4TSXA

Hiv-1 integrase catalytic core domain mutant complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
143
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPESMNKELKKIIGQVRDQAETLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Integrase
publication title The mechanism of H171T resistance reveals the importance of N -protonated His171 for the binding of allosteric inhibitor BI-D to HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 143
sequence length 155
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4tsxA00
4AILC 1UA0A 1IKWA 4DFJA 3OYCA 1BISA 1NOZA 4CGHA 4IG0A 1J5OA 4E1MA 1Q8IA 2G8KA 2F8SA 3P5JA 4PWDA 3UIQA 2BE2A 4IFVA 4HUEA 3RMAA 3QEPA 1C1CA 1BQNA 4I2QA 5DK5A 2XHBA 5HRRA 4KB0A 4KI4A 1WSFA 1GOCA 4Q0BA 4DSFA 3B6PA 1KTQA 4K8XA 2HVIA 5I3UA 4LH5A 3L2WA 3I0SA 3I8DA 1YTUA 2YNGA 5DMRA 3TWHA 1N5YA 2AJQA 4FCYA 2X74A 4BE1A 2HHQA 4Z4IA 1LWFA 1RTHA 4H4MA 1C1AA 1LW2A 1NK9A 2DFHA 4O44A 3NHGA 1EP4A 2EX3A 3L3UA 3OYLA 3L2RA 2HHWA 4YNQA 4CJRA 3TAGA 4BDPA 3M8SA 4NCGA 4TSXA 1RDCA 4F4KA 3IG1A 3V1RA 3ASMA 1T05A 1KLMA 1L3UA 4FLUA 4DSKA 3L2QA 4B3OA 3SUNA 1RTDA 4B9TA 4W5OA 4C8OA 2Z1IA 1TKZA 4OPKA 2XY5A 1D8YA 4B9UA 2RPIA 3BDPA 4FJIA 4FJHA 1JLCA 1S9GA 2VG6A 3C95A 3M8RA 5C42A 1TGOA 1ZBFA 4DQQA 1U49A 1NKBA 1S6QA 2YKMA 5KI6A 1A5XA 1HNVA 1HQEA 1UOCA 3MXIA 2PYLA 4W5NA 4AHRA 5E41A 4DQRA 5FRNA 3VQEA 3KIOA 5HRNA 3HXMA 3RMCA 3PV8A 3QO9A 3DLRA 4CFDA 4ELTA 3QERA 4AHSA 3QNNA 4KO0A 1MU2A 4DFKA 1S1VA 4DTUA 4NYFA 4GW6A 3NGIA 3PX4A 4AHCA 3LZIA 4FJKA 1SUQA 5K14A 3NGYA 3SYZA 4CESA 2YV0X 4O5BA 1RBRA 4RW8A 4KHUA 3PUFA 4DTJA 4CEOA 4O0JA 4NCAA 4OJRA 1VRUA 1JLGA 5KGWA 1JLQA 5HRPA 1TL1A 3HJFA 4DSJA 4UQGA 1RT2A 3CM6A 4FZYA 3S9HA 4OPJA 4QCLA 4Y1CA 1NKEA 3O4QA 2B4JA 4E7KA 4FJ8A 4QOZB 2HVHA 4B08A 2G8HA 1NKCA 3D45A 2KZZA 1KFSA 2FBYA 4DU3A 3LAMA 1BCMA 1WAJA 2E4LA 2QK9A 3AO3A 3DYAA 1ASVA 3P1GA 1LAWA 2NUBA 3DLKA 3SUQA 4J2EA 4FJ5A 4ICLA 3AA5X 1WN7A 2IGIA 3MXJA 4FW1A 4CIEA 3QEWA 3HP9A 1I39A 2DFEA 4C8NA 4B9SA 2XY6A 3V9ZA 1C0TA 1DTQA 3DOLA 3AVMA 3AVNA 1TKXA 4KFBA 4FLYA 1T8EA 4DTNA 4CGGA 1C1BA 5J2PA 3C6UA 3HPHA 4CGFA 4DS5A 2VG7A 3LPUA 4CF8A 1D5AA 2HB5A 4CJEA 1XWLA 3NE6A 3KK1A 4C8MA 1LAVA 2RF2A 3LP2A 1UWBA 2ETJA 4O55A 2A1SA 3OYGA 4B8CA 4M3YA 2YNFA 1A5VA 3OVNA 4DTPA 1QSLA 2G8UA 3BGRA 3ZT0A 1R0AA 3KLEA 5CY4A 4CJ5A 3DM2A 3VQPA 3O3FA 1IH7A 3S3OA 2GV9A 1CZ9A 3AA2A 4DTRA 1S1WA 1J53A 4CJQA 4CJKA 1RDBA 4W5QA 3OJSA 2W42A 3RMBA 1JL2A 4FLZA 4DQSA 4I9QA 3ISNC 5FRMA 1RBTA 3AVLA 3ZSQA 2GUIA 3ZT1A 5T7BA 4M3RA 2OZMA 4EZ6A 1FK9A 1WLJA 3DOKA 3NF7A 4CJSA 1IO2A 1JLBA 2LSNA 4DF8A 4IKFA 2KZMA 2G8IA 4CK3A 4CEEA 3DI6A 3KK2A 3WNGA 4R5PA 4JS4A 1NK8A 4CJ4A 3RR8A 1VSHA 1NK4A 1Y97A 1NJWA 2X6NA 1HRHA 1TK8A 3AVGA 1C0UA 2ATQA 3AVFA 3P83D 3OYNA 3IRXA 1RT7A 3HPGA 2E6LA 4CF1A 4DLEA 4BE2A 4FLWA 4FLVA 2PZSA 3LDSA 1J54A 1TVRA 1HPZA 3RTVA 4RW6A 3LPTA 3OYDA 5CZ2A 3OYFA 2QKKA 3LANA 3MECA 4FJLA 4DTXA 1SL1A 4PY5A 4ZTJA 4Z4CA 4FM0A 1L5UA 4KB1A 4RW7A 4LSNA 2WOMA 4FJ9A 1GOBA 3PO4A 1F21A 5JS1A 4BACA 2HHTA 1RCHA 3EY1A 4KPYA 1XI1A 3RR7A 2HHUA 1Z26A 3QNOA 1L3SA 3OS0A 3ZSZA 3C94A 3JSMA 3DLHA 1RNHA 4AHUA 3ZT2A 3QINA 3K2PA 3K5NA 2B5JA 4CIFA 3SUOA 1FKOA 4N56A 4CHPA 2ZE2A 1VSMA 4PA1A 3HM9A 1NK0A 2HNYA 4N41A 1ZBIA 4FJ7A 2P1JA 3LWMA 2JGUA 3NF8A 4I9LA 3SPYA 2KFNA 3KLHA 1NJZA 4CERA 3NDKA 4HTUA 1NOYA 1C6VA 4OVLA 3CFOA 3K5LA 3CFRA 3OYIA 4PQUA 3WNHA 4NYNA 3HYFA 4E1NA 2R7YA 1BGXT 3AO4A 3ZSWA 3AA3A 2O4IA 3RRGA 4CFCA 1NK5A 3QLHA 3NH2A 3EZ5A 1ZBLA 4Z4HA 4FK2A 2ZQBA 4CJVA 4YFUA 1ZYQA 2X78A 3PX0A 4FJXA 1B9FA 2FBXA 3CG7A 1RT4A 3C6TA 1TK5A 2G8WA 1QHTA 2RKIA 3SCXA 1RT5A 4DMNA 2HNZA 4AHTA 4BWJA 4CHOA 4E0DA 4OKKA 3SQ1A 1T03A 4DQPA 3OYKA 3MEDA 1TAQA 3ZT4A 4I2PA 3WNEA 3TANA 3OS2A 3V4IA 4AHVA 1VSEA 2YKNA 3AA4A 2I5JA 3OYMA 1N6QA 1YT3A 4KV8A 4NCBA 2ITGA 4F8RA 2OPQA 4HUFA 1RDAA 4FW2A 3PY8A 3OYEA 4FK0A 4DFPA 4FK4A 4KI6A 2DTUA 3K59A 2VG5A 1X1PA 4FLTA 4F3OA 3NBPA 1BL3A 1QE1A 1ZBUA 3DMJA 1VSDA 1SKRA 3TAEA 3MXMA 1HYZA 3L8BA 3RRHA 1CZBA 3SNNA 4KHYA 3K5OA 3WNFA 3KJVA 3QEIA 4KHSA 3SUPA 3O4NA 2YNHA 4F3TA 2P5GA 4F2SA 4CJ3A 3G10A 1S6PA 3U3GA 3TAFA 3HO1A 3KK3A 2D0AA 2KFZA 1VSKA 2P5OA 4WE1A 4FJGA 4KTQA 4IG3A 1KSPA 1JKHA 2PYJA 4DU4A 2Z1JA 4EP4A 1U48A 2VWJA 4KHQA 4LY7A 1SKWA 4ZTFA 1ZBHA 5HRSA 1VSFA 5C25A 2X6SA 5CYQA 3AO1A 3LP1A 3NF9A 2D0CA 4O0IA 4Z4GA 1C0MA 4JLHA 5CZ1A 1WSGA 4BWMA 3IS9A 4E7HA 4ELVA 2G8VA 4IBNA 4ID5A 3V6DA 1SL0A 1VSLA 4DQIA 5SWMA 3NCIA 3CYMA 2HHVA 1B9DA 3SZ2A 1BQMA 1GOAA 1HQUA 3V9WA 4JRQA 2DY4A 1RBUA 4F2RA 4DSLA 3HP6A 3TI0A 4FM2A 3NH0A 4N47A 4DS4A 1J9AA 4CEDA 2XO7A 3NAEA 3VQ5A 2KW4A 4DLGA 3OYHA 3HL8A 4DTMA 4M3TA 3ZCMA 1HYSA 2E6MA 4G1QA 3O3HA 3ULDA 2Q3SA 3PX6A 3QETA 3SQ0A 4HCCA 4FZXC 4OKJA 5CYMA 2IDOA 1FKPA 3ZSOA 2A1RA 3QIPA 4L8RB 3DRRA 2BGGA 3DLEA 3MEEA 4FM1A 1BI4A 1W9HA 2YNIA 4BE0A 3VQ9A 3B6OA 1KVBA 4E3SA 5J2MA 4KHNA 4C8KA 1LWCA 3TABA 3LALA 3SJJA 3KLGA 3VQDA 1IG9A 4RW9A 1QSYA 3K58A 3NGZA 3L2VA 1WAFA 2Z1GA 3T1AA 4LSLA 4BDZA 5J2QA 2PY5A 4OLAA 4CGJA 1VSJA 4DF4A 5C24A 1TV6A 4HCBA 3JYTA 4N76A 2F8TA 4MQ3A 1X9MA 3HVTA 3QEVA 3KD5E 4DTOA 3L2UA 2KTQA 1RTIA 4XIUA 1ASUA 1WSHA 4CK1A 1JLFA 4KTZA 1UAXA 3AVAA 4DTSA 4CFBA 3QEXA 4CECA 2G8FA 2D5RA 3OYBA 4KHWA 4CHZA 2JLEA 4E89A 4N5SA 3DRPA 2IS3A 3A2FA 1A5WA 1G15A 3D0PA 4M3ZA 2Y1IA 1VSIA 4CJTA 3TAPA 3TAQA 4CJPA 3QESA 4EZ9A 1EKEA 1KVAA 3VN5A 1JL1A 3LWLA 1WNSA 1K6YA 3VQCA 1X9WA 2YHAA 4B9VA 1UA1A 4KTWA 1ITGA 4J2AA 3VQAA 1BIUA 3SPZA 1HYVA 4FZZA 1JLAA 2B6AA 4Q5VA 3HVRA 5D3GA 3AVHA 1RTJA 3NFAA 4OKEA 4M41A 4CGIA 3H08A 1JLEA 2RN2A 3OY9A 4GVMA 4RG8A 3EYZA 1BHLA 5I42A 1Q9XA 4C8LA 4OGCA 5HLFA 1SKSA 2FBVA 4I7FA 4JRPA 1U45A 4GMJB 3T3FA 1CXUA 5KGXA 3S3NA 5KTQA 3HT3A 3U6FA 5KRTA 3K5MA 2OA8A 4CF2A 5JS2A 4KKOA 4CJWA 1VRTA 5HROA 5EU7A 3TAMA 1I3AA 4DG1A 1KCFA 4CFAA 1ASWA 3SV3A 4CCHA 4OLBA 3OYJA 5KRSA 4M3XA 1BIZA 4CHYA 3OYAA 4DSIA 3S3MA 1NK6A 1TL3A 3FFIA 1NK7A 4CIGA 4IFYA 2WONA 4HHTA 4CEZA 1IKXA 4LD0A 3ZT3A 1WSIA 4HVJA 1TKTA 3AVBA 1REVA 1RBVA 4KRFA 2HW3A 1Z25A 1WSEA 1NJXA 4FVMA 1B92A 4IDKA 5FROA 3DLGA 4CK2A 1JXBA 3VA3A 4B8AB 3K57A 4FJMA 2OZSA 3HSTB 3O3GA 4KREA 1U4BA 1L3TA 4W5RA 3ZSVA 3M8PA 5J2NA 4DSEA 2F96A 1QS4A 4PUOA 3KLFA 3LP3A 4CJLA 2BDPA 5HP1A 4FYDA 2HHXA 4CF0A 4E7JA 2VWKA 3AVKA 3MAQA 1TKDA 1RT6A 3THVA 1LV5A 1X9SA 3CM5A 4ID1A 3V81A 1FXXA 2XY8A 3AVIA 3QIOA 4CGDA 2FC0A 3KKRA 2O4GA 3RWUA 3VQQA 4CEQA 4FLXA 3KKSA 3F9KA 3LP0A 2Y1JA 1QTMA 4BDYA 1U47A 2GBZA 1RT3A 4CF9A 1U04A 2ZD1A 4M45A 3OS1A 1YTAA 1RT1A 2QXFA 4QAGA 4CEBA 3ALYA 4OGEA 1VK0A 3KTQA 2BANA 3V9UA 1XHZA 3I0RA 3VQBA 3ZSRA 2OPPA 3E01A 4Z4EA 4E7IA 5J1EA 4Z4FA 2OPRA 1CXQA 2IC3A 2FBTA 4LH4A 4E7LA 4CHNA 1DTTA 3HK2A 4J2BA 1KVCA 3DRSA 1S1TA 4H4OA 4O4GA 3VQ8A 4DFMA 4FXDA 2DFFA 1EETA 2YHBA 4H8KA 3V1OA 1BCOA 4ZHRA 1S9EA 4Z0UA 2XY7A 2IOCA 4B9LA 1HJRA 1W0HA 2Z1HA 4EP5A 3ZSXA 3MEGA 1LWEA 2KQ2A 3TR8A 1IKVA 4M42A 4J2DA 3VQ6A 5FDLA 5HBMA 1QSSA 3ITHA 3AO5A 1RDDA 5SZTA 1S1XA 1KFDA 3M8QA 1JXEA 3KD1E 1Q9YA 2QKBA 1TAUA 3NH1A 3AVCA 4DWIA 1SL2A 3NF6A 1BI4B 1HMVA 3V9XA 4M3WA 4Y1DA 3CQ8A 1XC9A 3T19A 4JS5A 2OYQA 2HHSA 2XRIA 4FJNA 3RMDA 1O1WA 4CHQA 2P51A 3F73A 1YVUA 4ELUA 2D0BA 1TK0A 3ZSYA 3U3YA 4CJFA 1XHXA 3SQ2A 1CLQA 2HNDA 3AV9A 4MFBA 4DU1A 1QQCA 4CE9A 3OJUA 1HNIA 1L3VA 3VQ7A 1LW0A 4CJUA 2HMIA 1RBSA 1WSJA 1KLNA 1DLOA 1RILA 3LAKA 3G0ZA 1NJYA 1S1UA 2IAJA 4M3UA 3AVJA 1D9FA 3V1QA 2EHGA 4B9NA 4FJJA 1T7PA 4B9MA 1D9DA 3CFPA 1S5JA 3PO5A 4CEAA 3SQ4A 4AH9A 3L3VA 3SV4A 3LZJA 3VA0A 3AO2A 4KAZA 1EX4A 3SI6A 4W5TA 4CEFA 4K8ZA 3TARA 1SV5A 4HUGA 3VQ4A 4E19A 3HPOA 4RW4A 1IKYA 2OPSA 3KLIA 1KRPA 1EXQA 3IAYA 3V9SA 3DLBA
chains in the Genus database with same CATH superfamily
3H1QA 4DFJA 4BRLA 3C6HA 4OO1J 4CBWA 3P5JA 4IFVA 3RMAA 5KQ8A 1C1CA 1BQNA 1R59O 4I2QA 4JKGB 2XHBA 4KI4A 1WSFA 4K8XA 5I3UA 4LH5A 3L2WA 4LF5K 2YNGA 4CZIA 4FCYA 4BE1A 4Z4IA 1LWFA 1RTHA 4GV9A 1C1AA 1LW2A 1GLDG 3L3UA 2HHWA 3MWPA 4BDPA 4NCGA 5AFUH 4DSKA 3L2QA 3AAPA 4W5OA 2RPIA 1J5EK 2CH5A 4JKFA 5AQOA 3M8RA 1TGOA 3RVCA 1U49A 1S6QA 2PYLA 1HQEA 1NGDA 4O8UA 1NGJA 5FRNA 3VQEA 3KIOA 5HRNA 3FLCO 2GELA 3HXMA 4ELTA 4CVNE 4DFKA 4KHPK 3PX4A 4AHCA 3NGYA 2QM1A 5GIOA 2YV0X 4RW8A 1JJ2M 4BVPA 1JLGA 5KGWA 3MWTA 4H0PA 4BC2A 4BRNA 5HRPA 3CM6A 3S9HA 1YITN 3O4QA 2B4JA 4E7KA 4M63C 2HVHA 4EIAA 1WAJA 2QK9A 3AO3A 4DV1K 4JD2B 4IJAA 3DYAA 1ASVA 3O1BA 1LAWA 4ICLA 3AA5X 1WN7A 2IGIA 3CPEA 4B9SA 3ZETB 4C8NA 1I39A 4KFBA 3IDHA 4FLYA 3D2FB 3CCVN 4BRFA 1C1BA 4JK9A 4CGFA 1U2VB 3E66A 1D5AA 4CJEA 3NE6A 3MCAB 4C8MA 3LP2A 2RF2A 3HI0A 4QS9A 4O55A 2ETJA 4M3YA 2YNFA 1HUXA 2FXUA 5DM6L 1R0AA 3KLEA 3VQPA 1CZ9A 3AA2A 1J53A 4CJQA 5KPTA 2VGMA 2FSJA 3VPZA 3RMBA 4BG9A 3LDOA 4I9QA 2D1KA 2GUIA 3ZT1A 4EZ6A 3BUZB 3EZWA 1WLJA 2LSNA 2G8IA 4CEEA 3DI6A 4R5PA 1NK4A 1Y97A 1KAZA 1NLVA 5AQRA 2ASPA 3OYNA 3VEXA 2P9LB 1RT7A 2PZSA 1VQ4N 1TVRA 1HPZA 2YJEA 4CBUA 3VGLA 3GL1A 4DTXA 5EVZA 4Z4CA 3VF6A 4ILJA 4RW7A 4FOIA 2WOMA 1FJGK 3KWGA 4BACA 1BWFO 3WQTA 3RR7A 1Z26A 3C65A 3QNOA 4LFAK 3OS0A 4KBOA 4FWMA 3DLHA 1RNHA 3QINA 3SUOA 4DUYK 4PA1A 1NK0A 3LDNA 4BRHA 2P1JA 3R6MA 2Q2RA 4I9LA 2FF3B 3KLHA 3NDKA 1NOYA 4OVLA 3G4SN 3CFRA 3WNHA 2R7YA 4IDHA 4DV4K 2O4IA 3QFUA 1YJNN 1ZBLA 4CJVA 5LMUK 3FFKB 3RSEA 4H5WA 2X78A 1OH5A 4H0YB 3PX0A 4FJXA 2FBXA 1VHXA 1RT4A 4YOTA 3OA9A 2QWQA 1IV0A 1NMDA 3L6QA 4F9OA 4I2PA 3WNEA 3AA4A 5AQZA 3SAHA 2ITGA 3SK3A 2OPQA 3L0QA 4DFPA 4FK4A 2QA4N 4DV7K 1QE1A 1SKRA 3DMJA 4IZ9A 1VSDA 1BOTO 3TAEA 3L8BA 1XNQK 3K5OA 3WNFA 3KJVA 3QEIA 3SUPA 4WF9L 4F3TA 3FZHA 3CD6N 3EE9A 3VF2A 4WQ5C 4BR5A 3FZMA 1GLJO 2KFZA 4WE1A 2Z1JA 4LY7A 4GY2B 1VQMN 3CXCM 4HWIA 3MN9A 2GEMA 4FWOA 3THYB 1WSGA 3IS9A 4E7HA 4ELVA 5SWMA 3CYMA 1B9DA 1GOAA 2DY4A 1RBUA 4DSLA 3TI0A 2F4VK 1P8ZA 4CEDA 3NAEA 2NNWA 1HYSA 3CCJN 2IVPA 4HCCA 3QETA 2IDOA 5AQXA 3A5NC 3HSCA 1HKBA 3MEEA 1BI4A 2YNIA 4BE0A 4CZFA 4C8KA 1LWCA 3TABA 4BR0A 3O9TA 3KLGA 4GNIA 4H5TA 3SBGA 3DXMA 3KK7A 3NGZA 1BUPA 4N76A 4DF4A 4HCBA 3JYTA 2F8TA 2P9NA 3KD5E 3CJ1A 4BRDA 2WTUA 4DR4K 4KTZA 4DTSA 1UAXA 4A2AA 1XC3A 3AY9A 1G15A 4M3ZA 4JKDA 5AQKA 1W7AA 4EZ9A 4PKIA 3LWLA 3OHRA 3N4PA 4YORA 5FPEA 4FWRA 4KTWA 3SPZA 4BC3A 1ZC6A 3R1XA 3AVHA 1RTJA 3OY9A 3EYZA 4RG8A 5I42A 1BHLA 4X65K 2F9WA 3LDPA 3QICA 2FBVA 4I7FA 4JRPA 2EWSA 3T3FA 2A5XA 5B8HA 1CXUA 4IXCA 3S3NA 4H5NA 5KTQA 4LF4K 3U6FA 2OA8A 4CF2A 5HROA 4KKOA 1VRTA 5EU7A 5M1QA 3SV3A 4OLBA 1KCFA 4CCHA 3OYJA 4M3XA 4DSIA 4JI1K 4CIGA 5EY4A 1TKTA 4IEEA 3KHYA 1B92A 4IDKA 4BR4A 4CK2A 3VA3A 3DJCA 3W3DA 4B8AB 3K57A 2VCPA 2OZSA 3HSTB 1U4BA 1L3TA 4W5RA 4JAXA 1MWKA 2F96A 1RFQA 2ZF5O 4CJLA 3WXMB 2HHXA 2YI1A 4E7JA 1GLBG 1VQ5N 3H45C 5HL7L 3V81A 4CZLA 2J4RA 4IFEA 5FLXO 4WCEL 4B1YB 4C1NK 2WC9A 3F9KA 2NRRA 4ISGA 1HNWK 2GBZA 2ZD1A 1YTAA 3ZX0A 4CEBA 3KTQA 2BANA 3I33A 2UUBK 2OPPA 4E7IA 1S72N 2FBTA 2DFFA 4X62K 3C7NA 1S9EA 2IOCA 5EXWA 3ZSXA 3AGKA 1LWEA 2V51B 1OH8A 3TR8A 1IKVA 4HTLA 1MDUB 5SZTA 5CHIA 1KFDA 3GG4A 5IT9O 2H3GX 2WBNA 1BI4B 3V9XA 1OH7A 4Y1DA 2HHSA 2XRIA 4FJNA 3FE1A 3F73A 1YVUA 3U3YA 3CF5L 3DXMB 3SQ2A 4MFBA 4CE9A 3OJUA 1L3VA 3E9PA 3VQ7A 4NO7A 1LW0A 1WSJA 2I7NA 2HSTA 3LAKA 3G0ZA 2QI2A 1T7PA 2P9SA 3CFPA 4AH9A 2IIRA 3SI6A 3TARA 4HUGA 3HPOA 4KH4A 3KLIA 4FPBA 4CI6A 3V9SA 1VQ9N 4AILC 1IKWA 4JKGA 4IG0A 1J5OA 3CCEN 3GDQA 1Q8IA 2P9KA 1IG8A 3UIQA 2HBMA 3I0SA 1YTUA 3TWHA 1N5YA 2X74A 1X9JA 4H4MA 1BG3A 4BRCA 2DFHA 4O44A 3NHGA 4B1XB 3OYLA 3L2RA 3ENOA 4FWNA 1RDCA 4DV6K 3V1RA 4BREA 3ASMA 1T05A 1L3UA 3W0LA 1YF5L 2Z1IA 3ENBA 2ITMA 3EE8A 1S9GA 3PLAA 4DQQA 1A5XA 1HNVA 1UOCA 3QFPA 5E41A 5LJVA 4DQRA 3RMCA 3BP8A 3WT0A 1OVYA 4FOEA 1N33K 3SYZA 2HOEA 4JHDA 4CESA 5BN9A 4NCAA 4OJRA 5C15A 1TL1A 1RT2A 3LDQA 4Y1CA 3IFRA 4B08A 4JKEA 1FW6A 3D45A 3UE5A 4GKJK 1NGCA 2W6KA 2NUBA 3DLKA 4ILGB 5GAEP 3TPQA 4FW1A 4DUZK 2W40A 3HP9A 4LF7K 2DFEA 2HF4A 3BZKA 1C0FA 5AQSA 3VERA 4FVUA 3CC2N 2AA4A 4B1ZA 1T8EA 4CGGA 5J2PA 2FLOA 3HPHA 4DS5A 3LPUA 3WXKA 3VGKA 3OYGA 3D7EO 4A61A 5GIPA 3UKUB 1KC8O 1N32K 3OVNA 3OBYA 2G8UA 3O4WA 2BH1A 1NG9A 3S3OA 4FWPA 5AQQA 1NGIA 2HBKA 1S1WA 1RDBA 5FRMA 3ISNC 4MLEA 1LOTB 2AP1A 1IO2A 3MK6A 4DR7K 2P9LA 2KZMA 5GADP 3KK2A 2VGNA 4JS4A 1VSHA 1HPMA 1NJWA 4AQYK 2P9SB 4O8KA 3P83D 3AVFA 4DLEA 4CJ7A 4BE2A 3LDSA 1J54A 1WB9A 3OYDA 1HKCA 1XQSC 1Z6RA 3EKUA 3LANA 4ZTJA 1L5UA 2ZJPL 5AQNA 3TU5A 5CE3A 2FF6A 1GOBA 3HOTA 3THWB 2HHTA 2HHUA 1NWKA 1GLCG 2P9KB 1NGEA 4FL9A 4WQ4A 1YXQA 3BF1A 4BRIA 3C94A 5BPNA 3ZT2A 4C1NI 3UB5A 2E2QA 1FKOA 2FSNA 4CHPA 4N56A 2ZE2A 3E1YA 1TYQA 3PSFA 5EX5A 4WFBL 3CFOA 3K5LA 2HHHK 4E1NA 3R9PA 4JI7K 2UU9K 4CFCA 2Q97A 4DHYA 3EZ5A 1V4TA 4Z4HA 4FK2A 2ZQBA 5AZJA 2Q36A 5KPZA 5C0YA 3CG7A 2P9IA 4B3SK 1JCFA 5I9EB 1YI2N 1QHTA 4ISEA 3SCXA 5JVHL 4DMNA 1NGAA 2HNZA 4OKKA 3MEDA 1DEJA 3ZT4A 3OS2A 3V4IA 2YKNA 4GKKK 2I5JA 3HRGA 1YT3A 4HUFA 3O6WA 5JMVA 1WOQA 2Q0UA 3O9SA 4KI6A 2DTUA 3K59A 2VG5A 3NBPA 5EOYA 4JHDB 1HYZA 3RRHA 5M1FA 4MO5A 3SNNA 4A2BA 1NJIO 3O4NA 2YNHA 2A40A 2QTDA 3U3GA 1T44A 3CPWM 1N36K 1XNRK 2YCHA 1KSPA 4K42A 5AJ3K 3S41A 3THYA 2VWJA 1VQON 1SKWA 4KHQA 1ZBHA 5HRSA 1VSFA 4BRGA 2X6SA 5C25A 4CZEA 5CYQA 3VGMA 2I7PA 1K9MO 4B1VA 2E5LK 2D0CA 4O0IA 1C0MA 5CZ1A 2D0OA 3F9MA 1VSLA 1YAGA 3GE1A 2GTDA 5AZIA 5GINA 3HP6A 4DS4A 1J9AA 4K41A 4IOXA 4MO4A 3VQ5A 2KW4A 4DTMA 3OYHA 4M3TA 3U9DA 2E6MA 3O3HA 3PX6A 2Q3SA 4OKJA 1DKGD 5CYMA 1FKPA 3ZSOA 4BQLA 3DLEA 1W9HA 4DR5K 4KHNA 1U6ZA 1KVBA 3UKRB 1W97L 5AQUA 3VQDA 1IG9A 4H5RA 4RW9A 1WAFA 3T1AA 4LSLA 5J2QA 3P39A 1TV6A 2IVNA 1X9MA 3QEVA 4DTOA 5E84A 1RTIA 2ZGZA 1WSHA 1JLFA 2G8FA 2HF3A 2D5RA 3TTFA 3OYBA 4CHZA 3CCMN 2Q1NA 1A5WA 3D0PA 2Y1IA 1VSIA 3SBTA 3OW2M 3QESA 1EKEA 2RE2A 1RGIA 2NRVA 1SQKA 1YHQN 3G6EN 4A57A 3VQAA 4FZZA 4YOYA 1N34K 3CCLN 2B6AA 3HVRA 3H08A 1JLEA 4OGCA 5HLFA 4H0TB 1VQPN 2ZM6K 4CW7B 3O9RA 2O8CA 1TYQB 2GWKA 4NLBA 2W41A 2E1YA 5KRTA 3VTHA 3Q7BA 3TAMA 3THXA 4DG1A 3T1HK 4IOCL 2PBDA 1BIZA 5AZJB 4K43A 4CHYA 2PFUA 3DLBA 4K25A 3H46O 2P9IB 4HHTA 3B8AX 1IKXA 3ZT3A 1WSIA 4YDUC 3M3ZA 4KRFA 4BGBA 2A3ZA 1Z25A 1NJXA 3G71N 5FROA 3DLGA 3QDKA 1JXBA 2YJFA 3MDQA 3AGRA 2UUAK 3O3GA 2BUPA 3ZSVA 4MLHA 3M8PA 4DV2K 5J2NA 2YX6A 4PUOA 3KLFA 5FPMA 1JCGA 1Q18A 5HP1A 3VEVA 2VWKA 3AVKA 3THVA 3VETA 5AQGA 2UYTA 2FC0A 3KKRA 5MLCQ 1IJJA 4O5FA 3RWUA 3VQQA 2GUPA 3KKSA 2Y1JA 3IKMA 5TKWA 4CF9A 1U04A 3OS1A 3FR0A 3NMUA 1N8RO 3L4QA 4G9ZA 3T1YK 3OBWA 4OGEA 2OTJN 2NRWA 1XHZA 3E01A 3VEYA 2Q0RA 2OPRA 5H1SQ 4E7LA 5FPNA 3BF3A 4CHNA 4CZGA 1DTTA 1KVCA 3DRSA 3VQ8A 4QS7A 3V1OA 5AZIB 2F7TA 4I6MA 1HJRA 1W0HA 1M90O 4CBXA 4J2DA 3VQ6A 1QSSA 4FO0A 2QKBA 1TAUA 1S1XA 3KD1E 3ULEA 1T6DA 4DWIA 4NXNK 1VQKN 4DR6K 1BA0A 4MDBA 4H0VB 3P38A 1QQNA 4EHTA 4PL8A 4ELUA 1T3VA 3ZSYA 3TSUA 3ID6A 1CLQA 2UUCK 2HNDA 3AV9A 3DXKA 4CJUA 3SJHA 2EHGA 3V1QA 4J8FA 1K8KB 1NGGA 5BREA 4JNEA 4JI6K 1RDUA 4K8ZA 1SV5A 5GAHP 1IKYA 1EXQA 3Q7CA 2E2PA 3CJ7A 5KQDA 4A62A 4E1MA 2O8FA 3KZBA 2ASMA 3HTVA 5DK5A 3CQXA 3MMVA 3TSQA 4BGAA 2AJQA 2HHQA 4LF8K 2O8CB 1NK9A 5AQPA 3CMEN 1EP4A 4YNQA 3M8SA 3WXLA 3THXB 3TSPA 3EEQA 3SUNA 1RTDA 4B9TA 4C8OA 2XY5A 1TKZA 3BDPA 4FJIA 4FJHA 4DV0K 4IOAL 2VG6A 1YVNA 1ZBFA 1NKBA 2YKMA 3C0BA 5KI6A 3MXIA 2JWKA 4WYBA 4LF9K 3PV8A 3QO9A 4Y0WA 4AHSA 3QNNA 1MU2A 4NYFA 4GW6A 3LZIA 3U4LA 1SUQA 5K14A 2GWJA 1IBLK 4O5BA 1RBRA 2D4WA 2QW9A 4KHUA 4CEOA 1E3MA 4O0JA 4IO8A 4PHTX 2ZWHA 1JLQA 3A5MC 4XH1A 2D0PA 1WUAA 3HJFA 4DSJA 4FZYA 4OPJA 4QCLA 1NKEA 4BRMA 1T6CA 5AQIA 1EO1A 2V52B 5M1PA 2KZZA 2FBYA 4DU3A 3E9OA 1BCMA 2E4LA 3LAMA 3A5OC 5LL6Z 4FWLA 3HM8A 3SUQA 4J2EA 4FJ5A 4BG8A 3MXJA 1J6ZA 2XY6A 3V9ZA 1C0TA 3DOLA 2YHXA 3AVMA 3AARA 3UKUA 3J7YP 3C6UA 2VG7A 2HB5A 1ZXOA 2QEXN 4X66K 3O80A 4I6MB 3J81O 3KK1A 1ILYA 2A1SA 1OH6A 4B8CA 1QSLA 3BGRA 3EL2A 3ULEB 3ZT0A 3HOSA 4BVOA 3O9UA 4CJ5A 4DR2K 4LF6K 2GV9A 4DTRA 3OJSA 2O8DA 2W42A 1JL2A 1RBTA 3CJBA 3AVLA 5T7BA 4M3RA 4CJSA 2QWMA 4IKFA 2CGLA 3DXKB 5C12A 4CK3A 3O08A 4JI0K 3RR8A 3WNGA 1VQ6N 3WXJA 1TK8A 3AVGA 1C0UA 1MWMA 2ATQA 4R79A 4CZMA 4FLVA 2E6LA 4H0OA 4CF1A 1ATSA 2VWBA 1HNXK 2ZJRL 4DB3A 4YOWA 1WBDA 3LPTA 4BRAA 5DM7L 3OYFA 2QKKA 3THWA 3JS6A 4FM0A 4KB1A 1F21A 5ADXA 1LCUA 2QWOA 4RCHA 2UXDK 1XI1A 1V4SA 2O8FB 4CD1A 1L3SA 1NM1A 3SAFA 1VQ8N 3K2PA 1Y64A 4CIFA 1ZBIA 3HM9A 4YOUA 3K9JA 3SPYA 4NB4A 4JI2K 3OYIA 4PQUA 4DR3K 3I55N 1BGXT 3AO4A 3QLHA 3NH2A 3CETA 4YFUA 4JN4A 1HLUA 1B9FA 4YHHK 3C6TA 1DT9A 2VYPA 1RT5A 1VAZA 1X3MA 1T03A 4DQPA 3OYKA 3A8YA 4AHVA 1KQSM 1VSEA 3OYMA 4CD3A 4NCBA 4F8RA 3CHWA 1RDAA 4FW2A 3PY8A 4WFAL 1I94K 4FLTA 1X1PA 4F3OA 3QBXA 1BL3A 3FZKA 4CZJA 3WEEB 5LMNK 2V7YA 5AR0A 2P5GA 4F2SA 4CJ3A 3G10A 2NLXA 1S6PA 3TAFA 1GLLO 3KK3A 4GV6A 2P5OA 4KTQA 4FJGA 4IG3A 1JKHA 4DV5K 2PYJA 1NU0A 4EP4A 1U48A 2QWPA 1Q7YO 3EO3A 4ZTFA 3AO1A 3LP1A 3NF9A 5GAGP 4JLHA 1S3XA 3SMPA 3I8BA 4ID5A 4DQIA 4A5AA 2HHVA 5AFUA 4JEPA 1BQMA 1HQUA 3V9WA 3ATVA 1ESVA 3CQYA 2HMPA 4LC9B 4FM2A 3NH0A 4FWQA 4N47A 2XO7A 3HL8A 3VESA 5C10A 3ULDA 4FZXC 3UKRA 2A1RA 4L3QA 3DRRA 3NVKA 4QS8A 4E3SA 2QWRA 2OCEA 1GLEG 1QVGM 2O8DB 3H1VX 4XEIA 3EN9A 3G25A 2PY5A 3LM9A 1GLAG 1VSJA 2DPNA 4WQ5A 4MQ3A 3HVTA 3L2UA 2KTQA 4XIUA 4KHWA 3AVAA 4CFBA 5M1KA 2O8EA 2JLEA 4N5SA 4BC5A 4MDAA 3DRPA 2IS3A 1TUUA 2E1ZA 3M6GA 3TAPA 2A42A 5JVGL 1KVAA 3J7AP 5M1NA 1WNSA 3T69A 1X9WA 4B9VA 4NLCA 1UA1A 1ITGA 4J2AA 4BRKA 3J7ZO 1HYVA 1O13A 5D3GA 4OKEA 1TK5A 4M41A 2G8HA 2NRZA 2RN2A 4C8LA 5F1XA 1SKSA 2JWLA 3KVGA 3FGUA 3JAMO 5AQJA 3NVMA 3K5MA 4DQ8A 1YJWN 3P4IA 4X64K 5KRSA 3OYAA 3K9KA 2OTLN 3U8XA 1NK6A 1TL3A 4IFYA 1QZ6A 1KAXA 4HVJA 3AVBA 4BQZA 1HKGA 3CERA 2A6AA 4YOVA 1H1VA 3O8MA 4FJMA 1OKJA 3GOIA 2RHKA 4KREA 3MCPA 1QS4A 2O8BB 3LP3A 3I56N 5HOOA 4FYDA 4JKAA 3GBTA 1D4XA 3MAQA 1TKDA 2QWNA 1X9SA 4ID1A 2P9PA 3AVIA 4CGDA 4CEQA 4FLXA 4BDYA 1RT3A 1EQYA 5BPLA 3LL3A 3ZEUA 1RT1A 3MN5A 3ALYA 1VK0A 4E1JA 3I0RA 3VQBA 3ZSRA 2ASOA 2VQFK 4BR7A 4Z4FA 3PIOL 2P9UA 3HK2A 4H4OA 4JK8A 4JI3K 1BCOA 4ZHRA 4Z0UA 1VQ7N 3IMXA 4B9LA 2F9TA 4RTFD 3SMSA 4GV3A 3J8AA 4LFCK 3ITHA 3AO5A 1RDDA 3M8QA 1JXEA 1X3NA 1Q9YA 1SS6A 3WQUA 1SL2A 1HX1A 3J80O 3QB0A 3LDLA 1K8AO 3O5BA 2IVOA 3ID8A 2P51A 4JI4K 2D0BA 2W6LA 4CJFA 5A2QO 4DU1A 3LM2A 5F2RA 1QQCA 3KWIA 1K8KA 3ENHA 5AQFA 1RBSA 1RDWX 1DLOA 1RILA 2IAJA 3VMFB 3AVJA 5LY3A 1D9FA 3ZX3A 4B9MA 4DV3K 1D9DA 1S5JA 5AQLA 3SQ4A 2O8EB 3SV4A 3VA0A 4XH5A 4W5TA 3CCSN 4E19A 4IO9L 3VOVA 1KRPA 3IAYA 1VQNN 1UA0A 3OYCA 5AQYA 1BISA 1NOZA 4CGHA 3PIPL 2F8SA 2G8KA 1KAYA 1IBKK 4PWDA 2BE2A 4HUEA 4A5BA 3QEPA 4BR9A 5JICA 4KB0A 5HRRA 5JLHA 1GOCA 4Q0BA 4DSFA 3B6PA 1KTQA 2HVIA 1SAZA 4M7XA 5CR4A 3VEWA 3I8DA 5DMRA 2E8AA 3CCRN 3H6EA 1NBWA 2EX3A 3FZLA 3ATUA 4AM6A 4CJRA 3F2KA 3TAGA 3A5LC 2KLAA 4TSXA 5C2DA 4F4KA 4OX9K 3IG1A 3O9QA 1KLMA 4FLUA 4B3OA 3VEOA 4OPKA 1D8YA 4B9UA 1JLCA 4LFBK 1YUWA 4EAHD 3OTOK 3C95A 4C23A 4BR2A 5C42A 4W5NA 4B1UB 4AHRA 4BY9C 1YJ9N 3DLRA 4CFDA 3QERA 1CZAN 4KO0A 3QMLA 1S1VA 3CCQN 4DTUA 3NGIA 4FJKA 1KXPA 4B3RK 2FSKA 4AM7A 3PUFA 4DTJA 1QQOA 3L4IA 1VRUA 4EHUA 3VTIA 4UQGA 2P9PB 3HZ6A 3DWLA 4FJ8A 2BTFA 1KD1O 4QOZB 3BY5A 1NMNA 5FPDA 4WFNL 1NKCA 4IJNA 1KFSA 3DLLL 3ZEUB 3P1GA 4DKWA 3CC4N 4CIEA 3QEWA 3H3OB 1EWRA 1DTQA 3AVNA 1TKXA 2P9UB 5BR9A 4DTNA 4U67L 3SLCA 4CF8A 4FWKA 1XWLA 1LAVA 4WQ4C 5BRFA 1UWBA 4B9QA 4BROA 1A5VA 4DTPA 4FPAA 3CI5A 2NZTA 4DR1K 5CY4A 3DM2A 3O3FA 3WUHA 1IH7A 1QZ5A 1M1KO 1HNZK 3MX2A 5JLFA 2PAVA 2GX9A 4W5QA 4CJKA 2ZJQL 1TUYA 3MN6A 4FLZA 4DQSA 3ZSQA 2OZMA 1XMOK 1QHAA 2Q31A 1FK9A 3DOKA 3NF7A 4DF8A 1JLBA 5AQHA 3H3NO 1NK8A 4CJ4A 2UXBK 2X6NA 1HRHA 1VQLN 3IRXA 5F0XA 3HPGA 4FLWA 3TTDA 3RTVA 4RW6A 4M7YA 5CZ2A 3U9ZA 3MECA 1JCEA 1HJOA 1SL1A 4FJLA 4PY5A 1NGFA 4LSNA 4ILHA 3ZYYX 4FJ9A 4B3TK 3PO4A 2VQEK 5JS1A 3TTCA 1RCHA 3EY1A 4KPYA 2E88A 3ZSZA 3JSMA 4IEIA 4AHUA 3K5NA 4IWVA 2B5JA 1BA1A 1DGKN 1IBMK 1VSMA 2NRTA 4N41A 2HNYA 4FJ7A 3LWMA 2JGUA 3NF8A 4DCHA 2KFNA 1NJZA 4CERA 4HTUA 1C6VA 4NYNA 3HYFA 3ZSWA 3AA3A 3BEXA 1WBBA 1NK5A 3RRGA 2HBLA 3VF4A 5C2FA 1ZYQA 3K0SA 4JI5K 4BRQA 3BZCA 2G8WA 2RKIA 4FSVA 1S22A 1C0GA 5BPMA 3RSEB 4A59A 4B1WB 1XUPO 4AHTA 1YIJN 2CGKA 3CCUN 4BWJA 3VEZA 4CHOA 3SQ1A 4E0DA 4JKCA 1TAQA 5AQVA 3TANA 3CMAN 3D6RA 1N6QA 2YHWA 4KV8A 4PKHA 1E4GT 1Z05A 3WEEA 3OYEA 4FK0A 4AF1A 1ZBUA 3QBWA 3MXMA 1CZBA 3IUCA 5AQWA 4KHYA 4RWTA 4KHSA 1NGBA 4CZKA 3SAGA 3HO1A 2D0AA 1VSKA 3P31A 1NNEA 4DU4A 4JI8K 4H5VA 4U7BA 4JK7A 4K0KK 4GVEA 3WXIA 4Z4GA 2KHOA 4BWMA 5BRHA 2G8VA 4IBNA 3V6DA 1SL0A 4KH5A 3NCIA 4EFHA 3SZ2A 3CIPA 4JRQA 4BC4A 3M1FA 4F2RA 3TAQA 4DLGA 1SZ2A 3ZCMA 1ATNA 2WUSA 4G1QA 4JKBA 3SQ0A 4L8RB 3QIPA 1Q82O 2BGGA 4FM1A 5BRDA 4YY3K 3VQ9A 3B6OA 5J2MA 3SJJA 3LALA 3PSIA 5ELZA 3D2EA 1QSYA 3K58A 3L2VA 2Z1GA 4BDZA 4OLAA 4CGJA 5C24A 3ZLJA 2CH6A 3T7ZA 4B3MK 5AQMA 1ASUA 4CK1A 3QEXA 4JKHA 4CECA 1QVFM 4E89A 2P9NB 3A2FA 2QXLA 4CJTA 3MN7A 4NXMK 4CJPA 3VN5A 1JL1A 5E26A 4FWSA 5LJWA 1OVQA 1K6YA 3VQCA 2YHAA 2KKZA 1GLFO 1BIUA 3MX5A 3FZFA 3A0IX 1JLAA 2E2OA 4Q5VA 4JYAK 3NFAA 4CGIA 4GVMA 1Q9XA 2UXCK 3VENA 5AQTA 1U45A 4GMJB 2NRXA 1ATRA 5KGXA 3HT3A 2NRHA 4Z94A 5JS2A 3O1WA 4CJWA 3CJAA 1I3AA 4KH6A 4CFAA 1ASWA 3CJ9A 3S3MA 3FFIA 1NK7A 2WONA 4CEZA 4LD0A 1REVA 1RBVA 3ZX2A 2HW3A 5BR8K 3CC7N 3N4QA 1P90A 1WSEA 4OPHA 4FVMA 3EKSA 4UY8O 3DAWA 2O8BA 5IWAK 3AAQA 1E4FT 4DSEA 5KPRA 1K73O 5M1OA 1BO5O 2OANA 2A41A 1BDGA 2BDPA 4CF0A 4ISFA 1RT6A 3JXUA 1LV5A 4V19S 3CM5A 1W2BM 1FXXA 2XY8A 3QIOA 1Q81O 4H03B 2O4GA 2WFBA 4CZHA 1HR0K 4XH4A 1QTMA 3LP0A 1U47A 1NGHA 2ZGYA 4JV5K 4M45A 3M5RA 4JD2A 2QXFA 4QAGA 1ZBSA 2E20A 3V9UA 1XMQK 5ADXH 4Z4EA 3ZETA 5J1EA 2HBJA 1CXQA 2IC3A 4LH4A 3CJCA 3D2FA 4J2BA 1S1TA 4O4GA 1BU6O 4YDUA 4DFMA 4FXDA 1EETA 2YHBA 1MA9B 4H8KA 1U2VA 3R8EA 2XY7A 4EP5A 2Z1HA 3MEGA 2KQ2A 4M42A 4PL7A 5FDLA 5HBMA 3C7NB 4H0XB 3NH1A 3AVCA 5BN8A 3NF6A 1HMVA 4M3WA 3CQ8A 1XC9A 2V7ZA 3C6AA 3T19A 4JS5A 2OYQA 3RMDA 1G99A 1O1WA 4CHQA 4BRPA 1QQMA 1EWQA 3E9LA 1TK0A 3D2EB 3R3LA 1XHXA 1Q86O 2YHYA 1HNIA 2E2NA 5TKYA 2HMIA 1KLNA 4YOXA 1NJYA 1S1UA 4M3UA 4FJJA 4B9NA 4OPAA 3PO5A 4CEAA 3L3VA 3LZJA 3AO2A 4KAZA 1EX4A 4CEFA 3F5TA 3VQ4A 4RW4A 2CGJA 2OPSA 2QWLA 4PKGA 3HBTA
chains in the Genus database with same CATH topology
4AILC 1UA0A 1IKWA 4DFJA 3OYCA 1BISA 1NOZA 4CGHA 4IG0A 1J5OA 4E1MA 1Q8IA 2G8KA 2F8SA 3P5JA 4PWDA 3UIQA 2BE2A 4IFVA 4HUEA 3RMAA 3QEPA 1C1CA 1BQNA 4I2QA 5DK5A 2XHBA 5HRRA 4KB0A 4KI4A 1WSFA 1GOCA 4Q0BA 4DSFA 3B6PA 1KTQA 4K8XA 2HVIA 5I3UA 4LH5A 3L2WA 3I0SA 3I8DA 1YTUA 2YNGA 5DMRA 3TWHA 1N5YA 2AJQA 4FCYA 2X74A 4BE1A 2HHQA 4Z4IA 1LWFA 1RTHA 4H4MA 1C1AA 1LW2A 1NK9A 2DFHA 4O44A 3NHGA 1EP4A 2EX3A 3L3UA 3OYLA 3L2RA 2HHWA 4YNQA 4CJRA 3TAGA 4BDPA 3M8SA 4NCGA 4TSXA 1RDCA 4F4KA 3IG1A 3V1RA 3ASMA 1T05A 1KLMA 1L3UA 4FLUA 4DSKA 3L2QA 4B3OA 3SUNA 1RTDA 4B9TA 4W5OA 4C8OA 2Z1IA 1TKZA 4OPKA 2XY5A 1D8YA 4B9UA 2RPIA 3BDPA 4FJIA 4FJHA 1JLCA 1S9GA 2VG6A 3C95A 3M8RA 5C42A 1TGOA 1ZBFA 4DQQA 1U49A 1NKBA 1S6QA 2YKMA 5KI6A 1A5XA 1HNVA 1HQEA 1UOCA 3MXIA 2PYLA 4W5NA 4AHRA 5E41A 4DQRA 5FRNA 3VQEA 3KIOA 5HRNA 3HXMA 3RMCA 3PV8A 3QO9A 3DLRA 4CFDA 4ELTA 3QERA 4AHSA 3QNNA 4KO0A 1MU2A 4DFKA 1S1VA 4DTUA 4NYFA 4GW6A 3NGIA 3PX4A 4AHCA 3LZIA 4FJKA 1SUQA 5K14A 3NGYA 3SYZA 4CESA 2YV0X 4O5BA 1RBRA 4RW8A 4KHUA 3PUFA 4DTJA 4CEOA 4O0JA 4NCAA 4OJRA 1VRUA 1JLGA 5KGWA 1JLQA 5HRPA 1TL1A 3HJFA 4DSJA 4UQGA 1RT2A 3CM6A 4FZYA 3S9HA 4OPJA 4QCLA 4Y1CA 1NKEA 3O4QA 2B4JA 4E7KA 4FJ8A 4QOZB 2HVHA 4B08A 2G8HA 1NKCA 3D45A 2KZZA 1KFSA 2FBYA 4DU3A 3LAMA 1BCMA 1WAJA 2E4LA 2QK9A 3AO3A 3DYAA 1ASVA 3P1GA 1LAWA 2NUBA 3DLKA 3SUQA 4J2EA 4FJ5A 4ICLA 3AA5X 1WN7A 2IGIA 3MXJA 4FW1A 4CIEA 3QEWA 3HP9A 1I39A 2DFEA 4C8NA 4B9SA 2XY6A 3V9ZA 1C0TA 1DTQA 3DOLA 3AVMA 3AVNA 1TKXA 4KFBA 4FLYA 1T8EA 4DTNA 4CGGA 1C1BA 5J2PA 3C6UA 3HPHA 4CGFA 4DS5A 2VG7A 3LPUA 4CF8A 1D5AA 2HB5A 4CJEA 1XWLA 3NE6A 3KK1A 4C8MA 1LAVA 2RF2A 3LP2A 1UWBA 2ETJA 4O55A 2A1SA 3OYGA 4B8CA 4M3YA 2YNFA 1A5VA 3OVNA 4DTPA 1QSLA 2G8UA 3BGRA 3ZT0A 1R0AA 3KLEA 5CY4A 4CJ5A 3DM2A 3VQPA 3O3FA 1IH7A 3S3OA 2GV9A 1CZ9A 3AA2A 4DTRA 1S1WA 1J53A 4CJQA 4CJKA 1RDBA 4W5QA 3OJSA 2W42A 3RMBA 1JL2A 4FLZA 4DQSA 4I9QA 3ISNC 5FRMA 1RBTA 3AVLA 3ZSQA 2GUIA 3ZT1A 5T7BA 4M3RA 2OZMA 4EZ6A 1FK9A 1WLJA 3DOKA 3NF7A 4CJSA 1IO2A 1JLBA 2LSNA 4DF8A 4IKFA 2KZMA 2G8IA 4CK3A 4CEEA 3DI6A 3KK2A 3WNGA 4R5PA 4JS4A 1NK8A 4CJ4A 3RR8A 1VSHA 1NK4A 1Y97A 1NJWA 2X6NA 1HRHA 1TK8A 3AVGA 1C0UA 2ATQA 3AVFA 3P83D 3OYNA 3IRXA 1RT7A 3HPGA 2E6LA 4CF1A 4DLEA 4BE2A 4FLWA 4FLVA 2PZSA 3LDSA 1J54A 1TVRA 1HPZA 3RTVA 4RW6A 3LPTA 3OYDA 5CZ2A 3OYFA 2QKKA 3LANA 3MECA 4FJLA 4DTXA 1SL1A 4PY5A 4ZTJA 4Z4CA 4FM0A 1L5UA 4KB1A 4RW7A 4LSNA 2WOMA 4FJ9A 1GOBA 3PO4A 1F21A 5JS1A 4BACA 2HHTA 1RCHA 3EY1A 4KPYA 1XI1A 3RR7A 2HHUA 1Z26A 3QNOA 1L3SA 3OS0A 3ZSZA 3C94A 3JSMA 3DLHA 1RNHA 4AHUA 3ZT2A 3QINA 3K2PA 3K5NA 2B5JA 4CIFA 3SUOA 1FKOA 4N56A 4CHPA 2ZE2A 1VSMA 4PA1A 3HM9A 1NK0A 2HNYA 4N41A 1ZBIA 4FJ7A 2P1JA 3LWMA 2JGUA 3NF8A 4I9LA 3SPYA 2KFNA 3KLHA 1NJZA 4CERA 3NDKA 4HTUA 1NOYA 1C6VA 4OVLA 3CFOA 3K5LA 3CFRA 3OYIA 4PQUA 3WNHA 4NYNA 3HYFA 4E1NA 2R7YA 1BGXT 3AO4A 3ZSWA 3AA3A 2O4IA 3RRGA 4CFCA 1NK5A 3QLHA 3NH2A 3EZ5A 1ZBLA 4Z4HA 4FK2A 2ZQBA 4CJVA 4YFUA 1ZYQA 2X78A 3PX0A 4FJXA 1B9FA 2FBXA 3CG7A 1RT4A 3C6TA 1TK5A 2G8WA 1QHTA 2RKIA 3SCXA 1RT5A 4DMNA 2HNZA 4AHTA 4BWJA 4CHOA 4E0DA 4OKKA 3SQ1A 1T03A 4DQPA 3OYKA 3MEDA 1TAQA 3ZT4A 4I2PA 3WNEA 3TANA 3OS2A 3V4IA 4AHVA 1VSEA 2YKNA 3AA4A 2I5JA 3OYMA 1N6QA 1YT3A 4KV8A 4NCBA 2ITGA 4F8RA 2OPQA 4HUFA 1RDAA 4FW2A 3PY8A 3OYEA 4FK0A 4DFPA 4FK4A 4KI6A 2DTUA 3K59A 2VG5A 1X1PA 4FLTA 4F3OA 3NBPA 1BL3A 1QE1A 1ZBUA 3DMJA 1VSDA 1SKRA 3TAEA 3MXMA 1HYZA 3L8BA 3RRHA 1CZBA 3SNNA 4KHYA 3K5OA 3WNFA 3KJVA 3QEIA 4KHSA 3SUPA 3O4NA 2YNHA 4F3TA 2P5GA 4F2SA 4CJ3A 3G10A 1S6PA 3U3GA 3TAFA 3HO1A 3KK3A 2D0AA 2KFZA 1VSKA 2P5OA 4WE1A 4FJGA 4KTQA 4IG3A 1KSPA 1JKHA 2PYJA 4DU4A 2Z1JA 4EP4A 1U48A 2VWJA 4KHQA 4LY7A 1SKWA 4ZTFA 1ZBHA 5HRSA 1VSFA 5C25A 2X6SA 5CYQA 3AO1A 3LP1A 3NF9A 2D0CA 4O0IA 4Z4GA 1C0MA 4JLHA 5CZ1A 1WSGA 4BWMA 3IS9A 4E7HA 4ELVA 2G8VA 4IBNA 4ID5A 3V6DA 1SL0A 1VSLA 4DQIA 5SWMA 3NCIA 3CYMA 2HHVA 1B9DA 3SZ2A 1BQMA 1GOAA 1HQUA 3V9WA 4JRQA 2DY4A 1RBUA 4F2RA 4DSLA 3HP6A 3TI0A 4FM2A 3NH0A 4N47A 4DS4A 1J9AA 4CEDA 2XO7A 3NAEA 3VQ5A 2KW4A 4DLGA 3OYHA 3HL8A 4DTMA 4M3TA 3ZCMA 1HYSA 2E6MA 4G1QA 3O3HA 3ULDA 2Q3SA 3PX6A 3QETA 3SQ0A 4HCCA 4FZXC 4OKJA 5CYMA 2IDOA 1FKPA 3ZSOA 2A1RA 3QIPA 4L8RB 3DRRA 2BGGA 3DLEA 3MEEA 4FM1A 1BI4A 1W9HA 2YNIA 4BE0A 3VQ9A 3B6OA 1KVBA 4E3SA 5J2MA 4KHNA 4C8KA 1LWCA 3TABA 3LALA 3SJJA 3KLGA 3VQDA 1IG9A 4RW9A 1QSYA 3K58A 3NGZA 3L2VA 1WAFA 2Z1GA 3T1AA 4LSLA 4BDZA 5J2QA 2PY5A 4OLAA 4CGJA 1VSJA 4DF4A 5C24A 1TV6A 4HCBA 3JYTA 4N76A 2F8TA 4MQ3A 1X9MA 3HVTA 3QEVA 3KD5E 4DTOA 3L2UA 2KTQA 1RTIA 4XIUA 1ASUA 1WSHA 4CK1A 1JLFA 4KTZA 1UAXA 3AVAA 4DTSA 4CFBA 3QEXA 4CECA 2G8FA 2D5RA 3OYBA 4KHWA 4CHZA 2JLEA 4E89A 4N5SA 3DRPA 2IS3A 3A2FA 1A5WA 1G15A 3D0PA 4M3ZA 2Y1IA 1VSIA 4CJTA 3TAPA 3TAQA 4CJPA 3QESA 4EZ9A 1EKEA 1KVAA 3VN5A 1JL1A 3LWLA 1WNSA 1K6YA 3VQCA 1X9WA 2YHAA 4B9VA 1UA1A 4KTWA 1ITGA 4J2AA 3VQAA 1BIUA 3SPZA 1HYVA 4FZZA 1JLAA 2B6AA 4Q5VA 3HVRA 5D3GA 3AVHA 1RTJA 3NFAA 4OKEA 4M41A 4CGIA 3H08A 1JLEA 2RN2A 3OY9A 4GVMA 4RG8A 3EYZA 1BHLA 5I42A 1Q9XA 4C8LA 4OGCA 5HLFA 1SKSA 2FBVA 4I7FA 4JRPA 1U45A 4GMJB 3T3FA 1CXUA 5KGXA 3S3NA 5KTQA 3HT3A 3U6FA 5KRTA 3K5MA 2OA8A 4CF2A 5JS2A 4KKOA 4CJWA 1VRTA 5HROA 5EU7A 3TAMA 1I3AA 4DG1A 1KCFA 4CFAA 1ASWA 3SV3A 4CCHA 4OLBA 3OYJA 5KRSA 4M3XA 1BIZA 4CHYA 3OYAA 4DSIA 3S3MA 1NK6A 1TL3A 3FFIA 1NK7A 4CIGA 4IFYA 2WONA 4HHTA 4CEZA 1IKXA 4LD0A 3ZT3A 1WSIA 4HVJA 1TKTA 3AVBA 1REVA 1RBVA 4KRFA 2HW3A 1Z25A 1WSEA 1NJXA 4FVMA 1B92A 4IDKA 5FROA 3DLGA 4CK2A 1JXBA 3VA3A 4B8AB 3K57A 4FJMA 2OZSA 3HSTB 3O3GA 4KREA 1U4BA 1L3TA 4W5RA 3ZSVA 3M8PA 5J2NA 4DSEA 2F96A 1QS4A 4PUOA 3KLFA 3LP3A 4CJLA 2BDPA 5HP1A 4FYDA 2HHXA 4CF0A 4E7JA 2VWKA 3AVKA 3MAQA 1TKDA 1RT6A 3THVA 1LV5A 1X9SA 3CM5A 4ID1A 3V81A 1FXXA 2XY8A 3AVIA 3QIOA 4CGDA 2FC0A 3KKRA 2O4GA 3RWUA 3VQQA 4CEQA 4FLXA 3KKSA 3F9KA 3LP0A 2Y1JA 1QTMA 4BDYA 1U47A 2GBZA 1RT3A 4CF9A 1U04A 2ZD1A 4M45A 3OS1A 1YTAA 1RT1A 2QXFA 4QAGA 4CEBA 3ALYA 4OGEA 1VK0A 3KTQA 2BANA 3V9UA 1XHZA 3I0RA 3VQBA 3ZSRA 2OPPA 3E01A 4Z4EA 4E7IA 5J1EA 4Z4FA 2OPRA 1CXQA 2IC3A 2FBTA 4LH4A 4E7LA 4CHNA 1DTTA 3HK2A 4J2BA 1KVCA 3DRSA 1S1TA 4H4OA 4O4GA 3VQ8A 4DFMA 4FXDA 2DFFA 1EETA 2YHBA 4H8KA 3V1OA 1BCOA 4ZHRA 1S9EA 4Z0UA 2XY7A 2IOCA 4B9LA 1HJRA 1W0HA 2Z1HA 4EP5A 3ZSXA 3MEGA 1LWEA 2KQ2A 3TR8A 1IKVA 4M42A 4J2DA 3VQ6A 5FDLA 5HBMA 1QSSA 3ITHA 3AO5A 1RDDA 5SZTA 1S1XA 1KFDA 3M8QA 1JXEA 3KD1E 1Q9YA 2QKBA 1TAUA 3NH1A 3AVCA 4DWIA 1SL2A 3NF6A 1BI4B 1HMVA 3V9XA 4M3WA 4Y1DA 3CQ8A 1XC9A 3T19A 4JS5A 2OYQA 2HHSA 2XRIA 4FJNA 3RMDA 1O1WA 4CHQA 2P51A 3F73A 1YVUA 4ELUA 2D0BA 1TK0A 3ZSYA 3U3YA 4CJFA 1XHXA 3SQ2A 1CLQA 2HNDA 3AV9A 4MFBA 4DU1A 1QQCA 4CE9A 3OJUA 1HNIA 1L3VA 3VQ7A 1LW0A 4CJUA 2HMIA 1RBSA 1WSJA 1KLNA 1DLOA 1RILA 3LAKA 3G0ZA 1NJYA 1S1UA 2IAJA 4M3UA 3AVJA 1D9FA 3V1QA 2EHGA 4B9NA 4FJJA 1T7PA 4B9MA 1D9DA 3CFPA 1S5JA 3PO5A 4CEAA 3SQ4A 4AH9A 3L3VA 3SV4A 3LZJA 3VA0A 3AO2A 4KAZA 1EX4A 3SI6A 4W5TA 4CEFA 4K8ZA 3TARA 1SV5A 4HUGA 3VQ4A 4E19A 3HPOA 4RW4A 1IKYA 2OPSA 3KLIA 1KRPA 1EXQA 3IAYA 3V9SA 3DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIL C;  1UA0 A;  1IKW A;  4DFJ A;  3OYC A;  1BIS A;  1NOZ A;  4CGH A;  4IG0 A;  1J5O A;  4E1M A;  1Q8I A;  2G8K A;  2F8S A;  3P5J A;  4PWD A;  3UIQ A;  2BE2 A;  4IFV A;  4HUE A;  3RMA A;  3QEP A;  1C1C A;  1BQN A;  4I2Q A;  5DK5 A;  2XHB A;  5HRR A;  4KB0 A;  4KI4 A;  1WSF A;  1GOC A;  4Q0B A;  4DSF A;  3B6P A;  1KTQ A;  4K8X A;  2HVI A;  5I3U A;  4LH5 A;  3L2W A;  3I0S A;  3I8D A;  1YTU A;  2YNG A;  5DMR A;  3TWH A;  1N5Y A;  2AJQ A;  4FCY A;  2X74 A;  4BE1 A;  2HHQ A;  4Z4I A;  1LWF A;  1RTH A;  4H4M A;  1C1A A;  1LW2 A;  1NK9 A;  2DFH A;  4O44 A;  3NHG A;  1EP4 A;  2EX3 A;  3L3U A;  3OYL A;  3L2R A;  2HHW A;  4YNQ A;  4CJR A;  3TAG A;  4BDP A;  3M8S A;  4NCG A;  4TSX A;  1RDC A;  4F4K A;  3IG1 A;  3V1R A;  3ASM A;  1T05 A;  1KLM A;  1L3U A;  4FLU A;  4DSK A;  3L2Q A;  4B3O A;  3SUN A;  1RTD A;  4B9T A;  4W5O A;  4C8O A;  2Z1I A;  1TKZ A;  4OPK A;  2XY5 A;  1D8Y A;  4B9U A;  2RPI A;  3BDP A;  4FJI A;  4FJH A;  1JLC A;  1S9G A;  2VG6 A;  3C95 A;  3M8R A;  5C42 A;  1TGO A;  1ZBF A;  4DQQ A;  1U49 A;  1NKB A;  1S6Q A;  2YKM A;  5KI6 A;  1A5X A;  1HNV A;  1HQE A;  1UOC A;  3MXI A;  2PYL A;  4W5N A;  4AHR A;  5E41 A;  4DQR A;  5FRN A;  3VQE A;  3KIO A;  5HRN A;  3HXM A;  3RMC A;  3PV8 A;  3QO9 A;  3DLR A;  4CFD A;  4ELT A;  3QER A;  4AHS A;  3QNN A;  4KO0 A;  1MU2 A;  4DFK A;  1S1V A;  4DTU A;  4NYF A;  4GW6 A;  3NGI A;  3PX4 A;  4AHC A;  3LZI A;  4FJK A;  1SUQ A;  5K14 A;  3NGY A;  3SYZ A;  4CES A;  2YV0 X;  4O5B A;  1RBR A;  4RW8 A;  4KHU A;  3PUF A;  4DTJ A;  4CEO A;  4O0J A;  4NCA A;  4OJR A;  1VRU A;  1JLG A;  5KGW A;  1JLQ A;  5HRP A;  1TL1 A;  3HJF A;  4DSJ A;  4UQG A;  1RT2 A;  3CM6 A;  4FZY A;  3S9H A;  4OPJ A;  4QCL A;  4Y1C A;  1NKE A;  3O4Q A;  2B4J A;  4E7K A;  4FJ8 A;  4QOZ B;  2HVH A;  4B08 A;  2G8H A;  1NKC A;  3D45 A;  2KZZ A;  1KFS A;  2FBY A;  4DU3 A;  3LAM A;  1BCM A;  1WAJ A;  2E4L A;  2QK9 A;  3AO3 A;  3DYA A;  1ASV A;  3P1G A;  1LAW A;  2NUB A;  3DLK A;  3SUQ A;  4J2E A;  4FJ5 A;  4ICL A;  3AA5 X;  1WN7 A;  2IGI A;  3MXJ A;  4FW1 A;  4CIE A;  3QEW A;  3HP9 A;  1I39 A;  2DFE A;  4C8N A;  4B9S A;  2XY6 A;  3V9Z A;  1C0T A;  1DTQ A;  3DOL A;  3AVM A;  3AVN A;  1TKX A;  4KFB A;  4FLY A;  1T8E A;  4DTN A;  4CGG A;  1C1B A;  5J2P A;  3C6U A;  3HPH A;  4CGF A;  4DS5 A;  2VG7 A;  3LPU A;  4CF8 A;  1D5A A;  2HB5 A;  4CJE A;  1XWL A;  3NE6 A;  3KK1 A;  4C8M A;  1LAV A;  2RF2 A;  3LP2 A;  1UWB A;  2ETJ A;  4O55 A;  2A1S A;  3OYG A;  4B8C A;  4M3Y A;  2YNF A;  1A5V A;  3OVN A;  4DTP A;  1QSL A;  2G8U A;  3BGR A;  3ZT0 A;  1R0A A;  3KLE A;  5CY4 A;  4CJ5 A;  3DM2 A;  3VQP A;  3O3F A;  1IH7 A;  3S3O A;  2GV9 A;  1CZ9 A;  3AA2 A;  4DTR A;  1S1W A;  1J53 A;  4CJQ A;  4CJK A;  1RDB A;  4W5Q A;  3OJS A;  2W42 A;  3RMB A;  1JL2 A;  4FLZ A;  4DQS A;  4I9Q A;  3ISN C;  5FRM A;  1RBT A;  3AVL A;  3ZSQ A;  2GUI A;  3ZT1 A;  5T7B A;  4M3R A;  2OZM A;  4EZ6 A;  1FK9 A;  1WLJ A;  3DOK A;  3NF7 A;  4CJS A;  1IO2 A;  1JLB A;  2LSN A;  4DF8 A;  4IKF A;  2KZM A;  2G8I A;  4CK3 A;  4CEE A;  3DI6 A;  3KK2 A;  3WNG A;  4R5P A;  4JS4 A;  1NK8 A;  4CJ4 A;  3RR8 A;  1VSH A;  1NK4 A;  1Y97 A;  1NJW A;  2X6N A;  1HRH A;  1TK8 A;  3AVG A;  1C0U A;  2ATQ A;  3AVF A;  3P83 D;  3OYN A;  3IRX A;  1RT7 A;  3HPG A;  2E6L A;  4CF1 A;  4DLE A;  4BE2 A;  4FLW A;  4FLV A;  2PZS A;  3LDS A;  1J54 A;  1TVR A;  1HPZ A;  3RTV A;  4RW6 A;  3LPT A;  3OYD A;  5CZ2 A;  3OYF A;  2QKK A;  3LAN A;  3MEC A;  4FJL A;  4DTX A;  1SL1 A;  4PY5 A;  4ZTJ A;  4Z4C A;  4FM0 A;  1L5U A;  4KB1 A;  4RW7 A;  4LSN A;  2WOM A;  4FJ9 A;  1GOB A;  3PO4 A;  1F21 A;  5JS1 A;  4BAC A;  2HHT A;  1RCH A;  3EY1 A;  4KPY A;  1XI1 A;  3RR7 A;  2HHU A;  1Z26 A;  3QNO A;  1L3S A;  3OS0 A;  3ZSZ A;  3C94 A;  3JSM A;  3DLH A;  1RNH A;  4AHU A;  3ZT2 A;  3QIN A;  3K2P A;  3K5N A;  2B5J A;  4CIF A;  3SUO A;  1FKO A;  4N56 A;  4CHP A;  2ZE2 A;  1VSM A;  4PA1 A;  3HM9 A;  1NK0 A;  2HNY A;  4N41 A;  1ZBI A;  4FJ7 A;  2P1J A;  3LWM A;  2JGU A;  3NF8 A;  4I9L A;  3SPY A;  2KFN A;  3KLH A;  1NJZ A;  4CER A;  3NDK A;  4HTU A;  1NOY A;  1C6V A;  4OVL A;  3CFO A;  3K5L A;  3CFR A;  3OYI A;  4PQU A;  3WNH A;  4NYN A;  3HYF A;  4E1N A;  2R7Y A;  1BGX T;  3AO4 A;  3ZSW A;  3AA3 A;  2O4I A;  3RRG A;  4CFC A;  1NK5 A;  3QLH A;  3NH2 A;  3EZ5 A;  1ZBL A;  4Z4H A;  4FK2 A;  2ZQB A;  4CJV A;  4YFU A;  1ZYQ A;  2X78 A;  3PX0 A;  4FJX A;  1B9F A;  2FBX A;  3CG7 A;  1RT4 A;  3C6T A;  1TK5 A;  2G8W A;  1QHT A;  2RKI A;  3SCX A;  1RT5 A;  4DMN A;  2HNZ A;  4AHT A;  4BWJ A;  4CHO A;  4E0D A;  4OKK A;  3SQ1 A;  1T03 A;  4DQP A;  3OYK A;  3MED A;  1TAQ A;  3ZT4 A;  4I2P A;  3WNE A;  3TAN A;  3OS2 A;  3V4I A;  4AHV A;  1VSE A;  2YKN A;  3AA4 A;  2I5J A;  3OYM A;  1N6Q A;  1YT3 A;  4KV8 A;  4NCB A;  2ITG A;  4F8R A;  2OPQ A;  4HUF A;  1RDA A;  4FW2 A;  3PY8 A;  3OYE A;  4FK0 A;  4DFP A;  4FK4 A;  4KI6 A;  2DTU A;  3K59 A;  2VG5 A;  1X1P A;  4FLT A;  4F3O A;  3NBP A;  1BL3 A;  1QE1 A;  1ZBU A;  3DMJ A;  1VSD A;  1SKR A;  3TAE A;  3MXM A;  1HYZ A;  3L8B A;  3RRH A;  1CZB A;  3SNN A;  4KHY A;  3K5O A;  3WNF A;  3KJV A;  3QEI A;  4KHS A;  3SUP A;  3O4N A;  2YNH A;  4F3T A;  2P5G A;  4F2S A;  4CJ3 A;  3G10 A;  1S6P A;  3U3G A;  3TAF A;  3HO1 A;  3KK3 A;  2D0A A;  2KFZ A;  1VSK A;  2P5O A;  4WE1 A;  4FJG A;  4KTQ A;  4IG3 A;  1KSP A;  1JKH A;  2PYJ A;  4DU4 A;  2Z1J A;  4EP4 A;  1U48 A;  2VWJ A;  4KHQ A;  4LY7 A;  1SKW A;  4ZTF A;  1ZBH A;  5HRS A;  1VSF A;  5C25 A;  2X6S A;  5CYQ A;  3AO1 A;  3LP1 A;  3NF9 A;  2D0C A;  4O0I A;  4Z4G A;  1C0M A;  4JLH A;  5CZ1 A;  1WSG A;  4BWM A;  3IS9 A;  4E7H A;  4ELV A;  2G8V A;  4IBN A;  4ID5 A;  3V6D A;  1SL0 A;  1VSL A;  4DQI A;  5SWM A;  3NCI A;  3CYM A;  2HHV A;  1B9D A;  3SZ2 A;  1BQM A;  1GOA A;  1HQU A;  3V9W A;  4JRQ A;  2DY4 A;  1RBU A;  4F2R A;  4DSL A;  3HP6 A;  3TI0 A;  4FM2 A;  3NH0 A;  4N47 A;  4DS4 A;  1J9A A;  4CED A;  2XO7 A;  3NAE A;  3VQ5 A;  2KW4 A;  4DLG A;  3OYH A;  3HL8 A;  4DTM A;  4M3T A;  3ZCM A;  1HYS A;  2E6M A;  4G1Q A;  3O3H A;  3ULD A;  2Q3S A;  3PX6 A;  3QET A;  3SQ0 A;  4HCC A;  4FZX C;  4OKJ A;  5CYM A;  2IDO A;  1FKP A;  3ZSO A;  2A1R A;  3QIP A;  4L8R B;  3DRR A;  2BGG A;  3DLE A;  3MEE A;  4FM1 A;  1BI4 A;  1W9H A;  2YNI A;  4BE0 A;  3VQ9 A;  3B6O A;  1KVB A;  4E3S A;  5J2M A;  4KHN A;  4C8K A;  1LWC A;  3TAB A;  3LAL A;  3SJJ A;  3KLG A;  3VQD A;  1IG9 A;  4RW9 A;  1QSY A;  3K58 A;  3NGZ A;  3L2V A;  1WAF A;  2Z1G A;  3T1A A;  4LSL A;  4BDZ A;  5J2Q A;  2PY5 A;  4OLA A;  4CGJ A;  1VSJ A;  4DF4 A;  5C24 A;  1TV6 A;  4HCB A;  3JYT A;  4N76 A;  2F8T A;  4MQ3 A;  1X9M A;  3HVT A;  3QEV A;  3KD5 E;  4DTO A;  3L2U A;  2KTQ A;  1RTI A;  4XIU A;  1ASU A;  1WSH A;  4CK1 A;  1JLF A;  4KTZ A;  1UAX A;  3AVA A;  4DTS A;  4CFB A;  3QEX A;  4CEC A;  2G8F A;  2D5R A;  3OYB A;  4KHW A;  4CHZ A;  2JLE A;  4E89 A;  4N5S A;  3DRP A;  2IS3 A;  3A2F A;  1A5W A;  1G15 A;  3D0P A;  4M3Z A;  2Y1I A;  1VSI A;  4CJT A;  3TAP A;  3TAQ A;  4CJP A;  3QES A;  4EZ9 A;  1EKE A;  1KVA A;  3VN5 A;  1JL1 A;  3LWL A;  1WNS A;  1K6Y A;  3VQC A;  1X9W A;  2YHA A;  4B9V A;  1UA1 A;  4KTW A;  1ITG A;  4J2A A;  3VQA A;  1BIU A;  3SPZ A;  1HYV A;  4FZZ A;  1JLA A;  2B6A A;  4Q5V A;  3HVR A;  5D3G A;  3AVH A;  1RTJ A;  3NFA A;  4OKE A;  4M41 A;  4CGI A;  3H08 A;  1JLE A;  2RN2 A;  3OY9 A;  4GVM A;  4RG8 A;  3EYZ A;  1BHL A;  5I42 A;  1Q9X A;  4C8L A;  4OGC A;  5HLF A;  1SKS A;  2FBV A;  4I7F A;  4JRP A;  1U45 A;  4GMJ B;  3T3F A;  1CXU A;  5KGX A;  3S3N A;  5KTQ A;  3HT3 A;  3U6F A;  5KRT A;  3K5M A;  2OA8 A;  4CF2 A;  5JS2 A;  4KKO A;  4CJW A;  1VRT A;  5HRO A;  5EU7 A;  3TAM A;  1I3A A;  4DG1 A;  1KCF A;  4CFA A;  1ASW A;  3SV3 A;  4CCH A;  4OLB A;  3OYJ A;  5KRS A;  4M3X A;  1BIZ A;  4CHY A;  3OYA A;  4DSI A;  3S3M A;  1NK6 A;  1TL3 A;  3FFI A;  1NK7 A;  4CIG A;  4IFY A;  2WON A;  4HHT A;  4CEZ A;  1IKX A;  4LD0 A;  3ZT3 A;  1WSI A;  4HVJ A;  1TKT A;  3AVB A;  1REV A;  1RBV A;  4KRF A;  2HW3 A;  1Z25 A;  1WSE A;  1NJX A;  4FVM A;  1B92 A;  4IDK A;  5FRO A;  3DLG A;  4CK2 A;  1JXB A;  3VA3 A;  4B8A B;  3K57 A;  4FJM A;  2OZS A;  3HST B;  3O3G A;  4KRE A;  1U4B A;  1L3T A;  4W5R A;  3ZSV A;  3M8P A;  5J2N A;  4DSE A;  2F96 A;  1QS4 A;  4PUO A;  3KLF A;  3LP3 A;  4CJL A;  2BDP A;  5HP1 A;  4FYD A;  2HHX A;  4CF0 A;  4E7J A;  2VWK A;  3AVK A;  3MAQ A;  1TKD A;  1RT6 A;  3THV A;  1LV5 A;  1X9S A;  3CM5 A;  4ID1 A;  3V81 A;  1FXX A;  2XY8 A;  3AVI A;  3QIO A;  4CGD A;  2FC0 A;  3KKR A;  2O4G A;  3RWU A;  3VQQ A;  4CEQ A;  4FLX A;  3KKS A;  3F9K A;  3LP0 A;  2Y1J A;  1QTM A;  4BDY A;  1U47 A;  2GBZ A;  1RT3 A;  4CF9 A;  1U04 A;  2ZD1 A;  4M45 A;  3OS1 A;  1YTA A;  1RT1 A;  2QXF A;  4QAG A;  4CEB A;  3ALY A;  4OGE A;  1VK0 A;  3KTQ A;  2BAN A;  3V9U A;  1XHZ A;  3I0R A;  3VQB A;  3ZSR A;  2OPP A;  3E01 A;  4Z4E A;  4E7I A;  5J1E A;  4Z4F A;  2OPR A;  1CXQ A;  2IC3 A;  2FBT A;  4LH4 A;  4E7L A;  4CHN A;  1DTT A;  3HK2 A;  4J2B A;  1KVC A;  3DRS A;  1S1T A;  4H4O A;  4O4G A;  3VQ8 A;  4DFM A;  4FXD A;  2DFF A;  1EET A;  2YHB A;  4H8K A;  3V1O A;  1BCO A;  4ZHR A;  1S9E A;  4Z0U A;  2XY7 A;  2IOC A;  4B9L A;  1HJR A;  1W0H A;  2Z1H A;  4EP5 A;  3ZSX A;  3MEG A;  1LWE A;  2KQ2 A;  3TR8 A;  1IKV A;  4M42 A;  4J2D A;  3VQ6 A;  5FDL A;  5HBM A;  1QSS A;  3ITH A;  3AO5 A;  1RDD A;  5SZT A;  1S1X A;  1KFD A;  3M8Q A;  1JXE A;  3KD1 E;  1Q9Y A;  2QKB A;  1TAU A;  3NH1 A;  3AVC A;  4DWI A;  1SL2 A;  3NF6 A;  1BI4 B;  1HMV A;  3V9X A;  4M3W A;  4Y1D A;  3CQ8 A;  1XC9 A;  3T19 A;  4JS5 A;  2OYQ A;  2HHS A;  2XRI A;  4FJN A;  3RMD A;  1O1W A;  4CHQ A;  2P51 A;  3F73 A;  1YVU A;  4ELU A;  2D0B A;  1TK0 A;  3ZSY A;  3U3Y A;  4CJF A;  1XHX A;  3SQ2 A;  1CLQ A;  2HND A;  3AV9 A;  4MFB A;  4DU1 A;  1QQC A;  4CE9 A;  3OJU A;  1HNI A;  1L3V A;  3VQ7 A;  1LW0 A;  4CJU A;  2HMI A;  1RBS A;  1WSJ A;  1KLN A;  1DLO A;  1RIL A;  3LAK A;  3G0Z A;  1NJY A;  1S1U A;  2IAJ A;  4M3U A;  3AVJ A;  1D9F A;  3V1Q A;  2EHG A;  4B9N A;  4FJJ A;  1T7P A;  4B9M A;  1D9D A;  3CFP A;  1S5J A;  3PO5 A;  4CEA A;  3SQ4 A;  4AH9 A;  3L3V A;  3SV4 A;  3LZJ A;  3VA0 A;  3AO2 A;  4KAZ A;  1EX4 A;  3SI6 A;  4W5T A;  4CEF A;  4K8Z A;  3TAR A;  1SV5 A;  4HUG A;  3VQ4 A;  4E19 A;  3HPO A;  4RW4 A;  1IKY A;  2OPS A;  3KLI A;  1KRP A;  1EXQ A;  3IAY A;  3V9S A;  3DLB A; 
#chains in the Genus database with same CATH topology
 3H1Q A;  4DFJ A;  4BRL A;  3C6H A;  4OO1 J;  4CBW A;  3P5J A;  4IFV A;  3RMA A;  5KQ8 A;  1C1C A;  1BQN A;  1R59 O;  4I2Q A;  4JKG B;  2XHB A;  4KI4 A;  1WSF A;  4K8X A;  5I3U A;  4LH5 A;  3L2W A;  4LF5 K;  2YNG A;  4CZI A;  4FCY A;  4BE1 A;  4Z4I A;  1LWF A;  1RTH A;  4GV9 A;  1C1A A;  1LW2 A;  1GLD G;  3L3U A;  2HHW A;  3MWP A;  4BDP A;  4NCG A;  5AFU H;  4DSK A;  3L2Q A;  3AAP A;  4W5O A;  2RPI A;  1J5E K;  2CH5 A;  4JKF A;  5AQO A;  3M8R A;  1TGO A;  3RVC A;  1U49 A;  1S6Q A;  2PYL A;  1HQE A;  1NGD A;  4O8U A;  1NGJ A;  5FRN A;  3VQE A;  3KIO A;  5HRN A;  3FLC O;  2GEL A;  3HXM A;  4ELT A;  4CVN E;  4DFK A;  4KHP K;  3PX4 A;  4AHC A;  3NGY A;  2QM1 A;  5GIO A;  2YV0 X;  4RW8 A;  1JJ2 M;  4BVP A;  1JLG A;  5KGW A;  3MWT A;  4H0P A;  4BC2 A;  4BRN A;  5HRP A;  3CM6 A;  3S9H A;  1YIT N;  3O4Q A;  2B4J A;  4E7K A;  4M63 C;  2HVH A;  4EIA A;  1WAJ A;  2QK9 A;  3AO3 A;  4DV1 K;  4JD2 B;  4IJA A;  3DYA A;  1ASV A;  3O1B A;  1LAW A;  4ICL A;  3AA5 X;  1WN7 A;  2IGI A;  3CPE A;  4B9S A;  3ZET B;  4C8N A;  1I39 A;  4KFB A;  3IDH A;  4FLY A;  3D2F B;  3CCV N;  4BRF A;  1C1B A;  4JK9 A;  4CGF A;  1U2V B;  3E66 A;  1D5A A;  4CJE A;  3NE6 A;  3MCA B;  4C8M A;  3LP2 A;  2RF2 A;  3HI0 A;  4QS9 A;  4O55 A;  2ETJ A;  4M3Y A;  2YNF A;  1HUX A;  2FXU A;  5DM6 L;  1R0A A;  3KLE A;  3VQP A;  1CZ9 A;  3AA2 A;  1J53 A;  4CJQ A;  5KPT A;  2VGM A;  2FSJ A;  3VPZ A;  3RMB A;  4BG9 A;  3LDO A;  4I9Q A;  2D1K A;  2GUI A;  3ZT1 A;  4EZ6 A;  3BUZ B;  3EZW A;  1WLJ A;  2LSN A;  2G8I A;  4CEE A;  3DI6 A;  4R5P A;  1NK4 A;  1Y97 A;  1KAZ A;  1NLV A;  5AQR A;  2ASP A;  3OYN A;  3VEX A;  2P9L B;  1RT7 A;  2PZS A;  1VQ4 N;  1TVR A;  1HPZ A;  2YJE A;  4CBU A;  3VGL A;  3GL1 A;  4DTX A;  5EVZ A;  4Z4C A;  3VF6 A;  4ILJ A;  4RW7 A;  4FOI A;  2WOM A;  1FJG K;  3KWG A;  4BAC A;  1BWF O;  3WQT A;  3RR7 A;  1Z26 A;  3C65 A;  3QNO A;  4LFA K;  3OS0 A;  4KBO A;  4FWM A;  3DLH A;  1RNH A;  3QIN A;  3SUO A;  4DUY K;  4PA1 A;  1NK0 A;  3LDN A;  4BRH A;  2P1J A;  3R6M A;  2Q2R A;  4I9L A;  2FF3 B;  3KLH A;  3NDK A;  1NOY A;  4OVL A;  3G4S N;  3CFR A;  3WNH A;  2R7Y A;  4IDH A;  4DV4 K;  2O4I A;  3QFU A;  1YJN N;  1ZBL A;  4CJV A;  5LMU K;  3FFK B;  3RSE A;  4H5W A;  2X78 A;  1OH5 A;  4H0Y B;  3PX0 A;  4FJX A;  2FBX A;  1VHX A;  1RT4 A;  4YOT A;  3OA9 A;  2QWQ A;  1IV0 A;  1NMD A;  3L6Q A;  4F9O A;  4I2P A;  3WNE A;  3AA4 A;  5AQZ A;  3SAH A;  2ITG A;  3SK3 A;  2OPQ A;  3L0Q A;  4DFP A;  4FK4 A;  2QA4 N;  4DV7 K;  1QE1 A;  1SKR A;  3DMJ A;  4IZ9 A;  1VSD A;  1BOT O;  3TAE A;  3L8B A;  1XNQ K;  3K5O A;  3WNF A;  3KJV A;  3QEI A;  3SUP A;  4WF9 L;  4F3T A;  3FZH A;  3CD6 N;  3EE9 A;  3VF2 A;  4WQ5 C;  4BR5 A;  3FZM A;  1GLJ O;  2KFZ A;  4WE1 A;  2Z1J A;  4LY7 A;  4GY2 B;  1VQM N;  3CXC M;  4HWI A;  3MN9 A;  2GEM A;  4FWO A;  3THY B;  1WSG A;  3IS9 A;  4E7H A;  4ELV A;  5SWM A;  3CYM A;  1B9D A;  1GOA A;  2DY4 A;  1RBU A;  4DSL A;  3TI0 A;  2F4V K;  1P8Z A;  4CED A;  3NAE A;  2NNW A;  1HYS A;  3CCJ N;  2IVP A;  4HCC A;  3QET A;  2IDO A;  5AQX A;  3A5N C;  3HSC A;  1HKB A;  3MEE A;  1BI4 A;  2YNI A;  4BE0 A;  4CZF A;  4C8K A;  1LWC A;  3TAB A;  4BR0 A;  3O9T A;  3KLG A;  4GNI A;  4H5T A;  3SBG A;  3DXM A;  3KK7 A;  3NGZ A;  1BUP A;  4N76 A;  4DF4 A;  4HCB A;  3JYT A;  2F8T A;  2P9N A;  3KD5 E;  3CJ1 A;  4BRD A;  2WTU A;  4DR4 K;  4KTZ A;  4DTS A;  1UAX A;  4A2A A;  1XC3 A;  3AY9 A;  1G15 A;  4M3Z A;  4JKD A;  5AQK A;  1W7A A;  4EZ9 A;  4PKI A;  3LWL A;  3OHR A;  3N4P A;  4YOR A;  5FPE A;  4FWR A;  4KTW A;  3SPZ A;  4BC3 A;  1ZC6 A;  3R1X A;  3AVH A;  1RTJ A;  3OY9 A;  3EYZ A;  4RG8 A;  5I42 A;  1BHL A;  4X65 K;  2F9W A;  3LDP A;  3QIC A;  2FBV A;  4I7F A;  4JRP A;  2EWS A;  3T3F A;  2A5X A;  5B8H A;  1CXU A;  4IXC A;  3S3N A;  4H5N A;  5KTQ A;  4LF4 K;  3U6F A;  2OA8 A;  4CF2 A;  5HRO A;  4KKO A;  1VRT A;  5EU7 A;  5M1Q A;  3SV3 A;  4OLB A;  1KCF A;  4CCH A;  3OYJ A;  4M3X A;  4DSI A;  4JI1 K;  4CIG A;  5EY4 A;  1TKT A;  4IEE A;  3KHY A;  1B92 A;  4IDK A;  4BR4 A;  4CK2 A;  3VA3 A;  3DJC A;  3W3D A;  4B8A B;  3K57 A;  2VCP A;  2OZS A;  3HST B;  1U4B A;  1L3T A;  4W5R A;  4JAX A;  1MWK A;  2F96 A;  1RFQ A;  2ZF5 O;  4CJL A;  3WXM B;  2HHX A;  2YI1 A;  4E7J A;  1GLB G;  1VQ5 N;  3H45 C;  5HL7 L;  3V81 A;  4CZL A;  2J4R A;  4IFE A;  5FLX O;  4WCE L;  4B1Y B;  4C1N K;  2WC9 A;  3F9K A;  2NRR A;  4ISG A;  1HNW K;  2GBZ A;  2ZD1 A;  1YTA A;  3ZX0 A;  4CEB A;  3KTQ A;  2BAN A;  3I33 A;  2UUB K;  2OPP A;  4E7I A;  1S72 N;  2FBT A;  2DFF A;  4X62 K;  3C7N A;  1S9E A;  2IOC A;  5EXW A;  3ZSX A;  3AGK A;  1LWE A;  2V51 B;  1OH8 A;  3TR8 A;  1IKV A;  4HTL A;  1MDU B;  5SZT A;  5CHI A;  1KFD A;  3GG4 A;  5IT9 O;  2H3G X;  2WBN A;  1BI4 B;  3V9X A;  1OH7 A;  4Y1D A;  2HHS A;  2XRI A;  4FJN A;  3FE1 A;  3F73 A;  1YVU A;  3U3Y A;  3CF5 L;  3DXM B;  3SQ2 A;  4MFB A;  4CE9 A;  3OJU A;  1L3V A;  3E9P A;  3VQ7 A;  4NO7 A;  1LW0 A;  1WSJ A;  2I7N A;  2HST A;  3LAK A;  3G0Z A;  2QI2 A;  1T7P A;  2P9S A;  3CFP A;  4AH9 A;  2IIR A;  3SI6 A;  3TAR A;  4HUG A;  3HPO A;  4KH4 A;  3KLI A;  4FPB A;  4CI6 A;  3V9S A;  1VQ9 N;  4AIL C;  1IKW A;  4JKG A;  4IG0 A;  1J5O A;  3CCE N;  3GDQ A;  1Q8I A;  2P9K A;  1IG8 A;  3UIQ A;  2HBM A;  3I0S A;  1YTU A;  3TWH A;  1N5Y A;  2X74 A;  1X9J A;  4H4M A;  1BG3 A;  4BRC A;  2DFH A;  4O44 A;  3NHG A;  4B1X B;  3OYL A;  3L2R A;  3ENO A;  4FWN A;  1RDC A;  4DV6 K;  3V1R A;  4BRE A;  3ASM A;  1T05 A;  1L3U A;  3W0L A;  1YF5 L;  2Z1I A;  3ENB A;  2ITM A;  3EE8 A;  1S9G A;  3PLA A;  4DQQ A;  1A5X A;  1HNV A;  1UOC A;  3QFP A;  5E41 A;  5LJV A;  4DQR A;  3RMC A;  3BP8 A;  3WT0 A;  1OVY A;  4FOE A;  1N33 K;  3SYZ A;  2HOE A;  4JHD A;  4CES A;  5BN9 A;  4NCA A;  4OJR A;  5C15 A;  1TL1 A;  1RT2 A;  3LDQ A;  4Y1C A;  3IFR A;  4B08 A;  4JKE A;  1FW6 A;  3D45 A;  3UE5 A;  4GKJ K;  1NGC A;  2W6K A;  2NUB A;  3DLK A;  4ILG B;  5GAE P;  3TPQ A;  4FW1 A;  4DUZ K;  2W40 A;  3HP9 A;  4LF7 K;  2DFE A;  2HF4 A;  3BZK A;  1C0F A;  5AQS A;  3VER A;  4FVU A;  3CC2 N;  2AA4 A;  4B1Z A;  1T8E A;  4CGG A;  5J2P A;  2FLO A;  3HPH A;  4DS5 A;  3LPU A;  3WXK A;  3VGK A;  3OYG A;  3D7E O;  4A61 A;  5GIP A;  3UKU B;  1KC8 O;  1N32 K;  3OVN A;  3OBY A;  2G8U A;  3O4W A;  2BH1 A;  1NG9 A;  3S3O A;  4FWP A;  5AQQ A;  1NGI A;  2HBK A;  1S1W A;  1RDB A;  5FRM A;  3ISN C;  4MLE A;  1LOT B;  2AP1 A;  1IO2 A;  3MK6 A;  4DR7 K;  2P9L A;  2KZM A;  5GAD P;  3KK2 A;  2VGN A;  4JS4 A;  1VSH A;  1HPM A;  1NJW A;  4AQY K;  2P9S B;  4O8K A;  3P83 D;  3AVF A;  4DLE A;  4CJ7 A;  4BE2 A;  3LDS A;  1J54 A;  1WB9 A;  3OYD A;  1HKC A;  1XQS C;  1Z6R A;  3EKU A;  3LAN A;  4ZTJ A;  1L5U A;  2ZJP L;  5AQN A;  3TU5 A;  5CE3 A;  2FF6 A;  1GOB A;  3HOT A;  3THW B;  2HHT A;  2HHU A;  1NWK A;  1GLC G;  2P9K B;  1NGE A;  4FL9 A;  4WQ4 A;  1YXQ A;  3BF1 A;  4BRI A;  3C94 A;  5BPN A;  3ZT2 A;  4C1N I;  3UB5 A;  2E2Q A;  1FKO A;  2FSN A;  4CHP A;  4N56 A;  2ZE2 A;  3E1Y A;  1TYQ A;  3PSF A;  5EX5 A;  4WFB L;  3CFO A;  3K5L A;  2HHH K;  4E1N A;  3R9P A;  4JI7 K;  2UU9 K;  4CFC A;  2Q97 A;  4DHY A;  3EZ5 A;  1V4T A;  4Z4H A;  4FK2 A;  2ZQB A;  5AZJ A;  2Q36 A;  5KPZ A;  5C0Y A;  3CG7 A;  2P9I A;  4B3S K;  1JCF A;  5I9E B;  1YI2 N;  1QHT A;  4ISE A;  3SCX A;  5JVH L;  4DMN A;  1NGA A;  2HNZ A;  4OKK A;  3MED A;  1DEJ A;  3ZT4 A;  3OS2 A;  3V4I A;  2YKN A;  4GKK K;  2I5J A;  3HRG A;  1YT3 A;  4HUF A;  3O6W A;  5JMV A;  1WOQ A;  2Q0U A;  3O9S A;  4KI6 A;  2DTU A;  3K59 A;  2VG5 A;  3NBP A;  5EOY A;  4JHD B;  1HYZ A;  3RRH A;  5M1F A;  4MO5 A;  3SNN A;  4A2B A;  1NJI O;  3O4N A;  2YNH A;  2A40 A;  2QTD A;  3U3G A;  1T44 A;  3CPW M;  1N36 K;  1XNR K;  2YCH A;  1KSP A;  4K42 A;  5AJ3 K;  3S41 A;  3THY A;  2VWJ A;  1VQO N;  1SKW A;  4KHQ A;  1ZBH A;  5HRS A;  1VSF A;  4BRG A;  2X6S A;  5C25 A;  4CZE A;  5CYQ A;  3VGM A;  2I7P A;  1K9M O;  4B1V A;  2E5L K;  2D0C A;  4O0I A;  1C0M A;  5CZ1 A;  2D0O A;  3F9M A;  1VSL A;  1YAG A;  3GE1 A;  2GTD A;  5AZI A;  5GIN A;  3HP6 A;  4DS4 A;  1J9A A;  4K41 A;  4IOX A;  4MO4 A;  3VQ5 A;  2KW4 A;  4DTM A;  3OYH A;  4M3T A;  3U9D A;  2E6M A;  3O3H A;  3PX6 A;  2Q3S A;  4OKJ A;  1DKG D;  5CYM A;  1FKP A;  3ZSO A;  4BQL A;  3DLE A;  1W9H A;  4DR5 K;  4KHN A;  1U6Z A;  1KVB A;  3UKR B;  1W97 L;  5AQU A;  3VQD A;  1IG9 A;  4H5R A;  4RW9 A;  1WAF A;  3T1A A;  4LSL A;  5J2Q A;  3P39 A;  1TV6 A;  2IVN A;  1X9M A;  3QEV A;  4DTO A;  5E84 A;  1RTI A;  2ZGZ A;  1WSH A;  1JLF A;  2G8F A;  2HF3 A;  2D5R A;  3TTF A;  3OYB A;  4CHZ A;  3CCM N;  2Q1N A;  1A5W A;  3D0P A;  2Y1I A;  1VSI A;  3SBT A;  3OW2 M;  3QES A;  1EKE A;  2RE2 A;  1RGI A;  2NRV A;  1SQK A;  1YHQ N;  3G6E N;  4A57 A;  3VQA A;  4FZZ A;  4YOY A;  1N34 K;  3CCL N;  2B6A A;  3HVR A;  3H08 A;  1JLE A;  4OGC A;  5HLF A;  4H0T B;  1VQP N;  2ZM6 K;  4CW7 B;  3O9R A;  2O8C A;  1TYQ B;  2GWK A;  4NLB A;  2W41 A;  2E1Y A;  5KRT A;  3VTH A;  3Q7B A;  3TAM A;  3THX A;  4DG1 A;  3T1H K;  4IOC L;  2PBD A;  1BIZ A;  5AZJ B;  4K43 A;  4CHY A;  2PFU A;  3DLB A;  4K25 A;  3H46 O;  2P9I B;  4HHT A;  3B8A X;  1IKX A;  3ZT3 A;  1WSI A;  4YDU C;  3M3Z A;  4KRF A;  4BGB A;  2A3Z A;  1Z25 A;  1NJX A;  3G71 N;  5FRO A;  3DLG A;  3QDK A;  1JXB A;  2YJF A;  3MDQ A;  3AGR A;  2UUA K;  3O3G A;  2BUP A;  3ZSV A;  4MLH A;  3M8P A;  4DV2 K;  5J2N A;  2YX6 A;  4PUO A;  3KLF A;  5FPM A;  1JCG A;  1Q18 A;  5HP1 A;  3VEV A;  2VWK A;  3AVK A;  3THV A;  3VET A;  5AQG A;  2UYT A;  2FC0 A;  3KKR A;  5MLC Q;  1IJJ A;  4O5F A;  3RWU A;  3VQQ A;  2GUP A;  3KKS A;  2Y1J A;  3IKM A;  5TKW A;  4CF9 A;  1U04 A;  3OS1 A;  3FR0 A;  3NMU A;  1N8R O;  3L4Q A;  4G9Z A;  3T1Y K;  3OBW A;  4OGE A;  2OTJ N;  2NRW A;  1XHZ A;  3E01 A;  3VEY A;  2Q0R A;  2OPR A;  5H1S Q;  4E7L A;  5FPN A;  3BF3 A;  4CHN A;  4CZG A;  1DTT A;  1KVC A;  3DRS A;  3VQ8 A;  4QS7 A;  3V1O A;  5AZI B;  2F7T A;  4I6M A;  1HJR A;  1W0H A;  1M90 O;  4CBX A;  4J2D A;  3VQ6 A;  1QSS A;  4FO0 A;  2QKB A;  1TAU A;  1S1X A;  3KD1 E;  3ULE A;  1T6D A;  4DWI A;  4NXN K;  1VQK N;  4DR6 K;  1BA0 A;  4MDB A;  4H0V B;  3P38 A;  1QQN A;  4EHT A;  4PL8 A;  4ELU A;  1T3V A;  3ZSY A;  3TSU A;  3ID6 A;  1CLQ A;  2UUC K;  2HND A;  3AV9 A;  3DXK A;  4CJU A;  3SJH A;  2EHG A;  3V1Q A;  4J8F A;  1K8K B;  1NGG A;  5BRE A;  4JNE A;  4JI6 K;  1RDU A;  4K8Z A;  1SV5 A;  5GAH P;  1IKY A;  1EXQ A;  3Q7C A;  2E2P A;  3CJ7 A;  5KQD A;  4A62 A;  4E1M A;  2O8F A;  3KZB A;  2ASM A;  3HTV A;  5DK5 A;  3CQX A;  3MMV A;  3TSQ A;  4BGA A;  2AJQ A;  2HHQ A;  4LF8 K;  2O8C B;  1NK9 A;  5AQP A;  3CME N;  1EP4 A;  4YNQ A;  3M8S A;  3WXL A;  3THX B;  3TSP A;  3EEQ A;  3SUN A;  1RTD A;  4B9T A;  4C8O A;  2XY5 A;  1TKZ A;  3BDP A;  4FJI A;  4FJH A;  4DV0 K;  4IOA L;  2VG6 A;  1YVN A;  1ZBF A;  1NKB A;  2YKM A;  3C0B A;  5KI6 A;  3MXI A;  2JWK A;  4WYB A;  4LF9 K;  3PV8 A;  3QO9 A;  4Y0W A;  4AHS A;  3QNN A;  1MU2 A;  4NYF A;  4GW6 A;  3LZI A;  3U4L A;  1SUQ A;  5K14 A;  2GWJ A;  1IBL K;  4O5B A;  1RBR A;  2D4W A;  2QW9 A;  4KHU A;  4CEO A;  1E3M A;  4O0J A;  4IO8 A;  4PHT X;  2ZWH A;  1JLQ A;  3A5M C;  4XH1 A;  2D0P A;  1WUA A;  3HJF A;  4DSJ A;  4FZY A;  4OPJ A;  4QCL A;  1NKE A;  4BRM A;  1T6C A;  5AQI A;  1EO1 A;  2V52 B;  5M1P A;  2KZZ A;  2FBY A;  4DU3 A;  3E9O A;  1BCM A;  2E4L A;  3LAM A;  3A5O C;  5LL6 Z;  4FWL A;  3HM8 A;  3SUQ A;  4J2E A;  4FJ5 A;  4BG8 A;  3MXJ A;  1J6Z A;  2XY6 A;  3V9Z A;  1C0T A;  3DOL A;  2YHX A;  3AVM A;  3AAR A;  3UKU A;  3J7Y P;  3C6U A;  2VG7 A;  2HB5 A;  1ZXO A;  2QEX N;  4X66 K;  3O80 A;  4I6M B;  3J81 O;  3KK1 A;  1ILY A;  2A1S A;  1OH6 A;  4B8C A;  1QSL A;  3BGR A;  3EL2 A;  3ULE B;  3ZT0 A;  3HOS A;  4BVO A;  3O9U A;  4CJ5 A;  4DR2 K;  4LF6 K;  2GV9 A;  4DTR A;  3OJS A;  2O8D A;  2W42 A;  1JL2 A;  1RBT A;  3CJB A;  3AVL A;  5T7B A;  4M3R A;  4CJS A;  2QWM A;  4IKF A;  2CGL A;  3DXK B;  5C12 A;  4CK3 A;  3O08 A;  4JI0 K;  3RR8 A;  3WNG A;  1VQ6 N;  3WXJ A;  1TK8 A;  3AVG A;  1C0U A;  1MWM A;  2ATQ A;  4R79 A;  4CZM A;  4FLV A;  2E6L A;  4H0O A;  4CF1 A;  1ATS A;  2VWB A;  1HNX K;  2ZJR L;  4DB3 A;  4YOW A;  1WBD A;  3LPT A;  4BRA A;  5DM7 L;  3OYF A;  2QKK A;  3THW A;  3JS6 A;  4FM0 A;  4KB1 A;  1F21 A;  5ADX A;  1LCU A;  2QWO A;  4RCH A;  2UXD K;  1XI1 A;  1V4S A;  2O8F B;  4CD1 A;  1L3S A;  1NM1 A;  3SAF A;  1VQ8 N;  3K2P A;  1Y64 A;  4CIF A;  1ZBI A;  3HM9 A;  4YOU A;  3K9J A;  3SPY A;  4NB4 A;  4JI2 K;  3OYI A;  4PQU A;  4DR3 K;  3I55 N;  1BGX T;  3AO4 A;  3QLH A;  3NH2 A;  3CET A;  4YFU A;  4JN4 A;  1HLU A;  1B9F A;  4YHH K;  3C6T A;  1DT9 A;  2VYP A;  1RT5 A;  1VAZ A;  1X3M A;  1T03 A;  4DQP A;  3OYK A;  3A8Y A;  4AHV A;  1KQS M;  1VSE A;  3OYM A;  4CD3 A;  4NCB A;  4F8R A;  3CHW A;  1RDA A;  4FW2 A;  3PY8 A;  4WFA L;  1I94 K;  4FLT A;  1X1P A;  4F3O A;  3QBX A;  1BL3 A;  3FZK A;  4CZJ A;  3WEE B;  5LMN K;  2V7Y A;  5AR0 A;  2P5G A;  4F2S A;  4CJ3 A;  3G10 A;  2NLX A;  1S6P A;  3TAF A;  1GLL O;  3KK3 A;  4GV6 A;  2P5O A;  4KTQ A;  4FJG A;  4IG3 A;  1JKH A;  4DV5 K;  2PYJ A;  1NU0 A;  4EP4 A;  1U48 A;  2QWP A;  1Q7Y O;  3EO3 A;  4ZTF A;  3AO1 A;  3LP1 A;  3NF9 A;  5GAG P;  4JLH A;  1S3X A;  3SMP A;  3I8B A;  4ID5 A;  4DQI A;  4A5A A;  2HHV A;  5AFU A;  4JEP A;  1BQM A;  1HQU A;  3V9W A;  3ATV A;  1ESV A;  3CQY A;  2HMP A;  4LC9 B;  4FM2 A;  3NH0 A;  4FWQ A;  4N47 A;  2XO7 A;  3HL8 A;  3VES A;  5C10 A;  3ULD A;  4FZX C;  3UKR A;  2A1R A;  4L3Q A;  3DRR A;  3NVK A;  4QS8 A;  4E3S A;  2QWR A;  2OCE A;  1GLE G;  1QVG M;  2O8D B;  3H1V X;  4XEI A;  3EN9 A;  3G25 A;  2PY5 A;  3LM9 A;  1GLA G;  1VSJ A;  2DPN A;  4WQ5 A;  4MQ3 A;  3HVT A;  3L2U A;  2KTQ A;  4XIU A;  4KHW A;  3AVA A;  4CFB A;  5M1K A;  2O8E A;  2JLE A;  4N5S A;  4BC5 A;  4MDA A;  3DRP A;  2IS3 A;  1TUU A;  2E1Z A;  3M6G A;  3TAP A;  2A42 A;  5JVG L;  1KVA A;  3J7A P;  5M1N A;  1WNS A;  3T69 A;  1X9W A;  4B9V A;  4NLC A;  1UA1 A;  1ITG A;  4J2A A;  4BRK A;  3J7Z O;  1HYV A;  1O13 A;  5D3G A;  4OKE A;  1TK5 A;  4M41 A;  2G8H A;  2NRZ A;  2RN2 A;  4C8L A;  5F1X A;  1SKS A;  2JWL A;  3KVG A;  3FGU A;  3JAM O;  5AQJ A;  3NVM A;  3K5M A;  4DQ8 A;  1YJW N;  3P4I A;  4X64 K;  5KRS A;  3OYA A;  3K9K A;  2OTL N;  3U8X A;  1NK6 A;  1TL3 A;  4IFY A;  1QZ6 A;  1KAX A;  4HVJ A;  3AVB A;  4BQZ A;  1HKG A;  3CER A;  2A6A A;  4YOV A;  1H1V A;  3O8M A;  4FJM A;  1OKJ A;  3GOI A;  2RHK A;  4KRE A;  3MCP A;  1QS4 A;  2O8B B;  3LP3 A;  3I56 N;  5HOO A;  4FYD A;  4JKA A;  3GBT A;  1D4X A;  3MAQ A;  1TKD A;  2QWN A;  1X9S A;  4ID1 A;  2P9P A;  3AVI A;  4CGD A;  4CEQ A;  4FLX A;  4BDY A;  1RT3 A;  1EQY A;  5BPL A;  3LL3 A;  3ZEU A;  1RT1 A;  3MN5 A;  3ALY A;  1VK0 A;  4E1J A;  3I0R A;  3VQB A;  3ZSR A;  2ASO A;  2VQF K;  4BR7 A;  4Z4F A;  3PIO L;  2P9U A;  3HK2 A;  4H4O A;  4JK8 A;  4JI3 K;  1BCO A;  4ZHR A;  4Z0U A;  1VQ7 N;  3IMX A;  4B9L A;  2F9T A;  4RTF D;  3SMS A;  4GV3 A;  3J8A A;  4LFC K;  3ITH A;  3AO5 A;  1RDD A;  3M8Q A;  1JXE A;  1X3N A;  1Q9Y A;  1SS6 A;  3WQU A;  1SL2 A;  1HX1 A;  3J80 O;  3QB0 A;  3LDL A;  1K8A O;  3O5B A;  2IVO A;  3ID8 A;  2P51 A;  4JI4 K;  2D0B A;  2W6L A;  4CJF A;  5A2Q O;  4DU1 A;  3LM2 A;  5F2R A;  1QQC A;  3KWI A;  1K8K A;  3ENH A;  5AQF A;  1RBS A;  1RDW X;  1DLO A;  1RIL A;  2IAJ A;  3VMF B;  3AVJ A;  5LY3 A;  1D9F A;  3ZX3 A;  4B9M A;  4DV3 K;  1D9D A;  1S5J A;  5AQL A;  3SQ4 A;  2O8E B;  3SV4 A;  3VA0 A;  4XH5 A;  4W5T A;  3CCS N;  4E19 A;  4IO9 L;  3VOV A;  1KRP A;  3IAY A;  1VQN N;  1UA0 A;  3OYC A;  5AQY A;  1BIS A;  1NOZ A;  4CGH A;  3PIP L;  2F8S A;  2G8K A;  1KAY A;  1IBK K;  4PWD A;  2BE2 A;  4HUE A;  4A5B A;  3QEP A;  4BR9 A;  5JIC A;  4KB0 A;  5HRR A;  5JLH A;  1GOC A;  4Q0B A;  4DSF A;  3B6P A;  1KTQ A;  2HVI A;  1SAZ A;  4M7X A;  5CR4 A;  3VEW A;  3I8D A;  5DMR A;  2E8A A;  3CCR N;  3H6E A;  1NBW A;  2EX3 A;  3FZL A;  3ATU A;  4AM6 A;  4CJR A;  3F2K A;  3TAG A;  3A5L C;  2KLA A;  4TSX A;  5C2D A;  4F4K A;  4OX9 K;  3IG1 A;  3O9Q A;  1KLM A;  4FLU A;  4B3O A;  3VEO A;  4OPK A;  1D8Y A;  4B9U A;  1JLC A;  4LFB K;  1YUW A;  4EAH D;  3OTO K;  3C95 A;  4C23 A;  4BR2 A;  5C42 A;  4W5N A;  4B1U B;  4AHR A;  4BY9 C;  1YJ9 N;  3DLR A;  4CFD A;  3QER A;  1CZA N;  4KO0 A;  3QML A;  1S1V A;  3CCQ N;  4DTU A;  3NGI A;  4FJK A;  1KXP A;  4B3R K;  2FSK A;  4AM7 A;  3PUF A;  4DTJ A;  1QQO A;  3L4I A;  1VRU A;  4EHU A;  3VTI A;  4UQG A;  2P9P B;  3HZ6 A;  3DWL A;  4FJ8 A;  2BTF A;  1KD1 O;  4QOZ B;  3BY5 A;  1NMN A;  5FPD A;  4WFN L;  1NKC A;  4IJN A;  1KFS A;  3DLL L;  3ZEU B;  3P1G A;  4DKW A;  3CC4 N;  4CIE A;  3QEW A;  3H3O B;  1EWR A;  1DTQ A;  3AVN A;  1TKX A;  2P9U B;  5BR9 A;  4DTN A;  4U67 L;  3SLC A;  4CF8 A;  4FWK A;  1XWL A;  1LAV A;  4WQ4 C;  5BRF A;  1UWB A;  4B9Q A;  4BRO A;  1A5V A;  4DTP A;  4FPA A;  3CI5 A;  2NZT A;  4DR1 K;  5CY4 A;  3DM2 A;  3O3F A;  3WUH A;  1IH7 A;  1QZ5 A;  1M1K O;  1HNZ K;  3MX2 A;  5JLF A;  2PAV A;  2GX9 A;  4W5Q A;  4CJK A;  2ZJQ L;  1TUY A;  3MN6 A;  4FLZ A;  4DQS A;  3ZSQ A;  2OZM A;  1XMO K;  1QHA A;  2Q31 A;  1FK9 A;  3DOK A;  3NF7 A;  4DF8 A;  1JLB A;  5AQH A;  3H3N O;  1NK8 A;  4CJ4 A;  2UXB K;  2X6N A;  1HRH A;  1VQL N;  3IRX A;  5F0X A;  3HPG A;  4FLW A;  3TTD A;  3RTV A;  4RW6 A;  4M7Y A;  5CZ2 A;  3U9Z A;  3MEC A;  1JCE A;  1HJO A;  1SL1 A;  4FJL A;  4PY5 A;  1NGF A;  4LSN A;  4ILH A;  3ZYY X;  4FJ9 A;  4B3T K;  3PO4 A;  2VQE K;  5JS1 A;  3TTC A;  1RCH A;  3EY1 A;  4KPY A;  2E88 A;  3ZSZ A;  3JSM A;  4IEI A;  4AHU A;  3K5N A;  4IWV A;  2B5J A;  1BA1 A;  1DGK N;  1IBM K;  1VSM A;  2NRT A;  4N41 A;  2HNY A;  4FJ7 A;  3LWM A;  2JGU A;  3NF8 A;  4DCH A;  2KFN A;  1NJZ A;  4CER A;  4HTU A;  1C6V A;  4NYN A;  3HYF A;  3ZSW A;  3AA3 A;  3BEX A;  1WBB A;  1NK5 A;  3RRG A;  2HBL A;  3VF4 A;  5C2F A;  1ZYQ A;  3K0S A;  4JI5 K;  4BRQ A;  3BZC A;  2G8W A;  2RKI A;  4FSV A;  1S22 A;  1C0G A;  5BPM A;  3RSE B;  4A59 A;  4B1W B;  1XUP O;  4AHT A;  1YIJ N;  2CGK A;  3CCU N;  4BWJ A;  3VEZ A;  4CHO A;  3SQ1 A;  4E0D A;  4JKC A;  1TAQ A;  5AQV A;  3TAN A;  3CMA N;  3D6R A;  1N6Q A;  2YHW A;  4KV8 A;  4PKH A;  1E4G T;  1Z05 A;  3WEE A;  3OYE A;  4FK0 A;  4AF1 A;  1ZBU A;  3QBW A;  3MXM A;  1CZB A;  3IUC A;  5AQW A;  4KHY A;  4RWT A;  4KHS A;  1NGB A;  4CZK A;  3SAG A;  3HO1 A;  2D0A A;  1VSK A;  3P31 A;  1NNE A;  4DU4 A;  4JI8 K;  4H5V A;  4U7B A;  4JK7 A;  4K0K K;  4GVE A;  3WXI A;  4Z4G A;  2KHO A;  4BWM A;  5BRH A;  2G8V A;  4IBN A;  3V6D A;  1SL0 A;  4KH5 A;  3NCI A;  4EFH A;  3SZ2 A;  3CIP A;  4JRQ A;  4BC4 A;  3M1F A;  4F2R A;  3TAQ A;  4DLG A;  1SZ2 A;  3ZCM A;  1ATN A;  2WUS A;  4G1Q A;  4JKB A;  3SQ0 A;  4L8R B;  3QIP A;  1Q82 O;  2BGG A;  4FM1 A;  5BRD A;  4YY3 K;  3VQ9 A;  3B6O A;  5J2M A;  3SJJ A;  3LAL A;  3PSI A;  5ELZ A;  3D2E A;  1QSY A;  3K58 A;  3L2V A;  2Z1G A;  4BDZ A;  4OLA A;  4CGJ A;  5C24 A;  3ZLJ A;  2CH6 A;  3T7Z A;  4B3M K;  5AQM A;  1ASU A;  4CK1 A;  3QEX A;  4JKH A;  4CEC A;  1QVF M;  4E89 A;  2P9N B;  3A2F A;  2QXL A;  4CJT A;  3MN7 A;  4NXM K;  4CJP A;  3VN5 A;  1JL1 A;  5E26 A;  4FWS A;  5LJW A;  1OVQ A;  1K6Y A;  3VQC A;  2YHA A;  2KKZ A;  1GLF O;  1BIU A;  3MX5 A;  3FZF A;  3A0I X;  1JLA A;  2E2O A;  4Q5V A;  4JYA K;  3NFA A;  4CGI A;  4GVM A;  1Q9X A;  2UXC K;  3VEN A;  5AQT A;  1U45 A;  4GMJ B;  2NRX A;  1ATR A;  5KGX A;  3HT3 A;  2NRH A;  4Z94 A;  5JS2 A;  3O1W A;  4CJW A;  3CJA A;  1I3A A;  4KH6 A;  4CFA A;  1ASW A;  3CJ9 A;  3S3M A;  3FFI A;  1NK7 A;  2WON A;  4CEZ A;  4LD0 A;  1REV A;  1RBV A;  3ZX2 A;  2HW3 A;  5BR8 K;  3CC7 N;  3N4Q A;  1P90 A;  1WSE A;  4OPH A;  4FVM A;  3EKS A;  4UY8 O;  3DAW A;  2O8B A;  5IWA K;  3AAQ A;  1E4F T;  4DSE A;  5KPR A;  1K73 O;  5M1O A;  1BO5 O;  2OAN A;  2A41 A;  1BDG A;  2BDP A;  4CF0 A;  4ISF A;  1RT6 A;  3JXU A;  1LV5 A;  4V19 S;  3CM5 A;  1W2B M;  1FXX A;  2XY8 A;  3QIO A;  1Q81 O;  4H03 B;  2O4G A;  2WFB A;  4CZH A;  1HR0 K;  4XH4 A;  1QTM A;  3LP0 A;  1U47 A;  1NGH A;  2ZGY A;  4JV5 K;  4M45 A;  3M5R A;  4JD2 A;  2QXF A;  4QAG A;  1ZBS A;  2E20 A;  3V9U A;  1XMQ K;  5ADX H;  4Z4E A;  3ZET A;  5J1E A;  2HBJ A;  1CXQ A;  2IC3 A;  4LH4 A;  3CJC A;  3D2F A;  4J2B A;  1S1T A;  4O4G A;  1BU6 O;  4YDU A;  4DFM A;  4FXD A;  1EET A;  2YHB A;  1MA9 B;  4H8K A;  1U2V A;  3R8E A;  2XY7 A;  4EP5 A;  2Z1H A;  3MEG A;  2KQ2 A;  4M42 A;  4PL7 A;  5FDL A;  5HBM A;  3C7N B;  4H0X B;  3NH1 A;  3AVC A;  5BN8 A;  3NF6 A;  1HMV A;  4M3W A;  3CQ8 A;  1XC9 A;  2V7Z A;  3C6A A;  3T19 A;  4JS5 A;  2OYQ A;  3RMD A;  1G99 A;  1O1W A;  4CHQ A;  4BRP A;  1QQM A;  1EWQ A;  3E9L A;  1TK0 A;  3D2E B;  3R3L A;  1XHX A;  1Q86 O;  2YHY A;  1HNI A;  2E2N A;  5TKY A;  2HMI A;  1KLN A;  4YOX A;  1NJY A;  1S1U A;  4M3U A;  4FJJ A;  4B9N A;  4OPA A;  3PO5 A;  4CEA A;  3L3V A;  3LZJ A;  3AO2 A;  4KAZ A;  1EX4 A;  4CEF A;  3F5T A;  3VQ4 A;  4RW4 A;  2CGJ A;  2OPS A;  2QWL A;  4PKG A;  3HBT A; 
#chains in the Genus database with same CATH homology
 4AIL C;  1UA0 A;  1IKW A;  4DFJ A;  3OYC A;  1BIS A;  1NOZ A;  4CGH A;  4IG0 A;  1J5O A;  4E1M A;  1Q8I A;  2G8K A;  2F8S A;  3P5J A;  4PWD A;  3UIQ A;  2BE2 A;  4IFV A;  4HUE A;  3RMA A;  3QEP A;  1C1C A;  1BQN A;  4I2Q A;  5DK5 A;  2XHB A;  5HRR A;  4KB0 A;  4KI4 A;  1WSF A;  1GOC A;  4Q0B A;  4DSF A;  3B6P A;  1KTQ A;  4K8X A;  2HVI A;  5I3U A;  4LH5 A;  3L2W A;  3I0S A;  3I8D A;  1YTU A;  2YNG A;  5DMR A;  3TWH A;  1N5Y A;  2AJQ A;  4FCY A;  2X74 A;  4BE1 A;  2HHQ A;  4Z4I A;  1LWF A;  1RTH A;  4H4M A;  1C1A A;  1LW2 A;  1NK9 A;  2DFH A;  4O44 A;  3NHG A;  1EP4 A;  2EX3 A;  3L3U A;  3OYL A;  3L2R A;  2HHW A;  4YNQ A;  4CJR A;  3TAG A;  4BDP A;  3M8S A;  4NCG A;  4TSX A;  1RDC A;  4F4K A;  3IG1 A;  3V1R A;  3ASM A;  1T05 A;  1KLM A;  1L3U A;  4FLU A;  4DSK A;  3L2Q A;  4B3O A;  3SUN A;  1RTD A;  4B9T A;  4W5O A;  4C8O A;  2Z1I A;  1TKZ A;  4OPK A;  2XY5 A;  1D8Y A;  4B9U A;  2RPI A;  3BDP A;  4FJI A;  4FJH A;  1JLC A;  1S9G A;  2VG6 A;  3C95 A;  3M8R A;  5C42 A;  1TGO A;  1ZBF A;  4DQQ A;  1U49 A;  1NKB A;  1S6Q A;  2YKM A;  5KI6 A;  1A5X A;  1HNV A;  1HQE A;  1UOC A;  3MXI A;  2PYL A;  4W5N A;  4AHR A;  5E41 A;  4DQR A;  5FRN A;  3VQE A;  3KIO A;  5HRN A;  3HXM A;  3RMC A;  3PV8 A;  3QO9 A;  3DLR A;  4CFD A;  4ELT A;  3QER A;  4AHS A;  3QNN A;  4KO0 A;  1MU2 A;  4DFK A;  1S1V A;  4DTU A;  4NYF A;  4GW6 A;  3NGI A;  3PX4 A;  4AHC A;  3LZI A;  4FJK A;  1SUQ A;  5K14 A;  3NGY A;  3SYZ A;  4CES A;  2YV0 X;  4O5B A;  1RBR A;  4RW8 A;  4KHU A;  3PUF A;  4DTJ A;  4CEO A;  4O0J A;  4NCA A;  4OJR A;  1VRU A;  1JLG A;  5KGW A;  1JLQ A;  5HRP A;  1TL1 A;  3HJF A;  4DSJ A;  4UQG A;  1RT2 A;  3CM6 A;  4FZY A;  3S9H A;  4OPJ A;  4QCL A;  4Y1C A;  1NKE A;  3O4Q A;  2B4J A;  4E7K A;  4FJ8 A;  4QOZ B;  2HVH A;  4B08 A;  2G8H A;  1NKC A;  3D45 A;  2KZZ A;  1KFS A;  2FBY A;  4DU3 A;  3LAM A;  1BCM A;  1WAJ A;  2E4L A;  2QK9 A;  3AO3 A;  3DYA A;  1ASV A;  3P1G A;  1LAW A;  2NUB A;  3DLK A;  3SUQ A;  4J2E A;  4FJ5 A;  4ICL A;  3AA5 X;  1WN7 A;  2IGI A;  3MXJ A;  4FW1 A;  4CIE A;  3QEW A;  3HP9 A;  1I39 A;  2DFE A;  4C8N A;  4B9S A;  2XY6 A;  3V9Z A;  1C0T A;  1DTQ A;  3DOL A;  3AVM A;  3AVN A;  1TKX A;  4KFB A;  4FLY A;  1T8E A;  4DTN A;  4CGG A;  1C1B A;  5J2P A;  3C6U A;  3HPH A;  4CGF A;  4DS5 A;  2VG7 A;  3LPU A;  4CF8 A;  1D5A A;  2HB5 A;  4CJE A;  1XWL A;  3NE6 A;  3KK1 A;  4C8M A;  1LAV A;  2RF2 A;  3LP2 A;  1UWB A;  2ETJ A;  4O55 A;  2A1S A;  3OYG A;  4B8C A;  4M3Y A;  2YNF A;  1A5V A;  3OVN A;  4DTP A;  1QSL A;  2G8U A;  3BGR A;  3ZT0 A;  1R0A A;  3KLE A;  5CY4 A;  4CJ5 A;  3DM2 A;  3VQP A;  3O3F A;  1IH7 A;  3S3O A;  2GV9 A;  1CZ9 A;  3AA2 A;  4DTR A;  1S1W A;  1J53 A;  4CJQ A;  4CJK A;  1RDB A;  4W5Q A;  3OJS A;  2W42 A;  3RMB A;  1JL2 A;  4FLZ A;  4DQS A;  4I9Q A;  3ISN C;  5FRM A;  1RBT A;  3AVL A;  3ZSQ A;  2GUI A;  3ZT1 A;  5T7B A;  4M3R A;  2OZM A;  4EZ6 A;  1FK9 A;  1WLJ A;  3DOK A;  3NF7 A;  4CJS A;  1IO2 A;  1JLB A;  2LSN A;  4DF8 A;  4IKF A;  2KZM A;  2G8I A;  4CK3 A;  4CEE A;  3DI6 A;  3KK2 A;  3WNG A;  4R5P A;  4JS4 A;  1NK8 A;  4CJ4 A;  3RR8 A;  1VSH A;  1NK4 A;  1Y97 A;  1NJW A;  2X6N A;  1HRH A;  1TK8 A;  3AVG A;  1C0U A;  2ATQ A;  3AVF A;  3P83 D;  3OYN A;  3IRX A;  1RT7 A;  3HPG A;  2E6L A;  4CF1 A;  4DLE A;  4BE2 A;  4FLW A;  4FLV A;  2PZS A;  3LDS A;  1J54 A;  1TVR A;  1HPZ A;  3RTV A;  4RW6 A;  3LPT A;  3OYD A;  5CZ2 A;  3OYF A;  2QKK A;  3LAN A;  3MEC A;  4FJL A;  4DTX A;  1SL1 A;  4PY5 A;  4ZTJ A;  4Z4C A;  4FM0 A;  1L5U A;  4KB1 A;  4RW7 A;  4LSN A;  2WOM A;  4FJ9 A;  1GOB A;  3PO4 A;  1F21 A;  5JS1 A;  4BAC A;  2HHT A;  1RCH A;  3EY1 A;  4KPY A;  1XI1 A;  3RR7 A;  2HHU A;  1Z26 A;  3QNO A;  1L3S A;  3OS0 A;  3ZSZ A;  3C94 A;  3JSM A;  3DLH A;  1RNH A;  4AHU A;  3ZT2 A;  3QIN A;  3K2P A;  3K5N A;  2B5J A;  4CIF A;  3SUO A;  1FKO A;  4N56 A;  4CHP A;  2ZE2 A;  1VSM A;  4PA1 A;  3HM9 A;  1NK0 A;  2HNY A;  4N41 A;  1ZBI A;  4FJ7 A;  2P1J A;  3LWM A;  2JGU A;  3NF8 A;  4I9L A;  3SPY A;  2KFN A;  3KLH A;  1NJZ A;  4CER A;  3NDK A;  4HTU A;  1NOY A;  1C6V A;  4OVL A;  3CFO A;  3K5L A;  3CFR A;  3OYI A;  4PQU A;  3WNH A;  4NYN A;  3HYF A;  4E1N A;  2R7Y A;  1BGX T;  3AO4 A;  3ZSW A;  3AA3 A;  2O4I A;  3RRG A;  4CFC A;  1NK5 A;  3QLH A;  3NH2 A;  3EZ5 A;  1ZBL A;  4Z4H A;  4FK2 A;  2ZQB A;  4CJV A;  4YFU A;  1ZYQ A;  2X78 A;  3PX0 A;  4FJX A;  1B9F A;  2FBX A;  3CG7 A;  1RT4 A;  3C6T A;  1TK5 A;  2G8W A;  1QHT A;  2RKI A;  3SCX A;  1RT5 A;  4DMN A;  2HNZ A;  4AHT A;  4BWJ A;  4CHO A;  4E0D A;  4OKK A;  3SQ1 A;  1T03 A;  4DQP A;  3OYK A;  3MED A;  1TAQ A;  3ZT4 A;  4I2P A;  3WNE A;  3TAN A;  3OS2 A;  3V4I A;  4AHV A;  1VSE A;  2YKN A;  3AA4 A;  2I5J A;  3OYM A;  1N6Q A;  1YT3 A;  4KV8 A;  4NCB A;  2ITG A;  4F8R A;  2OPQ A;  4HUF A;  1RDA A;  4FW2 A;  3PY8 A;  3OYE A;  4FK0 A;  4DFP A;  4FK4 A;  4KI6 A;  2DTU A;  3K59 A;  2VG5 A;  1X1P A;  4FLT A;  4F3O A;  3NBP A;  1BL3 A;  1QE1 A;  1ZBU A;  3DMJ A;  1VSD A;  1SKR A;  3TAE A;  3MXM A;  1HYZ A;  3L8B A;  3RRH A;  1CZB A;  3SNN A;  4KHY A;  3K5O A;  3WNF A;  3KJV A;  3QEI A;  4KHS A;  3SUP A;  3O4N A;  2YNH A;  4F3T A;  2P5G A;  4F2S A;  4CJ3 A;  3G10 A;  1S6P A;  3U3G A;  3TAF A;  3HO1 A;  3KK3 A;  2D0A A;  2KFZ A;  1VSK A;  2P5O A;  4WE1 A;  4FJG A;  4KTQ A;  4IG3 A;  1KSP A;  1JKH A;  2PYJ A;  4DU4 A;  2Z1J A;  4EP4 A;  1U48 A;  2VWJ A;  4KHQ A;  4LY7 A;  1SKW A;  4ZTF A;  1ZBH A;  5HRS A;  1VSF A;  5C25 A;  2X6S A;  5CYQ A;  3AO1 A;  3LP1 A;  3NF9 A;  2D0C A;  4O0I A;  4Z4G A;  1C0M A;  4JLH A;  5CZ1 A;  1WSG A;  4BWM A;  3IS9 A;  4E7H A;  4ELV A;  2G8V A;  4IBN A;  4ID5 A;  3V6D A;  1SL0 A;  1VSL A;  4DQI A;  5SWM A;  3NCI A;  3CYM A;  2HHV A;  1B9D A;  3SZ2 A;  1BQM A;  1GOA A;  1HQU A;  3V9W A;  4JRQ A;  2DY4 A;  1RBU A;  4F2R A;  4DSL A;  3HP6 A;  3TI0 A;  4FM2 A;  3NH0 A;  4N47 A;  4DS4 A;  1J9A A;  4CED A;  2XO7 A;  3NAE A;  3VQ5 A;  2KW4 A;  4DLG A;  3OYH A;  3HL8 A;  4DTM A;  4M3T A;  3ZCM A;  1HYS A;  2E6M A;  4G1Q A;  3O3H A;  3ULD A;  2Q3S A;  3PX6 A;  3QET A;  3SQ0 A;  4HCC A;  4FZX C;  4OKJ A;  5CYM A;  2IDO A;  1FKP A;  3ZSO A;  2A1R A;  3QIP A;  4L8R B;  3DRR A;  2BGG A;  3DLE A;  3MEE A;  4FM1 A;  1BI4 A;  1W9H A;  2YNI A;  4BE0 A;  3VQ9 A;  3B6O A;  1KVB A;  4E3S A;  5J2M A;  4KHN A;  4C8K A;  1LWC A;  3TAB A;  3LAL A;  3SJJ A;  3KLG A;  3VQD A;  1IG9 A;  4RW9 A;  1QSY A;  3K58 A;  3NGZ A;  3L2V A;  1WAF A;  2Z1G A;  3T1A A;  4LSL A;  4BDZ A;  5J2Q A;  2PY5 A;  4OLA A;  4CGJ A;  1VSJ A;  4DF4 A;  5C24 A;  1TV6 A;  4HCB A;  3JYT A;  4N76 A;  2F8T A;  4MQ3 A;  1X9M A;  3HVT A;  3QEV A;  3KD5 E;  4DTO A;  3L2U A;  2KTQ A;  1RTI A;  4XIU A;  1ASU A;  1WSH A;  4CK1 A;  1JLF A;  4KTZ A;  1UAX A;  3AVA A;  4DTS A;  4CFB A;  3QEX A;  4CEC A;  2G8F A;  2D5R A;  3OYB A;  4KHW A;  4CHZ A;  2JLE A;  4E89 A;  4N5S A;  3DRP A;  2IS3 A;  3A2F A;  1A5W A;  1G15 A;  3D0P A;  4M3Z A;  2Y1I A;  1VSI A;  4CJT A;  3TAP A;  3TAQ A;  4CJP A;  3QES A;  4EZ9 A;  1EKE A;  1KVA A;  3VN5 A;  1JL1 A;  3LWL A;  1WNS A;  1K6Y A;  3VQC A;  1X9W A;  2YHA A;  4B9V A;  1UA1 A;  4KTW A;  1ITG A;  4J2A A;  3VQA A;  1BIU A;  3SPZ A;  1HYV A;  4FZZ A;  1JLA A;  2B6A A;  4Q5V A;  3HVR A;  5D3G A;  3AVH A;  1RTJ A;  3NFA A;  4OKE A;  4M41 A;  4CGI A;  3H08 A;  1JLE A;  2RN2 A;  3OY9 A;  4GVM A;  4RG8 A;  3EYZ A;  1BHL A;  5I42 A;  1Q9X A;  4C8L A;  4OGC A;  5HLF A;  1SKS A;  2FBV A;  4I7F A;  4JRP A;  1U45 A;  4GMJ B;  3T3F A;  1CXU A;  5KGX A;  3S3N A;  5KTQ A;  3HT3 A;  3U6F A;  5KRT A;  3K5M A;  2OA8 A;  4CF2 A;  5JS2 A;  4KKO A;  4CJW A;  1VRT A;  5HRO A;  5EU7 A;  3TAM A;  1I3A A;  4DG1 A;  1KCF A;  4CFA A;  1ASW A;  3SV3 A;  4CCH A;  4OLB A;  3OYJ A;  5KRS A;  4M3X A;  1BIZ A;  4CHY A;  3OYA A;  4DSI A;  3S3M A;  1NK6 A;  1TL3 A;  3FFI A;  1NK7 A;  4CIG A;  4IFY A;  2WON A;  4HHT A;  4CEZ A;  1IKX A;  4LD0 A;  3ZT3 A;  1WSI A;  4HVJ A;  1TKT A;  3AVB A;  1REV A;  1RBV A;  4KRF A;  2HW3 A;  1Z25 A;  1WSE A;  1NJX A;  4FVM A;  1B92 A;  4IDK A;  5FRO A;  3DLG A;  4CK2 A;  1JXB A;  3VA3 A;  4B8A B;  3K57 A;  4FJM A;  2OZS A;  3HST B;  3O3G A;  4KRE A;  1U4B A;  1L3T A;  4W5R A;  3ZSV A;  3M8P A;  5J2N A;  4DSE A;  2F96 A;  1QS4 A;  4PUO A;  3KLF A;  3LP3 A;  4CJL A;  2BDP A;  5HP1 A;  4FYD A;  2HHX A;  4CF0 A;  4E7J A;  2VWK A;  3AVK A;  3MAQ A;  1TKD A;  1RT6 A;  3THV A;  1LV5 A;  1X9S A;  3CM5 A;  4ID1 A;  3V81 A;  1FXX A;  2XY8 A;  3AVI A;  3QIO A;  4CGD A;  2FC0 A;  3KKR A;  2O4G A;  3RWU A;  3VQQ A;  4CEQ A;  4FLX A;  3KKS A;  3F9K A;  3LP0 A;  2Y1J A;  1QTM A;  4BDY A;  1U47 A;  2GBZ A;  1RT3 A;  4CF9 A;  1U04 A;  2ZD1 A;  4M45 A;  3OS1 A;  1YTA A;  1RT1 A;  2QXF A;  4QAG A;  4CEB A;  3ALY A;  4OGE A;  1VK0 A;  3KTQ A;  2BAN A;  3V9U A;  1XHZ A;  3I0R A;  3VQB A;  3ZSR A;  2OPP A;  3E01 A;  4Z4E A;  4E7I A;  5J1E A;  4Z4F A;  2OPR A;  1CXQ A;  2IC3 A;  2FBT A;  4LH4 A;  4E7L A;  4CHN A;  1DTT A;  3HK2 A;  4J2B A;  1KVC A;  3DRS A;  1S1T A;  4H4O A;  4O4G A;  3VQ8 A;  4DFM A;  4FXD A;  2DFF A;  1EET A;  2YHB A;  4H8K A;  3V1O A;  1BCO A;  4ZHR A;  1S9E A;  4Z0U A;  2XY7 A;  2IOC A;  4B9L A;  1HJR A;  1W0H A;  2Z1H A;  4EP5 A;  3ZSX A;  3MEG A;  1LWE A;  2KQ2 A;  3TR8 A;  1IKV A;  4M42 A;  4J2D A;  3VQ6 A;  5FDL A;  5HBM A;  1QSS A;  3ITH A;  3AO5 A;  1RDD A;  5SZT A;  1S1X A;  1KFD A;  3M8Q A;  1JXE A;  3KD1 E;  1Q9Y A;  2QKB A;  1TAU A;  3NH1 A;  3AVC A;  4DWI A;  1SL2 A;  3NF6 A;  1BI4 B;  1HMV A;  3V9X A;  4M3W A;  4Y1D A;  3CQ8 A;  1XC9 A;  3T19 A;  4JS5 A;  2OYQ A;  2HHS A;  2XRI A;  4FJN A;  3RMD A;  1O1W A;  4CHQ A;  2P51 A;  3F73 A;  1YVU A;  4ELU A;  2D0B A;  1TK0 A;  3ZSY A;  3U3Y A;  4CJF A;  1XHX A;  3SQ2 A;  1CLQ A;  2HND A;  3AV9 A;  4MFB A;  4DU1 A;  1QQC A;  4CE9 A;  3OJU A;  1HNI A;  1L3V A;  3VQ7 A;  1LW0 A;  4CJU A;  2HMI A;  1RBS A;  1WSJ A;  1KLN A;  1DLO A;  1RIL A;  3LAK A;  3G0Z A;  1NJY A;  1S1U A;  2IAJ A;  4M3U A;  3AVJ A;  1D9F A;  3V1Q A;  2EHG A;  4B9N A;  4FJJ A;  1T7P A;  4B9M A;  1D9D A;  3CFP A;  1S5J A;  3PO5 A;  4CEA A;  3SQ4 A;  4AH9 A;  3L3V A;  3SV4 A;  3LZJ A;  3VA0 A;  3AO2 A;  4KAZ A;  1EX4 A;  3SI6 A;  4W5T A;  4CEF A;  4K8Z A;  3TAR A;  1SV5 A;  4HUG A;  3VQ4 A;  4E19 A;  3HPO A;  4RW4 A;  1IKY A;  2OPS A;  3KLI A;  1KRP A;  1EXQ A;  3IAY A;  3V9S A;  3DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...