4TSXA

Hiv-1 integrase catalytic core domain mutant complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
143
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPESMNKELKKIIGQVRDQAETLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of H171T resistance reveals the importance of N -protonated His171 for the binding of allosteric inhibitor BI-D to HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
molecule keywords Integrase
total genus 49
structure length 143
sequence length 155
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4tsxA00
2EX3A 3K5LA 1S9EA 3CM5A 4M3TA 2D5RA 4ELUA 4HHTA 1JXEA 4C8LA 3OYLA 3SNNA 3QO9A 4CJUA 3ZT3A 4M41A 4E0DA 2ZQBA 3PX0A 1TK5A 1W9HA 2P1JA 1RTJA 3DM2A 3DLEA 3QIOA 1KLMA 1BIUA 5DMRA 1RT7A 3ZSXA 2ETJA 1A5XA 3K59A 3RRHA 1Q9YA 5KRTA 3QEIA 4KO0A 2ZD1A 4ICLA 4B8CA 1S1VA 3QIPA 4DFMA 1NK0A 1NKEA 3M8SA 3KJVA 4QOZB 1VSHA 1GOCA 4CK3A 1NKCA 1XWLA 4EP4A 1QSYA 3AO4A 3VQAA 4CEAA 1W0HA 4O55A 1NK7A 2P5OA 3NH2A 1HYZA 2O4GA 3ZSYA 1EP4A 3AVNA 1XHZA 4IDKA 1UA1A 1KVCA 3DOLA 4OGCA 4DSFA 2A1RA 3VQ9A 5FRNA 4IG3A 3QNNA 3IG1A 1RBVA 3HVTA 4OKJA 3OS1A 5HROA 4L8RB 4DG1A 2YHAA 1VSEA 2VWKA 4Y1CA 4BDYA 2HHUA 3HL8A 5CYMA 4DQQA 4HTUA 4M3WA 4AH9A 1FKOA 2A1SA 1C0UA 3AA2A 4ID1A 4WE1A 5FDLA 2B4JA 4DTNA 1TL3A 1KFSA 3KD1E 2RPIA 4CEEA 3ISNC 4CHPA 4O0IA 4FK0A 4LSNA 4HCBA 3TAMA 4JS4A 1TK8A 4BE0A 1NJWA 3RTVA 1VK0A 4CFDA 3LAMA 4ELTA 4NYFA 2IOCA 5HP1A 1G15A 3MEEA 1ITGA 3WNEA 2RF2A 3LWMA 4B9NA 1T7PA 3OYHA 3SCXA 4M3ZA 3S9HA 4B8AB 3OYFA 1BI4A 3IS9A 3B6PA 3TARA 1BHLA 2HVIA 2FBTA 3AV9A 3CG7A 2HHQA 4FCYA 4C8NA 4BACA 4N41A 3AA3A 2Q3SA 3L3VA 4NYNA 3SZ2A 4C8MA 3L2VA 1QTMA 4CEQA 4KHUA 4B9TA 1HJRA 4YFUA 3NF8A 2IS3A 3JSMA 4KI4A 3MXIA 3OYCA 4DWIA 3TANA 4CJEA 4F2SA 3KLFA 4DS5A 2QKBA 1VSMA 4F3OA 3OYEA 4J2AA 4DF8A 3VQ4A 4N76A 4FJ5A 3LP0A 2P5GA 3E01A 3IAYA 4CHQA 2PZSA 2F96A 4AHUA 2P51A 4CJSA 3KLHA 3TABA 1RTDA 3KKSA 4E7KA 3ZT0A 3TAPA 3QETA 3V6DA 1S1XA 4W5OA 1VSJA 2G8HA 2DTUA 4CGIA 3VQ8A 1RCHA 3MEGA 3KTQA 4OLAA 3OS0A 3NFAA 4HUGA 1CZBA 1HYVA 3DLHA 1L3VA 2ZE2A 3HT3A 3PX6A 3NAEA 3TAFA 4EP5A 3AVHA 3VQCA 3V81A 3QERA 3O4NA 4I7FA 1D8YA 3AVGA 2X78A 4KTWA 3NHGA 4Z0UA 5FROA 3PV8A 2F8SA 3SUPA 2G8IA 4CHYA 2OPPA 3V1QA 3DLRA 4FLVA 4DTMA 2BE2A 3F9KA 1NKBA 3LP3A 4F3TA 4JS5A 2E6MA 2B6AA 3DLGA 4CEDA 1JLEA 5HRPA 1NJYA 1IKXA 2FC0A 3AVBA 2DFEA 1RT5A 2JLEA 3SI6A 3ZSVA 4HUFA 3V9WA 4E3SA 5JS1A 1SV5A 2X6NA 3RMDA 3VQ5A 4CECA 1UA0A 4CGJA 2BGGA 4CEZA 1QQCA 4H8KA 1JLBA 1RTIA 4FVMA 3ZSRA 4DQIA 3TI0A 4C8KA 1GOBA 1HQUA 1Y97A 5K14A 4IFYA 1TV6A 5J2MA 1IH7A 3C94A 4FLTA 2E4LA 3HSTB 1KRPA 1A5VA 2GBZA 1JLCA 3TAGA 1B9DA 4CJWA 2KZZA 3V9ZA 3OVNA 3ZT4A 3KLEA 4M3UA 1NJXA 5EU7A 5HRRA 3KK3A 3NF7A 4F2RA 1BIZA 3AVIA 3QLHA 1LWFA 5I42A 2HMIA 4Y1DA 1XI1A 4E7HA 4CHZA 1Z25A 1ZBLA 4CHNA 4CGDA 3RRGA 1IG9A 1S5JA 4FJ8A 1VRTA 1WSJA 1BCOA 2XY8A 3LPTA 3F73A 3CFPA 1KSPA 2BDPA 3QNOA 4B9UA 3V9XA 2LSNA 3AO3A 4QAGA 4AHRA 3L2RA 3K5NA 2Z1HA 1L3UA 1SKSA 4C8OA 1EETA 4KB0A 4JLHA 4BDZA 3LPUA 3VN5A 3DLBA 4FJMA 1D5AA 2X6SA 1S6QA 3P1GA 4CJ3A 3OYGA 1U47A 4CIFA 4Q0BA 4B08A 3P5JA 3MXJA 4OLBA 1HMVA 4W5QA 4CJLA 2VG6A 3OYDA 4IFVA 1RT4A 1TKDA 4LY7A 2YNGA 2G8FA 4FZXC 1VSIA 4B9VA 3OY9A 2YHBA 1XC9A 1JLFA 3PO5A 1BQNA 3VQBA 1X1PA 3SQ4A 1J9AA 3VQEA 4R5PA 1SL1A 3U3YA 1ASWA 4E7IA 2XHBA 4FW1A 4CERA 1C1BA 3ZSZA 3OS2A 3NF6A 1U49A 3SQ2A 4M3XA 3QEWA 2PYJA 1UWBA 3ZSOA 4IKFA 4DSIA 1U04A 3ZSWA 3NE6A 1WSGA 5J2PA 3KD5E 1CXQA 4RW9A 1NK4A 5KGWA 3TAQA 4FYDA 4CEFA 3WNFA 3P83D 4CF1A 2W42A 2OA8A 2KTQA 1A5WA 3LALA 1KTQA 3THVA 2G8WA 2OZSA 4K8XA 4DU4A 2IAJA 2G8VA 1WSEA 4OJRA 3C6UA 3DOKA 5C42A 4DTJA 3CFOA 1X9SA 2XY7A 3ASMA 3BDPA 1RBRA 2HHSA 4G1QA 1VRUA 2JGUA 3QINA 1O1WA 2KW4A 1RBUA 1UAXA 4ZHRA 3KLIA 3OJSA 3K57A 3QESA 2DFHA 5KGXA 3OJUA 4IBNA 1D9FA 3IRXA 2Z1IA 2HNDA 3O4QA 5KRSA 3CQ8A 1RNHA 1RT2A 5CYQA 4GVMA 4CJTA 1VSDA 2D0AA 4OGEA 4CESA 3OYNA 2XY5A 3SJJA 1LAVA 4YNQA 4ZTFA 4PQUA 5SZTA 1S1TA 1TAQA 4FJKA 4NCBA 2HHXA 2O4IA 4TSXA 4ZTJA 4KRFA 1VSLA 3B6OA 1YTUA 1J54A 1UOCA 1U45A 1ZBFA 3AVKA 1R0AA 1SL0A 4K8ZA 1YVUA 3RMAA 4DTRA 4DQSA 3HM9A 4CJQA 2Z1GA 3NH1A 1RBSA 4N5SA 3H08A 2YNFA 2X74A 4DFJA 4J2DA 2KQ2A 3AVMA 1RDDA 1ASVA 3V4IA 4KTQA 3OYJA 3NGZA 3UIQA 2BANA 3OYIA 1SL2A 4KV8A 3VQDA 3ITHA 4CGFA 2HHVA 1TKTA 3JYTA 4DS4A 1YT3A 2HVHA 2OPSA 3K58A 1U4BA 4Z4EA 3AA4A 1JLAA 3A2FA 3LWLA 4DSJA 3HPHA 4CGHA 1KCFA 4E7JA 4CF8A 4FJXA 3AVLA 3SPZA 1F21A 1X9WA 1JKHA 5KI6A 4OPKA 1L5UA 1TGOA 4CK1A 4EZ6A 1RTHA 1QSLA 1RDAA 2D0CA 3HVRA 2HW3A 1WNSA 3RR7A 2YKNA 4GW6A 5T7BA 3AVCA 4F4KA 5CZ1A 4E89A 4KAZA 3DRRA 4CF2A 1RT6A 2E6LA 3VQQA 1HNIA 1JXBA 1VSFA 4W5RA 4DTXA 3TAEA 4FZYA 4JRQA 1BGXT 4I9LA 1DTTA 1WSHA 4PA1A 4MFBA 3DRSA 5E41A 3OYAA 3NCIA 1QSSA 1ZBHA 4Z4CA 3D45A 2Y1JA 4DU1A 5CY4A 5D3GA 1NK6A 5HRNA 2WONA 4NCGA 3G0ZA 4CFAA 1HQEA 2VG5A 3KK1A 3LAKA 1WSIA 1JLGA 2YNIA 3HYFA 4OKEA 4BE1A 2IC3A 4I2QA 4CFBA 5SWMA 3HPOA 4F8RA 4FJIA 2ITGA 3LZIA 4RW4A 3U6FA 1WSFA 4FJ7A 2F8TA 2OYQA 4KREA 4LH5A 3DLKA 1C0MA 4KHNA 4FJJA 1CZ9A 4M3RA 1QHTA 4E1MA 3ZT2A 4LH4A 1T03A 4DQPA 1BCMA 3KIOA 3I0SA 3ZCMA 1TKZA 3D0PA 2XO7A 4DF4A 4FK2A 4RW7A 4KFBA 1HYSA 4FXDA 2VG7A 4FM0A 3CYMA 4AHSA 1LV5A 3K2PA 4KI6A 4FJ9A 1HNVA 1KVBA 2Z1JA 3KK2A 3O3HA 4CJFA 4CGGA 1I39A 3DI6A 4AHTA 3SQ0A 4I9QA 1IKYA 3C6TA 3HP9A 1TKXA 4KHWA 3HK2A 4O0JA 4BWJA 3VQ7A 4AHVA 1NK9A 4FLXA 4BDPA 2PYLA 3SPYA 4DSLA 3EZ5A 4FLZA 4DTPA 2XY6A 1QE1A 1LW2A 3M8QA 3PX4A 1EKEA 4DFKA 2RN2A 4MQ3A 1JLQA 1SUQA 3K5OA 3RMBA 1IKWA 4CCHA 3HO1A 4CK2A 4CJRA 3M8RA 2IDOA 1MU2A 3HP6A 3NGYA 1LAWA 3LP2A 3QEVA 4W5TA 1L3SA 3LANA 1Q9XA 4OVLA 1N5YA 4DQRA 2GUIA 3V9SA 4FJNA 4Q5VA 4Z4FA 4KTZA 4Z4GA 1EX4A 4CHOA 3MAQA 2PY5A 1C1CA 3V1OA 3PY8A 3L2UA 4KHQA 1HRHA 1RILA 1BI4B 1FKPA 3O3FA 4CJ4A 4RW6A 4W5NA 2GV9A 1WAJA 2KFZA 2YKMA 3T1AA 1GOAA 4FLWA 1BL3A 1C6VA 4ELVA 3SYZA 4FM1A 4CIEA 5JS2A 4FLYA 1TL1A 1VSKA 2OPQA 1SKRA 3NF9A 2QKKA 4GMJB 1REVA 4EZ9A 4M42A 4CE9A 1L3TA 4E7LA 3PO4A 5I3UA 4CJPA 4E19A 1D9DA 3VQ6A 1RBTA 3EYZA 1BQMA 4I2PA 1LWCA 5J2QA 3MECA 4O4GA 4Z4IA 1DLOA 4N56A 3AO5A 3QEPA 4OKKA 2HHWA 3DYAA 3VA0A 4CF0A 3O3GA 1CLQA 5FRMA 1IKVA 1TVRA 3NH0A 3RR8A 3AVFA 1RDBA 4FJLA 1FK9A 3FFIA 2DFFA 4CJVA 2FBXA 4Z4HA 4JRPA 3ULDA 3L3UA 4KHSA 2ATQA 3AO2A 2QXFA 3AVAA 3LP1A 2NUBA 3I8DA 3SUNA 2KZMA 1IO2A 3M8PA 2VWJA 4B9LA 3RWUA 2WOMA 3C95A 3PUFA 3ZSQA 3MXMA 4KHYA 2HNYA 1C0TA 4BWMA 1U48A 3EY1A 3NBPA 4LSLA 5C24A 3KKRA 1RDCA 1ZBUA 4CJ5A 4DSEA 2OPRA 1J53A 2AJQA 2HB5A 3OYMA 4H4MA 2FBVA 1ZYQA 1TAUA 1I3AA 1HPZA 1FXXA 1TK0A 3SUOA 4QCLA 4E1NA 1NK5A 4J2EA 1NOZA 2XRIA 3V9UA 2YV0X 2HNZA 3VQPA 3QEXA 4FJHA 4HVJA 4LD0A 4IG0A 4DLEA 4XIUA 3S3OA 4KB1A 1X9MA 1WAFA 4OPJA 1RT1A 2HHTA 2R7YA 1LW0A 2IGIA 4FK4A 4B3OA 3V1RA 4NCAA 1BISA 1QS4A 1S9GA 1NJZA 1S6PA 2QK9A 4RG8A 4DMNA 5HLFA 1YTAA 1XHXA 4HUEA 1KLNA 2EHGA 2OZMA 3LZJA 1JL2A 4DFPA 4FZZA 3HJFA 2KFNA 1KVAA 4KKOA 4DTSA 3SQ1A 1T05A 5HRSA 1NOYA 1ZBIA 4HCCA 3AO1A 3T19A 4CEOA 5HBMA 3OYBA 1ASUA 4RW8A 3DMJA 3OYKA 1EXQA 3DRPA 4O44A 3WNHA 3CFRA 4KPYA 4PWDA 4UQGA 3TWHA 3SUQA 1LWEA 2D0BA 1Z26A 4DTUA 4J2BA 3K5MA 1JL1A 4B9MA 4FJGA 4DTOA 1WLJA 3AA5X 4O5BA 1CXUA 3TR8A 1NK8A 2G8KA 1DTQA 3ZT1A 4BE2A 1WN7A 3RMCA 3BGRA 4M3YA 1C1AA 1S1WA 4DLGA 4PUOA 2Y1IA 2G8UA 3ALYA 4CJKA 1T8EA 3T3FA 1S1UA 3S3MA 4FW2A 3WNGA 5CZ2A 1J5OA 1B9FA 5C25A 3S3NA 4CIGA 4ID5A 3NGIA 4CEBA 5KTQA 4N47A 3VA3A 5J2NA 1N6QA 3MEDA 2I5JA 3CM6A 3LDSA 3SV4A 4CF9A 3SV3A 2FBYA 4AILC 4B9SA 2YNHA 1K6YA 3HXMA 4H4OA 1KFDA 3L8BA 4AHCA 4DSKA 1Q8IA 4M45A 4DU3A 3G10A 4PY5A 5J1EA 1B92A 1RT3A 3HPGA 3U3GA 3L2QA 1SKWA 2DY4A 3I0RA 3L2WA 5DK5A 2RKIA 4FM2A 3AVJA 2B5JA 3KLGA 4FLUA 4CFCA 3NDKA
chains in the Genus database with same CATH superfamily
3K5LA 3CM5A 4ELUA 1BWFO 3SNNA 1YXQA 2NRRA 3FE1A 4E0DA 1TK5A 1RTJA 2F7TA 5LY3A 4M7XA 5TKWA 2QWNA 3MN5A 5C15A 5DMRA 4X62K 1Y64A 1RT7A 3JAMO 2ETJA 2P9SB 4B8CA 3GG4A 3QB0A 4FWPA 4YY3K 2P9KB 3VENA 4QOZB 4CK3A 2UYTA 1QSYA 4WFBL 4FWSA 3AO4A 3VQAA 4CEAA 1W0HA 2P5OA 1UA1A 1KVCA 1RFQA 5AJ3K 3CCLN 3KK7A 2P9NB 5HROA 2OANA 2VWKA 4H0YB 5F1XA 4AH9A 5FDLA 1NBWA 4DTNA 3TAMA 3AAQA 3CIPA 3HOTA 1VK0A 3LAMA 5HP1A 4B9NA 3DXKA 5GINA 3LWMA 3H46O 3SCXA 4FL9A 1U2VA 1BHLA 4C23A 2HVIA 2HHQA 4H5WA 4FCYA 4C8NA 4DV2K 5E84A 5JVGL 4B9TA 1HJRA 1YI2N 1MWMA 4YFUA 1C0GA 1N32K 3OYCA 4DWIA 4CJEA 3C7NB 1BA1A 5AQTA 4DS5A 5JLFA 4J2AA 2P5GA 3E01A 4CHQA 1NGDA 2F96A 3TABA 1NLVA 3TAPA 4E7KA 3QETA 4DKWA 3PLAA 2O8BA 4B1VA 3F5TA 3NFAA 5CHIA 4HUGA 4A62A 4H0VB 3HT3A 3PX6A 3AVHA 4H5TA 3DXKB 2F8SA 3SUPA 2OPPA 2O8BB 2BE2A 3LP3A 5HRPA 2E1ZA 1RT5A 4HUFA 4Y0WA 4H8KA 3MMVA 4FVMA 3TI0A 2E5LK 5K14A 2QWPA 1TV6A 5J2MA 1IH7A 3WXIA 3C94A 4FLTA 2E4LA 4CZKA 1FJGK 3TAGA 1B9DA 4DV1K 4M3UA 1TYQA 5EU7A 3NF7A 4CI6A 3AGRA 3QLHA 5I42A 2HMIA 4Y1DA 4E7HA 1K73O 1GLAG 4CHNA 2E2PA 3RRGA 1WSJA 1BA0A 1BCOA 5AQWA 3O1WA 2V7YA 3QNOA 3V9XA 3ZX2A 4QAGA 3L2RA 4AHRA 1RDWX 3VN5A 3DLBA 1S6QA 3BEXA 2YX6A 4W5QA 2VG6A 4YDUA 3KZBA 1Q82O 1W7AA 1TKDA 4JKGA 4LY7A 2G8FA 1RDUA 3OY9A 5M1NA 1XC9A 1JLFA 2ASPA 1J9AA 2YCHA 4QS8A 4FW1A 1HKBA 3SQ2A 3U9ZA 2NRTA 2PYJA 3VOVA 1UWBA 3ZSOA 4LF6K 3ZSWA 3H6EA 1WSGA 5J2PA 4RW9A 4FYDA 4BROA 3TAQA 1E4GT 4CEFA 5GAHP 2W42A 2YJEA 4NXNK 1OH6A 4JHDA 2IAJA 1MA9B 1MWKA 3C6UA 3BDPA 2HHSA 4G1QA 1VRUA 1O1WA 1JCFA 4ZHRA 3OJSA 3D2FB 5KGXA 5KRSA 1YAGA 2RHKA 4CJTA 5AQYA 2D0AA 4CESA 3KVGA 3GBTA 1ZC6A 5LMNK 4DV3K 1U45A 4K8ZA 4LF9K 1SL0A 5C0YA 3HM9A 2OCEA 1VQ4N 1QVGM 4KTQA 3NGZA 3UIQA 1E3MA 2HBMA 5AQZA 4KV8A 5CE3A 1TKTA 4DS4A 4H03B 1SAZA 1YT3A 2F4VK 4DR7K 1U4BA 4E7JA 3JXUA 4MLHA 3SPZA 1F21A 3T7ZA 4IWVA 3R3LA 4LF7K 4YOUA 2HW3A 4EAHD 3BZKA 3VEYA 4KAZA 5DM6L 3SMPA 3SBGA 4RWTA 2D4WA 4DTXA 4H0OA 2VQEK 1Q18A 4MFBA 3HOSA 2Y1JA 3O6WA 2Q2RA 5D3GA 2CGKA 1NK6A 3R1XA 3KK1A 4BE1A 2IC3A 4I2QA 5SWMA 4LF8K 2ITGA 5BPNA 4JKCA 2F8TA 2OYQA 4WF9L 4LH5A 3DLKA 1C0MA 3ZEUB 1QHTA 4E1MA 5MLCQ 1T03A 1VAZA 3D0PA 1NGHA 4JKHA 2UXDK 4BRHA 4K43A 3CCRN 2P9UA 1KVBA 3FR0A 4WYBA 3OA9A 3HZ6A 3C6TA 4JI2K 3HP9A 3UE5A 4O0JA 1Z6RA 4FLXA 4BDPA 2PYLA 4DSLA 4LF4K 4DTPA 4OPHA 3PX4A 2P9LA 4DFKA 2RN2A 3K5OA 3R8EA 4WQ4A 3QFUA 4XH5A 2IDOA 3QEVA 4HTLA 1BO5O 4W5TA 1L3SA 3LANA 4DQRA 3SMSA 4CZEA 4CHOA 3PY8A 3L2UA 5GIOA 1FKPA 3O3FA 4W5NA 1IV0A 3CHWA 1WAJA 4JK7A 3CQYA 1HR0K 4C1NK 2UUCK 3D6RA 2QKKA 2GTDA 4GMJB 4M42A 4E19A 4YORA 4I2PA 1NGJA 5J2QA 4JI5K 3CMAN 4CBXA 4N56A 3K0SA 2E1YA 4OKKA 4DV7K 2NZTA 2ASOA 3RR8A 4FJLA 2DFFA 3ULDA 3AVAA 3LP1A 3I8DA 3SUNA 2P9KA 2VWJA 4B9LA 2WOMA 3LDLA 1ESVA 2HNYA 3VEOA 3DWLA 1U48A 4K41A 3NBPA 3KKRA 4DSEA 4K0KK 3VTIA 2V51B 1VQLN 1ZYQA 1TK0A 2NRWA 3SUOA 3QFPA 2CGJA 1NK5A 3U4LA 3LDNA 2HNZA 3VQPA 3BF1A 4HVJA 4IG0A 2JWLA 4XIUA 4KB1A 5C10A 3VEWA 1WAFA 4OPJA 3E9OA 3E9LA 1LW0A 1BISA 2OZMA 4M63C 1KQSM 4DFPA 5M1QA 4GY2B 4DTSA 3CXCM 2YI1A 1ZBIA 3T19A 5HBMA 3LDPA 3WNHA 4KPYA 4PWDA 3H3OB 4UQGA 1Z26A 4FJGA 3WEEA 4JKFA 4CD3A 4FSVA 3UKRB 4F9OA 1FW6A 2G8UA 1S1UA 5FPEA 4FW2A 1HLUA 3MWPA 4ID5A 5J2NA 4JI3K 5KQDA 2QW9A 3LDSA 2YNHA 3HXMA 1YIJN 3HRGA 4IFEA 5J1EA 1RT3A 3HPGA 3U3GA 1IG8A 3EEQA 1DT9A 2RKIA 4JKDA 2EX3A 4DHYA 4M3TA 4C8LA 5EVZA 1YHQN 1NM1A 3O9QA 2UXCK 3PX0A 3F9MA 1W9HA 4WQ5A 3DM2A 2OTLN 4H5RA 3FZLA 3DLEA 3QIOA 1KLMA 4FWKA 3QEIA 2ZD1A 4CD1A 1S1VA 3QIPA 4DFMA 3KJVA 1VSHA 1GOCA 2AP1A 3KHYA 2W40A 1NU0A 4OPAA 3ZSYA 4OGCA 5FRNA 3D7EO 3QNNA 5BREA 3THYA 4OKJA 1N36K 2Q1NA 4DG1A 2YHAA 2ZGZA 2HHUA 3CJ7A 1FKOA 5AQSA 1C0UA 3VMFB 1TL3A 1KFSA 3KD1E 3ULEB 4CEEA 3ISNC 4HCBA 4JS4A 1P8ZA 4FWNA 3MEEA 1C0FA 1HNZK 4B8AB 1BI4A 3IS9A 3CG7A 5I9EB 3IFRA 1BUPA 2FLOA 2Q3SA 3AA3A 1WBBA 3L3VA 4NYNA 4C8MA 1J5EK 4QS7A 4BGBA 1KXPA 4KI4A 1E4FT 3U8XA 1NGGA 1HX1A 4DF8A 2HOEA 1TUUA 2W6KA 3WEEB 3TTFA 3CC4N 1JJ2M 4IEEA 2W6LA 1NMDA 2J4RA 4A5AA 4B1UB 4AHUA 4CJSA 2P51A 3LDOA 4AQYK 1RTDA 3KKSA 3VGMA 4I6MA 4W5OA 2G8HA 3CCJN 4CGIA 1RCHA 5AQMA 4OLAA 3OS0A 4JI6K 1CZBA 3FZKA 1L3VA 4J8FA 2ZE2A 5BR9A 4EHTA 1D4XA 3V81A 3QERA 4I7FA 1D8YA 3AVGA 1SS6A 4C1NI 2O8FB 4XH4A 5FROA 3BY5A 3CC2N 4CHYA 3V1QA 4YOTA 3DLRA 4FLVA 4DTMA 3MX2A 3F9KA 4F3TA 4CEDA 1NJYA 4DV4K 3AVBA 2DFEA 2QXLA 3VEZA 2JLEA 3SI6A 3RMDA 3VQ5A 5AZIA 5BPLA 1UA0A 2P9NA 4CEZA 1QQCA 1VQ5N 4V19S 2BGGA 4FWOA 1JLBA 3CCSN 2QM1A 2NRHA 3GOIA 4IFYA 5EX5A 1GLFO 2GBZA 4WFAL 3OVNA 3ZT4A 4BRAA 5HRRA 4H0PA 4F2RA 3AVIA 1XI1A 4BR0A 3ZEUA 1Z25A 4CGDA 4BRDA 1VRTA 3QBWA 2HHHK 2WC9A 2LSNA 3AO3A 3K5NA 4O5FA 2Z1HA 4KB0A 4IEIA 1SKSA 3LPUA 5GAGP 2X6SA 4CJ3A 3OYGA 4Q0BA 1Z05A 4B08A 3MXJA 4DR1K 3C6AA 1KAXA 1RT4A 4B9VA 4CZHA 2YHBA 3AGKA 1BQNA 3VQBA 3A0IX 3A5NC 3F2KA 4R5PA 4PKHA 2XHBA 4I6MB 4M3XA 5M1FA 1U04A 3KD5E 3C6HA 1CXQA 2YJFA 4ILHA 1LOTB 3WNFA 3CERA 4BR4A 3LALA 1KTQA 2OZSA 4BG9A 2OTJN 3S41A 5C42A 3CFOA 1X9SA 2JGUA 4IDHA 4DSKA 3K57A 4CJ7A 3QESA 4FJJA 3OJUA 2Z1IA 2HNDA 1RNHA 1RT2A 1VQ7N 4GVMA 1LAVA 4YNQA 5SZTA 1TAQA 2O4IA 4TSXA 4PKGA 3B6OA 1YTUA 3ID8A 2V52B 1ZBFA 4DUYK 3CPEA 4BRKA 3RMAA 3VGKA 5ELZA 2O8EA 1NGCA 4B1YB 4DFJA 1OKJA 3NVMA 4JAXA 3J7ZO 3OYIA 1SL2A 4X65K 5B8HA 3VQDA 3ITHA 4CGFA 2HHVA 2HF3A 4ILJA 2HVHA 5LMUK 4H0XB 1HUXA 3C7NA 1KD1O 2GWJA 4BRFA 4FJXA 1X9WA 5KI6A 1TGOA 2P9UB 1RTHA 4ISFA 5AQOA 3RR7A 3O5BA 2YKNA 5T7BA 5GIPA 5C2FA 4E89A 4CF2A 3TTDA 1RT6A 2E6LA 3L4IA 1VSFA 4BC2A 4JS5A 3NCIA 1QSSA 5E41A 1ZBHA 4Z4CA 3D45A 1BG3A 1JCEA 1WUAA 2FXUA 1WBDA 4DUZK 3EO3A 4IZ9A 5CY4A 4JD2B 1ZXOA 5HRNA 2WONA 2H3GX 3G0ZA 3SJHA 1HQEA 2VG5A 4R79A 4ZTFA 4M7YA 2VGMA 4A2AA 3HPOA 3GDQA 4F8RA 2ZM6K 4ISGA 5AQGA 4EIAA 2E20A 4LH4A 1BCMA 3ZCMA 1J6ZA 3DXMA 4RW7A 1ILYA 1HYSA 3W0LA 3CCEN 1QQOA 1LV5A 4AHSA 4FJ9A 1HNVA 2GWKA 4CJFA 4CGGA 4YOVA 3SQ0A 1TKXA 5LJWA 1S22A 1NK9A 2NLXA 4PHTX 1XUPO 4CZGA 3HBTA 3KWIA 1EKEA 4CCHA 3HO1A 3M8RA 1MU2A 1LAWA 3LP2A 5GADP 3LM9A 4Z4FA 4Q5VA 1ATNA 4IXCA 3MAQA 3WXKA 2PY5A 2YHYA 3V1OA 1RILA 2GV9A 1EO1A 3T1AA 1GOAA 1BL3A 2NNWA 4FM1A 3MK6A 2OPQA 3ULEA 3NF9A 1REVA 4EZ9A 4CE9A 4E7LA 3PO4A 5I3UA 1D9DA 3U9DA 1RBTA 1BQMA 3A5LC 3EE9A 3I8BA 2YHWA 3IMXA 1DLOA 1HKGA 3CJCA 3AO5A 2FF3B 3O9RA 3QEPA 3VA0A 1ATRA 1CLQA 1TVRA 1RDBA 3SK3A 1BU6O 1FK9A 3IDHA 3PIOL 1S3XA 2ATQA 3AO2A 2QXFA 1IO2A 3M8PA 3J7YP 3C95A 1OH8A 3ZX0A 3E9PA 3DXMB 3MXMA 3RSEB 5JVHL 1Q86O 3EY1A 5C24A 1ZBUA 4BC4A 4HWIA 2OPRA 2AJQA 2W41A 5AFUA 3OYMA 4H4MA 1VQKN 4K25A 4QCLA 3FLCO 4E1NA 2YHXA 1NJIO 3V9UA 3LM2A 3QEXA 1NNEA 1U6ZA 4FJHA 3PSIA 4YHHK 4NXMK 4DLEA 1X9MA 4KH6A 1RT1A 4MDAA 3THYB 1QHAA 4NCAA 3WQUA 1NJZA 2QK9A 4RG8A 3P4IA 3TSPA 1KLNA 3J80O 1TYQB 2KFNA 1KVAA 4KKOA 5HRSA 4BR5A 3AO1A 4HCCA 3K9JA 3OYBA 1ASUA 4RW8A 3OYKA 1EXQA 3DRPA 3CFRA 3TWHA 5FLXO 4GVEA 3K5MA 1JL1A 3TR8A 4O5BA 2G8KA 4BQLA 3ZT1A 1WN7A 1C1AA 1S1WA 4B3SK 1T8EA 3S3MA 5C25A 3S3NA 1QZ5A 4CEBA 4N47A 3CCQN 3CM6A 3SV3A 3UB5A 3C0BA 1KFDA 3L8BA 1Q8IA 2HBLA 4DB3A 3G10A 4PY5A 1B92A 4JEPA 5DK5A 4FM2A 3AVJA 3O8MA 2B5JA 3KLGA 4GNIA 4RCHA 4BVOA 4IO8A 1JXEA 3OYLA 3QO9A 3ZT3A 2ZQBA 5IT9O 3UKUA 3WQTA 1NGFA 2P1JA 4JHDB 4IOXA 4GV3A 2HSTA 1BIUA 2CH5A 3ZSXA 1Q9YA 1A5XA 4BR2A 3RRHA 3PIPL 3BZCA 2O8CA 4B3TK 3CJ9A 1NKEA 4NLBA 3L6QA 5AQUA 4IO9L 4O55A 1O13A 1XHZA 1EP4A 3AVNA 4IDKA 2QWLA 3CJ1A 3OHRA 3VQ9A 2WTUA 4IG3A 3B8AX 3IG1A 4JI1K 4LFCK 1RBVA 4BRLA 1N8RO 3HVTA 2JWKA 4BDYA 1VSEA 3HL8A 4HTUA 4M3WA 3AA2A 4ID1A 2B4JA 1XMOK 3EKSA 2QWQA 4CHPA 4LSNA 4DCHA 3RTVA 4CFDA 4ELTA 4NYFA 2IOCA 4BVPA 1T7PA 3OYHA 4PL7A 5BR8K 3AV9A 2PAVA 4LF5K 4FWRA 3L2VA 4BRCA 2D0OA 3NF8A 3JSMA 4IOCL 3EN9A 1YJ9N 3TANA 3IKMA 3KLFA 2QKBA 1VSMA 4WFNL 4F3OA 3L0QA 3LP0A 3T69A 4YOYA 4BR9A 2PZSA 3AAPA 3KLHA 3MCPA 1GLBG 1VSJA 2DTUA 4DV0K 1GLDG 4DQ8A 3KTQA 2Q97A 1MDUB 3DLHA 3NAEA 4EP5A 1M1KO 4FVUA 2X78A 4IJAA 3EZWA 4KTWA 4Z0UA 3HM8A 2G8IA 3HSCA 3D2FA 4DR6K 2ZJQL 3SAGA 1HPMA 3DLGA 1VQ8N 3FZHA 2FC0A 1I94K 4BQZA 3CCMN 2FSJA 3MN9A 3ZSVA 3V9WA 2AA4A 4E3SA 1SV5A 1XNQK 5JS1A 1K9MO 2NRXA 4CGJA 3VF6A 1RTIA 3ZSRA 5IWAK 3QDKA 1GOBA 1HQUA 4CBWA 3HSTB 1DEJA 3ATVA 3G25A 2KZZA 3WUHA 3KLEA 1NJXA 2O8CB 4XEIA 1IBLK 3QMLA 3OBWA 3F73A 1KSPA 1BOTO 4BDZA 4FJMA 1D5AA 1U47A 4CIFA 3ZETA 4OLBA 1HMVA 4CJLA 5A2QO 2I7PA 3OYDA 2O8FA 1S72N 3P38A 4Z94A 1X1PA 3SQ4A 1IJJA 1X3MA 1SL1A 3U3YA 5FPDA 1VQPN 4CERA 1U49A 3NF6A 3QEWA 4IKFA 2NRZA 3ZX3A 2A3ZA 5KPTA 3NMUA 3R9PA 4FPAA 3P83D 2KTQA 5KQ8A 3D2EB 4JN4A 3THVA 3TTCA 4X64K 3P39A 3G4SN 2G8VA 4OJRA 5JICA 2QWOA 4DTJA 5EY4A 2XY7A 3ASMA 4WQ5C 1RBRA 1V4TA 1UAXA 3KLIA 5BRDA 4ISEA 1D9FA 2DFHA 4IBNA 3IRXA 4MLEA 3O4QA 4A61A 1M90O 1G99A 4OO1J 1VSDA 3VETA 4DR2K 4DR4K 2XY5A 4FWMA 3PSFA 2E8AA 3G71N 1KAZA 1IBMK 4FJKA 5AQVA 4E1JA 3IUCA 1R0AA 1YVUA 2VQFK 2Z1GA 3BP8A 4KHPK 2X74A 3AVMA 1RDDA 3D2EA 3R6MA 4QS9A 3DJCA 2OPSA 1K8AO 3K58A 3AA4A 1VQMN 3HPHA 4JI0K 1KCFA 4GV6A 4KH5A 2VWBA 5AQQA 1JKHA 1L5UA 4OPKA 4EZ6A 5AQHA 4YDUC 1QSLA 3HVRA 5BRHA 1WNSA 2E2NA 4GW6A 2O8DA 3AVCA 1XNRK 3OTOK 4F4KA 1T6CA 5JMVA 1T6DA 1WB9A 3VQQA 4W5RA 4FZZA 4KI6A 3GL1A 4JRQA 1BGXT 1WSHA 4PA1A 3DRSA 1HNWK 2RE2A 4DU1A 3ZETB 3UKUB 4NCGA 4CFAA 1NKBA 1KAYA 3LAKA 1WSIA 3HYFA 4J2DA 4FJIA 4CFBA 2HBJA 2Q0UA 4RW4A 3U6FA 4FJ7A 3SBTA 4KREA 4KHNA 4M3RA 2UUAK 3RSEA 4KFBA 4JYAK 4FM0A 1TUYA 3K2PA 2Z1JA 3O3HA 5AZJA 1I39A 3DI6A 4PKIA 3H1QA 1IKYA 4DR5K 1KC8O 4KHWA 2P9LB 3VQ7A 4AHVA 4JKBA 1P90A 4BRNA 5AZIB 3SPYA 2XY6A 1QE1A 1LW2A 3VGLA 3AARA 3M8QA 1QQNA 1IKWA 3HP6A 1GLLO 1Q9XA 4OVLA 2FSNA 3O08A 1N5YA 3V9SA 1OH5A 4KTZA 4AF1A 4BRGA 3FFKB 3HI0A 3VF4A 4DR3K 2KFZA 4FLWA 1C6VA 3SYZA 5ADXA 1ATSA 1NGEA 4CIEA 4FLYA 3FZFA 1SKRA 2UU9K 4BRIA 2HMPA 5M1PA 3J81O 4JI7K 2IIRA 1L3TA 3MN7A 1RGIA 1LWCA 1T44A 5HOOA 3I56N 3TPQA 2QEXN 4O4GA 2HHWA 4CF0A 3O3GA 3ATUA 3AVFA 5FPNA 3CF5L 3J7AP 3FFIA 4CJVA 4PQUA 2FBXA 3CD6N 3L3UA 5AQXA 1VQ9N 2KZMA 2NUBA 3WXMB 1N34K 3MN6A 3PUFA 5AQNA 3ZSQA 4KHYA 1YITN 1C0TA 4BWMA 4JKGB 4LSLA 2HB5A 2FBVA 3CETA 1HPZA 1I3AA 5BRFA 1NWKA 2XRIA 2YV0X 2P9PB 4JD2A 5AQJA 3I33A 3ENOA 3THXA 1YJWN 3O4WA 5M1KA 3OW2M 3WT0A 4FK4A 4B3OA 3DAWA 3V1RA 4DMNA 4HUEA 2EHGA 2O8DB 3HJFA 3SQ1A 3MX5A 3DLLL 1T05A 3NVKA 3DMJA 4O44A 5H1SQ 1LWEA 2D0BA 4A57A 4DTUA 4J2BA 4BREA 3GE1A 3TSUA 5AQIA 3TU5A 4DTOA 3AA5X 2CGLA 3ID6A 1DTQA 3CMEN 3HTVA 3RMCA 3BGRA 1CZAN 2O8EB 2HBKA 4PUOA 2Y1IA 3ALYA 4CJKA 5CZ2A 4CIGA 3NGIA 5AQPA 5EOYA 3T1YK 4JI8K 5KTQA 1N6QA 3MEDA 3CCUN 4AILC 4MO4A 5EXWA 1OVYA 4M45A 3J8AA 4B9QA 4DU3A 3L2QA 1SKWA 2DY4A 4BRQA 1IBKK 4CFCA 3NDKA 1S9EA 4EFHA 2BH1A 2D5RA 4HHTA 4H5VA 3N4PA 4CJUA 4M41A 4GKKK 1NGIA 1GLJO 3K59A 2UXBK 5KRTA 4KO0A 4ICLA 3CCVN 2KKZA 4CZFA 1NG9A 1DGKN 3ENHA 1NK0A 1XQSC 4O8KA 1K8KB 3M8SA 2QI2A 4X66K 1NKCA 1XWLA 4JI4K 4EP4A 1BDGA 1YUWA 1NK7A 3SAHA 3NH2A 1HYZA 2O4GA 5KPRA 3DOLA 2Q31A 4DSFA 2A1RA 2P9IB 4PL8A 3OS1A 4L8RB 4Y1CA 4BRMA 5CYMA 4DQQA 1DKGD 2A1SA 4WE1A 2HF4A 4O8UA 2RPIA 4FK0A 4O0IA 5TKYA 1WOQA 1TK8A 1QQMA 3EL2A 4AM6A 4BE0A 1NJWA 2NRVA 2E2QA 3M3ZA 1G15A 1ITGA 3WNEA 2RF2A 1H1VA 4M3ZA 3G6EN 3S9HA 5GAEP 3OYFA 3TARA 3B6PA 3AY9A 2FBTA 4BACA 3BUZB 4N41A 1T3VA 3QBXA 3SZ2A 1QTMA 4CEQA 4KHUA 5C12A 5AQFA 2IS3A 5M1OA 3VEVA 3E66A 3MXIA 2UUBK 3LL3A 4F2SA 3OYEA 4CZLA 4L3QA 4YOWA 3VQ4A 4N76A 4FJ5A 5LL6Z 5AQLA 2V7ZA 2WFBA 3IAYA 3ZT0A 3V6DA 1S1XA 4K42A 4FO0A 3JS6A 3EKUA 3VQ8A 3MEGA 1HYVA 4KH4A 2ZGYA 3TAFA 5E26A 3VQCA 3O4NA 4A5BA 3NHGA 3PV8A 5BPMA 1Q7YO 3I55N 4CZJA 5HL7L 3SAFA 2I7NA 2E6MA 2B6AA 2CH6A 2VCPA 1JLEA 1IKXA 4WQ4C 3WXJA 4U67L 2X6NA 5BN9A 4CECA 3OBYA 1ZBSA 4DQIA 2P9IA 4C8KA 1Y97A 3RVCA 5AQKA 4KBOA 3VTHA 3MCAB 1KRPA 1A5VA 1JLCA 4ILGB 1K8KA 2D0PA 2FSKA 4CJWA 1Q81O 3V9ZA 3KK3A 1BIZA 2PFUA 1LWFA 5FPMA 1X9JA 4CHZA 1ZBLA 3CQXA 4FJ8A 1IG9A 1S5JA 2BDPA 2XY8A 3LPTA 3CFPA 4B9UA 3MWTA 4LFBK 2BUPA 1L3UA 2A5XA 5AR0A 4C8OA 1EETA 4OX9K 4JLHA 3K9KA 3P1GA 2QWMA 4DV6K 3P5JA 4JV5K 4FPBA 4IFVA 1XMQK 2YNGA 4FZXC 1VSIA 3PO5A 4BR7A 2BTFA 3VQEA 3EE8A 1ASWA 4E7IA 5ADXH 3VERA 1C1BA 3ZSZA 4FOIA 3OS2A 4LFAK 4AM7A 3A8YA 2GUPA 4DSIA 2ZF5O 3T1HK 1GLCG 3NE6A 1NK4A 5KGWA 2OA8A 4CF1A 3CPWM 1A5WA 4K8XA 2G8WA 3O9SA 4DU4A 5DM7L 3N4QA 1WSEA 3DOKA 2Q0RA 1EQYA 3QINA 2KW4A 1RBUA 3CI5A 3CJAA 5LJVA 3CQ8A 5CYQA 4MDBA 3OYNA 4OGEA 2QA4N 3SJJA 1S1TA 4NCBA 2HHXA 2Q36A 4ZTJA 4KRFA 1VSLA 4IJNA 1J54A 1UOCA 1HKCA 3AVKA 4DTRA 4DQSA 2E2OA 4CJQA 4A59A 3NH1A 1RBSA 3KWGA 3H08A 4N5SA 2FF6A 2YNFA 2KQ2A 1ASVA 3V4IA 3OYJA 2BANA 3UKRA 4CZIA 3JYTA 2VYPA 5F2RA 2GX9A 4Z4EA 3LWLA 1JLAA 1JCGA 3A2FA 4DSJA 4CGHA 4GV9A 4G9ZA 4CF8A 3AVLA 5JLHA 4JK9A 2KHOA 3W3DA 4CK1A 1VQON 3VEXA 4B1XB 3ENBA 1RDAA 2D0CA 4H5NA 4LC9B 4B1WB 5CZ1A 3DRRA 4CW7B 4NLCA 4JKEA 1NGBA 1EWQA 5AFUH 2KLAA 1HNIA 1JXBA 4FZYA 3TAEA 1SZ2A 1DTTA 4I9LA 3OYAA 3THXB 1OH7A 2A6AA 4B3RK 4WCEL 1YF5L 2DPNA 2YNIA 1JLGA 4JK8A 4OKEA 3QICA 3LZIA 2A41A 1WSFA 3L4QA 1GLEG 1CZ9A 4DQPA 3Q7CA 4I9QA 3ZT2A 3KIOA 3I0SA 1TKZA 4DF4A 2XO7A 4FK2A 3WXLA 4UY8O 4RTFD 4FXDA 2VG7A 5KPZA 3CYMA 3KK2A 4AHTA 2ZJRL 4U7BA 4FWQA 3HK2A 3M5RA 4BWJA 3E1YA 1HNXK 4BC3A 3EZ5A 4FLZA 2F9TA 4BGAA 4MQ3A 1JLQA 1SUQA 3RMBA 4B3MK 4FOEA 4CK2A 4CJRA 1VHXA 3NGYA 1YJNN 4FJNA 2GUIA 4Z4GA 1EX4A 2E88A 3O80A 3FZMA 1C1CA 1R59O 2F9WA 4KHQA 1HRHA 5CR4A 1U2VB 1BI4B 4JNEA 4CJ4A 4RW6A 3MDQA 1YVNA 2YKMA 4MO5A 4ELVA 1EWRA 3M6GA 3VESA 4GKJK 5JS2A 3ZYYX 1TL1A 1VSKA 2P9PA 2ZWHA 3A5OC 3TSQA 4B1ZA 4CJPA 3O1BA 4BG8A 3VQ6A 3EYZA 2IVPA 2D1KA 3MECA 4Z4IA 4JKAA 1V4SA 3CJBA 3DYAA 2IVNA 5FRMA 1IKVA 1HJOA 3NH0A 4Z4HA 2ASMA 5AZJB 4JRPA 3H3NO 4KHSA 1N33K 2WUSA 5C2DA 4BY9C 3RWUA 1VQNN 2A40A 4BRPA 4A2BA 2P9SA 1RDCA 4CJ5A 1J53A 4YOXA 3SLCA 1W97L 2WBNA 1TAUA 1FXXA 1VQ6N 1W2BM 1LCUA 2GEMA 4IOAL 3H1VX 4J2EA 2A42A 3A5MC 3Q7BA 5BN8A 4LD0A 3O9UA 1QZ6A 3S3OA 2HHTA 2IVOA 3THWA 4XH1A 2R7YA 2QWRA 1OVQA 2IGIA 1QVFM 2PBDA 4CBUA 1QS4A 1S9GA 3C65A 3P31A 1S6PA 5HLFA 1YTAA 1XHXA 1X3NA 3LDQA 4H0TB 3LZJA 1JL2A 3M1FA 4CVNE 5AQRA 4FWLA 1NOYA 2QTDA 3H45C 4CEOA 4EHUA 2EWSA 3SUQA 4B9MA 5F0XA 1WLJA 1CXUA 1XC3A 1NK8A 4NO7A 4BE2A 3O9TA 3VPZA 3CC7N 3FGUA 4BC5A 4NB4A 3ZLJA 4DV5K 4M3YA 2ITMA 1NMNA 1SQKA 2ZJPL 4DLGA 3T3FA 3BF3A 3VF2A 3WNGA 1J5OA 1B9FA 3VA3A 2VGNA 2I5JA 1NGAA 3SV4A 4CF9A 4B9SA 2FBYA 2GELA 1K6YA 4H4OA 4AHCA 4CZMA 3I0RA 3L2WA 3THWB 1NOZA 4FLUA
chains in the Genus database with same CATH topology
2EX3A 3K5LA 1S9EA 3CM5A 4M3TA 2D5RA 4ELUA 4HHTA 1JXEA 4C8LA 3OYLA 3SNNA 3QO9A 4CJUA 3ZT3A 4M41A 4E0DA 2ZQBA 3PX0A 1TK5A 1W9HA 2P1JA 1RTJA 3DM2A 3DLEA 3QIOA 1KLMA 1BIUA 5DMRA 1RT7A 3ZSXA 2ETJA 1A5XA 3K59A 3RRHA 1Q9YA 5KRTA 3QEIA 4KO0A 2ZD1A 4ICLA 4B8CA 1S1VA 3QIPA 4DFMA 1NK0A 1NKEA 3M8SA 3KJVA 4QOZB 1VSHA 1GOCA 4CK3A 1NKCA 1XWLA 4EP4A 1QSYA 3AO4A 3VQAA 4CEAA 1W0HA 4O55A 1NK7A 2P5OA 3NH2A 1HYZA 2O4GA 3ZSYA 1EP4A 3AVNA 1XHZA 4IDKA 1UA1A 1KVCA 3DOLA 4OGCA 4DSFA 2A1RA 3VQ9A 5FRNA 4IG3A 3QNNA 3IG1A 1RBVA 3HVTA 4OKJA 3OS1A 5HROA 4L8RB 4DG1A 2YHAA 1VSEA 2VWKA 4Y1CA 4BDYA 2HHUA 3HL8A 5CYMA 4DQQA 4HTUA 4M3WA 4AH9A 1FKOA 2A1SA 1C0UA 3AA2A 4ID1A 4WE1A 5FDLA 2B4JA 4DTNA 1TL3A 1KFSA 3KD1E 2RPIA 4CEEA 3ISNC 4CHPA 4O0IA 4FK0A 4LSNA 4HCBA 3TAMA 4JS4A 1TK8A 4BE0A 1NJWA 3RTVA 1VK0A 4CFDA 3LAMA 4ELTA 4NYFA 2IOCA 5HP1A 1G15A 3MEEA 1ITGA 3WNEA 2RF2A 3LWMA 4B9NA 1T7PA 3OYHA 3SCXA 4M3ZA 3S9HA 4B8AB 3OYFA 1BI4A 3IS9A 3B6PA 3TARA 1BHLA 2HVIA 2FBTA 3AV9A 3CG7A 2HHQA 4FCYA 4C8NA 4BACA 4N41A 3AA3A 2Q3SA 3L3VA 4NYNA 3SZ2A 4C8MA 3L2VA 1QTMA 4CEQA 4KHUA 4B9TA 1HJRA 4YFUA 3NF8A 2IS3A 3JSMA 4KI4A 3MXIA 3OYCA 4DWIA 3TANA 4CJEA 4F2SA 3KLFA 4DS5A 2QKBA 1VSMA 4F3OA 3OYEA 4J2AA 4DF8A 3VQ4A 4N76A 4FJ5A 3LP0A 2P5GA 3E01A 3IAYA 4CHQA 2PZSA 2F96A 4AHUA 2P51A 4CJSA 3KLHA 3TABA 1RTDA 3KKSA 4E7KA 3ZT0A 3TAPA 3QETA 3V6DA 1S1XA 4W5OA 1VSJA 2G8HA 2DTUA 4CGIA 3VQ8A 1RCHA 3MEGA 3KTQA 4OLAA 3OS0A 3NFAA 4HUGA 1CZBA 1HYVA 3DLHA 1L3VA 2ZE2A 3HT3A 3PX6A 3NAEA 3TAFA 4EP5A 3AVHA 3VQCA 3V81A 3QERA 3O4NA 4I7FA 1D8YA 3AVGA 2X78A 4KTWA 3NHGA 4Z0UA 5FROA 3PV8A 2F8SA 3SUPA 2G8IA 4CHYA 2OPPA 3V1QA 3DLRA 4FLVA 4DTMA 2BE2A 3F9KA 1NKBA 3LP3A 4F3TA 4JS5A 2E6MA 2B6AA 3DLGA 4CEDA 1JLEA 5HRPA 1NJYA 1IKXA 2FC0A 3AVBA 2DFEA 1RT5A 2JLEA 3SI6A 3ZSVA 4HUFA 3V9WA 4E3SA 5JS1A 1SV5A 2X6NA 3RMDA 3VQ5A 4CECA 1UA0A 4CGJA 2BGGA 4CEZA 1QQCA 4H8KA 1JLBA 1RTIA 4FVMA 3ZSRA 4DQIA 3TI0A 4C8KA 1GOBA 1HQUA 1Y97A 5K14A 4IFYA 1TV6A 5J2MA 1IH7A 3C94A 4FLTA 2E4LA 3HSTB 1KRPA 1A5VA 2GBZA 1JLCA 3TAGA 1B9DA 4CJWA 2KZZA 3V9ZA 3OVNA 3ZT4A 3KLEA 4M3UA 1NJXA 5EU7A 5HRRA 3KK3A 3NF7A 4F2RA 1BIZA 3AVIA 3QLHA 1LWFA 5I42A 2HMIA 4Y1DA 1XI1A 4E7HA 4CHZA 1Z25A 1ZBLA 4CHNA 4CGDA 3RRGA 1IG9A 1S5JA 4FJ8A 1VRTA 1WSJA 1BCOA 2XY8A 3LPTA 3F73A 3CFPA 1KSPA 2BDPA 3QNOA 4B9UA 3V9XA 2LSNA 3AO3A 4QAGA 4AHRA 3L2RA 3K5NA 2Z1HA 1L3UA 1SKSA 4C8OA 1EETA 4KB0A 4JLHA 4BDZA 3LPUA 3VN5A 3DLBA 4FJMA 1D5AA 2X6SA 1S6QA 3P1GA 4CJ3A 3OYGA 1U47A 4CIFA 4Q0BA 4B08A 3P5JA 3MXJA 4OLBA 1HMVA 4W5QA 4CJLA 2VG6A 3OYDA 4IFVA 1RT4A 1TKDA 4LY7A 2YNGA 2G8FA 4FZXC 1VSIA 4B9VA 3OY9A 2YHBA 1XC9A 1JLFA 3PO5A 1BQNA 3VQBA 1X1PA 3SQ4A 1J9AA 3VQEA 4R5PA 1SL1A 3U3YA 1ASWA 4E7IA 2XHBA 4FW1A 4CERA 1C1BA 3ZSZA 3OS2A 3NF6A 1U49A 3SQ2A 4M3XA 3QEWA 2PYJA 1UWBA 3ZSOA 4IKFA 4DSIA 1U04A 3ZSWA 3NE6A 1WSGA 5J2PA 3KD5E 1CXQA 4RW9A 1NK4A 5KGWA 3TAQA 4FYDA 4CEFA 3WNFA 3P83D 4CF1A 2W42A 2OA8A 2KTQA 1A5WA 3LALA 1KTQA 3THVA 2G8WA 2OZSA 4K8XA 4DU4A 2IAJA 2G8VA 1WSEA 4OJRA 3C6UA 3DOKA 5C42A 4DTJA 3CFOA 1X9SA 2XY7A 3ASMA 3BDPA 1RBRA 2HHSA 4G1QA 1VRUA 2JGUA 3QINA 1O1WA 2KW4A 1RBUA 1UAXA 4ZHRA 3KLIA 3OJSA 3K57A 3QESA 2DFHA 5KGXA 3OJUA 4IBNA 1D9FA 3IRXA 2Z1IA 2HNDA 3O4QA 5KRSA 3CQ8A 1RNHA 1RT2A 5CYQA 4GVMA 4CJTA 1VSDA 2D0AA 4OGEA 4CESA 3OYNA 2XY5A 3SJJA 1LAVA 4YNQA 4ZTFA 4PQUA 5SZTA 1S1TA 1TAQA 4FJKA 4NCBA 2HHXA 2O4IA 4TSXA 4ZTJA 4KRFA 1VSLA 3B6OA 1YTUA 1J54A 1UOCA 1U45A 1ZBFA 3AVKA 1R0AA 1SL0A 4K8ZA 1YVUA 3RMAA 4DTRA 4DQSA 3HM9A 4CJQA 2Z1GA 3NH1A 1RBSA 4N5SA 3H08A 2YNFA 2X74A 4DFJA 4J2DA 2KQ2A 3AVMA 1RDDA 1ASVA 3V4IA 4KTQA 3OYJA 3NGZA 3UIQA 2BANA 3OYIA 1SL2A 4KV8A 3VQDA 3ITHA 4CGFA 2HHVA 1TKTA 3JYTA 4DS4A 1YT3A 2HVHA 2OPSA 3K58A 1U4BA 4Z4EA 3AA4A 1JLAA 3A2FA 3LWLA 4DSJA 3HPHA 4CGHA 1KCFA 4E7JA 4CF8A 4FJXA 3AVLA 3SPZA 1F21A 1X9WA 1JKHA 5KI6A 4OPKA 1L5UA 1TGOA 4CK1A 4EZ6A 1RTHA 1QSLA 1RDAA 2D0CA 3HVRA 2HW3A 1WNSA 3RR7A 2YKNA 4GW6A 5T7BA 3AVCA 4F4KA 5CZ1A 4E89A 4KAZA 3DRRA 4CF2A 1RT6A 2E6LA 3VQQA 1HNIA 1JXBA 1VSFA 4W5RA 4DTXA 3TAEA 4FZYA 4JRQA 1BGXT 4I9LA 1DTTA 1WSHA 4PA1A 4MFBA 3DRSA 5E41A 3OYAA 3NCIA 1QSSA 1ZBHA 4Z4CA 3D45A 2Y1JA 4DU1A 5CY4A 5D3GA 1NK6A 5HRNA 2WONA 4NCGA 3G0ZA 4CFAA 1HQEA 2VG5A 3KK1A 3LAKA 1WSIA 1JLGA 2YNIA 3HYFA 4OKEA 4BE1A 2IC3A 4I2QA 4CFBA 5SWMA 3HPOA 4F8RA 4FJIA 2ITGA 3LZIA 4RW4A 3U6FA 1WSFA 4FJ7A 2F8TA 2OYQA 4KREA 4LH5A 3DLKA 1C0MA 4KHNA 4FJJA 1CZ9A 4M3RA 1QHTA 4E1MA 3ZT2A 4LH4A 1T03A 4DQPA 1BCMA 3KIOA 3I0SA 3ZCMA 1TKZA 3D0PA 2XO7A 4DF4A 4FK2A 4RW7A 4KFBA 1HYSA 4FXDA 2VG7A 4FM0A 3CYMA 4AHSA 1LV5A 3K2PA 4KI6A 4FJ9A 1HNVA 1KVBA 2Z1JA 3KK2A 3O3HA 4CJFA 4CGGA 1I39A 3DI6A 4AHTA 3SQ0A 4I9QA 1IKYA 3C6TA 3HP9A 1TKXA 4KHWA 3HK2A 4O0JA 4BWJA 3VQ7A 4AHVA 1NK9A 4FLXA 4BDPA 2PYLA 3SPYA 4DSLA 3EZ5A 4FLZA 4DTPA 2XY6A 1QE1A 1LW2A 3M8QA 3PX4A 1EKEA 4DFKA 2RN2A 4MQ3A 1JLQA 1SUQA 3K5OA 3RMBA 1IKWA 4CCHA 3HO1A 4CK2A 4CJRA 3M8RA 2IDOA 1MU2A 3HP6A 3NGYA 1LAWA 3LP2A 3QEVA 4W5TA 1L3SA 3LANA 1Q9XA 4OVLA 1N5YA 4DQRA 2GUIA 3V9SA 4FJNA 4Q5VA 4Z4FA 4KTZA 4Z4GA 1EX4A 4CHOA 3MAQA 2PY5A 1C1CA 3V1OA 3PY8A 3L2UA 4KHQA 1HRHA 1RILA 1BI4B 1FKPA 3O3FA 4CJ4A 4RW6A 4W5NA 2GV9A 1WAJA 2KFZA 2YKMA 3T1AA 1GOAA 4FLWA 1BL3A 1C6VA 4ELVA 3SYZA 4FM1A 4CIEA 5JS2A 4FLYA 1TL1A 1VSKA 2OPQA 1SKRA 3NF9A 2QKKA 4GMJB 1REVA 4EZ9A 4M42A 4CE9A 1L3TA 4E7LA 3PO4A 5I3UA 4CJPA 4E19A 1D9DA 3VQ6A 1RBTA 3EYZA 1BQMA 4I2PA 1LWCA 5J2QA 3MECA 4O4GA 4Z4IA 1DLOA 4N56A 3AO5A 3QEPA 4OKKA 2HHWA 3DYAA 3VA0A 4CF0A 3O3GA 1CLQA 5FRMA 1IKVA 1TVRA 3NH0A 3RR8A 3AVFA 1RDBA 4FJLA 1FK9A 3FFIA 2DFFA 4CJVA 2FBXA 4Z4HA 4JRPA 3ULDA 3L3UA 4KHSA 2ATQA 3AO2A 2QXFA 3AVAA 3LP1A 2NUBA 3I8DA 3SUNA 2KZMA 1IO2A 3M8PA 2VWJA 4B9LA 3RWUA 2WOMA 3C95A 3PUFA 3ZSQA 3MXMA 4KHYA 2HNYA 1C0TA 4BWMA 1U48A 3EY1A 3NBPA 4LSLA 5C24A 3KKRA 1RDCA 1ZBUA 4CJ5A 4DSEA 2OPRA 1J53A 2AJQA 2HB5A 3OYMA 4H4MA 2FBVA 1ZYQA 1TAUA 1I3AA 1HPZA 1FXXA 1TK0A 3SUOA 4QCLA 4E1NA 1NK5A 4J2EA 1NOZA 2XRIA 3V9UA 2YV0X 2HNZA 3VQPA 3QEXA 4FJHA 4HVJA 4LD0A 4IG0A 4DLEA 4XIUA 3S3OA 4KB1A 1X9MA 1WAFA 4OPJA 1RT1A 2HHTA 2R7YA 1LW0A 2IGIA 4FK4A 4B3OA 3V1RA 4NCAA 1BISA 1QS4A 1S9GA 1NJZA 1S6PA 2QK9A 4RG8A 4DMNA 5HLFA 1YTAA 1XHXA 4HUEA 1KLNA 2EHGA 2OZMA 3LZJA 1JL2A 4DFPA 4FZZA 3HJFA 2KFNA 1KVAA 4KKOA 4DTSA 3SQ1A 1T05A 5HRSA 1NOYA 1ZBIA 4HCCA 3AO1A 3T19A 4CEOA 5HBMA 3OYBA 1ASUA 4RW8A 3DMJA 3OYKA 1EXQA 3DRPA 4O44A 3WNHA 3CFRA 4KPYA 4PWDA 4UQGA 3TWHA 3SUQA 1LWEA 2D0BA 1Z26A 4DTUA 4J2BA 3K5MA 1JL1A 4B9MA 4FJGA 4DTOA 1WLJA 3AA5X 4O5BA 1CXUA 3TR8A 1NK8A 2G8KA 1DTQA 3ZT1A 4BE2A 1WN7A 3RMCA 3BGRA 4M3YA 1C1AA 1S1WA 4DLGA 4PUOA 2Y1IA 2G8UA 3ALYA 4CJKA 1T8EA 3T3FA 1S1UA 3S3MA 4FW2A 3WNGA 5CZ2A 1J5OA 1B9FA 5C25A 3S3NA 4CIGA 4ID5A 3NGIA 4CEBA 5KTQA 4N47A 3VA3A 5J2NA 1N6QA 3MEDA 2I5JA 3CM6A 3LDSA 3SV4A 4CF9A 3SV3A 2FBYA 4AILC 4B9SA 2YNHA 1K6YA 3HXMA 4H4OA 1KFDA 3L8BA 4AHCA 4DSKA 1Q8IA 4M45A 4DU3A 3G10A 4PY5A 5J1EA 1B92A 1RT3A 3HPGA 3U3GA 3L2QA 1SKWA 2DY4A 3I0RA 3L2WA 5DK5A 2RKIA 4FM2A 3AVJA 2B5JA 3KLGA 4FLUA 4CFCA 3NDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX3 A;  3K5L A;  1S9E A;  3CM5 A;  4M3T A;  2D5R A;  4ELU A;  4HHT A;  1JXE A;  4C8L A;  3OYL A;  3SNN A;  3QO9 A;  4CJU A;  3ZT3 A;  4M41 A;  4E0D A;  2ZQB A;  3PX0 A;  1TK5 A;  1W9H A;  2P1J A;  1RTJ A;  3DM2 A;  3DLE A;  3QIO A;  1KLM A;  1BIU A;  5DMR A;  1RT7 A;  3ZSX A;  2ETJ A;  1A5X A;  3K59 A;  3RRH A;  1Q9Y A;  5KRT A;  3QEI A;  4KO0 A;  2ZD1 A;  4ICL A;  4B8C A;  1S1V A;  3QIP A;  4DFM A;  1NK0 A;  1NKE A;  3M8S A;  3KJV A;  4QOZ B;  1VSH A;  1GOC A;  4CK3 A;  1NKC A;  1XWL A;  4EP4 A;  1QSY A;  3AO4 A;  3VQA A;  4CEA A;  1W0H A;  4O55 A;  1NK7 A;  2P5O A;  3NH2 A;  1HYZ A;  2O4G A;  3ZSY A;  1EP4 A;  3AVN A;  1XHZ A;  4IDK A;  1UA1 A;  1KVC A;  3DOL A;  4OGC A;  4DSF A;  2A1R A;  3VQ9 A;  5FRN A;  4IG3 A;  3QNN A;  3IG1 A;  1RBV A;  3HVT A;  4OKJ A;  3OS1 A;  5HRO A;  4L8R B;  4DG1 A;  2YHA A;  1VSE A;  2VWK A;  4Y1C A;  4BDY A;  2HHU A;  3HL8 A;  5CYM A;  4DQQ A;  4HTU A;  4M3W A;  4AH9 A;  1FKO A;  2A1S A;  1C0U A;  3AA2 A;  4ID1 A;  4WE1 A;  5FDL A;  2B4J A;  4DTN A;  1TL3 A;  1KFS A;  3KD1 E;  2RPI A;  4CEE A;  3ISN C;  4CHP A;  4O0I A;  4FK0 A;  4LSN A;  4HCB A;  3TAM A;  4JS4 A;  1TK8 A;  4BE0 A;  1NJW A;  3RTV A;  1VK0 A;  4CFD A;  3LAM A;  4ELT A;  4NYF A;  2IOC A;  5HP1 A;  1G15 A;  3MEE A;  1ITG A;  3WNE A;  2RF2 A;  3LWM A;  4B9N A;  1T7P A;  3OYH A;  3SCX A;  4M3Z A;  3S9H A;  4B8A B;  3OYF A;  1BI4 A;  3IS9 A;  3B6P A;  3TAR A;  1BHL A;  2HVI A;  2FBT A;  3AV9 A;  3CG7 A;  2HHQ A;  4FCY A;  4C8N A;  4BAC A;  4N41 A;  3AA3 A;  2Q3S A;  3L3V A;  4NYN A;  3SZ2 A;  4C8M A;  3L2V A;  1QTM A;  4CEQ A;  4KHU A;  4B9T A;  1HJR A;  4YFU A;  3NF8 A;  2IS3 A;  3JSM A;  4KI4 A;  3MXI A;  3OYC A;  4DWI A;  3TAN A;  4CJE A;  4F2S A;  3KLF A;  4DS5 A;  2QKB A;  1VSM A;  4F3O A;  3OYE A;  4J2A A;  4DF8 A;  3VQ4 A;  4N76 A;  4FJ5 A;  3LP0 A;  2P5G A;  3E01 A;  3IAY A;  4CHQ A;  2PZS A;  2F96 A;  4AHU A;  2P51 A;  4CJS A;  3KLH A;  3TAB A;  1RTD A;  3KKS A;  4E7K A;  3ZT0 A;  3TAP A;  3QET A;  3V6D A;  1S1X A;  4W5O A;  1VSJ A;  2G8H A;  2DTU A;  4CGI A;  3VQ8 A;  1RCH A;  3MEG A;  3KTQ A;  4OLA A;  3OS0 A;  3NFA A;  4HUG A;  1CZB A;  1HYV A;  3DLH A;  1L3V A;  2ZE2 A;  3HT3 A;  3PX6 A;  3NAE A;  3TAF A;  4EP5 A;  3AVH A;  3VQC A;  3V81 A;  3QER A;  3O4N A;  4I7F A;  1D8Y A;  3AVG A;  2X78 A;  4KTW A;  3NHG A;  4Z0U A;  5FRO A;  3PV8 A;  2F8S A;  3SUP A;  2G8I A;  4CHY A;  2OPP A;  3V1Q A;  3DLR A;  4FLV A;  4DTM A;  2BE2 A;  3F9K A;  1NKB A;  3LP3 A;  4F3T A;  4JS5 A;  2E6M A;  2B6A A;  3DLG A;  4CED A;  1JLE A;  5HRP A;  1NJY A;  1IKX A;  2FC0 A;  3AVB A;  2DFE A;  1RT5 A;  2JLE A;  3SI6 A;  3ZSV A;  4HUF A;  3V9W A;  4E3S A;  5JS1 A;  1SV5 A;  2X6N A;  3RMD A;  3VQ5 A;  4CEC A;  1UA0 A;  4CGJ A;  2BGG A;  4CEZ A;  1QQC A;  4H8K A;  1JLB A;  1RTI A;  4FVM A;  3ZSR A;  4DQI A;  3TI0 A;  4C8K A;  1GOB A;  1HQU A;  1Y97 A;  5K14 A;  4IFY A;  1TV6 A;  5J2M A;  1IH7 A;  3C94 A;  4FLT A;  2E4L A;  3HST B;  1KRP A;  1A5V A;  2GBZ A;  1JLC A;  3TAG A;  1B9D A;  4CJW A;  2KZZ A;  3V9Z A;  3OVN A;  3ZT4 A;  3KLE A;  4M3U A;  1NJX A;  5EU7 A;  5HRR A;  3KK3 A;  3NF7 A;  4F2R A;  1BIZ A;  3AVI A;  3QLH A;  1LWF A;  5I42 A;  2HMI A;  4Y1D A;  1XI1 A;  4E7H A;  4CHZ A;  1Z25 A;  1ZBL A;  4CHN A;  4CGD A;  3RRG A;  1IG9 A;  1S5J A;  4FJ8 A;  1VRT A;  1WSJ A;  1BCO A;  2XY8 A;  3LPT A;  3F73 A;  3CFP A;  1KSP A;  2BDP A;  3QNO A;  4B9U A;  3V9X A;  2LSN A;  3AO3 A;  4QAG A;  4AHR A;  3L2R A;  3K5N A;  2Z1H A;  1L3U A;  1SKS A;  4C8O A;  1EET A;  4KB0 A;  4JLH A;  4BDZ A;  3LPU A;  3VN5 A;  3DLB A;  4FJM A;  1D5A A;  2X6S A;  1S6Q A;  3P1G A;  4CJ3 A;  3OYG A;  1U47 A;  4CIF A;  4Q0B A;  4B08 A;  3P5J A;  3MXJ A;  4OLB A;  1HMV A;  4W5Q A;  4CJL A;  2VG6 A;  3OYD A;  4IFV A;  1RT4 A;  1TKD A;  4LY7 A;  2YNG A;  2G8F A;  4FZX C;  1VSI A;  4B9V A;  3OY9 A;  2YHB A;  1XC9 A;  1JLF A;  3PO5 A;  1BQN A;  3VQB A;  1X1P A;  3SQ4 A;  1J9A A;  3VQE A;  4R5P A;  1SL1 A;  3U3Y A;  1ASW A;  4E7I A;  2XHB A;  4FW1 A;  4CER A;  1C1B A;  3ZSZ A;  3OS2 A;  3NF6 A;  1U49 A;  3SQ2 A;  4M3X A;  3QEW A;  2PYJ A;  1UWB A;  3ZSO A;  4IKF A;  4DSI A;  1U04 A;  3ZSW A;  3NE6 A;  1WSG A;  5J2P A;  3KD5 E;  1CXQ A;  4RW9 A;  1NK4 A;  5KGW A;  3TAQ A;  4FYD A;  4CEF A;  3WNF A;  3P83 D;  4CF1 A;  2W42 A;  2OA8 A;  2KTQ A;  1A5W A;  3LAL A;  1KTQ A;  3THV A;  2G8W A;  2OZS A;  4K8X A;  4DU4 A;  2IAJ A;  2G8V A;  1WSE A;  4OJR A;  3C6U A;  3DOK A;  5C42 A;  4DTJ A;  3CFO A;  1X9S A;  2XY7 A;  3ASM A;  3BDP A;  1RBR A;  2HHS A;  4G1Q A;  1VRU A;  2JGU A;  3QIN A;  1O1W A;  2KW4 A;  1RBU A;  1UAX A;  4ZHR A;  3KLI A;  3OJS A;  3K57 A;  3QES A;  2DFH A;  5KGX A;  3OJU A;  4IBN A;  1D9F A;  3IRX A;  2Z1I A;  2HND A;  3O4Q A;  5KRS A;  3CQ8 A;  1RNH A;  1RT2 A;  5CYQ A;  4GVM A;  4CJT A;  1VSD A;  2D0A A;  4OGE A;  4CES A;  3OYN A;  2XY5 A;  3SJJ A;  1LAV A;  4YNQ A;  4ZTF A;  4PQU A;  5SZT A;  1S1T A;  1TAQ A;  4FJK A;  4NCB A;  2HHX A;  2O4I A;  4TSX A;  4ZTJ A;  4KRF A;  1VSL A;  3B6O A;  1YTU A;  1J54 A;  1UOC A;  1U45 A;  1ZBF A;  3AVK A;  1R0A A;  1SL0 A;  4K8Z A;  1YVU A;  3RMA A;  4DTR A;  4DQS A;  3HM9 A;  4CJQ A;  2Z1G A;  3NH1 A;  1RBS A;  4N5S A;  3H08 A;  2YNF A;  2X74 A;  4DFJ A;  4J2D A;  2KQ2 A;  3AVM A;  1RDD A;  1ASV A;  3V4I A;  4KTQ A;  3OYJ A;  3NGZ A;  3UIQ A;  2BAN A;  3OYI A;  1SL2 A;  4KV8 A;  3VQD A;  3ITH A;  4CGF A;  2HHV A;  1TKT A;  3JYT A;  4DS4 A;  1YT3 A;  2HVH A;  2OPS A;  3K58 A;  1U4B A;  4Z4E A;  3AA4 A;  1JLA A;  3A2F A;  3LWL A;  4DSJ A;  3HPH A;  4CGH A;  1KCF A;  4E7J A;  4CF8 A;  4FJX A;  3AVL A;  3SPZ A;  1F21 A;  1X9W A;  1JKH A;  5KI6 A;  4OPK A;  1L5U A;  1TGO A;  4CK1 A;  4EZ6 A;  1RTH A;  1QSL A;  1RDA A;  2D0C A;  3HVR A;  2HW3 A;  1WNS A;  3RR7 A;  2YKN A;  4GW6 A;  5T7B A;  3AVC A;  4F4K A;  5CZ1 A;  4E89 A;  4KAZ A;  3DRR A;  4CF2 A;  1RT6 A;  2E6L A;  3VQQ A;  1HNI A;  1JXB A;  1VSF A;  4W5R A;  4DTX A;  3TAE A;  4FZY A;  4JRQ A;  1BGX T;  4I9L A;  1DTT A;  1WSH A;  4PA1 A;  4MFB A;  3DRS A;  5E41 A;  3OYA A;  3NCI A;  1QSS A;  1ZBH A;  4Z4C A;  3D45 A;  2Y1J A;  4DU1 A;  5CY4 A;  5D3G A;  1NK6 A;  5HRN A;  2WON A;  4NCG A;  3G0Z A;  4CFA A;  1HQE A;  2VG5 A;  3KK1 A;  3LAK A;  1WSI A;  1JLG A;  2YNI A;  3HYF A;  4OKE A;  4BE1 A;  2IC3 A;  4I2Q A;  4CFB A;  5SWM A;  3HPO A;  4F8R A;  4FJI A;  2ITG A;  3LZI A;  4RW4 A;  3U6F A;  1WSF A;  4FJ7 A;  2F8T A;  2OYQ A;  4KRE A;  4LH5 A;  3DLK A;  1C0M A;  4KHN A;  4FJJ A;  1CZ9 A;  4M3R A;  1QHT A;  4E1M A;  3ZT2 A;  4LH4 A;  1T03 A;  4DQP A;  1BCM A;  3KIO A;  3I0S A;  3ZCM A;  1TKZ A;  3D0P A;  2XO7 A;  4DF4 A;  4FK2 A;  4RW7 A;  4KFB A;  1HYS A;  4FXD A;  2VG7 A;  4FM0 A;  3CYM A;  4AHS A;  1LV5 A;  3K2P A;  4KI6 A;  4FJ9 A;  1HNV A;  1KVB A;  2Z1J A;  3KK2 A;  3O3H A;  4CJF A;  4CGG A;  1I39 A;  3DI6 A;  4AHT A;  3SQ0 A;  4I9Q A;  1IKY A;  3C6T A;  3HP9 A;  1TKX A;  4KHW A;  3HK2 A;  4O0J A;  4BWJ A;  3VQ7 A;  4AHV A;  1NK9 A;  4FLX A;  4BDP A;  2PYL A;  3SPY A;  4DSL A;  3EZ5 A;  4FLZ A;  4DTP A;  2XY6 A;  1QE1 A;  1LW2 A;  3M8Q A;  3PX4 A;  1EKE A;  4DFK A;  2RN2 A;  4MQ3 A;  1JLQ A;  1SUQ A;  3K5O A;  3RMB A;  1IKW A;  4CCH A;  3HO1 A;  4CK2 A;  4CJR A;  3M8R A;  2IDO A;  1MU2 A;  3HP6 A;  3NGY A;  1LAW A;  3LP2 A;  3QEV A;  4W5T A;  1L3S A;  3LAN A;  1Q9X A;  4OVL A;  1N5Y A;  4DQR A;  2GUI A;  3V9S A;  4FJN A;  4Q5V A;  4Z4F A;  4KTZ A;  4Z4G A;  1EX4 A;  4CHO A;  3MAQ A;  2PY5 A;  1C1C A;  3V1O A;  3PY8 A;  3L2U A;  4KHQ A;  1HRH A;  1RIL A;  1BI4 B;  1FKP A;  3O3F A;  4CJ4 A;  4RW6 A;  4W5N A;  2GV9 A;  1WAJ A;  2KFZ A;  2YKM A;  3T1A A;  1GOA A;  4FLW A;  1BL3 A;  1C6V A;  4ELV A;  3SYZ A;  4FM1 A;  4CIE A;  5JS2 A;  4FLY A;  1TL1 A;  1VSK A;  2OPQ A;  1SKR A;  3NF9 A;  2QKK A;  4GMJ B;  1REV A;  4EZ9 A;  4M42 A;  4CE9 A;  1L3T A;  4E7L A;  3PO4 A;  5I3U A;  4CJP A;  4E19 A;  1D9D A;  3VQ6 A;  1RBT A;  3EYZ A;  1BQM A;  4I2P A;  1LWC A;  5J2Q A;  3MEC A;  4O4G A;  4Z4I A;  1DLO A;  4N56 A;  3AO5 A;  3QEP A;  4OKK A;  2HHW A;  3DYA A;  3VA0 A;  4CF0 A;  3O3G A;  1CLQ A;  5FRM A;  1IKV A;  1TVR A;  3NH0 A;  3RR8 A;  3AVF A;  1RDB A;  4FJL A;  1FK9 A;  3FFI A;  2DFF A;  4CJV A;  2FBX A;  4Z4H A;  4JRP A;  3ULD A;  3L3U A;  4KHS A;  2ATQ A;  3AO2 A;  2QXF A;  3AVA A;  3LP1 A;  2NUB A;  3I8D A;  3SUN A;  2KZM A;  1IO2 A;  3M8P A;  2VWJ A;  4B9L A;  3RWU A;  2WOM A;  3C95 A;  3PUF A;  3ZSQ A;  3MXM A;  4KHY A;  2HNY A;  1C0T A;  4BWM A;  1U48 A;  3EY1 A;  3NBP A;  4LSL A;  5C24 A;  3KKR A;  1RDC A;  1ZBU A;  4CJ5 A;  4DSE A;  2OPR A;  1J53 A;  2AJQ A;  2HB5 A;  3OYM A;  4H4M A;  2FBV A;  1ZYQ A;  1TAU A;  1I3A A;  1HPZ A;  1FXX A;  1TK0 A;  3SUO A;  4QCL A;  4E1N A;  1NK5 A;  4J2E A;  1NOZ A;  2XRI A;  3V9U A;  2YV0 X;  2HNZ A;  3VQP A;  3QEX A;  4FJH A;  4HVJ A;  4LD0 A;  4IG0 A;  4DLE A;  4XIU A;  3S3O A;  4KB1 A;  1X9M A;  1WAF A;  4OPJ A;  1RT1 A;  2HHT A;  2R7Y A;  1LW0 A;  2IGI A;  4FK4 A;  4B3O A;  3V1R A;  4NCA A;  1BIS A;  1QS4 A;  1S9G A;  1NJZ A;  1S6P A;  2QK9 A;  4RG8 A;  4DMN A;  5HLF A;  1YTA A;  1XHX A;  4HUE A;  1KLN A;  2EHG A;  2OZM A;  3LZJ A;  1JL2 A;  4DFP A;  4FZZ A;  3HJF A;  2KFN A;  1KVA A;  4KKO A;  4DTS A;  3SQ1 A;  1T05 A;  5HRS A;  1NOY A;  1ZBI A;  4HCC A;  3AO1 A;  3T19 A;  4CEO A;  5HBM A;  3OYB A;  1ASU A;  4RW8 A;  3DMJ A;  3OYK A;  1EXQ A;  3DRP A;  4O44 A;  3WNH A;  3CFR A;  4KPY A;  4PWD A;  4UQG A;  3TWH A;  3SUQ A;  1LWE A;  2D0B A;  1Z26 A;  4DTU A;  4J2B A;  3K5M A;  1JL1 A;  4B9M A;  4FJG A;  4DTO A;  1WLJ A;  3AA5 X;  4O5B A;  1CXU A;  3TR8 A;  1NK8 A;  2G8K A;  1DTQ A;  3ZT1 A;  4BE2 A;  1WN7 A;  3RMC A;  3BGR A;  4M3Y A;  1C1A A;  1S1W A;  4DLG A;  4PUO A;  2Y1I A;  2G8U A;  3ALY A;  4CJK A;  1T8E A;  3T3F A;  1S1U A;  3S3M A;  4FW2 A;  3WNG A;  5CZ2 A;  1J5O A;  1B9F A;  5C25 A;  3S3N A;  4CIG A;  4ID5 A;  3NGI A;  4CEB A;  5KTQ A;  4N47 A;  3VA3 A;  5J2N A;  1N6Q A;  3MED A;  2I5J A;  3CM6 A;  3LDS A;  3SV4 A;  4CF9 A;  3SV3 A;  2FBY A;  4AIL C;  4B9S A;  2YNH A;  1K6Y A;  3HXM A;  4H4O A;  1KFD A;  3L8B A;  4AHC A;  4DSK A;  1Q8I A;  4M45 A;  4DU3 A;  3G10 A;  4PY5 A;  5J1E A;  1B92 A;  1RT3 A;  3HPG A;  3U3G A;  3L2Q A;  1SKW A;  2DY4 A;  3I0R A;  3L2W A;  5DK5 A;  2RKI A;  4FM2 A;  3AVJ A;  2B5J A;  3KLG A;  4FLU A;  4CFC A;  3NDK A; 
#chains in the Genus database with same CATH topology
 3K5L A;  3CM5 A;  4ELU A;  1BWF O;  3SNN A;  1YXQ A;  2NRR A;  3FE1 A;  4E0D A;  1TK5 A;  1RTJ A;  2F7T A;  5LY3 A;  4M7X A;  5TKW A;  2QWN A;  3MN5 A;  5C15 A;  5DMR A;  4X62 K;  1Y64 A;  1RT7 A;  3JAM O;  2ETJ A;  2P9S B;  4B8C A;  3GG4 A;  3QB0 A;  4FWP A;  4YY3 K;  2P9K B;  3VEN A;  4QOZ B;  4CK3 A;  2UYT A;  1QSY A;  4WFB L;  4FWS A;  3AO4 A;  3VQA A;  4CEA A;  1W0H A;  2P5O A;  1UA1 A;  1KVC A;  1RFQ A;  5AJ3 K;  3CCL N;  3KK7 A;  2P9N B;  5HRO A;  2OAN A;  2VWK A;  4H0Y B;  5F1X A;  4AH9 A;  5FDL A;  1NBW A;  4DTN A;  3TAM A;  3AAQ A;  3CIP A;  3HOT A;  1VK0 A;  3LAM A;  5HP1 A;  4B9N A;  3DXK A;  5GIN A;  3LWM A;  3H46 O;  3SCX A;  4FL9 A;  1U2V A;  1BHL A;  4C23 A;  2HVI A;  2HHQ A;  4H5W A;  4FCY A;  4C8N A;  4DV2 K;  5E84 A;  5JVG L;  4B9T A;  1HJR A;  1YI2 N;  1MWM A;  4YFU A;  1C0G A;  1N32 K;  3OYC A;  4DWI A;  4CJE A;  3C7N B;  1BA1 A;  5AQT A;  4DS5 A;  5JLF A;  4J2A A;  2P5G A;  3E01 A;  4CHQ A;  1NGD A;  2F96 A;  3TAB A;  1NLV A;  3TAP A;  4E7K A;  3QET A;  4DKW A;  3PLA A;  2O8B A;  4B1V A;  3F5T A;  3NFA A;  5CHI A;  4HUG A;  4A62 A;  4H0V B;  3HT3 A;  3PX6 A;  3AVH A;  4H5T A;  3DXK B;  2F8S A;  3SUP A;  2OPP A;  2O8B B;  2BE2 A;  3LP3 A;  5HRP A;  2E1Z A;  1RT5 A;  4HUF A;  4Y0W A;  4H8K A;  3MMV A;  4FVM A;  3TI0 A;  2E5L K;  5K14 A;  2QWP A;  1TV6 A;  5J2M A;  1IH7 A;  3WXI A;  3C94 A;  4FLT A;  2E4L A;  4CZK A;  1FJG K;  3TAG A;  1B9D A;  4DV1 K;  4M3U A;  1TYQ A;  5EU7 A;  3NF7 A;  4CI6 A;  3AGR A;  3QLH A;  5I42 A;  2HMI A;  4Y1D A;  4E7H A;  1K73 O;  1GLA G;  4CHN A;  2E2P A;  3RRG A;  1WSJ A;  1BA0 A;  1BCO A;  5AQW A;  3O1W A;  2V7Y A;  3QNO A;  3V9X A;  3ZX2 A;  4QAG A;  3L2R A;  4AHR A;  1RDW X;  3VN5 A;  3DLB A;  1S6Q A;  3BEX A;  2YX6 A;  4W5Q A;  2VG6 A;  4YDU A;  3KZB A;  1Q82 O;  1W7A A;  1TKD A;  4JKG A;  4LY7 A;  2G8F A;  1RDU A;  3OY9 A;  5M1N A;  1XC9 A;  1JLF A;  2ASP A;  1J9A A;  2YCH A;  4QS8 A;  4FW1 A;  1HKB A;  3SQ2 A;  3U9Z A;  2NRT A;  2PYJ A;  3VOV A;  1UWB A;  3ZSO A;  4LF6 K;  3ZSW A;  3H6E A;  1WSG A;  5J2P A;  4RW9 A;  4FYD A;  4BRO A;  3TAQ A;  1E4G T;  4CEF A;  5GAH P;  2W42 A;  2YJE A;  4NXN K;  1OH6 A;  4JHD A;  2IAJ A;  1MA9 B;  1MWK A;  3C6U A;  3BDP A;  2HHS A;  4G1Q A;  1VRU A;  1O1W A;  1JCF A;  4ZHR A;  3OJS A;  3D2F B;  5KGX A;  5KRS A;  1YAG A;  2RHK A;  4CJT A;  5AQY A;  2D0A A;  4CES A;  3KVG A;  3GBT A;  1ZC6 A;  5LMN K;  4DV3 K;  1U45 A;  4K8Z A;  4LF9 K;  1SL0 A;  5C0Y A;  3HM9 A;  2OCE A;  1VQ4 N;  1QVG M;  4KTQ A;  3NGZ A;  3UIQ A;  1E3M A;  2HBM A;  5AQZ A;  4KV8 A;  5CE3 A;  1TKT A;  4DS4 A;  4H03 B;  1SAZ A;  1YT3 A;  2F4V K;  4DR7 K;  1U4B A;  4E7J A;  3JXU A;  4MLH A;  3SPZ A;  1F21 A;  3T7Z A;  4IWV A;  3R3L A;  4LF7 K;  4YOU A;  2HW3 A;  4EAH D;  3BZK A;  3VEY A;  4KAZ A;  5DM6 L;  3SMP A;  3SBG A;  4RWT A;  2D4W A;  4DTX A;  4H0O A;  2VQE K;  1Q18 A;  4MFB A;  3HOS A;  2Y1J A;  3O6W A;  2Q2R A;  5D3G A;  2CGK A;  1NK6 A;  3R1X A;  3KK1 A;  4BE1 A;  2IC3 A;  4I2Q A;  5SWM A;  4LF8 K;  2ITG A;  5BPN A;  4JKC A;  2F8T A;  2OYQ A;  4WF9 L;  4LH5 A;  3DLK A;  1C0M A;  3ZEU B;  1QHT A;  4E1M A;  5MLC Q;  1T03 A;  1VAZ A;  3D0P A;  1NGH A;  4JKH A;  2UXD K;  4BRH A;  4K43 A;  3CCR N;  2P9U A;  1KVB A;  3FR0 A;  4WYB A;  3OA9 A;  3HZ6 A;  3C6T A;  4JI2 K;  3HP9 A;  3UE5 A;  4O0J A;  1Z6R A;  4FLX A;  4BDP A;  2PYL A;  4DSL A;  4LF4 K;  4DTP A;  4OPH A;  3PX4 A;  2P9L A;  4DFK A;  2RN2 A;  3K5O A;  3R8E A;  4WQ4 A;  3QFU A;  4XH5 A;  2IDO A;  3QEV A;  4HTL A;  1BO5 O;  4W5T A;  1L3S A;  3LAN A;  4DQR A;  3SMS A;  4CZE A;  4CHO A;  3PY8 A;  3L2U A;  5GIO A;  1FKP A;  3O3F A;  4W5N A;  1IV0 A;  3CHW A;  1WAJ A;  4JK7 A;  3CQY A;  1HR0 K;  4C1N K;  2UUC K;  3D6R A;  2QKK A;  2GTD A;  4GMJ B;  4M42 A;  4E19 A;  4YOR A;  4I2P A;  1NGJ A;  5J2Q A;  4JI5 K;  3CMA N;  4CBX A;  4N56 A;  3K0S A;  2E1Y A;  4OKK A;  4DV7 K;  2NZT A;  2ASO A;  3RR8 A;  4FJL A;  2DFF A;  3ULD A;  3AVA A;  3LP1 A;  3I8D A;  3SUN A;  2P9K A;  2VWJ A;  4B9L A;  2WOM A;  3LDL A;  1ESV A;  2HNY A;  3VEO A;  3DWL A;  1U48 A;  4K41 A;  3NBP A;  3KKR A;  4DSE A;  4K0K K;  3VTI A;  2V51 B;  1VQL N;  1ZYQ A;  1TK0 A;  2NRW A;  3SUO A;  3QFP A;  2CGJ A;  1NK5 A;  3U4L A;  3LDN A;  2HNZ A;  3VQP A;  3BF1 A;  4HVJ A;  4IG0 A;  2JWL A;  4XIU A;  4KB1 A;  5C10 A;  3VEW A;  1WAF A;  4OPJ A;  3E9O A;  3E9L A;  1LW0 A;  1BIS A;  2OZM A;  4M63 C;  1KQS M;  4DFP A;  5M1Q A;  4GY2 B;  4DTS A;  3CXC M;  2YI1 A;  1ZBI A;  3T19 A;  5HBM A;  3LDP A;  3WNH A;  4KPY A;  4PWD A;  3H3O B;  4UQG A;  1Z26 A;  4FJG A;  3WEE A;  4JKF A;  4CD3 A;  4FSV A;  3UKR B;  4F9O A;  1FW6 A;  2G8U A;  1S1U A;  5FPE A;  4FW2 A;  1HLU A;  3MWP A;  4ID5 A;  5J2N A;  4JI3 K;  5KQD A;  2QW9 A;  3LDS A;  2YNH A;  3HXM A;  1YIJ N;  3HRG A;  4IFE A;  5J1E A;  1RT3 A;  3HPG A;  3U3G A;  1IG8 A;  3EEQ A;  1DT9 A;  2RKI A;  4JKD A;  2EX3 A;  4DHY A;  4M3T A;  4C8L A;  5EVZ A;  1YHQ N;  1NM1 A;  3O9Q A;  2UXC K;  3PX0 A;  3F9M A;  1W9H A;  4WQ5 A;  3DM2 A;  2OTL N;  4H5R A;  3FZL A;  3DLE A;  3QIO A;  1KLM A;  4FWK A;  3QEI A;  2ZD1 A;  4CD1 A;  1S1V A;  3QIP A;  4DFM A;  3KJV A;  1VSH A;  1GOC A;  2AP1 A;  3KHY A;  2W40 A;  1NU0 A;  4OPA A;  3ZSY A;  4OGC A;  5FRN A;  3D7E O;  3QNN A;  5BRE A;  3THY A;  4OKJ A;  1N36 K;  2Q1N A;  4DG1 A;  2YHA A;  2ZGZ A;  2HHU A;  3CJ7 A;  1FKO A;  5AQS A;  1C0U A;  3VMF B;  1TL3 A;  1KFS A;  3KD1 E;  3ULE B;  4CEE A;  3ISN C;  4HCB A;  4JS4 A;  1P8Z A;  4FWN A;  3MEE A;  1C0F A;  1HNZ K;  4B8A B;  1BI4 A;  3IS9 A;  3CG7 A;  5I9E B;  3IFR A;  1BUP A;  2FLO A;  2Q3S A;  3AA3 A;  1WBB A;  3L3V A;  4NYN A;  4C8M A;  1J5E K;  4QS7 A;  4BGB A;  1KXP A;  4KI4 A;  1E4F T;  3U8X A;  1NGG A;  1HX1 A;  4DF8 A;  2HOE A;  1TUU A;  2W6K A;  3WEE B;  3TTF A;  3CC4 N;  1JJ2 M;  4IEE A;  2W6L A;  1NMD A;  2J4R A;  4A5A A;  4B1U B;  4AHU A;  4CJS A;  2P51 A;  3LDO A;  4AQY K;  1RTD A;  3KKS A;  3VGM A;  4I6M A;  4W5O A;  2G8H A;  3CCJ N;  4CGI A;  1RCH A;  5AQM A;  4OLA A;  3OS0 A;  4JI6 K;  1CZB A;  3FZK A;  1L3V A;  4J8F A;  2ZE2 A;  5BR9 A;  4EHT A;  1D4X A;  3V81 A;  3QER A;  4I7F A;  1D8Y A;  3AVG A;  1SS6 A;  4C1N I;  2O8F B;  4XH4 A;  5FRO A;  3BY5 A;  3CC2 N;  4CHY A;  3V1Q A;  4YOT A;  3DLR A;  4FLV A;  4DTM A;  3MX2 A;  3F9K A;  4F3T A;  4CED A;  1NJY A;  4DV4 K;  3AVB A;  2DFE A;  2QXL A;  3VEZ A;  2JLE A;  3SI6 A;  3RMD A;  3VQ5 A;  5AZI A;  5BPL A;  1UA0 A;  2P9N A;  4CEZ A;  1QQC A;  1VQ5 N;  4V19 S;  2BGG A;  4FWO A;  1JLB A;  3CCS N;  2QM1 A;  2NRH A;  3GOI A;  4IFY A;  5EX5 A;  1GLF O;  2GBZ A;  4WFA L;  3OVN A;  3ZT4 A;  4BRA A;  5HRR A;  4H0P A;  4F2R A;  3AVI A;  1XI1 A;  4BR0 A;  3ZEU A;  1Z25 A;  4CGD A;  4BRD A;  1VRT A;  3QBW A;  2HHH K;  2WC9 A;  2LSN A;  3AO3 A;  3K5N A;  4O5F A;  2Z1H A;  4KB0 A;  4IEI A;  1SKS A;  3LPU A;  5GAG P;  2X6S A;  4CJ3 A;  3OYG A;  4Q0B A;  1Z05 A;  4B08 A;  3MXJ A;  4DR1 K;  3C6A A;  1KAX A;  1RT4 A;  4B9V A;  4CZH A;  2YHB A;  3AGK A;  1BQN A;  3VQB A;  3A0I X;  3A5N C;  3F2K A;  4R5P A;  4PKH A;  2XHB A;  4I6M B;  4M3X A;  5M1F A;  1U04 A;  3KD5 E;  3C6H A;  1CXQ A;  2YJF A;  4ILH A;  1LOT B;  3WNF A;  3CER A;  4BR4 A;  3LAL A;  1KTQ A;  2OZS A;  4BG9 A;  2OTJ N;  3S41 A;  5C42 A;  3CFO A;  1X9S A;  2JGU A;  4IDH A;  4DSK A;  3K57 A;  4CJ7 A;  3QES A;  4FJJ A;  3OJU A;  2Z1I A;  2HND A;  1RNH A;  1RT2 A;  1VQ7 N;  4GVM A;  1LAV A;  4YNQ A;  5SZT A;  1TAQ A;  2O4I A;  4TSX A;  4PKG A;  3B6O A;  1YTU A;  3ID8 A;  2V52 B;  1ZBF A;  4DUY K;  3CPE A;  4BRK A;  3RMA A;  3VGK A;  5ELZ A;  2O8E A;  1NGC A;  4B1Y B;  4DFJ A;  1OKJ A;  3NVM A;  4JAX A;  3J7Z O;  3OYI A;  1SL2 A;  4X65 K;  5B8H A;  3VQD A;  3ITH A;  4CGF A;  2HHV A;  2HF3 A;  4ILJ A;  2HVH A;  5LMU K;  4H0X B;  1HUX A;  3C7N A;  1KD1 O;  2GWJ A;  4BRF A;  4FJX A;  1X9W A;  5KI6 A;  1TGO A;  2P9U B;  1RTH A;  4ISF A;  5AQO A;  3RR7 A;  3O5B A;  2YKN A;  5T7B A;  5GIP A;  5C2F A;  4E89 A;  4CF2 A;  3TTD A;  1RT6 A;  2E6L A;  3L4I A;  1VSF A;  4BC2 A;  4JS5 A;  3NCI A;  1QSS A;  5E41 A;  1ZBH A;  4Z4C A;  3D45 A;  1BG3 A;  1JCE A;  1WUA A;  2FXU A;  1WBD A;  4DUZ K;  3EO3 A;  4IZ9 A;  5CY4 A;  4JD2 B;  1ZXO A;  5HRN A;  2WON A;  2H3G X;  3G0Z A;  3SJH A;  1HQE A;  2VG5 A;  4R79 A;  4ZTF A;  4M7Y A;  2VGM A;  4A2A A;  3HPO A;  3GDQ A;  4F8R A;  2ZM6 K;  4ISG A;  5AQG A;  4EIA A;  2E20 A;  4LH4 A;  1BCM A;  3ZCM A;  1J6Z A;  3DXM A;  4RW7 A;  1ILY A;  1HYS A;  3W0L A;  3CCE N;  1QQO A;  1LV5 A;  4AHS A;  4FJ9 A;  1HNV A;  2GWK A;  4CJF A;  4CGG A;  4YOV A;  3SQ0 A;  1TKX A;  5LJW A;  1S22 A;  1NK9 A;  2NLX A;  4PHT X;  1XUP O;  4CZG A;  3HBT A;  3KWI A;  1EKE A;  4CCH A;  3HO1 A;  3M8R A;  1MU2 A;  1LAW A;  3LP2 A;  5GAD P;  3LM9 A;  4Z4F A;  4Q5V A;  1ATN A;  4IXC A;  3MAQ A;  3WXK A;  2PY5 A;  2YHY A;  3V1O A;  1RIL A;  2GV9 A;  1EO1 A;  3T1A A;  1GOA A;  1BL3 A;  2NNW A;  4FM1 A;  3MK6 A;  2OPQ A;  3ULE A;  3NF9 A;  1REV A;  4EZ9 A;  4CE9 A;  4E7L A;  3PO4 A;  5I3U A;  1D9D A;  3U9D A;  1RBT A;  1BQM A;  3A5L C;  3EE9 A;  3I8B A;  2YHW A;  3IMX A;  1DLO A;  1HKG A;  3CJC A;  3AO5 A;  2FF3 B;  3O9R A;  3QEP A;  3VA0 A;  1ATR A;  1CLQ A;  1TVR A;  1RDB A;  3SK3 A;  1BU6 O;  1FK9 A;  3IDH A;  3PIO L;  1S3X A;  2ATQ A;  3AO2 A;  2QXF A;  1IO2 A;  3M8P A;  3J7Y P;  3C95 A;  1OH8 A;  3ZX0 A;  3E9P A;  3DXM B;  3MXM A;  3RSE B;  5JVH L;  1Q86 O;  3EY1 A;  5C24 A;  1ZBU A;  4BC4 A;  4HWI A;  2OPR A;  2AJQ A;  2W41 A;  5AFU A;  3OYM A;  4H4M A;  1VQK N;  4K25 A;  4QCL A;  3FLC O;  4E1N A;  2YHX A;  1NJI O;  3V9U A;  3LM2 A;  3QEX A;  1NNE A;  1U6Z A;  4FJH A;  3PSI A;  4YHH K;  4NXM K;  4DLE A;  1X9M A;  4KH6 A;  1RT1 A;  4MDA A;  3THY B;  1QHA A;  4NCA A;  3WQU A;  1NJZ A;  2QK9 A;  4RG8 A;  3P4I A;  3TSP A;  1KLN A;  3J80 O;  1TYQ B;  2KFN A;  1KVA A;  4KKO A;  5HRS A;  4BR5 A;  3AO1 A;  4HCC A;  3K9J A;  3OYB A;  1ASU A;  4RW8 A;  3OYK A;  1EXQ A;  3DRP A;  3CFR A;  3TWH A;  5FLX O;  4GVE A;  3K5M A;  1JL1 A;  3TR8 A;  4O5B A;  2G8K A;  4BQL A;  3ZT1 A;  1WN7 A;  1C1A A;  1S1W A;  4B3S K;  1T8E A;  3S3M A;  5C25 A;  3S3N A;  1QZ5 A;  4CEB A;  4N47 A;  3CCQ N;  3CM6 A;  3SV3 A;  3UB5 A;  3C0B A;  1KFD A;  3L8B A;  1Q8I A;  2HBL A;  4DB3 A;  3G10 A;  4PY5 A;  1B92 A;  4JEP A;  5DK5 A;  4FM2 A;  3AVJ A;  3O8M A;  2B5J A;  3KLG A;  4GNI A;  4RCH A;  4BVO A;  4IO8 A;  1JXE A;  3OYL A;  3QO9 A;  3ZT3 A;  2ZQB A;  5IT9 O;  3UKU A;  3WQT A;  1NGF A;  2P1J A;  4JHD B;  4IOX A;  4GV3 A;  2HST A;  1BIU A;  2CH5 A;  3ZSX A;  1Q9Y A;  1A5X A;  4BR2 A;  3RRH A;  3PIP L;  3BZC A;  2O8C A;  4B3T K;  3CJ9 A;  1NKE A;  4NLB A;  3L6Q A;  5AQU A;  4IO9 L;  4O55 A;  1O13 A;  1XHZ A;  1EP4 A;  3AVN A;  4IDK A;  2QWL A;  3CJ1 A;  3OHR A;  3VQ9 A;  2WTU A;  4IG3 A;  3B8A X;  3IG1 A;  4JI1 K;  4LFC K;  1RBV A;  4BRL A;  1N8R O;  3HVT A;  2JWK A;  4BDY A;  1VSE A;  3HL8 A;  4HTU A;  4M3W A;  3AA2 A;  4ID1 A;  2B4J A;  1XMO K;  3EKS A;  2QWQ A;  4CHP A;  4LSN A;  4DCH A;  3RTV A;  4CFD A;  4ELT A;  4NYF A;  2IOC A;  4BVP A;  1T7P A;  3OYH A;  4PL7 A;  5BR8 K;  3AV9 A;  2PAV A;  4LF5 K;  4FWR A;  3L2V A;  4BRC A;  2D0O A;  3NF8 A;  3JSM A;  4IOC L;  3EN9 A;  1YJ9 N;  3TAN A;  3IKM A;  3KLF A;  2QKB A;  1VSM A;  4WFN L;  4F3O A;  3L0Q A;  3LP0 A;  3T69 A;  4YOY A;  4BR9 A;  2PZS A;  3AAP A;  3KLH A;  3MCP A;  1GLB G;  1VSJ A;  2DTU A;  4DV0 K;  1GLD G;  4DQ8 A;  3KTQ A;  2Q97 A;  1MDU B;  3DLH A;  3NAE A;  4EP5 A;  1M1K O;  4FVU A;  2X78 A;  4IJA A;  3EZW A;  4KTW A;  4Z0U A;  3HM8 A;  2G8I A;  3HSC A;  3D2F A;  4DR6 K;  2ZJQ L;  3SAG A;  1HPM A;  3DLG A;  1VQ8 N;  3FZH A;  2FC0 A;  1I94 K;  4BQZ A;  3CCM N;  2FSJ A;  3MN9 A;  3ZSV A;  3V9W A;  2AA4 A;  4E3S A;  1SV5 A;  1XNQ K;  5JS1 A;  1K9M O;  2NRX A;  4CGJ A;  3VF6 A;  1RTI A;  3ZSR A;  5IWA K;  3QDK A;  1GOB A;  1HQU A;  4CBW A;  3HST B;  1DEJ A;  3ATV A;  3G25 A;  2KZZ A;  3WUH A;  3KLE A;  1NJX A;  2O8C B;  4XEI A;  1IBL K;  3QML A;  3OBW A;  3F73 A;  1KSP A;  1BOT O;  4BDZ A;  4FJM A;  1D5A A;  1U47 A;  4CIF A;  3ZET A;  4OLB A;  1HMV A;  4CJL A;  5A2Q O;  2I7P A;  3OYD A;  2O8F A;  1S72 N;  3P38 A;  4Z94 A;  1X1P A;  3SQ4 A;  1IJJ A;  1X3M A;  1SL1 A;  3U3Y A;  5FPD A;  1VQP N;  4CER A;  1U49 A;  3NF6 A;  3QEW A;  4IKF A;  2NRZ A;  3ZX3 A;  2A3Z A;  5KPT A;  3NMU A;  3R9P A;  4FPA A;  3P83 D;  2KTQ A;  5KQ8 A;  3D2E B;  4JN4 A;  3THV A;  3TTC A;  4X64 K;  3P39 A;  3G4S N;  2G8V A;  4OJR A;  5JIC A;  2QWO A;  4DTJ A;  5EY4 A;  2XY7 A;  3ASM A;  4WQ5 C;  1RBR A;  1V4T A;  1UAX A;  3KLI A;  5BRD A;  4ISE A;  1D9F A;  2DFH A;  4IBN A;  3IRX A;  4MLE A;  3O4Q A;  4A61 A;  1M90 O;  1G99 A;  4OO1 J;  1VSD A;  3VET A;  4DR2 K;  4DR4 K;  2XY5 A;  4FWM A;  3PSF A;  2E8A A;  3G71 N;  1KAZ A;  1IBM K;  4FJK A;  5AQV A;  4E1J A;  3IUC A;  1R0A A;  1YVU A;  2VQF K;  2Z1G A;  3BP8 A;  4KHP K;  2X74 A;  3AVM A;  1RDD A;  3D2E A;  3R6M A;  4QS9 A;  3DJC A;  2OPS A;  1K8A O;  3K58 A;  3AA4 A;  1VQM N;  3HPH A;  4JI0 K;  1KCF A;  4GV6 A;  4KH5 A;  2VWB A;  5AQQ A;  1JKH A;  1L5U A;  4OPK A;  4EZ6 A;  5AQH A;  4YDU C;  1QSL A;  3HVR A;  5BRH A;  1WNS A;  2E2N A;  4GW6 A;  2O8D A;  3AVC A;  1XNR K;  3OTO K;  4F4K A;  1T6C A;  5JMV A;  1T6D A;  1WB9 A;  3VQQ A;  4W5R A;  4FZZ A;  4KI6 A;  3GL1 A;  4JRQ A;  1BGX T;  1WSH A;  4PA1 A;  3DRS A;  1HNW K;  2RE2 A;  4DU1 A;  3ZET B;  3UKU B;  4NCG A;  4CFA A;  1NKB A;  1KAY A;  3LAK A;  1WSI A;  3HYF A;  4J2D A;  4FJI A;  4CFB A;  2HBJ A;  2Q0U A;  4RW4 A;  3U6F A;  4FJ7 A;  3SBT A;  4KRE A;  4KHN A;  4M3R A;  2UUA K;  3RSE A;  4KFB A;  4JYA K;  4FM0 A;  1TUY A;  3K2P A;  2Z1J A;  3O3H A;  5AZJ A;  1I39 A;  3DI6 A;  4PKI A;  3H1Q A;  1IKY A;  4DR5 K;  1KC8 O;  4KHW A;  2P9L B;  3VQ7 A;  4AHV A;  4JKB A;  1P90 A;  4BRN A;  5AZI B;  3SPY A;  2XY6 A;  1QE1 A;  1LW2 A;  3VGL A;  3AAR A;  3M8Q A;  1QQN A;  1IKW A;  3HP6 A;  1GLL O;  1Q9X A;  4OVL A;  2FSN A;  3O08 A;  1N5Y A;  3V9S A;  1OH5 A;  4KTZ A;  4AF1 A;  4BRG A;  3FFK B;  3HI0 A;  3VF4 A;  4DR3 K;  2KFZ A;  4FLW A;  1C6V A;  3SYZ A;  5ADX A;  1ATS A;  1NGE A;  4CIE A;  4FLY A;  3FZF A;  1SKR A;  2UU9 K;  4BRI A;  2HMP A;  5M1P A;  3J81 O;  4JI7 K;  2IIR A;  1L3T A;  3MN7 A;  1RGI A;  1LWC A;  1T44 A;  5HOO A;  3I56 N;  3TPQ A;  2QEX N;  4O4G A;  2HHW A;  4CF0 A;  3O3G A;  3ATU A;  3AVF A;  5FPN A;  3CF5 L;  3J7A P;  3FFI A;  4CJV A;  4PQU A;  2FBX A;  3CD6 N;  3L3U A;  5AQX A;  1VQ9 N;  2KZM A;  2NUB A;  3WXM B;  1N34 K;  3MN6 A;  3PUF A;  5AQN A;  3ZSQ A;  4KHY A;  1YIT N;  1C0T A;  4BWM A;  4JKG B;  4LSL A;  2HB5 A;  2FBV A;  3CET A;  1HPZ A;  1I3A A;  5BRF A;  1NWK A;  2XRI A;  2YV0 X;  2P9P B;  4JD2 A;  5AQJ A;  3I33 A;  3ENO A;  3THX A;  1YJW N;  3O4W A;  5M1K A;  3OW2 M;  3WT0 A;  4FK4 A;  4B3O A;  3DAW A;  3V1R A;  4DMN A;  4HUE A;  2EHG A;  2O8D B;  3HJF A;  3SQ1 A;  3MX5 A;  3DLL L;  1T05 A;  3NVK A;  3DMJ A;  4O44 A;  5H1S Q;  1LWE A;  2D0B A;  4A57 A;  4DTU A;  4J2B A;  4BRE A;  3GE1 A;  3TSU A;  5AQI A;  3TU5 A;  4DTO A;  3AA5 X;  2CGL A;  3ID6 A;  1DTQ A;  3CME N;  3HTV A;  3RMC A;  3BGR A;  1CZA N;  2O8E B;  2HBK A;  4PUO A;  2Y1I A;  3ALY A;  4CJK A;  5CZ2 A;  4CIG A;  3NGI A;  5AQP A;  5EOY A;  3T1Y K;  4JI8 K;  5KTQ A;  1N6Q A;  3MED A;  3CCU N;  4AIL C;  4MO4 A;  5EXW A;  1OVY A;  4M45 A;  3J8A A;  4B9Q A;  4DU3 A;  3L2Q A;  1SKW A;  2DY4 A;  4BRQ A;  1IBK K;  4CFC A;  3NDK A;  1S9E A;  4EFH A;  2BH1 A;  2D5R A;  4HHT A;  4H5V A;  3N4P A;  4CJU A;  4M41 A;  4GKK K;  1NGI A;  1GLJ O;  3K59 A;  2UXB K;  5KRT A;  4KO0 A;  4ICL A;  3CCV N;  2KKZ A;  4CZF A;  1NG9 A;  1DGK N;  3ENH A;  1NK0 A;  1XQS C;  4O8K A;  1K8K B;  3M8S A;  2QI2 A;  4X66 K;  1NKC A;  1XWL A;  4JI4 K;  4EP4 A;  1BDG A;  1YUW A;  1NK7 A;  3SAH A;  3NH2 A;  1HYZ A;  2O4G A;  5KPR A;  3DOL A;  2Q31 A;  4DSF A;  2A1R A;  2P9I B;  4PL8 A;  3OS1 A;  4L8R B;  4Y1C A;  4BRM A;  5CYM A;  4DQQ A;  1DKG D;  2A1S A;  4WE1 A;  2HF4 A;  4O8U A;  2RPI A;  4FK0 A;  4O0I A;  5TKY A;  1WOQ A;  1TK8 A;  1QQM A;  3EL2 A;  4AM6 A;  4BE0 A;  1NJW A;  2NRV A;  2E2Q A;  3M3Z A;  1G15 A;  1ITG A;  3WNE A;  2RF2 A;  1H1V A;  4M3Z A;  3G6E N;  3S9H A;  5GAE P;  3OYF A;  3TAR A;  3B6P A;  3AY9 A;  2FBT A;  4BAC A;  3BUZ B;  4N41 A;  1T3V A;  3QBX A;  3SZ2 A;  1QTM A;  4CEQ A;  4KHU A;  5C12 A;  5AQF A;  2IS3 A;  5M1O A;  3VEV A;  3E66 A;  3MXI A;  2UUB K;  3LL3 A;  4F2S A;  3OYE A;  4CZL A;  4L3Q A;  4YOW A;  3VQ4 A;  4N76 A;  4FJ5 A;  5LL6 Z;  5AQL A;  2V7Z A;  2WFB A;  3IAY A;  3ZT0 A;  3V6D A;  1S1X A;  4K42 A;  4FO0 A;  3JS6 A;  3EKU A;  3VQ8 A;  3MEG A;  1HYV A;  4KH4 A;  2ZGY A;  3TAF A;  5E26 A;  3VQC A;  3O4N A;  4A5B A;  3NHG A;  3PV8 A;  5BPM A;  1Q7Y O;  3I55 N;  4CZJ A;  5HL7 L;  3SAF A;  2I7N A;  2E6M A;  2B6A A;  2CH6 A;  2VCP A;  1JLE A;  1IKX A;  4WQ4 C;  3WXJ A;  4U67 L;  2X6N A;  5BN9 A;  4CEC A;  3OBY A;  1ZBS A;  4DQI A;  2P9I A;  4C8K A;  1Y97 A;  3RVC A;  5AQK A;  4KBO A;  3VTH A;  3MCA B;  1KRP A;  1A5V A;  1JLC A;  4ILG B;  1K8K A;  2D0P A;  2FSK A;  4CJW A;  1Q81 O;  3V9Z A;  3KK3 A;  1BIZ A;  2PFU A;  1LWF A;  5FPM A;  1X9J A;  4CHZ A;  1ZBL A;  3CQX A;  4FJ8 A;  1IG9 A;  1S5J A;  2BDP A;  2XY8 A;  3LPT A;  3CFP A;  4B9U A;  3MWT A;  4LFB K;  2BUP A;  1L3U A;  2A5X A;  5AR0 A;  4C8O A;  1EET A;  4OX9 K;  4JLH A;  3K9K A;  3P1G A;  2QWM A;  4DV6 K;  3P5J A;  4JV5 K;  4FPB A;  4IFV A;  1XMQ K;  2YNG A;  4FZX C;  1VSI A;  3PO5 A;  4BR7 A;  2BTF A;  3VQE A;  3EE8 A;  1ASW A;  4E7I A;  5ADX H;  3VER A;  1C1B A;  3ZSZ A;  4FOI A;  3OS2 A;  4LFA K;  4AM7 A;  3A8Y A;  2GUP A;  4DSI A;  2ZF5 O;  3T1H K;  1GLC G;  3NE6 A;  1NK4 A;  5KGW A;  2OA8 A;  4CF1 A;  3CPW M;  1A5W A;  4K8X A;  2G8W A;  3O9S A;  4DU4 A;  5DM7 L;  3N4Q A;  1WSE A;  3DOK A;  2Q0R A;  1EQY A;  3QIN A;  2KW4 A;  1RBU A;  3CI5 A;  3CJA A;  5LJV A;  3CQ8 A;  5CYQ A;  4MDB A;  3OYN A;  4OGE A;  2QA4 N;  3SJJ A;  1S1T A;  4NCB A;  2HHX A;  2Q36 A;  4ZTJ A;  4KRF A;  1VSL A;  4IJN A;  1J54 A;  1UOC A;  1HKC A;  3AVK A;  4DTR A;  4DQS A;  2E2O A;  4CJQ A;  4A59 A;  3NH1 A;  1RBS A;  3KWG A;  3H08 A;  4N5S A;  2FF6 A;  2YNF A;  2KQ2 A;  1ASV A;  3V4I A;  3OYJ A;  2BAN A;  3UKR A;  4CZI A;  3JYT A;  2VYP A;  5F2R A;  2GX9 A;  4Z4E A;  3LWL A;  1JLA A;  1JCG A;  3A2F A;  4DSJ A;  4CGH A;  4GV9 A;  4G9Z A;  4CF8 A;  3AVL A;  5JLH A;  4JK9 A;  2KHO A;  3W3D A;  4CK1 A;  1VQO N;  3VEX A;  4B1X B;  3ENB A;  1RDA A;  2D0C A;  4H5N A;  4LC9 B;  4B1W B;  5CZ1 A;  3DRR A;  4CW7 B;  4NLC A;  4JKE A;  1NGB A;  1EWQ A;  5AFU H;  2KLA A;  1HNI A;  1JXB A;  4FZY A;  3TAE A;  1SZ2 A;  1DTT A;  4I9L A;  3OYA A;  3THX B;  1OH7 A;  2A6A A;  4B3R K;  4WCE L;  1YF5 L;  2DPN A;  2YNI A;  1JLG A;  4JK8 A;  4OKE A;  3QIC A;  3LZI A;  2A41 A;  1WSF A;  3L4Q A;  1GLE G;  1CZ9 A;  4DQP A;  3Q7C A;  4I9Q A;  3ZT2 A;  3KIO A;  3I0S A;  1TKZ A;  4DF4 A;  2XO7 A;  4FK2 A;  3WXL A;  4UY8 O;  4RTF D;  4FXD A;  2VG7 A;  5KPZ A;  3CYM A;  3KK2 A;  4AHT A;  2ZJR L;  4U7B A;  4FWQ A;  3HK2 A;  3M5R A;  4BWJ A;  3E1Y A;  1HNX K;  4BC3 A;  3EZ5 A;  4FLZ A;  2F9T A;  4BGA A;  4MQ3 A;  1JLQ A;  1SUQ A;  3RMB A;  4B3M K;  4FOE A;  4CK2 A;  4CJR A;  1VHX A;  3NGY A;  1YJN N;  4FJN A;  2GUI A;  4Z4G A;  1EX4 A;  2E88 A;  3O80 A;  3FZM A;  1C1C A;  1R59 O;  2F9W A;  4KHQ A;  1HRH A;  5CR4 A;  1U2V B;  1BI4 B;  4JNE A;  4CJ4 A;  4RW6 A;  3MDQ A;  1YVN A;  2YKM A;  4MO5 A;  4ELV A;  1EWR A;  3M6G A;  3VES A;  4GKJ K;  5JS2 A;  3ZYY X;  1TL1 A;  1VSK A;  2P9P A;  2ZWH A;  3A5O C;  3TSQ A;  4B1Z A;  4CJP A;  3O1B A;  4BG8 A;  3VQ6 A;  3EYZ A;  2IVP A;  2D1K A;  3MEC A;  4Z4I A;  4JKA A;  1V4S A;  3CJB A;  3DYA A;  2IVN A;  5FRM A;  1IKV A;  1HJO A;  3NH0 A;  4Z4H A;  2ASM A;  5AZJ B;  4JRP A;  3H3N O;  4KHS A;  1N33 K;  2WUS A;  5C2D A;  4BY9 C;  3RWU A;  1VQN N;  2A40 A;  4BRP A;  4A2B A;  2P9S A;  1RDC A;  4CJ5 A;  1J53 A;  4YOX A;  3SLC A;  1W97 L;  2WBN A;  1TAU A;  1FXX A;  1VQ6 N;  1W2B M;  1LCU A;  2GEM A;  4IOA L;  3H1V X;  4J2E A;  2A42 A;  3A5M C;  3Q7B A;  5BN8 A;  4LD0 A;  3O9U A;  1QZ6 A;  3S3O A;  2HHT A;  2IVO A;  3THW A;  4XH1 A;  2R7Y A;  2QWR A;  1OVQ A;  2IGI A;  1QVF M;  2PBD A;  4CBU A;  1QS4 A;  1S9G A;  3C65 A;  3P31 A;  1S6P A;  5HLF A;  1YTA A;  1XHX A;  1X3N A;  3LDQ A;  4H0T B;  3LZJ A;  1JL2 A;  3M1F A;  4CVN E;  5AQR A;  4FWL A;  1NOY A;  2QTD A;  3H45 C;  4CEO A;  4EHU A;  2EWS A;  3SUQ A;  4B9M A;  5F0X A;  1WLJ A;  1CXU A;  1XC3 A;  1NK8 A;  4NO7 A;  4BE2 A;  3O9T A;  3VPZ A;  3CC7 N;  3FGU A;  4BC5 A;  4NB4 A;  3ZLJ A;  4DV5 K;  4M3Y A;  2ITM A;  1NMN A;  1SQK A;  2ZJP L;  4DLG A;  3T3F A;  3BF3 A;  3VF2 A;  3WNG A;  1J5O A;  1B9F A;  3VA3 A;  2VGN A;  2I5J A;  1NGA A;  3SV4 A;  4CF9 A;  4B9S A;  2FBY A;  2GEL A;  1K6Y A;  4H4O A;  4AHC A;  4CZM A;  3I0R A;  3L2W A;  3THW B;  1NOZ A;  4FLU A; 
#chains in the Genus database with same CATH homology
 2EX3 A;  3K5L A;  1S9E A;  3CM5 A;  4M3T A;  2D5R A;  4ELU A;  4HHT A;  1JXE A;  4C8L A;  3OYL A;  3SNN A;  3QO9 A;  4CJU A;  3ZT3 A;  4M41 A;  4E0D A;  2ZQB A;  3PX0 A;  1TK5 A;  1W9H A;  2P1J A;  1RTJ A;  3DM2 A;  3DLE A;  3QIO A;  1KLM A;  1BIU A;  5DMR A;  1RT7 A;  3ZSX A;  2ETJ A;  1A5X A;  3K59 A;  3RRH A;  1Q9Y A;  5KRT A;  3QEI A;  4KO0 A;  2ZD1 A;  4ICL A;  4B8C A;  1S1V A;  3QIP A;  4DFM A;  1NK0 A;  1NKE A;  3M8S A;  3KJV A;  4QOZ B;  1VSH A;  1GOC A;  4CK3 A;  1NKC A;  1XWL A;  4EP4 A;  1QSY A;  3AO4 A;  3VQA A;  4CEA A;  1W0H A;  4O55 A;  1NK7 A;  2P5O A;  3NH2 A;  1HYZ A;  2O4G A;  3ZSY A;  1EP4 A;  3AVN A;  1XHZ A;  4IDK A;  1UA1 A;  1KVC A;  3DOL A;  4OGC A;  4DSF A;  2A1R A;  3VQ9 A;  5FRN A;  4IG3 A;  3QNN A;  3IG1 A;  1RBV A;  3HVT A;  4OKJ A;  3OS1 A;  5HRO A;  4L8R B;  4DG1 A;  2YHA A;  1VSE A;  2VWK A;  4Y1C A;  4BDY A;  2HHU A;  3HL8 A;  5CYM A;  4DQQ A;  4HTU A;  4M3W A;  4AH9 A;  1FKO A;  2A1S A;  1C0U A;  3AA2 A;  4ID1 A;  4WE1 A;  5FDL A;  2B4J A;  4DTN A;  1TL3 A;  1KFS A;  3KD1 E;  2RPI A;  4CEE A;  3ISN C;  4CHP A;  4O0I A;  4FK0 A;  4LSN A;  4HCB A;  3TAM A;  4JS4 A;  1TK8 A;  4BE0 A;  1NJW A;  3RTV A;  1VK0 A;  4CFD A;  3LAM A;  4ELT A;  4NYF A;  2IOC A;  5HP1 A;  1G15 A;  3MEE A;  1ITG A;  3WNE A;  2RF2 A;  3LWM A;  4B9N A;  1T7P A;  3OYH A;  3SCX A;  4M3Z A;  3S9H A;  4B8A B;  3OYF A;  1BI4 A;  3IS9 A;  3B6P A;  3TAR A;  1BHL A;  2HVI A;  2FBT A;  3AV9 A;  3CG7 A;  2HHQ A;  4FCY A;  4C8N A;  4BAC A;  4N41 A;  3AA3 A;  2Q3S A;  3L3V A;  4NYN A;  3SZ2 A;  4C8M A;  3L2V A;  1QTM A;  4CEQ A;  4KHU A;  4B9T A;  1HJR A;  4YFU A;  3NF8 A;  2IS3 A;  3JSM A;  4KI4 A;  3MXI A;  3OYC A;  4DWI A;  3TAN A;  4CJE A;  4F2S A;  3KLF A;  4DS5 A;  2QKB A;  1VSM A;  4F3O A;  3OYE A;  4J2A A;  4DF8 A;  3VQ4 A;  4N76 A;  4FJ5 A;  3LP0 A;  2P5G A;  3E01 A;  3IAY A;  4CHQ A;  2PZS A;  2F96 A;  4AHU A;  2P51 A;  4CJS A;  3KLH A;  3TAB A;  1RTD A;  3KKS A;  4E7K A;  3ZT0 A;  3TAP A;  3QET A;  3V6D A;  1S1X A;  4W5O A;  1VSJ A;  2G8H A;  2DTU A;  4CGI A;  3VQ8 A;  1RCH A;  3MEG A;  3KTQ A;  4OLA A;  3OS0 A;  3NFA A;  4HUG A;  1CZB A;  1HYV A;  3DLH A;  1L3V A;  2ZE2 A;  3HT3 A;  3PX6 A;  3NAE A;  3TAF A;  4EP5 A;  3AVH A;  3VQC A;  3V81 A;  3QER A;  3O4N A;  4I7F A;  1D8Y A;  3AVG A;  2X78 A;  4KTW A;  3NHG A;  4Z0U A;  5FRO A;  3PV8 A;  2F8S A;  3SUP A;  2G8I A;  4CHY A;  2OPP A;  3V1Q A;  3DLR A;  4FLV A;  4DTM A;  2BE2 A;  3F9K A;  1NKB A;  3LP3 A;  4F3T A;  4JS5 A;  2E6M A;  2B6A A;  3DLG A;  4CED A;  1JLE A;  5HRP A;  1NJY A;  1IKX A;  2FC0 A;  3AVB A;  2DFE A;  1RT5 A;  2JLE A;  3SI6 A;  3ZSV A;  4HUF A;  3V9W A;  4E3S A;  5JS1 A;  1SV5 A;  2X6N A;  3RMD A;  3VQ5 A;  4CEC A;  1UA0 A;  4CGJ A;  2BGG A;  4CEZ A;  1QQC A;  4H8K A;  1JLB A;  1RTI A;  4FVM A;  3ZSR A;  4DQI A;  3TI0 A;  4C8K A;  1GOB A;  1HQU A;  1Y97 A;  5K14 A;  4IFY A;  1TV6 A;  5J2M A;  1IH7 A;  3C94 A;  4FLT A;  2E4L A;  3HST B;  1KRP A;  1A5V A;  2GBZ A;  1JLC A;  3TAG A;  1B9D A;  4CJW A;  2KZZ A;  3V9Z A;  3OVN A;  3ZT4 A;  3KLE A;  4M3U A;  1NJX A;  5EU7 A;  5HRR A;  3KK3 A;  3NF7 A;  4F2R A;  1BIZ A;  3AVI A;  3QLH A;  1LWF A;  5I42 A;  2HMI A;  4Y1D A;  1XI1 A;  4E7H A;  4CHZ A;  1Z25 A;  1ZBL A;  4CHN A;  4CGD A;  3RRG A;  1IG9 A;  1S5J A;  4FJ8 A;  1VRT A;  1WSJ A;  1BCO A;  2XY8 A;  3LPT A;  3F73 A;  3CFP A;  1KSP A;  2BDP A;  3QNO A;  4B9U A;  3V9X A;  2LSN A;  3AO3 A;  4QAG A;  4AHR A;  3L2R A;  3K5N A;  2Z1H A;  1L3U A;  1SKS A;  4C8O A;  1EET A;  4KB0 A;  4JLH A;  4BDZ A;  3LPU A;  3VN5 A;  3DLB A;  4FJM A;  1D5A A;  2X6S A;  1S6Q A;  3P1G A;  4CJ3 A;  3OYG A;  1U47 A;  4CIF A;  4Q0B A;  4B08 A;  3P5J A;  3MXJ A;  4OLB A;  1HMV A;  4W5Q A;  4CJL A;  2VG6 A;  3OYD A;  4IFV A;  1RT4 A;  1TKD A;  4LY7 A;  2YNG A;  2G8F A;  4FZX C;  1VSI A;  4B9V A;  3OY9 A;  2YHB A;  1XC9 A;  1JLF A;  3PO5 A;  1BQN A;  3VQB A;  1X1P A;  3SQ4 A;  1J9A A;  3VQE A;  4R5P A;  1SL1 A;  3U3Y A;  1ASW A;  4E7I A;  2XHB A;  4FW1 A;  4CER A;  1C1B A;  3ZSZ A;  3OS2 A;  3NF6 A;  1U49 A;  3SQ2 A;  4M3X A;  3QEW A;  2PYJ A;  1UWB A;  3ZSO A;  4IKF A;  4DSI A;  1U04 A;  3ZSW A;  3NE6 A;  1WSG A;  5J2P A;  3KD5 E;  1CXQ A;  4RW9 A;  1NK4 A;  5KGW A;  3TAQ A;  4FYD A;  4CEF A;  3WNF A;  3P83 D;  4CF1 A;  2W42 A;  2OA8 A;  2KTQ A;  1A5W A;  3LAL A;  1KTQ A;  3THV A;  2G8W A;  2OZS A;  4K8X A;  4DU4 A;  2IAJ A;  2G8V A;  1WSE A;  4OJR A;  3C6U A;  3DOK A;  5C42 A;  4DTJ A;  3CFO A;  1X9S A;  2XY7 A;  3ASM A;  3BDP A;  1RBR A;  2HHS A;  4G1Q A;  1VRU A;  2JGU A;  3QIN A;  1O1W A;  2KW4 A;  1RBU A;  1UAX A;  4ZHR A;  3KLI A;  3OJS A;  3K57 A;  3QES A;  2DFH A;  5KGX A;  3OJU A;  4IBN A;  1D9F A;  3IRX A;  2Z1I A;  2HND A;  3O4Q A;  5KRS A;  3CQ8 A;  1RNH A;  1RT2 A;  5CYQ A;  4GVM A;  4CJT A;  1VSD A;  2D0A A;  4OGE A;  4CES A;  3OYN A;  2XY5 A;  3SJJ A;  1LAV A;  4YNQ A;  4ZTF A;  4PQU A;  5SZT A;  1S1T A;  1TAQ A;  4FJK A;  4NCB A;  2HHX A;  2O4I A;  4TSX A;  4ZTJ A;  4KRF A;  1VSL A;  3B6O A;  1YTU A;  1J54 A;  1UOC A;  1U45 A;  1ZBF A;  3AVK A;  1R0A A;  1SL0 A;  4K8Z A;  1YVU A;  3RMA A;  4DTR A;  4DQS A;  3HM9 A;  4CJQ A;  2Z1G A;  3NH1 A;  1RBS A;  4N5S A;  3H08 A;  2YNF A;  2X74 A;  4DFJ A;  4J2D A;  2KQ2 A;  3AVM A;  1RDD A;  1ASV A;  3V4I A;  4KTQ A;  3OYJ A;  3NGZ A;  3UIQ A;  2BAN A;  3OYI A;  1SL2 A;  4KV8 A;  3VQD A;  3ITH A;  4CGF A;  2HHV A;  1TKT A;  3JYT A;  4DS4 A;  1YT3 A;  2HVH A;  2OPS A;  3K58 A;  1U4B A;  4Z4E A;  3AA4 A;  1JLA A;  3A2F A;  3LWL A;  4DSJ A;  3HPH A;  4CGH A;  1KCF A;  4E7J A;  4CF8 A;  4FJX A;  3AVL A;  3SPZ A;  1F21 A;  1X9W A;  1JKH A;  5KI6 A;  4OPK A;  1L5U A;  1TGO A;  4CK1 A;  4EZ6 A;  1RTH A;  1QSL A;  1RDA A;  2D0C A;  3HVR A;  2HW3 A;  1WNS A;  3RR7 A;  2YKN A;  4GW6 A;  5T7B A;  3AVC A;  4F4K A;  5CZ1 A;  4E89 A;  4KAZ A;  3DRR A;  4CF2 A;  1RT6 A;  2E6L A;  3VQQ A;  1HNI A;  1JXB A;  1VSF A;  4W5R A;  4DTX A;  3TAE A;  4FZY A;  4JRQ A;  1BGX T;  4I9L A;  1DTT A;  1WSH A;  4PA1 A;  4MFB A;  3DRS A;  5E41 A;  3OYA A;  3NCI A;  1QSS A;  1ZBH A;  4Z4C A;  3D45 A;  2Y1J A;  4DU1 A;  5CY4 A;  5D3G A;  1NK6 A;  5HRN A;  2WON A;  4NCG A;  3G0Z A;  4CFA A;  1HQE A;  2VG5 A;  3KK1 A;  3LAK A;  1WSI A;  1JLG A;  2YNI A;  3HYF A;  4OKE A;  4BE1 A;  2IC3 A;  4I2Q A;  4CFB A;  5SWM A;  3HPO A;  4F8R A;  4FJI A;  2ITG A;  3LZI A;  4RW4 A;  3U6F A;  1WSF A;  4FJ7 A;  2F8T A;  2OYQ A;  4KRE A;  4LH5 A;  3DLK A;  1C0M A;  4KHN A;  4FJJ A;  1CZ9 A;  4M3R A;  1QHT A;  4E1M A;  3ZT2 A;  4LH4 A;  1T03 A;  4DQP A;  1BCM A;  3KIO A;  3I0S A;  3ZCM A;  1TKZ A;  3D0P A;  2XO7 A;  4DF4 A;  4FK2 A;  4RW7 A;  4KFB A;  1HYS A;  4FXD A;  2VG7 A;  4FM0 A;  3CYM A;  4AHS A;  1LV5 A;  3K2P A;  4KI6 A;  4FJ9 A;  1HNV A;  1KVB A;  2Z1J A;  3KK2 A;  3O3H A;  4CJF A;  4CGG A;  1I39 A;  3DI6 A;  4AHT A;  3SQ0 A;  4I9Q A;  1IKY A;  3C6T A;  3HP9 A;  1TKX A;  4KHW A;  3HK2 A;  4O0J A;  4BWJ A;  3VQ7 A;  4AHV A;  1NK9 A;  4FLX A;  4BDP A;  2PYL A;  3SPY A;  4DSL A;  3EZ5 A;  4FLZ A;  4DTP A;  2XY6 A;  1QE1 A;  1LW2 A;  3M8Q A;  3PX4 A;  1EKE A;  4DFK A;  2RN2 A;  4MQ3 A;  1JLQ A;  1SUQ A;  3K5O A;  3RMB A;  1IKW A;  4CCH A;  3HO1 A;  4CK2 A;  4CJR A;  3M8R A;  2IDO A;  1MU2 A;  3HP6 A;  3NGY A;  1LAW A;  3LP2 A;  3QEV A;  4W5T A;  1L3S A;  3LAN A;  1Q9X A;  4OVL A;  1N5Y A;  4DQR A;  2GUI A;  3V9S A;  4FJN A;  4Q5V A;  4Z4F A;  4KTZ A;  4Z4G A;  1EX4 A;  4CHO A;  3MAQ A;  2PY5 A;  1C1C A;  3V1O A;  3PY8 A;  3L2U A;  4KHQ A;  1HRH A;  1RIL A;  1BI4 B;  1FKP A;  3O3F A;  4CJ4 A;  4RW6 A;  4W5N A;  2GV9 A;  1WAJ A;  2KFZ A;  2YKM A;  3T1A A;  1GOA A;  4FLW A;  1BL3 A;  1C6V A;  4ELV A;  3SYZ A;  4FM1 A;  4CIE A;  5JS2 A;  4FLY A;  1TL1 A;  1VSK A;  2OPQ A;  1SKR A;  3NF9 A;  2QKK A;  4GMJ B;  1REV A;  4EZ9 A;  4M42 A;  4CE9 A;  1L3T A;  4E7L A;  3PO4 A;  5I3U A;  4CJP A;  4E19 A;  1D9D A;  3VQ6 A;  1RBT A;  3EYZ A;  1BQM A;  4I2P A;  1LWC A;  5J2Q A;  3MEC A;  4O4G A;  4Z4I A;  1DLO A;  4N56 A;  3AO5 A;  3QEP A;  4OKK A;  2HHW A;  3DYA A;  3VA0 A;  4CF0 A;  3O3G A;  1CLQ A;  5FRM A;  1IKV A;  1TVR A;  3NH0 A;  3RR8 A;  3AVF A;  1RDB A;  4FJL A;  1FK9 A;  3FFI A;  2DFF A;  4CJV A;  2FBX A;  4Z4H A;  4JRP A;  3ULD A;  3L3U A;  4KHS A;  2ATQ A;  3AO2 A;  2QXF A;  3AVA A;  3LP1 A;  2NUB A;  3I8D A;  3SUN A;  2KZM A;  1IO2 A;  3M8P A;  2VWJ A;  4B9L A;  3RWU A;  2WOM A;  3C95 A;  3PUF A;  3ZSQ A;  3MXM A;  4KHY A;  2HNY A;  1C0T A;  4BWM A;  1U48 A;  3EY1 A;  3NBP A;  4LSL A;  5C24 A;  3KKR A;  1RDC A;  1ZBU A;  4CJ5 A;  4DSE A;  2OPR A;  1J53 A;  2AJQ A;  2HB5 A;  3OYM A;  4H4M A;  2FBV A;  1ZYQ A;  1TAU A;  1I3A A;  1HPZ A;  1FXX A;  1TK0 A;  3SUO A;  4QCL A;  4E1N A;  1NK5 A;  4J2E A;  1NOZ A;  2XRI A;  3V9U A;  2YV0 X;  2HNZ A;  3VQP A;  3QEX A;  4FJH A;  4HVJ A;  4LD0 A;  4IG0 A;  4DLE A;  4XIU A;  3S3O A;  4KB1 A;  1X9M A;  1WAF A;  4OPJ A;  1RT1 A;  2HHT A;  2R7Y A;  1LW0 A;  2IGI A;  4FK4 A;  4B3O A;  3V1R A;  4NCA A;  1BIS A;  1QS4 A;  1S9G A;  1NJZ A;  1S6P A;  2QK9 A;  4RG8 A;  4DMN A;  5HLF A;  1YTA A;  1XHX A;  4HUE A;  1KLN A;  2EHG A;  2OZM A;  3LZJ A;  1JL2 A;  4DFP A;  4FZZ A;  3HJF A;  2KFN A;  1KVA A;  4KKO A;  4DTS A;  3SQ1 A;  1T05 A;  5HRS A;  1NOY A;  1ZBI A;  4HCC A;  3AO1 A;  3T19 A;  4CEO A;  5HBM A;  3OYB A;  1ASU A;  4RW8 A;  3DMJ A;  3OYK A;  1EXQ A;  3DRP A;  4O44 A;  3WNH A;  3CFR A;  4KPY A;  4PWD A;  4UQG A;  3TWH A;  3SUQ A;  1LWE A;  2D0B A;  1Z26 A;  4DTU A;  4J2B A;  3K5M A;  1JL1 A;  4B9M A;  4FJG A;  4DTO A;  1WLJ A;  3AA5 X;  4O5B A;  1CXU A;  3TR8 A;  1NK8 A;  2G8K A;  1DTQ A;  3ZT1 A;  4BE2 A;  1WN7 A;  3RMC A;  3BGR A;  4M3Y A;  1C1A A;  1S1W A;  4DLG A;  4PUO A;  2Y1I A;  2G8U A;  3ALY A;  4CJK A;  1T8E A;  3T3F A;  1S1U A;  3S3M A;  4FW2 A;  3WNG A;  5CZ2 A;  1J5O A;  1B9F A;  5C25 A;  3S3N A;  4CIG A;  4ID5 A;  3NGI A;  4CEB A;  5KTQ A;  4N47 A;  3VA3 A;  5J2N A;  1N6Q A;  3MED A;  2I5J A;  3CM6 A;  3LDS A;  3SV4 A;  4CF9 A;  3SV3 A;  2FBY A;  4AIL C;  4B9S A;  2YNH A;  1K6Y A;  3HXM A;  4H4O A;  1KFD A;  3L8B A;  4AHC A;  4DSK A;  1Q8I A;  4M45 A;  4DU3 A;  3G10 A;  4PY5 A;  5J1E A;  1B92 A;  1RT3 A;  3HPG A;  3U3G A;  3L2Q A;  1SKW A;  2DY4 A;  3I0R A;  3L2W A;  5DK5 A;  2RKI A;  4FM2 A;  3AVJ A;  2B5J A;  3KLG A;  4FLU A;  4CFC A;  3NDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...