3AVBA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avbA00
3QESA 1WSEA 1RBTA 5HRPA 1Y97A 1RBSA 3QIPA 4CEOA 1LWCA 3OS1A 5J2PA 3LZIA 1U49A 4KHSA 4E3SA 4FXDA 3P1GA 3QNOA 4FLZA 4DU4A 2KZZA 3OYFA 1TV6A 1C0UA 1KFSA 3I0SA 1NKBA 1WAJA 1T7PA 4DTRA 4HTUA 3DYAA 4AHVA 1BQNA 4E7KA 3V9WA 3HL8A 3OS2A 2HVIA 4O4GA 3KLEA 4F3OA 4O55A 3SPZA 4FJXA 2QK9A 2D0AA 2HHSA 3F73A 4CF8A 1RT4A 4KHNA 3VQQA 2HHVA 1VRTA 3AA5X 4DSLA 2PZSA 1CZBA 4CHQA 3OS0A 3K5MA 2JGUA 2VG5A 1KLNA 2Z1IA 3AVAA 2Z1HA 2DY4A 5HRRA 4Z4EA 1TL1A 3C95A 4KHQA 2P5GA 3F9KA 2OPRA 3NF6A 2HW3A 1CZ9A 1Q9YA 3AVKA 3TI0A 2B4JA 3LPUA 1RTDA 1UAXA 4DQIA 4CJVA 1IKYA 1BI4B 4CHOA 3VQ6A 4Z4IA 3K58A 2FBXA 1UA1A 4FJJA 4KB1A 2F8TA 3MXMA 4RW8A 1RTHA 1WN7A 3K2PA 4CF2A 3LWMA 4CJEA 3B6PA 1QSLA 4J2BA 1RDCA 4AHTA 2E6LA 4W5TA 3V4IA 4O0JA 3RRGA 4C8NA 4M3YA 3KLHA 4JS5A 4DTMA 2IC3A 3NBPA 2OYQA 4EZ9A 4KTQA 5EU7A 4QAGA 3VQ5A 1BL3A 4HUEA 5KGXA 2X74A 1BCMA 3AVHA 3ZT3A 4DG1A 3IRXA 1WSFA 3E01A 1L5UA 2YV0X 4DSFA 4FLVA 1FKPA 1HPZA 3LAKA 3HK2A 2QKBA 5CYMA 4LH5A 4FM2A 1RTJA 3KTQA 3AO3A 3DM2A 4I9LA 5KTQA 3OYCA 1BHLA 4NCAA 1J5OA 1KLMA 2RKIA 2DTUA 4AH9A 3AO5A 1F21A 3UIQA 4FJHA 3HYFA 4DS5A 4B9TA 4F4KA 5FRNA 4CHNA 2YNFA 1WAFA 3H08A 3NHGA 3AV9A 1JXEA 3QEWA 4CFBA 3K59A 4C8OA 1QS4A 1QTMA 2FBTA 1HQEA 3ULDA 4ID5A 2LSNA 1A5WA 4H4OA 4WE1A 2G8HA 1RBVA 4B8AB 3NF8A 4Z4GA 1R0AA 4HCCA 3HO1A 1U4BA 1KVAA 2ZD1A 4CK3A 2OA8A 2ITGA 3HM9A 4KB0A 2PYJA 4FJGA 4CJUA 4CGDA 5K14A 1D9FA 2F8SA 3ZSVA 1TVRA 3QNNA 3SV4A 2HHUA 3KKSA 5FRMA 4B9LA 1HYZA 4ELVA 4N76A 4CEZA 4B9UA 4JS4A 1W0HA 2X78A 1B9DA 3DI6A 3ASMA 3OYNA 4BE0A 3PY8A 4FLYA 4RW4A 4CECA 4O0IA 3QETA 1X1PA 4PUOA 1U48A 4K8XA 1NKCA 2Y1IA 4FZZA 1S1WA 4CIEA 4CGIA 3V9XA 3ZSYA 3RMAA 2A1SA 1B9FA 3FFIA 3EZ5A 4KAZA 4Z4CA 1IKXA 2JLEA 3NF9A 3OJUA 2HNZA 4JRPA 1SKWA 2X6NA 4CFCA 4Y1DA 3BDPA 4M45A 4DS4A 4CJSA 3AVGA 3KJVA 3L3VA 1L3VA 1RTIA 3OYEA 3KD1E 1RT5A 1VSFA 2G8VA 1JL2A 1RCHA 3AVNA 4CEFA 4M3TA 4GMJB 2FBYA 3M8SA 5I3UA 2ATQA 2YNGA 3G10A 4KFBA 1KRPA 4L8RB 3MXJA 3U3YA 2DFFA 3HP9A 4KHWA 3RTVA 4CF1A 3K5OA 4H4MA 1J54A 4NCBA 2BE2A 3ZT2A 3VQBA 1ITGA 3AO1A 4FJMA 1CLQA 4KI6A 2Q3SA 1RBRA 1BIUA 3IS9A 3QO9A 1Q8IA 4IG3A 4IG0A 1QHTA 4B08A 4PWDA 3QIOA 4EP5A 4NYNA 1JLQA 2DFEA 3M8RA 4IFYA 3S3NA 1YTAA 2D5RA 4M3ZA 4DQSA 1VK0A 1XC9A 4ZHRA 3ZT1A 2RPIA 4CERA 1U04A 2YKMA 4RW6A 4BWMA 4DFMA 1L3UA 2G8KA 4BACA 4IBNA 5HRNA 1IH7A 1WSHA 2IGIA 5C24A 2IAJA 4CE9A 3PV8A 1O1WA 2HNDA 4W5QA 3A2FA 4NCGA 3AO2A 3EY1A 2BDPA 4E7LA 4DTOA 4PQUA 3DRRA 4Z4HA 3SV3A 3CM5A 4B9NA 3CQ8A 4B9MA 4KO0A 4I7FA 3OYBA 1D8YA 1JXBA 4I9QA 4CEEA 1ZYQA 3VQPA 4DU3A 3LDSA 1RNHA 1SV5A 4FK4A 4CJ4A 2B5JA 3OVNA 2XO7A 4DLEA 3TABA 4DSIA 4QCLA 1JLBA 3K5LA 5J2QA 1RDBA 2HB5A 3U6FA 3CFPA 1TK5A 3B6OA 3VQ9A 1EX4A 1VSMA 3TAFA 4CF0A 3V9SA 1GOAA 3MEDA 1HQUA 4N41A 1S9EA 2G8FA 3DLBA 4I2QA 3ZT4A 1NOYA 4FJNA 3P5JA 4ELTA 3AO4A 4DSEA 4DMNA 3PUFA 4J2EA 3L2RA 3PO4A 4E7IA 4BE1A 4DTSA 1TAQA 4PA1A 2XY7A 3U3GA 1A5VA 3L2UA 3ZSWA 3NDKA 1Q9XA 3T1AA 5CZ1A 4DTUA 1L3SA 1GOCA 2KZMA 4CEAA 3NH1A 4JLHA 3DOKA 3HT3A 3SI6A 1ZBHA 4GW6A 2XHBA 5SZTA 2AJQA 2D0CA 2KQ2A 2ZE2A 4AHUA 3KLFA 4FLWA 4UQGA 4DF4A 1ZBLA 2G8WA 4FLUA 3NAEA 4CEBA 2PY5A 2RF2A 1UOCA 1KCFA 5SWMA 1S1TA 4N47A 4CJ5A 3HP6A 1SL0A 3C6UA 1ZBUA 4J2DA 1BQMA 4F8RA 4BWJA 3AA2A 1EXQA 2HVHA 4Y1CA 3VQEA 3AVFA 2PYLA 3LP1A 1A5XA 3SUNA 5CZ2A 3C94A 4FK0A 5HRSA 4AHSA 3SJJA 3M8QA 2Z1JA 5CYQA 2HNYA 3O4QA 3V1OA 1TK0A 3OYJA 4FM1A 2IS3A 1JLAA 4ICLA 2OPSA 3HXMA 3JYTA 4FCYA 1NJYA 5C42A 4KRFA 1SL2A 1VSEA 2RN2A 3MAQA 4DFKA 4EP4A 1JLFA 3O3GA 1TAUA 5JS1A 3OY9A 1JL1A 1IKVA 2HMIA 3RR8A 4E89A 1XHXA 4O44A 3WNFA 1TK8A 2R7YA 2O4IA 3WNEA 3SQ1A 5HP1A 3RR7A 1J53A 1VSLA 3DLHA 3CM6A 1QE1A 4KHUA 1NK4A 1Z26A 3V9UA 4M42A 3OYKA 1X9MA 2P1JA 2YHAA 1LWFA 1NK7A 2GV9A 2YKNA 4KTZA 3LAMA 1K6YA 4LSLA 3SUQA 1NJZA 1NK9A 1G15A 3DRPA 3T19A 3VQAA 3KK1A 1FXXA 1B92A 2E6MA 3RMBA 4E19A 4OKEA 5KI6A 3KKRA 3O3FA 3LWLA 2VG6A 4FLXA 4KI4A 1FKOA 1W9HA 2YHBA 1RDAA 3K5NA 3DRSA 2GUIA 2HHXA 1BI4A 4DSKA 4Z4FA 3AA4A 4F2SA 4ID1A 1JKHA 3VQ4A 4LSNA 3TR8A 4W5NA 2GBZA 4CJRA 1NK6A 2FBVA 4E1NA 1TL3A 3CG7A 3WNHA 3S3MA 3L8BA 3PO5A 3MECA 4LY7A 4CJFA 4BDZA 4M3WA 1JLCA 4CIGA 1U47A 3V9ZA 3I8DA 5E41A 4KREA 1RDDA 4OVLA 4M3RA 3L2VA 1WSJA 4HUGA 2OZMA 5D3GA 4CGHA 4AHCA 1RT1A 3O3HA 1N6QA 2ZQBA 3VQDA 4CGGA 3SYZA 2YNHA 4BDPA 1HMVA 1KTQA 3VN5A 4O5BA 2KFZA 1NKEA 3LANA 4HUFA 5DK5A 3QINA 3V1QA 3V1RA 1NK0A 3RWUA 3T3FA 3VA0A 1YVUA 1RT2A 4OPKA 3OYLA 2IDOA 1JLGA 4IDKA 4DTPA 4Z0UA 3DOLA 1HRHA 4R5PA 1LWEA 1TKZA 4PY5A 5J1EA 4ZTFA 1IO2A 1BIZA 1VSIA 2Z1GA 4FW1A 1SUQA 3NGYA 1HYVA 3TWHA 3DLRA 4ELUA 4RW7A 3QEPA 3HVTA 3DLEA 2P51A 4Q5VA 1S6QA 3HPGA 1C1AA 4FJLA 3SZ2A 3L2WA 3RMDA 1DTTA 4GVMA 2HHTA 2Y1JA 4RG8A 1RT3A 4FVMA 4FJKA 1S9GA 1S5JA 2O4GA 1I39A 1TKTA 4MFBA 4E7HA 1NJWA 2BGGA 1KFDA 4OKJA 3G0ZA 3AVCA 3SQ2A 1VSJA 4CJWA 3THVA 2OPQA 2VG7A 4G1QA 4H8KA 5CY4A 4CHPA 4DTXA 4DSJA 4KPYA 1WSIA 4FJ9A 4TSXA 3TAGA 3VQ7A 2D0BA 1IG9A 4CCHA 1D5AA 4RW9A 4CEDA 4B9VA 3V81A 2XRIA 4FK2A 4F3TA 2HHQA 4AHRA 3MXIA 3BGRA 1C0MA 1VSHA 4CJPA 3RMCA 4KHYA 4CGFA 2ETJA 5HROA 4DF8A 3LP3A 3SCXA 1NK5A 5J2MA 4FZXC 4FJIA 1VRUA 3CFOA 4BE2A 3P83D 5HBMA 1IKWA 1JLEA 1CXQA 3EYZA 3MEGA 1WLJA 4CFDA 5KRTA 2OPPA 4DFPA 1D9DA 2KTQA 4DQRA 1EETA 4CESA 1LV5A 4OLAA 2W42A 1NOZA 4XIUA 1BGXT 1ASVA 1YTUA 3SUPA 4EZ6A 3AVJA 3ISNC 3KK3A 3QERA 3S3OA 3TAPA 3SPYA 4FZYA 3NFAA 4CK1A 3KK2A 2XY5A 1UWBA 3KIOA 4OKKA 4OGCA 3DLGA 2IOCA 4Q0BA 3SNNA 4W5OA 4FJ5A 4FJ8A 4FM0A 4CJKA 4J2AA 3ALYA 3NCIA 4E0DA 4YFUA 3VQCA 3DLKA 4C8MA 1X9WA 5I42A 3QEVA 1HYSA 4M3XA 1TKXA 3CYMA 1EKEA 3LPTA 3ZSZA 4KKOA 3PX4A 5FDLA 5C25A 4CIFA 3OYGA 3PX6A 3L3UA 3LP2A 4HVJA 2XY6A 5KRSA 1Z25A 4M41A 4C8LA 4F2RA 1ASUA 3AVMA 1LW0A 4E7JA 1KSPA 4B3OA 4DQQA 3TAMA 3I0RA 3LZJA 3ZCMA 3TAQA 1WNSA 4CFAA 4W5RA 1S1XA 3IG1A 5HLFA 1KVBA 3CFRA 3NE6A 3TAEA 2NUBA 4OPJA 4HHTA 2VWJA 3VA3A 1N5YA 3L2QA 3OYMA 1EP4A 4JRQA 4NYFA 3NGZA 3QEIA 1HNVA 1UA0A 4CHZA 3S9HA 2I5JA 3QEXA 4CJ3A 4BDYA 5DMRA 1NJXA 1T03A 3KLIA 1WSGA 3ZSXA 3IAYA 3OJSA 1ZBFA 2DFHA 3AA3A 4CK2A 4K8ZA 4N5SA 3AVIA 1RT7A 3AVLA 4DTJA 2QKKA 4IKFA 2BANA 1C1CA 3QLHA 2F96A 3VQ8A 4DWIA 2EHGA 2HHWA 3D0PA 3OYHA 3MEEA 2G8UA 4OGEA 3SUOA 4HCBA 4E1MA 1T05A 1BISA 1C6VA 1XWLA 4MQ3A 4DLGA 2WOMA 4DTNA 1XHZA 1QSYA 1TGOA 3ZSOA 4CEQA 4KTWA 4CJTA 3HVRA 2VWKA 1RBUA 3HPOA 1SKSA 1DTQA 4FW2A 1J9AA 2EX3A 4ZTJA 2XY8A 4QOZB 3OYDA 3M8PA 1X9SA 1SL1A 3HJFA 1QQCA 2P5OA 4KV8A 2A1RA 1RILA 1ASWA 3AVBA 1L3TA 1VSKA 1T8EA 1BCOA 2X6SA 4LH4A 4DQPA 2KFNA 3OYIA 4B9SA 3ZT0A 1LAWA 4M3UA 3SQ0A 5KGWA 1LW2A 2QXFA 3ITHA 5J2NA 4CJLA 4DFJA 3TARA 1TKDA 1SKRA 1C1BA 1LAVA 3O4NA 1GOBA 3C6TA 3HSTB 3NH2A 4YNQA 3K57A 5FROA 1MU2A 4CGJA 2OZSA 3ZSQA 5JS2A 4CF9A 3KLGA 1C0TA 4OJRA 1QSSA 1YT3A 4CJQA 3NGIA 4AILC 3WNGA 4OLBA 3OYAA 3KD5E 1NK8A 2G8IA 4IFVA 1S1UA 4B8CA 3PX0A 4C8KA 3ZSRA 1VSDA 2B6AA 3NH0A 1I3AA 1FK9A 4FYDA 4FJ7A 4I2PA 3LP0A 1HJRA 4FLTA 1S1VA 2E4LA 1ZBIA 4N56A 2YNIA 1S6PA 1HNIA 1XI1A 3HPHA 5T7BA 3SQ4A 2FC0A 3D45A 4CHYA 2WONA 4DU1A 1KVCA 1RT6A 3NF7A 1CXUA 1U45A 3RRHA 3LALA 1REVA 4LD0A 2KW4A 1DLOA 3JSMA 3V6DA 3DMJA 3TANA
chains in the Genus database with same CATH superfamily
3QESA 4A62A 1OH8A 1MWMA 5HRPA 1Y97A 3QIPA 4CEOA 1S22A 3OS1A 4KHSA 4FXDA 4E3SA 4K43A 4A5BA 2GTDA 2KZZA 3I0SA 1NKBA 4HTUA 3ATUA 3L6QA 3MX2A 2Q36A 3CCEN 1K8KA 4GV6A 3SPZA 2QK9A 2Q31A 3C65A 1RT4A 3R1XA 4CF8A 2P9SB 2HHVA 1VRTA 4MDAA 3AA5X 4DSLA 2PZSA 2VG5A 1K8AO 4BGBA 4KHQA 2P5GA 3DXMA 3F9KA 3PSIA 2OPRA 3NF6A 2HW3A 1Q9YA 5M1FA 5LJWA 5H1SQ 4BC3A 1UAXA 2A3ZA 1IKYA 1WUAA 4Z4IA 2FBXA 4KB1A 2F8TA 3OBYA 5AQKA 4RW8A 4G9ZA 1VQ5N 4W5TA 4C1NI 5EXWA 4WQ4C 3ID6A 3TSQA 2KLAA 4QAGA 1BL3A 3UKUA 4KH6A 3AVHA 4DG1A 3E01A 4H5WA 3DAWA 2P9LA 3HK2A 3KK7A 4LH5A 1X3MA 3Q7CA 3KTQA 3DM2A 4DQ8A 3OYCA 4NCAA 1TUUA 1J5OA 2RKIA 2PAVA 1F21A 3UIQA 3HYFA 4CHNA 1WAFA 2YI1A 1JCEA 3O5BA 3AV9A 3NHGA 3FZMA 2QWLA 4CFBA 3K59A 1QS4A 2FBTA 1HQEA 4C8OA 4WE1A 3FZHA 1U2VB 3NF8A 4B8AB 3J81O 5C10A 4GNIA 5AQYA 1D9FA 3KWGA 4LF6K 4B1YB 3KKSA 5FRMA 1HYZA 3JAMO 4JS4A 2GUPA 1B9DA 3DI6A 1XNQK 2ZM6K 4FLYA 2P9KB 3QETA 1NKCA 3RMAA 2A1SA 4Z4CA 3OJUA 3NF9A 4JRPA 3KJVA 1OH6A 1RTIA 2GX9A 3AVNA 4BRHA 4CEFA 2YNGA 3G10A 1KRPA 4L8RB 2VGMA 3HRGA 4CZLA 4NCBA 2BE2A 3ZT2A 3AO1A 3CCJN 4KI6A 2NZTA 1KAYA 2F4VK 3QO9A 4B08A 2DFEA 1YTAA 2D5RA 1LCUA 1XC9A 4ZHRA 3ZT1A 1GLEG 4CERA 3QICA 2YKMA 1YI2N 2HOEA 1IH7A 3AO2A 3R3LA 4MDBA 3CPWM 4PQUA 3DRRA 2DPNA 5IWAK 4A57A 2A41A 4I7FA 3OYBA 2VCPA 1DKGD 5GAEP 4DU3A 1SV5A 4DUYK 3CJ9A 2CGLA 4DSIA 1JLBA 3K5LA 3SAGA 1HX1A 4UY8O 3TAFA 1Q7YO 1M90O 4WQ4A 2G8FA 3CCMN 3DLBA 5DM6L 2P9IB 3PUFA 3PO4A 4E7IA 4BE1A 5LMUK 1TAQA 5GADP 1O13A 3NH1A 4CZKA 3VEYA 3DOKA 4IDHA 2XHBA 5SZTA 2AJQA 1JCFA 4DKWA 1P90A 4BVOA 4UQGA 3M6GA 4M63C 4CEBA 1KXPA 1QHAA 1KCFA 1ESVA 1S1TA 4CJ5A 5SWMA 1BQMA 1EXQA 3O1BA 2EWSA 1A5XA 5CZ2A 4B1VA 5CYQA 1RFQA 1NJYA 3JYTA 3THXB 2RN2A 4DFKA 1JLFA 2D1KA 1TAUA 3O1WA 5JS1A 1IKVA 4OPHA 2QWOA 1TK8A 4O44A 3CMAN 3N4PA 3H3NO 4WQ5C 1VSLA 3CM6A 5AQZA 2YHAA 3C6AA 4KTZA 4XH4A 4LSLA 3SUQA 4BG9A 5AQNA 4WF9L 3T19A 3HOSA 1NJZA 3KK1A 1NK9A 1KC8O 3O3FA 2VG6A 2A6AA 1W9HA 2W6LA 1BI4A 4Z4FA 4F2SA 4LSNA 1NK6A 3RSEA 2FBVA 1TL3A 3L8BA 3PO5A 3MECA 2O8FB 3EE9A 1JLCA 2P9UB 3V9ZA 5E41A 1RDDA 5AQRA 2YCHA 4DV2K 3VQDA 3SYZA 1KTQA 3VN5A 4KBOA 4O5BA 5EX5A 5JMVA 5F0XA 1Q18A 3FZKA 3CQYA 3T3FA 2OCEA 4JKBA 4OPKA 3OYLA 1JLGA 2V7ZA 5GAGP 3A5LC 1YJNN 2Z1GA 3NGYA 3P4IA 4PKGA 4RW7A 3QEPA 3MDQA 3HPGA 3L2WA 2Y1JA 4RG8A 1RT3A 1NM1A 3JS6A 5AQWA 4MFBA 3HSCA 1KFDA 3IMXA 3G0ZA 2OPQA 4CHPA 4G1QA 3TAGA 4CCHA 4E1JA 1D5AA 2P9NA 4CEDA 4FK2A 4A59A 3V81A 3RMCA 4FWSA 4BY9C 1IBLK 3CCSN 3P39A 4WYBA 5J2MA 1VRUA 3MN9A 2FF3B 3P83D 4MLEA 5HBMA 4BE2A 1JLEA 4WCEL 3EYZA 3DXKA 3MEGA 2OPPA 1EETA 4CESA 3THWB 3R8EA 1BGXT 3AVJA 5GIOA 3KK3A 5JLHA 3S3OA 4JI8K 4FZYA 5I9EB 1W97L 2XY5A 4OKKA 5M1QA 3U4LA 4L3QA 4Q0BA 4DB3A 4J2AA 3ALYA 3NCIA 3VQCA 3MCAB 3CJBA 4WQ5A 3DLKA 3TTFA 3AAQA 1TKXA 4JAXA 3FR0A 3PX6A 3L3UA 3ZEUB 3LP2A 4H5VA 1Z25A 3CMEN 5AR0A 4DV1K 4F2RA 2E5LK 1ASUA 3AVMA 4EHTA 3L0QA 1DGKN 1WNSA 4CFAA 2O8BA 3CJ1A 1VQPN 4KH5A 5GIPA 4HHTA 2VWJA 2D0PA 3PSFA 4RWTA 3L2QA 3OYMA 4JRQA 3NGZA 4CHZA 5BRFA 3S9HA 2I5JA 3I33A 3OJSA 4JI6K 2DFHA 3AA3A 1VQLN 4FL9A 3AVIA 2QKKA 4IKFA 2BANA 1HNWK 2EHGA 3D0PA 4E1MA 1XWLA 2QWMA 1QSYA 4DLGA 3QB0A 1TYQA 2RHKA 5AZIB 1RBUA 1SKSA 3D6RA 1EWRA 4FOEA 4ZTJA 1DT9A 1GLBG 2XY8A 4OPAA 3M8PA 1X9SA 1QQCA 1QZ6A 3AVBA 5GAHP 1L3TA 4X66K 2QW9A 4LH4A 3ZT0A 1HUXA 4NO7A 5KGWA 3AAPA 1LW2A 2QXFA 4EFHA 1LAVA 3O4NA 3J7AP 5FPDA 1NWKA 4OJRA 1YT3A 3UKRA 2O8DA 3KD5E 1S1UA 3LM9A 2B6AA 3NH0A 1I3AA 1FK9A 3CI5A 4FJ7A 3WXMB 1S1VA 3P31A 1C0FA 5T7BA 3SQ4A 3CJAA 2FC0A 4BR0A 2IVOA 1CXUA 3CQXA 3T1HK 3HBTA 3JSMA 2NLXA 1WSEA 3QBWA 5CHIA 1RBSA 1U49A 1LWCA 3GOIA 3TTDA 5JVGL 4FLZA 3D7EO 1NU0A 1TV6A 1C0UA 1YAGA 2ZJQL 1KFSA 5BRHA 4WFBL 2IVPA 4CZFA 1BQNA 4FWRA 2Q0RA 2HVIA 3KLEA 5CR4A 1W2BM 5AZJB 2D0AA 4EHUA 2IVNA 3D2FA 5AQTA 3VGMA 4CHQA 4H03B 3OS0A 2JGUA 1YVNA 2YHYA 3F5TA 1BO5O 5LL6Z 4NXMK 2WTUA 3PIOL 3AVKA 2F9TA 4FWKA 4PKHA 1VQ9N 3LPUA 3ULEB 3A5NC 4BVPA 4DQIA 4CHOA 1BA0A 3OA9A 3VQ6A 2CGJA 2D0OA 4U67L 3K2PA 4J2BA 4CF2A 4CJEA 1QSLA 4Z94A 3K9JA 2FSNA 1HPMA 4ISFA 5EU7A 4BC5A 2UUBK 4DV0K 3QFUA 1VQ7N 4HUEA 5KGXA 3CXCM 4JK8A 2UUCK 1NGDA 3IRXA 1L5UA 4DSFA 1HPZA 3LAKA 3BZKA 1NGIA 5CYMA 1RTJA 3AO3A 4R79A 1KLMA 2DTUA 5FPNA 3P38A 4NB4A 4JV5K 3O9SA 4B3RK 2QEXN 4NLCA 1VQMN 2YNFA 1JXEA 4ID5A 1A5WA 1U4BA 2I7PA 4CK3A 2OA8A 4CW7B 2ITGA 4FJGA 4CJUA 1TVRA 3SV4A 4B9LA 4EIAA 2X78A 2E20A 3ENBA 3OYNA 3ASMA 2KFZA 4CECA 4PUOA 5AQSA 3V9XA 3ZSYA 3ZLJA 4KAZA 3HJFA 3EZ5A 4LFAK 3ENHA 2O8CA 4CFCA 4CVNE 3AVGA 3L3VA 3VEWA 1L3VA 3KD1E 3OYEA 2G8VA 5E26A 1RCHA 4M3TA 3WQTA 4YOUA 2FBYA 3M8SA 2ATQA 4KFBA 3HP9A 4IWVA 4B1UB 1BU6O 1J54A 1E4FT 2Q1NA 3QBXA 4JI1K 4FJMA 3CC2N 4IG0A 4EP5A 4NYNA 3M8RA 4JI3K 4IFYA 4X64K 3UB5A 4M3ZA 4IZ9A 2ZJPL 2RPIA 1U04A 4RW6A 2G8KA 5ELZA 4BACA 1XC3A 3PV8A 5C24A 4BR4A 4XH1A 4NCGA 3EY1A 3VETA 2BDPA 4DTOA 4Z4HA 3CQ8A 3BY5A 1D8YA 4LF8K 4I9QA 3VTHA 1ZYQA 3VQPA 1Q86O 4FK4A 4DLEA 3TABA 4QCLA 3KVGA 5J2QA 3U6FA 4FSVA 2UXCK 1GOAA 5C12A 2A5XA 2ZWHA 1HQUA 4N41A 3ZT4A 4FJNA 2ITMA 3AO4A 4CI6A 3MCPA 1S3XA 1QZ5A 4J2EA 4FWLA 3L2RA 4PA1A 3GE1A 3VPZA 2HSTA 4JKHA 2XY7A 3L2UA 3ZSWA 1OVQA 5CZ1A 5ADXA 5F2RA 2HMPA 4H5TA 4I6MA 1GLFO 4JKGA 2UU9K 2D0CA 3KLFA 3NMUA 3G4SN 1UOCA 1SL0A 3C6UA 3AA2A 4Y1CA 3CC4N 3SUNA 3C94A 3F9MA 4M7YA 4AHSA 4V19S 3M8QA 3O4QA 2Q97A 1YXQA 5MLCQ 3OYJA 4FCYA 4X65K 1SL2A 3A8YA 4DV5K 3MAQA 5A2QO 3OY9A 3QMLA 2HMIA 3RR8A 1I94K 3WNEA 5HP1A 2P9SA 3O80A 4M42A 1T3VA 3OYKA 2P1JA 2GV9A 2YKNA 3VEZA 3LAMA 4BRFA 1K6YA 4BRDA 3VQAA 3CC7N 2ZGZA 1B92A 4H0VB 4BROA 1FKOA 3O6WA 3K5NA 2HBLA 3DRSA 3AA4A 4ID1A 3VQ4A 3VF4A 2F7TA 2UXDK 2OTJN 4AM6A 4OO1J 4KREA 4OVLA 4M3RA 3L2VA 1WSJA 2E1YA 4BRLA 4CGGA 1HMVA 3AY9A 3SLCA 4BR2A 1ZXOA 1NKEA 2E88A 3A5OC 1KAZA 4JD2B 4HUFA 3V1QA 3V1RA 1NK0A 3RWUA 1YVUA 4K41A 5IT9O 4IDKA 2FSJA 4JEPA 2CH5A 3DOLA 4CZIA 4YY3K 2YJEA 3M5RA 1BIZA 2ZGYA 3ZX3A 1GLDG 2HF4A 5F1XA 3TWHA 3DLRA 3J7YP 1DTTA 1U2VA 2AP1A 1NJWA 4YOYA 4JHDB 3AVCA 4FWOA 3SQ2A 4CJWA 3THVA 2VG7A 4DTXA 1WSIA 4ISGA 4RCHA 2D0BA 4FWQA 1IG9A 4RW9A 3D2EB 4B9VA 3QDKA 1VHXA 4CJ7A 2HHQA 4YOWA 4KHYA 3G6EN 2ETJA 1NGEA 5HROA 4DF8A 4ILGB 1NK5A 3CFOA 2P9KA 1IKWA 3GDQA 5KRTA 1MA9B 2KTQA 1IV0A 4OLAA 4LFBK 1RGIA 2NNWA 1YTUA 2RE2A 3SUPA 4EZ6A 3WEEB 3QERA 2WUSA 3TAPA 1NGCA 3NFAA 1UWBA 3KIOA 4OGCA 1NGBA 2QWRA 3DLGA 2W40A 2IOCA 2A40A 3CCRN 3EE8A 1N34K 1OKJA 4DR6K 3C0BA 3VF2A 4B3MK 1IBKK 1BG3A 3SK3A 1YUWA 4M3XA 2UXBK 3CYMA 1EKEA 3LDPA 4CIFA 4CBWA 4GY2B 1RDWX 2XY6A 4IO9L 1ATRA 1NGAA 4M41A 5ADXH 2V51B 3W3DA 4E7JA 3TAMA 3LZJA 5TKWA 2FF6A 4W5RA 2BUPA 4YDUC 3TAEA 5EVZA 3ID8A 1EP4A 3KHYA 4CD3A 1HNZK 3ZETB 1BUPA 4LF5K 2P9IA 3QEXA 1KD1O 5DMRA 3T7ZA 4DR4K 2ASMA 5M1KA 3KLIA 3CJCA 5TKYA 3BZCA 3WXIA 4CK2A 4K8ZA 5KQ8A 1NGGA 3AVLA 3QLHA 3GBTA 1T6DA 3AARA 1YF5L 1OH5A 3MEEA 3E1YA 4HCBA 4DUZK 4MQ3A 1VQ8N 2VWKA 5BPNA 3AGKA 3WXLA 4FW2A 2EX3A 1MDUB 4QOZB 2FXUA 3SJHA 2UYTA 5EOYA 1T8EA 1BCOA 2X6SA 4H0XB 4YOTA 1VQ4N 2KFNA 1LAWA 2NRVA 4A2BA 3THXA 5J2NA 3ITHA 1TKDA 1SKRA 4DFJA 1P8ZA 3HSTB 5FROA 4QS8A 3ZSQA 5JS2A 1HKCA 2GWKA 3KLGA 1QSSA 3NGIA 2PFUA 3FFKB 4AILC 4OLBA 3OYAA 2VWBA 2CH6A 5BREA 4O5FA 3FE1A 4C8KA 3ZSRA 1VSDA 4B9QA 5CE3A 3O9QA 2KKZA 4BQLA 4FLTA 1HJRA 2E4LA 5LY3A 4N56A 1HNIA 2F9WA 1XI1A 3QFPA 3S41A 3LDOA 2WONA 4DU1A 1KVCA 3NF7A 3LALA 1XNRK 2O8FA 3O4WA 2KW4A 5BR8K 2P9UA 1HNXK 3V6DA 4CBUA 3TANA 1FJGK 5J2PA 2FSKA 2HBKA 5JICA 3IFRA 2O8EB 3SMPA 3LZIA 3BUZB 1NJIO 3OYFA 3ATVA 1T7PA 4DCHA 4AHVA 4E7KA 3V9WA 3HL8A 2QI2A 4O55A 2WC9A 2HHSA 3L4IA 3F73A 3VQQA 1V4SA 4YOXA 1CZBA 4CD1A 3K5MA 3GG4A 2DY4A 4YDUA 4Z4EA 1TL1A 3C95A 5FPMA 1NMDA 3TI0A 4CJVA 4CZGA 5AJ3K 4GKKK 1G99A 4FJJA 2NRTA 3CCVN 2OZSA 5AQUA 2PBDA 3IUCA 3T1YK 1RDCA 3CCUN 3C7NB 3RRGA 3KLHA 4JS5A 2IC3A 3NBPA 4JKFA 3VQ5A 5AQXA 4BREA 2VQEK 1BCMA 4DR3K 3ZT3A 1WSFA 2J4RA 5AFUA 3THWA 2ASPA 2YV0X 1FKPA 1HKBA 1SQKA 2QKBA 3SAFA 4QS9A 4DV7K 3ZX2A 3CIPA 3T69A 4AH9A 4OX9K 3AO5A 3NVMA 4FJHA 5FRNA 4B9TA 3H08A 3QEWA 4H5NA 1QTMA 3ULDA 4EAHD 4Z4GA 1R0AA 3HO1A 2P9PB 2HBJA 2ZD1A 4KB0A 4WFNL 3VESA 3ZSVA 2HBMA 3QNNA 3ZEUA 2HHUA 3SBTA 2W41A 3WXKA 3I56N 1W0HA 5LMNK 4RW4A 2YHXA 3ZX0A 4BC4A 1U48A 2Y1IA 4K8XA 4FZZA 1S1WA 4CIEA 3U9ZA 3FFIA 1EQYA 4BGAA 4ILHA 2HNZA 2X6NA 4JKEA 4Y1DA 1RT5A 3I8BA 4GMJB 1EO1A 5C15A 4LF7K 3MXJA 3U3YA 4CF1A 3K5OA 2VGNA 3VQBA 4U7BA 1CLQA 2Q3SA 3IS9A 4A2AA 4IG3A 4JKAA 4PWDA 1QHTA 3S3NA 1VK0A 4FPAA 5AZIA 5HL7L 4BWMA 3FGUA 3EKUA 4DR5K 2IAJA 1O1WA 2HNDA 3H1VX 3IDHA 1NG9A 4BRNA 4JI2K 4J8FA 3SV3A 3CM5A 4CBXA 4B9NA 1NLVA 4CEEA 1RNHA 4IJNA 2B5JA 1Q81O 1RDBA 3FLCO 4B3SK 4PL8A 1VAZA 4DHYA 4IJAA 4O8UA 3V9SA 3R9PA 3VMFB 5AQQA 3CF5L 3THYB 4I2QA 1NOYA 3P5JA 1E3MA 4DSEA 1YITN 4DTSA 1A5VA 3GL1A 4JI7K 3HZ6A 3T1AA 4DTUA 1M1KO 1L3SA 1GOCA 2KHOA 4CEAA 2KZMA 4JLHA 3HT3A 3SI6A 4GW6A 2KQ2A 4AHUA 1ZBLA 5E84A 2G8WA 4H0YB 4FLUA 3NAEA 2PY5A 2RF2A 1NGJA 4N47A 3EZWA 4J2DA 2NRHA 4BWJA 4DV4K 4CZEA 2HVHA 1KQSM 5FPEA 2PYLA 3E66A 3SJJA 2Z1JA 3V1OA 1TK0A 4FM1A 3VGKA 4ICLA 4KRFA 4AM7A 5C42A 4IEIA 4LF9K 5GINA 3CERA 5AZJA 1XHXA 2O4IA 5AQPA 2R7YA 4IO8A 2BTFA 4B1ZA 1NK4A 3V9UA 4B1WB 1X9MA 1LWFA 1NK7A 4RTFD 4IOAL 5AFUH 4ILJA 1G15A 3EN9A 4F9OA 3RMBA 4OKEA 3LWLA 4FWPA 4K0KK 3ULEA 5BRDA 2YHBA 2QWPA 1RDAA 2GUIA 2OANA 2QXLA 1FW6A 4DSKA 4LC9B 3TR8A 2GBZA 2VYPA 4E1NA 3CG7A 3WNHA 3S3MA 4FPBA 4LY7A 4BDZA 1U47A 4HUGA 3O3HA 4AHCA 1RT1A 1J6ZA 4BDPA 2YNHA 1HJOA 1K9MO 3OW2M 5DK5A 3QINA 2GELA 1N33K 3AGRA 2CGKA 1RT2A 1HRHA 1K8KB 1LWEA 4R5PA 4PY5A 5J1EA 1IBMK 1SUQA 4ELUA 1HYVA 3MK6A 3HVTA 3DLEA 2P51A 4Q5VA 1S6QA 1C1AA 2ZJRL 3SZ2A 5M1PA 4GVMA 3MN7A 2HHTA 5KPTA 4FJKA 1S9GA 1S5JA 3DXMB 1I39A 1TKTA 4E7HA 2YJFA 2BGGA 4OKJA 5LJVA 4H8KA 1BA1A 5JLFA 4FJ9A 3VQ7A 3J8AA 4F3TA 4O8KA 3BGRA 1C0MA 4CJPA 4KH4A 4YHHK 3LP3A 3SCXA 4FZXC 3WXJA 1CXQA 3UKUB 4CFDA 3DLLL 4DR1K 1OVYA 4DQRA 1LV5A 2W42A 2P9LB 1V4TA 1NOZA 3MWPA 3ISNC 3HM8A 1WB9A 3MX5A 5AQGA 1QQMA 1C0GA 3LM2A 1NBWA 3Q7BA 4K25A 3SNNA 4CJKA 1T6CA 4E0DA 1X9WA 2UUAK 5I42A 4FWMA 4BQZA 3ZSZA 4JKDA 1CZAN 3OYGA 4HVJA 2HHHK 3VGLA 4NXNK 4C8LA 4BR7A 4WFAL 1LW0A 4B3OA 4DQQA 3CCLN 3ZCMA 1GLJO 3FZFA 2V52B 1S1XA 1X9JA 3IG1A 4PHTX 5HLFA 3CFRA 3NE6A 4IOCL 3MN6A 4OPJA 4C23A 3QEIA 1HNVA 4IEEA 1UA0A 2VQFK 2QA4N 4JK7A 5BN8A 2V7YA 4BDYA 1NJXA 1T03A 3FZLA 1WSGA 3B8AX 3ZSXA 1ZBFA 1EWQA 4N5SA 1RT7A 4FWNA 3PIPL 1C1CA 3M3ZA 2GEMA 3E9PA 3VQ8A 4DWIA 2G8UA 4OGEA 3VEXA 1T05A 1C6VA 2WOMA 3J7ZO 4IFEA 3HVRA 3HPOA 5C2FA 4DV6K 3OYDA 1DEJA 2A1RA 2E2NA 1VQ6N 4JYAK 4DR2K 1ASWA 1VSKA 4DQPA 2OTLN 1YJ9N 4B9SA 4LF4K 4M3UA 4JNEA 3W0LA 5C2DA 3TARA 2W6KA 3A0IX 1C1BA 3NH2A 4YNQA 3K57A 4LFCK 1MU2A 4CGJA 4FVUA 4CZHA 2QTDA 1C0TA 3MMVA 4CJQA 3E9LA 2BH1A 3WNGA 1NK8A 2G8IA 2YHWA 4IFVA 4NLBA 2Q0UA 3PLAA 3O9TA 4FYDA 1HR0K 4I2PA 3LP0A 3LL3A 1ZBIA 2YNIA 1S6PA 2E8AA 1VQNN 4ISEA 1Q82O 1RT6A 1U45A 1REVA 1ASVA 1DLOA 1Z05A 5KPRA 3DMJA 3BF3A 3HXMA 1RBTA 1XUPO 3HOTA 4BRCA 1LOTB 1ATNA 3P1GA 1NNEA 3QNOA 4B1XB 4DU4A 3KZBA 4GVEA 2E2QA 2NRWA 1WAJA 4JD2A 4DTRA 2ZF5O 3DYAA 3OS2A 4O4GA 1N36K 4F3OA 4FJXA 3R6MA 4KHNA 1QQNA 4JKCA 3CD6N 5AQMA 1IG8A 3WQUA 1QQOA 1KLNA 2Z1IA 3AVAA 2Z1HA 5HRRA 2D4WA 1NGHA 1XMQK 1CZ9A 3U9DA 3HTVA 1XMOK 4JHDA 3G71N 2B4JA 1RTDA 1BI4B 3K58A 1UA1A 5B8HA 3LWMA 1RTHA 1WN7A 3D2EA 3MXMA 3B6PA 3RSEB 4AHTA 2E6LA 3V4IA 4BRIA 1T44A 2QM1A 4O0JA 4M3YA 4C8NA 4EZ9A 4DTMA 2OYQA 4KTQA 1ILYA 4M7XA 5M1OA 4BRKA 1E4GT 2X74A 2A42A 1YJWN 3ZYYX 5KQDA 4BRAA 3DWLA 3EEQA 3H3OB 3EL2A 4FLVA 4BR9A 3VOVA 4FM2A 4I9LA 3VEVA 5KTQA 3WEEA 1BHLA 2IIRA 4GV3A 3WT0A 1BWFO 3WUHA 4FOIA 4DS5A 4F4KA 4Y0WA 4BRQA 4BRGA 1VQON 4MO5A 5AQFA 2LSNA 4H4OA 3H46O 2NRZA 1RBVA 2G8HA 4HCCA 1KVAA 4IXCA 3HM9A 2PYJA 5AQJA 4HTLA 4CGDA 4H5RA 4DR7K 5K14A 2F8SA 1D4XA 2P9NB 4K42A 2I7NA 4ELVA 4N76A 1GLCG 4CEZA 4B9UA 1SS6A 2QWNA 4B3TK 4BE0A 3PY8A 4O0IA 1X1PA 5AQVA 3DXKB 4CGIA 1H1VA 1B9FA 5AQIA 3LDQA 1IKXA 2JLEA 1SKWA 3BDPA 4M45A 4DS4A 4CJSA 4A61A 1VSFA 1JL2A 3ZETA 5I3UA 1TUYA 3O8MA 4KHWA 2DFFA 2E2OA 3IKMA 3CJ7A 4H4MA 4BR5A 3RTVA 3HI0A 3LDNA 1ITGA 2NRXA 1RBRA 3C6HA 1BIUA 5BPLA 1Q8IA 3QIOA 1JLQA 1XQSC 4DQSA 5AQHA 1L3UA 4DFMA 5EY4A 4IBNA 5HRNA 1WSHA 2IGIA 3TSPA 4CE9A 4W5QA 3A2FA 3K9KA 4HWIA 4E7LA 3MWTA 4B9MA 4KO0A 1JXBA 4GV9A 3LDSA 4CJ4A 3OVNA 2XO7A 5BN9A 2FLOA 2HB5A 3H1QA 3CFPA 1TK5A 3OBWA 2O8BB 3L4QA 3B6OA 4JI4K 1EX4A 1VSMA 3VQ9A 4CF0A 1S9EA 1WOQA 1BOTO 3NVKA 4ELTA 3TU5A 1NMNA 4DMNA 3VENA 5KPZA 4JK9A 1YHQN 3U3GA 3NDKA 1Q9XA 1ZBHA 1J5EK 2ZE2A 4FLWA 3A5MC 4DF4A 1TYQB 4DV3K 1ZC6A 3HP6A 4CZMA 1ZBUA 4F8RA 1JCGA 3CETA 2QWQA 3VQEA 3AVFA 4MO4A 2O8EA 3LP1A 4FK0A 5HRSA 3DJCA 2HNYA 4FO0A 2IS3A 1JLAA 3E9OA 2OPSA 1VSEA 5AQLA 4BRMA 4EP4A 2H3GX 3O3GA 1JL1A 4E89A 3WNFA 4YOVA 1GLAG 3SQ1A 3RR7A 1J53A 3DLHA 4KHUA 1QE1A 1Z26A 1VQKN 1BDGA 3OHRA 2ASOA 3UKRB 2O8DB 1MWKA 3DRPA 1FXXA 2E6MA 4E19A 5KI6A 3KKRA 4X62K 4FLXA 4XH5A 3CCQN 4KI4A 1QVGM 2E2PA 2HHXA 3TTCA 1JKHA 4W5NA 4CJRA 1R59O 3C7NA 4BG8A 2WBNA 3JXUA 2HF3A 3CHWA 4CJFA 4AQYK 4M3WA 4CIGA 3I8DA 5D3GA 1QVFM 2OZMA 4CGHA 1N6QA 1Z6RA 2ZQBA 4BRPA 3F2KA 3LANA 4PKIA 3TPQA 3VA0A 4DTPA 2IDOA 2GWJA 4Z0UA 3TSUA 1TKZA 3BP8A 4IOXA 1IO2A 4ZTFA 3VTIA 1VSIA 4FW1A 3D2FB 4FJLA 3RMDA 3H45C 4XEIA 5JVHL 1ATSA 4FVMA 5DM7L 3O9RA 1HKGA 2O4GA 1WBDA 2P9PA 1RDUA 4H0TB 5BPMA 1VSJA 4DSJA 5CY4A 4KPYA 4TSXA 1X3NA 3VF6A 1GLLO 2XRIA 3H6EA 4H0PA 4AHRA 3MXIA 3UE5A 1VSHA 4CGFA 5M1NA 4FJIA 3RVCA 4JI0K 1WLJA 4DFPA 1S72N 1D9DA 3N4QA 3EO3A 3J80O 4XIUA 3SBGA 3SAHA 3SPYA 4CK1A 3KK2A 2NRRA 2WFBA 4W5OA 4FJ5A 4FJ8A 2AA4A 4FM0A 4YFUA 1WBBA 4C8MA 3QEVA 1HYSA 3BF1A 3EKSA 3LPTA 4KKOA 1SZ2A 5FDLA 5C25A 3PX4A 1W7AA 3BEXA 3OTOK 4MLHA 5KRSA 1ZBSA 1N32K 3CPEA 1KSPA 4AF1A 3I0RA 3TAQA 2JWKA 5AQOA 4A5AA 1KVBA 1SAZA 3G25A 2NUBA 3M1FA 2O8CB 1KAXA 5C0YA 4H0OA 4C1NK 3VEOA 3VA3A 1N5YA 1OH7A 4NYFA 3THYA 4PL7A 5FLXO 4CJ3A 2JWLA 4QS7A 3IAYA 1NGFA 4DTJA 2F96A 2HHWA 3OYHA 3SUOA 3MN5A 1BISA 4JI5K 4DTNA 1XHZA 1TGOA 3ZSOA 4CEQA 3LDLA 4KTWA 4CJTA 1DTQA 1K73O 1J9AA 1Y64A 4YORA 1SL1A 2P5OA 4BC2A 4KV8A 1RILA 3U8XA 4GKJK 2YX6A 3OYIA 4JN4A 2Q2RA 3SQ0A 4CJLA 1GOBA 3C6TA 4CF9A 3O08A 3O9UA 1HLUA 1U6ZA 3VERA 5BR9A 4B8CA 4KHPK 3PX0A 3ENOA 1JJ2M 5HOOA 4I6MB 4JKGB 3SMSA 1YIJN 3HPHA 3KWIA 2E1ZA 1IJJA 3D45A 4CHYA 1N8RO 4CZJA 3K0SA 3RRHA 3I55N 4LD0A 3MEDA
chains in the Genus database with same CATH topology
3QESA 1WSEA 1RBTA 5HRPA 1Y97A 1RBSA 3QIPA 4CEOA 1LWCA 3OS1A 5J2PA 3LZIA 1U49A 4KHSA 4E3SA 4FXDA 3P1GA 3QNOA 4FLZA 4DU4A 2KZZA 3OYFA 1TV6A 1C0UA 1KFSA 3I0SA 1NKBA 1WAJA 1T7PA 4DTRA 4HTUA 3DYAA 4AHVA 1BQNA 4E7KA 3V9WA 3HL8A 3OS2A 2HVIA 4O4GA 3KLEA 4F3OA 4O55A 3SPZA 4FJXA 2QK9A 2D0AA 2HHSA 3F73A 4CF8A 1RT4A 4KHNA 3VQQA 2HHVA 1VRTA 3AA5X 4DSLA 2PZSA 1CZBA 4CHQA 3OS0A 3K5MA 2JGUA 2VG5A 1KLNA 2Z1IA 3AVAA 2Z1HA 2DY4A 5HRRA 4Z4EA 1TL1A 3C95A 4KHQA 2P5GA 3F9KA 2OPRA 3NF6A 2HW3A 1CZ9A 1Q9YA 3AVKA 3TI0A 2B4JA 3LPUA 1RTDA 1UAXA 4DQIA 4CJVA 1IKYA 1BI4B 4CHOA 3VQ6A 4Z4IA 3K58A 2FBXA 1UA1A 4FJJA 4KB1A 2F8TA 3MXMA 4RW8A 1RTHA 1WN7A 3K2PA 4CF2A 3LWMA 4CJEA 3B6PA 1QSLA 4J2BA 1RDCA 4AHTA 2E6LA 4W5TA 3V4IA 4O0JA 3RRGA 4C8NA 4M3YA 3KLHA 4JS5A 4DTMA 2IC3A 3NBPA 2OYQA 4EZ9A 4KTQA 5EU7A 4QAGA 3VQ5A 1BL3A 4HUEA 5KGXA 2X74A 1BCMA 3AVHA 3ZT3A 4DG1A 3IRXA 1WSFA 3E01A 1L5UA 2YV0X 4DSFA 4FLVA 1FKPA 1HPZA 3LAKA 3HK2A 2QKBA 5CYMA 4LH5A 4FM2A 1RTJA 3KTQA 3AO3A 3DM2A 4I9LA 5KTQA 3OYCA 1BHLA 4NCAA 1J5OA 1KLMA 2RKIA 2DTUA 4AH9A 3AO5A 1F21A 3UIQA 4FJHA 3HYFA 4DS5A 4B9TA 4F4KA 5FRNA 4CHNA 2YNFA 1WAFA 3H08A 3NHGA 3AV9A 1JXEA 3QEWA 4CFBA 3K59A 4C8OA 1QS4A 1QTMA 2FBTA 1HQEA 3ULDA 4ID5A 2LSNA 1A5WA 4H4OA 4WE1A 2G8HA 1RBVA 4B8AB 3NF8A 4Z4GA 1R0AA 4HCCA 3HO1A 1U4BA 1KVAA 2ZD1A 4CK3A 2OA8A 2ITGA 3HM9A 4KB0A 2PYJA 4FJGA 4CJUA 4CGDA 5K14A 1D9FA 2F8SA 3ZSVA 1TVRA 3QNNA 3SV4A 2HHUA 3KKSA 5FRMA 4B9LA 1HYZA 4ELVA 4N76A 4CEZA 4B9UA 4JS4A 1W0HA 2X78A 1B9DA 3DI6A 3ASMA 3OYNA 4BE0A 3PY8A 4FLYA 4RW4A 4CECA 4O0IA 3QETA 1X1PA 4PUOA 1U48A 4K8XA 1NKCA 2Y1IA 4FZZA 1S1WA 4CIEA 4CGIA 3V9XA 3ZSYA 3RMAA 2A1SA 1B9FA 3FFIA 3EZ5A 4KAZA 4Z4CA 1IKXA 2JLEA 3NF9A 3OJUA 2HNZA 4JRPA 1SKWA 2X6NA 4CFCA 4Y1DA 3BDPA 4M45A 4DS4A 4CJSA 3AVGA 3KJVA 3L3VA 1L3VA 1RTIA 3OYEA 3KD1E 1RT5A 1VSFA 2G8VA 1JL2A 1RCHA 3AVNA 4CEFA 4M3TA 4GMJB 2FBYA 3M8SA 5I3UA 2ATQA 2YNGA 3G10A 4KFBA 1KRPA 4L8RB 3MXJA 3U3YA 2DFFA 3HP9A 4KHWA 3RTVA 4CF1A 3K5OA 4H4MA 1J54A 4NCBA 2BE2A 3ZT2A 3VQBA 1ITGA 3AO1A 4FJMA 1CLQA 4KI6A 2Q3SA 1RBRA 1BIUA 3IS9A 3QO9A 1Q8IA 4IG3A 4IG0A 1QHTA 4B08A 4PWDA 3QIOA 4EP5A 4NYNA 1JLQA 2DFEA 3M8RA 4IFYA 3S3NA 1YTAA 2D5RA 4M3ZA 4DQSA 1VK0A 1XC9A 4ZHRA 3ZT1A 2RPIA 4CERA 1U04A 2YKMA 4RW6A 4BWMA 4DFMA 1L3UA 2G8KA 4BACA 4IBNA 5HRNA 1IH7A 1WSHA 2IGIA 5C24A 2IAJA 4CE9A 3PV8A 1O1WA 2HNDA 4W5QA 3A2FA 4NCGA 3AO2A 3EY1A 2BDPA 4E7LA 4DTOA 4PQUA 3DRRA 4Z4HA 3SV3A 3CM5A 4B9NA 3CQ8A 4B9MA 4KO0A 4I7FA 3OYBA 1D8YA 1JXBA 4I9QA 4CEEA 1ZYQA 3VQPA 4DU3A 3LDSA 1RNHA 1SV5A 4FK4A 4CJ4A 2B5JA 3OVNA 2XO7A 4DLEA 3TABA 4DSIA 4QCLA 1JLBA 3K5LA 5J2QA 1RDBA 2HB5A 3U6FA 3CFPA 1TK5A 3B6OA 3VQ9A 1EX4A 1VSMA 3TAFA 4CF0A 3V9SA 1GOAA 3MEDA 1HQUA 4N41A 1S9EA 2G8FA 3DLBA 4I2QA 3ZT4A 1NOYA 4FJNA 3P5JA 4ELTA 3AO4A 4DSEA 4DMNA 3PUFA 4J2EA 3L2RA 3PO4A 4E7IA 4BE1A 4DTSA 1TAQA 4PA1A 2XY7A 3U3GA 1A5VA 3L2UA 3ZSWA 3NDKA 1Q9XA 3T1AA 5CZ1A 4DTUA 1L3SA 1GOCA 2KZMA 4CEAA 3NH1A 4JLHA 3DOKA 3HT3A 3SI6A 1ZBHA 4GW6A 2XHBA 5SZTA 2AJQA 2D0CA 2KQ2A 2ZE2A 4AHUA 3KLFA 4FLWA 4UQGA 4DF4A 1ZBLA 2G8WA 4FLUA 3NAEA 4CEBA 2PY5A 2RF2A 1UOCA 1KCFA 5SWMA 1S1TA 4N47A 4CJ5A 3HP6A 1SL0A 3C6UA 1ZBUA 4J2DA 1BQMA 4F8RA 4BWJA 3AA2A 1EXQA 2HVHA 4Y1CA 3VQEA 3AVFA 2PYLA 3LP1A 1A5XA 3SUNA 5CZ2A 3C94A 4FK0A 5HRSA 4AHSA 3SJJA 3M8QA 2Z1JA 5CYQA 2HNYA 3O4QA 3V1OA 1TK0A 3OYJA 4FM1A 2IS3A 1JLAA 4ICLA 2OPSA 3HXMA 3JYTA 4FCYA 1NJYA 5C42A 4KRFA 1SL2A 1VSEA 2RN2A 3MAQA 4DFKA 4EP4A 1JLFA 3O3GA 1TAUA 5JS1A 3OY9A 1JL1A 1IKVA 2HMIA 3RR8A 4E89A 1XHXA 4O44A 3WNFA 1TK8A 2R7YA 2O4IA 3WNEA 3SQ1A 5HP1A 3RR7A 1J53A 1VSLA 3DLHA 3CM6A 1QE1A 4KHUA 1NK4A 1Z26A 3V9UA 4M42A 3OYKA 1X9MA 2P1JA 2YHAA 1LWFA 1NK7A 2GV9A 2YKNA 4KTZA 3LAMA 1K6YA 4LSLA 3SUQA 1NJZA 1NK9A 1G15A 3DRPA 3T19A 3VQAA 3KK1A 1FXXA 1B92A 2E6MA 3RMBA 4E19A 4OKEA 5KI6A 3KKRA 3O3FA 3LWLA 2VG6A 4FLXA 4KI4A 1FKOA 1W9HA 2YHBA 1RDAA 3K5NA 3DRSA 2GUIA 2HHXA 1BI4A 4DSKA 4Z4FA 3AA4A 4F2SA 4ID1A 1JKHA 3VQ4A 4LSNA 3TR8A 4W5NA 2GBZA 4CJRA 1NK6A 2FBVA 4E1NA 1TL3A 3CG7A 3WNHA 3S3MA 3L8BA 3PO5A 3MECA 4LY7A 4CJFA 4BDZA 4M3WA 1JLCA 4CIGA 1U47A 3V9ZA 3I8DA 5E41A 4KREA 1RDDA 4OVLA 4M3RA 3L2VA 1WSJA 4HUGA 2OZMA 5D3GA 4CGHA 4AHCA 1RT1A 3O3HA 1N6QA 2ZQBA 3VQDA 4CGGA 3SYZA 2YNHA 4BDPA 1HMVA 1KTQA 3VN5A 4O5BA 2KFZA 1NKEA 3LANA 4HUFA 5DK5A 3QINA 3V1QA 3V1RA 1NK0A 3RWUA 3T3FA 3VA0A 1YVUA 1RT2A 4OPKA 3OYLA 2IDOA 1JLGA 4IDKA 4DTPA 4Z0UA 3DOLA 1HRHA 4R5PA 1LWEA 1TKZA 4PY5A 5J1EA 4ZTFA 1IO2A 1BIZA 1VSIA 2Z1GA 4FW1A 1SUQA 3NGYA 1HYVA 3TWHA 3DLRA 4ELUA 4RW7A 3QEPA 3HVTA 3DLEA 2P51A 4Q5VA 1S6QA 3HPGA 1C1AA 4FJLA 3SZ2A 3L2WA 3RMDA 1DTTA 4GVMA 2HHTA 2Y1JA 4RG8A 1RT3A 4FVMA 4FJKA 1S9GA 1S5JA 2O4GA 1I39A 1TKTA 4MFBA 4E7HA 1NJWA 2BGGA 1KFDA 4OKJA 3G0ZA 3AVCA 3SQ2A 1VSJA 4CJWA 3THVA 2OPQA 2VG7A 4G1QA 4H8KA 5CY4A 4CHPA 4DTXA 4DSJA 4KPYA 1WSIA 4FJ9A 4TSXA 3TAGA 3VQ7A 2D0BA 1IG9A 4CCHA 1D5AA 4RW9A 4CEDA 4B9VA 3V81A 2XRIA 4FK2A 4F3TA 2HHQA 4AHRA 3MXIA 3BGRA 1C0MA 1VSHA 4CJPA 3RMCA 4KHYA 4CGFA 2ETJA 5HROA 4DF8A 3LP3A 3SCXA 1NK5A 5J2MA 4FZXC 4FJIA 1VRUA 3CFOA 4BE2A 3P83D 5HBMA 1IKWA 1JLEA 1CXQA 3EYZA 3MEGA 1WLJA 4CFDA 5KRTA 2OPPA 4DFPA 1D9DA 2KTQA 4DQRA 1EETA 4CESA 1LV5A 4OLAA 2W42A 1NOZA 4XIUA 1BGXT 1ASVA 1YTUA 3SUPA 4EZ6A 3AVJA 3ISNC 3KK3A 3QERA 3S3OA 3TAPA 3SPYA 4FZYA 3NFAA 4CK1A 3KK2A 2XY5A 1UWBA 3KIOA 4OKKA 4OGCA 3DLGA 2IOCA 4Q0BA 3SNNA 4W5OA 4FJ5A 4FJ8A 4FM0A 4CJKA 4J2AA 3ALYA 3NCIA 4E0DA 4YFUA 3VQCA 3DLKA 4C8MA 1X9WA 5I42A 3QEVA 1HYSA 4M3XA 1TKXA 3CYMA 1EKEA 3LPTA 3ZSZA 4KKOA 3PX4A 5FDLA 5C25A 4CIFA 3OYGA 3PX6A 3L3UA 3LP2A 4HVJA 2XY6A 5KRSA 1Z25A 4M41A 4C8LA 4F2RA 1ASUA 3AVMA 1LW0A 4E7JA 1KSPA 4B3OA 4DQQA 3TAMA 3I0RA 3LZJA 3ZCMA 3TAQA 1WNSA 4CFAA 4W5RA 1S1XA 3IG1A 5HLFA 1KVBA 3CFRA 3NE6A 3TAEA 2NUBA 4OPJA 4HHTA 2VWJA 3VA3A 1N5YA 3L2QA 3OYMA 1EP4A 4JRQA 4NYFA 3NGZA 3QEIA 1HNVA 1UA0A 4CHZA 3S9HA 2I5JA 3QEXA 4CJ3A 4BDYA 5DMRA 1NJXA 1T03A 3KLIA 1WSGA 3ZSXA 3IAYA 3OJSA 1ZBFA 2DFHA 3AA3A 4CK2A 4K8ZA 4N5SA 3AVIA 1RT7A 3AVLA 4DTJA 2QKKA 4IKFA 2BANA 1C1CA 3QLHA 2F96A 3VQ8A 4DWIA 2EHGA 2HHWA 3D0PA 3OYHA 3MEEA 2G8UA 4OGEA 3SUOA 4HCBA 4E1MA 1T05A 1BISA 1C6VA 1XWLA 4MQ3A 4DLGA 2WOMA 4DTNA 1XHZA 1QSYA 1TGOA 3ZSOA 4CEQA 4KTWA 4CJTA 3HVRA 2VWKA 1RBUA 3HPOA 1SKSA 1DTQA 4FW2A 1J9AA 2EX3A 4ZTJA 2XY8A 4QOZB 3OYDA 3M8PA 1X9SA 1SL1A 3HJFA 1QQCA 2P5OA 4KV8A 2A1RA 1RILA 1ASWA 3AVBA 1L3TA 1VSKA 1T8EA 1BCOA 2X6SA 4LH4A 4DQPA 2KFNA 3OYIA 4B9SA 3ZT0A 1LAWA 4M3UA 3SQ0A 5KGWA 1LW2A 2QXFA 3ITHA 5J2NA 4CJLA 4DFJA 3TARA 1TKDA 1SKRA 1C1BA 1LAVA 3O4NA 1GOBA 3C6TA 3HSTB 3NH2A 4YNQA 3K57A 5FROA 1MU2A 4CGJA 2OZSA 3ZSQA 5JS2A 4CF9A 3KLGA 1C0TA 4OJRA 1QSSA 1YT3A 4CJQA 3NGIA 4AILC 3WNGA 4OLBA 3OYAA 3KD5E 1NK8A 2G8IA 4IFVA 1S1UA 4B8CA 3PX0A 4C8KA 3ZSRA 1VSDA 2B6AA 3NH0A 1I3AA 1FK9A 4FYDA 4FJ7A 4I2PA 3LP0A 1HJRA 4FLTA 1S1VA 2E4LA 1ZBIA 4N56A 2YNIA 1S6PA 1HNIA 1XI1A 3HPHA 5T7BA 3SQ4A 2FC0A 3D45A 4CHYA 2WONA 4DU1A 1KVCA 1RT6A 3NF7A 1CXUA 1U45A 3RRHA 3LALA 1REVA 4LD0A 2KW4A 1DLOA 3JSMA 3V6DA 3DMJA 3TANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QES A;  1WSE A;  1RBT A;  5HRP A;  1Y97 A;  1RBS A;  3QIP A;  4CEO A;  1LWC A;  3OS1 A;  5J2P A;  3LZI A;  1U49 A;  4KHS A;  4E3S A;  4FXD A;  3P1G A;  3QNO A;  4FLZ A;  4DU4 A;  2KZZ A;  3OYF A;  1TV6 A;  1C0U A;  1KFS A;  3I0S A;  1NKB A;  1WAJ A;  1T7P A;  4DTR A;  4HTU A;  3DYA A;  4AHV A;  1BQN A;  4E7K A;  3V9W A;  3HL8 A;  3OS2 A;  2HVI A;  4O4G A;  3KLE A;  4F3O A;  4O55 A;  3SPZ A;  4FJX A;  2QK9 A;  2D0A A;  2HHS A;  3F73 A;  4CF8 A;  1RT4 A;  4KHN A;  3VQQ A;  2HHV A;  1VRT A;  3AA5 X;  4DSL A;  2PZS A;  1CZB A;  4CHQ A;  3OS0 A;  3K5M A;  2JGU A;  2VG5 A;  1KLN A;  2Z1I A;  3AVA A;  2Z1H A;  2DY4 A;  5HRR A;  4Z4E A;  1TL1 A;  3C95 A;  4KHQ A;  2P5G A;  3F9K A;  2OPR A;  3NF6 A;  2HW3 A;  1CZ9 A;  1Q9Y A;  3AVK A;  3TI0 A;  2B4J A;  3LPU A;  1RTD A;  1UAX A;  4DQI A;  4CJV A;  1IKY A;  1BI4 B;  4CHO A;  3VQ6 A;  4Z4I A;  3K58 A;  2FBX A;  1UA1 A;  4FJJ A;  4KB1 A;  2F8T A;  3MXM A;  4RW8 A;  1RTH A;  1WN7 A;  3K2P A;  4CF2 A;  3LWM A;  4CJE A;  3B6P A;  1QSL A;  4J2B A;  1RDC A;  4AHT A;  2E6L A;  4W5T A;  3V4I A;  4O0J A;  3RRG A;  4C8N A;  4M3Y A;  3KLH A;  4JS5 A;  4DTM A;  2IC3 A;  3NBP A;  2OYQ A;  4EZ9 A;  4KTQ A;  5EU7 A;  4QAG A;  3VQ5 A;  1BL3 A;  4HUE A;  5KGX A;  2X74 A;  1BCM A;  3AVH A;  3ZT3 A;  4DG1 A;  3IRX A;  1WSF A;  3E01 A;  1L5U A;  2YV0 X;  4DSF A;  4FLV A;  1FKP A;  1HPZ A;  3LAK A;  3HK2 A;  2QKB A;  5CYM A;  4LH5 A;  4FM2 A;  1RTJ A;  3KTQ A;  3AO3 A;  3DM2 A;  4I9L A;  5KTQ A;  3OYC A;  1BHL A;  4NCA A;  1J5O A;  1KLM A;  2RKI A;  2DTU A;  4AH9 A;  3AO5 A;  1F21 A;  3UIQ A;  4FJH A;  3HYF A;  4DS5 A;  4B9T A;  4F4K A;  5FRN A;  4CHN A;  2YNF A;  1WAF A;  3H08 A;  3NHG A;  3AV9 A;  1JXE A;  3QEW A;  4CFB A;  3K59 A;  4C8O A;  1QS4 A;  1QTM A;  2FBT A;  1HQE A;  3ULD A;  4ID5 A;  2LSN A;  1A5W A;  4H4O A;  4WE1 A;  2G8H A;  1RBV A;  4B8A B;  3NF8 A;  4Z4G A;  1R0A A;  4HCC A;  3HO1 A;  1U4B A;  1KVA A;  2ZD1 A;  4CK3 A;  2OA8 A;  2ITG A;  3HM9 A;  4KB0 A;  2PYJ A;  4FJG A;  4CJU A;  4CGD A;  5K14 A;  1D9F A;  2F8S A;  3ZSV A;  1TVR A;  3QNN A;  3SV4 A;  2HHU A;  3KKS A;  5FRM A;  4B9L A;  1HYZ A;  4ELV A;  4N76 A;  4CEZ A;  4B9U A;  4JS4 A;  1W0H A;  2X78 A;  1B9D A;  3DI6 A;  3ASM A;  3OYN A;  4BE0 A;  3PY8 A;  4FLY A;  4RW4 A;  4CEC A;  4O0I A;  3QET A;  1X1P A;  4PUO A;  1U48 A;  4K8X A;  1NKC A;  2Y1I A;  4FZZ A;  1S1W A;  4CIE A;  4CGI A;  3V9X A;  3ZSY A;  3RMA A;  2A1S A;  1B9F A;  3FFI A;  3EZ5 A;  4KAZ A;  4Z4C A;  1IKX A;  2JLE A;  3NF9 A;  3OJU A;  2HNZ A;  4JRP A;  1SKW A;  2X6N A;  4CFC A;  4Y1D A;  3BDP A;  4M45 A;  4DS4 A;  4CJS A;  3AVG A;  3KJV A;  3L3V A;  1L3V A;  1RTI A;  3OYE A;  3KD1 E;  1RT5 A;  1VSF A;  2G8V A;  1JL2 A;  1RCH A;  3AVN A;  4CEF A;  4M3T A;  4GMJ B;  2FBY A;  3M8S A;  5I3U A;  2ATQ A;  2YNG A;  3G10 A;  4KFB A;  1KRP A;  4L8R B;  3MXJ A;  3U3Y A;  2DFF A;  3HP9 A;  4KHW A;  3RTV A;  4CF1 A;  3K5O A;  4H4M A;  1J54 A;  4NCB A;  2BE2 A;  3ZT2 A;  3VQB A;  1ITG A;  3AO1 A;  4FJM A;  1CLQ A;  4KI6 A;  2Q3S A;  1RBR A;  1BIU A;  3IS9 A;  3QO9 A;  1Q8I A;  4IG3 A;  4IG0 A;  1QHT A;  4B08 A;  4PWD A;  3QIO A;  4EP5 A;  4NYN A;  1JLQ A;  2DFE A;  3M8R A;  4IFY A;  3S3N A;  1YTA A;  2D5R A;  4M3Z A;  4DQS A;  1VK0 A;  1XC9 A;  4ZHR A;  3ZT1 A;  2RPI A;  4CER A;  1U04 A;  2YKM A;  4RW6 A;  4BWM A;  4DFM A;  1L3U A;  2G8K A;  4BAC A;  4IBN A;  5HRN A;  1IH7 A;  1WSH A;  2IGI A;  5C24 A;  2IAJ A;  4CE9 A;  3PV8 A;  1O1W A;  2HND A;  4W5Q A;  3A2F A;  4NCG A;  3AO2 A;  3EY1 A;  2BDP A;  4E7L A;  4DTO A;  4PQU A;  3DRR A;  4Z4H A;  3SV3 A;  3CM5 A;  4B9N A;  3CQ8 A;  4B9M A;  4KO0 A;  4I7F A;  3OYB A;  1D8Y A;  1JXB A;  4I9Q A;  4CEE A;  1ZYQ A;  3VQP A;  4DU3 A;  3LDS A;  1RNH A;  1SV5 A;  4FK4 A;  4CJ4 A;  2B5J A;  3OVN A;  2XO7 A;  4DLE A;  3TAB A;  4DSI A;  4QCL A;  1JLB A;  3K5L A;  5J2Q A;  1RDB A;  2HB5 A;  3U6F A;  3CFP A;  1TK5 A;  3B6O A;  3VQ9 A;  1EX4 A;  1VSM A;  3TAF A;  4CF0 A;  3V9S A;  1GOA A;  3MED A;  1HQU A;  4N41 A;  1S9E A;  2G8F A;  3DLB A;  4I2Q A;  3ZT4 A;  1NOY A;  4FJN A;  3P5J A;  4ELT A;  3AO4 A;  4DSE A;  4DMN A;  3PUF A;  4J2E A;  3L2R A;  3PO4 A;  4E7I A;  4BE1 A;  4DTS A;  1TAQ A;  4PA1 A;  2XY7 A;  3U3G A;  1A5V A;  3L2U A;  3ZSW A;  3NDK A;  1Q9X A;  3T1A A;  5CZ1 A;  4DTU A;  1L3S A;  1GOC A;  2KZM A;  4CEA A;  3NH1 A;  4JLH A;  3DOK A;  3HT3 A;  3SI6 A;  1ZBH A;  4GW6 A;  2XHB A;  5SZT A;  2AJQ A;  2D0C A;  2KQ2 A;  2ZE2 A;  4AHU A;  3KLF A;  4FLW A;  4UQG A;  4DF4 A;  1ZBL A;  2G8W A;  4FLU A;  3NAE A;  4CEB A;  2PY5 A;  2RF2 A;  1UOC A;  1KCF A;  5SWM A;  1S1T A;  4N47 A;  4CJ5 A;  3HP6 A;  1SL0 A;  3C6U A;  1ZBU A;  4J2D A;  1BQM A;  4F8R A;  4BWJ A;  3AA2 A;  1EXQ A;  2HVH A;  4Y1C A;  3VQE A;  3AVF A;  2PYL A;  3LP1 A;  1A5X A;  3SUN A;  5CZ2 A;  3C94 A;  4FK0 A;  5HRS A;  4AHS A;  3SJJ A;  3M8Q A;  2Z1J A;  5CYQ A;  2HNY A;  3O4Q A;  3V1O A;  1TK0 A;  3OYJ A;  4FM1 A;  2IS3 A;  1JLA A;  4ICL A;  2OPS A;  3HXM A;  3JYT A;  4FCY A;  1NJY A;  5C42 A;  4KRF A;  1SL2 A;  1VSE A;  2RN2 A;  3MAQ A;  4DFK A;  4EP4 A;  1JLF A;  3O3G A;  1TAU A;  5JS1 A;  3OY9 A;  1JL1 A;  1IKV A;  2HMI A;  3RR8 A;  4E89 A;  1XHX A;  4O44 A;  3WNF A;  1TK8 A;  2R7Y A;  2O4I A;  3WNE A;  3SQ1 A;  5HP1 A;  3RR7 A;  1J53 A;  1VSL A;  3DLH A;  3CM6 A;  1QE1 A;  4KHU A;  1NK4 A;  1Z26 A;  3V9U A;  4M42 A;  3OYK A;  1X9M A;  2P1J A;  2YHA A;  1LWF A;  1NK7 A;  2GV9 A;  2YKN A;  4KTZ A;  3LAM A;  1K6Y A;  4LSL A;  3SUQ A;  1NJZ A;  1NK9 A;  1G15 A;  3DRP A;  3T19 A;  3VQA A;  3KK1 A;  1FXX A;  1B92 A;  2E6M A;  3RMB A;  4E19 A;  4OKE A;  5KI6 A;  3KKR A;  3O3F A;  3LWL A;  2VG6 A;  4FLX A;  4KI4 A;  1FKO A;  1W9H A;  2YHB A;  1RDA A;  3K5N A;  3DRS A;  2GUI A;  2HHX A;  1BI4 A;  4DSK A;  4Z4F A;  3AA4 A;  4F2S A;  4ID1 A;  1JKH A;  3VQ4 A;  4LSN A;  3TR8 A;  4W5N A;  2GBZ A;  4CJR A;  1NK6 A;  2FBV A;  4E1N A;  1TL3 A;  3CG7 A;  3WNH A;  3S3M A;  3L8B A;  3PO5 A;  3MEC A;  4LY7 A;  4CJF A;  4BDZ A;  4M3W A;  1JLC A;  4CIG A;  1U47 A;  3V9Z A;  3I8D A;  5E41 A;  4KRE A;  1RDD A;  4OVL A;  4M3R A;  3L2V A;  1WSJ A;  4HUG A;  2OZM A;  5D3G A;  4CGH A;  4AHC A;  1RT1 A;  3O3H A;  1N6Q A;  2ZQB A;  3VQD A;  4CGG A;  3SYZ A;  2YNH A;  4BDP A;  1HMV A;  1KTQ A;  3VN5 A;  4O5B A;  2KFZ A;  1NKE A;  3LAN A;  4HUF A;  5DK5 A;  3QIN A;  3V1Q A;  3V1R A;  1NK0 A;  3RWU A;  3T3F A;  3VA0 A;  1YVU A;  1RT2 A;  4OPK A;  3OYL A;  2IDO A;  1JLG A;  4IDK A;  4DTP A;  4Z0U A;  3DOL A;  1HRH A;  4R5P A;  1LWE A;  1TKZ A;  4PY5 A;  5J1E A;  4ZTF A;  1IO2 A;  1BIZ A;  1VSI A;  2Z1G A;  4FW1 A;  1SUQ A;  3NGY A;  1HYV A;  3TWH A;  3DLR A;  4ELU A;  4RW7 A;  3QEP A;  3HVT A;  3DLE A;  2P51 A;  4Q5V A;  1S6Q A;  3HPG A;  1C1A A;  4FJL A;  3SZ2 A;  3L2W A;  3RMD A;  1DTT A;  4GVM A;  2HHT A;  2Y1J A;  4RG8 A;  1RT3 A;  4FVM A;  4FJK A;  1S9G A;  1S5J A;  2O4G A;  1I39 A;  1TKT A;  4MFB A;  4E7H A;  1NJW A;  2BGG A;  1KFD A;  4OKJ A;  3G0Z A;  3AVC A;  3SQ2 A;  1VSJ A;  4CJW A;  3THV A;  2OPQ A;  2VG7 A;  4G1Q A;  4H8K A;  5CY4 A;  4CHP A;  4DTX A;  4DSJ A;  4KPY A;  1WSI A;  4FJ9 A;  4TSX A;  3TAG A;  3VQ7 A;  2D0B A;  1IG9 A;  4CCH A;  1D5A A;  4RW9 A;  4CED A;  4B9V A;  3V81 A;  2XRI A;  4FK2 A;  4F3T A;  2HHQ A;  4AHR A;  3MXI A;  3BGR A;  1C0M A;  1VSH A;  4CJP A;  3RMC A;  4KHY A;  4CGF A;  2ETJ A;  5HRO A;  4DF8 A;  3LP3 A;  3SCX A;  1NK5 A;  5J2M A;  4FZX C;  4FJI A;  1VRU A;  3CFO A;  4BE2 A;  3P83 D;  5HBM A;  1IKW A;  1JLE A;  1CXQ A;  3EYZ A;  3MEG A;  1WLJ A;  4CFD A;  5KRT A;  2OPP A;  4DFP A;  1D9D A;  2KTQ A;  4DQR A;  1EET A;  4CES A;  1LV5 A;  4OLA A;  2W42 A;  1NOZ A;  4XIU A;  1BGX T;  1ASV A;  1YTU A;  3SUP A;  4EZ6 A;  3AVJ A;  3ISN C;  3KK3 A;  3QER A;  3S3O A;  3TAP A;  3SPY A;  4FZY A;  3NFA A;  4CK1 A;  3KK2 A;  2XY5 A;  1UWB A;  3KIO A;  4OKK A;  4OGC A;  3DLG A;  2IOC A;  4Q0B A;  3SNN A;  4W5O A;  4FJ5 A;  4FJ8 A;  4FM0 A;  4CJK A;  4J2A A;  3ALY A;  3NCI A;  4E0D A;  4YFU A;  3VQC A;  3DLK A;  4C8M A;  1X9W A;  5I42 A;  3QEV A;  1HYS A;  4M3X A;  1TKX A;  3CYM A;  1EKE A;  3LPT A;  3ZSZ A;  4KKO A;  3PX4 A;  5FDL A;  5C25 A;  4CIF A;  3OYG A;  3PX6 A;  3L3U A;  3LP2 A;  4HVJ A;  2XY6 A;  5KRS A;  1Z25 A;  4M41 A;  4C8L A;  4F2R A;  1ASU A;  3AVM A;  1LW0 A;  4E7J A;  1KSP A;  4B3O A;  4DQQ A;  3TAM A;  3I0R A;  3LZJ A;  3ZCM A;  3TAQ A;  1WNS A;  4CFA A;  4W5R A;  1S1X A;  3IG1 A;  5HLF A;  1KVB A;  3CFR A;  3NE6 A;  3TAE A;  2NUB A;  4OPJ A;  4HHT A;  2VWJ A;  3VA3 A;  1N5Y A;  3L2Q A;  3OYM A;  1EP4 A;  4JRQ A;  4NYF A;  3NGZ A;  3QEI A;  1HNV A;  1UA0 A;  4CHZ A;  3S9H A;  2I5J A;  3QEX A;  4CJ3 A;  4BDY A;  5DMR A;  1NJX A;  1T03 A;  3KLI A;  1WSG A;  3ZSX A;  3IAY A;  3OJS A;  1ZBF A;  2DFH A;  3AA3 A;  4CK2 A;  4K8Z A;  4N5S A;  3AVI A;  1RT7 A;  3AVL A;  4DTJ A;  2QKK A;  4IKF A;  2BAN A;  1C1C A;  3QLH A;  2F96 A;  3VQ8 A;  4DWI A;  2EHG A;  2HHW A;  3D0P A;  3OYH A;  3MEE A;  2G8U A;  4OGE A;  3SUO A;  4HCB A;  4E1M A;  1T05 A;  1BIS A;  1C6V A;  1XWL A;  4MQ3 A;  4DLG A;  2WOM A;  4DTN A;  1XHZ A;  1QSY A;  1TGO A;  3ZSO A;  4CEQ A;  4KTW A;  4CJT A;  3HVR A;  2VWK A;  1RBU A;  3HPO A;  1SKS A;  1DTQ A;  4FW2 A;  1J9A A;  2EX3 A;  4ZTJ A;  2XY8 A;  4QOZ B;  3OYD A;  3M8P A;  1X9S A;  1SL1 A;  3HJF A;  1QQC A;  2P5O A;  4KV8 A;  2A1R A;  1RIL A;  1ASW A;  3AVB A;  1L3T A;  1VSK A;  1T8E A;  1BCO A;  2X6S A;  4LH4 A;  4DQP A;  2KFN A;  3OYI A;  4B9S A;  3ZT0 A;  1LAW A;  4M3U A;  3SQ0 A;  5KGW A;  1LW2 A;  2QXF A;  3ITH A;  5J2N A;  4CJL A;  4DFJ A;  3TAR A;  1TKD A;  1SKR A;  1C1B A;  1LAV A;  3O4N A;  1GOB A;  3C6T A;  3HST B;  3NH2 A;  4YNQ A;  3K57 A;  5FRO A;  1MU2 A;  4CGJ A;  2OZS A;  3ZSQ A;  5JS2 A;  4CF9 A;  3KLG A;  1C0T A;  4OJR A;  1QSS A;  1YT3 A;  4CJQ A;  3NGI A;  4AIL C;  3WNG A;  4OLB A;  3OYA A;  3KD5 E;  1NK8 A;  2G8I A;  4IFV A;  1S1U A;  4B8C A;  3PX0 A;  4C8K A;  3ZSR A;  1VSD A;  2B6A A;  3NH0 A;  1I3A A;  1FK9 A;  4FYD A;  4FJ7 A;  4I2P A;  3LP0 A;  1HJR A;  4FLT A;  1S1V A;  2E4L A;  1ZBI A;  4N56 A;  2YNI A;  1S6P A;  1HNI A;  1XI1 A;  3HPH A;  5T7B A;  3SQ4 A;  2FC0 A;  3D45 A;  4CHY A;  2WON A;  4DU1 A;  1KVC A;  1RT6 A;  3NF7 A;  1CXU A;  1U45 A;  3RRH A;  3LAL A;  1REV A;  4LD0 A;  2KW4 A;  1DLO A;  3JSM A;  3V6D A;  3DMJ A;  3TAN A; 
#chains in the Genus database with same CATH topology
 3QES A;  4A62 A;  1OH8 A;  1MWM A;  5HRP A;  1Y97 A;  3QIP A;  4CEO A;  1S22 A;  3OS1 A;  4KHS A;  4FXD A;  4E3S A;  4K43 A;  4A5B A;  2GTD A;  2KZZ A;  3I0S A;  1NKB A;  4HTU A;  3ATU A;  3L6Q A;  3MX2 A;  2Q36 A;  3CCE N;  1K8K A;  4GV6 A;  3SPZ A;  2QK9 A;  2Q31 A;  3C65 A;  1RT4 A;  3R1X A;  4CF8 A;  2P9S B;  2HHV A;  1VRT A;  4MDA A;  3AA5 X;  4DSL A;  2PZS A;  2VG5 A;  1K8A O;  4BGB A;  4KHQ A;  2P5G A;  3DXM A;  3F9K A;  3PSI A;  2OPR A;  3NF6 A;  2HW3 A;  1Q9Y A;  5M1F A;  5LJW A;  5H1S Q;  4BC3 A;  1UAX A;  2A3Z A;  1IKY A;  1WUA A;  4Z4I A;  2FBX A;  4KB1 A;  2F8T A;  3OBY A;  5AQK A;  4RW8 A;  4G9Z A;  1VQ5 N;  4W5T A;  4C1N I;  5EXW A;  4WQ4 C;  3ID6 A;  3TSQ A;  2KLA A;  4QAG A;  1BL3 A;  3UKU A;  4KH6 A;  3AVH A;  4DG1 A;  3E01 A;  4H5W A;  3DAW A;  2P9L A;  3HK2 A;  3KK7 A;  4LH5 A;  1X3M A;  3Q7C A;  3KTQ A;  3DM2 A;  4DQ8 A;  3OYC A;  4NCA A;  1TUU A;  1J5O A;  2RKI A;  2PAV A;  1F21 A;  3UIQ A;  3HYF A;  4CHN A;  1WAF A;  2YI1 A;  1JCE A;  3O5B A;  3AV9 A;  3NHG A;  3FZM A;  2QWL A;  4CFB A;  3K59 A;  1QS4 A;  2FBT A;  1HQE A;  4C8O A;  4WE1 A;  3FZH A;  1U2V B;  3NF8 A;  4B8A B;  3J81 O;  5C10 A;  4GNI A;  5AQY A;  1D9F A;  3KWG A;  4LF6 K;  4B1Y B;  3KKS A;  5FRM A;  1HYZ A;  3JAM O;  4JS4 A;  2GUP A;  1B9D A;  3DI6 A;  1XNQ K;  2ZM6 K;  4FLY A;  2P9K B;  3QET A;  1NKC A;  3RMA A;  2A1S A;  4Z4C A;  3OJU A;  3NF9 A;  4JRP A;  3KJV A;  1OH6 A;  1RTI A;  2GX9 A;  3AVN A;  4BRH A;  4CEF A;  2YNG A;  3G10 A;  1KRP A;  4L8R B;  2VGM A;  3HRG A;  4CZL A;  4NCB A;  2BE2 A;  3ZT2 A;  3AO1 A;  3CCJ N;  4KI6 A;  2NZT A;  1KAY A;  2F4V K;  3QO9 A;  4B08 A;  2DFE A;  1YTA A;  2D5R A;  1LCU A;  1XC9 A;  4ZHR A;  3ZT1 A;  1GLE G;  4CER A;  3QIC A;  2YKM A;  1YI2 N;  2HOE A;  1IH7 A;  3AO2 A;  3R3L A;  4MDB A;  3CPW M;  4PQU A;  3DRR A;  2DPN A;  5IWA K;  4A57 A;  2A41 A;  4I7F A;  3OYB A;  2VCP A;  1DKG D;  5GAE P;  4DU3 A;  1SV5 A;  4DUY K;  3CJ9 A;  2CGL A;  4DSI A;  1JLB A;  3K5L A;  3SAG A;  1HX1 A;  4UY8 O;  3TAF A;  1Q7Y O;  1M90 O;  4WQ4 A;  2G8F A;  3CCM N;  3DLB A;  5DM6 L;  2P9I B;  3PUF A;  3PO4 A;  4E7I A;  4BE1 A;  5LMU K;  1TAQ A;  5GAD P;  1O13 A;  3NH1 A;  4CZK A;  3VEY A;  3DOK A;  4IDH A;  2XHB A;  5SZT A;  2AJQ A;  1JCF A;  4DKW A;  1P90 A;  4BVO A;  4UQG A;  3M6G A;  4M63 C;  4CEB A;  1KXP A;  1QHA A;  1KCF A;  1ESV A;  1S1T A;  4CJ5 A;  5SWM A;  1BQM A;  1EXQ A;  3O1B A;  2EWS A;  1A5X A;  5CZ2 A;  4B1V A;  5CYQ A;  1RFQ A;  1NJY A;  3JYT A;  3THX B;  2RN2 A;  4DFK A;  1JLF A;  2D1K A;  1TAU A;  3O1W A;  5JS1 A;  1IKV A;  4OPH A;  2QWO A;  1TK8 A;  4O44 A;  3CMA N;  3N4P A;  3H3N O;  4WQ5 C;  1VSL A;  3CM6 A;  5AQZ A;  2YHA A;  3C6A A;  4KTZ A;  4XH4 A;  4LSL A;  3SUQ A;  4BG9 A;  5AQN A;  4WF9 L;  3T19 A;  3HOS A;  1NJZ A;  3KK1 A;  1NK9 A;  1KC8 O;  3O3F A;  2VG6 A;  2A6A A;  1W9H A;  2W6L A;  1BI4 A;  4Z4F A;  4F2S A;  4LSN A;  1NK6 A;  3RSE A;  2FBV A;  1TL3 A;  3L8B A;  3PO5 A;  3MEC A;  2O8F B;  3EE9 A;  1JLC A;  2P9U B;  3V9Z A;  5E41 A;  1RDD A;  5AQR A;  2YCH A;  4DV2 K;  3VQD A;  3SYZ A;  1KTQ A;  3VN5 A;  4KBO A;  4O5B A;  5EX5 A;  5JMV A;  5F0X A;  1Q18 A;  3FZK A;  3CQY A;  3T3F A;  2OCE A;  4JKB A;  4OPK A;  3OYL A;  1JLG A;  2V7Z A;  5GAG P;  3A5L C;  1YJN N;  2Z1G A;  3NGY A;  3P4I A;  4PKG A;  4RW7 A;  3QEP A;  3MDQ A;  3HPG A;  3L2W A;  2Y1J A;  4RG8 A;  1RT3 A;  1NM1 A;  3JS6 A;  5AQW A;  4MFB A;  3HSC A;  1KFD A;  3IMX A;  3G0Z A;  2OPQ A;  4CHP A;  4G1Q A;  3TAG A;  4CCH A;  4E1J A;  1D5A A;  2P9N A;  4CED A;  4FK2 A;  4A59 A;  3V81 A;  3RMC A;  4FWS A;  4BY9 C;  1IBL K;  3CCS N;  3P39 A;  4WYB A;  5J2M A;  1VRU A;  3MN9 A;  2FF3 B;  3P83 D;  4MLE A;  5HBM A;  4BE2 A;  1JLE A;  4WCE L;  3EYZ A;  3DXK A;  3MEG A;  2OPP A;  1EET A;  4CES A;  3THW B;  3R8E A;  1BGX T;  3AVJ A;  5GIO A;  3KK3 A;  5JLH A;  3S3O A;  4JI8 K;  4FZY A;  5I9E B;  1W97 L;  2XY5 A;  4OKK A;  5M1Q A;  3U4L A;  4L3Q A;  4Q0B A;  4DB3 A;  4J2A A;  3ALY A;  3NCI A;  3VQC A;  3MCA B;  3CJB A;  4WQ5 A;  3DLK A;  3TTF A;  3AAQ A;  1TKX A;  4JAX A;  3FR0 A;  3PX6 A;  3L3U A;  3ZEU B;  3LP2 A;  4H5V A;  1Z25 A;  3CME N;  5AR0 A;  4DV1 K;  4F2R A;  2E5L K;  1ASU A;  3AVM A;  4EHT A;  3L0Q A;  1DGK N;  1WNS A;  4CFA A;  2O8B A;  3CJ1 A;  1VQP N;  4KH5 A;  5GIP A;  4HHT A;  2VWJ A;  2D0P A;  3PSF A;  4RWT A;  3L2Q A;  3OYM A;  4JRQ A;  3NGZ A;  4CHZ A;  5BRF A;  3S9H A;  2I5J A;  3I33 A;  3OJS A;  4JI6 K;  2DFH A;  3AA3 A;  1VQL N;  4FL9 A;  3AVI A;  2QKK A;  4IKF A;  2BAN A;  1HNW K;  2EHG A;  3D0P A;  4E1M A;  1XWL A;  2QWM A;  1QSY A;  4DLG A;  3QB0 A;  1TYQ A;  2RHK A;  5AZI B;  1RBU A;  1SKS A;  3D6R A;  1EWR A;  4FOE A;  4ZTJ A;  1DT9 A;  1GLB G;  2XY8 A;  4OPA A;  3M8P A;  1X9S A;  1QQC A;  1QZ6 A;  3AVB A;  5GAH P;  1L3T A;  4X66 K;  2QW9 A;  4LH4 A;  3ZT0 A;  1HUX A;  4NO7 A;  5KGW A;  3AAP A;  1LW2 A;  2QXF A;  4EFH A;  1LAV A;  3O4N A;  3J7A P;  5FPD A;  1NWK A;  4OJR A;  1YT3 A;  3UKR A;  2O8D A;  3KD5 E;  1S1U A;  3LM9 A;  2B6A A;  3NH0 A;  1I3A A;  1FK9 A;  3CI5 A;  4FJ7 A;  3WXM B;  1S1V A;  3P31 A;  1C0F A;  5T7B A;  3SQ4 A;  3CJA A;  2FC0 A;  4BR0 A;  2IVO A;  1CXU A;  3CQX A;  3T1H K;  3HBT A;  3JSM A;  2NLX A;  1WSE A;  3QBW A;  5CHI A;  1RBS A;  1U49 A;  1LWC A;  3GOI A;  3TTD A;  5JVG L;  4FLZ A;  3D7E O;  1NU0 A;  1TV6 A;  1C0U A;  1YAG A;  2ZJQ L;  1KFS A;  5BRH A;  4WFB L;  2IVP A;  4CZF A;  1BQN A;  4FWR A;  2Q0R A;  2HVI A;  3KLE A;  5CR4 A;  1W2B M;  5AZJ B;  2D0A A;  4EHU A;  2IVN A;  3D2F A;  5AQT A;  3VGM A;  4CHQ A;  4H03 B;  3OS0 A;  2JGU A;  1YVN A;  2YHY A;  3F5T A;  1BO5 O;  5LL6 Z;  4NXM K;  2WTU A;  3PIO L;  3AVK A;  2F9T A;  4FWK A;  4PKH A;  1VQ9 N;  3LPU A;  3ULE B;  3A5N C;  4BVP A;  4DQI A;  4CHO A;  1BA0 A;  3OA9 A;  3VQ6 A;  2CGJ A;  2D0O A;  4U67 L;  3K2P A;  4J2B A;  4CF2 A;  4CJE A;  1QSL A;  4Z94 A;  3K9J A;  2FSN A;  1HPM A;  4ISF A;  5EU7 A;  4BC5 A;  2UUB K;  4DV0 K;  3QFU A;  1VQ7 N;  4HUE A;  5KGX A;  3CXC M;  4JK8 A;  2UUC K;  1NGD A;  3IRX A;  1L5U A;  4DSF A;  1HPZ A;  3LAK A;  3BZK A;  1NGI A;  5CYM A;  1RTJ A;  3AO3 A;  4R79 A;  1KLM A;  2DTU A;  5FPN A;  3P38 A;  4NB4 A;  4JV5 K;  3O9S A;  4B3R K;  2QEX N;  4NLC A;  1VQM N;  2YNF A;  1JXE A;  4ID5 A;  1A5W A;  1U4B A;  2I7P A;  4CK3 A;  2OA8 A;  4CW7 B;  2ITG A;  4FJG A;  4CJU A;  1TVR A;  3SV4 A;  4B9L A;  4EIA A;  2X78 A;  2E20 A;  3ENB A;  3OYN A;  3ASM A;  2KFZ A;  4CEC A;  4PUO A;  5AQS A;  3V9X A;  3ZSY A;  3ZLJ A;  4KAZ A;  3HJF A;  3EZ5 A;  4LFA K;  3ENH A;  2O8C A;  4CFC A;  4CVN E;  3AVG A;  3L3V A;  3VEW A;  1L3V A;  3KD1 E;  3OYE A;  2G8V A;  5E26 A;  1RCH A;  4M3T A;  3WQT A;  4YOU A;  2FBY A;  3M8S A;  2ATQ A;  4KFB A;  3HP9 A;  4IWV A;  4B1U B;  1BU6 O;  1J54 A;  1E4F T;  2Q1N A;  3QBX A;  4JI1 K;  4FJM A;  3CC2 N;  4IG0 A;  4EP5 A;  4NYN A;  3M8R A;  4JI3 K;  4IFY A;  4X64 K;  3UB5 A;  4M3Z A;  4IZ9 A;  2ZJP L;  2RPI A;  1U04 A;  4RW6 A;  2G8K A;  5ELZ A;  4BAC A;  1XC3 A;  3PV8 A;  5C24 A;  4BR4 A;  4XH1 A;  4NCG A;  3EY1 A;  3VET A;  2BDP A;  4DTO A;  4Z4H A;  3CQ8 A;  3BY5 A;  1D8Y A;  4LF8 K;  4I9Q A;  3VTH A;  1ZYQ A;  3VQP A;  1Q86 O;  4FK4 A;  4DLE A;  3TAB A;  4QCL A;  3KVG A;  5J2Q A;  3U6F A;  4FSV A;  2UXC K;  1GOA A;  5C12 A;  2A5X A;  2ZWH A;  1HQU A;  4N41 A;  3ZT4 A;  4FJN A;  2ITM A;  3AO4 A;  4CI6 A;  3MCP A;  1S3X A;  1QZ5 A;  4J2E A;  4FWL A;  3L2R A;  4PA1 A;  3GE1 A;  3VPZ A;  2HST A;  4JKH A;  2XY7 A;  3L2U A;  3ZSW A;  1OVQ A;  5CZ1 A;  5ADX A;  5F2R A;  2HMP A;  4H5T A;  4I6M A;  1GLF O;  4JKG A;  2UU9 K;  2D0C A;  3KLF A;  3NMU A;  3G4S N;  1UOC A;  1SL0 A;  3C6U A;  3AA2 A;  4Y1C A;  3CC4 N;  3SUN A;  3C94 A;  3F9M A;  4M7Y A;  4AHS A;  4V19 S;  3M8Q A;  3O4Q A;  2Q97 A;  1YXQ A;  5MLC Q;  3OYJ A;  4FCY A;  4X65 K;  1SL2 A;  3A8Y A;  4DV5 K;  3MAQ A;  5A2Q O;  3OY9 A;  3QML A;  2HMI A;  3RR8 A;  1I94 K;  3WNE A;  5HP1 A;  2P9S A;  3O80 A;  4M42 A;  1T3V A;  3OYK A;  2P1J A;  2GV9 A;  2YKN A;  3VEZ A;  3LAM A;  4BRF A;  1K6Y A;  4BRD A;  3VQA A;  3CC7 N;  2ZGZ A;  1B92 A;  4H0V B;  4BRO A;  1FKO A;  3O6W A;  3K5N A;  2HBL A;  3DRS A;  3AA4 A;  4ID1 A;  3VQ4 A;  3VF4 A;  2F7T A;  2UXD K;  2OTJ N;  4AM6 A;  4OO1 J;  4KRE A;  4OVL A;  4M3R A;  3L2V A;  1WSJ A;  2E1Y A;  4BRL A;  4CGG A;  1HMV A;  3AY9 A;  3SLC A;  4BR2 A;  1ZXO A;  1NKE A;  2E88 A;  3A5O C;  1KAZ A;  4JD2 B;  4HUF A;  3V1Q A;  3V1R A;  1NK0 A;  3RWU A;  1YVU A;  4K41 A;  5IT9 O;  4IDK A;  2FSJ A;  4JEP A;  2CH5 A;  3DOL A;  4CZI A;  4YY3 K;  2YJE A;  3M5R A;  1BIZ A;  2ZGY A;  3ZX3 A;  1GLD G;  2HF4 A;  5F1X A;  3TWH A;  3DLR A;  3J7Y P;  1DTT A;  1U2V A;  2AP1 A;  1NJW A;  4YOY A;  4JHD B;  3AVC A;  4FWO A;  3SQ2 A;  4CJW A;  3THV A;  2VG7 A;  4DTX A;  1WSI A;  4ISG A;  4RCH A;  2D0B A;  4FWQ A;  1IG9 A;  4RW9 A;  3D2E B;  4B9V A;  3QDK A;  1VHX A;  4CJ7 A;  2HHQ A;  4YOW A;  4KHY A;  3G6E N;  2ETJ A;  1NGE A;  5HRO A;  4DF8 A;  4ILG B;  1NK5 A;  3CFO A;  2P9K A;  1IKW A;  3GDQ A;  5KRT A;  1MA9 B;  2KTQ A;  1IV0 A;  4OLA A;  4LFB K;  1RGI A;  2NNW A;  1YTU A;  2RE2 A;  3SUP A;  4EZ6 A;  3WEE B;  3QER A;  2WUS A;  3TAP A;  1NGC A;  3NFA A;  1UWB A;  3KIO A;  4OGC A;  1NGB A;  2QWR A;  3DLG A;  2W40 A;  2IOC A;  2A40 A;  3CCR N;  3EE8 A;  1N34 K;  1OKJ A;  4DR6 K;  3C0B A;  3VF2 A;  4B3M K;  1IBK K;  1BG3 A;  3SK3 A;  1YUW A;  4M3X A;  2UXB K;  3CYM A;  1EKE A;  3LDP A;  4CIF A;  4CBW A;  4GY2 B;  1RDW X;  2XY6 A;  4IO9 L;  1ATR A;  1NGA A;  4M41 A;  5ADX H;  2V51 B;  3W3D A;  4E7J A;  3TAM A;  3LZJ A;  5TKW A;  2FF6 A;  4W5R A;  2BUP A;  4YDU C;  3TAE A;  5EVZ A;  3ID8 A;  1EP4 A;  3KHY A;  4CD3 A;  1HNZ K;  3ZET B;  1BUP A;  4LF5 K;  2P9I A;  3QEX A;  1KD1 O;  5DMR A;  3T7Z A;  4DR4 K;  2ASM A;  5M1K A;  3KLI A;  3CJC A;  5TKY A;  3BZC A;  3WXI A;  4CK2 A;  4K8Z A;  5KQ8 A;  1NGG A;  3AVL A;  3QLH A;  3GBT A;  1T6D A;  3AAR A;  1YF5 L;  1OH5 A;  3MEE A;  3E1Y A;  4HCB A;  4DUZ K;  4MQ3 A;  1VQ8 N;  2VWK A;  5BPN A;  3AGK A;  3WXL A;  4FW2 A;  2EX3 A;  1MDU B;  4QOZ B;  2FXU A;  3SJH A;  2UYT A;  5EOY A;  1T8E A;  1BCO A;  2X6S A;  4H0X B;  4YOT A;  1VQ4 N;  2KFN A;  1LAW A;  2NRV A;  4A2B A;  3THX A;  5J2N A;  3ITH A;  1TKD A;  1SKR A;  4DFJ A;  1P8Z A;  3HST B;  5FRO A;  4QS8 A;  3ZSQ A;  5JS2 A;  1HKC A;  2GWK A;  3KLG A;  1QSS A;  3NGI A;  2PFU A;  3FFK B;  4AIL C;  4OLB A;  3OYA A;  2VWB A;  2CH6 A;  5BRE A;  4O5F A;  3FE1 A;  4C8K A;  3ZSR A;  1VSD A;  4B9Q A;  5CE3 A;  3O9Q A;  2KKZ A;  4BQL A;  4FLT A;  1HJR A;  2E4L A;  5LY3 A;  4N56 A;  1HNI A;  2F9W A;  1XI1 A;  3QFP A;  3S41 A;  3LDO A;  2WON A;  4DU1 A;  1KVC A;  3NF7 A;  3LAL A;  1XNR K;  2O8F A;  3O4W A;  2KW4 A;  5BR8 K;  2P9U A;  1HNX K;  3V6D A;  4CBU A;  3TAN A;  1FJG K;  5J2P A;  2FSK A;  2HBK A;  5JIC A;  3IFR A;  2O8E B;  3SMP A;  3LZI A;  3BUZ B;  1NJI O;  3OYF A;  3ATV A;  1T7P A;  4DCH A;  4AHV A;  4E7K A;  3V9W A;  3HL8 A;  2QI2 A;  4O55 A;  2WC9 A;  2HHS A;  3L4I A;  3F73 A;  3VQQ A;  1V4S A;  4YOX A;  1CZB A;  4CD1 A;  3K5M A;  3GG4 A;  2DY4 A;  4YDU A;  4Z4E A;  1TL1 A;  3C95 A;  5FPM A;  1NMD A;  3TI0 A;  4CJV A;  4CZG A;  5AJ3 K;  4GKK K;  1G99 A;  4FJJ A;  2NRT A;  3CCV N;  2OZS A;  5AQU A;  2PBD A;  3IUC A;  3T1Y K;  1RDC A;  3CCU N;  3C7N B;  3RRG A;  3KLH A;  4JS5 A;  2IC3 A;  3NBP A;  4JKF A;  3VQ5 A;  5AQX A;  4BRE A;  2VQE K;  1BCM A;  4DR3 K;  3ZT3 A;  1WSF A;  2J4R A;  5AFU A;  3THW A;  2ASP A;  2YV0 X;  1FKP A;  1HKB A;  1SQK A;  2QKB A;  3SAF A;  4QS9 A;  4DV7 K;  3ZX2 A;  3CIP A;  3T69 A;  4AH9 A;  4OX9 K;  3AO5 A;  3NVM A;  4FJH A;  5FRN A;  4B9T A;  3H08 A;  3QEW A;  4H5N A;  1QTM A;  3ULD A;  4EAH D;  4Z4G A;  1R0A A;  3HO1 A;  2P9P B;  2HBJ A;  2ZD1 A;  4KB0 A;  4WFN L;  3VES A;  3ZSV A;  2HBM A;  3QNN A;  3ZEU A;  2HHU A;  3SBT A;  2W41 A;  3WXK A;  3I56 N;  1W0H A;  5LMN K;  4RW4 A;  2YHX A;  3ZX0 A;  4BC4 A;  1U48 A;  2Y1I A;  4K8X A;  4FZZ A;  1S1W A;  4CIE A;  3U9Z A;  3FFI A;  1EQY A;  4BGA A;  4ILH A;  2HNZ A;  2X6N A;  4JKE A;  4Y1D A;  1RT5 A;  3I8B A;  4GMJ B;  1EO1 A;  5C15 A;  4LF7 K;  3MXJ A;  3U3Y A;  4CF1 A;  3K5O A;  2VGN A;  3VQB A;  4U7B A;  1CLQ A;  2Q3S A;  3IS9 A;  4A2A A;  4IG3 A;  4JKA A;  4PWD A;  1QHT A;  3S3N A;  1VK0 A;  4FPA A;  5AZI A;  5HL7 L;  4BWM A;  3FGU A;  3EKU A;  4DR5 K;  2IAJ A;  1O1W A;  2HND A;  3H1V X;  3IDH A;  1NG9 A;  4BRN A;  4JI2 K;  4J8F A;  3SV3 A;  3CM5 A;  4CBX A;  4B9N A;  1NLV A;  4CEE A;  1RNH A;  4IJN A;  2B5J A;  1Q81 O;  1RDB A;  3FLC O;  4B3S K;  4PL8 A;  1VAZ A;  4DHY A;  4IJA A;  4O8U A;  3V9S A;  3R9P A;  3VMF B;  5AQQ A;  3CF5 L;  3THY B;  4I2Q A;  1NOY A;  3P5J A;  1E3M A;  4DSE A;  1YIT N;  4DTS A;  1A5V A;  3GL1 A;  4JI7 K;  3HZ6 A;  3T1A A;  4DTU A;  1M1K O;  1L3S A;  1GOC A;  2KHO A;  4CEA A;  2KZM A;  4JLH A;  3HT3 A;  3SI6 A;  4GW6 A;  2KQ2 A;  4AHU A;  1ZBL A;  5E84 A;  2G8W A;  4H0Y B;  4FLU A;  3NAE A;  2PY5 A;  2RF2 A;  1NGJ A;  4N47 A;  3EZW A;  4J2D A;  2NRH A;  4BWJ A;  4DV4 K;  4CZE A;  2HVH A;  1KQS M;  5FPE A;  2PYL A;  3E66 A;  3SJJ A;  2Z1J A;  3V1O A;  1TK0 A;  4FM1 A;  3VGK A;  4ICL A;  4KRF A;  4AM7 A;  5C42 A;  4IEI A;  4LF9 K;  5GIN A;  3CER A;  5AZJ A;  1XHX A;  2O4I A;  5AQP A;  2R7Y A;  4IO8 A;  2BTF A;  4B1Z A;  1NK4 A;  3V9U A;  4B1W B;  1X9M A;  1LWF A;  1NK7 A;  4RTF D;  4IOA L;  5AFU H;  4ILJ A;  1G15 A;  3EN9 A;  4F9O A;  3RMB A;  4OKE A;  3LWL A;  4FWP A;  4K0K K;  3ULE A;  5BRD A;  2YHB A;  2QWP A;  1RDA A;  2GUI A;  2OAN A;  2QXL A;  1FW6 A;  4DSK A;  4LC9 B;  3TR8 A;  2GBZ A;  2VYP A;  4E1N A;  3CG7 A;  3WNH A;  3S3M A;  4FPB A;  4LY7 A;  4BDZ A;  1U47 A;  4HUG A;  3O3H A;  4AHC A;  1RT1 A;  1J6Z A;  4BDP A;  2YNH A;  1HJO A;  1K9M O;  3OW2 M;  5DK5 A;  3QIN A;  2GEL A;  1N33 K;  3AGR A;  2CGK A;  1RT2 A;  1HRH A;  1K8K B;  1LWE A;  4R5P A;  4PY5 A;  5J1E A;  1IBM K;  1SUQ A;  4ELU A;  1HYV A;  3MK6 A;  3HVT A;  3DLE A;  2P51 A;  4Q5V A;  1S6Q A;  1C1A A;  2ZJR L;  3SZ2 A;  5M1P A;  4GVM A;  3MN7 A;  2HHT A;  5KPT A;  4FJK A;  1S9G A;  1S5J A;  3DXM B;  1I39 A;  1TKT A;  4E7H A;  2YJF A;  2BGG A;  4OKJ A;  5LJV A;  4H8K A;  1BA1 A;  5JLF A;  4FJ9 A;  3VQ7 A;  3J8A A;  4F3T A;  4O8K A;  3BGR A;  1C0M A;  4CJP A;  4KH4 A;  4YHH K;  3LP3 A;  3SCX A;  4FZX C;  3WXJ A;  1CXQ A;  3UKU B;  4CFD A;  3DLL L;  4DR1 K;  1OVY A;  4DQR A;  1LV5 A;  2W42 A;  2P9L B;  1V4T A;  1NOZ A;  3MWP A;  3ISN C;  3HM8 A;  1WB9 A;  3MX5 A;  5AQG A;  1QQM A;  1C0G A;  3LM2 A;  1NBW A;  3Q7B A;  4K25 A;  3SNN A;  4CJK A;  1T6C A;  4E0D A;  1X9W A;  2UUA K;  5I42 A;  4FWM A;  4BQZ A;  3ZSZ A;  4JKD A;  1CZA N;  3OYG A;  4HVJ A;  2HHH K;  3VGL A;  4NXN K;  4C8L A;  4BR7 A;  4WFA L;  1LW0 A;  4B3O A;  4DQQ A;  3CCL N;  3ZCM A;  1GLJ O;  3FZF A;  2V52 B;  1S1X A;  1X9J A;  3IG1 A;  4PHT X;  5HLF A;  3CFR A;  3NE6 A;  4IOC L;  3MN6 A;  4OPJ A;  4C23 A;  3QEI A;  1HNV A;  4IEE A;  1UA0 A;  2VQF K;  2QA4 N;  4JK7 A;  5BN8 A;  2V7Y A;  4BDY A;  1NJX A;  1T03 A;  3FZL A;  1WSG A;  3B8A X;  3ZSX A;  1ZBF A;  1EWQ A;  4N5S A;  1RT7 A;  4FWN A;  3PIP L;  1C1C A;  3M3Z A;  2GEM A;  3E9P A;  3VQ8 A;  4DWI A;  2G8U A;  4OGE A;  3VEX A;  1T05 A;  1C6V A;  2WOM A;  3J7Z O;  4IFE A;  3HVR A;  3HPO A;  5C2F A;  4DV6 K;  3OYD A;  1DEJ A;  2A1R A;  2E2N A;  1VQ6 N;  4JYA K;  4DR2 K;  1ASW A;  1VSK A;  4DQP A;  2OTL N;  1YJ9 N;  4B9S A;  4LF4 K;  4M3U A;  4JNE A;  3W0L A;  5C2D A;  3TAR A;  2W6K A;  3A0I X;  1C1B A;  3NH2 A;  4YNQ A;  3K57 A;  4LFC K;  1MU2 A;  4CGJ A;  4FVU A;  4CZH A;  2QTD A;  1C0T A;  3MMV A;  4CJQ A;  3E9L A;  2BH1 A;  3WNG A;  1NK8 A;  2G8I A;  2YHW A;  4IFV A;  4NLB A;  2Q0U A;  3PLA A;  3O9T A;  4FYD A;  1HR0 K;  4I2P A;  3LP0 A;  3LL3 A;  1ZBI A;  2YNI A;  1S6P A;  2E8A A;  1VQN N;  4ISE A;  1Q82 O;  1RT6 A;  1U45 A;  1REV A;  1ASV A;  1DLO A;  1Z05 A;  5KPR A;  3DMJ A;  3BF3 A;  3HXM A;  1RBT A;  1XUP O;  3HOT A;  4BRC A;  1LOT B;  1ATN A;  3P1G A;  1NNE A;  3QNO A;  4B1X B;  4DU4 A;  3KZB A;  4GVE A;  2E2Q A;  2NRW A;  1WAJ A;  4JD2 A;  4DTR A;  2ZF5 O;  3DYA A;  3OS2 A;  4O4G A;  1N36 K;  4F3O A;  4FJX A;  3R6M A;  4KHN A;  1QQN A;  4JKC A;  3CD6 N;  5AQM A;  1IG8 A;  3WQU A;  1QQO A;  1KLN A;  2Z1I A;  3AVA A;  2Z1H A;  5HRR A;  2D4W A;  1NGH A;  1XMQ K;  1CZ9 A;  3U9D A;  3HTV A;  1XMO K;  4JHD A;  3G71 N;  2B4J A;  1RTD A;  1BI4 B;  3K58 A;  1UA1 A;  5B8H A;  3LWM A;  1RTH A;  1WN7 A;  3D2E A;  3MXM A;  3B6P A;  3RSE B;  4AHT A;  2E6L A;  3V4I A;  4BRI A;  1T44 A;  2QM1 A;  4O0J A;  4M3Y A;  4C8N A;  4EZ9 A;  4DTM A;  2OYQ A;  4KTQ A;  1ILY A;  4M7X A;  5M1O A;  4BRK A;  1E4G T;  2X74 A;  2A42 A;  1YJW N;  3ZYY X;  5KQD A;  4BRA A;  3DWL A;  3EEQ A;  3H3O B;  3EL2 A;  4FLV A;  4BR9 A;  3VOV A;  4FM2 A;  4I9L A;  3VEV A;  5KTQ A;  3WEE A;  1BHL A;  2IIR A;  4GV3 A;  3WT0 A;  1BWF O;  3WUH A;  4FOI A;  4DS5 A;  4F4K A;  4Y0W A;  4BRQ A;  4BRG A;  1VQO N;  4MO5 A;  5AQF A;  2LSN A;  4H4O A;  3H46 O;  2NRZ A;  1RBV A;  2G8H A;  4HCC A;  1KVA A;  4IXC A;  3HM9 A;  2PYJ A;  5AQJ A;  4HTL A;  4CGD A;  4H5R A;  4DR7 K;  5K14 A;  2F8S A;  1D4X A;  2P9N B;  4K42 A;  2I7N A;  4ELV A;  4N76 A;  1GLC G;  4CEZ A;  4B9U A;  1SS6 A;  2QWN A;  4B3T K;  4BE0 A;  3PY8 A;  4O0I A;  1X1P A;  5AQV A;  3DXK B;  4CGI A;  1H1V A;  1B9F A;  5AQI A;  3LDQ A;  1IKX A;  2JLE A;  1SKW A;  3BDP A;  4M45 A;  4DS4 A;  4CJS A;  4A61 A;  1VSF A;  1JL2 A;  3ZET A;  5I3U A;  1TUY A;  3O8M A;  4KHW A;  2DFF A;  2E2O A;  3IKM A;  3CJ7 A;  4H4M A;  4BR5 A;  3RTV A;  3HI0 A;  3LDN A;  1ITG A;  2NRX A;  1RBR A;  3C6H A;  1BIU A;  5BPL A;  1Q8I A;  3QIO A;  1JLQ A;  1XQS C;  4DQS A;  5AQH A;  1L3U A;  4DFM A;  5EY4 A;  4IBN A;  5HRN A;  1WSH A;  2IGI A;  3TSP A;  4CE9 A;  4W5Q A;  3A2F A;  3K9K A;  4HWI A;  4E7L A;  3MWT A;  4B9M A;  4KO0 A;  1JXB A;  4GV9 A;  3LDS A;  4CJ4 A;  3OVN A;  2XO7 A;  5BN9 A;  2FLO A;  2HB5 A;  3H1Q A;  3CFP A;  1TK5 A;  3OBW A;  2O8B B;  3L4Q A;  3B6O A;  4JI4 K;  1EX4 A;  1VSM A;  3VQ9 A;  4CF0 A;  1S9E A;  1WOQ A;  1BOT O;  3NVK A;  4ELT A;  3TU5 A;  1NMN A;  4DMN A;  3VEN A;  5KPZ A;  4JK9 A;  1YHQ N;  3U3G A;  3NDK A;  1Q9X A;  1ZBH A;  1J5E K;  2ZE2 A;  4FLW A;  3A5M C;  4DF4 A;  1TYQ B;  4DV3 K;  1ZC6 A;  3HP6 A;  4CZM A;  1ZBU A;  4F8R A;  1JCG A;  3CET A;  2QWQ A;  3VQE A;  3AVF A;  4MO4 A;  2O8E A;  3LP1 A;  4FK0 A;  5HRS A;  3DJC A;  2HNY A;  4FO0 A;  2IS3 A;  1JLA A;  3E9O A;  2OPS A;  1VSE A;  5AQL A;  4BRM A;  4EP4 A;  2H3G X;  3O3G A;  1JL1 A;  4E89 A;  3WNF A;  4YOV A;  1GLA G;  3SQ1 A;  3RR7 A;  1J53 A;  3DLH A;  4KHU A;  1QE1 A;  1Z26 A;  1VQK N;  1BDG A;  3OHR A;  2ASO A;  3UKR B;  2O8D B;  1MWK A;  3DRP A;  1FXX A;  2E6M A;  4E19 A;  5KI6 A;  3KKR A;  4X62 K;  4FLX A;  4XH5 A;  3CCQ N;  4KI4 A;  1QVG M;  2E2P A;  2HHX A;  3TTC A;  1JKH A;  4W5N A;  4CJR A;  1R59 O;  3C7N A;  4BG8 A;  2WBN A;  3JXU A;  2HF3 A;  3CHW A;  4CJF A;  4AQY K;  4M3W A;  4CIG A;  3I8D A;  5D3G A;  1QVF M;  2OZM A;  4CGH A;  1N6Q A;  1Z6R A;  2ZQB A;  4BRP A;  3F2K A;  3LAN A;  4PKI A;  3TPQ A;  3VA0 A;  4DTP A;  2IDO A;  2GWJ A;  4Z0U A;  3TSU A;  1TKZ A;  3BP8 A;  4IOX A;  1IO2 A;  4ZTF A;  3VTI A;  1VSI A;  4FW1 A;  3D2F B;  4FJL A;  3RMD A;  3H45 C;  4XEI A;  5JVH L;  1ATS A;  4FVM A;  5DM7 L;  3O9R A;  1HKG A;  2O4G A;  1WBD A;  2P9P A;  1RDU A;  4H0T B;  5BPM A;  1VSJ A;  4DSJ A;  5CY4 A;  4KPY A;  4TSX A;  1X3N A;  3VF6 A;  1GLL O;  2XRI A;  3H6E A;  4H0P A;  4AHR A;  3MXI A;  3UE5 A;  1VSH A;  4CGF A;  5M1N A;  4FJI A;  3RVC A;  4JI0 K;  1WLJ A;  4DFP A;  1S72 N;  1D9D A;  3N4Q A;  3EO3 A;  3J80 O;  4XIU A;  3SBG A;  3SAH A;  3SPY A;  4CK1 A;  3KK2 A;  2NRR A;  2WFB A;  4W5O A;  4FJ5 A;  4FJ8 A;  2AA4 A;  4FM0 A;  4YFU A;  1WBB A;  4C8M A;  3QEV A;  1HYS A;  3BF1 A;  3EKS A;  3LPT A;  4KKO A;  1SZ2 A;  5FDL A;  5C25 A;  3PX4 A;  1W7A A;  3BEX A;  3OTO K;  4MLH A;  5KRS A;  1ZBS A;  1N32 K;  3CPE A;  1KSP A;  4AF1 A;  3I0R A;  3TAQ A;  2JWK A;  5AQO A;  4A5A A;  1KVB A;  1SAZ A;  3G25 A;  2NUB A;  3M1F A;  2O8C B;  1KAX A;  5C0Y A;  4H0O A;  4C1N K;  3VEO A;  3VA3 A;  1N5Y A;  1OH7 A;  4NYF A;  3THY A;  4PL7 A;  5FLX O;  4CJ3 A;  2JWL A;  4QS7 A;  3IAY A;  1NGF A;  4DTJ A;  2F96 A;  2HHW A;  3OYH A;  3SUO A;  3MN5 A;  1BIS A;  4JI5 K;  4DTN A;  1XHZ A;  1TGO A;  3ZSO A;  4CEQ A;  3LDL A;  4KTW A;  4CJT A;  1DTQ A;  1K73 O;  1J9A A;  1Y64 A;  4YOR A;  1SL1 A;  2P5O A;  4BC2 A;  4KV8 A;  1RIL A;  3U8X A;  4GKJ K;  2YX6 A;  3OYI A;  4JN4 A;  2Q2R A;  3SQ0 A;  4CJL A;  1GOB A;  3C6T A;  4CF9 A;  3O08 A;  3O9U A;  1HLU A;  1U6Z A;  3VER A;  5BR9 A;  4B8C A;  4KHP K;  3PX0 A;  3ENO A;  1JJ2 M;  5HOO A;  4I6M B;  4JKG B;  3SMS A;  1YIJ N;  3HPH A;  3KWI A;  2E1Z A;  1IJJ A;  3D45 A;  4CHY A;  1N8R O;  4CZJ A;  3K0S A;  3RRH A;  3I55 N;  4LD0 A;  3MED A; 
#chains in the Genus database with same CATH homology
 3QES A;  1WSE A;  1RBT A;  5HRP A;  1Y97 A;  1RBS A;  3QIP A;  4CEO A;  1LWC A;  3OS1 A;  5J2P A;  3LZI A;  1U49 A;  4KHS A;  4E3S A;  4FXD A;  3P1G A;  3QNO A;  4FLZ A;  4DU4 A;  2KZZ A;  3OYF A;  1TV6 A;  1C0U A;  1KFS A;  3I0S A;  1NKB A;  1WAJ A;  1T7P A;  4DTR A;  4HTU A;  3DYA A;  4AHV A;  1BQN A;  4E7K A;  3V9W A;  3HL8 A;  3OS2 A;  2HVI A;  4O4G A;  3KLE A;  4F3O A;  4O55 A;  3SPZ A;  4FJX A;  2QK9 A;  2D0A A;  2HHS A;  3F73 A;  4CF8 A;  1RT4 A;  4KHN A;  3VQQ A;  2HHV A;  1VRT A;  3AA5 X;  4DSL A;  2PZS A;  1CZB A;  4CHQ A;  3OS0 A;  3K5M A;  2JGU A;  2VG5 A;  1KLN A;  2Z1I A;  3AVA A;  2Z1H A;  2DY4 A;  5HRR A;  4Z4E A;  1TL1 A;  3C95 A;  4KHQ A;  2P5G A;  3F9K A;  2OPR A;  3NF6 A;  2HW3 A;  1CZ9 A;  1Q9Y A;  3AVK A;  3TI0 A;  2B4J A;  3LPU A;  1RTD A;  1UAX A;  4DQI A;  4CJV A;  1IKY A;  1BI4 B;  4CHO A;  3VQ6 A;  4Z4I A;  3K58 A;  2FBX A;  1UA1 A;  4FJJ A;  4KB1 A;  2F8T A;  3MXM A;  4RW8 A;  1RTH A;  1WN7 A;  3K2P A;  4CF2 A;  3LWM A;  4CJE A;  3B6P A;  1QSL A;  4J2B A;  1RDC A;  4AHT A;  2E6L A;  4W5T A;  3V4I A;  4O0J A;  3RRG A;  4C8N A;  4M3Y A;  3KLH A;  4JS5 A;  4DTM A;  2IC3 A;  3NBP A;  2OYQ A;  4EZ9 A;  4KTQ A;  5EU7 A;  4QAG A;  3VQ5 A;  1BL3 A;  4HUE A;  5KGX A;  2X74 A;  1BCM A;  3AVH A;  3ZT3 A;  4DG1 A;  3IRX A;  1WSF A;  3E01 A;  1L5U A;  2YV0 X;  4DSF A;  4FLV A;  1FKP A;  1HPZ A;  3LAK A;  3HK2 A;  2QKB A;  5CYM A;  4LH5 A;  4FM2 A;  1RTJ A;  3KTQ A;  3AO3 A;  3DM2 A;  4I9L A;  5KTQ A;  3OYC A;  1BHL A;  4NCA A;  1J5O A;  1KLM A;  2RKI A;  2DTU A;  4AH9 A;  3AO5 A;  1F21 A;  3UIQ A;  4FJH A;  3HYF A;  4DS5 A;  4B9T A;  4F4K A;  5FRN A;  4CHN A;  2YNF A;  1WAF A;  3H08 A;  3NHG A;  3AV9 A;  1JXE A;  3QEW A;  4CFB A;  3K59 A;  4C8O A;  1QS4 A;  1QTM A;  2FBT A;  1HQE A;  3ULD A;  4ID5 A;  2LSN A;  1A5W A;  4H4O A;  4WE1 A;  2G8H A;  1RBV A;  4B8A B;  3NF8 A;  4Z4G A;  1R0A A;  4HCC A;  3HO1 A;  1U4B A;  1KVA A;  2ZD1 A;  4CK3 A;  2OA8 A;  2ITG A;  3HM9 A;  4KB0 A;  2PYJ A;  4FJG A;  4CJU A;  4CGD A;  5K14 A;  1D9F A;  2F8S A;  3ZSV A;  1TVR A;  3QNN A;  3SV4 A;  2HHU A;  3KKS A;  5FRM A;  4B9L A;  1HYZ A;  4ELV A;  4N76 A;  4CEZ A;  4B9U A;  4JS4 A;  1W0H A;  2X78 A;  1B9D A;  3DI6 A;  3ASM A;  3OYN A;  4BE0 A;  3PY8 A;  4FLY A;  4RW4 A;  4CEC A;  4O0I A;  3QET A;  1X1P A;  4PUO A;  1U48 A;  4K8X A;  1NKC A;  2Y1I A;  4FZZ A;  1S1W A;  4CIE A;  4CGI A;  3V9X A;  3ZSY A;  3RMA A;  2A1S A;  1B9F A;  3FFI A;  3EZ5 A;  4KAZ A;  4Z4C A;  1IKX A;  2JLE A;  3NF9 A;  3OJU A;  2HNZ A;  4JRP A;  1SKW A;  2X6N A;  4CFC A;  4Y1D A;  3BDP A;  4M45 A;  4DS4 A;  4CJS A;  3AVG A;  3KJV A;  3L3V A;  1L3V A;  1RTI A;  3OYE A;  3KD1 E;  1RT5 A;  1VSF A;  2G8V A;  1JL2 A;  1RCH A;  3AVN A;  4CEF A;  4M3T A;  4GMJ B;  2FBY A;  3M8S A;  5I3U A;  2ATQ A;  2YNG A;  3G10 A;  4KFB A;  1KRP A;  4L8R B;  3MXJ A;  3U3Y A;  2DFF A;  3HP9 A;  4KHW A;  3RTV A;  4CF1 A;  3K5O A;  4H4M A;  1J54 A;  4NCB A;  2BE2 A;  3ZT2 A;  3VQB A;  1ITG A;  3AO1 A;  4FJM A;  1CLQ A;  4KI6 A;  2Q3S A;  1RBR A;  1BIU A;  3IS9 A;  3QO9 A;  1Q8I A;  4IG3 A;  4IG0 A;  1QHT A;  4B08 A;  4PWD A;  3QIO A;  4EP5 A;  4NYN A;  1JLQ A;  2DFE A;  3M8R A;  4IFY A;  3S3N A;  1YTA A;  2D5R A;  4M3Z A;  4DQS A;  1VK0 A;  1XC9 A;  4ZHR A;  3ZT1 A;  2RPI A;  4CER A;  1U04 A;  2YKM A;  4RW6 A;  4BWM A;  4DFM A;  1L3U A;  2G8K A;  4BAC A;  4IBN A;  5HRN A;  1IH7 A;  1WSH A;  2IGI A;  5C24 A;  2IAJ A;  4CE9 A;  3PV8 A;  1O1W A;  2HND A;  4W5Q A;  3A2F A;  4NCG A;  3AO2 A;  3EY1 A;  2BDP A;  4E7L A;  4DTO A;  4PQU A;  3DRR A;  4Z4H A;  3SV3 A;  3CM5 A;  4B9N A;  3CQ8 A;  4B9M A;  4KO0 A;  4I7F A;  3OYB A;  1D8Y A;  1JXB A;  4I9Q A;  4CEE A;  1ZYQ A;  3VQP A;  4DU3 A;  3LDS A;  1RNH A;  1SV5 A;  4FK4 A;  4CJ4 A;  2B5J A;  3OVN A;  2XO7 A;  4DLE A;  3TAB A;  4DSI A;  4QCL A;  1JLB A;  3K5L A;  5J2Q A;  1RDB A;  2HB5 A;  3U6F A;  3CFP A;  1TK5 A;  3B6O A;  3VQ9 A;  1EX4 A;  1VSM A;  3TAF A;  4CF0 A;  3V9S A;  1GOA A;  3MED A;  1HQU A;  4N41 A;  1S9E A;  2G8F A;  3DLB A;  4I2Q A;  3ZT4 A;  1NOY A;  4FJN A;  3P5J A;  4ELT A;  3AO4 A;  4DSE A;  4DMN A;  3PUF A;  4J2E A;  3L2R A;  3PO4 A;  4E7I A;  4BE1 A;  4DTS A;  1TAQ A;  4PA1 A;  2XY7 A;  3U3G A;  1A5V A;  3L2U A;  3ZSW A;  3NDK A;  1Q9X A;  3T1A A;  5CZ1 A;  4DTU A;  1L3S A;  1GOC A;  2KZM A;  4CEA A;  3NH1 A;  4JLH A;  3DOK A;  3HT3 A;  3SI6 A;  1ZBH A;  4GW6 A;  2XHB A;  5SZT A;  2AJQ A;  2D0C A;  2KQ2 A;  2ZE2 A;  4AHU A;  3KLF A;  4FLW A;  4UQG A;  4DF4 A;  1ZBL A;  2G8W A;  4FLU A;  3NAE A;  4CEB A;  2PY5 A;  2RF2 A;  1UOC A;  1KCF A;  5SWM A;  1S1T A;  4N47 A;  4CJ5 A;  3HP6 A;  1SL0 A;  3C6U A;  1ZBU A;  4J2D A;  1BQM A;  4F8R A;  4BWJ A;  3AA2 A;  1EXQ A;  2HVH A;  4Y1C A;  3VQE A;  3AVF A;  2PYL A;  3LP1 A;  1A5X A;  3SUN A;  5CZ2 A;  3C94 A;  4FK0 A;  5HRS A;  4AHS A;  3SJJ A;  3M8Q A;  2Z1J A;  5CYQ A;  2HNY A;  3O4Q A;  3V1O A;  1TK0 A;  3OYJ A;  4FM1 A;  2IS3 A;  1JLA A;  4ICL A;  2OPS A;  3HXM A;  3JYT A;  4FCY A;  1NJY A;  5C42 A;  4KRF A;  1SL2 A;  1VSE A;  2RN2 A;  3MAQ A;  4DFK A;  4EP4 A;  1JLF A;  3O3G A;  1TAU A;  5JS1 A;  3OY9 A;  1JL1 A;  1IKV A;  2HMI A;  3RR8 A;  4E89 A;  1XHX A;  4O44 A;  3WNF A;  1TK8 A;  2R7Y A;  2O4I A;  3WNE A;  3SQ1 A;  5HP1 A;  3RR7 A;  1J53 A;  1VSL A;  3DLH A;  3CM6 A;  1QE1 A;  4KHU A;  1NK4 A;  1Z26 A;  3V9U A;  4M42 A;  3OYK A;  1X9M A;  2P1J A;  2YHA A;  1LWF A;  1NK7 A;  2GV9 A;  2YKN A;  4KTZ A;  3LAM A;  1K6Y A;  4LSL A;  3SUQ A;  1NJZ A;  1NK9 A;  1G15 A;  3DRP A;  3T19 A;  3VQA A;  3KK1 A;  1FXX A;  1B92 A;  2E6M A;  3RMB A;  4E19 A;  4OKE A;  5KI6 A;  3KKR A;  3O3F A;  3LWL A;  2VG6 A;  4FLX A;  4KI4 A;  1FKO A;  1W9H A;  2YHB A;  1RDA A;  3K5N A;  3DRS A;  2GUI A;  2HHX A;  1BI4 A;  4DSK A;  4Z4F A;  3AA4 A;  4F2S A;  4ID1 A;  1JKH A;  3VQ4 A;  4LSN A;  3TR8 A;  4W5N A;  2GBZ A;  4CJR A;  1NK6 A;  2FBV A;  4E1N A;  1TL3 A;  3CG7 A;  3WNH A;  3S3M A;  3L8B A;  3PO5 A;  3MEC A;  4LY7 A;  4CJF A;  4BDZ A;  4M3W A;  1JLC A;  4CIG A;  1U47 A;  3V9Z A;  3I8D A;  5E41 A;  4KRE A;  1RDD A;  4OVL A;  4M3R A;  3L2V A;  1WSJ A;  4HUG A;  2OZM A;  5D3G A;  4CGH A;  4AHC A;  1RT1 A;  3O3H A;  1N6Q A;  2ZQB A;  3VQD A;  4CGG A;  3SYZ A;  2YNH A;  4BDP A;  1HMV A;  1KTQ A;  3VN5 A;  4O5B A;  2KFZ A;  1NKE A;  3LAN A;  4HUF A;  5DK5 A;  3QIN A;  3V1Q A;  3V1R A;  1NK0 A;  3RWU A;  3T3F A;  3VA0 A;  1YVU A;  1RT2 A;  4OPK A;  3OYL A;  2IDO A;  1JLG A;  4IDK A;  4DTP A;  4Z0U A;  3DOL A;  1HRH A;  4R5P A;  1LWE A;  1TKZ A;  4PY5 A;  5J1E A;  4ZTF A;  1IO2 A;  1BIZ A;  1VSI A;  2Z1G A;  4FW1 A;  1SUQ A;  3NGY A;  1HYV A;  3TWH A;  3DLR A;  4ELU A;  4RW7 A;  3QEP A;  3HVT A;  3DLE A;  2P51 A;  4Q5V A;  1S6Q A;  3HPG A;  1C1A A;  4FJL A;  3SZ2 A;  3L2W A;  3RMD A;  1DTT A;  4GVM A;  2HHT A;  2Y1J A;  4RG8 A;  1RT3 A;  4FVM A;  4FJK A;  1S9G A;  1S5J A;  2O4G A;  1I39 A;  1TKT A;  4MFB A;  4E7H A;  1NJW A;  2BGG A;  1KFD A;  4OKJ A;  3G0Z A;  3AVC A;  3SQ2 A;  1VSJ A;  4CJW A;  3THV A;  2OPQ A;  2VG7 A;  4G1Q A;  4H8K A;  5CY4 A;  4CHP A;  4DTX A;  4DSJ A;  4KPY A;  1WSI A;  4FJ9 A;  4TSX A;  3TAG A;  3VQ7 A;  2D0B A;  1IG9 A;  4CCH A;  1D5A A;  4RW9 A;  4CED A;  4B9V A;  3V81 A;  2XRI A;  4FK2 A;  4F3T A;  2HHQ A;  4AHR A;  3MXI A;  3BGR A;  1C0M A;  1VSH A;  4CJP A;  3RMC A;  4KHY A;  4CGF A;  2ETJ A;  5HRO A;  4DF8 A;  3LP3 A;  3SCX A;  1NK5 A;  5J2M A;  4FZX C;  4FJI A;  1VRU A;  3CFO A;  4BE2 A;  3P83 D;  5HBM A;  1IKW A;  1JLE A;  1CXQ A;  3EYZ A;  3MEG A;  1WLJ A;  4CFD A;  5KRT A;  2OPP A;  4DFP A;  1D9D A;  2KTQ A;  4DQR A;  1EET A;  4CES A;  1LV5 A;  4OLA A;  2W42 A;  1NOZ A;  4XIU A;  1BGX T;  1ASV A;  1YTU A;  3SUP A;  4EZ6 A;  3AVJ A;  3ISN C;  3KK3 A;  3QER A;  3S3O A;  3TAP A;  3SPY A;  4FZY A;  3NFA A;  4CK1 A;  3KK2 A;  2XY5 A;  1UWB A;  3KIO A;  4OKK A;  4OGC A;  3DLG A;  2IOC A;  4Q0B A;  3SNN A;  4W5O A;  4FJ5 A;  4FJ8 A;  4FM0 A;  4CJK A;  4J2A A;  3ALY A;  3NCI A;  4E0D A;  4YFU A;  3VQC A;  3DLK A;  4C8M A;  1X9W A;  5I42 A;  3QEV A;  1HYS A;  4M3X A;  1TKX A;  3CYM A;  1EKE A;  3LPT A;  3ZSZ A;  4KKO A;  3PX4 A;  5FDL A;  5C25 A;  4CIF A;  3OYG A;  3PX6 A;  3L3U A;  3LP2 A;  4HVJ A;  2XY6 A;  5KRS A;  1Z25 A;  4M41 A;  4C8L A;  4F2R A;  1ASU A;  3AVM A;  1LW0 A;  4E7J A;  1KSP A;  4B3O A;  4DQQ A;  3TAM A;  3I0R A;  3LZJ A;  3ZCM A;  3TAQ A;  1WNS A;  4CFA A;  4W5R A;  1S1X A;  3IG1 A;  5HLF A;  1KVB A;  3CFR A;  3NE6 A;  3TAE A;  2NUB A;  4OPJ A;  4HHT A;  2VWJ A;  3VA3 A;  1N5Y A;  3L2Q A;  3OYM A;  1EP4 A;  4JRQ A;  4NYF A;  3NGZ A;  3QEI A;  1HNV A;  1UA0 A;  4CHZ A;  3S9H A;  2I5J A;  3QEX A;  4CJ3 A;  4BDY A;  5DMR A;  1NJX A;  1T03 A;  3KLI A;  1WSG A;  3ZSX A;  3IAY A;  3OJS A;  1ZBF A;  2DFH A;  3AA3 A;  4CK2 A;  4K8Z A;  4N5S A;  3AVI A;  1RT7 A;  3AVL A;  4DTJ A;  2QKK A;  4IKF A;  2BAN A;  1C1C A;  3QLH A;  2F96 A;  3VQ8 A;  4DWI A;  2EHG A;  2HHW A;  3D0P A;  3OYH A;  3MEE A;  2G8U A;  4OGE A;  3SUO A;  4HCB A;  4E1M A;  1T05 A;  1BIS A;  1C6V A;  1XWL A;  4MQ3 A;  4DLG A;  2WOM A;  4DTN A;  1XHZ A;  1QSY A;  1TGO A;  3ZSO A;  4CEQ A;  4KTW A;  4CJT A;  3HVR A;  2VWK A;  1RBU A;  3HPO A;  1SKS A;  1DTQ A;  4FW2 A;  1J9A A;  2EX3 A;  4ZTJ A;  2XY8 A;  4QOZ B;  3OYD A;  3M8P A;  1X9S A;  1SL1 A;  3HJF A;  1QQC A;  2P5O A;  4KV8 A;  2A1R A;  1RIL A;  1ASW A;  3AVB A;  1L3T A;  1VSK A;  1T8E A;  1BCO A;  2X6S A;  4LH4 A;  4DQP A;  2KFN A;  3OYI A;  4B9S A;  3ZT0 A;  1LAW A;  4M3U A;  3SQ0 A;  5KGW A;  1LW2 A;  2QXF A;  3ITH A;  5J2N A;  4CJL A;  4DFJ A;  3TAR A;  1TKD A;  1SKR A;  1C1B A;  1LAV A;  3O4N A;  1GOB A;  3C6T A;  3HST B;  3NH2 A;  4YNQ A;  3K57 A;  5FRO A;  1MU2 A;  4CGJ A;  2OZS A;  3ZSQ A;  5JS2 A;  4CF9 A;  3KLG A;  1C0T A;  4OJR A;  1QSS A;  1YT3 A;  4CJQ A;  3NGI A;  4AIL C;  3WNG A;  4OLB A;  3OYA A;  3KD5 E;  1NK8 A;  2G8I A;  4IFV A;  1S1U A;  4B8C A;  3PX0 A;  4C8K A;  3ZSR A;  1VSD A;  2B6A A;  3NH0 A;  1I3A A;  1FK9 A;  4FYD A;  4FJ7 A;  4I2P A;  3LP0 A;  1HJR A;  4FLT A;  1S1V A;  2E4L A;  1ZBI A;  4N56 A;  2YNI A;  1S6P A;  1HNI A;  1XI1 A;  3HPH A;  5T7B A;  3SQ4 A;  2FC0 A;  3D45 A;  4CHY A;  2WON A;  4DU1 A;  1KVC A;  1RT6 A;  3NF7 A;  1CXU A;  1U45 A;  3RRH A;  3LAL A;  1REV A;  4LD0 A;  2KW4 A;  1DLO A;  3JSM A;  3V6D A;  3DMJ A;  3TAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...