3AVBA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avbA00
3LWMA 3O4QA 4IFVA 1D8YA 1UA0A 1C1CA 1IH7A 2RPIA 3P5JA 3CYMA 1C0TA 1NK5A 1RTIA 4NYNA 2Z1IA 3AVFA 3SQ2A 1NKBA 4B9TA 4CIEA 3LP0A 1JLCA 4JLHA 1LAVA 3AVNA 4OJRA 4H4MA 4N56A 1NJWA 1W9HA 3AO1A 3OYJA 3L8BA 2WONA 1NOZA 2Y1IA 3LAMA 3WNEA 3HL8A 3L2VA 1TAUA 3ULDA 4FJLA 2FBVA 4CHZA 1RNHA 2HVHA 4HCCA 3FFIA 4RW6A 3TABA 3ZSRA 4CGIA 3TI0A 1RT5A 3IAYA 2QKBA 2HHTA 4E89A 2DTUA 1XHZA 3HT3A 3HPHA 1WAFA 3MXJA 4NCGA 4CJUA 3KK1A 4KHNA 1UAXA 3NF6A 4C8KA 3LZJA 3T3FA 4CK2A 3SI6A 4KB0A 3LAKA 4DSKA 1RDCA 2ETJA 4B9SA 3K57A 4HUFA 4FK4A 2JLEA 1WSJA 3M8SA 1FXXA 2XO7A 1UA1A 2JGUA 3KLIA 4DTRA 1IKVA 1Z25A 3DLRA 3VQDA 1HJRA 1IG9A 2FC0A 2ZD1A 4Y1DA 5C24A 3OJSA 3O3FA 1Z26A 1D5AA 1B9DA 1EKEA 1FKPA 4AHUA 1CZ9A 3CM5A 3SZ2A 3OYMA 3LPUA 4CF2A 2G8WA 2PY5A 4FJ9A 4CEZA 2XHBA 3QEXA 1QS4A 4DTJA 1KFDA 1EETA 3V81A 4M3TA 3QEIA 3PX0A 5T7BA 3MEGA 3V9SA 3SPZA 1N6QA 1SL1A 4BWJA 2IC3A 4CEDA 4MFBA 4KHWA 3WNHA 4N5SA 1S6QA 3G10A 4FZYA 3M8PA 4CHOA 4DF8A 4CF8A 3DRRA 4L8RB 1S9EA 4AHCA 1BQNA 3G0ZA 1S5JA 5DK5A 4CFCA 5J1EA 1WNSA 2DFEA 4BDPA 4Z4FA 1S1VA 1D9FA 1CXQA 4CFBA 1KVAA 2YHAA 4FJXA 1FK9A 2F8SA 3K59A 4J2EA 1S1TA 1N5YA 4BDZA 2PYJA 4Z4IA 3IG1A 4H8KA 3RRGA 3CFOA 4FW1A 4CJVA 4ZTFA 4IBNA 2HHUA 4IFYA 1HRHA 4CEOA 3TAGA 4C8NA 4OGCA 4DTUA 3AA3A 4OPJA 1RBRA 3HO1A 1LW0A 1B9FA 2X6NA 1HYZA 4CJLA 3THVA 3L2WA 2O4GA 1LV5A 4Z0UA 2G8KA 3V4IA 4CFDA 3QEVA 3TWHA 4DQSA 4F4KA 1GOAA 3AVLA 3HXMA 3HK2A 3RR7A 3KK3A 3OYCA 3SV3A 4B9VA 1L3VA 3DYAA 1RT2A 4AHVA 1WN7A 4CJ4A 1VSEA 4EZ6A 4LD0A 3OYFA 2YNHA 2XY7A 4Q5VA 2IGIA 3RMDA 1BL3A 1QQCA 1NK9A 1NK8A 3L2QA 3WNGA 2IAJA 3IS9A 1CZBA 3LP3A 1WSEA 3K5MA 1BQMA 3LP2A 1XI1A 3NGYA 3K2PA 4O4GA 3KD1E 2P1JA 4CHYA 1HQEA 1XHXA 4K8XA 4KI6A 3ZSQA 3OYEA 4KKOA 2DFFA 3F73A 2D0AA 1RDAA 1SUQA 1Q8IA 2KZZA 1S1XA 2G8IA 2PYLA 3EYZA 1JL2A 1NK6A 2BDPA 1ASWA 4I9QA 4Z4CA 1SL0A 3V9WA 3SV4A 3VQ6A 4CK3A 4KHSA 4B8CA 2YNGA 3QIPA 4CGGA 3O3HA 4FXDA 4CIGA 3OYGA 3ZT4A 3LPTA 4FLWA 4B9UA 2XY6A 2B4JA 3ASMA 2A1SA 4I2PA 4O55A 4CJRA 3TR8A 2G8HA 5HLFA 2HHWA 5CZ1A 2FBTA 1BIUA 2VG7A 3OYAA 4E7LA 4CEEA 3LWLA 2KW4A 1UOCA 3VQBA 3ZT3A 1DLOA 3DRSA 3DLEA 1R0AA 3K5LA 2VWKA 5KTQA 4DFKA 3AVKA 4CJ3A 3SQ4A 3D0PA 4J2BA 1ZBHA 1S9GA 3NHGA 4FVMA 3NCIA 1JLQA 4KAZA 3KLFA 1A5XA 1BGXT 4H4OA 3AO2A 4LH5A 4CJSA 3RMAA 4DQPA 5HRNA 2OZSA 4B9LA 4DSEA 3PO5A 1RDBA 3DLGA 4TSXA 1A5WA 4YNQA 1TKDA 3KD5E 1BI4A 4KB1A 2HVIA 1YTAA 3T19A 3MECA 4AHSA 3NH1A 2KFZA 1RBUA 2HW3A 2RF2A 3CQ8A 1W0HA 4RW8A 2ITGA 4N76A 5FROA 4F3TA 4DLGA 3CFRA 4UQGA 1QSLA 2ZE2A 3DI6A 1L3SA 4NCBA 3MEDA 3RRHA 3B6PA 3ZT0A 1KFSA 4FJHA 3VQQA 4FJKA 1L3UA 4CJTA 3KK2A 4DTOA 2IDOA 4OKEA 1J5OA 3KTQA 3L3UA 2F96A 2HB5A 2HNYA 4DQRA 1ITGA 1KTQA 4GW6A 1HNIA 4IG3A 2BANA 1ZBFA 4AH9A 1TKXA 3VQCA 1FKOA 4XIUA 1NOYA 1S1WA 4KV8A 3HM9A 2OZMA 3AA2A 3KLHA 4DSLA 4GMJB 5KI6A 5SZTA 4DG1A 2R7YA 1JLBA 2QKKA 2E4LA 4FZZA 1I39A 5KGXA 4FJMA 2FBXA 4R5PA 3SUOA 3RMCA 3NH0A 4E1MA 4I7FA 4C8OA 4CGHA 3ZSWA 4CHQA 4BE2A 4QCLA 1YT3A 3NH2A 3KLEA 4JS4A 4CJEA 1T8EA 3BDPA 2E6LA 4FJ5A 4HVJA 3SUQA 1JL1A 5CY4A 3VQ5A 4CJPA 3CG7A 4IDKA 2XRIA 3AO4A 4NYFA 4O0IA 1TVRA 3KLGA 3K5OA 5KRSA 3PX4A 4E19A 1JLEA 3QINA 4B9MA 4ICLA 4KTZA 4JS5A 5FRNA 3DLKA 4BDYA 2OPPA 1EX4A 4CF0A 5D3GA 2P51A 4CJ5A 1HYSA 1HQUA 1LWFA 2YHBA 2XY5A 3M8RA 3S3MA 3C6TA 4CGFA 4LY7A 5HRPA 4FCYA 1RBVA 2B6AA 3O4NA 1C0MA 1TV6A 1TGOA 1VSLA 1RCHA 2YV0X 4KFBA 4J2DA 5J2NA 1RTDA 2PZSA 2VWJA 1JLFA 4DTPA 1YTUA 3AVHA 4Z4HA 4E7KA 3SNNA 4MQ3A 3VN5A 4BE1A 2LSNA 4FYDA 1Q9XA 1JLAA 4M3RA 4AILC 1QHTA 5J2QA 1T7PA 4HUEA 3L2UA 4DU1A 4E3SA 5HP1A 1BI4B 3SQ0A 1X9SA 3TAQA 1NJYA 1JXEA 1T03A 1L5UA 2G8UA 1VSDA 1IO2A 4KO0A 1TAQA 3VQ4A 4DMNA 3LALA 4O0JA 3LANA 4FLZA 2VG5A 4W5RA 4CE9A 3HP6A 1WSGA 4CESA 3NAEA 3AO3A 4CERA 3HPOA 2A1RA 1QSYA 4WE1A 3DMJA 3RTVA 3DLHA 4NCAA 1NKEA 4RW9A 3V9XA 1RILA 3HSTB 1CXUA 3TAMA 4ELVA 1U4BA 3OS2A 5JS2A 1HMVA 3HYFA 1ZBUA 1WSIA 5K14A 1GOBA 4Z4GA 2I5JA 4M41A 4M3UA 1ASUA 5E41A 1NK0A 4FJGA 4CF9A 3KKSA 3AVBA 4EZ9A 1RBSA 4DTXA 4DFPA 1C1BA 3VQEA 4JRQA 4DTSA 3TAPA 4CHPA 4OLAA 3VQAA 1VK0A 5J2PA 4RW4A 3A2FA 4I2QA 4KTQA 3AVIA 1NJZA 2Y1JA 3EZ5A 2W42A 3V1RA 4O44A 3SYZA 1RTHA 4HCBA 4LSNA 4KPYA 4DQIA 4EP5A 2F8TA 4RG8A 1KVBA 2GV9A 2HHQA 2YKMA 4ZHRA 3O3GA 5HRSA 1VSFA 4CJFA 3AVCA 5CYQA 3QETA 3NGIA 2G8VA 1F21A 1VSIA 4M42A 4OLBA 4ELTA 3C94A 4B3OA 3DLBA 1UWBA 3OYIA 4QAGA 3HJFA 4I9LA 2OPRA 4Q0BA 1HPZA 1RDDA 4OKJA 1VSJA 2X6SA 3I0SA 1C1AA 3AVAA 1U48A 2Z1GA 4E7HA 4AHRA 4CJWA 4CFAA 1ZBIA 3WNFA 1QTMA 3IRXA 3C95A 4CEAA 1LAWA 3RR8A 4FJJA 1HNVA 2D5RA 3AVJA 1WLJA 1ZYQA 3F9KA 4KHQA 4KHYA 4DU4A 1B92A 3OJUA 3MXIA 4CF1A 1LWEA 4FM0A 4IG0A 1DTQA 3U6FA 3NGZA 3MXMA 4KHUA 1SKRA 4E7IA 2D0BA 4CGDA 4CEBA 3EY1A 3OY9A 4OGEA 3OYBA 1CLQA 1KVCA 4PA1A 3LZIA 4M3YA 1J53A 2RKIA 3K58A 2YNIA 4DFMA 1U49A 1KRPA 4W5NA 1NJXA 3QNOA 3S9HA 3CM6A 5HRRA 2VG6A 1K6YA 1TL3A 2EX3A 3V9ZA 1X9MA 3V6DA 5I42A 4ELUA 2ZQBA 4CGJA 1TK8A 1S6PA 4M3ZA 3DOLA 5C42A 3QEWA 2G8FA 4AHTA 1L3TA 3HVRA 3KIOA 3SUNA 4FJ7A 3OYKA 4DFJA 3AO5A 1KLMA 4CK1A 4KREA 2ATQA 5J2MA 1RT1A 1BCOA 1EXQA 5FRMA 1ASVA 1X1PA 2HHVA 3OVNA 3AA5X 5C25A 3ZSXA 3TAFA 1T05A 4J2AA 1DTTA 3DOKA 2B5JA 4FLVA 4M3XA 1REVA 3RMBA 2O4IA 3ZSOA 3UIQA 3B6OA 4BWMA 4QOZB 2QXFA 1TKZA 2WOMA 3OS0A 2OPQA 3JSMA 1LWCA 3U3YA 4M45A 4CJKA 1IKYA 4DS5A 1BIZA 3U3GA 4RW7A 1TKTA 2X74A 3BGRA 1S1UA 3ZT1A 4FZXC 3VQ7A 1JKHA 2GUIA 1QE1A 5HROA 4CJQA 2BE2A 3D45A 1SKSA 3L2RA 3SPYA 3VQ9A 1RTJA 4CHNA 4KTWA 4FJNA 1SL2A 3TANA 1QSSA 2IOCA 1RT6A 3SJJA 2XY8A 3NF9A 4FM1A 4KI4A 4FLYA 3OYNA 1EP4A 4FK0A 4PUOA 3SUPA 2KZMA 4KRFA 3VA0A 3SCXA 1NK4A 4LH4A 4BE0A 4O5BA 1VRTA 4OVLA 3ZCMA 5JS1A 4DTNA 4M3WA 3NF8A 2HNDA 5EU7A 4CEQA 4FK2A 2HHSA 1RT3A 1WSFA 1X9WA 3NF7A 1C6VA 4G1QA 3OYDA 4DQQA 3QERA 3HPGA 3OYHA 2OA8A 2KFNA 2RN2A 2YNFA 3TARA 2YKNA 1KSPA 4LSLA 4N41A 2OPSA 4C8MA 1O1WA 4DWIA 3DM2A 2Q3SA 1U45A 2AJQA 3S3OA 4BACA 2E6MA 4ZTJA 3OS1A 4FW2A 1ZBLA 2HMIA 3P1GA 3HVTA 3CFPA 4DTMA 3S3NA 4B9NA 4FJ8A 4FLTA 3QIOA 5SWMA 3QNNA 3NDKA 2DFHA 1XC9A 3ISNC 5CYMA 2EHGA 4OPKA 4YFUA 1KLNA 4DSJA 1VSKA 2KTQA 4DSIA 1YVUA 1VSMA 2NUBA 3VQ8A 3QO9A 1VSHA 2KQ2A 4HUGA 4CIFA 4PY5A 5DMRA 1GOCA 3LP1A 3NBPA 3VQPA 3NFAA 3C6UA 4CCHA 2IS3A 4E0DA 2QK9A 2DY4A 3PX6A 3QEPA 4Y1CA 1HYVA 3K5NA 3PO4A 4EP4A 1WSHA 1LW2A 4F2SA 1G15A 3HP9A 1BCMA 2P5GA 3NE6A 4DSFA 4IKFA 4FLXA 3ITHA 3PY8A 3VA3A 1JXBA 2HNZA 3ZSZA 1TL1A 1TK5A 1C0UA 3ZT2A 1XWLA 1BISA 1U47A 4E1NA 1TK0A 4N47A 1KCFA 3PUFA 3KKRA 4DU3A 2Z1JA 2D0CA 1D9DA 4W5OA 1U04A 2HHXA 4F3OA 3AVGA 4FJIA 4JRPA 5KGWA 3AA4A 3KJVA 2P5OA 3E01A 1RT7A 3QESA 3QLHA 1Q9YA 2FBYA 4GVMA 1NKCA 4FLUA 3AVMA 3DRPA 4FM2A 2OYQA 5HBMA 4CECA 3V1OA 1Y97A 5KRTA 1NK7A 3ZSYA 1WAJA 3AV9A 4Z4EA 2GBZA 4CEFA 4DF4A 3P83D 5CZ2A 3L3VA 3PV8A 4PQUA 3ALYA 3V1QA 1SKWA 3MAQA 3V9UA 3SQ1A 4PWDA 3M8QA 5I3UA 1RBTA 1VRUA 1RT4A 4ID5A 4W5QA 1MU2A 3TAEA 1IKWA 3LDSA 4F8RA 1I3AA 3MEEA 3JYTA 4K8ZA 4C8LA 4HTUA 3I0RA 4DLEA 1J54A 3I8DA 4OKKA 2Z1HA 1JLGA 4B8AB 1A5VA 2X78A 3H08A 4W5TA 1J9AA 2BGGA 4E7JA 1BHLA 3T1AA 4B08A 4HHTA 3RWUA 4DS4A 1IKXA 3OYLA 3ZSVA 4F2RA 4ID1A 1SV5A 5FDLA
chains in the Genus database with same CATH superfamily
4QS8A 1NKBA 3WQUA 1NNEA 3LP0A 3OBWA 4M7YA 1JLCA 4EHTA 1VQ8N 4OJRA 3OYJA 2WONA 1NOZA 2E88A 1TAUA 3ULDA 1RNHA 3S41A 4HCCA 3ZSRA 1RT5A 1XHZA 1WAFA 2YHXA 3I8BA 3MXJA 4KB0A 3JAMO 3LAKA 4DSKA 4HUFA 4LF4K 1YVNA 1WSJA 2XO7A 5E26A 3C0BA 1HJRA 2FC0A 5HOOA 1Z26A 3K0SA 1D5AA 3VEWA 4AHUA 3ZLJA 3OYMA 3LPUA 4MLEA 4CF2A 1QVGM 4FJ9A 5ELZA 1QS4A 1VAZA 4M7XA 3QEIA 1EWQA 3PX0A 5T7BA 1N6QA 2CH5A 3D6RA 4MFBA 2NLXA 3IFRA 4FZYA 4DF8A 1HX1A 1NGGA 4L8RB 1S9EA 2QWPA 4CFCA 1WNSA 1YITN 4FJXA 4J2EA 2OANA 1N5YA 4BDZA 3CMEN 3CJ1A 3IG1A 1RGIA 4DV5K 4DTUA 1LW0A 2Q36A 3VGKA 2QXLA 2UYTA 1Z05A 4CFDA 3T1HK 3TWHA 4FPBA 4DQSA 4F4KA 3HK2A 3HXMA 3OYCA 5DM7L 1VQKN 3THXB 1RT2A 3GDQA 3FGUA 4CJ4A 4EAHD 4EZ6A 4JI5K 5A2QO 3C7NA 3U4LA 2QWOA 2EWSA 2YNHA 4A5BA 4EFHA 1QQCA 3J7YP 1NK8A 3LP3A 1YJ9N 1XI1A 1BQMA 3HOTA 4O4GA 3KD1E 2P9KB 1N33K 3F73A 4IZ9A 3A5NC 1S1XA 3CC2N 2PYLA 3TSQA 3SV4A 4BR5A 5AZJA 4FXDA 3QFUA 2XY6A 4J8FA 3ASMA 4B3TK 2WFBA 2HHWA 2FBTA 3VEVA 4FWKA 1UOCA 1OVYA 3ZT3A 4FOIA 3UKUB 5KTQA 3AVKA 3MMVA 4BRIA 3SQ4A 3NHGA 3NCIA 1W2BM 4KAZA 4JI3K 1BGXT 4JI7K 3DXKB 4B9LA 1RDBA 2QM1A 3DLGA 1TKDA 3T19A 2HW3A 2RF2A 2ITGA 4F3TA 1N34K 1S22A 2ZE2A 4MO4A 4FVUA 1I94K 3DI6A 4NCBA 2CGKA 3SLCA 2E2QA 4CBWA 4FO0A 4PHTX 4BQLA 4AM6A 4V19S 2HB5A 4G9ZA 1HNIA 2Q0UA 2GUPA 4AH9A 3VQCA 1FKOA 1NOYA 3HM9A 3WXJA 3GOIA 2P9IB 3WUHA 4JKEA 5KGXA 3RMCA 4JI2K 3QBXA 3ZSWA 4CGHA 4BE2A 1YT3A 4YOXA 3HI0A 4CJEA 3BDPA 2E6LA 4CJPA 5CY4A 3OJUA 1TVRA 3PX4A 3K5OA 1JLEA 4QS7A 4B9MA 3SBGA 4PKHA 4WQ4C 4JS5A 4ISFA 4WQ4A 1U6ZA 4NLBA 2OPPA 4CF0A 5D3GA 2P51A 1NG9A 3M8RA 4BR2A 3CD6N 3L4QA 4FCYA 4LY7A 2B6AA 1C0MA 3VEXA 1VSLA 1RCHA 4KFBA 4DTPA 4K0KK 3PIOL 1XNQK 3SNNA 3FZFA 5AQZA 1Z6RA 1ZXOA 1QHTA 4HUEA 5HP1A 1BI4B 4CVNE 4JKDA 1T03A 3T69A 3MDQA 1TAQA 3FR0A 3VQ4A 4O0JA 1ATNA 1WSGA 4CERA 1NU0A 1QSYA 3DMJA 4JKHA 3JXUA 1WSIA 4M41A 4EZ9A 4DTXA 4DTSA 4CHPA 1RFQA 3PSIA 3VQAA 1QQNA 3CCLN 4RW4A 4KTQA 4FSVA 1RTHA 1YI2N 4RG8A 3O3GA 3P31A 5HRSA 2DPNA 2G8VA 4OLBA 2YJEA 4ELTA 4DR2K 3MX5A 4B3OA 4IJAA 1UWBA 3DLBA 3F2KA 4QAGA 3HJFA 4OO1J 4LF9K 3DLLL 4Q0BA 1RDDA 3AVAA 1U48A 4I6MB 3QBWA 3VF2A 1WUAA 1QTMA 4CEAA 4DR5K 1WLJA 4KHQA 2JWKA 4KHYA 4CF1A 4FM0A 4KHUA 3EY1A 4PL7A 3LM9A 1KVCA 2YNIA 4BVPA 1T44A 3KHYA 3S9HA 5HRRA 2O8EB 3V9ZA 4CGJA 2W40A 3CCMN 4M3ZA 3SMPA 2FF3B 1OKJA 2G8FA 4ILHA 4B1VA 1L3TA 3P39A 5C15A 1XNRK 3HVRA 1GLAG 3KIOA 1K9MO 4FJ7A 3OBYA 1K73O 1KLMA 3IMXA 3VPZA 5J2MA 1RT1A 3ID6A 2HHVA 3AA5X 4ISGA 2E5LK 2B5JA 4FLVA 3LM2A 3UIQA 3FZMA 3U3YA 4HTLA 3ZT1A 2X74A 1MWMA 3VQ7A 3O8MA 3VGMA 3B8AX 3VQ9A 1NGIA 1HNZK 1K8KB 4KTWA 4FJNA 1QSSA 2HOEA 4JD2A 1J6ZA 4DV1K 2D4WA 4A57A 4LH4A 3ZCMA 1VRTA 3TPQA 4L3QA 3J8AA 1SZ2A 3SAHA 1RT3A 1WSFA 1X9WA 4X64K 3KZBA 5LY3A 4CBUA 2RN2A 4BR7A 4YOUA 4JKFA 4BRDA 1MA9B 4LSLA 1U45A 1Q7YO 4ZTJA 4CZEA 3OS1A 2HMIA 5ADXH 3ZX0A 4B9NA 3QNNA 4M63C 1S72N 3NDKA 5GAEP 5CYMA 4YFUA 3M1FA 2VWBA 1KLNA 1KXPA 1X3NA 4DSJA 3MN5A 4CD1A 1YVUA 3BEXA 4O8KA 1GLFO 1QQMA 2NUBA 1P8ZA 4CIFA 1GOCA 2PFUA 3BY5A 4CCHA 4E0DA 2ASMA 5KPZA 3PO4A 1LW2A 5AQPA 4GV3A 1RDUA 3GBTA 4FLXA 1JXBA 3UB5A 2E8AA 1BISA 3R1XA 1TK0A 2Q97A 2D0CA 4W5OA 3AVGA 2P9PA 3ULEA 4JRPA 1NGEA 3E01A 1Q9YA 4JKGA 3QLHA 3QESA 4X66K 1NKCA 3AVMA 3DRPA 3E9PA 1U2VB 4FWLA 4K25A 2QTDA 3MX2A 4CECA 4CW7B 5KRTA 4EIAA 1WAJA 3V1QA 1SKWA 3MAQA 4BRCA 4CZFA 1MU2A 1IKWA 2J4RA 3SJHA 2ZGYA 1FJGK 3MEEA 3WQTA 4HTUA 4FWSA 4DLEA 4H5WA 1A5VA 2X78A 3SK3A 4B08A 5ADXA 4ID1A 4BG9A 5FDLA 1DEJA 3EE9A 5AQYA 1UA0A 1IH7A 3BZCA 3P5JA 5EXWA 4JV5K 4NYNA 5BRDA 1W9HA 3AO1A 4BVOA 1ATRA 3LAMA 3VF6A 5BPLA 4FJLA 2HVHA 1TUUA 4JNEA 3HT3A 1BDGA 3N4PA 3T3FA 3D2EA 4FK4A 3K57A 1UA1A 1OH8A 3BZKA 1IKVA 3VQDA 3MN7A 1IG9A 3OJSA 3O3FA 4FOEA 4IDHA 1B9DA 1EKEA 3D2FA 1CZ9A 3CM5A 3RVCA 2PY5A 2GWKA 4CEZA 2XHBA 5GAHP 3TSUA 3V81A 2NZTA 3V9SA 3SPZA 4CEDA 5FPNA 4MDAA 3G10A 2F7TA 3M8PA 4BRHA 3VETA 4FWRA 2FSNA 4AHCA 1C0FA 5AQWA 2P9SB 5J1EA 4LFCK 5DK5A 4B3MK 4BDPA 4Z4FA 1S1VA 3NMUA 4MDBA 3K59A 3CCEN 4DR1K 5CE3A 2A42A 4H8KA 3RRGA 3VEZA 3DXMB 3CFOA 4ZTFA 4IBNA 1HRHA 4OGCA 3A0IX 5AQOA 4DR3K 1RBRA 1HYZA 4IOXA 3THVA 4NXMK 2V52B 3O5BA 2P9NB 1NWKA 5AQLA 1YAGA 3V4IA 4IXCA 1GOAA 3RR7A 2O8DB 3VEOA 4BRMA 1WBDA 1VSEA 4LF5K 4NXNK 4FWQA 5TKWA 1TUYA 2A5XA 3IS9A 3K5MA 3FE1A 5AQKA 2P1JA 2HBJA 4CHYA 1XHXA 4K8XA 4K41A 4KKOA 1Q18A 2D0AA 1SUQA 3I56N 4CZHA 3EYZA 1NK6A 2BDPA 1ASWA 4I9QA 4CK3A 3OA9A 1JCGA 5AQFA 4CGGA 4KH5A 3QB0A 2KKZA 2NRHA 2A1SA 4I2PA 1ZC6A 5DM6L 5HLFA 4B9QA 1BIUA 2VG7A 3ZX3A 4JKCA 3LWLA 1HPMA 3DRSA 4X62K 1R0AA 3K5LA 3CPEA 5GAGP 4DFKA 2GEMA 3SBTA 3ZEUA 3O9UA 4YHHK 1EQYA 3THWA 2E20A 4H0PA 3SMSA 5KQDA 3EE8A 4YNQA 1A5WA 3KD5E 3NH1A 1RBUA 4N76A 1W0HA 4RW8A 3EEQA 4DLGA 3CFRA 2IIRA 1VHXA 2WTUA 1L3SA 3RRHA 3B6PA 3ZT0A 1KFSA 4FJKA 3VQQA 2GELA 3KK2A 4DTOA 3BP8A 5C2DA 2NRTA 3H45C 3HSCA 3L3UA 2BH1A 1ITGA 1KTQA 4IG3A 2BANA 3HRGA 5I9EB 2OZMA 4DSLA 3A5MC 3QICA 1EWRA 4GMJB 3M5RA 4DG1A 5SZTA 3BUZB 2FBXA 3SUOA 4FWPA 3NH0A 2O8CA 4E1MA 5CHIA 4CHQA 4JS4A 1T8EA 3VQ5A 3CG7A 3KLGA 3AO4A 5KRSA 4CZJA 3THYA 4E19A 1MWKA 2O8BA 4FWMA 4F9OA 5BN9A 3G4SN 2IVOA 3S3MA 4CGFA 1RBVA 3HOSA 4DV2K 5J2NA 1RTDA 2PZSA 1YTUA 3AVHA 4Z4HA 5LJVA 3FZHA 4MQ3A 5M1QA 3VN5A 2LSNA 4FYDA 4YOVA 3WXKA 4E3SA 2YHWA 3Q7CA 1NJYA 2G8UA 1VSDA 4KO0A 2F9WA 1VQPN 2UU9K 2VG5A 4H5TA 4H5VA 1VQ9N 3AO3A 3HPOA 3AGRA 3MWPA 3RTVA 3AGKA 1RILA 4A61A 4ELVA 1U4BA 4BRPA 2UUAK 3HYFA 1D4XA 4Z4GA 1BG3A 2I5JA 4M3UA 2P9UB 4OLAA 1RDWX 5J2PA 2I7NA 3MWTA 1Q86O 2A41A 3U9ZA 3AVIA 4BC4A 3V1RA 4YDUC 4YDUA 4O44A 3SYZA 4LSNA 4KPYA 1IBKK 4DQIA 3CPWM 2F8TA 2GV9A 2YKMA 3ZETB 3CC7N 3QETA 3CHWA 1VSIA 4M42A 1NGHA 3OYIA 2KHOA 3H3NO 4KH6A 4H03B 1VSJA 2X6SA 3HM8A 5C2FA 1C1AA 2NRRA 4JK7A 4E7HA 4AHRA 4CFAA 4BROA 3WNFA 2YJFA 4JI8K 1HNVA 3AVJA 4QS9A 1WBBA 1HKGA 2KLAA 3MXIA 1LWEA 5GIPA 4BR9A 4IG0A 3MCPA 3U6FA 4E7IA 4JI0K 4CGDA 3OTOK 4CEBA 3C65A 4OGEA 4U67L 4PA1A 3UE5A 1J53A 1U49A 5JLHA 2A3ZA 1NJXA 1HLUA 2CGLA 3CM6A 2GX9A 3UKRA 3V6DA 5I42A 2WBNA 4XH4A 4AHTA 4CBXA 5JLFA 5AQRA 4JAXA 1VQ7N 1VQLN 4KREA 5C25A 3ZSXA 1T05A 2HHHK 1REVA 3B6OA 1SQKA 1DT9A 2QXFA 1TKZA 5BPMA 2WOMA 2OPQA 3JSMA 4CJKA 3U3GA 4RW7A 1TKTA 2P9LB 4LC9B 2VGNA 1JKHA 2GUIA 1QE1A 1NM1A 3Q7BA 4CJQA 5FPEA 3D45A 4FPAA 3L2RA 3CCUN 3SPYA 4B1ZA 3SJJA 2XY8A 3NF9A 4KI4A 4RCHA 1EP4A 2QA4N 4FK0A 4PUOA 2OTJN 3CJ7A 1NK4A 5BREA 4DTNA 3NF8A 4BREA 1JCFA 3RSEA 3CJAA 3QERA 5AQIA 4B1WB 2YKNA 4H5RA 1KSPA 2OPSA 1O1WA 4DWIA 3S3OA 2QW9A 3N4QA 4KH4A 3S3NA 4H5NA 5JICA 3QIOA 3QDKA 4NB4A 3DWLA 1XC9A 3ISNC 2EHGA 3PIPL 2KTQA 4WYBA 4BC5A 1P90A 1VSMA 1O13A 1BOTO 3CMAN 4PY5A 5KPRA 3VQPA 2DY4A 2QK9A 2CGJA 3PX6A 3K5NA 4DUYK 4EP4A 2E2OA 3VENA 1BCMA 3ZSZA 1TL1A 4JI1K 1OH7A 4N47A 4Z94A 3PUFA 3KKRA 4DU3A 1D9DA 1U04A 3D7EO 4NLCA 5KGWA 3AA4A 4CZGA 2P5OA 3I55N 5HBMA 4WCEL 3ZX2A 1Y97A 3D2FB 1NK7A 3ZSYA 4Z4EA 4JHDA 4PQUA 4PWDA 4CZIA 3J81O 1RBTA 4NO7A 4PL8A 3LDSA 4F8RA 1MDUB 4IOAL 4K8ZA 1IJJA 5BPNA 5F0XA 3I8DA 4OKKA 1JCEA 4DCHA 4GY2B 3P38A 3H08A 4OPHA 5AQJA 4E7JA 1BHLA 3T1AA 4GV9A 3ZSVA 4F2RA 4CJVA 1SV5A 3OYDA 3LWMA 3MK6A 4IFVA 1D8YA 2BUPA 2YX6A 2RPIA 1RTIA 4B9TA 3AVNA 4H4MA 1Y64A 4JI4K 3L8BA 4B3RK 2Y1IA 3HL8A 3L2VA 4DV3K 1XUPO 2ASPA 3VOVA 1GLCG 2VGMA 3TABA 4RW6A 5LMUK 3TI0A 1KQSM 1XQSC 2HHTA 1YJWN 2DTUA 2FSKA 3KK1A 2ZM6K 3EZWA 4KHNA 2QWNA 3THXA 4CK2A 3I33A 4C1NK 1RDCA 2ETJA 4B9SA 3O1BA 4B1UB 2JLEA 3M8SA 1FXXA 2AA4A 2JGUA 3O4WA 4MO5A 5F1XA 2ZD1A 4Y1DA 5C24A 3R6MA 2P9KA 3SZ2A 3O9SA 3VTHA 4H0YB 2W6KA 5EOYA 4DTJA 1EETA 4XEIA 2GTDA 3MEGA 5AZIB 3CF5L 2IC3A 3WEEB 3E9LA 3CCQN 4CHOA 2O8FB 2OCEA 4H0XB 4IWVA 4CF8A 2HBLA 3DRRA 4A2AA 1BQNA 2DFEA 3UKUA 2QEXN 3TSPA 1D9FA 4CFBA 2ZJQL 2V7YA 5M1NA 5JMVA 2PYJA 3DXKA 4YOWA 4O5FA 4FW1A 4IFYA 4CEOA 3TAGA 2ZWHA 3E9OA 4JKAA 2WC9A 4OPJA 1KAYA 1QZ6A 3L2WA 1VQ4N 3QEVA 3CJ9A 5JVHL 1IBLK 4LF8K 4JKBA 3TTDA 3DYAA 4AHVA 1WN7A 4Q5VA 2IGIA 3RMDA 1BL3A 1NK9A 4BR0A 1OH5A 4BY9C 4AQYK 4FL9A 3HBTA 4W5NA 3NVKA 1YF5L 3NGYA 2HF4A 1QQOA 1HQEA 4KI6A 5B8HA 4UY8O 1JL2A 4X65K 3V9WA 3OHRA 3VQ6A 1YIJN 2A40A 3THYB 2YNGA 2I7PA 4CIGA 4B1YB 4JK8A 1VQON 4B9UA 4O55A 4CJRA 5CZ1A 4BR4A 3OYAA 4KBOA 4CEEA 3VQBA 1M1KO 1DLOA 3DLEA 3KWGA 1BO5O 1ZBHA 3D0PA 4J2BA 1S9GA 4HWIA 3KLFA 3AO2A 2HBKA 4DQPA 5HRNA 3FFKB 3PO5A 4DV4K 2NRZA 4TSXA 1IG8A 1BI4A 3KK7A 4MLHA 1YTAA 3DJCA 3MECA 4AHSA 4BQZA 3SAFA 3CXCM 4KB1A 3CQ8A 1SS6A 3E66A 1QSLA 2WUSA 3MEDA 4ILJA 4FJHA 1GLDG 1L3UA 4CJTA 2RHKA 1V4SA 1OVQA 5EX5A 4GKJK 1J5OA 5AJ3K 3G71N 1HNXK 3KTQA 2F96A 3ID8A 1HKBA 2HNYA 4DQRA 4GW6A 2ZJPL 1ZBFA 2BTFA 4IEIA 1FW6A 1TKXA 3C7NB 5E84A 1S1WA 4KV8A 3EKUA 3QMLA 2R7YA 1JLBA 5GIOA 2E4LA 2QKKA 1I39A 5C10A 3H1QA 1G99A 2E1ZA 3NH2A 3ATUA 4HVJA 5M1OA 5AZJB 2Q0RA 3QINA 4ICLA 4YOTA 5FRNA 3M3ZA 1J5EK 4IO8A 3DLKA 4BDYA 4BC3A 4RTFD 1HYSA 1HQUA 1LWFA 4IOCL 5CR4A 5HRPA 1VQNN 1TV6A 2YV0X 1TGOA 5LL6Z 4I6MA 4J2DA 5H1SQ 1JLFA 2VWJA 1HJOA 4E7KA 3CCVN 5AQUA 5LJWA 2HSTA 2QWMA 3IDHA 4AILC 5J2QA 3L2UA 4GNIA 1WB9A 3SQ0A 1X9SA 3AAQA 1HKCA 3TAQA 4CZKA 2UXDK 1JXEA 1L5UA 1YXQA 1DKGD 4DMNA 3LALA 4FLZA 4WQ5C 4W5RA 4WQ5A 3HP6A 2ASOA 3NAEA 2Q2RA 1H1VA 2O8EA 3DLHA 2FLOA 2D0OA 1NKEA 3V9XA 1CXUA 4H0OA 1ZBUA 2YI1A 1GOBA 1XMOK 3CQYA 5E41A 4BRAA 4CF9A 3M6GA 3CC4N 3VTIA 3VQEA 3TAPA 2AP1A 2Y1JA 4DHYA 3EZ5A 2PBDA 1W97L 4EP5A 1HR0K 1NGDA 1VSFA 4CJFA 3AVCA 1TYQA 1LOTB 3C94A 2ZGZA 2V7ZA 1BA0A 1K8KA 3VESA 3J7ZO 4OKJA 5F2RA 3I0SA 2Z1GA 5FLXO 4CD3A 4CJWA 3IRXA 1LAWA 3F9MA 1ZYQA 3F9KA 5BRFA 1NGJA 3VERA 3MXMA 3CJCA 4WF9L 1QHAA 2D0BA 4GV6A 3OY9A 1GLLO 1CLQA 3LZIA 4M3YA 2RKIA 5HL7L 4DFMA 1ILYA 2E2NA 3QNOA 2VG6A 1K6YA 1TL3A 3G25A 4FWNA 2ZQBA 1S6PA 4JYAK 3DOLA 4K43A 5C42A 4EHUA 4KHPK 4JI6K 3TTFA 3KVGA 3SUNA 4LFBK 2VQFK 1ATSA 1BCOA 4DR7K 4A62A 1X1PA 3ENBA 3OVNA 5BR9A 4AM7A 3QFPA 4J2AA 1DTTA 3ENOA 3DOKA 4M3XA 3RMBA 4BWMA 4QOZB 3CJBA 3OS0A 3R9PA 4YY3K 4M45A 1IKYA 5GADP 5HROA 1SKSA 2BE2A 4WFNL 2RE2A 4CHNA 4RWTA 1R59O 1SL2A 1U2VA 4CZMA 4FM1A 4FLYA 3OYNA 1IBMK 1X3MA 2HMPA 3EO3A 4KRFA 3H46O 5C12A 3LDPA 3VA0A 4JHDB 4BE0A 5JS1A 3EN9A 4M3WA 4Y0WA 5EU7A 4FK2A 3NVMA 1GLEG 2HHSA 3O9QA 4OPAA 1IV0A 3NF7A 1C6VA 3GE1A 4G1QA 2OA8A 3EL2A 2YNFA 2UUBK 4N41A 4C8MA 1BA1A 4FW2A 1ZBLA 3P1GA 5AQSA 2VQEK 2DFHA 5AQVA 4OPKA 4DV6K 4LF7K 3QO9A 1VSHA 2KQ2A 4HUGA 2E1YA 5DMRA 3LP1A 3IKMA 3C6UA 3NFAA 2IS3A 3KWIA 4Y1CA 1HYVA 2QI2A 1WSHA 3CIPA 1G15A 3HP9A 2P5GA 4IKFA 3ITHA 3VA3A 2HNZA 1TK5A 1C0UA 2Q31A 3ZT2A 4E1NA 1KCFA 1M90O 2HHXA 3CI5A 4FJIA 3TU5A 3AARA 4U7BA 2FBYA 4GVMA 3T7ZA 4FLUA 4FM2A 2OYQA 4JD2B 4IO9L 3V1OA 2HBMA 5AQGA 4XH1A 3O80A 3AV9A 5JVGL 5CZ2A 3L3VA 3CCJN 2H3GX 5KPTA 4DR6K 5IT9O 4BGBA 1JJ2M 3VF4A 1VRUA 1RT4A 1I3AA 1N36K 1YJNN 4C8LA 3H6EA 3I0RA 1J54A 4BRNA 2Z1HA 4XH5A 1JLGA 4B8AB 4IFEA 1ESVA 4W5TA 4HHTA 4FWOA 2P9SA 1VQ5N 3O4QA 1C1CA 3CYMA 1C0TA 1NK5A 3LDLA 3DXMA 2Z1IA 3AVFA 3SQ2A 4CIEA 4JLHA 1LAVA 3AY9A 4N56A 3SAGA 1NJWA 2E2PA 3A5OC 5TKYA 4B1XB 1QVFM 3L4IA 3R3LA 3WNEA 3O1WA 3LDNA 3O9RA 2P9NA 2FBVA 4CHZA 3CCRN 3FFIA 1X9JA 3IAYA 2QKBA 4CGIA 4E89A 4DV0K 1HNWK 3HPHA 2O8DA 4NCGA 4CJUA 4CZLA 1UAXA 3NF6A 4C8KA 3LZJA 2ZJRL 3SI6A 2P9PB 3ULEB 1N32K 3CETA 3KLIA 4DTRA 1S3XA 1Z25A 3DLRA 4JKGB 3OW2M 3J7AP 1FKPA 1YHQN 2D1KA 3ZYYX 1KC8O 2G8WA 3QEXA 1KFDA 1NGBA 3LL3A 4M3TA 2UUCK 3MN9A 5BR8K 1SL1A 4BWJA 2PAVA 4KHWA 3WNHA 3WXMB 4N5SA 1S6QA 4A5AA 1NLVA 2JWLA 3JS6A 3PLAA 3G0ZA 1S5JA 3BF1A 4DQ8A 3MCAB 1CXQA 1KVAA 2YHAA 1FK9A 2YCHA 2F8SA 1S1TA 4Z4IA 2HHUA 4C8NA 2NRVA 3AA3A 1VQ6N 4C23A 3HO1A 1B9FA 2X6NA 4CJLA 1Q81O 2O4GA 5AQMA 1LV5A 4Z0UA 2G8KA 5AQHA 1GLBG 2W41A 3ATVA 1DGKN 3AVLA 2FXUA 4O8UA 3KK3A 3SV3A 4B9VA 1L3VA 3D2EB 4LD0A 4BC2A 3OYFA 2XY7A 1XMQK 4H0TB 3L2QA 3L6QA 3WNGA 2IAJA 1CZBA 1WSEA 3LP2A 5AQQA 3K2PA 3ZSQA 3OYEA 2DFFA 3P4IA 1RDAA 3FZLA 1Q8IA 2KZZA 2G8IA 3VGLA 4Z4CA 1SL0A 1OH6A 2ZF5O 4DR4K 4KHSA 4DKWA 4B8CA 3QIPA 4JK9A 3O3HA 3OYGA 3ZT4A 1K8AO 3LPTA 4FLWA 4JEPA 3CERA 2B4JA 3TR8A 2G8HA 1EO1A 4E7LA 2IVNA 2KW4A 2YHYA 3LDQA 2VWKA 3MN6A 4JN4A 4CJ3A 3C6HA 3HTVA 3WT0A 4FVMA 5EY4A 1JLQA 1A5XA 4H4OA 4LH5A 4BGAA 3W0LA 4CJSA 3RMAA 1KD1O 2OZSA 4DSEA 2HVIA 5M1PA 2KFZA 5GINA 5FROA 4UQGA 3H1VX 2IDOA 4OKEA 3G6EN 4DB3A 1ZBSA 3HZ6A 4BRKA 4XIUA 2P9UA 3AA2A 3KLHA 2Q1NA 4ISEA 5KI6A 3E1YA 1E4FT 4FZZA 2HF3A 4FJMA 4R5PA 2NRWA 4C8OA 4I7FA 4QCLA 3KLEA 2FF6A 4FJ5A 3SUQA 1JL1A 4O0IA 3QEPA 4IDKA 2XRIA 4NYFA 4YOYA 3ZETA 5LMNK 1YUWA 1TYQB 4KTZA 1EX4A 3GG4A 4CJ5A 2YHBA 2XY5A 3C6TA 3O4NA 3ZEUB 4BE1A 5AFUH 3U9DA 1Q9XA 1NJIO 1JLAA 3THWB 4M3RA 4LF6K 4H0VB 5FPMA 1T7PA 1NMDA 4DU1A 4PKGA 1E4GT 1C0GA 5IWAK 1IO2A 2D0PA 1WOQA 3LANA 4CE9A 1HUXA 4CESA 5FPDA 2A1RA 4WE1A 1V4TA 4A2BA 4NCAA 3FLCO 4RW9A 3HSTB 3TAMA 3OS2A 5JS2A 1HMVA 5K14A 1Q82O 2UXBK 3F5TA 1ASUA 1NK0A 4FJGA 3KKSA 3AVBA 3W3DA 1RBSA 2P9IA 4DFPA 1C1BA 4JRQA 4PKIA 1VK0A 4GVEA 3A2FA 4I2QA 3LDOA 1NJZA 2O8CB 1GLJO 2W42A 1BUPA 4ILGB 4HCBA 3DAWA 2HHQA 1KVBA 4ZHRA 2O8BB 5CYQA 2P9LA 3NGIA 1F21A 1NBWA 3T1YK 4I9LA 2OPRA 1KAZA 1HPZA 3FZKA 4E1JA 4CJ7A 5BRHA 5BN8A 4WFAL 1ZBIA 4BRLA 5AFUA 2W6LA 3C95A 5EVZA 3RR8A 4FJJA 1T6CA 2D5RA 4BRGA 1SAZA 4BG8A 4DU4A 1B92A 2OTLN 1DTQA 3J80O 3NGZA 3A5LC 1SKRA 2CH6A 2NRXA 3OYBA 3O6WA 2FSJA 1KRPA 3K58A 1LCUA 2EX3A 1X9MA 1W7AA 2IVPA 4ELUA 1TK8A 1NGAA 4AF1A 1BU6O 3QEWA 2QWQA 3OYKA 3A8YA 4DFJA 3AO5A 4YORA 2QWLA 4CK1A 2ATQA 3H3OB 5FRMA 1EXQA 1ASVA 3TAFA 2F9TA 3ENHA 2O4IA 1CZAN 5MLCQ 4IEEA 3ZSOA 4A59A 1XC3A 2ITMA 4IJNA 1LWCA 4K42A 4DS5A 1BIZA 1NGCA 3BGRA 1S1UA 4GKKK 4FZXC 4DUZK 2F4VK 4OX9K 3O9TA 1RTJA 2VCPA 3TANA 2IOCA 3C6AA 1RT6A 2A6AA 2UXCK 3SUPA 2KZMA 2GWJA 3GL1A 3SCXA 4O5BA 4OVLA 2HNDA 4CEQA 3TTCA 4DQQA 3HPGA 3OYHA 2KFNA 3TARA 3VEYA 1N8RO 3DM2A 2Q3SA 2AJQA 3IUCA 2E6MA 4BACA 3HVTA 3CFPA 4DTMA 4FJ8A 4FLTA 5SWMA 3VMFB 5M1KA 4BRFA 3K9JA 3UKRB 1T6DA 1E3MA 5AR0A 2NNWA 4B3SK 1VSKA 4DSIA 5M1FA 3VQ8A 5C0YA 4DV7K 3WXIA 3NBPA 3L0QA 2QWRA 1BWFO 4R79A 4F2SA 3NE6A 4DSFA 3PY8A 3BF3A 1T3VA 3PSFA 1XWLA 1U47A 4CI6A 1VQMN 2Z1JA 4F3OA 5KQ8A 3U8XA 3R8EA 3KJVA 1RT7A 3O08A 5AQXA 5AQNA 2VYPA 1KAXA 2GBZA 4CEFA 4DF4A 3P83D 3PV8A 4C1NI 3ALYA 3WXLA 3K9KA 3CCSN 3V9UA 3SQ1A 3M8QA 5I3UA 4WFBL 4LFAK 4ID5A 4W5QA 3TAEA 5AZIA 3RSEB 2V51B 1NMNA 3JYTA 3WEEA 3EKSA 3AAPA 2O8FA 5AQTA 1J9AA 2BGGA 1NGFA 3RWUA 1QZ5A 1IKXA 3OYLA 4BRQA 4DS4A 3CQXA
chains in the Genus database with same CATH topology
3LWMA 3O4QA 4IFVA 1D8YA 1UA0A 1C1CA 1IH7A 2RPIA 3P5JA 3CYMA 1C0TA 1NK5A 1RTIA 4NYNA 2Z1IA 3AVFA 3SQ2A 1NKBA 4B9TA 4CIEA 3LP0A 1JLCA 4JLHA 1LAVA 3AVNA 4OJRA 4H4MA 4N56A 1NJWA 1W9HA 3AO1A 3OYJA 3L8BA 2WONA 1NOZA 2Y1IA 3LAMA 3WNEA 3HL8A 3L2VA 1TAUA 3ULDA 4FJLA 2FBVA 4CHZA 1RNHA 2HVHA 4HCCA 3FFIA 4RW6A 3TABA 3ZSRA 4CGIA 3TI0A 1RT5A 3IAYA 2QKBA 2HHTA 4E89A 2DTUA 1XHZA 3HT3A 3HPHA 1WAFA 3MXJA 4NCGA 4CJUA 3KK1A 4KHNA 1UAXA 3NF6A 4C8KA 3LZJA 3T3FA 4CK2A 3SI6A 4KB0A 3LAKA 4DSKA 1RDCA 2ETJA 4B9SA 3K57A 4HUFA 4FK4A 2JLEA 1WSJA 3M8SA 1FXXA 2XO7A 1UA1A 2JGUA 3KLIA 4DTRA 1IKVA 1Z25A 3DLRA 3VQDA 1HJRA 1IG9A 2FC0A 2ZD1A 4Y1DA 5C24A 3OJSA 3O3FA 1Z26A 1D5AA 1B9DA 1EKEA 1FKPA 4AHUA 1CZ9A 3CM5A 3SZ2A 3OYMA 3LPUA 4CF2A 2G8WA 2PY5A 4FJ9A 4CEZA 2XHBA 3QEXA 1QS4A 4DTJA 1KFDA 1EETA 3V81A 4M3TA 3QEIA 3PX0A 5T7BA 3MEGA 3V9SA 3SPZA 1N6QA 1SL1A 4BWJA 2IC3A 4CEDA 4MFBA 4KHWA 3WNHA 4N5SA 1S6QA 3G10A 4FZYA 3M8PA 4CHOA 4DF8A 4CF8A 3DRRA 4L8RB 1S9EA 4AHCA 1BQNA 3G0ZA 1S5JA 5DK5A 4CFCA 5J1EA 1WNSA 2DFEA 4BDPA 4Z4FA 1S1VA 1D9FA 1CXQA 4CFBA 1KVAA 2YHAA 4FJXA 1FK9A 2F8SA 3K59A 4J2EA 1S1TA 1N5YA 4BDZA 2PYJA 4Z4IA 3IG1A 4H8KA 3RRGA 3CFOA 4FW1A 4CJVA 4ZTFA 4IBNA 2HHUA 4IFYA 1HRHA 4CEOA 3TAGA 4C8NA 4OGCA 4DTUA 3AA3A 4OPJA 1RBRA 3HO1A 1LW0A 1B9FA 2X6NA 1HYZA 4CJLA 3THVA 3L2WA 2O4GA 1LV5A 4Z0UA 2G8KA 3V4IA 4CFDA 3QEVA 3TWHA 4DQSA 4F4KA 1GOAA 3AVLA 3HXMA 3HK2A 3RR7A 3KK3A 3OYCA 3SV3A 4B9VA 1L3VA 3DYAA 1RT2A 4AHVA 1WN7A 4CJ4A 1VSEA 4EZ6A 4LD0A 3OYFA 2YNHA 2XY7A 4Q5VA 2IGIA 3RMDA 1BL3A 1QQCA 1NK9A 1NK8A 3L2QA 3WNGA 2IAJA 3IS9A 1CZBA 3LP3A 1WSEA 3K5MA 1BQMA 3LP2A 1XI1A 3NGYA 3K2PA 4O4GA 3KD1E 2P1JA 4CHYA 1HQEA 1XHXA 4K8XA 4KI6A 3ZSQA 3OYEA 4KKOA 2DFFA 3F73A 2D0AA 1RDAA 1SUQA 1Q8IA 2KZZA 1S1XA 2G8IA 2PYLA 3EYZA 1JL2A 1NK6A 2BDPA 1ASWA 4I9QA 4Z4CA 1SL0A 3V9WA 3SV4A 3VQ6A 4CK3A 4KHSA 4B8CA 2YNGA 3QIPA 4CGGA 3O3HA 4FXDA 4CIGA 3OYGA 3ZT4A 3LPTA 4FLWA 4B9UA 2XY6A 2B4JA 3ASMA 2A1SA 4I2PA 4O55A 4CJRA 3TR8A 2G8HA 5HLFA 2HHWA 5CZ1A 2FBTA 1BIUA 2VG7A 3OYAA 4E7LA 4CEEA 3LWLA 2KW4A 1UOCA 3VQBA 3ZT3A 1DLOA 3DRSA 3DLEA 1R0AA 3K5LA 2VWKA 5KTQA 4DFKA 3AVKA 4CJ3A 3SQ4A 3D0PA 4J2BA 1ZBHA 1S9GA 3NHGA 4FVMA 3NCIA 1JLQA 4KAZA 3KLFA 1A5XA 1BGXT 4H4OA 3AO2A 4LH5A 4CJSA 3RMAA 4DQPA 5HRNA 2OZSA 4B9LA 4DSEA 3PO5A 1RDBA 3DLGA 4TSXA 1A5WA 4YNQA 1TKDA 3KD5E 1BI4A 4KB1A 2HVIA 1YTAA 3T19A 3MECA 4AHSA 3NH1A 2KFZA 1RBUA 2HW3A 2RF2A 3CQ8A 1W0HA 4RW8A 2ITGA 4N76A 5FROA 4F3TA 4DLGA 3CFRA 4UQGA 1QSLA 2ZE2A 3DI6A 1L3SA 4NCBA 3MEDA 3RRHA 3B6PA 3ZT0A 1KFSA 4FJHA 3VQQA 4FJKA 1L3UA 4CJTA 3KK2A 4DTOA 2IDOA 4OKEA 1J5OA 3KTQA 3L3UA 2F96A 2HB5A 2HNYA 4DQRA 1ITGA 1KTQA 4GW6A 1HNIA 4IG3A 2BANA 1ZBFA 4AH9A 1TKXA 3VQCA 1FKOA 4XIUA 1NOYA 1S1WA 4KV8A 3HM9A 2OZMA 3AA2A 3KLHA 4DSLA 4GMJB 5KI6A 5SZTA 4DG1A 2R7YA 1JLBA 2QKKA 2E4LA 4FZZA 1I39A 5KGXA 4FJMA 2FBXA 4R5PA 3SUOA 3RMCA 3NH0A 4E1MA 4I7FA 4C8OA 4CGHA 3ZSWA 4CHQA 4BE2A 4QCLA 1YT3A 3NH2A 3KLEA 4JS4A 4CJEA 1T8EA 3BDPA 2E6LA 4FJ5A 4HVJA 3SUQA 1JL1A 5CY4A 3VQ5A 4CJPA 3CG7A 4IDKA 2XRIA 3AO4A 4NYFA 4O0IA 1TVRA 3KLGA 3K5OA 5KRSA 3PX4A 4E19A 1JLEA 3QINA 4B9MA 4ICLA 4KTZA 4JS5A 5FRNA 3DLKA 4BDYA 2OPPA 1EX4A 4CF0A 5D3GA 2P51A 4CJ5A 1HYSA 1HQUA 1LWFA 2YHBA 2XY5A 3M8RA 3S3MA 3C6TA 4CGFA 4LY7A 5HRPA 4FCYA 1RBVA 2B6AA 3O4NA 1C0MA 1TV6A 1TGOA 1VSLA 1RCHA 2YV0X 4KFBA 4J2DA 5J2NA 1RTDA 2PZSA 2VWJA 1JLFA 4DTPA 1YTUA 3AVHA 4Z4HA 4E7KA 3SNNA 4MQ3A 3VN5A 4BE1A 2LSNA 4FYDA 1Q9XA 1JLAA 4M3RA 4AILC 1QHTA 5J2QA 1T7PA 4HUEA 3L2UA 4DU1A 4E3SA 5HP1A 1BI4B 3SQ0A 1X9SA 3TAQA 1NJYA 1JXEA 1T03A 1L5UA 2G8UA 1VSDA 1IO2A 4KO0A 1TAQA 3VQ4A 4DMNA 3LALA 4O0JA 3LANA 4FLZA 2VG5A 4W5RA 4CE9A 3HP6A 1WSGA 4CESA 3NAEA 3AO3A 4CERA 3HPOA 2A1RA 1QSYA 4WE1A 3DMJA 3RTVA 3DLHA 4NCAA 1NKEA 4RW9A 3V9XA 1RILA 3HSTB 1CXUA 3TAMA 4ELVA 1U4BA 3OS2A 5JS2A 1HMVA 3HYFA 1ZBUA 1WSIA 5K14A 1GOBA 4Z4GA 2I5JA 4M41A 4M3UA 1ASUA 5E41A 1NK0A 4FJGA 4CF9A 3KKSA 3AVBA 4EZ9A 1RBSA 4DTXA 4DFPA 1C1BA 3VQEA 4JRQA 4DTSA 3TAPA 4CHPA 4OLAA 3VQAA 1VK0A 5J2PA 4RW4A 3A2FA 4I2QA 4KTQA 3AVIA 1NJZA 2Y1JA 3EZ5A 2W42A 3V1RA 4O44A 3SYZA 1RTHA 4HCBA 4LSNA 4KPYA 4DQIA 4EP5A 2F8TA 4RG8A 1KVBA 2GV9A 2HHQA 2YKMA 4ZHRA 3O3GA 5HRSA 1VSFA 4CJFA 3AVCA 5CYQA 3QETA 3NGIA 2G8VA 1F21A 1VSIA 4M42A 4OLBA 4ELTA 3C94A 4B3OA 3DLBA 1UWBA 3OYIA 4QAGA 3HJFA 4I9LA 2OPRA 4Q0BA 1HPZA 1RDDA 4OKJA 1VSJA 2X6SA 3I0SA 1C1AA 3AVAA 1U48A 2Z1GA 4E7HA 4AHRA 4CJWA 4CFAA 1ZBIA 3WNFA 1QTMA 3IRXA 3C95A 4CEAA 1LAWA 3RR8A 4FJJA 1HNVA 2D5RA 3AVJA 1WLJA 1ZYQA 3F9KA 4KHQA 4KHYA 4DU4A 1B92A 3OJUA 3MXIA 4CF1A 1LWEA 4FM0A 4IG0A 1DTQA 3U6FA 3NGZA 3MXMA 4KHUA 1SKRA 4E7IA 2D0BA 4CGDA 4CEBA 3EY1A 3OY9A 4OGEA 3OYBA 1CLQA 1KVCA 4PA1A 3LZIA 4M3YA 1J53A 2RKIA 3K58A 2YNIA 4DFMA 1U49A 1KRPA 4W5NA 1NJXA 3QNOA 3S9HA 3CM6A 5HRRA 2VG6A 1K6YA 1TL3A 2EX3A 3V9ZA 1X9MA 3V6DA 5I42A 4ELUA 2ZQBA 4CGJA 1TK8A 1S6PA 4M3ZA 3DOLA 5C42A 3QEWA 2G8FA 4AHTA 1L3TA 3HVRA 3KIOA 3SUNA 4FJ7A 3OYKA 4DFJA 3AO5A 1KLMA 4CK1A 4KREA 2ATQA 5J2MA 1RT1A 1BCOA 1EXQA 5FRMA 1ASVA 1X1PA 2HHVA 3OVNA 3AA5X 5C25A 3ZSXA 3TAFA 1T05A 4J2AA 1DTTA 3DOKA 2B5JA 4FLVA 4M3XA 1REVA 3RMBA 2O4IA 3ZSOA 3UIQA 3B6OA 4BWMA 4QOZB 2QXFA 1TKZA 2WOMA 3OS0A 2OPQA 3JSMA 1LWCA 3U3YA 4M45A 4CJKA 1IKYA 4DS5A 1BIZA 3U3GA 4RW7A 1TKTA 2X74A 3BGRA 1S1UA 3ZT1A 4FZXC 3VQ7A 1JKHA 2GUIA 1QE1A 5HROA 4CJQA 2BE2A 3D45A 1SKSA 3L2RA 3SPYA 3VQ9A 1RTJA 4CHNA 4KTWA 4FJNA 1SL2A 3TANA 1QSSA 2IOCA 1RT6A 3SJJA 2XY8A 3NF9A 4FM1A 4KI4A 4FLYA 3OYNA 1EP4A 4FK0A 4PUOA 3SUPA 2KZMA 4KRFA 3VA0A 3SCXA 1NK4A 4LH4A 4BE0A 4O5BA 1VRTA 4OVLA 3ZCMA 5JS1A 4DTNA 4M3WA 3NF8A 2HNDA 5EU7A 4CEQA 4FK2A 2HHSA 1RT3A 1WSFA 1X9WA 3NF7A 1C6VA 4G1QA 3OYDA 4DQQA 3QERA 3HPGA 3OYHA 2OA8A 2KFNA 2RN2A 2YNFA 3TARA 2YKNA 1KSPA 4LSLA 4N41A 2OPSA 4C8MA 1O1WA 4DWIA 3DM2A 2Q3SA 1U45A 2AJQA 3S3OA 4BACA 2E6MA 4ZTJA 3OS1A 4FW2A 1ZBLA 2HMIA 3P1GA 3HVTA 3CFPA 4DTMA 3S3NA 4B9NA 4FJ8A 4FLTA 3QIOA 5SWMA 3QNNA 3NDKA 2DFHA 1XC9A 3ISNC 5CYMA 2EHGA 4OPKA 4YFUA 1KLNA 4DSJA 1VSKA 2KTQA 4DSIA 1YVUA 1VSMA 2NUBA 3VQ8A 3QO9A 1VSHA 2KQ2A 4HUGA 4CIFA 4PY5A 5DMRA 1GOCA 3LP1A 3NBPA 3VQPA 3NFAA 3C6UA 4CCHA 2IS3A 4E0DA 2QK9A 2DY4A 3PX6A 3QEPA 4Y1CA 1HYVA 3K5NA 3PO4A 4EP4A 1WSHA 1LW2A 4F2SA 1G15A 3HP9A 1BCMA 2P5GA 3NE6A 4DSFA 4IKFA 4FLXA 3ITHA 3PY8A 3VA3A 1JXBA 2HNZA 3ZSZA 1TL1A 1TK5A 1C0UA 3ZT2A 1XWLA 1BISA 1U47A 4E1NA 1TK0A 4N47A 1KCFA 3PUFA 3KKRA 4DU3A 2Z1JA 2D0CA 1D9DA 4W5OA 1U04A 2HHXA 4F3OA 3AVGA 4FJIA 4JRPA 5KGWA 3AA4A 3KJVA 2P5OA 3E01A 1RT7A 3QESA 3QLHA 1Q9YA 2FBYA 4GVMA 1NKCA 4FLUA 3AVMA 3DRPA 4FM2A 2OYQA 5HBMA 4CECA 3V1OA 1Y97A 5KRTA 1NK7A 3ZSYA 1WAJA 3AV9A 4Z4EA 2GBZA 4CEFA 4DF4A 3P83D 5CZ2A 3L3VA 3PV8A 4PQUA 3ALYA 3V1QA 1SKWA 3MAQA 3V9UA 3SQ1A 4PWDA 3M8QA 5I3UA 1RBTA 1VRUA 1RT4A 4ID5A 4W5QA 1MU2A 3TAEA 1IKWA 3LDSA 4F8RA 1I3AA 3MEEA 3JYTA 4K8ZA 4C8LA 4HTUA 3I0RA 4DLEA 1J54A 3I8DA 4OKKA 2Z1HA 1JLGA 4B8AB 1A5VA 2X78A 3H08A 4W5TA 1J9AA 2BGGA 4E7JA 1BHLA 3T1AA 4B08A 4HHTA 3RWUA 4DS4A 1IKXA 3OYLA 3ZSVA 4F2RA 4ID1A 1SV5A 5FDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWM A;  3O4Q A;  4IFV A;  1D8Y A;  1UA0 A;  1C1C A;  1IH7 A;  2RPI A;  3P5J A;  3CYM A;  1C0T A;  1NK5 A;  1RTI A;  4NYN A;  2Z1I A;  3AVF A;  3SQ2 A;  1NKB A;  4B9T A;  4CIE A;  3LP0 A;  1JLC A;  4JLH A;  1LAV A;  3AVN A;  4OJR A;  4H4M A;  4N56 A;  1NJW A;  1W9H A;  3AO1 A;  3OYJ A;  3L8B A;  2WON A;  1NOZ A;  2Y1I A;  3LAM A;  3WNE A;  3HL8 A;  3L2V A;  1TAU A;  3ULD A;  4FJL A;  2FBV A;  4CHZ A;  1RNH A;  2HVH A;  4HCC A;  3FFI A;  4RW6 A;  3TAB A;  3ZSR A;  4CGI A;  3TI0 A;  1RT5 A;  3IAY A;  2QKB A;  2HHT A;  4E89 A;  2DTU A;  1XHZ A;  3HT3 A;  3HPH A;  1WAF A;  3MXJ A;  4NCG A;  4CJU A;  3KK1 A;  4KHN A;  1UAX A;  3NF6 A;  4C8K A;  3LZJ A;  3T3F A;  4CK2 A;  3SI6 A;  4KB0 A;  3LAK A;  4DSK A;  1RDC A;  2ETJ A;  4B9S A;  3K57 A;  4HUF A;  4FK4 A;  2JLE A;  1WSJ A;  3M8S A;  1FXX A;  2XO7 A;  1UA1 A;  2JGU A;  3KLI A;  4DTR A;  1IKV A;  1Z25 A;  3DLR A;  3VQD A;  1HJR A;  1IG9 A;  2FC0 A;  2ZD1 A;  4Y1D A;  5C24 A;  3OJS A;  3O3F A;  1Z26 A;  1D5A A;  1B9D A;  1EKE A;  1FKP A;  4AHU A;  1CZ9 A;  3CM5 A;  3SZ2 A;  3OYM A;  3LPU A;  4CF2 A;  2G8W A;  2PY5 A;  4FJ9 A;  4CEZ A;  2XHB A;  3QEX A;  1QS4 A;  4DTJ A;  1KFD A;  1EET A;  3V81 A;  4M3T A;  3QEI A;  3PX0 A;  5T7B A;  3MEG A;  3V9S A;  3SPZ A;  1N6Q A;  1SL1 A;  4BWJ A;  2IC3 A;  4CED A;  4MFB A;  4KHW A;  3WNH A;  4N5S A;  1S6Q A;  3G10 A;  4FZY A;  3M8P A;  4CHO A;  4DF8 A;  4CF8 A;  3DRR A;  4L8R B;  1S9E A;  4AHC A;  1BQN A;  3G0Z A;  1S5J A;  5DK5 A;  4CFC A;  5J1E A;  1WNS A;  2DFE A;  4BDP A;  4Z4F A;  1S1V A;  1D9F A;  1CXQ A;  4CFB A;  1KVA A;  2YHA A;  4FJX A;  1FK9 A;  2F8S A;  3K59 A;  4J2E A;  1S1T A;  1N5Y A;  4BDZ A;  2PYJ A;  4Z4I A;  3IG1 A;  4H8K A;  3RRG A;  3CFO A;  4FW1 A;  4CJV A;  4ZTF A;  4IBN A;  2HHU A;  4IFY A;  1HRH A;  4CEO A;  3TAG A;  4C8N A;  4OGC A;  4DTU A;  3AA3 A;  4OPJ A;  1RBR A;  3HO1 A;  1LW0 A;  1B9F A;  2X6N A;  1HYZ A;  4CJL A;  3THV A;  3L2W A;  2O4G A;  1LV5 A;  4Z0U A;  2G8K A;  3V4I A;  4CFD A;  3QEV A;  3TWH A;  4DQS A;  4F4K A;  1GOA A;  3AVL A;  3HXM A;  3HK2 A;  3RR7 A;  3KK3 A;  3OYC A;  3SV3 A;  4B9V A;  1L3V A;  3DYA A;  1RT2 A;  4AHV A;  1WN7 A;  4CJ4 A;  1VSE A;  4EZ6 A;  4LD0 A;  3OYF A;  2YNH A;  2XY7 A;  4Q5V A;  2IGI A;  3RMD A;  1BL3 A;  1QQC A;  1NK9 A;  1NK8 A;  3L2Q A;  3WNG A;  2IAJ A;  3IS9 A;  1CZB A;  3LP3 A;  1WSE A;  3K5M A;  1BQM A;  3LP2 A;  1XI1 A;  3NGY A;  3K2P A;  4O4G A;  3KD1 E;  2P1J A;  4CHY A;  1HQE A;  1XHX A;  4K8X A;  4KI6 A;  3ZSQ A;  3OYE A;  4KKO A;  2DFF A;  3F73 A;  2D0A A;  1RDA A;  1SUQ A;  1Q8I A;  2KZZ A;  1S1X A;  2G8I A;  2PYL A;  3EYZ A;  1JL2 A;  1NK6 A;  2BDP A;  1ASW A;  4I9Q A;  4Z4C A;  1SL0 A;  3V9W A;  3SV4 A;  3VQ6 A;  4CK3 A;  4KHS A;  4B8C A;  2YNG A;  3QIP A;  4CGG A;  3O3H A;  4FXD A;  4CIG A;  3OYG A;  3ZT4 A;  3LPT A;  4FLW A;  4B9U A;  2XY6 A;  2B4J A;  3ASM A;  2A1S A;  4I2P A;  4O55 A;  4CJR A;  3TR8 A;  2G8H A;  5HLF A;  2HHW A;  5CZ1 A;  2FBT A;  1BIU A;  2VG7 A;  3OYA A;  4E7L A;  4CEE A;  3LWL A;  2KW4 A;  1UOC A;  3VQB A;  3ZT3 A;  1DLO A;  3DRS A;  3DLE A;  1R0A A;  3K5L A;  2VWK A;  5KTQ A;  4DFK A;  3AVK A;  4CJ3 A;  3SQ4 A;  3D0P A;  4J2B A;  1ZBH A;  1S9G A;  3NHG A;  4FVM A;  3NCI A;  1JLQ A;  4KAZ A;  3KLF A;  1A5X A;  1BGX T;  4H4O A;  3AO2 A;  4LH5 A;  4CJS A;  3RMA A;  4DQP A;  5HRN A;  2OZS A;  4B9L A;  4DSE A;  3PO5 A;  1RDB A;  3DLG A;  4TSX A;  1A5W A;  4YNQ A;  1TKD A;  3KD5 E;  1BI4 A;  4KB1 A;  2HVI A;  1YTA A;  3T19 A;  3MEC A;  4AHS A;  3NH1 A;  2KFZ A;  1RBU A;  2HW3 A;  2RF2 A;  3CQ8 A;  1W0H A;  4RW8 A;  2ITG A;  4N76 A;  5FRO A;  4F3T A;  4DLG A;  3CFR A;  4UQG A;  1QSL A;  2ZE2 A;  3DI6 A;  1L3S A;  4NCB A;  3MED A;  3RRH A;  3B6P A;  3ZT0 A;  1KFS A;  4FJH A;  3VQQ A;  4FJK A;  1L3U A;  4CJT A;  3KK2 A;  4DTO A;  2IDO A;  4OKE A;  1J5O A;  3KTQ A;  3L3U A;  2F96 A;  2HB5 A;  2HNY A;  4DQR A;  1ITG A;  1KTQ A;  4GW6 A;  1HNI A;  4IG3 A;  2BAN A;  1ZBF A;  4AH9 A;  1TKX A;  3VQC A;  1FKO A;  4XIU A;  1NOY A;  1S1W A;  4KV8 A;  3HM9 A;  2OZM A;  3AA2 A;  3KLH A;  4DSL A;  4GMJ B;  5KI6 A;  5SZT A;  4DG1 A;  2R7Y A;  1JLB A;  2QKK A;  2E4L A;  4FZZ A;  1I39 A;  5KGX A;  4FJM A;  2FBX A;  4R5P A;  3SUO A;  3RMC A;  3NH0 A;  4E1M A;  4I7F A;  4C8O A;  4CGH A;  3ZSW A;  4CHQ A;  4BE2 A;  4QCL A;  1YT3 A;  3NH2 A;  3KLE A;  4JS4 A;  4CJE A;  1T8E A;  3BDP A;  2E6L A;  4FJ5 A;  4HVJ A;  3SUQ A;  1JL1 A;  5CY4 A;  3VQ5 A;  4CJP A;  3CG7 A;  4IDK A;  2XRI A;  3AO4 A;  4NYF A;  4O0I A;  1TVR A;  3KLG A;  3K5O A;  5KRS A;  3PX4 A;  4E19 A;  1JLE A;  3QIN A;  4B9M A;  4ICL A;  4KTZ A;  4JS5 A;  5FRN A;  3DLK A;  4BDY A;  2OPP A;  1EX4 A;  4CF0 A;  5D3G A;  2P51 A;  4CJ5 A;  1HYS A;  1HQU A;  1LWF A;  2YHB A;  2XY5 A;  3M8R A;  3S3M A;  3C6T A;  4CGF A;  4LY7 A;  5HRP A;  4FCY A;  1RBV A;  2B6A A;  3O4N A;  1C0M A;  1TV6 A;  1TGO A;  1VSL A;  1RCH A;  2YV0 X;  4KFB A;  4J2D A;  5J2N A;  1RTD A;  2PZS A;  2VWJ A;  1JLF A;  4DTP A;  1YTU A;  3AVH A;  4Z4H A;  4E7K A;  3SNN A;  4MQ3 A;  3VN5 A;  4BE1 A;  2LSN A;  4FYD A;  1Q9X A;  1JLA A;  4M3R A;  4AIL C;  1QHT A;  5J2Q A;  1T7P A;  4HUE A;  3L2U A;  4DU1 A;  4E3S A;  5HP1 A;  1BI4 B;  3SQ0 A;  1X9S A;  3TAQ A;  1NJY A;  1JXE A;  1T03 A;  1L5U A;  2G8U A;  1VSD A;  1IO2 A;  4KO0 A;  1TAQ A;  3VQ4 A;  4DMN A;  3LAL A;  4O0J A;  3LAN A;  4FLZ A;  2VG5 A;  4W5R A;  4CE9 A;  3HP6 A;  1WSG A;  4CES A;  3NAE A;  3AO3 A;  4CER A;  3HPO A;  2A1R A;  1QSY A;  4WE1 A;  3DMJ A;  3RTV A;  3DLH A;  4NCA A;  1NKE A;  4RW9 A;  3V9X A;  1RIL A;  3HST B;  1CXU A;  3TAM A;  4ELV A;  1U4B A;  3OS2 A;  5JS2 A;  1HMV A;  3HYF A;  1ZBU A;  1WSI A;  5K14 A;  1GOB A;  4Z4G A;  2I5J A;  4M41 A;  4M3U A;  1ASU A;  5E41 A;  1NK0 A;  4FJG A;  4CF9 A;  3KKS A;  3AVB A;  4EZ9 A;  1RBS A;  4DTX A;  4DFP A;  1C1B A;  3VQE A;  4JRQ A;  4DTS A;  3TAP A;  4CHP A;  4OLA A;  3VQA A;  1VK0 A;  5J2P A;  4RW4 A;  3A2F A;  4I2Q A;  4KTQ A;  3AVI A;  1NJZ A;  2Y1J A;  3EZ5 A;  2W42 A;  3V1R A;  4O44 A;  3SYZ A;  1RTH A;  4HCB A;  4LSN A;  4KPY A;  4DQI A;  4EP5 A;  2F8T A;  4RG8 A;  1KVB A;  2GV9 A;  2HHQ A;  2YKM A;  4ZHR A;  3O3G A;  5HRS A;  1VSF A;  4CJF A;  3AVC A;  5CYQ A;  3QET A;  3NGI A;  2G8V A;  1F21 A;  1VSI A;  4M42 A;  4OLB A;  4ELT A;  3C94 A;  4B3O A;  3DLB A;  1UWB A;  3OYI A;  4QAG A;  3HJF A;  4I9L A;  2OPR A;  4Q0B A;  1HPZ A;  1RDD A;  4OKJ A;  1VSJ A;  2X6S A;  3I0S A;  1C1A A;  3AVA A;  1U48 A;  2Z1G A;  4E7H A;  4AHR A;  4CJW A;  4CFA A;  1ZBI A;  3WNF A;  1QTM A;  3IRX A;  3C95 A;  4CEA A;  1LAW A;  3RR8 A;  4FJJ A;  1HNV A;  2D5R A;  3AVJ A;  1WLJ A;  1ZYQ A;  3F9K A;  4KHQ A;  4KHY A;  4DU4 A;  1B92 A;  3OJU A;  3MXI A;  4CF1 A;  1LWE A;  4FM0 A;  4IG0 A;  1DTQ A;  3U6F A;  3NGZ A;  3MXM A;  4KHU A;  1SKR A;  4E7I A;  2D0B A;  4CGD A;  4CEB A;  3EY1 A;  3OY9 A;  4OGE A;  3OYB A;  1CLQ A;  1KVC A;  4PA1 A;  3LZI A;  4M3Y A;  1J53 A;  2RKI A;  3K58 A;  2YNI A;  4DFM A;  1U49 A;  1KRP A;  4W5N A;  1NJX A;  3QNO A;  3S9H A;  3CM6 A;  5HRR A;  2VG6 A;  1K6Y A;  1TL3 A;  2EX3 A;  3V9Z A;  1X9M A;  3V6D A;  5I42 A;  4ELU A;  2ZQB A;  4CGJ A;  1TK8 A;  1S6P A;  4M3Z A;  3DOL A;  5C42 A;  3QEW A;  2G8F A;  4AHT A;  1L3T A;  3HVR A;  3KIO A;  3SUN A;  4FJ7 A;  3OYK A;  4DFJ A;  3AO5 A;  1KLM A;  4CK1 A;  4KRE A;  2ATQ A;  5J2M A;  1RT1 A;  1BCO A;  1EXQ A;  5FRM A;  1ASV A;  1X1P A;  2HHV A;  3OVN A;  3AA5 X;  5C25 A;  3ZSX A;  3TAF A;  1T05 A;  4J2A A;  1DTT A;  3DOK A;  2B5J A;  4FLV A;  4M3X A;  1REV A;  3RMB A;  2O4I A;  3ZSO A;  3UIQ A;  3B6O A;  4BWM A;  4QOZ B;  2QXF A;  1TKZ A;  2WOM A;  3OS0 A;  2OPQ A;  3JSM A;  1LWC A;  3U3Y A;  4M45 A;  4CJK A;  1IKY A;  4DS5 A;  1BIZ A;  3U3G A;  4RW7 A;  1TKT A;  2X74 A;  3BGR A;  1S1U A;  3ZT1 A;  4FZX C;  3VQ7 A;  1JKH A;  2GUI A;  1QE1 A;  5HRO A;  4CJQ A;  2BE2 A;  3D45 A;  1SKS A;  3L2R A;  3SPY A;  3VQ9 A;  1RTJ A;  4CHN A;  4KTW A;  4FJN A;  1SL2 A;  3TAN A;  1QSS A;  2IOC A;  1RT6 A;  3SJJ A;  2XY8 A;  3NF9 A;  4FM1 A;  4KI4 A;  4FLY A;  3OYN A;  1EP4 A;  4FK0 A;  4PUO A;  3SUP A;  2KZM A;  4KRF A;  3VA0 A;  3SCX A;  1NK4 A;  4LH4 A;  4BE0 A;  4O5B A;  1VRT A;  4OVL A;  3ZCM A;  5JS1 A;  4DTN A;  4M3W A;  3NF8 A;  2HND A;  5EU7 A;  4CEQ A;  4FK2 A;  2HHS A;  1RT3 A;  1WSF A;  1X9W A;  3NF7 A;  1C6V A;  4G1Q A;  3OYD A;  4DQQ A;  3QER A;  3HPG A;  3OYH A;  2OA8 A;  2KFN A;  2RN2 A;  2YNF A;  3TAR A;  2YKN A;  1KSP A;  4LSL A;  4N41 A;  2OPS A;  4C8M A;  1O1W A;  4DWI A;  3DM2 A;  2Q3S A;  1U45 A;  2AJQ A;  3S3O A;  4BAC A;  2E6M A;  4ZTJ A;  3OS1 A;  4FW2 A;  1ZBL A;  2HMI A;  3P1G A;  3HVT A;  3CFP A;  4DTM A;  3S3N A;  4B9N A;  4FJ8 A;  4FLT A;  3QIO A;  5SWM A;  3QNN A;  3NDK A;  2DFH A;  1XC9 A;  3ISN C;  5CYM A;  2EHG A;  4OPK A;  4YFU A;  1KLN A;  4DSJ A;  1VSK A;  2KTQ A;  4DSI A;  1YVU A;  1VSM A;  2NUB A;  3VQ8 A;  3QO9 A;  1VSH A;  2KQ2 A;  4HUG A;  4CIF A;  4PY5 A;  5DMR A;  1GOC A;  3LP1 A;  3NBP A;  3VQP A;  3NFA A;  3C6U A;  4CCH A;  2IS3 A;  4E0D A;  2QK9 A;  2DY4 A;  3PX6 A;  3QEP A;  4Y1C A;  1HYV A;  3K5N A;  3PO4 A;  4EP4 A;  1WSH A;  1LW2 A;  4F2S A;  1G15 A;  3HP9 A;  1BCM A;  2P5G A;  3NE6 A;  4DSF A;  4IKF A;  4FLX A;  3ITH A;  3PY8 A;  3VA3 A;  1JXB A;  2HNZ A;  3ZSZ A;  1TL1 A;  1TK5 A;  1C0U A;  3ZT2 A;  1XWL A;  1BIS A;  1U47 A;  4E1N A;  1TK0 A;  4N47 A;  1KCF A;  3PUF A;  3KKR A;  4DU3 A;  2Z1J A;  2D0C A;  1D9D A;  4W5O A;  1U04 A;  2HHX A;  4F3O A;  3AVG A;  4FJI A;  4JRP A;  5KGW A;  3AA4 A;  3KJV A;  2P5O A;  3E01 A;  1RT7 A;  3QES A;  3QLH A;  1Q9Y A;  2FBY A;  4GVM A;  1NKC A;  4FLU A;  3AVM A;  3DRP A;  4FM2 A;  2OYQ A;  5HBM A;  4CEC A;  3V1O A;  1Y97 A;  5KRT A;  1NK7 A;  3ZSY A;  1WAJ A;  3AV9 A;  4Z4E A;  2GBZ A;  4CEF A;  4DF4 A;  3P83 D;  5CZ2 A;  3L3V A;  3PV8 A;  4PQU A;  3ALY A;  3V1Q A;  1SKW A;  3MAQ A;  3V9U A;  3SQ1 A;  4PWD A;  3M8Q A;  5I3U A;  1RBT A;  1VRU A;  1RT4 A;  4ID5 A;  4W5Q A;  1MU2 A;  3TAE A;  1IKW A;  3LDS A;  4F8R A;  1I3A A;  3MEE A;  3JYT A;  4K8Z A;  4C8L A;  4HTU A;  3I0R A;  4DLE A;  1J54 A;  3I8D A;  4OKK A;  2Z1H A;  1JLG A;  4B8A B;  1A5V A;  2X78 A;  3H08 A;  4W5T A;  1J9A A;  2BGG A;  4E7J A;  1BHL A;  3T1A A;  4B08 A;  4HHT A;  3RWU A;  4DS4 A;  1IKX A;  3OYL A;  3ZSV A;  4F2R A;  4ID1 A;  1SV5 A;  5FDL A; 
#chains in the Genus database with same CATH topology
 4QS8 A;  1NKB A;  3WQU A;  1NNE A;  3LP0 A;  3OBW A;  4M7Y A;  1JLC A;  4EHT A;  1VQ8 N;  4OJR A;  3OYJ A;  2WON A;  1NOZ A;  2E88 A;  1TAU A;  3ULD A;  1RNH A;  3S41 A;  4HCC A;  3ZSR A;  1RT5 A;  1XHZ A;  1WAF A;  2YHX A;  3I8B A;  3MXJ A;  4KB0 A;  3JAM O;  3LAK A;  4DSK A;  4HUF A;  4LF4 K;  1YVN A;  1WSJ A;  2XO7 A;  5E26 A;  3C0B A;  1HJR A;  2FC0 A;  5HOO A;  1Z26 A;  3K0S A;  1D5A A;  3VEW A;  4AHU A;  3ZLJ A;  3OYM A;  3LPU A;  4MLE A;  4CF2 A;  1QVG M;  4FJ9 A;  5ELZ A;  1QS4 A;  1VAZ A;  4M7X A;  3QEI A;  1EWQ A;  3PX0 A;  5T7B A;  1N6Q A;  2CH5 A;  3D6R A;  4MFB A;  2NLX A;  3IFR A;  4FZY A;  4DF8 A;  1HX1 A;  1NGG A;  4L8R B;  1S9E A;  2QWP A;  4CFC A;  1WNS A;  1YIT N;  4FJX A;  4J2E A;  2OAN A;  1N5Y A;  4BDZ A;  3CME N;  3CJ1 A;  3IG1 A;  1RGI A;  4DV5 K;  4DTU A;  1LW0 A;  2Q36 A;  3VGK A;  2QXL A;  2UYT A;  1Z05 A;  4CFD A;  3T1H K;  3TWH A;  4FPB A;  4DQS A;  4F4K A;  3HK2 A;  3HXM A;  3OYC A;  5DM7 L;  1VQK N;  3THX B;  1RT2 A;  3GDQ A;  3FGU A;  4CJ4 A;  4EAH D;  4EZ6 A;  4JI5 K;  5A2Q O;  3C7N A;  3U4L A;  2QWO A;  2EWS A;  2YNH A;  4A5B A;  4EFH A;  1QQC A;  3J7Y P;  1NK8 A;  3LP3 A;  1YJ9 N;  1XI1 A;  1BQM A;  3HOT A;  4O4G A;  3KD1 E;  2P9K B;  1N33 K;  3F73 A;  4IZ9 A;  3A5N C;  1S1X A;  3CC2 N;  2PYL A;  3TSQ A;  3SV4 A;  4BR5 A;  5AZJ A;  4FXD A;  3QFU A;  2XY6 A;  4J8F A;  3ASM A;  4B3T K;  2WFB A;  2HHW A;  2FBT A;  3VEV A;  4FWK A;  1UOC A;  1OVY A;  3ZT3 A;  4FOI A;  3UKU B;  5KTQ A;  3AVK A;  3MMV A;  4BRI A;  3SQ4 A;  3NHG A;  3NCI A;  1W2B M;  4KAZ A;  4JI3 K;  1BGX T;  4JI7 K;  3DXK B;  4B9L A;  1RDB A;  2QM1 A;  3DLG A;  1TKD A;  3T19 A;  2HW3 A;  2RF2 A;  2ITG A;  4F3T A;  1N34 K;  1S22 A;  2ZE2 A;  4MO4 A;  4FVU A;  1I94 K;  3DI6 A;  4NCB A;  2CGK A;  3SLC A;  2E2Q A;  4CBW A;  4FO0 A;  4PHT X;  4BQL A;  4AM6 A;  4V19 S;  2HB5 A;  4G9Z A;  1HNI A;  2Q0U A;  2GUP A;  4AH9 A;  3VQC A;  1FKO A;  1NOY A;  3HM9 A;  3WXJ A;  3GOI A;  2P9I B;  3WUH A;  4JKE A;  5KGX A;  3RMC A;  4JI2 K;  3QBX A;  3ZSW A;  4CGH A;  4BE2 A;  1YT3 A;  4YOX A;  3HI0 A;  4CJE A;  3BDP A;  2E6L A;  4CJP A;  5CY4 A;  3OJU A;  1TVR A;  3PX4 A;  3K5O A;  1JLE A;  4QS7 A;  4B9M A;  3SBG A;  4PKH A;  4WQ4 C;  4JS5 A;  4ISF A;  4WQ4 A;  1U6Z A;  4NLB A;  2OPP A;  4CF0 A;  5D3G A;  2P51 A;  1NG9 A;  3M8R A;  4BR2 A;  3CD6 N;  3L4Q A;  4FCY A;  4LY7 A;  2B6A A;  1C0M A;  3VEX A;  1VSL A;  1RCH A;  4KFB A;  4DTP A;  4K0K K;  3PIO L;  1XNQ K;  3SNN A;  3FZF A;  5AQZ A;  1Z6R A;  1ZXO A;  1QHT A;  4HUE A;  5HP1 A;  1BI4 B;  4CVN E;  4JKD A;  1T03 A;  3T69 A;  3MDQ A;  1TAQ A;  3FR0 A;  3VQ4 A;  4O0J A;  1ATN A;  1WSG A;  4CER A;  1NU0 A;  1QSY A;  3DMJ A;  4JKH A;  3JXU A;  1WSI A;  4M41 A;  4EZ9 A;  4DTX A;  4DTS A;  4CHP A;  1RFQ A;  3PSI A;  3VQA A;  1QQN A;  3CCL N;  4RW4 A;  4KTQ A;  4FSV A;  1RTH A;  1YI2 N;  4RG8 A;  3O3G A;  3P31 A;  5HRS A;  2DPN A;  2G8V A;  4OLB A;  2YJE A;  4ELT A;  4DR2 K;  3MX5 A;  4B3O A;  4IJA A;  1UWB A;  3DLB A;  3F2K A;  4QAG A;  3HJF A;  4OO1 J;  4LF9 K;  3DLL L;  4Q0B A;  1RDD A;  3AVA A;  1U48 A;  4I6M B;  3QBW A;  3VF2 A;  1WUA A;  1QTM A;  4CEA A;  4DR5 K;  1WLJ A;  4KHQ A;  2JWK A;  4KHY A;  4CF1 A;  4FM0 A;  4KHU A;  3EY1 A;  4PL7 A;  3LM9 A;  1KVC A;  2YNI A;  4BVP A;  1T44 A;  3KHY A;  3S9H A;  5HRR A;  2O8E B;  3V9Z A;  4CGJ A;  2W40 A;  3CCM N;  4M3Z A;  3SMP A;  2FF3 B;  1OKJ A;  2G8F A;  4ILH A;  4B1V A;  1L3T A;  3P39 A;  5C15 A;  1XNR K;  3HVR A;  1GLA G;  3KIO A;  1K9M O;  4FJ7 A;  3OBY A;  1K73 O;  1KLM A;  3IMX A;  3VPZ A;  5J2M A;  1RT1 A;  3ID6 A;  2HHV A;  3AA5 X;  4ISG A;  2E5L K;  2B5J A;  4FLV A;  3LM2 A;  3UIQ A;  3FZM A;  3U3Y A;  4HTL A;  3ZT1 A;  2X74 A;  1MWM A;  3VQ7 A;  3O8M A;  3VGM A;  3B8A X;  3VQ9 A;  1NGI A;  1HNZ K;  1K8K B;  4KTW A;  4FJN A;  1QSS A;  2HOE A;  4JD2 A;  1J6Z A;  4DV1 K;  2D4W A;  4A57 A;  4LH4 A;  3ZCM A;  1VRT A;  3TPQ A;  4L3Q A;  3J8A A;  1SZ2 A;  3SAH A;  1RT3 A;  1WSF A;  1X9W A;  4X64 K;  3KZB A;  5LY3 A;  4CBU A;  2RN2 A;  4BR7 A;  4YOU A;  4JKF A;  4BRD A;  1MA9 B;  4LSL A;  1U45 A;  1Q7Y O;  4ZTJ A;  4CZE A;  3OS1 A;  2HMI A;  5ADX H;  3ZX0 A;  4B9N A;  3QNN A;  4M63 C;  1S72 N;  3NDK A;  5GAE P;  5CYM A;  4YFU A;  3M1F A;  2VWB A;  1KLN A;  1KXP A;  1X3N A;  4DSJ A;  3MN5 A;  4CD1 A;  1YVU A;  3BEX A;  4O8K A;  1GLF O;  1QQM A;  2NUB A;  1P8Z A;  4CIF A;  1GOC A;  2PFU A;  3BY5 A;  4CCH A;  4E0D A;  2ASM A;  5KPZ A;  3PO4 A;  1LW2 A;  5AQP A;  4GV3 A;  1RDU A;  3GBT A;  4FLX A;  1JXB A;  3UB5 A;  2E8A A;  1BIS A;  3R1X A;  1TK0 A;  2Q97 A;  2D0C A;  4W5O A;  3AVG A;  2P9P A;  3ULE A;  4JRP A;  1NGE A;  3E01 A;  1Q9Y A;  4JKG A;  3QLH A;  3QES A;  4X66 K;  1NKC A;  3AVM A;  3DRP A;  3E9P A;  1U2V B;  4FWL A;  4K25 A;  2QTD A;  3MX2 A;  4CEC A;  4CW7 B;  5KRT A;  4EIA A;  1WAJ A;  3V1Q A;  1SKW A;  3MAQ A;  4BRC A;  4CZF A;  1MU2 A;  1IKW A;  2J4R A;  3SJH A;  2ZGY A;  1FJG K;  3MEE A;  3WQT A;  4HTU A;  4FWS A;  4DLE A;  4H5W A;  1A5V A;  2X78 A;  3SK3 A;  4B08 A;  5ADX A;  4ID1 A;  4BG9 A;  5FDL A;  1DEJ A;  3EE9 A;  5AQY A;  1UA0 A;  1IH7 A;  3BZC A;  3P5J A;  5EXW A;  4JV5 K;  4NYN A;  5BRD A;  1W9H A;  3AO1 A;  4BVO A;  1ATR A;  3LAM A;  3VF6 A;  5BPL A;  4FJL A;  2HVH A;  1TUU A;  4JNE A;  3HT3 A;  1BDG A;  3N4P A;  3T3F A;  3D2E A;  4FK4 A;  3K57 A;  1UA1 A;  1OH8 A;  3BZK A;  1IKV A;  3VQD A;  3MN7 A;  1IG9 A;  3OJS A;  3O3F A;  4FOE A;  4IDH A;  1B9D A;  1EKE A;  3D2F A;  1CZ9 A;  3CM5 A;  3RVC A;  2PY5 A;  2GWK A;  4CEZ A;  2XHB A;  5GAH P;  3TSU A;  3V81 A;  2NZT A;  3V9S A;  3SPZ A;  4CED A;  5FPN A;  4MDA A;  3G10 A;  2F7T A;  3M8P A;  4BRH A;  3VET A;  4FWR A;  2FSN A;  4AHC A;  1C0F A;  5AQW A;  2P9S B;  5J1E A;  4LFC K;  5DK5 A;  4B3M K;  4BDP A;  4Z4F A;  1S1V A;  3NMU A;  4MDB A;  3K59 A;  3CCE N;  4DR1 K;  5CE3 A;  2A42 A;  4H8K A;  3RRG A;  3VEZ A;  3DXM B;  3CFO A;  4ZTF A;  4IBN A;  1HRH A;  4OGC A;  3A0I X;  5AQO A;  4DR3 K;  1RBR A;  1HYZ A;  4IOX A;  3THV A;  4NXM K;  2V52 B;  3O5B A;  2P9N B;  1NWK A;  5AQL A;  1YAG A;  3V4I A;  4IXC A;  1GOA A;  3RR7 A;  2O8D B;  3VEO A;  4BRM A;  1WBD A;  1VSE A;  4LF5 K;  4NXN K;  4FWQ A;  5TKW A;  1TUY A;  2A5X A;  3IS9 A;  3K5M A;  3FE1 A;  5AQK A;  2P1J A;  2HBJ A;  4CHY A;  1XHX A;  4K8X A;  4K41 A;  4KKO A;  1Q18 A;  2D0A A;  1SUQ A;  3I56 N;  4CZH A;  3EYZ A;  1NK6 A;  2BDP A;  1ASW A;  4I9Q A;  4CK3 A;  3OA9 A;  1JCG A;  5AQF A;  4CGG A;  4KH5 A;  3QB0 A;  2KKZ A;  2NRH A;  2A1S A;  4I2P A;  1ZC6 A;  5DM6 L;  5HLF A;  4B9Q A;  1BIU A;  2VG7 A;  3ZX3 A;  4JKC A;  3LWL A;  1HPM A;  3DRS A;  4X62 K;  1R0A A;  3K5L A;  3CPE A;  5GAG P;  4DFK A;  2GEM A;  3SBT A;  3ZEU A;  3O9U A;  4YHH K;  1EQY A;  3THW A;  2E20 A;  4H0P A;  3SMS A;  5KQD A;  3EE8 A;  4YNQ A;  1A5W A;  3KD5 E;  3NH1 A;  1RBU A;  4N76 A;  1W0H A;  4RW8 A;  3EEQ A;  4DLG A;  3CFR A;  2IIR A;  1VHX A;  2WTU A;  1L3S A;  3RRH A;  3B6P A;  3ZT0 A;  1KFS A;  4FJK A;  3VQQ A;  2GEL A;  3KK2 A;  4DTO A;  3BP8 A;  5C2D A;  2NRT A;  3H45 C;  3HSC A;  3L3U A;  2BH1 A;  1ITG A;  1KTQ A;  4IG3 A;  2BAN A;  3HRG A;  5I9E B;  2OZM A;  4DSL A;  3A5M C;  3QIC A;  1EWR A;  4GMJ B;  3M5R A;  4DG1 A;  5SZT A;  3BUZ B;  2FBX A;  3SUO A;  4FWP A;  3NH0 A;  2O8C A;  4E1M A;  5CHI A;  4CHQ A;  4JS4 A;  1T8E A;  3VQ5 A;  3CG7 A;  3KLG A;  3AO4 A;  5KRS A;  4CZJ A;  3THY A;  4E19 A;  1MWK A;  2O8B A;  4FWM A;  4F9O A;  5BN9 A;  3G4S N;  2IVO A;  3S3M A;  4CGF A;  1RBV A;  3HOS A;  4DV2 K;  5J2N A;  1RTD A;  2PZS A;  1YTU A;  3AVH A;  4Z4H A;  5LJV A;  3FZH A;  4MQ3 A;  5M1Q A;  3VN5 A;  2LSN A;  4FYD A;  4YOV A;  3WXK A;  4E3S A;  2YHW A;  3Q7C A;  1NJY A;  2G8U A;  1VSD A;  4KO0 A;  2F9W A;  1VQP N;  2UU9 K;  2VG5 A;  4H5T A;  4H5V A;  1VQ9 N;  3AO3 A;  3HPO A;  3AGR A;  3MWP A;  3RTV A;  3AGK A;  1RIL A;  4A61 A;  4ELV A;  1U4B A;  4BRP A;  2UUA K;  3HYF A;  1D4X A;  4Z4G A;  1BG3 A;  2I5J A;  4M3U A;  2P9U B;  4OLA A;  1RDW X;  5J2P A;  2I7N A;  3MWT A;  1Q86 O;  2A41 A;  3U9Z A;  3AVI A;  4BC4 A;  3V1R A;  4YDU C;  4YDU A;  4O44 A;  3SYZ A;  4LSN A;  4KPY A;  1IBK K;  4DQI A;  3CPW M;  2F8T A;  2GV9 A;  2YKM A;  3ZET B;  3CC7 N;  3QET A;  3CHW A;  1VSI A;  4M42 A;  1NGH A;  3OYI A;  2KHO A;  3H3N O;  4KH6 A;  4H03 B;  1VSJ A;  2X6S A;  3HM8 A;  5C2F A;  1C1A A;  2NRR A;  4JK7 A;  4E7H A;  4AHR A;  4CFA A;  4BRO A;  3WNF A;  2YJF A;  4JI8 K;  1HNV A;  3AVJ A;  4QS9 A;  1WBB A;  1HKG A;  2KLA A;  3MXI A;  1LWE A;  5GIP A;  4BR9 A;  4IG0 A;  3MCP A;  3U6F A;  4E7I A;  4JI0 K;  4CGD A;  3OTO K;  4CEB A;  3C65 A;  4OGE A;  4U67 L;  4PA1 A;  3UE5 A;  1J53 A;  1U49 A;  5JLH A;  2A3Z A;  1NJX A;  1HLU A;  2CGL A;  3CM6 A;  2GX9 A;  3UKR A;  3V6D A;  5I42 A;  2WBN A;  4XH4 A;  4AHT A;  4CBX A;  5JLF A;  5AQR A;  4JAX A;  1VQ7 N;  1VQL N;  4KRE A;  5C25 A;  3ZSX A;  1T05 A;  2HHH K;  1REV A;  3B6O A;  1SQK A;  1DT9 A;  2QXF A;  1TKZ A;  5BPM A;  2WOM A;  2OPQ A;  3JSM A;  4CJK A;  3U3G A;  4RW7 A;  1TKT A;  2P9L B;  4LC9 B;  2VGN A;  1JKH A;  2GUI A;  1QE1 A;  1NM1 A;  3Q7B A;  4CJQ A;  5FPE A;  3D45 A;  4FPA A;  3L2R A;  3CCU N;  3SPY A;  4B1Z A;  3SJJ A;  2XY8 A;  3NF9 A;  4KI4 A;  4RCH A;  1EP4 A;  2QA4 N;  4FK0 A;  4PUO A;  2OTJ N;  3CJ7 A;  1NK4 A;  5BRE A;  4DTN A;  3NF8 A;  4BRE A;  1JCF A;  3RSE A;  3CJA A;  3QER A;  5AQI A;  4B1W B;  2YKN A;  4H5R A;  1KSP A;  2OPS A;  1O1W A;  4DWI A;  3S3O A;  2QW9 A;  3N4Q A;  4KH4 A;  3S3N A;  4H5N A;  5JIC A;  3QIO A;  3QDK A;  4NB4 A;  3DWL A;  1XC9 A;  3ISN C;  2EHG A;  3PIP L;  2KTQ A;  4WYB A;  4BC5 A;  1P90 A;  1VSM A;  1O13 A;  1BOT O;  3CMA N;  4PY5 A;  5KPR A;  3VQP A;  2DY4 A;  2QK9 A;  2CGJ A;  3PX6 A;  3K5N A;  4DUY K;  4EP4 A;  2E2O A;  3VEN A;  1BCM A;  3ZSZ A;  1TL1 A;  4JI1 K;  1OH7 A;  4N47 A;  4Z94 A;  3PUF A;  3KKR A;  4DU3 A;  1D9D A;  1U04 A;  3D7E O;  4NLC A;  5KGW A;  3AA4 A;  4CZG A;  2P5O A;  3I55 N;  5HBM A;  4WCE L;  3ZX2 A;  1Y97 A;  3D2F B;  1NK7 A;  3ZSY A;  4Z4E A;  4JHD A;  4PQU A;  4PWD A;  4CZI A;  3J81 O;  1RBT A;  4NO7 A;  4PL8 A;  3LDS A;  4F8R A;  1MDU B;  4IOA L;  4K8Z A;  1IJJ A;  5BPN A;  5F0X A;  3I8D A;  4OKK A;  1JCE A;  4DCH A;  4GY2 B;  3P38 A;  3H08 A;  4OPH A;  5AQJ A;  4E7J A;  1BHL A;  3T1A A;  4GV9 A;  3ZSV A;  4F2R A;  4CJV A;  1SV5 A;  3OYD A;  3LWM A;  3MK6 A;  4IFV A;  1D8Y A;  2BUP A;  2YX6 A;  2RPI A;  1RTI A;  4B9T A;  3AVN A;  4H4M A;  1Y64 A;  4JI4 K;  3L8B A;  4B3R K;  2Y1I A;  3HL8 A;  3L2V A;  4DV3 K;  1XUP O;  2ASP A;  3VOV A;  1GLC G;  2VGM A;  3TAB A;  4RW6 A;  5LMU K;  3TI0 A;  1KQS M;  1XQS C;  2HHT A;  1YJW N;  2DTU A;  2FSK A;  3KK1 A;  2ZM6 K;  3EZW A;  4KHN A;  2QWN A;  3THX A;  4CK2 A;  3I33 A;  4C1N K;  1RDC A;  2ETJ A;  4B9S A;  3O1B A;  4B1U B;  2JLE A;  3M8S A;  1FXX A;  2AA4 A;  2JGU A;  3O4W A;  4MO5 A;  5F1X A;  2ZD1 A;  4Y1D A;  5C24 A;  3R6M A;  2P9K A;  3SZ2 A;  3O9S A;  3VTH A;  4H0Y B;  2W6K A;  5EOY A;  4DTJ A;  1EET A;  4XEI A;  2GTD A;  3MEG A;  5AZI B;  3CF5 L;  2IC3 A;  3WEE B;  3E9L A;  3CCQ N;  4CHO A;  2O8F B;  2OCE A;  4H0X B;  4IWV A;  4CF8 A;  2HBL A;  3DRR A;  4A2A A;  1BQN A;  2DFE A;  3UKU A;  2QEX N;  3TSP A;  1D9F A;  4CFB A;  2ZJQ L;  2V7Y A;  5M1N A;  5JMV A;  2PYJ A;  3DXK A;  4YOW A;  4O5F A;  4FW1 A;  4IFY A;  4CEO A;  3TAG A;  2ZWH A;  3E9O A;  4JKA A;  2WC9 A;  4OPJ A;  1KAY A;  1QZ6 A;  3L2W A;  1VQ4 N;  3QEV A;  3CJ9 A;  5JVH L;  1IBL K;  4LF8 K;  4JKB A;  3TTD A;  3DYA A;  4AHV A;  1WN7 A;  4Q5V A;  2IGI A;  3RMD A;  1BL3 A;  1NK9 A;  4BR0 A;  1OH5 A;  4BY9 C;  4AQY K;  4FL9 A;  3HBT A;  4W5N A;  3NVK A;  1YF5 L;  3NGY A;  2HF4 A;  1QQO A;  1HQE A;  4KI6 A;  5B8H A;  4UY8 O;  1JL2 A;  4X65 K;  3V9W A;  3OHR A;  3VQ6 A;  1YIJ N;  2A40 A;  3THY B;  2YNG A;  2I7P A;  4CIG A;  4B1Y B;  4JK8 A;  1VQO N;  4B9U A;  4O55 A;  4CJR A;  5CZ1 A;  4BR4 A;  3OYA A;  4KBO A;  4CEE A;  3VQB A;  1M1K O;  1DLO A;  3DLE A;  3KWG A;  1BO5 O;  1ZBH A;  3D0P A;  4J2B A;  1S9G A;  4HWI A;  3KLF A;  3AO2 A;  2HBK A;  4DQP A;  5HRN A;  3FFK B;  3PO5 A;  4DV4 K;  2NRZ A;  4TSX A;  1IG8 A;  1BI4 A;  3KK7 A;  4MLH A;  1YTA A;  3DJC A;  3MEC A;  4AHS A;  4BQZ A;  3SAF A;  3CXC M;  4KB1 A;  3CQ8 A;  1SS6 A;  3E66 A;  1QSL A;  2WUS A;  3MED A;  4ILJ A;  4FJH A;  1GLD G;  1L3U A;  4CJT A;  2RHK A;  1V4S A;  1OVQ A;  5EX5 A;  4GKJ K;  1J5O A;  5AJ3 K;  3G71 N;  1HNX K;  3KTQ A;  2F96 A;  3ID8 A;  1HKB A;  2HNY A;  4DQR A;  4GW6 A;  2ZJP L;  1ZBF A;  2BTF A;  4IEI A;  1FW6 A;  1TKX A;  3C7N B;  5E84 A;  1S1W A;  4KV8 A;  3EKU A;  3QML A;  2R7Y A;  1JLB A;  5GIO A;  2E4L A;  2QKK A;  1I39 A;  5C10 A;  3H1Q A;  1G99 A;  2E1Z A;  3NH2 A;  3ATU A;  4HVJ A;  5M1O A;  5AZJ B;  2Q0R A;  3QIN A;  4ICL A;  4YOT A;  5FRN A;  3M3Z A;  1J5E K;  4IO8 A;  3DLK A;  4BDY A;  4BC3 A;  4RTF D;  1HYS A;  1HQU A;  1LWF A;  4IOC L;  5CR4 A;  5HRP A;  1VQN N;  1TV6 A;  2YV0 X;  1TGO A;  5LL6 Z;  4I6M A;  4J2D A;  5H1S Q;  1JLF A;  2VWJ A;  1HJO A;  4E7K A;  3CCV N;  5AQU A;  5LJW A;  2HST A;  2QWM A;  3IDH A;  4AIL C;  5J2Q A;  3L2U A;  4GNI A;  1WB9 A;  3SQ0 A;  1X9S A;  3AAQ A;  1HKC A;  3TAQ A;  4CZK A;  2UXD K;  1JXE A;  1L5U A;  1YXQ A;  1DKG D;  4DMN A;  3LAL A;  4FLZ A;  4WQ5 C;  4W5R A;  4WQ5 A;  3HP6 A;  2ASO A;  3NAE A;  2Q2R A;  1H1V A;  2O8E A;  3DLH A;  2FLO A;  2D0O A;  1NKE A;  3V9X A;  1CXU A;  4H0O A;  1ZBU A;  2YI1 A;  1GOB A;  1XMO K;  3CQY A;  5E41 A;  4BRA A;  4CF9 A;  3M6G A;  3CC4 N;  3VTI A;  3VQE A;  3TAP A;  2AP1 A;  2Y1J A;  4DHY A;  3EZ5 A;  2PBD A;  1W97 L;  4EP5 A;  1HR0 K;  1NGD A;  1VSF A;  4CJF A;  3AVC A;  1TYQ A;  1LOT B;  3C94 A;  2ZGZ A;  2V7Z A;  1BA0 A;  1K8K A;  3VES A;  3J7Z O;  4OKJ A;  5F2R A;  3I0S A;  2Z1G A;  5FLX O;  4CD3 A;  4CJW A;  3IRX A;  1LAW A;  3F9M A;  1ZYQ A;  3F9K A;  5BRF A;  1NGJ A;  3VER A;  3MXM A;  3CJC A;  4WF9 L;  1QHA A;  2D0B A;  4GV6 A;  3OY9 A;  1GLL O;  1CLQ A;  3LZI A;  4M3Y A;  2RKI A;  5HL7 L;  4DFM A;  1ILY A;  2E2N A;  3QNO A;  2VG6 A;  1K6Y A;  1TL3 A;  3G25 A;  4FWN A;  2ZQB A;  1S6P A;  4JYA K;  3DOL A;  4K43 A;  5C42 A;  4EHU A;  4KHP K;  4JI6 K;  3TTF A;  3KVG A;  3SUN A;  4LFB K;  2VQF K;  1ATS A;  1BCO A;  4DR7 K;  4A62 A;  1X1P A;  3ENB A;  3OVN A;  5BR9 A;  4AM7 A;  3QFP A;  4J2A A;  1DTT A;  3ENO A;  3DOK A;  4M3X A;  3RMB A;  4BWM A;  4QOZ B;  3CJB A;  3OS0 A;  3R9P A;  4YY3 K;  4M45 A;  1IKY A;  5GAD P;  5HRO A;  1SKS A;  2BE2 A;  4WFN L;  2RE2 A;  4CHN A;  4RWT A;  1R59 O;  1SL2 A;  1U2V A;  4CZM A;  4FM1 A;  4FLY A;  3OYN A;  1IBM K;  1X3M A;  2HMP A;  3EO3 A;  4KRF A;  3H46 O;  5C12 A;  3LDP A;  3VA0 A;  4JHD B;  4BE0 A;  5JS1 A;  3EN9 A;  4M3W A;  4Y0W A;  5EU7 A;  4FK2 A;  3NVM A;  1GLE G;  2HHS A;  3O9Q A;  4OPA A;  1IV0 A;  3NF7 A;  1C6V A;  3GE1 A;  4G1Q A;  2OA8 A;  3EL2 A;  2YNF A;  2UUB K;  4N41 A;  4C8M A;  1BA1 A;  4FW2 A;  1ZBL A;  3P1G A;  5AQS A;  2VQE K;  2DFH A;  5AQV A;  4OPK A;  4DV6 K;  4LF7 K;  3QO9 A;  1VSH A;  2KQ2 A;  4HUG A;  2E1Y A;  5DMR A;  3LP1 A;  3IKM A;  3C6U A;  3NFA A;  2IS3 A;  3KWI A;  4Y1C A;  1HYV A;  2QI2 A;  1WSH A;  3CIP A;  1G15 A;  3HP9 A;  2P5G A;  4IKF A;  3ITH A;  3VA3 A;  2HNZ A;  1TK5 A;  1C0U A;  2Q31 A;  3ZT2 A;  4E1N A;  1KCF A;  1M90 O;  2HHX A;  3CI5 A;  4FJI A;  3TU5 A;  3AAR A;  4U7B A;  2FBY A;  4GVM A;  3T7Z A;  4FLU A;  4FM2 A;  2OYQ A;  4JD2 B;  4IO9 L;  3V1O A;  2HBM A;  5AQG A;  4XH1 A;  3O80 A;  3AV9 A;  5JVG L;  5CZ2 A;  3L3V A;  3CCJ N;  2H3G X;  5KPT A;  4DR6 K;  5IT9 O;  4BGB A;  1JJ2 M;  3VF4 A;  1VRU A;  1RT4 A;  1I3A A;  1N36 K;  1YJN N;  4C8L A;  3H6E A;  3I0R A;  1J54 A;  4BRN A;  2Z1H A;  4XH5 A;  1JLG A;  4B8A B;  4IFE A;  1ESV A;  4W5T A;  4HHT A;  4FWO A;  2P9S A;  1VQ5 N;  3O4Q A;  1C1C A;  3CYM A;  1C0T A;  1NK5 A;  3LDL A;  3DXM A;  2Z1I A;  3AVF A;  3SQ2 A;  4CIE A;  4JLH A;  1LAV A;  3AY9 A;  4N56 A;  3SAG A;  1NJW A;  2E2P A;  3A5O C;  5TKY A;  4B1X B;  1QVF M;  3L4I A;  3R3L A;  3WNE A;  3O1W A;  3LDN A;  3O9R A;  2P9N A;  2FBV A;  4CHZ A;  3CCR N;  3FFI A;  1X9J A;  3IAY A;  2QKB A;  4CGI A;  4E89 A;  4DV0 K;  1HNW K;  3HPH A;  2O8D A;  4NCG A;  4CJU A;  4CZL A;  1UAX A;  3NF6 A;  4C8K A;  3LZJ A;  2ZJR L;  3SI6 A;  2P9P B;  3ULE B;  1N32 K;  3CET A;  3KLI A;  4DTR A;  1S3X A;  1Z25 A;  3DLR A;  4JKG B;  3OW2 M;  3J7A P;  1FKP A;  1YHQ N;  2D1K A;  3ZYY X;  1KC8 O;  2G8W A;  3QEX A;  1KFD A;  1NGB A;  3LL3 A;  4M3T A;  2UUC K;  3MN9 A;  5BR8 K;  1SL1 A;  4BWJ A;  2PAV A;  4KHW A;  3WNH A;  3WXM B;  4N5S A;  1S6Q A;  4A5A A;  1NLV A;  2JWL A;  3JS6 A;  3PLA A;  3G0Z A;  1S5J A;  3BF1 A;  4DQ8 A;  3MCA B;  1CXQ A;  1KVA A;  2YHA A;  1FK9 A;  2YCH A;  2F8S A;  1S1T A;  4Z4I A;  2HHU A;  4C8N A;  2NRV A;  3AA3 A;  1VQ6 N;  4C23 A;  3HO1 A;  1B9F A;  2X6N A;  4CJL A;  1Q81 O;  2O4G A;  5AQM A;  1LV5 A;  4Z0U A;  2G8K A;  5AQH A;  1GLB G;  2W41 A;  3ATV A;  1DGK N;  3AVL A;  2FXU A;  4O8U A;  3KK3 A;  3SV3 A;  4B9V A;  1L3V A;  3D2E B;  4LD0 A;  4BC2 A;  3OYF A;  2XY7 A;  1XMQ K;  4H0T B;  3L2Q A;  3L6Q A;  3WNG A;  2IAJ A;  1CZB A;  1WSE A;  3LP2 A;  5AQQ A;  3K2P A;  3ZSQ A;  3OYE A;  2DFF A;  3P4I A;  1RDA A;  3FZL A;  1Q8I A;  2KZZ A;  2G8I A;  3VGL A;  4Z4C A;  1SL0 A;  1OH6 A;  2ZF5 O;  4DR4 K;  4KHS A;  4DKW A;  4B8C A;  3QIP A;  4JK9 A;  3O3H A;  3OYG A;  3ZT4 A;  1K8A O;  3LPT A;  4FLW A;  4JEP A;  3CER A;  2B4J A;  3TR8 A;  2G8H A;  1EO1 A;  4E7L A;  2IVN A;  2KW4 A;  2YHY A;  3LDQ A;  2VWK A;  3MN6 A;  4JN4 A;  4CJ3 A;  3C6H A;  3HTV A;  3WT0 A;  4FVM A;  5EY4 A;  1JLQ A;  1A5X A;  4H4O A;  4LH5 A;  4BGA A;  3W0L A;  4CJS A;  3RMA A;  1KD1 O;  2OZS A;  4DSE A;  2HVI A;  5M1P A;  2KFZ A;  5GIN A;  5FRO A;  4UQG A;  3H1V X;  2IDO A;  4OKE A;  3G6E N;  4DB3 A;  1ZBS A;  3HZ6 A;  4BRK A;  4XIU A;  2P9U A;  3AA2 A;  3KLH A;  2Q1N A;  4ISE A;  5KI6 A;  3E1Y A;  1E4F T;  4FZZ A;  2HF3 A;  4FJM A;  4R5P A;  2NRW A;  4C8O A;  4I7F A;  4QCL A;  3KLE A;  2FF6 A;  4FJ5 A;  3SUQ A;  1JL1 A;  4O0I A;  3QEP A;  4IDK A;  2XRI A;  4NYF A;  4YOY A;  3ZET A;  5LMN K;  1YUW A;  1TYQ B;  4KTZ A;  1EX4 A;  3GG4 A;  4CJ5 A;  2YHB A;  2XY5 A;  3C6T A;  3O4N A;  3ZEU B;  4BE1 A;  5AFU H;  3U9D A;  1Q9X A;  1NJI O;  1JLA A;  3THW B;  4M3R A;  4LF6 K;  4H0V B;  5FPM A;  1T7P A;  1NMD A;  4DU1 A;  4PKG A;  1E4G T;  1C0G A;  5IWA K;  1IO2 A;  2D0P A;  1WOQ A;  3LAN A;  4CE9 A;  1HUX A;  4CES A;  5FPD A;  2A1R A;  4WE1 A;  1V4T A;  4A2B A;  4NCA A;  3FLC O;  4RW9 A;  3HST B;  3TAM A;  3OS2 A;  5JS2 A;  1HMV A;  5K14 A;  1Q82 O;  2UXB K;  3F5T A;  1ASU A;  1NK0 A;  4FJG A;  3KKS A;  3AVB A;  3W3D A;  1RBS A;  2P9I A;  4DFP A;  1C1B A;  4JRQ A;  4PKI A;  1VK0 A;  4GVE A;  3A2F A;  4I2Q A;  3LDO A;  1NJZ A;  2O8C B;  1GLJ O;  2W42 A;  1BUP A;  4ILG B;  4HCB A;  3DAW A;  2HHQ A;  1KVB A;  4ZHR A;  2O8B B;  5CYQ A;  2P9L A;  3NGI A;  1F21 A;  1NBW A;  3T1Y K;  4I9L A;  2OPR A;  1KAZ A;  1HPZ A;  3FZK A;  4E1J A;  4CJ7 A;  5BRH A;  5BN8 A;  4WFA L;  1ZBI A;  4BRL A;  5AFU A;  2W6L A;  3C95 A;  5EVZ A;  3RR8 A;  4FJJ A;  1T6C A;  2D5R A;  4BRG A;  1SAZ A;  4BG8 A;  4DU4 A;  1B92 A;  2OTL N;  1DTQ A;  3J80 O;  3NGZ A;  3A5L C;  1SKR A;  2CH6 A;  2NRX A;  3OYB A;  3O6W A;  2FSJ A;  1KRP A;  3K58 A;  1LCU A;  2EX3 A;  1X9M A;  1W7A A;  2IVP A;  4ELU A;  1TK8 A;  1NGA A;  4AF1 A;  1BU6 O;  3QEW A;  2QWQ A;  3OYK A;  3A8Y A;  4DFJ A;  3AO5 A;  4YOR A;  2QWL A;  4CK1 A;  2ATQ A;  3H3O B;  5FRM A;  1EXQ A;  1ASV A;  3TAF A;  2F9T A;  3ENH A;  2O4I A;  1CZA N;  5MLC Q;  4IEE A;  3ZSO A;  4A59 A;  1XC3 A;  2ITM A;  4IJN A;  1LWC A;  4K42 A;  4DS5 A;  1BIZ A;  1NGC A;  3BGR A;  1S1U A;  4GKK K;  4FZX C;  4DUZ K;  2F4V K;  4OX9 K;  3O9T A;  1RTJ A;  2VCP A;  3TAN A;  2IOC A;  3C6A A;  1RT6 A;  2A6A A;  2UXC K;  3SUP A;  2KZM A;  2GWJ A;  3GL1 A;  3SCX A;  4O5B A;  4OVL A;  2HND A;  4CEQ A;  3TTC A;  4DQQ A;  3HPG A;  3OYH A;  2KFN A;  3TAR A;  3VEY A;  1N8R O;  3DM2 A;  2Q3S A;  2AJQ A;  3IUC A;  2E6M A;  4BAC A;  3HVT A;  3CFP A;  4DTM A;  4FJ8 A;  4FLT A;  5SWM A;  3VMF B;  5M1K A;  4BRF A;  3K9J A;  3UKR B;  1T6D A;  1E3M A;  5AR0 A;  2NNW A;  4B3S K;  1VSK A;  4DSI A;  5M1F A;  3VQ8 A;  5C0Y A;  4DV7 K;  3WXI A;  3NBP A;  3L0Q A;  2QWR A;  1BWF O;  4R79 A;  4F2S A;  3NE6 A;  4DSF A;  3PY8 A;  3BF3 A;  1T3V A;  3PSF A;  1XWL A;  1U47 A;  4CI6 A;  1VQM N;  2Z1J A;  4F3O A;  5KQ8 A;  3U8X A;  3R8E A;  3KJV A;  1RT7 A;  3O08 A;  5AQX A;  5AQN A;  2VYP A;  1KAX A;  2GBZ A;  4CEF A;  4DF4 A;  3P83 D;  3PV8 A;  4C1N I;  3ALY A;  3WXL A;  3K9K A;  3CCS N;  3V9U A;  3SQ1 A;  3M8Q A;  5I3U A;  4WFB L;  4LFA K;  4ID5 A;  4W5Q A;  3TAE A;  5AZI A;  3RSE B;  2V51 B;  1NMN A;  3JYT A;  3WEE A;  3EKS A;  3AAP A;  2O8F A;  5AQT A;  1J9A A;  2BGG A;  1NGF A;  3RWU A;  1QZ5 A;  1IKX A;  3OYL A;  4BRQ A;  4DS4 A;  3CQX A; 
#chains in the Genus database with same CATH homology
 3LWM A;  3O4Q A;  4IFV A;  1D8Y A;  1UA0 A;  1C1C A;  1IH7 A;  2RPI A;  3P5J A;  3CYM A;  1C0T A;  1NK5 A;  1RTI A;  4NYN A;  2Z1I A;  3AVF A;  3SQ2 A;  1NKB A;  4B9T A;  4CIE A;  3LP0 A;  1JLC A;  4JLH A;  1LAV A;  3AVN A;  4OJR A;  4H4M A;  4N56 A;  1NJW A;  1W9H A;  3AO1 A;  3OYJ A;  3L8B A;  2WON A;  1NOZ A;  2Y1I A;  3LAM A;  3WNE A;  3HL8 A;  3L2V A;  1TAU A;  3ULD A;  4FJL A;  2FBV A;  4CHZ A;  1RNH A;  2HVH A;  4HCC A;  3FFI A;  4RW6 A;  3TAB A;  3ZSR A;  4CGI A;  3TI0 A;  1RT5 A;  3IAY A;  2QKB A;  2HHT A;  4E89 A;  2DTU A;  1XHZ A;  3HT3 A;  3HPH A;  1WAF A;  3MXJ A;  4NCG A;  4CJU A;  3KK1 A;  4KHN A;  1UAX A;  3NF6 A;  4C8K A;  3LZJ A;  3T3F A;  4CK2 A;  3SI6 A;  4KB0 A;  3LAK A;  4DSK A;  1RDC A;  2ETJ A;  4B9S A;  3K57 A;  4HUF A;  4FK4 A;  2JLE A;  1WSJ A;  3M8S A;  1FXX A;  2XO7 A;  1UA1 A;  2JGU A;  3KLI A;  4DTR A;  1IKV A;  1Z25 A;  3DLR A;  3VQD A;  1HJR A;  1IG9 A;  2FC0 A;  2ZD1 A;  4Y1D A;  5C24 A;  3OJS A;  3O3F A;  1Z26 A;  1D5A A;  1B9D A;  1EKE A;  1FKP A;  4AHU A;  1CZ9 A;  3CM5 A;  3SZ2 A;  3OYM A;  3LPU A;  4CF2 A;  2G8W A;  2PY5 A;  4FJ9 A;  4CEZ A;  2XHB A;  3QEX A;  1QS4 A;  4DTJ A;  1KFD A;  1EET A;  3V81 A;  4M3T A;  3QEI A;  3PX0 A;  5T7B A;  3MEG A;  3V9S A;  3SPZ A;  1N6Q A;  1SL1 A;  4BWJ A;  2IC3 A;  4CED A;  4MFB A;  4KHW A;  3WNH A;  4N5S A;  1S6Q A;  3G10 A;  4FZY A;  3M8P A;  4CHO A;  4DF8 A;  4CF8 A;  3DRR A;  4L8R B;  1S9E A;  4AHC A;  1BQN A;  3G0Z A;  1S5J A;  5DK5 A;  4CFC A;  5J1E A;  1WNS A;  2DFE A;  4BDP A;  4Z4F A;  1S1V A;  1D9F A;  1CXQ A;  4CFB A;  1KVA A;  2YHA A;  4FJX A;  1FK9 A;  2F8S A;  3K59 A;  4J2E A;  1S1T A;  1N5Y A;  4BDZ A;  2PYJ A;  4Z4I A;  3IG1 A;  4H8K A;  3RRG A;  3CFO A;  4FW1 A;  4CJV A;  4ZTF A;  4IBN A;  2HHU A;  4IFY A;  1HRH A;  4CEO A;  3TAG A;  4C8N A;  4OGC A;  4DTU A;  3AA3 A;  4OPJ A;  1RBR A;  3HO1 A;  1LW0 A;  1B9F A;  2X6N A;  1HYZ A;  4CJL A;  3THV A;  3L2W A;  2O4G A;  1LV5 A;  4Z0U A;  2G8K A;  3V4I A;  4CFD A;  3QEV A;  3TWH A;  4DQS A;  4F4K A;  1GOA A;  3AVL A;  3HXM A;  3HK2 A;  3RR7 A;  3KK3 A;  3OYC A;  3SV3 A;  4B9V A;  1L3V A;  3DYA A;  1RT2 A;  4AHV A;  1WN7 A;  4CJ4 A;  1VSE A;  4EZ6 A;  4LD0 A;  3OYF A;  2YNH A;  2XY7 A;  4Q5V A;  2IGI A;  3RMD A;  1BL3 A;  1QQC A;  1NK9 A;  1NK8 A;  3L2Q A;  3WNG A;  2IAJ A;  3IS9 A;  1CZB A;  3LP3 A;  1WSE A;  3K5M A;  1BQM A;  3LP2 A;  1XI1 A;  3NGY A;  3K2P A;  4O4G A;  3KD1 E;  2P1J A;  4CHY A;  1HQE A;  1XHX A;  4K8X A;  4KI6 A;  3ZSQ A;  3OYE A;  4KKO A;  2DFF A;  3F73 A;  2D0A A;  1RDA A;  1SUQ A;  1Q8I A;  2KZZ A;  1S1X A;  2G8I A;  2PYL A;  3EYZ A;  1JL2 A;  1NK6 A;  2BDP A;  1ASW A;  4I9Q A;  4Z4C A;  1SL0 A;  3V9W A;  3SV4 A;  3VQ6 A;  4CK3 A;  4KHS A;  4B8C A;  2YNG A;  3QIP A;  4CGG A;  3O3H A;  4FXD A;  4CIG A;  3OYG A;  3ZT4 A;  3LPT A;  4FLW A;  4B9U A;  2XY6 A;  2B4J A;  3ASM A;  2A1S A;  4I2P A;  4O55 A;  4CJR A;  3TR8 A;  2G8H A;  5HLF A;  2HHW A;  5CZ1 A;  2FBT A;  1BIU A;  2VG7 A;  3OYA A;  4E7L A;  4CEE A;  3LWL A;  2KW4 A;  1UOC A;  3VQB A;  3ZT3 A;  1DLO A;  3DRS A;  3DLE A;  1R0A A;  3K5L A;  2VWK A;  5KTQ A;  4DFK A;  3AVK A;  4CJ3 A;  3SQ4 A;  3D0P A;  4J2B A;  1ZBH A;  1S9G A;  3NHG A;  4FVM A;  3NCI A;  1JLQ A;  4KAZ A;  3KLF A;  1A5X A;  1BGX T;  4H4O A;  3AO2 A;  4LH5 A;  4CJS A;  3RMA A;  4DQP A;  5HRN A;  2OZS A;  4B9L A;  4DSE A;  3PO5 A;  1RDB A;  3DLG A;  4TSX A;  1A5W A;  4YNQ A;  1TKD A;  3KD5 E;  1BI4 A;  4KB1 A;  2HVI A;  1YTA A;  3T19 A;  3MEC A;  4AHS A;  3NH1 A;  2KFZ A;  1RBU A;  2HW3 A;  2RF2 A;  3CQ8 A;  1W0H A;  4RW8 A;  2ITG A;  4N76 A;  5FRO A;  4F3T A;  4DLG A;  3CFR A;  4UQG A;  1QSL A;  2ZE2 A;  3DI6 A;  1L3S A;  4NCB A;  3MED A;  3RRH A;  3B6P A;  3ZT0 A;  1KFS A;  4FJH A;  3VQQ A;  4FJK A;  1L3U A;  4CJT A;  3KK2 A;  4DTO A;  2IDO A;  4OKE A;  1J5O A;  3KTQ A;  3L3U A;  2F96 A;  2HB5 A;  2HNY A;  4DQR A;  1ITG A;  1KTQ A;  4GW6 A;  1HNI A;  4IG3 A;  2BAN A;  1ZBF A;  4AH9 A;  1TKX A;  3VQC A;  1FKO A;  4XIU A;  1NOY A;  1S1W A;  4KV8 A;  3HM9 A;  2OZM A;  3AA2 A;  3KLH A;  4DSL A;  4GMJ B;  5KI6 A;  5SZT A;  4DG1 A;  2R7Y A;  1JLB A;  2QKK A;  2E4L A;  4FZZ A;  1I39 A;  5KGX A;  4FJM A;  2FBX A;  4R5P A;  3SUO A;  3RMC A;  3NH0 A;  4E1M A;  4I7F A;  4C8O A;  4CGH A;  3ZSW A;  4CHQ A;  4BE2 A;  4QCL A;  1YT3 A;  3NH2 A;  3KLE A;  4JS4 A;  4CJE A;  1T8E A;  3BDP A;  2E6L A;  4FJ5 A;  4HVJ A;  3SUQ A;  1JL1 A;  5CY4 A;  3VQ5 A;  4CJP A;  3CG7 A;  4IDK A;  2XRI A;  3AO4 A;  4NYF A;  4O0I A;  1TVR A;  3KLG A;  3K5O A;  5KRS A;  3PX4 A;  4E19 A;  1JLE A;  3QIN A;  4B9M A;  4ICL A;  4KTZ A;  4JS5 A;  5FRN A;  3DLK A;  4BDY A;  2OPP A;  1EX4 A;  4CF0 A;  5D3G A;  2P51 A;  4CJ5 A;  1HYS A;  1HQU A;  1LWF A;  2YHB A;  2XY5 A;  3M8R A;  3S3M A;  3C6T A;  4CGF A;  4LY7 A;  5HRP A;  4FCY A;  1RBV A;  2B6A A;  3O4N A;  1C0M A;  1TV6 A;  1TGO A;  1VSL A;  1RCH A;  2YV0 X;  4KFB A;  4J2D A;  5J2N A;  1RTD A;  2PZS A;  2VWJ A;  1JLF A;  4DTP A;  1YTU A;  3AVH A;  4Z4H A;  4E7K A;  3SNN A;  4MQ3 A;  3VN5 A;  4BE1 A;  2LSN A;  4FYD A;  1Q9X A;  1JLA A;  4M3R A;  4AIL C;  1QHT A;  5J2Q A;  1T7P A;  4HUE A;  3L2U A;  4DU1 A;  4E3S A;  5HP1 A;  1BI4 B;  3SQ0 A;  1X9S A;  3TAQ A;  1NJY A;  1JXE A;  1T03 A;  1L5U A;  2G8U A;  1VSD A;  1IO2 A;  4KO0 A;  1TAQ A;  3VQ4 A;  4DMN A;  3LAL A;  4O0J A;  3LAN A;  4FLZ A;  2VG5 A;  4W5R A;  4CE9 A;  3HP6 A;  1WSG A;  4CES A;  3NAE A;  3AO3 A;  4CER A;  3HPO A;  2A1R A;  1QSY A;  4WE1 A;  3DMJ A;  3RTV A;  3DLH A;  4NCA A;  1NKE A;  4RW9 A;  3V9X A;  1RIL A;  3HST B;  1CXU A;  3TAM A;  4ELV A;  1U4B A;  3OS2 A;  5JS2 A;  1HMV A;  3HYF A;  1ZBU A;  1WSI A;  5K14 A;  1GOB A;  4Z4G A;  2I5J A;  4M41 A;  4M3U A;  1ASU A;  5E41 A;  1NK0 A;  4FJG A;  4CF9 A;  3KKS A;  3AVB A;  4EZ9 A;  1RBS A;  4DTX A;  4DFP A;  1C1B A;  3VQE A;  4JRQ A;  4DTS A;  3TAP A;  4CHP A;  4OLA A;  3VQA A;  1VK0 A;  5J2P A;  4RW4 A;  3A2F A;  4I2Q A;  4KTQ A;  3AVI A;  1NJZ A;  2Y1J A;  3EZ5 A;  2W42 A;  3V1R A;  4O44 A;  3SYZ A;  1RTH A;  4HCB A;  4LSN A;  4KPY A;  4DQI A;  4EP5 A;  2F8T A;  4RG8 A;  1KVB A;  2GV9 A;  2HHQ A;  2YKM A;  4ZHR A;  3O3G A;  5HRS A;  1VSF A;  4CJF A;  3AVC A;  5CYQ A;  3QET A;  3NGI A;  2G8V A;  1F21 A;  1VSI A;  4M42 A;  4OLB A;  4ELT A;  3C94 A;  4B3O A;  3DLB A;  1UWB A;  3OYI A;  4QAG A;  3HJF A;  4I9L A;  2OPR A;  4Q0B A;  1HPZ A;  1RDD A;  4OKJ A;  1VSJ A;  2X6S A;  3I0S A;  1C1A A;  3AVA A;  1U48 A;  2Z1G A;  4E7H A;  4AHR A;  4CJW A;  4CFA A;  1ZBI A;  3WNF A;  1QTM A;  3IRX A;  3C95 A;  4CEA A;  1LAW A;  3RR8 A;  4FJJ A;  1HNV A;  2D5R A;  3AVJ A;  1WLJ A;  1ZYQ A;  3F9K A;  4KHQ A;  4KHY A;  4DU4 A;  1B92 A;  3OJU A;  3MXI A;  4CF1 A;  1LWE A;  4FM0 A;  4IG0 A;  1DTQ A;  3U6F A;  3NGZ A;  3MXM A;  4KHU A;  1SKR A;  4E7I A;  2D0B A;  4CGD A;  4CEB A;  3EY1 A;  3OY9 A;  4OGE A;  3OYB A;  1CLQ A;  1KVC A;  4PA1 A;  3LZI A;  4M3Y A;  1J53 A;  2RKI A;  3K58 A;  2YNI A;  4DFM A;  1U49 A;  1KRP A;  4W5N A;  1NJX A;  3QNO A;  3S9H A;  3CM6 A;  5HRR A;  2VG6 A;  1K6Y A;  1TL3 A;  2EX3 A;  3V9Z A;  1X9M A;  3V6D A;  5I42 A;  4ELU A;  2ZQB A;  4CGJ A;  1TK8 A;  1S6P A;  4M3Z A;  3DOL A;  5C42 A;  3QEW A;  2G8F A;  4AHT A;  1L3T A;  3HVR A;  3KIO A;  3SUN A;  4FJ7 A;  3OYK A;  4DFJ A;  3AO5 A;  1KLM A;  4CK1 A;  4KRE A;  2ATQ A;  5J2M A;  1RT1 A;  1BCO A;  1EXQ A;  5FRM A;  1ASV A;  1X1P A;  2HHV A;  3OVN A;  3AA5 X;  5C25 A;  3ZSX A;  3TAF A;  1T05 A;  4J2A A;  1DTT A;  3DOK A;  2B5J A;  4FLV A;  4M3X A;  1REV A;  3RMB A;  2O4I A;  3ZSO A;  3UIQ A;  3B6O A;  4BWM A;  4QOZ B;  2QXF A;  1TKZ A;  2WOM A;  3OS0 A;  2OPQ A;  3JSM A;  1LWC A;  3U3Y A;  4M45 A;  4CJK A;  1IKY A;  4DS5 A;  1BIZ A;  3U3G A;  4RW7 A;  1TKT A;  2X74 A;  3BGR A;  1S1U A;  3ZT1 A;  4FZX C;  3VQ7 A;  1JKH A;  2GUI A;  1QE1 A;  5HRO A;  4CJQ A;  2BE2 A;  3D45 A;  1SKS A;  3L2R A;  3SPY A;  3VQ9 A;  1RTJ A;  4CHN A;  4KTW A;  4FJN A;  1SL2 A;  3TAN A;  1QSS A;  2IOC A;  1RT6 A;  3SJJ A;  2XY8 A;  3NF9 A;  4FM1 A;  4KI4 A;  4FLY A;  3OYN A;  1EP4 A;  4FK0 A;  4PUO A;  3SUP A;  2KZM A;  4KRF A;  3VA0 A;  3SCX A;  1NK4 A;  4LH4 A;  4BE0 A;  4O5B A;  1VRT A;  4OVL A;  3ZCM A;  5JS1 A;  4DTN A;  4M3W A;  3NF8 A;  2HND A;  5EU7 A;  4CEQ A;  4FK2 A;  2HHS A;  1RT3 A;  1WSF A;  1X9W A;  3NF7 A;  1C6V A;  4G1Q A;  3OYD A;  4DQQ A;  3QER A;  3HPG A;  3OYH A;  2OA8 A;  2KFN A;  2RN2 A;  2YNF A;  3TAR A;  2YKN A;  1KSP A;  4LSL A;  4N41 A;  2OPS A;  4C8M A;  1O1W A;  4DWI A;  3DM2 A;  2Q3S A;  1U45 A;  2AJQ A;  3S3O A;  4BAC A;  2E6M A;  4ZTJ A;  3OS1 A;  4FW2 A;  1ZBL A;  2HMI A;  3P1G A;  3HVT A;  3CFP A;  4DTM A;  3S3N A;  4B9N A;  4FJ8 A;  4FLT A;  3QIO A;  5SWM A;  3QNN A;  3NDK A;  2DFH A;  1XC9 A;  3ISN C;  5CYM A;  2EHG A;  4OPK A;  4YFU A;  1KLN A;  4DSJ A;  1VSK A;  2KTQ A;  4DSI A;  1YVU A;  1VSM A;  2NUB A;  3VQ8 A;  3QO9 A;  1VSH A;  2KQ2 A;  4HUG A;  4CIF A;  4PY5 A;  5DMR A;  1GOC A;  3LP1 A;  3NBP A;  3VQP A;  3NFA A;  3C6U A;  4CCH A;  2IS3 A;  4E0D A;  2QK9 A;  2DY4 A;  3PX6 A;  3QEP A;  4Y1C A;  1HYV A;  3K5N A;  3PO4 A;  4EP4 A;  1WSH A;  1LW2 A;  4F2S A;  1G15 A;  3HP9 A;  1BCM A;  2P5G A;  3NE6 A;  4DSF A;  4IKF A;  4FLX A;  3ITH A;  3PY8 A;  3VA3 A;  1JXB A;  2HNZ A;  3ZSZ A;  1TL1 A;  1TK5 A;  1C0U A;  3ZT2 A;  1XWL A;  1BIS A;  1U47 A;  4E1N A;  1TK0 A;  4N47 A;  1KCF A;  3PUF A;  3KKR A;  4DU3 A;  2Z1J A;  2D0C A;  1D9D A;  4W5O A;  1U04 A;  2HHX A;  4F3O A;  3AVG A;  4FJI A;  4JRP A;  5KGW A;  3AA4 A;  3KJV A;  2P5O A;  3E01 A;  1RT7 A;  3QES A;  3QLH A;  1Q9Y A;  2FBY A;  4GVM A;  1NKC A;  4FLU A;  3AVM A;  3DRP A;  4FM2 A;  2OYQ A;  5HBM A;  4CEC A;  3V1O A;  1Y97 A;  5KRT A;  1NK7 A;  3ZSY A;  1WAJ A;  3AV9 A;  4Z4E A;  2GBZ A;  4CEF A;  4DF4 A;  3P83 D;  5CZ2 A;  3L3V A;  3PV8 A;  4PQU A;  3ALY A;  3V1Q A;  1SKW A;  3MAQ A;  3V9U A;  3SQ1 A;  4PWD A;  3M8Q A;  5I3U A;  1RBT A;  1VRU A;  1RT4 A;  4ID5 A;  4W5Q A;  1MU2 A;  3TAE A;  1IKW A;  3LDS A;  4F8R A;  1I3A A;  3MEE A;  3JYT A;  4K8Z A;  4C8L A;  4HTU A;  3I0R A;  4DLE A;  1J54 A;  3I8D A;  4OKK A;  2Z1H A;  1JLG A;  4B8A B;  1A5V A;  2X78 A;  3H08 A;  4W5T A;  1J9A A;  2BGG A;  4E7J A;  1BHL A;  3T1A A;  4B08 A;  4HHT A;  3RWU A;  4DS4 A;  1IKX A;  3OYL A;  3ZSV A;  4F2R A;  4ID1 A;  1SV5 A;  5FDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...