4BRCA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
360
structure length
360
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 116
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brcA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brcA02
4BRAA 5FPEA 3AARA 3SMSA 4IZ9A 5BRHA 4IXCA 2QM1A 4BRPA 1EQYA 2A3ZA 4CZKA 2FLOA 2P9IA 2Q0UA 4BR0A 3IDHA 4H0VB 5AQQA 1HKCA 1JCGA 2A40A 3ATVA 3CJ1A 4DCHA 5AQXA 3UE5A 5I9EB 2A42A 3L0QA 4WQ4C 5KPRA 3FZLA 4FOEA 3ZETA 3ID8A 4IJNA 5E84A 3DXKB 2QWRA 4BRDA 2EWSA 3O4WA 4FWSA 4H5RA 1ZBSA 4A2BA 4K41A 4CZLA 4Y0WA 4BR4A 3FLCO 1QZ6A 2F9TA 1JCEA 3AAQA 1X9JA 4IJAA 2HOEA 3FFKB 3VOVA 2D0PA 2P9KA 1S3XA 1ZXOA 2CGJA 2QWPA 1NGIA 4H5WA 4BRHA 2QWLA 1P8ZA 1C0FA 4BROA 3LM2A 3O08A 3HTVA 2FF6A 1E4GT 4PKGA 4CZHA 1HJOA 4CI6A 1G99A 4BQLA 5AZIA 2QXLA 5JLFA 4BC2A 3ULEB 4BRGA 3VEYA 3CERA 4BREA 4F9OA 1GLFO 2E1ZA 4H0XB 1U2VA 3C7NA 3BUZB 1V4TA 1HPMA 4FWOA 2E2OA 4B1YB 2QWQA 4GNIA 2P9LA 1NGJA 3UKRB 3BEXA 4H03B 3ZX0A 1ATRA 4B1UB 2NLXA 3O1WA 4MLHA 5AQJA 3WUHA 3BF3A 2IVOA 4ISGA 4FWLA 1SQKA 1HKGA 3CIPA 1KXPA 3WQTA 1TYQA 4B1ZA 3LM9A 4BRKA 3FE1A 2NZTA 5AQYA 5AQVA 3VGKA 3CHWA 4CBUA 1HUXA 4FWMA 3VEVA 2V52B 2IVPA 3B8AX 5FPNA 1NLVA 3VENA 5BR9A 2GEMA 3VPZA 2WUSA 4XEIA 3QB0A 5F0XA 3H45C 2GUPA 1ESVA 1DKGD 1LCUA 1CZAN 2Q2RA 4JD2A 4PKHA 1TUYA 3MN5A 4WQ4A 3U8XA 2Q0RA 3DXMB 5CE3A 1GLEG 4BC5A 4BVPA 3CI5A 3WEEB 4QS9A 2H3GX 4PL7A 3KHYA 3D2FB 4BC4A 3HBTA 3L4IA 4XH5A 1NBWA 2P9UB 2P9PB 1YUWA 2Q1NA 1MWMA 2P9NB 4FWRA 3EKUA 3A5MC 4BVOA 5BRDA 4B9QA 1BA1A 2CH5A 2E20A 3ATUA 3HSCA 4LC9B 5E26A 5JLHA 5AFUH 4FWPA 2W41A 5F1XA 1X3NA 3H3OB 1GLAG 5BPMA 3H1VX 4PKIA 3UKUA 4BRQA 5AQFA 3JXUA 3VERA 5EY4A 3CJ7A 5AQNA 3U9DA 4C23A 5KQDA 5JMVA 2I7NA 4IWVA 5LY3A 4BR7A 4FWQA 5FPDA 4CZIA 4CZFA 2CGLA 2ZGZA 2QW9A 3VF4A 4NO7A 1RGIA 1YXQA 3D2EA 3ZEUB 4H5NA 3VEZA 3MN6A 1C0GA 2HMPA 2YI1A 2ZWHA 3A5NC 4BRCA 1GLJO 3LDPA 5LJWA 1X3MA 1NM1A 3A0IX 5BPNA 3M1FA 1NGGA 2FXUA 4H0TB 2E88A 5AQRA 3AAPA 1NGBA 2OANA 1MWKA 4BRIA 3AY9A 4WQ5C 4BRNA 1KAYA 4H5TA 3DAWA 4K43A 2E2PA 1HKBA 5BPLA 4Z94A 2E1YA 1QQNA 2AP1A 2P9SB 1Z6RA 3H46O 4K25A 3QMLA 5JICA 2ASPA 2VCPA 4MLEA 3RSEB 3U9ZA 3G25A 3SLCA 3WXIA 1GLLO 2P9KB 3O80A 3GE1A 4RCHA 3VF6A 4FL9A 3EL2A 1DGKN 4RWTA 4DHYA 4H5VA 4EFHA 1T6CA 3VEOA 4CBXA 1E4FT 5AZIB 4CD3A 4FPAA 3A5OC 3R6MA 4BG8A 1TUUA 1U6ZA 3CQYA 1U2VB 1H1VA 3GG4A 4GY2B 2I7PA 3C7NB 4FO0A 5ELZA 5ADXH 3DWLA 2HF3A 3GL1A 1NMDA 2YCHA 4O5FA 2P9LB 3H1QA 3UKRA 4H0OA 2PAVA 4YDUA 4JHDA 3VGLA 4HWIA 5AQMA 2A5XA 1ATNA 4M7YA 3VESA 2IIRA 5AFUA 5KQ8A 4XH4A 2D0OA 4BR9A 4E1JA 3SK3A 2Q36A 2VWBA 3J8AA 3IMXA 4O8KA 1Z05A 3VGMA 1ZC6A 3O1BA 3P4IA 3BF1A 2F9WA 1JCFA 3FGUA 3KZBA 5AR0A 1KAXA 3O8MA 3FZHA 4ISEA 2ZF5O 3W3DA 3I8BA 4A61A 2Q97A 2QWMA 3DJCA 1K8KB 4L3QA 4JNEA 1KAZA 3WQUA 5BRFA 3VETA 4CZMA 4JD2B 3A8YA 3ZX2A 5TKYA 2HF4A 2V7ZA 4EAHD 3HI0A 4WQ5A 3VEXA 3BP8A 3M3ZA 3R9PA 1T44A 2YHXA 1NGCA 2GWKA 2DPNA 5EOYA 5AZJA 1RDWX 2YJEA 4FWKA 2P9NA 4FSVA 4I6MA 3ENOA 4MO5A 5AQLA 3MMVA 3W0LA 1WUAA 3LDOA 4M63C 1QZ5A 3F9MA 4B1XB 1NGEA 2YHYA 4JN4A 5AQKA 3MN9A 4BGBA 3QDKA 1BDGA 3TU5A 4A2AA 1NGHA 3CJAA 4JAXA 2FSKA 3U4LA 4A62A 1MDUB 2ASMA 3CQXA 3FZKA 2P9IB 3MCPA 5AQGA 4DQ8A 5AQPA 5B8HA 1HX1A 2V7YA 2GELA 1QHAA 3MDQA 4MO4A 4DB3A 5ADXA 2CGKA 3ZEUA 5KPTA 3D2EB 4BRFA 3D7EO 3DXKA 3ZETB 4H0PA 1IJJA 3A5LC 2YJFA 3WXJA 3ZX3A 3O6WA 5EVZA 1SZ2A 2A41A 3FZMA 4QS7A 3TPQA 3SJHA 4NB4A 2BTFA 5AQHA 1NGFA 2NRHA 4BG9A 2ASOA 3WXLA 3LL3A 4BGAA 2YHWA 5AQOA 2P9SA 2QWNA 3CJBA 1HLUA 3R8EA 2FSNA 3RSEA 1GLBG 4K42A 4PL8A 1MA9B 4RTFD 3O5BA 5AQTA 2E2NA 4CZJA 5KPZA 1OKJA 3EO3A 2PBDA 3GOIA 3CETA 4AM7A 3ULEA 4B1VA 1QQMA 3QFPA 3WXKA 2V51B 3GDQA 5AQSA 5AQUA 4BQZA 3VF2A 3QICA 3IFRA 1IG8A 4FPBA 2AA4A 4EHUA 1SAZA 1YVNA 2D1KA 2W40A 1V4SA 3M6GA 1R59O 4CD1A 3WT0A 2BUPA 2VYPA 4CZEA 3SMPA 5FPMA 2ITMA 4ISFA 3CJCA 2D4WA 4QS8A 4M7XA 4AM6A 4J8FA 4EHTA 1BU6O 1BWFO 3EZWA 1BG3A 4FWNA 4BRLA 1GLDG 1BOTO 1NGDA 1NGAA 4JHDB 2E2QA 2FF3B 4WYBA 3FZFA 3UB5A 4CZGA 3CJ9A 1BO5O 3EKSA 3FR0A 3H6EA 3KVGA 1TYQB 4CBWA 1BA0A 1RFQA 1S22A 5F2RA 2KHOA 2CH6A 2IVNA 2Q31A 3LDNA 4EIAA 3QFUA 3H3NO 2QWOA 5AQIA 2GTDA 1Y64A 5AQWA 3GBTA 5EX5A 3HM8A 3ENHA 5LJVA 3OHRA 4H0YB 2GWJA 3JS6A 1XC3A 2UYTA 3DXMA 3IUCA 3C0BA 5EXWA 3VEWA 3LDLA 4BR2A 4XH1A 3LDQA 3WEEA 1K8KA 2E8AA 4CJ7A 3MK6A 1YAGA 3HZ6A 3QBXA 3EN9A 1T6DA 3D2FA 1Q18A 1J6ZA 2A6AA 1DEJA 4KBOA 4BRMA 2P9UA 2P9PA 1NWKA 1QQOA 5AQZA 5BN9A 4IO8A 4FOIA 4BR5A 1BUPA 1ATSA 5BN8A 1GLCG 3QBWA 4HTLA 1XQSC 3L6QA 1WOQA 1D4XA 2FSJA 2J4RA 5AZJB 4B1WB 3S41A 4YDUC 4I6MB 3UKUB 5BREA 1XUPO 3I33A 4BC3A 2ZGYA 1LOTB 3MN7A
chains in the Genus database with same CATH superfamily
4FJLA 5BRHA 2JGUA 2QM1A 1EQYA 2A3ZA 4AQYK 1VQ8N 5AQQA 4CHPA 3IS9A 2RE2A 4DCHA 3UE5A 5M1QA 1HNIA 3P31A 4NCGA 1WBDA 3ID8A 4IJNA 2B6AA 3SPZA 3I55N 3KLHA 1YJNN 2EWSA 3O4WA 4KKOA 4H5RA 3I0RA 5CY4A 4A2BA 4K41A 3NBPA 3K58A 4M3ZA 4CZLA 2EHGA 3LANA 4IG3A 5CYMA 1QZ6A 4E7JA 4DSKA 1X9JA 3DRRA 1NKCA 4PUOA 1JL2A 1S3XA 1C0UA 1D9FA 1ZXOA 2QWPA 1NGIA 3SYZA 1S1TA 4BWJA 1W2BM 4DF4A 3SUPA 4UY8O 1HJOA 2QA4N 2QXLA 3ULEB 4LFCK 3VQQA 1W9HA 4LSNA 3J7AP 2O8CA 3VN5A 1WN7A 4FK4A 4KHUA 3NGIA 1V4TA 2XY7A 4FWOA 3HP9A 3TARA 4B1YB 2P9LA 2F96A 3LPTA 4IEIA 1BIUA 4DU4A 3BEXA 3NAEA 4FZZA 4OVLA 4NLCA 4FW2A 3AVBA 4B1UB 4CHQA 4FJ8A 2NLXA 3SAFA 4CHYA 2XO7A 1Q86O 3WUHA 3M8RA 4ICLA 3M8PA 3NVKA 4FWLA 3ZSXA 2KZZA 2E6MA 4OLAA 1VSIA 1BQNA 1HPZA 2KFZA 3HXMA 5M1KA 4Z0UA 4B1ZA 3LM9A 4BRKA 2OPPA 3FE1A 1K6YA 2O8EB 4YFUA 3VGKA 5AQVA 1DTQA 3CHWA 3OBWA 5FPNA 3NH2A 2KW4A 3I0SA 4CJ3A 1J5EK 4XEIA 1B9DA 4FJXA 1O13A 1L3TA 4J2AA 1LCUA 3QINA 1JLGA 3T69A 1TUYA 1E3MA 2Q0RA 1DTTA 1NG9A 4FM2A 4DR4K 4HVJA 4CJPA 3J7ZO 3NH1A 2ZQBA 4IG0A 5J2MA 1BI4B 2ETJA 4CJUA 3HBTA 3BZKA 4KI6A 3SV4A 3OYKA 3TTFA 4B8AB 1YUWA 2Q1NA 2P9NB 4ILJA 4DTXA 3DLGA 4LF8K 5JS1A 2CH5A 2HBKA 3CM5A 4LC9B 5M1FA 5AFUH 3QEVA 4JI3K 3AVJA 1X3NA 3VTIA 1BIZA 4GVMA 5BPMA 3V9XA 4AHVA 3VQ6A 5LMUK 4PKIA 5EU7A 4IFVA 4CF8A 5CYQA 5AQNA 2Y1IA 4AHCA 1QVFM 4BR7A 5FPDA 4CZFA 2QW9A 3HL8A 2HMIA 4DQPA 1TKZA 1C6VA 1UA0A 1HYSA 4MQ3A 3BDPA 3NF7A 3MN6A 1ITGA 2HMPA 4JI0K 2ZWHA 1GLJO 4H4OA 1S1UA 4DFMA 3THXA 5C25A 1RDAA 1NNEA 4JKGB 4DTNA 4JRPA 1NGBA 1S9GA 3KK1A 4CGIA 4XIUA 2RKIA 4CJ4A 4DV7K 3S3OA 1W97L 4IFYA 1U48A 1QQNA 1TK5A 1NKBA 2QK9A 3QMLA 4OKEA 4J2BA 1TKXA 2ASPA 3G25A 4B9TA 3SLCA 3L2VA 4KH5A 5CZ1A 1JLBA 4FL9A 3EL2A 1T8EA 1T3VA 4WFNL 2HHTA 4RWTA 4DHYA 2A1RA 3NCIA 3KTQA 4CJFA 3VEOA 3JYTA 3G10A 5AZIB 2RF2A 2LSNA 3A5OC 2PY5A 1ASUA 1WSGA 2OTLN 5ELZA 3C7NB 3DWLA 1YF5L 2W6LA 5GAHP 1VQ5N 2G8UA 1RTIA 5KGXA 1F21A 4O5FA 3H1QA 3T3FA 3UKRA 4H0OA 2FBTA 4LSLA 2NRXA 3A2FA 3IG1A 1ATNA 4M7YA 3VESA 2OYQA 3NE6A 1SKWA 3DRPA 2HBJA 3RMBA 2D0OA 4BR9A 4ID1A 1D8YA 2VWBA 3SUQA 1RBRA 1ZC6A 5IWAK 3AO5A 4FK2A 1LW0A 3P4IA 3HJFA 1G15A 4KI4A 5AR0A 1N32K 3FZHA 3OYNA 3PIOL 2KTQA 2YNHA 3O9TA 2Q97A 3OTOK 3CCJN 4JNEA 4DKWA 3VETA 3PLAA 2VGMA 4YHHK 3PSIA 3ZSWA 5TKYA 4RW7A 1U4BA 3VEXA 3KIOA 3BP8A 3G4SN 3M3ZA 1FJGK 1IG9A 2OTJN 2DPNA 1UWBA 3AVNA 3LALA 1RDWX 4M41A 4FWKA 3LAKA 5E41A 3ENOA 4MO5A 4YORA 4OJRA 3QEWA 2OZMA 4M63C 4B1XB 4GV3A 2YHYA 4JN4A 3D0PA 1OH7A 1TVRA 3PUFA 1BDGA 4A2AA 3WNFA 1KLNA 2FSKA 4FJGA 3OVNA 3KD1E 1NJZA 3U4LA 3VA3A 4Z4GA 3FZKA 2UUAK 2P9IB 5AQPA 3LP0A 4EP5A 1ZBFA 1HX1A 3MDQA 3V1QA 1TK0A 3ZEUA 5KPTA 1YT3A 3HT3A 3DXKA 4M3TA 4ZHRA 3LP3A 2Z1IA 1XI1A 3O6WA 1SZ2A 4PWDA 4IBNA 3SJHA 4HCCA 4NB4A 3CM6A 4I9QA 4BG9A 4O0IA 3C6AA 4BGAA 4DUZK 2D5RA 1M90O 2P9SA 4JI5K 1VHXA 2O8DB 3RSEA 4B3MK 1U04A 1GLBG 1S9EA 1OKJA 4B1VA 4A59A 1QQMA 3E66A 3ID6A 2V51B 4CFDA 3V9UA 4CESA 3L2WA 1HQEA 1IBMK 4K8ZA 4OPAA 3ZSQA 2AA4A 1SAZA 2QKKA 2IAJA 2R7YA 1V4SA 3ZLJA 2RHKA 1I94K 5HROA 3C6UA 3CCVN 2ITMA 4ISFA 3OYJA 3QEPA 2DFFA 3CJCA 4QS8A 3CQ8A 1BU6O 1CLQA 2OCEA 4CHNA 3EZWA 4W5TA 1BOTO 1NJIO 4WYBA 3FZFA 5HOOA 2PZSA 3H6EA 5LL6Z 3U3GA 4CF2A 1RFQA 4X66K 3O4NA 3CCMN 1SV5A 5AQIA 2HHWA 3GBTA 5EX5A 5T7BA 4H0YB 3JS6A 2JWLA 4DTPA 3DXMA 4AHUA 2HVHA 3NF9A 3CPWM 4DTJA 3WEEA 2ATQA 3ZT1A 3ZYYX 1T6DA 4CGFA 4CF9A 3MAQA 3P83D 2NRZA 2P9UA 4FYDA 4FOIA 3P1GA 3O3FA 3CCQN 1C0TA 4BR5A 1HNZK 1SL0A 1HMVA 1ATSA 5BN8A 3TAFA 4HTLA 5KRSA 1RT5A 1D4XA 4DSLA 1RT2A 1VRTA 4B1WB 3KJVA 2IC3A 4I6MB 3KWIA 3UKUB 4X64K 4FJKA 4M3UA 1HNWK 4KV8A 1RTJA 5KI6A 4FLWA 1LOTB 4DUYK 3CMAN 1HNXK 3AA5X 4IZ9A 5HBMA 5JVHL 4BRPA 1YI2N 4CZKA 2FLOA 2IS3A 4CEQA 4BR0A 3IDHA 4IOXA 1HKCA 2A40A 2OPRA 2A42A 1IKXA 2NUBA 3FZLA 3ZETA 2FBXA 2YNIA 3L3UA 3SBGA 2QWRA 4BRDA 1QQCA 4DR3K 3OY9A 2VG6A 3R1XA 3E9PA 1NJYA 2VG5A 4BR4A 4CJVA 3VQ5A 3FLCO 1IKYA 2BE2A 2DTUA 4IJAA 1VQ6N 2HOEA 4FLXA 2D0PA 4B08A 4OO1J 3THWB 1EWRA 4KTQA 3OYFA 4H5WA 4BRHA 2WC9A 3QLHA 1C0FA 3O08A 2G8IA 1CZ9A 1E4GT 1RNHA 4CI6A 3TAMA 1DT9A 3CMEN 5JLFA 4BC2A 4CGJA 4BREA 3QEXA 4CIFA 4F9OA 1GLFO 2E1ZA 1U2VA 3VQEA 4DFJA 3S3MA 3V9ZA 1NK4A 1K9MO 1L3SA 4FJ9A 3OS2A 1OVQA 2Z1GA 2UUCK 4FZXC 4DV6K 3ZX0A 4TSXA 4MLHA 5AQJA 4ZTFA 2KLAA 1QSLA 1QVGM 2KQ2A 3HPGA 5DM7L 1HKGA 3OYAA 3WQTA 1TYQA 1L3UA 1WAFA 3UIQA 1CXQA 5HRPA 4O8UA 4CBUA 2GV9A 1HUXA 1VSKA 1NLVA 5KTQA 4FJ5A 2D0BA 2X6SA 3PX6A 4HCBA 3H45C 2GUPA 1YTAA 4IOCL 4YY3K 3SBTA 4JD2A 4WQ4A 4DV3K 2E4LA 1U47A 1BGXT 4BVPA 3CI5A 3MEDA 4CCHA 3PO5A 2H3GX 4BC4A 4CK2A 4DTRA 2ZJRL 1IBKK 1XMOK 2E5LK 2P9PB 5JVGL 1WSHA 4FWRA 3EKUA 4BVOA 5BRDA 4JS4A 3K0SA 2WBNA 3NH0A 1WSEA 3QEIA 4N76A 3KWGA 4CJKA 3DYAA 4I9LA 4LF6K 4F2RA 5AQFA 3JXUA 2BH1A 4O44A 2XHBA 5KQDA 2I7NA 5LY3A 3AVHA 5C12A 1TK8A 4M45A 5FLXO 4YOUA 4NYFA 3D2EA 4H5NA 3CPEA 3A5NC 4FLZA 3HM9A 3LDPA 3VQDA 3EE8A 3A0IX 5HL7L 3DLLL 2F8TA 4H0TB 5AQRA 4JKBA 3AAPA 4FVMA 3OYIA 3TAGA 5DM6L 1X9WA 4BRNA 1VSEA 4H5TA 3DAWA 1VQLN 1HKBA 1OH5A 4M42A 4PQUA 2E1YA 2HHUA 3NGYA 4DR7K 4Y1CA 2KZMA 4K25A 3QIOA 1NOZA 2VCPA 3N4PA 4MLEA 3RMAA 4NCBA 3WXIA 1SKSA 4DU1A 3O80A 1KLMA 4FW1A 1MU2A 2GX9A 3VF6A 4W5QA 4DSFA 3VQ8A 2XRIA 1WNSA 2ZJQL 1XWLA 3O3GA 4CBXA 4O4GA 3K5LA 5GIOA 1TUUA 3L4QA 2O8CB 3AVFA 4DTMA 4FO0A 4DQIA 3AO1A 5C2DA 2P9LB 1IO2A 4JHDA 3VGLA 4HWIA 3CFRA 1ASWA 4DTOA 3AO3A 2BANA 2IIRA 3MX5A 4XH4A 4MDAA 4DR1K 4E1JA 3AO4A 2O8FA 4O8KA 3EYZA 4LH5A 4X65K 3FGUA 3MECA 1LWCA 3O8MA 4R5PA 5HP1A 3HYFA 4ISEA 4IDHA 2ZF5O 1KQSM 3W3DA 3I8BA 3IRXA 4A61A 2Z1HA 4B3SK 1K8KB 1JL1A 1Y97A 2O4GA 4OPHA 4W5OA 4BWMA 1JJ2M 3ZX2A 1NOYA 4QOZB 4DSEA 3HI0A 3DOKA 4WQ5A 3R9PA 1T44A 4JI8K 2YHXA 3ULDA 1BI4A 1OH6A 3VA0A 3PIPL 4JK7A 1Z26A 3T1AA 3AO2A 2P9NA 4JK9A 1A5XA 3VQPA 1HYVA 1SUQA 3KD5E 1WUAA 3LDOA 1JLCA 1QZ5A 1NGEA 4PHTX 1VSMA 3J7YP 1W7AA 3MN9A 4CJEA 4DQRA 3QDKA 4CGGA 5C10A 4G9ZA 1S72N 4A62A 1MDUB 3CQXA 2RN2A 3M8QA 3MCPA 2XY6A 5AQGA 3V9WA 3Q7CA 1EETA 2G8WA 4F3OA 3G71N 3PY8A 2V7YA 5ADXA 2CGKA 4CFBA 3HPHA 3D7EO 4F3TA 4CIEA 4HUEA 1EXQA 1RBUA 3ZX3A 3HVTA 4JS5A 2G8KA 4ELVA 1S1XA 3MCAB 4BY9C 3ZT2A 1NGFA 2NRHA 3WXLA 1KTQA 5A2QO 4Z4IA 3LL3A 4E7IA 5SWMA 3ALYA 4DQSA 2YKNA 3KLEA 4YOTA 4K42A 1MA9B 3SAHA 3O5BA 4MFBA 2E2NA 4CZJA 5KPZA 4BE0A 3NHGA 3CETA 4DV5K 1TGOA 3WXKA 5AQSA 2UXBK 5AQUA 4PY5A 3QICA 3IFRA 3CCEN 3M6GA 4CD1A 3BZCA 2BUPA 3SAGA 4YNQA 4CZEA 5I42A 2HSTA 4KTZA 5C42A 4V19S 1WAJA 3TAEA 4E89A 1IBLK 2AJQA 4AM6A 3AVMA 4GV9A 4FWNA 4BRLA 1GLDG 1KVBA 1NGAA 1YHQN 2HHQA 2E2QA 2FF3B 3S9HA 2NRTA 3CJ9A 1BO5O 3T1HK 4WFBL 3ZT3A 4BACA 3F5TA 5F2RA 3I8DA 2CH6A 2IVNA 3H3NO 3QIPA 4CJ5A 1YIJN 2GTDA 3V1RA 5FROA 3HP6A 1EWQA 2HNDA 5LJVA 4LF4K 3ENHA 3LZJA 1CXUA 2F7TA 1Q9YA 3OYDA 2VGNA 1XC3A 3C6TA 4I7FA 3VEWA 1WSFA 3LDLA 3PV8A 4KHNA 3MWTA 4CJ7A 1YAGA 4A5BA 3D2FA 4B3RK 2A6AA 5LMNK 5D3GA 5AQZA 3KLFA 4CW7B 3SZ2A 3ITHA 3QBWA 5M1PA 4CHZA 4CHOA 1LWEA 3L6QA 1WOQA 4I2PA 1OVYA 3DI6A 3K2PA 4KB1A 4JKHA 3SQ4A 2G8VA 1HYZA 1BCOA 5FRMA 3HOTA 2ZGYA 1BL3A 3EZ5A 4BRAA 3EY1A 2P9IA 2YV0X 3N4QA 3LP2A 1YJ9N 3AVGA 3ATVA 3CJ1A 1UAXA 2VWKA 5I9EB 3L0QA 4WQ4C 3MXMA 5KPRA 4DTSA 4KHQA 4FOEA 3CCRN 3LWLA 2IDOA 4C8LA 5E84A 3M5RA 5DMRA 4ILHA 4FLYA 3DXKB 4LF5K 4A57A 1LW2A 4N56A 4FWSA 3AVLA 3K57A 1EKEA 1FXXA 1ZBSA 2O8BA 1ZYQA 4OGCA 5M1OA 4BE2A 2F9TA 3OA9A 4O0JA 4GW6A 3FFKB 1KCFA 2P9KA 5HLFA 3L8BA 5TKWA 3Q7BA 3ZSOA 2QWLA 1P8ZA 3MEGA 3ASMA 3NF8A 1KVCA 1JLQA 3HTVA 1RTHA 2FF6A 5AJ3K 4FXDA 4PKGA 4CZHA 4JKDA 4B3TK 4JI7K 4BQLA 4B9LA 4BRGA 1TAQA 3VEYA 2ZD1A 4H0XB 1XNQK 1TL1A 1VQPN 1HPMA 2QWQA 5GADP 1NGJA 3OYBA 2GBZA 3P39A 1A5WA 3O1WA 1RT1A 3RR8A 5I3UA 3VQ4A 2PFUA 3G0ZA 3R3LA 1KXPA 4LH4A 2YX6A 3LAMA 4DU3A 1R0AA 1T05A 2F4VK 4FWMA 3VEVA 4OKJA 4CEBA 4CJTA 2IVPA 1OH8A 3K5OA 3VENA 3SNNA 2GEMA 4Z4CA 1BISA 2WUSA 4EZ6A 4BDZA 3MWPA 5SZTA 1N5YA 1ESVA 1DKGD 3WNHA 4PKHA 2X78A 4CEZA 5JS2A 3DXMB 5CE3A 1LWFA 3DMJA 1T03A 1GLEG 4GVEA 4NCAA 4BC5A 3WEEB 4PL7A 1NJWA 4CVNE 4HTUA 3LPUA 1A5VA 3L4IA 3HRGA 4XH5A 1VSDA 2P9UB 3PSFA 2HW3A 1MWMA 1UA1A 3A5MC 1ZBIA 4U7BA 3RMDA 1S6QA 4B9QA 1GOCA 5E26A 2E20A 3ATUA 1WBBA 2W41A 5F1XA 1QTMA 1ILYA 4KHPK 3UKUA 3OYLA 4E1NA 4H4MA 5C2FA 3U9DA 4C23A 4J2DA 3HO1A 4EP4A 4FWQA 3OS0A 1NU0A 1IKVA 2ZGZA 2HHXA 4HHTA 1RGIA 3ZSRA 3THYB 4NXMK 1RDCA 4DF8A 1C0GA 5LJWA 1X3MA 5BPNA 1IKWA 1JXEA 2W6KA 1BQMA 1O1WA 1Q8IA 1WSIA 2FXUA 4DFKA 2OANA 4BRIA 1B92A 3AY9A 1VQ7N 4FJNA 4WQ5C 3VQCA 4CJWA 1KAYA 2DFHA 4K43A 1Q9XA 4IO9L 4Z4HA 4K0KK 4E19A 3OW2M 4FJMA 3HPOA 4X62K 2AP1A 2BGGA 1Z6RA 3H46O 3SUNA 5JICA 1TL3A 2G8HA 3U9ZA 4M3RA 1GLLO 3CD6N 3MEEA 3TR8A 1U45A 1VQNN 1J54A 5MLCQ 1NK5A 1KD1O 4EFHA 3AVCA 2YHAA 4NLBA 4NYNA 4F8RA 4CD3A 4O5BA 5GAGP 1QHTA 1VSLA 4FPAA 4DS4A 3R6MA 4BG8A 3CQYA 1U2VB 1H1VA 3GG4A 4KREA 2I7PA 4E3SA 4JYAK 3GL1A 1NMDA 5DK5A 2PAVA 2JWKA 1RT3A 1U49A 5AQMA 4CJLA 2A5XA 3PX0A 5AFUA 5KQ8A 5C0YA 1RBSA 1C1AA 3J8AA 2W42A 2EX3A 3VGMA 3L3VA 3O1BA 1B9FA 3ZSYA 2D0AA 3BF1A 2F9WA 4GKKK 3KZBA 3SPYA 1KAXA 4AHTA 2X74A 4LD0A 4DV4K 3E9OA 4B9MA 2FC0A 4JI6K 4F4KA 2QWMA 3VQ7A 4CF1A 4HUGA 3DJCA 3TI0A 1KFSA 1VAZA 4L3QA 1KAZA 3WQUA 5BRFA 3NF6A 3K5MA 4IDKA 4OGEA 4JD2B 3A8YA 2UXDK 4DV2K 3E01A 4DG1A 4OKKA 2HF4A 4EAHD 4CEOA 3K9KA 3VQAA 4C8OA 2F8SA 3BY5A 3SI6A 3KKRA 3RTVA 3HVRA 1NGCA 2GWKA 3RWUA 5EOYA 1RBTA 4U67L 5AZJA 4Z4FA 1ZBUA 3OJSA 4JV5K 5AQLA 3MMVA 3W0LA 4JK8A 3CXCM 2FBVA 4Q5VA 4G1QA 5H1SQ 3OS1A 3DLEA 3TANA 4BE1A 3QNOA 2NRWA 1XNRK 3TSQA 4BGBA 2XY5A 4ELTA 1YTUA 1KRPA 1KVAA 4DTUA 2ASMA 4UQGA 1C0MA 3TTDA 1XHXA 1VQON 4KFBA 4FCYA 4DQ8A 4ELUA 3DOLA 1P90A 1J5OA 3KLGA 2GELA 3CF5L 3T7ZA 1QHAA 4MO4A 2OZSA 4RW4A 3D2EB 3O9UA 4BRFA 4JKAA 3L2RA 3V1OA 3WNGA 4WE1A 3OYCA 4CFAA 1XC9A 2YJFA 4BDPA 2B5JA 3AVKA 1JLFA 1RT6A 5EVZA 4E7KA 3FZMA 4LY7A 3M8SA 2HBMA 2BTFA 2WFBA 4QAGA 2ASOA 2GUIA 4FLVA 2YHWA 5AQOA 2YNGA 4C8KA 3KKSA 3R8EA 3MXIA 4MDBA 3OJUA 4PL8A 2ITGA 4RTFD 3TWHA 3QNNA 3AA3A 4CE9A 3L2UA 1VSJA 2PBDA 4B9SA 4AM7A 3ULEA 3QFPA 3IAYA 1RDBA 3O9QA 4CERA 2UXCK 4BQZA 4JI1K 3VF2A 3ZSVA 4FPBA 1YVNA 2D1KA 2HBLA 2YHBA 2W40A 4CEEA 3WT0A 2VYPA 3F9KA 4FJ7A 1HQUA 4JRQA 1L3VA 3SMPA 5GINA 1RT7A 4M7XA 3C95A 4J8FA 4YOWA 1BWFO 4CEFA 1BG3A 3ZT4A 4JHDB 1C1CA 1RBVA 3UB5A 3NDKA 4FJJA 2YNFA 4AHSA 5FDLA 3EKSA 4CBWA 2O8EA 3CFPA 3SUOA 1S22A 3B6OA 3NGZA 2O8FB 2Q31A 4EIAA 3QFUA 1IV0A 3H08A 1Y64A 3O9SA 5AQWA 3HM8A 4FM0A 3OHRA 4IFEA 4KTWA 1K73O 3WXMB 3IUCA 3C0BA 5EXWA 4WCEL 4E7LA 4BR2A 3OYHA 3LDQA 1K8KA 2E8AA 1RCHA 3EN9A 1CZBA 1Q18A 1J6ZA 1X9SA 1NKEA 1NJXA 4FLTA 1QQOA 3E9LA 2DFEA 2OPSA 4JLHA 1REVA 3EEQA 3U3YA 2FBYA 1GLCG 4FLUA 1XQSC 2YKMA 1RTDA 1Q81O 2J4RA 5GIPA 3MX2A 3DLHA 3S41A 4KH4A 4YDUC 4WFAL 5GAEP 5BREA 1VQ9N 1NK7A 4BC3A 2Q3SA 3LP1A 3MN7A 3T19A 5J2NA 1JLAA 3AGKA 5FPEA 3V9SA 3AARA 3SMSA 1K8AO 1RT4A 1S5JA 4IXCA 4GKJK 1QS4A 4YOXA 2Q0UA 1NK9A 1M1KO 4H0VB 1JCGA 4LFBK 4DSIA 3D45A 3J80O 2WTUA 3THXB 5AQXA 4JKGA 3WNEA 3C65A 4IEEA 1N6QA 1JKHA 1NMNA 5M1NA 3F2KA 2VG7A 1XMQK 4YOYA 4DWIA 2IGIA 1LAVA 4Y0WA 3PO4A 3LDSA 2B4JA 4KH6A 1ZBHA 1N34K 1JCEA 1GOAA 3AAQA 3TSPA 1T7PA 3VOVA 3OBYA 2CGJA 1WLJA 1X1PA 4BROA 3LM2A 2WOMA 3RVCA 4CEAA 2IOCA 1Z25A 3VMFB 3KK2A 4M3WA 3OYGA 1G99A 4EZ9A 5AZIA 4JKEA 4AH9A 4B8CA 3CERA 3CC2N 1SL2A 3CC4N 4KHYA 2P51A 3C7NA 3BUZB 2KFNA 3J81O 3HK2A 2E2OA 1DLOA 1LAWA 4GNIA 3ENBA 5HRNA 3I56N 3K5NA 3CCSN 4M3XA 4CGHA 4GMJB 3NFAA 4FJIA 4RW8A 3UKRB 4C1NI 4H03B 4KPYA 2P1JA 3C94A 3O3HA 3ZCMA 1ATRA 1J53A 4RW6A 3KLIA 3BF3A 3AA4A 2IVOA 4FZYA 4ISGA 1XHZA 1UOCA 1VSHA 1S6PA 3AVAA 3DLKA 3ISNC 1SQKA 4RG8A 3CIPA 1KFDA 2BDPA 2QI2A 2NZTA 4CECA 5AQYA 4RW9A 4CJRA 2V52B 1TV6A 3B8AX 3CYMA 5BR9A 3D6RA 3VPZA 2VWJA 1JXBA 4ZTJA 1NK8A 3QB0A 5F0XA 2Q2RA 1CZAN 1N36K 3MN5A 1JLEA 3QO9A 3U8XA 2ZE2A 5FRNA 3RRHA 1KSPA 1SS6A 4QS9A 2HHSA 4AF1A 3KHYA 3D2FB 4M3YA 1BHLA 3K9JA 3CG7A 5BR8K 3K59A 4E1MA 4ILGB 4LF7K 1NBWA 4LF9K 5IT9O 1X9MA 1WSJA 4FM1A 4R79A 1BA1A 3HSCA 5JLHA 3SJJA 4FWPA 3MXJA 4H8KA 3SQ0A 3H3OB 3DRSA 2VQFK 1GLAG 3H1VX 3F73A 5J2PA 2RPIA 4BRQA 4C8MA 4CFCA 3VERA 5EY4A 3CJ7A 1BCMA 5JMVA 4IWVA 4CZIA 1TAUA 2CGLA 1D9DA 2QTDA 3VF4A 4NO7A 2NRRA 1YXQA 5K14A 4N41A 3ZEUB 3VEZA 3IKMA 3V4IA 4GV6A 2YI1A 4BRCA 1NK6A 1NM1A 4N47A 2P5OA 3M1FA 1NGGA 2E88A 3LWMA 4CK3A 1MWKA 4AHRA 2KKZA 2D0CA 4KAZA 3OYEA 4O55A 2E2PA 1SL1A 5BPLA 3P5JA 2O8BB 1N33K 4Z94A 2P9SB 2O8DA 4KRFA 3AA2A 1TKTA 1IH7A 3RSEB 1ASVA 2P9KB 3GE1A 3ZT0A 3DLRA 1SKRA 4RCHA 1Q7YO 1EO1A 1RDUA 2QXFA 4CJQA 4IKFA 1DGKN 1YITN 4DV0K 3RR7A 4DSJA 4W5RA 4H5VA 3TAPA 2HB5A 1T6CA 3TTCA 2OPQA 4DLEA 3EE9A 1E4FT 1YVUA 2QKBA 1C1BA 1VRUA 1U6ZA 2HVIA 5ADXH 4GY2B 5CHIA 2HF3A 2ZJPL 3CCUN 4DQQA 2YCHA 3SQ1A 1HRHA 1QSSA 1VQ4N 4E7HA 1QE1A 4YDUA 1NK0A 4L8RB 1KC8O 3DM2A 4DR6K 2WONA 4J2EA 3SK3A 2Q36A 3KK7A 1J9AA 3BGRA 3IMXA 4OX9K 1GOBA 1Z05A 4OPJA 4PA1A 2Y1JA 3SCXA 1JCFA 4OLBA 3O9RA 3V81A 1HJRA 4B9NA 5KRTA 3VQ9A 3QERA 5C15A 4HUFA 1VSFA 4A5AA 3ZSZA 4JKFA 4YOVA 4CZMA 3JSMA 4B9UA 3G6EN 2G8FA 2V7ZA 2HNYA 4DV1K 4DR5K 1FKOA 2I5JA 4DFPA 4CF0A 5J2QA 3AVIA 4FVUA 2YJEA 2Z1JA 2HHVA 4FSVA 4I6MA 3HOSA 2NNWA 1WB9A 1QSYA 3LZIA 3F9MA 4Q0BA 5AQKA 3THVA 1ZBLA 3TU5A 1NGHA 3CJAA 4JAXA 5CZ2A 1S1VA 1D5AA 4KHSA 4DMNA 3SV3A 4N5SA 5B8HA 4CIGA 3P38A 3QETA 4DB3A 4CJSA 3THYA 3CCLN 5HRSA 4B3OA 3E1YA 3ZETB 4H0PA 4K8XA 1IJJA 3A5LC 4Z4EA 3WXJA 2VQEK 1L5UA 3CFOA 3RRGA 3T1YK 4DS5A 2A41A 1RDDA 4QS7A 3TPQA 1YJWN 1HNVA 2JLEA 5AQHA 4Y1DA 5C24A 5J1EA 3THWA 4OPKA 3HSTB 2PYJA 2QWNA 3CJBA 3CC7N 1HLUA 2P5GA 1FK9A 1VQKN 2FSNA 3PX4A 4KO0A 5AQTA 2UUBK 3EO3A 1TKDA 2HHHK 3GOIA 2QEXN 3NMUA 2OA8A 1LV5A 4I2QA 3GDQA 1I39A 3DLBA 5CR4A 1I3AA 1IG8A 4EHUA 3C6HA 4CK1A 1R59O 1N8RO 3L2QA 4DR2K 1EP4A 5FPMA 3AV9A 4F2SA 2E6LA 1W0HA 2D4WA 4C1NK 1Q82O 1VQMN 4EHTA 3SQ2A 3TAQA 2NRVA 3U6FA 2XY8A 4KB0A 1NGDA 1RILA 3TSUA 4WF9L 4CZGA 4KHWA 3FR0A 3KVGA 1TYQB 3QESA 1BA0A 2PYLA 2KHOA 2HNZA 4AILC 3LDNA 4IOAL 4QCLA 4FK0A 2QWOA 3JAMO 3V6DA 4DLGA 2UU9K 5KGWA 2GWJA 2UYTA 4JI4K 4JEPA 1EX4A 2X6NA 3KK3A 4XH1A 2A1SA 3MK6A 4JKCA 3HZ6A 3QBXA 3VQBA 3AGRA 4E0DA 1DEJA 3NVMA 1S1WA 4KBOA 4BRMA 4FJHA 2O4IA 2P9PA 1NWKA 5BN9A 1HR0K 4IO8A 1BUPA 4CGDA 3FFIA 3O4QA 4C8NA 1VK0A 2DY4A 4W5NA 3TABA 4JI2K 2FSJA 4CEDA 5AZJB 3S3NA 4B9VA 3OYMA 4LFAK 1FW6A 2ZM6K 4BDYA 3B6PA 3RMCA 1XUPO 3I33A 4ID5A 1FKPA 4NXNK 5HRRA 3VTHA
chains in the Genus database with same CATH topology
4BRAA 5FPEA 3AARA 3SMSA 1K8AO 4IZ9A 5BRHA 5JVHL 4IXCA 2QM1A 4BRPA 1EQYA 1YI2N 2A3ZA 4CZKA 2FLOA 1VQ8N 2P9IA 4YOXA 2Q0UA 4BR0A 1M1KO 3N4QA 3IDHA 4H0VB 5AQQA 4IOXA 1HKCA 1YJ9N 1JCGA 2A40A 3ATVA 2RE2A 3CJ1A 4DCHA 5AQXA 3UE5A 4JKGA 5I9EB 2A42A 3L0QA 5M1QA 4WQ4C 3C65A 4IEEA 5KPRA 3P31A 3FZLA 4FOEA 3CCRN 3ZETA 3ID8A 4IJNA 5E84A 3M5RA 4ILHA 3F2KA 3SBGA 3DXKB 2QWRA 4BRDA 5M1NA 4A57A 3I55N 1YJNN 2EWSA 3R1XA 3O4WA 4FWSA 4YOYA 4H5RA 3E9PA 1ZBSA 4A2BA 4K41A 4CZLA 4Y0WA 4BR4A 3FLCO 5M1OA 1QZ6A 4KH6A 2F9TA 1JCEA 3AAQA 1X9JA 3TSPA 3OA9A 4IJAA 1VQ6N 2HOEA 3FFKB 3VOVA 2D0PA 4OO1J 3OBYA 2P9KA 1S3XA 1ZXOA 2CGJA 5TKWA 2QWPA 1NGIA 4H5WA 3Q7BA 4BRHA 2WC9A 2QWLA 1P8ZA 1W2BM 1C0FA 4BROA 3LM2A 3O08A 3RVCA 3HTVA 2FF6A 4UY8O 1E4GT 4PKGA 3VMFB 4CZHA 1HJOA 4CI6A 4JKDA 2QA4N 1DT9A 1G99A 4BQLA 5AZIA 3CMEN 2QXLA 4JKEA 4BC2A 3ULEB 4BRGA 5JLFA 3VEYA 3CERA 4BREA 3CC2N 3CC4N 4F9OA 1GLFO 2E1ZA 4H0XB 1U2VA 3C7NA 3BUZB 1VQPN 1V4TA 1HPMA 4FWOA 2E2OA 1K9MO 4B1YB 2QWQA 4GNIA 2P9LA 3ENBA 4IEIA 3I56N 3CCSN 5GADP 1NGJA 3UKRB 4C1NI 3BEXA 4H03B 3P39A 4NLCA 3ZX0A 1ATRA 4B1UB 2NLXA 3O1WA 4MLHA 3SAFA 5AQJA 1Q86O 3WUHA 3BF3A 2IVOA 2KLAA 3NVKA 4ISGA 4FWLA 1QVGM 2PFUA 5DM7L 1SQKA 1HKGA 3R3LA 3CIPA 1KXPA 3WQTA 2YX6A 2QI2A 1TYQA 5M1KA 4B1ZA 3LM9A 4BRKA 3FE1A 2NZTA 5AQYA 5AQVA 3VGKA 3CHWA 3OBWA 4O8UA 4CBUA 1HUXA 4FWMA 3VEVA 2V52B 2IVPA 3B8AX 5FPNA 1NLVA 3VENA 5BR9A 2GEMA 3D6RA 3VPZA 2WUSA 4XEIA 3QB0A 5F0XA 3H45C 2GUPA 1O13A 3MWPA 4IOCL 1ESVA 1DKGD 1LCUA 1CZAN 2Q2RA 4JD2A 4PKHA 3SBTA 3T69A 1TUYA 3MN5A 4WQ4A 3U8XA 2Q0RA 3DXMB 5CE3A 1GLEG 4GVEA 1SS6A 4BC5A 4BVPA 3J7ZO 3CI5A 3WEEB 4QS9A 4AF1A 2H3GX 4PL7A 3KHYA 3D2FB 4BC4A 3K9JA 2ZJRL 3HBTA 3L4IA 3HRGA 4XH5A 4ILGB 3TTFA 1NBWA 2P9UB 2P9PB 5JVGL 1YUWA 2Q1NA 1MWMA 2P9NB 4FWRA 3EKUA 4ILJA 3A5MC 4BVOA 5BRDA 4U7BA 4R79A 4B9QA 1BA1A 2CH5A 2E20A 2HBKA 2WBNA 3ATUA 3HSCA 4LC9B 5E26A 5JLHA 5AFUH 5M1FA 4FWPA 3KWGA 2W41A 5F1XA 1X3NA 3H3OB 3VTIA 1GLAG 5BPMA 3H1VX 1ILYA 4PKIA 3UKUA 4BRQA 5AQFA 3JXUA 2BH1A 3VERA 5C2FA 5EY4A 3CJ7A 5AQNA 3U9DA 4C23A 5KQDA 5JMVA 2I7NA 4IWVA 5LY3A 4BR7A 1QVFM 4FWQA 5C12A 4CZIA 4CZFA 5FPDA 2CGLA 2ZGZA 2QTDA 2QW9A 4YOUA 3VF4A 4NO7A 2NRRA 1RGIA 1YXQA 3D2EA 3ZEUB 4H5NA 3VEZA 3MN6A 3IKMA 1C0GA 2HMPA 4GV6A 2YI1A 2ZWHA 3A5NC 3CPEA 4BRCA 1GLJO 3LDPA 5LJWA 3EE8A 1X3MA 5ADXH 1NM1A 3A0IX 5HL7L 3DLLL 5BPNA 3M1FA 1NGGA 4JKGB 2FXUA 4H0TB 2E88A 4JKBA 5AQRA 3AAPA 1NGBA 2OANA 1MWKA 4BRIA 2KKZA 5DM6L 3AY9A 1VQ7N 4WQ5C 4BRNA 1KAYA 4H5TA 3DAWA 1W97L 4K43A 4IO9L 1VQLN 2E2PA 1HKBA 5BPLA 3OW2M 4Z94A 2E1YA 1QQNA 2AP1A 2P9SB 1Z6RA 3H46O 4K25A 3QMLA 5JICA 2ASPA 2VCPA 3N4PA 4MLEA 3RSEB 3U9ZA 3G25A 3SLCA 3WXIA 1GLLO 2P9KB 3CD6N 3O80A 4KH5A 3GE1A 4RCHA 2GX9A 3VF6A 1Q7YO 1EO1A 1RDUA 1VQNN 4FL9A 3EL2A 1DGKN 1T3VA 5MLCQ 4WFNL 1YITN 4RWTA 4DHYA 1KD1O 4H5VA 4EFHA 1T6CA 3TTCA 2ZJQL 4NLBA 3VEOA 4CBXA 3EE9A 1E4FT 5AZIB 4CD3A 5GAGP 4FPAA 3A5OC 3R6MA 4BG8A 5GIOA 1TUUA 1U6ZA 3CQYA 1U2VB 1H1VA 3GG4A 3L4QA 2I7PA 3C7NB 4FO0A 4GY2B 5ELZA 3DWLA 2HF3A 5CHIA 1YF5L 2ZJPL 3CCUN 5GAHP 1VQ5N 3GL1A 1NMDA 2YCHA 5C2DA 4O5FA 2P9LB 3H1QA 3UKRA 4H0OA 2PAVA 1VQ4N 2JWKA 2NRXA 4YDUA 4JHDA 3VGLA 4HWIA 5AQMA 2A5XA 1KC8O 1ATNA 4M7YA 3VESA 2IIRA 5AFUA 3MX5A 2HBJA 5KQ8A 4XH4A 4MDAA 2D0OA 4BR9A 4E1JA 5C0YA 3SK3A 2Q36A 2VWBA 3KK7A 3J8AA 3IMXA 4O8KA 1Z05A 3VGMA 1ZC6A 3O1BA 3P4IA 3BF1A 2F9WA 1JCFA 3FGUA 3KZBA 3O9RA 5AR0A 1KAXA 1YHQN 3O8MA 3FZHA 3E9OA 4ISEA 4IDHA 5C15A 3PIOL 2ZF5O 1KQSM 3W3DA 3I8BA 4A5AA 3O9TA 4A61A 2Q97A 2QWMA 4JKFA 4YOVA 3DJCA 3CCJN 1K8KB 1VAZA 4JNEA 1KAZA 4L3QA 3WQUA 5BRFA 4DKWA 3VETA 4CZMA 4OPHA 3PLAA 2VGMA 4JD2B 3A8YA 3ZX2A 3G6EN 1JJ2M 5TKYA 2HF4A 2V7ZA 4EAHD 3HI0A 4WQ5A 3K9KA 3VEXA 3G4SN 3BP8A 3M3ZA 3R9PA 1T44A 2YHXA 1NGCA 2GWKA 2OTJN 2DPNA 3PIPL 5EOYA 4JK7A 4U67L 4FVUA 5AZJA 1RDWX 2YJEA 4FWKA 2P9NA 4JK9A 4FSVA 4I6MA 3HOSA 2NNWA 3ENOA 4MO5A 4YORA 5AQLA 3MMVA 3W0LA 1WUAA 3LDOA 4JK8A 3CXCM 4M63C 5H1SQ 1QZ5A 3F9MA 4B1XB 4GV3A 1NGEA 2YHYA 4JN4A 2NRWA 4PHTX 1NJIO 5AQKA 3TSQA 3MN9A 4BGBA 3QDKA 1BDGA 3TU5A 4A2AA 1NGHA 3CJAA 4JAXA 2FSKA 3U4LA 5C10A 4G9ZA 1S72N 4A62A 1MDUB 2ASMA 3CQXA 3FZKA 3TTDA 1VQON 2P9IB 3MCPA 5AQGA 4DQ8A 3Q7CA 5AQPA 1P90A 5B8HA 3G71N 1HX1A 3P38A 2V7YA 2GELA 3CF5L 3T7ZA 1QHAA 3MDQA 4MO4A 4DB3A 5ADXA 2CGKA 3ZEUA 3CCLN 5KPTA 3D2EB 3O9UA 4BRFA 3E1YA 3D7EO 3DXKA 3ZETB 4JKAA 4H0PA 1IJJA 3A5LC 2YJFA 3WXJA 3ZX3A 3O6WA 5EVZA 1SZ2A 2A41A 3FZMA 4QS7A 3TPQA 2HBMA 3MCAB 3SJHA 1YJWN 4NB4A 2BTFA 4BY9C 5AQHA 1NGFA 2NRHA 2WFBA 4BG9A 2ASOA 3WXLA 3LL3A 3C6AA 4BGAA 2YHWA 1M90O 5AQOA 2P9SA 2QWNA 3CJBA 3CC7N 1HLUA 3R8EA 1VQKN 2FSNA 4MDBA 3RSEA 4YOTA 1GLBG 4K42A 4PL8A 1MA9B 4RTFD 3SAHA 3O5BA 5AQTA 2E2NA 4CZJA 5KPZA 2OTLN 1OKJA 3EO3A 2PBDA 3GOIA 3CETA 4AM7A 3ULEA 2QEXN 3NMUA 4B1VA 4A59A 1QQMA 3QFPA 3E66A 3ID6A 3O9QA 3WXKA 2V51B 3GDQA 5AQSA 5AQUA 5CR4A 4BQZA 3VF2A 4OPAA 3QICA 3IFRA 1IG8A 4FPBA 2AA4A 4EHUA 1SAZA 3C6HA 1YVNA 2D1KA 2HBLA 3CCEN 2W40A 1V4SA 3M6GA 1R59O 4CD1A 3WT0A 2BUPA 1N8RO 3SAGA 2RHKA 2VYPA 4CZEA 2HSTA 3SMPA 3CCVN 5FPMA 2ITMA 5GINA 4ISFA 3CJCA 2D4WA 1Q82O 4QS8A 4M7XA 4AM6A 4J8FA 4C1NK 1VQMN 4EHTA 1BU6O 4YOWA 1BWFO 3EZWA 4GV9A 1BG3A 4FWNA 2NRVA 4BRLA 1GLDG 1BOTO 1NGDA 1NGAA 4JHDB 3TSUA 2E2QA 4WF9L 2FF3B 4WYBA 3FZFA 3UB5A 2NRTA 3CJ9A 4CZGA 5HOOA 1BO5O 3EKSA 3FR0A 3H6EA 3KVGA 4WFBL 1TYQB 4CBWA 1BA0A 1RFQA 1S22A 3F5TA 5F2RA 2KHOA 2CH6A 2IVNA 2Q31A 3LDNA 4EIAA 3QFUA 4IOAL 3H3NO 3CCMN 1YIJN 2QWOA 5AQIA 2GTDA 1Y64A 3O9SA 5AQWA 3GBTA 5EX5A 3HM8A 3ENHA 5LJVA 2F7TA 3OHRA 4H0YB 4IFEA 2GWJA 3JS6A 2JWLA 1K73O 2VGNA 3WXMB 1XC3A 2UYTA 3DXMA 3IUCA 3C0BA 5EXWA 3VEWA 4WCEL 3LDLA 4JEPA 4BR2A 3CPWM 4XH1A 3LDQA 3WEEA 1K8KA 2E8AA 3MWTA 3MK6A 4JKCA 4CJ7A 1YAGA 3HZ6A 3ZYYX 3QBXA 3EN9A 4A5BA 1T6DA 3D2FA 3AGRA 1Q18A 1J6ZA 2A6AA 1DEJA 3NVMA 4KBOA 4BRMA 2NRZA 2P9UA 2P9PA 1NWKA 1QQOA 3E9LA 5AQZA 4IO8A 5BN9A 4FOIA 3CCQN 4BR5A 1BUPA 1ATSA 5BN8A 1GLCG 3QBWA 4HTLA 5M1PA 1XQSC 3L6QA 1WOQA 1Q81O 1D4XA 2FSJA 2J4RA 5AZJB 1OVYA 5GIPA 3MX2A 4B1WB 3S41A 4KH4A 4I6MB 4JKHA 4YDUC 3KWIA 3UKUB 4WFAL 5GAEP 5BREA 1VQ9N 1XUPO 3I33A 3HOTA 4BC3A 2ZGYA 1LOTB 3MN7A 3CMAN 3AGKA 3VTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRA A;  5FPE A;  3AAR A;  3SMS A;  4IZ9 A;  5BRH A;  4IXC A;  2QM1 A;  4BRP A;  1EQY A;  2A3Z A;  4CZK A;  2FLO A;  2P9I A;  2Q0U A;  4BR0 A;  3IDH A;  4H0V B;  5AQQ A;  1HKC A;  1JCG A;  2A40 A;  3ATV A;  3CJ1 A;  4DCH A;  5AQX A;  3UE5 A;  5I9E B;  2A42 A;  3L0Q A;  4WQ4 C;  5KPR A;  3FZL A;  4FOE A;  3ZET A;  3ID8 A;  4IJN A;  5E84 A;  3DXK B;  2QWR A;  4BRD A;  2EWS A;  3O4W A;  4FWS A;  4H5R A;  1ZBS A;  4A2B A;  4K41 A;  4CZL A;  4Y0W A;  4BR4 A;  3FLC O;  1QZ6 A;  2F9T A;  1JCE A;  3AAQ A;  1X9J A;  4IJA A;  2HOE A;  3FFK B;  3VOV A;  2D0P A;  2P9K A;  1S3X A;  1ZXO A;  2CGJ A;  2QWP A;  1NGI A;  4H5W A;  4BRH A;  2QWL A;  1P8Z A;  1C0F A;  4BRO A;  3LM2 A;  3O08 A;  3HTV A;  2FF6 A;  1E4G T;  4PKG A;  4CZH A;  1HJO A;  4CI6 A;  1G99 A;  4BQL A;  5AZI A;  2QXL A;  5JLF A;  4BC2 A;  3ULE B;  4BRG A;  3VEY A;  3CER A;  4BRE A;  4F9O A;  1GLF O;  2E1Z A;  4H0X B;  1U2V A;  3C7N A;  3BUZ B;  1V4T A;  1HPM A;  4FWO A;  2E2O A;  4B1Y B;  2QWQ A;  4GNI A;  2P9L A;  1NGJ A;  3UKR B;  3BEX A;  4H03 B;  3ZX0 A;  1ATR A;  4B1U B;  2NLX A;  3O1W A;  4MLH A;  5AQJ A;  3WUH A;  3BF3 A;  2IVO A;  4ISG A;  4FWL A;  1SQK A;  1HKG A;  3CIP A;  1KXP A;  3WQT A;  1TYQ A;  4B1Z A;  3LM9 A;  4BRK A;  3FE1 A;  2NZT A;  5AQY A;  5AQV A;  3VGK A;  3CHW A;  4CBU A;  1HUX A;  4FWM A;  3VEV A;  2V52 B;  2IVP A;  3B8A X;  5FPN A;  1NLV A;  3VEN A;  5BR9 A;  2GEM A;  3VPZ A;  2WUS A;  4XEI A;  3QB0 A;  5F0X A;  3H45 C;  2GUP A;  1ESV A;  1DKG D;  1LCU A;  1CZA N;  2Q2R A;  4JD2 A;  4PKH A;  1TUY A;  3MN5 A;  4WQ4 A;  3U8X A;  2Q0R A;  3DXM B;  5CE3 A;  1GLE G;  4BC5 A;  4BVP A;  3CI5 A;  3WEE B;  4QS9 A;  2H3G X;  4PL7 A;  3KHY A;  3D2F B;  4BC4 A;  3HBT A;  3L4I A;  4XH5 A;  1NBW A;  2P9U B;  2P9P B;  1YUW A;  2Q1N A;  1MWM A;  2P9N B;  4FWR A;  3EKU A;  3A5M C;  4BVO A;  5BRD A;  4B9Q A;  1BA1 A;  2CH5 A;  2E20 A;  3ATU A;  3HSC A;  4LC9 B;  5E26 A;  5JLH A;  5AFU H;  4FWP A;  2W41 A;  5F1X A;  1X3N A;  3H3O B;  1GLA G;  5BPM A;  3H1V X;  4PKI A;  3UKU A;  4BRQ A;  5AQF A;  3JXU A;  3VER A;  5EY4 A;  3CJ7 A;  5AQN A;  3U9D A;  4C23 A;  5KQD A;  5JMV A;  2I7N A;  4IWV A;  5LY3 A;  4BR7 A;  4FWQ A;  5FPD A;  4CZI A;  4CZF A;  2CGL A;  2ZGZ A;  2QW9 A;  3VF4 A;  4NO7 A;  1RGI A;  1YXQ A;  3D2E A;  3ZEU B;  4H5N A;  3VEZ A;  3MN6 A;  1C0G A;  2HMP A;  2YI1 A;  2ZWH A;  3A5N C;  4BRC A;  1GLJ O;  3LDP A;  5LJW A;  1X3M A;  1NM1 A;  3A0I X;  5BPN A;  3M1F A;  1NGG A;  2FXU A;  4H0T B;  2E88 A;  5AQR A;  3AAP A;  1NGB A;  2OAN A;  1MWK A;  4BRI A;  3AY9 A;  4WQ5 C;  4BRN A;  1KAY A;  4H5T A;  3DAW A;  4K43 A;  2E2P A;  1HKB A;  5BPL A;  4Z94 A;  2E1Y A;  1QQN A;  2AP1 A;  2P9S B;  1Z6R A;  3H46 O;  4K25 A;  3QML A;  5JIC A;  2ASP A;  2VCP A;  4MLE A;  3RSE B;  3U9Z A;  3G25 A;  3SLC A;  3WXI A;  1GLL O;  2P9K B;  3O80 A;  3GE1 A;  4RCH A;  3VF6 A;  4FL9 A;  3EL2 A;  1DGK N;  4RWT A;  4DHY A;  4H5V A;  4EFH A;  1T6C A;  3VEO A;  4CBX A;  1E4F T;  5AZI B;  4CD3 A;  4FPA A;  3A5O C;  3R6M A;  4BG8 A;  1TUU A;  1U6Z A;  3CQY A;  1U2V B;  1H1V A;  3GG4 A;  4GY2 B;  2I7P A;  3C7N B;  4FO0 A;  5ELZ A;  5ADX H;  3DWL A;  2HF3 A;  3GL1 A;  1NMD A;  2YCH A;  4O5F A;  2P9L B;  3H1Q A;  3UKR A;  4H0O A;  2PAV A;  4YDU A;  4JHD A;  3VGL A;  4HWI A;  5AQM A;  2A5X A;  1ATN A;  4M7Y A;  3VES A;  2IIR A;  5AFU A;  5KQ8 A;  4XH4 A;  2D0O A;  4BR9 A;  4E1J A;  3SK3 A;  2Q36 A;  2VWB A;  3J8A A;  3IMX A;  4O8K A;  1Z05 A;  3VGM A;  1ZC6 A;  3O1B A;  3P4I A;  3BF1 A;  2F9W A;  1JCF A;  3FGU A;  3KZB A;  5AR0 A;  1KAX A;  3O8M A;  3FZH A;  4ISE A;  2ZF5 O;  3W3D A;  3I8B A;  4A61 A;  2Q97 A;  2QWM A;  3DJC A;  1K8K B;  4L3Q A;  4JNE A;  1KAZ A;  3WQU A;  5BRF A;  3VET A;  4CZM A;  4JD2 B;  3A8Y A;  3ZX2 A;  5TKY A;  2HF4 A;  2V7Z A;  4EAH D;  3HI0 A;  4WQ5 A;  3VEX A;  3BP8 A;  3M3Z A;  3R9P A;  1T44 A;  2YHX A;  1NGC A;  2GWK A;  2DPN A;  5EOY A;  5AZJ A;  1RDW X;  2YJE A;  4FWK A;  2P9N A;  4FSV A;  4I6M A;  3ENO A;  4MO5 A;  5AQL A;  3MMV A;  3W0L A;  1WUA A;  3LDO A;  4M63 C;  1QZ5 A;  3F9M A;  4B1X B;  1NGE A;  2YHY A;  4JN4 A;  5AQK A;  3MN9 A;  4BGB A;  3QDK A;  1BDG A;  3TU5 A;  4A2A A;  1NGH A;  3CJA A;  4JAX A;  2FSK A;  3U4L A;  4A62 A;  1MDU B;  2ASM A;  3CQX A;  3FZK A;  2P9I B;  3MCP A;  5AQG A;  4DQ8 A;  5AQP A;  5B8H A;  1HX1 A;  2V7Y A;  2GEL A;  1QHA A;  3MDQ A;  4MO4 A;  4DB3 A;  5ADX A;  2CGK A;  3ZEU A;  5KPT A;  3D2E B;  4BRF A;  3D7E O;  3DXK A;  3ZET B;  4H0P A;  1IJJ A;  3A5L C;  2YJF A;  3WXJ A;  3ZX3 A;  3O6W A;  5EVZ A;  1SZ2 A;  2A41 A;  3FZM A;  4QS7 A;  3TPQ A;  3SJH A;  4NB4 A;  2BTF A;  5AQH A;  1NGF A;  2NRH A;  4BG9 A;  2ASO A;  3WXL A;  3LL3 A;  4BGA A;  2YHW A;  5AQO A;  2P9S A;  2QWN A;  3CJB A;  1HLU A;  3R8E A;  2FSN A;  3RSE A;  1GLB G;  4K42 A;  4PL8 A;  1MA9 B;  4RTF D;  3O5B A;  5AQT A;  2E2N A;  4CZJ A;  5KPZ A;  1OKJ A;  3EO3 A;  2PBD A;  3GOI A;  3CET A;  4AM7 A;  3ULE A;  4B1V A;  1QQM A;  3QFP A;  3WXK A;  2V51 B;  3GDQ A;  5AQS A;  5AQU A;  4BQZ A;  3VF2 A;  3QIC A;  3IFR A;  1IG8 A;  4FPB A;  2AA4 A;  4EHU A;  1SAZ A;  1YVN A;  2D1K A;  2W40 A;  1V4S A;  3M6G A;  1R59 O;  4CD1 A;  3WT0 A;  2BUP A;  2VYP A;  4CZE A;  3SMP A;  5FPM A;  2ITM A;  4ISF A;  3CJC A;  2D4W A;  4QS8 A;  4M7X A;  4AM6 A;  4J8F A;  4EHT A;  1BU6 O;  1BWF O;  3EZW A;  1BG3 A;  4FWN A;  4BRL A;  1GLD G;  1BOT O;  1NGD A;  1NGA A;  4JHD B;  2E2Q A;  2FF3 B;  4WYB A;  3FZF A;  3UB5 A;  4CZG A;  3CJ9 A;  1BO5 O;  3EKS A;  3FR0 A;  3H6E A;  3KVG A;  1TYQ B;  4CBW A;  1BA0 A;  1RFQ A;  1S22 A;  5F2R A;  2KHO A;  2CH6 A;  2IVN A;  2Q31 A;  3LDN A;  4EIA A;  3QFU A;  3H3N O;  2QWO A;  5AQI A;  2GTD A;  1Y64 A;  5AQW A;  3GBT A;  5EX5 A;  3HM8 A;  3ENH A;  5LJV A;  3OHR A;  4H0Y B;  2GWJ A;  3JS6 A;  1XC3 A;  2UYT A;  3DXM A;  3IUC A;  3C0B A;  5EXW A;  3VEW A;  3LDL A;  4BR2 A;  4XH1 A;  3LDQ A;  3WEE A;  1K8K A;  2E8A A;  4CJ7 A;  3MK6 A;  1YAG A;  3HZ6 A;  3QBX A;  3EN9 A;  1T6D A;  3D2F A;  1Q18 A;  1J6Z A;  2A6A A;  1DEJ A;  4KBO A;  4BRM A;  2P9U A;  2P9P A;  1NWK A;  1QQO A;  5AQZ A;  5BN9 A;  4IO8 A;  4FOI A;  4BR5 A;  1BUP A;  1ATS A;  5BN8 A;  1GLC G;  3QBW A;  4HTL A;  1XQS C;  3L6Q A;  1WOQ A;  1D4X A;  2FSJ A;  2J4R A;  5AZJ B;  4B1W B;  3S41 A;  4YDU C;  4I6M B;  3UKU B;  5BRE A;  1XUP O;  3I33 A;  4BC3 A;  2ZGY A;  1LOT B;  3MN7 A; 
#chains in the Genus database with same CATH topology
 4FJL A;  5BRH A;  2JGU A;  2QM1 A;  1EQY A;  2A3Z A;  4AQY K;  1VQ8 N;  5AQQ A;  4CHP A;  3IS9 A;  2RE2 A;  4DCH A;  3UE5 A;  5M1Q A;  1HNI A;  3P31 A;  4NCG A;  1WBD A;  3ID8 A;  4IJN A;  2B6A A;  3SPZ A;  3I55 N;  3KLH A;  1YJN N;  2EWS A;  3O4W A;  4KKO A;  4H5R A;  3I0R A;  5CY4 A;  4A2B A;  4K41 A;  3NBP A;  3K58 A;  4M3Z A;  4CZL A;  2EHG A;  3LAN A;  4IG3 A;  5CYM A;  1QZ6 A;  4E7J A;  4DSK A;  1X9J A;  3DRR A;  1NKC A;  4PUO A;  1JL2 A;  1S3X A;  1C0U A;  1D9F A;  1ZXO A;  2QWP A;  1NGI A;  3SYZ A;  1S1T A;  4BWJ A;  1W2B M;  4DF4 A;  3SUP A;  4UY8 O;  1HJO A;  2QA4 N;  2QXL A;  3ULE B;  4LFC K;  3VQQ A;  1W9H A;  4LSN A;  3J7A P;  2O8C A;  3VN5 A;  1WN7 A;  4FK4 A;  4KHU A;  3NGI A;  1V4T A;  2XY7 A;  4FWO A;  3HP9 A;  3TAR A;  4B1Y B;  2P9L A;  2F96 A;  3LPT A;  4IEI A;  1BIU A;  4DU4 A;  3BEX A;  3NAE A;  4FZZ A;  4OVL A;  4NLC A;  4FW2 A;  3AVB A;  4B1U B;  4CHQ A;  4FJ8 A;  2NLX A;  3SAF A;  4CHY A;  2XO7 A;  1Q86 O;  3WUH A;  3M8R A;  4ICL A;  3M8P A;  3NVK A;  4FWL A;  3ZSX A;  2KZZ A;  2E6M A;  4OLA A;  1VSI A;  1BQN A;  1HPZ A;  2KFZ A;  3HXM A;  5M1K A;  4Z0U A;  4B1Z A;  3LM9 A;  4BRK A;  2OPP A;  3FE1 A;  1K6Y A;  2O8E B;  4YFU A;  3VGK A;  5AQV A;  1DTQ A;  3CHW A;  3OBW A;  5FPN A;  3NH2 A;  2KW4 A;  3I0S A;  4CJ3 A;  1J5E K;  4XEI A;  1B9D A;  4FJX A;  1O13 A;  1L3T A;  4J2A A;  1LCU A;  3QIN A;  1JLG A;  3T69 A;  1TUY A;  1E3M A;  2Q0R A;  1DTT A;  1NG9 A;  4FM2 A;  4DR4 K;  4HVJ A;  4CJP A;  3J7Z O;  3NH1 A;  2ZQB A;  4IG0 A;  5J2M A;  1BI4 B;  2ETJ A;  4CJU A;  3HBT A;  3BZK A;  4KI6 A;  3SV4 A;  3OYK A;  3TTF A;  4B8A B;  1YUW A;  2Q1N A;  2P9N B;  4ILJ A;  4DTX A;  3DLG A;  4LF8 K;  5JS1 A;  2CH5 A;  2HBK A;  3CM5 A;  4LC9 B;  5M1F A;  5AFU H;  3QEV A;  4JI3 K;  3AVJ A;  1X3N A;  3VTI A;  1BIZ A;  4GVM A;  5BPM A;  3V9X A;  4AHV A;  3VQ6 A;  5LMU K;  4PKI A;  5EU7 A;  4IFV A;  4CF8 A;  5CYQ A;  5AQN A;  2Y1I A;  4AHC A;  1QVF M;  4BR7 A;  5FPD A;  4CZF A;  2QW9 A;  3HL8 A;  2HMI A;  4DQP A;  1TKZ A;  1C6V A;  1UA0 A;  1HYS A;  4MQ3 A;  3BDP A;  3NF7 A;  3MN6 A;  1ITG A;  2HMP A;  4JI0 K;  2ZWH A;  1GLJ O;  4H4O A;  1S1U A;  4DFM A;  3THX A;  5C25 A;  1RDA A;  1NNE A;  4JKG B;  4DTN A;  4JRP A;  1NGB A;  1S9G A;  3KK1 A;  4CGI A;  4XIU A;  2RKI A;  4CJ4 A;  4DV7 K;  3S3O A;  1W97 L;  4IFY A;  1U48 A;  1QQN A;  1TK5 A;  1NKB A;  2QK9 A;  3QML A;  4OKE A;  4J2B A;  1TKX A;  2ASP A;  3G25 A;  4B9T A;  3SLC A;  3L2V A;  4KH5 A;  5CZ1 A;  1JLB A;  4FL9 A;  3EL2 A;  1T8E A;  1T3V A;  4WFN L;  2HHT A;  4RWT A;  4DHY A;  2A1R A;  3NCI A;  3KTQ A;  4CJF A;  3VEO A;  3JYT A;  3G10 A;  5AZI B;  2RF2 A;  2LSN A;  3A5O C;  2PY5 A;  1ASU A;  1WSG A;  2OTL N;  5ELZ A;  3C7N B;  3DWL A;  1YF5 L;  2W6L A;  5GAH P;  1VQ5 N;  2G8U A;  1RTI A;  5KGX A;  1F21 A;  4O5F A;  3H1Q A;  3T3F A;  3UKR A;  4H0O A;  2FBT A;  4LSL A;  2NRX A;  3A2F A;  3IG1 A;  1ATN A;  4M7Y A;  3VES A;  2OYQ A;  3NE6 A;  1SKW A;  3DRP A;  2HBJ A;  3RMB A;  2D0O A;  4BR9 A;  4ID1 A;  1D8Y A;  2VWB A;  3SUQ A;  1RBR A;  1ZC6 A;  5IWA K;  3AO5 A;  4FK2 A;  1LW0 A;  3P4I A;  3HJF A;  1G15 A;  4KI4 A;  5AR0 A;  1N32 K;  3FZH A;  3OYN A;  3PIO L;  2KTQ A;  2YNH A;  3O9T A;  2Q97 A;  3OTO K;  3CCJ N;  4JNE A;  4DKW A;  3VET A;  3PLA A;  2VGM A;  4YHH K;  3PSI A;  3ZSW A;  5TKY A;  4RW7 A;  1U4B A;  3VEX A;  3KIO A;  3BP8 A;  3G4S N;  3M3Z A;  1FJG K;  1IG9 A;  2OTJ N;  2DPN A;  1UWB A;  3AVN A;  3LAL A;  1RDW X;  4M41 A;  4FWK A;  3LAK A;  5E41 A;  3ENO A;  4MO5 A;  4YOR A;  4OJR A;  3QEW A;  2OZM A;  4M63 C;  4B1X B;  4GV3 A;  2YHY A;  4JN4 A;  3D0P A;  1OH7 A;  1TVR A;  3PUF A;  1BDG A;  4A2A A;  3WNF A;  1KLN A;  2FSK A;  4FJG A;  3OVN A;  3KD1 E;  1NJZ A;  3U4L A;  3VA3 A;  4Z4G A;  3FZK A;  2UUA K;  2P9I B;  5AQP A;  3LP0 A;  4EP5 A;  1ZBF A;  1HX1 A;  3MDQ A;  3V1Q A;  1TK0 A;  3ZEU A;  5KPT A;  1YT3 A;  3HT3 A;  3DXK A;  4M3T A;  4ZHR A;  3LP3 A;  2Z1I A;  1XI1 A;  3O6W A;  1SZ2 A;  4PWD A;  4IBN A;  3SJH A;  4HCC A;  4NB4 A;  3CM6 A;  4I9Q A;  4BG9 A;  4O0I A;  3C6A A;  4BGA A;  4DUZ K;  2D5R A;  1M90 O;  2P9S A;  4JI5 K;  1VHX A;  2O8D B;  3RSE A;  4B3M K;  1U04 A;  1GLB G;  1S9E A;  1OKJ A;  4B1V A;  4A59 A;  1QQM A;  3E66 A;  3ID6 A;  2V51 B;  4CFD A;  3V9U A;  4CES A;  3L2W A;  1HQE A;  1IBM K;  4K8Z A;  4OPA A;  3ZSQ A;  2AA4 A;  1SAZ A;  2QKK A;  2IAJ A;  2R7Y A;  1V4S A;  3ZLJ A;  2RHK A;  1I94 K;  5HRO A;  3C6U A;  3CCV N;  2ITM A;  4ISF A;  3OYJ A;  3QEP A;  2DFF A;  3CJC A;  4QS8 A;  3CQ8 A;  1BU6 O;  1CLQ A;  2OCE A;  4CHN A;  3EZW A;  4W5T A;  1BOT O;  1NJI O;  4WYB A;  3FZF A;  5HOO A;  2PZS A;  3H6E A;  5LL6 Z;  3U3G A;  4CF2 A;  1RFQ A;  4X66 K;  3O4N A;  3CCM N;  1SV5 A;  5AQI A;  2HHW A;  3GBT A;  5EX5 A;  5T7B A;  4H0Y B;  3JS6 A;  2JWL A;  4DTP A;  3DXM A;  4AHU A;  2HVH A;  3NF9 A;  3CPW M;  4DTJ A;  3WEE A;  2ATQ A;  3ZT1 A;  3ZYY X;  1T6D A;  4CGF A;  4CF9 A;  3MAQ A;  3P83 D;  2NRZ A;  2P9U A;  4FYD A;  4FOI A;  3P1G A;  3O3F A;  3CCQ N;  1C0T A;  4BR5 A;  1HNZ K;  1SL0 A;  1HMV A;  1ATS A;  5BN8 A;  3TAF A;  4HTL A;  5KRS A;  1RT5 A;  1D4X A;  4DSL A;  1RT2 A;  1VRT A;  4B1W B;  3KJV A;  2IC3 A;  4I6M B;  3KWI A;  3UKU B;  4X64 K;  4FJK A;  4M3U A;  1HNW K;  4KV8 A;  1RTJ A;  5KI6 A;  4FLW A;  1LOT B;  4DUY K;  3CMA N;  1HNX K;  3AA5 X;  4IZ9 A;  5HBM A;  5JVH L;  4BRP A;  1YI2 N;  4CZK A;  2FLO A;  2IS3 A;  4CEQ A;  4BR0 A;  3IDH A;  4IOX A;  1HKC A;  2A40 A;  2OPR A;  2A42 A;  1IKX A;  2NUB A;  3FZL A;  3ZET A;  2FBX A;  2YNI A;  3L3U A;  3SBG A;  2QWR A;  4BRD A;  1QQC A;  4DR3 K;  3OY9 A;  2VG6 A;  3R1X A;  3E9P A;  1NJY A;  2VG5 A;  4BR4 A;  4CJV A;  3VQ5 A;  3FLC O;  1IKY A;  2BE2 A;  2DTU A;  4IJA A;  1VQ6 N;  2HOE A;  4FLX A;  2D0P A;  4B08 A;  4OO1 J;  3THW B;  1EWR A;  4KTQ A;  3OYF A;  4H5W A;  4BRH A;  2WC9 A;  3QLH A;  1C0F A;  3O08 A;  2G8I A;  1CZ9 A;  1E4G T;  1RNH A;  4CI6 A;  3TAM A;  1DT9 A;  3CME N;  5JLF A;  4BC2 A;  4CGJ A;  4BRE A;  3QEX A;  4CIF A;  4F9O A;  1GLF O;  2E1Z A;  1U2V A;  3VQE A;  4DFJ A;  3S3M A;  3V9Z A;  1NK4 A;  1K9M O;  1L3S A;  4FJ9 A;  3OS2 A;  1OVQ A;  2Z1G A;  2UUC K;  4FZX C;  4DV6 K;  3ZX0 A;  4TSX A;  4MLH A;  5AQJ A;  4ZTF A;  2KLA A;  1QSL A;  1QVG M;  2KQ2 A;  3HPG A;  5DM7 L;  1HKG A;  3OYA A;  3WQT A;  1TYQ A;  1L3U A;  1WAF A;  3UIQ A;  1CXQ A;  5HRP A;  4O8U A;  4CBU A;  2GV9 A;  1HUX A;  1VSK A;  1NLV A;  5KTQ A;  4FJ5 A;  2D0B A;  2X6S A;  3PX6 A;  4HCB A;  3H45 C;  2GUP A;  1YTA A;  4IOC L;  4YY3 K;  3SBT A;  4JD2 A;  4WQ4 A;  4DV3 K;  2E4L A;  1U47 A;  1BGX T;  4BVP A;  3CI5 A;  3MED A;  4CCH A;  3PO5 A;  2H3G X;  4BC4 A;  4CK2 A;  4DTR A;  2ZJR L;  1IBK K;  1XMO K;  2E5L K;  2P9P B;  5JVG L;  1WSH A;  4FWR A;  3EKU A;  4BVO A;  5BRD A;  4JS4 A;  3K0S A;  2WBN A;  3NH0 A;  1WSE A;  3QEI A;  4N76 A;  3KWG A;  4CJK A;  3DYA A;  4I9L A;  4LF6 K;  4F2R A;  5AQF A;  3JXU A;  2BH1 A;  4O44 A;  2XHB A;  5KQD A;  2I7N A;  5LY3 A;  3AVH A;  5C12 A;  1TK8 A;  4M45 A;  5FLX O;  4YOU A;  4NYF A;  3D2E A;  4H5N A;  3CPE A;  3A5N C;  4FLZ A;  3HM9 A;  3LDP A;  3VQD A;  3EE8 A;  3A0I X;  5HL7 L;  3DLL L;  2F8T A;  4H0T B;  5AQR A;  4JKB A;  3AAP A;  4FVM A;  3OYI A;  3TAG A;  5DM6 L;  1X9W A;  4BRN A;  1VSE A;  4H5T A;  3DAW A;  1VQL N;  1HKB A;  1OH5 A;  4M42 A;  4PQU A;  2E1Y A;  2HHU A;  3NGY A;  4DR7 K;  4Y1C A;  2KZM A;  4K25 A;  3QIO A;  1NOZ A;  2VCP A;  3N4P A;  4MLE A;  3RMA A;  4NCB A;  3WXI A;  1SKS A;  4DU1 A;  3O80 A;  1KLM A;  4FW1 A;  1MU2 A;  2GX9 A;  3VF6 A;  4W5Q A;  4DSF A;  3VQ8 A;  2XRI A;  1WNS A;  2ZJQ L;  1XWL A;  3O3G A;  4CBX A;  4O4G A;  3K5L A;  5GIO A;  1TUU A;  3L4Q A;  2O8C B;  3AVF A;  4DTM A;  4FO0 A;  4DQI A;  3AO1 A;  5C2D A;  2P9L B;  1IO2 A;  4JHD A;  3VGL A;  4HWI A;  3CFR A;  1ASW A;  4DTO A;  3AO3 A;  2BAN A;  2IIR A;  3MX5 A;  4XH4 A;  4MDA A;  4DR1 K;  4E1J A;  3AO4 A;  2O8F A;  4O8K A;  3EYZ A;  4LH5 A;  4X65 K;  3FGU A;  3MEC A;  1LWC A;  3O8M A;  4R5P A;  5HP1 A;  3HYF A;  4ISE A;  4IDH A;  2ZF5 O;  1KQS M;  3W3D A;  3I8B A;  3IRX A;  4A61 A;  2Z1H A;  4B3S K;  1K8K B;  1JL1 A;  1Y97 A;  2O4G A;  4OPH A;  4W5O A;  4BWM A;  1JJ2 M;  3ZX2 A;  1NOY A;  4QOZ B;  4DSE A;  3HI0 A;  3DOK A;  4WQ5 A;  3R9P A;  1T44 A;  4JI8 K;  2YHX A;  3ULD A;  1BI4 A;  1OH6 A;  3VA0 A;  3PIP L;  4JK7 A;  1Z26 A;  3T1A A;  3AO2 A;  2P9N A;  4JK9 A;  1A5X A;  3VQP A;  1HYV A;  1SUQ A;  3KD5 E;  1WUA A;  3LDO A;  1JLC A;  1QZ5 A;  1NGE A;  4PHT X;  1VSM A;  3J7Y P;  1W7A A;  3MN9 A;  4CJE A;  4DQR A;  3QDK A;  4CGG A;  5C10 A;  4G9Z A;  1S72 N;  4A62 A;  1MDU B;  3CQX A;  2RN2 A;  3M8Q A;  3MCP A;  2XY6 A;  5AQG A;  3V9W A;  3Q7C A;  1EET A;  2G8W A;  4F3O A;  3G71 N;  3PY8 A;  2V7Y A;  5ADX A;  2CGK A;  4CFB A;  3HPH A;  3D7E O;  4F3T A;  4CIE A;  4HUE A;  1EXQ A;  1RBU A;  3ZX3 A;  3HVT A;  4JS5 A;  2G8K A;  4ELV A;  1S1X A;  3MCA B;  4BY9 C;  3ZT2 A;  1NGF A;  2NRH A;  3WXL A;  1KTQ A;  5A2Q O;  4Z4I A;  3LL3 A;  4E7I A;  5SWM A;  3ALY A;  4DQS A;  2YKN A;  3KLE A;  4YOT A;  4K42 A;  1MA9 B;  3SAH A;  3O5B A;  4MFB A;  2E2N A;  4CZJ A;  5KPZ A;  4BE0 A;  3NHG A;  3CET A;  4DV5 K;  1TGO A;  3WXK A;  5AQS A;  2UXB K;  5AQU A;  4PY5 A;  3QIC A;  3IFR A;  3CCE N;  3M6G A;  4CD1 A;  3BZC A;  2BUP A;  3SAG A;  4YNQ A;  4CZE A;  5I42 A;  2HST A;  4KTZ A;  5C42 A;  4V19 S;  1WAJ A;  3TAE A;  4E89 A;  1IBL K;  2AJQ A;  4AM6 A;  3AVM A;  4GV9 A;  4FWN A;  4BRL A;  1GLD G;  1KVB A;  1NGA A;  1YHQ N;  2HHQ A;  2E2Q A;  2FF3 B;  3S9H A;  2NRT A;  3CJ9 A;  1BO5 O;  3T1H K;  4WFB L;  3ZT3 A;  4BAC A;  3F5T A;  5F2R A;  3I8D A;  2CH6 A;  2IVN A;  3H3N O;  3QIP A;  4CJ5 A;  1YIJ N;  2GTD A;  3V1R A;  5FRO A;  3HP6 A;  1EWQ A;  2HND A;  5LJV A;  4LF4 K;  3ENH A;  3LZJ A;  1CXU A;  2F7T A;  1Q9Y A;  3OYD A;  2VGN A;  1XC3 A;  3C6T A;  4I7F A;  3VEW A;  1WSF A;  3LDL A;  3PV8 A;  4KHN A;  3MWT A;  4CJ7 A;  1YAG A;  4A5B A;  3D2F A;  4B3R K;  2A6A A;  5LMN K;  5D3G A;  5AQZ A;  3KLF A;  4CW7 B;  3SZ2 A;  3ITH A;  3QBW A;  5M1P A;  4CHZ A;  4CHO A;  1LWE A;  3L6Q A;  1WOQ A;  4I2P A;  1OVY A;  3DI6 A;  3K2P A;  4KB1 A;  4JKH A;  3SQ4 A;  2G8V A;  1HYZ A;  1BCO A;  5FRM A;  3HOT A;  2ZGY A;  1BL3 A;  3EZ5 A;  4BRA A;  3EY1 A;  2P9I A;  2YV0 X;  3N4Q A;  3LP2 A;  1YJ9 N;  3AVG A;  3ATV A;  3CJ1 A;  1UAX A;  2VWK A;  5I9E B;  3L0Q A;  4WQ4 C;  3MXM A;  5KPR A;  4DTS A;  4KHQ A;  4FOE A;  3CCR N;  3LWL A;  2IDO A;  4C8L A;  5E84 A;  3M5R A;  5DMR A;  4ILH A;  4FLY A;  3DXK B;  4LF5 K;  4A57 A;  1LW2 A;  4N56 A;  4FWS A;  3AVL A;  3K57 A;  1EKE A;  1FXX A;  1ZBS A;  2O8B A;  1ZYQ A;  4OGC A;  5M1O A;  4BE2 A;  2F9T A;  3OA9 A;  4O0J A;  4GW6 A;  3FFK B;  1KCF A;  2P9K A;  5HLF A;  3L8B A;  5TKW A;  3Q7B A;  3ZSO A;  2QWL A;  1P8Z A;  3MEG A;  3ASM A;  3NF8 A;  1KVC A;  1JLQ A;  3HTV A;  1RTH A;  2FF6 A;  5AJ3 K;  4FXD A;  4PKG A;  4CZH A;  4JKD A;  4B3T K;  4JI7 K;  4BQL A;  4B9L A;  4BRG A;  1TAQ A;  3VEY A;  2ZD1 A;  4H0X B;  1XNQ K;  1TL1 A;  1VQP N;  1HPM A;  2QWQ A;  5GAD P;  1NGJ A;  3OYB A;  2GBZ A;  3P39 A;  1A5W A;  3O1W A;  1RT1 A;  3RR8 A;  5I3U A;  3VQ4 A;  2PFU A;  3G0Z A;  3R3L A;  1KXP A;  4LH4 A;  2YX6 A;  3LAM A;  4DU3 A;  1R0A A;  1T05 A;  2F4V K;  4FWM A;  3VEV A;  4OKJ A;  4CEB A;  4CJT A;  2IVP A;  1OH8 A;  3K5O A;  3VEN A;  3SNN A;  2GEM A;  4Z4C A;  1BIS A;  2WUS A;  4EZ6 A;  4BDZ A;  3MWP A;  5SZT A;  1N5Y A;  1ESV A;  1DKG D;  3WNH A;  4PKH A;  2X78 A;  4CEZ A;  5JS2 A;  3DXM B;  5CE3 A;  1LWF A;  3DMJ A;  1T03 A;  1GLE G;  4GVE A;  4NCA A;  4BC5 A;  3WEE B;  4PL7 A;  1NJW A;  4CVN E;  4HTU A;  3LPU A;  1A5V A;  3L4I A;  3HRG A;  4XH5 A;  1VSD A;  2P9U B;  3PSF A;  2HW3 A;  1MWM A;  1UA1 A;  3A5M C;  1ZBI A;  4U7B A;  3RMD A;  1S6Q A;  4B9Q A;  1GOC A;  5E26 A;  2E20 A;  3ATU A;  1WBB A;  2W41 A;  5F1X A;  1QTM A;  1ILY A;  4KHP K;  3UKU A;  3OYL A;  4E1N A;  4H4M A;  5C2F A;  3U9D A;  4C23 A;  4J2D A;  3HO1 A;  4EP4 A;  4FWQ A;  3OS0 A;  1NU0 A;  1IKV A;  2ZGZ A;  2HHX A;  4HHT A;  1RGI A;  3ZSR A;  3THY B;  4NXM K;  1RDC A;  4DF8 A;  1C0G A;  5LJW A;  1X3M A;  5BPN A;  1IKW A;  1JXE A;  2W6K A;  1BQM A;  1O1W A;  1Q8I A;  1WSI A;  2FXU A;  4DFK A;  2OAN A;  4BRI A;  1B92 A;  3AY9 A;  1VQ7 N;  4FJN A;  4WQ5 C;  3VQC A;  4CJW A;  1KAY A;  2DFH A;  4K43 A;  1Q9X A;  4IO9 L;  4Z4H A;  4K0K K;  4E19 A;  3OW2 M;  4FJM A;  3HPO A;  4X62 K;  2AP1 A;  2BGG A;  1Z6R A;  3H46 O;  3SUN A;  5JIC A;  1TL3 A;  2G8H A;  3U9Z A;  4M3R A;  1GLL O;  3CD6 N;  3MEE A;  3TR8 A;  1U45 A;  1VQN N;  1J54 A;  5MLC Q;  1NK5 A;  1KD1 O;  4EFH A;  3AVC A;  2YHA A;  4NLB A;  4NYN A;  4F8R A;  4CD3 A;  4O5B A;  5GAG P;  1QHT A;  1VSL A;  4FPA A;  4DS4 A;  3R6M A;  4BG8 A;  3CQY A;  1U2V B;  1H1V A;  3GG4 A;  4KRE A;  2I7P A;  4E3S A;  4JYA K;  3GL1 A;  1NMD A;  5DK5 A;  2PAV A;  2JWK A;  1RT3 A;  1U49 A;  5AQM A;  4CJL A;  2A5X A;  3PX0 A;  5AFU A;  5KQ8 A;  5C0Y A;  1RBS A;  1C1A A;  3J8A A;  2W42 A;  2EX3 A;  3VGM A;  3L3V A;  3O1B A;  1B9F A;  3ZSY A;  2D0A A;  3BF1 A;  2F9W A;  4GKK K;  3KZB A;  3SPY A;  1KAX A;  4AHT A;  2X74 A;  4LD0 A;  4DV4 K;  3E9O A;  4B9M A;  2FC0 A;  4JI6 K;  4F4K A;  2QWM A;  3VQ7 A;  4CF1 A;  4HUG A;  3DJC A;  3TI0 A;  1KFS A;  1VAZ A;  4L3Q A;  1KAZ A;  3WQU A;  5BRF A;  3NF6 A;  3K5M A;  4IDK A;  4OGE A;  4JD2 B;  3A8Y A;  2UXD K;  4DV2 K;  3E01 A;  4DG1 A;  4OKK A;  2HF4 A;  4EAH D;  4CEO A;  3K9K A;  3VQA A;  4C8O A;  2F8S A;  3BY5 A;  3SI6 A;  3KKR A;  3RTV A;  3HVR A;  1NGC A;  2GWK A;  3RWU A;  5EOY A;  1RBT A;  4U67 L;  5AZJ A;  4Z4F A;  1ZBU A;  3OJS A;  4JV5 K;  5AQL A;  3MMV A;  3W0L A;  4JK8 A;  3CXC M;  2FBV A;  4Q5V A;  4G1Q A;  5H1S Q;  3OS1 A;  3DLE A;  3TAN A;  4BE1 A;  3QNO A;  2NRW A;  1XNR K;  3TSQ A;  4BGB A;  2XY5 A;  4ELT A;  1YTU A;  1KRP A;  1KVA A;  4DTU A;  2ASM A;  4UQG A;  1C0M A;  3TTD A;  1XHX A;  1VQO N;  4KFB A;  4FCY A;  4DQ8 A;  4ELU A;  3DOL A;  1P90 A;  1J5O A;  3KLG A;  2GEL A;  3CF5 L;  3T7Z A;  1QHA A;  4MO4 A;  2OZS A;  4RW4 A;  3D2E B;  3O9U A;  4BRF A;  4JKA A;  3L2R A;  3V1O A;  3WNG A;  4WE1 A;  3OYC A;  4CFA A;  1XC9 A;  2YJF A;  4BDP A;  2B5J A;  3AVK A;  1JLF A;  1RT6 A;  5EVZ A;  4E7K A;  3FZM A;  4LY7 A;  3M8S A;  2HBM A;  2BTF A;  2WFB A;  4QAG A;  2ASO A;  2GUI A;  4FLV A;  2YHW A;  5AQO A;  2YNG A;  4C8K A;  3KKS A;  3R8E A;  3MXI A;  4MDB A;  3OJU A;  4PL8 A;  2ITG A;  4RTF D;  3TWH A;  3QNN A;  3AA3 A;  4CE9 A;  3L2U A;  1VSJ A;  2PBD A;  4B9S A;  4AM7 A;  3ULE A;  3QFP A;  3IAY A;  1RDB A;  3O9Q A;  4CER A;  2UXC K;  4BQZ A;  4JI1 K;  3VF2 A;  3ZSV A;  4FPB A;  1YVN A;  2D1K A;  2HBL A;  2YHB A;  2W40 A;  4CEE A;  3WT0 A;  2VYP A;  3F9K A;  4FJ7 A;  1HQU A;  4JRQ A;  1L3V A;  3SMP A;  5GIN A;  1RT7 A;  4M7X A;  3C95 A;  4J8F A;  4YOW A;  1BWF O;  4CEF A;  1BG3 A;  3ZT4 A;  4JHD B;  1C1C A;  1RBV A;  3UB5 A;  3NDK A;  4FJJ A;  2YNF A;  4AHS A;  5FDL A;  3EKS A;  4CBW A;  2O8E A;  3CFP A;  3SUO A;  1S22 A;  3B6O A;  3NGZ A;  2O8F B;  2Q31 A;  4EIA A;  3QFU A;  1IV0 A;  3H08 A;  1Y64 A;  3O9S A;  5AQW A;  3HM8 A;  4FM0 A;  3OHR A;  4IFE A;  4KTW A;  1K73 O;  3WXM B;  3IUC A;  3C0B A;  5EXW A;  4WCE L;  4E7L A;  4BR2 A;  3OYH A;  3LDQ A;  1K8K A;  2E8A A;  1RCH A;  3EN9 A;  1CZB A;  1Q18 A;  1J6Z A;  1X9S A;  1NKE A;  1NJX A;  4FLT A;  1QQO A;  3E9L A;  2DFE A;  2OPS A;  4JLH A;  1REV A;  3EEQ A;  3U3Y A;  2FBY A;  1GLC G;  4FLU A;  1XQS C;  2YKM A;  1RTD A;  1Q81 O;  2J4R A;  5GIP A;  3MX2 A;  3DLH A;  3S41 A;  4KH4 A;  4YDU C;  4WFA L;  5GAE P;  5BRE A;  1VQ9 N;  1NK7 A;  4BC3 A;  2Q3S A;  3LP1 A;  3MN7 A;  3T19 A;  5J2N A;  1JLA A;  3AGK A;  5FPE A;  3V9S A;  3AAR A;  3SMS A;  1K8A O;  1RT4 A;  1S5J A;  4IXC A;  4GKJ K;  1QS4 A;  4YOX A;  2Q0U A;  1NK9 A;  1M1K O;  4H0V B;  1JCG A;  4LFB K;  4DSI A;  3D45 A;  3J80 O;  2WTU A;  3THX B;  5AQX A;  4JKG A;  3WNE A;  3C65 A;  4IEE A;  1N6Q A;  1JKH A;  1NMN A;  5M1N A;  3F2K A;  2VG7 A;  1XMQ K;  4YOY A;  4DWI A;  2IGI A;  1LAV A;  4Y0W A;  3PO4 A;  3LDS A;  2B4J A;  4KH6 A;  1ZBH A;  1N34 K;  1JCE A;  1GOA A;  3AAQ A;  3TSP A;  1T7P A;  3VOV A;  3OBY A;  2CGJ A;  1WLJ A;  1X1P A;  4BRO A;  3LM2 A;  2WOM A;  3RVC A;  4CEA A;  2IOC A;  1Z25 A;  3VMF B;  3KK2 A;  4M3W A;  3OYG A;  1G99 A;  4EZ9 A;  5AZI A;  4JKE A;  4AH9 A;  4B8C A;  3CER A;  3CC2 N;  1SL2 A;  3CC4 N;  4KHY A;  2P51 A;  3C7N A;  3BUZ B;  2KFN A;  3J81 O;  3HK2 A;  2E2O A;  1DLO A;  1LAW A;  4GNI A;  3ENB A;  5HRN A;  3I56 N;  3K5N A;  3CCS N;  4M3X A;  4CGH A;  4GMJ B;  3NFA A;  4FJI A;  4RW8 A;  3UKR B;  4C1N I;  4H03 B;  4KPY A;  2P1J A;  3C94 A;  3O3H A;  3ZCM A;  1ATR A;  1J53 A;  4RW6 A;  3KLI A;  3BF3 A;  3AA4 A;  2IVO A;  4FZY A;  4ISG A;  1XHZ A;  1UOC A;  1VSH A;  1S6P A;  3AVA A;  3DLK A;  3ISN C;  1SQK A;  4RG8 A;  3CIP A;  1KFD A;  2BDP A;  2QI2 A;  2NZT A;  4CEC A;  5AQY A;  4RW9 A;  4CJR A;  2V52 B;  1TV6 A;  3B8A X;  3CYM A;  5BR9 A;  3D6R A;  3VPZ A;  2VWJ A;  1JXB A;  4ZTJ A;  1NK8 A;  3QB0 A;  5F0X A;  2Q2R A;  1CZA N;  1N36 K;  3MN5 A;  1JLE A;  3QO9 A;  3U8X A;  2ZE2 A;  5FRN A;  3RRH A;  1KSP A;  1SS6 A;  4QS9 A;  2HHS A;  4AF1 A;  3KHY A;  3D2F B;  4M3Y A;  1BHL A;  3K9J A;  3CG7 A;  5BR8 K;  3K59 A;  4E1M A;  4ILG B;  4LF7 K;  1NBW A;  4LF9 K;  5IT9 O;  1X9M A;  1WSJ A;  4FM1 A;  4R79 A;  1BA1 A;  3HSC A;  5JLH A;  3SJJ A;  4FWP A;  3MXJ A;  4H8K A;  3SQ0 A;  3H3O B;  3DRS A;  2VQF K;  1GLA G;  3H1V X;  3F73 A;  5J2P A;  2RPI A;  4BRQ A;  4C8M A;  4CFC A;  3VER A;  5EY4 A;  3CJ7 A;  1BCM A;  5JMV A;  4IWV A;  4CZI A;  1TAU A;  2CGL A;  1D9D A;  2QTD A;  3VF4 A;  4NO7 A;  2NRR A;  1YXQ A;  5K14 A;  4N41 A;  3ZEU B;  3VEZ A;  3IKM A;  3V4I A;  4GV6 A;  2YI1 A;  4BRC A;  1NK6 A;  1NM1 A;  4N47 A;  2P5O A;  3M1F A;  1NGG A;  2E88 A;  3LWM A;  4CK3 A;  1MWK A;  4AHR A;  2KKZ A;  2D0C A;  4KAZ A;  3OYE A;  4O55 A;  2E2P A;  1SL1 A;  5BPL A;  3P5J A;  2O8B B;  1N33 K;  4Z94 A;  2P9S B;  2O8D A;  4KRF A;  3AA2 A;  1TKT A;  1IH7 A;  3RSE B;  1ASV A;  2P9K B;  3GE1 A;  3ZT0 A;  3DLR A;  1SKR A;  4RCH A;  1Q7Y O;  1EO1 A;  1RDU A;  2QXF A;  4CJQ A;  4IKF A;  1DGK N;  1YIT N;  4DV0 K;  3RR7 A;  4DSJ A;  4W5R A;  4H5V A;  3TAP A;  2HB5 A;  1T6C A;  3TTC A;  2OPQ A;  4DLE A;  3EE9 A;  1E4F T;  1YVU A;  2QKB A;  1C1B A;  1VRU A;  1U6Z A;  2HVI A;  5ADX H;  4GY2 B;  5CHI A;  2HF3 A;  2ZJP L;  3CCU N;  4DQQ A;  2YCH A;  3SQ1 A;  1HRH A;  1QSS A;  1VQ4 N;  4E7H A;  1QE1 A;  4YDU A;  1NK0 A;  4L8R B;  1KC8 O;  3DM2 A;  4DR6 K;  2WON A;  4J2E A;  3SK3 A;  2Q36 A;  3KK7 A;  1J9A A;  3BGR A;  3IMX A;  4OX9 K;  1GOB A;  1Z05 A;  4OPJ A;  4PA1 A;  2Y1J A;  3SCX A;  1JCF A;  4OLB A;  3O9R A;  3V81 A;  1HJR A;  4B9N A;  5KRT A;  3VQ9 A;  3QER A;  5C15 A;  4HUF A;  1VSF A;  4A5A A;  3ZSZ A;  4JKF A;  4YOV A;  4CZM A;  3JSM A;  4B9U A;  3G6E N;  2G8F A;  2V7Z A;  2HNY A;  4DV1 K;  4DR5 K;  1FKO A;  2I5J A;  4DFP A;  4CF0 A;  5J2Q A;  3AVI A;  4FVU A;  2YJE A;  2Z1J A;  2HHV A;  4FSV A;  4I6M A;  3HOS A;  2NNW A;  1WB9 A;  1QSY A;  3LZI A;  3F9M A;  4Q0B A;  5AQK A;  3THV A;  1ZBL A;  3TU5 A;  1NGH A;  3CJA A;  4JAX A;  5CZ2 A;  1S1V A;  1D5A A;  4KHS A;  4DMN A;  3SV3 A;  4N5S A;  5B8H A;  4CIG A;  3P38 A;  3QET A;  4DB3 A;  4CJS A;  3THY A;  3CCL N;  5HRS A;  4B3O A;  3E1Y A;  3ZET B;  4H0P A;  4K8X A;  1IJJ A;  3A5L C;  4Z4E A;  3WXJ A;  2VQE K;  1L5U A;  3CFO A;  3RRG A;  3T1Y K;  4DS5 A;  2A41 A;  1RDD A;  4QS7 A;  3TPQ A;  1YJW N;  1HNV A;  2JLE A;  5AQH A;  4Y1D A;  5C24 A;  5J1E A;  3THW A;  4OPK A;  3HST B;  2PYJ A;  2QWN A;  3CJB A;  3CC7 N;  1HLU A;  2P5G A;  1FK9 A;  1VQK N;  2FSN A;  3PX4 A;  4KO0 A;  5AQT A;  2UUB K;  3EO3 A;  1TKD A;  2HHH K;  3GOI A;  2QEX N;  3NMU A;  2OA8 A;  1LV5 A;  4I2Q A;  3GDQ A;  1I39 A;  3DLB A;  5CR4 A;  1I3A A;  1IG8 A;  4EHU A;  3C6H A;  4CK1 A;  1R59 O;  1N8R O;  3L2Q A;  4DR2 K;  1EP4 A;  5FPM A;  3AV9 A;  4F2S A;  2E6L A;  1W0H A;  2D4W A;  4C1N K;  1Q82 O;  1VQM N;  4EHT A;  3SQ2 A;  3TAQ A;  2NRV A;  3U6F A;  2XY8 A;  4KB0 A;  1NGD A;  1RIL A;  3TSU A;  4WF9 L;  4CZG A;  4KHW A;  3FR0 A;  3KVG A;  1TYQ B;  3QES A;  1BA0 A;  2PYL A;  2KHO A;  2HNZ A;  4AIL C;  3LDN A;  4IOA L;  4QCL A;  4FK0 A;  2QWO A;  3JAM O;  3V6D A;  4DLG A;  2UU9 K;  5KGW A;  2GWJ A;  2UYT A;  4JI4 K;  4JEP A;  1EX4 A;  2X6N A;  3KK3 A;  4XH1 A;  2A1S A;  3MK6 A;  4JKC A;  3HZ6 A;  3QBX A;  3VQB A;  3AGR A;  4E0D A;  1DEJ A;  3NVM A;  1S1W A;  4KBO A;  4BRM A;  4FJH A;  2O4I A;  2P9P A;  1NWK A;  5BN9 A;  1HR0 K;  4IO8 A;  1BUP A;  4CGD A;  3FFI A;  3O4Q A;  4C8N A;  1VK0 A;  2DY4 A;  4W5N A;  3TAB A;  4JI2 K;  2FSJ A;  4CED A;  5AZJ B;  3S3N A;  4B9V A;  3OYM A;  4LFA K;  1FW6 A;  2ZM6 K;  4BDY A;  3B6P A;  3RMC A;  1XUP O;  3I33 A;  4ID5 A;  1FKP A;  4NXN K;  5HRR A;  3VTH A; 
#chains in the Genus database with same CATH homology
 4BRA A;  5FPE A;  3AAR A;  3SMS A;  1K8A O;  4IZ9 A;  5BRH A;  5JVH L;  4IXC A;  2QM1 A;  4BRP A;  1EQY A;  1YI2 N;  2A3Z A;  4CZK A;  2FLO A;  1VQ8 N;  2P9I A;  4YOX A;  2Q0U A;  4BR0 A;  1M1K O;  3N4Q A;  3IDH A;  4H0V B;  5AQQ A;  4IOX A;  1HKC A;  1YJ9 N;  1JCG A;  2A40 A;  3ATV A;  2RE2 A;  3CJ1 A;  4DCH A;  5AQX A;  3UE5 A;  4JKG A;  5I9E B;  2A42 A;  3L0Q A;  5M1Q A;  4WQ4 C;  3C65 A;  4IEE A;  5KPR A;  3P31 A;  3FZL A;  4FOE A;  3CCR N;  3ZET A;  3ID8 A;  4IJN A;  5E84 A;  3M5R A;  4ILH A;  3F2K A;  3SBG A;  3DXK B;  2QWR A;  4BRD A;  5M1N A;  4A57 A;  3I55 N;  1YJN N;  2EWS A;  3R1X A;  3O4W A;  4FWS A;  4YOY A;  4H5R A;  3E9P A;  1ZBS A;  4A2B A;  4K41 A;  4CZL A;  4Y0W A;  4BR4 A;  3FLC O;  5M1O A;  1QZ6 A;  4KH6 A;  2F9T A;  1JCE A;  3AAQ A;  1X9J A;  3TSP A;  3OA9 A;  4IJA A;  1VQ6 N;  2HOE A;  3FFK B;  3VOV A;  2D0P A;  4OO1 J;  3OBY A;  2P9K A;  1S3X A;  1ZXO A;  2CGJ A;  5TKW A;  2QWP A;  1NGI A;  4H5W A;  3Q7B A;  4BRH A;  2WC9 A;  2QWL A;  1P8Z A;  1W2B M;  1C0F A;  4BRO A;  3LM2 A;  3O08 A;  3RVC A;  3HTV A;  2FF6 A;  4UY8 O;  1E4G T;  4PKG A;  3VMF B;  4CZH A;  1HJO A;  4CI6 A;  4JKD A;  2QA4 N;  1DT9 A;  1G99 A;  4BQL A;  5AZI A;  3CME N;  2QXL A;  4JKE A;  4BC2 A;  3ULE B;  4BRG A;  5JLF A;  3VEY A;  3CER A;  4BRE A;  3CC2 N;  3CC4 N;  4F9O A;  1GLF O;  2E1Z A;  4H0X B;  1U2V A;  3C7N A;  3BUZ B;  1VQP N;  1V4T A;  1HPM A;  4FWO A;  2E2O A;  1K9M O;  4B1Y B;  2QWQ A;  4GNI A;  2P9L A;  3ENB A;  4IEI A;  3I56 N;  3CCS N;  5GAD P;  1NGJ A;  3UKR B;  4C1N I;  3BEX A;  4H03 B;  3P39 A;  4NLC A;  3ZX0 A;  1ATR A;  4B1U B;  2NLX A;  3O1W A;  4MLH A;  3SAF A;  5AQJ A;  1Q86 O;  3WUH A;  3BF3 A;  2IVO A;  2KLA A;  3NVK A;  4ISG A;  4FWL A;  1QVG M;  2PFU A;  5DM7 L;  1SQK A;  1HKG A;  3R3L A;  3CIP A;  1KXP A;  3WQT A;  2YX6 A;  2QI2 A;  1TYQ A;  5M1K A;  4B1Z A;  3LM9 A;  4BRK A;  3FE1 A;  2NZT A;  5AQY A;  5AQV A;  3VGK A;  3CHW A;  3OBW A;  4O8U A;  4CBU A;  1HUX A;  4FWM A;  3VEV A;  2V52 B;  2IVP A;  3B8A X;  5FPN A;  1NLV A;  3VEN A;  5BR9 A;  2GEM A;  3D6R A;  3VPZ A;  2WUS A;  4XEI A;  3QB0 A;  5F0X A;  3H45 C;  2GUP A;  1O13 A;  3MWP A;  4IOC L;  1ESV A;  1DKG D;  1LCU A;  1CZA N;  2Q2R A;  4JD2 A;  4PKH A;  3SBT A;  3T69 A;  1TUY A;  3MN5 A;  4WQ4 A;  3U8X A;  2Q0R A;  3DXM B;  5CE3 A;  1GLE G;  4GVE A;  1SS6 A;  4BC5 A;  4BVP A;  3J7Z O;  3CI5 A;  3WEE B;  4QS9 A;  4AF1 A;  2H3G X;  4PL7 A;  3KHY A;  3D2F B;  4BC4 A;  3K9J A;  2ZJR L;  3HBT A;  3L4I A;  3HRG A;  4XH5 A;  4ILG B;  3TTF A;  1NBW A;  2P9U B;  2P9P B;  5JVG L;  1YUW A;  2Q1N A;  1MWM A;  2P9N B;  4FWR A;  3EKU A;  4ILJ A;  3A5M C;  4BVO A;  5BRD A;  4U7B A;  4R79 A;  4B9Q A;  1BA1 A;  2CH5 A;  2E20 A;  2HBK A;  2WBN A;  3ATU A;  3HSC A;  4LC9 B;  5E26 A;  5JLH A;  5AFU H;  5M1F A;  4FWP A;  3KWG A;  2W41 A;  5F1X A;  1X3N A;  3H3O B;  3VTI A;  1GLA G;  5BPM A;  3H1V X;  1ILY A;  4PKI A;  3UKU A;  4BRQ A;  5AQF A;  3JXU A;  2BH1 A;  3VER A;  5C2F A;  5EY4 A;  3CJ7 A;  5AQN A;  3U9D A;  4C23 A;  5KQD A;  5JMV A;  2I7N A;  4IWV A;  5LY3 A;  4BR7 A;  1QVF M;  4FWQ A;  5C12 A;  4CZI A;  4CZF A;  5FPD A;  2CGL A;  2ZGZ A;  2QTD A;  2QW9 A;  4YOU A;  3VF4 A;  4NO7 A;  2NRR A;  1RGI A;  1YXQ A;  3D2E A;  3ZEU B;  4H5N A;  3VEZ A;  3MN6 A;  3IKM A;  1C0G A;  2HMP A;  4GV6 A;  2YI1 A;  2ZWH A;  3A5N C;  3CPE A;  4BRC A;  1GLJ O;  3LDP A;  5LJW A;  3EE8 A;  1X3M A;  5ADX H;  1NM1 A;  3A0I X;  5HL7 L;  3DLL L;  5BPN A;  3M1F A;  1NGG A;  4JKG B;  2FXU A;  4H0T B;  2E88 A;  4JKB A;  5AQR A;  3AAP A;  1NGB A;  2OAN A;  1MWK A;  4BRI A;  2KKZ A;  5DM6 L;  3AY9 A;  1VQ7 N;  4WQ5 C;  4BRN A;  1KAY A;  4H5T A;  3DAW A;  1W97 L;  4K43 A;  4IO9 L;  1VQL N;  2E2P A;  1HKB A;  5BPL A;  3OW2 M;  4Z94 A;  2E1Y A;  1QQN A;  2AP1 A;  2P9S B;  1Z6R A;  3H46 O;  4K25 A;  3QML A;  5JIC A;  2ASP A;  2VCP A;  3N4P A;  4MLE A;  3RSE B;  3U9Z A;  3G25 A;  3SLC A;  3WXI A;  1GLL O;  2P9K B;  3CD6 N;  3O80 A;  4KH5 A;  3GE1 A;  4RCH A;  2GX9 A;  3VF6 A;  1Q7Y O;  1EO1 A;  1RDU A;  1VQN N;  4FL9 A;  3EL2 A;  1DGK N;  1T3V A;  5MLC Q;  4WFN L;  1YIT N;  4RWT A;  4DHY A;  1KD1 O;  4H5V A;  4EFH A;  1T6C A;  3TTC A;  2ZJQ L;  4NLB A;  3VEO A;  4CBX A;  3EE9 A;  1E4F T;  5AZI B;  4CD3 A;  5GAG P;  4FPA A;  3A5O C;  3R6M A;  4BG8 A;  5GIO A;  1TUU A;  1U6Z A;  3CQY A;  1U2V B;  1H1V A;  3GG4 A;  3L4Q A;  2I7P A;  3C7N B;  4FO0 A;  4GY2 B;  5ELZ A;  3DWL A;  2HF3 A;  5CHI A;  1YF5 L;  2ZJP L;  3CCU N;  5GAH P;  1VQ5 N;  3GL1 A;  1NMD A;  2YCH A;  5C2D A;  4O5F A;  2P9L B;  3H1Q A;  3UKR A;  4H0O A;  2PAV A;  1VQ4 N;  2JWK A;  2NRX A;  4YDU A;  4JHD A;  3VGL A;  4HWI A;  5AQM A;  2A5X A;  1KC8 O;  1ATN A;  4M7Y A;  3VES A;  2IIR A;  5AFU A;  3MX5 A;  2HBJ A;  5KQ8 A;  4XH4 A;  4MDA A;  2D0O A;  4BR9 A;  4E1J A;  5C0Y A;  3SK3 A;  2Q36 A;  2VWB A;  3KK7 A;  3J8A A;  3IMX A;  4O8K A;  1Z05 A;  3VGM A;  1ZC6 A;  3O1B A;  3P4I A;  3BF1 A;  2F9W A;  1JCF A;  3FGU A;  3KZB A;  3O9R A;  5AR0 A;  1KAX A;  1YHQ N;  3O8M A;  3FZH A;  3E9O A;  4ISE A;  4IDH A;  5C15 A;  3PIO L;  2ZF5 O;  1KQS M;  3W3D A;  3I8B A;  4A5A A;  3O9T A;  4A61 A;  2Q97 A;  2QWM A;  4JKF A;  4YOV A;  3DJC A;  3CCJ N;  1K8K B;  1VAZ A;  4JNE A;  1KAZ A;  4L3Q A;  3WQU A;  5BRF A;  4DKW A;  3VET A;  4CZM A;  4OPH A;  3PLA A;  2VGM A;  4JD2 B;  3A8Y A;  3ZX2 A;  3G6E N;  1JJ2 M;  5TKY A;  2HF4 A;  2V7Z A;  4EAH D;  3HI0 A;  4WQ5 A;  3K9K A;  3VEX A;  3G4S N;  3BP8 A;  3M3Z A;  3R9P A;  1T44 A;  2YHX A;  1NGC A;  2GWK A;  2OTJ N;  2DPN A;  3PIP L;  5EOY A;  4JK7 A;  4U67 L;  4FVU A;  5AZJ A;  1RDW X;  2YJE A;  4FWK A;  2P9N A;  4JK9 A;  4FSV A;  4I6M A;  3HOS A;  2NNW A;  3ENO A;  4MO5 A;  4YOR A;  5AQL A;  3MMV A;  3W0L A;  1WUA A;  3LDO A;  4JK8 A;  3CXC M;  4M63 C;  5H1S Q;  1QZ5 A;  3F9M A;  4B1X B;  4GV3 A;  1NGE A;  2YHY A;  4JN4 A;  2NRW A;  4PHT X;  1NJI O;  5AQK A;  3TSQ A;  3MN9 A;  4BGB A;  3QDK A;  1BDG A;  3TU5 A;  4A2A A;  1NGH A;  3CJA A;  4JAX A;  2FSK A;  3U4L A;  5C10 A;  4G9Z A;  1S72 N;  4A62 A;  1MDU B;  2ASM A;  3CQX A;  3FZK A;  3TTD A;  1VQO N;  2P9I B;  3MCP A;  5AQG A;  4DQ8 A;  3Q7C A;  5AQP A;  1P90 A;  5B8H A;  3G71 N;  1HX1 A;  3P38 A;  2V7Y A;  2GEL A;  3CF5 L;  3T7Z A;  1QHA A;  3MDQ A;  4MO4 A;  4DB3 A;  5ADX A;  2CGK A;  3ZEU A;  3CCL N;  5KPT A;  3D2E B;  3O9U A;  4BRF A;  3E1Y A;  3D7E O;  3DXK A;  3ZET B;  4JKA A;  4H0P A;  1IJJ A;  3A5L C;  2YJF A;  3WXJ A;  3ZX3 A;  3O6W A;  5EVZ A;  1SZ2 A;  2A41 A;  3FZM A;  4QS7 A;  3TPQ A;  2HBM A;  3MCA B;  3SJH A;  1YJW N;  4NB4 A;  2BTF A;  4BY9 C;  5AQH A;  1NGF A;  2NRH A;  2WFB A;  4BG9 A;  2ASO A;  3WXL A;  3LL3 A;  3C6A A;  4BGA A;  2YHW A;  1M90 O;  5AQO A;  2P9S A;  2QWN A;  3CJB A;  3CC7 N;  1HLU A;  3R8E A;  1VQK N;  2FSN A;  4MDB A;  3RSE A;  4YOT A;  1GLB G;  4K42 A;  4PL8 A;  1MA9 B;  4RTF D;  3SAH A;  3O5B A;  5AQT A;  2E2N A;  4CZJ A;  5KPZ A;  2OTL N;  1OKJ A;  3EO3 A;  2PBD A;  3GOI A;  3CET A;  4AM7 A;  3ULE A;  2QEX N;  3NMU A;  4B1V A;  4A59 A;  1QQM A;  3QFP A;  3E66 A;  3ID6 A;  3O9Q A;  3WXK A;  2V51 B;  3GDQ A;  5AQS A;  5AQU A;  5CR4 A;  4BQZ A;  3VF2 A;  4OPA A;  3QIC A;  3IFR A;  1IG8 A;  4FPB A;  2AA4 A;  4EHU A;  1SAZ A;  3C6H A;  1YVN A;  2D1K A;  2HBL A;  3CCE N;  2W40 A;  1V4S A;  3M6G A;  1R59 O;  4CD1 A;  3WT0 A;  2BUP A;  1N8R O;  3SAG A;  2RHK A;  2VYP A;  4CZE A;  2HST A;  3SMP A;  3CCV N;  5FPM A;  2ITM A;  5GIN A;  4ISF A;  3CJC A;  2D4W A;  1Q82 O;  4QS8 A;  4M7X A;  4AM6 A;  4J8F A;  4C1N K;  1VQM N;  4EHT A;  1BU6 O;  4YOW A;  1BWF O;  3EZW A;  4GV9 A;  1BG3 A;  4FWN A;  2NRV A;  4BRL A;  1GLD G;  1BOT O;  1NGD A;  1NGA A;  4JHD B;  3TSU A;  2E2Q A;  4WF9 L;  2FF3 B;  4WYB A;  3FZF A;  3UB5 A;  2NRT A;  3CJ9 A;  4CZG A;  5HOO A;  1BO5 O;  3EKS A;  3FR0 A;  3H6E A;  3KVG A;  4WFB L;  1TYQ B;  4CBW A;  1BA0 A;  1RFQ A;  1S22 A;  3F5T A;  5F2R A;  2KHO A;  2CH6 A;  2IVN A;  2Q31 A;  3LDN A;  4EIA A;  3QFU A;  4IOA L;  3H3N O;  3CCM N;  1YIJ N;  2QWO A;  5AQI A;  2GTD A;  1Y64 A;  3O9S A;  5AQW A;  3GBT A;  5EX5 A;  3HM8 A;  3ENH A;  5LJV A;  2F7T A;  3OHR A;  4H0Y B;  4IFE A;  2GWJ A;  3JS6 A;  2JWL A;  1K73 O;  2VGN A;  3WXM B;  1XC3 A;  2UYT A;  3DXM A;  3IUC A;  3C0B A;  5EXW A;  3VEW A;  4WCE L;  3LDL A;  4JEP A;  4BR2 A;  3CPW M;  4XH1 A;  3LDQ A;  3WEE A;  1K8K A;  2E8A A;  3MWT A;  3MK6 A;  4JKC A;  4CJ7 A;  1YAG A;  3HZ6 A;  3ZYY X;  3QBX A;  3EN9 A;  4A5B A;  1T6D A;  3D2F A;  3AGR A;  1Q18 A;  1J6Z A;  2A6A A;  1DEJ A;  3NVM A;  4KBO A;  4BRM A;  2NRZ A;  2P9U A;  2P9P A;  1NWK A;  1QQO A;  3E9L A;  5AQZ A;  4IO8 A;  5BN9 A;  4FOI A;  3CCQ N;  4BR5 A;  1BUP A;  1ATS A;  5BN8 A;  1GLC G;  3QBW A;  4HTL A;  5M1P A;  1XQS C;  3L6Q A;  1WOQ A;  1Q81 O;  1D4X A;  2FSJ A;  2J4R A;  5AZJ B;  1OVY A;  5GIP A;  3MX2 A;  4B1W B;  3S41 A;  4KH4 A;  4I6M B;  4JKH A;  4YDU C;  3KWI A;  3UKU B;  4WFA L;  5GAE P;  5BRE A;  1VQ9 N;  1XUP O;  3I33 A;  3HOT A;  4BC3 A;  2ZGY A;  1LOT B;  3MN7 A;  3CMA N;  3AGK A;  3VTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...