4CEOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceoA00
1VRTA 3VQ6A 3MEEA 3LZJA 3SJJA 3VA0A 4EZ6A 1Z26A 2WOMA 4FW1A 4BWMA 4CHQA 3WNGA 3HVRA 1S6PA 3K2PA 3LAKA 3OS1A 1VK0A 2RN2A 4DF4A 4M3UA 3FFIA 4IG0A 4Z4CA 4W5NA 3CM6A 1A5WA 3QIOA 3NHGA 3THVA 2KTQA 4YNQA 3SQ1A 2P1JA 5JS1A 1S9EA 1T7PA 4PQUA 2GV9A 3CM5A 1B9DA 3TARA 3C95A 4F2RA 4IDKA 4Z4IA 1TAQA 3VQDA 3HPGA 3NH1A 3AO1A 4O4GA 3NE6A 1TK5A 3L2VA 4DSFA 1S1XA 3NH0A 3L8BA 1HMVA 4ID1A 1HYVA 5J1EA 1D9FA 1CZBA 5J2PA 1U49A 1VSDA 4DSJA 3IRXA 4NCBA 3NBPA 2DY4A 3AO4A 3NDKA 4TSXA 4GW6A 1JLFA 1LWEA 2Q3SA 5C42A 4BE0A 3MXJA 3AO5A 1U48A 4FM0A 5HP1A 2BANA 1IO2A 2A1SA 1WSEA 4DTMA 4B9TA 2D0CA 1JKHA 4FJ5A 4CECA 3ZT1A 4CHYA 3ASMA 3ZSQA 5E41A 4M3RA 3DRSA 3KTQA 3KD1E 4CGHA 2HHUA 2ZE2A 1QHTA 1NJYA 3ISNC 4FZYA 2JLEA 3HJFA 3OYNA 4N5SA 4HUGA 4DSEA 3DM2A 3RMAA 2QXFA 4DTXA 1SUQA 4KFBA 3TWHA 3SPYA 4E0DA 4AHUA 4QAGA 5SZTA 2D0AA 1F21A 3SCXA 1EP4A 3LDSA 2OPSA 3DOLA 2B6AA 2EHGA 2F96A 1MU2A 3IG1A 4FJHA 4M3TA 4CEEA 3OYMA 4AHSA 2JGUA 3JSMA 4AILC 2OA8A 4KTWA 4HHTA 3LP0A 3RMCA 4CHPA 4ELTA 1ZBFA 2FBVA 1B92A 3NF6A 2HMIA 4B9SA 3DLEA 4Q5VA 2VWJA 2IOCA 2OYQA 3KKSA 4CK2A 3SV3A 3QLHA 5KI6A 1RT2A 4CJRA 3JYTA 1SL2A 1VSKA 1WSGA 2YNIA 4RW9A 1U4BA 4F4KA 4FJ9A 4B08A 4CIGA 3TAPA 4AHRA 3KLIA 3OYJA 3S9HA 4LH4A 3OJUA 5K14A 3HPOA 3NCIA 4KAZA 4EP5A 1QSYA 1XWLA 4FM2A 1RT1A 1IKVA 3HPHA 2GBZA 4FW2A 1WSJA 5CZ2A 4IKFA 2XHBA 1TVRA 4CFBA 1DTQA 4AH9A 4CEDA 4CF0A 3OS0A 4CJEA 2RKIA 4FVMA 4CJTA 4O5BA 4RG8A 2P5GA 3KKRA 2EX3A 3VQEA 3PUFA 5FROA 2G8UA 1NJXA 2OPQA 3TI0A 1FKOA 3QETA 2I5JA 2GUIA 1TKXA 4DTJA 4XIUA 3U6FA 4RW4A 3QEVA 4CK3A 2HHVA 3MECA 1BI4B 4IBNA 4ZHRA 3OYIA 4ELVA 1N5YA 1KLNA 4B9NA 1W9HA 2FC0A 3V1QA 4OKJA 3KK2A 3CFRA 4FXDA 2HNDA 2OPRA 4Z0UA 4PUOA 2PYJA 3QEPA 4KHQA 1NOZA 4CJ3A 3HL8A 3NGYA 3TABA 3RMDA 3SPZA 2D5RA 4DQSA 4JRQA 3P83D 4BACA 3AVMA 4DQIA 4C8MA 1BI4A 1S9GA 3TAEA 4CJ4A 1CXQA 5HBMA 3C6TA 3HM9A 4E1MA 2NUBA 3TANA 1JXEA 1O1WA 1VSLA 1RT4A 1BISA 2HNYA 2HHXA 2VG5A 4CJPA 2P5OA 1JLGA 4E19A 4HTUA 1HYZA 4RW7A 1CLQA 4UQGA 3BDPA 1TL3A 1VSEA 1UWBA 4F3TA 4CESA 1C0TA 1S1WA 4PWDA 4O0JA 1C1BA 3ZSWA 3ZT4A 1GOAA 4EZ9A 2F8SA 3HO1A 2HVHA 3O3HA 1HRHA 1RTJA 1Q8IA 2PYLA 2ZQBA 1JL2A 5D3GA 3CQ8A 2DFEA 2FBTA 1ASUA 1B9FA 1HQEA 4DQQA 1UA0A 3AVHA 4KO0A 4O44A 3C6UA 1NKBA 3B6OA 3LWMA 4B9LA 4IG3A 3T19A 3ZSYA 1TK0A 4F3OA 4ID5A 4DQPA 3KJVA 1BL3A 1S1UA 2B5JA 3VQ9A 3O4QA 4CGGA 4CIEA 4DLEA 3QNOA 1QSSA 4Q0BA 1IKXA 4CFAA 3K59A 2YV0X 4LD0A 1SKWA 4E1NA 3NF8A 4C8OA 1RT5A 3DMJA 4CHZA 3KLEA 5JS2A 4C8LA 4KHYA 1RT3A 4B3OA 1ZYQA 4LY7A 4CJUA 3D0PA 1T05A 2QKBA 4FJ8A 4FLVA 3F73A 4J2DA 4OPJA 5J2QA 4M45A 2HHQA 3K5MA 4M42A 4FLZA 4Z4HA 5FDLA 3OYAA 1YVUA 1ZBLA 3OYBA 4Z4GA 3I8DA 1XHZA 1BIUA 3AVFA 2YNFA 4B8CA 4AHCA 3V6DA 3G10A 3KK1A 3PX0A 1U45A 3SI6A 4I2QA 4JRPA 4AHTA 1VSIA 3K5OA 1NK0A 4Z4FA 2HHTA 2KFNA 4I9QA 4FLUA 4Z4EA 4FJKA 2O4IA 2KQ2A 3L2UA 4FCYA 1HNIA 1Q9YA 3T3FA 3OS2A 4DFJA 3AVGA 5J2NA 1GOBA 3EY1A 1W0HA 2DFFA 4KRFA 1EXQA 3MEGA 3UIQA 4W5QA 5SWMA 1QQCA 3SUPA 1KTQA 4O55A 1IKYA 4KI4A 3LP1A 4E7KA 1K6YA 3LZIA 2OZMA 3L2QA 3V9SA 3DLGA 1J5OA 2PZSA 2DTUA 4W5RA 3TAQA 1X9SA 3LPTA 1CXUA 3HSTB 1KVAA 2R7YA 4DWIA 1JLQA 4DTPA 4LSNA 1WSFA 1WNSA 4DFPA 2IC3A 5HROA 2F8TA 1J9AA 3WNFA 1D8YA 4DTOA 4DG1A 1SL0A 3ZSZA 3BGRA 3V9XA 1QE1A 2ATQA 2YHAA 3PY8A 1C0MA 2X78A 2IAJA 1JXBA 3H08A 3OYEA 3M8QA 4DU4A 4K8ZA 2KZZA 5EU7A 3ZSRA 3AA4A 3KIOA 1REVA 3VQCA 1IKWA 1JLAA 3E01A 3RRHA 1NK5A 1RCHA 3NAEA 4NCAA 1DTTA 4CEQA 3ZSVA 2OZSA 3QESA 4DMNA 3U3GA 3AVLA 1WN7A 4CJQA 3RR8A 3SQ2A 4M3ZA 2Y1JA 3L2WA 3L3VA 1TKDA 4FZZA 1NJZA 1FKPA 1KFDA 1LW0A 4RW6A 1LW2A 3AVNA 2Z1HA 1S1VA 4CEZA 4ZTFA 4M3WA 5FRNA 4BDZA 1S6QA 4E89A 3S3MA 1RTIA 2HHWA 1BQMA 1X1PA 3G0ZA 3TAGA 5KRTA 1TV6A 4KTZA 4KHWA 1QS4A 3PO5A 2E6MA 3SQ0A 4CEAA 1BCOA 2HNZA 3AVJA 3HYFA 3EZ5A 4CJLA 3LWLA 4DTNA 1YT3A 1EKEA 3OYFA 1RDDA 3M8RA 4HCCA 3IAYA 3KLHA 4B9MA 4BDPA 4Y1CA 3VQ4A 3HP6A 3SQ4A 2A1RA 3DLKA 4FM1A 4E7HA 1TKTA 1NK9A 4FJNA 1LAWA 2VG6A 4FZXC 5C25A 2DFHA 4HCBA 3T1AA 1C6VA 3O4NA 3P5JA 4B8AB 4FJJA 4CJ5A 4CCHA 1NJWA 3RR7A 4CJSA 4OJRA 3RMBA 2ZD1A 4DU1A 2G8IA 4CGFA 2HB5A 1D9DA 4OGEA 3OJSA 4FJGA 3V9ZA 4M41A 2G8VA 3NF7A 2OPPA 3DYAA 4ICLA 1RBRA 1ASWA 5HRSA 3ITHA 2Y1IA 1DLOA 3ALYA 4N56A 1CZ9A 3TAFA 3I0SA 4HUFA 1R0AA 1A5XA 2P51A 2Z1JA 1RNHA 1X9MA 4DSLA 1G15A 4H4MA 4JS4A 4M3YA 1NK4A 1Q9XA 3CG7A 4IFYA 3KK3A 4FLYA 2YKNA 4HUEA 1HJRA 5HRNA 3L2RA 5I3UA 2G8FA 3ZSOA 1VSFA 1RTHA 2E4LA 4Y1DA 3AA3A 3AO2A 3LANA 1JLCA 1EX4A 3CFOA 1QSLA 3NFAA 1XC9A 4CEOA 5I42A 3K57A 3V9WA 1WSHA 3AA2A 1UOCA 1L3SA 5FRMA 5KTQA 4LH5A 1X9WA 1RBUA 3DLRA 4CGDA 3WNEA 3I0RA 1A5VA 3V1OA 4E3SA 1BQNA 3WNHA 3NH2A 3M8SA 1VSHA 1SV5A 4FJXA 2IGIA 4KHUA 2XY6A 3LALA 4CJFA 4CK1A 4W5TA 4CFCA 4DU3A 2XO7A 1RBTA 4PA1A 4FJIA 4C8KA 1RBSA 1UAXA 3OYKA 4E7LA 1RDAA 1KLMA 1VSJA 3V4IA 3DOKA 1TGOA 3IS9A 3MXMA 4OLAA 4FYDA 3ZT3A 1JLBA 2HHSA 3ZCMA 4K8XA 3VQAA 2IDOA 3PO4A 1JLEA 1NK6A 1L3VA 1J53A 1RT7A 4CF8A 4CHOA 3P1GA 4OPKA 4BDYA 3ZT0A 2PY5A 1FK9A 4FK0A 1RTDA 3DRRA 3K5NA 3QINA 1U47A 3EYZA 3AVAA 4DTSA 1KSPA 4DF8A 3VQPA 1TK8A 1ITGA 3K58A 1KRPA 1SKRA 4QCLA 4ZTJA 3HVTA 3L3UA 3AO3A 1WLJA 1RILA 1I3AA 4CF9A 3S3NA 5HRPA 3ULDA 4J2BA 2FBXA 2KFZA 5DMRA 3NGIA 4DSIA 4DFMA 2D0BA 4CJVA 3VN5A 1IG9A 5T7BA 3O3GA 1NKCA 1LWCA 2VWKA 2Z1IA 2E6LA 4OGCA 2XY7A 3D45A 4M3XA 1TAUA 3A2FA 4FJMA 3VA3A 5KRSA 3RRGA 1RDBA 4BE2A 3MAQA 1L3UA 2LSNA 4AHVA 3TAMA 1S1TA 4OKKA 3PV8A 3SNNA 1KCFA 4PY5A 1KFSA 4CJWA 2BGGA 2KW4A 4H4OA 4KHNA 1XI1A 2QK9A 3SUQA 4FLTA 1UA1A 1C0UA 1VSMA 1Z25A 5KGWA 4DS5A 1RDCA 3TR8A 1JL1A 1Y97A 4IFVA 1GOCA 3AVIA 4C8NA 3NGZA 4DQRA 1TL1A 4DTRA 3SUNA 4KB0A 3LAMA 2IS3A 4KKOA 3AV9A 4RW8A 3SV4A 3LP3A 4BWJA 4I9LA 4DS4A 4G1QA 2G8HA 4O0IA 3V1RA 3QERA 4KB1A 2AJQA 4N41A 4CHNA 3RWUA 4HVJA 3S3OA 3AVBA 1ZBHA 2YKMA 4CFDA 4ELUA 4DSKA 2BE2A 5CZ1A 4J2AA 1YTUA 1T03A 1HNVA 1BGXT 1WSIA 1I39A 4DLGA 3QIPA 3PX6A 1IH7A 1U04A 4OLBA 4KREA 4FLXA 4R5PA 1C1AA 3QEXA 4F8RA 3U3YA 3LP2A 3KLGA 3M8PA 4KPYA 3K5LA 1HYSA 1KVCA 4DFKA 4KV8A 4E7IA 5J2MA 2BDPA 4FJ7A 3HK2A 1S5JA 5HRRA 3SUOA 2XY8A 4NCGA 3NF9A 4EP4A 2YNGA 3OVNA 4CERA 2Z1GA 3CFPA 4FK2A 2RF2A 3OYHA 3RTVA 4JS5A 4CF2A 2KZMA 4J2EA 1BHLA 4FLWA 1BIZA 5HLFA 1RBVA 3VQ8A 2HW3A 3AA5X 3OY9A 3DLHA 1SL1A 1ZBUA 1NK8A 3VQQA 3PX4A 2W42A 2QKKA 2O4GA 4CGJA 4GVMA 4CIFA 4B9VA 4I2PA 2X6NA 4JLHA 2YNHA 3SYZA 3QEIA 1YTAA 3HXMA 3KD5E 1WAJA 4I7FA 4CEBA 4CF1A 4FK4A 3F9KA 4H8KA 2G8WA 3OYDA 5DK5A 3V9UA 4DTUA 3V81A 5CYQA 3ZT2A 2RPIA 3DRPA 1XHXA 3SZ2A 1NK7A 2X74A 2ETJA 4GMJB 3HT3A 2B4JA 4MQ3A 3OYGA 2FBYA 1T8EA 3AVCA 2WONA 1FXXA 1SKSA 1NKEA 4E7JA 1C1CA 4CJKA 3CYMA 4F2SA 3OYCA 3AVKA 4YFUA 3QNNA 3HP9A 2ITGA 5CY4A 4W5OA 1EETA 4CEFA 4CGIA 4BE1A 4NYFA 1KVBA 1D5AA 4MFBA 4CE9A 2XRIA 5CYMA 4N47A 1L3TA 1LV5A 4QOZB 3KLFA 1HPZA 4LSLA 1L5UA 2HVIA 3VQ5A 3MXIA 3C94A 1VRUA 2XY5A 1J54A 3MEDA 4KTQA 4N76A 3B6PA 1BCMA 1HQUA 4KHSA 3VQ7A 2VG7A 1QTMA 3ZSXA 2G8KA 3DLBA 1RT6A 4OKEA 3QO9A 1NOYA 4L8RB 1N6QA 3OYLA 2X6SA 3O3FA 4FJLA 1LAVA 3VQBA 3LPUA 2YHBA 4OVLA 1ASVA 1LWFA 1WAFA 4WE1A 5KGXA 1TKZA 3DI6A 4NYNA 5C24A 3QEWA 4B9UA 1ZBIA 4KI6A
chains in the Genus database with same CATH superfamily
5EVZA 2VCPA 4H5VA 4EZ6A 4IEIA 3HVRA 1NK6A 3WNGA 3K2PA 2UXBK 4A5AA 2P1JA 1S9EA 4PQUA 2GV9A 2D1KA 1B9DA 2O8EA 4F2RA 3SJHA 3AO1A 4O4GA 4QS8A 3L2VA 1E4FT 5JVHL 1CZBA 3IRXA 3AO4A 4TSXA 1LWEA 4CZIA 3AO5A 1U48A 4WFNL 5HP1A 3H1QA 3J7ZO 1NGBA 5AQNA 3ZT1A 3ZSQA 4DR5K 1BA1A 2HHUA 1NJYA 2JLEA 1GLJO 4JHDA 4AM6A 2QXFA 4DTXA 4KFBA 4QAGA 1F21A 3T1HK 3SCXA 5B8HA 2ZGZA 1WBBA 1MU2A 3IG1A 3OYMA 4AHSA 3JSMA 5I9EB 4FPBA 5KQDA 4HHTA 3SAHA 1ZBFA 3PIPL 5E84A 4CVNE 3K9KA 1V4SA 1YXQA 3DAWA 4LH4A 5K14A 3HPOA 4KAZA 1QSYA 1WOQA 3LDQA 3HPHA 1VQ4N 4FW2A 3D2EA 5CZ2A 2O8CA 4BG9A 1RGIA 2Q36A 5IT9O 3LM9A 4CF0A 4ILGB 2RKIA 4CJTA 3HOTA 4IJAA 5F0XA 4YOXA 2OPQA 1FKOA 3QETA 1SAZA 2GUIA 4DTJA 1WBDA 2HHVA 1P8ZA 5HOOA 1W9HA 1X3NA 3V1QA 2HNDA 2OPRA 3E9LA 4Z0UA 3AAQA 2GEMA 3AVMA 3E1YA 5EX5A 4CJ4A 1CXQA 5HBMA 3U8XA 3TANA 2NUBA 3R8EA 2HHXA 2VG5A 1JLGA 2NRRA 3MX5A 1HYZA 2VWBA 3F5TA 4IDHA 3F9MA 1UWBA 4A61A 4K42A 4B9QA 3RSEB 4EZ9A 3ZT4A 2F8SA 3O3HA 2PYLA 1RFQA 2RHKA 1HQEA 3CCSN 4GV6A 1NKBA 4V19S 3H3OB 4NLBA 2HHWA 3O6WA 3QBXA 1QSSA 1X9JA 1C0FA 2YV0X 4G9ZA 4JKAA 1DEJA 4B3OA 1RT3A 2QKBA 3D0PA 4CJUA 4J2DA 4CZLA 3MDQA 1YVUA 1XHZA 3V6DA 2YNFA 4ILJA 3KK1A 4JRPA 3K5OA 1NK0A 3KVGA 5M1NA 4Z4EA 3D2FA 3UKUB 2O4IA 1SQKA 2KQ2A 3WXKA 4FCYA 3CCLN 1XQSC 2DFFA 4KRFA 4PKGA 4W5QA 5AR0A 1GLAG 4JKGB 4E7KA 2PZSA 4BRNA 3TAQA 1X9SA 2R7YA 1WNSA 2IC3A 2F8TA 1YF5L 3V9XA 5M1PA 2YHAA 3PY8A 2KZZA 3AA4A 3E9OA 4H0VB 3KIOA 3GG4A 1REVA 3QB0A 4DV2K 4NCAA 1DTTA 3ZSVA 3U3GA 1WN7A 3MK6A 2CGJA 2UUBK 1JJ2M 4M3ZA 2Y1JA 3L2WA 1TKDA 1KFDA 3O9RA 2Z1HA 4M3WA 3PSIA 4BDZA 3S3MA 4CI6A 5AQKA 1U6ZA 1NGJA 1BQMA 5BRHA 2E20A 3P38A 4KHWA 1N34K 3PO5A 4CEAA 1HR0K 4CJLA 3G25A 4AQYK 4FVUA 3OBYA 4DTNA 4HCCA 2A41A 3KLHA 3A5LC 3VQ4A 3SQ4A 4X62K 3FZMA 2A1RA 2E8AA 3DLKA 4JI7K 4YDUA 4FZXC 4BC4A 3D6RA 2HOEA 3T1AA 3P5JA 4CCHA 1NJWA 1Q18A 2ZD1A 5AQRA 4LF5K 4DV0K 3OJSA 3G71N 4FJGA 1NJIO 2G8VA 3GDQA 2OPPA 3DWLA 5ELZA 3DYAA 3ZX0A 1RBRA 3ITHA 3PSFA 4N56A 4JI6K 3I0SA 1A5XA 2P51A 2QWQA 4DSLA 5TKYA 1NK4A 4HUEA 2ZWHA 4I6MA 3CMAN 3ZSOA 3O5BA 1RTHA 1JCGA 2E4LA 1HNZK 3D7EO 2AP1A 3LANA 5EOYA 4K43A 3NFAA 3I56N 4KH5A 4CZHA 4B1VA 4LH5A 3DLRA 3WNHA 3NH2A 1YUWA 5AFUA 3ZX2A 2XY6A 3LALA 4DU3A 2XO7A 1RBTA 4FJIA 4C8KA 3OYKA 1QQOA 4DKWA 3BEXA 3DOKA 3ZCMA 1HNWK 3U9ZA 2IDOA 3PO4A 1YJ9N 4CF8A 4BDYA 3ZT0A 2PY5A 1FK9A 4FK0A 1HUXA 2VGMA 3K5NA 2P9KB 1U47A 3EYZA 2QWPA 4DF8A 3VQPA 1VQ5N 1XC3A 3K58A 3WXJA 4KH4A 3HVTA 3L3UA 1WLJA 1RILA 1I3AA 4CF9A 2QWNA 3JXUA 3S3NA 4J2BA 3NGIA 4DSIA 4DFMA 2HF3A 2D0BA 5KPZA 3O1BA 2XY7A 2A40A 3VA3A 3RRGA 1L3UA 3MAQA 4AHVA 3M1FA 3PV8A 1KCFA 3VTIA 4CJWA 1ATNA 1DKGD 5JMVA 1HKCA 4DS5A 4A2AA 3TR8A 4ILHA 1X3MA 5AQOA 4MO4A 5IWAK 4I9LA 3V1RA 1BWFO 1HPMA 3RWUA 1NBWA 3NVMA 4GY2B 4ELUA 2GX9A 1GLEG 2BE2A 1YTUA 3O9TA 2V51B 4CD1A 2FSKA 4IO8A 3VERA 4FLXA 2OTJN 4F8RA 3LP2A 3KLGA 4GNIA 4KV8A 3HK2A 2XY8A 1IBLK 3NF9A 2YNGA 1V4TA 2OTLN 3P31A 3CFPA 2RF2A 4CF2A 4FLWA 3ZETA 1SL1A 3UKRB 1ZBUA 2HBKA 3PX4A 4LF4K 2QKKA 3WXMB 1KC8O 4CGJA 4GVMA 2YNHA 3HXMA 1WAJA 4I7FA 1Q7YO 4DV6K 4WQ5C 3VEVA 1XHXA 4MDBA 3G6EN 1ZXOA 1T8EA 3AVCA 1Q82O 1SKSA 5AJ3K 3CYMA 3EKSA 1FW6A 1K8KB 4JI1K 1JCEA 3HP9A 2ITGA 5AQSA 4W5OA 4CEFA 4CGIA 1VAZA 3VEWA 3B8AX 4CE9A 3FFKB 1LV5A 3KLFA 1VQ7N 1L5UA 3MXIA 3DXMB 1VRUA 4H5WA 3WEEB 3B6PA 1HQUA 3ZSXA 4PHTX 3QO9A 1YJNN 1J5EK 1NOYA 4FJLA 1LAVA 2P9SA 3LPUA 4OVLA 4WE1A 5KGXA 4B9UA 1YHQN 1XMOK 3VF6A 2YHYA 3SJJA 3VA0A 1Z26A 2P9NB 1SS6A 2VGNA 3OS1A 4M3UA 1IV0A 2RN2A 2A42A 2NRWA 4BQLA 3QIOA 4YNQA 3CJAA 3CC7N 3TARA 3C95A 3BUZB 1BO5O 2GUPA 4B3MK 3NE6A 3THYB 2KKZA 1GLDG 1S1XA 5DM7L 3LM2A 1HMVA 4ID1A 2FXUA 5J1EA 3ID6A 1U49A 1VSDA 4YOYA 3NDKA 1JLFA 3WXIA 3MXJA 3THXA 1O13A 4M63C 2O8DB 4B9TA 4DTMA 4B3SK 1JKHA 2WFBA 4CECA 4X64K 4BRCA 3LL3A 4M3RA 4E1JA 3KTQA 4DV5K 3KD1E 3ISNC 4FZYA 4HUGA 3RMAA 4ISGA 1QHAA 1SUQA 3QBWA 2P9LA 3SPYA 4E0DA 4O8KA 5SZTA 1EP4A 1HX1A 2OPSA 4FWLA 3CC4N 2B6AA 2EHGA 5GIOA 2F96A 4H5NA 2UXDK 4LC9B 3CJ1A 4AILC 2JGUA 3VPZA 4NXMK 3RMCA 2V7YA 4ELTA 2FBVA 4B9SA 2E1ZA 1N32K 3SBGA 3SV3A 4BR4A 3QLHA 4CJRA 1SL2A 3VGMA 4JI5K 2FLOA 2YNIA 4FJ9A 4M7YA 4OPAA 4AHRA 4JK9A 3S9HA 3C7NA 4CJ7A 5AQWA 1IKVA 1QQMA 1WSJA 4BVPA 2XHBA 3OS0A 4B1UB 5LY3A 4O5BA 4RG8A 2P5GA 3KKRA 2E1YA 2EX3A 4WFBL 1IG8A 3VQEA 1NJXA 5TKWA 4NB4A 1NGGA 1GLCG 1W2BM 4XIUA 2RE2A 1KAZA 3MECA 1BI4B 4ZHRA 1TYQB 1N5YA 1KLNA 4FXDA 3KK2A 5C2DA 1MA9B 4BC5A 3QEPA 3PLAA 1VQ9N 5BPNA 4CJ3A 3HL8A 3SPZA 2AA4A 4BGAA 3CQYA 3TAEA 4Y0WA 3I55N 3K9JA 2NRVA 1O1WA 1BISA 2W6LA 1I94K 3A5NC 1Q81O 3CI5A 1IJJA 3EO3A 4E19A 4JI0K 1CLQA 1W7AA 3BDPA 5FPNA 2BTFA 2HVHA 1GOAA 3HO1A 4JKHA 1P90A 2ZQBA 3ZX3A 1D4XA 2HSTA 1T44A 1Q86O 2OCEA 4KO0A 3MN7A 4IOXA 4O5FA 3C6UA 3B6OA 3CIPA 4B9LA 4IG3A 3T19A 1TK0A 4A59A 4B3RK 3HTVA 3KJVA 2YJFA 3CPWM 2B5JA 3O4QA 3BZCA 4NO7A 3QNOA 4CFAA 1SKWA 3THWB 4CZKA 3R6MA 1SZ2A 4C8OA 3DMJA 3SMPA 3KLEA 5JS2A 4JN4A 4LY7A 4FJ8A 4FLVA 4OPJA 5J2QA 4BC3A 2O8BA 5CHIA 4JAXA 5EXWA 4FLZA 4Z4GA 4IJNA 4B8CA 1U45A 4I2QA 4WFAL 2WTUA 4KBOA 4I9QA 1XNRK 2HBLA 4DHYA 2ASPA 4DFJA 5J2NA 2W41A 1U2VA 3W3DA 4CZGA 2UYTA 1QQCA 4O55A 2KHOA 3LP1A 4DB3A 3ULEB 3LZIA 2OZMA 3L2QA 1J5OA 2DTUA 4W5RA 1CXUA 1KVAA 4BRAA 4DWIA 4DFPA 1WSFA 3WNFA 4DV4K 4DTOA 1SL0A 3EL2A 3LDNA 4WQ4C 1C0MA 4BC2A 2X78A 3H08A 3WQUA 3EE9A 2GTDA 3M8QA 5ADXH 3GOIA 5GAHP 5EU7A 3ZSRA 3MWPA 1NK5A 1RCHA 3EN9A 2OZSA 4CJQA 2ZJPL 5BRFA 5E26A 3L3VA 1NJZA 4RW6A 4YOWA 1W97L 1LW2A 3AVNA 4YORA 5AZIB 4H0TB 5BN8A 2NRXA 1X1PA 3TAGA 3H45C 3QDKA 2E6MA 3SQ0A 3U9DA 4BRMA 2HNZA 3EZ5A 5AQLA 4BDPA 3HP6A 4FM1A 5C25A 4A57A 1C6VA 3O4NA 4B8AB 4CJ5A 2NZTA 4MO5A 3CCMN 3RR7A 3RMBA 4DU1A 2HB5A 1D9DA 1XNQK 3V9ZA 4M41A 3S41A 5C0YA 3UKRA 1DLOA 3ALYA 4PKIA 1CZ9A 4HUFA 2Z1JA 1G15A 4JS4A 4M3YA 5AZJB 4LFBK 3CG7A 4FLYA 3L2RA 3FZFA 4Y1DA 3AA3A 1JLCA 1YJWN 3CC2N 3WUHA 3VEYA 1XC9A 3F2KA 3V9WA 3AA2A 1L3SA 3L0QA 1VQLN 4LFAK 4CGDA 1K8KA 3I0RA 4H0OA 3V1OA 4E3SA 1BQNA 3M8SA 3TTDA 4CFCA 4PA1A 1NGEA 4E7LA 4BR7A 1YAGA 3M5RA 1KLMA 3V4IA 1XMQK 3JAMO 1TGOA 3MXMA 4OLAA 3FR0A 1JLEA 3SK3A 1L3VA 1J53A 1RT7A 4MLHA 4BRDA 2YHXA 1RTDA 2QM1A 4JEPA 3AVAA 1KRPA 4EIAA 2A5XA 4JKEA 3AO3A 3TTCA 3VGLA 5HRPA 4BRFA 4GV3A 5DMRA 3MN6A 3VN5A 4CJVA 3O3GA 2PBDA 2QWMA 2VWKA 4OGCA 4H03B 3CF5L 4IWVA 4OO1J 5KRSA 1S3XA 3KHYA 4BE2A 2LSNA 3TAMA 1S1TA 4OKKA 2YCHA 3MMVA 1KFSA 3C6HA 4H4OA 2ITMA 3OTOK 3THYA 3DXKB 3HI0A 1YI2N 1JL1A 1Y97A 4PL8A 1GOCA 4DQRA 4KB0A 5M1OA 3SUNA 3LAMA 5AQJA 3AV9A 3SV4A 3O9QA 4PKHA 5AQYA 2AJQA 4FWMA 2YKMA 4CBUA 4XH4A 4J2AA 1T03A 1HNVA 1QZ5A 2F7TA 3FZKA 1I39A 1J6ZA 1IH7A 1U04A 2W40A 4R5PA 2CH5A 3QEXA 3T1YK 4FJ7A 1VHXA 5HRRA 4NCGA 3IMXA 3KZBA 3A0IX 3LDPA 1OH5A 2ZGYA 3RTVA 4JI2K 4FSVA 1RBVA 2HW3A 3AA5X 3OY9A 2EWSA 3ZEUB 3VQQA 3CJBA 2NLXA 2O4GA 5C12A 4B9VA 3KD5E 3SYZA 1YTAA 3MN9A 4FK4A 3F9KA 4H8KA 4JK8A 3V9UA 4DTUA 5CYQA 3ZT2A 1NK7A 5DM6L 2ETJA 2P9PB 3SBTA 2B4JA 5F1XA 3H6EA 3O9SA 1H1VA 2WONA 1NKEA 1EQYA 4IEEA 3IKMA 4YFUA 3QNNA 4AF1A 1VQ8N 4NYFA 4OPHA 1S72N 2KLAA 3J80O 4FWSA 3SAGA 1L3TA 3WQTA 4ISFA 1HPZA 2HVIA 3O80A 5BN9A 1BUPA 5HL7L 4N76A 3MEDA 3TTFA 3JS6A 3LDOA 5JICA 4DV3K 2VG7A 1QTMA 2G8KA 3DLBA 1RT6A 3A5MC 2X6SA 5M1QA 3O3FA 4B1YB 4DQ8A 1LWFA 5EY4A 1TKZA 3DI6A 3QEWA 4HTLA 3LZJA 4X65K 4FW1A 4BWMA 4CHQA 4DF4A 1NU0A 3FFIA 3CM6A 3EEQA 2KTQA 3SQ1A 5JS1A 3CERA 1T7PA 2CGLA 3O9UA 3CCQN 5GAEP 3WXLA 3HZ6A 3H3NO 5C2FA 3HPGA 1LOTB 4DSFA 2E5LK 3T7ZA 1HYVA 4QS9A 1D9FA 3NBPA 5C42A 3VF2A 4JHDB 4FM0A 1HLUA 1IO2A 1WSEA 1VQKN 4FJ5A 4CHYA 1NG9A 5E41A 4CGHA 4DR6K 1QHTA 1VQON 3OYNA 2I7NA 3MCAB 4N5SA 3DM2A 3OBWA 4IZ9A 4AHUA 3TSUA 2D0AA 3DOLA 3MCPA 3RVCA 4FJHA 4M3TA 2OA8A 1KXPA 5JLFA 1OVQA 3NMUA 1IBMK 4CHPA 3NF6A 2E2NA 3D2EB 3DLEA 2VWJA 2OYQA 2IOCA 3CCUN 3KKSA 4BRIA 4CK2A 2O8CB 4LF6K 5KI6A 3JYTA 3WT0A 1VSKA 1WSGA 4BRHA 4B08A 4YY3K 3OYJA 1GLBG 3KLIA 3OJUA 1XUPO 3NCIA 4EP5A 4B1WB 4FM2A 1RT1A 2HF4A 4IKFA 3FE1A 1TVRA 3E66A 4CFBA 4DR2K 2YX6A 4IOAL 5LL6Z 3FZHA 4RCHA 4CJEA 2I7PA 2G8UA 3TI0A 1FJGK 2IVOA 1TKXA 3U6FA 3BF3A 4K0KK 4H5TA 3OYIA 5JLHA 4B9NA 4UY8O 2V52B 4PUOA 4KHQA 1HKGA 3TABA 3RMDA 2D5RA 4JRQA 4BACA 1ZC6A 4C8MA 4DQIA 1S9GA 2ASMA 3HM9A 3C6TA 1VSLA 2HNYA 4FOIA 2P5OA 3CJ7A 3UE5A 4UQGA 2GELA 1TL3A 4F3TA 1S1WA 4FWKA 4JV5K 4PWDA 1C1BA 1JL2A 3CQ8A 5FPMA 1RDWX 1ASUA 1B9FA 3KWGA 4DQQA 3AVHA 4DUZK 4EHUA 4F3OA 4H0PA 4ID5A 3RSEA 4DQPA 1BL3A 1S1UA 3VQ9A 4CGGA 4BR0A 4CIEA 4DLEA 5AQPA 1IKXA 2NRZA 3DLLL 3NF8A 1RT5A 4AM7A 4C8LA 3NVKA 1M1KO 1ZYQA 1T05A 3QFPA 3CJCA 4M45A 3VENA 4M42A 5FDLA 3OYAA 4FWRA 4GKJK 3OYBA 5FPEA 1BIUA 3AVFA 3C6AA 4JKBA 3PX0A 3G4SN 3L4IA 4FWOA 2KFNA 2J4RA 4FJKA 1VQ6N 2H3GX 3L2UA 2A3ZA 1HNIA 2QXLA 2ZJRL 5GAGP 3T3FA 2P9UB 3AVGA 4DR4K 4C1NK 3EY1A 4WCEL 5SWMA 3UKUA 2D0OA 3SMSA 3V9SA 3DLGA 2ZF5O 3LPTA 4DTPA 4LSNA 5HROA 4LF7K 1D8YA 4DG1A 3BGRA 2GWJA 2ATQA 2IAJA 1JXBA 3OYEA 4JKGA 4K8ZA 3SAFA 3E01A 3CPEA 2YI1A 3NAEA 2E2OA 4DMNA 3RR8A 1E4GT 3J7YP 3M3ZA 1S1VA 5FRNA 4ZTFA 1MDUB 1S6QA 4E89A 1RTIA 3G0ZA 5KRTA 4JKFA 4KTZA 3GL1A 5GIPA 1QS4A 3CCRN 3AVJA 1LCUA 1T3VA 3LWLA 1YT3A 3OYFA 1RDDA 3IAYA 4DR3K 4B9MA 4CD3A 1KD1O 3M6GA 5BR9A 1TKTA 2VG6A 2DFHA 4HCBA 5BR8K 4J8FA 4OGEA 1ATRA 4IXCA 2QWRA 1HJOA 3NF7A 3R1XA 1ASWA 5HRSA 5BRDA 2F9WA 4MLEA 3TAFA 1R0AA 1X9MA 3VOVA 4H4MA 2FF3B 4EFHA 2YKNA 5HRNA 5I3UA 1E3MA 3AO2A 5AQUA 5I42A 3K57A 1K8AO 5FRMA 2JWKA 1UOCA 1X9WA 1RBUA 3WNEA 1A5VA 4FJXA 2IGIA 2ZJQL 3CJ9A 3ATUA 1TUYA 4CJFA 1ESVA 1RBSA 3H1VX 4JI4K 5BPLA 5FLXO 5LMUK 4F9OA 1NGIA 4FYDA 1JLBA 2IVNA 5BREA 5GADP 4CHOA 4OPKA 3P1GA 3N4QA 3ZLJA 3DRRA 3O4WA 4DTSA 1KSPA 2JWLA 4QCLA 4ZTJA 2NRHA 3ULDA 3O1WA 2KFZA 3FGUA 2P9KA 1IG9A 5T7BA 2Z1IA 1Z6RA 2E6LA 4X66K 5AQHA 3OW2M 3D45A 2F9TA 1NNEA 3A2FA 4HWIA 5C10A 4FJMA 2VQFK 4JI8K 3SNNA 4JK7A 4YOUA 2KW4A 2UUCK 2QK9A 3SUQA 1VSMA 4IOCL 2QTDA 4C8NA 3AVIA 3NGZA 1TL1A 3QMLA 1NMNA 5M1FA 2IS3A 4KKOA 4RW8A 3LP3A 4DS4A 4G1QA 2G8HA 4KB1A 4N41A 4CHNA 4HVJA 4XEIA 3AGKA 3H46O 4JKCA 3MN5A 2HBJA 2CGKA 5MLCQ 4C23A 3ENHA 3UB5A 3O8MA 1M90O 4NXNK 3QIPA 2PFUA 4K41A 4DV1K 5AQZA 4OLBA 4KREA 3ZETB 1C1AA 4LFCK 4KPYA 2OANA 3K5LA 1HYSA 1KVCA 4DFKA 2BDPA 2P9IB 3LDLA 1TUUA 1S5JA 3A8YA 3SUOA 3ZYYX 3OVNA 4WF9L 3U4LA 4RTFD 2Z1GA 5A2QO 3OYHA 4JYAK 3VEOA 4JS5A 4B1ZA 2KZMA 1BHLA 1BIZA 4JD2B 3DLHA 4IO9L 2A6AA 1NK8A 2W6KA 3VMFB 4I2PA 3HRGA 3QEIA 3IDHA 4CF1A 4YOVA 2G8WA 4BY9C 5DK5A 3V81A 3CD6N 2RPIA 3DRPA 3EKUA 3HBTA 3OYGA 4CW7B 5LMNK 2Q97A 4A5BA 1C1CA 4F2SA 3OYCA 2E88A 5CY4A 1EETA 1KVBA 1D5AA 5BPMA 4M7XA 4MFBA 5CYMA 4BR2A 4N47A 4QOZB 5ADXA 4LSLA 2P9SB 4DR7K 3VGKA 4CZMA 4U7BA 4KTQA 2XY5A 3J81O 1BCMA 4JKDA 3VQ7A 1EO1A 4MDAA 3CCVN 4BRPA 1N6QA 3DJCA 4OX9K 2FSJA 2HMPA 2YHBA 4WYBA 1ASVA 1WAFA 3DXMA 5AQGA 4NYNA 3WEEA 5C24A 2VQEK 3CCJN 1ZBIA 4R79A 1VRTA 3VQ6A 3MEEA 5LJVA 3VTHA 5FPDA 2WOMA 1S6PA 3LAKA 4W5NA 1VK0A 1NMDA 4A2BA 4IG0A 4Z4CA 2CH6A 1R59O 1A5WA 3NHGA 3THVA 3OHRA 2IVPA 2Q0RA 3CM5A 3GE1A 3THXB 4IDKA 4Z4IA 1TAQA 3VQDA 2P9NA 5AQTA 3NH1A 1NGDA 1TK5A 2Q31A 2Q1NA 3NH0A 3L8BA 3TPQA 2O8FB 4NCBA 5J2PA 4DSJA 2DY4A 4BE0A 4GW6A 2Q3SA 1QVGM 1N8RO 2BH1A 1BOTO 2BANA 2P9LB 2A1SA 1HKBA 2D0CA 2NRTA 3ASMA 1RDUA 3DRSA 2ZE2A 3HJFA 1N33K 4DSEA 2V7ZA 1MWMA 2O8DA 3TWHA 2WUSA 2P9UA 1K73O 3LDSA 3OA9A 1S22A 4BRGA 4FWQA 4CEEA 5AQIA 3VF4A 1NM1A 4KTWA 3FLCO 3LP0A 2YJEA 3C7NB 3ENOA 3PIOL 2HMIA 1B92A 5CR4A 4XH1A 3ID8A 4Q5VA 1QQNA 4CZEA 3GBTA 2UU9K 5AFUH 1RT2A 4RW9A 1U4BA 4F4KA 4BROA 4CIGA 3TAPA 4RWTA 4L3QA 1N36K 1XWLA 3C0BA 1ATSA 2GBZA 4GVEA 3CQXA 1DTQA 1C0GA 4AH9A 4CEDA 4O8UA 4FVMA 4QS7A 4FOEA 2HHHK 4H0XB 3PUFA 5FROA 1BG3A 5AQVA 3W0LA 3AARA 2I5JA 5LJWA 1VQNN 2ZM6K 4RW4A 3QEVA 4CK3A 4BVOA 2QWLA 1T6CA 4IBNA 4ELVA 1OVYA 1VQPN 2FC0A 3CFRA 4OKJA 1QVFM 2PYJA 5AQMA 1NOZA 3NGYA 4DQSA 3P83D 3BZKA 3AGRA 1BI4A 1TYQA 3SLCA 3P39A 4E1MA 4DR1K 1JXEA 1MWKA 1RT4A 4CJPA 3MWTA 4HTUA 4RW7A 1VSEA 4CESA 1C0TA 4O0JA 3ZSWA 1HRHA 1RTJA 1Q8IA 3CETA 4FWNA 3E9PA 5D3GA 2DFEA 2FBTA 4ISEA 1UA0A 1Z05A 4O44A 3LWMA 2QI2A 4H0YB 3ZSYA 2O8EB 3Q7BA 2O8BB 3VEZA 4Q0BA 3K59A 1QZ6A 3EZWA 4LD0A 4E1NA 1OH7A 4YHHK 3I8BA 1NGAA 5AQXA 4CHZA 3K0SA 4KHYA 4FL9A 5JVGL 3F73A 1DGKN 2HHQA 3K5MA 4DCHA 4YDUC 4Z4HA 4LF9K 1ZBLA 3I8DA 3THWA 2YHWA 4AHCA 1WUAA 3G10A 3SI6A 1U2VB 2WBNA 3CXCM 4AHTA 3EE8A 1VSIA 3L6QA 4Z4FA 2HHTA 4WQ5A 4XH5A 1BA0A 4FLUA 1NGHA 4Z94A 1Q9YA 3OS2A 1GOBA 1W0HA 4YOTA 1EXQA 3MEGA 3UIQA 4IFEA 4BRQA 3SUPA 1KTQA 1IKYA 4KI4A 1K6YA 3HSCA 3HSTB 2IIRA 1JLQA 1YIJN 1J9AA 3CHWA 3ZSZA 1QE1A 3TU5A 3P4IA 4DU4A 5C15A 1BDGA 3ULEA 3Q7CA 3VQCA 1IKWA 1JLAA 4U67L 3RRHA 1T6DA 4CEQA 3QESA 3AVLA 3SQ2A 1KQSM 4FZZA 3HM8A 1FKPA 1LW0A 1OKJA 4CEZA 2DPNA 2FSNA 1NLVA 3A5OC 1TV6A 2E2QA 2HBMA 3AAPA 3BY5A 3TSPA 3CCEN 1BCOA 4BREA 3N4PA 3HYFA 5AZIA 4C1NI 1EKEA 3M8RA 4Y1CA 1NK9A 4E7HA 4FJNA 1LAWA 2P9IA 2PAVA 3AY9A 4FJJA 3QFUA 1VQMN 4CJSA 4OJRA 2G8IA 1BU6O 2GWKA 4CGFA 2F4VK 3BF1A 4JD2A 4ICLA 2Y1IA 3BP8A 5CE3A 3MX2A 1RNHA 1Q9XA 2E2PA 4IFYA 3KK3A 1HJRA 4CBWA 2QEXN 2G8FA 1VSFA 4EAHD 1EX4A 3CFOA 1QSLA 3ENBA 4CEOA 1YVNA 2Q2RA 1WSHA 5AZJA 5KTQA 4EHTA 2QW9A 1NWKA 2ASOA 1ILYA 3QICA 1VSHA 1SV5A 4NLCA 4LF8K 4KHUA 4FWPA 4CK1A 4W5TA 1OH8A 1UAXA 4CBXA 4BR5A 1RDAA 1VSJA 1IBKK 3D2FB 3IS9A 2D4WA 3ATVA 2FF6A 3ZT3A 2HHSA 4K8XA 3VQAA 4BG8A 4FO0A 4H5RA 3QINA 1TK8A 1ITGA 1SKRA 2UUAK 1GLLO 4GV9A 3HOSA 1EWRA 2QWOA 4BRKA 3VEXA 4JNEA 4BR9A 4BGBA 5KQ8A 2FBXA 5KPRA 4A62A 4B1XB 1NKCA 1LWCA 4FPAA 3L4QA 3IUCA 4M3XA 1TAUA 3J7AP 1HNXK 1RDBA 3KWIA 3IFRA 3R3LA 3O08A 4PY5A 2BGGA 4KHNA 1XI1A 1WB9A 3R9PA 4FLTA 1UA1A 2O8FA 5GINA 2QA4N 1C0UA 1Z25A 5KGWA 1RDCA 4IFVA 4DTRA 4K25A 4BWJA 4CZJA 4O0IA 3QERA 1JCFA 1NGCA 3S3OA 1YITN 3AVBA 1ZBHA 4PL7A 3DXKA 1KAYA 4CFDA 4DSKA 4KH6A 5CZ1A 1BGXT 1WSIA 4DLGA 3PX6A 3KK7A 2NNWA 3VETA 3U3YA 3M8PA 4BRLA 4BQZA 5J2MA 4E7IA 4KHPK 4EP4A 4CZFA 5H1SQ 3TSQA 1Y64A 4CERA 4DUYK 2D0PA 3I33A 4FK2A 5M1KA 4J2EA 5HLFA 3VQ8A 5AQFA 1GLFO 2W42A 4DV7K 4CIFA 2X6NA 4JLHA 2BUPA 4CEBA 1G99A 5AQQA 4I6MB 3OYDA 3SZ2A 2X74A 4GMJB 3HT3A 1KAXA 3ZEUA 4GKKK 4MQ3A 2FBYA 4JI3K 1FXXA 4E7JA 5F2RA 4CJKA 2WC9A 3AVKA 1ZBSA 2P9PA 1EWQA 4BE1A 1CZAN 2XRIA 3FZLA 3CMEN 2Q0UA 4WQ4A 3VQ5A 1OH6A 5KPTA 3C94A 1J54A 1K9MO 4B3TK 4KHSA 3VESA 3C65A 4OKEA 2VYPA 1DT9A 4L8RB 3OYLA 3VQBA 3J8AA 1NGFA 3T69A 2UXCK 4KI6A
chains in the Genus database with same CATH topology
1VRTA 3VQ6A 3MEEA 3LZJA 3SJJA 3VA0A 4EZ6A 1Z26A 2WOMA 4FW1A 4BWMA 4CHQA 3WNGA 3HVRA 1S6PA 3K2PA 3LAKA 3OS1A 1VK0A 2RN2A 4DF4A 4M3UA 3FFIA 4IG0A 4Z4CA 4W5NA 3CM6A 1A5WA 3QIOA 3NHGA 3THVA 2KTQA 4YNQA 3SQ1A 2P1JA 5JS1A 1S9EA 1T7PA 4PQUA 2GV9A 3CM5A 1B9DA 3TARA 3C95A 4F2RA 4IDKA 4Z4IA 1TAQA 3VQDA 3HPGA 3NH1A 3AO1A 4O4GA 3NE6A 1TK5A 3L2VA 4DSFA 1S1XA 3NH0A 3L8BA 1HMVA 4ID1A 1HYVA 5J1EA 1D9FA 1CZBA 5J2PA 1U49A 1VSDA 4DSJA 3IRXA 4NCBA 3NBPA 2DY4A 3AO4A 3NDKA 4TSXA 4GW6A 1JLFA 1LWEA 2Q3SA 5C42A 4BE0A 3MXJA 3AO5A 1U48A 4FM0A 5HP1A 2BANA 1IO2A 2A1SA 1WSEA 4DTMA 4B9TA 2D0CA 1JKHA 4FJ5A 4CECA 3ZT1A 4CHYA 3ASMA 3ZSQA 5E41A 4M3RA 3DRSA 3KTQA 3KD1E 4CGHA 2HHUA 2ZE2A 1QHTA 1NJYA 3ISNC 4FZYA 2JLEA 3HJFA 3OYNA 4N5SA 4HUGA 4DSEA 3DM2A 3RMAA 2QXFA 4DTXA 1SUQA 4KFBA 3TWHA 3SPYA 4E0DA 4AHUA 4QAGA 5SZTA 2D0AA 1F21A 3SCXA 1EP4A 3LDSA 2OPSA 3DOLA 2B6AA 2EHGA 2F96A 1MU2A 3IG1A 4FJHA 4M3TA 4CEEA 3OYMA 4AHSA 2JGUA 3JSMA 4AILC 2OA8A 4KTWA 4HHTA 3LP0A 3RMCA 4CHPA 4ELTA 1ZBFA 2FBVA 1B92A 3NF6A 2HMIA 4B9SA 3DLEA 4Q5VA 2VWJA 2IOCA 2OYQA 3KKSA 4CK2A 3SV3A 3QLHA 5KI6A 1RT2A 4CJRA 3JYTA 1SL2A 1VSKA 1WSGA 2YNIA 4RW9A 1U4BA 4F4KA 4FJ9A 4B08A 4CIGA 3TAPA 4AHRA 3KLIA 3OYJA 3S9HA 4LH4A 3OJUA 5K14A 3HPOA 3NCIA 4KAZA 4EP5A 1QSYA 1XWLA 4FM2A 1RT1A 1IKVA 3HPHA 2GBZA 4FW2A 1WSJA 5CZ2A 4IKFA 2XHBA 1TVRA 4CFBA 1DTQA 4AH9A 4CEDA 4CF0A 3OS0A 4CJEA 2RKIA 4FVMA 4CJTA 4O5BA 4RG8A 2P5GA 3KKRA 2EX3A 3VQEA 3PUFA 5FROA 2G8UA 1NJXA 2OPQA 3TI0A 1FKOA 3QETA 2I5JA 2GUIA 1TKXA 4DTJA 4XIUA 3U6FA 4RW4A 3QEVA 4CK3A 2HHVA 3MECA 1BI4B 4IBNA 4ZHRA 3OYIA 4ELVA 1N5YA 1KLNA 4B9NA 1W9HA 2FC0A 3V1QA 4OKJA 3KK2A 3CFRA 4FXDA 2HNDA 2OPRA 4Z0UA 4PUOA 2PYJA 3QEPA 4KHQA 1NOZA 4CJ3A 3HL8A 3NGYA 3TABA 3RMDA 3SPZA 2D5RA 4DQSA 4JRQA 3P83D 4BACA 3AVMA 4DQIA 4C8MA 1BI4A 1S9GA 3TAEA 4CJ4A 1CXQA 5HBMA 3C6TA 3HM9A 4E1MA 2NUBA 3TANA 1JXEA 1O1WA 1VSLA 1RT4A 1BISA 2HNYA 2HHXA 2VG5A 4CJPA 2P5OA 1JLGA 4E19A 4HTUA 1HYZA 4RW7A 1CLQA 4UQGA 3BDPA 1TL3A 1VSEA 1UWBA 4F3TA 4CESA 1C0TA 1S1WA 4PWDA 4O0JA 1C1BA 3ZSWA 3ZT4A 1GOAA 4EZ9A 2F8SA 3HO1A 2HVHA 3O3HA 1HRHA 1RTJA 1Q8IA 2PYLA 2ZQBA 1JL2A 5D3GA 3CQ8A 2DFEA 2FBTA 1ASUA 1B9FA 1HQEA 4DQQA 1UA0A 3AVHA 4KO0A 4O44A 3C6UA 1NKBA 3B6OA 3LWMA 4B9LA 4IG3A 3T19A 3ZSYA 1TK0A 4F3OA 4ID5A 4DQPA 3KJVA 1BL3A 1S1UA 2B5JA 3VQ9A 3O4QA 4CGGA 4CIEA 4DLEA 3QNOA 1QSSA 4Q0BA 1IKXA 4CFAA 3K59A 2YV0X 4LD0A 1SKWA 4E1NA 3NF8A 4C8OA 1RT5A 3DMJA 4CHZA 3KLEA 5JS2A 4C8LA 4KHYA 1RT3A 4B3OA 1ZYQA 4LY7A 4CJUA 3D0PA 1T05A 2QKBA 4FJ8A 4FLVA 3F73A 4J2DA 4OPJA 5J2QA 4M45A 2HHQA 3K5MA 4M42A 4FLZA 4Z4HA 5FDLA 3OYAA 1YVUA 1ZBLA 3OYBA 4Z4GA 3I8DA 1XHZA 1BIUA 3AVFA 2YNFA 4B8CA 4AHCA 3V6DA 3G10A 3KK1A 3PX0A 1U45A 3SI6A 4I2QA 4JRPA 4AHTA 1VSIA 3K5OA 1NK0A 4Z4FA 2HHTA 2KFNA 4I9QA 4FLUA 4Z4EA 4FJKA 2O4IA 2KQ2A 3L2UA 4FCYA 1HNIA 1Q9YA 3T3FA 3OS2A 4DFJA 3AVGA 5J2NA 1GOBA 3EY1A 1W0HA 2DFFA 4KRFA 1EXQA 3MEGA 3UIQA 4W5QA 5SWMA 1QQCA 3SUPA 1KTQA 4O55A 1IKYA 4KI4A 3LP1A 4E7KA 1K6YA 3LZIA 2OZMA 3L2QA 3V9SA 3DLGA 1J5OA 2PZSA 2DTUA 4W5RA 3TAQA 1X9SA 3LPTA 1CXUA 3HSTB 1KVAA 2R7YA 4DWIA 1JLQA 4DTPA 4LSNA 1WSFA 1WNSA 4DFPA 2IC3A 5HROA 2F8TA 1J9AA 3WNFA 1D8YA 4DTOA 4DG1A 1SL0A 3ZSZA 3BGRA 3V9XA 1QE1A 2ATQA 2YHAA 3PY8A 1C0MA 2X78A 2IAJA 1JXBA 3H08A 3OYEA 3M8QA 4DU4A 4K8ZA 2KZZA 5EU7A 3ZSRA 3AA4A 3KIOA 1REVA 3VQCA 1IKWA 1JLAA 3E01A 3RRHA 1NK5A 1RCHA 3NAEA 4NCAA 1DTTA 4CEQA 3ZSVA 2OZSA 3QESA 4DMNA 3U3GA 3AVLA 1WN7A 4CJQA 3RR8A 3SQ2A 4M3ZA 2Y1JA 3L2WA 3L3VA 1TKDA 4FZZA 1NJZA 1FKPA 1KFDA 1LW0A 4RW6A 1LW2A 3AVNA 2Z1HA 1S1VA 4CEZA 4ZTFA 4M3WA 5FRNA 4BDZA 1S6QA 4E89A 3S3MA 1RTIA 2HHWA 1BQMA 1X1PA 3G0ZA 3TAGA 5KRTA 1TV6A 4KTZA 4KHWA 1QS4A 3PO5A 2E6MA 3SQ0A 4CEAA 1BCOA 2HNZA 3AVJA 3HYFA 3EZ5A 4CJLA 3LWLA 4DTNA 1YT3A 1EKEA 3OYFA 1RDDA 3M8RA 4HCCA 3IAYA 3KLHA 4B9MA 4BDPA 4Y1CA 3VQ4A 3HP6A 3SQ4A 2A1RA 3DLKA 4FM1A 4E7HA 1TKTA 1NK9A 4FJNA 1LAWA 2VG6A 4FZXC 5C25A 2DFHA 4HCBA 3T1AA 1C6VA 3O4NA 3P5JA 4B8AB 4FJJA 4CJ5A 4CCHA 1NJWA 3RR7A 4CJSA 4OJRA 3RMBA 2ZD1A 4DU1A 2G8IA 4CGFA 2HB5A 1D9DA 4OGEA 3OJSA 4FJGA 3V9ZA 4M41A 2G8VA 3NF7A 2OPPA 3DYAA 4ICLA 1RBRA 1ASWA 5HRSA 3ITHA 2Y1IA 1DLOA 3ALYA 4N56A 1CZ9A 3TAFA 3I0SA 4HUFA 1R0AA 1A5XA 2P51A 2Z1JA 1RNHA 1X9MA 4DSLA 1G15A 4H4MA 4JS4A 4M3YA 1NK4A 1Q9XA 3CG7A 4IFYA 3KK3A 4FLYA 2YKNA 4HUEA 1HJRA 5HRNA 3L2RA 5I3UA 2G8FA 3ZSOA 1VSFA 1RTHA 2E4LA 4Y1DA 3AA3A 3AO2A 3LANA 1JLCA 1EX4A 3CFOA 1QSLA 3NFAA 1XC9A 4CEOA 5I42A 3K57A 3V9WA 1WSHA 3AA2A 1UOCA 1L3SA 5FRMA 5KTQA 4LH5A 1X9WA 1RBUA 3DLRA 4CGDA 3WNEA 3I0RA 1A5VA 3V1OA 4E3SA 1BQNA 3WNHA 3NH2A 3M8SA 1VSHA 1SV5A 4FJXA 2IGIA 4KHUA 2XY6A 3LALA 4CJFA 4CK1A 4W5TA 4CFCA 4DU3A 2XO7A 1RBTA 4PA1A 4FJIA 4C8KA 1RBSA 1UAXA 3OYKA 4E7LA 1RDAA 1KLMA 1VSJA 3V4IA 3DOKA 1TGOA 3IS9A 3MXMA 4OLAA 4FYDA 3ZT3A 1JLBA 2HHSA 3ZCMA 4K8XA 3VQAA 2IDOA 3PO4A 1JLEA 1NK6A 1L3VA 1J53A 1RT7A 4CF8A 4CHOA 3P1GA 4OPKA 4BDYA 3ZT0A 2PY5A 1FK9A 4FK0A 1RTDA 3DRRA 3K5NA 3QINA 1U47A 3EYZA 3AVAA 4DTSA 1KSPA 4DF8A 3VQPA 1TK8A 1ITGA 3K58A 1KRPA 1SKRA 4QCLA 4ZTJA 3HVTA 3L3UA 3AO3A 1WLJA 1RILA 1I3AA 4CF9A 3S3NA 5HRPA 3ULDA 4J2BA 2FBXA 2KFZA 5DMRA 3NGIA 4DSIA 4DFMA 2D0BA 4CJVA 3VN5A 1IG9A 5T7BA 3O3GA 1NKCA 1LWCA 2VWKA 2Z1IA 2E6LA 4OGCA 2XY7A 3D45A 4M3XA 1TAUA 3A2FA 4FJMA 3VA3A 5KRSA 3RRGA 1RDBA 4BE2A 3MAQA 1L3UA 2LSNA 4AHVA 3TAMA 1S1TA 4OKKA 3PV8A 3SNNA 1KCFA 4PY5A 1KFSA 4CJWA 2BGGA 2KW4A 4H4OA 4KHNA 1XI1A 2QK9A 3SUQA 4FLTA 1UA1A 1C0UA 1VSMA 1Z25A 5KGWA 4DS5A 1RDCA 3TR8A 1JL1A 1Y97A 4IFVA 1GOCA 3AVIA 4C8NA 3NGZA 4DQRA 1TL1A 4DTRA 3SUNA 4KB0A 3LAMA 2IS3A 4KKOA 3AV9A 4RW8A 3SV4A 3LP3A 4BWJA 4I9LA 4DS4A 4G1QA 2G8HA 4O0IA 3V1RA 3QERA 4KB1A 2AJQA 4N41A 4CHNA 3RWUA 4HVJA 3S3OA 3AVBA 1ZBHA 2YKMA 4CFDA 4ELUA 4DSKA 2BE2A 5CZ1A 4J2AA 1YTUA 1T03A 1HNVA 1BGXT 1WSIA 1I39A 4DLGA 3QIPA 3PX6A 1IH7A 1U04A 4OLBA 4KREA 4FLXA 4R5PA 1C1AA 3QEXA 4F8RA 3U3YA 3LP2A 3KLGA 3M8PA 4KPYA 3K5LA 1HYSA 1KVCA 4DFKA 4KV8A 4E7IA 5J2MA 2BDPA 4FJ7A 3HK2A 1S5JA 5HRRA 3SUOA 2XY8A 4NCGA 3NF9A 4EP4A 2YNGA 3OVNA 4CERA 2Z1GA 3CFPA 4FK2A 2RF2A 3OYHA 3RTVA 4JS5A 4CF2A 2KZMA 4J2EA 1BHLA 4FLWA 1BIZA 5HLFA 1RBVA 3VQ8A 2HW3A 3AA5X 3OY9A 3DLHA 1SL1A 1ZBUA 1NK8A 3VQQA 3PX4A 2W42A 2QKKA 2O4GA 4CGJA 4GVMA 4CIFA 4B9VA 4I2PA 2X6NA 4JLHA 2YNHA 3SYZA 3QEIA 1YTAA 3HXMA 3KD5E 1WAJA 4I7FA 4CEBA 4CF1A 4FK4A 3F9KA 4H8KA 2G8WA 3OYDA 5DK5A 3V9UA 4DTUA 3V81A 5CYQA 3ZT2A 2RPIA 3DRPA 1XHXA 3SZ2A 1NK7A 2X74A 2ETJA 4GMJB 3HT3A 2B4JA 4MQ3A 3OYGA 2FBYA 1T8EA 3AVCA 2WONA 1FXXA 1SKSA 1NKEA 4E7JA 1C1CA 4CJKA 3CYMA 4F2SA 3OYCA 3AVKA 4YFUA 3QNNA 3HP9A 2ITGA 5CY4A 4W5OA 1EETA 4CEFA 4CGIA 4BE1A 4NYFA 1KVBA 1D5AA 4MFBA 4CE9A 2XRIA 5CYMA 4N47A 1L3TA 1LV5A 4QOZB 3KLFA 1HPZA 4LSLA 1L5UA 2HVIA 3VQ5A 3MXIA 3C94A 1VRUA 2XY5A 1J54A 3MEDA 4KTQA 4N76A 3B6PA 1BCMA 1HQUA 4KHSA 3VQ7A 2VG7A 1QTMA 3ZSXA 2G8KA 3DLBA 1RT6A 4OKEA 3QO9A 1NOYA 4L8RB 1N6QA 3OYLA 2X6SA 3O3FA 4FJLA 1LAVA 3VQBA 3LPUA 2YHBA 4OVLA 1ASVA 1LWFA 1WAFA 4WE1A 5KGXA 1TKZA 3DI6A 4NYNA 5C24A 3QEWA 4B9UA 1ZBIA 4KI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRT A;  3VQ6 A;  3MEE A;  3LZJ A;  3SJJ A;  3VA0 A;  4EZ6 A;  1Z26 A;  2WOM A;  4FW1 A;  4BWM A;  4CHQ A;  3WNG A;  3HVR A;  1S6P A;  3K2P A;  3LAK A;  3OS1 A;  1VK0 A;  2RN2 A;  4DF4 A;  4M3U A;  3FFI A;  4IG0 A;  4Z4C A;  4W5N A;  3CM6 A;  1A5W A;  3QIO A;  3NHG A;  3THV A;  2KTQ A;  4YNQ A;  3SQ1 A;  2P1J A;  5JS1 A;  1S9E A;  1T7P A;  4PQU A;  2GV9 A;  3CM5 A;  1B9D A;  3TAR A;  3C95 A;  4F2R A;  4IDK A;  4Z4I A;  1TAQ A;  3VQD A;  3HPG A;  3NH1 A;  3AO1 A;  4O4G A;  3NE6 A;  1TK5 A;  3L2V A;  4DSF A;  1S1X A;  3NH0 A;  3L8B A;  1HMV A;  4ID1 A;  1HYV A;  5J1E A;  1D9F A;  1CZB A;  5J2P A;  1U49 A;  1VSD A;  4DSJ A;  3IRX A;  4NCB A;  3NBP A;  2DY4 A;  3AO4 A;  3NDK A;  4TSX A;  4GW6 A;  1JLF A;  1LWE A;  2Q3S A;  5C42 A;  4BE0 A;  3MXJ A;  3AO5 A;  1U48 A;  4FM0 A;  5HP1 A;  2BAN A;  1IO2 A;  2A1S A;  1WSE A;  4DTM A;  4B9T A;  2D0C A;  1JKH A;  4FJ5 A;  4CEC A;  3ZT1 A;  4CHY A;  3ASM A;  3ZSQ A;  5E41 A;  4M3R A;  3DRS A;  3KTQ A;  3KD1 E;  4CGH A;  2HHU A;  2ZE2 A;  1QHT A;  1NJY A;  3ISN C;  4FZY A;  2JLE A;  3HJF A;  3OYN A;  4N5S A;  4HUG A;  4DSE A;  3DM2 A;  3RMA A;  2QXF A;  4DTX A;  1SUQ A;  4KFB A;  3TWH A;  3SPY A;  4E0D A;  4AHU A;  4QAG A;  5SZT A;  2D0A A;  1F21 A;  3SCX A;  1EP4 A;  3LDS A;  2OPS A;  3DOL A;  2B6A A;  2EHG A;  2F96 A;  1MU2 A;  3IG1 A;  4FJH A;  4M3T A;  4CEE A;  3OYM A;  4AHS A;  2JGU A;  3JSM A;  4AIL C;  2OA8 A;  4KTW A;  4HHT A;  3LP0 A;  3RMC A;  4CHP A;  4ELT A;  1ZBF A;  2FBV A;  1B92 A;  3NF6 A;  2HMI A;  4B9S A;  3DLE A;  4Q5V A;  2VWJ A;  2IOC A;  2OYQ A;  3KKS A;  4CK2 A;  3SV3 A;  3QLH A;  5KI6 A;  1RT2 A;  4CJR A;  3JYT A;  1SL2 A;  1VSK A;  1WSG A;  2YNI A;  4RW9 A;  1U4B A;  4F4K A;  4FJ9 A;  4B08 A;  4CIG A;  3TAP A;  4AHR A;  3KLI A;  3OYJ A;  3S9H A;  4LH4 A;  3OJU A;  5K14 A;  3HPO A;  3NCI A;  4KAZ A;  4EP5 A;  1QSY A;  1XWL A;  4FM2 A;  1RT1 A;  1IKV A;  3HPH A;  2GBZ A;  4FW2 A;  1WSJ A;  5CZ2 A;  4IKF A;  2XHB A;  1TVR A;  4CFB A;  1DTQ A;  4AH9 A;  4CED A;  4CF0 A;  3OS0 A;  4CJE A;  2RKI A;  4FVM A;  4CJT A;  4O5B A;  4RG8 A;  2P5G A;  3KKR A;  2EX3 A;  3VQE A;  3PUF A;  5FRO A;  2G8U A;  1NJX A;  2OPQ A;  3TI0 A;  1FKO A;  3QET A;  2I5J A;  2GUI A;  1TKX A;  4DTJ A;  4XIU A;  3U6F A;  4RW4 A;  3QEV A;  4CK3 A;  2HHV A;  3MEC A;  1BI4 B;  4IBN A;  4ZHR A;  3OYI A;  4ELV A;  1N5Y A;  1KLN A;  4B9N A;  1W9H A;  2FC0 A;  3V1Q A;  4OKJ A;  3KK2 A;  3CFR A;  4FXD A;  2HND A;  2OPR A;  4Z0U A;  4PUO A;  2PYJ A;  3QEP A;  4KHQ A;  1NOZ A;  4CJ3 A;  3HL8 A;  3NGY A;  3TAB A;  3RMD A;  3SPZ A;  2D5R A;  4DQS A;  4JRQ A;  3P83 D;  4BAC A;  3AVM A;  4DQI A;  4C8M A;  1BI4 A;  1S9G A;  3TAE A;  4CJ4 A;  1CXQ A;  5HBM A;  3C6T A;  3HM9 A;  4E1M A;  2NUB A;  3TAN A;  1JXE A;  1O1W A;  1VSL A;  1RT4 A;  1BIS A;  2HNY A;  2HHX A;  2VG5 A;  4CJP A;  2P5O A;  1JLG A;  4E19 A;  4HTU A;  1HYZ A;  4RW7 A;  1CLQ A;  4UQG A;  3BDP A;  1TL3 A;  1VSE A;  1UWB A;  4F3T A;  4CES A;  1C0T A;  1S1W A;  4PWD A;  4O0J A;  1C1B A;  3ZSW A;  3ZT4 A;  1GOA A;  4EZ9 A;  2F8S A;  3HO1 A;  2HVH A;  3O3H A;  1HRH A;  1RTJ A;  1Q8I A;  2PYL A;  2ZQB A;  1JL2 A;  5D3G A;  3CQ8 A;  2DFE A;  2FBT A;  1ASU A;  1B9F A;  1HQE A;  4DQQ A;  1UA0 A;  3AVH A;  4KO0 A;  4O44 A;  3C6U A;  1NKB A;  3B6O A;  3LWM A;  4B9L A;  4IG3 A;  3T19 A;  3ZSY A;  1TK0 A;  4F3O A;  4ID5 A;  4DQP A;  3KJV A;  1BL3 A;  1S1U A;  2B5J A;  3VQ9 A;  3O4Q A;  4CGG A;  4CIE A;  4DLE A;  3QNO A;  1QSS A;  4Q0B A;  1IKX A;  4CFA A;  3K59 A;  2YV0 X;  4LD0 A;  1SKW A;  4E1N A;  3NF8 A;  4C8O A;  1RT5 A;  3DMJ A;  4CHZ A;  3KLE A;  5JS2 A;  4C8L A;  4KHY A;  1RT3 A;  4B3O A;  1ZYQ A;  4LY7 A;  4CJU A;  3D0P A;  1T05 A;  2QKB A;  4FJ8 A;  4FLV A;  3F73 A;  4J2D A;  4OPJ A;  5J2Q A;  4M45 A;  2HHQ A;  3K5M A;  4M42 A;  4FLZ A;  4Z4H A;  5FDL A;  3OYA A;  1YVU A;  1ZBL A;  3OYB A;  4Z4G A;  3I8D A;  1XHZ A;  1BIU A;  3AVF A;  2YNF A;  4B8C A;  4AHC A;  3V6D A;  3G10 A;  3KK1 A;  3PX0 A;  1U45 A;  3SI6 A;  4I2Q A;  4JRP A;  4AHT A;  1VSI A;  3K5O A;  1NK0 A;  4Z4F A;  2HHT A;  2KFN A;  4I9Q A;  4FLU A;  4Z4E A;  4FJK A;  2O4I A;  2KQ2 A;  3L2U A;  4FCY A;  1HNI A;  1Q9Y A;  3T3F A;  3OS2 A;  4DFJ A;  3AVG A;  5J2N A;  1GOB A;  3EY1 A;  1W0H A;  2DFF A;  4KRF A;  1EXQ A;  3MEG A;  3UIQ A;  4W5Q A;  5SWM A;  1QQC A;  3SUP A;  1KTQ A;  4O55 A;  1IKY A;  4KI4 A;  3LP1 A;  4E7K A;  1K6Y A;  3LZI A;  2OZM A;  3L2Q A;  3V9S A;  3DLG A;  1J5O A;  2PZS A;  2DTU A;  4W5R A;  3TAQ A;  1X9S A;  3LPT A;  1CXU A;  3HST B;  1KVA A;  2R7Y A;  4DWI A;  1JLQ A;  4DTP A;  4LSN A;  1WSF A;  1WNS A;  4DFP A;  2IC3 A;  5HRO A;  2F8T A;  1J9A A;  3WNF A;  1D8Y A;  4DTO A;  4DG1 A;  1SL0 A;  3ZSZ A;  3BGR A;  3V9X A;  1QE1 A;  2ATQ A;  2YHA A;  3PY8 A;  1C0M A;  2X78 A;  2IAJ A;  1JXB A;  3H08 A;  3OYE A;  3M8Q A;  4DU4 A;  4K8Z A;  2KZZ A;  5EU7 A;  3ZSR A;  3AA4 A;  3KIO A;  1REV A;  3VQC A;  1IKW A;  1JLA A;  3E01 A;  3RRH A;  1NK5 A;  1RCH A;  3NAE A;  4NCA A;  1DTT A;  4CEQ A;  3ZSV A;  2OZS A;  3QES A;  4DMN A;  3U3G A;  3AVL A;  1WN7 A;  4CJQ A;  3RR8 A;  3SQ2 A;  4M3Z A;  2Y1J A;  3L2W A;  3L3V A;  1TKD A;  4FZZ A;  1NJZ A;  1FKP A;  1KFD A;  1LW0 A;  4RW6 A;  1LW2 A;  3AVN A;  2Z1H A;  1S1V A;  4CEZ A;  4ZTF A;  4M3W A;  5FRN A;  4BDZ A;  1S6Q A;  4E89 A;  3S3M A;  1RTI A;  2HHW A;  1BQM A;  1X1P A;  3G0Z A;  3TAG A;  5KRT A;  1TV6 A;  4KTZ A;  4KHW A;  1QS4 A;  3PO5 A;  2E6M A;  3SQ0 A;  4CEA A;  1BCO A;  2HNZ A;  3AVJ A;  3HYF A;  3EZ5 A;  4CJL A;  3LWL A;  4DTN A;  1YT3 A;  1EKE A;  3OYF A;  1RDD A;  3M8R A;  4HCC A;  3IAY A;  3KLH A;  4B9M A;  4BDP A;  4Y1C A;  3VQ4 A;  3HP6 A;  3SQ4 A;  2A1R A;  3DLK A;  4FM1 A;  4E7H A;  1TKT A;  1NK9 A;  4FJN A;  1LAW A;  2VG6 A;  4FZX C;  5C25 A;  2DFH A;  4HCB A;  3T1A A;  1C6V A;  3O4N A;  3P5J A;  4B8A B;  4FJJ A;  4CJ5 A;  4CCH A;  1NJW A;  3RR7 A;  4CJS A;  4OJR A;  3RMB A;  2ZD1 A;  4DU1 A;  2G8I A;  4CGF A;  2HB5 A;  1D9D A;  4OGE A;  3OJS A;  4FJG A;  3V9Z A;  4M41 A;  2G8V A;  3NF7 A;  2OPP A;  3DYA A;  4ICL A;  1RBR A;  1ASW A;  5HRS A;  3ITH A;  2Y1I A;  1DLO A;  3ALY A;  4N56 A;  1CZ9 A;  3TAF A;  3I0S A;  4HUF A;  1R0A A;  1A5X A;  2P51 A;  2Z1J A;  1RNH A;  1X9M A;  4DSL A;  1G15 A;  4H4M A;  4JS4 A;  4M3Y A;  1NK4 A;  1Q9X A;  3CG7 A;  4IFY A;  3KK3 A;  4FLY A;  2YKN A;  4HUE A;  1HJR A;  5HRN A;  3L2R A;  5I3U A;  2G8F A;  3ZSO A;  1VSF A;  1RTH A;  2E4L A;  4Y1D A;  3AA3 A;  3AO2 A;  3LAN A;  1JLC A;  1EX4 A;  3CFO A;  1QSL A;  3NFA A;  1XC9 A;  4CEO A;  5I42 A;  3K57 A;  3V9W A;  1WSH A;  3AA2 A;  1UOC A;  1L3S A;  5FRM A;  5KTQ A;  4LH5 A;  1X9W A;  1RBU A;  3DLR A;  4CGD A;  3WNE A;  3I0R A;  1A5V A;  3V1O A;  4E3S A;  1BQN A;  3WNH A;  3NH2 A;  3M8S A;  1VSH A;  1SV5 A;  4FJX A;  2IGI A;  4KHU A;  2XY6 A;  3LAL A;  4CJF A;  4CK1 A;  4W5T A;  4CFC A;  4DU3 A;  2XO7 A;  1RBT A;  4PA1 A;  4FJI A;  4C8K A;  1RBS A;  1UAX A;  3OYK A;  4E7L A;  1RDA A;  1KLM A;  1VSJ A;  3V4I A;  3DOK A;  1TGO A;  3IS9 A;  3MXM A;  4OLA A;  4FYD A;  3ZT3 A;  1JLB A;  2HHS A;  3ZCM A;  4K8X A;  3VQA A;  2IDO A;  3PO4 A;  1JLE A;  1NK6 A;  1L3V A;  1J53 A;  1RT7 A;  4CF8 A;  4CHO A;  3P1G A;  4OPK A;  4BDY A;  3ZT0 A;  2PY5 A;  1FK9 A;  4FK0 A;  1RTD A;  3DRR A;  3K5N A;  3QIN A;  1U47 A;  3EYZ A;  3AVA A;  4DTS A;  1KSP A;  4DF8 A;  3VQP A;  1TK8 A;  1ITG A;  3K58 A;  1KRP A;  1SKR A;  4QCL A;  4ZTJ A;  3HVT A;  3L3U A;  3AO3 A;  1WLJ A;  1RIL A;  1I3A A;  4CF9 A;  3S3N A;  5HRP A;  3ULD A;  4J2B A;  2FBX A;  2KFZ A;  5DMR A;  3NGI A;  4DSI A;  4DFM A;  2D0B A;  4CJV A;  3VN5 A;  1IG9 A;  5T7B A;  3O3G A;  1NKC A;  1LWC A;  2VWK A;  2Z1I A;  2E6L A;  4OGC A;  2XY7 A;  3D45 A;  4M3X A;  1TAU A;  3A2F A;  4FJM A;  3VA3 A;  5KRS A;  3RRG A;  1RDB A;  4BE2 A;  3MAQ A;  1L3U A;  2LSN A;  4AHV A;  3TAM A;  1S1T A;  4OKK A;  3PV8 A;  3SNN A;  1KCF A;  4PY5 A;  1KFS A;  4CJW A;  2BGG A;  2KW4 A;  4H4O A;  4KHN A;  1XI1 A;  2QK9 A;  3SUQ A;  4FLT A;  1UA1 A;  1C0U A;  1VSM A;  1Z25 A;  5KGW A;  4DS5 A;  1RDC A;  3TR8 A;  1JL1 A;  1Y97 A;  4IFV A;  1GOC A;  3AVI A;  4C8N A;  3NGZ A;  4DQR A;  1TL1 A;  4DTR A;  3SUN A;  4KB0 A;  3LAM A;  2IS3 A;  4KKO A;  3AV9 A;  4RW8 A;  3SV4 A;  3LP3 A;  4BWJ A;  4I9L A;  4DS4 A;  4G1Q A;  2G8H A;  4O0I A;  3V1R A;  3QER A;  4KB1 A;  2AJQ A;  4N41 A;  4CHN A;  3RWU A;  4HVJ A;  3S3O A;  3AVB A;  1ZBH A;  2YKM A;  4CFD A;  4ELU A;  4DSK A;  2BE2 A;  5CZ1 A;  4J2A A;  1YTU A;  1T03 A;  1HNV A;  1BGX T;  1WSI A;  1I39 A;  4DLG A;  3QIP A;  3PX6 A;  1IH7 A;  1U04 A;  4OLB A;  4KRE A;  4FLX A;  4R5P A;  1C1A A;  3QEX A;  4F8R A;  3U3Y A;  3LP2 A;  3KLG A;  3M8P A;  4KPY A;  3K5L A;  1HYS A;  1KVC A;  4DFK A;  4KV8 A;  4E7I A;  5J2M A;  2BDP A;  4FJ7 A;  3HK2 A;  1S5J A;  5HRR A;  3SUO A;  2XY8 A;  4NCG A;  3NF9 A;  4EP4 A;  2YNG A;  3OVN A;  4CER A;  2Z1G A;  3CFP A;  4FK2 A;  2RF2 A;  3OYH A;  3RTV A;  4JS5 A;  4CF2 A;  2KZM A;  4J2E A;  1BHL A;  4FLW A;  1BIZ A;  5HLF A;  1RBV A;  3VQ8 A;  2HW3 A;  3AA5 X;  3OY9 A;  3DLH A;  1SL1 A;  1ZBU A;  1NK8 A;  3VQQ A;  3PX4 A;  2W42 A;  2QKK A;  2O4G A;  4CGJ A;  4GVM A;  4CIF A;  4B9V A;  4I2P A;  2X6N A;  4JLH A;  2YNH A;  3SYZ A;  3QEI A;  1YTA A;  3HXM A;  3KD5 E;  1WAJ A;  4I7F A;  4CEB A;  4CF1 A;  4FK4 A;  3F9K A;  4H8K A;  2G8W A;  3OYD A;  5DK5 A;  3V9U A;  4DTU A;  3V81 A;  5CYQ A;  3ZT2 A;  2RPI A;  3DRP A;  1XHX A;  3SZ2 A;  1NK7 A;  2X74 A;  2ETJ A;  4GMJ B;  3HT3 A;  2B4J A;  4MQ3 A;  3OYG A;  2FBY A;  1T8E A;  3AVC A;  2WON A;  1FXX A;  1SKS A;  1NKE A;  4E7J A;  1C1C A;  4CJK A;  3CYM A;  4F2S A;  3OYC A;  3AVK A;  4YFU A;  3QNN A;  3HP9 A;  2ITG A;  5CY4 A;  4W5O A;  1EET A;  4CEF A;  4CGI A;  4BE1 A;  4NYF A;  1KVB A;  1D5A A;  4MFB A;  4CE9 A;  2XRI A;  5CYM A;  4N47 A;  1L3T A;  1LV5 A;  4QOZ B;  3KLF A;  1HPZ A;  4LSL A;  1L5U A;  2HVI A;  3VQ5 A;  3MXI A;  3C94 A;  1VRU A;  2XY5 A;  1J54 A;  3MED A;  4KTQ A;  4N76 A;  3B6P A;  1BCM A;  1HQU A;  4KHS A;  3VQ7 A;  2VG7 A;  1QTM A;  3ZSX A;  2G8K A;  3DLB A;  1RT6 A;  4OKE A;  3QO9 A;  1NOY A;  4L8R B;  1N6Q A;  3OYL A;  2X6S A;  3O3F A;  4FJL A;  1LAV A;  3VQB A;  3LPU A;  2YHB A;  4OVL A;  1ASV A;  1LWF A;  1WAF A;  4WE1 A;  5KGX A;  1TKZ A;  3DI6 A;  4NYN A;  5C24 A;  3QEW A;  4B9U A;  1ZBI A;  4KI6 A; 
#chains in the Genus database with same CATH topology
 5EVZ A;  2VCP A;  4H5V A;  4EZ6 A;  4IEI A;  3HVR A;  1NK6 A;  3WNG A;  3K2P A;  2UXB K;  4A5A A;  2P1J A;  1S9E A;  4PQU A;  2GV9 A;  2D1K A;  1B9D A;  2O8E A;  4F2R A;  3SJH A;  3AO1 A;  4O4G A;  4QS8 A;  3L2V A;  1E4F T;  5JVH L;  1CZB A;  3IRX A;  3AO4 A;  4TSX A;  1LWE A;  4CZI A;  3AO5 A;  1U48 A;  4WFN L;  5HP1 A;  3H1Q A;  3J7Z O;  1NGB A;  5AQN A;  3ZT1 A;  3ZSQ A;  4DR5 K;  1BA1 A;  2HHU A;  1NJY A;  2JLE A;  1GLJ O;  4JHD A;  4AM6 A;  2QXF A;  4DTX A;  4KFB A;  4QAG A;  1F21 A;  3T1H K;  3SCX A;  5B8H A;  2ZGZ A;  1WBB A;  1MU2 A;  3IG1 A;  3OYM A;  4AHS A;  3JSM A;  5I9E B;  4FPB A;  5KQD A;  4HHT A;  3SAH A;  1ZBF A;  3PIP L;  5E84 A;  4CVN E;  3K9K A;  1V4S A;  1YXQ A;  3DAW A;  4LH4 A;  5K14 A;  3HPO A;  4KAZ A;  1QSY A;  1WOQ A;  3LDQ A;  3HPH A;  1VQ4 N;  4FW2 A;  3D2E A;  5CZ2 A;  2O8C A;  4BG9 A;  1RGI A;  2Q36 A;  5IT9 O;  3LM9 A;  4CF0 A;  4ILG B;  2RKI A;  4CJT A;  3HOT A;  4IJA A;  5F0X A;  4YOX A;  2OPQ A;  1FKO A;  3QET A;  1SAZ A;  2GUI A;  4DTJ A;  1WBD A;  2HHV A;  1P8Z A;  5HOO A;  1W9H A;  1X3N A;  3V1Q A;  2HND A;  2OPR A;  3E9L A;  4Z0U A;  3AAQ A;  2GEM A;  3AVM A;  3E1Y A;  5EX5 A;  4CJ4 A;  1CXQ A;  5HBM A;  3U8X A;  3TAN A;  2NUB A;  3R8E A;  2HHX A;  2VG5 A;  1JLG A;  2NRR A;  3MX5 A;  1HYZ A;  2VWB A;  3F5T A;  4IDH A;  3F9M A;  1UWB A;  4A61 A;  4K42 A;  4B9Q A;  3RSE B;  4EZ9 A;  3ZT4 A;  2F8S A;  3O3H A;  2PYL A;  1RFQ A;  2RHK A;  1HQE A;  3CCS N;  4GV6 A;  1NKB A;  4V19 S;  3H3O B;  4NLB A;  2HHW A;  3O6W A;  3QBX A;  1QSS A;  1X9J A;  1C0F A;  2YV0 X;  4G9Z A;  4JKA A;  1DEJ A;  4B3O A;  1RT3 A;  2QKB A;  3D0P A;  4CJU A;  4J2D A;  4CZL A;  3MDQ A;  1YVU A;  1XHZ A;  3V6D A;  2YNF A;  4ILJ A;  3KK1 A;  4JRP A;  3K5O A;  1NK0 A;  3KVG A;  5M1N A;  4Z4E A;  3D2F A;  3UKU B;  2O4I A;  1SQK A;  2KQ2 A;  3WXK A;  4FCY A;  3CCL N;  1XQS C;  2DFF A;  4KRF A;  4PKG A;  4W5Q A;  5AR0 A;  1GLA G;  4JKG B;  4E7K A;  2PZS A;  4BRN A;  3TAQ A;  1X9S A;  2R7Y A;  1WNS A;  2IC3 A;  2F8T A;  1YF5 L;  3V9X A;  5M1P A;  2YHA A;  3PY8 A;  2KZZ A;  3AA4 A;  3E9O A;  4H0V B;  3KIO A;  3GG4 A;  1REV A;  3QB0 A;  4DV2 K;  4NCA A;  1DTT A;  3ZSV A;  3U3G A;  1WN7 A;  3MK6 A;  2CGJ A;  2UUB K;  1JJ2 M;  4M3Z A;  2Y1J A;  3L2W A;  1TKD A;  1KFD A;  3O9R A;  2Z1H A;  4M3W A;  3PSI A;  4BDZ A;  3S3M A;  4CI6 A;  5AQK A;  1U6Z A;  1NGJ A;  1BQM A;  5BRH A;  2E20 A;  3P38 A;  4KHW A;  1N34 K;  3PO5 A;  4CEA A;  1HR0 K;  4CJL A;  3G25 A;  4AQY K;  4FVU A;  3OBY A;  4DTN A;  4HCC A;  2A41 A;  3KLH A;  3A5L C;  3VQ4 A;  3SQ4 A;  4X62 K;  3FZM A;  2A1R A;  2E8A A;  3DLK A;  4JI7 K;  4YDU A;  4FZX C;  4BC4 A;  3D6R A;  2HOE A;  3T1A A;  3P5J A;  4CCH A;  1NJW A;  1Q18 A;  2ZD1 A;  5AQR A;  4LF5 K;  4DV0 K;  3OJS A;  3G71 N;  4FJG A;  1NJI O;  2G8V A;  3GDQ A;  2OPP A;  3DWL A;  5ELZ A;  3DYA A;  3ZX0 A;  1RBR A;  3ITH A;  3PSF A;  4N56 A;  4JI6 K;  3I0S A;  1A5X A;  2P51 A;  2QWQ A;  4DSL A;  5TKY A;  1NK4 A;  4HUE A;  2ZWH A;  4I6M A;  3CMA N;  3ZSO A;  3O5B A;  1RTH A;  1JCG A;  2E4L A;  1HNZ K;  3D7E O;  2AP1 A;  3LAN A;  5EOY A;  4K43 A;  3NFA A;  3I56 N;  4KH5 A;  4CZH A;  4B1V A;  4LH5 A;  3DLR A;  3WNH A;  3NH2 A;  1YUW A;  5AFU A;  3ZX2 A;  2XY6 A;  3LAL A;  4DU3 A;  2XO7 A;  1RBT A;  4FJI A;  4C8K A;  3OYK A;  1QQO A;  4DKW A;  3BEX A;  3DOK A;  3ZCM A;  1HNW K;  3U9Z A;  2IDO A;  3PO4 A;  1YJ9 N;  4CF8 A;  4BDY A;  3ZT0 A;  2PY5 A;  1FK9 A;  4FK0 A;  1HUX A;  2VGM A;  3K5N A;  2P9K B;  1U47 A;  3EYZ A;  2QWP A;  4DF8 A;  3VQP A;  1VQ5 N;  1XC3 A;  3K58 A;  3WXJ A;  4KH4 A;  3HVT A;  3L3U A;  1WLJ A;  1RIL A;  1I3A A;  4CF9 A;  2QWN A;  3JXU A;  3S3N A;  4J2B A;  3NGI A;  4DSI A;  4DFM A;  2HF3 A;  2D0B A;  5KPZ A;  3O1B A;  2XY7 A;  2A40 A;  3VA3 A;  3RRG A;  1L3U A;  3MAQ A;  4AHV A;  3M1F A;  3PV8 A;  1KCF A;  3VTI A;  4CJW A;  1ATN A;  1DKG D;  5JMV A;  1HKC A;  4DS5 A;  4A2A A;  3TR8 A;  4ILH A;  1X3M A;  5AQO A;  4MO4 A;  5IWA K;  4I9L A;  3V1R A;  1BWF O;  1HPM A;  3RWU A;  1NBW A;  3NVM A;  4GY2 B;  4ELU A;  2GX9 A;  1GLE G;  2BE2 A;  1YTU A;  3O9T A;  2V51 B;  4CD1 A;  2FSK A;  4IO8 A;  3VER A;  4FLX A;  2OTJ N;  4F8R A;  3LP2 A;  3KLG A;  4GNI A;  4KV8 A;  3HK2 A;  2XY8 A;  1IBL K;  3NF9 A;  2YNG A;  1V4T A;  2OTL N;  3P31 A;  3CFP A;  2RF2 A;  4CF2 A;  4FLW A;  3ZET A;  1SL1 A;  3UKR B;  1ZBU A;  2HBK A;  3PX4 A;  4LF4 K;  2QKK A;  3WXM B;  1KC8 O;  4CGJ A;  4GVM A;  2YNH A;  3HXM A;  1WAJ A;  4I7F A;  1Q7Y O;  4DV6 K;  4WQ5 C;  3VEV A;  1XHX A;  4MDB A;  3G6E N;  1ZXO A;  1T8E A;  3AVC A;  1Q82 O;  1SKS A;  5AJ3 K;  3CYM A;  3EKS A;  1FW6 A;  1K8K B;  4JI1 K;  1JCE A;  3HP9 A;  2ITG A;  5AQS A;  4W5O A;  4CEF A;  4CGI A;  1VAZ A;  3VEW A;  3B8A X;  4CE9 A;  3FFK B;  1LV5 A;  3KLF A;  1VQ7 N;  1L5U A;  3MXI A;  3DXM B;  1VRU A;  4H5W A;  3WEE B;  3B6P A;  1HQU A;  3ZSX A;  4PHT X;  3QO9 A;  1YJN N;  1J5E K;  1NOY A;  4FJL A;  1LAV A;  2P9S A;  3LPU A;  4OVL A;  4WE1 A;  5KGX A;  4B9U A;  1YHQ N;  1XMO K;  3VF6 A;  2YHY A;  3SJJ A;  3VA0 A;  1Z26 A;  2P9N B;  1SS6 A;  2VGN A;  3OS1 A;  4M3U A;  1IV0 A;  2RN2 A;  2A42 A;  2NRW A;  4BQL A;  3QIO A;  4YNQ A;  3CJA A;  3CC7 N;  3TAR A;  3C95 A;  3BUZ B;  1BO5 O;  2GUP A;  4B3M K;  3NE6 A;  3THY B;  2KKZ A;  1GLD G;  1S1X A;  5DM7 L;  3LM2 A;  1HMV A;  4ID1 A;  2FXU A;  5J1E A;  3ID6 A;  1U49 A;  1VSD A;  4YOY A;  3NDK A;  1JLF A;  3WXI A;  3MXJ A;  3THX A;  1O13 A;  4M63 C;  2O8D B;  4B9T A;  4DTM A;  4B3S K;  1JKH A;  2WFB A;  4CEC A;  4X64 K;  4BRC A;  3LL3 A;  4M3R A;  4E1J A;  3KTQ A;  4DV5 K;  3KD1 E;  3ISN C;  4FZY A;  4HUG A;  3RMA A;  4ISG A;  1QHA A;  1SUQ A;  3QBW A;  2P9L A;  3SPY A;  4E0D A;  4O8K A;  5SZT A;  1EP4 A;  1HX1 A;  2OPS A;  4FWL A;  3CC4 N;  2B6A A;  2EHG A;  5GIO A;  2F96 A;  4H5N A;  2UXD K;  4LC9 B;  3CJ1 A;  4AIL C;  2JGU A;  3VPZ A;  4NXM K;  3RMC A;  2V7Y A;  4ELT A;  2FBV A;  4B9S A;  2E1Z A;  1N32 K;  3SBG A;  3SV3 A;  4BR4 A;  3QLH A;  4CJR A;  1SL2 A;  3VGM A;  4JI5 K;  2FLO A;  2YNI A;  4FJ9 A;  4M7Y A;  4OPA A;  4AHR A;  4JK9 A;  3S9H A;  3C7N A;  4CJ7 A;  5AQW A;  1IKV A;  1QQM A;  1WSJ A;  4BVP A;  2XHB A;  3OS0 A;  4B1U B;  5LY3 A;  4O5B A;  4RG8 A;  2P5G A;  3KKR A;  2E1Y A;  2EX3 A;  4WFB L;  1IG8 A;  3VQE A;  1NJX A;  5TKW A;  4NB4 A;  1NGG A;  1GLC G;  1W2B M;  4XIU A;  2RE2 A;  1KAZ A;  3MEC A;  1BI4 B;  4ZHR A;  1TYQ B;  1N5Y A;  1KLN A;  4FXD A;  3KK2 A;  5C2D A;  1MA9 B;  4BC5 A;  3QEP A;  3PLA A;  1VQ9 N;  5BPN A;  4CJ3 A;  3HL8 A;  3SPZ A;  2AA4 A;  4BGA A;  3CQY A;  3TAE A;  4Y0W A;  3I55 N;  3K9J A;  2NRV A;  1O1W A;  1BIS A;  2W6L A;  1I94 K;  3A5N C;  1Q81 O;  3CI5 A;  1IJJ A;  3EO3 A;  4E19 A;  4JI0 K;  1CLQ A;  1W7A A;  3BDP A;  5FPN A;  2BTF A;  2HVH A;  1GOA A;  3HO1 A;  4JKH A;  1P90 A;  2ZQB A;  3ZX3 A;  1D4X A;  2HST A;  1T44 A;  1Q86 O;  2OCE A;  4KO0 A;  3MN7 A;  4IOX A;  4O5F A;  3C6U A;  3B6O A;  3CIP A;  4B9L A;  4IG3 A;  3T19 A;  1TK0 A;  4A59 A;  4B3R K;  3HTV A;  3KJV A;  2YJF A;  3CPW M;  2B5J A;  3O4Q A;  3BZC A;  4NO7 A;  3QNO A;  4CFA A;  1SKW A;  3THW B;  4CZK A;  3R6M A;  1SZ2 A;  4C8O A;  3DMJ A;  3SMP A;  3KLE A;  5JS2 A;  4JN4 A;  4LY7 A;  4FJ8 A;  4FLV A;  4OPJ A;  5J2Q A;  4BC3 A;  2O8B A;  5CHI A;  4JAX A;  5EXW A;  4FLZ A;  4Z4G A;  4IJN A;  4B8C A;  1U45 A;  4I2Q A;  4WFA L;  2WTU A;  4KBO A;  4I9Q A;  1XNR K;  2HBL A;  4DHY A;  2ASP A;  4DFJ A;  5J2N A;  2W41 A;  1U2V A;  3W3D A;  4CZG A;  2UYT A;  1QQC A;  4O55 A;  2KHO A;  3LP1 A;  4DB3 A;  3ULE B;  3LZI A;  2OZM A;  3L2Q A;  1J5O A;  2DTU A;  4W5R A;  1CXU A;  1KVA A;  4BRA A;  4DWI A;  4DFP A;  1WSF A;  3WNF A;  4DV4 K;  4DTO A;  1SL0 A;  3EL2 A;  3LDN A;  4WQ4 C;  1C0M A;  4BC2 A;  2X78 A;  3H08 A;  3WQU A;  3EE9 A;  2GTD A;  3M8Q A;  5ADX H;  3GOI A;  5GAH P;  5EU7 A;  3ZSR A;  3MWP A;  1NK5 A;  1RCH A;  3EN9 A;  2OZS A;  4CJQ A;  2ZJP L;  5BRF A;  5E26 A;  3L3V A;  1NJZ A;  4RW6 A;  4YOW A;  1W97 L;  1LW2 A;  3AVN A;  4YOR A;  5AZI B;  4H0T B;  5BN8 A;  2NRX A;  1X1P A;  3TAG A;  3H45 C;  3QDK A;  2E6M A;  3SQ0 A;  3U9D A;  4BRM A;  2HNZ A;  3EZ5 A;  5AQL A;  4BDP A;  3HP6 A;  4FM1 A;  5C25 A;  4A57 A;  1C6V A;  3O4N A;  4B8A B;  4CJ5 A;  2NZT A;  4MO5 A;  3CCM N;  3RR7 A;  3RMB A;  4DU1 A;  2HB5 A;  1D9D A;  1XNQ K;  3V9Z A;  4M41 A;  3S41 A;  5C0Y A;  3UKR A;  1DLO A;  3ALY A;  4PKI A;  1CZ9 A;  4HUF A;  2Z1J A;  1G15 A;  4JS4 A;  4M3Y A;  5AZJ B;  4LFB K;  3CG7 A;  4FLY A;  3L2R A;  3FZF A;  4Y1D A;  3AA3 A;  1JLC A;  1YJW N;  3CC2 N;  3WUH A;  3VEY A;  1XC9 A;  3F2K A;  3V9W A;  3AA2 A;  1L3S A;  3L0Q A;  1VQL N;  4LFA K;  4CGD A;  1K8K A;  3I0R A;  4H0O A;  3V1O A;  4E3S A;  1BQN A;  3M8S A;  3TTD A;  4CFC A;  4PA1 A;  1NGE A;  4E7L A;  4BR7 A;  1YAG A;  3M5R A;  1KLM A;  3V4I A;  1XMQ K;  3JAM O;  1TGO A;  3MXM A;  4OLA A;  3FR0 A;  1JLE A;  3SK3 A;  1L3V A;  1J53 A;  1RT7 A;  4MLH A;  4BRD A;  2YHX A;  1RTD A;  2QM1 A;  4JEP A;  3AVA A;  1KRP A;  4EIA A;  2A5X A;  4JKE A;  3AO3 A;  3TTC A;  3VGL A;  5HRP A;  4BRF A;  4GV3 A;  5DMR A;  3MN6 A;  3VN5 A;  4CJV A;  3O3G A;  2PBD A;  2QWM A;  2VWK A;  4OGC A;  4H03 B;  3CF5 L;  4IWV A;  4OO1 J;  5KRS A;  1S3X A;  3KHY A;  4BE2 A;  2LSN A;  3TAM A;  1S1T A;  4OKK A;  2YCH A;  3MMV A;  1KFS A;  3C6H A;  4H4O A;  2ITM A;  3OTO K;  3THY A;  3DXK B;  3HI0 A;  1YI2 N;  1JL1 A;  1Y97 A;  4PL8 A;  1GOC A;  4DQR A;  4KB0 A;  5M1O A;  3SUN A;  3LAM A;  5AQJ A;  3AV9 A;  3SV4 A;  3O9Q A;  4PKH A;  5AQY A;  2AJQ A;  4FWM A;  2YKM A;  4CBU A;  4XH4 A;  4J2A A;  1T03 A;  1HNV A;  1QZ5 A;  2F7T A;  3FZK A;  1I39 A;  1J6Z A;  1IH7 A;  1U04 A;  2W40 A;  4R5P A;  2CH5 A;  3QEX A;  3T1Y K;  4FJ7 A;  1VHX A;  5HRR A;  4NCG A;  3IMX A;  3KZB A;  3A0I X;  3LDP A;  1OH5 A;  2ZGY A;  3RTV A;  4JI2 K;  4FSV A;  1RBV A;  2HW3 A;  3AA5 X;  3OY9 A;  2EWS A;  3ZEU B;  3VQQ A;  3CJB A;  2NLX A;  2O4G A;  5C12 A;  4B9V A;  3KD5 E;  3SYZ A;  1YTA A;  3MN9 A;  4FK4 A;  3F9K A;  4H8K A;  4JK8 A;  3V9U A;  4DTU A;  5CYQ A;  3ZT2 A;  1NK7 A;  5DM6 L;  2ETJ A;  2P9P B;  3SBT A;  2B4J A;  5F1X A;  3H6E A;  3O9S A;  1H1V A;  2WON A;  1NKE A;  1EQY A;  4IEE A;  3IKM A;  4YFU A;  3QNN A;  4AF1 A;  1VQ8 N;  4NYF A;  4OPH A;  1S72 N;  2KLA A;  3J80 O;  4FWS A;  3SAG A;  1L3T A;  3WQT A;  4ISF A;  1HPZ A;  2HVI A;  3O80 A;  5BN9 A;  1BUP A;  5HL7 L;  4N76 A;  3MED A;  3TTF A;  3JS6 A;  3LDO A;  5JIC A;  4DV3 K;  2VG7 A;  1QTM A;  2G8K A;  3DLB A;  1RT6 A;  3A5M C;  2X6S A;  5M1Q A;  3O3F A;  4B1Y B;  4DQ8 A;  1LWF A;  5EY4 A;  1TKZ A;  3DI6 A;  3QEW A;  4HTL A;  3LZJ A;  4X65 K;  4FW1 A;  4BWM A;  4CHQ A;  4DF4 A;  1NU0 A;  3FFI A;  3CM6 A;  3EEQ A;  2KTQ A;  3SQ1 A;  5JS1 A;  3CER A;  1T7P A;  2CGL A;  3O9U A;  3CCQ N;  5GAE P;  3WXL A;  3HZ6 A;  3H3N O;  5C2F A;  3HPG A;  1LOT B;  4DSF A;  2E5L K;  3T7Z A;  1HYV A;  4QS9 A;  1D9F A;  3NBP A;  5C42 A;  3VF2 A;  4JHD B;  4FM0 A;  1HLU A;  1IO2 A;  1WSE A;  1VQK N;  4FJ5 A;  4CHY A;  1NG9 A;  5E41 A;  4CGH A;  4DR6 K;  1QHT A;  1VQO N;  3OYN A;  2I7N A;  3MCA B;  4N5S A;  3DM2 A;  3OBW A;  4IZ9 A;  4AHU A;  3TSU A;  2D0A A;  3DOL A;  3MCP A;  3RVC A;  4FJH A;  4M3T A;  2OA8 A;  1KXP A;  5JLF A;  1OVQ A;  3NMU A;  1IBM K;  4CHP A;  3NF6 A;  2E2N A;  3D2E B;  3DLE A;  2VWJ A;  2OYQ A;  2IOC A;  3CCU N;  3KKS A;  4BRI A;  4CK2 A;  2O8C B;  4LF6 K;  5KI6 A;  3JYT A;  3WT0 A;  1VSK A;  1WSG A;  4BRH A;  4B08 A;  4YY3 K;  3OYJ A;  1GLB G;  3KLI A;  3OJU A;  1XUP O;  3NCI A;  4EP5 A;  4B1W B;  4FM2 A;  1RT1 A;  2HF4 A;  4IKF A;  3FE1 A;  1TVR A;  3E66 A;  4CFB A;  4DR2 K;  2YX6 A;  4IOA L;  5LL6 Z;  3FZH A;  4RCH A;  4CJE A;  2I7P A;  2G8U A;  3TI0 A;  1FJG K;  2IVO A;  1TKX A;  3U6F A;  3BF3 A;  4K0K K;  4H5T A;  3OYI A;  5JLH A;  4B9N A;  4UY8 O;  2V52 B;  4PUO A;  4KHQ A;  1HKG A;  3TAB A;  3RMD A;  2D5R A;  4JRQ A;  4BAC A;  1ZC6 A;  4C8M A;  4DQI A;  1S9G A;  2ASM A;  3HM9 A;  3C6T A;  1VSL A;  2HNY A;  4FOI A;  2P5O A;  3CJ7 A;  3UE5 A;  4UQG A;  2GEL A;  1TL3 A;  4F3T A;  1S1W A;  4FWK A;  4JV5 K;  4PWD A;  1C1B A;  1JL2 A;  3CQ8 A;  5FPM A;  1RDW X;  1ASU A;  1B9F A;  3KWG A;  4DQQ A;  3AVH A;  4DUZ K;  4EHU A;  4F3O A;  4H0P A;  4ID5 A;  3RSE A;  4DQP A;  1BL3 A;  1S1U A;  3VQ9 A;  4CGG A;  4BR0 A;  4CIE A;  4DLE A;  5AQP A;  1IKX A;  2NRZ A;  3DLL L;  3NF8 A;  1RT5 A;  4AM7 A;  4C8L A;  3NVK A;  1M1K O;  1ZYQ A;  1T05 A;  3QFP A;  3CJC A;  4M45 A;  3VEN A;  4M42 A;  5FDL A;  3OYA A;  4FWR A;  4GKJ K;  3OYB A;  5FPE A;  1BIU A;  3AVF A;  3C6A A;  4JKB A;  3PX0 A;  3G4S N;  3L4I A;  4FWO A;  2KFN A;  2J4R A;  4FJK A;  1VQ6 N;  2H3G X;  3L2U A;  2A3Z A;  1HNI A;  2QXL A;  2ZJR L;  5GAG P;  3T3F A;  2P9U B;  3AVG A;  4DR4 K;  4C1N K;  3EY1 A;  4WCE L;  5SWM A;  3UKU A;  2D0O A;  3SMS A;  3V9S A;  3DLG A;  2ZF5 O;  3LPT A;  4DTP A;  4LSN A;  5HRO A;  4LF7 K;  1D8Y A;  4DG1 A;  3BGR A;  2GWJ A;  2ATQ A;  2IAJ A;  1JXB A;  3OYE A;  4JKG A;  4K8Z A;  3SAF A;  3E01 A;  3CPE A;  2YI1 A;  3NAE A;  2E2O A;  4DMN A;  3RR8 A;  1E4G T;  3J7Y P;  3M3Z A;  1S1V A;  5FRN A;  4ZTF A;  1MDU B;  1S6Q A;  4E89 A;  1RTI A;  3G0Z A;  5KRT A;  4JKF A;  4KTZ A;  3GL1 A;  5GIP A;  1QS4 A;  3CCR N;  3AVJ A;  1LCU A;  1T3V A;  3LWL A;  1YT3 A;  3OYF A;  1RDD A;  3IAY A;  4DR3 K;  4B9M A;  4CD3 A;  1KD1 O;  3M6G A;  5BR9 A;  1TKT A;  2VG6 A;  2DFH A;  4HCB A;  5BR8 K;  4J8F A;  4OGE A;  1ATR A;  4IXC A;  2QWR A;  1HJO A;  3NF7 A;  3R1X A;  1ASW A;  5HRS A;  5BRD A;  2F9W A;  4MLE A;  3TAF A;  1R0A A;  1X9M A;  3VOV A;  4H4M A;  2FF3 B;  4EFH A;  2YKN A;  5HRN A;  5I3U A;  1E3M A;  3AO2 A;  5AQU A;  5I42 A;  3K57 A;  1K8A O;  5FRM A;  2JWK A;  1UOC A;  1X9W A;  1RBU A;  3WNE A;  1A5V A;  4FJX A;  2IGI A;  2ZJQ L;  3CJ9 A;  3ATU A;  1TUY A;  4CJF A;  1ESV A;  1RBS A;  3H1V X;  4JI4 K;  5BPL A;  5FLX O;  5LMU K;  4F9O A;  1NGI A;  4FYD A;  1JLB A;  2IVN A;  5BRE A;  5GAD P;  4CHO A;  4OPK A;  3P1G A;  3N4Q A;  3ZLJ A;  3DRR A;  3O4W A;  4DTS A;  1KSP A;  2JWL A;  4QCL A;  4ZTJ A;  2NRH A;  3ULD A;  3O1W A;  2KFZ A;  3FGU A;  2P9K A;  1IG9 A;  5T7B A;  2Z1I A;  1Z6R A;  2E6L A;  4X66 K;  5AQH A;  3OW2 M;  3D45 A;  2F9T A;  1NNE A;  3A2F A;  4HWI A;  5C10 A;  4FJM A;  2VQF K;  4JI8 K;  3SNN A;  4JK7 A;  4YOU A;  2KW4 A;  2UUC K;  2QK9 A;  3SUQ A;  1VSM A;  4IOC L;  2QTD A;  4C8N A;  3AVI A;  3NGZ A;  1TL1 A;  3QML A;  1NMN A;  5M1F A;  2IS3 A;  4KKO A;  4RW8 A;  3LP3 A;  4DS4 A;  4G1Q A;  2G8H A;  4KB1 A;  4N41 A;  4CHN A;  4HVJ A;  4XEI A;  3AGK A;  3H46 O;  4JKC A;  3MN5 A;  2HBJ A;  2CGK A;  5MLC Q;  4C23 A;  3ENH A;  3UB5 A;  3O8M A;  1M90 O;  4NXN K;  3QIP A;  2PFU A;  4K41 A;  4DV1 K;  5AQZ A;  4OLB A;  4KRE A;  3ZET B;  1C1A A;  4LFC K;  4KPY A;  2OAN A;  3K5L A;  1HYS A;  1KVC A;  4DFK A;  2BDP A;  2P9I B;  3LDL A;  1TUU A;  1S5J A;  3A8Y A;  3SUO A;  3ZYY X;  3OVN A;  4WF9 L;  3U4L A;  4RTF D;  2Z1G A;  5A2Q O;  3OYH A;  4JYA K;  3VEO A;  4JS5 A;  4B1Z A;  2KZM A;  1BHL A;  1BIZ A;  4JD2 B;  3DLH A;  4IO9 L;  2A6A A;  1NK8 A;  2W6K A;  3VMF B;  4I2P A;  3HRG A;  3QEI A;  3IDH A;  4CF1 A;  4YOV A;  2G8W A;  4BY9 C;  5DK5 A;  3V81 A;  3CD6 N;  2RPI A;  3DRP A;  3EKU A;  3HBT A;  3OYG A;  4CW7 B;  5LMN K;  2Q97 A;  4A5B A;  1C1C A;  4F2S A;  3OYC A;  2E88 A;  5CY4 A;  1EET A;  1KVB A;  1D5A A;  5BPM A;  4M7X A;  4MFB A;  5CYM A;  4BR2 A;  4N47 A;  4QOZ B;  5ADX A;  4LSL A;  2P9S B;  4DR7 K;  3VGK A;  4CZM A;  4U7B A;  4KTQ A;  2XY5 A;  3J81 O;  1BCM A;  4JKD A;  3VQ7 A;  1EO1 A;  4MDA A;  3CCV N;  4BRP A;  1N6Q A;  3DJC A;  4OX9 K;  2FSJ A;  2HMP A;  2YHB A;  4WYB A;  1ASV A;  1WAF A;  3DXM A;  5AQG A;  4NYN A;  3WEE A;  5C24 A;  2VQE K;  3CCJ N;  1ZBI A;  4R79 A;  1VRT A;  3VQ6 A;  3MEE A;  5LJV A;  3VTH A;  5FPD A;  2WOM A;  1S6P A;  3LAK A;  4W5N A;  1VK0 A;  1NMD A;  4A2B A;  4IG0 A;  4Z4C A;  2CH6 A;  1R59 O;  1A5W A;  3NHG A;  3THV A;  3OHR A;  2IVP A;  2Q0R A;  3CM5 A;  3GE1 A;  3THX B;  4IDK A;  4Z4I A;  1TAQ A;  3VQD A;  2P9N A;  5AQT A;  3NH1 A;  1NGD A;  1TK5 A;  2Q31 A;  2Q1N A;  3NH0 A;  3L8B A;  3TPQ A;  2O8F B;  4NCB A;  5J2P A;  4DSJ A;  2DY4 A;  4BE0 A;  4GW6 A;  2Q3S A;  1QVG M;  1N8R O;  2BH1 A;  1BOT O;  2BAN A;  2P9L B;  2A1S A;  1HKB A;  2D0C A;  2NRT A;  3ASM A;  1RDU A;  3DRS A;  2ZE2 A;  3HJF A;  1N33 K;  4DSE A;  2V7Z A;  1MWM A;  2O8D A;  3TWH A;  2WUS A;  2P9U A;  1K73 O;  3LDS A;  3OA9 A;  1S22 A;  4BRG A;  4FWQ A;  4CEE A;  5AQI A;  3VF4 A;  1NM1 A;  4KTW A;  3FLC O;  3LP0 A;  2YJE A;  3C7N B;  3ENO A;  3PIO L;  2HMI A;  1B92 A;  5CR4 A;  4XH1 A;  3ID8 A;  4Q5V A;  1QQN A;  4CZE A;  3GBT A;  2UU9 K;  5AFU H;  1RT2 A;  4RW9 A;  1U4B A;  4F4K A;  4BRO A;  4CIG A;  3TAP A;  4RWT A;  4L3Q A;  1N36 K;  1XWL A;  3C0B A;  1ATS A;  2GBZ A;  4GVE A;  3CQX A;  1DTQ A;  1C0G A;  4AH9 A;  4CED A;  4O8U A;  4FVM A;  4QS7 A;  4FOE A;  2HHH K;  4H0X B;  3PUF A;  5FRO A;  1BG3 A;  5AQV A;  3W0L A;  3AAR A;  2I5J A;  5LJW A;  1VQN N;  2ZM6 K;  4RW4 A;  3QEV A;  4CK3 A;  4BVO A;  2QWL A;  1T6C A;  4IBN A;  4ELV A;  1OVY A;  1VQP N;  2FC0 A;  3CFR A;  4OKJ A;  1QVF M;  2PYJ A;  5AQM A;  1NOZ A;  3NGY A;  4DQS A;  3P83 D;  3BZK A;  3AGR A;  1BI4 A;  1TYQ A;  3SLC A;  3P39 A;  4E1M A;  4DR1 K;  1JXE A;  1MWK A;  1RT4 A;  4CJP A;  3MWT A;  4HTU A;  4RW7 A;  1VSE A;  4CES A;  1C0T A;  4O0J A;  3ZSW A;  1HRH A;  1RTJ A;  1Q8I A;  3CET A;  4FWN A;  3E9P A;  5D3G A;  2DFE A;  2FBT A;  4ISE A;  1UA0 A;  1Z05 A;  4O44 A;  3LWM A;  2QI2 A;  4H0Y B;  3ZSY A;  2O8E B;  3Q7B A;  2O8B B;  3VEZ A;  4Q0B A;  3K59 A;  1QZ6 A;  3EZW A;  4LD0 A;  4E1N A;  1OH7 A;  4YHH K;  3I8B A;  1NGA A;  5AQX A;  4CHZ A;  3K0S A;  4KHY A;  4FL9 A;  5JVG L;  3F73 A;  1DGK N;  2HHQ A;  3K5M A;  4DCH A;  4YDU C;  4Z4H A;  4LF9 K;  1ZBL A;  3I8D A;  3THW A;  2YHW A;  4AHC A;  1WUA A;  3G10 A;  3SI6 A;  1U2V B;  2WBN A;  3CXC M;  4AHT A;  3EE8 A;  1VSI A;  3L6Q A;  4Z4F A;  2HHT A;  4WQ5 A;  4XH5 A;  1BA0 A;  4FLU A;  1NGH A;  4Z94 A;  1Q9Y A;  3OS2 A;  1GOB A;  1W0H A;  4YOT A;  1EXQ A;  3MEG A;  3UIQ A;  4IFE A;  4BRQ A;  3SUP A;  1KTQ A;  1IKY A;  4KI4 A;  1K6Y A;  3HSC A;  3HST B;  2IIR A;  1JLQ A;  1YIJ N;  1J9A A;  3CHW A;  3ZSZ A;  1QE1 A;  3TU5 A;  3P4I A;  4DU4 A;  5C15 A;  1BDG A;  3ULE A;  3Q7C A;  3VQC A;  1IKW A;  1JLA A;  4U67 L;  3RRH A;  1T6D A;  4CEQ A;  3QES A;  3AVL A;  3SQ2 A;  1KQS M;  4FZZ A;  3HM8 A;  1FKP A;  1LW0 A;  1OKJ A;  4CEZ A;  2DPN A;  2FSN A;  1NLV A;  3A5O C;  1TV6 A;  2E2Q A;  2HBM A;  3AAP A;  3BY5 A;  3TSP A;  3CCE N;  1BCO A;  4BRE A;  3N4P A;  3HYF A;  5AZI A;  4C1N I;  1EKE A;  3M8R A;  4Y1C A;  1NK9 A;  4E7H A;  4FJN A;  1LAW A;  2P9I A;  2PAV A;  3AY9 A;  4FJJ A;  3QFU A;  1VQM N;  4CJS A;  4OJR A;  2G8I A;  1BU6 O;  2GWK A;  4CGF A;  2F4V K;  3BF1 A;  4JD2 A;  4ICL A;  2Y1I A;  3BP8 A;  5CE3 A;  3MX2 A;  1RNH A;  1Q9X A;  2E2P A;  4IFY A;  3KK3 A;  1HJR A;  4CBW A;  2QEX N;  2G8F A;  1VSF A;  4EAH D;  1EX4 A;  3CFO A;  1QSL A;  3ENB A;  4CEO A;  1YVN A;  2Q2R A;  1WSH A;  5AZJ A;  5KTQ A;  4EHT A;  2QW9 A;  1NWK A;  2ASO A;  1ILY A;  3QIC A;  1VSH A;  1SV5 A;  4NLC A;  4LF8 K;  4KHU A;  4FWP A;  4CK1 A;  4W5T A;  1OH8 A;  1UAX A;  4CBX A;  4BR5 A;  1RDA A;  1VSJ A;  1IBK K;  3D2F B;  3IS9 A;  2D4W A;  3ATV A;  2FF6 A;  3ZT3 A;  2HHS A;  4K8X A;  3VQA A;  4BG8 A;  4FO0 A;  4H5R A;  3QIN A;  1TK8 A;  1ITG A;  1SKR A;  2UUA K;  1GLL O;  4GV9 A;  3HOS A;  1EWR A;  2QWO A;  4BRK A;  3VEX A;  4JNE A;  4BR9 A;  4BGB A;  5KQ8 A;  2FBX A;  5KPR A;  4A62 A;  4B1X B;  1NKC A;  1LWC A;  4FPA A;  3L4Q A;  3IUC A;  4M3X A;  1TAU A;  3J7A P;  1HNX K;  1RDB A;  3KWI A;  3IFR A;  3R3L A;  3O08 A;  4PY5 A;  2BGG A;  4KHN A;  1XI1 A;  1WB9 A;  3R9P A;  4FLT A;  1UA1 A;  2O8F A;  5GIN A;  2QA4 N;  1C0U A;  1Z25 A;  5KGW A;  1RDC A;  4IFV A;  4DTR A;  4K25 A;  4BWJ A;  4CZJ A;  4O0I A;  3QER A;  1JCF A;  1NGC A;  3S3O A;  1YIT N;  3AVB A;  1ZBH A;  4PL7 A;  3DXK A;  1KAY A;  4CFD A;  4DSK A;  4KH6 A;  5CZ1 A;  1BGX T;  1WSI A;  4DLG A;  3PX6 A;  3KK7 A;  2NNW A;  3VET A;  3U3Y A;  3M8P A;  4BRL A;  4BQZ A;  5J2M A;  4E7I A;  4KHP K;  4EP4 A;  4CZF A;  5H1S Q;  3TSQ A;  1Y64 A;  4CER A;  4DUY K;  2D0P A;  3I33 A;  4FK2 A;  5M1K A;  4J2E A;  5HLF A;  3VQ8 A;  5AQF A;  1GLF O;  2W42 A;  4DV7 K;  4CIF A;  2X6N A;  4JLH A;  2BUP A;  4CEB A;  1G99 A;  5AQQ A;  4I6M B;  3OYD A;  3SZ2 A;  2X74 A;  4GMJ B;  3HT3 A;  1KAX A;  3ZEU A;  4GKK K;  4MQ3 A;  2FBY A;  4JI3 K;  1FXX A;  4E7J A;  5F2R A;  4CJK A;  2WC9 A;  3AVK A;  1ZBS A;  2P9P A;  1EWQ A;  4BE1 A;  1CZA N;  2XRI A;  3FZL A;  3CME N;  2Q0U A;  4WQ4 A;  3VQ5 A;  1OH6 A;  5KPT A;  3C94 A;  1J54 A;  1K9M O;  4B3T K;  4KHS A;  3VES A;  3C65 A;  4OKE A;  2VYP A;  1DT9 A;  4L8R B;  3OYL A;  3VQB A;  3J8A A;  1NGF A;  3T69 A;  2UXC K;  4KI6 A; 
#chains in the Genus database with same CATH homology
 1VRT A;  3VQ6 A;  3MEE A;  3LZJ A;  3SJJ A;  3VA0 A;  4EZ6 A;  1Z26 A;  2WOM A;  4FW1 A;  4BWM A;  4CHQ A;  3WNG A;  3HVR A;  1S6P A;  3K2P A;  3LAK A;  3OS1 A;  1VK0 A;  2RN2 A;  4DF4 A;  4M3U A;  3FFI A;  4IG0 A;  4Z4C A;  4W5N A;  3CM6 A;  1A5W A;  3QIO A;  3NHG A;  3THV A;  2KTQ A;  4YNQ A;  3SQ1 A;  2P1J A;  5JS1 A;  1S9E A;  1T7P A;  4PQU A;  2GV9 A;  3CM5 A;  1B9D A;  3TAR A;  3C95 A;  4F2R A;  4IDK A;  4Z4I A;  1TAQ A;  3VQD A;  3HPG A;  3NH1 A;  3AO1 A;  4O4G A;  3NE6 A;  1TK5 A;  3L2V A;  4DSF A;  1S1X A;  3NH0 A;  3L8B A;  1HMV A;  4ID1 A;  1HYV A;  5J1E A;  1D9F A;  1CZB A;  5J2P A;  1U49 A;  1VSD A;  4DSJ A;  3IRX A;  4NCB A;  3NBP A;  2DY4 A;  3AO4 A;  3NDK A;  4TSX A;  4GW6 A;  1JLF A;  1LWE A;  2Q3S A;  5C42 A;  4BE0 A;  3MXJ A;  3AO5 A;  1U48 A;  4FM0 A;  5HP1 A;  2BAN A;  1IO2 A;  2A1S A;  1WSE A;  4DTM A;  4B9T A;  2D0C A;  1JKH A;  4FJ5 A;  4CEC A;  3ZT1 A;  4CHY A;  3ASM A;  3ZSQ A;  5E41 A;  4M3R A;  3DRS A;  3KTQ A;  3KD1 E;  4CGH A;  2HHU A;  2ZE2 A;  1QHT A;  1NJY A;  3ISN C;  4FZY A;  2JLE A;  3HJF A;  3OYN A;  4N5S A;  4HUG A;  4DSE A;  3DM2 A;  3RMA A;  2QXF A;  4DTX A;  1SUQ A;  4KFB A;  3TWH A;  3SPY A;  4E0D A;  4AHU A;  4QAG A;  5SZT A;  2D0A A;  1F21 A;  3SCX A;  1EP4 A;  3LDS A;  2OPS A;  3DOL A;  2B6A A;  2EHG A;  2F96 A;  1MU2 A;  3IG1 A;  4FJH A;  4M3T A;  4CEE A;  3OYM A;  4AHS A;  2JGU A;  3JSM A;  4AIL C;  2OA8 A;  4KTW A;  4HHT A;  3LP0 A;  3RMC A;  4CHP A;  4ELT A;  1ZBF A;  2FBV A;  1B92 A;  3NF6 A;  2HMI A;  4B9S A;  3DLE A;  4Q5V A;  2VWJ A;  2IOC A;  2OYQ A;  3KKS A;  4CK2 A;  3SV3 A;  3QLH A;  5KI6 A;  1RT2 A;  4CJR A;  3JYT A;  1SL2 A;  1VSK A;  1WSG A;  2YNI A;  4RW9 A;  1U4B A;  4F4K A;  4FJ9 A;  4B08 A;  4CIG A;  3TAP A;  4AHR A;  3KLI A;  3OYJ A;  3S9H A;  4LH4 A;  3OJU A;  5K14 A;  3HPO A;  3NCI A;  4KAZ A;  4EP5 A;  1QSY A;  1XWL A;  4FM2 A;  1RT1 A;  1IKV A;  3HPH A;  2GBZ A;  4FW2 A;  1WSJ A;  5CZ2 A;  4IKF A;  2XHB A;  1TVR A;  4CFB A;  1DTQ A;  4AH9 A;  4CED A;  4CF0 A;  3OS0 A;  4CJE A;  2RKI A;  4FVM A;  4CJT A;  4O5B A;  4RG8 A;  2P5G A;  3KKR A;  2EX3 A;  3VQE A;  3PUF A;  5FRO A;  2G8U A;  1NJX A;  2OPQ A;  3TI0 A;  1FKO A;  3QET A;  2I5J A;  2GUI A;  1TKX A;  4DTJ A;  4XIU A;  3U6F A;  4RW4 A;  3QEV A;  4CK3 A;  2HHV A;  3MEC A;  1BI4 B;  4IBN A;  4ZHR A;  3OYI A;  4ELV A;  1N5Y A;  1KLN A;  4B9N A;  1W9H A;  2FC0 A;  3V1Q A;  4OKJ A;  3KK2 A;  3CFR A;  4FXD A;  2HND A;  2OPR A;  4Z0U A;  4PUO A;  2PYJ A;  3QEP A;  4KHQ A;  1NOZ A;  4CJ3 A;  3HL8 A;  3NGY A;  3TAB A;  3RMD A;  3SPZ A;  2D5R A;  4DQS A;  4JRQ A;  3P83 D;  4BAC A;  3AVM A;  4DQI A;  4C8M A;  1BI4 A;  1S9G A;  3TAE A;  4CJ4 A;  1CXQ A;  5HBM A;  3C6T A;  3HM9 A;  4E1M A;  2NUB A;  3TAN A;  1JXE A;  1O1W A;  1VSL A;  1RT4 A;  1BIS A;  2HNY A;  2HHX A;  2VG5 A;  4CJP A;  2P5O A;  1JLG A;  4E19 A;  4HTU A;  1HYZ A;  4RW7 A;  1CLQ A;  4UQG A;  3BDP A;  1TL3 A;  1VSE A;  1UWB A;  4F3T A;  4CES A;  1C0T A;  1S1W A;  4PWD A;  4O0J A;  1C1B A;  3ZSW A;  3ZT4 A;  1GOA A;  4EZ9 A;  2F8S A;  3HO1 A;  2HVH A;  3O3H A;  1HRH A;  1RTJ A;  1Q8I A;  2PYL A;  2ZQB A;  1JL2 A;  5D3G A;  3CQ8 A;  2DFE A;  2FBT A;  1ASU A;  1B9F A;  1HQE A;  4DQQ A;  1UA0 A;  3AVH A;  4KO0 A;  4O44 A;  3C6U A;  1NKB A;  3B6O A;  3LWM A;  4B9L A;  4IG3 A;  3T19 A;  3ZSY A;  1TK0 A;  4F3O A;  4ID5 A;  4DQP A;  3KJV A;  1BL3 A;  1S1U A;  2B5J A;  3VQ9 A;  3O4Q A;  4CGG A;  4CIE A;  4DLE A;  3QNO A;  1QSS A;  4Q0B A;  1IKX A;  4CFA A;  3K59 A;  2YV0 X;  4LD0 A;  1SKW A;  4E1N A;  3NF8 A;  4C8O A;  1RT5 A;  3DMJ A;  4CHZ A;  3KLE A;  5JS2 A;  4C8L A;  4KHY A;  1RT3 A;  4B3O A;  1ZYQ A;  4LY7 A;  4CJU A;  3D0P A;  1T05 A;  2QKB A;  4FJ8 A;  4FLV A;  3F73 A;  4J2D A;  4OPJ A;  5J2Q A;  4M45 A;  2HHQ A;  3K5M A;  4M42 A;  4FLZ A;  4Z4H A;  5FDL A;  3OYA A;  1YVU A;  1ZBL A;  3OYB A;  4Z4G A;  3I8D A;  1XHZ A;  1BIU A;  3AVF A;  2YNF A;  4B8C A;  4AHC A;  3V6D A;  3G10 A;  3KK1 A;  3PX0 A;  1U45 A;  3SI6 A;  4I2Q A;  4JRP A;  4AHT A;  1VSI A;  3K5O A;  1NK0 A;  4Z4F A;  2HHT A;  2KFN A;  4I9Q A;  4FLU A;  4Z4E A;  4FJK A;  2O4I A;  2KQ2 A;  3L2U A;  4FCY A;  1HNI A;  1Q9Y A;  3T3F A;  3OS2 A;  4DFJ A;  3AVG A;  5J2N A;  1GOB A;  3EY1 A;  1W0H A;  2DFF A;  4KRF A;  1EXQ A;  3MEG A;  3UIQ A;  4W5Q A;  5SWM A;  1QQC A;  3SUP A;  1KTQ A;  4O55 A;  1IKY A;  4KI4 A;  3LP1 A;  4E7K A;  1K6Y A;  3LZI A;  2OZM A;  3L2Q A;  3V9S A;  3DLG A;  1J5O A;  2PZS A;  2DTU A;  4W5R A;  3TAQ A;  1X9S A;  3LPT A;  1CXU A;  3HST B;  1KVA A;  2R7Y A;  4DWI A;  1JLQ A;  4DTP A;  4LSN A;  1WSF A;  1WNS A;  4DFP A;  2IC3 A;  5HRO A;  2F8T A;  1J9A A;  3WNF A;  1D8Y A;  4DTO A;  4DG1 A;  1SL0 A;  3ZSZ A;  3BGR A;  3V9X A;  1QE1 A;  2ATQ A;  2YHA A;  3PY8 A;  1C0M A;  2X78 A;  2IAJ A;  1JXB A;  3H08 A;  3OYE A;  3M8Q A;  4DU4 A;  4K8Z A;  2KZZ A;  5EU7 A;  3ZSR A;  3AA4 A;  3KIO A;  1REV A;  3VQC A;  1IKW A;  1JLA A;  3E01 A;  3RRH A;  1NK5 A;  1RCH A;  3NAE A;  4NCA A;  1DTT A;  4CEQ A;  3ZSV A;  2OZS A;  3QES A;  4DMN A;  3U3G A;  3AVL A;  1WN7 A;  4CJQ A;  3RR8 A;  3SQ2 A;  4M3Z A;  2Y1J A;  3L2W A;  3L3V A;  1TKD A;  4FZZ A;  1NJZ A;  1FKP A;  1KFD A;  1LW0 A;  4RW6 A;  1LW2 A;  3AVN A;  2Z1H A;  1S1V A;  4CEZ A;  4ZTF A;  4M3W A;  5FRN A;  4BDZ A;  1S6Q A;  4E89 A;  3S3M A;  1RTI A;  2HHW A;  1BQM A;  1X1P A;  3G0Z A;  3TAG A;  5KRT A;  1TV6 A;  4KTZ A;  4KHW A;  1QS4 A;  3PO5 A;  2E6M A;  3SQ0 A;  4CEA A;  1BCO A;  2HNZ A;  3AVJ A;  3HYF A;  3EZ5 A;  4CJL A;  3LWL A;  4DTN A;  1YT3 A;  1EKE A;  3OYF A;  1RDD A;  3M8R A;  4HCC A;  3IAY A;  3KLH A;  4B9M A;  4BDP A;  4Y1C A;  3VQ4 A;  3HP6 A;  3SQ4 A;  2A1R A;  3DLK A;  4FM1 A;  4E7H A;  1TKT A;  1NK9 A;  4FJN A;  1LAW A;  2VG6 A;  4FZX C;  5C25 A;  2DFH A;  4HCB A;  3T1A A;  1C6V A;  3O4N A;  3P5J A;  4B8A B;  4FJJ A;  4CJ5 A;  4CCH A;  1NJW A;  3RR7 A;  4CJS A;  4OJR A;  3RMB A;  2ZD1 A;  4DU1 A;  2G8I A;  4CGF A;  2HB5 A;  1D9D A;  4OGE A;  3OJS A;  4FJG A;  3V9Z A;  4M41 A;  2G8V A;  3NF7 A;  2OPP A;  3DYA A;  4ICL A;  1RBR A;  1ASW A;  5HRS A;  3ITH A;  2Y1I A;  1DLO A;  3ALY A;  4N56 A;  1CZ9 A;  3TAF A;  3I0S A;  4HUF A;  1R0A A;  1A5X A;  2P51 A;  2Z1J A;  1RNH A;  1X9M A;  4DSL A;  1G15 A;  4H4M A;  4JS4 A;  4M3Y A;  1NK4 A;  1Q9X A;  3CG7 A;  4IFY A;  3KK3 A;  4FLY A;  2YKN A;  4HUE A;  1HJR A;  5HRN A;  3L2R A;  5I3U A;  2G8F A;  3ZSO A;  1VSF A;  1RTH A;  2E4L A;  4Y1D A;  3AA3 A;  3AO2 A;  3LAN A;  1JLC A;  1EX4 A;  3CFO A;  1QSL A;  3NFA A;  1XC9 A;  4CEO A;  5I42 A;  3K57 A;  3V9W A;  1WSH A;  3AA2 A;  1UOC A;  1L3S A;  5FRM A;  5KTQ A;  4LH5 A;  1X9W A;  1RBU A;  3DLR A;  4CGD A;  3WNE A;  3I0R A;  1A5V A;  3V1O A;  4E3S A;  1BQN A;  3WNH A;  3NH2 A;  3M8S A;  1VSH A;  1SV5 A;  4FJX A;  2IGI A;  4KHU A;  2XY6 A;  3LAL A;  4CJF A;  4CK1 A;  4W5T A;  4CFC A;  4DU3 A;  2XO7 A;  1RBT A;  4PA1 A;  4FJI A;  4C8K A;  1RBS A;  1UAX A;  3OYK A;  4E7L A;  1RDA A;  1KLM A;  1VSJ A;  3V4I A;  3DOK A;  1TGO A;  3IS9 A;  3MXM A;  4OLA A;  4FYD A;  3ZT3 A;  1JLB A;  2HHS A;  3ZCM A;  4K8X A;  3VQA A;  2IDO A;  3PO4 A;  1JLE A;  1NK6 A;  1L3V A;  1J53 A;  1RT7 A;  4CF8 A;  4CHO A;  3P1G A;  4OPK A;  4BDY A;  3ZT0 A;  2PY5 A;  1FK9 A;  4FK0 A;  1RTD A;  3DRR A;  3K5N A;  3QIN A;  1U47 A;  3EYZ A;  3AVA A;  4DTS A;  1KSP A;  4DF8 A;  3VQP A;  1TK8 A;  1ITG A;  3K58 A;  1KRP A;  1SKR A;  4QCL A;  4ZTJ A;  3HVT A;  3L3U A;  3AO3 A;  1WLJ A;  1RIL A;  1I3A A;  4CF9 A;  3S3N A;  5HRP A;  3ULD A;  4J2B A;  2FBX A;  2KFZ A;  5DMR A;  3NGI A;  4DSI A;  4DFM A;  2D0B A;  4CJV A;  3VN5 A;  1IG9 A;  5T7B A;  3O3G A;  1NKC A;  1LWC A;  2VWK A;  2Z1I A;  2E6L A;  4OGC A;  2XY7 A;  3D45 A;  4M3X A;  1TAU A;  3A2F A;  4FJM A;  3VA3 A;  5KRS A;  3RRG A;  1RDB A;  4BE2 A;  3MAQ A;  1L3U A;  2LSN A;  4AHV A;  3TAM A;  1S1T A;  4OKK A;  3PV8 A;  3SNN A;  1KCF A;  4PY5 A;  1KFS A;  4CJW A;  2BGG A;  2KW4 A;  4H4O A;  4KHN A;  1XI1 A;  2QK9 A;  3SUQ A;  4FLT A;  1UA1 A;  1C0U A;  1VSM A;  1Z25 A;  5KGW A;  4DS5 A;  1RDC A;  3TR8 A;  1JL1 A;  1Y97 A;  4IFV A;  1GOC A;  3AVI A;  4C8N A;  3NGZ A;  4DQR A;  1TL1 A;  4DTR A;  3SUN A;  4KB0 A;  3LAM A;  2IS3 A;  4KKO A;  3AV9 A;  4RW8 A;  3SV4 A;  3LP3 A;  4BWJ A;  4I9L A;  4DS4 A;  4G1Q A;  2G8H A;  4O0I A;  3V1R A;  3QER A;  4KB1 A;  2AJQ A;  4N41 A;  4CHN A;  3RWU A;  4HVJ A;  3S3O A;  3AVB A;  1ZBH A;  2YKM A;  4CFD A;  4ELU A;  4DSK A;  2BE2 A;  5CZ1 A;  4J2A A;  1YTU A;  1T03 A;  1HNV A;  1BGX T;  1WSI A;  1I39 A;  4DLG A;  3QIP A;  3PX6 A;  1IH7 A;  1U04 A;  4OLB A;  4KRE A;  4FLX A;  4R5P A;  1C1A A;  3QEX A;  4F8R A;  3U3Y A;  3LP2 A;  3KLG A;  3M8P A;  4KPY A;  3K5L A;  1HYS A;  1KVC A;  4DFK A;  4KV8 A;  4E7I A;  5J2M A;  2BDP A;  4FJ7 A;  3HK2 A;  1S5J A;  5HRR A;  3SUO A;  2XY8 A;  4NCG A;  3NF9 A;  4EP4 A;  2YNG A;  3OVN A;  4CER A;  2Z1G A;  3CFP A;  4FK2 A;  2RF2 A;  3OYH A;  3RTV A;  4JS5 A;  4CF2 A;  2KZM A;  4J2E A;  1BHL A;  4FLW A;  1BIZ A;  5HLF A;  1RBV A;  3VQ8 A;  2HW3 A;  3AA5 X;  3OY9 A;  3DLH A;  1SL1 A;  1ZBU A;  1NK8 A;  3VQQ A;  3PX4 A;  2W42 A;  2QKK A;  2O4G A;  4CGJ A;  4GVM A;  4CIF A;  4B9V A;  4I2P A;  2X6N A;  4JLH A;  2YNH A;  3SYZ A;  3QEI A;  1YTA A;  3HXM A;  3KD5 E;  1WAJ A;  4I7F A;  4CEB A;  4CF1 A;  4FK4 A;  3F9K A;  4H8K A;  2G8W A;  3OYD A;  5DK5 A;  3V9U A;  4DTU A;  3V81 A;  5CYQ A;  3ZT2 A;  2RPI A;  3DRP A;  1XHX A;  3SZ2 A;  1NK7 A;  2X74 A;  2ETJ A;  4GMJ B;  3HT3 A;  2B4J A;  4MQ3 A;  3OYG A;  2FBY A;  1T8E A;  3AVC A;  2WON A;  1FXX A;  1SKS A;  1NKE A;  4E7J A;  1C1C A;  4CJK A;  3CYM A;  4F2S A;  3OYC A;  3AVK A;  4YFU A;  3QNN A;  3HP9 A;  2ITG A;  5CY4 A;  4W5O A;  1EET A;  4CEF A;  4CGI A;  4BE1 A;  4NYF A;  1KVB A;  1D5A A;  4MFB A;  4CE9 A;  2XRI A;  5CYM A;  4N47 A;  1L3T A;  1LV5 A;  4QOZ B;  3KLF A;  1HPZ A;  4LSL A;  1L5U A;  2HVI A;  3VQ5 A;  3MXI A;  3C94 A;  1VRU A;  2XY5 A;  1J54 A;  3MED A;  4KTQ A;  4N76 A;  3B6P A;  1BCM A;  1HQU A;  4KHS A;  3VQ7 A;  2VG7 A;  1QTM A;  3ZSX A;  2G8K A;  3DLB A;  1RT6 A;  4OKE A;  3QO9 A;  1NOY A;  4L8R B;  1N6Q A;  3OYL A;  2X6S A;  3O3F A;  4FJL A;  1LAV A;  3VQB A;  3LPU A;  2YHB A;  4OVL A;  1ASV A;  1LWF A;  1WAF A;  4WE1 A;  5KGX A;  1TKZ A;  3DI6 A;  4NYN A;  5C24 A;  3QEW A;  4B9U A;  1ZBI A;  4KI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...