4GV9A

Lassa nucleoprotein c-terminal domain in complex with triphosphated dsrna soaking for 5 min
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
198
Chain Sequence
FGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*(GTP)P*GP*GP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
total genus 51
structure length 198
sequence length 207
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gv9A01
3Q7BA 4GV6A 3MWPA 3MX5A 3MX2A 3MWTA 4GV9A 4G9ZA 4GVEA 3Q7CA 4GV3A 3R3LA 4FVUA
chains in the Genus database with same CATH superfamily
1Q82O 5KGXA 1W0HA 5AQMA 1YVNA 1QTMA 1S1XA 3L2UA 3HP9A 3PSFA 2WC9A 1NGIA 1JXBA 3NVMA 3LPUA 4AHSA 2KQ2A 3F2KA 3E1YA 4B9TA 2Y1IA 3CF5L 3VA3A 1SL2A 2IVOA 2NRRA 3DOKA 4CJ5A 4BRKA 4JKGA 2A42A 1BA0A 3OYJA 1WAFA 3NHGA 2FSNA 3N4QA 4CJWA 4O0JA 4U67L 3WQUA 3GDQA 4CGDA 3KWGA 3HXMA 3ZT2A 4BQLA 2HHVA 3OTOK 1HYVA 3LANA 4IG0A 2VQFK 3OYMA 2VCPA 3AO1A 4DR3K 2YHAA 1UAXA 1XQSC 1VHXA 4LF6K 1SL1A 4LFAK 3CMEN 2W6LA 4JKGB 5AZIA 4CJUA 3EN9A 4LY7A 2I7PA 3VQ5A 4H5RA 3A2FA 3LZIA 4CFAA 3O4QA 5AJ3K 1YT3A 4FJGA 4PWDA 4OPHA 1RNHA 3CCEN 2X6SA 3TAGA 5K14A 2RF2A 2O4IA 4LFBK 3MWTA 1RDUA 3KLHA 1LV5A 3B6OA 1BWFO 2HHHK 4E7JA 5BRFA 2BGGA 4ID5A 2OCEA 2QTDA 2CH6A 3VMFB 5AQKA 5LMUK 4J8FA 5GADP 3DLBA 2BANA 5AZIB 4NO7A 3RMCA 5FROA 3CCQN 3WT0A 4CECA 1WB9A 2RKIA 3U9ZA 1GOBA 5KPZA 4BRQA 2Q36A 4A59A 4JLHA 3CJ7A 4BROA 2A1RA 4GW6A 2G8VA 2P9UB 3L3UA 4JRPA 4QS8A 2WBNA 4OX9K 3JSMA 2O8BB 3KIOA 4PKIA 5C25A 1W7AA 2YNGA 1ZBSA 1NKCA 4K41A 3DLHA 3VETA 1U47A 4BC3A 2ZJPL 1VQKN 3OA9A 1KFSA 4FWLA 4DTJA 1DTTA 2YNFA 5AQSA 3O4WA 4B3SK 1BUPA 4IFVA 2O4GA 3L3VA 3KLEA 3OBWA 2G8HA 4JI7K 1JLBA 1S6PA 5ADXA 1DLOA 3QFUA 1YTAA 5HLFA 4BVPA 4WF9L 4EP5A 2P9KA 2YKMA 3K0SA 2A40A 3TAQA 1GLBG 4CGFA 1W97L 4H4OA 4FM1A 3SUNA 3CQYA 4DQSA 1VQ9N 3DRPA 2FBXA 1S3XA 3O3HA 4G1QA 1EETA 4DUYK 3QNOA 4FLUA 2QW9A 2RPIA 3LP1A 5KRSA 3OS0A 1G15A 3CJCA 2HHSA 1Z26A 1LWEA 3M8RA 4GVEA 1JLCA 1ZXOA 2JGUA 2P9KB 3TWHA 4BR5A 2UUAK 2Z1HA 1A5VA 2FXUA 3VQDA 2BDPA 5F0XA 1U6ZA 4C8KA 4KHPK 3O4NA 4BY9C 2W41A 2CH5A 4IG3A 4B1UB 3LAKA 4CJEA 4JI0K 1FW6A 3MEGA 4EHTA 4CZIA 2RE2A 4BRPA 3KD1E 3NH2A 4DR4K 3RMAA 5JVGL 1C0UA 1CXQA 3OYLA 4OPKA 4FLTA 4BRFA 3ZEUA 1O1WA 5HOOA 4B1XB 1JLGA 3SAGA 3L8BA 1RT1A 3SQ1A 3EKSA 4YY3K 4FOEA 3DLKA 4WYBA 2ETJA 3LP2A 1OVQA 2ZQBA 1U4BA 5MLCQ 3FFKB 2ZF5O 4LSLA 4CEFA 4J2AA 1RGIA 3VTIA 1Q7YO 4KHSA 3C7NB 1CZ9A 3ZX2A 3HOSA 3I8DA 1RT5A 4NCGA 3CC4N 3FFIA 1KSPA 1SZ2A 3SZ2A 3L2VA 1IBMK 4IOCL 1NWKA 3VERA 4FLXA 3HOTA 1CLQA 1ATRA 3CPWM 4E7IA 1TAUA 3QDKA 1QQOA 3WUHA 3EY1A 3Q7BA 1XI1A 3LDSA 3ZX3A 1KAZA 2GUIA 1XHXA 1RT3A 1RBTA 1ASUA 2P5GA 1NK0A 1VSEA 3K5NA 1D9FA 1JLFA 1P8ZA 4FK4A 1RBUA 3KK2A 4FPBA 3VGKA 3H3NO 4CW7B 1SL0A 4B1YB 1YHQN 5B8HA 4FW2A 2VG5A 3OW2M 4B9UA 3A5MC 3VF2A 1H1VA 2YCHA 3ZX0A 4Z4GA 5JS2A 1NJIO 4IDHA 3ZSRA 4CGHA 1YITN 4JI2K 4EHUA 4DSKA 4Z4HA 2XY7A 4DS5A 3THYA 1BU6O 1Q86O 4FLYA 1E4FT 4M3XA 4I9QA 4XH5A 4WQ5A 1HYSA 5CZ2A 2W6KA 1J6ZA 1WAJA 4F9OA 1R59O 4CFBA 4X66K 1YXQA 2XY5A 1JL1A 4CVNE 1TKXA 1Z6RA 3K5MA 4DFMA 4LH5A 4H03B 1LW0A 4CIFA 4O5BA 3DXKB 3ZSZA 2ASMA 5D3GA 2RN2A 4HUEA 2HNYA 3VF6A 2P51A 3UKUA 2E88A 4RW6A 3PO4A 3D2FA 1J9AA 3THYB 2NRWA 3ASMA 4XH1A 4DTSA 5C0YA 5CYMA 3CJ9A 4HCBA 5BPLA 3RTVA 1SAZA 3SCXA 3O9SA 3WQTA 5CR4A 3DXMB 4RW7A 4RWTA 4CGGA 3AAPA 1YJWN 4W5RA 3OJSA 1BOTO 5AQNA 2BE2A 3GL1A 3G6EN 3UE5A 4CJKA 3MCAB 2XO7A 3KTQA 3CIPA 5FPMA 5BR8K 3DLEA 2V7YA 5HRRA 2ASOA 4BRAA 3D2FB 5J1EA 5AQFA 3R9PA 1KC8O 3CG7A 1BO5O 5GAGP 3HO1A 2JLEA 4YNQA 4FVMA 4H0XB 3TTFA 1GLLO 1BGXT 1HNIA 4FVUA 1WUAA 3HPHA 4DV2K 2WOMA 3KHYA 2PYLA 1D5AA 4JHDB 5AQUA 4ELVA 3WXLA 3AY9A 4FLVA 2D0OA 2Q31A 3MX5A 4CJ7A 1WN7A 1RILA 3V1QA 2P9NB 5KRTA 4FO0A 4PY5A 3K2PA 1VRTA 2FF3B 4DR5K 3V81A 3KLFA 4LF8K 4HHTA 1TGOA 1LWFA 3P5JA 2ZJQL 4F3TA 2O8FA 2G8IA 4FWRA 3AV9A 1VQ4N 3F5TA 3DM2A 3O9TA 4CERA 1T7PA 3HK2A 3I0SA 2V52B 4GV6A 4OVLA 1C1CA 5ADXH 4CF8A 3HSCA 2QWMA 4IDKA 1X9WA 5AQYA 3V1OA 4DTPA 4ELUA 4BDPA 4JYAK 2YI1A 4OPAA 1MU2A 4JI6K 5J2NA 1VSKA 5F1XA 2EHGA 3ZETA 3SAHA 4PKHA 3EE8A 2QI2A 3LP0A 5DMRA 5C42A 4J2DA 1BCOA 4CZLA 4EIAA 4G9ZA 1KCFA 2E4LA 4W5TA 4E3SA 1VQMN 3FZKA 1DTQA 1L3TA 3FZFA 3CCRN 2HSTA 1RBVA 4FJHA 2F96A 3VTHA 3F9MA 3HTVA 3C65A 4E1MA 1RDBA 3FR0A 1W2BM 3NGZA 1KLMA 5HROA 3BF1A 2VGMA 2O8EA 2EWSA 4KHNA 4JRQA 3SMSA 1TYQB 3VESA 3AVGA 5IWAK 3U3GA 3TI0A 3QEWA 3RR8A 1HX1A 3CYMA 4K43A 1ASVA 3WNGA 1REVA 1HMVA 3ID8A 3JYTA 3LWMA 1NKBA 2R7YA 1XWLA 2FBVA 2YNIA 3PX4A 1QZ5A 4FWOA 3E9OA 2P9LA 2YJFA 1TL1A 1IBLK 1C0GA 2DY4A 3M6GA 5JICA 3RR7A 4JV5K 1S1VA 2CGKA 2QWPA 3A5NC 1ASWA 1WSIA 3LDQA 3WEEA 4E7HA 2G8WA 4KTQA 3O9QA 1VSIA 4DU1A 2O8EB 4Y1CA 3TAFA 1HPZA 3ZSXA 1GOAA 4O55A 4FJIA 4BRIA 1HNVA 1HPMA 4FLZA 4ZTJA 4K8XA 3VQQA 1D8YA 2P5OA 2HHXA 1WLJA 3U4LA 3PLAA 3N4PA 4MLHA 5SWMA 1NMDA 4DKWA 2HVHA 1UA1A 3ID6A 1VSDA 4CJSA 2GEMA 1LCUA 3O8MA 4CEBA 2GBZA 2FLOA 1NG9A 1NNEA 1VQ5N 3AVNA 1N36K 4DSFA 5E41A 2X78A 3CJ1A 1NMNA 4BACA 3LDLA 3VGMA 3O08A 4E7KA 3IG1A 3V1RA 3CJBA 5M1OA 4DMNA 4CZMA 4FWMA 4LSNA 4A57A 4QAGA 1S9GA 1N8RO 1WSHA 4Z4EA 2OYQA 1BDGA 1P90A 2VG7A 4B9LA 4B9VA 4Z4IA 1JCEA 3THWA 5FPEA 2VWKA 4CHOA 3AO3A 4CFCA 3SMPA 5CYQA 1RCHA 3FGUA 1N6QA 3PO5A 4KTWA 1BG3A 3BEXA 3I0RA 1NGGA 3D2EA 1L3SA 3L4IA 4YOYA 3MEEA 3MK6A 4K42A 3NMUA 4OJRA 4UY8O 3C6UA 5BPMA 3PIOL 3JAMO 3CXCM 2F8TA 4AF1A 4DWIA 4JKHA 4M63C 3DI6A 1WSEA 4B1WB 3THWB 1VQNN 4I6MA 2ZE2A 4W5OA 1WSJA 2BUPA 4FJMA 1G99A 3AVHA 1IJJA 1OVYA 4JK9A 3HP6A 2PBDA 4CJ3A 4IWVA 4CJLA 2HBMA 4DFKA 4KI4A 1MWKA 3ULEB 1TV6A 3TTCA 5AQZA 3O6WA 4ISGA 4E1NA 3VEZA 4I2PA 3W3DA 5BN9A 4KHUA 4BR9A 1IKWA 4JEPA 1DKGD 1U2VB 4NCBA 1Q9YA 4I6MB 4FM2A 4GVMA 4O44A 4E7LA 3CC7N 4CEEA 2NRVA 3M8PA 1ZBHA 2DTUA 3NGYA 4CEOA 3NFAA 2IAJA 4OPJA 4N47A 2YHXA 1X9SA 1C1BA 2D5RA 4MFBA 5KPRA 3G71N 1HKGA 3TANA 4CZFA 2A1SA 4IOAL 4YOXA 4O8UA 3BZCA 3VQ6A 3OY9A 4WQ5C 3DLLL 2HHUA 2ZD1A 3LDPA 2DFFA 3M3ZA 3R1XA 3O9UA 3PX6A 4IXCA 4AILC 3MN5A 1RFQA 1TK0A 3OYFA 3T1HK 2E2NA 2CGJA 4M7YA 5I42A 4DV1K 4DV7K 2YNHA 3A8YA 4CJPA 2GELA 3DRSA 3WXKA 4XEIA 2PY5A 1FJGK 3LDNA 5KI6A 4W5QA 2DPNA 4CHQA 4JD2A 5AQJA 4WCEL 3OYBA 4JKCA 2IGIA 3QEXA 4KB1A 4DV3K 1ZYQA 3K57A 4BG9A 5FRMA 4F3OA 5CZ1A 3W0LA 3K59A 4FJKA 4RG8A 4CD1A 1NGFA 3PY8A 1NGDA 1WSFA 3PIPL 2XY8A 1GLEG 2PZSA 1B9FA 2E2QA 3QLHA 1T3VA 3CETA 4JD2B 3OBYA 3E9PA 4KFBA 4KH5A 2ZGYA 3FLCO 4CZEA 1VQ7N 4YFUA 3M8SA 4GY2B 3GE1A 1EXQA 1CZAN 3WNFA 3HVTA 3LALA 4JI4K 5KPTA 3P4IA 2AP1A 3H1VX 1SS6A 4YOVA 4WFNL 1LAWA 2AJQA 3SV3A 4RCHA 3VQ9A 4HTLA 4FJNA 1B92A 5BREA 4CF0A 4CZJA 4YHHK 4CJ4A 3PX0A 2JWKA 3AA3A 4OKKA 3KD5E 1RT7A 5CY4A 3IDHA 3HM9A 1S72N 1BISA 1DGKN 3LP3A 3AVMA 1NU0A 3EKUA 1QQNA 3G4SN 2IIRA 2VWBA 1GLJO 4XIUA 3NF7A 4CJTA 3KZBA 3V9XA 4QCLA 3EO3A 4DQIA 3VQ8A 1BQMA 1KAYA 1J54A 1BI4A 2QWLA 3KK3A 3OS2A 1NGBA 4B3MK 1EKEA 3FZMA 3CCVN 4JI1K 4CBUA 4KHQA 4CD3A 4ZHRA 3NF8A 3VEVA 3A5LC 4MQ3A 4N5SA 2V51B 4K25A 4JNEA 4B9QA 2G8FA 2Z1GA 4Z4FA 4E19A 5BPNA 4OO1J 2A5XA 4OKJA 2IDOA 2KTQA 2F9TA 4FWPA 4Y0WA 3C6AA 3ENOA 5AQVA 1MDUB 4ICLA 3RMDA 3ZEUB 3EL2A 4W5NA 2YHWA 1S1WA 4FSVA 1NM1A 3CCJN 4JI8K 2YHBA 3F9KA 5GAEP 3RVCA 3NH1A 3SV4A 1N32K 2GWKA 1D9DA 3O9RA 4JI5K 1Q8IA 3AVFA 3M1FA 1IG8A 3I33A 4FJ9A 1FKOA 4AHVA 2HHTA 4H8KA 1DEJA 4Z0UA 4FW1A 4IFYA 2XY6A 1N5YA 4BVOA 4KI6A 1WNSA 1YJ9N 1KXPA 1KFDA 4DUZK 5C15A 1YAGA 3HL8A 4CJFA 3HPGA 4CFDA 2H3GX 4O4GA 2EX3A 5E84A 3ENHA 1Y97A 4BRGA 2FF6A 4DLGA 1YUWA 3OYGA 2UXCK 1HNXK 1SKRA 2NLXA 3L0QA 4ELTA 2NNWA 1KQSM 3AA2A 2OA8A 1TVRA 3WNEA 4TSXA 4DV6K 3NBPA 1BCMA 1E3MA 1HRHA 4DTXA 3AVLA 3J80O 1S1TA 3ZSYA 4BRCA 3VQ7A 1MWMA 2KLAA 1NBWA 4RW4A 2W40A 2YKNA 3J8AA 1KAXA 1W9HA 1RBRA 4CI6A 4BR2A 3AVAA 3AARA 5TKWA 3DLRA 2QM1A 1XC3A 2YHYA 4JS4A 1F21A 1ZC6A 3BDPA 3O3FA 4DF4A 5I9EB 1I3AA 4HUFA 3VA0A 2P9PA 1J5OA 3AVJA 2ZM6K 1Z05A 1XUPO 2VWJA 1VK0A 3MXJA 4KKOA 4DTUA 3T69A 1LW2A 1WBBA 4JKAA 3QBWA 3T1YK 4CZGA 4WFAL 3TAMA 4H0VB 5HRPA 3K5OA 5JS1A 2Q97A 3UKUB 1C0FA 1QVGM 2A41A 4HUGA 4ILJA 2QWQA 1RTDA 4O8KA 3VQAA 3UIQA 3KK7A 4N76A 3AO5A 1VSFA 2IVPA 1JLQA 4CHZA 4DSJA 3TSPA 2HMIA 5AQIA 4DU3A 1D4XA 2UYTA 4DTNA 1HQEA 1IV0A 1Q18A 3VEYA 2HB5A 1BQNA 4E1JA 3ITHA 5LJWA 2I7NA 1SQKA 4IEEA 3CM5A 4CEZA 4DS4A 1JCFA 3MN6A 4Q0BA 2QWOA 1R0AA 4Q5VA 3CCLN 4M3ZA 1BA1A 5DM7L 3HJFA 4B8AB 4J2BA 1VSLA 3AA5X 4MLEA 3ZYYX 4A61A 3WXJA 4RTFD 3IAYA 5LJVA 4DQQA 4M3TA 1UOCA 3VQPA 4DV0K 3NAEA 3RWUA 3B6PA 1WOQA 4IBNA 3NGIA 3CERA 2NUBA 4XH4A 4NCAA 4U7BA 3RRGA 1JCGA 2Z1IA 4PKGA 3SLCA 1RT2A 3T3FA 2KZZA 1OH5A 4JKDA 3T7ZA 3CMAN 5AQQA 5C12A 2O8FB 4X64K 3KKSA 3CQXA 5EXWA 1RTIA 3BZKA 1RDAA 4H0OA 3WXIA 4M42A 4BC2A 3G25A 1K8AO 3V9UA 1X1PA 1LAVA 1NK6A 4BREA 4IEIA 1J5EK 4IZ9A 1VSJA 4WE1A 2QK9A 1IKYA 1YF5L 3VQCA 3MAQA 3OYDA 4UQGA 1XMOK 1Q9XA 1UA0A 1ATSA 2KFNA 4GV9A 2NRXA 4CZKA 3RRHA 5H1SQ 4DTRA 3TAEA 3THXA 4L8RB 3ZETB 3H6EA 4GKKK 1HJRA 3TU5A 4N56A 2FBYA 1Z25A 2E20A 3O1WA 3QICA 2E5LK 4DHYA 4FK0A 5FPDA 3VEOA 5JVHL 4FM0A 4EP4A 5AQWA 4B9MA 3MECA 4HTUA 5F2RA 3CD6N 2GX9A 3CI5A 5AQTA 4CK3A 1HYZA 4HVJA 4KAZA 3H45C 1NGCA 4OLBA 4LF5K 2FC0A 3AVIA 2YJEA 1ZBIA 4KHYA 3THXB 3LZJA 3BF3A 4CIGA 4BQZA 4C8MA 2KFZA 3CC2N 4NB4A 3GG4A 4KH4A 3UKRA 3TAPA 1ILYA 3WXMB 1C6VA 4HCCA 2P9IA 4ZTFA 4F4KA 3S41A 2E6LA 3CCMN 3M8QA 4LF4K 5SZTA 3DJCA 4HWIA 5JLFA 4GV3A 2D0BA 3J7AP 5AFUA 4IJAA 1QQCA 1RDDA 2ATQA 2KZMA 4JN4A 4DQ8A 2P9LB 3H3OB 4FJ7A 3L4QA 5EX5A 2D0PA 1J53A 1YTUA 3O1BA 4I7FA 3WEEB 5HRNA 3CM6A 1RTJA 3E66A 3IUCA 3UKRB 1S9EA 3TSUA 1TL3A 3HPOA 3BGRA 3HI0A 3J81O 3S3NA 2P9IB 5M1PA 4CF1A 2ZGZA 1M1KO 2Q0UA 4KB0A 3QESA 3TPQA 4AQYK 5AQLA 1XNRK 3V9SA 3NE6A 1SUQA 2OTLN 4YOWA 1IBKK 3WNHA 1HKBA 1QVFM 3QEPA 3P38A 3OS1A 2GWJA 3SQ2A 3C6TA 3MDQA 3OYCA 1JXEA 1EWRA 3L2RA 4H4MA 4CF9A 2IS3A 4DFPA 3P1GA 1HUXA 2HVIA 5KTQA 1T03A 5FPNA 4KREA 3RSEA 2NZTA 2W42A 3CFRA 2E1ZA 2HF4A 1N33K 2QXFA 3KVGA 3MMVA 1NK8A 1EWQA 3TSQA 4CEQA 3ZSVA 3J7YP 4M3UA 4JKEA 5DM6L 4AH9A 4JS5A 2KW4A 2O8CA 4YOTA 5AQXA 1NKEA 1VQ8N 3IRXA 4FL9A 1KD1O 1TKTA 3GOIA 3CFPA 2HHWA 1NK5A 3C6HA 1C0TA 2HF3A 4CGIA 2IVNA 3SPZA 3K58A 4C23A 4ILHA 2OZMA 3ENBA 4GMJB 3NH0A 4LH4A 4BRDA 4R79A 4QS7A 2DFEA 1XMQK 3A0IX 3SI6A 4B9NA 1JJ2M 4DLEA 3PSIA 4RW9A 5AR0A 3D2EB 1TK5A 3EZ5A 1FK9A 4DSIA 3O80A 3C95A 4CHPA 2O8CB 4H5WA 4IFEA 2D4WA 4B08A 2OTJN 3L6QA 4DSLA 3SBGA 3QEVA 3DOLA 3FE1A 1S1UA 3AVCA 3EEQA 1JKHA 1QSLA 5EOYA 3HSTB 3VF4A 1NK7A 1E4GT 3SK3A 3KLGA 3SQ0A 1C1AA 5AQRA 2G8KA 3DAWA 4FPAA 1EP4A 3FZHA 5FRNA 1KVBA 4A62A 1KTQA 3TARA 4KO0A 2CGLA 4DTOA 4DCHA 3SJJA 4FWKA 3ALYA 4K0KK 4NXNK 4IOXA 3JS6A 3K9KA 3OJUA 1IO2A 1S5JA 3MN7A 1NJYA 4CCHA 3R3LA 3QETA 4NXMK 1A5XA 1QHTA 4LFCK 2E2PA 2HBLA 4H0PA 3MXIA 1NK9A 3DWLA 4BR7A 1Q81O 4ISEA 3AO2A 4AHTA 2E1YA 3CQ8A 3LL3A 5GIOA 1DT9A 4H0YB 2VYPA 5GINA 4R5PA 2UUCK 2XHBA 4BE2A 3C0BA 5AQHA 1V4TA 4WFBL 3SUQA 1O13A 3O3GA 5HRSA 3HM8A 2P9UA 2WUSA 2KKZA 3D45A 2O8BA 4DR7K 3VQ4A 1A5WA 2O8DA 5HL7L 4BRHA 3IMXA 2KHOA 4H5NA 4Z94A 5A2QO 1QSYA 4FJ5A 2HW3A 4GKJK 2HBJA 1T44A 1NGEA 3FZLA 3NF9A 1HLUA 4M3YA 1T6CA 4KRFA 4F2RA 4BG8A 2XRIA 2Z1JA 4CEDA 4BDZA 4BWJA 3CPEA 3U6FA 3AAQA 3AGRA 2X6NA 3ZSQA 1LOTB 4IKFA 4LC9B 1K73O 4V19S 3QBXA 3R8EA 3GBTA 5FLXO 2FBTA 1VQPN 3K9JA 3QFPA 4M45A 2O8DB 2QKBA 2JWLA 1BIUA 3VEWA 4OGEA 1JL2A 5BR9A 1ESVA 5EVZA 4A2AA 4CJRA 3TABA 3QIPA 4J2EA 3VQEA 3QINA 1KVCA 4MO5A 3G10A 2OPSA 2LSNA 4M7XA 1EQYA 2QA4N 3THVA 3NF6A 4C1NK 3VEXA 4KH6A 4PUOA 5BRHA 4B3TK 5LMNK 4KPYA 4CBWA 4BE0A 3KLIA 5LL6Z 1Y64A 3EE9A 1ITGA 1TUYA 2X74A 1M90O 4ISFA 4FLWA 1QZ6A 4A2BA 3CCSN 1SKSA 4EFHA 4BRMA 3V9ZA 4B3OA 3MWPA 4GNIA 3EZWA 3L2QA 2GV9A 3G0ZA 2G8UA 1L5UA 4CHYA 2F4VK 1FXXA 3EYZA 3O5BA 1KLNA 2FSKA 4PL8A 2PFUA 3M5RA 2OPQA 3ZT3A 4JI3K 4LF7K 4AHRA 4AM7A 2P1JA 2D0AA 5AFUH 4FXDA 5BN8A 2OPRA 3MN9A 3BP8A 2Q3SA 4KTZA 2HBKA 2UUBK 4DQPA 2NRTA 2WTUA 3V9WA 3OHRA 3ISNC 4C1NI 1IKXA 1KVAA 3CJAA 1ZBUA 1NLVA 3B8AX 1YVUA 5JMVA 3S9HA 1T6DA 2PYJA 3C7NA 1RTHA 2D1KA 4CF2A 3R6MA 5E26A 4F2SA 1OH6A 1N34K 1BHLA 4KHWA 2VQEK 3DMJA 4AM6A 1SV5A 1CZBA 4DFJA 1UWBA 1X9JA 1B9DA 1OH8A 3KKRA 3K5LA 4CIEA 3VN5A 5J2MA 3IS9A 1BI4B 4EAHD 2YV0X 3LWLA 4IJNA 1OKJA 2V7ZA 2ZWHA 1X9MA 4FJXA 1OH7A 2F8SA 3S3MA 4DG1A 4DF8A 4FJJA 4E0DA 4BRLA 4JK8A 1LWCA 3PV8A 4M3WA 4A5BA 2OPPA 4H5VA 4DU4A 4ILGB 3CCUN 4O0IA 4BWMA 1U49A 1U04A 4YORA 4LD0A 2E8AA 4DB3A 4QOZB 5C24A 1X3MA 3VENA 4DR1K 1L3VA 3CHWA 4PA1A 4DR6K 3ZT4A 2HNDA 5C2DA 4AHUA 3SJHA 4ID1A 4EZ6A 3QO9A 1RT6A 4BRNA 4CZHA 3HYFA 1MA9B 1GLCG 4Z4CA 3PUFA 3BY5A 4FWSA 2ASPA 4DSEA 4OLAA 4FYDA 4DQRA 3QNNA 3IFRA 4PQUA 2ITMA 2P9SA 3T1AA 4BGBA 3DXKA 3ZCMA 3I56N 4BR4A 2VGNA 2NRZA 1K8KA 3SNNA 1NJZA 3MEDA 4E89A 4N41A 3U3YA 3A5OC 1NGJA 4QS9A 3VGLA 4I2QA 4Y1DA 1U48A 4FCYA 4OKEA 3DXMA 4BE1A 3OYHA 3E01A 3OYKA 4EZ9A 3TTDA 3ZSWA 4JKFA 5EY4A 4FZYA 2DFHA 2B4JA 1XHZA 2P9SB 4BC4A 4B1VA 3NDKA 1K8KB 4MDAA 4PHTX 3MCPA 5J2PA 1S6QA 4FOIA 4B9SA 4YDUC 2Q0RA 4DTMA 2ITGA 4F8RA 3MX2A 3KWIA 4WQ4C 4FK2A 5C10A 4A5AA 1HKCA 5KQDA 4BC5A 4X62K 4KV8A 3QMLA 3HZ6A 1FKPA 2P9PB 4BGAA 1ZBFA 4JHDA 4CESA 3P31A 3AVBA 3NCIA 3NVKA 1ZBLA 1VRUA 1NJXA 4I9LA 2P9NA 4O5FA 2Y1JA 1YI2N 2UXBK 1QHAA 2E6MA 1XNQK 3ZLJA 1C0MA 2IC3A 4CHNA 4JKBA 4B8CA 1NJWA 4BDYA 3MXMA 5CHIA 5AQOA 5BRDA 5M1FA 4L3QA 4NYFA 3OYIA 3LPTA 1VSMA 5HBMA 3V4IA 3SUPA 2AA4A 1U45A 1VAZA 1IH7A 3U8XA 3J7ZO 3KJVA 2FSJA 3VPZA 1VQLN 2GUPA 2WONA 4YOUA 5T7BA 1BIZA 1TUUA 2GTDA 5M1NA 1WSGA 4NYNA 5EU7A 2F7TA 5AQPA 4FJLA 2QWNA 5KQ8A 4FWQA 4CGJA 4NLBA 2YX6A 4CJVA 3V6DA 3SAFA 3I8BA 1BL3A 5M1QA 1GLAG 1K6YA 3JXUA 3QB0A 1VQON 1S22A 3UB5A 3AGKA 2HOEA 1TKDA 2BTFA 4MO4A 3QIOA 2QWRA 3QEIA 3P39A 1I94K 4RW8A 2F9WA 3OVNA 2A3ZA 2UXDK 3C94A 1HNWK 4DV4K 3SYZA 1RDWX 3L2WA 4CBXA 3I55N 5GAHP 3F73A 1TYQA 1NK4A 4FWNA 2A6AA 4B3RK 1T8EA 3QERA 1RDCA 4H0TB 3HVRA 4X65K 3RMBA 1QE1A 3D0PA 5HP1A 2PAVA 3SPYA 2D0CA 1SKWA 3CFOA 2RHKA 3T19A 5JLHA 3ATVA 5C2FA 1IKVA 2HNZA 5AZJA 1HJOA 4AHCA 4PL7A 3BUZB 2I5JA 1TK8A 1GLDG 1HR0K 1K9MO 3VOVA 3H08A 1YJNN 1I39A 3TR8A 4BR0A 3U9DA 3AVKA 4MDBA 4B1ZA 3ATUA 1NOYA 1JLAA 3ZSOA 2Q1NA 2HMPA 4CK2A 4JAXA 5ELZA 1X3NA 4FZZA 4C8LA 4CE9A 1XC9A 1GOCA 2NRHA 1HQUA 3HT3A 1NGHA 1EO1A 3D6RA 4M41A 5DK5A 4CJQA 4NLCA 1T05A 2VG6A 1NOZA 4CK1A 2OANA 3OYNA 4IO8A 2B6AA 1VSHA 5AZJB 3E9LA 1CXUA 3LM9A 1ATNA 4OGCA 5CE3A 5M1KA 4KBOA 3IKMA 3LDOA 4DV5K 2OZSA 5GIPA 1EX4A 4DR2K 2J4RA 2B5JA 3AA4A 2BH1A 1VQ6N 4LF9K 3ULDA 2QKKA 5FDLA 1L3UA 2QEXN 3SUOA 3LM2A 1TAQA 4FZXC 4K8ZA 5I3UA 3H46O 2IOCA 5KGWA 1WBDA 1HNZK 5TKYA 4C8OA 3Q7CA 5IT9O 4CEAA 2Q2RA 3H1QA 3HRGA 1KRPA 3SBTA 1RBSA 3OYEA 1RT4A 3LAMA 2E2OA 4YDUA 3OYAA 1YIJN 2QXLA 1GLFO 2UU9K 3ZT0A 5J2QA 2ZJRL 2HHQA 1IG9A 4WQ4A 4C8NA 3VQBA 3D7EO 1QSSA 3P83D 3KK1A 3HBTA 3DRRA 1NGAA 3SQ4A 1JLEA 5LY3A 3DYAA 1V4SA 3RSEB 1TKZA 1QQMA 4H5TA 3ULEA 1QS4A 3AO4A 3DLGA 4M3RA 3S3OA 3ZT1A 4JK7A 2WFBA 4FJ8A 4IO9L 1U2VA 5AQGA
chains in the Genus database with same CATH topology
3C65A 3EE9A 1MWMA 1Q82O 2KLAA 5AQMA 1YVNA 1NBWA 1TUYA 1M90O 2W40A 4ISFA 1QZ6A 4A2BA 3CCSN 3FR0A 4EFHA 3J8AA 1W2BM 2WC9A 4BRMA 1KAXA 1NGIA 3MWPA 3BF1A 2VGMA 3NVMA 4BR2A 4CI6A 3AARA 2EWSA 3EZWA 4GNIA 3F2KA 3E1YA 5TKWA 2QM1A 3CF5L 1XC3A 2IVOA 2YHYA 2NRRA 3O5BA 1ZC6A 1TYQB 3SMSA 4BRKA 4JKGA 2FSKA 2A42A 1BA0A 2PFUA 4PL8A 3VESA 2FSNA 3N4QA 5I9EB 3M5RA 1HX1A 2P9PA 4K43A 3ID8A 1Z05A 4U67L 4AM7A 3WQUA 1XUPO 3GDQA 1QZ5A 4FWOA 3E9OA 2P9LA 3KWGA 5AFUH 2YJFA 3T69A 4BQLA 5BN8A 3MN9A 3BP8A 1C0GA 2HBKA 3M6GA 5JICA 4JKAA 2NRTA 3QBWA 2CGKA 4CZGA 4WFAL 2QWPA 3OHRA 3A5NC 4H0VB 3LDQA 3WEEA 4C1NI 3CJAA 3O9QA 2VCPA 2Q97A 1NLVA 3B8AX 5JMVA 3UKUB 1C0FA 1T6DA 1XQSC 1QVGM 2A41A 3C7NA 2D1KA 3R6MA 5E26A 3CMEN 4JKGB 5AZIA 4ILJA 2QWQA 3EN9A 4O8KA 4BRIA 2I7PA 4AM6A 3KK7A 1HPMA 4H5RA 2IVPA 1X9JA 3TSPA 3U4LA 3PLAA 5AQIA 4OPHA 1D4XA 4EAHD 3CCEN 2UYTA 3N4PA 4MLHA 1NMDA 1Q18A 3VEYA 3MWTA 1RDUA 4IJNA 4DKWA 1BWFO 1OKJA 4E1JA 2V7ZA 5BRFA 5LJWA 2I7NA 1SQKA 3ID6A 2QTDA 4IEEA 2CH6A 2ZWHA 2GEMA 3VMFB 1JCFA 1LCUA 3MN6A 3O8MA 2QWOA 5AQKA 2FLOA 3CCLN 4J8FA 1VQ5N 1BA1A 4BRLA 4JK8A 5DM7L 5GADP 5AZIB 3CJ1A 4A5BA 4NO7A 3LDLA 3VGMA 3O08A 4H5VA 4ILGB 3CCUN 3CCQN 4MLEA 3ZYYX 3WT0A 4A61A 3U9ZA 3WXJA 4RTFD 3CJBA 5M1OA 4YORA 4CZMA 5LJVA 4FWMA 5KPZA 4BRQA 2Q36A 4A59A 2E8AA 4A57A 3CJ7A 4BROA 4DB3A 1N8RO 1BDGA 1P90A 1WOQA 2P9UB 1X3MA 4QS8A 3CERA 3VENA 1JCEA 2WBNA 5FPEA 4XH4A 4U7BA 3CHWA 4PKIA 1JCGA 4PKGA 3SLCA 5C2DA 1ZBSA 3SJHA 4K41A 4JKDA 3VETA 3SMPA 3T7ZA 4BC3A 2ZJPL 1VQKN 3FGUA 3CMAN 5AQQA 5C12A 3OA9A 4FWLA 1BG3A 3BEXA 4BRNA 3CQXA 1NGGA 5EXWA 4H0OA 3D2EA 4CZHA 5AQSA 1MA9B 1GLCG 3WXIA 4BC2A 3G25A 3O4WA 1BUPA 1K8AO 4FWSA 3L4IA 4YOYA 4K42A 3MK6A 4IEIA 2ASPA 4BREA 3NMUA 3OBWA 4IZ9A 4UY8O 3IFRA 5BPMA 1YF5L 5ADXA 2ITMA 3PIOL 3QFUA 4BVPA 4WF9L 2P9SA 3CXCM 2P9KA 4BGBA 3DXKA 4AF1A 3I56N 4BR4A 2VGNA 2NRZA 4JKHA 1ATSA 1K8KA 2A40A 4M63C 4B1WB 1GLBG 1VQNN 1W97L 4GV9A 2NRXA 4I6MA 4CZKA 5H1SQ 3CQYA 3A5OC 2BUPA 3ZETB 1NGJA 1G99A 1VQ9N 3H6EA 1IJJA 1OVYA 4JK9A 4QS9A 3VGLA 3TU5A 1S3XA 2PBDA 2E20A 3O1WA 3QICA 4IWVA 4DHYA 3DXMA 5FPDA 2HBMA 2QW9A 3VEOA 5JVHL 1MWKA 3ULEB 3CJCA 3TTDA 4JKFA 5AQWA 4GVEA 3TTCA 5AQZA 5F2RA 3CD6N 2GX9A 5EY4A 3CI5A 3O6WA 4ISGA 2OTLN 5AQTA 1ZXOA 3VEZA 3W3DA 2P9SB 5BN9A 2P9KB 4BC4A 3H45C 1NGCA 4BR9A 4BR5A 1YHQN 4B1VA 4JEPA 1DKGD 1K8KB 1U2VB 4MDAA 4PHTX 2FXUA 3MCPA 2YJEA 4I6MB 5F0XA 1U6ZA 4FOIA 4YDUC 2Q0RA 3CC7N 3BF3A 2NRVA 4BQZA 3MX2A 3KWIA 4NB4A 3CC2N 4BY9C 2W41A 2CH5A 3GG4A 4KH4A 3UKRA 4B1UB 3WXMB 4WQ4C 1ILYA 5C10A 4A5AA 1HKCA 4EHTA 5KQDA 2YHXA 4BC5A 4CZIA 2RE2A 5KPRA 4BRPA 2P9IA 1HKGA 3G71N 3QMLA 3S41A 4CZFA 5JVGL 3HZ6A 3CCMN 4IOAL 4YOXA 4O8UA 2P9PB 4BGAA 3DJCA 4HWIA 4JHDA 3P31A 5JLFA 4BRFA 4GV3A 3ZEUA 5HOOA 3NVKA 4B1XB 3SAGA 4WQ5C 3DLLL 5AFUA 4IJAA 3LDPA 2P9NA 4O5FA 3M3ZA 3R1XA 3EKSA 4JN4A 2P9LB 4DQ8A 3H3OB 3O9UA 1YI2N 3L4QA 4FOEA 4IXCA 1QHAA 5EX5A 4WYBA 3MN5A 2D0PA 1RFQA 3O1BA 3WEEB 5MLCQ 2E2NA 3FFKB 4JKBA 2CGJA 4M7YA 2ZF5O 3E66A 3IUCA 3UKRB 3A8YA 2GELA 3TSUA 3WXKA 5CHIA 1RGIA 3VTIA 4XEIA 1Q7YO 5AQOA 3C7NB 3HI0A 3ZX2A 4L3QA 5BRDA 5M1FA 3HOSA 2P9IB 3LDNA 5M1PA 2ZGZA 2DPNA 3CC4N 1M1KO 2Q0UA 4JD2A 5AQJA 4WCEL 3TPQA 1SZ2A 2AA4A 5AQLA 1VAZA 3U8XA 4YOWA 3J7ZO 1NWKA 3VERA 1HKBA 2FSJA 3HOTA 3VPZA 4IOCL 4JKCA 1QVFM 1ATRA 3CPWM 3P38A 1VQLN 2GUPA 4YOUA 1TUUA 2GWJA 2GTDA 3QDKA 1QQOA 3WUHA 5M1NA 3Q7BA 4BG9A 3MDQA 3ZX3A 3W0LA 1KAZA 2F7TA 5AQPA 1HUXA 4CD1A 1NGFA 2QWNA 5FPNA 3RSEA 2NZTA 5KQ8A 4FWQA 2E1ZA 1NGDA 3PIPL 2HF4A 1GLEG 4NLBA 2YX6A 1P8ZA 2E2QA 3KVGA 3MMVA 3SAFA 3I8BA 3TSQA 4FPBA 3VGKA 3H3NO 1T3VA 3CETA 4B1YB 4JKEA 5M1QA 1GLAG 3JXUA 5DM6L 3QB0A 4JD2B 3OBYA 1S22A 3E9PA 3UB5A 3AGKA 5B8HA 2HOEA 4KH5A 4YOTA 5AQXA 1VQ8N 4FL9A 2ZGYA 3FLCO 2BTFA 4MO4A 1KD1O 3OW2M 3GOIA 3A5MC 4CZEA 2QWRA 3VF2A 1H1VA 3P39A 2YCHA 3C6HA 2F9WA 2HF3A 3ZX0A 2IVNA 1NJIO 1VQ7N 2A3ZA 4IDHA 4C23A 4ILHA 4GY2B 3ENBA 3GE1A 4BRDA 4R79A 1YITN 1CZAN 1RDWX 4QS7A 4CBXA 4EHUA 3I55N 5GAHP 5KPTA 3P4IA 1BU6O 1Q86O 2AP1A 1TYQA 3H1VX 1SS6A 4YOVA 1E4FT 3A0IX 4FWNA 4WFNL 4XH5A 4WQ5A 2A6AA 1JJ2M 4RCHA 4H0TB 1J6ZA 4HTLA 3D2EB 5AR0A 4F9OA 5BREA 4CZJA 1R59O 3O80A 1YXQA 4H5WA 4IFEA 1Z6RA 2JWKA 2D4WA 2PAVA 3IDHA 1S72N 2OTJN 2RHKA 3L6QA 4H03B 3DXKB 3SBGA 5JLHA 2ASMA 1DGKN 3ATVA 3FE1A 3VF6A 3UKUA 2E88A 5EOYA 5C2FA 3VF4A 3D2FA 1QQNA 3EKUA 2NRWA 2IIRA 1E4GT 3SK3A 3G4SN 5AZJA 2VWBA 1HJOA 4XH1A 5C0YA 5AQRA 3CJ9A 4PL7A 3DAWA 1GLJO 3BUZB 4FPAA 5BPLA 1VQON 1GLDG 1SAZA 3FZHA 3VOVA 1K9MO 1YJNN 3KZBA 3O9SA 3WQTA 5CR4A 4BR0A 3DXMB 3EO3A 3U9DA 4A62A 4RWTA 4MDBA 4B1ZA 3ATUA 2CGLA 4DCHA 1KAYA 3AAPA 2Q1NA 4FWKA 1YJWN 2HMPA 4JAXA 2QWLA 5ELZA 1BOTO 1X3NA 5AQNA 3GL1A 1NGBA 3G6EN 4IOXA 3UE5A 3JS6A 2NRHA 3K9KA 3MCAB 3MN7A 3CIPA 3FZMA 1NGHA 5FPMA 3CCVN 3D6RA 3R3LA 1EO1A 4CBUA 2V7YA 4NLCA 4CD3A 2E2PA 2ASOA 2HBLA 4BRAA 3D2FB 4H0PA 3VEVA 5AQFA 2OANA 4IO8A 3R9PA 3A5LC 3DWLA 5AZJB 4BR7A 3E9LA 4ISEA 1Q81O 1KC8O 2E1YA 1BO5O 2V51B 4JNEA 4K25A 3LL3A 4B9QA 5GAGP 1DT9A 4H0YB 5GIOA 2VYPA 5GINA 4H0XB 3TTFA 1GLLO 5BPNA 4OO1J 3LM9A 1ATNA 2A5XA 3C0BA 5AQHA 1V4TA 4FVUA 2F9TA 1WUAA 4FWPA 4Y0WA 5CE3A 5M1KA 4KBOA 3IKMA 3C6AA 3ENOA 3LDOA 1O13A 3KHYA 5GIPA 3HM8A 2P9UA 2WUSA 1MDUB 2J4RA 5AQVA 2KKZA 4JHDB 5AQUA 3WXLA 3AY9A 2BH1A 3ZEUB 1VQ6N 2D0OA 2Q31A 3EL2A 3MX5A 4CJ7A 2YHWA 2P9NB 4FO0A 4FSVA 1NM1A 3CCJN 2QEXN 5HL7L 4BRHA 2FF3B 3IMXA 3LM2A 5GAEP 3RVCA 2KHOA 4H5NA 2GWKA 4Z94A 3H46O 2ZJQL 2HBJA 3O9RA 5TKYA 4FWRA 1VQ4N 3F5TA 3M1FA 1T44A 1IG8A 1NGEA 3FZLA 3I33A 1HLUA 3Q7CA 1T6CA 3O9TA 2Q2RA 3H1QA 1DEJA 3HRGA 4BG8A 4BVOA 1YJ9N 2V52B 1KXPA 3SBTA 3CPEA 4GV6A 3AAQA 3AGRA 5ADXH 3HSCA 2E2OA 2QWMA 4YDUA 1LOTB 5C15A 1YAGA 5AQYA 1YIJN 4LC9B 2QXLA 1K73O 3QBXA 1GLFO 2H3GX 2YI1A 3GBTA 4OPAA 3R8EA 5E84A 1VQPN 3ENHA 3K9JA 3QFPA 5F1XA 4BRGA 2FF6A 2ZJRL 4WQ4A 3SAHA 3ZETA 4PKHA 1YUWA 3D7EO 2JWLA 3VEWA 3EE8A 3HBTA 1NGAA 2NLXA 1ESVA 5BR9A 5EVZA 3L0QA 4A2AA 2QI2A 5LY3A 2NNWA 1KQSM 4CZLA 1V4SA 4EIAA 4G9ZA 4MO5A 3RSEB 1QQMA 4H5TA 4M7XA 3ULEA 1EQYA 2QA4N 1VQMN 3FZKA 4C1NK 4JK7A 3FZFA 3VEXA 3CCRN 4KH6A 5BRHA 2WFBA 4WFBL 2HSTA 4BRCA 4CBWA 3F9MA 3VTHA 3HTVA 4IO9L 1Y64A 1U2VA 5AQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7B A;  4GV6 A;  3MWP A;  3MX5 A;  3MX2 A;  3MWT A;  4GV9 A;  4G9Z A;  4GVE A;  3Q7C A;  4GV3 A;  3R3L A;  4FVU A; 
#chains in the Genus database with same CATH topology
 1Q82 O;  5KGX A;  1W0H A;  5AQM A;  1YVN A;  1QTM A;  1S1X A;  3L2U A;  3HP9 A;  3PSF A;  2WC9 A;  1NGI A;  1JXB A;  3NVM A;  3LPU A;  4AHS A;  2KQ2 A;  3F2K A;  3E1Y A;  4B9T A;  2Y1I A;  3CF5 L;  3VA3 A;  1SL2 A;  2IVO A;  2NRR A;  3DOK A;  4CJ5 A;  4BRK A;  4JKG A;  2A42 A;  1BA0 A;  3OYJ A;  1WAF A;  3NHG A;  2FSN A;  3N4Q A;  4CJW A;  4O0J A;  4U67 L;  3WQU A;  3GDQ A;  4CGD A;  3KWG A;  3HXM A;  3ZT2 A;  4BQL A;  2HHV A;  3OTO K;  1HYV A;  3LAN A;  4IG0 A;  2VQF K;  3OYM A;  2VCP A;  3AO1 A;  4DR3 K;  2YHA A;  1UAX A;  1XQS C;  1VHX A;  4LF6 K;  1SL1 A;  4LFA K;  3CME N;  2W6L A;  4JKG B;  5AZI A;  4CJU A;  3EN9 A;  4LY7 A;  2I7P A;  3VQ5 A;  4H5R A;  3A2F A;  3LZI A;  4CFA A;  3O4Q A;  5AJ3 K;  1YT3 A;  4FJG A;  4PWD A;  4OPH A;  1RNH A;  3CCE N;  2X6S A;  3TAG A;  5K14 A;  2RF2 A;  2O4I A;  4LFB K;  3MWT A;  1RDU A;  3KLH A;  1LV5 A;  3B6O A;  1BWF O;  2HHH K;  4E7J A;  5BRF A;  2BGG A;  4ID5 A;  2OCE A;  2QTD A;  2CH6 A;  3VMF B;  5AQK A;  5LMU K;  4J8F A;  5GAD P;  3DLB A;  2BAN A;  5AZI B;  4NO7 A;  3RMC A;  5FRO A;  3CCQ N;  3WT0 A;  4CEC A;  1WB9 A;  2RKI A;  3U9Z A;  1GOB A;  5KPZ A;  4BRQ A;  2Q36 A;  4A59 A;  4JLH A;  3CJ7 A;  4BRO A;  2A1R A;  4GW6 A;  2G8V A;  2P9U B;  3L3U A;  4JRP A;  4QS8 A;  2WBN A;  4OX9 K;  3JSM A;  2O8B B;  3KIO A;  4PKI A;  5C25 A;  1W7A A;  2YNG A;  1ZBS A;  1NKC A;  4K41 A;  3DLH A;  3VET A;  1U47 A;  4BC3 A;  2ZJP L;  1VQK N;  3OA9 A;  1KFS A;  4FWL A;  4DTJ A;  1DTT A;  2YNF A;  5AQS A;  3O4W A;  4B3S K;  1BUP A;  4IFV A;  2O4G A;  3L3V A;  3KLE A;  3OBW A;  2G8H A;  4JI7 K;  1JLB A;  1S6P A;  5ADX A;  1DLO A;  3QFU A;  1YTA A;  5HLF A;  4BVP A;  4WF9 L;  4EP5 A;  2P9K A;  2YKM A;  3K0S A;  2A40 A;  3TAQ A;  1GLB G;  4CGF A;  1W97 L;  4H4O A;  4FM1 A;  3SUN A;  3CQY A;  4DQS A;  1VQ9 N;  3DRP A;  2FBX A;  1S3X A;  3O3H A;  4G1Q A;  1EET A;  4DUY K;  3QNO A;  4FLU A;  2QW9 A;  2RPI A;  3LP1 A;  5KRS A;  3OS0 A;  1G15 A;  3CJC A;  2HHS A;  1Z26 A;  1LWE A;  3M8R A;  4GVE A;  1JLC A;  1ZXO A;  2JGU A;  2P9K B;  3TWH A;  4BR5 A;  2UUA K;  2Z1H A;  1A5V A;  2FXU A;  3VQD A;  2BDP A;  5F0X A;  1U6Z A;  4C8K A;  4KHP K;  3O4N A;  4BY9 C;  2W41 A;  2CH5 A;  4IG3 A;  4B1U B;  3LAK A;  4CJE A;  4JI0 K;  1FW6 A;  3MEG A;  4EHT A;  4CZI A;  2RE2 A;  4BRP A;  3KD1 E;  3NH2 A;  4DR4 K;  3RMA A;  5JVG L;  1C0U A;  1CXQ A;  3OYL A;  4OPK A;  4FLT A;  4BRF A;  3ZEU A;  1O1W A;  5HOO A;  4B1X B;  1JLG A;  3SAG A;  3L8B A;  1RT1 A;  3SQ1 A;  3EKS A;  4YY3 K;  4FOE A;  3DLK A;  4WYB A;  2ETJ A;  3LP2 A;  1OVQ A;  2ZQB A;  1U4B A;  5MLC Q;  3FFK B;  2ZF5 O;  4LSL A;  4CEF A;  4J2A A;  1RGI A;  3VTI A;  1Q7Y O;  4KHS A;  3C7N B;  1CZ9 A;  3ZX2 A;  3HOS A;  3I8D A;  1RT5 A;  4NCG A;  3CC4 N;  3FFI A;  1KSP A;  1SZ2 A;  3SZ2 A;  3L2V A;  1IBM K;  4IOC L;  1NWK A;  3VER A;  4FLX A;  3HOT A;  1CLQ A;  1ATR A;  3CPW M;  4E7I A;  1TAU A;  3QDK A;  1QQO A;  3WUH A;  3EY1 A;  3Q7B A;  1XI1 A;  3LDS A;  3ZX3 A;  1KAZ A;  2GUI A;  1XHX A;  1RT3 A;  1RBT A;  1ASU A;  2P5G A;  1NK0 A;  1VSE A;  3K5N A;  1D9F A;  1JLF A;  1P8Z A;  4FK4 A;  1RBU A;  3KK2 A;  4FPB A;  3VGK A;  3H3N O;  4CW7 B;  1SL0 A;  4B1Y B;  1YHQ N;  5B8H A;  4FW2 A;  2VG5 A;  3OW2 M;  4B9U A;  3A5M C;  3VF2 A;  1H1V A;  2YCH A;  3ZX0 A;  4Z4G A;  5JS2 A;  1NJI O;  4IDH A;  3ZSR A;  4CGH A;  1YIT N;  4JI2 K;  4EHU A;  4DSK A;  4Z4H A;  2XY7 A;  4DS5 A;  3THY A;  1BU6 O;  1Q86 O;  4FLY A;  1E4F T;  4M3X A;  4I9Q A;  4XH5 A;  4WQ5 A;  1HYS A;  5CZ2 A;  2W6K A;  1J6Z A;  1WAJ A;  4F9O A;  1R59 O;  4CFB A;  4X66 K;  1YXQ A;  2XY5 A;  1JL1 A;  4CVN E;  1TKX A;  1Z6R A;  3K5M A;  4DFM A;  4LH5 A;  4H03 B;  1LW0 A;  4CIF A;  4O5B A;  3DXK B;  3ZSZ A;  2ASM A;  5D3G A;  2RN2 A;  4HUE A;  2HNY A;  3VF6 A;  2P51 A;  3UKU A;  2E88 A;  4RW6 A;  3PO4 A;  3D2F A;  1J9A A;  3THY B;  2NRW A;  3ASM A;  4XH1 A;  4DTS A;  5C0Y A;  5CYM A;  3CJ9 A;  4HCB A;  5BPL A;  3RTV A;  1SAZ A;  3SCX A;  3O9S A;  3WQT A;  5CR4 A;  3DXM B;  4RW7 A;  4RWT A;  4CGG A;  3AAP A;  1YJW N;  4W5R A;  3OJS A;  1BOT O;  5AQN A;  2BE2 A;  3GL1 A;  3G6E N;  3UE5 A;  4CJK A;  3MCA B;  2XO7 A;  3KTQ A;  3CIP A;  5FPM A;  5BR8 K;  3DLE A;  2V7Y A;  5HRR A;  2ASO A;  4BRA A;  3D2F B;  5J1E A;  5AQF A;  3R9P A;  1KC8 O;  3CG7 A;  1BO5 O;  5GAG P;  3HO1 A;  2JLE A;  4YNQ A;  4FVM A;  4H0X B;  3TTF A;  1GLL O;  1BGX T;  1HNI A;  4FVU A;  1WUA A;  3HPH A;  4DV2 K;  2WOM A;  3KHY A;  2PYL A;  1D5A A;  4JHD B;  5AQU A;  4ELV A;  3WXL A;  3AY9 A;  4FLV A;  2D0O A;  2Q31 A;  3MX5 A;  4CJ7 A;  1WN7 A;  1RIL A;  3V1Q A;  2P9N B;  5KRT A;  4FO0 A;  4PY5 A;  3K2P A;  1VRT A;  2FF3 B;  4DR5 K;  3V81 A;  3KLF A;  4LF8 K;  4HHT A;  1TGO A;  1LWF A;  3P5J A;  2ZJQ L;  4F3T A;  2O8F A;  2G8I A;  4FWR A;  3AV9 A;  1VQ4 N;  3F5T A;  3DM2 A;  3O9T A;  4CER A;  1T7P A;  3HK2 A;  3I0S A;  2V52 B;  4GV6 A;  4OVL A;  1C1C A;  5ADX H;  4CF8 A;  3HSC A;  2QWM A;  4IDK A;  1X9W A;  5AQY A;  3V1O A;  4DTP A;  4ELU A;  4BDP A;  4JYA K;  2YI1 A;  4OPA A;  1MU2 A;  4JI6 K;  5J2N A;  1VSK A;  5F1X A;  2EHG A;  3ZET A;  3SAH A;  4PKH A;  3EE8 A;  2QI2 A;  3LP0 A;  5DMR A;  5C42 A;  4J2D A;  1BCO A;  4CZL A;  4EIA A;  4G9Z A;  1KCF A;  2E4L A;  4W5T A;  4E3S A;  1VQM N;  3FZK A;  1DTQ A;  1L3T A;  3FZF A;  3CCR N;  2HST A;  1RBV A;  4FJH A;  2F96 A;  3VTH A;  3F9M A;  3HTV A;  3C65 A;  4E1M A;  1RDB A;  3FR0 A;  1W2B M;  3NGZ A;  1KLM A;  5HRO A;  3BF1 A;  2VGM A;  2O8E A;  2EWS A;  4KHN A;  4JRQ A;  3SMS A;  1TYQ B;  3VES A;  3AVG A;  5IWA K;  3U3G A;  3TI0 A;  3QEW A;  3RR8 A;  1HX1 A;  3CYM A;  4K43 A;  1ASV A;  3WNG A;  1REV A;  1HMV A;  3ID8 A;  3JYT A;  3LWM A;  1NKB A;  2R7Y A;  1XWL A;  2FBV A;  2YNI A;  3PX4 A;  1QZ5 A;  4FWO A;  3E9O A;  2P9L A;  2YJF A;  1TL1 A;  1IBL K;  1C0G A;  2DY4 A;  3M6G A;  5JIC A;  3RR7 A;  4JV5 K;  1S1V A;  2CGK A;  2QWP A;  3A5N C;  1ASW A;  1WSI A;  3LDQ A;  3WEE A;  4E7H A;  2G8W A;  4KTQ A;  3O9Q A;  1VSI A;  4DU1 A;  2O8E B;  4Y1C A;  3TAF A;  1HPZ A;  3ZSX A;  1GOA A;  4O55 A;  4FJI A;  4BRI A;  1HNV A;  1HPM A;  4FLZ A;  4ZTJ A;  4K8X A;  3VQQ A;  1D8Y A;  2P5O A;  2HHX A;  1WLJ A;  3U4L A;  3PLA A;  3N4P A;  4MLH A;  5SWM A;  1NMD A;  4DKW A;  2HVH A;  1UA1 A;  3ID6 A;  1VSD A;  4CJS A;  2GEM A;  1LCU A;  3O8M A;  4CEB A;  2GBZ A;  2FLO A;  1NG9 A;  1NNE A;  1VQ5 N;  3AVN A;  1N36 K;  4DSF A;  5E41 A;  2X78 A;  3CJ1 A;  1NMN A;  4BAC A;  3LDL A;  3VGM A;  3O08 A;  4E7K A;  3IG1 A;  3V1R A;  3CJB A;  5M1O A;  4DMN A;  4CZM A;  4FWM A;  4LSN A;  4A57 A;  4QAG A;  1S9G A;  1N8R O;  1WSH A;  4Z4E A;  2OYQ A;  1BDG A;  1P90 A;  2VG7 A;  4B9L A;  4B9V A;  4Z4I A;  1JCE A;  3THW A;  5FPE A;  2VWK A;  4CHO A;  3AO3 A;  4CFC A;  3SMP A;  5CYQ A;  1RCH A;  3FGU A;  1N6Q A;  3PO5 A;  4KTW A;  1BG3 A;  3BEX A;  3I0R A;  1NGG A;  3D2E A;  1L3S A;  3L4I A;  4YOY A;  3MEE A;  3MK6 A;  4K42 A;  3NMU A;  4OJR A;  4UY8 O;  3C6U A;  5BPM A;  3PIO L;  3JAM O;  3CXC M;  2F8T A;  4AF1 A;  4DWI A;  4JKH A;  4M63 C;  3DI6 A;  1WSE A;  4B1W B;  3THW B;  1VQN N;  4I6M A;  2ZE2 A;  4W5O A;  1WSJ A;  2BUP A;  4FJM A;  1G99 A;  3AVH A;  1IJJ A;  1OVY A;  4JK9 A;  3HP6 A;  2PBD A;  4CJ3 A;  4IWV A;  4CJL A;  2HBM A;  4DFK A;  4KI4 A;  1MWK A;  3ULE B;  1TV6 A;  3TTC A;  5AQZ A;  3O6W A;  4ISG A;  4E1N A;  3VEZ A;  4I2P A;  3W3D A;  5BN9 A;  4KHU A;  4BR9 A;  1IKW A;  4JEP A;  1DKG D;  1U2V B;  4NCB A;  1Q9Y A;  4I6M B;  4FM2 A;  4GVM A;  4O44 A;  4E7L A;  3CC7 N;  4CEE A;  2NRV A;  3M8P A;  1ZBH A;  2DTU A;  3NGY A;  4CEO A;  3NFA A;  2IAJ A;  4OPJ A;  4N47 A;  2YHX A;  1X9S A;  1C1B A;  2D5R A;  4MFB A;  5KPR A;  3G71 N;  1HKG A;  3TAN A;  4CZF A;  2A1S A;  4IOA L;  4YOX A;  4O8U A;  3BZC A;  3VQ6 A;  3OY9 A;  4WQ5 C;  3DLL L;  2HHU A;  2ZD1 A;  3LDP A;  2DFF A;  3M3Z A;  3R1X A;  3O9U A;  3PX6 A;  4IXC A;  4AIL C;  3MN5 A;  1RFQ A;  1TK0 A;  3OYF A;  3T1H K;  2E2N A;  2CGJ A;  4M7Y A;  5I42 A;  4DV1 K;  4DV7 K;  2YNH A;  3A8Y A;  4CJP A;  2GEL A;  3DRS A;  3WXK A;  4XEI A;  2PY5 A;  1FJG K;  3LDN A;  5KI6 A;  4W5Q A;  2DPN A;  4CHQ A;  4JD2 A;  5AQJ A;  4WCE L;  3OYB A;  4JKC A;  2IGI A;  3QEX A;  4KB1 A;  4DV3 K;  1ZYQ A;  3K57 A;  4BG9 A;  5FRM A;  4F3O A;  5CZ1 A;  3W0L A;  3K59 A;  4FJK A;  4RG8 A;  4CD1 A;  1NGF A;  3PY8 A;  1NGD A;  1WSF A;  3PIP L;  2XY8 A;  1GLE G;  2PZS A;  1B9F A;  2E2Q A;  3QLH A;  1T3V A;  3CET A;  4JD2 B;  3OBY A;  3E9P A;  4KFB A;  4KH5 A;  2ZGY A;  3FLC O;  4CZE A;  1VQ7 N;  4YFU A;  3M8S A;  4GY2 B;  3GE1 A;  1EXQ A;  1CZA N;  3WNF A;  3HVT A;  3LAL A;  4JI4 K;  5KPT A;  3P4I A;  2AP1 A;  3H1V X;  1SS6 A;  4YOV A;  4WFN L;  1LAW A;  2AJQ A;  3SV3 A;  4RCH A;  3VQ9 A;  4HTL A;  4FJN A;  1B92 A;  5BRE A;  4CF0 A;  4CZJ A;  4YHH K;  4CJ4 A;  3PX0 A;  2JWK A;  3AA3 A;  4OKK A;  3KD5 E;  1RT7 A;  5CY4 A;  3IDH A;  3HM9 A;  1S72 N;  1BIS A;  1DGK N;  3LP3 A;  3AVM A;  1NU0 A;  3EKU A;  1QQN A;  3G4S N;  2IIR A;  2VWB A;  1GLJ O;  4XIU A;  3NF7 A;  4CJT A;  3KZB A;  3V9X A;  4QCL A;  3EO3 A;  4DQI A;  3VQ8 A;  1BQM A;  1KAY A;  1J54 A;  1BI4 A;  2QWL A;  3KK3 A;  3OS2 A;  1NGB A;  4B3M K;  1EKE A;  3FZM A;  3CCV N;  4JI1 K;  4CBU A;  4KHQ A;  4CD3 A;  4ZHR A;  3NF8 A;  3VEV A;  3A5L C;  4MQ3 A;  4N5S A;  2V51 B;  4K25 A;  4JNE A;  4B9Q A;  2G8F A;  2Z1G A;  4Z4F A;  4E19 A;  5BPN A;  4OO1 J;  2A5X A;  4OKJ A;  2IDO A;  2KTQ A;  2F9T A;  4FWP A;  4Y0W A;  3C6A A;  3ENO A;  5AQV A;  1MDU B;  4ICL A;  3RMD A;  3ZEU B;  3EL2 A;  4W5N A;  2YHW A;  1S1W A;  4FSV A;  1NM1 A;  3CCJ N;  4JI8 K;  2YHB A;  3F9K A;  5GAE P;  3RVC A;  3NH1 A;  3SV4 A;  1N32 K;  2GWK A;  1D9D A;  3O9R A;  4JI5 K;  1Q8I A;  3AVF A;  3M1F A;  1IG8 A;  3I33 A;  4FJ9 A;  1FKO A;  4AHV A;  2HHT A;  4H8K A;  1DEJ A;  4Z0U A;  4FW1 A;  4IFY A;  2XY6 A;  1N5Y A;  4BVO A;  4KI6 A;  1WNS A;  1YJ9 N;  1KXP A;  1KFD A;  4DUZ K;  5C15 A;  1YAG A;  3HL8 A;  4CJF A;  3HPG A;  4CFD A;  2H3G X;  4O4G A;  2EX3 A;  5E84 A;  3ENH A;  1Y97 A;  4BRG A;  2FF6 A;  4DLG A;  1YUW A;  3OYG A;  2UXC K;  1HNX K;  1SKR A;  2NLX A;  3L0Q A;  4ELT A;  2NNW A;  1KQS M;  3AA2 A;  2OA8 A;  1TVR A;  3WNE A;  4TSX A;  4DV6 K;  3NBP A;  1BCM A;  1E3M A;  1HRH A;  4DTX A;  3AVL A;  3J80 O;  1S1T A;  3ZSY A;  4BRC A;  3VQ7 A;  1MWM A;  2KLA A;  1NBW A;  4RW4 A;  2W40 A;  2YKN A;  3J8A A;  1KAX A;  1W9H A;  1RBR A;  4CI6 A;  4BR2 A;  3AVA A;  3AAR A;  5TKW A;  3DLR A;  2QM1 A;  1XC3 A;  2YHY A;  4JS4 A;  1F21 A;  1ZC6 A;  3BDP A;  3O3F A;  4DF4 A;  5I9E B;  1I3A A;  4HUF A;  3VA0 A;  2P9P A;  1J5O A;  3AVJ A;  2ZM6 K;  1Z05 A;  1XUP O;  2VWJ A;  1VK0 A;  3MXJ A;  4KKO A;  4DTU A;  3T69 A;  1LW2 A;  1WBB A;  4JKA A;  3QBW A;  3T1Y K;  4CZG A;  4WFA L;  3TAM A;  4H0V B;  5HRP A;  3K5O A;  5JS1 A;  2Q97 A;  3UKU B;  1C0F A;  1QVG M;  2A41 A;  4HUG A;  4ILJ A;  2QWQ A;  1RTD A;  4O8K A;  3VQA A;  3UIQ A;  3KK7 A;  4N76 A;  3AO5 A;  1VSF A;  2IVP A;  1JLQ A;  4CHZ A;  4DSJ A;  3TSP A;  2HMI A;  5AQI A;  4DU3 A;  1D4X A;  2UYT A;  4DTN A;  1HQE A;  1IV0 A;  1Q18 A;  3VEY A;  2HB5 A;  1BQN A;  4E1J A;  3ITH A;  5LJW A;  2I7N A;  1SQK A;  4IEE A;  3CM5 A;  4CEZ A;  4DS4 A;  1JCF A;  3MN6 A;  4Q0B A;  2QWO A;  1R0A A;  4Q5V A;  3CCL N;  4M3Z A;  1BA1 A;  5DM7 L;  3HJF A;  4B8A B;  4J2B A;  1VSL A;  3AA5 X;  4MLE A;  3ZYY X;  4A61 A;  3WXJ A;  4RTF D;  3IAY A;  5LJV A;  4DQQ A;  4M3T A;  1UOC A;  3VQP A;  4DV0 K;  3NAE A;  3RWU A;  3B6P A;  1WOQ A;  4IBN A;  3NGI A;  3CER A;  2NUB A;  4XH4 A;  4NCA A;  4U7B A;  3RRG A;  1JCG A;  2Z1I A;  4PKG A;  3SLC A;  1RT2 A;  3T3F A;  2KZZ A;  1OH5 A;  4JKD A;  3T7Z A;  3CMA N;  5AQQ A;  5C12 A;  2O8F B;  4X64 K;  3KKS A;  3CQX A;  5EXW A;  1RTI A;  3BZK A;  1RDA A;  4H0O A;  3WXI A;  4M42 A;  4BC2 A;  3G25 A;  1K8A O;  3V9U A;  1X1P A;  1LAV A;  1NK6 A;  4BRE A;  4IEI A;  1J5E K;  4IZ9 A;  1VSJ A;  4WE1 A;  2QK9 A;  1IKY A;  1YF5 L;  3VQC A;  3MAQ A;  3OYD A;  4UQG A;  1XMO K;  1Q9X A;  1UA0 A;  1ATS A;  2KFN A;  4GV9 A;  2NRX A;  4CZK A;  3RRH A;  5H1S Q;  4DTR A;  3TAE A;  3THX A;  4L8R B;  3ZET B;  3H6E A;  4GKK K;  1HJR A;  3TU5 A;  4N56 A;  2FBY A;  1Z25 A;  2E20 A;  3O1W A;  3QIC A;  2E5L K;  4DHY A;  4FK0 A;  5FPD A;  3VEO A;  5JVH L;  4FM0 A;  4EP4 A;  5AQW A;  4B9M A;  3MEC A;  4HTU A;  5F2R A;  3CD6 N;  2GX9 A;  3CI5 A;  5AQT A;  4CK3 A;  1HYZ A;  4HVJ A;  4KAZ A;  3H45 C;  1NGC A;  4OLB A;  4LF5 K;  2FC0 A;  3AVI A;  2YJE A;  1ZBI A;  4KHY A;  3THX B;  3LZJ A;  3BF3 A;  4CIG A;  4BQZ A;  4C8M A;  2KFZ A;  3CC2 N;  4NB4 A;  3GG4 A;  4KH4 A;  3UKR A;  3TAP A;  1ILY A;  3WXM B;  1C6V A;  4HCC A;  2P9I A;  4ZTF A;  4F4K A;  3S41 A;  2E6L A;  3CCM N;  3M8Q A;  4LF4 K;  5SZT A;  3DJC A;  4HWI A;  5JLF A;  4GV3 A;  2D0B A;  3J7A P;  5AFU A;  4IJA A;  1QQC A;  1RDD A;  2ATQ A;  2KZM A;  4JN4 A;  4DQ8 A;  2P9L B;  3H3O B;  4FJ7 A;  3L4Q A;  5EX5 A;  2D0P A;  1J53 A;  1YTU A;  3O1B A;  4I7F A;  3WEE B;  5HRN A;  3CM6 A;  1RTJ A;  3E66 A;  3IUC A;  3UKR B;  1S9E A;  3TSU A;  1TL3 A;  3HPO A;  3BGR A;  3HI0 A;  3J81 O;  3S3N A;  2P9I B;  5M1P A;  4CF1 A;  2ZGZ A;  1M1K O;  2Q0U A;  4KB0 A;  3QES A;  3TPQ A;  4AQY K;  5AQL A;  1XNR K;  3V9S A;  3NE6 A;  1SUQ A;  2OTL N;  4YOW A;  1IBK K;  3WNH A;  1HKB A;  1QVF M;  3QEP A;  3P38 A;  3OS1 A;  2GWJ A;  3SQ2 A;  3C6T A;  3MDQ A;  3OYC A;  1JXE A;  1EWR A;  3L2R A;  4H4M A;  4CF9 A;  2IS3 A;  4DFP A;  3P1G A;  1HUX A;  2HVI A;  5KTQ A;  1T03 A;  5FPN A;  4KRE A;  3RSE A;  2NZT A;  2W42 A;  3CFR A;  2E1Z A;  2HF4 A;  1N33 K;  2QXF A;  3KVG A;  3MMV A;  1NK8 A;  1EWQ A;  3TSQ A;  4CEQ A;  3ZSV A;  3J7Y P;  4M3U A;  4JKE A;  5DM6 L;  4AH9 A;  4JS5 A;  2KW4 A;  2O8C A;  4YOT A;  5AQX A;  1NKE A;  1VQ8 N;  3IRX A;  4FL9 A;  1KD1 O;  1TKT A;  3GOI A;  3CFP A;  2HHW A;  1NK5 A;  3C6H A;  1C0T A;  2HF3 A;  4CGI A;  2IVN A;  3SPZ A;  3K58 A;  4C23 A;  4ILH A;  2OZM A;  3ENB A;  4GMJ B;  3NH0 A;  4LH4 A;  4BRD A;  4R79 A;  4QS7 A;  2DFE A;  1XMQ K;  3A0I X;  3SI6 A;  4B9N A;  1JJ2 M;  4DLE A;  3PSI A;  4RW9 A;  5AR0 A;  3D2E B;  1TK5 A;  3EZ5 A;  1FK9 A;  4DSI A;  3O80 A;  3C95 A;  4CHP A;  2O8C B;  4H5W A;  4IFE A;  2D4W A;  4B08 A;  2OTJ N;  3L6Q A;  4DSL A;  3SBG A;  3QEV A;  3DOL A;  3FE1 A;  1S1U A;  3AVC A;  3EEQ A;  1JKH A;  1QSL A;  5EOY A;  3HST B;  3VF4 A;  1NK7 A;  1E4G T;  3SK3 A;  3KLG A;  3SQ0 A;  1C1A A;  5AQR A;  2G8K A;  3DAW A;  4FPA A;  1EP4 A;  3FZH A;  5FRN A;  1KVB A;  4A62 A;  1KTQ A;  3TAR A;  4KO0 A;  2CGL A;  4DTO A;  4DCH A;  3SJJ A;  4FWK A;  3ALY A;  4K0K K;  4NXN K;  4IOX A;  3JS6 A;  3K9K A;  3OJU A;  1IO2 A;  1S5J A;  3MN7 A;  1NJY A;  4CCH A;  3R3L A;  3QET A;  4NXM K;  1A5X A;  1QHT A;  4LFC K;  2E2P A;  2HBL A;  4H0P A;  3MXI A;  1NK9 A;  3DWL A;  4BR7 A;  1Q81 O;  4ISE A;  3AO2 A;  4AHT A;  2E1Y A;  3CQ8 A;  3LL3 A;  5GIO A;  1DT9 A;  4H0Y B;  2VYP A;  5GIN A;  4R5P A;  2UUC K;  2XHB A;  4BE2 A;  3C0B A;  5AQH A;  1V4T A;  4WFB L;  3SUQ A;  1O13 A;  3O3G A;  5HRS A;  3HM8 A;  2P9U A;  2WUS A;  2KKZ A;  3D45 A;  2O8B A;  4DR7 K;  3VQ4 A;  1A5W A;  2O8D A;  5HL7 L;  4BRH A;  3IMX A;  2KHO A;  4H5N A;  4Z94 A;  5A2Q O;  1QSY A;  4FJ5 A;  2HW3 A;  4GKJ K;  2HBJ A;  1T44 A;  1NGE A;  3FZL A;  3NF9 A;  1HLU A;  4M3Y A;  1T6C A;  4KRF A;  4F2R A;  4BG8 A;  2XRI A;  2Z1J A;  4CED A;  4BDZ A;  4BWJ A;  3CPE A;  3U6F A;  3AAQ A;  3AGR A;  2X6N A;  3ZSQ A;  1LOT B;  4IKF A;  4LC9 B;  1K73 O;  4V19 S;  3QBX A;  3R8E A;  3GBT A;  5FLX O;  2FBT A;  1VQP N;  3K9J A;  3QFP A;  4M45 A;  2O8D B;  2QKB A;  2JWL A;  1BIU A;  3VEW A;  4OGE A;  1JL2 A;  5BR9 A;  1ESV A;  5EVZ A;  4A2A A;  4CJR A;  3TAB A;  3QIP A;  4J2E A;  3VQE A;  3QIN A;  1KVC A;  4MO5 A;  3G10 A;  2OPS A;  2LSN A;  4M7X A;  1EQY A;  2QA4 N;  3THV A;  3NF6 A;  4C1N K;  3VEX A;  4KH6 A;  4PUO A;  5BRH A;  4B3T K;  5LMN K;  4KPY A;  4CBW A;  4BE0 A;  3KLI A;  5LL6 Z;  1Y64 A;  3EE9 A;  1ITG A;  1TUY A;  2X74 A;  1M90 O;  4ISF A;  4FLW A;  1QZ6 A;  4A2B A;  3CCS N;  1SKS A;  4EFH A;  4BRM A;  3V9Z A;  4B3O A;  3MWP A;  4GNI A;  3EZW A;  3L2Q A;  2GV9 A;  3G0Z A;  2G8U A;  1L5U A;  4CHY A;  2F4V K;  1FXX A;  3EYZ A;  3O5B A;  1KLN A;  2FSK A;  4PL8 A;  2PFU A;  3M5R A;  2OPQ A;  3ZT3 A;  4JI3 K;  4LF7 K;  4AHR A;  4AM7 A;  2P1J A;  2D0A A;  5AFU H;  4FXD A;  5BN8 A;  2OPR A;  3MN9 A;  3BP8 A;  2Q3S A;  4KTZ A;  2HBK A;  2UUB K;  4DQP A;  2NRT A;  2WTU A;  3V9W A;  3OHR A;  3ISN C;  4C1N I;  1IKX A;  1KVA A;  3CJA A;  1ZBU A;  1NLV A;  3B8A X;  1YVU A;  5JMV A;  3S9H A;  1T6D A;  2PYJ A;  3C7N A;  1RTH A;  2D1K A;  4CF2 A;  3R6M A;  5E26 A;  4F2S A;  1OH6 A;  1N34 K;  1BHL A;  4KHW A;  2VQE K;  3DMJ A;  4AM6 A;  1SV5 A;  1CZB A;  4DFJ A;  1UWB A;  1X9J A;  1B9D A;  1OH8 A;  3KKR A;  3K5L A;  4CIE A;  3VN5 A;  5J2M A;  3IS9 A;  1BI4 B;  4EAH D;  2YV0 X;  3LWL A;  4IJN A;  1OKJ A;  2V7Z A;  2ZWH A;  1X9M A;  4FJX A;  1OH7 A;  2F8S A;  3S3M A;  4DG1 A;  4DF8 A;  4FJJ A;  4E0D A;  4BRL A;  4JK8 A;  1LWC A;  3PV8 A;  4M3W A;  4A5B A;  2OPP A;  4H5V A;  4DU4 A;  4ILG B;  3CCU N;  4O0I A;  4BWM A;  1U49 A;  1U04 A;  4YOR A;  4LD0 A;  2E8A A;  4DB3 A;  4QOZ B;  5C24 A;  1X3M A;  3VEN A;  4DR1 K;  1L3V A;  3CHW A;  4PA1 A;  4DR6 K;  3ZT4 A;  2HND A;  5C2D A;  4AHU A;  3SJH A;  4ID1 A;  4EZ6 A;  3QO9 A;  1RT6 A;  4BRN A;  4CZH A;  3HYF A;  1MA9 B;  1GLC G;  4Z4C A;  3PUF A;  3BY5 A;  4FWS A;  2ASP A;  4DSE A;  4OLA A;  4FYD A;  4DQR A;  3QNN A;  3IFR A;  4PQU A;  2ITM A;  2P9S A;  3T1A A;  4BGB A;  3DXK A;  3ZCM A;  3I56 N;  4BR4 A;  2VGN A;  2NRZ A;  1K8K A;  3SNN A;  1NJZ A;  3MED A;  4E89 A;  4N41 A;  3U3Y A;  3A5O C;  1NGJ A;  4QS9 A;  3VGL A;  4I2Q A;  4Y1D A;  1U48 A;  4FCY A;  4OKE A;  3DXM A;  4BE1 A;  3OYH A;  3E01 A;  3OYK A;  4EZ9 A;  3TTD A;  3ZSW A;  4JKF A;  5EY4 A;  4FZY A;  2DFH A;  2B4J A;  1XHZ A;  2P9S B;  4BC4 A;  4B1V A;  3NDK A;  1K8K B;  4MDA A;  4PHT X;  3MCP A;  5J2P A;  1S6Q A;  4FOI A;  4B9S A;  4YDU C;  2Q0R A;  4DTM A;  2ITG A;  4F8R A;  3MX2 A;  3KWI A;  4WQ4 C;  4FK2 A;  5C10 A;  4A5A A;  1HKC A;  5KQD A;  4BC5 A;  4X62 K;  4KV8 A;  3QML A;  3HZ6 A;  1FKP A;  2P9P B;  4BGA A;  1ZBF A;  4JHD A;  4CES A;  3P31 A;  3AVB A;  3NCI A;  3NVK A;  1ZBL A;  1VRU A;  1NJX A;  4I9L A;  2P9N A;  4O5F A;  2Y1J A;  1YI2 N;  2UXB K;  1QHA A;  2E6M A;  1XNQ K;  3ZLJ A;  1C0M A;  2IC3 A;  4CHN A;  4JKB A;  4B8C A;  1NJW A;  4BDY A;  3MXM A;  5CHI A;  5AQO A;  5BRD A;  5M1F A;  4L3Q A;  4NYF A;  3OYI A;  3LPT A;  1VSM A;  5HBM A;  3V4I A;  3SUP A;  2AA4 A;  1U45 A;  1VAZ A;  1IH7 A;  3U8X A;  3J7Z O;  3KJV A;  2FSJ A;  3VPZ A;  1VQL N;  2GUP A;  2WON A;  4YOU A;  5T7B A;  1BIZ A;  1TUU A;  2GTD A;  5M1N A;  1WSG A;  4NYN A;  5EU7 A;  2F7T A;  5AQP A;  4FJL A;  2QWN A;  5KQ8 A;  4FWQ A;  4CGJ A;  4NLB A;  2YX6 A;  4CJV A;  3V6D A;  3SAF A;  3I8B A;  1BL3 A;  5M1Q A;  1GLA G;  1K6Y A;  3JXU A;  3QB0 A;  1VQO N;  1S22 A;  3UB5 A;  3AGK A;  2HOE A;  1TKD A;  2BTF A;  4MO4 A;  3QIO A;  2QWR A;  3QEI A;  3P39 A;  1I94 K;  4RW8 A;  2F9W A;  3OVN A;  2A3Z A;  2UXD K;  3C94 A;  1HNW K;  4DV4 K;  3SYZ A;  1RDW X;  3L2W A;  4CBX A;  3I55 N;  5GAH P;  3F73 A;  1TYQ A;  1NK4 A;  4FWN A;  2A6A A;  4B3R K;  1T8E A;  3QER A;  1RDC A;  4H0T B;  3HVR A;  4X65 K;  3RMB A;  1QE1 A;  3D0P A;  5HP1 A;  2PAV A;  3SPY A;  2D0C A;  1SKW A;  3CFO A;  2RHK A;  3T19 A;  5JLH A;  3ATV A;  5C2F A;  1IKV A;  2HNZ A;  5AZJ A;  1HJO A;  4AHC A;  4PL7 A;  3BUZ B;  2I5J A;  1TK8 A;  1GLD G;  1HR0 K;  1K9M O;  3VOV A;  3H08 A;  1YJN N;  1I39 A;  3TR8 A;  4BR0 A;  3U9D A;  3AVK A;  4MDB A;  4B1Z A;  3ATU A;  1NOY A;  1JLA A;  3ZSO A;  2Q1N A;  2HMP A;  4CK2 A;  4JAX A;  5ELZ A;  1X3N A;  4FZZ A;  4C8L A;  4CE9 A;  1XC9 A;  1GOC A;  2NRH A;  1HQU A;  3HT3 A;  1NGH A;  1EO1 A;  3D6R A;  4M41 A;  5DK5 A;  4CJQ A;  4NLC A;  1T05 A;  2VG6 A;  1NOZ A;  4CK1 A;  2OAN A;  3OYN A;  4IO8 A;  2B6A A;  1VSH A;  5AZJ B;  3E9L A;  1CXU A;  3LM9 A;  1ATN A;  4OGC A;  5CE3 A;  5M1K A;  4KBO A;  3IKM A;  3LDO A;  4DV5 K;  2OZS A;  5GIP A;  1EX4 A;  4DR2 K;  2J4R A;  2B5J A;  3AA4 A;  2BH1 A;  1VQ6 N;  4LF9 K;  3ULD A;  2QKK A;  5FDL A;  1L3U A;  2QEX N;  3SUO A;  3LM2 A;  1TAQ A;  4FZX C;  4K8Z A;  5I3U A;  3H46 O;  2IOC A;  5KGW A;  1WBD A;  1HNZ K;  5TKY A;  4C8O A;  3Q7C A;  5IT9 O;  4CEA A;  2Q2R A;  3H1Q A;  3HRG A;  1KRP A;  3SBT A;  1RBS A;  3OYE A;  1RT4 A;  3LAM A;  2E2O A;  4YDU A;  3OYA A;  1YIJ N;  2QXL A;  1GLF O;  2UU9 K;  3ZT0 A;  5J2Q A;  2ZJR L;  2HHQ A;  1IG9 A;  4WQ4 A;  4C8N A;  3VQB A;  3D7E O;  1QSS A;  3P83 D;  3KK1 A;  3HBT A;  3DRR A;  1NGA A;  3SQ4 A;  1JLE A;  5LY3 A;  3DYA A;  1V4S A;  3RSE B;  1TKZ A;  1QQM A;  4H5T A;  3ULE A;  1QS4 A;  3AO4 A;  3DLG A;  4M3R A;  3S3O A;  3ZT1 A;  4JK7 A;  2WFB A;  4FJ8 A;  4IO9 L;  1U2V A;  5AQG A; 
#chains in the Genus database with same CATH homology
 3C65 A;  3EE9 A;  1MWM A;  1Q82 O;  2KLA A;  5AQM A;  1YVN A;  1NBW A;  1TUY A;  1M90 O;  2W40 A;  4ISF A;  1QZ6 A;  4A2B A;  3CCS N;  3FR0 A;  4EFH A;  3J8A A;  1W2B M;  2WC9 A;  4BRM A;  1KAX A;  1NGI A;  3MWP A;  3BF1 A;  2VGM A;  3NVM A;  4BR2 A;  4CI6 A;  3AAR A;  2EWS A;  3EZW A;  4GNI A;  3F2K A;  3E1Y A;  5TKW A;  2QM1 A;  3CF5 L;  1XC3 A;  2IVO A;  2YHY A;  2NRR A;  3O5B A;  1ZC6 A;  1TYQ B;  3SMS A;  4BRK A;  4JKG A;  2FSK A;  2A42 A;  1BA0 A;  2PFU A;  4PL8 A;  3VES A;  2FSN A;  3N4Q A;  5I9E B;  3M5R A;  1HX1 A;  2P9P A;  4K43 A;  3ID8 A;  1Z05 A;  4U67 L;  4AM7 A;  3WQU A;  1XUP O;  3GDQ A;  1QZ5 A;  4FWO A;  3E9O A;  2P9L A;  3KWG A;  5AFU H;  2YJF A;  3T69 A;  4BQL A;  5BN8 A;  3MN9 A;  3BP8 A;  1C0G A;  2HBK A;  3M6G A;  5JIC A;  4JKA A;  2NRT A;  3QBW A;  2CGK A;  4CZG A;  4WFA L;  2QWP A;  3OHR A;  3A5N C;  4H0V B;  3LDQ A;  3WEE A;  4C1N I;  3CJA A;  3O9Q A;  2VCP A;  2Q97 A;  1NLV A;  3B8A X;  5JMV A;  3UKU B;  1C0F A;  1T6D A;  1XQS C;  1QVG M;  2A41 A;  3C7N A;  2D1K A;  3R6M A;  5E26 A;  3CME N;  4JKG B;  5AZI A;  4ILJ A;  2QWQ A;  3EN9 A;  4O8K A;  4BRI A;  2I7P A;  4AM6 A;  3KK7 A;  1HPM A;  4H5R A;  2IVP A;  1X9J A;  3TSP A;  3U4L A;  3PLA A;  5AQI A;  4OPH A;  1D4X A;  4EAH D;  3CCE N;  2UYT A;  3N4P A;  4MLH A;  1NMD A;  1Q18 A;  3VEY A;  3MWT A;  1RDU A;  4IJN A;  4DKW A;  1BWF O;  1OKJ A;  4E1J A;  2V7Z A;  5BRF A;  5LJW A;  2I7N A;  1SQK A;  3ID6 A;  2QTD A;  4IEE A;  2CH6 A;  2ZWH A;  2GEM A;  3VMF B;  1JCF A;  1LCU A;  3MN6 A;  3O8M A;  2QWO A;  5AQK A;  2FLO A;  3CCL N;  4J8F A;  1VQ5 N;  1BA1 A;  4BRL A;  4JK8 A;  5DM7 L;  5GAD P;  5AZI B;  3CJ1 A;  4A5B A;  4NO7 A;  3LDL A;  3VGM A;  3O08 A;  4H5V A;  4ILG B;  3CCU N;  3CCQ N;  4MLE A;  3ZYY X;  3WT0 A;  4A61 A;  3U9Z A;  3WXJ A;  4RTF D;  3CJB A;  5M1O A;  4YOR A;  4CZM A;  5LJV A;  4FWM A;  5KPZ A;  4BRQ A;  2Q36 A;  4A59 A;  2E8A A;  4A57 A;  3CJ7 A;  4BRO A;  4DB3 A;  1N8R O;  1BDG A;  1P90 A;  1WOQ A;  2P9U B;  1X3M A;  4QS8 A;  3CER A;  3VEN A;  1JCE A;  2WBN A;  5FPE A;  4XH4 A;  4U7B A;  3CHW A;  4PKI A;  1JCG A;  4PKG A;  3SLC A;  5C2D A;  1ZBS A;  3SJH A;  4K41 A;  4JKD A;  3VET A;  3SMP A;  3T7Z A;  4BC3 A;  2ZJP L;  1VQK N;  3FGU A;  3CMA N;  5AQQ A;  5C12 A;  3OA9 A;  4FWL A;  1BG3 A;  3BEX A;  4BRN A;  3CQX A;  1NGG A;  5EXW A;  4H0O A;  3D2E A;  4CZH A;  5AQS A;  1MA9 B;  1GLC G;  3WXI A;  4BC2 A;  3G25 A;  3O4W A;  1BUP A;  1K8A O;  4FWS A;  3L4I A;  4YOY A;  4K42 A;  3MK6 A;  4IEI A;  2ASP A;  4BRE A;  3NMU A;  3OBW A;  4IZ9 A;  4UY8 O;  3IFR A;  5BPM A;  1YF5 L;  5ADX A;  2ITM A;  3PIO L;  3QFU A;  4BVP A;  4WF9 L;  2P9S A;  3CXC M;  2P9K A;  4BGB A;  3DXK A;  4AF1 A;  3I56 N;  4BR4 A;  2VGN A;  2NRZ A;  4JKH A;  1ATS A;  1K8K A;  2A40 A;  4M63 C;  4B1W B;  1GLB G;  1VQN N;  1W97 L;  4GV9 A;  2NRX A;  4I6M A;  4CZK A;  5H1S Q;  3CQY A;  3A5O C;  2BUP A;  3ZET B;  1NGJ A;  1G99 A;  1VQ9 N;  3H6E A;  1IJJ A;  1OVY A;  4JK9 A;  4QS9 A;  3VGL A;  3TU5 A;  1S3X A;  2PBD A;  2E20 A;  3O1W A;  3QIC A;  4IWV A;  4DHY A;  3DXM A;  5FPD A;  2HBM A;  2QW9 A;  3VEO A;  5JVH L;  1MWK A;  3ULE B;  3CJC A;  3TTD A;  4JKF A;  5AQW A;  4GVE A;  3TTC A;  5AQZ A;  5F2R A;  3CD6 N;  2GX9 A;  5EY4 A;  3CI5 A;  3O6W A;  4ISG A;  2OTL N;  5AQT A;  1ZXO A;  3VEZ A;  3W3D A;  2P9S B;  5BN9 A;  2P9K B;  4BC4 A;  3H45 C;  1NGC A;  4BR9 A;  4BR5 A;  1YHQ N;  4B1V A;  4JEP A;  1DKG D;  1K8K B;  1U2V B;  4MDA A;  4PHT X;  2FXU A;  3MCP A;  2YJE A;  4I6M B;  5F0X A;  1U6Z A;  4FOI A;  4YDU C;  2Q0R A;  3CC7 N;  3BF3 A;  2NRV A;  4BQZ A;  3MX2 A;  3KWI A;  4NB4 A;  3CC2 N;  4BY9 C;  2W41 A;  2CH5 A;  3GG4 A;  4KH4 A;  3UKR A;  4B1U B;  3WXM B;  4WQ4 C;  1ILY A;  5C10 A;  4A5A A;  1HKC A;  4EHT A;  5KQD A;  2YHX A;  4BC5 A;  4CZI A;  2RE2 A;  5KPR A;  4BRP A;  2P9I A;  1HKG A;  3G71 N;  3QML A;  3S41 A;  4CZF A;  5JVG L;  3HZ6 A;  3CCM N;  4IOA L;  4YOX A;  4O8U A;  2P9P B;  4BGA A;  3DJC A;  4HWI A;  4JHD A;  3P31 A;  5JLF A;  4BRF A;  4GV3 A;  3ZEU A;  5HOO A;  3NVK A;  4B1X B;  3SAG A;  4WQ5 C;  3DLL L;  5AFU A;  4IJA A;  3LDP A;  2P9N A;  4O5F A;  3M3Z A;  3R1X A;  3EKS A;  4JN4 A;  2P9L B;  4DQ8 A;  3H3O B;  3O9U A;  1YI2 N;  3L4Q A;  4FOE A;  4IXC A;  1QHA A;  5EX5 A;  4WYB A;  3MN5 A;  2D0P A;  1RFQ A;  3O1B A;  3WEE B;  5MLC Q;  2E2N A;  3FFK B;  4JKB A;  2CGJ A;  4M7Y A;  2ZF5 O;  3E66 A;  3IUC A;  3UKR B;  3A8Y A;  2GEL A;  3TSU A;  3WXK A;  5CHI A;  1RGI A;  3VTI A;  4XEI A;  1Q7Y O;  5AQO A;  3C7N B;  3HI0 A;  3ZX2 A;  4L3Q A;  5BRD A;  5M1F A;  3HOS A;  2P9I B;  3LDN A;  5M1P A;  2ZGZ A;  2DPN A;  3CC4 N;  1M1K O;  2Q0U A;  4JD2 A;  5AQJ A;  4WCE L;  3TPQ A;  1SZ2 A;  2AA4 A;  5AQL A;  1VAZ A;  3U8X A;  4YOW A;  3J7Z O;  1NWK A;  3VER A;  1HKB A;  2FSJ A;  3HOT A;  3VPZ A;  4IOC L;  4JKC A;  1QVF M;  1ATR A;  3CPW M;  3P38 A;  1VQL N;  2GUP A;  4YOU A;  1TUU A;  2GWJ A;  2GTD A;  3QDK A;  1QQO A;  3WUH A;  5M1N A;  3Q7B A;  4BG9 A;  3MDQ A;  3ZX3 A;  3W0L A;  1KAZ A;  2F7T A;  5AQP A;  1HUX A;  4CD1 A;  1NGF A;  2QWN A;  5FPN A;  3RSE A;  2NZT A;  5KQ8 A;  4FWQ A;  2E1Z A;  1NGD A;  3PIP L;  2HF4 A;  1GLE G;  4NLB A;  2YX6 A;  1P8Z A;  2E2Q A;  3KVG A;  3MMV A;  3SAF A;  3I8B A;  3TSQ A;  4FPB A;  3VGK A;  3H3N O;  1T3V A;  3CET A;  4B1Y B;  4JKE A;  5M1Q A;  1GLA G;  3JXU A;  5DM6 L;  3QB0 A;  4JD2 B;  3OBY A;  1S22 A;  3E9P A;  3UB5 A;  3AGK A;  5B8H A;  2HOE A;  4KH5 A;  4YOT A;  5AQX A;  1VQ8 N;  4FL9 A;  2ZGY A;  3FLC O;  2BTF A;  4MO4 A;  1KD1 O;  3OW2 M;  3GOI A;  3A5M C;  4CZE A;  2QWR A;  3VF2 A;  1H1V A;  3P39 A;  2YCH A;  3C6H A;  2F9W A;  2HF3 A;  3ZX0 A;  2IVN A;  1NJI O;  1VQ7 N;  2A3Z A;  4IDH A;  4C23 A;  4ILH A;  4GY2 B;  3ENB A;  3GE1 A;  4BRD A;  4R79 A;  1YIT N;  1CZA N;  1RDW X;  4QS7 A;  4CBX A;  4EHU A;  3I55 N;  5GAH P;  5KPT A;  3P4I A;  1BU6 O;  1Q86 O;  2AP1 A;  1TYQ A;  3H1V X;  1SS6 A;  4YOV A;  1E4F T;  3A0I X;  4FWN A;  4WFN L;  4XH5 A;  4WQ5 A;  2A6A A;  1JJ2 M;  4RCH A;  4H0T B;  1J6Z A;  4HTL A;  3D2E B;  5AR0 A;  4F9O A;  5BRE A;  4CZJ A;  1R59 O;  3O80 A;  1YXQ A;  4H5W A;  4IFE A;  1Z6R A;  2JWK A;  2D4W A;  2PAV A;  3IDH A;  1S72 N;  2OTJ N;  2RHK A;  3L6Q A;  4H03 B;  3DXK B;  3SBG A;  5JLH A;  2ASM A;  1DGK N;  3ATV A;  3FE1 A;  3VF6 A;  3UKU A;  2E88 A;  5EOY A;  5C2F A;  3VF4 A;  3D2F A;  1QQN A;  3EKU A;  2NRW A;  2IIR A;  1E4G T;  3SK3 A;  3G4S N;  5AZJ A;  2VWB A;  1HJO A;  4XH1 A;  5C0Y A;  5AQR A;  3CJ9 A;  4PL7 A;  3DAW A;  1GLJ O;  3BUZ B;  4FPA A;  5BPL A;  1VQO N;  1GLD G;  1SAZ A;  3FZH A;  3VOV A;  1K9M O;  1YJN N;  3KZB A;  3O9S A;  3WQT A;  5CR4 A;  4BR0 A;  3DXM B;  3EO3 A;  3U9D A;  4A62 A;  4RWT A;  4MDB A;  4B1Z A;  3ATU A;  2CGL A;  4DCH A;  1KAY A;  3AAP A;  2Q1N A;  4FWK A;  1YJW N;  2HMP A;  4JAX A;  2QWL A;  5ELZ A;  1BOT O;  1X3N A;  5AQN A;  3GL1 A;  1NGB A;  3G6E N;  4IOX A;  3UE5 A;  3JS6 A;  2NRH A;  3K9K A;  3MCA B;  3MN7 A;  3CIP A;  3FZM A;  1NGH A;  5FPM A;  3CCV N;  3D6R A;  3R3L A;  1EO1 A;  4CBU A;  2V7Y A;  4NLC A;  4CD3 A;  2E2P A;  2ASO A;  2HBL A;  4BRA A;  3D2F B;  4H0P A;  3VEV A;  5AQF A;  2OAN A;  4IO8 A;  3R9P A;  3A5L C;  3DWL A;  5AZJ B;  4BR7 A;  3E9L A;  4ISE A;  1Q81 O;  1KC8 O;  2E1Y A;  1BO5 O;  2V51 B;  4JNE A;  4K25 A;  3LL3 A;  4B9Q A;  5GAG P;  1DT9 A;  4H0Y B;  5GIO A;  2VYP A;  5GIN A;  4H0X B;  3TTF A;  1GLL O;  5BPN A;  4OO1 J;  3LM9 A;  1ATN A;  2A5X A;  3C0B A;  5AQH A;  1V4T A;  4FVU A;  2F9T A;  1WUA A;  4FWP A;  4Y0W A;  5CE3 A;  5M1K A;  4KBO A;  3IKM A;  3C6A A;  3ENO A;  3LDO A;  1O13 A;  3KHY A;  5GIP A;  3HM8 A;  2P9U A;  2WUS A;  1MDU B;  2J4R A;  5AQV A;  2KKZ A;  4JHD B;  5AQU A;  3WXL A;  3AY9 A;  2BH1 A;  3ZEU B;  1VQ6 N;  2D0O A;  2Q31 A;  3EL2 A;  3MX5 A;  4CJ7 A;  2YHW A;  2P9N B;  4FO0 A;  4FSV A;  1NM1 A;  3CCJ N;  2QEX N;  5HL7 L;  4BRH A;  2FF3 B;  3IMX A;  3LM2 A;  5GAE P;  3RVC A;  2KHO A;  4H5N A;  2GWK A;  4Z94 A;  3H46 O;  2ZJQ L;  2HBJ A;  3O9R A;  5TKY A;  4FWR A;  1VQ4 N;  3F5T A;  3M1F A;  1T44 A;  1IG8 A;  1NGE A;  3FZL A;  3I33 A;  1HLU A;  3Q7C A;  1T6C A;  3O9T A;  2Q2R A;  3H1Q A;  1DEJ A;  3HRG A;  4BG8 A;  4BVO A;  1YJ9 N;  2V52 B;  1KXP A;  3SBT A;  3CPE A;  4GV6 A;  3AAQ A;  3AGR A;  5ADX H;  3HSC A;  2E2O A;  2QWM A;  4YDU A;  1LOT B;  5C15 A;  1YAG A;  5AQY A;  1YIJ N;  4LC9 B;  2QXL A;  1K73 O;  3QBX A;  1GLF O;  2H3G X;  2YI1 A;  3GBT A;  4OPA A;  3R8E A;  5E84 A;  1VQP N;  3ENH A;  3K9J A;  3QFP A;  5F1X A;  4BRG A;  2FF6 A;  2ZJR L;  4WQ4 A;  3SAH A;  3ZET A;  4PKH A;  1YUW A;  3D7E O;  2JWL A;  3VEW A;  3EE8 A;  3HBT A;  1NGA A;  2NLX A;  1ESV A;  5BR9 A;  5EVZ A;  3L0Q A;  4A2A A;  2QI2 A;  5LY3 A;  2NNW A;  1KQS M;  4CZL A;  1V4S A;  4EIA A;  4G9Z A;  4MO5 A;  3RSE B;  1QQM A;  4H5T A;  4M7X A;  3ULE A;  1EQY A;  2QA4 N;  1VQM N;  3FZK A;  4C1N K;  4JK7 A;  3FZF A;  3VEX A;  3CCR N;  4KH6 A;  5BRH A;  2WFB A;  4WFB L;  2HST A;  4BRC A;  4CBW A;  3F9M A;  3VTH A;  3HTV A;  4IO9 L;  1Y64 A;  1U2V A;  5AQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...