3O3HA

T. maritima rnase h2 d107n in complex with nucleic acid substrate and manganese ions
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVNGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna-rna hybrid
molecule keywords Ribonuclease HII
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 80
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3hA00
2Z1IA 2B5JA 1LW2A 3OS0A 3ZSRA 1U45A 4CJVA 3OYNA 3NF9A 2G8UA 4F8RA 3AVAA 4CIGA 4B8CA 3S9HA 5HP1A 1VSLA 2P51A 3TAEA 4BACA 3U3YA 4F2SA 3MEDA 4O44A 1ASVA 4FJNA 3RR7A 3NH1A 2VWJA 1HQEA 4HUFA 4FK4A 3C94A 5CZ1A 3HPOA 1D9FA 4J2BA 4Z4IA 5KGWA 4FJKA 3RMAA 1BIUA 4FCYA 3ZT4A 3EZ5A 3O3GA 3SUOA 4B9LA 2RKIA 4FW2A 4AHTA 3AVLA 4OGEA 4YFUA 4N5SA 1QSYA 1CLQA 3HPHA 4GMJB 4DFKA 4OGCA 4CCHA 3NGZA 3KLHA 4KTQA 1EX4A 4M3UA 3QIPA 3DRRA 3DLEA 3OYKA 1S6PA 4CF2A 1S1WA 1U4BA 1SL2A 1BISA 5DMRA 1TL1A 1S9EA 3OY9A 3S3OA 1NK9A 4HCBA 2IC3A 4CJSA 3TWHA 4F2RA 4NYFA 4GVMA 1ZBUA 4AHCA 4E89A 3O3FA 1SKRA 1U48A 3SPYA 1KVBA 4AILC 4PQUA 2XY8A 3PV8A 4FLVA 4FJLA 3L3VA 4CHPA 1KVCA 3M8QA 3OS2A 5I3UA 2ATQA 3V9UA 4DG1A 3G0ZA 2OZSA 4RW8A 2HHWA 1IKVA 1L3UA 4E7KA 1T7PA 2VG5A 3V6DA 3TAGA 3K2PA 4CEAA 4CGHA 3C6UA 3OYCA 3TARA 1LW0A 3RWUA 1RT4A 1RT6A 1C0MA 1HQUA 4AHRA 1NK4A 4TSXA 2G8IA 3HT3A 3KK1A 1JLGA 3SI6A 1LAWA 4OLBA 3PO4A 3AVBA 4FZYA 1GOCA 5C24A 1RILA 1T03A 3RMDA 3O4QA 1XC9A 3SQ4A 4I2QA 2FBTA 3DOKA 1NK0A 2ZE2A 3ASMA 4CFCA 3SNNA 1SUQA 4M45A 3PX6A 4KHWA 1VSEA 2FBYA 3SZ2A 3DLBA 1EXQA 3VQ6A 2QXFA 3NDKA 1I3AA 2GBZA 1IKWA 1RDAA 1WAJA 3VQPA 4CJWA 3HYFA 4EP4A 3DYAA 4ID5A 1UOCA 3BDPA 4I9LA 3QLHA 4LSNA 1XHXA 4EZ6A 3HK2A 1SL0A 1JLAA 4B9NA 2QK9A 1TAUA 2OPPA 3HO1A 3TI0A 1RDBA 4DSKA 4CHQA 1QSLA 4FJJA 3OYMA 3QNNA 4B3OA 3T1AA 4Q0BA 3C6TA 3VQ5A 2P5GA 5FROA 1JLFA 3AO1A 4DTOA 3ULDA 2YNGA 4O4GA 4CECA 4CJFA 2GUIA 3SUNA 2PYLA 5FRMA 4ZTFA 1RDDA 4CJRA 5J1EA 1SL1A 2DFEA 1C0TA 1FKOA 1TGOA 1VSDA 4DLEA 1IO2A 1RNHA 4BWJA 3SV3A 4CGGA 3OJUA 1ZBIA 3KTQA 4J2EA 2XRIA 1MU2A 3M8SA 4CFBA 3V81A 4DF8A 4CHNA 4FM0A 4E1MA 3KKSA 1JXEA 3QIOA 3ZSOA 1L3TA 2A1RA 4FLYA 4FZZA 2DTUA 4CEEA 3CQ8A 4Z0UA 2OA8A 1TKTA 3A2FA 1TAQA 2DFHA 4KTZA 3ISNC 2RPIA 4MQ3A 4N47A 4PUOA 4QCLA 3CYMA 3DRSA 4CK1A 2BE2A 4DLGA 4FJIA 4FLXA 1S1VA 3H08A 3LWLA 1RT1A 1Y97A 4XIUA 1C1CA 3ZT1A 1LWFA 2RN2A 2O4IA 5I42A 4OPJA 3DMJA 3G10A 1ZBLA 4L8RB 4FJ7A 3HXMA 3AV9A 3LPUA 3SQ2A 3OYEA 1ZYQA 3OS1A 4FVMA 4M3RA 3V9WA 3IAYA 4ELTA 4Z4GA 1UA1A 4B9TA 5D3GA 3NE6A 1ITGA 4Y1CA 4CJEA 1Q9XA 1RT2A 2HMIA 3U3GA 3C95A 3LDSA 4ID1A 5FDLA 1RBUA 1KFSA 1BQMA 1VSHA 3E01A 2JLEA 1G15A 3JSMA 5JS2A 3OYHA 4KI4A 2KFNA 3KLGA 1EP4A 1XWLA 4E19A 2YHAA 3NF6A 3JYTA 3QETA 4CHYA 2D0AA 1HJRA 3QEXA 3V1QA 2G8HA 4CF9A 3ITHA 1Z26A 3OYIA 3KJVA 3L2RA 1Q9YA 4KB0A 3CM5A 4CJ3A 3OYAA 1RBRA 3CM6A 3THVA 3IS9A 4CHZA 4CEDA 3K57A 3LZIA 2HHVA 1RTHA 1KFDA 4O0JA 4RW9A 3WNFA 4OKJA 2PYJA 3CFRA 1NKBA 1L3SA 2RF2A 4CHOA 1XHZA 2P5OA 1B9FA 2X78A 2IGIA 1QTMA 3AO5A 3AA4A 4Z4EA 1SKSA 3QESA 1WNSA 3OVNA 3VQ4A 3LPTA 2W42A 1JL1A 1RTJA 3PX4A 4DTXA 3F73A 1RBTA 3ZT3A 4CJ4A 4AHSA 1NK7A 5E41A 4JRPA 1C1BA 2Y1IA 3EYZA 3OYFA 3AA3A 4E7IA 4KI6A 3SJJA 3OYGA 4KHNA 4DFPA 3LALA 3NH2A 2QKBA 4KREA 3LZJA 2KZZA 1L5UA 4LY7A 2XY5A 3QEWA 1YTAA 4FK0A 5C25A 3RRGA 3WNEA 1NK5A 4NCAA 1JKHA 3CFOA 1FKPA 2KW4A 1VRUA 1JXBA 3QEPA 4KO0A 3B6OA 4IKFA 5SWMA 4KHUA 2BANA 3BGRA 1NJZA 1VK0A 4FLUA 1LV5A 4DQPA 1O1WA 4FYDA 1A5VA 1JLQA 2GV9A 4OJRA 1C0UA 3VQ7A 4CESA 2YNHA 4DFJA 1NKCA 4UQGA 5J2NA 1J9AA 3ZSZA 3K5LA 3K5MA 2HHTA 1WSGA 2KZMA 4Y1DA 4DF4A 3S3NA 2F8SA 3RTVA 4FW1A 1NOZA 3NFAA 4DS4A 2YNIA 1KLMA 2IAJA 3LWMA 5J2MA 3RMCA 1BHLA 4DU4A 3WNHA 4DTRA 2HW3A 4CJLA 2WOMA 1QQCA 5J2QA 1S1UA 4M3ZA 2VG7A 3HVRA 2HHXA 3RR8A 5EU7A 4DTNA 1DTQA 2FC0A 4CF8A 4BE1A 1A5WA 3V9XA 4J2DA 3I0RA 2EX3A 1X9WA 3VQAA 3HL8A 4HHTA 3DRPA 4IFYA 1RT3A 3CFPA 3I0SA 4BE2A 3KD1E 3S3MA 1J53A 3MXJA 5HBMA 1UWBA 1B9DA 3ALYA 1U47A 3DLGA 4W5OA 1NK8A 4FJ5A 1BCMA 4H4MA 1VRTA 3L8BA 1NJYA 1VSMA 1D9DA 5KRSA 1UA0A 4CJTA 3QERA 2HNZA 3AVCA 5CY4A 4N56A 2VWKA 3IRXA 4Z4HA 4DTMA 4DFMA 3AVJA 3V4IA 4IFVA 4FJMA 4OVLA 5KI6A 5C42A 3LAKA 4ZHRA 4ELVA 4K8ZA 2FBVA 3RRHA 3PO5A 3L2QA 1LAVA 4N41A 1REVA 4CJUA 3AA2A 4JS5A 2DY4A 1RTIA 1S9GA 1JLCA 1U04A 1W9HA 3TAMA 4CERA 4CEBA 4CGFA 2YKMA 4LD0A 4E3SA 3AVKA 3MEGA 1ZBFA 1RCHA 1JLBA 4KV8A 4AHUA 3O3HA 3NBPA 1TK8A 3D45A 1WSEA 4M41A 4DSIA 2PY5A 2D5RA 3NF8A 4M3YA 4C8KA 2HHUA 4CF0A 3AVGA 4DTPA 4DWIA 2I5JA 4CJQA 3DLKA 3TR8A 2E6MA 3PX0A 3O4NA 3AVFA 4OKKA 4CEQA 5HRPA 3HM9A 4W5TA 2PZSA 4BDZA 3OYJA 3HJFA 4M3TA 2BDPA 4KKOA 1QS4A 1YTUA 2BGGA 3M8RA 1TKZA 3AA5X 3LP2A 5HLFA 4DSEA 3UIQA 3VQQA 5KRTA 3NF7A 1S5JA 1S1XA 4B9SA 3P83D 1DTTA 4CEOA 1X9MA 4LSLA 3KD5E 3T3FA 4C8NA 1X1PA 3QEIA 2A1SA 5KTQA 1GOBA 2YV0X 4CK3A 1QHTA 1CZBA 3DOLA 2VG6A 5T7BA 5CYMA 4DTUA 2KQ2A 3AVIA 3V9SA 2Z1JA 1EETA 4B08A 4B9UA 3B6PA 4HUEA 2HHSA 4KHSA 3K5OA 1YVUA 2E4LA 1IKXA 3LP1A 2B6AA 1NOYA 4MFBA 4FLTA 1GOAA 3KIOA 3ZSVA 4DU3A 1ASWA 2G8VA 4WE1A 1CZ9A 2G8WA 3SQ1A 4CJ5A 4HCCA 4BWMA 4O0IA 1T05A 3SPZA 1F21A 3P1GA 1L3VA 4AHVA 4DQIA 1WSIA 4E1NA 1VSKA 3L2WA 1D5AA 3L2VA 3M8PA 4CE9A 3D0PA 2EHGA 4DTJA 4OKEA 4QAGA 1SKWA 1BGXT 4G1QA 2FBXA 4K8XA 2O4GA 5FRNA 1RBVA 4IG3A 3VQDA 4CJKA 4FM1A 4O5BA 3VQEA 2XO7A 4B8AB 2P1JA 4E7JA 3MAQA 3KKRA 3QINA 4ICLA 3VN5A 5JS1A 1WAFA 3VQBA 4CFDA 4I2PA 3PUFA 2ETJA 4O55A 4FJHA 1JLEA 4H8KA 4M3XA 2HVHA 3HP9A 3NGIA 4EZ9A 5HRNA 3MXIA 4NCGA 1J5OA 4FZXC 4KHQA 4DTSA 3HVTA 3MEEA 4CK2A 3KK2A 1KSPA 4C8LA 3LP3A 4ELUA 4F3TA 1QE1A 2IDOA 4HVJA 4LH4A 1LWCA 3LANA 1HYVA 2Q3SA 3ZSQA 4KB1A 1WN7A 1NJXA 2Z1GA 5CZ2A 3HSTB 3T19A 4FJ9A 3NGYA 4CGIA 2HVIA 3PY8A 3AVNA 1XI1A 2B4JA 3OJSA 5SZTA 1HMVA 1C1AA 1NK6A 2KTQA 3DLRA 3FFIA 1BI4A 3CG7A 4DSFA 1HYSA 4DSLA 3AO2A 1U49A 4LH5A 1KVAA 3V1OA 3SUPA 2AJQA 2R7YA 4BE0A 3ZT2A 1KLNA 4KRFA 2JGUA 3AVMA 4FJGA 2D0BA 4JLHA 3AO3A 4DQRA 1IH7A 1CXQA 3NAEA 4OLAA 2HNDA 3SYZA 4FXDA 2IS3A 3P5JA 1A5XA 2OPSA 2Y1JA 1RT5A 4BDYA 1BCOA 3TAQA 1TKDA 1ASUA 1D8YA 1HNVA 4CIEA 3LP0A 1RTDA 1HPZA 1KTQA 3SV4A 2OYQA 3HP6A 1TL3A 1JL2A 1BQNA 3TANA 5CYQA 3TAFA 4Q5VA 4Z4FA 4GW6A 4OPKA 1QSSA 2DFFA 4JS4A 3I8DA 3L2UA 4FLWA 4B9MA 3OYLA 4DS5A 4CJPA 3F9KA 1TVRA 4YNQA 3ZSWA 1HNIA 4C8OA 4PWDA 3SQ0A 1ZBHA 4M3WA 2G8FA 4ZTJA 4KPYA 4W5NA 4RW4A 4QOZB 3L3UA 2QKKA 2WONA 1S6QA 1VSJA 2ZQBA 1HRHA 3VQ9A 4IBNA 4DMNA 3TABA 3QO9A 3KLFA 1T8EA 4J2AA 4I7FA 4FJ8A 1HYZA 4IG0A 3ZCMA 3KLEA 3VA3A 4IDKA 1KCFA 2NUBA 4PA1A 4E7HA 4B9VA 2X6NA 1VSFA 2OZMA 4NCBA 2XY7A 4AH9A 1W0HA 3VA0A 4RG8A 4H4OA 2LSNA 3ZSXA 2XY6A 2HHQA 3V9ZA 3AO4A 1NKEA 5KGXA 1YT3A 4HTUA 1SV5A 1N5YA 5HRSA 2OPRA 3V1RA 1UAXA 2X74A 3NCIA 1LWEA 3ZT0A 3K5NA 3MXMA 4N76A 2OPQA 1RT7A 3DI6A 1J54A 4CGJA 1TK5A 3ZSYA 1TKXA 2IOCA 4FLZA 4DSJA 4KTWA 4NYNA 4R5PA 1C6VA 1WLJA 2YNFA 3MECA 3HPGA 1WSHA 3IG1A 4FK2A 2KFZA 1Q8IA 2F96A 3AVHA 3OYBA 4W5QA 3OYDA 3SCXA 3QEVA 3LAMA 4DU1A 1TK0A 1FK9A 2X6SA 3SUQA 4F3OA 2YHBA 4KFBA 5HROA 2XHBA 3VQCA 1FXXA 2G8KA 4RW7A 4EP5A 4DQQA 2ITGA 1Z25A 4E0DA 2D0CA 1WSJA 3EY1A 1KRPA 3KLIA 3WNGA 1X9SA 4FJXA 2Z1HA 5K14A 3U6FA 3RMBA 1NJWA 4BDPA 1BL3A 4W5RA 5HRRA 4M42A 4PY5A 1B92A 2F8TA 3KK3A 4F4KA 4KAZA 1CXUA 1DLOA 3NH0A 4FM2A 4DQSA 2HNYA 1N6QA 4CEFA 4KHYA 4E7LA 3DM2A 2E6LA 1EKEA 1WSFA 4C8MA 3TAPA 1BI4B 1BIZA 4CF1A 2HB5A 3K58A 1K6YA 3K59A 3DLHA 4CEZA 2ZD1A 1TV6A 4RW6A 1RDCA 3QNOA 4JRQA 4CGDA 1S1TA 4CFAA 1I39A 1R0AA 1RBSA 1VSIA 5J2PA 3VQ8A 1IG9A 4CIFA 5DK5A 4I9QA 1IKYA 4HUGA 2YKNA 4Z4CA 3NHGA
chains in the Genus database with same CATH superfamily
1EQYA 2Z1IA 4A2AA 4CJVA 3W0LA 1I94K 5BR8K 1YXQA 5HP1A 1M1KO 2P51A 1T6DA 5AQSA 4BACA 3U3YA 3MEDA 1HQEA 3HI0A 5CZ1A 2IVNA 3VF2A 3TSUA 2O8CA 4OGEA 1QSYA 1CLQA 4KBOA 2NLXA 2Q2RA 4O5FA 4KTQA 3CCUN 1N36K 5BR9A 3VF6A 3S3OA 1NK9A 4B1ZA 4E89A 1YVNA 4AILC 5AQYA 1BG3A 5AQJA 1KVCA 3OS2A 4I6MB 5I3UA 3V9UA 1DT9A 2GEMA 4RW8A 4YOWA 1MWMA 3HRGA 3CXCM 3V6DA 4CEAA 4CGHA 3C6UA 3R1XA 1RT4A 1HQUA 2NRHA 3CERA 1JLGA 1XC9A 3ASMA 4YOXA 3SNNA 2P9KB 2ZGZA 2FBYA 3DWLA 2GBZA 4YDUC 1WAJA 4CJWA 1IBKK 3EL2A 5I9EB 4H0PA 2RE2A 5KPRA 1RDBA 1NGHA 4JD2A 5JVHL 3QNNA 3VQ5A 3MCAB 3ULDA 1KQSM 1DEJA 4CJFA 3CF5L 2PYLA 5GIPA 1SL1A 2Q1NA 3ENOA 1C0TA 1FKOA 3KVGA 4DLEA 2NZTA 1RNHA 3ID8A 3SV3A 3UKRA 1ZBIA 4XH5A 3KTQA 4B3TK 3FZFA 3QIOA 2DTUA 5DM6L 1E4GT 4NXNK 1TAQA 3ISNC 2RPIA 4PUOA 4GVEA 3L4QA 4CK1A 2BE2A 4DLGA 4DV4K 3A0IX 1Y97A 3ZT1A 3JXUA 4OPJA 2GX9A 2W6LA 4FJ7A 3CHWA 3OYEA 4BRLA 2FSJA 3D7EO 3V9WA 5TKWA 2CGKA 4ELTA 4B9TA 2P9SB 1IBMK 5D3GA 5ADXA 3SJHA 3VEWA 3C95A 2P9PB 5FDLA 3U4LA 1RBUA 4C1NI 1KFSA 3T69A 4MO5A 1VSHA 4MLHA 1E3MA 5CR4A 1OKJA 5F2RA 2OCEA 3O9TA 3QETA 2YHAA 1S22A 1MWKA 2D0AA 3O08A 4GV9A 4ISFA 4CF9A 3MWPA 4B3SK 5AZIA 3O8MA 3LZIA 2ZF5O 3WNFA 4OKJA 3CFRA 1QZ5A 4CHOA 2CGLA 3WXMB 2IGIA 3VTHA 3AO5A 3PIPL 3OVNA 3C6AA 4XH4A 1S3XA 5JLFA 3F73A 3SAHA 3ZT3A 4CJ4A 1NK7A 5ADXH 5E41A 1BOTO 4JRPA 1C1BA 1XUPO 3LM2A 1YJ9N 3OYFA 1XQSC 5LJWA 4E7IA 4BRCA 4KHNA 4KREA 2E88A 3LZJA 1L5UA 4LY7A 4FWRA 2XY5A 2Q31A 3WEEA 3QEWA 1YTAA 5C25A 3RRGA 1NK5A 4NCAA 3CFOA 1QZ6A 3BF1A 1HNZK 3P4IA 3B6OA 2P9NA 2OANA 1VK0A 1NJZA 1LV5A 4JK9A 4DQPA 4FYDA 1JLQA 3SAFA 4CESA 1WUAA 3H6EA 3K5MA 3R9PA 1WB9A 1RDWX 2BH1A 4FW1A 1Q7YO 3NFAA 1VQMN 1T44A 1Q81O 3RMCA 1J5EK 4JKGA 3WNHA 1FJGK 5AQLA 1ESVA 4M3ZA 1OH6A 2VG7A 3CC7N 4DR2K 3IFRA 3RR8A 5EU7A 4JI5K 2YHXA 4J2DA 2EX3A 5AFUA 3DRPA 4IFYA 1RT3A 4BE2A 4FOEA 4QS9A 4O8UA 5HBMA 1CZAN 4ILJA 3KZBA 1GLJO 1U47A 1XNQK 4JI1K 4LF9K 3RSEA 4X64K 4LFBK 1U2VB 2HNZA 3AVCA 2VWKA 1BA0A 4FPAA 4IFVA 5C42A 4PL8A 3LAKA 3ZX0A 2FBVA 4IO9L 4K8ZA 4FO0A 3L2QA 4N41A 4CJUA 3P38A 4JS5A 3FZHA 2DY4A 1W9HA 3TAMA 3SAGA 1JLBA 4WFNL 2O8DA 4DSIA 2O8FA 5AFUH 2PY5A 2D5RA 4M3YA 2HHUA 2V52B 2YI1A 3AVGA 4CJQA 3PX0A 4W5TA 5KQ8A 2A40A 4JKBA 1QS4A 4KKOA 1YTUA 3LP2A 4DR1K 3VQQA 2A3ZA 1S5JA 3NF7A 5EVZA 4CEOA 4U7BA 3T3FA 1EWRA 4CK3A 4PHTX 3V9SA 3G25A 2I7NA 2D0OA 4KHSA 5EOYA 1K8KB 1IKXA 4KH4A 3D2FA 5CHIA 1ASWA 4AM7A 1CZ9A 4BRGA 4BWMA 3RVCA 1T05A 2YX6A 3R8EA 1ILYA 4JKCA 4CW7B 3D0PA 1RBVA 4RTFD 2WC9A 3M6GA 3VN5A 1WAFA 4CFDA 3LDLA 3BP8A 3OBYA 3J7ZO 3NGIA 5HRNA 4DTSA 4CK2A 3TTFA 2P9IB 4F3TA 2IDOA 4BRAA 3H3OB 3LANA 1HYVA 4FJ9A 4FWNA 3CI5A 2B4JA 3D2EB 4YOYA 4CZMA 5SZTA 3OJSA 4DSLA 2FXUA 5AQMA 4LH5A 1KVAA 2R7YA 4BE0A 2JGUA 4JKDA 2D0BA 3AO3A 1CXQA 3NAEA 4BY9C 1NWKA 4A61A 2QWNA 2YCHA 5BPNA 4K42A 1HNVA 4YHHK 3SV4A 2O8BB 3GE1A 1JL2A 2VQFK 5GAHP 1QSSA 2E20A 1VQLN 3ID6A 3MX2A 4FLWA 4B9MA 1OVYA 5DM7L 2VGMA 1TVRA 4YNQA 3ZSWA 4C8OA 4PWDA 3D6RA 2UXBK 5E26A 4ZTJA 4KPYA 1T6CA 2VGNA 4RW4A 5BRHA 3E66A 2WONA 1S6QA 2DPNA 4IBNA 3TABA 4J2AA 1HYZA 4IDKA 4NCBA 2X6NA 1VSFA 2ASMA 1V4SA 1W0HA 3VA0A 2IVPA 4FWPA 1WBDA 2E2NA 2LSNA 3ZSXA 1YT3A 4HTUA 4WFAL 3AY9A 3BEXA 1HKBA 1TKXA 3EZWA 4KTWA 4NYNA 5AQPA 3L6QA 4FK2A 2E2QA 2X6SA 3SUQA 5KPTA 1FXXA 4HWIA 2ITGA 2KLAA 1GLBG 3M3ZA 3KWIA 3ULEB 2Q97A 1QQMA 5K14A 1X9SA 4ISEA 3RMBA 2HBKA 5HRRA 4PY5A 1GLLO 1B92A 4F4KA 4KAZA 1DLOA 2O8CB 4YOUA 4E7LA 4YOTA 1WSFA 4C8MA 2A42A 4LF8K 3WUHA 1K6YA 4DB3A 1TV6A 1G99A 1RDCA 4M7XA 2WUSA 4CGDA 1I39A 4GV3A 1VSIA 2HOEA 3VQ8A 4CIFA 5M1KA 2YKNA 3OS0A 3WQTA 3OYNA 1R59O 3NF9A 4F8RA 3AVAA 4CIGA 4B8CA 3TSPA 1ASVA 4FJNA 3RR7A 3NH1A 2VWJA 4HUFA 4FK4A 3C94A 3HPOA 5M1PA 2VWBA 4AF1A 1D9FA 4AQYK 1BIUA 3EZ5A 3SUOA 4N5SA 3O5BA 3I56N 4CCHA 3G4SN 1NGBA 3QIPA 3DLEA 4CF2A 1S1WA 4BREA 1S9EA 4EHTA 2QWOA 2J4RA 4IOAL 4QS8A 4E1JA 3TWHA 4JI0K 4H5VA 4NYFA 5FPDA 3DLLL 4GVMA 1ZBUA 4AHCA 3O3FA 3SPYA 4DV2K 4PQUA 5MLCQ 3PV8A 2HSTA 4FLVA 2D0PA 4DG1A 1HKGA 3G0ZA 1L3UA 3CCVN 1ATRA 3WXLA 2NNWA 3EKUA 3OYCA 3TARA 3RWUA 3UKRB 1RT6A 4AHRA 4TSXA 2PAVA 3THYA 4MO4A 4OLBA 4JKHA 3AVBA 1NK0A 2FBTA 3DOKA 2ZE2A 3SZ2A 3DLBA 4FWKA 1RDAA 3VQPA 3C6HA 1X9JA 2GUPA 4I9LA 3HM8A 1XHXA 3HK2A 1SL0A 1JLAA 2QK9A 1TAUA 2OPPA 2UUAK 5FROA 3FFKB 2V51B 2YNGA 3A5NC 1HLUA 2GUIA 4MDAA 1RDDA 5J1EA 2DFEA 1TGOA 2OTJN 3AGKA 4ILHA 4CZHA 4FWOA 4BGBA 3OJUA 3HOSA 2XRIA 2P9LA 1MU2A 4JHDA 3M8SA 4DF8A 4FM0A 1JXEA 5AZJB 3CQ8A 3F5TA 4Z0UA 1TKTA 2DFHA 4QCLA 3CCEN 2O8EA 3VGMA 3CYMA 4CZJA 4FJIA 2Q0UA 3LM9A 3WXIA 3TTDA 3LWLA 4LFAK 1RT1A 2A6AA 4BR0A 5A2QO 4XIUA 4DV7K 4BRMA 1ZBLA 4L8RB 3LPUA 4M3RA 2GTDA 3IAYA 4Z4GA 3GDQA 3WEEB 3NE6A 4Y1CA 1Q9XA 1RT2A 2AP1A 1NMDA 1JCGA 1BQMA 4A2BA 4CZLA 4BRFA 2KFNA 4IEEA 1EP4A 3JYTA 3P39A 3NF6A 4Z4FA 3ZETB 4CJ7A 4LF4K 4B1VA 1BU6O 3GL1A 4K0KK 3ITHA 1Z26A 4KB0A 3CM5A 4CJ3A 1WBBA 2HHVA 1RTHA 1RDUA 4IWVA 5TKYA 2P5OA 2X78A 1QTMA 3EE9A 3AA4A 4Z4EA 3QESA 1WNSA 1IV0A 3WXJA 4DTXA 4IDHA 2CH6A 1EWQA 3EYZA 4KI6A 1KXPA 3L0QA 1YUWA 3RSEB 1MDUB 3WNEA 1ZC6A 4GNIA 1FKPA 1XC3A 4IKFA 3E9LA 1IBLK 1GLCG 4A5AA 4H0TB 4KH6A 1A5VA 4OJRA 2ITMA 2ZWHA 2YNHA 3EEQA 3K5LA 2HHTA 2KZMA 1S72N 4Y1DA 4DF4A 4H5RA 3DXMA 4DS4A 5ELZA 3PSFA 2IAJA 2NRRA 5AJ3K 3LWMA 1BHLA 1KAXA 4FL9A 3CCQN 4DTRA 2VYPA 4CJLA 5BN8A 3CCLN 2O8DB 5J2QA 2P9UA 3GBTA 2HHXA 1OH8A 3H1VX 5JMVA 3SK3A 4BE1A 5JICA 2GWKA 1YI2N 4DCHA 3I0RA 3VQAA 3IKMA 3I0SA 3ALYA 3DLGA 1RGIA 4G9ZA 3CIPA 3L8BA 1NGAA 3UKUA 3QERA 3AGRA 4Z4HA 4DTMA 4DFMA 3AVJA 3V4IA 5KI6A 1NG9A 1LAVA 3H1QA 1RTIA 4CERA 4CEBA 3QICA 4B3MK 1ZBFA 5BREA 4KV8A 4U67L 1NGJA 3O3HA 3NBPA 3MX5A 4YORA 3E9PA 2NRTA 3AVFA 4CEQA 3HM9A 4M63C 2PZSA 3ZEUB 2GWJA 3OYJA 4M3TA 3VEVA 3M8RA 5HLFA 4DSEA 5CE3A 1FW6A 5KRTA 1S1XA 4R79A 3FE1A 3DXKB 3J80O 3KD5E 3ZYYX 4C8NA 3CJCA 2A1SA 5KTQA 5EX5A 3DOLA 5T7BA 4DTUA 5CYMA 3J7AP 4B1WB 1EETA 1VQ9N 4HUEA 4YOVA 1NJIO 2HHSA 4CZGA 4EHUA 4O8KA 3CCSN 3MN5A 5KPZA 1NOYA 4FLTA 3ENBA 4DU3A 1SS6A 4O0IA 2D1KA 4Y0WA 3OTOK 3HZ6A 2QI2A 1WSIA 2NRVA 1VSKA 1D5AA 1TYQA 4OX9K 2EHGA 4QAGA 1SKWA 1BGXT 4G1QA 4FWMA 4IZ9A 3VENA 3VQDA 4FM1A 4E7JA 2E1YA 4CD1A 2E8AA 5GAEP 3KKRA 3QINA 4ICLA 4PKHA 3TSQA 3LDNA 2HVHA 1TUYA 3HP9A 4KHQA 4OO1J 3O9SA 3HVTA 1KSPA 3LP3A 2UU9K 1QE1A 4MDBA 4LH4A 4CVNE 1LWCA 1BA1A 3ZSQA 2Q3SA 4B1YB 3VPZA 2AA4A 5CZ2A 3HSTB 3A5MC 4DUZK 1XI1A 3NVKA 4JI8K 1C1AA 1HMVA 4JYAK 2KTQA 3FFIA 1BI4A 4JI4K 4DSFA 3AO2A 1U49A 2AJQA 2IVOA 3OA9A 5C2FA 2ZJPL 1KLNA 3ZT2A 3MWTA 3AVMA 3SLCA 3AAPA 1IH7A 1VQ7N 4CZIA 3SYZA 4FWLA 4BDYA 1BCOA 3O1BA 1D8YA 1ASUA 4OPHA 4CIEA 2FSNA 5AQQA 1DGKN 1HPZA 1Z6RA 1D4XA 3VERA 1NGCA 3TANA 3R3LA 3BY5A 4JK7A 2A5XA 4JS4A 3L2UA 2NRZA 4DKWA 3OYLA 3I8BA 4CJPA 2QWLA 3OBWA 3C7NB 1HNIA 3SQ0A 3CJ1A 4M3WA 3L3UA 3I33A 3J7YP 4WCEL 1HRHA 4DMNA 4I7FA 4FJ8A 2NUBA 1P8ZA 3CPWM 1KAZA 2F4VK 1P90A 4RG8A 1YJNN 4H4OA 2XY6A 1NKEA 5AQXA 2Q0RA 1SV5A 1N5YA 4DV1K 2OPRA 4I6MA 3PIOL 2X74A 4FWQA 2OPQA 1NU0A 3K9KA 5IWAK 1HR0K 4FLZA 4BVOA 4DSJA 4R5PA 1NNEA 3HPGA 2F96A 3AVHA 3OYDA 3LAMA 1TK0A 1FK9A 2RHKA 5AQUA 4F3OA 3MN9A 5HROA 2XHBA 5AR0A 1GLFO 2QTDA 4RW7A 4DQQA 3FLCO 3EY1A 1KRPA 2P9KA 3WNGA 4H0YB 2Z1HA 4BDPA 1C0FA 4W5RA 2HHHK 1OVQA 3HOTA 1U6ZA 5JVGL 3KK3A 3NH0A 2HNYA 2ZJRL 4CEFA 4IFEA 3DM2A 1BWFO 1ZXOA 4CEZA 2ZD1A 1VQNN 3KK7A 3QNOA 4JRQA 4BR5A 1S1TA 4CFAA 3QFPA 4JV5K 3CPEA 1VQ4N 1RBSA 1ZBSA 4IJNA 1IG9A 4GKJK 4Z4CA 4WQ5A 3NHGA 3ZSRA 1U45A 1Q82O 1NBWA 4NXMK 3S9HA 1VSLA 4LF6K 4F2SA 2UXDK 3O9UA 4EIAA 4Z4IA 4FJKA 4FCYA 3ZT4A 4FW2A 4AHTA 3AVLA 1QVGM 4OGCA 1SL2A 4JKFA 1S6PA 3CETA 3OYKA 1BISA 4GV6A 3OY9A 2IC3A 3T1YK 3WQUA 1SKRA 4BR7A 1KVBA 2P9SA 4IO8A 4FJLA 4CHPA 2ATQA 3WXKA 2OZSA 3Q7BA 2P9PA 1T7PA 4AM6A 2FSKA 3FZKA 4FSVA 4DV5K 4IOCL 4WQ4A 2W40A 4BC4A 3TAGA 5AQWA 1C0MA 2G8IA 4A59A 1NK4A 3KK1A 3SI6A 3PO4A 4FZYA 5AQOA 1GOCA 1T03A 3RMDA 1NM1A 2E1ZA 3MN6A 2HBMA 4CFCA 4DHYA 4M45A 3PX6A 1EXQA 2QXFA 3NDKA 1I3AA 2PBDA 3CCJN 4EP4A 1UOCA 3BDPA 3C65A 3THWA 4EZ6A 4CBUA 3O9RA 4CHQA 4B3OA 1QQOA 3OYMA 1Y64A 3U9ZA 3C6TA 4BC2A 2P5GA 4XH1A 3AO1A 4DTOA 4CECA 4ZTFA 1DKGD 2FLOA 4DR3K 2UUBK 3G6EN 4BRIA 1IO2A 4LFCK 3VGLA 4BWJA 3HTVA 4LF5K 4CGGA 4JNEA 4CFBA 4CBXA 4FWSA 3FGUA 4E1MA 3KKSA 3IUCA 4FLYA 4FZZA 3A2FA 2JWKA 4BVPA 3DRSA 3R6MA 4DV0K 5LJVA 1S1VA 4WFBL 2H3GX 2RN2A 4A5BA 4DR7K 3DMJA 3G10A 3SQ2A 3MDQA 1ZYQA 1KAYA 1UA1A 2W41A 1E4FT 1U2VA 1ITGA 3ZX2A 4CZFA 1YITN 1LCUA 2HMIA 3K0SA 3CJ7A 3E01A 2WTUA 3OYHA 2QXLA 4KI4A 4IXCA 1XWLA 3QEXA 1HJRA 2G8HA 3VOVA 3OYAA 1RBRA 3IS9A 3K57A 4CEDA 4BRHA 3BUZB 1KFDA 4O0JA 1LOTB 2QA4N 2E2PA 5C12A 1B9FA 2P9UB 1N34K 3VQ4A 3LPTA 5BPMA 1JL1A 3J81O 3PX4A 5BRDA 3SJJA 3OYGA 4JD2B 3LALA 3NH2A 4MLEA 2KZZA 3CQXA 1JKHA 2KW4A 1XNRK 1N32K 1N8RO 3WT0A 5SWMA 4KHUA 1BO5O 4FLUA 1O1WA 1K8KA 2GV9A 1J9AA 5AQZA 3EN9A 2CH5A 4BGAA 3RTVA 4RWTA 1QQNA 4DU4A 2HW3A 2WOMA 4CI6A 4H0XB 3THXA 1SAZA 1A5WA 1TUUA 3LDOA 4V19S 1X9WA 3KHYA 3HL8A 4HHTA 3KD1E 3S3MA 1J53A 2E2OA 2HBLA 2NRXA 4W5OA 4FJ5A 2P9IA 4H4MA 3SMPA 1NJYA 1VSMA 1D9DA 3CC4N 5KRSA 1UA0A 5HOOA 4BRQA 3IRXA 5BPLA 3D2EA 4OVLA 4ZHRA 4ELVA 3PO5A 3SBGA 1REVA 3VETA 4NB4A 3AA2A 1S9GA 1JLCA 3CCMN 3SBTA 4CGFA 2QWQA 3MEGA 4M7YA 3NMUA 3KWGA 5AZIB 1RCHA 4RCHA 2F9WA 1TK8A 3D45A 3EO3A 1GLDG 3CMEN 3B8AX 4IOXA 3NF8A 3LDQA 4YDUA 4C8KA 1N33K 4DTPA 4DWIA 2YJEA 2I5JA 3H3NO 3O4NA 3JAMO 5F1XA 4BR9A 4BDZA 4J8FA 4B1UB 3HJFA 2BDPA 4FVUA 1Z05A 4JI2K 1VQON 3OW2M 4WYBA 1IG8A 3K9JA 4B9SA 3P83D 1DTTA 1GOBA 2YV0X 1NMNA 1QHTA 4OPAA 2VG6A 3CJ9A 4B9UA 3B6PA 4IJAA 5FPMA 1VQ5N 5C2DA 2P9NB 3K5OA 1YVUA 4MFBA 3ZSVA 4H0VB 2G8VA 5BRFA 4WE1A 3M1FA 2G8WA 4HCCA 4X65K 3SPZA 1L3VA 3FR0A 5M1NA 4JKGB 3L2WA 1NLVA 4XEIA 4K8XA 5FRNA 4CJKA 3ATUA 3LL3A 3MAQA 3O1WA 4BC3A 3VQBA 4I2PA 2ETJA 4O55A 4FJHA 1JLEA 5BN9A 4H8KA 4M3XA 5LL6Z 3PSIA 4JI7K 1J5OA 3F2KA 4ELUA 3KK2A 3ULEA 2YHYA 2QW9A 2F9TA 3H45C 3C0BA 2HVIA 3NGYA 3PY8A 1NK6A 3DLRA 3CG7A 1HYSA 3SUPA 3NVMA 5EXWA 3A5LC 4KRFA 4FJGA 4JLHA 4DQRA 2HNDA 3VTIA 4FXDA 1A5XA 2OPSA 3J8AA 2Y1JA 3VMFB 2O8FB 3TAQA 1TKDA 3QB0A 4ILGB 1RTDA 1KTQA 2OYQA 3N4QA 1TL3A 4BR2A 5GINA 3TU5A 3MMVA 1RFQA 4DS5A 4B3RK 4CZEA 2VCPA 3ZX3A 3O4WA 4JN4A 1ZBHA 2BUPA 2QKKA 3MK6A 1VSJA 3VQ9A 3HBTA 1T8EA 1HPMA 4EFHA 3KLEA 4PA1A 1KCFA 1GLAG 3OHRA 3D2FB 2HHQA 3V9ZA 3AO4A 3V1RA 3O6WA 2V7ZA 4K43A 3ZT0A 3K5NA 3MXMA 3DI6A 2GELA 1J54A 4CGJA 2IOCA 2HMPA 1C6VA 1WLJA 3MECA 5JLHA 2KFZA 1WSHA 1Q8IA 3BF3A 4JAXA 3OYBA 4W5QA 3SCXA 3MCPA 3GOIA 3IDHA 4DU1A 1X3MA 4KFBA 4A57A 2G8KA 1K9MO 4E0DA 2D0CA 1WSJA 4FJXA 1NGEA 3U6FA 1VAZA 4M42A 3IMXA 4GY2B 4NLBA 1CXUA 4DQSA 1H1VA 4FM2A 3G71N 1N6QA 1W2BM 2E6LA 1YF5L 4H5WA 1BIZA 2ASOA 2HB5A 3QBWA 3K58A 3K59A 3DLHA 5FPEA 3HSCA 5EY4A 5FLXO 4WF9L 4NO7A 2UUCK 3EE8A 5J2PA 3QBXA 5DK5A 1IKYA 4HUGA 5JS1A 2B5JA 1JCEA 1LW2A 3DJCA 2G8UA 1SQKA 3M5RA 3LDPA 2F7TA 1SZ2A 5C15A 3TAEA 5AZJA 4O44A 3AAQA 1JJ2M 3EKSA 4J2BA 5KGWA 4F9OA 3RMAA 2ZJQL 3O3GA 4B9LA 2RKIA 4YFUA 3HPHA 4GMJB 4DFKA 2QEXN 3NGZA 3KLHA 1EX4A 4M3UA 3DRRA 3P31A 3THWB 1U4BA 5DMRA 1TL1A 1KD1O 4HCBA 4CJSA 4F2RA 3QMLA 4JK8A 1U48A 3N4PA 3DAWA 2PFUA 4GKKK 2XY8A 3L3VA 3M8QA 5C0YA 1Q86O 3VEYA 2HHWA 1IKVA 4E7KA 2VG5A 3ATVA 1HKCA 3K2PA 5AQKA 4KHPK 1LW0A 3ZETA 3HT3A 1LAWA 4DUYK 5C24A 1RILA 3O4QA 3SQ4A 4I2QA 2CGJA 1SUQA 4KHWA 1VSEA 1K8AO 1ATSA 3VQ6A 1IKWA 5AQGA 5LMUK 3HYFA 3DYAA 4ID5A 5M1QA 2ZGYA 3QLHA 4LSNA 2FF6A 1NGIA 2QM1A 4B9NA 4Z94A 1XMOK 3HO1A 3ENHA 3TI0A 4DSKA 1QSLA 4FJJA 1YIJN 3T1AA 4Q0BA 1JLFA 4X66K 4O4GA 1OH7A 5FRMA 3PLAA 3CJBA 4C23A 3SUNA 3H46O 1HNXK 2V7YA 4CJRA 1Q18A 4A62A 1VSDA 2ZM6K 3JS6A 2D4WA 1VHXA 4J2EA 3V81A 4CHNA 1ATNA 3ZSOA 1YAGA 3UE5A 1L3TA 1W97L 4ISGA 2A1RA 4PKGA 4CEEA 3UB5A 3O80A 2OA8A 4KTZA 4MQ3A 4N47A 3O9QA 2NRWA 3VEOA 4CBWA 3FZMA 4K25A 4FLXA 3H08A 1V4TA 4DV6K 1C1CA 1LWFA 3QDKA 4IEIA 1W7AA 2O4IA 5I42A 1VQKN 4BG9A 2KKZA 3HXMA 3AV9A 5GADP 3OS1A 4FVMA 2FF3B 2UXCK 5B8HA 4H5TA 4CJEA 3VEXA 3U3GA 3LDSA 4ID1A 4FOIA 3CCRN 2JLEA 1G15A 3JSMA 2BTFA 2I7PA 5JS2A 5H1SQ 3KLGA 3QFUA 4E19A 4UY8O 4CHYA 3THYB 3V1QA 3L2RA 3OYIA 3KJVA 2QWPA 1Q9YA 3CM6A 3THVA 4CHZA 1VQ6N 5AQTA 3E1YA 5LMNK 1K73O 4FPBA 4RW9A 2PYJA 4JI6K 1NKBA 1L3SA 2EWSA 2RF2A 1XHZA 1SKSA 3THXB 5M1OA 2W42A 1RTJA 1HUXA 3ZEUA 1RBTA 4JI3K 4AHSA 3BZKA 2Y1IA 3AA3A 4DQ8A 4NLCA 1JCFA 4BRKA 3DXKA 5KQDA 4DFPA 2QKBA 4FK0A 4L3QA 2KHOA 2HF3A 1VRUA 5HL7L 1JXBA 3QEPA 4KO0A 2BANA 2Q36A 3BGRA 5GIOA 3VQ7A 4DFJA 1C0UA 3VF4A 3SMSA 1NKCA 4UQGA 4JHDB 2P9LB 5AQFA 5J2NA 3ZSZA 1WSGA 3S3NA 2F8SA 3W3DA 1MA9B 1NOZA 2YNIA 1KLMA 5J2MA 1EO1A 5AQIA 1QQCA 1S1UA 3HVRA 2O8EB 4LC9B 4HTLA 4DTNA 1DTQA 1NGFA 2FC0A 3E9OA 4CF8A 2ASPA 3ZLJA 5F0XA 3V9XA 2HF4A 1BUPA 3CFPA 3MXJA 1UWBA 1B9DA 4BQLA 1NK8A 1BCMA 3F9MA 1VRTA 4PKIA 3TPQA 4CJTA 4JEPA 4JKAA 4N56A 5CY4A 1C0GA 4FJMA 1HX1A 3RRHA 2VQEK 1U04A 4CD3A 3CMAN 3TTCA 2YKMA 4EAHD 4LD0A 4E3SA 3AVKA 4AHUA 5M1FA 3MN7A 1IJJA 1WSEA 4M41A 4BRPA 4H5NA 3VGKA 4B9QA 4CF0A 4BC5A 3DLKA 3TR8A 2E6MA 4WQ5C 4OKKA 2YHWA 5HRPA 4BG8A 3L4IA 4JKEA 5E84A 2BGGA 1TKZA 3AA5X 4DR5K 3UIQA 3C7NA 4DR6K 1X9MA 4LSLA 1X1PA 3QEIA 1CZBA 1X3NA 2KQ2A 3AVIA 2Z1JA 4B08A 3U8XA 5AQRA 3CJAA 5AQVA 1J6ZA 2E4LA 3LP1A 1QHAA 2B6AA 1GOAA 3KIOA 3SQ1A 4CJ5A 4LF7K 3DXMB 4H03B 2E5LK 1F21A 3P1GA 4DV3K 4AHVA 4DQIA 4E1NA 1WOQA 1YHQN 3L2VA 3M8PA 4CE9A 2JWLA 4DTJA 4OKEA 4BR4A 1QVFM 2FBXA 2O4GA 4IG3A 4O5BA 3VQEA 2XO7A 3T1HK 4B8AB 2P1JA 2OTLN 4WQ4C 1HNWK 3PUFA 5GAGP 4EZ9A 3MXIA 4NCGA 4FZXC 4C8LA 3MEEA 1OH5A 2HBJA 2UYTA 4HVJA 4X62K 1YJWN 4KB1A 1WN7A 1T3VA 3S41A 3UKUB 1NJXA 2Z1GA 3T19A 4CGIA 3AVNA 2IIRA 3CD6N 2WBNA 3V1OA 4KH5A 3A5OC 4QS7A 4OLAA 4B1XB 2IS3A 3P5JA 4BQZA 1RT5A 3LP0A 4YY3K 4BROA 3HP6A 1BQNA 1NGGA 5CYQA 3TAFA 4Q5VA 4GW6A 4OPKA 2DFFA 3I8DA 2WFBA 4BRDA 1NGDA 3F9KA 5AQNA 1HJOA 1BDGA 2G8FA 4W5NA 5IT9O 4QOZB 3VEZA 4DR4K 2ZQBA 3QO9A 3KLFA 3U9DA 5LY3A 1GLEG 4IG0A 3ZCMA 3VA3A 4E7HA 2OZMA 5C10A 4B9VA 3GG4A 2XY7A 4AH9A 2W6KA 5KGXA 1KC8O 5HRSA 3T7ZA 1UAXA 3NCIA 3BZCA 1LWEA 4N76A 1RT7A 1TYQB 3VESA 4K41A 1TK5A 3ZSYA 2O8BA 5FPNA 3CC2N 2YNFA 4H0OA 3IG1A 3QEVA 1VQPN 4CZKA 2YHBA 2YJFA 3VQCA 4EP5A 1Z25A 3Q7CA 3KLIA 3AARA 4C1NK 1NJWA 1BL3A 4PL7A 2F8TA 3CQYA 2A41A 2QWRA 1XMQK 4KHYA 1EKEA 3A8YA 3TAPA 1BI4B 4CF1A 1O13A 4RW6A 5AQHA 1VQ8N 3I55N 4BRNA 1R0AA 4I9QA 3FZLA 2QWMA 1M90O
chains in the Genus database with same CATH topology
2Z1IA 2B5JA 1LW2A 3OS0A 3ZSRA 1U45A 4CJVA 3OYNA 3NF9A 2G8UA 4F8RA 3AVAA 4CIGA 4B8CA 3S9HA 5HP1A 1VSLA 2P51A 3TAEA 4BACA 3U3YA 4F2SA 3MEDA 4O44A 1ASVA 4FJNA 3RR7A 3NH1A 2VWJA 1HQEA 4HUFA 4FK4A 3C94A 5CZ1A 3HPOA 1D9FA 4J2BA 4Z4IA 5KGWA 4FJKA 3RMAA 1BIUA 4FCYA 3ZT4A 3EZ5A 3O3GA 3SUOA 4B9LA 2RKIA 4FW2A 4AHTA 3AVLA 4OGEA 4YFUA 4N5SA 1QSYA 1CLQA 3HPHA 4GMJB 4DFKA 4OGCA 4CCHA 3NGZA 3KLHA 4KTQA 1EX4A 4M3UA 3QIPA 3DRRA 3DLEA 3OYKA 1S6PA 4CF2A 1S1WA 1U4BA 1SL2A 1BISA 5DMRA 1TL1A 1S9EA 3OY9A 3S3OA 1NK9A 4HCBA 2IC3A 4CJSA 3TWHA 4F2RA 4NYFA 4GVMA 1ZBUA 4AHCA 4E89A 3O3FA 1SKRA 1U48A 3SPYA 1KVBA 4AILC 4PQUA 2XY8A 3PV8A 4FLVA 4FJLA 3L3VA 4CHPA 1KVCA 3M8QA 3OS2A 5I3UA 2ATQA 3V9UA 4DG1A 3G0ZA 2OZSA 4RW8A 2HHWA 1IKVA 1L3UA 4E7KA 1T7PA 2VG5A 3V6DA 3TAGA 3K2PA 4CEAA 4CGHA 3C6UA 3OYCA 3TARA 1LW0A 3RWUA 1RT4A 1RT6A 1C0MA 1HQUA 4AHRA 1NK4A 4TSXA 2G8IA 3HT3A 3KK1A 1JLGA 3SI6A 1LAWA 4OLBA 3PO4A 3AVBA 4FZYA 1GOCA 5C24A 1RILA 1T03A 3RMDA 3O4QA 1XC9A 3SQ4A 4I2QA 2FBTA 3DOKA 1NK0A 2ZE2A 3ASMA 4CFCA 3SNNA 1SUQA 4M45A 3PX6A 4KHWA 1VSEA 2FBYA 3SZ2A 3DLBA 1EXQA 3VQ6A 2QXFA 3NDKA 1I3AA 2GBZA 1IKWA 1RDAA 1WAJA 3VQPA 4CJWA 3HYFA 4EP4A 3DYAA 4ID5A 1UOCA 3BDPA 4I9LA 3QLHA 4LSNA 1XHXA 4EZ6A 3HK2A 1SL0A 1JLAA 4B9NA 2QK9A 1TAUA 2OPPA 3HO1A 3TI0A 1RDBA 4DSKA 4CHQA 1QSLA 4FJJA 3OYMA 3QNNA 4B3OA 3T1AA 4Q0BA 3C6TA 3VQ5A 2P5GA 5FROA 1JLFA 3AO1A 4DTOA 3ULDA 2YNGA 4O4GA 4CECA 4CJFA 2GUIA 3SUNA 2PYLA 5FRMA 4ZTFA 1RDDA 4CJRA 5J1EA 1SL1A 2DFEA 1C0TA 1FKOA 1TGOA 1VSDA 4DLEA 1IO2A 1RNHA 4BWJA 3SV3A 4CGGA 3OJUA 1ZBIA 3KTQA 4J2EA 2XRIA 1MU2A 3M8SA 4CFBA 3V81A 4DF8A 4CHNA 4FM0A 4E1MA 3KKSA 1JXEA 3QIOA 3ZSOA 1L3TA 2A1RA 4FLYA 4FZZA 2DTUA 4CEEA 3CQ8A 4Z0UA 2OA8A 1TKTA 3A2FA 1TAQA 2DFHA 4KTZA 3ISNC 2RPIA 4MQ3A 4N47A 4PUOA 4QCLA 3CYMA 3DRSA 4CK1A 2BE2A 4DLGA 4FJIA 4FLXA 1S1VA 3H08A 3LWLA 1RT1A 1Y97A 4XIUA 1C1CA 3ZT1A 1LWFA 2RN2A 2O4IA 5I42A 4OPJA 3DMJA 3G10A 1ZBLA 4L8RB 4FJ7A 3HXMA 3AV9A 3LPUA 3SQ2A 3OYEA 1ZYQA 3OS1A 4FVMA 4M3RA 3V9WA 3IAYA 4ELTA 4Z4GA 1UA1A 4B9TA 5D3GA 3NE6A 1ITGA 4Y1CA 4CJEA 1Q9XA 1RT2A 2HMIA 3U3GA 3C95A 3LDSA 4ID1A 5FDLA 1RBUA 1KFSA 1BQMA 1VSHA 3E01A 2JLEA 1G15A 3JSMA 5JS2A 3OYHA 4KI4A 2KFNA 3KLGA 1EP4A 1XWLA 4E19A 2YHAA 3NF6A 3JYTA 3QETA 4CHYA 2D0AA 1HJRA 3QEXA 3V1QA 2G8HA 4CF9A 3ITHA 1Z26A 3OYIA 3KJVA 3L2RA 1Q9YA 4KB0A 3CM5A 4CJ3A 3OYAA 1RBRA 3CM6A 3THVA 3IS9A 4CHZA 4CEDA 3K57A 3LZIA 2HHVA 1RTHA 1KFDA 4O0JA 4RW9A 3WNFA 4OKJA 2PYJA 3CFRA 1NKBA 1L3SA 2RF2A 4CHOA 1XHZA 2P5OA 1B9FA 2X78A 2IGIA 1QTMA 3AO5A 3AA4A 4Z4EA 1SKSA 3QESA 1WNSA 3OVNA 3VQ4A 3LPTA 2W42A 1JL1A 1RTJA 3PX4A 4DTXA 3F73A 1RBTA 3ZT3A 4CJ4A 4AHSA 1NK7A 5E41A 4JRPA 1C1BA 2Y1IA 3EYZA 3OYFA 3AA3A 4E7IA 4KI6A 3SJJA 3OYGA 4KHNA 4DFPA 3LALA 3NH2A 2QKBA 4KREA 3LZJA 2KZZA 1L5UA 4LY7A 2XY5A 3QEWA 1YTAA 4FK0A 5C25A 3RRGA 3WNEA 1NK5A 4NCAA 1JKHA 3CFOA 1FKPA 2KW4A 1VRUA 1JXBA 3QEPA 4KO0A 3B6OA 4IKFA 5SWMA 4KHUA 2BANA 3BGRA 1NJZA 1VK0A 4FLUA 1LV5A 4DQPA 1O1WA 4FYDA 1A5VA 1JLQA 2GV9A 4OJRA 1C0UA 3VQ7A 4CESA 2YNHA 4DFJA 1NKCA 4UQGA 5J2NA 1J9AA 3ZSZA 3K5LA 3K5MA 2HHTA 1WSGA 2KZMA 4Y1DA 4DF4A 3S3NA 2F8SA 3RTVA 4FW1A 1NOZA 3NFAA 4DS4A 2YNIA 1KLMA 2IAJA 3LWMA 5J2MA 3RMCA 1BHLA 4DU4A 3WNHA 4DTRA 2HW3A 4CJLA 2WOMA 1QQCA 5J2QA 1S1UA 4M3ZA 2VG7A 3HVRA 2HHXA 3RR8A 5EU7A 4DTNA 1DTQA 2FC0A 4CF8A 4BE1A 1A5WA 3V9XA 4J2DA 3I0RA 2EX3A 1X9WA 3VQAA 3HL8A 4HHTA 3DRPA 4IFYA 1RT3A 3CFPA 3I0SA 4BE2A 3KD1E 3S3MA 1J53A 3MXJA 5HBMA 1UWBA 1B9DA 3ALYA 1U47A 3DLGA 4W5OA 1NK8A 4FJ5A 1BCMA 4H4MA 1VRTA 3L8BA 1NJYA 1VSMA 1D9DA 5KRSA 1UA0A 4CJTA 3QERA 2HNZA 3AVCA 5CY4A 4N56A 2VWKA 3IRXA 4Z4HA 4DTMA 4DFMA 3AVJA 3V4IA 4IFVA 4FJMA 4OVLA 5KI6A 5C42A 3LAKA 4ZHRA 4ELVA 4K8ZA 2FBVA 3RRHA 3PO5A 3L2QA 1LAVA 4N41A 1REVA 4CJUA 3AA2A 4JS5A 2DY4A 1RTIA 1S9GA 1JLCA 1U04A 1W9HA 3TAMA 4CERA 4CEBA 4CGFA 2YKMA 4LD0A 4E3SA 3AVKA 3MEGA 1ZBFA 1RCHA 1JLBA 4KV8A 4AHUA 3O3HA 3NBPA 1TK8A 3D45A 1WSEA 4M41A 4DSIA 2PY5A 2D5RA 3NF8A 4M3YA 4C8KA 2HHUA 4CF0A 3AVGA 4DTPA 4DWIA 2I5JA 4CJQA 3DLKA 3TR8A 2E6MA 3PX0A 3O4NA 3AVFA 4OKKA 4CEQA 5HRPA 3HM9A 4W5TA 2PZSA 4BDZA 3OYJA 3HJFA 4M3TA 2BDPA 4KKOA 1QS4A 1YTUA 2BGGA 3M8RA 1TKZA 3AA5X 3LP2A 5HLFA 4DSEA 3UIQA 3VQQA 5KRTA 3NF7A 1S5JA 1S1XA 4B9SA 3P83D 1DTTA 4CEOA 1X9MA 4LSLA 3KD5E 3T3FA 4C8NA 1X1PA 3QEIA 2A1SA 5KTQA 1GOBA 2YV0X 4CK3A 1QHTA 1CZBA 3DOLA 2VG6A 5T7BA 5CYMA 4DTUA 2KQ2A 3AVIA 3V9SA 2Z1JA 1EETA 4B08A 4B9UA 3B6PA 4HUEA 2HHSA 4KHSA 3K5OA 1YVUA 2E4LA 1IKXA 3LP1A 2B6AA 1NOYA 4MFBA 4FLTA 1GOAA 3KIOA 3ZSVA 4DU3A 1ASWA 2G8VA 4WE1A 1CZ9A 2G8WA 3SQ1A 4CJ5A 4HCCA 4BWMA 4O0IA 1T05A 3SPZA 1F21A 3P1GA 1L3VA 4AHVA 4DQIA 1WSIA 4E1NA 1VSKA 3L2WA 1D5AA 3L2VA 3M8PA 4CE9A 3D0PA 2EHGA 4DTJA 4OKEA 4QAGA 1SKWA 1BGXT 4G1QA 2FBXA 4K8XA 2O4GA 5FRNA 1RBVA 4IG3A 3VQDA 4CJKA 4FM1A 4O5BA 3VQEA 2XO7A 4B8AB 2P1JA 4E7JA 3MAQA 3KKRA 3QINA 4ICLA 3VN5A 5JS1A 1WAFA 3VQBA 4CFDA 4I2PA 3PUFA 2ETJA 4O55A 4FJHA 1JLEA 4H8KA 4M3XA 2HVHA 3HP9A 3NGIA 4EZ9A 5HRNA 3MXIA 4NCGA 1J5OA 4FZXC 4KHQA 4DTSA 3HVTA 3MEEA 4CK2A 3KK2A 1KSPA 4C8LA 3LP3A 4ELUA 4F3TA 1QE1A 2IDOA 4HVJA 4LH4A 1LWCA 3LANA 1HYVA 2Q3SA 3ZSQA 4KB1A 1WN7A 1NJXA 2Z1GA 5CZ2A 3HSTB 3T19A 4FJ9A 3NGYA 4CGIA 2HVIA 3PY8A 3AVNA 1XI1A 2B4JA 3OJSA 5SZTA 1HMVA 1C1AA 1NK6A 2KTQA 3DLRA 3FFIA 1BI4A 3CG7A 4DSFA 1HYSA 4DSLA 3AO2A 1U49A 4LH5A 1KVAA 3V1OA 3SUPA 2AJQA 2R7YA 4BE0A 3ZT2A 1KLNA 4KRFA 2JGUA 3AVMA 4FJGA 2D0BA 4JLHA 3AO3A 4DQRA 1IH7A 1CXQA 3NAEA 4OLAA 2HNDA 3SYZA 4FXDA 2IS3A 3P5JA 1A5XA 2OPSA 2Y1JA 1RT5A 4BDYA 1BCOA 3TAQA 1TKDA 1ASUA 1D8YA 1HNVA 4CIEA 3LP0A 1RTDA 1HPZA 1KTQA 3SV4A 2OYQA 3HP6A 1TL3A 1JL2A 1BQNA 3TANA 5CYQA 3TAFA 4Q5VA 4Z4FA 4GW6A 4OPKA 1QSSA 2DFFA 4JS4A 3I8DA 3L2UA 4FLWA 4B9MA 3OYLA 4DS5A 4CJPA 3F9KA 1TVRA 4YNQA 3ZSWA 1HNIA 4C8OA 4PWDA 3SQ0A 1ZBHA 4M3WA 2G8FA 4ZTJA 4KPYA 4W5NA 4RW4A 4QOZB 3L3UA 2QKKA 2WONA 1S6QA 1VSJA 2ZQBA 1HRHA 3VQ9A 4IBNA 4DMNA 3TABA 3QO9A 3KLFA 1T8EA 4J2AA 4I7FA 4FJ8A 1HYZA 4IG0A 3ZCMA 3KLEA 3VA3A 4IDKA 1KCFA 2NUBA 4PA1A 4E7HA 4B9VA 2X6NA 1VSFA 2OZMA 4NCBA 2XY7A 4AH9A 1W0HA 3VA0A 4RG8A 4H4OA 2LSNA 3ZSXA 2XY6A 2HHQA 3V9ZA 3AO4A 1NKEA 5KGXA 1YT3A 4HTUA 1SV5A 1N5YA 5HRSA 2OPRA 3V1RA 1UAXA 2X74A 3NCIA 1LWEA 3ZT0A 3K5NA 3MXMA 4N76A 2OPQA 1RT7A 3DI6A 1J54A 4CGJA 1TK5A 3ZSYA 1TKXA 2IOCA 4FLZA 4DSJA 4KTWA 4NYNA 4R5PA 1C6VA 1WLJA 2YNFA 3MECA 3HPGA 1WSHA 3IG1A 4FK2A 2KFZA 1Q8IA 2F96A 3AVHA 3OYBA 4W5QA 3OYDA 3SCXA 3QEVA 3LAMA 4DU1A 1TK0A 1FK9A 2X6SA 3SUQA 4F3OA 2YHBA 4KFBA 5HROA 2XHBA 3VQCA 1FXXA 2G8KA 4RW7A 4EP5A 4DQQA 2ITGA 1Z25A 4E0DA 2D0CA 1WSJA 3EY1A 1KRPA 3KLIA 3WNGA 1X9SA 4FJXA 2Z1HA 5K14A 3U6FA 3RMBA 1NJWA 4BDPA 1BL3A 4W5RA 5HRRA 4M42A 4PY5A 1B92A 2F8TA 3KK3A 4F4KA 4KAZA 1CXUA 1DLOA 3NH0A 4FM2A 4DQSA 2HNYA 1N6QA 4CEFA 4KHYA 4E7LA 3DM2A 2E6LA 1EKEA 1WSFA 4C8MA 3TAPA 1BI4B 1BIZA 4CF1A 2HB5A 3K58A 1K6YA 3K59A 3DLHA 4CEZA 2ZD1A 1TV6A 4RW6A 1RDCA 3QNOA 4JRQA 4CGDA 1S1TA 4CFAA 1I39A 1R0AA 1RBSA 1VSIA 5J2PA 3VQ8A 1IG9A 4CIFA 5DK5A 4I9QA 1IKYA 4HUGA 2YKNA 4Z4CA 3NHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1I A;  2B5J A;  1LW2 A;  3OS0 A;  3ZSR A;  1U45 A;  4CJV A;  3OYN A;  3NF9 A;  2G8U A;  4F8R A;  3AVA A;  4CIG A;  4B8C A;  3S9H A;  5HP1 A;  1VSL A;  2P51 A;  3TAE A;  4BAC A;  3U3Y A;  4F2S A;  3MED A;  4O44 A;  1ASV A;  4FJN A;  3RR7 A;  3NH1 A;  2VWJ A;  1HQE A;  4HUF A;  4FK4 A;  3C94 A;  5CZ1 A;  3HPO A;  1D9F A;  4J2B A;  4Z4I A;  5KGW A;  4FJK A;  3RMA A;  1BIU A;  4FCY A;  3ZT4 A;  3EZ5 A;  3O3G A;  3SUO A;  4B9L A;  2RKI A;  4FW2 A;  4AHT A;  3AVL A;  4OGE A;  4YFU A;  4N5S A;  1QSY A;  1CLQ A;  3HPH A;  4GMJ B;  4DFK A;  4OGC A;  4CCH A;  3NGZ A;  3KLH A;  4KTQ A;  1EX4 A;  4M3U A;  3QIP A;  3DRR A;  3DLE A;  3OYK A;  1S6P A;  4CF2 A;  1S1W A;  1U4B A;  1SL2 A;  1BIS A;  5DMR A;  1TL1 A;  1S9E A;  3OY9 A;  3S3O A;  1NK9 A;  4HCB A;  2IC3 A;  4CJS A;  3TWH A;  4F2R A;  4NYF A;  4GVM A;  1ZBU A;  4AHC A;  4E89 A;  3O3F A;  1SKR A;  1U48 A;  3SPY A;  1KVB A;  4AIL C;  4PQU A;  2XY8 A;  3PV8 A;  4FLV A;  4FJL A;  3L3V A;  4CHP A;  1KVC A;  3M8Q A;  3OS2 A;  5I3U A;  2ATQ A;  3V9U A;  4DG1 A;  3G0Z A;  2OZS A;  4RW8 A;  2HHW A;  1IKV A;  1L3U A;  4E7K A;  1T7P A;  2VG5 A;  3V6D A;  3TAG A;  3K2P A;  4CEA A;  4CGH A;  3C6U A;  3OYC A;  3TAR A;  1LW0 A;  3RWU A;  1RT4 A;  1RT6 A;  1C0M A;  1HQU A;  4AHR A;  1NK4 A;  4TSX A;  2G8I A;  3HT3 A;  3KK1 A;  1JLG A;  3SI6 A;  1LAW A;  4OLB A;  3PO4 A;  3AVB A;  4FZY A;  1GOC A;  5C24 A;  1RIL A;  1T03 A;  3RMD A;  3O4Q A;  1XC9 A;  3SQ4 A;  4I2Q A;  2FBT A;  3DOK A;  1NK0 A;  2ZE2 A;  3ASM A;  4CFC A;  3SNN A;  1SUQ A;  4M45 A;  3PX6 A;  4KHW A;  1VSE A;  2FBY A;  3SZ2 A;  3DLB A;  1EXQ A;  3VQ6 A;  2QXF A;  3NDK A;  1I3A A;  2GBZ A;  1IKW A;  1RDA A;  1WAJ A;  3VQP A;  4CJW A;  3HYF A;  4EP4 A;  3DYA A;  4ID5 A;  1UOC A;  3BDP A;  4I9L A;  3QLH A;  4LSN A;  1XHX A;  4EZ6 A;  3HK2 A;  1SL0 A;  1JLA A;  4B9N A;  2QK9 A;  1TAU A;  2OPP A;  3HO1 A;  3TI0 A;  1RDB A;  4DSK A;  4CHQ A;  1QSL A;  4FJJ A;  3OYM A;  3QNN A;  4B3O A;  3T1A A;  4Q0B A;  3C6T A;  3VQ5 A;  2P5G A;  5FRO A;  1JLF A;  3AO1 A;  4DTO A;  3ULD A;  2YNG A;  4O4G A;  4CEC A;  4CJF A;  2GUI A;  3SUN A;  2PYL A;  5FRM A;  4ZTF A;  1RDD A;  4CJR A;  5J1E A;  1SL1 A;  2DFE A;  1C0T A;  1FKO A;  1TGO A;  1VSD A;  4DLE A;  1IO2 A;  1RNH A;  4BWJ A;  3SV3 A;  4CGG A;  3OJU A;  1ZBI A;  3KTQ A;  4J2E A;  2XRI A;  1MU2 A;  3M8S A;  4CFB A;  3V81 A;  4DF8 A;  4CHN A;  4FM0 A;  4E1M A;  3KKS A;  1JXE A;  3QIO A;  3ZSO A;  1L3T A;  2A1R A;  4FLY A;  4FZZ A;  2DTU A;  4CEE A;  3CQ8 A;  4Z0U A;  2OA8 A;  1TKT A;  3A2F A;  1TAQ A;  2DFH A;  4KTZ A;  3ISN C;  2RPI A;  4MQ3 A;  4N47 A;  4PUO A;  4QCL A;  3CYM A;  3DRS A;  4CK1 A;  2BE2 A;  4DLG A;  4FJI A;  4FLX A;  1S1V A;  3H08 A;  3LWL A;  1RT1 A;  1Y97 A;  4XIU A;  1C1C A;  3ZT1 A;  1LWF A;  2RN2 A;  2O4I A;  5I42 A;  4OPJ A;  3DMJ A;  3G10 A;  1ZBL A;  4L8R B;  4FJ7 A;  3HXM A;  3AV9 A;  3LPU A;  3SQ2 A;  3OYE A;  1ZYQ A;  3OS1 A;  4FVM A;  4M3R A;  3V9W A;  3IAY A;  4ELT A;  4Z4G A;  1UA1 A;  4B9T A;  5D3G A;  3NE6 A;  1ITG A;  4Y1C A;  4CJE A;  1Q9X A;  1RT2 A;  2HMI A;  3U3G A;  3C95 A;  3LDS A;  4ID1 A;  5FDL A;  1RBU A;  1KFS A;  1BQM A;  1VSH A;  3E01 A;  2JLE A;  1G15 A;  3JSM A;  5JS2 A;  3OYH A;  4KI4 A;  2KFN A;  3KLG A;  1EP4 A;  1XWL A;  4E19 A;  2YHA A;  3NF6 A;  3JYT A;  3QET A;  4CHY A;  2D0A A;  1HJR A;  3QEX A;  3V1Q A;  2G8H A;  4CF9 A;  3ITH A;  1Z26 A;  3OYI A;  3KJV A;  3L2R A;  1Q9Y A;  4KB0 A;  3CM5 A;  4CJ3 A;  3OYA A;  1RBR A;  3CM6 A;  3THV A;  3IS9 A;  4CHZ A;  4CED A;  3K57 A;  3LZI A;  2HHV A;  1RTH A;  1KFD A;  4O0J A;  4RW9 A;  3WNF A;  4OKJ A;  2PYJ A;  3CFR A;  1NKB A;  1L3S A;  2RF2 A;  4CHO A;  1XHZ A;  2P5O A;  1B9F A;  2X78 A;  2IGI A;  1QTM A;  3AO5 A;  3AA4 A;  4Z4E A;  1SKS A;  3QES A;  1WNS A;  3OVN A;  3VQ4 A;  3LPT A;  2W42 A;  1JL1 A;  1RTJ A;  3PX4 A;  4DTX A;  3F73 A;  1RBT A;  3ZT3 A;  4CJ4 A;  4AHS A;  1NK7 A;  5E41 A;  4JRP A;  1C1B A;  2Y1I A;  3EYZ A;  3OYF A;  3AA3 A;  4E7I A;  4KI6 A;  3SJJ A;  3OYG A;  4KHN A;  4DFP A;  3LAL A;  3NH2 A;  2QKB A;  4KRE A;  3LZJ A;  2KZZ A;  1L5U A;  4LY7 A;  2XY5 A;  3QEW A;  1YTA A;  4FK0 A;  5C25 A;  3RRG A;  3WNE A;  1NK5 A;  4NCA A;  1JKH A;  3CFO A;  1FKP A;  2KW4 A;  1VRU A;  1JXB A;  3QEP A;  4KO0 A;  3B6O A;  4IKF A;  5SWM A;  4KHU A;  2BAN A;  3BGR A;  1NJZ A;  1VK0 A;  4FLU A;  1LV5 A;  4DQP A;  1O1W A;  4FYD A;  1A5V A;  1JLQ A;  2GV9 A;  4OJR A;  1C0U A;  3VQ7 A;  4CES A;  2YNH A;  4DFJ A;  1NKC A;  4UQG A;  5J2N A;  1J9A A;  3ZSZ A;  3K5L A;  3K5M A;  2HHT A;  1WSG A;  2KZM A;  4Y1D A;  4DF4 A;  3S3N A;  2F8S A;  3RTV A;  4FW1 A;  1NOZ A;  3NFA A;  4DS4 A;  2YNI A;  1KLM A;  2IAJ A;  3LWM A;  5J2M A;  3RMC A;  1BHL A;  4DU4 A;  3WNH A;  4DTR A;  2HW3 A;  4CJL A;  2WOM A;  1QQC A;  5J2Q A;  1S1U A;  4M3Z A;  2VG7 A;  3HVR A;  2HHX A;  3RR8 A;  5EU7 A;  4DTN A;  1DTQ A;  2FC0 A;  4CF8 A;  4BE1 A;  1A5W A;  3V9X A;  4J2D A;  3I0R A;  2EX3 A;  1X9W A;  3VQA A;  3HL8 A;  4HHT A;  3DRP A;  4IFY A;  1RT3 A;  3CFP A;  3I0S A;  4BE2 A;  3KD1 E;  3S3M A;  1J53 A;  3MXJ A;  5HBM A;  1UWB A;  1B9D A;  3ALY A;  1U47 A;  3DLG A;  4W5O A;  1NK8 A;  4FJ5 A;  1BCM A;  4H4M A;  1VRT A;  3L8B A;  1NJY A;  1VSM A;  1D9D A;  5KRS A;  1UA0 A;  4CJT A;  3QER A;  2HNZ A;  3AVC A;  5CY4 A;  4N56 A;  2VWK A;  3IRX A;  4Z4H A;  4DTM A;  4DFM A;  3AVJ A;  3V4I A;  4IFV A;  4FJM A;  4OVL A;  5KI6 A;  5C42 A;  3LAK A;  4ZHR A;  4ELV A;  4K8Z A;  2FBV A;  3RRH A;  3PO5 A;  3L2Q A;  1LAV A;  4N41 A;  1REV A;  4CJU A;  3AA2 A;  4JS5 A;  2DY4 A;  1RTI A;  1S9G A;  1JLC A;  1U04 A;  1W9H A;  3TAM A;  4CER A;  4CEB A;  4CGF A;  2YKM A;  4LD0 A;  4E3S A;  3AVK A;  3MEG A;  1ZBF A;  1RCH A;  1JLB A;  4KV8 A;  4AHU A;  3O3H A;  3NBP A;  1TK8 A;  3D45 A;  1WSE A;  4M41 A;  4DSI A;  2PY5 A;  2D5R A;  3NF8 A;  4M3Y A;  4C8K A;  2HHU A;  4CF0 A;  3AVG A;  4DTP A;  4DWI A;  2I5J A;  4CJQ A;  3DLK A;  3TR8 A;  2E6M A;  3PX0 A;  3O4N A;  3AVF A;  4OKK A;  4CEQ A;  5HRP A;  3HM9 A;  4W5T A;  2PZS A;  4BDZ A;  3OYJ A;  3HJF A;  4M3T A;  2BDP A;  4KKO A;  1QS4 A;  1YTU A;  2BGG A;  3M8R A;  1TKZ A;  3AA5 X;  3LP2 A;  5HLF A;  4DSE A;  3UIQ A;  3VQQ A;  5KRT A;  3NF7 A;  1S5J A;  1S1X A;  4B9S A;  3P83 D;  1DTT A;  4CEO A;  1X9M A;  4LSL A;  3KD5 E;  3T3F A;  4C8N A;  1X1P A;  3QEI A;  2A1S A;  5KTQ A;  1GOB A;  2YV0 X;  4CK3 A;  1QHT A;  1CZB A;  3DOL A;  2VG6 A;  5T7B A;  5CYM A;  4DTU A;  2KQ2 A;  3AVI A;  3V9S A;  2Z1J A;  1EET A;  4B08 A;  4B9U A;  3B6P A;  4HUE A;  2HHS A;  4KHS A;  3K5O A;  1YVU A;  2E4L A;  1IKX A;  3LP1 A;  2B6A A;  1NOY A;  4MFB A;  4FLT A;  1GOA A;  3KIO A;  3ZSV A;  4DU3 A;  1ASW A;  2G8V A;  4WE1 A;  1CZ9 A;  2G8W A;  3SQ1 A;  4CJ5 A;  4HCC A;  4BWM A;  4O0I A;  1T05 A;  3SPZ A;  1F21 A;  3P1G A;  1L3V A;  4AHV A;  4DQI A;  1WSI A;  4E1N A;  1VSK A;  3L2W A;  1D5A A;  3L2V A;  3M8P A;  4CE9 A;  3D0P A;  2EHG A;  4DTJ A;  4OKE A;  4QAG A;  1SKW A;  1BGX T;  4G1Q A;  2FBX A;  4K8X A;  2O4G A;  5FRN A;  1RBV A;  4IG3 A;  3VQD A;  4CJK A;  4FM1 A;  4O5B A;  3VQE A;  2XO7 A;  4B8A B;  2P1J A;  4E7J A;  3MAQ A;  3KKR A;  3QIN A;  4ICL A;  3VN5 A;  5JS1 A;  1WAF A;  3VQB A;  4CFD A;  4I2P A;  3PUF A;  2ETJ A;  4O55 A;  4FJH A;  1JLE A;  4H8K A;  4M3X A;  2HVH A;  3HP9 A;  3NGI A;  4EZ9 A;  5HRN A;  3MXI A;  4NCG A;  1J5O A;  4FZX C;  4KHQ A;  4DTS A;  3HVT A;  3MEE A;  4CK2 A;  3KK2 A;  1KSP A;  4C8L A;  3LP3 A;  4ELU A;  4F3T A;  1QE1 A;  2IDO A;  4HVJ A;  4LH4 A;  1LWC A;  3LAN A;  1HYV A;  2Q3S A;  3ZSQ A;  4KB1 A;  1WN7 A;  1NJX A;  2Z1G A;  5CZ2 A;  3HST B;  3T19 A;  4FJ9 A;  3NGY A;  4CGI A;  2HVI A;  3PY8 A;  3AVN A;  1XI1 A;  2B4J A;  3OJS A;  5SZT A;  1HMV A;  1C1A A;  1NK6 A;  2KTQ A;  3DLR A;  3FFI A;  1BI4 A;  3CG7 A;  4DSF A;  1HYS A;  4DSL A;  3AO2 A;  1U49 A;  4LH5 A;  1KVA A;  3V1O A;  3SUP A;  2AJQ A;  2R7Y A;  4BE0 A;  3ZT2 A;  1KLN A;  4KRF A;  2JGU A;  3AVM A;  4FJG A;  2D0B A;  4JLH A;  3AO3 A;  4DQR A;  1IH7 A;  1CXQ A;  3NAE A;  4OLA A;  2HND A;  3SYZ A;  4FXD A;  2IS3 A;  3P5J A;  1A5X A;  2OPS A;  2Y1J A;  1RT5 A;  4BDY A;  1BCO A;  3TAQ A;  1TKD A;  1ASU A;  1D8Y A;  1HNV A;  4CIE A;  3LP0 A;  1RTD A;  1HPZ A;  1KTQ A;  3SV4 A;  2OYQ A;  3HP6 A;  1TL3 A;  1JL2 A;  1BQN A;  3TAN A;  5CYQ A;  3TAF A;  4Q5V A;  4Z4F A;  4GW6 A;  4OPK A;  1QSS A;  2DFF A;  4JS4 A;  3I8D A;  3L2U A;  4FLW A;  4B9M A;  3OYL A;  4DS5 A;  4CJP A;  3F9K A;  1TVR A;  4YNQ A;  3ZSW A;  1HNI A;  4C8O A;  4PWD A;  3SQ0 A;  1ZBH A;  4M3W A;  2G8F A;  4ZTJ A;  4KPY A;  4W5N A;  4RW4 A;  4QOZ B;  3L3U A;  2QKK A;  2WON A;  1S6Q A;  1VSJ A;  2ZQB A;  1HRH A;  3VQ9 A;  4IBN A;  4DMN A;  3TAB A;  3QO9 A;  3KLF A;  1T8E A;  4J2A A;  4I7F A;  4FJ8 A;  1HYZ A;  4IG0 A;  3ZCM A;  3KLE A;  3VA3 A;  4IDK A;  1KCF A;  2NUB A;  4PA1 A;  4E7H A;  4B9V A;  2X6N A;  1VSF A;  2OZM A;  4NCB A;  2XY7 A;  4AH9 A;  1W0H A;  3VA0 A;  4RG8 A;  4H4O A;  2LSN A;  3ZSX A;  2XY6 A;  2HHQ A;  3V9Z A;  3AO4 A;  1NKE A;  5KGX A;  1YT3 A;  4HTU A;  1SV5 A;  1N5Y A;  5HRS A;  2OPR A;  3V1R A;  1UAX A;  2X74 A;  3NCI A;  1LWE A;  3ZT0 A;  3K5N A;  3MXM A;  4N76 A;  2OPQ A;  1RT7 A;  3DI6 A;  1J54 A;  4CGJ A;  1TK5 A;  3ZSY A;  1TKX A;  2IOC A;  4FLZ A;  4DSJ A;  4KTW A;  4NYN A;  4R5P A;  1C6V A;  1WLJ A;  2YNF A;  3MEC A;  3HPG A;  1WSH A;  3IG1 A;  4FK2 A;  2KFZ A;  1Q8I A;  2F96 A;  3AVH A;  3OYB A;  4W5Q A;  3OYD A;  3SCX A;  3QEV A;  3LAM A;  4DU1 A;  1TK0 A;  1FK9 A;  2X6S A;  3SUQ A;  4F3O A;  2YHB A;  4KFB A;  5HRO A;  2XHB A;  3VQC A;  1FXX A;  2G8K A;  4RW7 A;  4EP5 A;  4DQQ A;  2ITG A;  1Z25 A;  4E0D A;  2D0C A;  1WSJ A;  3EY1 A;  1KRP A;  3KLI A;  3WNG A;  1X9S A;  4FJX A;  2Z1H A;  5K14 A;  3U6F A;  3RMB A;  1NJW A;  4BDP A;  1BL3 A;  4W5R A;  5HRR A;  4M42 A;  4PY5 A;  1B92 A;  2F8T A;  3KK3 A;  4F4K A;  4KAZ A;  1CXU A;  1DLO A;  3NH0 A;  4FM2 A;  4DQS A;  2HNY A;  1N6Q A;  4CEF A;  4KHY A;  4E7L A;  3DM2 A;  2E6L A;  1EKE A;  1WSF A;  4C8M A;  3TAP A;  1BI4 B;  1BIZ A;  4CF1 A;  2HB5 A;  3K58 A;  1K6Y A;  3K59 A;  3DLH A;  4CEZ A;  2ZD1 A;  1TV6 A;  4RW6 A;  1RDC A;  3QNO A;  4JRQ A;  4CGD A;  1S1T A;  4CFA A;  1I39 A;  1R0A A;  1RBS A;  1VSI A;  5J2P A;  3VQ8 A;  1IG9 A;  4CIF A;  5DK5 A;  4I9Q A;  1IKY A;  4HUG A;  2YKN A;  4Z4C A;  3NHG A; 
#chains in the Genus database with same CATH topology
 1EQY A;  2Z1I A;  4A2A A;  4CJV A;  3W0L A;  1I94 K;  5BR8 K;  1YXQ A;  5HP1 A;  1M1K O;  2P51 A;  1T6D A;  5AQS A;  4BAC A;  3U3Y A;  3MED A;  1HQE A;  3HI0 A;  5CZ1 A;  2IVN A;  3VF2 A;  3TSU A;  2O8C A;  4OGE A;  1QSY A;  1CLQ A;  4KBO A;  2NLX A;  2Q2R A;  4O5F A;  4KTQ A;  3CCU N;  1N36 K;  5BR9 A;  3VF6 A;  3S3O A;  1NK9 A;  4B1Z A;  4E89 A;  1YVN A;  4AIL C;  5AQY A;  1BG3 A;  5AQJ A;  1KVC A;  3OS2 A;  4I6M B;  5I3U A;  3V9U A;  1DT9 A;  2GEM A;  4RW8 A;  4YOW A;  1MWM A;  3HRG A;  3CXC M;  3V6D A;  4CEA A;  4CGH A;  3C6U A;  3R1X A;  1RT4 A;  1HQU A;  2NRH A;  3CER A;  1JLG A;  1XC9 A;  3ASM A;  4YOX A;  3SNN A;  2P9K B;  2ZGZ A;  2FBY A;  3DWL A;  2GBZ A;  4YDU C;  1WAJ A;  4CJW A;  1IBK K;  3EL2 A;  5I9E B;  4H0P A;  2RE2 A;  5KPR A;  1RDB A;  1NGH A;  4JD2 A;  5JVH L;  3QNN A;  3VQ5 A;  3MCA B;  3ULD A;  1KQS M;  1DEJ A;  4CJF A;  3CF5 L;  2PYL A;  5GIP A;  1SL1 A;  2Q1N A;  3ENO A;  1C0T A;  1FKO A;  3KVG A;  4DLE A;  2NZT A;  1RNH A;  3ID8 A;  3SV3 A;  3UKR A;  1ZBI A;  4XH5 A;  3KTQ A;  4B3T K;  3FZF A;  3QIO A;  2DTU A;  5DM6 L;  1E4G T;  4NXN K;  1TAQ A;  3ISN C;  2RPI A;  4PUO A;  4GVE A;  3L4Q A;  4CK1 A;  2BE2 A;  4DLG A;  4DV4 K;  3A0I X;  1Y97 A;  3ZT1 A;  3JXU A;  4OPJ A;  2GX9 A;  2W6L A;  4FJ7 A;  3CHW A;  3OYE A;  4BRL A;  2FSJ A;  3D7E O;  3V9W A;  5TKW A;  2CGK A;  4ELT A;  4B9T A;  2P9S B;  1IBM K;  5D3G A;  5ADX A;  3SJH A;  3VEW A;  3C95 A;  2P9P B;  5FDL A;  3U4L A;  1RBU A;  4C1N I;  1KFS A;  3T69 A;  4MO5 A;  1VSH A;  4MLH A;  1E3M A;  5CR4 A;  1OKJ A;  5F2R A;  2OCE A;  3O9T A;  3QET A;  2YHA A;  1S22 A;  1MWK A;  2D0A A;  3O08 A;  4GV9 A;  4ISF A;  4CF9 A;  3MWP A;  4B3S K;  5AZI A;  3O8M A;  3LZI A;  2ZF5 O;  3WNF A;  4OKJ A;  3CFR A;  1QZ5 A;  4CHO A;  2CGL A;  3WXM B;  2IGI A;  3VTH A;  3AO5 A;  3PIP L;  3OVN A;  3C6A A;  4XH4 A;  1S3X A;  5JLF A;  3F73 A;  3SAH A;  3ZT3 A;  4CJ4 A;  1NK7 A;  5ADX H;  5E41 A;  1BOT O;  4JRP A;  1C1B A;  1XUP O;  3LM2 A;  1YJ9 N;  3OYF A;  1XQS C;  5LJW A;  4E7I A;  4BRC A;  4KHN A;  4KRE A;  2E88 A;  3LZJ A;  1L5U A;  4LY7 A;  4FWR A;  2XY5 A;  2Q31 A;  3WEE A;  3QEW A;  1YTA A;  5C25 A;  3RRG A;  1NK5 A;  4NCA A;  3CFO A;  1QZ6 A;  3BF1 A;  1HNZ K;  3P4I A;  3B6O A;  2P9N A;  2OAN A;  1VK0 A;  1NJZ A;  1LV5 A;  4JK9 A;  4DQP A;  4FYD A;  1JLQ A;  3SAF A;  4CES A;  1WUA A;  3H6E A;  3K5M A;  3R9P A;  1WB9 A;  1RDW X;  2BH1 A;  4FW1 A;  1Q7Y O;  3NFA A;  1VQM N;  1T44 A;  1Q81 O;  3RMC A;  1J5E K;  4JKG A;  3WNH A;  1FJG K;  5AQL A;  1ESV A;  4M3Z A;  1OH6 A;  2VG7 A;  3CC7 N;  4DR2 K;  3IFR A;  3RR8 A;  5EU7 A;  4JI5 K;  2YHX A;  4J2D A;  2EX3 A;  5AFU A;  3DRP A;  4IFY A;  1RT3 A;  4BE2 A;  4FOE A;  4QS9 A;  4O8U A;  5HBM A;  1CZA N;  4ILJ A;  3KZB A;  1GLJ O;  1U47 A;  1XNQ K;  4JI1 K;  4LF9 K;  3RSE A;  4X64 K;  4LFB K;  1U2V B;  2HNZ A;  3AVC A;  2VWK A;  1BA0 A;  4FPA A;  4IFV A;  5C42 A;  4PL8 A;  3LAK A;  3ZX0 A;  2FBV A;  4IO9 L;  4K8Z A;  4FO0 A;  3L2Q A;  4N41 A;  4CJU A;  3P38 A;  4JS5 A;  3FZH A;  2DY4 A;  1W9H A;  3TAM A;  3SAG A;  1JLB A;  4WFN L;  2O8D A;  4DSI A;  2O8F A;  5AFU H;  2PY5 A;  2D5R A;  4M3Y A;  2HHU A;  2V52 B;  2YI1 A;  3AVG A;  4CJQ A;  3PX0 A;  4W5T A;  5KQ8 A;  2A40 A;  4JKB A;  1QS4 A;  4KKO A;  1YTU A;  3LP2 A;  4DR1 K;  3VQQ A;  2A3Z A;  1S5J A;  3NF7 A;  5EVZ A;  4CEO A;  4U7B A;  3T3F A;  1EWR A;  4CK3 A;  4PHT X;  3V9S A;  3G25 A;  2I7N A;  2D0O A;  4KHS A;  5EOY A;  1K8K B;  1IKX A;  4KH4 A;  3D2F A;  5CHI A;  1ASW A;  4AM7 A;  1CZ9 A;  4BRG A;  4BWM A;  3RVC A;  1T05 A;  2YX6 A;  3R8E A;  1ILY A;  4JKC A;  4CW7 B;  3D0P A;  1RBV A;  4RTF D;  2WC9 A;  3M6G A;  3VN5 A;  1WAF A;  4CFD A;  3LDL A;  3BP8 A;  3OBY A;  3J7Z O;  3NGI A;  5HRN A;  4DTS A;  4CK2 A;  3TTF A;  2P9I B;  4F3T A;  2IDO A;  4BRA A;  3H3O B;  3LAN A;  1HYV A;  4FJ9 A;  4FWN A;  3CI5 A;  2B4J A;  3D2E B;  4YOY A;  4CZM A;  5SZT A;  3OJS A;  4DSL A;  2FXU A;  5AQM A;  4LH5 A;  1KVA A;  2R7Y A;  4BE0 A;  2JGU A;  4JKD A;  2D0B A;  3AO3 A;  1CXQ A;  3NAE A;  4BY9 C;  1NWK A;  4A61 A;  2QWN A;  2YCH A;  5BPN A;  4K42 A;  1HNV A;  4YHH K;  3SV4 A;  2O8B B;  3GE1 A;  1JL2 A;  2VQF K;  5GAH P;  1QSS A;  2E20 A;  1VQL N;  3ID6 A;  3MX2 A;  4FLW A;  4B9M A;  1OVY A;  5DM7 L;  2VGM A;  1TVR A;  4YNQ A;  3ZSW A;  4C8O A;  4PWD A;  3D6R A;  2UXB K;  5E26 A;  4ZTJ A;  4KPY A;  1T6C A;  2VGN A;  4RW4 A;  5BRH A;  3E66 A;  2WON A;  1S6Q A;  2DPN A;  4IBN A;  3TAB A;  4J2A A;  1HYZ A;  4IDK A;  4NCB A;  2X6N A;  1VSF A;  2ASM A;  1V4S A;  1W0H A;  3VA0 A;  2IVP A;  4FWP A;  1WBD A;  2E2N A;  2LSN A;  3ZSX A;  1YT3 A;  4HTU A;  4WFA L;  3AY9 A;  3BEX A;  1HKB A;  1TKX A;  3EZW A;  4KTW A;  4NYN A;  5AQP A;  3L6Q A;  4FK2 A;  2E2Q A;  2X6S A;  3SUQ A;  5KPT A;  1FXX A;  4HWI A;  2ITG A;  2KLA A;  1GLB G;  3M3Z A;  3KWI A;  3ULE B;  2Q97 A;  1QQM A;  5K14 A;  1X9S A;  4ISE A;  3RMB A;  2HBK A;  5HRR A;  4PY5 A;  1GLL O;  1B92 A;  4F4K A;  4KAZ A;  1DLO A;  2O8C B;  4YOU A;  4E7L A;  4YOT A;  1WSF A;  4C8M A;  2A42 A;  4LF8 K;  3WUH A;  1K6Y A;  4DB3 A;  1TV6 A;  1G99 A;  1RDC A;  4M7X A;  2WUS A;  4CGD A;  1I39 A;  4GV3 A;  1VSI A;  2HOE A;  3VQ8 A;  4CIF A;  5M1K A;  2YKN A;  3OS0 A;  3WQT A;  3OYN A;  1R59 O;  3NF9 A;  4F8R A;  3AVA A;  4CIG A;  4B8C A;  3TSP A;  1ASV A;  4FJN A;  3RR7 A;  3NH1 A;  2VWJ A;  4HUF A;  4FK4 A;  3C94 A;  3HPO A;  5M1P A;  2VWB A;  4AF1 A;  1D9F A;  4AQY K;  1BIU A;  3EZ5 A;  3SUO A;  4N5S A;  3O5B A;  3I56 N;  4CCH A;  3G4S N;  1NGB A;  3QIP A;  3DLE A;  4CF2 A;  1S1W A;  4BRE A;  1S9E A;  4EHT A;  2QWO A;  2J4R A;  4IOA L;  4QS8 A;  4E1J A;  3TWH A;  4JI0 K;  4H5V A;  4NYF A;  5FPD A;  3DLL L;  4GVM A;  1ZBU A;  4AHC A;  3O3F A;  3SPY A;  4DV2 K;  4PQU A;  5MLC Q;  3PV8 A;  2HST A;  4FLV A;  2D0P A;  4DG1 A;  1HKG A;  3G0Z A;  1L3U A;  3CCV N;  1ATR A;  3WXL A;  2NNW A;  3EKU A;  3OYC A;  3TAR A;  3RWU A;  3UKR B;  1RT6 A;  4AHR A;  4TSX A;  2PAV A;  3THY A;  4MO4 A;  4OLB A;  4JKH A;  3AVB A;  1NK0 A;  2FBT A;  3DOK A;  2ZE2 A;  3SZ2 A;  3DLB A;  4FWK A;  1RDA A;  3VQP A;  3C6H A;  1X9J A;  2GUP A;  4I9L A;  3HM8 A;  1XHX A;  3HK2 A;  1SL0 A;  1JLA A;  2QK9 A;  1TAU A;  2OPP A;  2UUA K;  5FRO A;  3FFK B;  2V51 B;  2YNG A;  3A5N C;  1HLU A;  2GUI A;  4MDA A;  1RDD A;  5J1E A;  2DFE A;  1TGO A;  2OTJ N;  3AGK A;  4ILH A;  4CZH A;  4FWO A;  4BGB A;  3OJU A;  3HOS A;  2XRI A;  2P9L A;  1MU2 A;  4JHD A;  3M8S A;  4DF8 A;  4FM0 A;  1JXE A;  5AZJ B;  3CQ8 A;  3F5T A;  4Z0U A;  1TKT A;  2DFH A;  4QCL A;  3CCE N;  2O8E A;  3VGM A;  3CYM A;  4CZJ A;  4FJI A;  2Q0U A;  3LM9 A;  3WXI A;  3TTD A;  3LWL A;  4LFA K;  1RT1 A;  2A6A A;  4BR0 A;  5A2Q O;  4XIU A;  4DV7 K;  4BRM A;  1ZBL A;  4L8R B;  3LPU A;  4M3R A;  2GTD A;  3IAY A;  4Z4G A;  3GDQ A;  3WEE B;  3NE6 A;  4Y1C A;  1Q9X A;  1RT2 A;  2AP1 A;  1NMD A;  1JCG A;  1BQM A;  4A2B A;  4CZL A;  4BRF A;  2KFN A;  4IEE A;  1EP4 A;  3JYT A;  3P39 A;  3NF6 A;  4Z4F A;  3ZET B;  4CJ7 A;  4LF4 K;  4B1V A;  1BU6 O;  3GL1 A;  4K0K K;  3ITH A;  1Z26 A;  4KB0 A;  3CM5 A;  4CJ3 A;  1WBB A;  2HHV A;  1RTH A;  1RDU A;  4IWV A;  5TKY A;  2P5O A;  2X78 A;  1QTM A;  3EE9 A;  3AA4 A;  4Z4E A;  3QES A;  1WNS A;  1IV0 A;  3WXJ A;  4DTX A;  4IDH A;  2CH6 A;  1EWQ A;  3EYZ A;  4KI6 A;  1KXP A;  3L0Q A;  1YUW A;  3RSE B;  1MDU B;  3WNE A;  1ZC6 A;  4GNI A;  1FKP A;  1XC3 A;  4IKF A;  3E9L A;  1IBL K;  1GLC G;  4A5A A;  4H0T B;  4KH6 A;  1A5V A;  4OJR A;  2ITM A;  2ZWH A;  2YNH A;  3EEQ A;  3K5L A;  2HHT A;  2KZM A;  1S72 N;  4Y1D A;  4DF4 A;  4H5R A;  3DXM A;  4DS4 A;  5ELZ A;  3PSF A;  2IAJ A;  2NRR A;  5AJ3 K;  3LWM A;  1BHL A;  1KAX A;  4FL9 A;  3CCQ N;  4DTR A;  2VYP A;  4CJL A;  5BN8 A;  3CCL N;  2O8D B;  5J2Q A;  2P9U A;  3GBT A;  2HHX A;  1OH8 A;  3H1V X;  5JMV A;  3SK3 A;  4BE1 A;  5JIC A;  2GWK A;  1YI2 N;  4DCH A;  3I0R A;  3VQA A;  3IKM A;  3I0S A;  3ALY A;  3DLG A;  1RGI A;  4G9Z A;  3CIP A;  3L8B A;  1NGA A;  3UKU A;  3QER A;  3AGR A;  4Z4H A;  4DTM A;  4DFM A;  3AVJ A;  3V4I A;  5KI6 A;  1NG9 A;  1LAV A;  3H1Q A;  1RTI A;  4CER A;  4CEB A;  3QIC A;  4B3M K;  1ZBF A;  5BRE A;  4KV8 A;  4U67 L;  1NGJ A;  3O3H A;  3NBP A;  3MX5 A;  4YOR A;  3E9P A;  2NRT A;  3AVF A;  4CEQ A;  3HM9 A;  4M63 C;  2PZS A;  3ZEU B;  2GWJ A;  3OYJ A;  4M3T A;  3VEV A;  3M8R A;  5HLF A;  4DSE A;  5CE3 A;  1FW6 A;  5KRT A;  1S1X A;  4R79 A;  3FE1 A;  3DXK B;  3J80 O;  3KD5 E;  3ZYY X;  4C8N A;  3CJC A;  2A1S A;  5KTQ A;  5EX5 A;  3DOL A;  5T7B A;  4DTU A;  5CYM A;  3J7A P;  4B1W B;  1EET A;  1VQ9 N;  4HUE A;  4YOV A;  1NJI O;  2HHS A;  4CZG A;  4EHU A;  4O8K A;  3CCS N;  3MN5 A;  5KPZ A;  1NOY A;  4FLT A;  3ENB A;  4DU3 A;  1SS6 A;  4O0I A;  2D1K A;  4Y0W A;  3OTO K;  3HZ6 A;  2QI2 A;  1WSI A;  2NRV A;  1VSK A;  1D5A A;  1TYQ A;  4OX9 K;  2EHG A;  4QAG A;  1SKW A;  1BGX T;  4G1Q A;  4FWM A;  4IZ9 A;  3VEN A;  3VQD A;  4FM1 A;  4E7J A;  2E1Y A;  4CD1 A;  2E8A A;  5GAE P;  3KKR A;  3QIN A;  4ICL A;  4PKH A;  3TSQ A;  3LDN A;  2HVH A;  1TUY A;  3HP9 A;  4KHQ A;  4OO1 J;  3O9S A;  3HVT A;  1KSP A;  3LP3 A;  2UU9 K;  1QE1 A;  4MDB A;  4LH4 A;  4CVN E;  1LWC A;  1BA1 A;  3ZSQ A;  2Q3S A;  4B1Y B;  3VPZ A;  2AA4 A;  5CZ2 A;  3HST B;  3A5M C;  4DUZ K;  1XI1 A;  3NVK A;  4JI8 K;  1C1A A;  1HMV A;  4JYA K;  2KTQ A;  3FFI A;  1BI4 A;  4JI4 K;  4DSF A;  3AO2 A;  1U49 A;  2AJQ A;  2IVO A;  3OA9 A;  5C2F A;  2ZJP L;  1KLN A;  3ZT2 A;  3MWT A;  3AVM A;  3SLC A;  3AAP A;  1IH7 A;  1VQ7 N;  4CZI A;  3SYZ A;  4FWL A;  4BDY A;  1BCO A;  3O1B A;  1D8Y A;  1ASU A;  4OPH A;  4CIE A;  2FSN A;  5AQQ A;  1DGK N;  1HPZ A;  1Z6R A;  1D4X A;  3VER A;  1NGC A;  3TAN A;  3R3L A;  3BY5 A;  4JK7 A;  2A5X A;  4JS4 A;  3L2U A;  2NRZ A;  4DKW A;  3OYL A;  3I8B A;  4CJP A;  2QWL A;  3OBW A;  3C7N B;  1HNI A;  3SQ0 A;  3CJ1 A;  4M3W A;  3L3U A;  3I33 A;  3J7Y P;  4WCE L;  1HRH A;  4DMN A;  4I7F A;  4FJ8 A;  2NUB A;  1P8Z A;  3CPW M;  1KAZ A;  2F4V K;  1P90 A;  4RG8 A;  1YJN N;  4H4O A;  2XY6 A;  1NKE A;  5AQX A;  2Q0R A;  1SV5 A;  1N5Y A;  4DV1 K;  2OPR A;  4I6M A;  3PIO L;  2X74 A;  4FWQ A;  2OPQ A;  1NU0 A;  3K9K A;  5IWA K;  1HR0 K;  4FLZ A;  4BVO A;  4DSJ A;  4R5P A;  1NNE A;  3HPG A;  2F96 A;  3AVH A;  3OYD A;  3LAM A;  1TK0 A;  1FK9 A;  2RHK A;  5AQU A;  4F3O A;  3MN9 A;  5HRO A;  2XHB A;  5AR0 A;  1GLF O;  2QTD A;  4RW7 A;  4DQQ A;  3FLC O;  3EY1 A;  1KRP A;  2P9K A;  3WNG A;  4H0Y B;  2Z1H A;  4BDP A;  1C0F A;  4W5R A;  2HHH K;  1OVQ A;  3HOT A;  1U6Z A;  5JVG L;  3KK3 A;  3NH0 A;  2HNY A;  2ZJR L;  4CEF A;  4IFE A;  3DM2 A;  1BWF O;  1ZXO A;  4CEZ A;  2ZD1 A;  1VQN N;  3KK7 A;  3QNO A;  4JRQ A;  4BR5 A;  1S1T A;  4CFA A;  3QFP A;  4JV5 K;  3CPE A;  1VQ4 N;  1RBS A;  1ZBS A;  4IJN A;  1IG9 A;  4GKJ K;  4Z4C A;  4WQ5 A;  3NHG A;  3ZSR A;  1U45 A;  1Q82 O;  1NBW A;  4NXM K;  3S9H A;  1VSL A;  4LF6 K;  4F2S A;  2UXD K;  3O9U A;  4EIA A;  4Z4I A;  4FJK A;  4FCY A;  3ZT4 A;  4FW2 A;  4AHT A;  3AVL A;  1QVG M;  4OGC A;  1SL2 A;  4JKF A;  1S6P A;  3CET A;  3OYK A;  1BIS A;  4GV6 A;  3OY9 A;  2IC3 A;  3T1Y K;  3WQU A;  1SKR A;  4BR7 A;  1KVB A;  2P9S A;  4IO8 A;  4FJL A;  4CHP A;  2ATQ A;  3WXK A;  2OZS A;  3Q7B A;  2P9P A;  1T7P A;  4AM6 A;  2FSK A;  3FZK A;  4FSV A;  4DV5 K;  4IOC L;  4WQ4 A;  2W40 A;  4BC4 A;  3TAG A;  5AQW A;  1C0M A;  2G8I A;  4A59 A;  1NK4 A;  3KK1 A;  3SI6 A;  3PO4 A;  4FZY A;  5AQO A;  1GOC A;  1T03 A;  3RMD A;  1NM1 A;  2E1Z A;  3MN6 A;  2HBM A;  4CFC A;  4DHY A;  4M45 A;  3PX6 A;  1EXQ A;  2QXF A;  3NDK A;  1I3A A;  2PBD A;  3CCJ N;  4EP4 A;  1UOC A;  3BDP A;  3C65 A;  3THW A;  4EZ6 A;  4CBU A;  3O9R A;  4CHQ A;  4B3O A;  1QQO A;  3OYM A;  1Y64 A;  3U9Z A;  3C6T A;  4BC2 A;  2P5G A;  4XH1 A;  3AO1 A;  4DTO A;  4CEC A;  4ZTF A;  1DKG D;  2FLO A;  4DR3 K;  2UUB K;  3G6E N;  4BRI A;  1IO2 A;  4LFC K;  3VGL A;  4BWJ A;  3HTV A;  4LF5 K;  4CGG A;  4JNE A;  4CFB A;  4CBX A;  4FWS A;  3FGU A;  4E1M A;  3KKS A;  3IUC A;  4FLY A;  4FZZ A;  3A2F A;  2JWK A;  4BVP A;  3DRS A;  3R6M A;  4DV0 K;  5LJV A;  1S1V A;  4WFB L;  2H3G X;  2RN2 A;  4A5B A;  4DR7 K;  3DMJ A;  3G10 A;  3SQ2 A;  3MDQ A;  1ZYQ A;  1KAY A;  1UA1 A;  2W41 A;  1E4F T;  1U2V A;  1ITG A;  3ZX2 A;  4CZF A;  1YIT N;  1LCU A;  2HMI A;  3K0S A;  3CJ7 A;  3E01 A;  2WTU A;  3OYH A;  2QXL A;  4KI4 A;  4IXC A;  1XWL A;  3QEX A;  1HJR A;  2G8H A;  3VOV A;  3OYA A;  1RBR A;  3IS9 A;  3K57 A;  4CED A;  4BRH A;  3BUZ B;  1KFD A;  4O0J A;  1LOT B;  2QA4 N;  2E2P A;  5C12 A;  1B9F A;  2P9U B;  1N34 K;  3VQ4 A;  3LPT A;  5BPM A;  1JL1 A;  3J81 O;  3PX4 A;  5BRD A;  3SJJ A;  3OYG A;  4JD2 B;  3LAL A;  3NH2 A;  4MLE A;  2KZZ A;  3CQX A;  1JKH A;  2KW4 A;  1XNR K;  1N32 K;  1N8R O;  3WT0 A;  5SWM A;  4KHU A;  1BO5 O;  4FLU A;  1O1W A;  1K8K A;  2GV9 A;  1J9A A;  5AQZ A;  3EN9 A;  2CH5 A;  4BGA A;  3RTV A;  4RWT A;  1QQN A;  4DU4 A;  2HW3 A;  2WOM A;  4CI6 A;  4H0X B;  3THX A;  1SAZ A;  1A5W A;  1TUU A;  3LDO A;  4V19 S;  1X9W A;  3KHY A;  3HL8 A;  4HHT A;  3KD1 E;  3S3M A;  1J53 A;  2E2O A;  2HBL A;  2NRX A;  4W5O A;  4FJ5 A;  2P9I A;  4H4M A;  3SMP A;  1NJY A;  1VSM A;  1D9D A;  3CC4 N;  5KRS A;  1UA0 A;  5HOO A;  4BRQ A;  3IRX A;  5BPL A;  3D2E A;  4OVL A;  4ZHR A;  4ELV A;  3PO5 A;  3SBG A;  1REV A;  3VET A;  4NB4 A;  3AA2 A;  1S9G A;  1JLC A;  3CCM N;  3SBT A;  4CGF A;  2QWQ A;  3MEG A;  4M7Y A;  3NMU A;  3KWG A;  5AZI B;  1RCH A;  4RCH A;  2F9W A;  1TK8 A;  3D45 A;  3EO3 A;  1GLD G;  3CME N;  3B8A X;  4IOX A;  3NF8 A;  3LDQ A;  4YDU A;  4C8K A;  1N33 K;  4DTP A;  4DWI A;  2YJE A;  2I5J A;  3H3N O;  3O4N A;  3JAM O;  5F1X A;  4BR9 A;  4BDZ A;  4J8F A;  4B1U B;  3HJF A;  2BDP A;  4FVU A;  1Z05 A;  4JI2 K;  1VQO N;  3OW2 M;  4WYB A;  1IG8 A;  3K9J A;  4B9S A;  3P83 D;  1DTT A;  1GOB A;  2YV0 X;  1NMN A;  1QHT A;  4OPA A;  2VG6 A;  3CJ9 A;  4B9U A;  3B6P A;  4IJA A;  5FPM A;  1VQ5 N;  5C2D A;  2P9N B;  3K5O A;  1YVU A;  4MFB A;  3ZSV A;  4H0V B;  2G8V A;  5BRF A;  4WE1 A;  3M1F A;  2G8W A;  4HCC A;  4X65 K;  3SPZ A;  1L3V A;  3FR0 A;  5M1N A;  4JKG B;  3L2W A;  1NLV A;  4XEI A;  4K8X A;  5FRN A;  4CJK A;  3ATU A;  3LL3 A;  3MAQ A;  3O1W A;  4BC3 A;  3VQB A;  4I2P A;  2ETJ A;  4O55 A;  4FJH A;  1JLE A;  5BN9 A;  4H8K A;  4M3X A;  5LL6 Z;  3PSI A;  4JI7 K;  1J5O A;  3F2K A;  4ELU A;  3KK2 A;  3ULE A;  2YHY A;  2QW9 A;  2F9T A;  3H45 C;  3C0B A;  2HVI A;  3NGY A;  3PY8 A;  1NK6 A;  3DLR A;  3CG7 A;  1HYS A;  3SUP A;  3NVM A;  5EXW A;  3A5L C;  4KRF A;  4FJG A;  4JLH A;  4DQR A;  2HND A;  3VTI A;  4FXD A;  1A5X A;  2OPS A;  3J8A A;  2Y1J A;  3VMF B;  2O8F B;  3TAQ A;  1TKD A;  3QB0 A;  4ILG B;  1RTD A;  1KTQ A;  2OYQ A;  3N4Q A;  1TL3 A;  4BR2 A;  5GIN A;  3TU5 A;  3MMV A;  1RFQ A;  4DS5 A;  4B3R K;  4CZE A;  2VCP A;  3ZX3 A;  3O4W A;  4JN4 A;  1ZBH A;  2BUP A;  2QKK A;  3MK6 A;  1VSJ A;  3VQ9 A;  3HBT A;  1T8E A;  1HPM A;  4EFH A;  3KLE A;  4PA1 A;  1KCF A;  1GLA G;  3OHR A;  3D2F B;  2HHQ A;  3V9Z A;  3AO4 A;  3V1R A;  3O6W A;  2V7Z A;  4K43 A;  3ZT0 A;  3K5N A;  3MXM A;  3DI6 A;  2GEL A;  1J54 A;  4CGJ A;  2IOC A;  2HMP A;  1C6V A;  1WLJ A;  3MEC A;  5JLH A;  2KFZ A;  1WSH A;  1Q8I A;  3BF3 A;  4JAX A;  3OYB A;  4W5Q A;  3SCX A;  3MCP A;  3GOI A;  3IDH A;  4DU1 A;  1X3M A;  4KFB A;  4A57 A;  2G8K A;  1K9M O;  4E0D A;  2D0C A;  1WSJ A;  4FJX A;  1NGE A;  3U6F A;  1VAZ A;  4M42 A;  3IMX A;  4GY2 B;  4NLB A;  1CXU A;  4DQS A;  1H1V A;  4FM2 A;  3G71 N;  1N6Q A;  1W2B M;  2E6L A;  1YF5 L;  4H5W A;  1BIZ A;  2ASO A;  2HB5 A;  3QBW A;  3K58 A;  3K59 A;  3DLH A;  5FPE A;  3HSC A;  5EY4 A;  5FLX O;  4WF9 L;  4NO7 A;  2UUC K;  3EE8 A;  5J2P A;  3QBX A;  5DK5 A;  1IKY A;  4HUG A;  5JS1 A;  2B5J A;  1JCE A;  1LW2 A;  3DJC A;  2G8U A;  1SQK A;  3M5R A;  3LDP A;  2F7T A;  1SZ2 A;  5C15 A;  3TAE A;  5AZJ A;  4O44 A;  3AAQ A;  1JJ2 M;  3EKS A;  4J2B A;  5KGW A;  4F9O A;  3RMA A;  2ZJQ L;  3O3G A;  4B9L A;  2RKI A;  4YFU A;  3HPH A;  4GMJ B;  4DFK A;  2QEX N;  3NGZ A;  3KLH A;  1EX4 A;  4M3U A;  3DRR A;  3P31 A;  3THW B;  1U4B A;  5DMR A;  1TL1 A;  1KD1 O;  4HCB A;  4CJS A;  4F2R A;  3QML A;  4JK8 A;  1U48 A;  3N4P A;  3DAW A;  2PFU A;  4GKK K;  2XY8 A;  3L3V A;  3M8Q A;  5C0Y A;  1Q86 O;  3VEY A;  2HHW A;  1IKV A;  4E7K A;  2VG5 A;  3ATV A;  1HKC A;  3K2P A;  5AQK A;  4KHP K;  1LW0 A;  3ZET A;  3HT3 A;  1LAW A;  4DUY K;  5C24 A;  1RIL A;  3O4Q A;  3SQ4 A;  4I2Q A;  2CGJ A;  1SUQ A;  4KHW A;  1VSE A;  1K8A O;  1ATS A;  3VQ6 A;  1IKW A;  5AQG A;  5LMU K;  3HYF A;  3DYA A;  4ID5 A;  5M1Q A;  2ZGY A;  3QLH A;  4LSN A;  2FF6 A;  1NGI A;  2QM1 A;  4B9N A;  4Z94 A;  1XMO K;  3HO1 A;  3ENH A;  3TI0 A;  4DSK A;  1QSL A;  4FJJ A;  1YIJ N;  3T1A A;  4Q0B A;  1JLF A;  4X66 K;  4O4G A;  1OH7 A;  5FRM A;  3PLA A;  3CJB A;  4C23 A;  3SUN A;  3H46 O;  1HNX K;  2V7Y A;  4CJR A;  1Q18 A;  4A62 A;  1VSD A;  2ZM6 K;  3JS6 A;  2D4W A;  1VHX A;  4J2E A;  3V81 A;  4CHN A;  1ATN A;  3ZSO A;  1YAG A;  3UE5 A;  1L3T A;  1W97 L;  4ISG A;  2A1R A;  4PKG A;  4CEE A;  3UB5 A;  3O80 A;  2OA8 A;  4KTZ A;  4MQ3 A;  4N47 A;  3O9Q A;  2NRW A;  3VEO A;  4CBW A;  3FZM A;  4K25 A;  4FLX A;  3H08 A;  1V4T A;  4DV6 K;  1C1C A;  1LWF A;  3QDK A;  4IEI A;  1W7A A;  2O4I A;  5I42 A;  1VQK N;  4BG9 A;  2KKZ A;  3HXM A;  3AV9 A;  5GAD P;  3OS1 A;  4FVM A;  2FF3 B;  2UXC K;  5B8H A;  4H5T A;  4CJE A;  3VEX A;  3U3G A;  3LDS A;  4ID1 A;  4FOI A;  3CCR N;  2JLE A;  1G15 A;  3JSM A;  2BTF A;  2I7P A;  5JS2 A;  5H1S Q;  3KLG A;  3QFU A;  4E19 A;  4UY8 O;  4CHY A;  3THY B;  3V1Q A;  3L2R A;  3OYI A;  3KJV A;  2QWP A;  1Q9Y A;  3CM6 A;  3THV A;  4CHZ A;  1VQ6 N;  5AQT A;  3E1Y A;  5LMN K;  1K73 O;  4FPB A;  4RW9 A;  2PYJ A;  4JI6 K;  1NKB A;  1L3S A;  2EWS A;  2RF2 A;  1XHZ A;  1SKS A;  3THX B;  5M1O A;  2W42 A;  1RTJ A;  1HUX A;  3ZEU A;  1RBT A;  4JI3 K;  4AHS A;  3BZK A;  2Y1I A;  3AA3 A;  4DQ8 A;  4NLC A;  1JCF A;  4BRK A;  3DXK A;  5KQD A;  4DFP A;  2QKB A;  4FK0 A;  4L3Q A;  2KHO A;  2HF3 A;  1VRU A;  5HL7 L;  1JXB A;  3QEP A;  4KO0 A;  2BAN A;  2Q36 A;  3BGR A;  5GIO A;  3VQ7 A;  4DFJ A;  1C0U A;  3VF4 A;  3SMS A;  1NKC A;  4UQG A;  4JHD B;  2P9L B;  5AQF A;  5J2N A;  3ZSZ A;  1WSG A;  3S3N A;  2F8S A;  3W3D A;  1MA9 B;  1NOZ A;  2YNI A;  1KLM A;  5J2M A;  1EO1 A;  5AQI A;  1QQC A;  1S1U A;  3HVR A;  2O8E B;  4LC9 B;  4HTL A;  4DTN A;  1DTQ A;  1NGF A;  2FC0 A;  3E9O A;  4CF8 A;  2ASP A;  3ZLJ A;  5F0X A;  3V9X A;  2HF4 A;  1BUP A;  3CFP A;  3MXJ A;  1UWB A;  1B9D A;  4BQL A;  1NK8 A;  1BCM A;  3F9M A;  1VRT A;  4PKI A;  3TPQ A;  4CJT A;  4JEP A;  4JKA A;  4N56 A;  5CY4 A;  1C0G A;  4FJM A;  1HX1 A;  3RRH A;  2VQE K;  1U04 A;  4CD3 A;  3CMA N;  3TTC A;  2YKM A;  4EAH D;  4LD0 A;  4E3S A;  3AVK A;  4AHU A;  5M1F A;  3MN7 A;  1IJJ A;  1WSE A;  4M41 A;  4BRP A;  4H5N A;  3VGK A;  4B9Q A;  4CF0 A;  4BC5 A;  3DLK A;  3TR8 A;  2E6M A;  4WQ5 C;  4OKK A;  2YHW A;  5HRP A;  4BG8 A;  3L4I A;  4JKE A;  5E84 A;  2BGG A;  1TKZ A;  3AA5 X;  4DR5 K;  3UIQ A;  3C7N A;  4DR6 K;  1X9M A;  4LSL A;  1X1P A;  3QEI A;  1CZB A;  1X3N A;  2KQ2 A;  3AVI A;  2Z1J A;  4B08 A;  3U8X A;  5AQR A;  3CJA A;  5AQV A;  1J6Z A;  2E4L A;  3LP1 A;  1QHA A;  2B6A A;  1GOA A;  3KIO A;  3SQ1 A;  4CJ5 A;  4LF7 K;  3DXM B;  4H03 B;  2E5L K;  1F21 A;  3P1G A;  4DV3 K;  4AHV A;  4DQI A;  4E1N A;  1WOQ A;  1YHQ N;  3L2V A;  3M8P A;  4CE9 A;  2JWL A;  4DTJ A;  4OKE A;  4BR4 A;  1QVF M;  2FBX A;  2O4G A;  4IG3 A;  4O5B A;  3VQE A;  2XO7 A;  3T1H K;  4B8A B;  2P1J A;  2OTL N;  4WQ4 C;  1HNW K;  3PUF A;  5GAG P;  4EZ9 A;  3MXI A;  4NCG A;  4FZX C;  4C8L A;  3MEE A;  1OH5 A;  2HBJ A;  2UYT A;  4HVJ A;  4X62 K;  1YJW N;  4KB1 A;  1WN7 A;  1T3V A;  3S41 A;  3UKU B;  1NJX A;  2Z1G A;  3T19 A;  4CGI A;  3AVN A;  2IIR A;  3CD6 N;  2WBN A;  3V1O A;  4KH5 A;  3A5O C;  4QS7 A;  4OLA A;  4B1X B;  2IS3 A;  3P5J A;  4BQZ A;  1RT5 A;  3LP0 A;  4YY3 K;  4BRO A;  3HP6 A;  1BQN A;  1NGG A;  5CYQ A;  3TAF A;  4Q5V A;  4GW6 A;  4OPK A;  2DFF A;  3I8D A;  2WFB A;  4BRD A;  1NGD A;  3F9K A;  5AQN A;  1HJO A;  1BDG A;  2G8F A;  4W5N A;  5IT9 O;  4QOZ B;  3VEZ A;  4DR4 K;  2ZQB A;  3QO9 A;  3KLF A;  3U9D A;  5LY3 A;  1GLE G;  4IG0 A;  3ZCM A;  3VA3 A;  4E7H A;  2OZM A;  5C10 A;  4B9V A;  3GG4 A;  2XY7 A;  4AH9 A;  2W6K A;  5KGX A;  1KC8 O;  5HRS A;  3T7Z A;  1UAX A;  3NCI A;  3BZC A;  1LWE A;  4N76 A;  1RT7 A;  1TYQ B;  3VES A;  4K41 A;  1TK5 A;  3ZSY A;  2O8B A;  5FPN A;  3CC2 N;  2YNF A;  4H0O A;  3IG1 A;  3QEV A;  1VQP N;  4CZK A;  2YHB A;  2YJF A;  3VQC A;  4EP5 A;  1Z25 A;  3Q7C A;  3KLI A;  3AAR A;  4C1N K;  1NJW A;  1BL3 A;  4PL7 A;  2F8T A;  3CQY A;  2A41 A;  2QWR A;  1XMQ K;  4KHY A;  1EKE A;  3A8Y A;  3TAP A;  1BI4 B;  4CF1 A;  1O13 A;  4RW6 A;  5AQH A;  1VQ8 N;  3I55 N;  4BRN A;  1R0A A;  4I9Q A;  3FZL A;  2QWM A;  1M90 O; 
#chains in the Genus database with same CATH homology
 2Z1I A;  2B5J A;  1LW2 A;  3OS0 A;  3ZSR A;  1U45 A;  4CJV A;  3OYN A;  3NF9 A;  2G8U A;  4F8R A;  3AVA A;  4CIG A;  4B8C A;  3S9H A;  5HP1 A;  1VSL A;  2P51 A;  3TAE A;  4BAC A;  3U3Y A;  4F2S A;  3MED A;  4O44 A;  1ASV A;  4FJN A;  3RR7 A;  3NH1 A;  2VWJ A;  1HQE A;  4HUF A;  4FK4 A;  3C94 A;  5CZ1 A;  3HPO A;  1D9F A;  4J2B A;  4Z4I A;  5KGW A;  4FJK A;  3RMA A;  1BIU A;  4FCY A;  3ZT4 A;  3EZ5 A;  3O3G A;  3SUO A;  4B9L A;  2RKI A;  4FW2 A;  4AHT A;  3AVL A;  4OGE A;  4YFU A;  4N5S A;  1QSY A;  1CLQ A;  3HPH A;  4GMJ B;  4DFK A;  4OGC A;  4CCH A;  3NGZ A;  3KLH A;  4KTQ A;  1EX4 A;  4M3U A;  3QIP A;  3DRR A;  3DLE A;  3OYK A;  1S6P A;  4CF2 A;  1S1W A;  1U4B A;  1SL2 A;  1BIS A;  5DMR A;  1TL1 A;  1S9E A;  3OY9 A;  3S3O A;  1NK9 A;  4HCB A;  2IC3 A;  4CJS A;  3TWH A;  4F2R A;  4NYF A;  4GVM A;  1ZBU A;  4AHC A;  4E89 A;  3O3F A;  1SKR A;  1U48 A;  3SPY A;  1KVB A;  4AIL C;  4PQU A;  2XY8 A;  3PV8 A;  4FLV A;  4FJL A;  3L3V A;  4CHP A;  1KVC A;  3M8Q A;  3OS2 A;  5I3U A;  2ATQ A;  3V9U A;  4DG1 A;  3G0Z A;  2OZS A;  4RW8 A;  2HHW A;  1IKV A;  1L3U A;  4E7K A;  1T7P A;  2VG5 A;  3V6D A;  3TAG A;  3K2P A;  4CEA A;  4CGH A;  3C6U A;  3OYC A;  3TAR A;  1LW0 A;  3RWU A;  1RT4 A;  1RT6 A;  1C0M A;  1HQU A;  4AHR A;  1NK4 A;  4TSX A;  2G8I A;  3HT3 A;  3KK1 A;  1JLG A;  3SI6 A;  1LAW A;  4OLB A;  3PO4 A;  3AVB A;  4FZY A;  1GOC A;  5C24 A;  1RIL A;  1T03 A;  3RMD A;  3O4Q A;  1XC9 A;  3SQ4 A;  4I2Q A;  2FBT A;  3DOK A;  1NK0 A;  2ZE2 A;  3ASM A;  4CFC A;  3SNN A;  1SUQ A;  4M45 A;  3PX6 A;  4KHW A;  1VSE A;  2FBY A;  3SZ2 A;  3DLB A;  1EXQ A;  3VQ6 A;  2QXF A;  3NDK A;  1I3A A;  2GBZ A;  1IKW A;  1RDA A;  1WAJ A;  3VQP A;  4CJW A;  3HYF A;  4EP4 A;  3DYA A;  4ID5 A;  1UOC A;  3BDP A;  4I9L A;  3QLH A;  4LSN A;  1XHX A;  4EZ6 A;  3HK2 A;  1SL0 A;  1JLA A;  4B9N A;  2QK9 A;  1TAU A;  2OPP A;  3HO1 A;  3TI0 A;  1RDB A;  4DSK A;  4CHQ A;  1QSL A;  4FJJ A;  3OYM A;  3QNN A;  4B3O A;  3T1A A;  4Q0B A;  3C6T A;  3VQ5 A;  2P5G A;  5FRO A;  1JLF A;  3AO1 A;  4DTO A;  3ULD A;  2YNG A;  4O4G A;  4CEC A;  4CJF A;  2GUI A;  3SUN A;  2PYL A;  5FRM A;  4ZTF A;  1RDD A;  4CJR A;  5J1E A;  1SL1 A;  2DFE A;  1C0T A;  1FKO A;  1TGO A;  1VSD A;  4DLE A;  1IO2 A;  1RNH A;  4BWJ A;  3SV3 A;  4CGG A;  3OJU A;  1ZBI A;  3KTQ A;  4J2E A;  2XRI A;  1MU2 A;  3M8S A;  4CFB A;  3V81 A;  4DF8 A;  4CHN A;  4FM0 A;  4E1M A;  3KKS A;  1JXE A;  3QIO A;  3ZSO A;  1L3T A;  2A1R A;  4FLY A;  4FZZ A;  2DTU A;  4CEE A;  3CQ8 A;  4Z0U A;  2OA8 A;  1TKT A;  3A2F A;  1TAQ A;  2DFH A;  4KTZ A;  3ISN C;  2RPI A;  4MQ3 A;  4N47 A;  4PUO A;  4QCL A;  3CYM A;  3DRS A;  4CK1 A;  2BE2 A;  4DLG A;  4FJI A;  4FLX A;  1S1V A;  3H08 A;  3LWL A;  1RT1 A;  1Y97 A;  4XIU A;  1C1C A;  3ZT1 A;  1LWF A;  2RN2 A;  2O4I A;  5I42 A;  4OPJ A;  3DMJ A;  3G10 A;  1ZBL A;  4L8R B;  4FJ7 A;  3HXM A;  3AV9 A;  3LPU A;  3SQ2 A;  3OYE A;  1ZYQ A;  3OS1 A;  4FVM A;  4M3R A;  3V9W A;  3IAY A;  4ELT A;  4Z4G A;  1UA1 A;  4B9T A;  5D3G A;  3NE6 A;  1ITG A;  4Y1C A;  4CJE A;  1Q9X A;  1RT2 A;  2HMI A;  3U3G A;  3C95 A;  3LDS A;  4ID1 A;  5FDL A;  1RBU A;  1KFS A;  1BQM A;  1VSH A;  3E01 A;  2JLE A;  1G15 A;  3JSM A;  5JS2 A;  3OYH A;  4KI4 A;  2KFN A;  3KLG A;  1EP4 A;  1XWL A;  4E19 A;  2YHA A;  3NF6 A;  3JYT A;  3QET A;  4CHY A;  2D0A A;  1HJR A;  3QEX A;  3V1Q A;  2G8H A;  4CF9 A;  3ITH A;  1Z26 A;  3OYI A;  3KJV A;  3L2R A;  1Q9Y A;  4KB0 A;  3CM5 A;  4CJ3 A;  3OYA A;  1RBR A;  3CM6 A;  3THV A;  3IS9 A;  4CHZ A;  4CED A;  3K57 A;  3LZI A;  2HHV A;  1RTH A;  1KFD A;  4O0J A;  4RW9 A;  3WNF A;  4OKJ A;  2PYJ A;  3CFR A;  1NKB A;  1L3S A;  2RF2 A;  4CHO A;  1XHZ A;  2P5O A;  1B9F A;  2X78 A;  2IGI A;  1QTM A;  3AO5 A;  3AA4 A;  4Z4E A;  1SKS A;  3QES A;  1WNS A;  3OVN A;  3VQ4 A;  3LPT A;  2W42 A;  1JL1 A;  1RTJ A;  3PX4 A;  4DTX A;  3F73 A;  1RBT A;  3ZT3 A;  4CJ4 A;  4AHS A;  1NK7 A;  5E41 A;  4JRP A;  1C1B A;  2Y1I A;  3EYZ A;  3OYF A;  3AA3 A;  4E7I A;  4KI6 A;  3SJJ A;  3OYG A;  4KHN A;  4DFP A;  3LAL A;  3NH2 A;  2QKB A;  4KRE A;  3LZJ A;  2KZZ A;  1L5U A;  4LY7 A;  2XY5 A;  3QEW A;  1YTA A;  4FK0 A;  5C25 A;  3RRG A;  3WNE A;  1NK5 A;  4NCA A;  1JKH A;  3CFO A;  1FKP A;  2KW4 A;  1VRU A;  1JXB A;  3QEP A;  4KO0 A;  3B6O A;  4IKF A;  5SWM A;  4KHU A;  2BAN A;  3BGR A;  1NJZ A;  1VK0 A;  4FLU A;  1LV5 A;  4DQP A;  1O1W A;  4FYD A;  1A5V A;  1JLQ A;  2GV9 A;  4OJR A;  1C0U A;  3VQ7 A;  4CES A;  2YNH A;  4DFJ A;  1NKC A;  4UQG A;  5J2N A;  1J9A A;  3ZSZ A;  3K5L A;  3K5M A;  2HHT A;  1WSG A;  2KZM A;  4Y1D A;  4DF4 A;  3S3N A;  2F8S A;  3RTV A;  4FW1 A;  1NOZ A;  3NFA A;  4DS4 A;  2YNI A;  1KLM A;  2IAJ A;  3LWM A;  5J2M A;  3RMC A;  1BHL A;  4DU4 A;  3WNH A;  4DTR A;  2HW3 A;  4CJL A;  2WOM A;  1QQC A;  5J2Q A;  1S1U A;  4M3Z A;  2VG7 A;  3HVR A;  2HHX A;  3RR8 A;  5EU7 A;  4DTN A;  1DTQ A;  2FC0 A;  4CF8 A;  4BE1 A;  1A5W A;  3V9X A;  4J2D A;  3I0R A;  2EX3 A;  1X9W A;  3VQA A;  3HL8 A;  4HHT A;  3DRP A;  4IFY A;  1RT3 A;  3CFP A;  3I0S A;  4BE2 A;  3KD1 E;  3S3M A;  1J53 A;  3MXJ A;  5HBM A;  1UWB A;  1B9D A;  3ALY A;  1U47 A;  3DLG A;  4W5O A;  1NK8 A;  4FJ5 A;  1BCM A;  4H4M A;  1VRT A;  3L8B A;  1NJY A;  1VSM A;  1D9D A;  5KRS A;  1UA0 A;  4CJT A;  3QER A;  2HNZ A;  3AVC A;  5CY4 A;  4N56 A;  2VWK A;  3IRX A;  4Z4H A;  4DTM A;  4DFM A;  3AVJ A;  3V4I A;  4IFV A;  4FJM A;  4OVL A;  5KI6 A;  5C42 A;  3LAK A;  4ZHR A;  4ELV A;  4K8Z A;  2FBV A;  3RRH A;  3PO5 A;  3L2Q A;  1LAV A;  4N41 A;  1REV A;  4CJU A;  3AA2 A;  4JS5 A;  2DY4 A;  1RTI A;  1S9G A;  1JLC A;  1U04 A;  1W9H A;  3TAM A;  4CER A;  4CEB A;  4CGF A;  2YKM A;  4LD0 A;  4E3S A;  3AVK A;  3MEG A;  1ZBF A;  1RCH A;  1JLB A;  4KV8 A;  4AHU A;  3O3H A;  3NBP A;  1TK8 A;  3D45 A;  1WSE A;  4M41 A;  4DSI A;  2PY5 A;  2D5R A;  3NF8 A;  4M3Y A;  4C8K A;  2HHU A;  4CF0 A;  3AVG A;  4DTP A;  4DWI A;  2I5J A;  4CJQ A;  3DLK A;  3TR8 A;  2E6M A;  3PX0 A;  3O4N A;  3AVF A;  4OKK A;  4CEQ A;  5HRP A;  3HM9 A;  4W5T A;  2PZS A;  4BDZ A;  3OYJ A;  3HJF A;  4M3T A;  2BDP A;  4KKO A;  1QS4 A;  1YTU A;  2BGG A;  3M8R A;  1TKZ A;  3AA5 X;  3LP2 A;  5HLF A;  4DSE A;  3UIQ A;  3VQQ A;  5KRT A;  3NF7 A;  1S5J A;  1S1X A;  4B9S A;  3P83 D;  1DTT A;  4CEO A;  1X9M A;  4LSL A;  3KD5 E;  3T3F A;  4C8N A;  1X1P A;  3QEI A;  2A1S A;  5KTQ A;  1GOB A;  2YV0 X;  4CK3 A;  1QHT A;  1CZB A;  3DOL A;  2VG6 A;  5T7B A;  5CYM A;  4DTU A;  2KQ2 A;  3AVI A;  3V9S A;  2Z1J A;  1EET A;  4B08 A;  4B9U A;  3B6P A;  4HUE A;  2HHS A;  4KHS A;  3K5O A;  1YVU A;  2E4L A;  1IKX A;  3LP1 A;  2B6A A;  1NOY A;  4MFB A;  4FLT A;  1GOA A;  3KIO A;  3ZSV A;  4DU3 A;  1ASW A;  2G8V A;  4WE1 A;  1CZ9 A;  2G8W A;  3SQ1 A;  4CJ5 A;  4HCC A;  4BWM A;  4O0I A;  1T05 A;  3SPZ A;  1F21 A;  3P1G A;  1L3V A;  4AHV A;  4DQI A;  1WSI A;  4E1N A;  1VSK A;  3L2W A;  1D5A A;  3L2V A;  3M8P A;  4CE9 A;  3D0P A;  2EHG A;  4DTJ A;  4OKE A;  4QAG A;  1SKW A;  1BGX T;  4G1Q A;  2FBX A;  4K8X A;  2O4G A;  5FRN A;  1RBV A;  4IG3 A;  3VQD A;  4CJK A;  4FM1 A;  4O5B A;  3VQE A;  2XO7 A;  4B8A B;  2P1J A;  4E7J A;  3MAQ A;  3KKR A;  3QIN A;  4ICL A;  3VN5 A;  5JS1 A;  1WAF A;  3VQB A;  4CFD A;  4I2P A;  3PUF A;  2ETJ A;  4O55 A;  4FJH A;  1JLE A;  4H8K A;  4M3X A;  2HVH A;  3HP9 A;  3NGI A;  4EZ9 A;  5HRN A;  3MXI A;  4NCG A;  1J5O A;  4FZX C;  4KHQ A;  4DTS A;  3HVT A;  3MEE A;  4CK2 A;  3KK2 A;  1KSP A;  4C8L A;  3LP3 A;  4ELU A;  4F3T A;  1QE1 A;  2IDO A;  4HVJ A;  4LH4 A;  1LWC A;  3LAN A;  1HYV A;  2Q3S A;  3ZSQ A;  4KB1 A;  1WN7 A;  1NJX A;  2Z1G A;  5CZ2 A;  3HST B;  3T19 A;  4FJ9 A;  3NGY A;  4CGI A;  2HVI A;  3PY8 A;  3AVN A;  1XI1 A;  2B4J A;  3OJS A;  5SZT A;  1HMV A;  1C1A A;  1NK6 A;  2KTQ A;  3DLR A;  3FFI A;  1BI4 A;  3CG7 A;  4DSF A;  1HYS A;  4DSL A;  3AO2 A;  1U49 A;  4LH5 A;  1KVA A;  3V1O A;  3SUP A;  2AJQ A;  2R7Y A;  4BE0 A;  3ZT2 A;  1KLN A;  4KRF A;  2JGU A;  3AVM A;  4FJG A;  2D0B A;  4JLH A;  3AO3 A;  4DQR A;  1IH7 A;  1CXQ A;  3NAE A;  4OLA A;  2HND A;  3SYZ A;  4FXD A;  2IS3 A;  3P5J A;  1A5X A;  2OPS A;  2Y1J A;  1RT5 A;  4BDY A;  1BCO A;  3TAQ A;  1TKD A;  1ASU A;  1D8Y A;  1HNV A;  4CIE A;  3LP0 A;  1RTD A;  1HPZ A;  1KTQ A;  3SV4 A;  2OYQ A;  3HP6 A;  1TL3 A;  1JL2 A;  1BQN A;  3TAN A;  5CYQ A;  3TAF A;  4Q5V A;  4Z4F A;  4GW6 A;  4OPK A;  1QSS A;  2DFF A;  4JS4 A;  3I8D A;  3L2U A;  4FLW A;  4B9M A;  3OYL A;  4DS5 A;  4CJP A;  3F9K A;  1TVR A;  4YNQ A;  3ZSW A;  1HNI A;  4C8O A;  4PWD A;  3SQ0 A;  1ZBH A;  4M3W A;  2G8F A;  4ZTJ A;  4KPY A;  4W5N A;  4RW4 A;  4QOZ B;  3L3U A;  2QKK A;  2WON A;  1S6Q A;  1VSJ A;  2ZQB A;  1HRH A;  3VQ9 A;  4IBN A;  4DMN A;  3TAB A;  3QO9 A;  3KLF A;  1T8E A;  4J2A A;  4I7F A;  4FJ8 A;  1HYZ A;  4IG0 A;  3ZCM A;  3KLE A;  3VA3 A;  4IDK A;  1KCF A;  2NUB A;  4PA1 A;  4E7H A;  4B9V A;  2X6N A;  1VSF A;  2OZM A;  4NCB A;  2XY7 A;  4AH9 A;  1W0H A;  3VA0 A;  4RG8 A;  4H4O A;  2LSN A;  3ZSX A;  2XY6 A;  2HHQ A;  3V9Z A;  3AO4 A;  1NKE A;  5KGX A;  1YT3 A;  4HTU A;  1SV5 A;  1N5Y A;  5HRS A;  2OPR A;  3V1R A;  1UAX A;  2X74 A;  3NCI A;  1LWE A;  3ZT0 A;  3K5N A;  3MXM A;  4N76 A;  2OPQ A;  1RT7 A;  3DI6 A;  1J54 A;  4CGJ A;  1TK5 A;  3ZSY A;  1TKX A;  2IOC A;  4FLZ A;  4DSJ A;  4KTW A;  4NYN A;  4R5P A;  1C6V A;  1WLJ A;  2YNF A;  3MEC A;  3HPG A;  1WSH A;  3IG1 A;  4FK2 A;  2KFZ A;  1Q8I A;  2F96 A;  3AVH A;  3OYB A;  4W5Q A;  3OYD A;  3SCX A;  3QEV A;  3LAM A;  4DU1 A;  1TK0 A;  1FK9 A;  2X6S A;  3SUQ A;  4F3O A;  2YHB A;  4KFB A;  5HRO A;  2XHB A;  3VQC A;  1FXX A;  2G8K A;  4RW7 A;  4EP5 A;  4DQQ A;  2ITG A;  1Z25 A;  4E0D A;  2D0C A;  1WSJ A;  3EY1 A;  1KRP A;  3KLI A;  3WNG A;  1X9S A;  4FJX A;  2Z1H A;  5K14 A;  3U6F A;  3RMB A;  1NJW A;  4BDP A;  1BL3 A;  4W5R A;  5HRR A;  4M42 A;  4PY5 A;  1B92 A;  2F8T A;  3KK3 A;  4F4K A;  4KAZ A;  1CXU A;  1DLO A;  3NH0 A;  4FM2 A;  4DQS A;  2HNY A;  1N6Q A;  4CEF A;  4KHY A;  4E7L A;  3DM2 A;  2E6L A;  1EKE A;  1WSF A;  4C8M A;  3TAP A;  1BI4 B;  1BIZ A;  4CF1 A;  2HB5 A;  3K58 A;  1K6Y A;  3K59 A;  3DLH A;  4CEZ A;  2ZD1 A;  1TV6 A;  4RW6 A;  1RDC A;  3QNO A;  4JRQ A;  4CGD A;  1S1T A;  4CFA A;  1I39 A;  1R0A A;  1RBS A;  1VSI A;  5J2P A;  3VQ8 A;  1IG9 A;  4CIF A;  5DK5 A;  4I9Q A;  1IKY A;  4HUG A;  2YKN A;  4Z4C A;  3NHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...