4GV9A

Lassa nucleoprotein c-terminal domain in complex with triphosphated dsrna soaking for 5 min
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
198
Chain Sequence
FGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(*(GTP)P*GP*GP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Rna binding protein/rna
total genus 51
structure length 198
sequence length 207
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gv9A01
4GV6A 3MWPA 3R3LA 4GV3A 3Q7CA 4FVUA 3MX5A 4G9ZA 4GV9A 3MX2A 4GVEA 3Q7BA 3MWTA
chains in the Genus database with same CATH superfamily
3K5LA 1P8ZA 3A5NC 4EZ6A 1RT3A 3GDQA 4O8UA 4C8OA 4L3QA 4FWOA 1J6ZA 4RG8A 3CIPA 4PUOA 3M5RA 3MEDA 4OPAA 1WOQA 4ELTA 1RNHA 3AVGA 4IWVA 1UWBA 4R79A 1FJGK 1RTIA 1X9JA 4Z4GA 4CZEA 1IBKK 4FLXA 2UXCK 4I7FA 5E26A 3OYEA 4AILC 4DSFA 3TSUA 4LH5A 1LAVA 1HKBA 4CFBA 4IEIA 5GAGP 2FC0A 3KLGA 1XHXA 4JRPA 1NGGA 1MWMA 4F4KA 4FZZA 3CG7A 1FKOA 4KHPK 4DU3A 4YORA 3SCXA 4FVMA 5M1PA 4OKJA 4E1MA 1YF5L 2AP1A 1NK8A 3VGMA 1VQ6N 1W2BM 1JCFA 4DSEA 1U45A 2VWKA 3DLKA 3NDKA 2OA8A 3V4IA 3SQ1A 3OYJA 2A6AA 1NGEA 5C25A 4CEZA 3SUNA 2BUPA 2GWJA 4CBXA 1YHQN 3HT3A 2UYTA 3MEGA 2V7YA 3LALA 1VSMA 1NWKA 4QAGA 3MN5A 2D5RA 1KC8O 5BRDA 2HMIA 2BH1A 3SPYA 1SL2A 3ZLJA 3KVGA 1M1KO 3U4LA 3UB5A 3RR7A 3BZCA 3KK7A 4E7KA 4DQRA 4CJ5A 4NCBA 4BVOA 2QXFA 1GOAA 1FK9A 4FWKA 3WNEA 4DSLA 3HOTA 4GV9A 2P9NA 3OYAA 3WUHA 3VF4A 4IO8A 3CCQN 1HPMA 4BDPA 1VSIA 4DG1A 1VRTA 3KIOA 3HPHA 3RR8A 2P9IB 4FW2A 1IG9A 4LF7K 3C7NB 2W40A 1KVBA 2OZSA 2QM1A 5SWMA 1ASWA 4KHQA 4A5AA 4XH5A 3UKUB 3O9RA 3LAMA 4B3OA 3CCJN 3LM2A 4DSKA 2KFZA 2VG6A 4O0IA 3F73A 2QWOA 4CZKA 1L3SA 1IJJA 1WBDA 3ULEA 4TSXA 3ZT2A 1DKGD 2HVIA 2JWKA 3RRHA 4MLEA 3TTFA 3QEPA 3ZT0A 4JV5K 2GELA 4CEFA 5M1KA 4Z4IA 3ZETB 3M8RA 1Z25A 4KV8A 1OVYA 3TSPA 1VQ9N 3AVFA 4CHZA 4BE2A 4DV3K 3AVAA 2FSNA 2QWLA 2E2PA 1OH6A 4H0OA 5AQXA 4WQ4C 4Z4HA 1QSSA 3HVRA 2HBJA 3ZEUA 3PIPL 5AQPA 4YOTA 5AQIA 3VN5A 4Z0UA 4JLHA 4AF1A 4ICLA 1YITN 1VQ8N 1QQCA 3DOKA 2YNIA 1D9DA 1SL1A 2Q31A 4GMJB 4FJJA 3DXMA 2RPIA 2QXLA 3VTHA 1GOBA 1YTAA 3QESA 3SBTA 3CPEA 3AO4A 4FJKA 2O8EB 2ASMA 3EN9A 4ZHRA 1D5AA 1LW2A 4DFJA 4CESA 4CJ4A 3PIOL 2FBTA 3RSEB 1RBTA 3O08A 1HJRA 2YJFA 3OHRA 2QK9A 4DTSA 3C95A 1YJNN 4LFAK 3G4SN 1C0FA 3LL3A 1JXEA 4NLCA 3CI5A 3MX5A 3W0LA 3HVTA 4B08A 1TVRA 1TK5A 5M1FA 3E1YA 5AZIB 3SAHA 2D0PA 1BL3A 2W42A 3T3FA 5BR9A 3I0SA 2KW4A 2IOCA 4FLYA 4DWIA 2KZZA 4JK8A 3THVA 4CF9A 1QTMA 3OYGA 4OX9K 3D0PA 4AHTA 4BC2A 3O80A 4M63C 1IKYA 3FZLA 3NHGA 4IFYA 3QICA 2PFUA 3J8AA 4WQ5A 3O9UA 1H1VA 5BREA 2J4RA 3C6TA 4AHCA 4HCBA 3CC2N 4KI4A 3S41A 5BRHA 4J2EA 2IS3A 4JEPA 4CEAA 2V7ZA 3CPWM 4O4GA 1RBRA 2JWLA 3O5BA 2P9PB 1QHAA 4KBOA 1BU6O 3V6DA 3QEWA 4CGGA 3A8YA 5C2FA 2Q3SA 3SJHA 4CHYA 3UKRA 3THXB 4A2AA 4PQUA 2P9UB 1S6QA 3A5LC 4CIFA 3KJVA 2GEMA 3TTDA 3TANA 4BRGA 2YHWA 2DY4A 4CJFA 3L4IA 4C1NK 1YJWN 3NF8A 4BGAA 4K41A 4DHYA 3I33A 3CM5A 1GLBG 2HBMA 3MCPA 3NF7A 1Q86O 3THWA 3WNHA 3VERA 4BREA 4IO9L 2B4JA 3O9TA 1B9DA 3QFPA 1O1WA 1ZBFA 1A5XA 5EY4A 3MDQA 4M3WA 1TYQA 3VETA 4OKKA 4MDBA 1Q9XA 2GBZA 3D2EA 3DRPA 3ZCMA 4BQZA 3RWUA 2GUIA 2Z1JA 1W97L 4CZLA 4NCGA 5KQ8A 3EKSA 1T05A 3HOSA 2ETJA 2YHXA 3TR8A 2B6AA 3VQ4A 3FLCO 4QOZB 2VQFK 2O8BB 3P38A 4N41A 3CJ1A 3U6FA 2KHOA 2G8WA 5FPMA 3U9ZA 4IKFA 4FZYA 4JKCA 1X3MA 4LY7A 1KAYA 3KHYA 4F2SA 4CK1A 4ID5A 3G25A 3T7ZA 4CJ3A 3R9PA 4WE1A 3L2RA 3HBTA 1NGDA 4BC5A 1SKWA 1T3VA 3G6EN 3FZHA 5JLHA 1ATNA 4FLTA 4JK7A 2YHBA 5FPNA 4KHUA 4BY9C 1Q82O 1VSLA 4MO4A 1ZBHA 3FR0A 4BR9A 3K2PA 2NRVA 5EU7A 1QQMA 2ZM6K 3HRGA 4F3TA 1S9EA 1BA1A 4CJSA 4CHQA 3EO3A 4LSLA 2YNHA 4RWTA 4YOXA 4PA1A 4KHSA 4N56A 2P9SA 3SBGA 3V9SA 4CHPA 4IFVA 5CZ2A 2E6MA 1S5JA 4DV4K 3DLRA 5M1OA 3VMFB 3CHWA 4CJTA 3FFIA 1NOZA 2F8SA 4FWSA 2NUBA 4NYFA 2W6KA 1J5OA 1ATRA 3DXKB 3V81A 1IBLK 1Q81O 2WFBA 1J53A 3VEOA 4M7YA 1NK7A 3HPOA 3H08A 2DFFA 2IDOA 1HYSA 4RCHA 2FBXA 4B9NA 3E9LA 3L2VA 5M1QA 3DLEA 4BRLA 4CIEA 3V9UA 2GWKA 4A5BA 3CCRN 4LF6K 1EWQA 3NH2A 1BIZA 4YDUA 1OKJA 1N5YA 4BRMA 1U4BA 2Q1NA 1BOTO 3KK3A 1VSJA 4W5RA 4CEEA 3H1VX 1S9GA 4K42A 5ADXA 5FROA 1NKCA 4GW6A 4B1WB 4MQ3A 4ILHA 3QEIA 4KRFA 3OBYA 3E9OA 2AA4A 3TPQA 1L3UA 1LOTB 5K14A 1HYZA 4Q5VA 2HHSA 1YT3A 2P1JA 2P51A 2QWNA 1DEJA 2G8IA 3T1HK 4FYDA 4M45A 3I55N 1WSJA 4JKGB 5HRSA 3K5NA 4X64K 1RBUA 1S1TA 3ZSOA 3CC7N 3VQ8A 2RKIA 4J2DA 3KWIA 1L3VA 2NZTA 2E8AA 3OS1A 2PBDA 3R6MA 2E5LK 1NK5A 3CCUN 1DT9A 4DV6K 1JCEA 4OGCA 2OPQA 3TTCA 3KLFA 4HHTA 1RT2A 4CJ7A 4G9ZA 3TAMA 4J8FA 2ATQA 3OS0A 2I5JA 4NXMK 4FO0A 1VSKA 1XNQK 3M1FA 5T7BA 4FLZA 3V1QA 4CEBA 1NLVA 1QE1A 1O13A 3R3LA 3P4IA 5ADXH 3CERA 3PV8A 3FZFA 3HL8A 3AO5A 3VQDA 5BN9A 4KH5A 3F9KA 4XIUA 3EL2A 2P9IA 1TKZA 4KKOA 5BPMA 1X9MA 3NVMA 3C7NA 1CXQA 3SJJA 1NGAA 3DLBA 4ISEA 4BE0A 4B8CA 4CZMA 2OPPA 3UKUA 1GLJO 1NBWA 4V19S 4Z4EA 4RW4A 3CCEN 5E84A 5C24A 3QLHA 1XMQK 3WXJA 5BPNA 5CYQA 3AVJA 4PKIA 3T1AA 5AQSA 2PAVA 4GVMA 4IJNA 5AQJA 1WAJA 4FJ5A 4KO0A 1K8AO 4Z4CA 1RFQA 1BISA 2HNYA 1EQYA 1BIUA 4JK9A 4CF8A 1KVAA 1NMDA 3BUZB 1NK0A 4CJVA 5GAEP 4I6MA 4JI4K 4N5SA 2Y1JA 4PKHA 3CQXA 5AQNA 5JLFA 4Z4FA 1J5EK 2A41A 1E4GT 2JGUA 1KD1O 3PX0A 3LP3A 4HVJA 2QWQA 1C1BA 3QEVA 4B1ZA 1BI4B 1S1XA 1XWLA 2O8FA 3RMCA 5HBMA 5LMUK 1XMOK 1NG9A 4YOUA 1BHLA 3NBPA 3OBWA 5F2RA 1JLGA 3SAFA 3RRGA 2P5OA 5JICA 1NM1A 4FM0A 3CFPA 4YOYA 2CGJA 2WTUA 4JI6K 4YFUA 3TAEA 3BZKA 1C1AA 4Z94A 2HSTA 4DQQA 1HMVA 4NXNK 4DTXA 3WNFA 1YI2N 3L2WA 4DR3K 4DV0K 3DMJA 3BF1A 4B1XB 1I3AA 1RT4A 1RDWX 4M41A 4RW9A 2P9LB 3R8EA 4FLWA 3HTVA 3DRRA 4BRFA 3TI0A 3QINA 3SPZA 2F9WA 3MX2A 3R1XA 4FXDA 1C0MA 3MN9A 3ZT1A 4O44A 3SNNA 4HTLA 4FOEA 4FLUA 3HM9A 5DM6L 2IIRA 3L4QA 4BGBA 5EXWA 3C65A 2KTQA 4BRCA 1VQON 4CJWA 5KGXA 1WAFA 3QBWA 1SS6A 5IT9O 2W6LA 2FBVA 3LANA 4FWMA 3KWGA 3V9ZA 3CMEN 2I7PA 4KPYA 4E7LA 4JD2B 1TK0A 4H0YB 3ID8A 1KAXA 4EP5A 2P9PA 3ID6A 1KAZA 1BWFO 4A62A 3HP9A 4ZTJA 3U3YA 5CZ1A 3THXA 1NU0A 4O8KA 2UU9K 2P9UA 3NF9A 1KVCA 4A59A 3OYFA 2HHUA 5JMVA 3ZSWA 2YHAA 3DI6A 2KKZA 3DRSA 5LY3A 1J9AA 4XH1A 3MN6A 1HLUA 2D0AA 3CFRA 4CJUA 3VEYA 3NE6A 2BANA 1ZBUA 4H5RA 4IDKA 2XO7A 1T6DA 4ISFA 3RMBA 2FSKA 3JYTA 1RDBA 1ZBLA 1XNRK 3E01A 3L6QA 2EX3A 3AA5X 1U2VB 1DTTA 5CHIA 2QKKA 3H3NO 3ENOA 3L0QA 4CGDA 5AQTA 2ZF5O 3HM8A 2P9KB 3LP1A 1Z05A 5BR8K 1TAQA 1P90A 1GLCG 1RGIA 3KLEA 2GUPA 4C8MA 2O8BA 4DTNA 3LM9A 4JI3K 3N4PA 4CGJA 1REVA 1SUQA 1YUWA 1UAXA 5CR4A 4GY2B 3CD6N 4G1QA 2X74A 5AQZA 3M8PA 2Z1IA 2YJEA 1VAZA 4DB3A 1U49A 3S9HA 3QDKA 1KFDA 5LMNK 3HZ6A 4QS8A 3Q7CA 3LP2A 1TUUA 3THYB 4DR1K 4FZXC 4B3SK 4LC9B 2O4GA 2VGMA 1JL1A 4JI8K 5DK5A 3WXLA 4RW7A 1CZ9A 4A61A 3VGLA 4XEIA 4DFKA 4IOAL 1EWRA 2UUBK 3VQPA 5J2PA 1VQ5N 1JCGA 3H6EA 5GIPA 3SQ0A 2ITGA 4BR0A 1IO2A 3LPUA 1WSEA 2ASPA 3LP0A 2YV0X 3KZBA 4DTOA 2LSNA 2DFHA 3WQUA 2YCHA 1JJ2M 3OA9A 3VQEA 5ELZA 3HXMA 2VYPA 4MLHA 2IGIA 1TKTA 4KTQA 4CF2A 3MAQA 2IVNA 3DXKA 3PLAA 4DQSA 3I0RA 4ELVA 1NGJA 1CZBA 2HHHK 4CCHA 3CETA 3OYBA 3OYDA 4BVPA 1BG3A 4DV2K 3S3OA 3GG4A 4DTUA 4PL8A 5AQKA 4KHYA 4RW6A 3CCVN 5FDLA 4H0PA 2HB5A 1TKXA 5AQWA 2FXUA 4CEQA 1JXBA 3G71N 3IDHA 4O5FA 5AZJB 1C0UA 5KRTA 4KHWA 2VQEK 1T6CA 4H5NA 4Y0WA 3AVCA 1SL0A 5D3GA 3AY9A 1C0GA 4DTRA 3IFRA 3LAKA 3ZSVA 2ZJPL 2QWRA 4CBUA 3WQTA 4NYNA 5AQHA 1HX1A 1S1VA 4OPJA 2XY6A 1EXQA 5I3UA 1RTJA 3DLHA 1FKPA 5DM7L 1TV6A 3SMPA 4BE1A 3VA3A 3CJBA 1QVGM 1WNSA 5AR0A 4B3TK 4DR7K 4BQLA 4CJPA 4NO7A 3C6HA 3P39A 5HRPA 3KKRA 4OPHA 1VQNN 3EE8A 1LCUA 1ZXOA 4XH4A 3OVNA 1OH5A 2HHVA 3O1BA 3L2UA 3ENBA 4Y1CA 4OLBA 4FWLA 3IAYA 2A40A 4M3UA 4IFEA 3BDPA 2XHBA 4CHOA 3M6GA 1MWKA 1OVQA 3OYHA 3AA4A 5AQFA 1K8KB 4CJEA 1WUAA 2OANA 2XY8A 4H0XB 4OPKA 1T7PA 1BA0A 2FSJA 2YKMA 4EP4A 3ZT4A 3NGZA 4JS5A 4K8ZA 3EZ5A 4DR2K 1BO5O 1SZ2A 2F96A 3DM2A 4NCAA 3HO1A 4B3RK 3J81O 5C0YA 3OYLA 4FJ7A 1ITGA 1KLNA 2G8KA 4U7BA 4FVUA 4OLAA 4LF8K 1HNVA 4FJXA 1VQ7N 3GOIA 4DU1A 4CK3A 4DFMA 4IXCA 1ZBIA 4EHTA 3J7AP 2E1ZA 3LDQA 2XY5A 4M3TA 2O8CB 1VSHA 3SV4A 4BRIA 4CE9A 2NRTA 4B9MA 3MMVA 4ZTFA 4H5WA 4OGEA 1SAZA 4CGHA 4E1NA 2PY5A 1ASUA 2WC9A 1LWCA 2E1YA 4BWMA 3VEVA 1W9HA 3V1OA 5C12A 1HNXK 2ZWHA 1BQNA 4PKGA 3CXCM 4YDUC 5AQOA 1HUXA 4E19A 4M42A 4F2RA 4FWPA 3C6AA 4BWJA 2R7YA 1IKVA 1TKDA 1VQLN 3RVCA 4GKJK 1NMNA 4DLEA 2RHKA 5C42A 2QW9A 3IUCA 1QQNA 2I7NA 3TARA 3KLIA 4BC4A 2HHXA 1ESVA 2YHYA 3HSCA 3LDLA 2YNGA 1XC3A 2E4LA 5AQQA 3BF3A 3ULDA 3VA0A 3DAWA 1WSIA 2O8DA 2PYLA 1BI4A 4W5NA 1DTQA 4IZ9A 4BRPA 3EE9A 4DF4A 4KI6A 4FJMA 5KI6A 2YNFA 2HVHA 2HHWA 2OYQA 1RDCA 3IRXA 4A57A 4FPAA 1KXPA 2NRRA 1TUYA 4BROA 1X9SA 3ENHA 4ELUA 2G8HA 3SQ4A 3EEQA 3TAPA 3VQBA 3ZX3A 4CHNA 3NGIA 2OCEA 1QHTA 3E66A 4HTUA 1TL3A 3MK6A 3VEWA 4H5VA 3QETA 3ZT3A 3ITHA 3O6WA 2NRWA 4FPBA 1JLFA 4F3OA 4GV6A 3ISNC 3AVBA 1RT5A 5SZTA 5FPDA 1F21A 2VCPA 3J7YP 5HLFA 1YIJN 2V51B 3LPTA 4E89A 1RILA 2E6LA 3GBTA 3PO4A 4MO5A 4PY5A 4CZFA 4H0TB 3D2FB 3LWMA 3KD5E 2A1RA 4UQGA 1HQUA 2QWPA 3OY9A 1IG8A 4JKEA 4I2QA 1NJXA 1ASVA 2FLOA 3I8DA 3G0ZA 4AHVA 1Y64A 1IV0A 4MFBA 5F0XA 2UXBK 4DFPA 1S1UA 3A0IX 5TKYA 3EY1A 3W3DA 3JSMA 4JN4A 4JD2A 1E4FT 4CZGA 3QNNA 1ZYQA 4JI2K 1N8RO 3O4WA 1C6VA 1T8EA 5TKWA 2RN2A 3VQ7A 3NH0A 4AHSA 4LFBK 1V4SA 1YXQA 2NRXA 4CD1A 5BN8A 2QI2A 5HOOA 4CD3A 4CGIA 3UKRB 4M3RA 3WEEB 3PUFA 3O9QA 1EP4A 3AAPA 5A2QO 4ISGA 1GLEG 1BGXT 2KFNA 4KREA 4LH4A 1IKXA 4H4OA 2VG7A 1EX4A 3DLLL 1MU2A 4ILGB 4KH6A 3VQ6A 5I42A 2HF3A 4NB4A 2FF3B 2W41A 1QSYA 4JHDB 4QS9A 3P5JA 3KKSA 4LSNA 4O5BA 3PSIA 1QVFM 2OPSA 4JKAA 3MXJA 4KB1A 1U2VA 2P5GA 4KTWA 3QNOA 5F1XA 4U67L 3AO3A 2DTUA 4H03B 3TABA 3K9KA 4BC3A 1Z6RA 1B92A 1JLBA 3L3VA 2HHTA 3CJ7A 4OVLA 5FRMA 2D4WA 4DMNA 3E9PA 4CFCA 1S72N 1QZ5A 2JLEA 1NGFA 4WCEL 1W0HA 3TWHA 4JI7K 1BCMA 2E20A 4QCLA 1NJZA 1S3XA 4H8KA 1HNWK 3CJAA 3JXUA 1DGKN 1MDUB 3C94A 3QEXA 3ZETA 1RCHA 4UY8O 4JKHA 3OJUA 3KK1A 4FJ9A 3THYA 3V9WA 3ZSYA 3AGRA 3O9SA 1RDUA 2DPNA 3VQCA 3L2QA 3QMLA 2X78A 4AQYK 3TAGA 3O3FA 1JLCA 4YHHK 5EX5A 1WLJA 4B8AB 1U47A 3WXMB 1TAUA 3MN7A 4N76A 2ASOA 3VEXA 1TK8A 3I8BA 1UOCA 1A5VA 2QTDA 1CZAN 1JLAA 2D0BA 4CJKA 4FJ8A 4DF8A 2OTJN 4CBWA 2Q97A 4HWIA 3P1GA 2Z1HA 3V9XA 5KPRA 1SKSA 3MCAB 4CJRA 3U9DA 2HHQA 4WYBA 3LDSA 1WSGA 4X65K 2NRZA 2P9SB 1HYVA 4J2AA 3LZIA 2PZSA 1RTHA 4CZIA 3MEEA 2Q0RA 2O8EA 3JAMO 3OS2A 5AQMA 3WXIA 2HNDA 5CYMA 4IDHA 1KTQA 2E88A 4GNIA 1VRUA 3VTIA 4DV5K 4DQPA 4Q0BA 4AHUA 3RSEA 4M7XA 2ZJRL 3SI6A 4PHTX 4JNEA 3PX4A 3AVHA 4FK0A 4DLGA 1QSLA 3AVKA 4C1NI 4F8RA 3WNGA 5AQUA 5HL7L 2FBYA 5B8HA 3AA2A 4EZ9A 1NJIO 5AZIA 2IC3A 5AZJA 3TU5A 3CC4N 4FCYA 5EVZA 3O4NA 4CERA 1N34K 4CI6A 5H1SQ 2X6NA 5AQYA 3CQ8A 3T1YK 1VQ4N 4BRHA 4WFAL 4JS4A 3VQ5A 5FRNA 1YTUA 4LD0A 2F8TA 4H4MA 4DR6K 1VSDA 2EWSA 3K5OA 3RTVA 4BR2A 5GINA 1KQSM 4EIAA 3KTQA 1NGCA 1BCOA 1X3NA 3D45A 4DR4K 5JS1A 2ITMA 4DUYK 4RTFD 4KAZA 3QO9A 4X62K 2NNWA 1U04A 2YX6A 4CF0A 3A5OC 2A1SA 1VK0A 4X66K 1YJ9N 2QEXN 4LF5K 1C1CA 2E2NA 2EHGA 2QA4N 1N36K 4BRDA 1NK4A 2YKNA 4IEEA 4EHUA 1HPZA 3H1QA 2F7TA 5J1EA 3NMUA 1XHZA 3S3MA 1U6ZA 2G8VA 3H45C 1K8KA 4E7IA 4CF1A 3OYCA 1GLAG 5GIOA 5JVGL 1NK9A 1WSFA 3OYNA 1L3TA 1VSEA 4FLVA 3IKMA 4LFCK 4WF9L 4KH4A 4YY3K 3L3UA 3OYKA 1WBBA 1EKEA 4JKFA 4E7JA 3SYZA 3KK2A 5KRSA 2Z1GA 3O1WA 3SZ2A 4WFNL 1LWFA 1WB9A 2HF4A 4IOCL 2D1KA 3HK2A 5BRFA 3IS9A 2BE2A 4F9OA 4AH9A 3NF6A 1YAGA 3Q7BA 4J2BA 3AVNA 3AO2A 4CEDA 4KTZA 5IWAK 4I9LA 4FL9A 1Y97A 2ZQBA 2A42A 3DLGA 1N33K 1G15A 2ZGYA 3VESA 3ZX2A 1Q18A 1RT1A 2BDPA 2O8CA 1D4XA 3ZSRA 3ATVA 3K59A 3QIPA 3CM6A 4DCHA 4E7HA 3SK3A 1HRHA 3PO5A 3NAEA 1B9FA 1R59O 1VSFA 1DLOA 3QBXA 3VQ9A 4E0DA 4DU4A 3HYFA 2GV9A 1RDDA 4Y1DA 1YVNA 3ALYA 2F4VK 1K73O 4FWRA 3M8QA 3FGUA 4B9UA 3OW2M 4BR5A 1HNIA 2A5XA 2H3GX 3EKUA 2X6SA 4W5TA 3ATUA 4FWQA 2HBLA 3K57A 4WQ5C 3NGYA 2HOEA 5KPZA 1X1PA 1U48A 3VF6A 1NNEA 4N47A 2VWJA 2GX9A 3FZMA 4CFAA 2IAJA 2V52B 1LAWA 1ZC6A 4I6MB 3S3NA 1EETA 3KD1E 3EZWA 3PSFA 4DR5K 3AGKA 3VF2A 2Q0UA 2WOMA 2ZJQL 4QS7A 2O4IA 4B1UB 4B9LA 1TL1A 2O8FB 3M8SA 3C0BA 4DQ8A 3QB0A 2CH6A 4IBNA 2RE2A 4B3MK 5J2MA 2G8FA 4HCCA 4DTPA 1NKEA 1D9FA 1T44A 2ZGZA 3QERA 5KPTA 3VOVA 4NLBA 3F5TA 4FM2A 5AQLA 3K5MA 3VEZA 1MA9B 4BR4A 4IOXA 3CFOA 3OTOK 4FJGA 3SQ2A 4CJQA 4CZJA 3OYIA 1ILYA 1NGBA 4DSIA 1CXUA 1K6YA 3DYAA 1R0AA 3D2FA 3UIQA 5HROA 3CJ9A 1S22A 1RT7A 3MECA 3MWTA 1Q8IA 4K0KK 3ASMA 2HBKA 2XRIA 3NFAA 4WQ4A 4JRQA 2HNZA 2BTFA 5BPLA 3KLHA 2IVPA 1XQSC 5LJVA 3IG1A 4BG9A 4BRQA 4YNQA 3K58A 4JKGA 4PL7A 5KGWA 4JKBA 1ZBSA 1HNZK 4FW1A 1LW0A 1BUPA 3CMAN 1W7AA 4JI0K 1Z26A 5JS2A 3U8XA 4MDAA 3AV9A 3IMXA 1LWEA 3AARA 3BGRA 4EFHA 1HJOA 4FJHA 1VQPN 3P83D 2IVOA 3H3OB 4IG0A 1JLQA 4A2BA 1UA1A 4JI5K 3BEXA 3T69A 3WEEA 3CQYA 4B9VA 3VPZA 1ATSA 4BRNA 2RF2A 5HRRA 5AJ3K 1Q9YA 1GLDG 2CGKA 3LZJA 4DKWA 4JHDA 5M1NA 4GVEA 4BG8A 5E41A 1K9MO 1SKRA 2AJQA 1NJYA 1IBMK 4AHRA 2UUCK 2CGLA 3ZSXA 1RT6A 4LF9K 2VGNA 5AQRA 1OH8A 3ZX0A 4C8NA 1I94K 1S1WA 2P9NB 1WSHA 1OH7A 4BR7A 3O3GA 3BY5A 5FLXO 3HPGA 3O8MA 5AQVA 4FK4A 1E3MA 5GAHP 4M3YA 4YOVA 5C10A 5CY4A 5GADP 3SUOA 2KQ2A 2OZMA 4CVNE 4FSVA 3VGKA 4GKKK 2WUSA 3TAQA 1T03A 3VENA 1I39A 5FPEA 4FJNA 4JI1K 4GV3A 3F9MA 4WFBL 3ULEB 2Q2RA 3M3ZA 3AVLA 3PX6A 2FF6A 4E1JA 1NOYA 4KHNA 3H46O 2Y1IA 1G99A 3VQQA 1WN7A 4I2PA 3B8AX 2UUAK 3GL1A 3LDNA 3CF5L 2NLXA 3G10A 2G8UA 4K8XA 4HUFA 5J2NA 4CFDA 3O3HA 3B6PA 3ZSQA 5JVHL 4C23A 1M90O 1XI1A 4FM1A 4DUZK 3SMSA 2YI1A 4M3ZA 3ZEUB 4B9QA 3NCIA 1LV5A 1L5UA 4FWNA 1IH7A 2F9TA 1KFSA 4HUEA 3SAGA 3NVKA 4W5OA 4O55A 3P31A 3WT0A 3DXMB 2CH5A 2VG5A 4JKDA 4CGFA 3LWLA 4DV7K 1UA0A 4H5TA 4DTJA 1J54A 2Q36A 3LDOA 4C8KA 3VQAA 2ZD1A 2D0OA 1NK6A 2QWMA 4ID1A 1VHXA 2DFEA 2GTDA 3B6OA 3OYMA 3DOLA 4M3XA 4JYAK 2P9LA 3AO1A 4W5QA 2KZMA 3CCMN 4DQIA 3SUPA 4L8RB 1RBSA 2KLAA 5KTQA 1N6QA 1QQOA 3MWPA 4CIGA 3WXKA 4OJRA 5AFUA 5LL6Z 3DWLA 1SQKA 1XC9A 3OJSA 3NH1A 2WONA 1GLFO 2HMPA 1CLQA 1IKWA 4C8LA 1XUPO 4BDZA 2HW3A 1VQKN 1KCFA 3TSQA 4CECA 1Q7YO 3FFKB 4BACA 3AA3A 5J2QA 4H0VB 3MXIA 4FJIA 5DMRA 4RW8A 2OTLN 5EOYA 3SLCA 1HKCA 2B5JA 3K9JA 1RTDA 3K0SA 4O0JA 3A5MC 3V1RA 4I9QA 3FZKA 1VQMN 3AVMA 3QIOA 1SV5A 1GOCA 4PWDA 3DJCA 1NGHA 3T19A 3CYMA 3AVIA 4K43A 4DTMA 3PY8A 4CZHA 1FXXA 4DS4A 1NKBA 4FOIA 4CW7B 1QZ6A 4E3SA 1JL2A 2VWBA 1A5WA 4BRAA 4B9SA 1C0TA 3QFUA 4BRKA 1D8YA 2NRHA 1NGIA 2A3ZA 1GLLO 3THWB 2E2OA 3CCSN 3SV3A 3TAFA 3FE1A 3BP8A 3UE5A 4AM7A 1V4TA 5AFUH 3HP6A 4BDYA 1TYQB 3J7ZO 4CJLA 4B1VA 5C15A 4DSJA 2P9KA 3D2EB 5LJWA 3RMAA 4FK2A 4OKEA 5KQDA 3L8BA 1KRPA 2OPRA 5CE3A 1JLEA 1X9WA 3RMDA 3CJCA 3LDPA 3ZSZA 2ZE2A 4B1YB 1FW6A 1KLMA 3O4QA 4YOWA 4KB0A 5HP1A 5MLCQ 4R5PA 1HR0K 3J80O 3D7EO 4EAHD 5I9EB 3HSTB 3HJFA 3AAQA 1S6PA 3SUQA 4LF4K 2BGGA 3GE1A 3A2FA 3HI0A 2E2QA 2D0CA 3F2KA 4JAXA 3U3GA 4OO1J 4KFBA 1NJWA 1HKGA 2PYJA 3I56N 2UXDK 3N4QA 4IJAA 1YVUA 3D6RA 4FJLA 4CEOA 2XY7A 4AM6A 4CK2A 3JS6A 1QS4A 1HQEA 5HRNA 1BDGA 2QKBA 1KSPA 4B9TA 1BQMA 4IG3A 4DV1K 3CCLN 3C6UA 3ZYYX 5C2DA 2O8DB 5AQGA 1RDAA 1RBVA 2WBNA 1N32K 3MXMA 3EYZA 4K25A 1TGOA 4ILJA 4HUGA 1JKHA 4DS5A 1EO1A
chains in the Genus database with same CATH topology
4FWRA 3FGUA 2QWNA 1DEJA 3OW2M 4BR5A 4U7BA 4FVUA 2A5XA 2H3GX 3I55N 3EKUA 1P8ZA 3A5NC 3ATUA 4FWQA 3GDQA 4JKGB 4O8UA 2HBLA 4L3QA 4WQ5C 1VQ7N 4FWOA 1J6ZA 2HOEA 5KPZA 3GOIA 3CIPA 3VF6A 3CC7N 4IXCA 3M5RA 4EHTA 3KWIA 2NZTA 2E1ZA 2GX9A 4OPAA 3FZMA 3LDQA 2E8AA 2V52B 1WOQA 1ZC6A 2PBDA 3R6MA 4I6MB 3EZWA 3CCUN 1DT9A 3AGKA 4IWVA 3VF2A 2Q0UA 4BRIA 2NRTA 1JCEA 4R79A 3MMVA 4H5WA 1X9JA 1SAZA 4CZEA 3TTCA 2ZJQL 4QS7A 2WC9A 5E26A 4B1UB 2E1YA 4CJ7A 3TSUA 3VEVA 4G9ZA 3C0BA 4J8FA 3QB0A 4DQ8A 1HKBA 2CH6A 5C12A 2RE2A 2ZWHA 4IEIA 4FO0A 5GAGP 3M1FA 4PKGA 3CXCM 1NGGA 1MWMA 4YDUC 5AQOA 1HUXA 1T44A 2ZGZA 1NLVA 5KPTA 1O13A 3R3LA 3VOVA 4NLBA 3F5TA 4FWPA 4YORA 3P4IA 3C6AA 5M1PA 5ADXH 3CERA 5AQLA 3VEZA 1YF5L 2AP1A 3FZFA 3VGMA 1VQLN 3RVCA 1MA9B 4BR4A 1VQ6N 4IOXA 1W2BM 1JCFA 2RHKA 2QW9A 3IUCA 1QQNA 2I7NA 4BC4A 1ESVA 2YHYA 5BN9A 4KH5A 3HSCA 4CZJA 3LDLA 1XC3A 3EL2A 5AQQA 2A6AA 3BF3A 1NGEA 2P9IA 1ILYA 5BPMA 1NGBA 3NVMA 3C7NA 3DAWA 1NGAA 2BUPA 2GWJA 4ISEA 4CBXA 4CZMA 1YHQN 2UYTA 3D2FA 3UKUA 1GLJO 2V7YA 3CJ9A 4IZ9A 4BRPA 1NBWA 1NWKA 1S22A 3CCEN 5E84A 3EE9A 3MN5A 1KC8O 5BRDA 2BH1A 3MWTA 3WXJA 5BPNA 4WQ4A 2HBKA 3KVGA 4A57A 2BTFA 4FPAA 5BPLA 1M1KO 1KXPA 4PKIA 2NRRA 3U4LA 1TUYA 5AQSA 3UB5A 4BROA 2PAVA 2IVPA 1XQSC 3KK7A 5LJVA 4IJNA 4BG9A 5AQJA 4BRQA 3ENHA 4BVOA 1K8AO 4JKGA 4PL7A 3ZX3A 4JKBA 1ZBSA 4FWKA 1BUPA 3CMAN 1RFQA 3HOTA 4GV9A 1EQYA 2P9NA 3E66A 4JK9A 3WUHA 3MK6A 3VEWA 4H5VA 3VF4A 3U8XA 4IO8A 1NMDA 4MDAA 3IMXA 3CCQN 3O6WA 1HPMA 2NRWA 3AARA 3BUZB 4FPBA 5GAEP 4I6MA 4EFHA 1HJOA 4GV6A 4PKHA 3CQXA 5AQNA 2P9IB 5JLFA 1VQPN 2A41A 1E4GT 5FPDA 2IVOA 2VCPA 3C7NB 3H3OB 1KD1O 1YIJN 2W40A 2V51B 4A2BA 2QWQA 3BEXA 2QM1A 3T69A 3WEEA 4B1ZA 3GBTA 4MO5A 4A5AA 4H0TB 4CZFA 3D2FB 4XH5A 3CQYA 3UKUB 3O9RA 3VPZA 1ATSA 4BRNA 2QWPA 3CCJN 3LM2A 1IG8A 4YOUA 3OBWA 4JKEA 5F2RA 1GLDG 3SAFA 2CGKA 2QWOA 2FLOA 5JICA 4CZKA 4DKWA 1IJJA 1NM1A 4JHDA 3ULEA 5M1NA 1Y64A 4YOYA 1DKGD 4GVEA 2CGJA 4BG8A 2JWKA 5F0XA 4MLEA 3A0IX 5TKYA 3TTFA 1K9MO 4Z94A 2GELA 2HSTA 3W3DA 5M1KA 2CGLA 3ZETB 4JN4A 4JD2A 1E4FT 4CZGA 1OVYA 2VGNA 5AQRA 3TSPA 1YI2N 3ZX0A 1N8RO 3O4WA 1VQ9N 5TKWA 3BF1A 2P9NB 4B1XB 1RDWX 1V4SA 4BR7A 1YXQA 2NRXA 2FSNA 2P9LB 2QWLA 3R8EA 2E2PA 3HTVA 4CD1A 4H0OA 5BN8A 2QI2A 3O8MA 4BRFA 5AQXA 5AQVA 4WQ4C 5HOOA 2HBJA 3ZEUA 4CD3A 2F9WA 3PIPL 3MX2A 5AQPA 4YOTA 3UKRB 5GAHP 3R1XA 5AQIA 4YOVA 5C10A 5GADP 3WEEB 4AF1A 3O9QA 1YITN 3AAPA 3MN9A 4FSVA 4ISGA 3VGKA 1VQ8N 4HTLA 1GLEG 4FOEA 2WUSA 2Q31A 5DM6L 2IIRA 3VENA 3DXMA 3VTHA 2QXLA 3DLLL 4ILGB 3L4QA 5FPEA 4KH6A 4BGBA 2HF3A 4NB4A 2FF3B 2W41A 3C65A 3F9MA 5EXWA 4JHDB 3ULEB 4WFBL 4QS9A 2Q2RA 3SBTA 3M3ZA 3CPEA 4BRCA 2FF6A 4E1JA 1VQON 2ASMA 3EN9A 3H46O 1G99A 3QBWA 1SS6A 1QVFM 4FWMA 4JKAA 3KWGA 3B8AX 3CMEN 2I7PA 3PIOL 3GL1A 4JD2B 3LDNA 1U2VA 3CF5L 4H0YB 3ID8A 2NLXA 3RSEB 1KAXA 3O08A 2YJFA 3OHRA 2P9PA 3ID6A 1KAZA 1YJNN 1BWFO 3G4SN 1C0FA 3LL3A 4A62A 4NLCA 5JVHL 1M90O 4C23A 5F1XA 3CI5A 3MX5A 4U67L 4H03B 3K9KA 3W0LA 4BC3A 1Z6RA 4O8KA 2P9UA 5M1FA 3E1YA 3SMSA 5AZIB 2YI1A 3CJ7A 3SAHA 2D0PA 2D4WA 3ZEUB 4B9QA 4A59A 3E9PA 5JMVA 5BR9A 4FWNA 1S72N 2F9TA 2KKZA 1QZ5A 5LY3A 1NGFA 4JK8A 4WCEL 4XH1A 3SAGA 3NVKA 3MN6A 3O80A 1HLUA 4M63C 3P31A 4BC2A 3WT0A 2E20A 1S3XA 3DXMB 3FZLA 2CH5A 3VEYA 3QICA 2PFUA 3J8AA 4JKDA 3CJAA 3JXUA 4H5RA 4WQ5A 1DGKN 3O9UA 4H5TA 1MDUB 1H1VA 3ZETA 5BREA 2J4RA 2Q36A 1T6DA 4ISFA 4JKHA 4UY8O 3LDOA 3CC2N 3S41A 5BRHA 2FSKA 3AGRA 2D0OA 2QWMA 3O9SA 1RDUA 2DPNA 4JEPA 2GTDA 3L6QA 3QMLA 2V7ZA 3CPWM 1U2VB 5CHIA 2P9LA 2JWLA 3O5BA 5EX5A 2P9PB 3H3NO 1QHAA 3ENOA 3L0QA 4KBOA 1BU6O 3WXMB 5AQTA 3MN7A 2ZF5O 3HM8A 3A8YA 5C2FA 2ASOA 3CCMN 2P9KB 3SJHA 3VEXA 2KLAA 3UKRA 1Z05A 4A2AA 3I8BA 1QQOA 3MWPA 2P9UB 2QTDA 3WXKA 1CZAN 2OTJN 1P90A 1GLCG 1RGIA 3A5LC 4CBWA 5AFUA 2GEMA 2GUPA 2Q97A 4HWIA 3TTDA 4BRGA 3DWLA 5KPRA 1SQKA 2YHWA 4GV3A 3MCAB 3L4IA 3LM9A 4C1NK 1YJWN 3U9DA 3N4PA 4BGAA 1GLFO 4WYBA 2HMPA 4K41A 4DHYA 3I33A 1YUWA 2NRZA 2P9SB 5CR4A 4GY2B 1XUPO 3CD6N 1GLBG 2HBMA 4CZIA 1VQKN 5AQZA 3MCPA 3TSQA 1Q7YO 1Q86O 2Q0RA 3FFKB 3VERA 2YJEA 5AQMA 4BREA 4IO9L 3WXIA 4H0VB 1VAZA 4DB3A 3QDKA 3O9TA 3QFPA 4IDHA 3HZ6A 2E88A 4GNIA 3VTIA 4QS8A 3Q7CA 5EOYA 5EY4A 3MDQA 1TUUA 4M7XA 3RSEA 1HKCA 3SLCA 3K9JA 4PHTX 2ZJRL 1TYQA 4JNEA 3VETA 4LC9B 2VGMA 4MDBA 4C1NI 3A5MC 3WXLA 3D2EA 3FZKA 1VQMN 4BQZA 5AQUA 5HL7L 5B8HA 1NJIO 5AZIA 3DJCA 1W97L 1NGHA 4A61A 4CZLA 5AZJA 5KQ8A 4K43A 3TU5A 3VGLA 3CC4N 3EKSA 4XEIA 4CZHA 3HOSA 4IOAL 2YHXA 1VQ5N 5EVZA 1JCGA 3H6EA 4FOIA 3FLCO 4CI6A 5GIPA 5H1SQ 1QZ6A 4BR0A 5AQYA 2VWBA 3P38A 1VQ4N 2ASPA 4BRAA 3CJ1A 4BRHA 4WFAL 2KHOA 3QFUA 4BRKA 5FPMA 3U9ZA 3KZBA 1X3MA 2NRHA 4JKCA 1NGIA 2A3ZA 3WQUA 2YCHA 1JJ2M 1GLLO 3OA9A 2EWSA 1KAYA 5ELZA 2E2OA 2VYPA 4MLHA 3KHYA 4BR2A 5GINA 3G25A 2IVNA 3DXKA 3T7ZA 3PLAA 3CCSN 3FE1A 3BP8A 3R9PA 3UE5A 1KQSM 1NGJA 4AM7A 4EIAA 1V4TA 5AFUH 1NGCA 1X3NA 3HBTA 2ITMA 3CETA 1TYQB 4RTFD 1BG3A 1NGDA 4BC5A 4BVPA 2NNWA 2YX6A 3J7ZO 3GG4A 4B1VA 1T3VA 3A5OC 4PL8A 3G6EN 5AQKA 3FZHA 5JLHA 1ATNA 5C15A 3CCVN 2P9KA 4H0PA 4JK7A 3D2EB 5FPNA 5LJWA 1YJ9N 2QEXN 2OTLN 4BY9C 1Q82O 5AQWA 2FXUA 4MO4A 3FR0A 4BR9A 3G71N 2NRVA 5KQDA 1QQMA 3IDHA 2E2NA 3HRGA 4O5FA 5AZJB 4BRDA 2QA4N 5CE3A 1T6CA 4H5NA 4IEEA 4Y0WA 1BA1A 4EHUA 3CJCA 3EO3A 3H1QA 3AY9A 2F7TA 4YOXA 4RWTA 3LDPA 3NMUA 1C0GA 4B1YB 1U6ZA 2P9SA 3SBGA 3H45C 3IFRA 4YOWA 1K8KA 5MLCQ 1GLAG 5GIOA 2ZJPL 2QWRA 5JVGL 5M1OA 3VMFB 3CHWA 4CBUA 3IKMA 3D7EO 4WF9L 4EAHD 3WQTA 5I9EB 4KH4A 4FWSA 5AQHA 1HX1A 3AAQA 1ATRA 3DXKB 4JKFA 5DM7L 1Q81O 2WFBA 3GE1A 3HI0A 2E2QA 3O1WA 3SMPA 3VEOA 1QVGM 3CJBA 4WFNL 3F2KA 4M7YA 2HF4A 5AR0A 4IOCL 2D1KA 4JAXA 5BRFA 4BQLA 4F9OA 4OO1J 1HKGA 4RCHA 4NO7A 3E9LA 3C6HA 1YAGA 3P39A 3N4QA 3Q7BA 3I56N 4OPHA 5M1QA 1VQNN 4IJAA 3D6RA 4BRLA 3EE8A 1LCUA 1ZXOA 4XH4A 4AM6A 2GWKA 3O1BA 4A5BA 3CCRN 4FL9A 3ENBA 3JS6A 4YDUA 4FWLA 1OKJA 2A42A 2A40A 1BDGA 4IFEA 4BRMA 3VESA 2ZGYA 3ZX2A 2Q1NA 1Q18A 3M6GA 1BOTO 1MWKA 5AQFA 1D4XA 1K8KB 3H1VX 1WUAA 2OANA 4H0XB 3CCLN 1BA0A 2FSJA 3ATVA 4K42A 5ADXA 3ZYYX 4B1WB 5C2DA 4DCHA 3SK3A 5AQGA 4ILHA 1R59O 3QBXA 3OBYA 2WBNA 3E9OA 1BO5O 2AA4A 1SZ2A 3TPQA 4K25A 1LOTB 4ILJA 5C0YA 1YVNA 1EO1A 1K73O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV6 A;  3MWP A;  3R3L A;  4GV3 A;  3Q7C A;  4FVU A;  3MX5 A;  4G9Z A;  4GV9 A;  3MX2 A;  4GVE A;  3Q7B A;  3MWT A; 
#chains in the Genus database with same CATH topology
 3K5L A;  1P8Z A;  3A5N C;  4EZ6 A;  1RT3 A;  3GDQ A;  4O8U A;  4C8O A;  4L3Q A;  4FWO A;  1J6Z A;  4RG8 A;  3CIP A;  4PUO A;  3M5R A;  3MED A;  4OPA A;  1WOQ A;  4ELT A;  1RNH A;  3AVG A;  4IWV A;  1UWB A;  4R79 A;  1FJG K;  1RTI A;  1X9J A;  4Z4G A;  4CZE A;  1IBK K;  4FLX A;  2UXC K;  4I7F A;  5E26 A;  3OYE A;  4AIL C;  4DSF A;  3TSU A;  4LH5 A;  1LAV A;  1HKB A;  4CFB A;  4IEI A;  5GAG P;  2FC0 A;  3KLG A;  1XHX A;  4JRP A;  1NGG A;  1MWM A;  4F4K A;  4FZZ A;  3CG7 A;  1FKO A;  4KHP K;  4DU3 A;  4YOR A;  3SCX A;  4FVM A;  5M1P A;  4OKJ A;  4E1M A;  1YF5 L;  2AP1 A;  1NK8 A;  3VGM A;  1VQ6 N;  1W2B M;  1JCF A;  4DSE A;  1U45 A;  2VWK A;  3DLK A;  3NDK A;  2OA8 A;  3V4I A;  3SQ1 A;  3OYJ A;  2A6A A;  1NGE A;  5C25 A;  4CEZ A;  3SUN A;  2BUP A;  2GWJ A;  4CBX A;  1YHQ N;  3HT3 A;  2UYT A;  3MEG A;  2V7Y A;  3LAL A;  1VSM A;  1NWK A;  4QAG A;  3MN5 A;  2D5R A;  1KC8 O;  5BRD A;  2HMI A;  2BH1 A;  3SPY A;  1SL2 A;  3ZLJ A;  3KVG A;  1M1K O;  3U4L A;  3UB5 A;  3RR7 A;  3BZC A;  3KK7 A;  4E7K A;  4DQR A;  4CJ5 A;  4NCB A;  4BVO A;  2QXF A;  1GOA A;  1FK9 A;  4FWK A;  3WNE A;  4DSL A;  3HOT A;  4GV9 A;  2P9N A;  3OYA A;  3WUH A;  3VF4 A;  4IO8 A;  3CCQ N;  1HPM A;  4BDP A;  1VSI A;  4DG1 A;  1VRT A;  3KIO A;  3HPH A;  3RR8 A;  2P9I B;  4FW2 A;  1IG9 A;  4LF7 K;  3C7N B;  2W40 A;  1KVB A;  2OZS A;  2QM1 A;  5SWM A;  1ASW A;  4KHQ A;  4A5A A;  4XH5 A;  3UKU B;  3O9R A;  3LAM A;  4B3O A;  3CCJ N;  3LM2 A;  4DSK A;  2KFZ A;  2VG6 A;  4O0I A;  3F73 A;  2QWO A;  4CZK A;  1L3S A;  1IJJ A;  1WBD A;  3ULE A;  4TSX A;  3ZT2 A;  1DKG D;  2HVI A;  2JWK A;  3RRH A;  4MLE A;  3TTF A;  3QEP A;  3ZT0 A;  4JV5 K;  2GEL A;  4CEF A;  5M1K A;  4Z4I A;  3ZET B;  3M8R A;  1Z25 A;  4KV8 A;  1OVY A;  3TSP A;  1VQ9 N;  3AVF A;  4CHZ A;  4BE2 A;  4DV3 K;  3AVA A;  2FSN A;  2QWL A;  2E2P A;  1OH6 A;  4H0O A;  5AQX A;  4WQ4 C;  4Z4H A;  1QSS A;  3HVR A;  2HBJ A;  3ZEU A;  3PIP L;  5AQP A;  4YOT A;  5AQI A;  3VN5 A;  4Z0U A;  4JLH A;  4AF1 A;  4ICL A;  1YIT N;  1VQ8 N;  1QQC A;  3DOK A;  2YNI A;  1D9D A;  1SL1 A;  2Q31 A;  4GMJ B;  4FJJ A;  3DXM A;  2RPI A;  2QXL A;  3VTH A;  1GOB A;  1YTA A;  3QES A;  3SBT A;  3CPE A;  3AO4 A;  4FJK A;  2O8E B;  2ASM A;  3EN9 A;  4ZHR A;  1D5A A;  1LW2 A;  4DFJ A;  4CES A;  4CJ4 A;  3PIO L;  2FBT A;  3RSE B;  1RBT A;  3O08 A;  1HJR A;  2YJF A;  3OHR A;  2QK9 A;  4DTS A;  3C95 A;  1YJN N;  4LFA K;  3G4S N;  1C0F A;  3LL3 A;  1JXE A;  4NLC A;  3CI5 A;  3MX5 A;  3W0L A;  3HVT A;  4B08 A;  1TVR A;  1TK5 A;  5M1F A;  3E1Y A;  5AZI B;  3SAH A;  2D0P A;  1BL3 A;  2W42 A;  3T3F A;  5BR9 A;  3I0S A;  2KW4 A;  2IOC A;  4FLY A;  4DWI A;  2KZZ A;  4JK8 A;  3THV A;  4CF9 A;  1QTM A;  3OYG A;  4OX9 K;  3D0P A;  4AHT A;  4BC2 A;  3O80 A;  4M63 C;  1IKY A;  3FZL A;  3NHG A;  4IFY A;  3QIC A;  2PFU A;  3J8A A;  4WQ5 A;  3O9U A;  1H1V A;  5BRE A;  2J4R A;  3C6T A;  4AHC A;  4HCB A;  3CC2 N;  4KI4 A;  3S41 A;  5BRH A;  4J2E A;  2IS3 A;  4JEP A;  4CEA A;  2V7Z A;  3CPW M;  4O4G A;  1RBR A;  2JWL A;  3O5B A;  2P9P B;  1QHA A;  4KBO A;  1BU6 O;  3V6D A;  3QEW A;  4CGG A;  3A8Y A;  5C2F A;  2Q3S A;  3SJH A;  4CHY A;  3UKR A;  3THX B;  4A2A A;  4PQU A;  2P9U B;  1S6Q A;  3A5L C;  4CIF A;  3KJV A;  2GEM A;  3TTD A;  3TAN A;  4BRG A;  2YHW A;  2DY4 A;  4CJF A;  3L4I A;  4C1N K;  1YJW N;  3NF8 A;  4BGA A;  4K41 A;  4DHY A;  3I33 A;  3CM5 A;  1GLB G;  2HBM A;  3MCP A;  3NF7 A;  1Q86 O;  3THW A;  3WNH A;  3VER A;  4BRE A;  4IO9 L;  2B4J A;  3O9T A;  1B9D A;  3QFP A;  1O1W A;  1ZBF A;  1A5X A;  5EY4 A;  3MDQ A;  4M3W A;  1TYQ A;  3VET A;  4OKK A;  4MDB A;  1Q9X A;  2GBZ A;  3D2E A;  3DRP A;  3ZCM A;  4BQZ A;  3RWU A;  2GUI A;  2Z1J A;  1W97 L;  4CZL A;  4NCG A;  5KQ8 A;  3EKS A;  1T05 A;  3HOS A;  2ETJ A;  2YHX A;  3TR8 A;  2B6A A;  3VQ4 A;  3FLC O;  4QOZ B;  2VQF K;  2O8B B;  3P38 A;  4N41 A;  3CJ1 A;  3U6F A;  2KHO A;  2G8W A;  5FPM A;  3U9Z A;  4IKF A;  4FZY A;  4JKC A;  1X3M A;  4LY7 A;  1KAY A;  3KHY A;  4F2S A;  4CK1 A;  4ID5 A;  3G25 A;  3T7Z A;  4CJ3 A;  3R9P A;  4WE1 A;  3L2R A;  3HBT A;  1NGD A;  4BC5 A;  1SKW A;  1T3V A;  3G6E N;  3FZH A;  5JLH A;  1ATN A;  4FLT A;  4JK7 A;  2YHB A;  5FPN A;  4KHU A;  4BY9 C;  1Q82 O;  1VSL A;  4MO4 A;  1ZBH A;  3FR0 A;  4BR9 A;  3K2P A;  2NRV A;  5EU7 A;  1QQM A;  2ZM6 K;  3HRG A;  4F3T A;  1S9E A;  1BA1 A;  4CJS A;  4CHQ A;  3EO3 A;  4LSL A;  2YNH A;  4RWT A;  4YOX A;  4PA1 A;  4KHS A;  4N56 A;  2P9S A;  3SBG A;  3V9S A;  4CHP A;  4IFV A;  5CZ2 A;  2E6M A;  1S5J A;  4DV4 K;  3DLR A;  5M1O A;  3VMF B;  3CHW A;  4CJT A;  3FFI A;  1NOZ A;  2F8S A;  4FWS A;  2NUB A;  4NYF A;  2W6K A;  1J5O A;  1ATR A;  3DXK B;  3V81 A;  1IBL K;  1Q81 O;  2WFB A;  1J53 A;  3VEO A;  4M7Y A;  1NK7 A;  3HPO A;  3H08 A;  2DFF A;  2IDO A;  1HYS A;  4RCH A;  2FBX A;  4B9N A;  3E9L A;  3L2V A;  5M1Q A;  3DLE A;  4BRL A;  4CIE A;  3V9U A;  2GWK A;  4A5B A;  3CCR N;  4LF6 K;  1EWQ A;  3NH2 A;  1BIZ A;  4YDU A;  1OKJ A;  1N5Y A;  4BRM A;  1U4B A;  2Q1N A;  1BOT O;  3KK3 A;  1VSJ A;  4W5R A;  4CEE A;  3H1V X;  1S9G A;  4K42 A;  5ADX A;  5FRO A;  1NKC A;  4GW6 A;  4B1W B;  4MQ3 A;  4ILH A;  3QEI A;  4KRF A;  3OBY A;  3E9O A;  2AA4 A;  3TPQ A;  1L3U A;  1LOT B;  5K14 A;  1HYZ A;  4Q5V A;  2HHS A;  1YT3 A;  2P1J A;  2P51 A;  2QWN A;  1DEJ A;  2G8I A;  3T1H K;  4FYD A;  4M45 A;  3I55 N;  1WSJ A;  4JKG B;  5HRS A;  3K5N A;  4X64 K;  1RBU A;  1S1T A;  3ZSO A;  3CC7 N;  3VQ8 A;  2RKI A;  4J2D A;  3KWI A;  1L3V A;  2NZT A;  2E8A A;  3OS1 A;  2PBD A;  3R6M A;  2E5L K;  1NK5 A;  3CCU N;  1DT9 A;  4DV6 K;  1JCE A;  4OGC A;  2OPQ A;  3TTC A;  3KLF A;  4HHT A;  1RT2 A;  4CJ7 A;  4G9Z A;  3TAM A;  4J8F A;  2ATQ A;  3OS0 A;  2I5J A;  4NXM K;  4FO0 A;  1VSK A;  1XNQ K;  3M1F A;  5T7B A;  4FLZ A;  3V1Q A;  4CEB A;  1NLV A;  1QE1 A;  1O13 A;  3R3L A;  3P4I A;  5ADX H;  3CER A;  3PV8 A;  3FZF A;  3HL8 A;  3AO5 A;  3VQD A;  5BN9 A;  4KH5 A;  3F9K A;  4XIU A;  3EL2 A;  2P9I A;  1TKZ A;  4KKO A;  5BPM A;  1X9M A;  3NVM A;  3C7N A;  1CXQ A;  3SJJ A;  1NGA A;  3DLB A;  4ISE A;  4BE0 A;  4B8C A;  4CZM A;  2OPP A;  3UKU A;  1GLJ O;  1NBW A;  4V19 S;  4Z4E A;  4RW4 A;  3CCE N;  5E84 A;  5C24 A;  3QLH A;  1XMQ K;  3WXJ A;  5BPN A;  5CYQ A;  3AVJ A;  4PKI A;  3T1A A;  5AQS A;  2PAV A;  4GVM A;  4IJN A;  5AQJ A;  1WAJ A;  4FJ5 A;  4KO0 A;  1K8A O;  4Z4C A;  1RFQ A;  1BIS A;  2HNY A;  1EQY A;  1BIU A;  4JK9 A;  4CF8 A;  1KVA A;  1NMD A;  3BUZ B;  1NK0 A;  4CJV A;  5GAE P;  4I6M A;  4JI4 K;  4N5S A;  2Y1J A;  4PKH A;  3CQX A;  5AQN A;  5JLF A;  4Z4F A;  1J5E K;  2A41 A;  1E4G T;  2JGU A;  1KD1 O;  3PX0 A;  3LP3 A;  4HVJ A;  2QWQ A;  1C1B A;  3QEV A;  4B1Z A;  1BI4 B;  1S1X A;  1XWL A;  2O8F A;  3RMC A;  5HBM A;  5LMU K;  1XMO K;  1NG9 A;  4YOU A;  1BHL A;  3NBP A;  3OBW A;  5F2R A;  1JLG A;  3SAF A;  3RRG A;  2P5O A;  5JIC A;  1NM1 A;  4FM0 A;  3CFP A;  4YOY A;  2CGJ A;  2WTU A;  4JI6 K;  4YFU A;  3TAE A;  3BZK A;  1C1A A;  4Z94 A;  2HST A;  4DQQ A;  1HMV A;  4NXN K;  4DTX A;  3WNF A;  1YI2 N;  3L2W A;  4DR3 K;  4DV0 K;  3DMJ A;  3BF1 A;  4B1X B;  1I3A A;  1RT4 A;  1RDW X;  4M41 A;  4RW9 A;  2P9L B;  3R8E A;  4FLW A;  3HTV A;  3DRR A;  4BRF A;  3TI0 A;  3QIN A;  3SPZ A;  2F9W A;  3MX2 A;  3R1X A;  4FXD A;  1C0M A;  3MN9 A;  3ZT1 A;  4O44 A;  3SNN A;  4HTL A;  4FOE A;  4FLU A;  3HM9 A;  5DM6 L;  2IIR A;  3L4Q A;  4BGB A;  5EXW A;  3C65 A;  2KTQ A;  4BRC A;  1VQO N;  4CJW A;  5KGX A;  1WAF A;  3QBW A;  1SS6 A;  5IT9 O;  2W6L A;  2FBV A;  3LAN A;  4FWM A;  3KWG A;  3V9Z A;  3CME N;  2I7P A;  4KPY A;  4E7L A;  4JD2 B;  1TK0 A;  4H0Y B;  3ID8 A;  1KAX A;  4EP5 A;  2P9P A;  3ID6 A;  1KAZ A;  1BWF O;  4A62 A;  3HP9 A;  4ZTJ A;  3U3Y A;  5CZ1 A;  3THX A;  1NU0 A;  4O8K A;  2UU9 K;  2P9U A;  3NF9 A;  1KVC A;  4A59 A;  3OYF A;  2HHU A;  5JMV A;  3ZSW A;  2YHA A;  3DI6 A;  2KKZ A;  3DRS A;  5LY3 A;  1J9A A;  4XH1 A;  3MN6 A;  1HLU A;  2D0A A;  3CFR A;  4CJU A;  3VEY A;  3NE6 A;  2BAN A;  1ZBU A;  4H5R A;  4IDK A;  2XO7 A;  1T6D A;  4ISF A;  3RMB A;  2FSK A;  3JYT A;  1RDB A;  1ZBL A;  1XNR K;  3E01 A;  3L6Q A;  2EX3 A;  3AA5 X;  1U2V B;  1DTT A;  5CHI A;  2QKK A;  3H3N O;  3ENO A;  3L0Q A;  4CGD A;  5AQT A;  2ZF5 O;  3HM8 A;  2P9K B;  3LP1 A;  1Z05 A;  5BR8 K;  1TAQ A;  1P90 A;  1GLC G;  1RGI A;  3KLE A;  2GUP A;  4C8M A;  2O8B A;  4DTN A;  3LM9 A;  4JI3 K;  3N4P A;  4CGJ A;  1REV A;  1SUQ A;  1YUW A;  1UAX A;  5CR4 A;  4GY2 B;  3CD6 N;  4G1Q A;  2X74 A;  5AQZ A;  3M8P A;  2Z1I A;  2YJE A;  1VAZ A;  4DB3 A;  1U49 A;  3S9H A;  3QDK A;  1KFD A;  5LMN K;  3HZ6 A;  4QS8 A;  3Q7C A;  3LP2 A;  1TUU A;  3THY B;  4DR1 K;  4FZX C;  4B3S K;  4LC9 B;  2O4G A;  2VGM A;  1JL1 A;  4JI8 K;  5DK5 A;  3WXL A;  4RW7 A;  1CZ9 A;  4A61 A;  3VGL A;  4XEI A;  4DFK A;  4IOA L;  1EWR A;  2UUB K;  3VQP A;  5J2P A;  1VQ5 N;  1JCG A;  3H6E A;  5GIP A;  3SQ0 A;  2ITG A;  4BR0 A;  1IO2 A;  3LPU A;  1WSE A;  2ASP A;  3LP0 A;  2YV0 X;  3KZB A;  4DTO A;  2LSN A;  2DFH A;  3WQU A;  2YCH A;  1JJ2 M;  3OA9 A;  3VQE A;  5ELZ A;  3HXM A;  2VYP A;  4MLH A;  2IGI A;  1TKT A;  4KTQ A;  4CF2 A;  3MAQ A;  2IVN A;  3DXK A;  3PLA A;  4DQS A;  3I0R A;  4ELV A;  1NGJ A;  1CZB A;  2HHH K;  4CCH A;  3CET A;  3OYB A;  3OYD A;  4BVP A;  1BG3 A;  4DV2 K;  3S3O A;  3GG4 A;  4DTU A;  4PL8 A;  5AQK A;  4KHY A;  4RW6 A;  3CCV N;  5FDL A;  4H0P A;  2HB5 A;  1TKX A;  5AQW A;  2FXU A;  4CEQ A;  1JXB A;  3G71 N;  3IDH A;  4O5F A;  5AZJ B;  1C0U A;  5KRT A;  4KHW A;  2VQE K;  1T6C A;  4H5N A;  4Y0W A;  3AVC A;  1SL0 A;  5D3G A;  3AY9 A;  1C0G A;  4DTR A;  3IFR A;  3LAK A;  3ZSV A;  2ZJP L;  2QWR A;  4CBU A;  3WQT A;  4NYN A;  5AQH A;  1HX1 A;  1S1V A;  4OPJ A;  2XY6 A;  1EXQ A;  5I3U A;  1RTJ A;  3DLH A;  1FKP A;  5DM7 L;  1TV6 A;  3SMP A;  4BE1 A;  3VA3 A;  3CJB A;  1QVG M;  1WNS A;  5AR0 A;  4B3T K;  4DR7 K;  4BQL A;  4CJP A;  4NO7 A;  3C6H A;  3P39 A;  5HRP A;  3KKR A;  4OPH A;  1VQN N;  3EE8 A;  1LCU A;  1ZXO A;  4XH4 A;  3OVN A;  1OH5 A;  2HHV A;  3O1B A;  3L2U A;  3ENB A;  4Y1C A;  4OLB A;  4FWL A;  3IAY A;  2A40 A;  4M3U A;  4IFE A;  3BDP A;  2XHB A;  4CHO A;  3M6G A;  1MWK A;  1OVQ A;  3OYH A;  3AA4 A;  5AQF A;  1K8K B;  4CJE A;  1WUA A;  2OAN A;  2XY8 A;  4H0X B;  4OPK A;  1T7P A;  1BA0 A;  2FSJ A;  2YKM A;  4EP4 A;  3ZT4 A;  3NGZ A;  4JS5 A;  4K8Z A;  3EZ5 A;  4DR2 K;  1BO5 O;  1SZ2 A;  2F96 A;  3DM2 A;  4NCA A;  3HO1 A;  4B3R K;  3J81 O;  5C0Y A;  3OYL A;  4FJ7 A;  1ITG A;  1KLN A;  2G8K A;  4U7B A;  4FVU A;  4OLA A;  4LF8 K;  1HNV A;  4FJX A;  1VQ7 N;  3GOI A;  4DU1 A;  4CK3 A;  4DFM A;  4IXC A;  1ZBI A;  4EHT A;  3J7A P;  2E1Z A;  3LDQ A;  2XY5 A;  4M3T A;  2O8C B;  1VSH A;  3SV4 A;  4BRI A;  4CE9 A;  2NRT A;  4B9M A;  3MMV A;  4ZTF A;  4H5W A;  4OGE A;  1SAZ A;  4CGH A;  4E1N A;  2PY5 A;  1ASU A;  2WC9 A;  1LWC A;  2E1Y A;  4BWM A;  3VEV A;  1W9H A;  3V1O A;  5C12 A;  1HNX K;  2ZWH A;  1BQN A;  4PKG A;  3CXC M;  4YDU C;  5AQO A;  1HUX A;  4E19 A;  4M42 A;  4F2R A;  4FWP A;  3C6A A;  4BWJ A;  2R7Y A;  1IKV A;  1TKD A;  1VQL N;  3RVC A;  4GKJ K;  1NMN A;  4DLE A;  2RHK A;  5C42 A;  2QW9 A;  3IUC A;  1QQN A;  2I7N A;  3TAR A;  3KLI A;  4BC4 A;  2HHX A;  1ESV A;  2YHY A;  3HSC A;  3LDL A;  2YNG A;  1XC3 A;  2E4L A;  5AQQ A;  3BF3 A;  3ULD A;  3VA0 A;  3DAW A;  1WSI A;  2O8D A;  2PYL A;  1BI4 A;  4W5N A;  1DTQ A;  4IZ9 A;  4BRP A;  3EE9 A;  4DF4 A;  4KI6 A;  4FJM A;  5KI6 A;  2YNF A;  2HVH A;  2HHW A;  2OYQ A;  1RDC A;  3IRX A;  4A57 A;  4FPA A;  1KXP A;  2NRR A;  1TUY A;  4BRO A;  1X9S A;  3ENH A;  4ELU A;  2G8H A;  3SQ4 A;  3EEQ A;  3TAP A;  3VQB A;  3ZX3 A;  4CHN A;  3NGI A;  2OCE A;  1QHT A;  3E66 A;  4HTU A;  1TL3 A;  3MK6 A;  3VEW A;  4H5V A;  3QET A;  3ZT3 A;  3ITH A;  3O6W A;  2NRW A;  4FPB A;  1JLF A;  4F3O A;  4GV6 A;  3ISN C;  3AVB A;  1RT5 A;  5SZT A;  5FPD A;  1F21 A;  2VCP A;  3J7Y P;  5HLF A;  1YIJ N;  2V51 B;  3LPT A;  4E89 A;  1RIL A;  2E6L A;  3GBT A;  3PO4 A;  4MO5 A;  4PY5 A;  4CZF A;  4H0T B;  3D2F B;  3LWM A;  3KD5 E;  2A1R A;  4UQG A;  1HQU A;  2QWP A;  3OY9 A;  1IG8 A;  4JKE A;  4I2Q A;  1NJX A;  1ASV A;  2FLO A;  3I8D A;  3G0Z A;  4AHV A;  1Y64 A;  1IV0 A;  4MFB A;  5F0X A;  2UXB K;  4DFP A;  1S1U A;  3A0I X;  5TKY A;  3EY1 A;  3W3D A;  3JSM A;  4JN4 A;  4JD2 A;  1E4F T;  4CZG A;  3QNN A;  1ZYQ A;  4JI2 K;  1N8R O;  3O4W A;  1C6V A;  1T8E A;  5TKW A;  2RN2 A;  3VQ7 A;  3NH0 A;  4AHS A;  4LFB K;  1V4S A;  1YXQ A;  2NRX A;  4CD1 A;  5BN8 A;  2QI2 A;  5HOO A;  4CD3 A;  4CGI A;  3UKR B;  4M3R A;  3WEE B;  3PUF A;  3O9Q A;  1EP4 A;  3AAP A;  5A2Q O;  4ISG A;  1GLE G;  1BGX T;  2KFN A;  4KRE A;  4LH4 A;  1IKX A;  4H4O A;  2VG7 A;  1EX4 A;  3DLL L;  1MU2 A;  4ILG B;  4KH6 A;  3VQ6 A;  5I42 A;  2HF3 A;  4NB4 A;  2FF3 B;  2W41 A;  1QSY A;  4JHD B;  4QS9 A;  3P5J A;  3KKS A;  4LSN A;  4O5B A;  3PSI A;  1QVF M;  2OPS A;  4JKA A;  3MXJ A;  4KB1 A;  1U2V A;  2P5G A;  4KTW A;  3QNO A;  5F1X A;  4U67 L;  3AO3 A;  2DTU A;  4H03 B;  3TAB A;  3K9K A;  4BC3 A;  1Z6R A;  1B92 A;  1JLB A;  3L3V A;  2HHT A;  3CJ7 A;  4OVL A;  5FRM A;  2D4W A;  4DMN A;  3E9P A;  4CFC A;  1S72 N;  1QZ5 A;  2JLE A;  1NGF A;  4WCE L;  1W0H A;  3TWH A;  4JI7 K;  1BCM A;  2E20 A;  4QCL A;  1NJZ A;  1S3X A;  4H8K A;  1HNW K;  3CJA A;  3JXU A;  1DGK N;  1MDU B;  3C94 A;  3QEX A;  3ZET A;  1RCH A;  4UY8 O;  4JKH A;  3OJU A;  3KK1 A;  4FJ9 A;  3THY A;  3V9W A;  3ZSY A;  3AGR A;  3O9S A;  1RDU A;  2DPN A;  3VQC A;  3L2Q A;  3QML A;  2X78 A;  4AQY K;  3TAG A;  3O3F A;  1JLC A;  4YHH K;  5EX5 A;  1WLJ A;  4B8A B;  1U47 A;  3WXM B;  1TAU A;  3MN7 A;  4N76 A;  2ASO A;  3VEX A;  1TK8 A;  3I8B A;  1UOC A;  1A5V A;  2QTD A;  1CZA N;  1JLA A;  2D0B A;  4CJK A;  4FJ8 A;  4DF8 A;  2OTJ N;  4CBW A;  2Q97 A;  4HWI A;  3P1G A;  2Z1H A;  3V9X A;  5KPR A;  1SKS A;  3MCA B;  4CJR A;  3U9D A;  2HHQ A;  4WYB A;  3LDS A;  1WSG A;  4X65 K;  2NRZ A;  2P9S B;  1HYV A;  4J2A A;  3LZI A;  2PZS A;  1RTH A;  4CZI A;  3MEE A;  2Q0R A;  2O8E A;  3JAM O;  3OS2 A;  5AQM A;  3WXI A;  2HND A;  5CYM A;  4IDH A;  1KTQ A;  2E88 A;  4GNI A;  1VRU A;  3VTI A;  4DV5 K;  4DQP A;  4Q0B A;  4AHU A;  3RSE A;  4M7X A;  2ZJR L;  3SI6 A;  4PHT X;  4JNE A;  3PX4 A;  3AVH A;  4FK0 A;  4DLG A;  1QSL A;  3AVK A;  4C1N I;  4F8R A;  3WNG A;  5AQU A;  5HL7 L;  2FBY A;  5B8H A;  3AA2 A;  4EZ9 A;  1NJI O;  5AZI A;  2IC3 A;  5AZJ A;  3TU5 A;  3CC4 N;  4FCY A;  5EVZ A;  3O4N A;  4CER A;  1N34 K;  4CI6 A;  5H1S Q;  2X6N A;  5AQY A;  3CQ8 A;  3T1Y K;  1VQ4 N;  4BRH A;  4WFA L;  4JS4 A;  3VQ5 A;  5FRN A;  1YTU A;  4LD0 A;  2F8T A;  4H4M A;  4DR6 K;  1VSD A;  2EWS A;  3K5O A;  3RTV A;  4BR2 A;  5GIN A;  1KQS M;  4EIA A;  3KTQ A;  1NGC A;  1BCO A;  1X3N A;  3D45 A;  4DR4 K;  5JS1 A;  2ITM A;  4DUY K;  4RTF D;  4KAZ A;  3QO9 A;  4X62 K;  2NNW A;  1U04 A;  2YX6 A;  4CF0 A;  3A5O C;  2A1S A;  1VK0 A;  4X66 K;  1YJ9 N;  2QEX N;  4LF5 K;  1C1C A;  2E2N A;  2EHG A;  2QA4 N;  1N36 K;  4BRD A;  1NK4 A;  2YKN A;  4IEE A;  4EHU A;  1HPZ A;  3H1Q A;  2F7T A;  5J1E A;  3NMU A;  1XHZ A;  3S3M A;  1U6Z A;  2G8V A;  3H45 C;  1K8K A;  4E7I A;  4CF1 A;  3OYC A;  1GLA G;  5GIO A;  5JVG L;  1NK9 A;  1WSF A;  3OYN A;  1L3T A;  1VSE A;  4FLV A;  3IKM A;  4LFC K;  4WF9 L;  4KH4 A;  4YY3 K;  3L3U A;  3OYK A;  1WBB A;  1EKE A;  4JKF A;  4E7J A;  3SYZ A;  3KK2 A;  5KRS A;  2Z1G A;  3O1W A;  3SZ2 A;  4WFN L;  1LWF A;  1WB9 A;  2HF4 A;  4IOC L;  2D1K A;  3HK2 A;  5BRF A;  3IS9 A;  2BE2 A;  4F9O A;  4AH9 A;  3NF6 A;  1YAG A;  3Q7B A;  4J2B A;  3AVN A;  3AO2 A;  4CED A;  4KTZ A;  5IWA K;  4I9L A;  4FL9 A;  1Y97 A;  2ZQB A;  2A42 A;  3DLG A;  1N33 K;  1G15 A;  2ZGY A;  3VES A;  3ZX2 A;  1Q18 A;  1RT1 A;  2BDP A;  2O8C A;  1D4X A;  3ZSR A;  3ATV A;  3K59 A;  3QIP A;  3CM6 A;  4DCH A;  4E7H A;  3SK3 A;  1HRH A;  3PO5 A;  3NAE A;  1B9F A;  1R59 O;  1VSF A;  1DLO A;  3QBX A;  3VQ9 A;  4E0D A;  4DU4 A;  3HYF A;  2GV9 A;  1RDD A;  4Y1D A;  1YVN A;  3ALY A;  2F4V K;  1K73 O;  4FWR A;  3M8Q A;  3FGU A;  4B9U A;  3OW2 M;  4BR5 A;  1HNI A;  2A5X A;  2H3G X;  3EKU A;  2X6S A;  4W5T A;  3ATU A;  4FWQ A;  2HBL A;  3K57 A;  4WQ5 C;  3NGY A;  2HOE A;  5KPZ A;  1X1P A;  1U48 A;  3VF6 A;  1NNE A;  4N47 A;  2VWJ A;  2GX9 A;  3FZM A;  4CFA A;  2IAJ A;  2V52 B;  1LAW A;  1ZC6 A;  4I6M B;  3S3N A;  1EET A;  3KD1 E;  3EZW A;  3PSF A;  4DR5 K;  3AGK A;  3VF2 A;  2Q0U A;  2WOM A;  2ZJQ L;  4QS7 A;  2O4I A;  4B1U B;  4B9L A;  1TL1 A;  2O8F B;  3M8S A;  3C0B A;  4DQ8 A;  3QB0 A;  2CH6 A;  4IBN A;  2RE2 A;  4B3M K;  5J2M A;  2G8F A;  4HCC A;  4DTP A;  1NKE A;  1D9F A;  1T44 A;  2ZGZ A;  3QER A;  5KPT A;  3VOV A;  4NLB A;  3F5T A;  4FM2 A;  5AQL A;  3K5M A;  3VEZ A;  1MA9 B;  4BR4 A;  4IOX A;  3CFO A;  3OTO K;  4FJG A;  3SQ2 A;  4CJQ A;  4CZJ A;  3OYI A;  1ILY A;  1NGB A;  4DSI A;  1CXU A;  1K6Y A;  3DYA A;  1R0A A;  3D2F A;  3UIQ A;  5HRO A;  3CJ9 A;  1S22 A;  1RT7 A;  3MEC A;  3MWT A;  1Q8I A;  4K0K K;  3ASM A;  2HBK A;  2XRI A;  3NFA A;  4WQ4 A;  4JRQ A;  2HNZ A;  2BTF A;  5BPL A;  3KLH A;  2IVP A;  1XQS C;  5LJV A;  3IG1 A;  4BG9 A;  4BRQ A;  4YNQ A;  3K58 A;  4JKG A;  4PL7 A;  5KGW A;  4JKB A;  1ZBS A;  1HNZ K;  4FW1 A;  1LW0 A;  1BUP A;  3CMA N;  1W7A A;  4JI0 K;  1Z26 A;  5JS2 A;  3U8X A;  4MDA A;  3AV9 A;  3IMX A;  1LWE A;  3AAR A;  3BGR A;  4EFH A;  1HJO A;  4FJH A;  1VQP N;  3P83 D;  2IVO A;  3H3O B;  4IG0 A;  1JLQ A;  4A2B A;  1UA1 A;  4JI5 K;  3BEX A;  3T69 A;  3WEE A;  3CQY A;  4B9V A;  3VPZ A;  1ATS A;  4BRN A;  2RF2 A;  5HRR A;  5AJ3 K;  1Q9Y A;  1GLD G;  2CGK A;  3LZJ A;  4DKW A;  4JHD A;  5M1N A;  4GVE A;  4BG8 A;  5E41 A;  1K9M O;  1SKR A;  2AJQ A;  1NJY A;  1IBM K;  4AHR A;  2UUC K;  2CGL A;  3ZSX A;  1RT6 A;  4LF9 K;  2VGN A;  5AQR A;  1OH8 A;  3ZX0 A;  4C8N A;  1I94 K;  1S1W A;  2P9N B;  1WSH A;  1OH7 A;  4BR7 A;  3O3G A;  3BY5 A;  5FLX O;  3HPG A;  3O8M A;  5AQV A;  4FK4 A;  1E3M A;  5GAH P;  4M3Y A;  4YOV A;  5C10 A;  5CY4 A;  5GAD P;  3SUO A;  2KQ2 A;  2OZM A;  4CVN E;  4FSV A;  3VGK A;  4GKK K;  2WUS A;  3TAQ A;  1T03 A;  3VEN A;  1I39 A;  5FPE A;  4FJN A;  4JI1 K;  4GV3 A;  3F9M A;  4WFB L;  3ULE B;  2Q2R A;  3M3Z A;  3AVL A;  3PX6 A;  2FF6 A;  4E1J A;  1NOY A;  4KHN A;  3H46 O;  2Y1I A;  1G99 A;  3VQQ A;  1WN7 A;  4I2P A;  3B8A X;  2UUA K;  3GL1 A;  3LDN A;  3CF5 L;  2NLX A;  3G10 A;  2G8U A;  4K8X A;  4HUF A;  5J2N A;  4CFD A;  3O3H A;  3B6P A;  3ZSQ A;  5JVH L;  4C23 A;  1M90 O;  1XI1 A;  4FM1 A;  4DUZ K;  3SMS A;  2YI1 A;  4M3Z A;  3ZEU B;  4B9Q A;  3NCI A;  1LV5 A;  1L5U A;  4FWN A;  1IH7 A;  2F9T A;  1KFS A;  4HUE A;  3SAG A;  3NVK A;  4W5O A;  4O55 A;  3P31 A;  3WT0 A;  3DXM B;  2CH5 A;  2VG5 A;  4JKD A;  4CGF A;  3LWL A;  4DV7 K;  1UA0 A;  4H5T A;  4DTJ A;  1J54 A;  2Q36 A;  3LDO A;  4C8K A;  3VQA A;  2ZD1 A;  2D0O A;  1NK6 A;  2QWM A;  4ID1 A;  1VHX A;  2DFE A;  2GTD A;  3B6O A;  3OYM A;  3DOL A;  4M3X A;  4JYA K;  2P9L A;  3AO1 A;  4W5Q A;  2KZM A;  3CCM N;  4DQI A;  3SUP A;  4L8R B;  1RBS A;  2KLA A;  5KTQ A;  1N6Q A;  1QQO A;  3MWP A;  4CIG A;  3WXK A;  4OJR A;  5AFU A;  5LL6 Z;  3DWL A;  1SQK A;  1XC9 A;  3OJS A;  3NH1 A;  2WON A;  1GLF O;  2HMP A;  1CLQ A;  1IKW A;  4C8L A;  1XUP O;  4BDZ A;  2HW3 A;  1VQK N;  1KCF A;  3TSQ A;  4CEC A;  1Q7Y O;  3FFK B;  4BAC A;  3AA3 A;  5J2Q A;  4H0V B;  3MXI A;  4FJI A;  5DMR A;  4RW8 A;  2OTL N;  5EOY A;  3SLC A;  1HKC A;  2B5J A;  3K9J A;  1RTD A;  3K0S A;  4O0J A;  3A5M C;  3V1R A;  4I9Q A;  3FZK A;  1VQM N;  3AVM A;  3QIO A;  1SV5 A;  1GOC A;  4PWD A;  3DJC A;  1NGH A;  3T19 A;  3CYM A;  3AVI A;  4K43 A;  4DTM A;  3PY8 A;  4CZH A;  1FXX A;  4DS4 A;  1NKB A;  4FOI A;  4CW7 B;  1QZ6 A;  4E3S A;  1JL2 A;  2VWB A;  1A5W A;  4BRA A;  4B9S A;  1C0T A;  3QFU A;  4BRK A;  1D8Y A;  2NRH A;  1NGI A;  2A3Z A;  1GLL O;  3THW B;  2E2O A;  3CCS N;  3SV3 A;  3TAF A;  3FE1 A;  3BP8 A;  3UE5 A;  4AM7 A;  1V4T A;  5AFU H;  3HP6 A;  4BDY A;  1TYQ B;  3J7Z O;  4CJL A;  4B1V A;  5C15 A;  4DSJ A;  2P9K A;  3D2E B;  5LJW A;  3RMA A;  4FK2 A;  4OKE A;  5KQD A;  3L8B A;  1KRP A;  2OPR A;  5CE3 A;  1JLE A;  1X9W A;  3RMD A;  3CJC A;  3LDP A;  3ZSZ A;  2ZE2 A;  4B1Y B;  1FW6 A;  1KLM A;  3O4Q A;  4YOW A;  4KB0 A;  5HP1 A;  5MLC Q;  4R5P A;  1HR0 K;  3J80 O;  3D7E O;  4EAH D;  5I9E B;  3HST B;  3HJF A;  3AAQ A;  1S6P A;  3SUQ A;  4LF4 K;  2BGG A;  3GE1 A;  3A2F A;  3HI0 A;  2E2Q A;  2D0C A;  3F2K A;  4JAX A;  3U3G A;  4OO1 J;  4KFB A;  1NJW A;  1HKG A;  2PYJ A;  3I56 N;  2UXD K;  3N4Q A;  4IJA A;  1YVU A;  3D6R A;  4FJL A;  4CEO A;  2XY7 A;  4AM6 A;  4CK2 A;  3JS6 A;  1QS4 A;  1HQE A;  5HRN A;  1BDG A;  2QKB A;  1KSP A;  4B9T A;  1BQM A;  4IG3 A;  4DV1 K;  3CCL N;  3C6U A;  3ZYY X;  5C2D A;  2O8D B;  5AQG A;  1RDA A;  1RBV A;  2WBN A;  1N32 K;  3MXM A;  3EYZ A;  4K25 A;  1TGO A;  4ILJ A;  4HUG A;  1JKH A;  4DS5 A;  1EO1 A; 
#chains in the Genus database with same CATH homology
 4FWR A;  3FGU A;  2QWN A;  1DEJ A;  3OW2 M;  4BR5 A;  4U7B A;  4FVU A;  2A5X A;  2H3G X;  3I55 N;  3EKU A;  1P8Z A;  3A5N C;  3ATU A;  4FWQ A;  3GDQ A;  4JKG B;  4O8U A;  2HBL A;  4L3Q A;  4WQ5 C;  1VQ7 N;  4FWO A;  1J6Z A;  2HOE A;  5KPZ A;  3GOI A;  3CIP A;  3VF6 A;  3CC7 N;  4IXC A;  3M5R A;  4EHT A;  3KWI A;  2NZT A;  2E1Z A;  2GX9 A;  4OPA A;  3FZM A;  3LDQ A;  2E8A A;  2V52 B;  1WOQ A;  1ZC6 A;  2PBD A;  3R6M A;  4I6M B;  3EZW A;  3CCU N;  1DT9 A;  3AGK A;  4IWV A;  3VF2 A;  2Q0U A;  4BRI A;  2NRT A;  1JCE A;  4R79 A;  3MMV A;  4H5W A;  1X9J A;  1SAZ A;  4CZE A;  3TTC A;  2ZJQ L;  4QS7 A;  2WC9 A;  5E26 A;  4B1U B;  2E1Y A;  4CJ7 A;  3TSU A;  3VEV A;  4G9Z A;  3C0B A;  4J8F A;  3QB0 A;  4DQ8 A;  1HKB A;  2CH6 A;  5C12 A;  2RE2 A;  2ZWH A;  4IEI A;  4FO0 A;  5GAG P;  3M1F A;  4PKG A;  3CXC M;  1NGG A;  1MWM A;  4YDU C;  5AQO A;  1HUX A;  1T44 A;  2ZGZ A;  1NLV A;  5KPT A;  1O13 A;  3R3L A;  3VOV A;  4NLB A;  3F5T A;  4FWP A;  4YOR A;  3P4I A;  3C6A A;  5M1P A;  5ADX H;  3CER A;  5AQL A;  3VEZ A;  1YF5 L;  2AP1 A;  3FZF A;  3VGM A;  1VQL N;  3RVC A;  1MA9 B;  4BR4 A;  1VQ6 N;  4IOX A;  1W2B M;  1JCF A;  2RHK A;  2QW9 A;  3IUC A;  1QQN A;  2I7N A;  4BC4 A;  1ESV A;  2YHY A;  5BN9 A;  4KH5 A;  3HSC A;  4CZJ A;  3LDL A;  1XC3 A;  3EL2 A;  5AQQ A;  2A6A A;  3BF3 A;  1NGE A;  2P9I A;  1ILY A;  5BPM A;  1NGB A;  3NVM A;  3C7N A;  3DAW A;  1NGA A;  2BUP A;  2GWJ A;  4ISE A;  4CBX A;  4CZM A;  1YHQ N;  2UYT A;  3D2F A;  3UKU A;  1GLJ O;  2V7Y A;  3CJ9 A;  4IZ9 A;  4BRP A;  1NBW A;  1NWK A;  1S22 A;  3CCE N;  5E84 A;  3EE9 A;  3MN5 A;  1KC8 O;  5BRD A;  2BH1 A;  3MWT A;  3WXJ A;  5BPN A;  4WQ4 A;  2HBK A;  3KVG A;  4A57 A;  2BTF A;  4FPA A;  5BPL A;  1M1K O;  1KXP A;  4PKI A;  2NRR A;  3U4L A;  1TUY A;  5AQS A;  3UB5 A;  4BRO A;  2PAV A;  2IVP A;  1XQS C;  3KK7 A;  5LJV A;  4IJN A;  4BG9 A;  5AQJ A;  4BRQ A;  3ENH A;  4BVO A;  1K8A O;  4JKG A;  4PL7 A;  3ZX3 A;  4JKB A;  1ZBS A;  4FWK A;  1BUP A;  3CMA N;  1RFQ A;  3HOT A;  4GV9 A;  1EQY A;  2P9N A;  3E66 A;  4JK9 A;  3WUH A;  3MK6 A;  3VEW A;  4H5V A;  3VF4 A;  3U8X A;  4IO8 A;  1NMD A;  4MDA A;  3IMX A;  3CCQ N;  3O6W A;  1HPM A;  2NRW A;  3AAR A;  3BUZ B;  4FPB A;  5GAE P;  4I6M A;  4EFH A;  1HJO A;  4GV6 A;  4PKH A;  3CQX A;  5AQN A;  2P9I B;  5JLF A;  1VQP N;  2A41 A;  1E4G T;  5FPD A;  2IVO A;  2VCP A;  3C7N B;  3H3O B;  1KD1 O;  1YIJ N;  2W40 A;  2V51 B;  4A2B A;  2QWQ A;  3BEX A;  2QM1 A;  3T69 A;  3WEE A;  4B1Z A;  3GBT A;  4MO5 A;  4A5A A;  4H0T B;  4CZF A;  3D2F B;  4XH5 A;  3CQY A;  3UKU B;  3O9R A;  3VPZ A;  1ATS A;  4BRN A;  2QWP A;  3CCJ N;  3LM2 A;  1IG8 A;  4YOU A;  3OBW A;  4JKE A;  5F2R A;  1GLD G;  3SAF A;  2CGK A;  2QWO A;  2FLO A;  5JIC A;  4CZK A;  4DKW A;  1IJJ A;  1NM1 A;  4JHD A;  3ULE A;  5M1N A;  1Y64 A;  4YOY A;  1DKG D;  4GVE A;  2CGJ A;  4BG8 A;  2JWK A;  5F0X A;  4MLE A;  3A0I X;  5TKY A;  3TTF A;  1K9M O;  4Z94 A;  2GEL A;  2HST A;  3W3D A;  5M1K A;  2CGL A;  3ZET B;  4JN4 A;  4JD2 A;  1E4F T;  4CZG A;  1OVY A;  2VGN A;  5AQR A;  3TSP A;  1YI2 N;  3ZX0 A;  1N8R O;  3O4W A;  1VQ9 N;  5TKW A;  3BF1 A;  2P9N B;  4B1X B;  1RDW X;  1V4S A;  4BR7 A;  1YXQ A;  2NRX A;  2FSN A;  2P9L B;  2QWL A;  3R8E A;  2E2P A;  3HTV A;  4CD1 A;  4H0O A;  5BN8 A;  2QI2 A;  3O8M A;  4BRF A;  5AQX A;  5AQV A;  4WQ4 C;  5HOO A;  2HBJ A;  3ZEU A;  4CD3 A;  2F9W A;  3PIP L;  3MX2 A;  5AQP A;  4YOT A;  3UKR B;  5GAH P;  3R1X A;  5AQI A;  4YOV A;  5C10 A;  5GAD P;  3WEE B;  4AF1 A;  3O9Q A;  1YIT N;  3AAP A;  3MN9 A;  4FSV A;  4ISG A;  3VGK A;  1VQ8 N;  4HTL A;  1GLE G;  4FOE A;  2WUS A;  2Q31 A;  5DM6 L;  2IIR A;  3VEN A;  3DXM A;  3VTH A;  2QXL A;  3DLL L;  4ILG B;  3L4Q A;  5FPE A;  4KH6 A;  4BGB A;  2HF3 A;  4NB4 A;  2FF3 B;  2W41 A;  3C65 A;  3F9M A;  5EXW A;  4JHD B;  3ULE B;  4WFB L;  4QS9 A;  2Q2R A;  3SBT A;  3M3Z A;  3CPE A;  4BRC A;  2FF6 A;  4E1J A;  1VQO N;  2ASM A;  3EN9 A;  3H46 O;  1G99 A;  3QBW A;  1SS6 A;  1QVF M;  4FWM A;  4JKA A;  3KWG A;  3B8A X;  3CME N;  2I7P A;  3PIO L;  3GL1 A;  4JD2 B;  3LDN A;  1U2V A;  3CF5 L;  4H0Y B;  3ID8 A;  2NLX A;  3RSE B;  1KAX A;  3O08 A;  2YJF A;  3OHR A;  2P9P A;  3ID6 A;  1KAZ A;  1YJN N;  1BWF O;  3G4S N;  1C0F A;  3LL3 A;  4A62 A;  4NLC A;  5JVH L;  1M90 O;  4C23 A;  5F1X A;  3CI5 A;  3MX5 A;  4U67 L;  4H03 B;  3K9K A;  3W0L A;  4BC3 A;  1Z6R A;  4O8K A;  2P9U A;  5M1F A;  3E1Y A;  3SMS A;  5AZI B;  2YI1 A;  3CJ7 A;  3SAH A;  2D0P A;  2D4W A;  3ZEU B;  4B9Q A;  4A59 A;  3E9P A;  5JMV A;  5BR9 A;  4FWN A;  1S72 N;  2F9T A;  2KKZ A;  1QZ5 A;  5LY3 A;  1NGF A;  4JK8 A;  4WCE L;  4XH1 A;  3SAG A;  3NVK A;  3MN6 A;  3O80 A;  1HLU A;  4M63 C;  3P31 A;  4BC2 A;  3WT0 A;  2E20 A;  1S3X A;  3DXM B;  3FZL A;  2CH5 A;  3VEY A;  3QIC A;  2PFU A;  3J8A A;  4JKD A;  3CJA A;  3JXU A;  4H5R A;  4WQ5 A;  1DGK N;  3O9U A;  4H5T A;  1MDU B;  1H1V A;  3ZET A;  5BRE A;  2J4R A;  2Q36 A;  1T6D A;  4ISF A;  4JKH A;  4UY8 O;  3LDO A;  3CC2 N;  3S41 A;  5BRH A;  2FSK A;  3AGR A;  2D0O A;  2QWM A;  3O9S A;  1RDU A;  2DPN A;  4JEP A;  2GTD A;  3L6Q A;  3QML A;  2V7Z A;  3CPW M;  1U2V B;  5CHI A;  2P9L A;  2JWL A;  3O5B A;  5EX5 A;  2P9P B;  3H3N O;  1QHA A;  3ENO A;  3L0Q A;  4KBO A;  1BU6 O;  3WXM B;  5AQT A;  3MN7 A;  2ZF5 O;  3HM8 A;  3A8Y A;  5C2F A;  2ASO A;  3CCM N;  2P9K B;  3SJH A;  3VEX A;  2KLA A;  3UKR A;  1Z05 A;  4A2A A;  3I8B A;  1QQO A;  3MWP A;  2P9U B;  2QTD A;  3WXK A;  1CZA N;  2OTJ N;  1P90 A;  1GLC G;  1RGI A;  3A5L C;  4CBW A;  5AFU A;  2GEM A;  2GUP A;  2Q97 A;  4HWI A;  3TTD A;  4BRG A;  3DWL A;  5KPR A;  1SQK A;  2YHW A;  4GV3 A;  3MCA B;  3L4I A;  3LM9 A;  4C1N K;  1YJW N;  3U9D A;  3N4P A;  4BGA A;  1GLF O;  4WYB A;  2HMP A;  4K41 A;  4DHY A;  3I33 A;  1YUW A;  2NRZ A;  2P9S B;  5CR4 A;  4GY2 B;  1XUP O;  3CD6 N;  1GLB G;  2HBM A;  4CZI A;  1VQK N;  5AQZ A;  3MCP A;  3TSQ A;  1Q7Y O;  1Q86 O;  2Q0R A;  3FFK B;  3VER A;  2YJE A;  5AQM A;  4BRE A;  4IO9 L;  3WXI A;  4H0V B;  1VAZ A;  4DB3 A;  3QDK A;  3O9T A;  3QFP A;  4IDH A;  3HZ6 A;  2E88 A;  4GNI A;  3VTI A;  4QS8 A;  3Q7C A;  5EOY A;  5EY4 A;  3MDQ A;  1TUU A;  4M7X A;  3RSE A;  1HKC A;  3SLC A;  3K9J A;  4PHT X;  2ZJR L;  1TYQ A;  4JNE A;  3VET A;  4LC9 B;  2VGM A;  4MDB A;  4C1N I;  3A5M C;  3WXL A;  3D2E A;  3FZK A;  1VQM N;  4BQZ A;  5AQU A;  5HL7 L;  5B8H A;  1NJI O;  5AZI A;  3DJC A;  1W97 L;  1NGH A;  4A61 A;  4CZL A;  5AZJ A;  5KQ8 A;  4K43 A;  3TU5 A;  3VGL A;  3CC4 N;  3EKS A;  4XEI A;  4CZH A;  3HOS A;  4IOA L;  2YHX A;  1VQ5 N;  5EVZ A;  1JCG A;  3H6E A;  4FOI A;  3FLC O;  4CI6 A;  5GIP A;  5H1S Q;  1QZ6 A;  4BR0 A;  5AQY A;  2VWB A;  3P38 A;  1VQ4 N;  2ASP A;  4BRA A;  3CJ1 A;  4BRH A;  4WFA L;  2KHO A;  3QFU A;  4BRK A;  5FPM A;  3U9Z A;  3KZB A;  1X3M A;  2NRH A;  4JKC A;  1NGI A;  2A3Z A;  3WQU A;  2YCH A;  1JJ2 M;  1GLL O;  3OA9 A;  2EWS A;  1KAY A;  5ELZ A;  2E2O A;  2VYP A;  4MLH A;  3KHY A;  4BR2 A;  5GIN A;  3G25 A;  2IVN A;  3DXK A;  3T7Z A;  3PLA A;  3CCS N;  3FE1 A;  3BP8 A;  3R9P A;  3UE5 A;  1KQS M;  1NGJ A;  4AM7 A;  4EIA A;  1V4T A;  5AFU H;  1NGC A;  1X3N A;  3HBT A;  2ITM A;  3CET A;  1TYQ B;  4RTF D;  1BG3 A;  1NGD A;  4BC5 A;  4BVP A;  2NNW A;  2YX6 A;  3J7Z O;  3GG4 A;  4B1V A;  1T3V A;  3A5O C;  4PL8 A;  3G6E N;  5AQK A;  3FZH A;  5JLH A;  1ATN A;  5C15 A;  3CCV N;  2P9K A;  4H0P A;  4JK7 A;  3D2E B;  5FPN A;  5LJW A;  1YJ9 N;  2QEX N;  2OTL N;  4BY9 C;  1Q82 O;  5AQW A;  2FXU A;  4MO4 A;  3FR0 A;  4BR9 A;  3G71 N;  2NRV A;  5KQD A;  1QQM A;  3IDH A;  2E2N A;  3HRG A;  4O5F A;  5AZJ B;  4BRD A;  2QA4 N;  5CE3 A;  1T6C A;  4H5N A;  4IEE A;  4Y0W A;  1BA1 A;  4EHU A;  3CJC A;  3EO3 A;  3H1Q A;  3AY9 A;  2F7T A;  4YOX A;  4RWT A;  3LDP A;  3NMU A;  1C0G A;  4B1Y B;  1U6Z A;  2P9S A;  3SBG A;  3H45 C;  3IFR A;  4YOW A;  1K8K A;  5MLC Q;  1GLA G;  5GIO A;  2ZJP L;  2QWR A;  5JVG L;  5M1O A;  3VMF B;  3CHW A;  4CBU A;  3IKM A;  3D7E O;  4WF9 L;  4EAH D;  3WQT A;  5I9E B;  4KH4 A;  4FWS A;  5AQH A;  1HX1 A;  3AAQ A;  1ATR A;  3DXK B;  4JKF A;  5DM7 L;  1Q81 O;  2WFB A;  3GE1 A;  3HI0 A;  2E2Q A;  3O1W A;  3SMP A;  3VEO A;  1QVG M;  3CJB A;  4WFN L;  3F2K A;  4M7Y A;  2HF4 A;  5AR0 A;  4IOC L;  2D1K A;  4JAX A;  5BRF A;  4BQL A;  4F9O A;  4OO1 J;  1HKG A;  4RCH A;  4NO7 A;  3E9L A;  3C6H A;  1YAG A;  3P39 A;  3N4Q A;  3Q7B A;  3I56 N;  4OPH A;  5M1Q A;  1VQN N;  4IJA A;  3D6R A;  4BRL A;  3EE8 A;  1LCU A;  1ZXO A;  4XH4 A;  4AM6 A;  2GWK A;  3O1B A;  4A5B A;  3CCR N;  4FL9 A;  3ENB A;  3JS6 A;  4YDU A;  4FWL A;  1OKJ A;  2A42 A;  2A40 A;  1BDG A;  4IFE A;  4BRM A;  3VES A;  2ZGY A;  3ZX2 A;  2Q1N A;  1Q18 A;  3M6G A;  1BOT O;  1MWK A;  5AQF A;  1D4X A;  1K8K B;  3H1V X;  1WUA A;  2OAN A;  4H0X B;  3CCL N;  1BA0 A;  2FSJ A;  3ATV A;  4K42 A;  5ADX A;  3ZYY X;  4B1W B;  5C2D A;  4DCH A;  3SK3 A;  5AQG A;  4ILH A;  1R59 O;  3QBX A;  3OBY A;  2WBN A;  3E9O A;  1BO5 O;  2AA4 A;  1SZ2 A;  3TPQ A;  4K25 A;  1LOT B;  4ILJ A;  5C0Y A;  1YVN A;  1EO1 A;  1K73 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...