4IOXA

The structure of the herpes simplex virus dna-packaging motor pul15 c-terminal nuclease domain provides insights into cleavage of concatemeric viral genome precursors
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
255
structure length
225
Chain Sequence
PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTSDDLMVAVIMAIYLAAQAGPPHTFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Herpes Simplex Virus DNA-Packaging Terminase pUL15 Nuclease Domain Suggests an Evolutionary Lineage among Eukaryotic and Prokaryotic Viruses.
pubmed doi rcsb
source organism Human herpesvirus 1
molecule tags Viral protein
molecule keywords Tripartite terminase subunit UL15
total genus 70
structure length 225
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioxA00
3N4QA 4IOXA 3N4PA
chains in the Genus database with same CATH superfamily
1N8RO 3AVCA 1ZYQA 2KTQA 1LW0A 4ELUA 1WSJA 1FXXA 4HTUA 1SKWA 2P51A 4KHYA 2F9TA 2Y1JA 3CFPA 4H0VB 2VYPA 1UA0A 2NRHA 3PSFA 3LDSA 3LPTA 1NK0A 5CR4A 3MXIA 1OH6A 4FWKA 4BVOA 4H5VA 3TSQA 3GBTA 5AR0A 5BRFA 3GE1A 2FLOA 3OYKA 3C6AA 3SQ0A 3VN5A 3J7AP 2DFEA 1BISA 1T3VA 1G99A 4BE2A 1JCFA 1X9SA 3S3MA 3AVGA 3A5MC 4YOYA 3CJBA 3VOVA 4H0PA 4MO4A 5AFUA 3VQPA 4CJWA 3R8EA 1JLEA 4B1UB 1ILYA 2NRVA 1K9MO 1ZC6A 2YV0X 4DS5A 4JRQA 4FLYA 5AQJA 1YTUA 1BOTO 3HSCA 5B8HA 3SAHA 5J2QA 4CVNE 4YHHK 3QESA 3MN7A 2B5JA 3SV3A 3HZ6A 4LF7K 4B1VA 3NF8A 3Q7CA 3TAMA 4DTMA 4FK2A 2GUIA 1IJJA 4N76A 4C8NA 2HNZA 2RN2A 4K41A 4O0IA 2D0OA 3OTOK 4H0OA 5LMNK 1BGXT 2D1KA 3OYFA 3HP9A 1OVYA 1KLNA 1XUPO 3V9ZA 3O3GA 1WSGA 4I9QA 4OGEA 4Z4HA 3SQ2A 1A5WA 2HMPA 3NGZA 4CFAA 5JVHL 1NJZA 3I0SA 1KVBA 3OYBA 1XC3A 4CI6A 4GNIA 1QHTA 4Z4EA 1EQYA 1NK6A 4OLAA 2V7ZA 3VQAA 2OTJN 1BCOA 4JK8A 4JI3K 3CJAA 3TTFA 5LMUK 2X74A 4H0XB 5GINA 3WNEA 3M8QA 2XY5A 3DRSA 4FLWA 3AVJA 5IWAK 3NVMA 4GKKK 4GMJB 1BU6O 4O8KA 1U45A 2VCPA 4CJRA 3NF6A 3O4WA 4CEBA 1IKYA 1Q81O 3N4PA 2IOCA 3SZ2A 3E9PA 1U4BA 4CJVA 2Y1IA 4IO8A 4B1ZA 4CZMA 1OKJA 2P5GA 1XHZA 4FJ7A 4ZHRA 2KLAA 4MQ3A 3THXB 4E1MA 3OYCA 4ILGB 4Y0WA 3OYLA 1TUUA 1FJGK 1LOTB 3VTHA 2XO7A 3DLKA 3U9DA 2I7NA 3A5LC 1YAGA 4CEFA 1LWEA 3L2RA 3WNFA 4ID1A 3PV8A 3VEOA 4M7YA 4DV3K 4MLEA 3UE5A 2E2QA 3KIOA 3J80O 3IMXA 4BGAA 4Z4FA 3RRGA 4CEEA 2OPSA 1D9DA 4QS8A 4FLUA 4CIGA 3CCUN 1HKCA 1RFQA 4M41A 3QETA 1KQSM 4B9SA 1Z26A 2E6MA 3QINA 1WSFA 4DQRA 3VQBA 3CG7A 4A5BA 3VA3A 1XNQK 4FJMA 1D4XA 5E41A 4DQ8A 1TV6A 3K58A 4I2QA 1I94K 4W5TA 1NGEA 3HJFA 1T6DA 3DLGA 1NGAA 2IVOA 4CD1A 2WC9A 1ASUA 3LM9A 3P39A 1EWRA 4WE1A 4GV3A 4M3ZA 4CJ7A 2YHXA 3Q7BA 4H4MA 5C12A 5DM6L 3DLLL 4KHPK 1B9FA 4IO9L 3UKRB 2WTUA 3G71N 5CY4A 3NCIA 3ZSVA 4A2BA 1U2VB 3CCJN 3ULDA 3DLEA 4CERA 3AA3A 2BE2A 3ATUA 4M45A 4ISFA 3VQ6A 1IO2A 4IXCA 2KQ2A 4IKFA 1NGDA 3L2QA 4KKOA 5HRNA 4O5FA 1D8YA 4M7XA 3ID8A 5IT9O 1KCFA 3KLEA 4O5BA 1LW2A 3HM8A 4CHZA 3P5JA 1T05A 2PBDA 1R59O 1VK0A 1VSKA 2KHOA 1JKHA 1NOYA 5LJWA 2GX9A 3HYFA 1KD1O 3TTDA 3VQCA 4DMNA 4FWLA 4BWMA 3UB5A 1ZBFA 2QM1A 4WQ5C 5CE3A 2QWRA 4CZGA 1SKSA 3THYB 4NYFA 4BR2A 5C25A 1L5UA 4B9LA 3JXUA 4DHYA 3CJ7A 1NGIA 3RRHA 2QEXN 2VG7A 4FJGA 4KPYA 3ZYYX 3EE9A 4BY9C 1M90O 4BRQA 4RCHA 2XY6A 4KRFA 1IH7A 3CJ1A 4CF9A 4PKIA 3AVAA 4ISEA 4PY5A 1XNRK 4CEAA 1NK5A 4CEDA 4KHSA 3A8YA 1S9EA 3L2VA 4FWSA 5GIOA 1JCEA 5KPRA 5BN8A 2OCEA 3S3NA 3V81A 3EKUA 3A5OC 4CJ4A 3OHRA 4E3SA 4CGGA 1V4TA 1QQCA 4FJJA 3LZIA 1VSEA 4CE9A 2P9NB 3OYMA 1EX4A 1ATRA 4CBWA 1W97L 5HL7L 3AY9A 1VQMN 2Z1GA 4JLHA 3OYJA 1S1TA 1JLBA 5KQ8A 3ZSQA 1Y64A 4IBNA 2NLXA 1HKGA 1RT2A 1L3VA 2FC0A 3LL3A 1X3NA 2OYQA 2ZQBA 4RTFD 1RBSA 3ZX0A 4DV6K 3VF2A 4JS5A 1NK9A 3AVFA 2E2OA 3QEWA 2E1YA 5MLCQ 3V4IA 1QTMA 2YJEA 2ASOA 2CGLA 2HSTA 1LWFA 3DOKA 2ZGYA 2G8WA 3CJ9A 1KFDA 3GDQA 1L3TA 4DR5K 2VGMA 3WXLA 5JICA 1EKEA 1DT9A 3DXKB 4EFHA 4DTOA 3JSMA 4B1WB 4N41A 3SNNA 4CK3A 4NCAA 5HLFA 1QS4A 2F7TA 4JI0K 3SAFA 1HNWK 1KAYA 1VQKN 1TAUA 1VQPN 3CI5A 3G4SN 4DQSA 4JI5K 3C65A 4KI4A 4Y1CA 1U04A 3EEQA 4ELTA 4FJKA 3DLRA 1Z05A 4CZIA 1BQNA 1R0AA 1N5YA 1XWLA 1Q7YO 5SZTA 3EKSA 3KK2A 3AVBA 3LWLA 1S3XA 3J8AA 3BDPA 4RW4A 2WOMA 3O1BA 5KGWA 5BPLA 4DTXA 2ETJA 5AZIA 4WYBA 1SQKA 4JI6K 3NBPA 3LDNA 3PUFA 3VEZA 3FZKA 2KFNA 3AAQA 4FZYA 4Z0UA 5BREA 2IAJA 3ZSYA 5ADXH 3NHGA 5K14A 1IKVA 2UUAK 3QBWA 3DOLA 3T7ZA 3WXJA 3WEEA 4AM7A 4CK1A 1SZ2A 3QIPA 1S1XA 1RTIA 4C1NI 3QEPA 1TK5A 2BH1A 2P9KA 4ZTJA 3DLHA 3T69A 1IG9A 4JKFA 3SQ4A 2F8TA 1UA1A 4FSVA 5GAEP 4Z4CA 1HNXK 4E7IA 4DSKA 3RMBA 1NJIO 4BE1A 4FLTA 3H1QA 3ZSZA 1KFSA 1W0HA 3VGKA 3R3LA 4IFYA 1Q18A 3KKRA 2D0PA 2X78A 1TKDA 4Z4GA 2VWKA 4B9TA 3K5OA 1HUXA 5EOYA 4B8CA 5DMRA 5BPMA 3BGRA 3VEYA 3NVKA 4C8KA 4KTWA 1WNSA 4DR1K 4B3SK 2ZM6K 3VGLA 1KVAA 5AQGA 1LWCA 3CMEN 2I5JA 1OH8A 2O8BB 3U3GA 4A2AA 3OYAA 1VSFA 3MWTA 4BRLA 3TAQA 2QWQA 4JK9A 4CZHA 3TR8A 2WONA 2P1JA 2HF4A 3VERA 3VGMA 3AAPA 5AQRA 4WFBL 5GIPA 5C2FA 1P90A 4CD3A 4DR2K 4B3MK 3LDLA 1Q9XA 1BHLA 3M8RA 3I33A 2PAVA 3T1AA 1VSDA 2O8DA 2OPPA 5CZ1A 2CGKA 3DM2A 3VA0A 4DLEA 1IKWA 5KPTA 4M3YA 3H3OB 3ZSWA 4OPHA 1T03A 5GAGP 3U8XA 3LALA 3L8BA 2KW4A 4F2RA 2Z1IA 1NOZA 3V9UA 4B9MA 3TSUA 3L2UA 1RNHA 4DFKA 5BRHA 4QOZB 2FXUA 2E2PA 1TGOA 4JNEA 3ZSXA 1J53A 1TL1A 1RBRA 2V51B 4FM2A 4NXMK 4DTUA 4BRHA 2P9NA 4CZKA 3T19A 4FJIA 4MO5A 4N47A 3M8PA 4DV7K 4E7HA 1GLBG 3L6QA 4JI4K 4W5OA 4B3RK 4BC4A 4FLXA 2HVIA 3UKUA 3MMVA 3I8BA 1TL3A 3ITHA 2D0BA 1KRPA 3JYTA 4RW9A 5AQZA 4W5QA 3VMFB 2YHWA 1TKTA 1XHXA 3IKMA 1M1KO 4FJ9A 1BQMA 1I3AA 1KVCA 4RW8A 3K59A 1IBMK 4A62A 1RBUA 3KK7A 4K25A 1JLQA 3HBTA 1JXBA 4BR7A 4RW6A 3B6PA 2HHWA 3QNOA 1NJXA 4JKCA 3RWUA 2HHSA 1L3UA 3TARA 2VG6A 4IZ9A 4NYNA 1RDUA 2UYTA 1O1WA 3AO1A 4FM1A 3ULEA 4MLHA 3ZT1A 4BR0A 3PIPL 3AVIA 3FFIA 3HSTB 3QEVA 3MN5A 3QIOA 5HROA 3U6FA 1W9HA 1YJNN 3D2FB 3OBWA 4DV1K 4BRPA 2DY4A 1TKXA 4BACA 3LP3A 3ENHA 3U3YA 1KC8O 3VQ8A 3AA2A 3BF1A 4YOTA 1HNZK 3AVHA 4IJAA 3V1QA 4CGIA 4CBUA 2OPQA 1I39A 2ZJRL 4C1NK 4KI6A 2YHAA 3HXMA 4IWVA 1NLVA 4E1JA 2IVPA 1SL0A 4PWDA 5HOOA 1HMVA 4OPJA 4A5AA 4CJ3A 3KD1E 5E84A 5CHIA 3NH2A 4JD2B 3AO3A 2AP1A 2O4GA 4DCHA 2KZMA 1N34K 4BQZA 3ZT3A 4OVLA 3ID6A 2IDOA 3OYEA 1HQEA 1ESVA 2I7PA 5AQOA 5LJVA 4FO0A 3FFKB 2KFZA 2BANA 3RMDA 5DK5A 5AQSA 3DXMA 3LP1A 4FWOA 1X3MA 1VHXA 1K8KA 2UUCK 1BG3A 5M1NA 3TAFA 2A1RA 2P9SB 1NJYA 4JKGA 1QSLA 2PY5A 4IOAL 1ASVA 3U9ZA 3QMLA 2P9LA 3K5MA 2B6AA 4BRIA 1RGIA 3V6DA 2V7YA 4JD2A 4U67L 2EWSA 3IG1A 4FJ5A 4B1YB 3ZSOA 1N32K 4HUFA 3HPGA 4DTRA 4CJSA 4CJEA 3V9XA 2QKKA 3EZ5A 4BRFA 3KWIA 1VRTA 1K8KB 1RT4A 4H03B 1QE1A 2FBXA 3CPEA 2FSJA 3LP0A 2XY8A 3DXMB 3N4QA 2QWNA 3O9SA 1Q82O 3E1YA 2HBLA 4HUEA 1Q86O 1RDCA 2W6LA 4BE0A 5KGXA 5FRNA 4E1NA 3DJCA 4CFBA 3D7EO 4IOCL 3O8MA 1U49A 5T7BA 3ZT2A 4YDUC 4CJ5A 3A5NC 1RDAA 3M6GA 2GWJA 4FZXC 1QSYA 4H4OA 2Q2RA 3TAEA 1YTAA 2G8HA 3MN6A 4ID5A 1ZBSA 1X1PA 2A40A 1RDBA 1RTJA 4CGFA 1T44A 4LF8K 1NK7A 3THVA 3SBTA 1UWBA 4DQPA 3CERA 3ZCMA 5C24A 3RTVA 3CCRN 3CPWM 2E5LK 4IEIA 1VSJA 5FRMA 1GLAG 4BDYA 4AF1A 4EP4A 3K9JA 4A61A 5KQDA 2Q0RA 3SV4A 3H3NO 3SUOA 3AO5A 4XEIA 4KH5A 3LP2A 3H1VX 2D0CA 2YI1A 5AQLA 4CGHA 1ITGA 2VGNA 3T1HK 1N36K 4B3TK 1YT3A 4DS4A 3IDHA 4KTQA 3T3FA 3K57A 2QI2A 4FWNA 1VRUA 4IDHA 2OA8A 3BUZB 1S6QA 4CZFA 3TU5A 4V19S 3SUQA 5I3UA 4FJHA 5LL6Z 1EXQA 3SK3A 3F2KA 4HHTA 3F9KA 4WFNL 3CFOA 3WQUA 5JVGL 2PYJA 1HKBA 1SUQA 4KHWA 1JXEA 1RBVA 3DI6A 3F5TA 1HNVA 3T1YK 1TYQA 3QFPA 3FGUA 3DRPA 2O8EA 4CEZA 1S1VA 1FKOA 2FBVA 2ZGZA 1V4SA 3CF5L 3OVNA 3V9WA 4FWPA 5KRTA 4DSIA 4BRMA 3ZX3A 3KJVA 2ZE2A 1JJ2M 2UUBK 4BG8A 3PX4A 1LAWA 1NMNA 2YKNA 5M1QA 4DU1A 3I0RA 1NGFA 3V1OA 4X64K 3AVNA 4CHPA 1RT7A 4NXNK 3HP6A 1S6PA 2ASMA 1GLEG 2HHQA 4B1XB 4N5SA 3FLCO 4K8ZA 5AQHA 4LFAK 3KD5E 3MCAB 4LF6K 4DV4K 1WOQA 3BZKA 5SWMA 5CYQA 1QVGM 3O3FA 5J2PA 3TAGA 4DG1A 3KK3A 4X65K 5HBMA 2ITGA 3DLBA 4ELVA 1TKZA 1QZ5A 2CGJA 2RKIA 5JS2A 2ZD1A 3TANA 4KH6A 3G0ZA 1E4GT 4ILHA 1DKGD 3PX6A 4H5NA 3I55N 3TABA 3O4QA 3K2PA 2O4IA 4JI1K 4DSEA 4IEEA 2O8CB 2NUBA 2F9WA 4FLVA 4IG0A 4DFPA 5I42A 3KWGA 3EZWA 4CF0A 2BDPA 4LFCK 4C8LA 2GBZA 1MA9B 2NZTA 5F0XA 2OZSA 4F2SA 4FXDA 1NK8A 2QW9A 3PO4A 2RPIA 1FW6A 2FF3B 4DTPA 4CIEA 1LAVA 5AZJB 1TK8A 3CCLN 5BR8K 3RMCA 3HL8A 2ZJQL 3VESA 4YOUA 2E4LA 4U7BA 2UXCK 2NRRA 3JAMO 2HNYA 4BR9A 3L4IA 5HRSA 3VF4A 4FJNA 5EY4A 1YXQA 4JHDA 2P9PB 4JKEA 4OKKA 5AQNA 1S9GA 4AHTA 3KKSA 3ZEUA 4FM0A 3E01A 3O1WA 4ICLA 1OH5A 4DUYK 1RCHA 3K5LA 4DV5K 1VQ5N 1D5AA 4NLBA 4BDZA 3MCPA 1JLAA 3O9QA 4CJTA 4JYAK 3KTQA 3C7NB 3ULEB 3SYZA 4JI2K 3PIOL 2G8KA 3MK6A 1RT1A 1TAQA 4DU3A 1T7PA 3CQXA 3VETA 3QO9A 3EN9A 1HRHA 1J5EK 4LY7A 4B9NA 4FJ8A 4M3WA 2OANA 3GOIA 3KHYA 4WF9L 3QBXA 1CZ9A 2QWPA 1DEJA 1GLFO 4J2EA 3MDQA 1RT3A 3H08A 4AM6A 3CMAN 2JGUA 5F1XA 3AGRA 3MEGA 1NGBA 4DLGA 2YHYA 2G8IA 5J1EA 3MXJA 3E66A 3UKUB 3L0QA 2HF3A 3QEXA 1XMOK 4DQQA 4J2BA 4PKHA 1NGCA 3RSEB 4KHNA 4H0TB 3ZT0A 4E19A 4F9OA 3D2EA 1ZBIA 2X6SA 5AQWA 4F3TA 3LPUA 3VQ5A 3CD6N 4NB4A 2A5XA 3NF9A 1NKBA 1X9WA 3NMUA 4JKAA 2HBMA 3R6MA 2HVHA 4OPKA 3C7NA 3HPOA 2Q31A 2RF2A 3R1XA 1NGGA 1KXPA 4FW2A 2CH5A 4BROA 4DTJA 1Q9YA 1Q8IA 5EX5A 4RWTA 1EETA 3OY9A 1D9FA 4HCCA 1B92A 3D6RA 2PFUA 3K5NA 2OTLN 1IBKK 3HPHA 1BIZA 5FDLA 1DTQA 1SV5A 4K42A 3HOSA 3HT3A 3QLHA 1K6YA 4LD0A 4OPAA 1NGHA 2XY7A 3SPYA 2O8DB 3AVKA 3SLCA 5J2MA 3O5BA 4FVUA 5C0YA 3CJCA 3ASMA 3MXMA 2A6AA 5AZJA 4CEQA 4NCGA 3KVGA 3LWMA 5JS1A 4KFBA 1KTQA 1JL1A 2W42A 4CF2A 5E26A 3BZCA 3U4LA 4CFDA 2BTFA 5D3GA 1VQ9N 3LANA 4DWIA 5F2RA 4G9ZA 1CLQA 1KLMA 1YI2N 2P5OA 1JLCA 1DLOA 4MDAA 4UY8O 2E8AA 3ZEUB 4KBOA 2JWLA 2GEMA 4X66K 4ISGA 4F8RA 1P8ZA 3IAYA 3CCMN 3CCQN 4DSJA 4F3OA 3C0BA 4GVMA 2GUPA 3CIPA 5AJ3K 2ATQA 4AQYK 3H45C 3MWPA 4BRCA 2Q1NA 1HYVA 1GOBA 1ZBLA 1G15A 3SCXA 1A5XA 4LC9B 4FJXA 2OZMA 3AVMA 4O0JA 3ZX2A 4DR7K 2HMIA 2UU9K 3C94A 4NCBA 4KAZA 1IKXA 2E1ZA 1E4FT 4IFVA 4G1QA 4FOIA 3QICA 5KRSA 4FCYA 4M42A 2W41A 2HBJA 5JLHA 3OW2M 4BRKA 1C6VA 1NKEA 3KLGA 4CCHA 3WNHA 1HJRA 4CJLA 3AGKA 3M8SA 1T8EA 4WQ4C 4O8UA 5ADXA 2EHGA 2O8EB 2Q97A 1GLLO 3HVRA 2E20A 1VSHA 5AQUA 3RMAA 1W2BM 3AO4A 1NMDA 3KK1A 1WSHA 4BC5A 1S1WA 3THWB 2J4RA 1SS6A 2Q36A 1WUAA 5FPEA 3M5RA 2A42A 1NKCA 2GWKA 4CJFA 1Y97A 2Z1HA 3C6UA 3WT0A 5AQYA 4WQ4A 5AQVA 2ITMA 3L2WA 4ILJA 4M3RA 4I9LA 4I6MB 1JL2A 1C1BA 1TVRA 4AHRA 2JLEA 4H0YB 3I8DA 5ELZA 1YITN 4JKHA 1E3MA 2W40A 1HLUA 3EY1A 3SUNA 3KLIA 4CK2A 3OYGA 5M1PA 3VQDA 3CCVN 2PYLA 4UQGA 4BREA 3O9UA 1CZBA 4LF4K 3QFUA 1ASWA 4KH4A 2Q3SA 5FPDA 3IRXA 4QS7A 3SPZA 3QERA 1YUWA 1B9DA 5HP1A 1C0FA 3P38A 1ATNA 1S22A 4WQ5A 4IJNA 1VQ4N 4BR5A 3L3VA 3RR8A 2XHBA 4FZZA 2HBKA 2ZWHA 1Z25A 4HTLA 1VQ6N 4AILC 4DSLA 3C6TA 1GOCA 4IDKA 4BRGA 1HQUA 3MAQA 3EL2A 1ZBUA 3AA4A 1HPMA 2EX3A 3D2FA 3VENA 4AH9A 3TPQA 2XRIA 1VQ7N 4DTSA 2G8UA 4DUZK 1WSIA 3AV9A 4CJKA 1NJWA 4KB1A 4M63C 4BG9A 4B3OA 3W0LA 3VQEA 4IFEA 4LFBK 3K0SA 5GADP 4FWRA 2VWJA 2WUSA 1DGKN 1RDWX 2ASPA 3WXMB 4PHTX 3RSEA 5DM7L 4IOXA 3K9KA 2QWLA 4XH1A 4Q5VA 4QS9A 3D0PA 4EZ6A 4LF9K 1VQNN 2D4WA 4I6MA 3OS1A 3NDKA 1QQNA 2UXDK 2HNDA 4KB0A 2UXBK 4BWJA 1U48A 2F8SA 4BGBA 1UOCA 2E2NA 4BR4A 4K43A 1MWKA 3KZBA 3S41A 4E89A 3EE8A 3RVCA 2RHKA 4CF8A 2HHXA 5AQQA 3F9MA 3H46O 2FF6A 3VQ4A 1WAFA 5C2DA 5AQXA 2AA4A 1J6ZA 1GOAA 4Z94A 2X6NA 3O80A 4Q0BA 2RE2A 3G10A 4B9UA 3TAPA 5H1SQ 5C10A 4JS4A 4J2AA 4FJLA 1MDUB 5M1KA 3BP8A 1VSLA 2E6LA 4DR3K 3LDQA 3SBGA 2YKMA 3AA5X 3ATVA 4EHTA 4BRAA 3NH0A 4CFCA 5FPNA 3FZFA 5I9EB 1KAXA 2FBYA 3L4QA 5AQTA 3HRGA 3O9RA 3KLHA 1IBLK 4OGCA 1C1CA 1RTDA 1OVQA 5GAHP 3LAKA 4KO0A 3L3UA 4HCBA 5J2NA 4N56A 1O13A 4CJUA 1BCMA 2WBNA 1ZXOA 4EHUA 4FPBA 1CZAN 4DTNA 3CXCM 4FK0A 4LSLA 2NRZA 4XH5A 2QK9A 1S5JA 4OJRA 2IGIA 3VQ7A 2ZJPL 1QHAA 4AHSA 2DFFA 2P9KB 3A0IX 3MX2A 1WAJA 3ENBA 3HTVA 3QNNA 5A2QO 3CM6A 4BVPA 2BUPA 1J54A 1VAZA 3FR0A 4BRDA 4FWQA 4HVJA 3CETA 4W5NA 3AO2A 4CESA 4E7KA 2HB5A 1OH7A 2NRTA 3DRRA 4J8FA 3CYMA 2GV9A 3J7YP 1T6CA 5JLFA 3TWHA 1YIJN 1HYZA 2P9IB 5AZIB 4B08A 3GL1A 4W5RA 2KKZA 3PSIA 1NBWA 2CH6A 4FLZA 3VEWA 4AHVA 4FYDA 4YDUA 4FPAA 5FROA 1BL3A 2LSNA 1VQLN 3MX5A 2GTDA 3QEIA 2FSKA 3CC7N 4B8AB 4CJPA 1KAZA 1YVNA 1EP4A 3WEEB 4CHNA 2FSNA 3PX0A 4DR4K 3PO5A 4KV8A 1DTTA 1XQSC 5EXWA 1MWMA 4DSFA 3CC2N 4NLCA 4IG3A 2QWMA 2QTDA 4CGDA 1GLJO 3DXKA 3THXA 3C95A 3SJHA 4BC3A 1HJOA 3B8AX 3HVTA 2G8VA 4CBXA 5M1FA 1F21A 4FL9A 3G25A 1JLGA 4FW1A 4MDBA 3SUPA 4F4KA 1EWQA 2HHHK 3O4NA 3VQ9A 1VQON 4PL8A 3RR7A 1U47A 1HPZA 3E9OA 1QQMA 3J81O 3PLAA 1RBTA 3G6EN 4JN4A 3OYNA 4PQUA 1LV5A 4LSNA 3S9HA 1CXQA 1ATSA 3HOTA 4LH4A 3TTCA 1NK4A 3QB0A 5AFUH 2Q0UA 4EIAA 1VSMA 3SMSA 4JK7A 4CW7B 1XMQK 4C23A 4CEOA 4YFUA 3WXIA 4JI7K 2QWOA 3FE1A 1NU0A 4HWIA 5C15A 2DTUA 4JAXA 1VSIA 3OYDA 4H5RA 1SL2A 1YHQN 2QKBA 4WFAL 1TYQB 2O8FA 1NGJA 1FKPA 3SAGA 4E0DA 4GVEA 1NM1A 2D5RA 3BY5A 2KZZA 1NWKA 1C1AA 1QVFM 3R9PA 3V9SA 3TI0A 4O4GA 3VEXA 1C0GA 5BR9A 3LAMA 5FPMA 1YVUA 4FK4A 4JV5K 2IS3A 3OJUA 4CZJA 4AHCA 1HR0K 2FBTA 3CCEN 3H6EA 4B9QA 4DFMA 2YJFA 4K0KK 3EO3A 3JS6A 2R7YA 4OLBA 1RILA 3CHWA 3O6WA 1C0TA 2P9IA 3A2FA 3FZLA 3ZT4A 4JRPA 2F96A 1HX1A 1JLFA 4OX9K 3PY8A 4JKDA 2P9UA 1RT6A 3M1FA 1IG8A 4YNQA 2YNHA 1N6QA 2O8BA 3WNGA 5FLXO 5AQKA 4FOEA 5EVZA 3IS9A 1JCGA 4LH5A 1BA0A 4DFJA 2VWBA 1XI1A 2P9PA 4L3QA 4O55A 3ISNC 3WXKA 4KREA 1BI4A 5AQFA 1HYSA 4OKJA 3NE6A 1KSPA 3C6HA 1X9JA 4DF4A 3HM9A 3E9LA 5TKYA 4K8XA 3ALYA 4H8KA 2BGGA 2P9SA 3J7ZO 1BO5O 4GV6A 3CM5A 2IIRA 4CHYA 4GW6A 3VTIA 3NGIA 3MN9A 5C42A 4WCEL 4JEPA 1HNIA 2HHUA 3CFRA 4GKJK 4PUOA 4QCLA 3CQ8A 4DV2K 4H5TA 2HHTA 4CHQA 4JI8K 4CGJA 2YCHA 3THWA 2W6KA 2Z1JA 4EZ9A 3P31A 4YORA 1REVA 4M3UA 4GY2B 4NO7A 1BUPA 1QSSA 2YNGA 3OS2A 4FVMA 3WQTA 3UKRA 5CYMA 2E88A 4X62K 2GELA 3QDKA 4C8OA 3OJSA 1EO1A 2YNFA 4EP5A 1S1UA 3LZJA 1BIUA 2DPNA 4Z4IA 3NF7A 1BA1A 3IFRA 5AQIA 1GLCG 3ENOA 1VQ8N 1J9AA 5HRPA 4DU4A 3DWLA 5KPZA 4A57A 1A5VA 4CHOA 4CZEA 2VQFK 1NNEA 1FK9A 4CIFA 5BPNA 4DKWA 3DYAA 1WN7A 5KI6A 3NH1A 3NAEA 4E7JA 4TSXA 2NRXA 4RG8A 3ZETA 4OKEA 4LF5K 5AQMA 1K73O 4O44A 4DF8A 2IVNA 4C8MA 2YNIA 2DFHA 1W7AA 2A3ZA 2VQEK 3OYIA 3HK2A 3S3OA 3HI0A 2JWKA 2HOEA 1SAZA 3O9TA 3LDPA 4YOXA 4Y1DA 4M3XA 3O3HA 2QXLA 1WB9A 5EU7A 3HO1A 2P9UB 4XIUA 3ZETB 4EAHD 5M1OA 1WBDA 3I56N 2O8FB 4A59A 4CECA 3ZSRA 2HHVA 1YJ9N 4I7FA 3SI6A 4E7LA 4YOVA 4M3TA 4YOWA 2QA4N 3VF6A 4DR6K 2D0AA 3GG4A 2AJQA 1S72N 5TKWA 4QAGA 3SQ1A 1TUYA 1N33K 3CCSN 1TK0A 1GLDG 2OPRA 3P1GA 2G8FA 2YHBA 3VEVA 4KHUA 1RT5A 4MFBA 5KTQA 2B4JA 1BWFO 4DB3A 1C0UA 2IC3A 3FZHA 1L3SA 3DAWA 4DV0K 4H5WA 2ZF5O 1CXUA 3NFAA 4CZLA 3THYA 4CJQA 4JKGB 3D2EB 5BN9A 3CC4N 4BQLA 3UIQA 1YF5L 2PZSA 5LY3A 1BDGA 3WUHA 4BC2A 4XH4A 5BRDA 1MU2A 1K8AO 4YY3K 1Z6RA 4AHUA 1J5OA 1IV0A 3VQQA 3LDOA 4FWMA 4PL7A 5JMVA 1ZBHA 4BRNA 1WLJA 1WSEA 2YX6A 4CF1A 2WFBA 2A41A 4I2PA 1U6ZA 4JHDB 3MECA 1RTHA 1SKRA 2F4VK 1RDDA 4KTZA 4BDPA 3O08A 2V52B 2HW3A 1C0MA 3OYHA 2P9LB 3OS0A 3TSPA 3LM2A 1U2VA 2NRWA 3M3ZA 4L8RB 3FZMA 4HUGA 2QXFA 3AVLA 4JKBA 4KHQA 4OO1J 3KLFA 4R5PA 2H3GX 3MEEA 1NG9A 3SMPA 1QZ6A 1QQOA 5HRRA 1X9MA 3VPZA 3DMJA 1BI4B 1YJWN 3D45A 4DQIA 4PKGA 3NGYA 4PA1A 2NNWA 3B6OA 3P4IA 2VG5A 2A1SA 1UAXA 1H1VA 3BEXA 3MEDA 3ZLJA 4GV9A 3CQYA 1WBBA 5CZ2A 1LCUA 4RW7A 2O8CA 3BF3A 3OBYA 3AARA 3SJJA 4ZTFA 3P83D 3F73A 4J2DA 4B9VA 3IUCA 3W3DA 3V1RA 1XC9A 1SL1A 5AQPA 3OA9A 3EYZA 4R79A
chains in the Genus database with same CATH topology
1T6CA 5JLFA 1YIJN 2FF3B 1NJIO 1N8RO 3H1QA 2P9IB 5AZJB 5AZIB 3CCLN 3GL1A 3VGKA 2KKZA 3R3LA 1NBWA 2CH6A 1Q18A 2ZJQL 2D0PA 3VESA 3VEWA 2F9TA 4YOUA 4YDUA 4U7BA 2NRRA 1HUXA 4FPAA 5EOYA 4H0VB 2VYPA 4BR9A 3L4IA 5BPMA 3VF4A 3VEYA 1VQLN 5EY4A 1YXQA 2NRHA 3NVKA 3MX5A 4JHDA 2GTDA 2P9PB 4JKEA 5AQNA 2FSKA 5CR4A 3VGLA 5AQGA 3CC7N 4FWKA 4BVOA 3ZEUA 1KAZA 1YVNA 3O1WA 4H5VA 3GBTA 5AR0A 3TSQA 5BRFA 3WEEB 3CMEN 2FSNA 3GE1A 1VQ5N 4A2AA 4NLBA 2FLOA 1XQSC 3C6AA 3MWTA 4BRLA 5EXWA 1MWMA 1T3VA 3MCPA 2QWQA 3O9QA 3CC2N 4NLCA 1G99A 2QWMA 4JK9A 4CZHA 2QTDA 1JCFA 3C7NB 1GLJO 2HF4A 3ULEB 3DXKA 3VERA 3PIOL 3SJHA 3VGMA 3MK6A 1HJOA 3A5MC 3B8AX 4BC3A 3AAPA 5AQRA 4YOYA 3CJBA 4WFBL 3VOVA 4CBXA 5M1FA 3CQXA 5GIPA 4H0PA 4MO4A 1P90A 5AFUA 4FL9A 3G25A 5C2FA 3VETA 4CD3A 4MDBA 3EN9A 3LDLA 3R8EA 4B1UB 3I33A 1VQON 2PAVA 1ILYA 2NRVA 4PL8A 2OANA 1ZC6A 1K9MO 5AQJA 1BOTO 3GOIA 2CGKA 3HSCA 3KHYA 5B8HA 3E9OA 1QQMA 3QBXA 4WF9L 3PLAA 2QWPA 3SAHA 3G6EN 4JN4A 3MN7A 5KPTA 1DEJA 3HZ6A 3H3OB 4OPHA 4B1VA 5GAGP 1ATSA 3U8XA 3HOTA 1GLFO 3Q7CA 3TTCA 3MDQA 1IJJA 3QB0A 4AM6A 4K41A 3CMAN 5AFUH 2D0OA 5F1XA 2Q0UA 3AGRA 4H0OA 3TSUA 4EIAA 1NGBA 3SMSA 2D1KA 2YHYA 1OVYA 4JK7A 5BRHA 2FXUA 2E2PA 3E66A 4JNEA 1XUPO 3UKUB 4C23A 3WXIA 3L0QA 2HF3A 2QWOA 3FE1A 4PKHA 1NGCA 2V51B 3RSEB 4H0TB 4F9OA 4HWIA 2HMPA 5C15A 4BRHA 3D2EA 2P9NA 4JAXA 4CZKA 5JVHL 4H5RA 5AQWA 4MO5A 1GLBG 1XC3A 4NB4A 4CI6A 2A5XA 3L6QA 4GNIA 4WFAL 1YHQN 1TYQB 3CD6N 3NMUA 4JKAA 1NGJA 3SAGA 1EQYA 2HBMA 3R6MA 2V7ZA 4BC4A 4GVEA 3UKUA 2OTJN 3C7NA 3MMVA 3I8BA 1NM1A 1NWKA 4JK8A 2Q31A 3CJAA 3R1XA 1NGGA 1KXPA 3TTFA 2CH5A 3R9PA 4BROA 1QVFM 4H0XB 3VEXA 5AQZA 1C0GA 5GINA 5EX5A 5BR9A 5FPMA 4RWTA 3VMFB 3D6RA 4CZJA 2YHWA 2PFUA 2OTLN 3CCEN 3H6EA 4B9QA 3NVMA 3IKMA 2YJFA 1M1KO 4K42A 1BU6O 3HOSA 4O8KA 2VCPA 4OPAA 1NGHA 3O4WA 3KK7A 4A62A 4K25A 3EO3A 3HBTA 3JS6A 1Q81O 3N4PA 3SLCA 4BR7A 3CHWA 3O5BA 3E9PA 3O6WA 4FVUA 4IO8A 4B1ZA 5C0YA 4CZMA 1OKJA 3CJCA 4JKCA 2A6AA 2P9IA 5AZJA 3FZLA 2KLAA 4IZ9A 3KVGA 1RDUA 2UYTA 1HX1A 5E26A 4ILGB 3ULEA 4Y0WA 3U4LA 4MLHA 1TUUA 2BTFA 1LOTB 3VTHA 4BR0A 4JKDA 3PIPL 2P9UA 1VQ9N 3M1FA 3U9DA 1IG8A 2I7NA 3A5LC 3MN5A 5F2RA 4G9ZA 1YAGA 1YI2N 4MDAA 5AQKA 4UY8O 2E8AA 4FOEA 3ZEUB 1YJNN 3D2FB 5EVZA 3OBWA 4M7YA 1JCGA 3VEOA 4KBOA 2JWLA 2GEMA 4BRPA 1BA0A 4ISGA 2VWBA 3ENHA 2E2QA 2P9PA 4MLEA 3UE5A 1KC8O 1P8ZA 3IMXA 3CCMN 3CCQN 3BF1A 4L3QA 4YOTA 4BGAA 3WXKA 5AQFA 4IJAA 3C0BA 2GUPA 4CBUA 3CIPA 3C6HA 2ZJRL 1X9JA 4C1NK 3H45C 4QS8A 4IWVA 1NLVA 4E1JA 3MWPA 4BRCA 2IVPA 3CCUN 1HKCA 5HOOA 2Q1NA 1RFQA 1KQSM 3E9LA 5TKYA 4A5AA 4A5BA 4LC9B 5E84A 5CHIA 4JD2B 2AP1A 4DCHA 1D4XA 4DQ8A 4BQZA 3ZX2A 3ID6A 1NGEA 1T6DA 2E1ZA 1E4FT 1NGAA 2IVOA 2P9SA 4CD1A 1ESVA 3J7ZO 1BO5O 2I7PA 4GV6A 2IIRA 4FOIA 5AQOA 2WC9A 3QICA 3VTIA 5LJVA 4FO0A 3FFKB 3MN9A 3LM9A 3P39A 2W41A 4WCEL 2HBJA 5JLHA 4JEPA 3OW2M 5AQSA 3DXMA 4FWOA 4BRKA 1X3MA 4GV3A 4CJ7A 1K8KA 2YHXA 3Q7BA 1BG3A 5C12A 5M1NA 5DM6L 3DLLL 4H5TA 2P9SB 4IO9L 3AGKA 4JKGA 4WQ4C 4IOAL 3UKRB 4O8UA 5ADXA 3G71N 2Q97A 1GLLO 1U2VB 3U9ZA 4A2BA 3QMLA 2P9LA 2YCHA 3CCJN 4BRIA 1RGIA 2E20A 5AQUA 3P31A 1W2BM 4YORA 2V7YA 1NMDA 4JD2A 4U67L 4GY2B 4NO7A 1BUPA 4BC5A 2EWSA 2J4RA 3ATUA 1SS6A 4ISFA 4IXCA 3WQTA 1NGDA 3UKRA 4B1YB 2Q36A 2E88A 1WUAA 5FPEA 3M5RA 4O5FA 2A42A 2GELA 3ID8A 3QDKA 4M7XA 1EO1A 2GWKA 4BRFA 3KWIA 1K8KB 4H03B 3WT0A 5AQYA 2DPNA 3CPEA 2FSJA 4WQ4A 5AQVA 2ITMA 3HM8A 4ILJA 3DXMB 3N4QA 1BA1A 2PBDA 2QWNA 3IFRA 1R59O 3E1YA 2HBLA 3O9SA 4I6MB 5AQIA 1GLCG 2KHOA 3ENOA 1VQ8N 3DWLA 5KPZA 4H0YB 5LJWA 2GX9A 4A57A 1KD1O 3TTDA 5ELZA 3DJCA 4JKHA 4CZEA 1YITN 3D7EO 4FWLA 2W40A 3UB5A 4IOCL 2QM1A 3O8MA 1HLUA 4WQ5C 5CE3A 2QWRA 4CZGA 4YDUC 5BPNA 3A5NC 5M1PA 4DKWA 3M6GA 2GWJA 4BR2A 3CCVN 4BREA 3O9UA 3JXUA 4DHYA 2NRXA 3ZETA 3CJ7A 1NGIA 3QFUA 4KH4A 2Q2RA 5AQMA 1K73O 2QEXN 2IVNA 3ZYYX 3MN6A 3EE9A 4QS7A 5FPDA 1YUWA 1ZBSA 2A40A 4BY9C 1M90O 4BRQA 4RCHA 1C0FA 3P38A 1ATNA 1S22A 4WQ5A 1T44A 2A3ZA 4IJNA 4BR5A 3CJ1A 1VQ4N 4PKIA 2HBKA 2ZWHA 4HTLA 3SBTA 1VQ6N 4ISEA 3HI0A 3CERA 2JWKA 2HOEA 1SAZA 3O9TA 4BRGA 3CCRN 3EL2A 1HPMA 3D2FA 3CPWM 3VENA 3A8YA 3LDPA 4IEIA 3TPQA 4YOXA 4FWSA 1GLAG 1VQ7N 5GIOA 1JCEA 5KPRA 5BN8A 4AF1A 2QXLA 3K9JA 4A61A 2P9UB 5KQDA 2Q0RA 3ZETB 3EKUA 3H3NO 4EAHD 3A5OC 5M1OA 3I56N 4XEIA 4KH5A 3OHRA 3H1VX 4M63C 4A59A 4BG9A 1Q82O 1Q86O 3W0LA 1V4TA 2YI1A 4IFEA 5AQLA 1YJ9N 5GADP 4FWRA 2P9NB 2VGNA 2WUSA 1DGKN 1RDWX 4YOVA 2ASPA 4YOWA 3WXMB 2QA4N 3VF6A 4PHTX 3GG4A 1ATRA 3RSEA 4CBWA 5DM7L 1W97L 5HL7L 3AY9A 4IOXA 1S72N 1VQMN 5TKWA 3K9KA 3IDHA 2QWLA 4XH1A 4QS9A 1TUYA 2QI2A 4FWNA 1VQNN 5KQ8A 4IDHA 2D4WA 4I6MA 1Y64A 3BUZB 2NLXA 4CZFA 1HKGA 1QQNA 3TU5A 3CCSN 1GLDG 3LL3A 4BGBA 3VEVA 1X3NA 3SK3A 3F2KA 2E2NA 4BR4A 4K43A 4RTFD 1MWKA 3WQUA 4WFNL 1BWFO 3KZBA 5JVGL 1HKBA 3S41A 3ZX0A 4DB3A 3EE8A 3RVCA 2RHKA 3VF2A 3F5TA 5AQQA 2E2OA 2E1YA 5MLCQ 3F9MA 3H46O 3FZHA 2FF6A 2YJEA 1TYQA 2ASOA 2CGLA 3DAWA 3QFPA 4H5WA 2HSTA 3FGUA 2ZGYA 5C2DA 3CJ9A 2ZF5O 3GDQA 5AQXA 4CZLA 2AA4A 1J6ZA 2ZGZA 2VGMA 4JKGB 1V4SA 3D2EB 4Z94A 3CF5L 3WXLA 3O80A 2RE2A 5BN9A 5JICA 4FWPA 3CC4N 4BQLA 1DT9A 1YF5L 3DXKB 4BRMA 5H1SQ 4EFHA 3ZX3A 5LY3A 4B1WB 1BDGA 3WUHA 5C10A 4BC2A 4XH4A 5BRDA 1JJ2M 1MDUB 4BG8A 5M1KA 3BP8A 1K8AO 2F7TA 1Z6RA 5M1QA 3LDQA 3LDOA 3SAFA 3SBGA 4FWMA 1NGFA 1KAYA 1VQKN 3ATVA 4PL7A 4EHTA 4BRAA 5JMVA 4BRNA 2YX6A 5FPNA 2WFBA 3FZFA 2A41A 5I9EB 1KAXA 2ASMA 1VQPN 3L4QA 3CI5A 3G4SN 1GLEG 1U6ZA 4JHDB 3C65A 5AQTA 4B1XB 3HRGA 3O9RA 3FLCO 1Z05A 4CZIA 3O08A 2V52B 5AQHA 1Q7YO 5GAHP 3EKSA 3MCAB 2P9LB 3TSPA 3LM2A 1S3XA 1U2VA 2NRWA 1WOQA 3J8AA 3M3ZA 1O13A 3FZMA 3O1BA 5BPLA 1QVGM 2WBNA 1ZXOA 4JKBA 5AZIA 4EHUA 4FPBA 1CZAN 4WYBA 1SQKA 4OO1J 2H3GX 3LDNA 3CXCM 3SMPA 3VEZA 1QZ6A 1QQOA 3FZKA 2NRZA 4XH5A 3AAQA 5BREA 1QZ5A 3VPZA 2CGJA 5ADXH 1YJWN 2ZJPL 4PKGA 4KH6A 1QHAA 1E4GT 2NNWA 4ILHA 1DKGD 3P4IA 4H5NA 3I55N 3QBWA 3T7ZA 2P9KB 3BEXA 1H1VA 3A0IX 3MX2A 3WEEA 3WXJA 4AM7A 3CQYA 4GV9A 3ENBA 1SZ2A 3HTVA 4IEEA 1LCUA 4BVPA 2BUPA 2F9WA 1VAZA 3BF3A 4C1NI 3FR0A 4BRDA 3OBYA 2BH1A 2P9KA 3AARA 4FWQA 3T69A 3CETA 3KWGA 3EZWA 4JKFA 3IUCA 3W3DA 2NRTA 4FSVA 5GAEP 5AQPA 4J8FA 1MA9B 2NZTA 5F0XA 3OA9A 2QW9A 4R79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Q A;  4IOX A;  3N4P A; 
#chains in the Genus database with same CATH topology
 1N8R O;  3AVC A;  1ZYQ A;  2KTQ A;  1LW0 A;  4ELU A;  1WSJ A;  1FXX A;  4HTU A;  1SKW A;  2P51 A;  4KHY A;  2F9T A;  2Y1J A;  3CFP A;  4H0V B;  2VYP A;  1UA0 A;  2NRH A;  3PSF A;  3LDS A;  3LPT A;  1NK0 A;  5CR4 A;  3MXI A;  1OH6 A;  4FWK A;  4BVO A;  4H5V A;  3TSQ A;  3GBT A;  5AR0 A;  5BRF A;  3GE1 A;  2FLO A;  3OYK A;  3C6A A;  3SQ0 A;  3VN5 A;  3J7A P;  2DFE A;  1BIS A;  1T3V A;  1G99 A;  4BE2 A;  1JCF A;  1X9S A;  3S3M A;  3AVG A;  3A5M C;  4YOY A;  3CJB A;  3VOV A;  4H0P A;  4MO4 A;  5AFU A;  3VQP A;  4CJW A;  3R8E A;  1JLE A;  4B1U B;  1ILY A;  2NRV A;  1K9M O;  1ZC6 A;  2YV0 X;  4DS5 A;  4JRQ A;  4FLY A;  5AQJ A;  1YTU A;  1BOT O;  3HSC A;  5B8H A;  3SAH A;  5J2Q A;  4CVN E;  4YHH K;  3QES A;  3MN7 A;  2B5J A;  3SV3 A;  3HZ6 A;  4LF7 K;  4B1V A;  3NF8 A;  3Q7C A;  3TAM A;  4DTM A;  4FK2 A;  2GUI A;  1IJJ A;  4N76 A;  4C8N A;  2HNZ A;  2RN2 A;  4K41 A;  4O0I A;  2D0O A;  3OTO K;  4H0O A;  5LMN K;  1BGX T;  2D1K A;  3OYF A;  3HP9 A;  1OVY A;  1KLN A;  1XUP O;  3V9Z A;  3O3G A;  1WSG A;  4I9Q A;  4OGE A;  4Z4H A;  3SQ2 A;  1A5W A;  2HMP A;  3NGZ A;  4CFA A;  5JVH L;  1NJZ A;  3I0S A;  1KVB A;  3OYB A;  1XC3 A;  4CI6 A;  4GNI A;  1QHT A;  4Z4E A;  1EQY A;  1NK6 A;  4OLA A;  2V7Z A;  3VQA A;  2OTJ N;  1BCO A;  4JK8 A;  4JI3 K;  3CJA A;  3TTF A;  5LMU K;  2X74 A;  4H0X B;  5GIN A;  3WNE A;  3M8Q A;  2XY5 A;  3DRS A;  4FLW A;  3AVJ A;  5IWA K;  3NVM A;  4GKK K;  4GMJ B;  1BU6 O;  4O8K A;  1U45 A;  2VCP A;  4CJR A;  3NF6 A;  3O4W A;  4CEB A;  1IKY A;  1Q81 O;  3N4P A;  2IOC A;  3SZ2 A;  3E9P A;  1U4B A;  4CJV A;  2Y1I A;  4IO8 A;  4B1Z A;  4CZM A;  1OKJ A;  2P5G A;  1XHZ A;  4FJ7 A;  4ZHR A;  2KLA A;  4MQ3 A;  3THX B;  4E1M A;  3OYC A;  4ILG B;  4Y0W A;  3OYL A;  1TUU A;  1FJG K;  1LOT B;  3VTH A;  2XO7 A;  3DLK A;  3U9D A;  2I7N A;  3A5L C;  1YAG A;  4CEF A;  1LWE A;  3L2R A;  3WNF A;  4ID1 A;  3PV8 A;  3VEO A;  4M7Y A;  4DV3 K;  4MLE A;  3UE5 A;  2E2Q A;  3KIO A;  3J80 O;  3IMX A;  4BGA A;  4Z4F A;  3RRG A;  4CEE A;  2OPS A;  1D9D A;  4QS8 A;  4FLU A;  4CIG A;  3CCU N;  1HKC A;  1RFQ A;  4M41 A;  3QET A;  1KQS M;  4B9S A;  1Z26 A;  2E6M A;  3QIN A;  1WSF A;  4DQR A;  3VQB A;  3CG7 A;  4A5B A;  3VA3 A;  1XNQ K;  4FJM A;  1D4X A;  5E41 A;  4DQ8 A;  1TV6 A;  3K58 A;  4I2Q A;  1I94 K;  4W5T A;  1NGE A;  3HJF A;  1T6D A;  3DLG A;  1NGA A;  2IVO A;  4CD1 A;  2WC9 A;  1ASU A;  3LM9 A;  3P39 A;  1EWR A;  4WE1 A;  4GV3 A;  4M3Z A;  4CJ7 A;  2YHX A;  3Q7B A;  4H4M A;  5C12 A;  5DM6 L;  3DLL L;  4KHP K;  1B9F A;  4IO9 L;  3UKR B;  2WTU A;  3G71 N;  5CY4 A;  3NCI A;  3ZSV A;  4A2B A;  1U2V B;  3CCJ N;  3ULD A;  3DLE A;  4CER A;  3AA3 A;  2BE2 A;  3ATU A;  4M45 A;  4ISF A;  3VQ6 A;  1IO2 A;  4IXC A;  2KQ2 A;  4IKF A;  1NGD A;  3L2Q A;  4KKO A;  5HRN A;  4O5F A;  1D8Y A;  4M7X A;  3ID8 A;  5IT9 O;  1KCF A;  3KLE A;  4O5B A;  1LW2 A;  3HM8 A;  4CHZ A;  3P5J A;  1T05 A;  2PBD A;  1R59 O;  1VK0 A;  1VSK A;  2KHO A;  1JKH A;  1NOY A;  5LJW A;  2GX9 A;  3HYF A;  1KD1 O;  3TTD A;  3VQC A;  4DMN A;  4FWL A;  4BWM A;  3UB5 A;  1ZBF A;  2QM1 A;  4WQ5 C;  5CE3 A;  2QWR A;  4CZG A;  1SKS A;  3THY B;  4NYF A;  4BR2 A;  5C25 A;  1L5U A;  4B9L A;  3JXU A;  4DHY A;  3CJ7 A;  1NGI A;  3RRH A;  2QEX N;  2VG7 A;  4FJG A;  4KPY A;  3ZYY X;  3EE9 A;  4BY9 C;  1M90 O;  4BRQ A;  4RCH A;  2XY6 A;  4KRF A;  1IH7 A;  3CJ1 A;  4CF9 A;  4PKI A;  3AVA A;  4ISE A;  4PY5 A;  1XNR K;  4CEA A;  1NK5 A;  4CED A;  4KHS A;  3A8Y A;  1S9E A;  3L2V A;  4FWS A;  5GIO A;  1JCE A;  5KPR A;  5BN8 A;  2OCE A;  3S3N A;  3V81 A;  3EKU A;  3A5O C;  4CJ4 A;  3OHR A;  4E3S A;  4CGG A;  1V4T A;  1QQC A;  4FJJ A;  3LZI A;  1VSE A;  4CE9 A;  2P9N B;  3OYM A;  1EX4 A;  1ATR A;  4CBW A;  1W97 L;  5HL7 L;  3AY9 A;  1VQM N;  2Z1G A;  4JLH A;  3OYJ A;  1S1T A;  1JLB A;  5KQ8 A;  3ZSQ A;  1Y64 A;  4IBN A;  2NLX A;  1HKG A;  1RT2 A;  1L3V A;  2FC0 A;  3LL3 A;  1X3N A;  2OYQ A;  2ZQB A;  4RTF D;  1RBS A;  3ZX0 A;  4DV6 K;  3VF2 A;  4JS5 A;  1NK9 A;  3AVF A;  2E2O A;  3QEW A;  2E1Y A;  5MLC Q;  3V4I A;  1QTM A;  2YJE A;  2ASO A;  2CGL A;  2HST A;  1LWF A;  3DOK A;  2ZGY A;  2G8W A;  3CJ9 A;  1KFD A;  3GDQ A;  1L3T A;  4DR5 K;  2VGM A;  3WXL A;  5JIC A;  1EKE A;  1DT9 A;  3DXK B;  4EFH A;  4DTO A;  3JSM A;  4B1W B;  4N41 A;  3SNN A;  4CK3 A;  4NCA A;  5HLF A;  1QS4 A;  2F7T A;  4JI0 K;  3SAF A;  1HNW K;  1KAY A;  1VQK N;  1TAU A;  1VQP N;  3CI5 A;  3G4S N;  4DQS A;  4JI5 K;  3C65 A;  4KI4 A;  4Y1C A;  1U04 A;  3EEQ A;  4ELT A;  4FJK A;  3DLR A;  1Z05 A;  4CZI A;  1BQN A;  1R0A A;  1N5Y A;  1XWL A;  1Q7Y O;  5SZT A;  3EKS A;  3KK2 A;  3AVB A;  3LWL A;  1S3X A;  3J8A A;  3BDP A;  4RW4 A;  2WOM A;  3O1B A;  5KGW A;  5BPL A;  4DTX A;  2ETJ A;  5AZI A;  4WYB A;  1SQK A;  4JI6 K;  3NBP A;  3LDN A;  3PUF A;  3VEZ A;  3FZK A;  2KFN A;  3AAQ A;  4FZY A;  4Z0U A;  5BRE A;  2IAJ A;  3ZSY A;  5ADX H;  3NHG A;  5K14 A;  1IKV A;  2UUA K;  3QBW A;  3DOL A;  3T7Z A;  3WXJ A;  3WEE A;  4AM7 A;  4CK1 A;  1SZ2 A;  3QIP A;  1S1X A;  1RTI A;  4C1N I;  3QEP A;  1TK5 A;  2BH1 A;  2P9K A;  4ZTJ A;  3DLH A;  3T69 A;  1IG9 A;  4JKF A;  3SQ4 A;  2F8T A;  1UA1 A;  4FSV A;  5GAE P;  4Z4C A;  1HNX K;  4E7I A;  4DSK A;  3RMB A;  1NJI O;  4BE1 A;  4FLT A;  3H1Q A;  3ZSZ A;  1KFS A;  1W0H A;  3VGK A;  3R3L A;  4IFY A;  1Q18 A;  3KKR A;  2D0P A;  2X78 A;  1TKD A;  4Z4G A;  2VWK A;  4B9T A;  3K5O A;  1HUX A;  5EOY A;  4B8C A;  5DMR A;  5BPM A;  3BGR A;  3VEY A;  3NVK A;  4C8K A;  4KTW A;  1WNS A;  4DR1 K;  4B3S K;  2ZM6 K;  3VGL A;  1KVA A;  5AQG A;  1LWC A;  3CME N;  2I5J A;  1OH8 A;  2O8B B;  3U3G A;  4A2A A;  3OYA A;  1VSF A;  3MWT A;  4BRL A;  3TAQ A;  2QWQ A;  4JK9 A;  4CZH A;  3TR8 A;  2WON A;  2P1J A;  2HF4 A;  3VER A;  3VGM A;  3AAP A;  5AQR A;  4WFB L;  5GIP A;  5C2F A;  1P90 A;  4CD3 A;  4DR2 K;  4B3M K;  3LDL A;  1Q9X A;  1BHL A;  3M8R A;  3I33 A;  2PAV A;  3T1A A;  1VSD A;  2O8D A;  2OPP A;  5CZ1 A;  2CGK A;  3DM2 A;  3VA0 A;  4DLE A;  1IKW A;  5KPT A;  4M3Y A;  3H3O B;  3ZSW A;  4OPH A;  1T03 A;  5GAG P;  3U8X A;  3LAL A;  3L8B A;  2KW4 A;  4F2R A;  2Z1I A;  1NOZ A;  3V9U A;  4B9M A;  3TSU A;  3L2U A;  1RNH A;  4DFK A;  5BRH A;  4QOZ B;  2FXU A;  2E2P A;  1TGO A;  4JNE A;  3ZSX A;  1J53 A;  1TL1 A;  1RBR A;  2V51 B;  4FM2 A;  4NXM K;  4DTU A;  4BRH A;  2P9N A;  4CZK A;  3T19 A;  4FJI A;  4MO5 A;  4N47 A;  3M8P A;  4DV7 K;  4E7H A;  1GLB G;  3L6Q A;  4JI4 K;  4W5O A;  4B3R K;  4BC4 A;  4FLX A;  2HVI A;  3UKU A;  3MMV A;  3I8B A;  1TL3 A;  3ITH A;  2D0B A;  1KRP A;  3JYT A;  4RW9 A;  5AQZ A;  4W5Q A;  3VMF B;  2YHW A;  1TKT A;  1XHX A;  3IKM A;  1M1K O;  4FJ9 A;  1BQM A;  1I3A A;  1KVC A;  4RW8 A;  3K59 A;  1IBM K;  4A62 A;  1RBU A;  3KK7 A;  4K25 A;  1JLQ A;  3HBT A;  1JXB A;  4BR7 A;  4RW6 A;  3B6P A;  2HHW A;  3QNO A;  1NJX A;  4JKC A;  3RWU A;  2HHS A;  1L3U A;  3TAR A;  2VG6 A;  4IZ9 A;  4NYN A;  1RDU A;  2UYT A;  1O1W A;  3AO1 A;  4FM1 A;  3ULE A;  4MLH A;  3ZT1 A;  4BR0 A;  3PIP L;  3AVI A;  3FFI A;  3HST B;  3QEV A;  3MN5 A;  3QIO A;  5HRO A;  3U6F A;  1W9H A;  1YJN N;  3D2F B;  3OBW A;  4DV1 K;  4BRP A;  2DY4 A;  1TKX A;  4BAC A;  3LP3 A;  3ENH A;  3U3Y A;  1KC8 O;  3VQ8 A;  3AA2 A;  3BF1 A;  4YOT A;  1HNZ K;  3AVH A;  4IJA A;  3V1Q A;  4CGI A;  4CBU A;  2OPQ A;  1I39 A;  2ZJR L;  4C1N K;  4KI6 A;  2YHA A;  3HXM A;  4IWV A;  1NLV A;  4E1J A;  2IVP A;  1SL0 A;  4PWD A;  5HOO A;  1HMV A;  4OPJ A;  4A5A A;  4CJ3 A;  3KD1 E;  5E84 A;  5CHI A;  3NH2 A;  4JD2 B;  3AO3 A;  2AP1 A;  2O4G A;  4DCH A;  2KZM A;  1N34 K;  4BQZ A;  3ZT3 A;  4OVL A;  3ID6 A;  2IDO A;  3OYE A;  1HQE A;  1ESV A;  2I7P A;  5AQO A;  5LJV A;  4FO0 A;  3FFK B;  2KFZ A;  2BAN A;  3RMD A;  5DK5 A;  5AQS A;  3DXM A;  3LP1 A;  4FWO A;  1X3M A;  1VHX A;  1K8K A;  2UUC K;  1BG3 A;  5M1N A;  3TAF A;  2A1R A;  2P9S B;  1NJY A;  4JKG A;  1QSL A;  2PY5 A;  4IOA L;  1ASV A;  3U9Z A;  3QML A;  2P9L A;  3K5M A;  2B6A A;  4BRI A;  1RGI A;  3V6D A;  2V7Y A;  4JD2 A;  4U67 L;  2EWS A;  3IG1 A;  4FJ5 A;  4B1Y B;  3ZSO A;  1N32 K;  4HUF A;  3HPG A;  4DTR A;  4CJS A;  4CJE A;  3V9X A;  2QKK A;  3EZ5 A;  4BRF A;  3KWI A;  1VRT A;  1K8K B;  1RT4 A;  4H03 B;  1QE1 A;  2FBX A;  3CPE A;  2FSJ A;  3LP0 A;  2XY8 A;  3DXM B;  3N4Q A;  2QWN A;  3O9S A;  1Q82 O;  3E1Y A;  2HBL A;  4HUE A;  1Q86 O;  1RDC A;  2W6L A;  4BE0 A;  5KGX A;  5FRN A;  4E1N A;  3DJC A;  4CFB A;  3D7E O;  4IOC L;  3O8M A;  1U49 A;  5T7B A;  3ZT2 A;  4YDU C;  4CJ5 A;  3A5N C;  1RDA A;  3M6G A;  2GWJ A;  4FZX C;  1QSY A;  4H4O A;  2Q2R A;  3TAE A;  1YTA A;  2G8H A;  3MN6 A;  4ID5 A;  1ZBS A;  1X1P A;  2A40 A;  1RDB A;  1RTJ A;  4CGF A;  1T44 A;  4LF8 K;  1NK7 A;  3THV A;  3SBT A;  1UWB A;  4DQP A;  3CER A;  3ZCM A;  5C24 A;  3RTV A;  3CCR N;  3CPW M;  2E5L K;  4IEI A;  1VSJ A;  5FRM A;  1GLA G;  4BDY A;  4AF1 A;  4EP4 A;  3K9J A;  4A61 A;  5KQD A;  2Q0R A;  3SV4 A;  3H3N O;  3SUO A;  3AO5 A;  4XEI A;  4KH5 A;  3LP2 A;  3H1V X;  2D0C A;  2YI1 A;  5AQL A;  4CGH A;  1ITG A;  2VGN A;  3T1H K;  1N36 K;  4B3T K;  1YT3 A;  4DS4 A;  3IDH A;  4KTQ A;  3T3F A;  3K57 A;  2QI2 A;  4FWN A;  1VRU A;  4IDH A;  2OA8 A;  3BUZ B;  1S6Q A;  4CZF A;  3TU5 A;  4V19 S;  3SUQ A;  5I3U A;  4FJH A;  5LL6 Z;  1EXQ A;  3SK3 A;  3F2K A;  4HHT A;  3F9K A;  4WFN L;  3CFO A;  3WQU A;  5JVG L;  2PYJ A;  1HKB A;  1SUQ A;  4KHW A;  1JXE A;  1RBV A;  3DI6 A;  3F5T A;  1HNV A;  3T1Y K;  1TYQ A;  3QFP A;  3FGU A;  3DRP A;  2O8E A;  4CEZ A;  1S1V A;  1FKO A;  2FBV A;  2ZGZ A;  1V4S A;  3CF5 L;  3OVN A;  3V9W A;  4FWP A;  5KRT A;  4DSI A;  4BRM A;  3ZX3 A;  3KJV A;  2ZE2 A;  1JJ2 M;  2UUB K;  4BG8 A;  3PX4 A;  1LAW A;  1NMN A;  2YKN A;  5M1Q A;  4DU1 A;  3I0R A;  1NGF A;  3V1O A;  4X64 K;  3AVN A;  4CHP A;  1RT7 A;  4NXN K;  3HP6 A;  1S6P A;  2ASM A;  1GLE G;  2HHQ A;  4B1X B;  4N5S A;  3FLC O;  4K8Z A;  5AQH A;  4LFA K;  3KD5 E;  3MCA B;  4LF6 K;  4DV4 K;  1WOQ A;  3BZK A;  5SWM A;  5CYQ A;  1QVG M;  3O3F A;  5J2P A;  3TAG A;  4DG1 A;  3KK3 A;  4X65 K;  5HBM A;  2ITG A;  3DLB A;  4ELV A;  1TKZ A;  1QZ5 A;  2CGJ A;  2RKI A;  5JS2 A;  2ZD1 A;  3TAN A;  4KH6 A;  3G0Z A;  1E4G T;  4ILH A;  1DKG D;  3PX6 A;  4H5N A;  3I55 N;  3TAB A;  3O4Q A;  3K2P A;  2O4I A;  4JI1 K;  4DSE A;  4IEE A;  2O8C B;  2NUB A;  2F9W A;  4FLV A;  4IG0 A;  4DFP A;  5I42 A;  3KWG A;  3EZW A;  4CF0 A;  2BDP A;  4LFC K;  4C8L A;  2GBZ A;  1MA9 B;  2NZT A;  5F0X A;  2OZS A;  4F2S A;  4FXD A;  1NK8 A;  2QW9 A;  3PO4 A;  2RPI A;  1FW6 A;  2FF3 B;  4DTP A;  4CIE A;  1LAV A;  5AZJ B;  1TK8 A;  3CCL N;  5BR8 K;  3RMC A;  3HL8 A;  2ZJQ L;  3VES A;  4YOU A;  2E4L A;  4U7B A;  2UXC K;  2NRR A;  3JAM O;  2HNY A;  4BR9 A;  3L4I A;  5HRS A;  3VF4 A;  4FJN A;  5EY4 A;  1YXQ A;  4JHD A;  2P9P B;  4JKE A;  4OKK A;  5AQN A;  1S9G A;  4AHT A;  3KKS A;  3ZEU A;  4FM0 A;  3E01 A;  3O1W A;  4ICL A;  1OH5 A;  4DUY K;  1RCH A;  3K5L A;  4DV5 K;  1VQ5 N;  1D5A A;  4NLB A;  4BDZ A;  3MCP A;  1JLA A;  3O9Q A;  4CJT A;  4JYA K;  3KTQ A;  3C7N B;  3ULE B;  3SYZ A;  4JI2 K;  3PIO L;  2G8K A;  3MK6 A;  1RT1 A;  1TAQ A;  4DU3 A;  1T7P A;  3CQX A;  3VET A;  3QO9 A;  3EN9 A;  1HRH A;  1J5E K;  4LY7 A;  4B9N A;  4FJ8 A;  4M3W A;  2OAN A;  3GOI A;  3KHY A;  4WF9 L;  3QBX A;  1CZ9 A;  2QWP A;  1DEJ A;  1GLF O;  4J2E A;  3MDQ A;  1RT3 A;  3H08 A;  4AM6 A;  3CMA N;  2JGU A;  5F1X A;  3AGR A;  3MEG A;  1NGB A;  4DLG A;  2YHY A;  2G8I A;  5J1E A;  3MXJ A;  3E66 A;  3UKU B;  3L0Q A;  2HF3 A;  3QEX A;  1XMO K;  4DQQ A;  4J2B A;  4PKH A;  1NGC A;  3RSE B;  4KHN A;  4H0T B;  3ZT0 A;  4E19 A;  4F9O A;  3D2E A;  1ZBI A;  2X6S A;  5AQW A;  4F3T A;  3LPU A;  3VQ5 A;  3CD6 N;  4NB4 A;  2A5X A;  3NF9 A;  1NKB A;  1X9W A;  3NMU A;  4JKA A;  2HBM A;  3R6M A;  2HVH A;  4OPK A;  3C7N A;  3HPO A;  2Q31 A;  2RF2 A;  3R1X A;  1NGG A;  1KXP A;  4FW2 A;  2CH5 A;  4BRO A;  4DTJ A;  1Q9Y A;  1Q8I A;  5EX5 A;  4RWT A;  1EET A;  3OY9 A;  1D9F A;  4HCC A;  1B92 A;  3D6R A;  2PFU A;  3K5N A;  2OTL N;  1IBK K;  3HPH A;  1BIZ A;  5FDL A;  1DTQ A;  1SV5 A;  4K42 A;  3HOS A;  3HT3 A;  3QLH A;  1K6Y A;  4LD0 A;  4OPA A;  1NGH A;  2XY7 A;  3SPY A;  2O8D B;  3AVK A;  3SLC A;  5J2M A;  3O5B A;  4FVU A;  5C0Y A;  3CJC A;  3ASM A;  3MXM A;  2A6A A;  5AZJ A;  4CEQ A;  4NCG A;  3KVG A;  3LWM A;  5JS1 A;  4KFB A;  1KTQ A;  1JL1 A;  2W42 A;  4CF2 A;  5E26 A;  3BZC A;  3U4L A;  4CFD A;  2BTF A;  5D3G A;  1VQ9 N;  3LAN A;  4DWI A;  5F2R A;  4G9Z A;  1CLQ A;  1KLM A;  1YI2 N;  2P5O A;  1JLC A;  1DLO A;  4MDA A;  4UY8 O;  2E8A A;  3ZEU B;  4KBO A;  2JWL A;  2GEM A;  4X66 K;  4ISG A;  4F8R A;  1P8Z A;  3IAY A;  3CCM N;  3CCQ N;  4DSJ A;  4F3O A;  3C0B A;  4GVM A;  2GUP A;  3CIP A;  5AJ3 K;  2ATQ A;  4AQY K;  3H45 C;  3MWP A;  4BRC A;  2Q1N A;  1HYV A;  1GOB A;  1ZBL A;  1G15 A;  3SCX A;  1A5X A;  4LC9 B;  4FJX A;  2OZM A;  3AVM A;  4O0J A;  3ZX2 A;  4DR7 K;  2HMI A;  2UU9 K;  3C94 A;  4NCB A;  4KAZ A;  1IKX A;  2E1Z A;  1E4F T;  4IFV A;  4G1Q A;  4FOI A;  3QIC A;  5KRS A;  4FCY A;  4M42 A;  2W41 A;  2HBJ A;  5JLH A;  3OW2 M;  4BRK A;  1C6V A;  1NKE A;  3KLG A;  4CCH A;  3WNH A;  1HJR A;  4CJL A;  3AGK A;  3M8S A;  1T8E A;  4WQ4 C;  4O8U A;  5ADX A;  2EHG A;  2O8E B;  2Q97 A;  1GLL O;  3HVR A;  2E20 A;  1VSH A;  5AQU A;  3RMA A;  1W2B M;  3AO4 A;  1NMD A;  3KK1 A;  1WSH A;  4BC5 A;  1S1W A;  3THW B;  2J4R A;  1SS6 A;  2Q36 A;  1WUA A;  5FPE A;  3M5R A;  2A42 A;  1NKC A;  2GWK A;  4CJF A;  1Y97 A;  2Z1H A;  3C6U A;  3WT0 A;  5AQY A;  4WQ4 A;  5AQV A;  2ITM A;  3L2W A;  4ILJ A;  4M3R A;  4I9L A;  4I6M B;  1JL2 A;  1C1B A;  1TVR A;  4AHR A;  2JLE A;  4H0Y B;  3I8D A;  5ELZ A;  1YIT N;  4JKH A;  1E3M A;  2W40 A;  1HLU A;  3EY1 A;  3SUN A;  3KLI A;  4CK2 A;  3OYG A;  5M1P A;  3VQD A;  3CCV N;  2PYL A;  4UQG A;  4BRE A;  3O9U A;  1CZB A;  4LF4 K;  3QFU A;  1ASW A;  4KH4 A;  2Q3S A;  5FPD A;  3IRX A;  4QS7 A;  3SPZ A;  3QER A;  1YUW A;  1B9D A;  5HP1 A;  1C0F A;  3P38 A;  1ATN A;  1S22 A;  4WQ5 A;  4IJN A;  1VQ4 N;  4BR5 A;  3L3V A;  3RR8 A;  2XHB A;  4FZZ A;  2HBK A;  2ZWH A;  1Z25 A;  4HTL A;  1VQ6 N;  4AIL C;  4DSL A;  3C6T A;  1GOC A;  4IDK A;  4BRG A;  1HQU A;  3MAQ A;  3EL2 A;  1ZBU A;  3AA4 A;  1HPM A;  2EX3 A;  3D2F A;  3VEN A;  4AH9 A;  3TPQ A;  2XRI A;  1VQ7 N;  4DTS A;  2G8U A;  4DUZ K;  1WSI A;  3AV9 A;  4CJK A;  1NJW A;  4KB1 A;  4M63 C;  4BG9 A;  4B3O A;  3W0L A;  3VQE A;  4IFE A;  4LFB K;  3K0S A;  5GAD P;  4FWR A;  2VWJ A;  2WUS A;  1DGK N;  1RDW X;  2ASP A;  3WXM B;  4PHT X;  3RSE A;  5DM7 L;  4IOX A;  3K9K A;  2QWL A;  4XH1 A;  4Q5V A;  4QS9 A;  3D0P A;  4EZ6 A;  4LF9 K;  1VQN N;  2D4W A;  4I6M A;  3OS1 A;  3NDK A;  1QQN A;  2UXD K;  2HND A;  4KB0 A;  2UXB K;  4BWJ A;  1U48 A;  2F8S A;  4BGB A;  1UOC A;  2E2N A;  4BR4 A;  4K43 A;  1MWK A;  3KZB A;  3S41 A;  4E89 A;  3EE8 A;  3RVC A;  2RHK A;  4CF8 A;  2HHX A;  5AQQ A;  3F9M A;  3H46 O;  2FF6 A;  3VQ4 A;  1WAF A;  5C2D A;  5AQX A;  2AA4 A;  1J6Z A;  1GOA A;  4Z94 A;  2X6N A;  3O80 A;  4Q0B A;  2RE2 A;  3G10 A;  4B9U A;  3TAP A;  5H1S Q;  5C10 A;  4JS4 A;  4J2A A;  4FJL A;  1MDU B;  5M1K A;  3BP8 A;  1VSL A;  2E6L A;  4DR3 K;  3LDQ A;  3SBG A;  2YKM A;  3AA5 X;  3ATV A;  4EHT A;  4BRA A;  3NH0 A;  4CFC A;  5FPN A;  3FZF A;  5I9E B;  1KAX A;  2FBY A;  3L4Q A;  5AQT A;  3HRG A;  3O9R A;  3KLH A;  1IBL K;  4OGC A;  1C1C A;  1RTD A;  1OVQ A;  5GAH P;  3LAK A;  4KO0 A;  3L3U A;  4HCB A;  5J2N A;  4N56 A;  1O13 A;  4CJU A;  1BCM A;  2WBN A;  1ZXO A;  4EHU A;  4FPB A;  1CZA N;  4DTN A;  3CXC M;  4FK0 A;  4LSL A;  2NRZ A;  4XH5 A;  2QK9 A;  1S5J A;  4OJR A;  2IGI A;  3VQ7 A;  2ZJP L;  1QHA A;  4AHS A;  2DFF A;  2P9K B;  3A0I X;  3MX2 A;  1WAJ A;  3ENB A;  3HTV A;  3QNN A;  5A2Q O;  3CM6 A;  4BVP A;  2BUP A;  1J54 A;  1VAZ A;  3FR0 A;  4BRD A;  4FWQ A;  4HVJ A;  3CET A;  4W5N A;  3AO2 A;  4CES A;  4E7K A;  2HB5 A;  1OH7 A;  2NRT A;  3DRR A;  4J8F A;  3CYM A;  2GV9 A;  3J7Y P;  1T6C A;  5JLF A;  3TWH A;  1YIJ N;  1HYZ A;  2P9I B;  5AZI B;  4B08 A;  3GL1 A;  4W5R A;  2KKZ A;  3PSI A;  1NBW A;  2CH6 A;  4FLZ A;  3VEW A;  4AHV A;  4FYD A;  4YDU A;  4FPA A;  5FRO A;  1BL3 A;  2LSN A;  1VQL N;  3MX5 A;  2GTD A;  3QEI A;  2FSK A;  3CC7 N;  4B8A B;  4CJP A;  1KAZ A;  1YVN A;  1EP4 A;  3WEE B;  4CHN A;  2FSN A;  3PX0 A;  4DR4 K;  3PO5 A;  4KV8 A;  1DTT A;  1XQS C;  5EXW A;  1MWM A;  4DSF A;  3CC2 N;  4NLC A;  4IG3 A;  2QWM A;  2QTD A;  4CGD A;  1GLJ O;  3DXK A;  3THX A;  3C95 A;  3SJH A;  4BC3 A;  1HJO A;  3B8A X;  3HVT A;  2G8V A;  4CBX A;  5M1F A;  1F21 A;  4FL9 A;  3G25 A;  1JLG A;  4FW1 A;  4MDB A;  3SUP A;  4F4K A;  1EWQ A;  2HHH K;  3O4N A;  3VQ9 A;  1VQO N;  4PL8 A;  3RR7 A;  1U47 A;  1HPZ A;  3E9O A;  1QQM A;  3J81 O;  3PLA A;  1RBT A;  3G6E N;  4JN4 A;  3OYN A;  4PQU A;  1LV5 A;  4LSN A;  3S9H A;  1CXQ A;  1ATS A;  3HOT A;  4LH4 A;  3TTC A;  1NK4 A;  3QB0 A;  5AFU H;  2Q0U A;  4EIA A;  1VSM A;  3SMS A;  4JK7 A;  4CW7 B;  1XMQ K;  4C23 A;  4CEO A;  4YFU A;  3WXI A;  4JI7 K;  2QWO A;  3FE1 A;  1NU0 A;  4HWI A;  5C15 A;  2DTU A;  4JAX A;  1VSI A;  3OYD A;  4H5R A;  1SL2 A;  1YHQ N;  2QKB A;  4WFA L;  1TYQ B;  2O8F A;  1NGJ A;  1FKP A;  3SAG A;  4E0D A;  4GVE A;  1NM1 A;  2D5R A;  3BY5 A;  2KZZ A;  1NWK A;  1C1A A;  1QVF M;  3R9P A;  3V9S A;  3TI0 A;  4O4G A;  3VEX A;  1C0G A;  5BR9 A;  3LAM A;  5FPM A;  1YVU A;  4FK4 A;  4JV5 K;  2IS3 A;  3OJU A;  4CZJ A;  4AHC A;  1HR0 K;  2FBT A;  3CCE N;  3H6E A;  4B9Q A;  4DFM A;  2YJF A;  4K0K K;  3EO3 A;  3JS6 A;  2R7Y A;  4OLB A;  1RIL A;  3CHW A;  3O6W A;  1C0T A;  2P9I A;  3A2F A;  3FZL A;  3ZT4 A;  4JRP A;  2F96 A;  1HX1 A;  1JLF A;  4OX9 K;  3PY8 A;  4JKD A;  2P9U A;  1RT6 A;  3M1F A;  1IG8 A;  4YNQ A;  2YNH A;  1N6Q A;  2O8B A;  3WNG A;  5FLX O;  5AQK A;  4FOE A;  5EVZ A;  3IS9 A;  1JCG A;  4LH5 A;  1BA0 A;  4DFJ A;  2VWB A;  1XI1 A;  2P9P A;  4L3Q A;  4O55 A;  3ISN C;  3WXK A;  4KRE A;  1BI4 A;  5AQF A;  1HYS A;  4OKJ A;  3NE6 A;  1KSP A;  3C6H A;  1X9J A;  4DF4 A;  3HM9 A;  3E9L A;  5TKY A;  4K8X A;  3ALY A;  4H8K A;  2BGG A;  2P9S A;  3J7Z O;  1BO5 O;  4GV6 A;  3CM5 A;  2IIR A;  4CHY A;  4GW6 A;  3VTI A;  3NGI A;  3MN9 A;  5C42 A;  4WCE L;  4JEP A;  1HNI A;  2HHU A;  3CFR A;  4GKJ K;  4PUO A;  4QCL A;  3CQ8 A;  4DV2 K;  4H5T A;  2HHT A;  4CHQ A;  4JI8 K;  4CGJ A;  2YCH A;  3THW A;  2W6K A;  2Z1J A;  4EZ9 A;  3P31 A;  4YOR A;  1REV A;  4M3U A;  4GY2 B;  4NO7 A;  1BUP A;  1QSS A;  2YNG A;  3OS2 A;  4FVM A;  3WQT A;  3UKR A;  5CYM A;  2E88 A;  4X62 K;  2GEL A;  3QDK A;  4C8O A;  3OJS A;  1EO1 A;  2YNF A;  4EP5 A;  1S1U A;  3LZJ A;  1BIU A;  2DPN A;  4Z4I A;  3NF7 A;  1BA1 A;  3IFR A;  5AQI A;  1GLC G;  3ENO A;  1VQ8 N;  1J9A A;  5HRP A;  4DU4 A;  3DWL A;  5KPZ A;  4A57 A;  1A5V A;  4CHO A;  4CZE A;  2VQF K;  1NNE A;  1FK9 A;  4CIF A;  5BPN A;  4DKW A;  3DYA A;  1WN7 A;  5KI6 A;  3NH1 A;  3NAE A;  4E7J A;  4TSX A;  2NRX A;  4RG8 A;  3ZET A;  4OKE A;  4LF5 K;  5AQM A;  1K73 O;  4O44 A;  4DF8 A;  2IVN A;  4C8M A;  2YNI A;  2DFH A;  1W7A A;  2A3Z A;  2VQE K;  3OYI A;  3HK2 A;  3S3O A;  3HI0 A;  2JWK A;  2HOE A;  1SAZ A;  3O9T A;  3LDP A;  4YOX A;  4Y1D A;  4M3X A;  3O3H A;  2QXL A;  1WB9 A;  5EU7 A;  3HO1 A;  2P9U B;  4XIU A;  3ZET B;  4EAH D;  5M1O A;  1WBD A;  3I56 N;  2O8F B;  4A59 A;  4CEC A;  3ZSR A;  2HHV A;  1YJ9 N;  4I7F A;  3SI6 A;  4E7L A;  4YOV A;  4M3T A;  4YOW A;  2QA4 N;  3VF6 A;  4DR6 K;  2D0A A;  3GG4 A;  2AJQ A;  1S72 N;  5TKW A;  4QAG A;  3SQ1 A;  1TUY A;  1N33 K;  3CCS N;  1TK0 A;  1GLD G;  2OPR A;  3P1G A;  2G8F A;  2YHB A;  3VEV A;  4KHU A;  1RT5 A;  4MFB A;  5KTQ A;  2B4J A;  1BWF O;  4DB3 A;  1C0U A;  2IC3 A;  3FZH A;  1L3S A;  3DAW A;  4DV0 K;  4H5W A;  2ZF5 O;  1CXU A;  3NFA A;  4CZL A;  3THY A;  4CJQ A;  4JKG B;  3D2E B;  5BN9 A;  3CC4 N;  4BQL A;  3UIQ A;  1YF5 L;  2PZS A;  5LY3 A;  1BDG A;  3WUH A;  4BC2 A;  4XH4 A;  5BRD A;  1MU2 A;  1K8A O;  4YY3 K;  1Z6R A;  4AHU A;  1J5O A;  1IV0 A;  3VQQ A;  3LDO A;  4FWM A;  4PL7 A;  5JMV A;  1ZBH A;  4BRN A;  1WLJ A;  1WSE A;  2YX6 A;  4CF1 A;  2WFB A;  2A41 A;  4I2P A;  1U6Z A;  4JHD B;  3MEC A;  1RTH A;  1SKR A;  2F4V K;  1RDD A;  4KTZ A;  4BDP A;  3O08 A;  2V52 B;  2HW3 A;  1C0M A;  3OYH A;  2P9L B;  3OS0 A;  3TSP A;  3LM2 A;  1U2V A;  2NRW A;  3M3Z A;  4L8R B;  3FZM A;  4HUG A;  2QXF A;  3AVL A;  4JKB A;  4KHQ A;  4OO1 J;  3KLF A;  4R5P A;  2H3G X;  3MEE A;  1NG9 A;  3SMP A;  1QZ6 A;  1QQO A;  5HRR A;  1X9M A;  3VPZ A;  3DMJ A;  1BI4 B;  1YJW N;  3D45 A;  4DQI A;  4PKG A;  3NGY A;  4PA1 A;  2NNW A;  3B6O A;  3P4I A;  2VG5 A;  2A1S A;  1UAX A;  1H1V A;  3BEX A;  3MED A;  3ZLJ A;  4GV9 A;  3CQY A;  1WBB A;  5CZ2 A;  1LCU A;  4RW7 A;  2O8C A;  3BF3 A;  3OBY A;  3AAR A;  3SJJ A;  4ZTF A;  3P83 D;  3F73 A;  4J2D A;  4B9V A;  3IUC A;  3W3D A;  3V1R A;  1XC9 A;  1SL1 A;  5AQP A;  3OA9 A;  3EYZ A;  4R79 A; 
#chains in the Genus database with same CATH homology
 1T6C A;  5JLF A;  1YIJ N;  2FF3 B;  1NJI O;  1N8R O;  3H1Q A;  2P9I B;  5AZJ B;  5AZI B;  3CCL N;  3GL1 A;  3VGK A;  2KKZ A;  3R3L A;  1NBW A;  2CH6 A;  1Q18 A;  2ZJQ L;  2D0P A;  3VES A;  3VEW A;  2F9T A;  4YOU A;  4YDU A;  4U7B A;  2NRR A;  1HUX A;  4FPA A;  5EOY A;  4H0V B;  2VYP A;  4BR9 A;  3L4I A;  5BPM A;  3VF4 A;  3VEY A;  1VQL N;  5EY4 A;  1YXQ A;  2NRH A;  3NVK A;  3MX5 A;  4JHD A;  2GTD A;  2P9P B;  4JKE A;  5AQN A;  2FSK A;  5CR4 A;  3VGL A;  5AQG A;  3CC7 N;  4FWK A;  4BVO A;  3ZEU A;  1KAZ A;  1YVN A;  3O1W A;  4H5V A;  3GBT A;  5AR0 A;  3TSQ A;  5BRF A;  3WEE B;  3CME N;  2FSN A;  3GE1 A;  1VQ5 N;  4A2A A;  4NLB A;  2FLO A;  1XQS C;  3C6A A;  3MWT A;  4BRL A;  5EXW A;  1MWM A;  1T3V A;  3MCP A;  2QWQ A;  3O9Q A;  3CC2 N;  4NLC A;  1G99 A;  2QWM A;  4JK9 A;  4CZH A;  2QTD A;  1JCF A;  3C7N B;  1GLJ O;  2HF4 A;  3ULE B;  3DXK A;  3VER A;  3PIO L;  3SJH A;  3VGM A;  3MK6 A;  1HJO A;  3A5M C;  3B8A X;  4BC3 A;  3AAP A;  5AQR A;  4YOY A;  3CJB A;  4WFB L;  3VOV A;  4CBX A;  5M1F A;  3CQX A;  5GIP A;  4H0P A;  4MO4 A;  1P90 A;  5AFU A;  4FL9 A;  3G25 A;  5C2F A;  3VET A;  4CD3 A;  4MDB A;  3EN9 A;  3LDL A;  3R8E A;  4B1U B;  3I33 A;  1VQO N;  2PAV A;  1ILY A;  2NRV A;  4PL8 A;  2OAN A;  1ZC6 A;  1K9M O;  5AQJ A;  1BOT O;  3GOI A;  2CGK A;  3HSC A;  3KHY A;  5B8H A;  3E9O A;  1QQM A;  3QBX A;  4WF9 L;  3PLA A;  2QWP A;  3SAH A;  3G6E N;  4JN4 A;  3MN7 A;  5KPT A;  1DEJ A;  3HZ6 A;  3H3O B;  4OPH A;  4B1V A;  5GAG P;  1ATS A;  3U8X A;  3HOT A;  1GLF O;  3Q7C A;  3TTC A;  3MDQ A;  1IJJ A;  3QB0 A;  4AM6 A;  4K41 A;  3CMA N;  5AFU H;  2D0O A;  5F1X A;  2Q0U A;  3AGR A;  4H0O A;  3TSU A;  4EIA A;  1NGB A;  3SMS A;  2D1K A;  2YHY A;  1OVY A;  4JK7 A;  5BRH A;  2FXU A;  2E2P A;  3E66 A;  4JNE A;  1XUP O;  3UKU B;  4C23 A;  3WXI A;  3L0Q A;  2HF3 A;  2QWO A;  3FE1 A;  4PKH A;  1NGC A;  2V51 B;  3RSE B;  4H0T B;  4F9O A;  4HWI A;  2HMP A;  5C15 A;  4BRH A;  3D2E A;  2P9N A;  4JAX A;  4CZK A;  5JVH L;  4H5R A;  5AQW A;  4MO5 A;  1GLB G;  1XC3 A;  4NB4 A;  4CI6 A;  2A5X A;  3L6Q A;  4GNI A;  4WFA L;  1YHQ N;  1TYQ B;  3CD6 N;  3NMU A;  4JKA A;  1NGJ A;  3SAG A;  1EQY A;  2HBM A;  3R6M A;  2V7Z A;  4BC4 A;  4GVE A;  3UKU A;  2OTJ N;  3C7N A;  3MMV A;  3I8B A;  1NM1 A;  1NWK A;  4JK8 A;  2Q31 A;  3CJA A;  3R1X A;  1NGG A;  1KXP A;  3TTF A;  2CH5 A;  3R9P A;  4BRO A;  1QVF M;  4H0X B;  3VEX A;  5AQZ A;  1C0G A;  5GIN A;  5EX5 A;  5BR9 A;  5FPM A;  4RWT A;  3VMF B;  3D6R A;  4CZJ A;  2YHW A;  2PFU A;  2OTL N;  3CCE N;  3H6E A;  4B9Q A;  3NVM A;  3IKM A;  2YJF A;  1M1K O;  4K42 A;  1BU6 O;  3HOS A;  4O8K A;  2VCP A;  4OPA A;  1NGH A;  3O4W A;  3KK7 A;  4A62 A;  4K25 A;  3EO3 A;  3HBT A;  3JS6 A;  1Q81 O;  3N4P A;  3SLC A;  4BR7 A;  3CHW A;  3O5B A;  3E9P A;  3O6W A;  4FVU A;  4IO8 A;  4B1Z A;  5C0Y A;  4CZM A;  1OKJ A;  3CJC A;  4JKC A;  2A6A A;  2P9I A;  5AZJ A;  3FZL A;  2KLA A;  4IZ9 A;  3KVG A;  1RDU A;  2UYT A;  1HX1 A;  5E26 A;  4ILG B;  3ULE A;  4Y0W A;  3U4L A;  4MLH A;  1TUU A;  2BTF A;  1LOT B;  3VTH A;  4BR0 A;  4JKD A;  3PIP L;  2P9U A;  1VQ9 N;  3M1F A;  3U9D A;  1IG8 A;  2I7N A;  3A5L C;  3MN5 A;  5F2R A;  4G9Z A;  1YAG A;  1YI2 N;  4MDA A;  5AQK A;  4UY8 O;  2E8A A;  4FOE A;  3ZEU B;  1YJN N;  3D2F B;  5EVZ A;  3OBW A;  4M7Y A;  1JCG A;  3VEO A;  4KBO A;  2JWL A;  2GEM A;  4BRP A;  1BA0 A;  4ISG A;  2VWB A;  3ENH A;  2E2Q A;  2P9P A;  4MLE A;  3UE5 A;  1KC8 O;  1P8Z A;  3IMX A;  3CCM N;  3CCQ N;  3BF1 A;  4L3Q A;  4YOT A;  4BGA A;  3WXK A;  5AQF A;  4IJA A;  3C0B A;  2GUP A;  4CBU A;  3CIP A;  3C6H A;  2ZJR L;  1X9J A;  4C1N K;  3H45 C;  4QS8 A;  4IWV A;  1NLV A;  4E1J A;  3MWP A;  4BRC A;  2IVP A;  3CCU N;  1HKC A;  5HOO A;  2Q1N A;  1RFQ A;  1KQS M;  3E9L A;  5TKY A;  4A5A A;  4A5B A;  4LC9 B;  5E84 A;  5CHI A;  4JD2 B;  2AP1 A;  4DCH A;  1D4X A;  4DQ8 A;  4BQZ A;  3ZX2 A;  3ID6 A;  1NGE A;  1T6D A;  2E1Z A;  1E4F T;  1NGA A;  2IVO A;  2P9S A;  4CD1 A;  1ESV A;  3J7Z O;  1BO5 O;  2I7P A;  4GV6 A;  2IIR A;  4FOI A;  5AQO A;  2WC9 A;  3QIC A;  3VTI A;  5LJV A;  4FO0 A;  3FFK B;  3MN9 A;  3LM9 A;  3P39 A;  2W41 A;  4WCE L;  2HBJ A;  5JLH A;  4JEP A;  3OW2 M;  5AQS A;  3DXM A;  4FWO A;  4BRK A;  1X3M A;  4GV3 A;  4CJ7 A;  1K8K A;  2YHX A;  3Q7B A;  1BG3 A;  5C12 A;  5M1N A;  5DM6 L;  3DLL L;  4H5T A;  2P9S B;  4IO9 L;  3AGK A;  4JKG A;  4WQ4 C;  4IOA L;  3UKR B;  4O8U A;  5ADX A;  3G71 N;  2Q97 A;  1GLL O;  1U2V B;  3U9Z A;  4A2B A;  3QML A;  2P9L A;  2YCH A;  3CCJ N;  4BRI A;  1RGI A;  2E20 A;  5AQU A;  3P31 A;  1W2B M;  4YOR A;  2V7Y A;  1NMD A;  4JD2 A;  4U67 L;  4GY2 B;  4NO7 A;  1BUP A;  4BC5 A;  2EWS A;  2J4R A;  3ATU A;  1SS6 A;  4ISF A;  4IXC A;  3WQT A;  1NGD A;  3UKR A;  4B1Y B;  2Q36 A;  2E88 A;  1WUA A;  5FPE A;  3M5R A;  4O5F A;  2A42 A;  2GEL A;  3ID8 A;  3QDK A;  4M7X A;  1EO1 A;  2GWK A;  4BRF A;  3KWI A;  1K8K B;  4H03 B;  3WT0 A;  5AQY A;  2DPN A;  3CPE A;  2FSJ A;  4WQ4 A;  5AQV A;  2ITM A;  3HM8 A;  4ILJ A;  3DXM B;  3N4Q A;  1BA1 A;  2PBD A;  2QWN A;  3IFR A;  1R59 O;  3E1Y A;  2HBL A;  3O9S A;  4I6M B;  5AQI A;  1GLC G;  2KHO A;  3ENO A;  1VQ8 N;  3DWL A;  5KPZ A;  4H0Y B;  5LJW A;  2GX9 A;  4A57 A;  1KD1 O;  3TTD A;  5ELZ A;  3DJC A;  4JKH A;  4CZE A;  1YIT N;  3D7E O;  4FWL A;  2W40 A;  3UB5 A;  4IOC L;  2QM1 A;  3O8M A;  1HLU A;  4WQ5 C;  5CE3 A;  2QWR A;  4CZG A;  4YDU C;  5BPN A;  3A5N C;  5M1P A;  4DKW A;  3M6G A;  2GWJ A;  4BR2 A;  3CCV N;  4BRE A;  3O9U A;  3JXU A;  4DHY A;  2NRX A;  3ZET A;  3CJ7 A;  1NGI A;  3QFU A;  4KH4 A;  2Q2R A;  5AQM A;  1K73 O;  2QEX N;  2IVN A;  3ZYY X;  3MN6 A;  3EE9 A;  4QS7 A;  5FPD A;  1YUW A;  1ZBS A;  2A40 A;  4BY9 C;  1M90 O;  4BRQ A;  4RCH A;  1C0F A;  3P38 A;  1ATN A;  1S22 A;  4WQ5 A;  1T44 A;  2A3Z A;  4IJN A;  4BR5 A;  3CJ1 A;  1VQ4 N;  4PKI A;  2HBK A;  2ZWH A;  4HTL A;  3SBT A;  1VQ6 N;  4ISE A;  3HI0 A;  3CER A;  2JWK A;  2HOE A;  1SAZ A;  3O9T A;  4BRG A;  3CCR N;  3EL2 A;  1HPM A;  3D2F A;  3CPW M;  3VEN A;  3A8Y A;  3LDP A;  4IEI A;  3TPQ A;  4YOX A;  4FWS A;  1GLA G;  1VQ7 N;  5GIO A;  1JCE A;  5KPR A;  5BN8 A;  4AF1 A;  2QXL A;  3K9J A;  4A61 A;  2P9U B;  5KQD A;  2Q0R A;  3ZET B;  3EKU A;  3H3N O;  4EAH D;  3A5O C;  5M1O A;  3I56 N;  4XEI A;  4KH5 A;  3OHR A;  3H1V X;  4M63 C;  4A59 A;  4BG9 A;  1Q82 O;  1Q86 O;  3W0L A;  1V4T A;  2YI1 A;  4IFE A;  5AQL A;  1YJ9 N;  5GAD P;  4FWR A;  2P9N B;  2VGN A;  2WUS A;  1DGK N;  1RDW X;  4YOV A;  2ASP A;  4YOW A;  3WXM B;  2QA4 N;  3VF6 A;  4PHT X;  3GG4 A;  1ATR A;  3RSE A;  4CBW A;  5DM7 L;  1W97 L;  5HL7 L;  3AY9 A;  4IOX A;  1S72 N;  1VQM N;  5TKW A;  3K9K A;  3IDH A;  2QWL A;  4XH1 A;  4QS9 A;  1TUY A;  2QI2 A;  4FWN A;  1VQN N;  5KQ8 A;  4IDH A;  2D4W A;  4I6M A;  1Y64 A;  3BUZ B;  2NLX A;  4CZF A;  1HKG A;  1QQN A;  3TU5 A;  3CCS N;  1GLD G;  3LL3 A;  4BGB A;  3VEV A;  1X3N A;  3SK3 A;  3F2K A;  2E2N A;  4BR4 A;  4K43 A;  4RTF D;  1MWK A;  3WQU A;  4WFN L;  1BWF O;  3KZB A;  5JVG L;  1HKB A;  3S41 A;  3ZX0 A;  4DB3 A;  3EE8 A;  3RVC A;  2RHK A;  3VF2 A;  3F5T A;  5AQQ A;  2E2O A;  2E1Y A;  5MLC Q;  3F9M A;  3H46 O;  3FZH A;  2FF6 A;  2YJE A;  1TYQ A;  2ASO A;  2CGL A;  3DAW A;  3QFP A;  4H5W A;  2HST A;  3FGU A;  2ZGY A;  5C2D A;  3CJ9 A;  2ZF5 O;  3GDQ A;  5AQX A;  4CZL A;  2AA4 A;  1J6Z A;  2ZGZ A;  2VGM A;  4JKG B;  1V4S A;  3D2E B;  4Z94 A;  3CF5 L;  3WXL A;  3O80 A;  2RE2 A;  5BN9 A;  5JIC A;  4FWP A;  3CC4 N;  4BQL A;  1DT9 A;  1YF5 L;  3DXK B;  4BRM A;  5H1S Q;  4EFH A;  3ZX3 A;  5LY3 A;  4B1W B;  1BDG A;  3WUH A;  5C10 A;  4BC2 A;  4XH4 A;  5BRD A;  1JJ2 M;  1MDU B;  4BG8 A;  5M1K A;  3BP8 A;  1K8A O;  2F7T A;  1Z6R A;  5M1Q A;  3LDQ A;  3LDO A;  3SAF A;  3SBG A;  4FWM A;  1NGF A;  1KAY A;  1VQK N;  3ATV A;  4PL7 A;  4EHT A;  4BRA A;  5JMV A;  4BRN A;  2YX6 A;  5FPN A;  2WFB A;  3FZF A;  2A41 A;  5I9E B;  1KAX A;  2ASM A;  1VQP N;  3L4Q A;  3CI5 A;  3G4S N;  1GLE G;  1U6Z A;  4JHD B;  3C65 A;  5AQT A;  4B1X B;  3HRG A;  3O9R A;  3FLC O;  1Z05 A;  4CZI A;  3O08 A;  2V52 B;  5AQH A;  1Q7Y O;  5GAH P;  3EKS A;  3MCA B;  2P9L B;  3TSP A;  3LM2 A;  1S3X A;  1U2V A;  2NRW A;  1WOQ A;  3J8A A;  3M3Z A;  1O13 A;  3FZM A;  3O1B A;  5BPL A;  1QVG M;  2WBN A;  1ZXO A;  4JKB A;  5AZI A;  4EHU A;  4FPB A;  1CZA N;  4WYB A;  1SQK A;  4OO1 J;  2H3G X;  3LDN A;  3CXC M;  3SMP A;  3VEZ A;  1QZ6 A;  1QQO A;  3FZK A;  2NRZ A;  4XH5 A;  3AAQ A;  5BRE A;  1QZ5 A;  3VPZ A;  2CGJ A;  5ADX H;  1YJW N;  2ZJP L;  4PKG A;  4KH6 A;  1QHA A;  1E4G T;  2NNW A;  4ILH A;  1DKG D;  3P4I A;  4H5N A;  3I55 N;  3QBW A;  3T7Z A;  2P9K B;  3BEX A;  1H1V A;  3A0I X;  3MX2 A;  3WEE A;  3WXJ A;  4AM7 A;  3CQY A;  4GV9 A;  3ENB A;  1SZ2 A;  3HTV A;  4IEE A;  1LCU A;  4BVP A;  2BUP A;  2F9W A;  1VAZ A;  3BF3 A;  4C1N I;  3FR0 A;  4BRD A;  3OBY A;  2BH1 A;  2P9K A;  3AAR A;  4FWQ A;  3T69 A;  3CET A;  3KWG A;  3EZW A;  4JKF A;  3IUC A;  3W3D A;  2NRT A;  4FSV A;  5GAE P;  5AQP A;  4J8F A;  1MA9 B;  2NZT A;  5F0X A;  3OA9 A;  2QW9 A;  4R79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...