3AVBA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avbA00
1D9FA 4FLUA 3VQ4A 2EHGA 1WSEA 3LPTA 4CGHA 4C8OA 1NKBA 1NJWA 3HPHA 4EP5A 1RBSA 4FJKA 1TV6A 3QESA 1GOAA 4CJKA 3VQQA 3DRRA 4AH9A 4ICLA 3OYMA 1UAXA 1Z26A 1B9DA 1RT6A 3V81A 4KI6A 4J2BA 2XHBA 4CHPA 3CFRA 3SYZA 2G8HA 1B92A 1XC9A 1C1AA 1X1PA 3ZCMA 4EZ6A 1TL1A 1C0MA 2ITGA 2Z1JA 4CJ3A 4DQQA 4M42A 3AA4A 4OVLA 5FROA 3K57A 3L8BA 1S1XA 5FRMA 3OYFA 2HHVA 3V1QA 4DFKA 4FJHA 4BACA 1WSJA 3IRXA 4DS4A 2KW4A 4CHYA 2PYJA 1RDDA 4ID1A 2OYQA 1JXEA 1D9DA 3TR8A 4JRPA 1RDAA 3ISNC 3SPZA 4CGDA 4W5RA 3U3YA 1TK0A 4HCBA 1CZ9A 1CZBA 1NK0A 1RTJA 1KFDA 3DI6A 1HNVA 3HPGA 1W0HA 4O0JA 3AVIA 3ZT1A 4E7HA 1ZBIA 1N5YA 4QCLA 4RG8A 3O4QA 1EKEA 3B6OA 3LP1A 1RBTA 3VA0A 4DTJA 4Z4GA 3CFPA 4Z0UA 2W42A 4BE0A 1RTDA 2OPQA 3PX4A 4EZ9A 5FRNA 1C1BA 3V9XA 2F8TA 1EP4A 5I3UA 4OKKA 3VQ5A 4I9QA 1VSFA 1TKXA 1NJZA 2HNYA 2OPPA 1HMVA 3AA3A 3DM2A 3MXIA 1T03A 1EETA 2HHWA 4FK2A 3LWLA 1HQEA 3ZT3A 1RILA 1UWBA 1WSHA 2IOCA 2RPIA 3B6PA 3HM9A 4BE1A 4KHQA 3HO1A 1RT1A 3ALYA 3L2WA 3C94A 4CIFA 2R7YA 1GOBA 1TVRA 1S5JA 3ZSXA 4KHSA 4DSEA 4OGEA 3LP2A 1FKPA 1JXBA 1J53A 3TABA 3HVTA 4DTRA 1SV5A 1BIZA 2VG7A 5SWMA 1NJYA 3PO4A 4CF9A 1KVAA 3S3NA 3SUNA 4CEFA 1W9HA 4FK4A 1K6YA 2KZMA 1IO2A 3VQ9A 2BE2A 4ELVA 4DSJA 1TK5A 1BI4A 2P51A 3LAMA 1NK6A 2KZZA 1S1VA 1I3AA 3RTVA 4OJRA 4DSIA 1VSDA 1G15A 1LWFA 1MU2A 2ATQA 3O3HA 2VWJA 2HVHA 3PX0A 3O3GA 4FLWA 1KFSA 3F73A 2DTUA 4O0IA 4FJ8A 3TARA 1KLNA 4CK3A 5HRNA 1L5UA 1LAWA 3SV3A 3DLRA 1NKCA 3OYBA 4DQIA 2GV9A 3S9HA 4J2AA 1WLJA 4DMNA 3AO2A 4CFCA 4CGIA 4B8AB 2IGIA 4CEZA 4XIUA 3V4IA 3SCXA 3WNGA 3LWMA 4Q0BA 4YFUA 4E0DA 4DWIA 3VQBA 4HUEA 4M3RA 4H4MA 4I7FA 4BDZA 1Q9XA 2G8WA 4FJMA 1C0UA 4OPKA 4Z4HA 4O5BA 2QKBA 4M3UA 1BI4B 4CEEA 3RMDA 4RW8A 5HROA 1C1CA 1FXXA 3P1GA 5DK5A 3ZSZA 1LW0A 3KLIA 3HVRA 1JLQA 3LANA 1RT5A 4BWMA 4E7IA 4OLBA 1RT2A 2VG6A 2Y1JA 3QO9A 4TSXA 5JS2A 3NF9A 3VQAA 4CEQA 1VSIA 1IKVA 1KVBA 1WAJA 4FW2A 3CFOA 3OS0A 4E7LA 4NYFA 3V6DA 1NOYA 1L3TA 4B9MA 3CG7A 4KKOA 3NH1A 3PY8A 3SI6A 1RTHA 3O4NA 3TAPA 4B9UA 1L3SA 3S3MA 4DTOA 3OYJA 3K5LA 4KRFA 4DSFA 3P5JA 2X74A 3MEGA 4YNQA 3AO3A 4CERA 1Q9YA 4FJ7A 3UIQA 4B3OA 4B8CA 1JLCA 2D5RA 3PO5A 4KPYA 4C8NA 4DS5A 1WSGA 1YT3A 4N41A 3RRGA 3QLHA 2IDOA 3HK2A 2OPSA 1J5OA 4FLVA 3IG1A 4B9VA 4FVMA 3SNNA 4N47A 1DTTA 3VQEA 4DF8A 4QAGA 4FLYA 3D45A 4DTXA 2IAJA 1JLGA 1U04A 4CE9A 3ULDA 2OZMA 4CFBA 3MAQA 1RDBA 5CYMA 2FC0A 1JL1A 3CM6A 4DTNA 4AHRA 3P83D 3M8QA 1HJRA 5CYQA 4OLAA 1REVA 3G0ZA 4KTWA 3OYHA 1A5VA 2G8IA 5KGXA 1TL3A 3AO4A 3ZT4A 4CJQA 3KK2A 4C8MA 1ASWA 1JLBA 4CHZA 1KVCA 3FFIA 2G8FA 4DQPA 3TAGA 1BIUA 2XRIA 2HHUA 4Y1DA 3LZJA 4CIEA 4KREA 4FYDA 3THVA 4NCAA 1TKZA 4CJTA 1XHXA 2Z1GA 2VWKA 1HNIA 1RBVA 1WN7A 4CF2A 3QEWA 1KCFA 4G1QA 3M8PA 1ZBUA 4BDPA 4ELUA 1U4BA 1S1WA 3DLGA 3M8RA 2KFZA 4DLEA 2YHBA 3BDPA 3ASMA 3CYMA 5J2MA 1NKEA 2OA8A 1LAVA 3NH0A 4KHNA 3HT3A 4F3OA 1HRHA 1VRUA 4J2DA 2DFFA 5HRRA 2X6NA 3TAEA 2O4GA 1ITGA 2NUBA 5KGWA 4FJLA 2WOMA 1VSLA 3MEEA 4F8RA 1UA0A 2BANA 3VQCA 2X6SA 3RMBA 4OPJA 3EY1A 3OYGA 1QSYA 1RBRA 1RCHA 1SL0A 1JL2A 3DLKA 3AV9A 4GMJB 1ZBHA 2RN2A 2DFHA 3SUOA 1ZBLA 2OZSA 3OYNA 1Z25A 5K14A 1S9GA 3DYAA 4CJ4A 2B5JA 1YVUA 3KK1A 4BE2A 2RF2A 4M3TA 4AHTA 1QQCA 3DOKA 3QIPA 4M3XA 3L2VA 4KTQA 5T7BA 1KTQA 4CECA 4FJXA 1ZYQA 3AVBA 1U48A 2ZD1A 3MXMA 3SV4A 4CJVA 2QKKA 3SUQA 2P5GA 3NHGA 5KRSA 1RT3A 4KO0A 3SPYA 4F2SA 4CGFA 1NJXA 3SJJA 1QTMA 5J2PA 4LY7A 2B4JA 5KI6A 3OYLA 3LP0A 4Z4EA 3K5NA 2HHTA 1BISA 3LZIA 3C6TA 2LSNA 4ID5A 3ITHA 4CJUA 1I39A 3HP6A 4FZXC 4DFMA 1CLQA 1ASVA 4L8RB 1HYSA 3K5MA 4HCCA 3HYFA 3QERA 1VSMA 3I0RA 3KD5E 4H8KA 4BDYA 3VQPA 3HJFA 4J2EA 1IKXA 4B9NA 5C24A 4I2PA 3QINA 1BCMA 4FW1A 4M3YA 5FDLA 4QOZB 1KSPA 1JLAA 2YKMA 4MFBA 3CM5A 3BGRA 3L2UA 3QEVA 2BDPA 3DRPA 2XY7A 4E1MA 5SZTA 2DFEA 1VRTA 4CF1A 1NK9A 1S1UA 3NGYA 4Y1CA 3TAQA 4LSNA 4AHUA 3NF7A 4CJWA 4KHWA 3DOLA 5HRPA 4W5QA 2HVIA 3RWUA 3KJVA 2YV0X 1SKSA 3OYCA 1L3UA 2FBTA 3RRHA 3AVMA 4I9LA 1R0AA 4C8LA 3SZ2A 1L3VA 3LPUA 4HHTA 1BHLA 3NGZA 3OYAA 2E6MA 1BCOA 1F21A 3ZSRA 4OKEA 4CESA 3TI0A 2D0BA 3NFAA 4CHQA 2XO7A 3M8SA 3NF8A 3I0SA 4IG0A 4AHCA 4B9SA 4N56A 4M41A 4CIGA 4CFAA 4CJEA 4DTUA 3VQ8A 3JSMA 3NBPA 1CXUA 4B08A 3MEDA 2ETJA 4FLXA 4NYNA 1WNSA 3AVAA 4R5PA 4HVJA 1O1WA 3HP9A 5HRSA 3OYKA 4CEDA 5KRTA 4DFJA 2QK9A 3E01A 1XHZA 2B6AA 3SQ2A 2O4IA 2FBYA 4DTSA 4DSLA 4K8ZA 4C8KA 3V1OA 3TAFA 1VSHA 4OKJA 1U47A 3ZSQA 2HB5A 1JLEA 5EU7A 2JLEA 4KFBA 3OJUA 3ZSOA 4LH4A 1U49A 4E89A 1RBUA 4HUFA 1S6PA 1VSJA 1UOCA 3PV8A 2AJQA 3KKSA 3KLFA 2KFNA 1DTQA 1T05A 2G8VA 2HNDA 1X9MA 3DLHA 4BWJA 4CK2A 1LW2A 2Z1IA 3OYIA 5KTQA 3V9SA 3OYEA 4LD0A 3VQDA 4OGCA 2YNGA 3AO1A 4W5TA 1EXQA 4EP4A 1Q8IA 5HBMA 4KV8A 3NGIA 4Z4FA 4AHSA 4JS5A 3DLEA 2E6LA 3KKRA 3PUFA 4PY5A 3T3FA 5C42A 2EX3A 3IS9A 3L2RA 3QETA 2PY5A 1A5XA 4CJ5A 2PYLA 3HXMA 4NCGA 1HYVA 4DSKA 4DTMA 3C6UA 1YTUA 4KB1A 3QEIA 4CF8A 4ZHRA 3MXJA 1QSLA 3T19A 2ZQBA 3NAEA 5J1EA 1X9WA 3S3OA 4CJRA 2XY5A 1IG9A 3VQ7A 1J54A 4O44A 3WNHA 3K59A 2IS3A 3U6FA 3ZSYA 1NK8A 2BGGA 4W5NA 4DF4A 3LAKA 4GVMA 3NDKA 4PWDA 4RW9A 2IC3A 1IH7A 1S1TA 3ZT2A 4Z4IA 5CY4A 3OYDA 4FLZA 2KTQA 1HQUA 3AO5A 3V1RA 1TAUA 1TKTA 4DFPA 1SKWA 5E41A 2PZSA 1FK9A 2FBXA 4IG3A 3SQ1A 4FJGA 3NF6A 4HTUA 3MECA 4IFVA 3RMAA 2G8KA 3PX6A 3KTQA 2QXFA 3OJSA 4KHYA 5CZ1A 2JGUA 3AVNA 3WNFA 2A1SA 3T1AA 4E1NA 3KLHA 2YNHA 2RKIA 3EZ5A 4HUGA 2G8UA 4DU3A 4JS4A 1VSKA 2YHAA 4DLGA 1QS4A 3KLGA 4ZTFA 1DLOA 3AVKA 4CEOA 1IKWA 4FJ5A 3L3UA 3AVHA 2VG5A 4CHNA 4CGGA 3D0PA 1RT4A 3KK3A 2F8SA 3LP3A 1NOZA 4B9LA 4KI4A 4M3ZA 2ZE2A 3NH2A 1C0TA 3AVLA 4FXDA 4DU1A 5HP1A 1RT7A 3SQ0A 1N6QA 2A1RA 3KD1E 1CXQA 3SUPA 1WAFA 4KTZA 4O55A 2GBZA 4FJJA 2P5OA 2YNIA 4FCYA 4KHUA 1XWLA 2GUIA 3ZSVA 5DMRA 3OS1A 1VSEA 3QEXA 4GW6A 3IAYA 4CK1A 3QIOA 1TK8A 3K5OA 4FJNA 4E19A 2Y1IA 3I8DA 1C6VA 1VK0A 3K58A 4N76A 2E4LA 4CFDA 2YKNA 4AILC 1NK7A 3U3GA 3AA2A 2HHQA 3V9WA 2HMIA 2DY4A 4RW4A 2X78A 1S6QA 4UQGA 4KB0A 5JS1A 3L3VA 1A5WA 5I42A 3JYTA 4CEBA 4MQ3A 3A2FA 3L2QA 2XY8A 2XY6A 1IKYA 1RTIA 1U45A 1X9SA 4I2QA 4N5SA 1SKRA 1WSFA 4CHOA 4CCHA 4CJLA 4E7JA 1B9FA 4ZTJA 4DQSA 4ELTA 1LWCA 5J2QA 3V9UA 3H08A 2OPRA 4F3TA 1GOCA 4DTPA 1KLMA 4CJFA 3RMCA 4F2RA 1SL2A 4IBNA 3DRSA 3TWHA 3VQ6A 5HLFA 1SL1A 1RNHA 2YNFA 1QHTA 1UA1A 1BQNA 2Q3SA 1TAQA 2HHXA 4CJSA 4CEAA 3OY9A 4LSLA 4Q5VA 4K8XA 5J2NA 1T8EA 1T7PA 4CF0A 4DU4A 3F9KA 4NCBA 3K2PA 1QSSA 3VN5A 3QNNA 3RR8A 1WSIA 1YTAA 3HPOA 3AA5X 3KLEA 2F96A 4RW6A 1ZBFA 4CGJA 4M3WA 4B9TA 3AVGA 1TKDA 3ZT0A 3G10A 3DLBA 1JKHA 2FBVA 4FZYA 1BGXT 3VA3A 5C25A 3NE6A 4RW7A 4FK0A 3AVJA 4Z4CA 3CQ8A 4E3SA 3AVCA 1KRPA 2KQ2A 4LH5A 3V9ZA 4F4KA 1ASUA 2WONA 3ZSWA 3OS2A 5D3GA 4DQRA 3TANA 1FKOA 4WE1A 3EYZA 1S9EA 4FM2A 1LV5A 3RR7A 1QE1A 3AVFA 3HSTB 4IDKA 4JLHA 1BQMA 2P1JA 3O3FA 3NCIA 4FJ9A 1NK4A 3HL8A 4FM0A 4FLTA 4IKFA 2D0AA 1XI1A 4KAZA 3QNOA 4FM1A 3LALA 1RDCA 1Y97A 1HPZA 4E7KA 4FJIA 4PQUA 1BL3A 2HHSA 3LDSA 3SQ4A 4IFYA 1HYZA 1EX4A 2HW3A 4FZZA 1NK5A 5CZ2A 4CJPA 2I5JA 4PUOA 1D5AA 1D8YA 3TAMA 2D0CA 1TGOA 3KIOA 2HNZA 3QEPA 3WNEA 4M45A 1SUQA 4DG1A 4JRQA 3DMJA 3OVNA 1J9AA 3C95A 4O4GA 4AHVA 4W5OA 2Z1HA 4H4OA 1LWEA 4PA1A 1JLFA
chains in the Genus database with same CATH superfamily
1D9FA 3QFPA 3LPTA 3ZEUB 2UXDK 4EP5A 1RBSA 2VWBA 1TV6A 3QESA 3HI0A 4CJKA 4AH9A 1B9DA 2XHBA 3CFRA 2NRHA 2UU9K 2HF4A 1C1AA 3U9DA 1VQ4N 3ZCMA 4EZ6A 1TL1A 2ITGA 4CJ3A 3R6MA 3I56N 3L8BA 2HHVA 1WSJA 4IOXA 4CHYA 2KLAA 4ID1A 3UKUB 4BRFA 3WEEA 3TR8A 4CGDA 4WQ4A 2PAVA 1W0HA 4IJAA 4O0JA 1ZBIA 5AQHA 4E7HA 1EKEA 1RBTA 3VF4A 2QXLA 1C0GA 3CFPA 3PIOL 1K9MO 1BA0A 5FRNA 1DKGD 4OPAA 2GEMA 3MCAB 4OKKA 1NJZA 2YX6A 2HHWA 3ZT3A 1RILA 4KHQA 3ALYA 3L2WA 3ZSXA 5AQUA 4GVEA 3LP2A 1FKPA 1SAZA 4DTRA 1YAGA 5LJWA 4CF9A 4JEPA 4CEFA 4JKCA 4FK4A 2KZMA 3VQ9A 2BE2A 4DSJA 5KPRA 3HTVA 4GV3A 3I8BA 2ATQA 2HVHA 2DTUA 3PX0A 3HBTA 1KFSA 4O0IA 1KLNA 4H5NA 5HRNA 3P4IA 5AQMA 3S9HA 3AO2A 4CFCA 4CGIA 3FE1A 3D6RA 3VEXA 5C2DA 4E0DA 4PL7A 3EEQA 2EWSA 4H4MA 2G8WA 4FJMA 1NG9A 2VQFK 1BWFO 4XEIA 3C6AA 2ASOA 5HROA 3KLIA 4DV5K 3LANA 1NNEA 2OCEA 2Y1JA 3QO9A 5JS2A 4CBWA 1YVNA 1VSIA 5AQQA 4B3RK 5BREA 2E1YA 1NOYA 4LF7K 4KKOA 3VGMA 3D2FA 3NH1A 1RTHA 3O4NA 3JAMO 4B9UA 3S3MA 4DTOA 1KC8O 3P5JA 2X74A 5E84A 4YNQA 4CERA 4RCHA 3PO5A 4C8NA 3ZEUA 3HK2A 3DLLL 2OPSA 4ILGB 1V4SA 4FLVA 3T1HK 4FVMA 4BRMA 1DTTA 4O8UA 3VQEA 4PHTX 4E1JA 4FLYA 3D45A 4DTXA 1JLGA 2OZMA 3CIPA 5CYMA 1E3MA 1JL1A 4DTNA 2ZGYA 4LF8K 1REVA 5CE3A 2G8IA 5KGXA 1TL3A 3ZX0A 4CD3A 1Q7YO 1JLBA 4FWSA 1KVCA 3FFIA 2O8CB 4CZJA 1EWRA 2AP1A 2HHUA 4Y1DA 3GOIA 1TKZA 3TTFA 4EHUA 1RBVA 3M8PA 1ZBUA 1U4BA 1S1WA 2YHWA 1KXPA 3WXIA 3BDPA 5EY4A 1LAVA 3NH0A 4J2DA 3RSEA 5HRRA 3THYA 3TAEA 2NUBA 1BA1A 4F8RA 4CBXA 1JCEA 5BRDA 4FOIA 4DR1K 5AQIA 3H3OB 3AV9A 2ZJRL 2F9WA 3SLCA 4DR5K 4DV3K 5K14A 3ENOA 3ATVA 3KK1A 4BE2A 5CR4A 3CCRN 4M3XA 2P9KA 2WUSA 4KTQA 5AQVA 2A5XA 4ISEA 4U67L 4DV7K 3SV4A 4YDUC 5KRSA 4KO0A 4F2SA 1N36K 2GUPA 3O1BA 1QTMA 3CC7N 4K42A 4LY7A 5KI6A 3OYLA 3LP0A 4H0XB 2ITMA 4JI0K 1I39A 4WYBA 4FZXC 4DFMA 1XC3A 4JI5K 5KQ8A 1ZC6A 1YJ9N 4H8KA 3HJFA 3CCVN 1GLEG 2E1ZA 1XUPO 2O8FA 1JLAA 4MFBA 3CM5A 3QEVA 4B9QA 2XY7A 4FSVA 4MO4A 2DFEA 4CF1A 3CETA 4B3MK 4KHWA 4FWKA 3DOLA 2YV0X 1L3UA 1R0AA 4HHTA 1BHLA 1D4XA 1BCOA 3TI0A 3KVGA 3T1YK 2HBMA 5IWAK 3RR8A 3NF8A 4IG0A 4N56A 5ADXA 3VQ8A 4FLXA 1O1WA 1TYQA 3DWLA 3O08A 5M1PA 4JI1K 4CEDA 3OYKA 2QI2A 4DFJA 2QK9A 4OO1J 2O4IA 2BH1A 3TAFA 3I55N 1G99A 1U47A 4HUFA 1RBUA 3PV8A 1S6PA 4YOWA 4JNEA 4JN4A 3KLFA 2KFNA 1X9MA 4JKAA 2A42A 4FWRA 3QDKA 3VGLA 4A62A 3V9SA 1TUYA 2ZM6K 3AO1A 3D2EA 2J4RA 2D0PA 1X3NA 3NGIA 4Z4FA 1Y64A 2E6LA 3GL1A 3PUFA 2EX3A 3QETA 3ZYYX 2PYLA 4NCGA 3C6UA 1QQOA 3HOSA 1YTUA 1TUUA 4JHDA 3QEIA 2ASMA 1QSLA 3WQTA 3T19A 5J1EA 3J7ZO 4DUZK 4O44A 4FOEA 1NK8A 3ZSYA 3LAKA 5JLFA 4RW9A 5EXWA 1S1TA 1YUWA 2ZF5O 3A5MC 3ZT2A 3OYDA 1TAUA 4DFPA 1SKWA 2PZSA 1FK9A 1EO1A 5BPMA 3MECA 3RMAA 4KHYA 2JGUA 2YNHA 2GTDA 1QZ5A 4JS4A 1VSKA 3O9RA 4OPHA 4LF4K 1IKWA 1KAXA 1QQNA 2VG5A 2D1KA 4M7XA 2F8SA 4C23A 3NH2A 4FXDA 2QWLA 5HP1A 1RT7A 3SQ0A 1N6QA 1CXQA 3SUPA 4G9ZA 4FJJA 2YNIA 3CC2N 1EWQA 4KHUA 1CZAN 2O8EA 2GUIA 3WUHA 1NWKA 4GW6A 3QIOA 4A2AA 3VERA 1ZXOA 1TK8A 4E19A 2E4LA 4AILC 2YKNA 2F9TA 1S6QA 5JS1A 3L3VA 5I42A 3A2FA 3L2QA 2XY6A 1X9SA 1WOQA 4CHOA 3FZKA 3ULEB 5E26A 1HNXK 4ELTA 2QM1A 5J2QA 2HBJA 2VQEK 3V9UA 2OPRA 1HLUA 5MLCQ 4YDUA 1SL2A 2VGMA 3DRSA 1RNHA 1QHTA 4NXMK 2HHXA 3OY9A 3THWB 4Q5VA 1RDWX 4K8XA 4CF0A 1QSSA 3QNNA 1WSIA 3HPOA 4BG8A 4B1WB 4M3WA 1T6DA 3VEYA 3WXMB 4KH5A 4FZYA 4GV6A 1BGXT 1MA9B 4MO5A 1K8AO 4RW7A 1KRPA 3OW2M 4LH5A 2OTJN 4FM2A 2YHYA 1S9EA 3AVFA 3NCIA 3O3FA 4FM0A 1J6ZA 4WF9L 3LALA 1RDCA 3MCPA 4YOXA 3E9PA 1BL3A 3EO3A 3SQ4A 1EX4A 3F2KA 2HW3A 2PBDA 1NK5A 3D2FB 4CJPA 2I5JA 4PUOA 3G25A 2JWLA 4CZEA 4DR3K 1U2VB 2HNZA 3WNEA 2I7NA 1JCGA 4W5OA 4FLUA 3VTIA 2EHGA 2P9NA 4FJKA 3E9OA 1GOAA 1RFQA 1DT9A 3DRRA 3O1WA 3UE5A 4DR6K 4KI6A 4J2BA 4IEIA 5A2QO 4BQZA 1YITN 4RTFD 3VEVA 4M42A 4OVLA 3OYFA 3V1QA 3KWIA 1YF5L 3IRXA 5BRFA 2P9LA 1RDDA 3ZLJA 1HNWK 1JXEA 1D9DA 5F0XA 4JRPA 3SPZA 4W5RA 1CZ9A 2V52B 1C0FA 3DI6A 2FSKA 3O4QA 3B6OA 5GAHP 4CZLA 4DTJA 4Z4GA 1P90A 2W42A 4BE0A 4EZ9A 4IXCA 3ID6A 1C1BA 2F8TA 1EP4A 5I3UA 3U9ZA 1VSFA 3PSFA 5KPZA 1HMVA 2OPPA 1T03A 4ISGA 4H0YB 1EETA 3LWLA 3B6PA 4K0KK 3C94A 2R7YA 4KHSA 1S5JA 3R8EA 2IVOA 4BRNA 3BF3A 2UUBK 5SWMA 2V7YA 3HZ6A 1KVAA 4CZKA 1K6YA 1VQLN 2DPNA 3SBGA 4IO8A 1TK5A 3LAMA 3SAGA 3RTVA 4DSIA 4KBOA 1LWFA 2E88A 4B1ZA 3A5NC 3A5OC 1LAWA 4NLBA 1NBWA 4CEZA 5H1SQ 3V4IA 2D0OA 3LWMA 4Q0BA 4B1VA 3I33A 2E5LK 2W41A 3C0BA 4O5BA 1BI4B 3RMDA 3OBWA 1FXXA 1NMNA 1MWKA 1LW0A 5F2RA 3ZSZA 3ATUA 1S72N 4JYAK 4E7IA 4BRGA 4TSXA 3CPWM 3NF9A 4MDBA 3VQAA 2UUCK 1IKVA 3V6DA 3CFOA 4B9MA 4NYFA 3SI6A 2UXCK 4BC2A 4O8KA 3K5LA 1Q9YA 1E4FT 1R59O 4GKJK 3ID8A 4KPYA 1YT3A 4BRIA 1NGBA 4BC5A 4FWMA 4CVNE 4QAGA 4CE9A 5AQSA 4CFBA 3MAQA 2FC0A 2YCHA 3P83D 1HJRA 3WQUA 2WBNA 3OYHA 1A5VA 3ZT4A 4BR4A 4C8MA 1SS6A 1NGAA 3GG4A 4CHZA 1YI2N 3VENA 5DM6L 2RE2A 2E8AA 1P8ZA 3PLAA 4FYDA 3THVA 5BN9A 4CJTA 3S41A 3LL3A 1XHXA 4BR0A 5ELZA 1ATSA 1HNIA 1KCFA 4G1QA 5EVZA 4BDPA 2YHBA 1NKEA 2OA8A 2ASPA 4H5WA 3TSUA 1HRHA 1VRUA 2DFFA 2X6NA 2O4GA 3MEEA 4DV1K 4JI2K 2X6SA 1RCHA 1SL0A 3DLKA 3TPQA 4GMJB 3SUOA 2DFHA 3OYNA 1Z25A 1YXQA 2B5JA 1QZ6A 2KKZA 2RF2A 1QQCA 3DOKA 3QIPA 3R3LA 5T7BA 4CECA 4B1YB 3OTOK 1M1KO 1XQSC 3AVBA 2QKKA 3SUQA 1W7AA 4DV2K 2P5GA 3SJJA 3M3ZA 4Z4EA 4H03B 4HWIA 1QQMA 1JCFA 2HHTA 2LSNA 3KWGA 4CJUA 4AF1A 3THWA 1GLFO 4L8RB 3FR0A 4HCCA 4EAHD 2VCPA 3I0RA 1VQ6N 3QINA 4BR9A 1BCMA 1NGJA 4QOZB 1KSPA 1VHXA 3DXMB 3BGRA 1W2BM 4M7YA 3LDNA 2F4VK 3O80A 5SZTA 1S1UA 3TAQA 2ZGZA 5ADXH 4AHUA 4BVPA 3L4IA 3QMLA 2FLOA 1SKSA 3FZMA 5M1OA 3AVMA 4C8LA 3SZ2A 3LPUA 3C6HA 3OYAA 1F21A 4CESA 3NFAA 2XO7A 2AA4A 4M41A 5M1KA 3CJ7A 1V4TA 4FWLA 4IJNA 4B08A 2NRXA 3J7YP 4R5PA 4LF5K 2NRZA 3HP9A 4DKWA 1N33K 1XHZA 2FBYA 3EKSA 4DTSA 3LDOA 4OKJA 2HB5A 5EU7A 3TSQA 2H3GX 3OJUA 2Q1NA 3CI5A 3ZSOA 3CMEN 4FWNA 4BQLA 5AQZA 1T05A 4BWJA 4CK2A 1LW2A 4CZHA 4A5BA 2QWOA 1HX1A 1Q18A 4PKHA 5FPDA 4EP4A 1Q8IA 5EX5A 4KV8A 1IBLK 4AHSA 4JS5A 3CJBA 2HF3A 3O9QA 3MX5A 3ZETB 4PY5A 3L2RA 3HXMA 3UKUA 4DTMA 4KB1A 4DQ8A 3H1QA 3S3OA 3SMSA 4CJRA 3J80O 4H0VB 3VQ7A 3U6FA 3CJ1A 2BGGA 3BP8A 4WQ4C 3NDKA 4PWDA 2IC3A 3TU5A 4X62K 4FLZA 2QWMA 5BRHA 3V1RA 1TKTA 5E41A 2FBXA 4X66K 1BO5O 4HTUA 4JKGB 2IVPA 2QXFA 3OJSA 3KTQA 3AVNA 4FVUA 2A1SA 4MLEA 2G8UA 2RKIA 2E2NA 4LF6K 2O8CA 3KLGA 3AVKA 3JXUA 3L3UA 3EE8A 3MN6A 3IKMA 3LP3A 3FFKB 3Q7CA 1JJ2M 4B9LA 2ZE2A 3A8YA 2A3ZA 4M63C 1WAFA 3EZWA 4O55A 2CH6A 4K43A 3J81O 2VGNA 3WXLA 5LMNK 3K5OA 5CHIA 2Y1IA 3I8DA 1VK0A 3K58A 4YHHK 1NK7A 4GV9A 2QEXN 3V9WA 2DY4A 2X78A 2A41A 3TTCA 1A5WA 3CXCM 4MQ3A 1S3XA 2XY8A 1U45A 1IKYA 4JK8A 3VF6A 1SKRA 4CCHA 1HKGA 4E7JA 3THXA 1B9FA 3H08A 4F3TA 3PSIA 4BR7A 1IBKK 4IBNA 3TWHA 1SL1A 5HLFA 2YNFA 1UA1A 1BQNA 4CJ7A 4YORA 3F9KA 3AARA 3VN5A 3EKUA 4IOAL 1YTAA 2P9SA 3KLEA 1GLLO 1ZBFA 3CERA 1OH6A 2HMPA 2FBVA 3VA3A 1XNRK 4FK0A 4Z4CA 3CQ8A 4E3SA 2KQ2A 3V9ZA 3ZSWA 3OS2A 4A61A 4WE1A 3RR7A 4MLHA 4IDKA 1BQMA 2P1JA 4FO0A 3D2EB 2CGLA 4FLTA 1ESVA 2D0AA 1XI1A 4KAZA 2O8EB 1HNZK 1Y97A 5AQLA 4GNIA 1NU0A 3SBTA 2HHSA 3LDSA 4LFCK 3ZX2A 4IFYA 4BG9A 5CZ2A 4BR5A 2UUAK 1OVYA 3HSCA 2P9PA 1D5AA 4L3QA 4K41A 1U2VA 2D0CA 3QEPA 3N4PA 2RHKA 4AHVA 1J9AA 2W6KA 4O4GA 4H4OA 4BRHA 4PA1A 1JLFA 4DS4A 1FW6A 4AM7A 1WSEA 1NKBA 4LFBK 5AJ3K 5C2FA 3HPHA 3LDLA 3MN9A 3VQQA 5KPTA 3ENBA 3OYMA 1Z26A 4IFEA 5AQNA 5FPNA 3SYZA 2YI1A 2G8HA 1XC9A 1C0MA 2Z1JA 4DQQA 3AY9A 3AA4A 3K57A 5FROA 4DR4K 1VQ5N 1S1XA 1O13A 1TYQB 5M1NA 4BRLA 4BACA 2P9LB 4CBUA 2PYJA 2KW4A 1VQON 2E2PA 1VQPN 2OYQA 3DXMA 1TK0A 4HCBA 3CJ9A 1CZBA 1YJNN 1KFDA 2I7PA 2QWRA 3AVIA 4MDAA 1N5YA 3C65A 4DR2K 4Z0UA 1RTDA 4XH1A 3PX4A 4HTLA 2IVNA 4FWOA 3V9XA 3EN9A 3B8AX 1J5EK 4I9QA 4LC9B 1TKXA 2OTLN 2HNYA 3MXIA 3AA3A 3DM2A 3CCUN 4FK2A 1HQEA 4BE1A 2CH5A 2RPIA 3HM9A 3HO1A 1RT1A 4DUYK 4CIFA 4BRQA 1TVRA 2Q97A 4YY3K 1U6ZA 3HRGA 1J53A 3HVTA 3W0LA 1BIZA 2VG7A 3FZHA 1NJYA 2GWJA 3SUNA 1W9HA 4ELVA 2P51A 4OJRA 1VSDA 1MU2A 2Q36A 2FXUA 3O3GA 3F73A 1T3VA 5I9EB 1BDGA 1SQKA 3FGUA 3VTHA 4WFAL 4DQIA 2GV9A 2NRRA 1WLJA 4DMNA 4XIUA 4X65K 4JKBA 4FL9A 2QWNA 4HUEA 4OPKA 4Z4HA 4JAXA 4M3UA 1HPMA 1OH5A 3VF2A 4RW8A 1C1CA 3AAPA 3P1GA 4BGBA 3EL2A 1RT2A 4E7LA 3OS0A 1KVBA 4JI8K 3QBXA 5C10A 4EHTA 3PY8A 2ZJPL 3OYJA 5BPNA 4KRFA 5C15A 4FJ7A 4B3OA 4B8CA 1JLCA 3A0IX 4IOCL 4DS5A 3GDQA 4N41A 3RRGA 3NMUA 4WQ5C 2P9IB 3G4SN 3Q7BA 3C7NB 3IG1A 4B9VA 3SNNA 4N47A 4DF8A 4UY8O 2IAJA 1U04A 3LM2A 3O9TA 1RDBA 4AHRA 5CYQA 4C1NI 3H3NO 1VAZA 3TTDA 4JI3K 1WB9A 3KK2A 1ASWA 5TKWA 3CHWA 2G8FA 3J7AP 4DQPA 1Q81O 3WT0A 2WC9A 5JICA 4NCAA 2Z1GA 2VWKA 4CF2A 3QEWA 3ULEA 4ELUA 3DLGA 5FLXO 2KFZA 3OBYA 4JD2B 5J2MA 3QB0A 4CI6A 1VQNN 3HT3A 4F3OA 4OX9K 1RDUA 4DR7K 1ITGA 4WFNL 4FJLA 2WOMA 1VSLA 4CZIA 2BANA 5AQPA 1RGIA 3EY1A 5FPMA 3OYGA 4J8FA 4IWVA 4BY9C 2O8FB 3DYAA 3F9MA 4AHTA 3L2VA 3A5LC 1ZYQA 2ZD1A 3MXMA 4CJVA 3NHGA 1MWMA 4CGFA 1NJXA 5J2PA 2UXBK 1BISA 2Q0UA 4H5VA 5AFUA 2Q31A 1Q82O 3HOTA 1CLQA 1ASVA 1OH8A 1HYSA 3K5MA 3QERA 1VSMA 4BDYA 2O8BB 4BREA 5LY3A 2FF6A 5GIPA 1IKXA 5C24A 3K0SA 4I2PA 5AQWA 4CZGA 4FW1A 3WEEB 5AQYA 4EFHA 2YKMA 3L2UA 2BDPA 3DRPA 3FZLA 4LF9K 3UKRB 4CJWA 3GBTA 2HVIA 4W5QA 5HRPA 5FPEA 2FBTA 3RRHA 3NGZA 2E6MA 3ZSRA 4OKEA 2D0BA 3M8SA 4B9SA 3CMAN 2HSTA 4CFAA 3LDPA 3MEDA 2ETJA 4NYNA 4QS9A 4HVJA 5HRSA 1N34K 5KRTA 3E01A 2B6AA 3SQ2A 4K8ZA 4C8KA 3V1OA 1JLEA 4BC3A 4KFBA 1U49A 4LH4A 1KAZA 1VSJA 1UOCA 3KKSA 5JVHL 4H0PA 1YJWN 2G8VA 3DLHA 1MDUB 2Z1IA 3OYIA 5KTQA 3OYEA 4LD0A 1K8KA 2VYPA 4OGCA 3VQDA 3BY5A 1EXQA 3VMFB 5LJVA 1EQYA 5HBMA 3U4LA 3DLEA 3KKRA 4PL8A 5C42A 3DXKA 3VOVA 5C12A 2PY5A 1Z6RA 4A57A 1HYVA 4DSKA 3CCMN 4CF8A 4ZHRA 2P9PB 1GLCG 3MXJA 2E20A 2ZQBA 3NAEA 3O6WA 3KZBA 4NXNK 2XY5A 4QS7A 1J54A 4WFBL 3WNHA 5GINA 3K9JA 4GVMA 5AQOA 2HOEA 3CQYA 4Z4IA 1DEJA 2P9NB 1OH7A 1XMQK 3AO5A 5M1QA 4JKHA 1NGEA 1KD1O 4IG3A 3SQ1A 3KHYA 3NF6A 1S22A 1H1VA 2G8KA 1VQ7N 3T69A 4CD1A 4HUGA 3J8AA 4E1NA 3EZ5A 1FJGK 4DU3A 1ZBSA 4IZ9A 4DLGA 1QS4A 4K25A 4CEOA 4FJ5A 2NRVA 4BGAA 4BR2A 4QS8A 3DJCA 4CGGA 5M1FA 1RT4A 1XNQK 3O4WA 5GADP 4H0OA 3H6EA 1N8RO 5DM7L 4IO9L 3OA9A 2GBZA 2P5OA 4FCYA 3T7ZA 5DMRA 3QEXA 4AQYK 3TSPA 3VGKA 5KQDA 4A2BA 1C6VA 4CFDA 4PKIA 2HHQA 3QBWA 4RW4A 4UQGA 4KB0A 3BEXA 3BUZB 3MN7A 2OANA 4BRCA 1RTIA 1X3MA 4I2QA 4N5SA 1WSFA 5BR8K 2NLXA 3C7NA 3BZKA 4DQSA 2E2QA 1Z05A 2YHXA 3G6EN 4CJFA 3RMCA 3IMXA 4F2RA 1ATRA 3VQ6A 1QVGM 2Q3SA 1TAQA 2O8DA 4LSLA 3N4QA 5J2NA 1T8EA 4NCBA 2HBLA 4DU4A 3K2PA 5AZJB 2F96A 3L4QA 4RW6A 3PIPL 1TKDA 5GIOA 1JKHA 1BOTO 5C25A 1KAYA 3NE6A 3AVJA 3AVCA 2QWQA 3R1XA 3QFUA 1ASUA 2WONA 3CPEA 1OVQA 4DQRA 3THXB 3TANA 1FKOA 2CGKA 3DAWA 3HSTB 1LOTB 4WCEL 2E2OA 3E66A 1NK4A 3HL8A 4DV6K 3CJCA 2ZWHA 4FM1A 1KQSM 1HPZA 2ZJQL 3VETA 4FZZA 2HBKA 4C1NK 2PFUA 5JLHA 4M45A 4DG1A 2NRTA 3OVNA 4JRQA 2Z1HA 1LWEA 1U48A 3P38A 3L6QA 3VQ4A 4CGHA 4C8OA 4CZMA 1NJWA 1Q86O 2V51B 2Q2RA 4ICLA 1UAXA 1RT6A 3V81A 4CHPA 4YOTA 1B92A 1E4GT 1X1PA 3CJAA 4BRDA 4B1UB 4H5TA 5FRMA 1WUAA 4BC4A 4DFKA 4FJHA 3DXKB 1YHQN 1HUXA 4XH5A 1RDAA 3ISNC 3U3YA 1NK0A 1RTJA 2A40A 1HNVA 4DV4K 3HPGA 2JWKA 3ZT1A 3MN5A 4QCLA 4RG8A 3LP1A 3VA0A 1QVFM 1K8KB 2OPQA 5BN8A 2D4WA 1IJJA 3O9SA 3VQ5A 5GAEP 4JKGA 3VEWA 2F7TA 1WSHA 1UWBA 3MDQA 2IOCA 4JHDB 1GOBA 1HKBA 4CZFA 4DSEA 4KH4A 4OGEA 1JXBA 3TABA 1SV5A 3PO4A 3S3NA 3WXJA 4BRAA 4GKKK 1IO2A 1BI4A 1NK6A 3SK3A 2KZZA 1S1VA 1I3AA 3WXKA 1G15A 3O3HA 2VWJA 4FLWA 4FWPA 4JKDA 4FJ8A 3HM8A 3TARA 4CK3A 1L5UA 1NKCA 3SV3A 3DLRA 3OYBA 2QTDA 3L0QA 4J2AA 3U8XA 4B8AB 2IGIA 3ZETA 3SCXA 2BTFA 3WNGA 4YFUA 1SZ2A 2O8BA 4KHPK 4DWIA 3VQBA 3P39A 4M3RA 4I7FA 4BDZA 4FWQA 1Q9XA 1C0UA 2QKBA 4DCHA 4CEEA 5DK5A 3HVRA 4NLCA 1JLQA 4BWMA 1RT5A 4OLBA 3MWPA 4EIAA 2VG6A 3ZX3A 4CEQA 1WAJA 4FW2A 3QICA 1L3TA 5AQRA 3CG7A 2GX9A 4B3TK 1DGKN 4JKFA 3TAPA 1L3SA 1HJOA 4DSFA 3MEGA 4Z94A 3AO3A 4Y0WA 3UIQA 4IEEA 2D5RA 2IIRA 1WSGA 3QLHA 2IDOA 1J5OA 4B1XB 3M5RA 4CW7B 5LL6Z 3THYB 3CD6N 3LM9A 3W3DA 5C0YA 3ULDA 1HKCA 3CM6A 4OLAA 3M8QA 1NGIA 3G0ZA 4KTWA 3AO4A 4CJQA 4I6MB 1OKJA 2YJEA 2W6LA 3F5TA 3TAGA 1BIUA 2P9KB 2XRIA 3LZJA 4CIEA 4KREA 3VPZA 2WFBA 2GELA 1BG3A 1NGGA 1WN7A 5AZIB 3VEOA 3M8RA 4DLEA 2QA4N 3ASMA 3CCLN 2P9UB 3CYMA 4JD2A 4KHNA 3VESA 3BZCA 1NLVA 5KGWA 5AQFA 1UA0A 3VQCA 3R9PA 3RMBA 4OPJA 1QHAA 1QSYA 1RBRA 1K73O 4F9OA 1JL2A 3IUCA 1WBBA 1ZBHA 2RN2A 1GLAG 1ZBLA 2OZSA 4CJ4A 1S9GA 3AGRA 1YVUA 5F1XA 4M3TA 2UYTA 2NRWA 5AFUH 1KTQA 1NM1A 4FJXA 3H46O 2YJFA 5BPLA 1RT3A 5EOYA 3P31A 3SPYA 2B4JA 3K5NA 3MX2A 2FSNA 1T6CA 3LZIA 3C6TA 4ID5A 1VQ8N 3ITHA 3CF5L 1W97L 3HP6A 5AQXA 5AQGA 4JI6K 3HYFA 4I6MA 3KD5E 2QW9A 5IT9O 3VQPA 4J2EA 1YIJN 4B9NA 4V19S 2W40A 1NGDA 5GAGP 5TKYA 5FDLA 4M3YA 2FSJA 5AQKA 3O9UA 5JVGL 1T44A 4E1MA 1VRTA 1NK9A 3NGYA 4Y1CA 4ISFA 4LSNA 2Q0RA 3NF7A 1NGFA 3O5BA 3UKRA 3RWUA 3KJVA 1GLBG 3OYCA 2FF3B 2QWPA 4I9LA 3IDHA 1VQ9N 1L3VA 3H1VX 3AGKA 4H0TB 4CHQA 4X64K 3I0SA 4AHCA 4CIGA 3VEZA 4CJEA 4DTUA 2HHHK 3JSMA 4XH4A 3NBPA 1CXUA 4FPBA 3CQXA 3E1YA 1WNSA 1BU6O 1NGHA 3AVAA 2P9IA 5JMVA 3CCQN 4DSLA 4DB3A 4A59A 1VSHA 3ZSQA 5B8HA 2JLEA 4E89A 2AJQA 2V7ZA 1DTQA 2HNDA 3SJHA 4JV5K 2YNGA 3CC4N 3SMPA 4W5TA 4LFAK 4GY2B 4YOVA 3T3FA 3IS9A 1A5XA 4CJ5A 3MMVA 5AZIA 3OHRA 3ENHA 1X9WA 1IG9A 3K59A 2IS3A 4W5NA 4BROA 4DF4A 4NO7A 1NGCA 1N32K 1IH7A 3BF1A 5CY4A 2KTQA 1HQUA 4YOUA 4IDHA 4WQ5A 4FJGA 1IG8A 4IFVA 4NB4A 3FLCO 3PX6A 1IV0A 2GWKA 5CZ1A 3WNFA 3KLHA 3T1AA 3RVCA 2YHAA 4ZTFA 1DLOA 4KH6A 1GLJO 3AVHA 1X9JA 4BRKA 4CHNA 3D0PA 4H5RA 4DHYA 1ILYA 3AAQA 3KK3A 1NMDA 1ATNA 1NOZA 4KI4A 4M3ZA 1C0TA 3AVLA 4DU1A 1NJIO 3KD1E 2A1RA 4R79A 2P9UA 3H45C 3MK6A 5AQJA 4KTZA 5AR0A 3IFRA 1XWLA 3ZSVA 3OS1A 5AZJA 4AM6A 1VSEA 3IAYA 4CK1A 3E9LA 1VQMN 4FJNA 4N76A 3U3GA 3AA2A 3LDQA 2HMIA 4FPAA 3CCEN 5HOOA 3JYTA 4CEBA 1I94K 2P9SB 3FZFA 2KHOA 2NNWA 4YOYA 1GLDG 3NVMA 4CJLA 4JKEA 4JK9A 4ZTJA 4B3SK 4JI4K 4U7BA 1LWCA 1GOCA 4DTPA 1KLMA 5HL7L 3EE9A 2A6AA 3O8MA 3D7EO 3G71N 4CJSA 4CEAA 3CCJN 4PKGA 3K9KA 1T7PA 3M1FA 3SAFA 4JI7K 4BVOA 3AA5X 4CGJA 4JK7A 3MWTA 4B9TA 3AVGA 3ZT0A 3G10A 5LMUK 3DLBA 3JS6A 1XMOK 5BR9A 5AQTA 3CCSN 3KK7A 4F4KA 3SAHA 5D3GA 1LV5A 3EYZA 2CGJA 4A5AA 4JLHA 1QE1A 1M90O 4FJ9A 3RSEB 1IBMK 2WTUA 4IKFA 4O5FA 3QNOA 4ILJA 4E7KA 4FJIA 4PQUA 3M6GA 4ILHA 2O8DB 4RWTA 1WBDA 1HYZA 3UB5A 1D8YA 1BUPA 3TAMA 4BRPA 1TGOA 2NZTA 3KIOA 2BUPA 1HR0K 4DV0K 1VQKN 1SUQA 3NVKA 3DMJA 3C95A 1LCUA 3GE1A
chains in the Genus database with same CATH topology
1D9FA 4FLUA 3VQ4A 2EHGA 1WSEA 3LPTA 4CGHA 4C8OA 1NKBA 1NJWA 3HPHA 4EP5A 1RBSA 4FJKA 1TV6A 3QESA 1GOAA 4CJKA 3VQQA 3DRRA 4AH9A 4ICLA 3OYMA 1UAXA 1Z26A 1B9DA 1RT6A 3V81A 4KI6A 4J2BA 2XHBA 4CHPA 3CFRA 3SYZA 2G8HA 1B92A 1XC9A 1C1AA 1X1PA 3ZCMA 4EZ6A 1TL1A 1C0MA 2ITGA 2Z1JA 4CJ3A 4DQQA 4M42A 3AA4A 4OVLA 5FROA 3K57A 3L8BA 1S1XA 5FRMA 3OYFA 2HHVA 3V1QA 4DFKA 4FJHA 4BACA 1WSJA 3IRXA 4DS4A 2KW4A 4CHYA 2PYJA 1RDDA 4ID1A 2OYQA 1JXEA 1D9DA 3TR8A 4JRPA 1RDAA 3ISNC 3SPZA 4CGDA 4W5RA 3U3YA 1TK0A 4HCBA 1CZ9A 1CZBA 1NK0A 1RTJA 1KFDA 3DI6A 1HNVA 3HPGA 1W0HA 4O0JA 3AVIA 3ZT1A 4E7HA 1ZBIA 1N5YA 4QCLA 4RG8A 3O4QA 1EKEA 3B6OA 3LP1A 1RBTA 3VA0A 4DTJA 4Z4GA 3CFPA 4Z0UA 2W42A 4BE0A 1RTDA 2OPQA 3PX4A 4EZ9A 5FRNA 1C1BA 3V9XA 2F8TA 1EP4A 5I3UA 4OKKA 3VQ5A 4I9QA 1VSFA 1TKXA 1NJZA 2HNYA 2OPPA 1HMVA 3AA3A 3DM2A 3MXIA 1T03A 1EETA 2HHWA 4FK2A 3LWLA 1HQEA 3ZT3A 1RILA 1UWBA 1WSHA 2IOCA 2RPIA 3B6PA 3HM9A 4BE1A 4KHQA 3HO1A 1RT1A 3ALYA 3L2WA 3C94A 4CIFA 2R7YA 1GOBA 1TVRA 1S5JA 3ZSXA 4KHSA 4DSEA 4OGEA 3LP2A 1FKPA 1JXBA 1J53A 3TABA 3HVTA 4DTRA 1SV5A 1BIZA 2VG7A 5SWMA 1NJYA 3PO4A 4CF9A 1KVAA 3S3NA 3SUNA 4CEFA 1W9HA 4FK4A 1K6YA 2KZMA 1IO2A 3VQ9A 2BE2A 4ELVA 4DSJA 1TK5A 1BI4A 2P51A 3LAMA 1NK6A 2KZZA 1S1VA 1I3AA 3RTVA 4OJRA 4DSIA 1VSDA 1G15A 1LWFA 1MU2A 2ATQA 3O3HA 2VWJA 2HVHA 3PX0A 3O3GA 4FLWA 1KFSA 3F73A 2DTUA 4O0IA 4FJ8A 3TARA 1KLNA 4CK3A 5HRNA 1L5UA 1LAWA 3SV3A 3DLRA 1NKCA 3OYBA 4DQIA 2GV9A 3S9HA 4J2AA 1WLJA 4DMNA 3AO2A 4CFCA 4CGIA 4B8AB 2IGIA 4CEZA 4XIUA 3V4IA 3SCXA 3WNGA 3LWMA 4Q0BA 4YFUA 4E0DA 4DWIA 3VQBA 4HUEA 4M3RA 4H4MA 4I7FA 4BDZA 1Q9XA 2G8WA 4FJMA 1C0UA 4OPKA 4Z4HA 4O5BA 2QKBA 4M3UA 1BI4B 4CEEA 3RMDA 4RW8A 5HROA 1C1CA 1FXXA 3P1GA 5DK5A 3ZSZA 1LW0A 3KLIA 3HVRA 1JLQA 3LANA 1RT5A 4BWMA 4E7IA 4OLBA 1RT2A 2VG6A 2Y1JA 3QO9A 4TSXA 5JS2A 3NF9A 3VQAA 4CEQA 1VSIA 1IKVA 1KVBA 1WAJA 4FW2A 3CFOA 3OS0A 4E7LA 4NYFA 3V6DA 1NOYA 1L3TA 4B9MA 3CG7A 4KKOA 3NH1A 3PY8A 3SI6A 1RTHA 3O4NA 3TAPA 4B9UA 1L3SA 3S3MA 4DTOA 3OYJA 3K5LA 4KRFA 4DSFA 3P5JA 2X74A 3MEGA 4YNQA 3AO3A 4CERA 1Q9YA 4FJ7A 3UIQA 4B3OA 4B8CA 1JLCA 2D5RA 3PO5A 4KPYA 4C8NA 4DS5A 1WSGA 1YT3A 4N41A 3RRGA 3QLHA 2IDOA 3HK2A 2OPSA 1J5OA 4FLVA 3IG1A 4B9VA 4FVMA 3SNNA 4N47A 1DTTA 3VQEA 4DF8A 4QAGA 4FLYA 3D45A 4DTXA 2IAJA 1JLGA 1U04A 4CE9A 3ULDA 2OZMA 4CFBA 3MAQA 1RDBA 5CYMA 2FC0A 1JL1A 3CM6A 4DTNA 4AHRA 3P83D 3M8QA 1HJRA 5CYQA 4OLAA 1REVA 3G0ZA 4KTWA 3OYHA 1A5VA 2G8IA 5KGXA 1TL3A 3AO4A 3ZT4A 4CJQA 3KK2A 4C8MA 1ASWA 1JLBA 4CHZA 1KVCA 3FFIA 2G8FA 4DQPA 3TAGA 1BIUA 2XRIA 2HHUA 4Y1DA 3LZJA 4CIEA 4KREA 4FYDA 3THVA 4NCAA 1TKZA 4CJTA 1XHXA 2Z1GA 2VWKA 1HNIA 1RBVA 1WN7A 4CF2A 3QEWA 1KCFA 4G1QA 3M8PA 1ZBUA 4BDPA 4ELUA 1U4BA 1S1WA 3DLGA 3M8RA 2KFZA 4DLEA 2YHBA 3BDPA 3ASMA 3CYMA 5J2MA 1NKEA 2OA8A 1LAVA 3NH0A 4KHNA 3HT3A 4F3OA 1HRHA 1VRUA 4J2DA 2DFFA 5HRRA 2X6NA 3TAEA 2O4GA 1ITGA 2NUBA 5KGWA 4FJLA 2WOMA 1VSLA 3MEEA 4F8RA 1UA0A 2BANA 3VQCA 2X6SA 3RMBA 4OPJA 3EY1A 3OYGA 1QSYA 1RBRA 1RCHA 1SL0A 1JL2A 3DLKA 3AV9A 4GMJB 1ZBHA 2RN2A 2DFHA 3SUOA 1ZBLA 2OZSA 3OYNA 1Z25A 5K14A 1S9GA 3DYAA 4CJ4A 2B5JA 1YVUA 3KK1A 4BE2A 2RF2A 4M3TA 4AHTA 1QQCA 3DOKA 3QIPA 4M3XA 3L2VA 4KTQA 5T7BA 1KTQA 4CECA 4FJXA 1ZYQA 3AVBA 1U48A 2ZD1A 3MXMA 3SV4A 4CJVA 2QKKA 3SUQA 2P5GA 3NHGA 5KRSA 1RT3A 4KO0A 3SPYA 4F2SA 4CGFA 1NJXA 3SJJA 1QTMA 5J2PA 4LY7A 2B4JA 5KI6A 3OYLA 3LP0A 4Z4EA 3K5NA 2HHTA 1BISA 3LZIA 3C6TA 2LSNA 4ID5A 3ITHA 4CJUA 1I39A 3HP6A 4FZXC 4DFMA 1CLQA 1ASVA 4L8RB 1HYSA 3K5MA 4HCCA 3HYFA 3QERA 1VSMA 3I0RA 3KD5E 4H8KA 4BDYA 3VQPA 3HJFA 4J2EA 1IKXA 4B9NA 5C24A 4I2PA 3QINA 1BCMA 4FW1A 4M3YA 5FDLA 4QOZB 1KSPA 1JLAA 2YKMA 4MFBA 3CM5A 3BGRA 3L2UA 3QEVA 2BDPA 3DRPA 2XY7A 4E1MA 5SZTA 2DFEA 1VRTA 4CF1A 1NK9A 1S1UA 3NGYA 4Y1CA 3TAQA 4LSNA 4AHUA 3NF7A 4CJWA 4KHWA 3DOLA 5HRPA 4W5QA 2HVIA 3RWUA 3KJVA 2YV0X 1SKSA 3OYCA 1L3UA 2FBTA 3RRHA 3AVMA 4I9LA 1R0AA 4C8LA 3SZ2A 1L3VA 3LPUA 4HHTA 1BHLA 3NGZA 3OYAA 2E6MA 1BCOA 1F21A 3ZSRA 4OKEA 4CESA 3TI0A 2D0BA 3NFAA 4CHQA 2XO7A 3M8SA 3NF8A 3I0SA 4IG0A 4AHCA 4B9SA 4N56A 4M41A 4CIGA 4CFAA 4CJEA 4DTUA 3VQ8A 3JSMA 3NBPA 1CXUA 4B08A 3MEDA 2ETJA 4FLXA 4NYNA 1WNSA 3AVAA 4R5PA 4HVJA 1O1WA 3HP9A 5HRSA 3OYKA 4CEDA 5KRTA 4DFJA 2QK9A 3E01A 1XHZA 2B6AA 3SQ2A 2O4IA 2FBYA 4DTSA 4DSLA 4K8ZA 4C8KA 3V1OA 3TAFA 1VSHA 4OKJA 1U47A 3ZSQA 2HB5A 1JLEA 5EU7A 2JLEA 4KFBA 3OJUA 3ZSOA 4LH4A 1U49A 4E89A 1RBUA 4HUFA 1S6PA 1VSJA 1UOCA 3PV8A 2AJQA 3KKSA 3KLFA 2KFNA 1DTQA 1T05A 2G8VA 2HNDA 1X9MA 3DLHA 4BWJA 4CK2A 1LW2A 2Z1IA 3OYIA 5KTQA 3V9SA 3OYEA 4LD0A 3VQDA 4OGCA 2YNGA 3AO1A 4W5TA 1EXQA 4EP4A 1Q8IA 5HBMA 4KV8A 3NGIA 4Z4FA 4AHSA 4JS5A 3DLEA 2E6LA 3KKRA 3PUFA 4PY5A 3T3FA 5C42A 2EX3A 3IS9A 3L2RA 3QETA 2PY5A 1A5XA 4CJ5A 2PYLA 3HXMA 4NCGA 1HYVA 4DSKA 4DTMA 3C6UA 1YTUA 4KB1A 3QEIA 4CF8A 4ZHRA 3MXJA 1QSLA 3T19A 2ZQBA 3NAEA 5J1EA 1X9WA 3S3OA 4CJRA 2XY5A 1IG9A 3VQ7A 1J54A 4O44A 3WNHA 3K59A 2IS3A 3U6FA 3ZSYA 1NK8A 2BGGA 4W5NA 4DF4A 3LAKA 4GVMA 3NDKA 4PWDA 4RW9A 2IC3A 1IH7A 1S1TA 3ZT2A 4Z4IA 5CY4A 3OYDA 4FLZA 2KTQA 1HQUA 3AO5A 3V1RA 1TAUA 1TKTA 4DFPA 1SKWA 5E41A 2PZSA 1FK9A 2FBXA 4IG3A 3SQ1A 4FJGA 3NF6A 4HTUA 3MECA 4IFVA 3RMAA 2G8KA 3PX6A 3KTQA 2QXFA 3OJSA 4KHYA 5CZ1A 2JGUA 3AVNA 3WNFA 2A1SA 3T1AA 4E1NA 3KLHA 2YNHA 2RKIA 3EZ5A 4HUGA 2G8UA 4DU3A 4JS4A 1VSKA 2YHAA 4DLGA 1QS4A 3KLGA 4ZTFA 1DLOA 3AVKA 4CEOA 1IKWA 4FJ5A 3L3UA 3AVHA 2VG5A 4CHNA 4CGGA 3D0PA 1RT4A 3KK3A 2F8SA 3LP3A 1NOZA 4B9LA 4KI4A 4M3ZA 2ZE2A 3NH2A 1C0TA 3AVLA 4FXDA 4DU1A 5HP1A 1RT7A 3SQ0A 1N6QA 2A1RA 3KD1E 1CXQA 3SUPA 1WAFA 4KTZA 4O55A 2GBZA 4FJJA 2P5OA 2YNIA 4FCYA 4KHUA 1XWLA 2GUIA 3ZSVA 5DMRA 3OS1A 1VSEA 3QEXA 4GW6A 3IAYA 4CK1A 3QIOA 1TK8A 3K5OA 4FJNA 4E19A 2Y1IA 3I8DA 1C6VA 1VK0A 3K58A 4N76A 2E4LA 4CFDA 2YKNA 4AILC 1NK7A 3U3GA 3AA2A 2HHQA 3V9WA 2HMIA 2DY4A 4RW4A 2X78A 1S6QA 4UQGA 4KB0A 5JS1A 3L3VA 1A5WA 5I42A 3JYTA 4CEBA 4MQ3A 3A2FA 3L2QA 2XY8A 2XY6A 1IKYA 1RTIA 1U45A 1X9SA 4I2QA 4N5SA 1SKRA 1WSFA 4CHOA 4CCHA 4CJLA 4E7JA 1B9FA 4ZTJA 4DQSA 4ELTA 1LWCA 5J2QA 3V9UA 3H08A 2OPRA 4F3TA 1GOCA 4DTPA 1KLMA 4CJFA 3RMCA 4F2RA 1SL2A 4IBNA 3DRSA 3TWHA 3VQ6A 5HLFA 1SL1A 1RNHA 2YNFA 1QHTA 1UA1A 1BQNA 2Q3SA 1TAQA 2HHXA 4CJSA 4CEAA 3OY9A 4LSLA 4Q5VA 4K8XA 5J2NA 1T8EA 1T7PA 4CF0A 4DU4A 3F9KA 4NCBA 3K2PA 1QSSA 3VN5A 3QNNA 3RR8A 1WSIA 1YTAA 3HPOA 3AA5X 3KLEA 2F96A 4RW6A 1ZBFA 4CGJA 4M3WA 4B9TA 3AVGA 1TKDA 3ZT0A 3G10A 3DLBA 1JKHA 2FBVA 4FZYA 1BGXT 3VA3A 5C25A 3NE6A 4RW7A 4FK0A 3AVJA 4Z4CA 3CQ8A 4E3SA 3AVCA 1KRPA 2KQ2A 4LH5A 3V9ZA 4F4KA 1ASUA 2WONA 3ZSWA 3OS2A 5D3GA 4DQRA 3TANA 1FKOA 4WE1A 3EYZA 1S9EA 4FM2A 1LV5A 3RR7A 1QE1A 3AVFA 3HSTB 4IDKA 4JLHA 1BQMA 2P1JA 3O3FA 3NCIA 4FJ9A 1NK4A 3HL8A 4FM0A 4FLTA 4IKFA 2D0AA 1XI1A 4KAZA 3QNOA 4FM1A 3LALA 1RDCA 1Y97A 1HPZA 4E7KA 4FJIA 4PQUA 1BL3A 2HHSA 3LDSA 3SQ4A 4IFYA 1HYZA 1EX4A 2HW3A 4FZZA 1NK5A 5CZ2A 4CJPA 2I5JA 4PUOA 1D5AA 1D8YA 3TAMA 2D0CA 1TGOA 3KIOA 2HNZA 3QEPA 3WNEA 4M45A 1SUQA 4DG1A 4JRQA 3DMJA 3OVNA 1J9AA 3C95A 4O4GA 4AHVA 4W5OA 2Z1HA 4H4OA 1LWEA 4PA1A 1JLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9F A;  4FLU A;  3VQ4 A;  2EHG A;  1WSE A;  3LPT A;  4CGH A;  4C8O A;  1NKB A;  1NJW A;  3HPH A;  4EP5 A;  1RBS A;  4FJK A;  1TV6 A;  3QES A;  1GOA A;  4CJK A;  3VQQ A;  3DRR A;  4AH9 A;  4ICL A;  3OYM A;  1UAX A;  1Z26 A;  1B9D A;  1RT6 A;  3V81 A;  4KI6 A;  4J2B A;  2XHB A;  4CHP A;  3CFR A;  3SYZ A;  2G8H A;  1B92 A;  1XC9 A;  1C1A A;  1X1P A;  3ZCM A;  4EZ6 A;  1TL1 A;  1C0M A;  2ITG A;  2Z1J A;  4CJ3 A;  4DQQ A;  4M42 A;  3AA4 A;  4OVL A;  5FRO A;  3K57 A;  3L8B A;  1S1X A;  5FRM A;  3OYF A;  2HHV A;  3V1Q A;  4DFK A;  4FJH A;  4BAC A;  1WSJ A;  3IRX A;  4DS4 A;  2KW4 A;  4CHY A;  2PYJ A;  1RDD A;  4ID1 A;  2OYQ A;  1JXE A;  1D9D A;  3TR8 A;  4JRP A;  1RDA A;  3ISN C;  3SPZ A;  4CGD A;  4W5R A;  3U3Y A;  1TK0 A;  4HCB A;  1CZ9 A;  1CZB A;  1NK0 A;  1RTJ A;  1KFD A;  3DI6 A;  1HNV A;  3HPG A;  1W0H A;  4O0J A;  3AVI A;  3ZT1 A;  4E7H A;  1ZBI A;  1N5Y A;  4QCL A;  4RG8 A;  3O4Q A;  1EKE A;  3B6O A;  3LP1 A;  1RBT A;  3VA0 A;  4DTJ A;  4Z4G A;  3CFP A;  4Z0U A;  2W42 A;  4BE0 A;  1RTD A;  2OPQ A;  3PX4 A;  4EZ9 A;  5FRN A;  1C1B A;  3V9X A;  2F8T A;  1EP4 A;  5I3U A;  4OKK A;  3VQ5 A;  4I9Q A;  1VSF A;  1TKX A;  1NJZ A;  2HNY A;  2OPP A;  1HMV A;  3AA3 A;  3DM2 A;  3MXI A;  1T03 A;  1EET A;  2HHW A;  4FK2 A;  3LWL A;  1HQE A;  3ZT3 A;  1RIL A;  1UWB A;  1WSH A;  2IOC A;  2RPI A;  3B6P A;  3HM9 A;  4BE1 A;  4KHQ A;  3HO1 A;  1RT1 A;  3ALY A;  3L2W A;  3C94 A;  4CIF A;  2R7Y A;  1GOB A;  1TVR A;  1S5J A;  3ZSX A;  4KHS A;  4DSE A;  4OGE A;  3LP2 A;  1FKP A;  1JXB A;  1J53 A;  3TAB A;  3HVT A;  4DTR A;  1SV5 A;  1BIZ A;  2VG7 A;  5SWM A;  1NJY A;  3PO4 A;  4CF9 A;  1KVA A;  3S3N A;  3SUN A;  4CEF A;  1W9H A;  4FK4 A;  1K6Y A;  2KZM A;  1IO2 A;  3VQ9 A;  2BE2 A;  4ELV A;  4DSJ A;  1TK5 A;  1BI4 A;  2P51 A;  3LAM A;  1NK6 A;  2KZZ A;  1S1V A;  1I3A A;  3RTV A;  4OJR A;  4DSI A;  1VSD A;  1G15 A;  1LWF A;  1MU2 A;  2ATQ A;  3O3H A;  2VWJ A;  2HVH A;  3PX0 A;  3O3G A;  4FLW A;  1KFS A;  3F73 A;  2DTU A;  4O0I A;  4FJ8 A;  3TAR A;  1KLN A;  4CK3 A;  5HRN A;  1L5U A;  1LAW A;  3SV3 A;  3DLR A;  1NKC A;  3OYB A;  4DQI A;  2GV9 A;  3S9H A;  4J2A A;  1WLJ A;  4DMN A;  3AO2 A;  4CFC A;  4CGI A;  4B8A B;  2IGI A;  4CEZ A;  4XIU A;  3V4I A;  3SCX A;  3WNG A;  3LWM A;  4Q0B A;  4YFU A;  4E0D A;  4DWI A;  3VQB A;  4HUE A;  4M3R A;  4H4M A;  4I7F A;  4BDZ A;  1Q9X A;  2G8W A;  4FJM A;  1C0U A;  4OPK A;  4Z4H A;  4O5B A;  2QKB A;  4M3U A;  1BI4 B;  4CEE A;  3RMD A;  4RW8 A;  5HRO A;  1C1C A;  1FXX A;  3P1G A;  5DK5 A;  3ZSZ A;  1LW0 A;  3KLI A;  3HVR A;  1JLQ A;  3LAN A;  1RT5 A;  4BWM A;  4E7I A;  4OLB A;  1RT2 A;  2VG6 A;  2Y1J A;  3QO9 A;  4TSX A;  5JS2 A;  3NF9 A;  3VQA A;  4CEQ A;  1VSI A;  1IKV A;  1KVB A;  1WAJ A;  4FW2 A;  3CFO A;  3OS0 A;  4E7L A;  4NYF A;  3V6D A;  1NOY A;  1L3T A;  4B9M A;  3CG7 A;  4KKO A;  3NH1 A;  3PY8 A;  3SI6 A;  1RTH A;  3O4N A;  3TAP A;  4B9U A;  1L3S A;  3S3M A;  4DTO A;  3OYJ A;  3K5L A;  4KRF A;  4DSF A;  3P5J A;  2X74 A;  3MEG A;  4YNQ A;  3AO3 A;  4CER A;  1Q9Y A;  4FJ7 A;  3UIQ A;  4B3O A;  4B8C A;  1JLC A;  2D5R A;  3PO5 A;  4KPY A;  4C8N A;  4DS5 A;  1WSG A;  1YT3 A;  4N41 A;  3RRG A;  3QLH A;  2IDO A;  3HK2 A;  2OPS A;  1J5O A;  4FLV A;  3IG1 A;  4B9V A;  4FVM A;  3SNN A;  4N47 A;  1DTT A;  3VQE A;  4DF8 A;  4QAG A;  4FLY A;  3D45 A;  4DTX A;  2IAJ A;  1JLG A;  1U04 A;  4CE9 A;  3ULD A;  2OZM A;  4CFB A;  3MAQ A;  1RDB A;  5CYM A;  2FC0 A;  1JL1 A;  3CM6 A;  4DTN A;  4AHR A;  3P83 D;  3M8Q A;  1HJR A;  5CYQ A;  4OLA A;  1REV A;  3G0Z A;  4KTW A;  3OYH A;  1A5V A;  2G8I A;  5KGX A;  1TL3 A;  3AO4 A;  3ZT4 A;  4CJQ A;  3KK2 A;  4C8M A;  1ASW A;  1JLB A;  4CHZ A;  1KVC A;  3FFI A;  2G8F A;  4DQP A;  3TAG A;  1BIU A;  2XRI A;  2HHU A;  4Y1D A;  3LZJ A;  4CIE A;  4KRE A;  4FYD A;  3THV A;  4NCA A;  1TKZ A;  4CJT A;  1XHX A;  2Z1G A;  2VWK A;  1HNI A;  1RBV A;  1WN7 A;  4CF2 A;  3QEW A;  1KCF A;  4G1Q A;  3M8P A;  1ZBU A;  4BDP A;  4ELU A;  1U4B A;  1S1W A;  3DLG A;  3M8R A;  2KFZ A;  4DLE A;  2YHB A;  3BDP A;  3ASM A;  3CYM A;  5J2M A;  1NKE A;  2OA8 A;  1LAV A;  3NH0 A;  4KHN A;  3HT3 A;  4F3O A;  1HRH A;  1VRU A;  4J2D A;  2DFF A;  5HRR A;  2X6N A;  3TAE A;  2O4G A;  1ITG A;  2NUB A;  5KGW A;  4FJL A;  2WOM A;  1VSL A;  3MEE A;  4F8R A;  1UA0 A;  2BAN A;  3VQC A;  2X6S A;  3RMB A;  4OPJ A;  3EY1 A;  3OYG A;  1QSY A;  1RBR A;  1RCH A;  1SL0 A;  1JL2 A;  3DLK A;  3AV9 A;  4GMJ B;  1ZBH A;  2RN2 A;  2DFH A;  3SUO A;  1ZBL A;  2OZS A;  3OYN A;  1Z25 A;  5K14 A;  1S9G A;  3DYA A;  4CJ4 A;  2B5J A;  1YVU A;  3KK1 A;  4BE2 A;  2RF2 A;  4M3T A;  4AHT A;  1QQC A;  3DOK A;  3QIP A;  4M3X A;  3L2V A;  4KTQ A;  5T7B A;  1KTQ A;  4CEC A;  4FJX A;  1ZYQ A;  3AVB A;  1U48 A;  2ZD1 A;  3MXM A;  3SV4 A;  4CJV A;  2QKK A;  3SUQ A;  2P5G A;  3NHG A;  5KRS A;  1RT3 A;  4KO0 A;  3SPY A;  4F2S A;  4CGF A;  1NJX A;  3SJJ A;  1QTM A;  5J2P A;  4LY7 A;  2B4J A;  5KI6 A;  3OYL A;  3LP0 A;  4Z4E A;  3K5N A;  2HHT A;  1BIS A;  3LZI A;  3C6T A;  2LSN A;  4ID5 A;  3ITH A;  4CJU A;  1I39 A;  3HP6 A;  4FZX C;  4DFM A;  1CLQ A;  1ASV A;  4L8R B;  1HYS A;  3K5M A;  4HCC A;  3HYF A;  3QER A;  1VSM A;  3I0R A;  3KD5 E;  4H8K A;  4BDY A;  3VQP A;  3HJF A;  4J2E A;  1IKX A;  4B9N A;  5C24 A;  4I2P A;  3QIN A;  1BCM A;  4FW1 A;  4M3Y A;  5FDL A;  4QOZ B;  1KSP A;  1JLA A;  2YKM A;  4MFB A;  3CM5 A;  3BGR A;  3L2U A;  3QEV A;  2BDP A;  3DRP A;  2XY7 A;  4E1M A;  5SZT A;  2DFE A;  1VRT A;  4CF1 A;  1NK9 A;  1S1U A;  3NGY A;  4Y1C A;  3TAQ A;  4LSN A;  4AHU A;  3NF7 A;  4CJW A;  4KHW A;  3DOL A;  5HRP A;  4W5Q A;  2HVI A;  3RWU A;  3KJV A;  2YV0 X;  1SKS A;  3OYC A;  1L3U A;  2FBT A;  3RRH A;  3AVM A;  4I9L A;  1R0A A;  4C8L A;  3SZ2 A;  1L3V A;  3LPU A;  4HHT A;  1BHL A;  3NGZ A;  3OYA A;  2E6M A;  1BCO A;  1F21 A;  3ZSR A;  4OKE A;  4CES A;  3TI0 A;  2D0B A;  3NFA A;  4CHQ A;  2XO7 A;  3M8S A;  3NF8 A;  3I0S A;  4IG0 A;  4AHC A;  4B9S A;  4N56 A;  4M41 A;  4CIG A;  4CFA A;  4CJE A;  4DTU A;  3VQ8 A;  3JSM A;  3NBP A;  1CXU A;  4B08 A;  3MED A;  2ETJ A;  4FLX A;  4NYN A;  1WNS A;  3AVA A;  4R5P A;  4HVJ A;  1O1W A;  3HP9 A;  5HRS A;  3OYK A;  4CED A;  5KRT A;  4DFJ A;  2QK9 A;  3E01 A;  1XHZ A;  2B6A A;  3SQ2 A;  2O4I A;  2FBY A;  4DTS A;  4DSL A;  4K8Z A;  4C8K A;  3V1O A;  3TAF A;  1VSH A;  4OKJ A;  1U47 A;  3ZSQ A;  2HB5 A;  1JLE A;  5EU7 A;  2JLE A;  4KFB A;  3OJU A;  3ZSO A;  4LH4 A;  1U49 A;  4E89 A;  1RBU A;  4HUF A;  1S6P A;  1VSJ A;  1UOC A;  3PV8 A;  2AJQ A;  3KKS A;  3KLF A;  2KFN A;  1DTQ A;  1T05 A;  2G8V A;  2HND A;  1X9M A;  3DLH A;  4BWJ A;  4CK2 A;  1LW2 A;  2Z1I A;  3OYI A;  5KTQ A;  3V9S A;  3OYE A;  4LD0 A;  3VQD A;  4OGC A;  2YNG A;  3AO1 A;  4W5T A;  1EXQ A;  4EP4 A;  1Q8I A;  5HBM A;  4KV8 A;  3NGI A;  4Z4F A;  4AHS A;  4JS5 A;  3DLE A;  2E6L A;  3KKR A;  3PUF A;  4PY5 A;  3T3F A;  5C42 A;  2EX3 A;  3IS9 A;  3L2R A;  3QET A;  2PY5 A;  1A5X A;  4CJ5 A;  2PYL A;  3HXM A;  4NCG A;  1HYV A;  4DSK A;  4DTM A;  3C6U A;  1YTU A;  4KB1 A;  3QEI A;  4CF8 A;  4ZHR A;  3MXJ A;  1QSL A;  3T19 A;  2ZQB A;  3NAE A;  5J1E A;  1X9W A;  3S3O A;  4CJR A;  2XY5 A;  1IG9 A;  3VQ7 A;  1J54 A;  4O44 A;  3WNH A;  3K59 A;  2IS3 A;  3U6F A;  3ZSY A;  1NK8 A;  2BGG A;  4W5N A;  4DF4 A;  3LAK A;  4GVM A;  3NDK A;  4PWD A;  4RW9 A;  2IC3 A;  1IH7 A;  1S1T A;  3ZT2 A;  4Z4I A;  5CY4 A;  3OYD A;  4FLZ A;  2KTQ A;  1HQU A;  3AO5 A;  3V1R A;  1TAU A;  1TKT A;  4DFP A;  1SKW A;  5E41 A;  2PZS A;  1FK9 A;  2FBX A;  4IG3 A;  3SQ1 A;  4FJG A;  3NF6 A;  4HTU A;  3MEC A;  4IFV A;  3RMA A;  2G8K A;  3PX6 A;  3KTQ A;  2QXF A;  3OJS A;  4KHY A;  5CZ1 A;  2JGU A;  3AVN A;  3WNF A;  2A1S A;  3T1A A;  4E1N A;  3KLH A;  2YNH A;  2RKI A;  3EZ5 A;  4HUG A;  2G8U A;  4DU3 A;  4JS4 A;  1VSK A;  2YHA A;  4DLG A;  1QS4 A;  3KLG A;  4ZTF A;  1DLO A;  3AVK A;  4CEO A;  1IKW A;  4FJ5 A;  3L3U A;  3AVH A;  2VG5 A;  4CHN A;  4CGG A;  3D0P A;  1RT4 A;  3KK3 A;  2F8S A;  3LP3 A;  1NOZ A;  4B9L A;  4KI4 A;  4M3Z A;  2ZE2 A;  3NH2 A;  1C0T A;  3AVL A;  4FXD A;  4DU1 A;  5HP1 A;  1RT7 A;  3SQ0 A;  1N6Q A;  2A1R A;  3KD1 E;  1CXQ A;  3SUP A;  1WAF A;  4KTZ A;  4O55 A;  2GBZ A;  4FJJ A;  2P5O A;  2YNI A;  4FCY A;  4KHU A;  1XWL A;  2GUI A;  3ZSV A;  5DMR A;  3OS1 A;  1VSE A;  3QEX A;  4GW6 A;  3IAY A;  4CK1 A;  3QIO A;  1TK8 A;  3K5O A;  4FJN A;  4E19 A;  2Y1I A;  3I8D A;  1C6V A;  1VK0 A;  3K58 A;  4N76 A;  2E4L A;  4CFD A;  2YKN A;  4AIL C;  1NK7 A;  3U3G A;  3AA2 A;  2HHQ A;  3V9W A;  2HMI A;  2DY4 A;  4RW4 A;  2X78 A;  1S6Q A;  4UQG A;  4KB0 A;  5JS1 A;  3L3V A;  1A5W A;  5I42 A;  3JYT A;  4CEB A;  4MQ3 A;  3A2F A;  3L2Q A;  2XY8 A;  2XY6 A;  1IKY A;  1RTI A;  1U45 A;  1X9S A;  4I2Q A;  4N5S A;  1SKR A;  1WSF A;  4CHO A;  4CCH A;  4CJL A;  4E7J A;  1B9F A;  4ZTJ A;  4DQS A;  4ELT A;  1LWC A;  5J2Q A;  3V9U A;  3H08 A;  2OPR A;  4F3T A;  1GOC A;  4DTP A;  1KLM A;  4CJF A;  3RMC A;  4F2R A;  1SL2 A;  4IBN A;  3DRS A;  3TWH A;  3VQ6 A;  5HLF A;  1SL1 A;  1RNH A;  2YNF A;  1QHT A;  1UA1 A;  1BQN A;  2Q3S A;  1TAQ A;  2HHX A;  4CJS A;  4CEA A;  3OY9 A;  4LSL A;  4Q5V A;  4K8X A;  5J2N A;  1T8E A;  1T7P A;  4CF0 A;  4DU4 A;  3F9K A;  4NCB A;  3K2P A;  1QSS A;  3VN5 A;  3QNN A;  3RR8 A;  1WSI A;  1YTA A;  3HPO A;  3AA5 X;  3KLE A;  2F96 A;  4RW6 A;  1ZBF A;  4CGJ A;  4M3W A;  4B9T A;  3AVG A;  1TKD A;  3ZT0 A;  3G10 A;  3DLB A;  1JKH A;  2FBV A;  4FZY A;  1BGX T;  3VA3 A;  5C25 A;  3NE6 A;  4RW7 A;  4FK0 A;  3AVJ A;  4Z4C A;  3CQ8 A;  4E3S A;  3AVC A;  1KRP A;  2KQ2 A;  4LH5 A;  3V9Z A;  4F4K A;  1ASU A;  2WON A;  3ZSW A;  3OS2 A;  5D3G A;  4DQR A;  3TAN A;  1FKO A;  4WE1 A;  3EYZ A;  1S9E A;  4FM2 A;  1LV5 A;  3RR7 A;  1QE1 A;  3AVF A;  3HST B;  4IDK A;  4JLH A;  1BQM A;  2P1J A;  3O3F A;  3NCI A;  4FJ9 A;  1NK4 A;  3HL8 A;  4FM0 A;  4FLT A;  4IKF A;  2D0A A;  1XI1 A;  4KAZ A;  3QNO A;  4FM1 A;  3LAL A;  1RDC A;  1Y97 A;  1HPZ A;  4E7K A;  4FJI A;  4PQU A;  1BL3 A;  2HHS A;  3LDS A;  3SQ4 A;  4IFY A;  1HYZ A;  1EX4 A;  2HW3 A;  4FZZ A;  1NK5 A;  5CZ2 A;  4CJP A;  2I5J A;  4PUO A;  1D5A A;  1D8Y A;  3TAM A;  2D0C A;  1TGO A;  3KIO A;  2HNZ A;  3QEP A;  3WNE A;  4M45 A;  1SUQ A;  4DG1 A;  4JRQ A;  3DMJ A;  3OVN A;  1J9A A;  3C95 A;  4O4G A;  4AHV A;  4W5O A;  2Z1H A;  4H4O A;  1LWE A;  4PA1 A;  1JLF A; 
#chains in the Genus database with same CATH topology
 1D9F A;  3QFP A;  3LPT A;  3ZEU B;  2UXD K;  4EP5 A;  1RBS A;  2VWB A;  1TV6 A;  3QES A;  3HI0 A;  4CJK A;  4AH9 A;  1B9D A;  2XHB A;  3CFR A;  2NRH A;  2UU9 K;  2HF4 A;  1C1A A;  3U9D A;  1VQ4 N;  3ZCM A;  4EZ6 A;  1TL1 A;  2ITG A;  4CJ3 A;  3R6M A;  3I56 N;  3L8B A;  2HHV A;  1WSJ A;  4IOX A;  4CHY A;  2KLA A;  4ID1 A;  3UKU B;  4BRF A;  3WEE A;  3TR8 A;  4CGD A;  4WQ4 A;  2PAV A;  1W0H A;  4IJA A;  4O0J A;  1ZBI A;  5AQH A;  4E7H A;  1EKE A;  1RBT A;  3VF4 A;  2QXL A;  1C0G A;  3CFP A;  3PIO L;  1K9M O;  1BA0 A;  5FRN A;  1DKG D;  4OPA A;  2GEM A;  3MCA B;  4OKK A;  1NJZ A;  2YX6 A;  2HHW A;  3ZT3 A;  1RIL A;  4KHQ A;  3ALY A;  3L2W A;  3ZSX A;  5AQU A;  4GVE A;  3LP2 A;  1FKP A;  1SAZ A;  4DTR A;  1YAG A;  5LJW A;  4CF9 A;  4JEP A;  4CEF A;  4JKC A;  4FK4 A;  2KZM A;  3VQ9 A;  2BE2 A;  4DSJ A;  5KPR A;  3HTV A;  4GV3 A;  3I8B A;  2ATQ A;  2HVH A;  2DTU A;  3PX0 A;  3HBT A;  1KFS A;  4O0I A;  1KLN A;  4H5N A;  5HRN A;  3P4I A;  5AQM A;  3S9H A;  3AO2 A;  4CFC A;  4CGI A;  3FE1 A;  3D6R A;  3VEX A;  5C2D A;  4E0D A;  4PL7 A;  3EEQ A;  2EWS A;  4H4M A;  2G8W A;  4FJM A;  1NG9 A;  2VQF K;  1BWF O;  4XEI A;  3C6A A;  2ASO A;  5HRO A;  3KLI A;  4DV5 K;  3LAN A;  1NNE A;  2OCE A;  2Y1J A;  3QO9 A;  5JS2 A;  4CBW A;  1YVN A;  1VSI A;  5AQQ A;  4B3R K;  5BRE A;  2E1Y A;  1NOY A;  4LF7 K;  4KKO A;  3VGM A;  3D2F A;  3NH1 A;  1RTH A;  3O4N A;  3JAM O;  4B9U A;  3S3M A;  4DTO A;  1KC8 O;  3P5J A;  2X74 A;  5E84 A;  4YNQ A;  4CER A;  4RCH A;  3PO5 A;  4C8N A;  3ZEU A;  3HK2 A;  3DLL L;  2OPS A;  4ILG B;  1V4S A;  4FLV A;  3T1H K;  4FVM A;  4BRM A;  1DTT A;  4O8U A;  3VQE A;  4PHT X;  4E1J A;  4FLY A;  3D45 A;  4DTX A;  1JLG A;  2OZM A;  3CIP A;  5CYM A;  1E3M A;  1JL1 A;  4DTN A;  2ZGY A;  4LF8 K;  1REV A;  5CE3 A;  2G8I A;  5KGX A;  1TL3 A;  3ZX0 A;  4CD3 A;  1Q7Y O;  1JLB A;  4FWS A;  1KVC A;  3FFI A;  2O8C B;  4CZJ A;  1EWR A;  2AP1 A;  2HHU A;  4Y1D A;  3GOI A;  1TKZ A;  3TTF A;  4EHU A;  1RBV A;  3M8P A;  1ZBU A;  1U4B A;  1S1W A;  2YHW A;  1KXP A;  3WXI A;  3BDP A;  5EY4 A;  1LAV A;  3NH0 A;  4J2D A;  3RSE A;  5HRR A;  3THY A;  3TAE A;  2NUB A;  1BA1 A;  4F8R A;  4CBX A;  1JCE A;  5BRD A;  4FOI A;  4DR1 K;  5AQI A;  3H3O B;  3AV9 A;  2ZJR L;  2F9W A;  3SLC A;  4DR5 K;  4DV3 K;  5K14 A;  3ENO A;  3ATV A;  3KK1 A;  4BE2 A;  5CR4 A;  3CCR N;  4M3X A;  2P9K A;  2WUS A;  4KTQ A;  5AQV A;  2A5X A;  4ISE A;  4U67 L;  4DV7 K;  3SV4 A;  4YDU C;  5KRS A;  4KO0 A;  4F2S A;  1N36 K;  2GUP A;  3O1B A;  1QTM A;  3CC7 N;  4K42 A;  4LY7 A;  5KI6 A;  3OYL A;  3LP0 A;  4H0X B;  2ITM A;  4JI0 K;  1I39 A;  4WYB A;  4FZX C;  4DFM A;  1XC3 A;  4JI5 K;  5KQ8 A;  1ZC6 A;  1YJ9 N;  4H8K A;  3HJF A;  3CCV N;  1GLE G;  2E1Z A;  1XUP O;  2O8F A;  1JLA A;  4MFB A;  3CM5 A;  3QEV A;  4B9Q A;  2XY7 A;  4FSV A;  4MO4 A;  2DFE A;  4CF1 A;  3CET A;  4B3M K;  4KHW A;  4FWK A;  3DOL A;  2YV0 X;  1L3U A;  1R0A A;  4HHT A;  1BHL A;  1D4X A;  1BCO A;  3TI0 A;  3KVG A;  3T1Y K;  2HBM A;  5IWA K;  3RR8 A;  3NF8 A;  4IG0 A;  4N56 A;  5ADX A;  3VQ8 A;  4FLX A;  1O1W A;  1TYQ A;  3DWL A;  3O08 A;  5M1P A;  4JI1 K;  4CED A;  3OYK A;  2QI2 A;  4DFJ A;  2QK9 A;  4OO1 J;  2O4I A;  2BH1 A;  3TAF A;  3I55 N;  1G99 A;  1U47 A;  4HUF A;  1RBU A;  3PV8 A;  1S6P A;  4YOW A;  4JNE A;  4JN4 A;  3KLF A;  2KFN A;  1X9M A;  4JKA A;  2A42 A;  4FWR A;  3QDK A;  3VGL A;  4A62 A;  3V9S A;  1TUY A;  2ZM6 K;  3AO1 A;  3D2E A;  2J4R A;  2D0P A;  1X3N A;  3NGI A;  4Z4F A;  1Y64 A;  2E6L A;  3GL1 A;  3PUF A;  2EX3 A;  3QET A;  3ZYY X;  2PYL A;  4NCG A;  3C6U A;  1QQO A;  3HOS A;  1YTU A;  1TUU A;  4JHD A;  3QEI A;  2ASM A;  1QSL A;  3WQT A;  3T19 A;  5J1E A;  3J7Z O;  4DUZ K;  4O44 A;  4FOE A;  1NK8 A;  3ZSY A;  3LAK A;  5JLF A;  4RW9 A;  5EXW A;  1S1T A;  1YUW A;  2ZF5 O;  3A5M C;  3ZT2 A;  3OYD A;  1TAU A;  4DFP A;  1SKW A;  2PZS A;  1FK9 A;  1EO1 A;  5BPM A;  3MEC A;  3RMA A;  4KHY A;  2JGU A;  2YNH A;  2GTD A;  1QZ5 A;  4JS4 A;  1VSK A;  3O9R A;  4OPH A;  4LF4 K;  1IKW A;  1KAX A;  1QQN A;  2VG5 A;  2D1K A;  4M7X A;  2F8S A;  4C23 A;  3NH2 A;  4FXD A;  2QWL A;  5HP1 A;  1RT7 A;  3SQ0 A;  1N6Q A;  1CXQ A;  3SUP A;  4G9Z A;  4FJJ A;  2YNI A;  3CC2 N;  1EWQ A;  4KHU A;  1CZA N;  2O8E A;  2GUI A;  3WUH A;  1NWK A;  4GW6 A;  3QIO A;  4A2A A;  3VER A;  1ZXO A;  1TK8 A;  4E19 A;  2E4L A;  4AIL C;  2YKN A;  2F9T A;  1S6Q A;  5JS1 A;  3L3V A;  5I42 A;  3A2F A;  3L2Q A;  2XY6 A;  1X9S A;  1WOQ A;  4CHO A;  3FZK A;  3ULE B;  5E26 A;  1HNX K;  4ELT A;  2QM1 A;  5J2Q A;  2HBJ A;  2VQE K;  3V9U A;  2OPR A;  1HLU A;  5MLC Q;  4YDU A;  1SL2 A;  2VGM A;  3DRS A;  1RNH A;  1QHT A;  4NXM K;  2HHX A;  3OY9 A;  3THW B;  4Q5V A;  1RDW X;  4K8X A;  4CF0 A;  1QSS A;  3QNN A;  1WSI A;  3HPO A;  4BG8 A;  4B1W B;  4M3W A;  1T6D A;  3VEY A;  3WXM B;  4KH5 A;  4FZY A;  4GV6 A;  1BGX T;  1MA9 B;  4MO5 A;  1K8A O;  4RW7 A;  1KRP A;  3OW2 M;  4LH5 A;  2OTJ N;  4FM2 A;  2YHY A;  1S9E A;  3AVF A;  3NCI A;  3O3F A;  4FM0 A;  1J6Z A;  4WF9 L;  3LAL A;  1RDC A;  3MCP A;  4YOX A;  3E9P A;  1BL3 A;  3EO3 A;  3SQ4 A;  1EX4 A;  3F2K A;  2HW3 A;  2PBD A;  1NK5 A;  3D2F B;  4CJP A;  2I5J A;  4PUO A;  3G25 A;  2JWL A;  4CZE A;  4DR3 K;  1U2V B;  2HNZ A;  3WNE A;  2I7N A;  1JCG A;  4W5O A;  4FLU A;  3VTI A;  2EHG A;  2P9N A;  4FJK A;  3E9O A;  1GOA A;  1RFQ A;  1DT9 A;  3DRR A;  3O1W A;  3UE5 A;  4DR6 K;  4KI6 A;  4J2B A;  4IEI A;  5A2Q O;  4BQZ A;  1YIT N;  4RTF D;  3VEV A;  4M42 A;  4OVL A;  3OYF A;  3V1Q A;  3KWI A;  1YF5 L;  3IRX A;  5BRF A;  2P9L A;  1RDD A;  3ZLJ A;  1HNW K;  1JXE A;  1D9D A;  5F0X A;  4JRP A;  3SPZ A;  4W5R A;  1CZ9 A;  2V52 B;  1C0F A;  3DI6 A;  2FSK A;  3O4Q A;  3B6O A;  5GAH P;  4CZL A;  4DTJ A;  4Z4G A;  1P90 A;  2W42 A;  4BE0 A;  4EZ9 A;  4IXC A;  3ID6 A;  1C1B A;  2F8T A;  1EP4 A;  5I3U A;  3U9Z A;  1VSF A;  3PSF A;  5KPZ A;  1HMV A;  2OPP A;  1T03 A;  4ISG A;  4H0Y B;  1EET A;  3LWL A;  3B6P A;  4K0K K;  3C94 A;  2R7Y A;  4KHS A;  1S5J A;  3R8E A;  2IVO A;  4BRN A;  3BF3 A;  2UUB K;  5SWM A;  2V7Y A;  3HZ6 A;  1KVA A;  4CZK A;  1K6Y A;  1VQL N;  2DPN A;  3SBG A;  4IO8 A;  1TK5 A;  3LAM A;  3SAG A;  3RTV A;  4DSI A;  4KBO A;  1LWF A;  2E88 A;  4B1Z A;  3A5N C;  3A5O C;  1LAW A;  4NLB A;  1NBW A;  4CEZ A;  5H1S Q;  3V4I A;  2D0O A;  3LWM A;  4Q0B A;  4B1V A;  3I33 A;  2E5L K;  2W41 A;  3C0B A;  4O5B A;  1BI4 B;  3RMD A;  3OBW A;  1FXX A;  1NMN A;  1MWK A;  1LW0 A;  5F2R A;  3ZSZ A;  3ATU A;  1S72 N;  4JYA K;  4E7I A;  4BRG A;  4TSX A;  3CPW M;  3NF9 A;  4MDB A;  3VQA A;  2UUC K;  1IKV A;  3V6D A;  3CFO A;  4B9M A;  4NYF A;  3SI6 A;  2UXC K;  4BC2 A;  4O8K A;  3K5L A;  1Q9Y A;  1E4F T;  1R59 O;  4GKJ K;  3ID8 A;  4KPY A;  1YT3 A;  4BRI A;  1NGB A;  4BC5 A;  4FWM A;  4CVN E;  4QAG A;  4CE9 A;  5AQS A;  4CFB A;  3MAQ A;  2FC0 A;  2YCH A;  3P83 D;  1HJR A;  3WQU A;  2WBN A;  3OYH A;  1A5V A;  3ZT4 A;  4BR4 A;  4C8M A;  1SS6 A;  1NGA A;  3GG4 A;  4CHZ A;  1YI2 N;  3VEN A;  5DM6 L;  2RE2 A;  2E8A A;  1P8Z A;  3PLA A;  4FYD A;  3THV A;  5BN9 A;  4CJT A;  3S41 A;  3LL3 A;  1XHX A;  4BR0 A;  5ELZ A;  1ATS A;  1HNI A;  1KCF A;  4G1Q A;  5EVZ A;  4BDP A;  2YHB A;  1NKE A;  2OA8 A;  2ASP A;  4H5W A;  3TSU A;  1HRH A;  1VRU A;  2DFF A;  2X6N A;  2O4G A;  3MEE A;  4DV1 K;  4JI2 K;  2X6S A;  1RCH A;  1SL0 A;  3DLK A;  3TPQ A;  4GMJ B;  3SUO A;  2DFH A;  3OYN A;  1Z25 A;  1YXQ A;  2B5J A;  1QZ6 A;  2KKZ A;  2RF2 A;  1QQC A;  3DOK A;  3QIP A;  3R3L A;  5T7B A;  4CEC A;  4B1Y B;  3OTO K;  1M1K O;  1XQS C;  3AVB A;  2QKK A;  3SUQ A;  1W7A A;  4DV2 K;  2P5G A;  3SJJ A;  3M3Z A;  4Z4E A;  4H03 B;  4HWI A;  1QQM A;  1JCF A;  2HHT A;  2LSN A;  3KWG A;  4CJU A;  4AF1 A;  3THW A;  1GLF O;  4L8R B;  3FR0 A;  4HCC A;  4EAH D;  2VCP A;  3I0R A;  1VQ6 N;  3QIN A;  4BR9 A;  1BCM A;  1NGJ A;  4QOZ B;  1KSP A;  1VHX A;  3DXM B;  3BGR A;  1W2B M;  4M7Y A;  3LDN A;  2F4V K;  3O80 A;  5SZT A;  1S1U A;  3TAQ A;  2ZGZ A;  5ADX H;  4AHU A;  4BVP A;  3L4I A;  3QML A;  2FLO A;  1SKS A;  3FZM A;  5M1O A;  3AVM A;  4C8L A;  3SZ2 A;  3LPU A;  3C6H A;  3OYA A;  1F21 A;  4CES A;  3NFA A;  2XO7 A;  2AA4 A;  4M41 A;  5M1K A;  3CJ7 A;  1V4T A;  4FWL A;  4IJN A;  4B08 A;  2NRX A;  3J7Y P;  4R5P A;  4LF5 K;  2NRZ A;  3HP9 A;  4DKW A;  1N33 K;  1XHZ A;  2FBY A;  3EKS A;  4DTS A;  3LDO A;  4OKJ A;  2HB5 A;  5EU7 A;  3TSQ A;  2H3G X;  3OJU A;  2Q1N A;  3CI5 A;  3ZSO A;  3CME N;  4FWN A;  4BQL A;  5AQZ A;  1T05 A;  4BWJ A;  4CK2 A;  1LW2 A;  4CZH A;  4A5B A;  2QWO A;  1HX1 A;  1Q18 A;  4PKH A;  5FPD A;  4EP4 A;  1Q8I A;  5EX5 A;  4KV8 A;  1IBL K;  4AHS A;  4JS5 A;  3CJB A;  2HF3 A;  3O9Q A;  3MX5 A;  3ZET B;  4PY5 A;  3L2R A;  3HXM A;  3UKU A;  4DTM A;  4KB1 A;  4DQ8 A;  3H1Q A;  3S3O A;  3SMS A;  4CJR A;  3J80 O;  4H0V B;  3VQ7 A;  3U6F A;  3CJ1 A;  2BGG A;  3BP8 A;  4WQ4 C;  3NDK A;  4PWD A;  2IC3 A;  3TU5 A;  4X62 K;  4FLZ A;  2QWM A;  5BRH A;  3V1R A;  1TKT A;  5E41 A;  2FBX A;  4X66 K;  1BO5 O;  4HTU A;  4JKG B;  2IVP A;  2QXF A;  3OJS A;  3KTQ A;  3AVN A;  4FVU A;  2A1S A;  4MLE A;  2G8U A;  2RKI A;  2E2N A;  4LF6 K;  2O8C A;  3KLG A;  3AVK A;  3JXU A;  3L3U A;  3EE8 A;  3MN6 A;  3IKM A;  3LP3 A;  3FFK B;  3Q7C A;  1JJ2 M;  4B9L A;  2ZE2 A;  3A8Y A;  2A3Z A;  4M63 C;  1WAF A;  3EZW A;  4O55 A;  2CH6 A;  4K43 A;  3J81 O;  2VGN A;  3WXL A;  5LMN K;  3K5O A;  5CHI A;  2Y1I A;  3I8D A;  1VK0 A;  3K58 A;  4YHH K;  1NK7 A;  4GV9 A;  2QEX N;  3V9W A;  2DY4 A;  2X78 A;  2A41 A;  3TTC A;  1A5W A;  3CXC M;  4MQ3 A;  1S3X A;  2XY8 A;  1U45 A;  1IKY A;  4JK8 A;  3VF6 A;  1SKR A;  4CCH A;  1HKG A;  4E7J A;  3THX A;  1B9F A;  3H08 A;  4F3T A;  3PSI A;  4BR7 A;  1IBK K;  4IBN A;  3TWH A;  1SL1 A;  5HLF A;  2YNF A;  1UA1 A;  1BQN A;  4CJ7 A;  4YOR A;  3F9K A;  3AAR A;  3VN5 A;  3EKU A;  4IOA L;  1YTA A;  2P9S A;  3KLE A;  1GLL O;  1ZBF A;  3CER A;  1OH6 A;  2HMP A;  2FBV A;  3VA3 A;  1XNR K;  4FK0 A;  4Z4C A;  3CQ8 A;  4E3S A;  2KQ2 A;  3V9Z A;  3ZSW A;  3OS2 A;  4A61 A;  4WE1 A;  3RR7 A;  4MLH A;  4IDK A;  1BQM A;  2P1J A;  4FO0 A;  3D2E B;  2CGL A;  4FLT A;  1ESV A;  2D0A A;  1XI1 A;  4KAZ A;  2O8E B;  1HNZ K;  1Y97 A;  5AQL A;  4GNI A;  1NU0 A;  3SBT A;  2HHS A;  3LDS A;  4LFC K;  3ZX2 A;  4IFY A;  4BG9 A;  5CZ2 A;  4BR5 A;  2UUA K;  1OVY A;  3HSC A;  2P9P A;  1D5A A;  4L3Q A;  4K41 A;  1U2V A;  2D0C A;  3QEP A;  3N4P A;  2RHK A;  4AHV A;  1J9A A;  2W6K A;  4O4G A;  4H4O A;  4BRH A;  4PA1 A;  1JLF A;  4DS4 A;  1FW6 A;  4AM7 A;  1WSE A;  1NKB A;  4LFB K;  5AJ3 K;  5C2F A;  3HPH A;  3LDL A;  3MN9 A;  3VQQ A;  5KPT A;  3ENB A;  3OYM A;  1Z26 A;  4IFE A;  5AQN A;  5FPN A;  3SYZ A;  2YI1 A;  2G8H A;  1XC9 A;  1C0M A;  2Z1J A;  4DQQ A;  3AY9 A;  3AA4 A;  3K57 A;  5FRO A;  4DR4 K;  1VQ5 N;  1S1X A;  1O13 A;  1TYQ B;  5M1N A;  4BRL A;  4BAC A;  2P9L B;  4CBU A;  2PYJ A;  2KW4 A;  1VQO N;  2E2P A;  1VQP N;  2OYQ A;  3DXM A;  1TK0 A;  4HCB A;  3CJ9 A;  1CZB A;  1YJN N;  1KFD A;  2I7P A;  2QWR A;  3AVI A;  4MDA A;  1N5Y A;  3C65 A;  4DR2 K;  4Z0U A;  1RTD A;  4XH1 A;  3PX4 A;  4HTL A;  2IVN A;  4FWO A;  3V9X A;  3EN9 A;  3B8A X;  1J5E K;  4I9Q A;  4LC9 B;  1TKX A;  2OTL N;  2HNY A;  3MXI A;  3AA3 A;  3DM2 A;  3CCU N;  4FK2 A;  1HQE A;  4BE1 A;  2CH5 A;  2RPI A;  3HM9 A;  3HO1 A;  1RT1 A;  4DUY K;  4CIF A;  4BRQ A;  1TVR A;  2Q97 A;  4YY3 K;  1U6Z A;  3HRG A;  1J53 A;  3HVT A;  3W0L A;  1BIZ A;  2VG7 A;  3FZH A;  1NJY A;  2GWJ A;  3SUN A;  1W9H A;  4ELV A;  2P51 A;  4OJR A;  1VSD A;  1MU2 A;  2Q36 A;  2FXU A;  3O3G A;  3F73 A;  1T3V A;  5I9E B;  1BDG A;  1SQK A;  3FGU A;  3VTH A;  4WFA L;  4DQI A;  2GV9 A;  2NRR A;  1WLJ A;  4DMN A;  4XIU A;  4X65 K;  4JKB A;  4FL9 A;  2QWN A;  4HUE A;  4OPK A;  4Z4H A;  4JAX A;  4M3U A;  1HPM A;  1OH5 A;  3VF2 A;  4RW8 A;  1C1C A;  3AAP A;  3P1G A;  4BGB A;  3EL2 A;  1RT2 A;  4E7L A;  3OS0 A;  1KVB A;  4JI8 K;  3QBX A;  5C10 A;  4EHT A;  3PY8 A;  2ZJP L;  3OYJ A;  5BPN A;  4KRF A;  5C15 A;  4FJ7 A;  4B3O A;  4B8C A;  1JLC A;  3A0I X;  4IOC L;  4DS5 A;  3GDQ A;  4N41 A;  3RRG A;  3NMU A;  4WQ5 C;  2P9I B;  3G4S N;  3Q7B A;  3C7N B;  3IG1 A;  4B9V A;  3SNN A;  4N47 A;  4DF8 A;  4UY8 O;  2IAJ A;  1U04 A;  3LM2 A;  3O9T A;  1RDB A;  4AHR A;  5CYQ A;  4C1N I;  3H3N O;  1VAZ A;  3TTD A;  4JI3 K;  1WB9 A;  3KK2 A;  1ASW A;  5TKW A;  3CHW A;  2G8F A;  3J7A P;  4DQP A;  1Q81 O;  3WT0 A;  2WC9 A;  5JIC A;  4NCA A;  2Z1G A;  2VWK A;  4CF2 A;  3QEW A;  3ULE A;  4ELU A;  3DLG A;  5FLX O;  2KFZ A;  3OBY A;  4JD2 B;  5J2M A;  3QB0 A;  4CI6 A;  1VQN N;  3HT3 A;  4F3O A;  4OX9 K;  1RDU A;  4DR7 K;  1ITG A;  4WFN L;  4FJL A;  2WOM A;  1VSL A;  4CZI A;  2BAN A;  5AQP A;  1RGI A;  3EY1 A;  5FPM A;  3OYG A;  4J8F A;  4IWV A;  4BY9 C;  2O8F B;  3DYA A;  3F9M A;  4AHT A;  3L2V A;  3A5L C;  1ZYQ A;  2ZD1 A;  3MXM A;  4CJV A;  3NHG A;  1MWM A;  4CGF A;  1NJX A;  5J2P A;  2UXB K;  1BIS A;  2Q0U A;  4H5V A;  5AFU A;  2Q31 A;  1Q82 O;  3HOT A;  1CLQ A;  1ASV A;  1OH8 A;  1HYS A;  3K5M A;  3QER A;  1VSM A;  4BDY A;  2O8B B;  4BRE A;  5LY3 A;  2FF6 A;  5GIP A;  1IKX A;  5C24 A;  3K0S A;  4I2P A;  5AQW A;  4CZG A;  4FW1 A;  3WEE B;  5AQY A;  4EFH A;  2YKM A;  3L2U A;  2BDP A;  3DRP A;  3FZL A;  4LF9 K;  3UKR B;  4CJW A;  3GBT A;  2HVI A;  4W5Q A;  5HRP A;  5FPE A;  2FBT A;  3RRH A;  3NGZ A;  2E6M A;  3ZSR A;  4OKE A;  2D0B A;  3M8S A;  4B9S A;  3CMA N;  2HST A;  4CFA A;  3LDP A;  3MED A;  2ETJ A;  4NYN A;  4QS9 A;  4HVJ A;  5HRS A;  1N34 K;  5KRT A;  3E01 A;  2B6A A;  3SQ2 A;  4K8Z A;  4C8K A;  3V1O A;  1JLE A;  4BC3 A;  4KFB A;  1U49 A;  4LH4 A;  1KAZ A;  1VSJ A;  1UOC A;  3KKS A;  5JVH L;  4H0P A;  1YJW N;  2G8V A;  3DLH A;  1MDU B;  2Z1I A;  3OYI A;  5KTQ A;  3OYE A;  4LD0 A;  1K8K A;  2VYP A;  4OGC A;  3VQD A;  3BY5 A;  1EXQ A;  3VMF B;  5LJV A;  1EQY A;  5HBM A;  3U4L A;  3DLE A;  3KKR A;  4PL8 A;  5C42 A;  3DXK A;  3VOV A;  5C12 A;  2PY5 A;  1Z6R A;  4A57 A;  1HYV A;  4DSK A;  3CCM N;  4CF8 A;  4ZHR A;  2P9P B;  1GLC G;  3MXJ A;  2E20 A;  2ZQB A;  3NAE A;  3O6W A;  3KZB A;  4NXN K;  2XY5 A;  4QS7 A;  1J54 A;  4WFB L;  3WNH A;  5GIN A;  3K9J A;  4GVM A;  5AQO A;  2HOE A;  3CQY A;  4Z4I A;  1DEJ A;  2P9N B;  1OH7 A;  1XMQ K;  3AO5 A;  5M1Q A;  4JKH A;  1NGE A;  1KD1 O;  4IG3 A;  3SQ1 A;  3KHY A;  3NF6 A;  1S22 A;  1H1V A;  2G8K A;  1VQ7 N;  3T69 A;  4CD1 A;  4HUG A;  3J8A A;  4E1N A;  3EZ5 A;  1FJG K;  4DU3 A;  1ZBS A;  4IZ9 A;  4DLG A;  1QS4 A;  4K25 A;  4CEO A;  4FJ5 A;  2NRV A;  4BGA A;  4BR2 A;  4QS8 A;  3DJC A;  4CGG A;  5M1F A;  1RT4 A;  1XNQ K;  3O4W A;  5GAD P;  4H0O A;  3H6E A;  1N8R O;  5DM7 L;  4IO9 L;  3OA9 A;  2GBZ A;  2P5O A;  4FCY A;  3T7Z A;  5DMR A;  3QEX A;  4AQY K;  3TSP A;  3VGK A;  5KQD A;  4A2B A;  1C6V A;  4CFD A;  4PKI A;  2HHQ A;  3QBW A;  4RW4 A;  4UQG A;  4KB0 A;  3BEX A;  3BUZ B;  3MN7 A;  2OAN A;  4BRC A;  1RTI A;  1X3M A;  4I2Q A;  4N5S A;  1WSF A;  5BR8 K;  2NLX A;  3C7N A;  3BZK A;  4DQS A;  2E2Q A;  1Z05 A;  2YHX A;  3G6E N;  4CJF A;  3RMC A;  3IMX A;  4F2R A;  1ATR A;  3VQ6 A;  1QVG M;  2Q3S A;  1TAQ A;  2O8D A;  4LSL A;  3N4Q A;  5J2N A;  1T8E A;  4NCB A;  2HBL A;  4DU4 A;  3K2P A;  5AZJ B;  2F96 A;  3L4Q A;  4RW6 A;  3PIP L;  1TKD A;  5GIO A;  1JKH A;  1BOT O;  5C25 A;  1KAY A;  3NE6 A;  3AVJ A;  3AVC A;  2QWQ A;  3R1X A;  3QFU A;  1ASU A;  2WON A;  3CPE A;  1OVQ A;  4DQR A;  3THX B;  3TAN A;  1FKO A;  2CGK A;  3DAW A;  3HST B;  1LOT B;  4WCE L;  2E2O A;  3E66 A;  1NK4 A;  3HL8 A;  4DV6 K;  3CJC A;  2ZWH A;  4FM1 A;  1KQS M;  1HPZ A;  2ZJQ L;  3VET A;  4FZZ A;  2HBK A;  4C1N K;  2PFU A;  5JLH A;  4M45 A;  4DG1 A;  2NRT A;  3OVN A;  4JRQ A;  2Z1H A;  1LWE A;  1U48 A;  3P38 A;  3L6Q A;  3VQ4 A;  4CGH A;  4C8O A;  4CZM A;  1NJW A;  1Q86 O;  2V51 B;  2Q2R A;  4ICL A;  1UAX A;  1RT6 A;  3V81 A;  4CHP A;  4YOT A;  1B92 A;  1E4G T;  1X1P A;  3CJA A;  4BRD A;  4B1U B;  4H5T A;  5FRM A;  1WUA A;  4BC4 A;  4DFK A;  4FJH A;  3DXK B;  1YHQ N;  1HUX A;  4XH5 A;  1RDA A;  3ISN C;  3U3Y A;  1NK0 A;  1RTJ A;  2A40 A;  1HNV A;  4DV4 K;  3HPG A;  2JWK A;  3ZT1 A;  3MN5 A;  4QCL A;  4RG8 A;  3LP1 A;  3VA0 A;  1QVF M;  1K8K B;  2OPQ A;  5BN8 A;  2D4W A;  1IJJ A;  3O9S A;  3VQ5 A;  5GAE P;  4JKG A;  3VEW A;  2F7T A;  1WSH A;  1UWB A;  3MDQ A;  2IOC A;  4JHD B;  1GOB A;  1HKB A;  4CZF A;  4DSE A;  4KH4 A;  4OGE A;  1JXB A;  3TAB A;  1SV5 A;  3PO4 A;  3S3N A;  3WXJ A;  4BRA A;  4GKK K;  1IO2 A;  1BI4 A;  1NK6 A;  3SK3 A;  2KZZ A;  1S1V A;  1I3A A;  3WXK A;  1G15 A;  3O3H A;  2VWJ A;  4FLW A;  4FWP A;  4JKD A;  4FJ8 A;  3HM8 A;  3TAR A;  4CK3 A;  1L5U A;  1NKC A;  3SV3 A;  3DLR A;  3OYB A;  2QTD A;  3L0Q A;  4J2A A;  3U8X A;  4B8A B;  2IGI A;  3ZET A;  3SCX A;  2BTF A;  3WNG A;  4YFU A;  1SZ2 A;  2O8B A;  4KHP K;  4DWI A;  3VQB A;  3P39 A;  4M3R A;  4I7F A;  4BDZ A;  4FWQ A;  1Q9X A;  1C0U A;  2QKB A;  4DCH A;  4CEE A;  5DK5 A;  3HVR A;  4NLC A;  1JLQ A;  4BWM A;  1RT5 A;  4OLB A;  3MWP A;  4EIA A;  2VG6 A;  3ZX3 A;  4CEQ A;  1WAJ A;  4FW2 A;  3QIC A;  1L3T A;  5AQR A;  3CG7 A;  2GX9 A;  4B3T K;  1DGK N;  4JKF A;  3TAP A;  1L3S A;  1HJO A;  4DSF A;  3MEG A;  4Z94 A;  3AO3 A;  4Y0W A;  3UIQ A;  4IEE A;  2D5R A;  2IIR A;  1WSG A;  3QLH A;  2IDO A;  1J5O A;  4B1X B;  3M5R A;  4CW7 B;  5LL6 Z;  3THY B;  3CD6 N;  3LM9 A;  3W3D A;  5C0Y A;  3ULD A;  1HKC A;  3CM6 A;  4OLA A;  3M8Q A;  1NGI A;  3G0Z A;  4KTW A;  3AO4 A;  4CJQ A;  4I6M B;  1OKJ A;  2YJE A;  2W6L A;  3F5T A;  3TAG A;  1BIU A;  2P9K B;  2XRI A;  3LZJ A;  4CIE A;  4KRE A;  3VPZ A;  2WFB A;  2GEL A;  1BG3 A;  1NGG A;  1WN7 A;  5AZI B;  3VEO A;  3M8R A;  4DLE A;  2QA4 N;  3ASM A;  3CCL N;  2P9U B;  3CYM A;  4JD2 A;  4KHN A;  3VES A;  3BZC A;  1NLV A;  5KGW A;  5AQF A;  1UA0 A;  3VQC A;  3R9P A;  3RMB A;  4OPJ A;  1QHA A;  1QSY A;  1RBR A;  1K73 O;  4F9O A;  1JL2 A;  3IUC A;  1WBB A;  1ZBH A;  2RN2 A;  1GLA G;  1ZBL A;  2OZS A;  4CJ4 A;  1S9G A;  3AGR A;  1YVU A;  5F1X A;  4M3T A;  2UYT A;  2NRW A;  5AFU H;  1KTQ A;  1NM1 A;  4FJX A;  3H46 O;  2YJF A;  5BPL A;  1RT3 A;  5EOY A;  3P31 A;  3SPY A;  2B4J A;  3K5N A;  3MX2 A;  2FSN A;  1T6C A;  3LZI A;  3C6T A;  4ID5 A;  1VQ8 N;  3ITH A;  3CF5 L;  1W97 L;  3HP6 A;  5AQX A;  5AQG A;  4JI6 K;  3HYF A;  4I6M A;  3KD5 E;  2QW9 A;  5IT9 O;  3VQP A;  4J2E A;  1YIJ N;  4B9N A;  4V19 S;  2W40 A;  1NGD A;  5GAG P;  5TKY A;  5FDL A;  4M3Y A;  2FSJ A;  5AQK A;  3O9U A;  5JVG L;  1T44 A;  4E1M A;  1VRT A;  1NK9 A;  3NGY A;  4Y1C A;  4ISF A;  4LSN A;  2Q0R A;  3NF7 A;  1NGF A;  3O5B A;  3UKR A;  3RWU A;  3KJV A;  1GLB G;  3OYC A;  2FF3 B;  2QWP A;  4I9L A;  3IDH A;  1VQ9 N;  1L3V A;  3H1V X;  3AGK A;  4H0T B;  4CHQ A;  4X64 K;  3I0S A;  4AHC A;  4CIG A;  3VEZ A;  4CJE A;  4DTU A;  2HHH K;  3JSM A;  4XH4 A;  3NBP A;  1CXU A;  4FPB A;  3CQX A;  3E1Y A;  1WNS A;  1BU6 O;  1NGH A;  3AVA A;  2P9I A;  5JMV A;  3CCQ N;  4DSL A;  4DB3 A;  4A59 A;  1VSH A;  3ZSQ A;  5B8H A;  2JLE A;  4E89 A;  2AJQ A;  2V7Z A;  1DTQ A;  2HND A;  3SJH A;  4JV5 K;  2YNG A;  3CC4 N;  3SMP A;  4W5T A;  4LFA K;  4GY2 B;  4YOV A;  3T3F A;  3IS9 A;  1A5X A;  4CJ5 A;  3MMV A;  5AZI A;  3OHR A;  3ENH A;  1X9W A;  1IG9 A;  3K59 A;  2IS3 A;  4W5N A;  4BRO A;  4DF4 A;  4NO7 A;  1NGC A;  1N32 K;  1IH7 A;  3BF1 A;  5CY4 A;  2KTQ A;  1HQU A;  4YOU A;  4IDH A;  4WQ5 A;  4FJG A;  1IG8 A;  4IFV A;  4NB4 A;  3FLC O;  3PX6 A;  1IV0 A;  2GWK A;  5CZ1 A;  3WNF A;  3KLH A;  3T1A A;  3RVC A;  2YHA A;  4ZTF A;  1DLO A;  4KH6 A;  1GLJ O;  3AVH A;  1X9J A;  4BRK A;  4CHN A;  3D0P A;  4H5R A;  4DHY A;  1ILY A;  3AAQ A;  3KK3 A;  1NMD A;  1ATN A;  1NOZ A;  4KI4 A;  4M3Z A;  1C0T A;  3AVL A;  4DU1 A;  1NJI O;  3KD1 E;  2A1R A;  4R79 A;  2P9U A;  3H45 C;  3MK6 A;  5AQJ A;  4KTZ A;  5AR0 A;  3IFR A;  1XWL A;  3ZSV A;  3OS1 A;  5AZJ A;  4AM6 A;  1VSE A;  3IAY A;  4CK1 A;  3E9L A;  1VQM N;  4FJN A;  4N76 A;  3U3G A;  3AA2 A;  3LDQ A;  2HMI A;  4FPA A;  3CCE N;  5HOO A;  3JYT A;  4CEB A;  1I94 K;  2P9S B;  3FZF A;  2KHO A;  2NNW A;  4YOY A;  1GLD G;  3NVM A;  4CJL A;  4JKE A;  4JK9 A;  4ZTJ A;  4B3S K;  4JI4 K;  4U7B A;  1LWC A;  1GOC A;  4DTP A;  1KLM A;  5HL7 L;  3EE9 A;  2A6A A;  3O8M A;  3D7E O;  3G71 N;  4CJS A;  4CEA A;  3CCJ N;  4PKG A;  3K9K A;  1T7P A;  3M1F A;  3SAF A;  4JI7 K;  4BVO A;  3AA5 X;  4CGJ A;  4JK7 A;  3MWT A;  4B9T A;  3AVG A;  3ZT0 A;  3G10 A;  5LMU K;  3DLB A;  3JS6 A;  1XMO K;  5BR9 A;  5AQT A;  3CCS N;  3KK7 A;  4F4K A;  3SAH A;  5D3G A;  1LV5 A;  3EYZ A;  2CGJ A;  4A5A A;  4JLH A;  1QE1 A;  1M90 O;  4FJ9 A;  3RSE B;  1IBM K;  2WTU A;  4IKF A;  4O5F A;  3QNO A;  4ILJ A;  4E7K A;  4FJI A;  4PQU A;  3M6G A;  4ILH A;  2O8D B;  4RWT A;  1WBD A;  1HYZ A;  3UB5 A;  1D8Y A;  1BUP A;  3TAM A;  4BRP A;  1TGO A;  2NZT A;  3KIO A;  2BUP A;  1HR0 K;  4DV0 K;  1VQK N;  1SUQ A;  3NVK A;  3DMJ A;  3C95 A;  1LCU A;  3GE1 A; 
#chains in the Genus database with same CATH homology
 1D9F A;  4FLU A;  3VQ4 A;  2EHG A;  1WSE A;  3LPT A;  4CGH A;  4C8O A;  1NKB A;  1NJW A;  3HPH A;  4EP5 A;  1RBS A;  4FJK A;  1TV6 A;  3QES A;  1GOA A;  4CJK A;  3VQQ A;  3DRR A;  4AH9 A;  4ICL A;  3OYM A;  1UAX A;  1Z26 A;  1B9D A;  1RT6 A;  3V81 A;  4KI6 A;  4J2B A;  2XHB A;  4CHP A;  3CFR A;  3SYZ A;  2G8H A;  1B92 A;  1XC9 A;  1C1A A;  1X1P A;  3ZCM A;  4EZ6 A;  1TL1 A;  1C0M A;  2ITG A;  2Z1J A;  4CJ3 A;  4DQQ A;  4M42 A;  3AA4 A;  4OVL A;  5FRO A;  3K57 A;  3L8B A;  1S1X A;  5FRM A;  3OYF A;  2HHV A;  3V1Q A;  4DFK A;  4FJH A;  4BAC A;  1WSJ A;  3IRX A;  4DS4 A;  2KW4 A;  4CHY A;  2PYJ A;  1RDD A;  4ID1 A;  2OYQ A;  1JXE A;  1D9D A;  3TR8 A;  4JRP A;  1RDA A;  3ISN C;  3SPZ A;  4CGD A;  4W5R A;  3U3Y A;  1TK0 A;  4HCB A;  1CZ9 A;  1CZB A;  1NK0 A;  1RTJ A;  1KFD A;  3DI6 A;  1HNV A;  3HPG A;  1W0H A;  4O0J A;  3AVI A;  3ZT1 A;  4E7H A;  1ZBI A;  1N5Y A;  4QCL A;  4RG8 A;  3O4Q A;  1EKE A;  3B6O A;  3LP1 A;  1RBT A;  3VA0 A;  4DTJ A;  4Z4G A;  3CFP A;  4Z0U A;  2W42 A;  4BE0 A;  1RTD A;  2OPQ A;  3PX4 A;  4EZ9 A;  5FRN A;  1C1B A;  3V9X A;  2F8T A;  1EP4 A;  5I3U A;  4OKK A;  3VQ5 A;  4I9Q A;  1VSF A;  1TKX A;  1NJZ A;  2HNY A;  2OPP A;  1HMV A;  3AA3 A;  3DM2 A;  3MXI A;  1T03 A;  1EET A;  2HHW A;  4FK2 A;  3LWL A;  1HQE A;  3ZT3 A;  1RIL A;  1UWB A;  1WSH A;  2IOC A;  2RPI A;  3B6P A;  3HM9 A;  4BE1 A;  4KHQ A;  3HO1 A;  1RT1 A;  3ALY A;  3L2W A;  3C94 A;  4CIF A;  2R7Y A;  1GOB A;  1TVR A;  1S5J A;  3ZSX A;  4KHS A;  4DSE A;  4OGE A;  3LP2 A;  1FKP A;  1JXB A;  1J53 A;  3TAB A;  3HVT A;  4DTR A;  1SV5 A;  1BIZ A;  2VG7 A;  5SWM A;  1NJY A;  3PO4 A;  4CF9 A;  1KVA A;  3S3N A;  3SUN A;  4CEF A;  1W9H A;  4FK4 A;  1K6Y A;  2KZM A;  1IO2 A;  3VQ9 A;  2BE2 A;  4ELV A;  4DSJ A;  1TK5 A;  1BI4 A;  2P51 A;  3LAM A;  1NK6 A;  2KZZ A;  1S1V A;  1I3A A;  3RTV A;  4OJR A;  4DSI A;  1VSD A;  1G15 A;  1LWF A;  1MU2 A;  2ATQ A;  3O3H A;  2VWJ A;  2HVH A;  3PX0 A;  3O3G A;  4FLW A;  1KFS A;  3F73 A;  2DTU A;  4O0I A;  4FJ8 A;  3TAR A;  1KLN A;  4CK3 A;  5HRN A;  1L5U A;  1LAW A;  3SV3 A;  3DLR A;  1NKC A;  3OYB A;  4DQI A;  2GV9 A;  3S9H A;  4J2A A;  1WLJ A;  4DMN A;  3AO2 A;  4CFC A;  4CGI A;  4B8A B;  2IGI A;  4CEZ A;  4XIU A;  3V4I A;  3SCX A;  3WNG A;  3LWM A;  4Q0B A;  4YFU A;  4E0D A;  4DWI A;  3VQB A;  4HUE A;  4M3R A;  4H4M A;  4I7F A;  4BDZ A;  1Q9X A;  2G8W A;  4FJM A;  1C0U A;  4OPK A;  4Z4H A;  4O5B A;  2QKB A;  4M3U A;  1BI4 B;  4CEE A;  3RMD A;  4RW8 A;  5HRO A;  1C1C A;  1FXX A;  3P1G A;  5DK5 A;  3ZSZ A;  1LW0 A;  3KLI A;  3HVR A;  1JLQ A;  3LAN A;  1RT5 A;  4BWM A;  4E7I A;  4OLB A;  1RT2 A;  2VG6 A;  2Y1J A;  3QO9 A;  4TSX A;  5JS2 A;  3NF9 A;  3VQA A;  4CEQ A;  1VSI A;  1IKV A;  1KVB A;  1WAJ A;  4FW2 A;  3CFO A;  3OS0 A;  4E7L A;  4NYF A;  3V6D A;  1NOY A;  1L3T A;  4B9M A;  3CG7 A;  4KKO A;  3NH1 A;  3PY8 A;  3SI6 A;  1RTH A;  3O4N A;  3TAP A;  4B9U A;  1L3S A;  3S3M A;  4DTO A;  3OYJ A;  3K5L A;  4KRF A;  4DSF A;  3P5J A;  2X74 A;  3MEG A;  4YNQ A;  3AO3 A;  4CER A;  1Q9Y A;  4FJ7 A;  3UIQ A;  4B3O A;  4B8C A;  1JLC A;  2D5R A;  3PO5 A;  4KPY A;  4C8N A;  4DS5 A;  1WSG A;  1YT3 A;  4N41 A;  3RRG A;  3QLH A;  2IDO A;  3HK2 A;  2OPS A;  1J5O A;  4FLV A;  3IG1 A;  4B9V A;  4FVM A;  3SNN A;  4N47 A;  1DTT A;  3VQE A;  4DF8 A;  4QAG A;  4FLY A;  3D45 A;  4DTX A;  2IAJ A;  1JLG A;  1U04 A;  4CE9 A;  3ULD A;  2OZM A;  4CFB A;  3MAQ A;  1RDB A;  5CYM A;  2FC0 A;  1JL1 A;  3CM6 A;  4DTN A;  4AHR A;  3P83 D;  3M8Q A;  1HJR A;  5CYQ A;  4OLA A;  1REV A;  3G0Z A;  4KTW A;  3OYH A;  1A5V A;  2G8I A;  5KGX A;  1TL3 A;  3AO4 A;  3ZT4 A;  4CJQ A;  3KK2 A;  4C8M A;  1ASW A;  1JLB A;  4CHZ A;  1KVC A;  3FFI A;  2G8F A;  4DQP A;  3TAG A;  1BIU A;  2XRI A;  2HHU A;  4Y1D A;  3LZJ A;  4CIE A;  4KRE A;  4FYD A;  3THV A;  4NCA A;  1TKZ A;  4CJT A;  1XHX A;  2Z1G A;  2VWK A;  1HNI A;  1RBV A;  1WN7 A;  4CF2 A;  3QEW A;  1KCF A;  4G1Q A;  3M8P A;  1ZBU A;  4BDP A;  4ELU A;  1U4B A;  1S1W A;  3DLG A;  3M8R A;  2KFZ A;  4DLE A;  2YHB A;  3BDP A;  3ASM A;  3CYM A;  5J2M A;  1NKE A;  2OA8 A;  1LAV A;  3NH0 A;  4KHN A;  3HT3 A;  4F3O A;  1HRH A;  1VRU A;  4J2D A;  2DFF A;  5HRR A;  2X6N A;  3TAE A;  2O4G A;  1ITG A;  2NUB A;  5KGW A;  4FJL A;  2WOM A;  1VSL A;  3MEE A;  4F8R A;  1UA0 A;  2BAN A;  3VQC A;  2X6S A;  3RMB A;  4OPJ A;  3EY1 A;  3OYG A;  1QSY A;  1RBR A;  1RCH A;  1SL0 A;  1JL2 A;  3DLK A;  3AV9 A;  4GMJ B;  1ZBH A;  2RN2 A;  2DFH A;  3SUO A;  1ZBL A;  2OZS A;  3OYN A;  1Z25 A;  5K14 A;  1S9G A;  3DYA A;  4CJ4 A;  2B5J A;  1YVU A;  3KK1 A;  4BE2 A;  2RF2 A;  4M3T A;  4AHT A;  1QQC A;  3DOK A;  3QIP A;  4M3X A;  3L2V A;  4KTQ A;  5T7B A;  1KTQ A;  4CEC A;  4FJX A;  1ZYQ A;  3AVB A;  1U48 A;  2ZD1 A;  3MXM A;  3SV4 A;  4CJV A;  2QKK A;  3SUQ A;  2P5G A;  3NHG A;  5KRS A;  1RT3 A;  4KO0 A;  3SPY A;  4F2S A;  4CGF A;  1NJX A;  3SJJ A;  1QTM A;  5J2P A;  4LY7 A;  2B4J A;  5KI6 A;  3OYL A;  3LP0 A;  4Z4E A;  3K5N A;  2HHT A;  1BIS A;  3LZI A;  3C6T A;  2LSN A;  4ID5 A;  3ITH A;  4CJU A;  1I39 A;  3HP6 A;  4FZX C;  4DFM A;  1CLQ A;  1ASV A;  4L8R B;  1HYS A;  3K5M A;  4HCC A;  3HYF A;  3QER A;  1VSM A;  3I0R A;  3KD5 E;  4H8K A;  4BDY A;  3VQP A;  3HJF A;  4J2E A;  1IKX A;  4B9N A;  5C24 A;  4I2P A;  3QIN A;  1BCM A;  4FW1 A;  4M3Y A;  5FDL A;  4QOZ B;  1KSP A;  1JLA A;  2YKM A;  4MFB A;  3CM5 A;  3BGR A;  3L2U A;  3QEV A;  2BDP A;  3DRP A;  2XY7 A;  4E1M A;  5SZT A;  2DFE A;  1VRT A;  4CF1 A;  1NK9 A;  1S1U A;  3NGY A;  4Y1C A;  3TAQ A;  4LSN A;  4AHU A;  3NF7 A;  4CJW A;  4KHW A;  3DOL A;  5HRP A;  4W5Q A;  2HVI A;  3RWU A;  3KJV A;  2YV0 X;  1SKS A;  3OYC A;  1L3U A;  2FBT A;  3RRH A;  3AVM A;  4I9L A;  1R0A A;  4C8L A;  3SZ2 A;  1L3V A;  3LPU A;  4HHT A;  1BHL A;  3NGZ A;  3OYA A;  2E6M A;  1BCO A;  1F21 A;  3ZSR A;  4OKE A;  4CES A;  3TI0 A;  2D0B A;  3NFA A;  4CHQ A;  2XO7 A;  3M8S A;  3NF8 A;  3I0S A;  4IG0 A;  4AHC A;  4B9S A;  4N56 A;  4M41 A;  4CIG A;  4CFA A;  4CJE A;  4DTU A;  3VQ8 A;  3JSM A;  3NBP A;  1CXU A;  4B08 A;  3MED A;  2ETJ A;  4FLX A;  4NYN A;  1WNS A;  3AVA A;  4R5P A;  4HVJ A;  1O1W A;  3HP9 A;  5HRS A;  3OYK A;  4CED A;  5KRT A;  4DFJ A;  2QK9 A;  3E01 A;  1XHZ A;  2B6A A;  3SQ2 A;  2O4I A;  2FBY A;  4DTS A;  4DSL A;  4K8Z A;  4C8K A;  3V1O A;  3TAF A;  1VSH A;  4OKJ A;  1U47 A;  3ZSQ A;  2HB5 A;  1JLE A;  5EU7 A;  2JLE A;  4KFB A;  3OJU A;  3ZSO A;  4LH4 A;  1U49 A;  4E89 A;  1RBU A;  4HUF A;  1S6P A;  1VSJ A;  1UOC A;  3PV8 A;  2AJQ A;  3KKS A;  3KLF A;  2KFN A;  1DTQ A;  1T05 A;  2G8V A;  2HND A;  1X9M A;  3DLH A;  4BWJ A;  4CK2 A;  1LW2 A;  2Z1I A;  3OYI A;  5KTQ A;  3V9S A;  3OYE A;  4LD0 A;  3VQD A;  4OGC A;  2YNG A;  3AO1 A;  4W5T A;  1EXQ A;  4EP4 A;  1Q8I A;  5HBM A;  4KV8 A;  3NGI A;  4Z4F A;  4AHS A;  4JS5 A;  3DLE A;  2E6L A;  3KKR A;  3PUF A;  4PY5 A;  3T3F A;  5C42 A;  2EX3 A;  3IS9 A;  3L2R A;  3QET A;  2PY5 A;  1A5X A;  4CJ5 A;  2PYL A;  3HXM A;  4NCG A;  1HYV A;  4DSK A;  4DTM A;  3C6U A;  1YTU A;  4KB1 A;  3QEI A;  4CF8 A;  4ZHR A;  3MXJ A;  1QSL A;  3T19 A;  2ZQB A;  3NAE A;  5J1E A;  1X9W A;  3S3O A;  4CJR A;  2XY5 A;  1IG9 A;  3VQ7 A;  1J54 A;  4O44 A;  3WNH A;  3K59 A;  2IS3 A;  3U6F A;  3ZSY A;  1NK8 A;  2BGG A;  4W5N A;  4DF4 A;  3LAK A;  4GVM A;  3NDK A;  4PWD A;  4RW9 A;  2IC3 A;  1IH7 A;  1S1T A;  3ZT2 A;  4Z4I A;  5CY4 A;  3OYD A;  4FLZ A;  2KTQ A;  1HQU A;  3AO5 A;  3V1R A;  1TAU A;  1TKT A;  4DFP A;  1SKW A;  5E41 A;  2PZS A;  1FK9 A;  2FBX A;  4IG3 A;  3SQ1 A;  4FJG A;  3NF6 A;  4HTU A;  3MEC A;  4IFV A;  3RMA A;  2G8K A;  3PX6 A;  3KTQ A;  2QXF A;  3OJS A;  4KHY A;  5CZ1 A;  2JGU A;  3AVN A;  3WNF A;  2A1S A;  3T1A A;  4E1N A;  3KLH A;  2YNH A;  2RKI A;  3EZ5 A;  4HUG A;  2G8U A;  4DU3 A;  4JS4 A;  1VSK A;  2YHA A;  4DLG A;  1QS4 A;  3KLG A;  4ZTF A;  1DLO A;  3AVK A;  4CEO A;  1IKW A;  4FJ5 A;  3L3U A;  3AVH A;  2VG5 A;  4CHN A;  4CGG A;  3D0P A;  1RT4 A;  3KK3 A;  2F8S A;  3LP3 A;  1NOZ A;  4B9L A;  4KI4 A;  4M3Z A;  2ZE2 A;  3NH2 A;  1C0T A;  3AVL A;  4FXD A;  4DU1 A;  5HP1 A;  1RT7 A;  3SQ0 A;  1N6Q A;  2A1R A;  3KD1 E;  1CXQ A;  3SUP A;  1WAF A;  4KTZ A;  4O55 A;  2GBZ A;  4FJJ A;  2P5O A;  2YNI A;  4FCY A;  4KHU A;  1XWL A;  2GUI A;  3ZSV A;  5DMR A;  3OS1 A;  1VSE A;  3QEX A;  4GW6 A;  3IAY A;  4CK1 A;  3QIO A;  1TK8 A;  3K5O A;  4FJN A;  4E19 A;  2Y1I A;  3I8D A;  1C6V A;  1VK0 A;  3K58 A;  4N76 A;  2E4L A;  4CFD A;  2YKN A;  4AIL C;  1NK7 A;  3U3G A;  3AA2 A;  2HHQ A;  3V9W A;  2HMI A;  2DY4 A;  4RW4 A;  2X78 A;  1S6Q A;  4UQG A;  4KB0 A;  5JS1 A;  3L3V A;  1A5W A;  5I42 A;  3JYT A;  4CEB A;  4MQ3 A;  3A2F A;  3L2Q A;  2XY8 A;  2XY6 A;  1IKY A;  1RTI A;  1U45 A;  1X9S A;  4I2Q A;  4N5S A;  1SKR A;  1WSF A;  4CHO A;  4CCH A;  4CJL A;  4E7J A;  1B9F A;  4ZTJ A;  4DQS A;  4ELT A;  1LWC A;  5J2Q A;  3V9U A;  3H08 A;  2OPR A;  4F3T A;  1GOC A;  4DTP A;  1KLM A;  4CJF A;  3RMC A;  4F2R A;  1SL2 A;  4IBN A;  3DRS A;  3TWH A;  3VQ6 A;  5HLF A;  1SL1 A;  1RNH A;  2YNF A;  1QHT A;  1UA1 A;  1BQN A;  2Q3S A;  1TAQ A;  2HHX A;  4CJS A;  4CEA A;  3OY9 A;  4LSL A;  4Q5V A;  4K8X A;  5J2N A;  1T8E A;  1T7P A;  4CF0 A;  4DU4 A;  3F9K A;  4NCB A;  3K2P A;  1QSS A;  3VN5 A;  3QNN A;  3RR8 A;  1WSI A;  1YTA A;  3HPO A;  3AA5 X;  3KLE A;  2F96 A;  4RW6 A;  1ZBF A;  4CGJ A;  4M3W A;  4B9T A;  3AVG A;  1TKD A;  3ZT0 A;  3G10 A;  3DLB A;  1JKH A;  2FBV A;  4FZY A;  1BGX T;  3VA3 A;  5C25 A;  3NE6 A;  4RW7 A;  4FK0 A;  3AVJ A;  4Z4C A;  3CQ8 A;  4E3S A;  3AVC A;  1KRP A;  2KQ2 A;  4LH5 A;  3V9Z A;  4F4K A;  1ASU A;  2WON A;  3ZSW A;  3OS2 A;  5D3G A;  4DQR A;  3TAN A;  1FKO A;  4WE1 A;  3EYZ A;  1S9E A;  4FM2 A;  1LV5 A;  3RR7 A;  1QE1 A;  3AVF A;  3HST B;  4IDK A;  4JLH A;  1BQM A;  2P1J A;  3O3F A;  3NCI A;  4FJ9 A;  1NK4 A;  3HL8 A;  4FM0 A;  4FLT A;  4IKF A;  2D0A A;  1XI1 A;  4KAZ A;  3QNO A;  4FM1 A;  3LAL A;  1RDC A;  1Y97 A;  1HPZ A;  4E7K A;  4FJI A;  4PQU A;  1BL3 A;  2HHS A;  3LDS A;  3SQ4 A;  4IFY A;  1HYZ A;  1EX4 A;  2HW3 A;  4FZZ A;  1NK5 A;  5CZ2 A;  4CJP A;  2I5J A;  4PUO A;  1D5A A;  1D8Y A;  3TAM A;  2D0C A;  1TGO A;  3KIO A;  2HNZ A;  3QEP A;  3WNE A;  4M45 A;  1SUQ A;  4DG1 A;  4JRQ A;  3DMJ A;  3OVN A;  1J9A A;  3C95 A;  4O4G A;  4AHV A;  4W5O A;  2Z1H A;  4H4O A;  1LWE A;  4PA1 A;  1JLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...