3ALYA

Crystal structure of rnase hi from sulfolobus tokodaii with c-terminal deletion
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
MIIGYFDGLCEPKNPGGIATFGFVIYLDNRKIEGYGLAEKPFSINSTNNVAEYSGLICLMETMLRLGISSPIIKGDSQLVIKQMNGEYKVKAKRIIPLYEKAIELKKKLNATLIWVPREENKEADRLSRVAYELVRRGKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein ST0753
publication title Stabilization by fusion to the C-terminus of hyperthermophile Sulfolobus tokodaii RNase HI: a possibility of protein stabilization tag
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13456 RVT_3 Reverse transcriptase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3alyA00
1J5OA 2D5RA 4DTRA 4DSIA 3RMDA 1LW0A 3L2UA 4DFPA 4N47A 3WNHA 4EP5A 4BWMA 2GV9A 1G15A 3AVNA 4CJTA 3L3UA 5KI6A 4JRQA 3TI0A 3JYTA 4BDYA 4DSFA 4E7IA 3IRXA 3S3OA 4B08A 2RN2A 3DOLA 1RNHA 4G1QA 2I5JA 4FJ5A 3DRSA 4CJ4A 2XY7A 3LAKA 3HK2A 1JLFA 4DFJA 1TVRA 1U47A 4DQRA 1C1BA 2DFFA 5CZ1A 3E01A 4CF1A 1I39A 1U04A 4M45A 4OLBA 2Z1IA 2P1JA 3EZ5A 2X78A 4FLVA 1FK9A 2NUBA 4CIGA 4N56A 1NOYA 2O4IA 3RTVA 2KFNA 1S1UA 3P1GA 2G8VA 1GOAA 4NCGA 4C8OA 2YNGA 3V9WA 1K6YA 1RT3A 3BGRA 4GVMA 3OS1A 4HVJA 3VA0A 1BI4B 3K5MA 1NK9A 4DSEA 2D0AA 5HRNA 4Q5VA 4N5SA 4O0JA 3NH2A 3LZJA 4JS4A 1U45A 1EETA 3ISNC 1SKWA 3NF8A 4KPYA 1S1XA 3NF7A 4LY7A 2BANA 1KSPA 1L3VA 3LPTA 4FJXA 4I7FA 4E1NA 3OS0A 2G8IA 3OYGA 4J2DA 2HHTA 4Z4IA 4GW6A 3AVCA 4FZYA 3L2WA 3IG1A 1TGOA 4DU3A 3QEPA 1T05A 1LV5A 4DSKA 2BDPA 5CZ2A 4KREA 4E19A 1TKTA 4KI4A 4B3OA 1UWBA 1JXEA 3CFOA 3DYAA 4K8ZA 3NH1A 1IH7A 4HCCA 2Z1GA 4ICLA 1CLQA 4DQIA 1S1TA 3DLKA 2YNFA 5J1EA 4B9UA 4AH9A 1IG9A 3V6DA 2FBXA 3IAYA 4M3RA 2DFHA 4E0DA 4E1MA 2IS3A 4M3UA 4W5NA 4FLZA 3PY8A 3OJSA 4FXDA 3DLEA 1L3TA 5CY4A 1GOCA 4W5RA 1U49A 1X9WA 1JLGA 2RF2A 1QS4A 4CJQA 4BE0A 1S1WA 2OZMA 1TAUA 1WSHA 4DQSA 2IC3A 4RG8A 1TL1A 1VSFA 2VG6A 2Y1IA 5FRMA 4QAGA 1B92A 1QQCA 4DTSA 2Z1JA 3RR8A 4FM1A 3I0SA 1RT7A 3ASMA 1ASUA 2E6MA 1NK7A 3ULDA 1U4BA 3AVBA 1RTHA 4DSJA 3U3YA 2GBZA 3HPOA 2XRIA 3T3FA 1X9SA 1XWLA 4KTZA 1WSIA 4FK4A 1C6VA 3TAFA 4FM2A 1JLBA 3TABA 1RDAA 3C6UA 1SL2A 1BQNA 4FLYA 1LWEA 3V9SA 3ZT2A 5I3UA 2G8HA 3KTQA 1BCMA 4IG0A 2P5OA 5FDLA 4PQUA 2YNHA 3SCXA 4Z4EA 4DQPA 1HNIA 4FLTA 4EZ6A 4BE1A 3RRHA 2VG7A 4OKEA 4DTPA 5J2QA 3RWUA 3AVGA 4M3ZA 3LP0A 2HHQA 3VQAA 3WNGA 4N76A 2WOMA 4QOZB 3PUFA 4C8MA 3VQ7A 3B6OA 4ID5A 3FFIA 1T03A 1RILA 3DRPA 5DK5A 1C1CA 4UQGA 3L2RA 1BI4A 1J54A 4O4GA 3CFRA 2OYQA 4KAZA 4M3XA 4C8KA 5EU7A 1UA0A 1JLAA 3PX4A 1RTDA 3OYLA 4FZXC 1ZBHA 4FVMA 4CE9A 4DMNA 1QHTA 3KLHA 1WSEA 3KK2A 1JLQA 4ZHRA 2B4JA 3TAGA 1ASWA 4F4KA 4W5QA 2KFZA 1N5YA 3PX0A 2KW4A 4OKKA 1VSMA 3K5OA 1B9FA 2FBTA 4IDKA 4KHNA 5HP1A 1ZYQA 3KK1A 2G8FA 4CJLA 3OYAA 4FJ7A 3AO5A 1TL3A 1NOZA 3ITHA 3V9ZA 1S9EA 4NCAA 3DLBA 3S3NA 4CJRA 4W5OA 2PZSA 1RTJA 2XY8A 2HNDA 3ZSOA 3NF9A 3AO2A 3QINA 4I2QA 3QEWA 3V9XA 3VQ6A 1ZBFA 3AVFA 3ZSZA 3SYZA 4CCHA 4CEQA 1RBUA 4KV8A 1NK6A 4PY5A 3TANA 4Q0BA 1RBSA 1S1VA 1VSIA 3QLHA 1UOCA 1W9HA 1LW2A 3A2FA 3QEVA 4TSXA 2G8UA 4KTWA 3TAQA 4CJ3A 3HP6A 3O4NA 5HLFA 3EY1A 2XY6A 1TKZA 2OPQA 3QESA 4OVLA 1RCHA 2A1RA 1HRHA 3AA2A 1D5AA 5KRTA 4Z4FA 2Z1HA 4PUOA 2IDOA 3UIQA 4HCBA 2OPSA 3AVMA 4CGHA 4KRFA 1JL1A 2QXFA 1RTIA 1S6PA 3K5NA 4FJ8A 4KI6A 4DTOA 1WSGA 1RT4A 4M41A 2X74A 4RW8A 4FJGA 4J2AA 1ZBLA 1EX4A 3V4IA 3U6FA 4LH5A 5HRSA 3DLRA 4M3WA 3QETA 2XHBA 1Q9YA 4KHWA 1CZ9A 4AHCA 1VK0A 3OVNA 4BWJA 3DI6A 2AJQA 4DU4A 5SWMA 3LDSA 2HW3A 4DTXA 2X6SA 4DG1A 1S9GA 1WNSA 5D3GA 3NBPA 1XC9A 1VRUA 4Z4GA 1TKDA 3MEDA 4PA1A 3LP2A 1REVA 4KHUA 3ZT3A 4CJUA 3RMAA 4ID1A 3KLGA 3NH0A 4OGCA 1YTUA 4FZZA 4DWIA 3VQ9A 3AO4A 3OYEA 3HM9A 1NK0A 3B6PA 3C6TA 3ZSQA 4E89A 1FKOA 2Y1JA 4N41A 1I3AA 3MECA 4DS5A 2IOCA 2A1SA 3SPYA 4DTMA 2HHXA 4CJVA 3C95A 3KLEA 1NJWA 3C94A 1L3SA 5HRPA 1Q8IA 4WE1A 4BDZA 1BISA 1KVBA 2KZMA 1LWCA 5KTQA 1SL0A 4BDPA 1WSJA 3AV9A 4CJWA 2E4LA 4ZTFA 1CXUA 3QEIA 3VQ4A 3VQ5A 4CEZA 3M8RA 1NKCA 3AA3A 1IKVA 1YT3A 1DTTA 1JL2A 4DTUA 3PX6A 3RMBA 1U48A 4CGIA 3HXMA 3M8SA 2VG5A 4FCYA 1RT2A 1QSSA 1BIUA 3ZCMA 3LWLA 4E7HA 3HO1A 1XHZA 3RRGA 1X1PA 3AVJA 3VQ8A 1KRPA 4CF9A 1SKRA 3V81A 3SNNA 1KFSA 1HYZA 4CFDA 1RDCA 4I9LA 3QERA 3LP3A 1LWFA 3QIPA 4KO0A 3V9UA 4Z0UA 1A5XA 3V1QA 4CGJA 3KJVA 1F21A 4IFVA 4B8CA 3MAQA 3EYZA 4FLXA 4DS4A 4E7LA 4CEDA 4OPJA 3O3FA 1WAJA 4O55A 3P5JA 3OYHA 3OYBA 4DF4A 3TAEA 3VA3A 4KB1A 3LPUA 1TV6A 3JSMA 3HJFA 1S6QA 2PY5A 1FXXA 1FKPA 3MXMA 1JXBA 1ZBUA 1HJRA 1VSJA 4O5BA 1NJZA 4HHTA 2EX3A 2ZE2A 1J9AA 4CGFA 2P5GA 1B9DA 3K57A 3SI6A 3PV8A 4AHRA 3AA4A 3IS9A 4DFKA 4CF2A 4LD0A 3ZSXA 1VSHA 4FLUA 5CYQA 1TK5A 1TK8A 5JS1A 3MXJA 3ZSYA 4B8AB 3HVTA 4F2SA 3K58A 1L5UA 1Q9XA 2KTQA 3SQ1A 3HSTB 3NF6A 4HUGA 3QO9A 2VWJA 4FJKA 4FW1A 1W0HA 3OYJA 1TK0A 3I8DA 1YVUA 3KKRA 3VQPA 1Y97A 3LZIA 1MU2A 3LALA 3D0PA 2IGIA 3TARA 4J2EA 4CIFA 4B9TA 1IKWA 1VSDA 3LANA 3NFAA 3NHGA 3LP1A 2KZZA 2F8SA 3K59A 3MXIA 1VSLA 4OPKA 1HYVA 2FC0A 3OY9A 3L8BA 4HTUA 1QSYA 4KHSA 4O0IA 3V1RA 4FJ9A 1XHXA 3O4QA 5E41A 5HROA 4FJNA 1VRTA 4M3YA 5T7BA 3I0RA 4E3SA 4CHPA 4M42A 4CGDA 4CEBA 3NGYA 4FJMA 2HNYA 2YKNA 4Y1DA 1KFDA 3TAPA 4CJ5A 2HNZA 4CJPA 1Z25A 4F3TA 2IAJA 3U3GA 2DTUA 1NK4A 3TR8A 4CGGA 3BDPA 4B9MA 1O1WA 3M8QA 1WN7A 3DRRA 3HPGA 2YKMA 4OJRA 5K14A 4Z4HA 1JLCA 3PO5A 3OYFA 1NJYA 4CEFA 3M8PA 4I2PA 2F8TA 1NK8A 3ZSWA 1QE1A 3MEEA 5C42A 1WAFA 4FM0A 4AILC 4F2RA 3SUOA 3HL8A 3NGZA 1QSLA 2B5JA 3RR7A 1BL3A 4EZ9A 1VSEA 1UA1A 4KTQA 2HB5A 3AVHA 4C8NA 4JS5A 3OS2A 4DTNA 1JLEA 2FBYA 4CJSA 3OYIA 3NAEA 2W42A 5J2NA 3G10A 3ZSVA 4FJIA 4CECA 3NE6A 3SUQA 3SJJA 4CEAA 5FROA 2HHVA 3SQ2A 4FJHA 1HQEA 4YNQA 3OJUA 4DLGA 1C0TA 2KQ2A 4CFBA 3NCIA 3NGIA 3LAMA 2LSNA 3HYFA 4CHYA 4FLWA 4J2BA 2ETJA 4MFBA 2XO7A 3VQBA 3SV4A 4CFAA 4FJLA 3F9KA 1CXQA 1J53A 4CJEA 3AVKA 4ZTJA 1SKSA 1BIZA 1C0UA 2HVIA 3VQDA 3ZSRA 1QTMA 1D9FA 3VQCA 2HHSA 1IKYA 3QNOA 2DFEA 3QNNA 3L3VA 5C25A 4OLAA 2YHBA 4ELUA 4DQQA 1HQUA 1NKBA 2HMIA 2HHUA 4CHNA 3KLFA 3OYCA 1RBTA 1WLJA 4LH4A 4FW2A 4IG3A 3O3GA 4BE2A 5J2PA 1XI1A 3SUPA 4DLEA 1WSFA 2D0BA 5CYMA 4AHTA 1ASVA 1A5VA 2PYLA 4B9SA 1LAVA 3PO4A 2ITGA 2VWKA 2X6NA 2FBVA 1EXQA 2RKIA 2O4GA 4IBNA 4JRPA 2QKKA 2BE2A 5FRNA 4CESA 1C1AA 1EKEA 1BHLA 1VSKA 3CM5A 5C24A 1BGXT 4YFUA 4NYNA 4HUEA 3SQ4A 3SQ0A 3S3MA 4F8RA 4CFCA 1BQMA 1KVCA 3H08A 4L8RB 4QCLA 4FK2A 3DMJA 3QIOA 3KK3A 4GMJB 4HUFA 2WONA 4OKJA 1L3UA 3CM6A 3TWHA 3SZ2A 1DTQA 1Z26A 3V1OA 3S9HA 2YHAA 3SPZA 4FJJA 2PYJA 3AVIA 3AVAA 4RW7A 2OA8A 3AO3A 4F3OA 3KLIA 4KHYA 3HP9A 4IFYA 4RW6A 2GUIA 2OPRA 1SUQA 3ALYA 1RDDA 3ZT4A 4CERA 4CHZA 2G8KA 4PWDA 4DF8A 2BGGA 4M3TA 1EP4A 1HNVA 3DOKA 5DMRA 2ZD1A 1KVAA 1KTQA 1YTAA 3ZT0A 4AHSA 3AVLA 4RW4A 4RW9A 4CEEA 4CK2A 1UAXA 3AO1A 3L2VA 4CJKA 3AA5X 3K5LA 1SL1A 2JLEA 3DLHA 4I9QA 4EP4A 4LSLA 2B6AA 3K2PA 4KFBA 4OGEA 4XIUA 3QEXA 2R7YA 4B9VA 3HVRA 4FYDA 4AHUA 3SV3A 3MEGA 4JLHA 1NJXA 1ZBIA 3T1AA 4AHVA 1R0AA 2F96A 3D45A 2YV0X 3P83D 3OYMA 3CQ8A 2Q3SA 4W5TA 4C8LA 2RPIA 1RBVA 4CIEA 1JKHA 2D0CA 3TAMA 5SZTA 2DY4A 5KGXA 3CYMA 4NCBA 4KHQA 4K8XA 4B9NA 4DU1A 3DM2A 3CG7A 4KKOA 4CF0A 4CK1A 3HT3A 4CEOA 4BACA 1D9DA 2QK9A 3OYDA 4CF8A 1CZBA 3L2QA 2JGUA 1ITGA 3RMCA 4MQ3A 4Y1CA 5KRSA 4ELTA 2OPPA 1KLMA 4H8KA 3VQQA 4ELVA 1IKXA 1TAQA 1RT5A 1DLOA 3KIOA 4H4OA 3WNFA 4CJFA 4DFMA 2P51A 1TKXA 5I42A 1KLNA 3CFPA 3THVA 3G0ZA 3OYKA 1LAWA 3O3HA 3WNEA 3VN5A 4E7KA 3LWMA 3NDKA 3ZT1A 4R5PA 3KD5E 1T7PA 4FK0A 5HRRA 4CHQA 1IO2A 2G8WA 3KD1E 1BCOA 2E6LA 5JS2A 2XY5A 1RT6A 1S5JA 1D8YA 1RDBA 1HPZA 1HYSA 5KGWA 2QKBA 1KCFA 5HBMA 2HVHA 3HPHA 1A5WA 1RT1A 3KKSA 2ZQBA 4DSLA 1GOBA 3OYNA 4NYFA 4Z4CA 3DLGA 3VQEA 3SUNA 2OZSA 4B9LA 1HMVA 2ATQA 1RBRA 2EHGA 1C0MA 1SV5A 4CK3A 5J2MA 4CHOA 1X9MA 4DTJA 3F73A 1NKEA 4KB0A 4O44A 3T19A 2YNIA 4LSNA 2HHWA 4H4MA 1T8EA 4E7JA 1N6QA 4IKFA 1NK5A
chains in the Genus database with same CATH superfamily
1J5OA 2ZJQL 4N47A 2A3ZA 2GV9A 3AVNA 5KI6A 3ENHA 3QFUA 3TI0A 3I33A 4B1UB 3ID8A 4BDYA 5KQDA 5AQYA 4E7IA 4DSFA 4H5WA 3S3OA 2QM1A 2RN2A 1RNHA 1QVFM 3CMAN 3J7AP 3HK2A 1JLFA 1U47A 2W41A 2DFFA 4M45A 2X78A 1NOYA 3ZLJA 2O4IA 4N56A 5DM7L 4JK7A 2KFNA 1W7AA 1BUPA 1RT3A 3BGRA 4GVMA 3OS1A 4F9OA 1BI4B 1IV0A 4YDUC 4O0JA 3ISNC 1SKWA 3TU5A 4BR4A 2O8BB 3LM2A 4LY7A 5KPRA 1KSPA 1L3VA 1HNZK 4FZYA 4BR5A 2P9LA 1TGOA 2ZM6K 4BG9A 4JHDA 1NGCA 4K42A 1TUUA 4KI4A 3GE1A 3QMLA 4K8ZA 3NH1A 1IH7A 1VQ4N 4HCCA 1KD1O 3J8AA 2P9KB 3CPEA 4M63C 2FBXA 2DFHA 4FLZA 4GV9A 1GOCA 5CHIA 4B3TK 2RF2A 3CC4N 1S1WA 1TAUA 1WSHA 4DQSA 2IC3A 1OKJA 2GUPA 1Q81O 3G71N 1B92A 2A42A 3RR8A 4FM1A 3I0SA 3CCLN 2E6MA 1QZ5A 5M1FA 1RTHA 2GBZA 3HPOA 5DM6L 4FK4A 1C6VA 4FM2A 3MCPA 3UE5A 3TABA 3H1VX 4FWKA 1M1KO 1LWEA 3KTQA 2P5OA 4B3SK 4CZEA 2YNHA 4Z4EA 4K0KK 4DQPA 1HNIA 1ZC6A 4BE1A 5J2QA 4LF7K 3VEXA 2QWPA 3VQAA 3VETA 4N76A 5AQMA 3R8EA 3VQ7A 3B6OA 4ID5A 2WTUA 3CFRA 1RDUA 2OYQA 3UKRA 2PFUA 3PX4A 4FZXC 1ZBHA 3H1QA 3QFPA 2HOEA 4JI7K 4DMNA 1WSEA 1JLQA 2B4JA 3MCAB 3C0BA 2IVPA 3PX0A 1N5YA 4KHNA 3K5OA 1B9FA 3D2EA 1BOTO 1QQOA 2G8FA 4CJLA 3AO5A 4BC3A 2OTLN 5AQVA 1NOZA 3T7ZA 5JICA 4NCAA 4BR7A 3CCQN 4CJRA 1NM1A 5AQPA 4JK8A 3QINA 3VEZA 3VQ6A 1ZBFA 4H5VA 3SYZA 4CEQA 1RBSA 1LW2A 2CGLA 1VQMN 3A2FA 4A59A 4BREA 3O4NA 1TKZA 2OPQA 3QESA 4OVLA 4JEPA 1I94K 1NGEA 1HRHA 4JV5K 5FPEA 5KRTA 2Z1HA 1QHAA 3MDQA 5AFUH 1NGHA 1QQMA 1RTIA 4BRLA 4FJ8A 1JCEA 4DTOA 1WSGA 2ASPA 3CJCA 3NVMA 2X74A 1Z05A 3EN9A 1YIJN 4FJGA 3VTHA 1NG9A 2O8CA 4H0OA 1ATSA 4QS7A 3THYA 2X6SA 3ULEA 3H45C 1TKDA 4PKIA 4YOXA 5C15A 3ZT3A 3NH0A 3B6PA 3C6TA 3VGLA 3ZSQA 2Y1JA 1KQSM 4N41A 4EHTA 4DS5A 2A1SA 1T44A 4MO5A 3SPYA 2HHXA 1MWKA 4BDZA 1BISA 2KZMA 4AM7A 4NLCA 4JI6K 2P9PB 3VQ5A 3M8RA 5BPMA 3I55N 1YT3A 5LMUK 3WXJA 2E2QA 4ISFA 1QSSA 3WXMB 3FZKA 1Q7YO 3O1BA 4DCHA 4IOAL 5LY3A 4CF9A 5EVZA 3CCSN 4B9QA 1RDCA 2HBLA 1BA1A 4PL7A 1A5XA 3EZWA 1F21A 4C1NI 4FLXA 3EYZA 4DS4A 1VQNN 2D4WA 4O55A 3OYBA 5IT9O 4DF4A 4DB3A 3VA3A 3OW2M 5KQ8A 4FWNA 1FXXA 1FKPA 1ZBUA 4CD1A 2P5GA 3AA4A 3JXUA 4LD0A 1TK8A 1VSHA 1TK5A 3ATUA 1L5UA 1Q9XA 5AFUA 3DXKA 3SBTA 3T1HK 5BPLA 4DV5K 1VQLN 4FJKA 1W0HA 1HR0K 1TK0A 4Y0WA 2YX6A 1YVUA 5BRFA 3HI0A 3LZIA 3D0PA 2IGIA 1NGFA 3U9ZA 4B9TA 4BRHA 1KAXA 1NGJA 5F2RA 2RE2A 3MXIA 2Q1NA 3CPWM 3SAGA 3O8MA 4CHPA 3ATVA 1KFDA 5GADP 3TAPA 4CJPA 3BDPA 3FZHA 3SJHA 1WN7A 5K14A 3HPGA 2YKMA 4OJRA 1JLCA 4BRFA 2B5JA 1BL3A 1VHXA 5AQRA 1JLEA 3OYIA 2W42A 1JCGA 4CECA 1T6CA 3SUQA 2QWOA 5FROA 2HHVA 5AQTA 3LDOA 3VOVA 3OJUA 5LL6Z 3CCRN 4DLGA 3DXMB 3GG4A 3JS6A 3U9DA 3NGIA 1Q82O 4CHYA 4J2BA 4MFBA 3VQBA 3SV4A 3F9KA 4ZTJA 4CJEA 4IWVA 2HVIA 4B1XB 4U7BA 4KHPK 1QTMA 3VQCA 3QNOA 2DFEA 3QNNA 3ZX0A 2GEMA 4ELUA 1XNRK 2NRVA 1NMNA 1WSFA 4AHTA 5CYMA 1ASVA 1A5VA 3LDQA 1E3MA 4WFAL 2RKIA 4CVNE 4JRPA 5GIPA 5FRNA 4CESA 4IEIA 1BHLA 1VSKA 4F8RA 2BTFA 5BRHA 3H08A 4GV6A 4DV3K 5BR8K 3GDQA 1DTQA 4J8FA 5FLXO 2PYJA 3KLIA 2V51B 4RW6A 1SUQA 5TKWA 1N34K 4YY3K 2ZD1A 1KVAA 2ITMA 1K8KB 1NGGA 1XUPO 3AVLA 5AZIA 4GKJK 4CEEA 1UAXA 3AO1A 1VQ6N 3AA5X 4I9QA 2VGMA 4KFBA 4FL9A 2GELA 3CCJN 1NJXA 1R0AA 5AQSA 2E2OA 5FPNA 4BR0A 2RPIA 4GV3A 1RBVA 3R3LA 5BREA 1JKHA 2J4RA 5SZTA 5KGXA 3CYMA 4KKOA 4CZKA 3FZMA 4CEOA 2QK9A 1YJNN 4KBOA 4WQ4A 5AQLA 3VQQA 1DLOA 3WNFA 3UB5A 2NRXA 2FSNA 3OYKA 3WNEA 3P4IA 3T69A 4FPAA 2G8WA 3KD1E 2AA4A 3KWGA 4MDBA 4PKHA 2PBDA 1RDBA 1HPZA 3CIPA 1KCFA 4IXCA 1RT1A 3D2FB 4WFBL 3OYNA 4RTFD 3MN5A 2ATQA 1RBRA 1M90O 1SV5A 2UXDK 2DPNA 1X9MA 3F73A 4CBWA 4Z94A 3SMPA 2HHWA 1WUAA 4LSNA 2EWSA 2HBMA 3WEEB 3G6EN 1C0FA 3W3DA 3HZ6A 3THXA 4EP5A 4PKGA 4JRQA 5ADXA 3RSEB 4KH6A 3DOLA 2I5JA 2P9NB 4CJ4A 4DFJA 1TVRA 3E01A 4H03B 3CQYA 2Z1IA 4B1WB 3EZ5A 1FK9A 4CIGA 1HUXA 2HMPA 2HF3A 3E9LA 3P1GA 1GOAA 2YNGA 2PAVA 3Q7CA 5BR9A 4HVJA 3K5MA 4DSEA 3VTIA 1YAGA 4EIAA 3IMXA 1EETA 1LCUA 3E9PA 4JKDA 3O6WA 2BANA 2P9UA 4LF4K 1YUWA 3OYGA 2HHTA 4RWTA 1J6ZA 4DUZK 3IG1A 4DU3A 1T05A 4JI8K 2O8EB 5CZ2A 3A5OC 4KREA 1TKTA 1UWBA 1JXEA 3CFOA 4X65K 2ASOA 3FE1A 4ICLA 1S1TA 2YNFA 5J1EA 4B9UA 3V6DA 2NZTA 3IAYA 4M3RA 4E1MA 3DLLL 4W5NA 4FXDA 4W5RA 1U49A 4WQ5A 1TYQB 2NNWA 2Q2RA 4CJQA 4DR5K 5AQHA 2VG6A 4FWSA 5FRMA 5A2QO 4IOXA 1QQCA 4DTSA 1GLEG 4YOYA 3G4SN 3ZEUA 3ASMA 1ASUA 1NK7A 3ULDA 3AVBA 1VQPN 4FO0A 3T3FA 1MWMA 3CERA 5AZJB 1T6DA 1RDAA 2O8FB 2QWLA 1SL2A 3ZETB 1BQNA 1IG8A 2UYTA 5FDLA 4PQUA 4CZMA 2UUCK 4EZ6A 3HOTA 3RRHA 1NU0A 3DAWA 3AVGA 3L4IA 4BR9A 2HHQA 4MLHA 3FFIA 1KAZA 1RILA 4UQGA 1C1CA 2UUAK 2WUSA 1BI4A 1J54A 3E66A 4DV7K 3O80A 4C8KA 2F7TA 1UA0A 3OYLA 3KLHA 4ZHRA 2O8BA 1ASWA 4W5QA 4OKKA 5HP1A 2FSJA 3OYAA 1DKGD 3ITHA 4K41A 3MX2A 4ILJA 3DLBA 2QTDA 2HNDA 3ZSOA 1U2VB 3ID6A 5E26A 5CR4A 4JKAA 3ZSZA 1NK6A 3TANA 2W6KA 1S1VA 3QLHA 1ATNA 2G8UA 4KTWA 4CJ3A 3HP6A 1HLUA 2RHKA 3TSPA 1OH5A 4BC2A 4EFHA 1D5AA 4Z4FA 4FSVA 2FXUA 4BVOA 5H1SQ 4HCBA 3AVMA 3WQTA 4CGHA 1OH8A 4KRFA 4KI6A 2ZGYA 4LFCK 3CCUN 4J2AA 3AAPA 4B1YB 1ZBLA 3V4IA 2ZJPL 5AQXA 1RDWX 4M3WA 1Q9YA 2XHBA 4KHWA 3MN7A 1VK0A 1VQ9N 4DTXA 4BVPA 1VQON 4DG1A 3OHRA 3GOIA 1Y64A 4BGBA 1XC9A 1VRUA 4PA1A 1REVA 4CJUA 3RMAA 1Q18A 4OGCA 4DWIA 3AO4A 3OYEA 1TUYA 1K8AO 3RVCA 4YOTA 1EO1A 5BN8A 2FF3B 4IFEA 2IOCA 5IWAK 3CC7N 2UU9K 5M1OA 3WXIA 4WE1A 2H3GX 3VEVA 1LWCA 1SL0A 3AV9A 4CJWA 3QEIA 1NKCA 1N32K 4B3MK 3AA3A 3JAMO 4DTUA 2P9IA 1RT2A 4FCYA 3CJAA 3HO1A 3RRGA 1P90A 1X1PA 3VQ8A 1KRPA 1SKRA 3FR0A 1HYZA 4LC9B 3LP3A 4KO0A 3QIPA 2AP1A 3VPZA 4CGJA 3QBXA 4IO8A 3KJVA 4X62K 3B8AX 3O9SA 1P8ZA 4E7LA 4OPJA 3O3FA 1ZXOA 2GWKA 2VYPA 3TAEA 3JSMA 1S6QA 4YORA 4O5BA 1VSJA 1NJZA 3CJ7A 3SI6A 3J7ZO 3PV8A 4AHRA 3IS9A 2KKZA 4FLUA 4H0TB 4CZHA 1X3NA 4B8AB 3HVTA 4F2SA 3K58A 3HSTB 4FW1A 4B1ZA 2Q0RA 3KKRA 3VQPA 1OH6A 3LANA 3NFAA 2WFBA 4K43A 2P9LB 4ILHA 3K59A 1VSLA 2FC0A 3OY9A 4KHSA 3V1RA 3KVGA 2JWLA 5E41A 2HBKA 4M3YA 3K9JA 4HTLA 4E3SA 4CGDA 4JKBA 2YKNA 1EWRA 4MDAA 4Y1DA 1Z25A 1VQ8N 4E1JA 5LJWA 3KK7A 4G9ZA 2P9PA 3PO5A 3OYFA 1QE1A 3MEEA 3NGZA 2E1YA 4EZ9A 5KPTA 2HB5A 3VGKA 4JS5A 3IUCA 4JKCA 4CJSA 3NVKA 4JAXA 3G10A 3QB0A 3A5LC 1GLAG 1XC3A 1NGBA 1HQEA 3IDHA 2KQ2A 4CFBA 3C65A 2W6LA 1BO5O 3PSFA 2CH5A 1WOQA 1CXQA 3AVKA 1BIZA 4B1VA 1C0UA 4DR4K 2HHSA 4CD3A 4NLBA 2QXLA 3BP8A 4H5NA 5AQUA 2Q0UA 4DQQA 1HQUA 2HMIA 2ASMA 3UKRB 3OYCA 4FOIA 1RBTA 4BE2A 3A5NC 2NRRA 2PYLA 2VCPA 3PO4A 5AQFA 1EXQA 1WB9A 5MLCQ 3C7NB 3EE8A 4F3TA 3CM5A 4YFUA 1NK4A 3SQ4A 1HKCA 1BGXT 4WFNL 3BF1A 3S3MA 4M7YA 1KVCA 4CFCA 3UKUB 4QCLA 4FK2A 3DMJA 3KK3A 1QZ6A 2WONA 3R1XA 3SZ2A 2QWRA 3S9HA 1W2BM 4FJJA 3AVIA 4RW7A 4AQYK 3AO3A 4KHYA 3HP9A 3EEQA 4DV0K 1RGIA 4BRPA 3ALYA 2G8KA 4DF8A 4M3TA 1HNVA 3DOKA 3AGRA 1KTQA 3ZT0A 4AHSA 4IO9L 4C1NK 4CK2A 3L2VA 1S72N 4EAHD 2B6AA 3K2PA 2R7YA 4B9VA 2IIRA 3HVRA 4FYDA 4JN4A 3T1AA 2F96A 3SLCA 3OYMA 1V4SA 2Q3SA 2O8CB 4W5TA 4C8LA 3PIPL 3DXMA 1XMOK 4B9NA 3ULEB 3OYDA 4CF8A 1CZBA 4NB4A 4V19S 4H8KA 1IKXA 1TAQA 1RT5A 2P51A 3THVA 3VESA 4YOWA 5F1XA 4FK0A 4CHQA 1IO2A 5JS2A 1NGAA 3O9UA 2XY5A 5HL7L 1HYSA 5KGWA 2HVHA 3KKSA 2ZQBA 1GOBA 3O9QA 1SAZA 4JI3K 4GY2B 3HOSA 3MWPA 2EHGA 5J2MA 2V7YA 3ENBA 3LDPA 3WQUA 4DTJA 4JD2B 3T19A 4H4MA 1T8EA 3D7EO 5AQQA 1BDGA 1NK5A 5AQNA 1LW0A 3L2UA 4DFPA 3M6GA 4A62A 4CJTA 1OVYA 4G1QA 3DRSA 1DEJA 1K8KA 2V52B 4DQRA 5CZ1A 2E8AA 1U04A 4OLBA 2P1JA 3FLCO 3WXKA 2NUBA 1DGKN 1S1UA 4C8OA 1E4FT 1GLDG 2G8VA 3V9WA 5AQOA 4DV6K 1NK9A 2D0AA 5HRNA 2BUPA 5HOOA 3OBWA 3LZJA 4JS4A 1HNWK 5CE3A 4JKGB 1U45A 3M3ZA 1IBMK 3LM9A 3NF8A 4IJAA 4KPYA 5LJVA 3F2KA 3LPTA 4I7FA 2G8IA 1K73O 4J2DA 1HNXK 4Z4IA 1NGDA 3AVCA 4HWIA 4XEIA 1LV5A 4DSKA 4E19A 3DYAA 1NGIA 2Z1GA 4FWPA 3EO3A 2IS3A 5BRDA 3L6QA 3OJSA 2HSTA 1L3TA 2QWQA 1YHQN 4CZFA 1JLGA 3HBTA 1YI2N 1QS4A 3O4WA 2OZMA 1TL1A 1VSFA 3SMSA 1VQ5N 1H1VA 5AQGA 2Z1JA 3WEEA 4QS9A 3MK6A 4IOCL 2HHHK 1XWLA 4KTZA 1WSIA 3RSEA 1YJ9N 4X64K 3T1YK 3CD6N 1JLBA 1T3VA 2KHOA 2QWNA 1C0GA 4M7XA 4BRMA 3C6UA 2OTJN 4FLYA 5I3UA 3V9SA 3ZT2A 1NJIO 5C0YA 2YHXA 4A2AA 3SCXA 5F0XA 2GX9A 4YOUA 2VG7A 3RWUA 3TSUA 3EKSA 4GKKK 2E20A 3PUFA 4DR6K 4ILGB 1T03A 4O4GA 5EU7A 1X9JA 5AJ3K 4FVMA 1QHTA 1YITN 4BQLA 4UY8O 1V4TA 2KFZA 2KW4A 1VSMA 2FBTA 5C2FA 4U67L 3KK1A 4FJ7A 2OCEA 4DR1K 3V9ZA 5M1PA 2D0PA 2O8EA 3S3NA 3W0LA 4ISGA 2PZSA 2XY8A 1BWFO 3NF9A 3AO2A 3I56N 4BQZA 3VF2A 1O13A 2D0OA 2UXBK 4KV8A 3H46O 5JVHL 4BRKA 3O9TA 1VSIA 4GVEA 3ZX2A 1W9HA 3QEVA 5HLFA 2FLOA 3CQXA 4H5TA 3EY1A 4KH5A 1RCHA 2A1RA 3GL1A 4BRQA 4PUOA 3QDKA 5JLFA 3UIQA 2OPSA 3PSIA 2O8DA 1JL1A 2QXFA 3BUZB 2YI1A 3L4QA 4BR2A 4RW8A 1EX4A 3U6FA 1SZ2A 1GLCG 3QETA 3IKMA 4BWJA 2UUBK 3THWB 2O8FA 3LDSA 3ZETA 1WNSA 5D3GA 3NBPA 4Z4GA 3MEDA 4ID1A 3KLGA 3WXLA 4BRCA 5C2DA 3VQ9A 1GLBG 3HM9A 1NK0A 3VERA 4E89A 3ENOA 1FKOA 4AM6A 4MLEA 4C23A 3C95A 3KLEA 3C94A 1L3SA 4EHUA 4CBUA 5KTQA 4BDPA 1WSJA 2E4LA 4ZTFA 1CXUA 3VQ4A 3KZBA 4CEZA 1IKVA 5EY4A 4YDUA 1HJOA 5AR0A 3SAHA 1JCFA 4CGIA 1BIUA 3ZCMA 3LWLA 4XH1A 1XHZA 3AVJA 3H3NO 3Q7BA 4CBXA 3CCMN 3SNNA 1KFSA 4CFDA 4I9LA 3QERA 1VAZA 3VENA 1LWFA 4DKWA 4KH4A 3V9UA 4WQ4C 4Z0UA 3V1QA 3MAQA 1SQKA 4CEDA 1WAJA 3P5JA 1GLFO 4K25A 4BG8A 5M1QA 3MXMA 1JXBA 1HJRA 2EX3A 2ZE2A 1J9AA 4CGFA 1B9DA 4CF2A 3M5RA 3ZSXA 3MXJA 4FWQA 3ZSYA 3K0SA 2KTQA 3SQ1A 3NF6A 4HUGA 3QO9A 2P9SB 3OYJA 4OPAA 1Y97A 1MU2A 1RFQA 2P9UB 4J2EA 1IKWA 3CCEN 2F8SA 4DR3K 4OPKA 1D4XA 1HYVA 3L8BA 4HTUA 4FJ9A 4DV4K 1XHXA 5HROA 4FJNA 1VRTA 2E2PA 4M42A 4A57A 5EXWA 2HNYA 4BRAA 2P9KA 4O5FA 4CJ5A 2HNZA 2IAJA 2DTUA 4CI6A 2NRWA 4CGGA 1MA9B 1O1WA 5GIOA 3M8QA 3P31A 3DRRA 4Z4HA 4LF9K 3NMUA 2CGKA 5AQJA 3M8PA 4I2PA 2F8TA 4NXMK 1NK8A 3ZSWA 4FM0A 3N4QA 4AILC 4F2RA 4BRIA 3IFRA 1N8RO 3RR7A 1VSEA 3VF4A 3AVHA 3OS2A 4DTNA 3NAEA 2FBYA 5J2NA 3ZEUB 4ISEA 3ZX3A 4FJIA 1LOTB 3S41A 3TTCA 4JYAK 3NE6A 3SJJA 4CEAA 4DQ8A 4DHYA 4FJHA 4YNQA 2YHYA 4CZIA 3NCIA 4O8UA 3HYFA 2ETJA 4I6MB 1VQKN 4FJLA 4CFAA 2VQFK 1J53A 1SKSA 2VGNA 3SAFA 4OO1J 3VQDA 1D9FA 2D1KA 3R6MA 1J5EK 1IKYA 4OLAA 3L3VA 5C25A 3AARA 2YHBA 3P39A 2HHUA 1FJGK 3KLFA 3E9OA 5C10A 4WQ5C 1XI1A 4IG3A 2QEXN 1HX1A 4DLEA 4B9SA 1LAVA 2QW9A 2X6NA 5B8HA 2O4GA 4IBNA 5GAEP 2QKKA 4NYNA 3SQ0A 5C12A 4L8RB 4DV2K 4XH5A 3QIOA 4H0XB 5FPDA 5AQIA 1Z26A 3V1OA 3AVAA 4F3OA 2CH6A 2GUIA 4CERA 1RDDA 4CHZA 4PWDA 1EP4A 1QQNA 2ZF5O 3BZCA 2V7ZA 1YTAA 4RW4A 5JMVA 2NRZA 2JLEA 5TKYA 4EP4A 4FOEA 4FWLA 4OGEA 4XIUA 3QBWA 1BG3A 2WC9A 1OH7A 4BGAA 2ZJRL 3SV3A 4JLHA 4FWMA 3CJ1A 4AHVA 3CF5L 2F9TA 2YV0X 3P83D 3CQ8A 2D0CA 2DY4A 4KHQA 4K8XA 2Q31A 3DM2A 4CF0A 4CK1A 4BACA 1KXPA 2JGUA 3GBTA 4MQ3A 4Y1CA 3TPQA 5KRSA 1Q86O 1KLMA 1KAYA 4A5BA 3KIOA 5I42A 1KLNA 1TKXA 4JHDB 3CFPA 3A5MC 1LAWA 3O3HA 3VN5A 4E7KA 3NDKA 1MDUB 3CETA 4R5PA 3KD5E 1T7PA 5GAHP 3DWLA 3H6EA 1RT6A 1S5JA 1BU6O 4XH4A 3HPHA 1A5WA 1HKBA 3C7NA 4NYFA 3VQEA 3SUNA 4B9LA 1HMVA 2A41A 1C0MA 4CK3A 2I7PA 4CHOA 1NKEA 3PLAA 3UKUA 2P9IB 3J80O 4KB0A 4O44A 2YNIA 1YVNA 4E7JA 1IJJA 4Q0BA 4IKFA 4WF9L 2D5RA 4DTRA 4DSIA 3RMDA 1K9MO 3WNHA 4BWMA 1G15A 4DR7K 3L3UA 3JYTA 3IRXA 4B08A 3BF3A 2IVOA 4FJ5A 2XY7A 3LAKA 4NO7A 3CC2N 1C1BA 4CF1A 3OBYA 1I39A 4FLVA 1DT9A 1EQYA 5GAGP 3RTVA 4NCGA 3MMVA 3O9RA 1K6YA 3SK3A 3O1WA 3VA0A 4FPBA 2A6AA 1OVQA 4MO4A 4Q5VA 4YHHK 4N5SA 3NH2A 5JLHA 1BA0A 4H0PA 3F9MA 1S1XA 3NF7A 3U8XA 4FJXA 4E1NA 3OS0A 3D2EB 3D6RA 2UXCK 4GW6A 1QVGM 3L2WA 4JNEA 3QEPA 2BDPA 1GLJO 2YCHA 3FZFA 4O8KA 4B3OA 4JK9A 4PHTX 1CLQA 4DQIA 3DLKA 4AH9A 1IG9A 4E0DA 1ESVA 3O08A 4BC4A 4M3UA 3PY8A 3HRGA 3DLEA 5CY4A 1X9WA 2E5LK 5M1NA 4BE0A 4WYBA 4RG8A 2Y1IA 1ATRA 4JD2A 4QAGA 3O5BA 3BY5A 2NRTA 1RT7A 3G25A 1U4BA 4DR2K 4JI2K 4DSJA 3U3YA 2XRIA 1X9SA 4AF1A 3VEWA 2GWJA 3TAFA 2NRHA 3THYB 2G8HA 1BCMA 4IG0A 3P38A 2E2NA 3F5TA 4LFBK 4FLTA 5ELZA 5LMNK 4OKEA 4DTPA 4M3ZA 2Q36A 3LP0A 1IBKK 3WNGA 4QOZB 2WOMA 1N33K 4C8MA 1Z6RA 3DRPA 5DK5A 3L2RA 4KAZA 4M3XA 2IVNA 4OX9K 1JLAA 1RTDA 3OA9A 4LF5K 4CE9A 1YJWN 4JKGA 3KK2A 3MN9A 3TAGA 4F4KA 3LDNA 4IDKA 3HSCA 4L3QA 1ZYQA 4CZGA 1TL3A 5KPZA 4FVUA 1S9EA 1NMDA 4W5OA 1U6ZA 2HF4A 1RTJA 4I2QA 3QEWA 3V9XA 3AVFA 4CCHA 1RBUA 4PY5A 3MWTA 1UOCA 4IDHA 4TSXA 3CI5A 3TAQA 4LF8K 1ILYA 2XY6A 4H0VB 3AA2A 2A5XA 2IDOA 4BY9C 2QA4N 4H5RA 1S6PA 3K5NA 1RT4A 4M41A 3BZKA 3J7YP 4LH5A 5HRSA 4A61A 3DXKB 3DLRA 1JJ2M 1CZ9A 4AHCA 3OVNA 3DI6A 2AJQA 4DU4A 3HM8A 5SWMA 2HW3A 5FPMA 1S9GA 2QI2A 2FSKA 3K9KA 2JWKA 3LP2A 4KHUA 1S3XA 3QICA 3HTVA 2YJEA 1YTUA 4FZZA 3DJCA 4IEEA 1GLLO 4X66K 2VWBA 1I3AA 3MECA 4BRNA 1S22A 4DTMA 2E88A 3KWIA 4CJVA 3WT0A 1NJWA 5HRPA 1Q8IA 1KVBA 4LF6K 3D2FA 3ZYYX 1DTTA 4JKFA 1JL2A 3PX6A 3RMBA 5ADXH 1U48A 3HXMA 3M8SA 2VG5A 3VEYA 2BH1A 4E7HA 2GTDA 3FGUA 4BRDA 2W40A 3V81A 2KLAA 3AAQA 4IFVA 4B8CA 1NBWA 1EWQA 3A8YA 2P9NA 4A2BA 1W97L 3OYHA 4KB1A 5M1KA 3LPUA 1TV6A 1WBDA 3FZLA 4JI5K 2PY5A 3SBGA 3HJFA 4JI1K 4HHTA 2NLXA 2YJFA 5AQZA 3K57A 4DFKA 5JS1A 4R79A 5CYQA 2WBNA 3EE9A 1NLVA 4CJ7A 2VWJA 3C6AA 4BC5A 3THWA 1XMQK 3I8DA 4YOVA 1ZBSA 3LALA 5GINA 3TARA 4CIFA 1VSDA 2F4VK 3NHGA 3LP1A 2A40A 3AGKA 2KZZA 4CZJA 3M1FA 1QSYA 4O0IA 3O4QA 3MN6A 5T7BA 3I0RA 3U4LA 3VGMA 4CEBA 3NGYA 4FJMA 3LDLA 5AQKA 3U3GA 3VF6A 3TR8A 4B9MA 2Q97A 3OTOK 3J81O 4LFAK 3CXCM 2QWMA 5AZIB 1NJYA 4CEFA 1TYQA 2ZGZA 5C42A 3R9PA 1WAFA 3FFKB 3SUOA 3HL8A 1QSLA 1UA1A 3N4PA 4KTQA 4C8NA 4JI0K 5AQWA 4JI4K 1HKGA 3ZSVA 3EL2A 1SS6A 1XNQK 4WCEL 3SQ2A 1NNEA 1YXQA 2F9WA 3A0IX 1C0TA 5AZJA 1YF5L 1CZAN 3LAMA 2ZWHA 2LSNA 3E1YA 4QS8A 4FLWA 2XO7A 1X3MA 3L0QA 5BPNA 5E84A 3ZSRA 1NKBA 1WBBA 1N36K 4CHNA 2CGJA 2HBJA 4IZ9A 4LH4A 1WLJA 3O3GA 4FW2A 5J2PA 3MX5A 3SUPA 2D0BA 2P9SA 1R59O 2ITGA 4JKEA 2VWKA 4OPHA 5BN9A 2FBVA 3VMFB 3KHYA 2BE2A 4DUYK 4B3RK 1EKEA 1C1AA 4HUEA 5C24A 3LL3A 4PL8A 1BQMA 4BROA 4GMJB 4HUFA 4OKJA 1L3UA 3CM6A 3TWHA 4FWRA 3SPZA 2YHAA 4RCHA 1U2VA 2OA8A 1HPMA 3CCVN 3THXB 4BRGA 4IFYA 2OPRA 4NXNK 3ZT4A 3AY9A 2E1ZA 2BGGA 3BEXA 3TSQA 5DMRA 3H3OB 4RW9A 3EKUA 3K5LA 4CJKA 1SL1A 3DLHA 4GNIA 4LSLA 3CJBA 4JKHA 3WUHA 5I9EB 2O8DB 3QEXA 4CW7B 4IJNA 1KC8O 4AHUA 1ZBIA 3MEGA 4FWOA 3TTFA 3D45A 3PIOL 4CZLA 1FW6A 4CIEA 3CMEN 3TAMA 4NCBA 2FF6A 4DU1A 4A5AA 3CG7A 3HT3A 3CHWA 1D9DA 5EX5A 4I6MA 3VEOA 3L2QA 3RMCA 1ITGA 4ELTA 5EOYA 2OPPA 4ELVA 4DFMA 4H4OA 4CJFA 1G99A 1NWKA 2I7NA 3G0ZA 3LWMA 3ZT1A 1IBLK 5HRRA 3CJ9A 1BCOA 2E6LA 1VQ7N 4DV1K 1D8YA 2OANA 2VQEK 2QKBA 5HBMA 5JVGL 4DSLA 4Z4CA 3DLGA 1E4GT 2OZSA 3I8BA 3TTDA 4H0YB 2YHWA 3C6HA 1XQSC 1N6QA
chains in the Genus database with same CATH topology
1J5OA 2D5RA 4DTRA 4DSIA 3RMDA 1LW0A 3L2UA 4DFPA 4N47A 3WNHA 4EP5A 4BWMA 2GV9A 1G15A 3AVNA 4CJTA 3L3UA 5KI6A 4JRQA 3TI0A 3JYTA 4BDYA 4DSFA 4E7IA 3IRXA 3S3OA 4B08A 2RN2A 3DOLA 1RNHA 4G1QA 2I5JA 4FJ5A 3DRSA 4CJ4A 2XY7A 3LAKA 3HK2A 1JLFA 4DFJA 1TVRA 1U47A 4DQRA 1C1BA 2DFFA 5CZ1A 3E01A 4CF1A 1I39A 1U04A 4M45A 4OLBA 2Z1IA 2P1JA 3EZ5A 2X78A 4FLVA 1FK9A 2NUBA 4CIGA 4N56A 1NOYA 2O4IA 3RTVA 2KFNA 1S1UA 3P1GA 2G8VA 1GOAA 4NCGA 4C8OA 2YNGA 3V9WA 1K6YA 1RT3A 3BGRA 4GVMA 3OS1A 4HVJA 3VA0A 1BI4B 3K5MA 1NK9A 4DSEA 2D0AA 5HRNA 4Q5VA 4N5SA 4O0JA 3NH2A 3LZJA 4JS4A 1U45A 1EETA 3ISNC 1SKWA 3NF8A 4KPYA 1S1XA 3NF7A 4LY7A 2BANA 1KSPA 1L3VA 3LPTA 4FJXA 4I7FA 4E1NA 3OS0A 2G8IA 3OYGA 4J2DA 2HHTA 4Z4IA 4GW6A 3AVCA 4FZYA 3L2WA 3IG1A 1TGOA 4DU3A 3QEPA 1T05A 1LV5A 4DSKA 2BDPA 5CZ2A 4KREA 4E19A 1TKTA 4KI4A 4B3OA 1UWBA 1JXEA 3CFOA 3DYAA 4K8ZA 3NH1A 1IH7A 4HCCA 2Z1GA 4ICLA 1CLQA 4DQIA 1S1TA 3DLKA 2YNFA 5J1EA 4B9UA 4AH9A 1IG9A 3V6DA 2FBXA 3IAYA 4M3RA 2DFHA 4E0DA 4E1MA 2IS3A 4M3UA 4W5NA 4FLZA 3PY8A 3OJSA 4FXDA 3DLEA 1L3TA 5CY4A 1GOCA 4W5RA 1U49A 1X9WA 1JLGA 2RF2A 1QS4A 4CJQA 4BE0A 1S1WA 2OZMA 1TAUA 1WSHA 4DQSA 2IC3A 4RG8A 1TL1A 1VSFA 2VG6A 2Y1IA 5FRMA 4QAGA 1B92A 1QQCA 4DTSA 2Z1JA 3RR8A 4FM1A 3I0SA 1RT7A 3ASMA 1ASUA 2E6MA 1NK7A 3ULDA 1U4BA 3AVBA 1RTHA 4DSJA 3U3YA 2GBZA 3HPOA 2XRIA 3T3FA 1X9SA 1XWLA 4KTZA 1WSIA 4FK4A 1C6VA 3TAFA 4FM2A 1JLBA 3TABA 1RDAA 3C6UA 1SL2A 1BQNA 4FLYA 1LWEA 3V9SA 3ZT2A 5I3UA 2G8HA 3KTQA 1BCMA 4IG0A 2P5OA 5FDLA 4PQUA 2YNHA 3SCXA 4Z4EA 4DQPA 1HNIA 4FLTA 4EZ6A 4BE1A 3RRHA 2VG7A 4OKEA 4DTPA 5J2QA 3RWUA 3AVGA 4M3ZA 3LP0A 2HHQA 3VQAA 3WNGA 4N76A 2WOMA 4QOZB 3PUFA 4C8MA 3VQ7A 3B6OA 4ID5A 3FFIA 1T03A 1RILA 3DRPA 5DK5A 1C1CA 4UQGA 3L2RA 1BI4A 1J54A 4O4GA 3CFRA 2OYQA 4KAZA 4M3XA 4C8KA 5EU7A 1UA0A 1JLAA 3PX4A 1RTDA 3OYLA 4FZXC 1ZBHA 4FVMA 4CE9A 4DMNA 1QHTA 3KLHA 1WSEA 3KK2A 1JLQA 4ZHRA 2B4JA 3TAGA 1ASWA 4F4KA 4W5QA 2KFZA 1N5YA 3PX0A 2KW4A 4OKKA 1VSMA 3K5OA 1B9FA 2FBTA 4IDKA 4KHNA 5HP1A 1ZYQA 3KK1A 2G8FA 4CJLA 3OYAA 4FJ7A 3AO5A 1TL3A 1NOZA 3ITHA 3V9ZA 1S9EA 4NCAA 3DLBA 3S3NA 4CJRA 4W5OA 2PZSA 1RTJA 2XY8A 2HNDA 3ZSOA 3NF9A 3AO2A 3QINA 4I2QA 3QEWA 3V9XA 3VQ6A 1ZBFA 3AVFA 3ZSZA 3SYZA 4CCHA 4CEQA 1RBUA 4KV8A 1NK6A 4PY5A 3TANA 4Q0BA 1RBSA 1S1VA 1VSIA 3QLHA 1UOCA 1W9HA 1LW2A 3A2FA 3QEVA 4TSXA 2G8UA 4KTWA 3TAQA 4CJ3A 3HP6A 3O4NA 5HLFA 3EY1A 2XY6A 1TKZA 2OPQA 3QESA 4OVLA 1RCHA 2A1RA 1HRHA 3AA2A 1D5AA 5KRTA 4Z4FA 2Z1HA 4PUOA 2IDOA 3UIQA 4HCBA 2OPSA 3AVMA 4CGHA 4KRFA 1JL1A 2QXFA 1RTIA 1S6PA 3K5NA 4FJ8A 4KI6A 4DTOA 1WSGA 1RT4A 4M41A 2X74A 4RW8A 4FJGA 4J2AA 1ZBLA 1EX4A 3V4IA 3U6FA 4LH5A 5HRSA 3DLRA 4M3WA 3QETA 2XHBA 1Q9YA 4KHWA 1CZ9A 4AHCA 1VK0A 3OVNA 4BWJA 3DI6A 2AJQA 4DU4A 5SWMA 3LDSA 2HW3A 4DTXA 2X6SA 4DG1A 1S9GA 1WNSA 5D3GA 3NBPA 1XC9A 1VRUA 4Z4GA 1TKDA 3MEDA 4PA1A 3LP2A 1REVA 4KHUA 3ZT3A 4CJUA 3RMAA 4ID1A 3KLGA 3NH0A 4OGCA 1YTUA 4FZZA 4DWIA 3VQ9A 3AO4A 3OYEA 3HM9A 1NK0A 3B6PA 3C6TA 3ZSQA 4E89A 1FKOA 2Y1JA 4N41A 1I3AA 3MECA 4DS5A 2IOCA 2A1SA 3SPYA 4DTMA 2HHXA 4CJVA 3C95A 3KLEA 1NJWA 3C94A 1L3SA 5HRPA 1Q8IA 4WE1A 4BDZA 1BISA 1KVBA 2KZMA 1LWCA 5KTQA 1SL0A 4BDPA 1WSJA 3AV9A 4CJWA 2E4LA 4ZTFA 1CXUA 3QEIA 3VQ4A 3VQ5A 4CEZA 3M8RA 1NKCA 3AA3A 1IKVA 1YT3A 1DTTA 1JL2A 4DTUA 3PX6A 3RMBA 1U48A 4CGIA 3HXMA 3M8SA 2VG5A 4FCYA 1RT2A 1QSSA 1BIUA 3ZCMA 3LWLA 4E7HA 3HO1A 1XHZA 3RRGA 1X1PA 3AVJA 3VQ8A 1KRPA 4CF9A 1SKRA 3V81A 3SNNA 1KFSA 1HYZA 4CFDA 1RDCA 4I9LA 3QERA 3LP3A 1LWFA 3QIPA 4KO0A 3V9UA 4Z0UA 1A5XA 3V1QA 4CGJA 3KJVA 1F21A 4IFVA 4B8CA 3MAQA 3EYZA 4FLXA 4DS4A 4E7LA 4CEDA 4OPJA 3O3FA 1WAJA 4O55A 3P5JA 3OYHA 3OYBA 4DF4A 3TAEA 3VA3A 4KB1A 3LPUA 1TV6A 3JSMA 3HJFA 1S6QA 2PY5A 1FXXA 1FKPA 3MXMA 1JXBA 1ZBUA 1HJRA 1VSJA 4O5BA 1NJZA 4HHTA 2EX3A 2ZE2A 1J9AA 4CGFA 2P5GA 1B9DA 3K57A 3SI6A 3PV8A 4AHRA 3AA4A 3IS9A 4DFKA 4CF2A 4LD0A 3ZSXA 1VSHA 4FLUA 5CYQA 1TK5A 1TK8A 5JS1A 3MXJA 3ZSYA 4B8AB 3HVTA 4F2SA 3K58A 1L5UA 1Q9XA 2KTQA 3SQ1A 3HSTB 3NF6A 4HUGA 3QO9A 2VWJA 4FJKA 4FW1A 1W0HA 3OYJA 1TK0A 3I8DA 1YVUA 3KKRA 3VQPA 1Y97A 3LZIA 1MU2A 3LALA 3D0PA 2IGIA 3TARA 4J2EA 4CIFA 4B9TA 1IKWA 1VSDA 3LANA 3NFAA 3NHGA 3LP1A 2KZZA 2F8SA 3K59A 3MXIA 1VSLA 4OPKA 1HYVA 2FC0A 3OY9A 3L8BA 4HTUA 1QSYA 4KHSA 4O0IA 3V1RA 4FJ9A 1XHXA 3O4QA 5E41A 5HROA 4FJNA 1VRTA 4M3YA 5T7BA 3I0RA 4E3SA 4CHPA 4M42A 4CGDA 4CEBA 3NGYA 4FJMA 2HNYA 2YKNA 4Y1DA 1KFDA 3TAPA 4CJ5A 2HNZA 4CJPA 1Z25A 4F3TA 2IAJA 3U3GA 2DTUA 1NK4A 3TR8A 4CGGA 3BDPA 4B9MA 1O1WA 3M8QA 1WN7A 3DRRA 3HPGA 2YKMA 4OJRA 5K14A 4Z4HA 1JLCA 3PO5A 3OYFA 1NJYA 4CEFA 3M8PA 4I2PA 2F8TA 1NK8A 3ZSWA 1QE1A 3MEEA 5C42A 1WAFA 4FM0A 4AILC 4F2RA 3SUOA 3HL8A 3NGZA 1QSLA 2B5JA 3RR7A 1BL3A 4EZ9A 1VSEA 1UA1A 4KTQA 2HB5A 3AVHA 4C8NA 4JS5A 3OS2A 4DTNA 1JLEA 2FBYA 4CJSA 3OYIA 3NAEA 2W42A 5J2NA 3G10A 3ZSVA 4FJIA 4CECA 3NE6A 3SUQA 3SJJA 4CEAA 5FROA 2HHVA 3SQ2A 4FJHA 1HQEA 4YNQA 3OJUA 4DLGA 1C0TA 2KQ2A 4CFBA 3NCIA 3NGIA 3LAMA 2LSNA 3HYFA 4CHYA 4FLWA 4J2BA 2ETJA 4MFBA 2XO7A 3VQBA 3SV4A 4CFAA 4FJLA 3F9KA 1CXQA 1J53A 4CJEA 3AVKA 4ZTJA 1SKSA 1BIZA 1C0UA 2HVIA 3VQDA 3ZSRA 1QTMA 1D9FA 3VQCA 2HHSA 1IKYA 3QNOA 2DFEA 3QNNA 3L3VA 5C25A 4OLAA 2YHBA 4ELUA 4DQQA 1HQUA 1NKBA 2HMIA 2HHUA 4CHNA 3KLFA 3OYCA 1RBTA 1WLJA 4LH4A 4FW2A 4IG3A 3O3GA 4BE2A 5J2PA 1XI1A 3SUPA 4DLEA 1WSFA 2D0BA 5CYMA 4AHTA 1ASVA 1A5VA 2PYLA 4B9SA 1LAVA 3PO4A 2ITGA 2VWKA 2X6NA 2FBVA 1EXQA 2RKIA 2O4GA 4IBNA 4JRPA 2QKKA 2BE2A 5FRNA 4CESA 1C1AA 1EKEA 1BHLA 1VSKA 3CM5A 5C24A 1BGXT 4YFUA 4NYNA 4HUEA 3SQ4A 3SQ0A 3S3MA 4F8RA 4CFCA 1BQMA 1KVCA 3H08A 4L8RB 4QCLA 4FK2A 3DMJA 3QIOA 3KK3A 4GMJB 4HUFA 2WONA 4OKJA 1L3UA 3CM6A 3TWHA 3SZ2A 1DTQA 1Z26A 3V1OA 3S9HA 2YHAA 3SPZA 4FJJA 2PYJA 3AVIA 3AVAA 4RW7A 2OA8A 3AO3A 4F3OA 3KLIA 4KHYA 3HP9A 4IFYA 4RW6A 2GUIA 2OPRA 1SUQA 3ALYA 1RDDA 3ZT4A 4CERA 4CHZA 2G8KA 4PWDA 4DF8A 2BGGA 4M3TA 1EP4A 1HNVA 3DOKA 5DMRA 2ZD1A 1KVAA 1KTQA 1YTAA 3ZT0A 4AHSA 3AVLA 4RW4A 4RW9A 4CEEA 4CK2A 1UAXA 3AO1A 3L2VA 4CJKA 3AA5X 3K5LA 1SL1A 2JLEA 3DLHA 4I9QA 4EP4A 4LSLA 2B6AA 3K2PA 4KFBA 4OGEA 4XIUA 3QEXA 2R7YA 4B9VA 3HVRA 4FYDA 4AHUA 3SV3A 3MEGA 4JLHA 1NJXA 1ZBIA 3T1AA 4AHVA 1R0AA 2F96A 3D45A 2YV0X 3P83D 3OYMA 3CQ8A 2Q3SA 4W5TA 4C8LA 2RPIA 1RBVA 4CIEA 1JKHA 2D0CA 3TAMA 5SZTA 2DY4A 5KGXA 3CYMA 4NCBA 4KHQA 4K8XA 4B9NA 4DU1A 3DM2A 3CG7A 4KKOA 4CF0A 4CK1A 3HT3A 4CEOA 4BACA 1D9DA 2QK9A 3OYDA 4CF8A 1CZBA 3L2QA 2JGUA 1ITGA 3RMCA 4MQ3A 4Y1CA 5KRSA 4ELTA 2OPPA 1KLMA 4H8KA 3VQQA 4ELVA 1IKXA 1TAQA 1RT5A 1DLOA 3KIOA 4H4OA 3WNFA 4CJFA 4DFMA 2P51A 1TKXA 5I42A 1KLNA 3CFPA 3THVA 3G0ZA 3OYKA 1LAWA 3O3HA 3WNEA 3VN5A 4E7KA 3LWMA 3NDKA 3ZT1A 4R5PA 3KD5E 1T7PA 4FK0A 5HRRA 4CHQA 1IO2A 2G8WA 3KD1E 1BCOA 2E6LA 5JS2A 2XY5A 1RT6A 1S5JA 1D8YA 1RDBA 1HPZA 1HYSA 5KGWA 2QKBA 1KCFA 5HBMA 2HVHA 3HPHA 1A5WA 1RT1A 3KKSA 2ZQBA 4DSLA 1GOBA 3OYNA 4NYFA 4Z4CA 3DLGA 3VQEA 3SUNA 2OZSA 4B9LA 1HMVA 2ATQA 1RBRA 2EHGA 1C0MA 1SV5A 4CK3A 5J2MA 4CHOA 1X9MA 4DTJA 3F73A 1NKEA 4KB0A 4O44A 3T19A 2YNIA 4LSNA 2HHWA 4H4MA 1T8EA 4E7JA 1N6QA 4IKFA 1NK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5O A;  2D5R A;  4DTR A;  4DSI A;  3RMD A;  1LW0 A;  3L2U A;  4DFP A;  4N47 A;  3WNH A;  4EP5 A;  4BWM A;  2GV9 A;  1G15 A;  3AVN A;  4CJT A;  3L3U A;  5KI6 A;  4JRQ A;  3TI0 A;  3JYT A;  4BDY A;  4DSF A;  4E7I A;  3IRX A;  3S3O A;  4B08 A;  2RN2 A;  3DOL A;  1RNH A;  4G1Q A;  2I5J A;  4FJ5 A;  3DRS A;  4CJ4 A;  2XY7 A;  3LAK A;  3HK2 A;  1JLF A;  4DFJ A;  1TVR A;  1U47 A;  4DQR A;  1C1B A;  2DFF A;  5CZ1 A;  3E01 A;  4CF1 A;  1I39 A;  1U04 A;  4M45 A;  4OLB A;  2Z1I A;  2P1J A;  3EZ5 A;  2X78 A;  4FLV A;  1FK9 A;  2NUB A;  4CIG A;  4N56 A;  1NOY A;  2O4I A;  3RTV A;  2KFN A;  1S1U A;  3P1G A;  2G8V A;  1GOA A;  4NCG A;  4C8O A;  2YNG A;  3V9W A;  1K6Y A;  1RT3 A;  3BGR A;  4GVM A;  3OS1 A;  4HVJ A;  3VA0 A;  1BI4 B;  3K5M A;  1NK9 A;  4DSE A;  2D0A A;  5HRN A;  4Q5V A;  4N5S A;  4O0J A;  3NH2 A;  3LZJ A;  4JS4 A;  1U45 A;  1EET A;  3ISN C;  1SKW A;  3NF8 A;  4KPY A;  1S1X A;  3NF7 A;  4LY7 A;  2BAN A;  1KSP A;  1L3V A;  3LPT A;  4FJX A;  4I7F A;  4E1N A;  3OS0 A;  2G8I A;  3OYG A;  4J2D A;  2HHT A;  4Z4I A;  4GW6 A;  3AVC A;  4FZY A;  3L2W A;  3IG1 A;  1TGO A;  4DU3 A;  3QEP A;  1T05 A;  1LV5 A;  4DSK A;  2BDP A;  5CZ2 A;  4KRE A;  4E19 A;  1TKT A;  4KI4 A;  4B3O A;  1UWB A;  1JXE A;  3CFO A;  3DYA A;  4K8Z A;  3NH1 A;  1IH7 A;  4HCC A;  2Z1G A;  4ICL A;  1CLQ A;  4DQI A;  1S1T A;  3DLK A;  2YNF A;  5J1E A;  4B9U A;  4AH9 A;  1IG9 A;  3V6D A;  2FBX A;  3IAY A;  4M3R A;  2DFH A;  4E0D A;  4E1M A;  2IS3 A;  4M3U A;  4W5N A;  4FLZ A;  3PY8 A;  3OJS A;  4FXD A;  3DLE A;  1L3T A;  5CY4 A;  1GOC A;  4W5R A;  1U49 A;  1X9W A;  1JLG A;  2RF2 A;  1QS4 A;  4CJQ A;  4BE0 A;  1S1W A;  2OZM A;  1TAU A;  1WSH A;  4DQS A;  2IC3 A;  4RG8 A;  1TL1 A;  1VSF A;  2VG6 A;  2Y1I A;  5FRM A;  4QAG A;  1B92 A;  1QQC A;  4DTS A;  2Z1J A;  3RR8 A;  4FM1 A;  3I0S A;  1RT7 A;  3ASM A;  1ASU A;  2E6M A;  1NK7 A;  3ULD A;  1U4B A;  3AVB A;  1RTH A;  4DSJ A;  3U3Y A;  2GBZ A;  3HPO A;  2XRI A;  3T3F A;  1X9S A;  1XWL A;  4KTZ A;  1WSI A;  4FK4 A;  1C6V A;  3TAF A;  4FM2 A;  1JLB A;  3TAB A;  1RDA A;  3C6U A;  1SL2 A;  1BQN A;  4FLY A;  1LWE A;  3V9S A;  3ZT2 A;  5I3U A;  2G8H A;  3KTQ A;  1BCM A;  4IG0 A;  2P5O A;  5FDL A;  4PQU A;  2YNH A;  3SCX A;  4Z4E A;  4DQP A;  1HNI A;  4FLT A;  4EZ6 A;  4BE1 A;  3RRH A;  2VG7 A;  4OKE A;  4DTP A;  5J2Q A;  3RWU A;  3AVG A;  4M3Z A;  3LP0 A;  2HHQ A;  3VQA A;  3WNG A;  4N76 A;  2WOM A;  4QOZ B;  3PUF A;  4C8M A;  3VQ7 A;  3B6O A;  4ID5 A;  3FFI A;  1T03 A;  1RIL A;  3DRP A;  5DK5 A;  1C1C A;  4UQG A;  3L2R A;  1BI4 A;  1J54 A;  4O4G A;  3CFR A;  2OYQ A;  4KAZ A;  4M3X A;  4C8K A;  5EU7 A;  1UA0 A;  1JLA A;  3PX4 A;  1RTD A;  3OYL A;  4FZX C;  1ZBH A;  4FVM A;  4CE9 A;  4DMN A;  1QHT A;  3KLH A;  1WSE A;  3KK2 A;  1JLQ A;  4ZHR A;  2B4J A;  3TAG A;  1ASW A;  4F4K A;  4W5Q A;  2KFZ A;  1N5Y A;  3PX0 A;  2KW4 A;  4OKK A;  1VSM A;  3K5O A;  1B9F A;  2FBT A;  4IDK A;  4KHN A;  5HP1 A;  1ZYQ A;  3KK1 A;  2G8F A;  4CJL A;  3OYA A;  4FJ7 A;  3AO5 A;  1TL3 A;  1NOZ A;  3ITH A;  3V9Z A;  1S9E A;  4NCA A;  3DLB A;  3S3N A;  4CJR A;  4W5O A;  2PZS A;  1RTJ A;  2XY8 A;  2HND A;  3ZSO A;  3NF9 A;  3AO2 A;  3QIN A;  4I2Q A;  3QEW A;  3V9X A;  3VQ6 A;  1ZBF A;  3AVF A;  3ZSZ A;  3SYZ A;  4CCH A;  4CEQ A;  1RBU A;  4KV8 A;  1NK6 A;  4PY5 A;  3TAN A;  4Q0B A;  1RBS A;  1S1V A;  1VSI A;  3QLH A;  1UOC A;  1W9H A;  1LW2 A;  3A2F A;  3QEV A;  4TSX A;  2G8U A;  4KTW A;  3TAQ A;  4CJ3 A;  3HP6 A;  3O4N A;  5HLF A;  3EY1 A;  2XY6 A;  1TKZ A;  2OPQ A;  3QES A;  4OVL A;  1RCH A;  2A1R A;  1HRH A;  3AA2 A;  1D5A A;  5KRT A;  4Z4F A;  2Z1H A;  4PUO A;  2IDO A;  3UIQ A;  4HCB A;  2OPS A;  3AVM A;  4CGH A;  4KRF A;  1JL1 A;  2QXF A;  1RTI A;  1S6P A;  3K5N A;  4FJ8 A;  4KI6 A;  4DTO A;  1WSG A;  1RT4 A;  4M41 A;  2X74 A;  4RW8 A;  4FJG A;  4J2A A;  1ZBL A;  1EX4 A;  3V4I A;  3U6F A;  4LH5 A;  5HRS A;  3DLR A;  4M3W A;  3QET A;  2XHB A;  1Q9Y A;  4KHW A;  1CZ9 A;  4AHC A;  1VK0 A;  3OVN A;  4BWJ A;  3DI6 A;  2AJQ A;  4DU4 A;  5SWM A;  3LDS A;  2HW3 A;  4DTX A;  2X6S A;  4DG1 A;  1S9G A;  1WNS A;  5D3G A;  3NBP A;  1XC9 A;  1VRU A;  4Z4G A;  1TKD A;  3MED A;  4PA1 A;  3LP2 A;  1REV A;  4KHU A;  3ZT3 A;  4CJU A;  3RMA A;  4ID1 A;  3KLG A;  3NH0 A;  4OGC A;  1YTU A;  4FZZ A;  4DWI A;  3VQ9 A;  3AO4 A;  3OYE A;  3HM9 A;  1NK0 A;  3B6P A;  3C6T A;  3ZSQ A;  4E89 A;  1FKO A;  2Y1J A;  4N41 A;  1I3A A;  3MEC A;  4DS5 A;  2IOC A;  2A1S A;  3SPY A;  4DTM A;  2HHX A;  4CJV A;  3C95 A;  3KLE A;  1NJW A;  3C94 A;  1L3S A;  5HRP A;  1Q8I A;  4WE1 A;  4BDZ A;  1BIS A;  1KVB A;  2KZM A;  1LWC A;  5KTQ A;  1SL0 A;  4BDP A;  1WSJ A;  3AV9 A;  4CJW A;  2E4L A;  4ZTF A;  1CXU A;  3QEI A;  3VQ4 A;  3VQ5 A;  4CEZ A;  3M8R A;  1NKC A;  3AA3 A;  1IKV A;  1YT3 A;  1DTT A;  1JL2 A;  4DTU A;  3PX6 A;  3RMB A;  1U48 A;  4CGI A;  3HXM A;  3M8S A;  2VG5 A;  4FCY A;  1RT2 A;  1QSS A;  1BIU A;  3ZCM A;  3LWL A;  4E7H A;  3HO1 A;  1XHZ A;  3RRG A;  1X1P A;  3AVJ A;  3VQ8 A;  1KRP A;  4CF9 A;  1SKR A;  3V81 A;  3SNN A;  1KFS A;  1HYZ A;  4CFD A;  1RDC A;  4I9L A;  3QER A;  3LP3 A;  1LWF A;  3QIP A;  4KO0 A;  3V9U A;  4Z0U A;  1A5X A;  3V1Q A;  4CGJ A;  3KJV A;  1F21 A;  4IFV A;  4B8C A;  3MAQ A;  3EYZ A;  4FLX A;  4DS4 A;  4E7L A;  4CED A;  4OPJ A;  3O3F A;  1WAJ A;  4O55 A;  3P5J A;  3OYH A;  3OYB A;  4DF4 A;  3TAE A;  3VA3 A;  4KB1 A;  3LPU A;  1TV6 A;  3JSM A;  3HJF A;  1S6Q A;  2PY5 A;  1FXX A;  1FKP A;  3MXM A;  1JXB A;  1ZBU A;  1HJR A;  1VSJ A;  4O5B A;  1NJZ A;  4HHT A;  2EX3 A;  2ZE2 A;  1J9A A;  4CGF A;  2P5G A;  1B9D A;  3K57 A;  3SI6 A;  3PV8 A;  4AHR A;  3AA4 A;  3IS9 A;  4DFK A;  4CF2 A;  4LD0 A;  3ZSX A;  1VSH A;  4FLU A;  5CYQ A;  1TK5 A;  1TK8 A;  5JS1 A;  3MXJ A;  3ZSY A;  4B8A B;  3HVT A;  4F2S A;  3K58 A;  1L5U A;  1Q9X A;  2KTQ A;  3SQ1 A;  3HST B;  3NF6 A;  4HUG A;  3QO9 A;  2VWJ A;  4FJK A;  4FW1 A;  1W0H A;  3OYJ A;  1TK0 A;  3I8D A;  1YVU A;  3KKR A;  3VQP A;  1Y97 A;  3LZI A;  1MU2 A;  3LAL A;  3D0P A;  2IGI A;  3TAR A;  4J2E A;  4CIF A;  4B9T A;  1IKW A;  1VSD A;  3LAN A;  3NFA A;  3NHG A;  3LP1 A;  2KZZ A;  2F8S A;  3K59 A;  3MXI A;  1VSL A;  4OPK A;  1HYV A;  2FC0 A;  3OY9 A;  3L8B A;  4HTU A;  1QSY A;  4KHS A;  4O0I A;  3V1R A;  4FJ9 A;  1XHX A;  3O4Q A;  5E41 A;  5HRO A;  4FJN A;  1VRT A;  4M3Y A;  5T7B A;  3I0R A;  4E3S A;  4CHP A;  4M42 A;  4CGD A;  4CEB A;  3NGY A;  4FJM A;  2HNY A;  2YKN A;  4Y1D A;  1KFD A;  3TAP A;  4CJ5 A;  2HNZ A;  4CJP A;  1Z25 A;  4F3T A;  2IAJ A;  3U3G A;  2DTU A;  1NK4 A;  3TR8 A;  4CGG A;  3BDP A;  4B9M A;  1O1W A;  3M8Q A;  1WN7 A;  3DRR A;  3HPG A;  2YKM A;  4OJR A;  5K14 A;  4Z4H A;  1JLC A;  3PO5 A;  3OYF A;  1NJY A;  4CEF A;  3M8P A;  4I2P A;  2F8T A;  1NK8 A;  3ZSW A;  1QE1 A;  3MEE A;  5C42 A;  1WAF A;  4FM0 A;  4AIL C;  4F2R A;  3SUO A;  3HL8 A;  3NGZ A;  1QSL A;  2B5J A;  3RR7 A;  1BL3 A;  4EZ9 A;  1VSE A;  1UA1 A;  4KTQ A;  2HB5 A;  3AVH A;  4C8N A;  4JS5 A;  3OS2 A;  4DTN A;  1JLE A;  2FBY A;  4CJS A;  3OYI A;  3NAE A;  2W42 A;  5J2N A;  3G10 A;  3ZSV A;  4FJI A;  4CEC A;  3NE6 A;  3SUQ A;  3SJJ A;  4CEA A;  5FRO A;  2HHV A;  3SQ2 A;  4FJH A;  1HQE A;  4YNQ A;  3OJU A;  4DLG A;  1C0T A;  2KQ2 A;  4CFB A;  3NCI A;  3NGI A;  3LAM A;  2LSN A;  3HYF A;  4CHY A;  4FLW A;  4J2B A;  2ETJ A;  4MFB A;  2XO7 A;  3VQB A;  3SV4 A;  4CFA A;  4FJL A;  3F9K A;  1CXQ A;  1J53 A;  4CJE A;  3AVK A;  4ZTJ A;  1SKS A;  1BIZ A;  1C0U A;  2HVI A;  3VQD A;  3ZSR A;  1QTM A;  1D9F A;  3VQC A;  2HHS A;  1IKY A;  3QNO A;  2DFE A;  3QNN A;  3L3V A;  5C25 A;  4OLA A;  2YHB A;  4ELU A;  4DQQ A;  1HQU A;  1NKB A;  2HMI A;  2HHU A;  4CHN A;  3KLF A;  3OYC A;  1RBT A;  1WLJ A;  4LH4 A;  4FW2 A;  4IG3 A;  3O3G A;  4BE2 A;  5J2P A;  1XI1 A;  3SUP A;  4DLE A;  1WSF A;  2D0B A;  5CYM A;  4AHT A;  1ASV A;  1A5V A;  2PYL A;  4B9S A;  1LAV A;  3PO4 A;  2ITG A;  2VWK A;  2X6N A;  2FBV A;  1EXQ A;  2RKI A;  2O4G A;  4IBN A;  4JRP A;  2QKK A;  2BE2 A;  5FRN A;  4CES A;  1C1A A;  1EKE A;  1BHL A;  1VSK A;  3CM5 A;  5C24 A;  1BGX T;  4YFU A;  4NYN A;  4HUE A;  3SQ4 A;  3SQ0 A;  3S3M A;  4F8R A;  4CFC A;  1BQM A;  1KVC A;  3H08 A;  4L8R B;  4QCL A;  4FK2 A;  3DMJ A;  3QIO A;  3KK3 A;  4GMJ B;  4HUF A;  2WON A;  4OKJ A;  1L3U A;  3CM6 A;  3TWH A;  3SZ2 A;  1DTQ A;  1Z26 A;  3V1O A;  3S9H A;  2YHA A;  3SPZ A;  4FJJ A;  2PYJ A;  3AVI A;  3AVA A;  4RW7 A;  2OA8 A;  3AO3 A;  4F3O A;  3KLI A;  4KHY A;  3HP9 A;  4IFY A;  4RW6 A;  2GUI A;  2OPR A;  1SUQ A;  3ALY A;  1RDD A;  3ZT4 A;  4CER A;  4CHZ A;  2G8K A;  4PWD A;  4DF8 A;  2BGG A;  4M3T A;  1EP4 A;  1HNV A;  3DOK A;  5DMR A;  2ZD1 A;  1KVA A;  1KTQ A;  1YTA A;  3ZT0 A;  4AHS A;  3AVL A;  4RW4 A;  4RW9 A;  4CEE A;  4CK2 A;  1UAX A;  3AO1 A;  3L2V A;  4CJK A;  3AA5 X;  3K5L A;  1SL1 A;  2JLE A;  3DLH A;  4I9Q A;  4EP4 A;  4LSL A;  2B6A A;  3K2P A;  4KFB A;  4OGE A;  4XIU A;  3QEX A;  2R7Y A;  4B9V A;  3HVR A;  4FYD A;  4AHU A;  3SV3 A;  3MEG A;  4JLH A;  1NJX A;  1ZBI A;  3T1A A;  4AHV A;  1R0A A;  2F96 A;  3D45 A;  2YV0 X;  3P83 D;  3OYM A;  3CQ8 A;  2Q3S A;  4W5T A;  4C8L A;  2RPI A;  1RBV A;  4CIE A;  1JKH A;  2D0C A;  3TAM A;  5SZT A;  2DY4 A;  5KGX A;  3CYM A;  4NCB A;  4KHQ A;  4K8X A;  4B9N A;  4DU1 A;  3DM2 A;  3CG7 A;  4KKO A;  4CF0 A;  4CK1 A;  3HT3 A;  4CEO A;  4BAC A;  1D9D A;  2QK9 A;  3OYD A;  4CF8 A;  1CZB A;  3L2Q A;  2JGU A;  1ITG A;  3RMC A;  4MQ3 A;  4Y1C A;  5KRS A;  4ELT A;  2OPP A;  1KLM A;  4H8K A;  3VQQ A;  4ELV A;  1IKX A;  1TAQ A;  1RT5 A;  1DLO A;  3KIO A;  4H4O A;  3WNF A;  4CJF A;  4DFM A;  2P51 A;  1TKX A;  5I42 A;  1KLN A;  3CFP A;  3THV A;  3G0Z A;  3OYK A;  1LAW A;  3O3H A;  3WNE A;  3VN5 A;  4E7K A;  3LWM A;  3NDK A;  3ZT1 A;  4R5P A;  3KD5 E;  1T7P A;  4FK0 A;  5HRR A;  4CHQ A;  1IO2 A;  2G8W A;  3KD1 E;  1BCO A;  2E6L A;  5JS2 A;  2XY5 A;  1RT6 A;  1S5J A;  1D8Y A;  1RDB A;  1HPZ A;  1HYS A;  5KGW A;  2QKB A;  1KCF A;  5HBM A;  2HVH A;  3HPH A;  1A5W A;  1RT1 A;  3KKS A;  2ZQB A;  4DSL A;  1GOB A;  3OYN A;  4NYF A;  4Z4C A;  3DLG A;  3VQE A;  3SUN A;  2OZS A;  4B9L A;  1HMV A;  2ATQ A;  1RBR A;  2EHG A;  1C0M A;  1SV5 A;  4CK3 A;  5J2M A;  4CHO A;  1X9M A;  4DTJ A;  3F73 A;  1NKE A;  4KB0 A;  4O44 A;  3T19 A;  2YNI A;  4LSN A;  2HHW A;  4H4M A;  1T8E A;  4E7J A;  1N6Q A;  4IKF A;  1NK5 A; 
#chains in the Genus database with same CATH topology
 1J5O A;  2ZJQ L;  4N47 A;  2A3Z A;  2GV9 A;  3AVN A;  5KI6 A;  3ENH A;  3QFU A;  3TI0 A;  3I33 A;  4B1U B;  3ID8 A;  4BDY A;  5KQD A;  5AQY A;  4E7I A;  4DSF A;  4H5W A;  3S3O A;  2QM1 A;  2RN2 A;  1RNH A;  1QVF M;  3CMA N;  3J7A P;  3HK2 A;  1JLF A;  1U47 A;  2W41 A;  2DFF A;  4M45 A;  2X78 A;  1NOY A;  3ZLJ A;  2O4I A;  4N56 A;  5DM7 L;  4JK7 A;  2KFN A;  1W7A A;  1BUP A;  1RT3 A;  3BGR A;  4GVM A;  3OS1 A;  4F9O A;  1BI4 B;  1IV0 A;  4YDU C;  4O0J A;  3ISN C;  1SKW A;  3TU5 A;  4BR4 A;  2O8B B;  3LM2 A;  4LY7 A;  5KPR A;  1KSP A;  1L3V A;  1HNZ K;  4FZY A;  4BR5 A;  2P9L A;  1TGO A;  2ZM6 K;  4BG9 A;  4JHD A;  1NGC A;  4K42 A;  1TUU A;  4KI4 A;  3GE1 A;  3QML A;  4K8Z A;  3NH1 A;  1IH7 A;  1VQ4 N;  4HCC A;  1KD1 O;  3J8A A;  2P9K B;  3CPE A;  4M63 C;  2FBX A;  2DFH A;  4FLZ A;  4GV9 A;  1GOC A;  5CHI A;  4B3T K;  2RF2 A;  3CC4 N;  1S1W A;  1TAU A;  1WSH A;  4DQS A;  2IC3 A;  1OKJ A;  2GUP A;  1Q81 O;  3G71 N;  1B92 A;  2A42 A;  3RR8 A;  4FM1 A;  3I0S A;  3CCL N;  2E6M A;  1QZ5 A;  5M1F A;  1RTH A;  2GBZ A;  3HPO A;  5DM6 L;  4FK4 A;  1C6V A;  4FM2 A;  3MCP A;  3UE5 A;  3TAB A;  3H1V X;  4FWK A;  1M1K O;  1LWE A;  3KTQ A;  2P5O A;  4B3S K;  4CZE A;  2YNH A;  4Z4E A;  4K0K K;  4DQP A;  1HNI A;  1ZC6 A;  4BE1 A;  5J2Q A;  4LF7 K;  3VEX A;  2QWP A;  3VQA A;  3VET A;  4N76 A;  5AQM A;  3R8E A;  3VQ7 A;  3B6O A;  4ID5 A;  2WTU A;  3CFR A;  1RDU A;  2OYQ A;  3UKR A;  2PFU A;  3PX4 A;  4FZX C;  1ZBH A;  3H1Q A;  3QFP A;  2HOE A;  4JI7 K;  4DMN A;  1WSE A;  1JLQ A;  2B4J A;  3MCA B;  3C0B A;  2IVP A;  3PX0 A;  1N5Y A;  4KHN A;  3K5O A;  1B9F A;  3D2E A;  1BOT O;  1QQO A;  2G8F A;  4CJL A;  3AO5 A;  4BC3 A;  2OTL N;  5AQV A;  1NOZ A;  3T7Z A;  5JIC A;  4NCA A;  4BR7 A;  3CCQ N;  4CJR A;  1NM1 A;  5AQP A;  4JK8 A;  3QIN A;  3VEZ A;  3VQ6 A;  1ZBF A;  4H5V A;  3SYZ A;  4CEQ A;  1RBS A;  1LW2 A;  2CGL A;  1VQM N;  3A2F A;  4A59 A;  4BRE A;  3O4N A;  1TKZ A;  2OPQ A;  3QES A;  4OVL A;  4JEP A;  1I94 K;  1NGE A;  1HRH A;  4JV5 K;  5FPE A;  5KRT A;  2Z1H A;  1QHA A;  3MDQ A;  5AFU H;  1NGH A;  1QQM A;  1RTI A;  4BRL A;  4FJ8 A;  1JCE A;  4DTO A;  1WSG A;  2ASP A;  3CJC A;  3NVM A;  2X74 A;  1Z05 A;  3EN9 A;  1YIJ N;  4FJG A;  3VTH A;  1NG9 A;  2O8C A;  4H0O A;  1ATS A;  4QS7 A;  3THY A;  2X6S A;  3ULE A;  3H45 C;  1TKD A;  4PKI A;  4YOX A;  5C15 A;  3ZT3 A;  3NH0 A;  3B6P A;  3C6T A;  3VGL A;  3ZSQ A;  2Y1J A;  1KQS M;  4N41 A;  4EHT A;  4DS5 A;  2A1S A;  1T44 A;  4MO5 A;  3SPY A;  2HHX A;  1MWK A;  4BDZ A;  1BIS A;  2KZM A;  4AM7 A;  4NLC A;  4JI6 K;  2P9P B;  3VQ5 A;  3M8R A;  5BPM A;  3I55 N;  1YT3 A;  5LMU K;  3WXJ A;  2E2Q A;  4ISF A;  1QSS A;  3WXM B;  3FZK A;  1Q7Y O;  3O1B A;  4DCH A;  4IOA L;  5LY3 A;  4CF9 A;  5EVZ A;  3CCS N;  4B9Q A;  1RDC A;  2HBL A;  1BA1 A;  4PL7 A;  1A5X A;  3EZW A;  1F21 A;  4C1N I;  4FLX A;  3EYZ A;  4DS4 A;  1VQN N;  2D4W A;  4O55 A;  3OYB A;  5IT9 O;  4DF4 A;  4DB3 A;  3VA3 A;  3OW2 M;  5KQ8 A;  4FWN A;  1FXX A;  1FKP A;  1ZBU A;  4CD1 A;  2P5G A;  3AA4 A;  3JXU A;  4LD0 A;  1TK8 A;  1VSH A;  1TK5 A;  3ATU A;  1L5U A;  1Q9X A;  5AFU A;  3DXK A;  3SBT A;  3T1H K;  5BPL A;  4DV5 K;  1VQL N;  4FJK A;  1W0H A;  1HR0 K;  1TK0 A;  4Y0W A;  2YX6 A;  1YVU A;  5BRF A;  3HI0 A;  3LZI A;  3D0P A;  2IGI A;  1NGF A;  3U9Z A;  4B9T A;  4BRH A;  1KAX A;  1NGJ A;  5F2R A;  2RE2 A;  3MXI A;  2Q1N A;  3CPW M;  3SAG A;  3O8M A;  4CHP A;  3ATV A;  1KFD A;  5GAD P;  3TAP A;  4CJP A;  3BDP A;  3FZH A;  3SJH A;  1WN7 A;  5K14 A;  3HPG A;  2YKM A;  4OJR A;  1JLC A;  4BRF A;  2B5J A;  1BL3 A;  1VHX A;  5AQR A;  1JLE A;  3OYI A;  2W42 A;  1JCG A;  4CEC A;  1T6C A;  3SUQ A;  2QWO A;  5FRO A;  2HHV A;  5AQT A;  3LDO A;  3VOV A;  3OJU A;  5LL6 Z;  3CCR N;  4DLG A;  3DXM B;  3GG4 A;  3JS6 A;  3U9D A;  3NGI A;  1Q82 O;  4CHY A;  4J2B A;  4MFB A;  3VQB A;  3SV4 A;  3F9K A;  4ZTJ A;  4CJE A;  4IWV A;  2HVI A;  4B1X B;  4U7B A;  4KHP K;  1QTM A;  3VQC A;  3QNO A;  2DFE A;  3QNN A;  3ZX0 A;  2GEM A;  4ELU A;  1XNR K;  2NRV A;  1NMN A;  1WSF A;  4AHT A;  5CYM A;  1ASV A;  1A5V A;  3LDQ A;  1E3M A;  4WFA L;  2RKI A;  4CVN E;  4JRP A;  5GIP A;  5FRN A;  4CES A;  4IEI A;  1BHL A;  1VSK A;  4F8R A;  2BTF A;  5BRH A;  3H08 A;  4GV6 A;  4DV3 K;  5BR8 K;  3GDQ A;  1DTQ A;  4J8F A;  5FLX O;  2PYJ A;  3KLI A;  2V51 B;  4RW6 A;  1SUQ A;  5TKW A;  1N34 K;  4YY3 K;  2ZD1 A;  1KVA A;  2ITM A;  1K8K B;  1NGG A;  1XUP O;  3AVL A;  5AZI A;  4GKJ K;  4CEE A;  1UAX A;  3AO1 A;  1VQ6 N;  3AA5 X;  4I9Q A;  2VGM A;  4KFB A;  4FL9 A;  2GEL A;  3CCJ N;  1NJX A;  1R0A A;  5AQS A;  2E2O A;  5FPN A;  4BR0 A;  2RPI A;  4GV3 A;  1RBV A;  3R3L A;  5BRE A;  1JKH A;  2J4R A;  5SZT A;  5KGX A;  3CYM A;  4KKO A;  4CZK A;  3FZM A;  4CEO A;  2QK9 A;  1YJN N;  4KBO A;  4WQ4 A;  5AQL A;  3VQQ A;  1DLO A;  3WNF A;  3UB5 A;  2NRX A;  2FSN A;  3OYK A;  3WNE A;  3P4I A;  3T69 A;  4FPA A;  2G8W A;  3KD1 E;  2AA4 A;  3KWG A;  4MDB A;  4PKH A;  2PBD A;  1RDB A;  1HPZ A;  3CIP A;  1KCF A;  4IXC A;  1RT1 A;  3D2F B;  4WFB L;  3OYN A;  4RTF D;  3MN5 A;  2ATQ A;  1RBR A;  1M90 O;  1SV5 A;  2UXD K;  2DPN A;  1X9M A;  3F73 A;  4CBW A;  4Z94 A;  3SMP A;  2HHW A;  1WUA A;  4LSN A;  2EWS A;  2HBM A;  3WEE B;  3G6E N;  1C0F A;  3W3D A;  3HZ6 A;  3THX A;  4EP5 A;  4PKG A;  4JRQ A;  5ADX A;  3RSE B;  4KH6 A;  3DOL A;  2I5J A;  2P9N B;  4CJ4 A;  4DFJ A;  1TVR A;  3E01 A;  4H03 B;  3CQY A;  2Z1I A;  4B1W B;  3EZ5 A;  1FK9 A;  4CIG A;  1HUX A;  2HMP A;  2HF3 A;  3E9L A;  3P1G A;  1GOA A;  2YNG A;  2PAV A;  3Q7C A;  5BR9 A;  4HVJ A;  3K5M A;  4DSE A;  3VTI A;  1YAG A;  4EIA A;  3IMX A;  1EET A;  1LCU A;  3E9P A;  4JKD A;  3O6W A;  2BAN A;  2P9U A;  4LF4 K;  1YUW A;  3OYG A;  2HHT A;  4RWT A;  1J6Z A;  4DUZ K;  3IG1 A;  4DU3 A;  1T05 A;  4JI8 K;  2O8E B;  5CZ2 A;  3A5O C;  4KRE A;  1TKT A;  1UWB A;  1JXE A;  3CFO A;  4X65 K;  2ASO A;  3FE1 A;  4ICL A;  1S1T A;  2YNF A;  5J1E A;  4B9U A;  3V6D A;  2NZT A;  3IAY A;  4M3R A;  4E1M A;  3DLL L;  4W5N A;  4FXD A;  4W5R A;  1U49 A;  4WQ5 A;  1TYQ B;  2NNW A;  2Q2R A;  4CJQ A;  4DR5 K;  5AQH A;  2VG6 A;  4FWS A;  5FRM A;  5A2Q O;  4IOX A;  1QQC A;  4DTS A;  1GLE G;  4YOY A;  3G4S N;  3ZEU A;  3ASM A;  1ASU A;  1NK7 A;  3ULD A;  3AVB A;  1VQP N;  4FO0 A;  3T3F A;  1MWM A;  3CER A;  5AZJ B;  1T6D A;  1RDA A;  2O8F B;  2QWL A;  1SL2 A;  3ZET B;  1BQN A;  1IG8 A;  2UYT A;  5FDL A;  4PQU A;  4CZM A;  2UUC K;  4EZ6 A;  3HOT A;  3RRH A;  1NU0 A;  3DAW A;  3AVG A;  3L4I A;  4BR9 A;  2HHQ A;  4MLH A;  3FFI A;  1KAZ A;  1RIL A;  4UQG A;  1C1C A;  2UUA K;  2WUS A;  1BI4 A;  1J54 A;  3E66 A;  4DV7 K;  3O80 A;  4C8K A;  2F7T A;  1UA0 A;  3OYL A;  3KLH A;  4ZHR A;  2O8B A;  1ASW A;  4W5Q A;  4OKK A;  5HP1 A;  2FSJ A;  3OYA A;  1DKG D;  3ITH A;  4K41 A;  3MX2 A;  4ILJ A;  3DLB A;  2QTD A;  2HND A;  3ZSO A;  1U2V B;  3ID6 A;  5E26 A;  5CR4 A;  4JKA A;  3ZSZ A;  1NK6 A;  3TAN A;  2W6K A;  1S1V A;  3QLH A;  1ATN A;  2G8U A;  4KTW A;  4CJ3 A;  3HP6 A;  1HLU A;  2RHK A;  3TSP A;  1OH5 A;  4BC2 A;  4EFH A;  1D5A A;  4Z4F A;  4FSV A;  2FXU A;  4BVO A;  5H1S Q;  4HCB A;  3AVM A;  3WQT A;  4CGH A;  1OH8 A;  4KRF A;  4KI6 A;  2ZGY A;  4LFC K;  3CCU N;  4J2A A;  3AAP A;  4B1Y B;  1ZBL A;  3V4I A;  2ZJP L;  5AQX A;  1RDW X;  4M3W A;  1Q9Y A;  2XHB A;  4KHW A;  3MN7 A;  1VK0 A;  1VQ9 N;  4DTX A;  4BVP A;  1VQO N;  4DG1 A;  3OHR A;  3GOI A;  1Y64 A;  4BGB A;  1XC9 A;  1VRU A;  4PA1 A;  1REV A;  4CJU A;  3RMA A;  1Q18 A;  4OGC A;  4DWI A;  3AO4 A;  3OYE A;  1TUY A;  1K8A O;  3RVC A;  4YOT A;  1EO1 A;  5BN8 A;  2FF3 B;  4IFE A;  2IOC A;  5IWA K;  3CC7 N;  2UU9 K;  5M1O A;  3WXI A;  4WE1 A;  2H3G X;  3VEV A;  1LWC A;  1SL0 A;  3AV9 A;  4CJW A;  3QEI A;  1NKC A;  1N32 K;  4B3M K;  3AA3 A;  3JAM O;  4DTU A;  2P9I A;  1RT2 A;  4FCY A;  3CJA A;  3HO1 A;  3RRG A;  1P90 A;  1X1P A;  3VQ8 A;  1KRP A;  1SKR A;  3FR0 A;  1HYZ A;  4LC9 B;  3LP3 A;  4KO0 A;  3QIP A;  2AP1 A;  3VPZ A;  4CGJ A;  3QBX A;  4IO8 A;  3KJV A;  4X62 K;  3B8A X;  3O9S A;  1P8Z A;  4E7L A;  4OPJ A;  3O3F A;  1ZXO A;  2GWK A;  2VYP A;  3TAE A;  3JSM A;  1S6Q A;  4YOR A;  4O5B A;  1VSJ A;  1NJZ A;  3CJ7 A;  3SI6 A;  3J7Z O;  3PV8 A;  4AHR A;  3IS9 A;  2KKZ A;  4FLU A;  4H0T B;  4CZH A;  1X3N A;  4B8A B;  3HVT A;  4F2S A;  3K58 A;  3HST B;  4FW1 A;  4B1Z A;  2Q0R A;  3KKR A;  3VQP A;  1OH6 A;  3LAN A;  3NFA A;  2WFB A;  4K43 A;  2P9L B;  4ILH A;  3K59 A;  1VSL A;  2FC0 A;  3OY9 A;  4KHS A;  3V1R A;  3KVG A;  2JWL A;  5E41 A;  2HBK A;  4M3Y A;  3K9J A;  4HTL A;  4E3S A;  4CGD A;  4JKB A;  2YKN A;  1EWR A;  4MDA A;  4Y1D A;  1Z25 A;  1VQ8 N;  4E1J A;  5LJW A;  3KK7 A;  4G9Z A;  2P9P A;  3PO5 A;  3OYF A;  1QE1 A;  3MEE A;  3NGZ A;  2E1Y A;  4EZ9 A;  5KPT A;  2HB5 A;  3VGK A;  4JS5 A;  3IUC A;  4JKC A;  4CJS A;  3NVK A;  4JAX A;  3G10 A;  3QB0 A;  3A5L C;  1GLA G;  1XC3 A;  1NGB A;  1HQE A;  3IDH A;  2KQ2 A;  4CFB A;  3C65 A;  2W6L A;  1BO5 O;  3PSF A;  2CH5 A;  1WOQ A;  1CXQ A;  3AVK A;  1BIZ A;  4B1V A;  1C0U A;  4DR4 K;  2HHS A;  4CD3 A;  4NLB A;  2QXL A;  3BP8 A;  4H5N A;  5AQU A;  2Q0U A;  4DQQ A;  1HQU A;  2HMI A;  2ASM A;  3UKR B;  3OYC A;  4FOI A;  1RBT A;  4BE2 A;  3A5N C;  2NRR A;  2PYL A;  2VCP A;  3PO4 A;  5AQF A;  1EXQ A;  1WB9 A;  5MLC Q;  3C7N B;  3EE8 A;  4F3T A;  3CM5 A;  4YFU A;  1NK4 A;  3SQ4 A;  1HKC A;  1BGX T;  4WFN L;  3BF1 A;  3S3M A;  4M7Y A;  1KVC A;  4CFC A;  3UKU B;  4QCL A;  4FK2 A;  3DMJ A;  3KK3 A;  1QZ6 A;  2WON A;  3R1X A;  3SZ2 A;  2QWR A;  3S9H A;  1W2B M;  4FJJ A;  3AVI A;  4RW7 A;  4AQY K;  3AO3 A;  4KHY A;  3HP9 A;  3EEQ A;  4DV0 K;  1RGI A;  4BRP A;  3ALY A;  2G8K A;  4DF8 A;  4M3T A;  1HNV A;  3DOK A;  3AGR A;  1KTQ A;  3ZT0 A;  4AHS A;  4IO9 L;  4C1N K;  4CK2 A;  3L2V A;  1S72 N;  4EAH D;  2B6A A;  3K2P A;  2R7Y A;  4B9V A;  2IIR A;  3HVR A;  4FYD A;  4JN4 A;  3T1A A;  2F96 A;  3SLC A;  3OYM A;  1V4S A;  2Q3S A;  2O8C B;  4W5T A;  4C8L A;  3PIP L;  3DXM A;  1XMO K;  4B9N A;  3ULE B;  3OYD A;  4CF8 A;  1CZB A;  4NB4 A;  4V19 S;  4H8K A;  1IKX A;  1TAQ A;  1RT5 A;  2P51 A;  3THV A;  3VES A;  4YOW A;  5F1X A;  4FK0 A;  4CHQ A;  1IO2 A;  5JS2 A;  1NGA A;  3O9U A;  2XY5 A;  5HL7 L;  1HYS A;  5KGW A;  2HVH A;  3KKS A;  2ZQB A;  1GOB A;  3O9Q A;  1SAZ A;  4JI3 K;  4GY2 B;  3HOS A;  3MWP A;  2EHG A;  5J2M A;  2V7Y A;  3ENB A;  3LDP A;  3WQU A;  4DTJ A;  4JD2 B;  3T19 A;  4H4M A;  1T8E A;  3D7E O;  5AQQ A;  1BDG A;  1NK5 A;  5AQN A;  1LW0 A;  3L2U A;  4DFP A;  3M6G A;  4A62 A;  4CJT A;  1OVY A;  4G1Q A;  3DRS A;  1DEJ A;  1K8K A;  2V52 B;  4DQR A;  5CZ1 A;  2E8A A;  1U04 A;  4OLB A;  2P1J A;  3FLC O;  3WXK A;  2NUB A;  1DGK N;  1S1U A;  4C8O A;  1E4F T;  1GLD G;  2G8V A;  3V9W A;  5AQO A;  4DV6 K;  1NK9 A;  2D0A A;  5HRN A;  2BUP A;  5HOO A;  3OBW A;  3LZJ A;  4JS4 A;  1HNW K;  5CE3 A;  4JKG B;  1U45 A;  3M3Z A;  1IBM K;  3LM9 A;  3NF8 A;  4IJA A;  4KPY A;  5LJV A;  3F2K A;  3LPT A;  4I7F A;  2G8I A;  1K73 O;  4J2D A;  1HNX K;  4Z4I A;  1NGD A;  3AVC A;  4HWI A;  4XEI A;  1LV5 A;  4DSK A;  4E19 A;  3DYA A;  1NGI A;  2Z1G A;  4FWP A;  3EO3 A;  2IS3 A;  5BRD A;  3L6Q A;  3OJS A;  2HST A;  1L3T A;  2QWQ A;  1YHQ N;  4CZF A;  1JLG A;  3HBT A;  1YI2 N;  1QS4 A;  3O4W A;  2OZM A;  1TL1 A;  1VSF A;  3SMS A;  1VQ5 N;  1H1V A;  5AQG A;  2Z1J A;  3WEE A;  4QS9 A;  3MK6 A;  4IOC L;  2HHH K;  1XWL A;  4KTZ A;  1WSI A;  3RSE A;  1YJ9 N;  4X64 K;  3T1Y K;  3CD6 N;  1JLB A;  1T3V A;  2KHO A;  2QWN A;  1C0G A;  4M7X A;  4BRM A;  3C6U A;  2OTJ N;  4FLY A;  5I3U A;  3V9S A;  3ZT2 A;  1NJI O;  5C0Y A;  2YHX A;  4A2A A;  3SCX A;  5F0X A;  2GX9 A;  4YOU A;  2VG7 A;  3RWU A;  3TSU A;  3EKS A;  4GKK K;  2E20 A;  3PUF A;  4DR6 K;  4ILG B;  1T03 A;  4O4G A;  5EU7 A;  1X9J A;  5AJ3 K;  4FVM A;  1QHT A;  1YIT N;  4BQL A;  4UY8 O;  1V4T A;  2KFZ A;  2KW4 A;  1VSM A;  2FBT A;  5C2F A;  4U67 L;  3KK1 A;  4FJ7 A;  2OCE A;  4DR1 K;  3V9Z A;  5M1P A;  2D0P A;  2O8E A;  3S3N A;  3W0L A;  4ISG A;  2PZS A;  2XY8 A;  1BWF O;  3NF9 A;  3AO2 A;  3I56 N;  4BQZ A;  3VF2 A;  1O13 A;  2D0O A;  2UXB K;  4KV8 A;  3H46 O;  5JVH L;  4BRK A;  3O9T A;  1VSI A;  4GVE A;  3ZX2 A;  1W9H A;  3QEV A;  5HLF A;  2FLO A;  3CQX A;  4H5T A;  3EY1 A;  4KH5 A;  1RCH A;  2A1R A;  3GL1 A;  4BRQ A;  4PUO A;  3QDK A;  5JLF A;  3UIQ A;  2OPS A;  3PSI A;  2O8D A;  1JL1 A;  2QXF A;  3BUZ B;  2YI1 A;  3L4Q A;  4BR2 A;  4RW8 A;  1EX4 A;  3U6F A;  1SZ2 A;  1GLC G;  3QET A;  3IKM A;  4BWJ A;  2UUB K;  3THW B;  2O8F A;  3LDS A;  3ZET A;  1WNS A;  5D3G A;  3NBP A;  4Z4G A;  3MED A;  4ID1 A;  3KLG A;  3WXL A;  4BRC A;  5C2D A;  3VQ9 A;  1GLB G;  3HM9 A;  1NK0 A;  3VER A;  4E89 A;  3ENO A;  1FKO A;  4AM6 A;  4MLE A;  4C23 A;  3C95 A;  3KLE A;  3C94 A;  1L3S A;  4EHU A;  4CBU A;  5KTQ A;  4BDP A;  1WSJ A;  2E4L A;  4ZTF A;  1CXU A;  3VQ4 A;  3KZB A;  4CEZ A;  1IKV A;  5EY4 A;  4YDU A;  1HJO A;  5AR0 A;  3SAH A;  1JCF A;  4CGI A;  1BIU A;  3ZCM A;  3LWL A;  4XH1 A;  1XHZ A;  3AVJ A;  3H3N O;  3Q7B A;  4CBX A;  3CCM N;  3SNN A;  1KFS A;  4CFD A;  4I9L A;  3QER A;  1VAZ A;  3VEN A;  1LWF A;  4DKW A;  4KH4 A;  3V9U A;  4WQ4 C;  4Z0U A;  3V1Q A;  3MAQ A;  1SQK A;  4CED A;  1WAJ A;  3P5J A;  1GLF O;  4K25 A;  4BG8 A;  5M1Q A;  3MXM A;  1JXB A;  1HJR A;  2EX3 A;  2ZE2 A;  1J9A A;  4CGF A;  1B9D A;  4CF2 A;  3M5R A;  3ZSX A;  3MXJ A;  4FWQ A;  3ZSY A;  3K0S A;  2KTQ A;  3SQ1 A;  3NF6 A;  4HUG A;  3QO9 A;  2P9S B;  3OYJ A;  4OPA A;  1Y97 A;  1MU2 A;  1RFQ A;  2P9U B;  4J2E A;  1IKW A;  3CCE N;  2F8S A;  4DR3 K;  4OPK A;  1D4X A;  1HYV A;  3L8B A;  4HTU A;  4FJ9 A;  4DV4 K;  1XHX A;  5HRO A;  4FJN A;  1VRT A;  2E2P A;  4M42 A;  4A57 A;  5EXW A;  2HNY A;  4BRA A;  2P9K A;  4O5F A;  4CJ5 A;  2HNZ A;  2IAJ A;  2DTU A;  4CI6 A;  2NRW A;  4CGG A;  1MA9 B;  1O1W A;  5GIO A;  3M8Q A;  3P31 A;  3DRR A;  4Z4H A;  4LF9 K;  3NMU A;  2CGK A;  5AQJ A;  3M8P A;  4I2P A;  2F8T A;  4NXM K;  1NK8 A;  3ZSW A;  4FM0 A;  3N4Q A;  4AIL C;  4F2R A;  4BRI A;  3IFR A;  1N8R O;  3RR7 A;  1VSE A;  3VF4 A;  3AVH A;  3OS2 A;  4DTN A;  3NAE A;  2FBY A;  5J2N A;  3ZEU B;  4ISE A;  3ZX3 A;  4FJI A;  1LOT B;  3S41 A;  3TTC A;  4JYA K;  3NE6 A;  3SJJ A;  4CEA A;  4DQ8 A;  4DHY A;  4FJH A;  4YNQ A;  2YHY A;  4CZI A;  3NCI A;  4O8U A;  3HYF A;  2ETJ A;  4I6M B;  1VQK N;  4FJL A;  4CFA A;  2VQF K;  1J53 A;  1SKS A;  2VGN A;  3SAF A;  4OO1 J;  3VQD A;  1D9F A;  2D1K A;  3R6M A;  1J5E K;  1IKY A;  4OLA A;  3L3V A;  5C25 A;  3AAR A;  2YHB A;  3P39 A;  2HHU A;  1FJG K;  3KLF A;  3E9O A;  5C10 A;  4WQ5 C;  1XI1 A;  4IG3 A;  2QEX N;  1HX1 A;  4DLE A;  4B9S A;  1LAV A;  2QW9 A;  2X6N A;  5B8H A;  2O4G A;  4IBN A;  5GAE P;  2QKK A;  4NYN A;  3SQ0 A;  5C12 A;  4L8R B;  4DV2 K;  4XH5 A;  3QIO A;  4H0X B;  5FPD A;  5AQI A;  1Z26 A;  3V1O A;  3AVA A;  4F3O A;  2CH6 A;  2GUI A;  4CER A;  1RDD A;  4CHZ A;  4PWD A;  1EP4 A;  1QQN A;  2ZF5 O;  3BZC A;  2V7Z A;  1YTA A;  4RW4 A;  5JMV A;  2NRZ A;  2JLE A;  5TKY A;  4EP4 A;  4FOE A;  4FWL A;  4OGE A;  4XIU A;  3QBW A;  1BG3 A;  2WC9 A;  1OH7 A;  4BGA A;  2ZJR L;  3SV3 A;  4JLH A;  4FWM A;  3CJ1 A;  4AHV A;  3CF5 L;  2F9T A;  2YV0 X;  3P83 D;  3CQ8 A;  2D0C A;  2DY4 A;  4KHQ A;  4K8X A;  2Q31 A;  3DM2 A;  4CF0 A;  4CK1 A;  4BAC A;  1KXP A;  2JGU A;  3GBT A;  4MQ3 A;  4Y1C A;  3TPQ A;  5KRS A;  1Q86 O;  1KLM A;  1KAY A;  4A5B A;  3KIO A;  5I42 A;  1KLN A;  1TKX A;  4JHD B;  3CFP A;  3A5M C;  1LAW A;  3O3H A;  3VN5 A;  4E7K A;  3NDK A;  1MDU B;  3CET A;  4R5P A;  3KD5 E;  1T7P A;  5GAH P;  3DWL A;  3H6E A;  1RT6 A;  1S5J A;  1BU6 O;  4XH4 A;  3HPH A;  1A5W A;  1HKB A;  3C7N A;  4NYF A;  3VQE A;  3SUN A;  4B9L A;  1HMV A;  2A41 A;  1C0M A;  4CK3 A;  2I7P A;  4CHO A;  1NKE A;  3PLA A;  3UKU A;  2P9I B;  3J80 O;  4KB0 A;  4O44 A;  2YNI A;  1YVN A;  4E7J A;  1IJJ A;  4Q0B A;  4IKF A;  4WF9 L;  2D5R A;  4DTR A;  4DSI A;  3RMD A;  1K9M O;  3WNH A;  4BWM A;  1G15 A;  4DR7 K;  3L3U A;  3JYT A;  3IRX A;  4B08 A;  3BF3 A;  2IVO A;  4FJ5 A;  2XY7 A;  3LAK A;  4NO7 A;  3CC2 N;  1C1B A;  4CF1 A;  3OBY A;  1I39 A;  4FLV A;  1DT9 A;  1EQY A;  5GAG P;  3RTV A;  4NCG A;  3MMV A;  3O9R A;  1K6Y A;  3SK3 A;  3O1W A;  3VA0 A;  4FPB A;  2A6A A;  1OVQ A;  4MO4 A;  4Q5V A;  4YHH K;  4N5S A;  3NH2 A;  5JLH A;  1BA0 A;  4H0P A;  3F9M A;  1S1X A;  3NF7 A;  3U8X A;  4FJX A;  4E1N A;  3OS0 A;  3D2E B;  3D6R A;  2UXC K;  4GW6 A;  1QVG M;  3L2W A;  4JNE A;  3QEP A;  2BDP A;  1GLJ O;  2YCH A;  3FZF A;  4O8K A;  4B3O A;  4JK9 A;  4PHT X;  1CLQ A;  4DQI A;  3DLK A;  4AH9 A;  1IG9 A;  4E0D A;  1ESV A;  3O08 A;  4BC4 A;  4M3U A;  3PY8 A;  3HRG A;  3DLE A;  5CY4 A;  1X9W A;  2E5L K;  5M1N A;  4BE0 A;  4WYB A;  4RG8 A;  2Y1I A;  1ATR A;  4JD2 A;  4QAG A;  3O5B A;  3BY5 A;  2NRT A;  1RT7 A;  3G25 A;  1U4B A;  4DR2 K;  4JI2 K;  4DSJ A;  3U3Y A;  2XRI A;  1X9S A;  4AF1 A;  3VEW A;  2GWJ A;  3TAF A;  2NRH A;  3THY B;  2G8H A;  1BCM A;  4IG0 A;  3P38 A;  2E2N A;  3F5T A;  4LFB K;  4FLT A;  5ELZ A;  5LMN K;  4OKE A;  4DTP A;  4M3Z A;  2Q36 A;  3LP0 A;  1IBK K;  3WNG A;  4QOZ B;  2WOM A;  1N33 K;  4C8M A;  1Z6R A;  3DRP A;  5DK5 A;  3L2R A;  4KAZ A;  4M3X A;  2IVN A;  4OX9 K;  1JLA A;  1RTD A;  3OA9 A;  4LF5 K;  4CE9 A;  1YJW N;  4JKG A;  3KK2 A;  3MN9 A;  3TAG A;  4F4K A;  3LDN A;  4IDK A;  3HSC A;  4L3Q A;  1ZYQ A;  4CZG A;  1TL3 A;  5KPZ A;  4FVU A;  1S9E A;  1NMD A;  4W5O A;  1U6Z A;  2HF4 A;  1RTJ A;  4I2Q A;  3QEW A;  3V9X A;  3AVF A;  4CCH A;  1RBU A;  4PY5 A;  3MWT A;  1UOC A;  4IDH A;  4TSX A;  3CI5 A;  3TAQ A;  4LF8 K;  1ILY A;  2XY6 A;  4H0V B;  3AA2 A;  2A5X A;  2IDO A;  4BY9 C;  2QA4 N;  4H5R A;  1S6P A;  3K5N A;  1RT4 A;  4M41 A;  3BZK A;  3J7Y P;  4LH5 A;  5HRS A;  4A61 A;  3DXK B;  3DLR A;  1JJ2 M;  1CZ9 A;  4AHC A;  3OVN A;  3DI6 A;  2AJQ A;  4DU4 A;  3HM8 A;  5SWM A;  2HW3 A;  5FPM A;  1S9G A;  2QI2 A;  2FSK A;  3K9K A;  2JWK A;  3LP2 A;  4KHU A;  1S3X A;  3QIC A;  3HTV A;  2YJE A;  1YTU A;  4FZZ A;  3DJC A;  4IEE A;  1GLL O;  4X66 K;  2VWB A;  1I3A A;  3MEC A;  4BRN A;  1S22 A;  4DTM A;  2E88 A;  3KWI A;  4CJV A;  3WT0 A;  1NJW A;  5HRP A;  1Q8I A;  1KVB A;  4LF6 K;  3D2F A;  3ZYY X;  1DTT A;  4JKF A;  1JL2 A;  3PX6 A;  3RMB A;  5ADX H;  1U48 A;  3HXM A;  3M8S A;  2VG5 A;  3VEY A;  2BH1 A;  4E7H A;  2GTD A;  3FGU A;  4BRD A;  2W40 A;  3V81 A;  2KLA A;  3AAQ A;  4IFV A;  4B8C A;  1NBW A;  1EWQ A;  3A8Y A;  2P9N A;  4A2B A;  1W97 L;  3OYH A;  4KB1 A;  5M1K A;  3LPU A;  1TV6 A;  1WBD A;  3FZL A;  4JI5 K;  2PY5 A;  3SBG A;  3HJF A;  4JI1 K;  4HHT A;  2NLX A;  2YJF A;  5AQZ A;  3K57 A;  4DFK A;  5JS1 A;  4R79 A;  5CYQ A;  2WBN A;  3EE9 A;  1NLV A;  4CJ7 A;  2VWJ A;  3C6A A;  4BC5 A;  3THW A;  1XMQ K;  3I8D A;  4YOV A;  1ZBS A;  3LAL A;  5GIN A;  3TAR A;  4CIF A;  1VSD A;  2F4V K;  3NHG A;  3LP1 A;  2A40 A;  3AGK A;  2KZZ A;  4CZJ A;  3M1F A;  1QSY A;  4O0I A;  3O4Q A;  3MN6 A;  5T7B A;  3I0R A;  3U4L A;  3VGM A;  4CEB A;  3NGY A;  4FJM A;  3LDL A;  5AQK A;  3U3G A;  3VF6 A;  3TR8 A;  4B9M A;  2Q97 A;  3OTO K;  3J81 O;  4LFA K;  3CXC M;  2QWM A;  5AZI B;  1NJY A;  4CEF A;  1TYQ A;  2ZGZ A;  5C42 A;  3R9P A;  1WAF A;  3FFK B;  3SUO A;  3HL8 A;  1QSL A;  1UA1 A;  3N4P A;  4KTQ A;  4C8N A;  4JI0 K;  5AQW A;  4JI4 K;  1HKG A;  3ZSV A;  3EL2 A;  1SS6 A;  1XNQ K;  4WCE L;  3SQ2 A;  1NNE A;  1YXQ A;  2F9W A;  3A0I X;  1C0T A;  5AZJ A;  1YF5 L;  1CZA N;  3LAM A;  2ZWH A;  2LSN A;  3E1Y A;  4QS8 A;  4FLW A;  2XO7 A;  1X3M A;  3L0Q A;  5BPN A;  5E84 A;  3ZSR A;  1NKB A;  1WBB A;  1N36 K;  4CHN A;  2CGJ A;  2HBJ A;  4IZ9 A;  4LH4 A;  1WLJ A;  3O3G A;  4FW2 A;  5J2P A;  3MX5 A;  3SUP A;  2D0B A;  2P9S A;  1R59 O;  2ITG A;  4JKE A;  2VWK A;  4OPH A;  5BN9 A;  2FBV A;  3VMF B;  3KHY A;  2BE2 A;  4DUY K;  4B3R K;  1EKE A;  1C1A A;  4HUE A;  5C24 A;  3LL3 A;  4PL8 A;  1BQM A;  4BRO A;  4GMJ B;  4HUF A;  4OKJ A;  1L3U A;  3CM6 A;  3TWH A;  4FWR A;  3SPZ A;  2YHA A;  4RCH A;  1U2V A;  2OA8 A;  1HPM A;  3CCV N;  3THX B;  4BRG A;  4IFY A;  2OPR A;  4NXN K;  3ZT4 A;  3AY9 A;  2E1Z A;  2BGG A;  3BEX A;  3TSQ A;  5DMR A;  3H3O B;  4RW9 A;  3EKU A;  3K5L A;  4CJK A;  1SL1 A;  3DLH A;  4GNI A;  4LSL A;  3CJB A;  4JKH A;  3WUH A;  5I9E B;  2O8D B;  3QEX A;  4CW7 B;  4IJN A;  1KC8 O;  4AHU A;  1ZBI A;  3MEG A;  4FWO A;  3TTF A;  3D45 A;  3PIO L;  4CZL A;  1FW6 A;  4CIE A;  3CME N;  3TAM A;  4NCB A;  2FF6 A;  4DU1 A;  4A5A A;  3CG7 A;  3HT3 A;  3CHW A;  1D9D A;  5EX5 A;  4I6M A;  3VEO A;  3L2Q A;  3RMC A;  1ITG A;  4ELT A;  5EOY A;  2OPP A;  4ELV A;  4DFM A;  4H4O A;  4CJF A;  1G99 A;  1NWK A;  2I7N A;  3G0Z A;  3LWM A;  3ZT1 A;  1IBL K;  5HRR A;  3CJ9 A;  1BCO A;  2E6L A;  1VQ7 N;  4DV1 K;  1D8Y A;  2OAN A;  2VQE K;  2QKB A;  5HBM A;  5JVG L;  4DSL A;  4Z4C A;  3DLG A;  1E4G T;  2OZS A;  3I8B A;  3TTD A;  4H0Y B;  2YHW A;  3C6H A;  1XQS C;  1N6Q A; 
#chains in the Genus database with same CATH homology
 1J5O A;  2D5R A;  4DTR A;  4DSI A;  3RMD A;  1LW0 A;  3L2U A;  4DFP A;  4N47 A;  3WNH A;  4EP5 A;  4BWM A;  2GV9 A;  1G15 A;  3AVN A;  4CJT A;  3L3U A;  5KI6 A;  4JRQ A;  3TI0 A;  3JYT A;  4BDY A;  4DSF A;  4E7I A;  3IRX A;  3S3O A;  4B08 A;  2RN2 A;  3DOL A;  1RNH A;  4G1Q A;  2I5J A;  4FJ5 A;  3DRS A;  4CJ4 A;  2XY7 A;  3LAK A;  3HK2 A;  1JLF A;  4DFJ A;  1TVR A;  1U47 A;  4DQR A;  1C1B A;  2DFF A;  5CZ1 A;  3E01 A;  4CF1 A;  1I39 A;  1U04 A;  4M45 A;  4OLB A;  2Z1I A;  2P1J A;  3EZ5 A;  2X78 A;  4FLV A;  1FK9 A;  2NUB A;  4CIG A;  4N56 A;  1NOY A;  2O4I A;  3RTV A;  2KFN A;  1S1U A;  3P1G A;  2G8V A;  1GOA A;  4NCG A;  4C8O A;  2YNG A;  3V9W A;  1K6Y A;  1RT3 A;  3BGR A;  4GVM A;  3OS1 A;  4HVJ A;  3VA0 A;  1BI4 B;  3K5M A;  1NK9 A;  4DSE A;  2D0A A;  5HRN A;  4Q5V A;  4N5S A;  4O0J A;  3NH2 A;  3LZJ A;  4JS4 A;  1U45 A;  1EET A;  3ISN C;  1SKW A;  3NF8 A;  4KPY A;  1S1X A;  3NF7 A;  4LY7 A;  2BAN A;  1KSP A;  1L3V A;  3LPT A;  4FJX A;  4I7F A;  4E1N A;  3OS0 A;  2G8I A;  3OYG A;  4J2D A;  2HHT A;  4Z4I A;  4GW6 A;  3AVC A;  4FZY A;  3L2W A;  3IG1 A;  1TGO A;  4DU3 A;  3QEP A;  1T05 A;  1LV5 A;  4DSK A;  2BDP A;  5CZ2 A;  4KRE A;  4E19 A;  1TKT A;  4KI4 A;  4B3O A;  1UWB A;  1JXE A;  3CFO A;  3DYA A;  4K8Z A;  3NH1 A;  1IH7 A;  4HCC A;  2Z1G A;  4ICL A;  1CLQ A;  4DQI A;  1S1T A;  3DLK A;  2YNF A;  5J1E A;  4B9U A;  4AH9 A;  1IG9 A;  3V6D A;  2FBX A;  3IAY A;  4M3R A;  2DFH A;  4E0D A;  4E1M A;  2IS3 A;  4M3U A;  4W5N A;  4FLZ A;  3PY8 A;  3OJS A;  4FXD A;  3DLE A;  1L3T A;  5CY4 A;  1GOC A;  4W5R A;  1U49 A;  1X9W A;  1JLG A;  2RF2 A;  1QS4 A;  4CJQ A;  4BE0 A;  1S1W A;  2OZM A;  1TAU A;  1WSH A;  4DQS A;  2IC3 A;  4RG8 A;  1TL1 A;  1VSF A;  2VG6 A;  2Y1I A;  5FRM A;  4QAG A;  1B92 A;  1QQC A;  4DTS A;  2Z1J A;  3RR8 A;  4FM1 A;  3I0S A;  1RT7 A;  3ASM A;  1ASU A;  2E6M A;  1NK7 A;  3ULD A;  1U4B A;  3AVB A;  1RTH A;  4DSJ A;  3U3Y A;  2GBZ A;  3HPO A;  2XRI A;  3T3F A;  1X9S A;  1XWL A;  4KTZ A;  1WSI A;  4FK4 A;  1C6V A;  3TAF A;  4FM2 A;  1JLB A;  3TAB A;  1RDA A;  3C6U A;  1SL2 A;  1BQN A;  4FLY A;  1LWE A;  3V9S A;  3ZT2 A;  5I3U A;  2G8H A;  3KTQ A;  1BCM A;  4IG0 A;  2P5O A;  5FDL A;  4PQU A;  2YNH A;  3SCX A;  4Z4E A;  4DQP A;  1HNI A;  4FLT A;  4EZ6 A;  4BE1 A;  3RRH A;  2VG7 A;  4OKE A;  4DTP A;  5J2Q A;  3RWU A;  3AVG A;  4M3Z A;  3LP0 A;  2HHQ A;  3VQA A;  3WNG A;  4N76 A;  2WOM A;  4QOZ B;  3PUF A;  4C8M A;  3VQ7 A;  3B6O A;  4ID5 A;  3FFI A;  1T03 A;  1RIL A;  3DRP A;  5DK5 A;  1C1C A;  4UQG A;  3L2R A;  1BI4 A;  1J54 A;  4O4G A;  3CFR A;  2OYQ A;  4KAZ A;  4M3X A;  4C8K A;  5EU7 A;  1UA0 A;  1JLA A;  3PX4 A;  1RTD A;  3OYL A;  4FZX C;  1ZBH A;  4FVM A;  4CE9 A;  4DMN A;  1QHT A;  3KLH A;  1WSE A;  3KK2 A;  1JLQ A;  4ZHR A;  2B4J A;  3TAG A;  1ASW A;  4F4K A;  4W5Q A;  2KFZ A;  1N5Y A;  3PX0 A;  2KW4 A;  4OKK A;  1VSM A;  3K5O A;  1B9F A;  2FBT A;  4IDK A;  4KHN A;  5HP1 A;  1ZYQ A;  3KK1 A;  2G8F A;  4CJL A;  3OYA A;  4FJ7 A;  3AO5 A;  1TL3 A;  1NOZ A;  3ITH A;  3V9Z A;  1S9E A;  4NCA A;  3DLB A;  3S3N A;  4CJR A;  4W5O A;  2PZS A;  1RTJ A;  2XY8 A;  2HND A;  3ZSO A;  3NF9 A;  3AO2 A;  3QIN A;  4I2Q A;  3QEW A;  3V9X A;  3VQ6 A;  1ZBF A;  3AVF A;  3ZSZ A;  3SYZ A;  4CCH A;  4CEQ A;  1RBU A;  4KV8 A;  1NK6 A;  4PY5 A;  3TAN A;  4Q0B A;  1RBS A;  1S1V A;  1VSI A;  3QLH A;  1UOC A;  1W9H A;  1LW2 A;  3A2F A;  3QEV A;  4TSX A;  2G8U A;  4KTW A;  3TAQ A;  4CJ3 A;  3HP6 A;  3O4N A;  5HLF A;  3EY1 A;  2XY6 A;  1TKZ A;  2OPQ A;  3QES A;  4OVL A;  1RCH A;  2A1R A;  1HRH A;  3AA2 A;  1D5A A;  5KRT A;  4Z4F A;  2Z1H A;  4PUO A;  2IDO A;  3UIQ A;  4HCB A;  2OPS A;  3AVM A;  4CGH A;  4KRF A;  1JL1 A;  2QXF A;  1RTI A;  1S6P A;  3K5N A;  4FJ8 A;  4KI6 A;  4DTO A;  1WSG A;  1RT4 A;  4M41 A;  2X74 A;  4RW8 A;  4FJG A;  4J2A A;  1ZBL A;  1EX4 A;  3V4I A;  3U6F A;  4LH5 A;  5HRS A;  3DLR A;  4M3W A;  3QET A;  2XHB A;  1Q9Y A;  4KHW A;  1CZ9 A;  4AHC A;  1VK0 A;  3OVN A;  4BWJ A;  3DI6 A;  2AJQ A;  4DU4 A;  5SWM A;  3LDS A;  2HW3 A;  4DTX A;  2X6S A;  4DG1 A;  1S9G A;  1WNS A;  5D3G A;  3NBP A;  1XC9 A;  1VRU A;  4Z4G A;  1TKD A;  3MED A;  4PA1 A;  3LP2 A;  1REV A;  4KHU A;  3ZT3 A;  4CJU A;  3RMA A;  4ID1 A;  3KLG A;  3NH0 A;  4OGC A;  1YTU A;  4FZZ A;  4DWI A;  3VQ9 A;  3AO4 A;  3OYE A;  3HM9 A;  1NK0 A;  3B6P A;  3C6T A;  3ZSQ A;  4E89 A;  1FKO A;  2Y1J A;  4N41 A;  1I3A A;  3MEC A;  4DS5 A;  2IOC A;  2A1S A;  3SPY A;  4DTM A;  2HHX A;  4CJV A;  3C95 A;  3KLE A;  1NJW A;  3C94 A;  1L3S A;  5HRP A;  1Q8I A;  4WE1 A;  4BDZ A;  1BIS A;  1KVB A;  2KZM A;  1LWC A;  5KTQ A;  1SL0 A;  4BDP A;  1WSJ A;  3AV9 A;  4CJW A;  2E4L A;  4ZTF A;  1CXU A;  3QEI A;  3VQ4 A;  3VQ5 A;  4CEZ A;  3M8R A;  1NKC A;  3AA3 A;  1IKV A;  1YT3 A;  1DTT A;  1JL2 A;  4DTU A;  3PX6 A;  3RMB A;  1U48 A;  4CGI A;  3HXM A;  3M8S A;  2VG5 A;  4FCY A;  1RT2 A;  1QSS A;  1BIU A;  3ZCM A;  3LWL A;  4E7H A;  3HO1 A;  1XHZ A;  3RRG A;  1X1P A;  3AVJ A;  3VQ8 A;  1KRP A;  4CF9 A;  1SKR A;  3V81 A;  3SNN A;  1KFS A;  1HYZ A;  4CFD A;  1RDC A;  4I9L A;  3QER A;  3LP3 A;  1LWF A;  3QIP A;  4KO0 A;  3V9U A;  4Z0U A;  1A5X A;  3V1Q A;  4CGJ A;  3KJV A;  1F21 A;  4IFV A;  4B8C A;  3MAQ A;  3EYZ A;  4FLX A;  4DS4 A;  4E7L A;  4CED A;  4OPJ A;  3O3F A;  1WAJ A;  4O55 A;  3P5J A;  3OYH A;  3OYB A;  4DF4 A;  3TAE A;  3VA3 A;  4KB1 A;  3LPU A;  1TV6 A;  3JSM A;  3HJF A;  1S6Q A;  2PY5 A;  1FXX A;  1FKP A;  3MXM A;  1JXB A;  1ZBU A;  1HJR A;  1VSJ A;  4O5B A;  1NJZ A;  4HHT A;  2EX3 A;  2ZE2 A;  1J9A A;  4CGF A;  2P5G A;  1B9D A;  3K57 A;  3SI6 A;  3PV8 A;  4AHR A;  3AA4 A;  3IS9 A;  4DFK A;  4CF2 A;  4LD0 A;  3ZSX A;  1VSH A;  4FLU A;  5CYQ A;  1TK5 A;  1TK8 A;  5JS1 A;  3MXJ A;  3ZSY A;  4B8A B;  3HVT A;  4F2S A;  3K58 A;  1L5U A;  1Q9X A;  2KTQ A;  3SQ1 A;  3HST B;  3NF6 A;  4HUG A;  3QO9 A;  2VWJ A;  4FJK A;  4FW1 A;  1W0H A;  3OYJ A;  1TK0 A;  3I8D A;  1YVU A;  3KKR A;  3VQP A;  1Y97 A;  3LZI A;  1MU2 A;  3LAL A;  3D0P A;  2IGI A;  3TAR A;  4J2E A;  4CIF A;  4B9T A;  1IKW A;  1VSD A;  3LAN A;  3NFA A;  3NHG A;  3LP1 A;  2KZZ A;  2F8S A;  3K59 A;  3MXI A;  1VSL A;  4OPK A;  1HYV A;  2FC0 A;  3OY9 A;  3L8B A;  4HTU A;  1QSY A;  4KHS A;  4O0I A;  3V1R A;  4FJ9 A;  1XHX A;  3O4Q A;  5E41 A;  5HRO A;  4FJN A;  1VRT A;  4M3Y A;  5T7B A;  3I0R A;  4E3S A;  4CHP A;  4M42 A;  4CGD A;  4CEB A;  3NGY A;  4FJM A;  2HNY A;  2YKN A;  4Y1D A;  1KFD A;  3TAP A;  4CJ5 A;  2HNZ A;  4CJP A;  1Z25 A;  4F3T A;  2IAJ A;  3U3G A;  2DTU A;  1NK4 A;  3TR8 A;  4CGG A;  3BDP A;  4B9M A;  1O1W A;  3M8Q A;  1WN7 A;  3DRR A;  3HPG A;  2YKM A;  4OJR A;  5K14 A;  4Z4H A;  1JLC A;  3PO5 A;  3OYF A;  1NJY A;  4CEF A;  3M8P A;  4I2P A;  2F8T A;  1NK8 A;  3ZSW A;  1QE1 A;  3MEE A;  5C42 A;  1WAF A;  4FM0 A;  4AIL C;  4F2R A;  3SUO A;  3HL8 A;  3NGZ A;  1QSL A;  2B5J A;  3RR7 A;  1BL3 A;  4EZ9 A;  1VSE A;  1UA1 A;  4KTQ A;  2HB5 A;  3AVH A;  4C8N A;  4JS5 A;  3OS2 A;  4DTN A;  1JLE A;  2FBY A;  4CJS A;  3OYI A;  3NAE A;  2W42 A;  5J2N A;  3G10 A;  3ZSV A;  4FJI A;  4CEC A;  3NE6 A;  3SUQ A;  3SJJ A;  4CEA A;  5FRO A;  2HHV A;  3SQ2 A;  4FJH A;  1HQE A;  4YNQ A;  3OJU A;  4DLG A;  1C0T A;  2KQ2 A;  4CFB A;  3NCI A;  3NGI A;  3LAM A;  2LSN A;  3HYF A;  4CHY A;  4FLW A;  4J2B A;  2ETJ A;  4MFB A;  2XO7 A;  3VQB A;  3SV4 A;  4CFA A;  4FJL A;  3F9K A;  1CXQ A;  1J53 A;  4CJE A;  3AVK A;  4ZTJ A;  1SKS A;  1BIZ A;  1C0U A;  2HVI A;  3VQD A;  3ZSR A;  1QTM A;  1D9F A;  3VQC A;  2HHS A;  1IKY A;  3QNO A;  2DFE A;  3QNN A;  3L3V A;  5C25 A;  4OLA A;  2YHB A;  4ELU A;  4DQQ A;  1HQU A;  1NKB A;  2HMI A;  2HHU A;  4CHN A;  3KLF A;  3OYC A;  1RBT A;  1WLJ A;  4LH4 A;  4FW2 A;  4IG3 A;  3O3G A;  4BE2 A;  5J2P A;  1XI1 A;  3SUP A;  4DLE A;  1WSF A;  2D0B A;  5CYM A;  4AHT A;  1ASV A;  1A5V A;  2PYL A;  4B9S A;  1LAV A;  3PO4 A;  2ITG A;  2VWK A;  2X6N A;  2FBV A;  1EXQ A;  2RKI A;  2O4G A;  4IBN A;  4JRP A;  2QKK A;  2BE2 A;  5FRN A;  4CES A;  1C1A A;  1EKE A;  1BHL A;  1VSK A;  3CM5 A;  5C24 A;  1BGX T;  4YFU A;  4NYN A;  4HUE A;  3SQ4 A;  3SQ0 A;  3S3M A;  4F8R A;  4CFC A;  1BQM A;  1KVC A;  3H08 A;  4L8R B;  4QCL A;  4FK2 A;  3DMJ A;  3QIO A;  3KK3 A;  4GMJ B;  4HUF A;  2WON A;  4OKJ A;  1L3U A;  3CM6 A;  3TWH A;  3SZ2 A;  1DTQ A;  1Z26 A;  3V1O A;  3S9H A;  2YHA A;  3SPZ A;  4FJJ A;  2PYJ A;  3AVI A;  3AVA A;  4RW7 A;  2OA8 A;  3AO3 A;  4F3O A;  3KLI A;  4KHY A;  3HP9 A;  4IFY A;  4RW6 A;  2GUI A;  2OPR A;  1SUQ A;  3ALY A;  1RDD A;  3ZT4 A;  4CER A;  4CHZ A;  2G8K A;  4PWD A;  4DF8 A;  2BGG A;  4M3T A;  1EP4 A;  1HNV A;  3DOK A;  5DMR A;  2ZD1 A;  1KVA A;  1KTQ A;  1YTA A;  3ZT0 A;  4AHS A;  3AVL A;  4RW4 A;  4RW9 A;  4CEE A;  4CK2 A;  1UAX A;  3AO1 A;  3L2V A;  4CJK A;  3AA5 X;  3K5L A;  1SL1 A;  2JLE A;  3DLH A;  4I9Q A;  4EP4 A;  4LSL A;  2B6A A;  3K2P A;  4KFB A;  4OGE A;  4XIU A;  3QEX A;  2R7Y A;  4B9V A;  3HVR A;  4FYD A;  4AHU A;  3SV3 A;  3MEG A;  4JLH A;  1NJX A;  1ZBI A;  3T1A A;  4AHV A;  1R0A A;  2F96 A;  3D45 A;  2YV0 X;  3P83 D;  3OYM A;  3CQ8 A;  2Q3S A;  4W5T A;  4C8L A;  2RPI A;  1RBV A;  4CIE A;  1JKH A;  2D0C A;  3TAM A;  5SZT A;  2DY4 A;  5KGX A;  3CYM A;  4NCB A;  4KHQ A;  4K8X A;  4B9N A;  4DU1 A;  3DM2 A;  3CG7 A;  4KKO A;  4CF0 A;  4CK1 A;  3HT3 A;  4CEO A;  4BAC A;  1D9D A;  2QK9 A;  3OYD A;  4CF8 A;  1CZB A;  3L2Q A;  2JGU A;  1ITG A;  3RMC A;  4MQ3 A;  4Y1C A;  5KRS A;  4ELT A;  2OPP A;  1KLM A;  4H8K A;  3VQQ A;  4ELV A;  1IKX A;  1TAQ A;  1RT5 A;  1DLO A;  3KIO A;  4H4O A;  3WNF A;  4CJF A;  4DFM A;  2P51 A;  1TKX A;  5I42 A;  1KLN A;  3CFP A;  3THV A;  3G0Z A;  3OYK A;  1LAW A;  3O3H A;  3WNE A;  3VN5 A;  4E7K A;  3LWM A;  3NDK A;  3ZT1 A;  4R5P A;  3KD5 E;  1T7P A;  4FK0 A;  5HRR A;  4CHQ A;  1IO2 A;  2G8W A;  3KD1 E;  1BCO A;  2E6L A;  5JS2 A;  2XY5 A;  1RT6 A;  1S5J A;  1D8Y A;  1RDB A;  1HPZ A;  1HYS A;  5KGW A;  2QKB A;  1KCF A;  5HBM A;  2HVH A;  3HPH A;  1A5W A;  1RT1 A;  3KKS A;  2ZQB A;  4DSL A;  1GOB A;  3OYN A;  4NYF A;  4Z4C A;  3DLG A;  3VQE A;  3SUN A;  2OZS A;  4B9L A;  1HMV A;  2ATQ A;  1RBR A;  2EHG A;  1C0M A;  1SV5 A;  4CK3 A;  5J2M A;  4CHO A;  1X9M A;  4DTJ A;  3F73 A;  1NKE A;  4KB0 A;  4O44 A;  3T19 A;  2YNI A;  4LSN A;  2HHW A;  4H4M A;  1T8E A;  4E7J A;  1N6Q A;  4IKF A;  1NK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...