4IOXA

The structure of the herpes simplex virus dna-packaging motor pul15 c-terminal nuclease domain provides insights into cleavage of concatemeric viral genome precursors
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
255
structure length
225
Chain Sequence
PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTSDDLMVAVIMAIYLAAQAGPPHTFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tripartite terminase subunit UL15
publication title The Structure of the Herpes Simplex Virus DNA-Packaging Terminase pUL15 Nuclease Domain Suggests an Evolutionary Lineage among Eukaryotic and Prokaryotic Viruses.
pubmed doi rcsb
source organism Human herpesvirus 1
total genus 70
structure length 225
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioxA00
4IOXA 3N4PA 3N4QA
chains in the Genus database with same CATH superfamily
5KGWA 2VQFK 4B3OA 2BUPA 3L0QA 4B08A 4CJ7A 4FJ9A 3VQ6A 4PWDA 4Z94A 2H3GX 5LJWA 4KB1A 3LP1A 4BG9A 3WNGA 2E5LK 3C65A 4DTJA 1B9FA 3ZSWA 1SL0A 3AA2A 3DLEA 4CZLA 2A5XA 4YOYA 4Z4CA 5AQVA 5GAGP 1TK8A 4IO9L 3THXB 2HHWA 3LWMA 4IG3A 3VQAA 1RT4A 3L2WA 3CMAN 4A2AA 3ZSVA 1QZ6A 4BVOA 3ZT3A 1NK5A 3RTVA 1MDUB 1NNEA 1XMQK 5HROA 1HKBA 5FPMA 3WT0A 4M3XA 2O8BA 3V9XA 3AVCA 4BQZA 4GV9A 1HNXK 4DHYA 3V81A 5I42A 1VAZA 1ZBSA 2YX6A 4I2PA 3WXKA 3OYGA 4M41A 4NXMK 4I9QA 1JL2A 3OYEA 1W97L 5AFUH 1TL3A 1EKEA 4KHSA 1VSLA 3A5LC 4FW2A 4CHYA 4KHYA 3HBTA 3SJJA 1K6YA 4NCBA 4FK4A 4J2AA 2FBYA 2HF4A 2BH1A 3I0SA 3O9TA 4E0DA 4CF9A 3AO4A 3G10A 4LF5K 1NGAA 3KK1A 1WSFA 3E9OA 1QSLA 2KQ2A 3VQ8A 4DQIA 4YY3K 3CCJN 1X9JA 3ZSQA 4BRIA 2NRHA 3WEEB 5BPLA 1TAUA 4M7XA 4RG8A 1IKVA 4FJJA 3QEVA 5IT9O 1YXQA 5KRSA 4JKGB 1IJJA 1JLAA 1RBVA 4LH4A 3CCUN 3V1OA 3V9WA 3S3NA 4PL8A 3FZMA 4JV5K 5I9EB 5HP1A 4DMNA 2HBLA 3ZLJA 2Q1NA 4CBXA 4QS8A 4YDUA 3DMJA 3M6GA 3M8PA 3SNNA 4KHWA 4H0TB 1T3VA 4WQ5A 4CEQA 3G71N 1QSSA 2ZJPL 3M5RA 2IVPA 1NBWA 4YOTA 4B9MA 2E6MA 4PA1A 1VQKN 3AVBA 3P31A 1QHAA 1WBBA 4FWQA 3LDOA 1EQYA 4NXNK 1MWMA 3PY8A 4ISGA 1FW6A 2GUPA 2XY7A 5M1OA 4LC9B 4MFBA 1EX4A 3DXMA 1HPZA 4CJQA 3J7YP 3LPUA 1YI2N 4E3SA 3EKUA 4DSEA 5T7BA 3ULEB 3H46O 1EETA 3LZIA 2P9UB 3LDNA 3QINA 3WNEA 1RBUA 3CQYA 5AQZA 5LMNK 2FF6A 3VQ9A 3RRGA 3VOVA 2ZF5O 4W5OA 3HM9A 1I3AA 4K42A 5KGXA 2WOMA 3KTQA 4B1ZA 3LDQA 4DF4A 4FO0A 5JLFA 1RTDA 1LWCA 2WBNA 2YNIA 4FLYA 3MDQA 3AVKA 3K5OA 2WFBA 3QEXA 5CYMA 2X78A 4F9OA 4MDAA 3CCLN 4JRPA 3VEXA 4CIFA 5ADXH 4JI6K 4CBWA 2ZE2A 4K8ZA 5GADP 4M3WA 5C12A 1GOCA 4CHZA 3EZ5A 1C6VA 1YVUA 2IIRA 2IC3A 4FOEA 1WSGA 1HX1A 5AQXA 1QTMA 3ATUA 3VF2A 3GBTA 4B1XB 1HMVA 4GNIA 2E1ZA 4B1UB 3QLHA 2D1KA 2O8EB 5KRTA 3NBPA 4JKEA 4CIGA 4WQ4A 2Q2RA 4XEIA 1HJOA 1O13A 2VWBA 3VQPA 2OZMA 3O8MA 4HHTA 2Q0UA 4IEIA 4M3YA 1NGFA 3OY9A 4FL9A 3VERA 2P5OA 2RF2A 4DR2K 4E7KA 1N8RO 3EZWA 3LDPA 1RBRA 5AQNA 1T05A 2NNWA 4W5TA 4DFMA 4HCCA 3HYFA 3A5OC 4ELUA 5KQDA 2IGIA 4OO1J 3K59A 4CHQA 4BREA 4JKHA 1GLAG 3THWB 3DLGA 1NK0A 5CR4A 1NJXA 2YI1A 3BUZB 1Q81O 1NMDA 1BI4A 2OPPA 4FXDA 5CYQA 4DU4A 1UA0A 4BGAA 1RT2A 4BWMA 1CLQA 4YOXA 4FLXA 3NAEA 5CE3A 3QIPA 1MA9B 1E4GT 4I9LA 2P9SA 2NRTA 2ZJRL 1ZBUA 1IH7A 1W9HA 4FW1A 3NHGA 2X6NA 2IS3A 4H5WA 2B6AA 2UXDK 3D45A 1B92A 4GW6A 4RW4A 3TTCA 3I33A 1CZ9A 4LH5A 3KJVA 4BRFA 4A5AA 1NK8A 4CD3A 1HUXA 4DV4K 4CESA 5GAHP 4DTRA 3O9UA 3C6TA 4H4MA 3SV3A 2ZWHA 3VESA 3QETA 2QTDA 1VSMA 4DSFA 5AQKA 4KV8A 4CFDA 1CZBA 4HUGA 4FVMA 3VQ5A 4YOWA 3FGUA 4KRFA 3NCIA 4LSLA 4CZMA 4DTOA 3QIOA 3R9PA 2ASMA 4YDUC 3CCQN 2EWSA 5AQHA 3NVKA 4B3RK 1D9DA 3OYAA 4WQ5C 3PV8A 1LAVA 3PIOL 4BDYA 1VQ4N 4NCAA 1RT3A 4FWNA 3KLFA 3KVGA 4JK7A 4B9LA 3O4QA 1EXQA 4PHTX 4JI7K 5EY4A 2P9PA 3HPGA 4RW8A 3M8QA 2CGKA 2UUBK 1HRHA 1Y97A 2ITMA 3DWLA 4N56A 3A2FA 3THYA 3ULDA 3C6UA 3AY9A 2QWQA 5C42A 4X65K 1VQ8N 4O5FA 4OKKA 1KCFA 4QS9A 2QXLA 3EL2A 4H5RA 3VGKA 3BGRA 4WE1A 1G15A 4BRCA 1U47A 4QS7A 3D6RA 2IVOA 3UIQA 3WXIA 2Q36A 2O8BB 1ASVA 1RTHA 3GL1A 4PKGA 3HPHA 3C6HA 3CERA 2Q3SA 5BR8K 2GUIA 2HBMA 1JCFA 1SL2A 4ISEA 1VQMN 1LWFA 4HVJA 4K41A 3Q7BA 4M63C 2QKKA 4H0VB 1KAXA 3EY1A 1DLOA 3P5JA 4KREA 1S6QA 5FPDA 3WXLA 4DG1A 2P51A 5BREA 4DUYK 3FFIA 4I6MA 4LF6K 2HMIA 1M90O 4NCGA 5M1PA 1A5XA 1U45A 3R6MA 5AQOA 3AAQA 2FXUA 1TV6A 3T69A 1S5JA 4CGGA 4WQ4C 3CCEN 4EP5A 4MO4A 2G8KA 2F8SA 1WSIA 2DFEA 1LWEA 3OW2M 1IBMK 4CGIA 3TAQA 1XWLA 4BR7A 1E4FT 1HYZA 1J6ZA 4B9NA 3BY5A 3QNOA 2E2OA 2XRIA 1S1VA 4C1NK 2V52B 4M3ZA 2YCHA 4KTQA 5IWAK 4MO5A 1FJGK 4ILGB 3TSPA 5F2RA 3NGIA 3AARA 3WNFA 4CF0A 4HCBA 3JYTA 1X3NA 5D3GA 4JI2K 3PUFA 4IG0A 3K5MA 4FJXA 1OH6A 4OGEA 2R7YA 4CZGA 3LM2A 4Z4EA 4BACA 1J9AA 4FK0A 3DXMB 4BRMA 2Q31A 3OBWA 3NF9A 1I94K 1T6CA 4CFCA 4CZEA 1IBLK 3CCMN 1T8EA 3V9ZA 4JKBA 4EFHA 3OYHA 3B6PA 1NGCA 3RVCA 3DOLA 3OTOK 3RMCA 3QESA 1BA1A 3VEYA 2Z1HA 4ID5A 3T19A 3U3YA 1BISA 2FC0A 3TU5A 3VF6A 3QEIA 3E9PA 4YFUA 2UUCK 3RSEA 3OYIA 2JGUA 4JHDA 2NLXA 3KLHA 4X62K 3QB0A 3E66A 3QNNA 4F2SA 4IDHA 2GELA 3G25A 2HHTA 3DOKA 1RT7A 4X64K 1VQNN 3QEWA 4M45A 1ZBIA 3DLRA 4XH1A 3H6EA 5BRHA 4O44A 1ATSA 2PYLA 1FKOA 4F3OA 3JXUA 4A59A 1XQSC 2QWPA 4IOXA 3JS6A 4FPBA 2O8FA 3S9HA 4OLAA 4CBUA 1TYQA 2W6KA 3OYBA 3TAEA 5LMUK 5AQGA 4YHHK 4FWKA 3OYLA 4CD1A 1BCMA 3N4QA 4DSLA 4FJ5A 1QQMA 4AHCA 3PO5A 3OS0A 1KQSM 3I0RA 1UA1A 4JS5A 4KBOA 1ZC6A 1VQ7N 3L2VA 5H1SQ 1L3SA 1J54A 3H1VX 1GLJO 3LANA 5TKWA 2E6LA 1HJRA 3AVGA 3EE9A 1VSHA 2HF3A 2HB5A 3UKRA 4B9TA 1X9MA 3O9SA 2W42A 4M3TA 2HNDA 3RMAA 5BN8A 2W6LA 2X6SA 4HTUA 4ICLA 5ELZA 5FRNA 4JS4A 4EP4A 3NH1A 4OVLA 3MWTA 1BI4B 3C95A 1GLCG 5DMRA 1VSEA 4IZ9A 4BWJA 3DLKA 5AQUA 1NKEA 3J7AP 3H1QA 3ZT1A 3QO9A 1GOBA 5CY4A 5AQJA 5C15A 3O9RA 1HPMA 3KZBA 4FLUA 2P9SB 1ITGA 4JI0K 4JKDA 3TARA 4BRQA 1ATRA 4OKJA 5M1QA 4BVPA 2HHXA 2NRRA 1J5OA 1GLBG 4KB0A 2FBTA 1SZ2A 3HTVA 4CGDA 1R59O 3DYAA 1TK0A 3CM5A 3MX2A 4IBNA 4O55A 1XHZA 4BC2A 1C0TA 1SKRA 5KPTA 1TGOA 3TTFA 3U4LA 2VYPA 3U8XA 5FLXO 4E7LA 3VETA 1JXEA 2YHAA 2GV9A 3A5MC 2D0CA 3TAPA 4DQQA 1HLUA 4DQ8A 4DR7K 3LPTA 4Q5VA 1L5UA 3NDKA 3SPZA 4AQYK 1VHXA 3MEEA 4NLCA 1IKWA 1VQON 2P9PB 3C7NA 2UU9K 3HK2A 4PUOA 2YJEA 3THYB 4KHUA 3P39A 2A42A 3AA4A 4LSNA 4DTSA 2O8CA 4E19A 3VTHA 4DWIA 3CFRA 1XNRK 3CC4N 4J8FA 3EE8A 3ZT2A 3DRPA 1NGJA 1X3MA 2FBXA 5KQ8A 1REVA 4RW9A 4FK2A 2AP1A 4CK1A 3V9UA 1H1VA 3HVTA 4DSKA 2FSJA 1NLVA 3LDLA 1OKJA 4IOCL 4BE1A 3OYFA 1HNIA 5KPZA 4GMJB 3TI0A 3F9KA 2F9TA 4O8KA 2KZZA 3OYKA 2OANA 4LF4K 3HM8A 3VA0A 3RWUA 3A5NC 1YITN 2G8UA 4FOIA 3HL8A 1BG3A 3DRSA 1BGXT 3IG1A 4IDKA 3MWPA 2YHBA 4BE0A 1KVCA 5BPMA 3HZ6A 4RTFD 2P9LA 1NU0A 2A3ZA 3BZKA 2FF3B 2P9IA 3VEVA 1NJWA 3U9ZA 3L2RA 4I6MB 2AA4A 2OPRA 4ILHA 4BC5A 4ZTFA 2RKIA 4CHOA 3G6EN 3IMXA 5EU7A 3SAFA 3I8BA 4KHQA 4DTXA 3ASMA 5E84A 4MLHA 5C25A 3OYJA 1T44A 3MEDA 2NRWA 2YJFA 5A2QO 1QSYA 1IKYA 3ZSOA 3OYCA 3H45C 4BQLA 4GVEA 2WUSA 4AM7A 1Q9YA 3O3FA 4CJWA 3HT3A 4IJAA 3WXJA 1VK0A 5BN9A 4Y1DA 2GWKA 3G4SN 4BROA 1VSJA 4GVMA 3SK3A 4EZ9A 1L3VA 2RN2A 3HPOA 4DTMA 3UKUA 1KSPA 4W5NA 3DM2A 4O8UA 5DK5A 4FZZA 4C1NI 1BWFO 2KFNA 1X1PA 4CVNE 2A40A 2W40A 4FJGA 3TAMA 3A0IX 1KTQA 1HQUA 4ZTJA 3SBTA 1JKHA 3ZSXA 3VGMA 1I39A 3M8SA 3AVFA 4JEPA 3DLBA 2G8WA 2P9KB 2GBZA 4BDPA 3CI5A 4AH9A 3SQ0A 4FZYA 4E7HA 3U3GA 1RDCA 1Y64A 1W0HA 3QMLA 2PBDA 2BGGA 2YHWA 2HMPA 2ZGYA 3O9QA 4Z4GA 2DFFA 4A2BA 4CEOA 1BQMA 4JAXA 1D9FA 2UXBK 3TPQA 1V4TA 4HWIA 4GKJK 3NE6A 2ZGZA 2E20A 3VTIA 1S72N 2JLEA 4JKCA 4JHDB 4JRQA 1QVGM 3PSIA 5AQTA 1Q9XA 4OPAA 2FSNA 3E1YA 3ID6A 4DFJA 3VEWA 4DV2K 3KKSA 3O6WA 3MCPA 1NJIO 1R0AA 3VGLA 3QDKA 3C94A 5AQSA 4CJUA 2QWOA 4TSXA 4ELVA 4BRPA 4B9QA 1GLLO 3RR8A 2F4VK 5DM6L 1MWKA 1NGDA 2QWRA 3AGRA 1T03A 3FZLA 1WBDA 3M8RA 1U6ZA 3VMFB 1HQEA 4DR5K 2CH5A 3CJAA 3IAYA 1WUAA 1TYQB 1BIZA 2VQEK 3LAMA 3SQ1A 3QFUA 5BRFA 4IXCA 5HRNA 2X74A 3KK2A 2D0PA 3VQBA 4B3SK 4H0YB 2HNZA 3V1RA 1BL3A 4M3RA 3LP3A 4ELTA 4DSJA 3AVNA 3NFAA 3OS1A 3ZT4A 1N32K 2DPNA 5AZIB 3L2UA 1L3TA 1LCUA 4GKKK 3AVAA 4EHTA 3TABA 1T7PA 3HO1A 3TSUA 5CZ2A 3A8YA 3S3OA 4DS5A 1TAQA 4QAGA 4BC4A 2OTJN 2OA8A 1N33K 3ZX2A 4KTZA 3UKRB 4OJRA 2O4GA 3FZHA 3OYNA 2I7NA 1UWBA 3CCVN 2QM1A 3DRRA 1YTAA 2QKBA 3MXJA 3TAFA 4L3QA 4WFBL 3CPWM 4K8XA 1WLJA 1WSEA 3J81O 3I55N 3CETA 5AZJA 4XH4A 4G9ZA 3ZT0A 3J8AA 4E7JA 2HBJA 3KLEA 1NGIA 2HOEA 3CYMA 1K9MO 4JK9A 3SUPA 3MN5A 1RNHA 4DV6K 3H3NO 3Q7CA 4B1WB 5EXWA 4Z0UA 4MLEA 4IWVA 4OLBA 4N41A 5CZ1A 4O4GA 1Q86O 2F9WA 3W0LA 1CXQA 4IKFA 3MN7A 4WYBA 3DXKA 1NK9A 4UQGA 4RWTA 1U04A 4C8KA 4OPKA 1XI1A 4BRLA 4JI3K 2E2PA 3MECA 4BRKA 1RCHA 3CJCA 3PX0A 3SAHA 1TKDA 4Y1CA 1HYVA 2Z1IA 5C2DA 4M3UA 2ZJQL 2NRZA 3QERA 4KI6A 4JLHA 2UYTA 2Q0RA 2UUAK 4B3TK 2OCEA 4ID1A 4LF9K 3ZCMA 4JD2A 1VQ5N 2A1SA 3K5LA 2HVIA 4AM6A 3HVRA 4B8AB 4A5BA 4JKGA 1HNZK 3GDQA 3WUHA 2GTDA 3CCRN 4CEAA 2A1RA 2PAVA 4NB4A 3F9MA 1L3UA 4BR2A 3L2QA 2E1YA 3C7NB 5AQIA 3SQ2A 1EP4A 2P9NA 5J2MA 2RHKA 5FROA 4AILC 2O8CB 3AVLA 4JKFA 1C0FA 4AF1A 3O3GA 3KIOA 3G0ZA 3TTDA 2CGLA 3PSFA 1N5YA 3IFRA 5AR0A 3QBWA 1K8KA 1Z26A 4LF7K 1C0UA 3SI6A 2AJQA 1NK7A 4BR9A 2ITGA 3BF3A 1Z6RA 3BP8A 4AHVA 2QWLA 3CFPA 1QZ5A 4FJMA 3AO2A 2P1JA 1P90A 3HXMA 3CXCM 4CHPA 3ULEA 3VEZA 4DCHA 4CFBA 3TWHA 1VSFA 5HLFA 1LOTB 4I7FA 4FJ8A 2QW9A 3CJBA 4DR3K 3ZETA 3VQCA 3IDHA 4W5RA 1JXBA 4DR6K 3ZEUA 3ATVA 4AHTA 3B6OA 3RMDA 2O4IA 5LY3A 2QK9A 1Q82O 3NMUA 2O8DA 4PL7A 2OYQA 2P9LB 3P1GA 5FPNA 2XO7A 2P9IB 3L4IA 3AVMA 4FLZA 4JYAK 3CF5L 1KC8O 4U67L 1F21A 3LM9A 3CMEN 1Q7YO 3VF4A 3FZFA 1HYSA 1JJ2M 2VG5A 1C0GA 4B8CA 4N47A 4GY2B 5MLCQ 2NRXA 4KAZA 2V51B 1DGKN 5C2FA 4CJPA 1VQ9N 5DM7L 3NF6A 4CEFA 4CZIA 1P8ZA 3LZJA 1WAJA 3OHRA 4LFBK 3SPYA 3O08A 4CJEA 1J53A 1YHQN 2A41A 2Z1GA 4C8LA 4FLTA 4A57A 5KPRA 3N4PA 4WFAL 2O8EA 3OYDA 4YOUA 2VG7A 4CEBA 1XHXA 2ASPA 3MMVA 1YJWN 2DFHA 3C6AA 3NF7A 3O1BA 1TVRA 3VEOA 1T6DA 4L8RB 3UKUB 2BANA 1QVFM 1DTQA 1HR0K 1VSKA 1B9DA 1YJ9N 1KVAA 1WSJA 1J5EK 3LP2A 4Z4HA 1RBSA 4FWLA 1C1BA 1RDAA 4KPYA 5JICA 3IRXA 2B5JA 3IKMA 3THWA 4C8OA 1FKPA 4MQ3A 4DTNA 4H0PA 3K2PA 3SLCA 1YF5L 1OVYA 2UXCK 3ZYYX 2PY5A 3TANA 1EO1A 1A5VA 4LY7A 4JK8A 3D7EO 4KKOA 1S1XA 1S6PA 3O5BA 3D2EA 4KH5A 3SQ4A 3KK7A 1QQOA 1N36K 1Q8IA 5FRMA 2FLOA 2NRVA 3CD6N 4N76A 2D5RA 4HTLA 3MN9A 3AV9A 4OPJA 4CK2A 1ESVA 4E89A 2VWJA 1XMOK 4J2DA 3R1XA 4CJSA 3L3VA 2XY5A 4DU3A 2IVNA 1HNVA 4DLGA 2G8IA 4DV1K 4PKIA 2KFZA 3EKSA 4BDZA 4J2BA 4F8RA 3DLLL 1Z25A 1XUPO 4EAHD 2ATQA 3LAKA 3OA9A 3QBXA 1BUPA 1TKZA 4EIAA 3I56N 3QEPA 1X9SA 3CJ7A 1VQLN 1FK9A 4JI5K 3NH0A 1VQ6N 3KLGA 2YKMA 1HNWK 3TSQA 3DJCA 1WSHA 2G8VA 2HHSA 1RTJA 4C23A 4DU1A 4A62A 3V4IA 1M1KO 4FWPA 1ZXOA 4C8MA 1BHLA 4JI8K 3K58A 3SMSA 3NVMA 4XH5A 1TL1A 2XY6A 3NH2A 4U7BA 1YAGA 3VPZA 4NYNA 1KFDA 3MX5A 4DV7K 4K0KK 3V1QA 3HP9A 4KFBA 3J80O 3PX6A 3CIPA 4B9SA 4DTUA 1KD1O 4DB3A 4H03B 3DLHA 3CG7A 3MEGA 5E41A 2A6AA 3DI6A 1S1UA 4O0JA 1X9WA 1WN7A 4BC3A 3K5NA 4CFAA 3HRGA 2D0AA 4CGFA 3L4QA 5C24A 3AVHA 5AZJB 3BEXA 4EHUA 5LL6Z 1FXXA 1UOCA 4FJKA 5I3UA 2ZQBA 2V7YA 4X66K 4FZXC 4H5VA 2QWNA 2QXFA 2I5JA 4CI6A 3ENHA 5JLHA 1BOTO 3VQEA 4CJVA 3KHYA 2VGNA 3AVJA 3CJ9A 2B4JA 3CFOA 4DQRA 2LSNA 3ZSRA 4DFKA 5BPNA 3DXKB 1S1TA 3L8BA 4DV5K 1QE1A 3UB5A 3H08A 3FZKA 1S22A 4H8KA 2PFUA 2F96A 4DV3K 4MDBA 4KH6A 3L6QA 4BRGA 4FM2A 2WTUA 1DEJA 4FM1A 4NLBA 3K57A 3UE5A 4B9UA 1NOYA 2YKNA 3E9LA 4E7IA 4CJTA 3VN5A 1VRTA 4CGHA 3KK3A 4H5TA 3HSCA 2F8TA 4EZ6A 4BRNA 5JVGL 3FFKB 3FLCO 4JD2B 4NO7A 1JLCA 1OVQA 1A5WA 3FE1A 2JWKA 4FSVA 3CC2N 1RBTA 4BRDA 5HRRA 4HUFA 4LF8K 4NYFA 2OZSA 3MXMA 3L3UA 3SAGA 2KW4A 3CQ8A 2HHVA 2HSTA 4DKWA 4Z4FA 1E3MA 4XIUA 2YV0X 2F7TA 2HVHA 2NUBA 1NMNA 1NKCA 1IG9A 2EX3A 3CM6A 2P9NB 1NGEA 1QS4A 4FWSA 1NK6A 1U2VA 4CF1A 4OX9K 1U4BA 1OH5A 4JKAA 1DKGD 1G99A 4PKHA 4IFYA 2D4WA 3T7ZA 1K8KB 1BIUA 3FR0A 1JLEA 2QI2A 4WF9L 2HBKA 2OPSA 4RW7A 3V6DA 4PQUA 1BA0A 4PY5A 2G8FA 1XNQK 4CJLA 5HRPA 3SUNA 2YNFA 4CZKA 2XHBA 3NGZA 2NZTA 3PX4A 5BR9A 1Z05A 3QICA 3ZETB 4DQSA 4O5BA 1RDUA 1KAZA 5CHIA 1W7AA 4CZJA 1QHTA 3ZEUB 1VSDA 1YTUA 1VSIA 3D2FA 2O8DB 4FCYA 3PLAA 1GOAA 4BRAA 3B8AX 1TKTA 2ZM6K 1SUQA 3CCSN 3S3MA 1IV0A 5HL7L 2HHQA 3MCAB 3VQ7A 1ZBHA 5HRSA 1EWRA 4DUZK 5EVZA 5EOYA 3J7ZO 3VQ4A 1IO2A 1IBKK 1N34K 4M42A 3LWLA 4DF8A 4CF8A 1XC3A 3TR8A 1KAYA 3GE1A 4ILJA 3MK6A 4OPHA 4B9VA 1WB9A 4CEEA 1TUYA 5F1XA 3RSEB 3EN9A 3VA3A 1NWKA 2BDPA 1RTIA 3HOSA 5C0YA 1C1AA 5AQFA 4BR0A 3OVNA 2KHOA 3WNHA 4IEEA 3AO1A 4DQPA 2VCPA 1ZBLA 3O4WA 4FPAA 2VG6A 2J4RA 3OS2A 2HHHK 1W2BM 1N6QA 1SKSA 4HUEA 2O8FB 3RR7A 4CE9A 4FM0A 4IFEA 3OJSA 1RT6A 3E01A 3OJUA 2YNHA 1D5AA 3AA5X 1DT9A 3H3OB 5GIOA 4DTPA 4DSIA 3EEQA 3JAMO 4Y0WA 3SUOA 5FDLA 1RDBA 3ALYA 3D2EB 3SJHA 3O4NA 5HBMA 5F0XA 4IJNA 2ETJA 5AJ3K 4AHRA 1MU2A 5E26A 1C0MA 1U48A 4GV6A 4BGBA 3I8DA 2E2NA 4J2EA 2W41A 5M1NA 1WNSA 5SWMA 1K73O 2E8AA 4B1VA 4KHPK 3THXA 3HP6A 5KI6A 1JL1A 1S1WA 3K0SA 3VENA 2FBVA 5JVHL 2I7PA 4BY9C 4DFPA 1RILA 3V9SA 4CEZA 3R8EA 4E1MA 4BG8A 3KWIA 4KO0A 4M7YA 5AQPA 2QA4N 1RDDA 3HSTB 3THVA 2PZSA 2WC9A 4FJHA 2RPIA 3LL3A 1NJYA 2D0BA 3OBYA 1CXUA 3SCXA 4KHNA 1ASWA 3NF8A 1ZYQA 1XC9A 3F5TA 3O80A 4IFVA 3K9JA 3D0PA 1LW0A 1NKBA 2G8HA 2V7ZA 4DS4A 3OYMA 4WCEL 2ASOA 5FPEA 3P83D 1LV5A 1WAFA 2VWKA 5BRDA 3WQUA 4E1NA 4CHNA 3ZSYA 1JCGA 1DTTA 5GIPA 4DR1K 1KXPA 4W5QA 1RGIA 2KZMA 2DY4A 1GLDG 2EHGA 1D4XA 4DV0K 3ENOA 5M1KA 5AQYA 3ENBA 1HKGA 3JSMA 5B8HA 4CECA 4RW6A 3SYZA 3F73A 2Y1IA 2P5GA 4CF2A 1NGBA 4KTWA 4E1JA 3WEEA 4BRHA 5AFUA 3WQTA 3PO4A 4CIEA 2GWJA 4FJIA 3CJ1A 1BQNA 3KD5E 2RE2A 3RRHA 3AO5A 3MXIA 4N5SA 3ZX3A 2GEMA 1RT1A 4F4KA 3CHWA 3ID8A 3K9KA 2E88A 3LALA 2ZD1A 5C10A 3KKRA 4LFCK 3RMBA 3IUCA 4WFNL 3T1YK 1HKCA 3CQXA 3NGYA 4KI4A 3R3LA 4IOAL 2CH6A 3S41A 3T1HK 1SL1A 3BDPA 1ILYA 1TK5A 4JN4A 2PYJA 2DTUA 4OGCA 3O3HA 5J2PA 4H5NA 4CJKA 3KD1E 3WXMB 1EWQA 1YJNN 3HJFA 1GLEG 3VQDA 4JI1K 2QEXN 2HW3A 5AQLA 5J2NA 4FJ7A 2KKZA 1O1WA 4YOVA 5AQRA 4R5PA 1QQCA 2IOCA 2P9UA 1NGGA 4H0XB 1SV5A 1OH8A 2JWLA 5J1EA 3EYZA 3AA3A 1S9EA 3BF1A 4FVUA 5TKYA 4BE2A 3PIPL 4C8NA 4R79A 1S9GA 4CJ3A 1NM1A 2OPQA 3AO3A 3T3FA 1RFQA 1JLBA 4CGJA 1D8YA 4CCHA 4CJRA 1JLQA 4OKEA 5AQWA 3QFPA 3W3DA 3ZSZA 4CJFA 5EX5A 3P38A 4GV3A 4CW7B 1ZBFA 1KLNA 2BE2A 2KTQA 2Z1JA 3M1FA 3IS9A 2VGMA 5J2QA 4K43A 1QQNA 1LW2A 1BCOA 2E2QA 4Z4IA 5LJVA 4RCHA 5K14A 2D0OA 2E4LA 3ITHA 1ASUA 3T1AA 4CK3A 3P4IA 1Q18A 1SKWA 3O1WA 5AQQA 1CZAN 3EO3A 1U2VB 3SMPA 1KVBA 2KLAA 1SS6A 1WOQA 1SAZA 4O0IA 1LAWA 4F3TA 1JLFA 4DLEA 1RT5A 2OTLN 3AGKA 2P9KA 1VQPN 1IG8A 1YUWA 4AHSA 4K25A 1S3XA 4FYDA 2HHUA 4Q0BA 5JS1A 4AHUA 4FLVA 1YT3A 2WONA 2IAJA 5GINA 3LDSA 2GX9A 5ADXA 5SZTA 2YHYA 1UAXA 2Q97A 2FSKA 3KWGA 4ISFA 4JNEA 5AQMA 4CJ4A 4JI4K 3D2FB 4YNQA 3SBGA 1NK4A 4G1QA 3CPEA 5HOOA 3ISNC 5KTQA 1NJZA 4QCLA 1V4SA 3DAWA 2CGJA 4FLWA 1BU6O 1OH7A 1JCEA 3GOIA 1K8AO 3GG4A 1SQKA 2Y1JA 5JMVA 3BZCA 3SUQA 1RDWX 1U49A 1C1CA 3HI0A 1BO5O 4FWRA 3SZ2A 4B3MK 3F2KA 3CC7N 2YHXA 5GAEP 3KLIA 1TKXA 4CERA 4BR4A 4LFAK 4CEDA 1KLMA 4KH4A 4I2QA 2XY8A 1TUUA 3HOTA 4FJNA 3ZX0A 4BR5A 4FWOA 5AZIA 3TAGA 2QWMA 4ZHRA 1VRUA 4CZFA 4A61A 4B1YB 4LD0A 4FJLA 1BDGA 1YVNA 1KFSA 1ATNA 4FWMA 4H4OA 4YORA 4H0OA 3SV4A 3VQQA 3AVIA 1JLGA 4F2RA 1GLFO 1NG9A 5M1FA 3M3ZA 4DR4K 4UY8O 3C0BA 1IKXA 1NGHA 3LP0A 1YIJN 3MN6A 2BTFA 1KRPA 4CZHA 3U9DA 3AAPA 1NOZA 3MAQA 4QOZB 2IDOA 2HNYA 4V19S 4IO8A 5JS2A 4CJ5A 3U6FA 2YNGA
chains in the Genus database with same CATH topology
4C1NK 4L3QA 2BUPA 2V52B 3FR0A 3L0QA 2YCHA 4CJ7A 2QI2A 4WFBL 4WF9L 3CPWM 2HBKA 4MO5A 4ILGB 1BA0A 3TSPA 4Z94A 3I55N 3CETA 5AZJA 5F2RA 2H3GX 3AARA 4XH4A 5LJWA 4G9ZA 3J8AA 2HBJA 4BG9A 1X3NA 1NGIA 2HOEA 4CZKA 1K9MO 2NZTA 3C65A 5BR9A 4JK9A 4CZGA 3LM2A 1Z05A 3MN5A 3QICA 3ZETB 4CZLA 3H3NO 3DXMB 3Q7CA 4BRMA 1RDUA 2A5XA 2Q31A 4YOYA 3OBWA 1KAZA 5EXWA 4B1WB 4MLEA 4CZJA 5AQVA 4IWVA 5GAGP 5CHIA 4IO9L 3ZEUB 1T6CA 4CZEA 3D2FA 1Q86O 2F9WA 3W0LA 3CCMN 3CMAN 4JKBA 4EFHA 3RVCA 1NGCA 3PLAA 4BRAA 4A2AA 3B8AX 3MN7A 1QZ6A 4BVOA 4WYBA 1BA1A 3DXKA 3VEYA 5HL7L 3CCSN 3MCAB 1MDUB 3TU5A 3VF6A 4RWTA 1HKBA 5FPMA 3WT0A 3E9PA 5EVZA 4BRLA 4BQZA 5EOYA 3RSEA 4GV9A 2E2PA 3J7ZO 4JHDA 4BRKA 2NLXA 3CJCA 4DHYA 1VAZA 3QB0A 3E66A 3SAHA 5C2DA 1ZBSA 2YX6A 4IDHA 2GELA 3G25A 2NRZA 3WXKA 1XC3A 2ZJQL 1KAYA 3GE1A 4ILJA 1W97L 3MK6A 4OPHA 5AFUH 1VQNN 2UYTA 2Q0RA 1TUYA 4XH1A 5F1XA 3H6EA 3RSEB 3A5LC 3EN9A 5BRHA 1ATSA 1NWKA 4JD2A 3JXUA 4A59A 3HOSA 1XQSC 2QWPA 3HBTA 4IOXA 1VQ5N 5C0YA 3JS6A 5AQFA 4AM6A 4BR0A 4FPBA 2KHOA 4A5BA 2HF4A 2BH1A 4IEEA 4CBUA 1TYQA 4JKGA 3O9TA 5AQGA 3GDQA 4FWKA 2GTDA 2VCPA 3WUHA 3CCRN 1NGAA 2PAVA 3E9OA 4NB4A 3F9MA 4CD1A 3O4WA 4BR2A 3CCJN 2E1YA 1X9JA 3N4QA 4FPAA 3C7NB 2J4RA 5AQIA 1QQMA 4BRIA 2NRHA 1W2BM 1KQSM 3WEEB 5BPLA 4M7XA 2P9NA 2RHKA 1YXQA 4KBOA 1ZC6A 4JKGB 1IJJA 1VQ7N 1KD1O 5H1SQ 4IFEA 3CCUN 4JKFA 3H1VX 1C0FA 1GLJO 5TKWA 4AF1A 3FZMA 4PL8A 3TTDA 3EE9A 5I9EB 1DT9A 2CGLA 2HF3A 3H3OB 3UKRA 3O9SA 5GIOA 2HBLA 2Q1NA 3IFRA 5AR0A 3QBWA 4CBXA 5BN8A 4QS8A 1K8KA 4YDUA 4Y0WA 3M6GA 4H0TB 1T3VA 4WQ5A 3D2EB 4BR9A 3G71N 3BF3A 1Z6RA 3BP8A 3SJHA 2ZJPL 3M5RA 2IVPA 5ELZA 1NBWA 2QWLA 4YOTA 1QZ5A 5F0XA 4IJNA 1P90A 1VQKN 3CXCM 3ULEA 3VEZA 4DCHA 5E26A 3P31A 1QHAA 4GV6A 3MWTA 4BGBA 1LOTB 3LDOA 4FWQA 1EQYA 2E2NA 1MWMA 1GLCG 2QW9A 4ISGA 3CJBA 4IZ9A 2GUPA 2W41A 5M1OA 4LC9B 5AQUA 3ZETA 5M1NA 1K73O 3DXMA 2E8AA 4B1VA 3IDHA 3H1QA 3ZEUA 3ATVA 1YI2N 5AQJA 5C15A 3O9RA 5LY3A 1HPMA 3EKUA 3KZBA 3VENA 1Q82O 3NMUA 3ULEB 3H46O 2P9SB 4PL7A 2P9LB 5FPNA 2P9IB 3L4IA 4JKDA 5JVHL 4BRQA 2P9UB 3LDNA 2I7PA 4BY9C 3CQYA 5AQZA 3CF5L 1KC8O 1ATRA 2FF6A 5M1QA 4BVPA 2NRRA 4U67L 3R8EA 3LM9A 4BG8A 1GLBG 1Q7YO 3KWIA 3VF4A 3CMEN 3FZFA 1SZ2A 3HTVA 4M7YA 1R59O 5AQPA 3VOVA 1JJ2M 2ZF5O 2QA4N 1C0GA 4GY2B 5MLCQ 3MX2A 2WC9A 4K42A 2NRXA 2V51B 1DGKN 5C2FA 3LL3A 4B1ZA 3LDQA 4BC2A 3OBYA 5DM7L 1VQ9N 4FO0A 4CZIA 5JLFA 2WBNA 1P8ZA 3MDQA 5KPTA 3TTFA 3U4LA 2VYPA 3OHRA 2WFBA 3U8XA 3F5TA 3O80A 3VETA 3O08A 4F9OA 4MDAA 3CCLN 3K9JA 3VEXA 2V7ZA 1YHQN 5ADXH 2A41A 4WCEL 3A5MC 4A57A 2ASOA 5KPRA 3N4PA 5FPEA 4CBWA 4WFAL 5GADP 5BRDA 3WQUA 1HLUA 4YOUA 4DQ8A 5C12A 1JCGA 5GIPA 2ASPA 1KXPA 2IIRA 3MMVA 1YJWN 1RGIA 3C6AA 4FOEA 3O1BA 1HX1A 5AQXA 3ATUA 3VF2A 3VEOA 1GLDG 1T6DA 3GBTA 3UKUB 4B1XB 1D4XA 4NLCA 3ENOA 4GNIA 5M1KA 5AQYA 1QVFM 2E1ZA 3ENBA 1HKGA 1VQON 4B1UB 5B8HA 2D1KA 2P9PB 1YJ9N 3C7NA 1NGBA 4JKEA 4E1JA 4FWLA 4WQ4A 2Q2RA 4XEIA 1HJOA 3WEEA 3WQTA 4BRHA 1O13A 5AFUA 2VWBA 5JICA 2GWJA 2YJEA 3CJ1A 3IKMA 3O8MA 2Q0UA 3P39A 2A42A 4IEIA 2RE2A 1NGFA 3VTHA 4FL9A 3VERA 4J8FA 3EE8A 3CC4N 3ZX3A 1NGJA 2GEMA 4H0PA 1X3MA 1YF5L 3SLCA 1N8RO 1OVYA 3ZYYX 3EZWA 1EO1A 3CHWA 3LDPA 3ID8A 5AQNA 3K9KA 5KQ8A 2E88A 2NNWA 4JK8A 3D7EO 2AP1A 5C10A 1H1VA 3A5OC 5KQDA 2FSJA 3O5BA 3D2EA 4KH5A 4BREA 4OO1J 3KK7A 1GLAG 1QQOA 3IUCA 4JKHA 1NLVA 2FLOA 3LDLA 4WFNL 1HKCA 1OKJA 2NRVA 4IOCL 3CD6N 3CQXA 5CR4A 4HTLA 3MN9A 3R3LA 5KPZA 4IOAL 2YI1A 2CH6A 3S41A 3BUZB 2F9TA 4O8KA 1Q81O 1NMDA 1ESVA 4JN4A 1ILYA 2OANA 3R1XA 4H5NA 3HM8A 3WXMB 3A5NC 1YITN 2IVNA 4BGAA 4FOIA 1YJNN 1BG3A 4YOXA 1GLEG 3MWPA 4PKIA 3EKSA 5CE3A 2QEXN 5AQLA 5BPMA 3DLLL 1MA9B 1XUPO 1E4GT 2KKZA 3OA9A 4EAHD 4YOVA 5AQRA 3HZ6A 2P9SA 3QBXA 1BUPA 2P9LA 4RTFD 2A3ZA 4EIAA 3I56N 3CJ7A 1VQLN 2FF3B 2P9IA 2NRTA 3VEVA 2ZJRL 2P9UA 1NGGA 3U9ZA 4H0XB 1VQ6N 2JWLA 4I6MB 4H5WA 3BF1A 3TSQA 4FVUA 3DJCA 2AA4A 5TKYA 4ILHA 3PIPL 4BC5A 4R79A 4C23A 3G6EN 4A62A 3IMXA 1NM1A 3TTCA 3I33A 3SAFA 1RFQA 4BRFA 1M1KO 4FWPA 1ZXOA 4A5AA 3I8BA 3SMSA 3NVMA 4CD3A 1HUXA 4XH5A 5E84A 4MLHA 5AQWA 5GAHP 1T44A 3O9UA 2NRWA 3QFPA 3W3DA 4U7BA 4GV3A 1YAGA 2YJFA 3P38A 5EX5A 3VPZA 3M1FA 3MX5A 2ZWHA 2VGMA 3VESA 3H45C 2QTDA 4BQLA 5AQKA 4GVEA 2WUSA 4K43A 4AM7A 1QQNA 2E2QA 5LJVA 4RCHA 2D0OA 4IJAA 3WXJA 3CIPA 3FGUA 4YOWA 3P4IA 1Q18A 3O1WA 5AQQA 1CZAN 3EO3A 1U2VB 4H03B 2GWKA 5BN9A 4CZMA 3R9PA 3SMPA 4DB3A 3G4SN 4BROA 2KLAA 2ASMA 1SS6A 2A6AA 1WOQA 1SAZA 4YDUC 2EWSA 3SK3A 3CCQN 5AQHA 3NVKA 4WQ5C 3PIOL 2OTLN 4BC3A 1VQ4N 3AGKA 2P9KA 1VQPN 4FWNA 1IG8A 1YUWA 3UKUA 3KVGA 4JK7A 4K25A 4O8UA 1S3XA 3HRGA 4PHTX 3L4QA 4C1NI 1BWFO 5AZJB 3BEXA 4EHUA 5EY4A 2P9PA 2A40A 2W40A 3A0IX 2CGKA 3SBTA 2V7YA 5GINA 2ITMA 3VGMA 4H5VA 2QWNA 3DWLA 4JEPA 2GX9A 5ADXA 2P9KB 4CI6A 3ENHA 2YHYA 5JLHA 3AY9A 3CI5A 1BOTO 2QWQA 1VQ8N 2Q97A 2FSKA 3KWGA 4O5FA 1Y64A 4ISFA 4JNEA 3KHYA 4QS9A 3QMLA 2VGNA 3CJ9A 5AQMA 2PBDA 2QXLA 2YHWA 3D2FB 2HMPA 2ZGYA 3EL2A 3O9QA 4H5RA 3SBGA 3CPEA 3VGKA 5HOOA 4A2BA 4BRCA 4JAXA 1V4SA 3TPQA 1V4TA 3DAWA 5BPNA 2CGJA 3DXKB 1BU6O 3D6RA 4QS7A 2IVOA 4HWIA 3UB5A 1JCEA 3GOIA 3WXIA 2Q36A 1K8AO 3FZKA 1S22A 2PFUA 2ZGZA 1SQKA 3GG4A 3GL1A 4PKGA 2E20A 3VTIA 5JMVA 3C6HA 3CERA 4MDBA 1S72N 1RDWX 4KH6A 3L6QA 4JKCA 4JHDB 4BRGA 1QVGM 2HBMA 3HI0A 1JCFA 1BO5O 4FWRA 5AQTA 4OPAA 1DEJA 2FSNA 3E1YA 3F2KA 3ID6A 4NLBA 3UE5A 3CC7N 3VEWA 2YHXA 5GAEP 3O6WA 4ISEA 1VQMN 3MCPA 3E9LA 1NJIO 3VGLA 3QDKA 4K41A 3Q7BA 4M63C 5AQSA 4H5TA 4BR4A 2QWOA 3HSCA 1KAXA 4H0VB 4BRPA 4B9QA 1GLLO 4BRNA 5JVGL 5DM6L 5FPDA 1MWKA 3FFKB 1NGDA 2QWRA 3AGRA 3WXLA 3FLCO 5BREA 4JD2B 3FZLA 4KH4A 4I6MA 4NO7A 3CC2N 3FE1A 2JWKA 1U6ZA 4FSVA 1TUUA 3VMFB 1M90O 3HOTA 2CH5A 5M1PA 3ZX0A 4BRDA 3CJAA 4BR5A 4FWOA 3R6MA 5AZIA 1WUAA 1TYQB 2QWMA 5AQOA 3AAQA 4CZFA 2FXUA 4A61A 3QFUA 4B1YB 5BRFA 3SAGA 4IXCA 2D0PA 2HSTA 4DKWA 4H0YB 3T69A 1BDGA 1YVNA 2F7TA 1ATNA 4FWMA 4YORA 4H0OA 4WQ4C 3CCEN 4MO4A 1GLFO 5M1FA 3M3ZA 2P9NB 4UY8O 3C0BA 1NGHA 1NGEA 2DPNA 5AZIB 3OW2M 1LCUA 1YIJN 4EHTA 3MN6A 4FWSA 2BTFA 4CZHA 3U9DA 3TSUA 4BR7A 3A8YA 3AAPA 1U2VA 4BC4A 2OTJN 1E4FT 4JKAA 1DKGD 1G99A 4PKHA 3ZX2A 3UKRB 2D4WA 4IO8A 1J6ZA 3FZHA 3T7ZA 2I7NA 1K8KB 3CCVN 2QM1A 2E2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOX A;  3N4P A;  3N4Q A; 
#chains in the Genus database with same CATH topology
 5KGW A;  2VQF K;  4B3O A;  2BUP A;  3L0Q A;  4B08 A;  4CJ7 A;  4FJ9 A;  3VQ6 A;  4PWD A;  4Z94 A;  2H3G X;  5LJW A;  4KB1 A;  3LP1 A;  4BG9 A;  3WNG A;  2E5L K;  3C65 A;  4DTJ A;  1B9F A;  3ZSW A;  1SL0 A;  3AA2 A;  3DLE A;  4CZL A;  2A5X A;  4YOY A;  4Z4C A;  5AQV A;  5GAG P;  1TK8 A;  4IO9 L;  3THX B;  2HHW A;  3LWM A;  4IG3 A;  3VQA A;  1RT4 A;  3L2W A;  3CMA N;  4A2A A;  3ZSV A;  1QZ6 A;  4BVO A;  3ZT3 A;  1NK5 A;  3RTV A;  1MDU B;  1NNE A;  1XMQ K;  5HRO A;  1HKB A;  5FPM A;  3WT0 A;  4M3X A;  2O8B A;  3V9X A;  3AVC A;  4BQZ A;  4GV9 A;  1HNX K;  4DHY A;  3V81 A;  5I42 A;  1VAZ A;  1ZBS A;  2YX6 A;  4I2P A;  3WXK A;  3OYG A;  4M41 A;  4NXM K;  4I9Q A;  1JL2 A;  3OYE A;  1W97 L;  5AFU H;  1TL3 A;  1EKE A;  4KHS A;  1VSL A;  3A5L C;  4FW2 A;  4CHY A;  4KHY A;  3HBT A;  3SJJ A;  1K6Y A;  4NCB A;  4FK4 A;  4J2A A;  2FBY A;  2HF4 A;  2BH1 A;  3I0S A;  3O9T A;  4E0D A;  4CF9 A;  3AO4 A;  3G10 A;  4LF5 K;  1NGA A;  3KK1 A;  1WSF A;  3E9O A;  1QSL A;  2KQ2 A;  3VQ8 A;  4DQI A;  4YY3 K;  3CCJ N;  1X9J A;  3ZSQ A;  4BRI A;  2NRH A;  3WEE B;  5BPL A;  1TAU A;  4M7X A;  4RG8 A;  1IKV A;  4FJJ A;  3QEV A;  5IT9 O;  1YXQ A;  5KRS A;  4JKG B;  1IJJ A;  1JLA A;  1RBV A;  4LH4 A;  3CCU N;  3V1O A;  3V9W A;  3S3N A;  4PL8 A;  3FZM A;  4JV5 K;  5I9E B;  5HP1 A;  4DMN A;  2HBL A;  3ZLJ A;  2Q1N A;  4CBX A;  4QS8 A;  4YDU A;  3DMJ A;  3M6G A;  3M8P A;  3SNN A;  4KHW A;  4H0T B;  1T3V A;  4WQ5 A;  4CEQ A;  3G71 N;  1QSS A;  2ZJP L;  3M5R A;  2IVP A;  1NBW A;  4YOT A;  4B9M A;  2E6M A;  4PA1 A;  1VQK N;  3AVB A;  3P31 A;  1QHA A;  1WBB A;  4FWQ A;  3LDO A;  1EQY A;  4NXN K;  1MWM A;  3PY8 A;  4ISG A;  1FW6 A;  2GUP A;  2XY7 A;  5M1O A;  4LC9 B;  4MFB A;  1EX4 A;  3DXM A;  1HPZ A;  4CJQ A;  3J7Y P;  3LPU A;  1YI2 N;  4E3S A;  3EKU A;  4DSE A;  5T7B A;  3ULE B;  3H46 O;  1EET A;  3LZI A;  2P9U B;  3LDN A;  3QIN A;  3WNE A;  1RBU A;  3CQY A;  5AQZ A;  5LMN K;  2FF6 A;  3VQ9 A;  3RRG A;  3VOV A;  2ZF5 O;  4W5O A;  3HM9 A;  1I3A A;  4K42 A;  5KGX A;  2WOM A;  3KTQ A;  4B1Z A;  3LDQ A;  4DF4 A;  4FO0 A;  5JLF A;  1RTD A;  1LWC A;  2WBN A;  2YNI A;  4FLY A;  3MDQ A;  3AVK A;  3K5O A;  2WFB A;  3QEX A;  5CYM A;  2X78 A;  4F9O A;  4MDA A;  3CCL N;  4JRP A;  3VEX A;  4CIF A;  5ADX H;  4JI6 K;  4CBW A;  2ZE2 A;  4K8Z A;  5GAD P;  4M3W A;  5C12 A;  1GOC A;  4CHZ A;  3EZ5 A;  1C6V A;  1YVU A;  2IIR A;  2IC3 A;  4FOE A;  1WSG A;  1HX1 A;  5AQX A;  1QTM A;  3ATU A;  3VF2 A;  3GBT A;  4B1X B;  1HMV A;  4GNI A;  2E1Z A;  4B1U B;  3QLH A;  2D1K A;  2O8E B;  5KRT A;  3NBP A;  4JKE A;  4CIG A;  4WQ4 A;  2Q2R A;  4XEI A;  1HJO A;  1O13 A;  2VWB A;  3VQP A;  2OZM A;  3O8M A;  4HHT A;  2Q0U A;  4IEI A;  4M3Y A;  1NGF A;  3OY9 A;  4FL9 A;  3VER A;  2P5O A;  2RF2 A;  4DR2 K;  4E7K A;  1N8R O;  3EZW A;  3LDP A;  1RBR A;  5AQN A;  1T05 A;  2NNW A;  4W5T A;  4DFM A;  4HCC A;  3HYF A;  3A5O C;  4ELU A;  5KQD A;  2IGI A;  4OO1 J;  3K59 A;  4CHQ A;  4BRE A;  4JKH A;  1GLA G;  3THW B;  3DLG A;  1NK0 A;  5CR4 A;  1NJX A;  2YI1 A;  3BUZ B;  1Q81 O;  1NMD A;  1BI4 A;  2OPP A;  4FXD A;  5CYQ A;  4DU4 A;  1UA0 A;  4BGA A;  1RT2 A;  4BWM A;  1CLQ A;  4YOX A;  4FLX A;  3NAE A;  5CE3 A;  3QIP A;  1MA9 B;  1E4G T;  4I9L A;  2P9S A;  2NRT A;  2ZJR L;  1ZBU A;  1IH7 A;  1W9H A;  4FW1 A;  3NHG A;  2X6N A;  2IS3 A;  4H5W A;  2B6A A;  2UXD K;  3D45 A;  1B92 A;  4GW6 A;  4RW4 A;  3TTC A;  3I33 A;  1CZ9 A;  4LH5 A;  3KJV A;  4BRF A;  4A5A A;  1NK8 A;  4CD3 A;  1HUX A;  4DV4 K;  4CES A;  5GAH P;  4DTR A;  3O9U A;  3C6T A;  4H4M A;  3SV3 A;  2ZWH A;  3VES A;  3QET A;  2QTD A;  1VSM A;  4DSF A;  5AQK A;  4KV8 A;  4CFD A;  1CZB A;  4HUG A;  4FVM A;  3VQ5 A;  4YOW A;  3FGU A;  4KRF A;  3NCI A;  4LSL A;  4CZM A;  4DTO A;  3QIO A;  3R9P A;  2ASM A;  4YDU C;  3CCQ N;  2EWS A;  5AQH A;  3NVK A;  4B3R K;  1D9D A;  3OYA A;  4WQ5 C;  3PV8 A;  1LAV A;  3PIO L;  4BDY A;  1VQ4 N;  4NCA A;  1RT3 A;  4FWN A;  3KLF A;  3KVG A;  4JK7 A;  4B9L A;  3O4Q A;  1EXQ A;  4PHT X;  4JI7 K;  5EY4 A;  2P9P A;  3HPG A;  4RW8 A;  3M8Q A;  2CGK A;  2UUB K;  1HRH A;  1Y97 A;  2ITM A;  3DWL A;  4N56 A;  3A2F A;  3THY A;  3ULD A;  3C6U A;  3AY9 A;  2QWQ A;  5C42 A;  4X65 K;  1VQ8 N;  4O5F A;  4OKK A;  1KCF A;  4QS9 A;  2QXL A;  3EL2 A;  4H5R A;  3VGK A;  3BGR A;  4WE1 A;  1G15 A;  4BRC A;  1U47 A;  4QS7 A;  3D6R A;  2IVO A;  3UIQ A;  3WXI A;  2Q36 A;  2O8B B;  1ASV A;  1RTH A;  3GL1 A;  4PKG A;  3HPH A;  3C6H A;  3CER A;  2Q3S A;  5BR8 K;  2GUI A;  2HBM A;  1JCF A;  1SL2 A;  4ISE A;  1VQM N;  1LWF A;  4HVJ A;  4K41 A;  3Q7B A;  4M63 C;  2QKK A;  4H0V B;  1KAX A;  3EY1 A;  1DLO A;  3P5J A;  4KRE A;  1S6Q A;  5FPD A;  3WXL A;  4DG1 A;  2P51 A;  5BRE A;  4DUY K;  3FFI A;  4I6M A;  4LF6 K;  2HMI A;  1M90 O;  4NCG A;  5M1P A;  1A5X A;  1U45 A;  3R6M A;  5AQO A;  3AAQ A;  2FXU A;  1TV6 A;  3T69 A;  1S5J A;  4CGG A;  4WQ4 C;  3CCE N;  4EP5 A;  4MO4 A;  2G8K A;  2F8S A;  1WSI A;  2DFE A;  1LWE A;  3OW2 M;  1IBM K;  4CGI A;  3TAQ A;  1XWL A;  4BR7 A;  1E4F T;  1HYZ A;  1J6Z A;  4B9N A;  3BY5 A;  3QNO A;  2E2O A;  2XRI A;  1S1V A;  4C1N K;  2V52 B;  4M3Z A;  2YCH A;  4KTQ A;  5IWA K;  4MO5 A;  1FJG K;  4ILG B;  3TSP A;  5F2R A;  3NGI A;  3AAR A;  3WNF A;  4CF0 A;  4HCB A;  3JYT A;  1X3N A;  5D3G A;  4JI2 K;  3PUF A;  4IG0 A;  3K5M A;  4FJX A;  1OH6 A;  4OGE A;  2R7Y A;  4CZG A;  3LM2 A;  4Z4E A;  4BAC A;  1J9A A;  4FK0 A;  3DXM B;  4BRM A;  2Q31 A;  3OBW A;  3NF9 A;  1I94 K;  1T6C A;  4CFC A;  4CZE A;  1IBL K;  3CCM N;  1T8E A;  3V9Z A;  4JKB A;  4EFH A;  3OYH A;  3B6P A;  1NGC A;  3RVC A;  3DOL A;  3OTO K;  3RMC A;  3QES A;  1BA1 A;  3VEY A;  2Z1H A;  4ID5 A;  3T19 A;  3U3Y A;  1BIS A;  2FC0 A;  3TU5 A;  3VF6 A;  3QEI A;  3E9P A;  4YFU A;  2UUC K;  3RSE A;  3OYI A;  2JGU A;  4JHD A;  2NLX A;  3KLH A;  4X62 K;  3QB0 A;  3E66 A;  3QNN A;  4F2S A;  4IDH A;  2GEL A;  3G25 A;  2HHT A;  3DOK A;  1RT7 A;  4X64 K;  1VQN N;  3QEW A;  4M45 A;  1ZBI A;  3DLR A;  4XH1 A;  3H6E A;  5BRH A;  4O44 A;  1ATS A;  2PYL A;  1FKO A;  4F3O A;  3JXU A;  4A59 A;  1XQS C;  2QWP A;  4IOX A;  3JS6 A;  4FPB A;  2O8F A;  3S9H A;  4OLA A;  4CBU A;  1TYQ A;  2W6K A;  3OYB A;  3TAE A;  5LMU K;  5AQG A;  4YHH K;  4FWK A;  3OYL A;  4CD1 A;  1BCM A;  3N4Q A;  4DSL A;  4FJ5 A;  1QQM A;  4AHC A;  3PO5 A;  3OS0 A;  1KQS M;  3I0R A;  1UA1 A;  4JS5 A;  4KBO A;  1ZC6 A;  1VQ7 N;  3L2V A;  5H1S Q;  1L3S A;  1J54 A;  3H1V X;  1GLJ O;  3LAN A;  5TKW A;  2E6L A;  1HJR A;  3AVG A;  3EE9 A;  1VSH A;  2HF3 A;  2HB5 A;  3UKR A;  4B9T A;  1X9M A;  3O9S A;  2W42 A;  4M3T A;  2HND A;  3RMA A;  5BN8 A;  2W6L A;  2X6S A;  4HTU A;  4ICL A;  5ELZ A;  5FRN A;  4JS4 A;  4EP4 A;  3NH1 A;  4OVL A;  3MWT A;  1BI4 B;  3C95 A;  1GLC G;  5DMR A;  1VSE A;  4IZ9 A;  4BWJ A;  3DLK A;  5AQU A;  1NKE A;  3J7A P;  3H1Q A;  3ZT1 A;  3QO9 A;  1GOB A;  5CY4 A;  5AQJ A;  5C15 A;  3O9R A;  1HPM A;  3KZB A;  4FLU A;  2P9S B;  1ITG A;  4JI0 K;  4JKD A;  3TAR A;  4BRQ A;  1ATR A;  4OKJ A;  5M1Q A;  4BVP A;  2HHX A;  2NRR A;  1J5O A;  1GLB G;  4KB0 A;  2FBT A;  1SZ2 A;  3HTV A;  4CGD A;  1R59 O;  3DYA A;  1TK0 A;  3CM5 A;  3MX2 A;  4IBN A;  4O55 A;  1XHZ A;  4BC2 A;  1C0T A;  1SKR A;  5KPT A;  1TGO A;  3TTF A;  3U4L A;  2VYP A;  3U8X A;  5FLX O;  4E7L A;  3VET A;  1JXE A;  2YHA A;  2GV9 A;  3A5M C;  2D0C A;  3TAP A;  4DQQ A;  1HLU A;  4DQ8 A;  4DR7 K;  3LPT A;  4Q5V A;  1L5U A;  3NDK A;  3SPZ A;  4AQY K;  1VHX A;  3MEE A;  4NLC A;  1IKW A;  1VQO N;  2P9P B;  3C7N A;  2UU9 K;  3HK2 A;  4PUO A;  2YJE A;  3THY B;  4KHU A;  3P39 A;  2A42 A;  3AA4 A;  4LSN A;  4DTS A;  2O8C A;  4E19 A;  3VTH A;  4DWI A;  3CFR A;  1XNR K;  3CC4 N;  4J8F A;  3EE8 A;  3ZT2 A;  3DRP A;  1NGJ A;  1X3M A;  2FBX A;  5KQ8 A;  1REV A;  4RW9 A;  4FK2 A;  2AP1 A;  4CK1 A;  3V9U A;  1H1V A;  3HVT A;  4DSK A;  2FSJ A;  1NLV A;  3LDL A;  1OKJ A;  4IOC L;  4BE1 A;  3OYF A;  1HNI A;  5KPZ A;  4GMJ B;  3TI0 A;  3F9K A;  2F9T A;  4O8K A;  2KZZ A;  3OYK A;  2OAN A;  4LF4 K;  3HM8 A;  3VA0 A;  3RWU A;  3A5N C;  1YIT N;  2G8U A;  4FOI A;  3HL8 A;  1BG3 A;  3DRS A;  1BGX T;  3IG1 A;  4IDK A;  3MWP A;  2YHB A;  4BE0 A;  1KVC A;  5BPM A;  3HZ6 A;  4RTF D;  2P9L A;  1NU0 A;  2A3Z A;  3BZK A;  2FF3 B;  2P9I A;  3VEV A;  1NJW A;  3U9Z A;  3L2R A;  4I6M B;  2AA4 A;  2OPR A;  4ILH A;  4BC5 A;  4ZTF A;  2RKI A;  4CHO A;  3G6E N;  3IMX A;  5EU7 A;  3SAF A;  3I8B A;  4KHQ A;  4DTX A;  3ASM A;  5E84 A;  4MLH A;  5C25 A;  3OYJ A;  1T44 A;  3MED A;  2NRW A;  2YJF A;  5A2Q O;  1QSY A;  1IKY A;  3ZSO A;  3OYC A;  3H45 C;  4BQL A;  4GVE A;  2WUS A;  4AM7 A;  1Q9Y A;  3O3F A;  4CJW A;  3HT3 A;  4IJA A;  3WXJ A;  1VK0 A;  5BN9 A;  4Y1D A;  2GWK A;  3G4S N;  4BRO A;  1VSJ A;  4GVM A;  3SK3 A;  4EZ9 A;  1L3V A;  2RN2 A;  3HPO A;  4DTM A;  3UKU A;  1KSP A;  4W5N A;  3DM2 A;  4O8U A;  5DK5 A;  4FZZ A;  4C1N I;  1BWF O;  2KFN A;  1X1P A;  4CVN E;  2A40 A;  2W40 A;  4FJG A;  3TAM A;  3A0I X;  1KTQ A;  1HQU A;  4ZTJ A;  3SBT A;  1JKH A;  3ZSX A;  3VGM A;  1I39 A;  3M8S A;  3AVF A;  4JEP A;  3DLB A;  2G8W A;  2P9K B;  2GBZ A;  4BDP A;  3CI5 A;  4AH9 A;  3SQ0 A;  4FZY A;  4E7H A;  3U3G A;  1RDC A;  1Y64 A;  1W0H A;  3QML A;  2PBD A;  2BGG A;  2YHW A;  2HMP A;  2ZGY A;  3O9Q A;  4Z4G A;  2DFF A;  4A2B A;  4CEO A;  1BQM A;  4JAX A;  1D9F A;  2UXB K;  3TPQ A;  1V4T A;  4HWI A;  4GKJ K;  3NE6 A;  2ZGZ A;  2E20 A;  3VTI A;  1S72 N;  2JLE A;  4JKC A;  4JHD B;  4JRQ A;  1QVG M;  3PSI A;  5AQT A;  1Q9X A;  4OPA A;  2FSN A;  3E1Y A;  3ID6 A;  4DFJ A;  3VEW A;  4DV2 K;  3KKS A;  3O6W A;  3MCP A;  1NJI O;  1R0A A;  3VGL A;  3QDK A;  3C94 A;  5AQS A;  4CJU A;  2QWO A;  4TSX A;  4ELV A;  4BRP A;  4B9Q A;  1GLL O;  3RR8 A;  2F4V K;  5DM6 L;  1MWK A;  1NGD A;  2QWR A;  3AGR A;  1T03 A;  3FZL A;  1WBD A;  3M8R A;  1U6Z A;  3VMF B;  1HQE A;  4DR5 K;  2CH5 A;  3CJA A;  3IAY A;  1WUA A;  1TYQ B;  1BIZ A;  2VQE K;  3LAM A;  3SQ1 A;  3QFU A;  5BRF A;  4IXC A;  5HRN A;  2X74 A;  3KK2 A;  2D0P A;  3VQB A;  4B3S K;  4H0Y B;  2HNZ A;  3V1R A;  1BL3 A;  4M3R A;  3LP3 A;  4ELT A;  4DSJ A;  3AVN A;  3NFA A;  3OS1 A;  3ZT4 A;  1N32 K;  2DPN A;  5AZI B;  3L2U A;  1L3T A;  1LCU A;  4GKK K;  3AVA A;  4EHT A;  3TAB A;  1T7P A;  3HO1 A;  3TSU A;  5CZ2 A;  3A8Y A;  3S3O A;  4DS5 A;  1TAQ A;  4QAG A;  4BC4 A;  2OTJ N;  2OA8 A;  1N33 K;  3ZX2 A;  4KTZ A;  3UKR B;  4OJR A;  2O4G A;  3FZH A;  3OYN A;  2I7N A;  1UWB A;  3CCV N;  2QM1 A;  3DRR A;  1YTA A;  2QKB A;  3MXJ A;  3TAF A;  4L3Q A;  4WFB L;  3CPW M;  4K8X A;  1WLJ A;  1WSE A;  3J81 O;  3I55 N;  3CET A;  5AZJ A;  4XH4 A;  4G9Z A;  3ZT0 A;  3J8A A;  4E7J A;  2HBJ A;  3KLE A;  1NGI A;  2HOE A;  3CYM A;  1K9M O;  4JK9 A;  3SUP A;  3MN5 A;  1RNH A;  4DV6 K;  3H3N O;  3Q7C A;  4B1W B;  5EXW A;  4Z0U A;  4MLE A;  4IWV A;  4OLB A;  4N41 A;  5CZ1 A;  4O4G A;  1Q86 O;  2F9W A;  3W0L A;  1CXQ A;  4IKF A;  3MN7 A;  4WYB A;  3DXK A;  1NK9 A;  4UQG A;  4RWT A;  1U04 A;  4C8K A;  4OPK A;  1XI1 A;  4BRL A;  4JI3 K;  2E2P A;  3MEC A;  4BRK A;  1RCH A;  3CJC A;  3PX0 A;  3SAH A;  1TKD A;  4Y1C A;  1HYV A;  2Z1I A;  5C2D A;  4M3U A;  2ZJQ L;  2NRZ A;  3QER A;  4KI6 A;  4JLH A;  2UYT A;  2Q0R A;  2UUA K;  4B3T K;  2OCE A;  4ID1 A;  4LF9 K;  3ZCM A;  4JD2 A;  1VQ5 N;  2A1S A;  3K5L A;  2HVI A;  4AM6 A;  3HVR A;  4B8A B;  4A5B A;  4JKG A;  1HNZ K;  3GDQ A;  3WUH A;  2GTD A;  3CCR N;  4CEA A;  2A1R A;  2PAV A;  4NB4 A;  3F9M A;  1L3U A;  4BR2 A;  3L2Q A;  2E1Y A;  3C7N B;  5AQI A;  3SQ2 A;  1EP4 A;  2P9N A;  5J2M A;  2RHK A;  5FRO A;  4AIL C;  2O8C B;  3AVL A;  4JKF A;  1C0F A;  4AF1 A;  3O3G A;  3KIO A;  3G0Z A;  3TTD A;  2CGL A;  3PSF A;  1N5Y A;  3IFR A;  5AR0 A;  3QBW A;  1K8K A;  1Z26 A;  4LF7 K;  1C0U A;  3SI6 A;  2AJQ A;  1NK7 A;  4BR9 A;  2ITG A;  3BF3 A;  1Z6R A;  3BP8 A;  4AHV A;  2QWL A;  3CFP A;  1QZ5 A;  4FJM A;  3AO2 A;  2P1J A;  1P90 A;  3HXM A;  3CXC M;  4CHP A;  3ULE A;  3VEZ A;  4DCH A;  4CFB A;  3TWH A;  1VSF A;  5HLF A;  1LOT B;  4I7F A;  4FJ8 A;  2QW9 A;  3CJB A;  4DR3 K;  3ZET A;  3VQC A;  3IDH A;  4W5R A;  1JXB A;  4DR6 K;  3ZEU A;  3ATV A;  4AHT A;  3B6O A;  3RMD A;  2O4I A;  5LY3 A;  2QK9 A;  1Q82 O;  3NMU A;  2O8D A;  4PL7 A;  2OYQ A;  2P9L B;  3P1G A;  5FPN A;  2XO7 A;  2P9I B;  3L4I A;  3AVM A;  4FLZ A;  4JYA K;  3CF5 L;  1KC8 O;  4U67 L;  1F21 A;  3LM9 A;  3CME N;  1Q7Y O;  3VF4 A;  3FZF A;  1HYS A;  1JJ2 M;  2VG5 A;  1C0G A;  4B8C A;  4N47 A;  4GY2 B;  5MLC Q;  2NRX A;  4KAZ A;  2V51 B;  1DGK N;  5C2F A;  4CJP A;  1VQ9 N;  5DM7 L;  3NF6 A;  4CEF A;  4CZI A;  1P8Z A;  3LZJ A;  1WAJ A;  3OHR A;  4LFB K;  3SPY A;  3O08 A;  4CJE A;  1J53 A;  1YHQ N;  2A41 A;  2Z1G A;  4C8L A;  4FLT A;  4A57 A;  5KPR A;  3N4P A;  4WFA L;  2O8E A;  3OYD A;  4YOU A;  2VG7 A;  4CEB A;  1XHX A;  2ASP A;  3MMV A;  1YJW N;  2DFH A;  3C6A A;  3NF7 A;  3O1B A;  1TVR A;  3VEO A;  1T6D A;  4L8R B;  3UKU B;  2BAN A;  1QVF M;  1DTQ A;  1HR0 K;  1VSK A;  1B9D A;  1YJ9 N;  1KVA A;  1WSJ A;  1J5E K;  3LP2 A;  4Z4H A;  1RBS A;  4FWL A;  1C1B A;  1RDA A;  4KPY A;  5JIC A;  3IRX A;  2B5J A;  3IKM A;  3THW A;  4C8O A;  1FKP A;  4MQ3 A;  4DTN A;  4H0P A;  3K2P A;  3SLC A;  1YF5 L;  1OVY A;  2UXC K;  3ZYY X;  2PY5 A;  3TAN A;  1EO1 A;  1A5V A;  4LY7 A;  4JK8 A;  3D7E O;  4KKO A;  1S1X A;  1S6P A;  3O5B A;  3D2E A;  4KH5 A;  3SQ4 A;  3KK7 A;  1QQO A;  1N36 K;  1Q8I A;  5FRM A;  2FLO A;  2NRV A;  3CD6 N;  4N76 A;  2D5R A;  4HTL A;  3MN9 A;  3AV9 A;  4OPJ A;  4CK2 A;  1ESV A;  4E89 A;  2VWJ A;  1XMO K;  4J2D A;  3R1X A;  4CJS A;  3L3V A;  2XY5 A;  4DU3 A;  2IVN A;  1HNV A;  4DLG A;  2G8I A;  4DV1 K;  4PKI A;  2KFZ A;  3EKS A;  4BDZ A;  4J2B A;  4F8R A;  3DLL L;  1Z25 A;  1XUP O;  4EAH D;  2ATQ A;  3LAK A;  3OA9 A;  3QBX A;  1BUP A;  1TKZ A;  4EIA A;  3I56 N;  3QEP A;  1X9S A;  3CJ7 A;  1VQL N;  1FK9 A;  4JI5 K;  3NH0 A;  1VQ6 N;  3KLG A;  2YKM A;  1HNW K;  3TSQ A;  3DJC A;  1WSH A;  2G8V A;  2HHS A;  1RTJ A;  4C23 A;  4DU1 A;  4A62 A;  3V4I A;  1M1K O;  4FWP A;  1ZXO A;  4C8M A;  1BHL A;  4JI8 K;  3K58 A;  3SMS A;  3NVM A;  4XH5 A;  1TL1 A;  2XY6 A;  3NH2 A;  4U7B A;  1YAG A;  3VPZ A;  4NYN A;  1KFD A;  3MX5 A;  4DV7 K;  4K0K K;  3V1Q A;  3HP9 A;  4KFB A;  3J80 O;  3PX6 A;  3CIP A;  4B9S A;  4DTU A;  1KD1 O;  4DB3 A;  4H03 B;  3DLH A;  3CG7 A;  3MEG A;  5E41 A;  2A6A A;  3DI6 A;  1S1U A;  4O0J A;  1X9W A;  1WN7 A;  4BC3 A;  3K5N A;  4CFA A;  3HRG A;  2D0A A;  4CGF A;  3L4Q A;  5C24 A;  3AVH A;  5AZJ B;  3BEX A;  4EHU A;  5LL6 Z;  1FXX A;  1UOC A;  4FJK A;  5I3U A;  2ZQB A;  2V7Y A;  4X66 K;  4FZX C;  4H5V A;  2QWN A;  2QXF A;  2I5J A;  4CI6 A;  3ENH A;  5JLH A;  1BOT O;  3VQE A;  4CJV A;  3KHY A;  2VGN A;  3AVJ A;  3CJ9 A;  2B4J A;  3CFO A;  4DQR A;  2LSN A;  3ZSR A;  4DFK A;  5BPN A;  3DXK B;  1S1T A;  3L8B A;  4DV5 K;  1QE1 A;  3UB5 A;  3H08 A;  3FZK A;  1S22 A;  4H8K A;  2PFU A;  2F96 A;  4DV3 K;  4MDB A;  4KH6 A;  3L6Q A;  4BRG A;  4FM2 A;  2WTU A;  1DEJ A;  4FM1 A;  4NLB A;  3K57 A;  3UE5 A;  4B9U A;  1NOY A;  2YKN A;  3E9L A;  4E7I A;  4CJT A;  3VN5 A;  1VRT A;  4CGH A;  3KK3 A;  4H5T A;  3HSC A;  2F8T A;  4EZ6 A;  4BRN A;  5JVG L;  3FFK B;  3FLC O;  4JD2 B;  4NO7 A;  1JLC A;  1OVQ A;  1A5W A;  3FE1 A;  2JWK A;  4FSV A;  3CC2 N;  1RBT A;  4BRD A;  5HRR A;  4HUF A;  4LF8 K;  4NYF A;  2OZS A;  3MXM A;  3L3U A;  3SAG A;  2KW4 A;  3CQ8 A;  2HHV A;  2HST A;  4DKW A;  4Z4F A;  1E3M A;  4XIU A;  2YV0 X;  2F7T A;  2HVH A;  2NUB A;  1NMN A;  1NKC A;  1IG9 A;  2EX3 A;  3CM6 A;  2P9N B;  1NGE A;  1QS4 A;  4FWS A;  1NK6 A;  1U2V A;  4CF1 A;  4OX9 K;  1U4B A;  1OH5 A;  4JKA A;  1DKG D;  1G99 A;  4PKH A;  4IFY A;  2D4W A;  3T7Z A;  1K8K B;  1BIU A;  3FR0 A;  1JLE A;  2QI2 A;  4WF9 L;  2HBK A;  2OPS A;  4RW7 A;  3V6D A;  4PQU A;  1BA0 A;  4PY5 A;  2G8F A;  1XNQ K;  4CJL A;  5HRP A;  3SUN A;  2YNF A;  4CZK A;  2XHB A;  3NGZ A;  2NZT A;  3PX4 A;  5BR9 A;  1Z05 A;  3QIC A;  3ZET B;  4DQS A;  4O5B A;  1RDU A;  1KAZ A;  5CHI A;  1W7A A;  4CZJ A;  1QHT A;  3ZEU B;  1VSD A;  1YTU A;  1VSI A;  3D2F A;  2O8D B;  4FCY A;  3PLA A;  1GOA A;  4BRA A;  3B8A X;  1TKT A;  2ZM6 K;  1SUQ A;  3CCS N;  3S3M A;  1IV0 A;  5HL7 L;  2HHQ A;  3MCA B;  3VQ7 A;  1ZBH A;  5HRS A;  1EWR A;  4DUZ K;  5EVZ A;  5EOY A;  3J7Z O;  3VQ4 A;  1IO2 A;  1IBK K;  1N34 K;  4M42 A;  3LWL A;  4DF8 A;  4CF8 A;  1XC3 A;  3TR8 A;  1KAY A;  3GE1 A;  4ILJ A;  3MK6 A;  4OPH A;  4B9V A;  1WB9 A;  4CEE A;  1TUY A;  5F1X A;  3RSE B;  3EN9 A;  3VA3 A;  1NWK A;  2BDP A;  1RTI A;  3HOS A;  5C0Y A;  1C1A A;  5AQF A;  4BR0 A;  3OVN A;  2KHO A;  3WNH A;  4IEE A;  3AO1 A;  4DQP A;  2VCP A;  1ZBL A;  3O4W A;  4FPA A;  2VG6 A;  2J4R A;  3OS2 A;  2HHH K;  1W2B M;  1N6Q A;  1SKS A;  4HUE A;  2O8F B;  3RR7 A;  4CE9 A;  4FM0 A;  4IFE A;  3OJS A;  1RT6 A;  3E01 A;  3OJU A;  2YNH A;  1D5A A;  3AA5 X;  1DT9 A;  3H3O B;  5GIO A;  4DTP A;  4DSI A;  3EEQ A;  3JAM O;  4Y0W A;  3SUO A;  5FDL A;  1RDB A;  3ALY A;  3D2E B;  3SJH A;  3O4N A;  5HBM A;  5F0X A;  4IJN A;  2ETJ A;  5AJ3 K;  4AHR A;  1MU2 A;  5E26 A;  1C0M A;  1U48 A;  4GV6 A;  4BGB A;  3I8D A;  2E2N A;  4J2E A;  2W41 A;  5M1N A;  1WNS A;  5SWM A;  1K73 O;  2E8A A;  4B1V A;  4KHP K;  3THX A;  3HP6 A;  5KI6 A;  1JL1 A;  1S1W A;  3K0S A;  3VEN A;  2FBV A;  5JVH L;  2I7P A;  4BY9 C;  4DFP A;  1RIL A;  3V9S A;  4CEZ A;  3R8E A;  4E1M A;  4BG8 A;  3KWI A;  4KO0 A;  4M7Y A;  5AQP A;  2QA4 N;  1RDD A;  3HST B;  3THV A;  2PZS A;  2WC9 A;  4FJH A;  2RPI A;  3LL3 A;  1NJY A;  2D0B A;  3OBY A;  1CXU A;  3SCX A;  4KHN A;  1ASW A;  3NF8 A;  1ZYQ A;  1XC9 A;  3F5T A;  3O80 A;  4IFV A;  3K9J A;  3D0P A;  1LW0 A;  1NKB A;  2G8H A;  2V7Z A;  4DS4 A;  3OYM A;  4WCE L;  2ASO A;  5FPE A;  3P83 D;  1LV5 A;  1WAF A;  2VWK A;  5BRD A;  3WQU A;  4E1N A;  4CHN A;  3ZSY A;  1JCG A;  1DTT A;  5GIP A;  4DR1 K;  1KXP A;  4W5Q A;  1RGI A;  2KZM A;  2DY4 A;  1GLD G;  2EHG A;  1D4X A;  4DV0 K;  3ENO A;  5M1K A;  5AQY A;  3ENB A;  1HKG A;  3JSM A;  5B8H A;  4CEC A;  4RW6 A;  3SYZ A;  3F73 A;  2Y1I A;  2P5G A;  4CF2 A;  1NGB A;  4KTW A;  4E1J A;  3WEE A;  4BRH A;  5AFU A;  3WQT A;  3PO4 A;  4CIE A;  2GWJ A;  4FJI A;  3CJ1 A;  1BQN A;  3KD5 E;  2RE2 A;  3RRH A;  3AO5 A;  3MXI A;  4N5S A;  3ZX3 A;  2GEM A;  1RT1 A;  4F4K A;  3CHW A;  3ID8 A;  3K9K A;  2E88 A;  3LAL A;  2ZD1 A;  5C10 A;  3KKR A;  4LFC K;  3RMB A;  3IUC A;  4WFN L;  3T1Y K;  1HKC A;  3CQX A;  3NGY A;  4KI4 A;  3R3L A;  4IOA L;  2CH6 A;  3S41 A;  3T1H K;  1SL1 A;  3BDP A;  1ILY A;  1TK5 A;  4JN4 A;  2PYJ A;  2DTU A;  4OGC A;  3O3H A;  5J2P A;  4H5N A;  4CJK A;  3KD1 E;  3WXM B;  1EWQ A;  1YJN N;  3HJF A;  1GLE G;  3VQD A;  4JI1 K;  2QEX N;  2HW3 A;  5AQL A;  5J2N A;  4FJ7 A;  2KKZ A;  1O1W A;  4YOV A;  5AQR A;  4R5P A;  1QQC A;  2IOC A;  2P9U A;  1NGG A;  4H0X B;  1SV5 A;  1OH8 A;  2JWL A;  5J1E A;  3EYZ A;  3AA3 A;  1S9E A;  3BF1 A;  4FVU A;  5TKY A;  4BE2 A;  3PIP L;  4C8N A;  4R79 A;  1S9G A;  4CJ3 A;  1NM1 A;  2OPQ A;  3AO3 A;  3T3F A;  1RFQ A;  1JLB A;  4CGJ A;  1D8Y A;  4CCH A;  4CJR A;  1JLQ A;  4OKE A;  5AQW A;  3QFP A;  3W3D A;  3ZSZ A;  4CJF A;  5EX5 A;  3P38 A;  4GV3 A;  4CW7 B;  1ZBF A;  1KLN A;  2BE2 A;  2KTQ A;  2Z1J A;  3M1F A;  3IS9 A;  2VGM A;  5J2Q A;  4K43 A;  1QQN A;  1LW2 A;  1BCO A;  2E2Q A;  4Z4I A;  5LJV A;  4RCH A;  5K14 A;  2D0O A;  2E4L A;  3ITH A;  1ASU A;  3T1A A;  4CK3 A;  3P4I A;  1Q18 A;  1SKW A;  3O1W A;  5AQQ A;  1CZA N;  3EO3 A;  1U2V B;  3SMP A;  1KVB A;  2KLA A;  1SS6 A;  1WOQ A;  1SAZ A;  4O0I A;  1LAW A;  4F3T A;  1JLF A;  4DLE A;  1RT5 A;  2OTL N;  3AGK A;  2P9K A;  1VQP N;  1IG8 A;  1YUW A;  4AHS A;  4K25 A;  1S3X A;  4FYD A;  2HHU A;  4Q0B A;  5JS1 A;  4AHU A;  4FLV A;  1YT3 A;  2WON A;  2IAJ A;  5GIN A;  3LDS A;  2GX9 A;  5ADX A;  5SZT A;  2YHY A;  1UAX A;  2Q97 A;  2FSK A;  3KWG A;  4ISF A;  4JNE A;  5AQM A;  4CJ4 A;  4JI4 K;  3D2F B;  4YNQ A;  3SBG A;  1NK4 A;  4G1Q A;  3CPE A;  5HOO A;  3ISN C;  5KTQ A;  1NJZ A;  4QCL A;  1V4S A;  3DAW A;  2CGJ A;  4FLW A;  1BU6 O;  1OH7 A;  1JCE A;  3GOI A;  1K8A O;  3GG4 A;  1SQK A;  2Y1J A;  5JMV A;  3BZC A;  3SUQ A;  1RDW X;  1U49 A;  1C1C A;  3HI0 A;  1BO5 O;  4FWR A;  3SZ2 A;  4B3M K;  3F2K A;  3CC7 N;  2YHX A;  5GAE P;  3KLI A;  1TKX A;  4CER A;  4BR4 A;  4LFA K;  4CED A;  1KLM A;  4KH4 A;  4I2Q A;  2XY8 A;  1TUU A;  3HOT A;  4FJN A;  3ZX0 A;  4BR5 A;  4FWO A;  5AZI A;  3TAG A;  2QWM A;  4ZHR A;  1VRU A;  4CZF A;  4A61 A;  4B1Y B;  4LD0 A;  4FJL A;  1BDG A;  1YVN A;  1KFS A;  1ATN A;  4FWM A;  4H4O A;  4YOR A;  4H0O A;  3SV4 A;  3VQQ A;  3AVI A;  1JLG A;  4F2R A;  1GLF O;  1NG9 A;  5M1F A;  3M3Z A;  4DR4 K;  4UY8 O;  3C0B A;  1IKX A;  1NGH A;  3LP0 A;  1YIJ N;  3MN6 A;  2BTF A;  1KRP A;  4CZH A;  3U9D A;  3AAP A;  1NOZ A;  3MAQ A;  4QOZ B;  2IDO A;  2HNY A;  4V19 S;  4IO8 A;  5JS2 A;  4CJ5 A;  3U6F A;  2YNG A; 
#chains in the Genus database with same CATH homology
 4C1N K;  4L3Q A;  2BUP A;  2V52 B;  3FR0 A;  3L0Q A;  2YCH A;  4CJ7 A;  2QI2 A;  4WFB L;  4WF9 L;  3CPW M;  2HBK A;  4MO5 A;  4ILG B;  1BA0 A;  3TSP A;  4Z94 A;  3I55 N;  3CET A;  5AZJ A;  5F2R A;  2H3G X;  3AAR A;  4XH4 A;  5LJW A;  4G9Z A;  3J8A A;  2HBJ A;  4BG9 A;  1X3N A;  1NGI A;  2HOE A;  4CZK A;  1K9M O;  2NZT A;  3C65 A;  5BR9 A;  4JK9 A;  4CZG A;  3LM2 A;  1Z05 A;  3MN5 A;  3QIC A;  3ZET B;  4CZL A;  3H3N O;  3DXM B;  3Q7C A;  4BRM A;  1RDU A;  2A5X A;  2Q31 A;  4YOY A;  3OBW A;  1KAZ A;  5EXW A;  4B1W B;  4MLE A;  4CZJ A;  5AQV A;  4IWV A;  5GAG P;  5CHI A;  4IO9 L;  3ZEU B;  1T6C A;  4CZE A;  3D2F A;  1Q86 O;  2F9W A;  3W0L A;  3CCM N;  3CMA N;  4JKB A;  4EFH A;  3RVC A;  1NGC A;  3PLA A;  4BRA A;  4A2A A;  3B8A X;  3MN7 A;  1QZ6 A;  4BVO A;  4WYB A;  1BA1 A;  3DXK A;  3VEY A;  5HL7 L;  3CCS N;  3MCA B;  1MDU B;  3TU5 A;  3VF6 A;  4RWT A;  1HKB A;  5FPM A;  3WT0 A;  3E9P A;  5EVZ A;  4BRL A;  4BQZ A;  5EOY A;  3RSE A;  4GV9 A;  2E2P A;  3J7Z O;  4JHD A;  4BRK A;  2NLX A;  3CJC A;  4DHY A;  1VAZ A;  3QB0 A;  3E66 A;  3SAH A;  5C2D A;  1ZBS A;  2YX6 A;  4IDH A;  2GEL A;  3G25 A;  2NRZ A;  3WXK A;  1XC3 A;  2ZJQ L;  1KAY A;  3GE1 A;  4ILJ A;  1W97 L;  3MK6 A;  4OPH A;  5AFU H;  1VQN N;  2UYT A;  2Q0R A;  1TUY A;  4XH1 A;  5F1X A;  3H6E A;  3RSE B;  3A5L C;  3EN9 A;  5BRH A;  1ATS A;  1NWK A;  4JD2 A;  3JXU A;  4A59 A;  3HOS A;  1XQS C;  2QWP A;  3HBT A;  4IOX A;  1VQ5 N;  5C0Y A;  3JS6 A;  5AQF A;  4AM6 A;  4BR0 A;  4FPB A;  2KHO A;  4A5B A;  2HF4 A;  2BH1 A;  4IEE A;  4CBU A;  1TYQ A;  4JKG A;  3O9T A;  5AQG A;  3GDQ A;  4FWK A;  2GTD A;  2VCP A;  3WUH A;  3CCR N;  1NGA A;  2PAV A;  3E9O A;  4NB4 A;  3F9M A;  4CD1 A;  3O4W A;  4BR2 A;  3CCJ N;  2E1Y A;  1X9J A;  3N4Q A;  4FPA A;  3C7N B;  2J4R A;  5AQI A;  1QQM A;  4BRI A;  2NRH A;  1W2B M;  1KQS M;  3WEE B;  5BPL A;  4M7X A;  2P9N A;  2RHK A;  1YXQ A;  4KBO A;  1ZC6 A;  4JKG B;  1IJJ A;  1VQ7 N;  1KD1 O;  5H1S Q;  4IFE A;  3CCU N;  4JKF A;  3H1V X;  1C0F A;  1GLJ O;  5TKW A;  4AF1 A;  3FZM A;  4PL8 A;  3TTD A;  3EE9 A;  5I9E B;  1DT9 A;  2CGL A;  2HF3 A;  3H3O B;  3UKR A;  3O9S A;  5GIO A;  2HBL A;  2Q1N A;  3IFR A;  5AR0 A;  3QBW A;  4CBX A;  5BN8 A;  4QS8 A;  1K8K A;  4YDU A;  4Y0W A;  3M6G A;  4H0T B;  1T3V A;  4WQ5 A;  3D2E B;  4BR9 A;  3G71 N;  3BF3 A;  1Z6R A;  3BP8 A;  3SJH A;  2ZJP L;  3M5R A;  2IVP A;  5ELZ A;  1NBW A;  2QWL A;  4YOT A;  1QZ5 A;  5F0X A;  4IJN A;  1P90 A;  1VQK N;  3CXC M;  3ULE A;  3VEZ A;  4DCH A;  5E26 A;  3P31 A;  1QHA A;  4GV6 A;  3MWT A;  4BGB A;  1LOT B;  3LDO A;  4FWQ A;  1EQY A;  2E2N A;  1MWM A;  1GLC G;  2QW9 A;  4ISG A;  3CJB A;  4IZ9 A;  2GUP A;  2W41 A;  5M1O A;  4LC9 B;  5AQU A;  3ZET A;  5M1N A;  1K73 O;  3DXM A;  2E8A A;  4B1V A;  3IDH A;  3H1Q A;  3ZEU A;  3ATV A;  1YI2 N;  5AQJ A;  5C15 A;  3O9R A;  5LY3 A;  1HPM A;  3EKU A;  3KZB A;  3VEN A;  1Q82 O;  3NMU A;  3ULE B;  3H46 O;  2P9S B;  4PL7 A;  2P9L B;  5FPN A;  2P9I B;  3L4I A;  4JKD A;  5JVH L;  4BRQ A;  2P9U B;  3LDN A;  2I7P A;  4BY9 C;  3CQY A;  5AQZ A;  3CF5 L;  1KC8 O;  1ATR A;  2FF6 A;  5M1Q A;  4BVP A;  2NRR A;  4U67 L;  3R8E A;  3LM9 A;  4BG8 A;  1GLB G;  1Q7Y O;  3KWI A;  3VF4 A;  3CME N;  3FZF A;  1SZ2 A;  3HTV A;  4M7Y A;  1R59 O;  5AQP A;  3VOV A;  1JJ2 M;  2ZF5 O;  2QA4 N;  1C0G A;  4GY2 B;  5MLC Q;  3MX2 A;  2WC9 A;  4K42 A;  2NRX A;  2V51 B;  1DGK N;  5C2F A;  3LL3 A;  4B1Z A;  3LDQ A;  4BC2 A;  3OBY A;  5DM7 L;  1VQ9 N;  4FO0 A;  4CZI A;  5JLF A;  2WBN A;  1P8Z A;  3MDQ A;  5KPT A;  3TTF A;  3U4L A;  2VYP A;  3OHR A;  2WFB A;  3U8X A;  3F5T A;  3O80 A;  3VET A;  3O08 A;  4F9O A;  4MDA A;  3CCL N;  3K9J A;  3VEX A;  2V7Z A;  1YHQ N;  5ADX H;  2A41 A;  4WCE L;  3A5M C;  4A57 A;  2ASO A;  5KPR A;  3N4P A;  5FPE A;  4CBW A;  4WFA L;  5GAD P;  5BRD A;  3WQU A;  1HLU A;  4YOU A;  4DQ8 A;  5C12 A;  1JCG A;  5GIP A;  2ASP A;  1KXP A;  2IIR A;  3MMV A;  1YJW N;  1RGI A;  3C6A A;  4FOE A;  3O1B A;  1HX1 A;  5AQX A;  3ATU A;  3VF2 A;  3VEO A;  1GLD G;  1T6D A;  3GBT A;  3UKU B;  4B1X B;  1D4X A;  4NLC A;  3ENO A;  4GNI A;  5M1K A;  5AQY A;  1QVF M;  2E1Z A;  3ENB A;  1HKG A;  1VQO N;  4B1U B;  5B8H A;  2D1K A;  2P9P B;  1YJ9 N;  3C7N A;  1NGB A;  4JKE A;  4E1J A;  4FWL A;  4WQ4 A;  2Q2R A;  4XEI A;  1HJO A;  3WEE A;  3WQT A;  4BRH A;  1O13 A;  5AFU A;  2VWB A;  5JIC A;  2GWJ A;  2YJE A;  3CJ1 A;  3IKM A;  3O8M A;  2Q0U A;  3P39 A;  2A42 A;  4IEI A;  2RE2 A;  1NGF A;  3VTH A;  4FL9 A;  3VER A;  4J8F A;  3EE8 A;  3CC4 N;  3ZX3 A;  1NGJ A;  2GEM A;  4H0P A;  1X3M A;  1YF5 L;  3SLC A;  1N8R O;  1OVY A;  3ZYY X;  3EZW A;  1EO1 A;  3CHW A;  3LDP A;  3ID8 A;  5AQN A;  3K9K A;  5KQ8 A;  2E88 A;  2NNW A;  4JK8 A;  3D7E O;  2AP1 A;  5C10 A;  1H1V A;  3A5O C;  5KQD A;  2FSJ A;  3O5B A;  3D2E A;  4KH5 A;  4BRE A;  4OO1 J;  3KK7 A;  1GLA G;  1QQO A;  3IUC A;  4JKH A;  1NLV A;  2FLO A;  3LDL A;  4WFN L;  1HKC A;  1OKJ A;  2NRV A;  4IOC L;  3CD6 N;  3CQX A;  5CR4 A;  4HTL A;  3MN9 A;  3R3L A;  5KPZ A;  4IOA L;  2YI1 A;  2CH6 A;  3S41 A;  3BUZ B;  2F9T A;  4O8K A;  1Q81 O;  1NMD A;  1ESV A;  4JN4 A;  1ILY A;  2OAN A;  3R1X A;  4H5N A;  3HM8 A;  3WXM B;  3A5N C;  1YIT N;  2IVN A;  4BGA A;  4FOI A;  1YJN N;  1BG3 A;  4YOX A;  1GLE G;  3MWP A;  4PKI A;  3EKS A;  5CE3 A;  2QEX N;  5AQL A;  5BPM A;  3DLL L;  1MA9 B;  1XUP O;  1E4G T;  2KKZ A;  3OA9 A;  4EAH D;  4YOV A;  5AQR A;  3HZ6 A;  2P9S A;  3QBX A;  1BUP A;  2P9L A;  4RTF D;  2A3Z A;  4EIA A;  3I56 N;  3CJ7 A;  1VQL N;  2FF3 B;  2P9I A;  2NRT A;  3VEV A;  2ZJR L;  2P9U A;  1NGG A;  3U9Z A;  4H0X B;  1VQ6 N;  2JWL A;  4I6M B;  4H5W A;  3BF1 A;  3TSQ A;  4FVU A;  3DJC A;  2AA4 A;  5TKY A;  4ILH A;  3PIP L;  4BC5 A;  4R79 A;  4C23 A;  3G6E N;  4A62 A;  3IMX A;  1NM1 A;  3TTC A;  3I33 A;  3SAF A;  1RFQ A;  4BRF A;  1M1K O;  4FWP A;  1ZXO A;  4A5A A;  3I8B A;  3SMS A;  3NVM A;  4CD3 A;  1HUX A;  4XH5 A;  5E84 A;  4MLH A;  5AQW A;  5GAH P;  1T44 A;  3O9U A;  2NRW A;  3QFP A;  3W3D A;  4U7B A;  4GV3 A;  1YAG A;  2YJF A;  3P38 A;  5EX5 A;  3VPZ A;  3M1F A;  3MX5 A;  2ZWH A;  2VGM A;  3VES A;  3H45 C;  2QTD A;  4BQL A;  5AQK A;  4GVE A;  2WUS A;  4K43 A;  4AM7 A;  1QQN A;  2E2Q A;  5LJV A;  4RCH A;  2D0O A;  4IJA A;  3WXJ A;  3CIP A;  3FGU A;  4YOW A;  3P4I A;  1Q18 A;  3O1W A;  5AQQ A;  1CZA N;  3EO3 A;  1U2V B;  4H03 B;  2GWK A;  5BN9 A;  4CZM A;  3R9P A;  3SMP A;  4DB3 A;  3G4S N;  4BRO A;  2KLA A;  2ASM A;  1SS6 A;  2A6A A;  1WOQ A;  1SAZ A;  4YDU C;  2EWS A;  3SK3 A;  3CCQ N;  5AQH A;  3NVK A;  4WQ5 C;  3PIO L;  2OTL N;  4BC3 A;  1VQ4 N;  3AGK A;  2P9K A;  1VQP N;  4FWN A;  1IG8 A;  1YUW A;  3UKU A;  3KVG A;  4JK7 A;  4K25 A;  4O8U A;  1S3X A;  3HRG A;  4PHT X;  3L4Q A;  4C1N I;  1BWF O;  5AZJ B;  3BEX A;  4EHU A;  5EY4 A;  2P9P A;  2A40 A;  2W40 A;  3A0I X;  2CGK A;  3SBT A;  2V7Y A;  5GIN A;  2ITM A;  3VGM A;  4H5V A;  2QWN A;  3DWL A;  4JEP A;  2GX9 A;  5ADX A;  2P9K B;  4CI6 A;  3ENH A;  2YHY A;  5JLH A;  3AY9 A;  3CI5 A;  1BOT O;  2QWQ A;  1VQ8 N;  2Q97 A;  2FSK A;  3KWG A;  4O5F A;  1Y64 A;  4ISF A;  4JNE A;  3KHY A;  4QS9 A;  3QML A;  2VGN A;  3CJ9 A;  5AQM A;  2PBD A;  2QXL A;  2YHW A;  3D2F B;  2HMP A;  2ZGY A;  3EL2 A;  3O9Q A;  4H5R A;  3SBG A;  3CPE A;  3VGK A;  5HOO A;  4A2B A;  4BRC A;  4JAX A;  1V4S A;  3TPQ A;  1V4T A;  3DAW A;  5BPN A;  2CGJ A;  3DXK B;  1BU6 O;  3D6R A;  4QS7 A;  2IVO A;  4HWI A;  3UB5 A;  1JCE A;  3GOI A;  3WXI A;  2Q36 A;  1K8A O;  3FZK A;  1S22 A;  2PFU A;  2ZGZ A;  1SQK A;  3GG4 A;  3GL1 A;  4PKG A;  2E20 A;  3VTI A;  5JMV A;  3C6H A;  3CER A;  4MDB A;  1S72 N;  1RDW X;  4KH6 A;  3L6Q A;  4JKC A;  4JHD B;  4BRG A;  1QVG M;  2HBM A;  3HI0 A;  1JCF A;  1BO5 O;  4FWR A;  5AQT A;  4OPA A;  1DEJ A;  2FSN A;  3E1Y A;  3F2K A;  3ID6 A;  4NLB A;  3UE5 A;  3CC7 N;  3VEW A;  2YHX A;  5GAE P;  3O6W A;  4ISE A;  1VQM N;  3MCP A;  3E9L A;  1NJI O;  3VGL A;  3QDK A;  4K41 A;  3Q7B A;  4M63 C;  5AQS A;  4H5T A;  4BR4 A;  2QWO A;  3HSC A;  1KAX A;  4H0V B;  4BRP A;  4B9Q A;  1GLL O;  4BRN A;  5JVG L;  5DM6 L;  5FPD A;  1MWK A;  3FFK B;  1NGD A;  2QWR A;  3AGR A;  3WXL A;  3FLC O;  5BRE A;  4JD2 B;  3FZL A;  4KH4 A;  4I6M A;  4NO7 A;  3CC2 N;  3FE1 A;  2JWK A;  1U6Z A;  4FSV A;  1TUU A;  3VMF B;  1M90 O;  3HOT A;  2CH5 A;  5M1P A;  3ZX0 A;  4BRD A;  3CJA A;  4BR5 A;  4FWO A;  3R6M A;  5AZI A;  1WUA A;  1TYQ B;  2QWM A;  5AQO A;  3AAQ A;  4CZF A;  2FXU A;  4A61 A;  3QFU A;  4B1Y B;  5BRF A;  3SAG A;  4IXC A;  2D0P A;  2HST A;  4DKW A;  4H0Y B;  3T69 A;  1BDG A;  1YVN A;  2F7T A;  1ATN A;  4FWM A;  4YOR A;  4H0O A;  4WQ4 C;  3CCE N;  4MO4 A;  1GLF O;  5M1F A;  3M3Z A;  2P9N B;  4UY8 O;  3C0B A;  1NGH A;  1NGE A;  2DPN A;  5AZI B;  3OW2 M;  1LCU A;  1YIJ N;  4EHT A;  3MN6 A;  4FWS A;  2BTF A;  4CZH A;  3U9D A;  3TSU A;  4BR7 A;  3A8Y A;  3AAP A;  1U2V A;  4BC4 A;  2OTJ N;  1E4F T;  4JKA A;  1DKG D;  1G99 A;  4PKH A;  3ZX2 A;  3UKR B;  2D4W A;  4IO8 A;  1J6Z A;  3FZH A;  3T7Z A;  2I7N A;  1K8K B;  3CCV N;  2QM1 A;  2E2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...