3ALYA

Crystal structure of rnase hi from sulfolobus tokodaii with c-terminal deletion
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
MIIGYFDGLCEPKNPGGIATFGFVIYLDNRKIEGYGLAEKPFSINSTNNVAEYSGLICLMETMLRLGISSPIIKGDSQLVIKQMNGEYKVKAKRIIPLYEKAIELKKKLNATLIWVPREENKEADRLSRVAYELVRRGKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST0753
publication title Stabilization by fusion to the C-terminus of hyperthermophile Sulfolobus tokodaii RNase HI: a possibility of protein stabilization tag
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13456 RVT_3 Reverse transcriptase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3alyA00
4R5PA 4CGJA 3V9XA 4O4GA 3OYNA 3EY1A 4FJJA 3LAKA 4QOZB 4CGHA 1VSDA 3AVMA 3K5OA 3QLHA 1RT7A 5KGXA 4FLZA 1NK9A 3EZ5A 4KHNA 3F9KA 3HL8A 3TAFA 4CJKA 1RCHA 1TK0A 3ZT3A 3NF8A 4CJRA 4CJSA 3DRPA 4FJIA 2O4GA 2VWKA 1T7PA 4KO0A 4CK3A 4AHUA 1TAQA 2HVHA 4H8KA 4BE2A 4IFYA 4DTUA 1TK5A 4F8RA 4F2RA 3NF6A 1HQEA 1TKTA 1SKWA 1TAUA 2IDOA 3BDPA 3PUFA 5HROA 1L3VA 3C6TA 3C94A 2AJQA 1HJRA 3K57A 5FROA 4DSEA 3P83D 2OA8A 1QQCA 4HCCA 2YNGA 3AVKA 1BGXT 3P1GA 1J54A 4O44A 4CJLA 3OY9A 4KI6A 2HHWA 3IS9A 1LWCA 2VG5A 3VQ8A 2IC3A 3JSMA 3C95A 4IDKA 3LPTA 4JLHA 1ZBFA 3NF7A 5C24A 1SL2A 3QETA 3O4NA 4M3TA 2Z1GA 3NBPA 1NK6A 4FJMA 1WSHA 4FK2A 1S1XA 1JLEA 1RT1A 1NKCA 3HP9A 1F21A 2DFEA 4L8RB 4HUFA 2HHTA 4FLYA 3SQ1A 1ASUA 1NOZA 3U6FA 2IS3A 3LWMA 4JRQA 4YNQA 2HVIA 3LZIA 2EHGA 1HYSA 1QSYA 3SYZA 4BACA 2XRIA 4FJKA 1X9MA 2B5JA 5J2MA 3VQBA 3KLEA 4CCHA 5CZ1A 3WNFA 1D8YA 2D0BA 5HP1A 2QKBA 3QEIA 1QTMA 3U3GA 3LPUA 4DQPA 3OYCA 4M45A 1LW0A 4DSKA 2D0CA 1S1WA 3D45A 3QO9A 5J2NA 4E19A 1U47A 4LY7A 3CFRA 4I9QA 3S3OA 4RW4A 4DWIA 1RBVA 1BHLA 1WSGA 3DI6A 1C1BA 5HRSA 1DTQA 3C6UA 4IG0A 4FM2A 4AHCA 3V81A 1IG9A 4M3YA 1XWLA 1NK8A 1NKEA 2OPRA 2FBYA 5HRNA 4DFKA 1G15A 4HCBA 3LP3A 4DQQA 1KSPA 4C8LA 2FBTA 3RTVA 3ZSRA 4CFDA 4KPYA 1VSLA 3S3NA 5DMRA 1EP4A 5T7BA 4FM1A 3SCXA 4NCBA 5FRMA 2G8KA 1SL1A 1ZBHA 1B92A 2NUBA 4ID5A 1KLNA 1SKSA 1LWFA 4DMNA 1RILA 4LSLA 4DF4A 5HLFA 3H08A 3I0RA 4CJEA 4HHTA 3B6PA 2QXFA 2QKKA 4KAZA 3QNNA 3THVA 1BI4A 2B6AA 3VQAA 3V9SA 3M8PA 1T03A 4CHQA 4CEZA 1L3TA 2X6SA 4CERA 3NE6A 4BDZA 4BE0A 1BI4B 4M41A 2G8VA 1RBSA 4CK1A 1VSEA 2F96A 3EYZA 4HVJA 4DU1A 4Y1DA 2OYQA 4CFCA 4BWMA 1CXQA 1BQNA 2O4IA 1NJYA 3KLFA 4DSIA 4HTUA 3VQCA 3AVHA 4CIFA 4CGDA 1T05A 2R7YA 4ELVA 4ID1A 1CZBA 1S1TA 2HB5A 5HRRA 2XY7A 4N76A 2YNFA 4K8ZA 4RW9A 4J2AA 3WNHA 2KFZA 1NJWA 4C8MA 3ZSZA 1TK8A 4B9VA 3RMAA 2KZZA 3KLHA 4FW1A 3DRRA 3CQ8A 2BGGA 2X6NA 2ZE2A 1S6QA 3VQ7A 4QCLA 3AA5X 5KGWA 3TAQA 1HYZA 5CY4A 3O4QA 4FW2A 1JLQA 2FC0A 1RTJA 4PA1A 3CM5A 5FDLA 3OYDA 2VWJA 3OS0A 4AHSA 1TKZA 4O55A 3HYFA 1RDCA 3HP6A 3MECA 3DLKA 2ITGA 2VG7A 4J2EA 2E6MA 4Z4HA 3RMDA 1RBUA 5CYMA 2G8WA 5DK5A 3TARA 2JGUA 4CJUA 2D0AA 4M3XA 3DYAA 3OYIA 1U49A 4PQUA 3SUQA 4DS5A 3NH1A 3NF9A 4Z0UA 4E3SA 3NH2A 1U48A 3VQ9A 4AH9A 3T3FA 1TV6A 1XI1A 1FK9A 3RRGA 4B9LA 3HM9A 3V9UA 3CM6A 4FLUA 4CJQA 4E7HA 3HO1A 4CEDA 1VK0A 1WSEA 1A5XA 1BQMA 1HMVA 1GOAA 3LAMA 1KCFA 4KTWA 3V1OA 4E7LA 3U3YA 2HHQA 3M8SA 1D9FA 2BDPA 4EZ9A 4OLAA 3NCIA 2Z1HA 3ASMA 3I0SA 1GOCA 4CJFA 3MAQA 1SL0A 2I5JA 1HYVA 1VSMA 2YHBA 4CEQA 1WAJA 1A5VA 4CEEA 2G8HA 1R0AA 4KTZA 3L2QA 4FJHA 4KREA 3K59A 3DLRA 2ATQA 2JLEA 3O3FA 3PX4A 4W5RA 3AO2A 4WE1A 4EZ6A 2KTQA 1B9FA 3DLEA 3ZSOA 2PZSA 1HPZA 3KKRA 4B9NA 4F2SA 2RPIA 2HHVA 4E7KA 4ICLA 1KFDA 1VSHA 4KHQA 1JLAA 1Z25A 3IG1A 3LP2A 4O0JA 3DLBA 4M3RA 4DSFA 3L8BA 3G0ZA 1GOBA 3KLIA 5SZTA 2G8UA 1JLCA 3HK2A 3V1QA 1QSSA 1TKXA 4GMJB 4W5TA 2LSNA 5HBMA 1RDAA 1RT6A 3NHGA 1Q9XA 4J2BA 4Z4IA 2QK9A 4PY5A 1KTQA 1KVBA 4KHYA 4OPKA 1ZBLA 2F8TA 3DOKA 4B08A 4GW6A 4NCGA 4EP4A 1WN7A 4QAGA 3OJSA 4EP5A 1VSKA 3DLGA 3VQDA 1EXQA 4YFUA 4FZYA 4K8XA 1FKOA 1JL1A 3ZSVA 3CYMA 4FVMA 4CF0A 4LH4A 4PUOA 3AVGA 4C8KA 3AA2A 1REVA 2OZMA 2YKMA 4M3UA 3M8QA 1Q9YA 4CFAA 2F8SA 4FJXA 1JKHA 4CHPA 4HUEA 3TWHA 3MEGA 4DTXA 1UOCA 1VSJA 2E4LA 4IBNA 4AHTA 1X9WA 1NKBA 4FXDA 3L3VA 4E1MA 3OYLA 4MFBA 3RMBA 2G8FA 3OYKA 4F3TA 3RMCA 3I8DA 1RT3A 2HNZA 3ZT4A 4B9MA 1ZYQA 2XY8A 5HRPA 5J2PA 1YVUA 3LDSA 4IKFA 4DSJA 1KFSA 1C0TA 1QHTA 1IKVA 4CJ5A 3VA0A 3SPYA 3KD1E 3B6OA 4AHVA 4OVLA 1C1AA 4KFBA 4FJ7A 3PV8A 4DLEA 2Q3SA 1LW2A 4H4OA 4N41A 4DQRA 1O1WA 4FZZA 1K6YA 3SUOA 3V9WA 1ASVA 1LAVA 4BDYA 3S3MA 5C42A 4E0DA 3PX6A 1EETA 3QIOA 4CEAA 3O3GA 3OYJA 2XO7A 3L2RA 4CF8A 2XY6A 3QEXA 1NK5A 3P5JA 1U04A 2WONA 2HHXA 1EX4A 4MQ3A 3LWLA 4H4MA 4Z4GA 4IFVA 3OYAA 2RF2A 4C8OA 1NJXA 4BWJA 2WOMA 3HPHA 1LAWA 4KB0A 3RRHA 5FRNA 4DF8A 1SUQA 1JXBA 1TGOA 4Z4CA 3HVTA 4CEBA 4FLXA 4DS4A 3CFOA 2RKIA 1NOYA 2P5GA 4O0IA 3QESA 4CEFA 4FCYA 5J1EA 4OPJA 3D0PA 3SUPA 3TAPA 2YNHA 3MEDA 3AV9A 1RNHA 4NCAA 4KKOA 4E1NA 3QEVA 3T1AA 1SKRA 3NFAA 1KRPA 3AVFA 2HNYA 3OJUA 1ASWA 1Z26A 4I9LA 3LANA 4LD0A 1S9EA 1S6PA 2KQ2A 2IGIA 3G10A 3F73A 3MXMA 4KHSA 1JXEA 3KJVA 3QIPA 3AO5A 4BE1A 3ZSWA 4W5NA 4DFJA 3HJFA 1RDDA 3VN5A 3OYEA 2DFFA 2YV0X 5EU7A 3TAGA 1IO2A 4FJ9A 2Y1IA 4CF1A 1LWEA 1TKDA 1S9GA 3IRXA 4TSXA 1IKWA 4FJ5A 3V4IA 3AO1A 1BCOA 3QERA 2YNIA 3VQ4A 4JS4A 2HHSA 3IAYA 3MXJA 1DTTA 1S1UA 1XHXA 4OGEA 3O3HA 3WNGA 4B8CA 3KK2A 3ZT0A 2BE2A 1JLGA 2DY4A 5C25A 4CJTA 1UA0A 4M3ZA 2ETJA 2ZD1A 4IG3A 3LP1A 3ZSXA 3QEWA 2FBXA 1U4BA 4B9UA 3OVNA 1SV5A 2ZQBA 4OKEA 1W0HA 5CZ2A 3ZCMA 4CESA 1RBTA 4UQGA 3L2UA 3TI0A 4BDPA 4E7IA 4KRFA 3SI6A 2KZMA 1J5OA 1NJZA 4CJ3A 2HW3A 3TR8A 3AVNA 3SV3A 2RN2A 4FJGA 3T19A 2HMIA 4FLWA 4FJNA 1TL1A 4FZXC 3L3UA 1CLQA 1VRUA 2OPSA 4CHZA 3RR8A 3VQEA 1TVRA 1ZBIA 4NYFA 4CGIA 4CJVA 3S9HA 4NYNA 2PYLA 1X9SA 1WLJA 2HHUA 3PO5A 4DSLA 3AA4A 3ULDA 4FM0A 4FJ8A 2B4JA 4DFPA 1L5UA 3BGRA 3KIOA 4DTOA 2OPQA 5KRTA 1HNVA 5E41A 3OYMA 3HXMA 3OYGA 3KTQA 3ZSYA 4Q0BA 3ZSQA 1YTAA 3HT3A 2PYJA 4I2PA 4M42A 3NGIA 3E01A 1NK4A 2P51A 4FLVA 3PO4A 4B8AB 4B9TA 3AVJA 4CHYA 3NGZA 1A5WA 1BCMA 1RDBA 3VQPA 2YKNA 2OPPA 3ZT1A 4DTRA 4N47A 4FJLA 3DOLA 2KFNA 5JS2A 4KTQA 1WNSA 3VA3A 3OS2A 3HVRA 4DTSA 3AO3A 4Y1CA 2GBZA 1VSIA 4OGCA 2P5OA 1KLMA 4RW6A 3PY8A 5I42A 1RT4A 1RTIA 1S5JA 3AVBA 5K14A 1XHZA 1W9HA 3VQQA 4C8NA 2PY5A 3KK3A 1N6QA 1N5YA 2X74A 4JRPA 4B3OA 1UWBA 4FK4A 5KRSA 3SZ2A 4CEOA 4I7FA 2XY5A 3KKSA 4N5SA 4CECA 2P1JA 1UAXA 1IKYA 5D3GA 1LV5A 3WNEA 1RBRA 4CF2A 3K58A 1BL3A 1BISA 4FLTA 4DTPA 4DFMA 1D9DA 5J2QA 3KD5E 4LH5A 3AVIA 3DM2A 4FK0A 3DMJA 4KHUA 2A1SA 4DLGA 2A1RA 1RT5A 3V1RA 3SNNA 3LZJA 3PX0A 4GVMA 4XIUA 4J2DA 1JL2A 1I39A 2OZSA 1QSLA 1Y97A 4CGGA 1C0MA 2IAJA 1L3SA 4DQSA 3SPZA 4ELTA 3K5NA 2D5RA 1BIUA 4CE9A 3JYTA 3NAEA 4LSNA 1DLOA 4CGFA 3SQ2A 3SUNA 3OYFA 2X78A 4KI4A 1JLBA 2E6LA 3CFPA 1WSFA 4I2QA 1QE1A 1J53A 3HSTB 1KVAA 3NGYA 4CIGA 1RT2A 3OS1A 3L2VA 3QEPA 5I3UA 4Z4FA 3TAMA 3ISNC 4N56A 4CFBA 1C0UA 3DRSA 3NDKA 4M3WA 4JS5A 4CHNA 1X1PA 1RTDA 4ZTFA 1IH7A 2YHAA 1HQUA 4DTMA 4Q5VA 3SQ0A 4F3OA 4KV8A 4B9SA 4OLBA 4F4KA 4Z4EA 1CZ9A 3AO4A 3M8RA 3QNOA 1RTHA 1S1VA 5SWMA 2W42A 4DU3A 4E89A 2GV9A 2Y1JA 1HNIA 1ZBUA 3MXIA 4OKKA 4ZTJA 5JS1A 3AVLA 4RW7A 2BANA 3TABA 1QS4A 2Z1IA 1B9DA 1J9AA 4AHRA 4ELUA 2Z1JA 4G1QA 4W5OA 3LP0A 2XHBA 2DFHA 4OKJA 3OYHA 3TAEA 3VQ5A 4KB1A 1UA1A 1D5AA 4DG1A 1VSFA 2FBVA 4DTJA 1WAFA 1C6VA 4DQIA 3RWUA 2IOCA 2DTUA 3KK1A 4CHOA 4AILC 1C1CA 3HPGA 3L2WA 3KLGA 3SJJA 1NK7A 2G8IA 3AA3A 3CG7A 2GUIA 2KW4A 4CK2A 1WSJA 3SV4A 1T8EA 3MEEA 4O5BA 3K5LA 3ZT2A 3ITHA 3V9ZA 1EKEA 1MU2A 2EX3A 1YTUA 4FYDA 1NK0A 4CIEA 4HUGA 4KHWA 1I3AA 1BIZA 3OYBA 3AVAA 1TL3A 1FXXA 4CJPA 1IKXA 4CF9A 3K2PA 3A2FA 3QINA 1YT3A 3FFIA 4CJWA 4OJRA 3V6DA 1XC9A 4PWDA 5CYQA 2VG6A 3LALA 1ITGA 1VRTA 4CJ4A 4RG8A 5KTQA 4DU4A 4DTNA 3DLHA 1FKPA 3VQ6A 1L3UA 3UIQA 1WSIA 1U45A 3TANA 1KVCA 3RR7A 4RW8A 3ALYA 1JLFA 2HNDA 3SQ4A 3K5MA 4ZHRA 3NH0A 4E7JA 1HRHA 1Q8IA 3HPOA 3AVCA 5KI6A 1CXUA 4W5QA
chains in the Genus database with same CATH superfamily
2Q0RA 3EY1A 3MWTA 4E1JA 4DR1K 3AVMA 3K5OA 1K73O 3KK7A 5GADP 1QQMA 5AFUA 4CK3A 1HNXK 3G71N 3NF6A 2QWMA 4BC4A 4BVPA 2IDOA 2QI2A 2BTFA 3L4IA 5AQOA 3C94A 2AJQA 3J81O 3K57A 4JI2K 5FROA 2P9NB 3NVMA 2YNGA 3AVKA 4CJLA 5F2RA 3OY9A 4IJAA 1LCUA 3VQ8A 2IC3A 1HJOA 3N4QA 1ZBFA 4AM7A 1J5EK 4K41A 4M3TA 1HUXA 1NK6A 3VETA 4BC5A 3DAWA 1JLEA 3FLCO 4HUFA 2HHTA 4FLYA 3SQ1A 1NOZA 3U6FA 3J7ZO 3BEXA 3E9OA 3TTDA 4LC9B 3AARA 4Z94A 3QEIA 3LPUA 3MWPA 4M45A 3P4IA 1S1WA 1NM1A 2OANA 3MN9A 2O8FB 3S3OA 4DWIA 4GKKK 5AQVA 4BRCA 3C6UA 2W6KA 2GWJA 4ILHA 4AHCA 3V81A 1NK8A 5MLCQ 2OPRA 2FBYA 3M5RA 4DFKA 4Y0WA 4HCBA 3QFUA 3LP3A 4RWTA 4DQQA 4KH5A 2V7ZA 3RTVA 4CBUA 4NB4A 3ZSRA 3HOSA 4KPYA 3QMLA 4JNEA 5DMRA 3SCXA 2G8KA 2P9SA 1ZBHA 4CZHA 2NUBA 3O9UA 4DMNA 4LSLA 1S72N 4QS7A 3H08A 4BRFA 1IBLK 3EZWA 1BI4A 3DLLL 3IMXA 4CERA 3NE6A 4BDZA 1WBDA 2UUCK 4KH4A 1VSEA 4DV6K 3EYZA 4HVJA 4Y1DA 1CXQA 1BQNA 5AZJB 3KLFA 4DSIA 2HBJA 2E1ZA 2F9TA 1MWKA 3AVHA 2R7YA 1Q81O 4FVUA 1EQYA 3E1YA 3KLHA 3DRRA 3FZKA 3AA5X 5KGWA 2Q1NA 4EHUA 2V51B 1JLQA 1HKCA 4O55A 1RDCA 1GLJO 4JK7A 3PIPL 2JGUA 4DR4K 4CBWA 3PLAA 4CZEA 1NGJA 3ZEUB 3T3FA 5E26A 3DJCA 3RRGA 4JEPA 1KQSM 3HM9A 3SLCA 3SAHA 1OVQA 4H5VA 4CEDA 4DUYK 1WSEA 1A5XA 4BRIA 2FSKA 2HHQA 1GOAA 4DKWA 3QFPA 4BY9C 2I5JA 1HYVA 5AZIA 1WAJA 4CEEA 4KTZA 3L2QA 4FJHA 3K59A 2I7NA 3MK6A 2KTQA 3AO2A 2YHXA 1GLAG 1B9FA 2PZSA 1HPZA 3KKRA 4E7KA 3CPEA 5FPDA 1JLAA 4O0JA 3DLBA 4DSFA 1VQ7N 3A5OC 1BUPA 3G0ZA 1JLCA 3V1QA 1TKXA 4W5TA 4H03B 3CC4N 1RDAA 3C6AA 4J2BA 4KHYA 3M3ZA 4OPKA 5M1OA 4EP4A 1WN7A 5JMVA 5F1XA 1VSKA 2PBDA 1SQKA 4OPHA 4I6MB 1XNRK 4LH4A 3T1YK 3AGRA 3AVGA 1I94K 1E3MA 5AQRA 3U4LA 4M3UA 5M1KA 4CFAA 3CCMN 5GINA 4BRPA 4CHPA 2E4LA 4IBNA 1X9WA 3C0BA 3IKMA 1Z05A 3P39A 2HNZA 1MWMA 2XY8A 1N33K 4IKFA 4DSJA 4JI3K 3GDQA 1C0TA 1Q18A 3KD1E 3SPYA 2ZM6K 4IXCA 4EHTA 1YAGA 1K8AO 4AHVA 4OVLA 2E2QA 3O9QA 4DV1K 1O1WA 5LL6Z 2GX9A 4U7BA 4H0YB 1EETA 1SS6A 5EXWA 4CF8A 1NK5A 3ZX2A 2GELA 5AZJA 3LWLA 4Z4GA 3OYAA 3SK3A 3BF3A 1GLCG 4C8OA 3SBTA 4BGAA 1NGAA 2Q31A 4CEBA 3C7NB 3CFOA 2RKIA 2HBKA 2O8BA 4O0IA 4FCYA 3D2EB 3JS6A 3DXMB 3SUPA 3MEDA 4X64K 4NCAA 4KKOA 4A61A 4FOEA 1ZBSA 1WUAA 5M1NA 4LD0A 1S9EA 1S6PA 4CZKA 3HOTA 2IGIA 3G10A 3F73A 1EWQA 4IZ9A 3AO5A 4BE1A 3ZSWA 1IO2A 1ILYA 1TKDA 1LWEA 3IRXA 3ZEUA 4AQYK 4JS4A 2D0PA 2PFUA 1HR0K 3MXJA 4H0VB 3WNGA 4B8CA 3I33A 4PKHA 5C25A 2ETJA 4B9UA 4IG3A 3LP1A 2FBXA 3L2UA 4KRFA 1RBTA 4FWQA 2HW3A 5JLFA 3AVNA 3ZETB 3VEWA 4FJNA 1VRUA 1VQ8N 4XEIA 3WXIA 1VQLN 3H45C 3RR8A 3THXB 2WC9A 4NYNA 5AQXA 3PO5A 2NLXA 3WEEB 4FJ8A 4FM0A 2B4JA 3TU5A 1YF5L 2OPQA 5KRTA 4Q0BA 1XC3A 4IJNA 4I2PA 5HOOA 4HTLA 5FPNA 4MDBA 3NGIA 4CHYA 1A5WA 2OPPA 3B8AX 3AY9A 3DOLA 3MMVA 5JS2A 3I56N 2ASOA 5IWAK 2GBZA 1VSIA 2FSJA 4B1WB 5K14A 2Q36A 1N5YA 2X74A 4B3OA 4X66K 5KRSA 4OO1J 3BZCA 5AQYA 1UAXA 4YOYA 5D3GA 1LV5A 4CF2A 1BL3A 4DFMA 4LH5A 3P38A 4KHUA 4CW7B 2A1RA 5AQGA 2OZSA 3HM8A 4FWOA 2NRWA 3SPZA 1E4FT 2D5RA 2D4WA 3JYTA 1SZ2A 3NAEA 2HF4A 3CQXA 4LSNA 3SUNA 3CCVN 2X78A 5BN9A 4KI4A 2ZF5O 1WSFA 4I2QA 3CFPA 1KVAA 3NGYA 3QEPA 5I3UA 3L2VA 4GV9A 2E2PA 3ISNC 3NDKA 1BOTO 4JS5A 4CHNA 1X1PA 1HQUA 3SQ0A 3C7NA 4KV8A 1NGBA 4Z4EA 1RTHA 3RVCA 3D2EA 4CZMA 4E89A 4DU3A 1HNIA 3MXIA 4ZTJA 4RW7A 3TABA 4BRKA 4PKIA 1UA1A 1VSFA 2FBVA 2IOCA 1OKJA 3SAFA 3L2WA 3KLGA 1NK7A 2G8IA 2QM1A 3EL2A 1GLLO 4CK2A 1T8EA 3H3NO 3MEEA 3O4WA 3F5TA 3ZT2A 5I9EB 2O8CB 1NK0A 1VQMN 3OHRA 3VOVA 1TL3A 4CJPA 4CF9A 4LFAK 2CH5A 4OJRA 4PWDA 2IVOA 1VRTA 4YHHK 5KTQA 3DLHA 3C6HA 1L3UA 1U45A 4H5NA 3ALYA 2HNDA 4B1ZA 1V4SA 3SMPA 3ZETA 4E7JA 1NGHA 3AVCA 2QA4N 1ATNA 2YHWA 4CGJA 4R5PA 5AQHA 3V9XA 1ZXOA 4O4GA 3OYNA 1YITN 3WEEA 5KGXA 3QLHA 3EZ5A 1N34K 1X9JA 2E2OA 2ZJQL 3MX2A 3WXKA 1BA1A 4CJKA 3ZT3A 1Q7YO 4CJRA 4CZGA 5C2FA 2YX6A 2VWKA 5C15A 1T7PA 4AHUA 3EE9A 4H8KA 4X62K 4DTUA 4F8RA 4F2RA 4JI5K 1HQEA 3BDPA 5BRFA 4QS9A 4DSEA 1JJ2M 5CHIA 3P83D 2RE2A 3P1GA 4O44A 5AFUH 3IS9A 4WFAL 2VG5A 3C95A 4JLHA 3CIPA 5EOYA 4A62A 5C24A 3O4NA 1GLFO 3NBPA 4FJMA 1WSHA 4WYBA 2KLAA 1NKCA 1RT1A 3CCJN 1F21A 4OPAA 1ASUA 2P9KB 1GLEG 4FPBA 4BACA 2XRIA 2B5JA 5J2MA 5CZ1A 4FL9A 2QKBA 3U3GA 5EY4A 4DSKA 3CCRN 4IEEA 3P31A 3U8XA 1U47A 3BZKA 1RBVA 1BHLA 1WSGA 5DM7L 4X65K 4FWLA 1LOTB 4A5AA 3ULEB 4CFDA 1VSLA 5E84A 4BRDA 1KAZA 1EP4A 5T7BA 4FM1A 3VEOA 4YY3K 5FRMA 3DWLA 4ID5A 1SKSA 5EX5A 1RILA 5EVZA 4DF4A 3I0RA 3A8YA 4CJEA 1N8RO 2QKKA 4B3RK 1T03A 3M8PA 4FWMA 4GV3A 1BI4B 1RBSA 2F96A 2P9UB 2OYQA 2O4IA 2O8CA 2YI1A 2GWKA 4CIFA 4CGDA 2P9LB 2UXBK 1CZBA 4N76A 3WXMB 4BRLA 2XY7A 2YNFA 4H5TA 4RW9A 1IV0A 4DV0K 2KFZA 2NRVA 1OH8A 2KZZA 3RMAA 4FW1A 2BGGA 1FJGK 1OH6A 3TAQA 1HYZA 2A40A 3O4QA 1RTJA 5FDLA 3I55N 3GE1A 3OS0A 2O8EB 1C0FA 3HYFA 2OCEA 2YJFA 2ITGA 3RMDA 3VEYA 1RBUA 3O6WA 3TARA 5LJWA 1ZC6A 4CJUA 2FXUA 1U49A 1XUPO 4YOUA 3SUQA 3NH1A 4Z0UA 4E3SA 4IEIA 4C23A 1U48A 3VQ9A 2WBNA 5GIOA 4WF9L 3V9UA 3CM6A 3CJBA 1KCFA 3V1OA 1D9FA 4OLAA 3MX5A 1SL0A 3HI0A 3S41A 4XH5A 3CXCM 4CEQA 4A59A 1A5VA 2E20A 1R0AA 2FF3B 4BROA 5AZIB 3O3FA 3BF1A 4W5RA 3DLEA 3ZSOA 4CZJA 5AQMA 4KHQA 1Z25A 5AQTA 4M3RA 4DR3K 4JKGB 4LF9K 3W3DA 4EIAA 1QSSA 2P9KA 4GMJB 3NHGA 1WOQA 2QK9A 1KTQA 4FWRA 1ZBLA 2F8TA 3OJSA 4BRHA 4EP5A 3DLGA 3HBTA 4K8XA 4JI1K 1FKOA 3ZSVA 3CYMA 4BGBA 4CF0A 2DPNA 4PUOA 1E4GT 3AA2A 4BG9A 3M8QA 4BRGA 4FJXA 3PIOL 4NLBA 3O9SA 4FXDA 4AHTA 4J8FA 3L3VA 1OVYA 3RMBA 3OYKA 2G8FA 3CD6N 3RMCA 1JCFA 4FWPA 3ZT4A 3ULEA 3LDSA 4ILGB 3U9DA 1KFSA 3VA0A 3GOIA 1GLDG 3VEZA 3CMEN 1MA9B 3B6OA 4DR5K 1C1AA 4FJ7A 2A6AA 4DLEA 1BWFO 4DQRA 4LFCK 4DR2K 1DGKN 4FZZA 1K6YA 3SUOA 3V9WA 1ASVA 4DQ8A 3DXKA 4BDYA 3QDKA 3QIOA 3O3GA 3W0LA 1D4XA 1T6DA 3QEXA 4BRNA 1U04A 2P9UA 2HHXA 3TSQA 4H4MA 2RF2A 3QB0A 4A5BA 3QBWA 3E9LA 3HPHA 4KB0A 2P9LA 4DF8A 1TGOA 4Z4CA 3HVTA 4FLXA 4DS4A 1NGGA 3CCEN 1FW6A 5J1EA 4OPJA 3O80A 1S3XA 3D0PA 2O8BB 1RNHA 1SAZA 1ASWA 1Z26A 2O8EA 3LANA 4JKCA 1YIJN 4KHSA 1JXEA 1NBWA 4IO9L 3QIPA 4W5NA 3VN5A 3TAGA 1YXQA 4FJ9A 2Y1IA 4A2BA 1S9GA 3AO1A 1BCOA 2YNIA 4WQ4A 2YHYA 1VQKN 5KQ8A 1DTTA 1S1UA 4LF6K 3ZT0A 1BA0A 4WFNL 2BE2A 2HF3A 4CJTA 4M3ZA 1VQON 4OX9K 1U4BA 3QEWA 4OKEA 3ZCMA 1W0HA 1W7AA 4CESA 4BDPA 1P90A 3WXLA 3SI6A 4FJGA 1HKBA 3T19A 3E66A 4FO0A 1CLQA 4CHZA 3VQEA 4CJVA 3S9HA 3UKUA 3R1XA 3ULDA 4DFPA 2OTJN 3SBGA 4JKGA 5E41A 4FSVA 4NXMK 3ZSYA 3THWA 5AJ3K 2QEXN 3AAPA 3HT3A 4B1UB 4B9QA 4M42A 3E01A 2P51A 4FLVA 4B8AB 2NRXA 3ENBA 1BCMA 2A42A 3VQPA 5AQUA 4FJLA 4N47A 4KTQA 3VA3A 4GV6A 3PSFA 4Y1CA 1KLMA 3VF4A 1RTIA 3VF2A 3VQQA 1N6QA 4IDHA 3KHYA 4BR0A 4FK4A 4I7FA 4N5SA 3O08A 4DCHA 4JK9A 4BR5A 1RBRA 3K58A 2F4VK 4BQLA 3O9RA 4DR6K 3KD5E 1K8KA 4FK0A 3DMJA 4DLGA 1RT5A 4NO7A 4PL8A 4GVMA 4XIUA 2VYPA 4CGGA 1YVNA 4R79A 3K5NA 1BIUA 1DLOA 2JWKA 3VGKA 3HSTB 4CIGA 1RT2A 1JCGA 4Z4FA 3TAMA 3VEXA 3CC2N 1C0UA 3DRSA 5LMUK 1RTDA 2WTUA 4ZTFA 2NRTA 2YHAA 3OBWA 4Q5VA 3JAMO 4F3OA 2W40A 4DV7K 5BN8A 3QNOA 3AO4A 1T3VA 2W42A 3OW2M 3VESA 1BDGA 2BANA 3UKRA 1J9AA 1YUWA 4AHRA 4ELUA 4G1QA 3LP0A 4MLEA 3TSPA 3OYHA 3TAEA 1HNWK 2GUPA 1D5AA 2ASMA 4DB3A 1WAFA 3RWUA 2DTUA 3KK1A 2UYTA 4CHOA 3HTVA 2W41A 1O13A 2KW4A 1DKGD 2VQEK 1YTUA 1EKEA 1MU2A 2EX3A 3ID8A 4KHWA 1I3AA 3OYBA 3AVAA 4B1XB 3T7ZA 3A2FA 1YT3A 3FFIA 5TKWA 4CJ4A 1ITGA 4RG8A 4DTNA 3UIQA 1WSIA 5F0XA 3CCUN 3RR7A 3VF6A 1JLFA 4ISFA 5AQNA 4IOCL 3HPOA 5KI6A 1CXUA 4W5QA 5KPZA 2HBLA 2NRHA 3HSCA 4QOZB 3F9KA 1TK0A 3ZX0A 3VTIA 4CJSA 1BU6O 4IOAL 3DRPA 3L6QA 3EE8A 2O4GA 4KO0A 2A5XA 1NLVA 1TAQA 2HVHA 4BE2A 4IFYA 1TK5A 1TKTA 1SKWA 3H46O 1VHXA 3PUFA 1L3VA 2HOEA 1HJRA 1QVGM 3FE1A 1QQCA 4KI6A 1BGXT 4GNIA 1NGIA 3LL3A 4NXNK 4IDKA 3O5BA 1QQNA 1SL2A 3QETA 3RSEB 2Q2RA 3WT0A 5C10A 3EN9A 3CF5L 3HP9A 3AGKA 2DFEA 5AQIA 4PKGA 4B3TK 1HNZK 4YNQA 2HVIA 3LZIA 4FJKA 2Q0UA 1VAZA 1DT9A 3LDOA 1X9MA 3VQBA 3KLEA 3WNFA 1D8YA 2D0BA 5HP1A 1QTMA 4DQPA 3OYCA 5HL7L 2D0CA 3D45A 3QO9A 2WFBA 4LY7A 4I9QA 3ID6A 4RW4A 1YJNN 4V19S 1NGDA 3DI6A 5HRSA 4IG0A 1YJWN 4FM2A 1IG9A 1XWLA 4LF5K 1NKEA 5HRNA 1G15A 1KSPA 4C8LA 2FBTA 5GAGP 3U9ZA 1IJJA 2NRRA 4NCBA 3L0QA 1SL1A 2D1KA 4CBXA 1KLNA 1KAXA 5HLFA 3B6PA 2QXFA 3ENOA 3QNNA 3THVA 5LJVA 4KBOA 3LDLA 3EKSA 4CHQA 4CEZA 1L3TA 2X6SA 4M41A 4YOVA 4DU1A 4BWMA 4ISGA 3ATVA 4GVEA 3UB5A 1H1VA 4BR7A 3VQCA 1HX1A 1T05A 4ID1A 5HRRA 4JV5K 2VGNA 3CJCA 1S22A 1NJWA 4C8MA 3ZSZA 1TK8A 1YI2N 4B9VA 3CQ8A 2X6NA 3J80O 3VQ7A 4JI0K 1VQ6N 5CY4A 4FW2A 4PL7A 1M90O 2FC0A 2VWJA 3CCQN 1HLUA 4O5FA 3DLKA 4BRMA 2VG7A 4J2EA 2E6MA 4Z4HA 2G8WA 5DK5A 2A41A 1QZ6A 2D0AA 4M3XA 3DYAA 3VERA 3ZYYX 4JKEA 1FK9A 2GEMA 3GBTA 1NGFA 4FLUA 4E7HA 4JD2B 4JKDA 1VK0A 3WQTA 1BQMA 1HMVA 3LAMA 4KTWA 2BDPA 4EZ9A 3CQYA 3NCIA 1C0GA 1OH7A 1VSMA 4JAXA 2G8HA 4KREA 3G25A 3MCAB 3PX4A 1XNQK 2KKZA 4WE1A 4EZ6A 5LY3A 4F2SA 2ZJPL 3RSEA 2RPIA 2UXCK 4ICLA 3MN5A 3LP2A 2QTDA 1KXPA 4CZLA 3L8BA 3LDNA 2CH6A 4QS8A 2LSNA 5HBMA 1RT6A 4Z4IA 4PY5A 3DOKA 4BQZA 3LM2A 1EXQA 1QQOA 4YFUA 1ATSA 4FZYA 3G6EN 1Z6RA 1Y64A 4C8KA 3R9PA 3A5LC 1REVA 3FFKB 2YKMA 2OZMA 1J6ZA 4KH6A 3TWHA 4K42A 1UOCA 3R8EA 4MFBA 3MN7A 4F3TA 4ILJA 4B1YB 3A5NC 5HRPA 5J2PA 3BY5A 4CZIA 1IKVA 4KFBA 3R3LA 2NRZA 2Q3SA 1LW2A 4H4OA 5FPEA 4N41A 2GTDA 1LAVA 3S3MA 4LF8K 4CEAA 3OYJA 3L2RA 4CD3A 2XY6A 3P5JA 3DXKB 4BVOA 2WONA 4JI4K 3FGUA 2QXLA 3WUHA 4IFVA 3KWIA 4BWJA 5BR8K 5FRNA 1JXBA 4NLCA 1NWKA 1QHAA 1NOYA 3VTHA 5AQZA 2P5GA 2E2NA 3TAPA 2YNHA 4B3MK 1XQSC 3AV9A 4JHDB 4E1NA 5BPMA 3QEVA 4BREA 3NFAA 2HNYA 4I9LA 1TYQA 2KQ2A 3CETA 3KJVA 1WB9A 1P8ZA 4O8UA 4DFJA 3QBXA 4LF7K 3HJFA 3OYEA 2DFFA 2I7PA 5H1SQ 3SMSA 4CF1A 3VMFB 2HMPA 5ELZA 1KAYA 5BPLA 4OGEA 4C1NK 3O3HA 3KK2A 3BUZB 4JD2A 1UA0A 4FWKA 3OVNA 5CZ2A 4UQGA 2OTLN 4E7IA 2KZMA 1IBKK 4CJ3A 3TR8A 4JI7K 2RN2A 3THYB 2HMIA 4AF1A 4FZXC 2OPSA 1TVRA 1ZBIA 3MCPA 4BC2A 2HHUA 1X9SA 4JI8K 1IG8A 5M1FA 3UKUB 1OH5A 4EAHD 2ASPA 1HNVA 5KPRA 4KHPK 3OYMA 2V7YA 3HXMA 2E5LK 3OYGA 3KTQA 2Q97A 4BRQA 3ZSQA 1YTAA 3NVKA 5A2QO 4WCEL 5LMNK 3THWB 3PO4A 4B9TA 3AVJA 3NGZA 1RDBA 2E8AA 4DTRA 5JICA 3OBYA 1WNSA 4DTSA 3AO3A 3N4PA 1XMQK 2P5OA 1RDWX 4RW6A 3PY8A 5I42A 1S5JA 5FPMA 3A0IX 3J7YP 2PY5A 4JRPA 4FPAA 3SZ2A 3EO3A 2P9IB 4K43A 2P1JA 1IKYA 3WNEA 2ZGZA 3D2FA 4DTPA 2BUPA 4JN4A 1D9DA 2A3ZA 3AVIA 3VEVA 2A1SA 3LZJA 4J2DA 1K8KB 1VQPN 1JL2A 1I39A 4LFBK 4BG8A 1Y97A 2IAJA 4DQSA 4ELTA 4CE9A 1MDUB 2QWNA 3SQ2A 1VQNN 4AM6A 3OYFA 1JLBA 2E6LA 1J53A 3OS1A 2CGKA 3TPQA 4BC3A 2IVPA 1IH7A 3KZBA 4B9SA 1CZ9A 3M8RA 3SJHA 5B8HA 3O1BA 3FZHA 5JS1A 3ZLJA 2GV9A 1ZBUA 4OKKA 4JHDA 4DR7K 1QS4A 2Z1IA 1NJIO 1B9DA 4W5OA 3ENHA 3UKRB 2XHBA 1YHQN 1NGCA 1NMDA 3H1QA 4OKJA 3MN6A 3IFRA 4DG1A 5AR0A 1C1CA 3LDQA 4M7YA 3AA3A 3SV4A 1WSJA 4O5BA 3K5LA 3ITHA 4XH4A 4HUGA 1BIZA 3QINA 4DV3K 4B3SK 4CJWA 3V6DA 1XC9A 2QWQA 2VG6A 4DU4A 3C65A 1RGIA 3TANA 4RW8A 1N36K 2ZWHA 4A2AA 3K5MA 4ZHRA 3NH0A 1HRHA 3THYA 1NG9A 1Q86O 2QW9A 5AQSA 4FJJA 3LAKA 4CGHA 1VSDA 4FLZA 1RT7A 1NK9A 1V4TA 4KHNA 3CERA 3HL8A 3TAFA 1RCHA 3NF8A 3FZFA 1VQ5N 1T44A 3K0SA 1ESVA 4FJIA 3OTOK 4DV2K 3Q7CA 1M1KO 3CHWA 4JKHA 3QICA 5BRDA 1TAUA 3D7EO 5C12A 2P9NA 5HROA 1T6CA 3C6TA 4YORA 5ADXH 2OA8A 4HCCA 2NZTA 2QWLA 1J54A 2HHWA 1LWCA 3JSMA 3LPTA 3NF7A 3L4QA 2CGLA 4CD1A 2HBMA 2Z1GA 4K25A 2P9IA 5BPNA 2AA4A 4FK2A 1S1XA 4BR9A 1IBMK 4L8RB 2P9PB 4WFBL 2IS3A 1NMNA 3LWMA 4JRQA 4EFHA 2EHGA 1HYSA 1QSYA 3E9PA 3SYZA 4CCHA 2BH1A 3D6RA 1EWRA 5AQFA 4WQ4C 1LW0A 2O8FA 5JVGL 2QWPA 2ZGYA 4PHTX 5J2NA 4E19A 4H5WA 3F2KA 4H5RA 5C2DA 3CFRA 1RDUA 3TSUA 1C1BA 1DTQA 4M3YA 2O8DB 3H1VX 3GL1A 5GAEP 1HKGA 4B1VA 3S3NA 3CPWM 4YOTA 1NGEA 1B92A 3WXJA 4UY8O 1LWFA 5M1PA 3FZLA 3O1WA 3J8AA 4JKBA 3FZMA 4HHTA 4KAZA 1NNEA 2B6AA 3VQAA 3V9SA 2IIRA 4ISEA 4BE0A 2G8VA 4CK1A 4CFCA 1NJYA 4HTUA 4GY2B 3TTFA 3HRGA 3FR0A 4ELVA 1S1TA 2HB5A 4K8ZA 5AQKA 2ZJRL 4J2AA 3WNHA 5BREA 4L3QA 4U67L 3BP8A 2ZE2A 1S6QA 4QCLA 3H3OB 3CCSN 3OYDA 4PA1A 3CM5A 4AHSA 1TKZA 5AQJA 3HP6A 3MECA 2ITMA 3IDHA 4YDUA 2FLOA 5CYMA 4CVNE 3G4SN 3OYIA 4PQUA 4DS5A 3NF9A 3NH2A 4AH9A 3ATUA 5ADXA 1TV6A 4CJ7A 1XI1A 1KD1O 2IVNA 4B9LA 4WQ5A 4CJQA 3HO1A 4M7XA 4E7LA 3U3YA 3M8SA 3R6MA 3K9JA 2Z1HA 3ASMA 3I0SA 1GOCA 3WQUA 4CJFA 3MAQA 2YHBA 4C1NI 2FSNA 4F9OA 4GKJK 3PSIA 1KC8O 3DLRA 2ATQA 2JLEA 3VENA 2UU9K 3VGLA 4B9NA 1G99A 5BRHA 2EWSA 3VGMA 2HHVA 3LM9A 1KFDA 1VSHA 5AQWA 3IG1A 3T1HK 1W2BM 3EKUA 2FF6A 1HPMA 3KLIA 1GOBA 2P9PA 5SZTA 4RTFD 2G8UA 2HHHK 3HK2A 1Q9XA 4DV4K 3M6GA 4HWIA 3GG4A 1KVBA 4H0XB 5KPTA 4BR4A 4I6MA 4B08A 4GW6A 4NCGA 4QAGA 2D0OA 1EO1A 3VQDA 1JL1A 4FVMA 1QVFM 4IWVA 1VQ4N 4JKFA 1Q9YA 2F8SA 1JKHA 4HUEA 3CCLN 5C0YA 2AP1A 3MEGA 4DTXA 2O8DA 2YJEA 1VSJA 5CE3A 1NKBA 3KVGA 4E1MA 3OYLA 2HSTA 1WBBA 3I8DA 1RT3A 4B9MA 2WUSA 4YDUC 1CZAN 1ZYQA 1YVUA 2W6LA 4M63C 2RHKA 1QHTA 3LDPA 4CJ5A 5M1QA 4IFEA 1VQ9N 3CI5A 1X3MA 3KWGA 3PV8A 3H6EA 4FOIA 5AQQA 1U2VB 3UE5A 3M1FA 3EEQA 4H0TB 4WQ5C 1NU0A 5C42A 4CI6A 4E0DA 3PX6A 5JLHA 1TUUA 2XO7A 1TUYA 1Q82O 1EX4A 4JKAA 4MQ3A 5JVHL 2E1YA 4MDAA 1NJXA 2WOMA 4XH1A 1LAWA 3RRHA 2UXDK 1SUQA 5TKYA 2NNWA 3DXMA 3AAQA 3QESA 2KHOA 4CEFA 2V52B 1XMOK 4LF4K 2VCPA 4CZFA 3T1AA 1SKRA 1KRPA 3AVFA 3A5MC 3OJUA 3O9TA 1R59O 3CJ7A 2CGJA 3MXMA 1TYQB 3IUCA 3ZX3A 1RDDA 2YV0X 5EU7A 4DHYA 1ATRA 4TSXA 1IKWA 4FJ5A 3V4IA 3QERA 3VQ4A 2HHSA 2J4RA 3IAYA 1XHXA 1JLGA 2DY4A 4IOXA 2ZD1A 3HZ6A 3ZSXA 5AQPA 1RFQA 1SV5A 2ZQBA 3TI0A 1J5OA 1NJZA 3CC7N 3SV3A 3THXA 3I8BA 4FLWA 1TL1A 3L3UA 4NYFA 3VPZA 5GAHP 4CGIA 2PYLA 1WLJA 2E88A 4DSLA 2QWOA 3AA4A 4FWNA 3O8MA 1L5UA 4DV5K 3BGRA 3KIOA 4DTOA 3CJ1A 4H0PA 4G9ZA 4BRAA 2PYJA 4FWSA 1JCEA 1NK4A 5GIPA 2VGMA 4MO4A 2UUBK 4RCHA 1U6ZA 2YKNA 3ZT1A 2KFNA 3OS2A 3HVRA 1W97L 4OGCA 1RT4A 3AVBA 1XHZA 3SAGA 1W9HA 4C8NA 3KK3A 1K9MO 2VWBA 1UWBA 4YOWA 4YOXA 4CEOA 2XY5A 3KKSA 4MLHA 4CECA 1YJ9N 2JWLA 4H0OA 3F9MA 1BISA 4FLTA 3NMUA 5J2QA 3DM2A 3D2FB 5CR4A 4K0KK 3V1RA 3SNNA 1U2VA 4BR2A 3PX0A 3OA9A 1QSLA 1C0MA 1BO5O 1L3SA 4JI6K 2VQFK 2YCHA 4CGFA 5BR9A 5AQLA 1QE1A 1GLBG 2F7TA 4N56A 2H3GX 4CFBA 4M3WA 4DTMA 4MO5A 3J7AP 4DUZK 4OLBA 3K9KA 3MDQA 4F4KA 1S1VA 5SWMA 2Y1JA 2F9WA 3AVLA 1DEJA 2P9SB 2Z1JA 2DFHA 5IT9O 3VQ5A 4KB1A 3CJ9A 4DTJA 4DQIA 1QZ5A 1C6VA 4AILC 3HPGA 3SJJA 3CG7A 2GUIA 4IO8A 4JK8A 2QWRA 3V9ZA 1N32K 3CMAN 3JXUA 4FYDA 4CIEA 5FLXO 5KQDA 2UUAK 1FXXA 1IKXA 3K2PA 5DM6L 3Q7BA 3CJAA 5CYQA 3LALA 4A57A 1FKPA 4O8KA 3VQ6A 3T69A 1KVCA 1BG3A 1X3NA 3SQ4A 3TTCA 1Q8IA 4JYAK 2PAVA
chains in the Genus database with same CATH topology
4R5PA 4CGJA 3V9XA 4O4GA 3OYNA 3EY1A 4FJJA 3LAKA 4QOZB 4CGHA 1VSDA 3AVMA 3K5OA 3QLHA 1RT7A 5KGXA 4FLZA 1NK9A 3EZ5A 4KHNA 3F9KA 3HL8A 3TAFA 4CJKA 1RCHA 1TK0A 3ZT3A 3NF8A 4CJRA 4CJSA 3DRPA 4FJIA 2O4GA 2VWKA 1T7PA 4KO0A 4CK3A 4AHUA 1TAQA 2HVHA 4H8KA 4BE2A 4IFYA 4DTUA 1TK5A 4F8RA 4F2RA 3NF6A 1HQEA 1TKTA 1SKWA 1TAUA 2IDOA 3BDPA 3PUFA 5HROA 1L3VA 3C6TA 3C94A 2AJQA 1HJRA 3K57A 5FROA 4DSEA 3P83D 2OA8A 1QQCA 4HCCA 2YNGA 3AVKA 1BGXT 3P1GA 1J54A 4O44A 4CJLA 3OY9A 4KI6A 2HHWA 3IS9A 1LWCA 2VG5A 3VQ8A 2IC3A 3JSMA 3C95A 4IDKA 3LPTA 4JLHA 1ZBFA 3NF7A 5C24A 1SL2A 3QETA 3O4NA 4M3TA 2Z1GA 3NBPA 1NK6A 4FJMA 1WSHA 4FK2A 1S1XA 1JLEA 1RT1A 1NKCA 3HP9A 1F21A 2DFEA 4L8RB 4HUFA 2HHTA 4FLYA 3SQ1A 1ASUA 1NOZA 3U6FA 2IS3A 3LWMA 4JRQA 4YNQA 2HVIA 3LZIA 2EHGA 1HYSA 1QSYA 3SYZA 4BACA 2XRIA 4FJKA 1X9MA 2B5JA 5J2MA 3VQBA 3KLEA 4CCHA 5CZ1A 3WNFA 1D8YA 2D0BA 5HP1A 2QKBA 3QEIA 1QTMA 3U3GA 3LPUA 4DQPA 3OYCA 4M45A 1LW0A 4DSKA 2D0CA 1S1WA 3D45A 3QO9A 5J2NA 4E19A 1U47A 4LY7A 3CFRA 4I9QA 3S3OA 4RW4A 4DWIA 1RBVA 1BHLA 1WSGA 3DI6A 1C1BA 5HRSA 1DTQA 3C6UA 4IG0A 4FM2A 4AHCA 3V81A 1IG9A 4M3YA 1XWLA 1NK8A 1NKEA 2OPRA 2FBYA 5HRNA 4DFKA 1G15A 4HCBA 3LP3A 4DQQA 1KSPA 4C8LA 2FBTA 3RTVA 3ZSRA 4CFDA 4KPYA 1VSLA 3S3NA 5DMRA 1EP4A 5T7BA 4FM1A 3SCXA 4NCBA 5FRMA 2G8KA 1SL1A 1ZBHA 1B92A 2NUBA 4ID5A 1KLNA 1SKSA 1LWFA 4DMNA 1RILA 4LSLA 4DF4A 5HLFA 3H08A 3I0RA 4CJEA 4HHTA 3B6PA 2QXFA 2QKKA 4KAZA 3QNNA 3THVA 1BI4A 2B6AA 3VQAA 3V9SA 3M8PA 1T03A 4CHQA 4CEZA 1L3TA 2X6SA 4CERA 3NE6A 4BDZA 4BE0A 1BI4B 4M41A 2G8VA 1RBSA 4CK1A 1VSEA 2F96A 3EYZA 4HVJA 4DU1A 4Y1DA 2OYQA 4CFCA 4BWMA 1CXQA 1BQNA 2O4IA 1NJYA 3KLFA 4DSIA 4HTUA 3VQCA 3AVHA 4CIFA 4CGDA 1T05A 2R7YA 4ELVA 4ID1A 1CZBA 1S1TA 2HB5A 5HRRA 2XY7A 4N76A 2YNFA 4K8ZA 4RW9A 4J2AA 3WNHA 2KFZA 1NJWA 4C8MA 3ZSZA 1TK8A 4B9VA 3RMAA 2KZZA 3KLHA 4FW1A 3DRRA 3CQ8A 2BGGA 2X6NA 2ZE2A 1S6QA 3VQ7A 4QCLA 3AA5X 5KGWA 3TAQA 1HYZA 5CY4A 3O4QA 4FW2A 1JLQA 2FC0A 1RTJA 4PA1A 3CM5A 5FDLA 3OYDA 2VWJA 3OS0A 4AHSA 1TKZA 4O55A 3HYFA 1RDCA 3HP6A 3MECA 3DLKA 2ITGA 2VG7A 4J2EA 2E6MA 4Z4HA 3RMDA 1RBUA 5CYMA 2G8WA 5DK5A 3TARA 2JGUA 4CJUA 2D0AA 4M3XA 3DYAA 3OYIA 1U49A 4PQUA 3SUQA 4DS5A 3NH1A 3NF9A 4Z0UA 4E3SA 3NH2A 1U48A 3VQ9A 4AH9A 3T3FA 1TV6A 1XI1A 1FK9A 3RRGA 4B9LA 3HM9A 3V9UA 3CM6A 4FLUA 4CJQA 4E7HA 3HO1A 4CEDA 1VK0A 1WSEA 1A5XA 1BQMA 1HMVA 1GOAA 3LAMA 1KCFA 4KTWA 3V1OA 4E7LA 3U3YA 2HHQA 3M8SA 1D9FA 2BDPA 4EZ9A 4OLAA 3NCIA 2Z1HA 3ASMA 3I0SA 1GOCA 4CJFA 3MAQA 1SL0A 2I5JA 1HYVA 1VSMA 2YHBA 4CEQA 1WAJA 1A5VA 4CEEA 2G8HA 1R0AA 4KTZA 3L2QA 4FJHA 4KREA 3K59A 3DLRA 2ATQA 2JLEA 3O3FA 3PX4A 4W5RA 3AO2A 4WE1A 4EZ6A 2KTQA 1B9FA 3DLEA 3ZSOA 2PZSA 1HPZA 3KKRA 4B9NA 4F2SA 2RPIA 2HHVA 4E7KA 4ICLA 1KFDA 1VSHA 4KHQA 1JLAA 1Z25A 3IG1A 3LP2A 4O0JA 3DLBA 4M3RA 4DSFA 3L8BA 3G0ZA 1GOBA 3KLIA 5SZTA 2G8UA 1JLCA 3HK2A 3V1QA 1QSSA 1TKXA 4GMJB 4W5TA 2LSNA 5HBMA 1RDAA 1RT6A 3NHGA 1Q9XA 4J2BA 4Z4IA 2QK9A 4PY5A 1KTQA 1KVBA 4KHYA 4OPKA 1ZBLA 2F8TA 3DOKA 4B08A 4GW6A 4NCGA 4EP4A 1WN7A 4QAGA 3OJSA 4EP5A 1VSKA 3DLGA 3VQDA 1EXQA 4YFUA 4FZYA 4K8XA 1FKOA 1JL1A 3ZSVA 3CYMA 4FVMA 4CF0A 4LH4A 4PUOA 3AVGA 4C8KA 3AA2A 1REVA 2OZMA 2YKMA 4M3UA 3M8QA 1Q9YA 4CFAA 2F8SA 4FJXA 1JKHA 4CHPA 4HUEA 3TWHA 3MEGA 4DTXA 1UOCA 1VSJA 2E4LA 4IBNA 4AHTA 1X9WA 1NKBA 4FXDA 3L3VA 4E1MA 3OYLA 4MFBA 3RMBA 2G8FA 3OYKA 4F3TA 3RMCA 3I8DA 1RT3A 2HNZA 3ZT4A 4B9MA 1ZYQA 2XY8A 5HRPA 5J2PA 1YVUA 3LDSA 4IKFA 4DSJA 1KFSA 1C0TA 1QHTA 1IKVA 4CJ5A 3VA0A 3SPYA 3KD1E 3B6OA 4AHVA 4OVLA 1C1AA 4KFBA 4FJ7A 3PV8A 4DLEA 2Q3SA 1LW2A 4H4OA 4N41A 4DQRA 1O1WA 4FZZA 1K6YA 3SUOA 3V9WA 1ASVA 1LAVA 4BDYA 3S3MA 5C42A 4E0DA 3PX6A 1EETA 3QIOA 4CEAA 3O3GA 3OYJA 2XO7A 3L2RA 4CF8A 2XY6A 3QEXA 1NK5A 3P5JA 1U04A 2WONA 2HHXA 1EX4A 4MQ3A 3LWLA 4H4MA 4Z4GA 4IFVA 3OYAA 2RF2A 4C8OA 1NJXA 4BWJA 2WOMA 3HPHA 1LAWA 4KB0A 3RRHA 5FRNA 4DF8A 1SUQA 1JXBA 1TGOA 4Z4CA 3HVTA 4CEBA 4FLXA 4DS4A 3CFOA 2RKIA 1NOYA 2P5GA 4O0IA 3QESA 4CEFA 4FCYA 5J1EA 4OPJA 3D0PA 3SUPA 3TAPA 2YNHA 3MEDA 3AV9A 1RNHA 4NCAA 4KKOA 4E1NA 3QEVA 3T1AA 1SKRA 3NFAA 1KRPA 3AVFA 2HNYA 3OJUA 1ASWA 1Z26A 4I9LA 3LANA 4LD0A 1S9EA 1S6PA 2KQ2A 2IGIA 3G10A 3F73A 3MXMA 4KHSA 1JXEA 3KJVA 3QIPA 3AO5A 4BE1A 3ZSWA 4W5NA 4DFJA 3HJFA 1RDDA 3VN5A 3OYEA 2DFFA 2YV0X 5EU7A 3TAGA 1IO2A 4FJ9A 2Y1IA 4CF1A 1LWEA 1TKDA 1S9GA 3IRXA 4TSXA 1IKWA 4FJ5A 3V4IA 3AO1A 1BCOA 3QERA 2YNIA 3VQ4A 4JS4A 2HHSA 3IAYA 3MXJA 1DTTA 1S1UA 1XHXA 4OGEA 3O3HA 3WNGA 4B8CA 3KK2A 3ZT0A 2BE2A 1JLGA 2DY4A 5C25A 4CJTA 1UA0A 4M3ZA 2ETJA 2ZD1A 4IG3A 3LP1A 3ZSXA 3QEWA 2FBXA 1U4BA 4B9UA 3OVNA 1SV5A 2ZQBA 4OKEA 1W0HA 5CZ2A 3ZCMA 4CESA 1RBTA 4UQGA 3L2UA 3TI0A 4BDPA 4E7IA 4KRFA 3SI6A 2KZMA 1J5OA 1NJZA 4CJ3A 2HW3A 3TR8A 3AVNA 3SV3A 2RN2A 4FJGA 3T19A 2HMIA 4FLWA 4FJNA 1TL1A 4FZXC 3L3UA 1CLQA 1VRUA 2OPSA 4CHZA 3RR8A 3VQEA 1TVRA 1ZBIA 4NYFA 4CGIA 4CJVA 3S9HA 4NYNA 2PYLA 1X9SA 1WLJA 2HHUA 3PO5A 4DSLA 3AA4A 3ULDA 4FM0A 4FJ8A 2B4JA 4DFPA 1L5UA 3BGRA 3KIOA 4DTOA 2OPQA 5KRTA 1HNVA 5E41A 3OYMA 3HXMA 3OYGA 3KTQA 3ZSYA 4Q0BA 3ZSQA 1YTAA 3HT3A 2PYJA 4I2PA 4M42A 3NGIA 3E01A 1NK4A 2P51A 4FLVA 3PO4A 4B8AB 4B9TA 3AVJA 4CHYA 3NGZA 1A5WA 1BCMA 1RDBA 3VQPA 2YKNA 2OPPA 3ZT1A 4DTRA 4N47A 4FJLA 3DOLA 2KFNA 5JS2A 4KTQA 1WNSA 3VA3A 3OS2A 3HVRA 4DTSA 3AO3A 4Y1CA 2GBZA 1VSIA 4OGCA 2P5OA 1KLMA 4RW6A 3PY8A 5I42A 1RT4A 1RTIA 1S5JA 3AVBA 5K14A 1XHZA 1W9HA 3VQQA 4C8NA 2PY5A 3KK3A 1N6QA 1N5YA 2X74A 4JRPA 4B3OA 1UWBA 4FK4A 5KRSA 3SZ2A 4CEOA 4I7FA 2XY5A 3KKSA 4N5SA 4CECA 2P1JA 1UAXA 1IKYA 5D3GA 1LV5A 3WNEA 1RBRA 4CF2A 3K58A 1BL3A 1BISA 4FLTA 4DTPA 4DFMA 1D9DA 5J2QA 3KD5E 4LH5A 3AVIA 3DM2A 4FK0A 3DMJA 4KHUA 2A1SA 4DLGA 2A1RA 1RT5A 3V1RA 3SNNA 3LZJA 3PX0A 4GVMA 4XIUA 4J2DA 1JL2A 1I39A 2OZSA 1QSLA 1Y97A 4CGGA 1C0MA 2IAJA 1L3SA 4DQSA 3SPZA 4ELTA 3K5NA 2D5RA 1BIUA 4CE9A 3JYTA 3NAEA 4LSNA 1DLOA 4CGFA 3SQ2A 3SUNA 3OYFA 2X78A 4KI4A 1JLBA 2E6LA 3CFPA 1WSFA 4I2QA 1QE1A 1J53A 3HSTB 1KVAA 3NGYA 4CIGA 1RT2A 3OS1A 3L2VA 3QEPA 5I3UA 4Z4FA 3TAMA 3ISNC 4N56A 4CFBA 1C0UA 3DRSA 3NDKA 4M3WA 4JS5A 4CHNA 1X1PA 1RTDA 4ZTFA 1IH7A 2YHAA 1HQUA 4DTMA 4Q5VA 3SQ0A 4F3OA 4KV8A 4B9SA 4OLBA 4F4KA 4Z4EA 1CZ9A 3AO4A 3M8RA 3QNOA 1RTHA 1S1VA 5SWMA 2W42A 4DU3A 4E89A 2GV9A 2Y1JA 1HNIA 1ZBUA 3MXIA 4OKKA 4ZTJA 5JS1A 3AVLA 4RW7A 2BANA 3TABA 1QS4A 2Z1IA 1B9DA 1J9AA 4AHRA 4ELUA 2Z1JA 4G1QA 4W5OA 3LP0A 2XHBA 2DFHA 4OKJA 3OYHA 3TAEA 3VQ5A 4KB1A 1UA1A 1D5AA 4DG1A 1VSFA 2FBVA 4DTJA 1WAFA 1C6VA 4DQIA 3RWUA 2IOCA 2DTUA 3KK1A 4CHOA 4AILC 1C1CA 3HPGA 3L2WA 3KLGA 3SJJA 1NK7A 2G8IA 3AA3A 3CG7A 2GUIA 2KW4A 4CK2A 1WSJA 3SV4A 1T8EA 3MEEA 4O5BA 3K5LA 3ZT2A 3ITHA 3V9ZA 1EKEA 1MU2A 2EX3A 1YTUA 4FYDA 1NK0A 4CIEA 4HUGA 4KHWA 1I3AA 1BIZA 3OYBA 3AVAA 1TL3A 1FXXA 4CJPA 1IKXA 4CF9A 3K2PA 3A2FA 3QINA 1YT3A 3FFIA 4CJWA 4OJRA 3V6DA 1XC9A 4PWDA 5CYQA 2VG6A 3LALA 1ITGA 1VRTA 4CJ4A 4RG8A 5KTQA 4DU4A 4DTNA 3DLHA 1FKPA 3VQ6A 1L3UA 3UIQA 1WSIA 1U45A 3TANA 1KVCA 3RR7A 4RW8A 3ALYA 1JLFA 2HNDA 3SQ4A 3K5MA 4ZHRA 3NH0A 4E7JA 1HRHA 1Q8IA 3HPOA 3AVCA 5KI6A 1CXUA 4W5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5P A;  4CGJ A;  3V9X A;  4O4G A;  3OYN A;  3EY1 A;  4FJJ A;  3LAK A;  4QOZ B;  4CGH A;  1VSD A;  3AVM A;  3K5O A;  3QLH A;  1RT7 A;  5KGX A;  4FLZ A;  1NK9 A;  3EZ5 A;  4KHN A;  3F9K A;  3HL8 A;  3TAF A;  4CJK A;  1RCH A;  1TK0 A;  3ZT3 A;  3NF8 A;  4CJR A;  4CJS A;  3DRP A;  4FJI A;  2O4G A;  2VWK A;  1T7P A;  4KO0 A;  4CK3 A;  4AHU A;  1TAQ A;  2HVH A;  4H8K A;  4BE2 A;  4IFY A;  4DTU A;  1TK5 A;  4F8R A;  4F2R A;  3NF6 A;  1HQE A;  1TKT A;  1SKW A;  1TAU A;  2IDO A;  3BDP A;  3PUF A;  5HRO A;  1L3V A;  3C6T A;  3C94 A;  2AJQ A;  1HJR A;  3K57 A;  5FRO A;  4DSE A;  3P83 D;  2OA8 A;  1QQC A;  4HCC A;  2YNG A;  3AVK A;  1BGX T;  3P1G A;  1J54 A;  4O44 A;  4CJL A;  3OY9 A;  4KI6 A;  2HHW A;  3IS9 A;  1LWC A;  2VG5 A;  3VQ8 A;  2IC3 A;  3JSM A;  3C95 A;  4IDK A;  3LPT A;  4JLH A;  1ZBF A;  3NF7 A;  5C24 A;  1SL2 A;  3QET A;  3O4N A;  4M3T A;  2Z1G A;  3NBP A;  1NK6 A;  4FJM A;  1WSH A;  4FK2 A;  1S1X A;  1JLE A;  1RT1 A;  1NKC A;  3HP9 A;  1F21 A;  2DFE A;  4L8R B;  4HUF A;  2HHT A;  4FLY A;  3SQ1 A;  1ASU A;  1NOZ A;  3U6F A;  2IS3 A;  3LWM A;  4JRQ A;  4YNQ A;  2HVI A;  3LZI A;  2EHG A;  1HYS A;  1QSY A;  3SYZ A;  4BAC A;  2XRI A;  4FJK A;  1X9M A;  2B5J A;  5J2M A;  3VQB A;  3KLE A;  4CCH A;  5CZ1 A;  3WNF A;  1D8Y A;  2D0B A;  5HP1 A;  2QKB A;  3QEI A;  1QTM A;  3U3G A;  3LPU A;  4DQP A;  3OYC A;  4M45 A;  1LW0 A;  4DSK A;  2D0C A;  1S1W A;  3D45 A;  3QO9 A;  5J2N A;  4E19 A;  1U47 A;  4LY7 A;  3CFR A;  4I9Q A;  3S3O A;  4RW4 A;  4DWI A;  1RBV A;  1BHL A;  1WSG A;  3DI6 A;  1C1B A;  5HRS A;  1DTQ A;  3C6U A;  4IG0 A;  4FM2 A;  4AHC A;  3V81 A;  1IG9 A;  4M3Y A;  1XWL A;  1NK8 A;  1NKE A;  2OPR A;  2FBY A;  5HRN A;  4DFK A;  1G15 A;  4HCB A;  3LP3 A;  4DQQ A;  1KSP A;  4C8L A;  2FBT A;  3RTV A;  3ZSR A;  4CFD A;  4KPY A;  1VSL A;  3S3N A;  5DMR A;  1EP4 A;  5T7B A;  4FM1 A;  3SCX A;  4NCB A;  5FRM A;  2G8K A;  1SL1 A;  1ZBH A;  1B92 A;  2NUB A;  4ID5 A;  1KLN A;  1SKS A;  1LWF A;  4DMN A;  1RIL A;  4LSL A;  4DF4 A;  5HLF A;  3H08 A;  3I0R A;  4CJE A;  4HHT A;  3B6P A;  2QXF A;  2QKK A;  4KAZ A;  3QNN A;  3THV A;  1BI4 A;  2B6A A;  3VQA A;  3V9S A;  3M8P A;  1T03 A;  4CHQ A;  4CEZ A;  1L3T A;  2X6S A;  4CER A;  3NE6 A;  4BDZ A;  4BE0 A;  1BI4 B;  4M41 A;  2G8V A;  1RBS A;  4CK1 A;  1VSE A;  2F96 A;  3EYZ A;  4HVJ A;  4DU1 A;  4Y1D A;  2OYQ A;  4CFC A;  4BWM A;  1CXQ A;  1BQN A;  2O4I A;  1NJY A;  3KLF A;  4DSI A;  4HTU A;  3VQC A;  3AVH A;  4CIF A;  4CGD A;  1T05 A;  2R7Y A;  4ELV A;  4ID1 A;  1CZB A;  1S1T A;  2HB5 A;  5HRR A;  2XY7 A;  4N76 A;  2YNF A;  4K8Z A;  4RW9 A;  4J2A A;  3WNH A;  2KFZ A;  1NJW A;  4C8M A;  3ZSZ A;  1TK8 A;  4B9V A;  3RMA A;  2KZZ A;  3KLH A;  4FW1 A;  3DRR A;  3CQ8 A;  2BGG A;  2X6N A;  2ZE2 A;  1S6Q A;  3VQ7 A;  4QCL A;  3AA5 X;  5KGW A;  3TAQ A;  1HYZ A;  5CY4 A;  3O4Q A;  4FW2 A;  1JLQ A;  2FC0 A;  1RTJ A;  4PA1 A;  3CM5 A;  5FDL A;  3OYD A;  2VWJ A;  3OS0 A;  4AHS A;  1TKZ A;  4O55 A;  3HYF A;  1RDC A;  3HP6 A;  3MEC A;  3DLK A;  2ITG A;  2VG7 A;  4J2E A;  2E6M A;  4Z4H A;  3RMD A;  1RBU A;  5CYM A;  2G8W A;  5DK5 A;  3TAR A;  2JGU A;  4CJU A;  2D0A A;  4M3X A;  3DYA A;  3OYI A;  1U49 A;  4PQU A;  3SUQ A;  4DS5 A;  3NH1 A;  3NF9 A;  4Z0U A;  4E3S A;  3NH2 A;  1U48 A;  3VQ9 A;  4AH9 A;  3T3F A;  1TV6 A;  1XI1 A;  1FK9 A;  3RRG A;  4B9L A;  3HM9 A;  3V9U A;  3CM6 A;  4FLU A;  4CJQ A;  4E7H A;  3HO1 A;  4CED A;  1VK0 A;  1WSE A;  1A5X A;  1BQM A;  1HMV A;  1GOA A;  3LAM A;  1KCF A;  4KTW A;  3V1O A;  4E7L A;  3U3Y A;  2HHQ A;  3M8S A;  1D9F A;  2BDP A;  4EZ9 A;  4OLA A;  3NCI A;  2Z1H A;  3ASM A;  3I0S A;  1GOC A;  4CJF A;  3MAQ A;  1SL0 A;  2I5J A;  1HYV A;  1VSM A;  2YHB A;  4CEQ A;  1WAJ A;  1A5V A;  4CEE A;  2G8H A;  1R0A A;  4KTZ A;  3L2Q A;  4FJH A;  4KRE A;  3K59 A;  3DLR A;  2ATQ A;  2JLE A;  3O3F A;  3PX4 A;  4W5R A;  3AO2 A;  4WE1 A;  4EZ6 A;  2KTQ A;  1B9F A;  3DLE A;  3ZSO A;  2PZS A;  1HPZ A;  3KKR A;  4B9N A;  4F2S A;  2RPI A;  2HHV A;  4E7K A;  4ICL A;  1KFD A;  1VSH A;  4KHQ A;  1JLA A;  1Z25 A;  3IG1 A;  3LP2 A;  4O0J A;  3DLB A;  4M3R A;  4DSF A;  3L8B A;  3G0Z A;  1GOB A;  3KLI A;  5SZT A;  2G8U A;  1JLC A;  3HK2 A;  3V1Q A;  1QSS A;  1TKX A;  4GMJ B;  4W5T A;  2LSN A;  5HBM A;  1RDA A;  1RT6 A;  3NHG A;  1Q9X A;  4J2B A;  4Z4I A;  2QK9 A;  4PY5 A;  1KTQ A;  1KVB A;  4KHY A;  4OPK A;  1ZBL A;  2F8T A;  3DOK A;  4B08 A;  4GW6 A;  4NCG A;  4EP4 A;  1WN7 A;  4QAG A;  3OJS A;  4EP5 A;  1VSK A;  3DLG A;  3VQD A;  1EXQ A;  4YFU A;  4FZY A;  4K8X A;  1FKO A;  1JL1 A;  3ZSV A;  3CYM A;  4FVM A;  4CF0 A;  4LH4 A;  4PUO A;  3AVG A;  4C8K A;  3AA2 A;  1REV A;  2OZM A;  2YKM A;  4M3U A;  3M8Q A;  1Q9Y A;  4CFA A;  2F8S A;  4FJX A;  1JKH A;  4CHP A;  4HUE A;  3TWH A;  3MEG A;  4DTX A;  1UOC A;  1VSJ A;  2E4L A;  4IBN A;  4AHT A;  1X9W A;  1NKB A;  4FXD A;  3L3V A;  4E1M A;  3OYL A;  4MFB A;  3RMB A;  2G8F A;  3OYK A;  4F3T A;  3RMC A;  3I8D A;  1RT3 A;  2HNZ A;  3ZT4 A;  4B9M A;  1ZYQ A;  2XY8 A;  5HRP A;  5J2P A;  1YVU A;  3LDS A;  4IKF A;  4DSJ A;  1KFS A;  1C0T A;  1QHT A;  1IKV A;  4CJ5 A;  3VA0 A;  3SPY A;  3KD1 E;  3B6O A;  4AHV A;  4OVL A;  1C1A A;  4KFB A;  4FJ7 A;  3PV8 A;  4DLE A;  2Q3S A;  1LW2 A;  4H4O A;  4N41 A;  4DQR A;  1O1W A;  4FZZ A;  1K6Y A;  3SUO A;  3V9W A;  1ASV A;  1LAV A;  4BDY A;  3S3M A;  5C42 A;  4E0D A;  3PX6 A;  1EET A;  3QIO A;  4CEA A;  3O3G A;  3OYJ A;  2XO7 A;  3L2R A;  4CF8 A;  2XY6 A;  3QEX A;  1NK5 A;  3P5J A;  1U04 A;  2WON A;  2HHX A;  1EX4 A;  4MQ3 A;  3LWL A;  4H4M A;  4Z4G A;  4IFV A;  3OYA A;  2RF2 A;  4C8O A;  1NJX A;  4BWJ A;  2WOM A;  3HPH A;  1LAW A;  4KB0 A;  3RRH A;  5FRN A;  4DF8 A;  1SUQ A;  1JXB A;  1TGO A;  4Z4C A;  3HVT A;  4CEB A;  4FLX A;  4DS4 A;  3CFO A;  2RKI A;  1NOY A;  2P5G A;  4O0I A;  3QES A;  4CEF A;  4FCY A;  5J1E A;  4OPJ A;  3D0P A;  3SUP A;  3TAP A;  2YNH A;  3MED A;  3AV9 A;  1RNH A;  4NCA A;  4KKO A;  4E1N A;  3QEV A;  3T1A A;  1SKR A;  3NFA A;  1KRP A;  3AVF A;  2HNY A;  3OJU A;  1ASW A;  1Z26 A;  4I9L A;  3LAN A;  4LD0 A;  1S9E A;  1S6P A;  2KQ2 A;  2IGI A;  3G10 A;  3F73 A;  3MXM A;  4KHS A;  1JXE A;  3KJV A;  3QIP A;  3AO5 A;  4BE1 A;  3ZSW A;  4W5N A;  4DFJ A;  3HJF A;  1RDD A;  3VN5 A;  3OYE A;  2DFF A;  2YV0 X;  5EU7 A;  3TAG A;  1IO2 A;  4FJ9 A;  2Y1I A;  4CF1 A;  1LWE A;  1TKD A;  1S9G A;  3IRX A;  4TSX A;  1IKW A;  4FJ5 A;  3V4I A;  3AO1 A;  1BCO A;  3QER A;  2YNI A;  3VQ4 A;  4JS4 A;  2HHS A;  3IAY A;  3MXJ A;  1DTT A;  1S1U A;  1XHX A;  4OGE A;  3O3H A;  3WNG A;  4B8C A;  3KK2 A;  3ZT0 A;  2BE2 A;  1JLG A;  2DY4 A;  5C25 A;  4CJT A;  1UA0 A;  4M3Z A;  2ETJ A;  2ZD1 A;  4IG3 A;  3LP1 A;  3ZSX A;  3QEW A;  2FBX A;  1U4B A;  4B9U A;  3OVN A;  1SV5 A;  2ZQB A;  4OKE A;  1W0H A;  5CZ2 A;  3ZCM A;  4CES A;  1RBT A;  4UQG A;  3L2U A;  3TI0 A;  4BDP A;  4E7I A;  4KRF A;  3SI6 A;  2KZM A;  1J5O A;  1NJZ A;  4CJ3 A;  2HW3 A;  3TR8 A;  3AVN A;  3SV3 A;  2RN2 A;  4FJG A;  3T19 A;  2HMI A;  4FLW A;  4FJN A;  1TL1 A;  4FZX C;  3L3U A;  1CLQ A;  1VRU A;  2OPS A;  4CHZ A;  3RR8 A;  3VQE A;  1TVR A;  1ZBI A;  4NYF A;  4CGI A;  4CJV A;  3S9H A;  4NYN A;  2PYL A;  1X9S A;  1WLJ A;  2HHU A;  3PO5 A;  4DSL A;  3AA4 A;  3ULD A;  4FM0 A;  4FJ8 A;  2B4J A;  4DFP A;  1L5U A;  3BGR A;  3KIO A;  4DTO A;  2OPQ A;  5KRT A;  1HNV A;  5E41 A;  3OYM A;  3HXM A;  3OYG A;  3KTQ A;  3ZSY A;  4Q0B A;  3ZSQ A;  1YTA A;  3HT3 A;  2PYJ A;  4I2P A;  4M42 A;  3NGI A;  3E01 A;  1NK4 A;  2P51 A;  4FLV A;  3PO4 A;  4B8A B;  4B9T A;  3AVJ A;  4CHY A;  3NGZ A;  1A5W A;  1BCM A;  1RDB A;  3VQP A;  2YKN A;  2OPP A;  3ZT1 A;  4DTR A;  4N47 A;  4FJL A;  3DOL A;  2KFN A;  5JS2 A;  4KTQ A;  1WNS A;  3VA3 A;  3OS2 A;  3HVR A;  4DTS A;  3AO3 A;  4Y1C A;  2GBZ A;  1VSI A;  4OGC A;  2P5O A;  1KLM A;  4RW6 A;  3PY8 A;  5I42 A;  1RT4 A;  1RTI A;  1S5J A;  3AVB A;  5K14 A;  1XHZ A;  1W9H A;  3VQQ A;  4C8N A;  2PY5 A;  3KK3 A;  1N6Q A;  1N5Y A;  2X74 A;  4JRP A;  4B3O A;  1UWB A;  4FK4 A;  5KRS A;  3SZ2 A;  4CEO A;  4I7F A;  2XY5 A;  3KKS A;  4N5S A;  4CEC A;  2P1J A;  1UAX A;  1IKY A;  5D3G A;  1LV5 A;  3WNE A;  1RBR A;  4CF2 A;  3K58 A;  1BL3 A;  1BIS A;  4FLT A;  4DTP A;  4DFM A;  1D9D A;  5J2Q A;  3KD5 E;  4LH5 A;  3AVI A;  3DM2 A;  4FK0 A;  3DMJ A;  4KHU A;  2A1S A;  4DLG A;  2A1R A;  1RT5 A;  3V1R A;  3SNN A;  3LZJ A;  3PX0 A;  4GVM A;  4XIU A;  4J2D A;  1JL2 A;  1I39 A;  2OZS A;  1QSL A;  1Y97 A;  4CGG A;  1C0M A;  2IAJ A;  1L3S A;  4DQS A;  3SPZ A;  4ELT A;  3K5N A;  2D5R A;  1BIU A;  4CE9 A;  3JYT A;  3NAE A;  4LSN A;  1DLO A;  4CGF A;  3SQ2 A;  3SUN A;  3OYF A;  2X78 A;  4KI4 A;  1JLB A;  2E6L A;  3CFP A;  1WSF A;  4I2Q A;  1QE1 A;  1J53 A;  3HST B;  1KVA A;  3NGY A;  4CIG A;  1RT2 A;  3OS1 A;  3L2V A;  3QEP A;  5I3U A;  4Z4F A;  3TAM A;  3ISN C;  4N56 A;  4CFB A;  1C0U A;  3DRS A;  3NDK A;  4M3W A;  4JS5 A;  4CHN A;  1X1P A;  1RTD A;  4ZTF A;  1IH7 A;  2YHA A;  1HQU A;  4DTM A;  4Q5V A;  3SQ0 A;  4F3O A;  4KV8 A;  4B9S A;  4OLB A;  4F4K A;  4Z4E A;  1CZ9 A;  3AO4 A;  3M8R A;  3QNO A;  1RTH A;  1S1V A;  5SWM A;  2W42 A;  4DU3 A;  4E89 A;  2GV9 A;  2Y1J A;  1HNI A;  1ZBU A;  3MXI A;  4OKK A;  4ZTJ A;  5JS1 A;  3AVL A;  4RW7 A;  2BAN A;  3TAB A;  1QS4 A;  2Z1I A;  1B9D A;  1J9A A;  4AHR A;  4ELU A;  2Z1J A;  4G1Q A;  4W5O A;  3LP0 A;  2XHB A;  2DFH A;  4OKJ A;  3OYH A;  3TAE A;  3VQ5 A;  4KB1 A;  1UA1 A;  1D5A A;  4DG1 A;  1VSF A;  2FBV A;  4DTJ A;  1WAF A;  1C6V A;  4DQI A;  3RWU A;  2IOC A;  2DTU A;  3KK1 A;  4CHO A;  4AIL C;  1C1C A;  3HPG A;  3L2W A;  3KLG A;  3SJJ A;  1NK7 A;  2G8I A;  3AA3 A;  3CG7 A;  2GUI A;  2KW4 A;  4CK2 A;  1WSJ A;  3SV4 A;  1T8E A;  3MEE A;  4O5B A;  3K5L A;  3ZT2 A;  3ITH A;  3V9Z A;  1EKE A;  1MU2 A;  2EX3 A;  1YTU A;  4FYD A;  1NK0 A;  4CIE A;  4HUG A;  4KHW A;  1I3A A;  1BIZ A;  3OYB A;  3AVA A;  1TL3 A;  1FXX A;  4CJP A;  1IKX A;  4CF9 A;  3K2P A;  3A2F A;  3QIN A;  1YT3 A;  3FFI A;  4CJW A;  4OJR A;  3V6D A;  1XC9 A;  4PWD A;  5CYQ A;  2VG6 A;  3LAL A;  1ITG A;  1VRT A;  4CJ4 A;  4RG8 A;  5KTQ A;  4DU4 A;  4DTN A;  3DLH A;  1FKP A;  3VQ6 A;  1L3U A;  3UIQ A;  1WSI A;  1U45 A;  3TAN A;  1KVC A;  3RR7 A;  4RW8 A;  3ALY A;  1JLF A;  2HND A;  3SQ4 A;  3K5M A;  4ZHR A;  3NH0 A;  4E7J A;  1HRH A;  1Q8I A;  3HPO A;  3AVC A;  5KI6 A;  1CXU A;  4W5Q A; 
#chains in the Genus database with same CATH topology
 2Q0R A;  3EY1 A;  3MWT A;  4E1J A;  4DR1 K;  3AVM A;  3K5O A;  1K73 O;  3KK7 A;  5GAD P;  1QQM A;  5AFU A;  4CK3 A;  1HNX K;  3G71 N;  3NF6 A;  2QWM A;  4BC4 A;  4BVP A;  2IDO A;  2QI2 A;  2BTF A;  3L4I A;  5AQO A;  3C94 A;  2AJQ A;  3J81 O;  3K57 A;  4JI2 K;  5FRO A;  2P9N B;  3NVM A;  2YNG A;  3AVK A;  4CJL A;  5F2R A;  3OY9 A;  4IJA A;  1LCU A;  3VQ8 A;  2IC3 A;  1HJO A;  3N4Q A;  1ZBF A;  4AM7 A;  1J5E K;  4K41 A;  4M3T A;  1HUX A;  1NK6 A;  3VET A;  4BC5 A;  3DAW A;  1JLE A;  3FLC O;  4HUF A;  2HHT A;  4FLY A;  3SQ1 A;  1NOZ A;  3U6F A;  3J7Z O;  3BEX A;  3E9O A;  3TTD A;  4LC9 B;  3AAR A;  4Z94 A;  3QEI A;  3LPU A;  3MWP A;  4M45 A;  3P4I A;  1S1W A;  1NM1 A;  2OAN A;  3MN9 A;  2O8F B;  3S3O A;  4DWI A;  4GKK K;  5AQV A;  4BRC A;  3C6U A;  2W6K A;  2GWJ A;  4ILH A;  4AHC A;  3V81 A;  1NK8 A;  5MLC Q;  2OPR A;  2FBY A;  3M5R A;  4DFK A;  4Y0W A;  4HCB A;  3QFU A;  3LP3 A;  4RWT A;  4DQQ A;  4KH5 A;  2V7Z A;  3RTV A;  4CBU A;  4NB4 A;  3ZSR A;  3HOS A;  4KPY A;  3QML A;  4JNE A;  5DMR A;  3SCX A;  2G8K A;  2P9S A;  1ZBH A;  4CZH A;  2NUB A;  3O9U A;  4DMN A;  4LSL A;  1S72 N;  4QS7 A;  3H08 A;  4BRF A;  1IBL K;  3EZW A;  1BI4 A;  3DLL L;  3IMX A;  4CER A;  3NE6 A;  4BDZ A;  1WBD A;  2UUC K;  4KH4 A;  1VSE A;  4DV6 K;  3EYZ A;  4HVJ A;  4Y1D A;  1CXQ A;  1BQN A;  5AZJ B;  3KLF A;  4DSI A;  2HBJ A;  2E1Z A;  2F9T A;  1MWK A;  3AVH A;  2R7Y A;  1Q81 O;  4FVU A;  1EQY A;  3E1Y A;  3KLH A;  3DRR A;  3FZK A;  3AA5 X;  5KGW A;  2Q1N A;  4EHU A;  2V51 B;  1JLQ A;  1HKC A;  4O55 A;  1RDC A;  1GLJ O;  4JK7 A;  3PIP L;  2JGU A;  4DR4 K;  4CBW A;  3PLA A;  4CZE A;  1NGJ A;  3ZEU B;  3T3F A;  5E26 A;  3DJC A;  3RRG A;  4JEP A;  1KQS M;  3HM9 A;  3SLC A;  3SAH A;  1OVQ A;  4H5V A;  4CED A;  4DUY K;  1WSE A;  1A5X A;  4BRI A;  2FSK A;  2HHQ A;  1GOA A;  4DKW A;  3QFP A;  4BY9 C;  2I5J A;  1HYV A;  5AZI A;  1WAJ A;  4CEE A;  4KTZ A;  3L2Q A;  4FJH A;  3K59 A;  2I7N A;  3MK6 A;  2KTQ A;  3AO2 A;  2YHX A;  1GLA G;  1B9F A;  2PZS A;  1HPZ A;  3KKR A;  4E7K A;  3CPE A;  5FPD A;  1JLA A;  4O0J A;  3DLB A;  4DSF A;  1VQ7 N;  3A5O C;  1BUP A;  3G0Z A;  1JLC A;  3V1Q A;  1TKX A;  4W5T A;  4H03 B;  3CC4 N;  1RDA A;  3C6A A;  4J2B A;  4KHY A;  3M3Z A;  4OPK A;  5M1O A;  4EP4 A;  1WN7 A;  5JMV A;  5F1X A;  1VSK A;  2PBD A;  1SQK A;  4OPH A;  4I6M B;  1XNR K;  4LH4 A;  3T1Y K;  3AGR A;  3AVG A;  1I94 K;  1E3M A;  5AQR A;  3U4L A;  4M3U A;  5M1K A;  4CFA A;  3CCM N;  5GIN A;  4BRP A;  4CHP A;  2E4L A;  4IBN A;  1X9W A;  3C0B A;  3IKM A;  1Z05 A;  3P39 A;  2HNZ A;  1MWM A;  2XY8 A;  1N33 K;  4IKF A;  4DSJ A;  4JI3 K;  3GDQ A;  1C0T A;  1Q18 A;  3KD1 E;  3SPY A;  2ZM6 K;  4IXC A;  4EHT A;  1YAG A;  1K8A O;  4AHV A;  4OVL A;  2E2Q A;  3O9Q A;  4DV1 K;  1O1W A;  5LL6 Z;  2GX9 A;  4U7B A;  4H0Y B;  1EET A;  1SS6 A;  5EXW A;  4CF8 A;  1NK5 A;  3ZX2 A;  2GEL A;  5AZJ A;  3LWL A;  4Z4G A;  3OYA A;  3SK3 A;  3BF3 A;  1GLC G;  4C8O A;  3SBT A;  4BGA A;  1NGA A;  2Q31 A;  4CEB A;  3C7N B;  3CFO A;  2RKI A;  2HBK A;  2O8B A;  4O0I A;  4FCY A;  3D2E B;  3JS6 A;  3DXM B;  3SUP A;  3MED A;  4X64 K;  4NCA A;  4KKO A;  4A61 A;  4FOE A;  1ZBS A;  1WUA A;  5M1N A;  4LD0 A;  1S9E A;  1S6P A;  4CZK A;  3HOT A;  2IGI A;  3G10 A;  3F73 A;  1EWQ A;  4IZ9 A;  3AO5 A;  4BE1 A;  3ZSW A;  1IO2 A;  1ILY A;  1TKD A;  1LWE A;  3IRX A;  3ZEU A;  4AQY K;  4JS4 A;  2D0P A;  2PFU A;  1HR0 K;  3MXJ A;  4H0V B;  3WNG A;  4B8C A;  3I33 A;  4PKH A;  5C25 A;  2ETJ A;  4B9U A;  4IG3 A;  3LP1 A;  2FBX A;  3L2U A;  4KRF A;  1RBT A;  4FWQ A;  2HW3 A;  5JLF A;  3AVN A;  3ZET B;  3VEW A;  4FJN A;  1VRU A;  1VQ8 N;  4XEI A;  3WXI A;  1VQL N;  3H45 C;  3RR8 A;  3THX B;  2WC9 A;  4NYN A;  5AQX A;  3PO5 A;  2NLX A;  3WEE B;  4FJ8 A;  4FM0 A;  2B4J A;  3TU5 A;  1YF5 L;  2OPQ A;  5KRT A;  4Q0B A;  1XC3 A;  4IJN A;  4I2P A;  5HOO A;  4HTL A;  5FPN A;  4MDB A;  3NGI A;  4CHY A;  1A5W A;  2OPP A;  3B8A X;  3AY9 A;  3DOL A;  3MMV A;  5JS2 A;  3I56 N;  2ASO A;  5IWA K;  2GBZ A;  1VSI A;  2FSJ A;  4B1W B;  5K14 A;  2Q36 A;  1N5Y A;  2X74 A;  4B3O A;  4X66 K;  5KRS A;  4OO1 J;  3BZC A;  5AQY A;  1UAX A;  4YOY A;  5D3G A;  1LV5 A;  4CF2 A;  1BL3 A;  4DFM A;  4LH5 A;  3P38 A;  4KHU A;  4CW7 B;  2A1R A;  5AQG A;  2OZS A;  3HM8 A;  4FWO A;  2NRW A;  3SPZ A;  1E4F T;  2D5R A;  2D4W A;  3JYT A;  1SZ2 A;  3NAE A;  2HF4 A;  3CQX A;  4LSN A;  3SUN A;  3CCV N;  2X78 A;  5BN9 A;  4KI4 A;  2ZF5 O;  1WSF A;  4I2Q A;  3CFP A;  1KVA A;  3NGY A;  3QEP A;  5I3U A;  3L2V A;  4GV9 A;  2E2P A;  3ISN C;  3NDK A;  1BOT O;  4JS5 A;  4CHN A;  1X1P A;  1HQU A;  3SQ0 A;  3C7N A;  4KV8 A;  1NGB A;  4Z4E A;  1RTH A;  3RVC A;  3D2E A;  4CZM A;  4E89 A;  4DU3 A;  1HNI A;  3MXI A;  4ZTJ A;  4RW7 A;  3TAB A;  4BRK A;  4PKI A;  1UA1 A;  1VSF A;  2FBV A;  2IOC A;  1OKJ A;  3SAF A;  3L2W A;  3KLG A;  1NK7 A;  2G8I A;  2QM1 A;  3EL2 A;  1GLL O;  4CK2 A;  1T8E A;  3H3N O;  3MEE A;  3O4W A;  3F5T A;  3ZT2 A;  5I9E B;  2O8C B;  1NK0 A;  1VQM N;  3OHR A;  3VOV A;  1TL3 A;  4CJP A;  4CF9 A;  4LFA K;  2CH5 A;  4OJR A;  4PWD A;  2IVO A;  1VRT A;  4YHH K;  5KTQ A;  3DLH A;  3C6H A;  1L3U A;  1U45 A;  4H5N A;  3ALY A;  2HND A;  4B1Z A;  1V4S A;  3SMP A;  3ZET A;  4E7J A;  1NGH A;  3AVC A;  2QA4 N;  1ATN A;  2YHW A;  4CGJ A;  4R5P A;  5AQH A;  3V9X A;  1ZXO A;  4O4G A;  3OYN A;  1YIT N;  3WEE A;  5KGX A;  3QLH A;  3EZ5 A;  1N34 K;  1X9J A;  2E2O A;  2ZJQ L;  3MX2 A;  3WXK A;  1BA1 A;  4CJK A;  3ZT3 A;  1Q7Y O;  4CJR A;  4CZG A;  5C2F A;  2YX6 A;  2VWK A;  5C15 A;  1T7P A;  4AHU A;  3EE9 A;  4H8K A;  4X62 K;  4DTU A;  4F8R A;  4F2R A;  4JI5 K;  1HQE A;  3BDP A;  5BRF A;  4QS9 A;  4DSE A;  1JJ2 M;  5CHI A;  3P83 D;  2RE2 A;  3P1G A;  4O44 A;  5AFU H;  3IS9 A;  4WFA L;  2VG5 A;  3C95 A;  4JLH A;  3CIP A;  5EOY A;  4A62 A;  5C24 A;  3O4N A;  1GLF O;  3NBP A;  4FJM A;  1WSH A;  4WYB A;  2KLA A;  1NKC A;  1RT1 A;  3CCJ N;  1F21 A;  4OPA A;  1ASU A;  2P9K B;  1GLE G;  4FPB A;  4BAC A;  2XRI A;  2B5J A;  5J2M A;  5CZ1 A;  4FL9 A;  2QKB A;  3U3G A;  5EY4 A;  4DSK A;  3CCR N;  4IEE A;  3P31 A;  3U8X A;  1U47 A;  3BZK A;  1RBV A;  1BHL A;  1WSG A;  5DM7 L;  4X65 K;  4FWL A;  1LOT B;  4A5A A;  3ULE B;  4CFD A;  1VSL A;  5E84 A;  4BRD A;  1KAZ A;  1EP4 A;  5T7B A;  4FM1 A;  3VEO A;  4YY3 K;  5FRM A;  3DWL A;  4ID5 A;  1SKS A;  5EX5 A;  1RIL A;  5EVZ A;  4DF4 A;  3I0R A;  3A8Y A;  4CJE A;  1N8R O;  2QKK A;  4B3R K;  1T03 A;  3M8P A;  4FWM A;  4GV3 A;  1BI4 B;  1RBS A;  2F96 A;  2P9U B;  2OYQ A;  2O4I A;  2O8C A;  2YI1 A;  2GWK A;  4CIF A;  4CGD A;  2P9L B;  2UXB K;  1CZB A;  4N76 A;  3WXM B;  4BRL A;  2XY7 A;  2YNF A;  4H5T A;  4RW9 A;  1IV0 A;  4DV0 K;  2KFZ A;  2NRV A;  1OH8 A;  2KZZ A;  3RMA A;  4FW1 A;  2BGG A;  1FJG K;  1OH6 A;  3TAQ A;  1HYZ A;  2A40 A;  3O4Q A;  1RTJ A;  5FDL A;  3I55 N;  3GE1 A;  3OS0 A;  2O8E B;  1C0F A;  3HYF A;  2OCE A;  2YJF A;  2ITG A;  3RMD A;  3VEY A;  1RBU A;  3O6W A;  3TAR A;  5LJW A;  1ZC6 A;  4CJU A;  2FXU A;  1U49 A;  1XUP O;  4YOU A;  3SUQ A;  3NH1 A;  4Z0U A;  4E3S A;  4IEI A;  4C23 A;  1U48 A;  3VQ9 A;  2WBN A;  5GIO A;  4WF9 L;  3V9U A;  3CM6 A;  3CJB A;  1KCF A;  3V1O A;  1D9F A;  4OLA A;  3MX5 A;  1SL0 A;  3HI0 A;  3S41 A;  4XH5 A;  3CXC M;  4CEQ A;  4A59 A;  1A5V A;  2E20 A;  1R0A A;  2FF3 B;  4BRO A;  5AZI B;  3O3F A;  3BF1 A;  4W5R A;  3DLE A;  3ZSO A;  4CZJ A;  5AQM A;  4KHQ A;  1Z25 A;  5AQT A;  4M3R A;  4DR3 K;  4JKG B;  4LF9 K;  3W3D A;  4EIA A;  1QSS A;  2P9K A;  4GMJ B;  3NHG A;  1WOQ A;  2QK9 A;  1KTQ A;  4FWR A;  1ZBL A;  2F8T A;  3OJS A;  4BRH A;  4EP5 A;  3DLG A;  3HBT A;  4K8X A;  4JI1 K;  1FKO A;  3ZSV A;  3CYM A;  4BGB A;  4CF0 A;  2DPN A;  4PUO A;  1E4G T;  3AA2 A;  4BG9 A;  3M8Q A;  4BRG A;  4FJX A;  3PIO L;  4NLB A;  3O9S A;  4FXD A;  4AHT A;  4J8F A;  3L3V A;  1OVY A;  3RMB A;  3OYK A;  2G8F A;  3CD6 N;  3RMC A;  1JCF A;  4FWP A;  3ZT4 A;  3ULE A;  3LDS A;  4ILG B;  3U9D A;  1KFS A;  3VA0 A;  3GOI A;  1GLD G;  3VEZ A;  3CME N;  1MA9 B;  3B6O A;  4DR5 K;  1C1A A;  4FJ7 A;  2A6A A;  4DLE A;  1BWF O;  4DQR A;  4LFC K;  4DR2 K;  1DGK N;  4FZZ A;  1K6Y A;  3SUO A;  3V9W A;  1ASV A;  4DQ8 A;  3DXK A;  4BDY A;  3QDK A;  3QIO A;  3O3G A;  3W0L A;  1D4X A;  1T6D A;  3QEX A;  4BRN A;  1U04 A;  2P9U A;  2HHX A;  3TSQ A;  4H4M A;  2RF2 A;  3QB0 A;  4A5B A;  3QBW A;  3E9L A;  3HPH A;  4KB0 A;  2P9L A;  4DF8 A;  1TGO A;  4Z4C A;  3HVT A;  4FLX A;  4DS4 A;  1NGG A;  3CCE N;  1FW6 A;  5J1E A;  4OPJ A;  3O80 A;  1S3X A;  3D0P A;  2O8B B;  1RNH A;  1SAZ A;  1ASW A;  1Z26 A;  2O8E A;  3LAN A;  4JKC A;  1YIJ N;  4KHS A;  1JXE A;  1NBW A;  4IO9 L;  3QIP A;  4W5N A;  3VN5 A;  3TAG A;  1YXQ A;  4FJ9 A;  2Y1I A;  4A2B A;  1S9G A;  3AO1 A;  1BCO A;  2YNI A;  4WQ4 A;  2YHY A;  1VQK N;  5KQ8 A;  1DTT A;  1S1U A;  4LF6 K;  3ZT0 A;  1BA0 A;  4WFN L;  2BE2 A;  2HF3 A;  4CJT A;  4M3Z A;  1VQO N;  4OX9 K;  1U4B A;  3QEW A;  4OKE A;  3ZCM A;  1W0H A;  1W7A A;  4CES A;  4BDP A;  1P90 A;  3WXL A;  3SI6 A;  4FJG A;  1HKB A;  3T19 A;  3E66 A;  4FO0 A;  1CLQ A;  4CHZ A;  3VQE A;  4CJV A;  3S9H A;  3UKU A;  3R1X A;  3ULD A;  4DFP A;  2OTJ N;  3SBG A;  4JKG A;  5E41 A;  4FSV A;  4NXM K;  3ZSY A;  3THW A;  5AJ3 K;  2QEX N;  3AAP A;  3HT3 A;  4B1U B;  4B9Q A;  4M42 A;  3E01 A;  2P51 A;  4FLV A;  4B8A B;  2NRX A;  3ENB A;  1BCM A;  2A42 A;  3VQP A;  5AQU A;  4FJL A;  4N47 A;  4KTQ A;  3VA3 A;  4GV6 A;  3PSF A;  4Y1C A;  1KLM A;  3VF4 A;  1RTI A;  3VF2 A;  3VQQ A;  1N6Q A;  4IDH A;  3KHY A;  4BR0 A;  4FK4 A;  4I7F A;  4N5S A;  3O08 A;  4DCH A;  4JK9 A;  4BR5 A;  1RBR A;  3K58 A;  2F4V K;  4BQL A;  3O9R A;  4DR6 K;  3KD5 E;  1K8K A;  4FK0 A;  3DMJ A;  4DLG A;  1RT5 A;  4NO7 A;  4PL8 A;  4GVM A;  4XIU A;  2VYP A;  4CGG A;  1YVN A;  4R79 A;  3K5N A;  1BIU A;  1DLO A;  2JWK A;  3VGK A;  3HST B;  4CIG A;  1RT2 A;  1JCG A;  4Z4F A;  3TAM A;  3VEX A;  3CC2 N;  1C0U A;  3DRS A;  5LMU K;  1RTD A;  2WTU A;  4ZTF A;  2NRT A;  2YHA A;  3OBW A;  4Q5V A;  3JAM O;  4F3O A;  2W40 A;  4DV7 K;  5BN8 A;  3QNO A;  3AO4 A;  1T3V A;  2W42 A;  3OW2 M;  3VES A;  1BDG A;  2BAN A;  3UKR A;  1J9A A;  1YUW A;  4AHR A;  4ELU A;  4G1Q A;  3LP0 A;  4MLE A;  3TSP A;  3OYH A;  3TAE A;  1HNW K;  2GUP A;  1D5A A;  2ASM A;  4DB3 A;  1WAF A;  3RWU A;  2DTU A;  3KK1 A;  2UYT A;  4CHO A;  3HTV A;  2W41 A;  1O13 A;  2KW4 A;  1DKG D;  2VQE K;  1YTU A;  1EKE A;  1MU2 A;  2EX3 A;  3ID8 A;  4KHW A;  1I3A A;  3OYB A;  3AVA A;  4B1X B;  3T7Z A;  3A2F A;  1YT3 A;  3FFI A;  5TKW A;  4CJ4 A;  1ITG A;  4RG8 A;  4DTN A;  3UIQ A;  1WSI A;  5F0X A;  3CCU N;  3RR7 A;  3VF6 A;  1JLF A;  4ISF A;  5AQN A;  4IOC L;  3HPO A;  5KI6 A;  1CXU A;  4W5Q A;  5KPZ A;  2HBL A;  2NRH A;  3HSC A;  4QOZ B;  3F9K A;  1TK0 A;  3ZX0 A;  3VTI A;  4CJS A;  1BU6 O;  4IOA L;  3DRP A;  3L6Q A;  3EE8 A;  2O4G A;  4KO0 A;  2A5X A;  1NLV A;  1TAQ A;  2HVH A;  4BE2 A;  4IFY A;  1TK5 A;  1TKT A;  1SKW A;  3H46 O;  1VHX A;  3PUF A;  1L3V A;  2HOE A;  1HJR A;  1QVG M;  3FE1 A;  1QQC A;  4KI6 A;  1BGX T;  4GNI A;  1NGI A;  3LL3 A;  4NXN K;  4IDK A;  3O5B A;  1QQN A;  1SL2 A;  3QET A;  3RSE B;  2Q2R A;  3WT0 A;  5C10 A;  3EN9 A;  3CF5 L;  3HP9 A;  3AGK A;  2DFE A;  5AQI A;  4PKG A;  4B3T K;  1HNZ K;  4YNQ A;  2HVI A;  3LZI A;  4FJK A;  2Q0U A;  1VAZ A;  1DT9 A;  3LDO A;  1X9M A;  3VQB A;  3KLE A;  3WNF A;  1D8Y A;  2D0B A;  5HP1 A;  1QTM A;  4DQP A;  3OYC A;  5HL7 L;  2D0C A;  3D45 A;  3QO9 A;  2WFB A;  4LY7 A;  4I9Q A;  3ID6 A;  4RW4 A;  1YJN N;  4V19 S;  1NGD A;  3DI6 A;  5HRS A;  4IG0 A;  1YJW N;  4FM2 A;  1IG9 A;  1XWL A;  4LF5 K;  1NKE A;  5HRN A;  1G15 A;  1KSP A;  4C8L A;  2FBT A;  5GAG P;  3U9Z A;  1IJJ A;  2NRR A;  4NCB A;  3L0Q A;  1SL1 A;  2D1K A;  4CBX A;  1KLN A;  1KAX A;  5HLF A;  3B6P A;  2QXF A;  3ENO A;  3QNN A;  3THV A;  5LJV A;  4KBO A;  3LDL A;  3EKS A;  4CHQ A;  4CEZ A;  1L3T A;  2X6S A;  4M41 A;  4YOV A;  4DU1 A;  4BWM A;  4ISG A;  3ATV A;  4GVE A;  3UB5 A;  1H1V A;  4BR7 A;  3VQC A;  1HX1 A;  1T05 A;  4ID1 A;  5HRR A;  4JV5 K;  2VGN A;  3CJC A;  1S22 A;  1NJW A;  4C8M A;  3ZSZ A;  1TK8 A;  1YI2 N;  4B9V A;  3CQ8 A;  2X6N A;  3J80 O;  3VQ7 A;  4JI0 K;  1VQ6 N;  5CY4 A;  4FW2 A;  4PL7 A;  1M90 O;  2FC0 A;  2VWJ A;  3CCQ N;  1HLU A;  4O5F A;  3DLK A;  4BRM A;  2VG7 A;  4J2E A;  2E6M A;  4Z4H A;  2G8W A;  5DK5 A;  2A41 A;  1QZ6 A;  2D0A A;  4M3X A;  3DYA A;  3VER A;  3ZYY X;  4JKE A;  1FK9 A;  2GEM A;  3GBT A;  1NGF A;  4FLU A;  4E7H A;  4JD2 B;  4JKD A;  1VK0 A;  3WQT A;  1BQM A;  1HMV A;  3LAM A;  4KTW A;  2BDP A;  4EZ9 A;  3CQY A;  3NCI A;  1C0G A;  1OH7 A;  1VSM A;  4JAX A;  2G8H A;  4KRE A;  3G25 A;  3MCA B;  3PX4 A;  1XNQ K;  2KKZ A;  4WE1 A;  4EZ6 A;  5LY3 A;  4F2S A;  2ZJP L;  3RSE A;  2RPI A;  2UXC K;  4ICL A;  3MN5 A;  3LP2 A;  2QTD A;  1KXP A;  4CZL A;  3L8B A;  3LDN A;  2CH6 A;  4QS8 A;  2LSN A;  5HBM A;  1RT6 A;  4Z4I A;  4PY5 A;  3DOK A;  4BQZ A;  3LM2 A;  1EXQ A;  1QQO A;  4YFU A;  1ATS A;  4FZY A;  3G6E N;  1Z6R A;  1Y64 A;  4C8K A;  3R9P A;  3A5L C;  1REV A;  3FFK B;  2YKM A;  2OZM A;  1J6Z A;  4KH6 A;  3TWH A;  4K42 A;  1UOC A;  3R8E A;  4MFB A;  3MN7 A;  4F3T A;  4ILJ A;  4B1Y B;  3A5N C;  5HRP A;  5J2P A;  3BY5 A;  4CZI A;  1IKV A;  4KFB A;  3R3L A;  2NRZ A;  2Q3S A;  1LW2 A;  4H4O A;  5FPE A;  4N41 A;  2GTD A;  1LAV A;  3S3M A;  4LF8 K;  4CEA A;  3OYJ A;  3L2R A;  4CD3 A;  2XY6 A;  3P5J A;  3DXK B;  4BVO A;  2WON A;  4JI4 K;  3FGU A;  2QXL A;  3WUH A;  4IFV A;  3KWI A;  4BWJ A;  5BR8 K;  5FRN A;  1JXB A;  4NLC A;  1NWK A;  1QHA A;  1NOY A;  3VTH A;  5AQZ A;  2P5G A;  2E2N A;  3TAP A;  2YNH A;  4B3M K;  1XQS C;  3AV9 A;  4JHD B;  4E1N A;  5BPM A;  3QEV A;  4BRE A;  3NFA A;  2HNY A;  4I9L A;  1TYQ A;  2KQ2 A;  3CET A;  3KJV A;  1WB9 A;  1P8Z A;  4O8U A;  4DFJ A;  3QBX A;  4LF7 K;  3HJF A;  3OYE A;  2DFF A;  2I7P A;  5H1S Q;  3SMS A;  4CF1 A;  3VMF B;  2HMP A;  5ELZ A;  1KAY A;  5BPL A;  4OGE A;  4C1N K;  3O3H A;  3KK2 A;  3BUZ B;  4JD2 A;  1UA0 A;  4FWK A;  3OVN A;  5CZ2 A;  4UQG A;  2OTL N;  4E7I A;  2KZM A;  1IBK K;  4CJ3 A;  3TR8 A;  4JI7 K;  2RN2 A;  3THY B;  2HMI A;  4AF1 A;  4FZX C;  2OPS A;  1TVR A;  1ZBI A;  3MCP A;  4BC2 A;  2HHU A;  1X9S A;  4JI8 K;  1IG8 A;  5M1F A;  3UKU B;  1OH5 A;  4EAH D;  2ASP A;  1HNV A;  5KPR A;  4KHP K;  3OYM A;  2V7Y A;  3HXM A;  2E5L K;  3OYG A;  3KTQ A;  2Q97 A;  4BRQ A;  3ZSQ A;  1YTA A;  3NVK A;  5A2Q O;  4WCE L;  5LMN K;  3THW B;  3PO4 A;  4B9T A;  3AVJ A;  3NGZ A;  1RDB A;  2E8A A;  4DTR A;  5JIC A;  3OBY A;  1WNS A;  4DTS A;  3AO3 A;  3N4P A;  1XMQ K;  2P5O A;  1RDW X;  4RW6 A;  3PY8 A;  5I42 A;  1S5J A;  5FPM A;  3A0I X;  3J7Y P;  2PY5 A;  4JRP A;  4FPA A;  3SZ2 A;  3EO3 A;  2P9I B;  4K43 A;  2P1J A;  1IKY A;  3WNE A;  2ZGZ A;  3D2F A;  4DTP A;  2BUP A;  4JN4 A;  1D9D A;  2A3Z A;  3AVI A;  3VEV A;  2A1S A;  3LZJ A;  4J2D A;  1K8K B;  1VQP N;  1JL2 A;  1I39 A;  4LFB K;  4BG8 A;  1Y97 A;  2IAJ A;  4DQS A;  4ELT A;  4CE9 A;  1MDU B;  2QWN A;  3SQ2 A;  1VQN N;  4AM6 A;  3OYF A;  1JLB A;  2E6L A;  1J53 A;  3OS1 A;  2CGK A;  3TPQ A;  4BC3 A;  2IVP A;  1IH7 A;  3KZB A;  4B9S A;  1CZ9 A;  3M8R A;  3SJH A;  5B8H A;  3O1B A;  3FZH A;  5JS1 A;  3ZLJ A;  2GV9 A;  1ZBU A;  4OKK A;  4JHD A;  4DR7 K;  1QS4 A;  2Z1I A;  1NJI O;  1B9D A;  4W5O A;  3ENH A;  3UKR B;  2XHB A;  1YHQ N;  1NGC A;  1NMD A;  3H1Q A;  4OKJ A;  3MN6 A;  3IFR A;  4DG1 A;  5AR0 A;  1C1C A;  3LDQ A;  4M7Y A;  3AA3 A;  3SV4 A;  1WSJ A;  4O5B A;  3K5L A;  3ITH A;  4XH4 A;  4HUG A;  1BIZ A;  3QIN A;  4DV3 K;  4B3S K;  4CJW A;  3V6D A;  1XC9 A;  2QWQ A;  2VG6 A;  4DU4 A;  3C65 A;  1RGI A;  3TAN A;  4RW8 A;  1N36 K;  2ZWH A;  4A2A A;  3K5M A;  4ZHR A;  3NH0 A;  1HRH A;  3THY A;  1NG9 A;  1Q86 O;  2QW9 A;  5AQS A;  4FJJ A;  3LAK A;  4CGH A;  1VSD A;  4FLZ A;  1RT7 A;  1NK9 A;  1V4T A;  4KHN A;  3CER A;  3HL8 A;  3TAF A;  1RCH A;  3NF8 A;  3FZF A;  1VQ5 N;  1T44 A;  3K0S A;  1ESV A;  4FJI A;  3OTO K;  4DV2 K;  3Q7C A;  1M1K O;  3CHW A;  4JKH A;  3QIC A;  5BRD A;  1TAU A;  3D7E O;  5C12 A;  2P9N A;  5HRO A;  1T6C A;  3C6T A;  4YOR A;  5ADX H;  2OA8 A;  4HCC A;  2NZT A;  2QWL A;  1J54 A;  2HHW A;  1LWC A;  3JSM A;  3LPT A;  3NF7 A;  3L4Q A;  2CGL A;  4CD1 A;  2HBM A;  2Z1G A;  4K25 A;  2P9I A;  5BPN A;  2AA4 A;  4FK2 A;  1S1X A;  4BR9 A;  1IBM K;  4L8R B;  2P9P B;  4WFB L;  2IS3 A;  1NMN A;  3LWM A;  4JRQ A;  4EFH A;  2EHG A;  1HYS A;  1QSY A;  3E9P A;  3SYZ A;  4CCH A;  2BH1 A;  3D6R A;  1EWR A;  5AQF A;  4WQ4 C;  1LW0 A;  2O8F A;  5JVG L;  2QWP A;  2ZGY A;  4PHT X;  5J2N A;  4E19 A;  4H5W A;  3F2K A;  4H5R A;  5C2D A;  3CFR A;  1RDU A;  3TSU A;  1C1B A;  1DTQ A;  4M3Y A;  2O8D B;  3H1V X;  3GL1 A;  5GAE P;  1HKG A;  4B1V A;  3S3N A;  3CPW M;  4YOT A;  1NGE A;  1B92 A;  3WXJ A;  4UY8 O;  1LWF A;  5M1P A;  3FZL A;  3O1W A;  3J8A A;  4JKB A;  3FZM A;  4HHT A;  4KAZ A;  1NNE A;  2B6A A;  3VQA A;  3V9S A;  2IIR A;  4ISE A;  4BE0 A;  2G8V A;  4CK1 A;  4CFC A;  1NJY A;  4HTU A;  4GY2 B;  3TTF A;  3HRG A;  3FR0 A;  4ELV A;  1S1T A;  2HB5 A;  4K8Z A;  5AQK A;  2ZJR L;  4J2A A;  3WNH A;  5BRE A;  4L3Q A;  4U67 L;  3BP8 A;  2ZE2 A;  1S6Q A;  4QCL A;  3H3O B;  3CCS N;  3OYD A;  4PA1 A;  3CM5 A;  4AHS A;  1TKZ A;  5AQJ A;  3HP6 A;  3MEC A;  2ITM A;  3IDH A;  4YDU A;  2FLO A;  5CYM A;  4CVN E;  3G4S N;  3OYI A;  4PQU A;  4DS5 A;  3NF9 A;  3NH2 A;  4AH9 A;  3ATU A;  5ADX A;  1TV6 A;  4CJ7 A;  1XI1 A;  1KD1 O;  2IVN A;  4B9L A;  4WQ5 A;  4CJQ A;  3HO1 A;  4M7X A;  4E7L A;  3U3Y A;  3M8S A;  3R6M A;  3K9J A;  2Z1H A;  3ASM A;  3I0S A;  1GOC A;  3WQU A;  4CJF A;  3MAQ A;  2YHB A;  4C1N I;  2FSN A;  4F9O A;  4GKJ K;  3PSI A;  1KC8 O;  3DLR A;  2ATQ A;  2JLE A;  3VEN A;  2UU9 K;  3VGL A;  4B9N A;  1G99 A;  5BRH A;  2EWS A;  3VGM A;  2HHV A;  3LM9 A;  1KFD A;  1VSH A;  5AQW A;  3IG1 A;  3T1H K;  1W2B M;  3EKU A;  2FF6 A;  1HPM A;  3KLI A;  1GOB A;  2P9P A;  5SZT A;  4RTF D;  2G8U A;  2HHH K;  3HK2 A;  1Q9X A;  4DV4 K;  3M6G A;  4HWI A;  3GG4 A;  1KVB A;  4H0X B;  5KPT A;  4BR4 A;  4I6M A;  4B08 A;  4GW6 A;  4NCG A;  4QAG A;  2D0O A;  1EO1 A;  3VQD A;  1JL1 A;  4FVM A;  1QVF M;  4IWV A;  1VQ4 N;  4JKF A;  1Q9Y A;  2F8S A;  1JKH A;  4HUE A;  3CCL N;  5C0Y A;  2AP1 A;  3MEG A;  4DTX A;  2O8D A;  2YJE A;  1VSJ A;  5CE3 A;  1NKB A;  3KVG A;  4E1M A;  3OYL A;  2HST A;  1WBB A;  3I8D A;  1RT3 A;  4B9M A;  2WUS A;  4YDU C;  1CZA N;  1ZYQ A;  1YVU A;  2W6L A;  4M63 C;  2RHK A;  1QHT A;  3LDP A;  4CJ5 A;  5M1Q A;  4IFE A;  1VQ9 N;  3CI5 A;  1X3M A;  3KWG A;  3PV8 A;  3H6E A;  4FOI A;  5AQQ A;  1U2V B;  3UE5 A;  3M1F A;  3EEQ A;  4H0T B;  4WQ5 C;  1NU0 A;  5C42 A;  4CI6 A;  4E0D A;  3PX6 A;  5JLH A;  1TUU A;  2XO7 A;  1TUY A;  1Q82 O;  1EX4 A;  4JKA A;  4MQ3 A;  5JVH L;  2E1Y A;  4MDA A;  1NJX A;  2WOM A;  4XH1 A;  1LAW A;  3RRH A;  2UXD K;  1SUQ A;  5TKY A;  2NNW A;  3DXM A;  3AAQ A;  3QES A;  2KHO A;  4CEF A;  2V52 B;  1XMO K;  4LF4 K;  2VCP A;  4CZF A;  3T1A A;  1SKR A;  1KRP A;  3AVF A;  3A5M C;  3OJU A;  3O9T A;  1R59 O;  3CJ7 A;  2CGJ A;  3MXM A;  1TYQ B;  3IUC A;  3ZX3 A;  1RDD A;  2YV0 X;  5EU7 A;  4DHY A;  1ATR A;  4TSX A;  1IKW A;  4FJ5 A;  3V4I A;  3QER A;  3VQ4 A;  2HHS A;  2J4R A;  3IAY A;  1XHX A;  1JLG A;  2DY4 A;  4IOX A;  2ZD1 A;  3HZ6 A;  3ZSX A;  5AQP A;  1RFQ A;  1SV5 A;  2ZQB A;  3TI0 A;  1J5O A;  1NJZ A;  3CC7 N;  3SV3 A;  3THX A;  3I8B A;  4FLW A;  1TL1 A;  3L3U A;  4NYF A;  3VPZ A;  5GAH P;  4CGI A;  2PYL A;  1WLJ A;  2E88 A;  4DSL A;  2QWO A;  3AA4 A;  4FWN A;  3O8M A;  1L5U A;  4DV5 K;  3BGR A;  3KIO A;  4DTO A;  3CJ1 A;  4H0P A;  4G9Z A;  4BRA A;  2PYJ A;  4FWS A;  1JCE A;  1NK4 A;  5GIP A;  2VGM A;  4MO4 A;  2UUB K;  4RCH A;  1U6Z A;  2YKN A;  3ZT1 A;  2KFN A;  3OS2 A;  3HVR A;  1W97 L;  4OGC A;  1RT4 A;  3AVB A;  1XHZ A;  3SAG A;  1W9H A;  4C8N A;  3KK3 A;  1K9M O;  2VWB A;  1UWB A;  4YOW A;  4YOX A;  4CEO A;  2XY5 A;  3KKS A;  4MLH A;  4CEC A;  1YJ9 N;  2JWL A;  4H0O A;  3F9M A;  1BIS A;  4FLT A;  3NMU A;  5J2Q A;  3DM2 A;  3D2F B;  5CR4 A;  4K0K K;  3V1R A;  3SNN A;  1U2V A;  4BR2 A;  3PX0 A;  3OA9 A;  1QSL A;  1C0M A;  1BO5 O;  1L3S A;  4JI6 K;  2VQF K;  2YCH A;  4CGF A;  5BR9 A;  5AQL A;  1QE1 A;  1GLB G;  2F7T A;  4N56 A;  2H3G X;  4CFB A;  4M3W A;  4DTM A;  4MO5 A;  3J7A P;  4DUZ K;  4OLB A;  3K9K A;  3MDQ A;  4F4K A;  1S1V A;  5SWM A;  2Y1J A;  2F9W A;  3AVL A;  1DEJ A;  2P9S B;  2Z1J A;  2DFH A;  5IT9 O;  3VQ5 A;  4KB1 A;  3CJ9 A;  4DTJ A;  4DQI A;  1QZ5 A;  1C6V A;  4AIL C;  3HPG A;  3SJJ A;  3CG7 A;  2GUI A;  4IO8 A;  4JK8 A;  2QWR A;  3V9Z A;  1N32 K;  3CMA N;  3JXU A;  4FYD A;  4CIE A;  5FLX O;  5KQD A;  2UUA K;  1FXX A;  1IKX A;  3K2P A;  5DM6 L;  3Q7B A;  3CJA A;  5CYQ A;  3LAL A;  4A57 A;  1FKP A;  4O8K A;  3VQ6 A;  3T69 A;  1KVC A;  1BG3 A;  1X3N A;  3SQ4 A;  3TTC A;  1Q8I A;  4JYA K;  2PAV A; 
#chains in the Genus database with same CATH homology
 4R5P A;  4CGJ A;  3V9X A;  4O4G A;  3OYN A;  3EY1 A;  4FJJ A;  3LAK A;  4QOZ B;  4CGH A;  1VSD A;  3AVM A;  3K5O A;  3QLH A;  1RT7 A;  5KGX A;  4FLZ A;  1NK9 A;  3EZ5 A;  4KHN A;  3F9K A;  3HL8 A;  3TAF A;  4CJK A;  1RCH A;  1TK0 A;  3ZT3 A;  3NF8 A;  4CJR A;  4CJS A;  3DRP A;  4FJI A;  2O4G A;  2VWK A;  1T7P A;  4KO0 A;  4CK3 A;  4AHU A;  1TAQ A;  2HVH A;  4H8K A;  4BE2 A;  4IFY A;  4DTU A;  1TK5 A;  4F8R A;  4F2R A;  3NF6 A;  1HQE A;  1TKT A;  1SKW A;  1TAU A;  2IDO A;  3BDP A;  3PUF A;  5HRO A;  1L3V A;  3C6T A;  3C94 A;  2AJQ A;  1HJR A;  3K57 A;  5FRO A;  4DSE A;  3P83 D;  2OA8 A;  1QQC A;  4HCC A;  2YNG A;  3AVK A;  1BGX T;  3P1G A;  1J54 A;  4O44 A;  4CJL A;  3OY9 A;  4KI6 A;  2HHW A;  3IS9 A;  1LWC A;  2VG5 A;  3VQ8 A;  2IC3 A;  3JSM A;  3C95 A;  4IDK A;  3LPT A;  4JLH A;  1ZBF A;  3NF7 A;  5C24 A;  1SL2 A;  3QET A;  3O4N A;  4M3T A;  2Z1G A;  3NBP A;  1NK6 A;  4FJM A;  1WSH A;  4FK2 A;  1S1X A;  1JLE A;  1RT1 A;  1NKC A;  3HP9 A;  1F21 A;  2DFE A;  4L8R B;  4HUF A;  2HHT A;  4FLY A;  3SQ1 A;  1ASU A;  1NOZ A;  3U6F A;  2IS3 A;  3LWM A;  4JRQ A;  4YNQ A;  2HVI A;  3LZI A;  2EHG A;  1HYS A;  1QSY A;  3SYZ A;  4BAC A;  2XRI A;  4FJK A;  1X9M A;  2B5J A;  5J2M A;  3VQB A;  3KLE A;  4CCH A;  5CZ1 A;  3WNF A;  1D8Y A;  2D0B A;  5HP1 A;  2QKB A;  3QEI A;  1QTM A;  3U3G A;  3LPU A;  4DQP A;  3OYC A;  4M45 A;  1LW0 A;  4DSK A;  2D0C A;  1S1W A;  3D45 A;  3QO9 A;  5J2N A;  4E19 A;  1U47 A;  4LY7 A;  3CFR A;  4I9Q A;  3S3O A;  4RW4 A;  4DWI A;  1RBV A;  1BHL A;  1WSG A;  3DI6 A;  1C1B A;  5HRS A;  1DTQ A;  3C6U A;  4IG0 A;  4FM2 A;  4AHC A;  3V81 A;  1IG9 A;  4M3Y A;  1XWL A;  1NK8 A;  1NKE A;  2OPR A;  2FBY A;  5HRN A;  4DFK A;  1G15 A;  4HCB A;  3LP3 A;  4DQQ A;  1KSP A;  4C8L A;  2FBT A;  3RTV A;  3ZSR A;  4CFD A;  4KPY A;  1VSL A;  3S3N A;  5DMR A;  1EP4 A;  5T7B A;  4FM1 A;  3SCX A;  4NCB A;  5FRM A;  2G8K A;  1SL1 A;  1ZBH A;  1B92 A;  2NUB A;  4ID5 A;  1KLN A;  1SKS A;  1LWF A;  4DMN A;  1RIL A;  4LSL A;  4DF4 A;  5HLF A;  3H08 A;  3I0R A;  4CJE A;  4HHT A;  3B6P A;  2QXF A;  2QKK A;  4KAZ A;  3QNN A;  3THV A;  1BI4 A;  2B6A A;  3VQA A;  3V9S A;  3M8P A;  1T03 A;  4CHQ A;  4CEZ A;  1L3T A;  2X6S A;  4CER A;  3NE6 A;  4BDZ A;  4BE0 A;  1BI4 B;  4M41 A;  2G8V A;  1RBS A;  4CK1 A;  1VSE A;  2F96 A;  3EYZ A;  4HVJ A;  4DU1 A;  4Y1D A;  2OYQ A;  4CFC A;  4BWM A;  1CXQ A;  1BQN A;  2O4I A;  1NJY A;  3KLF A;  4DSI A;  4HTU A;  3VQC A;  3AVH A;  4CIF A;  4CGD A;  1T05 A;  2R7Y A;  4ELV A;  4ID1 A;  1CZB A;  1S1T A;  2HB5 A;  5HRR A;  2XY7 A;  4N76 A;  2YNF A;  4K8Z A;  4RW9 A;  4J2A A;  3WNH A;  2KFZ A;  1NJW A;  4C8M A;  3ZSZ A;  1TK8 A;  4B9V A;  3RMA A;  2KZZ A;  3KLH A;  4FW1 A;  3DRR A;  3CQ8 A;  2BGG A;  2X6N A;  2ZE2 A;  1S6Q A;  3VQ7 A;  4QCL A;  3AA5 X;  5KGW A;  3TAQ A;  1HYZ A;  5CY4 A;  3O4Q A;  4FW2 A;  1JLQ A;  2FC0 A;  1RTJ A;  4PA1 A;  3CM5 A;  5FDL A;  3OYD A;  2VWJ A;  3OS0 A;  4AHS A;  1TKZ A;  4O55 A;  3HYF A;  1RDC A;  3HP6 A;  3MEC A;  3DLK A;  2ITG A;  2VG7 A;  4J2E A;  2E6M A;  4Z4H A;  3RMD A;  1RBU A;  5CYM A;  2G8W A;  5DK5 A;  3TAR A;  2JGU A;  4CJU A;  2D0A A;  4M3X A;  3DYA A;  3OYI A;  1U49 A;  4PQU A;  3SUQ A;  4DS5 A;  3NH1 A;  3NF9 A;  4Z0U A;  4E3S A;  3NH2 A;  1U48 A;  3VQ9 A;  4AH9 A;  3T3F A;  1TV6 A;  1XI1 A;  1FK9 A;  3RRG A;  4B9L A;  3HM9 A;  3V9U A;  3CM6 A;  4FLU A;  4CJQ A;  4E7H A;  3HO1 A;  4CED A;  1VK0 A;  1WSE A;  1A5X A;  1BQM A;  1HMV A;  1GOA A;  3LAM A;  1KCF A;  4KTW A;  3V1O A;  4E7L A;  3U3Y A;  2HHQ A;  3M8S A;  1D9F A;  2BDP A;  4EZ9 A;  4OLA A;  3NCI A;  2Z1H A;  3ASM A;  3I0S A;  1GOC A;  4CJF A;  3MAQ A;  1SL0 A;  2I5J A;  1HYV A;  1VSM A;  2YHB A;  4CEQ A;  1WAJ A;  1A5V A;  4CEE A;  2G8H A;  1R0A A;  4KTZ A;  3L2Q A;  4FJH A;  4KRE A;  3K59 A;  3DLR A;  2ATQ A;  2JLE A;  3O3F A;  3PX4 A;  4W5R A;  3AO2 A;  4WE1 A;  4EZ6 A;  2KTQ A;  1B9F A;  3DLE A;  3ZSO A;  2PZS A;  1HPZ A;  3KKR A;  4B9N A;  4F2S A;  2RPI A;  2HHV A;  4E7K A;  4ICL A;  1KFD A;  1VSH A;  4KHQ A;  1JLA A;  1Z25 A;  3IG1 A;  3LP2 A;  4O0J A;  3DLB A;  4M3R A;  4DSF A;  3L8B A;  3G0Z A;  1GOB A;  3KLI A;  5SZT A;  2G8U A;  1JLC A;  3HK2 A;  3V1Q A;  1QSS A;  1TKX A;  4GMJ B;  4W5T A;  2LSN A;  5HBM A;  1RDA A;  1RT6 A;  3NHG A;  1Q9X A;  4J2B A;  4Z4I A;  2QK9 A;  4PY5 A;  1KTQ A;  1KVB A;  4KHY A;  4OPK A;  1ZBL A;  2F8T A;  3DOK A;  4B08 A;  4GW6 A;  4NCG A;  4EP4 A;  1WN7 A;  4QAG A;  3OJS A;  4EP5 A;  1VSK A;  3DLG A;  3VQD A;  1EXQ A;  4YFU A;  4FZY A;  4K8X A;  1FKO A;  1JL1 A;  3ZSV A;  3CYM A;  4FVM A;  4CF0 A;  4LH4 A;  4PUO A;  3AVG A;  4C8K A;  3AA2 A;  1REV A;  2OZM A;  2YKM A;  4M3U A;  3M8Q A;  1Q9Y A;  4CFA A;  2F8S A;  4FJX A;  1JKH A;  4CHP A;  4HUE A;  3TWH A;  3MEG A;  4DTX A;  1UOC A;  1VSJ A;  2E4L A;  4IBN A;  4AHT A;  1X9W A;  1NKB A;  4FXD A;  3L3V A;  4E1M A;  3OYL A;  4MFB A;  3RMB A;  2G8F A;  3OYK A;  4F3T A;  3RMC A;  3I8D A;  1RT3 A;  2HNZ A;  3ZT4 A;  4B9M A;  1ZYQ A;  2XY8 A;  5HRP A;  5J2P A;  1YVU A;  3LDS A;  4IKF A;  4DSJ A;  1KFS A;  1C0T A;  1QHT A;  1IKV A;  4CJ5 A;  3VA0 A;  3SPY A;  3KD1 E;  3B6O A;  4AHV A;  4OVL A;  1C1A A;  4KFB A;  4FJ7 A;  3PV8 A;  4DLE A;  2Q3S A;  1LW2 A;  4H4O A;  4N41 A;  4DQR A;  1O1W A;  4FZZ A;  1K6Y A;  3SUO A;  3V9W A;  1ASV A;  1LAV A;  4BDY A;  3S3M A;  5C42 A;  4E0D A;  3PX6 A;  1EET A;  3QIO A;  4CEA A;  3O3G A;  3OYJ A;  2XO7 A;  3L2R A;  4CF8 A;  2XY6 A;  3QEX A;  1NK5 A;  3P5J A;  1U04 A;  2WON A;  2HHX A;  1EX4 A;  4MQ3 A;  3LWL A;  4H4M A;  4Z4G A;  4IFV A;  3OYA A;  2RF2 A;  4C8O A;  1NJX A;  4BWJ A;  2WOM A;  3HPH A;  1LAW A;  4KB0 A;  3RRH A;  5FRN A;  4DF8 A;  1SUQ A;  1JXB A;  1TGO A;  4Z4C A;  3HVT A;  4CEB A;  4FLX A;  4DS4 A;  3CFO A;  2RKI A;  1NOY A;  2P5G A;  4O0I A;  3QES A;  4CEF A;  4FCY A;  5J1E A;  4OPJ A;  3D0P A;  3SUP A;  3TAP A;  2YNH A;  3MED A;  3AV9 A;  1RNH A;  4NCA A;  4KKO A;  4E1N A;  3QEV A;  3T1A A;  1SKR A;  3NFA A;  1KRP A;  3AVF A;  2HNY A;  3OJU A;  1ASW A;  1Z26 A;  4I9L A;  3LAN A;  4LD0 A;  1S9E A;  1S6P A;  2KQ2 A;  2IGI A;  3G10 A;  3F73 A;  3MXM A;  4KHS A;  1JXE A;  3KJV A;  3QIP A;  3AO5 A;  4BE1 A;  3ZSW A;  4W5N A;  4DFJ A;  3HJF A;  1RDD A;  3VN5 A;  3OYE A;  2DFF A;  2YV0 X;  5EU7 A;  3TAG A;  1IO2 A;  4FJ9 A;  2Y1I A;  4CF1 A;  1LWE A;  1TKD A;  1S9G A;  3IRX A;  4TSX A;  1IKW A;  4FJ5 A;  3V4I A;  3AO1 A;  1BCO A;  3QER A;  2YNI A;  3VQ4 A;  4JS4 A;  2HHS A;  3IAY A;  3MXJ A;  1DTT A;  1S1U A;  1XHX A;  4OGE A;  3O3H A;  3WNG A;  4B8C A;  3KK2 A;  3ZT0 A;  2BE2 A;  1JLG A;  2DY4 A;  5C25 A;  4CJT A;  1UA0 A;  4M3Z A;  2ETJ A;  2ZD1 A;  4IG3 A;  3LP1 A;  3ZSX A;  3QEW A;  2FBX A;  1U4B A;  4B9U A;  3OVN A;  1SV5 A;  2ZQB A;  4OKE A;  1W0H A;  5CZ2 A;  3ZCM A;  4CES A;  1RBT A;  4UQG A;  3L2U A;  3TI0 A;  4BDP A;  4E7I A;  4KRF A;  3SI6 A;  2KZM A;  1J5O A;  1NJZ A;  4CJ3 A;  2HW3 A;  3TR8 A;  3AVN A;  3SV3 A;  2RN2 A;  4FJG A;  3T19 A;  2HMI A;  4FLW A;  4FJN A;  1TL1 A;  4FZX C;  3L3U A;  1CLQ A;  1VRU A;  2OPS A;  4CHZ A;  3RR8 A;  3VQE A;  1TVR A;  1ZBI A;  4NYF A;  4CGI A;  4CJV A;  3S9H A;  4NYN A;  2PYL A;  1X9S A;  1WLJ A;  2HHU A;  3PO5 A;  4DSL A;  3AA4 A;  3ULD A;  4FM0 A;  4FJ8 A;  2B4J A;  4DFP A;  1L5U A;  3BGR A;  3KIO A;  4DTO A;  2OPQ A;  5KRT A;  1HNV A;  5E41 A;  3OYM A;  3HXM A;  3OYG A;  3KTQ A;  3ZSY A;  4Q0B A;  3ZSQ A;  1YTA A;  3HT3 A;  2PYJ A;  4I2P A;  4M42 A;  3NGI A;  3E01 A;  1NK4 A;  2P51 A;  4FLV A;  3PO4 A;  4B8A B;  4B9T A;  3AVJ A;  4CHY A;  3NGZ A;  1A5W A;  1BCM A;  1RDB A;  3VQP A;  2YKN A;  2OPP A;  3ZT1 A;  4DTR A;  4N47 A;  4FJL A;  3DOL A;  2KFN A;  5JS2 A;  4KTQ A;  1WNS A;  3VA3 A;  3OS2 A;  3HVR A;  4DTS A;  3AO3 A;  4Y1C A;  2GBZ A;  1VSI A;  4OGC A;  2P5O A;  1KLM A;  4RW6 A;  3PY8 A;  5I42 A;  1RT4 A;  1RTI A;  1S5J A;  3AVB A;  5K14 A;  1XHZ A;  1W9H A;  3VQQ A;  4C8N A;  2PY5 A;  3KK3 A;  1N6Q A;  1N5Y A;  2X74 A;  4JRP A;  4B3O A;  1UWB A;  4FK4 A;  5KRS A;  3SZ2 A;  4CEO A;  4I7F A;  2XY5 A;  3KKS A;  4N5S A;  4CEC A;  2P1J A;  1UAX A;  1IKY A;  5D3G A;  1LV5 A;  3WNE A;  1RBR A;  4CF2 A;  3K58 A;  1BL3 A;  1BIS A;  4FLT A;  4DTP A;  4DFM A;  1D9D A;  5J2Q A;  3KD5 E;  4LH5 A;  3AVI A;  3DM2 A;  4FK0 A;  3DMJ A;  4KHU A;  2A1S A;  4DLG A;  2A1R A;  1RT5 A;  3V1R A;  3SNN A;  3LZJ A;  3PX0 A;  4GVM A;  4XIU A;  4J2D A;  1JL2 A;  1I39 A;  2OZS A;  1QSL A;  1Y97 A;  4CGG A;  1C0M A;  2IAJ A;  1L3S A;  4DQS A;  3SPZ A;  4ELT A;  3K5N A;  2D5R A;  1BIU A;  4CE9 A;  3JYT A;  3NAE A;  4LSN A;  1DLO A;  4CGF A;  3SQ2 A;  3SUN A;  3OYF A;  2X78 A;  4KI4 A;  1JLB A;  2E6L A;  3CFP A;  1WSF A;  4I2Q A;  1QE1 A;  1J53 A;  3HST B;  1KVA A;  3NGY A;  4CIG A;  1RT2 A;  3OS1 A;  3L2V A;  3QEP A;  5I3U A;  4Z4F A;  3TAM A;  3ISN C;  4N56 A;  4CFB A;  1C0U A;  3DRS A;  3NDK A;  4M3W A;  4JS5 A;  4CHN A;  1X1P A;  1RTD A;  4ZTF A;  1IH7 A;  2YHA A;  1HQU A;  4DTM A;  4Q5V A;  3SQ0 A;  4F3O A;  4KV8 A;  4B9S A;  4OLB A;  4F4K A;  4Z4E A;  1CZ9 A;  3AO4 A;  3M8R A;  3QNO A;  1RTH A;  1S1V A;  5SWM A;  2W42 A;  4DU3 A;  4E89 A;  2GV9 A;  2Y1J A;  1HNI A;  1ZBU A;  3MXI A;  4OKK A;  4ZTJ A;  5JS1 A;  3AVL A;  4RW7 A;  2BAN A;  3TAB A;  1QS4 A;  2Z1I A;  1B9D A;  1J9A A;  4AHR A;  4ELU A;  2Z1J A;  4G1Q A;  4W5O A;  3LP0 A;  2XHB A;  2DFH A;  4OKJ A;  3OYH A;  3TAE A;  3VQ5 A;  4KB1 A;  1UA1 A;  1D5A A;  4DG1 A;  1VSF A;  2FBV A;  4DTJ A;  1WAF A;  1C6V A;  4DQI A;  3RWU A;  2IOC A;  2DTU A;  3KK1 A;  4CHO A;  4AIL C;  1C1C A;  3HPG A;  3L2W A;  3KLG A;  3SJJ A;  1NK7 A;  2G8I A;  3AA3 A;  3CG7 A;  2GUI A;  2KW4 A;  4CK2 A;  1WSJ A;  3SV4 A;  1T8E A;  3MEE A;  4O5B A;  3K5L A;  3ZT2 A;  3ITH A;  3V9Z A;  1EKE A;  1MU2 A;  2EX3 A;  1YTU A;  4FYD A;  1NK0 A;  4CIE A;  4HUG A;  4KHW A;  1I3A A;  1BIZ A;  3OYB A;  3AVA A;  1TL3 A;  1FXX A;  4CJP A;  1IKX A;  4CF9 A;  3K2P A;  3A2F A;  3QIN A;  1YT3 A;  3FFI A;  4CJW A;  4OJR A;  3V6D A;  1XC9 A;  4PWD A;  5CYQ A;  2VG6 A;  3LAL A;  1ITG A;  1VRT A;  4CJ4 A;  4RG8 A;  5KTQ A;  4DU4 A;  4DTN A;  3DLH A;  1FKP A;  3VQ6 A;  1L3U A;  3UIQ A;  1WSI A;  1U45 A;  3TAN A;  1KVC A;  3RR7 A;  4RW8 A;  3ALY A;  1JLF A;  2HND A;  3SQ4 A;  3K5M A;  4ZHR A;  3NH0 A;  4E7J A;  1HRH A;  1Q8I A;  3HPO A;  3AVC A;  5KI6 A;  1CXU A;  4W5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...