4TSXA

Hiv-1 integrase catalytic core domain mutant complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
143
Chain Sequence
b'DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPESMNKELKKIIGQVRDQAETLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of H171T resistance reveals the importance of N -protonated His171 for the binding of allosteric inhibitor BI-D to HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
total genus 49
structure length 143
sequence length 155
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4tsxA00
3HT3A 4FJXA 1MU2A 2OA8A 1JXBA 3PUFA 1TKXA 4F2RA 1VSDA 3QNOA 3V9UA 4CF2A 1YTUA 4KKOA 4KTZA 5EU7A 1J54A 4DLEA 1I3AA 1KTQA 4BE0A 3QESA 4OLAA 3OYGA 3A2FA 1L5UA 2QKKA 1IKXA 2KZMA 4CIGA 3LAMA 3VQEA 1T8EA 4FYDA 1I39A 4O0JA 3KD5E 4DFMA 3SJJA 4B3OA 3SNNA 4Q5VA 4DTMA 3OYJA 4BE2A 4DQQA 3RMCA 4FCYA 1X9WA 4FLVA 4J2EA 1WSEA 5KGWA 3HYFA 4ID5A 3LWLA 4KRFA 3QEVA 2FC0A 3NF7A 3DLEA 4BACA 2ETJA 2YNFA 3OYKA 4RW7A 4OJRA 1VSIA 2PZSA 3OYLA 2O4IA 3M8RA 2X6NA 3PX0A 2NUBA 2RPIA 3VQ4A 4FM1A 1KVBA 4F4KA 4DSIA 3HK2A 3KTQA 4ICLA 2IDOA 3AO1A 1EKEA 4M3XA 2FBVA 2YKNA 5KTQA 4IKFA 3V9SA 2OPRA 4BWJA 2OPQA 1JLEA 4CIEA 3S3MA 4CEFA 4MQ3A 1BHLA 3AVNA 3OYDA 1GOAA 4CJPA 4CHQA 3QNNA 3F9KA 4FZXC 5C25A 4W5QA 3SQ1A 1ZBIA 3VQCA 1BISA 3FFIA 4Q0BA 1UA0A 3QO9A 1Y97A 3ALYA 4WE1A 1QS4A 3KLEA 4M3ZA 3CFOA 1N6QA 1BL3A 3ZSWA 1L3UA 3BGRA 3ZT2A 4OPJA 3AVKA 3IRXA 4I2QA 1NK7A 3AVCA 1QQCA 3PV8A 5HLFA 2D0BA 1A5VA 1TL1A 3QEPA 5HRRA 1D9DA 1HPZA 1HYVA 2PYLA 4DS5A 3DLKA 4E7KA 3LP1A 4IDKA 3L2WA 3DRRA 3L2UA 4FJHA 1HNVA 1S1TA 3JYTA 2I5JA 1SKWA 2VG5A 4CK2A 4KAZA 3SPZA 3OYAA 3KJVA 4KFBA 3NDKA 3DLGA 1CXUA 5FRNA 4CEAA 4L8RB 1S1UA 4LD0A 4ID1A 1BCOA 2P51A 2XY7A 1R0AA 5E41A 3QIPA 1O1WA 4CHPA 3HM9A 4KHSA 4FW1A 4OGCA 1IKWA 5HRNA 2HHVA 4CJEA 3CQ8A 2B6AA 3OYBA 2XO7A 4C8MA 1WN7A 4Y1CA 2ITGA 3DLBA 3PO4A 3WNFA 1GOCA 3P83D 3C95A 4RG8A 1U04A 3ZSYA 2YKMA 4F8RA 1S1WA 5KRSA 3NH1A 2FBTA 1BQNA 4LH4A 2Y1JA 2F96A 3TABA 2KQ2A 2BGGA 1VSHA 2DFEA 3RWUA 2RN2A 4CERA 4CEDA 1SL1A 3HPGA 1NKBA 2HHXA 1KLMA 4JS5A 3KIOA 4Z4EA 4DSEA 3SQ0A 1QSSA 3LP0A 4DG1A 1DTTA 4NCGA 1BQMA 1B9DA 4KB0A 4J2DA 4OGEA 4DTPA 5J2PA 3V1RA 3RR8A 3SQ2A 4MFBA 4PA1A 3AVIA 1NOYA 4N76A 3MXJA 4DSKA 4DTUA 4BDYA 3HO1A 3V4IA 1VSLA 4O55A 3SZ2A 3SUOA 3P5JA 3LP2A 5HP1A 2YNIA 1FKPA 1RDDA 4CF8A 1F21A 1JLCA 5KRTA 1CLQA 2G8IA 3M8PA 2ZE2A 4CEOA 4FJIA 4IFVA 4FJJA 5JS1A 4EP4A 2X78A 1ASWA 4OPKA 1IKYA 3OS1A 3AA2A 4CEEA 1LAVA 4OLBA 4C8KA 4FLXA 4RW9A 2HNDA 3O3HA 4QOZB 1C0TA 1S1VA 4IFYA 2X74A 2P1JA 5J1EA 3HP6A 5J2QA 3T1AA 3ULDA 5J2MA 2PY5A 4CFCA 1ASVA 1U47A 2IOCA 1EETA 2XRIA 1Z25A 2KFNA 4FVMA 1JLFA 1TKTA 3V81A 2DY4A 2XY8A 1EXQA 1RBUA 2Z1HA 3SI6A 4DQRA 2D0AA 1T03A 4I9QA 3KLHA 4CJ4A 3OJUA 3L2QA 3EZ5A 1T7PA 4CJTA 4PUOA 3LPTA 2HVHA 1VSMA 3LALA 1S9GA 1ZYQA 4Z4CA 4HUEA 1ITGA 4OKJA 4ZTJA 3NGIA 1NJYA 1B92A 2OPPA 3LWMA 4N47A 3LZJA 1RDCA 3AVFA 4I7FA 4DS4A 1KCFA 3AVGA 1TAQA 2HHTA 1VSKA 1LV5A 4FJMA 3V1OA 3KLFA 3NHGA 3B6PA 1X1PA 2HNZA 4GVMA 4AHRA 3MECA 1RTIA 2BE2A 1RT6A 4R5PA 3NGZA 4FLUA 3TAPA 3G0ZA 4I2PA 2HHSA 3AO4A 2WONA 2A1RA 1NK9A 4RW6A 4HTUA 1RBVA 3C6UA 3IS9A 4OKKA 4FLYA 1U48A 1UOCA 3KK1A 2DFFA 2KFZA 4C8OA 4G1QA 5SWMA 4FK2A 4DTSA 2X6SA 2FBXA 1RTJA 3NE6A 4RW8A 3THVA 4CGIA 4E7HA 3AVBA 4Z0UA 3AVMA 1NJZA 3BDPA 1QHTA 3H08A 2EHGA 1WSIA 5DK5A 4CGHA 5T7BA 4W5OA 3RTVA 4E7IA 4DU4A 1Q8IA 3QEIA 4ZTFA 2HHQA 3SUPA 1RTDA 3DYAA 3DI6A 3SV4A 1S1XA 3SUQA 3MXIA 1XI1A 1VRTA 1NK8A 4KV8A 1NK6A 1WSJA 1YTAA 4ZHRA 1HQUA 4M45A 4KB1A 2QK9A 2HNYA 4KREA 2F8SA 4CEZA 1JL2A 1RT2A 3V6DA 3S9HA 1Q9YA 3SQ4A 3RR7A 3ZT3A 4ELUA 2HVIA 1JKHA 3TWHA 4M3RA 4B08A 3SUNA 3D0PA 4E3SA 4CFBA 1VSFA 1UA1A 2PYJA 1J9AA 4DFKA 1HNIA 1ZBHA 1LWCA 3ZSQA 5FROA 4CJRA 4M3UA 1TVRA 3IAYA 2G8HA 2Z1IA 2WOMA 4ELTA 2ATQA 1CZBA 1TGOA 4NCAA 1CZ9A 2Z1JA 3WNEA 3U3GA 4FJ9A 4YFUA 1JLBA 1SV5A 1UAXA 1CXQA 5CY4A 2RF2A 3AVAA 3V9XA 1DLOA 4H8KA 2W42A 1RCHA 3PO5A 2IAJA 4O44A 1L3TA 3NH2A 3VN5A 4FM0A 3NH0A 2LSNA 2OPSA 5C24A 1YVUA 1RTHA 3TR8A 4B9LA 4CHNA 3HPOA 3K5NA 4B9NA 3ZSXA 1BI4B 1K6YA 1VRUA 4FJLA 3NFAA 5K14A 5HROA 1IG9A 3HJFA 1RBTA 3NAEA 3TAMA 1WSFA 5KI6A 4CJFA 2G8WA 4C8LA 3D45A 3VQ8A 4BWMA 1J53A 4AHUA 3EYZA 4IG0A 1WSGA 4EP5A 3WNHA 3F73A 1UWBA 1TK8A 1C0MA 3ZSOA 4CJ3A 1TK0A 3KKSA 4Y1DA 4Z4IA 3AO5A 4AH9A 1JLGA 4CGJA 2BANA 1DTQA 4E7JA 4KTQA 3ASMA 1HYZA 4LH5A 2OZMA 4K8ZA 2JGUA 3TI0A 4UQGA 5FDLA 4FW2A 4BDPA 3AA3A 4LSLA 3ZT0A 2Q3SA 4K8XA 3VQAA 3C94A 4DTJA 2B4JA 1NJWA 1BIUA 4B9VA 1TV6A 4FM2A 3C6TA 3EY1A 1RT5A 3PX4A 3RMBA 3PX6A 2XY6A 1U45A 4KI4A 4DTRA 4LSNA 2P5GA 4CCHA 1VSEA 4DU1A 3NF6A 4H4MA 4EZ6A 3QETA 3UIQA 3HVRA 3T3FA 4CF1A 3PY8A 1LW2A 1ZBFA 3SCXA 3K58A 3CFPA 3VQPA 1HMVA 2O4GA 2YNHA 2BDPA 5HRPA 2OYQA 3S3OA 4CEBA 1SUQA 4H4OA 1GOBA 2F8TA 3SV3A 3O3GA 4TSXA 3ZSZA 2KZZA 4J2AA 3HPHA 4B8CA 4YNQA 3L8BA 4ELVA 4CF9A 5JS2A 3OY9A 1WAJA 1YT3A 4BDZA 1QTMA 4O0IA 1ZBUA 1IO2A 3IG1A 3OYFA 2HHWA 1SL2A 5CYMA 1FXXA 1JLQA 5KGXA 1A5XA 1W9HA 3HL8A 1SL0A 4F3TA 3V9WA 2DFHA 1FKOA 3LDSA 3VQ9A 2QXFA 1RDBA 1NKCA 1G15A 3I0SA 4DU3A 4FLZA 4DQIA 1RT4A 4DSLA 2VWJA 1C1AA 4O4GA 3I0RA 4CFAA 5J2NA 1TK5A 3KK2A 1NK0A 4E89A 4DQSA 1KRPA 3B6OA 4FJ5A 4NCBA 1KVAA 3KLIA 4CJ5A 4FJGA 1REVA 3AO2A 2JLEA 3V1QA 1S6PA 3DOLA 4KHYA 1VSJA 3WNGA 5D3GA 3SPYA 1SKRA 4NYFA 4PQUA 1QSLA 1RBRA 4CHOA 2XHBA 3DOKA 3CG7A 2G8VA 3K5MA 4B9SA 2A1SA 4I9LA 4FLTA 4N41A 3OS0A 2EX3A 3AO3A 1C0UA 5DMRA 5SZTA 4EZ9A 1L3VA 3HXMA 1IH7A 4DLGA 1XWLA 4CJQA 4DSJA 4FJNA 3VQDA 4M3YA 3CFRA 4CGFA 3U6FA 1KFSA 1LWFA 4E19A 2VG7A 2E6LA 4F3OA 1T05A 4AILC 4QCLA 1TL3A 4DTOA 3S3NA 2GBZA 4E1NA 4CJSA 3JSMA 3AVHA 3OYHA 4IBNA 3OYIA 4B9MA 4M3WA 4AHSA 4CECA 3L3UA 5CZ2A 4XIUA 3L2RA 3ITHA 1NOZA 4CJKA 3LP3A 3DMJA 5CZ1A 3DRSA 4HUGA 1LAWA 1ZBLA 1RNHA 1BGXT 4DWIA 3ZCMA 4KTWA 2VWKA 4JS4A 1JL1A 3RMDA 2HHUA 2YHAA 4CE9A 5C42A 3DM2A 3O4NA 3TAFA 3SYZA 1TAUA 1W0HA 1N5YA 3TAGA 3E01A 1NK4A 4AHTA 4OVLA 1NK5A 3LPUA 4E1MA 4M3TA 4O5BA 4C8NA 1KSPA 3QINA 4CGDA 4CK3A 1S5JA 4CF0A 4DMNA 1RT7A 2B5JA 1FK9A 2Y1IA 1J5OA 1RBSA 2IS3A 2E6MA 1B9FA 3ZSRA 2OZSA 1RT3A 3RRGA 4CIFA 3AA4A 1TKZA 4JLHA 3VA0A 4FK0A 2G8FA 1RDAA 5HRSA 3QEXA 1LW0A 3K2PA 3KLGA 4DQPA 4N56A 4KHNA 4DF4A 2D5RA 4KI6A 3NGYA 4CESA 2E4LA 4HHTA 2IC3A 4DFJA 4NYNA 3VQ7A 3QERA 3MXMA 1BIZA 4CK1A 1Z26A 1NJXA 3O4QA 4HCCA 1C1CA 1RILA 4RW4A 3CYMA 4FZZA 4QAGA 4FJKA 2HB5A 4JRPA 3V9ZA 5HBMA 3RRHA 3RMAA 4Z4GA 3T19A 1HQEA 1TKDA 3NF9A 2QKBA 3M8QA 3QLHA 4OKEA 2GV9A 1ASUA 4HCBA 2FBYA 1A5WA 4GMJB 3VA3A 3HSTB 4PWDA 3VQ6A 2HMIA 4FXDA 1WSHA 1HRHA 4FZYA 2KW4A 2G8UA 2YNGA 4CGGA 4BE1A 1X9SA 3AVLA 3OVNA 4FK4A 4N5SA 3OS2A 1D8YA 2DTUA 3KD1E 4AHVA 4Z4FA 4DTNA 4W5RA 1D5AA 4CHZA 4Z4HA 2ZQBA 3P1GA 3AA5X 3HVTA 1BCMA 3G10A 1KLNA 3OYNA 1WAFA 2VG6A 3DLHA 4B9UA 3MAQA 2GUIA 3LANA 2RKIA 1WLJA 1HJRA 2D0CA 4E0DA 1L3SA 1KVCA 4CJLA 3K57A 5I42A 4CJVA 1WNSA 3TAQA 4M42A 3ZSVA 3OJSA 4DF8A 4B8AB 4E7LA 4F2SA 1C1BA 3L2VA 3NBPA 3K59A 5I3UA 3KK3A 4HVJA 2HW3A 1IKVA 3MEEA 1S6QA 2IGIA 3L3VA 3TAEA 3ZT1A 1LWEA 5CYQA 4DSFA 2YV0X 3NCIA 4HUFA 1JXEA 2KTQA 3VQ5A 1JLAA 1KFDA 3QIOA 5FRMA 1QE1A 3I8DA 1QSYA 4B9TA 4FJ7A 4KHQA 4LY7A 3O3FA 2Z1GA 4AHCA 1X9MA 4KPYA 1VK0A 3MEDA 3OYEA 1XC9A 1EX4A 1EP4A 3HP9A 3VQQA 3AVJA 4W5TA 3LAKA 3OYMA 2R7YA 1NKEA 2P5OA 2AJQA 3LZIA 3ZT4A 3NF8A 4KO0A 1U4BA 3OYCA 2G8KA 3DRPA 3CM6A 1BI4A 3DLRA 3KKRA 4CEQA 3TARA 1U49A 1D9FA 4FJ8A 3M8SA 3K5LA 1C6VA 1RT1A 4IG3A 3MEGA 4M41A 4CJUA 4GW6A 3VQBA 4CJWA 1SKSA 4DFPA 4KHWA 2YHBA 4J2BA 4CFDA 1XHXA 4DTXA 3AV9A 4FLWA 4W5NA 4PY5A 3CM5A 3ISNC 2ZD1A 4CHYA 3U3YA 4KHUA 3TANA 2XY5A 1S9EA 3K5OA 1XHZA 1Q9XA 3QEWA 4JRQA 1HYSA
chains in the Genus database with same CATH superfamily
5C12A 3V9UA 4CF2A 4KKOA 3O9SA 4KTZA 5EU7A 3P38A 1VQ9N 3QESA 2O8FB 2IVNA 2NZTA 4JI2K 1MDUB 4DFMA 4Q5VA 1EWRA 3RMCA 1X9WA 4FCYA 4DV4K 4DR2K 2ZJQL 1VQ8N 4HTLA 5AQUA 4Y0WA 4NXMK 2ETJA 1YI2N 3CMEN 2PZSA 3OYLA 4JV5K 2NUBA 4CD3A 3WXJA 3N4QA 4F4KA 4DSIA 3THXA 3KTQA 4E1JA 1QZ6A 4FO0A 2OPRA 4YOVA 3S3MA 3OYDA 3AVNA 3LM2A 4CJPA 4LFBK 2F9TA 1HKGA 3KZBA 2OTJN 4BGAA 1UA0A 1S3XA 4FWPA 4BQLA 4BRCA 4YOXA 1P90A 2EWSA 4I2QA 1Y64A 1A5VA 2P9NA 1HPZA 2W41A 4CVNE 4MO4A 3CCQN 3C65A 1SS6A 1BUPA 3KWIA 1SKWA 1U2VA 5M1NA 3VEXA 4U7BA 3DLGA 3ZLJA 1CXUA 4L8RB 4LD0A 1X3MA 2XY7A 5E41A 4CHPA 4DCHA 4FW1A 4OGCA 4KHSA 3R3LA 2B6AA 5ADXH 3GG4A 3OYBA 2O8CA 5AQIA 3PO4A 1GOCA 3C95A 5KRSA 2Y1JA 2F96A 1WOQA 1VSHA 4Z4EA 4DG1A 1B9DA 4KB0A 2E2QA 3RR8A 4PA1A 3AVIA 5A2QO 3E66A 1NJIO 4CZEA 4BDYA 1VSLA 3SUOA 1Q7YO 3P5JA 4IFEA 1RDDA 1Z05A 2V7ZA 3R9PA 4FJIA 4CEOA 1U6ZA 3L4IA 2YX6A 2A3ZA 4OPKA 3OS1A 4CEEA 3SJHA 3JXUA 4C8KA 2HNDA 2VCPA 4QOZB 1C0TA 3EEQA 4JKDA 4GV9A 1NM1A 4IFYA 2VGMA 1T3VA 3ULDA 2PY5A 2YHWA 5FLXO 1ASVA 1E3MA 4IOAL 2KFNA 4G9ZA 2BH1A 1JLFA 1TKTA 3TSUA 2XY8A 1EXQA 2P9KB 4IXCA 3SI6A 1T03A 5BRFA 4I9QA 2FSKA 3L2QA 4PUOA 1ITGA 4B1UB 5C10A 4ZTJA 1NJYA 5GAEP 2OPPA 4N47A 1RDCA 1KCFA 3AVGA 1TAQA 3EE9A 4FJMA 3NGZA 3MECA 1RTIA 2BE2A 3WXMB 1IBLK 4AM6A 3THYA 4HTUA 1RBVA 3IS9A 1VQ5N 4BRKA 2DFFA 4C8OA 3SMPA 1YHQN 4CW7B 4XH5A 2X6SA 4BRMA 3A8YA 4E7HA 1YJNN 4BC2A 3AVMA 5AZJB 4CBUA 3VEVA 4W5OA 3J7YP 1TUYA 1RTDA 2O8EA 3DI6A 2P9LA 3O80A 1VRTA 3T69A 1NK8A 1HQUA 4DV6K 2HNYA 4KREA 1VAZA 4A2BA 3S9HA 1Q9YA 3RR7A 4B08A 3UKUB 2PYJA 1ZBSA 1J9AA 2PBDA 3ZSQA 2GEMA 1N34K 5FROA 4DKWA 1YJWN 4WF9L 2G8HA 4ELTA 4CZKA 2ATQA 1TGOA 4NCAA 1CZ9A 4FJ9A 3A5LC 1JLBA 3HOTA 4B1WB 1NGJA 5CY4A 1JJ2M 5AQFA 2Q31A 4H8KA 1BO5O 3PO5A 1L3TA 3L4QA 2CH6A 2GELA 4FM0A 3BZCA 3OW2M 1OH5A 4IJNA 3TR8A 3HPOA 4B9NA 2ZM6K 3ZSXA 4H5VA 1BI4B 5C15A 4FJLA 3CJ7A 5HROA 1IG9A 3CI5A 1RBTA 2QW9A 5KI6A 4K41A 5TKWA 2HBJA 1J53A 1VHXA 1YAGA 1C0MA 3ZSOA 4CJ3A 3KKSA 1HYZA 1X9JA 5JVHL 5KPTA 1HKCA 4BDPA 3AA3A 3FGUA 3NVMA 2Q3SA 3VF4A 1NG9A 4WYBA 3EY1A 1RT5A 5LY3A 4DTRA 4MO5A 4BRIA 4H4MA 4EZ6A 3QETA 3CXCM 2CH5A 3K58A 3CFPA 2O4GA 5BRDA 3ZSZA 4J2AA 4BREA 3QB0A 4CF9A 3OY9A 4BDZA 4DR5K 3I55N 3FE1A 3V9WA 2DFHA 4NB4A 3VQ9A 1RDBA 4CZFA 1NKCA 4DU3A 4FLZA 5J2NA 3I0RA 4H03B 4JK7A 4E89A 1DEJA 4DQSA 1KRPA 4B9QA 1KC8O 3KLIA 4FJGA 3AO2A 3WQTA 1S6PA 3WNGA 4LFAK 2Q0UA 4JKCA 1SKRA 4WQ5C 2GX9A 4KH4A 2XHBA 2A1SA 2FSNA 3SMSA 4FLTA 2EX3A 3AO3A 2F8TA 1L3VA 4FJNA 1IH7A 1XWLA 4CJQA 3VQDA 4JYAK 3CFRA 3CJBA 3U6FA 1FW6A 1KFSA 3LDQA 5AQVA 1OVQA 1T05A 3HI0A 4DTOA 3S3NA 4M7YA 4RCHA 1NGDA 3G6EN 2NRXA 4B9MA 4M3WA 2QEXN 4B3MK 4LF8K 4XIUA 3CJ1A 4HUGA 2ASOA 3CCSN 3E9PA 5FPDA 4WQ5A 2HHUA 3SBGA 1LOTB 4BR0A 4X64K 1NK4A 4AHTA 1NK5A 3SLCA 2A40A 4O5BA 3E1YA 1K8KB 4CK3A 1S5JA 3LL3A 2P9KA 4RTFD 2QA4N 4ILJA 2B5JA 2Y1IA 1V4TA 1B9FA 3T7ZA 2G8FA 5HRSA 1HNZK 3K2PA 3KLGA 4KHNA 5BPLA 4N56A 4DF4A 4CESA 2E4LA 4HHTA 2IC3A 4DFJA 5BR8K 3FZHA 3CJCA 4HCCA 3SAGA 4RW4A 4FJKA 1LCUA 4Z4GA 4YDUC 5AJ3K 3M8QA 4OPAA 1A5WA 2NRWA 3HSTB 3VQ6A 1WSHA 1HRHA 2P9PB 1HKBA 4BE1A 1KQSM 1GLBG 3AVLA 3OVNA 4Z4FA 2DPNA 1XQSC 1BCMA 3G10A 1IBMK 4LF9K 2YCHA 3SK3A 3LDOA 4E0DA 1HJRA 3K57A 4CJLA 4X66K 5BREA 2UXCK 1WNSA 2Q97A 4M42A 3OJSA 3CF5L 4E7LA 3VF6A 3L2VA 3VGLA 5ELZA 2IVPA 1YUWA 3MEEA 3TAEA 4YDUA 1LWEA 3ULEA 2YV0X 2ZWHA 5AQPA 4JI1K 2QXLA 1NGGA 5FRMA 4DUYK 2VYPA 3VETA 2Z1GA 2A5XA 3B8AX 1XC9A 3OYEA 3HP9A 3N4PA 4CZMA 1W7AA 3OYMA 3LAKA 4DV2K 3EKSA 3ZT4A 3NF8A 2VQEK 1BOTO 3VEWA 3PIPL 3CM6A 1BI4A 1D9FA 3TARA 1U49A 1WUAA 4IG3A 2IVOA 1SKSA 4DFPA 2YHBA 1VQ6N 3ISNC 5IT9O 2P9NB 3K5OA 1XHZA 1Q9XA 3O9RA 3OBYA 1FJGK 1TK8A 3ENBA 3WXIA 3HT3A 1U2VB 1JXBA 4B1XB 1TKXA 1MWMA 3VTIA 1YTUA 2BTFA 1J54A 4DLEA 4GKJK 1IV0A 5B8HA 3A2FA 3H45C 1IKXA 2KZMA 3JS6A 5E84A 3CHWA 1T8EA 4FYDA 1I39A 2O8CB 3SJJA 2WC9A 3OYJA 4J2EA 1NNEA 1WSEA 5KGWA 2UXDK 3HYFA 4ID5A 4KRFA 5KQDA 2FC0A 3ATVA 3NF7A 3CC2N 3MN5A 3OYKA 1YF5L 1VSIA 2A41A 4H5WA 2O4IA 2GWKA 1D4XA 2RPIA 3VQ4A 1KVBA 3CD6N 2IDOA 3S41A 3AO1A 2KLAA 1K73O 4BR7A 1NMNA 2FBVA 5H1SQ 3CPEA 1O13A 5HL7L 4CIEA 3MN9A 4MQ3A 4CEFA 4CHQA 3QNNA 5AQQA 2F7TA 4UY8O 5BR9A 3LM9A 3FFIA 4BQZA 3ENOA 1Y97A 3ALYA 4JI6K 3KLEA 2J4RA 1NGCA 2QWOA 3ZSWA 1L3UA 3ZT2A 3AVKA 5KQ8A 1QQCA 1E4GT 2D0BA 3IDHA 5HRRA 4M7XA 2V51B 2PYLA 1ZC6A 3L0QA 4PKGA 3L2WA 2YJEA 3BZKA 5CE3A 3L2UA 4FJHA 1HNVA 1S1TA 3K0SA 5LMUK 4KAZA 4C1NK 3MX5A 4KFBA 3NDKA 3ZETB 5FRNA 1S1UA 2E2OA 2A6AA 1BCOA 1QVGM 4FWMA 3TTCA 3QIPA 4BRHA 4JI0K 4CJEA 3CQ8A 1WN7A 4Y1CA 2ITGA 3WNFA 2QWQA 4RG8A 2YKMA 3E9LA 1S1WA 2FBTA 4CZIA 3TABA 2KQ2A 2DFEA 4JAXA 2RN2A 4CEDA 3WUHA 4JS5A 4DSEA 3SQ0A 3IKMA 1QSSA 4NCGA 3UB5A 1VQKN 4OGEA 3C6HA 1NOYA 4N76A 3MXJA 5C0YA 3AAQA 3SZ2A 3LP2A 4FSVA 2YNIA 1FKPA 5KRTA 2P9SA 3DAWA 1CLQA 5FPEA 2G8IA 4FOIA 4EP4A 1ASWA 1OVYA 1GLAG 4RW9A 3Q7CA 2UXBK 2P1JA 5J2MA 3K9KA 2VGNA 4CFCA 2HBKA 2IOCA 1EETA 1Z25A 3CCJN 4FWOA 3Q7BA 4FVUA 4DV5K 4DQRA 3HRGA 3KLHA 4CJTA 2P9PA 4HUEA 4OPHA 3LWMA 5AQKA 3AVFA 2Q0RA 1VSKA 3NHGA 3RVCA 2HNZA 4GVMA 4AHRA 4R5PA 4FLUA 2I7PA 4B1VA 5AQHA 3TAPA 4I2PA 2HHSA 3AO4A 4JD2B 3VERA 3ZX3A 2CGKA 2E88A 4G1QA 3MCPA 3QBWA 3ID8A 1RTJA 2QWPA 4RW8A 3THVA 4CGIA 2E8AA 4JKGB 4BR4A 1QHTA 3H08A 2EHGA 1JCGA 4CGHA 2W40A 3RTVA 1Q8IA 5AQXA 3SV4A 1S1XA 3TPQA 4ZHRA 5AQJA 3WXKA 2F8SA 1M90O 1JL2A 4BY9C 4ELUA 5JLHA 2HVIA 4M3RA 3EZWA 3D0PA 1VSFA 3CETA 1T44A 4CBXA 4FL9A 4CJRA 4M3UA 1TVRA 4JN4A 2Z1IA 2WOMA 1CZBA 2F9WA 4PL8A 4PHTX 4YFUA 1SV5A 2UUCK 1NGAA 5GAGP 1KAYA 2D0PA 4BVPA 1DLOA 2W42A 4O44A 3BUZB 1C0GA 3D7EO 4BRPA 4DR4K 2LSNA 2OPSA 2IIRA 4U67L 4CHNA 3LDPA 3W3DA 3D45A 4BWMA 4IG0A 4EP5A 1UWBA 3BP8A 1TK0A 1QQOA 4LH5A 4K8ZA 2JGUA 3CQXA 4UQGA 5FDLA 4FW2A 4EFHA 2ZF5O 1TV6A 4FM2A 2ZGZA 3PX4A 1OH8A 3SAHA 3RMBA 3PX6A 1U45A 2P5GA 4CCHA 5AFUH 3NF6A 3UIQA 3T3FA 4CF1A 4CD1A 1NGEA 1HMVA 2YNHA 4JHDB 3SV3A 4TSXA 2KZZA 2E1YA 1QTMA 2OTLN 1IO2A 2HHWA 1SL2A 1JLQA 3CCUN 4BRDA 4F3TA 2QXFA 4B1YB 1G15A 1RT4A 2VWJA 1C1AA 1NK0A 3KK2A 1HX1A 4PKHA 4FJ5A 4NCBA 4LC9B 1REVA 3V1QA 4KHYA 3ZETA 3SPYA 1X3NA 4IEIA 4NYFA 3AAPA 5AQRA 3O6WA 3DOKA 4B9SA 4L3QA 4N41A 3OS0A 5DMRA 1C0UA 5SZTA 3BEXA 1SQKA 3DXKB 5DM6L 4E19A 4BRGA 2WBNA 4AILC 2GBZA 1OH6A 4IBNA 5DM7L 3OYIA 2ITMA 5F1XA 3CCEN 3L2RA 1NOZA 3LP3A 3HSCA 3DRSA 1LAWA 4B3SK 3VOVA 4XH1A 4DWIA 2KHOA 3ZCMA 4KTWA 1GLJO 4GNIA 1JL1A 4JS4A 3RMDA 3DM2A 3SYZA 3AGKA 1MWKA 1BDGA 3E01A 4E1MA 4BGBA 4C8NA 3ULEB 5MLCQ 4IO9L 1W97L 4AQYK 3RSEB 3ZSRA 5HOOA 3QDKA 1TKZA 1LW0A 1MA9B 2QWMA 2D5RA 1GLEG 3HOSA 4NYNA 1NJXA 3EL2A 3O4QA 2UU9K 4H5TA 4JD2A 5HBMA 5LJWA 3RRHA 4KHPK 3GDQA 4CI6A 2GV9A 4HCBA 2FBYA 4GMJB 3VA3A 2HMIA 3M5RA 4FZYA 1QZ5A 2YNGA 4CGGA 4JKGA 3OS2A 3DWLA 4AHVA 1HNWK 3AGRA 2ZQBA 5AQSA 4Z4HA 3AA5X 4BRLA 5M1KA 4B9UA 3DLHA 2VG6A 1RDWX 3LANA 1WLJA 3IFRA 3GBTA 1KVCA 3SAFA 5M1FA 3TAQA 2D0OA 2QWNA 3NMUA 4F2SA 1C1BA 4CZGA 1VQPN 1ILYA 5C2FA 1QHAA 3TU5A 1NLVA 3THWB 2HW3A 1EQYA 2IGIA 5BPMA 3UE5A 4MDAA 2KKZA 3NCIA 4HUFA 3VQ5A 2WFBA 3P31A 5GAHP 1QSYA 4JKFA 4ISGA 4KH5A 4LF7K 3O3FA 4AHCA 1X9MA 3U4LA 2R7YA 4W5TA 5AQNA 3GOIA 1BA0A 1U4BA 1Q81O 3G71N 5E26A 4FJ8A 2NRHA 3M8SA 1C6VA 4M41A 3VQBA 4CJWA 4JI4K 4KHWA 5ADXA 4JEPA 1XHXA 5AQWA 2ZD1A 3TANA 2XY5A 3CMAN 3P39A 3O8MA 3CQYA 4FJXA 1MU2A 5CR4A 3PUFA 2FF3B 4F2RA 2GWJA 1VSDA 3QNOA 4PL7A 1I3AA 5AZIA 4V19S 1KTQA 4BE0A 4OLAA 4WCEL 5FPMA 4DQ8A 1RFQA 2QKKA 2CGLA 2Q36A 4CIGA 4O0JA 3KD5E 4JHDA 2AA4A 4BE2A 4BG8A 5EOYA 3MDQA 3MCAB 4BACA 3DLEA 4A5AA 2UUBK 2YNFA 4RW7A 3U8XA 2JWKA 4OJRA 3D2FA 1N33K 3PX0A 2QWLA 4FM1A 2A42A 3HK2A 1KD1O 1EKEA 2P9SB 5AQZA 5KTQA 4IKFA 4BWJA 1JLEA 3QFPA 4AM7A 4FZXC 3F9KA 1ZBIA 5C25A 4W5QA 1IJJA 3SQ1A 3VQCA 1BISA 4WE1A 4YOYA 1QS4A 1N6QA 1BL3A 4FPAA 4YOWA 5AQOA 2NRZA 1NK7A 3AVCA 3PV8A 3TTFA 1RDUA 1D9DA 5AQTA 4DS5A 3DLKA 3DXKA 4E7KA 3LP1A 5EX5A 4IDKA 2VG5A 3SPZA 3OYAA 2HOEA 4EHUA 4CEAA 3IMXA 4ID1A 1R0AA 3L6QA 5AQGA 1O1WA 3HM9A 2HHVA 1NGFA 2XO7A 4C8MA 3DLBA 4FK0A 1VQ7N 1TYQB 4CERA 5JICA 3HPGA 3KWGA 3KVGA 1KLMA 1YJ9N 3KIOA 1NKBA 2FF6A 1BQMA 5EY4A 2E1ZA 4DTPA 5J2PA 3V1RA 3SQ2A 4LF6K 4DTUA 3HO1A 3V4IA 3O4WA 4CF8A 3QFUA 1F21A 1M1KO 3M8PA 1CZAN 4IFVA 3RSEA 1WBDA 4YY3K 3AA2A 1Q86O 1LAVA 2F4VK 4JI5K 1QQNA 1Q82O 3O3HA 3VTHA 2PFUA 1C0FA 4BC3A 2D4WA 5J2QA 3T1AA 1EWQA 2YHXA 1U47A 3CERA 2OCEA 2YJFA 3OBWA 4FVMA 3I56N 3DJCA 3V81A 1RBUA 2Z1HA 3CC7N 4OX9K 1BG3A 1GLLO 3ZEUB 3EZ5A 3LPTA 2HVHA 3LALA 2HSTA 4LF5K 2RE2A 3NGIA 4B9TA 3LZJA 4I7FA 4K42A 2HHTA 1LV5A 3V1OA 4O8UA 3B6PA 1X1PA 5HP1A 1ATNA 1RT6A 3G0ZA 2WONA 5BN8A 1NK9A 2UYTA 3GL1A 3C6UA 1U48A 4FLYA 1N32K 2KFZA 4FK2A 2FBXA 3TTDA 3NE6A 3HTVA 3THWA 1OKJA 3AVBA 1P8ZA 1NJZA 1XMOK 2PAVA 1WSIA 5DK5A 4FWRA 4K25A 3ZX0A 4E7IA 4DU4A 4A2AA 3QEIA 3SUPA 3DYAA 3MXIA 3J81O 4KV8A 1NK6A 1E4FT 4ILGB 4CEZA 3V6DA 1RT2A 4WFNL 3SQ4A 3ZT3A 3M1FA 4E3SA 1HJOA 3C6AA 4HWIA 1HNIA 1ZBHA 1LWCA 4GKKK 3QBXA 4B3TK 2FLOA 2Q1NA 3F2KA 1NGHA 3KK7A 3IAYA 4EIAA 4DV3K 2Z1JA 3U3GA 1UAXA 4JI8K 3V9XA 1RCHA 4J8FA 3NH2A 3VN5A 3PSFA 4FWNA 4B9LA 4ISEA 1BU6O 1JCFA 1VRUA 2ASPA 4IOXA 3NAEA 1YIJN 3TAMA 1WSFA 5JVGL 3K9JA 4CJFA 2G8WA 4C8LA 1ESVA 3EYZA 3WNHA 1VQ4N 4Z4IA 3AO5A 4AH9A 1JLGA 4CGJA 2BANA 1DTQA 2QM1A 3EO3A 3WXLA 3ASMA 4E7JA 3ZX2A 2OZMA 3CC4N 4FPBA 3VQAA 3C94A 2B4JA 1NJWA 1BIUA 4B9VA 1Z6RA 5LL6Z 4OO1J 3R1XA 4KI4A 4LSNA 2HHHK 3M3ZA 3AARA 4DU1A 3DXMA 1NGBA 1DT9A 3J7AP 3PY8A 1LW2A 1ZBFA 3VQPA 2BDPA 5HRPA 1XMQK 2OYQA 1SUQA 1GOBA 2QTDA 3O3GA 2FSJA 5AQMA 1G99A 2QI2A 4DV0K 5JS2A 1SZ2A 1YT3A 4O0IA 4PKIA 2NNWA 3IG1A 5CYMA 1FXXA 5KGXA 2O8BB 3O9QA 3I0SA 1BWFO 5I9EB 4DQIA 1TK5A 3EE8A 4H5NA 5BN9A 3B6OA 1KVAA 4BRFA 4CJ5A 3F5TA 5D3GA 2HF3A 1XNQK 4PQUA 1RBRA 4CHOA 2VQFK 4H0TB 2JWLA 1HNXK 4EZ9A 4FWKA 4AF1A 3HXMA 4DLGA 3CCVN 4M3YA 3R6MA 4CGFA 3QMLA 3LDNA 1TYQA 2UUAK 5M1OA 2O8DA 2E6LA 2YHYA 2E2PA 4BR2A 4QCLA 3DLLL 3R8EA 4E1NA 1NBWA 4CJSA 4JK8A 3AVHA 2ZGYA 4CECA 3L3UA 5CZ2A 1J6ZA 3VF2A 1NMDA 3C7NB 1KXPA 3DMJA 1ZBLA 1RNHA 5F0XA 4X65K 2VWKA 4I6MB 2YHAA 3O4NA 3TAFA 4JKHA 1W0HA 1N5YA 3TAGA 2NRRA 4M3TA 4ILHA 2BUPA 4BRAA 1KSPA 1J5EK 3QINA 4CGDA 4CJ7A 4DMNA 1J5OA 1FK9A 2IS3A 3ZEUA 1ZXOA 1RT3A 3RRGA 4JLHA 2ZJPL 1RDAA 3WT0A 3VQ7A 3QERA 1BIZA 4CK1A 3H1VX 3VENA 1Z26A 3F9MA 1RILA 4FZZA 1GLFO 3HM8A 3V9ZA 4JRPA 3T19A 4A5BA 3NF9A 2QKBA 5JLFA 3QLHA 3JAMO 4PWDA 4FXDA 2P9UB 1KAZA 4N5SA 4BVOA 1D8YA 2DTUA 4WFBL 4W5RA 1D5AA 4CHZA 3HVTA 3WQUA 1KLNA 5AZIB 1WAFA 3OYNA 4QS8A 4DR1K 2GUIA 3H6EA 1R59O 4CZJA 3NVKA 3O9TA 2D0CA 4IOCL 1ATSA 4CJVA 3OTOK 3FZFA 4IJAA 4DF8A 3VEYA 3NBPA 1DGKN 5I3UA 1BA1A 4HVJA 1IKVA 1S6QA 3L3VA 1S72N 3A5NC 3GE1A 1HUXA 3D2FB 3KHYA 4Z94A 1SAZA 5IWAK 3G25A 4DSFA 3IUCA 1TUUA 1KFDA 3QIOA 1QE1A 3I8DA 4FJ7A 4LY7A 4KPYA 4BRQA 1VK0A 1EX4A 1EP4A 1NKEA 3O1BA 2P5OA 2AJQA 3LZIA 2G8KA 3DRPA 3KKRA 3DLRA 3MN6A 3A5MC 1ATRA 1NWKA 4F9OA 4FWLA 4GW6A 3VGKA 4J2BA 1YVNA 4DTXA 3UKRA 4FLWA 4W5NA 4PY5A 4CHYA 3U3YA 4KHUA 1S9EA 4C23A 4NLBA 4KH6A 3H3NO 4JRQA 1HYSA 3EKUA 5GADP 3I8BA 4BC4A 3J7ZO 2OA8A 3H1QA 3J80O 2HMPA 3FFKB 1VQON 3OYGA 1L5UA 1S22A 1QQMA 3LAMA 3VQEA 5KPZA 3T1HK 4B3OA 3SNNA 4DTMA 4DQQA 4FLVA 3LWLA 4R79A 3QEVA 2WUSA 4LF4K 1VQLN 3M8RA 2X6NA 2O8BA 4GVEA 4A61A 3VEZA 4IO8A 4ICLA 3P4IA 4M3XA 2YKNA 2H3GX 3V9SA 4BR5A 2OPQA 4FOEA 4MDBA 2WTUA 4GV6A 1BHLA 1GOAA 4DV7K 5BPNA 4Q0BA 3QO9A 4M3ZA 1K9MO 3CFOA 3AY9A 3D2EA 3BGRA 4OPJA 3IRXA 1XNRK 5HLFA 2P9IB 1TL1A 2W6LA 3QEPA 1HYVA 5AQLA 4DHYA 3PLAA 5KPRA 3DRRA 1JCEA 3JYTA 2I5JA 4CK2A 3KJVA 4BRNA 4A62A 1RGIA 1GLDG 4JKBA 2ZJRL 4JK9A 1N36K 1DKGD 4LFCK 2P51A 3H46O 5AQYA 1NU0A 2O8FA 3C7NA 1IKWA 2W6KA 3TSQA 5HRNA 3EN9A 4M63C 3FZLA 3P83D 1XC3A 3ZSYA 1U04A 4F8RA 3NH1A 4CZHA 1BQNA 4LH4A 2BGGA 4H0YB 4I6MA 3RWUA 1SL1A 2HHXA 5M1QA 3LP0A 4H5RA 1DTTA 4J2DA 4IWVA 3FZKA 4MFBA 4DSKA 2AP1A 4O55A 1JLCA 5JS1A 2ZE2A 4FJJA 4YHHK 2E20A 2X78A 1IKYA 3HZ6A 4OLBA 2FXUA 4FLXA 3VGMA 3T1YK 1S1VA 2X74A 5J1EA 2E2NA 3HP6A 3CCLN 2XRIA 1V4SA 3TSPA 3BY5A 2DY4A 2D0AA 4IDHA 4CJ4A 3OJUA 1T7PA 1VSMA 2P9UA 1S9GA 4B1ZA 5EXWA 4Z4CA 1ZYQA 4OKJA 1B92A 4DS4A 3KLFA 3MK6A 4CZLA 1IBKK 5AFUA 2HBMA 2A1RA 2NLXA 4IZ9A 3VPZA 4RW6A 4OKKA 1UOCA 3CCMN 3WEEB 3KK1A 3O5BA 3BF1A 5SWMA 4DTSA 2HF4A 4Z0UA 5TKYA 3O9UA 3BDPA 3O1WA 5T7BA 2HHQA 4B3RK 4ZTFA 2VWBA 2GTDA 3SUQA 1XI1A 3MWTA 3I33A 2E5LK 1WSJA 1YTAA 4KB1A 4M45A 4ISFA 4JKAA 2QK9A 3DXMB 4WFAL 3MN7A 1JKHA 3TWHA 3SUNA 4WQ4C 4CFBA 1UA1A 3D6RA 3PIOL 4DFKA 4BG9A 4GY2B 3O08A 2V52B 3WNEA 4BROA 3ATUA 1CXQA 1K8AO 5M1PA 2RF2A 3AVAA 4NO7A 2IAJA 1QVFM 1IG8A 3NH0A 5C24A 1YVUA 1RTHA 3OA9A 3ZYYX 3K5NA 1EO1A 2Q2RA 1K6YA 3HBTA 3NFAA 5K14A 4YOUA 3HJFA 1W2BM 1OH7A 3VQ8A 2OANA 4WQ4A 4AHUA 1WSGA 4JKEA 3F73A 4Y1DA 4QS7A 4DUZK 4KTQA 2GUPA 1Q18A 3TI0A 2O8DB 5AZJA 4LSLA 3ZT0A 4MLHA 4K8XA 4DTJA 1H1VA 4K0KK 3C6TA 2XY6A 4H0VB 3MX2A 1HLUA 1VSEA 4O5FA 4JI7K 3HVRA 3SCXA 4DR7K 1HPMA 3UKUA 4YOTA 5AR0A 3S3OA 4XEIA 4CEBA 4H4OA 3HPHA 4B8CA 4YNQA 4NLCA 1WB9A 3L8BA 4ELVA 1WAJA 3MMVA 1ZBUA 2QWRA 3M6GA 3OYFA 1GLCG 5BRHA 1A5XA 1W9HA 3HL8A 3VESA 5JMVA 1SL0A 2P9IA 1FKOA 3LDSA 3THXB 3J8AA 2I7NA 4DSLA 4O4GA 4CFAA 1KAXA 2JLEA 3DOLA 1VSJA 1NGIA 1QSLA 3CG7A 2G8VA 3K5MA 1VQMN 4I9LA 1VQNN 4NXNK 4DSJA 3G4SN 2ASMA 5GINA 1LWFA 4A57A 2VG7A 4F3OA 3ID6A 1TL3A 4K43A 3JSMA 3OYHA 4CBWA 4MLEA 4AHSA 4DB3A 4BC5A 3ITHA 2RHKA 3QICA 3E9OA 3VMFB 5CZ1A 4CJKA 5F2RA 4O8KA 1BGXT 4JI3K 3CJAA 3H3OB 5FPNA 2NRVA 4CE9A 5C42A 1T6DA 1I94K 1TAUA 3ENHA 4OVLA 3LPUA 4DR6K 5GIOA 5LJVA 4CF0A 5EVZA 4H0XB 1RT7A 1RBSA 2E6MA 3MWPA 4RWTA 3VEOA 2OZSA 4CIFA 3AA4A 3VA0A 4A59A 3QEXA 4EHTA 3FR0A 4DQPA 4YORA 4KI6A 4DV1K 3C0BA 3NGYA 1XUPO 3PSIA 3LDLA 2HBLA 3MXMA 3U9DA 4EAHD 1C1CA 4C1NI 3CYMA 4QAGA 2HB5A 3RMAA 4FWSA 3UKRB 1HQEA 3WEEA 1TKDA 4OKEA 1ASUA 5GIPA 2NRTA 4X62K 2V7YA 2KW4A 2G8UA 3A5OC 1X9SA 2CGJA 4FK4A 4H0OA 1N8RO 3KD1E 3FZMA 4IEEA 4DTNA 4KBOA 5C2DA 3P1GA 3W0LA 3MAQA 2RKIA 3OHRA 1T6CA 1L3SA 2YI1A 3THYB 5I42A 3CJ9A 3ZSVA 3FLCO 4B8AB 5LMNK 3CCRN 3K59A 4QS9A 1WBBA 3KK3A 1HR0K 3ZT1A 3U9ZA 5CYQA 4H0PA 1K8KA 1JXEA 2KTQA 2O8EB 3BF3A 1JLAA 2P9LB 3A0IX 4KHQA 4FWQA 4BR9A 2D1KA 3MEDA 3VQQA 1YXQA 3AVJA 5CHIA 3CIPA 4KO0A 4XH4A 3OYCA 1YITN 4CEQA 3K5LA 4GV3A 1RT1A 3MEGA 4CJUA 4JNEA 3D2EB 4CFDA 3AV9A 3CM5A 4DR3K 3QEWA 3CPWM 3SBTA
chains in the Genus database with same CATH topology
3HT3A 4FJXA 1MU2A 2OA8A 1JXBA 3PUFA 1TKXA 4F2RA 1VSDA 3QNOA 3V9UA 4CF2A 1YTUA 4KKOA 4KTZA 5EU7A 1J54A 4DLEA 1I3AA 1KTQA 4BE0A 3QESA 4OLAA 3OYGA 3A2FA 1L5UA 2QKKA 1IKXA 2KZMA 4CIGA 3LAMA 3VQEA 1T8EA 4FYDA 1I39A 4O0JA 3KD5E 4DFMA 3SJJA 4B3OA 3SNNA 4Q5VA 4DTMA 3OYJA 4BE2A 4DQQA 3RMCA 4FCYA 1X9WA 4FLVA 4J2EA 1WSEA 5KGWA 3HYFA 4ID5A 3LWLA 4KRFA 3QEVA 2FC0A 3NF7A 3DLEA 4BACA 2ETJA 2YNFA 3OYKA 4RW7A 4OJRA 1VSIA 2PZSA 3OYLA 2O4IA 3M8RA 2X6NA 3PX0A 2NUBA 2RPIA 3VQ4A 4FM1A 1KVBA 4F4KA 4DSIA 3HK2A 3KTQA 4ICLA 2IDOA 3AO1A 1EKEA 4M3XA 2FBVA 2YKNA 5KTQA 4IKFA 3V9SA 2OPRA 4BWJA 2OPQA 1JLEA 4CIEA 3S3MA 4CEFA 4MQ3A 1BHLA 3AVNA 3OYDA 1GOAA 4CJPA 4CHQA 3QNNA 3F9KA 4FZXC 5C25A 4W5QA 3SQ1A 1ZBIA 3VQCA 1BISA 3FFIA 4Q0BA 1UA0A 3QO9A 1Y97A 3ALYA 4WE1A 1QS4A 3KLEA 4M3ZA 3CFOA 1N6QA 1BL3A 3ZSWA 1L3UA 3BGRA 3ZT2A 4OPJA 3AVKA 3IRXA 4I2QA 1NK7A 3AVCA 1QQCA 3PV8A 5HLFA 2D0BA 1A5VA 1TL1A 3QEPA 5HRRA 1D9DA 1HPZA 1HYVA 2PYLA 4DS5A 3DLKA 4E7KA 3LP1A 4IDKA 3L2WA 3DRRA 3L2UA 4FJHA 1HNVA 1S1TA 3JYTA 2I5JA 1SKWA 2VG5A 4CK2A 4KAZA 3SPZA 3OYAA 3KJVA 4KFBA 3NDKA 3DLGA 1CXUA 5FRNA 4CEAA 4L8RB 1S1UA 4LD0A 4ID1A 1BCOA 2P51A 2XY7A 1R0AA 5E41A 3QIPA 1O1WA 4CHPA 3HM9A 4KHSA 4FW1A 4OGCA 1IKWA 5HRNA 2HHVA 4CJEA 3CQ8A 2B6AA 3OYBA 2XO7A 4C8MA 1WN7A 4Y1CA 2ITGA 3DLBA 3PO4A 3WNFA 1GOCA 3P83D 3C95A 4RG8A 1U04A 3ZSYA 2YKMA 4F8RA 1S1WA 5KRSA 3NH1A 2FBTA 1BQNA 4LH4A 2Y1JA 2F96A 3TABA 2KQ2A 2BGGA 1VSHA 2DFEA 3RWUA 2RN2A 4CERA 4CEDA 1SL1A 3HPGA 1NKBA 2HHXA 1KLMA 4JS5A 3KIOA 4Z4EA 4DSEA 3SQ0A 1QSSA 3LP0A 4DG1A 1DTTA 4NCGA 1BQMA 1B9DA 4KB0A 4J2DA 4OGEA 4DTPA 5J2PA 3V1RA 3RR8A 3SQ2A 4MFBA 4PA1A 3AVIA 1NOYA 4N76A 3MXJA 4DSKA 4DTUA 4BDYA 3HO1A 3V4IA 1VSLA 4O55A 3SZ2A 3SUOA 3P5JA 3LP2A 5HP1A 2YNIA 1FKPA 1RDDA 4CF8A 1F21A 1JLCA 5KRTA 1CLQA 2G8IA 3M8PA 2ZE2A 4CEOA 4FJIA 4IFVA 4FJJA 5JS1A 4EP4A 2X78A 1ASWA 4OPKA 1IKYA 3OS1A 3AA2A 4CEEA 1LAVA 4OLBA 4C8KA 4FLXA 4RW9A 2HNDA 3O3HA 4QOZB 1C0TA 1S1VA 4IFYA 2X74A 2P1JA 5J1EA 3HP6A 5J2QA 3T1AA 3ULDA 5J2MA 2PY5A 4CFCA 1ASVA 1U47A 2IOCA 1EETA 2XRIA 1Z25A 2KFNA 4FVMA 1JLFA 1TKTA 3V81A 2DY4A 2XY8A 1EXQA 1RBUA 2Z1HA 3SI6A 4DQRA 2D0AA 1T03A 4I9QA 3KLHA 4CJ4A 3OJUA 3L2QA 3EZ5A 1T7PA 4CJTA 4PUOA 3LPTA 2HVHA 1VSMA 3LALA 1S9GA 1ZYQA 4Z4CA 4HUEA 1ITGA 4OKJA 4ZTJA 3NGIA 1NJYA 1B92A 2OPPA 3LWMA 4N47A 3LZJA 1RDCA 3AVFA 4I7FA 4DS4A 1KCFA 3AVGA 1TAQA 2HHTA 1VSKA 1LV5A 4FJMA 3V1OA 3KLFA 3NHGA 3B6PA 1X1PA 2HNZA 4GVMA 4AHRA 3MECA 1RTIA 2BE2A 1RT6A 4R5PA 3NGZA 4FLUA 3TAPA 3G0ZA 4I2PA 2HHSA 3AO4A 2WONA 2A1RA 1NK9A 4RW6A 4HTUA 1RBVA 3C6UA 3IS9A 4OKKA 4FLYA 1U48A 1UOCA 3KK1A 2DFFA 2KFZA 4C8OA 4G1QA 5SWMA 4FK2A 4DTSA 2X6SA 2FBXA 1RTJA 3NE6A 4RW8A 3THVA 4CGIA 4E7HA 3AVBA 4Z0UA 3AVMA 1NJZA 3BDPA 1QHTA 3H08A 2EHGA 1WSIA 5DK5A 4CGHA 5T7BA 4W5OA 3RTVA 4E7IA 4DU4A 1Q8IA 3QEIA 4ZTFA 2HHQA 3SUPA 1RTDA 3DYAA 3DI6A 3SV4A 1S1XA 3SUQA 3MXIA 1XI1A 1VRTA 1NK8A 4KV8A 1NK6A 1WSJA 1YTAA 4ZHRA 1HQUA 4M45A 4KB1A 2QK9A 2HNYA 4KREA 2F8SA 4CEZA 1JL2A 1RT2A 3V6DA 3S9HA 1Q9YA 3SQ4A 3RR7A 3ZT3A 4ELUA 2HVIA 1JKHA 3TWHA 4M3RA 4B08A 3SUNA 3D0PA 4E3SA 4CFBA 1VSFA 1UA1A 2PYJA 1J9AA 4DFKA 1HNIA 1ZBHA 1LWCA 3ZSQA 5FROA 4CJRA 4M3UA 1TVRA 3IAYA 2G8HA 2Z1IA 2WOMA 4ELTA 2ATQA 1CZBA 1TGOA 4NCAA 1CZ9A 2Z1JA 3WNEA 3U3GA 4FJ9A 4YFUA 1JLBA 1SV5A 1UAXA 1CXQA 5CY4A 2RF2A 3AVAA 3V9XA 1DLOA 4H8KA 2W42A 1RCHA 3PO5A 2IAJA 4O44A 1L3TA 3NH2A 3VN5A 4FM0A 3NH0A 2LSNA 2OPSA 5C24A 1YVUA 1RTHA 3TR8A 4B9LA 4CHNA 3HPOA 3K5NA 4B9NA 3ZSXA 1BI4B 1K6YA 1VRUA 4FJLA 3NFAA 5K14A 5HROA 1IG9A 3HJFA 1RBTA 3NAEA 3TAMA 1WSFA 5KI6A 4CJFA 2G8WA 4C8LA 3D45A 3VQ8A 4BWMA 1J53A 4AHUA 3EYZA 4IG0A 1WSGA 4EP5A 3WNHA 3F73A 1UWBA 1TK8A 1C0MA 3ZSOA 4CJ3A 1TK0A 3KKSA 4Y1DA 4Z4IA 3AO5A 4AH9A 1JLGA 4CGJA 2BANA 1DTQA 4E7JA 4KTQA 3ASMA 1HYZA 4LH5A 2OZMA 4K8ZA 2JGUA 3TI0A 4UQGA 5FDLA 4FW2A 4BDPA 3AA3A 4LSLA 3ZT0A 2Q3SA 4K8XA 3VQAA 3C94A 4DTJA 2B4JA 1NJWA 1BIUA 4B9VA 1TV6A 4FM2A 3C6TA 3EY1A 1RT5A 3PX4A 3RMBA 3PX6A 2XY6A 1U45A 4KI4A 4DTRA 4LSNA 2P5GA 4CCHA 1VSEA 4DU1A 3NF6A 4H4MA 4EZ6A 3QETA 3UIQA 3HVRA 3T3FA 4CF1A 3PY8A 1LW2A 1ZBFA 3SCXA 3K58A 3CFPA 3VQPA 1HMVA 2O4GA 2YNHA 2BDPA 5HRPA 2OYQA 3S3OA 4CEBA 1SUQA 4H4OA 1GOBA 2F8TA 3SV3A 3O3GA 4TSXA 3ZSZA 2KZZA 4J2AA 3HPHA 4B8CA 4YNQA 3L8BA 4ELVA 4CF9A 5JS2A 3OY9A 1WAJA 1YT3A 4BDZA 1QTMA 4O0IA 1ZBUA 1IO2A 3IG1A 3OYFA 2HHWA 1SL2A 5CYMA 1FXXA 1JLQA 5KGXA 1A5XA 1W9HA 3HL8A 1SL0A 4F3TA 3V9WA 2DFHA 1FKOA 3LDSA 3VQ9A 2QXFA 1RDBA 1NKCA 1G15A 3I0SA 4DU3A 4FLZA 4DQIA 1RT4A 4DSLA 2VWJA 1C1AA 4O4GA 3I0RA 4CFAA 5J2NA 1TK5A 3KK2A 1NK0A 4E89A 4DQSA 1KRPA 3B6OA 4FJ5A 4NCBA 1KVAA 3KLIA 4CJ5A 4FJGA 1REVA 3AO2A 2JLEA 3V1QA 1S6PA 3DOLA 4KHYA 1VSJA 3WNGA 5D3GA 3SPYA 1SKRA 4NYFA 4PQUA 1QSLA 1RBRA 4CHOA 2XHBA 3DOKA 3CG7A 2G8VA 3K5MA 4B9SA 2A1SA 4I9LA 4FLTA 4N41A 3OS0A 2EX3A 3AO3A 1C0UA 5DMRA 5SZTA 4EZ9A 1L3VA 3HXMA 1IH7A 4DLGA 1XWLA 4CJQA 4DSJA 4FJNA 3VQDA 4M3YA 3CFRA 4CGFA 3U6FA 1KFSA 1LWFA 4E19A 2VG7A 2E6LA 4F3OA 1T05A 4AILC 4QCLA 1TL3A 4DTOA 3S3NA 2GBZA 4E1NA 4CJSA 3JSMA 3AVHA 3OYHA 4IBNA 3OYIA 4B9MA 4M3WA 4AHSA 4CECA 3L3UA 5CZ2A 4XIUA 3L2RA 3ITHA 1NOZA 4CJKA 3LP3A 3DMJA 5CZ1A 3DRSA 4HUGA 1LAWA 1ZBLA 1RNHA 1BGXT 4DWIA 3ZCMA 4KTWA 2VWKA 4JS4A 1JL1A 3RMDA 2HHUA 2YHAA 4CE9A 5C42A 3DM2A 3O4NA 3TAFA 3SYZA 1TAUA 1W0HA 1N5YA 3TAGA 3E01A 1NK4A 4AHTA 4OVLA 1NK5A 3LPUA 4E1MA 4M3TA 4O5BA 4C8NA 1KSPA 3QINA 4CGDA 4CK3A 1S5JA 4CF0A 4DMNA 1RT7A 2B5JA 1FK9A 2Y1IA 1J5OA 1RBSA 2IS3A 2E6MA 1B9FA 3ZSRA 2OZSA 1RT3A 3RRGA 4CIFA 3AA4A 1TKZA 4JLHA 3VA0A 4FK0A 2G8FA 1RDAA 5HRSA 3QEXA 1LW0A 3K2PA 3KLGA 4DQPA 4N56A 4KHNA 4DF4A 2D5RA 4KI6A 3NGYA 4CESA 2E4LA 4HHTA 2IC3A 4DFJA 4NYNA 3VQ7A 3QERA 3MXMA 1BIZA 4CK1A 1Z26A 1NJXA 3O4QA 4HCCA 1C1CA 1RILA 4RW4A 3CYMA 4FZZA 4QAGA 4FJKA 2HB5A 4JRPA 3V9ZA 5HBMA 3RRHA 3RMAA 4Z4GA 3T19A 1HQEA 1TKDA 3NF9A 2QKBA 3M8QA 3QLHA 4OKEA 2GV9A 1ASUA 4HCBA 2FBYA 1A5WA 4GMJB 3VA3A 3HSTB 4PWDA 3VQ6A 2HMIA 4FXDA 1WSHA 1HRHA 4FZYA 2KW4A 2G8UA 2YNGA 4CGGA 4BE1A 1X9SA 3AVLA 3OVNA 4FK4A 4N5SA 3OS2A 1D8YA 2DTUA 3KD1E 4AHVA 4Z4FA 4DTNA 4W5RA 1D5AA 4CHZA 4Z4HA 2ZQBA 3P1GA 3AA5X 3HVTA 1BCMA 3G10A 1KLNA 3OYNA 1WAFA 2VG6A 3DLHA 4B9UA 3MAQA 2GUIA 3LANA 2RKIA 1WLJA 1HJRA 2D0CA 4E0DA 1L3SA 1KVCA 4CJLA 3K57A 5I42A 4CJVA 1WNSA 3TAQA 4M42A 3ZSVA 3OJSA 4DF8A 4B8AB 4E7LA 4F2SA 1C1BA 3L2VA 3NBPA 3K59A 5I3UA 3KK3A 4HVJA 2HW3A 1IKVA 3MEEA 1S6QA 2IGIA 3L3VA 3TAEA 3ZT1A 1LWEA 5CYQA 4DSFA 2YV0X 3NCIA 4HUFA 1JXEA 2KTQA 3VQ5A 1JLAA 1KFDA 3QIOA 5FRMA 1QE1A 3I8DA 1QSYA 4B9TA 4FJ7A 4KHQA 4LY7A 3O3FA 2Z1GA 4AHCA 1X9MA 4KPYA 1VK0A 3MEDA 3OYEA 1XC9A 1EX4A 1EP4A 3HP9A 3VQQA 3AVJA 4W5TA 3LAKA 3OYMA 2R7YA 1NKEA 2P5OA 2AJQA 3LZIA 3ZT4A 3NF8A 4KO0A 1U4BA 3OYCA 2G8KA 3DRPA 3CM6A 1BI4A 3DLRA 3KKRA 4CEQA 3TARA 1U49A 1D9FA 4FJ8A 3M8SA 3K5LA 1C6VA 1RT1A 4IG3A 3MEGA 4M41A 4CJUA 4GW6A 3VQBA 4CJWA 1SKSA 4DFPA 4KHWA 2YHBA 4J2BA 4CFDA 1XHXA 4DTXA 3AV9A 4FLWA 4W5NA 4PY5A 3CM5A 3ISNC 2ZD1A 4CHYA 3U3YA 4KHUA 3TANA 2XY5A 1S9EA 3K5OA 1XHZA 1Q9XA 3QEWA 4JRQA 1HYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HT3 A;  4FJX A;  1MU2 A;  2OA8 A;  1JXB A;  3PUF A;  1TKX A;  4F2R A;  1VSD A;  3QNO A;  3V9U A;  4CF2 A;  1YTU A;  4KKO A;  4KTZ A;  5EU7 A;  1J54 A;  4DLE A;  1I3A A;  1KTQ A;  4BE0 A;  3QES A;  4OLA A;  3OYG A;  3A2F A;  1L5U A;  2QKK A;  1IKX A;  2KZM A;  4CIG A;  3LAM A;  3VQE A;  1T8E A;  4FYD A;  1I39 A;  4O0J A;  3KD5 E;  4DFM A;  3SJJ A;  4B3O A;  3SNN A;  4Q5V A;  4DTM A;  3OYJ A;  4BE2 A;  4DQQ A;  3RMC A;  4FCY A;  1X9W A;  4FLV A;  4J2E A;  1WSE A;  5KGW A;  3HYF A;  4ID5 A;  3LWL A;  4KRF A;  3QEV A;  2FC0 A;  3NF7 A;  3DLE A;  4BAC A;  2ETJ A;  2YNF A;  3OYK A;  4RW7 A;  4OJR A;  1VSI A;  2PZS A;  3OYL A;  2O4I A;  3M8R A;  2X6N A;  3PX0 A;  2NUB A;  2RPI A;  3VQ4 A;  4FM1 A;  1KVB A;  4F4K A;  4DSI A;  3HK2 A;  3KTQ A;  4ICL A;  2IDO A;  3AO1 A;  1EKE A;  4M3X A;  2FBV A;  2YKN A;  5KTQ A;  4IKF A;  3V9S A;  2OPR A;  4BWJ A;  2OPQ A;  1JLE A;  4CIE A;  3S3M A;  4CEF A;  4MQ3 A;  1BHL A;  3AVN A;  3OYD A;  1GOA A;  4CJP A;  4CHQ A;  3QNN A;  3F9K A;  4FZX C;  5C25 A;  4W5Q A;  3SQ1 A;  1ZBI A;  3VQC A;  1BIS A;  3FFI A;  4Q0B A;  1UA0 A;  3QO9 A;  1Y97 A;  3ALY A;  4WE1 A;  1QS4 A;  3KLE A;  4M3Z A;  3CFO A;  1N6Q A;  1BL3 A;  3ZSW A;  1L3U A;  3BGR A;  3ZT2 A;  4OPJ A;  3AVK A;  3IRX A;  4I2Q A;  1NK7 A;  3AVC A;  1QQC A;  3PV8 A;  5HLF A;  2D0B A;  1A5V A;  1TL1 A;  3QEP A;  5HRR A;  1D9D A;  1HPZ A;  1HYV A;  2PYL A;  4DS5 A;  3DLK A;  4E7K A;  3LP1 A;  4IDK A;  3L2W A;  3DRR A;  3L2U A;  4FJH A;  1HNV A;  1S1T A;  3JYT A;  2I5J A;  1SKW A;  2VG5 A;  4CK2 A;  4KAZ A;  3SPZ A;  3OYA A;  3KJV A;  4KFB A;  3NDK A;  3DLG A;  1CXU A;  5FRN A;  4CEA A;  4L8R B;  1S1U A;  4LD0 A;  4ID1 A;  1BCO A;  2P51 A;  2XY7 A;  1R0A A;  5E41 A;  3QIP A;  1O1W A;  4CHP A;  3HM9 A;  4KHS A;  4FW1 A;  4OGC A;  1IKW A;  5HRN A;  2HHV A;  4CJE A;  3CQ8 A;  2B6A A;  3OYB A;  2XO7 A;  4C8M A;  1WN7 A;  4Y1C A;  2ITG A;  3DLB A;  3PO4 A;  3WNF A;  1GOC A;  3P83 D;  3C95 A;  4RG8 A;  1U04 A;  3ZSY A;  2YKM A;  4F8R A;  1S1W A;  5KRS A;  3NH1 A;  2FBT A;  1BQN A;  4LH4 A;  2Y1J A;  2F96 A;  3TAB A;  2KQ2 A;  2BGG A;  1VSH A;  2DFE A;  3RWU A;  2RN2 A;  4CER A;  4CED A;  1SL1 A;  3HPG A;  1NKB A;  2HHX A;  1KLM A;  4JS5 A;  3KIO A;  4Z4E A;  4DSE A;  3SQ0 A;  1QSS A;  3LP0 A;  4DG1 A;  1DTT A;  4NCG A;  1BQM A;  1B9D A;  4KB0 A;  4J2D A;  4OGE A;  4DTP A;  5J2P A;  3V1R A;  3RR8 A;  3SQ2 A;  4MFB A;  4PA1 A;  3AVI A;  1NOY A;  4N76 A;  3MXJ A;  4DSK A;  4DTU A;  4BDY A;  3HO1 A;  3V4I A;  1VSL A;  4O55 A;  3SZ2 A;  3SUO A;  3P5J A;  3LP2 A;  5HP1 A;  2YNI A;  1FKP A;  1RDD A;  4CF8 A;  1F21 A;  1JLC A;  5KRT A;  1CLQ A;  2G8I A;  3M8P A;  2ZE2 A;  4CEO A;  4FJI A;  4IFV A;  4FJJ A;  5JS1 A;  4EP4 A;  2X78 A;  1ASW A;  4OPK A;  1IKY A;  3OS1 A;  3AA2 A;  4CEE A;  1LAV A;  4OLB A;  4C8K A;  4FLX A;  4RW9 A;  2HND A;  3O3H A;  4QOZ B;  1C0T A;  1S1V A;  4IFY A;  2X74 A;  2P1J A;  5J1E A;  3HP6 A;  5J2Q A;  3T1A A;  3ULD A;  5J2M A;  2PY5 A;  4CFC A;  1ASV A;  1U47 A;  2IOC A;  1EET A;  2XRI A;  1Z25 A;  2KFN A;  4FVM A;  1JLF A;  1TKT A;  3V81 A;  2DY4 A;  2XY8 A;  1EXQ A;  1RBU A;  2Z1H A;  3SI6 A;  4DQR A;  2D0A A;  1T03 A;  4I9Q A;  3KLH A;  4CJ4 A;  3OJU A;  3L2Q A;  3EZ5 A;  1T7P A;  4CJT A;  4PUO A;  3LPT A;  2HVH A;  1VSM A;  3LAL A;  1S9G A;  1ZYQ A;  4Z4C A;  4HUE A;  1ITG A;  4OKJ A;  4ZTJ A;  3NGI A;  1NJY A;  1B92 A;  2OPP A;  3LWM A;  4N47 A;  3LZJ A;  1RDC A;  3AVF A;  4I7F A;  4DS4 A;  1KCF A;  3AVG A;  1TAQ A;  2HHT A;  1VSK A;  1LV5 A;  4FJM A;  3V1O A;  3KLF A;  3NHG A;  3B6P A;  1X1P A;  2HNZ A;  4GVM A;  4AHR A;  3MEC A;  1RTI A;  2BE2 A;  1RT6 A;  4R5P A;  3NGZ A;  4FLU A;  3TAP A;  3G0Z A;  4I2P A;  2HHS A;  3AO4 A;  2WON A;  2A1R A;  1NK9 A;  4RW6 A;  4HTU A;  1RBV A;  3C6U A;  3IS9 A;  4OKK A;  4FLY A;  1U48 A;  1UOC A;  3KK1 A;  2DFF A;  2KFZ A;  4C8O A;  4G1Q A;  5SWM A;  4FK2 A;  4DTS A;  2X6S A;  2FBX A;  1RTJ A;  3NE6 A;  4RW8 A;  3THV A;  4CGI A;  4E7H A;  3AVB A;  4Z0U A;  3AVM A;  1NJZ A;  3BDP A;  1QHT A;  3H08 A;  2EHG A;  1WSI A;  5DK5 A;  4CGH A;  5T7B A;  4W5O A;  3RTV A;  4E7I A;  4DU4 A;  1Q8I A;  3QEI A;  4ZTF A;  2HHQ A;  3SUP A;  1RTD A;  3DYA A;  3DI6 A;  3SV4 A;  1S1X A;  3SUQ A;  3MXI A;  1XI1 A;  1VRT A;  1NK8 A;  4KV8 A;  1NK6 A;  1WSJ A;  1YTA A;  4ZHR A;  1HQU A;  4M45 A;  4KB1 A;  2QK9 A;  2HNY A;  4KRE A;  2F8S A;  4CEZ A;  1JL2 A;  1RT2 A;  3V6D A;  3S9H A;  1Q9Y A;  3SQ4 A;  3RR7 A;  3ZT3 A;  4ELU A;  2HVI A;  1JKH A;  3TWH A;  4M3R A;  4B08 A;  3SUN A;  3D0P A;  4E3S A;  4CFB A;  1VSF A;  1UA1 A;  2PYJ A;  1J9A A;  4DFK A;  1HNI A;  1ZBH A;  1LWC A;  3ZSQ A;  5FRO A;  4CJR A;  4M3U A;  1TVR A;  3IAY A;  2G8H A;  2Z1I A;  2WOM A;  4ELT A;  2ATQ A;  1CZB A;  1TGO A;  4NCA A;  1CZ9 A;  2Z1J A;  3WNE A;  3U3G A;  4FJ9 A;  4YFU A;  1JLB A;  1SV5 A;  1UAX A;  1CXQ A;  5CY4 A;  2RF2 A;  3AVA A;  3V9X A;  1DLO A;  4H8K A;  2W42 A;  1RCH A;  3PO5 A;  2IAJ A;  4O44 A;  1L3T A;  3NH2 A;  3VN5 A;  4FM0 A;  3NH0 A;  2LSN A;  2OPS A;  5C24 A;  1YVU A;  1RTH A;  3TR8 A;  4B9L A;  4CHN A;  3HPO A;  3K5N A;  4B9N A;  3ZSX A;  1BI4 B;  1K6Y A;  1VRU A;  4FJL A;  3NFA A;  5K14 A;  5HRO A;  1IG9 A;  3HJF A;  1RBT A;  3NAE A;  3TAM A;  1WSF A;  5KI6 A;  4CJF A;  2G8W A;  4C8L A;  3D45 A;  3VQ8 A;  4BWM A;  1J53 A;  4AHU A;  3EYZ A;  4IG0 A;  1WSG A;  4EP5 A;  3WNH A;  3F73 A;  1UWB A;  1TK8 A;  1C0M A;  3ZSO A;  4CJ3 A;  1TK0 A;  3KKS A;  4Y1D A;  4Z4I A;  3AO5 A;  4AH9 A;  1JLG A;  4CGJ A;  2BAN A;  1DTQ A;  4E7J A;  4KTQ A;  3ASM A;  1HYZ A;  4LH5 A;  2OZM A;  4K8Z A;  2JGU A;  3TI0 A;  4UQG A;  5FDL A;  4FW2 A;  4BDP A;  3AA3 A;  4LSL A;  3ZT0 A;  2Q3S A;  4K8X A;  3VQA A;  3C94 A;  4DTJ A;  2B4J A;  1NJW A;  1BIU A;  4B9V A;  1TV6 A;  4FM2 A;  3C6T A;  3EY1 A;  1RT5 A;  3PX4 A;  3RMB A;  3PX6 A;  2XY6 A;  1U45 A;  4KI4 A;  4DTR A;  4LSN A;  2P5G A;  4CCH A;  1VSE A;  4DU1 A;  3NF6 A;  4H4M A;  4EZ6 A;  3QET A;  3UIQ A;  3HVR A;  3T3F A;  4CF1 A;  3PY8 A;  1LW2 A;  1ZBF A;  3SCX A;  3K58 A;  3CFP A;  3VQP A;  1HMV A;  2O4G A;  2YNH A;  2BDP A;  5HRP A;  2OYQ A;  3S3O A;  4CEB A;  1SUQ A;  4H4O A;  1GOB A;  2F8T A;  3SV3 A;  3O3G A;  4TSX A;  3ZSZ A;  2KZZ A;  4J2A A;  3HPH A;  4B8C A;  4YNQ A;  3L8B A;  4ELV A;  4CF9 A;  5JS2 A;  3OY9 A;  1WAJ A;  1YT3 A;  4BDZ A;  1QTM A;  4O0I A;  1ZBU A;  1IO2 A;  3IG1 A;  3OYF A;  2HHW A;  1SL2 A;  5CYM A;  1FXX A;  1JLQ A;  5KGX A;  1A5X A;  1W9H A;  3HL8 A;  1SL0 A;  4F3T A;  3V9W A;  2DFH A;  1FKO A;  3LDS A;  3VQ9 A;  2QXF A;  1RDB A;  1NKC A;  1G15 A;  3I0S A;  4DU3 A;  4FLZ A;  4DQI A;  1RT4 A;  4DSL A;  2VWJ A;  1C1A A;  4O4G A;  3I0R A;  4CFA A;  5J2N A;  1TK5 A;  3KK2 A;  1NK0 A;  4E89 A;  4DQS A;  1KRP A;  3B6O A;  4FJ5 A;  4NCB A;  1KVA A;  3KLI A;  4CJ5 A;  4FJG A;  1REV A;  3AO2 A;  2JLE A;  3V1Q A;  1S6P A;  3DOL A;  4KHY A;  1VSJ A;  3WNG A;  5D3G A;  3SPY A;  1SKR A;  4NYF A;  4PQU A;  1QSL A;  1RBR A;  4CHO A;  2XHB A;  3DOK A;  3CG7 A;  2G8V A;  3K5M A;  4B9S A;  2A1S A;  4I9L A;  4FLT A;  4N41 A;  3OS0 A;  2EX3 A;  3AO3 A;  1C0U A;  5DMR A;  5SZT A;  4EZ9 A;  1L3V A;  3HXM A;  1IH7 A;  4DLG A;  1XWL A;  4CJQ A;  4DSJ A;  4FJN A;  3VQD A;  4M3Y A;  3CFR A;  4CGF A;  3U6F A;  1KFS A;  1LWF A;  4E19 A;  2VG7 A;  2E6L A;  4F3O A;  1T05 A;  4AIL C;  4QCL A;  1TL3 A;  4DTO A;  3S3N A;  2GBZ A;  4E1N A;  4CJS A;  3JSM A;  3AVH A;  3OYH A;  4IBN A;  3OYI A;  4B9M A;  4M3W A;  4AHS A;  4CEC A;  3L3U A;  5CZ2 A;  4XIU A;  3L2R A;  3ITH A;  1NOZ A;  4CJK A;  3LP3 A;  3DMJ A;  5CZ1 A;  3DRS A;  4HUG A;  1LAW A;  1ZBL A;  1RNH A;  1BGX T;  4DWI A;  3ZCM A;  4KTW A;  2VWK A;  4JS4 A;  1JL1 A;  3RMD A;  2HHU A;  2YHA A;  4CE9 A;  5C42 A;  3DM2 A;  3O4N A;  3TAF A;  3SYZ A;  1TAU A;  1W0H A;  1N5Y A;  3TAG A;  3E01 A;  1NK4 A;  4AHT A;  4OVL A;  1NK5 A;  3LPU A;  4E1M A;  4M3T A;  4O5B A;  4C8N A;  1KSP A;  3QIN A;  4CGD A;  4CK3 A;  1S5J A;  4CF0 A;  4DMN A;  1RT7 A;  2B5J A;  1FK9 A;  2Y1I A;  1J5O A;  1RBS A;  2IS3 A;  2E6M A;  1B9F A;  3ZSR A;  2OZS A;  1RT3 A;  3RRG A;  4CIF A;  3AA4 A;  1TKZ A;  4JLH A;  3VA0 A;  4FK0 A;  2G8F A;  1RDA A;  5HRS A;  3QEX A;  1LW0 A;  3K2P A;  3KLG A;  4DQP A;  4N56 A;  4KHN A;  4DF4 A;  2D5R A;  4KI6 A;  3NGY A;  4CES A;  2E4L A;  4HHT A;  2IC3 A;  4DFJ A;  4NYN A;  3VQ7 A;  3QER A;  3MXM A;  1BIZ A;  4CK1 A;  1Z26 A;  1NJX A;  3O4Q A;  4HCC A;  1C1C A;  1RIL A;  4RW4 A;  3CYM A;  4FZZ A;  4QAG A;  4FJK A;  2HB5 A;  4JRP A;  3V9Z A;  5HBM A;  3RRH A;  3RMA A;  4Z4G A;  3T19 A;  1HQE A;  1TKD A;  3NF9 A;  2QKB A;  3M8Q A;  3QLH A;  4OKE A;  2GV9 A;  1ASU A;  4HCB A;  2FBY A;  1A5W A;  4GMJ B;  3VA3 A;  3HST B;  4PWD A;  3VQ6 A;  2HMI A;  4FXD A;  1WSH A;  1HRH A;  4FZY A;  2KW4 A;  2G8U A;  2YNG A;  4CGG A;  4BE1 A;  1X9S A;  3AVL A;  3OVN A;  4FK4 A;  4N5S A;  3OS2 A;  1D8Y A;  2DTU A;  3KD1 E;  4AHV A;  4Z4F A;  4DTN A;  4W5R A;  1D5A A;  4CHZ A;  4Z4H A;  2ZQB A;  3P1G A;  3AA5 X;  3HVT A;  1BCM A;  3G10 A;  1KLN A;  3OYN A;  1WAF A;  2VG6 A;  3DLH A;  4B9U A;  3MAQ A;  2GUI A;  3LAN A;  2RKI A;  1WLJ A;  1HJR A;  2D0C A;  4E0D A;  1L3S A;  1KVC A;  4CJL A;  3K57 A;  5I42 A;  4CJV A;  1WNS A;  3TAQ A;  4M42 A;  3ZSV A;  3OJS A;  4DF8 A;  4B8A B;  4E7L A;  4F2S A;  1C1B A;  3L2V A;  3NBP A;  3K59 A;  5I3U A;  3KK3 A;  4HVJ A;  2HW3 A;  1IKV A;  3MEE A;  1S6Q A;  2IGI A;  3L3V A;  3TAE A;  3ZT1 A;  1LWE A;  5CYQ A;  4DSF A;  2YV0 X;  3NCI A;  4HUF A;  1JXE A;  2KTQ A;  3VQ5 A;  1JLA A;  1KFD A;  3QIO A;  5FRM A;  1QE1 A;  3I8D A;  1QSY A;  4B9T A;  4FJ7 A;  4KHQ A;  4LY7 A;  3O3F A;  2Z1G A;  4AHC A;  1X9M A;  4KPY A;  1VK0 A;  3MED A;  3OYE A;  1XC9 A;  1EX4 A;  1EP4 A;  3HP9 A;  3VQQ A;  3AVJ A;  4W5T A;  3LAK A;  3OYM A;  2R7Y A;  1NKE A;  2P5O A;  2AJQ A;  3LZI A;  3ZT4 A;  3NF8 A;  4KO0 A;  1U4B A;  3OYC A;  2G8K A;  3DRP A;  3CM6 A;  1BI4 A;  3DLR A;  3KKR A;  4CEQ A;  3TAR A;  1U49 A;  1D9F A;  4FJ8 A;  3M8S A;  3K5L A;  1C6V A;  1RT1 A;  4IG3 A;  3MEG A;  4M41 A;  4CJU A;  4GW6 A;  3VQB A;  4CJW A;  1SKS A;  4DFP A;  4KHW A;  2YHB A;  4J2B A;  4CFD A;  1XHX A;  4DTX A;  3AV9 A;  4FLW A;  4W5N A;  4PY5 A;  3CM5 A;  3ISN C;  2ZD1 A;  4CHY A;  3U3Y A;  4KHU A;  3TAN A;  2XY5 A;  1S9E A;  3K5O A;  1XHZ A;  1Q9X A;  3QEW A;  4JRQ A;  1HYS A; 
#chains in the Genus database with same CATH topology
 5C12 A;  3V9U A;  4CF2 A;  4KKO A;  3O9S A;  4KTZ A;  5EU7 A;  3P38 A;  1VQ9 N;  3QES A;  2O8F B;  2IVN A;  2NZT A;  4JI2 K;  1MDU B;  4DFM A;  4Q5V A;  1EWR A;  3RMC A;  1X9W A;  4FCY A;  4DV4 K;  4DR2 K;  2ZJQ L;  1VQ8 N;  4HTL A;  5AQU A;  4Y0W A;  4NXM K;  2ETJ A;  1YI2 N;  3CME N;  2PZS A;  3OYL A;  4JV5 K;  2NUB A;  4CD3 A;  3WXJ A;  3N4Q A;  4F4K A;  4DSI A;  3THX A;  3KTQ A;  4E1J A;  1QZ6 A;  4FO0 A;  2OPR A;  4YOV A;  3S3M A;  3OYD A;  3AVN A;  3LM2 A;  4CJP A;  4LFB K;  2F9T A;  1HKG A;  3KZB A;  2OTJ N;  4BGA A;  1UA0 A;  1S3X A;  4FWP A;  4BQL A;  4BRC A;  4YOX A;  1P90 A;  2EWS A;  4I2Q A;  1Y64 A;  1A5V A;  2P9N A;  1HPZ A;  2W41 A;  4CVN E;  4MO4 A;  3CCQ N;  3C65 A;  1SS6 A;  1BUP A;  3KWI A;  1SKW A;  1U2V A;  5M1N A;  3VEX A;  4U7B A;  3DLG A;  3ZLJ A;  1CXU A;  4L8R B;  4LD0 A;  1X3M A;  2XY7 A;  5E41 A;  4CHP A;  4DCH A;  4FW1 A;  4OGC A;  4KHS A;  3R3L A;  2B6A A;  5ADX H;  3GG4 A;  3OYB A;  2O8C A;  5AQI A;  3PO4 A;  1GOC A;  3C95 A;  5KRS A;  2Y1J A;  2F96 A;  1WOQ A;  1VSH A;  4Z4E A;  4DG1 A;  1B9D A;  4KB0 A;  2E2Q A;  3RR8 A;  4PA1 A;  3AVI A;  5A2Q O;  3E66 A;  1NJI O;  4CZE A;  4BDY A;  1VSL A;  3SUO A;  1Q7Y O;  3P5J A;  4IFE A;  1RDD A;  1Z05 A;  2V7Z A;  3R9P A;  4FJI A;  4CEO A;  1U6Z A;  3L4I A;  2YX6 A;  2A3Z A;  4OPK A;  3OS1 A;  4CEE A;  3SJH A;  3JXU A;  4C8K A;  2HND A;  2VCP A;  4QOZ B;  1C0T A;  3EEQ A;  4JKD A;  4GV9 A;  1NM1 A;  4IFY A;  2VGM A;  1T3V A;  3ULD A;  2PY5 A;  2YHW A;  5FLX O;  1ASV A;  1E3M A;  4IOA L;  2KFN A;  4G9Z A;  2BH1 A;  1JLF A;  1TKT A;  3TSU A;  2XY8 A;  1EXQ A;  2P9K B;  4IXC A;  3SI6 A;  1T03 A;  5BRF A;  4I9Q A;  2FSK A;  3L2Q A;  4PUO A;  1ITG A;  4B1U B;  5C10 A;  4ZTJ A;  1NJY A;  5GAE P;  2OPP A;  4N47 A;  1RDC A;  1KCF A;  3AVG A;  1TAQ A;  3EE9 A;  4FJM A;  3NGZ A;  3MEC A;  1RTI A;  2BE2 A;  3WXM B;  1IBL K;  4AM6 A;  3THY A;  4HTU A;  1RBV A;  3IS9 A;  1VQ5 N;  4BRK A;  2DFF A;  4C8O A;  3SMP A;  1YHQ N;  4CW7 B;  4XH5 A;  2X6S A;  4BRM A;  3A8Y A;  4E7H A;  1YJN N;  4BC2 A;  3AVM A;  5AZJ B;  4CBU A;  3VEV A;  4W5O A;  3J7Y P;  1TUY A;  1RTD A;  2O8E A;  3DI6 A;  2P9L A;  3O80 A;  1VRT A;  3T69 A;  1NK8 A;  1HQU A;  4DV6 K;  2HNY A;  4KRE A;  1VAZ A;  4A2B A;  3S9H A;  1Q9Y A;  3RR7 A;  4B08 A;  3UKU B;  2PYJ A;  1ZBS A;  1J9A A;  2PBD A;  3ZSQ A;  2GEM A;  1N34 K;  5FRO A;  4DKW A;  1YJW N;  4WF9 L;  2G8H A;  4ELT A;  4CZK A;  2ATQ A;  1TGO A;  4NCA A;  1CZ9 A;  4FJ9 A;  3A5L C;  1JLB A;  3HOT A;  4B1W B;  1NGJ A;  5CY4 A;  1JJ2 M;  5AQF A;  2Q31 A;  4H8K A;  1BO5 O;  3PO5 A;  1L3T A;  3L4Q A;  2CH6 A;  2GEL A;  4FM0 A;  3BZC A;  3OW2 M;  1OH5 A;  4IJN A;  3TR8 A;  3HPO A;  4B9N A;  2ZM6 K;  3ZSX A;  4H5V A;  1BI4 B;  5C15 A;  4FJL A;  3CJ7 A;  5HRO A;  1IG9 A;  3CI5 A;  1RBT A;  2QW9 A;  5KI6 A;  4K41 A;  5TKW A;  2HBJ A;  1J53 A;  1VHX A;  1YAG A;  1C0M A;  3ZSO A;  4CJ3 A;  3KKS A;  1HYZ A;  1X9J A;  5JVH L;  5KPT A;  1HKC A;  4BDP A;  3AA3 A;  3FGU A;  3NVM A;  2Q3S A;  3VF4 A;  1NG9 A;  4WYB A;  3EY1 A;  1RT5 A;  5LY3 A;  4DTR A;  4MO5 A;  4BRI A;  4H4M A;  4EZ6 A;  3QET A;  3CXC M;  2CH5 A;  3K58 A;  3CFP A;  2O4G A;  5BRD A;  3ZSZ A;  4J2A A;  4BRE A;  3QB0 A;  4CF9 A;  3OY9 A;  4BDZ A;  4DR5 K;  3I55 N;  3FE1 A;  3V9W A;  2DFH A;  4NB4 A;  3VQ9 A;  1RDB A;  4CZF A;  1NKC A;  4DU3 A;  4FLZ A;  5J2N A;  3I0R A;  4H03 B;  4JK7 A;  4E89 A;  1DEJ A;  4DQS A;  1KRP A;  4B9Q A;  1KC8 O;  3KLI A;  4FJG A;  3AO2 A;  3WQT A;  1S6P A;  3WNG A;  4LFA K;  2Q0U A;  4JKC A;  1SKR A;  4WQ5 C;  2GX9 A;  4KH4 A;  2XHB A;  2A1S A;  2FSN A;  3SMS A;  4FLT A;  2EX3 A;  3AO3 A;  2F8T A;  1L3V A;  4FJN A;  1IH7 A;  1XWL A;  4CJQ A;  3VQD A;  4JYA K;  3CFR A;  3CJB A;  3U6F A;  1FW6 A;  1KFS A;  3LDQ A;  5AQV A;  1OVQ A;  1T05 A;  3HI0 A;  4DTO A;  3S3N A;  4M7Y A;  4RCH A;  1NGD A;  3G6E N;  2NRX A;  4B9M A;  4M3W A;  2QEX N;  4B3M K;  4LF8 K;  4XIU A;  3CJ1 A;  4HUG A;  2ASO A;  3CCS N;  3E9P A;  5FPD A;  4WQ5 A;  2HHU A;  3SBG A;  1LOT B;  4BR0 A;  4X64 K;  1NK4 A;  4AHT A;  1NK5 A;  3SLC A;  2A40 A;  4O5B A;  3E1Y A;  1K8K B;  4CK3 A;  1S5J A;  3LL3 A;  2P9K A;  4RTF D;  2QA4 N;  4ILJ A;  2B5J A;  2Y1I A;  1V4T A;  1B9F A;  3T7Z A;  2G8F A;  5HRS A;  1HNZ K;  3K2P A;  3KLG A;  4KHN A;  5BPL A;  4N56 A;  4DF4 A;  4CES A;  2E4L A;  4HHT A;  2IC3 A;  4DFJ A;  5BR8 K;  3FZH A;  3CJC A;  4HCC A;  3SAG A;  4RW4 A;  4FJK A;  1LCU A;  4Z4G A;  4YDU C;  5AJ3 K;  3M8Q A;  4OPA A;  1A5W A;  2NRW A;  3HST B;  3VQ6 A;  1WSH A;  1HRH A;  2P9P B;  1HKB A;  4BE1 A;  1KQS M;  1GLB G;  3AVL A;  3OVN A;  4Z4F A;  2DPN A;  1XQS C;  1BCM A;  3G10 A;  1IBM K;  4LF9 K;  2YCH A;  3SK3 A;  3LDO A;  4E0D A;  1HJR A;  3K57 A;  4CJL A;  4X66 K;  5BRE A;  2UXC K;  1WNS A;  2Q97 A;  4M42 A;  3OJS A;  3CF5 L;  4E7L A;  3VF6 A;  3L2V A;  3VGL A;  5ELZ A;  2IVP A;  1YUW A;  3MEE A;  3TAE A;  4YDU A;  1LWE A;  3ULE A;  2YV0 X;  2ZWH A;  5AQP A;  4JI1 K;  2QXL A;  1NGG A;  5FRM A;  4DUY K;  2VYP A;  3VET A;  2Z1G A;  2A5X A;  3B8A X;  1XC9 A;  3OYE A;  3HP9 A;  3N4P A;  4CZM A;  1W7A A;  3OYM A;  3LAK A;  4DV2 K;  3EKS A;  3ZT4 A;  3NF8 A;  2VQE K;  1BOT O;  3VEW A;  3PIP L;  3CM6 A;  1BI4 A;  1D9F A;  3TAR A;  1U49 A;  1WUA A;  4IG3 A;  2IVO A;  1SKS A;  4DFP A;  2YHB A;  1VQ6 N;  3ISN C;  5IT9 O;  2P9N B;  3K5O A;  1XHZ A;  1Q9X A;  3O9R A;  3OBY A;  1FJG K;  1TK8 A;  3ENB A;  3WXI A;  3HT3 A;  1U2V B;  1JXB A;  4B1X B;  1TKX A;  1MWM A;  3VTI A;  1YTU A;  2BTF A;  1J54 A;  4DLE A;  4GKJ K;  1IV0 A;  5B8H A;  3A2F A;  3H45 C;  1IKX A;  2KZM A;  3JS6 A;  5E84 A;  3CHW A;  1T8E A;  4FYD A;  1I39 A;  2O8C B;  3SJJ A;  2WC9 A;  3OYJ A;  4J2E A;  1NNE A;  1WSE A;  5KGW A;  2UXD K;  3HYF A;  4ID5 A;  4KRF A;  5KQD A;  2FC0 A;  3ATV A;  3NF7 A;  3CC2 N;  3MN5 A;  3OYK A;  1YF5 L;  1VSI A;  2A41 A;  4H5W A;  2O4I A;  2GWK A;  1D4X A;  2RPI A;  3VQ4 A;  1KVB A;  3CD6 N;  2IDO A;  3S41 A;  3AO1 A;  2KLA A;  1K73 O;  4BR7 A;  1NMN A;  2FBV A;  5H1S Q;  3CPE A;  1O13 A;  5HL7 L;  4CIE A;  3MN9 A;  4MQ3 A;  4CEF A;  4CHQ A;  3QNN A;  5AQQ A;  2F7T A;  4UY8 O;  5BR9 A;  3LM9 A;  3FFI A;  4BQZ A;  3ENO A;  1Y97 A;  3ALY A;  4JI6 K;  3KLE A;  2J4R A;  1NGC A;  2QWO A;  3ZSW A;  1L3U A;  3ZT2 A;  3AVK A;  5KQ8 A;  1QQC A;  1E4G T;  2D0B A;  3IDH A;  5HRR A;  4M7X A;  2V51 B;  2PYL A;  1ZC6 A;  3L0Q A;  4PKG A;  3L2W A;  2YJE A;  3BZK A;  5CE3 A;  3L2U A;  4FJH A;  1HNV A;  1S1T A;  3K0S A;  5LMU K;  4KAZ A;  4C1N K;  3MX5 A;  4KFB A;  3NDK A;  3ZET B;  5FRN A;  1S1U A;  2E2O A;  2A6A A;  1BCO A;  1QVG M;  4FWM A;  3TTC A;  3QIP A;  4BRH A;  4JI0 K;  4CJE A;  3CQ8 A;  1WN7 A;  4Y1C A;  2ITG A;  3WNF A;  2QWQ A;  4RG8 A;  2YKM A;  3E9L A;  1S1W A;  2FBT A;  4CZI A;  3TAB A;  2KQ2 A;  2DFE A;  4JAX A;  2RN2 A;  4CED A;  3WUH A;  4JS5 A;  4DSE A;  3SQ0 A;  3IKM A;  1QSS A;  4NCG A;  3UB5 A;  1VQK N;  4OGE A;  3C6H A;  1NOY A;  4N76 A;  3MXJ A;  5C0Y A;  3AAQ A;  3SZ2 A;  3LP2 A;  4FSV A;  2YNI A;  1FKP A;  5KRT A;  2P9S A;  3DAW A;  1CLQ A;  5FPE A;  2G8I A;  4FOI A;  4EP4 A;  1ASW A;  1OVY A;  1GLA G;  4RW9 A;  3Q7C A;  2UXB K;  2P1J A;  5J2M A;  3K9K A;  2VGN A;  4CFC A;  2HBK A;  2IOC A;  1EET A;  1Z25 A;  3CCJ N;  4FWO A;  3Q7B A;  4FVU A;  4DV5 K;  4DQR A;  3HRG A;  3KLH A;  4CJT A;  2P9P A;  4HUE A;  4OPH A;  3LWM A;  5AQK A;  3AVF A;  2Q0R A;  1VSK A;  3NHG A;  3RVC A;  2HNZ A;  4GVM A;  4AHR A;  4R5P A;  4FLU A;  2I7P A;  4B1V A;  5AQH A;  3TAP A;  4I2P A;  2HHS A;  3AO4 A;  4JD2 B;  3VER A;  3ZX3 A;  2CGK A;  2E88 A;  4G1Q A;  3MCP A;  3QBW A;  3ID8 A;  1RTJ A;  2QWP A;  4RW8 A;  3THV A;  4CGI A;  2E8A A;  4JKG B;  4BR4 A;  1QHT A;  3H08 A;  2EHG A;  1JCG A;  4CGH A;  2W40 A;  3RTV A;  1Q8I A;  5AQX A;  3SV4 A;  1S1X A;  3TPQ A;  4ZHR A;  5AQJ A;  3WXK A;  2F8S A;  1M90 O;  1JL2 A;  4BY9 C;  4ELU A;  5JLH A;  2HVI A;  4M3R A;  3EZW A;  3D0P A;  1VSF A;  3CET A;  1T44 A;  4CBX A;  4FL9 A;  4CJR A;  4M3U A;  1TVR A;  4JN4 A;  2Z1I A;  2WOM A;  1CZB A;  2F9W A;  4PL8 A;  4PHT X;  4YFU A;  1SV5 A;  2UUC K;  1NGA A;  5GAG P;  1KAY A;  2D0P A;  4BVP A;  1DLO A;  2W42 A;  4O44 A;  3BUZ B;  1C0G A;  3D7E O;  4BRP A;  4DR4 K;  2LSN A;  2OPS A;  2IIR A;  4U67 L;  4CHN A;  3LDP A;  3W3D A;  3D45 A;  4BWM A;  4IG0 A;  4EP5 A;  1UWB A;  3BP8 A;  1TK0 A;  1QQO A;  4LH5 A;  4K8Z A;  2JGU A;  3CQX A;  4UQG A;  5FDL A;  4FW2 A;  4EFH A;  2ZF5 O;  1TV6 A;  4FM2 A;  2ZGZ A;  3PX4 A;  1OH8 A;  3SAH A;  3RMB A;  3PX6 A;  1U45 A;  2P5G A;  4CCH A;  5AFU H;  3NF6 A;  3UIQ A;  3T3F A;  4CF1 A;  4CD1 A;  1NGE A;  1HMV A;  2YNH A;  4JHD B;  3SV3 A;  4TSX A;  2KZZ A;  2E1Y A;  1QTM A;  2OTL N;  1IO2 A;  2HHW A;  1SL2 A;  1JLQ A;  3CCU N;  4BRD A;  4F3T A;  2QXF A;  4B1Y B;  1G15 A;  1RT4 A;  2VWJ A;  1C1A A;  1NK0 A;  3KK2 A;  1HX1 A;  4PKH A;  4FJ5 A;  4NCB A;  4LC9 B;  1REV A;  3V1Q A;  4KHY A;  3ZET A;  3SPY A;  1X3N A;  4IEI A;  4NYF A;  3AAP A;  5AQR A;  3O6W A;  3DOK A;  4B9S A;  4L3Q A;  4N41 A;  3OS0 A;  5DMR A;  1C0U A;  5SZT A;  3BEX A;  1SQK A;  3DXK B;  5DM6 L;  4E19 A;  4BRG A;  2WBN A;  4AIL C;  2GBZ A;  1OH6 A;  4IBN A;  5DM7 L;  3OYI A;  2ITM A;  5F1X A;  3CCE N;  3L2R A;  1NOZ A;  3LP3 A;  3HSC A;  3DRS A;  1LAW A;  4B3S K;  3VOV A;  4XH1 A;  4DWI A;  2KHO A;  3ZCM A;  4KTW A;  1GLJ O;  4GNI A;  1JL1 A;  4JS4 A;  3RMD A;  3DM2 A;  3SYZ A;  3AGK A;  1MWK A;  1BDG A;  3E01 A;  4E1M A;  4BGB A;  4C8N A;  3ULE B;  5MLC Q;  4IO9 L;  1W97 L;  4AQY K;  3RSE B;  3ZSR A;  5HOO A;  3QDK A;  1TKZ A;  1LW0 A;  1MA9 B;  2QWM A;  2D5R A;  1GLE G;  3HOS A;  4NYN A;  1NJX A;  3EL2 A;  3O4Q A;  2UU9 K;  4H5T A;  4JD2 A;  5HBM A;  5LJW A;  3RRH A;  4KHP K;  3GDQ A;  4CI6 A;  2GV9 A;  4HCB A;  2FBY A;  4GMJ B;  3VA3 A;  2HMI A;  3M5R A;  4FZY A;  1QZ5 A;  2YNG A;  4CGG A;  4JKG A;  3OS2 A;  3DWL A;  4AHV A;  1HNW K;  3AGR A;  2ZQB A;  5AQS A;  4Z4H A;  3AA5 X;  4BRL A;  5M1K A;  4B9U A;  3DLH A;  2VG6 A;  1RDW X;  3LAN A;  1WLJ A;  3IFR A;  3GBT A;  1KVC A;  3SAF A;  5M1F A;  3TAQ A;  2D0O A;  2QWN A;  3NMU A;  4F2S A;  1C1B A;  4CZG A;  1VQP N;  1ILY A;  5C2F A;  1QHA A;  3TU5 A;  1NLV A;  3THW B;  2HW3 A;  1EQY A;  2IGI A;  5BPM A;  3UE5 A;  4MDA A;  2KKZ A;  3NCI A;  4HUF A;  3VQ5 A;  2WFB A;  3P31 A;  5GAH P;  1QSY A;  4JKF A;  4ISG A;  4KH5 A;  4LF7 K;  3O3F A;  4AHC A;  1X9M A;  3U4L A;  2R7Y A;  4W5T A;  5AQN A;  3GOI A;  1BA0 A;  1U4B A;  1Q81 O;  3G71 N;  5E26 A;  4FJ8 A;  2NRH A;  3M8S A;  1C6V A;  4M41 A;  3VQB A;  4CJW A;  4JI4 K;  4KHW A;  5ADX A;  4JEP A;  1XHX A;  5AQW A;  2ZD1 A;  3TAN A;  2XY5 A;  3CMA N;  3P39 A;  3O8M A;  3CQY A;  4FJX A;  1MU2 A;  5CR4 A;  3PUF A;  2FF3 B;  4F2R A;  2GWJ A;  1VSD A;  3QNO A;  4PL7 A;  1I3A A;  5AZI A;  4V19 S;  1KTQ A;  4BE0 A;  4OLA A;  4WCE L;  5FPM A;  4DQ8 A;  1RFQ A;  2QKK A;  2CGL A;  2Q36 A;  4CIG A;  4O0J A;  3KD5 E;  4JHD A;  2AA4 A;  4BE2 A;  4BG8 A;  5EOY A;  3MDQ A;  3MCA B;  4BAC A;  3DLE A;  4A5A A;  2UUB K;  2YNF A;  4RW7 A;  3U8X A;  2JWK A;  4OJR A;  3D2F A;  1N33 K;  3PX0 A;  2QWL A;  4FM1 A;  2A42 A;  3HK2 A;  1KD1 O;  1EKE A;  2P9S B;  5AQZ A;  5KTQ A;  4IKF A;  4BWJ A;  1JLE A;  3QFP A;  4AM7 A;  4FZX C;  3F9K A;  1ZBI A;  5C25 A;  4W5Q A;  1IJJ A;  3SQ1 A;  3VQC A;  1BIS A;  4WE1 A;  4YOY A;  1QS4 A;  1N6Q A;  1BL3 A;  4FPA A;  4YOW A;  5AQO A;  2NRZ A;  1NK7 A;  3AVC A;  3PV8 A;  3TTF A;  1RDU A;  1D9D A;  5AQT A;  4DS5 A;  3DLK A;  3DXK A;  4E7K A;  3LP1 A;  5EX5 A;  4IDK A;  2VG5 A;  3SPZ A;  3OYA A;  2HOE A;  4EHU A;  4CEA A;  3IMX A;  4ID1 A;  1R0A A;  3L6Q A;  5AQG A;  1O1W A;  3HM9 A;  2HHV A;  1NGF A;  2XO7 A;  4C8M A;  3DLB A;  4FK0 A;  1VQ7 N;  1TYQ B;  4CER A;  5JIC A;  3HPG A;  3KWG A;  3KVG A;  1KLM A;  1YJ9 N;  3KIO A;  1NKB A;  2FF6 A;  1BQM A;  5EY4 A;  2E1Z A;  4DTP A;  5J2P A;  3V1R A;  3SQ2 A;  4LF6 K;  4DTU A;  3HO1 A;  3V4I A;  3O4W A;  4CF8 A;  3QFU A;  1F21 A;  1M1K O;  3M8P A;  1CZA N;  4IFV A;  3RSE A;  1WBD A;  4YY3 K;  3AA2 A;  1Q86 O;  1LAV A;  2F4V K;  4JI5 K;  1QQN A;  1Q82 O;  3O3H A;  3VTH A;  2PFU A;  1C0F A;  4BC3 A;  2D4W A;  5J2Q A;  3T1A A;  1EWQ A;  2YHX A;  1U47 A;  3CER A;  2OCE A;  2YJF A;  3OBW A;  4FVM A;  3I56 N;  3DJC A;  3V81 A;  1RBU A;  2Z1H A;  3CC7 N;  4OX9 K;  1BG3 A;  1GLL O;  3ZEU B;  3EZ5 A;  3LPT A;  2HVH A;  3LAL A;  2HST A;  4LF5 K;  2RE2 A;  3NGI A;  4B9T A;  3LZJ A;  4I7F A;  4K42 A;  2HHT A;  1LV5 A;  3V1O A;  4O8U A;  3B6P A;  1X1P A;  5HP1 A;  1ATN A;  1RT6 A;  3G0Z A;  2WON A;  5BN8 A;  1NK9 A;  2UYT A;  3GL1 A;  3C6U A;  1U48 A;  4FLY A;  1N32 K;  2KFZ A;  4FK2 A;  2FBX A;  3TTD A;  3NE6 A;  3HTV A;  3THW A;  1OKJ A;  3AVB A;  1P8Z A;  1NJZ A;  1XMO K;  2PAV A;  1WSI A;  5DK5 A;  4FWR A;  4K25 A;  3ZX0 A;  4E7I A;  4DU4 A;  4A2A A;  3QEI A;  3SUP A;  3DYA A;  3MXI A;  3J81 O;  4KV8 A;  1NK6 A;  1E4F T;  4ILG B;  4CEZ A;  3V6D A;  1RT2 A;  4WFN L;  3SQ4 A;  3ZT3 A;  3M1F A;  4E3S A;  1HJO A;  3C6A A;  4HWI A;  1HNI A;  1ZBH A;  1LWC A;  4GKK K;  3QBX A;  4B3T K;  2FLO A;  2Q1N A;  3F2K A;  1NGH A;  3KK7 A;  3IAY A;  4EIA A;  4DV3 K;  2Z1J A;  3U3G A;  1UAX A;  4JI8 K;  3V9X A;  1RCH A;  4J8F A;  3NH2 A;  3VN5 A;  3PSF A;  4FWN A;  4B9L A;  4ISE A;  1BU6 O;  1JCF A;  1VRU A;  2ASP A;  4IOX A;  3NAE A;  1YIJ N;  3TAM A;  1WSF A;  5JVG L;  3K9J A;  4CJF A;  2G8W A;  4C8L A;  1ESV A;  3EYZ A;  3WNH A;  1VQ4 N;  4Z4I A;  3AO5 A;  4AH9 A;  1JLG A;  4CGJ A;  2BAN A;  1DTQ A;  2QM1 A;  3EO3 A;  3WXL A;  3ASM A;  4E7J A;  3ZX2 A;  2OZM A;  3CC4 N;  4FPB A;  3VQA A;  3C94 A;  2B4J A;  1NJW A;  1BIU A;  4B9V A;  1Z6R A;  5LL6 Z;  4OO1 J;  3R1X A;  4KI4 A;  4LSN A;  2HHH K;  3M3Z A;  3AAR A;  4DU1 A;  3DXM A;  1NGB A;  1DT9 A;  3J7A P;  3PY8 A;  1LW2 A;  1ZBF A;  3VQP A;  2BDP A;  5HRP A;  1XMQ K;  2OYQ A;  1SUQ A;  1GOB A;  2QTD A;  3O3G A;  2FSJ A;  5AQM A;  1G99 A;  2QI2 A;  4DV0 K;  5JS2 A;  1SZ2 A;  1YT3 A;  4O0I A;  4PKI A;  2NNW A;  3IG1 A;  5CYM A;  1FXX A;  5KGX A;  2O8B B;  3O9Q A;  3I0S A;  1BWF O;  5I9E B;  4DQI A;  1TK5 A;  3EE8 A;  4H5N A;  5BN9 A;  3B6O A;  1KVA A;  4BRF A;  4CJ5 A;  3F5T A;  5D3G A;  2HF3 A;  1XNQ K;  4PQU A;  1RBR A;  4CHO A;  2VQF K;  4H0T B;  2JWL A;  1HNX K;  4EZ9 A;  4FWK A;  4AF1 A;  3HXM A;  4DLG A;  3CCV N;  4M3Y A;  3R6M A;  4CGF A;  3QML A;  3LDN A;  1TYQ A;  2UUA K;  5M1O A;  2O8D A;  2E6L A;  2YHY A;  2E2P A;  4BR2 A;  4QCL A;  3DLL L;  3R8E A;  4E1N A;  1NBW A;  4CJS A;  4JK8 A;  3AVH A;  2ZGY A;  4CEC A;  3L3U A;  5CZ2 A;  1J6Z A;  3VF2 A;  1NMD A;  3C7N B;  1KXP A;  3DMJ A;  1ZBL A;  1RNH A;  5F0X A;  4X65 K;  2VWK A;  4I6M B;  2YHA A;  3O4N A;  3TAF A;  4JKH A;  1W0H A;  1N5Y A;  3TAG A;  2NRR A;  4M3T A;  4ILH A;  2BUP A;  4BRA A;  1KSP A;  1J5E K;  3QIN A;  4CGD A;  4CJ7 A;  4DMN A;  1J5O A;  1FK9 A;  2IS3 A;  3ZEU A;  1ZXO A;  1RT3 A;  3RRG A;  4JLH A;  2ZJP L;  1RDA A;  3WT0 A;  3VQ7 A;  3QER A;  1BIZ A;  4CK1 A;  3H1V X;  3VEN A;  1Z26 A;  3F9M A;  1RIL A;  4FZZ A;  1GLF O;  3HM8 A;  3V9Z A;  4JRP A;  3T19 A;  4A5B A;  3NF9 A;  2QKB A;  5JLF A;  3QLH A;  3JAM O;  4PWD A;  4FXD A;  2P9U B;  1KAZ A;  4N5S A;  4BVO A;  1D8Y A;  2DTU A;  4WFB L;  4W5R A;  1D5A A;  4CHZ A;  3HVT A;  3WQU A;  1KLN A;  5AZI B;  1WAF A;  3OYN A;  4QS8 A;  4DR1 K;  2GUI A;  3H6E A;  1R59 O;  4CZJ A;  3NVK A;  3O9T A;  2D0C A;  4IOC L;  1ATS A;  4CJV A;  3OTO K;  3FZF A;  4IJA A;  4DF8 A;  3VEY A;  3NBP A;  1DGK N;  5I3U A;  1BA1 A;  4HVJ A;  1IKV A;  1S6Q A;  3L3V A;  1S72 N;  3A5N C;  3GE1 A;  1HUX A;  3D2F B;  3KHY A;  4Z94 A;  1SAZ A;  5IWA K;  3G25 A;  4DSF A;  3IUC A;  1TUU A;  1KFD A;  3QIO A;  1QE1 A;  3I8D A;  4FJ7 A;  4LY7 A;  4KPY A;  4BRQ A;  1VK0 A;  1EX4 A;  1EP4 A;  1NKE A;  3O1B A;  2P5O A;  2AJQ A;  3LZI A;  2G8K A;  3DRP A;  3KKR A;  3DLR A;  3MN6 A;  3A5M C;  1ATR A;  1NWK A;  4F9O A;  4FWL A;  4GW6 A;  3VGK A;  4J2B A;  1YVN A;  4DTX A;  3UKR A;  4FLW A;  4W5N A;  4PY5 A;  4CHY A;  3U3Y A;  4KHU A;  1S9E A;  4C23 A;  4NLB A;  4KH6 A;  3H3N O;  4JRQ A;  1HYS A;  3EKU A;  5GAD P;  3I8B A;  4BC4 A;  3J7Z O;  2OA8 A;  3H1Q A;  3J80 O;  2HMP A;  3FFK B;  1VQO N;  3OYG A;  1L5U A;  1S22 A;  1QQM A;  3LAM A;  3VQE A;  5KPZ A;  3T1H K;  4B3O A;  3SNN A;  4DTM A;  4DQQ A;  4FLV A;  3LWL A;  4R79 A;  3QEV A;  2WUS A;  4LF4 K;  1VQL N;  3M8R A;  2X6N A;  2O8B A;  4GVE A;  4A61 A;  3VEZ A;  4IO8 A;  4ICL A;  3P4I A;  4M3X A;  2YKN A;  2H3G X;  3V9S A;  4BR5 A;  2OPQ A;  4FOE A;  4MDB A;  2WTU A;  4GV6 A;  1BHL A;  1GOA A;  4DV7 K;  5BPN A;  4Q0B A;  3QO9 A;  4M3Z A;  1K9M O;  3CFO A;  3AY9 A;  3D2E A;  3BGR A;  4OPJ A;  3IRX A;  1XNR K;  5HLF A;  2P9I B;  1TL1 A;  2W6L A;  3QEP A;  1HYV A;  5AQL A;  4DHY A;  3PLA A;  5KPR A;  3DRR A;  1JCE A;  3JYT A;  2I5J A;  4CK2 A;  3KJV A;  4BRN A;  4A62 A;  1RGI A;  1GLD G;  4JKB A;  2ZJR L;  4JK9 A;  1N36 K;  1DKG D;  4LFC K;  2P51 A;  3H46 O;  5AQY A;  1NU0 A;  2O8F A;  3C7N A;  1IKW A;  2W6K A;  3TSQ A;  5HRN A;  3EN9 A;  4M63 C;  3FZL A;  3P83 D;  1XC3 A;  3ZSY A;  1U04 A;  4F8R A;  3NH1 A;  4CZH A;  1BQN A;  4LH4 A;  2BGG A;  4H0Y B;  4I6M A;  3RWU A;  1SL1 A;  2HHX A;  5M1Q A;  3LP0 A;  4H5R A;  1DTT A;  4J2D A;  4IWV A;  3FZK A;  4MFB A;  4DSK A;  2AP1 A;  4O55 A;  1JLC A;  5JS1 A;  2ZE2 A;  4FJJ A;  4YHH K;  2E20 A;  2X78 A;  1IKY A;  3HZ6 A;  4OLB A;  2FXU A;  4FLX A;  3VGM A;  3T1Y K;  1S1V A;  2X74 A;  5J1E A;  2E2N A;  3HP6 A;  3CCL N;  2XRI A;  1V4S A;  3TSP A;  3BY5 A;  2DY4 A;  2D0A A;  4IDH A;  4CJ4 A;  3OJU A;  1T7P A;  1VSM A;  2P9U A;  1S9G A;  4B1Z A;  5EXW A;  4Z4C A;  1ZYQ A;  4OKJ A;  1B92 A;  4DS4 A;  3KLF A;  3MK6 A;  4CZL A;  1IBK K;  5AFU A;  2HBM A;  2A1R A;  2NLX A;  4IZ9 A;  3VPZ A;  4RW6 A;  4OKK A;  1UOC A;  3CCM N;  3WEE B;  3KK1 A;  3O5B A;  3BF1 A;  5SWM A;  4DTS A;  2HF4 A;  4Z0U A;  5TKY A;  3O9U A;  3BDP A;  3O1W A;  5T7B A;  2HHQ A;  4B3R K;  4ZTF A;  2VWB A;  2GTD A;  3SUQ A;  1XI1 A;  3MWT A;  3I33 A;  2E5L K;  1WSJ A;  1YTA A;  4KB1 A;  4M45 A;  4ISF A;  4JKA A;  2QK9 A;  3DXM B;  4WFA L;  3MN7 A;  1JKH A;  3TWH A;  3SUN A;  4WQ4 C;  4CFB A;  1UA1 A;  3D6R A;  3PIO L;  4DFK A;  4BG9 A;  4GY2 B;  3O08 A;  2V52 B;  3WNE A;  4BRO A;  3ATU A;  1CXQ A;  1K8A O;  5M1P A;  2RF2 A;  3AVA A;  4NO7 A;  2IAJ A;  1QVF M;  1IG8 A;  3NH0 A;  5C24 A;  1YVU A;  1RTH A;  3OA9 A;  3ZYY X;  3K5N A;  1EO1 A;  2Q2R A;  1K6Y A;  3HBT A;  3NFA A;  5K14 A;  4YOU A;  3HJF A;  1W2B M;  1OH7 A;  3VQ8 A;  2OAN A;  4WQ4 A;  4AHU A;  1WSG A;  4JKE A;  3F73 A;  4Y1D A;  4QS7 A;  4DUZ K;  4KTQ A;  2GUP A;  1Q18 A;  3TI0 A;  2O8D B;  5AZJ A;  4LSL A;  3ZT0 A;  4MLH A;  4K8X A;  4DTJ A;  1H1V A;  4K0K K;  3C6T A;  2XY6 A;  4H0V B;  3MX2 A;  1HLU A;  1VSE A;  4O5F A;  4JI7 K;  3HVR A;  3SCX A;  4DR7 K;  1HPM A;  3UKU A;  4YOT A;  5AR0 A;  3S3O A;  4XEI A;  4CEB A;  4H4O A;  3HPH A;  4B8C A;  4YNQ A;  4NLC A;  1WB9 A;  3L8B A;  4ELV A;  1WAJ A;  3MMV A;  1ZBU A;  2QWR A;  3M6G A;  3OYF A;  1GLC G;  5BRH A;  1A5X A;  1W9H A;  3HL8 A;  3VES A;  5JMV A;  1SL0 A;  2P9I A;  1FKO A;  3LDS A;  3THX B;  3J8A A;  2I7N A;  4DSL A;  4O4G A;  4CFA A;  1KAX A;  2JLE A;  3DOL A;  1VSJ A;  1NGI A;  1QSL A;  3CG7 A;  2G8V A;  3K5M A;  1VQM N;  4I9L A;  1VQN N;  4NXN K;  4DSJ A;  3G4S N;  2ASM A;  5GIN A;  1LWF A;  4A57 A;  2VG7 A;  4F3O A;  3ID6 A;  1TL3 A;  4K43 A;  3JSM A;  3OYH A;  4CBW A;  4MLE A;  4AHS A;  4DB3 A;  4BC5 A;  3ITH A;  2RHK A;  3QIC A;  3E9O A;  3VMF B;  5CZ1 A;  4CJK A;  5F2R A;  4O8K A;  1BGX T;  4JI3 K;  3CJA A;  3H3O B;  5FPN A;  2NRV A;  4CE9 A;  5C42 A;  1T6D A;  1I94 K;  1TAU A;  3ENH A;  4OVL A;  3LPU A;  4DR6 K;  5GIO A;  5LJV A;  4CF0 A;  5EVZ A;  4H0X B;  1RT7 A;  1RBS A;  2E6M A;  3MWP A;  4RWT A;  3VEO A;  2OZS A;  4CIF A;  3AA4 A;  3VA0 A;  4A59 A;  3QEX A;  4EHT A;  3FR0 A;  4DQP A;  4YOR A;  4KI6 A;  4DV1 K;  3C0B A;  3NGY A;  1XUP O;  3PSI A;  3LDL A;  2HBL A;  3MXM A;  3U9D A;  4EAH D;  1C1C A;  4C1N I;  3CYM A;  4QAG A;  2HB5 A;  3RMA A;  4FWS A;  3UKR B;  1HQE A;  3WEE A;  1TKD A;  4OKE A;  1ASU A;  5GIP A;  2NRT A;  4X62 K;  2V7Y A;  2KW4 A;  2G8U A;  3A5O C;  1X9S A;  2CGJ A;  4FK4 A;  4H0O A;  1N8R O;  3KD1 E;  3FZM A;  4IEE A;  4DTN A;  4KBO A;  5C2D A;  3P1G A;  3W0L A;  3MAQ A;  2RKI A;  3OHR A;  1T6C A;  1L3S A;  2YI1 A;  3THY B;  5I42 A;  3CJ9 A;  3ZSV A;  3FLC O;  4B8A B;  5LMN K;  3CCR N;  3K59 A;  4QS9 A;  1WBB A;  3KK3 A;  1HR0 K;  3ZT1 A;  3U9Z A;  5CYQ A;  4H0P A;  1K8K A;  1JXE A;  2KTQ A;  2O8E B;  3BF3 A;  1JLA A;  2P9L B;  3A0I X;  4KHQ A;  4FWQ A;  4BR9 A;  2D1K A;  3MED A;  3VQQ A;  1YXQ A;  3AVJ A;  5CHI A;  3CIP A;  4KO0 A;  4XH4 A;  3OYC A;  1YIT N;  4CEQ A;  3K5L A;  4GV3 A;  1RT1 A;  3MEG A;  4CJU A;  4JNE A;  3D2E B;  4CFD A;  3AV9 A;  3CM5 A;  4DR3 K;  3QEW A;  3CPW M;  3SBT A; 
#chains in the Genus database with same CATH homology
 3HT3 A;  4FJX A;  1MU2 A;  2OA8 A;  1JXB A;  3PUF A;  1TKX A;  4F2R A;  1VSD A;  3QNO A;  3V9U A;  4CF2 A;  1YTU A;  4KKO A;  4KTZ A;  5EU7 A;  1J54 A;  4DLE A;  1I3A A;  1KTQ A;  4BE0 A;  3QES A;  4OLA A;  3OYG A;  3A2F A;  1L5U A;  2QKK A;  1IKX A;  2KZM A;  4CIG A;  3LAM A;  3VQE A;  1T8E A;  4FYD A;  1I39 A;  4O0J A;  3KD5 E;  4DFM A;  3SJJ A;  4B3O A;  3SNN A;  4Q5V A;  4DTM A;  3OYJ A;  4BE2 A;  4DQQ A;  3RMC A;  4FCY A;  1X9W A;  4FLV A;  4J2E A;  1WSE A;  5KGW A;  3HYF A;  4ID5 A;  3LWL A;  4KRF A;  3QEV A;  2FC0 A;  3NF7 A;  3DLE A;  4BAC A;  2ETJ A;  2YNF A;  3OYK A;  4RW7 A;  4OJR A;  1VSI A;  2PZS A;  3OYL A;  2O4I A;  3M8R A;  2X6N A;  3PX0 A;  2NUB A;  2RPI A;  3VQ4 A;  4FM1 A;  1KVB A;  4F4K A;  4DSI A;  3HK2 A;  3KTQ A;  4ICL A;  2IDO A;  3AO1 A;  1EKE A;  4M3X A;  2FBV A;  2YKN A;  5KTQ A;  4IKF A;  3V9S A;  2OPR A;  4BWJ A;  2OPQ A;  1JLE A;  4CIE A;  3S3M A;  4CEF A;  4MQ3 A;  1BHL A;  3AVN A;  3OYD A;  1GOA A;  4CJP A;  4CHQ A;  3QNN A;  3F9K A;  4FZX C;  5C25 A;  4W5Q A;  3SQ1 A;  1ZBI A;  3VQC A;  1BIS A;  3FFI A;  4Q0B A;  1UA0 A;  3QO9 A;  1Y97 A;  3ALY A;  4WE1 A;  1QS4 A;  3KLE A;  4M3Z A;  3CFO A;  1N6Q A;  1BL3 A;  3ZSW A;  1L3U A;  3BGR A;  3ZT2 A;  4OPJ A;  3AVK A;  3IRX A;  4I2Q A;  1NK7 A;  3AVC A;  1QQC A;  3PV8 A;  5HLF A;  2D0B A;  1A5V A;  1TL1 A;  3QEP A;  5HRR A;  1D9D A;  1HPZ A;  1HYV A;  2PYL A;  4DS5 A;  3DLK A;  4E7K A;  3LP1 A;  4IDK A;  3L2W A;  3DRR A;  3L2U A;  4FJH A;  1HNV A;  1S1T A;  3JYT A;  2I5J A;  1SKW A;  2VG5 A;  4CK2 A;  4KAZ A;  3SPZ A;  3OYA A;  3KJV A;  4KFB A;  3NDK A;  3DLG A;  1CXU A;  5FRN A;  4CEA A;  4L8R B;  1S1U A;  4LD0 A;  4ID1 A;  1BCO A;  2P51 A;  2XY7 A;  1R0A A;  5E41 A;  3QIP A;  1O1W A;  4CHP A;  3HM9 A;  4KHS A;  4FW1 A;  4OGC A;  1IKW A;  5HRN A;  2HHV A;  4CJE A;  3CQ8 A;  2B6A A;  3OYB A;  2XO7 A;  4C8M A;  1WN7 A;  4Y1C A;  2ITG A;  3DLB A;  3PO4 A;  3WNF A;  1GOC A;  3P83 D;  3C95 A;  4RG8 A;  1U04 A;  3ZSY A;  2YKM A;  4F8R A;  1S1W A;  5KRS A;  3NH1 A;  2FBT A;  1BQN A;  4LH4 A;  2Y1J A;  2F96 A;  3TAB A;  2KQ2 A;  2BGG A;  1VSH A;  2DFE A;  3RWU A;  2RN2 A;  4CER A;  4CED A;  1SL1 A;  3HPG A;  1NKB A;  2HHX A;  1KLM A;  4JS5 A;  3KIO A;  4Z4E A;  4DSE A;  3SQ0 A;  1QSS A;  3LP0 A;  4DG1 A;  1DTT A;  4NCG A;  1BQM A;  1B9D A;  4KB0 A;  4J2D A;  4OGE A;  4DTP A;  5J2P A;  3V1R A;  3RR8 A;  3SQ2 A;  4MFB A;  4PA1 A;  3AVI A;  1NOY A;  4N76 A;  3MXJ A;  4DSK A;  4DTU A;  4BDY A;  3HO1 A;  3V4I A;  1VSL A;  4O55 A;  3SZ2 A;  3SUO A;  3P5J A;  3LP2 A;  5HP1 A;  2YNI A;  1FKP A;  1RDD A;  4CF8 A;  1F21 A;  1JLC A;  5KRT A;  1CLQ A;  2G8I A;  3M8P A;  2ZE2 A;  4CEO A;  4FJI A;  4IFV A;  4FJJ A;  5JS1 A;  4EP4 A;  2X78 A;  1ASW A;  4OPK A;  1IKY A;  3OS1 A;  3AA2 A;  4CEE A;  1LAV A;  4OLB A;  4C8K A;  4FLX A;  4RW9 A;  2HND A;  3O3H A;  4QOZ B;  1C0T A;  1S1V A;  4IFY A;  2X74 A;  2P1J A;  5J1E A;  3HP6 A;  5J2Q A;  3T1A A;  3ULD A;  5J2M A;  2PY5 A;  4CFC A;  1ASV A;  1U47 A;  2IOC A;  1EET A;  2XRI A;  1Z25 A;  2KFN A;  4FVM A;  1JLF A;  1TKT A;  3V81 A;  2DY4 A;  2XY8 A;  1EXQ A;  1RBU A;  2Z1H A;  3SI6 A;  4DQR A;  2D0A A;  1T03 A;  4I9Q A;  3KLH A;  4CJ4 A;  3OJU A;  3L2Q A;  3EZ5 A;  1T7P A;  4CJT A;  4PUO A;  3LPT A;  2HVH A;  1VSM A;  3LAL A;  1S9G A;  1ZYQ A;  4Z4C A;  4HUE A;  1ITG A;  4OKJ A;  4ZTJ A;  3NGI A;  1NJY A;  1B92 A;  2OPP A;  3LWM A;  4N47 A;  3LZJ A;  1RDC A;  3AVF A;  4I7F A;  4DS4 A;  1KCF A;  3AVG A;  1TAQ A;  2HHT A;  1VSK A;  1LV5 A;  4FJM A;  3V1O A;  3KLF A;  3NHG A;  3B6P A;  1X1P A;  2HNZ A;  4GVM A;  4AHR A;  3MEC A;  1RTI A;  2BE2 A;  1RT6 A;  4R5P A;  3NGZ A;  4FLU A;  3TAP A;  3G0Z A;  4I2P A;  2HHS A;  3AO4 A;  2WON A;  2A1R A;  1NK9 A;  4RW6 A;  4HTU A;  1RBV A;  3C6U A;  3IS9 A;  4OKK A;  4FLY A;  1U48 A;  1UOC A;  3KK1 A;  2DFF A;  2KFZ A;  4C8O A;  4G1Q A;  5SWM A;  4FK2 A;  4DTS A;  2X6S A;  2FBX A;  1RTJ A;  3NE6 A;  4RW8 A;  3THV A;  4CGI A;  4E7H A;  3AVB A;  4Z0U A;  3AVM A;  1NJZ A;  3BDP A;  1QHT A;  3H08 A;  2EHG A;  1WSI A;  5DK5 A;  4CGH A;  5T7B A;  4W5O A;  3RTV A;  4E7I A;  4DU4 A;  1Q8I A;  3QEI A;  4ZTF A;  2HHQ A;  3SUP A;  1RTD A;  3DYA A;  3DI6 A;  3SV4 A;  1S1X A;  3SUQ A;  3MXI A;  1XI1 A;  1VRT A;  1NK8 A;  4KV8 A;  1NK6 A;  1WSJ A;  1YTA A;  4ZHR A;  1HQU A;  4M45 A;  4KB1 A;  2QK9 A;  2HNY A;  4KRE A;  2F8S A;  4CEZ A;  1JL2 A;  1RT2 A;  3V6D A;  3S9H A;  1Q9Y A;  3SQ4 A;  3RR7 A;  3ZT3 A;  4ELU A;  2HVI A;  1JKH A;  3TWH A;  4M3R A;  4B08 A;  3SUN A;  3D0P A;  4E3S A;  4CFB A;  1VSF A;  1UA1 A;  2PYJ A;  1J9A A;  4DFK A;  1HNI A;  1ZBH A;  1LWC A;  3ZSQ A;  5FRO A;  4CJR A;  4M3U A;  1TVR A;  3IAY A;  2G8H A;  2Z1I A;  2WOM A;  4ELT A;  2ATQ A;  1CZB A;  1TGO A;  4NCA A;  1CZ9 A;  2Z1J A;  3WNE A;  3U3G A;  4FJ9 A;  4YFU A;  1JLB A;  1SV5 A;  1UAX A;  1CXQ A;  5CY4 A;  2RF2 A;  3AVA A;  3V9X A;  1DLO A;  4H8K A;  2W42 A;  1RCH A;  3PO5 A;  2IAJ A;  4O44 A;  1L3T A;  3NH2 A;  3VN5 A;  4FM0 A;  3NH0 A;  2LSN A;  2OPS A;  5C24 A;  1YVU A;  1RTH A;  3TR8 A;  4B9L A;  4CHN A;  3HPO A;  3K5N A;  4B9N A;  3ZSX A;  1BI4 B;  1K6Y A;  1VRU A;  4FJL A;  3NFA A;  5K14 A;  5HRO A;  1IG9 A;  3HJF A;  1RBT A;  3NAE A;  3TAM A;  1WSF A;  5KI6 A;  4CJF A;  2G8W A;  4C8L A;  3D45 A;  3VQ8 A;  4BWM A;  1J53 A;  4AHU A;  3EYZ A;  4IG0 A;  1WSG A;  4EP5 A;  3WNH A;  3F73 A;  1UWB A;  1TK8 A;  1C0M A;  3ZSO A;  4CJ3 A;  1TK0 A;  3KKS A;  4Y1D A;  4Z4I A;  3AO5 A;  4AH9 A;  1JLG A;  4CGJ A;  2BAN A;  1DTQ A;  4E7J A;  4KTQ A;  3ASM A;  1HYZ A;  4LH5 A;  2OZM A;  4K8Z A;  2JGU A;  3TI0 A;  4UQG A;  5FDL A;  4FW2 A;  4BDP A;  3AA3 A;  4LSL A;  3ZT0 A;  2Q3S A;  4K8X A;  3VQA A;  3C94 A;  4DTJ A;  2B4J A;  1NJW A;  1BIU A;  4B9V A;  1TV6 A;  4FM2 A;  3C6T A;  3EY1 A;  1RT5 A;  3PX4 A;  3RMB A;  3PX6 A;  2XY6 A;  1U45 A;  4KI4 A;  4DTR A;  4LSN A;  2P5G A;  4CCH A;  1VSE A;  4DU1 A;  3NF6 A;  4H4M A;  4EZ6 A;  3QET A;  3UIQ A;  3HVR A;  3T3F A;  4CF1 A;  3PY8 A;  1LW2 A;  1ZBF A;  3SCX A;  3K58 A;  3CFP A;  3VQP A;  1HMV A;  2O4G A;  2YNH A;  2BDP A;  5HRP A;  2OYQ A;  3S3O A;  4CEB A;  1SUQ A;  4H4O A;  1GOB A;  2F8T A;  3SV3 A;  3O3G A;  4TSX A;  3ZSZ A;  2KZZ A;  4J2A A;  3HPH A;  4B8C A;  4YNQ A;  3L8B A;  4ELV A;  4CF9 A;  5JS2 A;  3OY9 A;  1WAJ A;  1YT3 A;  4BDZ A;  1QTM A;  4O0I A;  1ZBU A;  1IO2 A;  3IG1 A;  3OYF A;  2HHW A;  1SL2 A;  5CYM A;  1FXX A;  1JLQ A;  5KGX A;  1A5X A;  1W9H A;  3HL8 A;  1SL0 A;  4F3T A;  3V9W A;  2DFH A;  1FKO A;  3LDS A;  3VQ9 A;  2QXF A;  1RDB A;  1NKC A;  1G15 A;  3I0S A;  4DU3 A;  4FLZ A;  4DQI A;  1RT4 A;  4DSL A;  2VWJ A;  1C1A A;  4O4G A;  3I0R A;  4CFA A;  5J2N A;  1TK5 A;  3KK2 A;  1NK0 A;  4E89 A;  4DQS A;  1KRP A;  3B6O A;  4FJ5 A;  4NCB A;  1KVA A;  3KLI A;  4CJ5 A;  4FJG A;  1REV A;  3AO2 A;  2JLE A;  3V1Q A;  1S6P A;  3DOL A;  4KHY A;  1VSJ A;  3WNG A;  5D3G A;  3SPY A;  1SKR A;  4NYF A;  4PQU A;  1QSL A;  1RBR A;  4CHO A;  2XHB A;  3DOK A;  3CG7 A;  2G8V A;  3K5M A;  4B9S A;  2A1S A;  4I9L A;  4FLT A;  4N41 A;  3OS0 A;  2EX3 A;  3AO3 A;  1C0U A;  5DMR A;  5SZT A;  4EZ9 A;  1L3V A;  3HXM A;  1IH7 A;  4DLG A;  1XWL A;  4CJQ A;  4DSJ A;  4FJN A;  3VQD A;  4M3Y A;  3CFR A;  4CGF A;  3U6F A;  1KFS A;  1LWF A;  4E19 A;  2VG7 A;  2E6L A;  4F3O A;  1T05 A;  4AIL C;  4QCL A;  1TL3 A;  4DTO A;  3S3N A;  2GBZ A;  4E1N A;  4CJS A;  3JSM A;  3AVH A;  3OYH A;  4IBN A;  3OYI A;  4B9M A;  4M3W A;  4AHS A;  4CEC A;  3L3U A;  5CZ2 A;  4XIU A;  3L2R A;  3ITH A;  1NOZ A;  4CJK A;  3LP3 A;  3DMJ A;  5CZ1 A;  3DRS A;  4HUG A;  1LAW A;  1ZBL A;  1RNH A;  1BGX T;  4DWI A;  3ZCM A;  4KTW A;  2VWK A;  4JS4 A;  1JL1 A;  3RMD A;  2HHU A;  2YHA A;  4CE9 A;  5C42 A;  3DM2 A;  3O4N A;  3TAF A;  3SYZ A;  1TAU A;  1W0H A;  1N5Y A;  3TAG A;  3E01 A;  1NK4 A;  4AHT A;  4OVL A;  1NK5 A;  3LPU A;  4E1M A;  4M3T A;  4O5B A;  4C8N A;  1KSP A;  3QIN A;  4CGD A;  4CK3 A;  1S5J A;  4CF0 A;  4DMN A;  1RT7 A;  2B5J A;  1FK9 A;  2Y1I A;  1J5O A;  1RBS A;  2IS3 A;  2E6M A;  1B9F A;  3ZSR A;  2OZS A;  1RT3 A;  3RRG A;  4CIF A;  3AA4 A;  1TKZ A;  4JLH A;  3VA0 A;  4FK0 A;  2G8F A;  1RDA A;  5HRS A;  3QEX A;  1LW0 A;  3K2P A;  3KLG A;  4DQP A;  4N56 A;  4KHN A;  4DF4 A;  2D5R A;  4KI6 A;  3NGY A;  4CES A;  2E4L A;  4HHT A;  2IC3 A;  4DFJ A;  4NYN A;  3VQ7 A;  3QER A;  3MXM A;  1BIZ A;  4CK1 A;  1Z26 A;  1NJX A;  3O4Q A;  4HCC A;  1C1C A;  1RIL A;  4RW4 A;  3CYM A;  4FZZ A;  4QAG A;  4FJK A;  2HB5 A;  4JRP A;  3V9Z A;  5HBM A;  3RRH A;  3RMA A;  4Z4G A;  3T19 A;  1HQE A;  1TKD A;  3NF9 A;  2QKB A;  3M8Q A;  3QLH A;  4OKE A;  2GV9 A;  1ASU A;  4HCB A;  2FBY A;  1A5W A;  4GMJ B;  3VA3 A;  3HST B;  4PWD A;  3VQ6 A;  2HMI A;  4FXD A;  1WSH A;  1HRH A;  4FZY A;  2KW4 A;  2G8U A;  2YNG A;  4CGG A;  4BE1 A;  1X9S A;  3AVL A;  3OVN A;  4FK4 A;  4N5S A;  3OS2 A;  1D8Y A;  2DTU A;  3KD1 E;  4AHV A;  4Z4F A;  4DTN A;  4W5R A;  1D5A A;  4CHZ A;  4Z4H A;  2ZQB A;  3P1G A;  3AA5 X;  3HVT A;  1BCM A;  3G10 A;  1KLN A;  3OYN A;  1WAF A;  2VG6 A;  3DLH A;  4B9U A;  3MAQ A;  2GUI A;  3LAN A;  2RKI A;  1WLJ A;  1HJR A;  2D0C A;  4E0D A;  1L3S A;  1KVC A;  4CJL A;  3K57 A;  5I42 A;  4CJV A;  1WNS A;  3TAQ A;  4M42 A;  3ZSV A;  3OJS A;  4DF8 A;  4B8A B;  4E7L A;  4F2S A;  1C1B A;  3L2V A;  3NBP A;  3K59 A;  5I3U A;  3KK3 A;  4HVJ A;  2HW3 A;  1IKV A;  3MEE A;  1S6Q A;  2IGI A;  3L3V A;  3TAE A;  3ZT1 A;  1LWE A;  5CYQ A;  4DSF A;  2YV0 X;  3NCI A;  4HUF A;  1JXE A;  2KTQ A;  3VQ5 A;  1JLA A;  1KFD A;  3QIO A;  5FRM A;  1QE1 A;  3I8D A;  1QSY A;  4B9T A;  4FJ7 A;  4KHQ A;  4LY7 A;  3O3F A;  2Z1G A;  4AHC A;  1X9M A;  4KPY A;  1VK0 A;  3MED A;  3OYE A;  1XC9 A;  1EX4 A;  1EP4 A;  3HP9 A;  3VQQ A;  3AVJ A;  4W5T A;  3LAK A;  3OYM A;  2R7Y A;  1NKE A;  2P5O A;  2AJQ A;  3LZI A;  3ZT4 A;  3NF8 A;  4KO0 A;  1U4B A;  3OYC A;  2G8K A;  3DRP A;  3CM6 A;  1BI4 A;  3DLR A;  3KKR A;  4CEQ A;  3TAR A;  1U49 A;  1D9F A;  4FJ8 A;  3M8S A;  3K5L A;  1C6V A;  1RT1 A;  4IG3 A;  3MEG A;  4M41 A;  4CJU A;  4GW6 A;  3VQB A;  4CJW A;  1SKS A;  4DFP A;  4KHW A;  2YHB A;  4J2B A;  4CFD A;  1XHX A;  4DTX A;  3AV9 A;  4FLW A;  4W5N A;  4PY5 A;  3CM5 A;  3ISN C;  2ZD1 A;  4CHY A;  3U3Y A;  4KHU A;  3TAN A;  2XY5 A;  1S9E A;  3K5O A;  1XHZ A;  1Q9X A;  3QEW A;  4JRQ A;  1HYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...