4CEOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceoA00
2P5GA 4IG0A 4CECA 4ZTJA 1SL1A 3L2UA 3ZSRA 1CLQA 2OPPA 3L3VA 3OYIA 2KFZA 1EXQA 1JLAA 3AO5A 3DLRA 5T7BA 4B9SA 3DRPA 3OYNA 2FBTA 3G0ZA 1IG9A 2P5OA 4KHQA 3VQPA 4IDKA 3LAMA 2KZMA 4DMNA 3KD5E 4I9LA 3QETA 2DY4A 3QIPA 4HVJA 3O4QA 4F2SA 3KLHA 2XRIA 1ZBHA 4B9LA 3VQCA 4DFMA 3I0RA 4CF9A 2NUBA 4GW6A 4O5BA 3DLHA 3JYTA 4C8LA 4FZYA 1RBUA 2WOMA 3AO2A 5FROA 1QQCA 1NK6A 5FRMA 4CF1A 4IFYA 3SQ0A 4CJSA 5K14A 4L8RB 1SKSA 3K59A 3HPOA 2DFFA 2LSNA 1W9HA 3MEEA 1NKCA 4GMJB 3VQ4A 1RT1A 2KW4A 2OPRA 4CFDA 1S5JA 4OPJA 4W5TA 1L3TA 4OGCA 1XHXA 4E3SA 3SNNA 3AVNA 3AVHA 3G10A 3NF8A 3ULDA 4DU3A 4KREA 1D5AA 3KLFA 3TAGA 4NYFA 3HO1A 1JLBA 4CJFA 3L3UA 4HUFA 3V81A 1VSEA 3KD1E 2HVHA 2ATQA 1JLCA 1U49A 4CEEA 3M8SA 1SV5A 2E6MA 4FJGA 1RILA 2ZD1A 1T7PA 4DTMA 1EETA 5J2MA 4E7JA 4B8AB 1NK8A 4M3RA 2XHBA 3V9WA 2W42A 3AVJA 3TI0A 3SV4A 4FLVA 3DRRA 1S1TA 3M8RA 1U4BA 4CEOA 3QEIA 4KI6A 4QOZB 4HUEA 1RT4A 1TL3A 4UQGA 1SUQA 4KFBA 4FK0A 2YNIA 3ZT3A 2Y1JA 4BDZA 4FK2A 1BIZA 2AJQA 2YNGA 2Z1IA 5HBMA 3WNEA 1DLOA 3KLGA 2RF2A 1SKWA 3MXMA 2IOCA 1RBVA 4ZTFA 1JL2A 4BDPA 1RDDA 2HHVA 3CFRA 3TR8A 3HM9A 4YNQA 3AVMA 2OZSA 3DLKA 3KKRA 3VQEA 3NF9A 3HT3A 5CYMA 1GOBA 3QESA 3TANA 4O55A 1BCOA 1RDBA 1JKHA 3AVBA 4CHYA 4FZZA 1X9MA 1HNIA 5C42A 3SPZA 3P83D 5SWMA 1HYZA 1S6QA 3CM6A 3ZSOA 3QNNA 1J9AA 2IC3A 1U48A 1NOYA 4B9TA 4N47A 3M8PA 3M8QA 3DRSA 3NGZA 3E01A 1J5OA 4DSLA 4FJ7A 1VSHA 2FBXA 4CGFA 4CJ3A 2DFEA 3HYFA 4CJLA 4IFVA 3RMAA 3V9XA 1RDCA 1VSKA 4CE9A 2RPIA 3LP0A 1XC9A 3OJSA 4C8MA 4BDYA 4FCYA 1N5YA 3OYGA 1KCFA 3NF6A 1XWLA 4BWJA 3NBPA 4E1NA 2IAJA 3VQ9A 3U3YA 3PX6A 3NFAA 4CJUA 3VA0A 1IH7A 4CJTA 4NYNA 4FZXC 3SQ1A 1TK0A 4KTZA 1WSGA 1T05A 1NK7A 3AV9A 4BWMA 1TK8A 4M3UA 5KGXA 3L2VA 1HYVA 1W0HA 3MECA 2XY8A 1QSYA 1KSPA 4CK2A 2ZE2A 4O0IA 2JGUA 2A1SA 1ASUA 3L2QA 3PUFA 4FLYA 5CY4A 3NE6A 2HNYA 4HUGA 1B9DA 2BGGA 1TKXA 4K8XA 1BGXT 3OYLA 2KTQA 4M3YA 3F9KA 3KLEA 3C6TA 4DTRA 1RT3A 3HP9A 4BACA 4FJMA 5JS1A 3AA3A 3LAKA 1VSLA 1A5XA 1WNSA 3KK2A 4BE0A 2HHSA 3AO1A 3EY1A 4CGDA 4W5QA 2EX3A 1SKRA 2PYJA 4CCHA 2HHWA 4W5NA 3OY9A 2HHTA 4CEFA 1UOCA 1WSEA 4F4KA 1Q9XA 3HSTB 3DYAA 4DQQA 1IKVA 3V4IA 4M3WA 1BIUA 1LW2A 1JLGA 1RT7A 4DS4A 3SPYA 4ELTA 2QKBA 1VSMA 2R7YA 2Q3SA 3ISNC 1HNVA 4AHTA 1WN7A 4DSKA 4KKOA 4H8KA 3K5NA 3SUQA 1RBTA 2HNZA 4MQ3A 4Z0UA 2GUIA 4FJ5A 3SQ4A 4N56A 4HTUA 2YV0X 1HQEA 3AA5X 4LY7A 5KGWA 3TWHA 1TV6A 4DQPA 3QERA 5CYQA 1L3VA 4FYDA 4CGGA 1RDAA 4Z4HA 1TKZA 3ZCMA 3ZT0A 1JLQA 1C6VA 1UAXA 4EP4A 2E6LA 1EP4A 1L3UA 2EHGA 1FK9A 3CM5A 4KRFA 4OGEA 1FXXA 2WONA 3DM2A 3HPHA 4OKJA 4J2AA 1D9FA 4F2RA 1REVA 1WSJA 1IKWA 3LP2A 4CGJA 2D5RA 1G15A 5HLFA 4QCLA 3IAYA 2X78A 1LWEA 3HPGA 4FW1A 4DFPA 4DF8A 2ITGA 4BE2A 4OLAA 3KKSA 1UA1A 4M42A 4E19A 4FJJA 1TAUA 1JLEA 2HMIA 4LSLA 5KI6A 1CXUA 3TAQA 1NKBA 3OYMA 3I8DA 1ASVA 4E0DA 4B9VA 4CJEA 4E89A 4NCGA 4KTWA 4E7IA 4H4MA 3LDSA 1TKDA 1IO2A 5C24A 3MAQA 1FKPA 3OYJA 4DSFA 1BQMA 1TAQA 1JLFA 1HRHA 1WAJA 4F3OA 1VRUA 4CK1A 4I9QA 3PO4A 4ID5A 2E4LA 3NAEA 1YT3A 1B9FA 2OPQA 5HRSA 1WSIA 1Z25A 5J1EA 3OYCA 4OLBA 3NDKA 4NCAA 4RW6A 3U3GA 1NK4A 1A5VA 1XHZA 4HCCA 4KHNA 4RW4A 4Z4GA 1KVBA 4OJRA 4W5RA 1ZBIA 3TABA 3RRHA 1B92A 3K5LA 1NJWA 1L3SA 3SI6A 3AO3A 4QAGA 3O3GA 4CHPA 1HQUA 3NH0A 1LV5A 1QSLA 4LD0A 3LWLA 4AH9A 4JRQA 2VWJA 2G8VA 3OS1A 4M3XA 1IKXA 2YHAA 3RMCA 4KO0A 4ZHRA 2FBVA 3SUPA 1SL2A 2F8SA 3CYMA 1RCHA 2PYLA 3HVTA 4HHTA 3VQAA 1BCMA 1S1XA 3V1OA 5E41A 3S3MA 4AILC 4KB0A 2VG5A 4AHCA 2GBZA 1J53A 1RTHA 2IS3A 2G8WA 1WSHA 2KQ2A 3K2PA 4AHSA 4CGIA 1ZYQA 1VSFA 4H4OA 5I3UA 4AHRA 3IRXA 4CFBA 4CFAA 4OKEA 4KHUA 4KB1A 3LALA 3U6FA 3PV8A 2HVIA 5FRNA 4CJRA 3AVGA 1QHTA 2X6NA 4FJIA 4PY5A 3ZSWA 3S3OA 3ZSZA 2OYQA 1S1WA 3UIQA 3QINA 5J2PA 1N6QA 4NCBA 1WLJA 1GOAA 4FXDA 1QE1A 3VQQA 2ETJA 5FDLA 3LZJA 3ZSXA 3SUOA 3SQ2A 1J54A 1TKTA 3DLGA 4ICLA 4DU4A 4DLGA 3RTVA 1RBSA 3QEWA 1YTUA 1I39A 2QK9A 1KLNA 1GOCA 4KHWA 4M3ZA 5CZ2A 3ZT1A 5HRRA 5JS2A 2F8TA 3ZSYA 5J2NA 4LH5A 3V1QA 4WE1A 4I2PA 4CJ5A 3DOKA 2P51A 5KRSA 4Q0BA 3AA4A 5HRPA 3EZ5A 4CEZA 2HHUA 1BL3A 3AVLA 1QS4A 4DF4A 1X1PA 1YVUA 2KFNA 3IG1A 4DU1A 4KPYA 4M3TA 3AVCA 4MFBA 4K8ZA 4CHZA 1LW0A 3HVRA 1C0UA 2VG7A 2BANA 2QXFA 1C1BA 3LWMA 4BE1A 3LP3A 2PY5A 3NH1A 1BISA 4JRPA 1TVRA 4FJKA 1Q8IA 4FLZA 4DSEA 3ITHA 1S9GA 2X74A 1RT6A 2YNHA 4CIGA 3HXMA 4DG1A 1FKOA 2XY6A 3QIOA 1YTAA 1KFSA 1HMVA 2B5JA 4RW9A 4DTJA 3TARA 4Y1CA 1S9EA 2BDPA 3NGIA 4FJHA 3K5MA 3VQ5A 4F8RA 4ELUA 5CZ1A 4DTSA 4FK4A 4M45A 3WNGA 3RMBA 3D45A 1KRPA 4GVMA 3V6DA 2KZZA 4B8CA 1K6YA 4DLEA 4G1QA 1VK0A 1HPZA 4B3OA 1F21A 3F73A 2B6AA 1TK5A 3V9UA 1EKEA 4CIEA 1D8YA 3DOLA 1JXBA 3DMJA 2YKMA 4CJVA 5SZTA 3PX0A 4N41A 4IG3A 2O4GA 1CZBA 1RTIA 3BGRA 4DSIA 4O4GA 2G8FA 1KVAA 2D0CA 1D9DA 3K5OA 1X9SA 3MEDA 4C8NA 3OYBA 2XY7A 4Z4CA 5I42A 2A1RA 3KJVA 4KI4A 1BI4B 5J2QA 1HJRA 2IGIA 3L8BA 3AVKA 1LAWA 4RG8A 3CFPA 2HHXA 3C94A 5EU7A 4KV8A 4CF8A 1DTQA 3OYAA 1U45A 3RRGA 4JS4A 3V9ZA 4DFJA 1C1CA 3L2WA 3DI6A 4LSNA 3HJFA 1JL1A 3SV3A 4CEBA 3THVA 3DLEA 4FW2A 3OVNA 4B08A 5C25A 5KTQA 3D0PA 3A2FA 3VQ7A 3LANA 3VQ8A 3ZSQA 4YFUA 4DS5A 4DTOA 4DTPA 3QNOA 3I0SA 3PX4A 4Y1DA 2JLEA 3MXIA 1NK5A 4EZ6A 4FLWA 1RBRA 2OPSA 1X9WA 3RWUA 4C8KA 4DQSA 1TL1A 2Z1GA 2D0BA 3KLIA 3P1GA 3QO9A 2D0AA 3MEGA 1LWFA 4ID1A 3SCXA 1ZBUA 2QKKA 4HCBA 2HNDA 4CF2A 2Y1IA 2G8UA 1KTQA 4Z4FA 3AO4A 2O4IA 4DQIA 3RR8A 3TAPA 1DTTA 3NF7A 3OJUA 4FJ9A 4KAZA 3AVIA 3NHGA 4FLTA 3OYKA 3C95A 3TAMA 3QEVA 1Y97A 3H08A 1MU2A 4OVLA 3CG7A 1LWCA 1U47A 3VQBA 1VSDA 1IKYA 4CJKA 1I3AA 3NGYA 4CK3A 4EP5A 2HW3A 3BDPA 4ELVA 3HK2A 1S1VA 3KIOA 1RNHA 1C1AA 3VQ6A 4E7HA 3WNHA 1LAVA 1C0MA 4CHNA 3PY8A 5HROA 4FVMA 3PO5A 3TAEA 1RTJA 4FJXA 1KFDA 4XIUA 2G8KA 4DFKA 4FM2A 4J2BA 2HHQA 3SYZA 1SL0A 1S1UA 1JXEA 4CJ4A 4CEQA 3B6PA 1U04A 2DFHA 3IS9A 3K58A 4FM0A 3SJJA 4CIFA 4PA1A 4R5PA 1VSJA 2XY5A 3CQ8A 1ZBLA 1XI1A 1Q9YA 4FJLA 2P1JA 1BQNA 3TAFA 3OS2A 1QSSA 4KTQA 4PWDA 3JSMA 3ASMA 3QEPA 3O3HA 4EZ9A 3EYZA 4PQUA 2BE2A 3AVAA 4CHOA 3NH2A 3OYHA 4OPKA 4DWIA 1KVCA 2ZQBA 4DTNA 4CFCA 4CEAA 1UWBA 4J2EA 3NCIA 1BHLA 4N76A 2B4JA 3FFIA 3ALYA 4O44A 3ZT4A 4RW8A 5HRNA 3T1AA 3WNFA 1TGOA 2OA8A 2PZSA 3V9SA 4PUOA 3ZT2A 3OS0A 3AA2A 3S3NA 3OYDA 4FM1A 4CHQA 2YKNA 1RT2A 2YNFA 3VN5A 2OZMA 1CZ9A 5DMRA 4Q5VA 3B6OA 4RW7A 1BI4A 4FJ8A 1WSFA 3OYEA 4FLXA 4Z4IA 4IKFA 2YHBA 3RR7A 2DTUA 3V1RA 1HYSA 1NJXA 4F3TA 4KHYA 4IBNA 4E7KA 2G8IA 3QEXA 2GV9A 1NJYA 5HP1A 1NJZA 3HP6A 3LPTA 4I2QA 4KHSA 1ITGA 2FC0A 4O0JA 3MXJA 1QTMA 1NK0A 1VRTA 3S9HA 4JLHA 4CJQA 3RMDA 4DSJA 3P5JA 3T3FA 3CFOA 3L2RA 4E7LA 4C8OA 4AHVA 4Z4EA 1KLMA 3O3FA 1ASWA 5D3GA 4B9NA 1ZBFA 2VWKA 3SUNA 3C6UA 2I5JA 3DLBA 2VG6A 4I7FA 3KTQA 1NKEA 1WAFA 4OKKA 4DTUA 3HL8A 4DQRA 2F96A 1EX4A 3LP1A 1UA0A 1R0AA 4B9UA 5KRTA 1NOZA 1A5WA 4FLUA 2X6SA 3O4NA 4FJNA 4M41A 1C0TA 3T19A 4CGHA 3KK3A 2Z1HA 3LPUA 3KK1A 1RTDA 4AHUA 1T03A 3AVFA 4E1MA 3ZSVA 3LZIA 1CXQA 3VA3A 4W5OA 4CJPA 1Z26A 1S6PA 4TSXA 3QLHA 2HB5A 2RKIA 3K57A 2G8HA 3OYFA 4JS5A 4J2DA 2IDOA 1RT5A 4CERA 4N5SA 4B9MA 4CESA 4DTXA 2RN2A 1L5UA 3SZ2A 4CEDA 5DK5A 3VQDA 1VSIA 4LH4A 4CF0A 2Z1JA 1NK9A 1T8EA 4CJWA 2XO7A 1O1WA 2FBYA
chains in the Genus database with same CATH superfamily
1X3MA 4IG0A 3ZSRA 3AO5A 5T7BA 4JKBA 2FBTA 1IG9A 5AFUA 3VQPA 4IDKA 3LAMA 3ZEUB 3MDQA 3DXMA 2VWBA 3GG4A 5B8HA 2XRIA 1ZBHA 4CF9A 5ELZA 3DLHA 4K42A 2WOMA 3AAQA 1NK6A 3H3OB 4FL9A 4CJSA 5K14A 4L8RB 3CJCA 1WB9A 1W9HA 3E9PA 5JVHL 4GMJB 1R59O 2KW4A 2OPRA 3T7ZA 4OPJA 4W5TA 3A8YA 2FF3B 1V4TA 3AVNA 3DXKA 3ENHA 3ULDA 5AQTA 4JI2K 3HO1A 3GBTA 1X9JA 3L3UA 4HUFA 3V81A 2ATQA 2E6MA 4IEIA 1RILA 1T7PA 5J2MA 4B8AB 4M3RA 2XHBA 5BR8K 3TI0A 4A2BA 4NO7A 3VOVA 1S1TA 3FZKA 2P9IB 3M8RA 4DV2K 4KI6A 3QICA 4HUEA 3PLAA 2F7TA 4CI6A 4KFBA 3ZT3A 1OVQA 3TSUA 2YNGA 3A5OC 4B1UB 4DUZK 5F1XA 2RF2A 4DV0K 3J7AP 1RDDA 3CPWM 5IWAK 3TR8A 5F0XA 3KKRA 5C0YA 1GOBA 3TANA 3MX2A 1BCOA 4A61A 2FLOA 2CGKA 1HNIA 3SPZA 3P83D 5SWMA 1HYZA 3CM6A 2ASMA 4BRCA 3E01A 2NRTA 3GOIA 4CJ3A 4CJLA 3V9XA 2RPIA 5FLXO 4C8MA 2GWJA 2HBKA 3H1VX 1KCFA 1QVFM 4KH4A 5CE3A 1Q82O 3PX6A 4E1NA 3NFAA 1IH7A 4NYNA 1TK0A 1HX1A 3QFPA 1QSYA 4LF9K 3VEVA 2ASPA 4O0IA 2JGUA 1ASUA 4BVOA 5KPTA 3L2QA 5AQSA 3NE6A 3O9QA 3L6QA 4K8XA 3OYLA 4M3YA 3KLEA 4BRNA 4DTRA 4GVEA 5FPDA 3LAKA 1BA0A 2HHSA 2HBLA 2P9UA 4DR3K 4CGDA 1NGHA 2HHWA 2HHTA 2FF6A 3BZKA 1Q9XA 3HSTB 3ATUA 5AQHA 1IKVA 4ELTA 2VYPA 3SPYA 3CETA 1O13A 1HNVA 2W6KA 1WN7A 4AHTA 3SUQA 2HNZA 4X64K 3J7ZO 4N56A 2YV0X 1Q81O 3KWIA 4LY7A 3TWHA 4DQPA 1KAXA 4CGGA 1IJJA 4Z4HA 4YOYA 1JLQA 1HUXA 1UAXA 4JHDB 1EP4A 3WEEB 2KHOA 1REVA 1WSJA 2D5RA 2O8BA 1RDUA 3UB5A 3IAYA 4JKFA 4DF8A 3HPGA 1GLLO 3VEYA 4BRIA 4EIAA 4JI8K 1MWMA 4M42A 1JLEA 1SQKA 3MK6A 1CXUA 3MN7A 3OYMA 4E89A 4KTWA 4E7IA 1SZ2A 3K9KA 3UKRA 1HRHA 4GV6A 4CK1A 5C12A 4B3RK 4OLBA 1GLEG 4RW6A 1NK4A 1XHZA 3G25A 3TABA 3K5LA 1L3SA 5AQFA 3AO3A 3LDPA 3NH0A 5AQZA 3ID8A 2VWJA 1MDUB 2YHAA 4DV6K 2ZJPL 2HMPA 3O5BA 4ZHRA 3THYB 3CYMA 1NGAA 5E41A 4KB0A 1HNXK 3ZX2A 2G8WA 4CGIA 1ZYQA 4AHRA 4CFBA 4CFAA 2E2OA 4FO0A 2E20A 4CJRA 1QHTA 2QWQA 3ZSZA 4JKCA 2ETJA 3EE9A 4H03B 3ZSXA 1TKTA 4B1YB 3RTVA 1N8RO 1RBSA 3AY9A 3QEWA 1I39A 1YTUA 4KHWA 4M3ZA 2F8TA 3ZSYA 5J2NA 1VQKN 2V51B 4I2PA 1HNZK 4Q0BA 3CQYA 3AVLA 2FSKA 2KFNA 4EAHD 2JWKA 4BE1A 4H0VB 3VETA 4DR4K 1RT6A 2YNHA 4CIGA 3HXMA 3HBTA 1FKOA 3SAFA 2XY6A 3QIOA 4K25A 1KFSA 3FR0A 2B5JA 1ATRA 1Z05A 1S9EA 1Q86O 3VGKA 3RSEB 3EEQA 3RMBA 3SMSA 3V6DA 4MDBA 1TYQA 4RTFD 4BRKA 1D8YA 4JKAA 4IJAA 3DOLA 2YKMA 3DMJA 2V7ZA 2BTFA 3THWA 4FWQA 1RTIA 3BGRA 2J4RA 5AQJA 3R8EA 2D0CA 4BQZA 1H1VA 1X9SA 4JI0K 4ILGB 4Z4CA 2XY7A 3LM2A 2IGIA 3AVKA 4RG8A 3CFPA 5EU7A 4KV8A 5FPMA 4CF8A 2D0PA 3RRGA 3SMPA 2ZJRL 4JS4A 3S41A 4JI1K 4JEPA 3U4LA 4EFHA 4FW2A 5GIOA 3PSFA 3A2FA 3VQ8A 3LANA 4YFUA 4DS5A 3QDKA 2JLEA 4FLWA 1VQ8N 4GY2B 4YORA 4C8KA 3P1GA 3MEGA 3SCXA 1LWFA 4Z4FA 2O4IA 2G8UA 1KTQA 3AO4A 2KKZA 3RR8A 3EN9A 3TTFA 3OYKA 3C95A 3TAMA 4FVUA 5GAGP 1LWCA 1BU6O 2ITMA 1I3AA 1DEJA 4CK3A 1NMNA 1NG9A 3BDPA 4ELVA 3HK2A 1S1VA 3VQ6A 4OPHA 1LAVA 2F9TA 2UXDK 1FJGK 3TAEA 1RTJA 2G8KA 5F2RA 4FM2A 3FZMA 1SL0A 2I7PA 4LF4K 1QQNA 4CEQA 3BF1A 4G9ZA 1U04A 2DFHA 4FM0A 1XMQK 1Q9YA 4FJLA 3TAFA 1JCFA 3QEPA 3O3HA 3TSPA 3ATVA 3AVAA 3EL2A 3NH2A 2ZQBA 3ID6A 4CFCA 4JK8A 5DM6L 4IOCL 3WXKA 4DTNA 3CXCM 2B4JA 3WXMB 5HRNA 2ZF5O 4FWNA 5LL6Z 2A6AA 4YDUA 2YHYA 3OYDA 4CD1A 1DKGD 3O1WA 2QM1A 3OHRA 3VN5A 4Z4IA 1BI4A 1WSFA 4O5FA 4FLXA 2YHBA 3RR7A 5GIPA 4KHYA 4IBNA 5GAHP 4FOEA 4B3TK 2GV9A 3D2EA 4PKIA 4IEEA 4CBUA 5BRFA 4CJQA 4Z4EA 4BVPA 5D3GA 2P9UB 2VWKA 3O8MA 3C6UA 2O8CA 2BUPA 5C15A 1W2BM 1NKEA 3E9OA 1R0AA 3O4NA 2WUSA 1Q18A 2CH6A 2Q31A 4AM6A 4FJNA 2HHHK 1NGIA 4FWLA 4A62A 4DUYK 5EY4A 5AQVA 3KVGA 3O1BA 2G8HA 3AAPA 2IDOA 1RT5A 1K9MO 1NMDA 3MCAB 1L5UA 2Q36A 5DK5A 3VQDA 1U2VB 1VSIA 1BWFO 4GKKK 4ILHA 1NGBA 3RVCA 1YITN 3SAGA 4ZTJA 1SL1A 1RGIA 2OPPA 3L3VA 2O8BB 1JLAA 3DLRA 3H3NO 2ZJQL 3OYNA 2FXUA 4XH4A 3KD5E 2E2NA 3OA9A 4HVJA 2H3GX 2OTJN 3QBWA 2NUBA 3CMAN 1TYQB 4QS9A 4FZYA 3AO2A 3CJ9A 5AZIB 3P38A 4EHTA 4KHPK 5ADXH 3VF6A 1NKCA 4CFDA 5KQDA 4E3SA 1D5AA 3KLFA 1VQ9N 4XEIA 2AP1A 3SBGA 4CJFA 3KD1E 1U49A 3M8SA 4BRPA 1EETA 2W42A 3AVJA 1RFQA 2QWNA 2QWMA 1QHAA 3QEIA 1RT4A 1SUQA 4FK0A 2YNIA 3WNEA 4DHYA 1SKWA 3MXMA 1VAZA 1JL2A 2HHVA 3AVMA 2OZSA 4MLEA 3DLKA 3QESA 1BO5O 4ILJA 1X9MA 5C42A 4BQLA 1S6QA 3ZSOA 1NOYA 2QA4N 4DSLA 4N47A 3LDQA 3NGZA 4FJ7A 1VSHA 1J6ZA 3QB0A 2DFEA 3HYFA 4KH6A 4DR2K 1RDCA 4DQ8A 4CE9A 1XC9A 4FCYA 4BDYA 1S72N 2UXBK 4ISEA 3VGLA 3NF6A 1XWLA 4JHDA 2NNWA 3MN6A 4BWJA 3U3YA 1OH5A 3VQ9A 1VQMN 4CJUA 4X66K 3GDQA 4Y0WA 4BRLA 4M3UA 5KGXA 1C0GA 5C2DA 1HYVA 1W0HA 2UUAK 3CERA 1EO1A 3PUFA 4FLYA 5CY4A 4HUGA 2QWOA 1OH7A 3FE1A 3E66A 3F9KA 3C6TA 1RT3A 3AA3A 3A0IX 1A5XA 1WNSA 3AO1A 4W5QA 1SKRA 4W5NA 4CCHA 3OY9A 2HSTA 4U7BA 1IG8A 1UOCA 3I8BA 3DYAA 2QKBA 3HRGA 4WYBA 1WBDA 4O8KA 4H8KA 4Z0UA 4MQ3A 3SQ4A 3LDNA 3P39A 4HTUA 1GLFO 2E5LK 5KGWA 1TV6A 3QERA 3ZCMA 3C7NB 1S3XA 2E6LA 1KQSM 3CM5A 3HM8A 4JAXA 3DM2A 3O9RA 4J2AA 3LP2A 4CGJA 1G15A 1Q7YO 3O08A 4DFPA 2ITGA 4PKGA 3KKSA 1TAUA 2WBNA 4LSLA 4CJEA 4NCGA 4H4MA 1TKDA 5C24A 3OYJA 2WTUA 1JLFA 4E1JA 4I9QA 3F2KA 4ID5A 1YT3A 2OPQA 1WSIA 1SS6A 3OYCA 3NDKA 4NCAA 1T3VA 3C7NA 4OJRA 1ZBIA 1DT9A 3RRHA 1B92A 5LJWA 4KHNA 1LV5A 5M1FA 1LCUA 4ISGA 3MN9A 1IKXA 3LL3A 3BP8A 3RMCA 4FWKA 2QWPA 1WUAA 2F8SA 1GLCG 1RCHA 4JKGB 4IXCA 3VQAA 1J53A 3MX5A 2A3ZA 2KQ2A 3BY5A 2NRWA 1VSFA 4H4OA 1GLJO 4BR0A 4V19S 3LALA 4BRAA 3U6FA 2HVIA 5FRNA 2W6LA 3AVGA 3ZSWA 5ADXA 2QW9A 1S1WA 5J2PA 1QE1A 3D7EO 3LZJA 3N4QA 1VQ6N 4ICLA 3BF3A 3KWGA 1M1KO 2QK9A 3WXIA 2A42A 1I94K 3V1QA 4WE1A 4CJ5A 1BG3A 4IWVA 1BA1A 2P51A 3EKSA 2ZM6K 3IDHA 4QS7A 1XMOK 2GEMA 5GAEP 2YI1A 1IBKK 3SLCA 4FWSA 4M3TA 3AVCA 4MFBA 4K8ZA 4BC4A 3ULEA 3VF2A 3LP3A 5M1QA 3CJ7A 2PY5A 3NH1A 5AQLA 4K41A 4JI4K 3MCPA 2QEXN 3ZX0A 4DG1A 3WXJA 5M1PA 4DTJA 4RW9A 4Y1CA 5AQGA 3NGIA 2E88A 1HPMA 2QXLA 4FSVA 1VHXA 2QI2A 4LFCK 4G1QA 3FFKB 1TK5A 3L4QA 1EKEA 4CIEA 3V9UA 2Q97A 5SZTA 3PX0A 4N41A 1XNQK 3VENA 4I6MB 1HNWK 1CZBA 4DSIA 4RWTA 1BDGA 4MO4A 4CW7B 1T6CA 3FZLA 2O8FB 3BUZB 4H5NA 3KJVA 3L8BA 3ZEUA 1LAWA 2WFBA 2HHXA 3TTDA 5BN9A 3OYAA 4C23A 1C1CA 5BR9A 3DI6A 1TUYA 3HJFA 1JL1A 3SV3A 3OVNA 5C25A 5KTQA 3HOTA 2OYQA 4EZ6A 3K0SA 1RBRA 2F9WA 2OPSA 2NLXA 1X9WA 1NGCA 3RWUA 4CEZA 3QO9A 4HCBA 5AQYA 3A5LC 4DQIA 3NF7A 3OJUA 3AVIA 4FLTA 3LDLA 4OVLA 1G99A 2KLAA 4IJNA 4DR6K 4OO1J 3NGYA 2HW3A 1QZ6A 4CBWA 3JXUA 4L3QA 4XH5A 4MDAA 1C0MA 5HROA 4A5AA 3PO5A 4XIUA 1YJWN 1NM1A 3C0BA 3CI5A 2A5XA 1JXEA 4CJ4A 3F5TA 2YJFA 3K58A 3K9JA 3HSCA 4CIFA 3SAHA 1VSJA 1ZBLA 2OANA 4BC2A 5LMNK 2O8CB 3OS2A 4PWDA 3ASMA 4PQUA 2BE2A 5E84A 4CHOA 4BG8A 4DWIA 4OPKA 4JD2B 1KVCA 5BRHA 4CEAA 2VQFK 2IIRA 1BHLA 2E2QA 3J80O 3DXMB 4IOXA 2OA8A 3WNFA 4BG9A 3FZFA 4PUOA 3ZT2A 3KK7A 3AA2A 3S3NA 4B3MK 3ENOA 3LDOA 4CHQA 1W97L 2YKNA 2YNFA 1CZ9A 1HLUA 2EWSA 4BY9C 1YIJN 1ILYA 4IKFA 1X3NA 3V1RA 3AGRA 2E1YA 4BR4A 4F3TA 3PIOL 1YUWA 3QEXA 3C65A 3MMVA 3OW2M 4I6MA 1NNEA 5A2QO 1NJZA 3LPTA 3WEEA 4H0YB 3VEWA 3H45C 4O0JA 3M6GA 3HOSA 4JLHA 4IO9L 4JI3K 3ZYYX 2HF3A 3CMEN 3P5JA 4CZLA 1XC3A 3CCQN 1KLMA 1YJ9N 1ASWA 2GELA 3FLCO 4WQ5A 5BN8A 1K8KB 4OKKA 4DTUA 1UA0A 3M5RA 4BRFA 4M41A 5CR4A 1C0TA 1KAZA 3T1YK 3LPUA 3KK1A 5TKYA 4AHUA 3H46O 1V4SA 4WF9L 3VA3A 4W5OA 3CCMN 2O8DB 3K57A 4JS5A 1ATSA 4B9MA 4DTXA 1JCGA 4BC5A 4CEDA 5I9EB 3CCUN 1E3MA 1NK9A 3CCEN 2ZWHA 5AQIA 4CECA 2O8DA 1EXQA 3DRPA 3G0ZA 4KHQA 2P9PA 4BGAA 1P90A 2RE2A 4DMNA 4K43A 4F2SA 4GV3A 1VQON 5JMVA 4GW6A 4O5BA 4CZMA 3JYTA 3O80A 4H0OA 4CF1A 4IFYA 3SQ0A 1NJIO 3MEEA 3U9ZA 1XQSC 1S5JA 3C6AA 3SNNA 3G10A 3AVHA 3NF8A 3T1HK 3A5MC 3TAGA 4DR1K 4NYFA 1JLBA 5AQOA 1M90O 1VSEA 2P9KB 1JLCA 4HWIA 4M63C 3TTCA 4WCEL 4WQ4A 4DTMA 4E7JA 4A5BA 3V9WA 3SV4A 4FLVA 4DR7K 3JS6A 1U4BA 4QOZB 2A41A 4UQGA 2Y1JA 4FK2A 4BDZA 1BIZA 5HBMA 3F9MA 4DKWA 1DLOA 1KD1O 1RBVA 4ZTFA 4BDPA 3G4SN 4WQ5C 2PFUA 3HM9A 4KH5A 4YNQA 4B1WB 3WXLA 4KBOA 4LFAK 4BRMA 1RDBA 1YXQA 3QNNA 1U48A 1J9AA 2IC3A 5GINA 3M8QA 3QMLA 1WOQA 3OJSA 3J7YP 2V7YA 1N5YA 3OYGA 1KXPA 4YOXA 4DV4K 4CJTA 4FZXC 3SQ1A 4OX9K 3E1YA 4KTZA 1T05A 3AV9A 4BWMA 1TK8A 4O8UA 4A57A 1KSPA 2A1SA 3G6EN 5M1KA 1RDWX 3PIPL 1ZBSA 2VGNA 1BGXT 3EZWA 3T69A 3FZHA 3HP9A 4BACA 4FJMA 5JS1A 1VSLA 1VQ4N 2W41A 2EX3A 2PYJA 3D2FB 4MO5A 3CIPA 4DQQA 4M3WA 1BIUA 1LW2A 1JLGA 1RT7A 4DS4A 3DJCA 4BRQA 1JJ2M 3ISNC 4DSKA 2E1ZA 1IV0A 3VESA 2YHWA 4JI7K 4FJ5A 1HQEA 3AA5X 5CYQA 1L3VA 4FYDA 2UXCK 1RDAA 4LF5K 3M3ZA 3SJHA 1MWKA 4HTLA 3ZETB 1FK9A 3TPQA 3HPHA 5AQKA 2IVNA 1IKWA 4BRHA 4CBXA 5HLFA 2X78A 1LWEA 4FW1A 1VQLN 2FSNA 1UA1A 4FJJA 3I8DA 1ASVA 4E0DA 3GE1A 3DLLL 3LDSA 1ZXOA 3R1XA 1TAQA 1WAJA 3WQTA 4F3OA 5AR0A 1IBMK 3NAEA 1B9FA 5HRSA 1YI2N 5J1EA 3U3GA 4HCCA 4RW4A 1OKJA 4W5RA 3UE5A 1P8ZA 1NJWA 3SI6A 4QAGA 3O3GA 4CHPA 1HQUA 3VMFB 1QSLA 2HBMA 2G8VA 4BGBA 3OS1A 1LOTB 1XUPO 4KO0A 3SUPA 2FBVA 4JV5K 5M1NA 1BCMA 3S3MA 4AQYK 1RTHA 2IS3A 4PL7A 1WSHA 3K2PA 4AHSA 5I3UA 3IRXA 4KHUA 3E9LA 4KB1A 4CZEA 3R3LA 4FJIA 4PY5A 1VQ5N 3UIQA 4CZGA 1WLJA 1GOAA 4FXDA 5CHIA 3VQQA 3SUOA 3SQ2A 4BC3A 2NRZA 3DLGA 4DU4A 3DXKB 4DLGA 4BROA 1EWQA 3P4IA 1ZC6A 5CZ2A 3ZT1A 5HRRA 3UKUB 3CCRN 5TKWA 4LH5A 2HOEA 1XNRK 3I56N 5KRSA 3AA4A 5BPNA 4FPBA 1BL3A 4PL8A 4DF4A 3PSIA 1X1PA 1YVUA 3IG1A 4AM7A 4DU1A 4GV9A 2QXFA 1C1BA 4RCHA 4H5WA 3LWMA 2UU9K 4DR5K 1BISA 4FJKA 4DSEA 3ITHA 3CJAA 2QTDA 4YOTA 4FJHA 3K5MA 5KPZA 4F8RA 2YJEA 5CZ1A 4FK4A 4M45A 3HTVA 5KPRA 3D45A 1KRPA 4B8CA 2F4VK 1VK0A 4B3OA 4YDUC 5HOOA 1U2VA 4CJVA 4IG3A 2OTLN 2O4GA 2HBJA 2Q1NA 5H1SQ 5AQQA 2G8FA 3R6MA 1KVAA 3H6EA 3MEDA 3H1QA 4CZIA 4KI4A 1BI4B 5J2QA 3C94A 1U45A 1DTQA 2ASOA 3I33A 3V9ZA 4DFJA 3L2WA 4EHUA 4CEBA 3D0PA 3VQ7A 4GKJK 4DQSA 3TU5A 5EOYA 2D0BA 3KLIA 4ID1A 2QKKA 2HNDA 4CF2A 2Y1IA 2O8FA 1NGDA 5AQNA 1DTTA 3IFRA 1DGKN 4F9OA 1MU2A 1TUUA 3NMUA 4JKHA 3VQBA 1IKYA 2P9KA 4EP5A 4E7HA 2OCEA 4H5VA 4CHNA 2A40A 3PY8A 5MLCQ 4FVMA 5IT9O 4IFEA 5BPLA 4FJXA 4DFKA 4BR7A 4J2BA 3SYZA 4DB3A 4M7XA 4QS8A 3B6PA 5AQWA 3TSQA 3DAWA 3IS9A 2Q0RA 4NB4A 3SJJA 4LFBK 2P9SA 4R5PA 4PA1A 3CC2N 4WFBL 4K0KK 3W3DA 2P1JA 5EXWA 3JSMA 3J81O 3QFUA 1VQNN 1HKGA 5AFUH 1T6DA 3CPEA 1UWBA 1NBWA 2GX9A 3O6WA 3NCIA 3FFIA 4JNEA 3ZT4A 3ALYA 4O44A 3ZETA 3V9SA 2WC9A 4BR9A 3O9TA 2OZMA 4JKGA 4Q5VA 3U9DA 3IMXA 3OYEA 2GUPA 4A59A 1HYSA 1NJXA 2UUCK 2E8AA 2PAVA 4X62K 1VQPN 1NJYA 5HP1A 3SBTA 4PHTX 1ESVA 3SK3A 3HP6A 1Z6RA 4I2QA 1KAYA 3CCLN 4PKHA 3CHWA 3MXJA 1VRTA 3RMDA 3LM9A 3CFOA 3L2RA 4E7LA 4AHVA 4NLCA 3KZBA 4WQ4C 4B9NA 1VQ7N 1T44A 2VG6A 3DLBA 1YJNN 3KTQA 1WAFA 4JI5K 4DQRA 2F96A 1EX4A 3VTHA 1NOZA 4CZFA 2GTDA 1HKBA 4CGHA 2NRVA 3KK3A 1RTDA 3I55N 3AVFA 3ZSVA 2YHXA 4CJPA 1Z26A 1S6PA 3QLHA 2RKIA 1HKCA 4CERA 4N5SA 2RN2A 4XH1A 4JN4A 3OBWA 3THWB 4LH4A 5JICA 4CF0A 2D0OA 2Z1JA 5C10A 1T8EA 4CJWA 2IVPA 3VERA 1GLAG 2XO7A 1O1WA 3VEOA 1T03A 2P5GA 3MN5A 3L2UA 1CLQA 3OYIA 2KFZA 2NRXA 1OH6A 2UYTA 4B9SA 1YF5L 3ULEB 2P5OA 1WBBA 1OVYA 5AQXA 3G71N 2UUBK 2V52B 4LF7K 2KZMA 4I9LA 3QETA 2DY4A 3QIPA 3O4QA 3VTIA 3KLHA 4A2AA 1JCEA 1K8AO 4B9LA 3VQCA 4DFMA 3I0RA 2D1KA 4C8LA 4X65K 1RBUA 2DPNA 5FROA 1QQCA 5FRMA 3RSEA 2P9IA 3MWTA 1Y64A 1SKSA 3K59A 3HPOA 1NWKA 2DFFA 2LSNA 3VQ4A 1RT1A 1L3TA 4OGCA 5EVZA 1XHXA 3D2EB 4DU3A 4KREA 3R9PA 5EX5A 2HVHA 4CEEA 1SV5A 4BREA 4FJGA 1QQMA 2ZD1A 1NK8A 5DM7L 4CZKA 3P31A 3DRRA 2YX6A 2FSJA 4CEOA 2AA4A 1TL3A 4J8FA 2YCHA 2AJQA 3CCVN 5FPNA 2Z1IA 4DV1K 4B3SK 4CD3A 4JYAK 3KLGA 2IOCA 4JKDA 3KHYA 1FW6A 3CFRA 1J5EK 3VQEA 1EQYA 3NF9A 3HT3A 4H5TA 5CYMA 3CD6N 4O55A 3AVBA 1JKHA 4CHYA 4FZZA 2VCPA 4B9TA 3M8PA 4DV3K 3DRSA 1J5OA 2FBXA 3U8XA 4CGFA 4IFVA 3RMAA 1NU0A 1VSKA 3LP0A 4AF1A 4YOVA 3NBPA 2IAJA 1NGGA 3VA0A 4DV5K 3ENBA 4CZJA 3B8AX 1WSGA 3CJ1A 1NK7A 3VGMA 4FPAA 3L2VA 3MECA 2XY8A 4FWPA 4CK2A 2ZE2A 5LJVA 1S22A 2ZGZA 2HNYA 2BGGA 1B9DA 1TKXA 2KTQA 1U6ZA 1GLDG 4JD2A 5AZIA 1KC8O 3Q7BA 3KK2A 2VQEK 4BE0A 1GLBG 3EY1A 4U67L 3A5NC 4FWOA 4CEFA 3CCJN 1WSEA 4F4KA 1IBLK 3V4IA 2VGMA 3BEXA 3GL1A 3Q7CA 1VSMA 3AGKA 2R7YA 5BRDA 2Q3SA 4KKOA 3FGUA 3K5NA 3BZCA 1RBTA 2GUIA 2NRRA 2BH1A 1NGEA 1TKZA 3ZT0A 1C6VA 1QQOA 3WT0A 4B1ZA 4EP4A 1L3UA 2EHGA 5AQRA 4KRFA 4OGEA 5LMUK 2O8EA 1FXXA 2WONA 4OKJA 1D9FA 1BOTO 3MWPA 3IKMA 4F2RA 4QCLA 4B9QA 4BE2A 3HI0A 4OLAA 3JAMO 4E19A 2P9NB 5KI6A 3TAQA 2HMIA 1NKBA 1NGFA 4B9VA 1IO2A 5GADP 3MAQA 1FKPA 4DSFA 1W7AA 1YHQN 1BQMA 1YAGA 3EE8A 1VRUA 3PO4A 2E4LA 4C1NK 2GWKA 1Z25A 2CH5A 1A5VA 4Z4GA 1KVBA 3CCSN 1HJOA 1QZ5A 2ZGYA 4DCHA 3VEZA 4LD0A 4B1VA 3LWLA 4AH9A 4JRQA 4M3XA 3OBYA 4H0TB 2HF4A 5AZJB 1SL2A 2PYLA 3HVTA 3CQXA 4HHTA 1ATNA 3V1OA 1S1XA 3L0QA 4AILC 2VG5A 4AHCA 2CGJA 2GBZA 1MA9B 3D6RA 3WQUA 3UKRB 3HZ6A 4OKEA 1C0FA 4CZHA 3C6HA 4YOUA 5AZJA 5JLFA 3CC7N 3PV8A 3VEXA 2X6NA 3M1FA 4JK9A 3CF5L 3S3OA 3NVMA 4NCBA 3QINA 1N6QA 1N32K 3J8AA 5FDLA 4YHHK 3THXA 1J54A 3EKUA 4C1NI 4YOWA 1KLNA 1GOCA 4YY3K 3O9SA 5JS2A 1OH8A 4LF8K 2P9LB 3DOKA 4Z94A 5HRPA 3EZ5A 2HHUA 1QS4A 2JWLA 4KPYA 4IDHA 3ZLJA 4CHZA 1LW0A 3HVRA 1C0UA 2VG7A 2E2PA 2BANA 5C2FA 1NGJA 4JRPA 1TVRA 1Q8IA 2I7NA 4FLZA 1S9GA 2X74A 3EO3A 4H0PA 1HR0K 2NRHA 1YTAA 1HMVA 3TARA 2BDPA 3VQ5A 4IZ9A 4ELUA 4BR2A 4DTSA 1QVGM 4BRDA 4OPAA 3WNGA 4GVMA 2KZZA 4DLEA 1K6YA 1HPZA 1F21A 3F73A 2B6AA 5FPEA 2IVOA 1JXBA 2NZTA 2Q2RA 5AJ3K 2QWLA 2P9NA 4O4GA 3VPZA 5M1OA 3K5OA 1D9DA 4C8NA 3OYBA 4H5RA 5I42A 2A1RA 5JVGL 2P9SB 1HJRA 3WUHA 2D4WA 3D2FA 4GNIA 4LSNA 4H0XB 2PBDA 3N4PA 3ZX3A 3DLEA 3THVA 1EWRA 4B08A 4JI6K 4DTOA 3QNOA 3ZSQA 4DTPA 3MXIA 3I0SA 4FWMA 4Y1DA 3PX4A 1NK5A 4FWRA 2Q0UA 3CJBA 1TL1A 2Z1GA 3O9UA 2D0AA 2G8IA 2RHKA 1ZBUA 3DWLA 3TAPA 4FJ9A 4KAZA 3NHGA 3QEVA 1Y97A 3H08A 3CG7A 3OTOK 5JLHA 5AQUA 2O8EB 1U47A 1N34K 1VSDA 4CJKA 2QWRA 3KIOA 1RNHA 1C1AA 3VF4A 3WNHA 4BR5A 1KFDA 1E4FT 2HHQA 1S1UA 1N33K 4WFAL 4FOIA 4JK7A 2XY5A 4LF6K 2W40A 3CQ8A 1XI1A 1BQNA 4MLHA 4UY8O 1QSSA 4KTQA 4EZ9A 3EYZA 1D4XA 2P9LA 5KQ8A 3OYHA 1SAZA 4J2EA 4M7YA 4N76A 5AQPA 4RW8A 3T1AA 1TGOA 2PZSA 4DV7K 3OS0A 3THXB 3W0LA 4FM1A 1NLVA 4NLBA 1RT2A 1K73O 4B1XB 5DMRA 3B6OA 4RW7A 4FJ8A 2CGLA 2DTUA 4CVNE 5E26A 1K8KA 4E7KA 1N36K 5BREA 4WFNL 4NXNK 3AARA 3NVKA 3CC4N 4KHSA 5BPMA 1YVNA 3L4IA 1ITGA 2FC0A 1QTMA 1NK0A 3S9HA 4DSJA 5LY3A 4BRGA 5AQMA 3T3FA 4C8OA 3O3FA 1ZBFA 3SUNA 2I5JA 5HL7L 4I7FA 4LC9B 4NXMK 3HL8A 3UKUA 3LP1A 4B9UA 5KRTA 3IUCA 1A5WA 2P9PB 2X6SA 4FLUA 3THYA 3T19A 4CJ7A 2Z1HA 1CZAN 4JKEA 4E1MA 3LZIA 4R79A 1CXQA 3O4WA 4TSXA 4J2DA 2HB5A 4IOAL 3OYFA 4IO8A 4CESA 3SZ2A 1E4GT 3QBXA 1BUPA 4ISFA 2FBYA
chains in the Genus database with same CATH topology
2P5GA 4IG0A 4CECA 4ZTJA 1SL1A 3L2UA 3ZSRA 1CLQA 2OPPA 3L3VA 3OYIA 2KFZA 1EXQA 1JLAA 3AO5A 3DLRA 5T7BA 4B9SA 3DRPA 3OYNA 2FBTA 3G0ZA 1IG9A 2P5OA 4KHQA 3VQPA 4IDKA 3LAMA 2KZMA 4DMNA 3KD5E 4I9LA 3QETA 2DY4A 3QIPA 4HVJA 3O4QA 4F2SA 3KLHA 2XRIA 1ZBHA 4B9LA 3VQCA 4DFMA 3I0RA 4CF9A 2NUBA 4GW6A 4O5BA 3DLHA 3JYTA 4C8LA 4FZYA 1RBUA 2WOMA 3AO2A 5FROA 1QQCA 1NK6A 5FRMA 4CF1A 4IFYA 3SQ0A 4CJSA 5K14A 4L8RB 1SKSA 3K59A 3HPOA 2DFFA 2LSNA 1W9HA 3MEEA 1NKCA 4GMJB 3VQ4A 1RT1A 2KW4A 2OPRA 4CFDA 1S5JA 4OPJA 4W5TA 1L3TA 4OGCA 1XHXA 4E3SA 3SNNA 3AVNA 3AVHA 3G10A 3NF8A 3ULDA 4DU3A 4KREA 1D5AA 3KLFA 3TAGA 4NYFA 3HO1A 1JLBA 4CJFA 3L3UA 4HUFA 3V81A 1VSEA 3KD1E 2HVHA 2ATQA 1JLCA 1U49A 4CEEA 3M8SA 1SV5A 2E6MA 4FJGA 1RILA 2ZD1A 1T7PA 4DTMA 1EETA 5J2MA 4E7JA 4B8AB 1NK8A 4M3RA 2XHBA 3V9WA 2W42A 3AVJA 3TI0A 3SV4A 4FLVA 3DRRA 1S1TA 3M8RA 1U4BA 4CEOA 3QEIA 4KI6A 4QOZB 4HUEA 1RT4A 1TL3A 4UQGA 1SUQA 4KFBA 4FK0A 2YNIA 3ZT3A 2Y1JA 4BDZA 4FK2A 1BIZA 2AJQA 2YNGA 2Z1IA 5HBMA 3WNEA 1DLOA 3KLGA 2RF2A 1SKWA 3MXMA 2IOCA 1RBVA 4ZTFA 1JL2A 4BDPA 1RDDA 2HHVA 3CFRA 3TR8A 3HM9A 4YNQA 3AVMA 2OZSA 3DLKA 3KKRA 3VQEA 3NF9A 3HT3A 5CYMA 1GOBA 3QESA 3TANA 4O55A 1BCOA 1RDBA 1JKHA 3AVBA 4CHYA 4FZZA 1X9MA 1HNIA 5C42A 3SPZA 3P83D 5SWMA 1HYZA 1S6QA 3CM6A 3ZSOA 3QNNA 1J9AA 2IC3A 1U48A 1NOYA 4B9TA 4N47A 3M8PA 3M8QA 3DRSA 3NGZA 3E01A 1J5OA 4DSLA 4FJ7A 1VSHA 2FBXA 4CGFA 4CJ3A 2DFEA 3HYFA 4CJLA 4IFVA 3RMAA 3V9XA 1RDCA 1VSKA 4CE9A 2RPIA 3LP0A 1XC9A 3OJSA 4C8MA 4BDYA 4FCYA 1N5YA 3OYGA 1KCFA 3NF6A 1XWLA 4BWJA 3NBPA 4E1NA 2IAJA 3VQ9A 3U3YA 3PX6A 3NFAA 4CJUA 3VA0A 1IH7A 4CJTA 4NYNA 4FZXC 3SQ1A 1TK0A 4KTZA 1WSGA 1T05A 1NK7A 3AV9A 4BWMA 1TK8A 4M3UA 5KGXA 3L2VA 1HYVA 1W0HA 3MECA 2XY8A 1QSYA 1KSPA 4CK2A 2ZE2A 4O0IA 2JGUA 2A1SA 1ASUA 3L2QA 3PUFA 4FLYA 5CY4A 3NE6A 2HNYA 4HUGA 1B9DA 2BGGA 1TKXA 4K8XA 1BGXT 3OYLA 2KTQA 4M3YA 3F9KA 3KLEA 3C6TA 4DTRA 1RT3A 3HP9A 4BACA 4FJMA 5JS1A 3AA3A 3LAKA 1VSLA 1A5XA 1WNSA 3KK2A 4BE0A 2HHSA 3AO1A 3EY1A 4CGDA 4W5QA 2EX3A 1SKRA 2PYJA 4CCHA 2HHWA 4W5NA 3OY9A 2HHTA 4CEFA 1UOCA 1WSEA 4F4KA 1Q9XA 3HSTB 3DYAA 4DQQA 1IKVA 3V4IA 4M3WA 1BIUA 1LW2A 1JLGA 1RT7A 4DS4A 3SPYA 4ELTA 2QKBA 1VSMA 2R7YA 2Q3SA 3ISNC 1HNVA 4AHTA 1WN7A 4DSKA 4KKOA 4H8KA 3K5NA 3SUQA 1RBTA 2HNZA 4MQ3A 4Z0UA 2GUIA 4FJ5A 3SQ4A 4N56A 4HTUA 2YV0X 1HQEA 3AA5X 4LY7A 5KGWA 3TWHA 1TV6A 4DQPA 3QERA 5CYQA 1L3VA 4FYDA 4CGGA 1RDAA 4Z4HA 1TKZA 3ZCMA 3ZT0A 1JLQA 1C6VA 1UAXA 4EP4A 2E6LA 1EP4A 1L3UA 2EHGA 1FK9A 3CM5A 4KRFA 4OGEA 1FXXA 2WONA 3DM2A 3HPHA 4OKJA 4J2AA 1D9FA 4F2RA 1REVA 1WSJA 1IKWA 3LP2A 4CGJA 2D5RA 1G15A 5HLFA 4QCLA 3IAYA 2X78A 1LWEA 3HPGA 4FW1A 4DFPA 4DF8A 2ITGA 4BE2A 4OLAA 3KKSA 1UA1A 4M42A 4E19A 4FJJA 1TAUA 1JLEA 2HMIA 4LSLA 5KI6A 1CXUA 3TAQA 1NKBA 3OYMA 3I8DA 1ASVA 4E0DA 4B9VA 4CJEA 4E89A 4NCGA 4KTWA 4E7IA 4H4MA 3LDSA 1TKDA 1IO2A 5C24A 3MAQA 1FKPA 3OYJA 4DSFA 1BQMA 1TAQA 1JLFA 1HRHA 1WAJA 4F3OA 1VRUA 4CK1A 4I9QA 3PO4A 4ID5A 2E4LA 3NAEA 1YT3A 1B9FA 2OPQA 5HRSA 1WSIA 1Z25A 5J1EA 3OYCA 4OLBA 3NDKA 4NCAA 4RW6A 3U3GA 1NK4A 1A5VA 1XHZA 4HCCA 4KHNA 4RW4A 4Z4GA 1KVBA 4OJRA 4W5RA 1ZBIA 3TABA 3RRHA 1B92A 3K5LA 1NJWA 1L3SA 3SI6A 3AO3A 4QAGA 3O3GA 4CHPA 1HQUA 3NH0A 1LV5A 1QSLA 4LD0A 3LWLA 4AH9A 4JRQA 2VWJA 2G8VA 3OS1A 4M3XA 1IKXA 2YHAA 3RMCA 4KO0A 4ZHRA 2FBVA 3SUPA 1SL2A 2F8SA 3CYMA 1RCHA 2PYLA 3HVTA 4HHTA 3VQAA 1BCMA 1S1XA 3V1OA 5E41A 3S3MA 4AILC 4KB0A 2VG5A 4AHCA 2GBZA 1J53A 1RTHA 2IS3A 2G8WA 1WSHA 2KQ2A 3K2PA 4AHSA 4CGIA 1ZYQA 1VSFA 4H4OA 5I3UA 4AHRA 3IRXA 4CFBA 4CFAA 4OKEA 4KHUA 4KB1A 3LALA 3U6FA 3PV8A 2HVIA 5FRNA 4CJRA 3AVGA 1QHTA 2X6NA 4FJIA 4PY5A 3ZSWA 3S3OA 3ZSZA 2OYQA 1S1WA 3UIQA 3QINA 5J2PA 1N6QA 4NCBA 1WLJA 1GOAA 4FXDA 1QE1A 3VQQA 2ETJA 5FDLA 3LZJA 3ZSXA 3SUOA 3SQ2A 1J54A 1TKTA 3DLGA 4ICLA 4DU4A 4DLGA 3RTVA 1RBSA 3QEWA 1YTUA 1I39A 2QK9A 1KLNA 1GOCA 4KHWA 4M3ZA 5CZ2A 3ZT1A 5HRRA 5JS2A 2F8TA 3ZSYA 5J2NA 4LH5A 3V1QA 4WE1A 4I2PA 4CJ5A 3DOKA 2P51A 5KRSA 4Q0BA 3AA4A 5HRPA 3EZ5A 4CEZA 2HHUA 1BL3A 3AVLA 1QS4A 4DF4A 1X1PA 1YVUA 2KFNA 3IG1A 4DU1A 4KPYA 4M3TA 3AVCA 4MFBA 4K8ZA 4CHZA 1LW0A 3HVRA 1C0UA 2VG7A 2BANA 2QXFA 1C1BA 3LWMA 4BE1A 3LP3A 2PY5A 3NH1A 1BISA 4JRPA 1TVRA 4FJKA 1Q8IA 4FLZA 4DSEA 3ITHA 1S9GA 2X74A 1RT6A 2YNHA 4CIGA 3HXMA 4DG1A 1FKOA 2XY6A 3QIOA 1YTAA 1KFSA 1HMVA 2B5JA 4RW9A 4DTJA 3TARA 4Y1CA 1S9EA 2BDPA 3NGIA 4FJHA 3K5MA 3VQ5A 4F8RA 4ELUA 5CZ1A 4DTSA 4FK4A 4M45A 3WNGA 3RMBA 3D45A 1KRPA 4GVMA 3V6DA 2KZZA 4B8CA 1K6YA 4DLEA 4G1QA 1VK0A 1HPZA 4B3OA 1F21A 3F73A 2B6AA 1TK5A 3V9UA 1EKEA 4CIEA 1D8YA 3DOLA 1JXBA 3DMJA 2YKMA 4CJVA 5SZTA 3PX0A 4N41A 4IG3A 2O4GA 1CZBA 1RTIA 3BGRA 4DSIA 4O4GA 2G8FA 1KVAA 2D0CA 1D9DA 3K5OA 1X9SA 3MEDA 4C8NA 3OYBA 2XY7A 4Z4CA 5I42A 2A1RA 3KJVA 4KI4A 1BI4B 5J2QA 1HJRA 2IGIA 3L8BA 3AVKA 1LAWA 4RG8A 3CFPA 2HHXA 3C94A 5EU7A 4KV8A 4CF8A 1DTQA 3OYAA 1U45A 3RRGA 4JS4A 3V9ZA 4DFJA 1C1CA 3L2WA 3DI6A 4LSNA 3HJFA 1JL1A 3SV3A 4CEBA 3THVA 3DLEA 4FW2A 3OVNA 4B08A 5C25A 5KTQA 3D0PA 3A2FA 3VQ7A 3LANA 3VQ8A 3ZSQA 4YFUA 4DS5A 4DTOA 4DTPA 3QNOA 3I0SA 3PX4A 4Y1DA 2JLEA 3MXIA 1NK5A 4EZ6A 4FLWA 1RBRA 2OPSA 1X9WA 3RWUA 4C8KA 4DQSA 1TL1A 2Z1GA 2D0BA 3KLIA 3P1GA 3QO9A 2D0AA 3MEGA 1LWFA 4ID1A 3SCXA 1ZBUA 2QKKA 4HCBA 2HNDA 4CF2A 2Y1IA 2G8UA 1KTQA 4Z4FA 3AO4A 2O4IA 4DQIA 3RR8A 3TAPA 1DTTA 3NF7A 3OJUA 4FJ9A 4KAZA 3AVIA 3NHGA 4FLTA 3OYKA 3C95A 3TAMA 3QEVA 1Y97A 3H08A 1MU2A 4OVLA 3CG7A 1LWCA 1U47A 3VQBA 1VSDA 1IKYA 4CJKA 1I3AA 3NGYA 4CK3A 4EP5A 2HW3A 3BDPA 4ELVA 3HK2A 1S1VA 3KIOA 1RNHA 1C1AA 3VQ6A 4E7HA 3WNHA 1LAVA 1C0MA 4CHNA 3PY8A 5HROA 4FVMA 3PO5A 3TAEA 1RTJA 4FJXA 1KFDA 4XIUA 2G8KA 4DFKA 4FM2A 4J2BA 2HHQA 3SYZA 1SL0A 1S1UA 1JXEA 4CJ4A 4CEQA 3B6PA 1U04A 2DFHA 3IS9A 3K58A 4FM0A 3SJJA 4CIFA 4PA1A 4R5PA 1VSJA 2XY5A 3CQ8A 1ZBLA 1XI1A 1Q9YA 4FJLA 2P1JA 1BQNA 3TAFA 3OS2A 1QSSA 4KTQA 4PWDA 3JSMA 3ASMA 3QEPA 3O3HA 4EZ9A 3EYZA 4PQUA 2BE2A 3AVAA 4CHOA 3NH2A 3OYHA 4OPKA 4DWIA 1KVCA 2ZQBA 4DTNA 4CFCA 4CEAA 1UWBA 4J2EA 3NCIA 1BHLA 4N76A 2B4JA 3FFIA 3ALYA 4O44A 3ZT4A 4RW8A 5HRNA 3T1AA 3WNFA 1TGOA 2OA8A 2PZSA 3V9SA 4PUOA 3ZT2A 3OS0A 3AA2A 3S3NA 3OYDA 4FM1A 4CHQA 2YKNA 1RT2A 2YNFA 3VN5A 2OZMA 1CZ9A 5DMRA 4Q5VA 3B6OA 4RW7A 1BI4A 4FJ8A 1WSFA 3OYEA 4FLXA 4Z4IA 4IKFA 2YHBA 3RR7A 2DTUA 3V1RA 1HYSA 1NJXA 4F3TA 4KHYA 4IBNA 4E7KA 2G8IA 3QEXA 2GV9A 1NJYA 5HP1A 1NJZA 3HP6A 3LPTA 4I2QA 4KHSA 1ITGA 2FC0A 4O0JA 3MXJA 1QTMA 1NK0A 1VRTA 3S9HA 4JLHA 4CJQA 3RMDA 4DSJA 3P5JA 3T3FA 3CFOA 3L2RA 4E7LA 4C8OA 4AHVA 4Z4EA 1KLMA 3O3FA 1ASWA 5D3GA 4B9NA 1ZBFA 2VWKA 3SUNA 3C6UA 2I5JA 3DLBA 2VG6A 4I7FA 3KTQA 1NKEA 1WAFA 4OKKA 4DTUA 3HL8A 4DQRA 2F96A 1EX4A 3LP1A 1UA0A 1R0AA 4B9UA 5KRTA 1NOZA 1A5WA 4FLUA 2X6SA 3O4NA 4FJNA 4M41A 1C0TA 3T19A 4CGHA 3KK3A 2Z1HA 3LPUA 3KK1A 1RTDA 4AHUA 1T03A 3AVFA 4E1MA 3ZSVA 3LZIA 1CXQA 3VA3A 4W5OA 4CJPA 1Z26A 1S6PA 4TSXA 3QLHA 2HB5A 2RKIA 3K57A 2G8HA 3OYFA 4JS5A 4J2DA 2IDOA 1RT5A 4CERA 4N5SA 4B9MA 4CESA 4DTXA 2RN2A 1L5UA 3SZ2A 4CEDA 5DK5A 3VQDA 1VSIA 4LH4A 4CF0A 2Z1JA 1NK9A 1T8EA 4CJWA 2XO7A 1O1WA 2FBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5G A;  4IG0 A;  4CEC A;  4ZTJ A;  1SL1 A;  3L2U A;  3ZSR A;  1CLQ A;  2OPP A;  3L3V A;  3OYI A;  2KFZ A;  1EXQ A;  1JLA A;  3AO5 A;  3DLR A;  5T7B A;  4B9S A;  3DRP A;  3OYN A;  2FBT A;  3G0Z A;  1IG9 A;  2P5O A;  4KHQ A;  3VQP A;  4IDK A;  3LAM A;  2KZM A;  4DMN A;  3KD5 E;  4I9L A;  3QET A;  2DY4 A;  3QIP A;  4HVJ A;  3O4Q A;  4F2S A;  3KLH A;  2XRI A;  1ZBH A;  4B9L A;  3VQC A;  4DFM A;  3I0R A;  4CF9 A;  2NUB A;  4GW6 A;  4O5B A;  3DLH A;  3JYT A;  4C8L A;  4FZY A;  1RBU A;  2WOM A;  3AO2 A;  5FRO A;  1QQC A;  1NK6 A;  5FRM A;  4CF1 A;  4IFY A;  3SQ0 A;  4CJS A;  5K14 A;  4L8R B;  1SKS A;  3K59 A;  3HPO A;  2DFF A;  2LSN A;  1W9H A;  3MEE A;  1NKC A;  4GMJ B;  3VQ4 A;  1RT1 A;  2KW4 A;  2OPR A;  4CFD A;  1S5J A;  4OPJ A;  4W5T A;  1L3T A;  4OGC A;  1XHX A;  4E3S A;  3SNN A;  3AVN A;  3AVH A;  3G10 A;  3NF8 A;  3ULD A;  4DU3 A;  4KRE A;  1D5A A;  3KLF A;  3TAG A;  4NYF A;  3HO1 A;  1JLB A;  4CJF A;  3L3U A;  4HUF A;  3V81 A;  1VSE A;  3KD1 E;  2HVH A;  2ATQ A;  1JLC A;  1U49 A;  4CEE A;  3M8S A;  1SV5 A;  2E6M A;  4FJG A;  1RIL A;  2ZD1 A;  1T7P A;  4DTM A;  1EET A;  5J2M A;  4E7J A;  4B8A B;  1NK8 A;  4M3R A;  2XHB A;  3V9W A;  2W42 A;  3AVJ A;  3TI0 A;  3SV4 A;  4FLV A;  3DRR A;  1S1T A;  3M8R A;  1U4B A;  4CEO A;  3QEI A;  4KI6 A;  4QOZ B;  4HUE A;  1RT4 A;  1TL3 A;  4UQG A;  1SUQ A;  4KFB A;  4FK0 A;  2YNI A;  3ZT3 A;  2Y1J A;  4BDZ A;  4FK2 A;  1BIZ A;  2AJQ A;  2YNG A;  2Z1I A;  5HBM A;  3WNE A;  1DLO A;  3KLG A;  2RF2 A;  1SKW A;  3MXM A;  2IOC A;  1RBV A;  4ZTF A;  1JL2 A;  4BDP A;  1RDD A;  2HHV A;  3CFR A;  3TR8 A;  3HM9 A;  4YNQ A;  3AVM A;  2OZS A;  3DLK A;  3KKR A;  3VQE A;  3NF9 A;  3HT3 A;  5CYM A;  1GOB A;  3QES A;  3TAN A;  4O55 A;  1BCO A;  1RDB A;  1JKH A;  3AVB A;  4CHY A;  4FZZ A;  1X9M A;  1HNI A;  5C42 A;  3SPZ A;  3P83 D;  5SWM A;  1HYZ A;  1S6Q A;  3CM6 A;  3ZSO A;  3QNN A;  1J9A A;  2IC3 A;  1U48 A;  1NOY A;  4B9T A;  4N47 A;  3M8P A;  3M8Q A;  3DRS A;  3NGZ A;  3E01 A;  1J5O A;  4DSL A;  4FJ7 A;  1VSH A;  2FBX A;  4CGF A;  4CJ3 A;  2DFE A;  3HYF A;  4CJL A;  4IFV A;  3RMA A;  3V9X A;  1RDC A;  1VSK A;  4CE9 A;  2RPI A;  3LP0 A;  1XC9 A;  3OJS A;  4C8M A;  4BDY A;  4FCY A;  1N5Y A;  3OYG A;  1KCF A;  3NF6 A;  1XWL A;  4BWJ A;  3NBP A;  4E1N A;  2IAJ A;  3VQ9 A;  3U3Y A;  3PX6 A;  3NFA A;  4CJU A;  3VA0 A;  1IH7 A;  4CJT A;  4NYN A;  4FZX C;  3SQ1 A;  1TK0 A;  4KTZ A;  1WSG A;  1T05 A;  1NK7 A;  3AV9 A;  4BWM A;  1TK8 A;  4M3U A;  5KGX A;  3L2V A;  1HYV A;  1W0H A;  3MEC A;  2XY8 A;  1QSY A;  1KSP A;  4CK2 A;  2ZE2 A;  4O0I A;  2JGU A;  2A1S A;  1ASU A;  3L2Q A;  3PUF A;  4FLY A;  5CY4 A;  3NE6 A;  2HNY A;  4HUG A;  1B9D A;  2BGG A;  1TKX A;  4K8X A;  1BGX T;  3OYL A;  2KTQ A;  4M3Y A;  3F9K A;  3KLE A;  3C6T A;  4DTR A;  1RT3 A;  3HP9 A;  4BAC A;  4FJM A;  5JS1 A;  3AA3 A;  3LAK A;  1VSL A;  1A5X A;  1WNS A;  3KK2 A;  4BE0 A;  2HHS A;  3AO1 A;  3EY1 A;  4CGD A;  4W5Q A;  2EX3 A;  1SKR A;  2PYJ A;  4CCH A;  2HHW A;  4W5N A;  3OY9 A;  2HHT A;  4CEF A;  1UOC A;  1WSE A;  4F4K A;  1Q9X A;  3HST B;  3DYA A;  4DQQ A;  1IKV A;  3V4I A;  4M3W A;  1BIU A;  1LW2 A;  1JLG A;  1RT7 A;  4DS4 A;  3SPY A;  4ELT A;  2QKB A;  1VSM A;  2R7Y A;  2Q3S A;  3ISN C;  1HNV A;  4AHT A;  1WN7 A;  4DSK A;  4KKO A;  4H8K A;  3K5N A;  3SUQ A;  1RBT A;  2HNZ A;  4MQ3 A;  4Z0U A;  2GUI A;  4FJ5 A;  3SQ4 A;  4N56 A;  4HTU A;  2YV0 X;  1HQE A;  3AA5 X;  4LY7 A;  5KGW A;  3TWH A;  1TV6 A;  4DQP A;  3QER A;  5CYQ A;  1L3V A;  4FYD A;  4CGG A;  1RDA A;  4Z4H A;  1TKZ A;  3ZCM A;  3ZT0 A;  1JLQ A;  1C6V A;  1UAX A;  4EP4 A;  2E6L A;  1EP4 A;  1L3U A;  2EHG A;  1FK9 A;  3CM5 A;  4KRF A;  4OGE A;  1FXX A;  2WON A;  3DM2 A;  3HPH A;  4OKJ A;  4J2A A;  1D9F A;  4F2R A;  1REV A;  1WSJ A;  1IKW A;  3LP2 A;  4CGJ A;  2D5R A;  1G15 A;  5HLF A;  4QCL A;  3IAY A;  2X78 A;  1LWE A;  3HPG A;  4FW1 A;  4DFP A;  4DF8 A;  2ITG A;  4BE2 A;  4OLA A;  3KKS A;  1UA1 A;  4M42 A;  4E19 A;  4FJJ A;  1TAU A;  1JLE A;  2HMI A;  4LSL A;  5KI6 A;  1CXU A;  3TAQ A;  1NKB A;  3OYM A;  3I8D A;  1ASV A;  4E0D A;  4B9V A;  4CJE A;  4E89 A;  4NCG A;  4KTW A;  4E7I A;  4H4M A;  3LDS A;  1TKD A;  1IO2 A;  5C24 A;  3MAQ A;  1FKP A;  3OYJ A;  4DSF A;  1BQM A;  1TAQ A;  1JLF A;  1HRH A;  1WAJ A;  4F3O A;  1VRU A;  4CK1 A;  4I9Q A;  3PO4 A;  4ID5 A;  2E4L A;  3NAE A;  1YT3 A;  1B9F A;  2OPQ A;  5HRS A;  1WSI A;  1Z25 A;  5J1E A;  3OYC A;  4OLB A;  3NDK A;  4NCA A;  4RW6 A;  3U3G A;  1NK4 A;  1A5V A;  1XHZ A;  4HCC A;  4KHN A;  4RW4 A;  4Z4G A;  1KVB A;  4OJR A;  4W5R A;  1ZBI A;  3TAB A;  3RRH A;  1B92 A;  3K5L A;  1NJW A;  1L3S A;  3SI6 A;  3AO3 A;  4QAG A;  3O3G A;  4CHP A;  1HQU A;  3NH0 A;  1LV5 A;  1QSL A;  4LD0 A;  3LWL A;  4AH9 A;  4JRQ A;  2VWJ A;  2G8V A;  3OS1 A;  4M3X A;  1IKX A;  2YHA A;  3RMC A;  4KO0 A;  4ZHR A;  2FBV A;  3SUP A;  1SL2 A;  2F8S A;  3CYM A;  1RCH A;  2PYL A;  3HVT A;  4HHT A;  3VQA A;  1BCM A;  1S1X A;  3V1O A;  5E41 A;  3S3M A;  4AIL C;  4KB0 A;  2VG5 A;  4AHC A;  2GBZ A;  1J53 A;  1RTH A;  2IS3 A;  2G8W A;  1WSH A;  2KQ2 A;  3K2P A;  4AHS A;  4CGI A;  1ZYQ A;  1VSF A;  4H4O A;  5I3U A;  4AHR A;  3IRX A;  4CFB A;  4CFA A;  4OKE A;  4KHU A;  4KB1 A;  3LAL A;  3U6F A;  3PV8 A;  2HVI A;  5FRN A;  4CJR A;  3AVG A;  1QHT A;  2X6N A;  4FJI A;  4PY5 A;  3ZSW A;  3S3O A;  3ZSZ A;  2OYQ A;  1S1W A;  3UIQ A;  3QIN A;  5J2P A;  1N6Q A;  4NCB A;  1WLJ A;  1GOA A;  4FXD A;  1QE1 A;  3VQQ A;  2ETJ A;  5FDL A;  3LZJ A;  3ZSX A;  3SUO A;  3SQ2 A;  1J54 A;  1TKT A;  3DLG A;  4ICL A;  4DU4 A;  4DLG A;  3RTV A;  1RBS A;  3QEW A;  1YTU A;  1I39 A;  2QK9 A;  1KLN A;  1GOC A;  4KHW A;  4M3Z A;  5CZ2 A;  3ZT1 A;  5HRR A;  5JS2 A;  2F8T A;  3ZSY A;  5J2N A;  4LH5 A;  3V1Q A;  4WE1 A;  4I2P A;  4CJ5 A;  3DOK A;  2P51 A;  5KRS A;  4Q0B A;  3AA4 A;  5HRP A;  3EZ5 A;  4CEZ A;  2HHU A;  1BL3 A;  3AVL A;  1QS4 A;  4DF4 A;  1X1P A;  1YVU A;  2KFN A;  3IG1 A;  4DU1 A;  4KPY A;  4M3T A;  3AVC A;  4MFB A;  4K8Z A;  4CHZ A;  1LW0 A;  3HVR A;  1C0U A;  2VG7 A;  2BAN A;  2QXF A;  1C1B A;  3LWM A;  4BE1 A;  3LP3 A;  2PY5 A;  3NH1 A;  1BIS A;  4JRP A;  1TVR A;  4FJK A;  1Q8I A;  4FLZ A;  4DSE A;  3ITH A;  1S9G A;  2X74 A;  1RT6 A;  2YNH A;  4CIG A;  3HXM A;  4DG1 A;  1FKO A;  2XY6 A;  3QIO A;  1YTA A;  1KFS A;  1HMV A;  2B5J A;  4RW9 A;  4DTJ A;  3TAR A;  4Y1C A;  1S9E A;  2BDP A;  3NGI A;  4FJH A;  3K5M A;  3VQ5 A;  4F8R A;  4ELU A;  5CZ1 A;  4DTS A;  4FK4 A;  4M45 A;  3WNG A;  3RMB A;  3D45 A;  1KRP A;  4GVM A;  3V6D A;  2KZZ A;  4B8C A;  1K6Y A;  4DLE A;  4G1Q A;  1VK0 A;  1HPZ A;  4B3O A;  1F21 A;  3F73 A;  2B6A A;  1TK5 A;  3V9U A;  1EKE A;  4CIE A;  1D8Y A;  3DOL A;  1JXB A;  3DMJ A;  2YKM A;  4CJV A;  5SZT A;  3PX0 A;  4N41 A;  4IG3 A;  2O4G A;  1CZB A;  1RTI A;  3BGR A;  4DSI A;  4O4G A;  2G8F A;  1KVA A;  2D0C A;  1D9D A;  3K5O A;  1X9S A;  3MED A;  4C8N A;  3OYB A;  2XY7 A;  4Z4C A;  5I42 A;  2A1R A;  3KJV A;  4KI4 A;  1BI4 B;  5J2Q A;  1HJR A;  2IGI A;  3L8B A;  3AVK A;  1LAW A;  4RG8 A;  3CFP A;  2HHX A;  3C94 A;  5EU7 A;  4KV8 A;  4CF8 A;  1DTQ A;  3OYA A;  1U45 A;  3RRG A;  4JS4 A;  3V9Z A;  4DFJ A;  1C1C A;  3L2W A;  3DI6 A;  4LSN A;  3HJF A;  1JL1 A;  3SV3 A;  4CEB A;  3THV A;  3DLE A;  4FW2 A;  3OVN A;  4B08 A;  5C25 A;  5KTQ A;  3D0P A;  3A2F A;  3VQ7 A;  3LAN A;  3VQ8 A;  3ZSQ A;  4YFU A;  4DS5 A;  4DTO A;  4DTP A;  3QNO A;  3I0S A;  3PX4 A;  4Y1D A;  2JLE A;  3MXI A;  1NK5 A;  4EZ6 A;  4FLW A;  1RBR A;  2OPS A;  1X9W A;  3RWU A;  4C8K A;  4DQS A;  1TL1 A;  2Z1G A;  2D0B A;  3KLI A;  3P1G A;  3QO9 A;  2D0A A;  3MEG A;  1LWF A;  4ID1 A;  3SCX A;  1ZBU A;  2QKK A;  4HCB A;  2HND A;  4CF2 A;  2Y1I A;  2G8U A;  1KTQ A;  4Z4F A;  3AO4 A;  2O4I A;  4DQI A;  3RR8 A;  3TAP A;  1DTT A;  3NF7 A;  3OJU A;  4FJ9 A;  4KAZ A;  3AVI A;  3NHG A;  4FLT A;  3OYK A;  3C95 A;  3TAM A;  3QEV A;  1Y97 A;  3H08 A;  1MU2 A;  4OVL A;  3CG7 A;  1LWC A;  1U47 A;  3VQB A;  1VSD A;  1IKY A;  4CJK A;  1I3A A;  3NGY A;  4CK3 A;  4EP5 A;  2HW3 A;  3BDP A;  4ELV A;  3HK2 A;  1S1V A;  3KIO A;  1RNH A;  1C1A A;  3VQ6 A;  4E7H A;  3WNH A;  1LAV A;  1C0M A;  4CHN A;  3PY8 A;  5HRO A;  4FVM A;  3PO5 A;  3TAE A;  1RTJ A;  4FJX A;  1KFD A;  4XIU A;  2G8K A;  4DFK A;  4FM2 A;  4J2B A;  2HHQ A;  3SYZ A;  1SL0 A;  1S1U A;  1JXE A;  4CJ4 A;  4CEQ A;  3B6P A;  1U04 A;  2DFH A;  3IS9 A;  3K58 A;  4FM0 A;  3SJJ A;  4CIF A;  4PA1 A;  4R5P A;  1VSJ A;  2XY5 A;  3CQ8 A;  1ZBL A;  1XI1 A;  1Q9Y A;  4FJL A;  2P1J A;  1BQN A;  3TAF A;  3OS2 A;  1QSS A;  4KTQ A;  4PWD A;  3JSM A;  3ASM A;  3QEP A;  3O3H A;  4EZ9 A;  3EYZ A;  4PQU A;  2BE2 A;  3AVA A;  4CHO A;  3NH2 A;  3OYH A;  4OPK A;  4DWI A;  1KVC A;  2ZQB A;  4DTN A;  4CFC A;  4CEA A;  1UWB A;  4J2E A;  3NCI A;  1BHL A;  4N76 A;  2B4J A;  3FFI A;  3ALY A;  4O44 A;  3ZT4 A;  4RW8 A;  5HRN A;  3T1A A;  3WNF A;  1TGO A;  2OA8 A;  2PZS A;  3V9S A;  4PUO A;  3ZT2 A;  3OS0 A;  3AA2 A;  3S3N A;  3OYD A;  4FM1 A;  4CHQ A;  2YKN A;  1RT2 A;  2YNF A;  3VN5 A;  2OZM A;  1CZ9 A;  5DMR A;  4Q5V A;  3B6O A;  4RW7 A;  1BI4 A;  4FJ8 A;  1WSF A;  3OYE A;  4FLX A;  4Z4I A;  4IKF A;  2YHB A;  3RR7 A;  2DTU A;  3V1R A;  1HYS A;  1NJX A;  4F3T A;  4KHY A;  4IBN A;  4E7K A;  2G8I A;  3QEX A;  2GV9 A;  1NJY A;  5HP1 A;  1NJZ A;  3HP6 A;  3LPT A;  4I2Q A;  4KHS A;  1ITG A;  2FC0 A;  4O0J A;  3MXJ A;  1QTM A;  1NK0 A;  1VRT A;  3S9H A;  4JLH A;  4CJQ A;  3RMD A;  4DSJ A;  3P5J A;  3T3F A;  3CFO A;  3L2R A;  4E7L A;  4C8O A;  4AHV A;  4Z4E A;  1KLM A;  3O3F A;  1ASW A;  5D3G A;  4B9N A;  1ZBF A;  2VWK A;  3SUN A;  3C6U A;  2I5J A;  3DLB A;  2VG6 A;  4I7F A;  3KTQ A;  1NKE A;  1WAF A;  4OKK A;  4DTU A;  3HL8 A;  4DQR A;  2F96 A;  1EX4 A;  3LP1 A;  1UA0 A;  1R0A A;  4B9U A;  5KRT A;  1NOZ A;  1A5W A;  4FLU A;  2X6S A;  3O4N A;  4FJN A;  4M41 A;  1C0T A;  3T19 A;  4CGH A;  3KK3 A;  2Z1H A;  3LPU A;  3KK1 A;  1RTD A;  4AHU A;  1T03 A;  3AVF A;  4E1M A;  3ZSV A;  3LZI A;  1CXQ A;  3VA3 A;  4W5O A;  4CJP A;  1Z26 A;  1S6P A;  4TSX A;  3QLH A;  2HB5 A;  2RKI A;  3K57 A;  2G8H A;  3OYF A;  4JS5 A;  4J2D A;  2IDO A;  1RT5 A;  4CER A;  4N5S A;  4B9M A;  4CES A;  4DTX A;  2RN2 A;  1L5U A;  3SZ2 A;  4CED A;  5DK5 A;  3VQD A;  1VSI A;  4LH4 A;  4CF0 A;  2Z1J A;  1NK9 A;  1T8E A;  4CJW A;  2XO7 A;  1O1W A;  2FBY A; 
#chains in the Genus database with same CATH topology
 1X3M A;  4IG0 A;  3ZSR A;  3AO5 A;  5T7B A;  4JKB A;  2FBT A;  1IG9 A;  5AFU A;  3VQP A;  4IDK A;  3LAM A;  3ZEU B;  3MDQ A;  3DXM A;  2VWB A;  3GG4 A;  5B8H A;  2XRI A;  1ZBH A;  4CF9 A;  5ELZ A;  3DLH A;  4K42 A;  2WOM A;  3AAQ A;  1NK6 A;  3H3O B;  4FL9 A;  4CJS A;  5K14 A;  4L8R B;  3CJC A;  1WB9 A;  1W9H A;  3E9P A;  5JVH L;  4GMJ B;  1R59 O;  2KW4 A;  2OPR A;  3T7Z A;  4OPJ A;  4W5T A;  3A8Y A;  2FF3 B;  1V4T A;  3AVN A;  3DXK A;  3ENH A;  3ULD A;  5AQT A;  4JI2 K;  3HO1 A;  3GBT A;  1X9J A;  3L3U A;  4HUF A;  3V81 A;  2ATQ A;  2E6M A;  4IEI A;  1RIL A;  1T7P A;  5J2M A;  4B8A B;  4M3R A;  2XHB A;  5BR8 K;  3TI0 A;  4A2B A;  4NO7 A;  3VOV A;  1S1T A;  3FZK A;  2P9I B;  3M8R A;  4DV2 K;  4KI6 A;  3QIC A;  4HUE A;  3PLA A;  2F7T A;  4CI6 A;  4KFB A;  3ZT3 A;  1OVQ A;  3TSU A;  2YNG A;  3A5O C;  4B1U B;  4DUZ K;  5F1X A;  2RF2 A;  4DV0 K;  3J7A P;  1RDD A;  3CPW M;  5IWA K;  3TR8 A;  5F0X A;  3KKR A;  5C0Y A;  1GOB A;  3TAN A;  3MX2 A;  1BCO A;  4A61 A;  2FLO A;  2CGK A;  1HNI A;  3SPZ A;  3P83 D;  5SWM A;  1HYZ A;  3CM6 A;  2ASM A;  4BRC A;  3E01 A;  2NRT A;  3GOI A;  4CJ3 A;  4CJL A;  3V9X A;  2RPI A;  5FLX O;  4C8M A;  2GWJ A;  2HBK A;  3H1V X;  1KCF A;  1QVF M;  4KH4 A;  5CE3 A;  1Q82 O;  3PX6 A;  4E1N A;  3NFA A;  1IH7 A;  4NYN A;  1TK0 A;  1HX1 A;  3QFP A;  1QSY A;  4LF9 K;  3VEV A;  2ASP A;  4O0I A;  2JGU A;  1ASU A;  4BVO A;  5KPT A;  3L2Q A;  5AQS A;  3NE6 A;  3O9Q A;  3L6Q A;  4K8X A;  3OYL A;  4M3Y A;  3KLE A;  4BRN A;  4DTR A;  4GVE A;  5FPD A;  3LAK A;  1BA0 A;  2HHS A;  2HBL A;  2P9U A;  4DR3 K;  4CGD A;  1NGH A;  2HHW A;  2HHT A;  2FF6 A;  3BZK A;  1Q9X A;  3HST B;  3ATU A;  5AQH A;  1IKV A;  4ELT A;  2VYP A;  3SPY A;  3CET A;  1O13 A;  1HNV A;  2W6K A;  1WN7 A;  4AHT A;  3SUQ A;  2HNZ A;  4X64 K;  3J7Z O;  4N56 A;  2YV0 X;  1Q81 O;  3KWI A;  4LY7 A;  3TWH A;  4DQP A;  1KAX A;  4CGG A;  1IJJ A;  4Z4H A;  4YOY A;  1JLQ A;  1HUX A;  1UAX A;  4JHD B;  1EP4 A;  3WEE B;  2KHO A;  1REV A;  1WSJ A;  2D5R A;  2O8B A;  1RDU A;  3UB5 A;  3IAY A;  4JKF A;  4DF8 A;  3HPG A;  1GLL O;  3VEY A;  4BRI A;  4EIA A;  4JI8 K;  1MWM A;  4M42 A;  1JLE A;  1SQK A;  3MK6 A;  1CXU A;  3MN7 A;  3OYM A;  4E89 A;  4KTW A;  4E7I A;  1SZ2 A;  3K9K A;  3UKR A;  1HRH A;  4GV6 A;  4CK1 A;  5C12 A;  4B3R K;  4OLB A;  1GLE G;  4RW6 A;  1NK4 A;  1XHZ A;  3G25 A;  3TAB A;  3K5L A;  1L3S A;  5AQF A;  3AO3 A;  3LDP A;  3NH0 A;  5AQZ A;  3ID8 A;  2VWJ A;  1MDU B;  2YHA A;  4DV6 K;  2ZJP L;  2HMP A;  3O5B A;  4ZHR A;  3THY B;  3CYM A;  1NGA A;  5E41 A;  4KB0 A;  1HNX K;  3ZX2 A;  2G8W A;  4CGI A;  1ZYQ A;  4AHR A;  4CFB A;  4CFA A;  2E2O A;  4FO0 A;  2E20 A;  4CJR A;  1QHT A;  2QWQ A;  3ZSZ A;  4JKC A;  2ETJ A;  3EE9 A;  4H03 B;  3ZSX A;  1TKT A;  4B1Y B;  3RTV A;  1N8R O;  1RBS A;  3AY9 A;  3QEW A;  1I39 A;  1YTU A;  4KHW A;  4M3Z A;  2F8T A;  3ZSY A;  5J2N A;  1VQK N;  2V51 B;  4I2P A;  1HNZ K;  4Q0B A;  3CQY A;  3AVL A;  2FSK A;  2KFN A;  4EAH D;  2JWK A;  4BE1 A;  4H0V B;  3VET A;  4DR4 K;  1RT6 A;  2YNH A;  4CIG A;  3HXM A;  3HBT A;  1FKO A;  3SAF A;  2XY6 A;  3QIO A;  4K25 A;  1KFS A;  3FR0 A;  2B5J A;  1ATR A;  1Z05 A;  1S9E A;  1Q86 O;  3VGK A;  3RSE B;  3EEQ A;  3RMB A;  3SMS A;  3V6D A;  4MDB A;  1TYQ A;  4RTF D;  4BRK A;  1D8Y A;  4JKA A;  4IJA A;  3DOL A;  2YKM A;  3DMJ A;  2V7Z A;  2BTF A;  3THW A;  4FWQ A;  1RTI A;  3BGR A;  2J4R A;  5AQJ A;  3R8E A;  2D0C A;  4BQZ A;  1H1V A;  1X9S A;  4JI0 K;  4ILG B;  4Z4C A;  2XY7 A;  3LM2 A;  2IGI A;  3AVK A;  4RG8 A;  3CFP A;  5EU7 A;  4KV8 A;  5FPM A;  4CF8 A;  2D0P A;  3RRG A;  3SMP A;  2ZJR L;  4JS4 A;  3S41 A;  4JI1 K;  4JEP A;  3U4L A;  4EFH A;  4FW2 A;  5GIO A;  3PSF A;  3A2F A;  3VQ8 A;  3LAN A;  4YFU A;  4DS5 A;  3QDK A;  2JLE A;  4FLW A;  1VQ8 N;  4GY2 B;  4YOR A;  4C8K A;  3P1G A;  3MEG A;  3SCX A;  1LWF A;  4Z4F A;  2O4I A;  2G8U A;  1KTQ A;  3AO4 A;  2KKZ A;  3RR8 A;  3EN9 A;  3TTF A;  3OYK A;  3C95 A;  3TAM A;  4FVU A;  5GAG P;  1LWC A;  1BU6 O;  2ITM A;  1I3A A;  1DEJ A;  4CK3 A;  1NMN A;  1NG9 A;  3BDP A;  4ELV A;  3HK2 A;  1S1V A;  3VQ6 A;  4OPH A;  1LAV A;  2F9T A;  2UXD K;  1FJG K;  3TAE A;  1RTJ A;  2G8K A;  5F2R A;  4FM2 A;  3FZM A;  1SL0 A;  2I7P A;  4LF4 K;  1QQN A;  4CEQ A;  3BF1 A;  4G9Z A;  1U04 A;  2DFH A;  4FM0 A;  1XMQ K;  1Q9Y A;  4FJL A;  3TAF A;  1JCF A;  3QEP A;  3O3H A;  3TSP A;  3ATV A;  3AVA A;  3EL2 A;  3NH2 A;  2ZQB A;  3ID6 A;  4CFC A;  4JK8 A;  5DM6 L;  4IOC L;  3WXK A;  4DTN A;  3CXC M;  2B4J A;  3WXM B;  5HRN A;  2ZF5 O;  4FWN A;  5LL6 Z;  2A6A A;  4YDU A;  2YHY A;  3OYD A;  4CD1 A;  1DKG D;  3O1W A;  2QM1 A;  3OHR A;  3VN5 A;  4Z4I A;  1BI4 A;  1WSF A;  4O5F A;  4FLX A;  2YHB A;  3RR7 A;  5GIP A;  4KHY A;  4IBN A;  5GAH P;  4FOE A;  4B3T K;  2GV9 A;  3D2E A;  4PKI A;  4IEE A;  4CBU A;  5BRF A;  4CJQ A;  4Z4E A;  4BVP A;  5D3G A;  2P9U B;  2VWK A;  3O8M A;  3C6U A;  2O8C A;  2BUP A;  5C15 A;  1W2B M;  1NKE A;  3E9O A;  1R0A A;  3O4N A;  2WUS A;  1Q18 A;  2CH6 A;  2Q31 A;  4AM6 A;  4FJN A;  2HHH K;  1NGI A;  4FWL A;  4A62 A;  4DUY K;  5EY4 A;  5AQV A;  3KVG A;  3O1B A;  2G8H A;  3AAP A;  2IDO A;  1RT5 A;  1K9M O;  1NMD A;  3MCA B;  1L5U A;  2Q36 A;  5DK5 A;  3VQD A;  1U2V B;  1VSI A;  1BWF O;  4GKK K;  4ILH A;  1NGB A;  3RVC A;  1YIT N;  3SAG A;  4ZTJ A;  1SL1 A;  1RGI A;  2OPP A;  3L3V A;  2O8B B;  1JLA A;  3DLR A;  3H3N O;  2ZJQ L;  3OYN A;  2FXU A;  4XH4 A;  3KD5 E;  2E2N A;  3OA9 A;  4HVJ A;  2H3G X;  2OTJ N;  3QBW A;  2NUB A;  3CMA N;  1TYQ B;  4QS9 A;  4FZY A;  3AO2 A;  3CJ9 A;  5AZI B;  3P38 A;  4EHT A;  4KHP K;  5ADX H;  3VF6 A;  1NKC A;  4CFD A;  5KQD A;  4E3S A;  1D5A A;  3KLF A;  1VQ9 N;  4XEI A;  2AP1 A;  3SBG A;  4CJF A;  3KD1 E;  1U49 A;  3M8S A;  4BRP A;  1EET A;  2W42 A;  3AVJ A;  1RFQ A;  2QWN A;  2QWM A;  1QHA A;  3QEI A;  1RT4 A;  1SUQ A;  4FK0 A;  2YNI A;  3WNE A;  4DHY A;  1SKW A;  3MXM A;  1VAZ A;  1JL2 A;  2HHV A;  3AVM A;  2OZS A;  4MLE A;  3DLK A;  3QES A;  1BO5 O;  4ILJ A;  1X9M A;  5C42 A;  4BQL A;  1S6Q A;  3ZSO A;  1NOY A;  2QA4 N;  4DSL A;  4N47 A;  3LDQ A;  3NGZ A;  4FJ7 A;  1VSH A;  1J6Z A;  3QB0 A;  2DFE A;  3HYF A;  4KH6 A;  4DR2 K;  1RDC A;  4DQ8 A;  4CE9 A;  1XC9 A;  4FCY A;  4BDY A;  1S72 N;  2UXB K;  4ISE A;  3VGL A;  3NF6 A;  1XWL A;  4JHD A;  2NNW A;  3MN6 A;  4BWJ A;  3U3Y A;  1OH5 A;  3VQ9 A;  1VQM N;  4CJU A;  4X66 K;  3GDQ A;  4Y0W A;  4BRL A;  4M3U A;  5KGX A;  1C0G A;  5C2D A;  1HYV A;  1W0H A;  2UUA K;  3CER A;  1EO1 A;  3PUF A;  4FLY A;  5CY4 A;  4HUG A;  2QWO A;  1OH7 A;  3FE1 A;  3E66 A;  3F9K A;  3C6T A;  1RT3 A;  3AA3 A;  3A0I X;  1A5X A;  1WNS A;  3AO1 A;  4W5Q A;  1SKR A;  4W5N A;  4CCH A;  3OY9 A;  2HST A;  4U7B A;  1IG8 A;  1UOC A;  3I8B A;  3DYA A;  2QKB A;  3HRG A;  4WYB A;  1WBD A;  4O8K A;  4H8K A;  4Z0U A;  4MQ3 A;  3SQ4 A;  3LDN A;  3P39 A;  4HTU A;  1GLF O;  2E5L K;  5KGW A;  1TV6 A;  3QER A;  3ZCM A;  3C7N B;  1S3X A;  2E6L A;  1KQS M;  3CM5 A;  3HM8 A;  4JAX A;  3DM2 A;  3O9R A;  4J2A A;  3LP2 A;  4CGJ A;  1G15 A;  1Q7Y O;  3O08 A;  4DFP A;  2ITG A;  4PKG A;  3KKS A;  1TAU A;  2WBN A;  4LSL A;  4CJE A;  4NCG A;  4H4M A;  1TKD A;  5C24 A;  3OYJ A;  2WTU A;  1JLF A;  4E1J A;  4I9Q A;  3F2K A;  4ID5 A;  1YT3 A;  2OPQ A;  1WSI A;  1SS6 A;  3OYC A;  3NDK A;  4NCA A;  1T3V A;  3C7N A;  4OJR A;  1ZBI A;  1DT9 A;  3RRH A;  1B92 A;  5LJW A;  4KHN A;  1LV5 A;  5M1F A;  1LCU A;  4ISG A;  3MN9 A;  1IKX A;  3LL3 A;  3BP8 A;  3RMC A;  4FWK A;  2QWP A;  1WUA A;  2F8S A;  1GLC G;  1RCH A;  4JKG B;  4IXC A;  3VQA A;  1J53 A;  3MX5 A;  2A3Z A;  2KQ2 A;  3BY5 A;  2NRW A;  1VSF A;  4H4O A;  1GLJ O;  4BR0 A;  4V19 S;  3LAL A;  4BRA A;  3U6F A;  2HVI A;  5FRN A;  2W6L A;  3AVG A;  3ZSW A;  5ADX A;  2QW9 A;  1S1W A;  5J2P A;  1QE1 A;  3D7E O;  3LZJ A;  3N4Q A;  1VQ6 N;  4ICL A;  3BF3 A;  3KWG A;  1M1K O;  2QK9 A;  3WXI A;  2A42 A;  1I94 K;  3V1Q A;  4WE1 A;  4CJ5 A;  1BG3 A;  4IWV A;  1BA1 A;  2P51 A;  3EKS A;  2ZM6 K;  3IDH A;  4QS7 A;  1XMO K;  2GEM A;  5GAE P;  2YI1 A;  1IBK K;  3SLC A;  4FWS A;  4M3T A;  3AVC A;  4MFB A;  4K8Z A;  4BC4 A;  3ULE A;  3VF2 A;  3LP3 A;  5M1Q A;  3CJ7 A;  2PY5 A;  3NH1 A;  5AQL A;  4K41 A;  4JI4 K;  3MCP A;  2QEX N;  3ZX0 A;  4DG1 A;  3WXJ A;  5M1P A;  4DTJ A;  4RW9 A;  4Y1C A;  5AQG A;  3NGI A;  2E88 A;  1HPM A;  2QXL A;  4FSV A;  1VHX A;  2QI2 A;  4LFC K;  4G1Q A;  3FFK B;  1TK5 A;  3L4Q A;  1EKE A;  4CIE A;  3V9U A;  2Q97 A;  5SZT A;  3PX0 A;  4N41 A;  1XNQ K;  3VEN A;  4I6M B;  1HNW K;  1CZB A;  4DSI A;  4RWT A;  1BDG A;  4MO4 A;  4CW7 B;  1T6C A;  3FZL A;  2O8F B;  3BUZ B;  4H5N A;  3KJV A;  3L8B A;  3ZEU A;  1LAW A;  2WFB A;  2HHX A;  3TTD A;  5BN9 A;  3OYA A;  4C23 A;  1C1C A;  5BR9 A;  3DI6 A;  1TUY A;  3HJF A;  1JL1 A;  3SV3 A;  3OVN A;  5C25 A;  5KTQ A;  3HOT A;  2OYQ A;  4EZ6 A;  3K0S A;  1RBR A;  2F9W A;  2OPS A;  2NLX A;  1X9W A;  1NGC A;  3RWU A;  4CEZ A;  3QO9 A;  4HCB A;  5AQY A;  3A5L C;  4DQI A;  3NF7 A;  3OJU A;  3AVI A;  4FLT A;  3LDL A;  4OVL A;  1G99 A;  2KLA A;  4IJN A;  4DR6 K;  4OO1 J;  3NGY A;  2HW3 A;  1QZ6 A;  4CBW A;  3JXU A;  4L3Q A;  4XH5 A;  4MDA A;  1C0M A;  5HRO A;  4A5A A;  3PO5 A;  4XIU A;  1YJW N;  1NM1 A;  3C0B A;  3CI5 A;  2A5X A;  1JXE A;  4CJ4 A;  3F5T A;  2YJF A;  3K58 A;  3K9J A;  3HSC A;  4CIF A;  3SAH A;  1VSJ A;  1ZBL A;  2OAN A;  4BC2 A;  5LMN K;  2O8C B;  3OS2 A;  4PWD A;  3ASM A;  4PQU A;  2BE2 A;  5E84 A;  4CHO A;  4BG8 A;  4DWI A;  4OPK A;  4JD2 B;  1KVC A;  5BRH A;  4CEA A;  2VQF K;  2IIR A;  1BHL A;  2E2Q A;  3J80 O;  3DXM B;  4IOX A;  2OA8 A;  3WNF A;  4BG9 A;  3FZF A;  4PUO A;  3ZT2 A;  3KK7 A;  3AA2 A;  3S3N A;  4B3M K;  3ENO A;  3LDO A;  4CHQ A;  1W97 L;  2YKN A;  2YNF A;  1CZ9 A;  1HLU A;  2EWS A;  4BY9 C;  1YIJ N;  1ILY A;  4IKF A;  1X3N A;  3V1R A;  3AGR A;  2E1Y A;  4BR4 A;  4F3T A;  3PIO L;  1YUW A;  3QEX A;  3C65 A;  3MMV A;  3OW2 M;  4I6M A;  1NNE A;  5A2Q O;  1NJZ A;  3LPT A;  3WEE A;  4H0Y B;  3VEW A;  3H45 C;  4O0J A;  3M6G A;  3HOS A;  4JLH A;  4IO9 L;  4JI3 K;  3ZYY X;  2HF3 A;  3CME N;  3P5J A;  4CZL A;  1XC3 A;  3CCQ N;  1KLM A;  1YJ9 N;  1ASW A;  2GEL A;  3FLC O;  4WQ5 A;  5BN8 A;  1K8K B;  4OKK A;  4DTU A;  1UA0 A;  3M5R A;  4BRF A;  4M41 A;  5CR4 A;  1C0T A;  1KAZ A;  3T1Y K;  3LPU A;  3KK1 A;  5TKY A;  4AHU A;  3H46 O;  1V4S A;  4WF9 L;  3VA3 A;  4W5O A;  3CCM N;  2O8D B;  3K57 A;  4JS5 A;  1ATS A;  4B9M A;  4DTX A;  1JCG A;  4BC5 A;  4CED A;  5I9E B;  3CCU N;  1E3M A;  1NK9 A;  3CCE N;  2ZWH A;  5AQI A;  4CEC A;  2O8D A;  1EXQ A;  3DRP A;  3G0Z A;  4KHQ A;  2P9P A;  4BGA A;  1P90 A;  2RE2 A;  4DMN A;  4K43 A;  4F2S A;  4GV3 A;  1VQO N;  5JMV A;  4GW6 A;  4O5B A;  4CZM A;  3JYT A;  3O80 A;  4H0O A;  4CF1 A;  4IFY A;  3SQ0 A;  1NJI O;  3MEE A;  3U9Z A;  1XQS C;  1S5J A;  3C6A A;  3SNN A;  3G10 A;  3AVH A;  3NF8 A;  3T1H K;  3A5M C;  3TAG A;  4DR1 K;  4NYF A;  1JLB A;  5AQO A;  1M90 O;  1VSE A;  2P9K B;  1JLC A;  4HWI A;  4M63 C;  3TTC A;  4WCE L;  4WQ4 A;  4DTM A;  4E7J A;  4A5B A;  3V9W A;  3SV4 A;  4FLV A;  4DR7 K;  3JS6 A;  1U4B A;  4QOZ B;  2A41 A;  4UQG A;  2Y1J A;  4FK2 A;  4BDZ A;  1BIZ A;  5HBM A;  3F9M A;  4DKW A;  1DLO A;  1KD1 O;  1RBV A;  4ZTF A;  4BDP A;  3G4S N;  4WQ5 C;  2PFU A;  3HM9 A;  4KH5 A;  4YNQ A;  4B1W B;  3WXL A;  4KBO A;  4LFA K;  4BRM A;  1RDB A;  1YXQ A;  3QNN A;  1U48 A;  1J9A A;  2IC3 A;  5GIN A;  3M8Q A;  3QML A;  1WOQ A;  3OJS A;  3J7Y P;  2V7Y A;  1N5Y A;  3OYG A;  1KXP A;  4YOX A;  4DV4 K;  4CJT A;  4FZX C;  3SQ1 A;  4OX9 K;  3E1Y A;  4KTZ A;  1T05 A;  3AV9 A;  4BWM A;  1TK8 A;  4O8U A;  4A57 A;  1KSP A;  2A1S A;  3G6E N;  5M1K A;  1RDW X;  3PIP L;  1ZBS A;  2VGN A;  1BGX T;  3EZW A;  3T69 A;  3FZH A;  3HP9 A;  4BAC A;  4FJM A;  5JS1 A;  1VSL A;  1VQ4 N;  2W41 A;  2EX3 A;  2PYJ A;  3D2F B;  4MO5 A;  3CIP A;  4DQQ A;  4M3W A;  1BIU A;  1LW2 A;  1JLG A;  1RT7 A;  4DS4 A;  3DJC A;  4BRQ A;  1JJ2 M;  3ISN C;  4DSK A;  2E1Z A;  1IV0 A;  3VES A;  2YHW A;  4JI7 K;  4FJ5 A;  1HQE A;  3AA5 X;  5CYQ A;  1L3V A;  4FYD A;  2UXC K;  1RDA A;  4LF5 K;  3M3Z A;  3SJH A;  1MWK A;  4HTL A;  3ZET B;  1FK9 A;  3TPQ A;  3HPH A;  5AQK A;  2IVN A;  1IKW A;  4BRH A;  4CBX A;  5HLF A;  2X78 A;  1LWE A;  4FW1 A;  1VQL N;  2FSN A;  1UA1 A;  4FJJ A;  3I8D A;  1ASV A;  4E0D A;  3GE1 A;  3DLL L;  3LDS A;  1ZXO A;  3R1X A;  1TAQ A;  1WAJ A;  3WQT A;  4F3O A;  5AR0 A;  1IBM K;  3NAE A;  1B9F A;  5HRS A;  1YI2 N;  5J1E A;  3U3G A;  4HCC A;  4RW4 A;  1OKJ A;  4W5R A;  3UE5 A;  1P8Z A;  1NJW A;  3SI6 A;  4QAG A;  3O3G A;  4CHP A;  1HQU A;  3VMF B;  1QSL A;  2HBM A;  2G8V A;  4BGB A;  3OS1 A;  1LOT B;  1XUP O;  4KO0 A;  3SUP A;  2FBV A;  4JV5 K;  5M1N A;  1BCM A;  3S3M A;  4AQY K;  1RTH A;  2IS3 A;  4PL7 A;  1WSH A;  3K2P A;  4AHS A;  5I3U A;  3IRX A;  4KHU A;  3E9L A;  4KB1 A;  4CZE A;  3R3L A;  4FJI A;  4PY5 A;  1VQ5 N;  3UIQ A;  4CZG A;  1WLJ A;  1GOA A;  4FXD A;  5CHI A;  3VQQ A;  3SUO A;  3SQ2 A;  4BC3 A;  2NRZ A;  3DLG A;  4DU4 A;  3DXK B;  4DLG A;  4BRO A;  1EWQ A;  3P4I A;  1ZC6 A;  5CZ2 A;  3ZT1 A;  5HRR A;  3UKU B;  3CCR N;  5TKW A;  4LH5 A;  2HOE A;  1XNR K;  3I56 N;  5KRS A;  3AA4 A;  5BPN A;  4FPB A;  1BL3 A;  4PL8 A;  4DF4 A;  3PSI A;  1X1P A;  1YVU A;  3IG1 A;  4AM7 A;  4DU1 A;  4GV9 A;  2QXF A;  1C1B A;  4RCH A;  4H5W A;  3LWM A;  2UU9 K;  4DR5 K;  1BIS A;  4FJK A;  4DSE A;  3ITH A;  3CJA A;  2QTD A;  4YOT A;  4FJH A;  3K5M A;  5KPZ A;  4F8R A;  2YJE A;  5CZ1 A;  4FK4 A;  4M45 A;  3HTV A;  5KPR A;  3D45 A;  1KRP A;  4B8C A;  2F4V K;  1VK0 A;  4B3O A;  4YDU C;  5HOO A;  1U2V A;  4CJV A;  4IG3 A;  2OTL N;  2O4G A;  2HBJ A;  2Q1N A;  5H1S Q;  5AQQ A;  2G8F A;  3R6M A;  1KVA A;  3H6E A;  3MED A;  3H1Q A;  4CZI A;  4KI4 A;  1BI4 B;  5J2Q A;  3C94 A;  1U45 A;  1DTQ A;  2ASO A;  3I33 A;  3V9Z A;  4DFJ A;  3L2W A;  4EHU A;  4CEB A;  3D0P A;  3VQ7 A;  4GKJ K;  4DQS A;  3TU5 A;  5EOY A;  2D0B A;  3KLI A;  4ID1 A;  2QKK A;  2HND A;  4CF2 A;  2Y1I A;  2O8F A;  1NGD A;  5AQN A;  1DTT A;  3IFR A;  1DGK N;  4F9O A;  1MU2 A;  1TUU A;  3NMU A;  4JKH A;  3VQB A;  1IKY A;  2P9K A;  4EP5 A;  4E7H A;  2OCE A;  4H5V A;  4CHN A;  2A40 A;  3PY8 A;  5MLC Q;  4FVM A;  5IT9 O;  4IFE A;  5BPL A;  4FJX A;  4DFK A;  4BR7 A;  4J2B A;  3SYZ A;  4DB3 A;  4M7X A;  4QS8 A;  3B6P A;  5AQW A;  3TSQ A;  3DAW A;  3IS9 A;  2Q0R A;  4NB4 A;  3SJJ A;  4LFB K;  2P9S A;  4R5P A;  4PA1 A;  3CC2 N;  4WFB L;  4K0K K;  3W3D A;  2P1J A;  5EXW A;  3JSM A;  3J81 O;  3QFU A;  1VQN N;  1HKG A;  5AFU H;  1T6D A;  3CPE A;  1UWB A;  1NBW A;  2GX9 A;  3O6W A;  3NCI A;  3FFI A;  4JNE A;  3ZT4 A;  3ALY A;  4O44 A;  3ZET A;  3V9S A;  2WC9 A;  4BR9 A;  3O9T A;  2OZM A;  4JKG A;  4Q5V A;  3U9D A;  3IMX A;  3OYE A;  2GUP A;  4A59 A;  1HYS A;  1NJX A;  2UUC K;  2E8A A;  2PAV A;  4X62 K;  1VQP N;  1NJY A;  5HP1 A;  3SBT A;  4PHT X;  1ESV A;  3SK3 A;  3HP6 A;  1Z6R A;  4I2Q A;  1KAY A;  3CCL N;  4PKH A;  3CHW A;  3MXJ A;  1VRT A;  3RMD A;  3LM9 A;  3CFO A;  3L2R A;  4E7L A;  4AHV A;  4NLC A;  3KZB A;  4WQ4 C;  4B9N A;  1VQ7 N;  1T44 A;  2VG6 A;  3DLB A;  1YJN N;  3KTQ A;  1WAF A;  4JI5 K;  4DQR A;  2F96 A;  1EX4 A;  3VTH A;  1NOZ A;  4CZF A;  2GTD A;  1HKB A;  4CGH A;  2NRV A;  3KK3 A;  1RTD A;  3I55 N;  3AVF A;  3ZSV A;  2YHX A;  4CJP A;  1Z26 A;  1S6P A;  3QLH A;  2RKI A;  1HKC A;  4CER A;  4N5S A;  2RN2 A;  4XH1 A;  4JN4 A;  3OBW A;  3THW B;  4LH4 A;  5JIC A;  4CF0 A;  2D0O A;  2Z1J A;  5C10 A;  1T8E A;  4CJW A;  2IVP A;  3VER A;  1GLA G;  2XO7 A;  1O1W A;  3VEO A;  1T03 A;  2P5G A;  3MN5 A;  3L2U A;  1CLQ A;  3OYI A;  2KFZ A;  2NRX A;  1OH6 A;  2UYT A;  4B9S A;  1YF5 L;  3ULE B;  2P5O A;  1WBB A;  1OVY A;  5AQX A;  3G71 N;  2UUB K;  2V52 B;  4LF7 K;  2KZM A;  4I9L A;  3QET A;  2DY4 A;  3QIP A;  3O4Q A;  3VTI A;  3KLH A;  4A2A A;  1JCE A;  1K8A O;  4B9L A;  3VQC A;  4DFM A;  3I0R A;  2D1K A;  4C8L A;  4X65 K;  1RBU A;  2DPN A;  5FRO A;  1QQC A;  5FRM A;  3RSE A;  2P9I A;  3MWT A;  1Y64 A;  1SKS A;  3K59 A;  3HPO A;  1NWK A;  2DFF A;  2LSN A;  3VQ4 A;  1RT1 A;  1L3T A;  4OGC A;  5EVZ A;  1XHX A;  3D2E B;  4DU3 A;  4KRE A;  3R9P A;  5EX5 A;  2HVH A;  4CEE A;  1SV5 A;  4BRE A;  4FJG A;  1QQM A;  2ZD1 A;  1NK8 A;  5DM7 L;  4CZK A;  3P31 A;  3DRR A;  2YX6 A;  2FSJ A;  4CEO A;  2AA4 A;  1TL3 A;  4J8F A;  2YCH A;  2AJQ A;  3CCV N;  5FPN A;  2Z1I A;  4DV1 K;  4B3S K;  4CD3 A;  4JYA K;  3KLG A;  2IOC A;  4JKD A;  3KHY A;  1FW6 A;  3CFR A;  1J5E K;  3VQE A;  1EQY A;  3NF9 A;  3HT3 A;  4H5T A;  5CYM A;  3CD6 N;  4O55 A;  3AVB A;  1JKH A;  4CHY A;  4FZZ A;  2VCP A;  4B9T A;  3M8P A;  4DV3 K;  3DRS A;  1J5O A;  2FBX A;  3U8X A;  4CGF A;  4IFV A;  3RMA A;  1NU0 A;  1VSK A;  3LP0 A;  4AF1 A;  4YOV A;  3NBP A;  2IAJ A;  1NGG A;  3VA0 A;  4DV5 K;  3ENB A;  4CZJ A;  3B8A X;  1WSG A;  3CJ1 A;  1NK7 A;  3VGM A;  4FPA A;  3L2V A;  3MEC A;  2XY8 A;  4FWP A;  4CK2 A;  2ZE2 A;  5LJV A;  1S22 A;  2ZGZ A;  2HNY A;  2BGG A;  1B9D A;  1TKX A;  2KTQ A;  1U6Z A;  1GLD G;  4JD2 A;  5AZI A;  1KC8 O;  3Q7B A;  3KK2 A;  2VQE K;  4BE0 A;  1GLB G;  3EY1 A;  4U67 L;  3A5N C;  4FWO A;  4CEF A;  3CCJ N;  1WSE A;  4F4K A;  1IBL K;  3V4I A;  2VGM A;  3BEX A;  3GL1 A;  3Q7C A;  1VSM A;  3AGK A;  2R7Y A;  5BRD A;  2Q3S A;  4KKO A;  3FGU A;  3K5N A;  3BZC A;  1RBT A;  2GUI A;  2NRR A;  2BH1 A;  1NGE A;  1TKZ A;  3ZT0 A;  1C6V A;  1QQO A;  3WT0 A;  4B1Z A;  4EP4 A;  1L3U A;  2EHG A;  5AQR A;  4KRF A;  4OGE A;  5LMU K;  2O8E A;  1FXX A;  2WON A;  4OKJ A;  1D9F A;  1BOT O;  3MWP A;  3IKM A;  4F2R A;  4QCL A;  4B9Q A;  4BE2 A;  3HI0 A;  4OLA A;  3JAM O;  4E19 A;  2P9N B;  5KI6 A;  3TAQ A;  2HMI A;  1NKB A;  1NGF A;  4B9V A;  1IO2 A;  5GAD P;  3MAQ A;  1FKP A;  4DSF A;  1W7A A;  1YHQ N;  1BQM A;  1YAG A;  3EE8 A;  1VRU A;  3PO4 A;  2E4L A;  4C1N K;  2GWK A;  1Z25 A;  2CH5 A;  1A5V A;  4Z4G A;  1KVB A;  3CCS N;  1HJO A;  1QZ5 A;  2ZGY A;  4DCH A;  3VEZ A;  4LD0 A;  4B1V A;  3LWL A;  4AH9 A;  4JRQ A;  4M3X A;  3OBY A;  4H0T B;  2HF4 A;  5AZJ B;  1SL2 A;  2PYL A;  3HVT A;  3CQX A;  4HHT A;  1ATN A;  3V1O A;  1S1X A;  3L0Q A;  4AIL C;  2VG5 A;  4AHC A;  2CGJ A;  2GBZ A;  1MA9 B;  3D6R A;  3WQU A;  3UKR B;  3HZ6 A;  4OKE A;  1C0F A;  4CZH A;  3C6H A;  4YOU A;  5AZJ A;  5JLF A;  3CC7 N;  3PV8 A;  3VEX A;  2X6N A;  3M1F A;  4JK9 A;  3CF5 L;  3S3O A;  3NVM A;  4NCB A;  3QIN A;  1N6Q A;  1N32 K;  3J8A A;  5FDL A;  4YHH K;  3THX A;  1J54 A;  3EKU A;  4C1N I;  4YOW A;  1KLN A;  1GOC A;  4YY3 K;  3O9S A;  5JS2 A;  1OH8 A;  4LF8 K;  2P9L B;  3DOK A;  4Z94 A;  5HRP A;  3EZ5 A;  2HHU A;  1QS4 A;  2JWL A;  4KPY A;  4IDH A;  3ZLJ A;  4CHZ A;  1LW0 A;  3HVR A;  1C0U A;  2VG7 A;  2E2P A;  2BAN A;  5C2F A;  1NGJ A;  4JRP A;  1TVR A;  1Q8I A;  2I7N A;  4FLZ A;  1S9G A;  2X74 A;  3EO3 A;  4H0P A;  1HR0 K;  2NRH A;  1YTA A;  1HMV A;  3TAR A;  2BDP A;  3VQ5 A;  4IZ9 A;  4ELU A;  4BR2 A;  4DTS A;  1QVG M;  4BRD A;  4OPA A;  3WNG A;  4GVM A;  2KZZ A;  4DLE A;  1K6Y A;  1HPZ A;  1F21 A;  3F73 A;  2B6A A;  5FPE A;  2IVO A;  1JXB A;  2NZT A;  2Q2R A;  5AJ3 K;  2QWL A;  2P9N A;  4O4G A;  3VPZ A;  5M1O A;  3K5O A;  1D9D A;  4C8N A;  3OYB A;  4H5R A;  5I42 A;  2A1R A;  5JVG L;  2P9S B;  1HJR A;  3WUH A;  2D4W A;  3D2F A;  4GNI A;  4LSN A;  4H0X B;  2PBD A;  3N4P A;  3ZX3 A;  3DLE A;  3THV A;  1EWR A;  4B08 A;  4JI6 K;  4DTO A;  3QNO A;  3ZSQ A;  4DTP A;  3MXI A;  3I0S A;  4FWM A;  4Y1D A;  3PX4 A;  1NK5 A;  4FWR A;  2Q0U A;  3CJB A;  1TL1 A;  2Z1G A;  3O9U A;  2D0A A;  2G8I A;  2RHK A;  1ZBU A;  3DWL A;  3TAP A;  4FJ9 A;  4KAZ A;  3NHG A;  3QEV A;  1Y97 A;  3H08 A;  3CG7 A;  3OTO K;  5JLH A;  5AQU A;  2O8E B;  1U47 A;  1N34 K;  1VSD A;  4CJK A;  2QWR A;  3KIO A;  1RNH A;  1C1A A;  3VF4 A;  3WNH A;  4BR5 A;  1KFD A;  1E4F T;  2HHQ A;  1S1U A;  1N33 K;  4WFA L;  4FOI A;  4JK7 A;  2XY5 A;  4LF6 K;  2W40 A;  3CQ8 A;  1XI1 A;  1BQN A;  4MLH A;  4UY8 O;  1QSS A;  4KTQ A;  4EZ9 A;  3EYZ A;  1D4X A;  2P9L A;  5KQ8 A;  3OYH A;  1SAZ A;  4J2E A;  4M7Y A;  4N76 A;  5AQP A;  4RW8 A;  3T1A A;  1TGO A;  2PZS A;  4DV7 K;  3OS0 A;  3THX B;  3W0L A;  4FM1 A;  1NLV A;  4NLB A;  1RT2 A;  1K73 O;  4B1X B;  5DMR A;  3B6O A;  4RW7 A;  4FJ8 A;  2CGL A;  2DTU A;  4CVN E;  5E26 A;  1K8K A;  4E7K A;  1N36 K;  5BRE A;  4WFN L;  4NXN K;  3AAR A;  3NVK A;  3CC4 N;  4KHS A;  5BPM A;  1YVN A;  3L4I A;  1ITG A;  2FC0 A;  1QTM A;  1NK0 A;  3S9H A;  4DSJ A;  5LY3 A;  4BRG A;  5AQM A;  3T3F A;  4C8O A;  3O3F A;  1ZBF A;  3SUN A;  2I5J A;  5HL7 L;  4I7F A;  4LC9 B;  4NXM K;  3HL8 A;  3UKU A;  3LP1 A;  4B9U A;  5KRT A;  3IUC A;  1A5W A;  2P9P B;  2X6S A;  4FLU A;  3THY A;  3T19 A;  4CJ7 A;  2Z1H A;  1CZA N;  4JKE A;  4E1M A;  3LZI A;  4R79 A;  1CXQ A;  3O4W A;  4TSX A;  4J2D A;  2HB5 A;  4IOA L;  3OYF A;  4IO8 A;  4CES A;  3SZ2 A;  1E4G T;  3QBX A;  1BUP A;  4ISF A;  2FBY A; 
#chains in the Genus database with same CATH homology
 2P5G A;  4IG0 A;  4CEC A;  4ZTJ A;  1SL1 A;  3L2U A;  3ZSR A;  1CLQ A;  2OPP A;  3L3V A;  3OYI A;  2KFZ A;  1EXQ A;  1JLA A;  3AO5 A;  3DLR A;  5T7B A;  4B9S A;  3DRP A;  3OYN A;  2FBT A;  3G0Z A;  1IG9 A;  2P5O A;  4KHQ A;  3VQP A;  4IDK A;  3LAM A;  2KZM A;  4DMN A;  3KD5 E;  4I9L A;  3QET A;  2DY4 A;  3QIP A;  4HVJ A;  3O4Q A;  4F2S A;  3KLH A;  2XRI A;  1ZBH A;  4B9L A;  3VQC A;  4DFM A;  3I0R A;  4CF9 A;  2NUB A;  4GW6 A;  4O5B A;  3DLH A;  3JYT A;  4C8L A;  4FZY A;  1RBU A;  2WOM A;  3AO2 A;  5FRO A;  1QQC A;  1NK6 A;  5FRM A;  4CF1 A;  4IFY A;  3SQ0 A;  4CJS A;  5K14 A;  4L8R B;  1SKS A;  3K59 A;  3HPO A;  2DFF A;  2LSN A;  1W9H A;  3MEE A;  1NKC A;  4GMJ B;  3VQ4 A;  1RT1 A;  2KW4 A;  2OPR A;  4CFD A;  1S5J A;  4OPJ A;  4W5T A;  1L3T A;  4OGC A;  1XHX A;  4E3S A;  3SNN A;  3AVN A;  3AVH A;  3G10 A;  3NF8 A;  3ULD A;  4DU3 A;  4KRE A;  1D5A A;  3KLF A;  3TAG A;  4NYF A;  3HO1 A;  1JLB A;  4CJF A;  3L3U A;  4HUF A;  3V81 A;  1VSE A;  3KD1 E;  2HVH A;  2ATQ A;  1JLC A;  1U49 A;  4CEE A;  3M8S A;  1SV5 A;  2E6M A;  4FJG A;  1RIL A;  2ZD1 A;  1T7P A;  4DTM A;  1EET A;  5J2M A;  4E7J A;  4B8A B;  1NK8 A;  4M3R A;  2XHB A;  3V9W A;  2W42 A;  3AVJ A;  3TI0 A;  3SV4 A;  4FLV A;  3DRR A;  1S1T A;  3M8R A;  1U4B A;  4CEO A;  3QEI A;  4KI6 A;  4QOZ B;  4HUE A;  1RT4 A;  1TL3 A;  4UQG A;  1SUQ A;  4KFB A;  4FK0 A;  2YNI A;  3ZT3 A;  2Y1J A;  4BDZ A;  4FK2 A;  1BIZ A;  2AJQ A;  2YNG A;  2Z1I A;  5HBM A;  3WNE A;  1DLO A;  3KLG A;  2RF2 A;  1SKW A;  3MXM A;  2IOC A;  1RBV A;  4ZTF A;  1JL2 A;  4BDP A;  1RDD A;  2HHV A;  3CFR A;  3TR8 A;  3HM9 A;  4YNQ A;  3AVM A;  2OZS A;  3DLK A;  3KKR A;  3VQE A;  3NF9 A;  3HT3 A;  5CYM A;  1GOB A;  3QES A;  3TAN A;  4O55 A;  1BCO A;  1RDB A;  1JKH A;  3AVB A;  4CHY A;  4FZZ A;  1X9M A;  1HNI A;  5C42 A;  3SPZ A;  3P83 D;  5SWM A;  1HYZ A;  1S6Q A;  3CM6 A;  3ZSO A;  3QNN A;  1J9A A;  2IC3 A;  1U48 A;  1NOY A;  4B9T A;  4N47 A;  3M8P A;  3M8Q A;  3DRS A;  3NGZ A;  3E01 A;  1J5O A;  4DSL A;  4FJ7 A;  1VSH A;  2FBX A;  4CGF A;  4CJ3 A;  2DFE A;  3HYF A;  4CJL A;  4IFV A;  3RMA A;  3V9X A;  1RDC A;  1VSK A;  4CE9 A;  2RPI A;  3LP0 A;  1XC9 A;  3OJS A;  4C8M A;  4BDY A;  4FCY A;  1N5Y A;  3OYG A;  1KCF A;  3NF6 A;  1XWL A;  4BWJ A;  3NBP A;  4E1N A;  2IAJ A;  3VQ9 A;  3U3Y A;  3PX6 A;  3NFA A;  4CJU A;  3VA0 A;  1IH7 A;  4CJT A;  4NYN A;  4FZX C;  3SQ1 A;  1TK0 A;  4KTZ A;  1WSG A;  1T05 A;  1NK7 A;  3AV9 A;  4BWM A;  1TK8 A;  4M3U A;  5KGX A;  3L2V A;  1HYV A;  1W0H A;  3MEC A;  2XY8 A;  1QSY A;  1KSP A;  4CK2 A;  2ZE2 A;  4O0I A;  2JGU A;  2A1S A;  1ASU A;  3L2Q A;  3PUF A;  4FLY A;  5CY4 A;  3NE6 A;  2HNY A;  4HUG A;  1B9D A;  2BGG A;  1TKX A;  4K8X A;  1BGX T;  3OYL A;  2KTQ A;  4M3Y A;  3F9K A;  3KLE A;  3C6T A;  4DTR A;  1RT3 A;  3HP9 A;  4BAC A;  4FJM A;  5JS1 A;  3AA3 A;  3LAK A;  1VSL A;  1A5X A;  1WNS A;  3KK2 A;  4BE0 A;  2HHS A;  3AO1 A;  3EY1 A;  4CGD A;  4W5Q A;  2EX3 A;  1SKR A;  2PYJ A;  4CCH A;  2HHW A;  4W5N A;  3OY9 A;  2HHT A;  4CEF A;  1UOC A;  1WSE A;  4F4K A;  1Q9X A;  3HST B;  3DYA A;  4DQQ A;  1IKV A;  3V4I A;  4M3W A;  1BIU A;  1LW2 A;  1JLG A;  1RT7 A;  4DS4 A;  3SPY A;  4ELT A;  2QKB A;  1VSM A;  2R7Y A;  2Q3S A;  3ISN C;  1HNV A;  4AHT A;  1WN7 A;  4DSK A;  4KKO A;  4H8K A;  3K5N A;  3SUQ A;  1RBT A;  2HNZ A;  4MQ3 A;  4Z0U A;  2GUI A;  4FJ5 A;  3SQ4 A;  4N56 A;  4HTU A;  2YV0 X;  1HQE A;  3AA5 X;  4LY7 A;  5KGW A;  3TWH A;  1TV6 A;  4DQP A;  3QER A;  5CYQ A;  1L3V A;  4FYD A;  4CGG A;  1RDA A;  4Z4H A;  1TKZ A;  3ZCM A;  3ZT0 A;  1JLQ A;  1C6V A;  1UAX A;  4EP4 A;  2E6L A;  1EP4 A;  1L3U A;  2EHG A;  1FK9 A;  3CM5 A;  4KRF A;  4OGE A;  1FXX A;  2WON A;  3DM2 A;  3HPH A;  4OKJ A;  4J2A A;  1D9F A;  4F2R A;  1REV A;  1WSJ A;  1IKW A;  3LP2 A;  4CGJ A;  2D5R A;  1G15 A;  5HLF A;  4QCL A;  3IAY A;  2X78 A;  1LWE A;  3HPG A;  4FW1 A;  4DFP A;  4DF8 A;  2ITG A;  4BE2 A;  4OLA A;  3KKS A;  1UA1 A;  4M42 A;  4E19 A;  4FJJ A;  1TAU A;  1JLE A;  2HMI A;  4LSL A;  5KI6 A;  1CXU A;  3TAQ A;  1NKB A;  3OYM A;  3I8D A;  1ASV A;  4E0D A;  4B9V A;  4CJE A;  4E89 A;  4NCG A;  4KTW A;  4E7I A;  4H4M A;  3LDS A;  1TKD A;  1IO2 A;  5C24 A;  3MAQ A;  1FKP A;  3OYJ A;  4DSF A;  1BQM A;  1TAQ A;  1JLF A;  1HRH A;  1WAJ A;  4F3O A;  1VRU A;  4CK1 A;  4I9Q A;  3PO4 A;  4ID5 A;  2E4L A;  3NAE A;  1YT3 A;  1B9F A;  2OPQ A;  5HRS A;  1WSI A;  1Z25 A;  5J1E A;  3OYC A;  4OLB A;  3NDK A;  4NCA A;  4RW6 A;  3U3G A;  1NK4 A;  1A5V A;  1XHZ A;  4HCC A;  4KHN A;  4RW4 A;  4Z4G A;  1KVB A;  4OJR A;  4W5R A;  1ZBI A;  3TAB A;  3RRH A;  1B92 A;  3K5L A;  1NJW A;  1L3S A;  3SI6 A;  3AO3 A;  4QAG A;  3O3G A;  4CHP A;  1HQU A;  3NH0 A;  1LV5 A;  1QSL A;  4LD0 A;  3LWL A;  4AH9 A;  4JRQ A;  2VWJ A;  2G8V A;  3OS1 A;  4M3X A;  1IKX A;  2YHA A;  3RMC A;  4KO0 A;  4ZHR A;  2FBV A;  3SUP A;  1SL2 A;  2F8S A;  3CYM A;  1RCH A;  2PYL A;  3HVT A;  4HHT A;  3VQA A;  1BCM A;  1S1X A;  3V1O A;  5E41 A;  3S3M A;  4AIL C;  4KB0 A;  2VG5 A;  4AHC A;  2GBZ A;  1J53 A;  1RTH A;  2IS3 A;  2G8W A;  1WSH A;  2KQ2 A;  3K2P A;  4AHS A;  4CGI A;  1ZYQ A;  1VSF A;  4H4O A;  5I3U A;  4AHR A;  3IRX A;  4CFB A;  4CFA A;  4OKE A;  4KHU A;  4KB1 A;  3LAL A;  3U6F A;  3PV8 A;  2HVI A;  5FRN A;  4CJR A;  3AVG A;  1QHT A;  2X6N A;  4FJI A;  4PY5 A;  3ZSW A;  3S3O A;  3ZSZ A;  2OYQ A;  1S1W A;  3UIQ A;  3QIN A;  5J2P A;  1N6Q A;  4NCB A;  1WLJ A;  1GOA A;  4FXD A;  1QE1 A;  3VQQ A;  2ETJ A;  5FDL A;  3LZJ A;  3ZSX A;  3SUO A;  3SQ2 A;  1J54 A;  1TKT A;  3DLG A;  4ICL A;  4DU4 A;  4DLG A;  3RTV A;  1RBS A;  3QEW A;  1YTU A;  1I39 A;  2QK9 A;  1KLN A;  1GOC A;  4KHW A;  4M3Z A;  5CZ2 A;  3ZT1 A;  5HRR A;  5JS2 A;  2F8T A;  3ZSY A;  5J2N A;  4LH5 A;  3V1Q A;  4WE1 A;  4I2P A;  4CJ5 A;  3DOK A;  2P51 A;  5KRS A;  4Q0B A;  3AA4 A;  5HRP A;  3EZ5 A;  4CEZ A;  2HHU A;  1BL3 A;  3AVL A;  1QS4 A;  4DF4 A;  1X1P A;  1YVU A;  2KFN A;  3IG1 A;  4DU1 A;  4KPY A;  4M3T A;  3AVC A;  4MFB A;  4K8Z A;  4CHZ A;  1LW0 A;  3HVR A;  1C0U A;  2VG7 A;  2BAN A;  2QXF A;  1C1B A;  3LWM A;  4BE1 A;  3LP3 A;  2PY5 A;  3NH1 A;  1BIS A;  4JRP A;  1TVR A;  4FJK A;  1Q8I A;  4FLZ A;  4DSE A;  3ITH A;  1S9G A;  2X74 A;  1RT6 A;  2YNH A;  4CIG A;  3HXM A;  4DG1 A;  1FKO A;  2XY6 A;  3QIO A;  1YTA A;  1KFS A;  1HMV A;  2B5J A;  4RW9 A;  4DTJ A;  3TAR A;  4Y1C A;  1S9E A;  2BDP A;  3NGI A;  4FJH A;  3K5M A;  3VQ5 A;  4F8R A;  4ELU A;  5CZ1 A;  4DTS A;  4FK4 A;  4M45 A;  3WNG A;  3RMB A;  3D45 A;  1KRP A;  4GVM A;  3V6D A;  2KZZ A;  4B8C A;  1K6Y A;  4DLE A;  4G1Q A;  1VK0 A;  1HPZ A;  4B3O A;  1F21 A;  3F73 A;  2B6A A;  1TK5 A;  3V9U A;  1EKE A;  4CIE A;  1D8Y A;  3DOL A;  1JXB A;  3DMJ A;  2YKM A;  4CJV A;  5SZT A;  3PX0 A;  4N41 A;  4IG3 A;  2O4G A;  1CZB A;  1RTI A;  3BGR A;  4DSI A;  4O4G A;  2G8F A;  1KVA A;  2D0C A;  1D9D A;  3K5O A;  1X9S A;  3MED A;  4C8N A;  3OYB A;  2XY7 A;  4Z4C A;  5I42 A;  2A1R A;  3KJV A;  4KI4 A;  1BI4 B;  5J2Q A;  1HJR A;  2IGI A;  3L8B A;  3AVK A;  1LAW A;  4RG8 A;  3CFP A;  2HHX A;  3C94 A;  5EU7 A;  4KV8 A;  4CF8 A;  1DTQ A;  3OYA A;  1U45 A;  3RRG A;  4JS4 A;  3V9Z A;  4DFJ A;  1C1C A;  3L2W A;  3DI6 A;  4LSN A;  3HJF A;  1JL1 A;  3SV3 A;  4CEB A;  3THV A;  3DLE A;  4FW2 A;  3OVN A;  4B08 A;  5C25 A;  5KTQ A;  3D0P A;  3A2F A;  3VQ7 A;  3LAN A;  3VQ8 A;  3ZSQ A;  4YFU A;  4DS5 A;  4DTO A;  4DTP A;  3QNO A;  3I0S A;  3PX4 A;  4Y1D A;  2JLE A;  3MXI A;  1NK5 A;  4EZ6 A;  4FLW A;  1RBR A;  2OPS A;  1X9W A;  3RWU A;  4C8K A;  4DQS A;  1TL1 A;  2Z1G A;  2D0B A;  3KLI A;  3P1G A;  3QO9 A;  2D0A A;  3MEG A;  1LWF A;  4ID1 A;  3SCX A;  1ZBU A;  2QKK A;  4HCB A;  2HND A;  4CF2 A;  2Y1I A;  2G8U A;  1KTQ A;  4Z4F A;  3AO4 A;  2O4I A;  4DQI A;  3RR8 A;  3TAP A;  1DTT A;  3NF7 A;  3OJU A;  4FJ9 A;  4KAZ A;  3AVI A;  3NHG A;  4FLT A;  3OYK A;  3C95 A;  3TAM A;  3QEV A;  1Y97 A;  3H08 A;  1MU2 A;  4OVL A;  3CG7 A;  1LWC A;  1U47 A;  3VQB A;  1VSD A;  1IKY A;  4CJK A;  1I3A A;  3NGY A;  4CK3 A;  4EP5 A;  2HW3 A;  3BDP A;  4ELV A;  3HK2 A;  1S1V A;  3KIO A;  1RNH A;  1C1A A;  3VQ6 A;  4E7H A;  3WNH A;  1LAV A;  1C0M A;  4CHN A;  3PY8 A;  5HRO A;  4FVM A;  3PO5 A;  3TAE A;  1RTJ A;  4FJX A;  1KFD A;  4XIU A;  2G8K A;  4DFK A;  4FM2 A;  4J2B A;  2HHQ A;  3SYZ A;  1SL0 A;  1S1U A;  1JXE A;  4CJ4 A;  4CEQ A;  3B6P A;  1U04 A;  2DFH A;  3IS9 A;  3K58 A;  4FM0 A;  3SJJ A;  4CIF A;  4PA1 A;  4R5P A;  1VSJ A;  2XY5 A;  3CQ8 A;  1ZBL A;  1XI1 A;  1Q9Y A;  4FJL A;  2P1J A;  1BQN A;  3TAF A;  3OS2 A;  1QSS A;  4KTQ A;  4PWD A;  3JSM A;  3ASM A;  3QEP A;  3O3H A;  4EZ9 A;  3EYZ A;  4PQU A;  2BE2 A;  3AVA A;  4CHO A;  3NH2 A;  3OYH A;  4OPK A;  4DWI A;  1KVC A;  2ZQB A;  4DTN A;  4CFC A;  4CEA A;  1UWB A;  4J2E A;  3NCI A;  1BHL A;  4N76 A;  2B4J A;  3FFI A;  3ALY A;  4O44 A;  3ZT4 A;  4RW8 A;  5HRN A;  3T1A A;  3WNF A;  1TGO A;  2OA8 A;  2PZS A;  3V9S A;  4PUO A;  3ZT2 A;  3OS0 A;  3AA2 A;  3S3N A;  3OYD A;  4FM1 A;  4CHQ A;  2YKN A;  1RT2 A;  2YNF A;  3VN5 A;  2OZM A;  1CZ9 A;  5DMR A;  4Q5V A;  3B6O A;  4RW7 A;  1BI4 A;  4FJ8 A;  1WSF A;  3OYE A;  4FLX A;  4Z4I A;  4IKF A;  2YHB A;  3RR7 A;  2DTU A;  3V1R A;  1HYS A;  1NJX A;  4F3T A;  4KHY A;  4IBN A;  4E7K A;  2G8I A;  3QEX A;  2GV9 A;  1NJY A;  5HP1 A;  1NJZ A;  3HP6 A;  3LPT A;  4I2Q A;  4KHS A;  1ITG A;  2FC0 A;  4O0J A;  3MXJ A;  1QTM A;  1NK0 A;  1VRT A;  3S9H A;  4JLH A;  4CJQ A;  3RMD A;  4DSJ A;  3P5J A;  3T3F A;  3CFO A;  3L2R A;  4E7L A;  4C8O A;  4AHV A;  4Z4E A;  1KLM A;  3O3F A;  1ASW A;  5D3G A;  4B9N A;  1ZBF A;  2VWK A;  3SUN A;  3C6U A;  2I5J A;  3DLB A;  2VG6 A;  4I7F A;  3KTQ A;  1NKE A;  1WAF A;  4OKK A;  4DTU A;  3HL8 A;  4DQR A;  2F96 A;  1EX4 A;  3LP1 A;  1UA0 A;  1R0A A;  4B9U A;  5KRT A;  1NOZ A;  1A5W A;  4FLU A;  2X6S A;  3O4N A;  4FJN A;  4M41 A;  1C0T A;  3T19 A;  4CGH A;  3KK3 A;  2Z1H A;  3LPU A;  3KK1 A;  1RTD A;  4AHU A;  1T03 A;  3AVF A;  4E1M A;  3ZSV A;  3LZI A;  1CXQ A;  3VA3 A;  4W5O A;  4CJP A;  1Z26 A;  1S6P A;  4TSX A;  3QLH A;  2HB5 A;  2RKI A;  3K57 A;  2G8H A;  3OYF A;  4JS5 A;  4J2D A;  2IDO A;  1RT5 A;  4CER A;  4N5S A;  4B9M A;  4CES A;  4DTX A;  2RN2 A;  1L5U A;  3SZ2 A;  4CED A;  5DK5 A;  3VQD A;  1VSI A;  4LH4 A;  4CF0 A;  2Z1J A;  1NK9 A;  1T8E A;  4CJW A;  2XO7 A;  1O1W A;  2FBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...