3O3HA

T. maritima rnase h2 d107n in complex with nucleic acid substrate and manganese ions
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVNGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna-rna hybrid
total genus 80
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3hA00
1I39A 2VG6A 3L2UA 4DLGA 3AVCA 2OPPA 3VQ8A 3V9ZA 3LP3A 4M3XA 3LAMA 1S1XA 3LDSA 3I0SA 5KI6A 4ZHRA 3DLBA 3KTQA 3LZIA 3CG7A 3KD1E 3OYGA 3M8PA 5KTQA 3HL8A 4FLUA 3VQEA 3L2WA 3V4IA 1SV5A 3AO1A 3V9WA 1YVUA 1ZBFA 4M45A 2IAJA 1D5AA 1TKZA 1X9WA 3NF8A 3KK3A 4FJNA 4E19A 4E1NA 1B9DA 3OYNA 5FRMA 3HXMA 3M8QA 1Q8IA 3WNFA 1LW0A 3V9XA 2XY5A 4HUFA 1KFSA 4J2BA 4J2EA 4FVMA 4CEEA 5HRSA 3RWUA 4CF1A 3U6FA 4KHSA 3V81A 1B9FA 1NJXA 4K8ZA 3TAFA 1NOZA 2Z1GA 5K14A 1HYVA 3LPTA 4RW8A 4DTOA 3NF7A 1RBRA 3PUFA 4DFMA 1YTAA 3OS2A 3AA3A 1HNVA 1R0AA 1JLBA 4EZ6A 1RBVA 1X1PA 3O3FA 1NJYA 4FM0A 3OYFA 2G8HA 4ELTA 2G8VA 4KREA 4OLAA 3MECA 3VQBA 1KRPA 3QEVA 3K5MA 4CECA 1L3UA 4WE1A 4DSEA 4KTWA 3OS0A 3OYJA 4DF4A 3QEIA 2B5JA 2BDPA 4M3UA 3AVKA 4CFAA 4E7LA 3K5LA 3L3VA 1X9MA 2O4IA 3V1RA 3AVNA 4KO0A 1ASVA 2OPQA 4FK4A 2KFZA 3TAEA 3SV4A 4JLHA 2RF2A 4LSLA 1NKCA 4CEFA 2QKBA 3THVA 3NGIA 1D9DA 1C6VA 2FC0A 1NK4A 1RT7A 4H4MA 4DQIA 3MEGA 4KKOA 1VSFA 1RDCA 3P5JA 4BE0A 1L3VA 4AHVA 5HLFA 3NF6A 2DFEA 3AA4A 4FW1A 4CGDA 3LP2A 4I2QA 1LWCA 3DLEA 1UOCA 3P83D 5HROA 4O0JA 4BWMA 4FJIA 3CQ8A 3LPUA 3SUOA 3PO4A 3AA2A 4GVMA 1QE1A 2I5JA 4OJRA 3DMJA 4DSLA 4CESA 4CGGA 3VQAA 3I0RA 4DS5A 2GUIA 3L2VA 4BDPA 4HCCA 4DMNA 4LD0A 4E0DA 1HPZA 2HNDA 3NFAA 1Z26A 1UA1A 3LWMA 2G8WA 3LALA 5J2PA 1TL1A 4DWIA 4CF8A 4KFBA 3D0PA 1LV5A 4Z4HA 3V1QA 3OYBA 4DS4A 2IS3A 3E01A 3ZT4A 4LSNA 4B9VA 3TABA 3SPZA 1RTHA 3VA0A 4C8LA 2X6SA 4KV8A 4OVLA 3KK2A 4Q0BA 1SL0A 3QINA 1XHXA 3HVTA 4PUOA 1D9FA 4H4OA 3AVBA 3MXMA 2KZMA 1RDBA 2OYQA 3PV8A 2HMIA 3ZSWA 2FBVA 1FKPA 3A2FA 2G8KA 4JRPA 1NK0A 1HNIA 1LWFA 2EX3A 3NF9A 4TSXA 1U04A 5CZ1A 5HRNA 1U48A 3DLHA 1WSJA 3CFRA 1IH7A 4Z4GA 2DTUA 3QETA 3OVNA 3PO5A 4OGCA 4CJEA 4J2DA 1QSLA 4N41A 1HMVA 1RT5A 1QSYA 4H8KA 3VQDA 3PX6A 3M8RA 4CHQA 3C95A 3QIOA 4CF9A 1TK8A 1ZBHA 2P51A 3KLIA 4FYDA 3O3HA 4CIEA 1I3AA 1J5OA 2P1JA 3TAMA 4N56A 3H08A 3VQ4A 4CJPA 3QO9A 4CEQA 1LW2A 3L2RA 4B3OA 2PYJA 1RBUA 3AV9A 4Q5VA 1A5XA 3P1GA 4CK3A 2Z1IA 4CE9A 4N5SA 4ELVA 5CYQA 1Z25A 3O4NA 4HHTA 4B9NA 2IC3A 4QOZB 4DF8A 4AHCA 1DTTA 4CFDA 4W5QA 4CGIA 4FLZA 1HRHA 1XWLA 1VSIA 1W0HA 5I3UA 2ETJA 4FJ7A 1LAVA 5DK5A 4FLWA 1T7PA 4KTQA 3RRHA 3ZSQA 2HNYA 2XHBA 3ZSOA 4DSJA 4G1QA 3QEXA 3DRRA 2O4GA 3S3NA 4Z4IA 3V9UA 4CJWA 4M3ZA 1HYSA 3DOLA 4PWDA 4DTJA 1L5UA 4CHYA 2G8UA 3WNHA 4BWJA 2RPIA 4CHPA 2FBYA 2YNGA 1A5VA 1QS4A 3HP9A 1X9SA 3O3GA 2XO7A 3TAPA 4CHOA 1N5YA 1VSHA 3OYCA 4BE2A 4KI4A 2KFNA 1NK6A 3T3FA 2B6AA 3K5OA 3QNNA 2KTQA 3CYMA 1YT3A 4NYNA 2OA8A 1IG9A 4IG3A 1JLFA 2ZE2A 1NK5A 1S5JA 3IG1A 1Q9YA 1HJRA 3D45A 3SI6A 2BGGA 2KW4A 3NH0A 4B9MA 3ULDA 3QERA 4C8NA 1LAWA 4CJRA 2DY4A 1KCFA 4KHUA 1NK8A 4N76A 1Y97A 1KFDA 2PY5A 3DLKA 5JS2A 3VQ6A 2X6NA 3UIQA 3HJFA 5J1EA 4DU4A 3SCXA 4CGJA 3KLGA 5HRPA 3BDPA 4F3TA 4O4GA 3NAEA 1O1WA 3DYAA 4OKEA 5KRSA 3PX4A 2G8IA 3SUNA 1HYZA 3HVRA 2Y1JA 1XHZA 4DQSA 1NK9A 2JLEA 3OYEA 3C6UA 1CZBA 3AA5X 2W42A 5FDLA 2KZZA 1HQEA 3RMBA 1WN7A 1S9EA 1S9GA 4BDYA 2YNIA 1EKEA 3AO3A 4ZTJA 3LAKA 5EU7A 4YNQA 3NHGA 2A1SA 4E7HA 4J2AA 3MEEA 4XIUA 1VRUA 1KVCA 3L8BA 1QTMA 1NJZA 2YHBA 4I9LA 4CJ5A 3K2PA 3MXJA 4NCGA 4M3WA 3VA3A 5C42A 2OZMA 4AHTA 1DLOA 3AO4A 4IFYA 1QQCA 4O0IA 3ZT3A 1SKWA 4FJ5A 1A5WA 3JSMA 4DFJA 4RG8A 3HSTB 4ZTFA 1CXQA 3V6DA 4M3YA 1RDAA 1IKVA 2ZQBA 3QEPA 1J53A 4AH9A 4CJUA 3DM2A 3CFOA 1C0UA 3NGZA 4CFCA 1WSHA 3QIPA 2E6LA 4ID5A 4LH4A 3QEWA 5C24A 2R7YA 4F2SA 1TK5A 3ZSYA 2PYLA 2D5RA 1U4BA 2X78A 1JLAA 3VQQA 1C0TA 4DTNA 3RR7A 3OYIA 4DTXA 3OS1A 3TAGA 1GOBA 2E4LA 3SQ4A 1TKDA 3QNOA 3KK1A 5D3GA 3HK2A 2HHQA 4CGFA 4ELUA 4FZYA 1ITGA 4Z0UA 2Z1JA 3HPGA 3WNEA 3ZSZA 3K5NA 4DTRA 5I42A 4CHNA 1SL1A 4I9QA 1BISA 4B08A 4Z4CA 3K58A 1JLCA 3DRPA 4W5RA 1JLQA 1C1BA 2EHGA 4FZZA 3S3OA 3CM6A 4UQGA 1SKSA 3EYZA 3K59A 1HQUA 4DSIA 4NCBA 1RCHA 3AVJA 4FXDA 2YHAA 3U3GA 4Z4EA 1ZBIA 4M41A 1J9AA 1GOAA 2HB5A 4B9SA 1EETA 5CYMA 3EZ5A 2P5GA 1BQNA 3OYHA 2JGUA 2IGIA 3SPYA 3DRSA 1RTIA 3AO5A 3HYFA 1S1UA 4N47A 3HP6A 4EP5A 2F96A 1KTQA 3SV3A 4F3OA 1F21A 1VSDA 2KQ2A 3CM5A 3DLGA 3SQ2A 4O5BA 4EZ9A 5KGXA 3NGYA 5FROA 4NYFA 2DFFA 2BANA 4CHZA 4E89A 3AVMA 2QKKA 4C8KA 4KB1A 4F2RA 1KSPA 3ITHA 4CJVA 4FZXC 4AHUA 1VSLA 4FLYA 4DFPA 4PY5A 2YV0X 3ZSVA 2XRIA 4HUEA 4C8MA 1U49A 1GOCA 4IDKA 1IKXA 4LH5A 4HCBA 3AVLA 4FJGA 1NKEA 4IBNA 4CEOA 1RT6A 3QESA 1L3TA 4RW9A 2DFHA 4E1MA 4ID1A 1RT2A 3LWLA 1BQMA 3T19A 1IO2A 1FK9A 3C94A 3SJJA 1IKWA 4HUGA 1U47A 4B9TA 4FJMA 4OKKA 3TI0A 1ZBLA 1ZYQA 4DU1A 1TAQA 3IRXA 5SWMA 4W5OA 3TANA 3L2QA 2FBTA 4ICLA 4B9UA 1CXUA 2QK9A 4CIGA 3OJUA 3AVFA 3DI6A 4I7FA 4FK2A 3OYAA 1MU2A 1VK0A 3KKRA 4CEZA 3RTVA 4C8OA 1FKOA 4CEDA 4OGEA 2HHUA 2B4JA 3VQ7A 3QLHA 4DSKA 4KPYA 2D0CA 2XY8A 1SKRA 4JS4A 1YTUA 2LSNA 1TV6A 3V1OA 3ZSXA 5J2NA 3G10A 1T05A 1J54A 3C6TA 4KHNA 5KRTA 1JXEA 2XY7A 3B6OA 4F8RA 4DQQA 1RT4A 3S9HA 2HHWA 1BI4B 2IOCA 3RMCA 2A1RA 4B8AB 1CZ9A 1RBTA 4KTZA 4OKJA 4E7KA 4IKFA 1RBSA 3TR8A 2WOMA 5HBMA 3OJSA 3PX0A 3HT3A 1TGOA 4CGHA 4DG1A 4DFKA 1NJWA 4OLBA 2G8FA 3NH2A 1B92A 3M8SA 4BDZA 4CK2A 3AVHA 3EY1A 2HNZA 1SL2A 1XI1A 2VG7A 3NBPA 4M3RA 1XC9A 4QCLA 1EP4A 1REVA 4DQRA 1KVAA 4E7IA 1JLGA 3HPOA 4PQUA 3LANA 3VQPA 4Z4FA 1WAFA 1SUQA 1TKXA 4KAZA 3TWHA 1TKTA 4MQ3A 1BCOA 4BACA 3SNNA 2VG5A 4CK1A 3VQ9A 1G15A 1TAUA 4FLVA 1WAJA 4CEBA 2VWJA 2OPRA 3VQCA 4DU3A 4DTUA 3IAYA 3NE6A 1KLNA 3ZCMA 3B6PA 3KKSA 1FXXA 4LY7A 4CJSA 5KGWA 3KLEA 4DLEA 1BGXT 4PA1A 4KRFA 2HHSA 4IG0A 3ZT1A 3O4QA 4CIFA 4RW7A 4F4KA 1VSMA 1S1TA 5J2QA 1IKYA 3TAQA 3DOKA 2Z1HA 4L8RB 4KB0A 3RRGA 2F8TA 5CY4A 1EXQA 3OYDA 2GV9A 3F9KA 1T03A 1RDDA 4CJ3A 4KHWA 1JKHA 2AJQA 4E3SA 4O55A 2IDOA 4QAGA 3TARA 3S3MA 1JL2A 3MXIA 4B9LA 1S6QA 2YKMA 3AVGA 1NOYA 3ZSRA 2RN2A 4FM2A 2VWKA 2Y1IA 4W5NA 1BL3A 1S1WA 4R5PA 1WSFA 3U3YA 1RTJA 4FJHA 4RW6A 1DTQA 4CJTA 4HVJA 3SQ1A 4CJ4A 1CLQA 4CJFA 3OY9A 4FK0A 3AVAA 1RT3A 1VRTA 5SZTA 4FLTA 3PY8A 4CCHA 4CJLA 4DQPA 3ALYA 2D0BA 4RW4A 4M3TA 4KHYA 1D8YA 4NCAA 2E6MA 1VSJA 1UWBA 4FJ8A 1T8EA 4BE1A 3HO1A 4CJQA 3LP1A 1KLMA 3FFIA 3ASMA 4GW6A 3RMDA 4HTUA 1JLEA 1WNSA 4FJXA 2HHVA 4GMJB 1C1CA 5CZ2A 4B8CA 2ATQA 1L3SA 1S1VA 3BGRA 2F8SA 1WSIA 2P5OA 4JRQA 3LP0A 3IS9A 3NCIA 5JS1A 1LWEA 1BIUA 1VSEA 1C1AA 4CEAA 3L3UA 1TK0A 4EP4A 3F73A 5T7BA 4FJJA 4KI6A 2YKNA 1C0MA 1W9HA 3G0ZA 1ASUA 3KJVA 4AILC 1WLJA 1WSGA 2OPSA 3WNGA 4OPJA 3NH1A 1Q9XA 2ITGA 4W5TA 3RR8A 2BE2A 1JL1A 3JYTA 1K6YA 2D0AA 5DMRA 3ZT0A 4M42A 4FLXA 4O44A 4DTMA 3VQ5A 1BCMA 5HP1A 3ZT2A 3SUQA 2HVHA 3HM9A 2WONA 1WSEA 2YNFA 1ZBUA 3MEDA 2YNHA 3AVIA 4DTPA 3LZJA 1BIZA 3OYLA 2HW3A 2QXFA 2XY6A 4CFBA 4FJLA 4MFBA 5HRRA 3I8DA 3SZ2A 1QSSA 4FW2A 2PZSA 3SQ0A 3ISNC 2OZSA 1EX4A 4FCYA 2HVIA 2NUBA 3DLRA 2Q3SA 3OYKA 4CJKA 4YFUA 3T1AA 1U45A 4DTSA 1UAXA 2RKIA 4CF2A 3OYMA 3KLHA 4IFVA 4OPKA 4CF0A 3RMAA 2HHXA 3NDKA 1BI4A 4Y1CA 3AO2A 4Y1DA 1TL3A 5C25A 4AHSA 3VN5A 2FBXA 2ZD1A 2GBZA 5E41A 4KHQA 1ASWA 3KIOA 4JS5A 4AHRA 2HHTA 1N6QA 3SYZA 1BHLA 1JXBA 1RNHA 1QHTA 4K8XA 4FJ9A 1S6PA 3KLFA 3K57A 5J2MA 4E7JA 1UA0A 4CERA 1NK7A 1NKBA 3HPHA 5FRNA 3KD5E 1RT1A 4I2PA 3MAQA 1VSKA 4FJKA 1RTDA 2X74A 3V9SA 1KVBA 3CFPA 4FM1A 1RILA 1TVRA 4DSFA 3SUPA
chains in the Genus database with same CATH superfamily
1I39A 2VG6A 1NNEA 2E1YA 4B1ZA 4DLGA 3AVCA 4CW7B 4WQ5A 3LDSA 4ZHRA 3KD1E 3OYGA 3HL8A 3VQEA 4IWVA 4FOIA 1SV5A 1TKZA 5BR9A 3KK3A 2V7ZA 3TU5A 3OYNA 3UE5A 3VENA 3HXMA 3M8QA 3HI0A 4J2BA 4J2EA 1LW0A 4FWRA 2A5XA 2KLAA 4CEEA 3U6FA 4GKJK 3TAFA 5BREA 3SK3A 2UXCK 3NF7A 1YTAA 4MLHA 4EZ6A 2G8HA 3OYFA 4KREA 4CBUA 3QEVA 4CECA 2O8FA 4DF4A 2O8DA 4M3UA 4E7LA 3D2EA 1HKGA 2UUAK 4KO0A 3TAEA 1ESVA 2RF2A 2QKBA 3NGIA 1C6VA 2FC0A 3KVGA 5CR4A 2O8FB 3JXUA 4JI5K 2O8DB 1IG8A 2WUSA 3CHWA 3P5JA 3QFPA 3D2EB 3NF6A 4FW1A 4DV1K 5C0YA 5HROA 4ISEA 4K25A 4FJIA 3CQ8A 3SUOA 1JJ2M 2YHWA 2A41A 5KPRA 4DS5A 2GUIA 1WBDA 1HPZA 2G8WA 1TL1A 4CF8A 4EIAA 3MDQA 4DS4A 2IS3A 3E01A 3AARA 5BN8A 4B9VA 3VA0A 5FPEA 2GUPA 4C8LA 1SZ2A 4BY9C 2P9KA 1D9FA 1D4XA 2FBVA 3KHYA 2G8KA 5LMNK 4JRPA 1HNIA 1LWFA 2EX3A 3NF9A 5CZ1A 1U48A 4EFHA 4IOXA 3DLHA 3CFRA 3U8XA 2DTUA 1XC3A 2CH5A 2FSJA 2P9KB 3OVNA 3QETA 3PO5A 4J2DA 3PX6A 5AZIA 4WFBL 4CF9A 3OBYA 3TTCA 4FYDA 3CF5L 2P9UA 4CJPA 4JKCA 1RBUA 3F5TA 5BR8K 4BRNA 1A5XA 3P1GA 4CK3A 4JKFA 4CE9A 2P9UB 4JK9A 3O4NA 3VEWA 4QOZB 3ZX2A 4DF8A 1KAYA 3U9DA 4CFDA 3CQYA 4CGIA 5C15A 4FLZA 1W0HA 1YVNA 5DK5A 4FLWA 4B1WB 3MWTA 3QEXA 2A40A 2NRVA 4CJWA 3DOLA 4IJAA 1L5UA 4CHYA 1ILYA 2YNGA 3T1YK 1K9MO 3VGMA 3QNNA 3CYMA 4BVOA 4NYNA 4DKWA 5E84A 4M7XA 2ZE2A 3SAHA 1Q9YA 4BRGA 2BGGA 2NRWA 1LAWA 1HJOA 3O9UA 2DY4A 1Y97A 3VQ6A 4AQYK 3MX2A 3J7ZO 3KLGA 5HRPA 4B1VA 3VTIA 3PX4A 4OKEA 5LY3A 3PLAA 2Q97A 5KQDA 3EKUA 4A57A 5FDLA 3TPQA 4MDBA 2VCPA 3RMBA 1S9EA 1S9GA 2YJEA 3FFKB 4BR0A 4E7HA 1QZ5A 1Z6RA 3H45C 4CJ5A 1T6DA 3K2PA 2E5LK 4OPHA 3VETA 4O0IA 1QQCA 4DFJA 2HMPA 3EE8A 4LFCK 1RDAA 2ZQBA 3CFOA 1C0UA 1WSHA 3LM9A 4GY2B 2PYLA 1C0TA 3KK1A 5D3GA 3HK2A 4CGFA 4I6MB 4LF9K 4DR6K 1SL1A 4Z4CA 4C23A 2E88A 1JLQA 3CERA 3PIPL 3CM6A 4H5RA 3EYZA 5ADXA 1SQKA 4H03B 2ASPA 2OCEA 3AVJA 3MN5A 4CZKA 3CCVN 1YJNN 4FXDA 1SAZA 3HRGA 5B8HA 4V19S 5AQKA 4LF8K 4Z4EA 2DPNA 4JN4A 1GOAA 3CJBA 3AGRA 4AM6A 2IGIA 3DRSA 2F96A 4CD1A 1IV0A 1VSDA 2KQ2A 3SQ2A 4O5BA 4EZ9A 5FROA 4E89A 3THXA 4LC9B 4QS7A 4F2RA 1HX1A 3CC4N 4PY5A 3ZSVA 4HUEA 1GOCA 4LH5A 4HCBA 3AVLA 4IBNA 5GIOA 1Y64A 3QESA 2W6LA 5BRFA 2WTUA 2YX6A 5JICA 2QWOA 4K42A 3T19A 3SJJA 3W3DA 3IRXA 2ASMA 2FBTA 2UXDK 4B9UA 1CXUA 3J7YP 2P9SA 4JK8A 3PSIA 4GV3A 3OJUA 3I56N 2NLXA 4I7FA 2Q1NA 4BR2A 1VQON 3RTVA 1N36K 3VQ7A 4DSKA 5AQMA 3AAPA 3M5RA 2P9SB 3V1OA 4JI0K 5KRTA 4RTFD 3WUHA 4B3RK 1RT4A 2HHWA 4B8AB 4E7KA 2P9PA 4X64K 1TGOA 4OLBA 2G8FA 3NH2A 3NBPA 1EP4A 4DQRA 2P9PB 3DWLA 1TUYA 4K0KK 1MA9B 1BCOA 3SNNA 4CK1A 1TAUA 4FLVA 1WAJA 3IAYA 4BREA 2OPRA 3VQCA 4DU3A 5AQGA 4CJSA 3KLEA 4IG0A 4H0OA 1VSMA 1H1VA 1IKYA 2CH6A 4L8RB 1XUPO 4KB0A 3RRGA 2F8TA 5I9EB 1C0FA 2HF3A 1RDDA 4CJ3A 4KHWA 2HBJA 3L4QA 2QWRA 3S3MA 5ADXH 4B9LA 2CGLA 3AVGA 4W5NA 5JLFA 1WSFA 1KAZA 1RTJA 3F9MA 1DTQA 4CJTA 1CLQA 4FK0A 3OY9A 4H5WA 4DQPA 5AQTA 2D0BA 4M3TA 1D8YA 4NCAA 2E6MA 1HNXK 3HO1A 4H0VB 1NWKA 2ATQA 1L3SA 1S1VA 4FWKA 5AQHA 2KKZA 5CE3A 4JRQA 3LP0A 3ENHA 4CEAA 4EP4A 3LDOA 1W9HA 3DLLL 5AR0A 2NNWA 1GLAG 4BRIA 3O6WA 4W5TA 3RR8A 2BE2A 3VERA 1JCFA 2BTFA 1JL1A 3A5MC 1K6YA 2QXLA 4FLXA 1TYQA 5LJWA 4BG8A 3G4SN 3SUQA 2GWJA 2I7NA 2WONA 2YNFA 1S22A 1BIZA 1TYQB 4MFBA 3QBWA 2PZSA 2E1ZA 4BR7A 2OZSA 1EX4A 1XNQK 2E8AA 3DLRA 4FWLA 4YFUA 4JKGB 4H0PA 4XH4A 5EVZA 1YIJN 4LF4K 4ISGA 1BI4A 3AO2A 3CJ7A 5AQXA 4AHRA 1N32K 2VQFK 4JI6K 1JXBA 4K8XA 5AQVA 1NKBA 3VEVA 3KD5E 4XH5A 1WUAA 4FJKA 1RTDA 1KVBA 4FM1A 1TVRA 3L2UA 3VQ8A 4M3XA 3LP3A 3DLBA 2FF3B 3CG7A 5AQIA 3LZIA 3M8PA 5KTQA 1NGHA 4FLUA 1XNRK 3AO1A 3C7NA 4B1YB 3NF8A 4E19A 4XH1A 1Q8IA 3WNFA 4CZHA 2XY5A 1KFSA 5HRSA 2UU9K 3C7NB 4CZGA 2P9NA 3V81A 1B9FA 1NJXA 4JI4K 1OH6A 4FWQA 1HYVA 2P9LB 4RW8A 2OTLN 3PUFA 1YI2N 4DFMA 1R0AA 1JLBA 3CIPA 4FM0A 4ELTA 2G8VA 4OLAA 2F7TA 3K5MA 1L3UA 1T44A 4BRLA 1VHXA 4KTWA 2B5JA 3AVKA 3L3VA 3V1RA 1ASVA 4MO5A 4FK4A 3WXMB 4JLHA 1XMQK 1RT7A 4H4MA 1JCGA 3MEGA 4KKOA 3H46O 3G71N 1L3VA 4AHVA 2DFEA 3LP2A 4I2QA 3DLEA 1Q18A 1UOCA 3P83D 4BWMA 3KWGA 3LPUA 3LDNA 3AA2A 4OJRA 2HSTA 4DSLA 4DMNA 4DV2K 2FLOA 4LD0A 3LALA 5J2PA 4DWIA 4KFBA 3BZKA 4U67L 5AZJA 3ZT4A 1G99A 1V4TA 4OVLA 3KK2A 3CCRN 3HVTA 4PUOA 2WBNA 3C65A 5BPNA 1FKPA 3A2FA 3ZETA 4TSXA 5HRNA 5CHIA 1WSJA 2OANA 1MDUB 4BVPA 1OH5A 4NLBA 4CJEA 3EKSA 1HMVA 3S41A 1RT5A 3E9LA 3M8RA 2V52B 3ZETB 3QIOA 5BPMA 1ZBHA 2W41A 1Q7YO 1KXPA 4NB4A 3TAMA 4CJ7A 4LF7K 3PIOL 3CMAN 4FOEA 4B3OA 4XEIA 2PYJA 3AV9A 3KZBA 1NMNA 3MX5A 4CBXA 3LM2A 1DTTA 2IVNA 2NRZA 3SBTA 3CCQN 4BQZA 1LAVA 2D4WA 2NRRA 1M1KO 3ZX3A 4G1QA 3S3NA 2O4GA 2QWPA 5C12A 4YDUC 4M3ZA 4PWDA 4DTJA 2G8UA 1C0GA 3WNHA 2RPIA 4CHPA 2FBYA 3HP9A 1A5VA 4BRCA 1X9SA 5AQLA 3R1XA 3E9PA 2KFNA 3K5OA 2QWMA 1YT3A 4BRAA 4WQ4A 4IG3A 2EWSA 4H0YB 4FWSA 1S5JA 3IG1A 5BRHA 4U7BA 1HJRA 3D45A 3SI6A 2KW4A 3ULDA 3QERA 2D0PA 4C8NA 2H3GX 4CJRA 4B1XB 4N76A 1VQLN 1J5EK 1KFDA 5J1EA 4DU4A 4K43A 4CGJA 3SCXA 3BDPA 4F3TA 1BOTO 3NAEA 1O1WA 5KRSA 2G8IA 3HVRA 4DQSA 1WOQA 3C6UA 5BN9A 2KZZA 4BDYA 3GL1A 3MWPA 2YNIA 1EKEA 3AO3A 5EU7A 2HBMA 4XIUA 1NJZA 3EN9A 4I9LA 4NCGA 5M1QA 4AHTA 3ZT3A 3C6HA 3JSMA 1W7AA 4RG8A 4OPAA 4ZTFA 1CXQA 1IKVA 3EZWA 1J53A 3JS6A 5GAGP 4AH9A 4A5AA 3DM2A 4CFCA 3QIPA 3FZHA 4EHTA 4ID5A 1HNZK 2R7YA 1TK5A 1U4BA 1KC8O 1JLAA 3J7AP 3P39A 4DTXA 3SQ4A 3L0QA 4ELUA 1ITGA 3WNEA 3HPGA 4EAHD 3ZSZA 4DTRA 3DJCA 3K58A 2HHHK 1JLCA 3DRPA 5GAHP 1NGCA 3S3OA 3L4IA 4DSIA 2ZJQL 4H5TA 2YHAA 5M1OA 5EOYA 1ZBIA 4JI3K 2HB5A 5CYMA 3OYHA 2F4VK 3TSPA 1NGFA 5HL7L 3AO5A 3HYFA 1S1UA 4ILGB 4LF6K 4PL7A 1KTQA 1F21A 1ZC6A 3DLGA 1EWQA 2JWLA 4NYFA 2BANA 4AHUA 3CJ9A 4FLYA 4DFPA 4C8MA 4CZFA 4IDKA 4FJGA 1RT6A 4WQ5C 3VGLA 5IWAK 4E1MA 4K41A 5AQPA 3LWLA 2QWLA 4B9TA 3VOVA 1OVQA 3A5LC 4IO9L 4DU1A 1TAQA 5SWMA 1ZBLA 4W5OA 3HOSA 4ICLA 1YHQN 5KQ8A 4BRDA 4CIGA 1LOTB 3DI6A 4FK2A 3OYAA 4CEZA 3MN7A 3OA9A 4CEDA 2HHUA 3QLHA 2D0CA 2XY8A 4JS4A 1TV6A 1BWFO 1J54A 3O9TA 1JXEA 2IVPA 4F8RA 4DQQA 3VEYA 4FZYA 3JAMO 2QW9A 4R79A 1CZ9A 1RBTA 4KTZA 4OKJA 5AQZA 4IOAL 1RBSA 4DHYA 1BU6O 2ASOA 5HBMA 4DUYK 3UB5A 4CGHA 4DG1A 4DFKA 1NJWA 1B92A 3M8SA 4BDZA 1XI1A 2ZJRL 1XC9A 1REVA 2I7PA 3HPOA 5AJ3K 4KAZA 4MQ3A 3SAFA 3VQ9A 1G15A 5E26A 3RSEB 4CEBA 1VQMN 4JYAK 3ZCMA 3B6PA 3BUZB 3KKSA 3LDQA 4LY7A 5KGWA 3VESA 4A5BA 2UYTA 1I94K 4PA1A 3TTFA 4YOYA 3EO3A 4DV0K 2HHSA 3IFRA 4IDHA 1E4GT 1S1TA 3TAQA 2Z1HA 2NZTA 1EQYA 3OYDA 3F9KA 1KQSM 1JKHA 2YJFA 4IO8A 4I6MA 1NOYA 3OBWA 2RN2A 4FM2A 2VWKA 1BL3A 3U3YA 1FW6A 4RW6A 4HVJA 3SQ1A 4BC2A 3AVAA 1VRTA 3PY8A 4JD2A 4KHYA 2VQEK 4JAXA 5M1NA 3MK6A 4GVEA 4FJ8A 1T8EA 4BE1A 3CCSN 3LP1A 4GW6A 3RMDA 3ASMA 4HTUA 1JLEA 3VTHA 3SMPA 1MWMA 1Q86O 2F8SA 4IOCL 2Q31A 2P5OA 4IEEA 4JD2B 5H1SQ 3ULEA 3NCIA 2O8EA 3H3NO 3CQXA 3GG4A 4FJJA 3L3UA 4KB1A 4BRFA 1WLJA 1WSGA 3LDLA 3ULEB 1Q9XA 2ITGA 3AAQA 2O8EB 3QICA 3ZT0A 3OHRA 5AQUA 4GV6A 4DV6K 4O5FA 2HVHA 3Q7CA 3OYLA 2QXFA 4FJLA 1RDUA 1QSSA 4Y0WA 1J6ZA 1ATSA 3SQ0A 4KH4A 3ISNC 4BC3A 1NGBA 3FLCO 4GKKK 4JKHA 5KPTA 3OYKA 2VGMA 2RKIA 1K8KB 1IBMK 1EO1A 4LF5K 4PHTX 4Y1CA 3H6EA 3A0IX 4DV4K 4NO7A 2FF6A 5E41A 1NM1A 2WFBA 3KIOA 4JS5A 3MCAB 2HHTA 1N6QA 3OW2M 1RNHA 1QHTA 4E7JA 1UA0A 2V51B 1RT1A 3MAQA 3V9SA 3THYA 1VQPN 3RVCA 3GE1A 2WC9A 4DSFA 4M7YA 4BROA 2OPPA 3V9ZA 4WYBA 5KI6A 4BC5A 3THYB 4FWMA 3V4IA 3L2WA 1VQKN 4A61A 5F0XA 2P9IA 3R3LA 1YVUA 3V9WA 4M45A 1M90O 1D5AA 4WF9L 2A6AA 2ZJPL 1B9DA 5FRMA 4JI8K 4HUFA 5AQFA 2P9IB 4CF1A 4KHSA 3I55N 3OTOK 2E2PA 1NOZA 2Z1GA 3CCMN 3LPTA 1RBRA 3AA3A 5M1KA 3IUCA 3O3FA 1NJYA 1YITN 2AP1A 3ID8A 4O8UA 3WXIA 4DSEA 3QEIA 2BDPA 2IIRA 4CFAA 3LL3A 3K5LA 1YJ9N 1X9MA 2O4IA 2OPQA 4NXMK 2KFZA 4LSLA 4YHHK 1NKCA 4QS9A 3THVA 3TSUA 1NK4A 4DQIA 1RDCA 4BE0A 5HLFA 5C2DA 3TSQA 3PO4A 1QE1A 3DMJA 4CESA 3VF2A 1Z26A 3K9JA 3D0PA 4KH6A 1LV5A 3OYBA 3V1QA 2Q0RA 3T69A 3SPZA 1RTHA 1K8AO 4KV8A 3M3ZA 1SL0A 3MXMA 3EE9A 3I33A 1RDBA 2OYQA 2HMIA 3CPEA 4DV5K 4JI7K 1U04A 5MLCQ 1IH7A 4Z4GA 4OGCA 1QSLA 4N41A 1QSYA 3VQDA 4H5VA 4JKGA 4CHQA 5TKWA 3C95A 1TK8A 4ISFA 2P51A 3J81O 3O3HA 1I3AA 2ZM6K 1J5OA 4N56A 2Q36A 3QO9A 4CEQA 1LW2A 3L2RA 4IXCA 3O9SA 2F9TA 4Q5VA 3TTDA 4N5SA 2RE2A 2Z1IA 5C10A 5CYQA 3FZKA 4HHTA 4BRMA 1NGAA 3U9ZA 4W5QA 1HRHA 1XWLA 3PSFA 1VSIA 2ETJA 2HNYA 2XHBA 3T1HK 3MMVA 3DRRA 4Z4IA 5IT9O 3F2KA 3CC2N 3W0LA 4WCEL 3VF6A 4BWJA 1QS4A 3BEXA 2XO7A 3TAPA 4CZMA 4ILJA 5AQYA 1N5YA 1VSHA 1RDWX 1NJIO 4KI4A 3FGUA 1NK6A 1IG9A 2D1KA 1NK5A 3NH0A 4B9MA 3O80A 4KHUA 1NK8A 1U2VB 2P9LA 2PY5A 3DLKA 5JS2A 3UIQA 3HJFA 5AFUA 3DYAA 2VYPA 1HYZA 1NK9A 2JLEA 3OYEA 1CZBA 3AA5X 2A3ZA 1HQEA 2E2QA 1WN7A 3LAKA 4YNQA 1BA1A 3NHGA 1VQ8N 3A8YA 3L8BA 4JKAA 3MXJA 3SBGA 4M3WA 1WB9A 3VA3A 2OZMA 3AO4A 1SKWA 2YI1A 2BH1A 1A5WA 3HSTB 2A42A 1ATNA 4H0TB 3O9QA 4CJUA 3EL2A 3NGZA 3O5BA 3E66A 1HPMA 2E6LA 2FSNA 2ZF5O 3E9OA 4LH4A 3E1YA 3ZSYA 4CVNE 1ZXOA 2UUBK 1WBBA 4FPAA 3RR7A 3ENOA 3OS1A 3TAGA 1GOBA 2E4LA 2Q2RA 1Q81O 4DB3A 4Z0UA 3CETA 4J8FA 4PL8A 2HOEA 1BISA 4W5RA 4FZZA 3MN6A 1XQSC 1HQUA 4NCBA 4LFBK 3U3GA 1IBKK 5LMUK 4M41A 4JHDB 3WEEA 4B9SA 2VWBA 3WXLA 1EETA 4B1UB 5FPNA 1E4FT 1RTIA 1EWRA 4N47A 3D2FA 4EP5A 3WEEB 3SV3A 4CZJA 4IZ9A 3B8AX 3A5OC 3NGYA 3P31A 4C8KA 3AVMA 3ITHA 3D2FB 4CJVA 1VSLA 3HM8A 3FZLA 1IKXA 5FPDA 1NGJA 1DT9A 1L3TA 4RW9A 2DFHA 3ATUA 4JKEA 4NXNK 1BA0A 4ID1A 4JI1K 3CD6N 5GADP 3C94A 3QDKA 5JVGL 4IJNA 5EY4A 1ZYQA 5M1FA 5JMVA 3FR0A 2QK9A 1RGIA 2NRHA 3AVFA 2NRTA 3CCUN 3ZYYX 1VK0A 3KKRA 3CXCM 1NGEA 1FKOA 1U6ZA 4KPYA 1CZAN 5AFUH 1SKRA 2LSNA 4YORA 5J2NA 3ZSXA 1IBLK 4RCHA 4KHNA 4A2BA 3B6OA 4KBOA 4PKHA 1OH7A 2QTDA 2IOCA 1NGGA 5LL6Z 4JKDA 1GLEG 3AVHA 2HNZA 3UKRA 1SS6A 4QCLA 1IJJA 1KVAA 5AQJA 1JLGA 3K9KA 5JVHL 4CZLA 3LANA 4Z4FA 5GAEP 1HUXA 1SUQA 4GNIA 3TWHA 3D7EO 4BACA 3UKRB 3H1VX 1S3XA 4DTUA 1NU0A 4OX9K 1S72N 4OO1J 4FWNA 3CJAA 1FXXA 3J80O 4F9OA 4DLEA 1BGXT 2D0OA 3ZT1A 3O4QA 4RW7A 2NRXA 5DM6L 5CY4A 1EXQA 2GV9A 4WFAL 1T03A 3L6QA 2PBDA 4E3SA 4O55A 4JNEA 2J4RA 2IDOA 4QAGA 3TARA 2GELA 3MXIA 4G9ZA 2YKMA 2VGNA 3ZSRA 2Y1IA 1S1WA 4R5PA 4FJHA 4PKGA 3P38A 1VQ7N 4CJFA 1OVYA 5SZTA 4FLTA 4CCHA 3ALYA 4DR4K 4CJQA 3FFIA 3FZFA 4FJXA 1WNSA 4B3SK 4GMJB 3CCLN 1WSIA 4X65K 3KWIA 3H1QA 5JS1A 1XMOK 3AY9A 1QQNA 3MN9A 1C1AA 2CGKA 2KHOA 4YOUA 1TK0A 3F73A 1KD1O 5T7BA 4KI6A 2YKNA 3G0ZA 3KJVA 4BRKA 4AILC 2OPSA 1NBWA 1O13A 3WNGA 4C1NK 2Q0UA 4FWPA 2BUPA 5DMRA 4M42A 3HZ6A 4O44A 4JI2K 3VQ5A 1BCMA 4DTMA 5HP1A 4JK7A 3BF3A 4A62A 1WSEA 4DTPA 2HW3A 3HOTA 1X3MA 2XY6A 4JKBA 2F9WA 3I8DA 4WQ4C 4CZEA 2V7YA 5TKYA 4FWOA 2ITMA 2NUBA 4B3MK 2HVIA 2PAVA 2Q3SA 4BRQA 3QBXA 4DTSA 5AZIB 3O8MA 1UAXA 4PKIA 3OYMA 1OH8A 4CF0A 3I8BA 3RMAA 2HHXA 4FPBA 3DXKA 5C25A 2ZD1A 2GBZA 1BUPA 3GDQA 4KHQA 3NVMA 3AGKA 1HKBA 4BG9A 5M1PA 3SYZA 1BHLA 3ZEUA 3SJHA 4FJ9A 1S6PA 3VEXA 4BQLA 3K57A 5J2MA 3DXKB 1NK7A 3C0BA 3HPHA 5FRNA 4I2PA 1VQ4N 1VSKA 5AQQA 4DV3K 1X3NA 3CFPA 3SAGA 1RILA 3ZEUB 1R59O 1NLVA 3RSEA 2AA4A 3LAMA 1S1XA 3I0SA 4BGAA 3KTQA 3QB0A 2E2OA 4IEIA 1GLJO 3CCEN 1ZBFA 1VQ6N 2IAJA 1X9WA 4FJNA 4E1NA 4O8KA 4BR9A 3V9XA 2HHQA 4BR5A 2OTJN 4FVMA 3RWUA 3WXJA 1HLUA 3R8EA 2GX9A 1W97L 4K8ZA 4AF1A 5K14A 4DTOA 3OS2A 1QQOA 3M6GA 1HNVA 1RBVA 1X1PA 4BRPA 2PFUA 1YXQA 1FJGK 3MECA 3VQBA 4DV7K 1KRPA 5FPMA 4WE1A 1QVFM 3OS0A 3OYJA 3H3OB 1YUWA 3AVNA 4BGBA 3SV4A 3QFUA 3SMSA 4CEFA 1D9DA 3SLCA 1P90A 1VSFA 3O9RA 4YOXA 3AA4A 4CGDA 1VAZA 1LWCA 4O0JA 4H0XB 4EHUA 4GVMA 5FLXO 1NGIA 2I5JA 3ATVA 4CGGA 3VQAA 3I0RA 4BDPA 4HCCA 3L2VA 1RFQA 1Z05A 4E0DA 2HNDA 3NFAA 3CI5A 1UA1A 3LWMA 4Z4HA 4LSNA 1N8RO 3TABA 2O8CA 3N4PA 2X6SA 4Q0BA 4BR4A 3QINA 1XHXA 5AQWA 2GTDA 4H4OA 3AVBA 3ENBA 3BY5A 2KZMA 4IFEA 3PV8A 3ZSWA 4WFNL 1X9JA 1NK0A 2O8CB 1GLCG 1BDGA 5AQOA 2QM1A 1E3MA 3T7ZA 4DR3K 4B9QA 4NLCA 4H8KA 2UUCK 4GV9A 1K8KA 1QZ6A 4L3QA 3KLIA 4CIEA 5BPLA 1GLDG 2P1JA 3VEZA 3H08A 3VQ4A 1OKJA 1JCEA 4B3TK 1HKCA 5DM7L 3Q7BA 4ELVA 1Z25A 3THXB 4B9NA 2IC3A 4AHCA 1V4SA 4DQ8A 4YY3K 1P8ZA 4YOWA 5I3UA 4FJ7A 2W40A 1QVGM 4KTQA 1T7PA 3RRHA 3ZSQA 3ZSOA 3ID6A 3V9UA 1HYSA 3HBTA 1NMDA 3O3GA 4H5NA 4CHOA 3VEOA 3OYCA 4BE2A 3T3FA 2B6AA 2QWQA 2KTQA 2OA8A 4DR7K 1JLFA 2YHYA 2ZGZA 1KCFA 3THWA 4RWTA 1GLFO 2X6NA 1Q82O 4A59A 5AQSA 4O4GA 1W2BM 4QS8A 3G25A 3SUNA 2Y1JA 4A2AA 3WQTA 1XHZA 2W42A 3THWB 3R6MA 3VF4A 5JLHA 1K73O 4DCHA 1T6CA 4ZTJA 2A1SA 4J2AA 3MEEA 1VRUA 1KVCA 1QTMA 3FE1A 2YHBA 5EXWA 4FVUA 4YOVA 5C42A 3VGKA 1DLOA 4IFYA 2W6KA 3CCJN 4FJ5A 3V6DA 4M3YA 3QEPA 2QA4N 2FXUA 4FSVA 4E1JA 3QEWA 5C24A 1BO5O 4F2SA 2D5RA 2X78A 4CD3A 3VQQA 4DTNA 2QEXN 3OYIA 1TKDA 3NVKA 3QNOA 3D6RA 5BRDA 2Z1JA 3K5NA 5I42A 3O1BA 4CHNA 4I9QA 4B08A 4X66K 1C1BA 2EHGA 2QI2A 4UQGA 1SKSA 3K59A 1ATRA 3WXKA 1RCHA 3CMEN 4UY8O 5C2FA 1J9AA 3VPZA 1QHAA 4KHPK 3EZ5A 2P5GA 1BQNA 4HWIA 2JGUA 3SPYA 3CJ1A 2FSKA 3HP6A 4F3OA 4ILHA 5ELZA 3DXMA 3CM5A 4MDAA 3A5NC 2HBLA 5KGXA 4CHZA 5KPZA 2QKKA 2DFFA 3K0SA 5AQNA 1KSPA 1HNWK 4FZXC 3FZMA 2UXBK 3DXMB 4AM7A 2YV0X 1N33K 2XRIA 1U49A 1VQNN 1NKEA 3CPWM 3IDHA 4CEOA 4LFAK 3CC7N 5LJVA 1NG9A 1RT2A 3J8AA 1BQMA 1VQ9N 1IO2A 1FK9A 1U47A 1IKWA 4HUGA 4FJMA 4OKKA 3TI0A 3TANA 3ZLJA 3L2QA 3BF1A 4DR5K 2GEMA 1KAXA 1DEJA 4HTLA 3IKMA 1MWKA 1MU2A 4C8OA 2QWNA 4OGEA 2B4JA 1YTUA 2IVOA 1U2VA 2HF4A 3G10A 1T05A 3C6TA 4JV5K 2XY7A 3IMXA 4BC4A 3NMUA 3S9HA 3O08A 1BI4B 2A1RA 3RMCA 4DSJA 4IKFA 3TR8A 2WOMA 3U4LA 3OJSA 3PX0A 2GWKA 3HT3A 3C6AA 4CK2A 3EY1A 1SL2A 4X62K 2VG7A 4M3RA 4E7IA 4PQUA 3M1FA 3VQPA 1WAFA 1TKXA 2E20A 1TKTA 2VG5A 4Z94A 4DR2K 2VWJA 1DGKN 3NE6A 4FO0A 4BRHA 1YJWN 1KLNA 4YDUA 3P4IA 4KRFA 4CZIA 4M63C 3QMLA 3VMFB 4CIFA 4F4KA 3EEQA 5J2QA 3DOKA 1LCUA 2YHXA 3GOIA 2O8BA 3G6EN 4YOTA 1NGDA 4DUZK 2CGJA 3UKUA 2AJQA 4FL9A 3HTVA 2P9NB 5HOOA 1JL2A 1S6QA 2O8BB 4KH5A 3UKUB 4JEPA 1T3VA 4CJ4A 1GLBG 1RT3A 4CJLA 4RW4A 4JHDA 1VSJA 1UWBA 1KLMA 3CJCA 2HHVA 5CZ2A 1C1CA 3BZCA 4B8CA 3BGRA 5A2QO 1HR0K 3IS9A 1LWEA 5F1XA 1BIUA 1VSEA 1QQMA 3O1WA 2E2NA 1C0MA 1ASUA 4MLEA 4OPJA 3NH1A 1YAGA 5F2RA 3JYTA 2D0AA 3ZX0A 1ZBSA 1BG3A 5GINA 3ZT2A 3KK7A 2RHKA 3HM9A 2ZWHA 5AZJB 1ZBUA 3MEDA 2YNHA 3AVIA 4DR1K 3LZJA 2JWKA 1N34K 4CFBA 2HBKA 3N4QA 5HRRA 3SZ2A 3R9PA 4MO4A 4FW2A 1YF5L 3LDPA 4FCYA 5GIPA 3HSCA 4CBWA 4CI6A 1GLLO 4C1NI 4CJKA 3T1AA 1U45A 4CF2A 3KLHA 3MCPA 4IFVA 4OPKA 3BP8A 5AQRA 3NDKA 3O4WA 5EX5A 3DAWA 4Y1DA 1TL3A 4AHSA 3VN5A 2FBXA 1ASWA 2YCHA 3KLFA 1DKGD 3WT0A 4CERA 2ZGYA 1VQ5N 2X74A 3WQUA 1TUUA 3GBTA 3SUPA
chains in the Genus database with same CATH topology
1I39A 2VG6A 3L2UA 4DLGA 3AVCA 2OPPA 3VQ8A 3V9ZA 3LP3A 4M3XA 3LAMA 1S1XA 3LDSA 3I0SA 5KI6A 4ZHRA 3DLBA 3KTQA 3LZIA 3CG7A 3KD1E 3OYGA 3M8PA 5KTQA 3HL8A 4FLUA 3VQEA 3L2WA 3V4IA 1SV5A 3AO1A 3V9WA 1YVUA 1ZBFA 4M45A 2IAJA 1D5AA 1TKZA 1X9WA 3NF8A 3KK3A 4FJNA 4E19A 4E1NA 1B9DA 3OYNA 5FRMA 3HXMA 3M8QA 1Q8IA 3WNFA 1LW0A 3V9XA 2XY5A 4HUFA 1KFSA 4J2BA 4J2EA 4FVMA 4CEEA 5HRSA 3RWUA 4CF1A 3U6FA 4KHSA 3V81A 1B9FA 1NJXA 4K8ZA 3TAFA 1NOZA 2Z1GA 5K14A 1HYVA 3LPTA 4RW8A 4DTOA 3NF7A 1RBRA 3PUFA 4DFMA 1YTAA 3OS2A 3AA3A 1HNVA 1R0AA 1JLBA 4EZ6A 1RBVA 1X1PA 3O3FA 1NJYA 4FM0A 3OYFA 2G8HA 4ELTA 2G8VA 4KREA 4OLAA 3MECA 3VQBA 1KRPA 3QEVA 3K5MA 4CECA 1L3UA 4WE1A 4DSEA 4KTWA 3OS0A 3OYJA 4DF4A 3QEIA 2B5JA 2BDPA 4M3UA 3AVKA 4CFAA 4E7LA 3K5LA 3L3VA 1X9MA 2O4IA 3V1RA 3AVNA 4KO0A 1ASVA 2OPQA 4FK4A 2KFZA 3TAEA 3SV4A 4JLHA 2RF2A 4LSLA 1NKCA 4CEFA 2QKBA 3THVA 3NGIA 1D9DA 1C6VA 2FC0A 1NK4A 1RT7A 4H4MA 4DQIA 3MEGA 4KKOA 1VSFA 1RDCA 3P5JA 4BE0A 1L3VA 4AHVA 5HLFA 3NF6A 2DFEA 3AA4A 4FW1A 4CGDA 3LP2A 4I2QA 1LWCA 3DLEA 1UOCA 3P83D 5HROA 4O0JA 4BWMA 4FJIA 3CQ8A 3LPUA 3SUOA 3PO4A 3AA2A 4GVMA 1QE1A 2I5JA 4OJRA 3DMJA 4DSLA 4CESA 4CGGA 3VQAA 3I0RA 4DS5A 2GUIA 3L2VA 4BDPA 4HCCA 4DMNA 4LD0A 4E0DA 1HPZA 2HNDA 3NFAA 1Z26A 1UA1A 3LWMA 2G8WA 3LALA 5J2PA 1TL1A 4DWIA 4CF8A 4KFBA 3D0PA 1LV5A 4Z4HA 3V1QA 3OYBA 4DS4A 2IS3A 3E01A 3ZT4A 4LSNA 4B9VA 3TABA 3SPZA 1RTHA 3VA0A 4C8LA 2X6SA 4KV8A 4OVLA 3KK2A 4Q0BA 1SL0A 3QINA 1XHXA 3HVTA 4PUOA 1D9FA 4H4OA 3AVBA 3MXMA 2KZMA 1RDBA 2OYQA 3PV8A 2HMIA 3ZSWA 2FBVA 1FKPA 3A2FA 2G8KA 4JRPA 1NK0A 1HNIA 1LWFA 2EX3A 3NF9A 4TSXA 1U04A 5CZ1A 5HRNA 1U48A 3DLHA 1WSJA 3CFRA 1IH7A 4Z4GA 2DTUA 3QETA 3OVNA 3PO5A 4OGCA 4CJEA 4J2DA 1QSLA 4N41A 1HMVA 1RT5A 1QSYA 4H8KA 3VQDA 3PX6A 3M8RA 4CHQA 3C95A 3QIOA 4CF9A 1TK8A 1ZBHA 2P51A 3KLIA 4FYDA 3O3HA 4CIEA 1I3AA 1J5OA 2P1JA 3TAMA 4N56A 3H08A 3VQ4A 4CJPA 3QO9A 4CEQA 1LW2A 3L2RA 4B3OA 2PYJA 1RBUA 3AV9A 4Q5VA 1A5XA 3P1GA 4CK3A 2Z1IA 4CE9A 4N5SA 4ELVA 5CYQA 1Z25A 3O4NA 4HHTA 4B9NA 2IC3A 4QOZB 4DF8A 4AHCA 1DTTA 4CFDA 4W5QA 4CGIA 4FLZA 1HRHA 1XWLA 1VSIA 1W0HA 5I3UA 2ETJA 4FJ7A 1LAVA 5DK5A 4FLWA 1T7PA 4KTQA 3RRHA 3ZSQA 2HNYA 2XHBA 3ZSOA 4DSJA 4G1QA 3QEXA 3DRRA 2O4GA 3S3NA 4Z4IA 3V9UA 4CJWA 4M3ZA 1HYSA 3DOLA 4PWDA 4DTJA 1L5UA 4CHYA 2G8UA 3WNHA 4BWJA 2RPIA 4CHPA 2FBYA 2YNGA 1A5VA 1QS4A 3HP9A 1X9SA 3O3GA 2XO7A 3TAPA 4CHOA 1N5YA 1VSHA 3OYCA 4BE2A 4KI4A 2KFNA 1NK6A 3T3FA 2B6AA 3K5OA 3QNNA 2KTQA 3CYMA 1YT3A 4NYNA 2OA8A 1IG9A 4IG3A 1JLFA 2ZE2A 1NK5A 1S5JA 3IG1A 1Q9YA 1HJRA 3D45A 3SI6A 2BGGA 2KW4A 3NH0A 4B9MA 3ULDA 3QERA 4C8NA 1LAWA 4CJRA 2DY4A 1KCFA 4KHUA 1NK8A 4N76A 1Y97A 1KFDA 2PY5A 3DLKA 5JS2A 3VQ6A 2X6NA 3UIQA 3HJFA 5J1EA 4DU4A 3SCXA 4CGJA 3KLGA 5HRPA 3BDPA 4F3TA 4O4GA 3NAEA 1O1WA 3DYAA 4OKEA 5KRSA 3PX4A 2G8IA 3SUNA 1HYZA 3HVRA 2Y1JA 1XHZA 4DQSA 1NK9A 2JLEA 3OYEA 3C6UA 1CZBA 3AA5X 2W42A 5FDLA 2KZZA 1HQEA 3RMBA 1WN7A 1S9EA 1S9GA 4BDYA 2YNIA 1EKEA 3AO3A 4ZTJA 3LAKA 5EU7A 4YNQA 3NHGA 2A1SA 4E7HA 4J2AA 3MEEA 4XIUA 1VRUA 1KVCA 3L8BA 1QTMA 1NJZA 2YHBA 4I9LA 4CJ5A 3K2PA 3MXJA 4NCGA 4M3WA 3VA3A 5C42A 2OZMA 4AHTA 1DLOA 3AO4A 4IFYA 1QQCA 4O0IA 3ZT3A 1SKWA 4FJ5A 1A5WA 3JSMA 4DFJA 4RG8A 3HSTB 4ZTFA 1CXQA 3V6DA 4M3YA 1RDAA 1IKVA 2ZQBA 3QEPA 1J53A 4AH9A 4CJUA 3DM2A 3CFOA 1C0UA 3NGZA 4CFCA 1WSHA 3QIPA 2E6LA 4ID5A 4LH4A 3QEWA 5C24A 2R7YA 4F2SA 1TK5A 3ZSYA 2PYLA 2D5RA 1U4BA 2X78A 1JLAA 3VQQA 1C0TA 4DTNA 3RR7A 3OYIA 4DTXA 3OS1A 3TAGA 1GOBA 2E4LA 3SQ4A 1TKDA 3QNOA 3KK1A 5D3GA 3HK2A 2HHQA 4CGFA 4ELUA 4FZYA 1ITGA 4Z0UA 2Z1JA 3HPGA 3WNEA 3ZSZA 3K5NA 4DTRA 5I42A 4CHNA 1SL1A 4I9QA 1BISA 4B08A 4Z4CA 3K58A 1JLCA 3DRPA 4W5RA 1JLQA 1C1BA 2EHGA 4FZZA 3S3OA 3CM6A 4UQGA 1SKSA 3EYZA 3K59A 1HQUA 4DSIA 4NCBA 1RCHA 3AVJA 4FXDA 2YHAA 3U3GA 4Z4EA 1ZBIA 4M41A 1J9AA 1GOAA 2HB5A 4B9SA 1EETA 5CYMA 3EZ5A 2P5GA 1BQNA 3OYHA 2JGUA 2IGIA 3SPYA 3DRSA 1RTIA 3AO5A 3HYFA 1S1UA 4N47A 3HP6A 4EP5A 2F96A 1KTQA 3SV3A 4F3OA 1F21A 1VSDA 2KQ2A 3CM5A 3DLGA 3SQ2A 4O5BA 4EZ9A 5KGXA 3NGYA 5FROA 4NYFA 2DFFA 2BANA 4CHZA 4E89A 3AVMA 2QKKA 4C8KA 4KB1A 4F2RA 1KSPA 3ITHA 4CJVA 4FZXC 4AHUA 1VSLA 4FLYA 4DFPA 4PY5A 2YV0X 3ZSVA 2XRIA 4HUEA 4C8MA 1U49A 1GOCA 4IDKA 1IKXA 4LH5A 4HCBA 3AVLA 4FJGA 1NKEA 4IBNA 4CEOA 1RT6A 3QESA 1L3TA 4RW9A 2DFHA 4E1MA 4ID1A 1RT2A 3LWLA 1BQMA 3T19A 1IO2A 1FK9A 3C94A 3SJJA 1IKWA 4HUGA 1U47A 4B9TA 4FJMA 4OKKA 3TI0A 1ZBLA 1ZYQA 4DU1A 1TAQA 3IRXA 5SWMA 4W5OA 3TANA 3L2QA 2FBTA 4ICLA 4B9UA 1CXUA 2QK9A 4CIGA 3OJUA 3AVFA 3DI6A 4I7FA 4FK2A 3OYAA 1MU2A 1VK0A 3KKRA 4CEZA 3RTVA 4C8OA 1FKOA 4CEDA 4OGEA 2HHUA 2B4JA 3VQ7A 3QLHA 4DSKA 4KPYA 2D0CA 2XY8A 1SKRA 4JS4A 1YTUA 2LSNA 1TV6A 3V1OA 3ZSXA 5J2NA 3G10A 1T05A 1J54A 3C6TA 4KHNA 5KRTA 1JXEA 2XY7A 3B6OA 4F8RA 4DQQA 1RT4A 3S9HA 2HHWA 1BI4B 2IOCA 3RMCA 2A1RA 4B8AB 1CZ9A 1RBTA 4KTZA 4OKJA 4E7KA 4IKFA 1RBSA 3TR8A 2WOMA 5HBMA 3OJSA 3PX0A 3HT3A 1TGOA 4CGHA 4DG1A 4DFKA 1NJWA 4OLBA 2G8FA 3NH2A 1B92A 3M8SA 4BDZA 4CK2A 3AVHA 3EY1A 2HNZA 1SL2A 1XI1A 2VG7A 3NBPA 4M3RA 1XC9A 4QCLA 1EP4A 1REVA 4DQRA 1KVAA 4E7IA 1JLGA 3HPOA 4PQUA 3LANA 3VQPA 4Z4FA 1WAFA 1SUQA 1TKXA 4KAZA 3TWHA 1TKTA 4MQ3A 1BCOA 4BACA 3SNNA 2VG5A 4CK1A 3VQ9A 1G15A 1TAUA 4FLVA 1WAJA 4CEBA 2VWJA 2OPRA 3VQCA 4DU3A 4DTUA 3IAYA 3NE6A 1KLNA 3ZCMA 3B6PA 3KKSA 1FXXA 4LY7A 4CJSA 5KGWA 3KLEA 4DLEA 1BGXT 4PA1A 4KRFA 2HHSA 4IG0A 3ZT1A 3O4QA 4CIFA 4RW7A 4F4KA 1VSMA 1S1TA 5J2QA 1IKYA 3TAQA 3DOKA 2Z1HA 4L8RB 4KB0A 3RRGA 2F8TA 5CY4A 1EXQA 3OYDA 2GV9A 3F9KA 1T03A 1RDDA 4CJ3A 4KHWA 1JKHA 2AJQA 4E3SA 4O55A 2IDOA 4QAGA 3TARA 3S3MA 1JL2A 3MXIA 4B9LA 1S6QA 2YKMA 3AVGA 1NOYA 3ZSRA 2RN2A 4FM2A 2VWKA 2Y1IA 4W5NA 1BL3A 1S1WA 4R5PA 1WSFA 3U3YA 1RTJA 4FJHA 4RW6A 1DTQA 4CJTA 4HVJA 3SQ1A 4CJ4A 1CLQA 4CJFA 3OY9A 4FK0A 3AVAA 1RT3A 1VRTA 5SZTA 4FLTA 3PY8A 4CCHA 4CJLA 4DQPA 3ALYA 2D0BA 4RW4A 4M3TA 4KHYA 1D8YA 4NCAA 2E6MA 1VSJA 1UWBA 4FJ8A 1T8EA 4BE1A 3HO1A 4CJQA 3LP1A 1KLMA 3FFIA 3ASMA 4GW6A 3RMDA 4HTUA 1JLEA 1WNSA 4FJXA 2HHVA 4GMJB 1C1CA 5CZ2A 4B8CA 2ATQA 1L3SA 1S1VA 3BGRA 2F8SA 1WSIA 2P5OA 4JRQA 3LP0A 3IS9A 3NCIA 5JS1A 1LWEA 1BIUA 1VSEA 1C1AA 4CEAA 3L3UA 1TK0A 4EP4A 3F73A 5T7BA 4FJJA 4KI6A 2YKNA 1C0MA 1W9HA 3G0ZA 1ASUA 3KJVA 4AILC 1WLJA 1WSGA 2OPSA 3WNGA 4OPJA 3NH1A 1Q9XA 2ITGA 4W5TA 3RR8A 2BE2A 1JL1A 3JYTA 1K6YA 2D0AA 5DMRA 3ZT0A 4M42A 4FLXA 4O44A 4DTMA 3VQ5A 1BCMA 5HP1A 3ZT2A 3SUQA 2HVHA 3HM9A 2WONA 1WSEA 2YNFA 1ZBUA 3MEDA 2YNHA 3AVIA 4DTPA 3LZJA 1BIZA 3OYLA 2HW3A 2QXFA 2XY6A 4CFBA 4FJLA 4MFBA 5HRRA 3I8DA 3SZ2A 1QSSA 4FW2A 2PZSA 3SQ0A 3ISNC 2OZSA 1EX4A 4FCYA 2HVIA 2NUBA 3DLRA 2Q3SA 3OYKA 4CJKA 4YFUA 3T1AA 1U45A 4DTSA 1UAXA 2RKIA 4CF2A 3OYMA 3KLHA 4IFVA 4OPKA 4CF0A 3RMAA 2HHXA 3NDKA 1BI4A 4Y1CA 3AO2A 4Y1DA 1TL3A 5C25A 4AHSA 3VN5A 2FBXA 2ZD1A 2GBZA 5E41A 4KHQA 1ASWA 3KIOA 4JS5A 4AHRA 2HHTA 1N6QA 3SYZA 1BHLA 1JXBA 1RNHA 1QHTA 4K8XA 4FJ9A 1S6PA 3KLFA 3K57A 5J2MA 4E7JA 1UA0A 4CERA 1NK7A 1NKBA 3HPHA 5FRNA 3KD5E 1RT1A 4I2PA 3MAQA 1VSKA 4FJKA 1RTDA 2X74A 3V9SA 1KVBA 3CFPA 4FM1A 1RILA 1TVRA 4DSFA 3SUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I39 A;  2VG6 A;  3L2U A;  4DLG A;  3AVC A;  2OPP A;  3VQ8 A;  3V9Z A;  3LP3 A;  4M3X A;  3LAM A;  1S1X A;  3LDS A;  3I0S A;  5KI6 A;  4ZHR A;  3DLB A;  3KTQ A;  3LZI A;  3CG7 A;  3KD1 E;  3OYG A;  3M8P A;  5KTQ A;  3HL8 A;  4FLU A;  3VQE A;  3L2W A;  3V4I A;  1SV5 A;  3AO1 A;  3V9W A;  1YVU A;  1ZBF A;  4M45 A;  2IAJ A;  1D5A A;  1TKZ A;  1X9W A;  3NF8 A;  3KK3 A;  4FJN A;  4E19 A;  4E1N A;  1B9D A;  3OYN A;  5FRM A;  3HXM A;  3M8Q A;  1Q8I A;  3WNF A;  1LW0 A;  3V9X A;  2XY5 A;  4HUF A;  1KFS A;  4J2B A;  4J2E A;  4FVM A;  4CEE A;  5HRS A;  3RWU A;  4CF1 A;  3U6F A;  4KHS A;  3V81 A;  1B9F A;  1NJX A;  4K8Z A;  3TAF A;  1NOZ A;  2Z1G A;  5K14 A;  1HYV A;  3LPT A;  4RW8 A;  4DTO A;  3NF7 A;  1RBR A;  3PUF A;  4DFM A;  1YTA A;  3OS2 A;  3AA3 A;  1HNV A;  1R0A A;  1JLB A;  4EZ6 A;  1RBV A;  1X1P A;  3O3F A;  1NJY A;  4FM0 A;  3OYF A;  2G8H A;  4ELT A;  2G8V A;  4KRE A;  4OLA A;  3MEC A;  3VQB A;  1KRP A;  3QEV A;  3K5M A;  4CEC A;  1L3U A;  4WE1 A;  4DSE A;  4KTW A;  3OS0 A;  3OYJ A;  4DF4 A;  3QEI A;  2B5J A;  2BDP A;  4M3U A;  3AVK A;  4CFA A;  4E7L A;  3K5L A;  3L3V A;  1X9M A;  2O4I A;  3V1R A;  3AVN A;  4KO0 A;  1ASV A;  2OPQ A;  4FK4 A;  2KFZ A;  3TAE A;  3SV4 A;  4JLH A;  2RF2 A;  4LSL A;  1NKC A;  4CEF A;  2QKB A;  3THV A;  3NGI A;  1D9D A;  1C6V A;  2FC0 A;  1NK4 A;  1RT7 A;  4H4M A;  4DQI A;  3MEG A;  4KKO A;  1VSF A;  1RDC A;  3P5J A;  4BE0 A;  1L3V A;  4AHV A;  5HLF A;  3NF6 A;  2DFE A;  3AA4 A;  4FW1 A;  4CGD A;  3LP2 A;  4I2Q A;  1LWC A;  3DLE A;  1UOC A;  3P83 D;  5HRO A;  4O0J A;  4BWM A;  4FJI A;  3CQ8 A;  3LPU A;  3SUO A;  3PO4 A;  3AA2 A;  4GVM A;  1QE1 A;  2I5J A;  4OJR A;  3DMJ A;  4DSL A;  4CES A;  4CGG A;  3VQA A;  3I0R A;  4DS5 A;  2GUI A;  3L2V A;  4BDP A;  4HCC A;  4DMN A;  4LD0 A;  4E0D A;  1HPZ A;  2HND A;  3NFA A;  1Z26 A;  1UA1 A;  3LWM A;  2G8W A;  3LAL A;  5J2P A;  1TL1 A;  4DWI A;  4CF8 A;  4KFB A;  3D0P A;  1LV5 A;  4Z4H A;  3V1Q A;  3OYB A;  4DS4 A;  2IS3 A;  3E01 A;  3ZT4 A;  4LSN A;  4B9V A;  3TAB A;  3SPZ A;  1RTH A;  3VA0 A;  4C8L A;  2X6S A;  4KV8 A;  4OVL A;  3KK2 A;  4Q0B A;  1SL0 A;  3QIN A;  1XHX A;  3HVT A;  4PUO A;  1D9F A;  4H4O A;  3AVB A;  3MXM A;  2KZM A;  1RDB A;  2OYQ A;  3PV8 A;  2HMI A;  3ZSW A;  2FBV A;  1FKP A;  3A2F A;  2G8K A;  4JRP A;  1NK0 A;  1HNI A;  1LWF A;  2EX3 A;  3NF9 A;  4TSX A;  1U04 A;  5CZ1 A;  5HRN A;  1U48 A;  3DLH A;  1WSJ A;  3CFR A;  1IH7 A;  4Z4G A;  2DTU A;  3QET A;  3OVN A;  3PO5 A;  4OGC A;  4CJE A;  4J2D A;  1QSL A;  4N41 A;  1HMV A;  1RT5 A;  1QSY A;  4H8K A;  3VQD A;  3PX6 A;  3M8R A;  4CHQ A;  3C95 A;  3QIO A;  4CF9 A;  1TK8 A;  1ZBH A;  2P51 A;  3KLI A;  4FYD A;  3O3H A;  4CIE A;  1I3A A;  1J5O A;  2P1J A;  3TAM A;  4N56 A;  3H08 A;  3VQ4 A;  4CJP A;  3QO9 A;  4CEQ A;  1LW2 A;  3L2R A;  4B3O A;  2PYJ A;  1RBU A;  3AV9 A;  4Q5V A;  1A5X A;  3P1G A;  4CK3 A;  2Z1I A;  4CE9 A;  4N5S A;  4ELV A;  5CYQ A;  1Z25 A;  3O4N A;  4HHT A;  4B9N A;  2IC3 A;  4QOZ B;  4DF8 A;  4AHC A;  1DTT A;  4CFD A;  4W5Q A;  4CGI A;  4FLZ A;  1HRH A;  1XWL A;  1VSI A;  1W0H A;  5I3U A;  2ETJ A;  4FJ7 A;  1LAV A;  5DK5 A;  4FLW A;  1T7P A;  4KTQ A;  3RRH A;  3ZSQ A;  2HNY A;  2XHB A;  3ZSO A;  4DSJ A;  4G1Q A;  3QEX A;  3DRR A;  2O4G A;  3S3N A;  4Z4I A;  3V9U A;  4CJW A;  4M3Z A;  1HYS A;  3DOL A;  4PWD A;  4DTJ A;  1L5U A;  4CHY A;  2G8U A;  3WNH A;  4BWJ A;  2RPI A;  4CHP A;  2FBY A;  2YNG A;  1A5V A;  1QS4 A;  3HP9 A;  1X9S A;  3O3G A;  2XO7 A;  3TAP A;  4CHO A;  1N5Y A;  1VSH A;  3OYC A;  4BE2 A;  4KI4 A;  2KFN A;  1NK6 A;  3T3F A;  2B6A A;  3K5O A;  3QNN A;  2KTQ A;  3CYM A;  1YT3 A;  4NYN A;  2OA8 A;  1IG9 A;  4IG3 A;  1JLF A;  2ZE2 A;  1NK5 A;  1S5J A;  3IG1 A;  1Q9Y A;  1HJR A;  3D45 A;  3SI6 A;  2BGG A;  2KW4 A;  3NH0 A;  4B9M A;  3ULD A;  3QER A;  4C8N A;  1LAW A;  4CJR A;  2DY4 A;  1KCF A;  4KHU A;  1NK8 A;  4N76 A;  1Y97 A;  1KFD A;  2PY5 A;  3DLK A;  5JS2 A;  3VQ6 A;  2X6N A;  3UIQ A;  3HJF A;  5J1E A;  4DU4 A;  3SCX A;  4CGJ A;  3KLG A;  5HRP A;  3BDP A;  4F3T A;  4O4G A;  3NAE A;  1O1W A;  3DYA A;  4OKE A;  5KRS A;  3PX4 A;  2G8I A;  3SUN A;  1HYZ A;  3HVR A;  2Y1J A;  1XHZ A;  4DQS A;  1NK9 A;  2JLE A;  3OYE A;  3C6U A;  1CZB A;  3AA5 X;  2W42 A;  5FDL A;  2KZZ A;  1HQE A;  3RMB A;  1WN7 A;  1S9E A;  1S9G A;  4BDY A;  2YNI A;  1EKE A;  3AO3 A;  4ZTJ A;  3LAK A;  5EU7 A;  4YNQ A;  3NHG A;  2A1S A;  4E7H A;  4J2A A;  3MEE A;  4XIU A;  1VRU A;  1KVC A;  3L8B A;  1QTM A;  1NJZ A;  2YHB A;  4I9L A;  4CJ5 A;  3K2P A;  3MXJ A;  4NCG A;  4M3W A;  3VA3 A;  5C42 A;  2OZM A;  4AHT A;  1DLO A;  3AO4 A;  4IFY A;  1QQC A;  4O0I A;  3ZT3 A;  1SKW A;  4FJ5 A;  1A5W A;  3JSM A;  4DFJ A;  4RG8 A;  3HST B;  4ZTF A;  1CXQ A;  3V6D A;  4M3Y A;  1RDA A;  1IKV A;  2ZQB A;  3QEP A;  1J53 A;  4AH9 A;  4CJU A;  3DM2 A;  3CFO A;  1C0U A;  3NGZ A;  4CFC A;  1WSH A;  3QIP A;  2E6L A;  4ID5 A;  4LH4 A;  3QEW A;  5C24 A;  2R7Y A;  4F2S A;  1TK5 A;  3ZSY A;  2PYL A;  2D5R A;  1U4B A;  2X78 A;  1JLA A;  3VQQ A;  1C0T A;  4DTN A;  3RR7 A;  3OYI A;  4DTX A;  3OS1 A;  3TAG A;  1GOB A;  2E4L A;  3SQ4 A;  1TKD A;  3QNO A;  3KK1 A;  5D3G A;  3HK2 A;  2HHQ A;  4CGF A;  4ELU A;  4FZY A;  1ITG A;  4Z0U A;  2Z1J A;  3HPG A;  3WNE A;  3ZSZ A;  3K5N A;  4DTR A;  5I42 A;  4CHN A;  1SL1 A;  4I9Q A;  1BIS A;  4B08 A;  4Z4C A;  3K58 A;  1JLC A;  3DRP A;  4W5R A;  1JLQ A;  1C1B A;  2EHG A;  4FZZ A;  3S3O A;  3CM6 A;  4UQG A;  1SKS A;  3EYZ A;  3K59 A;  1HQU A;  4DSI A;  4NCB A;  1RCH A;  3AVJ A;  4FXD A;  2YHA A;  3U3G A;  4Z4E A;  1ZBI A;  4M41 A;  1J9A A;  1GOA A;  2HB5 A;  4B9S A;  1EET A;  5CYM A;  3EZ5 A;  2P5G A;  1BQN A;  3OYH A;  2JGU A;  2IGI A;  3SPY A;  3DRS A;  1RTI A;  3AO5 A;  3HYF A;  1S1U A;  4N47 A;  3HP6 A;  4EP5 A;  2F96 A;  1KTQ A;  3SV3 A;  4F3O A;  1F21 A;  1VSD A;  2KQ2 A;  3CM5 A;  3DLG A;  3SQ2 A;  4O5B A;  4EZ9 A;  5KGX A;  3NGY A;  5FRO A;  4NYF A;  2DFF A;  2BAN A;  4CHZ A;  4E89 A;  3AVM A;  2QKK A;  4C8K A;  4KB1 A;  4F2R A;  1KSP A;  3ITH A;  4CJV A;  4FZX C;  4AHU A;  1VSL A;  4FLY A;  4DFP A;  4PY5 A;  2YV0 X;  3ZSV A;  2XRI A;  4HUE A;  4C8M A;  1U49 A;  1GOC A;  4IDK A;  1IKX A;  4LH5 A;  4HCB A;  3AVL A;  4FJG A;  1NKE A;  4IBN A;  4CEO A;  1RT6 A;  3QES A;  1L3T A;  4RW9 A;  2DFH A;  4E1M A;  4ID1 A;  1RT2 A;  3LWL A;  1BQM A;  3T19 A;  1IO2 A;  1FK9 A;  3C94 A;  3SJJ A;  1IKW A;  4HUG A;  1U47 A;  4B9T A;  4FJM A;  4OKK A;  3TI0 A;  1ZBL A;  1ZYQ A;  4DU1 A;  1TAQ A;  3IRX A;  5SWM A;  4W5O A;  3TAN A;  3L2Q A;  2FBT A;  4ICL A;  4B9U A;  1CXU A;  2QK9 A;  4CIG A;  3OJU A;  3AVF A;  3DI6 A;  4I7F A;  4FK2 A;  3OYA A;  1MU2 A;  1VK0 A;  3KKR A;  4CEZ A;  3RTV A;  4C8O A;  1FKO A;  4CED A;  4OGE A;  2HHU A;  2B4J A;  3VQ7 A;  3QLH A;  4DSK A;  4KPY A;  2D0C A;  2XY8 A;  1SKR A;  4JS4 A;  1YTU A;  2LSN A;  1TV6 A;  3V1O A;  3ZSX A;  5J2N A;  3G10 A;  1T05 A;  1J54 A;  3C6T A;  4KHN A;  5KRT A;  1JXE A;  2XY7 A;  3B6O A;  4F8R A;  4DQQ A;  1RT4 A;  3S9H A;  2HHW A;  1BI4 B;  2IOC A;  3RMC A;  2A1R A;  4B8A B;  1CZ9 A;  1RBT A;  4KTZ A;  4OKJ A;  4E7K A;  4IKF A;  1RBS A;  3TR8 A;  2WOM A;  5HBM A;  3OJS A;  3PX0 A;  3HT3 A;  1TGO A;  4CGH A;  4DG1 A;  4DFK A;  1NJW A;  4OLB A;  2G8F A;  3NH2 A;  1B92 A;  3M8S A;  4BDZ A;  4CK2 A;  3AVH A;  3EY1 A;  2HNZ A;  1SL2 A;  1XI1 A;  2VG7 A;  3NBP A;  4M3R A;  1XC9 A;  4QCL A;  1EP4 A;  1REV A;  4DQR A;  1KVA A;  4E7I A;  1JLG A;  3HPO A;  4PQU A;  3LAN A;  3VQP A;  4Z4F A;  1WAF A;  1SUQ A;  1TKX A;  4KAZ A;  3TWH A;  1TKT A;  4MQ3 A;  1BCO A;  4BAC A;  3SNN A;  2VG5 A;  4CK1 A;  3VQ9 A;  1G15 A;  1TAU A;  4FLV A;  1WAJ A;  4CEB A;  2VWJ A;  2OPR A;  3VQC A;  4DU3 A;  4DTU A;  3IAY A;  3NE6 A;  1KLN A;  3ZCM A;  3B6P A;  3KKS A;  1FXX A;  4LY7 A;  4CJS A;  5KGW A;  3KLE A;  4DLE A;  1BGX T;  4PA1 A;  4KRF A;  2HHS A;  4IG0 A;  3ZT1 A;  3O4Q A;  4CIF A;  4RW7 A;  4F4K A;  1VSM A;  1S1T A;  5J2Q A;  1IKY A;  3TAQ A;  3DOK A;  2Z1H A;  4L8R B;  4KB0 A;  3RRG A;  2F8T A;  5CY4 A;  1EXQ A;  3OYD A;  2GV9 A;  3F9K A;  1T03 A;  1RDD A;  4CJ3 A;  4KHW A;  1JKH A;  2AJQ A;  4E3S A;  4O55 A;  2IDO A;  4QAG A;  3TAR A;  3S3M A;  1JL2 A;  3MXI A;  4B9L A;  1S6Q A;  2YKM A;  3AVG A;  1NOY A;  3ZSR A;  2RN2 A;  4FM2 A;  2VWK A;  2Y1I A;  4W5N A;  1BL3 A;  1S1W A;  4R5P A;  1WSF A;  3U3Y A;  1RTJ A;  4FJH A;  4RW6 A;  1DTQ A;  4CJT A;  4HVJ A;  3SQ1 A;  4CJ4 A;  1CLQ A;  4CJF A;  3OY9 A;  4FK0 A;  3AVA A;  1RT3 A;  1VRT A;  5SZT A;  4FLT A;  3PY8 A;  4CCH A;  4CJL A;  4DQP A;  3ALY A;  2D0B A;  4RW4 A;  4M3T A;  4KHY A;  1D8Y A;  4NCA A;  2E6M A;  1VSJ A;  1UWB A;  4FJ8 A;  1T8E A;  4BE1 A;  3HO1 A;  4CJQ A;  3LP1 A;  1KLM A;  3FFI A;  3ASM A;  4GW6 A;  3RMD A;  4HTU A;  1JLE A;  1WNS A;  4FJX A;  2HHV A;  4GMJ B;  1C1C A;  5CZ2 A;  4B8C A;  2ATQ A;  1L3S A;  1S1V A;  3BGR A;  2F8S A;  1WSI A;  2P5O A;  4JRQ A;  3LP0 A;  3IS9 A;  3NCI A;  5JS1 A;  1LWE A;  1BIU A;  1VSE A;  1C1A A;  4CEA A;  3L3U A;  1TK0 A;  4EP4 A;  3F73 A;  5T7B A;  4FJJ A;  4KI6 A;  2YKN A;  1C0M A;  1W9H A;  3G0Z A;  1ASU A;  3KJV A;  4AIL C;  1WLJ A;  1WSG A;  2OPS A;  3WNG A;  4OPJ A;  3NH1 A;  1Q9X A;  2ITG A;  4W5T A;  3RR8 A;  2BE2 A;  1JL1 A;  3JYT A;  1K6Y A;  2D0A A;  5DMR A;  3ZT0 A;  4M42 A;  4FLX A;  4O44 A;  4DTM A;  3VQ5 A;  1BCM A;  5HP1 A;  3ZT2 A;  3SUQ A;  2HVH A;  3HM9 A;  2WON A;  1WSE A;  2YNF A;  1ZBU A;  3MED A;  2YNH A;  3AVI A;  4DTP A;  3LZJ A;  1BIZ A;  3OYL A;  2HW3 A;  2QXF A;  2XY6 A;  4CFB A;  4FJL A;  4MFB A;  5HRR A;  3I8D A;  3SZ2 A;  1QSS A;  4FW2 A;  2PZS A;  3SQ0 A;  3ISN C;  2OZS A;  1EX4 A;  4FCY A;  2HVI A;  2NUB A;  3DLR A;  2Q3S A;  3OYK A;  4CJK A;  4YFU A;  3T1A A;  1U45 A;  4DTS A;  1UAX A;  2RKI A;  4CF2 A;  3OYM A;  3KLH A;  4IFV A;  4OPK A;  4CF0 A;  3RMA A;  2HHX A;  3NDK A;  1BI4 A;  4Y1C A;  3AO2 A;  4Y1D A;  1TL3 A;  5C25 A;  4AHS A;  3VN5 A;  2FBX A;  2ZD1 A;  2GBZ A;  5E41 A;  4KHQ A;  1ASW A;  3KIO A;  4JS5 A;  4AHR A;  2HHT A;  1N6Q A;  3SYZ A;  1BHL A;  1JXB A;  1RNH A;  1QHT A;  4K8X A;  4FJ9 A;  1S6P A;  3KLF A;  3K57 A;  5J2M A;  4E7J A;  1UA0 A;  4CER A;  1NK7 A;  1NKB A;  3HPH A;  5FRN A;  3KD5 E;  1RT1 A;  4I2P A;  3MAQ A;  1VSK A;  4FJK A;  1RTD A;  2X74 A;  3V9S A;  1KVB A;  3CFP A;  4FM1 A;  1RIL A;  1TVR A;  4DSF A;  3SUP A; 
#chains in the Genus database with same CATH topology
 1I39 A;  2VG6 A;  1NNE A;  2E1Y A;  4B1Z A;  4DLG A;  3AVC A;  4CW7 B;  4WQ5 A;  3LDS A;  4ZHR A;  3KD1 E;  3OYG A;  3HL8 A;  3VQE A;  4IWV A;  4FOI A;  1SV5 A;  1TKZ A;  5BR9 A;  3KK3 A;  2V7Z A;  3TU5 A;  3OYN A;  3UE5 A;  3VEN A;  3HXM A;  3M8Q A;  3HI0 A;  4J2B A;  4J2E A;  1LW0 A;  4FWR A;  2A5X A;  2KLA A;  4CEE A;  3U6F A;  4GKJ K;  3TAF A;  5BRE A;  3SK3 A;  2UXC K;  3NF7 A;  1YTA A;  4MLH A;  4EZ6 A;  2G8H A;  3OYF A;  4KRE A;  4CBU A;  3QEV A;  4CEC A;  2O8F A;  4DF4 A;  2O8D A;  4M3U A;  4E7L A;  3D2E A;  1HKG A;  2UUA K;  4KO0 A;  3TAE A;  1ESV A;  2RF2 A;  2QKB A;  3NGI A;  1C6V A;  2FC0 A;  3KVG A;  5CR4 A;  2O8F B;  3JXU A;  4JI5 K;  2O8D B;  1IG8 A;  2WUS A;  3CHW A;  3P5J A;  3QFP A;  3D2E B;  3NF6 A;  4FW1 A;  4DV1 K;  5C0Y A;  5HRO A;  4ISE A;  4K25 A;  4FJI A;  3CQ8 A;  3SUO A;  1JJ2 M;  2YHW A;  2A41 A;  5KPR A;  4DS5 A;  2GUI A;  1WBD A;  1HPZ A;  2G8W A;  1TL1 A;  4CF8 A;  4EIA A;  3MDQ A;  4DS4 A;  2IS3 A;  3E01 A;  3AAR A;  5BN8 A;  4B9V A;  3VA0 A;  5FPE A;  2GUP A;  4C8L A;  1SZ2 A;  4BY9 C;  2P9K A;  1D9F A;  1D4X A;  2FBV A;  3KHY A;  2G8K A;  5LMN K;  4JRP A;  1HNI A;  1LWF A;  2EX3 A;  3NF9 A;  5CZ1 A;  1U48 A;  4EFH A;  4IOX A;  3DLH A;  3CFR A;  3U8X A;  2DTU A;  1XC3 A;  2CH5 A;  2FSJ A;  2P9K B;  3OVN A;  3QET A;  3PO5 A;  4J2D A;  3PX6 A;  5AZI A;  4WFB L;  4CF9 A;  3OBY A;  3TTC A;  4FYD A;  3CF5 L;  2P9U A;  4CJP A;  4JKC A;  1RBU A;  3F5T A;  5BR8 K;  4BRN A;  1A5X A;  3P1G A;  4CK3 A;  4JKF A;  4CE9 A;  2P9U B;  4JK9 A;  3O4N A;  3VEW A;  4QOZ B;  3ZX2 A;  4DF8 A;  1KAY A;  3U9D A;  4CFD A;  3CQY A;  4CGI A;  5C15 A;  4FLZ A;  1W0H A;  1YVN A;  5DK5 A;  4FLW A;  4B1W B;  3MWT A;  3QEX A;  2A40 A;  2NRV A;  4CJW A;  3DOL A;  4IJA A;  1L5U A;  4CHY A;  1ILY A;  2YNG A;  3T1Y K;  1K9M O;  3VGM A;  3QNN A;  3CYM A;  4BVO A;  4NYN A;  4DKW A;  5E84 A;  4M7X A;  2ZE2 A;  3SAH A;  1Q9Y A;  4BRG A;  2BGG A;  2NRW A;  1LAW A;  1HJO A;  3O9U A;  2DY4 A;  1Y97 A;  3VQ6 A;  4AQY K;  3MX2 A;  3J7Z O;  3KLG A;  5HRP A;  4B1V A;  3VTI A;  3PX4 A;  4OKE A;  5LY3 A;  3PLA A;  2Q97 A;  5KQD A;  3EKU A;  4A57 A;  5FDL A;  3TPQ A;  4MDB A;  2VCP A;  3RMB A;  1S9E A;  1S9G A;  2YJE A;  3FFK B;  4BR0 A;  4E7H A;  1QZ5 A;  1Z6R A;  3H45 C;  4CJ5 A;  1T6D A;  3K2P A;  2E5L K;  4OPH A;  3VET A;  4O0I A;  1QQC A;  4DFJ A;  2HMP A;  3EE8 A;  4LFC K;  1RDA A;  2ZQB A;  3CFO A;  1C0U A;  1WSH A;  3LM9 A;  4GY2 B;  2PYL A;  1C0T A;  3KK1 A;  5D3G A;  3HK2 A;  4CGF A;  4I6M B;  4LF9 K;  4DR6 K;  1SL1 A;  4Z4C A;  4C23 A;  2E88 A;  1JLQ A;  3CER A;  3PIP L;  3CM6 A;  4H5R A;  3EYZ A;  5ADX A;  1SQK A;  4H03 B;  2ASP A;  2OCE A;  3AVJ A;  3MN5 A;  4CZK A;  3CCV N;  1YJN N;  4FXD A;  1SAZ A;  3HRG A;  5B8H A;  4V19 S;  5AQK A;  4LF8 K;  4Z4E A;  2DPN A;  4JN4 A;  1GOA A;  3CJB A;  3AGR A;  4AM6 A;  2IGI A;  3DRS A;  2F96 A;  4CD1 A;  1IV0 A;  1VSD A;  2KQ2 A;  3SQ2 A;  4O5B A;  4EZ9 A;  5FRO A;  4E89 A;  3THX A;  4LC9 B;  4QS7 A;  4F2R A;  1HX1 A;  3CC4 N;  4PY5 A;  3ZSV A;  4HUE A;  1GOC A;  4LH5 A;  4HCB A;  3AVL A;  4IBN A;  5GIO A;  1Y64 A;  3QES A;  2W6L A;  5BRF A;  2WTU A;  2YX6 A;  5JIC A;  2QWO A;  4K42 A;  3T19 A;  3SJJ A;  3W3D A;  3IRX A;  2ASM A;  2FBT A;  2UXD K;  4B9U A;  1CXU A;  3J7Y P;  2P9S A;  4JK8 A;  3PSI A;  4GV3 A;  3OJU A;  3I56 N;  2NLX A;  4I7F A;  2Q1N A;  4BR2 A;  1VQO N;  3RTV A;  1N36 K;  3VQ7 A;  4DSK A;  5AQM A;  3AAP A;  3M5R A;  2P9S B;  3V1O A;  4JI0 K;  5KRT A;  4RTF D;  3WUH A;  4B3R K;  1RT4 A;  2HHW A;  4B8A B;  4E7K A;  2P9P A;  4X64 K;  1TGO A;  4OLB A;  2G8F A;  3NH2 A;  3NBP A;  1EP4 A;  4DQR A;  2P9P B;  3DWL A;  1TUY A;  4K0K K;  1MA9 B;  1BCO A;  3SNN A;  4CK1 A;  1TAU A;  4FLV A;  1WAJ A;  3IAY A;  4BRE A;  2OPR A;  3VQC A;  4DU3 A;  5AQG A;  4CJS A;  3KLE A;  4IG0 A;  4H0O A;  1VSM A;  1H1V A;  1IKY A;  2CH6 A;  4L8R B;  1XUP O;  4KB0 A;  3RRG A;  2F8T A;  5I9E B;  1C0F A;  2HF3 A;  1RDD A;  4CJ3 A;  4KHW A;  2HBJ A;  3L4Q A;  2QWR A;  3S3M A;  5ADX H;  4B9L A;  2CGL A;  3AVG A;  4W5N A;  5JLF A;  1WSF A;  1KAZ A;  1RTJ A;  3F9M A;  1DTQ A;  4CJT A;  1CLQ A;  4FK0 A;  3OY9 A;  4H5W A;  4DQP A;  5AQT A;  2D0B A;  4M3T A;  1D8Y A;  4NCA A;  2E6M A;  1HNX K;  3HO1 A;  4H0V B;  1NWK A;  2ATQ A;  1L3S A;  1S1V A;  4FWK A;  5AQH A;  2KKZ A;  5CE3 A;  4JRQ A;  3LP0 A;  3ENH A;  4CEA A;  4EP4 A;  3LDO A;  1W9H A;  3DLL L;  5AR0 A;  2NNW A;  1GLA G;  4BRI A;  3O6W A;  4W5T A;  3RR8 A;  2BE2 A;  3VER A;  1JCF A;  2BTF A;  1JL1 A;  3A5M C;  1K6Y A;  2QXL A;  4FLX A;  1TYQ A;  5LJW A;  4BG8 A;  3G4S N;  3SUQ A;  2GWJ A;  2I7N A;  2WON A;  2YNF A;  1S22 A;  1BIZ A;  1TYQ B;  4MFB A;  3QBW A;  2PZS A;  2E1Z A;  4BR7 A;  2OZS A;  1EX4 A;  1XNQ K;  2E8A A;  3DLR A;  4FWL A;  4YFU A;  4JKG B;  4H0P A;  4XH4 A;  5EVZ A;  1YIJ N;  4LF4 K;  4ISG A;  1BI4 A;  3AO2 A;  3CJ7 A;  5AQX A;  4AHR A;  1N32 K;  2VQF K;  4JI6 K;  1JXB A;  4K8X A;  5AQV A;  1NKB A;  3VEV A;  3KD5 E;  4XH5 A;  1WUA A;  4FJK A;  1RTD A;  1KVB A;  4FM1 A;  1TVR A;  3L2U A;  3VQ8 A;  4M3X A;  3LP3 A;  3DLB A;  2FF3 B;  3CG7 A;  5AQI A;  3LZI A;  3M8P A;  5KTQ A;  1NGH A;  4FLU A;  1XNR K;  3AO1 A;  3C7N A;  4B1Y B;  3NF8 A;  4E19 A;  4XH1 A;  1Q8I A;  3WNF A;  4CZH A;  2XY5 A;  1KFS A;  5HRS A;  2UU9 K;  3C7N B;  4CZG A;  2P9N A;  3V81 A;  1B9F A;  1NJX A;  4JI4 K;  1OH6 A;  4FWQ A;  1HYV A;  2P9L B;  4RW8 A;  2OTL N;  3PUF A;  1YI2 N;  4DFM A;  1R0A A;  1JLB A;  3CIP A;  4FM0 A;  4ELT A;  2G8V A;  4OLA A;  2F7T A;  3K5M A;  1L3U A;  1T44 A;  4BRL A;  1VHX A;  4KTW A;  2B5J A;  3AVK A;  3L3V A;  3V1R A;  1ASV A;  4MO5 A;  4FK4 A;  3WXM B;  4JLH A;  1XMQ K;  1RT7 A;  4H4M A;  1JCG A;  3MEG A;  4KKO A;  3H46 O;  3G71 N;  1L3V A;  4AHV A;  2DFE A;  3LP2 A;  4I2Q A;  3DLE A;  1Q18 A;  1UOC A;  3P83 D;  4BWM A;  3KWG A;  3LPU A;  3LDN A;  3AA2 A;  4OJR A;  2HST A;  4DSL A;  4DMN A;  4DV2 K;  2FLO A;  4LD0 A;  3LAL A;  5J2P A;  4DWI A;  4KFB A;  3BZK A;  4U67 L;  5AZJ A;  3ZT4 A;  1G99 A;  1V4T A;  4OVL A;  3KK2 A;  3CCR N;  3HVT A;  4PUO A;  2WBN A;  3C65 A;  5BPN A;  1FKP A;  3A2F A;  3ZET A;  4TSX A;  5HRN A;  5CHI A;  1WSJ A;  2OAN A;  1MDU B;  4BVP A;  1OH5 A;  4NLB A;  4CJE A;  3EKS A;  1HMV A;  3S41 A;  1RT5 A;  3E9L A;  3M8R A;  2V52 B;  3ZET B;  3QIO A;  5BPM A;  1ZBH A;  2W41 A;  1Q7Y O;  1KXP A;  4NB4 A;  3TAM A;  4CJ7 A;  4LF7 K;  3PIO L;  3CMA N;  4FOE A;  4B3O A;  4XEI A;  2PYJ A;  3AV9 A;  3KZB A;  1NMN A;  3MX5 A;  4CBX A;  3LM2 A;  1DTT A;  2IVN A;  2NRZ A;  3SBT A;  3CCQ N;  4BQZ A;  1LAV A;  2D4W A;  2NRR A;  1M1K O;  3ZX3 A;  4G1Q A;  3S3N A;  2O4G A;  2QWP A;  5C12 A;  4YDU C;  4M3Z A;  4PWD A;  4DTJ A;  2G8U A;  1C0G A;  3WNH A;  2RPI A;  4CHP A;  2FBY A;  3HP9 A;  1A5V A;  4BRC A;  1X9S A;  5AQL A;  3R1X A;  3E9P A;  2KFN A;  3K5O A;  2QWM A;  1YT3 A;  4BRA A;  4WQ4 A;  4IG3 A;  2EWS A;  4H0Y B;  4FWS A;  1S5J A;  3IG1 A;  5BRH A;  4U7B A;  1HJR A;  3D45 A;  3SI6 A;  2KW4 A;  3ULD A;  3QER A;  2D0P A;  4C8N A;  2H3G X;  4CJR A;  4B1X B;  4N76 A;  1VQL N;  1J5E K;  1KFD A;  5J1E A;  4DU4 A;  4K43 A;  4CGJ A;  3SCX A;  3BDP A;  4F3T A;  1BOT O;  3NAE A;  1O1W A;  5KRS A;  2G8I A;  3HVR A;  4DQS A;  1WOQ A;  3C6U A;  5BN9 A;  2KZZ A;  4BDY A;  3GL1 A;  3MWP A;  2YNI A;  1EKE A;  3AO3 A;  5EU7 A;  2HBM A;  4XIU A;  1NJZ A;  3EN9 A;  4I9L A;  4NCG A;  5M1Q A;  4AHT A;  3ZT3 A;  3C6H A;  3JSM A;  1W7A A;  4RG8 A;  4OPA A;  4ZTF A;  1CXQ A;  1IKV A;  3EZW A;  1J53 A;  3JS6 A;  5GAG P;  4AH9 A;  4A5A A;  3DM2 A;  4CFC A;  3QIP A;  3FZH A;  4EHT A;  4ID5 A;  1HNZ K;  2R7Y A;  1TK5 A;  1U4B A;  1KC8 O;  1JLA A;  3J7A P;  3P39 A;  4DTX A;  3SQ4 A;  3L0Q A;  4ELU A;  1ITG A;  3WNE A;  3HPG A;  4EAH D;  3ZSZ A;  4DTR A;  3DJC A;  3K58 A;  2HHH K;  1JLC A;  3DRP A;  5GAH P;  1NGC A;  3S3O A;  3L4I A;  4DSI A;  2ZJQ L;  4H5T A;  2YHA A;  5M1O A;  5EOY A;  1ZBI A;  4JI3 K;  2HB5 A;  5CYM A;  3OYH A;  2F4V K;  3TSP A;  1NGF A;  5HL7 L;  3AO5 A;  3HYF A;  1S1U A;  4ILG B;  4LF6 K;  4PL7 A;  1KTQ A;  1F21 A;  1ZC6 A;  3DLG A;  1EWQ A;  2JWL A;  4NYF A;  2BAN A;  4AHU A;  3CJ9 A;  4FLY A;  4DFP A;  4C8M A;  4CZF A;  4IDK A;  4FJG A;  1RT6 A;  4WQ5 C;  3VGL A;  5IWA K;  4E1M A;  4K41 A;  5AQP A;  3LWL A;  2QWL A;  4B9T A;  3VOV A;  1OVQ A;  3A5L C;  4IO9 L;  4DU1 A;  1TAQ A;  5SWM A;  1ZBL A;  4W5O A;  3HOS A;  4ICL A;  1YHQ N;  5KQ8 A;  4BRD A;  4CIG A;  1LOT B;  3DI6 A;  4FK2 A;  3OYA A;  4CEZ A;  3MN7 A;  3OA9 A;  4CED A;  2HHU A;  3QLH A;  2D0C A;  2XY8 A;  4JS4 A;  1TV6 A;  1BWF O;  1J54 A;  3O9T A;  1JXE A;  2IVP A;  4F8R A;  4DQQ A;  3VEY A;  4FZY A;  3JAM O;  2QW9 A;  4R79 A;  1CZ9 A;  1RBT A;  4KTZ A;  4OKJ A;  5AQZ A;  4IOA L;  1RBS A;  4DHY A;  1BU6 O;  2ASO A;  5HBM A;  4DUY K;  3UB5 A;  4CGH A;  4DG1 A;  4DFK A;  1NJW A;  1B92 A;  3M8S A;  4BDZ A;  1XI1 A;  2ZJR L;  1XC9 A;  1REV A;  2I7P A;  3HPO A;  5AJ3 K;  4KAZ A;  4MQ3 A;  3SAF A;  3VQ9 A;  1G15 A;  5E26 A;  3RSE B;  4CEB A;  1VQM N;  4JYA K;  3ZCM A;  3B6P A;  3BUZ B;  3KKS A;  3LDQ A;  4LY7 A;  5KGW A;  3VES A;  4A5B A;  2UYT A;  1I94 K;  4PA1 A;  3TTF A;  4YOY A;  3EO3 A;  4DV0 K;  2HHS A;  3IFR A;  4IDH A;  1E4G T;  1S1T A;  3TAQ A;  2Z1H A;  2NZT A;  1EQY A;  3OYD A;  3F9K A;  1KQS M;  1JKH A;  2YJF A;  4IO8 A;  4I6M A;  1NOY A;  3OBW A;  2RN2 A;  4FM2 A;  2VWK A;  1BL3 A;  3U3Y A;  1FW6 A;  4RW6 A;  4HVJ A;  3SQ1 A;  4BC2 A;  3AVA A;  1VRT A;  3PY8 A;  4JD2 A;  4KHY A;  2VQE K;  4JAX A;  5M1N A;  3MK6 A;  4GVE A;  4FJ8 A;  1T8E A;  4BE1 A;  3CCS N;  3LP1 A;  4GW6 A;  3RMD A;  3ASM A;  4HTU A;  1JLE A;  3VTH A;  3SMP A;  1MWM A;  1Q86 O;  2F8S A;  4IOC L;  2Q31 A;  2P5O A;  4IEE A;  4JD2 B;  5H1S Q;  3ULE A;  3NCI A;  2O8E A;  3H3N O;  3CQX A;  3GG4 A;  4FJJ A;  3L3U A;  4KB1 A;  4BRF A;  1WLJ A;  1WSG A;  3LDL A;  3ULE B;  1Q9X A;  2ITG A;  3AAQ A;  2O8E B;  3QIC A;  3ZT0 A;  3OHR A;  5AQU A;  4GV6 A;  4DV6 K;  4O5F A;  2HVH A;  3Q7C A;  3OYL A;  2QXF A;  4FJL A;  1RDU A;  1QSS A;  4Y0W A;  1J6Z A;  1ATS A;  3SQ0 A;  4KH4 A;  3ISN C;  4BC3 A;  1NGB A;  3FLC O;  4GKK K;  4JKH A;  5KPT A;  3OYK A;  2VGM A;  2RKI A;  1K8K B;  1IBM K;  1EO1 A;  4LF5 K;  4PHT X;  4Y1C A;  3H6E A;  3A0I X;  4DV4 K;  4NO7 A;  2FF6 A;  5E41 A;  1NM1 A;  2WFB A;  3KIO A;  4JS5 A;  3MCA B;  2HHT A;  1N6Q A;  3OW2 M;  1RNH A;  1QHT A;  4E7J A;  1UA0 A;  2V51 B;  1RT1 A;  3MAQ A;  3V9S A;  3THY A;  1VQP N;  3RVC A;  3GE1 A;  2WC9 A;  4DSF A;  4M7Y A;  4BRO A;  2OPP A;  3V9Z A;  4WYB A;  5KI6 A;  4BC5 A;  3THY B;  4FWM A;  3V4I A;  3L2W A;  1VQK N;  4A61 A;  5F0X A;  2P9I A;  3R3L A;  1YVU A;  3V9W A;  4M45 A;  1M90 O;  1D5A A;  4WF9 L;  2A6A A;  2ZJP L;  1B9D A;  5FRM A;  4JI8 K;  4HUF A;  5AQF A;  2P9I B;  4CF1 A;  4KHS A;  3I55 N;  3OTO K;  2E2P A;  1NOZ A;  2Z1G A;  3CCM N;  3LPT A;  1RBR A;  3AA3 A;  5M1K A;  3IUC A;  3O3F A;  1NJY A;  1YIT N;  2AP1 A;  3ID8 A;  4O8U A;  3WXI A;  4DSE A;  3QEI A;  2BDP A;  2IIR A;  4CFA A;  3LL3 A;  3K5L A;  1YJ9 N;  1X9M A;  2O4I A;  2OPQ A;  4NXM K;  2KFZ A;  4LSL A;  4YHH K;  1NKC A;  4QS9 A;  3THV A;  3TSU A;  1NK4 A;  4DQI A;  1RDC A;  4BE0 A;  5HLF A;  5C2D A;  3TSQ A;  3PO4 A;  1QE1 A;  3DMJ A;  4CES A;  3VF2 A;  1Z26 A;  3K9J A;  3D0P A;  4KH6 A;  1LV5 A;  3OYB A;  3V1Q A;  2Q0R A;  3T69 A;  3SPZ A;  1RTH A;  1K8A O;  4KV8 A;  3M3Z A;  1SL0 A;  3MXM A;  3EE9 A;  3I33 A;  1RDB A;  2OYQ A;  2HMI A;  3CPE A;  4DV5 K;  4JI7 K;  1U04 A;  5MLC Q;  1IH7 A;  4Z4G A;  4OGC A;  1QSL A;  4N41 A;  1QSY A;  3VQD A;  4H5V A;  4JKG A;  4CHQ A;  5TKW A;  3C95 A;  1TK8 A;  4ISF A;  2P51 A;  3J81 O;  3O3H A;  1I3A A;  2ZM6 K;  1J5O A;  4N56 A;  2Q36 A;  3QO9 A;  4CEQ A;  1LW2 A;  3L2R A;  4IXC A;  3O9S A;  2F9T A;  4Q5V A;  3TTD A;  4N5S A;  2RE2 A;  2Z1I A;  5C10 A;  5CYQ A;  3FZK A;  4HHT A;  4BRM A;  1NGA A;  3U9Z A;  4W5Q A;  1HRH A;  1XWL A;  3PSF A;  1VSI A;  2ETJ A;  2HNY A;  2XHB A;  3T1H K;  3MMV A;  3DRR A;  4Z4I A;  5IT9 O;  3F2K A;  3CC2 N;  3W0L A;  4WCE L;  3VF6 A;  4BWJ A;  1QS4 A;  3BEX A;  2XO7 A;  3TAP A;  4CZM A;  4ILJ A;  5AQY A;  1N5Y A;  1VSH A;  1RDW X;  1NJI O;  4KI4 A;  3FGU A;  1NK6 A;  1IG9 A;  2D1K A;  1NK5 A;  3NH0 A;  4B9M A;  3O80 A;  4KHU A;  1NK8 A;  1U2V B;  2P9L A;  2PY5 A;  3DLK A;  5JS2 A;  3UIQ A;  3HJF A;  5AFU A;  3DYA A;  2VYP A;  1HYZ A;  1NK9 A;  2JLE A;  3OYE A;  1CZB A;  3AA5 X;  2A3Z A;  1HQE A;  2E2Q A;  1WN7 A;  3LAK A;  4YNQ A;  1BA1 A;  3NHG A;  1VQ8 N;  3A8Y A;  3L8B A;  4JKA A;  3MXJ A;  3SBG A;  4M3W A;  1WB9 A;  3VA3 A;  2OZM A;  3AO4 A;  1SKW A;  2YI1 A;  2BH1 A;  1A5W A;  3HST B;  2A42 A;  1ATN A;  4H0T B;  3O9Q A;  4CJU A;  3EL2 A;  3NGZ A;  3O5B A;  3E66 A;  1HPM A;  2E6L A;  2FSN A;  2ZF5 O;  3E9O A;  4LH4 A;  3E1Y A;  3ZSY A;  4CVN E;  1ZXO A;  2UUB K;  1WBB A;  4FPA A;  3RR7 A;  3ENO A;  3OS1 A;  3TAG A;  1GOB A;  2E4L A;  2Q2R A;  1Q81 O;  4DB3 A;  4Z0U A;  3CET A;  4J8F A;  4PL8 A;  2HOE A;  1BIS A;  4W5R A;  4FZZ A;  3MN6 A;  1XQS C;  1HQU A;  4NCB A;  4LFB K;  3U3G A;  1IBK K;  5LMU K;  4M41 A;  4JHD B;  3WEE A;  4B9S A;  2VWB A;  3WXL A;  1EET A;  4B1U B;  5FPN A;  1E4F T;  1RTI A;  1EWR A;  4N47 A;  3D2F A;  4EP5 A;  3WEE B;  3SV3 A;  4CZJ A;  4IZ9 A;  3B8A X;  3A5O C;  3NGY A;  3P31 A;  4C8K A;  3AVM A;  3ITH A;  3D2F B;  4CJV A;  1VSL A;  3HM8 A;  3FZL A;  1IKX A;  5FPD A;  1NGJ A;  1DT9 A;  1L3T A;  4RW9 A;  2DFH A;  3ATU A;  4JKE A;  4NXN K;  1BA0 A;  4ID1 A;  4JI1 K;  3CD6 N;  5GAD P;  3C94 A;  3QDK A;  5JVG L;  4IJN A;  5EY4 A;  1ZYQ A;  5M1F A;  5JMV A;  3FR0 A;  2QK9 A;  1RGI A;  2NRH A;  3AVF A;  2NRT A;  3CCU N;  3ZYY X;  1VK0 A;  3KKR A;  3CXC M;  1NGE A;  1FKO A;  1U6Z A;  4KPY A;  1CZA N;  5AFU H;  1SKR A;  2LSN A;  4YOR A;  5J2N A;  3ZSX A;  1IBL K;  4RCH A;  4KHN A;  4A2B A;  3B6O A;  4KBO A;  4PKH A;  1OH7 A;  2QTD A;  2IOC A;  1NGG A;  5LL6 Z;  4JKD A;  1GLE G;  3AVH A;  2HNZ A;  3UKR A;  1SS6 A;  4QCL A;  1IJJ A;  1KVA A;  5AQJ A;  1JLG A;  3K9K A;  5JVH L;  4CZL A;  3LAN A;  4Z4F A;  5GAE P;  1HUX A;  1SUQ A;  4GNI A;  3TWH A;  3D7E O;  4BAC A;  3UKR B;  3H1V X;  1S3X A;  4DTU A;  1NU0 A;  4OX9 K;  1S72 N;  4OO1 J;  4FWN A;  3CJA A;  1FXX A;  3J80 O;  4F9O A;  4DLE A;  1BGX T;  2D0O A;  3ZT1 A;  3O4Q A;  4RW7 A;  2NRX A;  5DM6 L;  5CY4 A;  1EXQ A;  2GV9 A;  4WFA L;  1T03 A;  3L6Q A;  2PBD A;  4E3S A;  4O55 A;  4JNE A;  2J4R A;  2IDO A;  4QAG A;  3TAR A;  2GEL A;  3MXI A;  4G9Z A;  2YKM A;  2VGN A;  3ZSR A;  2Y1I A;  1S1W A;  4R5P A;  4FJH A;  4PKG A;  3P38 A;  1VQ7 N;  4CJF A;  1OVY A;  5SZT A;  4FLT A;  4CCH A;  3ALY A;  4DR4 K;  4CJQ A;  3FFI A;  3FZF A;  4FJX A;  1WNS A;  4B3S K;  4GMJ B;  3CCL N;  1WSI A;  4X65 K;  3KWI A;  3H1Q A;  5JS1 A;  1XMO K;  3AY9 A;  1QQN A;  3MN9 A;  1C1A A;  2CGK A;  2KHO A;  4YOU A;  1TK0 A;  3F73 A;  1KD1 O;  5T7B A;  4KI6 A;  2YKN A;  3G0Z A;  3KJV A;  4BRK A;  4AIL C;  2OPS A;  1NBW A;  1O13 A;  3WNG A;  4C1N K;  2Q0U A;  4FWP A;  2BUP A;  5DMR A;  4M42 A;  3HZ6 A;  4O44 A;  4JI2 K;  3VQ5 A;  1BCM A;  4DTM A;  5HP1 A;  4JK7 A;  3BF3 A;  4A62 A;  1WSE A;  4DTP A;  2HW3 A;  3HOT A;  1X3M A;  2XY6 A;  4JKB A;  2F9W A;  3I8D A;  4WQ4 C;  4CZE A;  2V7Y A;  5TKY A;  4FWO A;  2ITM A;  2NUB A;  4B3M K;  2HVI A;  2PAV A;  2Q3S A;  4BRQ A;  3QBX A;  4DTS A;  5AZI B;  3O8M A;  1UAX A;  4PKI A;  3OYM A;  1OH8 A;  4CF0 A;  3I8B A;  3RMA A;  2HHX A;  4FPB A;  3DXK A;  5C25 A;  2ZD1 A;  2GBZ A;  1BUP A;  3GDQ A;  4KHQ A;  3NVM A;  3AGK A;  1HKB A;  4BG9 A;  5M1P A;  3SYZ A;  1BHL A;  3ZEU A;  3SJH A;  4FJ9 A;  1S6P A;  3VEX A;  4BQL A;  3K57 A;  5J2M A;  3DXK B;  1NK7 A;  3C0B A;  3HPH A;  5FRN A;  4I2P A;  1VQ4 N;  1VSK A;  5AQQ A;  4DV3 K;  1X3N A;  3CFP A;  3SAG A;  1RIL A;  3ZEU B;  1R59 O;  1NLV A;  3RSE A;  2AA4 A;  3LAM A;  1S1X A;  3I0S A;  4BGA A;  3KTQ A;  3QB0 A;  2E2O A;  4IEI A;  1GLJ O;  3CCE N;  1ZBF A;  1VQ6 N;  2IAJ A;  1X9W A;  4FJN A;  4E1N A;  4O8K A;  4BR9 A;  3V9X A;  2HHQ A;  4BR5 A;  2OTJ N;  4FVM A;  3RWU A;  3WXJ A;  1HLU A;  3R8E A;  2GX9 A;  1W97 L;  4K8Z A;  4AF1 A;  5K14 A;  4DTO A;  3OS2 A;  1QQO A;  3M6G A;  1HNV A;  1RBV A;  1X1P A;  4BRP A;  2PFU A;  1YXQ A;  1FJG K;  3MEC A;  3VQB A;  4DV7 K;  1KRP A;  5FPM A;  4WE1 A;  1QVF M;  3OS0 A;  3OYJ A;  3H3O B;  1YUW A;  3AVN A;  4BGB A;  3SV4 A;  3QFU A;  3SMS A;  4CEF A;  1D9D A;  3SLC A;  1P90 A;  1VSF A;  3O9R A;  4YOX A;  3AA4 A;  4CGD A;  1VAZ A;  1LWC A;  4O0J A;  4H0X B;  4EHU A;  4GVM A;  5FLX O;  1NGI A;  2I5J A;  3ATV A;  4CGG A;  3VQA A;  3I0R A;  4BDP A;  4HCC A;  3L2V A;  1RFQ A;  1Z05 A;  4E0D A;  2HND A;  3NFA A;  3CI5 A;  1UA1 A;  3LWM A;  4Z4H A;  4LSN A;  1N8R O;  3TAB A;  2O8C A;  3N4P A;  2X6S A;  4Q0B A;  4BR4 A;  3QIN A;  1XHX A;  5AQW A;  2GTD A;  4H4O A;  3AVB A;  3ENB A;  3BY5 A;  2KZM A;  4IFE A;  3PV8 A;  3ZSW A;  4WFN L;  1X9J A;  1NK0 A;  2O8C B;  1GLC G;  1BDG A;  5AQO A;  2QM1 A;  1E3M A;  3T7Z A;  4DR3 K;  4B9Q A;  4NLC A;  4H8K A;  2UUC K;  4GV9 A;  1K8K A;  1QZ6 A;  4L3Q A;  3KLI A;  4CIE A;  5BPL A;  1GLD G;  2P1J A;  3VEZ A;  3H08 A;  3VQ4 A;  1OKJ A;  1JCE A;  4B3T K;  1HKC A;  5DM7 L;  3Q7B A;  4ELV A;  1Z25 A;  3THX B;  4B9N A;  2IC3 A;  4AHC A;  1V4S A;  4DQ8 A;  4YY3 K;  1P8Z A;  4YOW A;  5I3U A;  4FJ7 A;  2W40 A;  1QVG M;  4KTQ A;  1T7P A;  3RRH A;  3ZSQ A;  3ZSO A;  3ID6 A;  3V9U A;  1HYS A;  3HBT A;  1NMD A;  3O3G A;  4H5N A;  4CHO A;  3VEO A;  3OYC A;  4BE2 A;  3T3F A;  2B6A A;  2QWQ A;  2KTQ A;  2OA8 A;  4DR7 K;  1JLF A;  2YHY A;  2ZGZ A;  1KCF A;  3THW A;  4RWT A;  1GLF O;  2X6N A;  1Q82 O;  4A59 A;  5AQS A;  4O4G A;  1W2B M;  4QS8 A;  3G25 A;  3SUN A;  2Y1J A;  4A2A A;  3WQT A;  1XHZ A;  2W42 A;  3THW B;  3R6M A;  3VF4 A;  5JLH A;  1K73 O;  4DCH A;  1T6C A;  4ZTJ A;  2A1S A;  4J2A A;  3MEE A;  1VRU A;  1KVC A;  1QTM A;  3FE1 A;  2YHB A;  5EXW A;  4FVU A;  4YOV A;  5C42 A;  3VGK A;  1DLO A;  4IFY A;  2W6K A;  3CCJ N;  4FJ5 A;  3V6D A;  4M3Y A;  3QEP A;  2QA4 N;  2FXU A;  4FSV A;  4E1J A;  3QEW A;  5C24 A;  1BO5 O;  4F2S A;  2D5R A;  2X78 A;  4CD3 A;  3VQQ A;  4DTN A;  2QEX N;  3OYI A;  1TKD A;  3NVK A;  3QNO A;  3D6R A;  5BRD A;  2Z1J A;  3K5N A;  5I42 A;  3O1B A;  4CHN A;  4I9Q A;  4B08 A;  4X66 K;  1C1B A;  2EHG A;  2QI2 A;  4UQG A;  1SKS A;  3K59 A;  1ATR A;  3WXK A;  1RCH A;  3CME N;  4UY8 O;  5C2F A;  1J9A A;  3VPZ A;  1QHA A;  4KHP K;  3EZ5 A;  2P5G A;  1BQN A;  4HWI A;  2JGU A;  3SPY A;  3CJ1 A;  2FSK A;  3HP6 A;  4F3O A;  4ILH A;  5ELZ A;  3DXM A;  3CM5 A;  4MDA A;  3A5N C;  2HBL A;  5KGX A;  4CHZ A;  5KPZ A;  2QKK A;  2DFF A;  3K0S A;  5AQN A;  1KSP A;  1HNW K;  4FZX C;  3FZM A;  2UXB K;  3DXM B;  4AM7 A;  2YV0 X;  1N33 K;  2XRI A;  1U49 A;  1VQN N;  1NKE A;  3CPW M;  3IDH A;  4CEO A;  4LFA K;  3CC7 N;  5LJV A;  1NG9 A;  1RT2 A;  3J8A A;  1BQM A;  1VQ9 N;  1IO2 A;  1FK9 A;  1U47 A;  1IKW A;  4HUG A;  4FJM A;  4OKK A;  3TI0 A;  3TAN A;  3ZLJ A;  3L2Q A;  3BF1 A;  4DR5 K;  2GEM A;  1KAX A;  1DEJ A;  4HTL A;  3IKM A;  1MWK A;  1MU2 A;  4C8O A;  2QWN A;  4OGE A;  2B4J A;  1YTU A;  2IVO A;  1U2V A;  2HF4 A;  3G10 A;  1T05 A;  3C6T A;  4JV5 K;  2XY7 A;  3IMX A;  4BC4 A;  3NMU A;  3S9H A;  3O08 A;  1BI4 B;  2A1R A;  3RMC A;  4DSJ A;  4IKF A;  3TR8 A;  2WOM A;  3U4L A;  3OJS A;  3PX0 A;  2GWK A;  3HT3 A;  3C6A A;  4CK2 A;  3EY1 A;  1SL2 A;  4X62 K;  2VG7 A;  4M3R A;  4E7I A;  4PQU A;  3M1F A;  3VQP A;  1WAF A;  1TKX A;  2E20 A;  1TKT A;  2VG5 A;  4Z94 A;  4DR2 K;  2VWJ A;  1DGK N;  3NE6 A;  4FO0 A;  4BRH A;  1YJW N;  1KLN A;  4YDU A;  3P4I A;  4KRF A;  4CZI A;  4M63 C;  3QML A;  3VMF B;  4CIF A;  4F4K A;  3EEQ A;  5J2Q A;  3DOK A;  1LCU A;  2YHX A;  3GOI A;  2O8B A;  3G6E N;  4YOT A;  1NGD A;  4DUZ K;  2CGJ A;  3UKU A;  2AJQ A;  4FL9 A;  3HTV A;  2P9N B;  5HOO A;  1JL2 A;  1S6Q A;  2O8B B;  4KH5 A;  3UKU B;  4JEP A;  1T3V A;  4CJ4 A;  1GLB G;  1RT3 A;  4CJL A;  4RW4 A;  4JHD A;  1VSJ A;  1UWB A;  1KLM A;  3CJC A;  2HHV A;  5CZ2 A;  1C1C A;  3BZC A;  4B8C A;  3BGR A;  5A2Q O;  1HR0 K;  3IS9 A;  1LWE A;  5F1X A;  1BIU A;  1VSE A;  1QQM A;  3O1W A;  2E2N A;  1C0M A;  1ASU A;  4MLE A;  4OPJ A;  3NH1 A;  1YAG A;  5F2R A;  3JYT A;  2D0A A;  3ZX0 A;  1ZBS A;  1BG3 A;  5GIN A;  3ZT2 A;  3KK7 A;  2RHK A;  3HM9 A;  2ZWH A;  5AZJ B;  1ZBU A;  3MED A;  2YNH A;  3AVI A;  4DR1 K;  3LZJ A;  2JWK A;  1N34 K;  4CFB A;  2HBK A;  3N4Q A;  5HRR A;  3SZ2 A;  3R9P A;  4MO4 A;  4FW2 A;  1YF5 L;  3LDP A;  4FCY A;  5GIP A;  3HSC A;  4CBW A;  4CI6 A;  1GLL O;  4C1N I;  4CJK A;  3T1A A;  1U45 A;  4CF2 A;  3KLH A;  3MCP A;  4IFV A;  4OPK A;  3BP8 A;  5AQR A;  3NDK A;  3O4W A;  5EX5 A;  3DAW A;  4Y1D A;  1TL3 A;  4AHS A;  3VN5 A;  2FBX A;  1ASW A;  2YCH A;  3KLF A;  1DKG D;  3WT0 A;  4CER A;  2ZGY A;  1VQ5 N;  2X74 A;  3WQU A;  1TUU A;  3GBT A;  3SUP A; 
#chains in the Genus database with same CATH homology
 1I39 A;  2VG6 A;  3L2U A;  4DLG A;  3AVC A;  2OPP A;  3VQ8 A;  3V9Z A;  3LP3 A;  4M3X A;  3LAM A;  1S1X A;  3LDS A;  3I0S A;  5KI6 A;  4ZHR A;  3DLB A;  3KTQ A;  3LZI A;  3CG7 A;  3KD1 E;  3OYG A;  3M8P A;  5KTQ A;  3HL8 A;  4FLU A;  3VQE A;  3L2W A;  3V4I A;  1SV5 A;  3AO1 A;  3V9W A;  1YVU A;  1ZBF A;  4M45 A;  2IAJ A;  1D5A A;  1TKZ A;  1X9W A;  3NF8 A;  3KK3 A;  4FJN A;  4E19 A;  4E1N A;  1B9D A;  3OYN A;  5FRM A;  3HXM A;  3M8Q A;  1Q8I A;  3WNF A;  1LW0 A;  3V9X A;  2XY5 A;  4HUF A;  1KFS A;  4J2B A;  4J2E A;  4FVM A;  4CEE A;  5HRS A;  3RWU A;  4CF1 A;  3U6F A;  4KHS A;  3V81 A;  1B9F A;  1NJX A;  4K8Z A;  3TAF A;  1NOZ A;  2Z1G A;  5K14 A;  1HYV A;  3LPT A;  4RW8 A;  4DTO A;  3NF7 A;  1RBR A;  3PUF A;  4DFM A;  1YTA A;  3OS2 A;  3AA3 A;  1HNV A;  1R0A A;  1JLB A;  4EZ6 A;  1RBV A;  1X1P A;  3O3F A;  1NJY A;  4FM0 A;  3OYF A;  2G8H A;  4ELT A;  2G8V A;  4KRE A;  4OLA A;  3MEC A;  3VQB A;  1KRP A;  3QEV A;  3K5M A;  4CEC A;  1L3U A;  4WE1 A;  4DSE A;  4KTW A;  3OS0 A;  3OYJ A;  4DF4 A;  3QEI A;  2B5J A;  2BDP A;  4M3U A;  3AVK A;  4CFA A;  4E7L A;  3K5L A;  3L3V A;  1X9M A;  2O4I A;  3V1R A;  3AVN A;  4KO0 A;  1ASV A;  2OPQ A;  4FK4 A;  2KFZ A;  3TAE A;  3SV4 A;  4JLH A;  2RF2 A;  4LSL A;  1NKC A;  4CEF A;  2QKB A;  3THV A;  3NGI A;  1D9D A;  1C6V A;  2FC0 A;  1NK4 A;  1RT7 A;  4H4M A;  4DQI A;  3MEG A;  4KKO A;  1VSF A;  1RDC A;  3P5J A;  4BE0 A;  1L3V A;  4AHV A;  5HLF A;  3NF6 A;  2DFE A;  3AA4 A;  4FW1 A;  4CGD A;  3LP2 A;  4I2Q A;  1LWC A;  3DLE A;  1UOC A;  3P83 D;  5HRO A;  4O0J A;  4BWM A;  4FJI A;  3CQ8 A;  3LPU A;  3SUO A;  3PO4 A;  3AA2 A;  4GVM A;  1QE1 A;  2I5J A;  4OJR A;  3DMJ A;  4DSL A;  4CES A;  4CGG A;  3VQA A;  3I0R A;  4DS5 A;  2GUI A;  3L2V A;  4BDP A;  4HCC A;  4DMN A;  4LD0 A;  4E0D A;  1HPZ A;  2HND A;  3NFA A;  1Z26 A;  1UA1 A;  3LWM A;  2G8W A;  3LAL A;  5J2P A;  1TL1 A;  4DWI A;  4CF8 A;  4KFB A;  3D0P A;  1LV5 A;  4Z4H A;  3V1Q A;  3OYB A;  4DS4 A;  2IS3 A;  3E01 A;  3ZT4 A;  4LSN A;  4B9V A;  3TAB A;  3SPZ A;  1RTH A;  3VA0 A;  4C8L A;  2X6S A;  4KV8 A;  4OVL A;  3KK2 A;  4Q0B A;  1SL0 A;  3QIN A;  1XHX A;  3HVT A;  4PUO A;  1D9F A;  4H4O A;  3AVB A;  3MXM A;  2KZM A;  1RDB A;  2OYQ A;  3PV8 A;  2HMI A;  3ZSW A;  2FBV A;  1FKP A;  3A2F A;  2G8K A;  4JRP A;  1NK0 A;  1HNI A;  1LWF A;  2EX3 A;  3NF9 A;  4TSX A;  1U04 A;  5CZ1 A;  5HRN A;  1U48 A;  3DLH A;  1WSJ A;  3CFR A;  1IH7 A;  4Z4G A;  2DTU A;  3QET A;  3OVN A;  3PO5 A;  4OGC A;  4CJE A;  4J2D A;  1QSL A;  4N41 A;  1HMV A;  1RT5 A;  1QSY A;  4H8K A;  3VQD A;  3PX6 A;  3M8R A;  4CHQ A;  3C95 A;  3QIO A;  4CF9 A;  1TK8 A;  1ZBH A;  2P51 A;  3KLI A;  4FYD A;  3O3H A;  4CIE A;  1I3A A;  1J5O A;  2P1J A;  3TAM A;  4N56 A;  3H08 A;  3VQ4 A;  4CJP A;  3QO9 A;  4CEQ A;  1LW2 A;  3L2R A;  4B3O A;  2PYJ A;  1RBU A;  3AV9 A;  4Q5V A;  1A5X A;  3P1G A;  4CK3 A;  2Z1I A;  4CE9 A;  4N5S A;  4ELV A;  5CYQ A;  1Z25 A;  3O4N A;  4HHT A;  4B9N A;  2IC3 A;  4QOZ B;  4DF8 A;  4AHC A;  1DTT A;  4CFD A;  4W5Q A;  4CGI A;  4FLZ A;  1HRH A;  1XWL A;  1VSI A;  1W0H A;  5I3U A;  2ETJ A;  4FJ7 A;  1LAV A;  5DK5 A;  4FLW A;  1T7P A;  4KTQ A;  3RRH A;  3ZSQ A;  2HNY A;  2XHB A;  3ZSO A;  4DSJ A;  4G1Q A;  3QEX A;  3DRR A;  2O4G A;  3S3N A;  4Z4I A;  3V9U A;  4CJW A;  4M3Z A;  1HYS A;  3DOL A;  4PWD A;  4DTJ A;  1L5U A;  4CHY A;  2G8U A;  3WNH A;  4BWJ A;  2RPI A;  4CHP A;  2FBY A;  2YNG A;  1A5V A;  1QS4 A;  3HP9 A;  1X9S A;  3O3G A;  2XO7 A;  3TAP A;  4CHO A;  1N5Y A;  1VSH A;  3OYC A;  4BE2 A;  4KI4 A;  2KFN A;  1NK6 A;  3T3F A;  2B6A A;  3K5O A;  3QNN A;  2KTQ A;  3CYM A;  1YT3 A;  4NYN A;  2OA8 A;  1IG9 A;  4IG3 A;  1JLF A;  2ZE2 A;  1NK5 A;  1S5J A;  3IG1 A;  1Q9Y A;  1HJR A;  3D45 A;  3SI6 A;  2BGG A;  2KW4 A;  3NH0 A;  4B9M A;  3ULD A;  3QER A;  4C8N A;  1LAW A;  4CJR A;  2DY4 A;  1KCF A;  4KHU A;  1NK8 A;  4N76 A;  1Y97 A;  1KFD A;  2PY5 A;  3DLK A;  5JS2 A;  3VQ6 A;  2X6N A;  3UIQ A;  3HJF A;  5J1E A;  4DU4 A;  3SCX A;  4CGJ A;  3KLG A;  5HRP A;  3BDP A;  4F3T A;  4O4G A;  3NAE A;  1O1W A;  3DYA A;  4OKE A;  5KRS A;  3PX4 A;  2G8I A;  3SUN A;  1HYZ A;  3HVR A;  2Y1J A;  1XHZ A;  4DQS A;  1NK9 A;  2JLE A;  3OYE A;  3C6U A;  1CZB A;  3AA5 X;  2W42 A;  5FDL A;  2KZZ A;  1HQE A;  3RMB A;  1WN7 A;  1S9E A;  1S9G A;  4BDY A;  2YNI A;  1EKE A;  3AO3 A;  4ZTJ A;  3LAK A;  5EU7 A;  4YNQ A;  3NHG A;  2A1S A;  4E7H A;  4J2A A;  3MEE A;  4XIU A;  1VRU A;  1KVC A;  3L8B A;  1QTM A;  1NJZ A;  2YHB A;  4I9L A;  4CJ5 A;  3K2P A;  3MXJ A;  4NCG A;  4M3W A;  3VA3 A;  5C42 A;  2OZM A;  4AHT A;  1DLO A;  3AO4 A;  4IFY A;  1QQC A;  4O0I A;  3ZT3 A;  1SKW A;  4FJ5 A;  1A5W A;  3JSM A;  4DFJ A;  4RG8 A;  3HST B;  4ZTF A;  1CXQ A;  3V6D A;  4M3Y A;  1RDA A;  1IKV A;  2ZQB A;  3QEP A;  1J53 A;  4AH9 A;  4CJU A;  3DM2 A;  3CFO A;  1C0U A;  3NGZ A;  4CFC A;  1WSH A;  3QIP A;  2E6L A;  4ID5 A;  4LH4 A;  3QEW A;  5C24 A;  2R7Y A;  4F2S A;  1TK5 A;  3ZSY A;  2PYL A;  2D5R A;  1U4B A;  2X78 A;  1JLA A;  3VQQ A;  1C0T A;  4DTN A;  3RR7 A;  3OYI A;  4DTX A;  3OS1 A;  3TAG A;  1GOB A;  2E4L A;  3SQ4 A;  1TKD A;  3QNO A;  3KK1 A;  5D3G A;  3HK2 A;  2HHQ A;  4CGF A;  4ELU A;  4FZY A;  1ITG A;  4Z0U A;  2Z1J A;  3HPG A;  3WNE A;  3ZSZ A;  3K5N A;  4DTR A;  5I42 A;  4CHN A;  1SL1 A;  4I9Q A;  1BIS A;  4B08 A;  4Z4C A;  3K58 A;  1JLC A;  3DRP A;  4W5R A;  1JLQ A;  1C1B A;  2EHG A;  4FZZ A;  3S3O A;  3CM6 A;  4UQG A;  1SKS A;  3EYZ A;  3K59 A;  1HQU A;  4DSI A;  4NCB A;  1RCH A;  3AVJ A;  4FXD A;  2YHA A;  3U3G A;  4Z4E A;  1ZBI A;  4M41 A;  1J9A A;  1GOA A;  2HB5 A;  4B9S A;  1EET A;  5CYM A;  3EZ5 A;  2P5G A;  1BQN A;  3OYH A;  2JGU A;  2IGI A;  3SPY A;  3DRS A;  1RTI A;  3AO5 A;  3HYF A;  1S1U A;  4N47 A;  3HP6 A;  4EP5 A;  2F96 A;  1KTQ A;  3SV3 A;  4F3O A;  1F21 A;  1VSD A;  2KQ2 A;  3CM5 A;  3DLG A;  3SQ2 A;  4O5B A;  4EZ9 A;  5KGX A;  3NGY A;  5FRO A;  4NYF A;  2DFF A;  2BAN A;  4CHZ A;  4E89 A;  3AVM A;  2QKK A;  4C8K A;  4KB1 A;  4F2R A;  1KSP A;  3ITH A;  4CJV A;  4FZX C;  4AHU A;  1VSL A;  4FLY A;  4DFP A;  4PY5 A;  2YV0 X;  3ZSV A;  2XRI A;  4HUE A;  4C8M A;  1U49 A;  1GOC A;  4IDK A;  1IKX A;  4LH5 A;  4HCB A;  3AVL A;  4FJG A;  1NKE A;  4IBN A;  4CEO A;  1RT6 A;  3QES A;  1L3T A;  4RW9 A;  2DFH A;  4E1M A;  4ID1 A;  1RT2 A;  3LWL A;  1BQM A;  3T19 A;  1IO2 A;  1FK9 A;  3C94 A;  3SJJ A;  1IKW A;  4HUG A;  1U47 A;  4B9T A;  4FJM A;  4OKK A;  3TI0 A;  1ZBL A;  1ZYQ A;  4DU1 A;  1TAQ A;  3IRX A;  5SWM A;  4W5O A;  3TAN A;  3L2Q A;  2FBT A;  4ICL A;  4B9U A;  1CXU A;  2QK9 A;  4CIG A;  3OJU A;  3AVF A;  3DI6 A;  4I7F A;  4FK2 A;  3OYA A;  1MU2 A;  1VK0 A;  3KKR A;  4CEZ A;  3RTV A;  4C8O A;  1FKO A;  4CED A;  4OGE A;  2HHU A;  2B4J A;  3VQ7 A;  3QLH A;  4DSK A;  4KPY A;  2D0C A;  2XY8 A;  1SKR A;  4JS4 A;  1YTU A;  2LSN A;  1TV6 A;  3V1O A;  3ZSX A;  5J2N A;  3G10 A;  1T05 A;  1J54 A;  3C6T A;  4KHN A;  5KRT A;  1JXE A;  2XY7 A;  3B6O A;  4F8R A;  4DQQ A;  1RT4 A;  3S9H A;  2HHW A;  1BI4 B;  2IOC A;  3RMC A;  2A1R A;  4B8A B;  1CZ9 A;  1RBT A;  4KTZ A;  4OKJ A;  4E7K A;  4IKF A;  1RBS A;  3TR8 A;  2WOM A;  5HBM A;  3OJS A;  3PX0 A;  3HT3 A;  1TGO A;  4CGH A;  4DG1 A;  4DFK A;  1NJW A;  4OLB A;  2G8F A;  3NH2 A;  1B92 A;  3M8S A;  4BDZ A;  4CK2 A;  3AVH A;  3EY1 A;  2HNZ A;  1SL2 A;  1XI1 A;  2VG7 A;  3NBP A;  4M3R A;  1XC9 A;  4QCL A;  1EP4 A;  1REV A;  4DQR A;  1KVA A;  4E7I A;  1JLG A;  3HPO A;  4PQU A;  3LAN A;  3VQP A;  4Z4F A;  1WAF A;  1SUQ A;  1TKX A;  4KAZ A;  3TWH A;  1TKT A;  4MQ3 A;  1BCO A;  4BAC A;  3SNN A;  2VG5 A;  4CK1 A;  3VQ9 A;  1G15 A;  1TAU A;  4FLV A;  1WAJ A;  4CEB A;  2VWJ A;  2OPR A;  3VQC A;  4DU3 A;  4DTU A;  3IAY A;  3NE6 A;  1KLN A;  3ZCM A;  3B6P A;  3KKS A;  1FXX A;  4LY7 A;  4CJS A;  5KGW A;  3KLE A;  4DLE A;  1BGX T;  4PA1 A;  4KRF A;  2HHS A;  4IG0 A;  3ZT1 A;  3O4Q A;  4CIF A;  4RW7 A;  4F4K A;  1VSM A;  1S1T A;  5J2Q A;  1IKY A;  3TAQ A;  3DOK A;  2Z1H A;  4L8R B;  4KB0 A;  3RRG A;  2F8T A;  5CY4 A;  1EXQ A;  3OYD A;  2GV9 A;  3F9K A;  1T03 A;  1RDD A;  4CJ3 A;  4KHW A;  1JKH A;  2AJQ A;  4E3S A;  4O55 A;  2IDO A;  4QAG A;  3TAR A;  3S3M A;  1JL2 A;  3MXI A;  4B9L A;  1S6Q A;  2YKM A;  3AVG A;  1NOY A;  3ZSR A;  2RN2 A;  4FM2 A;  2VWK A;  2Y1I A;  4W5N A;  1BL3 A;  1S1W A;  4R5P A;  1WSF A;  3U3Y A;  1RTJ A;  4FJH A;  4RW6 A;  1DTQ A;  4CJT A;  4HVJ A;  3SQ1 A;  4CJ4 A;  1CLQ A;  4CJF A;  3OY9 A;  4FK0 A;  3AVA A;  1RT3 A;  1VRT A;  5SZT A;  4FLT A;  3PY8 A;  4CCH A;  4CJL A;  4DQP A;  3ALY A;  2D0B A;  4RW4 A;  4M3T A;  4KHY A;  1D8Y A;  4NCA A;  2E6M A;  1VSJ A;  1UWB A;  4FJ8 A;  1T8E A;  4BE1 A;  3HO1 A;  4CJQ A;  3LP1 A;  1KLM A;  3FFI A;  3ASM A;  4GW6 A;  3RMD A;  4HTU A;  1JLE A;  1WNS A;  4FJX A;  2HHV A;  4GMJ B;  1C1C A;  5CZ2 A;  4B8C A;  2ATQ A;  1L3S A;  1S1V A;  3BGR A;  2F8S A;  1WSI A;  2P5O A;  4JRQ A;  3LP0 A;  3IS9 A;  3NCI A;  5JS1 A;  1LWE A;  1BIU A;  1VSE A;  1C1A A;  4CEA A;  3L3U A;  1TK0 A;  4EP4 A;  3F73 A;  5T7B A;  4FJJ A;  4KI6 A;  2YKN A;  1C0M A;  1W9H A;  3G0Z A;  1ASU A;  3KJV A;  4AIL C;  1WLJ A;  1WSG A;  2OPS A;  3WNG A;  4OPJ A;  3NH1 A;  1Q9X A;  2ITG A;  4W5T A;  3RR8 A;  2BE2 A;  1JL1 A;  3JYT A;  1K6Y A;  2D0A A;  5DMR A;  3ZT0 A;  4M42 A;  4FLX A;  4O44 A;  4DTM A;  3VQ5 A;  1BCM A;  5HP1 A;  3ZT2 A;  3SUQ A;  2HVH A;  3HM9 A;  2WON A;  1WSE A;  2YNF A;  1ZBU A;  3MED A;  2YNH A;  3AVI A;  4DTP A;  3LZJ A;  1BIZ A;  3OYL A;  2HW3 A;  2QXF A;  2XY6 A;  4CFB A;  4FJL A;  4MFB A;  5HRR A;  3I8D A;  3SZ2 A;  1QSS A;  4FW2 A;  2PZS A;  3SQ0 A;  3ISN C;  2OZS A;  1EX4 A;  4FCY A;  2HVI A;  2NUB A;  3DLR A;  2Q3S A;  3OYK A;  4CJK A;  4YFU A;  3T1A A;  1U45 A;  4DTS A;  1UAX A;  2RKI A;  4CF2 A;  3OYM A;  3KLH A;  4IFV A;  4OPK A;  4CF0 A;  3RMA A;  2HHX A;  3NDK A;  1BI4 A;  4Y1C A;  3AO2 A;  4Y1D A;  1TL3 A;  5C25 A;  4AHS A;  3VN5 A;  2FBX A;  2ZD1 A;  2GBZ A;  5E41 A;  4KHQ A;  1ASW A;  3KIO A;  4JS5 A;  4AHR A;  2HHT A;  1N6Q A;  3SYZ A;  1BHL A;  1JXB A;  1RNH A;  1QHT A;  4K8X A;  4FJ9 A;  1S6P A;  3KLF A;  3K57 A;  5J2M A;  4E7J A;  1UA0 A;  4CER A;  1NK7 A;  1NKB A;  3HPH A;  5FRN A;  3KD5 E;  1RT1 A;  4I2P A;  3MAQ A;  1VSK A;  4FJK A;  1RTD A;  2X74 A;  3V9S A;  1KVB A;  3CFP A;  4FM1 A;  1RIL A;  1TVR A;  4DSF A;  3SUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...