3O3HA

T. maritima rnase h2 d107n in complex with nucleic acid substrate and manganese ions
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVNGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna-rna hybrid
molecule keywords Ribonuclease HII
total genus 80
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3hA00
1A5VA 5K14A 1BHLA 3DLEA 4F3OA 4DSJA 1Q8IA 2QXFA 4KI4A 2X74A 1RDDA 1ZBHA 2KFNA 1FK9A 1HQUA 1VSHA 2YKNA 4R5PA 2XHBA 4B9LA 1WNSA 4W5NA 4N76A 4BE0A 3K58A 3ZSWA 5HRSA 1VSDA 5CZ1A 3HVRA 5DK5A 1NK8A 3M8SA 4DFPA 3QINA 3V1OA 1Q9XA 3DOLA 4QOZB 3DLRA 4CJLA 3KTQA 1RDBA 1S6PA 3DOKA 4CHOA 3LZIA 3KJVA 3LP0A 1DTQA 4AHTA 3K5NA 3KLIA 3A2FA 3NFAA 2P5OA 4C8OA 1CZ9A 1BQNA 1NOZA 1WSFA 4O44A 3AA2A 3DRSA 4QAGA 5CYMA 3QEVA 1UA1A 5HLFA 5CYQA 3QEIA 1CXUA 1KTQA 3NCIA 1U47A 4DG1A 3K59A 1WLJA 4FLUA 3TARA 3NH0A 1F21A 4FZYA 4RW9A 3SCXA 4FVMA 4EZ9A 4KKOA 4DSEA 3CG7A 1JKHA 4FK0A 2DY4A 2BE2A 2ITGA 4CEDA 3HO1A 3OYGA 4DSFA 3AVNA 4NYNA 4DTRA 1VSEA 4LH5A 2VG5A 4N56A 1BI4A 1RBSA 3SQ0A 1SKWA 5JS1A 1J53A 1L5UA 5KI6A 4FJNA 4E1MA 4LD0A 1U4BA 3TAQA 1TKZA 2O4IA 1HYVA 4FLZA 2B4JA 3TWHA 4IBNA 3H08A 3VA3A 1JL1A 5I3UA 1LWEA 3DLHA 4FJHA 4DSLA 4KHWA 4KHNA 3RMBA 4CE9A 4DTJA 1BI4B 3SYZA 4HUFA 4FJ5A 1LWCA 2B5JA 5J2MA 3MXIA 3HK2A 4FLYA 1C6VA 1LW0A 5SZTA 3TAMA 3VQ4A 3MXMA 4CJPA 4M3RA 1JLBA 4OJRA 2OZSA 2Z1JA 5C25A 2G8UA 1RT3A 3HM9A 4NYFA 1U04A 3NF8A 3ALYA 2D0AA 4KRFA 1WN7A 3SQ1A 2DTUA 4DQQA 1BGXT 3F73A 1QSLA 1W0HA 3PY8A 4TSXA 3AVJA 1R0AA 1RT7A 3AVFA 1NOYA 1TL1A 4FJ8A 4N41A 4CHPA 5FRMA 4DS4A 3S3OA 2DFFA 3HP9A 3LPTA 1JLEA 3AVKA 4OGEA 3V1QA 1TV6A 1N5YA 2PZSA 3KKRA 1TVRA 2NUBA 4LSLA 3T19A 4BE1A 3SZ2A 4Z4IA 1ZBIA 4BDPA 3CFPA 2PYLA 2P5GA 1VRUA 2ETJA 3PUFA 3SQ2A 3RMCA 4J2EA 3QNNA 4JRQA 4CJQA 3AVHA 4AHUA 1RCHA 3JSMA 3SI6A 1XHXA 1IKWA 1BL3A 1JLGA 4BE2A 5DMRA 3D45A 4BACA 4DU4A 1X9WA 3M8PA 1BCMA 5J2QA 1QE1A 4OPJA 1RT1A 4LY7A 4CEZA 1WAFA 3AA3A 3AO5A 3VQ5A 4BWMA 4CESA 4CCHA 1CLQA 1D8YA 3C6UA 4CJVA 3NF9A 3WNGA 2A1RA 4DFMA 3K5LA 1BIZA 4KHSA 5HP1A 2Q3SA 3FFIA 4JS4A 3K5MA 1WSHA 4KO0A 3VQPA 2XY5A 1RTDA 3RR7A 1RT4A 2IDOA 4CGFA 3VQCA 5HRPA 4DWIA 3L3UA 4CHZA 1SL2A 1VSMA 1T8EA 4C8KA 3LANA 4E19A 4M3YA 5FROA 3RMDA 3C95A 1B92A 3ZT0A 4DMNA 4M3WA 2YHBA 4CEQA 3PX0A 4DTSA 4DSKA 3D0PA 2RN2A 1NKBA 1REVA 3TAGA 2RKIA 1JLQA 3OYEA 4IDKA 4KTWA 4M3XA 3DRPA 2OPSA 2X6SA 3E01A 1HNVA 1QS4A 3V9XA 3JYTA 1UAXA 4DU3A 3QIPA 4E89A 1YT3A 1YTUA 4CEBA 4DTUA 3EYZA 4DF8A 3ZT4A 3ULDA 4KHYA 4HCCA 1KVBA 3OS2A 2HVHA 3G10A 4KTZA 1BCOA 4H4OA 4FK4A 2W42A 1S1XA 4I7FA 4CJEA 3UIQA 3NF6A 4IG0A 4CIFA 3SUOA 4CGHA 3IAYA 1IKYA 4Y1CA 3DMJA 1IKVA 3ZT2A 3OJUA 3SV3A 1HPZA 4OLAA 3NF7A 3RR8A 1VSJA 4ZHRA 4FZZA 3F9KA 4H8KA 2HB5A 4WE1A 3LZJA 3SJJA 2OYQA 1EP4A 4JLHA 3MXJA 3WNHA 1X9SA 5KRSA 3VQ7A 3LAMA 3EZ5A 3TABA 2YNIA 4MFBA 2PYJA 4K8XA 4FJKA 4KHQA 2X78A 1X1PA 3DRRA 3C94A 3DM2A 3DLBA 1QSYA 1SV5A 2FBVA 5KGWA 4CF9A 3EY1A 4AHCA 1J5OA 3V6DA 3QO9A 2G8HA 4BDYA 2HHSA 3LALA 4CK3A 3RMAA 2OA8A 1VSLA 2QK9A 1BQMA 1LV5A 3HPGA 2KW4A 3KKSA 3OYHA 3RRGA 1BIUA 1RBUA 4Y1DA 5E41A 3OYIA 2KQ2A 3OYKA 1RBRA 4B9UA 3P5JA 1XI1A 1U49A 1VSFA 1WSEA 1A5XA 4GW6A 4E1NA 2IS3A 1QTMA 1S1TA 3DLGA 1LAWA 4CJRA 3HXMA 4CEFA 1RTHA 3SPYA 1XC9A 2QKKA 4J2DA 3KIOA 3M8QA 4N5SA 4FW2A 1HRHA 1KSPA 1JLFA 1YTAA 1GOBA 3V81A 1HYZA 4DS5A 1O1WA 5HRRA 3VN5A 1KLNA 1S1UA 2GUIA 2WONA 4CFDA 1IH7A 3BDPA 2XY6A 4ELTA 2PY5A 4CJ4A 5HROA 2VG6A 4I2QA 1ASVA 4OKJA 4YFUA 4B08A 3QEPA 1NK4A 3QESA 4W5OA 1U45A 3HP6A 3VQQA 2G8KA 2FBYA 3SPZA 3ZSYA 4Q0BA 1EKEA 3THVA 4PQUA 3ZT3A 3I0RA 3NDKA 3CM5A 3SUQA 1D9FA 4IFYA 1KVAA 4AH9A 4CHNA 3L2VA 3QETA 4QCLA 4CERA 4JRPA 4DTOA 1NJZA 4EP5A 3HSTB 2Y1IA 3ZSXA 2A1SA 2XRIA 1C0TA 2WOMA 3HPHA 3B6OA 4ID1A 3MAQA 4E7KA 3ITHA 4DTNA 4FZXC 4CJ5A 3LDSA 3V9WA 1IO2A 1TAQA 3U3YA 4B9TA 3PV8A 2ZD1A 4B9SA 4DTPA 3RWUA 4NCGA 4OKEA 4W5TA 2F8SA 2QKBA 4CGJA 3KLEA 3V9UA 3LWLA 4DQRA 1LAVA 1KLMA 1HNIA 3PO4A 4ELUA 4E7HA 3HYFA 2Z1IA 3QIOA 4FJIA 4FCYA 4I2PA 4HUGA 2HMIA 4DQPA 4ELVA 3QNOA 1S5JA 1LWFA 3AO2A 1QQCA 3L3VA 3L2QA 1L3UA 3OYAA 4E0DA 4CJ3A 1UOCA 2OPQA 4ZTJA 3K2PA 1HQEA 3V9ZA 1C1AA 1JLCA 1RNHA 3AVMA 3MEGA 3OYJA 1TK0A 1QHTA 2FC0A 3WNFA 4FM1A 2HHVA 4H4MA 1I39A 2KTQA 3QLHA 3OYMA 4O5BA 1VRTA 2E4LA 4CF2A 3VQBA 2OZMA 1EX4A 2HNDA 1L3VA 2D5RA 4OGCA 2VWJA 3HJFA 3OS1A 4NCAA 1HYSA 1RDAA 1X9MA 5T7BA 2DFHA 1B9FA 4DTXA 1L3SA 1C1BA 4DLGA 4Z4HA 2FBXA 1SL0A 4HHTA 4DLEA 3I0SA 4GMJB 3ZCMA 1TAUA 2IGIA 2YNGA 3NGYA 3O3GA 3VQ6A 1A5WA 4K8ZA 1RT6A 2HW3A 1JXBA 1WSGA 3AVGA 5C42A 5SWMA 4I9LA 3OY9A 1KFDA 2OPRA 3KK2A 3ZSOA 5J1EA 1D5AA 2HHQA 3IG1A 3LPUA 3RRHA 2F8TA 1ASWA 3MEEA 4M41A 2YNFA 4CGDA 4KB0A 3ISNC 3ZSVA 1NJYA 3VQAA 5CZ2A 4CIGA 2O4GA 4W5RA 4DF4A 3SUPA 1ZBLA 1D9DA 1NJXA 1KRPA 4C8LA 3KK3A 5I42A 4ZTFA 3NGZA 2XO7A 3CM6A 3KD5E 1C0MA 1JLAA 4CEAA 2YHAA 5KTQA 2HVIA 1QSSA 3AA5X 1GOCA 3P1GA 1FKPA 3DLKA 3VQEA 5HRNA 5FDLA 4FLWA 1HJRA 4N47A 2E6MA 3OS0A 1RTIA 4OVLA 1ZBUA 4F2RA 1K6YA 4F8RA 4KREA 4FM0A 4LH4A 3NGIA 3SNNA 3K5OA 2IAJA 1C1CA 2D0BA 4FW1A 3NH1A 1SL1A 4DFJA 3V9SA 1YVUA 1NKCA 4B9VA 4IKFA 1NK7A 4KTQA 3AVCA 4O4GA 1S1VA 4RW4A 1UA0A 5J2PA 1BISA 2ZQBA 1WSIA 3O3HA 1KCFA 2RPIA 4M45A 3KLHA 3L2RA 3SV4A 3TANA 4B9NA 2BANA 5HBMA 3TR8A 1FXXA 3AO4A 1RTJA 3PX6A 1RT5A 2E6LA 4AILC 4PUOA 4DQIA 4M3TA 1S6QA 2Z1GA 1TL3A 1ZBFA 3MEDA 5C24A 1KFSA 4OLBA 2EHGA 3ZSZA 3LAKA 1JXEA 1Y97A 2I5JA 3CFOA 4DU1A 1Z25A 2YKMA 1S1WA 1SKRA 2VG7A 1Z26A 1G15A 1VK0A 2YNHA 4DFKA 4DSIA 2JGUA 1XHZA 1GOAA 1XWLA 1EETA 4L8RB 4AHRA 2F96A 4CK1A 1TK5A 4HUEA 2KZZA 4W5QA 4RW8A 5KRTA 1TK8A 1ASUA 4KPYA 2GBZA 4B3OA 2LSNA 5D3GA 4ICLA 4E3SA 4CJWA 1SUQA 4FM2A 4AHSA 3AV9A 4PA1A 4FXDA 3QEWA 1J9AA 4O0JA 4KFBA 3NH2A 4FJJA 2AJQA 3HVTA 4FJXA 1RBVA 3G0ZA 1W9HA 3PO5A 3L2UA 4XIUA 3S3NA 1FKOA 3LP2A 3L2WA 1WAJA 3LWMA 3QEXA 4HCBA 4CEEA 3HL8A 4C8NA 3M8RA 3TAPA 4FJLA 3OVNA 4Q5VA 4KI6A 2FBTA 4KV8A 5JS2A 1ZYQA 1NK9A 4IFVA 1NK6A 1I3AA 1LW2A 4CGGA 2Y1JA 1EXQA 3TI0A 3AVBA 4F3TA 2YV0X 1HMVA 3DYAA 1NJWA 1T03A 4NCBA 4M42A 3VA0A 2KFZA 2G8VA 2IOCA 1J54A 2G8FA 4OKKA 4CJFA 1S9EA 4DTMA 5CY4A 1WSJA 3V1RA 2R7YA 3KD1E 3O4QA 1TKTA 4AHVA 3L8BA 3RTVA 3LP1A 4M3ZA 4MQ3A 1C0UA 4CEOA 1DLOA 4CFCA 3MECA 3T3FA 2B6AA 3AO3A 4CFAA 3S9HA 1Q9YA 3K57A 4LSNA 3QERA 1N6QA 4I9QA 4B8AB 3O4NA 4JS5A 4PWDA 4KB1A 2RF2A 3B6PA 4B9MA 1ITGA 1KVCA 2JLEA 3KLGA 4O0IA 4CHQA 3OYDA 4CJKA 4FJ7A 4C8MA 4HTUA 1RDCA 2Z1HA 2P1JA 3O3FA 4CECA 1TGOA 3AA4A 3KK1A 3CQ8A 2OPPA 2HHUA 2GV9A 4J2BA 4YNQA 3V4IA 4RW7A 2XY7A 4CGIA 4CJSA 3TAFA 4KAZA 2BDPA 2HNYA 4E7LA 4J2AA 2ATQA 1TKXA 4RW6A 4OPKA 1SKSA 2G8WA 4F2SA 4FJGA 2ZE2A 3ZSQA 3HPOA 3OYCA 1NK5A 3OYBA 4FYDA 1MU2A 2DFEA 1UWBA 2P51A 4G1QA 4BWJA 3U3GA 3VQ8A 3SUNA 2G8IA 1DTTA 4Z0UA 1U48A 3I8DA 1T7PA 3TAEA 4FK2A 2IC3A 1VSKA 4PY5A 3AO1A 4Z4FA 4DQSA 4FJ9A 4CIEA 4HVJA 3PX4A 5EU7A 2HNZA 4F4KA 4Z4GA 3OJSA 4EZ6A 2BGGA 2X6NA 1IG9A 3IRXA 1B9DA 4GVMA 1NKEA 4ID5A 3SQ4A 4FLXA 1L3TA 3DI6A 3BGRA 4RG8A 4CFBA 4FLVA 4Z4CA 3AVLA 1S9GA 2EX3A 4CJTA 3ASMA 3NAEA 3VQ9A 4UQGA 1NK0A 4E7IA 4E7JA 4IG3A 2HHWA 4Z4EA 2KZMA 4CF8A 3KLFA 1T05A 3IS9A 4BDZA 1RBTA 1RILA 5KGXA 2HHXA 4CF0A 3AVIA 3VQDA 4CK2A 5J2NA 4M3UA 3AVAA 3OYNA 3ZT1A 3OYFA 3CFRA 1CZBA 1VSIA 2XY8A 4FLTA 2D0CA 1JL2A 3LP3A 1IKXA 2HHTA 4CHYA 3P83D 4O55A 3NHGA 4FJMA 4CJUA 4KHUA 4CF1A 1CXQA 3T1AA 3NE6A 5FRNA 1RT2A 3ZSRA 2VWKA 3CYMA 3C6TA 1TKDA 3NBPA 4EP4A 4B8CA 3S3MA 3OYLA 3WNEA 3U6FA 3HT3A
chains in the Genus database with same CATH superfamily
1A5VA 3AY9A 1BHLA 4GV6A 1Q8IA 2QXFA 1RDDA 1IJJA 3CF5L 3VF6A 4CZKA 2YI1A 4MLHA 3ZSWA 1NK8A 3JXUA 4NO7A 5BR8K 1YUWA 2V7ZA 4QOZB 3LZIA 4CHOA 1EWRA 3KLIA 4C1NI 2P5OA 4JK9A 3K9KA 1UA1A 5CYQA 3ENBA 3O8MA 3NCIA 3K59A 4FLUA 5AZJA 3NH0A 1F21A 4FZYA 3SCXA 4FVMA 2VGMA 4BRLA 4DSEA 3THYB 3CG7A 1M1KO 4CEDA 3HO1A 3AVNA 5ADXA 2Q36A 2QWLA 1BI4A 5JS1A 1SKWA 1GLFO 1G99A 3U8XA 3TAQA 4IDHA 4KHPK 3VA3A 1JL1A 4BR2A 5KPZA 3RMBA 4CE9A 3F2KA 1BI4B 4HUFA 3J81O 1LWCA 4FJ5A 3HK2A 1C6VA 1LW0A 4YORA 3TAMA 3VQ4A 3BP8A 4CJPA 4M3RA 4OJRA 3KHYA 2Z1JA 5C25A 2G8UA 2E2PA 3NF8A 3ALYA 2D0AA 3C0BA 3F73A 1QSLA 3A5OC 4JKBA 4BRCA 1NOYA 1TL1A 4FJ8A 1ZXOA 2DFFA 3LPTA 4OGEA 3AVKA 3V1QA 1KAXA 5JVHL 2NUBA 3A0IX 2OTLN 4WQ4A 2P5GA 3SQ2A 4JRQA 4DV2K 4CJQA 3CJ1A 1RCHA 2NRHA 1BL3A 4GV3A 4PHTX 4BE2A 3D45A 4DU4A 4F9OA 4O5FA 2P9NB 1NWKA 4OPJA 4LY7A 3WQTA 3AA3A 5BN9A 4CESA 1D8YA 3C6UA 1YXQA 3WNGA 4DFMA 4UY8O 2XY5A 4KO0A 1RTDA 3RR7A 1RT4A 4DWIA 4BR4A 1T8EA 4M3YA 3C95A 3CJBA 5AZIB 4FWLA 2KLAA 4KH6A 3SAFA 1SZ2A 1BA0A 4BVPA 1REVA 2RKIA 4IDKA 3DRPA 2OPSA 2X6SA 3GDQA 3GOIA 1UAXA 3QIPA 4CEBA 3ULDA 2PAVA 3C7NB 3H3NO 3RVCA 3G10A 5TKYA 3FZLA 3UIQA 4CIFA 3IAYA 5GAGP 4IWVA 1KC8O 3GE1A 3OJUA 3J8AA 1HPZA 3RR8A 2IVNA 4H8KA 3LZJA 4WE1A 1ATRA 3VQ7A 3LAMA 3PIOL 3TABA 4MFBA 4FJKA 3C65A 1QVGM 3DRRA 4NB4A 3ZETB 3EY1A 3CCMN 4BDYA 3VERA 5AQIA 1S22A 3KKSA 3RRGA 5E41A 1RBUA 2Q0RA 3OYIA 2KQ2A 2BH1A 3HM8A 1RBRA 3ATVA 1VSFA 4GW6A 1A5XA 4E1NA 2O8DA 1QTMA 4JI1K 4CJRA 3SPYA 4JI3K 4J2DA 4JI5K 4QS8A 5AJ3K 1KSPA 1YTAA 3O9UA 2GUIA 4BROA 4M63C 3THWB 4AQYK 2NRVA 2NLXA 4OKJA 5JLHA 4LF8K 3HP6A 5FPEA 4LF6K 3BF3A 2FBYA 1EKEA 4PQUA 1QZ6A 3NDKA 2ZJRL 3CM5A 2Q1NA 1D9FA 4BRPA 3U9DA 1MWKA 2Y1IA 5BPNA 2W6LA 3HPHA 3MAQA 1LCUA 3ITHA 3KWGA 3V9WA 3VEYA 3NMUA 4NCGA 4EFHA 3KLEA 3EN9A 4CZFA 1VAZA 4HUGA 4FCYA 4B3MK 3CPWM 4DV0K 1XQSC 3OYAA 3VETA 4XH5A 4CJ3A 1UOCA 2OPQA 4CZGA 3IKMA 4FPBA 3MEGA 3QBXA 3BEXA 5H1SQ 2FC0A 3FZHA 1I39A 3OYMA 2O8EB 2P9PB 4CF2A 4JKHA 2HNDA 2D5RA 3KK7A 4NCAA 1X9MA 4BRQA 5T7BA 2DFHA 4DTXA 1L3SA 1ATNA 4FVUA 2O8CB 3J7YP 4IO9L 1TAUA 4WFNL 3VQ6A 1WUAA 1JXBA 5AQZA 3N4QA 3E9PA 3IFRA 3ZEUB 2HHQA 4BGBA 4JKFA 3MEEA 4LFCK 4HWIA 4KB0A 3ZSVA 1D9DA 4BVOA 5AFUH 4MDBA 3CCEN 5I42A 3L0QA 4ZTFA 4PKHA 4X64K 2WC9A 4CBXA 4IO8A 3AA5X 2UXBK 3P1GA 1FKPA 4FLWA 1HJRA 4CBWA 4OPAA 1TYQA 3FZKA 4BREA 3OA9A 4B1VA 1C1CA 4JKDA 3V9SA 1Q82O 1J5OA 3SV4A 2RPIA 3AO4A 3QB0A 3I33A 4FOIA 4AILC 4PUOA 4ILGB 3LDOA 4K42A 3MEDA 1TL3A 3ULEA 1NGCA 4CD1A 2YCHA 2I5JA 4DU1A 2V52B 1SKRA 1SQKA 2VG7A 3AAPA 2ITMA 1Z26A 4DSIA 2JGUA 1XHZA 4L8RB 1EETA 4CK1A 3CMAN 4DV6K 2KZZA 5KRTA 3OBWA 3D7EO 4ICLA 4B1UB 1SUQA 4C23A 4FM2A 4DR4K 3AV9A 3DXMA 3NH2A 3HVTA 3T1HK 4FJXA 3PO5A 1W9HA 1T6DA 5AQMA 3S3NA 3LP2A 1HKBA 3LWMA 1P8ZA 4PKIA 2OTJN 3M8RA 3A5MC 3OVNA 4KV8A 4IFVA 1I3AA 2UUAK 3QDKA 1NJWA 1J54A 4CJFA 1XNRK 4DTMA 3J7ZO 5FPMA 1X3MA 3UKUA 5AQWA 4MQ3A 5TKWA 2CH6A 2B6AA 3AO3A 3QFUA 3UKUB 1Q9YA 3K57A 1K8AO 1N6QA 4PWDA 4B8AB 3O4NA 4JS5A 4YDUA 1ITGA 1KVCA 3KLGA 3QFPA 4FJ7A 3IUCA 2IVPA 3MWTA 3CHWA 2GX9A 3RSEB 4RWTA 3M6GA 3UB5A 4J2BA 3B8AX 3AAQA 3CCRN 4CGIA 4FJGA 3WXLA 5BPLA 1MU2A 4G1QA 3CC2N 3GG4A 1DTTA 4K43A 2IC3A 4H0TB 4DQSA 4HVJA 5C15A 4JD2B 4JHDB 1IG9A 1B9DA 3SQ4A 5E26A 1L3TA 1QZ5A 5AQTA 3BGRA 2HHHK 4Z4CA 3AVLA 2GWJA 2V7YA 3SK3A 1E3MA 4CJTA 3VQ9A 4UQGA 5LY3A 2O8BA 4DUZK 4IG3A 3M5RA 4PL7A 4CF8A 3HZ6A 2NNWA 3VESA 5C12A 3MDQA 2HHXA 3AVIA 4M3UA 4BRIA 1NNEA 3OYFA 4K41A 4FLTA 4WQ5C 3OBYA 3O9QA 3P83D 5AFUA 3GL1A 1KAYA 4CF1A 3T1AA 3NE6A 1RT2A 2VWKA 2HBJA 1GLEG 1YF5L 4EP4A 3CCSN 3S3MA 3OYLA 3FFKB 3HT3A 5K14A 4DS4A 5F0XA 3ZYYX 1M90O 4DSJA 4F3OA 4JI0K 2KFNA 1U2VB 3FE1A 4YOXA 1VSHA 2YKNA 4R5PA 4B9LA 4LFBK 3WUHA 5HRSA 4H0YB 1NGGA 2F7TA 4A62A 1WBDA 3DOLA 1VQ4N 3DLRA 3VGLA 2WBNA 1RDBA 3DOKA 3LP0A 3D2EB 3WXIA 3TU5A 2H3GX 3K5NA 5BR9A 3AA2A 4Z94A 3EE8A 5HLFA 4WFAL 1U47A 1KQSM 4EZ9A 4IXCA 1JKHA 2GTDA 2QA4N 4N56A 3SQ0A 4FJNA 4AM6A 4E1MA 1U4BA 1BDGA 3VEWA 4FLZA 5BRHA 3H08A 4KHWA 4CBUA 2B5JA 5SZTA 1JLBA 2OZSA 1SAZA 3ZEUA 3HM9A 1MWMA 4NYFA 2AP1A 1HJOA 3H45C 1WN7A 3SQ1A 1RFQA 3CJCA 2QI2A 3PY8A 1V4TA 4TSXA 3AVJA 3A5LC 3PSFA 4CZEA 1R0AA 3HI0A 1RT7A 3AVFA 5AQGA 4N41A 3LM2A 3SZ2A 3T19A 2I7NA 4BDPA 2ETJA 3PUFA 3I56N 3ID8A 1ZC6A 3JSMA 3AVHA 5FPNA 4AHUA 5DMRA 4BACA 5LMNK 4DV1K 3VTIA 5J2QA 1QE1A 4BRDA 1RT1A 3EO3A 3VQ5A 4BWMA 1S3XA 3NF9A 3ZLJA 2A1RA 3K5LA 1BIZA 4KHSA 3K5MA 3VQPA 2QW9A 2IDOA 4CGFA 4CHZA 1VSMA 4C8KA 3LANA 5FROA 5C2DA 1B92A 4FWPA 1E4FT 4U67L 1IBLK 4M3WA 1BWFO 4CEQA 5KQ8A 3U6FA 3D0PA 5LJWA 3Q7CA 2EWSA 3LDLA 3TAGA 2IVOA 4M3XA 4DU3A 1X3NA 1YT3A 1YTUA 1NGJA 3ZT4A 4KHYA 1W97L 1KVBA 4H5RA 4H4OA 2W42A 4RCHA 4I7FA 4CJEA 4IG0A 3SUOA 4WQ4C 1IKYA 3KZBA 2GEMA 2E2QA 4OLAA 3NF7A 4ZHRA 4DR7K 2HB5A 2VGNA 3WNHA 4C8LA 3EZ5A 2PYJA 2X78A 3L4IA 1YJNN 3M1FA 4CF9A 4BRKA 4AHCA 3V6DA 1JCGA 2HHSA 2OA8A 3JAMO 1LV5A 3HPGA 2KW4A 1H1VA 4NCBA 4B1YB 3SAGA 2CH5A 4H5WA 1D4XA 5ADXH 2IS3A 1HYSA 3KIOA 1HRHA 4XH4A 5EX5A 1HX1A 3V81A 1NGHA 5HRRA 2NRRA 1NLVA 3EL2A 1KLNA 4EAHD 4YY3K 4V19S 3BDPA 1R59O 4ELTA 2PY5A 4CJ4A 1Z05A 2VG6A 4YFUA 1ASVA 4B08A 4X62K 3QESA 4W5OA 1U45A 1O13A 2G8KA 2QWOA 3SPZA 2P9PA 3ZT3A 3I0RA 3SUQA 4AH9A 1VQPN 4JKGB 4DTOA 2E5LK 2A1SA 3CQXA 1NGAA 1C0TA 2XRIA 2W40A 4E7KA 3PIPL 4DTNA 2E2OA 4FZXC 4IOXA 4AF1A 1IO2A 2PBDA 1OKJA 4CD3A 5BREA 3VEXA 3MN6A 4W5TA 1JCEA 4CGJA 1HNIA 5AQSA 4ELUA 1ESVA 2NZTA 2Z1IA 3QIOA 2HBLA 4I2PA 2HMIA 4DQPA 4CZLA 2WFBA 3QNOA 3L3VA 2YHYA 4FWNA 3K2PA 1RNHA 1N36K 4FM1A 4OO1J 2P9LA 4X65K 5F2RA 2KTQA 2E1YA 2NRTA 4JK8A 2OZMA 3O5BA 3VQBA 5JICA 5C2FA 4OGCA 2VWJA 3HJFA 1RDAA 5KPTA 1C1BA 1DKGD 4DLGA 2FBXA 1Q86O 1SL0A 4DLEA 3I0SA 2IGIA 2YNGA 3NGYA 4K8ZA 3D2EA 4PL8A 3CIPA 3OY9A 3ZSOA 3IG1A 3RRHA 4M41A 1GLLO 5AQLA 4JI6K 2P9UB 4CIGA 4DF4A 4W5RA 1KRPA 3CCQN 1NJXA 4GKJK 2HF3A 4FWMA 3KK3A 4KBOA 1C0MA 2YHAA 2J4RA 5LJVA 1FW6A 1VQNN 3L6QA 3CI5A 4F8RA 4F2RA 1K6YA 4FM0A 3K5OA 2IAJA 3CCJN 4BR0A 1SL1A 4DFJA 1YVUA 1J6ZA 4KTQA 3AVCA 4BGAA 1UA0A 5J2PA 1WSIA 3O3HA 1KCFA 3KLHA 3TANA 5I9EB 3TR8A 4A61A 5CR4A 4GNIA 4I6MB 2Z1GA 4DB3A 3THXB 3LAKA 1Z25A 3AGRA 3FZMA 4DFKA 3DXKA 4JN4A 1XWLA 1BA1A 2F96A 1HLUA 1C0GA 2E1ZA 4O8KA 1ASUA 2GBZA 1BUPA 4E3SA 3UE5A 4FXDA 1YJ9N 4KFBA 4FJJA 1RBVA 2D1KA 3L2UA 4H5VA 4IEIA 3QEXA 4HCBA 1Q18A 4FJLA 4KI6A 2QWPA 3A8YA 1OH6A 1EWQA 3MX5A 1ZYQA 2P9UA 1OVQA 1NK9A 3LM9A 4JI2K 3DAWA 1QQMA 2E8AA 2IIRA 4A2BA 3OHRA 2A41A 1VQ6N 2P9IB 2G8VA 4DKWA 5M1NA 2VCPA 1S9EA 4DR2K 1OH7A 3KD1E 1K8KB 1TKTA 4AHVA 3RTVA 4H5NA 3CJ9A 4LF7K 1TUUA 4CEOA 1DLOA 3OW2M 2FF6A 3MECA 4CFAA 3S41A 2RF2A 4B9MA 2JLEA 4O0IA 3NVKA 4C8MA 4JHDA 4CECA 3AA4A 4JI8K 5AQXA 2OPPA 1N32K 4QS9A 2ZJPL 3H3OB 1U6ZA 3T1YK 4DV7K 1E4GT 4XEIA 3ULEB 1BOTO 2ATQA 1TKXA 5M1QA 1SKSA 2UU9K 3ZSQA 3HPOA 3OYBA 1UWBA 2G8IA 3SUNA 2W6KA 1T7PA 3TAEA 4FK2A 5GAEP 3O08A 4PY5A 4QS7A 3PX4A 4F4KA 4Z4GA 3OJSA 4EZ6A 5AQJA 3ZX2A 3IRXA 4GVMA 3UKRA 1NKEA 3U4LA 5C0YA 4RTFD 3DI6A 3P39A 3BZKA 4RG8A 4CFBA 4FLVA 1XUPO 2EX3A 3BF1A 5C10A 1NK0A 3NAEA 3CXCM 4E7IA 4Z4EA 3KLFA 1KXPA 1T05A 4BDZA 1VQKN 1YJWN 1RBTA 4CK2A 3AVAA 4BRGA 1XMOK 1W7AA 3BZCA 2D0CA 1JL2A 3LP3A 1IKXA 2ASMA 4DQ8A 3ENOA 2P9KB 4JEPA 1RDUA 4FPAA 4L3QA 2X74A 2F4VK 3C6AA 4Y0WA 1FK9A 2XHBA 3CCUN 1WNSA 3R8EA 4EHTA 4BE0A 2F9WA 3K58A 4CVNE 1YI2N 3W0LA 5DK5A 3LL3A 1IBMK 3QINA 3V1OA 1Q9XA 1YVNA 3CQYA 4KH4A 4CJLA 3KTQA 1ILYA 3KJVA 1DTQA 3NFAA 3A2FA 2UUBK 1BQNA 3IMXA 3DRSA 4QAGA 3QEVA 2QWNA 3ATUA 2E20A 3QEIA 1CXUA 1KTQA 3T7ZA 4MO5A 1WLJA 3TARA 2BUPA 4RW9A 1EO1A 4FWRA 2E88A 2ITGA 3D2FA 2DY4A 5AQNA 1GLJO 1VSEA 2VG5A 1RBSA 1J53A 1L5UA 4OX9K 2O4IA 1HYVA 4IBNA 4BC2A 4FJHA 3DLHA 2UXDK 4DSLA 3WEEB 4KHNA 1VQ5N 3HOTA 4DTJA 2Q97A 4DCHA 4JI7K 3MXIA 4FLYA 3MXMA 1RT3A 4CZJA 1U04A 5AZIA 4NLBA 2DTUA 4DQQA 1BGXT 1WB9A 1W0HA 1S72N 3WQUA 5JMVA 3SAHA 4WF9L 3MN7A 3DJCA 2PFUA 3S3OA 1TV6A 1N5YA 2PZSA 3DWLA 3KKRA 4B1ZA 1VRUA 4BRFA 5GIPA 3RMCA 3QNNA 4R79A 3SI6A 1XHXA 3SMSA 1JLGA 1U2VA 3MK6A 5M1PA 3M8PA 2RE2A 4MLEA 1BCMA 5HL7L 5A2QO 3R9PA 3ENHA 1HNZK 4CCHA 3CD6N 3VTHA 1DGKN 4FOEA 4CJVA 2VYPA 4H0OA 5HP1A 2NRZA 2Q3SA 2HMPA 1WSHA 3P31A 4EIAA 3VQCA 5HRPA 2JWKA 4B1WB 4CZMA 4DMNA 2YHBA 3PX0A 3VMFB 2A3ZA 2FSJA 2RN2A 1NKBA 1JLQA 3OYEA 4JYAK 3WEEA 3JYTA 1NMDA 4HCCA 3OS2A 4KTZA 1BCOA 4FK4A 4Y1CA 4FZZA 1N8RO 2V51B 4FWOA 2YJFA 3SLCA 4JLHA 1X9SA 3MXJA 5KRSA 4K8XA 1VQ7N 1NJIO 3C94A 5KGWA 2Q2RA 3QO9A 4K25A 4H03B 3LALA 4CK3A 1VQMN 3EKUA 1BIUA 4Y1DA 1NGFA 1NGBA 4FL9A 4B9UA 1I94K 1MDUB 2E2NA 1S1TA 1LAWA 1T3VA 2QKKA 1RTHA 1OH5A 3EKSA 1BO5O 1GOBA 3O4WA 1HYZA 3ZETA 4YOWA 1O1WA 3J7AP 2WTUA 4DR1K 3VN5A 1S1UA 4CFDA 1IH7A 2A6AA 2O8FA 2P9KA 2P9IA 4YOVA 5HROA 5EXWA 3OTOK 3QEPA 3TTDA 1NK4A 3LDNA 5BPMA 4GKKK 3ZSYA 3THVA 4DR3K 3L2VA 4CHNA 1J5EK 4QCLA 3SJHA 3LDQA 4YHHK 1NJZA 3HSTB 3SMPA 2WOMA 3THXA 3B6OA 4ID1A 3LDSA 1TAQA 3U3YA 3FR0A 3PV8A 1T44A 2ZGZA 3RWUA 4OKEA 2F8SA 2QKBA 4E1JA 3LWLA 3V9UA 4DQRA 1KLMA 3PO4A 5HOOA 4E7HA 4FJIA 1HNWK 4CW7B 1S5JA 1L3UA 3L2QA 5GADP 4ZTJA 1W2BM 1HQEA 1JLCA 3OYJA 1TK0A 3WNFA 4BRMA 3PSIA 1Q81O 3QLHA 1HNXK 4GVEA 4O5BA 1VRTA 2E4LA 1L3VA 5B8HA 3OS1A 4ILJA 1VQ9N 3J80O 4GMJB 3K9JA 3ZCMA 1LOTB 2VWBA 3O3GA 1RT6A 4H0VB 2HW3A 5AQFA 1WSGA 5SWMA 4BRAA 1D5AA 2GELA 3FLCO 4YOUA 1ASWA 3HTVA 3EZWA 1NJYA 2O4GA 3SUPA 1ZBLA 1TUYA 3GBTA 4BQZA 5LL6Z 4CZIA 3AGKA 2JWLA 2XO7A 3CM6A 4BG8A 4O8UA 4DV4K 3P38A 5KTQA 1QSSA 5E84A 2HVIA 1GOCA 3VQEA 5FDLA 4JKEA 4N47A 2E6MA 3OS0A 1ZBUA 4NXMK 1NGIA 4LH4A 3NGIA 3SNNA 2Q31A 3TSUA 1DT9A 3CPEA 2D0BA 4FW1A 3NH1A 1MA9B 1OVYA 4O4GA 1S1VA 1BISA 4B9NA 4KH5A 4LF4K 2QWRA 2Q0UA 5KPRA 1RT5A 3VF4A 4BC3A 4M3TA 5C24A 4H5TA 4OLBA 3N4PA 1JXEA 3CFOA 4EHUA 1S1WA 4NLCA 3MCAB 1G15A 1VK0A 4IJAA 5M1FA 1GOAA 4AHRA 1TK5A 1CZAN 3QBWA 1NGDA 5D3GA 2P9SB 4BG9A 4AHSA 4DHYA 1J9AA 4O0JA 2YHXA 4XIUA 4ILHA 3L2WA 4BC4A 4CEEA 4C8NA 3TAPA 1QVFM 5AQUA 4Q5VA 1IBKK 2FBTA 4FSVA 5JS2A 1LW2A 4CGGA 3H1VX 3AVBA 2YV0X 1T03A 3DYAA 3MMVA 2QWQA 2KFZA 4A5BA 1WSJA 3O9RA 3V1RA 2R7YA 3L8BA 4M3ZA 3AARA 5AQOA 2HBMA 2QTDA 3D6RA 1NBWA 4I9QA 3QERA 4KB1A 3SBGA 3OYDA 2ZM6K 4CJKA 2UYTA 4HTUA 2UXCK 2Z1HA 3FGUA 2HSTA 4JD2A 3O3FA 3KK1A 1TGOA 3JS6A 4ISEA 4JKCA 2HHUA 3V4IA 4RW7A 2XY7A 4KAZA 4CJSA 4DR5K 4FWKA 2O8BB 3D2FB 4RW6A 4J2AA 2I7PA 5GIOA 2G8WA 2ZE2A 4FYDA 3VQ8A 3U3GA 2QEXN 3VPZA 4Z4FA 4CIEA 1XMQK 5EU7A 2HNZA 1NMNA 2BGGA 2X6NA 2QM1A 4ID5A 4FLXA 1HR0K 5IT9O 4A59A 3CERA 3ASMA 2YX6A 4E7JA 3G25A 5AQHA 3IS9A 1N33K 5BN8A 2NRWA 1RILA 3HSCA 5KGXA 4B3SK 4CF0A 1K8KA 5J2NA 4JKGA 3OYNA 2FSKA 3ZT1A 3CFRA 5M1OA 4H0XB 1VSIA 2XY8A 3TPQA 3VGKA 3KWIA 2BTFA 4MO4A 3ZX0A 2W41A 2F9TA 4CHYA 3TTFA 1N34K 3NHGA 4FJMA 1YIJN 1CXQA 4BC5A 5FRNA 3CYMA 4WFBL 4B8CA 1C0FA 3WNEA 1KAZA 3DLEA 3F9MA 4KI4A 1ZBHA 3VGMA 2AA4A 1HQUA 2ASPA 4W5NA 4LC9B 5AQRA 3K0SA 4N76A 3G71N 3HVRA 1VSDA 5CZ1A 4BR5A 3M8SA 4DFPA 1OH8A 4A57A 5AQVA 1Y64A 1S6PA 4WYBA 4AHTA 4C8OA 1IV0A 4YDUC 1CZ9A 1NOZA 1WSFA 4O44A 3G4SN 5CYMA 5FLXO 3E66A 4DG1A 3E1YA 4KKOA 2D4WA 4FK0A 2BE2A 3QICA 3OYGA 1K9MO 4DSFA 1TYQB 4IOAL 4NYNA 4DTRA 1NM1A 4LH5A 3T69A 5DM6L 5KI6A 1EQYA 5JLFA 4LD0A 1TKZA 2OCEA 2B4JA 3O6WA 3TWHA 5I3UA 3CJAA 1LWEA 4JKAA 4YOTA 3SYZA 4HTLA 5J2MA 2ZWHA 1JJ2M 5CHIA 3BY5A 3TSPA 4LF9K 4KRFA 3EE9A 1Z6RA 3VEVA 4IOCL 3CJ7A 1T6CA 3C6HA 5DM7L 4WCEL 4CHPA 5FRMA 3HP9A 1JLEA 2O8FB 3E9OA 1TVRA 4LSLA 4BE1A 4Z4IA 1ZBIA 3CC7N 3CFPA 4J2EA 4DV5K 1IKWA 5KQDA 4JV5K 5FPDA 2KHOA 4JI4K 1X9WA 3IDHA 4CI6A 4CEZA 1HUXA 3NVMA 1WAFA 3AO5A 1CLQA 4OPHA 2P9NA 2GUPA 1ZBSA 3PLAA 3FFIA 4IZ9A 4JS4A 3THWA 3EEQA 3L3UA 1SL2A 4E19A 3RMDA 3UKRB 3W3DA 3R1XA 3ZT0A 3E9LA 3DXKB 1RDWX 4DTSA 4DSKA 4U7BA 4IEEA 4YOYA 3U9ZA 2D0PA 4IFEA 4KTWA 3E01A 1HNVA 1QS4A 3V9XA 5AZJB 4E89A 4DTUA 3EYZA 4DF8A 3CETA 2HVHA 2FXUA 1S1XA 3NF6A 4FO0A 1GLDG 3C7NA 3O1BA 4CGHA 1GLAG 1IG8A 3DMJA 1IKVA 4JK7A 3ZT2A 3SV3A 1VSJA 3F9KA 1K73O 3SJJA 2OYQA 1EP4A 2PYLA 2YNIA 4KHQA 1X1PA 3DLBA 3DM2A 1QSYA 1SV5A 2FBVA 3O1WA 2G8HA 2DPNA 3RMAA 2QK9A 1VSLA 1BQMA 2FF3B 3OYHA 2ZF5O 3OYKA 3P5JA 1XI1A 1KD1O 3H1QA 1U49A 4C1NK 3I55N 1WSEA 4ISGA 4LFAK 1BU6O 3DLGA 3HXMA 1XC9A 4CEFA 4H0PA 4JAXA 4N5SA 3M8QA 4FW2A 1Q7YO 1JLFA 2O8DB 1VQON 3VF2A 4DS5A 2WONA 4NXNK 2XY6A 3HOSA 4GV9A 2O8EA 4I2QA 4PKGA 4CJ7A 4M7YA 3VQQA 4Q0BA 3WT0A 3VENA 1XNQK 4IFYA 1KVAA 5AR0A 4B1XB 4ISFA 3QETA 4CERA 4JRPA 2ZGYA 4EP5A 2ASOA 3ZSXA 2GWKA 3BUZB 4CJ5A 4B9TA 2ZD1A 4B9SA 1NGEA 4DTPA 2QWMA 4BY9C 1WOQA 1LAVA 5CE3A 3HYFA 2FSNA 4ELVA 2CGLA 4WQ5A 1HPMA 1LWFA 3AO2A 1QQCA 1YITN 3P4IA 3VOVA 4E0DA 3V9ZA 1C1AA 3AVMA 4BRNA 1QHTA 2HHVA 4H4MA 1EX4A 3M3ZA 4FWQA 1B9FA 1VQ8N 1VHXA 4Z4HA 4A5AA 4G9ZA 4HHTA 3Q7BA 3ID6A 4LF5K 2HF4A 1A5WA 3WXMB 5C42A 3AVGA 4I9LA 1KFDA 2OPRA 3KK2A 2FLOA 5J1EA 3DXMB 3LPUA 2F8TA 4CGDA 2YNFA 3WXKA 4BRHA 4B3RK 3ISNC 3O80A 3VQAA 5CZ2A 3NGZA 3KD5E 1JLAA 3F5TA 4CEAA 3DLKA 4B9QA 5HRNA 5GAHP 2VQFK 1RTIA 4OVLA 4KREA 3H46O 4JNEA 1BG3A 1NKCA 5EOYA 4B9VA 3WXJA 4IKFA 1NK7A 2YHWA 4BR7A 4RW4A 2P9SA 2ZQBA 4M45A 3L2RA 4FWSA 1GLBG 2BANA 4GY2B 5HBMA 1FXXA 3MCPA 1RTJA 3PX6A 3CCVN 2E6LA 5IWAK 4DQIA 4BQLA 3R3LA 2A5XA 1S6QA 1ZBFA 1KFSA 1YAGA 2EHGA 3ZSZA 1Y97A 2YKMA 2KKZA 5F1XA 2YNHA 4MDAA 3L4QA 1QQNA 4I6MA 4HUEA 4W5QA 2D0OA 4RW8A 1TK8A 3A5NC 4KPYA 4B3OA 2LSNA 4CJWA 5GINA 1HKGA 4PA1A 5AQPA 3VEZA 1FJGK 5AQYA 3QEWA 2AJQA 3MX2A 3G0ZA 2NRXA 4AM7A 1FKOA 1WAJA 3H6EA 3DLLL 3HL8A 3CCLN 2VQEK 5MLCQ 1JCFA 1WBBA 1NK6A 2Y1JA 1EXQA 4J8FA 3TI0A 3KVGA 3FZFA 5AQQA 4F3TA 3CC4N 1HMVA 4M42A 5BRDA 1V4SA 3VA0A 3HBTA 3O9TA 2CGJA 2IOCA 2G8FA 4OKKA 5LMUK 3G6EN 1P90A 2A40A 5CY4A 2WUSA 3O4QA 2O8CA 3LP1A 1C0UA 4X66K 4CFCA 3T3FA 1XC3A 3MWPA 3S9HA 4LSNA 3B6PA 1QHAA 4CHQA 3HRGA 1RDCA 2P1JA 3CQ8A 3SBTA 2ZJQL 2GV9A 4DR6K 4YNQA 2P9LB 3RSEA 2OANA 2A42A 2HBKA 1NU0A 3TAFA 3TTCA 2BDPA 2HNYA 4A2AA 5JVGL 4E7LA 4OPKA 3VEOA 4F2SA 4CZHA 4K0KK 1NK5A 1SS6A 5EY4A 3OYCA 2DFEA 2P51A 2QXLA 4BWJA 4BR9A 3TSQA 4Z0UA 3LDPA 1U48A 3I8DA 1VSKA 4IJNA 3AO1A 3THYA 4FJ9A 1QQOA 3ZX3A 2CGKA 3I8BA 4XH1A 1S9GA 3R6MA 3MN5A 5M1KA 4DV3K 1ATSA 1HKCA 3QMLA 2RHKA 1YHQN 2HHWA 2KZMA 1VQLN 1NG9A 3VQDA 5BRFA 1RGIA 1CZBA 1X9JA 3CMEN 2HHTA 1GLCG 5ELZA 4O55A 3MN9A 4CJUA 2UUCK 4B3TK 2YJEA 4KHUA 2HOEA 3ZSRA 1TKDA 3C6TA 3O9SA 4M7XA 1DEJA 5EVZA 3NBPA 4DUYK 5AQKA
chains in the Genus database with same CATH topology
1A5VA 5K14A 1BHLA 3DLEA 4F3OA 4DSJA 1Q8IA 2QXFA 4KI4A 2X74A 1RDDA 1ZBHA 2KFNA 1FK9A 1HQUA 1VSHA 2YKNA 4R5PA 2XHBA 4B9LA 1WNSA 4W5NA 4N76A 4BE0A 3K58A 3ZSWA 5HRSA 1VSDA 5CZ1A 3HVRA 5DK5A 1NK8A 3M8SA 4DFPA 3QINA 3V1OA 1Q9XA 3DOLA 4QOZB 3DLRA 4CJLA 3KTQA 1RDBA 1S6PA 3DOKA 4CHOA 3LZIA 3KJVA 3LP0A 1DTQA 4AHTA 3K5NA 3KLIA 3A2FA 3NFAA 2P5OA 4C8OA 1CZ9A 1BQNA 1NOZA 1WSFA 4O44A 3AA2A 3DRSA 4QAGA 5CYMA 3QEVA 1UA1A 5HLFA 5CYQA 3QEIA 1CXUA 1KTQA 3NCIA 1U47A 4DG1A 3K59A 1WLJA 4FLUA 3TARA 3NH0A 1F21A 4FZYA 4RW9A 3SCXA 4FVMA 4EZ9A 4KKOA 4DSEA 3CG7A 1JKHA 4FK0A 2DY4A 2BE2A 2ITGA 4CEDA 3HO1A 3OYGA 4DSFA 3AVNA 4NYNA 4DTRA 1VSEA 4LH5A 2VG5A 4N56A 1BI4A 1RBSA 3SQ0A 1SKWA 5JS1A 1J53A 1L5UA 5KI6A 4FJNA 4E1MA 4LD0A 1U4BA 3TAQA 1TKZA 2O4IA 1HYVA 4FLZA 2B4JA 3TWHA 4IBNA 3H08A 3VA3A 1JL1A 5I3UA 1LWEA 3DLHA 4FJHA 4DSLA 4KHWA 4KHNA 3RMBA 4CE9A 4DTJA 1BI4B 3SYZA 4HUFA 4FJ5A 1LWCA 2B5JA 5J2MA 3MXIA 3HK2A 4FLYA 1C6VA 1LW0A 5SZTA 3TAMA 3VQ4A 3MXMA 4CJPA 4M3RA 1JLBA 4OJRA 2OZSA 2Z1JA 5C25A 2G8UA 1RT3A 3HM9A 4NYFA 1U04A 3NF8A 3ALYA 2D0AA 4KRFA 1WN7A 3SQ1A 2DTUA 4DQQA 1BGXT 3F73A 1QSLA 1W0HA 3PY8A 4TSXA 3AVJA 1R0AA 1RT7A 3AVFA 1NOYA 1TL1A 4FJ8A 4N41A 4CHPA 5FRMA 4DS4A 3S3OA 2DFFA 3HP9A 3LPTA 1JLEA 3AVKA 4OGEA 3V1QA 1TV6A 1N5YA 2PZSA 3KKRA 1TVRA 2NUBA 4LSLA 3T19A 4BE1A 3SZ2A 4Z4IA 1ZBIA 4BDPA 3CFPA 2PYLA 2P5GA 1VRUA 2ETJA 3PUFA 3SQ2A 3RMCA 4J2EA 3QNNA 4JRQA 4CJQA 3AVHA 4AHUA 1RCHA 3JSMA 3SI6A 1XHXA 1IKWA 1BL3A 1JLGA 4BE2A 5DMRA 3D45A 4BACA 4DU4A 1X9WA 3M8PA 1BCMA 5J2QA 1QE1A 4OPJA 1RT1A 4LY7A 4CEZA 1WAFA 3AA3A 3AO5A 3VQ5A 4BWMA 4CESA 4CCHA 1CLQA 1D8YA 3C6UA 4CJVA 3NF9A 3WNGA 2A1RA 4DFMA 3K5LA 1BIZA 4KHSA 5HP1A 2Q3SA 3FFIA 4JS4A 3K5MA 1WSHA 4KO0A 3VQPA 2XY5A 1RTDA 3RR7A 1RT4A 2IDOA 4CGFA 3VQCA 5HRPA 4DWIA 3L3UA 4CHZA 1SL2A 1VSMA 1T8EA 4C8KA 3LANA 4E19A 4M3YA 5FROA 3RMDA 3C95A 1B92A 3ZT0A 4DMNA 4M3WA 2YHBA 4CEQA 3PX0A 4DTSA 4DSKA 3D0PA 2RN2A 1NKBA 1REVA 3TAGA 2RKIA 1JLQA 3OYEA 4IDKA 4KTWA 4M3XA 3DRPA 2OPSA 2X6SA 3E01A 1HNVA 1QS4A 3V9XA 3JYTA 1UAXA 4DU3A 3QIPA 4E89A 1YT3A 1YTUA 4CEBA 4DTUA 3EYZA 4DF8A 3ZT4A 3ULDA 4KHYA 4HCCA 1KVBA 3OS2A 2HVHA 3G10A 4KTZA 1BCOA 4H4OA 4FK4A 2W42A 1S1XA 4I7FA 4CJEA 3UIQA 3NF6A 4IG0A 4CIFA 3SUOA 4CGHA 3IAYA 1IKYA 4Y1CA 3DMJA 1IKVA 3ZT2A 3OJUA 3SV3A 1HPZA 4OLAA 3NF7A 3RR8A 1VSJA 4ZHRA 4FZZA 3F9KA 4H8KA 2HB5A 4WE1A 3LZJA 3SJJA 2OYQA 1EP4A 4JLHA 3MXJA 3WNHA 1X9SA 5KRSA 3VQ7A 3LAMA 3EZ5A 3TABA 2YNIA 4MFBA 2PYJA 4K8XA 4FJKA 4KHQA 2X78A 1X1PA 3DRRA 3C94A 3DM2A 3DLBA 1QSYA 1SV5A 2FBVA 5KGWA 4CF9A 3EY1A 4AHCA 1J5OA 3V6DA 3QO9A 2G8HA 4BDYA 2HHSA 3LALA 4CK3A 3RMAA 2OA8A 1VSLA 2QK9A 1BQMA 1LV5A 3HPGA 2KW4A 3KKSA 3OYHA 3RRGA 1BIUA 1RBUA 4Y1DA 5E41A 3OYIA 2KQ2A 3OYKA 1RBRA 4B9UA 3P5JA 1XI1A 1U49A 1VSFA 1WSEA 1A5XA 4GW6A 4E1NA 2IS3A 1QTMA 1S1TA 3DLGA 1LAWA 4CJRA 3HXMA 4CEFA 1RTHA 3SPYA 1XC9A 2QKKA 4J2DA 3KIOA 3M8QA 4N5SA 4FW2A 1HRHA 1KSPA 1JLFA 1YTAA 1GOBA 3V81A 1HYZA 4DS5A 1O1WA 5HRRA 3VN5A 1KLNA 1S1UA 2GUIA 2WONA 4CFDA 1IH7A 3BDPA 2XY6A 4ELTA 2PY5A 4CJ4A 5HROA 2VG6A 4I2QA 1ASVA 4OKJA 4YFUA 4B08A 3QEPA 1NK4A 3QESA 4W5OA 1U45A 3HP6A 3VQQA 2G8KA 2FBYA 3SPZA 3ZSYA 4Q0BA 1EKEA 3THVA 4PQUA 3ZT3A 3I0RA 3NDKA 3CM5A 3SUQA 1D9FA 4IFYA 1KVAA 4AH9A 4CHNA 3L2VA 3QETA 4QCLA 4CERA 4JRPA 4DTOA 1NJZA 4EP5A 3HSTB 2Y1IA 3ZSXA 2A1SA 2XRIA 1C0TA 2WOMA 3HPHA 3B6OA 4ID1A 3MAQA 4E7KA 3ITHA 4DTNA 4FZXC 4CJ5A 3LDSA 3V9WA 1IO2A 1TAQA 3U3YA 4B9TA 3PV8A 2ZD1A 4B9SA 4DTPA 3RWUA 4NCGA 4OKEA 4W5TA 2F8SA 2QKBA 4CGJA 3KLEA 3V9UA 3LWLA 4DQRA 1LAVA 1KLMA 1HNIA 3PO4A 4ELUA 4E7HA 3HYFA 2Z1IA 3QIOA 4FJIA 4FCYA 4I2PA 4HUGA 2HMIA 4DQPA 4ELVA 3QNOA 1S5JA 1LWFA 3AO2A 1QQCA 3L3VA 3L2QA 1L3UA 3OYAA 4E0DA 4CJ3A 1UOCA 2OPQA 4ZTJA 3K2PA 1HQEA 3V9ZA 1C1AA 1JLCA 1RNHA 3AVMA 3MEGA 3OYJA 1TK0A 1QHTA 2FC0A 3WNFA 4FM1A 2HHVA 4H4MA 1I39A 2KTQA 3QLHA 3OYMA 4O5BA 1VRTA 2E4LA 4CF2A 3VQBA 2OZMA 1EX4A 2HNDA 1L3VA 2D5RA 4OGCA 2VWJA 3HJFA 3OS1A 4NCAA 1HYSA 1RDAA 1X9MA 5T7BA 2DFHA 1B9FA 4DTXA 1L3SA 1C1BA 4DLGA 4Z4HA 2FBXA 1SL0A 4HHTA 4DLEA 3I0SA 4GMJB 3ZCMA 1TAUA 2IGIA 2YNGA 3NGYA 3O3GA 3VQ6A 1A5WA 4K8ZA 1RT6A 2HW3A 1JXBA 1WSGA 3AVGA 5C42A 5SWMA 4I9LA 3OY9A 1KFDA 2OPRA 3KK2A 3ZSOA 5J1EA 1D5AA 2HHQA 3IG1A 3LPUA 3RRHA 2F8TA 1ASWA 3MEEA 4M41A 2YNFA 4CGDA 4KB0A 3ISNC 3ZSVA 1NJYA 3VQAA 5CZ2A 4CIGA 2O4GA 4W5RA 4DF4A 3SUPA 1ZBLA 1D9DA 1NJXA 1KRPA 4C8LA 3KK3A 5I42A 4ZTFA 3NGZA 2XO7A 3CM6A 3KD5E 1C0MA 1JLAA 4CEAA 2YHAA 5KTQA 2HVIA 1QSSA 3AA5X 1GOCA 3P1GA 1FKPA 3DLKA 3VQEA 5HRNA 5FDLA 4FLWA 1HJRA 4N47A 2E6MA 3OS0A 1RTIA 4OVLA 1ZBUA 4F2RA 1K6YA 4F8RA 4KREA 4FM0A 4LH4A 3NGIA 3SNNA 3K5OA 2IAJA 1C1CA 2D0BA 4FW1A 3NH1A 1SL1A 4DFJA 3V9SA 1YVUA 1NKCA 4B9VA 4IKFA 1NK7A 4KTQA 3AVCA 4O4GA 1S1VA 4RW4A 1UA0A 5J2PA 1BISA 2ZQBA 1WSIA 3O3HA 1KCFA 2RPIA 4M45A 3KLHA 3L2RA 3SV4A 3TANA 4B9NA 2BANA 5HBMA 3TR8A 1FXXA 3AO4A 1RTJA 3PX6A 1RT5A 2E6LA 4AILC 4PUOA 4DQIA 4M3TA 1S6QA 2Z1GA 1TL3A 1ZBFA 3MEDA 5C24A 1KFSA 4OLBA 2EHGA 3ZSZA 3LAKA 1JXEA 1Y97A 2I5JA 3CFOA 4DU1A 1Z25A 2YKMA 1S1WA 1SKRA 2VG7A 1Z26A 1G15A 1VK0A 2YNHA 4DFKA 4DSIA 2JGUA 1XHZA 1GOAA 1XWLA 1EETA 4L8RB 4AHRA 2F96A 4CK1A 1TK5A 4HUEA 2KZZA 4W5QA 4RW8A 5KRTA 1TK8A 1ASUA 4KPYA 2GBZA 4B3OA 2LSNA 5D3GA 4ICLA 4E3SA 4CJWA 1SUQA 4FM2A 4AHSA 3AV9A 4PA1A 4FXDA 3QEWA 1J9AA 4O0JA 4KFBA 3NH2A 4FJJA 2AJQA 3HVTA 4FJXA 1RBVA 3G0ZA 1W9HA 3PO5A 3L2UA 4XIUA 3S3NA 1FKOA 3LP2A 3L2WA 1WAJA 3LWMA 3QEXA 4HCBA 4CEEA 3HL8A 4C8NA 3M8RA 3TAPA 4FJLA 3OVNA 4Q5VA 4KI6A 2FBTA 4KV8A 5JS2A 1ZYQA 1NK9A 4IFVA 1NK6A 1I3AA 1LW2A 4CGGA 2Y1JA 1EXQA 3TI0A 3AVBA 4F3TA 2YV0X 1HMVA 3DYAA 1NJWA 1T03A 4NCBA 4M42A 3VA0A 2KFZA 2G8VA 2IOCA 1J54A 2G8FA 4OKKA 4CJFA 1S9EA 4DTMA 5CY4A 1WSJA 3V1RA 2R7YA 3KD1E 3O4QA 1TKTA 4AHVA 3L8BA 3RTVA 3LP1A 4M3ZA 4MQ3A 1C0UA 4CEOA 1DLOA 4CFCA 3MECA 3T3FA 2B6AA 3AO3A 4CFAA 3S9HA 1Q9YA 3K57A 4LSNA 3QERA 1N6QA 4I9QA 4B8AB 3O4NA 4JS5A 4PWDA 4KB1A 2RF2A 3B6PA 4B9MA 1ITGA 1KVCA 2JLEA 3KLGA 4O0IA 4CHQA 3OYDA 4CJKA 4FJ7A 4C8MA 4HTUA 1RDCA 2Z1HA 2P1JA 3O3FA 4CECA 1TGOA 3AA4A 3KK1A 3CQ8A 2OPPA 2HHUA 2GV9A 4J2BA 4YNQA 3V4IA 4RW7A 2XY7A 4CGIA 4CJSA 3TAFA 4KAZA 2BDPA 2HNYA 4E7LA 4J2AA 2ATQA 1TKXA 4RW6A 4OPKA 1SKSA 2G8WA 4F2SA 4FJGA 2ZE2A 3ZSQA 3HPOA 3OYCA 1NK5A 3OYBA 4FYDA 1MU2A 2DFEA 1UWBA 2P51A 4G1QA 4BWJA 3U3GA 3VQ8A 3SUNA 2G8IA 1DTTA 4Z0UA 1U48A 3I8DA 1T7PA 3TAEA 4FK2A 2IC3A 1VSKA 4PY5A 3AO1A 4Z4FA 4DQSA 4FJ9A 4CIEA 4HVJA 3PX4A 5EU7A 2HNZA 4F4KA 4Z4GA 3OJSA 4EZ6A 2BGGA 2X6NA 1IG9A 3IRXA 1B9DA 4GVMA 1NKEA 4ID5A 3SQ4A 4FLXA 1L3TA 3DI6A 3BGRA 4RG8A 4CFBA 4FLVA 4Z4CA 3AVLA 1S9GA 2EX3A 4CJTA 3ASMA 3NAEA 3VQ9A 4UQGA 1NK0A 4E7IA 4E7JA 4IG3A 2HHWA 4Z4EA 2KZMA 4CF8A 3KLFA 1T05A 3IS9A 4BDZA 1RBTA 1RILA 5KGXA 2HHXA 4CF0A 3AVIA 3VQDA 4CK2A 5J2NA 4M3UA 3AVAA 3OYNA 3ZT1A 3OYFA 3CFRA 1CZBA 1VSIA 2XY8A 4FLTA 2D0CA 1JL2A 3LP3A 1IKXA 2HHTA 4CHYA 3P83D 4O55A 3NHGA 4FJMA 4CJUA 4KHUA 4CF1A 1CXQA 3T1AA 3NE6A 5FRNA 1RT2A 3ZSRA 2VWKA 3CYMA 3C6TA 1TKDA 3NBPA 4EP4A 4B8CA 3S3MA 3OYLA 3WNEA 3U6FA 3HT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5V A;  5K14 A;  1BHL A;  3DLE A;  4F3O A;  4DSJ A;  1Q8I A;  2QXF A;  4KI4 A;  2X74 A;  1RDD A;  1ZBH A;  2KFN A;  1FK9 A;  1HQU A;  1VSH A;  2YKN A;  4R5P A;  2XHB A;  4B9L A;  1WNS A;  4W5N A;  4N76 A;  4BE0 A;  3K58 A;  3ZSW A;  5HRS A;  1VSD A;  5CZ1 A;  3HVR A;  5DK5 A;  1NK8 A;  3M8S A;  4DFP A;  3QIN A;  3V1O A;  1Q9X A;  3DOL A;  4QOZ B;  3DLR A;  4CJL A;  3KTQ A;  1RDB A;  1S6P A;  3DOK A;  4CHO A;  3LZI A;  3KJV A;  3LP0 A;  1DTQ A;  4AHT A;  3K5N A;  3KLI A;  3A2F A;  3NFA A;  2P5O A;  4C8O A;  1CZ9 A;  1BQN A;  1NOZ A;  1WSF A;  4O44 A;  3AA2 A;  3DRS A;  4QAG A;  5CYM A;  3QEV A;  1UA1 A;  5HLF A;  5CYQ A;  3QEI A;  1CXU A;  1KTQ A;  3NCI A;  1U47 A;  4DG1 A;  3K59 A;  1WLJ A;  4FLU A;  3TAR A;  3NH0 A;  1F21 A;  4FZY A;  4RW9 A;  3SCX A;  4FVM A;  4EZ9 A;  4KKO A;  4DSE A;  3CG7 A;  1JKH A;  4FK0 A;  2DY4 A;  2BE2 A;  2ITG A;  4CED A;  3HO1 A;  3OYG A;  4DSF A;  3AVN A;  4NYN A;  4DTR A;  1VSE A;  4LH5 A;  2VG5 A;  4N56 A;  1BI4 A;  1RBS A;  3SQ0 A;  1SKW A;  5JS1 A;  1J53 A;  1L5U A;  5KI6 A;  4FJN A;  4E1M A;  4LD0 A;  1U4B A;  3TAQ A;  1TKZ A;  2O4I A;  1HYV A;  4FLZ A;  2B4J A;  3TWH A;  4IBN A;  3H08 A;  3VA3 A;  1JL1 A;  5I3U A;  1LWE A;  3DLH A;  4FJH A;  4DSL A;  4KHW A;  4KHN A;  3RMB A;  4CE9 A;  4DTJ A;  1BI4 B;  3SYZ A;  4HUF A;  4FJ5 A;  1LWC A;  2B5J A;  5J2M A;  3MXI A;  3HK2 A;  4FLY A;  1C6V A;  1LW0 A;  5SZT A;  3TAM A;  3VQ4 A;  3MXM A;  4CJP A;  4M3R A;  1JLB A;  4OJR A;  2OZS A;  2Z1J A;  5C25 A;  2G8U A;  1RT3 A;  3HM9 A;  4NYF A;  1U04 A;  3NF8 A;  3ALY A;  2D0A A;  4KRF A;  1WN7 A;  3SQ1 A;  2DTU A;  4DQQ A;  1BGX T;  3F73 A;  1QSL A;  1W0H A;  3PY8 A;  4TSX A;  3AVJ A;  1R0A A;  1RT7 A;  3AVF A;  1NOY A;  1TL1 A;  4FJ8 A;  4N41 A;  4CHP A;  5FRM A;  4DS4 A;  3S3O A;  2DFF A;  3HP9 A;  3LPT A;  1JLE A;  3AVK A;  4OGE A;  3V1Q A;  1TV6 A;  1N5Y A;  2PZS A;  3KKR A;  1TVR A;  2NUB A;  4LSL A;  3T19 A;  4BE1 A;  3SZ2 A;  4Z4I A;  1ZBI A;  4BDP A;  3CFP A;  2PYL A;  2P5G A;  1VRU A;  2ETJ A;  3PUF A;  3SQ2 A;  3RMC A;  4J2E A;  3QNN A;  4JRQ A;  4CJQ A;  3AVH A;  4AHU A;  1RCH A;  3JSM A;  3SI6 A;  1XHX A;  1IKW A;  1BL3 A;  1JLG A;  4BE2 A;  5DMR A;  3D45 A;  4BAC A;  4DU4 A;  1X9W A;  3M8P A;  1BCM A;  5J2Q A;  1QE1 A;  4OPJ A;  1RT1 A;  4LY7 A;  4CEZ A;  1WAF A;  3AA3 A;  3AO5 A;  3VQ5 A;  4BWM A;  4CES A;  4CCH A;  1CLQ A;  1D8Y A;  3C6U A;  4CJV A;  3NF9 A;  3WNG A;  2A1R A;  4DFM A;  3K5L A;  1BIZ A;  4KHS A;  5HP1 A;  2Q3S A;  3FFI A;  4JS4 A;  3K5M A;  1WSH A;  4KO0 A;  3VQP A;  2XY5 A;  1RTD A;  3RR7 A;  1RT4 A;  2IDO A;  4CGF A;  3VQC A;  5HRP A;  4DWI A;  3L3U A;  4CHZ A;  1SL2 A;  1VSM A;  1T8E A;  4C8K A;  3LAN A;  4E19 A;  4M3Y A;  5FRO A;  3RMD A;  3C95 A;  1B92 A;  3ZT0 A;  4DMN A;  4M3W A;  2YHB A;  4CEQ A;  3PX0 A;  4DTS A;  4DSK A;  3D0P A;  2RN2 A;  1NKB A;  1REV A;  3TAG A;  2RKI A;  1JLQ A;  3OYE A;  4IDK A;  4KTW A;  4M3X A;  3DRP A;  2OPS A;  2X6S A;  3E01 A;  1HNV A;  1QS4 A;  3V9X A;  3JYT A;  1UAX A;  4DU3 A;  3QIP A;  4E89 A;  1YT3 A;  1YTU A;  4CEB A;  4DTU A;  3EYZ A;  4DF8 A;  3ZT4 A;  3ULD A;  4KHY A;  4HCC A;  1KVB A;  3OS2 A;  2HVH A;  3G10 A;  4KTZ A;  1BCO A;  4H4O A;  4FK4 A;  2W42 A;  1S1X A;  4I7F A;  4CJE A;  3UIQ A;  3NF6 A;  4IG0 A;  4CIF A;  3SUO A;  4CGH A;  3IAY A;  1IKY A;  4Y1C A;  3DMJ A;  1IKV A;  3ZT2 A;  3OJU A;  3SV3 A;  1HPZ A;  4OLA A;  3NF7 A;  3RR8 A;  1VSJ A;  4ZHR A;  4FZZ A;  3F9K A;  4H8K A;  2HB5 A;  4WE1 A;  3LZJ A;  3SJJ A;  2OYQ A;  1EP4 A;  4JLH A;  3MXJ A;  3WNH A;  1X9S A;  5KRS A;  3VQ7 A;  3LAM A;  3EZ5 A;  3TAB A;  2YNI A;  4MFB A;  2PYJ A;  4K8X A;  4FJK A;  4KHQ A;  2X78 A;  1X1P A;  3DRR A;  3C94 A;  3DM2 A;  3DLB A;  1QSY A;  1SV5 A;  2FBV A;  5KGW A;  4CF9 A;  3EY1 A;  4AHC A;  1J5O A;  3V6D A;  3QO9 A;  2G8H A;  4BDY A;  2HHS A;  3LAL A;  4CK3 A;  3RMA A;  2OA8 A;  1VSL A;  2QK9 A;  1BQM A;  1LV5 A;  3HPG A;  2KW4 A;  3KKS A;  3OYH A;  3RRG A;  1BIU A;  1RBU A;  4Y1D A;  5E41 A;  3OYI A;  2KQ2 A;  3OYK A;  1RBR A;  4B9U A;  3P5J A;  1XI1 A;  1U49 A;  1VSF A;  1WSE A;  1A5X A;  4GW6 A;  4E1N A;  2IS3 A;  1QTM A;  1S1T A;  3DLG A;  1LAW A;  4CJR A;  3HXM A;  4CEF A;  1RTH A;  3SPY A;  1XC9 A;  2QKK A;  4J2D A;  3KIO A;  3M8Q A;  4N5S A;  4FW2 A;  1HRH A;  1KSP A;  1JLF A;  1YTA A;  1GOB A;  3V81 A;  1HYZ A;  4DS5 A;  1O1W A;  5HRR A;  3VN5 A;  1KLN A;  1S1U A;  2GUI A;  2WON A;  4CFD A;  1IH7 A;  3BDP A;  2XY6 A;  4ELT A;  2PY5 A;  4CJ4 A;  5HRO A;  2VG6 A;  4I2Q A;  1ASV A;  4OKJ A;  4YFU A;  4B08 A;  3QEP A;  1NK4 A;  3QES A;  4W5O A;  1U45 A;  3HP6 A;  3VQQ A;  2G8K A;  2FBY A;  3SPZ A;  3ZSY A;  4Q0B A;  1EKE A;  3THV A;  4PQU A;  3ZT3 A;  3I0R A;  3NDK A;  3CM5 A;  3SUQ A;  1D9F A;  4IFY A;  1KVA A;  4AH9 A;  4CHN A;  3L2V A;  3QET A;  4QCL A;  4CER A;  4JRP A;  4DTO A;  1NJZ A;  4EP5 A;  3HST B;  2Y1I A;  3ZSX A;  2A1S A;  2XRI A;  1C0T A;  2WOM A;  3HPH A;  3B6O A;  4ID1 A;  3MAQ A;  4E7K A;  3ITH A;  4DTN A;  4FZX C;  4CJ5 A;  3LDS A;  3V9W A;  1IO2 A;  1TAQ A;  3U3Y A;  4B9T A;  3PV8 A;  2ZD1 A;  4B9S A;  4DTP A;  3RWU A;  4NCG A;  4OKE A;  4W5T A;  2F8S A;  2QKB A;  4CGJ A;  3KLE A;  3V9U A;  3LWL A;  4DQR A;  1LAV A;  1KLM A;  1HNI A;  3PO4 A;  4ELU A;  4E7H A;  3HYF A;  2Z1I A;  3QIO A;  4FJI A;  4FCY A;  4I2P A;  4HUG A;  2HMI A;  4DQP A;  4ELV A;  3QNO A;  1S5J A;  1LWF A;  3AO2 A;  1QQC A;  3L3V A;  3L2Q A;  1L3U A;  3OYA A;  4E0D A;  4CJ3 A;  1UOC A;  2OPQ A;  4ZTJ A;  3K2P A;  1HQE A;  3V9Z A;  1C1A A;  1JLC A;  1RNH A;  3AVM A;  3MEG A;  3OYJ A;  1TK0 A;  1QHT A;  2FC0 A;  3WNF A;  4FM1 A;  2HHV A;  4H4M A;  1I39 A;  2KTQ A;  3QLH A;  3OYM A;  4O5B A;  1VRT A;  2E4L A;  4CF2 A;  3VQB A;  2OZM A;  1EX4 A;  2HND A;  1L3V A;  2D5R A;  4OGC A;  2VWJ A;  3HJF A;  3OS1 A;  4NCA A;  1HYS A;  1RDA A;  1X9M A;  5T7B A;  2DFH A;  1B9F A;  4DTX A;  1L3S A;  1C1B A;  4DLG A;  4Z4H A;  2FBX A;  1SL0 A;  4HHT A;  4DLE A;  3I0S A;  4GMJ B;  3ZCM A;  1TAU A;  2IGI A;  2YNG A;  3NGY A;  3O3G A;  3VQ6 A;  1A5W A;  4K8Z A;  1RT6 A;  2HW3 A;  1JXB A;  1WSG A;  3AVG A;  5C42 A;  5SWM A;  4I9L A;  3OY9 A;  1KFD A;  2OPR A;  3KK2 A;  3ZSO A;  5J1E A;  1D5A A;  2HHQ A;  3IG1 A;  3LPU A;  3RRH A;  2F8T A;  1ASW A;  3MEE A;  4M41 A;  2YNF A;  4CGD A;  4KB0 A;  3ISN C;  3ZSV A;  1NJY A;  3VQA A;  5CZ2 A;  4CIG A;  2O4G A;  4W5R A;  4DF4 A;  3SUP A;  1ZBL A;  1D9D A;  1NJX A;  1KRP A;  4C8L A;  3KK3 A;  5I42 A;  4ZTF A;  3NGZ A;  2XO7 A;  3CM6 A;  3KD5 E;  1C0M A;  1JLA A;  4CEA A;  2YHA A;  5KTQ A;  2HVI A;  1QSS A;  3AA5 X;  1GOC A;  3P1G A;  1FKP A;  3DLK A;  3VQE A;  5HRN A;  5FDL A;  4FLW A;  1HJR A;  4N47 A;  2E6M A;  3OS0 A;  1RTI A;  4OVL A;  1ZBU A;  4F2R A;  1K6Y A;  4F8R A;  4KRE A;  4FM0 A;  4LH4 A;  3NGI A;  3SNN A;  3K5O A;  2IAJ A;  1C1C A;  2D0B A;  4FW1 A;  3NH1 A;  1SL1 A;  4DFJ A;  3V9S A;  1YVU A;  1NKC A;  4B9V A;  4IKF A;  1NK7 A;  4KTQ A;  3AVC A;  4O4G A;  1S1V A;  4RW4 A;  1UA0 A;  5J2P A;  1BIS A;  2ZQB A;  1WSI A;  3O3H A;  1KCF A;  2RPI A;  4M45 A;  3KLH A;  3L2R A;  3SV4 A;  3TAN A;  4B9N A;  2BAN A;  5HBM A;  3TR8 A;  1FXX A;  3AO4 A;  1RTJ A;  3PX6 A;  1RT5 A;  2E6L A;  4AIL C;  4PUO A;  4DQI A;  4M3T A;  1S6Q A;  2Z1G A;  1TL3 A;  1ZBF A;  3MED A;  5C24 A;  1KFS A;  4OLB A;  2EHG A;  3ZSZ A;  3LAK A;  1JXE A;  1Y97 A;  2I5J A;  3CFO A;  4DU1 A;  1Z25 A;  2YKM A;  1S1W A;  1SKR A;  2VG7 A;  1Z26 A;  1G15 A;  1VK0 A;  2YNH A;  4DFK A;  4DSI A;  2JGU A;  1XHZ A;  1GOA A;  1XWL A;  1EET A;  4L8R B;  4AHR A;  2F96 A;  4CK1 A;  1TK5 A;  4HUE A;  2KZZ A;  4W5Q A;  4RW8 A;  5KRT A;  1TK8 A;  1ASU A;  4KPY A;  2GBZ A;  4B3O A;  2LSN A;  5D3G A;  4ICL A;  4E3S A;  4CJW A;  1SUQ A;  4FM2 A;  4AHS A;  3AV9 A;  4PA1 A;  4FXD A;  3QEW A;  1J9A A;  4O0J A;  4KFB A;  3NH2 A;  4FJJ A;  2AJQ A;  3HVT A;  4FJX A;  1RBV A;  3G0Z A;  1W9H A;  3PO5 A;  3L2U A;  4XIU A;  3S3N A;  1FKO A;  3LP2 A;  3L2W A;  1WAJ A;  3LWM A;  3QEX A;  4HCB A;  4CEE A;  3HL8 A;  4C8N A;  3M8R A;  3TAP A;  4FJL A;  3OVN A;  4Q5V A;  4KI6 A;  2FBT A;  4KV8 A;  5JS2 A;  1ZYQ A;  1NK9 A;  4IFV A;  1NK6 A;  1I3A A;  1LW2 A;  4CGG A;  2Y1J A;  1EXQ A;  3TI0 A;  3AVB A;  4F3T A;  2YV0 X;  1HMV A;  3DYA A;  1NJW A;  1T03 A;  4NCB A;  4M42 A;  3VA0 A;  2KFZ A;  2G8V A;  2IOC A;  1J54 A;  2G8F A;  4OKK A;  4CJF A;  1S9E A;  4DTM A;  5CY4 A;  1WSJ A;  3V1R A;  2R7Y A;  3KD1 E;  3O4Q A;  1TKT A;  4AHV A;  3L8B A;  3RTV A;  3LP1 A;  4M3Z A;  4MQ3 A;  1C0U A;  4CEO A;  1DLO A;  4CFC A;  3MEC A;  3T3F A;  2B6A A;  3AO3 A;  4CFA A;  3S9H A;  1Q9Y A;  3K57 A;  4LSN A;  3QER A;  1N6Q A;  4I9Q A;  4B8A B;  3O4N A;  4JS5 A;  4PWD A;  4KB1 A;  2RF2 A;  3B6P A;  4B9M A;  1ITG A;  1KVC A;  2JLE A;  3KLG A;  4O0I A;  4CHQ A;  3OYD A;  4CJK A;  4FJ7 A;  4C8M A;  4HTU A;  1RDC A;  2Z1H A;  2P1J A;  3O3F A;  4CEC A;  1TGO A;  3AA4 A;  3KK1 A;  3CQ8 A;  2OPP A;  2HHU A;  2GV9 A;  4J2B A;  4YNQ A;  3V4I A;  4RW7 A;  2XY7 A;  4CGI A;  4CJS A;  3TAF A;  4KAZ A;  2BDP A;  2HNY A;  4E7L A;  4J2A A;  2ATQ A;  1TKX A;  4RW6 A;  4OPK A;  1SKS A;  2G8W A;  4F2S A;  4FJG A;  2ZE2 A;  3ZSQ A;  3HPO A;  3OYC A;  1NK5 A;  3OYB A;  4FYD A;  1MU2 A;  2DFE A;  1UWB A;  2P51 A;  4G1Q A;  4BWJ A;  3U3G A;  3VQ8 A;  3SUN A;  2G8I A;  1DTT A;  4Z0U A;  1U48 A;  3I8D A;  1T7P A;  3TAE A;  4FK2 A;  2IC3 A;  1VSK A;  4PY5 A;  3AO1 A;  4Z4F A;  4DQS A;  4FJ9 A;  4CIE A;  4HVJ A;  3PX4 A;  5EU7 A;  2HNZ A;  4F4K A;  4Z4G A;  3OJS A;  4EZ6 A;  2BGG A;  2X6N A;  1IG9 A;  3IRX A;  1B9D A;  4GVM A;  1NKE A;  4ID5 A;  3SQ4 A;  4FLX A;  1L3T A;  3DI6 A;  3BGR A;  4RG8 A;  4CFB A;  4FLV A;  4Z4C A;  3AVL A;  1S9G A;  2EX3 A;  4CJT A;  3ASM A;  3NAE A;  3VQ9 A;  4UQG A;  1NK0 A;  4E7I A;  4E7J A;  4IG3 A;  2HHW A;  4Z4E A;  2KZM A;  4CF8 A;  3KLF A;  1T05 A;  3IS9 A;  4BDZ A;  1RBT A;  1RIL A;  5KGX A;  2HHX A;  4CF0 A;  3AVI A;  3VQD A;  4CK2 A;  5J2N A;  4M3U A;  3AVA A;  3OYN A;  3ZT1 A;  3OYF A;  3CFR A;  1CZB A;  1VSI A;  2XY8 A;  4FLT A;  2D0C A;  1JL2 A;  3LP3 A;  1IKX A;  2HHT A;  4CHY A;  3P83 D;  4O55 A;  3NHG A;  4FJM A;  4CJU A;  4KHU A;  4CF1 A;  1CXQ A;  3T1A A;  3NE6 A;  5FRN A;  1RT2 A;  3ZSR A;  2VWK A;  3CYM A;  3C6T A;  1TKD A;  3NBP A;  4EP4 A;  4B8C A;  3S3M A;  3OYL A;  3WNE A;  3U6F A;  3HT3 A; 
#chains in the Genus database with same CATH topology
 1A5V A;  3AY9 A;  1BHL A;  4GV6 A;  1Q8I A;  2QXF A;  1RDD A;  1IJJ A;  3CF5 L;  3VF6 A;  4CZK A;  2YI1 A;  4MLH A;  3ZSW A;  1NK8 A;  3JXU A;  4NO7 A;  5BR8 K;  1YUW A;  2V7Z A;  4QOZ B;  3LZI A;  4CHO A;  1EWR A;  3KLI A;  4C1N I;  2P5O A;  4JK9 A;  3K9K A;  1UA1 A;  5CYQ A;  3ENB A;  3O8M A;  3NCI A;  3K59 A;  4FLU A;  5AZJ A;  3NH0 A;  1F21 A;  4FZY A;  3SCX A;  4FVM A;  2VGM A;  4BRL A;  4DSE A;  3THY B;  3CG7 A;  1M1K O;  4CED A;  3HO1 A;  3AVN A;  5ADX A;  2Q36 A;  2QWL A;  1BI4 A;  5JS1 A;  1SKW A;  1GLF O;  1G99 A;  3U8X A;  3TAQ A;  4IDH A;  4KHP K;  3VA3 A;  1JL1 A;  4BR2 A;  5KPZ A;  3RMB A;  4CE9 A;  3F2K A;  1BI4 B;  4HUF A;  3J81 O;  1LWC A;  4FJ5 A;  3HK2 A;  1C6V A;  1LW0 A;  4YOR A;  3TAM A;  3VQ4 A;  3BP8 A;  4CJP A;  4M3R A;  4OJR A;  3KHY A;  2Z1J A;  5C25 A;  2G8U A;  2E2P A;  3NF8 A;  3ALY A;  2D0A A;  3C0B A;  3F73 A;  1QSL A;  3A5O C;  4JKB A;  4BRC A;  1NOY A;  1TL1 A;  4FJ8 A;  1ZXO A;  2DFF A;  3LPT A;  4OGE A;  3AVK A;  3V1Q A;  1KAX A;  5JVH L;  2NUB A;  3A0I X;  2OTL N;  4WQ4 A;  2P5G A;  3SQ2 A;  4JRQ A;  4DV2 K;  4CJQ A;  3CJ1 A;  1RCH A;  2NRH A;  1BL3 A;  4GV3 A;  4PHT X;  4BE2 A;  3D45 A;  4DU4 A;  4F9O A;  4O5F A;  2P9N B;  1NWK A;  4OPJ A;  4LY7 A;  3WQT A;  3AA3 A;  5BN9 A;  4CES A;  1D8Y A;  3C6U A;  1YXQ A;  3WNG A;  4DFM A;  4UY8 O;  2XY5 A;  4KO0 A;  1RTD A;  3RR7 A;  1RT4 A;  4DWI A;  4BR4 A;  1T8E A;  4M3Y A;  3C95 A;  3CJB A;  5AZI B;  4FWL A;  2KLA A;  4KH6 A;  3SAF A;  1SZ2 A;  1BA0 A;  4BVP A;  1REV A;  2RKI A;  4IDK A;  3DRP A;  2OPS A;  2X6S A;  3GDQ A;  3GOI A;  1UAX A;  3QIP A;  4CEB A;  3ULD A;  2PAV A;  3C7N B;  3H3N O;  3RVC A;  3G10 A;  5TKY A;  3FZL A;  3UIQ A;  4CIF A;  3IAY A;  5GAG P;  4IWV A;  1KC8 O;  3GE1 A;  3OJU A;  3J8A A;  1HPZ A;  3RR8 A;  2IVN A;  4H8K A;  3LZJ A;  4WE1 A;  1ATR A;  3VQ7 A;  3LAM A;  3PIO L;  3TAB A;  4MFB A;  4FJK A;  3C65 A;  1QVG M;  3DRR A;  4NB4 A;  3ZET B;  3EY1 A;  3CCM N;  4BDY A;  3VER A;  5AQI A;  1S22 A;  3KKS A;  3RRG A;  5E41 A;  1RBU A;  2Q0R A;  3OYI A;  2KQ2 A;  2BH1 A;  3HM8 A;  1RBR A;  3ATV A;  1VSF A;  4GW6 A;  1A5X A;  4E1N A;  2O8D A;  1QTM A;  4JI1 K;  4CJR A;  3SPY A;  4JI3 K;  4J2D A;  4JI5 K;  4QS8 A;  5AJ3 K;  1KSP A;  1YTA A;  3O9U A;  2GUI A;  4BRO A;  4M63 C;  3THW B;  4AQY K;  2NRV A;  2NLX A;  4OKJ A;  5JLH A;  4LF8 K;  3HP6 A;  5FPE A;  4LF6 K;  3BF3 A;  2FBY A;  1EKE A;  4PQU A;  1QZ6 A;  3NDK A;  2ZJR L;  3CM5 A;  2Q1N A;  1D9F A;  4BRP A;  3U9D A;  1MWK A;  2Y1I A;  5BPN A;  2W6L A;  3HPH A;  3MAQ A;  1LCU A;  3ITH A;  3KWG A;  3V9W A;  3VEY A;  3NMU A;  4NCG A;  4EFH A;  3KLE A;  3EN9 A;  4CZF A;  1VAZ A;  4HUG A;  4FCY A;  4B3M K;  3CPW M;  4DV0 K;  1XQS C;  3OYA A;  3VET A;  4XH5 A;  4CJ3 A;  1UOC A;  2OPQ A;  4CZG A;  3IKM A;  4FPB A;  3MEG A;  3QBX A;  3BEX A;  5H1S Q;  2FC0 A;  3FZH A;  1I39 A;  3OYM A;  2O8E B;  2P9P B;  4CF2 A;  4JKH A;  2HND A;  2D5R A;  3KK7 A;  4NCA A;  1X9M A;  4BRQ A;  5T7B A;  2DFH A;  4DTX A;  1L3S A;  1ATN A;  4FVU A;  2O8C B;  3J7Y P;  4IO9 L;  1TAU A;  4WFN L;  3VQ6 A;  1WUA A;  1JXB A;  5AQZ A;  3N4Q A;  3E9P A;  3IFR A;  3ZEU B;  2HHQ A;  4BGB A;  4JKF A;  3MEE A;  4LFC K;  4HWI A;  4KB0 A;  3ZSV A;  1D9D A;  4BVO A;  5AFU H;  4MDB A;  3CCE N;  5I42 A;  3L0Q A;  4ZTF A;  4PKH A;  4X64 K;  2WC9 A;  4CBX A;  4IO8 A;  3AA5 X;  2UXB K;  3P1G A;  1FKP A;  4FLW A;  1HJR A;  4CBW A;  4OPA A;  1TYQ A;  3FZK A;  4BRE A;  3OA9 A;  4B1V A;  1C1C A;  4JKD A;  3V9S A;  1Q82 O;  1J5O A;  3SV4 A;  2RPI A;  3AO4 A;  3QB0 A;  3I33 A;  4FOI A;  4AIL C;  4PUO A;  4ILG B;  3LDO A;  4K42 A;  3MED A;  1TL3 A;  3ULE A;  1NGC A;  4CD1 A;  2YCH A;  2I5J A;  4DU1 A;  2V52 B;  1SKR A;  1SQK A;  2VG7 A;  3AAP A;  2ITM A;  1Z26 A;  4DSI A;  2JGU A;  1XHZ A;  4L8R B;  1EET A;  4CK1 A;  3CMA N;  4DV6 K;  2KZZ A;  5KRT A;  3OBW A;  3D7E O;  4ICL A;  4B1U B;  1SUQ A;  4C23 A;  4FM2 A;  4DR4 K;  3AV9 A;  3DXM A;  3NH2 A;  3HVT A;  3T1H K;  4FJX A;  3PO5 A;  1W9H A;  1T6D A;  5AQM A;  3S3N A;  3LP2 A;  1HKB A;  3LWM A;  1P8Z A;  4PKI A;  2OTJ N;  3M8R A;  3A5M C;  3OVN A;  4KV8 A;  4IFV A;  1I3A A;  2UUA K;  3QDK A;  1NJW A;  1J54 A;  4CJF A;  1XNR K;  4DTM A;  3J7Z O;  5FPM A;  1X3M A;  3UKU A;  5AQW A;  4MQ3 A;  5TKW A;  2CH6 A;  2B6A A;  3AO3 A;  3QFU A;  3UKU B;  1Q9Y A;  3K57 A;  1K8A O;  1N6Q A;  4PWD A;  4B8A B;  3O4N A;  4JS5 A;  4YDU A;  1ITG A;  1KVC A;  3KLG A;  3QFP A;  4FJ7 A;  3IUC A;  2IVP A;  3MWT A;  3CHW A;  2GX9 A;  3RSE B;  4RWT A;  3M6G A;  3UB5 A;  4J2B A;  3B8A X;  3AAQ A;  3CCR N;  4CGI A;  4FJG A;  3WXL A;  5BPL A;  1MU2 A;  4G1Q A;  3CC2 N;  3GG4 A;  1DTT A;  4K43 A;  2IC3 A;  4H0T B;  4DQS A;  4HVJ A;  5C15 A;  4JD2 B;  4JHD B;  1IG9 A;  1B9D A;  3SQ4 A;  5E26 A;  1L3T A;  1QZ5 A;  5AQT A;  3BGR A;  2HHH K;  4Z4C A;  3AVL A;  2GWJ A;  2V7Y A;  3SK3 A;  1E3M A;  4CJT A;  3VQ9 A;  4UQG A;  5LY3 A;  2O8B A;  4DUZ K;  4IG3 A;  3M5R A;  4PL7 A;  4CF8 A;  3HZ6 A;  2NNW A;  3VES A;  5C12 A;  3MDQ A;  2HHX A;  3AVI A;  4M3U A;  4BRI A;  1NNE A;  3OYF A;  4K41 A;  4FLT A;  4WQ5 C;  3OBY A;  3O9Q A;  3P83 D;  5AFU A;  3GL1 A;  1KAY A;  4CF1 A;  3T1A A;  3NE6 A;  1RT2 A;  2VWK A;  2HBJ A;  1GLE G;  1YF5 L;  4EP4 A;  3CCS N;  3S3M A;  3OYL A;  3FFK B;  3HT3 A;  5K14 A;  4DS4 A;  5F0X A;  3ZYY X;  1M90 O;  4DSJ A;  4F3O A;  4JI0 K;  2KFN A;  1U2V B;  3FE1 A;  4YOX A;  1VSH A;  2YKN A;  4R5P A;  4B9L A;  4LFB K;  3WUH A;  5HRS A;  4H0Y B;  1NGG A;  2F7T A;  4A62 A;  1WBD A;  3DOL A;  1VQ4 N;  3DLR A;  3VGL A;  2WBN A;  1RDB A;  3DOK A;  3LP0 A;  3D2E B;  3WXI A;  3TU5 A;  2H3G X;  3K5N A;  5BR9 A;  3AA2 A;  4Z94 A;  3EE8 A;  5HLF A;  4WFA L;  1U47 A;  1KQS M;  4EZ9 A;  4IXC A;  1JKH A;  2GTD A;  2QA4 N;  4N56 A;  3SQ0 A;  4FJN A;  4AM6 A;  4E1M A;  1U4B A;  1BDG A;  3VEW A;  4FLZ A;  5BRH A;  3H08 A;  4KHW A;  4CBU A;  2B5J A;  5SZT A;  1JLB A;  2OZS A;  1SAZ A;  3ZEU A;  3HM9 A;  1MWM A;  4NYF A;  2AP1 A;  1HJO A;  3H45 C;  1WN7 A;  3SQ1 A;  1RFQ A;  3CJC A;  2QI2 A;  3PY8 A;  1V4T A;  4TSX A;  3AVJ A;  3A5L C;  3PSF A;  4CZE A;  1R0A A;  3HI0 A;  1RT7 A;  3AVF A;  5AQG A;  4N41 A;  3LM2 A;  3SZ2 A;  3T19 A;  2I7N A;  4BDP A;  2ETJ A;  3PUF A;  3I56 N;  3ID8 A;  1ZC6 A;  3JSM A;  3AVH A;  5FPN A;  4AHU A;  5DMR A;  4BAC A;  5LMN K;  4DV1 K;  3VTI A;  5J2Q A;  1QE1 A;  4BRD A;  1RT1 A;  3EO3 A;  3VQ5 A;  4BWM A;  1S3X A;  3NF9 A;  3ZLJ A;  2A1R A;  3K5L A;  1BIZ A;  4KHS A;  3K5M A;  3VQP A;  2QW9 A;  2IDO A;  4CGF A;  4CHZ A;  1VSM A;  4C8K A;  3LAN A;  5FRO A;  5C2D A;  1B92 A;  4FWP A;  1E4F T;  4U67 L;  1IBL K;  4M3W A;  1BWF O;  4CEQ A;  5KQ8 A;  3U6F A;  3D0P A;  5LJW A;  3Q7C A;  2EWS A;  3LDL A;  3TAG A;  2IVO A;  4M3X A;  4DU3 A;  1X3N A;  1YT3 A;  1YTU A;  1NGJ A;  3ZT4 A;  4KHY A;  1W97 L;  1KVB A;  4H5R A;  4H4O A;  2W42 A;  4RCH A;  4I7F A;  4CJE A;  4IG0 A;  3SUO A;  4WQ4 C;  1IKY A;  3KZB A;  2GEM A;  2E2Q A;  4OLA A;  3NF7 A;  4ZHR A;  4DR7 K;  2HB5 A;  2VGN A;  3WNH A;  4C8L A;  3EZ5 A;  2PYJ A;  2X78 A;  3L4I A;  1YJN N;  3M1F A;  4CF9 A;  4BRK A;  4AHC A;  3V6D A;  1JCG A;  2HHS A;  2OA8 A;  3JAM O;  1LV5 A;  3HPG A;  2KW4 A;  1H1V A;  4NCB A;  4B1Y B;  3SAG A;  2CH5 A;  4H5W A;  1D4X A;  5ADX H;  2IS3 A;  1HYS A;  3KIO A;  1HRH A;  4XH4 A;  5EX5 A;  1HX1 A;  3V81 A;  1NGH A;  5HRR A;  2NRR A;  1NLV A;  3EL2 A;  1KLN A;  4EAH D;  4YY3 K;  4V19 S;  3BDP A;  1R59 O;  4ELT A;  2PY5 A;  4CJ4 A;  1Z05 A;  2VG6 A;  4YFU A;  1ASV A;  4B08 A;  4X62 K;  3QES A;  4W5O A;  1U45 A;  1O13 A;  2G8K A;  2QWO A;  3SPZ A;  2P9P A;  3ZT3 A;  3I0R A;  3SUQ A;  4AH9 A;  1VQP N;  4JKG B;  4DTO A;  2E5L K;  2A1S A;  3CQX A;  1NGA A;  1C0T A;  2XRI A;  2W40 A;  4E7K A;  3PIP L;  4DTN A;  2E2O A;  4FZX C;  4IOX A;  4AF1 A;  1IO2 A;  2PBD A;  1OKJ A;  4CD3 A;  5BRE A;  3VEX A;  3MN6 A;  4W5T A;  1JCE A;  4CGJ A;  1HNI A;  5AQS A;  4ELU A;  1ESV A;  2NZT A;  2Z1I A;  3QIO A;  2HBL A;  4I2P A;  2HMI A;  4DQP A;  4CZL A;  2WFB A;  3QNO A;  3L3V A;  2YHY A;  4FWN A;  3K2P A;  1RNH A;  1N36 K;  4FM1 A;  4OO1 J;  2P9L A;  4X65 K;  5F2R A;  2KTQ A;  2E1Y A;  2NRT A;  4JK8 A;  2OZM A;  3O5B A;  3VQB A;  5JIC A;  5C2F A;  4OGC A;  2VWJ A;  3HJF A;  1RDA A;  5KPT A;  1C1B A;  1DKG D;  4DLG A;  2FBX A;  1Q86 O;  1SL0 A;  4DLE A;  3I0S A;  2IGI A;  2YNG A;  3NGY A;  4K8Z A;  3D2E A;  4PL8 A;  3CIP A;  3OY9 A;  3ZSO A;  3IG1 A;  3RRH A;  4M41 A;  1GLL O;  5AQL A;  4JI6 K;  2P9U B;  4CIG A;  4DF4 A;  4W5R A;  1KRP A;  3CCQ N;  1NJX A;  4GKJ K;  2HF3 A;  4FWM A;  3KK3 A;  4KBO A;  1C0M A;  2YHA A;  2J4R A;  5LJV A;  1FW6 A;  1VQN N;  3L6Q A;  3CI5 A;  4F8R A;  4F2R A;  1K6Y A;  4FM0 A;  3K5O A;  2IAJ A;  3CCJ N;  4BR0 A;  1SL1 A;  4DFJ A;  1YVU A;  1J6Z A;  4KTQ A;  3AVC A;  4BGA A;  1UA0 A;  5J2P A;  1WSI A;  3O3H A;  1KCF A;  3KLH A;  3TAN A;  5I9E B;  3TR8 A;  4A61 A;  5CR4 A;  4GNI A;  4I6M B;  2Z1G A;  4DB3 A;  3THX B;  3LAK A;  1Z25 A;  3AGR A;  3FZM A;  4DFK A;  3DXK A;  4JN4 A;  1XWL A;  1BA1 A;  2F96 A;  1HLU A;  1C0G A;  2E1Z A;  4O8K A;  1ASU A;  2GBZ A;  1BUP A;  4E3S A;  3UE5 A;  4FXD A;  1YJ9 N;  4KFB A;  4FJJ A;  1RBV A;  2D1K A;  3L2U A;  4H5V A;  4IEI A;  3QEX A;  4HCB A;  1Q18 A;  4FJL A;  4KI6 A;  2QWP A;  3A8Y A;  1OH6 A;  1EWQ A;  3MX5 A;  1ZYQ A;  2P9U A;  1OVQ A;  1NK9 A;  3LM9 A;  4JI2 K;  3DAW A;  1QQM A;  2E8A A;  2IIR A;  4A2B A;  3OHR A;  2A41 A;  1VQ6 N;  2P9I B;  2G8V A;  4DKW A;  5M1N A;  2VCP A;  1S9E A;  4DR2 K;  1OH7 A;  3KD1 E;  1K8K B;  1TKT A;  4AHV A;  3RTV A;  4H5N A;  3CJ9 A;  4LF7 K;  1TUU A;  4CEO A;  1DLO A;  3OW2 M;  2FF6 A;  3MEC A;  4CFA A;  3S41 A;  2RF2 A;  4B9M A;  2JLE A;  4O0I A;  3NVK A;  4C8M A;  4JHD A;  4CEC A;  3AA4 A;  4JI8 K;  5AQX A;  2OPP A;  1N32 K;  4QS9 A;  2ZJP L;  3H3O B;  1U6Z A;  3T1Y K;  4DV7 K;  1E4G T;  4XEI A;  3ULE B;  1BOT O;  2ATQ A;  1TKX A;  5M1Q A;  1SKS A;  2UU9 K;  3ZSQ A;  3HPO A;  3OYB A;  1UWB A;  2G8I A;  3SUN A;  2W6K A;  1T7P A;  3TAE A;  4FK2 A;  5GAE P;  3O08 A;  4PY5 A;  4QS7 A;  3PX4 A;  4F4K A;  4Z4G A;  3OJS A;  4EZ6 A;  5AQJ A;  3ZX2 A;  3IRX A;  4GVM A;  3UKR A;  1NKE A;  3U4L A;  5C0Y A;  4RTF D;  3DI6 A;  3P39 A;  3BZK A;  4RG8 A;  4CFB A;  4FLV A;  1XUP O;  2EX3 A;  3BF1 A;  5C10 A;  1NK0 A;  3NAE A;  3CXC M;  4E7I A;  4Z4E A;  3KLF A;  1KXP A;  1T05 A;  4BDZ A;  1VQK N;  1YJW N;  1RBT A;  4CK2 A;  3AVA A;  4BRG A;  1XMO K;  1W7A A;  3BZC A;  2D0C A;  1JL2 A;  3LP3 A;  1IKX A;  2ASM A;  4DQ8 A;  3ENO A;  2P9K B;  4JEP A;  1RDU A;  4FPA A;  4L3Q A;  2X74 A;  2F4V K;  3C6A A;  4Y0W A;  1FK9 A;  2XHB A;  3CCU N;  1WNS A;  3R8E A;  4EHT A;  4BE0 A;  2F9W A;  3K58 A;  4CVN E;  1YI2 N;  3W0L A;  5DK5 A;  3LL3 A;  1IBM K;  3QIN A;  3V1O A;  1Q9X A;  1YVN A;  3CQY A;  4KH4 A;  4CJL A;  3KTQ A;  1ILY A;  3KJV A;  1DTQ A;  3NFA A;  3A2F A;  2UUB K;  1BQN A;  3IMX A;  3DRS A;  4QAG A;  3QEV A;  2QWN A;  3ATU A;  2E20 A;  3QEI A;  1CXU A;  1KTQ A;  3T7Z A;  4MO5 A;  1WLJ A;  3TAR A;  2BUP A;  4RW9 A;  1EO1 A;  4FWR A;  2E88 A;  2ITG A;  3D2F A;  2DY4 A;  5AQN A;  1GLJ O;  1VSE A;  2VG5 A;  1RBS A;  1J53 A;  1L5U A;  4OX9 K;  2O4I A;  1HYV A;  4IBN A;  4BC2 A;  4FJH A;  3DLH A;  2UXD K;  4DSL A;  3WEE B;  4KHN A;  1VQ5 N;  3HOT A;  4DTJ A;  2Q97 A;  4DCH A;  4JI7 K;  3MXI A;  4FLY A;  3MXM A;  1RT3 A;  4CZJ A;  1U04 A;  5AZI A;  4NLB A;  2DTU A;  4DQQ A;  1BGX T;  1WB9 A;  1W0H A;  1S72 N;  3WQU A;  5JMV A;  3SAH A;  4WF9 L;  3MN7 A;  3DJC A;  2PFU A;  3S3O A;  1TV6 A;  1N5Y A;  2PZS A;  3DWL A;  3KKR A;  4B1Z A;  1VRU A;  4BRF A;  5GIP A;  3RMC A;  3QNN A;  4R79 A;  3SI6 A;  1XHX A;  3SMS A;  1JLG A;  1U2V A;  3MK6 A;  5M1P A;  3M8P A;  2RE2 A;  4MLE A;  1BCM A;  5HL7 L;  5A2Q O;  3R9P A;  3ENH A;  1HNZ K;  4CCH A;  3CD6 N;  3VTH A;  1DGK N;  4FOE A;  4CJV A;  2VYP A;  4H0O A;  5HP1 A;  2NRZ A;  2Q3S A;  2HMP A;  1WSH A;  3P31 A;  4EIA A;  3VQC A;  5HRP A;  2JWK A;  4B1W B;  4CZM A;  4DMN A;  2YHB A;  3PX0 A;  3VMF B;  2A3Z A;  2FSJ A;  2RN2 A;  1NKB A;  1JLQ A;  3OYE A;  4JYA K;  3WEE A;  3JYT A;  1NMD A;  4HCC A;  3OS2 A;  4KTZ A;  1BCO A;  4FK4 A;  4Y1C A;  4FZZ A;  1N8R O;  2V51 B;  4FWO A;  2YJF A;  3SLC A;  4JLH A;  1X9S A;  3MXJ A;  5KRS A;  4K8X A;  1VQ7 N;  1NJI O;  3C94 A;  5KGW A;  2Q2R A;  3QO9 A;  4K25 A;  4H03 B;  3LAL A;  4CK3 A;  1VQM N;  3EKU A;  1BIU A;  4Y1D A;  1NGF A;  1NGB A;  4FL9 A;  4B9U A;  1I94 K;  1MDU B;  2E2N A;  1S1T A;  1LAW A;  1T3V A;  2QKK A;  1RTH A;  1OH5 A;  3EKS A;  1BO5 O;  1GOB A;  3O4W A;  1HYZ A;  3ZET A;  4YOW A;  1O1W A;  3J7A P;  2WTU A;  4DR1 K;  3VN5 A;  1S1U A;  4CFD A;  1IH7 A;  2A6A A;  2O8F A;  2P9K A;  2P9I A;  4YOV A;  5HRO A;  5EXW A;  3OTO K;  3QEP A;  3TTD A;  1NK4 A;  3LDN A;  5BPM A;  4GKK K;  3ZSY A;  3THV A;  4DR3 K;  3L2V A;  4CHN A;  1J5E K;  4QCL A;  3SJH A;  3LDQ A;  4YHH K;  1NJZ A;  3HST B;  3SMP A;  2WOM A;  3THX A;  3B6O A;  4ID1 A;  3LDS A;  1TAQ A;  3U3Y A;  3FR0 A;  3PV8 A;  1T44 A;  2ZGZ A;  3RWU A;  4OKE A;  2F8S A;  2QKB A;  4E1J A;  3LWL A;  3V9U A;  4DQR A;  1KLM A;  3PO4 A;  5HOO A;  4E7H A;  4FJI A;  1HNW K;  4CW7 B;  1S5J A;  1L3U A;  3L2Q A;  5GAD P;  4ZTJ A;  1W2B M;  1HQE A;  1JLC A;  3OYJ A;  1TK0 A;  3WNF A;  4BRM A;  3PSI A;  1Q81 O;  3QLH A;  1HNX K;  4GVE A;  4O5B A;  1VRT A;  2E4L A;  1L3V A;  5B8H A;  3OS1 A;  4ILJ A;  1VQ9 N;  3J80 O;  4GMJ B;  3K9J A;  3ZCM A;  1LOT B;  2VWB A;  3O3G A;  1RT6 A;  4H0V B;  2HW3 A;  5AQF A;  1WSG A;  5SWM A;  4BRA A;  1D5A A;  2GEL A;  3FLC O;  4YOU A;  1ASW A;  3HTV A;  3EZW A;  1NJY A;  2O4G A;  3SUP A;  1ZBL A;  1TUY A;  3GBT A;  4BQZ A;  5LL6 Z;  4CZI A;  3AGK A;  2JWL A;  2XO7 A;  3CM6 A;  4BG8 A;  4O8U A;  4DV4 K;  3P38 A;  5KTQ A;  1QSS A;  5E84 A;  2HVI A;  1GOC A;  3VQE A;  5FDL A;  4JKE A;  4N47 A;  2E6M A;  3OS0 A;  1ZBU A;  4NXM K;  1NGI A;  4LH4 A;  3NGI A;  3SNN A;  2Q31 A;  3TSU A;  1DT9 A;  3CPE A;  2D0B A;  4FW1 A;  3NH1 A;  1MA9 B;  1OVY A;  4O4G A;  1S1V A;  1BIS A;  4B9N A;  4KH5 A;  4LF4 K;  2QWR A;  2Q0U A;  5KPR A;  1RT5 A;  3VF4 A;  4BC3 A;  4M3T A;  5C24 A;  4H5T A;  4OLB A;  3N4P A;  1JXE A;  3CFO A;  4EHU A;  1S1W A;  4NLC A;  3MCA B;  1G15 A;  1VK0 A;  4IJA A;  5M1F A;  1GOA A;  4AHR A;  1TK5 A;  1CZA N;  3QBW A;  1NGD A;  5D3G A;  2P9S B;  4BG9 A;  4AHS A;  4DHY A;  1J9A A;  4O0J A;  2YHX A;  4XIU A;  4ILH A;  3L2W A;  4BC4 A;  4CEE A;  4C8N A;  3TAP A;  1QVF M;  5AQU A;  4Q5V A;  1IBK K;  2FBT A;  4FSV A;  5JS2 A;  1LW2 A;  4CGG A;  3H1V X;  3AVB A;  2YV0 X;  1T03 A;  3DYA A;  3MMV A;  2QWQ A;  2KFZ A;  4A5B A;  1WSJ A;  3O9R A;  3V1R A;  2R7Y A;  3L8B A;  4M3Z A;  3AAR A;  5AQO A;  2HBM A;  2QTD A;  3D6R A;  1NBW A;  4I9Q A;  3QER A;  4KB1 A;  3SBG A;  3OYD A;  2ZM6 K;  4CJK A;  2UYT A;  4HTU A;  2UXC K;  2Z1H A;  3FGU A;  2HST A;  4JD2 A;  3O3F A;  3KK1 A;  1TGO A;  3JS6 A;  4ISE A;  4JKC A;  2HHU A;  3V4I A;  4RW7 A;  2XY7 A;  4KAZ A;  4CJS A;  4DR5 K;  4FWK A;  2O8B B;  3D2F B;  4RW6 A;  4J2A A;  2I7P A;  5GIO A;  2G8W A;  2ZE2 A;  4FYD A;  3VQ8 A;  3U3G A;  2QEX N;  3VPZ A;  4Z4F A;  4CIE A;  1XMQ K;  5EU7 A;  2HNZ A;  1NMN A;  2BGG A;  2X6N A;  2QM1 A;  4ID5 A;  4FLX A;  1HR0 K;  5IT9 O;  4A59 A;  3CER A;  3ASM A;  2YX6 A;  4E7J A;  3G25 A;  5AQH A;  3IS9 A;  1N33 K;  5BN8 A;  2NRW A;  1RIL A;  3HSC A;  5KGX A;  4B3S K;  4CF0 A;  1K8K A;  5J2N A;  4JKG A;  3OYN A;  2FSK A;  3ZT1 A;  3CFR A;  5M1O A;  4H0X B;  1VSI A;  2XY8 A;  3TPQ A;  3VGK A;  3KWI A;  2BTF A;  4MO4 A;  3ZX0 A;  2W41 A;  2F9T A;  4CHY A;  3TTF A;  1N34 K;  3NHG A;  4FJM A;  1YIJ N;  1CXQ A;  4BC5 A;  5FRN A;  3CYM A;  4WFB L;  4B8C A;  1C0F A;  3WNE A;  1KAZ A;  3DLE A;  3F9M A;  4KI4 A;  1ZBH A;  3VGM A;  2AA4 A;  1HQU A;  2ASP A;  4W5N A;  4LC9 B;  5AQR A;  3K0S A;  4N76 A;  3G71 N;  3HVR A;  1VSD A;  5CZ1 A;  4BR5 A;  3M8S A;  4DFP A;  1OH8 A;  4A57 A;  5AQV A;  1Y64 A;  1S6P A;  4WYB A;  4AHT A;  4C8O A;  1IV0 A;  4YDU C;  1CZ9 A;  1NOZ A;  1WSF A;  4O44 A;  3G4S N;  5CYM A;  5FLX O;  3E66 A;  4DG1 A;  3E1Y A;  4KKO A;  2D4W A;  4FK0 A;  2BE2 A;  3QIC A;  3OYG A;  1K9M O;  4DSF A;  1TYQ B;  4IOA L;  4NYN A;  4DTR A;  1NM1 A;  4LH5 A;  3T69 A;  5DM6 L;  5KI6 A;  1EQY A;  5JLF A;  4LD0 A;  1TKZ A;  2OCE A;  2B4J A;  3O6W A;  3TWH A;  5I3U A;  3CJA A;  1LWE A;  4JKA A;  4YOT A;  3SYZ A;  4HTL A;  5J2M A;  2ZWH A;  1JJ2 M;  5CHI A;  3BY5 A;  3TSP A;  4LF9 K;  4KRF A;  3EE9 A;  1Z6R A;  3VEV A;  4IOC L;  3CJ7 A;  1T6C A;  3C6H A;  5DM7 L;  4WCE L;  4CHP A;  5FRM A;  3HP9 A;  1JLE A;  2O8F B;  3E9O A;  1TVR A;  4LSL A;  4BE1 A;  4Z4I A;  1ZBI A;  3CC7 N;  3CFP A;  4J2E A;  4DV5 K;  1IKW A;  5KQD A;  4JV5 K;  5FPD A;  2KHO A;  4JI4 K;  1X9W A;  3IDH A;  4CI6 A;  4CEZ A;  1HUX A;  3NVM A;  1WAF A;  3AO5 A;  1CLQ A;  4OPH A;  2P9N A;  2GUP A;  1ZBS A;  3PLA A;  3FFI A;  4IZ9 A;  4JS4 A;  3THW A;  3EEQ A;  3L3U A;  1SL2 A;  4E19 A;  3RMD A;  3UKR B;  3W3D A;  3R1X A;  3ZT0 A;  3E9L A;  3DXK B;  1RDW X;  4DTS A;  4DSK A;  4U7B A;  4IEE A;  4YOY A;  3U9Z A;  2D0P A;  4IFE A;  4KTW A;  3E01 A;  1HNV A;  1QS4 A;  3V9X A;  5AZJ B;  4E89 A;  4DTU A;  3EYZ A;  4DF8 A;  3CET A;  2HVH A;  2FXU A;  1S1X A;  3NF6 A;  4FO0 A;  1GLD G;  3C7N A;  3O1B A;  4CGH A;  1GLA G;  1IG8 A;  3DMJ A;  1IKV A;  4JK7 A;  3ZT2 A;  3SV3 A;  1VSJ A;  3F9K A;  1K73 O;  3SJJ A;  2OYQ A;  1EP4 A;  2PYL A;  2YNI A;  4KHQ A;  1X1P A;  3DLB A;  3DM2 A;  1QSY A;  1SV5 A;  2FBV A;  3O1W A;  2G8H A;  2DPN A;  3RMA A;  2QK9 A;  1VSL A;  1BQM A;  2FF3 B;  3OYH A;  2ZF5 O;  3OYK A;  3P5J A;  1XI1 A;  1KD1 O;  3H1Q A;  1U49 A;  4C1N K;  3I55 N;  1WSE A;  4ISG A;  4LFA K;  1BU6 O;  3DLG A;  3HXM A;  1XC9 A;  4CEF A;  4H0P A;  4JAX A;  4N5S A;  3M8Q A;  4FW2 A;  1Q7Y O;  1JLF A;  2O8D B;  1VQO N;  3VF2 A;  4DS5 A;  2WON A;  4NXN K;  2XY6 A;  3HOS A;  4GV9 A;  2O8E A;  4I2Q A;  4PKG A;  4CJ7 A;  4M7Y A;  3VQQ A;  4Q0B A;  3WT0 A;  3VEN A;  1XNQ K;  4IFY A;  1KVA A;  5AR0 A;  4B1X B;  4ISF A;  3QET A;  4CER A;  4JRP A;  2ZGY A;  4EP5 A;  2ASO A;  3ZSX A;  2GWK A;  3BUZ B;  4CJ5 A;  4B9T A;  2ZD1 A;  4B9S A;  1NGE A;  4DTP A;  2QWM A;  4BY9 C;  1WOQ A;  1LAV A;  5CE3 A;  3HYF A;  2FSN A;  4ELV A;  2CGL A;  4WQ5 A;  1HPM A;  1LWF A;  3AO2 A;  1QQC A;  1YIT N;  3P4I A;  3VOV A;  4E0D A;  3V9Z A;  1C1A A;  3AVM A;  4BRN A;  1QHT A;  2HHV A;  4H4M A;  1EX4 A;  3M3Z A;  4FWQ A;  1B9F A;  1VQ8 N;  1VHX A;  4Z4H A;  4A5A A;  4G9Z A;  4HHT A;  3Q7B A;  3ID6 A;  4LF5 K;  2HF4 A;  1A5W A;  3WXM B;  5C42 A;  3AVG A;  4I9L A;  1KFD A;  2OPR A;  3KK2 A;  2FLO A;  5J1E A;  3DXM B;  3LPU A;  2F8T A;  4CGD A;  2YNF A;  3WXK A;  4BRH A;  4B3R K;  3ISN C;  3O80 A;  3VQA A;  5CZ2 A;  3NGZ A;  3KD5 E;  1JLA A;  3F5T A;  4CEA A;  3DLK A;  4B9Q A;  5HRN A;  5GAH P;  2VQF K;  1RTI A;  4OVL A;  4KRE A;  3H46 O;  4JNE A;  1BG3 A;  1NKC A;  5EOY A;  4B9V A;  3WXJ A;  4IKF A;  1NK7 A;  2YHW A;  4BR7 A;  4RW4 A;  2P9S A;  2ZQB A;  4M45 A;  3L2R A;  4FWS A;  1GLB G;  2BAN A;  4GY2 B;  5HBM A;  1FXX A;  3MCP A;  1RTJ A;  3PX6 A;  3CCV N;  2E6L A;  5IWA K;  4DQI A;  4BQL A;  3R3L A;  2A5X A;  1S6Q A;  1ZBF A;  1KFS A;  1YAG A;  2EHG A;  3ZSZ A;  1Y97 A;  2YKM A;  2KKZ A;  5F1X A;  2YNH A;  4MDA A;  3L4Q A;  1QQN A;  4I6M A;  4HUE A;  4W5Q A;  2D0O A;  4RW8 A;  1TK8 A;  3A5N C;  4KPY A;  4B3O A;  2LSN A;  4CJW A;  5GIN A;  1HKG A;  4PA1 A;  5AQP A;  3VEZ A;  1FJG K;  5AQY A;  3QEW A;  2AJQ A;  3MX2 A;  3G0Z A;  2NRX A;  4AM7 A;  1FKO A;  1WAJ A;  3H6E A;  3DLL L;  3HL8 A;  3CCL N;  2VQE K;  5MLC Q;  1JCF A;  1WBB A;  1NK6 A;  2Y1J A;  1EXQ A;  4J8F A;  3TI0 A;  3KVG A;  3FZF A;  5AQQ A;  4F3T A;  3CC4 N;  1HMV A;  4M42 A;  5BRD A;  1V4S A;  3VA0 A;  3HBT A;  3O9T A;  2CGJ A;  2IOC A;  2G8F A;  4OKK A;  5LMU K;  3G6E N;  1P90 A;  2A40 A;  5CY4 A;  2WUS A;  3O4Q A;  2O8C A;  3LP1 A;  1C0U A;  4X66 K;  4CFC A;  3T3F A;  1XC3 A;  3MWP A;  3S9H A;  4LSN A;  3B6P A;  1QHA A;  4CHQ A;  3HRG A;  1RDC A;  2P1J A;  3CQ8 A;  3SBT A;  2ZJQ L;  2GV9 A;  4DR6 K;  4YNQ A;  2P9L B;  3RSE A;  2OAN A;  2A42 A;  2HBK A;  1NU0 A;  3TAF A;  3TTC A;  2BDP A;  2HNY A;  4A2A A;  5JVG L;  4E7L A;  4OPK A;  3VEO A;  4F2S A;  4CZH A;  4K0K K;  1NK5 A;  1SS6 A;  5EY4 A;  3OYC A;  2DFE A;  2P51 A;  2QXL A;  4BWJ A;  4BR9 A;  3TSQ A;  4Z0U A;  3LDP A;  1U48 A;  3I8D A;  1VSK A;  4IJN A;  3AO1 A;  3THY A;  4FJ9 A;  1QQO A;  3ZX3 A;  2CGK A;  3I8B A;  4XH1 A;  1S9G A;  3R6M A;  3MN5 A;  5M1K A;  4DV3 K;  1ATS A;  1HKC A;  3QML A;  2RHK A;  1YHQ N;  2HHW A;  2KZM A;  1VQL N;  1NG9 A;  3VQD A;  5BRF A;  1RGI A;  1CZB A;  1X9J A;  3CME N;  2HHT A;  1GLC G;  5ELZ A;  4O55 A;  3MN9 A;  4CJU A;  2UUC K;  4B3T K;  2YJE A;  4KHU A;  2HOE A;  3ZSR A;  1TKD A;  3C6T A;  3O9S A;  4M7X A;  1DEJ A;  5EVZ A;  3NBP A;  4DUY K;  5AQK A; 
#chains in the Genus database with same CATH homology
 1A5V A;  5K14 A;  1BHL A;  3DLE A;  4F3O A;  4DSJ A;  1Q8I A;  2QXF A;  4KI4 A;  2X74 A;  1RDD A;  1ZBH A;  2KFN A;  1FK9 A;  1HQU A;  1VSH A;  2YKN A;  4R5P A;  2XHB A;  4B9L A;  1WNS A;  4W5N A;  4N76 A;  4BE0 A;  3K58 A;  3ZSW A;  5HRS A;  1VSD A;  5CZ1 A;  3HVR A;  5DK5 A;  1NK8 A;  3M8S A;  4DFP A;  3QIN A;  3V1O A;  1Q9X A;  3DOL A;  4QOZ B;  3DLR A;  4CJL A;  3KTQ A;  1RDB A;  1S6P A;  3DOK A;  4CHO A;  3LZI A;  3KJV A;  3LP0 A;  1DTQ A;  4AHT A;  3K5N A;  3KLI A;  3A2F A;  3NFA A;  2P5O A;  4C8O A;  1CZ9 A;  1BQN A;  1NOZ A;  1WSF A;  4O44 A;  3AA2 A;  3DRS A;  4QAG A;  5CYM A;  3QEV A;  1UA1 A;  5HLF A;  5CYQ A;  3QEI A;  1CXU A;  1KTQ A;  3NCI A;  1U47 A;  4DG1 A;  3K59 A;  1WLJ A;  4FLU A;  3TAR A;  3NH0 A;  1F21 A;  4FZY A;  4RW9 A;  3SCX A;  4FVM A;  4EZ9 A;  4KKO A;  4DSE A;  3CG7 A;  1JKH A;  4FK0 A;  2DY4 A;  2BE2 A;  2ITG A;  4CED A;  3HO1 A;  3OYG A;  4DSF A;  3AVN A;  4NYN A;  4DTR A;  1VSE A;  4LH5 A;  2VG5 A;  4N56 A;  1BI4 A;  1RBS A;  3SQ0 A;  1SKW A;  5JS1 A;  1J53 A;  1L5U A;  5KI6 A;  4FJN A;  4E1M A;  4LD0 A;  1U4B A;  3TAQ A;  1TKZ A;  2O4I A;  1HYV A;  4FLZ A;  2B4J A;  3TWH A;  4IBN A;  3H08 A;  3VA3 A;  1JL1 A;  5I3U A;  1LWE A;  3DLH A;  4FJH A;  4DSL A;  4KHW A;  4KHN A;  3RMB A;  4CE9 A;  4DTJ A;  1BI4 B;  3SYZ A;  4HUF A;  4FJ5 A;  1LWC A;  2B5J A;  5J2M A;  3MXI A;  3HK2 A;  4FLY A;  1C6V A;  1LW0 A;  5SZT A;  3TAM A;  3VQ4 A;  3MXM A;  4CJP A;  4M3R A;  1JLB A;  4OJR A;  2OZS A;  2Z1J A;  5C25 A;  2G8U A;  1RT3 A;  3HM9 A;  4NYF A;  1U04 A;  3NF8 A;  3ALY A;  2D0A A;  4KRF A;  1WN7 A;  3SQ1 A;  2DTU A;  4DQQ A;  1BGX T;  3F73 A;  1QSL A;  1W0H A;  3PY8 A;  4TSX A;  3AVJ A;  1R0A A;  1RT7 A;  3AVF A;  1NOY A;  1TL1 A;  4FJ8 A;  4N41 A;  4CHP A;  5FRM A;  4DS4 A;  3S3O A;  2DFF A;  3HP9 A;  3LPT A;  1JLE A;  3AVK A;  4OGE A;  3V1Q A;  1TV6 A;  1N5Y A;  2PZS A;  3KKR A;  1TVR A;  2NUB A;  4LSL A;  3T19 A;  4BE1 A;  3SZ2 A;  4Z4I A;  1ZBI A;  4BDP A;  3CFP A;  2PYL A;  2P5G A;  1VRU A;  2ETJ A;  3PUF A;  3SQ2 A;  3RMC A;  4J2E A;  3QNN A;  4JRQ A;  4CJQ A;  3AVH A;  4AHU A;  1RCH A;  3JSM A;  3SI6 A;  1XHX A;  1IKW A;  1BL3 A;  1JLG A;  4BE2 A;  5DMR A;  3D45 A;  4BAC A;  4DU4 A;  1X9W A;  3M8P A;  1BCM A;  5J2Q A;  1QE1 A;  4OPJ A;  1RT1 A;  4LY7 A;  4CEZ A;  1WAF A;  3AA3 A;  3AO5 A;  3VQ5 A;  4BWM A;  4CES A;  4CCH A;  1CLQ A;  1D8Y A;  3C6U A;  4CJV A;  3NF9 A;  3WNG A;  2A1R A;  4DFM A;  3K5L A;  1BIZ A;  4KHS A;  5HP1 A;  2Q3S A;  3FFI A;  4JS4 A;  3K5M A;  1WSH A;  4KO0 A;  3VQP A;  2XY5 A;  1RTD A;  3RR7 A;  1RT4 A;  2IDO A;  4CGF A;  3VQC A;  5HRP A;  4DWI A;  3L3U A;  4CHZ A;  1SL2 A;  1VSM A;  1T8E A;  4C8K A;  3LAN A;  4E19 A;  4M3Y A;  5FRO A;  3RMD A;  3C95 A;  1B92 A;  3ZT0 A;  4DMN A;  4M3W A;  2YHB A;  4CEQ A;  3PX0 A;  4DTS A;  4DSK A;  3D0P A;  2RN2 A;  1NKB A;  1REV A;  3TAG A;  2RKI A;  1JLQ A;  3OYE A;  4IDK A;  4KTW A;  4M3X A;  3DRP A;  2OPS A;  2X6S A;  3E01 A;  1HNV A;  1QS4 A;  3V9X A;  3JYT A;  1UAX A;  4DU3 A;  3QIP A;  4E89 A;  1YT3 A;  1YTU A;  4CEB A;  4DTU A;  3EYZ A;  4DF8 A;  3ZT4 A;  3ULD A;  4KHY A;  4HCC A;  1KVB A;  3OS2 A;  2HVH A;  3G10 A;  4KTZ A;  1BCO A;  4H4O A;  4FK4 A;  2W42 A;  1S1X A;  4I7F A;  4CJE A;  3UIQ A;  3NF6 A;  4IG0 A;  4CIF A;  3SUO A;  4CGH A;  3IAY A;  1IKY A;  4Y1C A;  3DMJ A;  1IKV A;  3ZT2 A;  3OJU A;  3SV3 A;  1HPZ A;  4OLA A;  3NF7 A;  3RR8 A;  1VSJ A;  4ZHR A;  4FZZ A;  3F9K A;  4H8K A;  2HB5 A;  4WE1 A;  3LZJ A;  3SJJ A;  2OYQ A;  1EP4 A;  4JLH A;  3MXJ A;  3WNH A;  1X9S A;  5KRS A;  3VQ7 A;  3LAM A;  3EZ5 A;  3TAB A;  2YNI A;  4MFB A;  2PYJ A;  4K8X A;  4FJK A;  4KHQ A;  2X78 A;  1X1P A;  3DRR A;  3C94 A;  3DM2 A;  3DLB A;  1QSY A;  1SV5 A;  2FBV A;  5KGW A;  4CF9 A;  3EY1 A;  4AHC A;  1J5O A;  3V6D A;  3QO9 A;  2G8H A;  4BDY A;  2HHS A;  3LAL A;  4CK3 A;  3RMA A;  2OA8 A;  1VSL A;  2QK9 A;  1BQM A;  1LV5 A;  3HPG A;  2KW4 A;  3KKS A;  3OYH A;  3RRG A;  1BIU A;  1RBU A;  4Y1D A;  5E41 A;  3OYI A;  2KQ2 A;  3OYK A;  1RBR A;  4B9U A;  3P5J A;  1XI1 A;  1U49 A;  1VSF A;  1WSE A;  1A5X A;  4GW6 A;  4E1N A;  2IS3 A;  1QTM A;  1S1T A;  3DLG A;  1LAW A;  4CJR A;  3HXM A;  4CEF A;  1RTH A;  3SPY A;  1XC9 A;  2QKK A;  4J2D A;  3KIO A;  3M8Q A;  4N5S A;  4FW2 A;  1HRH A;  1KSP A;  1JLF A;  1YTA A;  1GOB A;  3V81 A;  1HYZ A;  4DS5 A;  1O1W A;  5HRR A;  3VN5 A;  1KLN A;  1S1U A;  2GUI A;  2WON A;  4CFD A;  1IH7 A;  3BDP A;  2XY6 A;  4ELT A;  2PY5 A;  4CJ4 A;  5HRO A;  2VG6 A;  4I2Q A;  1ASV A;  4OKJ A;  4YFU A;  4B08 A;  3QEP A;  1NK4 A;  3QES A;  4W5O A;  1U45 A;  3HP6 A;  3VQQ A;  2G8K A;  2FBY A;  3SPZ A;  3ZSY A;  4Q0B A;  1EKE A;  3THV A;  4PQU A;  3ZT3 A;  3I0R A;  3NDK A;  3CM5 A;  3SUQ A;  1D9F A;  4IFY A;  1KVA A;  4AH9 A;  4CHN A;  3L2V A;  3QET A;  4QCL A;  4CER A;  4JRP A;  4DTO A;  1NJZ A;  4EP5 A;  3HST B;  2Y1I A;  3ZSX A;  2A1S A;  2XRI A;  1C0T A;  2WOM A;  3HPH A;  3B6O A;  4ID1 A;  3MAQ A;  4E7K A;  3ITH A;  4DTN A;  4FZX C;  4CJ5 A;  3LDS A;  3V9W A;  1IO2 A;  1TAQ A;  3U3Y A;  4B9T A;  3PV8 A;  2ZD1 A;  4B9S A;  4DTP A;  3RWU A;  4NCG A;  4OKE A;  4W5T A;  2F8S A;  2QKB A;  4CGJ A;  3KLE A;  3V9U A;  3LWL A;  4DQR A;  1LAV A;  1KLM A;  1HNI A;  3PO4 A;  4ELU A;  4E7H A;  3HYF A;  2Z1I A;  3QIO A;  4FJI A;  4FCY A;  4I2P A;  4HUG A;  2HMI A;  4DQP A;  4ELV A;  3QNO A;  1S5J A;  1LWF A;  3AO2 A;  1QQC A;  3L3V A;  3L2Q A;  1L3U A;  3OYA A;  4E0D A;  4CJ3 A;  1UOC A;  2OPQ A;  4ZTJ A;  3K2P A;  1HQE A;  3V9Z A;  1C1A A;  1JLC A;  1RNH A;  3AVM A;  3MEG A;  3OYJ A;  1TK0 A;  1QHT A;  2FC0 A;  3WNF A;  4FM1 A;  2HHV A;  4H4M A;  1I39 A;  2KTQ A;  3QLH A;  3OYM A;  4O5B A;  1VRT A;  2E4L A;  4CF2 A;  3VQB A;  2OZM A;  1EX4 A;  2HND A;  1L3V A;  2D5R A;  4OGC A;  2VWJ A;  3HJF A;  3OS1 A;  4NCA A;  1HYS A;  1RDA A;  1X9M A;  5T7B A;  2DFH A;  1B9F A;  4DTX A;  1L3S A;  1C1B A;  4DLG A;  4Z4H A;  2FBX A;  1SL0 A;  4HHT A;  4DLE A;  3I0S A;  4GMJ B;  3ZCM A;  1TAU A;  2IGI A;  2YNG A;  3NGY A;  3O3G A;  3VQ6 A;  1A5W A;  4K8Z A;  1RT6 A;  2HW3 A;  1JXB A;  1WSG A;  3AVG A;  5C42 A;  5SWM A;  4I9L A;  3OY9 A;  1KFD A;  2OPR A;  3KK2 A;  3ZSO A;  5J1E A;  1D5A A;  2HHQ A;  3IG1 A;  3LPU A;  3RRH A;  2F8T A;  1ASW A;  3MEE A;  4M41 A;  2YNF A;  4CGD A;  4KB0 A;  3ISN C;  3ZSV A;  1NJY A;  3VQA A;  5CZ2 A;  4CIG A;  2O4G A;  4W5R A;  4DF4 A;  3SUP A;  1ZBL A;  1D9D A;  1NJX A;  1KRP A;  4C8L A;  3KK3 A;  5I42 A;  4ZTF A;  3NGZ A;  2XO7 A;  3CM6 A;  3KD5 E;  1C0M A;  1JLA A;  4CEA A;  2YHA A;  5KTQ A;  2HVI A;  1QSS A;  3AA5 X;  1GOC A;  3P1G A;  1FKP A;  3DLK A;  3VQE A;  5HRN A;  5FDL A;  4FLW A;  1HJR A;  4N47 A;  2E6M A;  3OS0 A;  1RTI A;  4OVL A;  1ZBU A;  4F2R A;  1K6Y A;  4F8R A;  4KRE A;  4FM0 A;  4LH4 A;  3NGI A;  3SNN A;  3K5O A;  2IAJ A;  1C1C A;  2D0B A;  4FW1 A;  3NH1 A;  1SL1 A;  4DFJ A;  3V9S A;  1YVU A;  1NKC A;  4B9V A;  4IKF A;  1NK7 A;  4KTQ A;  3AVC A;  4O4G A;  1S1V A;  4RW4 A;  1UA0 A;  5J2P A;  1BIS A;  2ZQB A;  1WSI A;  3O3H A;  1KCF A;  2RPI A;  4M45 A;  3KLH A;  3L2R A;  3SV4 A;  3TAN A;  4B9N A;  2BAN A;  5HBM A;  3TR8 A;  1FXX A;  3AO4 A;  1RTJ A;  3PX6 A;  1RT5 A;  2E6L A;  4AIL C;  4PUO A;  4DQI A;  4M3T A;  1S6Q A;  2Z1G A;  1TL3 A;  1ZBF A;  3MED A;  5C24 A;  1KFS A;  4OLB A;  2EHG A;  3ZSZ A;  3LAK A;  1JXE A;  1Y97 A;  2I5J A;  3CFO A;  4DU1 A;  1Z25 A;  2YKM A;  1S1W A;  1SKR A;  2VG7 A;  1Z26 A;  1G15 A;  1VK0 A;  2YNH A;  4DFK A;  4DSI A;  2JGU A;  1XHZ A;  1GOA A;  1XWL A;  1EET A;  4L8R B;  4AHR A;  2F96 A;  4CK1 A;  1TK5 A;  4HUE A;  2KZZ A;  4W5Q A;  4RW8 A;  5KRT A;  1TK8 A;  1ASU A;  4KPY A;  2GBZ A;  4B3O A;  2LSN A;  5D3G A;  4ICL A;  4E3S A;  4CJW A;  1SUQ A;  4FM2 A;  4AHS A;  3AV9 A;  4PA1 A;  4FXD A;  3QEW A;  1J9A A;  4O0J A;  4KFB A;  3NH2 A;  4FJJ A;  2AJQ A;  3HVT A;  4FJX A;  1RBV A;  3G0Z A;  1W9H A;  3PO5 A;  3L2U A;  4XIU A;  3S3N A;  1FKO A;  3LP2 A;  3L2W A;  1WAJ A;  3LWM A;  3QEX A;  4HCB A;  4CEE A;  3HL8 A;  4C8N A;  3M8R A;  3TAP A;  4FJL A;  3OVN A;  4Q5V A;  4KI6 A;  2FBT A;  4KV8 A;  5JS2 A;  1ZYQ A;  1NK9 A;  4IFV A;  1NK6 A;  1I3A A;  1LW2 A;  4CGG A;  2Y1J A;  1EXQ A;  3TI0 A;  3AVB A;  4F3T A;  2YV0 X;  1HMV A;  3DYA A;  1NJW A;  1T03 A;  4NCB A;  4M42 A;  3VA0 A;  2KFZ A;  2G8V A;  2IOC A;  1J54 A;  2G8F A;  4OKK A;  4CJF A;  1S9E A;  4DTM A;  5CY4 A;  1WSJ A;  3V1R A;  2R7Y A;  3KD1 E;  3O4Q A;  1TKT A;  4AHV A;  3L8B A;  3RTV A;  3LP1 A;  4M3Z A;  4MQ3 A;  1C0U A;  4CEO A;  1DLO A;  4CFC A;  3MEC A;  3T3F A;  2B6A A;  3AO3 A;  4CFA A;  3S9H A;  1Q9Y A;  3K57 A;  4LSN A;  3QER A;  1N6Q A;  4I9Q A;  4B8A B;  3O4N A;  4JS5 A;  4PWD A;  4KB1 A;  2RF2 A;  3B6P A;  4B9M A;  1ITG A;  1KVC A;  2JLE A;  3KLG A;  4O0I A;  4CHQ A;  3OYD A;  4CJK A;  4FJ7 A;  4C8M A;  4HTU A;  1RDC A;  2Z1H A;  2P1J A;  3O3F A;  4CEC A;  1TGO A;  3AA4 A;  3KK1 A;  3CQ8 A;  2OPP A;  2HHU A;  2GV9 A;  4J2B A;  4YNQ A;  3V4I A;  4RW7 A;  2XY7 A;  4CGI A;  4CJS A;  3TAF A;  4KAZ A;  2BDP A;  2HNY A;  4E7L A;  4J2A A;  2ATQ A;  1TKX A;  4RW6 A;  4OPK A;  1SKS A;  2G8W A;  4F2S A;  4FJG A;  2ZE2 A;  3ZSQ A;  3HPO A;  3OYC A;  1NK5 A;  3OYB A;  4FYD A;  1MU2 A;  2DFE A;  1UWB A;  2P51 A;  4G1Q A;  4BWJ A;  3U3G A;  3VQ8 A;  3SUN A;  2G8I A;  1DTT A;  4Z0U A;  1U48 A;  3I8D A;  1T7P A;  3TAE A;  4FK2 A;  2IC3 A;  1VSK A;  4PY5 A;  3AO1 A;  4Z4F A;  4DQS A;  4FJ9 A;  4CIE A;  4HVJ A;  3PX4 A;  5EU7 A;  2HNZ A;  4F4K A;  4Z4G A;  3OJS A;  4EZ6 A;  2BGG A;  2X6N A;  1IG9 A;  3IRX A;  1B9D A;  4GVM A;  1NKE A;  4ID5 A;  3SQ4 A;  4FLX A;  1L3T A;  3DI6 A;  3BGR A;  4RG8 A;  4CFB A;  4FLV A;  4Z4C A;  3AVL A;  1S9G A;  2EX3 A;  4CJT A;  3ASM A;  3NAE A;  3VQ9 A;  4UQG A;  1NK0 A;  4E7I A;  4E7J A;  4IG3 A;  2HHW A;  4Z4E A;  2KZM A;  4CF8 A;  3KLF A;  1T05 A;  3IS9 A;  4BDZ A;  1RBT A;  1RIL A;  5KGX A;  2HHX A;  4CF0 A;  3AVI A;  3VQD A;  4CK2 A;  5J2N A;  4M3U A;  3AVA A;  3OYN A;  3ZT1 A;  3OYF A;  3CFR A;  1CZB A;  1VSI A;  2XY8 A;  4FLT A;  2D0C A;  1JL2 A;  3LP3 A;  1IKX A;  2HHT A;  4CHY A;  3P83 D;  4O55 A;  3NHG A;  4FJM A;  4CJU A;  4KHU A;  4CF1 A;  1CXQ A;  3T1A A;  3NE6 A;  5FRN A;  1RT2 A;  3ZSR A;  2VWK A;  3CYM A;  3C6T A;  1TKD A;  3NBP A;  4EP4 A;  4B8C A;  3S3M A;  3OYL A;  3WNE A;  3U6F A;  3HT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...