4IOXA

The structure of the herpes simplex virus dna-packaging motor pul15 c-terminal nuclease domain provides insights into cleavage of concatemeric viral genome precursors
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
255
structure length
225
Chain Sequence
PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTSDDLMVAVIMAIYLAAQAGPPHTFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tripartite terminase subunit UL15
publication title The Structure of the Herpes Simplex Virus DNA-Packaging Terminase pUL15 Nuclease Domain Suggests an Evolutionary Lineage among Eukaryotic and Prokaryotic Viruses.
pubmed doi rcsb
source organism Human herpesvirus 1
molecule tags Viral protein
total genus 70
structure length 225
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioxA00
4IOXA 3N4PA 3N4QA
chains in the Genus database with same CATH superfamily
1QVFM 3RR7A 1L5UA 4JI2K 3LAKA 3IS9A 2O8BB 1TKZA 4IXCA 4DQPA 2ZF5O 1X9MA 3J7ZO 4BC3A 4F2SA 3LWMA 3JSMA 2CGJA 2OA8A 4IEIA 4DTRA 4OLAA 3MWTA 2P5GA 3ZSXA 3EY1A 1K73O 4O0IA 3S9HA 3WT0A 4JKGA 1DLOA 5FDLA 2IGIA 2NRZA 3VMFB 2V7ZA 4JKEA 4DUZK 1EWRA 1KVCA 1ESVA 4MQ3A 3ZX0A 4CEOA 4AHVA 4F8RA 1BHLA 2HNZA 3B6OA 5KI6A 1HYZA 4IO8A 2E6LA 3HSTB 3CCMN 3TSUA 3VENA 4EZ9A 1T6CA 4JI1K 3K5LA 1DKGD 2XY5A 4M3TA 4F4KA 3UKRA 2E2PA 2P9UA 2IS3A 3VETA 1NGBA 3LP0A 4DU1A 1BCMA 1HKBA 2A1SA 3AVBA 2X6NA 1TUYA 4FWRA 4JS5A 3QEIA 1R59O 1VQ5N 2Z1GA 2BDPA 3FZLA 4CZJA 1N33K 3NF6A 5HLFA 2QKKA 1VRTA 1E4FT 3TAFA 1QVGM 1KFSA 3MDQA 4CEZA 5M1NA 4KI6A 1TK0A 1MA9B 4FM1A 1U6ZA 4OKEA 4B9MA 3OYHA 4IOCL 1SQKA 5BRHA 3H1QA 2QXFA 4H0PA 4Z4IA 3P31A 1NKBA 4BE1A 3O9SA 1JCFA 3QBWA 2FXUA 3RSEB 4FLZA 3BZCA 1S1VA 1KFDA 1ASVA 3AVCA 3D2FA 2FBTA 4M41A 1KC8O 5DK5A 1XMOK 3E01A 2IOCA 4DTUA 1Z25A 2YHBA 1O1WA 4B9QA 5M1PA 5HP1A 3OYIA 3VEXA 4M42A 1NGEA 2ASOA 3KK7A 1CXQA 3NH1A 5CYQA 2P9IA 1BO5O 1SUQA 1TL1A 1HPMA 1LWEA 2LSNA 3CHWA 3JS6A 3P1GA 2G8WA 4BGBA 2F9TA 3V9UA 3MXIA 3QEPA 5J2MA 4CECA 4YDUA 4BVPA 4BG9A 4EP5A 4E1JA 4FK4A 4K41A 1RILA 4BE0A 1WLJA 1Z05A 3FFIA 2B4JA 4FJ9A 1RTHA 2HBLA 1D5AA 1VQNN 4DR2K 1K8AO 1WAFA 4JD2B 4DSKA 3TAEA 3BDPA 4DSLA 4O0JA 5AQYA 3TTCA 5I9EB 5LMUK 1TK8A 1VQMN 1VQ9N 1HNWK 1LWCA 4DFJA 1HYSA 4KAZA 3V9WA 5KPRA 4JS4A 3U4LA 1NGAA 3NDKA 3S3OA 1L3SA 5EU7A 1C6VA 1WOQA 4H0VB 1NK7A 3R9PA 3ZEUA 2Q2RA 1TL3A 4C8KA 3Q7BA 4FJJA 4CW7B 3MCAB 4DSIA 2E2QA 2HBMA 4PQUA 4F2RA 4OPKA 3TR8A 3P83D 4OGEA 3MCPA 3ZSRA 4RW6A 5E84A 2ITGA 5JLFA 3EL2A 3S3MA 3K9KA 3CXCM 2QWMA 2WOMA 4CI6A 1NBWA 3KZBA 2QWQA 4C1NK 1SL2A 1WSJA 3CCLN 4H5WA 4A59A 2IDOA 4GKKK 4BRQA 3C0BA 3VTHA 4MO4A 3C94A 3CERA 2O4IA 4DTJA 4DTOA 4YOVA 4NCGA 4OPHA 3VQ9A 2OCEA 2D0CA 3VQ7A 5AFUA 5AZJA 4DQIA 1I94K 3DXMA 1JXBA 4G9ZA 1TKTA 5TKYA 1S3XA 4RG8A 2FSKA 4CZLA 4PA1A 4CZMA 4GNIA 2WUSA 5AQNA 4J2DA 3HL8A 4DFKA 3QEXA 3FZMA 3CQXA 3HPOA 5BPNA 4C8OA 4CJSA 3H1VX 2CH5A 2VG6A 2HBJA 5KGWA 4B1UB 5FRNA 1XNQK 3E9LA 3OJUA 4B3RK 3DLKA 5KPTA 4IZ9A 4PKHA 3QESA 1MWMA 2VCPA 5LL6Z 3QEWA 3LALA 3D6RA 4DQ8A 3A2FA 1SS6A 2QM1A 4OVLA 4OLBA 1JKHA 3I0SA 3GE1A 4E7HA 1GOCA 2OZMA 3MXJA 3OJSA 1SZ2A 2P9PA 2D0PA 1RT3A 1P8ZA 1QSLA 3SAGA 1VSLA 4W5TA 3Q7CA 4JRPA 4B9SA 1EETA 1ATNA 2FBVA 4O8UA 3JXUA 1HRHA 4J2BA 3DJCA 4W5RA 4GVEA 1Q7YO 5EXWA 4FWPA 2KZMA 1OKJA 1GLEG 3H3NO 1YJ9N 4LF5K 3QIPA 4B8CA 5I42A 1HKCA 4OKKA 1VK0A 1C0GA 3WQUA 1N5YA 3THYB 4DR5K 1WUAA 4NLBA 2P9NB 5C10A 3AVKA 5CR4A 3SCXA 4L3QA 3NCIA 4E7IA 1V4SA 4BC4A 5HRPA 4DR6K 3NF9A 1G99A 4CHZA 1NK5A 4IG3A 4F3OA 3SI6A 3J80O 3U6FA 3V1OA 5ADXA 1V4TA 4FLUA 4MO5A 4QS8A 2HHUA 1GLJO 2ETJA 5LMNK 1A5WA 4A62A 1HNZK 4HUGA 2HVIA 5CZ2A 3AY9A 4E89A 1L3UA 4B8AB 2V52B 3DLEA 3ID6A 3THXB 2FBXA 2O8EA 3LANA 4N56A 2BANA 2YNIA 1RDUA 5LJVA 1D8YA 1VQKN 3PO4A 3L2WA 4CEAA 3KLIA 5AQHA 3R6MA 4HVJA 4YOYA 1NK4A 4E7KA 3RTVA 3MN6A 4V19S 2A41A 4A57A 3M6GA 3FZFA 3FZKA 3I0RA 4OGCA 2O8BA 5DM7L 4WFBL 1R0AA 3SV4A 3CQYA 3CM5A 4RWTA 3F9KA 1J5OA 2Q0RA 1SL1A 2QI2A 4DMNA 4CF9A 2QA4N 4BQLA 3ZT0A 3PO5A 3O1BA 3HM9A 3BF3A 3OW2M 2Q0UA 3QETA 1RT1A 4PKIA 4JI8K 2VYPA 2E20A 4WYBA 3QBXA 1BIZA 4CZEA 4IJNA 4Q0BA 3TTFA 1SKRA 1BU6O 5AQQA 4ELTA 3U8XA 3SUQA 5C24A 1JLEA 3RMCA 4EAHD 1KSPA 4H5RA 2W41A 1NM1A 3C65A 4X64K 4DSEA 1JCGA 1DGKN 3CJ7A 4IDHA 5CYMA 4BR5A 3L2UA 1NJZA 2DTUA 4IOXA 1VQ8N 3P4IA 4JKCA 3U3YA 2YI1A 3ZCMA 4FSVA 4BROA 3KLEA 3CCVN 3CMAN 2YNFA 2EX3A 2EWSA 1RDDA 3ID8A 2QXLA 4LY7A 3PSIA 5AQRA 1KVAA 2Z1JA 3ZSVA 3VQCA 4BRAA 3BY5A 3WNFA 4CK1A 4CHPA 3OVNA 2XY8A 3VQDA 3WXKA 2RPIA 2NZTA 1RT4A 5AQSA 3THWB 5DM6L 3SQ0A 2AJQA 3VN5A 3KKSA 4W5NA 3K9JA 4M3UA 4LFBK 3U9DA 4ELUA 3RSEA 4ZTFA 5KQDA 3VQ6A 4ICLA 2RE2A 3ZSYA 3G4SN 3I55N 3ENBA 4DLEA 4M3RA 3F2KA 5KTQA 2KFNA 3NF8A 3O4WA 3HO1A 3WXJA 2XO7A 3K0SA 5AQIA 4CJQA 4WCEL 2VG5A 1BI4B 4DQQA 4EHTA 2IVNA 2HHVA 4FWKA 1BGXT 3CMEN 4FPBA 2DY4A 3E9PA 1FK9A 4BR4A 3QIOA 4FPAA 1HR0K 3SUNA 4JHDB 1EKEA 4I9LA 4DV5K 2KW4A 4DR7K 3AGKA 3GDQA 3QLHA 1TUUA 4A5AA 4J2AA 4EHUA 4DTNA 1JCEA 4MDBA 3HXMA 4BQZA 4JD2A 5AQWA 1VQPN 4B1VA 1W0HA 3ZSZA 4CEQA 1NMDA 2P5OA 2DFEA 3L2VA 3U3GA 4FM2A 1GLBG 4FW1A 4M3WA 3TAQA 4IBNA 3JAMO 3BF1A 5CE3A 4X62K 3VQ8A 4KTQA 4WFAL 3VEYA 2G8UA 1IH7A 1YJNN 2GUIA 3HBTA 3CM6A 3T1YK 3AA4A 4NXNK 3QICA 1BQNA 1LW0A 1IBLK 2HHQA 1QE1A 3PX0A 2NLXA 2NRRA 4CHYA 4Z4EA 4AM6A 4Z4FA 3WXLA 3CCUN 4CESA 3CD6N 4BR0A 3OYGA 3L2QA 3HSCA 3CPWM 3WEEB 1WSHA 3AGRA 1NK0A 3GBTA 5KRTA 1E4GT 3LZIA 4YOTA 5FRMA 2W40A 1UWBA 3U9ZA 3CI5A 4CBWA 3CCQN 2H3GX 4FM0A 3K5MA 1UA1A 1IG9A 1FW6A 1BL3A 4HHTA 4WFNL 3ULEB 4DB3A 3HI0A 1HQEA 1N32K 3CC7N 1TKDA 4B3SK 1RCHA 3CCEN 1ZBIA 2G8IA 3TAMA 1NKEA 1XQSC 2DFFA 1W9HA 1RFQA 1I3AA 4H5NA 1D9DA 3PUFA 2CH6A 3K59A 1ATSA 4CVNE 3HP9A 1BA1A 1C1CA 1J53A 5A2QO 5HBMA 2F4VK 2HHSA 2X74A 1U04A 2FLOA 1NLVA 1XI1A 2QEXN 3DM2A 3AVIA 2NRTA 4B1WB 3G0ZA 1X1PA 4B1XB 3PV8A 1JLAA 3AO1A 4ZTJA 4KH4A 2I7NA 2G8HA 2P9LB 3W3DA 3NH2A 4DV3K 1WBDA 3UE5A 2EHGA 1KAYA 3P5JA 1WSGA 4X65K 1RT7A 4BE2A 2UXDK 3C6HA 4R5PA 3V6DA 3FR0A 4JYAK 3S41A 2W42A 3KLFA 1B9DA 4LFCK 2Q97A 2HHXA 4DQRA 3AVAA 3WXIA 4E1NA 3DRSA 1CLQA 1RDAA 3VPZA 1S72N 3C7NB 3THYA 1VQ4N 2P9NA 3M8QA 1BCOA 4JKHA 3KTQA 3ZT4A 3V4IA 3VQBA 3V9ZA 2E6MA 1NJXA 3VA3A 3V9SA 1JLFA 2HF3A 4RW4A 2D4WA 1NWKA 4JK8A 3A5NC 2IAJA 3VGKA 2Z1IA 1LW2A 4M3YA 3SAHA 3I56N 2HVHA 4CGGA 4NYNA 4DV4K 4O44A 3SPZA 4CJPA 5ELZA 1HUXA 3CFOA 3CIPA 3HOTA 3SLCA 4FLYA 3CETA 3THXA 3P39A 1RBSA 4ISEA 3RMAA 5E26A 1Q9XA 4TSXA 3DRPA 4KHQA 4FJMA 3NAEA 4B9NA 4BRHA 4CZKA 3MN7A 1NNEA 3VEVA 4CFDA 5B8HA 3M8PA 3BGRA 3QNOA 2ZE2A 5F1XA 1ZXOA 2B6AA 4LF7K 4XIUA 1HQUA 2HNYA 5AQKA 5BPMA 3VQAA 1KAZA 1A5VA 2CGKA 3GOIA 3I8BA 2XY6A 4K43A 4HTUA 3ALYA 3KKRA 5D3GA 1HJRA 2E2OA 1HKGA 1QZ5A 1WSEA 4H4OA 1NGGA 3F5TA 3M3ZA 4FVUA 2OTLN 3VQPA 1J9AA 1HNVA 1I39A 3QFUA 3NBPA 3MX2A 1J6ZA 3PX4A 1W7AA 1M90O 3O9TA 4LSNA 1X9SA 3CF5L 5I3UA 4H0OA 4LF8K 1BDGA 3E9OA 1MDUB 3DYAA 4U67L 1HPZA 1U4BA 3LL3A 4QS7A 1VSHA 4CJTA 1NOYA 1Q18A 5JVHL 3HZ6A 3N4PA 4O8KA 3AO3A 4Z4GA 4JN4A 5AR0A 3V81A 4DTPA 2ITMA 4DR1K 2E8AA 2GEMA 3EKUA 4BR2A 5GAHP 3HK2A 3DXKB 4CJ7A 1IKYA 2E1ZA 4KHSA 4PY5A 2R7YA 4JKAA 5MLCQ 5M1KA 1YTUA 4C8LA 1GOBA 3O9RA 1T05A 4A61A 3RRGA 3THWA 3LDQA 1VSKA 3TTDA 5BPLA 3SQ2A 4I2PA 2GTDA 3L3UA 5IT9O 3C95A 2WTUA 3AVJA 1IKXA 1Z26A 3OYFA 4CHQA 2G8KA 4QCLA 3I33A 2Z1HA 4AHRA 4DF8A 1W97L 1XMQK 3DAWA 1JL1A 2JWKA 1TK5A 3SPYA 3F9MA 1QHTA 1YVUA 4O5BA 4BREA 2NRXA 1S9GA 3AA5X 1UA0A 5AQFA 1RBVA 3ZLJA 3AVMA 4RW9A 1BI4A 2JGUA 4CFBA 2YNGA 1SAZA 3MAQA 1O13A 1ATRA 3UB5A 2W6KA 3ZSQA 2QKBA 4JI6K 1EQYA 3AA3A 4CF2A 1M1KO 4MLEA 5J1EA 4FJ8A 4JHDA 5IWAK 2DPNA 1A5XA 1RNHA 1JLCA 3OHRA 5AQXA 2O8FB 4N76A 3VQQA 2YV0X 2A40A 4KO0A 4CE9A 4KHNA 4QAGA 3LDNA 3LP3A 2BE2A 2YKNA 3DWLA 4FWQA 1Y64A 3HM8A 1QQMA 4FJNA 4IO9L 3MX5A 1NGCA 2ZJRL 1XNRK 1ZYQA 1D4XA 3DI6A 4B1ZA 3O8MA 2D0BA 2FF6A 2DFHA 4ZHRA 4JK9A 1WB9A 3J7YP 4CD3A 1BOTO 3ATUA 3O4NA 5C2DA 4C8MA 3TI0A 2Y1IA 1VSIA 5AQGA 2KLAA 2GBZA 3RWUA 4KTZA 1YI2N 4AHTA 3BZKA 3ZT3A 5KRSA 3K57A 2KZZA 4KI4A 3C6TA 3BUZB 5BR9A 4FWNA 1IJJA 2AA4A 5DMRA 4H8KA 2O8CB 4B1YB 3WEEA 1MU2A 1NU0A 2OPSA 2D5RA 4B9TA 4BGAA 2OANA 1KXPA 3G71N 1RDWX 3WNHA 3AVGA 3KIOA 3V1QA 3NHGA 2UUCK 1VSJA 3ULEA 4C23A 4IJAA 3OYBA 3NH0A 4FLWA 3H3OB 3NGZA 1T7PA 1RBUA 2V7YA 1N34K 4FZYA 4ID1A 4Z94A 4UQGA 1LAVA 2D0AA 3D7EO 1IBKK 1EWQA 4FWMA 3TANA 4K42A 3CJBA 1X3NA 3LP2A 4B3MK 4N5SA 2NRVA 1IV0A 1YIJN 4WF9L 3O3GA 1N8RO 1EO1A 2PYJA 1F21A 4JKDA 2IC3A 1EP4A 3JYTA 3QDKA 3OYKA 4YHHK 3SNNA 2QWNA 2KQ2A 3SYZA 1RTDA 1NK9A 3WNEA 1NOZA 3A5MC 3R3LA 2P9KB 4M3XA 5ADXH 4KHYA 2YHAA 2P9LA 4W5QA 3HPGA 4FK0A 4CIGA 4FO0A 3CJAA 2YHWA 1BUPA 2E88A 3IDHA 3SBTA 1RT5A 4HWIA 4E0DA 2HHHK 3LDLA 1ZBFA 1HX1A 3IKMA 1GLDG 4CEBA 2FC0A 1X9JA 3DOKA 2HHWA 1X3MA 4KH5A 4LF6K 2YHYA 1QTMA 4H0YB 1TGOA 3AVFA 4LF4K 3T1AA 2E2NA 3KWIA 5AJ3K 3ENOA 4CJFA 3KK3A 1YITN 3R1XA 4BR7A 2ASMA 2IVPA 3C7NA 2VWJA 4K25A 4YOUA 2ZJQL 3O5BA 3DLBA 4CJRA 1ZBSA 1VQ6N 4E1MA 2Q36A 1NK8A 4FK2A 5AQZA 2O8DB 4FOIA 1NK6A 4LSLA 3OS1A 3BP8A 4BC2A 4DV1K 3O3FA 4DF4A 3QERA 1Q82O 4DS5A 5JVGL 1KLNA 4BRGA 4IFYA 1VQ7N 4CJVA 3C6AA 4FLTA 4AQYK 3HP6A 2W6LA 3L6QA 4KPYA 3VQ4A 4H0XB 1NJIO 2WFBA 4I9QA 3VERA 4FW2A 3AAPA 1B9FA 3O3HA 1WBBA 4KHUA 4A5BA 3WXMB 2QW9A 2RKIA 3NMUA 3DLHA 2VWBA 4CGHA 5M1FA 3TSQA 4BRIA 3PLAA 2NNWA 3VQ5A 1S1UA 4YNQA 4BACA 2PZSA 5EVZA 3D2EB 1E3MA 5J2QA 1T8EA 1Q81O 1C0UA 5E41A 5C15A 3O08A 3WNGA 1YTAA 1WSFA 1K6YA 4MFBA 1BIUA 4DSFA 1S22A 2B5JA 4FZZA 4RCHA 1YVNA 2YKMA 4DR3K 1JXEA 3CJ9A 3A5OC 3FFKB 4KHPK 5AQVA 2KTQA 3P38A 3O9QA 4HCBA 3E66A 1JJ2M 2YCHA 3OYNA 4KB1A 2Q3SA 2UXBK 3KLHA 3KVGA 3T1HK 3ATVA 5BRFA 4FLVA 2YJEA 3LM2A 4DV2K 3M8SA 3CC4N 4B3TK 2JWLA 2HB5A 1J5EK 4CZGA 1KCFA 5M1QA 4AHUA 2UUAK 4KTWA 1IO2A 5BN8A 4HCCA 3KLGA 4NXMK 1T44A 4H4MA 4CIFA 3DXKA 3A8YA 4OX9K 3ZT1A 1EX4A 4CBXA 4LFAK 2YNHA 1NJWA 4C8NA 5AZIB 4H5TA 4IOAL 1U47A 2A5XA 3DRRA 4M7YA 1LWFA 4RTFD 1Z6RA 4B9UA 3HTVA 3LAMA 3OYAA 3LDPA 5AQJA 3T7ZA 4CJLA 2NUBA 4FZXC 3SZ2A 1VSDA 3G10A 4FJ7A 3HPHA 3VGMA 4FL9A 2UUBK 4JNEA 4GVMA 1T3VA 3ENHA 1WSIA 1X9WA 3NGIA 3KD1E 2BH1A 4KKOA 1LV5A 1QHAA 4CHNA 1OH5A 3AVHA 1YXQA 4M63C 3SMSA 1YF5L 3VTIA 1GLAG 1ZBUA 4IWVA 3OS2A 1U45A 1KAXA 1TYQB 4CFAA 2BGGA 4CJ4A 3M1FA 1K8KB 3O4QA 3VOVA 3ZX2A 2PAVA 2D1KA 2UXCK 1NGIA 4RW7A 5GAGP 3G25A 3IFRA 3SK3A 3OS0A 1RDCA 2RN2A 4KBOA 3OYEA 2QWOA 3FE1A 5KGXA 3VF6A 3EN9A 2O8FA 2F96A 4JKFA 2WBNA 1S6PA 1YT3A 4CJKA 1NGHA 4EP4A 4BWJA 3AA2A 2GELA 4PKGA 4JI4K 3VGLA 4IDKA 3AO2A 3KHYA 2E1YA 2HSTA 4NB4A 4JK7A 2O4GA 2FSJA 4YDUC 4BRDA 1D9FA 1QZ6A 2A3ZA 3OYMA 2F8TA 4QOZB 4NO7A 3O6WA 1P90A 5AQOA 4DHYA 3KK1A 3ZYYX 4BRFA 4FJGA 4BRCA 4DTSA 4B3OA 3W0LA 4FOEA 4H0TB 5FPDA 1Y97A 2KHOA 4I6MB 1HNXK 1BISA 3AV9A 3K2PA 4DV6K 3D0PA 1KD1O 4FJKA 2A1RA 5JICA 5TKWA 3MWPA 4ISFA 2E5LK 4YORA 3L4QA 5GINA 3EZ5A 2O8CA 4OPAA 5C2FA 3O80A 2HMPA 4UY8O 4DUYK 2ZQBA 1S5JA 2X6SA 1VHXA 3MN9A 4CJ3A 1ZBHA 1VRUA 3HRGA 3TAPA 3SUPA 4CEEA 3DOLA 4FWSA 3UKUA 4ELVA 3L8BA 4BY9C 1U49A 4XEIA 4F3TA 4E19A 3PY8A 4KFBA 3TAGA 3PIPL 3AARA 4Y1DA 4PL7A 3LWLA 3G6EN 3TABA 1IBMK 4FYDA 4CBUA 2A42A 3H08A 2BUPA 1RDBA 2BTFA 2FF3B 1TKXA 3CCRN 1U2VB 4CZHA 4BRPA 3OBWA 3ITHA 4BC5A 1YUWA 5C25A 3ISNC 3PSFA 3ZETB 1OH7A 3EO3A 3CC2N 1TAUA 1S9EA 1ASUA 4N41A 1KVBA 4A2BA 4A2AA 4JV5K 4YOWA 5CHIA 5M1OA 1DEJA 3AAQA 3DLLL 3MEDA 3VEZA 2YX6A 2HMIA 1G15A 5C0YA 4O55A 2V51B 2P1JA 2P9KA 2Q31A 2RF2A 4I2QA 1CZ9A 1SV5A 3B6PA 4CGIA 3SUOA 4AF1A 5GIOA 1KRPA 4HUEA 3T69A 2PBDA 4JLHA 2JLEA 1UAXA 1N6QA 1QQOA 4CGDA 3CG7A 3T19A 3C6UA 1YHQN 3TPQA 4Z0UA 4GY2B 3M8RA 4CJEA 2OPQA 4BDYA 1NKCA 3QO9A 3LDOA 4I7FA 2XY7A 3PIOL 4WQ4C 1OH6A 1HMVA 1DT9A 4HUFA 4AILC 2F9WA 4FLXA 2J4RA 3TU5A 4KV8A 5CZ1A 2VG7A 3RR8A 3VEOA 1B92A 3ZSWA 4XH5A 1NGDA 4GV6A 1RTJA 3NVMA 2P9SB 4CGFA 5AQTA 3WQTA 2PFUA 4M3ZA 4BVOA 3CCJN 4AHCA 2O8DA 1Q9YA 1LAWA 2E4LA 1J54A 1XHZA 3MK6A 2OYQA 4IKFA 3H46O 1N36K 1CXUA 1OVYA 3VF4A 3LP1A 3PX6A 1DTQA 1VQLN 3CPEA 1IG8A 3EE9A 4AM7A 2F8SA 5FROA 5C42A 3HJFA 2YHXA 3OYCA 1KTQA 4NLCA 1QQNA 2D0OA 3D45A 5JMVA 4ILHA 4H03B 5KPZA 1QSSA 3QEVA 3EZWA 3K58A 1YJWN 2OPPA 5H1SQ 4CZIA 2ZGZA 1BA0A 3QINA 4NYFA 3KJVA 4E3SA 2NRWA 3AO4A 4BRKA 4C1NI 4FXDA 5SZTA 3SQ1A 3J7AP 5EY4A 1XWLA 5J2NA 1UOCA 4Z4CA 5T7BA 4PWDA 4JEPA 4CK3A 4KB0A 4CHOA 1VQON 3FGUA 4ISGA 4WQ4A 3NE6A 3D2EA 3E1YA 1XC3A 1GOAA 4BRNA 1FJGK 4JKGB 3N4QA 4CIEA 1BWFO 1XHXA 4M45A 3HT3A 3QMLA 1RBTA 3R8EA 2VWKA 5AQLA 4CF8A 3KK2A 4OPJA 3ULDA 1GLCG 5AFUH 3I8DA 1NJYA 3CQ8A 4ILGB 4E7JA 4OO1J 3QB0A 4BG8A 3EE8A 3LZJA 3SQ4A 1VAZA 5F2RA 3LPUA 1QSYA 4MLHA 3SV3A 3UKRB 4IEEA 2P9UB 2OPRA 3VESA 4H5VA 1LCUA 1TVRA 2HW3A 5JS2A 4BDZA 2FSNA 1GLLO 4KH6A 4O5FA 5FPMA 1QS4A 2WONA 3THVA 3A0IX 1EXQA 1VSFA 2X78A 3K5NA 4DU3A 4QS9A 3S3NA 2UU9K 1C1BA 1JLGA 3IUCA 2P51A 1ZC6A 3MN5A 2ZD1A 2HNDA 1OVQA 2QWRA 3AVLA 4JI5K 4JRQA 2ZGYA 3H45C 4IG0A 4CGJA 4DKWA 1NGFA 5BRDA 3O9UA 5HRSA 4DS4A 2HHTA 2QWLA 4KREA 3MEEA 3MEGA 1ITGA 5AZIA 4KHWA 3B8AX 3A5LC 5J2PA 2KFZA 4WQ5C 3D2FB 3UKUB 4GV3A 2WC9A 1Q8IA 1NG9A 4CCHA 4DFPA 3UIQA 2QTDA 1H1VA 3HYFA 1FKOA 4CERA 4DLGA 4CJWA 1RBRA 4DTMA 5LJWA 1JLBA 5GADP 2ATQA 4K8ZA 1W2BM 4DR4K 1Q86O 1C0FA 3RVCA 1KQSM 2IVOA 2GV9A 3SAFA 2Y1JA 3TWHA 2VQFK 5HRRA 2P9IB 3LDSA 3J8AA 4LC9B 1SKSA 3IG1A 3OYLA 3HVRA 3OYDA 1BG3A 1GLFO 3V1RA 1TYQA 4BRMA 2GUPA 4WE1A 2KKZA 1KLMA 3OY9A 4FVMA 2F7TA 4Z4HA 4FJ5A 3RMDA 3CJCA 1K8KA 4R79A 5FPEA 2GWKA 4JKBA 1JL2A 4CFCA 1OH8A 1CZAN 1LOTB 3NVKA 3MMVA 4LF9K 3LPTA 2HBKA 3FLCO 3K5OA 1K9MO 2G8FA 4YFUA 5HL7L 2G8VA 5GAEP 4BR9A 1QQCA 4CF1A 4CJUA 1U48A 3EKSA 1RT6A 2AP1A 1SKWA 3L3VA 2HF4A 4EFHA 4XH4A 1T03A 4XH1A 3NGYA 4FCYA 1L3VA 4BRLA 4B9LA 4DTXA 3ZEUB 4DWIA 4NCBA 4DSJA 4CF0A 4FJXA 4WQ5A 4J2EA 1RT2A 5FLXO 3CCSN 4FWLA 3SJHA 1HLUA 1ASWA 4DV0K 5BN9A 3TARA 3L2RA 4Y0WA 5HROA 2QK9A 3EEQA 3GG4A 1S1WA 4I6MA 1C1AA 5CY4A 4LH4A 1WNSA 1TAQA 4GW6A 4O4GA 4Q5VA 1JLQA 2ZWHA 3IMXA 3RMBA 4CJ5A 3ZX3A 4F9OA 2PY5A 1BQMA 4L8RB 5AQMA 3VEWA 3KD5E 3CFPA 2VQEK 4BWMA 2ASPA 5LY3A 5EOYA 4IFEA 3TSPA 2GWJA 5AZJB 3ZSOA 1XC9A 1HJOA 2RHKA 4RW8A 3DXMB 4FJHA 3J81O 4PHTX 3SBGA 4K8XA 3BEXA 2OTJN 3L0QA 1S1XA 5BREA 2A6AA 3EYZA 1FXXA 2ZJPL 3QFPA 3ZT2A 4CEDA 4DG1A 2VGMA 1ZBLA 1VSMA 4GV9A 4B08A 1C0MA 4JI0K 4GMJB 3AVNA 4YOXA 4FJIA 1TV6A 2Q1NA 1U2VA 1RGIA 2UYTA 4MDAA 4J8FA 1DTTA 2QWPA 3CJ1A 3DLGA 1WN7A 2NRHA 3ZETA 3ASMA 4M7XA 5EX5A 1IKWA 3F73A 3DLRA 2I7PA 4B9VA 3DMJA 5AQPA 3VQEA 1L3TA 1VSEA 4CEFA 4PUOA 3M5RA 3AO5A 4DCHA 1REVA 2P9PB 3WUHA 1SL0A 5HRNA 3L4IA 4ID5A 3QNNA 5FPNA 1FKPA 3CFRA 5KQ8A 4EZ6A 1S1TA 4EIAA 4G1QA 3KWGA 3LM9A 1ILYA 3MXMA 4FJLA 5HOOA 3OA9A 3IRXA 4U7BA 1RTIA 5GIPA 4KRFA 4ILJA 1NMNA 2IIRA 3MECA 4OJRA 4AH9A 4CZFA 1S6QA 4DV7K 1HYVA 4BDPA 3NFAA 1NGJA 2CGLA 2PYLA 3T3FA 4LH5A 5AQUA 3HVTA 4W5OA 3NF7A 3HOSA 4DU4A 4YY3K 3VF2A 2ZM6K 5JS1A 4GKJK 2VGNA 4E7LA 2GX9A 4OKJA 4X66K 1T6DA 2P9SA 5K14A 1C0TA 3H6EA 3RRHA 4FWOA 2I5JA 4JI3K 5F0XA 4HTLA 3V9XA 1WAJA 4LD0A 3IAYA 4K0KK 2FBYA 1MWKA 1XUPO 4CD1A 4IFVA 4JAXA 4N47A 5C12A 1CZBA 3SJJA 4DQSA 5SWMA 3GL1A 1IKVA 4NCAA 2XHBA 4AHSA 5BR8K 2O8EB 1HNIA 3SMPA 4CK2A 1YAGA 5JLHA 3FZHA 3OYJA 2OZSA 4DFMA 4Y1CA 4JI7K 3OBYA 2XRIA 2YJFA 3VA0A 3CYMA 4PL8A 3OTOK 2HOEA 3O1WA
chains in the Genus database with same CATH topology
2FF6A 1QVFM 4JK9A 4AF1A 1BOTO 3ATUA 4CD3A 5C2DA 5GIOA 3K9JA 2PBDA 3T69A 4IXCA 5AQGA 2ZF5O 3U9DA 3RSEA 4BC3A 5KQDA 3J7ZO 1QQOA 2CGJA 1YHQN 2KLAA 2RE2A 3TPQA 3G4SN 3I55N 3ENBA 1YI2N 4GY2B 4IEIA 5BR9A 3BUZB 3MWTA 4FWNA 1IJJA 3F2KA 2AA4A 3O4WA 3LDOA 4B1YB 4WQ4C 3WEEA 3PIOL 1K73O 3WT0A 4JKGA 3WXJA 4BGAA 2OANA 1KXPA 1DT9A 1RDWX 3G71N 2F9WA 2NRZA 3VMFB 2V7ZA 4JKEA 5AQIA 2J4RA 1ESVA 3ZX0A 4WCEL 3TU5A 4WFNL 4EHTA 2IVNA 4FWKA 3CMEN 3ULEA 4IO8A 4IJAA 3VEOA 4C23A 3CCMN 4FPBA 3TSUA 4XH5A 1NGDA 4GV6A 3E9PA 3H3OB 3NVMA 4BR4A 2V7YA 3VENA 4FPAA 2P9SB 4Z94A 3D7EO 1T6CA 4JHDB 1DKGD 5AQTA 3WQTA 3UKRA 2PFUA 2E2PA 4FWMA 4BVOA 3CCJN 2P9UA 4K42A 3VETA 3AGKA 3GDQA 3CJBA 1NGBA 1TUUA 3MK6A 4A5AA 4EHUA 1JCEA 4MDBA 1X3NA 1HKBA 4BQZA 3H46O 4JD2A 5AQWA 2NRVA 1TUYA 4FWRA 4B1VA 1VQPN 1YIJN 4WF9L 1R59O 1VQ5N 1OVYA 1N8RO 1EO1A 1NMDA 3VF4A 4JKDA 1VQLN 3FZLA 4CZJA 3CPEA 1IG8A 3EE9A 1GLBG 3QDKA 4AM7A 2YHXA 2QWNA 1E4FT 3BF1A 4NLCA 1QQNA 2D0OA 5CE3A 1QVGM 3MDQA 5JMVA 4ILHA 4H03B 5KPZA 5M1NA 1MA9B 3EZWA 4WFAL 3VEYA 1U6ZA 1YJWN 5H1SQ 3A5MC 4IOCL 4CZIA 3R3LA 1SQKA 2P9KB 5BRHA 1YJNN 2ZGZA 1BA0A 3H1QA 3HBTA 4H0PA 5ADXH 3P31A 2P9LA 2NRWA 3QICA 4BRKA 3O9SA 1JCFA 4C1NI 4FO0A 3CJAA 3QBWA 2YHWA 1BUPA 2FXUA 2NLXA 2E88A 3IDHA 2NRRA 5EY4A 3RSEB 3SBTA 3D2FA 4HWIA 4JEPA 4AM6A 1VQON 1KC8O 3FGUA 4ISGA 3LDLA 3WXLA 3CCUN 4WQ4A 3CD6N 4BR0A 3D2EA 1HX1A 3E1YA 3HSCA 4B9QA 1XC3A 3IKMA 1GLDG 5M1PA 3WEEB 3CPWM 4BRNA 3AGRA 1X9JA 4JKGB 1X3MA 4KH5A 3N4QA 3GBTA 2YHYA 3VEXA 1BWFO 1NGEA 1E4GT 4H0YB 3QMLA 4YOTA 2ASOA 3KK7A 2W40A 3R8EA 5AQLA 3U9ZA 3CI5A 4CBWA 3CCQN 2E2NA 2P9IA 1BO5O 2H3GX 3KWIA 1GLCG 5AFUH 3CHWA 1HPMA 3JS6A 3ENOA 1YITN 4BGBA 2F9TA 3R1XA 3ULEB 4BR7A 2ASMA 2IVPA 3C7NA 4ILGB 4DB3A 4OO1J 3QB0A 4BG8A 3HI0A 3EE8A 4YDUA 4BVPA 4K25A 4BG9A 1VAZA 3CC7N 4E1JA 4YOUA 5F2RA 2ZJQL 3O5BA 4K41A 3CCEN 4MLHA 1Z05A 1ZBSA 1XQSC 1VQ6N 3UKRB 4IEEA 2Q36A 2P9UB 3VESA 1RFQA 5AQZA 4FOIA 4H5VA 1LCUA 2HBLA 4H5NA 1VQNN 2FSNA 1GLLO 4KH6A 3BP8A 4O5FA 5FPMA 4BC2A 1K8AO 2CH6A 4JD2B 1ATSA 1Q82O 3A0IX 5JVGL 1BA1A 4QS9A 5AQYA 3TTCA 4BRGA 5I9EB 1VQMN 1VQ7N 3IUCA 1VQ9N 1ZC6A 3C6AA 3MN5A 2FLOA 1NLVA 3L6QA 4H0XB 5KPRA 2QEXN 2QWRA 1NJIO 3U4LA 2NRTA 4B1WB 2ZGYA 3H45C 1NGAA 4B1XB 2WFBA 4DKWA 1NGFA 5BRDA 1WOQA 3VERA 3O9UA 3AAPA 2QWLA 4H0VB 4KH4A 2I7NA 3R9PA 2P9LB 4A5BA 3WXMB 5AZIA 3W3DA 3ZEUA 2QW9A 3NMUA 2Q2RA 3B8AX 3A5LC 3UE5A 2VWBA 3Q7BA 1KAYA 5M1FA 4WQ5C 3D2FB 3TSQA 3UKUB 4GV3A 2WC9A 4BRIA 3MCAB 3PLAA 2NNWA 2E2QA 2QTDA 1H1VA 2HBMA 5EVZA 3D2EB 3MCPA 5LJWA 1Q81O 3C6HA 5E84A 5GADP 3FR0A 5JLFA 3S41A 3EL2A 5C15A 3K9KA 1W2BM 3CXCM 1Q86O 1C0FA 3RVCA 2QWMA 3O08A 4CI6A 1KQSM 2IVOA 1NBWA 3SAFA 3KZBA 2QWQA 4C1NK 3CCLN 1S22A 2P9IB 4H5WA 2Q97A 4A59A 3WXIA 4RCHA 1YVNA 3J8AA 4LC9B 4BRQA 3C0BA 3A5OC 3CJ9A 3FFKB 3VPZA 3VTHA 1S72N 5AQVA 4MO4A 3P38A 1BG3A 3C7NB 3CERA 1GLFO 3O9QA 3E66A 1JJ2M 1VQ4N 2YCHA 1TYQA 2P9NA 4BRMA 4YOVA 4JKHA 4OPHA 2GUPA 5AFUA 5AZJA 2KKZA 3DXMA 4G9ZA 2F7TA 3KVGA 5TKYA 3CJCA 1K8KA 4R79A 5FPEA 3ATVA 5BRFA 1S3XA 2FSKA 4CZLA 2GWKA 2YJEA 4GNIA 2WUSA 4JKBA 2HF3A 5AQNA 4CZMA 3LM2A 1CZAN 1LOTB 3CC4N 3FZMA 3NVKA 2JWLA 3CQXA 3MMVA 2D4WA 5BPNA 1NWKA 4JK8A 2HBKA 3FLCO 3A5NC 1K9MO 3H1VX 4CZGA 2CH5A 5M1QA 2HBJA 3VGKA 4B1UB 5HL7L 3E9LA 5GAEP 4BR9A 3SAHA 3I56N 5KPTA 5BN8A 4IZ9A 4PKHA 1T44A 3EKSA 1MWMA 2AP1A 2VCPA 3DXKA 3A8YA 5ELZA 1HUXA 2HF4A 4EFHA 3CIPA 4XH4A 3SLCA 3HOTA 3D6RA 4XH1A 4CBXA 3CETA 3P39A 4DQ8A 4ISEA 4BRLA 5E26A 1SS6A 3ZEUB 2QM1A 5AZIB 4H5TA 3GE1A 4IOAL 4WQ5A 3CCSN 2A5XA 4FWLA 1HLUA 3MN7A 4M7YA 3SJHA 4BRHA 4CZKA 5BN9A 1SZ2A 3VEVA 2P9PA 5B8HA 2D0PA 4RTFD 1Z6RA 4Y0WA 3HTVA 1P8ZA 3SAGA 5F1XA 1ZXOA 3LDPA 3Q7CA 5AQJA 3T7ZA 5AQKA 5BPMA 1ATNA 1KAZA 4O8UA 2CGKA 3JXUA 3VGMA 4FL9A 3GOIA 3I8BA 3DJCA 3GG4A 4K43A 4GVEA 1Q7YO 4I6MA 4JNEA 5EXWA 1T3VA 4FWPA 2E2OA 1HKGA 1OKJA 1QZ5A 3ENHA 1GLEG 2ZWHA 3H3NO 1YJ9N 3IMXA 1NGGA 3F5TA 2BH1A 3M3ZA 1QHAA 1HKCA 3ZX3A 4F9OA 4FVUA 1C0GA 2OTLN 1YXQA 4M63C 3SMSA 1YF5L 3VTIA 3WQUA 3QFUA 5AQMA 1GLAG 3VEWA 2ASPA 3MX2A 4IWVA 5EOYA 5LY3A 1KAXA 1WUAA 4IFEA 1TYQB 2P9NB 1J6ZA 4NLBA 3TSPA 2GWJA 5C10A 1M90O 5AZJB 1HJOA 5CR4A 3O9TA 4L3QA 3CF5L 2RHKA 3DXMB 3M1FA 4PHTX 3SBGA 1V4SA 3BEXA 4H0OA 1K8KB 2OTJN 3VOVA 4BC4A 3ZX2A 1BDGA 2PAVA 3E9OA 2D1KA 1G99A 3L0QA 5BREA 1MDUB 2A6AA 4U67L 3LL3A 4QS7A 2ZJPL 1NGIA 5GAGP 1Q18A 5JVHL 3G25A 3IFRA 3QFPA 3HZ6A 3SK3A 3N4PA 4KBOA 4O8KA 5ADXA 4JN4A 1V4TA 2QWOA 2VGMA 3FE1A 4GV9A 5AR0A 4MO5A 3VF6A 3EN9A 4QS8A 1GLJO 4YOXA 2ITMA 4JKFA 2E8AA 2WBNA 2GEMA 3EKUA 4BR2A 4A62A 5GAHP 2Q1NA 1U2VA 1NGHA 1RGIA 2UYTA 4MDAA 4J8FA 3DXKB 2QWPA 4CJ7A 3CJ1A 2NRHA 3AY9A 3ZETA 2E1ZA 2GELA 4M7XA 2V52B 5EX5A 3ID6A 4JKAA 4PKGA 3VGLA 2I7PA 5MLCQ 5M1KA 5AQPA 3KHYA 2E1YA 1RDUA 3M5RA 2HSTA 4NB4A 5LJVA 1VQKN 4JK7A 3O9RA 4DCHA 2P9PB 3WUHA 2FSJA 4A61A 4YDUC 4BRDA 3L4IA 5AQHA 1QZ6A 3R6MA 4YOYA 2A3ZA 3LDQA 4NO7A 3MN6A 3O6WA 1P90A 3TTDA 5AQOA 5FPNA 2A41A 4A57A 4DHYA 3M6GA 3ZYYX 3FZFA 5BPLA 3FZKA 4BRFA 4BRCA 5DM7L 4WFBL 5KQ8A 3W0LA 4FOEA 2GTDA 4H0TB 5FPDA 2KHOA 3CQYA 4I6MB 4EIAA 4RWTA 3KWGA 2Q0RA 3LM9A 1ILYA 2QI2A 1KD1O 5HOOA 3OA9A 2QA4N 5JICA 5TKWA 3MWPA 4ISFA 4BQLA 4U7BA 3I33A 5GIPA 1W97L 4ILJA 4YORA 2IIRA 3L4QA 5GINA 3DAWA 2JWKA 4CZFA 3O1BA 4OPAA 3BF3A 3F9MA 5C2FA 3O80A 2HMPA 2Q0UA 3OW2M 4PKIA 2VYPA 2E20A 1NGJA 2CGLA 4BREA 4UY8O 2NRXA 4WYBA 5AQFA 5AQUA 3QBXA 4CZEA 4IJNA 3HOSA 3VF2A 3TTFA 1SAZA 3MN9A 3HRGA 1BU6O 1O13A 1ATRA 5AQQA 3UB5A 3U8XA 2VGNA 1EQYA 4FWSA 2GX9A 3UKUA 4EAHD 4BY9C 4XEIA 1T6DA 4H5RA 1M1KO 2P9SA 2W41A 3PIPL 4MLEA 1NM1A 3AARA 3C65A 3H6EA 4JHDA 4PL7A 4FWOA 2DPNA 3G6EN 1JCGA 1DGKN 3CJ7A 4HTLA 5F0XA 4IDHA 4BR5A 2A42A 4CBUA 3OHRA 5AQXA 2BUPA 2BTFA 4IOXA 2FF3B 1MWKA 1XUPO 3CCRN 1VQ8N 3P4IA 1U2VB 2A40A 4JKCA 4CZHA 2YI1A 4BRPA 4CD1A 4JAXA 4FSVA 4BROA 3CCVN 3OBWA 3LDNA 5C12A 3CMAN 4BC5A 1YUWA 2EWSA 3ZETB 3GL1A 3EO3A 3ID8A 3CC2N 3DWLA 2QXLA 5AQRA 4FWQA 1Y64A 3HM8A 4BRAA 3SMPA 4A2BA 1QQMA 4A2AA 4YOWA 1YAGA 5CHIA 5M1OA 1DEJA 3AAQA 3DLLL 3MX5A 4IO9L 3VEZA 2YX6A 5JLHA 3FZHA 1NGCA 3WXKA 2ZJRL 5C0YA 2NZTA 3OBYA 5AQSA 2YJFA 1D4XA 2V51B 2Q31A 2P9KA 4B1ZA 4PL8A 3O8MA 5DM6L 2HOEA 3O1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOX A;  3N4P A;  3N4Q A; 
#chains in the Genus database with same CATH topology
 1QVF M;  3RR7 A;  1L5U A;  4JI2 K;  3LAK A;  3IS9 A;  2O8B B;  1TKZ A;  4IXC A;  4DQP A;  2ZF5 O;  1X9M A;  3J7Z O;  4BC3 A;  4F2S A;  3LWM A;  3JSM A;  2CGJ A;  2OA8 A;  4IEI A;  4DTR A;  4OLA A;  3MWT A;  2P5G A;  3ZSX A;  3EY1 A;  1K73 O;  4O0I A;  3S9H A;  3WT0 A;  4JKG A;  1DLO A;  5FDL A;  2IGI A;  2NRZ A;  3VMF B;  2V7Z A;  4JKE A;  4DUZ K;  1EWR A;  1KVC A;  1ESV A;  4MQ3 A;  3ZX0 A;  4CEO A;  4AHV A;  4F8R A;  1BHL A;  2HNZ A;  3B6O A;  5KI6 A;  1HYZ A;  4IO8 A;  2E6L A;  3HST B;  3CCM N;  3TSU A;  3VEN A;  4EZ9 A;  1T6C A;  4JI1 K;  3K5L A;  1DKG D;  2XY5 A;  4M3T A;  4F4K A;  3UKR A;  2E2P A;  2P9U A;  2IS3 A;  3VET A;  1NGB A;  3LP0 A;  4DU1 A;  1BCM A;  1HKB A;  2A1S A;  3AVB A;  2X6N A;  1TUY A;  4FWR A;  4JS5 A;  3QEI A;  1R59 O;  1VQ5 N;  2Z1G A;  2BDP A;  3FZL A;  4CZJ A;  1N33 K;  3NF6 A;  5HLF A;  2QKK A;  1VRT A;  1E4F T;  3TAF A;  1QVG M;  1KFS A;  3MDQ A;  4CEZ A;  5M1N A;  4KI6 A;  1TK0 A;  1MA9 B;  4FM1 A;  1U6Z A;  4OKE A;  4B9M A;  3OYH A;  4IOC L;  1SQK A;  5BRH A;  3H1Q A;  2QXF A;  4H0P A;  4Z4I A;  3P31 A;  1NKB A;  4BE1 A;  3O9S A;  1JCF A;  3QBW A;  2FXU A;  3RSE B;  4FLZ A;  3BZC A;  1S1V A;  1KFD A;  1ASV A;  3AVC A;  3D2F A;  2FBT A;  4M41 A;  1KC8 O;  5DK5 A;  1XMO K;  3E01 A;  2IOC A;  4DTU A;  1Z25 A;  2YHB A;  1O1W A;  4B9Q A;  5M1P A;  5HP1 A;  3OYI A;  3VEX A;  4M42 A;  1NGE A;  2ASO A;  3KK7 A;  1CXQ A;  3NH1 A;  5CYQ A;  2P9I A;  1BO5 O;  1SUQ A;  1TL1 A;  1HPM A;  1LWE A;  2LSN A;  3CHW A;  3JS6 A;  3P1G A;  2G8W A;  4BGB A;  2F9T A;  3V9U A;  3MXI A;  3QEP A;  5J2M A;  4CEC A;  4YDU A;  4BVP A;  4BG9 A;  4EP5 A;  4E1J A;  4FK4 A;  4K41 A;  1RIL A;  4BE0 A;  1WLJ A;  1Z05 A;  3FFI A;  2B4J A;  4FJ9 A;  1RTH A;  2HBL A;  1D5A A;  1VQN N;  4DR2 K;  1K8A O;  1WAF A;  4JD2 B;  4DSK A;  3TAE A;  3BDP A;  4DSL A;  4O0J A;  5AQY A;  3TTC A;  5I9E B;  5LMU K;  1TK8 A;  1VQM N;  1VQ9 N;  1HNW K;  1LWC A;  4DFJ A;  1HYS A;  4KAZ A;  3V9W A;  5KPR A;  4JS4 A;  3U4L A;  1NGA A;  3NDK A;  3S3O A;  1L3S A;  5EU7 A;  1C6V A;  1WOQ A;  4H0V B;  1NK7 A;  3R9P A;  3ZEU A;  2Q2R A;  1TL3 A;  4C8K A;  3Q7B A;  4FJJ A;  4CW7 B;  3MCA B;  4DSI A;  2E2Q A;  2HBM A;  4PQU A;  4F2R A;  4OPK A;  3TR8 A;  3P83 D;  4OGE A;  3MCP A;  3ZSR A;  4RW6 A;  5E84 A;  2ITG A;  5JLF A;  3EL2 A;  3S3M A;  3K9K A;  3CXC M;  2QWM A;  2WOM A;  4CI6 A;  1NBW A;  3KZB A;  2QWQ A;  4C1N K;  1SL2 A;  1WSJ A;  3CCL N;  4H5W A;  4A59 A;  2IDO A;  4GKK K;  4BRQ A;  3C0B A;  3VTH A;  4MO4 A;  3C94 A;  3CER A;  2O4I A;  4DTJ A;  4DTO A;  4YOV A;  4NCG A;  4OPH A;  3VQ9 A;  2OCE A;  2D0C A;  3VQ7 A;  5AFU A;  5AZJ A;  4DQI A;  1I94 K;  3DXM A;  1JXB A;  4G9Z A;  1TKT A;  5TKY A;  1S3X A;  4RG8 A;  2FSK A;  4CZL A;  4PA1 A;  4CZM A;  4GNI A;  2WUS A;  5AQN A;  4J2D A;  3HL8 A;  4DFK A;  3QEX A;  3FZM A;  3CQX A;  3HPO A;  5BPN A;  4C8O A;  4CJS A;  3H1V X;  2CH5 A;  2VG6 A;  2HBJ A;  5KGW A;  4B1U B;  5FRN A;  1XNQ K;  3E9L A;  3OJU A;  4B3R K;  3DLK A;  5KPT A;  4IZ9 A;  4PKH A;  3QES A;  1MWM A;  2VCP A;  5LL6 Z;  3QEW A;  3LAL A;  3D6R A;  4DQ8 A;  3A2F A;  1SS6 A;  2QM1 A;  4OVL A;  4OLB A;  1JKH A;  3I0S A;  3GE1 A;  4E7H A;  1GOC A;  2OZM A;  3MXJ A;  3OJS A;  1SZ2 A;  2P9P A;  2D0P A;  1RT3 A;  1P8Z A;  1QSL A;  3SAG A;  1VSL A;  4W5T A;  3Q7C A;  4JRP A;  4B9S A;  1EET A;  1ATN A;  2FBV A;  4O8U A;  3JXU A;  1HRH A;  4J2B A;  3DJC A;  4W5R A;  4GVE A;  1Q7Y O;  5EXW A;  4FWP A;  2KZM A;  1OKJ A;  1GLE G;  3H3N O;  1YJ9 N;  4LF5 K;  3QIP A;  4B8C A;  5I42 A;  1HKC A;  4OKK A;  1VK0 A;  1C0G A;  3WQU A;  1N5Y A;  3THY B;  4DR5 K;  1WUA A;  4NLB A;  2P9N B;  5C10 A;  3AVK A;  5CR4 A;  3SCX A;  4L3Q A;  3NCI A;  4E7I A;  1V4S A;  4BC4 A;  5HRP A;  4DR6 K;  3NF9 A;  1G99 A;  4CHZ A;  1NK5 A;  4IG3 A;  4F3O A;  3SI6 A;  3J80 O;  3U6F A;  3V1O A;  5ADX A;  1V4T A;  4FLU A;  4MO5 A;  4QS8 A;  2HHU A;  1GLJ O;  2ETJ A;  5LMN K;  1A5W A;  4A62 A;  1HNZ K;  4HUG A;  2HVI A;  5CZ2 A;  3AY9 A;  4E89 A;  1L3U A;  4B8A B;  2V52 B;  3DLE A;  3ID6 A;  3THX B;  2FBX A;  2O8E A;  3LAN A;  4N56 A;  2BAN A;  2YNI A;  1RDU A;  5LJV A;  1D8Y A;  1VQK N;  3PO4 A;  3L2W A;  4CEA A;  3KLI A;  5AQH A;  3R6M A;  4HVJ A;  4YOY A;  1NK4 A;  4E7K A;  3RTV A;  3MN6 A;  4V19 S;  2A41 A;  4A57 A;  3M6G A;  3FZF A;  3FZK A;  3I0R A;  4OGC A;  2O8B A;  5DM7 L;  4WFB L;  1R0A A;  3SV4 A;  3CQY A;  3CM5 A;  4RWT A;  3F9K A;  1J5O A;  2Q0R A;  1SL1 A;  2QI2 A;  4DMN A;  4CF9 A;  2QA4 N;  4BQL A;  3ZT0 A;  3PO5 A;  3O1B A;  3HM9 A;  3BF3 A;  3OW2 M;  2Q0U A;  3QET A;  1RT1 A;  4PKI A;  4JI8 K;  2VYP A;  2E20 A;  4WYB A;  3QBX A;  1BIZ A;  4CZE A;  4IJN A;  4Q0B A;  3TTF A;  1SKR A;  1BU6 O;  5AQQ A;  4ELT A;  3U8X A;  3SUQ A;  5C24 A;  1JLE A;  3RMC A;  4EAH D;  1KSP A;  4H5R A;  2W41 A;  1NM1 A;  3C65 A;  4X64 K;  4DSE A;  1JCG A;  1DGK N;  3CJ7 A;  4IDH A;  5CYM A;  4BR5 A;  3L2U A;  1NJZ A;  2DTU A;  4IOX A;  1VQ8 N;  3P4I A;  4JKC A;  3U3Y A;  2YI1 A;  3ZCM A;  4FSV A;  4BRO A;  3KLE A;  3CCV N;  3CMA N;  2YNF A;  2EX3 A;  2EWS A;  1RDD A;  3ID8 A;  2QXL A;  4LY7 A;  3PSI A;  5AQR A;  1KVA A;  2Z1J A;  3ZSV A;  3VQC A;  4BRA A;  3BY5 A;  3WNF A;  4CK1 A;  4CHP A;  3OVN A;  2XY8 A;  3VQD A;  3WXK A;  2RPI A;  2NZT A;  1RT4 A;  5AQS A;  3THW B;  5DM6 L;  3SQ0 A;  2AJQ A;  3VN5 A;  3KKS A;  4W5N A;  3K9J A;  4M3U A;  4LFB K;  3U9D A;  4ELU A;  3RSE A;  4ZTF A;  5KQD A;  3VQ6 A;  4ICL A;  2RE2 A;  3ZSY A;  3G4S N;  3I55 N;  3ENB A;  4DLE A;  4M3R A;  3F2K A;  5KTQ A;  2KFN A;  3NF8 A;  3O4W A;  3HO1 A;  3WXJ A;  2XO7 A;  3K0S A;  5AQI A;  4CJQ A;  4WCE L;  2VG5 A;  1BI4 B;  4DQQ A;  4EHT A;  2IVN A;  2HHV A;  4FWK A;  1BGX T;  3CME N;  4FPB A;  2DY4 A;  3E9P A;  1FK9 A;  4BR4 A;  3QIO A;  4FPA A;  1HR0 K;  3SUN A;  4JHD B;  1EKE A;  4I9L A;  4DV5 K;  2KW4 A;  4DR7 K;  3AGK A;  3GDQ A;  3QLH A;  1TUU A;  4A5A A;  4J2A A;  4EHU A;  4DTN A;  1JCE A;  4MDB A;  3HXM A;  4BQZ A;  4JD2 A;  5AQW A;  1VQP N;  4B1V A;  1W0H A;  3ZSZ A;  4CEQ A;  1NMD A;  2P5O A;  2DFE A;  3L2V A;  3U3G A;  4FM2 A;  1GLB G;  4FW1 A;  4M3W A;  3TAQ A;  4IBN A;  3JAM O;  3BF1 A;  5CE3 A;  4X62 K;  3VQ8 A;  4KTQ A;  4WFA L;  3VEY A;  2G8U A;  1IH7 A;  1YJN N;  2GUI A;  3HBT A;  3CM6 A;  3T1Y K;  3AA4 A;  4NXN K;  3QIC A;  1BQN A;  1LW0 A;  1IBL K;  2HHQ A;  1QE1 A;  3PX0 A;  2NLX A;  2NRR A;  4CHY A;  4Z4E A;  4AM6 A;  4Z4F A;  3WXL A;  3CCU N;  4CES A;  3CD6 N;  4BR0 A;  3OYG A;  3L2Q A;  3HSC A;  3CPW M;  3WEE B;  1WSH A;  3AGR A;  1NK0 A;  3GBT A;  5KRT A;  1E4G T;  3LZI A;  4YOT A;  5FRM A;  2W40 A;  1UWB A;  3U9Z A;  3CI5 A;  4CBW A;  3CCQ N;  2H3G X;  4FM0 A;  3K5M A;  1UA1 A;  1IG9 A;  1FW6 A;  1BL3 A;  4HHT A;  4WFN L;  3ULE B;  4DB3 A;  3HI0 A;  1HQE A;  1N32 K;  3CC7 N;  1TKD A;  4B3S K;  1RCH A;  3CCE N;  1ZBI A;  2G8I A;  3TAM A;  1NKE A;  1XQS C;  2DFF A;  1W9H A;  1RFQ A;  1I3A A;  4H5N A;  1D9D A;  3PUF A;  2CH6 A;  3K59 A;  1ATS A;  4CVN E;  3HP9 A;  1BA1 A;  1C1C A;  1J53 A;  5A2Q O;  5HBM A;  2F4V K;  2HHS A;  2X74 A;  1U04 A;  2FLO A;  1NLV A;  1XI1 A;  2QEX N;  3DM2 A;  3AVI A;  2NRT A;  4B1W B;  3G0Z A;  1X1P A;  4B1X B;  3PV8 A;  1JLA A;  3AO1 A;  4ZTJ A;  4KH4 A;  2I7N A;  2G8H A;  2P9L B;  3W3D A;  3NH2 A;  4DV3 K;  1WBD A;  3UE5 A;  2EHG A;  1KAY A;  3P5J A;  1WSG A;  4X65 K;  1RT7 A;  4BE2 A;  2UXD K;  3C6H A;  4R5P A;  3V6D A;  3FR0 A;  4JYA K;  3S41 A;  2W42 A;  3KLF A;  1B9D A;  4LFC K;  2Q97 A;  2HHX A;  4DQR A;  3AVA A;  3WXI A;  4E1N A;  3DRS A;  1CLQ A;  1RDA A;  3VPZ A;  1S72 N;  3C7N B;  3THY A;  1VQ4 N;  2P9N A;  3M8Q A;  1BCO A;  4JKH A;  3KTQ A;  3ZT4 A;  3V4I A;  3VQB A;  3V9Z A;  2E6M A;  1NJX A;  3VA3 A;  3V9S A;  1JLF A;  2HF3 A;  4RW4 A;  2D4W A;  1NWK A;  4JK8 A;  3A5N C;  2IAJ A;  3VGK A;  2Z1I A;  1LW2 A;  4M3Y A;  3SAH A;  3I56 N;  2HVH A;  4CGG A;  4NYN A;  4DV4 K;  4O44 A;  3SPZ A;  4CJP A;  5ELZ A;  1HUX A;  3CFO A;  3CIP A;  3HOT A;  3SLC A;  4FLY A;  3CET A;  3THX A;  3P39 A;  1RBS A;  4ISE A;  3RMA A;  5E26 A;  1Q9X A;  4TSX A;  3DRP A;  4KHQ A;  4FJM A;  3NAE A;  4B9N A;  4BRH A;  4CZK A;  3MN7 A;  1NNE A;  3VEV A;  4CFD A;  5B8H A;  3M8P A;  3BGR A;  3QNO A;  2ZE2 A;  5F1X A;  1ZXO A;  2B6A A;  4LF7 K;  4XIU A;  1HQU A;  2HNY A;  5AQK A;  5BPM A;  3VQA A;  1KAZ A;  1A5V A;  2CGK A;  3GOI A;  3I8B A;  2XY6 A;  4K43 A;  4HTU A;  3ALY A;  3KKR A;  5D3G A;  1HJR A;  2E2O A;  1HKG A;  1QZ5 A;  1WSE A;  4H4O A;  1NGG A;  3F5T A;  3M3Z A;  4FVU A;  2OTL N;  3VQP A;  1J9A A;  1HNV A;  1I39 A;  3QFU A;  3NBP A;  3MX2 A;  1J6Z A;  3PX4 A;  1W7A A;  1M90 O;  3O9T A;  4LSN A;  1X9S A;  3CF5 L;  5I3U A;  4H0O A;  4LF8 K;  1BDG A;  3E9O A;  1MDU B;  3DYA A;  4U67 L;  1HPZ A;  1U4B A;  3LL3 A;  4QS7 A;  1VSH A;  4CJT A;  1NOY A;  1Q18 A;  5JVH L;  3HZ6 A;  3N4P A;  4O8K A;  3AO3 A;  4Z4G A;  4JN4 A;  5AR0 A;  3V81 A;  4DTP A;  2ITM A;  4DR1 K;  2E8A A;  2GEM A;  3EKU A;  4BR2 A;  5GAH P;  3HK2 A;  3DXK B;  4CJ7 A;  1IKY A;  2E1Z A;  4KHS A;  4PY5 A;  2R7Y A;  4JKA A;  5MLC Q;  5M1K A;  1YTU A;  4C8L A;  1GOB A;  3O9R A;  1T05 A;  4A61 A;  3RRG A;  3THW A;  3LDQ A;  1VSK A;  3TTD A;  5BPL A;  3SQ2 A;  4I2P A;  2GTD A;  3L3U A;  5IT9 O;  3C95 A;  2WTU A;  3AVJ A;  1IKX A;  1Z26 A;  3OYF A;  4CHQ A;  2G8K A;  4QCL A;  3I33 A;  2Z1H A;  4AHR A;  4DF8 A;  1W97 L;  1XMQ K;  3DAW A;  1JL1 A;  2JWK A;  1TK5 A;  3SPY A;  3F9M A;  1QHT A;  1YVU A;  4O5B A;  4BRE A;  2NRX A;  1S9G A;  3AA5 X;  1UA0 A;  5AQF A;  1RBV A;  3ZLJ A;  3AVM A;  4RW9 A;  1BI4 A;  2JGU A;  4CFB A;  2YNG A;  1SAZ A;  3MAQ A;  1O13 A;  1ATR A;  3UB5 A;  2W6K A;  3ZSQ A;  2QKB A;  4JI6 K;  1EQY A;  3AA3 A;  4CF2 A;  1M1K O;  4MLE A;  5J1E A;  4FJ8 A;  4JHD A;  5IWA K;  2DPN A;  1A5X A;  1RNH A;  1JLC A;  3OHR A;  5AQX A;  2O8F B;  4N76 A;  3VQQ A;  2YV0 X;  2A40 A;  4KO0 A;  4CE9 A;  4KHN A;  4QAG A;  3LDN A;  3LP3 A;  2BE2 A;  2YKN A;  3DWL A;  4FWQ A;  1Y64 A;  3HM8 A;  1QQM A;  4FJN A;  4IO9 L;  3MX5 A;  1NGC A;  2ZJR L;  1XNR K;  1ZYQ A;  1D4X A;  3DI6 A;  4B1Z A;  3O8M A;  2D0B A;  2FF6 A;  2DFH A;  4ZHR A;  4JK9 A;  1WB9 A;  3J7Y P;  4CD3 A;  1BOT O;  3ATU A;  3O4N A;  5C2D A;  4C8M A;  3TI0 A;  2Y1I A;  1VSI A;  5AQG A;  2KLA A;  2GBZ A;  3RWU A;  4KTZ A;  1YI2 N;  4AHT A;  3BZK A;  3ZT3 A;  5KRS A;  3K57 A;  2KZZ A;  4KI4 A;  3C6T A;  3BUZ B;  5BR9 A;  4FWN A;  1IJJ A;  2AA4 A;  5DMR A;  4H8K A;  2O8C B;  4B1Y B;  3WEE A;  1MU2 A;  1NU0 A;  2OPS A;  2D5R A;  4B9T A;  4BGA A;  2OAN A;  1KXP A;  3G71 N;  1RDW X;  3WNH A;  3AVG A;  3KIO A;  3V1Q A;  3NHG A;  2UUC K;  1VSJ A;  3ULE A;  4C23 A;  4IJA A;  3OYB A;  3NH0 A;  4FLW A;  3H3O B;  3NGZ A;  1T7P A;  1RBU A;  2V7Y A;  1N34 K;  4FZY A;  4ID1 A;  4Z94 A;  4UQG A;  1LAV A;  2D0A A;  3D7E O;  1IBK K;  1EWQ A;  4FWM A;  3TAN A;  4K42 A;  3CJB A;  1X3N A;  3LP2 A;  4B3M K;  4N5S A;  2NRV A;  1IV0 A;  1YIJ N;  4WF9 L;  3O3G A;  1N8R O;  1EO1 A;  2PYJ A;  1F21 A;  4JKD A;  2IC3 A;  1EP4 A;  3JYT A;  3QDK A;  3OYK A;  4YHH K;  3SNN A;  2QWN A;  2KQ2 A;  3SYZ A;  1RTD A;  1NK9 A;  3WNE A;  1NOZ A;  3A5M C;  3R3L A;  2P9K B;  4M3X A;  5ADX H;  4KHY A;  2YHA A;  2P9L A;  4W5Q A;  3HPG A;  4FK0 A;  4CIG A;  4FO0 A;  3CJA A;  2YHW A;  1BUP A;  2E88 A;  3IDH A;  3SBT A;  1RT5 A;  4HWI A;  4E0D A;  2HHH K;  3LDL A;  1ZBF A;  1HX1 A;  3IKM A;  1GLD G;  4CEB A;  2FC0 A;  1X9J A;  3DOK A;  2HHW A;  1X3M A;  4KH5 A;  4LF6 K;  2YHY A;  1QTM A;  4H0Y B;  1TGO A;  3AVF A;  4LF4 K;  3T1A A;  2E2N A;  3KWI A;  5AJ3 K;  3ENO A;  4CJF A;  3KK3 A;  1YIT N;  3R1X A;  4BR7 A;  2ASM A;  2IVP A;  3C7N A;  2VWJ A;  4K25 A;  4YOU A;  2ZJQ L;  3O5B A;  3DLB A;  4CJR A;  1ZBS A;  1VQ6 N;  4E1M A;  2Q36 A;  1NK8 A;  4FK2 A;  5AQZ A;  2O8D B;  4FOI A;  1NK6 A;  4LSL A;  3OS1 A;  3BP8 A;  4BC2 A;  4DV1 K;  3O3F A;  4DF4 A;  3QER A;  1Q82 O;  4DS5 A;  5JVG L;  1KLN A;  4BRG A;  4IFY A;  1VQ7 N;  4CJV A;  3C6A A;  4FLT A;  4AQY K;  3HP6 A;  2W6L A;  3L6Q A;  4KPY A;  3VQ4 A;  4H0X B;  1NJI O;  2WFB A;  4I9Q A;  3VER A;  4FW2 A;  3AAP A;  1B9F A;  3O3H A;  1WBB A;  4KHU A;  4A5B A;  3WXM B;  2QW9 A;  2RKI A;  3NMU A;  3DLH A;  2VWB A;  4CGH A;  5M1F A;  3TSQ A;  4BRI A;  3PLA A;  2NNW A;  3VQ5 A;  1S1U A;  4YNQ A;  4BAC A;  2PZS A;  5EVZ A;  3D2E B;  1E3M A;  5J2Q A;  1T8E A;  1Q81 O;  1C0U A;  5E41 A;  5C15 A;  3O08 A;  3WNG A;  1YTA A;  1WSF A;  1K6Y A;  4MFB A;  1BIU A;  4DSF A;  1S22 A;  2B5J A;  4FZZ A;  4RCH A;  1YVN A;  2YKM A;  4DR3 K;  1JXE A;  3CJ9 A;  3A5O C;  3FFK B;  4KHP K;  5AQV A;  2KTQ A;  3P38 A;  3O9Q A;  4HCB A;  3E66 A;  1JJ2 M;  2YCH A;  3OYN A;  4KB1 A;  2Q3S A;  2UXB K;  3KLH A;  3KVG A;  3T1H K;  3ATV A;  5BRF A;  4FLV A;  2YJE A;  3LM2 A;  4DV2 K;  3M8S A;  3CC4 N;  4B3T K;  2JWL A;  2HB5 A;  1J5E K;  4CZG A;  1KCF A;  5M1Q A;  4AHU A;  2UUA K;  4KTW A;  1IO2 A;  5BN8 A;  4HCC A;  3KLG A;  4NXM K;  1T44 A;  4H4M A;  4CIF A;  3DXK A;  3A8Y A;  4OX9 K;  3ZT1 A;  1EX4 A;  4CBX A;  4LFA K;  2YNH A;  1NJW A;  4C8N A;  5AZI B;  4H5T A;  4IOA L;  1U47 A;  2A5X A;  3DRR A;  4M7Y A;  1LWF A;  4RTF D;  1Z6R A;  4B9U A;  3HTV A;  3LAM A;  3OYA A;  3LDP A;  5AQJ A;  3T7Z A;  4CJL A;  2NUB A;  4FZX C;  3SZ2 A;  1VSD A;  3G10 A;  4FJ7 A;  3HPH A;  3VGM A;  4FL9 A;  2UUB K;  4JNE A;  4GVM A;  1T3V A;  3ENH A;  1WSI A;  1X9W A;  3NGI A;  3KD1 E;  2BH1 A;  4KKO A;  1LV5 A;  1QHA A;  4CHN A;  1OH5 A;  3AVH A;  1YXQ A;  4M63 C;  3SMS A;  1YF5 L;  3VTI A;  1GLA G;  1ZBU A;  4IWV A;  3OS2 A;  1U45 A;  1KAX A;  1TYQ B;  4CFA A;  2BGG A;  4CJ4 A;  3M1F A;  1K8K B;  3O4Q A;  3VOV A;  3ZX2 A;  2PAV A;  2D1K A;  2UXC K;  1NGI A;  4RW7 A;  5GAG P;  3G25 A;  3IFR A;  3SK3 A;  3OS0 A;  1RDC A;  2RN2 A;  4KBO A;  3OYE A;  2QWO A;  3FE1 A;  5KGX A;  3VF6 A;  3EN9 A;  2O8F A;  2F96 A;  4JKF A;  2WBN A;  1S6P A;  1YT3 A;  4CJK A;  1NGH A;  4EP4 A;  4BWJ A;  3AA2 A;  2GEL A;  4PKG A;  4JI4 K;  3VGL A;  4IDK A;  3AO2 A;  3KHY A;  2E1Y A;  2HST A;  4NB4 A;  4JK7 A;  2O4G A;  2FSJ A;  4YDU C;  4BRD A;  1D9F A;  1QZ6 A;  2A3Z A;  3OYM A;  2F8T A;  4QOZ B;  4NO7 A;  3O6W A;  1P90 A;  5AQO A;  4DHY A;  3KK1 A;  3ZYY X;  4BRF A;  4FJG A;  4BRC A;  4DTS A;  4B3O A;  3W0L A;  4FOE A;  4H0T B;  5FPD A;  1Y97 A;  2KHO A;  4I6M B;  1HNX K;  1BIS A;  3AV9 A;  3K2P A;  4DV6 K;  3D0P A;  1KD1 O;  4FJK A;  2A1R A;  5JIC A;  5TKW A;  3MWP A;  4ISF A;  2E5L K;  4YOR A;  3L4Q A;  5GIN A;  3EZ5 A;  2O8C A;  4OPA A;  5C2F A;  3O80 A;  2HMP A;  4UY8 O;  4DUY K;  2ZQB A;  1S5J A;  2X6S A;  1VHX A;  3MN9 A;  4CJ3 A;  1ZBH A;  1VRU A;  3HRG A;  3TAP A;  3SUP A;  4CEE A;  3DOL A;  4FWS A;  3UKU A;  4ELV A;  3L8B A;  4BY9 C;  1U49 A;  4XEI A;  4F3T A;  4E19 A;  3PY8 A;  4KFB A;  3TAG A;  3PIP L;  3AAR A;  4Y1D A;  4PL7 A;  3LWL A;  3G6E N;  3TAB A;  1IBM K;  4FYD A;  4CBU A;  2A42 A;  3H08 A;  2BUP A;  1RDB A;  2BTF A;  2FF3 B;  1TKX A;  3CCR N;  1U2V B;  4CZH A;  4BRP A;  3OBW A;  3ITH A;  4BC5 A;  1YUW A;  5C25 A;  3ISN C;  3PSF A;  3ZET B;  1OH7 A;  3EO3 A;  3CC2 N;  1TAU A;  1S9E A;  1ASU A;  4N41 A;  1KVB A;  4A2B A;  4A2A A;  4JV5 K;  4YOW A;  5CHI A;  5M1O A;  1DEJ A;  3AAQ A;  3DLL L;  3MED A;  3VEZ A;  2YX6 A;  2HMI A;  1G15 A;  5C0Y A;  4O55 A;  2V51 B;  2P1J A;  2P9K A;  2Q31 A;  2RF2 A;  4I2Q A;  1CZ9 A;  1SV5 A;  3B6P A;  4CGI A;  3SUO A;  4AF1 A;  5GIO A;  1KRP A;  4HUE A;  3T69 A;  2PBD A;  4JLH A;  2JLE A;  1UAX A;  1N6Q A;  1QQO A;  4CGD A;  3CG7 A;  3T19 A;  3C6U A;  1YHQ N;  3TPQ A;  4Z0U A;  4GY2 B;  3M8R A;  4CJE A;  2OPQ A;  4BDY A;  1NKC A;  3QO9 A;  3LDO A;  4I7F A;  2XY7 A;  3PIO L;  4WQ4 C;  1OH6 A;  1HMV A;  1DT9 A;  4HUF A;  4AIL C;  2F9W A;  4FLX A;  2J4R A;  3TU5 A;  4KV8 A;  5CZ1 A;  2VG7 A;  3RR8 A;  3VEO A;  1B92 A;  3ZSW A;  4XH5 A;  1NGD A;  4GV6 A;  1RTJ A;  3NVM A;  2P9S B;  4CGF A;  5AQT A;  3WQT A;  2PFU A;  4M3Z A;  4BVO A;  3CCJ N;  4AHC A;  2O8D A;  1Q9Y A;  1LAW A;  2E4L A;  1J54 A;  1XHZ A;  3MK6 A;  2OYQ A;  4IKF A;  3H46 O;  1N36 K;  1CXU A;  1OVY A;  3VF4 A;  3LP1 A;  3PX6 A;  1DTQ A;  1VQL N;  3CPE A;  1IG8 A;  3EE9 A;  4AM7 A;  2F8S A;  5FRO A;  5C42 A;  3HJF A;  2YHX A;  3OYC A;  1KTQ A;  4NLC A;  1QQN A;  2D0O A;  3D45 A;  5JMV A;  4ILH A;  4H03 B;  5KPZ A;  1QSS A;  3QEV A;  3EZW A;  3K58 A;  1YJW N;  2OPP A;  5H1S Q;  4CZI A;  2ZGZ A;  1BA0 A;  3QIN A;  4NYF A;  3KJV A;  4E3S A;  2NRW A;  3AO4 A;  4BRK A;  4C1N I;  4FXD A;  5SZT A;  3SQ1 A;  3J7A P;  5EY4 A;  1XWL A;  5J2N A;  1UOC A;  4Z4C A;  5T7B A;  4PWD A;  4JEP A;  4CK3 A;  4KB0 A;  4CHO A;  1VQO N;  3FGU A;  4ISG A;  4WQ4 A;  3NE6 A;  3D2E A;  3E1Y A;  1XC3 A;  1GOA A;  4BRN A;  1FJG K;  4JKG B;  3N4Q A;  4CIE A;  1BWF O;  1XHX A;  4M45 A;  3HT3 A;  3QML A;  1RBT A;  3R8E A;  2VWK A;  5AQL A;  4CF8 A;  3KK2 A;  4OPJ A;  3ULD A;  1GLC G;  5AFU H;  3I8D A;  1NJY A;  3CQ8 A;  4ILG B;  4E7J A;  4OO1 J;  3QB0 A;  4BG8 A;  3EE8 A;  3LZJ A;  3SQ4 A;  1VAZ A;  5F2R A;  3LPU A;  1QSY A;  4MLH A;  3SV3 A;  3UKR B;  4IEE A;  2P9U B;  2OPR A;  3VES A;  4H5V A;  1LCU A;  1TVR A;  2HW3 A;  5JS2 A;  4BDZ A;  2FSN A;  1GLL O;  4KH6 A;  4O5F A;  5FPM A;  1QS4 A;  2WON A;  3THV A;  3A0I X;  1EXQ A;  1VSF A;  2X78 A;  3K5N A;  4DU3 A;  4QS9 A;  3S3N A;  2UU9 K;  1C1B A;  1JLG A;  3IUC A;  2P51 A;  1ZC6 A;  3MN5 A;  2ZD1 A;  2HND A;  1OVQ A;  2QWR A;  3AVL A;  4JI5 K;  4JRQ A;  2ZGY A;  3H45 C;  4IG0 A;  4CGJ A;  4DKW A;  1NGF A;  5BRD A;  3O9U A;  5HRS A;  4DS4 A;  2HHT A;  2QWL A;  4KRE A;  3MEE A;  3MEG A;  1ITG A;  5AZI A;  4KHW A;  3B8A X;  3A5L C;  5J2P A;  2KFZ A;  4WQ5 C;  3D2F B;  3UKU B;  4GV3 A;  2WC9 A;  1Q8I A;  1NG9 A;  4CCH A;  4DFP A;  3UIQ A;  2QTD A;  1H1V A;  3HYF A;  1FKO A;  4CER A;  4DLG A;  4CJW A;  1RBR A;  4DTM A;  5LJW A;  1JLB A;  5GAD P;  2ATQ A;  4K8Z A;  1W2B M;  4DR4 K;  1Q86 O;  1C0F A;  3RVC A;  1KQS M;  2IVO A;  2GV9 A;  3SAF A;  2Y1J A;  3TWH A;  2VQF K;  5HRR A;  2P9I B;  3LDS A;  3J8A A;  4LC9 B;  1SKS A;  3IG1 A;  3OYL A;  3HVR A;  3OYD A;  1BG3 A;  1GLF O;  3V1R A;  1TYQ A;  4BRM A;  2GUP A;  4WE1 A;  2KKZ A;  1KLM A;  3OY9 A;  4FVM A;  2F7T A;  4Z4H A;  4FJ5 A;  3RMD A;  3CJC A;  1K8K A;  4R79 A;  5FPE A;  2GWK A;  4JKB A;  1JL2 A;  4CFC A;  1OH8 A;  1CZA N;  1LOT B;  3NVK A;  3MMV A;  4LF9 K;  3LPT A;  2HBK A;  3FLC O;  3K5O A;  1K9M O;  2G8F A;  4YFU A;  5HL7 L;  2G8V A;  5GAE P;  4BR9 A;  1QQC A;  4CF1 A;  4CJU A;  1U48 A;  3EKS A;  1RT6 A;  2AP1 A;  1SKW A;  3L3V A;  2HF4 A;  4EFH A;  4XH4 A;  1T03 A;  4XH1 A;  3NGY A;  4FCY A;  1L3V A;  4BRL A;  4B9L A;  4DTX A;  3ZEU B;  4DWI A;  4NCB A;  4DSJ A;  4CF0 A;  4FJX A;  4WQ5 A;  4J2E A;  1RT2 A;  5FLX O;  3CCS N;  4FWL A;  3SJH A;  1HLU A;  1ASW A;  4DV0 K;  5BN9 A;  3TAR A;  3L2R A;  4Y0W A;  5HRO A;  2QK9 A;  3EEQ A;  3GG4 A;  1S1W A;  4I6M A;  1C1A A;  5CY4 A;  4LH4 A;  1WNS A;  1TAQ A;  4GW6 A;  4O4G A;  4Q5V A;  1JLQ A;  2ZWH A;  3IMX A;  3RMB A;  4CJ5 A;  3ZX3 A;  4F9O A;  2PY5 A;  1BQM A;  4L8R B;  5AQM A;  3VEW A;  3KD5 E;  3CFP A;  2VQE K;  4BWM A;  2ASP A;  5LY3 A;  5EOY A;  4IFE A;  3TSP A;  2GWJ A;  5AZJ B;  3ZSO A;  1XC9 A;  1HJO A;  2RHK A;  4RW8 A;  3DXM B;  4FJH A;  3J81 O;  4PHT X;  3SBG A;  4K8X A;  3BEX A;  2OTJ N;  3L0Q A;  1S1X A;  5BRE A;  2A6A A;  3EYZ A;  1FXX A;  2ZJP L;  3QFP A;  3ZT2 A;  4CED A;  4DG1 A;  2VGM A;  1ZBL A;  1VSM A;  4GV9 A;  4B08 A;  1C0M A;  4JI0 K;  4GMJ B;  3AVN A;  4YOX A;  4FJI A;  1TV6 A;  2Q1N A;  1U2V A;  1RGI A;  2UYT A;  4MDA A;  4J8F A;  1DTT A;  2QWP A;  3CJ1 A;  3DLG A;  1WN7 A;  2NRH A;  3ZET A;  3ASM A;  4M7X A;  5EX5 A;  1IKW A;  3F73 A;  3DLR A;  2I7P A;  4B9V A;  3DMJ A;  5AQP A;  3VQE A;  1L3T A;  1VSE A;  4CEF A;  4PUO A;  3M5R A;  3AO5 A;  4DCH A;  1REV A;  2P9P B;  3WUH A;  1SL0 A;  5HRN A;  3L4I A;  4ID5 A;  3QNN A;  5FPN A;  1FKP A;  3CFR A;  5KQ8 A;  4EZ6 A;  1S1T A;  4EIA A;  4G1Q A;  3KWG A;  3LM9 A;  1ILY A;  3MXM A;  4FJL A;  5HOO A;  3OA9 A;  3IRX A;  4U7B A;  1RTI A;  5GIP A;  4KRF A;  4ILJ A;  1NMN A;  2IIR A;  3MEC A;  4OJR A;  4AH9 A;  4CZF A;  1S6Q A;  4DV7 K;  1HYV A;  4BDP A;  3NFA A;  1NGJ A;  2CGL A;  2PYL A;  3T3F A;  4LH5 A;  5AQU A;  3HVT A;  4W5O A;  3NF7 A;  3HOS A;  4DU4 A;  4YY3 K;  3VF2 A;  2ZM6 K;  5JS1 A;  4GKJ K;  2VGN A;  4E7L A;  2GX9 A;  4OKJ A;  4X66 K;  1T6D A;  2P9S A;  5K14 A;  1C0T A;  3H6E A;  3RRH A;  4FWO A;  2I5J A;  4JI3 K;  5F0X A;  4HTL A;  3V9X A;  1WAJ A;  4LD0 A;  3IAY A;  4K0K K;  2FBY A;  1MWK A;  1XUP O;  4CD1 A;  4IFV A;  4JAX A;  4N47 A;  5C12 A;  1CZB A;  3SJJ A;  4DQS A;  5SWM A;  3GL1 A;  1IKV A;  4NCA A;  2XHB A;  4AHS A;  5BR8 K;  2O8E B;  1HNI A;  3SMP A;  4CK2 A;  1YAG A;  5JLH A;  3FZH A;  3OYJ A;  2OZS A;  4DFM A;  4Y1C A;  4JI7 K;  3OBY A;  2XRI A;  2YJF A;  3VA0 A;  3CYM A;  4PL8 A;  3OTO K;  2HOE A;  3O1W A; 
#chains in the Genus database with same CATH homology
 2FF6 A;  1QVF M;  4JK9 A;  4AF1 A;  1BOT O;  3ATU A;  4CD3 A;  5C2D A;  5GIO A;  3K9J A;  2PBD A;  3T69 A;  4IXC A;  5AQG A;  2ZF5 O;  3U9D A;  3RSE A;  4BC3 A;  5KQD A;  3J7Z O;  1QQO A;  2CGJ A;  1YHQ N;  2KLA A;  2RE2 A;  3TPQ A;  3G4S N;  3I55 N;  3ENB A;  1YI2 N;  4GY2 B;  4IEI A;  5BR9 A;  3BUZ B;  3MWT A;  4FWN A;  1IJJ A;  3F2K A;  2AA4 A;  3O4W A;  3LDO A;  4B1Y B;  4WQ4 C;  3WEE A;  3PIO L;  1K73 O;  3WT0 A;  4JKG A;  3WXJ A;  4BGA A;  2OAN A;  1KXP A;  1DT9 A;  1RDW X;  3G71 N;  2F9W A;  2NRZ A;  3VMF B;  2V7Z A;  4JKE A;  5AQI A;  2J4R A;  1ESV A;  3ZX0 A;  4WCE L;  3TU5 A;  4WFN L;  4EHT A;  2IVN A;  4FWK A;  3CME N;  3ULE A;  4IO8 A;  4IJA A;  3VEO A;  4C23 A;  3CCM N;  4FPB A;  3TSU A;  4XH5 A;  1NGD A;  4GV6 A;  3E9P A;  3H3O B;  3NVM A;  4BR4 A;  2V7Y A;  3VEN A;  4FPA A;  2P9S B;  4Z94 A;  3D7E O;  1T6C A;  4JHD B;  1DKG D;  5AQT A;  3WQT A;  3UKR A;  2PFU A;  2E2P A;  4FWM A;  4BVO A;  3CCJ N;  2P9U A;  4K42 A;  3VET A;  3AGK A;  3GDQ A;  3CJB A;  1NGB A;  1TUU A;  3MK6 A;  4A5A A;  4EHU A;  1JCE A;  4MDB A;  1X3N A;  1HKB A;  4BQZ A;  3H46 O;  4JD2 A;  5AQW A;  2NRV A;  1TUY A;  4FWR A;  4B1V A;  1VQP N;  1YIJ N;  4WF9 L;  1R59 O;  1VQ5 N;  1OVY A;  1N8R O;  1EO1 A;  1NMD A;  3VF4 A;  4JKD A;  1VQL N;  3FZL A;  4CZJ A;  3CPE A;  1IG8 A;  3EE9 A;  1GLB G;  3QDK A;  4AM7 A;  2YHX A;  2QWN A;  1E4F T;  3BF1 A;  4NLC A;  1QQN A;  2D0O A;  5CE3 A;  1QVG M;  3MDQ A;  5JMV A;  4ILH A;  4H03 B;  5KPZ A;  5M1N A;  1MA9 B;  3EZW A;  4WFA L;  3VEY A;  1U6Z A;  1YJW N;  5H1S Q;  3A5M C;  4IOC L;  4CZI A;  3R3L A;  1SQK A;  2P9K B;  5BRH A;  1YJN N;  2ZGZ A;  1BA0 A;  3H1Q A;  3HBT A;  4H0P A;  5ADX H;  3P31 A;  2P9L A;  2NRW A;  3QIC A;  4BRK A;  3O9S A;  1JCF A;  4C1N I;  4FO0 A;  3CJA A;  3QBW A;  2YHW A;  1BUP A;  2FXU A;  2NLX A;  2E88 A;  3IDH A;  2NRR A;  5EY4 A;  3RSE B;  3SBT A;  3D2F A;  4HWI A;  4JEP A;  4AM6 A;  1VQO N;  1KC8 O;  3FGU A;  4ISG A;  3LDL A;  3WXL A;  3CCU N;  4WQ4 A;  3CD6 N;  4BR0 A;  3D2E A;  1HX1 A;  3E1Y A;  3HSC A;  4B9Q A;  1XC3 A;  3IKM A;  1GLD G;  5M1P A;  3WEE B;  3CPW M;  4BRN A;  3AGR A;  1X9J A;  4JKG B;  1X3M A;  4KH5 A;  3N4Q A;  3GBT A;  2YHY A;  3VEX A;  1BWF O;  1NGE A;  1E4G T;  4H0Y B;  3QML A;  4YOT A;  2ASO A;  3KK7 A;  2W40 A;  3R8E A;  5AQL A;  3U9Z A;  3CI5 A;  4CBW A;  3CCQ N;  2E2N A;  2P9I A;  1BO5 O;  2H3G X;  3KWI A;  1GLC G;  5AFU H;  3CHW A;  1HPM A;  3JS6 A;  3ENO A;  1YIT N;  4BGB A;  2F9T A;  3R1X A;  3ULE B;  4BR7 A;  2ASM A;  2IVP A;  3C7N A;  4ILG B;  4DB3 A;  4OO1 J;  3QB0 A;  4BG8 A;  3HI0 A;  3EE8 A;  4YDU A;  4BVP A;  4K25 A;  4BG9 A;  1VAZ A;  3CC7 N;  4E1J A;  4YOU A;  5F2R A;  2ZJQ L;  3O5B A;  4K41 A;  3CCE N;  4MLH A;  1Z05 A;  1ZBS A;  1XQS C;  1VQ6 N;  3UKR B;  4IEE A;  2Q36 A;  2P9U B;  3VES A;  1RFQ A;  5AQZ A;  4FOI A;  4H5V A;  1LCU A;  2HBL A;  4H5N A;  1VQN N;  2FSN A;  1GLL O;  4KH6 A;  3BP8 A;  4O5F A;  5FPM A;  4BC2 A;  1K8A O;  2CH6 A;  4JD2 B;  1ATS A;  1Q82 O;  3A0I X;  5JVG L;  1BA1 A;  4QS9 A;  5AQY A;  3TTC A;  4BRG A;  5I9E B;  1VQM N;  1VQ7 N;  3IUC A;  1VQ9 N;  1ZC6 A;  3C6A A;  3MN5 A;  2FLO A;  1NLV A;  3L6Q A;  4H0X B;  5KPR A;  2QEX N;  2QWR A;  1NJI O;  3U4L A;  2NRT A;  4B1W B;  2ZGY A;  3H45 C;  1NGA A;  4B1X B;  2WFB A;  4DKW A;  1NGF A;  5BRD A;  1WOQ A;  3VER A;  3O9U A;  3AAP A;  2QWL A;  4H0V B;  4KH4 A;  2I7N A;  3R9P A;  2P9L B;  4A5B A;  3WXM B;  5AZI A;  3W3D A;  3ZEU A;  2QW9 A;  3NMU A;  2Q2R A;  3B8A X;  3A5L C;  3UE5 A;  2VWB A;  3Q7B A;  1KAY A;  5M1F A;  4WQ5 C;  3D2F B;  3TSQ A;  3UKU B;  4GV3 A;  2WC9 A;  4BRI A;  3MCA B;  3PLA A;  2NNW A;  2E2Q A;  2QTD A;  1H1V A;  2HBM A;  5EVZ A;  3D2E B;  3MCP A;  5LJW A;  1Q81 O;  3C6H A;  5E84 A;  5GAD P;  3FR0 A;  5JLF A;  3S41 A;  3EL2 A;  5C15 A;  3K9K A;  1W2B M;  3CXC M;  1Q86 O;  1C0F A;  3RVC A;  2QWM A;  3O08 A;  4CI6 A;  1KQS M;  2IVO A;  1NBW A;  3SAF A;  3KZB A;  2QWQ A;  4C1N K;  3CCL N;  1S22 A;  2P9I B;  4H5W A;  2Q97 A;  4A59 A;  3WXI A;  4RCH A;  1YVN A;  3J8A A;  4LC9 B;  4BRQ A;  3C0B A;  3A5O C;  3CJ9 A;  3FFK B;  3VPZ A;  3VTH A;  1S72 N;  5AQV A;  4MO4 A;  3P38 A;  1BG3 A;  3C7N B;  3CER A;  1GLF O;  3O9Q A;  3E66 A;  1JJ2 M;  1VQ4 N;  2YCH A;  1TYQ A;  2P9N A;  4BRM A;  4YOV A;  4JKH A;  4OPH A;  2GUP A;  5AFU A;  5AZJ A;  2KKZ A;  3DXM A;  4G9Z A;  2F7T A;  3KVG A;  5TKY A;  3CJC A;  1K8K A;  4R79 A;  5FPE A;  3ATV A;  5BRF A;  1S3X A;  2FSK A;  4CZL A;  2GWK A;  2YJE A;  4GNI A;  2WUS A;  4JKB A;  2HF3 A;  5AQN A;  4CZM A;  3LM2 A;  1CZA N;  1LOT B;  3CC4 N;  3FZM A;  3NVK A;  2JWL A;  3CQX A;  3MMV A;  2D4W A;  5BPN A;  1NWK A;  4JK8 A;  2HBK A;  3FLC O;  3A5N C;  1K9M O;  3H1V X;  4CZG A;  2CH5 A;  5M1Q A;  2HBJ A;  3VGK A;  4B1U B;  5HL7 L;  3E9L A;  5GAE P;  4BR9 A;  3SAH A;  3I56 N;  5KPT A;  5BN8 A;  4IZ9 A;  4PKH A;  1T44 A;  3EKS A;  1MWM A;  2AP1 A;  2VCP A;  3DXK A;  3A8Y A;  5ELZ A;  1HUX A;  2HF4 A;  4EFH A;  3CIP A;  4XH4 A;  3SLC A;  3HOT A;  3D6R A;  4XH1 A;  4CBX A;  3CET A;  3P39 A;  4DQ8 A;  4ISE A;  4BRL A;  5E26 A;  1SS6 A;  3ZEU B;  2QM1 A;  5AZI B;  4H5T A;  3GE1 A;  4IOA L;  4WQ5 A;  3CCS N;  2A5X A;  4FWL A;  1HLU A;  3MN7 A;  4M7Y A;  3SJH A;  4BRH A;  4CZK A;  5BN9 A;  1SZ2 A;  3VEV A;  2P9P A;  5B8H A;  2D0P A;  4RTF D;  1Z6R A;  4Y0W A;  3HTV A;  1P8Z A;  3SAG A;  5F1X A;  1ZXO A;  3LDP A;  3Q7C A;  5AQJ A;  3T7Z A;  5AQK A;  5BPM A;  1ATN A;  1KAZ A;  4O8U A;  2CGK A;  3JXU A;  3VGM A;  4FL9 A;  3GOI A;  3I8B A;  3DJC A;  3GG4 A;  4K43 A;  4GVE A;  1Q7Y O;  4I6M A;  4JNE A;  5EXW A;  1T3V A;  4FWP A;  2E2O A;  1HKG A;  1OKJ A;  1QZ5 A;  3ENH A;  1GLE G;  2ZWH A;  3H3N O;  1YJ9 N;  3IMX A;  1NGG A;  3F5T A;  2BH1 A;  3M3Z A;  1QHA A;  1HKC A;  3ZX3 A;  4F9O A;  4FVU A;  1C0G A;  2OTL N;  1YXQ A;  4M63 C;  3SMS A;  1YF5 L;  3VTI A;  3WQU A;  3QFU A;  5AQM A;  1GLA G;  3VEW A;  2ASP A;  3MX2 A;  4IWV A;  5EOY A;  5LY3 A;  1KAX A;  1WUA A;  4IFE A;  1TYQ B;  2P9N B;  1J6Z A;  4NLB A;  3TSP A;  2GWJ A;  5C10 A;  1M90 O;  5AZJ B;  1HJO A;  5CR4 A;  3O9T A;  4L3Q A;  3CF5 L;  2RHK A;  3DXM B;  3M1F A;  4PHT X;  3SBG A;  1V4S A;  3BEX A;  4H0O A;  1K8K B;  2OTJ N;  3VOV A;  4BC4 A;  3ZX2 A;  1BDG A;  2PAV A;  3E9O A;  2D1K A;  1G99 A;  3L0Q A;  5BRE A;  1MDU B;  2A6A A;  4U67 L;  3LL3 A;  4QS7 A;  2ZJP L;  1NGI A;  5GAG P;  1Q18 A;  5JVH L;  3G25 A;  3IFR A;  3QFP A;  3HZ6 A;  3SK3 A;  3N4P A;  4KBO A;  4O8K A;  5ADX A;  4JN4 A;  1V4T A;  2QWO A;  2VGM A;  3FE1 A;  4GV9 A;  5AR0 A;  4MO5 A;  3VF6 A;  3EN9 A;  4QS8 A;  1GLJ O;  4YOX A;  2ITM A;  4JKF A;  2E8A A;  2WBN A;  2GEM A;  3EKU A;  4BR2 A;  4A62 A;  5GAH P;  2Q1N A;  1U2V A;  1NGH A;  1RGI A;  2UYT A;  4MDA A;  4J8F A;  3DXK B;  2QWP A;  4CJ7 A;  3CJ1 A;  2NRH A;  3AY9 A;  3ZET A;  2E1Z A;  2GEL A;  4M7X A;  2V52 B;  5EX5 A;  3ID6 A;  4JKA A;  4PKG A;  3VGL A;  2I7P A;  5MLC Q;  5M1K A;  5AQP A;  3KHY A;  2E1Y A;  1RDU A;  3M5R A;  2HST A;  4NB4 A;  5LJV A;  1VQK N;  4JK7 A;  3O9R A;  4DCH A;  2P9P B;  3WUH A;  2FSJ A;  4A61 A;  4YDU C;  4BRD A;  3L4I A;  5AQH A;  1QZ6 A;  3R6M A;  4YOY A;  2A3Z A;  3LDQ A;  4NO7 A;  3MN6 A;  3O6W A;  1P90 A;  3TTD A;  5AQO A;  5FPN A;  2A41 A;  4A57 A;  4DHY A;  3M6G A;  3ZYY X;  3FZF A;  5BPL A;  3FZK A;  4BRF A;  4BRC A;  5DM7 L;  4WFB L;  5KQ8 A;  3W0L A;  4FOE A;  2GTD A;  4H0T B;  5FPD A;  2KHO A;  3CQY A;  4I6M B;  4EIA A;  4RWT A;  3KWG A;  2Q0R A;  3LM9 A;  1ILY A;  2QI2 A;  1KD1 O;  5HOO A;  3OA9 A;  2QA4 N;  5JIC A;  5TKW A;  3MWP A;  4ISF A;  4BQL A;  4U7B A;  3I33 A;  5GIP A;  1W97 L;  4ILJ A;  4YOR A;  2IIR A;  3L4Q A;  5GIN A;  3DAW A;  2JWK A;  4CZF A;  3O1B A;  4OPA A;  3BF3 A;  3F9M A;  5C2F A;  3O80 A;  2HMP A;  2Q0U A;  3OW2 M;  4PKI A;  2VYP A;  2E20 A;  1NGJ A;  2CGL A;  4BRE A;  4UY8 O;  2NRX A;  4WYB A;  5AQF A;  5AQU A;  3QBX A;  4CZE A;  4IJN A;  3HOS A;  3VF2 A;  3TTF A;  1SAZ A;  3MN9 A;  3HRG A;  1BU6 O;  1O13 A;  1ATR A;  5AQQ A;  3UB5 A;  3U8X A;  2VGN A;  1EQY A;  4FWS A;  2GX9 A;  3UKU A;  4EAH D;  4BY9 C;  4XEI A;  1T6D A;  4H5R A;  1M1K O;  2P9S A;  2W41 A;  3PIP L;  4MLE A;  1NM1 A;  3AAR A;  3C65 A;  3H6E A;  4JHD A;  4PL7 A;  4FWO A;  2DPN A;  3G6E N;  1JCG A;  1DGK N;  3CJ7 A;  4HTL A;  5F0X A;  4IDH A;  4BR5 A;  2A42 A;  4CBU A;  3OHR A;  5AQX A;  2BUP A;  2BTF A;  4IOX A;  2FF3 B;  1MWK A;  1XUP O;  3CCR N;  1VQ8 N;  3P4I A;  1U2V B;  2A40 A;  4JKC A;  4CZH A;  2YI1 A;  4BRP A;  4CD1 A;  4JAX A;  4FSV A;  4BRO A;  3CCV N;  3OBW A;  3LDN A;  5C12 A;  3CMA N;  4BC5 A;  1YUW A;  2EWS A;  3ZET B;  3GL1 A;  3EO3 A;  3ID8 A;  3CC2 N;  3DWL A;  2QXL A;  5AQR A;  4FWQ A;  1Y64 A;  3HM8 A;  4BRA A;  3SMP A;  4A2B A;  1QQM A;  4A2A A;  4YOW A;  1YAG A;  5CHI A;  5M1O A;  1DEJ A;  3AAQ A;  3DLL L;  3MX5 A;  4IO9 L;  3VEZ A;  2YX6 A;  5JLH A;  3FZH A;  1NGC A;  3WXK A;  2ZJR L;  5C0Y A;  2NZT A;  3OBY A;  5AQS A;  2YJF A;  1D4X A;  2V51 B;  2Q31 A;  2P9K A;  4B1Z A;  4PL8 A;  3O8M A;  5DM6 L;  2HOE A;  3O1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...