4IOXA

The structure of the herpes simplex virus dna-packaging motor pul15 c-terminal nuclease domain provides insights into cleavage of concatemeric viral genome precursors
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
255
structure length
225
Chain Sequence
b'PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTSDDLMVAVIMAIYLAAQAGPPHTFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tripartite terminase subunit UL15
publication title The Structure of the Herpes Simplex Virus DNA-Packaging Terminase pUL15 Nuclease Domain Suggests an Evolutionary Lineage among Eukaryotic and Prokaryotic Viruses.
pubmed doi rcsb
source organism Human herpesvirus 1
molecule tags Viral protein
total genus 70
structure length 225
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioxA00
4IOXA 3N4QA 3N4PA
chains in the Genus database with same CATH superfamily
4YOXA 5AZJB 1JLCA 3MWPA 4K43A 4KHYA 3SCXA 5EY4A 1TYQA 2QWQA 3TI0A 1X9MA 2ITMA 1KVAA 3TU5A 4GKKK 2ZM6K 3OA9A 1EO1A 3LPTA 3TTFA 2J4RA 4BC4A 1G99A 5AQYA 4XH5A 3MDQA 2HMIA 3L3VA 1VQON 3ZX2A 2KZMA 5CZ1A 4KREA 2IVOA 4BVPA 3RMCA 2QTDA 1N32K 1QS4A 4W5OA 3K5OA 3O1BA 4QCLA 2VGMA 5BR9A 2YHWA 2YNIA 1NK4A 1VQ5N 2HVHA 4CF2A 4FK0A 4RW8A 3I0RA 4BACA 3MWTA 5GIOA 1C0MA 4AH9A 3ISNC 4CJTA 1TK0A 3VEXA 3EE9A 1RT3A 1WUAA 3UKRB 1I39A 1RDDA 4CZEA 1YTUA 4H0VB 5AQOA 2P9IB 2W41A 3WNGA 2VG6A 4BDYA 2GELA 4CERA 3SUPA 4FYDA 4NLCA 3H1QA 5AQTA 4LF6K 2HHQA 3E66A 3H45C 3QMLA 3MX2A 2UXBK 4J2EA 4OGCA 2ZQBA 3WNHA 1TAQA 4EFHA 2YHYA 3WXLA 4NCBA 4FWOA 4BRAA 3WNEA 3EO3A 1X9JA 1VQ7N 2D0CA 1YJ9N 1OVYA 2VCPA 3A8YA 4GY2B 3VQ8A 1U4BA 4QS8A 4CF1A 1LW2A 1FK9A 4FWPA 1NK5A 3T1YK 3J8AA 4WQ4A 5AQLA 3VENA 3IS9A 3F9KA 5J2MA 3C7NA 2UUAK 4AHSA 1JXEA 3M8PA 1S6QA 4OKKA 4FLVA 5B8HA 3KZBA 5HBMA 1IO2A 3PV8A 4FJHA 4MQ3A 4CZGA 3R1XA 4DSLA 1Y64A 1RBSA 3QINA 4YDUA 1GLJO 4DHYA 4FJ7A 4OO1J 5D3GA 5C15A 3QEVA 3CCRN 1W97L 3KLHA 4GW6A 4KHNA 3TR8A 3D45A 3DRSA 5C12A 2IVPA 4FM0A 3SBGA 1NJIO 3HP6A 4DSJA 1W0HA 3CM6A 4F2RA 3DXKA 1YHQN 3IRXA 2O8CA 1X9SA 2QWPA 5LL6Z 1IKWA 5AQQA 4W5RA 2YCHA 3ASMA 5E41A 4KO0A 4ILGB 1C0TA 4CJWA 4OPKA 1RT7A 4FWMA 3QERA 4JNEA 4O55A 4M3TA 4I6MA 1FKOA 1EQYA 1HPZA 1NNEA 3P4IA 4CZIA 2CGJA 3VQ5A 1HX1A 4CK3A 1SV5A 4KHSA 3ID6A 1BIZA 5FDLA 4BR2A 2D0BA 2O8EB 3R9PA 4ILHA 3MEGA 2A40A 1S22A 1KLNA 2UUCK 4CIEA 1JLGA 4DTRA 2E20A 4DF4A 1RCHA 4A2BA 4YOWA 3G0ZA 4WQ4C 3VGMA 4CJ7A 3V9XA 1R0AA 4EZ6A 1P8ZA 3THXB 2QW9A 2Q0UA 3VEOA 3NGIA 3VEYA 3PUFA 1HLUA 3CG7A 3H08A 4JEPA 4O8UA 4A61A 4PWDA 1EETA 2OPSA 5H1SQ 4EHTA 3ZT1A 1MWMA 3HM8A 4KTWA 4YDUC 4CZMA 1UA0A 1LAVA 2Q3SA 5BR8K 2OTLN 1VQPN 4CHQA 3KKRA 1D9FA 4E7JA 3IMXA 3HBTA 5FPDA 3ALYA 1B9DA 2WFBA 4DQ8A 1NGFA 3CCEN 1QHTA 4DTUA 3I56N 3O9UA 1NK6A 4B08A 3PX0A 2O8BA 4A62A 3F73A 4CJ3A 1T05A 4PUOA 4DV6K 4B1WB 5CZ2A 3K9KA 2F8TA 2A6AA 2NRZA 3AVKA 1GOCA 4B3RK 3A0IX 1IBLK 4RTFD 2ASPA 1DGKN 4CF0A 3ENBA 2Q36A 3CJAA 1S72N 1VQ6N 2OTJN 5FRNA 4M42A 2E2NA 1JLEA 1OKJA 3MEEA 3E01A 2HHHK 2WUSA 5FLXO 1L3UA 2F96A 4H5TA 4C8NA 1QHAA 3H3NO 1U47A 3I8DA 4JI5K 3V1RA 1LCUA 2NUBA 3CCVN 4CJQA 4L8RB 1Q82O 1U2VA 1VQKN 1T7PA 3HJFA 2UXDK 3DM2A 1HKCA 2FBXA 1X9WA 3M8RA 3UKUA 3GBTA 4C8LA 4B9MA 3N4PA 3V9WA 1BISA 3KD5E 3MXJA 3KK1A 2BGGA 4E0DA 3HXMA 3HRGA 5C25A 4CJRA 4OLBA 1C0UA 3CJ1A 4DFKA 3HVTA 4IOAL 3SK3A 1MWKA 2FBYA 4LSLA 5AFUH 3L6QA 2W42A 1ATNA 4H5WA 3CF5L 1KTQA 2W6KA 1SAZA 1NK0A 1NGAA 1FW6A 1NJZA 2ZWHA 3ZETA 4CJVA 1NGIA 2R7YA 2HNDA 3BUZB 3NHGA 3PO4A 1JXBA 2P51A 2GUIA 1QSSA 5IT9O 4DSFA 3WEEA 5J2QA 4E3SA 1U6ZA 2UXCK 2F4VK 1S9GA 1SUQA 3K5NA 2P9KA 3IG1A 4YFUA 3PSIA 4LH4A 2D4WA 3VERA 3LDNA 4DS4A 4I7FA 2DTUA 3ZSOA 1VSIA 1NMNA 2XRIA 4YOVA 4FJLA 4C8OA 1BL3A 3HVRA 1J54A 1XHXA 4W5QA 3ULEB 4CEDA 1VQLN 1XC9A 1K8KA 1V4SA 3LDSA 5BPMA 4B9UA 1W7AA 1ASWA 4XH4A 1V4TA 2RPIA 5SZTA 2PYJA 4M7YA 3KHYA 3CETA 4B3TK 4IDHA 4IO8A 3KWGA 4WYBA 1HKBA 4G9ZA 3D0PA 2VG7A 3LZJA 3DLHA 3HPOA 3NVMA 3AVAA 3SV3A 1L3TA 4PL7A 2FF3B 2HNYA 4NYFA 1BCOA 2H3GX 1RDUA 1YF5L 3CHWA 3VGKA 4OVLA 1Z05A 2KQ2A 3O8MA 1NGDA 3NVKA 1M1KO 1WSHA 3M5RA 3TAMA 3ID8A 1N6QA 5F2RA 3LAKA 2GTDA 3LDOA 1NLVA 1JL2A 3KTQA 1CXQA 2HVIA 3VQQA 4FLXA 5AQRA 5I3UA 2AA4A 2P1JA 3VQEA 3DLEA 2O8FB 4A5AA 5HROA 3HI0A 5LJVA 3VQBA 4BRQA 1CZBA 4C8MA 3OY9A 4B3MK 5M1QA 1X1PA 3ZSQA 3RMAA 1U48A 1ZBHA 1YI2N 1BA1A 2WTUA 4CD1A 2O8DA 3VTHA 1RDWX 4H4OA 1QQMA 4KH5A 3OYDA 2EHGA 1UWBA 2ETJA 3HZ6A 3LP2A 1DEJA 2Z1IA 4DKWA 5CHIA 3RRHA 2KZZA 4WE1A 5GADP 3FR0A 2PFUA 3SQ0A 1KLMA 2QI2A 2QWMA 3OYMA 2G8WA 2A1RA 3O6WA 2HHWA 1LW0A 2O4IA 1VHXA 3S9HA 5HP1A 3GL1A 1SKSA 3EL2A 4DR1K 1BI4B 2FXUA 4LF5K 2XO7A 2GWKA 4LFCK 3SQ1A 1YJWN 1XNRK 1I3AA 4DQPA 3VETA 2CGKA 4Z4HA 4JRPA 3KKSA 3NF9A 2HMPA 3KLIA 1S1XA 4BRMA 2HHVA 4HUGA 5BPNA 4QAGA 4G1QA 1KAZA 4CVNE 1YVUA 3H3OB 2ASMA 1NGEA 1E4GT 4IO9L 2RE2A 4DQIA 4OJRA 1RGIA 5DM6L 2IC3A 2NRRA 3LWMA 4DTOA 3GDQA 3NDKA 1J5OA 4A57A 3PX4A 4BR5A 2BE2A 1D5AA 2DFEA 2HBJA 4NLBA 1XI1A 4KB0A 4FM2A 3NH1A 5AQUA 3CCSN 2ZE2A 4B9VA 2HHSA 4BRHA 1RBRA 4L3QA 1D9DA 3QESA 3CJ9A 3AO2A 2YNFA 3D2EB 2QA4N 3L2UA 4CFAA 1NGGA 3FZHA 4ILJA 1ZBIA 1RBVA 3MN5A 4DQRA 3RR8A 4OKJA 4BY9C 3ENOA 3PLAA 5LJWA 4CHZA 3ZT3A 5KRTA 4JS4A 3TAFA 3VQ4A 1KCFA 3BEXA 4FJ9A 1KXPA 4I2QA 3CC7N 1HMVA 3FGUA 3AGKA 3LP3A 5AJ3K 5HRSA 4JI3K 4KHUA 1NJXA 1NBWA 2P9SA 3DI6A 3VQ9A 1NKEA 4I9LA 2Y1IA 5AQJA 1GLFO 3MCAB 4JKHA 1YITN 1A5VA 2I7PA 3T19A 5JS1A 1E3MA 4FLWA 2UUBK 3R8EA 3RVCA 4O44A 4BR7A 4AHRA 4B8AB 4CBXA 4BE0A 3OS1A 4HWIA 3ITHA 4BRKA 2KLAA 2OCEA 3SMPA 3OYJA 4YNQA 2DY4A 5KQ8A 1RT4A 2YHBA 3UE5A 4BC5A 1S1TA 3DRRA 1MDUB 4KI6A 1RT6A 3LP1A 4N47A 3OBWA 4KAZA 4CJSA 1WNSA 3SI6A 4M3YA 1SL2A 5AQSA 3DXMB 2XY5A 1YT3A 4IZ9A 4Z94A 4H0YB 4FLZA 4DF8A 2ZD1A 4YOYA 1IBKK 5BPLA 4X66K 3DLBA 1Q18A 3M6GA 4AF1A 2X6NA 4QS9A 1OH5A 1QZ6A 4JLHA 4CGDA 2WONA 4CIFA 3D2FA 4OPAA 5BRHA 4CHOA 2YV0X 2D0AA 4RWTA 3QEIA 3PO5A 4HVJA 4DU1A 3WXMB 5BRFA 1HQUA 4M3RA 4TSXA 3O9SA 4ISFA 3EEQA 1RILA 3O9TA 4X65K 2P5GA 3ATUA 2IAJA 3FLCO 4M3WA 4FJ8A 3ZSYA 3MXMA 4PY5A 5AQFA 1LWEA 4DR2K 2QWNA 4R79A 4ELUA 4M45A 3V6DA 4BRPA 4CJUA 2G8FA 3HYFA 3U9ZA 1JCGA 5M1PA 2G8UA 1L3VA 2ZJQL 3E9PA 3LDPA 3OVNA 1NK8A 1IG8A 1LAWA 1TL1A 2X78A 2ZJPL 1REVA 1ZYQA 3VMFB 2I5JA 3O1WA 2GX9A 1TL3A 1RT5A 3HL8A 4CW7B 4O0JA 5AQHA 4GV9A 3TAPA 2XHBA 2VWBA 4PKGA 3MCPA 4H4MA 4RG8A 2RHKA 2YJEA 3V9SA 1YIJN 2P9PB 3AVLA 5JICA 3THWA 2GWJA 4DTJA 2NZTA 1E4FT 3AO1A 3CJBA 3LDLA 2B5JA 1QQOA 4Z4IA 1HPMA 4YOUA 3VQCA 2CH5A 3P38A 1RNHA 5I42A 3S41A 4DR5K 4V19S 4JS5A 1D4XA 2PY5A 3EE8A 4DLGA 3TAGA 4JD2A 3T7ZA 4DSEA 3K0SA 2QWRA 1IV0A 4JKCA 1B9FA 2OPRA 4FWRA 3VPZA 4BR9A 3CQYA 3O08A 5J1EA 1BDGA 3LZIA 4ELTA 5AZIA 1IKXA 1SL0A 2QXFA 1YVNA 1RTHA 1HNVA 1TKTA 4M63C 3R3LA 4FLYA 5KPZA 4F2SA 1N34K 3O3HA 1MA9B 1KRPA 1KD1O 2QWLA 5HRNA 3SZ2A 3BGRA 4ZHRA 4JI2K 4BG8A 1VSLA 1C0GA 2GBZA 4IWVA 3HM9A 1TK5A 4I9QA 4DFJA 1NKCA 1BHLA 1BU6O 1J6ZA 3FFKB 2P9LA 5KPTA 4DV1K 2Z1JA 4XIUA 4KFBA 2E1YA 4BRIA 2IOCA 4IJNA 5HRPA 4E7IA 4H03B 2CGLA 1LWCA 4LF4K 1U49A 4CFCA 1TYQB 3U8XA 5J2NA 2YNGA 3FZLA 1VSDA 3HT3A 1VQNN 2KW4A 4RW7A 3KK3A 1C6VA 2A5XA 4FCYA 3VN5A 5F1XA 1K73O 4DU3A 4FWQA 1IKVA 2OANA 1Q9YA 1GOBA 4B9SA 3HSCA 1JCFA 1SQKA 3OYFA 3C6AA 3PX6A 3TAEA 2FSNA 4E7KA 4O5FA 1VQ9N 1Q86O 4EIAA 3CXCM 4PKIA 4WFAL 4FPAA 1KAXA 1SS6A 3O9RA 4FW2A 5JVGL 3CCQN 1VSFA 3G6EN 4AM6A 2Q97A 5KGWA 3D6RA 4BDPA 4KRFA 3IAYA 4HUFA 2GV9A 4U7BA 3OYBA 4BE1A 4CESA 3SJHA 3W0LA 4KKOA 2G8IA 3U3YA 4GMJB 1BQMA 4JRQA 4AQYK 3QETA 3K58A 4WF9L 4DS5A 4CHYA 4JKGA 1WSEA 2ITGA 3PSFA 3AO3A 2E6LA 1XMQK 4B1UB 1ZBLA 5T7BA 3OYGA 1ESVA 3EZWA 1ZBSA 3ZEUA 4DR3K 1NG9A 1GLCG 3I8BA 5M1FA 3TSUA 2I7NA 3T1AA 4CEZA 3EKSA 2P9NA 4B8CA 1RTJA 4IDKA 3NAEA 4Z0UA 1HKGA 5HLFA 3M3ZA 3O4WA 4E7LA 3S3OA 4FVMA 4CZKA 1W9HA 4O5BA 3C7NB 3OYEA 3MXIA 4KHWA 2V7YA 4CBUA 2F7TA 3AVJA 1O13A 4PKHA 4AHCA 3P83D 1YAGA 4Q0BA 4Y0WA 4JHDA 1RDAA 1HYZA 1UAXA 3ZT2A 4CF9A 2HBLA 3WUHA 1GOAA 4EP5A 4GV6A 1S6PA 3Q7CA 5HOOA 2QWOA 3OJSA 2F9WA 1HRHA 2FC0A 4E1NA 3LDQA 3DAWA 4FOEA 4CFBA 4BVOA 3U3GA 4W5NA 1C1BA 3QDKA 3OJUA 2W40A 5EXWA 4E7HA 4DSIA 3DXKB 4BQZA 2OA8A 2E4LA 3IDHA 4FPBA 2XY7A 3CCJN 4HTUA 3HOSA 2O8CB 3QNNA 3VESA 1CZ9A 2VYPA 1SKRA 4CEEA 1C1CA 2E2QA 1IKYA 2E6MA 2NRXA 2PBDA 3SAFA 4CK1A 1VAZA 2Q1NA 3CPWM 2WOMA 4FXDA 1R59O 1WSJA 5M1NA 3QIOA 1T6CA 3UIQA 5CE3A 3D7EO 3V4IA 4I6MB 3A5NC 3O9QA 5CY4A 1NM1A 1OVQA 5JLFA 3HPHA 5AFUA 4DUZK 2XY6A 5AQZA 3OYIA 3LP0A 4Y1CA 5ELZA 3M1FA 5JS2A 3EKUA 1HYSA 4E89A 5LMNK 4NO7A 2Q31A 5FROA 2E88A 1IBMK 3ZT4A 4KI4A 2FLOA 1S5JA 1MU2A 3O4NA 2G8KA 4BWJA 2BH1A 1IH7A 3THYA 4DV4K 2FSJA 3SUOA 3I0SA 2P9UA 4BC2A 3F9MA 4BR4A 2PZSA 1QSLA 1U45A 3SYZA 4CBWA 1NK7A 1TKZA 3KLEA 3LANA 1EWRA 4JI1K 3EYZA 1BA0A 3NCIA 3NH2A 3TSQA 3K5LA 2KTQA 1NU0A 3RSEA 2HB5A 1HUXA 4B9NA 1EWQA 2FSKA 3NBPA 1WSFA 4JKBA 3OYKA 3WQTA 1XWLA 2DFHA 5I9EB 2BDPA 3T1HK 3U9DA 3VEZA 5AZJA 3P5JA 4FJKA 4IOXA 3ULDA 1Q9XA 3VQPA 3U4LA 5LMUK 4H0XB 2QKKA 3AV9A 2VG5A 4DMNA 4Q5VA 4O4GA 4FM1A 1QQNA 4NCAA 4J2AA 4IEIA 1YTAA 1XHZA 4PHTX 1EP4A 2O8BB 2OYQA 5CYQA 4KH6A 1DT9A 3RMDA 3A5LC 1BIUA 2X74A 4N5SA 1NOYA 1QSYA 5A2QO 4GV3A 3KLFA 2ZGZA 4EZ9A 5JVHL 1RT1A 4FJ5A 2BANA 4UQGA 1VQ4N 1DKGD 3O3GA 2E5LK 3L4QA 4CF8A 2X6SA 1YJNN 1HJRA 1Q81O 1CXUA 1Z25A 1JLAA 4BRNA 3VQ6A 1IJJA 3MX5A 2RF2A 5KI6A 3BZCA 3L4IA 3UKRA 1CZAN 1Z26A 1KVCA 3IKMA 2NNWA 2D1KA 3MK6A 2P9IA 1WBDA 4FVUA 2E2OA 4MO4A 4CGHA 1U2VB 3QIPA 4B9QA 3WXIA 3CI5A 5BN9A 4CEAA 4KH4A 4B1YB 3DLLL 3UKUB 3I55N 4CGIA 4ZTFA 3V1QA 3HOTA 3CFPA 3T3FA 2F8SA 3AO4A 4CHNA 5BREA 3CC2N 3TAQA 4DUYK 4JI4K 1Y97A 5AQGA 3CQXA 4FJNA 4DV0K 4KBOA 1WSGA 5J2PA 3MAQA 1XC3A 3DLGA 4Z4GA 3BF3A 4CZLA 3J7ZO 1N36K 2B6AA 3GOIA 4X62K 1QVGM 4AILC 4DCHA 4NXMK 4F3TA 4JKAA 3QB0A 3ZETB 5BRDA 4CJEA 4HCBA 3OYHA 3WEEB 4ELVA 4DLEA 4KHPK 1S1WA 4NCGA 2P9KB 3P1GA 2YHAA 3CFOA 1BG3A 3J7YP 1OH6A 4MLEA 4MFBA 5ADXA 1S9EA 3LM2A 4CZFA 1G15A 2WBNA 1LWFA 1JLFA 4FL9A 3SAGA 3C6HA 5KGXA 3OW2M 4F3OA 4HHTA 1OH7A 3NMUA 1K8KB 1RBUA 3MMVA 4HUEA 4DR6K 2YI1A 3B6OA 2ASOA 3THVA 2F9TA 3SQ2A 2GEMA 4BGAA 4CI6A 2NRTA 3LL3A 4FZYA 4IJAA 4LF8K 3SNNA 5GIPA 2JLEA 5MLCQ 2IGIA 3KK7A 4K8XA 3AAPA 4CEQA 1K9MO 2FBTA 5EU7A 3QLHA 3O80A 1QE1A 4CIGA 2QXLA 1RDCA 3QEXA 2E1ZA 4FJXA 3BP8A 3NE6A 1EX4A 1L5UA 5CYMA 3VEVA 4BRCA 3DLKA 2QKBA 5F0XA 3FE1A 1T03A 3CCLN 5GINA 4K0KK 2O8EA 3L2VA 5AQKA 3TABA 3EZ5A 3SUQA 3QICA 3NF8A 1KVBA 4MLHA 1J9AA 4NB4A 5C0YA 2OPQA 3KLGA 2EWSA 1WAJA 3AVGA 2D5RA 3LALA 5HRRA 2E8AA 1P90A 1TKXA 1U04A 4OPJA 1WBBA 1TAUA 3ZSVA 4H8KA 4DFMA 4IEEA 3VA3A 3CCUN 3NGYA 4CECA 1JJ2M 4B9LA 3THXA 5GAEP 2HF3A 1KAYA 1UOCA 3JS6A 1XNQK 1K8AO 1DTTA 5AQMA 2AJQA 1X3NA 3BZKA 1RBTA 3ZLJA 1ILYA 1I94K 2O8DB 3WQUA 1Z6RA 4DSKA 1BO5O 4K41A 3PIPL 4B1VA 3NF7A 4OX9K 5AQNA 1RTDA 4FO0A 1SZ2A 4EHUA 3L2RA 3KJVA 1RDBA 3G25A 1HYVA 3SPYA 1WOQA 4IG0A 4W5TA 4ZTJA 1TGOA 1TUYA 5AQPA 4AM7A 4CEFA 3GE1A 3ZYYX 1N5YA 2PAVA 3EN9A 3OYLA 3AVBA 4A59A 5GAGP 3VF4A 3A2FA 4LC9B 1KQSM 2ZF5O 4DB3A 3AARA 1BQNA 3O3FA 3VQAA 3K9JA 1KC8O 4CHPA 2BUPA 3ZSZA 5C42A 3AA3A 3AVCA 2P5OA 3O4QA 3E9OA 1XQSC 4C8KA 2HBMA 3DLRA 4DTNA 3MN7A 3RWUA 1WLJA 4BE2A 4MDAA 2D0OA 1HNZK 3C95A 4AHUA 4H0PA 5FPMA 4LF9K 4JAXA 5E84A 3TWHA 1UA1A 2O4GA 2VWKA 4A5BA 4JI7K 5C10A 5M1OA 4CJ4A 3KIOA 2VGNA 1ATRA 3M8QA 3J81O 3ZSRA 5KRSA 1X3MA 3J80O 4C1NK 5HL7L 1BWFO 3L2QA 5C2DA 4CZHA 4EP4A 5C24A 1JLBA 4WCEL 5JMVA 4BRDA 4FWNA 1J53A 3QEWA 3CQ8A 1NK9A 4BG9A 3AVFA 4AHTA 2NRVA 1VRUA 3DOLA 4FWKA 4IFYA 2HBKA 4KPYA 4QOZB 3M8SA 2HHXA 2P9SB 1NJYA 3A5MC 4DG1A 3UB5A 4E1JA 1CLQA 2V7ZA 1N8RO 1HQEA 1YXQA 1JCEA 3L8BA 1WB9A 2QM1A 2V51B 3S3MA 2NLXA 1VQ8N 1ZXOA 1JL1A 4FK2A 1GLAG 2NRWA 4CGGA 1S3XA 2UU9K 3N4QA 1TK8A 3KD1E 3DOKA 3AA5X 4XEIA 2DFFA 4FZXC 4CEOA 4XH1A 1ATSA 4B1XB 3JSMA 3OS0A 1KFDA 3C6UA 3PIOL 1SKWA 4BRLA 2YHXA 1RT2A 4KB1A 2QK9A 4C23A 2GUPA 2Z1HA 4ID1A 4CE9A 1NKBA 3ULEA 4FWLA 1A5XA 3H6EA 3OBYA 5FPEA 3ZSXA 2IDOA 3FZMA 4Z4EA 3D2FB 3OTOK 2W6LA 3K5MA 1QQCA 4WQ5A 1KFSA 2OPPA 3VQ7A 4O0IA 5TKWA 1W2BM 3A5OC 1FKPA 3C65A 3CM5A 2OZSA 3Q7BA 3T69A 4JI8K 4IBNA 5SWMA 5E26A 1JKHA 3CC4N 1NGBA 1TVRA 3TTDA 4U67L 4K25A 4ISGA 1C0FA 1ITGA 3SQ4A 4DR4K 2HW3A 3QNOA 1NJWA 3QO9A 4M41A 4FLUA 1HNIA 3RR7A 1M90O 4M3ZA 1WAFA 3HPGA 3WT0A 3JYTA 2IS3A 3ZT0A 2O8FA 4B1ZA 5IWAK 3MEDA 5EVZA 4F9OA 4IG3A 2HNZA 2KKZA 4DFPA 3AVHA 4JKFA 3L2WA 1FXXA 4IXCA 3PY8A 4DWIA 1T3VA 4KV8A 4A2AA 4OGEA 4O8KA 4CCHA 1O1WA 1VRTA 3K57A 2FF6A 3THWB 3DRPA 2RKIA 3CYMA 3FFIA 1C1AA 4N76A 4B3SK 1A5WA 2HSTA 2YKMA 3OYAA 1H1VA 1TUUA 3MN6A 1VSEA 4Z4CA 4ID5A 3CFRA 2ATQA 4KHQA 4RW6A 1N33K 4JD2B 3L3UA 3AO5A 4CD3A 3G71N 2JGUA 4RW9A 1OH8A 1ZBUA 1Q8IA 5AR0A 4LD0A 4FJJA 1SL1A 4GNIA 4BDZA 3B8AX 3ATVA 4E1MA 1HNWK 4DTSA 2YNHA 4FOIA 3P39A 4BRFA 1BI4A 2Q0RA 4LSNA 4LFBK 4WQ5C 5AZIB 3DYAA 3CMAN 4BROA 4MDBA 1L3SA 3MECA 3KWIA 3I33A 4M3XA 4LF7K 2HHTA 3DWLA 4FLTA 2YKNA 4CJLA 4E19A 4YY3K 4B3OA 1VK0A 2A1SA 1ASVA 1BOTO 3ZCMA 3W3DA 3NGZA 3SPZA 4HTLA 3BDPA 3CERA 3K2PA 3LAMA 5AQXA 2OZMA 4JN4A 3VQDA 4DU4A 4PQUA 2ZGYA 4F8RA 4N41A 1VSMA 1WN7A 4CFDA 4H5VA 1RTIA 3C6TA 3ZX0A 4FJMA 3CJ7A 4LFAK 4K8ZA 4DV3K 2Y1JA 4H5NA 1NMDA 4HCCA 3CMEN 2P9LB 4DQQA 4YORA 2G8HA 4IFVA 2A41A 3FZKA 3D2EA 3OYNA 3WNFA 2VWJA 3HP9A 2HF4A 2DPNA 4OKEA 2IIRA 3QBWA 4H0TB 4YHHK 3SAHA 3E1YA 4DV7K 4UY8O 3JXUA 4KTZA 3QFPA 4M7XA 5KQDA 3IFRA 3CD6N 1T8EA 1J5EK 4PA1A 4DTPA 2VQEK 3SBTA 4PL8A 3VA0A 5LY3A 3K59A 3TANA 3WXKA 3B6PA 3S3NA 1GLEG 3AVMA 3TTCA 5GAHP 1BGXT 1EKEA 3NFAA 5DK5A 4C1NI 2VQFK 3SJJA 5CR4A 4FK4A 3GG4A 4JK9A 4EAHD 4WFBL 2JWKA 3BY5A 3AY9A 4H0OA 1QVFM 1BCMA 3AVIA 3BF1A 4H5RA 3EY1A 3VEWA 1XUPO 2ZJRL 3TSPA 2Q2RA 2JWLA 3P31A 2D0PA 3VOVA 3AAQA 3HO1A 1ZC6A 4DV2K 4Z4FA 3JAMO 1S1UA 4LY7A 4FZZA 2RN2A 3SLCA 4B9TA 4KTQA 4BQLA 1GLLO 1VSJA 3CIPA 1EXQA 4DTMA 4I2PA 4K42A 2A42A 3V9ZA 3L0QA 4ICLA 5K14A 1WSIA 3C94A 1JLQA 3LM9A 1HNXK 2KHOA 3QEPA 3DXMA 4JKGB 4NXNK 1ZBFA 4BREA 1NWKA 3AA4A 3DJCA 3VF6A 4RCHA 3ZEUB 1KSPA 3TARA 4QS7A 4J2BA 1ASUA 5FPNA 3RRGA 4F4KA 3IUCA 4BR0A 4N56A 3HTVA 4J2DA 4OPHA 3C0BA 3R6MA 5C2FA 1HJOA 5AQIA 2P9NB 4LH5A 2LSNA 5KTQA 1VSHA 1NGHA 1XMOK 1TKDA 2AP1A 3SUNA 4X64K 1DTQA 1FJGK 4CK2A 3CCMN 3QFUA 3LWLA 4DQSA 4DR7K 3HSTB 4OLAA 4JI0K 4DV5K 4CJKA 3J7AP 4CJFA 4JHDB 2KFNA 1TV6A 3G4SN 3ZX3A 5AQWA 4CZJA 5TKYA 3SMSA 4JYAK 3ENHA 1NGJA 3KK2A 4FSVA 4JKDA 4IOCL 4JV5K 4CGJA 3AGRA 1QZ5A 3H1VX 4NYNA 3G10A 4MO5A 2P9PA 5DMRA 4BRGA 3V81A 3V1OA 3FZFA 1LOTB 3CJCA 4JKEA 4BC3A 3RMBA 4GKJK 3AA2A 1HR0K 1VQMN 3SV4A 2UYTA 1BUPA 4GVEA 4JI6K 4FJIA 2A3ZA 4BGBA 1LV5A 1QTMA 3TPQA 2EX3A 3NF6A 4BWMA 1S1VA 2PYLA 2BTFA 3ZSWA 3QBXA 2YX6A 3VTIA 5ADXH 3CPEA 1T6DA 4CGFA 4R5PA 5DM7L 3OS2A 4FW1A 2B4JA 3H46O 3O5BA 1K6YA 3VF2A 4FJGA 2IVNA 3MN9A 3WXJA 2WC9A 3F2KA 2CH6A 1DLOA 4AHVA 4GVMA 4FWSA 1F21A 2YJFA 1Q7YO 4J8FA 3OYCA 3OHRA 1NGCA 5FRMA 4M3UA 5M1KA 4JK7A 3LPUA 2XY8A 1D8YA 3DMJA 1YUWA 4CJPA 5BN8A 4JK8A 4WFNL 1T44A 4Y1DA 5EOYA 1GLBG 3THYB 3RTVA 4DTXA 5EX5A 2P9UB 3VGLA 4YOTA 4IKFA 2NRHA 3KVGA 3F5TA 2E2PA 3U6FA 1VSKA 3V9UA 3HK2A 2QEXN 1NOZA 4ISEA 4CJ5A 5KPRA 2KFZA 1B92A 1IG9A 3AVNA 2Z1GA 3E9LA 3RSEB 4IFEA 2FBVA 1GLDG 1RFQA 3NH0A 2HHUA 4CEBA 5AQVA 4RW4A 5JLHA 2G8VA 2V52B 2HOEA
chains in the Genus database with same CATH topology
4YOXA 5AZJB 4K43A 3MWPA 2HBLA 3WUHA 3UB5A 5EY4A 1TYQA 2QWQA 5M1QA 4GV6A 4E1JA 2V7ZA 1N8RO 1YXQA 3Q7CA 5HOOA 1JCEA 2QWOA 1YI2N 2F9WA 1BA1A 2QM1A 2V51B 2ITMA 2NLXA 4CD1A 3VTHA 1VQ8N 1RDWX 3TU5A 1QQMA 1ZXOA 3OA9A 1EO1A 4KH5A 3LDQA 1GLAG 3TTFA 2J4RA 2NRWA 3DAWA 1G99A 3HZ6A 4FOEA 4XH5A 5AQYA 4BC4A 1DEJA 1S3XA 4DKWA 5CHIA 3N4QA 3MDQA 4BVOA 5GADP 3FR0A 2PFUA 3QDKA 4XEIA 2QI2A 2QWMA 2W40A 5EXWA 1VQON 3ZX2A 3DXKB 3O6WA 4BQZA 3IDHA 4FPBA 4XH1A 1ATSA 2IVOA 4B1XB 3HOSA 3CCJN 4BVPA 2QTDA 3VESA 2VYPA 3O1BA 2E2QA 3GL1A 3EL2A 2VGMA 5BR9A 2NRXA 2PBDA 2YHWA 3SAFA 3PIOL 2FXUA 2YHXA 4BRLA 1VQ5N 2GWKA 1VAZA 2Q1NA 3CPWM 4C23A 2GUPA 1YJWN 1R59O 3VETA 3MWTA 2CGKA 5GIOA 3ULEA 5M1NA 2HMPA 1T6CA 4FWLA 5CE3A 4BRMA 3H6EA 3D7EO 3OBYA 3VEXA 5BPNA 4I6MB 3A5NC 3EE9A 5FPEA 3O9QA 1NM1A 1WUAA 3UKRB 3FZMA 4CZEA 3D2FB 5JLFA 5AFUA 4H0VB 5AQOA 5AQZA 1KAZA 2P9IB 2W41A 4WQ5A 3H3OB 2ASMA 1NGEA 5TKWA 1E4GT 3A5OC 5ELZA 4IO9L 1W2BM 2RE2A 2GELA 3C65A 3M1FA 1RGIA 4NLCA 5DM6L 2NRRA 3H1QA 3EKUA 3Q7BA 5AQTA 3GDQA 3T69A 3E66A 3H45C 3QMLA 4NO7A 4A57A 4BR5A 2Q31A 3MX2A 4NLBA 2HBJA 2E88A 5E26A 3CC4N 2FLOA 1NGBA 3TTDA 2YHYA 4EFHA 5AQUA 3CCSN 4U67L 3WXLA 4BRHA 4K25A 4ISGA 4L3QA 2BH1A 3CJ9A 4FWOA 4BRAA 1C0FA 3D2EB 2QA4N 3EO3A 2FSJA 1X9JA 1NGGA 3FZHA 4BC2A 2P9UA 4BR4A 3F9MA 4ILJA 1VQ7N 4CBWA 1M90O 1YJ9N 1OVYA 2VCPA 3MN5A 4BY9C 3A8YA 4GY2B 3ENOA 3PLAA 5LJWA 3WT0A 4QS8A 1BA0A 4B1ZA 5EVZA 4F9OA 3TSQA 2KKZA 4FWPA 4JKFA 3RSEA 3J8AA 4WQ4A 5AQLA 3VENA 3BEXA 1HUXA 2FSKA 4JKBA 1KXPA 3C7NA 3WQTA 3CC7N 5I9EB 3FGUA 3AGKA 4IXCA 3U9DA 1NBWA 2P9SA 1T3VA 3VEZA 4A2AA 5B8HA 5AZJA 4O8KA 4IOXA 3KZBA 2FF6A 5AQJA 3U4LA 4H0XB 4CZGA 1GLFO 3R1XA 3MCAB 4JKHA 1YITN 1Y64A 2I7PA 4YDUA 1GLJO 1QQNA 4DHYA 2HSTA 3R8EA 4OO1J 3RVCA 5C15A 1H1VA 1TUUA 4IEIA 3MN6A 1W97L 4PHTX 3CCRN 4BR7A 4JHDA 4CBXA 5C12A 4HWIA 4KH6A 1DT9A 2IVPA 3A5LC 4JD2B 4BRKA 3SBGA 1NJIO 4CD3A 2KLAA 3SMPA 3G71N 3DXKA 1YHQN 5KQ8A 4GV3A 5AR0A 3UE5A 2ZGZA 4BC5A 5JVHL 4GNIA 1MDUB 3B8AX 3ATVA 2QWPA 3P39A 3OBWA 4FOIA 4BRFA 1VQ4N 1DKGD 5AQQA 2Q0RA 2YCHA 5AQSA 3DXMB 3L4QA 4ILGB 4IZ9A 4H0YB 4Z94A 4WQ5C 5AZIB 4YOYA 4FWMA 1YJNN 3CMAN 5BPLA 1Q81O 4BROA 4MDBA 1Q18A 3M6GA 4AF1A 4QS9A 4BRNA 3KWIA 3I33A 4JNEA 1QZ6A 1IJJA 3DWLA 3MX5A 4I6MA 3L4IA 3UKRA 1CZAN 1BOTO 1EQYA 3D2FA 3IKMA 2NNWA 4OPAA 3W3DA 5BRHA 4HTLA 2D1KA 3MK6A 2P9IA 3P4IA 3CERA 5AQXA 4RWTA 4CZIA 4FVUA 2CGJA 4JN4A 1HX1A 2E2OA 2ZGYA 3ID6A 4MO4A 3WXMB 5BRFA 1U2VB 4B9QA 4BR2A 3WXIA 3CI5A 4H5VA 5BN9A 3ZX0A 4KH4A 3O9SA 4ILHA 3R9PA 4ISFA 4B1YB 3DLLL 2A40A 3O9TA 1S22A 3CJ7A 3UKUB 3I55N 3ATUA 3FLCO 4H5NA 1NMDA 3CMEN 2E20A 2P9LB 5AQFA 4YORA 2QWNA 4R79A 3HOTA 2A41A 3FZKA 3D2EA 4A2BA 5BREA 4YOWA 2HF4A 2DPNA 4WQ4C 3VGMA 4BRPA 2IIRA 3QBWA 3U9ZA 4H0TB 4CJ7A 3CC2N 3NVKA 1JCGA 3E1YA 5AQGA 5M1PA 3SAHA 3CQXA 1P8ZA 2ZJQL 3E9PA 3LDPA 4KBOA 3JXUA 4UY8O 2QW9A 2Q0UA 3VEOA 1IG8A 3VEYA 3QFPA 1HLUA 2ZJPL 4JEPA 4M7XA 5KQDA 1XC3A 3IFRA 3CD6N 3BF3A 3VMFB 4O8UA 4CZLA 3J7ZO 3O1WA 2GX9A 4A61A 3GOIA 1QVGM 5H1SQ 4EHTA 4DCHA 3SBTA 5AQHA 4PL8A 4GV9A 2VWBA 4PKGA 4JKAA 3MCPA 3QB0A 3ZETB 5LY3A 1MWMA 3HM8A 4YDUC 3WXKA 1GLEG 3TTCA 5BRDA 5GAHP 2RHKA 2YJEA 4CZMA 4C1NI 1YIJN 2P9PB 3WEEB 2OTLN 5JICA 5CR4A 3GG4A 4JK9A 4EAHD 4WFBL 1VQPN 2P9KB 2JWKA 4H0OA 3AY9A 1YAGA 2GWJA 1QVFM 2NZTA 3IMXA 3HBTA 1E4FT 1BG3A 5FPDA 3BF1A 2WFBA 3CJBA 3LDLA 1NGFA 4MLEA 4DQ8A 4H5RA 5ADXA 1QQOA 3LM2A 4CZFA 3CCEN 1HPMA 4YOUA 2WBNA 3I56N 3VEWA 1XUPO 2ZJRL 3O9UA 3TSPA 2CH5A 3P38A 2Q2RA 2JWLA 4FL9A 3S41A 3SAGA 3C6HA 3P31A 2D0PA 3VOVA 4A62A 3OW2M 3AAQA 1D4XA 1ZC6A 3NMUA 3EE8A 1K8KB 4JD2A 3T7ZA 3MMVA 2QWRA 3SLCA 4JKCA 4B1WB 2YI1A 3K9KA 4BQLA 2A6AA 2NRZA 2ASOA 1GLLO 2F9TA 3CIPA 4K42A 2GEMA 2A42A 4BGAA 4CI6A 4FWRA 2NRTA 3VPZA 3L0QA 3LL3A 4IJAA 4BR9A 3LM9A 3A0IX 3CQYA 2KHOA 4RTFD 3O08A 1BDGA 3DXMA 2ASPA 1DGKN 4JKGB 5GIPA 4BREA 5MLCQ 5AZIA 3ENBA 3KK7A 1NWKA 2Q36A 3AAPA 3CJAA 1S72N 1VQ6N 3DJCA 2OTJN 3VF6A 1K9MO 3O80A 1YVNA 2E2NA 4RCHA 1OKJA 3ZEUB 4M63C 2WUSA 4QS7A 3R3LA 2QXLA 5FPNA 2E1ZA 3IUCA 4BR0A 5KPZA 4H5TA 3HTVA 3BP8A 1QHAA 3H3NO 1MA9B 4OPHA 1KD1O 3VEVA 4BRCA 3C0BA 3R6MA 5C2FA 2QWLA 5F0XA 3FE1A 1HJOA 3CCLN 1LCUA 5AQIA 5GINA 3CCVN 2P9NB 1Q82O 1U2VA 4BG8A 1VQKN 1C0GA 1HKCA 4IWVA 5AQKA 1NGHA 3UKUA 3GBTA 3QICA 2AP1A 3N4PA 4MLHA 4NB4A 5C0YA 1BU6O 1J6ZA 2EWSA 3CCMN 3FFKB 2P9LA 3QFUA 5KPTA 2E8AA 1P90A 2E1YA 4BRIA 3HRGA 4IJNA 4IEEA 4JHDB 3CCUN 3CJ1A 1JJ2M 4H03B 2CGLA 4IOAL 3SK3A 1MWKA 5GAEP 2HF3A 5AFUH 3L6QA 1TYQB 3U8XA 1KAYA 3G4SN 3JS6A 3ZX3A 5AQWA 1K8AO 4CZJA 5TKYA 1ATNA 3SMSA 4H5WA 3FZLA 5AQMA 3CF5L 1VQNN 3ENHA 1X3NA 1SAZA 1NGJA 1ILYA 4IOCL 4FSVA 4JKDA 1NGAA 3AGRA 2ZWHA 3ZETA 3WQUA 1NGIA 1QZ5A 1Z6RA 3H1VX 2A5XA 1K73O 3BUZB 5F1XA 1BO5O 4K41A 3PIPL 4FWQA 4B1VA 2OANA 4MO5A 5AQNA 3HSCA 2P9PA 1JCFA 1SQKA 4FO0A 3C6AA 3WEEA 1SZ2A 4BRGA 4EHUA 1U6ZA 2FSNA 3G25A 3FZFA 1WOQA 1LOTB 4O5FA 3CJCA 2P9KA 4JKEA 1Q86O 1TUYA 1VQ9N 5AQPA 4EIAA 3CXCM 4BC3A 4PKIA 4WFAL 4AM7A 2D4WA 1VQMN 3GE1A 2UYTA 4FPAA 3VERA 1BUPA 1KAXA 1SS6A 3LDNA 3O9RA 4GVEA 3CCQN 5JVGL 3ZYYX 2A3ZA 4BGBA 3G6EN 4AM6A 2Q97A 3TPQA 4YOVA 3D6RA 2PAVA 3EN9A 2BTFA 3QBXA 4A59A 3ULEB 2YX6A 3VTIA 5GAGP 4U7BA 3VF4A 1K8KA 1V4SA 5ADXH 3CPEA 5BPMA 1VQLN 4LC9B 1T6DA 1KQSM 2ZF5O 4XH4A 4DB3A 3AARA 1V4TA 3SJHA 3W0LA 5DM7L 4M7YA 3K9JA 1KC8O 3H46O 3O5BA 3KHYA 3VF2A 2BUPA 3CETA 4IDHA 4IO8A 2IVNA 3MN9A 3KWGA 4WYBA 1HKBA 4G9ZA 4WF9L 3E9OA 1XQSC 2HBMA 3WXJA 2WC9A 3F2KA 2CH6A 3MN7A 3NVMA 4JKGA 4PL7A 4FWSA 2FF3B 2YJFA 1Q7YO 4MDAA 4J8FA 2D0OA 4B1UB 1ESVA 2H3GX 3EZWA 1RDUA 1NGCA 1YF5L 3CHWA 3OHRA 4H0PA 5FPMA 4JAXA 4JK7A 1ZBSA 5E84A 3ZEUA 5M1KA 3VGKA 1Z05A 1GLCG 3I8BA 1NGDA 3O8MA 5M1FA 1YUWA 5BN8A 1M1KO 3TSUA 2I7NA 4JK8A 4WFNL 4A5BA 3M5RA 1T44A 5C10A 5M1OA 5EOYA 1GLBG 3ID8A 2VGNA 1ATRA 5EX5A 5F2RA 3EKSA 2P9UB 2GTDA 3LDOA 1NLVA 3VGLA 4YOTA 1X3MA 4C1NK 5HL7L 2NRHA 2P9NA 3KVGA 3F5TA 1BWFO 5AQRA 2E2PA 5C2DA 4CZHA 2AA4A 4WCEL 5JMVA 4A5AA 4ISEA 4BRDA 2QEXN 5KPRA 1HKGA 4FWNA 3M3ZA 3O4WA 3E9LA 3RSEB 4CZKA 4IFEA 1GLDG 4BG9A 3HI0A 3C7NB 1RFQA 2NRVA 5LJVA 5AQVA 5JLHA 2V7YA 4FWKA 4CBUA 2F7TA 2HBKA 4BRQA 1O13A 4PKHA 2P9SB 3A5MC 2V52B 4Y0WA 2HOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOX A;  3N4Q A;  3N4P A; 
#chains in the Genus database with same CATH topology
 4YOX A;  5AZJ B;  1JLC A;  3MWP A;  4K43 A;  4KHY A;  3SCX A;  5EY4 A;  1TYQ A;  2QWQ A;  3TI0 A;  1X9M A;  2ITM A;  1KVA A;  3TU5 A;  4GKK K;  2ZM6 K;  3OA9 A;  1EO1 A;  3LPT A;  3TTF A;  2J4R A;  4BC4 A;  1G99 A;  5AQY A;  4XH5 A;  3MDQ A;  2HMI A;  3L3V A;  1VQO N;  3ZX2 A;  2KZM A;  5CZ1 A;  4KRE A;  2IVO A;  4BVP A;  3RMC A;  2QTD A;  1N32 K;  1QS4 A;  4W5O A;  3K5O A;  3O1B A;  4QCL A;  2VGM A;  5BR9 A;  2YHW A;  2YNI A;  1NK4 A;  1VQ5 N;  2HVH A;  4CF2 A;  4FK0 A;  4RW8 A;  3I0R A;  4BAC A;  3MWT A;  5GIO A;  1C0M A;  4AH9 A;  3ISN C;  4CJT A;  1TK0 A;  3VEX A;  3EE9 A;  1RT3 A;  1WUA A;  3UKR B;  1I39 A;  1RDD A;  4CZE A;  1YTU A;  4H0V B;  5AQO A;  2P9I B;  2W41 A;  3WNG A;  2VG6 A;  4BDY A;  2GEL A;  4CER A;  3SUP A;  4FYD A;  4NLC A;  3H1Q A;  5AQT A;  4LF6 K;  2HHQ A;  3E66 A;  3H45 C;  3QML A;  3MX2 A;  2UXB K;  4J2E A;  4OGC A;  2ZQB A;  3WNH A;  1TAQ A;  4EFH A;  2YHY A;  3WXL A;  4NCB A;  4FWO A;  4BRA A;  3WNE A;  3EO3 A;  1X9J A;  1VQ7 N;  2D0C A;  1YJ9 N;  1OVY A;  2VCP A;  3A8Y A;  4GY2 B;  3VQ8 A;  1U4B A;  4QS8 A;  4CF1 A;  1LW2 A;  1FK9 A;  4FWP A;  1NK5 A;  3T1Y K;  3J8A A;  4WQ4 A;  5AQL A;  3VEN A;  3IS9 A;  3F9K A;  5J2M A;  3C7N A;  2UUA K;  4AHS A;  1JXE A;  3M8P A;  1S6Q A;  4OKK A;  4FLV A;  5B8H A;  3KZB A;  5HBM A;  1IO2 A;  3PV8 A;  4FJH A;  4MQ3 A;  4CZG A;  3R1X A;  4DSL A;  1Y64 A;  1RBS A;  3QIN A;  4YDU A;  1GLJ O;  4DHY A;  4FJ7 A;  4OO1 J;  5D3G A;  5C15 A;  3QEV A;  3CCR N;  1W97 L;  3KLH A;  4GW6 A;  4KHN A;  3TR8 A;  3D45 A;  3DRS A;  5C12 A;  2IVP A;  4FM0 A;  3SBG A;  1NJI O;  3HP6 A;  4DSJ A;  1W0H A;  3CM6 A;  4F2R A;  3DXK A;  1YHQ N;  3IRX A;  2O8C A;  1X9S A;  2QWP A;  5LL6 Z;  1IKW A;  5AQQ A;  4W5R A;  2YCH A;  3ASM A;  5E41 A;  4KO0 A;  4ILG B;  1C0T A;  4CJW A;  4OPK A;  1RT7 A;  4FWM A;  3QER A;  4JNE A;  4O55 A;  4M3T A;  4I6M A;  1FKO A;  1EQY A;  1HPZ A;  1NNE A;  3P4I A;  4CZI A;  2CGJ A;  3VQ5 A;  1HX1 A;  4CK3 A;  1SV5 A;  4KHS A;  3ID6 A;  1BIZ A;  5FDL A;  4BR2 A;  2D0B A;  2O8E B;  3R9P A;  4ILH A;  3MEG A;  2A40 A;  1S22 A;  1KLN A;  2UUC K;  4CIE A;  1JLG A;  4DTR A;  2E20 A;  4DF4 A;  1RCH A;  4A2B A;  4YOW A;  3G0Z A;  4WQ4 C;  3VGM A;  4CJ7 A;  3V9X A;  1R0A A;  4EZ6 A;  1P8Z A;  3THX B;  2QW9 A;  2Q0U A;  3VEO A;  3NGI A;  3VEY A;  3PUF A;  1HLU A;  3CG7 A;  3H08 A;  4JEP A;  4O8U A;  4A61 A;  4PWD A;  1EET A;  2OPS A;  5H1S Q;  4EHT A;  3ZT1 A;  1MWM A;  3HM8 A;  4KTW A;  4YDU C;  4CZM A;  1UA0 A;  1LAV A;  2Q3S A;  5BR8 K;  2OTL N;  1VQP N;  4CHQ A;  3KKR A;  1D9F A;  4E7J A;  3IMX A;  3HBT A;  5FPD A;  3ALY A;  1B9D A;  2WFB A;  4DQ8 A;  1NGF A;  3CCE N;  1QHT A;  4DTU A;  3I56 N;  3O9U A;  1NK6 A;  4B08 A;  3PX0 A;  2O8B A;  4A62 A;  3F73 A;  4CJ3 A;  1T05 A;  4PUO A;  4DV6 K;  4B1W B;  5CZ2 A;  3K9K A;  2F8T A;  2A6A A;  2NRZ A;  3AVK A;  1GOC A;  4B3R K;  3A0I X;  1IBL K;  4RTF D;  2ASP A;  1DGK N;  4CF0 A;  3ENB A;  2Q36 A;  3CJA A;  1S72 N;  1VQ6 N;  2OTJ N;  5FRN A;  4M42 A;  2E2N A;  1JLE A;  1OKJ A;  3MEE A;  3E01 A;  2HHH K;  2WUS A;  5FLX O;  1L3U A;  2F96 A;  4H5T A;  4C8N A;  1QHA A;  3H3N O;  1U47 A;  3I8D A;  4JI5 K;  3V1R A;  1LCU A;  2NUB A;  3CCV N;  4CJQ A;  4L8R B;  1Q82 O;  1U2V A;  1VQK N;  1T7P A;  3HJF A;  2UXD K;  3DM2 A;  1HKC A;  2FBX A;  1X9W A;  3M8R A;  3UKU A;  3GBT A;  4C8L A;  4B9M A;  3N4P A;  3V9W A;  1BIS A;  3KD5 E;  3MXJ A;  3KK1 A;  2BGG A;  4E0D A;  3HXM A;  3HRG A;  5C25 A;  4CJR A;  4OLB A;  1C0U A;  3CJ1 A;  4DFK A;  3HVT A;  4IOA L;  3SK3 A;  1MWK A;  2FBY A;  4LSL A;  5AFU H;  3L6Q A;  2W42 A;  1ATN A;  4H5W A;  3CF5 L;  1KTQ A;  2W6K A;  1SAZ A;  1NK0 A;  1NGA A;  1FW6 A;  1NJZ A;  2ZWH A;  3ZET A;  4CJV A;  1NGI A;  2R7Y A;  2HND A;  3BUZ B;  3NHG A;  3PO4 A;  1JXB A;  2P51 A;  2GUI A;  1QSS A;  5IT9 O;  4DSF A;  3WEE A;  5J2Q A;  4E3S A;  1U6Z A;  2UXC K;  2F4V K;  1S9G A;  1SUQ A;  3K5N A;  2P9K A;  3IG1 A;  4YFU A;  3PSI A;  4LH4 A;  2D4W A;  3VER A;  3LDN A;  4DS4 A;  4I7F A;  2DTU A;  3ZSO A;  1VSI A;  1NMN A;  2XRI A;  4YOV A;  4FJL A;  4C8O A;  1BL3 A;  3HVR A;  1J54 A;  1XHX A;  4W5Q A;  3ULE B;  4CED A;  1VQL N;  1XC9 A;  1K8K A;  1V4S A;  3LDS A;  5BPM A;  4B9U A;  1W7A A;  1ASW A;  4XH4 A;  1V4T A;  2RPI A;  5SZT A;  2PYJ A;  4M7Y A;  3KHY A;  3CET A;  4B3T K;  4IDH A;  4IO8 A;  3KWG A;  4WYB A;  1HKB A;  4G9Z A;  3D0P A;  2VG7 A;  3LZJ A;  3DLH A;  3HPO A;  3NVM A;  3AVA A;  3SV3 A;  1L3T A;  4PL7 A;  2FF3 B;  2HNY A;  4NYF A;  1BCO A;  2H3G X;  1RDU A;  1YF5 L;  3CHW A;  3VGK A;  4OVL A;  1Z05 A;  2KQ2 A;  3O8M A;  1NGD A;  3NVK A;  1M1K O;  1WSH A;  3M5R A;  3TAM A;  3ID8 A;  1N6Q A;  5F2R A;  3LAK A;  2GTD A;  3LDO A;  1NLV A;  1JL2 A;  3KTQ A;  1CXQ A;  2HVI A;  3VQQ A;  4FLX A;  5AQR A;  5I3U A;  2AA4 A;  2P1J A;  3VQE A;  3DLE A;  2O8F B;  4A5A A;  5HRO A;  3HI0 A;  5LJV A;  3VQB A;  4BRQ A;  1CZB A;  4C8M A;  3OY9 A;  4B3M K;  5M1Q A;  1X1P A;  3ZSQ A;  3RMA A;  1U48 A;  1ZBH A;  1YI2 N;  1BA1 A;  2WTU A;  4CD1 A;  2O8D A;  3VTH A;  1RDW X;  4H4O A;  1QQM A;  4KH5 A;  3OYD A;  2EHG A;  1UWB A;  2ETJ A;  3HZ6 A;  3LP2 A;  1DEJ A;  2Z1I A;  4DKW A;  5CHI A;  3RRH A;  2KZZ A;  4WE1 A;  5GAD P;  3FR0 A;  2PFU A;  3SQ0 A;  1KLM A;  2QI2 A;  2QWM A;  3OYM A;  2G8W A;  2A1R A;  3O6W A;  2HHW A;  1LW0 A;  2O4I A;  1VHX A;  3S9H A;  5HP1 A;  3GL1 A;  1SKS A;  3EL2 A;  4DR1 K;  1BI4 B;  2FXU A;  4LF5 K;  2XO7 A;  2GWK A;  4LFC K;  3SQ1 A;  1YJW N;  1XNR K;  1I3A A;  4DQP A;  3VET A;  2CGK A;  4Z4H A;  4JRP A;  3KKS A;  3NF9 A;  2HMP A;  3KLI A;  1S1X A;  4BRM A;  2HHV A;  4HUG A;  5BPN A;  4QAG A;  4G1Q A;  1KAZ A;  4CVN E;  1YVU A;  3H3O B;  2ASM A;  1NGE A;  1E4G T;  4IO9 L;  2RE2 A;  4DQI A;  4OJR A;  1RGI A;  5DM6 L;  2IC3 A;  2NRR A;  3LWM A;  4DTO A;  3GDQ A;  3NDK A;  1J5O A;  4A57 A;  3PX4 A;  4BR5 A;  2BE2 A;  1D5A A;  2DFE A;  2HBJ A;  4NLB A;  1XI1 A;  4KB0 A;  4FM2 A;  3NH1 A;  5AQU A;  3CCS N;  2ZE2 A;  4B9V A;  2HHS A;  4BRH A;  1RBR A;  4L3Q A;  1D9D A;  3QES A;  3CJ9 A;  3AO2 A;  2YNF A;  3D2E B;  2QA4 N;  3L2U A;  4CFA A;  1NGG A;  3FZH A;  4ILJ A;  1ZBI A;  1RBV A;  3MN5 A;  4DQR A;  3RR8 A;  4OKJ A;  4BY9 C;  3ENO A;  3PLA A;  5LJW A;  4CHZ A;  3ZT3 A;  5KRT A;  4JS4 A;  3TAF A;  3VQ4 A;  1KCF A;  3BEX A;  4FJ9 A;  1KXP A;  4I2Q A;  3CC7 N;  1HMV A;  3FGU A;  3AGK A;  3LP3 A;  5AJ3 K;  5HRS A;  4JI3 K;  4KHU A;  1NJX A;  1NBW A;  2P9S A;  3DI6 A;  3VQ9 A;  1NKE A;  4I9L A;  2Y1I A;  5AQJ A;  1GLF O;  3MCA B;  4JKH A;  1YIT N;  1A5V A;  2I7P A;  3T19 A;  5JS1 A;  1E3M A;  4FLW A;  2UUB K;  3R8E A;  3RVC A;  4O44 A;  4BR7 A;  4AHR A;  4B8A B;  4CBX A;  4BE0 A;  3OS1 A;  4HWI A;  3ITH A;  4BRK A;  2KLA A;  2OCE A;  3SMP A;  3OYJ A;  4YNQ A;  2DY4 A;  5KQ8 A;  1RT4 A;  2YHB A;  3UE5 A;  4BC5 A;  1S1T A;  3DRR A;  1MDU B;  4KI6 A;  1RT6 A;  3LP1 A;  4N47 A;  3OBW A;  4KAZ A;  4CJS A;  1WNS A;  3SI6 A;  4M3Y A;  1SL2 A;  5AQS A;  3DXM B;  2XY5 A;  1YT3 A;  4IZ9 A;  4Z94 A;  4H0Y B;  4FLZ A;  4DF8 A;  2ZD1 A;  4YOY A;  1IBK K;  5BPL A;  4X66 K;  3DLB A;  1Q18 A;  3M6G A;  4AF1 A;  2X6N A;  4QS9 A;  1OH5 A;  1QZ6 A;  4JLH A;  4CGD A;  2WON A;  4CIF A;  3D2F A;  4OPA A;  5BRH A;  4CHO A;  2YV0 X;  2D0A A;  4RWT A;  3QEI A;  3PO5 A;  4HVJ A;  4DU1 A;  3WXM B;  5BRF A;  1HQU A;  4M3R A;  4TSX A;  3O9S A;  4ISF A;  3EEQ A;  1RIL A;  3O9T A;  4X65 K;  2P5G A;  3ATU A;  2IAJ A;  3FLC O;  4M3W A;  4FJ8 A;  3ZSY A;  3MXM A;  4PY5 A;  5AQF A;  1LWE A;  4DR2 K;  2QWN A;  4R79 A;  4ELU A;  4M45 A;  3V6D A;  4BRP A;  4CJU A;  2G8F A;  3HYF A;  3U9Z A;  1JCG A;  5M1P A;  2G8U A;  1L3V A;  2ZJQ L;  3E9P A;  3LDP A;  3OVN A;  1NK8 A;  1IG8 A;  1LAW A;  1TL1 A;  2X78 A;  2ZJP L;  1REV A;  1ZYQ A;  3VMF B;  2I5J A;  3O1W A;  2GX9 A;  1TL3 A;  1RT5 A;  3HL8 A;  4CW7 B;  4O0J A;  5AQH A;  4GV9 A;  3TAP A;  2XHB A;  2VWB A;  4PKG A;  3MCP A;  4H4M A;  4RG8 A;  2RHK A;  2YJE A;  3V9S A;  1YIJ N;  2P9P B;  3AVL A;  5JIC A;  3THW A;  2GWJ A;  4DTJ A;  2NZT A;  1E4F T;  3AO1 A;  3CJB A;  3LDL A;  2B5J A;  1QQO A;  4Z4I A;  1HPM A;  4YOU A;  3VQC A;  2CH5 A;  3P38 A;  1RNH A;  5I42 A;  3S41 A;  4DR5 K;  4V19 S;  4JS5 A;  1D4X A;  2PY5 A;  3EE8 A;  4DLG A;  3TAG A;  4JD2 A;  3T7Z A;  4DSE A;  3K0S A;  2QWR A;  1IV0 A;  4JKC A;  1B9F A;  2OPR A;  4FWR A;  3VPZ A;  4BR9 A;  3CQY A;  3O08 A;  5J1E A;  1BDG A;  3LZI A;  4ELT A;  5AZI A;  1IKX A;  1SL0 A;  2QXF A;  1YVN A;  1RTH A;  1HNV A;  1TKT A;  4M63 C;  3R3L A;  4FLY A;  5KPZ A;  4F2S A;  1N34 K;  3O3H A;  1MA9 B;  1KRP A;  1KD1 O;  2QWL A;  5HRN A;  3SZ2 A;  3BGR A;  4ZHR A;  4JI2 K;  4BG8 A;  1VSL A;  1C0G A;  2GBZ A;  4IWV A;  3HM9 A;  1TK5 A;  4I9Q A;  4DFJ A;  1NKC A;  1BHL A;  1BU6 O;  1J6Z A;  3FFK B;  2P9L A;  5KPT A;  4DV1 K;  2Z1J A;  4XIU A;  4KFB A;  2E1Y A;  4BRI A;  2IOC A;  4IJN A;  5HRP A;  4E7I A;  4H03 B;  2CGL A;  1LWC A;  4LF4 K;  1U49 A;  4CFC A;  1TYQ B;  3U8X A;  5J2N A;  2YNG A;  3FZL A;  1VSD A;  3HT3 A;  1VQN N;  2KW4 A;  4RW7 A;  3KK3 A;  1C6V A;  2A5X A;  4FCY A;  3VN5 A;  5F1X A;  1K73 O;  4DU3 A;  4FWQ A;  1IKV A;  2OAN A;  1Q9Y A;  1GOB A;  4B9S A;  3HSC A;  1JCF A;  1SQK A;  3OYF A;  3C6A A;  3PX6 A;  3TAE A;  2FSN A;  4E7K A;  4O5F A;  1VQ9 N;  1Q86 O;  4EIA A;  3CXC M;  4PKI A;  4WFA L;  4FPA A;  1KAX A;  1SS6 A;  3O9R A;  4FW2 A;  5JVG L;  3CCQ N;  1VSF A;  3G6E N;  4AM6 A;  2Q97 A;  5KGW A;  3D6R A;  4BDP A;  4KRF A;  3IAY A;  4HUF A;  2GV9 A;  4U7B A;  3OYB A;  4BE1 A;  4CES A;  3SJH A;  3W0L A;  4KKO A;  2G8I A;  3U3Y A;  4GMJ B;  1BQM A;  4JRQ A;  4AQY K;  3QET A;  3K58 A;  4WF9 L;  4DS5 A;  4CHY A;  4JKG A;  1WSE A;  2ITG A;  3PSF A;  3AO3 A;  2E6L A;  1XMQ K;  4B1U B;  1ZBL A;  5T7B A;  3OYG A;  1ESV A;  3EZW A;  1ZBS A;  3ZEU A;  4DR3 K;  1NG9 A;  1GLC G;  3I8B A;  5M1F A;  3TSU A;  2I7N A;  3T1A A;  4CEZ A;  3EKS A;  2P9N A;  4B8C A;  1RTJ A;  4IDK A;  3NAE A;  4Z0U A;  1HKG A;  5HLF A;  3M3Z A;  3O4W A;  4E7L A;  3S3O A;  4FVM A;  4CZK A;  1W9H A;  4O5B A;  3C7N B;  3OYE A;  3MXI A;  4KHW A;  2V7Y A;  4CBU A;  2F7T A;  3AVJ A;  1O13 A;  4PKH A;  4AHC A;  3P83 D;  1YAG A;  4Q0B A;  4Y0W A;  4JHD A;  1RDA A;  1HYZ A;  1UAX A;  3ZT2 A;  4CF9 A;  2HBL A;  3WUH A;  1GOA A;  4EP5 A;  4GV6 A;  1S6P A;  3Q7C A;  5HOO A;  2QWO A;  3OJS A;  2F9W A;  1HRH A;  2FC0 A;  4E1N A;  3LDQ A;  3DAW A;  4FOE A;  4CFB A;  4BVO A;  3U3G A;  4W5N A;  1C1B A;  3QDK A;  3OJU A;  2W40 A;  5EXW A;  4E7H A;  4DSI A;  3DXK B;  4BQZ A;  2OA8 A;  2E4L A;  3IDH A;  4FPB A;  2XY7 A;  3CCJ N;  4HTU A;  3HOS A;  2O8C B;  3QNN A;  3VES A;  1CZ9 A;  2VYP A;  1SKR A;  4CEE A;  1C1C A;  2E2Q A;  1IKY A;  2E6M A;  2NRX A;  2PBD A;  3SAF A;  4CK1 A;  1VAZ A;  2Q1N A;  3CPW M;  2WOM A;  4FXD A;  1R59 O;  1WSJ A;  5M1N A;  3QIO A;  1T6C A;  3UIQ A;  5CE3 A;  3D7E O;  3V4I A;  4I6M B;  3A5N C;  3O9Q A;  5CY4 A;  1NM1 A;  1OVQ A;  5JLF A;  3HPH A;  5AFU A;  4DUZ K;  2XY6 A;  5AQZ A;  3OYI A;  3LP0 A;  4Y1C A;  5ELZ A;  3M1F A;  5JS2 A;  3EKU A;  1HYS A;  4E89 A;  5LMN K;  4NO7 A;  2Q31 A;  5FRO A;  2E88 A;  1IBM K;  3ZT4 A;  4KI4 A;  2FLO A;  1S5J A;  1MU2 A;  3O4N A;  2G8K A;  4BWJ A;  2BH1 A;  1IH7 A;  3THY A;  4DV4 K;  2FSJ A;  3SUO A;  3I0S A;  2P9U A;  4BC2 A;  3F9M A;  4BR4 A;  2PZS A;  1QSL A;  1U45 A;  3SYZ A;  4CBW A;  1NK7 A;  1TKZ A;  3KLE A;  3LAN A;  1EWR A;  4JI1 K;  3EYZ A;  1BA0 A;  3NCI A;  3NH2 A;  3TSQ A;  3K5L A;  2KTQ A;  1NU0 A;  3RSE A;  2HB5 A;  1HUX A;  4B9N A;  1EWQ A;  2FSK A;  3NBP A;  1WSF A;  4JKB A;  3OYK A;  3WQT A;  1XWL A;  2DFH A;  5I9E B;  2BDP A;  3T1H K;  3U9D A;  3VEZ A;  5AZJ A;  3P5J A;  4FJK A;  4IOX A;  3ULD A;  1Q9X A;  3VQP A;  3U4L A;  5LMU K;  4H0X B;  2QKK A;  3AV9 A;  2VG5 A;  4DMN A;  4Q5V A;  4O4G A;  4FM1 A;  1QQN A;  4NCA A;  4J2A A;  4IEI A;  1YTA A;  1XHZ A;  4PHT X;  1EP4 A;  2O8B B;  2OYQ A;  5CYQ A;  4KH6 A;  1DT9 A;  3RMD A;  3A5L C;  1BIU A;  2X74 A;  4N5S A;  1NOY A;  1QSY A;  5A2Q O;  4GV3 A;  3KLF A;  2ZGZ A;  4EZ9 A;  5JVH L;  1RT1 A;  4FJ5 A;  2BAN A;  4UQG A;  1VQ4 N;  1DKG D;  3O3G A;  2E5L K;  3L4Q A;  4CF8 A;  2X6S A;  1YJN N;  1HJR A;  1Q81 O;  1CXU A;  1Z25 A;  1JLA A;  4BRN A;  3VQ6 A;  1IJJ A;  3MX5 A;  2RF2 A;  5KI6 A;  3BZC A;  3L4I A;  3UKR A;  1CZA N;  1Z26 A;  1KVC A;  3IKM A;  2NNW A;  2D1K A;  3MK6 A;  2P9I A;  1WBD A;  4FVU A;  2E2O A;  4MO4 A;  4CGH A;  1U2V B;  3QIP A;  4B9Q A;  3WXI A;  3CI5 A;  5BN9 A;  4CEA A;  4KH4 A;  4B1Y B;  3DLL L;  3UKU B;  3I55 N;  4CGI A;  4ZTF A;  3V1Q A;  3HOT A;  3CFP A;  3T3F A;  2F8S A;  3AO4 A;  4CHN A;  5BRE A;  3CC2 N;  3TAQ A;  4DUY K;  4JI4 K;  1Y97 A;  5AQG A;  3CQX A;  4FJN A;  4DV0 K;  4KBO A;  1WSG A;  5J2P A;  3MAQ A;  1XC3 A;  3DLG A;  4Z4G A;  3BF3 A;  4CZL A;  3J7Z O;  1N36 K;  2B6A A;  3GOI A;  4X62 K;  1QVG M;  4AIL C;  4DCH A;  4NXM K;  4F3T A;  4JKA A;  3QB0 A;  3ZET B;  5BRD A;  4CJE A;  4HCB A;  3OYH A;  3WEE B;  4ELV A;  4DLE A;  4KHP K;  1S1W A;  4NCG A;  2P9K B;  3P1G A;  2YHA A;  3CFO A;  1BG3 A;  3J7Y P;  1OH6 A;  4MLE A;  4MFB A;  5ADX A;  1S9E A;  3LM2 A;  4CZF A;  1G15 A;  2WBN A;  1LWF A;  1JLF A;  4FL9 A;  3SAG A;  3C6H A;  5KGX A;  3OW2 M;  4F3O A;  4HHT A;  1OH7 A;  3NMU A;  1K8K B;  1RBU A;  3MMV A;  4HUE A;  4DR6 K;  2YI1 A;  3B6O A;  2ASO A;  3THV A;  2F9T A;  3SQ2 A;  2GEM A;  4BGA A;  4CI6 A;  2NRT A;  3LL3 A;  4FZY A;  4IJA A;  4LF8 K;  3SNN A;  5GIP A;  2JLE A;  5MLC Q;  2IGI A;  3KK7 A;  4K8X A;  3AAP A;  4CEQ A;  1K9M O;  2FBT A;  5EU7 A;  3QLH A;  3O80 A;  1QE1 A;  4CIG A;  2QXL A;  1RDC A;  3QEX A;  2E1Z A;  4FJX A;  3BP8 A;  3NE6 A;  1EX4 A;  1L5U A;  5CYM A;  3VEV A;  4BRC A;  3DLK A;  2QKB A;  5F0X A;  3FE1 A;  1T03 A;  3CCL N;  5GIN A;  4K0K K;  2O8E A;  3L2V A;  5AQK A;  3TAB A;  3EZ5 A;  3SUQ A;  3QIC A;  3NF8 A;  1KVB A;  4MLH A;  1J9A A;  4NB4 A;  5C0Y A;  2OPQ A;  3KLG A;  2EWS A;  1WAJ A;  3AVG A;  2D5R A;  3LAL A;  5HRR A;  2E8A A;  1P90 A;  1TKX A;  1U04 A;  4OPJ A;  1WBB A;  1TAU A;  3ZSV A;  4H8K A;  4DFM A;  4IEE A;  3VA3 A;  3CCU N;  3NGY A;  4CEC A;  1JJ2 M;  4B9L A;  3THX A;  5GAE P;  2HF3 A;  1KAY A;  1UOC A;  3JS6 A;  1XNQ K;  1K8A O;  1DTT A;  5AQM A;  2AJQ A;  1X3N A;  3BZK A;  1RBT A;  3ZLJ A;  1ILY A;  1I94 K;  2O8D B;  3WQU A;  1Z6R A;  4DSK A;  1BO5 O;  4K41 A;  3PIP L;  4B1V A;  3NF7 A;  4OX9 K;  5AQN A;  1RTD A;  4FO0 A;  1SZ2 A;  4EHU A;  3L2R A;  3KJV A;  1RDB A;  3G25 A;  1HYV A;  3SPY A;  1WOQ A;  4IG0 A;  4W5T A;  4ZTJ A;  1TGO A;  1TUY A;  5AQP A;  4AM7 A;  4CEF A;  3GE1 A;  3ZYY X;  1N5Y A;  2PAV A;  3EN9 A;  3OYL A;  3AVB A;  4A59 A;  5GAG P;  3VF4 A;  3A2F A;  4LC9 B;  1KQS M;  2ZF5 O;  4DB3 A;  3AAR A;  1BQN A;  3O3F A;  3VQA A;  3K9J A;  1KC8 O;  4CHP A;  2BUP A;  3ZSZ A;  5C42 A;  3AA3 A;  3AVC A;  2P5O A;  3O4Q A;  3E9O A;  1XQS C;  4C8K A;  2HBM A;  3DLR A;  4DTN A;  3MN7 A;  3RWU A;  1WLJ A;  4BE2 A;  4MDA A;  2D0O A;  1HNZ K;  3C95 A;  4AHU A;  4H0P A;  5FPM A;  4LF9 K;  4JAX A;  5E84 A;  3TWH A;  1UA1 A;  2O4G A;  2VWK A;  4A5B A;  4JI7 K;  5C10 A;  5M1O A;  4CJ4 A;  3KIO A;  2VGN A;  1ATR A;  3M8Q A;  3J81 O;  3ZSR A;  5KRS A;  1X3M A;  3J80 O;  4C1N K;  5HL7 L;  1BWF O;  3L2Q A;  5C2D A;  4CZH A;  4EP4 A;  5C24 A;  1JLB A;  4WCE L;  5JMV A;  4BRD A;  4FWN A;  1J53 A;  3QEW A;  3CQ8 A;  1NK9 A;  4BG9 A;  3AVF A;  4AHT A;  2NRV A;  1VRU A;  3DOL A;  4FWK A;  4IFY A;  2HBK A;  4KPY A;  4QOZ B;  3M8S A;  2HHX A;  2P9S B;  1NJY A;  3A5M C;  4DG1 A;  3UB5 A;  4E1J A;  1CLQ A;  2V7Z A;  1N8R O;  1HQE A;  1YXQ A;  1JCE A;  3L8B A;  1WB9 A;  2QM1 A;  2V51 B;  3S3M A;  2NLX A;  1VQ8 N;  1ZXO A;  1JL1 A;  4FK2 A;  1GLA G;  2NRW A;  4CGG A;  1S3X A;  2UU9 K;  3N4Q A;  1TK8 A;  3KD1 E;  3DOK A;  3AA5 X;  4XEI A;  2DFF A;  4FZX C;  4CEO A;  4XH1 A;  1ATS A;  4B1X B;  3JSM A;  3OS0 A;  1KFD A;  3C6U A;  3PIO L;  1SKW A;  4BRL A;  2YHX A;  1RT2 A;  4KB1 A;  2QK9 A;  4C23 A;  2GUP A;  2Z1H A;  4ID1 A;  4CE9 A;  1NKB A;  3ULE A;  4FWL A;  1A5X A;  3H6E A;  3OBY A;  5FPE A;  3ZSX A;  2IDO A;  3FZM A;  4Z4E A;  3D2F B;  3OTO K;  2W6L A;  3K5M A;  1QQC A;  4WQ5 A;  1KFS A;  2OPP A;  3VQ7 A;  4O0I A;  5TKW A;  1W2B M;  3A5O C;  1FKP A;  3C65 A;  3CM5 A;  2OZS A;  3Q7B A;  3T69 A;  4JI8 K;  4IBN A;  5SWM A;  5E26 A;  1JKH A;  3CC4 N;  1NGB A;  1TVR A;  3TTD A;  4U67 L;  4K25 A;  4ISG A;  1C0F A;  1ITG A;  3SQ4 A;  4DR4 K;  2HW3 A;  3QNO A;  1NJW A;  3QO9 A;  4M41 A;  4FLU A;  1HNI A;  3RR7 A;  1M90 O;  4M3Z A;  1WAF A;  3HPG A;  3WT0 A;  3JYT A;  2IS3 A;  3ZT0 A;  2O8F A;  4B1Z A;  5IWA K;  3MED A;  5EVZ A;  4F9O A;  4IG3 A;  2HNZ A;  2KKZ A;  4DFP A;  3AVH A;  4JKF A;  3L2W A;  1FXX A;  4IXC A;  3PY8 A;  4DWI A;  1T3V A;  4KV8 A;  4A2A A;  4OGE A;  4O8K A;  4CCH A;  1O1W A;  1VRT A;  3K57 A;  2FF6 A;  3THW B;  3DRP A;  2RKI A;  3CYM A;  3FFI A;  1C1A A;  4N76 A;  4B3S K;  1A5W A;  2HST A;  2YKM A;  3OYA A;  1H1V A;  1TUU A;  3MN6 A;  1VSE A;  4Z4C A;  4ID5 A;  3CFR A;  2ATQ A;  4KHQ A;  4RW6 A;  1N33 K;  4JD2 B;  3L3U A;  3AO5 A;  4CD3 A;  3G71 N;  2JGU A;  4RW9 A;  1OH8 A;  1ZBU A;  1Q8I A;  5AR0 A;  4LD0 A;  4FJJ A;  1SL1 A;  4GNI A;  4BDZ A;  3B8A X;  3ATV A;  4E1M A;  1HNW K;  4DTS A;  2YNH A;  4FOI A;  3P39 A;  4BRF A;  1BI4 A;  2Q0R A;  4LSN A;  4LFB K;  4WQ5 C;  5AZI B;  3DYA A;  3CMA N;  4BRO A;  4MDB A;  1L3S A;  3MEC A;  3KWI A;  3I33 A;  4M3X A;  4LF7 K;  2HHT A;  3DWL A;  4FLT A;  2YKN A;  4CJL A;  4E19 A;  4YY3 K;  4B3O A;  1VK0 A;  2A1S A;  1ASV A;  1BOT O;  3ZCM A;  3W3D A;  3NGZ A;  3SPZ A;  4HTL A;  3BDP A;  3CER A;  3K2P A;  3LAM A;  5AQX A;  2OZM A;  4JN4 A;  3VQD A;  4DU4 A;  4PQU A;  2ZGY A;  4F8R A;  4N41 A;  1VSM A;  1WN7 A;  4CFD A;  4H5V A;  1RTI A;  3C6T A;  3ZX0 A;  4FJM A;  3CJ7 A;  4LFA K;  4K8Z A;  4DV3 K;  2Y1J A;  4H5N A;  1NMD A;  4HCC A;  3CME N;  2P9L B;  4DQQ A;  4YOR A;  2G8H A;  4IFV A;  2A41 A;  3FZK A;  3D2E A;  3OYN A;  3WNF A;  2VWJ A;  3HP9 A;  2HF4 A;  2DPN A;  4OKE A;  2IIR A;  3QBW A;  4H0T B;  4YHH K;  3SAH A;  3E1Y A;  4DV7 K;  4UY8 O;  3JXU A;  4KTZ A;  3QFP A;  4M7X A;  5KQD A;  3IFR A;  3CD6 N;  1T8E A;  1J5E K;  4PA1 A;  4DTP A;  2VQE K;  3SBT A;  4PL8 A;  3VA0 A;  5LY3 A;  3K59 A;  3TAN A;  3WXK A;  3B6P A;  3S3N A;  1GLE G;  3AVM A;  3TTC A;  5GAH P;  1BGX T;  1EKE A;  3NFA A;  5DK5 A;  4C1N I;  2VQF K;  3SJJ A;  5CR4 A;  4FK4 A;  3GG4 A;  4JK9 A;  4EAH D;  4WFB L;  2JWK A;  3BY5 A;  3AY9 A;  4H0O A;  1QVF M;  1BCM A;  3AVI A;  3BF1 A;  4H5R A;  3EY1 A;  3VEW A;  1XUP O;  2ZJR L;  3TSP A;  2Q2R A;  2JWL A;  3P31 A;  2D0P A;  3VOV A;  3AAQ A;  3HO1 A;  1ZC6 A;  4DV2 K;  4Z4F A;  3JAM O;  1S1U A;  4LY7 A;  4FZZ A;  2RN2 A;  3SLC A;  4B9T A;  4KTQ A;  4BQL A;  1GLL O;  1VSJ A;  3CIP A;  1EXQ A;  4DTM A;  4I2P A;  4K42 A;  2A42 A;  3V9Z A;  3L0Q A;  4ICL A;  5K14 A;  1WSI A;  3C94 A;  1JLQ A;  3LM9 A;  1HNX K;  2KHO A;  3QEP A;  3DXM A;  4JKG B;  4NXN K;  1ZBF A;  4BRE A;  1NWK A;  3AA4 A;  3DJC A;  3VF6 A;  4RCH A;  3ZEU B;  1KSP A;  3TAR A;  4QS7 A;  4J2B A;  1ASU A;  5FPN A;  3RRG A;  4F4K A;  3IUC A;  4BR0 A;  4N56 A;  3HTV A;  4J2D A;  4OPH A;  3C0B A;  3R6M A;  5C2F A;  1HJO A;  5AQI A;  2P9N B;  4LH5 A;  2LSN A;  5KTQ A;  1VSH A;  1NGH A;  1XMO K;  1TKD A;  2AP1 A;  3SUN A;  4X64 K;  1DTQ A;  1FJG K;  4CK2 A;  3CCM N;  3QFU A;  3LWL A;  4DQS A;  4DR7 K;  3HST B;  4OLA A;  4JI0 K;  4DV5 K;  4CJK A;  3J7A P;  4CJF A;  4JHD B;  2KFN A;  1TV6 A;  3G4S N;  3ZX3 A;  5AQW A;  4CZJ A;  5TKY A;  3SMS A;  4JYA K;  3ENH A;  1NGJ A;  3KK2 A;  4FSV A;  4JKD A;  4IOC L;  4JV5 K;  4CGJ A;  3AGR A;  1QZ5 A;  3H1V X;  4NYN A;  3G10 A;  4MO5 A;  2P9P A;  5DMR A;  4BRG A;  3V81 A;  3V1O A;  3FZF A;  1LOT B;  3CJC A;  4JKE A;  4BC3 A;  3RMB A;  4GKJ K;  3AA2 A;  1HR0 K;  1VQM N;  3SV4 A;  2UYT A;  1BUP A;  4GVE A;  4JI6 K;  4FJI A;  2A3Z A;  4BGB A;  1LV5 A;  1QTM A;  3TPQ A;  2EX3 A;  3NF6 A;  4BWM A;  1S1V A;  2PYL A;  2BTF A;  3ZSW A;  3QBX A;  2YX6 A;  3VTI A;  5ADX H;  3CPE A;  1T6D A;  4CGF A;  4R5P A;  5DM7 L;  3OS2 A;  4FW1 A;  2B4J A;  3H46 O;  3O5B A;  1K6Y A;  3VF2 A;  4FJG A;  2IVN A;  3MN9 A;  3WXJ A;  2WC9 A;  3F2K A;  2CH6 A;  1DLO A;  4AHV A;  4GVM A;  4FWS A;  1F21 A;  2YJF A;  1Q7Y O;  4J8F A;  3OYC A;  3OHR A;  1NGC A;  5FRM A;  4M3U A;  5M1K A;  4JK7 A;  3LPU A;  2XY8 A;  1D8Y A;  3DMJ A;  1YUW A;  4CJP A;  5BN8 A;  4JK8 A;  4WFN L;  1T44 A;  4Y1D A;  5EOY A;  1GLB G;  3THY B;  3RTV A;  4DTX A;  5EX5 A;  2P9U B;  3VGL A;  4YOT A;  4IKF A;  2NRH A;  3KVG A;  3F5T A;  2E2P A;  3U6F A;  1VSK A;  3V9U A;  3HK2 A;  2QEX N;  1NOZ A;  4ISE A;  4CJ5 A;  5KPR A;  2KFZ A;  1B92 A;  1IG9 A;  3AVN A;  2Z1G A;  3E9L A;  3RSE B;  4IFE A;  2FBV A;  1GLD G;  1RFQ A;  3NH0 A;  2HHU A;  4CEB A;  5AQV A;  4RW4 A;  5JLH A;  2G8V A;  2V52 B;  2HOE A; 
#chains in the Genus database with same CATH homology
 4YOX A;  5AZJ B;  4K43 A;  3MWP A;  2HBL A;  3WUH A;  3UB5 A;  5EY4 A;  1TYQ A;  2QWQ A;  5M1Q A;  4GV6 A;  4E1J A;  2V7Z A;  1N8R O;  1YXQ A;  3Q7C A;  5HOO A;  1JCE A;  2QWO A;  1YI2 N;  2F9W A;  1BA1 A;  2QM1 A;  2V51 B;  2ITM A;  2NLX A;  4CD1 A;  3VTH A;  1VQ8 N;  1RDW X;  3TU5 A;  1QQM A;  1ZXO A;  3OA9 A;  1EO1 A;  4KH5 A;  3LDQ A;  1GLA G;  3TTF A;  2J4R A;  2NRW A;  3DAW A;  1G99 A;  3HZ6 A;  4FOE A;  4XH5 A;  5AQY A;  4BC4 A;  1DEJ A;  1S3X A;  4DKW A;  5CHI A;  3N4Q A;  3MDQ A;  4BVO A;  5GAD P;  3FR0 A;  2PFU A;  3QDK A;  4XEI A;  2QI2 A;  2QWM A;  2W40 A;  5EXW A;  1VQO N;  3ZX2 A;  3DXK B;  3O6W A;  4BQZ A;  3IDH A;  4FPB A;  4XH1 A;  1ATS A;  2IVO A;  4B1X B;  3HOS A;  3CCJ N;  4BVP A;  2QTD A;  3VES A;  2VYP A;  3O1B A;  2E2Q A;  3GL1 A;  3EL2 A;  2VGM A;  5BR9 A;  2NRX A;  2PBD A;  2YHW A;  3SAF A;  3PIO L;  2FXU A;  2YHX A;  4BRL A;  1VQ5 N;  2GWK A;  1VAZ A;  2Q1N A;  3CPW M;  4C23 A;  2GUP A;  1YJW N;  1R59 O;  3VET A;  3MWT A;  2CGK A;  5GIO A;  3ULE A;  5M1N A;  2HMP A;  1T6C A;  4FWL A;  5CE3 A;  4BRM A;  3H6E A;  3D7E O;  3OBY A;  3VEX A;  5BPN A;  4I6M B;  3A5N C;  3EE9 A;  5FPE A;  3O9Q A;  1NM1 A;  1WUA A;  3UKR B;  3FZM A;  4CZE A;  3D2F B;  5JLF A;  5AFU A;  4H0V B;  5AQO A;  5AQZ A;  1KAZ A;  2P9I B;  2W41 A;  4WQ5 A;  3H3O B;  2ASM A;  1NGE A;  5TKW A;  1E4G T;  3A5O C;  5ELZ A;  4IO9 L;  1W2B M;  2RE2 A;  2GEL A;  3C65 A;  3M1F A;  1RGI A;  4NLC A;  5DM6 L;  2NRR A;  3H1Q A;  3EKU A;  3Q7B A;  5AQT A;  3GDQ A;  3T69 A;  3E66 A;  3H45 C;  3QML A;  4NO7 A;  4A57 A;  4BR5 A;  2Q31 A;  3MX2 A;  4NLB A;  2HBJ A;  2E88 A;  5E26 A;  3CC4 N;  2FLO A;  1NGB A;  3TTD A;  2YHY A;  4EFH A;  5AQU A;  3CCS N;  4U67 L;  3WXL A;  4BRH A;  4K25 A;  4ISG A;  4L3Q A;  2BH1 A;  3CJ9 A;  4FWO A;  4BRA A;  1C0F A;  3D2E B;  2QA4 N;  3EO3 A;  2FSJ A;  1X9J A;  1NGG A;  3FZH A;  4BC2 A;  2P9U A;  4BR4 A;  3F9M A;  4ILJ A;  1VQ7 N;  4CBW A;  1M90 O;  1YJ9 N;  1OVY A;  2VCP A;  3MN5 A;  4BY9 C;  3A8Y A;  4GY2 B;  3ENO A;  3PLA A;  5LJW A;  3WT0 A;  4QS8 A;  1BA0 A;  4B1Z A;  5EVZ A;  4F9O A;  3TSQ A;  2KKZ A;  4FWP A;  4JKF A;  3RSE A;  3J8A A;  4WQ4 A;  5AQL A;  3VEN A;  3BEX A;  1HUX A;  2FSK A;  4JKB A;  1KXP A;  3C7N A;  3WQT A;  3CC7 N;  5I9E B;  3FGU A;  3AGK A;  4IXC A;  3U9D A;  1NBW A;  2P9S A;  1T3V A;  3VEZ A;  4A2A A;  5B8H A;  5AZJ A;  4O8K A;  4IOX A;  3KZB A;  2FF6 A;  5AQJ A;  3U4L A;  4H0X B;  4CZG A;  1GLF O;  3R1X A;  3MCA B;  4JKH A;  1YIT N;  1Y64 A;  2I7P A;  4YDU A;  1GLJ O;  1QQN A;  4DHY A;  2HST A;  3R8E A;  4OO1 J;  3RVC A;  5C15 A;  1H1V A;  1TUU A;  4IEI A;  3MN6 A;  1W97 L;  4PHT X;  3CCR N;  4BR7 A;  4JHD A;  4CBX A;  5C12 A;  4HWI A;  4KH6 A;  1DT9 A;  2IVP A;  3A5L C;  4JD2 B;  4BRK A;  3SBG A;  1NJI O;  4CD3 A;  2KLA A;  3SMP A;  3G71 N;  3DXK A;  1YHQ N;  5KQ8 A;  4GV3 A;  5AR0 A;  3UE5 A;  2ZGZ A;  4BC5 A;  5JVH L;  4GNI A;  1MDU B;  3B8A X;  3ATV A;  2QWP A;  3P39 A;  3OBW A;  4FOI A;  4BRF A;  1VQ4 N;  1DKG D;  5AQQ A;  2Q0R A;  2YCH A;  5AQS A;  3DXM B;  3L4Q A;  4ILG B;  4IZ9 A;  4H0Y B;  4Z94 A;  4WQ5 C;  5AZI B;  4YOY A;  4FWM A;  1YJN N;  3CMA N;  5BPL A;  1Q81 O;  4BRO A;  4MDB A;  1Q18 A;  3M6G A;  4AF1 A;  4QS9 A;  4BRN A;  3KWI A;  3I33 A;  4JNE A;  1QZ6 A;  1IJJ A;  3DWL A;  3MX5 A;  4I6M A;  3L4I A;  3UKR A;  1CZA N;  1BOT O;  1EQY A;  3D2F A;  3IKM A;  2NNW A;  4OPA A;  3W3D A;  5BRH A;  4HTL A;  2D1K A;  3MK6 A;  2P9I A;  3P4I A;  3CER A;  5AQX A;  4RWT A;  4CZI A;  4FVU A;  2CGJ A;  4JN4 A;  1HX1 A;  2E2O A;  2ZGY A;  3ID6 A;  4MO4 A;  3WXM B;  5BRF A;  1U2V B;  4B9Q A;  4BR2 A;  3WXI A;  3CI5 A;  4H5V A;  5BN9 A;  3ZX0 A;  4KH4 A;  3O9S A;  4ILH A;  3R9P A;  4ISF A;  4B1Y B;  3DLL L;  2A40 A;  3O9T A;  1S22 A;  3CJ7 A;  3UKU B;  3I55 N;  3ATU A;  3FLC O;  4H5N A;  1NMD A;  3CME N;  2E20 A;  2P9L B;  5AQF A;  4YOR A;  2QWN A;  4R79 A;  3HOT A;  2A41 A;  3FZK A;  3D2E A;  4A2B A;  5BRE A;  4YOW A;  2HF4 A;  2DPN A;  4WQ4 C;  3VGM A;  4BRP A;  2IIR A;  3QBW A;  3U9Z A;  4H0T B;  4CJ7 A;  3CC2 N;  3NVK A;  1JCG A;  3E1Y A;  5AQG A;  5M1P A;  3SAH A;  3CQX A;  1P8Z A;  2ZJQ L;  3E9P A;  3LDP A;  4KBO A;  3JXU A;  4UY8 O;  2QW9 A;  2Q0U A;  3VEO A;  1IG8 A;  3VEY A;  3QFP A;  1HLU A;  2ZJP L;  4JEP A;  4M7X A;  5KQD A;  1XC3 A;  3IFR A;  3CD6 N;  3BF3 A;  3VMF B;  4O8U A;  4CZL A;  3J7Z O;  3O1W A;  2GX9 A;  4A61 A;  3GOI A;  1QVG M;  5H1S Q;  4EHT A;  4DCH A;  3SBT A;  5AQH A;  4PL8 A;  4GV9 A;  2VWB A;  4PKG A;  4JKA A;  3MCP A;  3QB0 A;  3ZET B;  5LY3 A;  1MWM A;  3HM8 A;  4YDU C;  3WXK A;  1GLE G;  3TTC A;  5BRD A;  5GAH P;  2RHK A;  2YJE A;  4CZM A;  4C1N I;  1YIJ N;  2P9P B;  3WEE B;  2OTL N;  5JIC A;  5CR4 A;  3GG4 A;  4JK9 A;  4EAH D;  4WFB L;  1VQP N;  2P9K B;  2JWK A;  4H0O A;  3AY9 A;  1YAG A;  2GWJ A;  1QVF M;  2NZT A;  3IMX A;  3HBT A;  1E4F T;  1BG3 A;  5FPD A;  3BF1 A;  2WFB A;  3CJB A;  3LDL A;  1NGF A;  4MLE A;  4DQ8 A;  4H5R A;  5ADX A;  1QQO A;  3LM2 A;  4CZF A;  3CCE N;  1HPM A;  4YOU A;  2WBN A;  3I56 N;  3VEW A;  1XUP O;  2ZJR L;  3O9U A;  3TSP A;  2CH5 A;  3P38 A;  2Q2R A;  2JWL A;  4FL9 A;  3S41 A;  3SAG A;  3C6H A;  3P31 A;  2D0P A;  3VOV A;  4A62 A;  3OW2 M;  3AAQ A;  1D4X A;  1ZC6 A;  3NMU A;  3EE8 A;  1K8K B;  4JD2 A;  3T7Z A;  3MMV A;  2QWR A;  3SLC A;  4JKC A;  4B1W B;  2YI1 A;  3K9K A;  4BQL A;  2A6A A;  2NRZ A;  2ASO A;  1GLL O;  2F9T A;  3CIP A;  4K42 A;  2GEM A;  2A42 A;  4BGA A;  4CI6 A;  4FWR A;  2NRT A;  3VPZ A;  3L0Q A;  3LL3 A;  4IJA A;  4BR9 A;  3LM9 A;  3A0I X;  3CQY A;  2KHO A;  4RTF D;  3O08 A;  1BDG A;  3DXM A;  2ASP A;  1DGK N;  4JKG B;  5GIP A;  4BRE A;  5MLC Q;  5AZI A;  3ENB A;  3KK7 A;  1NWK A;  2Q36 A;  3AAP A;  3CJA A;  1S72 N;  1VQ6 N;  3DJC A;  2OTJ N;  3VF6 A;  1K9M O;  3O80 A;  1YVN A;  2E2N A;  4RCH A;  1OKJ A;  3ZEU B;  4M63 C;  2WUS A;  4QS7 A;  3R3L A;  2QXL A;  5FPN A;  2E1Z A;  3IUC A;  4BR0 A;  5KPZ A;  4H5T A;  3HTV A;  3BP8 A;  1QHA A;  3H3N O;  1MA9 B;  4OPH A;  1KD1 O;  3VEV A;  4BRC A;  3C0B A;  3R6M A;  5C2F A;  2QWL A;  5F0X A;  3FE1 A;  1HJO A;  3CCL N;  1LCU A;  5AQI A;  5GIN A;  3CCV N;  2P9N B;  1Q82 O;  1U2V A;  4BG8 A;  1VQK N;  1C0G A;  1HKC A;  4IWV A;  5AQK A;  1NGH A;  3UKU A;  3GBT A;  3QIC A;  2AP1 A;  3N4P A;  4MLH A;  4NB4 A;  5C0Y A;  1BU6 O;  1J6Z A;  2EWS A;  3CCM N;  3FFK B;  2P9L A;  3QFU A;  5KPT A;  2E8A A;  1P90 A;  2E1Y A;  4BRI A;  3HRG A;  4IJN A;  4IEE A;  4JHD B;  3CCU N;  3CJ1 A;  1JJ2 M;  4H03 B;  2CGL A;  4IOA L;  3SK3 A;  1MWK A;  5GAE P;  2HF3 A;  5AFU H;  3L6Q A;  1TYQ B;  3U8X A;  1KAY A;  3G4S N;  3JS6 A;  3ZX3 A;  5AQW A;  1K8A O;  4CZJ A;  5TKY A;  1ATN A;  3SMS A;  4H5W A;  3FZL A;  5AQM A;  3CF5 L;  1VQN N;  3ENH A;  1X3N A;  1SAZ A;  1NGJ A;  1ILY A;  4IOC L;  4FSV A;  4JKD A;  1NGA A;  3AGR A;  2ZWH A;  3ZET A;  3WQU A;  1NGI A;  1QZ5 A;  1Z6R A;  3H1V X;  2A5X A;  1K73 O;  3BUZ B;  5F1X A;  1BO5 O;  4K41 A;  3PIP L;  4FWQ A;  4B1V A;  2OAN A;  4MO5 A;  5AQN A;  3HSC A;  2P9P A;  1JCF A;  1SQK A;  4FO0 A;  3C6A A;  3WEE A;  1SZ2 A;  4BRG A;  4EHU A;  1U6Z A;  2FSN A;  3G25 A;  3FZF A;  1WOQ A;  1LOT B;  4O5F A;  3CJC A;  2P9K A;  4JKE A;  1Q86 O;  1TUY A;  1VQ9 N;  5AQP A;  4EIA A;  3CXC M;  4BC3 A;  4PKI A;  4WFA L;  4AM7 A;  2D4W A;  1VQM N;  3GE1 A;  2UYT A;  4FPA A;  3VER A;  1BUP A;  1KAX A;  1SS6 A;  3LDN A;  3O9R A;  4GVE A;  3CCQ N;  5JVG L;  3ZYY X;  2A3Z A;  4BGB A;  3G6E N;  4AM6 A;  2Q97 A;  3TPQ A;  4YOV A;  3D6R A;  2PAV A;  3EN9 A;  2BTF A;  3QBX A;  4A59 A;  3ULE B;  2YX6 A;  3VTI A;  5GAG P;  4U7B A;  3VF4 A;  1K8K A;  1V4S A;  5ADX H;  3CPE A;  5BPM A;  1VQL N;  4LC9 B;  1T6D A;  1KQS M;  2ZF5 O;  4XH4 A;  4DB3 A;  3AAR A;  1V4T A;  3SJH A;  3W0L A;  5DM7 L;  4M7Y A;  3K9J A;  1KC8 O;  3H46 O;  3O5B A;  3KHY A;  3VF2 A;  2BUP A;  3CET A;  4IDH A;  4IO8 A;  2IVN A;  3MN9 A;  3KWG A;  4WYB A;  1HKB A;  4G9Z A;  4WF9 L;  3E9O A;  1XQS C;  2HBM A;  3WXJ A;  2WC9 A;  3F2K A;  2CH6 A;  3MN7 A;  3NVM A;  4JKG A;  4PL7 A;  4FWS A;  2FF3 B;  2YJF A;  1Q7Y O;  4MDA A;  4J8F A;  2D0O A;  4B1U B;  1ESV A;  2H3G X;  3EZW A;  1RDU A;  1NGC A;  1YF5 L;  3CHW A;  3OHR A;  4H0P A;  5FPM A;  4JAX A;  4JK7 A;  1ZBS A;  5E84 A;  3ZEU A;  5M1K A;  3VGK A;  1Z05 A;  1GLC G;  3I8B A;  1NGD A;  3O8M A;  5M1F A;  1YUW A;  5BN8 A;  1M1K O;  3TSU A;  2I7N A;  4JK8 A;  4WFN L;  4A5B A;  3M5R A;  1T44 A;  5C10 A;  5M1O A;  5EOY A;  1GLB G;  3ID8 A;  2VGN A;  1ATR A;  5EX5 A;  5F2R A;  3EKS A;  2P9U B;  2GTD A;  3LDO A;  1NLV A;  3VGL A;  4YOT A;  1X3M A;  4C1N K;  5HL7 L;  2NRH A;  2P9N A;  3KVG A;  3F5T A;  1BWF O;  5AQR A;  2E2P A;  5C2D A;  4CZH A;  2AA4 A;  4WCE L;  5JMV A;  4A5A A;  4ISE A;  4BRD A;  2QEX N;  5KPR A;  1HKG A;  4FWN A;  3M3Z A;  3O4W A;  3E9L A;  3RSE B;  4CZK A;  4IFE A;  1GLD G;  4BG9 A;  3HI0 A;  3C7N B;  1RFQ A;  2NRV A;  5LJV A;  5AQV A;  5JLH A;  2V7Y A;  4FWK A;  4CBU A;  2F7T A;  2HBK A;  4BRQ A;  1O13 A;  4PKH A;  2P9S B;  3A5M C;  2V52 B;  4Y0W A;  2HOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...