QA 1U45A 5M1NA 1J5OA 3QNOA 3VQ5A 5LL6Z 2G8UA 3JAMO 1Q18A 3CJ1A 3CD6N 3HT3A 4N5SA 4FJ7A 3OYAA 3D45A 4IJAA 2ASPA 5HROA 3RSEA 1BHLA 4EP5A 4BR7A 3V9UA 4CZKA 1OH8A 3NE6A 3QB0A 1RBSA 3I8DA 3OVNA 4Y1CA 3BF1A 4F2RA 4DHYA 3RSEB 3I8BA 1S5JA 1V4TA 3V6DA 4XH4A 1S9GA 4NXMK 1ZBIA 4FWNA 4KTQA 3PLAA 5FPNA 4G1QA 4QAGA 2QWNA 5AZJA 2ITMA 5FRNA 2VG7A 2BTFA 2HW3A 5T7BA 5AQTA 1RCHA 3SQ2A 1KVCA 4BRPA 4E7HA 4ILJA 5CE3A 3IMXA 3MWPA 3I55N 3ZT2A 3VQ4A 1Z25A 5AZJB 4CEBA 3MXMA 1GOCA 4FZXC 4FVUA 2HHQA 3HXMA 3PX0A 4LF7K 3SLCA 1JLGA 1VHXA 1WOQA 4M3RA 4FOIA 4CK1A 3NGIA 4DTPA 2NNWA 4ILHA 2GWJA 1JLAA 4IDHA 4CIGA 1EWRA 2VQFK 4I7FA 2FXUA 3VTIA 3FFKB 2JWLA 3QDKA 1YHQN 1JCEA 1ITGA 5DM6L 3FGUA 5KGXA 4O55A 1YXQA 2Q0RA 4YOVA 1JXBA 4FZZA 4B1XB 1X3NA 1WBDA 4CF1A 1HMVA 1VSJA 1UWBA 3AV9A 4CERA 3HP6A 1NGHA 3ZSXA 3QBXA 3DLKA 1QHAA 4GW6A 4M3ZA 4I9QA 5J1EA 1VQLN 1HPMA 1NJWA 1KTQA 1XQSC 4UY8O 4LD0A 4CF0A 3CCSN 3DLRA 3DXKA 3HYFA 3VEZA 1J6ZA 1G99A 2P9NA 3IRXA 1KFSA 4C8NA 3LL3A 3TAFA 1HYZA 2E2PA 2WBNA 2FF6A 4HCBA 1EX4A 3J7YP 5FROA 1X9WA 3DXKB 3O08A 3D2FA 4Q0BA 5SWMA 2P9NB 5DMRA 3HSTB 4O8KA 1KQSM 1Q82O 1XWLA 1TYQA 2X6SA 3NCIA 5A2QO 4BC5A 4C23A 2HSTA 4DFKA 3D2FB 3DMJA 4C8MA 1NGDA 3LM2A 3DLLL 2QW9A 1BCOA 1XC9A 2E20A 3KK3A 3F73A 3CJBA 1TYQB 2Y1IA 1S1XA 1HQEA 4ISFA 1GOBA 1N6QA 1VAZA 2KFNA 5AQQA 5AFUA 4PKGA 1XMQK 3CFPA 2P9PA 5C24A 1NLVA 1TUUA 2PAVA 1NJZA 4DF8A 3MMVA 5C10A 1C0UA 2GEMA 2HBJA 4DQPA 2R7YA 1T6DA 3ZYYX 3SAHA 3NVMA 3P4IA 4CESA 3VQPA 3BZKA 5ADXH 2IS3A 3KZBA 2P9PB 1Q86O 5C0YA 2XY7A 4PUOA 5AQHA 3HP9A 3T1AA 2FSKA 1ZBUA 4YFUA 1K9MO 4GKKK 1VQ8N 4IOCL 3SMSA 3MX5A 1NKCA 3LZJA 3MEDA 4RWTA 3AVHA 3U6FA 3T69A 4CBUA 3JSMA 3EO3A 2Q2RA 2FBXA 3WNFA 3ALYA 3NH0A 4JK7A 4BR4A 1M90O 4AQYK 3MXIA 1SUQA 1X9JA 2V7YA 3LALA 1S1VA 3PO5A 3PIPL 1VSFA 4NLCA 2Q31A 5BRDA 4B9MA 3QINA 3WXKA 1V4SA 2ZJPL 2QWMA 5AQVA 1WAFA 2O8EA 1RDAA 1KCFA 1WNSA 1S1WA 2D1KA 3FE1A 4EIAA 4M3XA 1K6YA 2F96A 4Y0WA 3ZT3A 5IT9O 2F4VK 1KAZA 3OYNA 4FK2A 1C6VA 4M3YA 2O8EB 3V1RA 3O9QA 1I94K 1G15A 4GNIA 1RBRA 4H5WA 3OYGA 5C2DA 4A61A 3HO1A 1VSHA 3LAMA 1HYVA 2YV0X 4PL7A 2OA8A 3KJVA 4DQSA 1LWEA 1VRTA 5I9EB 3AGKA 3SYZA 2B4JA 1NMNA 3TTCA 4IO9L 1NM1A 3PIOL 4DU3A 1KLNA 4LSNA 5AZIB 3TR8A 4IFVA 4GV3A 3OTOK 5KQ8A 2HBKA 2UUBK 2KZZA 2DPNA 2QEXN 4ID5A 3SJHA 4L8RB 4FK0A 3KK2A 4C8LA 2P9LA 4OGCA 4LF4K 3O1BA 5GIOA 5AQSA 2I7PA 3EL2A 4B9SA 4CGJA 4ELVA 3DXMA 2WOMA 1ZBFA 3A5LC 3M1FA 4CJRA 4EP4A 4FOEA 3EE8A 3VENA 1BGXT 3AO1A 2P9LB 4ILGB 2Q3SA 3HTVA 4BG8A 4GVMA 5C12A 3GBTA 4F3TA 1OVYA 4JKFA 3DXMB 3CCMN 4DG1A 1JLFA 3QNNA 4K8XA 4LF5K 2F8SA 3T7ZA 3CCRN 3ZT1A 1LW0A 4ZTJA 4A2AA 4XIUA 2KW4A 2OCEA 1WBBA 2HVIA 3HJFA 3WQUA 3QFUA 1EP4A 5AQMA 3O4WA 2W40A 2E88A 2E4LA 3J8AA 5EY4A 2QTDA 5IWAK 1BQNA 2HNDA 4JS5A 1HR0K 2WUSA 1F21A 4I2QA 1RBUA 4BRNA 3AO2A 4KH4A 3C0BA 4M63C 4KAZA 2CH5A 3LPTA 2O8DA 4B3RK 2DY4A 2HHUA 1EETA 3NGZA 4LH5A 1HNXK 2HBMA 4O4GA 3Q7BA 3ULEA 4IFYA 2NRWA 4IDKA 1UA0A 4FWMA 3CF5L 3QIPA 3C7NA 4DV2K 2D0CA 5BRFA 3LDLA 2O8DB 3QLHA 3A5OC 1JCFA 1W0HA 3EKUA 5HOOA 3ULEB 3CCLN 5AFUH 4BRMA 1GLBG 2HB5A 3AVJA 4RW4A 4E89A 1YF5L 3AGRA 3C7NB 3ZETA 1L3TA 4DB3A 2HF3A 3AARA 3AO3A 2NRXA 4X65K 3VESA 4CEZA 4JKHA 4M41A 4MDBA 4OPKA 1VSIA 4DV7K 3LANA 3IS9A 3NF6A 3ZETB 2KTQA 5HRNA 1RGIA 2VCPA 1EO1A 3BGRA 3CMEN 1Z6RA 1N5YA 4C8OA 2HF4A 4KFBA 4CHPA 4W5RA 1IO2A 3ZSQA 4ISEA 3K5LA 3LDQA 1WLJA 4FWLA 4FWQA 2OTLN 3EEQA 4BRAA 1NGAA 4PKIA 2B6AA 1S1UA 1NKEA 2IGIA 3LZIA 2Y1JA 1YVNA 4BGBA 5C25A 4H5NA 3SQ1A 3OY9A 3THXA 4YORA 3O5BA 3J80O 3VN5A 1QQNA 3G0ZA 4DR7K 1T7PA 3THWA 3SV4A 5B8HA 1NK0A 4HTUA 5TKWA 3P31A 3AY9A 1ZYQA 5AQOA 3THXB 1VQ4N 2IVOA 3SUPA 1VQ5N 3TSQA 5GAHP 1HNWK 5M1PA 5FPDA 4YY3K 4H4OA 1NU0A 4DR1K 3DRSA 1ZC6A 3VGKA 3OYIA 5BR9A 3THWB 4N41A 1WSJA 2I7NA 2HNYA 4NO7A 3S3OA 3O80A 4AHTA 1Q81O 4KHSA 3LWMA 1E4GT 3OYDA 3DJCA 3VTHA 3HVRA 4DV5K 5GINA 1ASUA 2KHOA 2NRHA 4J8FA 2WC9A 1RTJA 2ZJRL 3WNEA 4NCGA 4B1UB 1GLLO 3KLGA 3LP0A 3OA9A 2Z1JA 3VQ7A 3VQEA 2F9TA 4CVNE 4CFCA 2O8CA 3QMLA 4OLBA 2RF2A 4N56A 2G8IA 4J2AA 3B8AX 1T3VA 4CEOA 3HOTA 1LWCA 5JLHA 5AQLA 4DUYK 3NVKA 2X74A 1YJNN 2V52B 2O8CB 3V9XA 4NYFA 1C1CA 4GV6A 4I6MA 4B08A 2A41A 3BEXA 1L3VA 4IWVA 5KRSA 2G8FA 5BPMA 3CC2N 2YCHA 4Z4EA 1L5UA 4I6MB 4B3SK 3OBYA 2XRIA 5SZTA 4BE0A 4M45A 3ZSOA 3SQ4A 2E6LA 4QOZB 3T1HK 4IEEA 3IUCA 2VWJA 4HHTA 4CJ7A 1B92A 1BIZA 3AVLA 3C6HA 1ZXOA 3T3FA 3DI6A 4JKDA 1SL0A 2RPIA 2YI1A 4CJ4A 3AVNA 4E7JA 2NUBA 5KTQA 4H0OA 5GAEP 3I33A 5E41A 1FJGK 4CJFA 4RW7A 4FYDA 3QERA 4B9TA 4FLWA 4FM0A 4DLEA 1T6CA 4H03B 2XY8A 3CQXA 4V19S 4YOYA 2P9UA 3RMBA 4ICLA 4WQ4A 3V9WA 4GV9A 4MQ3A 3OS1A 1RBVA 4CHYA 4XH1A 3V4IA 4CJLA 1ESVA 4WF9L 3E9PA 3H3OB 1YUWA 4JI1K 4N76A 5DK5A 2P9UB 4DFMA 4BGAA 1TL1A 3OYFA 3EZWA 4FJXA 4CE9A 1K73O 3JYTA 2IC3A 1OVQA 3E9LA 4DFJA 5FRMA 3HI0A 3AVIA 1S6QA 4F8RA 2DTUA 2ZD1A 2D0AA 3E66A 3WXLA 3SPZA 5LY3A 2KLAA 4M7XA 5F1XA 3DLBA 3KLFA 3UIQA 3W3DA 1SKWA 3CM6A 1ASWA 1IKVA 3AVBA 4B9LA 1RT7A 3CJAA 1TVRA 2XO7A 4AILC 3S3NA 3CFRA 1KD1O 3QO9A 3DOKA 1RTHA 5CYQA 1BDGA 1RFQA 3QEWA 4DTMA 1NMDA 2Z1IA 3OHRA 4DTRA 1B9DA 4JRPA 3S9HA 4KRFA 2KKZA 4JRQA 4MFBA 3AA2A 1NNEA 1RT3A 3FZFA 1HJRA 3VQ9A 1JJ2M 1P90A 2PZSA 1RNHA 4NXNK 3O1WA 4NB4A 2BUPA 3FZLA 3MN9A 2HNZA 1YVUA 3O9SA 1GLEG 5JVHL 1SZ2A 1U6ZA 1NGEA 1ZBSA 4DSIA 4IG3A 2ZJQL 3H45C 1QE1A 3NF7A 3BUZB 4FJ8A 3KLIA 3KTQA 1Q8IA 1VQ9N 1KC8O 3AO4A 1X3MA 2IOCA 4KB1A 1J5EK 4DSEA 1RDBA 4BRKA 4ZTFA 3VEWA 4BY9C 1J53A 1Y64A 3CM5A 4YDUC 1W2BM 3HPGA 1NK5A 4JKBA 1DKGD 5LJVA 4BDZA 3TAPA 1BL3A 5J2NA 2HVHA 1NG9A 3PO4A 2DFHA 3MX2A 4YNQA 1TKZA 3VEXA 1C1AA 4LFCK 3H3NO 1BUPA 4LC9B 2O4IA 1JLCA 1QVFM 5K14A 1TL3A 2WONA 2V7ZA 3C95A 2FSNA 1TK5A 1UA1A 3B6PA 3VQCA 3HL8A 2LSNA 3OYLA 4MLHA 4PY5A 2B5JA 1HKGA 4CBWA 4KHNA 1VSKA 1OH6A 2QWRA 3MCAB 4FWKA 5JS2A 3F2KA 1EQYA 3DAWA 2ZGYA 4DSLA 4FLTA 1HUXA 3C6TA 3TAMA 2UUCK 1Y97A 2P9IA 5DM7L 4KB0A 4CEEA 4DFPA 4CF9A 4DV4K 4FJNA 1DGKN 1IH7A 3L6QA 3O9TA 4BC2A 5GIPA 3RVCA 1NOZA 3ZSVA 5KI6A 4PWDA 3MCPA 2WFBA 4CI6A 1U49A 3WXJA 1RILA 2P9IB 2P1JA 3J7AP 4FPBA 4AM7A 3CJ9A 3ZX3A 3K2PA 3ID8A 3N4PA 4KHQA 1WUAA 4KHPK 3ZX0A 3CMAN 4IFEA 3U9DA 3ATVA 4A62A 4FJ5A 1UAXA 4CJQA 1NGIA 2ETJA 3WXIA 3AVMA 4BREA 1IJJA 2JGUA 4K25A 1TK0A 1S1TA 2BH1A 4IJNA 3LDPA 2A1SA 1YTUA 5C15A 3OYBA 3HBTA 3IAYA 4A2BA 3F9MA 2AJQA 1OKJA 3L2QA 3NF9A 4CJEA 5HLFA 3QICA 4FJGA 2W42A 4RW8A 3WQTA 3L2UA 2IIRA 2VWKA 1WSHA 4CEAA 2FLOA 3ISNC 3RMAA 2OTJN 3MN5A 3NGYA 3G6EN 3QEXA 4DR2K 1GLDG 3VERA 4W5QA 4AHRA 4KHUA 2ATQA 2YHWA 3GOIA 3CQYA 4CEDA 1KFDA 4FL9A 2QXLA 3OJUA 1RDDA 3SI6A 2OANA 1EXQA 5GADP 3TU5A 1W7AA 2NRZA 3TI0A 5BREA 2E2QA 1NGGA 1XUPO 4OO1J 3KWIA 2O8BA 4DTOA 1JL1A 2OPRA 5AZIA 3MXJA 3AVCA 1XI1A 1YAGA 4BC4A 5E26A 4H0TB 2ZE2A 3IDHA 1T44A 1U4BA 5GAGP 4TSXA 5BN9A 2O8BB 4XH5A 1FKOA 1FK9A 3NBPA 3H46O 3WNGA 2NRTA 1O1WA 4FPAA 3U9ZA 4CGDA 3RR7A 3SJJA 3CPWM 2VGNA 3ITHA 3N4QA 4QS9A 3OW2M 3AVFA 1KXPA 3IKMA 4JV5K 1SL2A 2W6KA 1QQMA 4CEQA 2GBZA 4GKJK 3SMPA 4OPJA 2EWSA 1TK8A 3R3LA 2QK9A 4IOXA 2ZF5O 4BR9A 4ELUA 1YT3A 4K41A 3AAQA 2GUIA 4JKCA 4CCHA 3UKUA 4CZMA 1N32K 2RKIA 3HVTA 5KPZA 5EU7A 4FWOA 4BRLA 3V81A 4W5NA 3EKSA 4B1ZA 3L3UA 3VOVA 1RT6A 2EX3A 3VPZA 3J7ZO 1IBLK 4EFHA 3UKUB 4X62K 4DU1A 4JS4A 4CIEA 4M3UA 4DV1K 1VQPN 3CCEN 4YOXA 3MEGA 3ATUA 3PSFA 4FWRA 3KLHA 2CGLA 3I0SA 5AQPA 1BWFO 4BE1A 1TAUA 3NFAA 3RTVA 1YITN 2PYLA 3MECA 4Z94A 3AA4A 1BQMA 5BPLA 4ELTA 3SUQA 1A5VA 1NWKA 1A5XA 4M7YA 4CF2A 1LV5A 1ZBHA 3L4IA 3T19A 3LDSA 3DYAA 5E84A 3CERA 1HNZK 3VEVA 3TAQA 1GLFO 2JLEA 4BWJA 4AHUA 3L2RA 4FK4A 4DTXA 3OS2A 1HKBA 1C0FA 3C6AA 4CJKA 1WSEA 3M8RA 3P38A 3ZSZA 4DV3K 1SQKA 3CJCA 3NH2A 5JS1A 3GE1A 1XC3A 3NHGA 4JAXA 4BR0A 1MA9B 3CCVN 2E6MA 1RDWX 3DLHA 3A5NC 2QM1A 1N33K 3VEOA 1NOYA 1L3SA 4JI8K 2D0OA 3OBWA 1ATRA 5CHIA 2VWBA 3VMFB 5LMNK 4CD3A 3CPEA 5ELZA 4A59A 5I3UA 1J54A 3P5JA 1LWFA 4FJIA 4XEIA 5EVZA 2FBVA 3E9OA 3RR8A 4K42A 2DFFA 3OS0A 4CIFA 2KZMA 1RT4A 4J2BA 4HUEA 3TAEA 1U47A 5F0XA 4WQ4C 3PX6A 5C42A 1BISA 5JICA 2BE2A 3M5RA 3ID6A 3SZ2A 4E1NA 2FBTA 1YIJN 3OYJA 3UE5A 2YHXA 2GX9A 4RW6A 5M1FA 4B9NA 4WFAL 1TUYA 5M1QA 4PQUA 4JK9A 1D4XA 1S3XA 5AQRA 4BRQA 2AP1A 1WSIA 2YNFA 1TGOA 3AVKA 2GUPA 4O44A 4ZHRA 4HTLA 3HK2A 3BDPA 3FLCO 4H0VB 4Z4CA 2HHTA 1DTQA 1QSYA 2FBYA 1X1PA 2V51B 3NAEA 3RMCA 1Z05A 4HCCA 3SUNA 2GTDA 3BY5A 1S72N 4OGEA 3L2WA 4CZLA 2BDPA 4KI4A 4BQLA 2OZMA 1JLBA 2YX6A 3U4LA 2P5OA 4BQZA 3ASMA 4FW2A 3TSUA 1O13A 1P8ZA 4B3TK 3CHWA 4H0XB 4CJVA 4B9VA 1D8YA 3MDQA 4FW1A 4EAHD 1HYSA 3OYEA 2KFZA 3L8BA 4F9OA 4BRCA 3E01A 1L3UA 2HHHK 4RW9A 4CZJA 1IKXA 4F3OA 5LMUK 4DSJA 1N34K 3SPYA 1CZ9A 3R8EA 3QIOA 1IG8A 2CGJA 4QS7A 4OKJA 3AVAA 4H8KA 4U67L 4KI6A 2PFUA 1N8RO 1TKXA 1VQKN 5BR8K 3LP2A
chains in the Genus database with same CATH topology
4BWMA 2A1RA 3V1OA 1RT3A 3AVHA 3IG1A 3U6FA 1HJRA 3JSMA 3VQ9A 2VG5A 3C6UA 1FKPA 4QCLA 1JKHA 2FBXA 2PZSA 1RNHA 3ALYA 3WNFA 1Q9XA 1VSDA 1BI4A 1Z26A 3NH0A 4CGFA 4FJ9A 4OKEA 4W5TA 4M42A 2XHBA 3MXIA 1SV5A 1SUQA 1YVUA 2HNZA 3SUQA 1Q9YA 3LALA 1S1VA 3VQAA 4LY7A 3PO5A 1JLEA 1VSFA 2YHAA 4DSIA 4IG3A 5KGWA 4CJ3A 2G8WA 2YHBA 1W9HA 3P83D 1QHTA 4CJTA 3FFIA 4B9MA 4E7KA 4DTNA 1S6PA 3QINA 3VQDA 1QE1A 3HM9A 3NF7A 4DQIA 2HHWA 5HP1A 1NK6A 1HRHA 2OYQA 4FJ8A 1BI4B 3B6OA 3HPHA 3KLIA 3KTQA 1Q8IA 1WAFA 2OPQA 1KLMA 1RDAA 1KCFA 3AO4A 4IKFA 1WNSA 1S1WA 3KLEA 4KREA 5FDLA 1DTTA 4CEFA 2G8VA 1K6YA 2IOCA 3NF8A 3PX4A 1KRPA 1U04A 4DSEA 1ZBLA 3OYKA 4KB1A 2F96A 4C8KA 1RDBA 4ZTFA 4B8AB 1D5AA 3ZT3A 4Z4IA 2OPSA 1J53A 1J9AA 3CM5A 4DQQA 3OYNA 4J2DA 4LH4A 4FK2A 4Z0UA 1BIUA 1C6VA 3HPGA 1NK5A 2OZSA 4HUGA 4M3YA 3V1RA 3VQBA 3OYMA 1G15A 3A2FA 4BDZA 1RBRA 3C94A 3OYGA 4B9UA 1LAVA 5HBMA 1VSLA 2ITGA 3TAPA 1BL3A 5J2NA 3HO1A 4FJKA 2HVHA 1VSHA 3LAMA 3PO4A 1HYVA 2DFHA 4YNQA 1TKZA 1TAQA 2YV0X 4DSFA 4BDPA 1C1AA 3QETA 2OA8A 3KJVA 4AHVA 1CZBA 4DQRA 1NKBA 2O4IA 3D0PA 1LWEA 1VRTA 1JLCA 4CHZA 5K14A 4DQSA 3L3VA 2G8KA 1TKTA 1TL3A 2B4JA 2WONA 3C95A 3SYZA 3SNNA 3S3MA 1TK5A 1UA1A 4DU3A 3B6PA 3VQCA 3PY8A 3HL8A 2LSNA 1KLNA 4LSNA 3TR8A 1VSMA 4IFVA 3OYLA 3LP1A 4PY5A 2KZZA 1UOCA 2HMIA 2B5JA 4ID5A 4L8RB 4FK0A 1NK9A 4KHNA 4KO0A 3KK2A 4C8LA 4B8CA 1VSKA 4AHSA 4BACA 5J2MA 5J2PA 1JXEA 4OGCA 4NYNA 1I39A 1KVAA 5JS2A 2ZQBA 4ID1A 2Z1HA 4K8ZA 1MU2A 3QESA 4DSLA 3DLEA 4AHCA 4FLTA 4B9SA 3C6TA 3TAMA 3VQ8A 3H08A 1Y97A 4CGJA 2X78A 4ELVA 1D9FA 2QKBA 1RT2A 1WSGA 2WOMA 1ZBFA 4CJRA 1D9DA 4KB0A 4CEEA 4EP4A 4DFPA 4CF9A 4CHQA 1XHZA 5J2QA 4CHOA 4J2EA 1BGXT 3AO1A 4FJNA 2HHVA 1IH7A 3QEPA 2X6NA 2Q3SA 1NOZA 2DFEA 2QKKA 4I2PA 3ZSVA 4GVMA 5KI6A 2P5GA 3K59A 4PWDA 4O5BA 4F3TA 3OYCA 3U3YA 4FLYA 2YNGA 4CGIA 4DG1A 1U49A 3LP2A 3LPUA 4EZ6A 2EHGA 1RILA 1JLFA 2P1JA 4KTZA 1SKSA 2PYJA 3K2PA 2VG6A 4KHQA 4F4KA 3QNNA 4BDYA 4K8XA 1RT1A 2F8SA 4CJSA 4FZYA 3SQ0A 4FJ5A 1UAXA 4KKOA 4CJQA 2ETJA 3ZT1A 4FJHA 3AO5A 3KD5E 1LW0A 1VK0A 4ZTJA 3AVMA 4R5PA 4XIUA 3VQQA 2KW4A 4M3TA 2JGUA 4DMNA 4FM2A 2HVIA 1TK0A 1S1TA 4Z4GA 3HJFA 1EP4A 4Z4HA 4F2SA 4FLUA 2A1SA 5CZ1A 4E3SA 1YTUA 1X9MA 3OYBA 3KD1E 3IAYA 2E4LA 2HHSA 1WN7A 1BQNA 4DTUA 2HNDA 4JS5A 5D3GA 4DSKA 2AJQA 1RT5A 3L2QA 1HNVA 1TV6A 3NF9A 4CJEA 4DU4A 4FJJA 5HLFA 1QSSA 1F21A 4I2QA 4FJGA 1QTMA 1RBUA 4CGGA 2W42A 3AO2A 4RW8A 3TWHA 3L2UA 1KSPA 4KAZA 3O4QA 1KVBA 3LPTA 4N47A 4DS5A 4FLVA 2DY4A 2HHUA 1EETA 3NGZA 3ZSWA 1U48A 2VWKA 4LH5A 1WSHA 4CEAA 3EY1A 4CJPA 4FVMA 4O4GA 1NJXA 1X9SA 3ISNC 3O3HA 3RMAA 4IFYA 4CK2A 3NGYA 4IDKA 2IDOA 1UA0A 3K58A 3QEXA 4EZ9A 4DTSA 2BGGA 1GOAA 3QIPA 4UQGA 3VQ6A 4W5QA 2D0CA 4AHRA 3TAGA 4KHUA 2ATQA 4KHWA 3QLHA 4CEDA 1QS4A 1KFDA 3V9ZA 1W0HA 1A5WA 5CZ2A 3SI6A 3OJUA 1RDDA 4I9LA 1EXQA 3K5NA 4KPYA 3O4NA 4RW4A 2HB5A 3AVJA 4CK3A 4E89A 3TI0A 3O3GA 4ELTA 1T03A 3ZT0A 3NDKA 3MAQA 1RTIA 4CFAA 3RMDA 1L3TA 4Y1DA 3ZSYA 1WAJA 3AO3A 1HPZA 5HRRA 4DTOA 1RDCA 1JL1A 4CEZA 2YKMA 4FLXA 3OYHA 3DRPA 3LAKA 2OPRA 4M41A 3K5MA 4OPKA 4E19A 5I42A 3MXJA 3AVCA 1VSIA 5KRTA 1XI1A 4OJRA 4GMJB 4DTJA 4Z4FA 4LSLA 4FJLA 2I5JA 3LANA 3IS9A 3SUOA 4AH9A 3NF6A 2YNIA 2ZE2A 5HRNA 2KTQA 4Q5VA 1U4BA 4TSXA 4NCAA 2IAJA 3BGRA 4DF4A 1FKOA 1FK9A 1IKWA 4O0JA 3CQ8A 4E7LA 3NBPA 1N5YA 3ZCMA 4C8OA 3DLGA 3WNGA 3TANA 1B9FA 2QXFA 4CHPA 4KFBA 3ULDA 1O1WA 4W5RA 4CGDA 2YKNA 1IO2A 4BE2A 3ZSQA 3RR7A 1DLOA 3M8SA 3DM2A 3K5LA 3SJJA 3CFOA 1WLJA 1T05A 1LW2A 4DLGA 3ITHA 4DWIA 4M3WA 4KHYA 3AVFA 2B6AA 1S1UA 3SCXA 1NKEA 4H4MA 2IGIA 3KKRA 2RN2A 3CG7A 4CEQA 1T8EA 2GBZA 3LZIA 2Y1JA 1SL2A 3RRGA 1REVA 5C25A 1RTDA 4OPJA 3SV3A 3P1GA 3KK1A 1U45A 1TK8A 1J5OA 3QNOA 2QK9A 3VQ5A 3SQ1A 3L2VA 2G8UA 3OY9A 4ELUA 1YT3A 3VN5A 3HT3A 2GUIA 4N5SA 4FJ7A 5HRPA 2FC0A 4OKKA 3OYAA 3G0ZA 4CCHA 1TKDA 3WNHA 1T7PA 3D45A 3LWLA 4E1MA 2KQ2A 3SV4A 1NK0A 5HROA 4HTUA 2RKIA 1ZYQA 3HVTA 5EU7A 3V81A 3EZ5A 4W5NA 4CJUA 3TABA 3SUPA 1BHLA 4EP5A 3L3UA 3V9UA 4H4OA 3VA0A 1RT6A 2EX3A 3DRSA 4B3OA 3NE6A 3OYIA 3F9KA 4N41A 1RBSA 1WSJA 2HNYA 3I8DA 3OVNA 4Y1CA 4DU1A 4FCYA 4JS4A 4AHTA 4CIEA 3S3OA 3LWMA 4KHSA 3OYDA 4F2RA 4IG0A 1SL1A 4M3UA 2O4GA 3I0RA 1C0TA 3HPOA 3HVRA 3MEGA 1S5JA 1ASUA 3KLHA 2BANA 3I0SA 3OJSA 1S9GA 4BE1A 3V6DA 1TAUA 1ZBIA 3NFAA 3RTVA 2XY5A 3RRHA 2PYLA 3MECA 1RTJA 4CF8A 4KTQA 3WNEA 3AA4A 4G1QA 1RBTA 1BQMA 4NCGA 3M8PA 4OVLA 4QAGA 3ZSRA 1A5VA 4W5OA 3AA5X 3LP0A 1A5XA 3KLGA 2VG7A 4CF2A 3PV8A 1LV5A 1HQUA 5FRNA 1ZBHA 3T19A 3LDSA 2HW3A 3DYAA 3M8QA 2Z1JA 3VQ7A 3VQEA 2HHXA 5T7BA 4FM1A 5CY4A 1RCHA 3TAQA 2JLEA 4E7IA 4CFCA 3SQ2A 1KVCA 4BWJA 5CYMA 4OLBA 4AHUA 4E7HA 2RF2A 4N56A 1NJYA 1WSFA 3L2RA 2G8IA 4J2AA 4FK4A 4CEOA 3ZT2A 4DTXA 3VQ4A 3OS2A 1Z25A 4CEBA 3VA3A 3MXMA 1GOCA 1LWCA 4FZXC 4JLHA 2HHQA 3HXMA 4CJKA 1WSEA 3M8RA 3PX0A 3MEDA 1JLGA 3ZSZA 2X74A 4M3RA 4CK1A 3NGIA 1NK7A 4FLZA 1JL2A 4O0IA 3NH2A 4DTPA 4FXDA 5JS1A 1JLAA 4CIGA 3V9XA 4NYFA 1C1CA 4I7FA 3NHGA 4KTWA 4B08A 1R0AA 1NK4A 2E6MA 1ITGA 3V9SA 3DLHA 3KIOA 4WE1A 4CHNA 1L3VA 1ASVA 5KGXA 1CXUA 4O55A 5KRSA 3NH1A 1SKRA 1L3SA 1NOYA 2G8FA 1C0MA 4RG8A 4CECA 4KV8A 1JXBA 3LP3A 4FZZA 4Z4EA 4PA1A 1L5UA 1XHXA 3TARA 4CF1A 3RWUA 5I3UA 1VRUA 1HMVA 1J54A 3P5JA 1VSJA 1UWBA 1LWFA 3AV9A 4CERA 3AVGA 3ZSXA 3O3FA 3DLKA 4GW6A 2XRIA 4FJIA 5SZTA 2FBVA 1BCMA 4BE0A 4I9QA 4M3ZA 4M45A 5J1EA 3ZSOA 4HUFA 3RR8A 4IBNA 3SQ4A 2DFFA 3OS0A 4CIFA 1NJWA 1RT4A 3U3GA 4J2BA 2KZMA 1KTQA 2E6LA 4QOZB 1QQCA 4HUEA 3TAEA 4LD0A 2VWJA 1U47A 3QEIA 4HHTA 3PX6A 3PUFA 1B92A 1BIZA 3AVLA 4CF0A 3CYMA 4CFDA 5C42A 4CGHA 3DLRA 3HYFA 3T3FA 3DI6A 1JLQA 1SL0A 2RPIA 2D5RA 3IRXA 1KFSA 1BISA 2P51A 2BE2A 4C8NA 4CJ4A 4HVJA 3SZ2A 3TAFA 1HYZA 3AVNA 3ZT4A 4E1NA 2NUBA 5KTQA 4E7JA 2FBTA 4HCBA 4NCBA 1EX4A 5E41A 3OYJA 5FROA 4CJFA 4RW7A 4FYDA 3KKSA 3QERA 4B9TA 4RW6A 4FLWA 1X9WA 4FM0A 4CJWA 4DLEA 1HNIA 3EYZA 4Q0BA 5SWMA 4FJMA 4B9NA 2XY8A 5DMRA 3RMBA 4PQUA 3HSTB 4ICLA 4OLAA 3V9WA 3K57A 3G10A 3AA3A 1LAWA 1XWLA 2X6SA 3NCIA 4MQ3A 1WSIA 2YNFA 1TGOA 3AVKA 3OS1A 1RBVA 2D0BA 4CHYA 4O44A 4M3XA 2F8TA 4ZHRA 4DS4A 3V4IA 3BDPA 3HK2A 2HHTA 4Z4CA 1DTQA 1VSEA 4CJLA 1QSYA 2FBYA 1X1PA 4DFKA 3DMJA 3NAEA 3RMCA 4C8MA 1FXXA 4N76A 5DK5A 4DFMA 1BCOA 1XC9A 4HCCA 3SUNA 1TL1A 3KK3A 3F73A 3THVA 2Y1IA 3DRRA 4OGEA 3L2WA 1S1XA 1HQEA 1EKEA 2BDPA 3OYFA 1GOBA 4KI4A 3K5OA 1N6QA 4FJXA 4CE9A 2YNHA 2OZMA 3JYTA 2KFNA 1S9EA 2IC3A 1JLBA 3CFPA 4DFJA 5FRMA 2P5OA 5C24A 1NJZA 1I3AA 3ASMA 4FW2A 3AVIA 1S6QA 4CFBA 4DF8A 2OPPA 4F8RA 2DTUA 2ZD1A 3MEEA 1C0UA 2D0AA 4CJVA 2XY6A 1D8YA 1QSLA 4B9VA 4DQPA 1CLQA 2R7YA 4FW1A 3SPZA 3QEVA 1HYSA 1IKYA 3OYEA 3DLBA 3KLFA 3UIQA 4CESA 1CXQA 3VQPA 1SKWA 2KFZA 3DOLA 3L8BA 1NK8A 3CM6A 2IS3A 1ASWA 3E01A 4RW9A 5HRSA 1IKVA 3AVBA 1L3UA 1IKXA 2XY7A 4B9LA 1RT7A 1YTAA 4F3OA 4PUOA 2G8HA 1TVRA 4DSJA 3HP6A 2PY5A 2XO7A 3HP9A 3T1AA 4AILC 3S3NA 2Z1GA 1ZBUA 3CFRA 3QO9A 3SPYA 3DOKA 1RTHA 5CYQA 3V1QA 4YFUA 1IG9A 1CZ9A 3QEWA 4DTMA 3QIOA 2Z1IA 4DTRA 1B9DA 4OKJA 4E0DA 1C1BA 4JRPA 2GV9A 3AVAA 3S9HA 4H8KA 4CJ5A 1NKCA 4KI6A 4KRFA 1TKXA 3LZJA 4JRQA 4MFBA 3AA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWM A;  2A1R A;  3V1O A;  1RT3 A;  3AVH A;  3IG1 A;  3U6F A;  1HJR A;  3JSM A;  3VQ9 A;  2VG5 A;  3C6U A;  1FKP A;  4QCL A;  1JKH A;  2FBX A;  2PZS A;  1RNH A;  3ALY A;  3WNF A;  1Q9X A;  1VSD A;  1BI4 A;  1Z26 A;  3NH0 A;  4CGF A;  4FJ9 A;  4OKE A;  4W5T A;  4M42 A;  2XHB A;  3MXI A;  1SV5 A;  1SUQ A;  1YVU A;  2HNZ A;  3SUQ A;  1Q9Y A;  3LAL A;  1S1V A;  3VQA A;  4LY7 A;  3PO5 A;  1JLE A;  1VSF A;  2YHA A;  4DSI A;  4IG3 A;  5KGW A;  4CJ3 A;  2G8W A;  2YHB A;  1W9H A;  3P83 D;  1QHT A;  4CJT A;  3FFI A;  4B9M A;  4E7K A;  4DTN A;  1S6P A;  3QIN A;  3VQD A;  1QE1 A;  3HM9 A;  3NF7 A;  4DQI A;  2HHW A;  5HP1 A;  1NK6 A;  1HRH A;  2OYQ A;  4FJ8 A;  1BI4 B;  3B6O A;  3HPH A;  3KLI A;  3KTQ A;  1Q8I A;  1WAF A;  2OPQ A;  1KLM A;  1RDA A;  1KCF A;  3AO4 A;  4IKF A;  1WNS A;  1S1W A;  3KLE A;  4KRE A;  5FDL A;  1DTT A;  4CEF A;  2G8V A;  1K6Y A;  2IOC A;  3NF8 A;  3PX4 A;  1KRP A;  1U04 A;  4DSE A;  1ZBL A;  3OYK A;  4KB1 A;  2F96 A;  4C8K A;  1RDB A;  4ZTF A;  4B8A B;  1D5A A;  3ZT3 A;  4Z4I A;  2OPS A;  1J53 A;  1J9A A;  3CM5 A;  4DQQ A;  3OYN A;  4J2D A;  4LH4 A;  4FK2 A;  4Z0U A;  1BIU A;  1C6V A;  3HPG A;  1NK5 A;  2OZS A;  4HUG A;  4M3Y A;  3V1R A;  3VQB A;  3OYM A;  1G15 A;  3A2F A;  4BDZ A;  1RBR A;  3C94 A;  3OYG A;  4B9U A;  1LAV A;  5HBM A;  1VSL A;  2ITG A;  3TAP A;  1BL3 A;  5J2N A;  3HO1 A;  4FJK A;  2HVH A;  1VSH A;  3LAM A;  3PO4 A;  1HYV A;  2DFH A;  4YNQ A;  1TKZ A;  1TAQ A;  2YV0 X;  4DSF A;  4BDP A;  1C1A A;  3QET A;  2OA8 A;  3KJV A;  4AHV A;  1CZB A;  4DQR A;  1NKB A;  2O4I A;  3D0P A;  1LWE A;  1VRT A;  1JLC A;  4CHZ A;  5K14 A;  4DQS A;  3L3V A;  2G8K A;  1TKT A;  1TL3 A;  2B4J A;  2WON A;  3C95 A;  3SYZ A;  3SNN A;  3S3M A;  1TK5 A;  1UA1 A;  4DU3 A;  3B6P A;  3VQC A;  3PY8 A;  3HL8 A;  2LSN A;  1KLN A;  4LSN A;  3TR8 A;  1VSM A;  4IFV A;  3OYL A;  3LP1 A;  4PY5 A;  2KZZ A;  1UOC A;  2HMI A;  2B5J A;  4ID5 A;  4L8R B;  4FK0 A;  1NK9 A;  4KHN A;  4KO0 A;  3KK2 A;  4C8L A;  4B8C A;  1VSK A;  4AHS A;  4BAC A;  5J2M A;  5J2P A;  1JXE A;  4OGC A;  4NYN A;  1I39 A;  1KVA A;  5JS2 A;  2ZQB A;  4ID1 A;  2Z1H A;  4K8Z A;  1MU2 A;  3QES A;  4DSL A;  3DLE A;  4AHC A;  4FLT A;  4B9S A;  3C6T A;  3TAM A;  3VQ8 A;  3H08 A;  1Y97 A;  4CGJ A;  2X78 A;  4ELV A;  1D9F A;  2QKB A;  1RT2 A;  1WSG A;  2WOM A;  1ZBF A;  4CJR A;  1D9D A;  4KB0 A;  4CEE A;  4EP4 A;  4DFP A;  4CF9 A;  4CHQ A;  1XHZ A;  5J2Q A;  4CHO A;  4J2E A;  1BGX T;  3AO1 A;  4FJN A;  2HHV A;  1IH7 A;  3QEP A;  2X6N A;  2Q3S A;  1NOZ A;  2DFE A;  2QKK A;  4I2P A;  3ZSV A;  4GVM A;  5KI6 A;  2P5G A;  3K59 A;  4PWD A;  4O5B A;  4F3T A;  3OYC A;  3U3Y A;  4FLY A;  2YNG A;  4CGI A;  4DG1 A;  1U49 A;  3LP2 A;  3LPU A;  4EZ6 A;  2EHG A;  1RIL A;  1JLF A;  2P1J A;  4KTZ A;  1SKS A;  2PYJ A;  3K2P A;  2VG6 A;  4KHQ A;  4F4K A;  3QNN A;  4BDY A;  4K8X A;  1RT1 A;  2F8S A;  4CJS A;  4FZY A;  3SQ0 A;  4FJ5 A;  1UAX A;  4KKO A;  4CJQ A;  2ETJ A;  3ZT1 A;  4FJH A;  3AO5 A;  3KD5 E;  1LW0 A;  1VK0 A;  4ZTJ A;  3AVM A;  4R5P A;  4XIU A;  3VQQ A;  2KW4 A;  4M3T A;  2JGU A;  4DMN A;  4FM2 A;  2HVI A;  1TK0 A;  1S1T A;  4Z4G A;  3HJF A;  1EP4 A;  4Z4H A;  4F2S A;  4FLU A;  2A1S A;  5CZ1 A;  4E3S A;  1YTU A;  1X9M A;  3OYB A;  3KD1 E;  3IAY A;  2E4L A;  2HHS A;  1WN7 A;  1BQN A;  4DTU A;  2HND A;  4JS5 A;  5D3G A;  4DSK A;  2AJQ A;  1RT5 A;  3L2Q A;  1HNV A;  1TV6 A;  3NF9 A;  4CJE A;  4DU4 A;  4FJJ A;  5HLF A;  1QSS A;  1F21 A;  4I2Q A;  4FJG A;  1QTM A;  1RBU A;  4CGG A;  2W42 A;  3AO2 A;  4RW8 A;  3TWH A;  3L2U A;  1KSP A;  4KAZ A;  3O4Q A;  1KVB A;  3LPT A;  4N47 A;  4DS5 A;  4FLV A;  2DY4 A;  2HHU A;  1EET A;  3NGZ A;  3ZSW A;  1U48 A;  2VWK A;  4LH5 A;  1WSH A;  4CEA A;  3EY1 A;  4CJP A;  4FVM A;  4O4G A;  1NJX A;  1X9S A;  3ISN C;  3O3H A;  3RMA A;  4IFY A;  4CK2 A;  3NGY A;  4IDK A;  2IDO A;  1UA0 A;  3K58 A;  3QEX A;  4EZ9 A;  4DTS A;  2BGG A;  1GOA A;  3QIP A;  4UQG A;  3VQ6 A;  4W5Q A;  2D0C A;  4AHR A;  3TAG A;  4KHU A;  2ATQ A;  4KHW A;  3QLH A;  4CED A;  1QS4 A;  1KFD A;  3V9Z A;  1W0H A;  1A5W A;  5CZ2 A;  3SI6 A;  3OJU A;  1RDD A;  4I9L A;  1EXQ A;  3K5N A;  4KPY A;  3O4N A;  4RW4 A;  2HB5 A;  3AVJ A;  4CK3 A;  4E89 A;  3TI0 A;  3O3G A;  4ELT A;  1T03 A;  3ZT0 A;  3NDK A;  3MAQ A;  1RTI A;  4CFA A;  3RMD A;  1L3T A;  4Y1D A;  3ZSY A;  1WAJ A;  3AO3 A;  1HPZ A;  5HRR A;  4DTO A;  1RDC A;  1JL1 A;  4CEZ A;  2YKM A;  4FLX A;  3OYH A;  3DRP A;  3LAK A;  2OPR A;  4M41 A;  3K5M A;  4OPK A;  4E19 A;  5I42 A;  3MXJ A;  3AVC A;  1VSI A;  5KRT A;  1XI1 A;  4OJR A;  4GMJ B;  4DTJ A;  4Z4F A;  4LSL A;  4FJL A;  2I5J A;  3LAN A;  3IS9 A;  3SUO A;  4AH9 A;  3NF6 A;  2YNI A;  2ZE2 A;  5HRN A;  2KTQ A;  4Q5V A;  1U4B A;  4TSX A;  4NCA A;  2IAJ A;  3BGR A;  4DF4 A;  1FKO A;  1FK9 A;  1IKW A;  4O0J A;  3CQ8 A;  4E7L A;  3NBP A;  1N5Y A;  3ZCM A;  4C8O A;  3DLG A;  3WNG A;  3TAN A;  1B9F A;  2QXF A;  4CHP A;  4KFB A;  3ULD A;  1O1W A;  4W5R A;  4CGD A;  2YKN A;  1IO2 A;  4BE2 A;  3ZSQ A;  3RR7 A;  1DLO A;  3M8S A;  3DM2 A;  3K5L A;  3SJJ A;  3CFO A;  1WLJ A;  1T05 A;  1LW2 A;  4DLG A;  3ITH A;  4DWI A;  4M3W A;  4KHY A;  3AVF A;  2B6A A;  1S1U A;  3SCX A;  1NKE A;  4H4M A;  2IGI A;  3KKR A;  2RN2 A;  3CG7 A;  4CEQ A;  1T8E A;  2GBZ A;  3LZI A;  2Y1J A;  1SL2 A;  3RRG A;  1REV A;  5C25 A;  1RTD A;  4OPJ A;  3SV3 A;  3P1G A;  3KK1 A;  1U45 A;  1TK8 A;  1J5O A;  3QNO A;  2QK9 A;  3VQ5 A;  3SQ1 A;  3L2V A;  2G8U A;  3OY9 A;  4ELU A;  1YT3 A;  3VN5 A;  3HT3 A;  2GUI A;  4N5S A;  4FJ7 A;  5HRP A;  2FC0 A;  4OKK A;  3OYA A;  3G0Z A;  4CCH A;  1TKD A;  3WNH A;  1T7P A;  3D45 A;  3LWL A;  4E1M A;  2KQ2 A;  3SV4 A;  1NK0 A;  5HRO A;  4HTU A;  2RKI A;  1ZYQ A;  3HVT A;  5EU7 A;  3V81 A;  3EZ5 A;  4W5N A;  4CJU A;  3TAB A;  3SUP A;  1BHL A;  4EP5 A;  3L3U A;  3V9U A;  4H4O A;  3VA0 A;  1RT6 A;  2EX3 A;  3DRS A;  4B3O A;  3NE6 A;  3OYI A;  3F9K A;  4N41 A;  1RBS A;  1WSJ A;  2HNY A;  3I8D A;  3OVN A;  4Y1C A;  4DU1 A;  4FCY A;  4JS4 A;  4AHT A;  4CIE A;  3S3O A;  3LWM A;  4KHS A;  3OYD A;  4F2R A;  4IG0 A;  1SL1 A;  4M3U A;  2O4G A;  3I0R A;  1C0T A;  3HPO A;  3HVR A;  3MEG A;  1S5J A;  1ASU A;  3KLH A;  2BAN A;  3I0S A;  3OJS A;  1S9G A;  4BE1 A;  3V6D A;  1TAU A;  1ZBI A;  3NFA A;  3RTV A;  2XY5 A;  3RRH A;  2PYL A;  3MEC A;  1RTJ A;  4CF8 A;  4KTQ A;  3WNE A;  3AA4 A;  4G1Q A;  1RBT A;  1BQM A;  4NCG A;  3M8P A;  4OVL A;  4QAG A;  3ZSR A;  1A5V A;  4W5O A;  3AA5 X;  3LP0 A;  1A5X A;  3KLG A;  2VG7 A;  4CF2 A;  3PV8 A;  1LV5 A;  1HQU A;  5FRN A;  1ZBH A;  3T19 A;  3LDS A;  2HW3 A;  3DYA A;  3M8Q A;  2Z1J A;  3VQ7 A;  3VQE A;  2HHX A;  5T7B A;  4FM1 A;  5CY4 A;  1RCH A;  3TAQ A;  2JLE A;  4E7I A;  4CFC A;  3SQ2 A;  1KVC A;  4BWJ A;  5CYM A;  4OLB A;  4AHU A;  4E7H A;  2RF2 A;  4N56 A;  1NJY A;  1WSF A;  3L2R A;  2G8I A;  4J2A A;  4FK4 A;  4CEO A;  3ZT2 A;  4DTX A;  3VQ4 A;  3OS2 A;  1Z25 A;  4CEB A;  3VA3 A;  3MXM A;  1GOC A;  1LWC A;  4FZX C;  4JLH A;  2HHQ A;  3HXM A;  4CJK A;  1WSE A;  3M8R A;  3PX0 A;  3MED A;  1JLG A;  3ZSZ A;  2X74 A;  4M3R A;  4CK1 A;  3NGI A;  1NK7 A;  4FLZ A;  1JL2 A;  4O0I A;  3NH2 A;  4DTP A;  4FXD A;  5JS1 A;  1JLA A;  4CIG A;  3V9X A;  4NYF A;  1C1C A;  4I7F A;  3NHG A;  4KTW A;  4B08 A;  1R0A A;  1NK4 A;  2E6M A;  1ITG A;  3V9S A;  3DLH A;  3KIO A;  4WE1 A;  4CHN A;  1L3V A;  1ASV A;  5KGX A;  1CXU A;  4O55 A;  5KRS A;  3NH1 A;  1SKR A;  1L3S A;  1NOY A;  2G8F A;  1C0M A;  4RG8 A;  4CEC A;  4KV8 A;  1JXB A;  3LP3 A;  4FZZ A;  4Z4E A;  4PA1 A;  1L5U A;  1XHX A;  3TAR A;  4CF1 A;  3RWU A;  5I3U A;  1VRU A;  1HMV A;  1J54 A;  3P5J A;  1VSJ A;  1UWB A;  1LWF A;  3AV9 A;  4CER A;  3AVG A;  3ZSX A;  3O3F A;  3DLK A;  4GW6 A;  2XRI A;  4FJI A;  5SZT A;  2FBV A;  1BCM A;  4BE0 A;  4I9Q A;  4M3Z A;  4M45 A;  5J1E A;  3ZSO A;  4HUF A;  3RR8 A;  4IBN A;  3SQ4 A;  2DFF A;  3OS0 A;  4CIF A;  1NJW A;  1RT4 A;  3U3G A;  4J2B A;  2KZM A;  1KTQ A;  2E6L A;  4QOZ B;  1QQC A;  4HUE A;  3TAE A;  4LD0 A;  2VWJ A;  1U47 A;  3QEI A;  4HHT A;  3PX6 A;  3PUF A;  1B92 A;  1BIZ A;  3AVL A;  4CF0 A;  3CYM A;  4CFD A;  5C42 A;  4CGH A;  3DLR A;  3HYF A;  3T3F A;  3DI6 A;  1JLQ A;  1SL0 A;  2RPI A;  2D5R A;  3IRX A;  1KFS A;  1BIS A;  2P51 A;  2BE2 A;  4C8N A;  4CJ4 A;  4HVJ A;  3SZ2 A;  3TAF A;  1HYZ A;  3AVN A;  3ZT4 A;  4E1N A;  2NUB A;  5KTQ A;  4E7J A;  2FBT A;  4HCB A;  4NCB A;  1EX4 A;  5E41 A;  3OYJ A;  5FRO A;  4CJF A;  4RW7 A;  4FYD A;  3KKS A;  3QER A;  4B9T A;  4RW6 A;  4FLW A;  1X9W A;  4FM0 A;  4CJW A;  4DLE A;  1HNI A;  3EYZ A;  4Q0B A;  5SWM A;  4FJM A;  4B9N A;  2XY8 A;  5DMR A;  3RMB A;  4PQU A;  3HST B;  4ICL A;  4OLA A;  3V9W A;  3K57 A;  3G10 A;  3AA3 A;  1LAW A;  1XWL A;  2X6S A;  3NCI A;  4MQ3 A;  1WSI A;  2YNF A;  1TGO A;  3AVK A;  3OS1 A;  1RBV A;  2D0B A;  4CHY A;  4O44 A;  4M3X A;  2F8T A;  4ZHR A;  4DS4 A;  3V4I A;  3BDP A;  3HK2 A;  2HHT A;  4Z4C A;  1DTQ A;  1VSE A;  4CJL A;  1QSY A;  2FBY A;  1X1P A;  4DFK A;  3DMJ A;  3NAE A;  3RMC A;  4C8M A;  1FXX A;  4N76 A;  5DK5 A;  4DFM A;  1BCO A;  1XC9 A;  4HCC A;  3SUN A;  1TL1 A;  3KK3 A;  3F73 A;  3THV A;  2Y1I A;  3DRR A;  4OGE A;  3L2W A;  1S1X A;  1HQE A;  1EKE A;  2BDP A;  3OYF A;  1GOB A;  4KI4 A;  3K5O A;  1N6Q A;  4FJX A;  4CE9 A;  2YNH A;  2OZM A;  3JYT A;  2KFN A;  1S9E A;  2IC3 A;  1JLB A;  3CFP A;  4DFJ A;  5FRM A;  2P5O A;  5C24 A;  1NJZ A;  1I3A A;  3ASM A;  4FW2 A;  3AVI A;  1S6Q A;  4CFB A;  4DF8 A;  2OPP A;  4F8R A;  2DTU A;  2ZD1 A;  3MEE A;  1C0U A;  2D0A A;  4CJV A;  2XY6 A;  1D8Y A;  1QSL A;  4B9V A;  4DQP A;  1CLQ A;  2R7Y A;  4FW1 A;  3SPZ A;  3QEV A;  1HYS A;  1IKY A;  3OYE A;  3DLB A;  3KLF A;  3UIQ A;  4CES A;  1CXQ A;  3VQP A;  1SKW A;  2KFZ A;  3DOL A;  3L8B A;  1NK8 A;  3CM6 A;  2IS3 A;  1ASW A;  3E01 A;  4RW9 A;  5HRS A;  1IKV A;  3AVB A;  1L3U A;  1IKX A;  2XY7 A;  4B9L A;  1RT7 A;  1YTA A;  4F3O A;  4PUO A;  2G8H A;  1TVR A;  4DSJ A;  3HP6 A;  2PY5 A;  2XO7 A;  3HP9 A;  3T1A A;  4AIL C;  3S3N A;  2Z1G A;  1ZBU A;  3CFR A;  3QO9 A;  3SPY A;  3DOK A;  1RTH A;  5CYQ A;  3V1Q A;  4YFU A;  1IG9 A;  1CZ9 A;  3QEW A;  4DTM A;  3QIO A;  2Z1I A;  4DTR A;  1B9D A;  4OKJ A;  4E0D A;  1C1B A;  4JRP A;  2GV9 A;  3AVA A;  3S9H A;  4H8K A;  4CJ5 A;  1NKC A;  4KI6 A;  4KRF A;  1TKX A;  3LZJ A;  4JRQ A;  4MFB A;  3AA2 A; 
#chains in the Genus database with same CATH topology
 4X64 K;  2VG5 A;  4QCL A;  1JKH A;  2UXC K;  4JN4 A;  1VSD A;  4IO8 A;  3MWT A;  4MO4 A;  4FJ9 A;  4W5T A;  4M42 A;  2J4R A;  2XHB A;  3K9J A;  1Q9Y A;  3ZLJ A;  3CC7 N;  2GEL A;  2A3Z A;  1BA0 A;  2YHA A;  3ZEU A;  5AQW A;  2G8W A;  3C65 A;  1W9H A;  3P83 D;  1QHT A;  4CJT A;  3FFI A;  5KPR A;  3D7E O;  4E7K A;  1S6P A;  3HM9 A;  2HHW A;  1HRH A;  2OYQ A;  3B6O A;  1XMO K;  2OPQ A;  2A6A A;  5EOY A;  1Q7Y O;  4IKF A;  1YJW N;  3KLE A;  5FDL A;  4CEF A;  2G8V A;  1KRP A;  3NF8 A;  2QWO A;  1U04 A;  3ZEU B;  5EXW A;  3OYK A;  4C8K A;  4CZF A;  4B8A B;  1D5A A;  4CBX A;  4BRH A;  4WFB L;  1J9A A;  1K8K B;  4DQQ A;  4LH4 A;  1BIU A;  5FLX O;  4LF6 K;  4HUG A;  3O8M A;  3VQB A;  3A2F A;  3C94 A;  2ASO A;  4B9U A;  1LAV A;  5HBM A;  1BG3 A;  2ITG A;  4OPH A;  3HM8 A;  4FJK A;  2E1Z A;  3M6G A;  1FW6 A;  2E1Y A;  4JI7 K;  4BDP A;  4H5T A;  1CZB A;  5ADX A;  2ZGZ A;  3FR0 A;  2G8K A;  1HKC A;  1TKT A;  3SNN A;  5AQZ A;  3CI5 A;  3KWG A;  4H5V A;  2UU9 K;  3LP1 A;  3FZK A;  2HMI A;  3D2E A;  1NK9 A;  2ZWH A;  4KO0 A;  4BAC A;  1JXE A;  4NYN A;  4DKW A;  4LF9 K;  2ZQB A;  2Z1H A;  1MU2 A;  1QQO A;  3BZC A;  3H08 A;  2X78 A;  5JLF A;  1D9F A;  1RT2 A;  4BVO A;  3D2E B;  1D9D A;  1LCU A;  3Q7C A;  4JNE A;  4BRG A;  2X6N A;  4OX9 K;  4WQ5 A;  2QKK A;  4I2P A;  3R9P A;  2IVN A;  2E2N A;  4O5B A;  5BRH A;  3OYC A;  4FLY A;  4CGI A;  3LPU A;  4EZ6 A;  2EHG A;  1SKS A;  2PYJ A;  1C0G A;  5JMV A;  2VG6 A;  4JI2 K;  4JKE A;  4CJS A;  1IBM K;  3SQ0 A;  1KAX A;  4K0K K;  5KQD A;  4KKO A;  4DQ8 A;  4FJH A;  3KD5 E;  3VF4 A;  1VK0 A;  4R5P A;  5AQX A;  3VQQ A;  2W6L A;  4JI5 K;  4DMN A;  3GG4 A;  4Z4G A;  5AQI A;  4F2S A;  4FLU A;  5CZ1 A;  4YOT A;  5C2F A;  4E3S A;  4BR2 A;  1GLA G;  4DTU A;  1HX1 A;  5D3G A;  3CET A;  1HNV A;  4R79 A;  4FJJ A;  1QSS A;  4B1Y B;  2PBD A;  3AAP A;  4DS5 A;  1HLU A;  3ZSW A;  3G71 N;  5BPN A;  1NJX A;  1X9S A;  4E1J A;  3O3H A;  2VYP A;  2IDO A;  1SAZ A;  3K58 A;  4DTS A;  3TTF A;  3VQ6 A;  3TAG A;  4JKA A;  4KHW A;  3MK6 A;  1MWM A;  4NLB A;  3V9Z A;  2Q36 A;  4I9L A;  5HL7 L;  3GL1 A;  1XNR K;  3O4N A;  3THY A;  4CZI A;  3O3G A;  3ZT0 A;  3NDK A;  3MAQ A;  4CFA A;  3F5T A;  3ZSY A;  1NJI O;  1HPZ A;  2YKM A;  3OYH A;  3DRP A;  3LAK A;  3VF2 A;  5I42 A;  2Q0U A;  4GMJ B;  4OJR A;  4DTJ A;  1SS6 A;  4FJL A;  2I5J A;  3THY B;  3SUO A;  1YJ9 N;  1JCG A;  5TKY A;  4AH9 A;  3SAG A;  4NCA A;  2A5X A;  4B1W B;  2IAJ A;  4DF4 A;  4O0J A;  3ENO A;  1IKW A;  3CQ8 A;  4E7L A;  3IFR A;  2UXD K;  1BO5 O;  2HMP A;  1B9F A;  2QXF A;  4EHT A;  1DLO A;  3M8S A;  3DM2 A;  3CFO A;  1T05 A;  4DLG A;  2NRV A;  1R59 O;  4DWI A;  4M3W A;  4KHY A;  1NGJ A;  3SCX A;  3CG7 A;  2CGK A;  2UYT A;  2ZM6 K;  3SV3 A;  3HRG A;  3EE9 A;  3L2V A;  3VEY A;  5CR4 A;  1CZA N;  3QBW A;  5HRP A;  2FC0 A;  4OKK A;  4B1V A;  1TKD A;  4FWP A;  1U2V A;  2AA4 A;  3WNH A;  3LWL A;  4E1M A;  2KQ2 A;  1VQM N;  3A8Y A;  3A5M C;  3TSP A;  3EZ5 A;  3UB5 A;  4CJU A;  3TAB A;  3CIP A;  4A57 A;  3R6M A;  3VA0 A;  4G9Z A;  4B3O A;  1U2V B;  1NGF A;  3F9K A;  3WT0 A;  4FCY A;  2HOE A;  4IG0 A;  1SL1 A;  2O4G A;  3I0R A;  1C0T A;  4H0Y B;  3HPO A;  1ATS A;  3O9R A;  2BAN A;  3JS6 A;  3OJS A;  1VQN N;  5AQG A;  2Q97 A;  3RRH A;  4MO5 A;  2XY5 A;  4CF8 A;  5J2P A;  1RBT A;  4OVL A;  4W5O A;  3M8P A;  3ZSR A;  2XY6 A;  1NK7 A;  3M3Z A;  3AA5 X;  3PV8 A;  4MDA A;  1HQU A;  4BRO A;  2HBL A;  3MN6 A;  3M8Q A;  2HHX A;  4FM1 A;  4L3Q A;  5CY4 A;  3CJ7 A;  4E7I A;  1H1V A;  5CYM A;  3EN9 A;  4WCE L;  1NJY A;  1WSF A;  3I56 N;  3VA3 A;  4JLH A;  2D0P A;  3KHY A;  3CXC M;  4DR5 K;  3E1Y A;  1JL2 A;  3FZH A;  4O0I A;  4FLZ A;  5H1S Q;  2FF3 B;  5AQK A;  1M1K O;  4FXD A;  3R1X A;  2E5L K;  4KTW A;  4O5F A;  2A40 A;  3SK3 A;  1R0A A;  3ENH A;  1NK4 A;  4KBO A;  3V9S A;  3KIO A;  4WE1 A;  5M1K A;  1QVG M;  4DUZ K;  3L4Q A;  4CHN A;  1ASV A;  1CXU A;  3NH1 A;  1SKR A;  1C0M A;  4RG8 A;  4CEC A;  4KV8 A;  3LP3 A;  5AQN A;  4PA1 A;  1XHX A;  3TAR A;  3RWU A;  2ASM A;  1VRU A;  4IEI A;  3A0I X;  3O3F A;  3AVG A;  1BCM A;  4CW7 B;  4HUF A;  5AQF A;  4DV0 K;  4IBN A;  4DV6 K;  3S41 A;  4DR6 K;  3U3G A;  3WEE A;  4JKG A;  1QQC A;  3QEI A;  4PL8 A;  3PUF A;  3ZX2 A;  3ENB A;  3CYM A;  3LDN A;  4CFD A;  4CGH A;  4BVP A;  1JLQ A;  1BA1 A;  2D5R A;  2P51 A;  3QFP A;  4HVJ A;  2YJE A;  3HSC A;  4JI0 K;  3ZT4 A;  3WEE B;  3MN7 A;  4JKG B;  1BU6 O;  4GY2 B;  4NCB A;  5KPT A;  4CZE A;  3KKS A;  4CJW A;  1HNI A;  3EYZ A;  4FJM A;  1QZ5 A;  1IBK K;  4KH6 A;  1QZ6 A;  4YDU A;  4OLA A;  3G4S N;  4BRI A;  3K57 A;  3G10 A;  3AA3 A;  1LAW A;  2D0B A;  2F8T A;  1OH7 A;  1YI2 N;  2P9S A;  4DS4 A;  4JYA K;  4HWI A;  1VSE A;  4C1N I;  1FXX A;  2JWK A;  1W97 L;  2UUA K;  2E2O A;  3THV A;  3K0S A;  3DRR A;  1EKE A;  1S22 A;  2D4W A;  3K5O A;  2P9S B;  2YNH A;  3VET A;  1S9E A;  4U7B A;  3CCU N;  1E3M A;  1I3A A;  3CCJ N;  5M1O A;  4CFB A;  1GLJ O;  2OPP A;  3MEE A;  1QSL A;  3TTD A;  1CLQ A;  1N36 K;  3QEV A;  1IKY A;  2E8A A;  2RE2 A;  1CXQ A;  3DOL A;  1NK8 A;  5HRS A;  1YTA A;  2G8H A;  2PY5 A;  2Z1G A;  3V1Q A;  1IG9 A;  5AQY A;  4BC3 A;  2W41 A;  1VQO N;  4E0D A;  1C1B A;  2GV9 A;  4CJ5 A;  1DT9 A;  1IV0 A;  4GVE A;  2FSJ A;  4BWM A;  2A1R A;  2VGM A;  2RHK A;  3V1O A;  2QI2 A;  3IG1 A;  3C6U A;  1FKP A;  4MLE A;  4JK8 A;  1Q9X A;  2P9K A;  1BI4 A;  1Z26 A;  5AJ3 K;  4CGF A;  4JHD A;  4OKE A;  1EWQ A;  1SV5 A;  1XNQ K;  3VQA A;  4LY7 A;  3SAF A;  1JLE A;  4FO0 A;  4CZG A;  5KGW A;  3K9K A;  4CJ3 A;  2YHY A;  2YHB A;  4FWS A;  4PKH A;  4EHU A;  4B9Q A;  4DTN A;  4DQI A;  3VQD A;  2QWP A;  3TPQ A;  5HP1 A;  2P9K B;  4RCH A;  1NK6 A;  1BI4 B;  3BF3 A;  3HPH A;  4B3M K;  4JI3 K;  4JHD B;  3VF6 A;  1KLM A;  1ATN A;  4YOW A;  4KRE A;  1DTT A;  3JXU A;  4H0P A;  4K43 A;  3LDO A;  3PX4 A;  3KK7 A;  1ZBL A;  4C1N K;  3P39 A;  4Z4I A;  4YOU A;  2GWK A;  2OPS A;  4J2D A;  2F7T A;  5AQJ A;  4Z0U A;  2OZS A;  4FSV A;  4DCH A;  3OYM A;  4QS8 A;  1VSL A;  1K8A O;  3WUH A;  5AR0 A;  4JI4 K;  4X66 K;  3O9U A;  1TAQ A;  4DSF A;  3QET A;  3SBG A;  4BR5 A;  4AHV A;  4DQR A;  3D6R A;  1NKB A;  3D0P A;  4CHZ A;  3L3V A;  5EX5 A;  1LOT B;  3T1Y K;  2IVP A;  3S3M A;  3FZM A;  3PY8 A;  4RTF D;  1VSM A;  4WQ5 C;  1UOC A;  3UKR A;  1KAY A;  4B8C A;  5LJW A;  4AF1 A;  4AHS A;  5J2M A;  3H1V X;  1I39 A;  1KVA A;  4ID1 A;  2NZT A;  4K8Z A;  3QES A;  5AQU A;  3DLE A;  4AHC A;  1OH5 A;  3VQ8 A;  2QKB A;  1WSG A;  4BG9 A;  2QWQ A;  1MWK A;  4BRF A;  1XHZ A;  4CHQ A;  3UKR B;  5J2Q A;  1VQ6 N;  4CHO A;  4IOA L;  4J2E A;  2HHV A;  3QEP A;  3HZ6 A;  3NMU A;  1RDU A;  2DFE A;  2NRR A;  2P5G A;  3K59 A;  2VQE K;  5MLC Q;  3U3Y A;  2YNG A;  3W0L A;  4KTZ A;  2YJF A;  4JI6 K;  4F4K A;  4BDY A;  4O8U A;  4DR3 K;  1RT1 A;  1NBW A;  2CH6 A;  4FZY A;  4DR4 K;  3SBT A;  4JD2 A;  3GDQ A;  3KVG A;  3AO5 A;  4A5B A;  4IZ9 A;  2WTU A;  4M3T A;  4LFB K;  4FM2 A;  4Z4H A;  2F9W A;  3L0Q A;  1X9M A;  3KD1 E;  4JD2 B;  4PHT X;  2HHS A;  2UXB K;  1WN7 A;  1E4F T;  4WYB A;  4IXC A;  4DSK A;  1BOT O;  1RT5 A;  1TV6 A;  4DU4 A;  4JEP A;  1QTM A;  4CGG A;  3TWH A;  3H6E A;  1KSP A;  3O4Q A;  1KVB A;  4N47 A;  1DEJ A;  4FLV A;  2O8F A;  1U48 A;  4H5R A;  3EY1 A;  4CJP A;  4FVM A;  4CD1 A;  3CC4 N;  4CK2 A;  4EZ9 A;  4A5A A;  2BGG A;  1GOA A;  1K8K A;  1VQ7 N;  4UQG A;  4YHH K;  5JVG L;  3BP8 A;  1WB9 A;  2Q1N A;  1QS4 A;  4BRD A;  2O8F B;  3VGM A;  1NGB A;  5FPM A;  2H3G X;  1A5W A;  5CZ2 A;  3U8X A;  1NGC A;  3G25 A;  4KH5 A;  3K5N A;  4KPY A;  4OPA A;  4LFA K;  4CK3 A;  3HOS A;  1T03 A;  3LM9 A;  1RTI A;  3RMD A;  4Y1D A;  1WAJ A;  5F2R A;  5BN8 A;  4WFN L;  3VGL A;  2QWL A;  5HRR A;  1RDC A;  4ISG A;  4FLX A;  3K5M A;  4E19 A;  5KRT A;  1ILY A;  3PSI A;  4Z4F A;  5FPE A;  3CCQ N;  4LSL A;  1HJO A;  2YNI A;  3O6W A;  4Q5V A;  2NLX A;  1MDU B;  2A42 A;  4CZH A;  3ZCM A;  3DLG A;  3TAN A;  3ULD A;  3J81 O;  3WXM B;  2YKN A;  4BE2 A;  1LW2 A;  1GLC G;  4AM6 A;  3DWL A;  4H4M A;  2QA4 N;  3KKR A;  2RN2 A;  1T8E A;  3RRG A;  1REV A;  1RTD A;  4LF8 K;  3P1G A;  3KK1 A;  3H1Q A;  1U45 A;  5M1N A;  1J5O A;  3QNO A;  3VQ5 A;  5LL6 Z;  2G8U A;  3JAM O;  1Q18 A;  3CJ1 A;  3CD6 N;  3HT3 A;  4N5S A;  4FJ7 A;  3OYA A;  3D45 A;  4IJA A;  2ASP A;  5HRO A;  3RSE A;  1BHL A;  4EP5 A;  4BR7 A;  3V9U A;  4CZK A;  1OH8 A;  3NE6 A;  3QB0 A;  1RBS A;  3I8D A;  3OVN A;  4Y1C A;  3BF1 A;  4F2R A;  4DHY A;  3RSE B;  3I8B A;  1S5J A;  1V4T A;  3V6D A;  4XH4 A;  1S9G A;  4NXM K;  1ZBI A;  4FWN A;  4KTQ A;  3PLA A;  5FPN A;  4G1Q A;  4QAG A;  2QWN A;  5AZJ A;  2ITM A;  5FRN A;  2VG7 A;  2BTF A;  2HW3 A;  5T7B A;  5AQT A;  1RCH A;  3SQ2 A;  1KVC A;  4BRP A;  4E7H A;  4ILJ A;  5CE3 A;  3IMX A;  3MWP A;  3I55 N;  3ZT2 A;  3VQ4 A;  1Z25 A;  5AZJ B;  4CEB A;  3MXM A;  1GOC A;  4FZX C;  4FVU A;  2HHQ A;  3HXM A;  3PX0 A;  4LF7 K;  3SLC A;  1JLG A;  1VHX A;  1WOQ A;  4M3R A;  4FOI A;  4CK1 A;  3NGI A;  4DTP A;  2NNW A;  4ILH A;  2GWJ A;  1JLA A;  4IDH A;  4CIG A;  1EWR A;  2VQF K;  4I7F A;  2FXU A;  3VTI A;  3FFK B;  2JWL A;  3QDK A;  1YHQ N;  1JCE A;  1ITG A;  5DM6 L;  3FGU A;  5KGX A;  4O55 A;  1YXQ A;  2Q0R A;  4YOV A;  1JXB A;  4FZZ A;  4B1X B;  1X3N A;  1WBD A;  4CF1 A;  1HMV A;  1VSJ A;  1UWB A;  3AV9 A;  4CER A;  3HP6 A;  1NGH A;  3ZSX A;  3QBX A;  3DLK A;  1QHA A;  4GW6 A;  4M3Z A;  4I9Q A;  5J1E A;  1VQL N;  1HPM A;  1NJW A;  1KTQ A;  1XQS C;  4UY8 O;  4LD0 A;  4CF0 A;  3CCS N;  3DLR A;  3DXK A;  3HYF A;  3VEZ A;  1J6Z A;  1G99 A;  2P9N A;  3IRX A;  1KFS A;  4C8N A;  3LL3 A;  3TAF A;  1HYZ A;  2E2P A;  2WBN A;  2FF6 A;  4HCB A;  1EX4 A;  3J7Y P;  5FRO A;  1X9W A;  3DXK B;  3O08 A;  3D2F A;  4Q0B A;  5SWM A;  2P9N B;  5DMR A;  3HST B;  4O8K A;  1KQS M;  1Q82 O;  1XWL A;  1TYQ A;  2X6S A;  3NCI A;  5A2Q O;  4BC5 A;  4C23 A;  2HST A;  4DFK A;  3D2F B;  3DMJ A;  4C8M A;  1NGD A;  3LM2 A;  3DLL L;  2QW9 A;  1BCO A;  1XC9 A;  2E20 A;  3KK3 A;  3F73 A;  3CJB A;  1TYQ B;  2Y1I A;  1S1X A;  1HQE A;  4ISF A;  1GOB A;  1N6Q A;  1VAZ A;  2KFN A;  5AQQ A;  5AFU A;  4PKG A;  1XMQ K;  3CFP A;  2P9P A;  5C24 A;  1NLV A;  1TUU A;  2PAV A;  1NJZ A;  4DF8 A;  3MMV A;  5C10 A;  1C0U A;  2GEM A;  2HBJ A;  4DQP A;  2R7Y A;  1T6D A;  3ZYY X;  3SAH A;  3NVM A;  3P4I A;  4CES A;  3VQP A;  3BZK A;  5ADX H;  2IS3 A;  3KZB A;  2P9P B;  1Q86 O;  5C0Y A;  2XY7 A;  4PUO A;  5AQH A;  3HP9 A;  3T1A A;  2FSK A;  1ZBU A;  4YFU A;  1K9M O;  4GKK K;  1VQ8 N;  4IOC L;  3SMS A;  3MX5 A;  1NKC A;  3LZJ A;  3MED A;  4RWT A;  3AVH A;  3U6F A;  3T69 A;  4CBU A;  3JSM A;  3EO3 A;  2Q2R A;  2FBX A;  3WNF A;  3ALY A;  3NH0 A;  4JK7 A;  4BR4 A;  1M90 O;  4AQY K;  3MXI A;  1SUQ A;  1X9J A;  2V7Y A;  3LAL A;  1S1V A;  3PO5 A;  3PIP L;  1VSF A;  4NLC A;  2Q31 A;  5BRD A;  4B9M A;  3QIN A;  3WXK A;  1V4S A;  2ZJP L;  2QWM A;  5AQV A;  1WAF A;  2O8E A;  1RDA A;  1KCF A;  1WNS A;  1S1W A;  2D1K A;  3FE1 A;  4EIA A;  4M3X A;  1K6Y A;  2F96 A;  4Y0W A;  3ZT3 A;  5IT9 O;  2F4V K;  1KAZ A;  3OYN A;  4FK2 A;  1C6V A;  4M3Y A;  2O8E B;  3V1R A;  3O9Q A;  1I94 K;  1G15 A;  4GNI A;  1RBR A;  4H5W A;  3OYG A;  5C2D A;  4A61 A;  3HO1 A;  1VSH A;  3LAM A;  1HYV A;  2YV0 X;  4PL7 A;  2OA8 A;  3KJV A;  4DQS A;  1LWE A;  1VRT A;  5I9E B;  3AGK A;  3SYZ A;  2B4J A;  1NMN A;  3TTC A;  4IO9 L;  1NM1 A;  3PIO L;  4DU3 A;  1KLN A;  4LSN A;  5AZI B;  3TR8 A;  4IFV A;  4GV3 A;  3OTO K;  5KQ8 A;  2HBK A;  2UUB K;  2KZZ A;  2DPN A;  2QEX N;  4ID5 A;  3SJH A;  4L8R B;  4FK0 A;  3KK2 A;  4C8L A;  2P9L A;  4OGC A;  4LF4 K;  3O1B A;  5GIO A;  5AQS A;  2I7P A;  3EL2 A;  4B9S A;  4CGJ A;  4ELV A;  3DXM A;  2WOM A;  1ZBF A;  3A5L C;  3M1F A;  4CJR A;  4EP4 A;  4FOE A;  3EE8 A;  3VEN A;  1BGX T;  3AO1 A;  2P9L B;  4ILG B;  2Q3S A;  3HTV A;  4BG8 A;  4GVM A;  5C12 A;  3GBT A;  4F3T A;  1OVY A;  4JKF A;  3DXM B;  3CCM N;  4DG1 A;  1JLF A;  3QNN A;  4K8X A;  4LF5 K;  2F8S A;  3T7Z A;  3CCR N;  3ZT1 A;  1LW0 A;  4ZTJ A;  4A2A A;  4XIU A;  2KW4 A;  2OCE A;  1WBB A;  2HVI A;  3HJF A;  3WQU A;  3QFU A;  1EP4 A;  5AQM A;  3O4W A;  2W40 A;  2E88 A;  2E4L A;  3J8A A;  5EY4 A;  2QTD A;  5IWA K;  1BQN A;  2HND A;  4JS5 A;  1HR0 K;  2WUS A;  1F21 A;  4I2Q A;  1RBU A;  4BRN A;  3AO2 A;  4KH4 A;  3C0B A;  4M63 C;  4KAZ A;  2CH5 A;  3LPT A;  2O8D A;  4B3R K;  2DY4 A;  2HHU A;  1EET A;  3NGZ A;  4LH5 A;  1HNX K;  2HBM A;  4O4G A;  3Q7B A;  3ULE A;  4IFY A;  2NRW A;  4IDK A;  1UA0 A;  4FWM A;  3CF5 L;  3QIP A;  3C7N A;  4DV2 K;  2D0C A;  5BRF A;  3LDL A;  2O8D B;  3QLH A;  3A5O C;  1JCF A;  1W0H A;  3EKU A;  5HOO A;  3ULE B;  3CCL N;  5AFU H;  4BRM A;  1GLB G;  2HB5 A;  3AVJ A;  4RW4 A;  4E89 A;  1YF5 L;  3AGR A;  3C7N B;  3ZET A;  1L3T A;  4DB3 A;  2HF3 A;  3AAR A;  3AO3 A;  2NRX A;  4X65 K;  3VES A;  4CEZ A;  4JKH A;  4M41 A;  4MDB A;  4OPK A;  1VSI A;  4DV7 K;  3LAN A;  3IS9 A;  3NF6 A;  3ZET B;  2KTQ A;  5HRN A;  1RGI A;  2VCP A;  1EO1 A;  3BGR A;  3CME N;  1Z6R A;  1N5Y A;  4C8O A;  2HF4 A;  4KFB A;  4CHP A;  4W5R A;  1IO2 A;  3ZSQ A;  4ISE A;  3K5L A;  3LDQ A;  1WLJ A;  4FWL A;  4FWQ A;  2OTL N;  3EEQ A;  4BRA A;  1NGA A;  4PKI A;  2B6A A;  1S1U A;  1NKE A;  2IGI A;  3LZI A;  2Y1J A;  1YVN A;  4BGB A;  5C25 A;  4H5N A;  3SQ1 A;  3OY9 A;  3THX A;  4YOR A;  3O5B A;  3J80 O;  3VN5 A;  1QQN A;  3G0Z A;  4DR7 K;  1T7P A;  3THW A;  3SV4 A;  5B8H A;  1NK0 A;  4HTU A;  5TKW A;  3P31 A;  3AY9 A;  1ZYQ A;  5AQO A;  3THX B;  1VQ4 N;  2IVO A;  3SUP A;  1VQ5 N;  3TSQ A;  5GAH P;  1HNW K;  5M1P A;  5FPD A;  4YY3 K;  4H4O A;  1NU0 A;  4DR1 K;  3DRS A;  1ZC6 A;  3VGK A;  3OYI A;  5BR9 A;  3THW B;  4N41 A;  1WSJ A;  2I7N A;  2HNY A;  4NO7 A;  3S3O A;  3O80 A;  4AHT A;  1Q81 O;  4KHS A;  3LWM A;  1E4G T;  3OYD A;  3DJC A;  3VTH A;  3HVR A;  4DV5 K;  5GIN A;  1ASU A;  2KHO A;  2NRH A;  4J8F A;  2WC9 A;  1RTJ A;  2ZJR L;  3WNE A;  4NCG A;  4B1U B;  1GLL O;  3KLG A;  3LP0 A;  3OA9 A;  2Z1J A;  3VQ7 A;  3VQE A;  2F9T A;  4CVN E;  4CFC A;  2O8C A;  3QML A;  4OLB A;  2RF2 A;  4N56 A;  2G8I A;  4J2A A;  3B8A X;  1T3V A;  4CEO A;  3HOT A;  1LWC A;  5JLH A;  5AQL A;  4DUY K;  3NVK A;  2X74 A;  1YJN N;  2V52 B;  2O8C B;  3V9X A;  4NYF A;  1C1C A;  4GV6 A;  4I6M A;  4B08 A;  2A41 A;  3BEX A;  1L3V A;  4IWV A;  5KRS A;  2G8F A;  5BPM A;  3CC2 N;  2YCH A;  4Z4E A;  1L5U A;  4I6M B;  4B3S K;  3OBY A;  2XRI A;  5SZT A;  4BE0 A;  4M45 A;  3ZSO A;  3SQ4 A;  2E6L A;  4QOZ B;  3T1H K;  4IEE A;  3IUC A;  2VWJ A;  4HHT A;  4CJ7 A;  1B92 A;  1BIZ A;  3AVL A;  3C6H A;  1ZXO A;  3T3F A;  3DI6 A;  4JKD A;  1SL0 A;  2RPI A;  2YI1 A;  4CJ4 A;  3AVN A;  4E7J A;  2NUB A;  5KTQ A;  4H0O A;  5GAE P;  3I33 A;  5E41 A;  1FJG K;  4CJF A;  4RW7 A;  4FYD A;  3QER A;  4B9T A;  4FLW A;  4FM0 A;  4DLE A;  1T6C A;  4H03 B;  2XY8 A;  3CQX A;  4V19 S;  4YOY A;  2P9U A;  3RMB A;  4ICL A;  4WQ4 A;  3V9W A;  4GV9 A;  4MQ3 A;  3OS1 A;  1RBV A;  4CHY A;  4XH1 A;  3V4I A;  4CJL A;  1ESV A;  4WF9 L;  3E9P A;  3H3O B;  1YUW A;  4JI1 K;  4N76 A;  5DK5 A;  2P9U B;  4DFM A;  4BGA A;  1TL1 A;  3OYF A;  3EZW A;  4FJX A;  4CE9 A;  1K73 O;  3JYT A;  2IC3 A;  1OVQ A;  3E9L A;  4DFJ A;  5FRM A;  3HI0 A;  3AVI A;  1S6Q A;  4F8R A;  2DTU A;  2ZD1 A;  2D0A A;  3E66 A;  3WXL A;  3SPZ A;  5LY3 A;  2KLA A;  4M7X A;  5F1X A;  3DLB A;  3KLF A;  3UIQ A;  3W3D A;  1SKW A;  3CM6 A;  1ASW A;  1IKV A;  3AVB A;  4B9L A;  1RT7 A;  3CJA A;  1TVR A;  2XO7 A;  4AIL C;  3S3N A;  3CFR A;  1KD1 O;  3QO9 A;  3DOK A;  1RTH A;  5CYQ A;  1BDG A;  1RFQ A;  3QEW A;  4DTM A;  1NMD A;  2Z1I A;  3OHR A;  4DTR A;  1B9D A;  4JRP A;  3S9H A;  4KRF A;  2KKZ A;  4JRQ A;  4MFB A;  3AA2 A;  1NNE A;  1RT3 A;  3FZF A;  1HJR A;  3VQ9 A;  1JJ2 M;  1P90 A;  2PZS A;  1RNH A;  4NXN K;  3O1W A;  4NB4 A;  2BUP A;  3FZL A;  3MN9 A;  2HNZ A;  1YVU A;  3O9S A;  1GLE G;  5JVH L;  1SZ2 A;  1U6Z A;  1NGE A;  1ZBS A;  4DSI A;  4IG3 A;  2ZJQ L;  3H45 C;  1QE1 A;  3NF7 A;  3BUZ B;  4FJ8 A;  3KLI A;  3KTQ A;  1Q8I A;  1VQ9 N;  1KC8 O;  3AO4 A;  1X3M A;  2IOC A;  4KB1 A;  1J5E K;  4DSE A;  1RDB A;  4BRK A;  4ZTF A;  3VEW A;  4BY9 C;  1J53 A;  1Y64 A;  3CM5 A;  4YDU C;  1W2B M;  3HPG A;  1NK5 A;  4JKB A;  1DKG D;  5LJV A;  4BDZ A;  3TAP A;  1BL3 A;  5J2N A;  2HVH A;  1NG9 A;  3PO4 A;  2DFH A;  3MX2 A;  4YNQ A;  1TKZ A;  3VEX A;  1C1A A;  4LFC K;  3H3N O;  1BUP A;  4LC9 B;  2O4I A;  1JLC A;  1QVF M;  5K14 A;  1TL3 A;  2WON A;  2V7Z A;  3C95 A;  2FSN A;  1TK5 A;  1UA1 A;  3B6P A;  3VQC A;  3HL8 A;  2LSN A;  3OYL A;  4MLH A;  4PY5 A;  2B5J A;  1HKG A;  4CBW A;  4KHN A;  1VSK A;  1OH6 A;  2QWR A;  3MCA B;  4FWK A;  5JS2 A;  3F2K A;  1EQY A;  3DAW A;  2ZGY A;  4DSL A;  4FLT A;  1HUX A;  3C6T A;  3TAM A;  2UUC K;  1Y97 A;  2P9I A;  5DM7 L;  4KB0 A;  4CEE A;  4DFP A;  4CF9 A;  4DV4 K;  4FJN A;  1DGK N;  1IH7 A;  3L6Q A;  3O9T A;  4BC2 A;  5GIP A;  3RVC A;  1NOZ A;  3ZSV A;  5KI6 A;  4PWD A;  3MCP A;  2WFB A;  4CI6 A;  1U49 A;  3WXJ A;  1RIL A;  2P9I B;  2P1J A;  3J7A P;  4FPB A;  4AM7 A;  3CJ9 A;  3ZX3 A;  3K2P A;  3ID8 A;  3N4P A;  4KHQ A;  1WUA A;  4KHP K;  3ZX0 A;  3CMA N;  4IFE A;  3U9D A;  3ATV A;  4A62 A;  4FJ5 A;  1UAX A;  4CJQ A;  1NGI A;  2ETJ A;  3WXI A;  3AVM A;  4BRE A;  1IJJ A;  2JGU A;  4K25 A;  1TK0 A;  1S1T A;  2BH1 A;  4IJN A;  3LDP A;  2A1S A;  1YTU A;  5C15 A;  3OYB A;  3HBT A;  3IAY A;  4A2B A;  3F9M A;  2AJQ A;  1OKJ A;  3L2Q A;  3NF9 A;  4CJE A;  5HLF A;  3QIC A;  4FJG A;  2W42 A;  4RW8 A;  3WQT A;  3L2U A;  2IIR A;  2VWK A;  1WSH A;  4CEA A;  2FLO A;  3ISN C;  3RMA A;  2OTJ N;  3MN5 A;  3NGY A;  3G6E N;  3QEX A;  4DR2 K;  1GLD G;  3VER A;  4W5Q A;  4AHR A;  4KHU A;  2ATQ A;  2YHW A;  3GOI A;  3CQY A;  4CED A;  1KFD A;  4FL9 A;  2QXL A;  3OJU A;  1RDD A;  3SI6 A;  2OAN A;  1EXQ A;  5GAD P;  3TU5 A;  1W7A A;  2NRZ A;  3TI0 A;  5BRE A;  2E2Q A;  1NGG A;  1XUP O;  4OO1 J;  3KWI A;  2O8B A;  4DTO A;  1JL1 A;  2OPR A;  5AZI A;  3MXJ A;  3AVC A;  1XI1 A;  1YAG A;  4BC4 A;  5E26 A;  4H0T B;  2ZE2 A;  3IDH A;  1T44 A;  1U4B A;  5GAG P;  4TSX A;  5BN9 A;  2O8B B;  4XH5 A;  1FKO A;  1FK9 A;  3NBP A;  3H46 O;  3WNG A;  2NRT A;  1O1W A;  4FPA A;  3U9Z A;  4CGD A;  3RR7 A;  3SJJ A;  3CPW M;  2VGN A;  3ITH A;  3N4Q A;  4QS9 A;  3OW2 M;  3AVF A;  1KXP A;  3IKM A;  4JV5 K;  1SL2 A;  2W6K A;  1QQM A;  4CEQ A;  2GBZ A;  4GKJ K;  3SMP A;  4OPJ A;  2EWS A;  1TK8 A;  3R3L A;  2QK9 A;  4IOX A;  2ZF5 O;  4BR9 A;  4ELU A;  1YT3 A;  4K41 A;  3AAQ A;  2GUI A;  4JKC A;  4CCH A;  3UKU A;  4CZM A;  1N32 K;  2RKI A;  3HVT A;  5KPZ A;  5EU7 A;  4FWO A;  4BRL A;  3V81 A;  4W5N A;  3EKS A;  4B1Z A;  3L3U A;  3VOV A;  1RT6 A;  2EX3 A;  3VPZ A;  3J7Z O;  1IBL K;  4EFH A;  3UKU B;  4X62 K;  4DU1 A;  4JS4 A;  4CIE A;  4M3U A;  4DV1 K;  1VQP N;  3CCE N;  4YOX A;  3MEG A;  3ATU A;  3PSF A;  4FWR A;  3KLH A;  2CGL A;  3I0S A;  5AQP A;  1BWF O;  4BE1 A;  1TAU A;  3NFA A;  3RTV A;  1YIT N;  2PYL A;  3MEC A;  4Z94 A;  3AA4 A;  1BQM A;  5BPL A;  4ELT A;  3SUQ A;  1A5V A;  1NWK A;  1A5X A;  4M7Y A;  4CF2 A;  1LV5 A;  1ZBH A;  3L4I A;  3T19 A;  3LDS A;  3DYA A;  5E84 A;  3CER A;  1HNZ K;  3VEV A;  3TAQ A;  1GLF O;  2JLE A;  4BWJ A;  4AHU A;  3L2R A;  4FK4 A;  4DTX A;  3OS2 A;  1HKB A;  1C0F A;  3C6A A;  4CJK A;  1WSE A;  3M8R A;  3P38 A;  3ZSZ A;  4DV3 K;  1SQK A;  3CJC A;  3NH2 A;  5JS1 A;  3GE1 A;  1XC3 A;  3NHG A;  4JAX A;  4BR0 A;  1MA9 B;  3CCV N;  2E6M A;  1RDW X;  3DLH A;  3A5N C;  2QM1 A;  1N33 K;  3VEO A;  1NOY A;  1L3S A;  4JI8 K;  2D0O A;  3OBW A;  1ATR A;  5CHI A;  2VWB A;  3VMF B;  5LMN K;  4CD3 A;  3CPE A;  5ELZ A;  4A59 A;  5I3U A;  1J54 A;  3P5J A;  1LWF A;  4FJI A;  4XEI A;  5EVZ A;  2FBV A;  3E9O A;  3RR8 A;  4K42 A;  2DFF A;  3OS0 A;  4CIF A;  2KZM A;  1RT4 A;  4J2B A;  4HUE A;  3TAE A;  1U47 A;  5F0X A;  4WQ4 C;  3PX6 A;  5C42 A;  1BIS A;  5JIC A;  2BE2 A;  3M5R A;  3ID6 A;  3SZ2 A;  4E1N A;  2FBT A;  1YIJ N;  3OYJ A;  3UE5 A;  2YHX A;  2GX9 A;  4RW6 A;  5M1F A;  4B9N A;  4WFA L;  1TUY A;  5M1Q A;  4PQU A;  4JK9 A;  1D4X A;  1S3X A;  5AQR A;  4BRQ A;  2AP1 A;  1WSI A;  2YNF A;  1TGO A;  3AVK A;  2GUP A;  4O44 A;  4ZHR A;  4HTL A;  3HK2 A;  3BDP A;  3FLC O;  4H0V B;  4Z4C A;  2HHT A;  1DTQ A;  1QSY A;  2FBY A;  1X1P A;  2V51 B;  3NAE A;  3RMC A;  1Z05 A;  4HCC A;  3SUN A;  2GTD A;  3BY5 A;  1S72 N;  4OGE A;  3L2W A;  4CZL A;  2BDP A;  4KI4 A;  4BQL A;  2OZM A;  1JLB A;  2YX6 A;  3U4L A;  2P5O A;  4BQZ A;  3ASM A;  4FW2 A;  3TSU A;  1O13 A;  1P8Z A;  4B3T K;  3CHW A;  4H0X B;  4CJV A;  4B9V A;  1D8Y A;  3MDQ A;  4FW1 A;  4EAH D;  1HYS A;  3OYE A;  2KFZ A;  3L8B A;  4F9O A;  4BRC A;  3E01 A;  1L3U A;  2HHH K;  4RW9 A;  4CZJ A;  1IKX A;  4F3O A;  5LMU K;  4DSJ A;  1N34 K;  3SPY A;  1CZ9 A;  3R8E A;  3QIO A;  1IG8 A;  2CGJ A;  4QS7 A;  4OKJ A;  3AVA A;  4H8K A;  4U67 L;  4KI6 A;  2PFU A;  1N8R O;  1TKX A;  1VQK N;  5BR8 K;  3LP2 A; 
#chains in the Genus database with same CATH homology
 4BWM A;  2A1R A;  3V1O A;  1RT3 A;  3AVH A;  3IG1 A;  3U6F A;  1HJR A;  3JSM A;  3VQ9 A;  2VG5 A;  3C6U A;  1FKP A;  4QCL A;  1JKH A;  2FBX A;  2PZS A;  1RNH A;  3ALY A;  3WNF A;  1Q9X A;  1VSD A;  1BI4 A;  1Z26 A;  3NH0 A;  4CGF A;  4FJ9 A;  4OKE A;  4W5T A;  4M42 A;  2XHB A;  3MXI A;  1SV5 A;  1SUQ A;  1YVU A;  2HNZ A;  3SUQ A;  1Q9Y A;  3LAL A;  1S1V A;  3VQA A;  4LY7 A;  3PO5 A;  1JLE A;  1VSF A;  2YHA A;  4DSI A;  4IG3 A;  5KGW A;  4CJ3 A;  2G8W A;  2YHB A;  1W9H A;  3P83 D;  1QHT A;  4CJT A;  3FFI A;  4B9M A;  4E7K A;  4DTN A;  1S6P A;  3QIN A;  3VQD A;  1QE1 A;  3HM9 A;  3NF7 A;  4DQI A;  2HHW A;  5HP1 A;  1NK6 A;  1HRH A;  2OYQ A;  4FJ8 A;  1BI4 B;  3B6O A;  3HPH A;  3KLI A;  3KTQ A;  1Q8I A;  1WAF A;  2OPQ A;  1KLM A;  1RDA A;  1KCF A;  3AO4 A;  4IKF A;  1WNS A;  1S1W A;  3KLE A;  4KRE A;  5FDL A;  1DTT A;  4CEF A;  2G8V A;  1K6Y A;  2IOC A;  3NF8 A;  3PX4 A;  1KRP A;  1U04 A;  4DSE A;  1ZBL A;  3OYK A;  4KB1 A;  2F96 A;  4C8K A;  1RDB A;  4ZTF A;  4B8A B;  1D5A A;  3ZT3 A;  4Z4I A;  2OPS A;  1J53 A;  1J9A A;  3CM5 A;  4DQQ A;  3OYN A;  4J2D A;  4LH4 A;  4FK2 A;  4Z0U A;  1BIU A;  1C6V A;  3HPG A;  1NK5 A;  2OZS A;  4HUG A;  4M3Y A;  3V1R A;  3VQB A;  3OYM A;  1G15 A;  3A2F A;  4BDZ A;  1RBR A;  3C94 A;  3OYG A;  4B9U A;  1LAV A;  5HBM A;  1VSL A;  2ITG A;  3TAP A;  1BL3 A;  5J2N A;  3HO1 A;  4FJK A;  2HVH A;  1VSH A;  3LAM A;  3PO4 A;  1HYV A;  2DFH A;  4YNQ A;  1TKZ A;  1TAQ A;  2YV0 X;  4DSF A;  4BDP A;  1C1A A;  3QET A;  2OA8 A;  3KJV A;  4AHV A;  1CZB A;  4DQR A;  1NKB A;  2O4I A;  3D0P A;  1LWE A;  1VRT A;  1JLC A;  4CHZ A;  5K14 A;  4DQS A;  3L3V A;  2G8K A;  1TKT A;  1TL3 A;  2B4J A;  2WON A;  3C95 A;  3SYZ A;  3SNN A;  3S3M A;  1TK5 A;  1UA1 A;  4DU3 A;  3B6P A;  3VQC A;  3PY8 A;  3HL8 A;  2LSN A;  1KLN A;  4LSN A;  3TR8 A;  1VSM A;  4IFV A;  3OYL A;  3LP1 A;  4PY5 A;  2KZZ A;  1UOC A;  2HMI A;  2B5J A;  4ID5 A;  4L8R B;  4FK0 A;  1NK9 A;  4KHN A;  4KO0 A;  3KK2 A;  4C8L A;  4B8C A;  1VSK A;  4AHS A;  4BAC A;  5J2M A;  5J2P A;  1JXE A;  4OGC A;  4NYN A;  1I39 A;  1KVA A;  5JS2 A;  2ZQB A;  4ID1 A;  2Z1H A;  4K8Z A;  1MU2 A;  3QES A;  4DSL A;  3DLE A;  4AHC A;  4FLT A;  4B9S A;  3C6T A;  3TAM A;  3VQ8 A;  3H08 A;  1Y97 A;  4CGJ A;  2X78 A;  4ELV A;  1D9F A;  2QKB A;  1RT2 A;  1WSG A;  2WOM A;  1ZBF A;  4CJR A;  1D9D A;  4KB0 A;  4CEE A;  4EP4 A;  4DFP A;  4CF9 A;  4CHQ A;  1XHZ A;  5J2Q A;  4CHO A;  4J2E A;  1BGX T;  3AO1 A;  4FJN A;  2HHV A;  1IH7 A;  3QEP A;  2X6N A;  2Q3S A;  1NOZ A;  2DFE A;  2QKK A;  4I2P A;  3ZSV A;  4GVM A;  5KI6 A;  2P5G A;  3K59 A;  4PWD A;  4O5B A;  4F3T A;  3OYC A;  3U3Y A;  4FLY A;  2YNG A;  4CGI A;  4DG1 A;  1U49 A;  3LP2 A;  3LPU A;  4EZ6 A;  2EHG A;  1RIL A;  1JLF A;  2P1J A;  4KTZ A;  1SKS A;  2PYJ A;  3K2P A;  2VG6 A;  4KHQ A;  4F4K A;  3QNN A;  4BDY A;  4K8X A;  1RT1 A;  2F8S A;  4CJS A;  4FZY A;  3SQ0 A;  4FJ5 A;  1UAX A;  4KKO A;  4CJQ A;  2ETJ A;  3ZT1 A;  4FJH A;  3AO5 A;  3KD5 E;  1LW0 A;  1VK0 A;  4ZTJ A;  3AVM A;  4R5P A;  4XIU A;  3VQQ A;  2KW4 A;  4M3T A;  2JGU A;  4DMN A;  4FM2 A;  2HVI A;  1TK0 A;  1S1T A;  4Z4G A;  3HJF A;  1EP4 A;  4Z4H A;  4F2S A;  4FLU A;  2A1S A;  5CZ1 A;  4E3S A;  1YTU A;  1X9M A;  3OYB A;  3KD1 E;  3IAY A;  2E4L A;  2HHS A;  1WN7 A;  1BQN A;  4DTU A;  2HND A;  4JS5 A;  5D3G A;  4DSK A;  2AJQ A;  1RT5 A;  3L2Q A;  1HNV A;  1TV6 A;  3NF9 A;  4CJE A;  4DU4 A;  4FJJ A;  5HLF A;  1QSS A;  1F21 A;  4I2Q A;  4FJG A;  1QTM A;  1RBU A;  4CGG A;  2W42 A;  3AO2 A;  4RW8 A;  3TWH A;  3L2U A;  1KSP A;  4KAZ A;  3O4Q A;  1KVB A;  3LPT A;  4N47 A;  4DS5 A;  4FLV A;  2DY4 A;  2HHU A;  1EET A;  3NGZ A;  3ZSW A;  1U48 A;  2VWK A;  4LH5 A;  1WSH A;  4CEA A;  3EY1 A;  4CJP A;  4FVM A;  4O4G A;  1NJX A;  1X9S A;  3ISN C;  3O3H A;  3RMA A;  4IFY A;  4CK2 A;  3NGY A;  4IDK A;  2IDO A;  1UA0 A;  3K58 A;  3QEX A;  4EZ9 A;  4DTS A;  2BGG A;  1GOA A;  3QIP A;  4UQG A;  3VQ6 A;  4W5Q A;  2D0C A;  4AHR A;  3TAG A;  4KHU A;  2ATQ A;  4KHW A;  3QLH A;  4CED A;  1QS4 A;  1KFD A;  3V9Z A;  1W0H A;  1A5W A;  5CZ2 A;  3SI6 A;  3OJU A;  1RDD A;  4I9L A;  1EXQ A;  3K5N A;  4KPY A;  3O4N A;  4RW4 A;  2HB5 A;  3AVJ A;  4CK3 A;  4E89 A;  3TI0 A;  3O3G A;  4ELT A;  1T03 A;  3ZT0 A;  3NDK A;  3MAQ A;  1RTI A;  4CFA A;  3RMD A;  1L3T A;  4Y1D A;  3ZSY A;  1WAJ A;  3AO3 A;  1HPZ A;  5HRR A;  4DTO A;  1RDC A;  1JL1 A;  4CEZ A;  2YKM A;  4FLX A;  3OYH A;  3DRP A;  3LAK A;  2OPR A;  4M41 A;  3K5M A;  4OPK A;  4E19 A;  5I42 A;  3MXJ A;  3AVC A;  1VSI A;  5KRT A;  1XI1 A;  4OJR A;  4GMJ B;  4DTJ A;  4Z4F A;  4LSL A;  4FJL A;  2I5J A;  3LAN A;  3IS9 A;  3SUO A;  4AH9 A;  3NF6 A;  2YNI A;  2ZE2 A;  5HRN A;  2KTQ A;  4Q5V A;  1U4B A;  4TSX A;  4NCA A;  2IAJ A;  3BGR A;  4DF4 A;  1FKO A;  1FK9 A;  1IKW A;  4O0J A;  3CQ8 A;  4E7L A;  3NBP A;  1N5Y A;  3ZCM A;  4C8O A;  3DLG A;  3WNG A;  3TAN A;  1B9F A;  2QXF A;  4CHP A;  4KFB A;  3ULD A;  1O1W A;  4W5R A;  4CGD A;  2YKN A;  1IO2 A;  4BE2 A;  3ZSQ A;  3RR7 A;  1DLO A;  3M8S A;  3DM2 A;  3K5L A;  3SJJ A;  3CFO A;  1WLJ A;  1T05 A;  1LW2 A;  4DLG A;  3ITH A;  4DWI A;  4M3W A;  4KHY A;  3AVF A;  2B6A A;  1S1U A;  3SCX A;  1NKE A;  4H4M A;  2IGI A;  3KKR A;  2RN2 A;  3CG7 A;  4CEQ A;  1T8E A;  2GBZ A;  3LZI A;  2Y1J A;  1SL2 A;  3RRG A;  1REV A;  5C25 A;  1RTD A;  4OPJ A;  3SV3 A;  3P1G A;  3KK1 A;  1U45 A;  1TK8 A;  1J5O A;  3QNO A;  2QK9 A;  3VQ5 A;  3SQ1 A;  3L2V A;  2G8U A;  3OY9 A;  4ELU A;  1YT3 A;  3VN5 A;  3HT3 A;  2GUI A;  4N5S A;  4FJ7 A;  5HRP A;  2FC0 A;  4OKK A;  3OYA A;  3G0Z A;  4CCH A;  1TKD A;  3WNH A;  1T7P A;  3D45 A;  3LWL A;  4E1M A;  2KQ2 A;  3SV4 A;  1NK0 A;  5HRO A;  4HTU A;  2RKI A;  1ZYQ A;  3HVT A;  5EU7 A;  3V81 A;  3EZ5 A;  4W5N A;  4CJU A;  3TAB A;  3SUP A;  1BHL A;  4EP5 A;  3L3U A;  3V9U A;  4H4O A;  3VA0 A;  1RT6 A;  2EX3 A;  3DRS A;  4B3O A;  3NE6 A;  3OYI A;  3F9K A;  4N41 A;  1RBS A;  1WSJ A;  2HNY A;  3I8D A;  3OVN A;  4Y1C A;  4DU1 A;  4FCY A;  4JS4 A;  4AHT A;  4CIE A;  3S3O A;  3LWM A;  4KHS A;  3OYD A;  4F2R A;  4IG0 A;  1SL1 A;  4M3U A;  2O4G A;  3I0R A;  1C0T A;  3HPO A;  3HVR A;  3MEG A;  1S5J A;  1ASU A;  3KLH A;  2BAN A;  3I0S A;  3OJS A;  1S9G A;  4BE1 A;  3V6D A;  1TAU A;  1ZBI A;  3NFA A;  3RTV A;  2XY5 A;  3RRH A;  2PYL A;  3MEC A;  1RTJ A;  4CF8 A;  4KTQ A;  3WNE A;  3AA4 A;  4G1Q A;  1RBT A;  1BQM A;  4NCG A;  3M8P A;  4OVL A;  4QAG A;  3ZSR A;  1A5V A;  4W5O A;  3AA5 X;  3LP0 A;  1A5X A;  3KLG A;  2VG7 A;  4CF2 A;  3PV8 A;  1LV5 A;  1HQU A;  5FRN A;  1ZBH A;  3T19 A;  3LDS A;  2HW3 A;  3DYA A;  3M8Q A;  2Z1J A;  3VQ7 A;  3VQE A;  2HHX A;  5T7B A;  4FM1 A;  5CY4 A;  1RCH A;  3TAQ A;  2JLE A;  4E7I A;  4CFC A;  3SQ2 A;  1KVC A;  4BWJ A;  5CYM A;  4OLB A;  4AHU A;  4E7H A;  2RF2 A;  4N56 A;  1NJY A;  1WSF A;  3L2R A;  2G8I A;  4J2A A;  4FK4 A;  4CEO A;  3ZT2 A;  4DTX A;  3VQ4 A;  3OS2 A;  1Z25 A;  4CEB A;  3VA3 A;  3MXM A;  1GOC A;  1LWC A;  4FZX C;  4JLH A;  2HHQ A;  3HXM A;  4CJK A;  1WSE A;  3M8R A;  3PX0 A;  3MED A;  1JLG A;  3ZSZ A;  2X74 A;  4M3R A;  4CK1 A;  3NGI A;  1NK7 A;  4FLZ A;  1JL2 A;  4O0I A;  3NH2 A;  4DTP A;  4FXD A;  5JS1 A;  1JLA A;  4CIG A;  3V9X A;  4NYF A;  1C1C A;  4I7F A;  3NHG A;  4KTW A;  4B08 A;  1R0A A;  1NK4 A;  2E6M A;  1ITG A;  3V9S A;  3DLH A;  3KIO A;  4WE1 A;  4CHN A;  1L3V A;  1ASV A;  5KGX A;  1CXU A;  4O55 A;  5KRS A;  3NH1 A;  1SKR A;  1L3S A;  1NOY A;  2G8F A;  1C0M A;  4RG8 A;  4CEC A;  4KV8 A;  1JXB A;  3LP3 A;  4FZZ A;  4Z4E A;  4PA1 A;  1L5U A;  1XHX A;  3TAR A;  4CF1 A;  3RWU A;  5I3U A;  1VRU A;  1HMV A;  1J54 A;  3P5J A;  1VSJ A;  1UWB A;  1LWF A;  3AV9 A;  4CER A;  3AVG A;  3ZSX A;  3O3F A;  3DLK A;  4GW6 A;  2XRI A;  4FJI A;  5SZT A;  2FBV A;  1BCM A;  4BE0 A;  4I9Q A;  4M3Z A;  4M45 A;  5J1E A;  3ZSO A;  4HUF A;  3RR8 A;  4IBN A;  3SQ4 A;  2DFF A;  3OS0 A;  4CIF A;  1NJW A;  1RT4 A;  3U3G A;  4J2B A;  2KZM A;  1KTQ A;  2E6L A;  4QOZ B;  1QQC A;  4HUE A;  3TAE A;  4LD0 A;  2VWJ A;  1U47 A;  3QEI A;  4HHT A;  3PX6 A;  3PUF A;  1B92 A;  1BIZ A;  3AVL A;  4CF0 A;  3CYM A;  4CFD A;  5C42 A;  4CGH A;  3DLR A;  3HYF A;  3T3F A;  3DI6 A;  1JLQ A;  1SL0 A;  2RPI A;  2D5R A;  3IRX A;  1KFS A;  1BIS A;  2P51 A;  2BE2 A;  4C8N A;  4CJ4 A;  4HVJ A;  3SZ2 A;  3TAF A;  1HYZ A;  3AVN A;  3ZT4 A;  4E1N A;  2NUB A;  5KTQ A;  4E7J A;  2FBT A;  4HCB A;  4NCB A;  1EX4 A;  5E41 A;  3OYJ A;  5FRO A;  4CJF A;  4RW7 A;  4FYD A;  3KKS A;  3QER A;  4B9T A;  4RW6 A;  4FLW A;  1X9W A;  4FM0 A;  4CJW A;  4DLE A;  1HNI A;  3EYZ A;  4Q0B A;  5SWM A;  4FJM A;  4B9N A;  2XY8 A;  5DMR A;  3RMB A;  4PQU A;  3HST B;  4ICL A;  4OLA A;  3V9W A;  3K57 A;  3G10 A;  3AA3 A;  1LAW A;  1XWL A;  2X6S A;  3NCI A;  4MQ3 A;  1WSI A;  2YNF A;  1TGO A;  3AVK A;  3OS1 A;  1RBV A;  2D0B A;  4CHY A;  4O44 A;  4M3X A;  2F8T A;  4ZHR A;  4DS4 A;  3V4I A;  3BDP A;  3HK2 A;  2HHT A;  4Z4C A;  1DTQ A;  1VSE A;  4CJL A;  1QSY A;  2FBY A;  1X1P A;  4DFK A;  3DMJ A;  3NAE A;  3RMC A;  4C8M A;  1FXX A;  4N76 A;  5DK5 A;  4DFM A;  1BCO A;  1XC9 A;  4HCC A;  3SUN A;  1TL1 A;  3KK3 A;  3F73 A;  3THV A;  2Y1I A;  3DRR A;  4OGE A;  3L2W A;  1S1X A;  1HQE A;  1EKE A;  2BDP A;  3OYF A;  1GOB A;  4KI4 A;  3K5O A;  1N6Q A;  4FJX A;  4CE9 A;  2YNH A;  2OZM A;  3JYT A;  2KFN A;  1S9E A;  2IC3 A;  1JLB A;  3CFP A;  4DFJ A;  5FRM A;  2P5O A;  5C24 A;  1NJZ A;  1I3A A;  3ASM A;  4FW2 A;  3AVI A;  1S6Q A;  4CFB A;  4DF8 A;  2OPP A;  4F8R A;  2DTU A;  2ZD1 A;  3MEE A;  1C0U A;  2D0A A;  4CJV A;  2XY6 A;  1D8Y A;  1QSL A;  4B9V A;  4DQP A;  1CLQ A;  2R7Y A;  4FW1 A;  3SPZ A;  3QEV A;  1HYS A;  1IKY A;  3OYE A;  3DLB A;  3KLF A;  3UIQ A;  4CES A;  1CXQ A;  3VQP A;  1SKW A;  2KFZ A;  3DOL A;  3L8B A;  1NK8 A;  3CM6 A;  2IS3 A;  1ASW A;  3E01 A;  4RW9 A;  5HRS A;  1IKV A;  3AVB A;  1L3U A;  1IKX A;  2XY7 A;  4B9L A;  1RT7 A;  1YTA A;  4F3O A;  4PUO A;  2G8H A;  1TVR A;  4DSJ A;  3HP6 A;  2PY5 A;  2XO7 A;  3HP9 A;  3T1A A;  4AIL C;  3S3N A;  2Z1G A;  1ZBU A;  3CFR A;  3QO9 A;  3SPY A;  3DOK A;  1RTH A;  5CYQ A;  3V1Q A;  4YFU A;  1IG9 A;  1CZ9 A;  3QEW A;  4DTM A;  3QIO A;  2Z1I A;  4DTR A;  1B9D A;  4OKJ A;  4E0D A;  1C1B A;  4JRP A;  2GV9 A;  3AVA A;  3S9H A;  4H8K A;  4CJ5 A;  1NKC A;  4KI6 A;  4KRF A;  1TKX A;  3LZJ A;  4JRQ A;  4MFB A;  3AA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...