4BRCA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
360
structure length
360
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 116
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brcA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brcA02
3TPQA 1NGJA 1U6ZA 4FWRA 3VGMA 1NLVA 3LL3A 4CBWA 3HTVA 1HKCA 2HMPA 2UYTA 1ZXOA 4QS9A 3VEZA 3CQXA 2A41A 4IXCA 3VEVA 3MN6A 4B9QA 3O1WA 1KAYA 1NMDA 4JHDB 2V51B 1OKJA 4FWMA 3O4WA 3GE1A 4EHTA 2DPNA 2ZGZA 5I9EB 4XEIA 5AQTA 1X3MA 1SQKA 3F9MA 2ASOA 5EY4A 4MO5A 1GLCG 2AP1A 2V7YA 4PL8A 2P9IB 3FZFA 4K41A 2FXUA 3W0LA 4FWNA 2ZWHA 3ZEUB 2BTFA 3FGUA 1GLAG 2E2QA 4BRGA 2CGLA 5ADXA 4PKIA 3A5LC 1Z6RA 3RSEA 4WQ4C 2NLXA 3I33A 3EN9A 4BC3A 3CJAA 5AQPA 3C7NB 4PKHA 1T6DA 5E84A 4WQ5C 5B8HA 2GEMA 5BR9A 2E20A 3LDPA 1HX1A 1HPMA 3AAQA 2P9KA 1BA0A 2PAVA 1KAXA 3EZWA 3U4LA 3O8MA 3WXKA 4EFHA 5AZJA 1NBWA 2P9NB 5EXWA 5AQKA 3WUHA 3DJCA 5BRHA 4AM6A 5BRFA 3WXLA 4IJNA 3SK3A 3CI5A 2I7NA 4A2AA 1KAZA 3QFPA 1JCEA 1LOTB 3IDHA 4BR5A 3O1BA 2E1YA 4IO8A 4BR4A 5AR0A 3W3DA 4RTFD 4RWTA 3H1QA 4BREA 3LDNA 1WUAA 3VF6A 3R6MA 4FPAA 4DCHA 2W40A 1NGHA 3L4IA 3H6EA 1E4FT 2QWRA 3D2FA 4JD2A 3CETA 2HF3A 1QZ6A 3ENHA 4DHYA 3MDQA 4FWOA 5AZIA 5FPEA 1ESVA 1GLBG 1IG8A 3OHRA 2QWLA 2CGKA 3ZX0A 5AQZA 4DQ8A 4FSVA 3ULEA 1BOTO 2FSKA 1CZAN 1GLJO 3O80A 3VESA 2ASPA 2VCPA 2E2NA 3JXUA 3FZLA 4H5WA 4JN4A 4FPBA 5AQOA 3JS6A 1QHAA 3S41A 4BR7A 1SZ2A 2P9SA 3GOIA 3O08A 2E1ZA 2P9UA 3M1FA 2Q36A 4EAHD 3QICA 1NGEA 1NGDA 3MK6A 3IFRA 4BR9A 2P9KB 3ATVA 1BO5O 2CH5A 3A0IX 2NRHA 4ISFA 1DKGD 4CJ7A 3BF3A 1RFQA 2E2PA 3QMLA 4BGBA 1BA1A 3GBTA 5EVZA 3QBWA 3QBXA 3FZHA 5KPZA 2VWBA 4Z94A 3H45C 1GLLO 3UKRA 2Q0UA 4EHUA 2D0PA 4B1XB 4BRCA 4CZJA 4J8FA 2Q0RA 5AQHA 3MN7A 4H0XB 2A42A 3U9ZA 5FPMA 1XUPO 3KZBA 1U2VB 2P9LA 3FR0A 5JLFA 3BEXA 4CD3A 1JCFA 4CZFA 1XQSC 3D2EA 2A40A 5BRDA 4WYBA 3BUZB 4CZLA 3A5OC 3ULEB 5F2RA 3WXJA 2D4WA 2QW9A 1J6ZA 1X9JA 3DXKA 3WXIA 4FWQA 3UKUB 2Q31A 5AQNA 5JICA 2GWKA 4EIAA 5AFUH 5TKYA 4H5VA 4I6MA 3IMXA 3VPZA 1DEJA 2HF4A 2P9PB 3DXMB 3QFUA 2GWJA 4IJAA 2WUSA 4QS7A 3VEXA 4BVOA 4BRQA 4BC4A 3LDLA 3VOVA 3VGKA 4WQ4A 5AQQA 3A5MC 5AQIA 4BQZA 4IZ9A 3TU5A 4L3QA 1K8KB 3CJ1A 4WQ5A 3LM2A 2I7PA 4A2BA 4BRHA 3P4IA 4MLHA 4B1UB 2CGJA 1IJJA 4BRIA 1HLUA 1MDUB 4ISEA 4O5FA 5LY3A 2IVNA 3MMVA 1RDWX 2IVOA 1EQYA 1X3NA 4FOIA 4CD1A 4CZEA 1D4XA 4M63C 2QWNA 1NGCA 4NO7A 3GG4A 2AA4A 3ZETA 1ZC6A 3HM8A 3VEWA 1YUWA 5BPLA 4E1JA 1NM1A 5AQWA 1GLEG 2PBDA 4FL9A 3VERA 3C0BA 5AQMA 1RGIA 1HUXA 3G25A 5ADXH 1Q18A 4H03B 4BRMA 4HWIA 3H3OB 1BDGA 3L6QA 2FSJA 2IIRA 2ITMA 5KPTA 5ELZA 1P8ZA 5AQJA 3FE1A 3M3ZA 4BR0A 4MLEA 2Q2RA 3RSEB 3AAPA 4JHDA 1V4TA 4H0OA 2QWQA 5LJWA 3FFKB 1ATNA 3M6GA 3ENOA 4H5RA 1V4SA 4B1VA 4F9OA 2BUPA 1YAGA 2IVPA 4B1ZA 5AQVA 3WEEA 5AZJB 3H1VX 2YHXA 1NGAA 4FO0A 3ZEUA 3FZKA 1NWKA 3QB0A 2VYPA 4CZMA 3SLCA 5JLHA 3CJBA 1NGIA 5E26A 2H3GX 4BROA 3UE5A 1BUPA 1XC3A 2GUPA 1NGBA 3C7NA 3DAWA 2FSNA 2QWOA 1S22A 4RCHA 4BRNA 5CE3A 3WQTA 5AFUA 5BN9A 1SAZA 3GDQA 5EX5A 1T44A 3VEYA 1NGGA 4BQLA 3A5NC 3CJ9A 4CI6A 3U9DA 3B8AX 2P9NA 2D0OA 4AM7A 4PL7A 3I8BA 3VF4A 3DWLA 3AY9A 3D2FB 4JD2B 4XH1A 2ZF5O 4NB4A 2A6AA 3SJHA 3LDQA 1E4GT 3VETA 4A62A 4BRKA 2W41A 3ID8A 3IUCA 5AZIB 5FPDA 4B1YB 4BRDA 1C0FA 1Y64A 2V52B 3J8AA 2F9WA 3LM9A 3CJ7A 3BF1A 3EKSA 3HBTA 1HJOA 5BPNA 5KPRA 4JNEA 5AQSA 3MN5A 5FPNA 4XH5A 2CH6A 3R8EA 3WT0A 2QWPA 2GELA 4KBOA 3L0QA 4BG9A 4BGAA 2P9SB 4H0PA 2P9UB 3ATUA 3O5BA 1T6CA 4FWSA 4K25A 2QWMA 3HI0A 3EO3A 1QQMA 1GLDG 1G99A 4B1WB 3WEEB 2D1KA 3UB5A 2QXLA 4BC2A 4H5NA 1BWFO 4FWPA 2A5XA 1JCGA 4K43A 4K42A 1H1VA 5KQDA 4BG8A 5AQGA 4BRFA 1BU6O 4CZIA 5AQRA 1TYQA 2FLOA 2GTDA 3GL1A 3KVGA 1BG3A 2V7ZA 4GY2B 4YDUC 1TUUA 1C0GA 3UKRB 2NZTA 2YHWA 3FLCO 2E8AA 3FZMA 5LJVA 1Z05A 3HZ6A 1WOQA 3EL2A 3A8YA 2A3ZA 4A61A 1S3XA 3CJCA 1MWKA 4IWVA 5F0XA 3MCPA 3BP8A 4YDUA 5AQLA 4DB3A 2OANA 4LC9B 2Q1NA 2YCHA 3D7EO 4C23A 5KQ8A 2P9LB 5EOYA 3VEOA 5JMVA 3LDOA 3AARA 4BRPA 5BPMA 3D2EB 4BVPA 2Q97A 4FWKA 4FOEA 4PKGA 1DGKN 2J4RA 2KHOA 2ZGYA 4BRLA 2QM1A 4H5TA 3H46O 3VGLA 2F9TA 3WQUA 3KHYA 1KXPA 1QQOA 3DXKB 3SMSA 1QZ5A 4H0YB 5BN8A 2HOEA 5AQYA 3U8XA 5AQUA 3ZX2A 3R9PA 1GLFO 4Y0WA 3CHWA 1U2VA 3ZX3A 4I6MB 4M7YA 5BREA 2FF3B 4M7XA 2P9IA 2E88A 2EWSA 3VF2A 2ASMA 3UKUA 4BC5A 1ATRA 1QQNA 1TYQB 4CZGA 1YXQA 4ISGA 1LCUA 1HKBA 2YJEA 3H3NO 4CZHA 1ATSA 4CZKA 1ZBSA 2P9PA 3DXMA 2E2OA 1MA9B 4CBXA 4BRAA 4GNIA 2YI1A 3HSCA 4BR2A 4MO4A 4CBUA 5AQFA 4HTLA 4QS8A 3CIPA 3VENA 1TUYA 4XH4A 4FWLA 3CQYA 3QDKA 3ZETB 5F1XA 3EKUA 4H0VB 4O8KA 1K8KA 5AQXA 4H0TB 3O6WA 4JAXA 3CERA 1YVNA 1HKGA 2FF6A 2YJFA 1R59O 3MN9A 1MWMA 2YHYA 3SMPA 1NGFA
chains in the Genus database with same CATH superfamily
3OYKA 1U45A 3TAMA 4DFJA 3BY5A 4FWRA 1HNVA 1CZBA 3HP9A 4J2EA 4QS9A 3CQXA 5CHIA 4IXCA 4CJKA 3MN6A 4JHDB 2HHWA 4B9MA 2ZGZA 4XEIA 2ASOA 2V7YA 2P9IB 2VGMA 2FXUA 2O8BA 1E3MA 2FC0A 2ZWHA 3AGRA 3G4SN 3FGUA 2HHQA 3FFIA 3R3LA 2E2QA 2OZMA 2CGLA 1VK0A 1X9MA 3A5LC 4WQ4C 3TWHA 3AVLA 4FK2A 4PQUA 2JWLA 4IFEA 5E84A 3DYAA 2QI2A 4CJRA 1YF5L 1KAXA 3WXKA 4EFHA 5EXWA 2P9NB 4DV5K 3LP2A 4FJ9A 4DLEA 3THWB 4YORA 1Q81O 4L8RB 1DLOA 3DMJA 3ZSOA 3CI5A 2I7NA 5M1QA 3QFPA 4BR5A 1BGXT 4FVUA 4FM2A 4IO8A 3C6UA 4B3TK 5AR0A 3W3DA 4RTFD 4BREA 3CD6N 3I55N 3VF6A 3ASMA 3R6MA 2W40A 1U47A 2YKMA 3AO1A 1LAWA 4U67L 1VSMA 2HF3A 3ENHA 4KFBA 5C0YA 1LWEA 4FWOA 4QCLA 4FJHA 3MWPA 5AZIA 2YNGA 1GLBG 3OHRA 3ZX0A 1SL2A 3DLGA 4B3RK 1WBBA 5HP1A 1JLAA 2HNZA 3SAFA 2ASPA 4H5WA 2E2NA 1KD1O 4KHYA 4F2SA 3MXJA 3C6TA 3O9RA 4NCGA 5AQOA 4HVJA 3GOIA 4FW2A 3M1FA 3PX0A 1HNZK 5M1OA 1NGEA 4DFPA 4CK1A 1FKPA 2P9KB 2ZQBA 3ID6A 4DTJA 5HRRA 2F8TA 4FLYA 4CF1A 4JLHA 3O9UA 3TSPA 4IO9L 3NVMA 1BCMA 4JKDA 4E7IA 5KPZA 4WFAL 1DTTA 5GAGP 3H45C 1REVA 4Z94A 2RE2A 3QO9A 4WE1A 3T7ZA 3VQQA 3P1GA 3SI6A 3KLEA 4EHUA 2D0PA 4O4GA 3RRHA 3OW2M 3ZSZA 3OYGA 4F4KA 2W42A 1YIJN 4AHVA 4GKKK 5FPMA 3QERA 3SAGA 2G8IA 1XUPO 3IG1A 4YOTA 3BEXA 4CD3A 2X6NA 2GX9A 1XQSC 1HR0K 3D2EA 1LV5A 4FK4A 4CZLA 3A5OC 1T3VA 4ELUA 2D4WA 2QW9A 4OX9K 4A5BA 3T69A 1NOZA 4FJNA 1YTAA 3NF9A 2ZD1A 1T03A 4EIAA 4DUYK 5AFUH 1N8RO 4H5VA 1VRTA 3OYFA 4WFBL 3QFUA 3RRGA 3J7AP 2GWJA 4DFMA 4IJAA 2WUSA 4QS7A 3KD1E 3VEXA 3OYAA 4LF9K 3VOVA 4A59A 3VGKA 5AQIA 1W97L 3HXMA 4L3QA 1NKCA 1QVGM 1NK6A 3CCQN 3CMAN 4OPJA 4A2BA 4CHZA 4MLHA 4OGCA 2O8CB 2CGJA 4B3SK 1J5OA 4Y1CA 1MDUB 1YHQN 4M3RA 2VQFK 2IVNA 1RDWX 2IVOA 3DOLA 4CGGA 1HNWK 2P1JA 4FOIA 3RR8A 3E66A 4CD1A 3SUPA 2QWNA 1NGCA 1YT3A 4CIGA 3HM8A 1X1PA 4KTWA 4NCBA 2KFNA 5HROA 3KJVA 4KV8A 1WSEA 4JI4K 1NM1A 3C65A 4F3OA 4DTMA 2HNYA 4DMNA 3V81A 1ITGA 1VRUA 4AQYK 1L3UA 1OH8A 3DI6A 4KH4A 5CYQA 3G25A 1GOCA 4FJGA 1YTUA 3CPWM 4JK9A 5HL7L 3CF5L 5KPTA 1P8ZA 5AQJA 3NF7A 4G9ZA 3I8DA 2F4VK 4DKWA 1V4TA 5LJWA 3FFKB 1K8AO 1KVBA 3M6GA 4LH4A 3VQAA 2B4JA 1V4SA 2BUPA 3HP6A 4FYDA 3WEEA 5AZJB 4FO0A 1NWKA 2VYPA 2ZE2A 2LSNA 1VSDA 3ZLJA 3CJBA 5E26A 2EHGA 3C95A 1NJZA 1VQ5N 2PYJA 1OH5A 3DM2A 3E1YA 3OJUA 1S22A 1N32K 4KH5A 5BN9A 2X78A 5TKWA 3VEYA 4BWMA 3CJ9A 4CI6A 4Z4IA 4CJEA 2D0OA 5JS1A 3I8BA 4RW4A 1M1KO 1ASWA 1L3VA 2XRIA 3TAEA 2ZF5O 3PSFA 4C8LA 1G15A 2KFZA 3VETA 3G0ZA 3OVNA 3IUCA 4X66K 3WNFA 4B1YB 4BRDA 3NGIA 3ZSRA 4CIEA 4C1NI 4O55A 5BPNA 3OYNA 4BDPA 5BR8K 3WT0A 3R1XA 4EZ9A 3S3MA 4BG9A 5FROA 2P9UB 4Z0UA 1TK8A 2KKZA 3JSMA 1QQMA 3M8QA 1G99A 1KVAA 3JAMO 4OKJA 3O3FA 4N76A 5JS2A 1EWRA 4CHYA 2GUIA 4JKAA 4G1QA 3KLFA 3MXMA 4YDUC 1C0GA 3KK1A 3UKRB 3K0SA 1KFDA 3FZMA 2JLEA 5LJVA 4O8UA 1D5AA 3LWLA 4CEBA 3KK7A 3SAHA 1S5JA 2FBTA 4CF0A 2QTDA 4M42A 4FLWA 2VWKA 3ZT2A 2Q1NA 3D7EO 2P9LB 4B3OA 3VEOA 2WOMA 4JKHA 4DQSA 2PY5A 4CHOA 1UA0A 4PKGA 4B8AB 2KHOA 2O4GA 4CJ5A 1IKVA 5C42A 4H0YB 1ZBLA 1VSKA 3BGRA 5AQUA 4JI8K 1WNSA 5GIOA 1GLFO 3HM9A 3CHWA 1U2VA 3VQDA 3J7YP 3BZCA 1JLEA 1X9SA 1A5VA 3L2UA 1NJWA 3HK2A 2EWSA 3DLKA 1EWQA 1BIZA 4DSJA 1DT9A 4BC5A 1QQNA 1QSYA 4KPYA 1TYQB 5CZ2A 3AVBA 4ISGA 4CZKA 1ZBSA 2P9PA 5J2NA 2E2OA 1MA9B 4GNIA 4C8MA 4YOXA 3OY9A 4EZ6A 4FVMA 3CIPA 4FWLA 4O8KA 1K8KA 3SJJA 3TANA 3TABA 1N34K 4WCEL 3M8SA 3MN9A 5M1KA 4HUGA 2R7YA 3SMPA 3LP0A 4E0DA 1NGFA 3LAMA 1TKTA 4DR5K 1NGJA 3OYIA 1EP4A 4HUFA 4M3TA 5FRMA 5J2MA 1R0AA 3IS9A 1IKYA 3VEVA 4C8OA 2V51B 1RDDA 1OKJA 4FWMA 5M1NA 3GE1A 3MX5A 3B6OA 4CK2A 4EHTA 3NCIA 5I9EB 3DLRA 5JVHL 2GV9A 1SQKA 3F9MA 4PL8A 4DS4A 1OVQA 4FWNA 1KVCA 4R5PA 1U04A 3OBYA 1Z6RA 3NH1A 2XHBA 3THYB 4DTSA 3MX2A 3C7NB 1T8EA 3NMUA 3KK3A 4Y1DA 4E7JA 3O9TA 1XNRK 3S3NA 3N4PA 2HBMA 4IOXA 3LDPA 4LFAK 3MEEA 3CC4N 5FLXO 3AAQA 1RT5A 3U4LA 3EZWA 1FKOA 3O8MA 5AQKA 1I3AA 1W0HA 4H8KA 3DJCA 3KWGA 4CFCA 4J2BA 4AM6A 3NH2A 3DLLL 3P83D 4A2AA 3TAFA 1N36K 1HNXK 4YOVA 5E41A 3V9XA 4KHUA 3H1QA 2W6LA 3SBGA 1RT4A 1WUAA 4DCHA 2PFUA 3AVMA 3OS2A 3H6EA 1WAJA 2VG7A 4AHSA 4JD2A 1K6YA 3IAYA 2O8DA 3QNNA 1IG8A 2QWLA 5AQZA 4GMJB 1BOTO 4NLCA 3VESA 2IGIA 4H4OA 1CLQA 1WBDA 4FPBA 3ZT3A 3VA3A 1S6PA 4BR7A 1SZ2A 4ZHRA 3V9ZA 4E89A 2Q36A 3HL8A 1LW2A 4EAHD 3LP3A 3I0RA 2BH1A 2WONA 1J5EK 3QICA 3MCAB 1NGDA 3MK6A 4JI7K 3ATVA 4DTXA 1BO5O 2CH5A 4AHCA 2NRHA 2A1RA 1RTDA 3E01A 1EO1A 4XIUA 2E2PA 3QNOA 2HBLA 3GBTA 1VSLA 1WSGA 1ILYA 3QBWA 2QKBA 4OGEA 3DRPA 3QBXA 3FZHA 3AVAA 4E3SA 2RHKA 1KFSA 5A2QO 1C1BA 4ICLA 3ULDA 4B1XB 3VQ5A 3K5MA 3SYZA 2KTQA 2Q0RA 3MN7A 2A42A 1OH6A 1RT1A 4LSNA 3QEVA 1IG9A 3KZBA 5HBMA 3FR0A 3OYEA 1JCFA 4HTUA 2Y1JA 1XI1A 2IDOA 5BRDA 4WYBA 1Z26A 3BUZB 5F2RA 3E9PA 3LANA 1J6ZA 5M1FA 3TI0A 3ZYYX 1SKRA 1X9JA 3AA2A 2RKIA 3UKUB 1YJNN 2Q31A 5AQNA 1K73O 2NRWA 4DR4K 3P38A 1B92A 3CCUN 1NJXA 2XY5A 4CVNE 1FW6A 2A1SA 1DEJA 2HF4A 3DXMB 4CF2A 4I7FA 4AHUA 4DSKA 3OS0A 3L3VA 3O9QA 4ELVA 4BRQA 4LY7A 4BC4A 4CEEA 4KHSA 4LFBK 3HO1A 3LDLA 4CHNA 1UOCA 3LP1A 1RT7A 4FJJA 4BQZA 4IG0A 4IZ9A 3EE8A 5M1PA 5SZTA 4WQ5A 3LM2A 4RW6A 2I7PA 2HSTA 5KRTA 3P4IA 4B1UB 4M45A 1HLUA 4JK8A 4CERA 1RBTA 2WBNA 2OTJN 1EQYA 1X3NA 4DS5A 3U3YA 4C8KA 4PA1A 4E1MA 4B3MK 4M63C 4FM1A 4NO7A 1BI4B 2AA4A 1ZC6A 3VEWA 1YUWA 1O1WA 3D45A 4E1JA 3ENBA 2AJQA 5C15A 3C6HA 2HB5A 4RW7A 2PBDA 4FL9A 3VERA 3T1HK 1RGIA 1KLNA 4DQIA 3S9HA 4M3XA 1HUXA 5ADXH 5HOOA 1Q18A 5LL6Z 4BRMA 4HWIA 3AVIA 1NKEA 3T19A 3VQ4A 1GOAA 2F7TA 3CCEN 1TKZA 3MEGA 3O4NA 2OZSA 1RCHA 3LAKA 4KB1A 4FLVA 1CXUA 1QE1A 3AAPA 4JHDA 3K2PA 3RSEB 1ATNA 1ASVA 1VQMN 4F9OA 5GAHP 1YAGA 1HNIA 3WNHA 4NYFA 4B1ZA 4JKGB 4DSEA 2VG6A 3FZKA 1SL1A 3SLCA 4O44A 2IOCA 4DV4K 4AHTA 2Z1JA 1C6VA 1NK9A 3TSQA 2H3GX 1XWLA 3VQCA 3KLHA 2ETJA 4DV2K 1XC3A 4DQQA 1NGBA 2FSNA 1QSLA 2QWOA 3O3HA 2YNIA 4HUEA 1NK5A 4BRNA 4HCBA 4IEEA 4DR3K 4O0JA 4YNQA 3F2KA 3GDQA 3HSTB 4GVMA 4PUOA 3K5LA 3AO4A 4BQLA 4YHHK 4JEPA 3B8AX 2P9NA 4PL7A 4MDAA 4DQRA 3MEDA 3SQ2A 5I42A 3D2FB 2OPPA 2A6AA 4JS4A 3LDQA 4A62A 4FJLA 4E7KA 2W41A 4ELTA 1C0FA 1S1UA 3ZSWA 1Y64A 1BISA 3RMBA 1S1WA 2F9WA 1TAUA 3BF1A 3EKSA 1HJOA 3B6PA 1EKEA 4V19S 4KBOA 3L0QA 1NKBA 4Q5VA 2VGNA 2P9SB 1J53A 2DFHA 4R79A 2NRRA 4FWSA 4K25A 3T3FA 3HI0A 1GLDG 4K8XA 3WEEB 4OKKA 2QXLA 3UB5A 4FWPA 2A5XA 1JCGA 2O8FB 1N33K 4I2QA 4BRFA 4CZIA 1KSPA 2D5RA 5AQRA 1EETA 4CJPA 1S6QA 2GTDA 3GL1A 3KVGA 4GY2B 2YHWA 3FLCO 2E8AA 2G8KA 1CZ9A 3K58A 3EL2A 3NAEA 3ALYA 5DMRA 4DV0K 4NXNK 4FJ5A 1L5UA 1S3XA 2RF2A 3CJCA 4IWVA 4YDUA 4DB3A 2YNHA 3L2QA 4B9VA 1XHXA 1ASUA 5EOYA 5JMVA 3LDOA 3AARA 3CCJN 1VSEA 1JLCA 4C8NA 4W5QA 2E6MA 4BVPA 2Q97A 1I94K 1MU2A 4IKFA 2P51A 3RMCA 3THXB 2J4RA 2QM1A 4H5TA 5KRSA 2QK9A 3VGLA 3OYDA 1QQOA 3DXKB 3AA5X 4AH9A 2HOEA 3AVJA 3KTQA 2D0AA 1C0UA 3RWUA 4DF8A 1OVYA 3R9PA 3ZX3A 4FW1A 4I6MB 3V6DA 4ILGB 4BDYA 2FF3B 4M7XA 3NGZA 1RT3A 4N47A 1JXEA 1WB9A 1RTJA 1VQPN 1I39A 4CHPA 3ZSYA 1RBUA 4N56A 3TAPA 4MQ3A 4CZGA 1YXQA 1SL0A 1LCUA 3H3NO 2YJEA 2HHXA 4CZHA 1ATSA 1LWFA 1J9AA 4A5AA 4MDBA 3VTHA 2JWKA 1LWCA 4BR2A 2YKNA 4QS8A 3S3OA 4ID1A 4XH4A 3ZETB 2VG5A 3EKUA 3QIPA 1FJGK 4KHNA 4H0TB 3O6WA 4JAXA 2O8CA 1YVNA 1HKGA 2YJFA 3LZJA 1S1VA 4FXDA 2G8HA 2HBKA 1BQNA 1U6ZA 3A2FA 3VGMA 1NLVA 3LL3A 4CBWA 1HKCA 4DSIA 4J2AA 4CW7B 1VQLN 2HMPA 3NE6A 2E5LK 4F8RA 1RTIA 1P90A 1ZXOA 4EP4A 2IAJA 3VEZA 5CY4A 2A41A 1X9WA 3IKMA 4B9QA 3L3UA 3O1WA 3SQ1A 1KAYA 5C10A 2DPNA 1EXQA 3QEXA 5EY4A 1UWBA 4BY9C 3FZFA 1QHTA 4TSXA 3AGKA 4H4MA 3JYTA 3ZEUB 3SV4A 1KQSM 1GLAG 4DR7K 2HBJA 2KLAA 3V1RA 4K0KK 3K57A 5ADXA 1HQUA 3DRRA 4BC3A 3I33A 4CGIA 4PKHA 1T6DA 2P5GA 5B8HA 4CCHA 3AVCA 5BR9A 4CJ3A 5GIPA 3ZSVA 1RILA 1HX1A 1NK8A 1Q86O 2PAVA 5AZJA 3CFOA 1NBWA 3TTDA 3U3GA 3QEWA 4ZTFA 4FJ8A 4FLUA 3VN5A 5BRFA 4IJNA 1KAZA 3VQBA 4IFVA 1JCEA 3IDHA 2BDPA 4OVLA 4JI6K 3NBPA 2ZJRL 1WSHA 1XC9A 4BR4A 1ZYQA 4RWTA 2G8FA 3LDNA 1K9MO 4FPAA 3SUNA 1T05A 3C94A 2Y1IA 4PY5A 4OKEA 4CEAA 1U4BA 3DLBA 1NK7A 2HHUA 4DHYA 3KIOA 1IO2A 4JRQA 4JK7A 1ESVA 4CIFA 5DM6L 3ULEA 4DG1A 1GLJO 4RG8A 2VCPA 4JN4A 3FZLA 4DTRA 4FZYA 4LSLA 3HOTA 2PYLA 3VQEA 4IOCL 3SQ4A 3AVFA 4JI5K 1ZBIA 3O08A 2E6LA 2E1ZA 2P9UA 3HPHA 2OPSA 1JL2A 5LMNK 3OTOK 3D0PA 3IFRA 1WSFA 2NNWA 3A0IX 3OYMA 1DKGD 3QMLA 1BA1A 3TTCA 3VQ9A 2XY7A 2YX6A 3KLGA 3NFAA 2VWBA 1GLLO 3UKRA 2Q0UA 4BACA 4CFDA 2HHVA 1RBSA 4KREA 3EZ5A 2VWJA 4BRCA 1JXBA 4AILC 3N4QA 4J8FA 1UAXA 4H0XB 3U9ZA 4DV7K 1GOBA 3QINA 4UQGA 3RMDA 2Q3SA 3KLIA 4I9LA 5CYMA 3LWMA 2P9LA 4DU4A 1BIUA 3DLEA 5JLFA 2PZSA 1JLFA 3V1QA 4PWDA 2UXBK 2YHAA 2O8DB 3Q7CA 1NJIO 2NRVA 2O8EB 3E9LA 3CC7N 4E7LA 4CJVA 5D3GA 2WTUA 4FLZA 3WXIA 4FWQA 4FJIA 4CGDA 1ZBUA 2GWKA 5TKYA 2KZMA 4KHPK 3IMXA 3VPZA 4DTNA 4KI4A 4DSFA 1NG9A 2OPQA 4BVOA 4FM0A 3SV3A 1RTHA 4QAGA 2ITGA 3CFRA 4WQ4A 4DR2K 3DRSA 3A5MC 2HHTA 2JGUA 4B9LA 4BRHA 3PY8A 3O9SA 1IBKK 4ISEA 4GV6A 5LY3A 4YOYA 3WNGA 2D0CA 3NDKA 4FJXA 1D4XA 4I2PA 3E9OA 3NVKA 5DM7L 1W9HA 2GBZA 4DLGA 5BPLA 3NGYA 4W5RA 3CCVN 5J2QA 4LH5A 4CJTA 3WNEA 3AO2A 4Z4EA 1BHLA 3TAGA 4KO0A 3VQ7A 3SQ0A 3ITHA 5AQMA 3K5NA 2O8BB 4H03B 3BDPA 1JKHA 1BDGA 1Z25A 2FSJA 2IIRA 1TKDA 2D0BA 3M3ZA 4BR0A 1TGOA 2W6KA 2NUBA 4H0OA 2QWQA 1IKWA 3O3GA 1D9DA 4OLAA 4H5RA 4B1VA 1NOYA 4B08A 4DR6K 5AQVA 1S1XA 1RDAA 2YHXA 4CF9A 3QB0A 1XNQK 4CZMA 1YI2N 3BZKA 4IEIA 4CFAA 4CJFA 3J7ZO 4DTUA 1IBLK 1TVRA 3THYA 4KKOA 3UE5A 5GADP 1BUPA 1J54A 2GUPA 4LF8K 3C7NA 3VQPA 1JLBA 5CE3A 3WQTA 5T7BA 4M3UA 3D6RA 3AVNA 3KWIA 4QOZB 4LF5K 3A5NC 3PO5A 4FZXC 1VSFA 4B9UA 3VF4A 3DWLA 1IBMK 1JLGA 4B9SA 3EE9A 4XH1A 1IV0A 1U48A 3SJHA 3CC2N 1E4GT 4BRKA 3ID8A 4CJQA 1A5XA 5AZIB 2F96A 3V9UA 2V52B 1HMVA 1N5YA 4DTPA 3MAQA 1D9FA 3HYFA 1VQ6N 3HBTA 5KPRA 1QQCA 4JNEA 5FPNA 4LF7K 4XH5A 2CH6A 3R8EA 3TTFA 5KI6A 1SUQA 2QWPA 2GELA 4KI6A 1RT6A 5K14A 3O5BA 3I56N 1SV5A 1B9DA 1YJ9N 3NHGA 1TL1A 4B1WB 2D1KA 4KH6A 4W5TA 4BC2A 1HRHA 4JRPA 1VQ7N 1BWFO 4K43A 3MXIA 1H1VA 2RN2A 4BG8A 4HHTA 2QKKA 4JYAK 3AO5A 2FLOA 1BG3A 3KKRA 1JJ2M 1TUUA 3RVCA 4MFBA 2NZTA 3SBTA 3AVHA 4KHWA 1Z05A 3HOSA 1KTQA 3A8YA 2A3ZA 3PLAA 4WF9L 4CGJA 2X74A 5F0XA 3OYLA 1TK0A 1DTQA 5KGWA 4NYNA 4LC9B 4YFUA 1UA1A 2YCHA 5KQ8A 5HRPA 1Q9XA 2UXCK 3L2RA 5BPMA 3D2EB 4AHRA 4FOEA 1NK0A 1N6QA 1WN7A 3F9KA 4BRLA 5HRNA 3CCSN 2Z1GA 4BE2A 3WQUA 4DV6K 3VMFB 2FBYA 3SMSA 1QZ5A 4CF8A 4CHQA 3VQ6A 4M3ZA 1Y97A 5BN8A 3KKSA 5AQYA 3U8XA 2ATQA 3SUQA 1C0TA 4Y0WA 4LD0A 4CJLA 2XY8A 4M7YA 5BREA 4FLXA 1JLQA 3SCXA 1VQ8N 3HPOA 4CFBA 2P9IA 3SZ2A 1L3SA 2E88A 2F8SA 4NCAA 3VF2A 4Q0BA 1Q9YA 3UKUA 3CQ8A 1ATRA 3AA4A 2OCEA 3V9WA 1HKBA 4KRFA 2G8UA 3ISNC 4A57A 3DXMA 4CBXA 4BRAA 5AQFA 2HVHA 2XY6A 4HTLA 3OYCA 3G6EN 3VENA 4ZTJA 3CQYA 3QDKA 5AQXA 3THWA 1RBRA 1RBVA 5C24A 2Z1HA 3CERA 3PIOL 3DLHA 4O0IA 2FF6A 3G71N 3PX6A 1MWMA 4FJMA 2YHYA 4ILJA 3HPGA 1NJYA 3CCLN 3TPQA 3HTVA 4DFKA 4AF1A 2UYTA 1BI4A 1XMQK 4JI1K 1VQKN 4W5NA 1NMDA 2QA4N 1BQMA 5KTQA 3O4WA 4Z4CA 2P5OA 5AQTA 1X3MA 1FXXA 2OPRA 3UIQA 4MO5A 1GLCG 2AP1A 5C25A 4RW9A 3NF6A 4K41A 1XHZA 4OO1J 3W0LA 4CJWA 4BE0A 2BTFA 4BRGA 3CM6A 4N5SA 4IG3A 3SPYA 3HJFA 4PKIA 3RSEA 4IDKA 2NLXA 3EN9A 3CJAA 5AQPA 4OPKA 4CEZA 4KB0A 4Z4HA 1NNEA 4WQ5C 1S1TA 4DV3K 2GEMA 2E20A 1HPMA 3Q7BA 4JKGA 2P9KA 1BA0A 4JI3K 3WUHA 1QVFM 3AV9A 1IH7A 2HMIA 3CCRN 5BRHA 3WXLA 4FCYA 3SK3A 1LOTB 2DFEA 3O1BA 2QEXN 2YNFA 2E1YA 4RW8A 5LMUK 1NGHA 3L4IA 2KQ2A 3K9KA 3NH0A 1E4FT 1T7PA 3SNNA 2QWRA 2WFBA 3D2FA 3PSIA 4YOWA 3CETA 1Q7YO 1NU0A 2QXFA 5IWAK 1QZ6A 4BE1A 3MDQA 4B9TA 3O4QA 4JKEA 2DTUA 3QEIA 5FPEA 4PHTX 2CGKA 4DQ8A 4FSVA 3PX4A 5CZ1A 4CGHA 2FSKA 1CZAN 3O80A 4DF4A 4ILHA 3JXUA 3V1OA 5C12A 3PV8A 3OYBA 3QETA 3QEPA 1RDBA 1SKWA 3ZSXA 4FLTA 4DTOA 1NMNA 3RR7A 5FRNA 4CE9A 3JS6A 3OS1A 1QHAA 1F21A 3S41A 4CESA 2P9SA 5H1SQ 3VQ8A 3K5OA 3V9SA 4X65K 1C1AA 1WLJA 3M5RA 4BR9A 3M8PA 4ISFA 1S9GA 4CJ7A 1QTMA 3BF3A 1RFQA 4BGBA 4DU3A 4OPHA 1KRPA 2O8FA 5EVZA 3T1YK 1VSJA 3MECA 3AVGA 4X64K 1IKXA 3P31A 4KTQA 1TK5A 4GV9A 3MWTA 2Z1IA 4LF6K 4JI0K 4CZJA 4K8ZA 1CXQA 2HW3A 3K59A 3CYMA 5AQHA 3VA0A 1VQ4N 4KTZA 2X6SA 1KC8O 4DQPA 3G10A 1W7AA 1U2VB 3CMEN 5EU7A 4CZFA 3ZCMA 2A40A 5GINA 5DK5A 5CR4A 3U6FA 3THXA 3ULEB 3WXJA 3LPUA 3DXKA 4DSLA 2HHSA 1S9EA 5SWMA 3TR8A 3PIPL 4U7BA 2DY4A 5JICA 5J2PA 4YY3K 5I3UA 4I6MA 3T1AA 1TAQA 1VSHA 3KD5E 5HRSA 2P9PB 3P5JA 2UUAK 2B5JA 3SPZA 4CEOA 4DR1K 5AQQA 1KLMA 2IC3A 3TU5A 2G8VA 1O13A 1K8KB 3WXMB 1C1CA 5GAEP 3CJ1A 5C2FA 2IS3A 1IJJA 4BRIA 3QLHA 1Q82O 3HT3A 3ZSQA 4O5FA 3F5TA 3MMVA 3OJSA 4M3YA 3L2VA 4CZEA 4GV3A 2YV0X 5HLFA 2OTLN 3GG4A 3ZETA 4FJ7A 3CG7A 3NF8A 1TKXA 4CJUA 2HNDA 3CM5A 3H08A 1QSSA 3CCMN 5AQWA 4E19A 4I9QA 3OA9A 3LPTA 5AJ3K 4DWIA 1GLEG 3C0BA 3M8RA 4BWJA 3J80O 3EY1A 4LFCK 3LZIA 5IT9O 4BDZA 1HPZA 3H3OB 3L6QA 2ITMA 5ELZA 3FE1A 4MLEA 4CEFA 4CJ4A 2Q2RA 1YITN 4M3WA 1LAVA 4EP5A 3HRGA 1WAFA 3THVA 4J2DA 4F3TA 4ID5A 1RT2A 2RPIA 3ENOA 3AO3A 2IVPA 2I5JA 1VQON 3H1VX 4Z4FA 1NGAA 3ZEUA 3IRXA 1M90O 1EX4A 3L8BA 3TAQA 5JLHA 1A5WA 1NGIA 2VQEK 3OBWA 1W2BM 1VHXA 3CXCM 4BROA 1BCOA 2ZJQL 1WSJA 3DAWA 2KZZA 4RCHA 2HHHK 2EX3A 2FBVA 5AFUA 4X62K 3TSUA 5J1EA 2NRXA 1OH7A 1SAZA 3ZT4A 5EX5A 1SKSA 1T44A 1NGGA 4KHQA 3HVRA 1U49A 3U9DA 4JS5A 4AM7A 2BGGA 3TARA 4JKFA 3ZT1A 3AY9A 2XO7A 1HYZA 4JD2B 4NB4A 2E4LA 1WSIA 4LF4K 1Q8IA 1ZBHA 5FPDA 3L4QA 3RTVA 3PUFA 5MLCQ 3J8AA 3LM9A 4F2RA 3CJ7A 3OYHA 3F73A 5AQSA 3MN5A 3QIOA 3L2WA 1TL3A 1LW0A 1NK4A 4C1NK 4KAZA 4WFNL 4BGAA 1VQNN 3AVKA 3RMAA 4N41A 2BANA 3SUOA 4H0PA 3ATUA 3K9JA 1T6CA 1VAZA 3EEQA 2G8WA 4FK0A 2QWMA 3EO3A 3CFPA 3DOKA 4H5NA 2KW4A 5JVGL 4K42A 4O5BA 2NRZA 1RDCA 4CK3A 5KQDA 1VSIA 1FK9A 1SS6A 3KK2A 5AQGA 3J81O 1BU6O 4GVEA 2OA8A 4CECA 1TYQA 3LALA 1L3TA 2V7ZA 3CPEA 2HVIA 4CJSA 2UUBK 4YOUA 3HZ6A 1D8YA 1HYSA 1WOQA 4JKCA 1VQ9N 1S72N 4A61A 4E7HA 1MWKA 4NXMK 3MCPA 3BP8A 5AQLA 4HCCA 4DV1K 1TV6A 2OANA 4FJKA 2B6AA 3LDSA 2ZJPL 4C23A 4OLBA 2UUCK 1HQEA 4BRPA 4UY8O 4OPAA 4FWKA 2YHBA 1DGKN 4NLBA 2ZGYA 2BE2A 3H46O 2F9TA 3KHYA 1HJRA 1KXPA 4CGFA 2NRTA 4B8CA 1B9FA 2UXDK 1KCFA 3P39A 4IBNA 3ZX2A 3OYJA 3QESA 4IFYA 5KGXA 3EYZA 4B9NA 5FDLA 5C2DA 1C0MA 2ZM6K 2OYQA 2O8EA 2O4IA 3PO4A 3I0SA 3ZT0A 2UU9K 2ASMA 2FBXA 1RDUA 4OJRA 1HYVA 4JKBA 4M41A 4FZZA 4Z4GA 4CEDA 3VTIA 4DU1A 2WC9A 4GW6A 4JI2K 2YI1A 3HSCA 4IOAL 4E1NA 3C6AA 2DFFA 4MO4A 4CBUA 4IDHA 3AA3A 1TUYA 3V4IA 1JL1A 5F1XA 4H0VB 1XMOK 1YJWN 4DUZK 1RNHA 4CEQA 4GKJK 1QS4A 3HVTA 4JV5K 1R59O 1BL3A 4W5OA 1ZBFA 1YVUA
chains in the Genus database with same CATH topology
2HBKA 3TPQA 1NGJA 1U6ZA 4FWRA 3VGMA 1NLVA 3LL3A 4CBWA 3HTVA 1HKCA 4AF1A 1VQLN 2HMPA 2UYTA 1P90A 1ZXOA 4QS9A 3VEZA 1VQKN 3CQXA 5CHIA 2A41A 4IXCA 3VEVA 3IKMA 3MN6A 4B9QA 3O1WA 1KAYA 1NMDA 4JHDB 5C10A 2QA4N 2V51B 1OKJA 4FWMA 3O4WA 3GE1A 3MX5A 4EHTA 5M1NA 2DPNA 2ZGZA 5I9EB 4XEIA 5AQTA 5JVHL 1X3MA 1SQKA 3F9MA 2ASOA 5EY4A 4MO5A 1GLCG 2AP1A 2V7YA 4PL8A 4BY9C 2P9IB 2VGMA 3FZFA 4K41A 2FXUA 4OO1J 3W0LA 3AGKA 4FWNA 2ZWHA 3AGRA 3ZEUB 3G4SN 2BTFA 3FGUA 1KQSM 1GLAG 3R3LA 2E2QA 2HBJA 2KLAA 4BRGA 2CGLA 5ADXA 3OBYA 4PKIA 3A5LC 1Z6RA 3RSEA 4WQ4C 3MX2A 2NLXA 3I33A 3EN9A 4BC3A 3CJAA 2JWLA 5AQPA 3C7NB 3NMUA 4PKHA 4IFEA 1T6DA 5E84A 4WQ5C 3O9TA 5B8HA 2QI2A 3N4PA 2GEMA 2HBMA 4IOXA 2E20A 5BR9A 5GIPA 3LDPA 1HX1A 3CC4N 1Q86O 1HPMA 3AAQA 3Q7BA 1YF5L 4JKGA 2P9KA 1BA0A 2PAVA 1KAXA 3EZWA 3U4LA 3O8MA 3WXKA 4EFHA 5AZJA 1NBWA 2P9NB 5EXWA 3TTDA 5AQKA 3WUHA 1QVFM 4YORA 3DJCA 3KWGA 3CCRN 5BRHA 1Q81O 4AM6A 5BRFA 3WXLA 4IJNA 3SK3A 3DLLL 3CI5A 2I7NA 4A2AA 1KAZA 5M1QA 3QFPA 1JCEA 1LOTB 3IDHA 4BR5A 3O1BA 2QEXN 2E1YA 4YOVA 4FVUA 2ZJRL 4IO8A 4BR4A 5AR0A 3W3DA 4RTFD 4RWTA 3H1QA 4BREA 3LDNA 3SBGA 3I55N 1WUAA 3VF6A 1K9MO 3CD6N 3R6MA 4FPAA 4DCHA 2W40A 2PFUA 1NGHA 3L4IA 3H6EA 3K9KA 1E4FT 2QWRA 2WFBA 4U67L 3D2FA 4JD2A 4YOWA 3CETA 1Q7YO 2HF3A 1QZ6A 3ENHA 4DHYA 5C0YA 3MDQA 4FWOA 3MWPA 4JKEA 5AZIA 5FPEA 4JK7A 1ESVA 1GLBG 1IG8A 3OHRA 2QWLA 2CGKA 3ZX0A 4PHTX 5AQZA 4DQ8A 4FSVA 5DM6L 3ULEA 1BOTO 4NLCA 2FSKA 1CZAN 1GLJO 3O80A 3VESA 4ILHA 3SAFA 2ASPA 2VCPA 2E2NA 3JXUA 3FZLA 4H5WA 4JN4A 5C12A 1KD1O 3HOTA 3O9RA 4IOCL 4FPBA 5AQOA 3JS6A 1QHAA 3S41A 4BR7A 1SZ2A 2P9SA 3GOIA 3O08A 5H1SQ 2E1ZA 2P9UA 3M1FA 2Q36A 4EAHD 2BH1A 3M5RA 3QICA 5M1OA 1NGEA 3MCAB 1NGDA 3MK6A 3IFRA 4BR9A 2P9KB 3ATVA 2NNWA 1BO5O 2CH5A 3A0IX 2NRHA 4ISFA 1DKGD 4CJ7A 3ID6A 3BF3A 1RFQA 2E2PA 3QMLA 2HBLA 4OPHA 1BA1A 3GBTA 4BGBA 3TSPA 3O9UA 5EVZA 3TTCA 2YX6A 1ILYA 3QBWA 4IO9L 3NVMA 4JKDA 3P31A 3QBXA 3FZHA 5KPZA 4WFAL 2VWBA 5GAGP 3H45C 4Z94A 2RE2A 2RHKA 1GLLO 3UKRA 2Q0UA 3MWTA 4GV9A 3T7ZA 4EHUA 2D0PA 4B1XB 3OW2M 4BRCA 4CZJA 3N4QA 4J8FA 2Q0RA 5AQHA 3MN7A 4H0XB 2A42A 3U9ZA 1YIJN 1VQ4N 5FPMA 1KC8O 3SAGA 1XUPO 3KZBA 1U2VB 2P9LA 3FR0A 5JLFA 4YOTA 3BEXA 3CMEN 4CD3A 1JCFA 2GX9A 3Q7CA 1NJIO 4CZFA 1XQSC 2NRVA 3D2EA 2A40A 5GINA 3E9LA 5BRDA 4WYBA 3CC7N 3BUZB 5CR4A 3A5OC 4CZLA 3ULEB 5F2RA 1T3VA 3WXJA 2D4WA 2QW9A 3E9PA 1J6ZA 5M1FA 4A5BA 3T69A 3ZYYX 1X9JA 3DXKA 3WXIA 4FWQA 3PIPL 3UKUB 1YJNN 2Q31A 5AQNA 4U7BA 1K73O 5JICA 2NRWA 2GWKA 4EIAA 3P38A 5AFUH 1N8RO 3CCUN 5TKYA 4H5VA 4I6MA 3IMXA 3VPZA 1DEJA 2HF4A 2P9PB 3DXMB 3QFUA 4WFBL 2GWJA 4IJAA 2WUSA 4QS7A 3VEXA 3O9QA 4BVOA 4BRQA 4BC4A 3LDLA 3VOVA 4A59A 3VGKA 4WQ4A 5AQQA 3A5MC 5AQIA 4BQZA 4IZ9A 1W97L 3EE8A 3TU5A 1O13A 5M1PA 4L3QA 1K8KB 3WXMB 1QVGM 5GAEP 3CJ1A 4WQ5A 5C2FA 3LM2A 3CCQN 3CMAN 2I7PA 2HSTA 4A2BA 4BRHA 3P4IA 4MLHA 4B1UB 2CGJA 1IJJA 4BRIA 1Q82O 3O9SA 1HLUA 4JK8A 1MDUB 4ISEA 4O5FA 1YHQN 4GV6A 2WBNA 5LY3A 3F5TA 2IVNA 3MMVA 1RDWX 2IVOA 1EQYA 2OTJN 1X3NA 4YOYA 4FOIA 3E66A 4CD1A 4CZEA 1D4XA 4GV3A 4M63C 2QWNA 1NGCA 3E9OA 2OTLN 4NO7A 3NVKA 3GG4A 5DM7L 2AA4A 3ZETA 1ZC6A 3HM8A 3VEWA 1YUWA 5BPLA 4E1JA 3ENBA 3CCVN 1NM1A 3C65A 3CCMN 5C15A 5AQWA 3C6HA 3OA9A 1GLEG 2PBDA 4FL9A 3VERA 3C0BA 5AQMA 1RGIA 4KH4A 1HUXA 3G25A 5ADXH 5HOOA 1Q18A 4H03B 4BRMA 4HWIA 3H3OB 3CPWM 4JK9A 1BDGA 5HL7L 3L6QA 2FSJA 2IIRA 3CF5L 2ITMA 2F7TA 5ELZA 1P8ZA 5AQJA 5KPTA 3CCEN 3FE1A 3M3ZA 4BR0A 4G9ZA 4MLEA 2Q2RA 3RSEB 3AAPA 4JHDA 1YITN 4DKWA 1V4TA 4H0OA 2QWQA 3HRGA 5LJWA 3FFKB 1K8AO 1ATNA 3M6GA 3ENOA 1VQMN 4H5RA 1V4SA 4B1VA 4F9OA 2BUPA 5GAHP 1YAGA 2IVPA 4B1ZA 5AQVA 4JKGB 3WEEA 5AZJB 3H1VX 2YHXA 1NGAA 4FO0A 1VQON 3ZEUA 3FZKA 1NWKA 3QB0A 1M90O 2VYPA 4CZMA 3SLCA 5JLHA 1YI2N 3CJBA 1NGIA 5E26A 4IEIA 3OBWA 3TSQA 2H3GX 3J7ZO 1W2BM 3CXCM 4BROA 1VQ5N 3UE5A 5GADP 1BUPA 1XC3A 2ZJQL 2GUPA 3E1YA 1NGBA 3C7NA 3DAWA 2FSNA 2QWOA 1S22A 4RCHA 4BRNA 5CE3A 3WQTA 5AFUA 4IEEA 4KH5A 3D6RA 5BN9A 3TSUA 2NRXA 3KWIA 1SAZA 3F2KA 3GDQA 5EX5A 1T44A 5TKWA 1NGGA 3VEYA 4BQLA 3A5NC 3CJ9A 4CI6A 4JEPA 3U9DA 3B8AX 2P9NA 2D0OA 4AM7A 4PL7A 4MDAA 3I8BA 3VF4A 1M1KO 3DWLA 4JKFA 3AY9A 3D2FB 3EE9A 4JD2B 4XH1A 2ZF5O 4NB4A 2A6AA 3SJHA 3CC2N 3LDQA 1E4GT 3VETA 4A62A 4BRKA 2W41A 3ID8A 3IUCA 5AZIB 5FPDA 3L4QA 4B1YB 4BRDA 1C0FA 1Y64A 2V52B 5MLCQ 3J8AA 4C1NI 2F9WA 3LM9A 1VQ6N 3CJ7A 3BF1A 3EKSA 3HBTA 1HJOA 5BPNA 5KPRA 4JNEA 5AQSA 3MN5A 5FPNA 4XH5A 2CH6A 3R8EA 3WT0A 3R1XA 3TTFA 4C1NK 2QWPA 4WFNL 2GELA 4KBOA 3L0QA 4BG9A 4BGAA 1VQNN 2VGNA 2P9SB 4H0PA 2P9UB 3ATUA 3O5BA 2NRRA 1T6CA 1VAZA 3K9JA 4FWSA 4K25A 2QWMA 3HI0A 4R79A 3I56N 3EO3A 2KKZA 1QQMA 1GLDG 1YJ9N 1G99A 4B1WB 3WEEB 2D1KA 4KH6A 3UB5A 2QXLA 4BC2A 4H5NA 1VQ7N 1BWFO 4FWPA 5JVGL 2A5XA 1JCGA 4K43A 4K42A 2NRZA 1H1VA 5KQDA 4BG8A 1SS6A 5AQGA 4BRFA 1BU6O 4CZIA 4GVEA 5AQRA 1TYQA 2FLOA 2GTDA 3GL1A 3KVGA 4JKAA 1BG3A 2V7ZA 4GY2B 1JJ2M 4YDUC 1TUUA 3CPEA 1C0GA 3RVCA 3SBTA 2NZTA 2YHWA 3FLCO 3UKRB 2E8AA 3FZMA 5LJVA 4YOUA 1Z05A 3HZ6A 3HOSA 4O8UA 1WOQA 3EL2A 3A8YA 4JKCA 1S72N 2A3ZA 3KK7A 4A61A 3SAHA 1VQ9N 3PLAA 4WF9L 1S3XA 3CJCA 1MWKA 4IWVA 5F0XA 3MCPA 3BP8A 2QTDA 4YDUA 5AQLA 4DB3A 2OANA 4LC9B 2ZJPL 2Q1NA 2YCHA 3D7EO 4C23A 5KQ8A 2P9LB 5EOYA 3VEOA 5JMVA 3LDOA 4JKHA 3AARA 4BRPA 3CCJN 5BPMA 4UY8O 4OPAA 3D2EB 4BVPA 2Q97A 4FWKA 4FOEA 1EO1A 4PKGA 1DGKN 4NLBA 2J4RA 2KHOA 2ZGYA 4BRLA 2QM1A 4H5TA 3H46O 3CCSN 3VGLA 2F9TA 3WQUA 3KHYA 1KXPA 3VMFB 1QQOA 2NRTA 3DXKB 1QZ5A 3SMSA 4H0YB 5BN8A 2HOEA 5AQYA 3U8XA 5AQUA 3P39A 3ZX2A 1OVYA 3R9PA 1GLFO 4Y0WA 3CHWA 1U2VA 3ZX3A 5GIOA 4I6MB 4M7YA 5BREA 4ILGB 2FF3B 5C2DA 4M7XA 1VQ8N 2P9IA 1VQPN 2E88A 2EWSA 3VF2A 2ASMA 3UKUA 1DT9A 1RDUA 4BC5A 1ATRA 1QQNA 4JKBA 1TYQB 4CZGA 1YXQA 4ISGA 1LCUA 1HKBA 2YJEA 3H3NO 4CZHA 3VTIA 1ATSA 4CZKA 4A57A 1ZBSA 2P9PA 3DXMA 2E2OA 4A5AA 1MA9B 4CBXA 2WC9A 4BRAA 4GNIA 4MDBA 3VTHA 2JWKA 2YI1A 3HSCA 4IOAL 4YOXA 3C6AA 4MO4A 4BR2A 4CBUA 5AQFA 4IDHA 4HTLA 4QS8A 3G6EN 3CIPA 3VENA 1TUYA 4XH4A 4FWLA 3CQYA 3QDKA 3ZETB 5F1XA 3EKUA 4H0VB 4O8KA 1K8KA 5AQXA 1YJWN 4H0TB 3O6WA 4JAXA 3CERA 3PIOL 1YVNA 4WCEL 1HKGA 2FF6A 2YJFA 1R59O 3G71N 3MN9A 5M1KA 1MWMA 2YHYA 4ILJA 3SMPA 1NGFA 3CCLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TPQ A;  1NGJ A;  1U6Z A;  4FWR A;  3VGM A;  1NLV A;  3LL3 A;  4CBW A;  3HTV A;  1HKC A;  2HMP A;  2UYT A;  1ZXO A;  4QS9 A;  3VEZ A;  3CQX A;  2A41 A;  4IXC A;  3VEV A;  3MN6 A;  4B9Q A;  3O1W A;  1KAY A;  1NMD A;  4JHD B;  2V51 B;  1OKJ A;  4FWM A;  3O4W A;  3GE1 A;  4EHT A;  2DPN A;  2ZGZ A;  5I9E B;  4XEI A;  5AQT A;  1X3M A;  1SQK A;  3F9M A;  2ASO A;  5EY4 A;  4MO5 A;  1GLC G;  2AP1 A;  2V7Y A;  4PL8 A;  2P9I B;  3FZF A;  4K41 A;  2FXU A;  3W0L A;  4FWN A;  2ZWH A;  3ZEU B;  2BTF A;  3FGU A;  1GLA G;  2E2Q A;  4BRG A;  2CGL A;  5ADX A;  4PKI A;  3A5L C;  1Z6R A;  3RSE A;  4WQ4 C;  2NLX A;  3I33 A;  3EN9 A;  4BC3 A;  3CJA A;  5AQP A;  3C7N B;  4PKH A;  1T6D A;  5E84 A;  4WQ5 C;  5B8H A;  2GEM A;  5BR9 A;  2E20 A;  3LDP A;  1HX1 A;  1HPM A;  3AAQ A;  2P9K A;  1BA0 A;  2PAV A;  1KAX A;  3EZW A;  3U4L A;  3O8M A;  3WXK A;  4EFH A;  5AZJ A;  1NBW A;  2P9N B;  5EXW A;  5AQK A;  3WUH A;  3DJC A;  5BRH A;  4AM6 A;  5BRF A;  3WXL A;  4IJN A;  3SK3 A;  3CI5 A;  2I7N A;  4A2A A;  1KAZ A;  3QFP A;  1JCE A;  1LOT B;  3IDH A;  4BR5 A;  3O1B A;  2E1Y A;  4IO8 A;  4BR4 A;  5AR0 A;  3W3D A;  4RTF D;  4RWT A;  3H1Q A;  4BRE A;  3LDN A;  1WUA A;  3VF6 A;  3R6M A;  4FPA A;  4DCH A;  2W40 A;  1NGH A;  3L4I A;  3H6E A;  1E4F T;  2QWR A;  3D2F A;  4JD2 A;  3CET A;  2HF3 A;  1QZ6 A;  3ENH A;  4DHY A;  3MDQ A;  4FWO A;  5AZI A;  5FPE A;  1ESV A;  1GLB G;  1IG8 A;  3OHR A;  2QWL A;  2CGK A;  3ZX0 A;  5AQZ A;  4DQ8 A;  4FSV A;  3ULE A;  1BOT O;  2FSK A;  1CZA N;  1GLJ O;  3O80 A;  3VES A;  2ASP A;  2VCP A;  2E2N A;  3JXU A;  3FZL A;  4H5W A;  4JN4 A;  4FPB A;  5AQO A;  3JS6 A;  1QHA A;  3S41 A;  4BR7 A;  1SZ2 A;  2P9S A;  3GOI A;  3O08 A;  2E1Z A;  2P9U A;  3M1F A;  2Q36 A;  4EAH D;  3QIC A;  1NGE A;  1NGD A;  3MK6 A;  3IFR A;  4BR9 A;  2P9K B;  3ATV A;  1BO5 O;  2CH5 A;  3A0I X;  2NRH A;  4ISF A;  1DKG D;  4CJ7 A;  3BF3 A;  1RFQ A;  2E2P A;  3QML A;  4BGB A;  1BA1 A;  3GBT A;  5EVZ A;  3QBW A;  3QBX A;  3FZH A;  5KPZ A;  2VWB A;  4Z94 A;  3H45 C;  1GLL O;  3UKR A;  2Q0U A;  4EHU A;  2D0P A;  4B1X B;  4BRC A;  4CZJ A;  4J8F A;  2Q0R A;  5AQH A;  3MN7 A;  4H0X B;  2A42 A;  3U9Z A;  5FPM A;  1XUP O;  3KZB A;  1U2V B;  2P9L A;  3FR0 A;  5JLF A;  3BEX A;  4CD3 A;  1JCF A;  4CZF A;  1XQS C;  3D2E A;  2A40 A;  5BRD A;  4WYB A;  3BUZ B;  4CZL A;  3A5O C;  3ULE B;  5F2R A;  3WXJ A;  2D4W A;  2QW9 A;  1J6Z A;  1X9J A;  3DXK A;  3WXI A;  4FWQ A;  3UKU B;  2Q31 A;  5AQN A;  5JIC A;  2GWK A;  4EIA A;  5AFU H;  5TKY A;  4H5V A;  4I6M A;  3IMX A;  3VPZ A;  1DEJ A;  2HF4 A;  2P9P B;  3DXM B;  3QFU A;  2GWJ A;  4IJA A;  2WUS A;  4QS7 A;  3VEX A;  4BVO A;  4BRQ A;  4BC4 A;  3LDL A;  3VOV A;  3VGK A;  4WQ4 A;  5AQQ A;  3A5M C;  5AQI A;  4BQZ A;  4IZ9 A;  3TU5 A;  4L3Q A;  1K8K B;  3CJ1 A;  4WQ5 A;  3LM2 A;  2I7P A;  4A2B A;  4BRH A;  3P4I A;  4MLH A;  4B1U B;  2CGJ A;  1IJJ A;  4BRI A;  1HLU A;  1MDU B;  4ISE A;  4O5F A;  5LY3 A;  2IVN A;  3MMV A;  1RDW X;  2IVO A;  1EQY A;  1X3N A;  4FOI A;  4CD1 A;  4CZE A;  1D4X A;  4M63 C;  2QWN A;  1NGC A;  4NO7 A;  3GG4 A;  2AA4 A;  3ZET A;  1ZC6 A;  3HM8 A;  3VEW A;  1YUW A;  5BPL A;  4E1J A;  1NM1 A;  5AQW A;  1GLE G;  2PBD A;  4FL9 A;  3VER A;  3C0B A;  5AQM A;  1RGI A;  1HUX A;  3G25 A;  5ADX H;  1Q18 A;  4H03 B;  4BRM A;  4HWI A;  3H3O B;  1BDG A;  3L6Q A;  2FSJ A;  2IIR A;  2ITM A;  5KPT A;  5ELZ A;  1P8Z A;  5AQJ A;  3FE1 A;  3M3Z A;  4BR0 A;  4MLE A;  2Q2R A;  3RSE B;  3AAP A;  4JHD A;  1V4T A;  4H0O A;  2QWQ A;  5LJW A;  3FFK B;  1ATN A;  3M6G A;  3ENO A;  4H5R A;  1V4S A;  4B1V A;  4F9O A;  2BUP A;  1YAG A;  2IVP A;  4B1Z A;  5AQV A;  3WEE A;  5AZJ B;  3H1V X;  2YHX A;  1NGA A;  4FO0 A;  3ZEU A;  3FZK A;  1NWK A;  3QB0 A;  2VYP A;  4CZM A;  3SLC A;  5JLH A;  3CJB A;  1NGI A;  5E26 A;  2H3G X;  4BRO A;  3UE5 A;  1BUP A;  1XC3 A;  2GUP A;  1NGB A;  3C7N A;  3DAW A;  2FSN A;  2QWO A;  1S22 A;  4RCH A;  4BRN A;  5CE3 A;  3WQT A;  5AFU A;  5BN9 A;  1SAZ A;  3GDQ A;  5EX5 A;  1T44 A;  3VEY A;  1NGG A;  4BQL A;  3A5N C;  3CJ9 A;  4CI6 A;  3U9D A;  3B8A X;  2P9N A;  2D0O A;  4AM7 A;  4PL7 A;  3I8B A;  3VF4 A;  3DWL A;  3AY9 A;  3D2F B;  4JD2 B;  4XH1 A;  2ZF5 O;  4NB4 A;  2A6A A;  3SJH A;  3LDQ A;  1E4G T;  3VET A;  4A62 A;  4BRK A;  2W41 A;  3ID8 A;  3IUC A;  5AZI B;  5FPD A;  4B1Y B;  4BRD A;  1C0F A;  1Y64 A;  2V52 B;  3J8A A;  2F9W A;  3LM9 A;  3CJ7 A;  3BF1 A;  3EKS A;  3HBT A;  1HJO A;  5BPN A;  5KPR A;  4JNE A;  5AQS A;  3MN5 A;  5FPN A;  4XH5 A;  2CH6 A;  3R8E A;  3WT0 A;  2QWP A;  2GEL A;  4KBO A;  3L0Q A;  4BG9 A;  4BGA A;  2P9S B;  4H0P A;  2P9U B;  3ATU A;  3O5B A;  1T6C A;  4FWS A;  4K25 A;  2QWM A;  3HI0 A;  3EO3 A;  1QQM A;  1GLD G;  1G99 A;  4B1W B;  3WEE B;  2D1K A;  3UB5 A;  2QXL A;  4BC2 A;  4H5N A;  1BWF O;  4FWP A;  2A5X A;  1JCG A;  4K43 A;  4K42 A;  1H1V A;  5KQD A;  4BG8 A;  5AQG A;  4BRF A;  1BU6 O;  4CZI A;  5AQR A;  1TYQ A;  2FLO A;  2GTD A;  3GL1 A;  3KVG A;  1BG3 A;  2V7Z A;  4GY2 B;  4YDU C;  1TUU A;  1C0G A;  3UKR B;  2NZT A;  2YHW A;  3FLC O;  2E8A A;  3FZM A;  5LJV A;  1Z05 A;  3HZ6 A;  1WOQ A;  3EL2 A;  3A8Y A;  2A3Z A;  4A61 A;  1S3X A;  3CJC A;  1MWK A;  4IWV A;  5F0X A;  3MCP A;  3BP8 A;  4YDU A;  5AQL A;  4DB3 A;  2OAN A;  4LC9 B;  2Q1N A;  2YCH A;  3D7E O;  4C23 A;  5KQ8 A;  2P9L B;  5EOY A;  3VEO A;  5JMV A;  3LDO A;  3AAR A;  4BRP A;  5BPM A;  3D2E B;  4BVP A;  2Q97 A;  4FWK A;  4FOE A;  4PKG A;  1DGK N;  2J4R A;  2KHO A;  2ZGY A;  4BRL A;  2QM1 A;  4H5T A;  3H46 O;  3VGL A;  2F9T A;  3WQU A;  3KHY A;  1KXP A;  1QQO A;  3DXK B;  3SMS A;  1QZ5 A;  4H0Y B;  5BN8 A;  2HOE A;  5AQY A;  3U8X A;  5AQU A;  3ZX2 A;  3R9P A;  1GLF O;  4Y0W A;  3CHW A;  1U2V A;  3ZX3 A;  4I6M B;  4M7Y A;  5BRE A;  2FF3 B;  4M7X A;  2P9I A;  2E88 A;  2EWS A;  3VF2 A;  2ASM A;  3UKU A;  4BC5 A;  1ATR A;  1QQN A;  1TYQ B;  4CZG A;  1YXQ A;  4ISG A;  1LCU A;  1HKB A;  2YJE A;  3H3N O;  4CZH A;  1ATS A;  4CZK A;  1ZBS A;  2P9P A;  3DXM A;  2E2O A;  1MA9 B;  4CBX A;  4BRA A;  4GNI A;  2YI1 A;  3HSC A;  4BR2 A;  4MO4 A;  4CBU A;  5AQF A;  4HTL A;  4QS8 A;  3CIP A;  3VEN A;  1TUY A;  4XH4 A;  4FWL A;  3CQY A;  3QDK A;  3ZET B;  5F1X A;  3EKU A;  4H0V B;  4O8K A;  1K8K A;  5AQX A;  4H0T B;  3O6W A;  4JAX A;  3CER A;  1YVN A;  1HKG A;  2FF6 A;  2YJF A;  1R59 O;  3MN9 A;  1MWM A;  2YHY A;  3SMP A;  1NGF A; 
#chains in the Genus database with same CATH topology
 3OYK A;  1U45 A;  3TAM A;  4DFJ A;  3BY5 A;  4FWR A;  1HNV A;  1CZB A;  3HP9 A;  4J2E A;  4QS9 A;  3CQX A;  5CHI A;  4IXC A;  4CJK A;  3MN6 A;  4JHD B;  2HHW A;  4B9M A;  2ZGZ A;  4XEI A;  2ASO A;  2V7Y A;  2P9I B;  2VGM A;  2FXU A;  2O8B A;  1E3M A;  2FC0 A;  2ZWH A;  3AGR A;  3G4S N;  3FGU A;  2HHQ A;  3FFI A;  3R3L A;  2E2Q A;  2OZM A;  2CGL A;  1VK0 A;  1X9M A;  3A5L C;  4WQ4 C;  3TWH A;  3AVL A;  4FK2 A;  4PQU A;  2JWL A;  4IFE A;  5E84 A;  3DYA A;  2QI2 A;  4CJR A;  1YF5 L;  1KAX A;  3WXK A;  4EFH A;  5EXW A;  2P9N B;  4DV5 K;  3LP2 A;  4FJ9 A;  4DLE A;  3THW B;  4YOR A;  1Q81 O;  4L8R B;  1DLO A;  3DMJ A;  3ZSO A;  3CI5 A;  2I7N A;  5M1Q A;  3QFP A;  4BR5 A;  1BGX T;  4FVU A;  4FM2 A;  4IO8 A;  3C6U A;  4B3T K;  5AR0 A;  3W3D A;  4RTF D;  4BRE A;  3CD6 N;  3I55 N;  3VF6 A;  3ASM A;  3R6M A;  2W40 A;  1U47 A;  2YKM A;  3AO1 A;  1LAW A;  4U67 L;  1VSM A;  2HF3 A;  3ENH A;  4KFB A;  5C0Y A;  1LWE A;  4FWO A;  4QCL A;  4FJH A;  3MWP A;  5AZI A;  2YNG A;  1GLB G;  3OHR A;  3ZX0 A;  1SL2 A;  3DLG A;  4B3R K;  1WBB A;  5HP1 A;  1JLA A;  2HNZ A;  3SAF A;  2ASP A;  4H5W A;  2E2N A;  1KD1 O;  4KHY A;  4F2S A;  3MXJ A;  3C6T A;  3O9R A;  4NCG A;  5AQO A;  4HVJ A;  3GOI A;  4FW2 A;  3M1F A;  3PX0 A;  1HNZ K;  5M1O A;  1NGE A;  4DFP A;  4CK1 A;  1FKP A;  2P9K B;  2ZQB A;  3ID6 A;  4DTJ A;  5HRR A;  2F8T A;  4FLY A;  4CF1 A;  4JLH A;  3O9U A;  3TSP A;  4IO9 L;  3NVM A;  1BCM A;  4JKD A;  4E7I A;  5KPZ A;  4WFA L;  1DTT A;  5GAG P;  3H45 C;  1REV A;  4Z94 A;  2RE2 A;  3QO9 A;  4WE1 A;  3T7Z A;  3VQQ A;  3P1G A;  3SI6 A;  3KLE A;  4EHU A;  2D0P A;  4O4G A;  3RRH A;  3OW2 M;  3ZSZ A;  3OYG A;  4F4K A;  2W42 A;  1YIJ N;  4AHV A;  4GKK K;  5FPM A;  3QER A;  3SAG A;  2G8I A;  1XUP O;  3IG1 A;  4YOT A;  3BEX A;  4CD3 A;  2X6N A;  2GX9 A;  1XQS C;  1HR0 K;  3D2E A;  1LV5 A;  4FK4 A;  4CZL A;  3A5O C;  1T3V A;  4ELU A;  2D4W A;  2QW9 A;  4OX9 K;  4A5B A;  3T69 A;  1NOZ A;  4FJN A;  1YTA A;  3NF9 A;  2ZD1 A;  1T03 A;  4EIA A;  4DUY K;  5AFU H;  1N8R O;  4H5V A;  1VRT A;  3OYF A;  4WFB L;  3QFU A;  3RRG A;  3J7A P;  2GWJ A;  4DFM A;  4IJA A;  2WUS A;  4QS7 A;  3KD1 E;  3VEX A;  3OYA A;  4LF9 K;  3VOV A;  4A59 A;  3VGK A;  5AQI A;  1W97 L;  3HXM A;  4L3Q A;  1NKC A;  1QVG M;  1NK6 A;  3CCQ N;  3CMA N;  4OPJ A;  4A2B A;  4CHZ A;  4MLH A;  4OGC A;  2O8C B;  2CGJ A;  4B3S K;  1J5O A;  4Y1C A;  1MDU B;  1YHQ N;  4M3R A;  2VQF K;  2IVN A;  1RDW X;  2IVO A;  3DOL A;  4CGG A;  1HNW K;  2P1J A;  4FOI A;  3RR8 A;  3E66 A;  4CD1 A;  3SUP A;  2QWN A;  1NGC A;  1YT3 A;  4CIG A;  3HM8 A;  1X1P A;  4KTW A;  4NCB A;  2KFN A;  5HRO A;  3KJV A;  4KV8 A;  1WSE A;  4JI4 K;  1NM1 A;  3C65 A;  4F3O A;  4DTM A;  2HNY A;  4DMN A;  3V81 A;  1ITG A;  1VRU A;  4AQY K;  1L3U A;  1OH8 A;  3DI6 A;  4KH4 A;  5CYQ A;  3G25 A;  1GOC A;  4FJG A;  1YTU A;  3CPW M;  4JK9 A;  5HL7 L;  3CF5 L;  5KPT A;  1P8Z A;  5AQJ A;  3NF7 A;  4G9Z A;  3I8D A;  2F4V K;  4DKW A;  1V4T A;  5LJW A;  3FFK B;  1K8A O;  1KVB A;  3M6G A;  4LH4 A;  3VQA A;  2B4J A;  1V4S A;  2BUP A;  3HP6 A;  4FYD A;  3WEE A;  5AZJ B;  4FO0 A;  1NWK A;  2VYP A;  2ZE2 A;  2LSN A;  1VSD A;  3ZLJ A;  3CJB A;  5E26 A;  2EHG A;  3C95 A;  1NJZ A;  1VQ5 N;  2PYJ A;  1OH5 A;  3DM2 A;  3E1Y A;  3OJU A;  1S22 A;  1N32 K;  4KH5 A;  5BN9 A;  2X78 A;  5TKW A;  3VEY A;  4BWM A;  3CJ9 A;  4CI6 A;  4Z4I A;  4CJE A;  2D0O A;  5JS1 A;  3I8B A;  4RW4 A;  1M1K O;  1ASW A;  1L3V A;  2XRI A;  3TAE A;  2ZF5 O;  3PSF A;  4C8L A;  1G15 A;  2KFZ A;  3VET A;  3G0Z A;  3OVN A;  3IUC A;  4X66 K;  3WNF A;  4B1Y B;  4BRD A;  3NGI A;  3ZSR A;  4CIE A;  4C1N I;  4O55 A;  5BPN A;  3OYN A;  4BDP A;  5BR8 K;  3WT0 A;  3R1X A;  4EZ9 A;  3S3M A;  4BG9 A;  5FRO A;  2P9U B;  4Z0U A;  1TK8 A;  2KKZ A;  3JSM A;  1QQM A;  3M8Q A;  1G99 A;  1KVA A;  3JAM O;  4OKJ A;  3O3F A;  4N76 A;  5JS2 A;  1EWR A;  4CHY A;  2GUI A;  4JKA A;  4G1Q A;  3KLF A;  3MXM A;  4YDU C;  1C0G A;  3KK1 A;  3UKR B;  3K0S A;  1KFD A;  3FZM A;  2JLE A;  5LJV A;  4O8U A;  1D5A A;  3LWL A;  4CEB A;  3KK7 A;  3SAH A;  1S5J A;  2FBT A;  4CF0 A;  2QTD A;  4M42 A;  4FLW A;  2VWK A;  3ZT2 A;  2Q1N A;  3D7E O;  2P9L B;  4B3O A;  3VEO A;  2WOM A;  4JKH A;  4DQS A;  2PY5 A;  4CHO A;  1UA0 A;  4PKG A;  4B8A B;  2KHO A;  2O4G A;  4CJ5 A;  1IKV A;  5C42 A;  4H0Y B;  1ZBL A;  1VSK A;  3BGR A;  5AQU A;  4JI8 K;  1WNS A;  5GIO A;  1GLF O;  3HM9 A;  3CHW A;  1U2V A;  3VQD A;  3J7Y P;  3BZC A;  1JLE A;  1X9S A;  1A5V A;  3L2U A;  1NJW A;  3HK2 A;  2EWS A;  3DLK A;  1EWQ A;  1BIZ A;  4DSJ A;  1DT9 A;  4BC5 A;  1QQN A;  1QSY A;  4KPY A;  1TYQ B;  5CZ2 A;  3AVB A;  4ISG A;  4CZK A;  1ZBS A;  2P9P A;  5J2N A;  2E2O A;  1MA9 B;  4GNI A;  4C8M A;  4YOX A;  3OY9 A;  4EZ6 A;  4FVM A;  3CIP A;  4FWL A;  4O8K A;  1K8K A;  3SJJ A;  3TAN A;  3TAB A;  1N34 K;  4WCE L;  3M8S A;  3MN9 A;  5M1K A;  4HUG A;  2R7Y A;  3SMP A;  3LP0 A;  4E0D A;  1NGF A;  3LAM A;  1TKT A;  4DR5 K;  1NGJ A;  3OYI A;  1EP4 A;  4HUF A;  4M3T A;  5FRM A;  5J2M A;  1R0A A;  3IS9 A;  1IKY A;  3VEV A;  4C8O A;  2V51 B;  1RDD A;  1OKJ A;  4FWM A;  5M1N A;  3GE1 A;  3MX5 A;  3B6O A;  4CK2 A;  4EHT A;  3NCI A;  5I9E B;  3DLR A;  5JVH L;  2GV9 A;  1SQK A;  3F9M A;  4PL8 A;  4DS4 A;  1OVQ A;  4FWN A;  1KVC A;  4R5P A;  1U04 A;  3OBY A;  1Z6R A;  3NH1 A;  2XHB A;  3THY B;  4DTS A;  3MX2 A;  3C7N B;  1T8E A;  3NMU A;  3KK3 A;  4Y1D A;  4E7J A;  3O9T A;  1XNR K;  3S3N A;  3N4P A;  2HBM A;  4IOX A;  3LDP A;  4LFA K;  3MEE A;  3CC4 N;  5FLX O;  3AAQ A;  1RT5 A;  3U4L A;  3EZW A;  1FKO A;  3O8M A;  5AQK A;  1I3A A;  1W0H A;  4H8K A;  3DJC A;  3KWG A;  4CFC A;  4J2B A;  4AM6 A;  3NH2 A;  3DLL L;  3P83 D;  4A2A A;  3TAF A;  1N36 K;  1HNX K;  4YOV A;  5E41 A;  3V9X A;  4KHU A;  3H1Q A;  2W6L A;  3SBG A;  1RT4 A;  1WUA A;  4DCH A;  2PFU A;  3AVM A;  3OS2 A;  3H6E A;  1WAJ A;  2VG7 A;  4AHS A;  4JD2 A;  1K6Y A;  3IAY A;  2O8D A;  3QNN A;  1IG8 A;  2QWL A;  5AQZ A;  4GMJ B;  1BOT O;  4NLC A;  3VES A;  2IGI A;  4H4O A;  1CLQ A;  1WBD A;  4FPB A;  3ZT3 A;  3VA3 A;  1S6P A;  4BR7 A;  1SZ2 A;  4ZHR A;  3V9Z A;  4E89 A;  2Q36 A;  3HL8 A;  1LW2 A;  4EAH D;  3LP3 A;  3I0R A;  2BH1 A;  2WON A;  1J5E K;  3QIC A;  3MCA B;  1NGD A;  3MK6 A;  4JI7 K;  3ATV A;  4DTX A;  1BO5 O;  2CH5 A;  4AHC A;  2NRH A;  2A1R A;  1RTD A;  3E01 A;  1EO1 A;  4XIU A;  2E2P A;  3QNO A;  2HBL A;  3GBT A;  1VSL A;  1WSG A;  1ILY A;  3QBW A;  2QKB A;  4OGE A;  3DRP A;  3QBX A;  3FZH A;  3AVA A;  4E3S A;  2RHK A;  1KFS A;  5A2Q O;  1C1B A;  4ICL A;  3ULD A;  4B1X B;  3VQ5 A;  3K5M A;  3SYZ A;  2KTQ A;  2Q0R A;  3MN7 A;  2A42 A;  1OH6 A;  1RT1 A;  4LSN A;  3QEV A;  1IG9 A;  3KZB A;  5HBM A;  3FR0 A;  3OYE A;  1JCF A;  4HTU A;  2Y1J A;  1XI1 A;  2IDO A;  5BRD A;  4WYB A;  1Z26 A;  3BUZ B;  5F2R A;  3E9P A;  3LAN A;  1J6Z A;  5M1F A;  3TI0 A;  3ZYY X;  1SKR A;  1X9J A;  3AA2 A;  2RKI A;  3UKU B;  1YJN N;  2Q31 A;  5AQN A;  1K73 O;  2NRW A;  4DR4 K;  3P38 A;  1B92 A;  3CCU N;  1NJX A;  2XY5 A;  4CVN E;  1FW6 A;  2A1S A;  1DEJ A;  2HF4 A;  3DXM B;  4CF2 A;  4I7F A;  4AHU A;  4DSK A;  3OS0 A;  3L3V A;  3O9Q A;  4ELV A;  4BRQ A;  4LY7 A;  4BC4 A;  4CEE A;  4KHS A;  4LFB K;  3HO1 A;  3LDL A;  4CHN A;  1UOC A;  3LP1 A;  1RT7 A;  4FJJ A;  4BQZ A;  4IG0 A;  4IZ9 A;  3EE8 A;  5M1P A;  5SZT A;  4WQ5 A;  3LM2 A;  4RW6 A;  2I7P A;  2HST A;  5KRT A;  3P4I A;  4B1U B;  4M45 A;  1HLU A;  4JK8 A;  4CER A;  1RBT A;  2WBN A;  2OTJ N;  1EQY A;  1X3N A;  4DS5 A;  3U3Y A;  4C8K A;  4PA1 A;  4E1M A;  4B3M K;  4M63 C;  4FM1 A;  4NO7 A;  1BI4 B;  2AA4 A;  1ZC6 A;  3VEW A;  1YUW A;  1O1W A;  3D45 A;  4E1J A;  3ENB A;  2AJQ A;  5C15 A;  3C6H A;  2HB5 A;  4RW7 A;  2PBD A;  4FL9 A;  3VER A;  3T1H K;  1RGI A;  1KLN A;  4DQI A;  3S9H A;  4M3X A;  1HUX A;  5ADX H;  5HOO A;  1Q18 A;  5LL6 Z;  4BRM A;  4HWI A;  3AVI A;  1NKE A;  3T19 A;  3VQ4 A;  1GOA A;  2F7T A;  3CCE N;  1TKZ A;  3MEG A;  3O4N A;  2OZS A;  1RCH A;  3LAK A;  4KB1 A;  4FLV A;  1CXU A;  1QE1 A;  3AAP A;  4JHD A;  3K2P A;  3RSE B;  1ATN A;  1ASV A;  1VQM N;  4F9O A;  5GAH P;  1YAG A;  1HNI A;  3WNH A;  4NYF A;  4B1Z A;  4JKG B;  4DSE A;  2VG6 A;  3FZK A;  1SL1 A;  3SLC A;  4O44 A;  2IOC A;  4DV4 K;  4AHT A;  2Z1J A;  1C6V A;  1NK9 A;  3TSQ A;  2H3G X;  1XWL A;  3VQC A;  3KLH A;  2ETJ A;  4DV2 K;  1XC3 A;  4DQQ A;  1NGB A;  2FSN A;  1QSL A;  2QWO A;  3O3H A;  2YNI A;  4HUE A;  1NK5 A;  4BRN A;  4HCB A;  4IEE A;  4DR3 K;  4O0J A;  4YNQ A;  3F2K A;  3GDQ A;  3HST B;  4GVM A;  4PUO A;  3K5L A;  3AO4 A;  4BQL A;  4YHH K;  4JEP A;  3B8A X;  2P9N A;  4PL7 A;  4MDA A;  4DQR A;  3MED A;  3SQ2 A;  5I42 A;  3D2F B;  2OPP A;  2A6A A;  4JS4 A;  3LDQ A;  4A62 A;  4FJL A;  4E7K A;  2W41 A;  4ELT A;  1C0F A;  1S1U A;  3ZSW A;  1Y64 A;  1BIS A;  3RMB A;  1S1W A;  2F9W A;  1TAU A;  3BF1 A;  3EKS A;  1HJO A;  3B6P A;  1EKE A;  4V19 S;  4KBO A;  3L0Q A;  1NKB A;  4Q5V A;  2VGN A;  2P9S B;  1J53 A;  2DFH A;  4R79 A;  2NRR A;  4FWS A;  4K25 A;  3T3F A;  3HI0 A;  1GLD G;  4K8X A;  3WEE B;  4OKK A;  2QXL A;  3UB5 A;  4FWP A;  2A5X A;  1JCG A;  2O8F B;  1N33 K;  4I2Q A;  4BRF A;  4CZI A;  1KSP A;  2D5R A;  5AQR A;  1EET A;  4CJP A;  1S6Q A;  2GTD A;  3GL1 A;  3KVG A;  4GY2 B;  2YHW A;  3FLC O;  2E8A A;  2G8K A;  1CZ9 A;  3K58 A;  3EL2 A;  3NAE A;  3ALY A;  5DMR A;  4DV0 K;  4NXN K;  4FJ5 A;  1L5U A;  1S3X A;  2RF2 A;  3CJC A;  4IWV A;  4YDU A;  4DB3 A;  2YNH A;  3L2Q A;  4B9V A;  1XHX A;  1ASU A;  5EOY A;  5JMV A;  3LDO A;  3AAR A;  3CCJ N;  1VSE A;  1JLC A;  4C8N A;  4W5Q A;  2E6M A;  4BVP A;  2Q97 A;  1I94 K;  1MU2 A;  4IKF A;  2P51 A;  3RMC A;  3THX B;  2J4R A;  2QM1 A;  4H5T A;  5KRS A;  2QK9 A;  3VGL A;  3OYD A;  1QQO A;  3DXK B;  3AA5 X;  4AH9 A;  2HOE A;  3AVJ A;  3KTQ A;  2D0A A;  1C0U A;  3RWU A;  4DF8 A;  1OVY A;  3R9P A;  3ZX3 A;  4FW1 A;  4I6M B;  3V6D A;  4ILG B;  4BDY A;  2FF3 B;  4M7X A;  3NGZ A;  1RT3 A;  4N47 A;  1JXE A;  1WB9 A;  1RTJ A;  1VQP N;  1I39 A;  4CHP A;  3ZSY A;  1RBU A;  4N56 A;  3TAP A;  4MQ3 A;  4CZG A;  1YXQ A;  1SL0 A;  1LCU A;  3H3N O;  2YJE A;  2HHX A;  4CZH A;  1ATS A;  1LWF A;  1J9A A;  4A5A A;  4MDB A;  3VTH A;  2JWK A;  1LWC A;  4BR2 A;  2YKN A;  4QS8 A;  3S3O A;  4ID1 A;  4XH4 A;  3ZET B;  2VG5 A;  3EKU A;  3QIP A;  1FJG K;  4KHN A;  4H0T B;  3O6W A;  4JAX A;  2O8C A;  1YVN A;  1HKG A;  2YJF A;  3LZJ A;  1S1V A;  4FXD A;  2G8H A;  2HBK A;  1BQN A;  1U6Z A;  3A2F A;  3VGM A;  1NLV A;  3LL3 A;  4CBW A;  1HKC A;  4DSI A;  4J2A A;  4CW7 B;  1VQL N;  2HMP A;  3NE6 A;  2E5L K;  4F8R A;  1RTI A;  1P90 A;  1ZXO A;  4EP4 A;  2IAJ A;  3VEZ A;  5CY4 A;  2A41 A;  1X9W A;  3IKM A;  4B9Q A;  3L3U A;  3O1W A;  3SQ1 A;  1KAY A;  5C10 A;  2DPN A;  1EXQ A;  3QEX A;  5EY4 A;  1UWB A;  4BY9 C;  3FZF A;  1QHT A;  4TSX A;  3AGK A;  4H4M A;  3JYT A;  3ZEU B;  3SV4 A;  1KQS M;  1GLA G;  4DR7 K;  2HBJ A;  2KLA A;  3V1R A;  4K0K K;  3K57 A;  5ADX A;  1HQU A;  3DRR A;  4BC3 A;  3I33 A;  4CGI A;  4PKH A;  1T6D A;  2P5G A;  5B8H A;  4CCH A;  3AVC A;  5BR9 A;  4CJ3 A;  5GIP A;  3ZSV A;  1RIL A;  1HX1 A;  1NK8 A;  1Q86 O;  2PAV A;  5AZJ A;  3CFO A;  1NBW A;  3TTD A;  3U3G A;  3QEW A;  4ZTF A;  4FJ8 A;  4FLU A;  3VN5 A;  5BRF A;  4IJN A;  1KAZ A;  3VQB A;  4IFV A;  1JCE A;  3IDH A;  2BDP A;  4OVL A;  4JI6 K;  3NBP A;  2ZJR L;  1WSH A;  1XC9 A;  4BR4 A;  1ZYQ A;  4RWT A;  2G8F A;  3LDN A;  1K9M O;  4FPA A;  3SUN A;  1T05 A;  3C94 A;  2Y1I A;  4PY5 A;  4OKE A;  4CEA A;  1U4B A;  3DLB A;  1NK7 A;  2HHU A;  4DHY A;  3KIO A;  1IO2 A;  4JRQ A;  4JK7 A;  1ESV A;  4CIF A;  5DM6 L;  3ULE A;  4DG1 A;  1GLJ O;  4RG8 A;  2VCP A;  4JN4 A;  3FZL A;  4DTR A;  4FZY A;  4LSL A;  3HOT A;  2PYL A;  3VQE A;  4IOC L;  3SQ4 A;  3AVF A;  4JI5 K;  1ZBI A;  3O08 A;  2E6L A;  2E1Z A;  2P9U A;  3HPH A;  2OPS A;  1JL2 A;  5LMN K;  3OTO K;  3D0P A;  3IFR A;  1WSF A;  2NNW A;  3A0I X;  3OYM A;  1DKG D;  3QML A;  1BA1 A;  3TTC A;  3VQ9 A;  2XY7 A;  2YX6 A;  3KLG A;  3NFA A;  2VWB A;  1GLL O;  3UKR A;  2Q0U A;  4BAC A;  4CFD A;  2HHV A;  1RBS A;  4KRE A;  3EZ5 A;  2VWJ A;  4BRC A;  1JXB A;  4AIL C;  3N4Q A;  4J8F A;  1UAX A;  4H0X B;  3U9Z A;  4DV7 K;  1GOB A;  3QIN A;  4UQG A;  3RMD A;  2Q3S A;  3KLI A;  4I9L A;  5CYM A;  3LWM A;  2P9L A;  4DU4 A;  1BIU A;  3DLE A;  5JLF A;  2PZS A;  1JLF A;  3V1Q A;  4PWD A;  2UXB K;  2YHA A;  2O8D B;  3Q7C A;  1NJI O;  2NRV A;  2O8E B;  3E9L A;  3CC7 N;  4E7L A;  4CJV A;  5D3G A;  2WTU A;  4FLZ A;  3WXI A;  4FWQ A;  4FJI A;  4CGD A;  1ZBU A;  2GWK A;  5TKY A;  2KZM A;  4KHP K;  3IMX A;  3VPZ A;  4DTN A;  4KI4 A;  4DSF A;  1NG9 A;  2OPQ A;  4BVO A;  4FM0 A;  3SV3 A;  1RTH A;  4QAG A;  2ITG A;  3CFR A;  4WQ4 A;  4DR2 K;  3DRS A;  3A5M C;  2HHT A;  2JGU A;  4B9L A;  4BRH A;  3PY8 A;  3O9S A;  1IBK K;  4ISE A;  4GV6 A;  5LY3 A;  4YOY A;  3WNG A;  2D0C A;  3NDK A;  4FJX A;  1D4X A;  4I2P A;  3E9O A;  3NVK A;  5DM7 L;  1W9H A;  2GBZ A;  4DLG A;  5BPL A;  3NGY A;  4W5R A;  3CCV N;  5J2Q A;  4LH5 A;  4CJT A;  3WNE A;  3AO2 A;  4Z4E A;  1BHL A;  3TAG A;  4KO0 A;  3VQ7 A;  3SQ0 A;  3ITH A;  5AQM A;  3K5N A;  2O8B B;  4H03 B;  3BDP A;  1JKH A;  1BDG A;  1Z25 A;  2FSJ A;  2IIR A;  1TKD A;  2D0B A;  3M3Z A;  4BR0 A;  1TGO A;  2W6K A;  2NUB A;  4H0O A;  2QWQ A;  1IKW A;  3O3G A;  1D9D A;  4OLA A;  4H5R A;  4B1V A;  1NOY A;  4B08 A;  4DR6 K;  5AQV A;  1S1X A;  1RDA A;  2YHX A;  4CF9 A;  3QB0 A;  1XNQ K;  4CZM A;  1YI2 N;  3BZK A;  4IEI A;  4CFA A;  4CJF A;  3J7Z O;  4DTU A;  1IBL K;  1TVR A;  3THY A;  4KKO A;  3UE5 A;  5GAD P;  1BUP A;  1J54 A;  2GUP A;  4LF8 K;  3C7N A;  3VQP A;  1JLB A;  5CE3 A;  3WQT A;  5T7B A;  4M3U A;  3D6R A;  3AVN A;  3KWI A;  4QOZ B;  4LF5 K;  3A5N C;  3PO5 A;  4FZX C;  1VSF A;  4B9U A;  3VF4 A;  3DWL A;  1IBM K;  1JLG A;  4B9S A;  3EE9 A;  4XH1 A;  1IV0 A;  1U48 A;  3SJH A;  3CC2 N;  1E4G T;  4BRK A;  3ID8 A;  4CJQ A;  1A5X A;  5AZI B;  2F96 A;  3V9U A;  2V52 B;  1HMV A;  1N5Y A;  4DTP A;  3MAQ A;  1D9F A;  3HYF A;  1VQ6 N;  3HBT A;  5KPR A;  1QQC A;  4JNE A;  5FPN A;  4LF7 K;  4XH5 A;  2CH6 A;  3R8E A;  3TTF A;  5KI6 A;  1SUQ A;  2QWP A;  2GEL A;  4KI6 A;  1RT6 A;  5K14 A;  3O5B A;  3I56 N;  1SV5 A;  1B9D A;  1YJ9 N;  3NHG A;  1TL1 A;  4B1W B;  2D1K A;  4KH6 A;  4W5T A;  4BC2 A;  1HRH A;  4JRP A;  1VQ7 N;  1BWF O;  4K43 A;  3MXI A;  1H1V A;  2RN2 A;  4BG8 A;  4HHT A;  2QKK A;  4JYA K;  3AO5 A;  2FLO A;  1BG3 A;  3KKR A;  1JJ2 M;  1TUU A;  3RVC A;  4MFB A;  2NZT A;  3SBT A;  3AVH A;  4KHW A;  1Z05 A;  3HOS A;  1KTQ A;  3A8Y A;  2A3Z A;  3PLA A;  4WF9 L;  4CGJ A;  2X74 A;  5F0X A;  3OYL A;  1TK0 A;  1DTQ A;  5KGW A;  4NYN A;  4LC9 B;  4YFU A;  1UA1 A;  2YCH A;  5KQ8 A;  5HRP A;  1Q9X A;  2UXC K;  3L2R A;  5BPM A;  3D2E B;  4AHR A;  4FOE A;  1NK0 A;  1N6Q A;  1WN7 A;  3F9K A;  4BRL A;  5HRN A;  3CCS N;  2Z1G A;  4BE2 A;  3WQU A;  4DV6 K;  3VMF B;  2FBY A;  3SMS A;  1QZ5 A;  4CF8 A;  4CHQ A;  3VQ6 A;  4M3Z A;  1Y97 A;  5BN8 A;  3KKS A;  5AQY A;  3U8X A;  2ATQ A;  3SUQ A;  1C0T A;  4Y0W A;  4LD0 A;  4CJL A;  2XY8 A;  4M7Y A;  5BRE A;  4FLX A;  1JLQ A;  3SCX A;  1VQ8 N;  3HPO A;  4CFB A;  2P9I A;  3SZ2 A;  1L3S A;  2E88 A;  2F8S A;  4NCA A;  3VF2 A;  4Q0B A;  1Q9Y A;  3UKU A;  3CQ8 A;  1ATR A;  3AA4 A;  2OCE A;  3V9W A;  1HKB A;  4KRF A;  2G8U A;  3ISN C;  4A57 A;  3DXM A;  4CBX A;  4BRA A;  5AQF A;  2HVH A;  2XY6 A;  4HTL A;  3OYC A;  3G6E N;  3VEN A;  4ZTJ A;  3CQY A;  3QDK A;  5AQX A;  3THW A;  1RBR A;  1RBV A;  5C24 A;  2Z1H A;  3CER A;  3PIO L;  3DLH A;  4O0I A;  2FF6 A;  3G71 N;  3PX6 A;  1MWM A;  4FJM A;  2YHY A;  4ILJ A;  3HPG A;  1NJY A;  3CCL N;  3TPQ A;  3HTV A;  4DFK A;  4AF1 A;  2UYT A;  1BI4 A;  1XMQ K;  4JI1 K;  1VQK N;  4W5N A;  1NMD A;  2QA4 N;  1BQM A;  5KTQ A;  3O4W A;  4Z4C A;  2P5O A;  5AQT A;  1X3M A;  1FXX A;  2OPR A;  3UIQ A;  4MO5 A;  1GLC G;  2AP1 A;  5C25 A;  4RW9 A;  3NF6 A;  4K41 A;  1XHZ A;  4OO1 J;  3W0L A;  4CJW A;  4BE0 A;  2BTF A;  4BRG A;  3CM6 A;  4N5S A;  4IG3 A;  3SPY A;  3HJF A;  4PKI A;  3RSE A;  4IDK A;  2NLX A;  3EN9 A;  3CJA A;  5AQP A;  4OPK A;  4CEZ A;  4KB0 A;  4Z4H A;  1NNE A;  4WQ5 C;  1S1T A;  4DV3 K;  2GEM A;  2E20 A;  1HPM A;  3Q7B A;  4JKG A;  2P9K A;  1BA0 A;  4JI3 K;  3WUH A;  1QVF M;  3AV9 A;  1IH7 A;  2HMI A;  3CCR N;  5BRH A;  3WXL A;  4FCY A;  3SK3 A;  1LOT B;  2DFE A;  3O1B A;  2QEX N;  2YNF A;  2E1Y A;  4RW8 A;  5LMU K;  1NGH A;  3L4I A;  2KQ2 A;  3K9K A;  3NH0 A;  1E4F T;  1T7P A;  3SNN A;  2QWR A;  2WFB A;  3D2F A;  3PSI A;  4YOW A;  3CET A;  1Q7Y O;  1NU0 A;  2QXF A;  5IWA K;  1QZ6 A;  4BE1 A;  3MDQ A;  4B9T A;  3O4Q A;  4JKE A;  2DTU A;  3QEI A;  5FPE A;  4PHT X;  2CGK A;  4DQ8 A;  4FSV A;  3PX4 A;  5CZ1 A;  4CGH A;  2FSK A;  1CZA N;  3O80 A;  4DF4 A;  4ILH A;  3JXU A;  3V1O A;  5C12 A;  3PV8 A;  3OYB A;  3QET A;  3QEP A;  1RDB A;  1SKW A;  3ZSX A;  4FLT A;  4DTO A;  1NMN A;  3RR7 A;  5FRN A;  4CE9 A;  3JS6 A;  3OS1 A;  1QHA A;  1F21 A;  3S41 A;  4CES A;  2P9S A;  5H1S Q;  3VQ8 A;  3K5O A;  3V9S A;  4X65 K;  1C1A A;  1WLJ A;  3M5R A;  4BR9 A;  3M8P A;  4ISF A;  1S9G A;  4CJ7 A;  1QTM A;  3BF3 A;  1RFQ A;  4BGB A;  4DU3 A;  4OPH A;  1KRP A;  2O8F A;  5EVZ A;  3T1Y K;  1VSJ A;  3MEC A;  3AVG A;  4X64 K;  1IKX A;  3P31 A;  4KTQ A;  1TK5 A;  4GV9 A;  3MWT A;  2Z1I A;  4LF6 K;  4JI0 K;  4CZJ A;  4K8Z A;  1CXQ A;  2HW3 A;  3K59 A;  3CYM A;  5AQH A;  3VA0 A;  1VQ4 N;  4KTZ A;  2X6S A;  1KC8 O;  4DQP A;  3G10 A;  1W7A A;  1U2V B;  3CME N;  5EU7 A;  4CZF A;  3ZCM A;  2A40 A;  5GIN A;  5DK5 A;  5CR4 A;  3U6F A;  3THX A;  3ULE B;  3WXJ A;  3LPU A;  3DXK A;  4DSL A;  2HHS A;  1S9E A;  5SWM A;  3TR8 A;  3PIP L;  4U7B A;  2DY4 A;  5JIC A;  5J2P A;  4YY3 K;  5I3U A;  4I6M A;  3T1A A;  1TAQ A;  1VSH A;  3KD5 E;  5HRS A;  2P9P B;  3P5J A;  2UUA K;  2B5J A;  3SPZ A;  4CEO A;  4DR1 K;  5AQQ A;  1KLM A;  2IC3 A;  3TU5 A;  2G8V A;  1O13 A;  1K8K B;  3WXM B;  1C1C A;  5GAE P;  3CJ1 A;  5C2F A;  2IS3 A;  1IJJ A;  4BRI A;  3QLH A;  1Q82 O;  3HT3 A;  3ZSQ A;  4O5F A;  3F5T A;  3MMV A;  3OJS A;  4M3Y A;  3L2V A;  4CZE A;  4GV3 A;  2YV0 X;  5HLF A;  2OTL N;  3GG4 A;  3ZET A;  4FJ7 A;  3CG7 A;  3NF8 A;  1TKX A;  4CJU A;  2HND A;  3CM5 A;  3H08 A;  1QSS A;  3CCM N;  5AQW A;  4E19 A;  4I9Q A;  3OA9 A;  3LPT A;  5AJ3 K;  4DWI A;  1GLE G;  3C0B A;  3M8R A;  4BWJ A;  3J80 O;  3EY1 A;  4LFC K;  3LZI A;  5IT9 O;  4BDZ A;  1HPZ A;  3H3O B;  3L6Q A;  2ITM A;  5ELZ A;  3FE1 A;  4MLE A;  4CEF A;  4CJ4 A;  2Q2R A;  1YIT N;  4M3W A;  1LAV A;  4EP5 A;  3HRG A;  1WAF A;  3THV A;  4J2D A;  4F3T A;  4ID5 A;  1RT2 A;  2RPI A;  3ENO A;  3AO3 A;  2IVP A;  2I5J A;  1VQO N;  3H1V X;  4Z4F A;  1NGA A;  3ZEU A;  3IRX A;  1M90 O;  1EX4 A;  3L8B A;  3TAQ A;  5JLH A;  1A5W A;  1NGI A;  2VQE K;  3OBW A;  1W2B M;  1VHX A;  3CXC M;  4BRO A;  1BCO A;  2ZJQ L;  1WSJ A;  3DAW A;  2KZZ A;  4RCH A;  2HHH K;  2EX3 A;  2FBV A;  5AFU A;  4X62 K;  3TSU A;  5J1E A;  2NRX A;  1OH7 A;  1SAZ A;  3ZT4 A;  5EX5 A;  1SKS A;  1T44 A;  1NGG A;  4KHQ A;  3HVR A;  1U49 A;  3U9D A;  4JS5 A;  4AM7 A;  2BGG A;  3TAR A;  4JKF A;  3ZT1 A;  3AY9 A;  2XO7 A;  1HYZ A;  4JD2 B;  4NB4 A;  2E4L A;  1WSI A;  4LF4 K;  1Q8I A;  1ZBH A;  5FPD A;  3L4Q A;  3RTV A;  3PUF A;  5MLC Q;  3J8A A;  3LM9 A;  4F2R A;  3CJ7 A;  3OYH A;  3F73 A;  5AQS A;  3MN5 A;  3QIO A;  3L2W A;  1TL3 A;  1LW0 A;  1NK4 A;  4C1N K;  4KAZ A;  4WFN L;  4BGA A;  1VQN N;  3AVK A;  3RMA A;  4N41 A;  2BAN A;  3SUO A;  4H0P A;  3ATU A;  3K9J A;  1T6C A;  1VAZ A;  3EEQ A;  2G8W A;  4FK0 A;  2QWM A;  3EO3 A;  3CFP A;  3DOK A;  4H5N A;  2KW4 A;  5JVG L;  4K42 A;  4O5B A;  2NRZ A;  1RDC A;  4CK3 A;  5KQD A;  1VSI A;  1FK9 A;  1SS6 A;  3KK2 A;  5AQG A;  3J81 O;  1BU6 O;  4GVE A;  2OA8 A;  4CEC A;  1TYQ A;  3LAL A;  1L3T A;  2V7Z A;  3CPE A;  2HVI A;  4CJS A;  2UUB K;  4YOU A;  3HZ6 A;  1D8Y A;  1HYS A;  1WOQ A;  4JKC A;  1VQ9 N;  1S72 N;  4A61 A;  4E7H A;  1MWK A;  4NXM K;  3MCP A;  3BP8 A;  5AQL A;  4HCC A;  4DV1 K;  1TV6 A;  2OAN A;  4FJK A;  2B6A A;  3LDS A;  2ZJP L;  4C23 A;  4OLB A;  2UUC K;  1HQE A;  4BRP A;  4UY8 O;  4OPA A;  4FWK A;  2YHB A;  1DGK N;  4NLB A;  2ZGY A;  2BE2 A;  3H46 O;  2F9T A;  3KHY A;  1HJR A;  1KXP A;  4CGF A;  2NRT A;  4B8C A;  1B9F A;  2UXD K;  1KCF A;  3P39 A;  4IBN A;  3ZX2 A;  3OYJ A;  3QES A;  4IFY A;  5KGX A;  3EYZ A;  4B9N A;  5FDL A;  5C2D A;  1C0M A;  2ZM6 K;  2OYQ A;  2O8E A;  2O4I A;  3PO4 A;  3I0S A;  3ZT0 A;  2UU9 K;  2ASM A;  2FBX A;  1RDU A;  4OJR A;  1HYV A;  4JKB A;  4M41 A;  4FZZ A;  4Z4G A;  4CED A;  3VTI A;  4DU1 A;  2WC9 A;  4GW6 A;  4JI2 K;  2YI1 A;  3HSC A;  4IOA L;  4E1N A;  3C6A A;  2DFF A;  4MO4 A;  4CBU A;  4IDH A;  3AA3 A;  1TUY A;  3V4I A;  1JL1 A;  5F1X A;  4H0V B;  1XMO K;  1YJW N;  4DUZ K;  1RNH A;  4CEQ A;  4GKJ K;  1QS4 A;  3HVT A;  4JV5 K;  1R59 O;  1BL3 A;  4W5O A;  1ZBF A;  1YVU A; 
#chains in the Genus database with same CATH homology
 2HBK A;  3TPQ A;  1NGJ A;  1U6Z A;  4FWR A;  3VGM A;  1NLV A;  3LL3 A;  4CBW A;  3HTV A;  1HKC A;  4AF1 A;  1VQL N;  2HMP A;  2UYT A;  1P90 A;  1ZXO A;  4QS9 A;  3VEZ A;  1VQK N;  3CQX A;  5CHI A;  2A41 A;  4IXC A;  3VEV A;  3IKM A;  3MN6 A;  4B9Q A;  3O1W A;  1KAY A;  1NMD A;  4JHD B;  5C10 A;  2QA4 N;  2V51 B;  1OKJ A;  4FWM A;  3O4W A;  3GE1 A;  3MX5 A;  4EHT A;  5M1N A;  2DPN A;  2ZGZ A;  5I9E B;  4XEI A;  5AQT A;  5JVH L;  1X3M A;  1SQK A;  3F9M A;  2ASO A;  5EY4 A;  4MO5 A;  1GLC G;  2AP1 A;  2V7Y A;  4PL8 A;  4BY9 C;  2P9I B;  2VGM A;  3FZF A;  4K41 A;  2FXU A;  4OO1 J;  3W0L A;  3AGK A;  4FWN A;  2ZWH A;  3AGR A;  3ZEU B;  3G4S N;  2BTF A;  3FGU A;  1KQS M;  1GLA G;  3R3L A;  2E2Q A;  2HBJ A;  2KLA A;  4BRG A;  2CGL A;  5ADX A;  3OBY A;  4PKI A;  3A5L C;  1Z6R A;  3RSE A;  4WQ4 C;  3MX2 A;  2NLX A;  3I33 A;  3EN9 A;  4BC3 A;  3CJA A;  2JWL A;  5AQP A;  3C7N B;  3NMU A;  4PKH A;  4IFE A;  1T6D A;  5E84 A;  4WQ5 C;  3O9T A;  5B8H A;  2QI2 A;  3N4P A;  2GEM A;  2HBM A;  4IOX A;  2E20 A;  5BR9 A;  5GIP A;  3LDP A;  1HX1 A;  3CC4 N;  1Q86 O;  1HPM A;  3AAQ A;  3Q7B A;  1YF5 L;  4JKG A;  2P9K A;  1BA0 A;  2PAV A;  1KAX A;  3EZW A;  3U4L A;  3O8M A;  3WXK A;  4EFH A;  5AZJ A;  1NBW A;  2P9N B;  5EXW A;  3TTD A;  5AQK A;  3WUH A;  1QVF M;  4YOR A;  3DJC A;  3KWG A;  3CCR N;  5BRH A;  1Q81 O;  4AM6 A;  5BRF A;  3WXL A;  4IJN A;  3SK3 A;  3DLL L;  3CI5 A;  2I7N A;  4A2A A;  1KAZ A;  5M1Q A;  3QFP A;  1JCE A;  1LOT B;  3IDH A;  4BR5 A;  3O1B A;  2QEX N;  2E1Y A;  4YOV A;  4FVU A;  2ZJR L;  4IO8 A;  4BR4 A;  5AR0 A;  3W3D A;  4RTF D;  4RWT A;  3H1Q A;  4BRE A;  3LDN A;  3SBG A;  3I55 N;  1WUA A;  3VF6 A;  1K9M O;  3CD6 N;  3R6M A;  4FPA A;  4DCH A;  2W40 A;  2PFU A;  1NGH A;  3L4I A;  3H6E A;  3K9K A;  1E4F T;  2QWR A;  2WFB A;  4U67 L;  3D2F A;  4JD2 A;  4YOW A;  3CET A;  1Q7Y O;  2HF3 A;  1QZ6 A;  3ENH A;  4DHY A;  5C0Y A;  3MDQ A;  4FWO A;  3MWP A;  4JKE A;  5AZI A;  5FPE A;  4JK7 A;  1ESV A;  1GLB G;  1IG8 A;  3OHR A;  2QWL A;  2CGK A;  3ZX0 A;  4PHT X;  5AQZ A;  4DQ8 A;  4FSV A;  5DM6 L;  3ULE A;  1BOT O;  4NLC A;  2FSK A;  1CZA N;  1GLJ O;  3O80 A;  3VES A;  4ILH A;  3SAF A;  2ASP A;  2VCP A;  2E2N A;  3JXU A;  3FZL A;  4H5W A;  4JN4 A;  5C12 A;  1KD1 O;  3HOT A;  3O9R A;  4IOC L;  4FPB A;  5AQO A;  3JS6 A;  1QHA A;  3S41 A;  4BR7 A;  1SZ2 A;  2P9S A;  3GOI A;  3O08 A;  5H1S Q;  2E1Z A;  2P9U A;  3M1F A;  2Q36 A;  4EAH D;  2BH1 A;  3M5R A;  3QIC A;  5M1O A;  1NGE A;  3MCA B;  1NGD A;  3MK6 A;  3IFR A;  4BR9 A;  2P9K B;  3ATV A;  2NNW A;  1BO5 O;  2CH5 A;  3A0I X;  2NRH A;  4ISF A;  1DKG D;  4CJ7 A;  3ID6 A;  3BF3 A;  1RFQ A;  2E2P A;  3QML A;  2HBL A;  4OPH A;  1BA1 A;  3GBT A;  4BGB A;  3TSP A;  3O9U A;  5EVZ A;  3TTC A;  2YX6 A;  1ILY A;  3QBW A;  4IO9 L;  3NVM A;  4JKD A;  3P31 A;  3QBX A;  3FZH A;  5KPZ A;  4WFA L;  2VWB A;  5GAG P;  3H45 C;  4Z94 A;  2RE2 A;  2RHK A;  1GLL O;  3UKR A;  2Q0U A;  3MWT A;  4GV9 A;  3T7Z A;  4EHU A;  2D0P A;  4B1X B;  3OW2 M;  4BRC A;  4CZJ A;  3N4Q A;  4J8F A;  2Q0R A;  5AQH A;  3MN7 A;  4H0X B;  2A42 A;  3U9Z A;  1YIJ N;  1VQ4 N;  5FPM A;  1KC8 O;  3SAG A;  1XUP O;  3KZB A;  1U2V B;  2P9L A;  3FR0 A;  5JLF A;  4YOT A;  3BEX A;  3CME N;  4CD3 A;  1JCF A;  2GX9 A;  3Q7C A;  1NJI O;  4CZF A;  1XQS C;  2NRV A;  3D2E A;  2A40 A;  5GIN A;  3E9L A;  5BRD A;  4WYB A;  3CC7 N;  3BUZ B;  5CR4 A;  3A5O C;  4CZL A;  3ULE B;  5F2R A;  1T3V A;  3WXJ A;  2D4W A;  2QW9 A;  3E9P A;  1J6Z A;  5M1F A;  4A5B A;  3T69 A;  3ZYY X;  1X9J A;  3DXK A;  3WXI A;  4FWQ A;  3PIP L;  3UKU B;  1YJN N;  2Q31 A;  5AQN A;  4U7B A;  1K73 O;  5JIC A;  2NRW A;  2GWK A;  4EIA A;  3P38 A;  5AFU H;  1N8R O;  3CCU N;  5TKY A;  4H5V A;  4I6M A;  3IMX A;  3VPZ A;  1DEJ A;  2HF4 A;  2P9P B;  3DXM B;  3QFU A;  4WFB L;  2GWJ A;  4IJA A;  2WUS A;  4QS7 A;  3VEX A;  3O9Q A;  4BVO A;  4BRQ A;  4BC4 A;  3LDL A;  3VOV A;  4A59 A;  3VGK A;  4WQ4 A;  5AQQ A;  3A5M C;  5AQI A;  4BQZ A;  4IZ9 A;  1W97 L;  3EE8 A;  3TU5 A;  1O13 A;  5M1P A;  4L3Q A;  1K8K B;  3WXM B;  1QVG M;  5GAE P;  3CJ1 A;  4WQ5 A;  5C2F A;  3LM2 A;  3CCQ N;  3CMA N;  2I7P A;  2HST A;  4A2B A;  4BRH A;  3P4I A;  4MLH A;  4B1U B;  2CGJ A;  1IJJ A;  4BRI A;  1Q82 O;  3O9S A;  1HLU A;  4JK8 A;  1MDU B;  4ISE A;  4O5F A;  1YHQ N;  4GV6 A;  2WBN A;  5LY3 A;  3F5T A;  2IVN A;  3MMV A;  1RDW X;  2IVO A;  1EQY A;  2OTJ N;  1X3N A;  4YOY A;  4FOI A;  3E66 A;  4CD1 A;  4CZE A;  1D4X A;  4GV3 A;  4M63 C;  2QWN A;  1NGC A;  3E9O A;  2OTL N;  4NO7 A;  3NVK A;  3GG4 A;  5DM7 L;  2AA4 A;  3ZET A;  1ZC6 A;  3HM8 A;  3VEW A;  1YUW A;  5BPL A;  4E1J A;  3ENB A;  3CCV N;  1NM1 A;  3C65 A;  3CCM N;  5C15 A;  5AQW A;  3C6H A;  3OA9 A;  1GLE G;  2PBD A;  4FL9 A;  3VER A;  3C0B A;  5AQM A;  1RGI A;  4KH4 A;  1HUX A;  3G25 A;  5ADX H;  5HOO A;  1Q18 A;  4H03 B;  4BRM A;  4HWI A;  3H3O B;  3CPW M;  4JK9 A;  1BDG A;  5HL7 L;  3L6Q A;  2FSJ A;  2IIR A;  3CF5 L;  2ITM A;  2F7T A;  5ELZ A;  1P8Z A;  5AQJ A;  5KPT A;  3CCE N;  3FE1 A;  3M3Z A;  4BR0 A;  4G9Z A;  4MLE A;  2Q2R A;  3RSE B;  3AAP A;  4JHD A;  1YIT N;  4DKW A;  1V4T A;  4H0O A;  2QWQ A;  3HRG A;  5LJW A;  3FFK B;  1K8A O;  1ATN A;  3M6G A;  3ENO A;  1VQM N;  4H5R A;  1V4S A;  4B1V A;  4F9O A;  2BUP A;  5GAH P;  1YAG A;  2IVP A;  4B1Z A;  5AQV A;  4JKG B;  3WEE A;  5AZJ B;  3H1V X;  2YHX A;  1NGA A;  4FO0 A;  1VQO N;  3ZEU A;  3FZK A;  1NWK A;  3QB0 A;  1M90 O;  2VYP A;  4CZM A;  3SLC A;  5JLH A;  1YI2 N;  3CJB A;  1NGI A;  5E26 A;  4IEI A;  3OBW A;  3TSQ A;  2H3G X;  3J7Z O;  1W2B M;  3CXC M;  4BRO A;  1VQ5 N;  3UE5 A;  5GAD P;  1BUP A;  1XC3 A;  2ZJQ L;  2GUP A;  3E1Y A;  1NGB A;  3C7N A;  3DAW A;  2FSN A;  2QWO A;  1S22 A;  4RCH A;  4BRN A;  5CE3 A;  3WQT A;  5AFU A;  4IEE A;  4KH5 A;  3D6R A;  5BN9 A;  3TSU A;  2NRX A;  3KWI A;  1SAZ A;  3F2K A;  3GDQ A;  5EX5 A;  1T44 A;  5TKW A;  1NGG A;  3VEY A;  4BQL A;  3A5N C;  3CJ9 A;  4CI6 A;  4JEP A;  3U9D A;  3B8A X;  2P9N A;  2D0O A;  4AM7 A;  4PL7 A;  4MDA A;  3I8B A;  3VF4 A;  1M1K O;  3DWL A;  4JKF A;  3AY9 A;  3D2F B;  3EE9 A;  4JD2 B;  4XH1 A;  2ZF5 O;  4NB4 A;  2A6A A;  3SJH A;  3CC2 N;  3LDQ A;  1E4G T;  3VET A;  4A62 A;  4BRK A;  2W41 A;  3ID8 A;  3IUC A;  5AZI B;  5FPD A;  3L4Q A;  4B1Y B;  4BRD A;  1C0F A;  1Y64 A;  2V52 B;  5MLC Q;  3J8A A;  4C1N I;  2F9W A;  3LM9 A;  1VQ6 N;  3CJ7 A;  3BF1 A;  3EKS A;  3HBT A;  1HJO A;  5BPN A;  5KPR A;  4JNE A;  5AQS A;  3MN5 A;  5FPN A;  4XH5 A;  2CH6 A;  3R8E A;  3WT0 A;  3R1X A;  3TTF A;  4C1N K;  2QWP A;  4WFN L;  2GEL A;  4KBO A;  3L0Q A;  4BG9 A;  4BGA A;  1VQN N;  2VGN A;  2P9S B;  4H0P A;  2P9U B;  3ATU A;  3O5B A;  2NRR A;  1T6C A;  1VAZ A;  3K9J A;  4FWS A;  4K25 A;  2QWM A;  3HI0 A;  4R79 A;  3I56 N;  3EO3 A;  2KKZ A;  1QQM A;  1GLD G;  1YJ9 N;  1G99 A;  4B1W B;  3WEE B;  2D1K A;  4KH6 A;  3UB5 A;  2QXL A;  4BC2 A;  4H5N A;  1VQ7 N;  1BWF O;  4FWP A;  5JVG L;  2A5X A;  1JCG A;  4K43 A;  4K42 A;  2NRZ A;  1H1V A;  5KQD A;  4BG8 A;  1SS6 A;  5AQG A;  4BRF A;  1BU6 O;  4CZI A;  4GVE A;  5AQR A;  1TYQ A;  2FLO A;  2GTD A;  3GL1 A;  3KVG A;  4JKA A;  1BG3 A;  2V7Z A;  4GY2 B;  1JJ2 M;  4YDU C;  1TUU A;  3CPE A;  1C0G A;  3RVC A;  3SBT A;  2NZT A;  2YHW A;  3FLC O;  3UKR B;  2E8A A;  3FZM A;  5LJV A;  4YOU A;  1Z05 A;  3HZ6 A;  3HOS A;  4O8U A;  1WOQ A;  3EL2 A;  3A8Y A;  4JKC A;  1S72 N;  2A3Z A;  3KK7 A;  4A61 A;  3SAH A;  1VQ9 N;  3PLA A;  4WF9 L;  1S3X A;  3CJC A;  1MWK A;  4IWV A;  5F0X A;  3MCP A;  3BP8 A;  2QTD A;  4YDU A;  5AQL A;  4DB3 A;  2OAN A;  4LC9 B;  2ZJP L;  2Q1N A;  2YCH A;  3D7E O;  4C23 A;  5KQ8 A;  2P9L B;  5EOY A;  3VEO A;  5JMV A;  3LDO A;  4JKH A;  3AAR A;  4BRP A;  3CCJ N;  5BPM A;  4UY8 O;  4OPA A;  3D2E B;  4BVP A;  2Q97 A;  4FWK A;  4FOE A;  1EO1 A;  4PKG A;  1DGK N;  4NLB A;  2J4R A;  2KHO A;  2ZGY A;  4BRL A;  2QM1 A;  4H5T A;  3H46 O;  3CCS N;  3VGL A;  2F9T A;  3WQU A;  3KHY A;  1KXP A;  3VMF B;  1QQO A;  2NRT A;  3DXK B;  1QZ5 A;  3SMS A;  4H0Y B;  5BN8 A;  2HOE A;  5AQY A;  3U8X A;  5AQU A;  3P39 A;  3ZX2 A;  1OVY A;  3R9P A;  1GLF O;  4Y0W A;  3CHW A;  1U2V A;  3ZX3 A;  5GIO A;  4I6M B;  4M7Y A;  5BRE A;  4ILG B;  2FF3 B;  5C2D A;  4M7X A;  1VQ8 N;  2P9I A;  1VQP N;  2E88 A;  2EWS A;  3VF2 A;  2ASM A;  3UKU A;  1DT9 A;  1RDU A;  4BC5 A;  1ATR A;  1QQN A;  4JKB A;  1TYQ B;  4CZG A;  1YXQ A;  4ISG A;  1LCU A;  1HKB A;  2YJE A;  3H3N O;  4CZH A;  3VTI A;  1ATS A;  4CZK A;  4A57 A;  1ZBS A;  2P9P A;  3DXM A;  2E2O A;  4A5A A;  1MA9 B;  4CBX A;  2WC9 A;  4BRA A;  4GNI A;  4MDB A;  3VTH A;  2JWK A;  2YI1 A;  3HSC A;  4IOA L;  4YOX A;  3C6A A;  4MO4 A;  4BR2 A;  4CBU A;  5AQF A;  4IDH A;  4HTL A;  4QS8 A;  3G6E N;  3CIP A;  3VEN A;  1TUY A;  4XH4 A;  4FWL A;  3CQY A;  3QDK A;  3ZET B;  5F1X A;  3EKU A;  4H0V B;  4O8K A;  1K8K A;  5AQX A;  1YJW N;  4H0T B;  3O6W A;  4JAX A;  3CER A;  3PIO L;  1YVN A;  4WCE L;  1HKG A;  2FF6 A;  2YJF A;  1R59 O;  3G71 N;  3MN9 A;  5M1K A;  1MWM A;  2YHY A;  4ILJ A;  3SMP A;  1NGF A;  3CCL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...