4CEOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceoA00
5FRNA 3OYDA 1FXXA 2YNGA 1FKOA 3ALYA 4O0IA 3QERA 4NYFA 1L3SA 3C95A 4RW9A 4Z4CA 1HNIA 3ZSZA 1S9EA 1D9FA 4KTWA 3ZCMA 3SI6A 3SQ4A 2DTUA 3AA5X 3O3HA 1A5XA 4CEQA 1I39A 4F3TA 3JYTA 1RTIA 2XY8A 3A2FA 5KTQA 4KAZA 1RBVA 4CJ5A 4DTNA 2G8FA 2IOCA 3T1AA 3OJUA 4FLVA 3SUNA 1HRHA 1SKSA 4KRFA 5HBMA 1BI4B 3OYJA 3KJVA 2XRIA 4CJEA 4CFBA 3S3NA 1LV5A 3IAYA 1TKZA 3OYEA 3QNNA 2G8HA 3QEXA 1TGOA 4M3XA 4CHPA 3TWHA 4FZZA 3KKSA 1GOCA 1JLGA 4DG1A 2RN2A 3KKRA 3TI0A 3VQ9A 1C1AA 4KB0A 2FBYA 2BANA 4B9NA 3DLKA 4FM2A 1X9SA 1KLMA 1QSLA 4FJ9A 4AHUA 4FXDA 1TAUA 3IG1A 3LAMA 1KTQA 1HQEA 2FBXA 1R0AA 3C6UA 3NH2A 3V4IA 1JLEA 3SQ1A 1FKPA 4M3UA 2ITGA 3JSMA 1LAWA 3WNHA 1VSMA 1QQCA 3P83D 3LP0A 4CGIA 1RT2A 3CFOA 3QETA 1U4BA 3QINA 1WNSA 4CGGA 4CHZA 3K5NA 1IG9A 4CJFA 4J2AA 1BQMA 1A5VA 4IG0A 4OGEA 5FDLA 5HRRA 4Z4FA 1F21A 4DMNA 2F8SA 2YNIA 4BWMA 4DU4A 1Z25A 3AVJA 4O4GA 4BE0A 3NGYA 4R5PA 3ITHA 1HMVA 1X9WA 2XO7A 1JL2A 2YNFA 3LWLA 1QTMA 1QE1A 2DFFA 4KKOA 3ZSXA 1GOAA 3NE6A 4CGJA 3D0PA 4HCBA 5J2NA 4CEFA 3NGZA 3VQ5A 4NCAA 3T3FA 1WAJA 4KREA 3SUOA 1C6VA 2HNYA 4NCGA 2OPRA 3DM2A 2GUIA 3LZJA 3EZ5A 4GVMA 1QSYA 4W5QA 4CF1A 1L5UA 3L8BA 1NJXA 4DSJA 4IFYA 4F2SA 4DSEA 1RDDA 3NBPA 4FZXC 1WSGA 4OLBA 4E7LA 3TAPA 1ZBIA 4IFVA 3RWUA 1JKHA 4FJKA 3KTQA 4OKJA 1TKDA 4Z4GA 4N5SA 3LALA 1Y97A 1HYVA 3OYLA 1LWCA 2IGIA 5HRSA 3PV8A 2YNHA 4H4MA 1N6QA 2RKIA 1NKBA 2HHWA 1BCMA 4RG8A 1SL1A 3KLFA 4L8RB 2LSNA 2X6SA 4FVMA 4CEDA 4DLEA 2OZSA 1ZBHA 4CHNA 3DOKA 3DI6A 3LP3A 2OA8A 2X74A 3BGRA 1S9GA 3MAQA 2DFHA 4FZYA 3QEPA 2HHVA 4DFPA 1NJWA 2FBVA 4I2QA 4EP5A 3SQ2A 4CHYA 5KRSA 3M8SA 4E7JA 2ZQBA 3DYAA 4IBNA 4CFDA 5D3GA 1NK9A 3LPUA 3NHGA 1A5WA 3CFPA 3QEIA 3HJFA 3DOLA 3AVNA 1QS4A 4CFAA 4JS4A 5HP1A 1K6YA 4RW8A 4E19A 3V9UA 2G8WA 4FM1A 4M3WA 4AHSA 3OYBA 3VN5A 4DTRA 3THVA 3VQBA 4E1NA 1KVAA 1YVUA 4DTOA 5CYMA 4CK2A 4WE1A 3TAEA 4W5RA 2HW3A 4RW4A 2E4LA 4FLTA 2ETJA 2Z1HA 1TK0A 4DU1A 3ZSVA 4BDYA 4I7FA 1LW2A 3OYAA 2XY7A 1VSJA 4QCLA 1ZBFA 1CZBA 1VSDA 3K5MA 4N76A 1S1WA 1JLFA 1UA1A 4CF9A 3LWMA 1L3UA 3PO4A 4FJHA 1CXUA 4M3RA 4CJKA 4QOZB 4YFUA 1NJZA 1C1BA 1QHTA 2FBTA 1SL0A 4AHVA 3U3YA 3MEEA 4CJRA 4KO0A 3DRRA 1RCHA 1WSEA 1D8YA 1BL3A 3EY1A 3DLGA 4KTQA 4ID5A 3OS1A 3IRXA 3ZSRA 4CECA 4HTUA 3NH0A 1NK0A 3CQ8A 4LSNA 4F3OA 4FJJA 5KGWA 3AVCA 5CYQA 2HMIA 4IKFA 3MEGA 5CZ2A 4DTJA 4M41A 4C8KA 4B9VA 1REVA 5HROA 1MU2A 3AVBA 3AVHA 1RILA 1NOZA 2D0BA 1RT3A 4GW6A 2FC0A 3TANA 2P51A 2YHAA 2EHGA 2IDOA 4FJ5A 2A1RA 4CGFA 3SQ0A 1NK5A 4B9UA 1IKVA 2VG6A 1WSHA 1J53A 1RNHA 3HVTA 4Y1DA 4PWDA 3K5OA 4Q0BA 1WSFA 2PYJA 4FM0A 3RRGA 2VG5A 3KLIA 4YNQA 2ZD1A 4M3TA 5CY4A 4ZTJA 3RMBA 1IKWA 3KIOA 1NKEA 2HVHA 2ZE2A 4CF0A 1TL3A 1T05A 3HYFA 4KPYA 1LW0A 1SL2A 3CM5A 3NAEA 3ASMA 1LAVA 1KRPA 1KFDA 4DTPA 1BIUA 1D9DA 4C8LA 4I2PA 3ZSQA 4FK4A 3ZT3A 1RBRA 1C0UA 3AVIA 1VSKA 5HRPA 1YT3A 4FJMA 2Z1GA 2Z1IA 1TV6A 3S3OA 1RDCA 1UA0A 5HLFA 2P5GA 4KHWA 3LDSA 3NCIA 3AA2A 3AO3A 1IKYA 3SJJA 2YHBA 4CGDA 5FRMA 3TAMA 3NF7A 5J2MA 2A1SA 3AVGA 3AV9A 1S1VA 4NYNA 3VQ7A 4H8KA 3WNFA 3L3VA 1B9FA 4Z4HA 1NKCA 4N41A 1C1CA 2G8IA 1Q9YA 3NF8A 4BDZA 5C24A 5J2QA 2PYLA 2KTQA 3AA4A 2PZSA 4W5NA 4K8XA 2JGUA 3LP1A 4KI4A 4W5TA 1JXBA 3O4QA 2KW4A 4CJTA 3CM6A 3VQ4A 3NDKA 3L2WA 2OZMA 4DQPA 1L3TA 4J2DA 3OYNA 3AVFA 3DRPA 3B6OA 3V1OA 1S5JA 4ID1A 4CF2A 1VRUA 1CZ9A 1WN7A 2KQ2A 3AVKA 4JLHA 4N56A 4CEAA 3TABA 5SWMA 2BDPA 3DLHA 1S6PA 1WAFA 1VSIA 3SZ2A 4DF8A 2B6AA 5E41A 3AO1A 3S3MA 2GBZA 3ULDA 1D5AA 3LPTA 3RMDA 4B9SA 3LP2A 1BI4A 2WOMA 2VWJA 1VRTA 3V9SA 4B8CA 4CJ4A 4DQRA 4NCBA 1WSIA 4M42A 2EX3A 4B9TA 1RBSA 3AVAA 4CIGA 3PO5A 4FK0A 4DSIA 4CIEA 3KLHA 3QEVA 3V81A 4IG3A 5I42A 4DF4A 3OJSA 4FJ8A 3S9HA 4KFBA 1LWEA 1SUQA 3EYZA 4M45A 3FFIA 1IH7A 2QKKA 1LWFA 2BE2A 3SV3A 3VQCA 2G8KA 1ZYQA 5JS1A 4AHTA 4LY7A 3P1GA 4C8MA 4O5BA 1TVRA 3CG7A 1BHLA 1C0TA 2HNZA 2D0AA 2VG7A 1UAXA 3QO9A 4AH9A 5C42A 4CHQA 2G8VA 2O4IA 3DLBA 4FW2A 3OYKA 5C25A 4DFJA 2D5RA 4B8AB 4CJSA 3SPZA 1KSPA 3AVLA 3SYZA 2QKBA 4FW1A 3DMJA 4B9MA 5J2PA 2RF2A 5J1EA 4CK1A 5CZ1A 4Q5VA 4CJLA 1U45A 3KLEA 4F4KA 4E1MA 4F8RA 5JS2A 4FJNA 4HUGA 4CF8A 3LZIA 4PY5A 4KV8A 1SV5A 4DWIA 1RT4A 4LH5A 4CGHA 4FJ7A 4RW7A 4OJRA 4FK2A 3HT3A 3PUFA 3KK1A 4E7IA 3OYMA 1NOYA 1Q8IA 1RBTA 3HM9A 2VWKA 4E0DA 1O1WA 1X1PA 3QEWA 1U47A 2Z1JA 1VSHA 3D45A 4MFBA 4E7HA 3HP9A 2HHQA 3V9XA 3QLHA 4PQUA 1XC9A 1U04A 1JLAA 3U3GA 1ZBUA 3QNOA 1J9AA 2RPIA 3DRSA 3CYMA 4OPJA 3I8DA 4KHSA 3MECA 3WNGA 3HVRA 1XHXA 4J2BA 3K58A 1Z26A 2OPSA 2W42A 1EETA 4LSLA 4ELUA 4TSXA 3L2QA 3O4NA 3KK3A 4M3ZA 1VSEA 4LD0A 4CFCA 3RR7A 1B92A 3G0ZA 3F73A 4BWJA 1Q9XA 1ASVA 3QIPA 2Y1JA 1RBUA 2OPPA 5FROA 1BIZA 3RMAA 1UWBA 2B5JA 1RTJA 4DTSA 3SCXA 2B4JA 4ZHRA 2YKMA 5KI6A 1VSLA 3DLEA 4BE2A 1KFSA 1JL1A 3HSTB 4MQ3A 4QAGA 4DLGA 4FLXA 3SPYA 3OYCA 1S1UA 3OS2A 3M8RA 4E7KA 5HRNA 5EU7A 1JXEA 4CJ3A 1EXQA 1W0HA 3L3UA 3OYHA 3KLGA 5DMRA 1BCOA 4CEEA 3HPOA 3K59A 4IDKA 3NGIA 4ELVA 4FJGA 2XHBA 3V9ZA 3V6DA 3RRHA 4FJIA 4Z4IA 4FLUA 4B9LA 2E6MA 2IAJA 4E3SA 2KFNA 3SUPA 4KTZA 3K2PA 4DQSA 1YTAA 3V1QA 4DU3A 2DFEA 4KHQA 4O0JA 2HB5A 4HHTA 3VQ6A 1KVBA 3PX6A 1U48A 2F8TA 2WONA 3DLRA 3U6FA 2IC3A 1HYZA 4J2EA 3I0SA 3VA3A 1RT5A 4DTUA 1IKXA 3KD5E 3NF9A 4DSKA 3TARA 3VQEA 1ASUA 5DK5A 3E01A 3WNEA 1RT6A 4ICLA 3V9WA 3VQ8A 1HNVA 4I9LA 3B6PA 3NH1A 4Z4EA 4EP4A 3K57A 1J54A 3O3FA 4CJVA 1KCFA 4B3OA 2O4GA 4CK3A 4KB1A 4CEOA 3HPHA 4FJXA 1I3AA 5KGXA 3OYIA 1SKRA 1EKEA 4I9QA 4E89A 4O44A 4B08A 3OVNA 1QSSA 4CJPA 3RMCA 4O55A 5T7BA 1T03A 3BDPA 4OLAA 4XIUA 2YV0X 3L2UA 2HHUA 3MXMA 1KVCA 4CERA 3ZSYA 4OVLA 3IS9A 1DLOA 1CXQA 2I5JA 1NK6A 3VA0A 1JLBA 3G10A 1RTDA 1T7PA 1VSFA 3RR8A 2HNDA 4M3YA 2KZZA 3M8QA 1CLQA 2E6LA 2YKNA 3PY8A 1HQUA 1N5YA 4JRPA 3F9KA 1G15A 2OPQA 4OKEA 4DSLA 1UOCA 2X78A 3H08A 3ISNC 3OYFA 2BGGA 3HP6A 3AA3A 4C8NA 1TAQA 3MEDA 1ITGA 1RDAA 3TAFA 4W5OA 2XY6A 4C8OA 4FCYA 3KK2A 3HXMA 1BISA 1TKTA 1C0MA 1JLQA 4CHOA 3AO4A 2QK9A 4H4OA 4OPKA 3PX4A 3V1RA 1IO2A 2DY4A 4Z0UA 5I3UA 3T19A 1U49A 4UQGA 1WSJA 3SV4A 1X9MA 4HCCA 1YTUA 2P5OA 2F96A 4EZ6A 4CCHA 2AJQA 3HO1A 3QESA 4BDPA 2Q3SA 4CJQA 3OS0A 1JLCA 3MXJA 2QXFA 4CIFA 4HVJA 3QIOA 4DTMA 4DQIA 3AO5A 4PA1A 4DTXA 4CEZA 4DFMA 4EZ9A 3RTVA 4OKKA 1S6QA 2R7YA 3SUQA 4DFKA 2Y1IA 3K5LA 3CFRA 3VQPA 1RTHA 2G8UA 3ZSOA 4BACA 2OYQA 4DSFA 1TKXA 3C6TA 4CESA 1EP4A 1WLJA 3AO2A 3M8PA 3PX0A 1NK4A 3KD1E 3OYGA 1SKWA 2HHTA 1FK9A 4AHCA 4AHRA 2ATQA 4ELTA 4N47A 1EX4A 1XHZA 3OY9A 1S1XA 4DQQA 3UIQA 2NUBA 3ZT1A 1XWLA 1TK8A 4HUEA 1BGXT 1KLNA 3VQQA 4DS5A 1BQNA 1DTQA 4CJUA 2X6NA 4FLZA 1NK8A 1NJYA 4FJLA 3L2RA 3TAGA 1XI1A 1HYSA 2KZMA 5SZTA 3ZT4A 3NF6A 3HL8A 1TL1A 3L2VA 2GV9A 4AILC 3NFAA 5KRTA 3TAQA 1W9HA 4JRQA 3VQDA 4DS4A 1T8EA 1S1TA 4F2RA 4RW6A 4G1QA 1VK0A 4K8ZA 3MXIA 3TR8A 1ASWA 1L3VA 2D0CA 3O3GA 4KHNA 1B9DA 2XY5A 1NK7A 1HJRA 3I0RA 3HK2A 3ZT2A 1GOBA 4CJWA 4FLYA 4CE9A 3VQAA 2PY5A 4KHUA 1TK5A 4Y1CA 4JS5A 4LH4A 2JLEA 4CEBA 4GMJB 3C94A 3ZT0A 3P5JA 1RDBA 3LANA 4HUFA 4ZTFA 4PUOA 3HPGA 3ZSWA 1RT7A 1ZBLA 2HHXA 3LAKA 5K14A 1RT1A 4BE1A 1J5OA 2HHSA 1HPZA 1DTTA 4OGCA 3SNNA 4KHYA 2HVIA 4FLWA 4FYDA 2P1JA 2KFZA 3AVMA 2IS3A 4KI6A
chains in the Genus database with same CATH superfamily
4LC9B 1FXXA 4LF4K 3E1YA 3ALYA 1FKOA 4O0IA 3OW2M 1S9EA 1D9FA 4BR5A 3AA5X 4CEQA 3JYTA 3U8XA 4KAZA 3ENBA 4YDUA 4CW7B 1RBVA 3QFPA 3OJUA 4FLVA 4B3MK 1BI4B 1IBLK 2XRIA 1DT9A 4CFBA 3LDQA 3EKUA 5AZIB 2G8HA 1H1VA 1Q86O 3J7YP 3TI0A 1GOCA 4DG1A 4KB0A 3KKRA 1C1AA 2BANA 4PL7A 3DLKA 3ZETA 5AQKA 4FM2A 4GV6A 4FXDA 3IG1A 3C6UA 3THXA 2HBJA 3D2FB 2ITGA 1LAWA 1QQCA 3LDOA 2O8FB 5LMNK 1RT2A 4MDAA 4WQ5A 4CGGA 4CHZA 3K5NA 4CJFA 1NGFA 4H0YB 4JI1K 4IG0A 4YOXA 5BRHA 4DMNA 4KHPK 5B8HA 2QWOA 4BE0A 5AQRA 2XO7A 1JL2A 1QE1A 3ZSXA 1GOAA 4RCHA 3CCEN 3D0PA 4HCBA 4CEFA 4NCAA 3T3FA 3SUOA 5EOYA 4DV1K 1NGDA 3C65A 4NCGA 3DM2A 3PIOL 2V7ZA 4W5QA 4CF1A 1RDDA 4FZXC 4OLBA 3O1WA 2O8BA 4FJKA 4F9OA 4CZJA 1LWCA 2IGIA 5C0YA 2D0PA 4H4MA 3J81O 1BCMA 3KLFA 3S41A 4NXNK 1ZBHA 1HKGA 5AFUH 1S9GA 3VEYA 1Y64A 4EP5A 4CHYA 2ZQBA 4BRFA 5D3GA 1BUPA 3DOLA 3IKMA 4JS4A 4RW8A 2A5XA 4E19A 4M3WA 4DTRA 3OYBA 4ISGA 1KVAA 4DTOA 3OHRA 1TYQA 4DV3K 4W5RA 4H5TA 4RW4A 4DU1A 1WB9A 1YITN 3CIPA 1GLCG 4DV2K 4A62A 1LW2A 3C0BA 1VSJA 3F2KA 4A5AA 4N76A 3K5MA 1RGIA 1MA9B 1CXUA 5DM6L 1C1BA 4DHYA 3EY1A 3DLGA 4KBOA 3IRXA 3ZSRA 4HTUA 3NH0A 1NK0A 3D2EB 4LSNA 4F3OA 4BG8A 3AAPA 4FJJA 3AVCA 4IKFA 4IOCL 5GINA 3TSQA 4KH6A 3HOSA 4M41A 4BRDA 3AVBA 2D0BA 1U2VB 2UU9K 2A1RA 3HI0A 4B9UA 1IKVA 3FZMA 4R79A 5BPMA 4Y1DA 3THWB 4Q0BA 3ZX2A 2VG5A 4YNQA 5EVZA 4CBXA 1IKWA 3KIOA 2ZE2A 4CF0A 3A5LC 4WFBL 3CETA 4IZ9A 4KPYA 5CR4A 4BR0A 3NAEA 4BRHA 4X64K 4DTPA 1D9DA 4C8LA 1RBRA 1VSKA 1YT3A 4FJMA 3PSFA 1UA0A 3D6RA 5HLFA 1I94K 5KQ8A 3TAMA 3NF7A 2A1SA 3AVGA 5AQHA 3WNFA 3U9ZA 4JI5K 4Z4HA 4N41A 3TTDA 3T7ZA 3O08A 4JKAA 3TTCA 2GTDA 3LP1A 1JXBA 5M1KA 4BRMA 3NDKA 3OYNA 3AVFA 3ZEUA 5AFUA 1S5JA 4ID1A 4CF2A 1VRUA 1CZ9A 3ZX3A 2BDPA 4CEAA 3FZKA 4JKCA 3SZ2A 4DF8A 3S3MA 3D7EO 2VWJA 4DQRA 4I6MB 2H3GX 4CJ4A 4CZHA 5LJWA 4CIGA 4CIEA 2VWBA 2Q31A 1NGAA 4J8FA 4NB4A 4DF4A 1EWRA 4CZEA 1LWEA 1SUQA 1IH7A 3LM9A 1HUXA 3SV3A 3G71N 1NMNA 3MWTA 4LY7A 2NRVA 1TVRA 5BRFA 3QBWA 4CHQA 2G8VA 2O4IA 3DLBA 2E88A 5ADXH 4B8AB 4WCEL 1YIJN 3TPQA 1K9MO 3AVLA 2QKBA 4B9MA 3DMJA 4DV0K 2UUAK 4Q5VA 2O8EA 3KLEA 4E1MA 1J5EK 1MWKA 4HUGA 1JCEA 4CF8A 4PY5A 1SV5A 4DWIA 4FJ7A 4RW7A 1X9JA 1YAGA 3LDPA 3O1BA 4FK2A 4YOVA 3HT3A 3PUFA 4E7IA 3BP8A 1Q8IA 5BRDA 5AQUA 4E0DA 1X1PA 3VTHA 2FSJA 4MFBA 3MX2A 2HF4A 4WQ4C 4PQUA 1YI2N 3OTOK 4BREA 4FO0A 4J2BA 3E66A 2ZWHA 1V4SA 3R3LA 1EETA 4IDHA 4LSLA 5JLHA 4ELUA 2UUCK 4ILGB 4BWJA 1ASVA 3MN7A 3A5OC 3WEEA 1X3NA 2B5JA 2IVNA 2Q36A 4OPHA 5KI6A 3HSTB 4DLGA 3H46O 4FPBA 5HRNA 1JXEA 1VQ6N 4H5RA 4DR5K 1W0HA 2JWLA 4WF9L 2F4VK 1BCOA 4CEEA 4B1WB 3V9ZA 4Z4IA 2E6MA 4A2AA 3EN9A 4KTZA 3K2PA 3WT0A 4O0JA 4CZIA 1K8AO 2F8TA 2WONA 3DLRA 4B9QA 1T6DA 3I0SA 3VGKA 1RT5A 4DSKA 3BY5A 4ICLA 3VQ8A 1RDUA 4I9LA 4MO5A 2ZJQL 4JK8A 1SKRA 1EKEA 5MLCQ 4E89A 3ENOA 3A8YA 4O44A 4OLAA 3OVNA 1P8ZA 1QSSA 4OVLA 4JEPA 1CXQA 3CC2N 3VA0A 1MWMA 2O8DB 2KZZA 1VSFA 4M3YA 4JI3K 3ATVA 1HQUA 1N5YA 1G15A 4BRQA 3HP6A 3DJCA 1TAQA 3VEXA 4DR3K 1RDAA 3I55N 4FCYA 2FF3B 3KK2A 1E4FT 3GL1A 1JLQA 2QK9A 3O9RA 5GAGP 5LJVA 4RTFD 1WSJA 2F96A 2AJQA 3ZX0A 2QXFA 4HVJA 4DQIA 5C2DA 5KQDA 5CE3A 4PA1A 1BWFO 3CI5A 2QWNA 4DFMA 1KC8O 3VPZA 4ILHA 4DFKA 2G8UA 1WOQA 4DSFA 3KD1E 4ILJA 2Q1NA 2Q97A 1QZ6A 4BY9C 2HHTA 1OH8A 4KH4A 4AM6A 1GLBG 2WTUA 4A59A 4YHHK 4HUEA 3B8AX 3KHYA 4CJUA 2X6NA 4BR4A 4JI8K 1N33K 3TAGA 4FWMA 3GG4A 2P9UB 3NF6A 1Z6RA 1TL1A 4AILC 4F2RA 3ID8A 1L3VA 3O9SA 1NK7A 1HJRA 3ZT2A 4CE9A 4GMJB 2O8EB 2HOEA 3P5JA 4DV5K 3ZSWA 3E9PA 3LAKA 4FOEA 4BE1A 2ZM6K 2HHSA 3CJBA 5M1FA 4OGCA 4FYDA 2P1JA 3OYDA 4K0KK 3C95A 4RW9A 4Z4CA 4KTWA 5AQGA 3QBXA 5BPLA 3O3HA 2AA4A 4CI6A 5KTQA 2E1YA 5FPMA 1VQMN 5AQIA 3HOTA 2G8FA 3CCMN 3EZWA 3SUNA 4KRFA 3L4IA 5GIPA 5HBMA 1XNQK 4XH5A 3H6EA 1C0FA 3OYEA 1FJGK 4DV6K 4CJ7A 1TGOA 4BC3A 1TUYA 4M3XA 1IV0A 2RN2A 3K9KA 2FBYA 4B9NA 1X9SA 1KLMA 3GBTA 4A5BA 4OPAA 5AQTA 4DUYK 3KWIA 2FBXA 3EKSA 1JLEA 3SQ1A 3QDKA 4CGIA 3QETA 3CFOA 3ATUA 4J2AA 2V52B 3DXKB 3MN9A 1ZBSA 5HRRA 2YNIA 3CJ7A 4DU4A 3EE8A 4BQZA 4IEIA 3ITHA 1HMVA 3LWLA 1HLUA 1W7AA 4IJAA 5M1NA 3J80O 3UKRB 4KREA 3PLAA 2GUIA 3EZ5A 4GVMA 2UXBK 5E26A 4DSJA 4IFYA 4E7LA 3TAPA 4BRKA 1JKHA 3SLCA 3WXLA 4OKJA 1TKDA 3PV8A 2YNHA 3THWA 2KHOA 4C1NI 3HBTA 1GLJO 3CCQN 1SL1A 2LSNA 2OZSA 4CHNA 3LP3A 4JK9A 3BGRA 2E2PA 1ILYA 3CF5L 3SQ2A 5KRSA 4E7JA 4CFDA 3C6HA 1NK9A 3LPUA 3AGKA 3CFPA 3HJFA 2AP1A 1QS4A 5HP1A 1CZAN 4JKDA 3V9UA 2G8WA 1XQSC 3LDLA 3VN5A 3THVA 3VQBA 2GX9A 3M5RA 4DR6K 1YVUA 4JK7A 4GY2B 3TAEA 1VQNN 2P9PA 4JYAK 2ETJA 2Z1HA 1TK0A 1P90A 4I7FA 3WUHA 2XY7A 1ZBFA 1NWKA 1VSDA 3UE5A 4K41A 1UA1A 5C2FA 4CJKA 4EHTA 4QOZB 4YFUA 1NJZA 3KZBA 1SL0A 3U3YA 5AQLA 4CJRA 3DRRA 2NRRA 1ATNA 2YHWA 3O80A 3O9TA 2KKZA 4JKBA 4QS7A 3CQ8A 1K8KB 2HMIA 1JCGA 2EWSA 1KD1O 4B9VA 5HROA 1MU2A 1SS6A 3AVHA 4GW6A 1RT3A 2FC0A 3TANA 3NVMA 2YHAA 2EHGA 3SQ0A 1NK5A 1WSHA 4M7XA 4Y0WA 3HVTA 3K5OA 1GLEG 1WSFA 2PYJA 3A5MC 4PKIA 2ZD1A 4O5FA 3VEOA 3AGRA 2HVHA 4OX9K 1U6ZA 4FWQA 4BC2A 5GAEP 2VYPA 1GLFO 1W2BM 1QQNA 1KRPA 1KFDA 3GDQA 4XH4A 3ZSQA 1JCFA 4FK4A 3ZT3A 2Z1IA 3WQTA 2ZJPL 1QHAA 3AO3A 3SK3A 5J2MA 4NYNA 3AV9A 2QW9A 3I33A 2G8IA 2PYLA 4BRLA 5C24A 5BR9A 4W5NA 4BC5A 3SBTA 4KI4A 3O4QA 2BH1A 4CJTA 3CM6A 3VQ4A 4DQPA 4EFHA 3V1OA 4JLHA 3AVKA 4U67L 2WBNA 2B6AA 5E41A 3AO1A 1D5AA 3LPTA 3AARA 4B9SA 3LP2A 4NCBA 2EX3A 1VQ5N 1RBSA 3PO5A 4FK0A 3V81A 3VEWA 4K43A 3CJCA 1QVGM 1NNEA 2FSNA 3ULEB 1OVYA 2QKKA 3J8AA 5JS1A 1R59O 2FXUA 3CG7A 4AH9A 2D0AA 4C23A 1UAXA 5C42A 4CVNE 1KXPA 4FW2A 3OYKA 4DFJA 2D5RA 4CJSA 1J6ZA 4FW1A 2RF2A 4A57A 3F9MA 1N34K 3IDHA 1U45A 4F4KA 5JS2A 3LZIA 4KV8A 4YOYA 3R1XA 1N36K 3KK1A 4FVUA 5AQOA 2VWKA 3MK6A 2Z1JA 3C6AA 3D45A 3HP9A 4KH5A 3QLHA 4NLCA 1U04A 4JI4K 1ZC6A 1ZBUA 5AQVA 3DRSA 3MECA 5HOOA 5AQWA 1ATRA 3K58A 1Z26A 1XMQK 3TTFA 4MLEA 2W42A 4ISFA 3O4NA 4M3ZA 4OO1J 5ELZA 1Q9XA 1M90O 2Y1JA 3K9JA 1RBUA 1W97L 1BIZA 1UWBA 4DTSA 1RTJA 2YKMA 1VSLA 3DLEA 1KFSA 4QAGA 3SPYA 1S1UA 3P38A 4IWVA 4E7KA 3DLLL 3BF3A 3OYHA 4IDKA 5BN9A 3NGIA 2XHBA 3RRHA 4FLUA 4B9LA 2IAJA 2KFNA 1IJJA 1HPMA 4DQSA 3MN5A 4DV7K 2HB5A 2CH6A 2IC3A 3IMXA 3VMFB 3I8BA 3VA3A 1IKXA 1S72N 2NLXA 2QEXN 3E01A 1RT6A 4H5WA 1Z05A 1HNVA 1NGIA 4H5VA 3B6PA 1VQ9N 4Z4EA 4EP4A 4CK3A 3SBGA 5KGXA 3OYIA 4JD2B 2O8DA 2KLAA 5AQXA 4ISEA 5T7BA 2HHUA 3MXMA 4CERA 1K73O 2NRHA 4DR2K 2P9NA 1RTDA 3TSPA 1CLQA 3RR8A 3M8QA 2I7PA 2YKNA 3PY8A 3F9KA 4OKEA 4DSLA 1UOCA 2X78A 3OYFA 3U4LA 4Z94A 2BGGA 3CC7N 1ITGA 3TAFA 2XY6A 1TKTA 2OTLN 4H4OA 4OPKA 3PX4A 2DY4A 1IO2A 2GWKA 3EO3A 5E84A 3SV4A 1X9MA 4HCCA 4WQ5C 2P9UA 4DV4K 4EZ6A 4CCHA 4O8KA 1KAXA 1S22A 4BDPA 2Q3SA 2YJEA 3OS0A 1JLCA 4CIFA 5GAHP 4DTXA 3RTVA 4OKKA 3CQYA 3WEEB 2R7YA 1ESVA 2Y1IA 3K5LA 1RTHA 1TKXA 2E2NA 1VQPN 1NK4A 2P9KA 3M8PA 5IWAK 1SKWA 1WBDA 2ZF5O 4U7BA 3G4SN 4ELTA 3HTVA 1XHZA 5FPDA 1S1XA 4DQQA 5AQMA 5M1OA 3ZT1A 1BGXT 4H0PA 5C10A 4FLZA 1NK8A 4FJLA 1NJYA 3J7AP 2A3ZA 2NRTA 1XI1A 4BRGA 2KZMA 3CC4N 3VETA 3NFAA 3FZFA 5KRTA 4WYBA 4B1XB 1VK0A 4FWLA 4K8ZA 1VAZA 4FWKA 3FR0A 2PY5A 4K25A 4JS5A 4LH4A 2JLEA 1XMOK 1Q7YO 4LFCK 4PUOA 1ZBLA 3GE1A 1J5OA 4H0XB 2GWJA 2HVIA 3GOIA 1DEJA 4FLWA 4H5NA 2KFZA 4FPAA 4LF7K 3W0LA 1YXQA 1NGGA 3QERA 1HNIA 4JKGA 2RE2A 3ZCMA 3SI6A 4MLHA 2DTUA 2PFUA 3BZKA 1A5XA 4F3TA 2CGKA 1RTIA 2XY8A 3Q7BA 2W6KA 3VENA 3RSEA 4CJ5A 4DTNA 1SKSA 1MDUB 1HRHA 1YJNN 3CJAA 3CQXA 2HSTA 3KJVA 3OYJA 4CJEA 3S3NA 3IAYA 2J4RA 1TKZA 3QNNA 3QEXA 5H1SQ 4CZLA 3BZCA 2BUPA 3TWHA 1JLGA 3BEXA 4PHTX 1OVQA 2P9SB 3DXMA 1QSLA 4JNEA 4AHUA 1TAUA 2GEMA 3OBWA 1QVFM 1HQEA 1R0AA 3V4IA 5C12A 2WFBA 3MDQA 1VSMA 3DWLA 1XNRK 4MDBA 3QINA 1IG9A 3VEVA 1BQMA 4EHUA 1F21A 3LDNA 5AQYA 1Z25A 3NGYA 4R5PA 4GV3A 2DFFA 4KKOA 4CGJA 3NGZA 3VQ5A 3CXCM 5AZJA 1KAYA 2OPRA 3LZJA 2VCPA 4BRPA 4X65K 2QXLA 3L8BA 1NJXA 3N4PA 4F2SA 4DSEA 3NBPA 1WSGA 1ZBIA 1HKCA 3RWUA 2QWQA 3QMLA 1VQLN 3KTQA 5JVHL 4Z4GA 1HYVA 3WXJA 4B3RK 3H3OB 1N6QA 1Q18A 1NGHA 2RKIA 4DQ8A 2HHWA 4RG8A 4L8RB 2X6SA 4FVMA 3SMSA 4LF8K 4C1NK 3DI6A 2OA8A 2X74A 4FZYA 3MAQA 1T6CA 3QEPA 4DFPA 1NJWA 2FBVA 3AY9A 4I2QA 2FF6A 5BREA 3NHGA 1A5WA 3AVNA 3FFKB 1EQYA 4CFAA 4A2BA 4WFNL 1K6YA 4BVOA 4FM1A 3ULEA 1NGJA 1T44A 4IXCA 5CYMA 4CK2A 4WE1A 2E4LA 1FW6A 3ZSVA 1RFQA 4BDYA 3HZ6A 3VF6A 1Q81O 1CZBA 2HMPA 4IJNA 1L3UA 3PO4A 4JKEA 4FJHA 3ZYYX 3F5TA 3LM2A 1TYQB 2YCHA 4AHVA 3ZEUB 4YOTA 4KO0A 4KTQA 2ITMA 5AQFA 2Q0UA 5KGWA 5CYQA 2FLOA 1LOTB 5CZ2A 4C8KA 4DTJA 4NXMK 3M3ZA 3O8MA 3QFUA 3A0IX 4M63C 1KAZA 2IDOA 4FJ5A 3JXUA 3JAMO 1J53A 1SZ2A 1BDGA 1RNHA 4PWDA 3RRGA 4GV9A 4BGBA 2O8BB 5CY4A 4BRIA 2NRWA 3NVKA 1QQMA 5AQPA 1HKBA 3ASMA 3CJ1A 5A2QO 4FOIA 1OH7A 4IO8A 2UXDK 3AVIA 5JVGL 3VEZA 1TV6A 4IO9L 2P5GA 2QI2A 4LFBK 3LDSA 4DUZK 1IKYA 3SJJA 5DM7L 2DPNA 2YHBA 4CGDA 5FRMA 4DR4K 1S1VA 3VQ7A 1U2VA 4GNIA 1B9FA 2YI1A 1BG3A 3NF8A 5J2QA 2NRZA 1Q9YA 2KTQA 2PZSA 2GELA 5AQJA 2CH5A 2JGUA 1K8KA 4W5TA 3CMAN 2OZMA 4JV5K 2NZTA 3B6OA 1X3MA 2KQ2A 5SWMA 5AR0A 4NLBA 2GBZA 3ULDA 3RMDA 3LL3A 4YORA 1BI4A 1VRTA 1WSIA 4B9TA 3AVAA 4DSIA 2F7TA 4CZFA 4IG3A 5I42A 2P9PB 3OJSA 2Q0RA 3S9HA 4JHDA 2E5LK 4FJ8A 3EYZA 3MWPA 4M45A 3VQCA 2G8KA 3BF1A 1ZYQA 5FPEA 4B1ZA 4AHTA 2E1ZA 3P1GA 4B3SK 1C0TA 2HNZA 2VG7A 3QO9A 2UXCK 4B3TK 5C25A 2HHHK 2WC9A 4BG9A 3SYZA 4IOAL 5J2PA 1DGKN 5J1EA 4MO4A 2QWRA 3BUZB 3IUCA 5CZ1A 3I56N 4QS9A 4YOWA 4H0OA 4FJNA 5TKWA 1NBWA 4BRNA 2YJFA 2VGNA 2QTDA 2ZGZA 3OYMA 1RBTA 1U47A 2HHQA 1XC9A 4HTLA 1JLAA 2HBLA 3UKRA 1G99A 3QNOA 1J9AA 4OPJA 3CYMA 2ZJRL 3HVRA 2OPSA 3WXIA 4H0VB 4BR7A 4TSXA 3L2QA 3KK3A 1VSEA 4LD0A 3DXKA 3CCSN 3H3NO 4CFCA 4EIAA 3RR7A 5GIOA 1B92A 1IBKK 3F73A 2HBKA 4M7YA 3QIPA 1NG9A 5FROA 2OPPA 2O8FA 1NU0A 3THXB 4BE2A 1HNXK 3OYCA 3M8RA 4CD3A 3ZETB 3N4QA 4CBUA 4ELVA 4LF6K 5DMRA 3HPOA 3K59A 4FJGA 1RDWX 4X66K 3T1YK 3V6DA 4E3SA 3SUPA 4JI0K 5AZIA 1YTAA 3V1QA 4DU3A 4KHQA 3VQ6A 1KVBA 1U48A 5I9EB 3U6FA 4J2EA 1NJIO 3KD5E 3UB5A 3TARA 5DK5A 3WNEA 3V9WA 1HR0K 2O8CA 1YUWA 3NH1A 3O3FA 3MCAB 4B3OA 2O4GA 4KB1A 4CEOA 4FJXA 3P31A 1I3AA 1BA0A 2VGMA 5JICA 3VF2A 3CCRN 4IEEA 4B08A 3BDPA 4CJPA 2YV0X 3MMVA 3L2UA 3ZSYA 1LCUA 3PSIA 3UKUA 1NK6A 4XEIA 1JLBA 3G10A 1T7PA 3FGUA 1OH5A 4JRPA 2O8CB 2OPQA 1YF5L 3NMUA 3AA3A 2F9TA 4LFAK 1OH6A 4B1YB 3OBYA 2QM1A 1BISA 3O4WA 4BQLA 3HSCA 3V1RA 5I3UA 3T19A 3E9LA 3HO1A 3MCPA 3MXJA 2HF3A 4DTMA 4LF9K 3CCVN 2OANA 3SUQA 4FL9A 3VQPA 3ZSOA 4BACA 4AM7A 3C6TA 4NO7A 3AO2A 3PX0A 4BGAA 3OYGA 2QA4N 5FLXO 2IIRA 3OA9A 4FWOA 3CCLN 2ASOA 4AHCA 4AHRA 1DKGD 4GKJK 2ATQA 3OY9A 1TUUA 5BN8A 2NUBA 1TK8A 3VQQA 3AAQA 4DS5A 1DTQA 3L2RA 2E2OA 4GKKK 1QQOA 1HYSA 3ZT4A 3FLCO 2GV9A 5M1PA 1KQSM 1W9HA 4JRQA 3VQDA 4DS4A 2UYTA 3RVCA 1SAZA 2ZGYA 3TR8A 1ASWA 4BRCA 2D0CA 3O3GA 4KHNA 2VQFK 3HK2A 3EL2A 3KWGA 4CJWA 5HL7L 3J7ZO 3VQAA 4FLYA 1TK5A 4Y1CA 4CEBA 3IFRA 1RDBA 3LANA 4HUFA 3HPGA 1RT7A 1SQKA 4JKHA 4CBWA 1WBBA 4KHYA 3HRGA 1GLDG 4CJLA 2IS3A 4DLEA 1M1KO 4KI6A 5FRNA 3H1VX 2YNGA 1GLAG 1L3SA 2D1KA 4NYFA 3ZSZA 3H45C 3CMEN 1NGCA 2A40A 3SQ4A 4FWRA 2E8AA 3W3DA 1I39A 1N32K 1EWQA 4JHDB 3A2FA 2PBDA 4WQ4A 3EEQA 5M1QA 4JKFA 2IOCA 3T1AA 5TKYA 2ASPA 4H0TB 3CPEA 1BA1A 4RWTA 4O8UA 1LV5A 5EXWA 4LF5K 5CHIA 1S3XA 4CHPA 2D4WA 2OCEA 4FZZA 3KKSA 1VQ7N 3VQ9A 1BO5O 4FJ9A 3LAMA 1KTQA 3VOVA 3CCUN 3O9UA 3NH2A 3CERA 1NM1A 1FKPA 4M3UA 3JSMA 2P9LB 3WNHA 3P83D 3LP0A 1U4BA 1WNSA 2F9WA 2A41A 1A5VA 1GLLO 4OGEA 5FDLA 4Z4FA 3CJ9A 2F8SA 4BWMA 4O4GA 3AVJA 1X9WA 2YNFA 1QTMA 3NE6A 5J2NA 1WAJA 1C6VA 2P9IA 4H03B 2HNYA 2W40A 3CD6N 1QSYA 1L5UA 2OTJN 3L4QA 1BOTO 4IFVA 3ID6A 4N5SA 3LALA 1Y97A 3OYLA 4XH1A 5HRSA 1NKBA 5F0XA 4CEDA 4CZGA 3DOKA 3U9DA 1NGEA 2HHVA 3C7NB 2DFHA 3TSUA 3WQUA 3M8SA 4IBNA 3DYAA 3QEIA 3L6QA 5GADP 4AHSA 4E1NA 3VERA 5JMVA 2HW3A 3ENHA 4FLTA 3OYAA 3T1HK 4I6MA 4QCLA 5AQZA 3VESA 4PL8A 1S1WA 1JLFA 4BVPA 3FZLA 4CF9A 3LWMA 2W41A 4AF1A 1NLVA 4PKGA 4M3RA 5FPNA 1QHTA 2FBTA 3MEEA 3M1FA 1RCHA 1WSEA 1D8YA 1BL3A 2CGLA 4JI6K 3SJHA 4X62K 4ID5A 2QWLA 3OS1A 4CECA 3MX5A 2GUPA 4G9ZA 3MEGA 1REVA 3THYA 4AQYK 4V19S 1RILA 1NOZA 3C7NA 2P51A 4CGFA 4QS8A 4FWSA 2A42A 2VG6A 1E4GT 4BC4A 1VQ4N 4FM0A 2Q2RA 3KLIA 4M3TA 1WUAA 4ZTJA 3RMBA 2YHXA 1NKEA 1IBMK 1T05A 1TL3A 3MN6A 3HYFA 3CPWM 1HJOA 1LW0A 1SL2A 2W6LA 3CM5A 4WFAL 2P9IB 4DB3A 1LAVA 5AZJB 1BIUA 4I2PA 2I7NA 1C0UA 5HRPA 3CCJN 2Z1GA 3S3OA 1RDCA 4KHWA 3NCIA 5EX5A 3AA2A 4B1UB 5BPNA 4H8KA 3L3VA 1NKCA 1C1CA 3THYB 4JI7K 4BDZA 1ZXOA 3AA4A 4K8XA 3O9QA 3D2EA 5JLFA 2KW4A 4BR9A 1VQKN 3L2WA 3R9PA 1QZ5A 1L3TA 2P9SA 3DXMB 4J2DA 4FSVA 3E9OA 3DRPA 4N56A 1WN7A 3TABA 3DLHA 1XUPO 1S6PA 1WAFA 1VSIA 3K0SA 1C0GA 3SAGA 1NGBA 2WOMA 3V9SA 4M42A 4B8CA 4DCHA 5EY4A 3G6EN 3KLHA 3QEVA 2V7YA 5KPRA 3RSEB 5F1XA 1E3MA 2IVPA 2FSKA 2E20A 4KFBA 2UUBK 3FFIA 1LWFA 2BE2A 4JKGB 4C8MA 4O5BA 1BHLA 1VQON 1YVNA 3SPZA 3SMPA 1KSPA 4JAXA 4FWNA 4CK1A 2A6AA 4A61A 4F8RA 1VQ8N 4BR2A 3R6MA 3T69A 1O13A 1RT4A 3O6WA 4LH5A 4CGHA 4OJRA 1NOYA 3HM9A 5IT9O 1EO1A 1O1WA 3QEWA 4L3QA 1VSHA 4E7HA 3V9XA 2E2QA 3U3GA 3VTIA 2IVOA 2RPIA 4KHSA 3I8DA 3WNGA 1XHXA 5LY3A 1JJ2M 2RHKA 3O5BA 4FWPA 1HNZK 1YJWN 3QICA 1HX1A 4YOUA 2P9KB 1ATSA 3G0ZA 3G25A 1HNWK 3R8EA 5AJ3K 2P9LA 3HM8A 3RMAA 3D2FA 3Q7CA 3SCXA 2D0OA 2B4JA 2VQEK 4ZHRA 4K42A 4YY3K 1JL1A 4MQ3A 4FLXA 3OS2A 5EU7A 1N8RO 4CJ3A 1EXQA 3L3UA 4PKHA 3KLGA 1T3VA 3JS6A 4FJIA 3FZHA 3KK7A 1YJ9N 5ADXA 4BRAA 5AQSA 1V4TA 3L0QA 5KPZA 2DFEA 4HHTA 3PX6A 5BR8K 1HYZA 2HBMA 4JI2K 2WUSA 4DTUA 3NF9A 4CZMA 4YDUC 4DKWA 5F2RA 3VQEA 3TU5A 1ASUA 5C15A 1Q82O 3M6GA 3K57A 1J54A 4CJVA 1KCFA 4BROA 3HPHA 2P9NB 1YHQN 2QWMA 4I9QA 3UKUB 4UY8O 3RMCA 4O55A 1T03A 2NRXA 4XIUA 5AQNA 3KVGA 1KVCA 3IS9A 1DLOA 5LL6Z 1BU6O 2I5JA 1IG8A 4JD2A 2JWKA 2BTFA 2HNDA 2E6LA 2QWPA 2YHYA 5LMUK 3H08A 3ISNC 4C8NA 3MEDA 4EAHD 4W5OA 2YX6A 4C8OA 3VGMA 3HXMA 1C0MA 3QB0A 4CHOA 3AO4A 3A5NC 4JN4A 3WXMB 4Z0UA 3FE1A 1U49A 4UQGA 2NNWA 1YTUA 2ASMA 4DR1K 2P5OA 4B1VA 3QESA 1XC3A 4CJQA 4IFEA 5AQQA 3DAWA 1NMDA 3CHWA 3QIOA 3VGLA 3WXKA 3AO5A 4GVEA 3H1QA 1D4XA 4CEZA 4EZ9A 1S6QA 3ZLJA 3CFRA 2OYQA 4CESA 1EP4A 1WLJA 4IOXA 3SAHA 1FK9A 2PAVA 5KPTA 4CZKA 4CD1A 4N47A 1EX4A 3UIQA 1XWLA 1KLNA 3VF4A 1BQNA 4DR7K 4HWIA 5SZTA 3HL8A 3EE9A 1OKJA 3L2VA 3TAQA 1T8EA 3P4IA 1S1TA 4RW6A 4G1QA 3MXIA 3PIPL 2V51B 3P39A 1B9DA 2XY5A 3I0RA 1VHXA 1GOBA 4KHUA 3C94A 3ZT0A 4ZTFA 4E1JA 2HHXA 5K14A 1RT1A 2CGJA 1HPZA 1DTTA 3SNNA 3SAFA 3AVMA
chains in the Genus database with same CATH topology
5FRNA 3OYDA 1FXXA 2YNGA 1FKOA 3ALYA 4O0IA 3QERA 4NYFA 1L3SA 3C95A 4RW9A 4Z4CA 1HNIA 3ZSZA 1S9EA 1D9FA 4KTWA 3ZCMA 3SI6A 3SQ4A 2DTUA 3AA5X 3O3HA 1A5XA 4CEQA 1I39A 4F3TA 3JYTA 1RTIA 2XY8A 3A2FA 5KTQA 4KAZA 1RBVA 4CJ5A 4DTNA 2G8FA 2IOCA 3T1AA 3OJUA 4FLVA 3SUNA 1HRHA 1SKSA 4KRFA 5HBMA 1BI4B 3OYJA 3KJVA 2XRIA 4CJEA 4CFBA 3S3NA 1LV5A 3IAYA 1TKZA 3OYEA 3QNNA 2G8HA 3QEXA 1TGOA 4M3XA 4CHPA 3TWHA 4FZZA 3KKSA 1GOCA 1JLGA 4DG1A 2RN2A 3KKRA 3TI0A 3VQ9A 1C1AA 4KB0A 2FBYA 2BANA 4B9NA 3DLKA 4FM2A 1X9SA 1KLMA 1QSLA 4FJ9A 4AHUA 4FXDA 1TAUA 3IG1A 3LAMA 1KTQA 1HQEA 2FBXA 1R0AA 3C6UA 3NH2A 3V4IA 1JLEA 3SQ1A 1FKPA 4M3UA 2ITGA 3JSMA 1LAWA 3WNHA 1VSMA 1QQCA 3P83D 3LP0A 4CGIA 1RT2A 3CFOA 3QETA 1U4BA 3QINA 1WNSA 4CGGA 4CHZA 3K5NA 1IG9A 4CJFA 4J2AA 1BQMA 1A5VA 4IG0A 4OGEA 5FDLA 5HRRA 4Z4FA 1F21A 4DMNA 2F8SA 2YNIA 4BWMA 4DU4A 1Z25A 3AVJA 4O4GA 4BE0A 3NGYA 4R5PA 3ITHA 1HMVA 1X9WA 2XO7A 1JL2A 2YNFA 3LWLA 1QTMA 1QE1A 2DFFA 4KKOA 3ZSXA 1GOAA 3NE6A 4CGJA 3D0PA 4HCBA 5J2NA 4CEFA 3NGZA 3VQ5A 4NCAA 3T3FA 1WAJA 4KREA 3SUOA 1C6VA 2HNYA 4NCGA 2OPRA 3DM2A 2GUIA 3LZJA 3EZ5A 4GVMA 1QSYA 4W5QA 4CF1A 1L5UA 3L8BA 1NJXA 4DSJA 4IFYA 4F2SA 4DSEA 1RDDA 3NBPA 4FZXC 1WSGA 4OLBA 4E7LA 3TAPA 1ZBIA 4IFVA 3RWUA 1JKHA 4FJKA 3KTQA 4OKJA 1TKDA 4Z4GA 4N5SA 3LALA 1Y97A 1HYVA 3OYLA 1LWCA 2IGIA 5HRSA 3PV8A 2YNHA 4H4MA 1N6QA 2RKIA 1NKBA 2HHWA 1BCMA 4RG8A 1SL1A 3KLFA 4L8RB 2LSNA 2X6SA 4FVMA 4CEDA 4DLEA 2OZSA 1ZBHA 4CHNA 3DOKA 3DI6A 3LP3A 2OA8A 2X74A 3BGRA 1S9GA 3MAQA 2DFHA 4FZYA 3QEPA 2HHVA 4DFPA 1NJWA 2FBVA 4I2QA 4EP5A 3SQ2A 4CHYA 5KRSA 3M8SA 4E7JA 2ZQBA 3DYAA 4IBNA 4CFDA 5D3GA 1NK9A 3LPUA 3NHGA 1A5WA 3CFPA 3QEIA 3HJFA 3DOLA 3AVNA 1QS4A 4CFAA 4JS4A 5HP1A 1K6YA 4RW8A 4E19A 3V9UA 2G8WA 4FM1A 4M3WA 4AHSA 3OYBA 3VN5A 4DTRA 3THVA 3VQBA 4E1NA 1KVAA 1YVUA 4DTOA 5CYMA 4CK2A 4WE1A 3TAEA 4W5RA 2HW3A 4RW4A 2E4LA 4FLTA 2ETJA 2Z1HA 1TK0A 4DU1A 3ZSVA 4BDYA 4I7FA 1LW2A 3OYAA 2XY7A 1VSJA 4QCLA 1ZBFA 1CZBA 1VSDA 3K5MA 4N76A 1S1WA 1JLFA 1UA1A 4CF9A 3LWMA 1L3UA 3PO4A 4FJHA 1CXUA 4M3RA 4CJKA 4QOZB 4YFUA 1NJZA 1C1BA 1QHTA 2FBTA 1SL0A 4AHVA 3U3YA 3MEEA 4CJRA 4KO0A 3DRRA 1RCHA 1WSEA 1D8YA 1BL3A 3EY1A 3DLGA 4KTQA 4ID5A 3OS1A 3IRXA 3ZSRA 4CECA 4HTUA 3NH0A 1NK0A 3CQ8A 4LSNA 4F3OA 4FJJA 5KGWA 3AVCA 5CYQA 2HMIA 4IKFA 3MEGA 5CZ2A 4DTJA 4M41A 4C8KA 4B9VA 1REVA 5HROA 1MU2A 3AVBA 3AVHA 1RILA 1NOZA 2D0BA 1RT3A 4GW6A 2FC0A 3TANA 2P51A 2YHAA 2EHGA 2IDOA 4FJ5A 2A1RA 4CGFA 3SQ0A 1NK5A 4B9UA 1IKVA 2VG6A 1WSHA 1J53A 1RNHA 3HVTA 4Y1DA 4PWDA 3K5OA 4Q0BA 1WSFA 2PYJA 4FM0A 3RRGA 2VG5A 3KLIA 4YNQA 2ZD1A 4M3TA 5CY4A 4ZTJA 3RMBA 1IKWA 3KIOA 1NKEA 2HVHA 2ZE2A 4CF0A 1TL3A 1T05A 3HYFA 4KPYA 1LW0A 1SL2A 3CM5A 3NAEA 3ASMA 1LAVA 1KRPA 1KFDA 4DTPA 1BIUA 1D9DA 4C8LA 4I2PA 3ZSQA 4FK4A 3ZT3A 1RBRA 1C0UA 3AVIA 1VSKA 5HRPA 1YT3A 4FJMA 2Z1GA 2Z1IA 1TV6A 3S3OA 1RDCA 1UA0A 5HLFA 2P5GA 4KHWA 3LDSA 3NCIA 3AA2A 3AO3A 1IKYA 3SJJA 2YHBA 4CGDA 5FRMA 3TAMA 3NF7A 5J2MA 2A1SA 3AVGA 3AV9A 1S1VA 4NYNA 3VQ7A 4H8KA 3WNFA 3L3VA 1B9FA 4Z4HA 1NKCA 4N41A 1C1CA 2G8IA 1Q9YA 3NF8A 4BDZA 5C24A 5J2QA 2PYLA 2KTQA 3AA4A 2PZSA 4W5NA 4K8XA 2JGUA 3LP1A 4KI4A 4W5TA 1JXBA 3O4QA 2KW4A 4CJTA 3CM6A 3VQ4A 3NDKA 3L2WA 2OZMA 4DQPA 1L3TA 4J2DA 3OYNA 3AVFA 3DRPA 3B6OA 3V1OA 1S5JA 4ID1A 4CF2A 1VRUA 1CZ9A 1WN7A 2KQ2A 3AVKA 4JLHA 4N56A 4CEAA 3TABA 5SWMA 2BDPA 3DLHA 1S6PA 1WAFA 1VSIA 3SZ2A 4DF8A 2B6AA 5E41A 3AO1A 3S3MA 2GBZA 3ULDA 1D5AA 3LPTA 3RMDA 4B9SA 3LP2A 1BI4A 2WOMA 2VWJA 1VRTA 3V9SA 4B8CA 4CJ4A 4DQRA 4NCBA 1WSIA 4M42A 2EX3A 4B9TA 1RBSA 3AVAA 4CIGA 3PO5A 4FK0A 4DSIA 4CIEA 3KLHA 3QEVA 3V81A 4IG3A 5I42A 4DF4A 3OJSA 4FJ8A 3S9HA 4KFBA 1LWEA 1SUQA 3EYZA 4M45A 3FFIA 1IH7A 2QKKA 1LWFA 2BE2A 3SV3A 3VQCA 2G8KA 1ZYQA 5JS1A 4AHTA 4LY7A 3P1GA 4C8MA 4O5BA 1TVRA 3CG7A 1BHLA 1C0TA 2HNZA 2D0AA 2VG7A 1UAXA 3QO9A 4AH9A 5C42A 4CHQA 2G8VA 2O4IA 3DLBA 4FW2A 3OYKA 5C25A 4DFJA 2D5RA 4B8AB 4CJSA 3SPZA 1KSPA 3AVLA 3SYZA 2QKBA 4FW1A 3DMJA 4B9MA 5J2PA 2RF2A 5J1EA 4CK1A 5CZ1A 4Q5VA 4CJLA 1U45A 3KLEA 4F4KA 4E1MA 4F8RA 5JS2A 4FJNA 4HUGA 4CF8A 3LZIA 4PY5A 4KV8A 1SV5A 4DWIA 1RT4A 4LH5A 4CGHA 4FJ7A 4RW7A 4OJRA 4FK2A 3HT3A 3PUFA 3KK1A 4E7IA 3OYMA 1NOYA 1Q8IA 1RBTA 3HM9A 2VWKA 4E0DA 1O1WA 1X1PA 3QEWA 1U47A 2Z1JA 1VSHA 3D45A 4MFBA 4E7HA 3HP9A 2HHQA 3V9XA 3QLHA 4PQUA 1XC9A 1U04A 1JLAA 3U3GA 1ZBUA 3QNOA 1J9AA 2RPIA 3DRSA 3CYMA 4OPJA 3I8DA 4KHSA 3MECA 3WNGA 3HVRA 1XHXA 4J2BA 3K58A 1Z26A 2OPSA 2W42A 1EETA 4LSLA 4ELUA 4TSXA 3L2QA 3O4NA 3KK3A 4M3ZA 1VSEA 4LD0A 4CFCA 3RR7A 1B92A 3G0ZA 3F73A 4BWJA 1Q9XA 1ASVA 3QIPA 2Y1JA 1RBUA 2OPPA 5FROA 1BIZA 3RMAA 1UWBA 2B5JA 1RTJA 4DTSA 3SCXA 2B4JA 4ZHRA 2YKMA 5KI6A 1VSLA 3DLEA 4BE2A 1KFSA 1JL1A 3HSTB 4MQ3A 4QAGA 4DLGA 4FLXA 3SPYA 3OYCA 1S1UA 3OS2A 3M8RA 4E7KA 5HRNA 5EU7A 1JXEA 4CJ3A 1EXQA 1W0HA 3L3UA 3OYHA 3KLGA 5DMRA 1BCOA 4CEEA 3HPOA 3K59A 4IDKA 3NGIA 4ELVA 4FJGA 2XHBA 3V9ZA 3V6DA 3RRHA 4FJIA 4Z4IA 4FLUA 4B9LA 2E6MA 2IAJA 4E3SA 2KFNA 3SUPA 4KTZA 3K2PA 4DQSA 1YTAA 3V1QA 4DU3A 2DFEA 4KHQA 4O0JA 2HB5A 4HHTA 3VQ6A 1KVBA 3PX6A 1U48A 2F8TA 2WONA 3DLRA 3U6FA 2IC3A 1HYZA 4J2EA 3I0SA 3VA3A 1RT5A 4DTUA 1IKXA 3KD5E 3NF9A 4DSKA 3TARA 3VQEA 1ASUA 5DK5A 3E01A 3WNEA 1RT6A 4ICLA 3V9WA 3VQ8A 1HNVA 4I9LA 3B6PA 3NH1A 4Z4EA 4EP4A 3K57A 1J54A 3O3FA 4CJVA 1KCFA 4B3OA 2O4GA 4CK3A 4KB1A 4CEOA 3HPHA 4FJXA 1I3AA 5KGXA 3OYIA 1SKRA 1EKEA 4I9QA 4E89A 4O44A 4B08A 3OVNA 1QSSA 4CJPA 3RMCA 4O55A 5T7BA 1T03A 3BDPA 4OLAA 4XIUA 2YV0X 3L2UA 2HHUA 3MXMA 1KVCA 4CERA 3ZSYA 4OVLA 3IS9A 1DLOA 1CXQA 2I5JA 1NK6A 3VA0A 1JLBA 3G10A 1RTDA 1T7PA 1VSFA 3RR8A 2HNDA 4M3YA 2KZZA 3M8QA 1CLQA 2E6LA 2YKNA 3PY8A 1HQUA 1N5YA 4JRPA 3F9KA 1G15A 2OPQA 4OKEA 4DSLA 1UOCA 2X78A 3H08A 3ISNC 3OYFA 2BGGA 3HP6A 3AA3A 4C8NA 1TAQA 3MEDA 1ITGA 1RDAA 3TAFA 4W5OA 2XY6A 4C8OA 4FCYA 3KK2A 3HXMA 1BISA 1TKTA 1C0MA 1JLQA 4CHOA 3AO4A 2QK9A 4H4OA 4OPKA 3PX4A 3V1RA 1IO2A 2DY4A 4Z0UA 5I3UA 3T19A 1U49A 4UQGA 1WSJA 3SV4A 1X9MA 4HCCA 1YTUA 2P5OA 2F96A 4EZ6A 4CCHA 2AJQA 3HO1A 3QESA 4BDPA 2Q3SA 4CJQA 3OS0A 1JLCA 3MXJA 2QXFA 4CIFA 4HVJA 3QIOA 4DTMA 4DQIA 3AO5A 4PA1A 4DTXA 4CEZA 4DFMA 4EZ9A 3RTVA 4OKKA 1S6QA 2R7YA 3SUQA 4DFKA 2Y1IA 3K5LA 3CFRA 3VQPA 1RTHA 2G8UA 3ZSOA 4BACA 2OYQA 4DSFA 1TKXA 3C6TA 4CESA 1EP4A 1WLJA 3AO2A 3M8PA 3PX0A 1NK4A 3KD1E 3OYGA 1SKWA 2HHTA 1FK9A 4AHCA 4AHRA 2ATQA 4ELTA 4N47A 1EX4A 1XHZA 3OY9A 1S1XA 4DQQA 3UIQA 2NUBA 3ZT1A 1XWLA 1TK8A 4HUEA 1BGXT 1KLNA 3VQQA 4DS5A 1BQNA 1DTQA 4CJUA 2X6NA 4FLZA 1NK8A 1NJYA 4FJLA 3L2RA 3TAGA 1XI1A 1HYSA 2KZMA 5SZTA 3ZT4A 3NF6A 3HL8A 1TL1A 3L2VA 2GV9A 4AILC 3NFAA 5KRTA 3TAQA 1W9HA 4JRQA 3VQDA 4DS4A 1T8EA 1S1TA 4F2RA 4RW6A 4G1QA 1VK0A 4K8ZA 3MXIA 3TR8A 1ASWA 1L3VA 2D0CA 3O3GA 4KHNA 1B9DA 2XY5A 1NK7A 1HJRA 3I0RA 3HK2A 3ZT2A 1GOBA 4CJWA 4FLYA 4CE9A 3VQAA 2PY5A 4KHUA 1TK5A 4Y1CA 4JS5A 4LH4A 2JLEA 4CEBA 4GMJB 3C94A 3ZT0A 3P5JA 1RDBA 3LANA 4HUFA 4ZTFA 4PUOA 3HPGA 3ZSWA 1RT7A 1ZBLA 2HHXA 3LAKA 5K14A 1RT1A 4BE1A 1J5OA 2HHSA 1HPZA 1DTTA 4OGCA 3SNNA 4KHYA 2HVIA 4FLWA 4FYDA 2P1JA 2KFZA 3AVMA 2IS3A 4KI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRN A;  3OYD A;  1FXX A;  2YNG A;  1FKO A;  3ALY A;  4O0I A;  3QER A;  4NYF A;  1L3S A;  3C95 A;  4RW9 A;  4Z4C A;  1HNI A;  3ZSZ A;  1S9E A;  1D9F A;  4KTW A;  3ZCM A;  3SI6 A;  3SQ4 A;  2DTU A;  3AA5 X;  3O3H A;  1A5X A;  4CEQ A;  1I39 A;  4F3T A;  3JYT A;  1RTI A;  2XY8 A;  3A2F A;  5KTQ A;  4KAZ A;  1RBV A;  4CJ5 A;  4DTN A;  2G8F A;  2IOC A;  3T1A A;  3OJU A;  4FLV A;  3SUN A;  1HRH A;  1SKS A;  4KRF A;  5HBM A;  1BI4 B;  3OYJ A;  3KJV A;  2XRI A;  4CJE A;  4CFB A;  3S3N A;  1LV5 A;  3IAY A;  1TKZ A;  3OYE A;  3QNN A;  2G8H A;  3QEX A;  1TGO A;  4M3X A;  4CHP A;  3TWH A;  4FZZ A;  3KKS A;  1GOC A;  1JLG A;  4DG1 A;  2RN2 A;  3KKR A;  3TI0 A;  3VQ9 A;  1C1A A;  4KB0 A;  2FBY A;  2BAN A;  4B9N A;  3DLK A;  4FM2 A;  1X9S A;  1KLM A;  1QSL A;  4FJ9 A;  4AHU A;  4FXD A;  1TAU A;  3IG1 A;  3LAM A;  1KTQ A;  1HQE A;  2FBX A;  1R0A A;  3C6U A;  3NH2 A;  3V4I A;  1JLE A;  3SQ1 A;  1FKP A;  4M3U A;  2ITG A;  3JSM A;  1LAW A;  3WNH A;  1VSM A;  1QQC A;  3P83 D;  3LP0 A;  4CGI A;  1RT2 A;  3CFO A;  3QET A;  1U4B A;  3QIN A;  1WNS A;  4CGG A;  4CHZ A;  3K5N A;  1IG9 A;  4CJF A;  4J2A A;  1BQM A;  1A5V A;  4IG0 A;  4OGE A;  5FDL A;  5HRR A;  4Z4F A;  1F21 A;  4DMN A;  2F8S A;  2YNI A;  4BWM A;  4DU4 A;  1Z25 A;  3AVJ A;  4O4G A;  4BE0 A;  3NGY A;  4R5P A;  3ITH A;  1HMV A;  1X9W A;  2XO7 A;  1JL2 A;  2YNF A;  3LWL A;  1QTM A;  1QE1 A;  2DFF A;  4KKO A;  3ZSX A;  1GOA A;  3NE6 A;  4CGJ A;  3D0P A;  4HCB A;  5J2N A;  4CEF A;  3NGZ A;  3VQ5 A;  4NCA A;  3T3F A;  1WAJ A;  4KRE A;  3SUO A;  1C6V A;  2HNY A;  4NCG A;  2OPR A;  3DM2 A;  2GUI A;  3LZJ A;  3EZ5 A;  4GVM A;  1QSY A;  4W5Q A;  4CF1 A;  1L5U A;  3L8B A;  1NJX A;  4DSJ A;  4IFY A;  4F2S A;  4DSE A;  1RDD A;  3NBP A;  4FZX C;  1WSG A;  4OLB A;  4E7L A;  3TAP A;  1ZBI A;  4IFV A;  3RWU A;  1JKH A;  4FJK A;  3KTQ A;  4OKJ A;  1TKD A;  4Z4G A;  4N5S A;  3LAL A;  1Y97 A;  1HYV A;  3OYL A;  1LWC A;  2IGI A;  5HRS A;  3PV8 A;  2YNH A;  4H4M A;  1N6Q A;  2RKI A;  1NKB A;  2HHW A;  1BCM A;  4RG8 A;  1SL1 A;  3KLF A;  4L8R B;  2LSN A;  2X6S A;  4FVM A;  4CED A;  4DLE A;  2OZS A;  1ZBH A;  4CHN A;  3DOK A;  3DI6 A;  3LP3 A;  2OA8 A;  2X74 A;  3BGR A;  1S9G A;  3MAQ A;  2DFH A;  4FZY A;  3QEP A;  2HHV A;  4DFP A;  1NJW A;  2FBV A;  4I2Q A;  4EP5 A;  3SQ2 A;  4CHY A;  5KRS A;  3M8S A;  4E7J A;  2ZQB A;  3DYA A;  4IBN A;  4CFD A;  5D3G A;  1NK9 A;  3LPU A;  3NHG A;  1A5W A;  3CFP A;  3QEI A;  3HJF A;  3DOL A;  3AVN A;  1QS4 A;  4CFA A;  4JS4 A;  5HP1 A;  1K6Y A;  4RW8 A;  4E19 A;  3V9U A;  2G8W A;  4FM1 A;  4M3W A;  4AHS A;  3OYB A;  3VN5 A;  4DTR A;  3THV A;  3VQB A;  4E1N A;  1KVA A;  1YVU A;  4DTO A;  5CYM A;  4CK2 A;  4WE1 A;  3TAE A;  4W5R A;  2HW3 A;  4RW4 A;  2E4L A;  4FLT A;  2ETJ A;  2Z1H A;  1TK0 A;  4DU1 A;  3ZSV A;  4BDY A;  4I7F A;  1LW2 A;  3OYA A;  2XY7 A;  1VSJ A;  4QCL A;  1ZBF A;  1CZB A;  1VSD A;  3K5M A;  4N76 A;  1S1W A;  1JLF A;  1UA1 A;  4CF9 A;  3LWM A;  1L3U A;  3PO4 A;  4FJH A;  1CXU A;  4M3R A;  4CJK A;  4QOZ B;  4YFU A;  1NJZ A;  1C1B A;  1QHT A;  2FBT A;  1SL0 A;  4AHV A;  3U3Y A;  3MEE A;  4CJR A;  4KO0 A;  3DRR A;  1RCH A;  1WSE A;  1D8Y A;  1BL3 A;  3EY1 A;  3DLG A;  4KTQ A;  4ID5 A;  3OS1 A;  3IRX A;  3ZSR A;  4CEC A;  4HTU A;  3NH0 A;  1NK0 A;  3CQ8 A;  4LSN A;  4F3O A;  4FJJ A;  5KGW A;  3AVC A;  5CYQ A;  2HMI A;  4IKF A;  3MEG A;  5CZ2 A;  4DTJ A;  4M41 A;  4C8K A;  4B9V A;  1REV A;  5HRO A;  1MU2 A;  3AVB A;  3AVH A;  1RIL A;  1NOZ A;  2D0B A;  1RT3 A;  4GW6 A;  2FC0 A;  3TAN A;  2P51 A;  2YHA A;  2EHG A;  2IDO A;  4FJ5 A;  2A1R A;  4CGF A;  3SQ0 A;  1NK5 A;  4B9U A;  1IKV A;  2VG6 A;  1WSH A;  1J53 A;  1RNH A;  3HVT A;  4Y1D A;  4PWD A;  3K5O A;  4Q0B A;  1WSF A;  2PYJ A;  4FM0 A;  3RRG A;  2VG5 A;  3KLI A;  4YNQ A;  2ZD1 A;  4M3T A;  5CY4 A;  4ZTJ A;  3RMB A;  1IKW A;  3KIO A;  1NKE A;  2HVH A;  2ZE2 A;  4CF0 A;  1TL3 A;  1T05 A;  3HYF A;  4KPY A;  1LW0 A;  1SL2 A;  3CM5 A;  3NAE A;  3ASM A;  1LAV A;  1KRP A;  1KFD A;  4DTP A;  1BIU A;  1D9D A;  4C8L A;  4I2P A;  3ZSQ A;  4FK4 A;  3ZT3 A;  1RBR A;  1C0U A;  3AVI A;  1VSK A;  5HRP A;  1YT3 A;  4FJM A;  2Z1G A;  2Z1I A;  1TV6 A;  3S3O A;  1RDC A;  1UA0 A;  5HLF A;  2P5G A;  4KHW A;  3LDS A;  3NCI A;  3AA2 A;  3AO3 A;  1IKY A;  3SJJ A;  2YHB A;  4CGD A;  5FRM A;  3TAM A;  3NF7 A;  5J2M A;  2A1S A;  3AVG A;  3AV9 A;  1S1V A;  4NYN A;  3VQ7 A;  4H8K A;  3WNF A;  3L3V A;  1B9F A;  4Z4H A;  1NKC A;  4N41 A;  1C1C A;  2G8I A;  1Q9Y A;  3NF8 A;  4BDZ A;  5C24 A;  5J2Q A;  2PYL A;  2KTQ A;  3AA4 A;  2PZS A;  4W5N A;  4K8X A;  2JGU A;  3LP1 A;  4KI4 A;  4W5T A;  1JXB A;  3O4Q A;  2KW4 A;  4CJT A;  3CM6 A;  3VQ4 A;  3NDK A;  3L2W A;  2OZM A;  4DQP A;  1L3T A;  4J2D A;  3OYN A;  3AVF A;  3DRP A;  3B6O A;  3V1O A;  1S5J A;  4ID1 A;  4CF2 A;  1VRU A;  1CZ9 A;  1WN7 A;  2KQ2 A;  3AVK A;  4JLH A;  4N56 A;  4CEA A;  3TAB A;  5SWM A;  2BDP A;  3DLH A;  1S6P A;  1WAF A;  1VSI A;  3SZ2 A;  4DF8 A;  2B6A A;  5E41 A;  3AO1 A;  3S3M A;  2GBZ A;  3ULD A;  1D5A A;  3LPT A;  3RMD A;  4B9S A;  3LP2 A;  1BI4 A;  2WOM A;  2VWJ A;  1VRT A;  3V9S A;  4B8C A;  4CJ4 A;  4DQR A;  4NCB A;  1WSI A;  4M42 A;  2EX3 A;  4B9T A;  1RBS A;  3AVA A;  4CIG A;  3PO5 A;  4FK0 A;  4DSI A;  4CIE A;  3KLH A;  3QEV A;  3V81 A;  4IG3 A;  5I42 A;  4DF4 A;  3OJS A;  4FJ8 A;  3S9H A;  4KFB A;  1LWE A;  1SUQ A;  3EYZ A;  4M45 A;  3FFI A;  1IH7 A;  2QKK A;  1LWF A;  2BE2 A;  3SV3 A;  3VQC A;  2G8K A;  1ZYQ A;  5JS1 A;  4AHT A;  4LY7 A;  3P1G A;  4C8M A;  4O5B A;  1TVR A;  3CG7 A;  1BHL A;  1C0T A;  2HNZ A;  2D0A A;  2VG7 A;  1UAX A;  3QO9 A;  4AH9 A;  5C42 A;  4CHQ A;  2G8V A;  2O4I A;  3DLB A;  4FW2 A;  3OYK A;  5C25 A;  4DFJ A;  2D5R A;  4B8A B;  4CJS A;  3SPZ A;  1KSP A;  3AVL A;  3SYZ A;  2QKB A;  4FW1 A;  3DMJ A;  4B9M A;  5J2P A;  2RF2 A;  5J1E A;  4CK1 A;  5CZ1 A;  4Q5V A;  4CJL A;  1U45 A;  3KLE A;  4F4K A;  4E1M A;  4F8R A;  5JS2 A;  4FJN A;  4HUG A;  4CF8 A;  3LZI A;  4PY5 A;  4KV8 A;  1SV5 A;  4DWI A;  1RT4 A;  4LH5 A;  4CGH A;  4FJ7 A;  4RW7 A;  4OJR A;  4FK2 A;  3HT3 A;  3PUF A;  3KK1 A;  4E7I A;  3OYM A;  1NOY A;  1Q8I A;  1RBT A;  3HM9 A;  2VWK A;  4E0D A;  1O1W A;  1X1P A;  3QEW A;  1U47 A;  2Z1J A;  1VSH A;  3D45 A;  4MFB A;  4E7H A;  3HP9 A;  2HHQ A;  3V9X A;  3QLH A;  4PQU A;  1XC9 A;  1U04 A;  1JLA A;  3U3G A;  1ZBU A;  3QNO A;  1J9A A;  2RPI A;  3DRS A;  3CYM A;  4OPJ A;  3I8D A;  4KHS A;  3MEC A;  3WNG A;  3HVR A;  1XHX A;  4J2B A;  3K58 A;  1Z26 A;  2OPS A;  2W42 A;  1EET A;  4LSL A;  4ELU A;  4TSX A;  3L2Q A;  3O4N A;  3KK3 A;  4M3Z A;  1VSE A;  4LD0 A;  4CFC A;  3RR7 A;  1B92 A;  3G0Z A;  3F73 A;  4BWJ A;  1Q9X A;  1ASV A;  3QIP A;  2Y1J A;  1RBU A;  2OPP A;  5FRO A;  1BIZ A;  3RMA A;  1UWB A;  2B5J A;  1RTJ A;  4DTS A;  3SCX A;  2B4J A;  4ZHR A;  2YKM A;  5KI6 A;  1VSL A;  3DLE A;  4BE2 A;  1KFS A;  1JL1 A;  3HST B;  4MQ3 A;  4QAG A;  4DLG A;  4FLX A;  3SPY A;  3OYC A;  1S1U A;  3OS2 A;  3M8R A;  4E7K A;  5HRN A;  5EU7 A;  1JXE A;  4CJ3 A;  1EXQ A;  1W0H A;  3L3U A;  3OYH A;  3KLG A;  5DMR A;  1BCO A;  4CEE A;  3HPO A;  3K59 A;  4IDK A;  3NGI A;  4ELV A;  4FJG A;  2XHB A;  3V9Z A;  3V6D A;  3RRH A;  4FJI A;  4Z4I A;  4FLU A;  4B9L A;  2E6M A;  2IAJ A;  4E3S A;  2KFN A;  3SUP A;  4KTZ A;  3K2P A;  4DQS A;  1YTA A;  3V1Q A;  4DU3 A;  2DFE A;  4KHQ A;  4O0J A;  2HB5 A;  4HHT A;  3VQ6 A;  1KVB A;  3PX6 A;  1U48 A;  2F8T A;  2WON A;  3DLR A;  3U6F A;  2IC3 A;  1HYZ A;  4J2E A;  3I0S A;  3VA3 A;  1RT5 A;  4DTU A;  1IKX A;  3KD5 E;  3NF9 A;  4DSK A;  3TAR A;  3VQE A;  1ASU A;  5DK5 A;  3E01 A;  3WNE A;  1RT6 A;  4ICL A;  3V9W A;  3VQ8 A;  1HNV A;  4I9L A;  3B6P A;  3NH1 A;  4Z4E A;  4EP4 A;  3K57 A;  1J54 A;  3O3F A;  4CJV A;  1KCF A;  4B3O A;  2O4G A;  4CK3 A;  4KB1 A;  4CEO A;  3HPH A;  4FJX A;  1I3A A;  5KGX A;  3OYI A;  1SKR A;  1EKE A;  4I9Q A;  4E89 A;  4O44 A;  4B08 A;  3OVN A;  1QSS A;  4CJP A;  3RMC A;  4O55 A;  5T7B A;  1T03 A;  3BDP A;  4OLA A;  4XIU A;  2YV0 X;  3L2U A;  2HHU A;  3MXM A;  1KVC A;  4CER A;  3ZSY A;  4OVL A;  3IS9 A;  1DLO A;  1CXQ A;  2I5J A;  1NK6 A;  3VA0 A;  1JLB A;  3G10 A;  1RTD A;  1T7P A;  1VSF A;  3RR8 A;  2HND A;  4M3Y A;  2KZZ A;  3M8Q A;  1CLQ A;  2E6L A;  2YKN A;  3PY8 A;  1HQU A;  1N5Y A;  4JRP A;  3F9K A;  1G15 A;  2OPQ A;  4OKE A;  4DSL A;  1UOC A;  2X78 A;  3H08 A;  3ISN C;  3OYF A;  2BGG A;  3HP6 A;  3AA3 A;  4C8N A;  1TAQ A;  3MED A;  1ITG A;  1RDA A;  3TAF A;  4W5O A;  2XY6 A;  4C8O A;  4FCY A;  3KK2 A;  3HXM A;  1BIS A;  1TKT A;  1C0M A;  1JLQ A;  4CHO A;  3AO4 A;  2QK9 A;  4H4O A;  4OPK A;  3PX4 A;  3V1R A;  1IO2 A;  2DY4 A;  4Z0U A;  5I3U A;  3T19 A;  1U49 A;  4UQG A;  1WSJ A;  3SV4 A;  1X9M A;  4HCC A;  1YTU A;  2P5O A;  2F96 A;  4EZ6 A;  4CCH A;  2AJQ A;  3HO1 A;  3QES A;  4BDP A;  2Q3S A;  4CJQ A;  3OS0 A;  1JLC A;  3MXJ A;  2QXF A;  4CIF A;  4HVJ A;  3QIO A;  4DTM A;  4DQI A;  3AO5 A;  4PA1 A;  4DTX A;  4CEZ A;  4DFM A;  4EZ9 A;  3RTV A;  4OKK A;  1S6Q A;  2R7Y A;  3SUQ A;  4DFK A;  2Y1I A;  3K5L A;  3CFR A;  3VQP A;  1RTH A;  2G8U A;  3ZSO A;  4BAC A;  2OYQ A;  4DSF A;  1TKX A;  3C6T A;  4CES A;  1EP4 A;  1WLJ A;  3AO2 A;  3M8P A;  3PX0 A;  1NK4 A;  3KD1 E;  3OYG A;  1SKW A;  2HHT A;  1FK9 A;  4AHC A;  4AHR A;  2ATQ A;  4ELT A;  4N47 A;  1EX4 A;  1XHZ A;  3OY9 A;  1S1X A;  4DQQ A;  3UIQ A;  2NUB A;  3ZT1 A;  1XWL A;  1TK8 A;  4HUE A;  1BGX T;  1KLN A;  3VQQ A;  4DS5 A;  1BQN A;  1DTQ A;  4CJU A;  2X6N A;  4FLZ A;  1NK8 A;  1NJY A;  4FJL A;  3L2R A;  3TAG A;  1XI1 A;  1HYS A;  2KZM A;  5SZT A;  3ZT4 A;  3NF6 A;  3HL8 A;  1TL1 A;  3L2V A;  2GV9 A;  4AIL C;  3NFA A;  5KRT A;  3TAQ A;  1W9H A;  4JRQ A;  3VQD A;  4DS4 A;  1T8E A;  1S1T A;  4F2R A;  4RW6 A;  4G1Q A;  1VK0 A;  4K8Z A;  3MXI A;  3TR8 A;  1ASW A;  1L3V A;  2D0C A;  3O3G A;  4KHN A;  1B9D A;  2XY5 A;  1NK7 A;  1HJR A;  3I0R A;  3HK2 A;  3ZT2 A;  1GOB A;  4CJW A;  4FLY A;  4CE9 A;  3VQA A;  2PY5 A;  4KHU A;  1TK5 A;  4Y1C A;  4JS5 A;  4LH4 A;  2JLE A;  4CEB A;  4GMJ B;  3C94 A;  3ZT0 A;  3P5J A;  1RDB A;  3LAN A;  4HUF A;  4ZTF A;  4PUO A;  3HPG A;  3ZSW A;  1RT7 A;  1ZBL A;  2HHX A;  3LAK A;  5K14 A;  1RT1 A;  4BE1 A;  1J5O A;  2HHS A;  1HPZ A;  1DTT A;  4OGC A;  3SNN A;  4KHY A;  2HVI A;  4FLW A;  4FYD A;  2P1J A;  2KFZ A;  3AVM A;  2IS3 A;  4KI6 A; 
#chains in the Genus database with same CATH topology
 4LC9 B;  1FXX A;  4LF4 K;  3E1Y A;  3ALY A;  1FKO A;  4O0I A;  3OW2 M;  1S9E A;  1D9F A;  4BR5 A;  3AA5 X;  4CEQ A;  3JYT A;  3U8X A;  4KAZ A;  3ENB A;  4YDU A;  4CW7 B;  1RBV A;  3QFP A;  3OJU A;  4FLV A;  4B3M K;  1BI4 B;  1IBL K;  2XRI A;  1DT9 A;  4CFB A;  3LDQ A;  3EKU A;  5AZI B;  2G8H A;  1H1V A;  1Q86 O;  3J7Y P;  3TI0 A;  1GOC A;  4DG1 A;  4KB0 A;  3KKR A;  1C1A A;  2BAN A;  4PL7 A;  3DLK A;  3ZET A;  5AQK A;  4FM2 A;  4GV6 A;  4FXD A;  3IG1 A;  3C6U A;  3THX A;  2HBJ A;  3D2F B;  2ITG A;  1LAW A;  1QQC A;  3LDO A;  2O8F B;  5LMN K;  1RT2 A;  4MDA A;  4WQ5 A;  4CGG A;  4CHZ A;  3K5N A;  4CJF A;  1NGF A;  4H0Y B;  4JI1 K;  4IG0 A;  4YOX A;  5BRH A;  4DMN A;  4KHP K;  5B8H A;  2QWO A;  4BE0 A;  5AQR A;  2XO7 A;  1JL2 A;  1QE1 A;  3ZSX A;  1GOA A;  4RCH A;  3CCE N;  3D0P A;  4HCB A;  4CEF A;  4NCA A;  3T3F A;  3SUO A;  5EOY A;  4DV1 K;  1NGD A;  3C65 A;  4NCG A;  3DM2 A;  3PIO L;  2V7Z A;  4W5Q A;  4CF1 A;  1RDD A;  4FZX C;  4OLB A;  3O1W A;  2O8B A;  4FJK A;  4F9O A;  4CZJ A;  1LWC A;  2IGI A;  5C0Y A;  2D0P A;  4H4M A;  3J81 O;  1BCM A;  3KLF A;  3S41 A;  4NXN K;  1ZBH A;  1HKG A;  5AFU H;  1S9G A;  3VEY A;  1Y64 A;  4EP5 A;  4CHY A;  2ZQB A;  4BRF A;  5D3G A;  1BUP A;  3DOL A;  3IKM A;  4JS4 A;  4RW8 A;  2A5X A;  4E19 A;  4M3W A;  4DTR A;  3OYB A;  4ISG A;  1KVA A;  4DTO A;  3OHR A;  1TYQ A;  4DV3 K;  4W5R A;  4H5T A;  4RW4 A;  4DU1 A;  1WB9 A;  1YIT N;  3CIP A;  1GLC G;  4DV2 K;  4A62 A;  1LW2 A;  3C0B A;  1VSJ A;  3F2K A;  4A5A A;  4N76 A;  3K5M A;  1RGI A;  1MA9 B;  1CXU A;  5DM6 L;  1C1B A;  4DHY A;  3EY1 A;  3DLG A;  4KBO A;  3IRX A;  3ZSR A;  4HTU A;  3NH0 A;  1NK0 A;  3D2E B;  4LSN A;  4F3O A;  4BG8 A;  3AAP A;  4FJJ A;  3AVC A;  4IKF A;  4IOC L;  5GIN A;  3TSQ A;  4KH6 A;  3HOS A;  4M41 A;  4BRD A;  3AVB A;  2D0B A;  1U2V B;  2UU9 K;  2A1R A;  3HI0 A;  4B9U A;  1IKV A;  3FZM A;  4R79 A;  5BPM A;  4Y1D A;  3THW B;  4Q0B A;  3ZX2 A;  2VG5 A;  4YNQ A;  5EVZ A;  4CBX A;  1IKW A;  3KIO A;  2ZE2 A;  4CF0 A;  3A5L C;  4WFB L;  3CET A;  4IZ9 A;  4KPY A;  5CR4 A;  4BR0 A;  3NAE A;  4BRH A;  4X64 K;  4DTP A;  1D9D A;  4C8L A;  1RBR A;  1VSK A;  1YT3 A;  4FJM A;  3PSF A;  1UA0 A;  3D6R A;  5HLF A;  1I94 K;  5KQ8 A;  3TAM A;  3NF7 A;  2A1S A;  3AVG A;  5AQH A;  3WNF A;  3U9Z A;  4JI5 K;  4Z4H A;  4N41 A;  3TTD A;  3T7Z A;  3O08 A;  4JKA A;  3TTC A;  2GTD A;  3LP1 A;  1JXB A;  5M1K A;  4BRM A;  3NDK A;  3OYN A;  3AVF A;  3ZEU A;  5AFU A;  1S5J A;  4ID1 A;  4CF2 A;  1VRU A;  1CZ9 A;  3ZX3 A;  2BDP A;  4CEA A;  3FZK A;  4JKC A;  3SZ2 A;  4DF8 A;  3S3M A;  3D7E O;  2VWJ A;  4DQR A;  4I6M B;  2H3G X;  4CJ4 A;  4CZH A;  5LJW A;  4CIG A;  4CIE A;  2VWB A;  2Q31 A;  1NGA A;  4J8F A;  4NB4 A;  4DF4 A;  1EWR A;  4CZE A;  1LWE A;  1SUQ A;  1IH7 A;  3LM9 A;  1HUX A;  3SV3 A;  3G71 N;  1NMN A;  3MWT A;  4LY7 A;  2NRV A;  1TVR A;  5BRF A;  3QBW A;  4CHQ A;  2G8V A;  2O4I A;  3DLB A;  2E88 A;  5ADX H;  4B8A B;  4WCE L;  1YIJ N;  3TPQ A;  1K9M O;  3AVL A;  2QKB A;  4B9M A;  3DMJ A;  4DV0 K;  2UUA K;  4Q5V A;  2O8E A;  3KLE A;  4E1M A;  1J5E K;  1MWK A;  4HUG A;  1JCE A;  4CF8 A;  4PY5 A;  1SV5 A;  4DWI A;  4FJ7 A;  4RW7 A;  1X9J A;  1YAG A;  3LDP A;  3O1B A;  4FK2 A;  4YOV A;  3HT3 A;  3PUF A;  4E7I A;  3BP8 A;  1Q8I A;  5BRD A;  5AQU A;  4E0D A;  1X1P A;  3VTH A;  2FSJ A;  4MFB A;  3MX2 A;  2HF4 A;  4WQ4 C;  4PQU A;  1YI2 N;  3OTO K;  4BRE A;  4FO0 A;  4J2B A;  3E66 A;  2ZWH A;  1V4S A;  3R3L A;  1EET A;  4IDH A;  4LSL A;  5JLH A;  4ELU A;  2UUC K;  4ILG B;  4BWJ A;  1ASV A;  3MN7 A;  3A5O C;  3WEE A;  1X3N A;  2B5J A;  2IVN A;  2Q36 A;  4OPH A;  5KI6 A;  3HST B;  4DLG A;  3H46 O;  4FPB A;  5HRN A;  1JXE A;  1VQ6 N;  4H5R A;  4DR5 K;  1W0H A;  2JWL A;  4WF9 L;  2F4V K;  1BCO A;  4CEE A;  4B1W B;  3V9Z A;  4Z4I A;  2E6M A;  4A2A A;  3EN9 A;  4KTZ A;  3K2P A;  3WT0 A;  4O0J A;  4CZI A;  1K8A O;  2F8T A;  2WON A;  3DLR A;  4B9Q A;  1T6D A;  3I0S A;  3VGK A;  1RT5 A;  4DSK A;  3BY5 A;  4ICL A;  3VQ8 A;  1RDU A;  4I9L A;  4MO5 A;  2ZJQ L;  4JK8 A;  1SKR A;  1EKE A;  5MLC Q;  4E89 A;  3ENO A;  3A8Y A;  4O44 A;  4OLA A;  3OVN A;  1P8Z A;  1QSS A;  4OVL A;  4JEP A;  1CXQ A;  3CC2 N;  3VA0 A;  1MWM A;  2O8D B;  2KZZ A;  1VSF A;  4M3Y A;  4JI3 K;  3ATV A;  1HQU A;  1N5Y A;  1G15 A;  4BRQ A;  3HP6 A;  3DJC A;  1TAQ A;  3VEX A;  4DR3 K;  1RDA A;  3I55 N;  4FCY A;  2FF3 B;  3KK2 A;  1E4F T;  3GL1 A;  1JLQ A;  2QK9 A;  3O9R A;  5GAG P;  5LJV A;  4RTF D;  1WSJ A;  2F96 A;  2AJQ A;  3ZX0 A;  2QXF A;  4HVJ A;  4DQI A;  5C2D A;  5KQD A;  5CE3 A;  4PA1 A;  1BWF O;  3CI5 A;  2QWN A;  4DFM A;  1KC8 O;  3VPZ A;  4ILH A;  4DFK A;  2G8U A;  1WOQ A;  4DSF A;  3KD1 E;  4ILJ A;  2Q1N A;  2Q97 A;  1QZ6 A;  4BY9 C;  2HHT A;  1OH8 A;  4KH4 A;  4AM6 A;  1GLB G;  2WTU A;  4A59 A;  4YHH K;  4HUE A;  3B8A X;  3KHY A;  4CJU A;  2X6N A;  4BR4 A;  4JI8 K;  1N33 K;  3TAG A;  4FWM A;  3GG4 A;  2P9U B;  3NF6 A;  1Z6R A;  1TL1 A;  4AIL C;  4F2R A;  3ID8 A;  1L3V A;  3O9S A;  1NK7 A;  1HJR A;  3ZT2 A;  4CE9 A;  4GMJ B;  2O8E B;  2HOE A;  3P5J A;  4DV5 K;  3ZSW A;  3E9P A;  3LAK A;  4FOE A;  4BE1 A;  2ZM6 K;  2HHS A;  3CJB A;  5M1F A;  4OGC A;  4FYD A;  2P1J A;  3OYD A;  4K0K K;  3C95 A;  4RW9 A;  4Z4C A;  4KTW A;  5AQG A;  3QBX A;  5BPL A;  3O3H A;  2AA4 A;  4CI6 A;  5KTQ A;  2E1Y A;  5FPM A;  1VQM N;  5AQI A;  3HOT A;  2G8F A;  3CCM N;  3EZW A;  3SUN A;  4KRF A;  3L4I A;  5GIP A;  5HBM A;  1XNQ K;  4XH5 A;  3H6E A;  1C0F A;  3OYE A;  1FJG K;  4DV6 K;  4CJ7 A;  1TGO A;  4BC3 A;  1TUY A;  4M3X A;  1IV0 A;  2RN2 A;  3K9K A;  2FBY A;  4B9N A;  1X9S A;  1KLM A;  3GBT A;  4A5B A;  4OPA A;  5AQT A;  4DUY K;  3KWI A;  2FBX A;  3EKS A;  1JLE A;  3SQ1 A;  3QDK A;  4CGI A;  3QET A;  3CFO A;  3ATU A;  4J2A A;  2V52 B;  3DXK B;  3MN9 A;  1ZBS A;  5HRR A;  2YNI A;  3CJ7 A;  4DU4 A;  3EE8 A;  4BQZ A;  4IEI A;  3ITH A;  1HMV A;  3LWL A;  1HLU A;  1W7A A;  4IJA A;  5M1N A;  3J80 O;  3UKR B;  4KRE A;  3PLA A;  2GUI A;  3EZ5 A;  4GVM A;  2UXB K;  5E26 A;  4DSJ A;  4IFY A;  4E7L A;  3TAP A;  4BRK A;  1JKH A;  3SLC A;  3WXL A;  4OKJ A;  1TKD A;  3PV8 A;  2YNH A;  3THW A;  2KHO A;  4C1N I;  3HBT A;  1GLJ O;  3CCQ N;  1SL1 A;  2LSN A;  2OZS A;  4CHN A;  3LP3 A;  4JK9 A;  3BGR A;  2E2P A;  1ILY A;  3CF5 L;  3SQ2 A;  5KRS A;  4E7J A;  4CFD A;  3C6H A;  1NK9 A;  3LPU A;  3AGK A;  3CFP A;  3HJF A;  2AP1 A;  1QS4 A;  5HP1 A;  1CZA N;  4JKD A;  3V9U A;  2G8W A;  1XQS C;  3LDL A;  3VN5 A;  3THV A;  3VQB A;  2GX9 A;  3M5R A;  4DR6 K;  1YVU A;  4JK7 A;  4GY2 B;  3TAE A;  1VQN N;  2P9P A;  4JYA K;  2ETJ A;  2Z1H A;  1TK0 A;  1P90 A;  4I7F A;  3WUH A;  2XY7 A;  1ZBF A;  1NWK A;  1VSD A;  3UE5 A;  4K41 A;  1UA1 A;  5C2F A;  4CJK A;  4EHT A;  4QOZ B;  4YFU A;  1NJZ A;  3KZB A;  1SL0 A;  3U3Y A;  5AQL A;  4CJR A;  3DRR A;  2NRR A;  1ATN A;  2YHW A;  3O80 A;  3O9T A;  2KKZ A;  4JKB A;  4QS7 A;  3CQ8 A;  1K8K B;  2HMI A;  1JCG A;  2EWS A;  1KD1 O;  4B9V A;  5HRO A;  1MU2 A;  1SS6 A;  3AVH A;  4GW6 A;  1RT3 A;  2FC0 A;  3TAN A;  3NVM A;  2YHA A;  2EHG A;  3SQ0 A;  1NK5 A;  1WSH A;  4M7X A;  4Y0W A;  3HVT A;  3K5O A;  1GLE G;  1WSF A;  2PYJ A;  3A5M C;  4PKI A;  2ZD1 A;  4O5F A;  3VEO A;  3AGR A;  2HVH A;  4OX9 K;  1U6Z A;  4FWQ A;  4BC2 A;  5GAE P;  2VYP A;  1GLF O;  1W2B M;  1QQN A;  1KRP A;  1KFD A;  3GDQ A;  4XH4 A;  3ZSQ A;  1JCF A;  4FK4 A;  3ZT3 A;  2Z1I A;  3WQT A;  2ZJP L;  1QHA A;  3AO3 A;  3SK3 A;  5J2M A;  4NYN A;  3AV9 A;  2QW9 A;  3I33 A;  2G8I A;  2PYL A;  4BRL A;  5C24 A;  5BR9 A;  4W5N A;  4BC5 A;  3SBT A;  4KI4 A;  3O4Q A;  2BH1 A;  4CJT A;  3CM6 A;  3VQ4 A;  4DQP A;  4EFH A;  3V1O A;  4JLH A;  3AVK A;  4U67 L;  2WBN A;  2B6A A;  5E41 A;  3AO1 A;  1D5A A;  3LPT A;  3AAR A;  4B9S A;  3LP2 A;  4NCB A;  2EX3 A;  1VQ5 N;  1RBS A;  3PO5 A;  4FK0 A;  3V81 A;  3VEW A;  4K43 A;  3CJC A;  1QVG M;  1NNE A;  2FSN A;  3ULE B;  1OVY A;  2QKK A;  3J8A A;  5JS1 A;  1R59 O;  2FXU A;  3CG7 A;  4AH9 A;  2D0A A;  4C23 A;  1UAX A;  5C42 A;  4CVN E;  1KXP A;  4FW2 A;  3OYK A;  4DFJ A;  2D5R A;  4CJS A;  1J6Z A;  4FW1 A;  2RF2 A;  4A57 A;  3F9M A;  1N34 K;  3IDH A;  1U45 A;  4F4K A;  5JS2 A;  3LZI A;  4KV8 A;  4YOY A;  3R1X A;  1N36 K;  3KK1 A;  4FVU A;  5AQO A;  2VWK A;  3MK6 A;  2Z1J A;  3C6A A;  3D45 A;  3HP9 A;  4KH5 A;  3QLH A;  4NLC A;  1U04 A;  4JI4 K;  1ZC6 A;  1ZBU A;  5AQV A;  3DRS A;  3MEC A;  5HOO A;  5AQW A;  1ATR A;  3K58 A;  1Z26 A;  1XMQ K;  3TTF A;  4MLE A;  2W42 A;  4ISF A;  3O4N A;  4M3Z A;  4OO1 J;  5ELZ A;  1Q9X A;  1M90 O;  2Y1J A;  3K9J A;  1RBU A;  1W97 L;  1BIZ A;  1UWB A;  4DTS A;  1RTJ A;  2YKM A;  1VSL A;  3DLE A;  1KFS A;  4QAG A;  3SPY A;  1S1U A;  3P38 A;  4IWV A;  4E7K A;  3DLL L;  3BF3 A;  3OYH A;  4IDK A;  5BN9 A;  3NGI A;  2XHB A;  3RRH A;  4FLU A;  4B9L A;  2IAJ A;  2KFN A;  1IJJ A;  1HPM A;  4DQS A;  3MN5 A;  4DV7 K;  2HB5 A;  2CH6 A;  2IC3 A;  3IMX A;  3VMF B;  3I8B A;  3VA3 A;  1IKX A;  1S72 N;  2NLX A;  2QEX N;  3E01 A;  1RT6 A;  4H5W A;  1Z05 A;  1HNV A;  1NGI A;  4H5V A;  3B6P A;  1VQ9 N;  4Z4E A;  4EP4 A;  4CK3 A;  3SBG A;  5KGX A;  3OYI A;  4JD2 B;  2O8D A;  2KLA A;  5AQX A;  4ISE A;  5T7B A;  2HHU A;  3MXM A;  4CER A;  1K73 O;  2NRH A;  4DR2 K;  2P9N A;  1RTD A;  3TSP A;  1CLQ A;  3RR8 A;  3M8Q A;  2I7P A;  2YKN A;  3PY8 A;  3F9K A;  4OKE A;  4DSL A;  1UOC A;  2X78 A;  3OYF A;  3U4L A;  4Z94 A;  2BGG A;  3CC7 N;  1ITG A;  3TAF A;  2XY6 A;  1TKT A;  2OTL N;  4H4O A;  4OPK A;  3PX4 A;  2DY4 A;  1IO2 A;  2GWK A;  3EO3 A;  5E84 A;  3SV4 A;  1X9M A;  4HCC A;  4WQ5 C;  2P9U A;  4DV4 K;  4EZ6 A;  4CCH A;  4O8K A;  1KAX A;  1S22 A;  4BDP A;  2Q3S A;  2YJE A;  3OS0 A;  1JLC A;  4CIF A;  5GAH P;  4DTX A;  3RTV A;  4OKK A;  3CQY A;  3WEE B;  2R7Y A;  1ESV A;  2Y1I A;  3K5L A;  1RTH A;  1TKX A;  2E2N A;  1VQP N;  1NK4 A;  2P9K A;  3M8P A;  5IWA K;  1SKW A;  1WBD A;  2ZF5 O;  4U7B A;  3G4S N;  4ELT A;  3HTV A;  1XHZ A;  5FPD A;  1S1X A;  4DQQ A;  5AQM A;  5M1O A;  3ZT1 A;  1BGX T;  4H0P A;  5C10 A;  4FLZ A;  1NK8 A;  4FJL A;  1NJY A;  3J7A P;  2A3Z A;  2NRT A;  1XI1 A;  4BRG A;  2KZM A;  3CC4 N;  3VET A;  3NFA A;  3FZF A;  5KRT A;  4WYB A;  4B1X B;  1VK0 A;  4FWL A;  4K8Z A;  1VAZ A;  4FWK A;  3FR0 A;  2PY5 A;  4K25 A;  4JS5 A;  4LH4 A;  2JLE A;  1XMO K;  1Q7Y O;  4LFC K;  4PUO A;  1ZBL A;  3GE1 A;  1J5O A;  4H0X B;  2GWJ A;  2HVI A;  3GOI A;  1DEJ A;  4FLW A;  4H5N A;  2KFZ A;  4FPA A;  4LF7 K;  3W0L A;  1YXQ A;  1NGG A;  3QER A;  1HNI A;  4JKG A;  2RE2 A;  3ZCM A;  3SI6 A;  4MLH A;  2DTU A;  2PFU A;  3BZK A;  1A5X A;  4F3T A;  2CGK A;  1RTI A;  2XY8 A;  3Q7B A;  2W6K A;  3VEN A;  3RSE A;  4CJ5 A;  4DTN A;  1SKS A;  1MDU B;  1HRH A;  1YJN N;  3CJA A;  3CQX A;  2HST A;  3KJV A;  3OYJ A;  4CJE A;  3S3N A;  3IAY A;  2J4R A;  1TKZ A;  3QNN A;  3QEX A;  5H1S Q;  4CZL A;  3BZC A;  2BUP A;  3TWH A;  1JLG A;  3BEX A;  4PHT X;  1OVQ A;  2P9S B;  3DXM A;  1QSL A;  4JNE A;  4AHU A;  1TAU A;  2GEM A;  3OBW A;  1QVF M;  1HQE A;  1R0A A;  3V4I A;  5C12 A;  2WFB A;  3MDQ A;  1VSM A;  3DWL A;  1XNR K;  4MDB A;  3QIN A;  1IG9 A;  3VEV A;  1BQM A;  4EHU A;  1F21 A;  3LDN A;  5AQY A;  1Z25 A;  3NGY A;  4R5P A;  4GV3 A;  2DFF A;  4KKO A;  4CGJ A;  3NGZ A;  3VQ5 A;  3CXC M;  5AZJ A;  1KAY A;  2OPR A;  3LZJ A;  2VCP A;  4BRP A;  4X65 K;  2QXL A;  3L8B A;  1NJX A;  3N4P A;  4F2S A;  4DSE A;  3NBP A;  1WSG A;  1ZBI A;  1HKC A;  3RWU A;  2QWQ A;  3QML A;  1VQL N;  3KTQ A;  5JVH L;  4Z4G A;  1HYV A;  3WXJ A;  4B3R K;  3H3O B;  1N6Q A;  1Q18 A;  1NGH A;  2RKI A;  4DQ8 A;  2HHW A;  4RG8 A;  4L8R B;  2X6S A;  4FVM A;  3SMS A;  4LF8 K;  4C1N K;  3DI6 A;  2OA8 A;  2X74 A;  4FZY A;  3MAQ A;  1T6C A;  3QEP A;  4DFP A;  1NJW A;  2FBV A;  3AY9 A;  4I2Q A;  2FF6 A;  5BRE A;  3NHG A;  1A5W A;  3AVN A;  3FFK B;  1EQY A;  4CFA A;  4A2B A;  4WFN L;  1K6Y A;  4BVO A;  4FM1 A;  3ULE A;  1NGJ A;  1T44 A;  4IXC A;  5CYM A;  4CK2 A;  4WE1 A;  2E4L A;  1FW6 A;  3ZSV A;  1RFQ A;  4BDY A;  3HZ6 A;  3VF6 A;  1Q81 O;  1CZB A;  2HMP A;  4IJN A;  1L3U A;  3PO4 A;  4JKE A;  4FJH A;  3ZYY X;  3F5T A;  3LM2 A;  1TYQ B;  2YCH A;  4AHV A;  3ZEU B;  4YOT A;  4KO0 A;  4KTQ A;  2ITM A;  5AQF A;  2Q0U A;  5KGW A;  5CYQ A;  2FLO A;  1LOT B;  5CZ2 A;  4C8K A;  4DTJ A;  4NXM K;  3M3Z A;  3O8M A;  3QFU A;  3A0I X;  4M63 C;  1KAZ A;  2IDO A;  4FJ5 A;  3JXU A;  3JAM O;  1J53 A;  1SZ2 A;  1BDG A;  1RNH A;  4PWD A;  3RRG A;  4GV9 A;  4BGB A;  2O8B B;  5CY4 A;  4BRI A;  2NRW A;  3NVK A;  1QQM A;  5AQP A;  1HKB A;  3ASM A;  3CJ1 A;  5A2Q O;  4FOI A;  1OH7 A;  4IO8 A;  2UXD K;  3AVI A;  5JVG L;  3VEZ A;  1TV6 A;  4IO9 L;  2P5G A;  2QI2 A;  4LFB K;  3LDS A;  4DUZ K;  1IKY A;  3SJJ A;  5DM7 L;  2DPN A;  2YHB A;  4CGD A;  5FRM A;  4DR4 K;  1S1V A;  3VQ7 A;  1U2V A;  4GNI A;  1B9F A;  2YI1 A;  1BG3 A;  3NF8 A;  5J2Q A;  2NRZ A;  1Q9Y A;  2KTQ A;  2PZS A;  2GEL A;  5AQJ A;  2CH5 A;  2JGU A;  1K8K A;  4W5T A;  3CMA N;  2OZM A;  4JV5 K;  2NZT A;  3B6O A;  1X3M A;  2KQ2 A;  5SWM A;  5AR0 A;  4NLB A;  2GBZ A;  3ULD A;  3RMD A;  3LL3 A;  4YOR A;  1BI4 A;  1VRT A;  1WSI A;  4B9T A;  3AVA A;  4DSI A;  2F7T A;  4CZF A;  4IG3 A;  5I42 A;  2P9P B;  3OJS A;  2Q0R A;  3S9H A;  4JHD A;  2E5L K;  4FJ8 A;  3EYZ A;  3MWP A;  4M45 A;  3VQC A;  2G8K A;  3BF1 A;  1ZYQ A;  5FPE A;  4B1Z A;  4AHT A;  2E1Z A;  3P1G A;  4B3S K;  1C0T A;  2HNZ A;  2VG7 A;  3QO9 A;  2UXC K;  4B3T K;  5C25 A;  2HHH K;  2WC9 A;  4BG9 A;  3SYZ A;  4IOA L;  5J2P A;  1DGK N;  5J1E A;  4MO4 A;  2QWR A;  3BUZ B;  3IUC A;  5CZ1 A;  3I56 N;  4QS9 A;  4YOW A;  4H0O A;  4FJN A;  5TKW A;  1NBW A;  4BRN A;  2YJF A;  2VGN A;  2QTD A;  2ZGZ A;  3OYM A;  1RBT A;  1U47 A;  2HHQ A;  1XC9 A;  4HTL A;  1JLA A;  2HBL A;  3UKR A;  1G99 A;  3QNO A;  1J9A A;  4OPJ A;  3CYM A;  2ZJR L;  3HVR A;  2OPS A;  3WXI A;  4H0V B;  4BR7 A;  4TSX A;  3L2Q A;  3KK3 A;  1VSE A;  4LD0 A;  3DXK A;  3CCS N;  3H3N O;  4CFC A;  4EIA A;  3RR7 A;  5GIO A;  1B92 A;  1IBK K;  3F73 A;  2HBK A;  4M7Y A;  3QIP A;  1NG9 A;  5FRO A;  2OPP A;  2O8F A;  1NU0 A;  3THX B;  4BE2 A;  1HNX K;  3OYC A;  3M8R A;  4CD3 A;  3ZET B;  3N4Q A;  4CBU A;  4ELV A;  4LF6 K;  5DMR A;  3HPO A;  3K59 A;  4FJG A;  1RDW X;  4X66 K;  3T1Y K;  3V6D A;  4E3S A;  3SUP A;  4JI0 K;  5AZI A;  1YTA A;  3V1Q A;  4DU3 A;  4KHQ A;  3VQ6 A;  1KVB A;  1U48 A;  5I9E B;  3U6F A;  4J2E A;  1NJI O;  3KD5 E;  3UB5 A;  3TAR A;  5DK5 A;  3WNE A;  3V9W A;  1HR0 K;  2O8C A;  1YUW A;  3NH1 A;  3O3F A;  3MCA B;  4B3O A;  2O4G A;  4KB1 A;  4CEO A;  4FJX A;  3P31 A;  1I3A A;  1BA0 A;  2VGM A;  5JIC A;  3VF2 A;  3CCR N;  4IEE A;  4B08 A;  3BDP A;  4CJP A;  2YV0 X;  3MMV A;  3L2U A;  3ZSY A;  1LCU A;  3PSI A;  3UKU A;  1NK6 A;  4XEI A;  1JLB A;  3G10 A;  1T7P A;  3FGU A;  1OH5 A;  4JRP A;  2O8C B;  2OPQ A;  1YF5 L;  3NMU A;  3AA3 A;  2F9T A;  4LFA K;  1OH6 A;  4B1Y B;  3OBY A;  2QM1 A;  1BIS A;  3O4W A;  4BQL A;  3HSC A;  3V1R A;  5I3U A;  3T19 A;  3E9L A;  3HO1 A;  3MCP A;  3MXJ A;  2HF3 A;  4DTM A;  4LF9 K;  3CCV N;  2OAN A;  3SUQ A;  4FL9 A;  3VQP A;  3ZSO A;  4BAC A;  4AM7 A;  3C6T A;  4NO7 A;  3AO2 A;  3PX0 A;  4BGA A;  3OYG A;  2QA4 N;  5FLX O;  2IIR A;  3OA9 A;  4FWO A;  3CCL N;  2ASO A;  4AHC A;  4AHR A;  1DKG D;  4GKJ K;  2ATQ A;  3OY9 A;  1TUU A;  5BN8 A;  2NUB A;  1TK8 A;  3VQQ A;  3AAQ A;  4DS5 A;  1DTQ A;  3L2R A;  2E2O A;  4GKK K;  1QQO A;  1HYS A;  3ZT4 A;  3FLC O;  2GV9 A;  5M1P A;  1KQS M;  1W9H A;  4JRQ A;  3VQD A;  4DS4 A;  2UYT A;  3RVC A;  1SAZ A;  2ZGY A;  3TR8 A;  1ASW A;  4BRC A;  2D0C A;  3O3G A;  4KHN A;  2VQF K;  3HK2 A;  3EL2 A;  3KWG A;  4CJW A;  5HL7 L;  3J7Z O;  3VQA A;  4FLY A;  1TK5 A;  4Y1C A;  4CEB A;  3IFR A;  1RDB A;  3LAN A;  4HUF A;  3HPG A;  1RT7 A;  1SQK A;  4JKH A;  4CBW A;  1WBB A;  4KHY A;  3HRG A;  1GLD G;  4CJL A;  2IS3 A;  4DLE A;  1M1K O;  4KI6 A;  5FRN A;  3H1V X;  2YNG A;  1GLA G;  1L3S A;  2D1K A;  4NYF A;  3ZSZ A;  3H45 C;  3CME N;  1NGC A;  2A40 A;  3SQ4 A;  4FWR A;  2E8A A;  3W3D A;  1I39 A;  1N32 K;  1EWQ A;  4JHD B;  3A2F A;  2PBD A;  4WQ4 A;  3EEQ A;  5M1Q A;  4JKF A;  2IOC A;  3T1A A;  5TKY A;  2ASP A;  4H0T B;  3CPE A;  1BA1 A;  4RWT A;  4O8U A;  1LV5 A;  5EXW A;  4LF5 K;  5CHI A;  1S3X A;  4CHP A;  2D4W A;  2OCE A;  4FZZ A;  3KKS A;  1VQ7 N;  3VQ9 A;  1BO5 O;  4FJ9 A;  3LAM A;  1KTQ A;  3VOV A;  3CCU N;  3O9U A;  3NH2 A;  3CER A;  1NM1 A;  1FKP A;  4M3U A;  3JSM A;  2P9L B;  3WNH A;  3P83 D;  3LP0 A;  1U4B A;  1WNS A;  2F9W A;  2A41 A;  1A5V A;  1GLL O;  4OGE A;  5FDL A;  4Z4F A;  3CJ9 A;  2F8S A;  4BWM A;  4O4G A;  3AVJ A;  1X9W A;  2YNF A;  1QTM A;  3NE6 A;  5J2N A;  1WAJ A;  1C6V A;  2P9I A;  4H03 B;  2HNY A;  2W40 A;  3CD6 N;  1QSY A;  1L5U A;  2OTJ N;  3L4Q A;  1BOT O;  4IFV A;  3ID6 A;  4N5S A;  3LAL A;  1Y97 A;  3OYL A;  4XH1 A;  5HRS A;  1NKB A;  5F0X A;  4CED A;  4CZG A;  3DOK A;  3U9D A;  1NGE A;  2HHV A;  3C7N B;  2DFH A;  3TSU A;  3WQU A;  3M8S A;  4IBN A;  3DYA A;  3QEI A;  3L6Q A;  5GAD P;  4AHS A;  4E1N A;  3VER A;  5JMV A;  2HW3 A;  3ENH A;  4FLT A;  3OYA A;  3T1H K;  4I6M A;  4QCL A;  5AQZ A;  3VES A;  4PL8 A;  1S1W A;  1JLF A;  4BVP A;  3FZL A;  4CF9 A;  3LWM A;  2W41 A;  4AF1 A;  1NLV A;  4PKG A;  4M3R A;  5FPN A;  1QHT A;  2FBT A;  3MEE A;  3M1F A;  1RCH A;  1WSE A;  1D8Y A;  1BL3 A;  2CGL A;  4JI6 K;  3SJH A;  4X62 K;  4ID5 A;  2QWL A;  3OS1 A;  4CEC A;  3MX5 A;  2GUP A;  4G9Z A;  3MEG A;  1REV A;  3THY A;  4AQY K;  4V19 S;  1RIL A;  1NOZ A;  3C7N A;  2P51 A;  4CGF A;  4QS8 A;  4FWS A;  2A42 A;  2VG6 A;  1E4G T;  4BC4 A;  1VQ4 N;  4FM0 A;  2Q2R A;  3KLI A;  4M3T A;  1WUA A;  4ZTJ A;  3RMB A;  2YHX A;  1NKE A;  1IBM K;  1T05 A;  1TL3 A;  3MN6 A;  3HYF A;  3CPW M;  1HJO A;  1LW0 A;  1SL2 A;  2W6L A;  3CM5 A;  4WFA L;  2P9I B;  4DB3 A;  1LAV A;  5AZJ B;  1BIU A;  4I2P A;  2I7N A;  1C0U A;  5HRP A;  3CCJ N;  2Z1G A;  3S3O A;  1RDC A;  4KHW A;  3NCI A;  5EX5 A;  3AA2 A;  4B1U B;  5BPN A;  4H8K A;  3L3V A;  1NKC A;  1C1C A;  3THY B;  4JI7 K;  4BDZ A;  1ZXO A;  3AA4 A;  4K8X A;  3O9Q A;  3D2E A;  5JLF A;  2KW4 A;  4BR9 A;  1VQK N;  3L2W A;  3R9P A;  1QZ5 A;  1L3T A;  2P9S A;  3DXM B;  4J2D A;  4FSV A;  3E9O A;  3DRP A;  4N56 A;  1WN7 A;  3TAB A;  3DLH A;  1XUP O;  1S6P A;  1WAF A;  1VSI A;  3K0S A;  1C0G A;  3SAG A;  1NGB A;  2WOM A;  3V9S A;  4M42 A;  4B8C A;  4DCH A;  5EY4 A;  3G6E N;  3KLH A;  3QEV A;  2V7Y A;  5KPR A;  3RSE B;  5F1X A;  1E3M A;  2IVP A;  2FSK A;  2E20 A;  4KFB A;  2UUB K;  3FFI A;  1LWF A;  2BE2 A;  4JKG B;  4C8M A;  4O5B A;  1BHL A;  1VQO N;  1YVN A;  3SPZ A;  3SMP A;  1KSP A;  4JAX A;  4FWN A;  4CK1 A;  2A6A A;  4A61 A;  4F8R A;  1VQ8 N;  4BR2 A;  3R6M A;  3T69 A;  1O13 A;  1RT4 A;  3O6W A;  4LH5 A;  4CGH A;  4OJR A;  1NOY A;  3HM9 A;  5IT9 O;  1EO1 A;  1O1W A;  3QEW A;  4L3Q A;  1VSH A;  4E7H A;  3V9X A;  2E2Q A;  3U3G A;  3VTI A;  2IVO A;  2RPI A;  4KHS A;  3I8D A;  3WNG A;  1XHX A;  5LY3 A;  1JJ2 M;  2RHK A;  3O5B A;  4FWP A;  1HNZ K;  1YJW N;  3QIC A;  1HX1 A;  4YOU A;  2P9K B;  1ATS A;  3G0Z A;  3G25 A;  1HNW K;  3R8E A;  5AJ3 K;  2P9L A;  3HM8 A;  3RMA A;  3D2F A;  3Q7C A;  3SCX A;  2D0O A;  2B4J A;  2VQE K;  4ZHR A;  4K42 A;  4YY3 K;  1JL1 A;  4MQ3 A;  4FLX A;  3OS2 A;  5EU7 A;  1N8R O;  4CJ3 A;  1EXQ A;  3L3U A;  4PKH A;  3KLG A;  1T3V A;  3JS6 A;  4FJI A;  3FZH A;  3KK7 A;  1YJ9 N;  5ADX A;  4BRA A;  5AQS A;  1V4T A;  3L0Q A;  5KPZ A;  2DFE A;  4HHT A;  3PX6 A;  5BR8 K;  1HYZ A;  2HBM A;  4JI2 K;  2WUS A;  4DTU A;  3NF9 A;  4CZM A;  4YDU C;  4DKW A;  5F2R A;  3VQE A;  3TU5 A;  1ASU A;  5C15 A;  1Q82 O;  3M6G A;  3K57 A;  1J54 A;  4CJV A;  1KCF A;  4BRO A;  3HPH A;  2P9N B;  1YHQ N;  2QWM A;  4I9Q A;  3UKU B;  4UY8 O;  3RMC A;  4O55 A;  1T03 A;  2NRX A;  4XIU A;  5AQN A;  3KVG A;  1KVC A;  3IS9 A;  1DLO A;  5LL6 Z;  1BU6 O;  2I5J A;  1IG8 A;  4JD2 A;  2JWK A;  2BTF A;  2HND A;  2E6L A;  2QWP A;  2YHY A;  5LMU K;  3H08 A;  3ISN C;  4C8N A;  3MED A;  4EAH D;  4W5O A;  2YX6 A;  4C8O A;  3VGM A;  3HXM A;  1C0M A;  3QB0 A;  4CHO A;  3AO4 A;  3A5N C;  4JN4 A;  3WXM B;  4Z0U A;  3FE1 A;  1U49 A;  4UQG A;  2NNW A;  1YTU A;  2ASM A;  4DR1 K;  2P5O A;  4B1V A;  3QES A;  1XC3 A;  4CJQ A;  4IFE A;  5AQQ A;  3DAW A;  1NMD A;  3CHW A;  3QIO A;  3VGL A;  3WXK A;  3AO5 A;  4GVE A;  3H1Q A;  1D4X A;  4CEZ A;  4EZ9 A;  1S6Q A;  3ZLJ A;  3CFR A;  2OYQ A;  4CES A;  1EP4 A;  1WLJ A;  4IOX A;  3SAH A;  1FK9 A;  2PAV A;  5KPT A;  4CZK A;  4CD1 A;  4N47 A;  1EX4 A;  3UIQ A;  1XWL A;  1KLN A;  3VF4 A;  1BQN A;  4DR7 K;  4HWI A;  5SZT A;  3HL8 A;  3EE9 A;  1OKJ A;  3L2V A;  3TAQ A;  1T8E A;  3P4I A;  1S1T A;  4RW6 A;  4G1Q A;  3MXI A;  3PIP L;  2V51 B;  3P39 A;  1B9D A;  2XY5 A;  3I0R A;  1VHX A;  1GOB A;  4KHU A;  3C94 A;  3ZT0 A;  4ZTF A;  4E1J A;  2HHX A;  5K14 A;  1RT1 A;  2CGJ A;  1HPZ A;  1DTT A;  3SNN A;  3SAF A;  3AVM A; 
#chains in the Genus database with same CATH homology
 5FRN A;  3OYD A;  1FXX A;  2YNG A;  1FKO A;  3ALY A;  4O0I A;  3QER A;  4NYF A;  1L3S A;  3C95 A;  4RW9 A;  4Z4C A;  1HNI A;  3ZSZ A;  1S9E A;  1D9F A;  4KTW A;  3ZCM A;  3SI6 A;  3SQ4 A;  2DTU A;  3AA5 X;  3O3H A;  1A5X A;  4CEQ A;  1I39 A;  4F3T A;  3JYT A;  1RTI A;  2XY8 A;  3A2F A;  5KTQ A;  4KAZ A;  1RBV A;  4CJ5 A;  4DTN A;  2G8F A;  2IOC A;  3T1A A;  3OJU A;  4FLV A;  3SUN A;  1HRH A;  1SKS A;  4KRF A;  5HBM A;  1BI4 B;  3OYJ A;  3KJV A;  2XRI A;  4CJE A;  4CFB A;  3S3N A;  1LV5 A;  3IAY A;  1TKZ A;  3OYE A;  3QNN A;  2G8H A;  3QEX A;  1TGO A;  4M3X A;  4CHP A;  3TWH A;  4FZZ A;  3KKS A;  1GOC A;  1JLG A;  4DG1 A;  2RN2 A;  3KKR A;  3TI0 A;  3VQ9 A;  1C1A A;  4KB0 A;  2FBY A;  2BAN A;  4B9N A;  3DLK A;  4FM2 A;  1X9S A;  1KLM A;  1QSL A;  4FJ9 A;  4AHU A;  4FXD A;  1TAU A;  3IG1 A;  3LAM A;  1KTQ A;  1HQE A;  2FBX A;  1R0A A;  3C6U A;  3NH2 A;  3V4I A;  1JLE A;  3SQ1 A;  1FKP A;  4M3U A;  2ITG A;  3JSM A;  1LAW A;  3WNH A;  1VSM A;  1QQC A;  3P83 D;  3LP0 A;  4CGI A;  1RT2 A;  3CFO A;  3QET A;  1U4B A;  3QIN A;  1WNS A;  4CGG A;  4CHZ A;  3K5N A;  1IG9 A;  4CJF A;  4J2A A;  1BQM A;  1A5V A;  4IG0 A;  4OGE A;  5FDL A;  5HRR A;  4Z4F A;  1F21 A;  4DMN A;  2F8S A;  2YNI A;  4BWM A;  4DU4 A;  1Z25 A;  3AVJ A;  4O4G A;  4BE0 A;  3NGY A;  4R5P A;  3ITH A;  1HMV A;  1X9W A;  2XO7 A;  1JL2 A;  2YNF A;  3LWL A;  1QTM A;  1QE1 A;  2DFF A;  4KKO A;  3ZSX A;  1GOA A;  3NE6 A;  4CGJ A;  3D0P A;  4HCB A;  5J2N A;  4CEF A;  3NGZ A;  3VQ5 A;  4NCA A;  3T3F A;  1WAJ A;  4KRE A;  3SUO A;  1C6V A;  2HNY A;  4NCG A;  2OPR A;  3DM2 A;  2GUI A;  3LZJ A;  3EZ5 A;  4GVM A;  1QSY A;  4W5Q A;  4CF1 A;  1L5U A;  3L8B A;  1NJX A;  4DSJ A;  4IFY A;  4F2S A;  4DSE A;  1RDD A;  3NBP A;  4FZX C;  1WSG A;  4OLB A;  4E7L A;  3TAP A;  1ZBI A;  4IFV A;  3RWU A;  1JKH A;  4FJK A;  3KTQ A;  4OKJ A;  1TKD A;  4Z4G A;  4N5S A;  3LAL A;  1Y97 A;  1HYV A;  3OYL A;  1LWC A;  2IGI A;  5HRS A;  3PV8 A;  2YNH A;  4H4M A;  1N6Q A;  2RKI A;  1NKB A;  2HHW A;  1BCM A;  4RG8 A;  1SL1 A;  3KLF A;  4L8R B;  2LSN A;  2X6S A;  4FVM A;  4CED A;  4DLE A;  2OZS A;  1ZBH A;  4CHN A;  3DOK A;  3DI6 A;  3LP3 A;  2OA8 A;  2X74 A;  3BGR A;  1S9G A;  3MAQ A;  2DFH A;  4FZY A;  3QEP A;  2HHV A;  4DFP A;  1NJW A;  2FBV A;  4I2Q A;  4EP5 A;  3SQ2 A;  4CHY A;  5KRS A;  3M8S A;  4E7J A;  2ZQB A;  3DYA A;  4IBN A;  4CFD A;  5D3G A;  1NK9 A;  3LPU A;  3NHG A;  1A5W A;  3CFP A;  3QEI A;  3HJF A;  3DOL A;  3AVN A;  1QS4 A;  4CFA A;  4JS4 A;  5HP1 A;  1K6Y A;  4RW8 A;  4E19 A;  3V9U A;  2G8W A;  4FM1 A;  4M3W A;  4AHS A;  3OYB A;  3VN5 A;  4DTR A;  3THV A;  3VQB A;  4E1N A;  1KVA A;  1YVU A;  4DTO A;  5CYM A;  4CK2 A;  4WE1 A;  3TAE A;  4W5R A;  2HW3 A;  4RW4 A;  2E4L A;  4FLT A;  2ETJ A;  2Z1H A;  1TK0 A;  4DU1 A;  3ZSV A;  4BDY A;  4I7F A;  1LW2 A;  3OYA A;  2XY7 A;  1VSJ A;  4QCL A;  1ZBF A;  1CZB A;  1VSD A;  3K5M A;  4N76 A;  1S1W A;  1JLF A;  1UA1 A;  4CF9 A;  3LWM A;  1L3U A;  3PO4 A;  4FJH A;  1CXU A;  4M3R A;  4CJK A;  4QOZ B;  4YFU A;  1NJZ A;  1C1B A;  1QHT A;  2FBT A;  1SL0 A;  4AHV A;  3U3Y A;  3MEE A;  4CJR A;  4KO0 A;  3DRR A;  1RCH A;  1WSE A;  1D8Y A;  1BL3 A;  3EY1 A;  3DLG A;  4KTQ A;  4ID5 A;  3OS1 A;  3IRX A;  3ZSR A;  4CEC A;  4HTU A;  3NH0 A;  1NK0 A;  3CQ8 A;  4LSN A;  4F3O A;  4FJJ A;  5KGW A;  3AVC A;  5CYQ A;  2HMI A;  4IKF A;  3MEG A;  5CZ2 A;  4DTJ A;  4M41 A;  4C8K A;  4B9V A;  1REV A;  5HRO A;  1MU2 A;  3AVB A;  3AVH A;  1RIL A;  1NOZ A;  2D0B A;  1RT3 A;  4GW6 A;  2FC0 A;  3TAN A;  2P51 A;  2YHA A;  2EHG A;  2IDO A;  4FJ5 A;  2A1R A;  4CGF A;  3SQ0 A;  1NK5 A;  4B9U A;  1IKV A;  2VG6 A;  1WSH A;  1J53 A;  1RNH A;  3HVT A;  4Y1D A;  4PWD A;  3K5O A;  4Q0B A;  1WSF A;  2PYJ A;  4FM0 A;  3RRG A;  2VG5 A;  3KLI A;  4YNQ A;  2ZD1 A;  4M3T A;  5CY4 A;  4ZTJ A;  3RMB A;  1IKW A;  3KIO A;  1NKE A;  2HVH A;  2ZE2 A;  4CF0 A;  1TL3 A;  1T05 A;  3HYF A;  4KPY A;  1LW0 A;  1SL2 A;  3CM5 A;  3NAE A;  3ASM A;  1LAV A;  1KRP A;  1KFD A;  4DTP A;  1BIU A;  1D9D A;  4C8L A;  4I2P A;  3ZSQ A;  4FK4 A;  3ZT3 A;  1RBR A;  1C0U A;  3AVI A;  1VSK A;  5HRP A;  1YT3 A;  4FJM A;  2Z1G A;  2Z1I A;  1TV6 A;  3S3O A;  1RDC A;  1UA0 A;  5HLF A;  2P5G A;  4KHW A;  3LDS A;  3NCI A;  3AA2 A;  3AO3 A;  1IKY A;  3SJJ A;  2YHB A;  4CGD A;  5FRM A;  3TAM A;  3NF7 A;  5J2M A;  2A1S A;  3AVG A;  3AV9 A;  1S1V A;  4NYN A;  3VQ7 A;  4H8K A;  3WNF A;  3L3V A;  1B9F A;  4Z4H A;  1NKC A;  4N41 A;  1C1C A;  2G8I A;  1Q9Y A;  3NF8 A;  4BDZ A;  5C24 A;  5J2Q A;  2PYL A;  2KTQ A;  3AA4 A;  2PZS A;  4W5N A;  4K8X A;  2JGU A;  3LP1 A;  4KI4 A;  4W5T A;  1JXB A;  3O4Q A;  2KW4 A;  4CJT A;  3CM6 A;  3VQ4 A;  3NDK A;  3L2W A;  2OZM A;  4DQP A;  1L3T A;  4J2D A;  3OYN A;  3AVF A;  3DRP A;  3B6O A;  3V1O A;  1S5J A;  4ID1 A;  4CF2 A;  1VRU A;  1CZ9 A;  1WN7 A;  2KQ2 A;  3AVK A;  4JLH A;  4N56 A;  4CEA A;  3TAB A;  5SWM A;  2BDP A;  3DLH A;  1S6P A;  1WAF A;  1VSI A;  3SZ2 A;  4DF8 A;  2B6A A;  5E41 A;  3AO1 A;  3S3M A;  2GBZ A;  3ULD A;  1D5A A;  3LPT A;  3RMD A;  4B9S A;  3LP2 A;  1BI4 A;  2WOM A;  2VWJ A;  1VRT A;  3V9S A;  4B8C A;  4CJ4 A;  4DQR A;  4NCB A;  1WSI A;  4M42 A;  2EX3 A;  4B9T A;  1RBS A;  3AVA A;  4CIG A;  3PO5 A;  4FK0 A;  4DSI A;  4CIE A;  3KLH A;  3QEV A;  3V81 A;  4IG3 A;  5I42 A;  4DF4 A;  3OJS A;  4FJ8 A;  3S9H A;  4KFB A;  1LWE A;  1SUQ A;  3EYZ A;  4M45 A;  3FFI A;  1IH7 A;  2QKK A;  1LWF A;  2BE2 A;  3SV3 A;  3VQC A;  2G8K A;  1ZYQ A;  5JS1 A;  4AHT A;  4LY7 A;  3P1G A;  4C8M A;  4O5B A;  1TVR A;  3CG7 A;  1BHL A;  1C0T A;  2HNZ A;  2D0A A;  2VG7 A;  1UAX A;  3QO9 A;  4AH9 A;  5C42 A;  4CHQ A;  2G8V A;  2O4I A;  3DLB A;  4FW2 A;  3OYK A;  5C25 A;  4DFJ A;  2D5R A;  4B8A B;  4CJS A;  3SPZ A;  1KSP A;  3AVL A;  3SYZ A;  2QKB A;  4FW1 A;  3DMJ A;  4B9M A;  5J2P A;  2RF2 A;  5J1E A;  4CK1 A;  5CZ1 A;  4Q5V A;  4CJL A;  1U45 A;  3KLE A;  4F4K A;  4E1M A;  4F8R A;  5JS2 A;  4FJN A;  4HUG A;  4CF8 A;  3LZI A;  4PY5 A;  4KV8 A;  1SV5 A;  4DWI A;  1RT4 A;  4LH5 A;  4CGH A;  4FJ7 A;  4RW7 A;  4OJR A;  4FK2 A;  3HT3 A;  3PUF A;  3KK1 A;  4E7I A;  3OYM A;  1NOY A;  1Q8I A;  1RBT A;  3HM9 A;  2VWK A;  4E0D A;  1O1W A;  1X1P A;  3QEW A;  1U47 A;  2Z1J A;  1VSH A;  3D45 A;  4MFB A;  4E7H A;  3HP9 A;  2HHQ A;  3V9X A;  3QLH A;  4PQU A;  1XC9 A;  1U04 A;  1JLA A;  3U3G A;  1ZBU A;  3QNO A;  1J9A A;  2RPI A;  3DRS A;  3CYM A;  4OPJ A;  3I8D A;  4KHS A;  3MEC A;  3WNG A;  3HVR A;  1XHX A;  4J2B A;  3K58 A;  1Z26 A;  2OPS A;  2W42 A;  1EET A;  4LSL A;  4ELU A;  4TSX A;  3L2Q A;  3O4N A;  3KK3 A;  4M3Z A;  1VSE A;  4LD0 A;  4CFC A;  3RR7 A;  1B92 A;  3G0Z A;  3F73 A;  4BWJ A;  1Q9X A;  1ASV A;  3QIP A;  2Y1J A;  1RBU A;  2OPP A;  5FRO A;  1BIZ A;  3RMA A;  1UWB A;  2B5J A;  1RTJ A;  4DTS A;  3SCX A;  2B4J A;  4ZHR A;  2YKM A;  5KI6 A;  1VSL A;  3DLE A;  4BE2 A;  1KFS A;  1JL1 A;  3HST B;  4MQ3 A;  4QAG A;  4DLG A;  4FLX A;  3SPY A;  3OYC A;  1S1U A;  3OS2 A;  3M8R A;  4E7K A;  5HRN A;  5EU7 A;  1JXE A;  4CJ3 A;  1EXQ A;  1W0H A;  3L3U A;  3OYH A;  3KLG A;  5DMR A;  1BCO A;  4CEE A;  3HPO A;  3K59 A;  4IDK A;  3NGI A;  4ELV A;  4FJG A;  2XHB A;  3V9Z A;  3V6D A;  3RRH A;  4FJI A;  4Z4I A;  4FLU A;  4B9L A;  2E6M A;  2IAJ A;  4E3S A;  2KFN A;  3SUP A;  4KTZ A;  3K2P A;  4DQS A;  1YTA A;  3V1Q A;  4DU3 A;  2DFE A;  4KHQ A;  4O0J A;  2HB5 A;  4HHT A;  3VQ6 A;  1KVB A;  3PX6 A;  1U48 A;  2F8T A;  2WON A;  3DLR A;  3U6F A;  2IC3 A;  1HYZ A;  4J2E A;  3I0S A;  3VA3 A;  1RT5 A;  4DTU A;  1IKX A;  3KD5 E;  3NF9 A;  4DSK A;  3TAR A;  3VQE A;  1ASU A;  5DK5 A;  3E01 A;  3WNE A;  1RT6 A;  4ICL A;  3V9W A;  3VQ8 A;  1HNV A;  4I9L A;  3B6P A;  3NH1 A;  4Z4E A;  4EP4 A;  3K57 A;  1J54 A;  3O3F A;  4CJV A;  1KCF A;  4B3O A;  2O4G A;  4CK3 A;  4KB1 A;  4CEO A;  3HPH A;  4FJX A;  1I3A A;  5KGX A;  3OYI A;  1SKR A;  1EKE A;  4I9Q A;  4E89 A;  4O44 A;  4B08 A;  3OVN A;  1QSS A;  4CJP A;  3RMC A;  4O55 A;  5T7B A;  1T03 A;  3BDP A;  4OLA A;  4XIU A;  2YV0 X;  3L2U A;  2HHU A;  3MXM A;  1KVC A;  4CER A;  3ZSY A;  4OVL A;  3IS9 A;  1DLO A;  1CXQ A;  2I5J A;  1NK6 A;  3VA0 A;  1JLB A;  3G10 A;  1RTD A;  1T7P A;  1VSF A;  3RR8 A;  2HND A;  4M3Y A;  2KZZ A;  3M8Q A;  1CLQ A;  2E6L A;  2YKN A;  3PY8 A;  1HQU A;  1N5Y A;  4JRP A;  3F9K A;  1G15 A;  2OPQ A;  4OKE A;  4DSL A;  1UOC A;  2X78 A;  3H08 A;  3ISN C;  3OYF A;  2BGG A;  3HP6 A;  3AA3 A;  4C8N A;  1TAQ A;  3MED A;  1ITG A;  1RDA A;  3TAF A;  4W5O A;  2XY6 A;  4C8O A;  4FCY A;  3KK2 A;  3HXM A;  1BIS A;  1TKT A;  1C0M A;  1JLQ A;  4CHO A;  3AO4 A;  2QK9 A;  4H4O A;  4OPK A;  3PX4 A;  3V1R A;  1IO2 A;  2DY4 A;  4Z0U A;  5I3U A;  3T19 A;  1U49 A;  4UQG A;  1WSJ A;  3SV4 A;  1X9M A;  4HCC A;  1YTU A;  2P5O A;  2F96 A;  4EZ6 A;  4CCH A;  2AJQ A;  3HO1 A;  3QES A;  4BDP A;  2Q3S A;  4CJQ A;  3OS0 A;  1JLC A;  3MXJ A;  2QXF A;  4CIF A;  4HVJ A;  3QIO A;  4DTM A;  4DQI A;  3AO5 A;  4PA1 A;  4DTX A;  4CEZ A;  4DFM A;  4EZ9 A;  3RTV A;  4OKK A;  1S6Q A;  2R7Y A;  3SUQ A;  4DFK A;  2Y1I A;  3K5L A;  3CFR A;  3VQP A;  1RTH A;  2G8U A;  3ZSO A;  4BAC A;  2OYQ A;  4DSF A;  1TKX A;  3C6T A;  4CES A;  1EP4 A;  1WLJ A;  3AO2 A;  3M8P A;  3PX0 A;  1NK4 A;  3KD1 E;  3OYG A;  1SKW A;  2HHT A;  1FK9 A;  4AHC A;  4AHR A;  2ATQ A;  4ELT A;  4N47 A;  1EX4 A;  1XHZ A;  3OY9 A;  1S1X A;  4DQQ A;  3UIQ A;  2NUB A;  3ZT1 A;  1XWL A;  1TK8 A;  4HUE A;  1BGX T;  1KLN A;  3VQQ A;  4DS5 A;  1BQN A;  1DTQ A;  4CJU A;  2X6N A;  4FLZ A;  1NK8 A;  1NJY A;  4FJL A;  3L2R A;  3TAG A;  1XI1 A;  1HYS A;  2KZM A;  5SZT A;  3ZT4 A;  3NF6 A;  3HL8 A;  1TL1 A;  3L2V A;  2GV9 A;  4AIL C;  3NFA A;  5KRT A;  3TAQ A;  1W9H A;  4JRQ A;  3VQD A;  4DS4 A;  1T8E A;  1S1T A;  4F2R A;  4RW6 A;  4G1Q A;  1VK0 A;  4K8Z A;  3MXI A;  3TR8 A;  1ASW A;  1L3V A;  2D0C A;  3O3G A;  4KHN A;  1B9D A;  2XY5 A;  1NK7 A;  1HJR A;  3I0R A;  3HK2 A;  3ZT2 A;  1GOB A;  4CJW A;  4FLY A;  4CE9 A;  3VQA A;  2PY5 A;  4KHU A;  1TK5 A;  4Y1C A;  4JS5 A;  4LH4 A;  2JLE A;  4CEB A;  4GMJ B;  3C94 A;  3ZT0 A;  3P5J A;  1RDB A;  3LAN A;  4HUF A;  4ZTF A;  4PUO A;  3HPG A;  3ZSW A;  1RT7 A;  1ZBL A;  2HHX A;  3LAK A;  5K14 A;  1RT1 A;  4BE1 A;  1J5O A;  2HHS A;  1HPZ A;  1DTT A;  4OGC A;  3SNN A;  4KHY A;  2HVI A;  4FLW A;  4FYD A;  2P1J A;  2KFZ A;  3AVM A;  2IS3 A;  4KI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...