4BRCA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
360
structure length
360
Chain Sequence
b'NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 116
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brcA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brcA02
3HBTA 2DPNA 3ATVA 5KPRA 3ZEUB 3RSEA 4JHDA 3JS6A 2AP1A 3ZETA 5FPDA 4FWLA 5KPZA 2FF6A 3MN6A 1MWKA 2UYTA 2I7NA 2QM1A 2GEMA 4CZLA 3ENHA 4F9OA 4A2AA 3ZEUA 2QWPA 2IIRA 3DXKA 2KHOA 4DHYA 3H46O 4QS7A 4FO0A 5AQHA 2FSNA 3MDQA 2YJFA 5LJVA 4AM6A 1HPMA 4FOIA 2ASMA 2P9NB 1KAYA 3H45C 3QBXA 3QFPA 4C23A 3SK3A 1TUUA 4BG9A 2QWLA 3CJ1A 4CBWA 2P9LB 4CBXA 2OANA 4H0YB 2P9KB 3O4WA 3VETA 2A42A 1X3NA 3VEVA 1S3XA 3LDLA 1NGEA 2YHXA 3VEZA 2P9NA 1LOTB 3QICA 2E1ZA 2A40A 3FZLA 5AZJB 5AQYA 3L6QA 4HWIA 2ASPA 3C7NB 3MN5A 3IFRA 3O08A 3VF6A 2Q31A 4BRCA 3VENA 2E2OA 5ADXA 3LM9A 4NB4A 3G25A 2A5XA 2GUPA 2P9IA 3WXJA 4EIAA 2BUPA 2P9PB 1Q18A 4LC9B 1V4TA 4FPAA 3LDNA 1EQYA 4PKGA 3VERA 5AQMA 2IVPA 1BU6O 4FSVA 4BRPA 1ZC6A 3U8XA 4JD2B 3W3DA 1P8ZA 2WUSA 1NGCA 2Q36A 4IJNA 2E2QA 4H0PA 2HOEA 2A41A 5AZIB 3LDPA 3F9MA 1T6DA 5FPMA 3WQTA 4Z94A 2QWOA 4YDUC 4RWTA 5AQZA 4BRAA 3EKSA 3ULEB 4BR5A 3CI5A 3DWLA 3LDQA 3VF4A 2GWKA 1E4GT 1HKBA 4BR0A 4GNIA 3CJCA 4BG8A 5AQIA 3ULEA 3A0IX 2GELA 3VEWA 2P9UB 1JCEA 4MLEA 3WXKA 4MLHA 2CGKA 2CH6A 1GLAG 4FWRA 4BRLA 1GLDG 1BG3A 2D0OA 5AQRA 5BN8A 3CJAA 4JAXA 4B9QA 4BREA 4CI6A 3H1QA 2NLXA 4BROA 1SZ2A 4RTFD 3UKRB 4BC2A 4FWQA 1Z6RA 5E26A 4GY2B 4J8FA 3U4LA 1BOTO 2CH5A 2ZWHA 1ATRA 1NWKA 1OKJA 1TUYA 3FZFA 1U6ZA 1RDWX 1WOQA 4M63C 3AAQA 4WQ5A 1GLFO 4H5NA 4XH4A 1YXQA 1GLEG 1T6CA 4B1ZA 5JLFA 2H3GX 4H0TB 4IXCA 2V51B 3L4IA 3A5NC 2YJEA 3C0BA 1ATSA 4CJ7A 1BO5O 3JXUA 1BA0A 1QQNA 3D2EB 3J8AA 3VPZA 1C0GA 2NZTA 4FOEA 4HTLA 1HLUA 5AFUH 3ENOA 4Y0WA 5BRFA 5FPEA 4B1VA 2VWBA 4BRFA 1NGDA 2V7ZA 3ZX0A 1HKGA 3BF1A 1KAZA 2PAVA 4L3QA 3CJBA 4B1WB 3UB5A 5AQQA 5AQTA 5AQUA 5ADXH 4WQ4C 4H0OA 4KBOA 1NMDA 2YCHA 4B1UB 2ZF5O 1QQOA 3ATUA 1U2VB 4BRNA 4CZEA 5KPTA 1XUPO 3H6EA 3LM2A 2QWRA 5AFUA 4A61A 3AAPA 4A2BA 3ZX2A 1D4XA 1T44A 1MA9B 4JNEA 1SAZA 2P9LA 3HTVA 3GOIA 2P9KA 3W0LA 3FZKA 3O1BA 5AR0A 4BR9A 4I6MB 3M1FA 1IJJA 1ATNA 4DQ8A 2IVOA 4M7XA 5BPLA 4M7YA 5EX5A 4EAHD 3CJ7A 5AZJA 4K25A 4WQ4A 2VYPA 3TPQA 3C7NA 4I6MA 2V7YA 5AQKA 5BN9A 4CZGA 3O1WA 3GG4A 3EKUA 1G99A 2D1KA 3IMXA 2E1YA 4BRHA 3WEEB 5AQWA 4K41A 2QWQA 1NM1A 3GBTA 5BRHA 5B8HA 1XQSC 2P9PA 4BC4A 4H03B 4BGBA 1HJOA 3IUCA 1NGIA 3FZHA 5TKYA 3VGMA 1XC3A 2CGLA 3CHWA 3BP8A 4O5FA 1RGIA 3DAWA 5AQLA 3QB0A 5CE3A 3WEEA 4BR4A 3FFKB 1NGHA 1NLVA 4JD2A 2YHYA 3QFUA 3VEOA 1R59O 3EL2A 1NGFA 4WYBA 3VOVA 4CZMA 2QWNA 4FWSA 2P9SB 4BC5A 2VCPA 1NGJA 3O6WA 4WQ5C 2IVNA 2E2NA 5AZIA 3U9ZA 3H3OB 1S22A 4RCHA 2F9TA 5AQGA 5AQOA 4MO4A 1ESVA 4K43A 3WXLA 1LCUA 5LJWA 4BGAA 4NO7A 3BUZB 3R8EA 1DEJA 3WQUA 3VEYA 3MCPA 5AQPA 3R6MA 4BVOA 5BRDA 5JLHA 1RFQA 4QS9A 1HUXA 4ISEA 1TYQB 1MDUB 2GWJA 2P9UA 4CZJA 3D2FB 4EFHA 1ZBSA 3DJCA 4FWNA 1H1VA 3MK6A 3MN9A 3H3NO 2QXLA 4FWPA 3SJHA 4H5RA 3UKRA 3VGLA 1TYQA 3HSCA 3HZ6A 1YUWA 4A62A 4H0XB 4BC3A 4E1JA 2FF3B 1C0FA 1KXPA 1HX1A 3BEXA 2YI1A 1V4SA 4FWMA 3UKUB 1JCGA 4BQZA 2D4WA 4CZHA 2E88A 2A6AA 3WT0A 1BWFO 3RSEB 4JHDB 3SMPA 2PBDA 2F9WA 1BDGA 3I8BA 3D2EA 2HMPA 3ZETB 2NRHA 3TU5A 4PKIA 5JICA 4O8KA 3UKUA 3D7EO 3A5MC 2HF3A 4BQLA 4BR7A 3B8AX 2E20A 3DXMB 3O80A 3DXKB 4IWVA 3LL3A 3EO3A 2I7PA 4XEIA 4CZFA 1QQMA 3SMSA 1ZXOA 1MWMA 3O5BA 4B1YB 3CETA 3EZWA 5EY4A 3EN9A 1DKGD 2Q0UA 3IDHA 3GDQA 3DXMA 4H0VB 3BF3A 1NGAA 1QHAA 3FLCO 4IO8A 1JCFA 1QZ5A 4FL9A 3WUHA 1GLCG 4BRQA 5AQJA 1U2VA 5BPMA 5FPNA 4CZIA 4JN4A 1NGGA 5LY3A 2FLOA 5E84A 4IZ9A 3FR0A 1HKCA 1Y64A 5JMVA 1GLBG 3MMVA 3S41A 3A8YA 2ZGYA 4FWKA 5BPNA 4BRDA 4BRIA 1E4FT 2E8AA 1GLJO 3AARA 3OHRA 4BRKA 5AQVA 3VEXA 2J4RA 4FWOA 5BR9A 1NBWA 3A5LC 5ELZA 4IJAA 3KZBA 2YHWA 3WXIA 3VF2A 3LDOA 3FGUA 3R9PA 1K8KB 2P9IB 3UE5A 2Q97A 3GL1A 3MN7A 1Z05A 3HI0A 5AQXA 3H1VX 3P4IA 2ITMA 5KQDA 3ZX3A 1DGKN 5AQSA 1BUPA 1WUAA 3CERA 4AM7A 4BVPA 2V52B 2AA4A 4FPBA 1K8KA 1KAXA 1YVNA 3FE1A 1NGBA 1X3MA 4XH5A 3QBWA 1X9JA 3QDKA 2Q0RA 2CGJA 3CJ9A 3QMLA 1J6ZA 1IG8A 3AY9A 5AQFA 1QZ6A 3U9DA 3KHYA 3GE1A 2FXUA 2FSKA 5AQNA 3CQYA 4PL7A 2E2PA 2W41A 3O8MA 2Q1NA 1GLLO 2GTDA 2Q2RA 5F2RA 2P9SA 3KVGA 4CD1A 4ISFA 4H5TA 3CQXA 4H5WA 4K42A 4QS8A 5EVZA 4BR2A 3FZMA 4EHUA 4PKHA 3VESA 4CZKA 4DCHA 1SQKA 1YAGA 3A5OC 3VGKA 2D0PA 3M3ZA 4H5VA 4PL8A 2FSJA 2ASOA 3I33A 5EOYA 2W40A 4BRGA 4XH1A 2BTFA 3D2FA 3SLCA 4BRMA 5F0XA 4CD3A 4DB3A 2QWMA 4ISGA 2ZGZA 4YDUA 3CIPA 5F1XA 3M6GA 5KQ8A 4EHTA 1CZAN 3ID8A 5I9EB 2QW9A 4B1XB 2HF4A 3HM8A 2EWSA 4CBUA 4MO5A 3L0QA 5EXWA 2A3ZA 1BA1A 5BREA
chains in the Genus database with same CATH superfamily
3G4SN 3A2FA 2DPNA 3CCMN 3SQ1A 2W6LA 1CXQA 5HBMA 3RSEA 4CGHA 1RT6A 3OYBA 4JS4A 3JS6A 1NJYA 3ZETA 4CHZA 1I3AA 4YFUA 4FLUA 2FF6A 3HT3A 1RDDA 1GOCA 2QM1A 4CZLA 5FDLA 3ENHA 1ILYA 4A2AA 3Q7BA 4YOXA 4LF7K 3DXKA 2KHOA 1TK0A 4IOXA 3O3FA 1T3VA 4FM0A 3SQ0A 1IKYA 1ZYQA 3SAHA 1Q81O 4FOIA 4FJJA 4DFJA 1VSDA 4C23A 1JL2A 3P38A 3PO4A 1YF5L 2QXFA 4IG3A 3NF6A 2OANA 3PSIA 3TABA 3IAYA 3VEZA 1OVQA 3QICA 3WNFA 1DT9A 1TKXA 2KKZA 3P31A 2UU9K 1BL3A 5AZJB 1VSIA 4HWIA 3IFRA 3OVNA 2OZSA 5FRMA 4O44A 4CIGA 5ADXA 3WNHA 4B3MK 2GUPA 1S6QA 1KQSM 2O4GA 4LC9B 1V4TA 1Q9XA 4FPAA 4K8ZA 5SWMA 1TV6A 4BRPA 4KO0A 3CF5L 1P8ZA 1F21A 4GMJB 2HOEA 2A41A 3D0PA 4YDUC 3OYDA 4FCYA 5AQZA 4BRAA 3ZT3A 4DV2K 2VQFK 3VA3A 3DWLA 4FZYA 1YIJN 4LFBK 1E4GT 1TL1A 1HKBA 4B9MA 4B3OA 3DRSA 2ZE2A 1TKTA 4B9TA 4DTPA 4BG8A 4W5NA 3A0IX 3E66A 1QS4A 3VEWA 1JCEA 1IBLK 1W2BM 2O8DB 4MLHA 4G9ZA 2FBXA 4CJKA 3PX6A 2XY6A 4BREA 3H1QA 2NLXA 4BROA 3UKRB 3V9SA 1VQ8N 4DF8A 3THYA 1KC8O 2CH5A 3TTFA 4WF9L 1ATRA 1NWKA 4FJIA 1OKJA 3RRGA 1HNZK 1WOQA 3TSUA 1ASVA 1GLEG 5JLFA 1EO1A 4IXCA 3C0BA 3JYTA 2KW4A 4X66K 2AJQA 3E1YA 4CEBA 4BDPA 2NZTA 4FOEA 4DS4A 1HLUA 3ENOA 1RBTA 1U47A 4KH5A 2PZSA 3NVKA 4K8XA 5KTQA 3OYNA 4BRFA 2V7ZA 1RT7A 4R79A 4DTUA 2D5RA 3BF1A 1KAZA 5JS1A 3UB5A 1IKWA 5AQTA 5AQUA 3SUOA 4M3UA 4DTNA 3G0ZA 3TSPA 3ZSVA 3D45A 3O9QA 4E3SA 4WFAL 3AGRA 3CCJN 3VMFB 4CEOA 1FW6A 4A2BA 4FJGA 1D4XA 2XY5A 1FKPA 1O1WA 3EE9A 3R3LA 3DYAA 3HTVA 1ZBFA 4JKGA 4HVJA 3NCIA 3V9XA 2BANA 4J2AA 4JK9A 1EKEA 1FK9A 5AR0A 3VTIA 3M1FA 1ZBIA 4IFYA 4EAHD 3CCUN 4K25A 1K73O 5KGWA 4WQ4A 4FVMA 1RNHA 3C7NA 1C0TA 4DKWA 4EZ9A 1VQ9N 4I6MA 3GG4A 4CJFA 5M1OA 3HSTB 4LH4A 3BGRA 4OPAA 2E1YA 4BRHA 4CK3A 1VQMN 1LW2A 1VQPN 3GBTA 3LP2A 3G10A 4OLBA 4JKDA 3E9OA 3SNNA 3CHWA 2OPPA 3NVMA 3OYAA 3NAEA 2VG7A 1C0UA 3O9TA 3OS1A 4LSLA 2HNYA 3KD1E 3O9SA 1NLVA 3L2VA 3K59A 2YHYA 2IAJA 3QFUA 1IKVA 3VOVA 1A5XA 4BC5A 1SL1A 4WQ5C 2IVNA 5AZIA 4NCGA 3SV4A 4DFMA 3HK2A 3DLHA 5AQGA 5AQOA 4OO1J 1ESVA 4OGEA 4K43A 4BGAA 4NO7A 1Q8IA 3CCSN 3L2WA 3DLLL 3TAGA 4M3TA 1BIZA 4CF8A 4QS9A 2WTUA 1KVCA 5E41A 3HJFA 4FXDA 1J53A 4CJPA 1UA1A 1B92A 4KHNA 3MK6A 4DSFA 2JGUA 3CM5A 3HSCA 2LSNA 1YUWA 4A62A 4DUYK 4E1JA 4WE1A 3N4PA 4FJ7A 1N6QA 3L2UA 1V4SA 3AVNA 4WFBL 4BQZA 2D4WA 4CZHA 2E88A 4JK7A 4K0KK 1TKZA 3SMPA 2PBDA 4OKEA 3ZSRA 1U45A 2E6LA 2NRTA 3D2EA 4OKKA 5JICA 4C8OA 2YNGA 1XHZA 1EWQA 3D7EO 1HNWK 3A5MC 3C65A 3ZSQA 4AILC 3K5OA 3M8QA 3QEXA 4IWVA 3L3VA 3LL3A 4HCBA 1C1CA 3EO3A 1G15A 3CM6A 4ILHA 2Q0UA 4H8KA 3QESA 1BGXT 1BI4B 4FW1A 4Z4FA 3AVCA 1DLOA 4BRQA 1XNRK 1U2VA 1HRHA 1RCHA 3SBGA 1LWFA 4LH5A 3TSQA 3Q7CA 3A8YA 4E19A 5HRRA 4FWKA 4JRQA 1E4FT 5JVHL 4I7FA 5AQVA 5M1NA 2X74A 2A1SA 4IJAA 3KZBA 2YHWA 1KSPA 3WXIA 3MECA 3T1HK 3R9PA 1ASWA 2P9IB 1YT3A 2KTQA 2Q97A 1EWRA 4DV6K 5AQXA 1VAZA 3P4IA 4I2QA 5GADP 1QE1A 1M90O 4M3XA 2KLAA 4IBNA 4J2DA 1X9MA 1WUAA 5CZ2A 1YVNA 2G8IA 1X9JA 1S1TA 2HW3A 3QMLA 3CJ9A 4CEZA 4X65K 2G8UA 3P83D 5CYMA 1GOAA 4DR2K 5AQNA 1U4BA 1J5EK 4CFAA 4F3OA 4JI8K 2E2PA 3AVLA 4CEDA 4DMNA 1I39A 3NMUA 3HP9A 5K14A 2Q1NA 3LALA 4RG8A 3KLGA 5F2RA 3AVKA 4CD1A 4ISFA 2UXDK 4H5TA 3DLGA 4BR2A 4H5WA 4DR3K 2O8CB 3FZMA 1HQUA 4EHUA 4YOTA 5JVGL 1FJGK 1FXXA 3JSMA 4N5SA 3SYZA 5C25A 2D0BA 4DU3A 2W40A 3KD5E 3D2FA 3MEEA 2X78A 2HBMA 2ZGZA 4AHSA 3THXA 4KH4A 2PY5A 4CJQA 4L8RB 4LD0A 3AVBA 5CYQA 3H08A 2KZMA 2P5GA 4CGIA 5EXWA 3PUFA 3T69A 3LZIA 4LSNA 1K6YA 4CF9A 4LF4K 1JLQA 5BREA 4CJWA 5J2PA 5KPRA 1X1PA 2HHSA 1M1KO 3MN6A 1MWKA 2UYTA 4CESA 4FW2A 1P90A 1RBVA 1N34K 2B4JA 2IIRA 4CEAA 2FBVA 1OH5A 1SV5A 3E9LA 5JS2A 4DHYA 3H46O 2FSNA 3MDQA 2IS3A 1RTDA 1JLAA 4AM6A 3MAQA 1HPMA 4E7LA 3H45C 3MXMA 3QFPA 4CW7B 2BE2A 1TUUA 3JAMO 3KLIA 4YORA 3ULDA 1S1WA 1JXBA 4ZTFA 3OBWA 3VETA 3VEVA 3N4QA 1JJ2M 2W42A 2E1ZA 3M8PA 2A40A 5AQYA 1RBUA 4CEFA 5LMNK 5GAHP 2XO7A 3V9WA 3O08A 1QVGM 4YY3K 4BRCA 1RBRA 4JKCA 2E2OA 3LM9A 1K9MO 3G25A 3C6UA 3ITHA 4DR7K 4NLBA 1Q18A 3HVRA 3QEWA 1XNQK 3CYMA 3LDNA 4FK4A 2RKIA 1EQYA 4PKGA 4O55A 4PWDA 1QQCA 1BU6O 1ZC6A 4A5BA 4FLZA 4JD2B 3KLHA 4W5QA 2Y1IA 1JXEA 2E2QA 1VSEA 1IKXA 1NNEA 1L3UA 3WQTA 4RWTA 3EKSA 3ULEB 3RR7A 3CCVN 4IOAL 4JEPA 1VQON 3CI5A 4CCHA 2WBNA 1HYZA 3NDKA 4Y1DA 4FJKA 1NJZA 1VSKA 3OYMA 2P9UB 1A5WA 1GLAG 1KTQA 1UA0A 1KFSA 5HRNA 4FJ8A 4KB1A 1EXQA 2D0OA 5BN8A 1UAXA 1NJIO 4KI4A 4JAXA 4B9QA 5GAEP 4KH6A 4FWQA 1Z6RA 1TGOA 4CHNA 2O8DA 3U4LA 1BOTO 1JKHA 4ID1A 3KK1A 1U6ZA 4JKAA 3RMAA 3V1QA 4M63C 3NH1A 1GLFO 4YOYA 4H0TB 4AF1A 2ZQBA 1BO5O 3T1YK 1BA0A 3J8AA 5AFUH 3AGKA 5BRFA 5GIOA 3DI6A 2DFFA 5FPEA 1WNSA 3I0SA 5KGXA 2VWBA 3THWA 1NOYA 2JWLA 4JKEA 1REVA 4ELTA 5C42A 4L3QA 4I2PA 2HHTA 5ADXH 4O4GA 4WQ4C 3K0SA 4KBOA 1NMDA 4B1UB 5CR4A 3K5LA 4CZEA 1OVYA 3LM2A 5AFUA 4B9LA 1VQ7N 3AAPA 4CK1A 4OJRA 3ZX2A 3CC7N 1T44A 2HNDA 1HYSA 3CXCM 4DF4A 3PIOL 4GKJK 2P9LA 1TAQA 2P9KA 3RMCA 3NH2A 3FZKA 3I55N 5H1SQ 3O1BA 1MU2A 1EP4A 1LAVA 4M7XA 5HOOA 1WBBA 2UUAK 3ISNC 4M7YA 5C2DA 2OCEA 1ZBLA 3V81A 2VYPA 1XWLA 3TPQA 3DMJA 1J54A 2F96A 4HTUA 1HNXK 4CJEA 2F4VK 4FLYA 4U67L 1G99A 2QA4N 1TVRA 2D1KA 1NKEA 3IMXA 4JS5A 2QWQA 3UIQA 1NM1A 1S6PA 2IDOA 4PUOA 3OS2A 2P9PA 4JI2K 1HNVA 4BGBA 3IUCA 4JLHA 5C15A 1NGIA 3AVIA 3FZHA 4FLTA 1XC3A 4DR4K 3HVTA 5AQLA 2G8HA 4B8CA 4CJTA 3QB0A 4ZHRA 3SJJA 3AA5X 3S3OA 3FFKB 2GX9A 5BR8K 1OH8A 1KCFA 1R59O 1NGFA 4WYBA 4IEIA 4FWSA 4CGDA 2P9SB 1DTQA 4NXNK 3J7AP 1S22A 1UWBA 1WSGA 3WXLA 4JRPA 2HNZA 4E1NA 3OYJA 1DEJA 4DSIA 3WQUA 5M1PA 2HVIA 5BRDA 1RFQA 1HUXA 1MDUB 1N36K 1BISA 3T1AA 4CZJA 3DJCA 2Z1GA 2KZZA 3H3NO 2KFNA 2QXLA 3KLFA 3SUNA 3T19A 4EP4A 3HYFA 4OPKA 3HZ6A 4QCLA 4H0XB 3MCAB 3OTOK 2O8FB 1KXPA 1S9GA 3DLBA 4M45A 3UKUB 4FWMA 3VQQA 1JCGA 1BHLA 4OPHA 2WFBA 4CFBA 4IEEA 4XIUA 3QINA 3RR8A 3RSEB 2F9WA 2OPQA 1IV0A 1BDGA 3I8BA 4CEEA 3ZETB 4FM2A 3OY9A 3BY5A 1JLFA 2W6KA 3SQ4A 4BQLA 3PV8A 4BR7A 3B8AX 4PA1A 2BH1A 3DXKB 4DV7K 2I7PA 1QQMA 3VTHA 4FLVA 1MWMA 1J9AA 4B1YB 5EY4A 3DRPA 5C2FA 2QK9A 1SUQA 4J2BA 2UXBK 4FZXC 1NGAA 3NFAA 2HB5A 3FLCO 4IO8A 5FPNA 4CZIA 4JN4A 5LY3A 2FLOA 4IFEA 4IOCL 4HUEA 1YJWN 2VWJA 1CZBA 3EE8A 3WXMB 5JMVA 1ZBHA 1BI4A 4DSKA 3ZSWA 3S41A 5GAGP 3LP0A 2ZGYA 4NXMK 5BPNA 4BRDA 4B3RK 5M1KA 1D9DA 4BRIA 2E8AA 1YITN 3OHRA 4CJUA 2J4RA 3TAEA 3J81O 3VQ9A 4QAGA 2VG6A 4CJ5A 2OYQA 4LF6K 2F8SA 4FYDA 4F8RA 3UE5A 2G8VA 3ALYA 3HI0A 4Z4HA 3AO1A 1NK0A 3AVGA 3LPUA 1Z26A 1QSSA 1BUPA 3VQAA 2ZD1A 2V52B 1KVBA 2F7TA 4YOUA 4FPBA 5IWAK 4DR1K 3CG7A 1KAXA 1VSLA 1LWCA 3FE1A 4F4KA 4HCCA 1NGBA 1X3MA 1TKDA 2IC3A 1C1AA 1RDCA 3QBWA 4I9LA 5CZ1A 4ID5A 2CGJA 3VQ7A 2B5JA 3CCRN 4N47A 1Q9YA 4FJXA 4BY9C 3KHYA 2FXUA 3O3HA 4YHHK 1RT3A 2W41A 4J2EA 1QVFM 3DLRA 4GW6A 2Q2RA 4GKKK 1VQKN 1BCOA 3NHGA 3TI0A 1HMVA 1VQ4N 4PKHA 1JLBA 1YAGA 2YHAA 3QEIA 3A5OC 3G6EN 1Q86O 2D0PA 4JI0K 3QLHA 3HOTA 4X62K 2VGMA 3P1GA 3I0RA 4KHQA 4BRGA 3EEQA 2BTFA 1NJXA 3SLCA 5GINA 3NF9A 1HQEA 4YDUA 2OZMA 3CIPA 3M6GA 4C1NI 5I9EB 1TK5A 1BQMA 4CVNE 4JKBA 4EZ6A 2HF4A 4OX9K 4MO5A 2A3ZA 4FLWA 3RMDA 1GOBA 5DM7L 3ATVA 3ZEUB 4JHDA 4CHYA 3D6RA 2AP1A 2YNFA 5FPDA 3SI6A 5KPZA 4KTWA 2HBJA 1D9FA 3LAKA 1W9HA 3O3GA 1IBKK 3PLAA 2GEMA 4QOZB 5T7BA 1QSYA 1KVAA 4F9OA 2QWPA 3E01A 4JI1K 2GUIA 4FO0A 1KD1O 2YJFA 3AVMA 2PFUA 2ASMA 2IOCA 1KAYA 2P9NB 3QBXA 4W5TA 1IO2A 3SK3A 2A1RA 2QTDA 4M3WA 1J5OA 3AA3A 4KHSA 5DK5A 4JKGB 4CBXA 4H0YB 1NU0A 3O4WA 3ZSOA 1S3XA 3LDLA 1NGEA 3TAMA 4JI6K 3TARA 1LOTB 1W97L 4A57A 4JI7K 2ETJA 3FZLA 1WSIA 4OGCA 4JKFA 5HROA 3SPZA 3L6QA 4IO9L 2ASPA 3C7NB 4YOWA 3MN5A 4NCBA 3ZSYA 3FFIA 1S9EA 3VENA 4NB4A 3T7ZA 3J7ZO 3WXJA 2BUPA 3OJSA 3AA4A 3KLEA 4F2SA 4O0JA 1XMOK 1Z25A 2IVPA 1QSLA 1T7PA 1RDAA 1S1VA 5TKWA 3U8XA 3KJVA 2WUSA 3NF7A 1NGCA 2O8EA 4IJNA 4KHYA 5KRTA 3OA9A 1VK0A 3AO3A 2DFEA 1TL3A 3L2RA 5AZIB 1SKWA 2OTLN 1T6DA 1E3MA 4Z94A 2QWOA 2VQEK 3MX2A 4BR5A 4RW7A 1RT4A 3VF4A 2OTJN 2GWKA 4BDZA 4BR0A 2HBKA 4DFKA 1U04A 5LMUK 3O4NA 4BE2A 4E7IA 3CJCA 1NMNA 3ULEA 4AHTA 3OBYA 5IT9O 3O9RA 3J80O 3WXKA 3AVJA 2X6NA 2CH6A 1SKSA 4FWRA 4BRLA 1GLDG 3ZT4A 4FVUA 3P5JA 1BG3A 5AQRA 3CJAA 4O0IA 2RN2A 3NF8A 4M41A 4CI6A 4MFBA 1SZ2A 4RTFD 4DV0K 1D8YA 5E26A 1R0AA 1NK8A 3KIOA 4ELVA 4J8FA 3U3YA 4KRFA 5LL6Z 1N5YA 1IG9A 2ZWHA 3DM2A 2HHQA 3FZFA 1RDWX 4WQ5A 4YNQA 4MDBA 1T6CA 4B1ZA 2Z1HA 2V51B 4CJ7A 3A5NC 2YJEA 1ATSA 3C94A 4DR6K 3JXUA 4N76A 3D2EB 3SAFA 3DOLA 1C0GA 2GBZA 3S3NA 4B3SK 2RE2A 3ZSXA 3TTDA 2OPSA 1N33K 4B1VA 4HUGA 3QIPA 5FROA 1OH7A 3V1OA 1JL1A 4U7BA 1NK6A 1WSHA 1JLGA 2HSTA 2QEXN 4M3YA 3C6AA 2PAVA 1KRPA 1HNIA 4H0OA 2ZF5O 1QQOA 1WAFA 4DG1A 1U2VB 4IG0A 4AHVA 1XUPO 3H6EA 4JKHA 3QEVA 2QWRA 4A61A 5C0YA 4AHCA 4DLEA 5FRNA 2FBYA 3CCEN 3EZ5A 4LFCK 3L3UA 3SV3A 3GOIA 3V9ZA 1HR0K 3PO5A 4BR9A 4CF0A 1ATNA 5BPLA 3ENBA 2I5JA 4PQUA 5EX5A 1VRTA 3VQBA 2HHHK 4DSJA 2YNHA 1U49A 5AZJA 5SZTA 4Q0BA 4PHTX 2BGGA 3M8SA 5AQKA 5BN9A 2HHVA 2VG5A 1LWEA 4CERA 4DU1A 3CFOA 3WEEB 5AQWA 3K57A 3K58A 4JK8A 5BRHA 4CHQA 5B8HA 1XQSC 1B9DA 3KWIA 4H03B 2B6AA 3MWPA 1WBDA 5TKYA 4NYNA 3L4QA 4O5FA 1RGIA 2YKNA 5CE3A 4BR4A 1NGHA 3MXIA 3WNGA 3VEOA 1NK5A 3EL2A 4RW4A 4AHUA 4G1QA 5HRPA 2E2NA 4M42A 1L3VA 3ZYYX 5J2NA 4RCHA 3EYZA 3V9UA 4OKJA 4N56A 4MO4A 5LJWA 1X9WA 3OS0A 3ID6A 3R8EA 3S3MA 4FK0A 3VEYA 4DQIA 4BVOA 1TYQB 4DUZK 2NRRA 3C6HA 3AVFA 2O4IA 3D2FB 4EFHA 4FWNA 3MN9A 2DFHA 3VQ8A 2G8WA 4GV6A 4FWPA 3SJHA 4KFBA 3UKRA 3VGLA 3DLEA 3LPTA 2FF3B 3OYLA 1C0FA 3VN5A 3BEXA 2YI1A 4ILJA 3WT0A 1Q82O 1QHTA 1BWFO 3F5TA 2RF2A 2IGIA 4FJLA 4CHOA 4CE9A 4KTZA 2HMPA 2UXCK 4O8KA 3UKUA 3BDPA 2HF3A 2WONA 3DXMB 1YJNN 3E9PA 5HRSA 3O80A 4DR5K 2DY4A 4LY7A 3TAQA 4IDHA 1WSEA 4CZFA 3SMSA 1ZXOA 4Z4IA 3O5BA 3CETA 3EZWA 3EN9A 2PYJA 1DKGD 4BACA 3LAMA 3GDQA 1NG9A 4H0VB 4DQRA 1BIUA 3PX0A 3BF3A 4GV3A 1SL2A 1JCFA 1QZ5A 3WUHA 5AQJA 4CJVA 4DTOA 4FK2A 4RW9A 1B9FA 2NRZA 4DTSA 3IRXA 1CZ9A 4BRKA 1GLJO 2P51A 3AARA 4FWOA 5ELZA 2HBLA 3VF2A 3VQCA 4FJHA 1K8KB 1RTIA 3GL1A 2O8BB 1Z05A 2E6MA 4CJLA 2ITMA 5M1QA 3ZX3A 1VQNN 4CGGA 5GIPA 4KHPK 4OLAA 3CERA 1KLMA 4BVPA 1WSJA 2AA4A 2YX6A 3SZ2A 4LF5K 1CLQA 3F2KA 1HYVA 2R7YA 3ZSZA 1J6ZA 1S1XA 4AQYK 2NNWA 4DTJA 3BZCA 3RRHA 3CQYA 3DOKA 3O8MA 4KAZA 1GLLO 3NBPA 3KVGA 5MLCQ 3HPGA 2E4LA 3V1RA 4B8AB 3CQXA 3VESA 4HHTA 4DCHA 1JLEA 2KQ2A 4DQSA 1W0HA 5CY4A 3C6TA 4CEQA 2ZJPL 1L5UA 2YV0X 1LV5A 3U6FA 4KHUA 4LF9K 4CFDA 3B6OA 2ITGA 4WCEL 3QERA 2ASOA 1Y97A 5EOYA 1QTMA 4XH1A 5C12A 1RILA 3CPWM 3CC4N 3F9KA 5DMRA 4BWMA 3VQPA 3KTQA 2QWMA 2WC9A 4ICLA 4ISGA 3OYKA 4O5BA 4B3TK 4A59A 1BCMA 3LP3A 1CZAN 2QKBA 1HJRA 1ITGA 3TAFA 3CC2N 2QW9A 4E7JA 3CCLN 4B1XB 3HM8A 4BDYA 4CBUA 3CCQN 1YJ9N 1KLNA 4EP5A 5J2QA 3AA2A 4OVLA 3HBTA 3THWB 4RW8A 4C8LA 4GV9A 3NGIA 4KHWA 4N41A 3I8DA 1WAJA 4FWLA 1HPZA 2I7NA 4CK2A 3AV9A 1RT1A 4V19S 3ZEUA 1NKCA 4QS7A 4MDAA 5AQHA 3HPOA 5LJVA 1K8AO 4E0DA 4GVMA 3PX4A 4KTQA 4DTMA 2OPRA 4BG9A 4ILGB 2QWLA 3CJ1A 4CBWA 2P9LB 3S9HA 4KKOA 2P9KB 1RTJA 4E89A 2NUBA 2XHBA 1XC9A 2A42A 1X3NA 4NYFA 2YHXA 2P9NA 1YHQN 1DTTA 3VA0A 3ZCMA 4DV1K 4WFNL 1SS6A 3NE6A 2ATQA 3VF6A 4FJ5A 1U48A 3AVHA 4JI5K 2Q31A 3RWUA 4JV5K 1S5JA 3WNEA 3KWGA 3HOSA 4B9SA 2A5XA 4IKFA 2DTUA 2P9IA 3SCXA 1NK9A 4EIAA 5D3GA 2P9PB 3VQ4A 1VQ6N 4KV8A 4DFPA 3VERA 5AQMA 4DS5A 3P39A 4MQ3A 2QI2A 4FSVA 3V4IA 3SUPA 3W3DA 3NGZA 2Q36A 3RTVA 4KB0A 4H0PA 4RW6A 2E5LK 3VQEA 1KFDA 3NGYA 3LDPA 3F9MA 2X6SA 5FPMA 1OH6A 2D0CA 2WOMA 3MX5A 2HHUA 3LDQA 4CJRA 4Q5VA 4GNIA 3PIPL 4IDKA 5AQIA 3K9JA 2ZJRL 4CF2A 2GELA 3TANA 4MLEA 4IFVA 1XI1A 3THYB 2EX3A 2CGKA 5A2QO 2O8CA 3SPYA 1L3SA 4HUFA 3NH0A 4CIFA 5J2MA 4BC2A 2NRWA 4AH9A 5KI6A 4GY2B 1IH7A 2G8FA 2XY8A 3QIOA 3LWMA 5HL7L 4UQGA 1TUYA 1VQLN 3AO5A 2HHWA 3AAQA 4H5NA 4XH4A 1YXQA 1YTAA 2H3GX 3L4IA 4CF1A 2JLEA 1QQNA 3VPZA 4B08A 2F8TA 3IS9A 3HRGA 4HTLA 3CFRA 1XHXA 4Y0WA 1SKRA 3B6PA 3K9KA 3O4QA 1VQ5N 3CD6N 3IG1A 3QO9A 4FZZA 3I56N 1S72N 1NGDA 5I42A 2RHKA 1VRUA 2YHBA 3ZX0A 1HKGA 1W7AA 4B1WB 3CJBA 5AQQA 3RVCA 1VSJA 4OPJA 4BE1A 3K5MA 3SUQA 3CMAN 4Y1CA 2YCHA 3ZT1A 3C95A 2YNIA 3ATUA 5KPTA 4BRNA 3L2QA 1O13A 1VSFA 2Z1IA 3LWLA 1TK8A 1NOZA 1N32K 3PY8A 1MA9B 1RTHA 1A5VA 3LP1A 4YOVA 4JNEA 1SAZA 3KK3A 2Z1JA 2VGNA 1YI2N 3K2PA 1S1UA 4M3RA 3W0LA 3ASMA 2BDPA 3MEDA 3QETA 3F73A 4I6MB 1SL0A 1FKOA 1IJJA 4C8NA 2IVOA 4DQ8A 2HMIA 4C8KA 1EETA 3OYFA 1VHXA 1YTUA 4CIEA 3CJ7A 4KREA 4DTXA 4Z4CA 1NJWA 3OYHA 4FJMA 1JLCA 1NK7A 3KKSA 2NRVA 2V7YA 1WLJA 3SBTA 4CZGA 3O1WA 3EKUA 1VSMA 2UUCK 4K41A 4KI6A 2XRIA 5C10A 4BWJA 3OYCA 3OYGA 4BC4A 1T8EA 1HJOA 5C24A 4F2RA 5I3UA 3LDSA 1ZBUA 3VGMA 4A5AA 2CGLA 4Z4EA 3BP8A 4DSEA 4CECA 3DAWA 4F3TA 3WEEA 1WSFA 1C1BA 4Z4GA 4JD2A 4DWIA 1RDUA 4CZMA 3IKMA 2P1JA 3TWHA 2QWNA 4CGFA 2VCPA 1NGJA 3O6WA 2VWKA 4DU4A 2P5OA 3U9ZA 2GV9A 2RPIA 3H3OB 2F9TA 4X64K 3OYEA 1LCUA 4Z0UA 3CFPA 4FJ9A 3BUZB 1C0MA 2G8KA 3MCPA 5AQPA 3R6MA 5JLHA 4ISEA 3OJUA 3M8RA 4LF8K 2GWJA 2P9UA 4C8MA 4ZTJA 3QNNA 2PYLA 1ZBSA 1IBMK 4PY5A 4C1NK 3MXJA 1H1VA 3VQ5A 4CGJA 2FC0A 4DQPA 5M1FA 3HL8A 1RT5A 3MEGA 5KRSA 4H5RA 4CJ3A 4M3ZA 1EX4A 1TYQA 3OYIA 4BC3A 3U3GA 2EHGA 1HX1A 4CHPA 2OA8A 3ZT2A 2A6AA 4TSXA 3G71N 3EY1A 4JHDB 1D5AA 4DTRA 1L3TA 2NRHA 4GVEA 4PKIA 3TU5A 4KPYA 1WN7A 2KFZA 3KKRA 2E20A 5AJ3K 3V6DA 3SAGA 3CQ8A 4LFAK 4E7KA 5CHIA 4XEIA 4NLCA 1T05A 4E7HA 1C6VA 1NKBA 3IDHA 4UY8O 3HP6A 3DXMA 3SQ2A 3J7YP 3LZJA 1I94K 4FJNA 3THVA 2D0AA 3O9UA 3R1XA 3HXMA 1QHAA 4H4MA 4FL9A 1GLCG 5BPMA 4AHRA 1NGGA 3CMEN 4W5RA 5E84A 4IZ9A 3FR0A 1HKCA 1Y64A 3BZKA 1GLBG 4CFCA 3MMVA 3AVAA 4O8UA 4B9UA 2ZM6K 3DRRA 3VEXA 4DV5K 4H4OA 5BR9A 1NBWA 3A5LC 4B9VA 3HPHA 1VSHA 1TAUA 3AO2A 3LDOA 3FGUA 2YKMA 3VQ6A 4R5PA 2QKKA 5HLFA 3KK7A 3MN7A 3ZT0A 3M5RA 4DV4K 4B9NA 3H1VX 3HO1A 3AO4A 5KQDA 5EU7A 1DGKN 3PSFA 5AQSA 2JWKA 3CPEA 4JI4K 4AM7A 4E1MA 1CXUA 1RBSA 5J1EA 1K8KA 2O8EB 3TTCA 3TR8A 4XH5A 4DV3K 4ELUA 2O8BA 1BQNA 2XY7A 1LW0A 3QDKA 4BE0A 2Q0RA 2NRXA 1N8RO 1ASUA 1IG8A 4W5OA 3AY9A 5AQFA 1QZ6A 3K5NA 3QNOA 3U9DA 1WB9A 3GE1A 2FSKA 3RMBA 3HM9A 2Q3SA 4PL7A 1LAWA 4FLXA 2GTDA 4FM1A 2HVHA 2P9SA 3TAPA 1RDBA 2ZJQL 4JYAK 5DM6L 4K42A 4QS8A 5EVZA 4I9QA 3LANA 3DLKA 4CZKA 1SQKA 4CJ4A 1UOCA 3VGKA 3M3ZA 4H5VA 3OW2M 3MWTA 4PL8A 1NK4A 1XMQK 2HHXA 1YVUA 1Q7YO 3VQDA 3THXB 2FSJA 3KK2A 3I33A 2Y1JA 1T03A 4BRMA 1X9SA 5HP1A 2UUBK 5F0XA 4CD3A 4DSLA 4DLGA 3T3FA 4DB3A 5FLXO 5F1XA 1RT2A 3L8BA 5KQ8A 2FBTA 4EHTA 3ID8A 3QEPA 4DQQA 3ZLJA 4JI3K 4NCAA 2EWSA 2O8FA 3L0QA 4CJSA 1BA1A
chains in the Genus database with same CATH topology
5DM7L 3HBTA 3G4SN 2DPNA 3CCMN 3ATVA 5KPRA 3ZEUB 3RSEA 4JHDA 4GV9A 3JS6A 3D6RA 2AP1A 3ZETA 5FPDA 4FWLA 5KPZA 2HBJA 1M1KO 2FF6A 3MN6A 1MWKA 2UYTA 2I7NA 2QM1A 3PLAA 2GEMA 4CZLA 3ENHA 1ILYA 4F9OA 1P90A 4A2AA 3Q7BA 3ZEUA 2QWPA 4YOXA 2IIRA 3DXKA 2KHOA 3E9LA 4DHYA 3H46O 4IOXA 4FO0A 4MDAA 1T3VA 2FSNA 3MDQA 4QS7A 2YJFA 5AQHA 1KD1O 5LJVA 1K8AO 4AM6A 3SAHA 2PFUA 1HPMA 4FOIA 2ASMA 1Q81O 2P9NB 1KAYA 3H45C 3P38A 3QBXA 3QFPA 4C23A 3SK3A 2QTDA 1TUUA 1YF5L 4ILGB 4YORA 2QWLA 3CJ1A 4BG9A 2P9LB 4CBWA 4JKGB 4CBXA 2OANA 4H0YB 2P9KB 3O4WA 3OBWA 3VETA 2A42A 1X3NA 3VEVA 1S3XA 3LDLA 1NGEA 2YHXA 3VEZA 3N4QA 1JJ2M 2P9NA 1LOTB 3QICA 1YHQN 1DT9A 2E1ZA 1W97L 2KKZA 4A57A 2A40A 3P31A 3FZLA 4JKFA 5AZJB 5AQYA 3L6QA 5GAHP 4IO9L 4WFNL 4HWIA 1SS6A 2ASPA 3C7NB 4YOWA 3MN5A 3IFRA 3O08A 3VF6A 1QVGM 2Q31A 4BRCA 4JKCA 3VENA 2E2OA 5ADXA 3LM9A 3KWGA 4NB4A 3T7ZA 3HOSA 3G25A 2A5XA 1K9MO 2GUPA 3J7ZO 2P9IA 3WXJA 4EIAA 1KQSM 2BUPA 2P9PB 4NLBA 1VQ6N 1Q18A 4LC9B 1V4TA 4FPAA 3LDNA 1EQYA 4PKGA 3VERA 5AQMA 3P39A 2IVPA 2QI2A 1BU6O 4FSVA 4BRPA 5TKWA 1ZC6A 4A5BA 3U8XA 4JD2B 3W3DA 3CF5L 1P8ZA 2WUSA 1NGCA 2Q36A 4IJNA 2E2QA 4H0PA 2HOEA 2A41A 3OA9A 5AZIB 3LDPA 3F9MA 1T6DA 5FPMA 3WQTA 4Z94A 2QWOA 4YDUC 4RWTA 2OTLN 5AQZA 3MX2A 4BRAA 3EKSA 3ULEB 3CCVN 4BR5A 4IOAL 4JEPA 1VQON 3CI5A 3MX5A 3DWLA 3LDQA 3VF4A 2OTJN 2GWKA 1YIJN 2WBNA 1E4GT 1HKBA 4BR0A 4GNIA 3PIPL 2HBKA 3CJCA 4BG8A 5AQIA 3K9JA 3ULEA 3A0IX 3OBYA 2ZJRL 2GELA 3E66A 3O9RA 3VEWA 2P9UB 1JCEA 4MLEA 3WXKA 1W2BM 4MLHA 2CGKA 2CH6A 1GLAG 4FWRA 4G9ZA 4BRLA 1GLDG 4FVUA 1BG3A 2D0OA 5AQRA 5BN8A 1NJIO 3CJAA 4JAXA 4B9QA 4BREA 4CI6A 5GAEP 3H1QA 2NLXA 4KH6A 1SZ2A 4RTFD 3UKRB 4BC2A 4BROA 4FWQA 2NRWA 1Z6RA 5E26A 1VQ8N 4GY2B 4J8FA 3U4LA 1BOTO 1KC8O 2CH5A 3TTFA 4WF9L 2ZWHA 1ATRA 1NWKA 5HL7L 1OKJA 1TUYA 3FZFA 1VQLN 1U6ZA 4JKAA 1RDWX 1WOQA 3TSUA 4M63C 3AAQA 4WQ5A 1GLFO 4H5NA 4MDBA 4XH4A 4YOYA 1YXQA 1GLEG 1T6CA 4B1ZA 5JLFA 1EO1A 2H3GX 4H0TB 4IXCA 4AF1A 2V51B 3L4IA 3A5NC 2YJEA 3C0BA 1ATSA 4CJ7A 1BO5O 3JXUA 1BA0A 1QQNA 3D2EB 3E1YA 3J8AA 3VPZA 3SAFA 1C0GA 3HRGA 2NZTA 4FOEA 4HTLA 1HLUA 5AFUH 3ENOA 3AGKA 4Y0WA 5BRFA 2RE2A 5GIOA 3TTDA 4KH5A 5FPEA 4B1VA 3NVKA 3K9KA 1VQ5N 2VWBA 3CD6N 4U7BA 3I56N 4BRFA 1NGDA 1S72N 2V7ZA 2JWLA 2HSTA 2RHKA 4JKEA 4R79A 3ZX0A 1HKGA 2QEXN 3BF1A 1KAZA 3C6AA 2PAVA 4L3QA 3CJBA 4B1WB 3UB5A 5AQQA 3RVCA 5AQTA 5AQUA 5ADXH 4WQ4C 4H0OA 4KBOA 3TSPA 3CMAN 1NMDA 2YCHA 4B1UB 5CR4A 3O9QA 2ZF5O 1QQOA 3ATUA 1U2VB 4BRNA 4CZEA 5KPTA 1XUPO 3AGRA 3H6EA 4WFAL 4JKHA 3CCJN 1OVYA 3LM2A 3VMFB 2QWRA 5AFUA 1O13A 4A61A 3AAPA 1VQ7N 5C0YA 4A2BA 3ZX2A 3CC7N 1D4XA 1T44A 3CXCM 1MA9B 3CCEN 4YOVA 3EE9A 4JNEA 1SAZA 3PIOL 2VGNA 3R3LA 2P9LA 3HTVA 3GOIA 4JKGA 1YI2N 2P9KA 3W0LA 3FZKA 4JK9A 5H1SQ 3I55N 3O1BA 5AR0A 3VTIA 4BR9A 4I6MB 3M1FA 1IJJA 1ATNA 4DQ8A 2IVOA 3ENBA 4M7XA 5BPLA 5HOOA 4M7YA 5EX5A 4EAHD 3CJ7A 3CCUN 5C2DA 5AZJA 4K25A 1K73O 4WQ4A 2VYPA 3TPQA 4PHTX 3C7NA 4DKWA 1VQ9N 2NRVA 4I6MA 2V7YA 5AQKA 5BN9A 3SBTA 4CZGA 3O1WA 4U67L 3GG4A 3EKUA 1G99A 2QA4N 2D1KA 5M1OA 4OPAA 3IMXA 2E1YA 4BRHA 3WEEB 5AQWA 4K41A 1VQMN 2QWQA 1VQPN 1NM1A 3GBTA 4JK8A 5C10A 5BRHA 5B8HA 1XQSC 2P9PA 3KWIA 4BC4A 4H03B 4BGBA 4JKDA 1HJOA 3IUCA 3E9OA 3MWPA 5C15A 1NGIA 3FZHA 5TKYA 3VGMA 4A5AA 1XC3A 2CGLA 3CHWA 3BP8A 3L4QA 4O5FA 3NVMA 1RGIA 3DAWA 5AQLA 3O9TA 3QB0A 5CE3A 3WEEA 4BR4A 3O9SA 3FFKB 1NGHA 1NLVA 2GX9A 4JD2A 2YHYA 3QFUA 3VEOA 1R59O 3EL2A 1RDUA 1NGFA 4WYBA 3VOVA 3IKMA 4IEIA 4CZMA 2QWNA 4FWSA 2P9SB 4BC5A 2VCPA 1NGJA 3O6WA 4WQ5C 2IVNA 2E2NA 5AZIA 3U9ZA 3ZYYX 3H3OB 1S22A 4RCHA 2F9TA 5AQGA 5AQOA 4MO4A 4OO1J 1ESVA 4K43A 3WXLA 1LCUA 5LJWA 4BGAA 4NO7A 3BUZB 3ID6A 1DEJA 3R8EA 3CCSN 3DLLL 3WQUA 5M1PA 3VEYA 3MCPA 5AQPA 3R6MA 4BVOA 5BRDA 5JLHA 1RFQA 4QS9A 1HUXA 4ISEA 1TYQB 1MDUB 2GWJA 2P9UA 4CZJA 2NRRA 3C6HA 3D2FB 4EFHA 1ZBSA 3DJCA 4FWNA 4C1NK 1H1VA 3MK6A 3MN9A 3H3NO 4GV6A 2QXLA 5M1FA 4FWPA 3SJHA 4H5RA 3UKRA 3VGLA 1TYQA 3HSCA 3HZ6A 1YUWA 4A62A 4H0XB 4BC3A 4E1JA 2FF3B 3MCAB 1C0FA 3N4PA 1KXPA 1HX1A 3BEXA 2YI1A 4ILJA 1V4SA 4FWMA 3UKUB 1JCGA 4WFBL 4BQZA 2D4WA 4OPHA 4CZHA 2WFBA 2E88A 2A6AA 4JK7A 3WT0A 1Q82O 4IEEA 3G71N 1BWFO 3F5TA 3RSEB 4JHDB 3SMPA 2PBDA 2F9WA 1BDGA 3I8BA 2NRTA 3D2EA 2HMPA 3ZETB 2NRHA 4GVEA 4PKIA 3TU5A 5JICA 4O8KA 3UKUA 3D7EO 3A5MC 2HF3A 4BQLA 4BR7A 3B8AX 2E20A 2BH1A 3DXMB 3C65A 3E9PA 1YJNN 3SAGA 3O80A 3DXKB 4IWVA 3LL3A 3EO3A 5CHIA 4IDHA 2I7PA 4XEIA 4CZFA 1QQMA 4NLCA 3SMSA 1ZXOA 3VTHA 1MWMA 3O5BA 4B1YB 3CETA 3EZWA 5EY4A 3EN9A 4ILHA 1DKGD 2Q0UA 3IDHA 3GDQA 5C2FA 4UY8O 3DXMA 3O9UA 3R1XA 4H0VB 3BF3A 1NGAA 1QHAA 4GV3A 3FLCO 4IO8A 1JCFA 1QZ5A 4FL9A 3WUHA 1GLCG 4BRQA 5AQJA 1U2VA 5BPMA 5FPNA 4CZIA 4JN4A 1NGGA 5LY3A 2FLOA 3CMEN 4IFEA 5E84A 4IZ9A 4IOCL 2NRZA 3FR0A 1YJWN 3SBGA 1HKCA 1Y64A 3EE8A 3WXMB 3TSQA 3Q7CA 5JMVA 1GLBG 3MMVA 4O8UA 3A8YA 3S41A 5GAGP 2ZGYA 4FWKA 5BPNA 4BRDA 5M1KA 4BRIA 1E4FT 2E8AA 1GLJO 3AARA 3OHRA 4BRKA 5JVHL 1YITN 5AQVA 3VEXA 2J4RA 5M1NA 4FWOA 5BR9A 1NBWA 3A5LC 5ELZA 4IJAA 3KZBA 2HBLA 2YHWA 3WXIA 3VF2A 3LDOA 3FGUA 3R9PA 1K8KB 2P9IB 3UE5A 2Q97A 3KK7A 3GL1A 3MN7A 1Z05A 3M5RA 3HI0A 5AQXA 1VAZA 3H1VX 3P4IA 5M1QA 2ITMA 5KQDA 5GADP 3ZX3A 1VQNN 1M90O 1DGKN 5GIPA 2KLAA 1BUPA 5AQSA 2JWKA 3CPEA 1WUAA 3CERA 4AM7A 4BVPA 2V52B 2AA4A 2F7TA 2YX6A 4FPBA 4YOUA 1K8KA 1KAXA 1YVNA 3FE1A 3TTCA 1NGBA 1X3MA 4XH5A 3F2KA 3QBWA 1X9JA 3QDKA 2Q0RA 2CGJA 3CJ9A 3QMLA 2NRXA 1J6ZA 3CCRN 1N8RO 1IG8A 3AY9A 5AQFA 2NNWA 1QZ6A 3U9DA 4BY9C 3KHYA 3GE1A 2FXUA 2FSKA 5AQNA 3CQYA 4PL7A 2E2PA 2W41A 3O8MA 3NMUA 2Q1NA 1GLLO 2GTDA 1QVFM 2Q2RA 1VQKN 5F2RA 2P9SA 3KVGA 4CD1A 5MLCQ 4ISFA 2ZJQL 4H5TA 5DM6L 1VQ4N 3CQXA 4H5WA 4K42A 4QS8A 5EVZA 4BR2A 3FZMA 4EHUA 4PKHA 3VESA 4CZKA 4DCHA 1SQKA 1YAGA 4YOTA 3A5OC 3VGKA 3G6EN 5JVGL 1Q86O 2D0PA 3M3ZA 4H5VA 3HOTA 2ZJPL 3MWTA 3OW2M 4PL8A 2VGMA 1Q7YO 2FSJA 4WCEL 2ASOA 3I33A 5EOYA 2W40A 4BRGA 4XH1A 5C12A 2BTFA 3D2FA 3SLCA 4BRMA 3CPWM 3CC4N 5F0XA 4CD3A 4DB3A 5GINA 2QWMA 2WC9A 4ISGA 2HBMA 2ZGZA 4YDUA 3CIPA 4A59A 3M6GA 4C1NI 5F1XA 5KQ8A 4KH4A 4EHTA 1CZAN 3ID8A 5I9EB 3CC2N 2QW9A 3CCLN 4B1XB 4JKBA 2HF4A 3HM8A 2EWSA 4CBUA 4MO5A 3L0QA 3CCQN 5EXWA 2A3ZA 1YJ9N 3T69A 1BA1A 5BREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HBT A;  2DPN A;  3ATV A;  5KPR A;  3ZEU B;  3RSE A;  4JHD A;  3JS6 A;  2AP1 A;  3ZET A;  5FPD A;  4FWL A;  5KPZ A;  2FF6 A;  3MN6 A;  1MWK A;  2UYT A;  2I7N A;  2QM1 A;  2GEM A;  4CZL A;  3ENH A;  4F9O A;  4A2A A;  3ZEU A;  2QWP A;  2IIR A;  3DXK A;  2KHO A;  4DHY A;  3H46 O;  4QS7 A;  4FO0 A;  5AQH A;  2FSN A;  3MDQ A;  2YJF A;  5LJV A;  4AM6 A;  1HPM A;  4FOI A;  2ASM A;  2P9N B;  1KAY A;  3H45 C;  3QBX A;  3QFP A;  4C23 A;  3SK3 A;  1TUU A;  4BG9 A;  2QWL A;  3CJ1 A;  4CBW A;  2P9L B;  4CBX A;  2OAN A;  4H0Y B;  2P9K B;  3O4W A;  3VET A;  2A42 A;  1X3N A;  3VEV A;  1S3X A;  3LDL A;  1NGE A;  2YHX A;  3VEZ A;  2P9N A;  1LOT B;  3QIC A;  2E1Z A;  2A40 A;  3FZL A;  5AZJ B;  5AQY A;  3L6Q A;  4HWI A;  2ASP A;  3C7N B;  3MN5 A;  3IFR A;  3O08 A;  3VF6 A;  2Q31 A;  4BRC A;  3VEN A;  2E2O A;  5ADX A;  3LM9 A;  4NB4 A;  3G25 A;  2A5X A;  2GUP A;  2P9I A;  3WXJ A;  4EIA A;  2BUP A;  2P9P B;  1Q18 A;  4LC9 B;  1V4T A;  4FPA A;  3LDN A;  1EQY A;  4PKG A;  3VER A;  5AQM A;  2IVP A;  1BU6 O;  4FSV A;  4BRP A;  1ZC6 A;  3U8X A;  4JD2 B;  3W3D A;  1P8Z A;  2WUS A;  1NGC A;  2Q36 A;  4IJN A;  2E2Q A;  4H0P A;  2HOE A;  2A41 A;  5AZI B;  3LDP A;  3F9M A;  1T6D A;  5FPM A;  3WQT A;  4Z94 A;  2QWO A;  4YDU C;  4RWT A;  5AQZ A;  4BRA A;  3EKS A;  3ULE B;  4BR5 A;  3CI5 A;  3DWL A;  3LDQ A;  3VF4 A;  2GWK A;  1E4G T;  1HKB A;  4BR0 A;  4GNI A;  3CJC A;  4BG8 A;  5AQI A;  3ULE A;  3A0I X;  2GEL A;  3VEW A;  2P9U B;  1JCE A;  4MLE A;  3WXK A;  4MLH A;  2CGK A;  2CH6 A;  1GLA G;  4FWR A;  4BRL A;  1GLD G;  1BG3 A;  2D0O A;  5AQR A;  5BN8 A;  3CJA A;  4JAX A;  4B9Q A;  4BRE A;  4CI6 A;  3H1Q A;  2NLX A;  4BRO A;  1SZ2 A;  4RTF D;  3UKR B;  4BC2 A;  4FWQ A;  1Z6R A;  5E26 A;  4GY2 B;  4J8F A;  3U4L A;  1BOT O;  2CH5 A;  2ZWH A;  1ATR A;  1NWK A;  1OKJ A;  1TUY A;  3FZF A;  1U6Z A;  1RDW X;  1WOQ A;  4M63 C;  3AAQ A;  4WQ5 A;  1GLF O;  4H5N A;  4XH4 A;  1YXQ A;  1GLE G;  1T6C A;  4B1Z A;  5JLF A;  2H3G X;  4H0T B;  4IXC A;  2V51 B;  3L4I A;  3A5N C;  2YJE A;  3C0B A;  1ATS A;  4CJ7 A;  1BO5 O;  3JXU A;  1BA0 A;  1QQN A;  3D2E B;  3J8A A;  3VPZ A;  1C0G A;  2NZT A;  4FOE A;  4HTL A;  1HLU A;  5AFU H;  3ENO A;  4Y0W A;  5BRF A;  5FPE A;  4B1V A;  2VWB A;  4BRF A;  1NGD A;  2V7Z A;  3ZX0 A;  1HKG A;  3BF1 A;  1KAZ A;  2PAV A;  4L3Q A;  3CJB A;  4B1W B;  3UB5 A;  5AQQ A;  5AQT A;  5AQU A;  5ADX H;  4WQ4 C;  4H0O A;  4KBO A;  1NMD A;  2YCH A;  4B1U B;  2ZF5 O;  1QQO A;  3ATU A;  1U2V B;  4BRN A;  4CZE A;  5KPT A;  1XUP O;  3H6E A;  3LM2 A;  2QWR A;  5AFU A;  4A61 A;  3AAP A;  4A2B A;  3ZX2 A;  1D4X A;  1T44 A;  1MA9 B;  4JNE A;  1SAZ A;  2P9L A;  3HTV A;  3GOI A;  2P9K A;  3W0L A;  3FZK A;  3O1B A;  5AR0 A;  4BR9 A;  4I6M B;  3M1F A;  1IJJ A;  1ATN A;  4DQ8 A;  2IVO A;  4M7X A;  5BPL A;  4M7Y A;  5EX5 A;  4EAH D;  3CJ7 A;  5AZJ A;  4K25 A;  4WQ4 A;  2VYP A;  3TPQ A;  3C7N A;  4I6M A;  2V7Y A;  5AQK A;  5BN9 A;  4CZG A;  3O1W A;  3GG4 A;  3EKU A;  1G99 A;  2D1K A;  3IMX A;  2E1Y A;  4BRH A;  3WEE B;  5AQW A;  4K41 A;  2QWQ A;  1NM1 A;  3GBT A;  5BRH A;  5B8H A;  1XQS C;  2P9P A;  4BC4 A;  4H03 B;  4BGB A;  1HJO A;  3IUC A;  1NGI A;  3FZH A;  5TKY A;  3VGM A;  1XC3 A;  2CGL A;  3CHW A;  3BP8 A;  4O5F A;  1RGI A;  3DAW A;  5AQL A;  3QB0 A;  5CE3 A;  3WEE A;  4BR4 A;  3FFK B;  1NGH A;  1NLV A;  4JD2 A;  2YHY A;  3QFU A;  3VEO A;  1R59 O;  3EL2 A;  1NGF A;  4WYB A;  3VOV A;  4CZM A;  2QWN A;  4FWS A;  2P9S B;  4BC5 A;  2VCP A;  1NGJ A;  3O6W A;  4WQ5 C;  2IVN A;  2E2N A;  5AZI A;  3U9Z A;  3H3O B;  1S22 A;  4RCH A;  2F9T A;  5AQG A;  5AQO A;  4MO4 A;  1ESV A;  4K43 A;  3WXL A;  1LCU A;  5LJW A;  4BGA A;  4NO7 A;  3BUZ B;  3R8E A;  1DEJ A;  3WQU A;  3VEY A;  3MCP A;  5AQP A;  3R6M A;  4BVO A;  5BRD A;  5JLH A;  1RFQ A;  4QS9 A;  1HUX A;  4ISE A;  1TYQ B;  1MDU B;  2GWJ A;  2P9U A;  4CZJ A;  3D2F B;  4EFH A;  1ZBS A;  3DJC A;  4FWN A;  1H1V A;  3MK6 A;  3MN9 A;  3H3N O;  2QXL A;  4FWP A;  3SJH A;  4H5R A;  3UKR A;  3VGL A;  1TYQ A;  3HSC A;  3HZ6 A;  1YUW A;  4A62 A;  4H0X B;  4BC3 A;  4E1J A;  2FF3 B;  1C0F A;  1KXP A;  1HX1 A;  3BEX A;  2YI1 A;  1V4S A;  4FWM A;  3UKU B;  1JCG A;  4BQZ A;  2D4W A;  4CZH A;  2E88 A;  2A6A A;  3WT0 A;  1BWF O;  3RSE B;  4JHD B;  3SMP A;  2PBD A;  2F9W A;  1BDG A;  3I8B A;  3D2E A;  2HMP A;  3ZET B;  2NRH A;  3TU5 A;  4PKI A;  5JIC A;  4O8K A;  3UKU A;  3D7E O;  3A5M C;  2HF3 A;  4BQL A;  4BR7 A;  3B8A X;  2E20 A;  3DXM B;  3O80 A;  3DXK B;  4IWV A;  3LL3 A;  3EO3 A;  2I7P A;  4XEI A;  4CZF A;  1QQM A;  3SMS A;  1ZXO A;  1MWM A;  3O5B A;  4B1Y B;  3CET A;  3EZW A;  5EY4 A;  3EN9 A;  1DKG D;  2Q0U A;  3IDH A;  3GDQ A;  3DXM A;  4H0V B;  3BF3 A;  1NGA A;  1QHA A;  3FLC O;  4IO8 A;  1JCF A;  1QZ5 A;  4FL9 A;  3WUH A;  1GLC G;  4BRQ A;  5AQJ A;  1U2V A;  5BPM A;  5FPN A;  4CZI A;  4JN4 A;  1NGG A;  5LY3 A;  2FLO A;  5E84 A;  4IZ9 A;  3FR0 A;  1HKC A;  1Y64 A;  5JMV A;  1GLB G;  3MMV A;  3S41 A;  3A8Y A;  2ZGY A;  4FWK A;  5BPN A;  4BRD A;  4BRI A;  1E4F T;  2E8A A;  1GLJ O;  3AAR A;  3OHR A;  4BRK A;  5AQV A;  3VEX A;  2J4R A;  4FWO A;  5BR9 A;  1NBW A;  3A5L C;  5ELZ A;  4IJA A;  3KZB A;  2YHW A;  3WXI A;  3VF2 A;  3LDO A;  3FGU A;  3R9P A;  1K8K B;  2P9I B;  3UE5 A;  2Q97 A;  3GL1 A;  3MN7 A;  1Z05 A;  3HI0 A;  5AQX A;  3H1V X;  3P4I A;  2ITM A;  5KQD A;  3ZX3 A;  1DGK N;  5AQS A;  1BUP A;  1WUA A;  3CER A;  4AM7 A;  4BVP A;  2V52 B;  2AA4 A;  4FPB A;  1K8K A;  1KAX A;  1YVN A;  3FE1 A;  1NGB A;  1X3M A;  4XH5 A;  3QBW A;  1X9J A;  3QDK A;  2Q0R A;  2CGJ A;  3CJ9 A;  3QML A;  1J6Z A;  1IG8 A;  3AY9 A;  5AQF A;  1QZ6 A;  3U9D A;  3KHY A;  3GE1 A;  2FXU A;  2FSK A;  5AQN A;  3CQY A;  4PL7 A;  2E2P A;  2W41 A;  3O8M A;  2Q1N A;  1GLL O;  2GTD A;  2Q2R A;  5F2R A;  2P9S A;  3KVG A;  4CD1 A;  4ISF A;  4H5T A;  3CQX A;  4H5W A;  4K42 A;  4QS8 A;  5EVZ A;  4BR2 A;  3FZM A;  4EHU A;  4PKH A;  3VES A;  4CZK A;  4DCH A;  1SQK A;  1YAG A;  3A5O C;  3VGK A;  2D0P A;  3M3Z A;  4H5V A;  4PL8 A;  2FSJ A;  2ASO A;  3I33 A;  5EOY A;  2W40 A;  4BRG A;  4XH1 A;  2BTF A;  3D2F A;  3SLC A;  4BRM A;  5F0X A;  4CD3 A;  4DB3 A;  2QWM A;  4ISG A;  2ZGZ A;  4YDU A;  3CIP A;  5F1X A;  3M6G A;  5KQ8 A;  4EHT A;  1CZA N;  3ID8 A;  5I9E B;  2QW9 A;  4B1X B;  2HF4 A;  3HM8 A;  2EWS A;  4CBU A;  4MO5 A;  3L0Q A;  5EXW A;  2A3Z A;  1BA1 A;  5BRE A; 
#chains in the Genus database with same CATH topology
 3G4S N;  3A2F A;  2DPN A;  3CCM N;  3SQ1 A;  2W6L A;  1CXQ A;  5HBM A;  3RSE A;  4CGH A;  1RT6 A;  3OYB A;  4JS4 A;  3JS6 A;  1NJY A;  3ZET A;  4CHZ A;  1I3A A;  4YFU A;  4FLU A;  2FF6 A;  3HT3 A;  1RDD A;  1GOC A;  2QM1 A;  4CZL A;  5FDL A;  3ENH A;  1ILY A;  4A2A A;  3Q7B A;  4YOX A;  4LF7 K;  3DXK A;  2KHO A;  1TK0 A;  4IOX A;  3O3F A;  1T3V A;  4FM0 A;  3SQ0 A;  1IKY A;  1ZYQ A;  3SAH A;  1Q81 O;  4FOI A;  4FJJ A;  4DFJ A;  1VSD A;  4C23 A;  1JL2 A;  3P38 A;  3PO4 A;  1YF5 L;  2QXF A;  4IG3 A;  3NF6 A;  2OAN A;  3PSI A;  3TAB A;  3IAY A;  3VEZ A;  1OVQ A;  3QIC A;  3WNF A;  1DT9 A;  1TKX A;  2KKZ A;  3P31 A;  2UU9 K;  1BL3 A;  5AZJ B;  1VSI A;  4HWI A;  3IFR A;  3OVN A;  2OZS A;  5FRM A;  4O44 A;  4CIG A;  5ADX A;  3WNH A;  4B3M K;  2GUP A;  1S6Q A;  1KQS M;  2O4G A;  4LC9 B;  1V4T A;  1Q9X A;  4FPA A;  4K8Z A;  5SWM A;  1TV6 A;  4BRP A;  4KO0 A;  3CF5 L;  1P8Z A;  1F21 A;  4GMJ B;  2HOE A;  2A41 A;  3D0P A;  4YDU C;  3OYD A;  4FCY A;  5AQZ A;  4BRA A;  3ZT3 A;  4DV2 K;  2VQF K;  3VA3 A;  3DWL A;  4FZY A;  1YIJ N;  4LFB K;  1E4G T;  1TL1 A;  1HKB A;  4B9M A;  4B3O A;  3DRS A;  2ZE2 A;  1TKT A;  4B9T A;  4DTP A;  4BG8 A;  4W5N A;  3A0I X;  3E66 A;  1QS4 A;  3VEW A;  1JCE A;  1IBL K;  1W2B M;  2O8D B;  4MLH A;  4G9Z A;  2FBX A;  4CJK A;  3PX6 A;  2XY6 A;  4BRE A;  3H1Q A;  2NLX A;  4BRO A;  3UKR B;  3V9S A;  1VQ8 N;  4DF8 A;  3THY A;  1KC8 O;  2CH5 A;  3TTF A;  4WF9 L;  1ATR A;  1NWK A;  4FJI A;  1OKJ A;  3RRG A;  1HNZ K;  1WOQ A;  3TSU A;  1ASV A;  1GLE G;  5JLF A;  1EO1 A;  4IXC A;  3C0B A;  3JYT A;  2KW4 A;  4X66 K;  2AJQ A;  3E1Y A;  4CEB A;  4BDP A;  2NZT A;  4FOE A;  4DS4 A;  1HLU A;  3ENO A;  1RBT A;  1U47 A;  4KH5 A;  2PZS A;  3NVK A;  4K8X A;  5KTQ A;  3OYN A;  4BRF A;  2V7Z A;  1RT7 A;  4R79 A;  4DTU A;  2D5R A;  3BF1 A;  1KAZ A;  5JS1 A;  3UB5 A;  1IKW A;  5AQT A;  5AQU A;  3SUO A;  4M3U A;  4DTN A;  3G0Z A;  3TSP A;  3ZSV A;  3D45 A;  3O9Q A;  4E3S A;  4WFA L;  3AGR A;  3CCJ N;  3VMF B;  4CEO A;  1FW6 A;  4A2B A;  4FJG A;  1D4X A;  2XY5 A;  1FKP A;  1O1W A;  3EE9 A;  3R3L A;  3DYA A;  3HTV A;  1ZBF A;  4JKG A;  4HVJ A;  3NCI A;  3V9X A;  2BAN A;  4J2A A;  4JK9 A;  1EKE A;  1FK9 A;  5AR0 A;  3VTI A;  3M1F A;  1ZBI A;  4IFY A;  4EAH D;  3CCU N;  4K25 A;  1K73 O;  5KGW A;  4WQ4 A;  4FVM A;  1RNH A;  3C7N A;  1C0T A;  4DKW A;  4EZ9 A;  1VQ9 N;  4I6M A;  3GG4 A;  4CJF A;  5M1O A;  3HST B;  4LH4 A;  3BGR A;  4OPA A;  2E1Y A;  4BRH A;  4CK3 A;  1VQM N;  1LW2 A;  1VQP N;  3GBT A;  3LP2 A;  3G10 A;  4OLB A;  4JKD A;  3E9O A;  3SNN A;  3CHW A;  2OPP A;  3NVM A;  3OYA A;  3NAE A;  2VG7 A;  1C0U A;  3O9T A;  3OS1 A;  4LSL A;  2HNY A;  3KD1 E;  3O9S A;  1NLV A;  3L2V A;  3K59 A;  2YHY A;  2IAJ A;  3QFU A;  1IKV A;  3VOV A;  1A5X A;  4BC5 A;  1SL1 A;  4WQ5 C;  2IVN A;  5AZI A;  4NCG A;  3SV4 A;  4DFM A;  3HK2 A;  3DLH A;  5AQG A;  5AQO A;  4OO1 J;  1ESV A;  4OGE A;  4K43 A;  4BGA A;  4NO7 A;  1Q8I A;  3CCS N;  3L2W A;  3DLL L;  3TAG A;  4M3T A;  1BIZ A;  4CF8 A;  4QS9 A;  2WTU A;  1KVC A;  5E41 A;  3HJF A;  4FXD A;  1J53 A;  4CJP A;  1UA1 A;  1B92 A;  4KHN A;  3MK6 A;  4DSF A;  2JGU A;  3CM5 A;  3HSC A;  2LSN A;  1YUW A;  4A62 A;  4DUY K;  4E1J A;  4WE1 A;  3N4P A;  4FJ7 A;  1N6Q A;  3L2U A;  1V4S A;  3AVN A;  4WFB L;  4BQZ A;  2D4W A;  4CZH A;  2E88 A;  4JK7 A;  4K0K K;  1TKZ A;  3SMP A;  2PBD A;  4OKE A;  3ZSR A;  1U45 A;  2E6L A;  2NRT A;  3D2E A;  4OKK A;  5JIC A;  4C8O A;  2YNG A;  1XHZ A;  1EWQ A;  3D7E O;  1HNW K;  3A5M C;  3C65 A;  3ZSQ A;  4AIL C;  3K5O A;  3M8Q A;  3QEX A;  4IWV A;  3L3V A;  3LL3 A;  4HCB A;  1C1C A;  3EO3 A;  1G15 A;  3CM6 A;  4ILH A;  2Q0U A;  4H8K A;  3QES A;  1BGX T;  1BI4 B;  4FW1 A;  4Z4F A;  3AVC A;  1DLO A;  4BRQ A;  1XNR K;  1U2V A;  1HRH A;  1RCH A;  3SBG A;  1LWF A;  4LH5 A;  3TSQ A;  3Q7C A;  3A8Y A;  4E19 A;  5HRR A;  4FWK A;  4JRQ A;  1E4F T;  5JVH L;  4I7F A;  5AQV A;  5M1N A;  2X74 A;  2A1S A;  4IJA A;  3KZB A;  2YHW A;  1KSP A;  3WXI A;  3MEC A;  3T1H K;  3R9P A;  1ASW A;  2P9I B;  1YT3 A;  2KTQ A;  2Q97 A;  1EWR A;  4DV6 K;  5AQX A;  1VAZ A;  3P4I A;  4I2Q A;  5GAD P;  1QE1 A;  1M90 O;  4M3X A;  2KLA A;  4IBN A;  4J2D A;  1X9M A;  1WUA A;  5CZ2 A;  1YVN A;  2G8I A;  1X9J A;  1S1T A;  2HW3 A;  3QML A;  3CJ9 A;  4CEZ A;  4X65 K;  2G8U A;  3P83 D;  5CYM A;  1GOA A;  4DR2 K;  5AQN A;  1U4B A;  1J5E K;  4CFA A;  4F3O A;  4JI8 K;  2E2P A;  3AVL A;  4CED A;  4DMN A;  1I39 A;  3NMU A;  3HP9 A;  5K14 A;  2Q1N A;  3LAL A;  4RG8 A;  3KLG A;  5F2R A;  3AVK A;  4CD1 A;  4ISF A;  2UXD K;  4H5T A;  3DLG A;  4BR2 A;  4H5W A;  4DR3 K;  2O8C B;  3FZM A;  1HQU A;  4EHU A;  4YOT A;  5JVG L;  1FJG K;  1FXX A;  3JSM A;  4N5S A;  3SYZ A;  5C25 A;  2D0B A;  4DU3 A;  2W40 A;  3KD5 E;  3D2F A;  3MEE A;  2X78 A;  2HBM A;  2ZGZ A;  4AHS A;  3THX A;  4KH4 A;  2PY5 A;  4CJQ A;  4L8R B;  4LD0 A;  3AVB A;  5CYQ A;  3H08 A;  2KZM A;  2P5G A;  4CGI A;  5EXW A;  3PUF A;  3T69 A;  3LZI A;  4LSN A;  1K6Y A;  4CF9 A;  4LF4 K;  1JLQ A;  5BRE A;  4CJW A;  5J2P A;  5KPR A;  1X1P A;  2HHS A;  1M1K O;  3MN6 A;  1MWK A;  2UYT A;  4CES A;  4FW2 A;  1P90 A;  1RBV A;  1N34 K;  2B4J A;  2IIR A;  4CEA A;  2FBV A;  1OH5 A;  1SV5 A;  3E9L A;  5JS2 A;  4DHY A;  3H46 O;  2FSN A;  3MDQ A;  2IS3 A;  1RTD A;  1JLA A;  4AM6 A;  3MAQ A;  1HPM A;  4E7L A;  3H45 C;  3MXM A;  3QFP A;  4CW7 B;  2BE2 A;  1TUU A;  3JAM O;  3KLI A;  4YOR A;  3ULD A;  1S1W A;  1JXB A;  4ZTF A;  3OBW A;  3VET A;  3VEV A;  3N4Q A;  1JJ2 M;  2W42 A;  2E1Z A;  3M8P A;  2A40 A;  5AQY A;  1RBU A;  4CEF A;  5LMN K;  5GAH P;  2XO7 A;  3V9W A;  3O08 A;  1QVG M;  4YY3 K;  4BRC A;  1RBR A;  4JKC A;  2E2O A;  3LM9 A;  1K9M O;  3G25 A;  3C6U A;  3ITH A;  4DR7 K;  4NLB A;  1Q18 A;  3HVR A;  3QEW A;  1XNQ K;  3CYM A;  3LDN A;  4FK4 A;  2RKI A;  1EQY A;  4PKG A;  4O55 A;  4PWD A;  1QQC A;  1BU6 O;  1ZC6 A;  4A5B A;  4FLZ A;  4JD2 B;  3KLH A;  4W5Q A;  2Y1I A;  1JXE A;  2E2Q A;  1VSE A;  1IKX A;  1NNE A;  1L3U A;  3WQT A;  4RWT A;  3EKS A;  3ULE B;  3RR7 A;  3CCV N;  4IOA L;  4JEP A;  1VQO N;  3CI5 A;  4CCH A;  2WBN A;  1HYZ A;  3NDK A;  4Y1D A;  4FJK A;  1NJZ A;  1VSK A;  3OYM A;  2P9U B;  1A5W A;  1GLA G;  1KTQ A;  1UA0 A;  1KFS A;  5HRN A;  4FJ8 A;  4KB1 A;  1EXQ A;  2D0O A;  5BN8 A;  1UAX A;  1NJI O;  4KI4 A;  4JAX A;  4B9Q A;  5GAE P;  4KH6 A;  4FWQ A;  1Z6R A;  1TGO A;  4CHN A;  2O8D A;  3U4L A;  1BOT O;  1JKH A;  4ID1 A;  3KK1 A;  1U6Z A;  4JKA A;  3RMA A;  3V1Q A;  4M63 C;  3NH1 A;  1GLF O;  4YOY A;  4H0T B;  4AF1 A;  2ZQB A;  1BO5 O;  3T1Y K;  1BA0 A;  3J8A A;  5AFU H;  3AGK A;  5BRF A;  5GIO A;  3DI6 A;  2DFF A;  5FPE A;  1WNS A;  3I0S A;  5KGX A;  2VWB A;  3THW A;  1NOY A;  2JWL A;  4JKE A;  1REV A;  4ELT A;  5C42 A;  4L3Q A;  4I2P A;  2HHT A;  5ADX H;  4O4G A;  4WQ4 C;  3K0S A;  4KBO A;  1NMD A;  4B1U B;  5CR4 A;  3K5L A;  4CZE A;  1OVY A;  3LM2 A;  5AFU A;  4B9L A;  1VQ7 N;  3AAP A;  4CK1 A;  4OJR A;  3ZX2 A;  3CC7 N;  1T44 A;  2HND A;  1HYS A;  3CXC M;  4DF4 A;  3PIO L;  4GKJ K;  2P9L A;  1TAQ A;  2P9K A;  3RMC A;  3NH2 A;  3FZK A;  3I55 N;  5H1S Q;  3O1B A;  1MU2 A;  1EP4 A;  1LAV A;  4M7X A;  5HOO A;  1WBB A;  2UUA K;  3ISN C;  4M7Y A;  5C2D A;  2OCE A;  1ZBL A;  3V81 A;  2VYP A;  1XWL A;  3TPQ A;  3DMJ A;  1J54 A;  2F96 A;  4HTU A;  1HNX K;  4CJE A;  2F4V K;  4FLY A;  4U67 L;  1G99 A;  2QA4 N;  1TVR A;  2D1K A;  1NKE A;  3IMX A;  4JS5 A;  2QWQ A;  3UIQ A;  1NM1 A;  1S6P A;  2IDO A;  4PUO A;  3OS2 A;  2P9P A;  4JI2 K;  1HNV A;  4BGB A;  3IUC A;  4JLH A;  5C15 A;  1NGI A;  3AVI A;  3FZH A;  4FLT A;  1XC3 A;  4DR4 K;  3HVT A;  5AQL A;  2G8H A;  4B8C A;  4CJT A;  3QB0 A;  4ZHR A;  3SJJ A;  3AA5 X;  3S3O A;  3FFK B;  2GX9 A;  5BR8 K;  1OH8 A;  1KCF A;  1R59 O;  1NGF A;  4WYB A;  4IEI A;  4FWS A;  4CGD A;  2P9S B;  1DTQ A;  4NXN K;  3J7A P;  1S22 A;  1UWB A;  1WSG A;  3WXL A;  4JRP A;  2HNZ A;  4E1N A;  3OYJ A;  1DEJ A;  4DSI A;  3WQU A;  5M1P A;  2HVI A;  5BRD A;  1RFQ A;  1HUX A;  1MDU B;  1N36 K;  1BIS A;  3T1A A;  4CZJ A;  3DJC A;  2Z1G A;  2KZZ A;  3H3N O;  2KFN A;  2QXL A;  3KLF A;  3SUN A;  3T19 A;  4EP4 A;  3HYF A;  4OPK A;  3HZ6 A;  4QCL A;  4H0X B;  3MCA B;  3OTO K;  2O8F B;  1KXP A;  1S9G A;  3DLB A;  4M45 A;  3UKU B;  4FWM A;  3VQQ A;  1JCG A;  1BHL A;  4OPH A;  2WFB A;  4CFB A;  4IEE A;  4XIU A;  3QIN A;  3RR8 A;  3RSE B;  2F9W A;  2OPQ A;  1IV0 A;  1BDG A;  3I8B A;  4CEE A;  3ZET B;  4FM2 A;  3OY9 A;  3BY5 A;  1JLF A;  2W6K A;  3SQ4 A;  4BQL A;  3PV8 A;  4BR7 A;  3B8A X;  4PA1 A;  2BH1 A;  3DXK B;  4DV7 K;  2I7P A;  1QQM A;  3VTH A;  4FLV A;  1MWM A;  1J9A A;  4B1Y B;  5EY4 A;  3DRP A;  5C2F A;  2QK9 A;  1SUQ A;  4J2B A;  2UXB K;  4FZX C;  1NGA A;  3NFA A;  2HB5 A;  3FLC O;  4IO8 A;  5FPN A;  4CZI A;  4JN4 A;  5LY3 A;  2FLO A;  4IFE A;  4IOC L;  4HUE A;  1YJW N;  2VWJ A;  1CZB A;  3EE8 A;  3WXM B;  5JMV A;  1ZBH A;  1BI4 A;  4DSK A;  3ZSW A;  3S41 A;  5GAG P;  3LP0 A;  2ZGY A;  4NXM K;  5BPN A;  4BRD A;  4B3R K;  5M1K A;  1D9D A;  4BRI A;  2E8A A;  1YIT N;  3OHR A;  4CJU A;  2J4R A;  3TAE A;  3J81 O;  3VQ9 A;  4QAG A;  2VG6 A;  4CJ5 A;  2OYQ A;  4LF6 K;  2F8S A;  4FYD A;  4F8R A;  3UE5 A;  2G8V A;  3ALY A;  3HI0 A;  4Z4H A;  3AO1 A;  1NK0 A;  3AVG A;  3LPU A;  1Z26 A;  1QSS A;  1BUP A;  3VQA A;  2ZD1 A;  2V52 B;  1KVB A;  2F7T A;  4YOU A;  4FPB A;  5IWA K;  4DR1 K;  3CG7 A;  1KAX A;  1VSL A;  1LWC A;  3FE1 A;  4F4K A;  4HCC A;  1NGB A;  1X3M A;  1TKD A;  2IC3 A;  1C1A A;  1RDC A;  3QBW A;  4I9L A;  5CZ1 A;  4ID5 A;  2CGJ A;  3VQ7 A;  2B5J A;  3CCR N;  4N47 A;  1Q9Y A;  4FJX A;  4BY9 C;  3KHY A;  2FXU A;  3O3H A;  4YHH K;  1RT3 A;  2W41 A;  4J2E A;  1QVF M;  3DLR A;  4GW6 A;  2Q2R A;  4GKK K;  1VQK N;  1BCO A;  3NHG A;  3TI0 A;  1HMV A;  1VQ4 N;  4PKH A;  1JLB A;  1YAG A;  2YHA A;  3QEI A;  3A5O C;  3G6E N;  1Q86 O;  2D0P A;  4JI0 K;  3QLH A;  3HOT A;  4X62 K;  2VGM A;  3P1G A;  3I0R A;  4KHQ A;  4BRG A;  3EEQ A;  2BTF A;  1NJX A;  3SLC A;  5GIN A;  3NF9 A;  1HQE A;  4YDU A;  2OZM A;  3CIP A;  3M6G A;  4C1N I;  5I9E B;  1TK5 A;  1BQM A;  4CVN E;  4JKB A;  4EZ6 A;  2HF4 A;  4OX9 K;  4MO5 A;  2A3Z A;  4FLW A;  3RMD A;  1GOB A;  5DM7 L;  3ATV A;  3ZEU B;  4JHD A;  4CHY A;  3D6R A;  2AP1 A;  2YNF A;  5FPD A;  3SI6 A;  5KPZ A;  4KTW A;  2HBJ A;  1D9F A;  3LAK A;  1W9H A;  3O3G A;  1IBK K;  3PLA A;  2GEM A;  4QOZ B;  5T7B A;  1QSY A;  1KVA A;  4F9O A;  2QWP A;  3E01 A;  4JI1 K;  2GUI A;  4FO0 A;  1KD1 O;  2YJF A;  3AVM A;  2PFU A;  2ASM A;  2IOC A;  1KAY A;  2P9N B;  3QBX A;  4W5T A;  1IO2 A;  3SK3 A;  2A1R A;  2QTD A;  4M3W A;  1J5O A;  3AA3 A;  4KHS A;  5DK5 A;  4JKG B;  4CBX A;  4H0Y B;  1NU0 A;  3O4W A;  3ZSO A;  1S3X A;  3LDL A;  1NGE A;  3TAM A;  4JI6 K;  3TAR A;  1LOT B;  1W97 L;  4A57 A;  4JI7 K;  2ETJ A;  3FZL A;  1WSI A;  4OGC A;  4JKF A;  5HRO A;  3SPZ A;  3L6Q A;  4IO9 L;  2ASP A;  3C7N B;  4YOW A;  3MN5 A;  4NCB A;  3ZSY A;  3FFI A;  1S9E A;  3VEN A;  4NB4 A;  3T7Z A;  3J7Z O;  3WXJ A;  2BUP A;  3OJS A;  3AA4 A;  3KLE A;  4F2S A;  4O0J A;  1XMO K;  1Z25 A;  2IVP A;  1QSL A;  1T7P A;  1RDA A;  1S1V A;  5TKW A;  3U8X A;  3KJV A;  2WUS A;  3NF7 A;  1NGC A;  2O8E A;  4IJN A;  4KHY A;  5KRT A;  3OA9 A;  1VK0 A;  3AO3 A;  2DFE A;  1TL3 A;  3L2R A;  5AZI B;  1SKW A;  2OTL N;  1T6D A;  1E3M A;  4Z94 A;  2QWO A;  2VQE K;  3MX2 A;  4BR5 A;  4RW7 A;  1RT4 A;  3VF4 A;  2OTJ N;  2GWK A;  4BDZ A;  4BR0 A;  2HBK A;  4DFK A;  1U04 A;  5LMU K;  3O4N A;  4BE2 A;  4E7I A;  3CJC A;  1NMN A;  3ULE A;  4AHT A;  3OBY A;  5IT9 O;  3O9R A;  3J80 O;  3WXK A;  3AVJ A;  2X6N A;  2CH6 A;  1SKS A;  4FWR A;  4BRL A;  1GLD G;  3ZT4 A;  4FVU A;  3P5J A;  1BG3 A;  5AQR A;  3CJA A;  4O0I A;  2RN2 A;  3NF8 A;  4M41 A;  4CI6 A;  4MFB A;  1SZ2 A;  4RTF D;  4DV0 K;  1D8Y A;  5E26 A;  1R0A A;  1NK8 A;  3KIO A;  4ELV A;  4J8F A;  3U3Y A;  4KRF A;  5LL6 Z;  1N5Y A;  1IG9 A;  2ZWH A;  3DM2 A;  2HHQ A;  3FZF A;  1RDW X;  4WQ5 A;  4YNQ A;  4MDB A;  1T6C A;  4B1Z A;  2Z1H A;  2V51 B;  4CJ7 A;  3A5N C;  2YJE A;  1ATS A;  3C94 A;  4DR6 K;  3JXU A;  4N76 A;  3D2E B;  3SAF A;  3DOL A;  1C0G A;  2GBZ A;  3S3N A;  4B3S K;  2RE2 A;  3ZSX A;  3TTD A;  2OPS A;  1N33 K;  4B1V A;  4HUG A;  3QIP A;  5FRO A;  1OH7 A;  3V1O A;  1JL1 A;  4U7B A;  1NK6 A;  1WSH A;  1JLG A;  2HST A;  2QEX N;  4M3Y A;  3C6A A;  2PAV A;  1KRP A;  1HNI A;  4H0O A;  2ZF5 O;  1QQO A;  1WAF A;  4DG1 A;  1U2V B;  4IG0 A;  4AHV A;  1XUP O;  3H6E A;  4JKH A;  3QEV A;  2QWR A;  4A61 A;  5C0Y A;  4AHC A;  4DLE A;  5FRN A;  2FBY A;  3CCE N;  3EZ5 A;  4LFC K;  3L3U A;  3SV3 A;  3GOI A;  3V9Z A;  1HR0 K;  3PO5 A;  4BR9 A;  4CF0 A;  1ATN A;  5BPL A;  3ENB A;  2I5J A;  4PQU A;  5EX5 A;  1VRT A;  3VQB A;  2HHH K;  4DSJ A;  2YNH A;  1U49 A;  5AZJ A;  5SZT A;  4Q0B A;  4PHT X;  2BGG A;  3M8S A;  5AQK A;  5BN9 A;  2HHV A;  2VG5 A;  1LWE A;  4CER A;  4DU1 A;  3CFO A;  3WEE B;  5AQW A;  3K57 A;  3K58 A;  4JK8 A;  5BRH A;  4CHQ A;  5B8H A;  1XQS C;  1B9D A;  3KWI A;  4H03 B;  2B6A A;  3MWP A;  1WBD A;  5TKY A;  4NYN A;  3L4Q A;  4O5F A;  1RGI A;  2YKN A;  5CE3 A;  4BR4 A;  1NGH A;  3MXI A;  3WNG A;  3VEO A;  1NK5 A;  3EL2 A;  4RW4 A;  4AHU A;  4G1Q A;  5HRP A;  2E2N A;  4M42 A;  1L3V A;  3ZYY X;  5J2N A;  4RCH A;  3EYZ A;  3V9U A;  4OKJ A;  4N56 A;  4MO4 A;  5LJW A;  1X9W A;  3OS0 A;  3ID6 A;  3R8E A;  3S3M A;  4FK0 A;  3VEY A;  4DQI A;  4BVO A;  1TYQ B;  4DUZ K;  2NRR A;  3C6H A;  3AVF A;  2O4I A;  3D2F B;  4EFH A;  4FWN A;  3MN9 A;  2DFH A;  3VQ8 A;  2G8W A;  4GV6 A;  4FWP A;  3SJH A;  4KFB A;  3UKR A;  3VGL A;  3DLE A;  3LPT A;  2FF3 B;  3OYL A;  1C0F A;  3VN5 A;  3BEX A;  2YI1 A;  4ILJ A;  3WT0 A;  1Q82 O;  1QHT A;  1BWF O;  3F5T A;  2RF2 A;  2IGI A;  4FJL A;  4CHO A;  4CE9 A;  4KTZ A;  2HMP A;  2UXC K;  4O8K A;  3UKU A;  3BDP A;  2HF3 A;  2WON A;  3DXM B;  1YJN N;  3E9P A;  5HRS A;  3O80 A;  4DR5 K;  2DY4 A;  4LY7 A;  3TAQ A;  4IDH A;  1WSE A;  4CZF A;  3SMS A;  1ZXO A;  4Z4I A;  3O5B A;  3CET A;  3EZW A;  3EN9 A;  2PYJ A;  1DKG D;  4BAC A;  3LAM A;  3GDQ A;  1NG9 A;  4H0V B;  4DQR A;  1BIU A;  3PX0 A;  3BF3 A;  4GV3 A;  1SL2 A;  1JCF A;  1QZ5 A;  3WUH A;  5AQJ A;  4CJV A;  4DTO A;  4FK2 A;  4RW9 A;  1B9F A;  2NRZ A;  4DTS A;  3IRX A;  1CZ9 A;  4BRK A;  1GLJ O;  2P51 A;  3AAR A;  4FWO A;  5ELZ A;  2HBL A;  3VF2 A;  3VQC A;  4FJH A;  1K8K B;  1RTI A;  3GL1 A;  2O8B B;  1Z05 A;  2E6M A;  4CJL A;  2ITM A;  5M1Q A;  3ZX3 A;  1VQN N;  4CGG A;  5GIP A;  4KHP K;  4OLA A;  3CER A;  1KLM A;  4BVP A;  1WSJ A;  2AA4 A;  2YX6 A;  3SZ2 A;  4LF5 K;  1CLQ A;  3F2K A;  1HYV A;  2R7Y A;  3ZSZ A;  1J6Z A;  1S1X A;  4AQY K;  2NNW A;  4DTJ A;  3BZC A;  3RRH A;  3CQY A;  3DOK A;  3O8M A;  4KAZ A;  1GLL O;  3NBP A;  3KVG A;  5MLC Q;  3HPG A;  2E4L A;  3V1R A;  4B8A B;  3CQX A;  3VES A;  4HHT A;  4DCH A;  1JLE A;  2KQ2 A;  4DQS A;  1W0H A;  5CY4 A;  3C6T A;  4CEQ A;  2ZJP L;  1L5U A;  2YV0 X;  1LV5 A;  3U6F A;  4KHU A;  4LF9 K;  4CFD A;  3B6O A;  2ITG A;  4WCE L;  3QER A;  2ASO A;  1Y97 A;  5EOY A;  1QTM A;  4XH1 A;  5C12 A;  1RIL A;  3CPW M;  3CC4 N;  3F9K A;  5DMR A;  4BWM A;  3VQP A;  3KTQ A;  2QWM A;  2WC9 A;  4ICL A;  4ISG A;  3OYK A;  4O5B A;  4B3T K;  4A59 A;  1BCM A;  3LP3 A;  1CZA N;  2QKB A;  1HJR A;  1ITG A;  3TAF A;  3CC2 N;  2QW9 A;  4E7J A;  3CCL N;  4B1X B;  3HM8 A;  4BDY A;  4CBU A;  3CCQ N;  1YJ9 N;  1KLN A;  4EP5 A;  5J2Q A;  3AA2 A;  4OVL A;  3HBT A;  3THW B;  4RW8 A;  4C8L A;  4GV9 A;  3NGI A;  4KHW A;  4N41 A;  3I8D A;  1WAJ A;  4FWL A;  1HPZ A;  2I7N A;  4CK2 A;  3AV9 A;  1RT1 A;  4V19 S;  3ZEU A;  1NKC A;  4QS7 A;  4MDA A;  5AQH A;  3HPO A;  5LJV A;  1K8A O;  4E0D A;  4GVM A;  3PX4 A;  4KTQ A;  4DTM A;  2OPR A;  4BG9 A;  4ILG B;  2QWL A;  3CJ1 A;  4CBW A;  2P9L B;  3S9H A;  4KKO A;  2P9K B;  1RTJ A;  4E89 A;  2NUB A;  2XHB A;  1XC9 A;  2A42 A;  1X3N A;  4NYF A;  2YHX A;  2P9N A;  1YHQ N;  1DTT A;  3VA0 A;  3ZCM A;  4DV1 K;  4WFN L;  1SS6 A;  3NE6 A;  2ATQ A;  3VF6 A;  4FJ5 A;  1U48 A;  3AVH A;  4JI5 K;  2Q31 A;  3RWU A;  4JV5 K;  1S5J A;  3WNE A;  3KWG A;  3HOS A;  4B9S A;  2A5X A;  4IKF A;  2DTU A;  2P9I A;  3SCX A;  1NK9 A;  4EIA A;  5D3G A;  2P9P B;  3VQ4 A;  1VQ6 N;  4KV8 A;  4DFP A;  3VER A;  5AQM A;  4DS5 A;  3P39 A;  4MQ3 A;  2QI2 A;  4FSV A;  3V4I A;  3SUP A;  3W3D A;  3NGZ A;  2Q36 A;  3RTV A;  4KB0 A;  4H0P A;  4RW6 A;  2E5L K;  3VQE A;  1KFD A;  3NGY A;  3LDP A;  3F9M A;  2X6S A;  5FPM A;  1OH6 A;  2D0C A;  2WOM A;  3MX5 A;  2HHU A;  3LDQ A;  4CJR A;  4Q5V A;  4GNI A;  3PIP L;  4IDK A;  5AQI A;  3K9J A;  2ZJR L;  4CF2 A;  2GEL A;  3TAN A;  4MLE A;  4IFV A;  1XI1 A;  3THY B;  2EX3 A;  2CGK A;  5A2Q O;  2O8C A;  3SPY A;  1L3S A;  4HUF A;  3NH0 A;  4CIF A;  5J2M A;  4BC2 A;  2NRW A;  4AH9 A;  5KI6 A;  4GY2 B;  1IH7 A;  2G8F A;  2XY8 A;  3QIO A;  3LWM A;  5HL7 L;  4UQG A;  1TUY A;  1VQL N;  3AO5 A;  2HHW A;  3AAQ A;  4H5N A;  4XH4 A;  1YXQ A;  1YTA A;  2H3G X;  3L4I A;  4CF1 A;  2JLE A;  1QQN A;  3VPZ A;  4B08 A;  2F8T A;  3IS9 A;  3HRG A;  4HTL A;  3CFR A;  1XHX A;  4Y0W A;  1SKR A;  3B6P A;  3K9K A;  3O4Q A;  1VQ5 N;  3CD6 N;  3IG1 A;  3QO9 A;  4FZZ A;  3I56 N;  1S72 N;  1NGD A;  5I42 A;  2RHK A;  1VRU A;  2YHB A;  3ZX0 A;  1HKG A;  1W7A A;  4B1W B;  3CJB A;  5AQQ A;  3RVC A;  1VSJ A;  4OPJ A;  4BE1 A;  3K5M A;  3SUQ A;  3CMA N;  4Y1C A;  2YCH A;  3ZT1 A;  3C95 A;  2YNI A;  3ATU A;  5KPT A;  4BRN A;  3L2Q A;  1O13 A;  1VSF A;  2Z1I A;  3LWL A;  1TK8 A;  1NOZ A;  1N32 K;  3PY8 A;  1MA9 B;  1RTH A;  1A5V A;  3LP1 A;  4YOV A;  4JNE A;  1SAZ A;  3KK3 A;  2Z1J A;  2VGN A;  1YI2 N;  3K2P A;  1S1U A;  4M3R A;  3W0L A;  3ASM A;  2BDP A;  3MED A;  3QET A;  3F73 A;  4I6M B;  1SL0 A;  1FKO A;  1IJJ A;  4C8N A;  2IVO A;  4DQ8 A;  2HMI A;  4C8K A;  1EET A;  3OYF A;  1VHX A;  1YTU A;  4CIE A;  3CJ7 A;  4KRE A;  4DTX A;  4Z4C A;  1NJW A;  3OYH A;  4FJM A;  1JLC A;  1NK7 A;  3KKS A;  2NRV A;  2V7Y A;  1WLJ A;  3SBT A;  4CZG A;  3O1W A;  3EKU A;  1VSM A;  2UUC K;  4K41 A;  4KI6 A;  2XRI A;  5C10 A;  4BWJ A;  3OYC A;  3OYG A;  4BC4 A;  1T8E A;  1HJO A;  5C24 A;  4F2R A;  5I3U A;  3LDS A;  1ZBU A;  3VGM A;  4A5A A;  2CGL A;  4Z4E A;  3BP8 A;  4DSE A;  4CEC A;  3DAW A;  4F3T A;  3WEE A;  1WSF A;  1C1B A;  4Z4G A;  4JD2 A;  4DWI A;  1RDU A;  4CZM A;  3IKM A;  2P1J A;  3TWH A;  2QWN A;  4CGF A;  2VCP A;  1NGJ A;  3O6W A;  2VWK A;  4DU4 A;  2P5O A;  3U9Z A;  2GV9 A;  2RPI A;  3H3O B;  2F9T A;  4X64 K;  3OYE A;  1LCU A;  4Z0U A;  3CFP A;  4FJ9 A;  3BUZ B;  1C0M A;  2G8K A;  3MCP A;  5AQP A;  3R6M A;  5JLH A;  4ISE A;  3OJU A;  3M8R A;  4LF8 K;  2GWJ A;  2P9U A;  4C8M A;  4ZTJ A;  3QNN A;  2PYL A;  1ZBS A;  1IBM K;  4PY5 A;  4C1N K;  3MXJ A;  1H1V A;  3VQ5 A;  4CGJ A;  2FC0 A;  4DQP A;  5M1F A;  3HL8 A;  1RT5 A;  3MEG A;  5KRS A;  4H5R A;  4CJ3 A;  4M3Z A;  1EX4 A;  1TYQ A;  3OYI A;  4BC3 A;  3U3G A;  2EHG A;  1HX1 A;  4CHP A;  2OA8 A;  3ZT2 A;  2A6A A;  4TSX A;  3G71 N;  3EY1 A;  4JHD B;  1D5A A;  4DTR A;  1L3T A;  2NRH A;  4GVE A;  4PKI A;  3TU5 A;  4KPY A;  1WN7 A;  2KFZ A;  3KKR A;  2E20 A;  5AJ3 K;  3V6D A;  3SAG A;  3CQ8 A;  4LFA K;  4E7K A;  5CHI A;  4XEI A;  4NLC A;  1T05 A;  4E7H A;  1C6V A;  1NKB A;  3IDH A;  4UY8 O;  3HP6 A;  3DXM A;  3SQ2 A;  3J7Y P;  3LZJ A;  1I94 K;  4FJN A;  3THV A;  2D0A A;  3O9U A;  3R1X A;  3HXM A;  1QHA A;  4H4M A;  4FL9 A;  1GLC G;  5BPM A;  4AHR A;  1NGG A;  3CME N;  4W5R A;  5E84 A;  4IZ9 A;  3FR0 A;  1HKC A;  1Y64 A;  3BZK A;  1GLB G;  4CFC A;  3MMV A;  3AVA A;  4O8U A;  4B9U A;  2ZM6 K;  3DRR A;  3VEX A;  4DV5 K;  4H4O A;  5BR9 A;  1NBW A;  3A5L C;  4B9V A;  3HPH A;  1VSH A;  1TAU A;  3AO2 A;  3LDO A;  3FGU A;  2YKM A;  3VQ6 A;  4R5P A;  2QKK A;  5HLF A;  3KK7 A;  3MN7 A;  3ZT0 A;  3M5R A;  4DV4 K;  4B9N A;  3H1V X;  3HO1 A;  3AO4 A;  5KQD A;  5EU7 A;  1DGK N;  3PSF A;  5AQS A;  2JWK A;  3CPE A;  4JI4 K;  4AM7 A;  4E1M A;  1CXU A;  1RBS A;  5J1E A;  1K8K A;  2O8E B;  3TTC A;  3TR8 A;  4XH5 A;  4DV3 K;  4ELU A;  2O8B A;  1BQN A;  2XY7 A;  1LW0 A;  3QDK A;  4BE0 A;  2Q0R A;  2NRX A;  1N8R O;  1ASU A;  1IG8 A;  4W5O A;  3AY9 A;  5AQF A;  1QZ6 A;  3K5N A;  3QNO A;  3U9D A;  1WB9 A;  3GE1 A;  2FSK A;  3RMB A;  3HM9 A;  2Q3S A;  4PL7 A;  1LAW A;  4FLX A;  2GTD A;  4FM1 A;  2HVH A;  2P9S A;  3TAP A;  1RDB A;  2ZJQ L;  4JYA K;  5DM6 L;  4K42 A;  4QS8 A;  5EVZ A;  4I9Q A;  3LAN A;  3DLK A;  4CZK A;  1SQK A;  4CJ4 A;  1UOC A;  3VGK A;  3M3Z A;  4H5V A;  3OW2 M;  3MWT A;  4PL8 A;  1NK4 A;  1XMQ K;  2HHX A;  1YVU A;  1Q7Y O;  3VQD A;  3THX B;  2FSJ A;  3KK2 A;  3I33 A;  2Y1J A;  1T03 A;  4BRM A;  1X9S A;  5HP1 A;  2UUB K;  5F0X A;  4CD3 A;  4DSL A;  4DLG A;  3T3F A;  4DB3 A;  5FLX O;  5F1X A;  1RT2 A;  3L8B A;  5KQ8 A;  2FBT A;  4EHT A;  3ID8 A;  3QEP A;  4DQQ A;  3ZLJ A;  4JI3 K;  4NCA A;  2EWS A;  2O8F A;  3L0Q A;  4CJS A;  1BA1 A; 
#chains in the Genus database with same CATH homology
 5DM7 L;  3HBT A;  3G4S N;  2DPN A;  3CCM N;  3ATV A;  5KPR A;  3ZEU B;  3RSE A;  4JHD A;  4GV9 A;  3JS6 A;  3D6R A;  2AP1 A;  3ZET A;  5FPD A;  4FWL A;  5KPZ A;  2HBJ A;  1M1K O;  2FF6 A;  3MN6 A;  1MWK A;  2UYT A;  2I7N A;  2QM1 A;  3PLA A;  2GEM A;  4CZL A;  3ENH A;  1ILY A;  4F9O A;  1P90 A;  4A2A A;  3Q7B A;  3ZEU A;  2QWP A;  4YOX A;  2IIR A;  3DXK A;  2KHO A;  3E9L A;  4DHY A;  3H46 O;  4IOX A;  4FO0 A;  4MDA A;  1T3V A;  2FSN A;  3MDQ A;  4QS7 A;  2YJF A;  5AQH A;  1KD1 O;  5LJV A;  1K8A O;  4AM6 A;  3SAH A;  2PFU A;  1HPM A;  4FOI A;  2ASM A;  1Q81 O;  2P9N B;  1KAY A;  3H45 C;  3P38 A;  3QBX A;  3QFP A;  4C23 A;  3SK3 A;  2QTD A;  1TUU A;  1YF5 L;  4ILG B;  4YOR A;  2QWL A;  3CJ1 A;  4BG9 A;  2P9L B;  4CBW A;  4JKG B;  4CBX A;  2OAN A;  4H0Y B;  2P9K B;  3O4W A;  3OBW A;  3VET A;  2A42 A;  1X3N A;  3VEV A;  1S3X A;  3LDL A;  1NGE A;  2YHX A;  3VEZ A;  3N4Q A;  1JJ2 M;  2P9N A;  1LOT B;  3QIC A;  1YHQ N;  1DT9 A;  2E1Z A;  1W97 L;  2KKZ A;  4A57 A;  2A40 A;  3P31 A;  3FZL A;  4JKF A;  5AZJ B;  5AQY A;  3L6Q A;  5GAH P;  4IO9 L;  4WFN L;  4HWI A;  1SS6 A;  2ASP A;  3C7N B;  4YOW A;  3MN5 A;  3IFR A;  3O08 A;  3VF6 A;  1QVG M;  2Q31 A;  4BRC A;  4JKC A;  3VEN A;  2E2O A;  5ADX A;  3LM9 A;  3KWG A;  4NB4 A;  3T7Z A;  3HOS A;  3G25 A;  2A5X A;  1K9M O;  2GUP A;  3J7Z O;  2P9I A;  3WXJ A;  4EIA A;  1KQS M;  2BUP A;  2P9P B;  4NLB A;  1VQ6 N;  1Q18 A;  4LC9 B;  1V4T A;  4FPA A;  3LDN A;  1EQY A;  4PKG A;  3VER A;  5AQM A;  3P39 A;  2IVP A;  2QI2 A;  1BU6 O;  4FSV A;  4BRP A;  5TKW A;  1ZC6 A;  4A5B A;  3U8X A;  4JD2 B;  3W3D A;  3CF5 L;  1P8Z A;  2WUS A;  1NGC A;  2Q36 A;  4IJN A;  2E2Q A;  4H0P A;  2HOE A;  2A41 A;  3OA9 A;  5AZI B;  3LDP A;  3F9M A;  1T6D A;  5FPM A;  3WQT A;  4Z94 A;  2QWO A;  4YDU C;  4RWT A;  2OTL N;  5AQZ A;  3MX2 A;  4BRA A;  3EKS A;  3ULE B;  3CCV N;  4BR5 A;  4IOA L;  4JEP A;  1VQO N;  3CI5 A;  3MX5 A;  3DWL A;  3LDQ A;  3VF4 A;  2OTJ N;  2GWK A;  1YIJ N;  2WBN A;  1E4G T;  1HKB A;  4BR0 A;  4GNI A;  3PIP L;  2HBK A;  3CJC A;  4BG8 A;  5AQI A;  3K9J A;  3ULE A;  3A0I X;  3OBY A;  2ZJR L;  2GEL A;  3E66 A;  3O9R A;  3VEW A;  2P9U B;  1JCE A;  4MLE A;  3WXK A;  1W2B M;  4MLH A;  2CGK A;  2CH6 A;  1GLA G;  4FWR A;  4G9Z A;  4BRL A;  1GLD G;  4FVU A;  1BG3 A;  2D0O A;  5AQR A;  5BN8 A;  1NJI O;  3CJA A;  4JAX A;  4B9Q A;  4BRE A;  4CI6 A;  5GAE P;  3H1Q A;  2NLX A;  4KH6 A;  1SZ2 A;  4RTF D;  3UKR B;  4BC2 A;  4BRO A;  4FWQ A;  2NRW A;  1Z6R A;  5E26 A;  1VQ8 N;  4GY2 B;  4J8F A;  3U4L A;  1BOT O;  1KC8 O;  2CH5 A;  3TTF A;  4WF9 L;  2ZWH A;  1ATR A;  1NWK A;  5HL7 L;  1OKJ A;  1TUY A;  3FZF A;  1VQL N;  1U6Z A;  4JKA A;  1RDW X;  1WOQ A;  3TSU A;  4M63 C;  3AAQ A;  4WQ5 A;  1GLF O;  4H5N A;  4MDB A;  4XH4 A;  4YOY A;  1YXQ A;  1GLE G;  1T6C A;  4B1Z A;  5JLF A;  1EO1 A;  2H3G X;  4H0T B;  4IXC A;  4AF1 A;  2V51 B;  3L4I A;  3A5N C;  2YJE A;  3C0B A;  1ATS A;  4CJ7 A;  1BO5 O;  3JXU A;  1BA0 A;  1QQN A;  3D2E B;  3E1Y A;  3J8A A;  3VPZ A;  3SAF A;  1C0G A;  3HRG A;  2NZT A;  4FOE A;  4HTL A;  1HLU A;  5AFU H;  3ENO A;  3AGK A;  4Y0W A;  5BRF A;  2RE2 A;  5GIO A;  3TTD A;  4KH5 A;  5FPE A;  4B1V A;  3NVK A;  3K9K A;  1VQ5 N;  2VWB A;  3CD6 N;  4U7B A;  3I56 N;  4BRF A;  1NGD A;  1S72 N;  2V7Z A;  2JWL A;  2HST A;  2RHK A;  4JKE A;  4R79 A;  3ZX0 A;  1HKG A;  2QEX N;  3BF1 A;  1KAZ A;  3C6A A;  2PAV A;  4L3Q A;  3CJB A;  4B1W B;  3UB5 A;  5AQQ A;  3RVC A;  5AQT A;  5AQU A;  5ADX H;  4WQ4 C;  4H0O A;  4KBO A;  3TSP A;  3CMA N;  1NMD A;  2YCH A;  4B1U B;  5CR4 A;  3O9Q A;  2ZF5 O;  1QQO A;  3ATU A;  1U2V B;  4BRN A;  4CZE A;  5KPT A;  1XUP O;  3AGR A;  3H6E A;  4WFA L;  4JKH A;  3CCJ N;  1OVY A;  3LM2 A;  3VMF B;  2QWR A;  5AFU A;  1O13 A;  4A61 A;  3AAP A;  1VQ7 N;  5C0Y A;  4A2B A;  3ZX2 A;  3CC7 N;  1D4X A;  1T44 A;  3CXC M;  1MA9 B;  3CCE N;  4YOV A;  3EE9 A;  4JNE A;  1SAZ A;  3PIO L;  2VGN A;  3R3L A;  2P9L A;  3HTV A;  3GOI A;  4JKG A;  1YI2 N;  2P9K A;  3W0L A;  3FZK A;  4JK9 A;  5H1S Q;  3I55 N;  3O1B A;  5AR0 A;  3VTI A;  4BR9 A;  4I6M B;  3M1F A;  1IJJ A;  1ATN A;  4DQ8 A;  2IVO A;  3ENB A;  4M7X A;  5BPL A;  5HOO A;  4M7Y A;  5EX5 A;  4EAH D;  3CJ7 A;  3CCU N;  5C2D A;  5AZJ A;  4K25 A;  1K73 O;  4WQ4 A;  2VYP A;  3TPQ A;  4PHT X;  3C7N A;  4DKW A;  1VQ9 N;  2NRV A;  4I6M A;  2V7Y A;  5AQK A;  5BN9 A;  3SBT A;  4CZG A;  3O1W A;  4U67 L;  3GG4 A;  3EKU A;  1G99 A;  2QA4 N;  2D1K A;  5M1O A;  4OPA A;  3IMX A;  2E1Y A;  4BRH A;  3WEE B;  5AQW A;  4K41 A;  1VQM N;  2QWQ A;  1VQP N;  1NM1 A;  3GBT A;  4JK8 A;  5C10 A;  5BRH A;  5B8H A;  1XQS C;  2P9P A;  3KWI A;  4BC4 A;  4H03 B;  4BGB A;  4JKD A;  1HJO A;  3IUC A;  3E9O A;  3MWP A;  5C15 A;  1NGI A;  3FZH A;  5TKY A;  3VGM A;  4A5A A;  1XC3 A;  2CGL A;  3CHW A;  3BP8 A;  3L4Q A;  4O5F A;  3NVM A;  1RGI A;  3DAW A;  5AQL A;  3O9T A;  3QB0 A;  5CE3 A;  3WEE A;  4BR4 A;  3O9S A;  3FFK B;  1NGH A;  1NLV A;  2GX9 A;  4JD2 A;  2YHY A;  3QFU A;  3VEO A;  1R59 O;  3EL2 A;  1RDU A;  1NGF A;  4WYB A;  3VOV A;  3IKM A;  4IEI A;  4CZM A;  2QWN A;  4FWS A;  2P9S B;  4BC5 A;  2VCP A;  1NGJ A;  3O6W A;  4WQ5 C;  2IVN A;  2E2N A;  5AZI A;  3U9Z A;  3ZYY X;  3H3O B;  1S22 A;  4RCH A;  2F9T A;  5AQG A;  5AQO A;  4MO4 A;  4OO1 J;  1ESV A;  4K43 A;  3WXL A;  1LCU A;  5LJW A;  4BGA A;  4NO7 A;  3BUZ B;  3ID6 A;  1DEJ A;  3R8E A;  3CCS N;  3DLL L;  3WQU A;  5M1P A;  3VEY A;  3MCP A;  5AQP A;  3R6M A;  4BVO A;  5BRD A;  5JLH A;  1RFQ A;  4QS9 A;  1HUX A;  4ISE A;  1TYQ B;  1MDU B;  2GWJ A;  2P9U A;  4CZJ A;  2NRR A;  3C6H A;  3D2F B;  4EFH A;  1ZBS A;  3DJC A;  4FWN A;  4C1N K;  1H1V A;  3MK6 A;  3MN9 A;  3H3N O;  4GV6 A;  2QXL A;  5M1F A;  4FWP A;  3SJH A;  4H5R A;  3UKR A;  3VGL A;  1TYQ A;  3HSC A;  3HZ6 A;  1YUW A;  4A62 A;  4H0X B;  4BC3 A;  4E1J A;  2FF3 B;  3MCA B;  1C0F A;  3N4P A;  1KXP A;  1HX1 A;  3BEX A;  2YI1 A;  4ILJ A;  1V4S A;  4FWM A;  3UKU B;  1JCG A;  4WFB L;  4BQZ A;  2D4W A;  4OPH A;  4CZH A;  2WFB A;  2E88 A;  2A6A A;  4JK7 A;  3WT0 A;  1Q82 O;  4IEE A;  3G71 N;  1BWF O;  3F5T A;  3RSE B;  4JHD B;  3SMP A;  2PBD A;  2F9W A;  1BDG A;  3I8B A;  2NRT A;  3D2E A;  2HMP A;  3ZET B;  2NRH A;  4GVE A;  4PKI A;  3TU5 A;  5JIC A;  4O8K A;  3UKU A;  3D7E O;  3A5M C;  2HF3 A;  4BQL A;  4BR7 A;  3B8A X;  2E20 A;  2BH1 A;  3DXM B;  3C65 A;  3E9P A;  1YJN N;  3SAG A;  3O80 A;  3DXK B;  4IWV A;  3LL3 A;  3EO3 A;  5CHI A;  4IDH A;  2I7P A;  4XEI A;  4CZF A;  1QQM A;  4NLC A;  3SMS A;  1ZXO A;  3VTH A;  1MWM A;  3O5B A;  4B1Y B;  3CET A;  3EZW A;  5EY4 A;  3EN9 A;  4ILH A;  1DKG D;  2Q0U A;  3IDH A;  3GDQ A;  5C2F A;  4UY8 O;  3DXM A;  3O9U A;  3R1X A;  4H0V B;  3BF3 A;  1NGA A;  1QHA A;  4GV3 A;  3FLC O;  4IO8 A;  1JCF A;  1QZ5 A;  4FL9 A;  3WUH A;  1GLC G;  4BRQ A;  5AQJ A;  1U2V A;  5BPM A;  5FPN A;  4CZI A;  4JN4 A;  1NGG A;  5LY3 A;  2FLO A;  3CME N;  4IFE A;  5E84 A;  4IZ9 A;  4IOC L;  2NRZ A;  3FR0 A;  1YJW N;  3SBG A;  1HKC A;  1Y64 A;  3EE8 A;  3WXM B;  3TSQ A;  3Q7C A;  5JMV A;  1GLB G;  3MMV A;  4O8U A;  3A8Y A;  3S41 A;  5GAG P;  2ZGY A;  4FWK A;  5BPN A;  4BRD A;  5M1K A;  4BRI A;  1E4F T;  2E8A A;  1GLJ O;  3AAR A;  3OHR A;  4BRK A;  5JVH L;  1YIT N;  5AQV A;  3VEX A;  2J4R A;  5M1N A;  4FWO A;  5BR9 A;  1NBW A;  3A5L C;  5ELZ A;  4IJA A;  3KZB A;  2HBL A;  2YHW A;  3WXI A;  3VF2 A;  3LDO A;  3FGU A;  3R9P A;  1K8K B;  2P9I B;  3UE5 A;  2Q97 A;  3KK7 A;  3GL1 A;  3MN7 A;  1Z05 A;  3M5R A;  3HI0 A;  5AQX A;  1VAZ A;  3H1V X;  3P4I A;  5M1Q A;  2ITM A;  5KQD A;  5GAD P;  3ZX3 A;  1VQN N;  1M90 O;  1DGK N;  5GIP A;  2KLA A;  1BUP A;  5AQS A;  2JWK A;  3CPE A;  1WUA A;  3CER A;  4AM7 A;  4BVP A;  2V52 B;  2AA4 A;  2F7T A;  2YX6 A;  4FPB A;  4YOU A;  1K8K A;  1KAX A;  1YVN A;  3FE1 A;  3TTC A;  1NGB A;  1X3M A;  4XH5 A;  3F2K A;  3QBW A;  1X9J A;  3QDK A;  2Q0R A;  2CGJ A;  3CJ9 A;  3QML A;  2NRX A;  1J6Z A;  3CCR N;  1N8R O;  1IG8 A;  3AY9 A;  5AQF A;  2NNW A;  1QZ6 A;  3U9D A;  4BY9 C;  3KHY A;  3GE1 A;  2FXU A;  2FSK A;  5AQN A;  3CQY A;  4PL7 A;  2E2P A;  2W41 A;  3O8M A;  3NMU A;  2Q1N A;  1GLL O;  2GTD A;  1QVF M;  2Q2R A;  1VQK N;  5F2R A;  2P9S A;  3KVG A;  4CD1 A;  5MLC Q;  4ISF A;  2ZJQ L;  4H5T A;  5DM6 L;  1VQ4 N;  3CQX A;  4H5W A;  4K42 A;  4QS8 A;  5EVZ A;  4BR2 A;  3FZM A;  4EHU A;  4PKH A;  3VES A;  4CZK A;  4DCH A;  1SQK A;  1YAG A;  4YOT A;  3A5O C;  3VGK A;  3G6E N;  5JVG L;  1Q86 O;  2D0P A;  3M3Z A;  4H5V A;  3HOT A;  2ZJP L;  3MWT A;  3OW2 M;  4PL8 A;  2VGM A;  1Q7Y O;  2FSJ A;  4WCE L;  2ASO A;  3I33 A;  5EOY A;  2W40 A;  4BRG A;  4XH1 A;  5C12 A;  2BTF A;  3D2F A;  3SLC A;  4BRM A;  3CPW M;  3CC4 N;  5F0X A;  4CD3 A;  4DB3 A;  5GIN A;  2QWM A;  2WC9 A;  4ISG A;  2HBM A;  2ZGZ A;  4YDU A;  3CIP A;  4A59 A;  3M6G A;  4C1N I;  5F1X A;  5KQ8 A;  4KH4 A;  4EHT A;  1CZA N;  3ID8 A;  5I9E B;  3CC2 N;  2QW9 A;  3CCL N;  4B1X B;  4JKB A;  2HF4 A;  3HM8 A;  2EWS A;  4CBU A;  4MO5 A;  3L0Q A;  3CCQ N;  5EXW A;  2A3Z A;  1YJ9 N;  3T69 A;  1BA1 A;  5BRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...