3ALYA

Crystal structure of rnase hi from sulfolobus tokodaii with c-terminal deletion
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
MIIGYFDGLCEPKNPGGIATFGFVIYLDNRKIEGYGLAEKPFSINSTNNVAEYSGLICLMETMLRLGISSPIIKGDSQLVIKQMNGEYKVKAKRIIPLYEKAIELKKKLNATLIWVPREENKEADRLSRVAYELVRRGKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST0753
publication title Stabilization by fusion to the C-terminus of hyperthermophile Sulfolobus tokodaii RNase HI: a possibility of protein stabilization tag
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13456 RVT_3 Reverse transcriptase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3alyA00
2XY5A 1J5OA 4JRPA 1HNVA 4CHPA 2YHAA 3G10A 1EETA 3OYCA 3SPZA 1HYZA 4EP5A 1L3VA 3KD5E 2HHUA 1RILA 4OKJA 5CYMA 4CE9A 2WONA 1BCMA 3NH2A 3RMCA 4DQIA 3HM9A 3LP0A 1RDCA 3AVJA 3LWLA 2ZQBA 1IKYA 2OZSA 4AHUA 1B92A 4CJFA 4FM2A 5CZ1A 5DK5A 2X6SA 3CM5A 3RMBA 3E01A 3SCXA 4DLEA 3KLGA 3AVKA 3OYNA 4CEQA 1EP4A 1QTMA 4O55A 4E7IA 3I8DA 4FJ5A 1FKPA 4DTMA 1SKRA 4CIEA 3L2WA 3QEVA 4B9NA 1D9FA 4M3YA 3MEEA 3SQ1A 4DSJA 5HRSA 4CJRA 1JLGA 2Z1JA 3CYMA 3SNNA 4HCBA 1D5AA 3OYBA 4J2BA 3T19A 4AHCA 2F8SA 3AO5A 1WSIA 1HYSA 3D0PA 4DFMA 1W0HA 2HVIA 4E3SA 2YNFA 3AA5X 2E4LA 4DFJA 2YNIA 4OJRA 3QINA 3LZIA 2HB5A 4FLTA 1WN7A 3KKSA 1EXQA 1JL2A 4KB0A 3CFOA 2P5GA 3VQCA 3SV3A 2ATQA 3MXIA 4KHNA 2B5JA 3O4NA 3V1OA 4DFKA 4PQUA 2P5OA 3VQ9A 1TKZA 4FLXA 4CJUA 5J2MA 5D3GA 1JLEA 4CFAA 4N41A 1FXXA 2YNHA 1J54A 3DRSA 1F21A 2P1JA 3A2FA 3QEXA 1D9DA 4FJGA 4CF8A 1SKWA 3HO1A 1IKXA 4DU1A 5K14A 1BQNA 1UA1A 3ASMA 4CK2A 4KKOA 2GUIA 2IGIA 4OKEA 1S1UA 4RW7A 3V4IA 2JGUA 3QNOA 1TK5A 1GOCA 1VSMA 4PA1A 4CEBA 1C0UA 3RTVA 4DTXA 3PO5A 1VSDA 4KAZA 1TKXA 4KRFA 1RTJA 1L3TA 5T7BA 4FK2A 4H8KA 1HQEA 2D0AA 4Z4HA 2YHBA 3EYZA 1U45A 2PY5A 5JS2A 3AA3A 1XC9A 1BI4B 4F8RA 2O4GA 3MAQA 3AVAA 4LSLA 4CEAA 2HHVA 3ISNC 2VG6A 4CF0A 1YTAA 1IH7A 3L3UA 1QHTA 4KO0A 4Y1DA 2YKNA 2Z1GA 4JLHA 3NGIA 3OY9A 3KLHA 4EZ6A 2OPQA 3MXJA 3AVIA 1WSHA 4HUEA 1Q9YA 3C95A 3TABA 1ASVA 1LWCA 4C8MA 4AHTA 3OS1A 1BI4A 4KTZA 4DWIA 1IG9A 4CF9A 1NK8A 3KLIA 4CJTA 3AVLA 4N5SA 3ZT1A 2X6NA 4B9SA 1CZ9A 1RDBA 4B9MA 4I9LA 4CESA 1S9EA 3TAGA 1T03A 3KTQA 2IC3A 4Y1CA 4CGHA 4CJ5A 4O44A 3HVRA 1X9MA 4KHSA 1RNHA 3HK2A 4DU4A 1NK7A 5JS1A 3NHGA 4CJLA 1ITGA 2DTUA 1A5WA 4BWMA 4CHOA 2RPIA 1T05A 1DTTA 3DI6A 3V9UA 4CK3A 3O3FA 3NDKA 1KRPA 4QOZB 3OYMA 4G1QA 1NK0A 5FRMA 3LANA 3CM6A 4E89A 4NYFA 1TKDA 4NCBA 2Y1JA 4DG1A 3HPOA 4E7LA 4ELUA 2ZE2A 1QSYA 2OPPA 3RR8A 3O3GA 1S1VA 1TAQA 1JKHA 3QLHA 4DMNA 3V81A 3AVFA 2FC0A 3OS2A 1C6VA 5C42A 1NK4A 3S9HA 1YTUA 2VG5A 2HHXA 4DF8A 1RT5A 3LALA 4FJHA 3D45A 5KRSA 1UWBA 3C94A 2D5RA 4DFPA 1TVRA 2ETJA 3DYAA 4FJMA 3NF6A 1TAUA 2VWKA 3NF9A 3BGRA 3VQAA 4Q0BA 1YVUA 3ZSXA 3ALYA 1U47A 3MEGA 3VQ7A 1RTDA 1Z26A 2I5JA 2Z1IA 1RBSA 4CJVA 1NKEA 3KK3A 3QESA 4ELTA 3AA2A 4CECA 3MECA 3QO9A 2GV9A 4DTNA 1UAXA 3MEDA 3L2VA 4W5OA 1LAVA 2IAJA 4CHNA 5KTQA 3NGZA 3JYTA 3U6FA 4FJNA 3SV4A 1XWLA 5HP1A 2G8HA 3L2RA 1NOYA 1I39A 1U48A 3HJFA 3FFIA 2HVHA 1KSPA 2GBZA 3TAMA 4E1NA 3OYHA 2VG7A 4DTSA 1RBVA 2A1RA 2G8KA 3ZSYA 3IG1A 2PYJA 3WNHA 3WNEA 3HP6A 4M3WA 1W9HA 4JS5A 1WSGA 3RMAA 4OVLA 4DSKA 2HNYA 1NOZA 4CJPA 4DTJA 4ZTJA 3RR7A 2QXFA 1UOCA 5HRPA 3RRGA 4DSIA 4RW8A 4JRQA 1KTQA 4Z4CA 4QCLA 1JLBA 1VRUA 4B9VA 4CGIA 1FKOA 4OLBA 1XHXA 3B6PA 1JLFA 5HRRA 5I3UA 1QS4A 1JLAA 3ZT4A 1ZBHA 1BIUA 4KTQA 3OYKA 3V9ZA 4W5NA 2B6AA 1C0MA 2HNDA 3K59A 3LZJA 2F8TA 4KREA 4KHYA 3DLKA 3AVGA 3OYJA 3NAEA 5FRNA 1EX4A 5KRTA 1ZBIA 4CJ4A 3VQ8A 1X9WA 2XY8A 3VQ5A 2KTQA 1K6YA 4KFBA 3G0ZA 3ZSRA 2W42A 3VA3A 2PYLA 3IS9A 1CLQA 3QIOA 4CIGA 3SUOA 1X1PA 1LW2A 3DOKA 4GW6A 4NYNA 2XO7A 4DS5A 1KFSA 3AVMA 3HYFA 3V9SA 4NCAA 3DLGA 3LPUA 4CF2A 2FBVA 3RWUA 3AO4A 1IKWA 1VSHA 2DFFA 3AV9A 5HRNA 2R7YA 1C1BA 4CFCA 4HVJA 4C8KA 3U3YA 4LY7A 1SV5A 5J2NA 3S3OA 1SUQA 5CZ2A 4RG8A 3T1AA 3OJUA 3V9WA 3T3FA 2G8FA 2Q3SA 5CY4A 1EKEA 4AHSA 4CJ3A 4OPJA 2Y1IA 4ICLA 3WNGA 3NGYA 4CEOA 3NF7A 3SYZA 4QAGA 2OYQA 2HW3A 3ZT3A 1RT3A 4I7FA 4O0IA 3QETA 3S3NA 1S9GA 1VSJA 3AO3A 4BACA 3VQ4A 4CEFA 4N56A 2QKKA 4F2RA 4PY5A 3TR8A 4FLZA 2HMIA 4O0JA 1LWEA 3CG7A 4Z0UA 4F3OA 2OPRA 3K2PA 3BDPA 1KVAA 1U04A 4B9LA 3LWMA 4CERA 3VQPA 4JS4A 1A5XA 4F4KA 1ASWA 2XY7A 3RMDA 4C8NA 3OYDA 4HUGA 1LAWA 3DLEA 4KHQA 1IO2A 2D0CA 1RT6A 3OYFA 5J1EA 3OYIA 3SQ2A 5HROA 3UIQA 3DOLA 2O4IA 4F2SA 5KGXA 3TARA 1RTHA 3DM2A 3K57A 1N6QA 1GOBA 2HHQA 1RT1A 3CQ8A 3NCIA 3ZT0A 3SQ0A 4FJKA 4HHTA 1REVA 4M3ZA 4FM0A 1Q8IA 3TAFA 3OS0A 2KFNA 2ZD1A 3AO2A 3DLRA 4AH9A 3DLBA 1LW0A 1FK9A 4OGEA 4RW4A 4CF1A 4J2AA 1L5UA 3KK2A 1BISA 4E7HA 4DTUA 2DFHA 2WOMA 1O1WA 3PUFA 4Z4IA 3I0RA 4O4GA 4K8XA 1RBUA 3I0SA 4Z4FA 4DTOA 4K8ZA 4KB1A 3L8BA 1WNSA 1RTIA 3LP2A 4CEDA 1B9DA 3K5LA 4ZHRA 3O3HA 3SUPA 1RT2A 4FZXC 5EU7A 2HHTA 1SKSA 1ZBLA 4LH4A 4IKFA 4CGFA 4AHVA 3EY1A 1WSJA 3NH1A 1DLOA 2VWJA 4BE0A 4E7JA 1RCHA 3QEWA 4Z4EA 2DY4A 4M3RA 4C8LA 2XY6A 3AO1A 1R0AA 4BE1A 3PX0A 5CYQA 4DSLA 3C6UA 3NH0A 3S3MA 2EHGA 4IG0A 1HPZA 2HHWA 1KLMA 3O4QA 3HT3A 3HL8A 1KCFA 2HHSA 1WLJA 4LD0A 3PO4A 4ID5A 2KQ2A 1QSSA 4KPYA 1ZBUA 4OGCA 3QEPA 1I3AA 3SI6A 1VSLA 3P5JA 3VQ6A 1RT4A 4E19A 5J2PA 1HRHA 3ZT2A 3SQ4A 3M8RA 4N76A 3L3VA 1C0TA 4R5PA 3EZ5A 3TAQA 2YNGA 4OPKA 3F73A 4CFDA 1A5VA 4IFYA 2D0BA 1RDDA 3OYLA 4E0DA 3QNNA 5DMRA 4M3TA 3VQEA 3K5OA 3NF8A 1C1AA 4IFVA 4M41A 4DQPA 4M3UA 4O5BA 4DS4A 4B9TA 1GOAA 1S1TA 4FJLA 1KVCA 4L8RB 4FJ8A 4FJ9A 4KHUA 4I9QA 2KZZA 3SPYA 4I2QA 1VSIA 2A1SA 4BE2A 3K58A 4HCCA 5C24A 4WE1A 3KD1E 1JLCA 3VQBA 1JXBA 4CGJA 3WNFA 3M8PA 2BANA 4FCYA 2X74A 2YKMA 1B9FA 3KJVA 1KLNA 4BWJA 4HUFA 1S1XA 3LAMA 4B9UA 2AJQA 4FLYA 1WAJA 3M8QA 4KTWA 4B3OA 3QEIA 1UA0A 2PZSA 2G8IA 5FDLA 1HJRA 4KV8A 4DU3A 5I42A 3KLEA 3TAPA 1L3UA 4CHZA 1VRTA 4DSFA 5C25A 1NJYA 3LPTA 3PX6A 4M42A 3H08A 2OPSA 4FJ7A 3B6OA 1NJWA 2BGGA 5FROA 4CCHA 2ITGA 3SJJA 1S6QA 4PWDA 1Z25A 3RRHA 4W5TA 4FXDA 1TV6A 4DQSA 1SL0A 2G8WA 1RDAA 1HYVA 3CFPA 3L2QA 3V9XA 3MXMA 4FLVA 1QSLA 2BDPA 3IAYA 4TSXA 2KFZA 2B4JA 1QE1A 1G15A 1BHLA 4EZ9A 2P51A 3KKRA 4CJQA 1LWFA 2FBXA 3PV8A 1X9SA 2JLEA 2FBYA 4DLGA 4CGDA 4ID1A 1TK0A 1JL1A 2XRIA 4BDPA 3ZSOA 4M45A 3TANA 1S1WA 4Q5VA 3HPHA 3TI0A 4FK0A 1NK5A 4B8CA 3KLFA 2X78A 4UQGA 2NUBA 2RKIA 5HLFA 1BIZA 3SZ2A 3AVHA 1TL1A 5J2QA 1D8YA 4DTPA 4XIUA 4HTUA 1TK8A 1J53A 2Z1HA 1ZYQA 1SL2A 1MU2A 2YV0X 4IBNA 3DRRA 5HBMA 3K5MA 3LAKA 5SZTA 1BCOA 1VSKA 3HSTB 3QIPA 3QERA 4E7KA 3OVNA 3NE6A 1C1CA 5SWMA 4W5RA 3HXMA 1KFDA 2IS3A 4FLUA 3V6DA 1XHZA 1JLQA 1NKCA 3ZCMA 4CIFA 3NFAA 5KGWA 4KI4A 3HVTA 3V1QA 3NBPA 1VK0A 3U3GA 1HQUA 1Y97A 3VQDA 3TAEA 3PX4A 5E41A 4YFUA 1YT3A 4B08A 4GVMA 4OLAA 4J2DA 3AVCA 1ASUA 3TWHA 2FBTA 3AVNA 4KHWA 3VQQA 4E1MA 3AVBA 4I2PA 3ZSZA 4DTRA 3ITHA 4DSEA 4EP4A 3ZSQA 4FJXA 4FK4A 4MQ3A 1WSFA 2BE2A 2EX3A 3SUQA 1J9AA 1KVBA 4MFBA 1XI1A 3V1RA 4AILC 4CFBA 1CXUA 1RBRA 1NKBA 3PY8A 4CJSA 1NJXA 3LDSA 4FJJA 4FW1A 3C6TA 4RW9A 1NK6A 4FW2A 4FM1A 1VSFA 3VN5A 4J2EA 2LSNA 4CHYA 2KW4A 3P1GA 4CEEA 1RT7A 3OYAA 3ULDA 1IKVA 1NJZA 1TL3A 2DFEA 4ELVA 4FYDA 4LH5A 3JSMA 1S5JA 4H4MA 4FZZA 1JXEA 1T8EA 1CZBA 2IDOA 4YNQA 2IOCA 2QK9A 2OA8A 3OYEA 1VSEA 4PUOA 4CJWA 4IDKA 3AA4A 4H4OA 3ZSWA 2E6LA 4CJEA 4DQRA 4CGGA 1QQCA 2E6MA 1BGXT 3LP1A 1N5YA 4CHQA 1BL3A 4NCGA 3SUNA 1DTQA 2QKBA 2RN2A 2RF2A 3KIOA 4FZYA 4AHRA 3K5NA 3CFRA 2XHBA 1NK9A 4C8OA 1HNIA 1WSEA 3HP9A 1L3SA 1S6PA 4N47A 4W5QA 4BDZA 2G8UA 3F9KA 1LV5A 3ZSVA 2OZMA 3DRPA 4CK1A 3DLHA 4F3TA 1Q9XA 3KK1A 4IG3A 4GMJB 3OYGA 3L2UA 1HMVA 3HPGA 3IRXA 4KI6A 4B8AB 1T7PA 2F96A 4RW6A 1RBTA 3OJSA 1TKTA 4FLWA 3P83D 4FVMA 1WAFA 1ZBFA 2KZMA 1TGOA 4Z4GA 3DMJA 1BQMA 4LSNA 1CXQA 1SL1A 2G8VA 4BDYA 4ZTFA 1U49A 3THVA 1U4BA 4CJKA 3VA0A 4M3XA 5KI6A 4DF4A 4FJIA 4DQQA 3LP3A 4OKKA 2HNZA 4CEZA 3M8SA
chains in the Genus database with same CATH superfamily
2XY5A 2OANA 2YHAA 1NU0A 2QWRA 1WUAA 1RILA 4OKJA 3DXMB 4CE9A 4LF9K 4L3QA 4IFEA 3QMLA 4XH4A 5HL7L 2E2PA 2A6AA 3LWLA 1IKYA 2OZSA 3SNNA 1OH8A 3SCXA 2O8FB 4DLEA 4AQYK 1EWRA 3CJ9A 4PL7A 4O55A 3EEQA 3L2WA 4BRNA 3K9JA 2F9TA 3GG4A 4J2BA 4BC3A 4BG9A 4BVPA 2O8FA 4RCHA 3CPWM 2W40A 2YNIA 4DV0K 4JI2K 2NNWA 3C6HA 3WEEB 1EXQA 3VQCA 1JJ2M 4U7BA 3O4NA 4CJUA 4N41A 2YNHA 1J54A 4B3SK 2FXUA 3DRSA 3A2FA 5K14A 1UA1A 2UUBK 4CK2A 1S22A 2GUIA 3CCJN 1S1UA 3V4IA 3D6RA 3WEEA 4YOVA 3G71N 3I55N 4PA1A 5ADXH 4ILJA 3RTVA 1TKXA 2RE2A 3JXUA 3TTFA 2YHBA 4JKHA 2ASMA 4LSLA 5AQKA 5M1OA 1NGGA 3TU5A 4QS7A 1YTAA 1IH7A 4Y1DA 5C12A 4B1VA 4PKGA 4EZ6A 3MXJA 3R6MA 3SBTA 3ATVA 3C95A 2P9KA 5AQUA 1ASVA 1J5EK 3OS1A 3SAGA 1ZBSA 2FF3B 4CJTA 1K73O 4WFAL 1CZ9A 3VEVA 1WOQA 1IBKK 3KTQA 4MO4A 3VPZA 4CGHA 3HVRA 4OO1J 4A2BA 3CHWA 3G4SN 5JS1A 2E2OA 2RPIA 1DTTA 5IT9O 4E89A 1SAZA 4DG1A 4E7LA 4ELUA 3CCQN 3CJAA 1RFQA 4JK8A 3AVFA 2HF4A 2A41A 3OS2A 1C6VA 2NRXA 5C42A 1YTUA 2BUPA 4FO0A 1EQYA 2ETJA 5AQPA 4A57A 3P39A 1TAUA 3BGRA 3VQAA 4LF4K 4PL8A 1QQNA 4BRDA 3MEGA 5H1SQ 3VQ7A 2VQEK 4JKAA 3KK3A 3QESA 4ELTA 2UU9K 2GV9A 3UE5A 3MEDA 4B1ZA 5KTQA 1CZAN 3ENBA 2CH5A 3GL1A 2Q31A 4O8UA 1NOYA 1VQ9N 2V7ZA 5GIPA 2GBZA 3OYHA 1BU6O 3IG1A 2YX6A 3BY5A 5KQDA 4DSKA 2HNYA 1NOZA 4ZTJA 2QXFA 5HRPA 1YAGA 4JRQA 2YJFA 2P9LA 4CGIA 4OLBA 4JHDB 5I3UA 1QS4A 3I8BA 3OA9A 4KREA 3DLKA 5BR8K 5KRTA 3VQ8A 1KD1O 3VQ5A 4BR9A 4KFBA 4DV4K 3G0ZA 3ZSRA 4BRFA 2GWKA 1CLQA 4GW6A 1NLVA 4NCAA 4BRAA 1GLJO 4FWOA 2FBVA 4A5BA 5HRNA 3J7YP 2R7YA 3UB5A 2YHWA 3BEXA 2Q0UA 4WYBA 4HVJA 3U3YA 5J2NA 3S3OA 4DQ8A 5CZ2A 3T1AA 3OJUA 1LCUA 1HLUA 1GLLO 5JICA 3WNGA 3NF7A 4QAGA 3LDPA 3UKUB 3ZT3A 5BN8A 2HW3A 3AO3A 1VQ5N 4N56A 2E1YA 4FLZA 3H3OB 4Z0UA 3S41A 3AGRA 3LWMA 4NXNK 2V7YA 1SS6A 1HR0K 3JS6A 3P31A 1IO2A 2D0CA 3OYIA 4DR5K 3SQ2A 4K43A 3CJ1A 5KGXA 4GV6A 2Q2RA 4H0PA 4I6MB 2W6KA 5AQOA 3NCIA 3ZT0A 2P9IB 4HHTA 1IBMK 5AZIA 4AH9A 3DLBA 4RW4A 1HKCA 1U6ZA 1JCFA 4WQ5A 5AQMA 2CGKA 4DTUA 2GWJA 3PUFA 4Z4IA 4K8XA 3D7EO 3TSUA 1Q81O 4QS8A 3AAQA 5FLXO 2P9IA 4ZHRA 4FZXC 5EU7A 4LH4A 3QFPA 4M3RA 3AO1A 2QXLA 2O8DB 3K0SA 3KWIA 1G99A 3S3MA 1VQPN 3O4QA 1KCFA 2HHSA 1WLJA 3A5LC 2KQ2A 1ZXOA 4KPYA 5KPZA 3SI6A 2IVOA 3ID8A 3ZT2A 4N76A 2A3ZA 2UXCK 5AQFA 4A61A 2NRHA 2FSKA 2YCHA 4CFDA 4IFYA 2D0BA 4YORA 1RDDA 4DR1K 4E0DA 5DMRA 2KLAA 3WXIA 4DS4A 4FJ9A 3SPYA 3THWB 2A1SA 4BE2A 5C24A 1X9JA 2A40A 4YOWA 3VQBA 3WNFA 4MLHA 3CMAN 2YKMA 1B9FA 2W6LA 3KJVA 4DV3K 4BR0A 2AJQA 3E9PA 4CBWA 1N34K 3M8QA 4KTWA 1YITN 2HBLA 3WXLA 2G8IA 3CD6N 1P90A 3J81O 4CHZA 4RTFD 5C25A 1NJYA 5ELZA 3WQTA 2OPSA 1M1KO 5HOOA 4JD2A 1VQ4N 4FLVA 2E2NA 2CGJA 1W7AA 1QE1A 1G15A 1BHLA 4BRPA 5AFUA 2P51A 4CJQA 2FBXA 3PV8A 2JLEA 2FBYA 3E66A 2NRZA 2XRIA 5F0XA 4BDPA 2E1ZA 2FLOA 2GTDA 3ZSOA 3TANA 4GKJK 3TI0A 4FK0A 1HKBA 4B1WB 2X78A 4UQGA 1BIZA 5AZJB 3SZ2A 1TL1A 4WQ4C 4DTPA 3GOIA 5DM7L 4IBNA 5HBMA 5SZTA 3HSTB 4JI0K 3OVNA 1C1CA 3HXMA 4FLUA 1NKCA 4JI8K 3IDHA 5KGWA 3MN7A 3HVTA 4LC9B 4B3RK 1NG9A 5E41A 1YJWN 4B9QA 3T1HK 1ASUA 3AVBA 4I2PA 2WBNA 3AAPA 3VETA 1NKBA 3PY8A 1CXUA 1RBRA 3MN9A 3VF4A 4FJJA 3MX5A 1NK6A 3SMSA 3LL3A 4FW2A 1VSFA 5GADP 5BPMA 2LSNA 4CEEA 4PKIA 1IKVA 2DFEA 5GAHP 4H5VA 4YNQA 2OA8A 3DAWA 2ZM6K 4JKCA 2V52B 4IDKA 1NJIO 4CJEA 4CGGA 4ILGB 2E6MA 3LP1A 3O9SA 3SUNA 2QKBA 5MLCQ 3KVGA 1NK9A 4C8OA 1WSEA 3HP9A 1S6PA 4N47A 4BDZA 4EHTA 2G8UA 3DRPA 4F3TA 4IG3A 3L2UA 1HMVA 2ZWHA 1RDWX 1T7PA 5TKYA 2QA4N 1TKTA 2KZMA 3DXKB 4Z4GA 4LSNA 3J8AA 5AQXA 5EX5A 2G8VA 1U49A 5M1NA 3C6AA 1NGAA 5C2FA 3K9KA 4DQQA 3LP3A 4OKKA 2HNZA 3Q7BA 1J5OA 1HNVA 3F9MA 4KH6A 3TSQA 3G10A 1YF5L 3OYCA 3VF6A 3SPZA 4EP5A 1L3VA 5CYMA 4WFNL 4H0YB 1QVFM 3N4QA 1X3NA 3CETA 3O1BA 4NLBA 5BN9A 4YOYA 4CJFA 1B92A 3HTVA 5CZ1A 2P9NA 2X6SA 3CM5A 4GVEA 1NGHA 4E1JA 3CF5L 3AVKA 3OYNA 4CEQA 3PIPL 3DLLL 4B9NA 4DSJA 5HRSA 1JLGA 3CYMA 4HCBA 1D5AA 4DV5K 1QVGM 3EKSA 1WSIA 1HYSA 3QBXA 3AA5X 4DFJA 1D4XA 3LZIA 4FLTA 2HB5A 1WN7A 1JL2A 1DGKN 4O8KA 4DFKA 4FWQA 1YUWA 3IMXA 4JI1K 4FOEA 3CPEA 1ATNA 1JLEA 4CFAA 5D3GA 1FXXA 1HNWK 1ATRA 3O08A 3O5BA 3QEXA 1D9DA 2WFBA 4DR7K 1SKWA 3HO1A 4DU1A 3I33A 3VENA 3ASMA 4CJ7A 2O8EA 2JGUA 1HPMA 3AY9A 1C0UA 4QS9A 4KAZA 4FWSA 3ZYYX 4KRFA 3U8XA 3EYZA 1U45A 4F8RA 4YY3K 1BI4B 2NZTA 4H5TA 1XC9A 3D2EB 2Q0RA 2VG6A 3L3UA 1QHTA 4M63C 3EL2A 3WXJA 4CZHA 3OY9A 3NGIA 3KLHA 1WSHA 2QWQA 4HUEA 2P9UB 4BGBA 3RSEA 4B3MK 4LF6K 2E5LK 3CCLN 4DR2K 4C8MA 1BI4A 4K42A 1NK8A 1N33K 3LDQA 3EN9A 3FLCO 5JLFA 3AVLA 4N5SA 4DUZK 4NB4A 4BROA 4CESA 3M5RA 3HK2A 3HZ6A 2P9UA 1GLEG 2WUSA 2WC9A 2F7TA 5LY3A 3O3FA 4A62A 4QOZB 1QQOA 4G1QA 5FRMA 1TKDA 4NYFA 4NCBA 4OX9K 3LDNA 2ZE2A 2OPPA 3H3NO 3RR8A 3F2KA 3O3GA 1K8KA 4DMNA 1JKHA 3J7ZO 3V81A 5LJVA 2P9PB 1MWKA 2VG5A 3C65A 1Q86O 3LALA 4FJHA 5KRSA 3C94A 3DYAA 3NF9A 3CC4N 2O8BB 1YVUA 1RTDA 4RWTA 4IOXA 3QO9A 3L2VA 1SZ2A 4W5OA 4BR2A 4UY8O 4FJNA 5HP1A 3A5NC 3U9ZA 4FSVA 5F1XA 2HVHA 1QHAA 1IV0A 3TAMA 4E1NA 2VG7A 4ISGA 3ZSYA 1ILYA 5JMVA 4M3WA 4CJPA 4DTJA 3RR7A 1KTQA 1JLBA 3DXMA 5F2RA 4B9VA 3B6PA 1ZBHA 2QI2A 2NRWA 4KTQA 3OYKA 1KAYA 1C0MA 4FWPA 3AVGA 3OYJA 5FRNA 4DUYK 2F4VK 3CQYA 4LFBK 3ULEB 1VQ7N 1X1PA 1LW2A 1KFSA 1BWFO 2O8CB 2I7NA 3AO4A 1IKWA 2DFFA 3AV9A 4IOAL 4C8KA 2HHHK 3NVKA 1SUQA 5GIOA 3VEZA 4CJ3A 3ULEA 1XQSC 1RGIA 2Y1IA 3SYZA 2OYQA 2O8CA 1RT3A 4O0IA 3S3NA 3WXKA 4PY5A 4FL9A 4CEFA 2HMIA 4O0JA 4F3OA 2OPRA 3W0LA 4GV9A 1KVAA 4PKHA 4CZGA 3MMVA 3VQPA 4F4KA 1C0FA 4K0KK 1OH6A 3HOTA 3JAMO 1ESVA 4KHQA 3UIQA 2O4IA 4CZLA 5AJ3K 1N6QA 1GOBA 4OPHA 3CQ8A 3SQ0A 4FJKA 4H03B 4BRQA 2H3GX 3TAFA 3DLRA 2QWMA 3WQUA 4J2AA 4HWIA 5AQRA 3KK2A 4E7HA 5BR9A 2WOMA 3R1XA 2VGMA 4O4GA 1RBUA 1VQ6N 3L8BA 1RTIA 3LM9A 4CEDA 3O3HA 1RT2A 1Q82O 5AQVA 3U9DA 1BO5O 3CCRN 1ZBLA 1SKSA 4IKFA 3EY1A 3NH1A 1DLOA 1VQMN 4BE0A 4Z4EA 2DY4A 1KAZA 1R0AA 4BE1A 1X3MA 1V4TA 2EHGA 3OHRA 4LD0A 3PO4A 4ID5A 2V51B 4NLCA 1I3AA 4CZKA 4E19A 1HRHA 3M8RA 1C0TA 4R5PA 3HSCA 3TTCA 3EZ5A 4OPKA 1GLAG 3VF2A 2A5XA 1KQSM 3VQEA 4DQPA 4M3UA 3HI0A 4B9TA 4FJ8A 2D1KA 4I2QA 4KHPK 4HCCA 4BC4A 1JLCA 2AP1A 4FCYA 4KH4A 5M1KA 3BP8A 3OBYA 4CD3A 1KLNA 4HUFA 3SMPA 4FOIA 3ZX0A 3QEIA 4FPAA 1HJRA 3TAPA 3OW2M 3Q7CA 2QWPA 1MA9B 4M42A 3CCSN 4NO7A 1S6QA 4R79A 4FXDA 1TV6A 4JHDA 5AQZA 1X9SA 1TUYA 5FPEA 5KPRA 4CGDA 5E84A 1S1WA 5AQWA 4OPAA 4BRIA 1E3MA 5CE3A 3P4IA 4HTUA 1J53A 2Z1HA 1ZYQA 1SL2A 3ZEUB 2EWSA 4H5WA 1GLFO 3LAKA 3QIPA 4E7KA 4W5RA 1JLQA 4JNEA 2Q36A 4CIFA 3CC7N 4WCEL 3UKUA 1VK0A 3MN6A 3CC2N 3PX4A 1YJ9N 4B08A 4OLAA 2D0OA 2FBTA 3AVNA 3ZSZA 4DSEA 3BZCA 4FJXA 5AQQA 3EE9A 1WSFA 3CIPA 2EX3A 3SK3A 4AM6A 1NJXA 4XH1A 4FW1A 1Z6RA 3VN5A 4X64K 4I6MA 4CHYA 3QICA 3WT0A 4LH5A 5FPDA 1T8EA 2NRRA 3G25A 4PUOA 4X66K 4H4OA 4JKBA 3ZSWA 2JWKA 2E6LA 3VERA 4DQRA 1N5YA 4NCGA 3KIOA 4H0VB 3K5NA 3CFRA 1HNIA 1NMDA 3CERA 3T1YK 3MWTA 2VWBA 4BRKA 3DLHA 3KK1A 4DKWA 4GKKK 2O8DA 4GMJB 4Z94A 2F96A 4RW6A 4FLWA 3P83D 1TGOA 1DEJA 3J80O 3QBWA 1CXQA 1SL1A 3R8EA 4BRLA 4WQ4A 3GE1A 3KHYA 4B3TK 2I7PA 4FJIA 4IO8A 2ITMA 1N36K 5IWAK 4CHPA 4CZMA 3BUZB 3THWA 4LFCK 3KD5E 2HHUA 3O8MA 3R9PA 3RVCA 1VQKN 3E9OA 1BCMA 1E4GT 3NH2A 3RMCA 4DQIA 4AHUA 4FM2A 3RMBA 3E01A 3KLGA 1QTMA 3I8DA 1FKPA 3P38A 4DTMA 1SKRA 4YHHK 1T6CA 4CJRA 1HJOA 2Z1JA 4BRMA 3GDQA 1HUXA 4JI5K 2DPNA 2F8SA 3AO5A 4DFMA 1W0HA 4E3SA 3VMFB 3VOVA 2E4LA 3VESA 4B1YB 4OJRA 3FZLA 3QINA 3KKSA 3O9UA 3A0IX 4KB0A 4JI4K 4PQUA 4KHNA 2ATQA 2PFUA 2B5JA 3V1OA 2P5OA 1TKZA 4FLXA 5ADXA 2QWOA 5J2MA 1S72N 1F21A 3QFUA 4FJGA 3OTOK 4EHUA 1ATSA 1XNQK 4KKOA 5AZJA 2UUAK 4OKEA 3QNOA 1TK5A 3C0BA 1GOCA 3HM8A 4DTXA 3PO5A 1VSDA 1VQLN 4BGAA 1L3TA 4FK2A 4H8KA 1HQEA 2D0AA 4Z4HA 1KC8O 3N4PA 5JS2A 3AA3A 2O4GA 3MAQA 3AVAA 1HNZK 2HHVA 4BQLA 2YKNA 4JLHA 3KK7A 4FWLA 3C7NB 2OPQA 3AVIA 3O1WA 3MCPA 3TABA 1LWCA 2UXDK 4KTZA 1IG9A 4CF9A 3CJ7A 4B9SA 3ZT1A 4B9MA 2A42A 1RDBA 5EXWA 3FR0A 3L4IA 4I9LA 1S9EA 3TAGA 2IC3A 3C7NA 4Y1CA 4KHSA 3CMEN 1RNHA 1NK7A 2HBKA 3G6EN 2DTUA 1ITGA 4BWMA 4CHOA 2CH6A 3I56N 4CK3A 1OH7A 1KRPA 1NK0A 3CJBA 2QWLA 2Y1JA 4AM7A 1QSYA 4CZFA 1S1VA 5KPTA 3QLHA 1KAXA 3A8YA 1E4FT 2HHXA 1RT5A 5FPMA 1UWBA 4DFPA 1TVRA 1HKGA 4Q0BA 3ZSXA 5DM6L 4CJVA 1WB9A 5B8HA 3AA2A 4CECA 3MECA 1NMNA 3VEYA 3TPQA 3DXKA 3SJHA 3CCUN 5BRDA 5M1PA 3JYTA 4O5FA 3NGZA 3WUHA 2G8HA 3L2RA 1KSPA 4DB3A 4DTSA 2G8KA 5GAGP 2PYJA 3WNHA 1NGCA 3HP6A 1W9HA 4JS5A 4OVLA 3CCVN 3RRGA 4DSIA 1VQON 4RW8A 4QCLA 1VRUA 4MO5A 3OBWA 1FKOA 1MDUB 4YDUC 5HRRA 4IJNA 1JLAA 3ZT4A 3THYB 3ATUA 1BIUA 2QTDA 2B6AA 3K59A 2F8TA 4DCHA 4JN4A 4C1NI 3NAEA 3EKUA 2BTFA 3HRGA 4CJ4A 1X9WA 3HOSA 4ILHA 2KTQA 1K6YA 2ASOA 3VA3A 3IS9A 4BVOA 2YI1A 2NLXA 4DS5A 3ZX2A 5C2DA 3THYA 3DLGA 3LPUA 4FVUA 1VSHA 1KXPA 4DV7K 4CFCA 4LY7A 1GLCG 3V9WA 4JAXA 1EKEA 4AHSA 4K25A 1YIJN 4ICLA 4A59A 2HF3A 5AQIA 4XEIA 1VAZA 4I7FA 4EIAA 3QETA 1VSJA 4BACA 1NNEA 3TR8A 4F9OA 3K2PA 4KH5A 4B9LA 4CERA 4JS4A 1A5XA 1ASWA 1Y64A 4IJAA 3RMDA 1LOTB 4HUGA 1LAWA 3OYFA 4DV2K 1WBBA 4F2SA 3O9RA 1NGDA 1RTHA 3K57A 3T69A 3D2EA 2HHQA 4ISEA 4BRGA 4M3ZA 1O13A 4CZIA 3OS0A 2E2QA 2KFNA 2ZD1A 3AO2A 1FK9A 1OVYA 1OH5A 4CF1A 2UUCK 2E20A 1L5UA 4GY2B 4CBUA 4KB1A 3LP2A 3GBTA 1B9DA 2FSNA 2VWJA 1WSJA 3EZWA 4E7JA 3IFRA 1RCHA 3QEWA 1JCGA 3PX0A 5AQNA 4FWKA 4IG0A 2HHWA 1P8ZA 3HL8A 3LM2A 4BR4A 1J6ZA 1W2BM 1QSSA 4OGCA 3QEPA 1VSLA 3P5JA 3VQ6A 1T6DA 3L3VA 2P9PA 1A5VA 4CZJA 3QNNA 3K5OA 3NF8A 4IFVA 4C23A 2PBDA 1S1TA 2O8BA 2VCPA 1VSIA 3K58A 4WE1A 3KD1E 4CGJA 3A5MC 3H6EA 5CHIA 4BWJA 2IIRA 4B9UA 4FLYA 3MK6A 3DJCA 1UA0A 2PZSA 3L6QA 5FDLA 3KLEA 1VRTA 2HBMA 4DSFA 3PX6A 2VGNA 3H08A 2PAVA 1NJWA 3VEOA 5C0YA 4CCHA 2ITGA 3SJJA 3RRHA 3SBGA 4DQSA 2G8WA 2BDPA 1RDAA 1HYVA 3L2QA 3V9XA 3MXMA 1QSLA 3VEXA 4BG8A 5C15A 2B4JA 4EZ9A 3KKRA 1LWFA 2Q1NA 2UYTA 4ID1A 3ENHA 1K8AO 2CGLA 3HPHA 1XNRK 1NK5A 1YXQA 2NUBA 4M7XA 4LFAK 5AFUH 3PLAA 3AVHA 5LMNK 3FE1A 1OKJA 4XIUA 1TK8A 4IXCA 4XH5A 3L0QA 1NGEA 4JEPA 3ID6A 3QERA 1VSKA 3V6DA 3J7AP 3ZCMA 1IBLK 3O80A 4KI4A 3V1QA 3NBPA 4GNIA 3SLCA 1Y97A 4LF7K 2HBJA 3VQDA 4IO9L 2D4WA 4YFUA 3TAEA 2D0PA 3AVCA 3TWHA 4KHWA 2P9KB 3VGKA 4LF5K 3ZSQA 5AQJA 4CW7B 1QZ6A 3SUQA 1J9AA 2ZF5O 4MFBA 1XI1A 3V1RA 3VGMA 4AILC 3LDOA 4JKFA 4IOCL 4FM1A 4U67L 2KW4A 3OYAA 1NJZA 4ELVA 4JKDA 1S5JA 4IDHA 3JSMA 4FZZA 1CZBA 3IUCA 2ZJPL 2QK9A 4BRCA 4DHYA 3OYEA 1VSEA 4CJWA 1H1VA 3AA4A 5TKWA 4FWRA 1QQCA 1DKGD 1M90O 4MLEA 1BL3A 2RN2A 2RF2A 3D2FB 4FZYA 4AHRA 4FWNA 2XHBA 2F9WA 4W5QA 1LV5A 2ZGYA 2OZMA 4CK1A 2NRTA 2UXBK 5AQSA 1EO1A 1GLDG 1Z05A 3D2FA 1RBTA 3OJSA 4FVMA 1BA0A 1Q18A 1ZBFA 4B1UB 3ENOA 4A5AA 1U2VB 4BDYA 4ZTFA 3THVA 3CJCA 3VA0A 4DF4A 4JI7K 1BDGA 5BREA 2QW9A 3MX2A 4JRPA 4LF8K 1HX1A 2KHOA 1EETA 3MWPA 1HYZA 2P9LB 1U2VA 2WONA 3HM9A 3LP0A 2E8AA 1RDCA 3AVJA 1RDUA 2ZQBA 3BF1A 5DK5A 1EP4A 4E7IA 4FJ5A 4FPBA 4CIEA 3QEVA 1D9FA 4M3YA 3MEEA 4BREA 3AARA 3SQ1A 4JYAK 2BH1A 3BZKA 4Y0WA 1BOTO 3OYBA 4K41A 3T19A 5BRFA 4AHCA 2HVIA 3D0PA 3E1YA 1OVQA 2YNFA 4FWMA 1IJJA 2GEMA 3KZBA 5AQLA 1NGFA 2IVPA 4CBXA 3CFOA 2P5GA 4DV1K 3SV3A 3MXIA 3PSIA 3MCAB 3VQ9A 5EOYA 4CVNE 3O4WA 2P1JA 3H1VX 4CF8A 1IKXA 1BQNA 2NRVA 2IGIA 4RW7A 4AF1A 1XC3A 1VSMA 4CEBA 5GINA 3ZEUA 1RTJA 5T7BA 4IZ9A 3VTIA 2PY5A 2P9SB 4CEAA 3ISNC 4CF0A 1TUUA 4KO0A 4BC2A 5AQTA 2Z1GA 4HTLA 5AZIB 4CZEA 4B1XB 2FF6A 1Q9YA 1XMQK 4BQZA 4AHTA 2P9SA 4DWIA 3KLIA 2X6NA 1HNXK 1GLBG 4WF9L 1T03A 3U4LA 4CJ5A 1X9MA 4O44A 4G9ZA 4DU4A 3ZETB 1XMOK 3NHGA 1MWMA 4CJLA 1A5WA 2OCEA 4JI6K 1T05A 3DI6A 3V9UA 3NDKA 4JKEA 3OYMA 4H5RA 3LANA 3CM6A 4BC5A 3HPOA 4PHTX 1W97L 3ZETA 1BG3A 1YJNN 1TAQA 2VQFK 2HMPA 2FC0A 3FGUA 1NK4A 3S9HA 4DF8A 3SAHA 3H1QA 3D45A 4CD1A 2D5RA 4FJMA 5I9EB 3KWGA 3NF6A 2VWKA 3LDLA 3O6WA 3ALYA 1U47A 5CR4A 3VGLA 1Z26A 2I5JA 1SQKA 2Z1IA 1RBSA 1NKEA 5LJWA 1XUPO 4DTNA 1UAXA 1LAVA 2IAJA 4CHNA 5AR0A 3U6FA 2ZJRL 5AQGA 1XWLA 3SV4A 4WQ5C 1NM1A 2HOEA 1I94K 3CQXA 1I39A 1U48A 3HJFA 3FFIA 2J4RA 1IG8A 1RBVA 2A1RA 3WNEA 1N32K 3BF3A 1WSGA 3HBTA 3VEWA 3RMAA 1UOCA 1NWKA 4Z4CA 4JD2B 3PIOL 1XHXA 3MDQA 1JLFA 3H45C 3V9ZA 4MDAA 2HNDA 4W5NA 3LZJA 4KHYA 1ZC6A 3QB0A 1EX4A 1ZBIA 5C10A 2XY8A 3W3DA 5BRHA 2W42A 5EVZA 1VQNN 2PYLA 3CI5A 3L4QA 3NMUA 3QIOA 2YHYA 4CIGA 3SUOA 2YJEA 4KI6A 3DOKA 4NYNA 2XO7A 3AVMA 3HYFA 3V9SA 4CF2A 5LMUK 3RWUA 1C1BA 3DWLA 3WXMB 1SV5A 1YI2N 3FZKA 4RG8A 3CCMN 3T7ZA 3T3FA 2G8FA 2Q3SA 5CY4A 4OPJA 4CEOA 5BPNA 3NGYA 3CCEN 3MN5A 4WFBL 2QKKA 1S9GA 4DR3K 4F2RA 3VQ4A 1S3XA 4YOUA 1LWEA 3CG7A 3BDPA 1U04A 5A2QO 2GUPA 5E26A 2XY7A 2AA4A 3ZX3A 4C8NA 3OYDA 2JWLA 3EO3A 3M6GA 3DLEA 1RT6A 5HROA 5J1EA 1R59O 3DOLA 4ISFA 3TARA 3DM2A 1RT1A 1NGBA 1V4SA 1REVA 4FM0A 1Q8IA 1BUPA 2QWNA 1LW0A 1FW6A 4OGEA 1DT9A 1BISA 2DFHA 3TSPA 4IEEA 1O1WA 3I0RA 4Z4FA 3I0SA 1JCEA 4DTOA 4K8ZA 1QZ5A 1Q7YO 1WNSA 3F5TA 5BPLA 4IEIA 3K5LA 3SUPA 2HHTA 4CGFA 4AHVA 3THXB 4H0TB 4C8LA 2XY6A 4YDUA 5CYQA 4DSLA 3C6UA 3NH0A 3UKRB 1HPZA 1KLMA 3HT3A 4JI3K 4KBOA 1BA1A 1ZBUA 4NXMK 5J2PA 3SQ4A 1RT4A 2IVNA 3THXA 3TAQA 2YNGA 3FZHA 3F73A 2OTJN 3OYLA 2ZGZA 3UKRA 1YVNA 4M3TA 2FSJA 4M41A 1C1AA 3M1FA 1VHXA 4O5BA 3SAFA 1GOAA 4FJLA 4L8RB 1KVCA 1WBDA 3VTHA 4KHUA 2KZZA 4I9QA 2W41A 4BR7A 2VYPA 3E9LA 5JVGL 1JXBA 2KKZA 5LL6Z 3M8PA 2BANA 2X74A 2P9NB 1S1XA 3LAMA 3QDKA 5M1FA 5EY4A 1WAJA 1FJGK 4B3OA 2QM1A 4C1NK 4H5NA 4KV8A 5I42A 4X62K 4DU3A 1L3UA 3B8AX 5JLHA 1NBWA 3LPTA 4H0OA 1VQ8N 3B6OA 4BR5A 4FJ7A 2BGGA 5FROA 4PWDA 1Z25A 4W5TA 1SL0A 3CFPA 1QQMA 3IAYA 4TSXA 2E88A 2KFZA 2Q97A 1YHQN 2YHXA 4DLGA 5AQYA 1TK0A 1JL1A 4M45A 3FZFA 4Q5VA 3FFKB 4B8CA 3KLFA 3IKMA 5HLFA 2RKIA 2HSTA 5M1QA 4BY9C 4A2AA 2O8EB 5J2QA 1D8YA 3ZLJA 4JK7A 4DR6K 3AGKA 3M3ZA 1MU2A 2YV0X 3DRRA 3K5MA 1BCOA 1TYQB 4YOXA 2GX9A 3NE6A 5SWMA 1KFDA 2IS3A 1XHZA 2ZJQL 3NFAA 3U3GA 4JKGB 1HQUA 2GELA 1YT3A 4GVMA 4J2DA 3RSEB 5AQHA 3VQQA 1TYQA 4MDBA 4E1MA 2RHKA 4CI6A 1NGJA 4DTRA 3ITHA 4EP4A 4FK4A 4MQ3A 4EAHD 2BE2A 3NVMA 4GV3A 1KVBA 3R3LA 4CFBA 1NGIA 4JKGA 4CJSA 4DV6K 3LDSA 3O9QA 4V19S 5GAEP 3C6TA 4RW9A 4J2EA 3P1GA 1RT7A 3ULDA 4H0XB 1T3VA 1TL3A 4FYDA 3O9TA 4H4MA 1JXEA 1K9MO 2IDOA 2IOCA 4J8FA 2QEXN 5FPNA 1K8KB 1N8RO 1BGXT 4M7YA 4CHQA 4JK9A 3A5OC 1DTQA 3TTDA 1L3SA 3F9KA 3ZSVA 3FZMA 1Q9XA 4BRHA 4YOTA 1EWQA 5KQ8A 3OYGA 4JV5K 3H46O 2ASPA 3HPGA 3IRXA 3EE8A 4B8AB 1C0GA 1WAFA 1T44A 4EFHA 3DMJA 1BQMA 2WTUA 4X65K 5JVHL 4DR4K 2OTLN 3PSFA 4IWVA 1U4BA 4CJKA 4M3XA 5KI6A 3CXCM 4CEZA 3M8SA
chains in the Genus database with same CATH topology
2XY5A 1J5OA 4JRPA 1HNVA 4CHPA 2YHAA 3G10A 1EETA 3OYCA 3SPZA 1HYZA 4EP5A 1L3VA 3KD5E 2HHUA 1RILA 4OKJA 5CYMA 4CE9A 2WONA 1BCMA 3NH2A 3RMCA 4DQIA 3HM9A 3LP0A 1RDCA 3AVJA 3LWLA 2ZQBA 1IKYA 2OZSA 4AHUA 1B92A 4CJFA 4FM2A 5CZ1A 5DK5A 2X6SA 3CM5A 3RMBA 3E01A 3SCXA 4DLEA 3KLGA 3AVKA 3OYNA 4CEQA 1EP4A 1QTMA 4O55A 4E7IA 3I8DA 4FJ5A 1FKPA 4DTMA 1SKRA 4CIEA 3L2WA 3QEVA 4B9NA 1D9FA 4M3YA 3MEEA 3SQ1A 4DSJA 5HRSA 4CJRA 1JLGA 2Z1JA 3CYMA 3SNNA 4HCBA 1D5AA 3OYBA 4J2BA 3T19A 4AHCA 2F8SA 3AO5A 1WSIA 1HYSA 3D0PA 4DFMA 1W0HA 2HVIA 4E3SA 2YNFA 3AA5X 2E4LA 4DFJA 2YNIA 4OJRA 3QINA 3LZIA 2HB5A 4FLTA 1WN7A 3KKSA 1EXQA 1JL2A 4KB0A 3CFOA 2P5GA 3VQCA 3SV3A 2ATQA 3MXIA 4KHNA 2B5JA 3O4NA 3V1OA 4DFKA 4PQUA 2P5OA 3VQ9A 1TKZA 4FLXA 4CJUA 5J2MA 5D3GA 1JLEA 4CFAA 4N41A 1FXXA 2YNHA 1J54A 3DRSA 1F21A 2P1JA 3A2FA 3QEXA 1D9DA 4FJGA 4CF8A 1SKWA 3HO1A 1IKXA 4DU1A 5K14A 1BQNA 1UA1A 3ASMA 4CK2A 4KKOA 2GUIA 2IGIA 4OKEA 1S1UA 4RW7A 3V4IA 2JGUA 3QNOA 1TK5A 1GOCA 1VSMA 4PA1A 4CEBA 1C0UA 3RTVA 4DTXA 3PO5A 1VSDA 4KAZA 1TKXA 4KRFA 1RTJA 1L3TA 5T7BA 4FK2A 4H8KA 1HQEA 2D0AA 4Z4HA 2YHBA 3EYZA 1U45A 2PY5A 5JS2A 3AA3A 1XC9A 1BI4B 4F8RA 2O4GA 3MAQA 3AVAA 4LSLA 4CEAA 2HHVA 3ISNC 2VG6A 4CF0A 1YTAA 1IH7A 3L3UA 1QHTA 4KO0A 4Y1DA 2YKNA 2Z1GA 4JLHA 3NGIA 3OY9A 3KLHA 4EZ6A 2OPQA 3MXJA 3AVIA 1WSHA 4HUEA 1Q9YA 3C95A 3TABA 1ASVA 1LWCA 4C8MA 4AHTA 3OS1A 1BI4A 4KTZA 4DWIA 1IG9A 4CF9A 1NK8A 3KLIA 4CJTA 3AVLA 4N5SA 3ZT1A 2X6NA 4B9SA 1CZ9A 1RDBA 4B9MA 4I9LA 4CESA 1S9EA 3TAGA 1T03A 3KTQA 2IC3A 4Y1CA 4CGHA 4CJ5A 4O44A 3HVRA 1X9MA 4KHSA 1RNHA 3HK2A 4DU4A 1NK7A 5JS1A 3NHGA 4CJLA 1ITGA 2DTUA 1A5WA 4BWMA 4CHOA 2RPIA 1T05A 1DTTA 3DI6A 3V9UA 4CK3A 3O3FA 3NDKA 1KRPA 4QOZB 3OYMA 4G1QA 1NK0A 5FRMA 3LANA 3CM6A 4E89A 4NYFA 1TKDA 4NCBA 2Y1JA 4DG1A 3HPOA 4E7LA 4ELUA 2ZE2A 1QSYA 2OPPA 3RR8A 3O3GA 1S1VA 1TAQA 1JKHA 3QLHA 4DMNA 3V81A 3AVFA 2FC0A 3OS2A 1C6VA 5C42A 1NK4A 3S9HA 1YTUA 2VG5A 2HHXA 4DF8A 1RT5A 3LALA 4FJHA 3D45A 5KRSA 1UWBA 3C94A 2D5RA 4DFPA 1TVRA 2ETJA 3DYAA 4FJMA 3NF6A 1TAUA 2VWKA 3NF9A 3BGRA 3VQAA 4Q0BA 1YVUA 3ZSXA 3ALYA 1U47A 3MEGA 3VQ7A 1RTDA 1Z26A 2I5JA 2Z1IA 1RBSA 4CJVA 1NKEA 3KK3A 3QESA 4ELTA 3AA2A 4CECA 3MECA 3QO9A 2GV9A 4DTNA 1UAXA 3MEDA 3L2VA 4W5OA 1LAVA 2IAJA 4CHNA 5KTQA 3NGZA 3JYTA 3U6FA 4FJNA 3SV4A 1XWLA 5HP1A 2G8HA 3L2RA 1NOYA 1I39A 1U48A 3HJFA 3FFIA 2HVHA 1KSPA 2GBZA 3TAMA 4E1NA 3OYHA 2VG7A 4DTSA 1RBVA 2A1RA 2G8KA 3ZSYA 3IG1A 2PYJA 3WNHA 3WNEA 3HP6A 4M3WA 1W9HA 4JS5A 1WSGA 3RMAA 4OVLA 4DSKA 2HNYA 1NOZA 4CJPA 4DTJA 4ZTJA 3RR7A 2QXFA 1UOCA 5HRPA 3RRGA 4DSIA 4RW8A 4JRQA 1KTQA 4Z4CA 4QCLA 1JLBA 1VRUA 4B9VA 4CGIA 1FKOA 4OLBA 1XHXA 3B6PA 1JLFA 5HRRA 5I3UA 1QS4A 1JLAA 3ZT4A 1ZBHA 1BIUA 4KTQA 3OYKA 3V9ZA 4W5NA 2B6AA 1C0MA 2HNDA 3K59A 3LZJA 2F8TA 4KREA 4KHYA 3DLKA 3AVGA 3OYJA 3NAEA 5FRNA 1EX4A 5KRTA 1ZBIA 4CJ4A 3VQ8A 1X9WA 2XY8A 3VQ5A 2KTQA 1K6YA 4KFBA 3G0ZA 3ZSRA 2W42A 3VA3A 2PYLA 3IS9A 1CLQA 3QIOA 4CIGA 3SUOA 1X1PA 1LW2A 3DOKA 4GW6A 4NYNA 2XO7A 4DS5A 1KFSA 3AVMA 3HYFA 3V9SA 4NCAA 3DLGA 3LPUA 4CF2A 2FBVA 3RWUA 3AO4A 1IKWA 1VSHA 2DFFA 3AV9A 5HRNA 2R7YA 1C1BA 4CFCA 4HVJA 4C8KA 3U3YA 4LY7A 1SV5A 5J2NA 3S3OA 1SUQA 5CZ2A 4RG8A 3T1AA 3OJUA 3V9WA 3T3FA 2G8FA 2Q3SA 5CY4A 1EKEA 4AHSA 4CJ3A 4OPJA 2Y1IA 4ICLA 3WNGA 3NGYA 4CEOA 3NF7A 3SYZA 4QAGA 2OYQA 2HW3A 3ZT3A 1RT3A 4I7FA 4O0IA 3QETA 3S3NA 1S9GA 1VSJA 3AO3A 4BACA 3VQ4A 4CEFA 4N56A 2QKKA 4F2RA 4PY5A 3TR8A 4FLZA 2HMIA 4O0JA 1LWEA 3CG7A 4Z0UA 4F3OA 2OPRA 3K2PA 3BDPA 1KVAA 1U04A 4B9LA 3LWMA 4CERA 3VQPA 4JS4A 1A5XA 4F4KA 1ASWA 2XY7A 3RMDA 4C8NA 3OYDA 4HUGA 1LAWA 3DLEA 4KHQA 1IO2A 2D0CA 1RT6A 3OYFA 5J1EA 3OYIA 3SQ2A 5HROA 3UIQA 3DOLA 2O4IA 4F2SA 5KGXA 3TARA 1RTHA 3DM2A 3K57A 1N6QA 1GOBA 2HHQA 1RT1A 3CQ8A 3NCIA 3ZT0A 3SQ0A 4FJKA 4HHTA 1REVA 4M3ZA 4FM0A 1Q8IA 3TAFA 3OS0A 2KFNA 2ZD1A 3AO2A 3DLRA 4AH9A 3DLBA 1LW0A 1FK9A 4OGEA 4RW4A 4CF1A 4J2AA 1L5UA 3KK2A 1BISA 4E7HA 4DTUA 2DFHA 2WOMA 1O1WA 3PUFA 4Z4IA 3I0RA 4O4GA 4K8XA 1RBUA 3I0SA 4Z4FA 4DTOA 4K8ZA 4KB1A 3L8BA 1WNSA 1RTIA 3LP2A 4CEDA 1B9DA 3K5LA 4ZHRA 3O3HA 3SUPA 1RT2A 4FZXC 5EU7A 2HHTA 1SKSA 1ZBLA 4LH4A 4IKFA 4CGFA 4AHVA 3EY1A 1WSJA 3NH1A 1DLOA 2VWJA 4BE0A 4E7JA 1RCHA 3QEWA 4Z4EA 2DY4A 4M3RA 4C8LA 2XY6A 3AO1A 1R0AA 4BE1A 3PX0A 5CYQA 4DSLA 3C6UA 3NH0A 3S3MA 2EHGA 4IG0A 1HPZA 2HHWA 1KLMA 3O4QA 3HT3A 3HL8A 1KCFA 2HHSA 1WLJA 4LD0A 3PO4A 4ID5A 2KQ2A 1QSSA 4KPYA 1ZBUA 4OGCA 3QEPA 1I3AA 3SI6A 1VSLA 3P5JA 3VQ6A 1RT4A 4E19A 5J2PA 1HRHA 3ZT2A 3SQ4A 3M8RA 4N76A 3L3VA 1C0TA 4R5PA 3EZ5A 3TAQA 2YNGA 4OPKA 3F73A 4CFDA 1A5VA 4IFYA 2D0BA 1RDDA 3OYLA 4E0DA 3QNNA 5DMRA 4M3TA 3VQEA 3K5OA 3NF8A 1C1AA 4IFVA 4M41A 4DQPA 4M3UA 4O5BA 4DS4A 4B9TA 1GOAA 1S1TA 4FJLA 1KVCA 4L8RB 4FJ8A 4FJ9A 4KHUA 4I9QA 2KZZA 3SPYA 4I2QA 1VSIA 2A1SA 4BE2A 3K58A 4HCCA 5C24A 4WE1A 3KD1E 1JLCA 3VQBA 1JXBA 4CGJA 3WNFA 3M8PA 2BANA 4FCYA 2X74A 2YKMA 1B9FA 3KJVA 1KLNA 4BWJA 4HUFA 1S1XA 3LAMA 4B9UA 2AJQA 4FLYA 1WAJA 3M8QA 4KTWA 4B3OA 3QEIA 1UA0A 2PZSA 2G8IA 5FDLA 1HJRA 4KV8A 4DU3A 5I42A 3KLEA 3TAPA 1L3UA 4CHZA 1VRTA 4DSFA 5C25A 1NJYA 3LPTA 3PX6A 4M42A 3H08A 2OPSA 4FJ7A 3B6OA 1NJWA 2BGGA 5FROA 4CCHA 2ITGA 3SJJA 1S6QA 4PWDA 1Z25A 3RRHA 4W5TA 4FXDA 1TV6A 4DQSA 1SL0A 2G8WA 1RDAA 1HYVA 3CFPA 3L2QA 3V9XA 3MXMA 4FLVA 1QSLA 2BDPA 3IAYA 4TSXA 2KFZA 2B4JA 1QE1A 1G15A 1BHLA 4EZ9A 2P51A 3KKRA 4CJQA 1LWFA 2FBXA 3PV8A 1X9SA 2JLEA 2FBYA 4DLGA 4CGDA 4ID1A 1TK0A 1JL1A 2XRIA 4BDPA 3ZSOA 4M45A 3TANA 1S1WA 4Q5VA 3HPHA 3TI0A 4FK0A 1NK5A 4B8CA 3KLFA 2X78A 4UQGA 2NUBA 2RKIA 5HLFA 1BIZA 3SZ2A 3AVHA 1TL1A 5J2QA 1D8YA 4DTPA 4XIUA 4HTUA 1TK8A 1J53A 2Z1HA 1ZYQA 1SL2A 1MU2A 2YV0X 4IBNA 3DRRA 5HBMA 3K5MA 3LAKA 5SZTA 1BCOA 1VSKA 3HSTB 3QIPA 3QERA 4E7KA 3OVNA 3NE6A 1C1CA 5SWMA 4W5RA 3HXMA 1KFDA 2IS3A 4FLUA 3V6DA 1XHZA 1JLQA 1NKCA 3ZCMA 4CIFA 3NFAA 5KGWA 4KI4A 3HVTA 3V1QA 3NBPA 1VK0A 3U3GA 1HQUA 1Y97A 3VQDA 3TAEA 3PX4A 5E41A 4YFUA 1YT3A 4B08A 4GVMA 4OLAA 4J2DA 3AVCA 1ASUA 3TWHA 2FBTA 3AVNA 4KHWA 3VQQA 4E1MA 3AVBA 4I2PA 3ZSZA 4DTRA 3ITHA 4DSEA 4EP4A 3ZSQA 4FJXA 4FK4A 4MQ3A 1WSFA 2BE2A 2EX3A 3SUQA 1J9AA 1KVBA 4MFBA 1XI1A 3V1RA 4AILC 4CFBA 1CXUA 1RBRA 1NKBA 3PY8A 4CJSA 1NJXA 3LDSA 4FJJA 4FW1A 3C6TA 4RW9A 1NK6A 4FW2A 4FM1A 1VSFA 3VN5A 4J2EA 2LSNA 4CHYA 2KW4A 3P1GA 4CEEA 1RT7A 3OYAA 3ULDA 1IKVA 1NJZA 1TL3A 2DFEA 4ELVA 4FYDA 4LH5A 3JSMA 1S5JA 4H4MA 4FZZA 1JXEA 1T8EA 1CZBA 2IDOA 4YNQA 2IOCA 2QK9A 2OA8A 3OYEA 1VSEA 4PUOA 4CJWA 4IDKA 3AA4A 4H4OA 3ZSWA 2E6LA 4CJEA 4DQRA 4CGGA 1QQCA 2E6MA 1BGXT 3LP1A 1N5YA 4CHQA 1BL3A 4NCGA 3SUNA 1DTQA 2QKBA 2RN2A 2RF2A 3KIOA 4FZYA 4AHRA 3K5NA 3CFRA 2XHBA 1NK9A 4C8OA 1HNIA 1WSEA 3HP9A 1L3SA 1S6PA 4N47A 4W5QA 4BDZA 2G8UA 3F9KA 1LV5A 3ZSVA 2OZMA 3DRPA 4CK1A 3DLHA 4F3TA 1Q9XA 3KK1A 4IG3A 4GMJB 3OYGA 3L2UA 1HMVA 3HPGA 3IRXA 4KI6A 4B8AB 1T7PA 2F96A 4RW6A 1RBTA 3OJSA 1TKTA 4FLWA 3P83D 4FVMA 1WAFA 1ZBFA 2KZMA 1TGOA 4Z4GA 3DMJA 1BQMA 4LSNA 1CXQA 1SL1A 2G8VA 4BDYA 4ZTFA 1U49A 3THVA 1U4BA 4CJKA 3VA0A 4M3XA 5KI6A 4DF4A 4FJIA 4DQQA 3LP3A 4OKKA 2HNZA 4CEZA 3M8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XY5 A;  1J5O A;  4JRP A;  1HNV A;  4CHP A;  2YHA A;  3G10 A;  1EET A;  3OYC A;  3SPZ A;  1HYZ A;  4EP5 A;  1L3V A;  3KD5 E;  2HHU A;  1RIL A;  4OKJ A;  5CYM A;  4CE9 A;  2WON A;  1BCM A;  3NH2 A;  3RMC A;  4DQI A;  3HM9 A;  3LP0 A;  1RDC A;  3AVJ A;  3LWL A;  2ZQB A;  1IKY A;  2OZS A;  4AHU A;  1B92 A;  4CJF A;  4FM2 A;  5CZ1 A;  5DK5 A;  2X6S A;  3CM5 A;  3RMB A;  3E01 A;  3SCX A;  4DLE A;  3KLG A;  3AVK A;  3OYN A;  4CEQ A;  1EP4 A;  1QTM A;  4O55 A;  4E7I A;  3I8D A;  4FJ5 A;  1FKP A;  4DTM A;  1SKR A;  4CIE A;  3L2W A;  3QEV A;  4B9N A;  1D9F A;  4M3Y A;  3MEE A;  3SQ1 A;  4DSJ A;  5HRS A;  4CJR A;  1JLG A;  2Z1J A;  3CYM A;  3SNN A;  4HCB A;  1D5A A;  3OYB A;  4J2B A;  3T19 A;  4AHC A;  2F8S A;  3AO5 A;  1WSI A;  1HYS A;  3D0P A;  4DFM A;  1W0H A;  2HVI A;  4E3S A;  2YNF A;  3AA5 X;  2E4L A;  4DFJ A;  2YNI A;  4OJR A;  3QIN A;  3LZI A;  2HB5 A;  4FLT A;  1WN7 A;  3KKS A;  1EXQ A;  1JL2 A;  4KB0 A;  3CFO A;  2P5G A;  3VQC A;  3SV3 A;  2ATQ A;  3MXI A;  4KHN A;  2B5J A;  3O4N A;  3V1O A;  4DFK A;  4PQU A;  2P5O A;  3VQ9 A;  1TKZ A;  4FLX A;  4CJU A;  5J2M A;  5D3G A;  1JLE A;  4CFA A;  4N41 A;  1FXX A;  2YNH A;  1J54 A;  3DRS A;  1F21 A;  2P1J A;  3A2F A;  3QEX A;  1D9D A;  4FJG A;  4CF8 A;  1SKW A;  3HO1 A;  1IKX A;  4DU1 A;  5K14 A;  1BQN A;  1UA1 A;  3ASM A;  4CK2 A;  4KKO A;  2GUI A;  2IGI A;  4OKE A;  1S1U A;  4RW7 A;  3V4I A;  2JGU A;  3QNO A;  1TK5 A;  1GOC A;  1VSM A;  4PA1 A;  4CEB A;  1C0U A;  3RTV A;  4DTX A;  3PO5 A;  1VSD A;  4KAZ A;  1TKX A;  4KRF A;  1RTJ A;  1L3T A;  5T7B A;  4FK2 A;  4H8K A;  1HQE A;  2D0A A;  4Z4H A;  2YHB A;  3EYZ A;  1U45 A;  2PY5 A;  5JS2 A;  3AA3 A;  1XC9 A;  1BI4 B;  4F8R A;  2O4G A;  3MAQ A;  3AVA A;  4LSL A;  4CEA A;  2HHV A;  3ISN C;  2VG6 A;  4CF0 A;  1YTA A;  1IH7 A;  3L3U A;  1QHT A;  4KO0 A;  4Y1D A;  2YKN A;  2Z1G A;  4JLH A;  3NGI A;  3OY9 A;  3KLH A;  4EZ6 A;  2OPQ A;  3MXJ A;  3AVI A;  1WSH A;  4HUE A;  1Q9Y A;  3C95 A;  3TAB A;  1ASV A;  1LWC A;  4C8M A;  4AHT A;  3OS1 A;  1BI4 A;  4KTZ A;  4DWI A;  1IG9 A;  4CF9 A;  1NK8 A;  3KLI A;  4CJT A;  3AVL A;  4N5S A;  3ZT1 A;  2X6N A;  4B9S A;  1CZ9 A;  1RDB A;  4B9M A;  4I9L A;  4CES A;  1S9E A;  3TAG A;  1T03 A;  3KTQ A;  2IC3 A;  4Y1C A;  4CGH A;  4CJ5 A;  4O44 A;  3HVR A;  1X9M A;  4KHS A;  1RNH A;  3HK2 A;  4DU4 A;  1NK7 A;  5JS1 A;  3NHG A;  4CJL A;  1ITG A;  2DTU A;  1A5W A;  4BWM A;  4CHO A;  2RPI A;  1T05 A;  1DTT A;  3DI6 A;  3V9U A;  4CK3 A;  3O3F A;  3NDK A;  1KRP A;  4QOZ B;  3OYM A;  4G1Q A;  1NK0 A;  5FRM A;  3LAN A;  3CM6 A;  4E89 A;  4NYF A;  1TKD A;  4NCB A;  2Y1J A;  4DG1 A;  3HPO A;  4E7L A;  4ELU A;  2ZE2 A;  1QSY A;  2OPP A;  3RR8 A;  3O3G A;  1S1V A;  1TAQ A;  1JKH A;  3QLH A;  4DMN A;  3V81 A;  3AVF A;  2FC0 A;  3OS2 A;  1C6V A;  5C42 A;  1NK4 A;  3S9H A;  1YTU A;  2VG5 A;  2HHX A;  4DF8 A;  1RT5 A;  3LAL A;  4FJH A;  3D45 A;  5KRS A;  1UWB A;  3C94 A;  2D5R A;  4DFP A;  1TVR A;  2ETJ A;  3DYA A;  4FJM A;  3NF6 A;  1TAU A;  2VWK A;  3NF9 A;  3BGR A;  3VQA A;  4Q0B A;  1YVU A;  3ZSX A;  3ALY A;  1U47 A;  3MEG A;  3VQ7 A;  1RTD A;  1Z26 A;  2I5J A;  2Z1I A;  1RBS A;  4CJV A;  1NKE A;  3KK3 A;  3QES A;  4ELT A;  3AA2 A;  4CEC A;  3MEC A;  3QO9 A;  2GV9 A;  4DTN A;  1UAX A;  3MED A;  3L2V A;  4W5O A;  1LAV A;  2IAJ A;  4CHN A;  5KTQ A;  3NGZ A;  3JYT A;  3U6F A;  4FJN A;  3SV4 A;  1XWL A;  5HP1 A;  2G8H A;  3L2R A;  1NOY A;  1I39 A;  1U48 A;  3HJF A;  3FFI A;  2HVH A;  1KSP A;  2GBZ A;  3TAM A;  4E1N A;  3OYH A;  2VG7 A;  4DTS A;  1RBV A;  2A1R A;  2G8K A;  3ZSY A;  3IG1 A;  2PYJ A;  3WNH A;  3WNE A;  3HP6 A;  4M3W A;  1W9H A;  4JS5 A;  1WSG A;  3RMA A;  4OVL A;  4DSK A;  2HNY A;  1NOZ A;  4CJP A;  4DTJ A;  4ZTJ A;  3RR7 A;  2QXF A;  1UOC A;  5HRP A;  3RRG A;  4DSI A;  4RW8 A;  4JRQ A;  1KTQ A;  4Z4C A;  4QCL A;  1JLB A;  1VRU A;  4B9V A;  4CGI A;  1FKO A;  4OLB A;  1XHX A;  3B6P A;  1JLF A;  5HRR A;  5I3U A;  1QS4 A;  1JLA A;  3ZT4 A;  1ZBH A;  1BIU A;  4KTQ A;  3OYK A;  3V9Z A;  4W5N A;  2B6A A;  1C0M A;  2HND A;  3K59 A;  3LZJ A;  2F8T A;  4KRE A;  4KHY A;  3DLK A;  3AVG A;  3OYJ A;  3NAE A;  5FRN A;  1EX4 A;  5KRT A;  1ZBI A;  4CJ4 A;  3VQ8 A;  1X9W A;  2XY8 A;  3VQ5 A;  2KTQ A;  1K6Y A;  4KFB A;  3G0Z A;  3ZSR A;  2W42 A;  3VA3 A;  2PYL A;  3IS9 A;  1CLQ A;  3QIO A;  4CIG A;  3SUO A;  1X1P A;  1LW2 A;  3DOK A;  4GW6 A;  4NYN A;  2XO7 A;  4DS5 A;  1KFS A;  3AVM A;  3HYF A;  3V9S A;  4NCA A;  3DLG A;  3LPU A;  4CF2 A;  2FBV A;  3RWU A;  3AO4 A;  1IKW A;  1VSH A;  2DFF A;  3AV9 A;  5HRN A;  2R7Y A;  1C1B A;  4CFC A;  4HVJ A;  4C8K A;  3U3Y A;  4LY7 A;  1SV5 A;  5J2N A;  3S3O A;  1SUQ A;  5CZ2 A;  4RG8 A;  3T1A A;  3OJU A;  3V9W A;  3T3F A;  2G8F A;  2Q3S A;  5CY4 A;  1EKE A;  4AHS A;  4CJ3 A;  4OPJ A;  2Y1I A;  4ICL A;  3WNG A;  3NGY A;  4CEO A;  3NF7 A;  3SYZ A;  4QAG A;  2OYQ A;  2HW3 A;  3ZT3 A;  1RT3 A;  4I7F A;  4O0I A;  3QET A;  3S3N A;  1S9G A;  1VSJ A;  3AO3 A;  4BAC A;  3VQ4 A;  4CEF A;  4N56 A;  2QKK A;  4F2R A;  4PY5 A;  3TR8 A;  4FLZ A;  2HMI A;  4O0J A;  1LWE A;  3CG7 A;  4Z0U A;  4F3O A;  2OPR A;  3K2P A;  3BDP A;  1KVA A;  1U04 A;  4B9L A;  3LWM A;  4CER A;  3VQP A;  4JS4 A;  1A5X A;  4F4K A;  1ASW A;  2XY7 A;  3RMD A;  4C8N A;  3OYD A;  4HUG A;  1LAW A;  3DLE A;  4KHQ A;  1IO2 A;  2D0C A;  1RT6 A;  3OYF A;  5J1E A;  3OYI A;  3SQ2 A;  5HRO A;  3UIQ A;  3DOL A;  2O4I A;  4F2S A;  5KGX A;  3TAR A;  1RTH A;  3DM2 A;  3K57 A;  1N6Q A;  1GOB A;  2HHQ A;  1RT1 A;  3CQ8 A;  3NCI A;  3ZT0 A;  3SQ0 A;  4FJK A;  4HHT A;  1REV A;  4M3Z A;  4FM0 A;  1Q8I A;  3TAF A;  3OS0 A;  2KFN A;  2ZD1 A;  3AO2 A;  3DLR A;  4AH9 A;  3DLB A;  1LW0 A;  1FK9 A;  4OGE A;  4RW4 A;  4CF1 A;  4J2A A;  1L5U A;  3KK2 A;  1BIS A;  4E7H A;  4DTU A;  2DFH A;  2WOM A;  1O1W A;  3PUF A;  4Z4I A;  3I0R A;  4O4G A;  4K8X A;  1RBU A;  3I0S A;  4Z4F A;  4DTO A;  4K8Z A;  4KB1 A;  3L8B A;  1WNS A;  1RTI A;  3LP2 A;  4CED A;  1B9D A;  3K5L A;  4ZHR A;  3O3H A;  3SUP A;  1RT2 A;  4FZX C;  5EU7 A;  2HHT A;  1SKS A;  1ZBL A;  4LH4 A;  4IKF A;  4CGF A;  4AHV A;  3EY1 A;  1WSJ A;  3NH1 A;  1DLO A;  2VWJ A;  4BE0 A;  4E7J A;  1RCH A;  3QEW A;  4Z4E A;  2DY4 A;  4M3R A;  4C8L A;  2XY6 A;  3AO1 A;  1R0A A;  4BE1 A;  3PX0 A;  5CYQ A;  4DSL A;  3C6U A;  3NH0 A;  3S3M A;  2EHG A;  4IG0 A;  1HPZ A;  2HHW A;  1KLM A;  3O4Q A;  3HT3 A;  3HL8 A;  1KCF A;  2HHS A;  1WLJ A;  4LD0 A;  3PO4 A;  4ID5 A;  2KQ2 A;  1QSS A;  4KPY A;  1ZBU A;  4OGC A;  3QEP A;  1I3A A;  3SI6 A;  1VSL A;  3P5J A;  3VQ6 A;  1RT4 A;  4E19 A;  5J2P A;  1HRH A;  3ZT2 A;  3SQ4 A;  3M8R A;  4N76 A;  3L3V A;  1C0T A;  4R5P A;  3EZ5 A;  3TAQ A;  2YNG A;  4OPK A;  3F73 A;  4CFD A;  1A5V A;  4IFY A;  2D0B A;  1RDD A;  3OYL A;  4E0D A;  3QNN A;  5DMR A;  4M3T A;  3VQE A;  3K5O A;  3NF8 A;  1C1A A;  4IFV A;  4M41 A;  4DQP A;  4M3U A;  4O5B A;  4DS4 A;  4B9T A;  1GOA A;  1S1T A;  4FJL A;  1KVC A;  4L8R B;  4FJ8 A;  4FJ9 A;  4KHU A;  4I9Q A;  2KZZ A;  3SPY A;  4I2Q A;  1VSI A;  2A1S A;  4BE2 A;  3K58 A;  4HCC A;  5C24 A;  4WE1 A;  3KD1 E;  1JLC A;  3VQB A;  1JXB A;  4CGJ A;  3WNF A;  3M8P A;  2BAN A;  4FCY A;  2X74 A;  2YKM A;  1B9F A;  3KJV A;  1KLN A;  4BWJ A;  4HUF A;  1S1X A;  3LAM A;  4B9U A;  2AJQ A;  4FLY A;  1WAJ A;  3M8Q A;  4KTW A;  4B3O A;  3QEI A;  1UA0 A;  2PZS A;  2G8I A;  5FDL A;  1HJR A;  4KV8 A;  4DU3 A;  5I42 A;  3KLE A;  3TAP A;  1L3U A;  4CHZ A;  1VRT A;  4DSF A;  5C25 A;  1NJY A;  3LPT A;  3PX6 A;  4M42 A;  3H08 A;  2OPS A;  4FJ7 A;  3B6O A;  1NJW A;  2BGG A;  5FRO A;  4CCH A;  2ITG A;  3SJJ A;  1S6Q A;  4PWD A;  1Z25 A;  3RRH A;  4W5T A;  4FXD A;  1TV6 A;  4DQS A;  1SL0 A;  2G8W A;  1RDA A;  1HYV A;  3CFP A;  3L2Q A;  3V9X A;  3MXM A;  4FLV A;  1QSL A;  2BDP A;  3IAY A;  4TSX A;  2KFZ A;  2B4J A;  1QE1 A;  1G15 A;  1BHL A;  4EZ9 A;  2P51 A;  3KKR A;  4CJQ A;  1LWF A;  2FBX A;  3PV8 A;  1X9S A;  2JLE A;  2FBY A;  4DLG A;  4CGD A;  4ID1 A;  1TK0 A;  1JL1 A;  2XRI A;  4BDP A;  3ZSO A;  4M45 A;  3TAN A;  1S1W A;  4Q5V A;  3HPH A;  3TI0 A;  4FK0 A;  1NK5 A;  4B8C A;  3KLF A;  2X78 A;  4UQG A;  2NUB A;  2RKI A;  5HLF A;  1BIZ A;  3SZ2 A;  3AVH A;  1TL1 A;  5J2Q A;  1D8Y A;  4DTP A;  4XIU A;  4HTU A;  1TK8 A;  1J53 A;  2Z1H A;  1ZYQ A;  1SL2 A;  1MU2 A;  2YV0 X;  4IBN A;  3DRR A;  5HBM A;  3K5M A;  3LAK A;  5SZT A;  1BCO A;  1VSK A;  3HST B;  3QIP A;  3QER A;  4E7K A;  3OVN A;  3NE6 A;  1C1C A;  5SWM A;  4W5R A;  3HXM A;  1KFD A;  2IS3 A;  4FLU A;  3V6D A;  1XHZ A;  1JLQ A;  1NKC A;  3ZCM A;  4CIF A;  3NFA A;  5KGW A;  4KI4 A;  3HVT A;  3V1Q A;  3NBP A;  1VK0 A;  3U3G A;  1HQU A;  1Y97 A;  3VQD A;  3TAE A;  3PX4 A;  5E41 A;  4YFU A;  1YT3 A;  4B08 A;  4GVM A;  4OLA A;  4J2D A;  3AVC A;  1ASU A;  3TWH A;  2FBT A;  3AVN A;  4KHW A;  3VQQ A;  4E1M A;  3AVB A;  4I2P A;  3ZSZ A;  4DTR A;  3ITH A;  4DSE A;  4EP4 A;  3ZSQ A;  4FJX A;  4FK4 A;  4MQ3 A;  1WSF A;  2BE2 A;  2EX3 A;  3SUQ A;  1J9A A;  1KVB A;  4MFB A;  1XI1 A;  3V1R A;  4AIL C;  4CFB A;  1CXU A;  1RBR A;  1NKB A;  3PY8 A;  4CJS A;  1NJX A;  3LDS A;  4FJJ A;  4FW1 A;  3C6T A;  4RW9 A;  1NK6 A;  4FW2 A;  4FM1 A;  1VSF A;  3VN5 A;  4J2E A;  2LSN A;  4CHY A;  2KW4 A;  3P1G A;  4CEE A;  1RT7 A;  3OYA A;  3ULD A;  1IKV A;  1NJZ A;  1TL3 A;  2DFE A;  4ELV A;  4FYD A;  4LH5 A;  3JSM A;  1S5J A;  4H4M A;  4FZZ A;  1JXE A;  1T8E A;  1CZB A;  2IDO A;  4YNQ A;  2IOC A;  2QK9 A;  2OA8 A;  3OYE A;  1VSE A;  4PUO A;  4CJW A;  4IDK A;  3AA4 A;  4H4O A;  3ZSW A;  2E6L A;  4CJE A;  4DQR A;  4CGG A;  1QQC A;  2E6M A;  1BGX T;  3LP1 A;  1N5Y A;  4CHQ A;  1BL3 A;  4NCG A;  3SUN A;  1DTQ A;  2QKB A;  2RN2 A;  2RF2 A;  3KIO A;  4FZY A;  4AHR A;  3K5N A;  3CFR A;  2XHB A;  1NK9 A;  4C8O A;  1HNI A;  1WSE A;  3HP9 A;  1L3S A;  1S6P A;  4N47 A;  4W5Q A;  4BDZ A;  2G8U A;  3F9K A;  1LV5 A;  3ZSV A;  2OZM A;  3DRP A;  4CK1 A;  3DLH A;  4F3T A;  1Q9X A;  3KK1 A;  4IG3 A;  4GMJ B;  3OYG A;  3L2U A;  1HMV A;  3HPG A;  3IRX A;  4KI6 A;  4B8A B;  1T7P A;  2F96 A;  4RW6 A;  1RBT A;  3OJS A;  1TKT A;  4FLW A;  3P83 D;  4FVM A;  1WAF A;  1ZBF A;  2KZM A;  1TGO A;  4Z4G A;  3DMJ A;  1BQM A;  4LSN A;  1CXQ A;  1SL1 A;  2G8V A;  4BDY A;  4ZTF A;  1U49 A;  3THV A;  1U4B A;  4CJK A;  3VA0 A;  4M3X A;  5KI6 A;  4DF4 A;  4FJI A;  4DQQ A;  3LP3 A;  4OKK A;  2HNZ A;  4CEZ A;  3M8S A; 
#chains in the Genus database with same CATH topology
 2XY5 A;  2OAN A;  2YHA A;  1NU0 A;  2QWR A;  1WUA A;  1RIL A;  4OKJ A;  3DXM B;  4CE9 A;  4LF9 K;  4L3Q A;  4IFE A;  3QML A;  4XH4 A;  5HL7 L;  2E2P A;  2A6A A;  3LWL A;  1IKY A;  2OZS A;  3SNN A;  1OH8 A;  3SCX A;  2O8F B;  4DLE A;  4AQY K;  1EWR A;  3CJ9 A;  4PL7 A;  4O55 A;  3EEQ A;  3L2W A;  4BRN A;  3K9J A;  2F9T A;  3GG4 A;  4J2B A;  4BC3 A;  4BG9 A;  4BVP A;  2O8F A;  4RCH A;  3CPW M;  2W40 A;  2YNI A;  4DV0 K;  4JI2 K;  2NNW A;  3C6H A;  3WEE B;  1EXQ A;  3VQC A;  1JJ2 M;  4U7B A;  3O4N A;  4CJU A;  4N41 A;  2YNH A;  1J54 A;  4B3S K;  2FXU A;  3DRS A;  3A2F A;  5K14 A;  1UA1 A;  2UUB K;  4CK2 A;  1S22 A;  2GUI A;  3CCJ N;  1S1U A;  3V4I A;  3D6R A;  3WEE A;  4YOV A;  3G71 N;  3I55 N;  4PA1 A;  5ADX H;  4ILJ A;  3RTV A;  1TKX A;  2RE2 A;  3JXU A;  3TTF A;  2YHB A;  4JKH A;  2ASM A;  4LSL A;  5AQK A;  5M1O A;  1NGG A;  3TU5 A;  4QS7 A;  1YTA A;  1IH7 A;  4Y1D A;  5C12 A;  4B1V A;  4PKG A;  4EZ6 A;  3MXJ A;  3R6M A;  3SBT A;  3ATV A;  3C95 A;  2P9K A;  5AQU A;  1ASV A;  1J5E K;  3OS1 A;  3SAG A;  1ZBS A;  2FF3 B;  4CJT A;  1K73 O;  4WFA L;  1CZ9 A;  3VEV A;  1WOQ A;  1IBK K;  3KTQ A;  4MO4 A;  3VPZ A;  4CGH A;  3HVR A;  4OO1 J;  4A2B A;  3CHW A;  3G4S N;  5JS1 A;  2E2O A;  2RPI A;  1DTT A;  5IT9 O;  4E89 A;  1SAZ A;  4DG1 A;  4E7L A;  4ELU A;  3CCQ N;  3CJA A;  1RFQ A;  4JK8 A;  3AVF A;  2HF4 A;  2A41 A;  3OS2 A;  1C6V A;  2NRX A;  5C42 A;  1YTU A;  2BUP A;  4FO0 A;  1EQY A;  2ETJ A;  5AQP A;  4A57 A;  3P39 A;  1TAU A;  3BGR A;  3VQA A;  4LF4 K;  4PL8 A;  1QQN A;  4BRD A;  3MEG A;  5H1S Q;  3VQ7 A;  2VQE K;  4JKA A;  3KK3 A;  3QES A;  4ELT A;  2UU9 K;  2GV9 A;  3UE5 A;  3MED A;  4B1Z A;  5KTQ A;  1CZA N;  3ENB A;  2CH5 A;  3GL1 A;  2Q31 A;  4O8U A;  1NOY A;  1VQ9 N;  2V7Z A;  5GIP A;  2GBZ A;  3OYH A;  1BU6 O;  3IG1 A;  2YX6 A;  3BY5 A;  5KQD A;  4DSK A;  2HNY A;  1NOZ A;  4ZTJ A;  2QXF A;  5HRP A;  1YAG A;  4JRQ A;  2YJF A;  2P9L A;  4CGI A;  4OLB A;  4JHD B;  5I3U A;  1QS4 A;  3I8B A;  3OA9 A;  4KRE A;  3DLK A;  5BR8 K;  5KRT A;  3VQ8 A;  1KD1 O;  3VQ5 A;  4BR9 A;  4KFB A;  4DV4 K;  3G0Z A;  3ZSR A;  4BRF A;  2GWK A;  1CLQ A;  4GW6 A;  1NLV A;  4NCA A;  4BRA A;  1GLJ O;  4FWO A;  2FBV A;  4A5B A;  5HRN A;  3J7Y P;  2R7Y A;  3UB5 A;  2YHW A;  3BEX A;  2Q0U A;  4WYB A;  4HVJ A;  3U3Y A;  5J2N A;  3S3O A;  4DQ8 A;  5CZ2 A;  3T1A A;  3OJU A;  1LCU A;  1HLU A;  1GLL O;  5JIC A;  3WNG A;  3NF7 A;  4QAG A;  3LDP A;  3UKU B;  3ZT3 A;  5BN8 A;  2HW3 A;  3AO3 A;  1VQ5 N;  4N56 A;  2E1Y A;  4FLZ A;  3H3O B;  4Z0U A;  3S41 A;  3AGR A;  3LWM A;  4NXN K;  2V7Y A;  1SS6 A;  1HR0 K;  3JS6 A;  3P31 A;  1IO2 A;  2D0C A;  3OYI A;  4DR5 K;  3SQ2 A;  4K43 A;  3CJ1 A;  5KGX A;  4GV6 A;  2Q2R A;  4H0P A;  4I6M B;  2W6K A;  5AQO A;  3NCI A;  3ZT0 A;  2P9I B;  4HHT A;  1IBM K;  5AZI A;  4AH9 A;  3DLB A;  4RW4 A;  1HKC A;  1U6Z A;  1JCF A;  4WQ5 A;  5AQM A;  2CGK A;  4DTU A;  2GWJ A;  3PUF A;  4Z4I A;  4K8X A;  3D7E O;  3TSU A;  1Q81 O;  4QS8 A;  3AAQ A;  5FLX O;  2P9I A;  4ZHR A;  4FZX C;  5EU7 A;  4LH4 A;  3QFP A;  4M3R A;  3AO1 A;  2QXL A;  2O8D B;  3K0S A;  3KWI A;  1G99 A;  3S3M A;  1VQP N;  3O4Q A;  1KCF A;  2HHS A;  1WLJ A;  3A5L C;  2KQ2 A;  1ZXO A;  4KPY A;  5KPZ A;  3SI6 A;  2IVO A;  3ID8 A;  3ZT2 A;  4N76 A;  2A3Z A;  2UXC K;  5AQF A;  4A61 A;  2NRH A;  2FSK A;  2YCH A;  4CFD A;  4IFY A;  2D0B A;  4YOR A;  1RDD A;  4DR1 K;  4E0D A;  5DMR A;  2KLA A;  3WXI A;  4DS4 A;  4FJ9 A;  3SPY A;  3THW B;  2A1S A;  4BE2 A;  5C24 A;  1X9J A;  2A40 A;  4YOW A;  3VQB A;  3WNF A;  4MLH A;  3CMA N;  2YKM A;  1B9F A;  2W6L A;  3KJV A;  4DV3 K;  4BR0 A;  2AJQ A;  3E9P A;  4CBW A;  1N34 K;  3M8Q A;  4KTW A;  1YIT N;  2HBL A;  3WXL A;  2G8I A;  3CD6 N;  1P90 A;  3J81 O;  4CHZ A;  4RTF D;  5C25 A;  1NJY A;  5ELZ A;  3WQT A;  2OPS A;  1M1K O;  5HOO A;  4JD2 A;  1VQ4 N;  4FLV A;  2E2N A;  2CGJ A;  1W7A A;  1QE1 A;  1G15 A;  1BHL A;  4BRP A;  5AFU A;  2P51 A;  4CJQ A;  2FBX A;  3PV8 A;  2JLE A;  2FBY A;  3E66 A;  2NRZ A;  2XRI A;  5F0X A;  4BDP A;  2E1Z A;  2FLO A;  2GTD A;  3ZSO A;  3TAN A;  4GKJ K;  3TI0 A;  4FK0 A;  1HKB A;  4B1W B;  2X78 A;  4UQG A;  1BIZ A;  5AZJ B;  3SZ2 A;  1TL1 A;  4WQ4 C;  4DTP A;  3GOI A;  5DM7 L;  4IBN A;  5HBM A;  5SZT A;  3HST B;  4JI0 K;  3OVN A;  1C1C A;  3HXM A;  4FLU A;  1NKC A;  4JI8 K;  3IDH A;  5KGW A;  3MN7 A;  3HVT A;  4LC9 B;  4B3R K;  1NG9 A;  5E41 A;  1YJW N;  4B9Q A;  3T1H K;  1ASU A;  3AVB A;  4I2P A;  2WBN A;  3AAP A;  3VET A;  1NKB A;  3PY8 A;  1CXU A;  1RBR A;  3MN9 A;  3VF4 A;  4FJJ A;  3MX5 A;  1NK6 A;  3SMS A;  3LL3 A;  4FW2 A;  1VSF A;  5GAD P;  5BPM A;  2LSN A;  4CEE A;  4PKI A;  1IKV A;  2DFE A;  5GAH P;  4H5V A;  4YNQ A;  2OA8 A;  3DAW A;  2ZM6 K;  4JKC A;  2V52 B;  4IDK A;  1NJI O;  4CJE A;  4CGG A;  4ILG B;  2E6M A;  3LP1 A;  3O9S A;  3SUN A;  2QKB A;  5MLC Q;  3KVG A;  1NK9 A;  4C8O A;  1WSE A;  3HP9 A;  1S6P A;  4N47 A;  4BDZ A;  4EHT A;  2G8U A;  3DRP A;  4F3T A;  4IG3 A;  3L2U A;  1HMV A;  2ZWH A;  1RDW X;  1T7P A;  5TKY A;  2QA4 N;  1TKT A;  2KZM A;  3DXK B;  4Z4G A;  4LSN A;  3J8A A;  5AQX A;  5EX5 A;  2G8V A;  1U49 A;  5M1N A;  3C6A A;  1NGA A;  5C2F A;  3K9K A;  4DQQ A;  3LP3 A;  4OKK A;  2HNZ A;  3Q7B A;  1J5O A;  1HNV A;  3F9M A;  4KH6 A;  3TSQ A;  3G10 A;  1YF5 L;  3OYC A;  3VF6 A;  3SPZ A;  4EP5 A;  1L3V A;  5CYM A;  4WFN L;  4H0Y B;  1QVF M;  3N4Q A;  1X3N A;  3CET A;  3O1B A;  4NLB A;  5BN9 A;  4YOY A;  4CJF A;  1B92 A;  3HTV A;  5CZ1 A;  2P9N A;  2X6S A;  3CM5 A;  4GVE A;  1NGH A;  4E1J A;  3CF5 L;  3AVK A;  3OYN A;  4CEQ A;  3PIP L;  3DLL L;  4B9N A;  4DSJ A;  5HRS A;  1JLG A;  3CYM A;  4HCB A;  1D5A A;  4DV5 K;  1QVG M;  3EKS A;  1WSI A;  1HYS A;  3QBX A;  3AA5 X;  4DFJ A;  1D4X A;  3LZI A;  4FLT A;  2HB5 A;  1WN7 A;  1JL2 A;  1DGK N;  4O8K A;  4DFK A;  4FWQ A;  1YUW A;  3IMX A;  4JI1 K;  4FOE A;  3CPE A;  1ATN A;  1JLE A;  4CFA A;  5D3G A;  1FXX A;  1HNW K;  1ATR A;  3O08 A;  3O5B A;  3QEX A;  1D9D A;  2WFB A;  4DR7 K;  1SKW A;  3HO1 A;  4DU1 A;  3I33 A;  3VEN A;  3ASM A;  4CJ7 A;  2O8E A;  2JGU A;  1HPM A;  3AY9 A;  1C0U A;  4QS9 A;  4KAZ A;  4FWS A;  3ZYY X;  4KRF A;  3U8X A;  3EYZ A;  1U45 A;  4F8R A;  4YY3 K;  1BI4 B;  2NZT A;  4H5T A;  1XC9 A;  3D2E B;  2Q0R A;  2VG6 A;  3L3U A;  1QHT A;  4M63 C;  3EL2 A;  3WXJ A;  4CZH A;  3OY9 A;  3NGI A;  3KLH A;  1WSH A;  2QWQ A;  4HUE A;  2P9U B;  4BGB A;  3RSE A;  4B3M K;  4LF6 K;  2E5L K;  3CCL N;  4DR2 K;  4C8M A;  1BI4 A;  4K42 A;  1NK8 A;  1N33 K;  3LDQ A;  3EN9 A;  3FLC O;  5JLF A;  3AVL A;  4N5S A;  4DUZ K;  4NB4 A;  4BRO A;  4CES A;  3M5R A;  3HK2 A;  3HZ6 A;  2P9U A;  1GLE G;  2WUS A;  2WC9 A;  2F7T A;  5LY3 A;  3O3F A;  4A62 A;  4QOZ B;  1QQO A;  4G1Q A;  5FRM A;  1TKD A;  4NYF A;  4NCB A;  4OX9 K;  3LDN A;  2ZE2 A;  2OPP A;  3H3N O;  3RR8 A;  3F2K A;  3O3G A;  1K8K A;  4DMN A;  1JKH A;  3J7Z O;  3V81 A;  5LJV A;  2P9P B;  1MWK A;  2VG5 A;  3C65 A;  1Q86 O;  3LAL A;  4FJH A;  5KRS A;  3C94 A;  3DYA A;  3NF9 A;  3CC4 N;  2O8B B;  1YVU A;  1RTD A;  4RWT A;  4IOX A;  3QO9 A;  3L2V A;  1SZ2 A;  4W5O A;  4BR2 A;  4UY8 O;  4FJN A;  5HP1 A;  3A5N C;  3U9Z A;  4FSV A;  5F1X A;  2HVH A;  1QHA A;  1IV0 A;  3TAM A;  4E1N A;  2VG7 A;  4ISG A;  3ZSY A;  1ILY A;  5JMV A;  4M3W A;  4CJP A;  4DTJ A;  3RR7 A;  1KTQ A;  1JLB A;  3DXM A;  5F2R A;  4B9V A;  3B6P A;  1ZBH A;  2QI2 A;  2NRW A;  4KTQ A;  3OYK A;  1KAY A;  1C0M A;  4FWP A;  3AVG A;  3OYJ A;  5FRN A;  4DUY K;  2F4V K;  3CQY A;  4LFB K;  3ULE B;  1VQ7 N;  1X1P A;  1LW2 A;  1KFS A;  1BWF O;  2O8C B;  2I7N A;  3AO4 A;  1IKW A;  2DFF A;  3AV9 A;  4IOA L;  4C8K A;  2HHH K;  3NVK A;  1SUQ A;  5GIO A;  3VEZ A;  4CJ3 A;  3ULE A;  1XQS C;  1RGI A;  2Y1I A;  3SYZ A;  2OYQ A;  2O8C A;  1RT3 A;  4O0I A;  3S3N A;  3WXK A;  4PY5 A;  4FL9 A;  4CEF A;  2HMI A;  4O0J A;  4F3O A;  2OPR A;  3W0L A;  4GV9 A;  1KVA A;  4PKH A;  4CZG A;  3MMV A;  3VQP A;  4F4K A;  1C0F A;  4K0K K;  1OH6 A;  3HOT A;  3JAM O;  1ESV A;  4KHQ A;  3UIQ A;  2O4I A;  4CZL A;  5AJ3 K;  1N6Q A;  1GOB A;  4OPH A;  3CQ8 A;  3SQ0 A;  4FJK A;  4H03 B;  4BRQ A;  2H3G X;  3TAF A;  3DLR A;  2QWM A;  3WQU A;  4J2A A;  4HWI A;  5AQR A;  3KK2 A;  4E7H A;  5BR9 A;  2WOM A;  3R1X A;  2VGM A;  4O4G A;  1RBU A;  1VQ6 N;  3L8B A;  1RTI A;  3LM9 A;  4CED A;  3O3H A;  1RT2 A;  1Q82 O;  5AQV A;  3U9D A;  1BO5 O;  3CCR N;  1ZBL A;  1SKS A;  4IKF A;  3EY1 A;  3NH1 A;  1DLO A;  1VQM N;  4BE0 A;  4Z4E A;  2DY4 A;  1KAZ A;  1R0A A;  4BE1 A;  1X3M A;  1V4T A;  2EHG A;  3OHR A;  4LD0 A;  3PO4 A;  4ID5 A;  2V51 B;  4NLC A;  1I3A A;  4CZK A;  4E19 A;  1HRH A;  3M8R A;  1C0T A;  4R5P A;  3HSC A;  3TTC A;  3EZ5 A;  4OPK A;  1GLA G;  3VF2 A;  2A5X A;  1KQS M;  3VQE A;  4DQP A;  4M3U A;  3HI0 A;  4B9T A;  4FJ8 A;  2D1K A;  4I2Q A;  4KHP K;  4HCC A;  4BC4 A;  1JLC A;  2AP1 A;  4FCY A;  4KH4 A;  5M1K A;  3BP8 A;  3OBY A;  4CD3 A;  1KLN A;  4HUF A;  3SMP A;  4FOI A;  3ZX0 A;  3QEI A;  4FPA A;  1HJR A;  3TAP A;  3OW2 M;  3Q7C A;  2QWP A;  1MA9 B;  4M42 A;  3CCS N;  4NO7 A;  1S6Q A;  4R79 A;  4FXD A;  1TV6 A;  4JHD A;  5AQZ A;  1X9S A;  1TUY A;  5FPE A;  5KPR A;  4CGD A;  5E84 A;  1S1W A;  5AQW A;  4OPA A;  4BRI A;  1E3M A;  5CE3 A;  3P4I A;  4HTU A;  1J53 A;  2Z1H A;  1ZYQ A;  1SL2 A;  3ZEU B;  2EWS A;  4H5W A;  1GLF O;  3LAK A;  3QIP A;  4E7K A;  4W5R A;  1JLQ A;  4JNE A;  2Q36 A;  4CIF A;  3CC7 N;  4WCE L;  3UKU A;  1VK0 A;  3MN6 A;  3CC2 N;  3PX4 A;  1YJ9 N;  4B08 A;  4OLA A;  2D0O A;  2FBT A;  3AVN A;  3ZSZ A;  4DSE A;  3BZC A;  4FJX A;  5AQQ A;  3EE9 A;  1WSF A;  3CIP A;  2EX3 A;  3SK3 A;  4AM6 A;  1NJX A;  4XH1 A;  4FW1 A;  1Z6R A;  3VN5 A;  4X64 K;  4I6M A;  4CHY A;  3QIC A;  3WT0 A;  4LH5 A;  5FPD A;  1T8E A;  2NRR A;  3G25 A;  4PUO A;  4X66 K;  4H4O A;  4JKB A;  3ZSW A;  2JWK A;  2E6L A;  3VER A;  4DQR A;  1N5Y A;  4NCG A;  3KIO A;  4H0V B;  3K5N A;  3CFR A;  1HNI A;  1NMD A;  3CER A;  3T1Y K;  3MWT A;  2VWB A;  4BRK A;  3DLH A;  3KK1 A;  4DKW A;  4GKK K;  2O8D A;  4GMJ B;  4Z94 A;  2F96 A;  4RW6 A;  4FLW A;  3P83 D;  1TGO A;  1DEJ A;  3J80 O;  3QBW A;  1CXQ A;  1SL1 A;  3R8E A;  4BRL A;  4WQ4 A;  3GE1 A;  3KHY A;  4B3T K;  2I7P A;  4FJI A;  4IO8 A;  2ITM A;  1N36 K;  5IWA K;  4CHP A;  4CZM A;  3BUZ B;  3THW A;  4LFC K;  3KD5 E;  2HHU A;  3O8M A;  3R9P A;  3RVC A;  1VQK N;  3E9O A;  1BCM A;  1E4G T;  3NH2 A;  3RMC A;  4DQI A;  4AHU A;  4FM2 A;  3RMB A;  3E01 A;  3KLG A;  1QTM A;  3I8D A;  1FKP A;  3P38 A;  4DTM A;  1SKR A;  4YHH K;  1T6C A;  4CJR A;  1HJO A;  2Z1J A;  4BRM A;  3GDQ A;  1HUX A;  4JI5 K;  2DPN A;  2F8S A;  3AO5 A;  4DFM A;  1W0H A;  4E3S A;  3VMF B;  3VOV A;  2E4L A;  3VES A;  4B1Y B;  4OJR A;  3FZL A;  3QIN A;  3KKS A;  3O9U A;  3A0I X;  4KB0 A;  4JI4 K;  4PQU A;  4KHN A;  2ATQ A;  2PFU A;  2B5J A;  3V1O A;  2P5O A;  1TKZ A;  4FLX A;  5ADX A;  2QWO A;  5J2M A;  1S72 N;  1F21 A;  3QFU A;  4FJG A;  3OTO K;  4EHU A;  1ATS A;  1XNQ K;  4KKO A;  5AZJ A;  2UUA K;  4OKE A;  3QNO A;  1TK5 A;  3C0B A;  1GOC A;  3HM8 A;  4DTX A;  3PO5 A;  1VSD A;  1VQL N;  4BGA A;  1L3T A;  4FK2 A;  4H8K A;  1HQE A;  2D0A A;  4Z4H A;  1KC8 O;  3N4P A;  5JS2 A;  3AA3 A;  2O4G A;  3MAQ A;  3AVA A;  1HNZ K;  2HHV A;  4BQL A;  2YKN A;  4JLH A;  3KK7 A;  4FWL A;  3C7N B;  2OPQ A;  3AVI A;  3O1W A;  3MCP A;  3TAB A;  1LWC A;  2UXD K;  4KTZ A;  1IG9 A;  4CF9 A;  3CJ7 A;  4B9S A;  3ZT1 A;  4B9M A;  2A42 A;  1RDB A;  5EXW A;  3FR0 A;  3L4I A;  4I9L A;  1S9E A;  3TAG A;  2IC3 A;  3C7N A;  4Y1C A;  4KHS A;  3CME N;  1RNH A;  1NK7 A;  2HBK A;  3G6E N;  2DTU A;  1ITG A;  4BWM A;  4CHO A;  2CH6 A;  3I56 N;  4CK3 A;  1OH7 A;  1KRP A;  1NK0 A;  3CJB A;  2QWL A;  2Y1J A;  4AM7 A;  1QSY A;  4CZF A;  1S1V A;  5KPT A;  3QLH A;  1KAX A;  3A8Y A;  1E4F T;  2HHX A;  1RT5 A;  5FPM A;  1UWB A;  4DFP A;  1TVR A;  1HKG A;  4Q0B A;  3ZSX A;  5DM6 L;  4CJV A;  1WB9 A;  5B8H A;  3AA2 A;  4CEC A;  3MEC A;  1NMN A;  3VEY A;  3TPQ A;  3DXK A;  3SJH A;  3CCU N;  5BRD A;  5M1P A;  3JYT A;  4O5F A;  3NGZ A;  3WUH A;  2G8H A;  3L2R A;  1KSP A;  4DB3 A;  4DTS A;  2G8K A;  5GAG P;  2PYJ A;  3WNH A;  1NGC A;  3HP6 A;  1W9H A;  4JS5 A;  4OVL A;  3CCV N;  3RRG A;  4DSI A;  1VQO N;  4RW8 A;  4QCL A;  1VRU A;  4MO5 A;  3OBW A;  1FKO A;  1MDU B;  4YDU C;  5HRR A;  4IJN A;  1JLA A;  3ZT4 A;  3THY B;  3ATU A;  1BIU A;  2QTD A;  2B6A A;  3K59 A;  2F8T A;  4DCH A;  4JN4 A;  4C1N I;  3NAE A;  3EKU A;  2BTF A;  3HRG A;  4CJ4 A;  1X9W A;  3HOS A;  4ILH A;  2KTQ A;  1K6Y A;  2ASO A;  3VA3 A;  3IS9 A;  4BVO A;  2YI1 A;  2NLX A;  4DS5 A;  3ZX2 A;  5C2D A;  3THY A;  3DLG A;  3LPU A;  4FVU A;  1VSH A;  1KXP A;  4DV7 K;  4CFC A;  4LY7 A;  1GLC G;  3V9W A;  4JAX A;  1EKE A;  4AHS A;  4K25 A;  1YIJ N;  4ICL A;  4A59 A;  2HF3 A;  5AQI A;  4XEI A;  1VAZ A;  4I7F A;  4EIA A;  3QET A;  1VSJ A;  4BAC A;  1NNE A;  3TR8 A;  4F9O A;  3K2P A;  4KH5 A;  4B9L A;  4CER A;  4JS4 A;  1A5X A;  1ASW A;  1Y64 A;  4IJA A;  3RMD A;  1LOT B;  4HUG A;  1LAW A;  3OYF A;  4DV2 K;  1WBB A;  4F2S A;  3O9R A;  1NGD A;  1RTH A;  3K57 A;  3T69 A;  3D2E A;  2HHQ A;  4ISE A;  4BRG A;  4M3Z A;  1O13 A;  4CZI A;  3OS0 A;  2E2Q A;  2KFN A;  2ZD1 A;  3AO2 A;  1FK9 A;  1OVY A;  1OH5 A;  4CF1 A;  2UUC K;  2E20 A;  1L5U A;  4GY2 B;  4CBU A;  4KB1 A;  3LP2 A;  3GBT A;  1B9D A;  2FSN A;  2VWJ A;  1WSJ A;  3EZW A;  4E7J A;  3IFR A;  1RCH A;  3QEW A;  1JCG A;  3PX0 A;  5AQN A;  4FWK A;  4IG0 A;  2HHW A;  1P8Z A;  3HL8 A;  3LM2 A;  4BR4 A;  1J6Z A;  1W2B M;  1QSS A;  4OGC A;  3QEP A;  1VSL A;  3P5J A;  3VQ6 A;  1T6D A;  3L3V A;  2P9P A;  1A5V A;  4CZJ A;  3QNN A;  3K5O A;  3NF8 A;  4IFV A;  4C23 A;  2PBD A;  1S1T A;  2O8B A;  2VCP A;  1VSI A;  3K58 A;  4WE1 A;  3KD1 E;  4CGJ A;  3A5M C;  3H6E A;  5CHI A;  4BWJ A;  2IIR A;  4B9U A;  4FLY A;  3MK6 A;  3DJC A;  1UA0 A;  2PZS A;  3L6Q A;  5FDL A;  3KLE A;  1VRT A;  2HBM A;  4DSF A;  3PX6 A;  2VGN A;  3H08 A;  2PAV A;  1NJW A;  3VEO A;  5C0Y A;  4CCH A;  2ITG A;  3SJJ A;  3RRH A;  3SBG A;  4DQS A;  2G8W A;  2BDP A;  1RDA A;  1HYV A;  3L2Q A;  3V9X A;  3MXM A;  1QSL A;  3VEX A;  4BG8 A;  5C15 A;  2B4J A;  4EZ9 A;  3KKR A;  1LWF A;  2Q1N A;  2UYT A;  4ID1 A;  3ENH A;  1K8A O;  2CGL A;  3HPH A;  1XNR K;  1NK5 A;  1YXQ A;  2NUB A;  4M7X A;  4LFA K;  5AFU H;  3PLA A;  3AVH A;  5LMN K;  3FE1 A;  1OKJ A;  4XIU A;  1TK8 A;  4IXC A;  4XH5 A;  3L0Q A;  1NGE A;  4JEP A;  3ID6 A;  3QER A;  1VSK A;  3V6D A;  3J7A P;  3ZCM A;  1IBL K;  3O80 A;  4KI4 A;  3V1Q A;  3NBP A;  4GNI A;  3SLC A;  1Y97 A;  4LF7 K;  2HBJ A;  3VQD A;  4IO9 L;  2D4W A;  4YFU A;  3TAE A;  2D0P A;  3AVC A;  3TWH A;  4KHW A;  2P9K B;  3VGK A;  4LF5 K;  3ZSQ A;  5AQJ A;  4CW7 B;  1QZ6 A;  3SUQ A;  1J9A A;  2ZF5 O;  4MFB A;  1XI1 A;  3V1R A;  3VGM A;  4AIL C;  3LDO A;  4JKF A;  4IOC L;  4FM1 A;  4U67 L;  2KW4 A;  3OYA A;  1NJZ A;  4ELV A;  4JKD A;  1S5J A;  4IDH A;  3JSM A;  4FZZ A;  1CZB A;  3IUC A;  2ZJP L;  2QK9 A;  4BRC A;  4DHY A;  3OYE A;  1VSE A;  4CJW A;  1H1V A;  3AA4 A;  5TKW A;  4FWR A;  1QQC A;  1DKG D;  1M90 O;  4MLE A;  1BL3 A;  2RN2 A;  2RF2 A;  3D2F B;  4FZY A;  4AHR A;  4FWN A;  2XHB A;  2F9W A;  4W5Q A;  1LV5 A;  2ZGY A;  2OZM A;  4CK1 A;  2NRT A;  2UXB K;  5AQS A;  1EO1 A;  1GLD G;  1Z05 A;  3D2F A;  1RBT A;  3OJS A;  4FVM A;  1BA0 A;  1Q18 A;  1ZBF A;  4B1U B;  3ENO A;  4A5A A;  1U2V B;  4BDY A;  4ZTF A;  3THV A;  3CJC A;  3VA0 A;  4DF4 A;  4JI7 K;  1BDG A;  5BRE A;  2QW9 A;  3MX2 A;  4JRP A;  4LF8 K;  1HX1 A;  2KHO A;  1EET A;  3MWP A;  1HYZ A;  2P9L B;  1U2V A;  2WON A;  3HM9 A;  3LP0 A;  2E8A A;  1RDC A;  3AVJ A;  1RDU A;  2ZQB A;  3BF1 A;  5DK5 A;  1EP4 A;  4E7I A;  4FJ5 A;  4FPB A;  4CIE A;  3QEV A;  1D9F A;  4M3Y A;  3MEE A;  4BRE A;  3AAR A;  3SQ1 A;  4JYA K;  2BH1 A;  3BZK A;  4Y0W A;  1BOT O;  3OYB A;  4K41 A;  3T19 A;  5BRF A;  4AHC A;  2HVI A;  3D0P A;  3E1Y A;  1OVQ A;  2YNF A;  4FWM A;  1IJJ A;  2GEM A;  3KZB A;  5AQL A;  1NGF A;  2IVP A;  4CBX A;  3CFO A;  2P5G A;  4DV1 K;  3SV3 A;  3MXI A;  3PSI A;  3MCA B;  3VQ9 A;  5EOY A;  4CVN E;  3O4W A;  2P1J A;  3H1V X;  4CF8 A;  1IKX A;  1BQN A;  2NRV A;  2IGI A;  4RW7 A;  4AF1 A;  1XC3 A;  1VSM A;  4CEB A;  5GIN A;  3ZEU A;  1RTJ A;  5T7B A;  4IZ9 A;  3VTI A;  2PY5 A;  2P9S B;  4CEA A;  3ISN C;  4CF0 A;  1TUU A;  4KO0 A;  4BC2 A;  5AQT A;  2Z1G A;  4HTL A;  5AZI B;  4CZE A;  4B1X B;  2FF6 A;  1Q9Y A;  1XMQ K;  4BQZ A;  4AHT A;  2P9S A;  4DWI A;  3KLI A;  2X6N A;  1HNX K;  1GLB G;  4WF9 L;  1T03 A;  3U4L A;  4CJ5 A;  1X9M A;  4O44 A;  4G9Z A;  4DU4 A;  3ZET B;  1XMO K;  3NHG A;  1MWM A;  4CJL A;  1A5W A;  2OCE A;  4JI6 K;  1T05 A;  3DI6 A;  3V9U A;  3NDK A;  4JKE A;  3OYM A;  4H5R A;  3LAN A;  3CM6 A;  4BC5 A;  3HPO A;  4PHT X;  1W97 L;  3ZET A;  1BG3 A;  1YJN N;  1TAQ A;  2VQF K;  2HMP A;  2FC0 A;  3FGU A;  1NK4 A;  3S9H A;  4DF8 A;  3SAH A;  3H1Q A;  3D45 A;  4CD1 A;  2D5R A;  4FJM A;  5I9E B;  3KWG A;  3NF6 A;  2VWK A;  3LDL A;  3O6W A;  3ALY A;  1U47 A;  5CR4 A;  3VGL A;  1Z26 A;  2I5J A;  1SQK A;  2Z1I A;  1RBS A;  1NKE A;  5LJW A;  1XUP O;  4DTN A;  1UAX A;  1LAV A;  2IAJ A;  4CHN A;  5AR0 A;  3U6F A;  2ZJR L;  5AQG A;  1XWL A;  3SV4 A;  4WQ5 C;  1NM1 A;  2HOE A;  1I94 K;  3CQX A;  1I39 A;  1U48 A;  3HJF A;  3FFI A;  2J4R A;  1IG8 A;  1RBV A;  2A1R A;  3WNE A;  1N32 K;  3BF3 A;  1WSG A;  3HBT A;  3VEW A;  3RMA A;  1UOC A;  1NWK A;  4Z4C A;  4JD2 B;  3PIO L;  1XHX A;  3MDQ A;  1JLF A;  3H45 C;  3V9Z A;  4MDA A;  2HND A;  4W5N A;  3LZJ A;  4KHY A;  1ZC6 A;  3QB0 A;  1EX4 A;  1ZBI A;  5C10 A;  2XY8 A;  3W3D A;  5BRH A;  2W42 A;  5EVZ A;  1VQN N;  2PYL A;  3CI5 A;  3L4Q A;  3NMU A;  3QIO A;  2YHY A;  4CIG A;  3SUO A;  2YJE A;  4KI6 A;  3DOK A;  4NYN A;  2XO7 A;  3AVM A;  3HYF A;  3V9S A;  4CF2 A;  5LMU K;  3RWU A;  1C1B A;  3DWL A;  3WXM B;  1SV5 A;  1YI2 N;  3FZK A;  4RG8 A;  3CCM N;  3T7Z A;  3T3F A;  2G8F A;  2Q3S A;  5CY4 A;  4OPJ A;  4CEO A;  5BPN A;  3NGY A;  3CCE N;  3MN5 A;  4WFB L;  2QKK A;  1S9G A;  4DR3 K;  4F2R A;  3VQ4 A;  1S3X A;  4YOU A;  1LWE A;  3CG7 A;  3BDP A;  1U04 A;  5A2Q O;  2GUP A;  5E26 A;  2XY7 A;  2AA4 A;  3ZX3 A;  4C8N A;  3OYD A;  2JWL A;  3EO3 A;  3M6G A;  3DLE A;  1RT6 A;  5HRO A;  5J1E A;  1R59 O;  3DOL A;  4ISF A;  3TAR A;  3DM2 A;  1RT1 A;  1NGB A;  1V4S A;  1REV A;  4FM0 A;  1Q8I A;  1BUP A;  2QWN A;  1LW0 A;  1FW6 A;  4OGE A;  1DT9 A;  1BIS A;  2DFH A;  3TSP A;  4IEE A;  1O1W A;  3I0R A;  4Z4F A;  3I0S A;  1JCE A;  4DTO A;  4K8Z A;  1QZ5 A;  1Q7Y O;  1WNS A;  3F5T A;  5BPL A;  4IEI A;  3K5L A;  3SUP A;  2HHT A;  4CGF A;  4AHV A;  3THX B;  4H0T B;  4C8L A;  2XY6 A;  4YDU A;  5CYQ A;  4DSL A;  3C6U A;  3NH0 A;  3UKR B;  1HPZ A;  1KLM A;  3HT3 A;  4JI3 K;  4KBO A;  1BA1 A;  1ZBU A;  4NXM K;  5J2P A;  3SQ4 A;  1RT4 A;  2IVN A;  3THX A;  3TAQ A;  2YNG A;  3FZH A;  3F73 A;  2OTJ N;  3OYL A;  2ZGZ A;  3UKR A;  1YVN A;  4M3T A;  2FSJ A;  4M41 A;  1C1A A;  3M1F A;  1VHX A;  4O5B A;  3SAF A;  1GOA A;  4FJL A;  4L8R B;  1KVC A;  1WBD A;  3VTH A;  4KHU A;  2KZZ A;  4I9Q A;  2W41 A;  4BR7 A;  2VYP A;  3E9L A;  5JVG L;  1JXB A;  2KKZ A;  5LL6 Z;  3M8P A;  2BAN A;  2X74 A;  2P9N B;  1S1X A;  3LAM A;  3QDK A;  5M1F A;  5EY4 A;  1WAJ A;  1FJG K;  4B3O A;  2QM1 A;  4C1N K;  4H5N A;  4KV8 A;  5I42 A;  4X62 K;  4DU3 A;  1L3U A;  3B8A X;  5JLH A;  1NBW A;  3LPT A;  4H0O A;  1VQ8 N;  3B6O A;  4BR5 A;  4FJ7 A;  2BGG A;  5FRO A;  4PWD A;  1Z25 A;  4W5T A;  1SL0 A;  3CFP A;  1QQM A;  3IAY A;  4TSX A;  2E88 A;  2KFZ A;  2Q97 A;  1YHQ N;  2YHX A;  4DLG A;  5AQY A;  1TK0 A;  1JL1 A;  4M45 A;  3FZF A;  4Q5V A;  3FFK B;  4B8C A;  3KLF A;  3IKM A;  5HLF A;  2RKI A;  2HST A;  5M1Q A;  4BY9 C;  4A2A A;  2O8E B;  5J2Q A;  1D8Y A;  3ZLJ A;  4JK7 A;  4DR6 K;  3AGK A;  3M3Z A;  1MU2 A;  2YV0 X;  3DRR A;  3K5M A;  1BCO A;  1TYQ B;  4YOX A;  2GX9 A;  3NE6 A;  5SWM A;  1KFD A;  2IS3 A;  1XHZ A;  2ZJQ L;  3NFA A;  3U3G A;  4JKG B;  1HQU A;  2GEL A;  1YT3 A;  4GVM A;  4J2D A;  3RSE B;  5AQH A;  3VQQ A;  1TYQ A;  4MDB A;  4E1M A;  2RHK A;  4CI6 A;  1NGJ A;  4DTR A;  3ITH A;  4EP4 A;  4FK4 A;  4MQ3 A;  4EAH D;  2BE2 A;  3NVM A;  4GV3 A;  1KVB A;  3R3L A;  4CFB A;  1NGI A;  4JKG A;  4CJS A;  4DV6 K;  3LDS A;  3O9Q A;  4V19 S;  5GAE P;  3C6T A;  4RW9 A;  4J2E A;  3P1G A;  1RT7 A;  3ULD A;  4H0X B;  1T3V A;  1TL3 A;  4FYD A;  3O9T A;  4H4M A;  1JXE A;  1K9M O;  2IDO A;  2IOC A;  4J8F A;  2QEX N;  5FPN A;  1K8K B;  1N8R O;  1BGX T;  4M7Y A;  4CHQ A;  4JK9 A;  3A5O C;  1DTQ A;  3TTD A;  1L3S A;  3F9K A;  3ZSV A;  3FZM A;  1Q9X A;  4BRH A;  4YOT A;  1EWQ A;  5KQ8 A;  3OYG A;  4JV5 K;  3H46 O;  2ASP A;  3HPG A;  3IRX A;  3EE8 A;  4B8A B;  1C0G A;  1WAF A;  1T44 A;  4EFH A;  3DMJ A;  1BQM A;  2WTU A;  4X65 K;  5JVH L;  4DR4 K;  2OTL N;  3PSF A;  4IWV A;  1U4B A;  4CJK A;  4M3X A;  5KI6 A;  3CXC M;  4CEZ A;  3M8S A; 
#chains in the Genus database with same CATH homology
 2XY5 A;  1J5O A;  4JRP A;  1HNV A;  4CHP A;  2YHA A;  3G10 A;  1EET A;  3OYC A;  3SPZ A;  1HYZ A;  4EP5 A;  1L3V A;  3KD5 E;  2HHU A;  1RIL A;  4OKJ A;  5CYM A;  4CE9 A;  2WON A;  1BCM A;  3NH2 A;  3RMC A;  4DQI A;  3HM9 A;  3LP0 A;  1RDC A;  3AVJ A;  3LWL A;  2ZQB A;  1IKY A;  2OZS A;  4AHU A;  1B92 A;  4CJF A;  4FM2 A;  5CZ1 A;  5DK5 A;  2X6S A;  3CM5 A;  3RMB A;  3E01 A;  3SCX A;  4DLE A;  3KLG A;  3AVK A;  3OYN A;  4CEQ A;  1EP4 A;  1QTM A;  4O55 A;  4E7I A;  3I8D A;  4FJ5 A;  1FKP A;  4DTM A;  1SKR A;  4CIE A;  3L2W A;  3QEV A;  4B9N A;  1D9F A;  4M3Y A;  3MEE A;  3SQ1 A;  4DSJ A;  5HRS A;  4CJR A;  1JLG A;  2Z1J A;  3CYM A;  3SNN A;  4HCB A;  1D5A A;  3OYB A;  4J2B A;  3T19 A;  4AHC A;  2F8S A;  3AO5 A;  1WSI A;  1HYS A;  3D0P A;  4DFM A;  1W0H A;  2HVI A;  4E3S A;  2YNF A;  3AA5 X;  2E4L A;  4DFJ A;  2YNI A;  4OJR A;  3QIN A;  3LZI A;  2HB5 A;  4FLT A;  1WN7 A;  3KKS A;  1EXQ A;  1JL2 A;  4KB0 A;  3CFO A;  2P5G A;  3VQC A;  3SV3 A;  2ATQ A;  3MXI A;  4KHN A;  2B5J A;  3O4N A;  3V1O A;  4DFK A;  4PQU A;  2P5O A;  3VQ9 A;  1TKZ A;  4FLX A;  4CJU A;  5J2M A;  5D3G A;  1JLE A;  4CFA A;  4N41 A;  1FXX A;  2YNH A;  1J54 A;  3DRS A;  1F21 A;  2P1J A;  3A2F A;  3QEX A;  1D9D A;  4FJG A;  4CF8 A;  1SKW A;  3HO1 A;  1IKX A;  4DU1 A;  5K14 A;  1BQN A;  1UA1 A;  3ASM A;  4CK2 A;  4KKO A;  2GUI A;  2IGI A;  4OKE A;  1S1U A;  4RW7 A;  3V4I A;  2JGU A;  3QNO A;  1TK5 A;  1GOC A;  1VSM A;  4PA1 A;  4CEB A;  1C0U A;  3RTV A;  4DTX A;  3PO5 A;  1VSD A;  4KAZ A;  1TKX A;  4KRF A;  1RTJ A;  1L3T A;  5T7B A;  4FK2 A;  4H8K A;  1HQE A;  2D0A A;  4Z4H A;  2YHB A;  3EYZ A;  1U45 A;  2PY5 A;  5JS2 A;  3AA3 A;  1XC9 A;  1BI4 B;  4F8R A;  2O4G A;  3MAQ A;  3AVA A;  4LSL A;  4CEA A;  2HHV A;  3ISN C;  2VG6 A;  4CF0 A;  1YTA A;  1IH7 A;  3L3U A;  1QHT A;  4KO0 A;  4Y1D A;  2YKN A;  2Z1G A;  4JLH A;  3NGI A;  3OY9 A;  3KLH A;  4EZ6 A;  2OPQ A;  3MXJ A;  3AVI A;  1WSH A;  4HUE A;  1Q9Y A;  3C95 A;  3TAB A;  1ASV A;  1LWC A;  4C8M A;  4AHT A;  3OS1 A;  1BI4 A;  4KTZ A;  4DWI A;  1IG9 A;  4CF9 A;  1NK8 A;  3KLI A;  4CJT A;  3AVL A;  4N5S A;  3ZT1 A;  2X6N A;  4B9S A;  1CZ9 A;  1RDB A;  4B9M A;  4I9L A;  4CES A;  1S9E A;  3TAG A;  1T03 A;  3KTQ A;  2IC3 A;  4Y1C A;  4CGH A;  4CJ5 A;  4O44 A;  3HVR A;  1X9M A;  4KHS A;  1RNH A;  3HK2 A;  4DU4 A;  1NK7 A;  5JS1 A;  3NHG A;  4CJL A;  1ITG A;  2DTU A;  1A5W A;  4BWM A;  4CHO A;  2RPI A;  1T05 A;  1DTT A;  3DI6 A;  3V9U A;  4CK3 A;  3O3F A;  3NDK A;  1KRP A;  4QOZ B;  3OYM A;  4G1Q A;  1NK0 A;  5FRM A;  3LAN A;  3CM6 A;  4E89 A;  4NYF A;  1TKD A;  4NCB A;  2Y1J A;  4DG1 A;  3HPO A;  4E7L A;  4ELU A;  2ZE2 A;  1QSY A;  2OPP A;  3RR8 A;  3O3G A;  1S1V A;  1TAQ A;  1JKH A;  3QLH A;  4DMN A;  3V81 A;  3AVF A;  2FC0 A;  3OS2 A;  1C6V A;  5C42 A;  1NK4 A;  3S9H A;  1YTU A;  2VG5 A;  2HHX A;  4DF8 A;  1RT5 A;  3LAL A;  4FJH A;  3D45 A;  5KRS A;  1UWB A;  3C94 A;  2D5R A;  4DFP A;  1TVR A;  2ETJ A;  3DYA A;  4FJM A;  3NF6 A;  1TAU A;  2VWK A;  3NF9 A;  3BGR A;  3VQA A;  4Q0B A;  1YVU A;  3ZSX A;  3ALY A;  1U47 A;  3MEG A;  3VQ7 A;  1RTD A;  1Z26 A;  2I5J A;  2Z1I A;  1RBS A;  4CJV A;  1NKE A;  3KK3 A;  3QES A;  4ELT A;  3AA2 A;  4CEC A;  3MEC A;  3QO9 A;  2GV9 A;  4DTN A;  1UAX A;  3MED A;  3L2V A;  4W5O A;  1LAV A;  2IAJ A;  4CHN A;  5KTQ A;  3NGZ A;  3JYT A;  3U6F A;  4FJN A;  3SV4 A;  1XWL A;  5HP1 A;  2G8H A;  3L2R A;  1NOY A;  1I39 A;  1U48 A;  3HJF A;  3FFI A;  2HVH A;  1KSP A;  2GBZ A;  3TAM A;  4E1N A;  3OYH A;  2VG7 A;  4DTS A;  1RBV A;  2A1R A;  2G8K A;  3ZSY A;  3IG1 A;  2PYJ A;  3WNH A;  3WNE A;  3HP6 A;  4M3W A;  1W9H A;  4JS5 A;  1WSG A;  3RMA A;  4OVL A;  4DSK A;  2HNY A;  1NOZ A;  4CJP A;  4DTJ A;  4ZTJ A;  3RR7 A;  2QXF A;  1UOC A;  5HRP A;  3RRG A;  4DSI A;  4RW8 A;  4JRQ A;  1KTQ A;  4Z4C A;  4QCL A;  1JLB A;  1VRU A;  4B9V A;  4CGI A;  1FKO A;  4OLB A;  1XHX A;  3B6P A;  1JLF A;  5HRR A;  5I3U A;  1QS4 A;  1JLA A;  3ZT4 A;  1ZBH A;  1BIU A;  4KTQ A;  3OYK A;  3V9Z A;  4W5N A;  2B6A A;  1C0M A;  2HND A;  3K59 A;  3LZJ A;  2F8T A;  4KRE A;  4KHY A;  3DLK A;  3AVG A;  3OYJ A;  3NAE A;  5FRN A;  1EX4 A;  5KRT A;  1ZBI A;  4CJ4 A;  3VQ8 A;  1X9W A;  2XY8 A;  3VQ5 A;  2KTQ A;  1K6Y A;  4KFB A;  3G0Z A;  3ZSR A;  2W42 A;  3VA3 A;  2PYL A;  3IS9 A;  1CLQ A;  3QIO A;  4CIG A;  3SUO A;  1X1P A;  1LW2 A;  3DOK A;  4GW6 A;  4NYN A;  2XO7 A;  4DS5 A;  1KFS A;  3AVM A;  3HYF A;  3V9S A;  4NCA A;  3DLG A;  3LPU A;  4CF2 A;  2FBV A;  3RWU A;  3AO4 A;  1IKW A;  1VSH A;  2DFF A;  3AV9 A;  5HRN A;  2R7Y A;  1C1B A;  4CFC A;  4HVJ A;  4C8K A;  3U3Y A;  4LY7 A;  1SV5 A;  5J2N A;  3S3O A;  1SUQ A;  5CZ2 A;  4RG8 A;  3T1A A;  3OJU A;  3V9W A;  3T3F A;  2G8F A;  2Q3S A;  5CY4 A;  1EKE A;  4AHS A;  4CJ3 A;  4OPJ A;  2Y1I A;  4ICL A;  3WNG A;  3NGY A;  4CEO A;  3NF7 A;  3SYZ A;  4QAG A;  2OYQ A;  2HW3 A;  3ZT3 A;  1RT3 A;  4I7F A;  4O0I A;  3QET A;  3S3N A;  1S9G A;  1VSJ A;  3AO3 A;  4BAC A;  3VQ4 A;  4CEF A;  4N56 A;  2QKK A;  4F2R A;  4PY5 A;  3TR8 A;  4FLZ A;  2HMI A;  4O0J A;  1LWE A;  3CG7 A;  4Z0U A;  4F3O A;  2OPR A;  3K2P A;  3BDP A;  1KVA A;  1U04 A;  4B9L A;  3LWM A;  4CER A;  3VQP A;  4JS4 A;  1A5X A;  4F4K A;  1ASW A;  2XY7 A;  3RMD A;  4C8N A;  3OYD A;  4HUG A;  1LAW A;  3DLE A;  4KHQ A;  1IO2 A;  2D0C A;  1RT6 A;  3OYF A;  5J1E A;  3OYI A;  3SQ2 A;  5HRO A;  3UIQ A;  3DOL A;  2O4I A;  4F2S A;  5KGX A;  3TAR A;  1RTH A;  3DM2 A;  3K57 A;  1N6Q A;  1GOB A;  2HHQ A;  1RT1 A;  3CQ8 A;  3NCI A;  3ZT0 A;  3SQ0 A;  4FJK A;  4HHT A;  1REV A;  4M3Z A;  4FM0 A;  1Q8I A;  3TAF A;  3OS0 A;  2KFN A;  2ZD1 A;  3AO2 A;  3DLR A;  4AH9 A;  3DLB A;  1LW0 A;  1FK9 A;  4OGE A;  4RW4 A;  4CF1 A;  4J2A A;  1L5U A;  3KK2 A;  1BIS A;  4E7H A;  4DTU A;  2DFH A;  2WOM A;  1O1W A;  3PUF A;  4Z4I A;  3I0R A;  4O4G A;  4K8X A;  1RBU A;  3I0S A;  4Z4F A;  4DTO A;  4K8Z A;  4KB1 A;  3L8B A;  1WNS A;  1RTI A;  3LP2 A;  4CED A;  1B9D A;  3K5L A;  4ZHR A;  3O3H A;  3SUP A;  1RT2 A;  4FZX C;  5EU7 A;  2HHT A;  1SKS A;  1ZBL A;  4LH4 A;  4IKF A;  4CGF A;  4AHV A;  3EY1 A;  1WSJ A;  3NH1 A;  1DLO A;  2VWJ A;  4BE0 A;  4E7J A;  1RCH A;  3QEW A;  4Z4E A;  2DY4 A;  4M3R A;  4C8L A;  2XY6 A;  3AO1 A;  1R0A A;  4BE1 A;  3PX0 A;  5CYQ A;  4DSL A;  3C6U A;  3NH0 A;  3S3M A;  2EHG A;  4IG0 A;  1HPZ A;  2HHW A;  1KLM A;  3O4Q A;  3HT3 A;  3HL8 A;  1KCF A;  2HHS A;  1WLJ A;  4LD0 A;  3PO4 A;  4ID5 A;  2KQ2 A;  1QSS A;  4KPY A;  1ZBU A;  4OGC A;  3QEP A;  1I3A A;  3SI6 A;  1VSL A;  3P5J A;  3VQ6 A;  1RT4 A;  4E19 A;  5J2P A;  1HRH A;  3ZT2 A;  3SQ4 A;  3M8R A;  4N76 A;  3L3V A;  1C0T A;  4R5P A;  3EZ5 A;  3TAQ A;  2YNG A;  4OPK A;  3F73 A;  4CFD A;  1A5V A;  4IFY A;  2D0B A;  1RDD A;  3OYL A;  4E0D A;  3QNN A;  5DMR A;  4M3T A;  3VQE A;  3K5O A;  3NF8 A;  1C1A A;  4IFV A;  4M41 A;  4DQP A;  4M3U A;  4O5B A;  4DS4 A;  4B9T A;  1GOA A;  1S1T A;  4FJL A;  1KVC A;  4L8R B;  4FJ8 A;  4FJ9 A;  4KHU A;  4I9Q A;  2KZZ A;  3SPY A;  4I2Q A;  1VSI A;  2A1S A;  4BE2 A;  3K58 A;  4HCC A;  5C24 A;  4WE1 A;  3KD1 E;  1JLC A;  3VQB A;  1JXB A;  4CGJ A;  3WNF A;  3M8P A;  2BAN A;  4FCY A;  2X74 A;  2YKM A;  1B9F A;  3KJV A;  1KLN A;  4BWJ A;  4HUF A;  1S1X A;  3LAM A;  4B9U A;  2AJQ A;  4FLY A;  1WAJ A;  3M8Q A;  4KTW A;  4B3O A;  3QEI A;  1UA0 A;  2PZS A;  2G8I A;  5FDL A;  1HJR A;  4KV8 A;  4DU3 A;  5I42 A;  3KLE A;  3TAP A;  1L3U A;  4CHZ A;  1VRT A;  4DSF A;  5C25 A;  1NJY A;  3LPT A;  3PX6 A;  4M42 A;  3H08 A;  2OPS A;  4FJ7 A;  3B6O A;  1NJW A;  2BGG A;  5FRO A;  4CCH A;  2ITG A;  3SJJ A;  1S6Q A;  4PWD A;  1Z25 A;  3RRH A;  4W5T A;  4FXD A;  1TV6 A;  4DQS A;  1SL0 A;  2G8W A;  1RDA A;  1HYV A;  3CFP A;  3L2Q A;  3V9X A;  3MXM A;  4FLV A;  1QSL A;  2BDP A;  3IAY A;  4TSX A;  2KFZ A;  2B4J A;  1QE1 A;  1G15 A;  1BHL A;  4EZ9 A;  2P51 A;  3KKR A;  4CJQ A;  1LWF A;  2FBX A;  3PV8 A;  1X9S A;  2JLE A;  2FBY A;  4DLG A;  4CGD A;  4ID1 A;  1TK0 A;  1JL1 A;  2XRI A;  4BDP A;  3ZSO A;  4M45 A;  3TAN A;  1S1W A;  4Q5V A;  3HPH A;  3TI0 A;  4FK0 A;  1NK5 A;  4B8C A;  3KLF A;  2X78 A;  4UQG A;  2NUB A;  2RKI A;  5HLF A;  1BIZ A;  3SZ2 A;  3AVH A;  1TL1 A;  5J2Q A;  1D8Y A;  4DTP A;  4XIU A;  4HTU A;  1TK8 A;  1J53 A;  2Z1H A;  1ZYQ A;  1SL2 A;  1MU2 A;  2YV0 X;  4IBN A;  3DRR A;  5HBM A;  3K5M A;  3LAK A;  5SZT A;  1BCO A;  1VSK A;  3HST B;  3QIP A;  3QER A;  4E7K A;  3OVN A;  3NE6 A;  1C1C A;  5SWM A;  4W5R A;  3HXM A;  1KFD A;  2IS3 A;  4FLU A;  3V6D A;  1XHZ A;  1JLQ A;  1NKC A;  3ZCM A;  4CIF A;  3NFA A;  5KGW A;  4KI4 A;  3HVT A;  3V1Q A;  3NBP A;  1VK0 A;  3U3G A;  1HQU A;  1Y97 A;  3VQD A;  3TAE A;  3PX4 A;  5E41 A;  4YFU A;  1YT3 A;  4B08 A;  4GVM A;  4OLA A;  4J2D A;  3AVC A;  1ASU A;  3TWH A;  2FBT A;  3AVN A;  4KHW A;  3VQQ A;  4E1M A;  3AVB A;  4I2P A;  3ZSZ A;  4DTR A;  3ITH A;  4DSE A;  4EP4 A;  3ZSQ A;  4FJX A;  4FK4 A;  4MQ3 A;  1WSF A;  2BE2 A;  2EX3 A;  3SUQ A;  1J9A A;  1KVB A;  4MFB A;  1XI1 A;  3V1R A;  4AIL C;  4CFB A;  1CXU A;  1RBR A;  1NKB A;  3PY8 A;  4CJS A;  1NJX A;  3LDS A;  4FJJ A;  4FW1 A;  3C6T A;  4RW9 A;  1NK6 A;  4FW2 A;  4FM1 A;  1VSF A;  3VN5 A;  4J2E A;  2LSN A;  4CHY A;  2KW4 A;  3P1G A;  4CEE A;  1RT7 A;  3OYA A;  3ULD A;  1IKV A;  1NJZ A;  1TL3 A;  2DFE A;  4ELV A;  4FYD A;  4LH5 A;  3JSM A;  1S5J A;  4H4M A;  4FZZ A;  1JXE A;  1T8E A;  1CZB A;  2IDO A;  4YNQ A;  2IOC A;  2QK9 A;  2OA8 A;  3OYE A;  1VSE A;  4PUO A;  4CJW A;  4IDK A;  3AA4 A;  4H4O A;  3ZSW A;  2E6L A;  4CJE A;  4DQR A;  4CGG A;  1QQC A;  2E6M A;  1BGX T;  3LP1 A;  1N5Y A;  4CHQ A;  1BL3 A;  4NCG A;  3SUN A;  1DTQ A;  2QKB A;  2RN2 A;  2RF2 A;  3KIO A;  4FZY A;  4AHR A;  3K5N A;  3CFR A;  2XHB A;  1NK9 A;  4C8O A;  1HNI A;  1WSE A;  3HP9 A;  1L3S A;  1S6P A;  4N47 A;  4W5Q A;  4BDZ A;  2G8U A;  3F9K A;  1LV5 A;  3ZSV A;  2OZM A;  3DRP A;  4CK1 A;  3DLH A;  4F3T A;  1Q9X A;  3KK1 A;  4IG3 A;  4GMJ B;  3OYG A;  3L2U A;  1HMV A;  3HPG A;  3IRX A;  4KI6 A;  4B8A B;  1T7P A;  2F96 A;  4RW6 A;  1RBT A;  3OJS A;  1TKT A;  4FLW A;  3P83 D;  4FVM A;  1WAF A;  1ZBF A;  2KZM A;  1TGO A;  4Z4G A;  3DMJ A;  1BQM A;  4LSN A;  1CXQ A;  1SL1 A;  2G8V A;  4BDY A;  4ZTF A;  1U49 A;  3THV A;  1U4B A;  4CJK A;  3VA0 A;  4M3X A;  5KI6 A;  4DF4 A;  4FJI A;  4DQQ A;  3LP3 A;  4OKK A;  2HNZ A;  4CEZ A;  3M8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...