4CEOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceoA00
4KB1A 3HP9A 4CHOA 3S3OA 1KVCA 3K5LA 1ASVA 4YNQA 1BL3A 4F3OA 1D8YA 1TAQA 4ZTJA 4HUGA 4LSNA 3SCXA 2ETJA 3KD1E 4ICLA 1B92A 1C0UA 4KV8A 4LH5A 3K58A 4DSIA 1FK9A 3O3FA 1SL2A 3PV8A 4KFBA 4CJEA 2XY7A 3PX4A 4QCLA 2R7YA 2HHWA 3IAYA 3TAEA 4CJWA 4B9SA 1RTJA 4C8LA 1LAVA 2D5RA 1VSHA 4DS4A 3KKSA 1C1AA 3HPGA 4DTMA 3SI6A 1TAUA 2OPQA 4KB0A 4E0DA 1RDDA 4CFDA 4CJKA 3L2QA 2Y1IA 3SQ2A 2QKBA 4AHSA 5KTQA 4E7LA 4DS5A 1DTTA 3V1OA 1VSIA 4AHRA 4OVLA 3ZSXA 3VA0A 3K5OA 4Q5VA 3SZ2A 4DQQA 3K2PA 3SQ0A 3DRRA 3HJFA 1X1PA 1RDCA 3WNEA 1Z26A 3DRSA 1GOCA 4KPYA 4K8XA 3MEDA 5C24A 4CEDA 4CEBA 2F8TA 1LAWA 2OZMA 1WSGA 3TABA 2XY6A 5J2NA 1GOBA 4IFVA 2X6SA 4B9TA 5HLFA 4OKEA 4FJKA 3ISNC 4KI6A 3CQ8A 4JRQA 1Z25A 4O4GA 4OKJA 5HRPA 4CCHA 3EYZA 1D9FA 4HVJA 5FDLA 1LWEA 3AVJA 4CGHA 3V6DA 4B9MA 3NHGA 3DOLA 1KVAA 3DYAA 4LH4A 1QS4A 2PYLA 1WLJA 2KQ2A 4CF0A 3DI6A 3EY1A 5C25A 4HCCA 3LDSA 4LY7A 4HUEA 1NJZA 1KLMA 3RRHA 3RMBA 3PY8A 4E1NA 4I2PA 4L8RB 1W9HA 3CFPA 2PZSA 2KFNA 3RMAA 1FXXA 1BCOA 1JLFA 3VQ4A 3KJVA 1X9SA 4GMJB 1VRUA 5CZ2A 4Q0BA 2OZSA 3KK1A 4Z4CA 3FFIA 3VQPA 2OPPA 4DQPA 4MFBA 1NK7A 4FJ5A 3KLIA 1JLGA 1VSEA 3OJSA 1UWBA 4ZHRA 3HXMA 4FJNA 4M3UA 3M8RA 4DF8A 1MU2A 3K59A 5I3UA 2ITGA 1HMVA 2HHUA 1UA1A 4CEOA 4FCYA 3QINA 1U04A 2VG6A 3AO1A 3AVIA 3DLGA 3NBPA 1SL0A 1L3SA 4CFCA 1UOCA 1NJXA 1WAFA 2F96A 4KHWA 3K5NA 4GVMA 4NYFA 3OYJA 4FYDA 3NH1A 3MXMA 4CEZA 3LALA 4G1QA 4CJQA 3TAFA 3L3UA 4DTXA 1NOYA 4FJJA 4KHYA 2BGGA 4M3TA 3ASMA 2XY5A 1L3UA 3NH0A 2JGUA 4FW2A 3HVRA 4B9LA 3SV3A 4FJ7A 3OYNA 1TKXA 3OYFA 1ZYQA 3HPHA 4IG0A 4HUFA 1YTUA 2RPIA 1DTQA 1SUQA 5EU7A 3O3GA 1LW2A 3OJUA 4CHQA 4BE0A 1BCMA 1G15A 2Z1HA 1C0TA 4H8KA 4KHQA 3I0RA 3VA3A 1HRHA 2YHAA 3DMJA 3HL8A 3CYMA 4OPKA 1BIUA 4CF1A 2YKNA 3NGIA 4B9UA 3CM5A 1HPZA 3DLKA 4FVMA 4AHVA 5J2PA 1HYSA 1A5WA 4DSFA 1XI1A 4UQGA 2X78A 1QE1A 1VSLA 2VWJA 2DTUA 3RMCA 3SV4A 3QIPA 4KHNA 1A5XA 1RT3A 4KREA 2HHTA 1WSIA 2IS3A 4DU3A 1NK5A 3U6FA 1VSDA 3TWHA 4CGIA 1TK0A 4OGCA 3TAMA 4KO0A 3SPZA 1WAJA 1QSLA 1EETA 4OPJA 4E19A 2G8FA 1UAXA 2FBVA 3G0ZA 3ZT1A 4CHYA 4Z0UA 2XY8A 1L3VA 1B9DA 2BANA 5C42A 5JS1A 1HYZA 3NDKA 2HB5A 4OLBA 2G8HA 4CIFA 4DLGA 4CHPA 3IG1A 2DFFA 3TR8A 3ZSWA 4B9VA 2VWKA 4FJ9A 2E6LA 3LZJA 4FZYA 3JSMA 4EP4A 4J2EA 1WN7A 2YKMA 3SQ1A 4E7JA 1D9DA 3V9ZA 1IKXA 1RBTA 1SV5A 3KLHA 4BWJA 3AO2A 4JS4A 3WNHA 1XHZA 1NJWA 4KTWA 3RTVA 1WSFA 4DLEA 1N6QA 3DOKA 4CK1A 2YV0X 4DTNA 1SL1A 3M8QA 3T3FA 3MAQA 3QETA 1JLCA 2FBYA 3VQ5A 2G8VA 1T03A 4AH9A 1VSFA 3LAMA 4E1MA 5KGWA 1BHLA 4Z4IA 1W0HA 3OYAA 2HNZA 2NUBA 3AVHA 4DSEA 1KFSA 2O4IA 3DLEA 2W42A 2B4JA 4OLAA 1J5OA 2DFHA 4OJRA 2EX3A 1B9FA 3L2UA 2P1JA 3ULDA 1C1CA 3D0PA 1RNHA 4H4OA 3HP6A 3MXJA 1NJYA 3MEGA 3PO4A 1BQMA 3I0SA 3VQCA 4FK0A 3M8SA 1D5AA 2I5JA 1JLAA 3NF8A 2OYQA 2KTQA 3HPOA 4CJTA 4DFJA 1S9GA 1S1WA 1ASUA 3AO5A 3CM6A 4Y1DA 4CGDA 1U4BA 3ZT3A 5KI6A 5J2QA 1U47A 4BE1A 1Q9XA 4Z4GA 4F8RA 3AVLA 3F9KA 5J2MA 1KVBA 4E7HA 2Z1GA 3AVFA 2HVIA 1CZBA 1IG9A 4CK3A 4WE1A 3SYZA 1S9EA 1S1UA 4CIEA 4FK4A 1LWCA 1IKWA 3HVTA 1TKTA 3AVBA 1VRTA 2F8SA 3QESA 4RW8A 4NCGA 3OYDA 5HP1A 4KAZA 1T05A 1KRPA 4PY5A 4KKOA 1ZBLA 1RBRA 3OYIA 1Q9YA 1IKVA 4Z4HA 4PA1A 4DQRA 3MXIA 4CIGA 3T1AA 3L2VA 2G8WA 4Z4EA 3NF7A 1RBVA 3OYEA 1CZ9A 1BI4A 3C94A 4CEAA 3V9WA 3AA5X 1N5YA 5CYMA 4HHTA 2G8UA 3S3NA 1Q8IA 5K14A 1NKCA 1RILA 4IBNA 3HSTB 2FBXA 2VG5A 3AVMA 3QEXA 3QEWA 1U45A 1NK4A 4KTZA 4ID1A 4CGJA 2Q3SA 2E6MA 3AVGA 1RBUA 3NAEA 4AHCA 3PX6A 4B9NA 2YNFA 3AVCA 1T7PA 1VSMA 4FJIA 2XHBA 1I3AA 3NE6A 1KSPA 2QK9A 3AO3A 2HNYA 3KTQA 3PX0A 1JXEA 1C6VA 1S6PA 3LP0A 2OPSA 3V1QA 5HROA 3V4IA 4FLUA 3QEVA 2HHQA 1QHTA 3ZT4A 4NYNA 5HRRA 2HHVA 1YT3A 3OYLA 5CYQA 1C1BA 1QQCA 3QNNA 1KLNA 1DLOA 4O55A 3P5JA 3VN5A 1TV6A 4CJ3A 5KRSA 4N56A 1ASWA 3SUNA 1CXQA 1VK0A 3OS0A 1U48A 1RDAA 3LP1A 2AJQA 3U3GA 3AVAA 4DF4A 1NK8A 2DFEA 3AA2A 1NK0A 4QOZB 3AA4A 2ZE2A 4O0IA 3VQ8A 4N47A 4BDZA 4DSKA 2HVHA 1RT4A 1IO2A 2GBZA 4CJVA 3KLGA 3SNNA 1SKWA 4NCAA 5E41A 4CK2A 1QTMA 4CJUA 1F21A 4FJMA 3G10A 3TAQA 1VSJA 2ATQA 4DTPA 2FC0A 1CXUA 2RF2A 2EHGA 2E4LA 1HJRA 3DLRA 3QLHA 3ZSRA 3V9XA 3TI0A 3ZSYA 1A5VA 1SKRA 4IKFA 4M45A 1S1VA 1O1WA 3OVNA 3KK2A 4KHSA 3HM9A 3EZ5A 4C8OA 3CFOA 3LPUA 4O44A 3V9SA 4DU4A 1IH7A 4FXDA 2GV9A 4GW6A 4JS5A 2Y1JA 2YNIA 4CF8A 3KIOA 3L3VA 1HYVA 3VQBA 3RMDA 3IRXA 1WSEA 1ZBFA 3LAKA 5T7BA 3F73A 3OYBA 1REVA 3OS2A 1C0MA 4DSJA 4H4MA 5HRNA 2KW4A 4M3RA 2IOCA 3C6UA 3AVKA 3TAGA 5CY4A 3MEEA 2VG7A 2IAJA 2OPRA 1FKPA 2QXFA 4LSLA 2RN2A 5KRTA 3LPTA 5JS2A 3SUQA 1I39A 3ITHA 2HHSA 2Z1IA 4EZ6A 3ZSQA 4FK2A 3LWMA 1GOAA 3M8PA 4DQIA 4FLWA 4IFYA 1RTIA 4JLHA 4KRFA 4I7FA 4DWIA 3DLHA 1LWFA 3C95A 3NGYA 3HO1A 1SKSA 3NCIA 3LZIA 1RCHA 4E7IA 1YVUA 4W5OA 4CESA 1QSSA 1J54A 1ZBUA 3H08A 2D0CA 1JL2A 1VSKA 1JKHA 2BE2A 1KCFA 4CEFA 4M3ZA 1IKYA 2FBTA 5J1EA 1JLEA 3V9UA 1L5UA 3UIQA 4FLYA 1BIZA 3ZT0A 2JLEA 3AV9A 4N5SA 3OS1A 4HTUA 1LV5A 3WNGA 4RG8A 3B6OA 3KLEA 1EP4A 1TL3A 1ZBHA 2G8IA 4BACA 3HK2A 1K6YA 4XIUA 3MECA 3OYCA 1UA0A 4CHZA 3OYHA 3IS9A 4C8MA 3K57A 4RW7A 4HCBA 4F3TA 1X9WA 3V1RA 2YHBA 4FLTA 4F2SA 3L2WA 4K8ZA 3ZSOA 4KHUA 2Z1JA 3HYFA 3VQ6A 3LP3A 2LSNA 1S5JA 3KLFA 4C8NA 4FLXA 1RT6A 4F2RA 1RTHA 2KZMA 4BDPA 1RBSA 4RW6A 4FJLA 1FKOA 4DTRA 2BDPA 2XO7A 4YFUA 2B5JA 4E7KA 3WNFA 4FJXA 4N41A 5HRSA 4R5PA 4BWMA 1ZBIA 2P51A 2A1SA 2ZQBA 4EP5A 4JRPA 2A1RA 4O5BA 1S6QA 1TKZA 1BISA 1KFDA 4W5QA 1EXQA 1S1TA 1XWLA 2HMIA 1EKEA 4O0JA 3SUPA 4ELVA 3QERA 1TK8A 2D0AA 4CEQA 4DMNA 2QKKA 4NCBA 4DFPA 3T19A 4M3WA 4CERA 3TANA 3CG7A 2HHXA 3RR7A 5DK5A 3VQ9A 1NK9A 3NFAA 3THVA 1NKBA 1YTAA 4W5RA 1NKEA 4CJPA 4ELTA 1CLQA 1WSHA 4FW1A 4M42A 3JYTA 2PYJA 3VQQA 1XC9A 4I2QA 4E3SA 4J2BA 4M3XA 4CFBA 5DMRA 5SWMA 4W5TA 3HT3A 4AHTA 3CFRA 3KKRA 3TAPA 4FJGA 5SZTA 4F4KA 3RR8A 4CJRA 4CECA 3VQEA 2IC3A 4RW9A 4CFAA 3SQ4A 3BGRA 3QEIA 4CHNA 1RT5A 2WONA 1NOZA 1J53A 1XHXA 3U3YA 2P5OA 4B3OA 4PWDA 3NH2A 4B8AB 4CJ4A 4QAGA 3A2FA 4DSLA 4B8CA 4ID5A 4IDKA 4CF9A 3S9HA 2D0BA 4KTQA 1JLBA 3QNOA 3PO5A 5D3GA 4CF2A 4CJ5A 2WOMA 3B6PA 1JLQA 4J2DA 4CE9A 1TKDA 1BI4B 3ZSZA 3OYGA 4N76A 2ZD1A 2KZZA 1BQNA 2X6NA 3LP2A 3K5MA 1TK5A 3OYKA 2G8KA 4CJFA 2OA8A 1TVRA 4AHUA 4CEEA 4FM1A 5I42A 4DTOA 3QO9A 3D45A 4AILC 1J9AA 3O4NA 3PUFA 4OKKA 1KTQA 2O4GA 2HW3A 4CJLA 2IGIA 1TL1A 3VQ7A 1WNSA 1WSJA 3O4QA 3O3HA 3KD5E 3V81A 4FM2A 3NGZA 1RT2A 3P83D 4M41A 2XRIA 4FZZA 4DQSA 4DTJA 2YNGA 3ZCMA 3QEPA 3OY9A 2PY5A 4DTSA 4FJHA 1HQEA 4ELUA 4IG3A 3SJJA 5FRNA 4DG1A 1JL1A 1R0AA 1HQUA 3L8BA 1L3TA 3DRPA 4C8KA 4RW4A 4ZTFA 3QIOA 1BGXT 4TSXA 4PQUA 3NF9A 1HNVA 1ITGA 4BDYA 3ZT2A 4I9LA 2HNDA 4OGEA 1U49A 5KGXA 3SUOA 1LW0A 1Y97A 3AO4A 2KFZA 4CGGA 2RKIA 4E89A 3ZSVA 3L2RA 3S3MA 4MQ3A 4BE2A 3KK3A 4PUOA 1RTDA 4FLVA 2DY4A 3OYMA 1NK6A 4M3YA 4B08A 2IDOA 3LWLA 4W5NA 4FM0A 1EX4A 3VQDA 3TARA 1QSYA 4Y1CA 3AVNA 4FLZA 3RRGA 1JXBA 1RT1A 1X9MA 4I9QA 1RT7A 3SPYA 4FZXC 1S1XA 4Z4FA 4DFMA 3DM2A 1HNIA 1TGOA 3P1GA 1RDBA 3NF6A 3BDPA 3E01A 4J2AA 4FJ8A 2YNHA 2B6AA 3I8DA 4DTUA 3LANA 4EZ9A 4KI4A 5FRMA 3ALYA 4DU1A 5CZ1A 4CGFA 2GUIA 3DLBA 1T8EA 4CJSA 4LD0A 3C6TA 3VQAA 3RWUA 3AA3A 5FROA 2X74A 4DFKA 2P5GA 5HBMA
chains in the Genus database with same CATH superfamily
1NMNA 3ZX3A 4CHOA 4B3MK 4K42A 4M7XA 1TAQA 3R1XA 1Q86O 4B1UB 1C0UA 2HMPA 4DSIA 3CCEN 3UKRA 5C12A 3PV8A 4KFBA 3M5RA 3SK3A 2R7YA 2HHWA 3IAYA 1WBDA 4C8LA 2D5RA 4DS4A 2GTDA 3O9TA 4DTMA 4E0DA 4CFDA 4CJKA 3L2QA 3CJ1A 2Y1IA 3SQ2A 4E7LA 2W41A 4LF5K 4BQLA 4CZJA 3UKUB 3SZ2A 4Q5VA 3HJFA 4FWPA 3CJCA 4K8XA 2F8TA 3TABA 4B9TA 2X6SA 3SBGA 3ISNC 3RSEB 5AQKA 3CQ8A 4JRQA 4OKJA 5HRPA 3THYB 5A2QO 1LCUA 4CGHA 4B9MA 3DOLA 3ID6A 1WLJA 4HCCA 3LDSA 4X62K 4HUEA 2ASPA 3RRHA 4EIAA 3RMBA 4BR4A 1W9HA 4B9QA 3RMAA 1JLFA 1BCOA 1E4FT 4G9ZA 1HX1A 4DR3K 3KK1A 4Z4CA 3FFIA 4H0PA 4MFBA 1NK7A 4FJ5A 1VSEA 2HOEA 1UWBA 3CETA 3T69A 4ZHRA 4MO4A 5AQWA 1HMVA 1SL0A 4BREA 3NBPA 2F96A 5AQUA 3OTOK 3CMAN 4NYFA 2VGMA 4CEZA 4KHYA 1NOYA 2BGGA 3SAFA 2XY5A 4B9LA 3I33A 3SV3A 4FJ7A 5BPNA 3BP8A 1ZC6A 3HPHA 4IG0A 2HF3A 2QXLA 4HUFA 1YTUA 1SUQA 3H6EA 3OJUA 3O9UA 1BCMA 3DMJA 2YHAA 4R79A 3HL8A 4CF1A 3LDQA 3NGIA 4YDUA 3CM5A 5C10A 5J2PA 3TTFA 4DSFA 4A2BA 1VSLA 3SV4A 4CVNE 2QWLA 2HHTA 4CGIA 3O9SA 1EWQA 3VEWA 1EETA 3WXIA 2E1ZA 1UAXA 3L4QA 4CHYA 4Z0UA 2UXBK 4OPHA 4CIFA 3GOIA 4B9VA 2VWKA 2E6LA 3QB0A 1K9MO 1J5EK 3V9ZA 1RBTA 3AO2A 1BG3A 1XHZA 4JYAK 4GV3A 4DLEA 2F9WA 4CK1A 4CBUA 2YV0X 4LF6K 3QETA 3VF2A 5AQTA 3VQ5A 4NLCA 3ENHA 3LAMA 1BO5O 4E1MA 3J7YP 1BHLA 2QEXN 3OYAA 2NUBA 4JHDB 5EVZA 4OJRA 3VETA 2EX3A 3BF1A 5FPDA 3CJ7A 3MXJA 3PO4A 4IEIA 3NVMA 3CPEA 4FK0A 1IBLK 3M8SA 1CZAN 4DR6K 2QW9A 2P9LA 3CM6A 2P9SB 4Y1DA 3JXUA 5KI6A 1Q9XA 4BC4A 1NGFA 4F8RA 3F9KA 4JAXA 2Z1GA 3CC4N 4KBOA 5H1SQ 4QS9A 4WE1A 1LWCA 3AVBA 5HP1A 4NCGA 4PY5A 4WF9L 1GLCG 3FZFA 1Q9YA 5C2DA 4PA1A 4IOXA 4QS7A 3T1AA 3G6EN 4ISFA 1NMDA 1RBVA 3V9WA 3AA5X 3SMSA 1J6ZA 1SQKA 1W7AA 2YJFA 1M90O 5JICA 1NK4A 4JI0K 2Q3SA 2E6MA 2YNFA 2E2OA 4AF1A 4C23A 3J7AP 4MDAA 2QK9A 3FLCO 2HNYA 3KTQA 1JXEA 3V1QA 3QEVA 3THXA 3ZT4A 5IT9O 1JCEA 3OYLA 2HBLA 3BZKA 1C1BA 1QQCA 1DLOA 2GWJA 3O80A 4O55A 1TV6A 2FF3B 1YITN 3J8AA 1ASWA 3SUNA 2NRHA 1U48A 4BR5A 1KC8O 4BR2A 1ATRA 3AVAA 3ATVA 1NK8A 4BDZA 4CZHA 3VQ8A 4JI5K 1RT4A 1IO2A 4CJVA 4PL7A 4GKJK 4NCAA 3TAQA 3J80O 4DTPA 3DLRA 1Y64A 2RF2A 2EHGA 3ZSRA 3V9XA 4BRHA 4C8OA 3CFOA 4JK7A 4O44A 2NLXA 2GV9A 3KWIA 2YNIA 3L3VA 3IRXA 1WSEA 4DR5K 3C6HA 3OYBA 3OS2A 5HRNA 1YAGA 3VEVA 1EQYA 5CY4A 4LSLA 2RN2A 5KRTA 3LPTA 5ADXA 1VQNN 3CPWM 3M8PA 3FZLA 1TYQB 4IFYA 3VEOA 4KRFA 4H03B 3DLHA 4DV3K 3SLCA 4MO5A 2P9KA 4JKAA 4J8FA 4JHDA 1RCHA 4CESA 1ZBUA 4YDUC 2D0CA 3EKUA 1VSKA 2HF4A 4M3ZA 1VAZA 1IKYA 2FBTA 5J1EA 3QFPA 3V9UA 4BRMA 1L5UA 3ZT0A 2W6KA 4QS8A 3OS1A 1LV5A 4PQUA 3B6OA 2G8IA 1EP4A 1NWKA 4IJNA 3HK2A 5EY4A 1UA0A 3MECA 3OYCA 4CHZA 2WBNA 4H0VB 4HCBA 4F3TA 1V4SA 4H5NA 4FLTA 4F2SA 3L2WA 3FZMA 3VQ6A 4C8NA 4HWIA 4F2RA 4RW6A 5F0XA 2E2QA 3WNFA 3PSFA 4IEEA 2FSJA 4BWMA 2P51A 4K41A 2WTUA 1SS6A 4JRPA 4GV6A 3DLLL 3G25A 4A59A 1EXQA 2HMIA 1EKEA 3D2EA 3FE1A 2D0AA 4CEQA 2QKKA 4NCBA 4DFPA 3T19A 4CERA 2E5LK 3CG7A 5DK5A 3THWA 3NFAA 1NK9A 1YTAA 1NKEA 3CCJN 2P9NB 2CH6A 4FW1A 3ZLJA 3MCAB 4E3SA 1OH5A 3ZX2A 5DMRA 4JKCA 3AARA 3CFRA 5GAHP 1KXPA 4CFAA 4CHNA 2WONA 4PWDA 4LC9B 3NH2A 4QAGA 3A2FA 3ENBA 4PHTX 4ID5A 4IDKA 4CZKA 2IVPA 1WBBA 3CCUN 4B1VA 1TKDA 3ZSZA 3T1HK 4K25A 1ZXOA 5FPNA 1TK5A 1IJJA 2YHYA 3QO9A 3D45A 2ZWHA 1NGEA 4OKKA 4H5RA 2IGIA 3VQ7A 3KD5E 3VEZA 3P83D 4CW7B 2XRIA 3AGKA 5AZJB 2PY5A 4JK9A 1HQEA 3E9PA 5LMUK 3A5OC 4BG9A 3SJJA 4ELUA 2HBJA 4DV4K 4E1JA 1ATNA 2GELA 5AQOA 3ZETB 3NF9A 1ITGA 2A40A 3ZT2A 2HNDA 4FOEA 2D0OA 2ZGYA 4CGGA 2RKIA 4E89A 5GAGP 3L2RA 4BE2A 1RTDA 4FLVA 4MDBA 3TARA 1QSYA 3DXMA 4BRPA 2A42A 2QWRA 1RDWX 3SPYA 4FZXC 3HBTA 4RCHA 3O08A 1C0FA 1S72N 4FJ8A 2YNHA 3I8DA 3LANA 4DV5K 5AQYA 4DU1A 4CJSA 4H0YB 3D7EO 1ZBSA 1K8AO 4KB1A 1KVCA 1TUYA 4YNQA 1BL3A 3VF6A 4ZTJA 3KD1E 1NM1A 2CGKA 4ICLA 4BRDA 3LM9A 4BR7A 5AQVA 1DGKN 2XY7A 3PX4A 2NNWA 4XEIA 2VQFK 2FSKA 1LAVA 3KKSA 3HPGA 3SI6A 4KB0A 3VEYA 3MCPA 2HSTA 3FZHA 3AAQA 4AHSA 5KTQA 3EN9A 1DTTA 4IFEA 3G4SN 3OW2M 1VSIA 3A5NC 4OVLA 4PKHA 5HOOA 2P9PB 3PIOL 5GIOA 4WFNL 1GOCA 3F9MA 5C24A 2OZMA 1WSGA 4I6MA 4IFVA 3EEQA 4YOWA 1Z25A 3EYZA 1D9FA 2Q31A 3H3OB 4HVJA 1LWEA 5AQRA 2YJEA 3U9ZA 1YIJN 1QS4A 3M3ZA 2PYLA 2GWKA 2IIRA 3DI6A 1Q81O 5C25A 1NJZA 1KLMA 3PY8A 4L8RB 4I2PA 2PZSA 2HHHK 2V51B 2KFNA 3LDPA 1X9SA 3VQ4A 1VRUA 4Q0BA 2OZSA 4GY2B 1IBMK 4JNEA 3WEEB 3IFRA 3VQPA 2D0PA 4JK8A 2V7ZA 4JD2B 3OJSA 4F9OA 4B1ZA 4DF8A 3Q7CA 3K59A 5I3UA 2ITGA 1UA1A 2QA4N 2F8SA 1UOCA 1NJXA 2D1KA 3MK6A 4FYDA 1VQ4N 3NH1A 3MXMA 2Q2RA 4G1QA 3LL3A 4IO9L 3L3UA 4DTXA 4FJJA 3D6RA 3NH0A 3IDHA 1QQNA 1XNRK 3OYNA 1TKXA 3OYFA 1ZYQA 1VQLN 2RPIA 5AQPA 1H1VA 1G15A 3AAPA 1C0TA 4H8KA 3R9PA 4KHQA 3IKMA 1HRHA 4U7BA 3H45C 3EE8A 3F2KA 3CYMA 4OPKA 5CHIA 3CJAA 4IOCL 3DLKA 4AHVA 4C1NI 1HYSA 1P8ZA 1A5WA 4KHNA 2WUSA 4DQ8A 4KREA 1EWRA 1WSIA 4DU3A 3JS6A 3TAMA 4KO0A 4DV7K 2ZJRL 1YHQN 1R59O 3CHWA 3KVGA 1MWKA 1VHXA 4E19A 2G8FA 2FBVA 3ZT1A 2XY8A 5JS1A 1B9DA 2BANA 1HYZA 4H0XB 2G8HA 4DLGA 4CHPA 3IG1A 3FZKA 4FWRA 4FJ9A 3LZJA 4FZYA 3JSMA 1K8KA 2YKMA 3KLHA 4BWJA 1KAYA 1NJWA 1X3NA 4DR7K 5JLFA 3CIPA 4IO8A 3M8QA 3T3FA 4ILHA 3MAQA 1JLCA 1T03A 4AH9A 4Z4IA 1Z05A 2P9UA 2O4IA 2W42A 2WC9A 3HI0A 2DFHA 3CMEN 5AQMA 2P1JA 2Q1NA 5E84A 1BA1A 1GLEG 1NJYA 4JV5K 3I8BA 1XNQK 5FPMA 2O8FA 3HPOA 4CD1A 1S9GA 1S1WA 3OHRA 1U4BA 2QWPA 5JVGL 1KVBA 4CK3A 1S9EA 4FK4A 3WUHA 4XH1A 1T05A 1KRPA 4DR1K 2UYTA 3CCQN 3OYIA 4DQRA 5M1FA 4LF4K 2EWSA 5AFUA 3B8AX 2P9IB 2D4WA 3C94A 3Q7BA 4JN4A 3JAMO 5K14A 3O5BA 4IBNA 3HSTB 3SJHA 2VG5A 3TSUA 4CGJA 2O8EA 3AVGA 3NAEA 4BGBA 4C1NK 1T7PA 4FJIA 3VF4A 3NE6A 5BRHA 1OVYA 1KSPA 1C6VA 1S6PA 2OPSA 1XUPO 4FLUA 2UUBK 1QHTA 1BU6O 3R3LA 1OKJA 3O1BA 4BROA 5HRRA 1D4XA 3BY5A 5CYQA 4K43A 2I7NA 3P5JA 3VN5A 4CJ3A 1E3MA 5M1NA 2AJQA 5AZIB 1NLVA 2DFEA 1NK0A 3AA4A 4DSKA 2GBZA 3MWPA 4FJMA 3W3DA 1VSJA 5JVHL 3QLHA 2VQEK 3ZSYA 4NB4A 4M45A 1HKBA 4B1WB 3V9SA 3L6QA 5AQSA 5FPEA 1NBWA 2DPNA 3BF3A 2OTJN 4CF8A 3RMDA 3TSPA 3LAKA 4JKHA 3F73A 4DSJA 1GLFO 3C6UA 4IDHA 4CBXA 2IAJA 3QDKA 3SUQA 4EZ6A 2Q0RA 1XQSC 3E9LA 3SAHA 3VGLA 4I7FA 4DWIA 4YOVA 3NGYA 4YOUA 3VGMA 3LZIA 4BC5A 3P4IA 1J54A 5AQFA 4EFHA 1JKHA 4PKGA 4FVUA 2NZTA 1BIZA 2JLEA 3AV9A 3UKUA 4HTUA 4DB3A 4RG8A 1ZBHA 1K6YA 4XIUA 1HLUA 3IS9A 4C8MA 3RSEA 2YHBA 3V1RA 4K8ZA 3THYA 1NNEA 2LSNA 3GDQA 4DTRA 1T44A 5TKWA 2NRVA 5HRSA 5KQDA 3TSQA 4A2AA 2GEMA 2A1SA 1HPMA 4H0OA 4O5BA 4FPBA 3K0SA 1S1TA 4O0JA 3QERA 4FWMA 4YORA 3MN9A 1GLJO 3RR7A 5MLCQ 3THVA 1CLQA 1WSHA 1YI2N 2PYJA 4M3XA 5SWMA 4W5TA 3CF5L 3KKRA 1YUWA 4NXMK 4RWTA 5ADXH 5SZTA 4V19S 4F4KA 3SQ4A 3U3YA 2P5OA 3C0BA 1I94K 4FWNA 2UU9K 5D3GA 4CF2A 1JLQA 1BI4B 1LOTB 2F9TA 4AM6A 3OYGA 4N76A 1BQNA 4BVOA 2F7TA 5AJ3K 3LP2A 3K5MA 2G8KA 4CJFA 1DKGD 5F2RA 3WXKA 3O4WA 4AILC 2FLOA 3AY9A 4K0KK 3PUFA 2QWMA 1WNSA 1WSJA 3O4QA 3V81A 4DQSA 2CGJA 2E1YA 4JKBA 2J4RA 5M1KA 5FRNA 1HQUA 4RW4A 1Q82O 2UXDK 3CQYA 2Q0UA 2ZGZA 1HNVA 4BDYA 4OGEA 1RFQA 3P39A 3SUOA 1LW0A 1Y97A 2KFZA 4LF7K 3ZSVA 4GV9A 3KK3A 4PUOA 2DY4A 1YJNN 4W5NA 1EX4A 1E4GT 3RRGA 1BWFO 4I9QA 4Z4FA 1S3XA 3DM2A 1HNIA 1RDBA 2HBKA 4KI4A 5FRMA 4CGFA 4DR4K 1BDGA 1T8EA 3RWUA 5FROA 4JKGB 3C95A 1RTJA 5KRSA 2O8CB 3HP9A 2QWQA 1MA9B 3S3OA 3ULEB 1ASVA 3K5LA 3OBWA 1D8YA 4HUGA 4WFAL 4LSNA 3SCXA 2VCPA 3CERA 3CCMN 4LH5A 4KH6A 2P9SA 1NGIA 2CGLA 3TAEA 3LM2A 3MN6A 1VSHA 2OPQA 5AQZA 4IJAA 4BRFA 1RDDA 3HOTA 2QTDA 4BRIA 1OH7A 3DJCA 1ATSA 1JJ2M 3VA0A 3K5OA 4DQQA 3K2PA 1WUAA 3DRSA 3MEDA 4CEDA 1OVQA 5GAEP 4DCHA 2XY6A 5HLFA 1Q18A 4KI6A 3SBTA 4CCHA 4O4GA 3GG4A 5FDLA 3AVJA 2Q36A 3V6DA 3DYAA 4BQZA 4LH4A 4M63C 1N34K 2KQ2A 4CF0A 1N36K 3EY1A 2WFBA 4E1NA 1IG8A 4CZLA 3KJVA 1HNXK 4GMJB 4JEPA 4WQ5A 1VQON 3H46O 4DQPA 1U2VB 2NRWA 3HXMA 1MU2A 3PLAA 4FCYA 1U04A 3AO1A 3QICA 1V4TA 1WAFA 3N4QA 3K5NA 3OYJA 3EKSA 3GL1A 3LALA 4B3RK 4M3TA 3ASMA 1L3UA 3U4LA 5BRDA 3C6AA 4FW2A 3HVRA 5M1QA 5E26A 4JI8K 4WYBA 4WQ4A 3LDOA 2KLAA 4A5BA 5M1OA 1OH6A 4CHQA 4BR9A 2ITMA 4BE0A 2Z1HA 1QQMA 3VA3A 1BIUA 4A62A 1ILYA 3A5MC 4FVMA 3O8MA 3S41A 1XI1A 4BRQA 1QE1A 2DTUA 1DEJA 3QBWA 3QIPA 1A5XA 3DAWA 1NK5A 1TYQA 3U6FA 3ENOA 3FFKB 3TWHA 3SPZA 1QSLA 4B3SK 3ZEUB 1NGAA 4FWKA 3F5TA 1X9JA 2O8CA 1L3VA 5FLXO 5C42A 4PKIA 1QQOA 3NDKA 2OTLN 4RTFD 3ULEA 4OLBA 1XC3A 4H0TB 3TR8A 1YJ9N 4J2EA 1WN7A 3MX2A 4Y0WA 1D9DA 1IKXA 4FWQA 2KHOA 2JWLA 3WNHA 3WQUA 3L0QA 1N6QA 4OX9K 3DOKA 4DTNA 1SL1A 1VQMN 4DHYA 1C0GA 1P90A 2YCHA 4U67L 2G8VA 3DXKB 1VSFA 3A5LC 3CJ9A 3WXLA 3AVHA 3DLEA 2A3ZA 2B4JA 4CZEA 3HRGA 1J5OA 2E2NA 4DUZK 2E88A 1B9FA 3L2UA 3ULDA 1RNHA 3H3NO 4H4OA 3HP6A 3MEGA 1BQMA 3I0SA 2I5JA 1JLAA 3SAGA 3C65A 3NF8A 1JCFA 2KTQA 4DFJA 5M1PA 3AO5A 4CGDA 2P9NA 5EOYA 3R8EA 4Z4GA 3AVLA 3IMXA 5J2MA 3AVFA 2UUAK 2HVIA 1BA0A 5CE3A 3MN7A 2FSNA 1IKWA 3HVTA 1TKTA 4YY3K 1U6ZA 4RW8A 3OYDA 3QESA 2ZF5O 4KKOA 2BTFA 4CIGA 3CQXA 4Z4EA 3OBYA 1CZ9A 4CEAA 1YVNA 3FR0A 4HHTA 5BREA 3S3NA 4LFAK 1NGJA 1RILA 3CJBA 2FBXA 4NLBA 4DFKA 2RHKA 3AVMA 5BN9A 1IV0A 3QEWA 1U45A 4GNIA 5AR0A 4XH4A 4B9NA 1RBUA 4AHCA 3AVCA 4ILGB 5C15A 1M1KO 3PX0A 3K9KA 5AZJA 5HROA 5I9EB 3V4IA 2A41A 2HHQA 3I55N 1NGDA 3ZETA 1CXQA 1VK0A 3P31A 2QI2A 4ISEA 4O0IA 4N47A 2HVHA 2QWNA 3SNNA 4WQ5C 1QTMA 1SZ2A 3G10A 2IVNA 2ATQA 4FWSA 1XMQK 2FC0A 2PBDA 3TI0A 4IXCA 1O1WA 3OVNA 3KK2A 1SAZA 3HM9A 5C0YA 1IH7A 4GW6A 5GINA 4JS5A 1W2BM 1HYVA 3N4PA 3HZ6A 4BRAA 3MN5A 4M3RA 1NGHA 3BZCA 2VG7A 2OPRA 4DV1K 3VPZA 2QXFA 3ATUA 5AFUH 5JS2A 1I39A 3ITHA 1HJOA 4JI2K 4FK2A 3LWMA 1GOAA 4DQIA 3KWGA 3CD6N 5CR4A 3VOVA 1RTIA 1T3VA 2OANA 4JLHA 1YXQA 3CI5A 1JCGA 3LDLA 3HO1A 1SKSA 2V7YA 3MDQA 4JKFA 3H08A 1JL2A 4CEFA 3HOSA 1JLEA 2PAVA 4N5SA 2P9PA 2V52B 2RE2A 3M6GA 3KLEA 1GLBG 5AQHA 1VQ9N 4KHPK 3OYHA 3K57A 4RW7A 2A5XA 3ZSOA 3CC7N 3HM8A 3HSCA 1T6DA 1Q7YO 5AQQA 4FLXA 1RT6A 4GVEA 1RTHA 2BH1A 2KZMA 2KKZA 2BDPA 1NJIO 2XO7A 2O8BB 1ZBIA 2ZQBA 4H5TA 1TKZA 1KFDA 2W40A 4W5QA 1XWLA 4ELVA 1NU0A 1VQ5N 1TK8A 4DMNA 3WEEA 3VMFB 4BRKA 3ID8A 3R6MA 3TANA 4JD2A 4BG8A 4DKWA 3VQ9A 3DWLA 2P9LB 4W5RA 4CJPA 4JI7K 3M1FA 4M42A 4MLEA 2ASOA 1XC9A 4I2QA 4EAHD 2NRXA 3HT3A 4AHTA 3TAPA 4FJGA 4HTLA 4OPAA 3RR8A 3O9QA 4CECA 2IC3A 3BGRA 5DM6L 3QEIA 1RT5A 3CCLN 1XHXA 5GIPA 4CJ4A 3NVKA 1JLBA 3QNOA 3PO5A 4OO1J 4CJ5A 2WOMA 1S22A 1RDUA 2H3GX 1BUPA 2X6NA 1HKCA 2AA4A 4FL9A 4B1YB 1TVRA 4CEEA 1J9AA 3O4NA 1KTQA 3EZWA 5BR8K 3O3HA 4CZGA 4BRNA 3LDNA 4DTJA 3ZCMA 3QEPA 4FJHA 3OY9A 5BN8A 3THXB 2OCEA 3FGUA 3EO3A 4O5FA 4C8KA 3EE9A 4IZ9A 4ZTFA 3QIOA 1BGXT 4JI3K 4FWOA 4TSXA 4DV2K 4I9LA 2ZM6K 3AO4A 3VENA 5F1XA 4LF8K 4MQ3A 4B1XB 3OYMA 1NK6A 3U8XA 3LWLA 1QVFM 2Q97A 1VQ8N 3VQDA 3AVNA 2NRZA 3A8YA 3WXMB 1O13A 1KAZA 4DFMA 1TGOA 3P1GA 4DUYK 4JI4K 5GADP 5CZ1A 2GUIA 5JMVA 3J7ZO 3VQAA 3AA3A 2X74A 4F3OA 3CXCM 4BVPA 2ETJA 3BEXA 1B92A 4KV8A 4WCEL 3K58A 1FK9A 3H1VX 4Z94A 3O3FA 1SL2A 4JKEA 4CJEA 4QCLA 3TTCA 4A57A 3J81O 4CJWA 4B9SA 2P9KB 5LY3A 1C1AA 5LJWA 2O8BA 1TAUA 2CH5A 2QKBA 4DS5A 3V1OA 2E2PA 2FF6A 4AHRA 4CI6A 5BRFA 3ZSXA 4WFBL 3SQ0A 1DT9A 1GLAG 3DRRA 1X1PA 3L4IA 3ZYYX 1RDCA 3WNEA 1Z26A 4KPYA 3VGKA 4CEBA 1LAWA 3PIPL 1NGGA 3CC2N 2P9IA 5J2NA 1GOBA 4OKEA 4FJKA 5HL7L 4EHTA 5KPTA 4AQYK 4LFCK 4CZFA 3NHGA 1KVAA 4YHHK 2E8AA 1KAXA 4KH5A 4LY7A 1K73O 3C7NB 3CFPA 4O8KA 1KD1O 1FXXA 3VERA 5CZ2A 3D2EB 3OA9A 3U9DA 4ISGA 4CZMA 3AGRA 2OPPA 5LMNK 3KLIA 1JLGA 3THWB 5KPRA 4M3UA 4FJNA 3M8RA 2HHUA 3CCSN 1WOQA 5AZIA 4CEOA 3QINA 3DLGA 2VG6A 3AVIA 3G71N 1L3SA 3KK7A 4CFCA 4KHWA 4BRGA 4GVMA 3I56N 5LL6Z 4YOTA 4ILJA 2JWKA 4CJQA 3TAFA 4PL8A 2JGUA 5AQJA 1YF5L 1DTQA 5EU7A 2QM1A 3O3GA 1LW2A 3T1YK 1W97L 3I0RA 3PSIA 3TPQA 2VGNA 2IVOA 3VTIA 1FW6A 2YKNA 1X3MA 4B9UA 1HPZA 2NRTA 2VYPA 4UQGA 2X78A 1G99A 2VWJA 4CJ7A 3RMCA 1RT3A 1Z6RA 1VQKN 3GBTA 3VTHA 2IS3A 1NG9A 1VSDA 1TK0A 4OGCA 2GUPA 5AQXA 1WAJA 1MWMA 3E66A 5EXWA 3T7ZA 3O9RA 3WQTA 4CZIA 4OPJA 3CCRN 3W0LA 3G0ZA 2HB5A 2DFFA 3ZSWA 3SMPA 1T6CA 1HNZK 4EP4A 3SQ1A 4B3TK 4E7JA 3DXMB 1SV5A 5DM7L 3A0IX 4JS4A 4KTWA 5BR9A 3RTVA 1WSFA 5TKYA 3IUCA 4BC2A 2FBYA 5KGWA 1W0HA 2HNZA 4DSEA 1KFSA 4M7YA 4BRLA 4OLAA 3E1YA 5B8HA 4BR0A 1C1CA 1VQPN 3D0PA 4FPAA 3TU5A 3NMUA 3VQCA 2AP1A 2F4VK 1D5AA 5BPLA 1QZ5A 4FSVA 2QWOA 2OYQA 4CJTA 1ASUA 1ESVA 1U47A 3ZT3A 5J2QA 1QVGM 2ZJPL 4BE1A 2I7PA 3HTVA 4E7HA 4DV6K 1CZBA 1IG9A 1N33K 3SYZA 4CIEA 1S1UA 1N8RO 3C7NA 5BPMA 1VRTA 1NGBA 1N32K 2FXUA 4KAZA 1ZBLA 1RBRA 1IKVA 4Z4HA 1TUUA 3MXIA 2PFUA 3L2VA 3CCVN 5IWAK 2G8WA 3NF7A 3OYEA 1BI4A 4I6MB 4BRCA 2GX9A 4DV0K 1N5YA 5CYMA 2G8UA 4KH4A 1EO1A 1Q8IA 4JI6K 1NKCA 3KZBA 2UUCK 3QEXA 4KTZA 4ID1A 2ZJQL 3PX6A 1VQ7N 1VSMA 2XHBA 1I3AA 3AO3A 4H5WA 4H5VA 3LP0A 4NYNA 2UXCK 2HHVA 1YT3A 3K9JA 1BOTO 3QNNA 1KLNA 4N56A 3OS0A 1RDAA 3LP1A 3U3GA 4DF4A 1GLDG 3AA2A 4QOZB 4FOIA 2ZE2A 3KLGA 1SKWA 5AQIA 3VESA 3BUZB 4CK2A 5E41A 4CJUA 1F21A 1CXUA 2E4LA 1HJRA 3EL2A 1SKRA 4IKFA 1A5VA 1S1VA 4BGAA 4KHSA 3EZ5A 3LPUA 4X66K 4O8UA 4DU4A 5AQLA 4FXDA 4DR2K 2Y1JA 4BC3A 1HUXA 3KIOA 4JKGA 3VEXA 3VQBA 1ZBFA 5T7BA 4YOYA 1REVA 1C0MA 4H4MA 2KW4A 2IOCA 1IBKK 4GKKK 3AVKA 3O6WA 3TAGA 2VWBA 2YX6A 3MEEA 1FKPA 2HHSA 2Z1IA 3QFUA 2W6LA 3ZSQA 3QBXA 4FO0A 4FLWA 1LWFA 1HR0K 3D2FB 3NCIA 4IOAL 2O8DB 4E7IA 1YVUA 4W5OA 1QSSA 2BE2A 1KCFA 3UIQA 4FLYA 5EX5A 1K8KB 4AM7A 3WNGA 2YI1A 1TL3A 1XMOK 1RGIA 4BACA 3KHYA 1KQSM 4L3QA 1MDUB 4CD3A 4LF9K 4NXNK 1X9WA 4KHUA 3UKRB 4A61A 2Z1JA 3HYFA 3UE5A 3KLFA 3LP3A 1S5JA 1OH8A 5KQ8A 4BDPA 1RBSA 4FJLA 2ASMA 1FKOA 4LFBK 4IWVA 4YFUA 2B5JA 4FWLA 2A6AA 4E7KA 4FJXA 4N41A 4R5PA 2P9UB 1QZ6A 4EP5A 2A1RA 4BY9C 3MMVA 1S6QA 3TTDA 1BISA 2BUPA 3SUPA 3UB5A 4M3WA 1U2VA 2O8FB 5JLHA 3MWTA 2HHXA 5AQNA 1NKBA 4ELTA 4XH5A 4NO7A 3JYTA 3VQQA 4J2BA 4CFBA 4CJRA 3VQEA 4RW9A 3GE1A 1NOZA 1J53A 4YOXA 4B3OA 1VQ6N 1FJGK 4B8AB 4A5AA 4DSLA 4B8CA 4CF9A 4X64K 3S9HA 4KTQA 2D0BA 4MLHA 3WT0A 3MX5A 2HBMA 4CBWA 3B6PA 4J2DA 2NRRA 4CE9A 4JI1K 1GLLO 2ZD1A 2KZZA 5ELZA 3OYKA 2OA8A 3RVCA 5KPZA 4AHUA 5I42A 4FM1A 1HNWK 4DTOA 5LJVA 2O8EB 2O4GA 2HW3A 4CJLA 1TL1A 4FM2A 3NGZA 3O1WA 1RT2A 4UY8O 4M41A 4FZZA 4EHUA 2YNGA 4DTSA 4X65K 4IG3A 1QHAA 4DG1A 1NGCA 1JL1A 1R0AA 3L8BA 1L3TA 3DRPA 1YJWN 5C2FA 3QMLA 3ZEUA 5AQGA 1U49A 5KGXA 2E20A 3S3MA 3H1QA 4M3YA 4B08A 3WXJA 2IDOA 4FM0A 4Y1CA 4FLZA 1JXBA 4WQ4C 1RT1A 1X9MA 1WB9A 2YHXA 1RT7A 1S1XA 3BDPA 3NF6A 2YHWA 3E01A 4J2AA 2B6AA 4DTUA 3D2FA 4EZ9A 4JKDA 3ALYA 3DXKA 1HKGA 3DLBA 2O8DA 4LD0A 3C6TA 3P38A 3ZX0A 3E9OA 2P5GA 5HBMA
chains in the Genus database with same CATH topology
4KB1A 3HP9A 4CHOA 3S3OA 1KVCA 3K5LA 1ASVA 4YNQA 1BL3A 4F3OA 1D8YA 1TAQA 4ZTJA 4HUGA 4LSNA 3SCXA 2ETJA 3KD1E 4ICLA 1B92A 1C0UA 4KV8A 4LH5A 3K58A 4DSIA 1FK9A 3O3FA 1SL2A 3PV8A 4KFBA 4CJEA 2XY7A 3PX4A 4QCLA 2R7YA 2HHWA 3IAYA 3TAEA 4CJWA 4B9SA 1RTJA 4C8LA 1LAVA 2D5RA 1VSHA 4DS4A 3KKSA 1C1AA 3HPGA 4DTMA 3SI6A 1TAUA 2OPQA 4KB0A 4E0DA 1RDDA 4CFDA 4CJKA 3L2QA 2Y1IA 3SQ2A 2QKBA 4AHSA 5KTQA 4E7LA 4DS5A 1DTTA 3V1OA 1VSIA 4AHRA 4OVLA 3ZSXA 3VA0A 3K5OA 4Q5VA 3SZ2A 4DQQA 3K2PA 3SQ0A 3DRRA 3HJFA 1X1PA 1RDCA 3WNEA 1Z26A 3DRSA 1GOCA 4KPYA 4K8XA 3MEDA 5C24A 4CEDA 4CEBA 2F8TA 1LAWA 2OZMA 1WSGA 3TABA 2XY6A 5J2NA 1GOBA 4IFVA 2X6SA 4B9TA 5HLFA 4OKEA 4FJKA 3ISNC 4KI6A 3CQ8A 4JRQA 1Z25A 4O4GA 4OKJA 5HRPA 4CCHA 3EYZA 1D9FA 4HVJA 5FDLA 1LWEA 3AVJA 4CGHA 3V6DA 4B9MA 3NHGA 3DOLA 1KVAA 3DYAA 4LH4A 1QS4A 2PYLA 1WLJA 2KQ2A 4CF0A 3DI6A 3EY1A 5C25A 4HCCA 3LDSA 4LY7A 4HUEA 1NJZA 1KLMA 3RRHA 3RMBA 3PY8A 4E1NA 4I2PA 4L8RB 1W9HA 3CFPA 2PZSA 2KFNA 3RMAA 1FXXA 1BCOA 1JLFA 3VQ4A 3KJVA 1X9SA 4GMJB 1VRUA 5CZ2A 4Q0BA 2OZSA 3KK1A 4Z4CA 3FFIA 3VQPA 2OPPA 4DQPA 4MFBA 1NK7A 4FJ5A 3KLIA 1JLGA 1VSEA 3OJSA 1UWBA 4ZHRA 3HXMA 4FJNA 4M3UA 3M8RA 4DF8A 1MU2A 3K59A 5I3UA 2ITGA 1HMVA 2HHUA 1UA1A 4CEOA 4FCYA 3QINA 1U04A 2VG6A 3AO1A 3AVIA 3DLGA 3NBPA 1SL0A 1L3SA 4CFCA 1UOCA 1NJXA 1WAFA 2F96A 4KHWA 3K5NA 4GVMA 4NYFA 3OYJA 4FYDA 3NH1A 3MXMA 4CEZA 3LALA 4G1QA 4CJQA 3TAFA 3L3UA 4DTXA 1NOYA 4FJJA 4KHYA 2BGGA 4M3TA 3ASMA 2XY5A 1L3UA 3NH0A 2JGUA 4FW2A 3HVRA 4B9LA 3SV3A 4FJ7A 3OYNA 1TKXA 3OYFA 1ZYQA 3HPHA 4IG0A 4HUFA 1YTUA 2RPIA 1DTQA 1SUQA 5EU7A 3O3GA 1LW2A 3OJUA 4CHQA 4BE0A 1BCMA 1G15A 2Z1HA 1C0TA 4H8KA 4KHQA 3I0RA 3VA3A 1HRHA 2YHAA 3DMJA 3HL8A 3CYMA 4OPKA 1BIUA 4CF1A 2YKNA 3NGIA 4B9UA 3CM5A 1HPZA 3DLKA 4FVMA 4AHVA 5J2PA 1HYSA 1A5WA 4DSFA 1XI1A 4UQGA 2X78A 1QE1A 1VSLA 2VWJA 2DTUA 3RMCA 3SV4A 3QIPA 4KHNA 1A5XA 1RT3A 4KREA 2HHTA 1WSIA 2IS3A 4DU3A 1NK5A 3U6FA 1VSDA 3TWHA 4CGIA 1TK0A 4OGCA 3TAMA 4KO0A 3SPZA 1WAJA 1QSLA 1EETA 4OPJA 4E19A 2G8FA 1UAXA 2FBVA 3G0ZA 3ZT1A 4CHYA 4Z0UA 2XY8A 1L3VA 1B9DA 2BANA 5C42A 5JS1A 1HYZA 3NDKA 2HB5A 4OLBA 2G8HA 4CIFA 4DLGA 4CHPA 3IG1A 2DFFA 3TR8A 3ZSWA 4B9VA 2VWKA 4FJ9A 2E6LA 3LZJA 4FZYA 3JSMA 4EP4A 4J2EA 1WN7A 2YKMA 3SQ1A 4E7JA 1D9DA 3V9ZA 1IKXA 1RBTA 1SV5A 3KLHA 4BWJA 3AO2A 4JS4A 3WNHA 1XHZA 1NJWA 4KTWA 3RTVA 1WSFA 4DLEA 1N6QA 3DOKA 4CK1A 2YV0X 4DTNA 1SL1A 3M8QA 3T3FA 3MAQA 3QETA 1JLCA 2FBYA 3VQ5A 2G8VA 1T03A 4AH9A 1VSFA 3LAMA 4E1MA 5KGWA 1BHLA 4Z4IA 1W0HA 3OYAA 2HNZA 2NUBA 3AVHA 4DSEA 1KFSA 2O4IA 3DLEA 2W42A 2B4JA 4OLAA 1J5OA 2DFHA 4OJRA 2EX3A 1B9FA 3L2UA 2P1JA 3ULDA 1C1CA 3D0PA 1RNHA 4H4OA 3HP6A 3MXJA 1NJYA 3MEGA 3PO4A 1BQMA 3I0SA 3VQCA 4FK0A 3M8SA 1D5AA 2I5JA 1JLAA 3NF8A 2OYQA 2KTQA 3HPOA 4CJTA 4DFJA 1S9GA 1S1WA 1ASUA 3AO5A 3CM6A 4Y1DA 4CGDA 1U4BA 3ZT3A 5KI6A 5J2QA 1U47A 4BE1A 1Q9XA 4Z4GA 4F8RA 3AVLA 3F9KA 5J2MA 1KVBA 4E7HA 2Z1GA 3AVFA 2HVIA 1CZBA 1IG9A 4CK3A 4WE1A 3SYZA 1S9EA 1S1UA 4CIEA 4FK4A 1LWCA 1IKWA 3HVTA 1TKTA 3AVBA 1VRTA 2F8SA 3QESA 4RW8A 4NCGA 3OYDA 5HP1A 4KAZA 1T05A 1KRPA 4PY5A 4KKOA 1ZBLA 1RBRA 3OYIA 1Q9YA 1IKVA 4Z4HA 4PA1A 4DQRA 3MXIA 4CIGA 3T1AA 3L2VA 2G8WA 4Z4EA 3NF7A 1RBVA 3OYEA 1CZ9A 1BI4A 3C94A 4CEAA 3V9WA 3AA5X 1N5YA 5CYMA 4HHTA 2G8UA 3S3NA 1Q8IA 5K14A 1NKCA 1RILA 4IBNA 3HSTB 2FBXA 2VG5A 3AVMA 3QEXA 3QEWA 1U45A 1NK4A 4KTZA 4ID1A 4CGJA 2Q3SA 2E6MA 3AVGA 1RBUA 3NAEA 4AHCA 3PX6A 4B9NA 2YNFA 3AVCA 1T7PA 1VSMA 4FJIA 2XHBA 1I3AA 3NE6A 1KSPA 2QK9A 3AO3A 2HNYA 3KTQA 3PX0A 1JXEA 1C6VA 1S6PA 3LP0A 2OPSA 3V1QA 5HROA 3V4IA 4FLUA 3QEVA 2HHQA 1QHTA 3ZT4A 4NYNA 5HRRA 2HHVA 1YT3A 3OYLA 5CYQA 1C1BA 1QQCA 3QNNA 1KLNA 1DLOA 4O55A 3P5JA 3VN5A 1TV6A 4CJ3A 5KRSA 4N56A 1ASWA 3SUNA 1CXQA 1VK0A 3OS0A 1U48A 1RDAA 3LP1A 2AJQA 3U3GA 3AVAA 4DF4A 1NK8A 2DFEA 3AA2A 1NK0A 4QOZB 3AA4A 2ZE2A 4O0IA 3VQ8A 4N47A 4BDZA 4DSKA 2HVHA 1RT4A 1IO2A 2GBZA 4CJVA 3KLGA 3SNNA 1SKWA 4NCAA 5E41A 4CK2A 1QTMA 4CJUA 1F21A 4FJMA 3G10A 3TAQA 1VSJA 2ATQA 4DTPA 2FC0A 1CXUA 2RF2A 2EHGA 2E4LA 1HJRA 3DLRA 3QLHA 3ZSRA 3V9XA 3TI0A 3ZSYA 1A5VA 1SKRA 4IKFA 4M45A 1S1VA 1O1WA 3OVNA 3KK2A 4KHSA 3HM9A 3EZ5A 4C8OA 3CFOA 3LPUA 4O44A 3V9SA 4DU4A 1IH7A 4FXDA 2GV9A 4GW6A 4JS5A 2Y1JA 2YNIA 4CF8A 3KIOA 3L3VA 1HYVA 3VQBA 3RMDA 3IRXA 1WSEA 1ZBFA 3LAKA 5T7BA 3F73A 3OYBA 1REVA 3OS2A 1C0MA 4DSJA 4H4MA 5HRNA 2KW4A 4M3RA 2IOCA 3C6UA 3AVKA 3TAGA 5CY4A 3MEEA 2VG7A 2IAJA 2OPRA 1FKPA 2QXFA 4LSLA 2RN2A 5KRTA 3LPTA 5JS2A 3SUQA 1I39A 3ITHA 2HHSA 2Z1IA 4EZ6A 3ZSQA 4FK2A 3LWMA 1GOAA 3M8PA 4DQIA 4FLWA 4IFYA 1RTIA 4JLHA 4KRFA 4I7FA 4DWIA 3DLHA 1LWFA 3C95A 3NGYA 3HO1A 1SKSA 3NCIA 3LZIA 1RCHA 4E7IA 1YVUA 4W5OA 4CESA 1QSSA 1J54A 1ZBUA 3H08A 2D0CA 1JL2A 1VSKA 1JKHA 2BE2A 1KCFA 4CEFA 4M3ZA 1IKYA 2FBTA 5J1EA 1JLEA 3V9UA 1L5UA 3UIQA 4FLYA 1BIZA 3ZT0A 2JLEA 3AV9A 4N5SA 3OS1A 4HTUA 1LV5A 3WNGA 4RG8A 3B6OA 3KLEA 1EP4A 1TL3A 1ZBHA 2G8IA 4BACA 3HK2A 1K6YA 4XIUA 3MECA 3OYCA 1UA0A 4CHZA 3OYHA 3IS9A 4C8MA 3K57A 4RW7A 4HCBA 4F3TA 1X9WA 3V1RA 2YHBA 4FLTA 4F2SA 3L2WA 4K8ZA 3ZSOA 4KHUA 2Z1JA 3HYFA 3VQ6A 3LP3A 2LSNA 1S5JA 3KLFA 4C8NA 4FLXA 1RT6A 4F2RA 1RTHA 2KZMA 4BDPA 1RBSA 4RW6A 4FJLA 1FKOA 4DTRA 2BDPA 2XO7A 4YFUA 2B5JA 4E7KA 3WNFA 4FJXA 4N41A 5HRSA 4R5PA 4BWMA 1ZBIA 2P51A 2A1SA 2ZQBA 4EP5A 4JRPA 2A1RA 4O5BA 1S6QA 1TKZA 1BISA 1KFDA 4W5QA 1EXQA 1S1TA 1XWLA 2HMIA 1EKEA 4O0JA 3SUPA 4ELVA 3QERA 1TK8A 2D0AA 4CEQA 4DMNA 2QKKA 4NCBA 4DFPA 3T19A 4M3WA 4CERA 3TANA 3CG7A 2HHXA 3RR7A 5DK5A 3VQ9A 1NK9A 3NFAA 3THVA 1NKBA 1YTAA 4W5RA 1NKEA 4CJPA 4ELTA 1CLQA 1WSHA 4FW1A 4M42A 3JYTA 2PYJA 3VQQA 1XC9A 4I2QA 4E3SA 4J2BA 4M3XA 4CFBA 5DMRA 5SWMA 4W5TA 3HT3A 4AHTA 3CFRA 3KKRA 3TAPA 4FJGA 5SZTA 4F4KA 3RR8A 4CJRA 4CECA 3VQEA 2IC3A 4RW9A 4CFAA 3SQ4A 3BGRA 3QEIA 4CHNA 1RT5A 2WONA 1NOZA 1J53A 1XHXA 3U3YA 2P5OA 4B3OA 4PWDA 3NH2A 4B8AB 4CJ4A 4QAGA 3A2FA 4DSLA 4B8CA 4ID5A 4IDKA 4CF9A 3S9HA 2D0BA 4KTQA 1JLBA 3QNOA 3PO5A 5D3GA 4CF2A 4CJ5A 2WOMA 3B6PA 1JLQA 4J2DA 4CE9A 1TKDA 1BI4B 3ZSZA 3OYGA 4N76A 2ZD1A 2KZZA 1BQNA 2X6NA 3LP2A 3K5MA 1TK5A 3OYKA 2G8KA 4CJFA 2OA8A 1TVRA 4AHUA 4CEEA 4FM1A 5I42A 4DTOA 3QO9A 3D45A 4AILC 1J9AA 3O4NA 3PUFA 4OKKA 1KTQA 2O4GA 2HW3A 4CJLA 2IGIA 1TL1A 3VQ7A 1WNSA 1WSJA 3O4QA 3O3HA 3KD5E 3V81A 4FM2A 3NGZA 1RT2A 3P83D 4M41A 2XRIA 4FZZA 4DQSA 4DTJA 2YNGA 3ZCMA 3QEPA 3OY9A 2PY5A 4DTSA 4FJHA 1HQEA 4ELUA 4IG3A 3SJJA 5FRNA 4DG1A 1JL1A 1R0AA 1HQUA 3L8BA 1L3TA 3DRPA 4C8KA 4RW4A 4ZTFA 3QIOA 1BGXT 4TSXA 4PQUA 3NF9A 1HNVA 1ITGA 4BDYA 3ZT2A 4I9LA 2HNDA 4OGEA 1U49A 5KGXA 3SUOA 1LW0A 1Y97A 3AO4A 2KFZA 4CGGA 2RKIA 4E89A 3ZSVA 3L2RA 3S3MA 4MQ3A 4BE2A 3KK3A 4PUOA 1RTDA 4FLVA 2DY4A 3OYMA 1NK6A 4M3YA 4B08A 2IDOA 3LWLA 4W5NA 4FM0A 1EX4A 3VQDA 3TARA 1QSYA 4Y1CA 3AVNA 4FLZA 3RRGA 1JXBA 1RT1A 1X9MA 4I9QA 1RT7A 3SPYA 4FZXC 1S1XA 4Z4FA 4DFMA 3DM2A 1HNIA 1TGOA 3P1GA 1RDBA 3NF6A 3BDPA 3E01A 4J2AA 4FJ8A 2YNHA 2B6AA 3I8DA 4DTUA 3LANA 4EZ9A 4KI4A 5FRMA 3ALYA 4DU1A 5CZ1A 4CGFA 2GUIA 3DLBA 1T8EA 4CJSA 4LD0A 3C6TA 3VQAA 3RWUA 3AA3A 5FROA 2X74A 4DFKA 2P5GA 5HBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KB1 A;  3HP9 A;  4CHO A;  3S3O A;  1KVC A;  3K5L A;  1ASV A;  4YNQ A;  1BL3 A;  4F3O A;  1D8Y A;  1TAQ A;  4ZTJ A;  4HUG A;  4LSN A;  3SCX A;  2ETJ A;  3KD1 E;  4ICL A;  1B92 A;  1C0U A;  4KV8 A;  4LH5 A;  3K58 A;  4DSI A;  1FK9 A;  3O3F A;  1SL2 A;  3PV8 A;  4KFB A;  4CJE A;  2XY7 A;  3PX4 A;  4QCL A;  2R7Y A;  2HHW A;  3IAY A;  3TAE A;  4CJW A;  4B9S A;  1RTJ A;  4C8L A;  1LAV A;  2D5R A;  1VSH A;  4DS4 A;  3KKS A;  1C1A A;  3HPG A;  4DTM A;  3SI6 A;  1TAU A;  2OPQ A;  4KB0 A;  4E0D A;  1RDD A;  4CFD A;  4CJK A;  3L2Q A;  2Y1I A;  3SQ2 A;  2QKB A;  4AHS A;  5KTQ A;  4E7L A;  4DS5 A;  1DTT A;  3V1O A;  1VSI A;  4AHR A;  4OVL A;  3ZSX A;  3VA0 A;  3K5O A;  4Q5V A;  3SZ2 A;  4DQQ A;  3K2P A;  3SQ0 A;  3DRR A;  3HJF A;  1X1P A;  1RDC A;  3WNE A;  1Z26 A;  3DRS A;  1GOC A;  4KPY A;  4K8X A;  3MED A;  5C24 A;  4CED A;  4CEB A;  2F8T A;  1LAW A;  2OZM A;  1WSG A;  3TAB A;  2XY6 A;  5J2N A;  1GOB A;  4IFV A;  2X6S A;  4B9T A;  5HLF A;  4OKE A;  4FJK A;  3ISN C;  4KI6 A;  3CQ8 A;  4JRQ A;  1Z25 A;  4O4G A;  4OKJ A;  5HRP A;  4CCH A;  3EYZ A;  1D9F A;  4HVJ A;  5FDL A;  1LWE A;  3AVJ A;  4CGH A;  3V6D A;  4B9M A;  3NHG A;  3DOL A;  1KVA A;  3DYA A;  4LH4 A;  1QS4 A;  2PYL A;  1WLJ A;  2KQ2 A;  4CF0 A;  3DI6 A;  3EY1 A;  5C25 A;  4HCC A;  3LDS A;  4LY7 A;  4HUE A;  1NJZ A;  1KLM A;  3RRH A;  3RMB A;  3PY8 A;  4E1N A;  4I2P A;  4L8R B;  1W9H A;  3CFP A;  2PZS A;  2KFN A;  3RMA A;  1FXX A;  1BCO A;  1JLF A;  3VQ4 A;  3KJV A;  1X9S A;  4GMJ B;  1VRU A;  5CZ2 A;  4Q0B A;  2OZS A;  3KK1 A;  4Z4C A;  3FFI A;  3VQP A;  2OPP A;  4DQP A;  4MFB A;  1NK7 A;  4FJ5 A;  3KLI A;  1JLG A;  1VSE A;  3OJS A;  1UWB A;  4ZHR A;  3HXM A;  4FJN A;  4M3U A;  3M8R A;  4DF8 A;  1MU2 A;  3K59 A;  5I3U A;  2ITG A;  1HMV A;  2HHU A;  1UA1 A;  4CEO A;  4FCY A;  3QIN A;  1U04 A;  2VG6 A;  3AO1 A;  3AVI A;  3DLG A;  3NBP A;  1SL0 A;  1L3S A;  4CFC A;  1UOC A;  1NJX A;  1WAF A;  2F96 A;  4KHW A;  3K5N A;  4GVM A;  4NYF A;  3OYJ A;  4FYD A;  3NH1 A;  3MXM A;  4CEZ A;  3LAL A;  4G1Q A;  4CJQ A;  3TAF A;  3L3U A;  4DTX A;  1NOY A;  4FJJ A;  4KHY A;  2BGG A;  4M3T A;  3ASM A;  2XY5 A;  1L3U A;  3NH0 A;  2JGU A;  4FW2 A;  3HVR A;  4B9L A;  3SV3 A;  4FJ7 A;  3OYN A;  1TKX A;  3OYF A;  1ZYQ A;  3HPH A;  4IG0 A;  4HUF A;  1YTU A;  2RPI A;  1DTQ A;  1SUQ A;  5EU7 A;  3O3G A;  1LW2 A;  3OJU A;  4CHQ A;  4BE0 A;  1BCM A;  1G15 A;  2Z1H A;  1C0T A;  4H8K A;  4KHQ A;  3I0R A;  3VA3 A;  1HRH A;  2YHA A;  3DMJ A;  3HL8 A;  3CYM A;  4OPK A;  1BIU A;  4CF1 A;  2YKN A;  3NGI A;  4B9U A;  3CM5 A;  1HPZ A;  3DLK A;  4FVM A;  4AHV A;  5J2P A;  1HYS A;  1A5W A;  4DSF A;  1XI1 A;  4UQG A;  2X78 A;  1QE1 A;  1VSL A;  2VWJ A;  2DTU A;  3RMC A;  3SV4 A;  3QIP A;  4KHN A;  1A5X A;  1RT3 A;  4KRE A;  2HHT A;  1WSI A;  2IS3 A;  4DU3 A;  1NK5 A;  3U6F A;  1VSD A;  3TWH A;  4CGI A;  1TK0 A;  4OGC A;  3TAM A;  4KO0 A;  3SPZ A;  1WAJ A;  1QSL A;  1EET A;  4OPJ A;  4E19 A;  2G8F A;  1UAX A;  2FBV A;  3G0Z A;  3ZT1 A;  4CHY A;  4Z0U A;  2XY8 A;  1L3V A;  1B9D A;  2BAN A;  5C42 A;  5JS1 A;  1HYZ A;  3NDK A;  2HB5 A;  4OLB A;  2G8H A;  4CIF A;  4DLG A;  4CHP A;  3IG1 A;  2DFF A;  3TR8 A;  3ZSW A;  4B9V A;  2VWK A;  4FJ9 A;  2E6L A;  3LZJ A;  4FZY A;  3JSM A;  4EP4 A;  4J2E A;  1WN7 A;  2YKM A;  3SQ1 A;  4E7J A;  1D9D A;  3V9Z A;  1IKX A;  1RBT A;  1SV5 A;  3KLH A;  4BWJ A;  3AO2 A;  4JS4 A;  3WNH A;  1XHZ A;  1NJW A;  4KTW A;  3RTV A;  1WSF A;  4DLE A;  1N6Q A;  3DOK A;  4CK1 A;  2YV0 X;  4DTN A;  1SL1 A;  3M8Q A;  3T3F A;  3MAQ A;  3QET A;  1JLC A;  2FBY A;  3VQ5 A;  2G8V A;  1T03 A;  4AH9 A;  1VSF A;  3LAM A;  4E1M A;  5KGW A;  1BHL A;  4Z4I A;  1W0H A;  3OYA A;  2HNZ A;  2NUB A;  3AVH A;  4DSE A;  1KFS A;  2O4I A;  3DLE A;  2W42 A;  2B4J A;  4OLA A;  1J5O A;  2DFH A;  4OJR A;  2EX3 A;  1B9F A;  3L2U A;  2P1J A;  3ULD A;  1C1C A;  3D0P A;  1RNH A;  4H4O A;  3HP6 A;  3MXJ A;  1NJY A;  3MEG A;  3PO4 A;  1BQM A;  3I0S A;  3VQC A;  4FK0 A;  3M8S A;  1D5A A;  2I5J A;  1JLA A;  3NF8 A;  2OYQ A;  2KTQ A;  3HPO A;  4CJT A;  4DFJ A;  1S9G A;  1S1W A;  1ASU A;  3AO5 A;  3CM6 A;  4Y1D A;  4CGD A;  1U4B A;  3ZT3 A;  5KI6 A;  5J2Q A;  1U47 A;  4BE1 A;  1Q9X A;  4Z4G A;  4F8R A;  3AVL A;  3F9K A;  5J2M A;  1KVB A;  4E7H A;  2Z1G A;  3AVF A;  2HVI A;  1CZB A;  1IG9 A;  4CK3 A;  4WE1 A;  3SYZ A;  1S9E A;  1S1U A;  4CIE A;  4FK4 A;  1LWC A;  1IKW A;  3HVT A;  1TKT A;  3AVB A;  1VRT A;  2F8S A;  3QES A;  4RW8 A;  4NCG A;  3OYD A;  5HP1 A;  4KAZ A;  1T05 A;  1KRP A;  4PY5 A;  4KKO A;  1ZBL A;  1RBR A;  3OYI A;  1Q9Y A;  1IKV A;  4Z4H A;  4PA1 A;  4DQR A;  3MXI A;  4CIG A;  3T1A A;  3L2V A;  2G8W A;  4Z4E A;  3NF7 A;  1RBV A;  3OYE A;  1CZ9 A;  1BI4 A;  3C94 A;  4CEA A;  3V9W A;  3AA5 X;  1N5Y A;  5CYM A;  4HHT A;  2G8U A;  3S3N A;  1Q8I A;  5K14 A;  1NKC A;  1RIL A;  4IBN A;  3HST B;  2FBX A;  2VG5 A;  3AVM A;  3QEX A;  3QEW A;  1U45 A;  1NK4 A;  4KTZ A;  4ID1 A;  4CGJ A;  2Q3S A;  2E6M A;  3AVG A;  1RBU A;  3NAE A;  4AHC A;  3PX6 A;  4B9N A;  2YNF A;  3AVC A;  1T7P A;  1VSM A;  4FJI A;  2XHB A;  1I3A A;  3NE6 A;  1KSP A;  2QK9 A;  3AO3 A;  2HNY A;  3KTQ A;  3PX0 A;  1JXE A;  1C6V A;  1S6P A;  3LP0 A;  2OPS A;  3V1Q A;  5HRO A;  3V4I A;  4FLU A;  3QEV A;  2HHQ A;  1QHT A;  3ZT4 A;  4NYN A;  5HRR A;  2HHV A;  1YT3 A;  3OYL A;  5CYQ A;  1C1B A;  1QQC A;  3QNN A;  1KLN A;  1DLO A;  4O55 A;  3P5J A;  3VN5 A;  1TV6 A;  4CJ3 A;  5KRS A;  4N56 A;  1ASW A;  3SUN A;  1CXQ A;  1VK0 A;  3OS0 A;  1U48 A;  1RDA A;  3LP1 A;  2AJQ A;  3U3G A;  3AVA A;  4DF4 A;  1NK8 A;  2DFE A;  3AA2 A;  1NK0 A;  4QOZ B;  3AA4 A;  2ZE2 A;  4O0I A;  3VQ8 A;  4N47 A;  4BDZ A;  4DSK A;  2HVH A;  1RT4 A;  1IO2 A;  2GBZ A;  4CJV A;  3KLG A;  3SNN A;  1SKW A;  4NCA A;  5E41 A;  4CK2 A;  1QTM A;  4CJU A;  1F21 A;  4FJM A;  3G10 A;  3TAQ A;  1VSJ A;  2ATQ A;  4DTP A;  2FC0 A;  1CXU A;  2RF2 A;  2EHG A;  2E4L A;  1HJR A;  3DLR A;  3QLH A;  3ZSR A;  3V9X A;  3TI0 A;  3ZSY A;  1A5V A;  1SKR A;  4IKF A;  4M45 A;  1S1V A;  1O1W A;  3OVN A;  3KK2 A;  4KHS A;  3HM9 A;  3EZ5 A;  4C8O A;  3CFO A;  3LPU A;  4O44 A;  3V9S A;  4DU4 A;  1IH7 A;  4FXD A;  2GV9 A;  4GW6 A;  4JS5 A;  2Y1J A;  2YNI A;  4CF8 A;  3KIO A;  3L3V A;  1HYV A;  3VQB A;  3RMD A;  3IRX A;  1WSE A;  1ZBF A;  3LAK A;  5T7B A;  3F73 A;  3OYB A;  1REV A;  3OS2 A;  1C0M A;  4DSJ A;  4H4M A;  5HRN A;  2KW4 A;  4M3R A;  2IOC A;  3C6U A;  3AVK A;  3TAG A;  5CY4 A;  3MEE A;  2VG7 A;  2IAJ A;  2OPR A;  1FKP A;  2QXF A;  4LSL A;  2RN2 A;  5KRT A;  3LPT A;  5JS2 A;  3SUQ A;  1I39 A;  3ITH A;  2HHS A;  2Z1I A;  4EZ6 A;  3ZSQ A;  4FK2 A;  3LWM A;  1GOA A;  3M8P A;  4DQI A;  4FLW A;  4IFY A;  1RTI A;  4JLH A;  4KRF A;  4I7F A;  4DWI A;  3DLH A;  1LWF A;  3C95 A;  3NGY A;  3HO1 A;  1SKS A;  3NCI A;  3LZI A;  1RCH A;  4E7I A;  1YVU A;  4W5O A;  4CES A;  1QSS A;  1J54 A;  1ZBU A;  3H08 A;  2D0C A;  1JL2 A;  1VSK A;  1JKH A;  2BE2 A;  1KCF A;  4CEF A;  4M3Z A;  1IKY A;  2FBT A;  5J1E A;  1JLE A;  3V9U A;  1L5U A;  3UIQ A;  4FLY A;  1BIZ A;  3ZT0 A;  2JLE A;  3AV9 A;  4N5S A;  3OS1 A;  4HTU A;  1LV5 A;  3WNG A;  4RG8 A;  3B6O A;  3KLE A;  1EP4 A;  1TL3 A;  1ZBH A;  2G8I A;  4BAC A;  3HK2 A;  1K6Y A;  4XIU A;  3MEC A;  3OYC A;  1UA0 A;  4CHZ A;  3OYH A;  3IS9 A;  4C8M A;  3K57 A;  4RW7 A;  4HCB A;  4F3T A;  1X9W A;  3V1R A;  2YHB A;  4FLT A;  4F2S A;  3L2W A;  4K8Z A;  3ZSO A;  4KHU A;  2Z1J A;  3HYF A;  3VQ6 A;  3LP3 A;  2LSN A;  1S5J A;  3KLF A;  4C8N A;  4FLX A;  1RT6 A;  4F2R A;  1RTH A;  2KZM A;  4BDP A;  1RBS A;  4RW6 A;  4FJL A;  1FKO A;  4DTR A;  2BDP A;  2XO7 A;  4YFU A;  2B5J A;  4E7K A;  3WNF A;  4FJX A;  4N41 A;  5HRS A;  4R5P A;  4BWM A;  1ZBI A;  2P51 A;  2A1S A;  2ZQB A;  4EP5 A;  4JRP A;  2A1R A;  4O5B A;  1S6Q A;  1TKZ A;  1BIS A;  1KFD A;  4W5Q A;  1EXQ A;  1S1T A;  1XWL A;  2HMI A;  1EKE A;  4O0J A;  3SUP A;  4ELV A;  3QER A;  1TK8 A;  2D0A A;  4CEQ A;  4DMN A;  2QKK A;  4NCB A;  4DFP A;  3T19 A;  4M3W A;  4CER A;  3TAN A;  3CG7 A;  2HHX A;  3RR7 A;  5DK5 A;  3VQ9 A;  1NK9 A;  3NFA A;  3THV A;  1NKB A;  1YTA A;  4W5R A;  1NKE A;  4CJP A;  4ELT A;  1CLQ A;  1WSH A;  4FW1 A;  4M42 A;  3JYT A;  2PYJ A;  3VQQ A;  1XC9 A;  4I2Q A;  4E3S A;  4J2B A;  4M3X A;  4CFB A;  5DMR A;  5SWM A;  4W5T A;  3HT3 A;  4AHT A;  3CFR A;  3KKR A;  3TAP A;  4FJG A;  5SZT A;  4F4K A;  3RR8 A;  4CJR A;  4CEC A;  3VQE A;  2IC3 A;  4RW9 A;  4CFA A;  3SQ4 A;  3BGR A;  3QEI A;  4CHN A;  1RT5 A;  2WON A;  1NOZ A;  1J53 A;  1XHX A;  3U3Y A;  2P5O A;  4B3O A;  4PWD A;  3NH2 A;  4B8A B;  4CJ4 A;  4QAG A;  3A2F A;  4DSL A;  4B8C A;  4ID5 A;  4IDK A;  4CF9 A;  3S9H A;  2D0B A;  4KTQ A;  1JLB A;  3QNO A;  3PO5 A;  5D3G A;  4CF2 A;  4CJ5 A;  2WOM A;  3B6P A;  1JLQ A;  4J2D A;  4CE9 A;  1TKD A;  1BI4 B;  3ZSZ A;  3OYG A;  4N76 A;  2ZD1 A;  2KZZ A;  1BQN A;  2X6N A;  3LP2 A;  3K5M A;  1TK5 A;  3OYK A;  2G8K A;  4CJF A;  2OA8 A;  1TVR A;  4AHU A;  4CEE A;  4FM1 A;  5I42 A;  4DTO A;  3QO9 A;  3D45 A;  4AIL C;  1J9A A;  3O4N A;  3PUF A;  4OKK A;  1KTQ A;  2O4G A;  2HW3 A;  4CJL A;  2IGI A;  1TL1 A;  3VQ7 A;  1WNS A;  1WSJ A;  3O4Q A;  3O3H A;  3KD5 E;  3V81 A;  4FM2 A;  3NGZ A;  1RT2 A;  3P83 D;  4M41 A;  2XRI A;  4FZZ A;  4DQS A;  4DTJ A;  2YNG A;  3ZCM A;  3QEP A;  3OY9 A;  2PY5 A;  4DTS A;  4FJH A;  1HQE A;  4ELU A;  4IG3 A;  3SJJ A;  5FRN A;  4DG1 A;  1JL1 A;  1R0A A;  1HQU A;  3L8B A;  1L3T A;  3DRP A;  4C8K A;  4RW4 A;  4ZTF A;  3QIO A;  1BGX T;  4TSX A;  4PQU A;  3NF9 A;  1HNV A;  1ITG A;  4BDY A;  3ZT2 A;  4I9L A;  2HND A;  4OGE A;  1U49 A;  5KGX A;  3SUO A;  1LW0 A;  1Y97 A;  3AO4 A;  2KFZ A;  4CGG A;  2RKI A;  4E89 A;  3ZSV A;  3L2R A;  3S3M A;  4MQ3 A;  4BE2 A;  3KK3 A;  4PUO A;  1RTD A;  4FLV A;  2DY4 A;  3OYM A;  1NK6 A;  4M3Y A;  4B08 A;  2IDO A;  3LWL A;  4W5N A;  4FM0 A;  1EX4 A;  3VQD A;  3TAR A;  1QSY A;  4Y1C A;  3AVN A;  4FLZ A;  3RRG A;  1JXB A;  1RT1 A;  1X9M A;  4I9Q A;  1RT7 A;  3SPY A;  4FZX C;  1S1X A;  4Z4F A;  4DFM A;  3DM2 A;  1HNI A;  1TGO A;  3P1G A;  1RDB A;  3NF6 A;  3BDP A;  3E01 A;  4J2A A;  4FJ8 A;  2YNH A;  2B6A A;  3I8D A;  4DTU A;  3LAN A;  4EZ9 A;  4KI4 A;  5FRM A;  3ALY A;  4DU1 A;  5CZ1 A;  4CGF A;  2GUI A;  3DLB A;  1T8E A;  4CJS A;  4LD0 A;  3C6T A;  3VQA A;  3RWU A;  3AA3 A;  5FRO A;  2X74 A;  4DFK A;  2P5G A;  5HBM A; 
#chains in the Genus database with same CATH topology
 1NMN A;  3ZX3 A;  4CHO A;  4B3M K;  4K42 A;  4M7X A;  1TAQ A;  3R1X A;  1Q86 O;  4B1U B;  1C0U A;  2HMP A;  4DSI A;  3CCE N;  3UKR A;  5C12 A;  3PV8 A;  4KFB A;  3M5R A;  3SK3 A;  2R7Y A;  2HHW A;  3IAY A;  1WBD A;  4C8L A;  2D5R A;  4DS4 A;  2GTD A;  3O9T A;  4DTM A;  4E0D A;  4CFD A;  4CJK A;  3L2Q A;  3CJ1 A;  2Y1I A;  3SQ2 A;  4E7L A;  2W41 A;  4LF5 K;  4BQL A;  4CZJ A;  3UKU B;  3SZ2 A;  4Q5V A;  3HJF A;  4FWP A;  3CJC A;  4K8X A;  2F8T A;  3TAB A;  4B9T A;  2X6S A;  3SBG A;  3ISN C;  3RSE B;  5AQK A;  3CQ8 A;  4JRQ A;  4OKJ A;  5HRP A;  3THY B;  5A2Q O;  1LCU A;  4CGH A;  4B9M A;  3DOL A;  3ID6 A;  1WLJ A;  4HCC A;  3LDS A;  4X62 K;  4HUE A;  2ASP A;  3RRH A;  4EIA A;  3RMB A;  4BR4 A;  1W9H A;  4B9Q A;  3RMA A;  1JLF A;  1BCO A;  1E4F T;  4G9Z A;  1HX1 A;  4DR3 K;  3KK1 A;  4Z4C A;  3FFI A;  4H0P A;  4MFB A;  1NK7 A;  4FJ5 A;  1VSE A;  2HOE A;  1UWB A;  3CET A;  3T69 A;  4ZHR A;  4MO4 A;  5AQW A;  1HMV A;  1SL0 A;  4BRE A;  3NBP A;  2F96 A;  5AQU A;  3OTO K;  3CMA N;  4NYF A;  2VGM A;  4CEZ A;  4KHY A;  1NOY A;  2BGG A;  3SAF A;  2XY5 A;  4B9L A;  3I33 A;  3SV3 A;  4FJ7 A;  5BPN A;  3BP8 A;  1ZC6 A;  3HPH A;  4IG0 A;  2HF3 A;  2QXL A;  4HUF A;  1YTU A;  1SUQ A;  3H6E A;  3OJU A;  3O9U A;  1BCM A;  3DMJ A;  2YHA A;  4R79 A;  3HL8 A;  4CF1 A;  3LDQ A;  3NGI A;  4YDU A;  3CM5 A;  5C10 A;  5J2P A;  3TTF A;  4DSF A;  4A2B A;  1VSL A;  3SV4 A;  4CVN E;  2QWL A;  2HHT A;  4CGI A;  3O9S A;  1EWQ A;  3VEW A;  1EET A;  3WXI A;  2E1Z A;  1UAX A;  3L4Q A;  4CHY A;  4Z0U A;  2UXB K;  4OPH A;  4CIF A;  3GOI A;  4B9V A;  2VWK A;  2E6L A;  3QB0 A;  1K9M O;  1J5E K;  3V9Z A;  1RBT A;  3AO2 A;  1BG3 A;  1XHZ A;  4JYA K;  4GV3 A;  4DLE A;  2F9W A;  4CK1 A;  4CBU A;  2YV0 X;  4LF6 K;  3QET A;  3VF2 A;  5AQT A;  3VQ5 A;  4NLC A;  3ENH A;  3LAM A;  1BO5 O;  4E1M A;  3J7Y P;  1BHL A;  2QEX N;  3OYA A;  2NUB A;  4JHD B;  5EVZ A;  4OJR A;  3VET A;  2EX3 A;  3BF1 A;  5FPD A;  3CJ7 A;  3MXJ A;  3PO4 A;  4IEI A;  3NVM A;  3CPE A;  4FK0 A;  1IBL K;  3M8S A;  1CZA N;  4DR6 K;  2QW9 A;  2P9L A;  3CM6 A;  2P9S B;  4Y1D A;  3JXU A;  5KI6 A;  1Q9X A;  4BC4 A;  1NGF A;  4F8R A;  3F9K A;  4JAX A;  2Z1G A;  3CC4 N;  4KBO A;  5H1S Q;  4QS9 A;  4WE1 A;  1LWC A;  3AVB A;  5HP1 A;  4NCG A;  4PY5 A;  4WF9 L;  1GLC G;  3FZF A;  1Q9Y A;  5C2D A;  4PA1 A;  4IOX A;  4QS7 A;  3T1A A;  3G6E N;  4ISF A;  1NMD A;  1RBV A;  3V9W A;  3AA5 X;  3SMS A;  1J6Z A;  1SQK A;  1W7A A;  2YJF A;  1M90 O;  5JIC A;  1NK4 A;  4JI0 K;  2Q3S A;  2E6M A;  2YNF A;  2E2O A;  4AF1 A;  4C23 A;  3J7A P;  4MDA A;  2QK9 A;  3FLC O;  2HNY A;  3KTQ A;  1JXE A;  3V1Q A;  3QEV A;  3THX A;  3ZT4 A;  5IT9 O;  1JCE A;  3OYL A;  2HBL A;  3BZK A;  1C1B A;  1QQC A;  1DLO A;  2GWJ A;  3O80 A;  4O55 A;  1TV6 A;  2FF3 B;  1YIT N;  3J8A A;  1ASW A;  3SUN A;  2NRH A;  1U48 A;  4BR5 A;  1KC8 O;  4BR2 A;  1ATR A;  3AVA A;  3ATV A;  1NK8 A;  4BDZ A;  4CZH A;  3VQ8 A;  4JI5 K;  1RT4 A;  1IO2 A;  4CJV A;  4PL7 A;  4GKJ K;  4NCA A;  3TAQ A;  3J80 O;  4DTP A;  3DLR A;  1Y64 A;  2RF2 A;  2EHG A;  3ZSR A;  3V9X A;  4BRH A;  4C8O A;  3CFO A;  4JK7 A;  4O44 A;  2NLX A;  2GV9 A;  3KWI A;  2YNI A;  3L3V A;  3IRX A;  1WSE A;  4DR5 K;  3C6H A;  3OYB A;  3OS2 A;  5HRN A;  1YAG A;  3VEV A;  1EQY A;  5CY4 A;  4LSL A;  2RN2 A;  5KRT A;  3LPT A;  5ADX A;  1VQN N;  3CPW M;  3M8P A;  3FZL A;  1TYQ B;  4IFY A;  3VEO A;  4KRF A;  4H03 B;  3DLH A;  4DV3 K;  3SLC A;  4MO5 A;  2P9K A;  4JKA A;  4J8F A;  4JHD A;  1RCH A;  4CES A;  1ZBU A;  4YDU C;  2D0C A;  3EKU A;  1VSK A;  2HF4 A;  4M3Z A;  1VAZ A;  1IKY A;  2FBT A;  5J1E A;  3QFP A;  3V9U A;  4BRM A;  1L5U A;  3ZT0 A;  2W6K A;  4QS8 A;  3OS1 A;  1LV5 A;  4PQU A;  3B6O A;  2G8I A;  1EP4 A;  1NWK A;  4IJN A;  3HK2 A;  5EY4 A;  1UA0 A;  3MEC A;  3OYC A;  4CHZ A;  2WBN A;  4H0V B;  4HCB A;  4F3T A;  1V4S A;  4H5N A;  4FLT A;  4F2S A;  3L2W A;  3FZM A;  3VQ6 A;  4C8N A;  4HWI A;  4F2R A;  4RW6 A;  5F0X A;  2E2Q A;  3WNF A;  3PSF A;  4IEE A;  2FSJ A;  4BWM A;  2P51 A;  4K41 A;  2WTU A;  1SS6 A;  4JRP A;  4GV6 A;  3DLL L;  3G25 A;  4A59 A;  1EXQ A;  2HMI A;  1EKE A;  3D2E A;  3FE1 A;  2D0A A;  4CEQ A;  2QKK A;  4NCB A;  4DFP A;  3T19 A;  4CER A;  2E5L K;  3CG7 A;  5DK5 A;  3THW A;  3NFA A;  1NK9 A;  1YTA A;  1NKE A;  3CCJ N;  2P9N B;  2CH6 A;  4FW1 A;  3ZLJ A;  3MCA B;  4E3S A;  1OH5 A;  3ZX2 A;  5DMR A;  4JKC A;  3AAR A;  3CFR A;  5GAH P;  1KXP A;  4CFA A;  4CHN A;  2WON A;  4PWD A;  4LC9 B;  3NH2 A;  4QAG A;  3A2F A;  3ENB A;  4PHT X;  4ID5 A;  4IDK A;  4CZK A;  2IVP A;  1WBB A;  3CCU N;  4B1V A;  1TKD A;  3ZSZ A;  3T1H K;  4K25 A;  1ZXO A;  5FPN A;  1TK5 A;  1IJJ A;  2YHY A;  3QO9 A;  3D45 A;  2ZWH A;  1NGE A;  4OKK A;  4H5R A;  2IGI A;  3VQ7 A;  3KD5 E;  3VEZ A;  3P83 D;  4CW7 B;  2XRI A;  3AGK A;  5AZJ B;  2PY5 A;  4JK9 A;  1HQE A;  3E9P A;  5LMU K;  3A5O C;  4BG9 A;  3SJJ A;  4ELU A;  2HBJ A;  4DV4 K;  4E1J A;  1ATN A;  2GEL A;  5AQO A;  3ZET B;  3NF9 A;  1ITG A;  2A40 A;  3ZT2 A;  2HND A;  4FOE A;  2D0O A;  2ZGY A;  4CGG A;  2RKI A;  4E89 A;  5GAG P;  3L2R A;  4BE2 A;  1RTD A;  4FLV A;  4MDB A;  3TAR A;  1QSY A;  3DXM A;  4BRP A;  2A42 A;  2QWR A;  1RDW X;  3SPY A;  4FZX C;  3HBT A;  4RCH A;  3O08 A;  1C0F A;  1S72 N;  4FJ8 A;  2YNH A;  3I8D A;  3LAN A;  4DV5 K;  5AQY A;  4DU1 A;  4CJS A;  4H0Y B;  3D7E O;  1ZBS A;  1K8A O;  4KB1 A;  1KVC A;  1TUY A;  4YNQ A;  1BL3 A;  3VF6 A;  4ZTJ A;  3KD1 E;  1NM1 A;  2CGK A;  4ICL A;  4BRD A;  3LM9 A;  4BR7 A;  5AQV A;  1DGK N;  2XY7 A;  3PX4 A;  2NNW A;  4XEI A;  2VQF K;  2FSK A;  1LAV A;  3KKS A;  3HPG A;  3SI6 A;  4KB0 A;  3VEY A;  3MCP A;  2HST A;  3FZH A;  3AAQ A;  4AHS A;  5KTQ A;  3EN9 A;  1DTT A;  4IFE A;  3G4S N;  3OW2 M;  1VSI A;  3A5N C;  4OVL A;  4PKH A;  5HOO A;  2P9P B;  3PIO L;  5GIO A;  4WFN L;  1GOC A;  3F9M A;  5C24 A;  2OZM A;  1WSG A;  4I6M A;  4IFV A;  3EEQ A;  4YOW A;  1Z25 A;  3EYZ A;  1D9F A;  2Q31 A;  3H3O B;  4HVJ A;  1LWE A;  5AQR A;  2YJE A;  3U9Z A;  1YIJ N;  1QS4 A;  3M3Z A;  2PYL A;  2GWK A;  2IIR A;  3DI6 A;  1Q81 O;  5C25 A;  1NJZ A;  1KLM A;  3PY8 A;  4L8R B;  4I2P A;  2PZS A;  2HHH K;  2V51 B;  2KFN A;  3LDP A;  1X9S A;  3VQ4 A;  1VRU A;  4Q0B A;  2OZS A;  4GY2 B;  1IBM K;  4JNE A;  3WEE B;  3IFR A;  3VQP A;  2D0P A;  4JK8 A;  2V7Z A;  4JD2 B;  3OJS A;  4F9O A;  4B1Z A;  4DF8 A;  3Q7C A;  3K59 A;  5I3U A;  2ITG A;  1UA1 A;  2QA4 N;  2F8S A;  1UOC A;  1NJX A;  2D1K A;  3MK6 A;  4FYD A;  1VQ4 N;  3NH1 A;  3MXM A;  2Q2R A;  4G1Q A;  3LL3 A;  4IO9 L;  3L3U A;  4DTX A;  4FJJ A;  3D6R A;  3NH0 A;  3IDH A;  1QQN A;  1XNR K;  3OYN A;  1TKX A;  3OYF A;  1ZYQ A;  1VQL N;  2RPI A;  5AQP A;  1H1V A;  1G15 A;  3AAP A;  1C0T A;  4H8K A;  3R9P A;  4KHQ A;  3IKM A;  1HRH A;  4U7B A;  3H45 C;  3EE8 A;  3F2K A;  3CYM A;  4OPK A;  5CHI A;  3CJA A;  4IOC L;  3DLK A;  4AHV A;  4C1N I;  1HYS A;  1P8Z A;  1A5W A;  4KHN A;  2WUS A;  4DQ8 A;  4KRE A;  1EWR A;  1WSI A;  4DU3 A;  3JS6 A;  3TAM A;  4KO0 A;  4DV7 K;  2ZJR L;  1YHQ N;  1R59 O;  3CHW A;  3KVG A;  1MWK A;  1VHX A;  4E19 A;  2G8F A;  2FBV A;  3ZT1 A;  2XY8 A;  5JS1 A;  1B9D A;  2BAN A;  1HYZ A;  4H0X B;  2G8H A;  4DLG A;  4CHP A;  3IG1 A;  3FZK A;  4FWR A;  4FJ9 A;  3LZJ A;  4FZY A;  3JSM A;  1K8K A;  2YKM A;  3KLH A;  4BWJ A;  1KAY A;  1NJW A;  1X3N A;  4DR7 K;  5JLF A;  3CIP A;  4IO8 A;  3M8Q A;  3T3F A;  4ILH A;  3MAQ A;  1JLC A;  1T03 A;  4AH9 A;  4Z4I A;  1Z05 A;  2P9U A;  2O4I A;  2W42 A;  2WC9 A;  3HI0 A;  2DFH A;  3CME N;  5AQM A;  2P1J A;  2Q1N A;  5E84 A;  1BA1 A;  1GLE G;  1NJY A;  4JV5 K;  3I8B A;  1XNQ K;  5FPM A;  2O8F A;  3HPO A;  4CD1 A;  1S9G A;  1S1W A;  3OHR A;  1U4B A;  2QWP A;  5JVG L;  1KVB A;  4CK3 A;  1S9E A;  4FK4 A;  3WUH A;  4XH1 A;  1T05 A;  1KRP A;  4DR1 K;  2UYT A;  3CCQ N;  3OYI A;  4DQR A;  5M1F A;  4LF4 K;  2EWS A;  5AFU A;  3B8A X;  2P9I B;  2D4W A;  3C94 A;  3Q7B A;  4JN4 A;  3JAM O;  5K14 A;  3O5B A;  4IBN A;  3HST B;  3SJH A;  2VG5 A;  3TSU A;  4CGJ A;  2O8E A;  3AVG A;  3NAE A;  4BGB A;  4C1N K;  1T7P A;  4FJI A;  3VF4 A;  3NE6 A;  5BRH A;  1OVY A;  1KSP A;  1C6V A;  1S6P A;  2OPS A;  1XUP O;  4FLU A;  2UUB K;  1QHT A;  1BU6 O;  3R3L A;  1OKJ A;  3O1B A;  4BRO A;  5HRR A;  1D4X A;  3BY5 A;  5CYQ A;  4K43 A;  2I7N A;  3P5J A;  3VN5 A;  4CJ3 A;  1E3M A;  5M1N A;  2AJQ A;  5AZI B;  1NLV A;  2DFE A;  1NK0 A;  3AA4 A;  4DSK A;  2GBZ A;  3MWP A;  4FJM A;  3W3D A;  1VSJ A;  5JVH L;  3QLH A;  2VQE K;  3ZSY A;  4NB4 A;  4M45 A;  1HKB A;  4B1W B;  3V9S A;  3L6Q A;  5AQS A;  5FPE A;  1NBW A;  2DPN A;  3BF3 A;  2OTJ N;  4CF8 A;  3RMD A;  3TSP A;  3LAK A;  4JKH A;  3F73 A;  4DSJ A;  1GLF O;  3C6U A;  4IDH A;  4CBX A;  2IAJ A;  3QDK A;  3SUQ A;  4EZ6 A;  2Q0R A;  1XQS C;  3E9L A;  3SAH A;  3VGL A;  4I7F A;  4DWI A;  4YOV A;  3NGY A;  4YOU A;  3VGM A;  3LZI A;  4BC5 A;  3P4I A;  1J54 A;  5AQF A;  4EFH A;  1JKH A;  4PKG A;  4FVU A;  2NZT A;  1BIZ A;  2JLE A;  3AV9 A;  3UKU A;  4HTU A;  4DB3 A;  4RG8 A;  1ZBH A;  1K6Y A;  4XIU A;  1HLU A;  3IS9 A;  4C8M A;  3RSE A;  2YHB A;  3V1R A;  4K8Z A;  3THY A;  1NNE A;  2LSN A;  3GDQ A;  4DTR A;  1T44 A;  5TKW A;  2NRV A;  5HRS A;  5KQD A;  3TSQ A;  4A2A A;  2GEM A;  2A1S A;  1HPM A;  4H0O A;  4O5B A;  4FPB A;  3K0S A;  1S1T A;  4O0J A;  3QER A;  4FWM A;  4YOR A;  3MN9 A;  1GLJ O;  3RR7 A;  5MLC Q;  3THV A;  1CLQ A;  1WSH A;  1YI2 N;  2PYJ A;  4M3X A;  5SWM A;  4W5T A;  3CF5 L;  3KKR A;  1YUW A;  4NXM K;  4RWT A;  5ADX H;  5SZT A;  4V19 S;  4F4K A;  3SQ4 A;  3U3Y A;  2P5O A;  3C0B A;  1I94 K;  4FWN A;  2UU9 K;  5D3G A;  4CF2 A;  1JLQ A;  1BI4 B;  1LOT B;  2F9T A;  4AM6 A;  3OYG A;  4N76 A;  1BQN A;  4BVO A;  2F7T A;  5AJ3 K;  3LP2 A;  3K5M A;  2G8K A;  4CJF A;  1DKG D;  5F2R A;  3WXK A;  3O4W A;  4AIL C;  2FLO A;  3AY9 A;  4K0K K;  3PUF A;  2QWM A;  1WNS A;  1WSJ A;  3O4Q A;  3V81 A;  4DQS A;  2CGJ A;  2E1Y A;  4JKB A;  2J4R A;  5M1K A;  5FRN A;  1HQU A;  4RW4 A;  1Q82 O;  2UXD K;  3CQY A;  2Q0U A;  2ZGZ A;  1HNV A;  4BDY A;  4OGE A;  1RFQ A;  3P39 A;  3SUO A;  1LW0 A;  1Y97 A;  2KFZ A;  4LF7 K;  3ZSV A;  4GV9 A;  3KK3 A;  4PUO A;  2DY4 A;  1YJN N;  4W5N A;  1EX4 A;  1E4G T;  3RRG A;  1BWF O;  4I9Q A;  4Z4F A;  1S3X A;  3DM2 A;  1HNI A;  1RDB A;  2HBK A;  4KI4 A;  5FRM A;  4CGF A;  4DR4 K;  1BDG A;  1T8E A;  3RWU A;  5FRO A;  4JKG B;  3C95 A;  1RTJ A;  5KRS A;  2O8C B;  3HP9 A;  2QWQ A;  1MA9 B;  3S3O A;  3ULE B;  1ASV A;  3K5L A;  3OBW A;  1D8Y A;  4HUG A;  4WFA L;  4LSN A;  3SCX A;  2VCP A;  3CER A;  3CCM N;  4LH5 A;  4KH6 A;  2P9S A;  1NGI A;  2CGL A;  3TAE A;  3LM2 A;  3MN6 A;  1VSH A;  2OPQ A;  5AQZ A;  4IJA A;  4BRF A;  1RDD A;  3HOT A;  2QTD A;  4BRI A;  1OH7 A;  3DJC A;  1ATS A;  1JJ2 M;  3VA0 A;  3K5O A;  4DQQ A;  3K2P A;  1WUA A;  3DRS A;  3MED A;  4CED A;  1OVQ A;  5GAE P;  4DCH A;  2XY6 A;  5HLF A;  1Q18 A;  4KI6 A;  3SBT A;  4CCH A;  4O4G A;  3GG4 A;  5FDL A;  3AVJ A;  2Q36 A;  3V6D A;  3DYA A;  4BQZ A;  4LH4 A;  4M63 C;  1N34 K;  2KQ2 A;  4CF0 A;  1N36 K;  3EY1 A;  2WFB A;  4E1N A;  1IG8 A;  4CZL A;  3KJV A;  1HNX K;  4GMJ B;  4JEP A;  4WQ5 A;  1VQO N;  3H46 O;  4DQP A;  1U2V B;  2NRW A;  3HXM A;  1MU2 A;  3PLA A;  4FCY A;  1U04 A;  3AO1 A;  3QIC A;  1V4T A;  1WAF A;  3N4Q A;  3K5N A;  3OYJ A;  3EKS A;  3GL1 A;  3LAL A;  4B3R K;  4M3T A;  3ASM A;  1L3U A;  3U4L A;  5BRD A;  3C6A A;  4FW2 A;  3HVR A;  5M1Q A;  5E26 A;  4JI8 K;  4WYB A;  4WQ4 A;  3LDO A;  2KLA A;  4A5B A;  5M1O A;  1OH6 A;  4CHQ A;  4BR9 A;  2ITM A;  4BE0 A;  2Z1H A;  1QQM A;  3VA3 A;  1BIU A;  4A62 A;  1ILY A;  3A5M C;  4FVM A;  3O8M A;  3S41 A;  1XI1 A;  4BRQ A;  1QE1 A;  2DTU A;  1DEJ A;  3QBW A;  3QIP A;  1A5X A;  3DAW A;  1NK5 A;  1TYQ A;  3U6F A;  3ENO A;  3FFK B;  3TWH A;  3SPZ A;  1QSL A;  4B3S K;  3ZEU B;  1NGA A;  4FWK A;  3F5T A;  1X9J A;  2O8C A;  1L3V A;  5FLX O;  5C42 A;  4PKI A;  1QQO A;  3NDK A;  2OTL N;  4RTF D;  3ULE A;  4OLB A;  1XC3 A;  4H0T B;  3TR8 A;  1YJ9 N;  4J2E A;  1WN7 A;  3MX2 A;  4Y0W A;  1D9D A;  1IKX A;  4FWQ A;  2KHO A;  2JWL A;  3WNH A;  3WQU A;  3L0Q A;  1N6Q A;  4OX9 K;  3DOK A;  4DTN A;  1SL1 A;  1VQM N;  4DHY A;  1C0G A;  1P90 A;  2YCH A;  4U67 L;  2G8V A;  3DXK B;  1VSF A;  3A5L C;  3CJ9 A;  3WXL A;  3AVH A;  3DLE A;  2A3Z A;  2B4J A;  4CZE A;  3HRG A;  1J5O A;  2E2N A;  4DUZ K;  2E88 A;  1B9F A;  3L2U A;  3ULD A;  1RNH A;  3H3N O;  4H4O A;  3HP6 A;  3MEG A;  1BQM A;  3I0S A;  2I5J A;  1JLA A;  3SAG A;  3C65 A;  3NF8 A;  1JCF A;  2KTQ A;  4DFJ A;  5M1P A;  3AO5 A;  4CGD A;  2P9N A;  5EOY A;  3R8E A;  4Z4G A;  3AVL A;  3IMX A;  5J2M A;  3AVF A;  2UUA K;  2HVI A;  1BA0 A;  5CE3 A;  3MN7 A;  2FSN A;  1IKW A;  3HVT A;  1TKT A;  4YY3 K;  1U6Z A;  4RW8 A;  3OYD A;  3QES A;  2ZF5 O;  4KKO A;  2BTF A;  4CIG A;  3CQX A;  4Z4E A;  3OBY A;  1CZ9 A;  4CEA A;  1YVN A;  3FR0 A;  4HHT A;  5BRE A;  3S3N A;  4LFA K;  1NGJ A;  1RIL A;  3CJB A;  2FBX A;  4NLB A;  4DFK A;  2RHK A;  3AVM A;  5BN9 A;  1IV0 A;  3QEW A;  1U45 A;  4GNI A;  5AR0 A;  4XH4 A;  4B9N A;  1RBU A;  4AHC A;  3AVC A;  4ILG B;  5C15 A;  1M1K O;  3PX0 A;  3K9K A;  5AZJ A;  5HRO A;  5I9E B;  3V4I A;  2A41 A;  2HHQ A;  3I55 N;  1NGD A;  3ZET A;  1CXQ A;  1VK0 A;  3P31 A;  2QI2 A;  4ISE A;  4O0I A;  4N47 A;  2HVH A;  2QWN A;  3SNN A;  4WQ5 C;  1QTM A;  1SZ2 A;  3G10 A;  2IVN A;  2ATQ A;  4FWS A;  1XMQ K;  2FC0 A;  2PBD A;  3TI0 A;  4IXC A;  1O1W A;  3OVN A;  3KK2 A;  1SAZ A;  3HM9 A;  5C0Y A;  1IH7 A;  4GW6 A;  5GIN A;  4JS5 A;  1W2B M;  1HYV A;  3N4P A;  3HZ6 A;  4BRA A;  3MN5 A;  4M3R A;  1NGH A;  3BZC A;  2VG7 A;  2OPR A;  4DV1 K;  3VPZ A;  2QXF A;  3ATU A;  5AFU H;  5JS2 A;  1I39 A;  3ITH A;  1HJO A;  4JI2 K;  4FK2 A;  3LWM A;  1GOA A;  4DQI A;  3KWG A;  3CD6 N;  5CR4 A;  3VOV A;  1RTI A;  1T3V A;  2OAN A;  4JLH A;  1YXQ A;  3CI5 A;  1JCG A;  3LDL A;  3HO1 A;  1SKS A;  2V7Y A;  3MDQ A;  4JKF A;  3H08 A;  1JL2 A;  4CEF A;  3HOS A;  1JLE A;  2PAV A;  4N5S A;  2P9P A;  2V52 B;  2RE2 A;  3M6G A;  3KLE A;  1GLB G;  5AQH A;  1VQ9 N;  4KHP K;  3OYH A;  3K57 A;  4RW7 A;  2A5X A;  3ZSO A;  3CC7 N;  3HM8 A;  3HSC A;  1T6D A;  1Q7Y O;  5AQQ A;  4FLX A;  1RT6 A;  4GVE A;  1RTH A;  2BH1 A;  2KZM A;  2KKZ A;  2BDP A;  1NJI O;  2XO7 A;  2O8B B;  1ZBI A;  2ZQB A;  4H5T A;  1TKZ A;  1KFD A;  2W40 A;  4W5Q A;  1XWL A;  4ELV A;  1NU0 A;  1VQ5 N;  1TK8 A;  4DMN A;  3WEE A;  3VMF B;  4BRK A;  3ID8 A;  3R6M A;  3TAN A;  4JD2 A;  4BG8 A;  4DKW A;  3VQ9 A;  3DWL A;  2P9L B;  4W5R A;  4CJP A;  4JI7 K;  3M1F A;  4M42 A;  4MLE A;  2ASO A;  1XC9 A;  4I2Q A;  4EAH D;  2NRX A;  3HT3 A;  4AHT A;  3TAP A;  4FJG A;  4HTL A;  4OPA A;  3RR8 A;  3O9Q A;  4CEC A;  2IC3 A;  3BGR A;  5DM6 L;  3QEI A;  1RT5 A;  3CCL N;  1XHX A;  5GIP A;  4CJ4 A;  3NVK A;  1JLB A;  3QNO A;  3PO5 A;  4OO1 J;  4CJ5 A;  2WOM A;  1S22 A;  1RDU A;  2H3G X;  1BUP A;  2X6N A;  1HKC A;  2AA4 A;  4FL9 A;  4B1Y B;  1TVR A;  4CEE A;  1J9A A;  3O4N A;  1KTQ A;  3EZW A;  5BR8 K;  3O3H A;  4CZG A;  4BRN A;  3LDN A;  4DTJ A;  3ZCM A;  3QEP A;  4FJH A;  3OY9 A;  5BN8 A;  3THX B;  2OCE A;  3FGU A;  3EO3 A;  4O5F A;  4C8K A;  3EE9 A;  4IZ9 A;  4ZTF A;  3QIO A;  1BGX T;  4JI3 K;  4FWO A;  4TSX A;  4DV2 K;  4I9L A;  2ZM6 K;  3AO4 A;  3VEN A;  5F1X A;  4LF8 K;  4MQ3 A;  4B1X B;  3OYM A;  1NK6 A;  3U8X A;  3LWL A;  1QVF M;  2Q97 A;  1VQ8 N;  3VQD A;  3AVN A;  2NRZ A;  3A8Y A;  3WXM B;  1O13 A;  1KAZ A;  4DFM A;  1TGO A;  3P1G A;  4DUY K;  4JI4 K;  5GAD P;  5CZ1 A;  2GUI A;  5JMV A;  3J7Z O;  3VQA A;  3AA3 A;  2X74 A;  4F3O A;  3CXC M;  4BVP A;  2ETJ A;  3BEX A;  1B92 A;  4KV8 A;  4WCE L;  3K58 A;  1FK9 A;  3H1V X;  4Z94 A;  3O3F A;  1SL2 A;  4JKE A;  4CJE A;  4QCL A;  3TTC A;  4A57 A;  3J81 O;  4CJW A;  4B9S A;  2P9K B;  5LY3 A;  1C1A A;  5LJW A;  2O8B A;  1TAU A;  2CH5 A;  2QKB A;  4DS5 A;  3V1O A;  2E2P A;  2FF6 A;  4AHR A;  4CI6 A;  5BRF A;  3ZSX A;  4WFB L;  3SQ0 A;  1DT9 A;  1GLA G;  3DRR A;  1X1P A;  3L4I A;  3ZYY X;  1RDC A;  3WNE A;  1Z26 A;  4KPY A;  3VGK A;  4CEB A;  1LAW A;  3PIP L;  1NGG A;  3CC2 N;  2P9I A;  5J2N A;  1GOB A;  4OKE A;  4FJK A;  5HL7 L;  4EHT A;  5KPT A;  4AQY K;  4LFC K;  4CZF A;  3NHG A;  1KVA A;  4YHH K;  2E8A A;  1KAX A;  4KH5 A;  4LY7 A;  1K73 O;  3C7N B;  3CFP A;  4O8K A;  1KD1 O;  1FXX A;  3VER A;  5CZ2 A;  3D2E B;  3OA9 A;  3U9D A;  4ISG A;  4CZM A;  3AGR A;  2OPP A;  5LMN K;  3KLI A;  1JLG A;  3THW B;  5KPR A;  4M3U A;  4FJN A;  3M8R A;  2HHU A;  3CCS N;  1WOQ A;  5AZI A;  4CEO A;  3QIN A;  3DLG A;  2VG6 A;  3AVI A;  3G71 N;  1L3S A;  3KK7 A;  4CFC A;  4KHW A;  4BRG A;  4GVM A;  3I56 N;  5LL6 Z;  4YOT A;  4ILJ A;  2JWK A;  4CJQ A;  3TAF A;  4PL8 A;  2JGU A;  5AQJ A;  1YF5 L;  1DTQ A;  5EU7 A;  2QM1 A;  3O3G A;  1LW2 A;  3T1Y K;  1W97 L;  3I0R A;  3PSI A;  3TPQ A;  2VGN A;  2IVO A;  3VTI A;  1FW6 A;  2YKN A;  1X3M A;  4B9U A;  1HPZ A;  2NRT A;  2VYP A;  4UQG A;  2X78 A;  1G99 A;  2VWJ A;  4CJ7 A;  3RMC A;  1RT3 A;  1Z6R A;  1VQK N;  3GBT A;  3VTH A;  2IS3 A;  1NG9 A;  1VSD A;  1TK0 A;  4OGC A;  2GUP A;  5AQX A;  1WAJ A;  1MWM A;  3E66 A;  5EXW A;  3T7Z A;  3O9R A;  3WQT A;  4CZI A;  4OPJ A;  3CCR N;  3W0L A;  3G0Z A;  2HB5 A;  2DFF A;  3ZSW A;  3SMP A;  1T6C A;  1HNZ K;  4EP4 A;  3SQ1 A;  4B3T K;  4E7J A;  3DXM B;  1SV5 A;  5DM7 L;  3A0I X;  4JS4 A;  4KTW A;  5BR9 A;  3RTV A;  1WSF A;  5TKY A;  3IUC A;  4BC2 A;  2FBY A;  5KGW A;  1W0H A;  2HNZ A;  4DSE A;  1KFS A;  4M7Y A;  4BRL A;  4OLA A;  3E1Y A;  5B8H A;  4BR0 A;  1C1C A;  1VQP N;  3D0P A;  4FPA A;  3TU5 A;  3NMU A;  3VQC A;  2AP1 A;  2F4V K;  1D5A A;  5BPL A;  1QZ5 A;  4FSV A;  2QWO A;  2OYQ A;  4CJT A;  1ASU A;  1ESV A;  1U47 A;  3ZT3 A;  5J2Q A;  1QVG M;  2ZJP L;  4BE1 A;  2I7P A;  3HTV A;  4E7H A;  4DV6 K;  1CZB A;  1IG9 A;  1N33 K;  3SYZ A;  4CIE A;  1S1U A;  1N8R O;  3C7N A;  5BPM A;  1VRT A;  1NGB A;  1N32 K;  2FXU A;  4KAZ A;  1ZBL A;  1RBR A;  1IKV A;  4Z4H A;  1TUU A;  3MXI A;  2PFU A;  3L2V A;  3CCV N;  5IWA K;  2G8W A;  3NF7 A;  3OYE A;  1BI4 A;  4I6M B;  4BRC A;  2GX9 A;  4DV0 K;  1N5Y A;  5CYM A;  2G8U A;  4KH4 A;  1EO1 A;  1Q8I A;  4JI6 K;  1NKC A;  3KZB A;  2UUC K;  3QEX A;  4KTZ A;  4ID1 A;  2ZJQ L;  3PX6 A;  1VQ7 N;  1VSM A;  2XHB A;  1I3A A;  3AO3 A;  4H5W A;  4H5V A;  3LP0 A;  4NYN A;  2UXC K;  2HHV A;  1YT3 A;  3K9J A;  1BOT O;  3QNN A;  1KLN A;  4N56 A;  3OS0 A;  1RDA A;  3LP1 A;  3U3G A;  4DF4 A;  1GLD G;  3AA2 A;  4QOZ B;  4FOI A;  2ZE2 A;  3KLG A;  1SKW A;  5AQI A;  3VES A;  3BUZ B;  4CK2 A;  5E41 A;  4CJU A;  1F21 A;  1CXU A;  2E4L A;  1HJR A;  3EL2 A;  1SKR A;  4IKF A;  1A5V A;  1S1V A;  4BGA A;  4KHS A;  3EZ5 A;  3LPU A;  4X66 K;  4O8U A;  4DU4 A;  5AQL A;  4FXD A;  4DR2 K;  2Y1J A;  4BC3 A;  1HUX A;  3KIO A;  4JKG A;  3VEX A;  3VQB A;  1ZBF A;  5T7B A;  4YOY A;  1REV A;  1C0M A;  4H4M A;  2KW4 A;  2IOC A;  1IBK K;  4GKK K;  3AVK A;  3O6W A;  3TAG A;  2VWB A;  2YX6 A;  3MEE A;  1FKP A;  2HHS A;  2Z1I A;  3QFU A;  2W6L A;  3ZSQ A;  3QBX A;  4FO0 A;  4FLW A;  1LWF A;  1HR0 K;  3D2F B;  3NCI A;  4IOA L;  2O8D B;  4E7I A;  1YVU A;  4W5O A;  1QSS A;  2BE2 A;  1KCF A;  3UIQ A;  4FLY A;  5EX5 A;  1K8K B;  4AM7 A;  3WNG A;  2YI1 A;  1TL3 A;  1XMO K;  1RGI A;  4BAC A;  3KHY A;  1KQS M;  4L3Q A;  1MDU B;  4CD3 A;  4LF9 K;  4NXN K;  1X9W A;  4KHU A;  3UKR B;  4A61 A;  2Z1J A;  3HYF A;  3UE5 A;  3KLF A;  3LP3 A;  1S5J A;  1OH8 A;  5KQ8 A;  4BDP A;  1RBS A;  4FJL A;  2ASM A;  1FKO A;  4LFB K;  4IWV A;  4YFU A;  2B5J A;  4FWL A;  2A6A A;  4E7K A;  4FJX A;  4N41 A;  4R5P A;  2P9U B;  1QZ6 A;  4EP5 A;  2A1R A;  4BY9 C;  3MMV A;  1S6Q A;  3TTD A;  1BIS A;  2BUP A;  3SUP A;  3UB5 A;  4M3W A;  1U2V A;  2O8F B;  5JLH A;  3MWT A;  2HHX A;  5AQN A;  1NKB A;  4ELT A;  4XH5 A;  4NO7 A;  3JYT A;  3VQQ A;  4J2B A;  4CFB A;  4CJR A;  3VQE A;  4RW9 A;  3GE1 A;  1NOZ A;  1J53 A;  4YOX A;  4B3O A;  1VQ6 N;  1FJG K;  4B8A B;  4A5A A;  4DSL A;  4B8C A;  4CF9 A;  4X64 K;  3S9H A;  4KTQ A;  2D0B A;  4MLH A;  3WT0 A;  3MX5 A;  2HBM A;  4CBW A;  3B6P A;  4J2D A;  2NRR A;  4CE9 A;  4JI1 K;  1GLL O;  2ZD1 A;  2KZZ A;  5ELZ A;  3OYK A;  2OA8 A;  3RVC A;  5KPZ A;  4AHU A;  5I42 A;  4FM1 A;  1HNW K;  4DTO A;  5LJV A;  2O8E B;  2O4G A;  2HW3 A;  4CJL A;  1TL1 A;  4FM2 A;  3NGZ A;  3O1W A;  1RT2 A;  4UY8 O;  4M41 A;  4FZZ A;  4EHU A;  2YNG A;  4DTS A;  4X65 K;  4IG3 A;  1QHA A;  4DG1 A;  1NGC A;  1JL1 A;  1R0A A;  3L8B A;  1L3T A;  3DRP A;  1YJW N;  5C2F A;  3QML A;  3ZEU A;  5AQG A;  1U49 A;  5KGX A;  2E20 A;  3S3M A;  3H1Q A;  4M3Y A;  4B08 A;  3WXJ A;  2IDO A;  4FM0 A;  4Y1C A;  4FLZ A;  1JXB A;  4WQ4 C;  1RT1 A;  1X9M A;  1WB9 A;  2YHX A;  1RT7 A;  1S1X A;  3BDP A;  3NF6 A;  2YHW A;  3E01 A;  4J2A A;  2B6A A;  4DTU A;  3D2F A;  4EZ9 A;  4JKD A;  3ALY A;  3DXK A;  1HKG A;  3DLB A;  2O8D A;  4LD0 A;  3C6T A;  3P38 A;  3ZX0 A;  3E9O A;  2P5G A;  5HBM A; 
#chains in the Genus database with same CATH homology
 4KB1 A;  3HP9 A;  4CHO A;  3S3O A;  1KVC A;  3K5L A;  1ASV A;  4YNQ A;  1BL3 A;  4F3O A;  1D8Y A;  1TAQ A;  4ZTJ A;  4HUG A;  4LSN A;  3SCX A;  2ETJ A;  3KD1 E;  4ICL A;  1B92 A;  1C0U A;  4KV8 A;  4LH5 A;  3K58 A;  4DSI A;  1FK9 A;  3O3F A;  1SL2 A;  3PV8 A;  4KFB A;  4CJE A;  2XY7 A;  3PX4 A;  4QCL A;  2R7Y A;  2HHW A;  3IAY A;  3TAE A;  4CJW A;  4B9S A;  1RTJ A;  4C8L A;  1LAV A;  2D5R A;  1VSH A;  4DS4 A;  3KKS A;  1C1A A;  3HPG A;  4DTM A;  3SI6 A;  1TAU A;  2OPQ A;  4KB0 A;  4E0D A;  1RDD A;  4CFD A;  4CJK A;  3L2Q A;  2Y1I A;  3SQ2 A;  2QKB A;  4AHS A;  5KTQ A;  4E7L A;  4DS5 A;  1DTT A;  3V1O A;  1VSI A;  4AHR A;  4OVL A;  3ZSX A;  3VA0 A;  3K5O A;  4Q5V A;  3SZ2 A;  4DQQ A;  3K2P A;  3SQ0 A;  3DRR A;  3HJF A;  1X1P A;  1RDC A;  3WNE A;  1Z26 A;  3DRS A;  1GOC A;  4KPY A;  4K8X A;  3MED A;  5C24 A;  4CED A;  4CEB A;  2F8T A;  1LAW A;  2OZM A;  1WSG A;  3TAB A;  2XY6 A;  5J2N A;  1GOB A;  4IFV A;  2X6S A;  4B9T A;  5HLF A;  4OKE A;  4FJK A;  3ISN C;  4KI6 A;  3CQ8 A;  4JRQ A;  1Z25 A;  4O4G A;  4OKJ A;  5HRP A;  4CCH A;  3EYZ A;  1D9F A;  4HVJ A;  5FDL A;  1LWE A;  3AVJ A;  4CGH A;  3V6D A;  4B9M A;  3NHG A;  3DOL A;  1KVA A;  3DYA A;  4LH4 A;  1QS4 A;  2PYL A;  1WLJ A;  2KQ2 A;  4CF0 A;  3DI6 A;  3EY1 A;  5C25 A;  4HCC A;  3LDS A;  4LY7 A;  4HUE A;  1NJZ A;  1KLM A;  3RRH A;  3RMB A;  3PY8 A;  4E1N A;  4I2P A;  4L8R B;  1W9H A;  3CFP A;  2PZS A;  2KFN A;  3RMA A;  1FXX A;  1BCO A;  1JLF A;  3VQ4 A;  3KJV A;  1X9S A;  4GMJ B;  1VRU A;  5CZ2 A;  4Q0B A;  2OZS A;  3KK1 A;  4Z4C A;  3FFI A;  3VQP A;  2OPP A;  4DQP A;  4MFB A;  1NK7 A;  4FJ5 A;  3KLI A;  1JLG A;  1VSE A;  3OJS A;  1UWB A;  4ZHR A;  3HXM A;  4FJN A;  4M3U A;  3M8R A;  4DF8 A;  1MU2 A;  3K59 A;  5I3U A;  2ITG A;  1HMV A;  2HHU A;  1UA1 A;  4CEO A;  4FCY A;  3QIN A;  1U04 A;  2VG6 A;  3AO1 A;  3AVI A;  3DLG A;  3NBP A;  1SL0 A;  1L3S A;  4CFC A;  1UOC A;  1NJX A;  1WAF A;  2F96 A;  4KHW A;  3K5N A;  4GVM A;  4NYF A;  3OYJ A;  4FYD A;  3NH1 A;  3MXM A;  4CEZ A;  3LAL A;  4G1Q A;  4CJQ A;  3TAF A;  3L3U A;  4DTX A;  1NOY A;  4FJJ A;  4KHY A;  2BGG A;  4M3T A;  3ASM A;  2XY5 A;  1L3U A;  3NH0 A;  2JGU A;  4FW2 A;  3HVR A;  4B9L A;  3SV3 A;  4FJ7 A;  3OYN A;  1TKX A;  3OYF A;  1ZYQ A;  3HPH A;  4IG0 A;  4HUF A;  1YTU A;  2RPI A;  1DTQ A;  1SUQ A;  5EU7 A;  3O3G A;  1LW2 A;  3OJU A;  4CHQ A;  4BE0 A;  1BCM A;  1G15 A;  2Z1H A;  1C0T A;  4H8K A;  4KHQ A;  3I0R A;  3VA3 A;  1HRH A;  2YHA A;  3DMJ A;  3HL8 A;  3CYM A;  4OPK A;  1BIU A;  4CF1 A;  2YKN A;  3NGI A;  4B9U A;  3CM5 A;  1HPZ A;  3DLK A;  4FVM A;  4AHV A;  5J2P A;  1HYS A;  1A5W A;  4DSF A;  1XI1 A;  4UQG A;  2X78 A;  1QE1 A;  1VSL A;  2VWJ A;  2DTU A;  3RMC A;  3SV4 A;  3QIP A;  4KHN A;  1A5X A;  1RT3 A;  4KRE A;  2HHT A;  1WSI A;  2IS3 A;  4DU3 A;  1NK5 A;  3U6F A;  1VSD A;  3TWH A;  4CGI A;  1TK0 A;  4OGC A;  3TAM A;  4KO0 A;  3SPZ A;  1WAJ A;  1QSL A;  1EET A;  4OPJ A;  4E19 A;  2G8F A;  1UAX A;  2FBV A;  3G0Z A;  3ZT1 A;  4CHY A;  4Z0U A;  2XY8 A;  1L3V A;  1B9D A;  2BAN A;  5C42 A;  5JS1 A;  1HYZ A;  3NDK A;  2HB5 A;  4OLB A;  2G8H A;  4CIF A;  4DLG A;  4CHP A;  3IG1 A;  2DFF A;  3TR8 A;  3ZSW A;  4B9V A;  2VWK A;  4FJ9 A;  2E6L A;  3LZJ A;  4FZY A;  3JSM A;  4EP4 A;  4J2E A;  1WN7 A;  2YKM A;  3SQ1 A;  4E7J A;  1D9D A;  3V9Z A;  1IKX A;  1RBT A;  1SV5 A;  3KLH A;  4BWJ A;  3AO2 A;  4JS4 A;  3WNH A;  1XHZ A;  1NJW A;  4KTW A;  3RTV A;  1WSF A;  4DLE A;  1N6Q A;  3DOK A;  4CK1 A;  2YV0 X;  4DTN A;  1SL1 A;  3M8Q A;  3T3F A;  3MAQ A;  3QET A;  1JLC A;  2FBY A;  3VQ5 A;  2G8V A;  1T03 A;  4AH9 A;  1VSF A;  3LAM A;  4E1M A;  5KGW A;  1BHL A;  4Z4I A;  1W0H A;  3OYA A;  2HNZ A;  2NUB A;  3AVH A;  4DSE A;  1KFS A;  2O4I A;  3DLE A;  2W42 A;  2B4J A;  4OLA A;  1J5O A;  2DFH A;  4OJR A;  2EX3 A;  1B9F A;  3L2U A;  2P1J A;  3ULD A;  1C1C A;  3D0P A;  1RNH A;  4H4O A;  3HP6 A;  3MXJ A;  1NJY A;  3MEG A;  3PO4 A;  1BQM A;  3I0S A;  3VQC A;  4FK0 A;  3M8S A;  1D5A A;  2I5J A;  1JLA A;  3NF8 A;  2OYQ A;  2KTQ A;  3HPO A;  4CJT A;  4DFJ A;  1S9G A;  1S1W A;  1ASU A;  3AO5 A;  3CM6 A;  4Y1D A;  4CGD A;  1U4B A;  3ZT3 A;  5KI6 A;  5J2Q A;  1U47 A;  4BE1 A;  1Q9X A;  4Z4G A;  4F8R A;  3AVL A;  3F9K A;  5J2M A;  1KVB A;  4E7H A;  2Z1G A;  3AVF A;  2HVI A;  1CZB A;  1IG9 A;  4CK3 A;  4WE1 A;  3SYZ A;  1S9E A;  1S1U A;  4CIE A;  4FK4 A;  1LWC A;  1IKW A;  3HVT A;  1TKT A;  3AVB A;  1VRT A;  2F8S A;  3QES A;  4RW8 A;  4NCG A;  3OYD A;  5HP1 A;  4KAZ A;  1T05 A;  1KRP A;  4PY5 A;  4KKO A;  1ZBL A;  1RBR A;  3OYI A;  1Q9Y A;  1IKV A;  4Z4H A;  4PA1 A;  4DQR A;  3MXI A;  4CIG A;  3T1A A;  3L2V A;  2G8W A;  4Z4E A;  3NF7 A;  1RBV A;  3OYE A;  1CZ9 A;  1BI4 A;  3C94 A;  4CEA A;  3V9W A;  3AA5 X;  1N5Y A;  5CYM A;  4HHT A;  2G8U A;  3S3N A;  1Q8I A;  5K14 A;  1NKC A;  1RIL A;  4IBN A;  3HST B;  2FBX A;  2VG5 A;  3AVM A;  3QEX A;  3QEW A;  1U45 A;  1NK4 A;  4KTZ A;  4ID1 A;  4CGJ A;  2Q3S A;  2E6M A;  3AVG A;  1RBU A;  3NAE A;  4AHC A;  3PX6 A;  4B9N A;  2YNF A;  3AVC A;  1T7P A;  1VSM A;  4FJI A;  2XHB A;  1I3A A;  3NE6 A;  1KSP A;  2QK9 A;  3AO3 A;  2HNY A;  3KTQ A;  3PX0 A;  1JXE A;  1C6V A;  1S6P A;  3LP0 A;  2OPS A;  3V1Q A;  5HRO A;  3V4I A;  4FLU A;  3QEV A;  2HHQ A;  1QHT A;  3ZT4 A;  4NYN A;  5HRR A;  2HHV A;  1YT3 A;  3OYL A;  5CYQ A;  1C1B A;  1QQC A;  3QNN A;  1KLN A;  1DLO A;  4O55 A;  3P5J A;  3VN5 A;  1TV6 A;  4CJ3 A;  5KRS A;  4N56 A;  1ASW A;  3SUN A;  1CXQ A;  1VK0 A;  3OS0 A;  1U48 A;  1RDA A;  3LP1 A;  2AJQ A;  3U3G A;  3AVA A;  4DF4 A;  1NK8 A;  2DFE A;  3AA2 A;  1NK0 A;  4QOZ B;  3AA4 A;  2ZE2 A;  4O0I A;  3VQ8 A;  4N47 A;  4BDZ A;  4DSK A;  2HVH A;  1RT4 A;  1IO2 A;  2GBZ A;  4CJV A;  3KLG A;  3SNN A;  1SKW A;  4NCA A;  5E41 A;  4CK2 A;  1QTM A;  4CJU A;  1F21 A;  4FJM A;  3G10 A;  3TAQ A;  1VSJ A;  2ATQ A;  4DTP A;  2FC0 A;  1CXU A;  2RF2 A;  2EHG A;  2E4L A;  1HJR A;  3DLR A;  3QLH A;  3ZSR A;  3V9X A;  3TI0 A;  3ZSY A;  1A5V A;  1SKR A;  4IKF A;  4M45 A;  1S1V A;  1O1W A;  3OVN A;  3KK2 A;  4KHS A;  3HM9 A;  3EZ5 A;  4C8O A;  3CFO A;  3LPU A;  4O44 A;  3V9S A;  4DU4 A;  1IH7 A;  4FXD A;  2GV9 A;  4GW6 A;  4JS5 A;  2Y1J A;  2YNI A;  4CF8 A;  3KIO A;  3L3V A;  1HYV A;  3VQB A;  3RMD A;  3IRX A;  1WSE A;  1ZBF A;  3LAK A;  5T7B A;  3F73 A;  3OYB A;  1REV A;  3OS2 A;  1C0M A;  4DSJ A;  4H4M A;  5HRN A;  2KW4 A;  4M3R A;  2IOC A;  3C6U A;  3AVK A;  3TAG A;  5CY4 A;  3MEE A;  2VG7 A;  2IAJ A;  2OPR A;  1FKP A;  2QXF A;  4LSL A;  2RN2 A;  5KRT A;  3LPT A;  5JS2 A;  3SUQ A;  1I39 A;  3ITH A;  2HHS A;  2Z1I A;  4EZ6 A;  3ZSQ A;  4FK2 A;  3LWM A;  1GOA A;  3M8P A;  4DQI A;  4FLW A;  4IFY A;  1RTI A;  4JLH A;  4KRF A;  4I7F A;  4DWI A;  3DLH A;  1LWF A;  3C95 A;  3NGY A;  3HO1 A;  1SKS A;  3NCI A;  3LZI A;  1RCH A;  4E7I A;  1YVU A;  4W5O A;  4CES A;  1QSS A;  1J54 A;  1ZBU A;  3H08 A;  2D0C A;  1JL2 A;  1VSK A;  1JKH A;  2BE2 A;  1KCF A;  4CEF A;  4M3Z A;  1IKY A;  2FBT A;  5J1E A;  1JLE A;  3V9U A;  1L5U A;  3UIQ A;  4FLY A;  1BIZ A;  3ZT0 A;  2JLE A;  3AV9 A;  4N5S A;  3OS1 A;  4HTU A;  1LV5 A;  3WNG A;  4RG8 A;  3B6O A;  3KLE A;  1EP4 A;  1TL3 A;  1ZBH A;  2G8I A;  4BAC A;  3HK2 A;  1K6Y A;  4XIU A;  3MEC A;  3OYC A;  1UA0 A;  4CHZ A;  3OYH A;  3IS9 A;  4C8M A;  3K57 A;  4RW7 A;  4HCB A;  4F3T A;  1X9W A;  3V1R A;  2YHB A;  4FLT A;  4F2S A;  3L2W A;  4K8Z A;  3ZSO A;  4KHU A;  2Z1J A;  3HYF A;  3VQ6 A;  3LP3 A;  2LSN A;  1S5J A;  3KLF A;  4C8N A;  4FLX A;  1RT6 A;  4F2R A;  1RTH A;  2KZM A;  4BDP A;  1RBS A;  4RW6 A;  4FJL A;  1FKO A;  4DTR A;  2BDP A;  2XO7 A;  4YFU A;  2B5J A;  4E7K A;  3WNF A;  4FJX A;  4N41 A;  5HRS A;  4R5P A;  4BWM A;  1ZBI A;  2P51 A;  2A1S A;  2ZQB A;  4EP5 A;  4JRP A;  2A1R A;  4O5B A;  1S6Q A;  1TKZ A;  1BIS A;  1KFD A;  4W5Q A;  1EXQ A;  1S1T A;  1XWL A;  2HMI A;  1EKE A;  4O0J A;  3SUP A;  4ELV A;  3QER A;  1TK8 A;  2D0A A;  4CEQ A;  4DMN A;  2QKK A;  4NCB A;  4DFP A;  3T19 A;  4M3W A;  4CER A;  3TAN A;  3CG7 A;  2HHX A;  3RR7 A;  5DK5 A;  3VQ9 A;  1NK9 A;  3NFA A;  3THV A;  1NKB A;  1YTA A;  4W5R A;  1NKE A;  4CJP A;  4ELT A;  1CLQ A;  1WSH A;  4FW1 A;  4M42 A;  3JYT A;  2PYJ A;  3VQQ A;  1XC9 A;  4I2Q A;  4E3S A;  4J2B A;  4M3X A;  4CFB A;  5DMR A;  5SWM A;  4W5T A;  3HT3 A;  4AHT A;  3CFR A;  3KKR A;  3TAP A;  4FJG A;  5SZT A;  4F4K A;  3RR8 A;  4CJR A;  4CEC A;  3VQE A;  2IC3 A;  4RW9 A;  4CFA A;  3SQ4 A;  3BGR A;  3QEI A;  4CHN A;  1RT5 A;  2WON A;  1NOZ A;  1J53 A;  1XHX A;  3U3Y A;  2P5O A;  4B3O A;  4PWD A;  3NH2 A;  4B8A B;  4CJ4 A;  4QAG A;  3A2F A;  4DSL A;  4B8C A;  4ID5 A;  4IDK A;  4CF9 A;  3S9H A;  2D0B A;  4KTQ A;  1JLB A;  3QNO A;  3PO5 A;  5D3G A;  4CF2 A;  4CJ5 A;  2WOM A;  3B6P A;  1JLQ A;  4J2D A;  4CE9 A;  1TKD A;  1BI4 B;  3ZSZ A;  3OYG A;  4N76 A;  2ZD1 A;  2KZZ A;  1BQN A;  2X6N A;  3LP2 A;  3K5M A;  1TK5 A;  3OYK A;  2G8K A;  4CJF A;  2OA8 A;  1TVR A;  4AHU A;  4CEE A;  4FM1 A;  5I42 A;  4DTO A;  3QO9 A;  3D45 A;  4AIL C;  1J9A A;  3O4N A;  3PUF A;  4OKK A;  1KTQ A;  2O4G A;  2HW3 A;  4CJL A;  2IGI A;  1TL1 A;  3VQ7 A;  1WNS A;  1WSJ A;  3O4Q A;  3O3H A;  3KD5 E;  3V81 A;  4FM2 A;  3NGZ A;  1RT2 A;  3P83 D;  4M41 A;  2XRI A;  4FZZ A;  4DQS A;  4DTJ A;  2YNG A;  3ZCM A;  3QEP A;  3OY9 A;  2PY5 A;  4DTS A;  4FJH A;  1HQE A;  4ELU A;  4IG3 A;  3SJJ A;  5FRN A;  4DG1 A;  1JL1 A;  1R0A A;  1HQU A;  3L8B A;  1L3T A;  3DRP A;  4C8K A;  4RW4 A;  4ZTF A;  3QIO A;  1BGX T;  4TSX A;  4PQU A;  3NF9 A;  1HNV A;  1ITG A;  4BDY A;  3ZT2 A;  4I9L A;  2HND A;  4OGE A;  1U49 A;  5KGX A;  3SUO A;  1LW0 A;  1Y97 A;  3AO4 A;  2KFZ A;  4CGG A;  2RKI A;  4E89 A;  3ZSV A;  3L2R A;  3S3M A;  4MQ3 A;  4BE2 A;  3KK3 A;  4PUO A;  1RTD A;  4FLV A;  2DY4 A;  3OYM A;  1NK6 A;  4M3Y A;  4B08 A;  2IDO A;  3LWL A;  4W5N A;  4FM0 A;  1EX4 A;  3VQD A;  3TAR A;  1QSY A;  4Y1C A;  3AVN A;  4FLZ A;  3RRG A;  1JXB A;  1RT1 A;  1X9M A;  4I9Q A;  1RT7 A;  3SPY A;  4FZX C;  1S1X A;  4Z4F A;  4DFM A;  3DM2 A;  1HNI A;  1TGO A;  3P1G A;  1RDB A;  3NF6 A;  3BDP A;  3E01 A;  4J2A A;  4FJ8 A;  2YNH A;  2B6A A;  3I8D A;  4DTU A;  3LAN A;  4EZ9 A;  4KI4 A;  5FRM A;  3ALY A;  4DU1 A;  5CZ1 A;  4CGF A;  2GUI A;  3DLB A;  1T8E A;  4CJS A;  4LD0 A;  3C6T A;  3VQA A;  3RWU A;  3AA3 A;  5FRO A;  2X74 A;  4DFK A;  2P5G A;  5HBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...