4TSXA

Hiv-1 integrase catalytic core domain mutant complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
143
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPESMNKELKKIIGQVRDQAETLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of H171T resistance reveals the importance of N -protonated His171 for the binding of allosteric inhibitor BI-D to HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
total genus 49
structure length 143
sequence length 155
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4tsxA00
2VWJA 4M3RA 2Y1IA 1C0UA 3VQ6A 1IO2A 3TAPA 3K5MA 1BI4B 5C25A 4M3UA 1RBSA 1SKRA 4E7HA 2HW3A 1BIUA 2IGIA 3NGYA 5E41A 4DU3A 3QEWA 5I42A 5DK5A 3O4QA 4Z0UA 3RMCA 4CGIA 3HK2A 3ISNC 4OKEA 2EHGA 4CHNA 4DSFA 4W5QA 1SKSA 3NH2A 4CEEA 1FKPA 3QESA 5HBMA 2LSNA 1GOAA 4CGGA 2IC3A 2Z1HA 1HYVA 3DLRA 4E7LA 2NUBA 3AVKA 1WN7A 3QEIA 4IBNA 4DLGA 5J2QA 4CEZA 3VQ7A 4W5OA 4BACA 3KD1E 4KPYA 4O0IA 1LW2A 1WSIA 5DMRA 4RW8A 3CG7A 3HPHA 2GUIA 2G8VA 3ZT4A 3HVTA 3NBPA 4IFVA 4TSXA 1L3UA 1WSGA 4KHNA 1S1WA 1X1PA 3DLBA 1K6YA 4FLZA 4M3WA 3NDKA 4PUOA 1T8EA 4FJNA 1D5AA 5KI6A 3KK2A 4KHQA 3A2FA 1KLMA 3M8PA 2HNDA 1U4BA 3RR8A 2QXFA 2I5JA 4FXDA 3MXJA 3NF7A 4LH4A 4AHSA 1ASWA 4M42A 5FRMA 1S1VA 4O4GA 1VSKA 1UA1A 3V1OA 2IS3A 3LZIA 1XI1A 1EKEA 3QIOA 4ELTA 3KK1A 3SPZA 4OLAA 3VQPA 2X74A 3HSTB 4Q5VA 1VSDA 3VQAA 3K5NA 3SV3A 3TANA 4CHQA 4E7IA 2KTQA 3PX6A 1S1UA 4E7JA 4K8XA 4CF1A 1ASVA 3I8DA 2GBZA 2EX3A 4GW6A 1L3VA 3NE6A 3OYJA 4CEQA 3B6PA 1LAVA 1HMVA 4CESA 2X6SA 1LWCA 4CIEA 4FJLA 1KTQA 2BDPA 1JLGA 3B6OA 3DRSA 4O44A 1J9AA 3IS9A 2OA8A 1WSEA 2OPPA 4ICLA 3SZ2A 3SCXA 1S9EA 3JYTA 3BGRA 1RT1A 4CJ5A 4CK2A 3HM9A 1R0AA 1EX4A 4BDYA 3E01A 1QSYA 3HP6A 4FCYA 4M3XA 3VQ8A 4FJIA 4CCHA 3V9UA 5CZ1A 3K2PA 1QQCA 5CY4A 4E19A 4CERA 3OJUA 4JRPA 4DTMA 1JKHA 3G0ZA 1WAJA 1KVCA 4KTWA 3QO9A 1BISA 2OZMA 3NH0A 4CGHA 3KIOA 4E7KA 3UIQA 1S6QA 3L2QA 5CZ2A 3VQQA 3ZT0A 2R7YA 3L2VA 1VK0A 2OZSA 2XY8A 3AA4A 1NK9A 4Z4EA 4Z4CA 3S3MA 1CXUA 2G8UA 4YNQA 2YNIA 1TL3A 3QINA 1D9FA 1BCOA 1RTHA 4KHUA 2BE2A 1U04A 1TKXA 1RDCA 1QE1A 4M41A 3V1QA 1NJWA 4DQIA 3VQ9A 1RDDA 2FC0A 4QCLA 5SWMA 2DFFA 3SV4A 4CE9A 3TAEA 4ZTFA 1UA0A 4GMJB 4DQRA 4M3YA 3QEVA 1NJZA 3SI6A 3JSMA 4JRQA 1G15A 3V1RA 3LP0A 4KTZA 2XHBA 1A5VA 3ZSRA 4CIFA 4FVMA 1WAFA 4IFYA 4EP4A 4OPJA 4KTQA 4BWJA 1HPZA 2IAJA 3NFAA 4CJRA 5I3UA 3K5OA 4DMNA 4OVLA 3HPOA 4CJVA 4EZ9A 1QTMA 3TR8A 3OYAA 1VRTA 4HVJA 4DSIA 2GV9A 2QKBA 4FJ8A 1HQEA 2OPQA 1XWLA 1VSEA 4DTRA 5J2PA 2ETJA 3MEGA 4CGJA 4DFMA 4LH5A 4DTPA 4GVMA 2OYQA 4FJ5A 3VQEA 4OPKA 5EU7A 3QEPA 4F3TA 3LP1A 1BQMA 3RRGA 2P5GA 3CFPA 4AH9A 1QSLA 1TK5A 3PX4A 1VSFA 4B08A 1VSIA 1RBVA 1FXXA 3C94A 1LW0A 2O4IA 2KQ2A 2ATQA 2D0AA 2ZD1A 1DLOA 3VN5A 4CFBA 3KLEA 1NKCA 1HYZA 3L3VA 4DTSA 1TAQA 1TK8A 3ULDA 2VG7A 3PUFA 1O1WA 1SL1A 3LP3A 3AVHA 4O55A 2HHQA 3SQ1A 4N76A 4FM1A 3ZSXA 3AVLA 1KFDA 3ITHA 4IKFA 3C6TA 3HL8A 1DTTA 3P83D 4CEOA 5T7BA 3OYHA 2G8FA 3AO2A 3CYMA 4BE2A 1NK0A 4CIGA 4E1MA 3AVNA 2XO7A 3KD5E 2YNGA 2WOMA 1ITGA 5KRTA 4PWDA 1GOCA 4O5BA 4OJRA 4FLVA 3SQ2A 3DM2A 4N56A 1U49A 1ZBUA 3RMDA 2YNFA 1TV6A 4MFBA 3HYFA 4H4OA 1KLNA 4DQPA 4KHWA 4FJKA 1YTUA 1SL0A 4FK0A 3V6DA 4J2EA 4FW1A 4OLBA 3OYEA 4OKJA 4DF8A 4DFPA 4DF4A 1N6QA 2ZE2A 1Q9YA 4RW9A 4HUGA 1RDAA 4DG1A 1W0HA 4FJHA 1RT2A 2JLEA 4DS4A 4C8LA 3NF9A 1NK8A 4FZXC 4FJ7A 4HTUA 3T1AA 3AVGA 4Q0BA 3M8SA 4FLXA 3WNFA 1IKXA 1EXQA 1LWEA 3DI6A 3DOLA 1B9FA 4JS4A 3WNEA 1TKDA 1I3AA 3NF6A 4UQGA 4ELVA 1VSJA 4LD0A 4CJ3A 3OS0A 4NYFA 1JLCA 2F8SA 4HCBA 4J2BA 3KKSA 4CJ4A 1X9MA 1BGXT 1TL1A 2XY5A 1VRUA 1BHLA 3AVCA 4CGFA 3THVA 3TAMA 2P1JA 4FM0A 3AA2A 3S3OA 1NJYA 4Z4FA 4N41A 4RW7A 3LAMA 5J2MA 3TAFA 2YHBA 1LAWA 2KFZA 2DFEA 2HNZA 2DY4A 5FROA 1HNIA 1RT4A 1NKEA 1TAUA 4CJSA 3KK3A 4HUFA 4OGEA 3V81A 1T7PA 1T05A 3MXMA 3O4NA 1KFSA 4CECA 3CM5A 1RTJA 4JS5A 3VQDA 4ZTJA 1ZBFA 4HUEA 3K5LA 4NCBA 4FLWA 2VWKA 1A5WA 2HHWA 4CHPA 4FJJA 4FJMA 4F2SA 2KW4A 1J53A 1S1XA 1TGOA 3MEEA 3P5JA 3C95A 4ID1A 4LSNA 4EP5A 4W5RA 4KB0A 2B4JA 2PYLA 1SV5A 2IOCA 1U47A 2G8WA 1N5YA 2RPIA 2QK9A 5FDLA 4E0DA 3V9XA 1ZBHA 3AVIA 4E89A 1GOBA 2HHSA 3LALA 3T3FA 1RNHA 4KB1A 3SUPA 4FJGA 4OGCA 4DSJA 2D0CA 2BGGA 3U3YA 1SKWA 4AILC 3HT3A 4CF0A 3G10A 4CFCA 4PQUA 1U45A 2JGUA 1C0TA 1DTQA 1JXEA 3HP9A 1C1BA 4I9LA 3WNHA 3AO3A 1IKYA 5D3GA 2G8IA 4NCGA 2AJQA 3OJSA 5HRNA 4CHYA 1KSPA 4L8RB 4KHYA 3OYDA 1QHTA 4I2PA 4WE1A 3O3FA 3OYCA 2XRIA 3TWHA 4KAZA 3DLGA 2DFHA 3MEDA 3OYKA 4FJ9A 3ALYA 4CFDA 1XHZA 2HHTA 4RW4A 3KLIA 1F21A 2E4LA 3LANA 4AHVA 2YKMA 3OYMA 1MU2A 1RT5A 4DFKA 3QNNA 5JS1A 1BI4A 4XIUA 2RF2A 2A1RA 4FK4A 3OS1A 1JLBA 3L2UA 4C8NA 2B5JA 4KI6A 4FYDA 4CEDA 4CJPA 3AO5A 1J5OA 4Z4IA 4LSLA 1W9HA 3DRPA 4M45A 4KV8A 3AVBA 1X9WA 3DLHA 3TARA 3LP2A 4O0JA 1NK7A 3HJFA 3AVFA 5HRPA 3KTQA 2Z1GA 1EP4A 2Q3SA 4G1QA 3TABA 3ZSZA 1L3TA 3NGIA 2HB5A 1I39A 5KGWA 3AA3A 4CJEA 4DLEA 4E3SA 1S5JA 3SQ4A 3HPGA 4K8ZA 2FBVA 3SUQA 4DTNA 3VA0A 3PY8A 2FBXA 3K58A 4DSEA 3RWUA 3PO4A 4DU1A 3DOKA 4QOZB 1J54A 1D9DA 4KREA 1JLAA 1WNSA 3T19A 3V4IA 4N5SA 4DTJA 1KRPA 2E6LA 2B6AA 2YV0X 3NCIA 2D0BA 3OYNA 4ELUA 1C1AA 3I0SA 1U48A 1ZBLA 4CJLA 1ASUA 4FZZA 3F9KA 4H8KA 2YNHA 1KVAA 4CJWA 3VQ4A 4DQQA 4IDKA 1Q9XA 4J2DA 2W42A 3PO5A 3L2WA 3KLGA 1BIZA 1JLFA 1IKVA 1Z26A 3IRXA 3M8QA 3KLHA 1TKTA 5CYMA 4CEFA 3VQ5A 4CJQA 3AO4A 5HRSA 3PV8A 5K14A 2PZSA 3OYBA 3RR7A 4DS5A 3V9ZA 3AVJA 5C42A 1RBRA 1S9GA 2ITGA 1D8YA 3DLKA 4DWIA 4B9NA 4I7FA 4CK1A 1RT7A 1LWFA 1KVBA 3LDSA 4C8OA 4KI4A 4N47A 5HRRA 4KFBA 4FW2A 5CYQA 4CFAA 3MECA 3QERA 4CHOA 4RG8A 1UOCA 1JLQA 3WNGA 4H4MA 1TKZA 4DSLA 4CHZA 5HP1A 4CEBA 4B9SA 1XC9A 1BL3A 4DQSA 1RTIA 4FLUA 1IG9A 1QS4A 2G8HA 2QKKA 1NK6A 1LV5A 2X6NA 1X9SA 1RILA 4CJUA 1RTDA 4M3TA 3V9WA 4YFUA 1QSSA 4B3OA 1YTAA 3OYFA 3MAQA 1FKOA 4E1NA 4FZYA 2HVHA 4R5PA 1HQUA 3OVNA 4FLYA 1L5UA 3QIPA 4J2AA 3ZSQA 3SUOA 3AVAA 3TI0A 3V9SA 3ZSYA 2F96A 4CJKA 4C8MA 2E6MA 3LZJA 2HHUA 3S9HA 5HLFA 3K57A 3C6UA 3CFRA 4B9LA 1CZ9A 1S1TA 3OS2A 1NK5A 4QAGA 3D0PA 4DTUA 2HNYA 4B9TA 3LPTA 5KRSA 4PY5A 1JL2A 1WSHA 4F3OA 1L3SA 1JXBA 3NHGA 1Q8IA 3CM6A 3KJVA 3SYZA 2KZZA 1IH7A 2KZMA 1NKBA 4B8CA 3DLEA 3VQCA 5C24A 5HROA 3LWMA 3OY9A 2BANA 4BDZA 3CFOA 3CQ8A 3QLHA 3L2RA 3RMBA 2G8KA 1B92A 3IAYA 4OKKA 1KCFA 4ZHRA 3ZSOA 3EZ5A 1XHXA 1YVUA 2HVIA 5KGXA 1Z25A 2WONA 1IKWA 1RBUA 3QETA 2OPSA 3F73A 2YKNA 4LY7A 3ZT2A 2YHAA 3M8RA 4KRFA 2PY5A 3DYAA 1NOYA 3NH1A 4NCAA 3SUNA 1JL1A 4I9QA 1Y97A 2D5RA 2F8TA 2P5OA 2O4GA 3P1GA 3ZT1A 4Y1DA 3SQ0A 4F4KA 4Z4HA 3RMAA 4DFJA 1HNVA 2OPRA 4CEAA 4FLTA 3QNOA 1NJXA 4B9VA 2KFNA 3DRRA 3ZCMA 3RRHA 1C0MA 4RW6A 3K59A 3PX0A 1HYSA 1RT6A 5KTQA 4DSKA 1EETA 1SL2A 1VSMA 3ZSVA 1NOZA 3H08A 4B9MA 2HHVA 1C6VA 3ZSWA 1RBTA 4FK2A 3HVRA 2DTUA 1NK4A 2XY7A 1T03A 1SUQA 3AO1A 3NGZA 2X78A 3SPYA 4AHRA 1A5XA 4PA1A 1ZBIA 1S6PA 3OYLA 4HHTA 4BE1A 4BWMA 2FBYA 4DTXA 3FFIA 3D45A 4CF8A 4BE0A 3NF8A 3HO1A 4I2QA 3EY1A 4BDPA 1VSLA 1CLQA 4FM2A 1WSJA 4ID5A 3U6FA 2Z1IA 2VG6A 3SJJA 3AA5X 3DMJA 1C1CA 3OYIA 3TAGA 4AHUA 1HRHA 2PYJA 3L3UA 3VA3A 2A1SA 1BCMA 1BQNA 1UAXA 3KKRA 5J2NA 1FK9A 4F2RA 4F8RA 4B8AB 3LWLA 3L8BA 4KHSA 2HHXA 4HCCA 4KO0A 3HXMA 4W5TA 3RTVA 3MXIA 2IDOA 3AVMA 2HMIA 3QEXA 3ASMA 3O3HA 4CK3A 4B9UA 3EYZA 4CF2A 4CJTA 4Y1CA 2RKIA 3U3GA 1WLJA 1RDBA 1REVA 3LAKA 5J1EA 3S3NA 3I0RA 2FBTA 4AHTA 4Z4GA 2Y1JA 2ZQBA 3LPUA 2XY6A 1YT3A 3OYGA 4FJXA 4JLHA 4CJFA 4NYNA 4EZ6A 1RT3A 2VG5A 1HJRA 4M3ZA 1TK0A 3ZT3A 3BDPA 1WSFA 3O3GA 5FRNA 1UWBA 4DTOA 4C8KA 4CGDA 2RN2A 3NAEA 4DU4A 2Z1JA 4IG3A 1B9DA 1RCHA 4IG0A 3TAQA 1TVRA 3AV9A 5SZTA 5JS2A 3KLFA 3SNNA 4W5NA 1CZBA 2P51A 4KKOA 3VQBA 4CF9A 4MQ3A 4AHCA 3IG1A 1VSHA 1CXQA 1JLEA 1ZYQA
chains in the Genus database with same CATH superfamily
3CHWA 2Y1IA 4F9OA 5AQWA 3VQ6A 3K5MA 5C25A 3SMPA 1RBSA 1BIUA 1NLVA 5AQUA 4DU3A 4GV6A 5DK5A 5BRDA 2FSKA 3ISNC 2EHGA 1FKPA 2P9NB 5BPNA 4CGGA 3I8BA 2IC3A 3QEIA 3SLCA 3VQ7A 3KD1E 1N33K 3TSPA 2GUIA 2HMPA 3HM8A 4A59A 1L3UA 1WSGA 3LDNA 1S1WA 5TKWA 1X1PA 4I6MB 4LFAK 4CVNE 1TYQA 4PUOA 5CE3A 2H3GX 1DT9A 4BRDA 4YDUC 1BDGA 1KLMA 3MXJA 4DV3K 2HBJA 1GLCG 2IIRA 3CCSN 4DV2K 1UA1A 3CJ1A 3V1OA 2QXLA 5JVGL 4ELTA 3KK1A 4OLAA 2X74A 1VSDA 5BRHA 3PLAA 2Q0RA 4CHQA 4E7IA 3SAFA 3L4QA 3SJHA 1YXQA 3QB0A 4CEQA 3UKUB 3B6PA 1LWCA 4FJLA 1KTQA 1VQ5N 2OA8A 2OPPA 1BOTO 2WBNA 1S9EA 3HM9A 3OA9A 3EKSA 1VQ7N 4M3XA 1E3MA 2AA4A 5CY4A 4E19A 3OJUA 4JRPA 2O8CB 3UIQA 3CCJN 1S6QA 4IWVA 5CZ2A 3VQQA 2R7YA 3H3NO 2OZSA 3AA4A 1NK9A 4Z4EA 1CXUA 3ZETB 2G8UA 4DV4K 4YNQA 2E2QA 1TL3A 3QINA 1D9FA 4KHUA 3U8XA 1TKXA 4DQIA 2FC0A 5SWMA 3W3DA 3SV4A 3TAEA 4BRMA 4M3YA 1NJZA 2YX6A 4JRQA 4CZGA 2XHBA 3F9MA 4CZFA 1QVFM 2O8EB 3WXLA 4EP4A 4DUZK 3NFAA 4BROA 1QTMA 1D4XA 2A40A 2GV9A 3W0LA 2OPQA 5J2PA 2ETJA 3MEGA 4CGJA 3QBXA 4DTPA 3K0SA 4A57A 3RSEA 1CZAN 3CFPA 4WCEL 4NLBA 4B1WB 2KLAA 1KC8O 4BRIA 4ILGB 1FXXA 3T69A 2O4IA 2ATQA 2D0AA 4EIAA 1VQLN 1T44A 1O1WA 3LP3A 3AVHA 2VGNA 1DTTA 5T7BA 1VHXA 2G8FA 2FLOA 3VTHA 3AO2A 1BG3A 3UB5A 1NK0A 4CZHA 4E1MA 2WOMA 4JN4A 4BC4A 4K0KK 3KK7A 3H1QA 2ZJPL 2YCHA 4MFBA 4BR2A 3WXMB 3HYFA 4DQPA 4FJKA 1YTUA 4G9ZA 3GDQA 3V6DA 3O8MA 4J2EA 5F0XA 3ULEA 5GAEP 2ZE2A 4HUGA 1RDAA 4FWKA 1W0HA 2WTUA 4FJHA 4C8LA 3VMFB 3CC7N 3AVGA 3WNFA 1I3AA 4K25A 4UQGA 4AQYK 1VSJA 3HI0A 4LD0A 2E88A 3OS0A 4WQ4A 2F8SA 4HCBA 1X9MA 1VRUA 5GINA 3AVCA 3THVA 3TAMA 4FM0A 3EL2A 3AA2A 5KPTA 3TAFA 1LAWA 1BU6O 3V81A 1N36K 4CZLA 2GUPA 2KKZA 4NCBA 1O13A 2VWKA 2HHWA 4CHPA 4FJMA 4F2SA 1WB9A 1J53A 4IEIA 4KB0A 3UKRB 1N5YA 3C7NB 5FDLA 4E0DA 3MN6A 4YHHK 4E89A 1GOBA 2HHSA 3VENA 3LALA 4KB1A 4FJGA 2DPNA 1SKWA 4FWRA 4PQUA 3E1YA 3AAPA 1JXEA 3HP9A 1HR0K 1C1BA 4CHYA 1KSPA 4DR2K 4JK7A 2DFHA 4FJ9A 2UUCK 2HHTA 5LJVA 3KLIA 3MCAB 3LANA 5JS1A 1RT5A 1V4SA 4JI4K 2RF2A 4FK4A 3VOVA 4C8NA 3CJ7A 1W9HA 1X9WA 3DLHA 3LP2A 2ITMA 3HJFA 3WUHA 3AVFA 2P9NA 3KTQA 1HX1A 4JKCA 1L3TA 2VGMA 3NGIA 5BPMA 3MN7A 4BQLA 1JCEA 2ZGZA 4DLEA 3HPGA 3CJBA 2AP1A 3VERA 4DTNA 1ZBSA 4JEPA 4H5RA 4DSEA 4JI3K 2F9WA 4FVUA 1JLAA 4I6MA 1WNSA 3CERA 3OW2M 4DTJA 4ELUA 1C1AA 2V51B 1U48A 1M90O 4J8FA 3F9KA 4CJWA 3VQ4A 4JK9A 4RTFD 4LF4K 3PO5A 1Z26A 3M8QA 1XUPO 3KLHA 5K14A 4DS5A 3AVJA 1RBRA 5A2QO 2ITGA 4DWIA 1P90A 3QBWA 4YOUA 4BRHA 3CPWM 4C8OA 2J4RA 4N47A 3WXJA 4KFBA 3UKUA 3OBWA 4DV0K 1UOCA 1YUWA 4H4MA 4AM6A 5HP1A 1BL3A 1R59O 1RTIA 4FLUA 1QS4A 3OBYA 2E2NA 2YI1A 4ILJA 2F9TA 4RCHA 1X9SA 4B3SK 1RTDA 4IEEA 3V9WA 4ISFA 4YFUA 2A42A 3LL3A 4J2AA 2O8CA 3QIPA 3AVAA 5AQHA 3DLLL 3ZSYA 4V19S 5HLFA 3C6UA 3R3LA 4B9LA 3ZETA 1GLAG 1CZ9A 4B1YB 3OS2A 4K41A 1NK5A 4FWMA 2FF6A 1WSHA 2NRRA 1MA9B 2RHKA 4BRFA 4H5TA 3CM6A 3KJVA 1IH7A 4BQZA 4H5NA 3QLHA 2G8KA 1ESVA 1KCFA 3ZSOA 3EZ5A 1RBUA 4BR4A 2OPSA 1YJNN 4Z94A 4A62A 5BN9A 2F8TA 1GLFO 2O4GA 3P1GA 3KHYA 4F4KA 3EE9A 4Z4HA 3I33A 2V7YA 2OPRA 4FLTA 1N34K 2KFNA 1Z05A 3JXUA 1RT6A 4DSKA 4B9MA 2QWLA 4FK2A 5AQSA 3MN5A 2XY7A 1SUQA 5E26A 2D0PA 4PA1A 4BE1A 2ZJRL 4M7YA 1NWKA 1WBDA 3HO1A 1NGDA 3EY1A 4YDUA 2CGLA 3U6FA 3ENBA 4YOWA 4Y0WA 3SJJA 3AA5X 3WEEB 1C1CA 4AHUA 2PYJA 4JI2K 2QEXN 2A1SA 1UAXA 3PSIA 3VGMA 4W5TA 1QQMA 4LFCK 3TTDA 3AVMA 4C23A 2QI2A 1QVGM 4B9UA 4M63C 4Y1CA 2RKIA 4QOZB 1RDBA 1REVA 3QICA 3I0RA 2FBTA 4DR7K 5BPLA 4YOVA 4NYNA 1NBWA 1RT3A 1N8RO 1WSFA 2I7PA 4C8KA 2GWJA 4NLCA 4C1NK 1HKCA 1TVRA 5AQVA 5JS2A 3SNNA 4KKOA 4MQ3A 4DV6K 1VSHA 1CXQA 4FL9A 2QM1A 4H0PA 2F4VK 3TAPA 1BI4B 1ZC6A 4JK8A 5AQTA 3ZLJA 5E41A 4H0OA 3G71N 1SKSA 3UKRA 3C7NA 2NNWA 4H03B 3T7ZA 2LSNA 1GOAA 5FPMA 3QESA 3DLRA 4A5BA 4E7LA 4EFHA 4W5OA 1XNQK 4O0IA 1LW2A 1WSIA 4RW8A 2HHHK 2G8VA 3DLBA 1D5AA 2QWQA 3KK2A 3G6EN 2I5JA 3THYB 3NF7A 2BTFA 4M42A 2ZJQL 5FRMA 5IT9O 1VSKA 1XI1A 2YHWA 2ZWHA 3SV3A 2KTQA 5C0YA 1ASVA 1NGJA 1GLBG 3I8DA 5EOYA 3JAMO 4LF9K 1LAVA 4CESA 2W6LA 2X6SA 2P9UB 3MWTA 5FPEA 4CW7B 3R6MA 4ICLA 3JYTA 4X65K 3JS6A 4CK2A 1R0AA 1EX4A 1YVNA 3E01A 3WQUA 1Q18A 4BGBA 3HP6A 5MLCQ 3BZCA 4CCHA 1QQCA 4DTMA 1JKHA 1KVCA 3QO9A 2UU9K 4O8UA 2OZMA 4DCHA 3CC4N 1VK0A 3TTFA 2XY8A 4JKAA 2YNIA 1RTHA 1QE1A 1NJWA 4H5VA 1RDDA 5LJWA 2DFFA 4CE9A 3Q7CA 4GMJB 4CBWA 3JSMA 5F2RA 4NXNK 3LP0A 4KTZA 1A5VA 5LL6Z 1U6ZA 4FVMA 4JKEA 1Q82O 2WFBA 3L4IA 1YITN 1HPZA 2IAJA 4CJRA 3O9RA 3CD6N 4BRLA 1GLJO 1KAYA 3OYAA 4HVJA 4CZKA 4FJ8A 4JV5K 1HQEA 5ADXA 4PKGA 1VSEA 4F3TA 3VQEA 3AGKA 3LM2A 1BO5O 1OVQA 2CGJA 2YHYA 5C2DA 1FJGK 3OHRA 1VSFA 1ATSA 2KQ2A 1W97L 1C0FA 2NRWA 4EAHD 1VAZA 3BF1A 3L3VA 1TK8A 4BR5A 2HHQA 4FM1A 3AVLA 1KFDA 3C6TA 3CJCA 5DM7L 1VQ6N 4CEOA 3OYHA 4BE2A 1WBBA 5AQYA 3AVNA 2YNGA 3ENOA 4PWDA 1GOCA 1U49A 1RDUA 2YNFA 1KAZA 2UUAK 3VEOA 3CC2N 2D0OA 4KHWA 3N4PA 4FW1A 5M1OA 3T1YK 4DFPA 3A5NC 1Q9YA 5DM6L 3C0BA 4FZXC 3T1AA 3CQXA 3M8SA 4FLXA 1IKXA 3DOLA 4JS4A 4PL8A 1T6DA 3TU5A 3FZKA 1TL1A 2XY5A 2YJFA 1BHLA 4CGFA 2HOEA 2P1JA 2QW9A 1IV0A 5M1PA 4BGAA 3LAMA 5J2MA 1OH7A 5EY4A 2HNZA 3H46O 5FROA 1HNIA 3WEEA 1TAUA 4DR3K 4OGEA 1T05A 3O4NA 2O8BB 1RTJA 4JS5A 3VQDA 3D6RA 4HUEA 3AGRA 3FZLA 2KW4A 1S1XA 1K8KB 3C95A 2B4JA 1SV5A 3Q7BA 1ZBHA 4BREA 4JD2B 4MO4A 1W7AA 4KH4A 4DUYK 3T3FA 3SUPA 4OGCA 2BGGA 4CFCA 1OVYA 4ISEA 1U45A 2JGUA 1DTQA 3WNHA 3LDQA 3WXKA 1VQ8N 5D3GA 3E9LA 4NCGA 2AJQA 3OJSA 5AQQA 3CCEN 4KHYA 4FWOA 4GY2B 4LFBK 4KAZA 4NXMK 2CGKA 3U9DA 3ALYA 1XHZA 3FZFA 3OYMA 4AHVA 2Q97A 1BI4A 3KWIA 4XH4A 2A1RA 1OH6A 3VEYA 2B5JA 4FYDA 3AO5A 3O5BA 3DRPA 3AVBA 4X64K 2NZTA 2Z1GA 4G1QA 4FO0A 1QHAA 1IBLK 5KQDA 3AA3A 3O1BA 4CJEA 4E3SA 4BRKA 3SQ4A 4FWLA 3SUQA 1NU0A 4BRAA 4EHTA 3EE8A 4LF7K 1J54A 3WQTA 4BVPA 1D9DA 3T19A 5TKYA 4N5SA 2E6LA 3NCIA 3OYNA 4CBXA 1EWRA 1ZBLA 1ASUA 4B3RK 3FZHA 5AZJB 4H8KA 2YNHA 1KVAA 3BY5A 1IBMK 4J2DA 3THYA 4IDKA 2W42A 3L2WA 5CYMA 4CEFA 4YOYA 1DKGD 3M5RA 2P9IB 4B9NA 3GOIA 4I7FA 1LWFA 1KVBA 3S41A 4CFAA 1VQ4N 3MECA 2QA4N 3QERA 4CHOA 1YIJN 1NMNA 2P9UA 4RG8A 1JLQA 3WNGA 3GG4A 4CHZA 4B9SA 1XC9A 1NK6A 3E66A 4FPAA 2X6NA 3CF5L 4H0XB 4B3OA 4FZYA 4NB4A 3ATUA 5JICA 4FLYA 3SUOA 1NM1A 3L0QA 4CJKA 4UY8O 2JWKA 4KBOA 3S9HA 3P4IA 1MWKA 2W41A 1RFQA 2HNYA 3LPTA 3BP8A 1TUYA 3SBGA 4JKGB 5KPRA 1K8AO 3NHGA 1Q8IA 5HOOA 3J80O 3FZMA 2HSTA 1S3XA 2KZZA 4B8CA 3N4QA 2HF4A 3H3OB 3DLEA 3VQCA 5HROA 3H45C 3LWMA 4JI6K 1QZ6A 1B92A 4OKKA 4ZHRA 1K9MO 3AARA 5GAHP 1XHXA 1YVUA 1NGCA 1Z25A 2WONA 5F1XA 3M8RA 3DYAA 4JI7K 1BWFO 1IG8A 3DXMA 4I9QA 2D5RA 2P5OA 3ZT1A 2A6AA 2E2OA 4PKHA 2NRHA 3QNOA 4DR4K 3ZCMA 1C0MA 4RW6A 1HYSA 4IXCA 4PKIA 2UUBK 1IJJA 1NOZA 3VF6A 1C6VA 3EKUA 1RBTA 3IMXA 3ZSWA 2DTUA 3D2EB 3HZ6A 4IDHA 4AHRA 1RGIA 3SPYA 1A5XA 3LDOA 4IZ9A 4HHTA 3NVKA 1HNWK 3FFIA 3D45A 4I2QA 4BDPA 1WSJA 3DMJA 4GV9A 4OPHA 3L3UA 3VA3A 1BCMA 1BQNA 1QZ5A 1YF5L 3KKRA 2HHXA 3L8BA 1ATNA 1NGEA 4LC9B 2HMIA 3O08A 4JKHA 3GE1A 3ASMA 3O3HA 3EYZA 2P9KB 3MX2A 4CJTA 4WFAL 1WLJA 3NVMA 1JCFA 5AFUH 4AHTA 2ZQBA 4CZIA 2XY6A 4MDAA 4FJXA 1M1KO 1RDWX 2JWLA 3IFRA 1TK0A 3O6WA 5FRNA 3A8YA 4DTOA 4DU4A 4IG3A 4H0VB 3TPQA 1B9DA 3TAQA 3AV9A 5SZTA 4CZMA 3HRGA 1HLUA 1CZBA 4CF9A 1YAGA 2I7NA 3ID6A 1OH5A 1JLEA 2VWJA 2O8BA 2P9SB 4B1XB 1IO2A 4H5WA 1SKRA 4E7HA 2HW3A 2IGIA 3NGYA 1XMQK 1K8KA 4OKEA 4DSFA 4W5QA 5FPDA 5HBMA 3KZBA 3BUZB 1HYVA 4JD2A 3AVKA 1WN7A 3A5OC 3U9ZA 5J2QA 3MN9A 3CG7A 3HPHA 2VYPA 2V7ZA 4X62K 4H0YB 3C6AA 4CBUA 3FR0A 4FLZA 4M3WA 3M6GA 1T8EA 4FJNA 1U4BA 2QXFA 4FXDA 1SAZA 3ENHA 4LH4A 1ASWA 4AHSA 3PIPL 3C65A 3DXKB 3LZIA 1EKEA 3CJ9A 3A5MC 3QIOA 4Q5VA 3HSTB 3TANA 3K5NA 2O8EA 3M3ZA 3PX6A 1S1UA 4BVOA 4E7JA 4K8XA 2PBDA 4CF1A 4B1ZA 2GBZA 4IJNA 2WUSA 1YI2N 1L3VA 3OYJA 2P9LB 1HMVA 3LM9A 1JLGA 3B6OA 1J9AA 3IS9A 1WSEA 3SCXA 1RT1A 3VEVA 4BDYA 2A3ZA 5AQGA 3R1XA 1GLEG 3PSFA 5CZ1A 3K2PA 4CERA 3G0ZA 4CZEA 1SZ2A 4IO8A 4CGHA 3CQYA 5C10A 4E7KA 5AZJA 3L2QA 1LCUA 3ZT0A 1VQKN 5LMUK 3L2VA 2W6KA 3S3MA 5AQLA 1BCOA 1TYQB 3G25A 4M41A 2P9IA 4QCLA 1VQ9N 2HF3A 4ZTFA 4KH6A 4BR9A 4YOXA 3QEVA 3SI6A 3V1RA 3ZSRA 1LOTB 1NGBA 4IFYA 4OPJA 4KTQA 5I3UA 3VETA 4IJAA 3P38A 3TR8A 4LF6K 4DSIA 2QKBA 4BC5A 4O5FA 2GTDA 3DWLA 4DTRA 3EN9A 4DFMA 4LH5A 2OYQA 4FJ5A 3QEPA 3LP1A 1BQMA 1MWMA 2P5GA 4AH9A 3O4WA 4JKFA 4B08A 1VSIA 1YHQN 5AJ3K 2NRXA 1LW0A 1GLLO 2ZD1A 3VN5A 3R9PA 4CFBA 3KLEA 1IBKK 4DTSA 3ULDA 2VG7A 3AAQA 4JKGA 1HKBA 4O55A 5CR4A 3SQ1A 4N76A 3P83D 4KHPK 2E1YA 2OTJN 3CYMA 4CIGA 1BA1A 1DEJA 2XO7A 1ITGA 5KRTA 4O5BA 4OJRA 3CCLN 4FLVA 3SQ2A 1ZBUA 3CI5A 3RMDA 1TV6A 4H4OA 5KQ8A 4JI1K 1W2BM 5AZIB 1SL0A 3ZX3A 3QFPA 4OLBA 3OYEA 4DF8A 5AQRA 2BUPA 4GKKK 4JNEA 4DB3A 4YORA 1HKGA 5IWAK 1NK8A 4HTUA 1LWEA 3DI6A 1B9FA 3WNEA 1NGIA 3D2EA 1TKDA 5BR8K 2E20A 1ZXOA 4NYFA 1JLCA 3KKSA 4CJ4A 1BGXT 5I9EB 4FOEA 5BRFA 1NJYA 3S3OA 2HBLA 4N41A 1NG9A 3QMLA 1NGHA 4O8KA 1NKEA 4WYBA 1T7PA 3MXMA 3CM5A 3A5LC 1ZBFA 3CPEA 3O1WA 1A5WA 1YJ9N 5H1SQ 1HNXK 3WT0A 1TGOA 2E8AA 4EP5A 4ID1A 2HVHA 2PYLA 1U47A 2G8WA 5GAGP 1N32K 3IUCA 2P9KA 3TSUA 3AVIA 3HTVA 1RNHA 4K43A 3VEZA 2D0CA 4DSJA 3U3YA 4AILC 4CF0A 1C0TA 4A2AA 3AO3A 1IKYA 2G8IA 5HRNA 3OYDA 1YJWN 4WE1A 3O3FA 4L3QA 1EQYA 4RW4A 3DAWA 3FE1A 3QNNA 5FPNA 3VF2A 4CEDA 3IDHA 2EWSA 4Z4IA 2NRZA 4LSLA 3NMUA 5LY3A 4O0JA 5AQJA 1NK7A 5HRPA 1WUAA 1G99A 3TABA 3SAGA 1BUPA 2ASMA 2HB5A 1I39A 2ZF5O 1S5JA 4WQ5C 2FBVA 4EHUA 2NRTA 3VA0A 2Q36A 3K58A 2WC9A 3RWUA 4DU1A 2O8DB 4KREA 3BEXA 2HBKA 3BZKA 1Q7YO 3V4IA 1KRPA 2B6AA 2YV0X 4CJLA 4E1JA 3TSQA 2CH5A 3KLGA 1BIZA 1JLFA 3DXKA 1TKTA 4DR5K 1XQSC 3VQ5A 4CJQA 3AO4A 1SS6A 3O9SA 3OYBA 1J5EK 2OCEA 4B3MK 3DLKA 3CXCM 2UXDK 4KH5A 4B9QA 4U7BA 2GWKA 2P9LA 3QDKA 4IOCL 2ZM6K 5AQOA 4DSLA 3SMSA 5ELZA 4CEBA 2GELA 2VCPA 1JJ2M 2QKKA 3B8AX 2G8HA 1C0GA 1RILA 4CJUA 4M3TA 1QSSA 1YTAA 4OPAA 1FKOA 1X3NA 4E1NA 4R5PA 1HQUA 1L5UA 3TI0A 4X66K 5HL7L 2F7TA 3V9SA 4JI8K 4BRCA 2VWBA 2HHUA 1NGFA 4DR1K 3CFRA 1S1TA 4B9TA 4DTUA 1OKJA 4PY5A 3OTOK 4HTLA 4BR0A 1L3SA 1JXBA 4QS7A 2BH1A 3SYZA 2KZMA 1NKBA 3OY9A 2BANA 3CQ8A 3L2RA 3RMBA 5AQIA 2FSNA 2HVIA 1IKWA 3F73A 2YKNA 3ZT2A 3THXB 2PY5A 3CIPA 3NH1A 1VQNN 3SUNA 1Y97A 3O9QA 3D7EO 2PAVA 5AR0A 4DR6K 4DFJA 4B9VA 4DQ8A 3K59A 4PL7A 4WFBL 5KTQA 1EETA 4DV7K 3H08A 4CZJA 2Q0UA 2HHVA 5GIOA 1NK4A 2QWNA 3AO1A 3NGZA 2X78A 4A61A 3RVCA 1S6PA 3OYLA 1KAXA 2FBYA 4DTXA 4CF8A 4BE0A 3NF8A 1VSLA 3FGUA 4ID5A 5AQZA 3OYIA 3TAGA 3C6HA 3HSCA 4F2RA 5J2NA 3I55N 1FK9A 4F8RA 4B8AB 3LWLA 2E1ZA 4KO0A 3HXMA 1U2VB 5AZIA 4A5AA 1X9JA 1DGKN 4M7XA 1XMOK 4NO7A 4JKBA 4CF2A 4FWPA 5J1EA 4FSVA 1YT3A 3H6EA 3MK6A 4JLHA 4CJFA 2VG5A 4FWQA 3ZT3A 3GBTA 3BDPA 3NAEA 2Z1JA 2Q2RA 3DJCA 1GLDG 3KLFA 1S22A 2O8FB 3VQBA 4W5NA 1XNRK 4DQSA 5AQXA 3TTCA 4M3RA 1C0UA 2QTDA 2D1KA 3O9TA 4M3UA 3U4LA 3CCVN 3MCPA 3K9JA 3T1HK 3QEWA 5I42A 3O4QA 4Z0UA 3RMCA 4CGIA 2UXBK 3HK2A 4CHNA 3NH2A 4CEEA 3WXIA 2Z1HA 1QQOA 2NUBA 4IBNA 4DLGA 4KPYA 4CEZA 4BACA 3K9KA 1T3VA 5DMRA 3J81O 3ZT4A 3HVTA 3NBPA 4IFVA 4TSXA 4BRGA 3HOTA 3EO3A 4KHNA 2D4WA 1K73O 2E5LK 1K6YA 3NDKA 5KI6A 3KVGA 3UE5A 4KHQA 2GEMA 3A2FA 3HBTA 2HNDA 3M8PA 3RR8A 2QWOA 4OX9K 3P31A 3ZX0A 2A41A 1S1VA 4O4GA 4U67L 5GADP 2IS3A 2KHOA 3SPZA 4LF8K 3VQPA 2FF3B 4H0TB 3VQAA 2UXCK 3SBTA 2NRVA 1VQPN 2VQFK 5M1NA 4WFNL 2EX3A 4GW6A 3NE6A 5M1KA 5EX5A 2QWPA 3VGLA 4CIEA 5GIPA 3J8AA 2BDPA 3DRSA 4O44A 1OH8A 1NNEA 1E4GT 3SZ2A 3BGRA 3SK3A 4CJ5A 4DKWA 1QSYA 4FCYA 5AQFA 2O8DA 3VQ8A 4FJIA 5EXWA 3V9UA 3THWB 3GL1A 1WAJA 4KTWA 1BISA 4XH1A 3NH0A 3KIOA 1S72N 4JHDB 3M1FA 4MLEA 4Z4CA 4YY3K 4B3TK 2BE2A 1U04A 4LF5K 3V1QA 1RDCA 3VQ9A 5M1FA 4MDBA 1UA0A 3ZEUB 5JVHL 4DQRA 1G15A 3J7YP 1KQSM 4CIFA 1Q86O 1WAFA 2P9PB 4BWJA 3D2FB 3K5OA 4DMNA 4OVLA 3HPOA 2OANA 4CJVA 4EZ9A 4B1VA 1NGGA 1VRTA 3EEQA 1HJOA 1XWLA 1P8ZA 3L6QA 3E9PA 4GVMA 4OPKA 5EU7A 3RRGA 3A0IX 1QSLA 3CMAN 1TK5A 3FLCO 3P39A 4FWSA 3PX4A 1RBVA 3C94A 1FW6A 4QS8A 1DLOA 4BG9A 1NKCA 1HYZA 1TAQA 2Q1NA 3PUFA 1SL1A 4QS9A 3E9OA 3ZSXA 4IKFA 3ITHA 3O9UA 1KD1O 3HL8A 1NJIO 1XC3A 5JLFA 3VF4A 5C12A 3KD5E 2OTLN 4ISGA 2FXUA 3DM2A 4N56A 3THXA 1KLNA 2ASOA 4IFEA 4DF4A 4OKJA 3VPZA 4XEIA 1N6QA 4RW9A 5BR9A 4GVEA 4BRNA 4DG1A 3J7AP 3BF3A 1RT2A 2JLEA 4DS4A 4BRPA 3NF9A 4FJ7A 4WQ5A 1ILYA 4Q0BA 4GNIA 5B8HA 1EXQA 4ELVA 3NF6A 5JMVA 4CJ3A 5EVZA 4J2BA 4FOIA 3G4SN 4K42A 4Z4FA 4JI5K 3SAHA 4JYAK 3VEWA 4RW7A 2KFZA 1NGAA 2YHBA 3EZWA 2DFEA 2DY4A 1RT4A 4CJSA 5AQKA 1JCGA 4BG8A 3KK3A 4HUFA 3CMEN 1KFSA 4CECA 4IOXA 4ZTJA 4FWNA 3K5LA 4GKJK 4FLWA 4OO1J 1U2VA 3H1VX 4FJJA 3MEEA 3P5JA 4LSNA 4W5RA 5BN8A 2IOCA 3ID8A 2QK9A 2RPIA 4ILHA 3VESA 3V9XA 3HOSA 4B1UB 3CJAA 3CCMN 4XH5A 1HNZK 3KWGA 2A5XA 4IO9L 4MLHA 3HT3A 3G10A 4FPBA 2W40A 3MX5A 4I9LA 2HBMA 4CJ7A 4PHTX 2E2PA 4HWIA 3R8EA 4L8RB 1QHTA 4I2PA 3OYCA 3LDPA 3CCUN 2O8FA 2XRIA 3TWHA 1V4TA 3DLGA 3MEDA 3OYKA 3IKMA 4CFDA 2UYTA 4BC2A 1F21A 2E4LA 4DFKA 2YKMA 1X3MA 1MU2A 4XIUA 3OS1A 1JLBA 3L2UA 3MMVA 4KI6A 2IVPA 4CJPA 1J5OA 2VQEK 4CD1A 4M45A 4R79A 4KV8A 3TARA 5BREA 1EP4A 2Q3SA 5ADXH 3ZSZA 5E84A 3FFKB 5KGWA 4K8ZA 3I56N 5C2FA 3PY8A 2FBXA 5C15A 3O80A 1T6CA 4YOTA 3PO4A 1ZYQA 3DOKA 4WQ4C 3J7ZO 4WF9L 5LMNK 2D0BA 5AFUA 3I0SA 4FZZA 3ZX2A 5CHIA 4DQQA 4JI0K 1Q9XA 2IVOA 4FK0A 1I94K 3IRXA 1IKVA 5AQPA 5HRSA 3PV8A 2PZSA 3CETA 3RR7A 3CCRN 3V9ZA 5C42A 1S9GA 1EWQA 1D8YA 2YJEA 4CK1A 1RT7A 3LDSA 4RWTA 4KI4A 5HRRA 3AY9A 4FW2A 5CYQA 3VGKA 2ZGYA 4AM7A 1TKZA 2YHXA 2GX9A 1IG9A 1LV5A 4AF1A 1Q81O 1QQNA 3THWA 3OYFA 3MAQA 5AQMA 4C1NI 2QWMA 3OVNA 3ZSQA 3RSEB 2F96A 4C8MA 2E6MA 1KXPA 3LZJA 1WOQA 4JHDA 1HUXA 3K57A 5JLHA 5KPZA 5M1QA 4QAGA 4BR7A 3D0PA 5KRSA 1JL2A 4F3OA 3ZEUA 2FSJA 5C24A 4BDZA 3CFOA 4GV3A 3IAYA 2V52B 3LDLA 4DHYA 2P9PA 4A2BA 3VEXA 3MDQA 5KGXA 3QETA 3D2FA 5AQNA 4LY7A 2YHAA 3VTIA 4IOAL 4KRFA 1NOYA 3QFUA 3ATVA 1TUUA 4NCAA 4BY9C 1JL1A 1ATRA 3CCQN 4Y1DA 3SQ0A 1VQMN 3RMAA 1J6ZA 2IVNA 1HNVA 3ULEB 4CEAA 3ZYYX 1NJXA 2Q31A 2RE2A 3DRRA 3RRHA 3MWPA 3PX0A 1SL2A 1VSMA 3ZSVA 4DV5K 3HVRA 1T03A 2P9SA 1ZBIA 3F5TA 4JAXA 1E4FT 4BWMA 4CD3A 1MDUB 4MO5A 4FM2A 1CLQA 5FLXO 4DV1K 2Z1IA 2VG6A 1H1VA 1HRHA 2NLXA 1SQKA 3PIOL 2ASPA 4KHSA 1Z6RA 4HCCA 2PFUA 1NMDA 3RTVA 3MXIA 2IDOA 3QEXA 1VQON 4CK3A 3U3GA 3S3NA 3LAKA 4Z4GA 2QWRA 2Y1JA 3LPUA 2CH6A 4JKDA 1EO1A 3OYGA 3DXMB 4EZ6A 1Y64A 1HJRA 4M3ZA 3O3GA 4CI6A 1BA0A 3F2KA 1UWBA 4CGDA 2RN2A 1RCHA 4IG0A 1HPMA 2P51A 4AHCA 3IG1A 4BRQA 4BC3A
chains in the Genus database with same CATH topology
2VWJA 4M3RA 2Y1IA 1C0UA 3VQ6A 1IO2A 3TAPA 3K5MA 1BI4B 5C25A 4M3UA 1RBSA 1SKRA 4E7HA 2HW3A 1BIUA 2IGIA 3NGYA 5E41A 4DU3A 3QEWA 5I42A 5DK5A 3O4QA 4Z0UA 3RMCA 4CGIA 3HK2A 3ISNC 4OKEA 2EHGA 4CHNA 4DSFA 4W5QA 1SKSA 3NH2A 4CEEA 1FKPA 3QESA 5HBMA 2LSNA 1GOAA 4CGGA 2IC3A 2Z1HA 1HYVA 3DLRA 4E7LA 2NUBA 3AVKA 1WN7A 3QEIA 4IBNA 4DLGA 5J2QA 4CEZA 3VQ7A 4W5OA 4BACA 3KD1E 4KPYA 4O0IA 1LW2A 1WSIA 5DMRA 4RW8A 3CG7A 3HPHA 2GUIA 2G8VA 3ZT4A 3HVTA 3NBPA 4IFVA 4TSXA 1L3UA 1WSGA 4KHNA 1S1WA 1X1PA 3DLBA 1K6YA 4FLZA 4M3WA 3NDKA 4PUOA 1T8EA 4FJNA 1D5AA 5KI6A 3KK2A 4KHQA 3A2FA 1KLMA 3M8PA 2HNDA 1U4BA 3RR8A 2QXFA 2I5JA 4FXDA 3MXJA 3NF7A 4LH4A 4AHSA 1ASWA 4M42A 5FRMA 1S1VA 4O4GA 1VSKA 1UA1A 3V1OA 2IS3A 3LZIA 1XI1A 1EKEA 3QIOA 4ELTA 3KK1A 3SPZA 4OLAA 3VQPA 2X74A 3HSTB 4Q5VA 1VSDA 3VQAA 3K5NA 3SV3A 3TANA 4CHQA 4E7IA 2KTQA 3PX6A 1S1UA 4E7JA 4K8XA 4CF1A 1ASVA 3I8DA 2GBZA 2EX3A 4GW6A 1L3VA 3NE6A 3OYJA 4CEQA 3B6PA 1LAVA 1HMVA 4CESA 2X6SA 1LWCA 4CIEA 4FJLA 1KTQA 2BDPA 1JLGA 3B6OA 3DRSA 4O44A 1J9AA 3IS9A 2OA8A 1WSEA 2OPPA 4ICLA 3SZ2A 3SCXA 1S9EA 3JYTA 3BGRA 1RT1A 4CJ5A 4CK2A 3HM9A 1R0AA 1EX4A 4BDYA 3E01A 1QSYA 3HP6A 4FCYA 4M3XA 3VQ8A 4FJIA 4CCHA 3V9UA 5CZ1A 3K2PA 1QQCA 5CY4A 4E19A 4CERA 3OJUA 4JRPA 4DTMA 1JKHA 3G0ZA 1WAJA 1KVCA 4KTWA 3QO9A 1BISA 2OZMA 3NH0A 4CGHA 3KIOA 4E7KA 3UIQA 1S6QA 3L2QA 5CZ2A 3VQQA 3ZT0A 2R7YA 3L2VA 1VK0A 2OZSA 2XY8A 3AA4A 1NK9A 4Z4EA 4Z4CA 3S3MA 1CXUA 2G8UA 4YNQA 2YNIA 1TL3A 3QINA 1D9FA 1BCOA 1RTHA 4KHUA 2BE2A 1U04A 1TKXA 1RDCA 1QE1A 4M41A 3V1QA 1NJWA 4DQIA 3VQ9A 1RDDA 2FC0A 4QCLA 5SWMA 2DFFA 3SV4A 4CE9A 3TAEA 4ZTFA 1UA0A 4GMJB 4DQRA 4M3YA 3QEVA 1NJZA 3SI6A 3JSMA 4JRQA 1G15A 3V1RA 3LP0A 4KTZA 2XHBA 1A5VA 3ZSRA 4CIFA 4FVMA 1WAFA 4IFYA 4EP4A 4OPJA 4KTQA 4BWJA 1HPZA 2IAJA 3NFAA 4CJRA 5I3UA 3K5OA 4DMNA 4OVLA 3HPOA 4CJVA 4EZ9A 1QTMA 3TR8A 3OYAA 1VRTA 4HVJA 4DSIA 2GV9A 2QKBA 4FJ8A 1HQEA 2OPQA 1XWLA 1VSEA 4DTRA 5J2PA 2ETJA 3MEGA 4CGJA 4DFMA 4LH5A 4DTPA 4GVMA 2OYQA 4FJ5A 3VQEA 4OPKA 5EU7A 3QEPA 4F3TA 3LP1A 1BQMA 3RRGA 2P5GA 3CFPA 4AH9A 1QSLA 1TK5A 3PX4A 1VSFA 4B08A 1VSIA 1RBVA 1FXXA 3C94A 1LW0A 2O4IA 2KQ2A 2ATQA 2D0AA 2ZD1A 1DLOA 3VN5A 4CFBA 3KLEA 1NKCA 1HYZA 3L3VA 4DTSA 1TAQA 1TK8A 3ULDA 2VG7A 3PUFA 1O1WA 1SL1A 3LP3A 3AVHA 4O55A 2HHQA 3SQ1A 4N76A 4FM1A 3ZSXA 3AVLA 1KFDA 3ITHA 4IKFA 3C6TA 3HL8A 1DTTA 3P83D 4CEOA 5T7BA 3OYHA 2G8FA 3AO2A 3CYMA 4BE2A 1NK0A 4CIGA 4E1MA 3AVNA 2XO7A 3KD5E 2YNGA 2WOMA 1ITGA 5KRTA 4PWDA 1GOCA 4O5BA 4OJRA 4FLVA 3SQ2A 3DM2A 4N56A 1U49A 1ZBUA 3RMDA 2YNFA 1TV6A 4MFBA 3HYFA 4H4OA 1KLNA 4DQPA 4KHWA 4FJKA 1YTUA 1SL0A 4FK0A 3V6DA 4J2EA 4FW1A 4OLBA 3OYEA 4OKJA 4DF8A 4DFPA 4DF4A 1N6QA 2ZE2A 1Q9YA 4RW9A 4HUGA 1RDAA 4DG1A 1W0HA 4FJHA 1RT2A 2JLEA 4DS4A 4C8LA 3NF9A 1NK8A 4FZXC 4FJ7A 4HTUA 3T1AA 3AVGA 4Q0BA 3M8SA 4FLXA 3WNFA 1IKXA 1EXQA 1LWEA 3DI6A 3DOLA 1B9FA 4JS4A 3WNEA 1TKDA 1I3AA 3NF6A 4UQGA 4ELVA 1VSJA 4LD0A 4CJ3A 3OS0A 4NYFA 1JLCA 2F8SA 4HCBA 4J2BA 3KKSA 4CJ4A 1X9MA 1BGXT 1TL1A 2XY5A 1VRUA 1BHLA 3AVCA 4CGFA 3THVA 3TAMA 2P1JA 4FM0A 3AA2A 3S3OA 1NJYA 4Z4FA 4N41A 4RW7A 3LAMA 5J2MA 3TAFA 2YHBA 1LAWA 2KFZA 2DFEA 2HNZA 2DY4A 5FROA 1HNIA 1RT4A 1NKEA 1TAUA 4CJSA 3KK3A 4HUFA 4OGEA 3V81A 1T7PA 1T05A 3MXMA 3O4NA 1KFSA 4CECA 3CM5A 1RTJA 4JS5A 3VQDA 4ZTJA 1ZBFA 4HUEA 3K5LA 4NCBA 4FLWA 2VWKA 1A5WA 2HHWA 4CHPA 4FJJA 4FJMA 4F2SA 2KW4A 1J53A 1S1XA 1TGOA 3MEEA 3P5JA 3C95A 4ID1A 4LSNA 4EP5A 4W5RA 4KB0A 2B4JA 2PYLA 1SV5A 2IOCA 1U47A 2G8WA 1N5YA 2RPIA 2QK9A 5FDLA 4E0DA 3V9XA 1ZBHA 3AVIA 4E89A 1GOBA 2HHSA 3LALA 3T3FA 1RNHA 4KB1A 3SUPA 4FJGA 4OGCA 4DSJA 2D0CA 2BGGA 3U3YA 1SKWA 4AILC 3HT3A 4CF0A 3G10A 4CFCA 4PQUA 1U45A 2JGUA 1C0TA 1DTQA 1JXEA 3HP9A 1C1BA 4I9LA 3WNHA 3AO3A 1IKYA 5D3GA 2G8IA 4NCGA 2AJQA 3OJSA 5HRNA 4CHYA 1KSPA 4L8RB 4KHYA 3OYDA 1QHTA 4I2PA 4WE1A 3O3FA 3OYCA 2XRIA 3TWHA 4KAZA 3DLGA 2DFHA 3MEDA 3OYKA 4FJ9A 3ALYA 4CFDA 1XHZA 2HHTA 4RW4A 3KLIA 1F21A 2E4LA 3LANA 4AHVA 2YKMA 3OYMA 1MU2A 1RT5A 4DFKA 3QNNA 5JS1A 1BI4A 4XIUA 2RF2A 2A1RA 4FK4A 3OS1A 1JLBA 3L2UA 4C8NA 2B5JA 4KI6A 4FYDA 4CEDA 4CJPA 3AO5A 1J5OA 4Z4IA 4LSLA 1W9HA 3DRPA 4M45A 4KV8A 3AVBA 1X9WA 3DLHA 3TARA 3LP2A 4O0JA 1NK7A 3HJFA 3AVFA 5HRPA 3KTQA 2Z1GA 1EP4A 2Q3SA 4G1QA 3TABA 3ZSZA 1L3TA 3NGIA 2HB5A 1I39A 5KGWA 3AA3A 4CJEA 4DLEA 4E3SA 1S5JA 3SQ4A 3HPGA 4K8ZA 2FBVA 3SUQA 4DTNA 3VA0A 3PY8A 2FBXA 3K58A 4DSEA 3RWUA 3PO4A 4DU1A 3DOKA 4QOZB 1J54A 1D9DA 4KREA 1JLAA 1WNSA 3T19A 3V4IA 4N5SA 4DTJA 1KRPA 2E6LA 2B6AA 2YV0X 3NCIA 2D0BA 3OYNA 4ELUA 1C1AA 3I0SA 1U48A 1ZBLA 4CJLA 1ASUA 4FZZA 3F9KA 4H8KA 2YNHA 1KVAA 4CJWA 3VQ4A 4DQQA 4IDKA 1Q9XA 4J2DA 2W42A 3PO5A 3L2WA 3KLGA 1BIZA 1JLFA 1IKVA 1Z26A 3IRXA 3M8QA 3KLHA 1TKTA 5CYMA 4CEFA 3VQ5A 4CJQA 3AO4A 5HRSA 3PV8A 5K14A 2PZSA 3OYBA 3RR7A 4DS5A 3V9ZA 3AVJA 5C42A 1RBRA 1S9GA 2ITGA 1D8YA 3DLKA 4DWIA 4B9NA 4I7FA 4CK1A 1RT7A 1LWFA 1KVBA 3LDSA 4C8OA 4KI4A 4N47A 5HRRA 4KFBA 4FW2A 5CYQA 4CFAA 3MECA 3QERA 4CHOA 4RG8A 1UOCA 1JLQA 3WNGA 4H4MA 1TKZA 4DSLA 4CHZA 5HP1A 4CEBA 4B9SA 1XC9A 1BL3A 4DQSA 1RTIA 4FLUA 1IG9A 1QS4A 2G8HA 2QKKA 1NK6A 1LV5A 2X6NA 1X9SA 1RILA 4CJUA 1RTDA 4M3TA 3V9WA 4YFUA 1QSSA 4B3OA 1YTAA 3OYFA 3MAQA 1FKOA 4E1NA 4FZYA 2HVHA 4R5PA 1HQUA 3OVNA 4FLYA 1L5UA 3QIPA 4J2AA 3ZSQA 3SUOA 3AVAA 3TI0A 3V9SA 3ZSYA 2F96A 4CJKA 4C8MA 2E6MA 3LZJA 2HHUA 3S9HA 5HLFA 3K57A 3C6UA 3CFRA 4B9LA 1CZ9A 1S1TA 3OS2A 1NK5A 4QAGA 3D0PA 4DTUA 2HNYA 4B9TA 3LPTA 5KRSA 4PY5A 1JL2A 1WSHA 4F3OA 1L3SA 1JXBA 3NHGA 1Q8IA 3CM6A 3KJVA 3SYZA 2KZZA 1IH7A 2KZMA 1NKBA 4B8CA 3DLEA 3VQCA 5C24A 5HROA 3LWMA 3OY9A 2BANA 4BDZA 3CFOA 3CQ8A 3QLHA 3L2RA 3RMBA 2G8KA 1B92A 3IAYA 4OKKA 1KCFA 4ZHRA 3ZSOA 3EZ5A 1XHXA 1YVUA 2HVIA 5KGXA 1Z25A 2WONA 1IKWA 1RBUA 3QETA 2OPSA 3F73A 2YKNA 4LY7A 3ZT2A 2YHAA 3M8RA 4KRFA 2PY5A 3DYAA 1NOYA 3NH1A 4NCAA 3SUNA 1JL1A 4I9QA 1Y97A 2D5RA 2F8TA 2P5OA 2O4GA 3P1GA 3ZT1A 4Y1DA 3SQ0A 4F4KA 4Z4HA 3RMAA 4DFJA 1HNVA 2OPRA 4CEAA 4FLTA 3QNOA 1NJXA 4B9VA 2KFNA 3DRRA 3ZCMA 3RRHA 1C0MA 4RW6A 3K59A 3PX0A 1HYSA 1RT6A 5KTQA 4DSKA 1EETA 1SL2A 1VSMA 3ZSVA 1NOZA 3H08A 4B9MA 2HHVA 1C6VA 3ZSWA 1RBTA 4FK2A 3HVRA 2DTUA 1NK4A 2XY7A 1T03A 1SUQA 3AO1A 3NGZA 2X78A 3SPYA 4AHRA 1A5XA 4PA1A 1ZBIA 1S6PA 3OYLA 4HHTA 4BE1A 4BWMA 2FBYA 4DTXA 3FFIA 3D45A 4CF8A 4BE0A 3NF8A 3HO1A 4I2QA 3EY1A 4BDPA 1VSLA 1CLQA 4FM2A 1WSJA 4ID5A 3U6FA 2Z1IA 2VG6A 3SJJA 3AA5X 3DMJA 1C1CA 3OYIA 3TAGA 4AHUA 1HRHA 2PYJA 3L3UA 3VA3A 2A1SA 1BCMA 1BQNA 1UAXA 3KKRA 5J2NA 1FK9A 4F2RA 4F8RA 4B8AB 3LWLA 3L8BA 4KHSA 2HHXA 4HCCA 4KO0A 3HXMA 4W5TA 3RTVA 3MXIA 2IDOA 3AVMA 2HMIA 3QEXA 3ASMA 3O3HA 4CK3A 4B9UA 3EYZA 4CF2A 4CJTA 4Y1CA 2RKIA 3U3GA 1WLJA 1RDBA 1REVA 3LAKA 5J1EA 3S3NA 3I0RA 2FBTA 4AHTA 4Z4GA 2Y1JA 2ZQBA 3LPUA 2XY6A 1YT3A 3OYGA 4FJXA 4JLHA 4CJFA 4NYNA 4EZ6A 1RT3A 2VG5A 1HJRA 4M3ZA 1TK0A 3ZT3A 3BDPA 1WSFA 3O3GA 5FRNA 1UWBA 4DTOA 4C8KA 4CGDA 2RN2A 3NAEA 4DU4A 2Z1JA 4IG3A 1B9DA 1RCHA 4IG0A 3TAQA 1TVRA 3AV9A 5SZTA 5JS2A 3KLFA 3SNNA 4W5NA 1CZBA 2P51A 4KKOA 3VQBA 4CF9A 4MQ3A 4AHCA 3IG1A 1VSHA 1CXQA 1JLEA 1ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWJ A;  4M3R A;  2Y1I A;  1C0U A;  3VQ6 A;  1IO2 A;  3TAP A;  3K5M A;  1BI4 B;  5C25 A;  4M3U A;  1RBS A;  1SKR A;  4E7H A;  2HW3 A;  1BIU A;  2IGI A;  3NGY A;  5E41 A;  4DU3 A;  3QEW A;  5I42 A;  5DK5 A;  3O4Q A;  4Z0U A;  3RMC A;  4CGI A;  3HK2 A;  3ISN C;  4OKE A;  2EHG A;  4CHN A;  4DSF A;  4W5Q A;  1SKS A;  3NH2 A;  4CEE A;  1FKP A;  3QES A;  5HBM A;  2LSN A;  1GOA A;  4CGG A;  2IC3 A;  2Z1H A;  1HYV A;  3DLR A;  4E7L A;  2NUB A;  3AVK A;  1WN7 A;  3QEI A;  4IBN A;  4DLG A;  5J2Q A;  4CEZ A;  3VQ7 A;  4W5O A;  4BAC A;  3KD1 E;  4KPY A;  4O0I A;  1LW2 A;  1WSI A;  5DMR A;  4RW8 A;  3CG7 A;  3HPH A;  2GUI A;  2G8V A;  3ZT4 A;  3HVT A;  3NBP A;  4IFV A;  4TSX A;  1L3U A;  1WSG A;  4KHN A;  1S1W A;  1X1P A;  3DLB A;  1K6Y A;  4FLZ A;  4M3W A;  3NDK A;  4PUO A;  1T8E A;  4FJN A;  1D5A A;  5KI6 A;  3KK2 A;  4KHQ A;  3A2F A;  1KLM A;  3M8P A;  2HND A;  1U4B A;  3RR8 A;  2QXF A;  2I5J A;  4FXD A;  3MXJ A;  3NF7 A;  4LH4 A;  4AHS A;  1ASW A;  4M42 A;  5FRM A;  1S1V A;  4O4G A;  1VSK A;  1UA1 A;  3V1O A;  2IS3 A;  3LZI A;  1XI1 A;  1EKE A;  3QIO A;  4ELT A;  3KK1 A;  3SPZ A;  4OLA A;  3VQP A;  2X74 A;  3HST B;  4Q5V A;  1VSD A;  3VQA A;  3K5N A;  3SV3 A;  3TAN A;  4CHQ A;  4E7I A;  2KTQ A;  3PX6 A;  1S1U A;  4E7J A;  4K8X A;  4CF1 A;  1ASV A;  3I8D A;  2GBZ A;  2EX3 A;  4GW6 A;  1L3V A;  3NE6 A;  3OYJ A;  4CEQ A;  3B6P A;  1LAV A;  1HMV A;  4CES A;  2X6S A;  1LWC A;  4CIE A;  4FJL A;  1KTQ A;  2BDP A;  1JLG A;  3B6O A;  3DRS A;  4O44 A;  1J9A A;  3IS9 A;  2OA8 A;  1WSE A;  2OPP A;  4ICL A;  3SZ2 A;  3SCX A;  1S9E A;  3JYT A;  3BGR A;  1RT1 A;  4CJ5 A;  4CK2 A;  3HM9 A;  1R0A A;  1EX4 A;  4BDY A;  3E01 A;  1QSY A;  3HP6 A;  4FCY A;  4M3X A;  3VQ8 A;  4FJI A;  4CCH A;  3V9U A;  5CZ1 A;  3K2P A;  1QQC A;  5CY4 A;  4E19 A;  4CER A;  3OJU A;  4JRP A;  4DTM A;  1JKH A;  3G0Z A;  1WAJ A;  1KVC A;  4KTW A;  3QO9 A;  1BIS A;  2OZM A;  3NH0 A;  4CGH A;  3KIO A;  4E7K A;  3UIQ A;  1S6Q A;  3L2Q A;  5CZ2 A;  3VQQ A;  3ZT0 A;  2R7Y A;  3L2V A;  1VK0 A;  2OZS A;  2XY8 A;  3AA4 A;  1NK9 A;  4Z4E A;  4Z4C A;  3S3M A;  1CXU A;  2G8U A;  4YNQ A;  2YNI A;  1TL3 A;  3QIN A;  1D9F A;  1BCO A;  1RTH A;  4KHU A;  2BE2 A;  1U04 A;  1TKX A;  1RDC A;  1QE1 A;  4M41 A;  3V1Q A;  1NJW A;  4DQI A;  3VQ9 A;  1RDD A;  2FC0 A;  4QCL A;  5SWM A;  2DFF A;  3SV4 A;  4CE9 A;  3TAE A;  4ZTF A;  1UA0 A;  4GMJ B;  4DQR A;  4M3Y A;  3QEV A;  1NJZ A;  3SI6 A;  3JSM A;  4JRQ A;  1G15 A;  3V1R A;  3LP0 A;  4KTZ A;  2XHB A;  1A5V A;  3ZSR A;  4CIF A;  4FVM A;  1WAF A;  4IFY A;  4EP4 A;  4OPJ A;  4KTQ A;  4BWJ A;  1HPZ A;  2IAJ A;  3NFA A;  4CJR A;  5I3U A;  3K5O A;  4DMN A;  4OVL A;  3HPO A;  4CJV A;  4EZ9 A;  1QTM A;  3TR8 A;  3OYA A;  1VRT A;  4HVJ A;  4DSI A;  2GV9 A;  2QKB A;  4FJ8 A;  1HQE A;  2OPQ A;  1XWL A;  1VSE A;  4DTR A;  5J2P A;  2ETJ A;  3MEG A;  4CGJ A;  4DFM A;  4LH5 A;  4DTP A;  4GVM A;  2OYQ A;  4FJ5 A;  3VQE A;  4OPK A;  5EU7 A;  3QEP A;  4F3T A;  3LP1 A;  1BQM A;  3RRG A;  2P5G A;  3CFP A;  4AH9 A;  1QSL A;  1TK5 A;  3PX4 A;  1VSF A;  4B08 A;  1VSI A;  1RBV A;  1FXX A;  3C94 A;  1LW0 A;  2O4I A;  2KQ2 A;  2ATQ A;  2D0A A;  2ZD1 A;  1DLO A;  3VN5 A;  4CFB A;  3KLE A;  1NKC A;  1HYZ A;  3L3V A;  4DTS A;  1TAQ A;  1TK8 A;  3ULD A;  2VG7 A;  3PUF A;  1O1W A;  1SL1 A;  3LP3 A;  3AVH A;  4O55 A;  2HHQ A;  3SQ1 A;  4N76 A;  4FM1 A;  3ZSX A;  3AVL A;  1KFD A;  3ITH A;  4IKF A;  3C6T A;  3HL8 A;  1DTT A;  3P83 D;  4CEO A;  5T7B A;  3OYH A;  2G8F A;  3AO2 A;  3CYM A;  4BE2 A;  1NK0 A;  4CIG A;  4E1M A;  3AVN A;  2XO7 A;  3KD5 E;  2YNG A;  2WOM A;  1ITG A;  5KRT A;  4PWD A;  1GOC A;  4O5B A;  4OJR A;  4FLV A;  3SQ2 A;  3DM2 A;  4N56 A;  1U49 A;  1ZBU A;  3RMD A;  2YNF A;  1TV6 A;  4MFB A;  3HYF A;  4H4O A;  1KLN A;  4DQP A;  4KHW A;  4FJK A;  1YTU A;  1SL0 A;  4FK0 A;  3V6D A;  4J2E A;  4FW1 A;  4OLB A;  3OYE A;  4OKJ A;  4DF8 A;  4DFP A;  4DF4 A;  1N6Q A;  2ZE2 A;  1Q9Y A;  4RW9 A;  4HUG A;  1RDA A;  4DG1 A;  1W0H A;  4FJH A;  1RT2 A;  2JLE A;  4DS4 A;  4C8L A;  3NF9 A;  1NK8 A;  4FZX C;  4FJ7 A;  4HTU A;  3T1A A;  3AVG A;  4Q0B A;  3M8S A;  4FLX A;  3WNF A;  1IKX A;  1EXQ A;  1LWE A;  3DI6 A;  3DOL A;  1B9F A;  4JS4 A;  3WNE A;  1TKD A;  1I3A A;  3NF6 A;  4UQG A;  4ELV A;  1VSJ A;  4LD0 A;  4CJ3 A;  3OS0 A;  4NYF A;  1JLC A;  2F8S A;  4HCB A;  4J2B A;  3KKS A;  4CJ4 A;  1X9M A;  1BGX T;  1TL1 A;  2XY5 A;  1VRU A;  1BHL A;  3AVC A;  4CGF A;  3THV A;  3TAM A;  2P1J A;  4FM0 A;  3AA2 A;  3S3O A;  1NJY A;  4Z4F A;  4N41 A;  4RW7 A;  3LAM A;  5J2M A;  3TAF A;  2YHB A;  1LAW A;  2KFZ A;  2DFE A;  2HNZ A;  2DY4 A;  5FRO A;  1HNI A;  1RT4 A;  1NKE A;  1TAU A;  4CJS A;  3KK3 A;  4HUF A;  4OGE A;  3V81 A;  1T7P A;  1T05 A;  3MXM A;  3O4N A;  1KFS A;  4CEC A;  3CM5 A;  1RTJ A;  4JS5 A;  3VQD A;  4ZTJ A;  1ZBF A;  4HUE A;  3K5L A;  4NCB A;  4FLW A;  2VWK A;  1A5W A;  2HHW A;  4CHP A;  4FJJ A;  4FJM A;  4F2S A;  2KW4 A;  1J53 A;  1S1X A;  1TGO A;  3MEE A;  3P5J A;  3C95 A;  4ID1 A;  4LSN A;  4EP5 A;  4W5R A;  4KB0 A;  2B4J A;  2PYL A;  1SV5 A;  2IOC A;  1U47 A;  2G8W A;  1N5Y A;  2RPI A;  2QK9 A;  5FDL A;  4E0D A;  3V9X A;  1ZBH A;  3AVI A;  4E89 A;  1GOB A;  2HHS A;  3LAL A;  3T3F A;  1RNH A;  4KB1 A;  3SUP A;  4FJG A;  4OGC A;  4DSJ A;  2D0C A;  2BGG A;  3U3Y A;  1SKW A;  4AIL C;  3HT3 A;  4CF0 A;  3G10 A;  4CFC A;  4PQU A;  1U45 A;  2JGU A;  1C0T A;  1DTQ A;  1JXE A;  3HP9 A;  1C1B A;  4I9L A;  3WNH A;  3AO3 A;  1IKY A;  5D3G A;  2G8I A;  4NCG A;  2AJQ A;  3OJS A;  5HRN A;  4CHY A;  1KSP A;  4L8R B;  4KHY A;  3OYD A;  1QHT A;  4I2P A;  4WE1 A;  3O3F A;  3OYC A;  2XRI A;  3TWH A;  4KAZ A;  3DLG A;  2DFH A;  3MED A;  3OYK A;  4FJ9 A;  3ALY A;  4CFD A;  1XHZ A;  2HHT A;  4RW4 A;  3KLI A;  1F21 A;  2E4L A;  3LAN A;  4AHV A;  2YKM A;  3OYM A;  1MU2 A;  1RT5 A;  4DFK A;  3QNN A;  5JS1 A;  1BI4 A;  4XIU A;  2RF2 A;  2A1R A;  4FK4 A;  3OS1 A;  1JLB A;  3L2U A;  4C8N A;  2B5J A;  4KI6 A;  4FYD A;  4CED A;  4CJP A;  3AO5 A;  1J5O A;  4Z4I A;  4LSL A;  1W9H A;  3DRP A;  4M45 A;  4KV8 A;  3AVB A;  1X9W A;  3DLH A;  3TAR A;  3LP2 A;  4O0J A;  1NK7 A;  3HJF A;  3AVF A;  5HRP A;  3KTQ A;  2Z1G A;  1EP4 A;  2Q3S A;  4G1Q A;  3TAB A;  3ZSZ A;  1L3T A;  3NGI A;  2HB5 A;  1I39 A;  5KGW A;  3AA3 A;  4CJE A;  4DLE A;  4E3S A;  1S5J A;  3SQ4 A;  3HPG A;  4K8Z A;  2FBV A;  3SUQ A;  4DTN A;  3VA0 A;  3PY8 A;  2FBX A;  3K58 A;  4DSE A;  3RWU A;  3PO4 A;  4DU1 A;  3DOK A;  4QOZ B;  1J54 A;  1D9D A;  4KRE A;  1JLA A;  1WNS A;  3T19 A;  3V4I A;  4N5S A;  4DTJ A;  1KRP A;  2E6L A;  2B6A A;  2YV0 X;  3NCI A;  2D0B A;  3OYN A;  4ELU A;  1C1A A;  3I0S A;  1U48 A;  1ZBL A;  4CJL A;  1ASU A;  4FZZ A;  3F9K A;  4H8K A;  2YNH A;  1KVA A;  4CJW A;  3VQ4 A;  4DQQ A;  4IDK A;  1Q9X A;  4J2D A;  2W42 A;  3PO5 A;  3L2W A;  3KLG A;  1BIZ A;  1JLF A;  1IKV A;  1Z26 A;  3IRX A;  3M8Q A;  3KLH A;  1TKT A;  5CYM A;  4CEF A;  3VQ5 A;  4CJQ A;  3AO4 A;  5HRS A;  3PV8 A;  5K14 A;  2PZS A;  3OYB A;  3RR7 A;  4DS5 A;  3V9Z A;  3AVJ A;  5C42 A;  1RBR A;  1S9G A;  2ITG A;  1D8Y A;  3DLK A;  4DWI A;  4B9N A;  4I7F A;  4CK1 A;  1RT7 A;  1LWF A;  1KVB A;  3LDS A;  4C8O A;  4KI4 A;  4N47 A;  5HRR A;  4KFB A;  4FW2 A;  5CYQ A;  4CFA A;  3MEC A;  3QER A;  4CHO A;  4RG8 A;  1UOC A;  1JLQ A;  3WNG A;  4H4M A;  1TKZ A;  4DSL A;  4CHZ A;  5HP1 A;  4CEB A;  4B9S A;  1XC9 A;  1BL3 A;  4DQS A;  1RTI A;  4FLU A;  1IG9 A;  1QS4 A;  2G8H A;  2QKK A;  1NK6 A;  1LV5 A;  2X6N A;  1X9S A;  1RIL A;  4CJU A;  1RTD A;  4M3T A;  3V9W A;  4YFU A;  1QSS A;  4B3O A;  1YTA A;  3OYF A;  3MAQ A;  1FKO A;  4E1N A;  4FZY A;  2HVH A;  4R5P A;  1HQU A;  3OVN A;  4FLY A;  1L5U A;  3QIP A;  4J2A A;  3ZSQ A;  3SUO A;  3AVA A;  3TI0 A;  3V9S A;  3ZSY A;  2F96 A;  4CJK A;  4C8M A;  2E6M A;  3LZJ A;  2HHU A;  3S9H A;  5HLF A;  3K57 A;  3C6U A;  3CFR A;  4B9L A;  1CZ9 A;  1S1T A;  3OS2 A;  1NK5 A;  4QAG A;  3D0P A;  4DTU A;  2HNY A;  4B9T A;  3LPT A;  5KRS A;  4PY5 A;  1JL2 A;  1WSH A;  4F3O A;  1L3S A;  1JXB A;  3NHG A;  1Q8I A;  3CM6 A;  3KJV A;  3SYZ A;  2KZZ A;  1IH7 A;  2KZM A;  1NKB A;  4B8C A;  3DLE A;  3VQC A;  5C24 A;  5HRO A;  3LWM A;  3OY9 A;  2BAN A;  4BDZ A;  3CFO A;  3CQ8 A;  3QLH A;  3L2R A;  3RMB A;  2G8K A;  1B92 A;  3IAY A;  4OKK A;  1KCF A;  4ZHR A;  3ZSO A;  3EZ5 A;  1XHX A;  1YVU A;  2HVI A;  5KGX A;  1Z25 A;  2WON A;  1IKW A;  1RBU A;  3QET A;  2OPS A;  3F73 A;  2YKN A;  4LY7 A;  3ZT2 A;  2YHA A;  3M8R A;  4KRF A;  2PY5 A;  3DYA A;  1NOY A;  3NH1 A;  4NCA A;  3SUN A;  1JL1 A;  4I9Q A;  1Y97 A;  2D5R A;  2F8T A;  2P5O A;  2O4G A;  3P1G A;  3ZT1 A;  4Y1D A;  3SQ0 A;  4F4K A;  4Z4H A;  3RMA A;  4DFJ A;  1HNV A;  2OPR A;  4CEA A;  4FLT A;  3QNO A;  1NJX A;  4B9V A;  2KFN A;  3DRR A;  3ZCM A;  3RRH A;  1C0M A;  4RW6 A;  3K59 A;  3PX0 A;  1HYS A;  1RT6 A;  5KTQ A;  4DSK A;  1EET A;  1SL2 A;  1VSM A;  3ZSV A;  1NOZ A;  3H08 A;  4B9M A;  2HHV A;  1C6V A;  3ZSW A;  1RBT A;  4FK2 A;  3HVR A;  2DTU A;  1NK4 A;  2XY7 A;  1T03 A;  1SUQ A;  3AO1 A;  3NGZ A;  2X78 A;  3SPY A;  4AHR A;  1A5X A;  4PA1 A;  1ZBI A;  1S6P A;  3OYL A;  4HHT A;  4BE1 A;  4BWM A;  2FBY A;  4DTX A;  3FFI A;  3D45 A;  4CF8 A;  4BE0 A;  3NF8 A;  3HO1 A;  4I2Q A;  3EY1 A;  4BDP A;  1VSL A;  1CLQ A;  4FM2 A;  1WSJ A;  4ID5 A;  3U6F A;  2Z1I A;  2VG6 A;  3SJJ A;  3AA5 X;  3DMJ A;  1C1C A;  3OYI A;  3TAG A;  4AHU A;  1HRH A;  2PYJ A;  3L3U A;  3VA3 A;  2A1S A;  1BCM A;  1BQN A;  1UAX A;  3KKR A;  5J2N A;  1FK9 A;  4F2R A;  4F8R A;  4B8A B;  3LWL A;  3L8B A;  4KHS A;  2HHX A;  4HCC A;  4KO0 A;  3HXM A;  4W5T A;  3RTV A;  3MXI A;  2IDO A;  3AVM A;  2HMI A;  3QEX A;  3ASM A;  3O3H A;  4CK3 A;  4B9U A;  3EYZ A;  4CF2 A;  4CJT A;  4Y1C A;  2RKI A;  3U3G A;  1WLJ A;  1RDB A;  1REV A;  3LAK A;  5J1E A;  3S3N A;  3I0R A;  2FBT A;  4AHT A;  4Z4G A;  2Y1J A;  2ZQB A;  3LPU A;  2XY6 A;  1YT3 A;  3OYG A;  4FJX A;  4JLH A;  4CJF A;  4NYN A;  4EZ6 A;  1RT3 A;  2VG5 A;  1HJR A;  4M3Z A;  1TK0 A;  3ZT3 A;  3BDP A;  1WSF A;  3O3G A;  5FRN A;  1UWB A;  4DTO A;  4C8K A;  4CGD A;  2RN2 A;  3NAE A;  4DU4 A;  2Z1J A;  4IG3 A;  1B9D A;  1RCH A;  4IG0 A;  3TAQ A;  1TVR A;  3AV9 A;  5SZT A;  5JS2 A;  3KLF A;  3SNN A;  4W5N A;  1CZB A;  2P51 A;  4KKO A;  3VQB A;  4CF9 A;  4MQ3 A;  4AHC A;  3IG1 A;  1VSH A;  1CXQ A;  1JLE A;  1ZYQ A; 
#chains in the Genus database with same CATH topology
 3CHW A;  2Y1I A;  4F9O A;  5AQW A;  3VQ6 A;  3K5M A;  5C25 A;  3SMP A;  1RBS A;  1BIU A;  1NLV A;  5AQU A;  4DU3 A;  4GV6 A;  5DK5 A;  5BRD A;  2FSK A;  3ISN C;  2EHG A;  1FKP A;  2P9N B;  5BPN A;  4CGG A;  3I8B A;  2IC3 A;  3QEI A;  3SLC A;  3VQ7 A;  3KD1 E;  1N33 K;  3TSP A;  2GUI A;  2HMP A;  3HM8 A;  4A59 A;  1L3U A;  1WSG A;  3LDN A;  1S1W A;  5TKW A;  1X1P A;  4I6M B;  4LFA K;  4CVN E;  1TYQ A;  4PUO A;  5CE3 A;  2H3G X;  1DT9 A;  4BRD A;  4YDU C;  1BDG A;  1KLM A;  3MXJ A;  4DV3 K;  2HBJ A;  1GLC G;  2IIR A;  3CCS N;  4DV2 K;  1UA1 A;  3CJ1 A;  3V1O A;  2QXL A;  5JVG L;  4ELT A;  3KK1 A;  4OLA A;  2X74 A;  1VSD A;  5BRH A;  3PLA A;  2Q0R A;  4CHQ A;  4E7I A;  3SAF A;  3L4Q A;  3SJH A;  1YXQ A;  3QB0 A;  4CEQ A;  3UKU B;  3B6P A;  1LWC A;  4FJL A;  1KTQ A;  1VQ5 N;  2OA8 A;  2OPP A;  1BOT O;  2WBN A;  1S9E A;  3HM9 A;  3OA9 A;  3EKS A;  1VQ7 N;  4M3X A;  1E3M A;  2AA4 A;  5CY4 A;  4E19 A;  3OJU A;  4JRP A;  2O8C B;  3UIQ A;  3CCJ N;  1S6Q A;  4IWV A;  5CZ2 A;  3VQQ A;  2R7Y A;  3H3N O;  2OZS A;  3AA4 A;  1NK9 A;  4Z4E A;  1CXU A;  3ZET B;  2G8U A;  4DV4 K;  4YNQ A;  2E2Q A;  1TL3 A;  3QIN A;  1D9F A;  4KHU A;  3U8X A;  1TKX A;  4DQI A;  2FC0 A;  5SWM A;  3W3D A;  3SV4 A;  3TAE A;  4BRM A;  4M3Y A;  1NJZ A;  2YX6 A;  4JRQ A;  4CZG A;  2XHB A;  3F9M A;  4CZF A;  1QVF M;  2O8E B;  3WXL A;  4EP4 A;  4DUZ K;  3NFA A;  4BRO A;  1QTM A;  1D4X A;  2A40 A;  2GV9 A;  3W0L A;  2OPQ A;  5J2P A;  2ETJ A;  3MEG A;  4CGJ A;  3QBX A;  4DTP A;  3K0S A;  4A57 A;  3RSE A;  1CZA N;  3CFP A;  4WCE L;  4NLB A;  4B1W B;  2KLA A;  1KC8 O;  4BRI A;  4ILG B;  1FXX A;  3T69 A;  2O4I A;  2ATQ A;  2D0A A;  4EIA A;  1VQL N;  1T44 A;  1O1W A;  3LP3 A;  3AVH A;  2VGN A;  1DTT A;  5T7B A;  1VHX A;  2G8F A;  2FLO A;  3VTH A;  3AO2 A;  1BG3 A;  3UB5 A;  1NK0 A;  4CZH A;  4E1M A;  2WOM A;  4JN4 A;  4BC4 A;  4K0K K;  3KK7 A;  3H1Q A;  2ZJP L;  2YCH A;  4MFB A;  4BR2 A;  3WXM B;  3HYF A;  4DQP A;  4FJK A;  1YTU A;  4G9Z A;  3GDQ A;  3V6D A;  3O8M A;  4J2E A;  5F0X A;  3ULE A;  5GAE P;  2ZE2 A;  4HUG A;  1RDA A;  4FWK A;  1W0H A;  2WTU A;  4FJH A;  4C8L A;  3VMF B;  3CC7 N;  3AVG A;  3WNF A;  1I3A A;  4K25 A;  4UQG A;  4AQY K;  1VSJ A;  3HI0 A;  4LD0 A;  2E88 A;  3OS0 A;  4WQ4 A;  2F8S A;  4HCB A;  1X9M A;  1VRU A;  5GIN A;  3AVC A;  3THV A;  3TAM A;  4FM0 A;  3EL2 A;  3AA2 A;  5KPT A;  3TAF A;  1LAW A;  1BU6 O;  3V81 A;  1N36 K;  4CZL A;  2GUP A;  2KKZ A;  4NCB A;  1O13 A;  2VWK A;  2HHW A;  4CHP A;  4FJM A;  4F2S A;  1WB9 A;  1J53 A;  4IEI A;  4KB0 A;  3UKR B;  1N5Y A;  3C7N B;  5FDL A;  4E0D A;  3MN6 A;  4YHH K;  4E89 A;  1GOB A;  2HHS A;  3VEN A;  3LAL A;  4KB1 A;  4FJG A;  2DPN A;  1SKW A;  4FWR A;  4PQU A;  3E1Y A;  3AAP A;  1JXE A;  3HP9 A;  1HR0 K;  1C1B A;  4CHY A;  1KSP A;  4DR2 K;  4JK7 A;  2DFH A;  4FJ9 A;  2UUC K;  2HHT A;  5LJV A;  3KLI A;  3MCA B;  3LAN A;  5JS1 A;  1RT5 A;  1V4S A;  4JI4 K;  2RF2 A;  4FK4 A;  3VOV A;  4C8N A;  3CJ7 A;  1W9H A;  1X9W A;  3DLH A;  3LP2 A;  2ITM A;  3HJF A;  3WUH A;  3AVF A;  2P9N A;  3KTQ A;  1HX1 A;  4JKC A;  1L3T A;  2VGM A;  3NGI A;  5BPM A;  3MN7 A;  4BQL A;  1JCE A;  2ZGZ A;  4DLE A;  3HPG A;  3CJB A;  2AP1 A;  3VER A;  4DTN A;  1ZBS A;  4JEP A;  4H5R A;  4DSE A;  4JI3 K;  2F9W A;  4FVU A;  1JLA A;  4I6M A;  1WNS A;  3CER A;  3OW2 M;  4DTJ A;  4ELU A;  1C1A A;  2V51 B;  1U48 A;  1M90 O;  4J8F A;  3F9K A;  4CJW A;  3VQ4 A;  4JK9 A;  4RTF D;  4LF4 K;  3PO5 A;  1Z26 A;  3M8Q A;  1XUP O;  3KLH A;  5K14 A;  4DS5 A;  3AVJ A;  1RBR A;  5A2Q O;  2ITG A;  4DWI A;  1P90 A;  3QBW A;  4YOU A;  4BRH A;  3CPW M;  4C8O A;  2J4R A;  4N47 A;  3WXJ A;  4KFB A;  3UKU A;  3OBW A;  4DV0 K;  1UOC A;  1YUW A;  4H4M A;  4AM6 A;  5HP1 A;  1BL3 A;  1R59 O;  1RTI A;  4FLU A;  1QS4 A;  3OBY A;  2E2N A;  2YI1 A;  4ILJ A;  2F9T A;  4RCH A;  1X9S A;  4B3S K;  1RTD A;  4IEE A;  3V9W A;  4ISF A;  4YFU A;  2A42 A;  3LL3 A;  4J2A A;  2O8C A;  3QIP A;  3AVA A;  5AQH A;  3DLL L;  3ZSY A;  4V19 S;  5HLF A;  3C6U A;  3R3L A;  4B9L A;  3ZET A;  1GLA G;  1CZ9 A;  4B1Y B;  3OS2 A;  4K41 A;  1NK5 A;  4FWM A;  2FF6 A;  1WSH A;  2NRR A;  1MA9 B;  2RHK A;  4BRF A;  4H5T A;  3CM6 A;  3KJV A;  1IH7 A;  4BQZ A;  4H5N A;  3QLH A;  2G8K A;  1ESV A;  1KCF A;  3ZSO A;  3EZ5 A;  1RBU A;  4BR4 A;  2OPS A;  1YJN N;  4Z94 A;  4A62 A;  5BN9 A;  2F8T A;  1GLF O;  2O4G A;  3P1G A;  3KHY A;  4F4K A;  3EE9 A;  4Z4H A;  3I33 A;  2V7Y A;  2OPR A;  4FLT A;  1N34 K;  2KFN A;  1Z05 A;  3JXU A;  1RT6 A;  4DSK A;  4B9M A;  2QWL A;  4FK2 A;  5AQS A;  3MN5 A;  2XY7 A;  1SUQ A;  5E26 A;  2D0P A;  4PA1 A;  4BE1 A;  2ZJR L;  4M7Y A;  1NWK A;  1WBD A;  3HO1 A;  1NGD A;  3EY1 A;  4YDU A;  2CGL A;  3U6F A;  3ENB A;  4YOW A;  4Y0W A;  3SJJ A;  3AA5 X;  3WEE B;  1C1C A;  4AHU A;  2PYJ A;  4JI2 K;  2QEX N;  2A1S A;  1UAX A;  3PSI A;  3VGM A;  4W5T A;  1QQM A;  4LFC K;  3TTD A;  3AVM A;  4C23 A;  2QI2 A;  1QVG M;  4B9U A;  4M63 C;  4Y1C A;  2RKI A;  4QOZ B;  1RDB A;  1REV A;  3QIC A;  3I0R A;  2FBT A;  4DR7 K;  5BPL A;  4YOV A;  4NYN A;  1NBW A;  1RT3 A;  1N8R O;  1WSF A;  2I7P A;  4C8K A;  2GWJ A;  4NLC A;  4C1N K;  1HKC A;  1TVR A;  5AQV A;  5JS2 A;  3SNN A;  4KKO A;  4MQ3 A;  4DV6 K;  1VSH A;  1CXQ A;  4FL9 A;  2QM1 A;  4H0P A;  2F4V K;  3TAP A;  1BI4 B;  1ZC6 A;  4JK8 A;  5AQT A;  3ZLJ A;  5E41 A;  4H0O A;  3G71 N;  1SKS A;  3UKR A;  3C7N A;  2NNW A;  4H03 B;  3T7Z A;  2LSN A;  1GOA A;  5FPM A;  3QES A;  3DLR A;  4A5B A;  4E7L A;  4EFH A;  4W5O A;  1XNQ K;  4O0I A;  1LW2 A;  1WSI A;  4RW8 A;  2HHH K;  2G8V A;  3DLB A;  1D5A A;  2QWQ A;  3KK2 A;  3G6E N;  2I5J A;  3THY B;  3NF7 A;  2BTF A;  4M42 A;  2ZJQ L;  5FRM A;  5IT9 O;  1VSK A;  1XI1 A;  2YHW A;  2ZWH A;  3SV3 A;  2KTQ A;  5C0Y A;  1ASV A;  1NGJ A;  1GLB G;  3I8D A;  5EOY A;  3JAM O;  4LF9 K;  1LAV A;  4CES A;  2W6L A;  2X6S A;  2P9U B;  3MWT A;  5FPE A;  4CW7 B;  3R6M A;  4ICL A;  3JYT A;  4X65 K;  3JS6 A;  4CK2 A;  1R0A A;  1EX4 A;  1YVN A;  3E01 A;  3WQU A;  1Q18 A;  4BGB A;  3HP6 A;  5MLC Q;  3BZC A;  4CCH A;  1QQC A;  4DTM A;  1JKH A;  1KVC A;  3QO9 A;  2UU9 K;  4O8U A;  2OZM A;  4DCH A;  3CC4 N;  1VK0 A;  3TTF A;  2XY8 A;  4JKA A;  2YNI A;  1RTH A;  1QE1 A;  1NJW A;  4H5V A;  1RDD A;  5LJW A;  2DFF A;  4CE9 A;  3Q7C A;  4GMJ B;  4CBW A;  3JSM A;  5F2R A;  4NXN K;  3LP0 A;  4KTZ A;  1A5V A;  5LL6 Z;  1U6Z A;  4FVM A;  4JKE A;  1Q82 O;  2WFB A;  3L4I A;  1YIT N;  1HPZ A;  2IAJ A;  4CJR A;  3O9R A;  3CD6 N;  4BRL A;  1GLJ O;  1KAY A;  3OYA A;  4HVJ A;  4CZK A;  4FJ8 A;  4JV5 K;  1HQE A;  5ADX A;  4PKG A;  1VSE A;  4F3T A;  3VQE A;  3AGK A;  3LM2 A;  1BO5 O;  1OVQ A;  2CGJ A;  2YHY A;  5C2D A;  1FJG K;  3OHR A;  1VSF A;  1ATS A;  2KQ2 A;  1W97 L;  1C0F A;  2NRW A;  4EAH D;  1VAZ A;  3BF1 A;  3L3V A;  1TK8 A;  4BR5 A;  2HHQ A;  4FM1 A;  3AVL A;  1KFD A;  3C6T A;  3CJC A;  5DM7 L;  1VQ6 N;  4CEO A;  3OYH A;  4BE2 A;  1WBB A;  5AQY A;  3AVN A;  2YNG A;  3ENO A;  4PWD A;  1GOC A;  1U49 A;  1RDU A;  2YNF A;  1KAZ A;  2UUA K;  3VEO A;  3CC2 N;  2D0O A;  4KHW A;  3N4P A;  4FW1 A;  5M1O A;  3T1Y K;  4DFP A;  3A5N C;  1Q9Y A;  5DM6 L;  3C0B A;  4FZX C;  3T1A A;  3CQX A;  3M8S A;  4FLX A;  1IKX A;  3DOL A;  4JS4 A;  4PL8 A;  1T6D A;  3TU5 A;  3FZK A;  1TL1 A;  2XY5 A;  2YJF A;  1BHL A;  4CGF A;  2HOE A;  2P1J A;  2QW9 A;  1IV0 A;  5M1P A;  4BGA A;  3LAM A;  5J2M A;  1OH7 A;  5EY4 A;  2HNZ A;  3H46 O;  5FRO A;  1HNI A;  3WEE A;  1TAU A;  4DR3 K;  4OGE A;  1T05 A;  3O4N A;  2O8B B;  1RTJ A;  4JS5 A;  3VQD A;  3D6R A;  4HUE A;  3AGR A;  3FZL A;  2KW4 A;  1S1X A;  1K8K B;  3C95 A;  2B4J A;  1SV5 A;  3Q7B A;  1ZBH A;  4BRE A;  4JD2 B;  4MO4 A;  1W7A A;  4KH4 A;  4DUY K;  3T3F A;  3SUP A;  4OGC A;  2BGG A;  4CFC A;  1OVY A;  4ISE A;  1U45 A;  2JGU A;  1DTQ A;  3WNH A;  3LDQ A;  3WXK A;  1VQ8 N;  5D3G A;  3E9L A;  4NCG A;  2AJQ A;  3OJS A;  5AQQ A;  3CCE N;  4KHY A;  4FWO A;  4GY2 B;  4LFB K;  4KAZ A;  4NXM K;  2CGK A;  3U9D A;  3ALY A;  1XHZ A;  3FZF A;  3OYM A;  4AHV A;  2Q97 A;  1BI4 A;  3KWI A;  4XH4 A;  2A1R A;  1OH6 A;  3VEY A;  2B5J A;  4FYD A;  3AO5 A;  3O5B A;  3DRP A;  3AVB A;  4X64 K;  2NZT A;  2Z1G A;  4G1Q A;  4FO0 A;  1QHA A;  1IBL K;  5KQD A;  3AA3 A;  3O1B A;  4CJE A;  4E3S A;  4BRK A;  3SQ4 A;  4FWL A;  3SUQ A;  1NU0 A;  4BRA A;  4EHT A;  3EE8 A;  4LF7 K;  1J54 A;  3WQT A;  4BVP A;  1D9D A;  3T19 A;  5TKY A;  4N5S A;  2E6L A;  3NCI A;  3OYN A;  4CBX A;  1EWR A;  1ZBL A;  1ASU A;  4B3R K;  3FZH A;  5AZJ B;  4H8K A;  2YNH A;  1KVA A;  3BY5 A;  1IBM K;  4J2D A;  3THY A;  4IDK A;  2W42 A;  3L2W A;  5CYM A;  4CEF A;  4YOY A;  1DKG D;  3M5R A;  2P9I B;  4B9N A;  3GOI A;  4I7F A;  1LWF A;  1KVB A;  3S41 A;  4CFA A;  1VQ4 N;  3MEC A;  2QA4 N;  3QER A;  4CHO A;  1YIJ N;  1NMN A;  2P9U A;  4RG8 A;  1JLQ A;  3WNG A;  3GG4 A;  4CHZ A;  4B9S A;  1XC9 A;  1NK6 A;  3E66 A;  4FPA A;  2X6N A;  3CF5 L;  4H0X B;  4B3O A;  4FZY A;  4NB4 A;  3ATU A;  5JIC A;  4FLY A;  3SUO A;  1NM1 A;  3L0Q A;  4CJK A;  4UY8 O;  2JWK A;  4KBO A;  3S9H A;  3P4I A;  1MWK A;  2W41 A;  1RFQ A;  2HNY A;  3LPT A;  3BP8 A;  1TUY A;  3SBG A;  4JKG B;  5KPR A;  1K8A O;  3NHG A;  1Q8I A;  5HOO A;  3J80 O;  3FZM A;  2HST A;  1S3X A;  2KZZ A;  4B8C A;  3N4Q A;  2HF4 A;  3H3O B;  3DLE A;  3VQC A;  5HRO A;  3H45 C;  3LWM A;  4JI6 K;  1QZ6 A;  1B92 A;  4OKK A;  4ZHR A;  1K9M O;  3AAR A;  5GAH P;  1XHX A;  1YVU A;  1NGC A;  1Z25 A;  2WON A;  5F1X A;  3M8R A;  3DYA A;  4JI7 K;  1BWF O;  1IG8 A;  3DXM A;  4I9Q A;  2D5R A;  2P5O A;  3ZT1 A;  2A6A A;  2E2O A;  4PKH A;  2NRH A;  3QNO A;  4DR4 K;  3ZCM A;  1C0M A;  4RW6 A;  1HYS A;  4IXC A;  4PKI A;  2UUB K;  1IJJ A;  1NOZ A;  3VF6 A;  1C6V A;  3EKU A;  1RBT A;  3IMX A;  3ZSW A;  2DTU A;  3D2E B;  3HZ6 A;  4IDH A;  4AHR A;  1RGI A;  3SPY A;  1A5X A;  3LDO A;  4IZ9 A;  4HHT A;  3NVK A;  1HNW K;  3FFI A;  3D45 A;  4I2Q A;  4BDP A;  1WSJ A;  3DMJ A;  4GV9 A;  4OPH A;  3L3U A;  3VA3 A;  1BCM A;  1BQN A;  1QZ5 A;  1YF5 L;  3KKR A;  2HHX A;  3L8B A;  1ATN A;  1NGE A;  4LC9 B;  2HMI A;  3O08 A;  4JKH A;  3GE1 A;  3ASM A;  3O3H A;  3EYZ A;  2P9K B;  3MX2 A;  4CJT A;  4WFA L;  1WLJ A;  3NVM A;  1JCF A;  5AFU H;  4AHT A;  2ZQB A;  4CZI A;  2XY6 A;  4MDA A;  4FJX A;  1M1K O;  1RDW X;  2JWL A;  3IFR A;  1TK0 A;  3O6W A;  5FRN A;  3A8Y A;  4DTO A;  4DU4 A;  4IG3 A;  4H0V B;  3TPQ A;  1B9D A;  3TAQ A;  3AV9 A;  5SZT A;  4CZM A;  3HRG A;  1HLU A;  1CZB A;  4CF9 A;  1YAG A;  2I7N A;  3ID6 A;  1OH5 A;  1JLE A;  2VWJ A;  2O8B A;  2P9S B;  4B1X B;  1IO2 A;  4H5W A;  1SKR A;  4E7H A;  2HW3 A;  2IGI A;  3NGY A;  1XMQ K;  1K8K A;  4OKE A;  4DSF A;  4W5Q A;  5FPD A;  5HBM A;  3KZB A;  3BUZ B;  1HYV A;  4JD2 A;  3AVK A;  1WN7 A;  3A5O C;  3U9Z A;  5J2Q A;  3MN9 A;  3CG7 A;  3HPH A;  2VYP A;  2V7Z A;  4X62 K;  4H0Y B;  3C6A A;  4CBU A;  3FR0 A;  4FLZ A;  4M3W A;  3M6G A;  1T8E A;  4FJN A;  1U4B A;  2QXF A;  4FXD A;  1SAZ A;  3ENH A;  4LH4 A;  1ASW A;  4AHS A;  3PIP L;  3C65 A;  3DXK B;  3LZI A;  1EKE A;  3CJ9 A;  3A5M C;  3QIO A;  4Q5V A;  3HST B;  3TAN A;  3K5N A;  2O8E A;  3M3Z A;  3PX6 A;  1S1U A;  4BVO A;  4E7J A;  4K8X A;  2PBD A;  4CF1 A;  4B1Z A;  2GBZ A;  4IJN A;  2WUS A;  1YI2 N;  1L3V A;  3OYJ A;  2P9L B;  1HMV A;  3LM9 A;  1JLG A;  3B6O A;  1J9A A;  3IS9 A;  1WSE A;  3SCX A;  1RT1 A;  3VEV A;  4BDY A;  2A3Z A;  5AQG A;  3R1X A;  1GLE G;  3PSF A;  5CZ1 A;  3K2P A;  4CER A;  3G0Z A;  4CZE A;  1SZ2 A;  4IO8 A;  4CGH A;  3CQY A;  5C10 A;  4E7K A;  5AZJ A;  3L2Q A;  1LCU A;  3ZT0 A;  1VQK N;  5LMU K;  3L2V A;  2W6K A;  3S3M A;  5AQL A;  1BCO A;  1TYQ B;  3G25 A;  4M41 A;  2P9I A;  4QCL A;  1VQ9 N;  2HF3 A;  4ZTF A;  4KH6 A;  4BR9 A;  4YOX A;  3QEV A;  3SI6 A;  3V1R A;  3ZSR A;  1LOT B;  1NGB A;  4IFY A;  4OPJ A;  4KTQ A;  5I3U A;  3VET A;  4IJA A;  3P38 A;  3TR8 A;  4LF6 K;  4DSI A;  2QKB A;  4BC5 A;  4O5F A;  2GTD A;  3DWL A;  4DTR A;  3EN9 A;  4DFM A;  4LH5 A;  2OYQ A;  4FJ5 A;  3QEP A;  3LP1 A;  1BQM A;  1MWM A;  2P5G A;  4AH9 A;  3O4W A;  4JKF A;  4B08 A;  1VSI A;  1YHQ N;  5AJ3 K;  2NRX A;  1LW0 A;  1GLL O;  2ZD1 A;  3VN5 A;  3R9P A;  4CFB A;  3KLE A;  1IBK K;  4DTS A;  3ULD A;  2VG7 A;  3AAQ A;  4JKG A;  1HKB A;  4O55 A;  5CR4 A;  3SQ1 A;  4N76 A;  3P83 D;  4KHP K;  2E1Y A;  2OTJ N;  3CYM A;  4CIG A;  1BA1 A;  1DEJ A;  2XO7 A;  1ITG A;  5KRT A;  4O5B A;  4OJR A;  3CCL N;  4FLV A;  3SQ2 A;  1ZBU A;  3CI5 A;  3RMD A;  1TV6 A;  4H4O A;  5KQ8 A;  4JI1 K;  1W2B M;  5AZI B;  1SL0 A;  3ZX3 A;  3QFP A;  4OLB A;  3OYE A;  4DF8 A;  5AQR A;  2BUP A;  4GKK K;  4JNE A;  4DB3 A;  4YOR A;  1HKG A;  5IWA K;  1NK8 A;  4HTU A;  1LWE A;  3DI6 A;  1B9F A;  3WNE A;  1NGI A;  3D2E A;  1TKD A;  5BR8 K;  2E20 A;  1ZXO A;  4NYF A;  1JLC A;  3KKS A;  4CJ4 A;  1BGX T;  5I9E B;  4FOE A;  5BRF A;  1NJY A;  3S3O A;  2HBL A;  4N41 A;  1NG9 A;  3QML A;  1NGH A;  4O8K A;  1NKE A;  4WYB A;  1T7P A;  3MXM A;  3CM5 A;  3A5L C;  1ZBF A;  3CPE A;  3O1W A;  1A5W A;  1YJ9 N;  5H1S Q;  1HNX K;  3WT0 A;  1TGO A;  2E8A A;  4EP5 A;  4ID1 A;  2HVH A;  2PYL A;  1U47 A;  2G8W A;  5GAG P;  1N32 K;  3IUC A;  2P9K A;  3TSU A;  3AVI A;  3HTV A;  1RNH A;  4K43 A;  3VEZ A;  2D0C A;  4DSJ A;  3U3Y A;  4AIL C;  4CF0 A;  1C0T A;  4A2A A;  3AO3 A;  1IKY A;  2G8I A;  5HRN A;  3OYD A;  1YJW N;  4WE1 A;  3O3F A;  4L3Q A;  1EQY A;  4RW4 A;  3DAW A;  3FE1 A;  3QNN A;  5FPN A;  3VF2 A;  4CED A;  3IDH A;  2EWS A;  4Z4I A;  2NRZ A;  4LSL A;  3NMU A;  5LY3 A;  4O0J A;  5AQJ A;  1NK7 A;  5HRP A;  1WUA A;  1G99 A;  3TAB A;  3SAG A;  1BUP A;  2ASM A;  2HB5 A;  1I39 A;  2ZF5 O;  1S5J A;  4WQ5 C;  2FBV A;  4EHU A;  2NRT A;  3VA0 A;  2Q36 A;  3K58 A;  2WC9 A;  3RWU A;  4DU1 A;  2O8D B;  4KRE A;  3BEX A;  2HBK A;  3BZK A;  1Q7Y O;  3V4I A;  1KRP A;  2B6A A;  2YV0 X;  4CJL A;  4E1J A;  3TSQ A;  2CH5 A;  3KLG A;  1BIZ A;  1JLF A;  3DXK A;  1TKT A;  4DR5 K;  1XQS C;  3VQ5 A;  4CJQ A;  3AO4 A;  1SS6 A;  3O9S A;  3OYB A;  1J5E K;  2OCE A;  4B3M K;  3DLK A;  3CXC M;  2UXD K;  4KH5 A;  4B9Q A;  4U7B A;  2GWK A;  2P9L A;  3QDK A;  4IOC L;  2ZM6 K;  5AQO A;  4DSL A;  3SMS A;  5ELZ A;  4CEB A;  2GEL A;  2VCP A;  1JJ2 M;  2QKK A;  3B8A X;  2G8H A;  1C0G A;  1RIL A;  4CJU A;  4M3T A;  1QSS A;  1YTA A;  4OPA A;  1FKO A;  1X3N A;  4E1N A;  4R5P A;  1HQU A;  1L5U A;  3TI0 A;  4X66 K;  5HL7 L;  2F7T A;  3V9S A;  4JI8 K;  4BRC A;  2VWB A;  2HHU A;  1NGF A;  4DR1 K;  3CFR A;  1S1T A;  4B9T A;  4DTU A;  1OKJ A;  4PY5 A;  3OTO K;  4HTL A;  4BR0 A;  1L3S A;  1JXB A;  4QS7 A;  2BH1 A;  3SYZ A;  2KZM A;  1NKB A;  3OY9 A;  2BAN A;  3CQ8 A;  3L2R A;  3RMB A;  5AQI A;  2FSN A;  2HVI A;  1IKW A;  3F73 A;  2YKN A;  3ZT2 A;  3THX B;  2PY5 A;  3CIP A;  3NH1 A;  1VQN N;  3SUN A;  1Y97 A;  3O9Q A;  3D7E O;  2PAV A;  5AR0 A;  4DR6 K;  4DFJ A;  4B9V A;  4DQ8 A;  3K59 A;  4PL7 A;  4WFB L;  5KTQ A;  1EET A;  4DV7 K;  3H08 A;  4CZJ A;  2Q0U A;  2HHV A;  5GIO A;  1NK4 A;  2QWN A;  3AO1 A;  3NGZ A;  2X78 A;  4A61 A;  3RVC A;  1S6P A;  3OYL A;  1KAX A;  2FBY A;  4DTX A;  4CF8 A;  4BE0 A;  3NF8 A;  1VSL A;  3FGU A;  4ID5 A;  5AQZ A;  3OYI A;  3TAG A;  3C6H A;  3HSC A;  4F2R A;  5J2N A;  3I55 N;  1FK9 A;  4F8R A;  4B8A B;  3LWL A;  2E1Z A;  4KO0 A;  3HXM A;  1U2V B;  5AZI A;  4A5A A;  1X9J A;  1DGK N;  4M7X A;  1XMO K;  4NO7 A;  4JKB A;  4CF2 A;  4FWP A;  5J1E A;  4FSV A;  1YT3 A;  3H6E A;  3MK6 A;  4JLH A;  4CJF A;  2VG5 A;  4FWQ A;  3ZT3 A;  3GBT A;  3BDP A;  3NAE A;  2Z1J A;  2Q2R A;  3DJC A;  1GLD G;  3KLF A;  1S22 A;  2O8F B;  3VQB A;  4W5N A;  1XNR K;  4DQS A;  5AQX A;  3TTC A;  4M3R A;  1C0U A;  2QTD A;  2D1K A;  3O9T A;  4M3U A;  3U4L A;  3CCV N;  3MCP A;  3K9J A;  3T1H K;  3QEW A;  5I42 A;  3O4Q A;  4Z0U A;  3RMC A;  4CGI A;  2UXB K;  3HK2 A;  4CHN A;  3NH2 A;  4CEE A;  3WXI A;  2Z1H A;  1QQO A;  2NUB A;  4IBN A;  4DLG A;  4KPY A;  4CEZ A;  4BAC A;  3K9K A;  1T3V A;  5DMR A;  3J81 O;  3ZT4 A;  3HVT A;  3NBP A;  4IFV A;  4TSX A;  4BRG A;  3HOT A;  3EO3 A;  4KHN A;  2D4W A;  1K73 O;  2E5L K;  1K6Y A;  3NDK A;  5KI6 A;  3KVG A;  3UE5 A;  4KHQ A;  2GEM A;  3A2F A;  3HBT A;  2HND A;  3M8P A;  3RR8 A;  2QWO A;  4OX9 K;  3P31 A;  3ZX0 A;  2A41 A;  1S1V A;  4O4G A;  4U67 L;  5GAD P;  2IS3 A;  2KHO A;  3SPZ A;  4LF8 K;  3VQP A;  2FF3 B;  4H0T B;  3VQA A;  2UXC K;  3SBT A;  2NRV A;  1VQP N;  2VQF K;  5M1N A;  4WFN L;  2EX3 A;  4GW6 A;  3NE6 A;  5M1K A;  5EX5 A;  2QWP A;  3VGL A;  4CIE A;  5GIP A;  3J8A A;  2BDP A;  3DRS A;  4O44 A;  1OH8 A;  1NNE A;  1E4G T;  3SZ2 A;  3BGR A;  3SK3 A;  4CJ5 A;  4DKW A;  1QSY A;  4FCY A;  5AQF A;  2O8D A;  3VQ8 A;  4FJI A;  5EXW A;  3V9U A;  3THW B;  3GL1 A;  1WAJ A;  4KTW A;  1BIS A;  4XH1 A;  3NH0 A;  3KIO A;  1S72 N;  4JHD B;  3M1F A;  4MLE A;  4Z4C A;  4YY3 K;  4B3T K;  2BE2 A;  1U04 A;  4LF5 K;  3V1Q A;  1RDC A;  3VQ9 A;  5M1F A;  4MDB A;  1UA0 A;  3ZEU B;  5JVH L;  4DQR A;  1G15 A;  3J7Y P;  1KQS M;  4CIF A;  1Q86 O;  1WAF A;  2P9P B;  4BWJ A;  3D2F B;  3K5O A;  4DMN A;  4OVL A;  3HPO A;  2OAN A;  4CJV A;  4EZ9 A;  4B1V A;  1NGG A;  1VRT A;  3EEQ A;  1HJO A;  1XWL A;  1P8Z A;  3L6Q A;  3E9P A;  4GVM A;  4OPK A;  5EU7 A;  3RRG A;  3A0I X;  1QSL A;  3CMA N;  1TK5 A;  3FLC O;  3P39 A;  4FWS A;  3PX4 A;  1RBV A;  3C94 A;  1FW6 A;  4QS8 A;  1DLO A;  4BG9 A;  1NKC A;  1HYZ A;  1TAQ A;  2Q1N A;  3PUF A;  1SL1 A;  4QS9 A;  3E9O A;  3ZSX A;  4IKF A;  3ITH A;  3O9U A;  1KD1 O;  3HL8 A;  1NJI O;  1XC3 A;  5JLF A;  3VF4 A;  5C12 A;  3KD5 E;  2OTL N;  4ISG A;  2FXU A;  3DM2 A;  4N56 A;  3THX A;  1KLN A;  2ASO A;  4IFE A;  4DF4 A;  4OKJ A;  3VPZ A;  4XEI A;  1N6Q A;  4RW9 A;  5BR9 A;  4GVE A;  4BRN A;  4DG1 A;  3J7A P;  3BF3 A;  1RT2 A;  2JLE A;  4DS4 A;  4BRP A;  3NF9 A;  4FJ7 A;  4WQ5 A;  1ILY A;  4Q0B A;  4GNI A;  5B8H A;  1EXQ A;  4ELV A;  3NF6 A;  5JMV A;  4CJ3 A;  5EVZ A;  4J2B A;  4FOI A;  3G4S N;  4K42 A;  4Z4F A;  4JI5 K;  3SAH A;  4JYA K;  3VEW A;  4RW7 A;  2KFZ A;  1NGA A;  2YHB A;  3EZW A;  2DFE A;  2DY4 A;  1RT4 A;  4CJS A;  5AQK A;  1JCG A;  4BG8 A;  3KK3 A;  4HUF A;  3CME N;  1KFS A;  4CEC A;  4IOX A;  4ZTJ A;  4FWN A;  3K5L A;  4GKJ K;  4FLW A;  4OO1 J;  1U2V A;  3H1V X;  4FJJ A;  3MEE A;  3P5J A;  4LSN A;  4W5R A;  5BN8 A;  2IOC A;  3ID8 A;  2QK9 A;  2RPI A;  4ILH A;  3VES A;  3V9X A;  3HOS A;  4B1U B;  3CJA A;  3CCM N;  4XH5 A;  1HNZ K;  3KWG A;  2A5X A;  4IO9 L;  4MLH A;  3HT3 A;  3G10 A;  4FPB A;  2W40 A;  3MX5 A;  4I9L A;  2HBM A;  4CJ7 A;  4PHT X;  2E2P A;  4HWI A;  3R8E A;  4L8R B;  1QHT A;  4I2P A;  3OYC A;  3LDP A;  3CCU N;  2O8F A;  2XRI A;  3TWH A;  1V4T A;  3DLG A;  3MED A;  3OYK A;  3IKM A;  4CFD A;  2UYT A;  4BC2 A;  1F21 A;  2E4L A;  4DFK A;  2YKM A;  1X3M A;  1MU2 A;  4XIU A;  3OS1 A;  1JLB A;  3L2U A;  3MMV A;  4KI6 A;  2IVP A;  4CJP A;  1J5O A;  2VQE K;  4CD1 A;  4M45 A;  4R79 A;  4KV8 A;  3TAR A;  5BRE A;  1EP4 A;  2Q3S A;  5ADX H;  3ZSZ A;  5E84 A;  3FFK B;  5KGW A;  4K8Z A;  3I56 N;  5C2F A;  3PY8 A;  2FBX A;  5C15 A;  3O80 A;  1T6C A;  4YOT A;  3PO4 A;  1ZYQ A;  3DOK A;  4WQ4 C;  3J7Z O;  4WF9 L;  5LMN K;  2D0B A;  5AFU A;  3I0S A;  4FZZ A;  3ZX2 A;  5CHI A;  4DQQ A;  4JI0 K;  1Q9X A;  2IVO A;  4FK0 A;  1I94 K;  3IRX A;  1IKV A;  5AQP A;  5HRS A;  3PV8 A;  2PZS A;  3CET A;  3RR7 A;  3CCR N;  3V9Z A;  5C42 A;  1S9G A;  1EWQ A;  1D8Y A;  2YJE A;  4CK1 A;  1RT7 A;  3LDS A;  4RWT A;  4KI4 A;  5HRR A;  3AY9 A;  4FW2 A;  5CYQ A;  3VGK A;  2ZGY A;  4AM7 A;  1TKZ A;  2YHX A;  2GX9 A;  1IG9 A;  1LV5 A;  4AF1 A;  1Q81 O;  1QQN A;  3THW A;  3OYF A;  3MAQ A;  5AQM A;  4C1N I;  2QWM A;  3OVN A;  3ZSQ A;  3RSE B;  2F96 A;  4C8M A;  2E6M A;  1KXP A;  3LZJ A;  1WOQ A;  4JHD A;  1HUX A;  3K57 A;  5JLH A;  5KPZ A;  5M1Q A;  4QAG A;  4BR7 A;  3D0P A;  5KRS A;  1JL2 A;  4F3O A;  3ZEU A;  2FSJ A;  5C24 A;  4BDZ A;  3CFO A;  4GV3 A;  3IAY A;  2V52 B;  3LDL A;  4DHY A;  2P9P A;  4A2B A;  3VEX A;  3MDQ A;  5KGX A;  3QET A;  3D2F A;  5AQN A;  4LY7 A;  2YHA A;  3VTI A;  4IOA L;  4KRF A;  1NOY A;  3QFU A;  3ATV A;  1TUU A;  4NCA A;  4BY9 C;  1JL1 A;  1ATR A;  3CCQ N;  4Y1D A;  3SQ0 A;  1VQM N;  3RMA A;  1J6Z A;  2IVN A;  1HNV A;  3ULE B;  4CEA A;  3ZYY X;  1NJX A;  2Q31 A;  2RE2 A;  3DRR A;  3RRH A;  3MWP A;  3PX0 A;  1SL2 A;  1VSM A;  3ZSV A;  4DV5 K;  3HVR A;  1T03 A;  2P9S A;  1ZBI A;  3F5T A;  4JAX A;  1E4F T;  4BWM A;  4CD3 A;  1MDU B;  4MO5 A;  4FM2 A;  1CLQ A;  5FLX O;  4DV1 K;  2Z1I A;  2VG6 A;  1H1V A;  1HRH A;  2NLX A;  1SQK A;  3PIO L;  2ASP A;  4KHS A;  1Z6R A;  4HCC A;  2PFU A;  1NMD A;  3RTV A;  3MXI A;  2IDO A;  3QEX A;  1VQO N;  4CK3 A;  3U3G A;  3S3N A;  3LAK A;  4Z4G A;  2QWR A;  2Y1J A;  3LPU A;  2CH6 A;  4JKD A;  1EO1 A;  3OYG A;  3DXM B;  4EZ6 A;  1Y64 A;  1HJR A;  4M3Z A;  3O3G A;  4CI6 A;  1BA0 A;  3F2K A;  1UWB A;  4CGD A;  2RN2 A;  1RCH A;  4IG0 A;  1HPM A;  2P51 A;  4AHC A;  3IG1 A;  4BRQ A;  4BC3 A; 
#chains in the Genus database with same CATH homology
 2VWJ A;  4M3R A;  2Y1I A;  1C0U A;  3VQ6 A;  1IO2 A;  3TAP A;  3K5M A;  1BI4 B;  5C25 A;  4M3U A;  1RBS A;  1SKR A;  4E7H A;  2HW3 A;  1BIU A;  2IGI A;  3NGY A;  5E41 A;  4DU3 A;  3QEW A;  5I42 A;  5DK5 A;  3O4Q A;  4Z0U A;  3RMC A;  4CGI A;  3HK2 A;  3ISN C;  4OKE A;  2EHG A;  4CHN A;  4DSF A;  4W5Q A;  1SKS A;  3NH2 A;  4CEE A;  1FKP A;  3QES A;  5HBM A;  2LSN A;  1GOA A;  4CGG A;  2IC3 A;  2Z1H A;  1HYV A;  3DLR A;  4E7L A;  2NUB A;  3AVK A;  1WN7 A;  3QEI A;  4IBN A;  4DLG A;  5J2Q A;  4CEZ A;  3VQ7 A;  4W5O A;  4BAC A;  3KD1 E;  4KPY A;  4O0I A;  1LW2 A;  1WSI A;  5DMR A;  4RW8 A;  3CG7 A;  3HPH A;  2GUI A;  2G8V A;  3ZT4 A;  3HVT A;  3NBP A;  4IFV A;  4TSX A;  1L3U A;  1WSG A;  4KHN A;  1S1W A;  1X1P A;  3DLB A;  1K6Y A;  4FLZ A;  4M3W A;  3NDK A;  4PUO A;  1T8E A;  4FJN A;  1D5A A;  5KI6 A;  3KK2 A;  4KHQ A;  3A2F A;  1KLM A;  3M8P A;  2HND A;  1U4B A;  3RR8 A;  2QXF A;  2I5J A;  4FXD A;  3MXJ A;  3NF7 A;  4LH4 A;  4AHS A;  1ASW A;  4M42 A;  5FRM A;  1S1V A;  4O4G A;  1VSK A;  1UA1 A;  3V1O A;  2IS3 A;  3LZI A;  1XI1 A;  1EKE A;  3QIO A;  4ELT A;  3KK1 A;  3SPZ A;  4OLA A;  3VQP A;  2X74 A;  3HST B;  4Q5V A;  1VSD A;  3VQA A;  3K5N A;  3SV3 A;  3TAN A;  4CHQ A;  4E7I A;  2KTQ A;  3PX6 A;  1S1U A;  4E7J A;  4K8X A;  4CF1 A;  1ASV A;  3I8D A;  2GBZ A;  2EX3 A;  4GW6 A;  1L3V A;  3NE6 A;  3OYJ A;  4CEQ A;  3B6P A;  1LAV A;  1HMV A;  4CES A;  2X6S A;  1LWC A;  4CIE A;  4FJL A;  1KTQ A;  2BDP A;  1JLG A;  3B6O A;  3DRS A;  4O44 A;  1J9A A;  3IS9 A;  2OA8 A;  1WSE A;  2OPP A;  4ICL A;  3SZ2 A;  3SCX A;  1S9E A;  3JYT A;  3BGR A;  1RT1 A;  4CJ5 A;  4CK2 A;  3HM9 A;  1R0A A;  1EX4 A;  4BDY A;  3E01 A;  1QSY A;  3HP6 A;  4FCY A;  4M3X A;  3VQ8 A;  4FJI A;  4CCH A;  3V9U A;  5CZ1 A;  3K2P A;  1QQC A;  5CY4 A;  4E19 A;  4CER A;  3OJU A;  4JRP A;  4DTM A;  1JKH A;  3G0Z A;  1WAJ A;  1KVC A;  4KTW A;  3QO9 A;  1BIS A;  2OZM A;  3NH0 A;  4CGH A;  3KIO A;  4E7K A;  3UIQ A;  1S6Q A;  3L2Q A;  5CZ2 A;  3VQQ A;  3ZT0 A;  2R7Y A;  3L2V A;  1VK0 A;  2OZS A;  2XY8 A;  3AA4 A;  1NK9 A;  4Z4E A;  4Z4C A;  3S3M A;  1CXU A;  2G8U A;  4YNQ A;  2YNI A;  1TL3 A;  3QIN A;  1D9F A;  1BCO A;  1RTH A;  4KHU A;  2BE2 A;  1U04 A;  1TKX A;  1RDC A;  1QE1 A;  4M41 A;  3V1Q A;  1NJW A;  4DQI A;  3VQ9 A;  1RDD A;  2FC0 A;  4QCL A;  5SWM A;  2DFF A;  3SV4 A;  4CE9 A;  3TAE A;  4ZTF A;  1UA0 A;  4GMJ B;  4DQR A;  4M3Y A;  3QEV A;  1NJZ A;  3SI6 A;  3JSM A;  4JRQ A;  1G15 A;  3V1R A;  3LP0 A;  4KTZ A;  2XHB A;  1A5V A;  3ZSR A;  4CIF A;  4FVM A;  1WAF A;  4IFY A;  4EP4 A;  4OPJ A;  4KTQ A;  4BWJ A;  1HPZ A;  2IAJ A;  3NFA A;  4CJR A;  5I3U A;  3K5O A;  4DMN A;  4OVL A;  3HPO A;  4CJV A;  4EZ9 A;  1QTM A;  3TR8 A;  3OYA A;  1VRT A;  4HVJ A;  4DSI A;  2GV9 A;  2QKB A;  4FJ8 A;  1HQE A;  2OPQ A;  1XWL A;  1VSE A;  4DTR A;  5J2P A;  2ETJ A;  3MEG A;  4CGJ A;  4DFM A;  4LH5 A;  4DTP A;  4GVM A;  2OYQ A;  4FJ5 A;  3VQE A;  4OPK A;  5EU7 A;  3QEP A;  4F3T A;  3LP1 A;  1BQM A;  3RRG A;  2P5G A;  3CFP A;  4AH9 A;  1QSL A;  1TK5 A;  3PX4 A;  1VSF A;  4B08 A;  1VSI A;  1RBV A;  1FXX A;  3C94 A;  1LW0 A;  2O4I A;  2KQ2 A;  2ATQ A;  2D0A A;  2ZD1 A;  1DLO A;  3VN5 A;  4CFB A;  3KLE A;  1NKC A;  1HYZ A;  3L3V A;  4DTS A;  1TAQ A;  1TK8 A;  3ULD A;  2VG7 A;  3PUF A;  1O1W A;  1SL1 A;  3LP3 A;  3AVH A;  4O55 A;  2HHQ A;  3SQ1 A;  4N76 A;  4FM1 A;  3ZSX A;  3AVL A;  1KFD A;  3ITH A;  4IKF A;  3C6T A;  3HL8 A;  1DTT A;  3P83 D;  4CEO A;  5T7B A;  3OYH A;  2G8F A;  3AO2 A;  3CYM A;  4BE2 A;  1NK0 A;  4CIG A;  4E1M A;  3AVN A;  2XO7 A;  3KD5 E;  2YNG A;  2WOM A;  1ITG A;  5KRT A;  4PWD A;  1GOC A;  4O5B A;  4OJR A;  4FLV A;  3SQ2 A;  3DM2 A;  4N56 A;  1U49 A;  1ZBU A;  3RMD A;  2YNF A;  1TV6 A;  4MFB A;  3HYF A;  4H4O A;  1KLN A;  4DQP A;  4KHW A;  4FJK A;  1YTU A;  1SL0 A;  4FK0 A;  3V6D A;  4J2E A;  4FW1 A;  4OLB A;  3OYE A;  4OKJ A;  4DF8 A;  4DFP A;  4DF4 A;  1N6Q A;  2ZE2 A;  1Q9Y A;  4RW9 A;  4HUG A;  1RDA A;  4DG1 A;  1W0H A;  4FJH A;  1RT2 A;  2JLE A;  4DS4 A;  4C8L A;  3NF9 A;  1NK8 A;  4FZX C;  4FJ7 A;  4HTU A;  3T1A A;  3AVG A;  4Q0B A;  3M8S A;  4FLX A;  3WNF A;  1IKX A;  1EXQ A;  1LWE A;  3DI6 A;  3DOL A;  1B9F A;  4JS4 A;  3WNE A;  1TKD A;  1I3A A;  3NF6 A;  4UQG A;  4ELV A;  1VSJ A;  4LD0 A;  4CJ3 A;  3OS0 A;  4NYF A;  1JLC A;  2F8S A;  4HCB A;  4J2B A;  3KKS A;  4CJ4 A;  1X9M A;  1BGX T;  1TL1 A;  2XY5 A;  1VRU A;  1BHL A;  3AVC A;  4CGF A;  3THV A;  3TAM A;  2P1J A;  4FM0 A;  3AA2 A;  3S3O A;  1NJY A;  4Z4F A;  4N41 A;  4RW7 A;  3LAM A;  5J2M A;  3TAF A;  2YHB A;  1LAW A;  2KFZ A;  2DFE A;  2HNZ A;  2DY4 A;  5FRO A;  1HNI A;  1RT4 A;  1NKE A;  1TAU A;  4CJS A;  3KK3 A;  4HUF A;  4OGE A;  3V81 A;  1T7P A;  1T05 A;  3MXM A;  3O4N A;  1KFS A;  4CEC A;  3CM5 A;  1RTJ A;  4JS5 A;  3VQD A;  4ZTJ A;  1ZBF A;  4HUE A;  3K5L A;  4NCB A;  4FLW A;  2VWK A;  1A5W A;  2HHW A;  4CHP A;  4FJJ A;  4FJM A;  4F2S A;  2KW4 A;  1J53 A;  1S1X A;  1TGO A;  3MEE A;  3P5J A;  3C95 A;  4ID1 A;  4LSN A;  4EP5 A;  4W5R A;  4KB0 A;  2B4J A;  2PYL A;  1SV5 A;  2IOC A;  1U47 A;  2G8W A;  1N5Y A;  2RPI A;  2QK9 A;  5FDL A;  4E0D A;  3V9X A;  1ZBH A;  3AVI A;  4E89 A;  1GOB A;  2HHS A;  3LAL A;  3T3F A;  1RNH A;  4KB1 A;  3SUP A;  4FJG A;  4OGC A;  4DSJ A;  2D0C A;  2BGG A;  3U3Y A;  1SKW A;  4AIL C;  3HT3 A;  4CF0 A;  3G10 A;  4CFC A;  4PQU A;  1U45 A;  2JGU A;  1C0T A;  1DTQ A;  1JXE A;  3HP9 A;  1C1B A;  4I9L A;  3WNH A;  3AO3 A;  1IKY A;  5D3G A;  2G8I A;  4NCG A;  2AJQ A;  3OJS A;  5HRN A;  4CHY A;  1KSP A;  4L8R B;  4KHY A;  3OYD A;  1QHT A;  4I2P A;  4WE1 A;  3O3F A;  3OYC A;  2XRI A;  3TWH A;  4KAZ A;  3DLG A;  2DFH A;  3MED A;  3OYK A;  4FJ9 A;  3ALY A;  4CFD A;  1XHZ A;  2HHT A;  4RW4 A;  3KLI A;  1F21 A;  2E4L A;  3LAN A;  4AHV A;  2YKM A;  3OYM A;  1MU2 A;  1RT5 A;  4DFK A;  3QNN A;  5JS1 A;  1BI4 A;  4XIU A;  2RF2 A;  2A1R A;  4FK4 A;  3OS1 A;  1JLB A;  3L2U A;  4C8N A;  2B5J A;  4KI6 A;  4FYD A;  4CED A;  4CJP A;  3AO5 A;  1J5O A;  4Z4I A;  4LSL A;  1W9H A;  3DRP A;  4M45 A;  4KV8 A;  3AVB A;  1X9W A;  3DLH A;  3TAR A;  3LP2 A;  4O0J A;  1NK7 A;  3HJF A;  3AVF A;  5HRP A;  3KTQ A;  2Z1G A;  1EP4 A;  2Q3S A;  4G1Q A;  3TAB A;  3ZSZ A;  1L3T A;  3NGI A;  2HB5 A;  1I39 A;  5KGW A;  3AA3 A;  4CJE A;  4DLE A;  4E3S A;  1S5J A;  3SQ4 A;  3HPG A;  4K8Z A;  2FBV A;  3SUQ A;  4DTN A;  3VA0 A;  3PY8 A;  2FBX A;  3K58 A;  4DSE A;  3RWU A;  3PO4 A;  4DU1 A;  3DOK A;  4QOZ B;  1J54 A;  1D9D A;  4KRE A;  1JLA A;  1WNS A;  3T19 A;  3V4I A;  4N5S A;  4DTJ A;  1KRP A;  2E6L A;  2B6A A;  2YV0 X;  3NCI A;  2D0B A;  3OYN A;  4ELU A;  1C1A A;  3I0S A;  1U48 A;  1ZBL A;  4CJL A;  1ASU A;  4FZZ A;  3F9K A;  4H8K A;  2YNH A;  1KVA A;  4CJW A;  3VQ4 A;  4DQQ A;  4IDK A;  1Q9X A;  4J2D A;  2W42 A;  3PO5 A;  3L2W A;  3KLG A;  1BIZ A;  1JLF A;  1IKV A;  1Z26 A;  3IRX A;  3M8Q A;  3KLH A;  1TKT A;  5CYM A;  4CEF A;  3VQ5 A;  4CJQ A;  3AO4 A;  5HRS A;  3PV8 A;  5K14 A;  2PZS A;  3OYB A;  3RR7 A;  4DS5 A;  3V9Z A;  3AVJ A;  5C42 A;  1RBR A;  1S9G A;  2ITG A;  1D8Y A;  3DLK A;  4DWI A;  4B9N A;  4I7F A;  4CK1 A;  1RT7 A;  1LWF A;  1KVB A;  3LDS A;  4C8O A;  4KI4 A;  4N47 A;  5HRR A;  4KFB A;  4FW2 A;  5CYQ A;  4CFA A;  3MEC A;  3QER A;  4CHO A;  4RG8 A;  1UOC A;  1JLQ A;  3WNG A;  4H4M A;  1TKZ A;  4DSL A;  4CHZ A;  5HP1 A;  4CEB A;  4B9S A;  1XC9 A;  1BL3 A;  4DQS A;  1RTI A;  4FLU A;  1IG9 A;  1QS4 A;  2G8H A;  2QKK A;  1NK6 A;  1LV5 A;  2X6N A;  1X9S A;  1RIL A;  4CJU A;  1RTD A;  4M3T A;  3V9W A;  4YFU A;  1QSS A;  4B3O A;  1YTA A;  3OYF A;  3MAQ A;  1FKO A;  4E1N A;  4FZY A;  2HVH A;  4R5P A;  1HQU A;  3OVN A;  4FLY A;  1L5U A;  3QIP A;  4J2A A;  3ZSQ A;  3SUO A;  3AVA A;  3TI0 A;  3V9S A;  3ZSY A;  2F96 A;  4CJK A;  4C8M A;  2E6M A;  3LZJ A;  2HHU A;  3S9H A;  5HLF A;  3K57 A;  3C6U A;  3CFR A;  4B9L A;  1CZ9 A;  1S1T A;  3OS2 A;  1NK5 A;  4QAG A;  3D0P A;  4DTU A;  2HNY A;  4B9T A;  3LPT A;  5KRS A;  4PY5 A;  1JL2 A;  1WSH A;  4F3O A;  1L3S A;  1JXB A;  3NHG A;  1Q8I A;  3CM6 A;  3KJV A;  3SYZ A;  2KZZ A;  1IH7 A;  2KZM A;  1NKB A;  4B8C A;  3DLE A;  3VQC A;  5C24 A;  5HRO A;  3LWM A;  3OY9 A;  2BAN A;  4BDZ A;  3CFO A;  3CQ8 A;  3QLH A;  3L2R A;  3RMB A;  2G8K A;  1B92 A;  3IAY A;  4OKK A;  1KCF A;  4ZHR A;  3ZSO A;  3EZ5 A;  1XHX A;  1YVU A;  2HVI A;  5KGX A;  1Z25 A;  2WON A;  1IKW A;  1RBU A;  3QET A;  2OPS A;  3F73 A;  2YKN A;  4LY7 A;  3ZT2 A;  2YHA A;  3M8R A;  4KRF A;  2PY5 A;  3DYA A;  1NOY A;  3NH1 A;  4NCA A;  3SUN A;  1JL1 A;  4I9Q A;  1Y97 A;  2D5R A;  2F8T A;  2P5O A;  2O4G A;  3P1G A;  3ZT1 A;  4Y1D A;  3SQ0 A;  4F4K A;  4Z4H A;  3RMA A;  4DFJ A;  1HNV A;  2OPR A;  4CEA A;  4FLT A;  3QNO A;  1NJX A;  4B9V A;  2KFN A;  3DRR A;  3ZCM A;  3RRH A;  1C0M A;  4RW6 A;  3K59 A;  3PX0 A;  1HYS A;  1RT6 A;  5KTQ A;  4DSK A;  1EET A;  1SL2 A;  1VSM A;  3ZSV A;  1NOZ A;  3H08 A;  4B9M A;  2HHV A;  1C6V A;  3ZSW A;  1RBT A;  4FK2 A;  3HVR A;  2DTU A;  1NK4 A;  2XY7 A;  1T03 A;  1SUQ A;  3AO1 A;  3NGZ A;  2X78 A;  3SPY A;  4AHR A;  1A5X A;  4PA1 A;  1ZBI A;  1S6P A;  3OYL A;  4HHT A;  4BE1 A;  4BWM A;  2FBY A;  4DTX A;  3FFI A;  3D45 A;  4CF8 A;  4BE0 A;  3NF8 A;  3HO1 A;  4I2Q A;  3EY1 A;  4BDP A;  1VSL A;  1CLQ A;  4FM2 A;  1WSJ A;  4ID5 A;  3U6F A;  2Z1I A;  2VG6 A;  3SJJ A;  3AA5 X;  3DMJ A;  1C1C A;  3OYI A;  3TAG A;  4AHU A;  1HRH A;  2PYJ A;  3L3U A;  3VA3 A;  2A1S A;  1BCM A;  1BQN A;  1UAX A;  3KKR A;  5J2N A;  1FK9 A;  4F2R A;  4F8R A;  4B8A B;  3LWL A;  3L8B A;  4KHS A;  2HHX A;  4HCC A;  4KO0 A;  3HXM A;  4W5T A;  3RTV A;  3MXI A;  2IDO A;  3AVM A;  2HMI A;  3QEX A;  3ASM A;  3O3H A;  4CK3 A;  4B9U A;  3EYZ A;  4CF2 A;  4CJT A;  4Y1C A;  2RKI A;  3U3G A;  1WLJ A;  1RDB A;  1REV A;  3LAK A;  5J1E A;  3S3N A;  3I0R A;  2FBT A;  4AHT A;  4Z4G A;  2Y1J A;  2ZQB A;  3LPU A;  2XY6 A;  1YT3 A;  3OYG A;  4FJX A;  4JLH A;  4CJF A;  4NYN A;  4EZ6 A;  1RT3 A;  2VG5 A;  1HJR A;  4M3Z A;  1TK0 A;  3ZT3 A;  3BDP A;  1WSF A;  3O3G A;  5FRN A;  1UWB A;  4DTO A;  4C8K A;  4CGD A;  2RN2 A;  3NAE A;  4DU4 A;  2Z1J A;  4IG3 A;  1B9D A;  1RCH A;  4IG0 A;  3TAQ A;  1TVR A;  3AV9 A;  5SZT A;  5JS2 A;  3KLF A;  3SNN A;  4W5N A;  1CZB A;  2P51 A;  4KKO A;  3VQB A;  4CF9 A;  4MQ3 A;  4AHC A;  3IG1 A;  1VSH A;  1CXQ A;  1JLE A;  1ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...