2RPIA

The nmr structure of the submillisecond folding intermediate of the thermus thermophilus ribonuclease h
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
b'MNPSPRKRVALFTDGAALGNPGPGTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title The high-resolution NMR structure of the early folding intermediate of the Thermus thermophilus ribonuclease H
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Hydrolase
total genus 19
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rpiA00
1BIUA 4M45A 4CHQA 1Z26A 4K8ZA 4WE1A 3LANA 2A1RA 4KB0A 3A2FA 4GW6A 3NCIA 3LZJA 3KIOA 4AHSA 3AVGA 3T3FA 1QTMA 4B9LA 4DTXA 4NCAA 1O1WA 1TKTA 2E6MA 4AILC 3ZT0A 2HMIA 5HP1A 1L5UA 2LSNA 2Q3SA 4PY5A 3ZT4A 3I0SA 3QEIA 1VSKA 2ITGA 2F8SA 4CJSA 4HVJA 3SPZA 3HK2A 4CHOA 1BCOA 4FLUA 2YV0X 1NOZA 3QIPA 4PQUA 4YNQA 1KLMA 4CEBA 5SZTA 4O55A 1HQUA 1LWCA 3O3HA 2IDOA 3PO4A 3TAQA 4LH5A 3SQ4A 3S3NA 3TAPA 1JLAA 2Z1GA 4FYDA 4DU4A 4CK2A 4IG3A 1ZBIA 1JKHA 3OVNA 1R0AA 3MEEA 3LP0A 1EX4A 4CJWA 1TAQA 4CJ3A 1BGXT 3CFRA 4CF2A 2OZMA 2XY8A 3DRSA 4LY7A 3VQ9A 3BDPA 1FKOA 1VRTA 4M41A 4AHUA 3K5MA 3LZIA 1RTJA 4FJJA 4N76A 2PY5A 4UQGA 4CE9A 2YKNA 2EHGA 4JLHA 1XWLA 2FC0A 1WN7A 1BL3A 4CF1A 3TANA 4CFCA 4CEAA 4E7IA 3QETA 3TAMA 5HROA 1WLJA 3VQEA 1D5AA 3VA0A 2I5JA 1RTDA 3SUPA 4KB1A 1HPZA 2YNGA 2F8TA 3H08A 4OVLA 1QE1A 3LAMA 5CZ2A 3NH1A 3RR7A 2JGUA 3DRPA 1JLEA 3VQ5A 3WNFA 1RT7A 3OYFA 4DTSA 2XHBA 2Y1JA 1NK6A 4L8RB 2D5RA 2ZE2A 3AA4A 3AVLA 1C0MA 3HT3A 3L2VA 2O4IA 4CJVA 4DTMA 3RMAA 4FLXA 3LP1A 4Z4HA 3RMBA 1J53A 4CJEA 1Q9XA 3ZCMA 4ZTFA 2FBYA 4W5RA 3PO5A 4KO0A 2X74A 3F73A 3LPTA 4HHTA 3SV4A 3QEWA 5KGWA 4AHRA 4CHNA 1SKWA 1WSHA 3QO9A 1KLNA 4M3ZA 2BDPA 1C1AA 1QSSA 3B6PA 5JS2A 3DLBA 4CF0A 3SZ2A 4CESA 4Z0UA 4N47A 3HPOA 3HJFA 3S3MA 2RF2A 4FW2A 2D0CA 1CZBA 4E1MA 1KTQA 3NGYA 5T7BA 1W0HA 3DLRA 4FLWA 3QEPA 4ZTJA 4B9TA 3LALA 3RWUA 4I7FA 4FJ7A 3ZSXA 3ZT2A 2OPSA 2HNZA 3MEGA 3KLFA 1NJWA 3PY8A 2X6NA 1RNHA 2Z1IA 3L8BA 1VSLA 3SCXA 4KPYA 4KREA 1LW2A 4DS4A 3KLEA 3L2RA 5C24A 3KLGA 4OPJA 1YVUA 1A5VA 4I9QA 1EP4A 4J2AA 1RBTA 5KRSA 4LD0A 2YNFA 1WSFA 1I39A 1NJXA 3ZSWA 4DG1A 3V9XA 3QNNA 3SUQA 4QCLA 1RTIA 3AVKA 4M3RA 4ICLA 4CERA 4CEFA 4CJPA 5SWMA 3SQ1A 1EXQA 1U49A 4B9VA 4FCYA 1TL3A 1HNVA 2OPPA 3K5OA 4FJXA 1FK9A 3ALYA 1IH7A 4F3TA 4CGHA 1GOCA 4XIUA 4DQIA 3KD1E 2KZMA 3KTQA 4BACA 2G8VA 4CJFA 1IKYA 1RBRA 1QQCA 4FM2A 2DFHA 1ASWA 1EKEA 1C0UA 4KHSA 4C8NA 5CYQA 2YHBA 4ELVA 3V1QA 1VSMA 3DLGA 3JSMA 2Z1HA 3NDKA 3AVNA 3D45A 1XI1A 1TK5A 1N6QA 2G8HA 4E0DA 5FRMA 3TAGA 3G10A 1NJZA 1SL0A 2HNYA 3E01A 3K5LA 3IAYA 3ZT1A 2PYLA 4DWIA 1QSYA 1NKBA 3ZSVA 1S1WA 1WSGA 3M8SA 3QNOA 3S9HA 1YT3A 2G8UA 3LDSA 4BE0A 3SUNA 4RW6A 4M42A 3TABA 1ITGA 4K8XA 1C0TA 4CJKA 3D0PA 5HRNA 3OS1A 1TL1A 4DTNA 1RDDA 2P1JA 3TARA 1VSFA 4M3WA 3VQ4A 1HYVA 4YFUA 1L3VA 4EZ6A 2P5GA 3LWLA 5KGXA 2KFZA 1T8EA 3K59A 1NKEA 1BI4B 1U45A 2KZZA 4IDKA 3MECA 2HVHA 1GOAA 2BGGA 4NYNA 2F96A 4CHPA 4HUFA 4LSNA 3L2WA 1VK0A 4DTUA 4DFKA 2HHXA 5DMRA 1D8YA 4QAGA 1JXEA 3PUFA 1BHLA 3ISNC 3L3VA 3ZSQA 4DU3A 1WSEA 3V1RA 3C6TA 1KVAA 3NHGA 3VN5A 3ZSZA 3CFOA 3QINA 2OPRA 3HP6A 4DLEA 4E7JA 1HYSA 4OKJA 3M8RA 4CHZA 1LWEA 4CGGA 1YTUA 4M3YA 2X78A 4BDPA 4I9LA 1L3UA 1NK9A 3G0ZA 4H4OA 3SV3A 4J2DA 3L3UA 2YNHA 3TAFA 1S1UA 1B9DA 2KTQA 4KRFA 3EY1A 4N56A 3MXJA 2HHUA 1TKXA 1F21A 4CFBA 3OS0A 2OPQA 2AJQA 5CYMA 1S1XA 1LAWA 3C94A 1UA0A 1KFDA 4HTUA 3V6DA 4DFMA 4PWDA 4C8KA 3NAEA 4ELTA 3NF6A 3DM2A 3V1OA 3HPHA 1FXXA 4FK2A 4PA1A 4FJNA 1X1PA 3KJVA 3IS9A 4FXDA 3NE6A 1VRUA 3NH0A 4W5OA 4AHVA 3PX0A 3U6FA 1A5XA 2GBZA 2JLEA 4FJ8A 4TSXA 1C6VA 3MXIA 5HBMA 2DFFA 3OY9A 1XC9A 4I2QA 1WAJA 3T1AA 2XRIA 1GOBA 3WNHA 4F3OA 1S9EA 3AVFA 3MXMA 1QHTA 3OYAA 1YTAA 2BANA 4F2RA 1JL1A 1RT6A 1WSIA 2ZD1A 3WNEA 3EYZA 3TI0A 5KTQA 4FVMA 4O4GA 3VQAA 3LWMA 4E3SA 3O4NA 2QKKA 4FZXC 1WNSA 4BWJA 3ITHA 3V81A 4CF8A 1A5WA 3AO3A 1C1BA 1RTHA 4CEDA 3TAEA 1NK0A 3UIQA 1TKZA 2B4JA 2D0BA 4GMJB 3OYGA 4M3UA 3OS2A 4IG0A 1BQMA 3LP3A 1RDAA 3OYBA 2W42A 1NKCA 2KW4A 3HVTA 5J2PA 2DTUA 4EP5A 2OA8A 4RW7A 1MU2A 3M8QA 4DLGA 5HRSA 3VQPA 3VQBA 4E7HA 3AVJA 4DTRA 3OYHA 1T03A 4B3OA 4B9NA 4OKKA 4CEEA 3HM9A 3OYCA 4HCBA 1UA1A 4DSJA 3AA2A 4CJQA 1NOYA 2QXFA 4W5NA 1HYZA 1Q9YA 1HNIA 2YHAA 3NH2A 4I2PA 3VQDA 4Z4GA 1S1TA 2BE2A 1TV6A 3SJJA 4CJLA 4M3XA 2WONA 1WSJA 3KLIA 4G1QA 1JLBA 2QKBA 2WOMA 4FLVA 3L2UA 1RBVA 3OJUA 3CM5A 4DSLA 2IAJA 5FRNA 1TAUA 3DYAA 1U4BA 1J5OA 3AVAA 1REVA 1QSLA 3AVIA 4RG8A 1TGOA 3OYKA 2YKMA 4DTPA 3DLHA 2DY4A 1ZBLA 5HRPA 4NCGA 4O44A 3VQ8A 5J2QA 3HVRA 5J2NA 3P83D 4IFYA 2XY7A 4E7KA 1RT4A 4ELUA 2HNDA 4R5PA 3V9ZA 3VA3A 4OLBA 3PX6A 4FJGA 4DU1A 3CFPA 4OJRA 3O3FA 2ATQA 1RT2A 1WAFA 2HHWA 1S6PA 1UWBA 3VQ6A 1RBUA 1J54A 3DMJA 4B8CA 1SL1A 1D9DA 1X9MA 1XHXA 2OZSA 3C6UA 4DQSA 2PYJA 1HQEA 4B8AB 3KKRA 4CFAA 3OYLA 4LH4A 3RMDA 3K58A 2HVIA 4DSIA 3KKSA 1JLCA 1C1CA 3NF9A 3B6OA 3SI6A 2HW3A 1SUQA 3DOLA 3PX4A 4DTJA 3U3YA 3O4QA 4Z4CA 4O0JA 3OYIA 4KHNA 1FKPA 1X9WA 1JLFA 1NK4A 2ETJA 4CJUA 1TK0A 2HHTA 2KFNA 2B6AA 4FJHA 4FJ5A 2RKIA 3KD5E 1LAVA 1NK8A 4NCBA 4Z4EA 4JS5A 1I3AA 2VG7A 3P1GA 1L3TA 4H8KA 3AVMA 4IFVA 1JXBA 4AHTA 4DMNA 4PUOA 1UOCA 1IKWA 3NF7A 4KKOA 2E6LA 4OKEA 1RDCA 1VSJA 2NUBA 3ZSYA 3RTVA 3RR8A 2P51A 3RRHA 2PZSA 4DFPA 1TKDA 3LAKA 4CEQA 1HRHA 1CZ9A 4Y1CA 4OGEA 1K6YA 4DSFA 1IKXA 2D0AA 1KVCA 1U04A 3HYFA 4KV8A 4JS4A 1D9FA 4N41A 4FJKA 4KHYA 3HP9A 4CF9A 1SV5A 4KFBA 1U48A 2VG5A 3S3OA 2GUIA 3IG1A 4F8RA 3FFIA 2R7YA 4CHYA 4J2EA 3AVHA 1CXUA 5FDLA 2GV9A 3VQCA 4FK0A 3I8DA 4KHUA 4W5QA 2Y1IA 4FK4A 2IS3A 3AO5A 2VG6A 3K2PA 4OGCA 4Q5VA 3QEXA 4FLTA 1VSHA 3NGIA 1LW0A 4ZHRA 4NYFA 2XY5A 3BGRA 1BISA 5JS1A 1G15A 1JLQA 4DSEA 3AA3A 4C8LA 4M3TA 1CLQA 3KK1A 5I42A 3HL8A 3LPUA 3HSTB 5J2MA 4OLAA 3CG7A 3IRXA 3KK2A 3OYNA 3SQ2A 1BI4A 4KHWA 4FLZA 2Z1JA 1HJRA 3C95A 4F4KA 4BWMA 5D3GA 4ID1A 4MFBA 4EZ9A 5FROA 3HPGA 4O0IA 1JL2A 1LV5A 1DTQA 4B08A 3KK3A 3OYJA 1Q8IA 1S5JA 3SQ0A 1CXQA 5EU7A 4CEZA 3DRRA 3PV8A 1T05A 1J9AA 1ZBHA 1HMVA 3V9UA 5K14A 3O3GA 1SKRA 4C8OA 3EZ5A 3SNNA 4DQQA 3OYEA 5I3UA 4KAZA 1IKVA 1QS4A 4FM0A 1VSDA 2XY6A 1N5YA 4LSLA 3QESA 1S9GA 4EP4A 1ZYQA 4AH9A 5DK5A 1KCFA 3V9SA 1SL2A 3NFAA 4CGJA 4CJTA 5C25A 4BDYA 1NK5A 4RW9A 4E1NA 4DFJA 1L3SA 3NF8A 3VQ7A 3QEVA 2G8WA 5HLFA 3QLHA 4CK3A 1W9HA 2DFEA 2HB5A 5CZ1A 3HXMA 3DLEA 1DTTA 4DQRA 1JLGA 3DOKA 4FJMA 3AVCA 4N5SA 3P5JA 3VQQA 5KI6A 4KTQA 3WNGA 3K5NA 1Y97A 4AHCA 1B9FA 1S1VA 3K57A 4HUEA 4RW4A 3ZSRA 1NJYA 4B9MA 4KI6A 1S6QA 4Z4IA 4CIFA 3CQ8A 4B9UA 4CJ4A 2IC3A 4E7LA 1T7PA 4CGDA 4Q0BA 3TWHA 4HUGA 1ASVA 3V4IA 4DF8A 5HRRA 4DSKA 4E89A 3M8PA 1RCHA 2FBVA 3ZSOA 4W5TA 4DS5A 4Y1DA 1RT1A 4CJ5A 1TVRA 1X9SA 2B5JA 3AO1A 1SKSA 4BE2A 2FBTA 4CFDA 1IG9A 3NGZA 2HHSA 4KI4A 5CY4A 2VWKA 3THVA 1B92A 5KRTA 4FZYA 4E19A 3RRGA 1EETA 3ZT3A 2HHQA 5E41A 3OJSA 1RT5A 4DTOA 2ZQBA 4BDZA 1ZBFA 4ID5A 1RDBA 3ULDA 1TK8A 1VSEA 3OYDA 3MAQA 4BE1A 1KRPA 4JRPA 4CECA 4DQPA 3SUOA 3NBPA 2O4GA 2G8KA 5C42A 4KHQA 1XHZA 2OYQA 3CM6A 1KSPA 4H4MA 1ASUA 4CGFA 4FM1A 3DI6A 3AA5X 4CIEA 4FJ9A 4CCHA 3TR8A 4CK1A 3OYMA 4IKFA 2G8IA 4C8MA 2XO7A 2G8FA 4IBNA 4RW8A 3F9KA 3AO2A 4GVMA 3V9WA 1BCMA 3JYTA 4CEOA 1DLOA 1BQNA 3AV9A 3RMCA 3LP2A 1IO2A 4MQ3A 3QIOA 4CGIA 4Z4FA 3HO1A 2EX3A 3L2QA 2RPIA 4KTZA 1RBSA 4O5BA 2IOCA 4FLYA 4B9SA 4QOZB 2E4LA 2KQ2A 3I0RA 1RT3A 3SPYA 2HHVA 3QERA 4CIGA 1U47A 2RN2A 2FBXA 4CJRA 1RILA 1KFSA 4KTWA 4FZZA 4DF4A 3KLHA 3U3GA 1NK7A 2VWJA 4OPKA 2P5OA 1ZBUA 4F2SA 4FJIA 3ASMA 2YNIA 4HCCA 2X6SA 3T19A 1VSIA 2IGIA 1UAXA 1BIZA 5J1EA 2A1SA 2QK9A 4FW1A 1Z25A 4FJLA 3CYMA 3AVBA 4JRQA 3SYZA 4J2BA 3DLKA 1KVBA 1LWFA 3AO4A 3MEDA
chains in the Genus database with same CATH superfamily
4M45A 5AZIB 4K8ZA 3AAPA 1TKTA 1ZXOA 3CCMN 2OCEA 3QEIA 1VSKA 3SPZA 3HK2A 3CETA 3QDKA 4BRFA 3BP8A 1VQPN 2P9LB 1HQUA 5TKYA 4LF4K 4BRKA 3SQ4A 1JLAA 1S22A 3ID6A 1EX4A 2WBNA 1T6DA 2OZMA 5GAHP 1X3NA 2FSKA 1FKOA 4AHUA 1MWKA 2EHGA 1XWLA 2Q2RA 1HJOA 2FC0A 4LFCK 4CF1A 5BR8K 4FWLA 4E7IA 5KQ8A 3MDQA 2QW9A 1D5AA 4H5RA 3VEYA 3VA0A 2I5JA 4JKEA 1NLVA 1QE1A 1WBDA 3OYFA 1T3VA 1N8RO 1NK6A 2D5RA 3AA4A 3AVLA 1C0MA 3HT3A 3CCLN 4FLXA 4FWNA 4LF9K 3OW2M 4WFNL 3PO5A 1KXPA 2X74A 4BRGA 5BN9A 3SV4A 3I33A 5KGWA 5AQIA 3QO9A 5AQYA 1KLNA 4IOCL 2BDPA 5AQJA 3QFPA 5JS2A 1E4GT 4FWOA 4CF0A 3SZ2A 4CESA 3SLCA 2NRZA 2RF2A 4FW2A 4E1MA 4H5NA 5T7BA 4ZTJA 4B9TA 4I7FA 1VQ5N 5CE3A 2OPSA 3KLFA 4H0VB 3VEVA 1VSLA 2QWMA 3ULEA 3KLGA 4OPJA 4I9QA 1EP4A 1VQLN 1RBTA 5KRSA 1WSFA 3O9TA 4DG1A 3QNNA 3AVKA 4ICLA 1EXQA 2E20A 1TL3A 2F9WA 3EN9A 4FJXA 1IH7A 1GOCA 4XIUA 1IKYA 4OO1J 5JMVA 1EKEA 4JK7A 5FPMA 4EHTA 5CYQA 4ELVA 3BF1A 3V1QA 1VSMA 4DV7K 3JSMA 3NDKA 4E0DA 5FRMA 1SQKA 2HNYA 3MN5A 4H03B 2PYLA 4B1YB 4DWIA 3ENOA 1HNXK 3QNOA 3S9HA 5LMUK 2G8UA 4M42A 1OVYA 4CJKA 2P9UB 3VF2A 4DTNA 1HYVA 2P5GA 3LWLA 1OVQA 4BG8A 4DR7K 2KZZA 1U45A 4LSNA 3L2WA 3EKUA 5DMRA 3PUFA 5M1FA 5IT9O 5AFUA 3ZSQA 3V1RA 3C6TA 3QINA 4DLEA 2OPRA 3HP6A 1HYSA 2HSTA 4OKJA 3M8RA 2A3ZA 1BWFO 3FZMA 2W6LA 4ILGB 1NK9A 4J2DA 4H0YB 4KRFA 3EY1A 2GTDA 3OS0A 2A41A 2OPQA 4JI1K 5CYMA 3LDNA 1IV0A 1KFDA 3L6QA 5HOOA 1TYQB 4C8KA 4FWMA 3FZLA 3D2EB 1FXXA 4LF6K 1X1PA 4FXDA 1VRUA 4R79A 4JHDB 2GBZA 3LDOA 5BRDA 4FJ8A 5HBMA 2DFFA 4BREA 4IO9L 3T1AA 3WNHA 4F3OA 1ILYA 1QHTA 3OYAA 3FZKA 2BANA 2FSJA 4F2RA 1WSIA 3TU5A 5KTQA 2QKKA 4CI6A 4IOXA 3O4NA 4FZXC 4OPAA 3ITHA 5EVZA 1RTHA 2KKZA 3TAEA 1N34K 4M3UA 1TKZA 4IG0A 2I7PA 3LP3A 3ATUA 2P9IA 3EEQA 4RW7A 5HRSA 3E9LA 3OYHA 4B3OA 1NGDA 1OH8A 3W0LA 3VEOA 4DSJA 4CJQA 2QXFA 5AQLA 1OH7A 4FO0A 3KWIA 3SJJA 4CJLA 4H5VA 4K25A 3O6WA 3L2UA 1RBVA 3CM5A 1TAUA 5KPRA 1QQNA 3AVAA 4RG8A 2NRVA 2YKMA 2DY4A 1ZBLA 4NCGA 5J2QA 1T44A 3BZCA 4E7KA 3KWGA 3R6MA 3FFKB 2HNDA 4R5PA 3PX6A 4DU1A 3ZYYX 2ATQA 1WAFA 1TUUA 2HHWA 5JVHL 1BG3A 3MWTA 3DMJA 2D4WA 2OZSA 4DQSA 5AQMA 4LH4A 3RMDA 5JLFA 3IFRA 2HVIA 3NF9A 4A62A 4QOZB 1X9WA 2P9PB 5LJWA 1NK4A 2HHTA 4A59A 4C1NK 2RKIA 2Q1NA 1HNWK 3U9ZA 5BPLA 4NCBA 4Z4EA 1BO5O 2FF3B 1WUAA 4H8KA 3N4PA 3UKRA 3NF7A 4OKEA 3RTVA 1RDCA 4OPHA 2CGLA 1U2VB 1TKDA 1HRHA 1CZ9A 1VQ9N 2IVOA 3QFUA 4FPBA 1KVCA 4JS4A 4DR2K 2FXUA 3HP9A 4JD2A 4CF9A 4KFBA 1U48A 2GUIA 5FDLA 2F9TA 2ASMA 4BRQA 2Y1IA 3AO5A 3QEXA 3CC2N 1VSHA 1N33K 5M1NA 1MDUB 3BGRA 1BISA 1JLQA 4U67L 3E1YA 3GOIA 3HL8A 1KAYA 3HSTB 3MN7A 4OLAA 3CG7A 3IRXA 3KK2A 3OYNA 4KHWA 5AR0A 2Z1JA 1HJRA 3PSIA 4YOVA 4BWMA 1HKCA 4JI4K 5FROA 1LV5A 3KK3A 1CXQA 5EU7A 1JJ2M 1J9AA 4NLCA 5K14A 3HBTA 4JEPA 3O3GA 1SKRA 4PHTX 4C8OA 5AQRA 1IKVA 2XY6A 1BDGA 4LSLA 3QESA 2AA4A 3U8XA 3EL2A 5C25A 3WQUA 3CQXA 3ZEUB 3NF8A 3VQ7A 2G8WA 3DJCA 2HB5A 1DTTA 1YJWN 3AVCA 4B1WB 3UE5A 3WNGA 4AHCA 3THXA 3J7YP 1NJYA 2CGKA 4E7LA 5C12A 4CGDA 4Q0BA 4IEEA 1X9JA 2W40A 1ASVA 4CZHA 4E89A 4LF7K 4DS5A 4Y1DA 1RT1A 4H5WA 2B5JA 1IG9A 4DR6K 3F5TA 3HOTA 2V7ZA 3THVA 2KHOA 4FZYA 4E19A 3RRGA 4CD1A 1VQNN 1RT5A 3O5BA 3OBWA 1ZBFA 3ULDA 1KRPA 4BE1A 1RGIA 5M1QA 4BR5A 5E84A 3DXMA 4YOTA 1Q7YO 1P8ZA 2O4GA 5C42A 4KHQA 1KSPA 3VEXA 4DUYK 4FM1A 1BU6O 4FJ9A 3MX5A 4CCHA 1YXQA 1KQSM 4C8MA 2G8FA 4H0XB 4JK9A 4JK8A 1BCMA 4CEOA 4MQ3A 3A5LC 1WBBA 3C0BA 4CGIA 4IJAA 3O9QA 3HO1A 2EX3A 3L2QA 1DEJA 1RBSA 4O5BA 4B9SA 3I0RA 4CIGA 1U47A 4CJRA 2FBXA 1KFSA 1X3MA 3KLHA 3U3GA 2VWJA 1YITN 1ZBUA 4F2SA 4FJIA 2CH6A 3ASMA 2X6SA 5J1EA 2A1SA 2QWOA 3E9PA 2ZGZA 5CR4A 4JV5K 4MDBA 4IFEA 3LANA 1NGJA 3AARA 3MK6A 4BRAA 5AQSA 1O1WA 2E6MA 4NLBA 4AILC 2Q3SA 4PY5A 3ATVA 5EOYA 2F8SA 4YDUC 4WQ4A 5M1PA 1VHXA 3HZ6A 3AY9A 5C0YA 1KLMA 2ZJQL 1BA1A 3O3HA 2IDOA 3PO4A 1QZ5A 3TAQA 5F2RA 2NRWA 3PLAA 1JKHA 1R0AA 3LP0A 5F1XA 1K73O 2GUPA 4CF2A 4RTFD 5AZIA 2E88A 4LY7A 4CD3A 4N76A 3DXKB 3K5MA 3LZIA 1RTJA 2PY5A 4UQGA 4CE9A 3KK7A 4PKIA 3A0IX 2BTFA 1SZ2A 4JKFA 4CEAA 3QETA 3TAMA 3G4SN 4WFBL 3VQEA 4OX9K 3SUPA 3H08A 5CZ2A 3WNFA 4BQZA 2P9LA 3ZX3A 3GBTA 4DTMA 4JI0K 3RMBA 5AZJB 4CJEA 3HTVA 4W5RA 1QHAA 3HSCA 4KO0A 3F73A 3FZHA 4HHTA 4AHRA 3WXLA 4CHNA 3U9DA 1WSHA 3QBWA 4M3ZA 1C1AA 4JN4A 3P31A 4IO8A 4DV5K 1GLBG 4Z0UA 3NGYA 3CMAN 2ITMA 4FLWA 4FJ7A 2HNZA 3MEGA 5FPEA 3PY8A 1RNHA 2Z1IA 3CERA 4CJ7A 3R1XA 4JKHA 4LD0A 1VQON 1I39A 1NJXA 3FZFA 1C0GA 3IUCA 3V9XA 3BUZB 4WFAL 5SWMA 1U49A 3TSQA 4B9VA 1HNVA 1OH5A 4F3TA 4CGHA 3L0QA 3VTIA 1QQCA 4FM2A 1ATRA 4JI6K 4KHSA 5E26A 3MN9A 2ASPA 4BR0A 1V4TA 3DLGA 1JCGA 1TK5A 3D45A 3PSFA 4WQ5C 3E01A 3IAYA 1QSYA 3FLCO 3SBTA 3RSEB 1YT3A 2QWRA 3VEZA 1K8KB 3LDSA 2E2OA 4RW6A 4BE0A 3TABA 3SUNA 4LFAK 1C0TA 3D0PA 4JI5K 3OS1A 3JXUA 2P1JA 3TARA 4YFUA 1L3VA 4FWKA 4YHHK 1HR0K 3CHWA 3CJCA 1BI4B 3VF4A 2O8DB 3I56N 3MMVA 4DFKA 4DTUA 4QAGA 1Q18A 5LJVA 4B3SK 5LL6Z 3NHGA 4E7JA 3ZSZA 5M1OA 3VPZA 3C65A 1T6CA 4M3YA 4GV3A 4BDPA 3B8AX 1L3UA 5AQWA 4BGAA 3SV3A 2P9UA 3L3UA 4CVNE 1B9DA 1S3XA 4N56A 3H46O 4MLHA 4CFBA 1VAZA 3V6DA 4PWDA 5IWAK 3HPHA 4FK2A 4FJNA 2VYPA 4YOXA 3F2KA 3NH0A 4W5OA 4AHVA 1YHQN 3CIPA 3ENHA 2E1YA 4B1UB 3OY9A 4I2QA 2XRIA 1XQSC 3MXMA 3H45C 3C7NB 4BC2A 3WNEA 3ID8A 3UB5A 4E3SA 1MA9B 1WNSA 4BWJA 3T1YK 3V81A 1A5WA 1C1BA 4BRNA 1M1KO 3OYGA 4GMJB 1ESVA 1BQMA 1RDAA 2Q36A 1NKCA 2KW4A 3HVTA 1TYQA 3M8QA 4DLGA 3AAQA 4XH1A 3D2EA 3VQPA 2O8CB 3AVJA 1T03A 4B9NA 3HM9A 1NOYA 1HYZA 4QS8A 2BH1A 1Q9YA 4IOAL 5H1SQ 3VQDA 5B8HA 2P9KB 1YVNA 3GDQA 2P9NB 1WSJA 2A42A 4EIAA 4V19S 3OJUA 2IAJA 4A2BA 3G6EN 1QSLA 3AVIA 2HHHK 1TGOA 2E2PA 4DTPA 3HOSA 1GLCG 1EO1A 4JAXA 3EE9A 4ELUA 3N4QA 4OLBA 4UY8O 1IJJA 4FJGA 1QQMA 2F7TA 2O8FB 4OJRA 1R59O 2GWJA 1UWBA 4B8CA 5AQFA 1XHXA 1HQEA 5FLXO 4BRPA 4AQYK 2HW3A 2WTUA 3SBGA 1D4XA 3THYA 1SUQA 3PX4A 4Z4CA 1BA0A 2A5XA 3EE8A 1FKPA 2B6AA 3AGRA 4ISEA 1QQOA 3KD5E 1NGIA 3CCVN 4JNEA 4JS5A 1I3AA 4GVEA 3P1GA 1DT9A 4JI7K 2O8EB 4EHUA 1L3TA 4PUOA 4IFVA 2ASOA 1JXBA 4FWRA 1UOCA 1VSJA 1GLAG 3ZSYA 3CCQN 3Q7CA 2PZSA 4DFPA 4CEQA 1U04A 3HYFA 4FJKA 3O9UA 3CJBA 3S3OA 4F8RA 3IG1A 1YI2N 3CI5A 3OA9A 1EQYA 3AVHA 3C6HA 4CHYA 3VENA 4AM6A 3VQCA 1NGEA 2P9PA 4FK4A 2YJFA 4OGCA 3K2PA 4Q5VA 2UU9K 4FOEA 1LW0A 4ZHRA 4B1ZA 4CZJA 3TTCA 4C8LA 3AA3A 3CXCM 3KK1A 5J2MA 3LPUA 1KD1O 1GLFO 4MO5A 1U2VA 3WXJA 3M5RA 2RHKA 4RWTA 3H3NO 4IDHA 3HPGA 3UKUB 1JL2A 3IDHA 4Z94A 3DAWA 3WXIA 1S5JA 2QWNA 1HMVA 3V9UA 3KVGA 5JICA 2JWKA 3SNNA 2CH5A 4X62K 5I3UA 4H5TA 4KAZA 1VSDA 4ISGA 4EP4A 4AH9A 5DK5A 1KCFA 5BRFA 4CGJA 4CJTA 5FPNA 1VQ8N 1H1VA 4CBXA 4AF1A 4E1NA 1L3SA 3EKSA 1Q81O 3JAMO 5CZ1A 3VERA 1XNRK 1NGCA 3DLEA 4DQRA 2FLOA 3DOKA 4I6MA 2VQFK 5DM6L 3WEEB 3C6AA 5KI6A 3LDQA 3I55N 4HUEA 4B9MA 4Z4IA 4KI6A 4B9UA 2P9SA 2VQEK 3V4IA 3D2FA 1FW6A 3ZSOA 4LF5K 1X9SA 3L4IA 1HKGA 3TTFA 3AO1A 1WOQA 4GV6A 3CCSN 3O8MA 2W41A 1RFQA 5FPDA 1K8AO 3ZT3A 4BR4A 3G71N 3ZEUA 2ZQBA 1RDBA 3OYDA 3T69A 3CCJN 1YIJN 4JRPA 4DQPA 3ZX0A 4FL9A 3CM6A 4Y0WA 4GNIA 4H4MA 4CGFA 3AA5X 4CIEA 3A5MC 2ZGYA 1KAXA 3AO2A 4GVMA 2V7YA 1DLOA 3AV9A 3RMCA 1IO2A 4BROA 4QS9A 2KQ2A 2VGNA 1RT3A 4GKKK 5LY3A 4FZZA 5ADXA 2P5OA 3AGKA 4MO4A 2NLXA 4HCCA 4FVUA 4LFBK 3O4WA 4C1NI 4IJNA 1UAXA 2QK9A 5EX5A 4FJLA 3J80O 3DLKA 1TUYA 1XUPO 4K41A 2HF4A 4K0KK 3MEDA 4CHQA 2ZJPL 1Z26A 2A1RA 4KB0A 3NCIA 3HI0A 3KIOA 4JKGA 2YJEA 4DTXA 4NCAA 2QI2A 2VGMA 4O8KA 3ZT4A 2ITGA 2J4RA 4CJSA 4HVJA 4CHOA 1BCOA 2NNWA 4L3QA 4RCHA 1K9MO 2E8AA 4BRMA 1NWKA 4YNQA 5SZTA 4O55A 1LWCA 3DLLL 2WFBA 4BRIA 5KPTA 3S3NA 2Z1GA 4CK2A 5BPMA 1O13A 3MEEA 2ZM6K 1TAQA 4B1XB 3CFRA 2HMPA 2EWSA 3BDPA 3VETA 2YKNA 5BN8A 2QA4N 1Q82O 3MCPA 1WN7A 3FR0A 4CFCA 5LMNK 2P9IB 5HROA 4KB1A 1HPZA 4OVLA 4EFHA 3RR7A 3NH1A 2JGUA 1JLEA 4DTSA 4WCEL 2Y1JA 4L8RB 4ISFA 3L2VA 1XC3A 2O4IA 4AM7A 3LP1A 4Z4HA 1J53A 5BRHA 1Q9XA 3VMFB 4LC9B 3DXKA 4CZLA 3MWPA 4K42A 4CBUA 3M6GA 3DWLA 4DB3A 1QSSA 1VQKN 3B6PA 3WXKA 4CW7B 1YUWA 4JKDA 4JYAK 3DLBA 1G99A 3A8YA 4H0TB 4BQLA 3ENBA 5KPZA 3S3MA 4NXNK 4BR9A 1W0HA 3LALA 3ZSXA 1NJWA 1GLJO 2X6NA 3L8BA 3SCXA 4KPYA 1LW2A 2UUCK 4BRLA 3KLEA 3Q7BA 3CCRN 1A5VA 4J2AA 3SAHA 3SUQA 1RTIA 5DM7L 4CEFA 1OH6A 3SAFA 4FCYA 3K5OA 1FK9A 3KD1E 1NGAA 2KZMA 5AFUH 1RBRA 4CJFA 2DFHA 4BGBA 1ASWA 4C8NA 4JD2B 5GAGP 2G8HA 1XI1A 3AVNA 5F0XA 1N6QA 4DUZK 3TAGA 3G10A 1NJZA 2E2NA 3K5LA 3A5OC 1NKBA 3ZSVA 1WSGA 3M8SA 1W97L 5C10A 4BRDA 1RDUA 4JKCA 1ITGA 4K8XA 1HX1A 2QM1A 4NO7A 1RDDA 1VSFA 3VQ4A 3S41A 4EZ6A 2KFZA 3K59A 1NKEA 3O08A 4IDKA 3MECA 4E1JA 2HVHA 2BGGA 4NYNA 1Q86O 1D8YA 1BHLA 4GY2B 3QMLA 3L3VA 3CD6N 3OBYA 1NM1A 4BR7A 4FPAA 2GELA 3VN5A 3RSEA 4IWVA 1YTUA 3KZBA 2Q0UA 4I9LA 3G0ZA 1ATNA 2YNHA 3O9SA 1S1UA 3TAFA 1VQ6N 2KTQA 1YJ9N 3VGLA 2HHUA 3EO3A 2AJQA 3WUHA 1UA0A 4HTUA 4DFMA 2QWLA 5EXWA 3NAEA 4ELTA 3NF6A 3DM2A 5TKWA 3THXB 3O1WA 3CPEA 1N32K 1A5XA 4KH4A 1C6VA 3MXIA 4CBWA 4ILJA 1GLEG 3AVFA 5BPNA 4X65K 4LF8K 4CZFA 1JL1A 1RT6A 3TI0A 5AQPA 3VQAA 3ZETB 4CZGA 3LWMA 4CEDA 3UIQA 2D0BA 2B4JA 3CF5L 3WT0A 3OS2A 2VWBA 2W42A 4DV2K 2DTUA 1VQMN 4EP5A 1MU2A 3VQBA 4E7HA 4DTRA 4CEEA 2Q31A 1UA1A 3AA2A 5AQZA 4W5NA 3R3LA 1HNIA 5AQTA 4Z4GA 3K9KA 1Y64A 3KLIA 1JLBA 3BEXA 4G1QA 2QKBA 1WB9A 3DYAA 3CC4N 3C7NA 1REVA 3OYKA 3FGUA 1LCUA 3VQ8A 3CC7N 4X64K 3P83D 1DGKN 2O8BB 2XY7A 3THWB 1QVGM 4BVPA 3V9ZA 4JKBA 2ZWHA 4BG9A 3O3FA 1XMOK 2HOEA 1M90O 3VQ6A 2O8CA 4O5FA 1D9DA 3C6UA 3TTDA 4CFAA 3OYLA 3K58A 2OANA 4DSIA 2P9KA 1JCFA 2RE2A 1JLCA 1C1CA 1IBKK 3DOLA 4O0JA 4CZMA 4KHNA 1JLFA 2ETJA 4CJUA 1TK0A 3FE1A 4HTLA 2KFNA 2NRHA 1IBMK 4FJHA 1GLLO 1LAVA 4DR1K 1NK8A 3VEWA 1J5EK 1NGFA 3P4IA 4DMNA 3CQ8A 1IKWA 3CCEN 3RR8A 2NUBA 4WF9L 2O8FA 4FOIA 1V4SA 3R9PA 4KV8A 1D9FA 1W2BM 2VG5A 2YHWA 3FFIA 1HNZK 2GV9A 3BY5A 3I8DA 4KHUA 1NGBA 4W5QA 2IS3A 2VG6A 1Z6RA 1GLDG 4FLTA 1EWQA 3NGIA 1NU0A 5HL7L 2IVPA 1G15A 4KH5A 4CZKA 4A5AA 4DSEA 4M3TA 2O8EA 5I42A 3TPQA 4DQ8A 4WQ4C 4G9ZA 1Z05A 5D3GA 4ID1A 4MFBA 4YOWA 3IMXA 3OYJA 3SQ0A 4CEZA 3ZX2A 3DRRA 3PV8A 1T05A 4DCHA 1LOTB 2GWKA 4FM0A 1XMQK 4M7YA 4B1VA 3R8EA 5AQGA 1ZYQA 3V9SA 4BC5A 1SL2A 3MX2A 4DR5K 5BR9A 1HKBA 2I7NA 2E1ZA 4DFJA 4K43A 5GINA 5HLFA 3QLHA 4CK3A 1W9HA 3GG4A 4J8FA 3HXMA 4FJMA 1JLGA 4N5SA 2KLAA 3P5JA 3K57A 3UKUA 3J8AA 4RW4A 3ZSRA 4QCLA 4CIFA 3PIOL 2IC3A 2HBJA 4JHDA 2PBDA 3TWHA 4DF8A 5HRRA 4DSKA 4IEIA 3M8PA 3LL3A 2FBVA 4CJ5A 1SKSA 1TVRA 4BE2A 2FBTA 4CFDA 3VGMA 1W7AA 3NGZA 4IXCA 5CY4A 5AQNA 3J81O 5KRTA 3L4QA 2JWLA 2W6KA 5E41A 1ZC6A 4DTOA 1VQ7N 4ID5A 5AQQA 1TK8A 4JKAA 3MAQA 3O80A 4CECA 3VF6A 3WEEA 4CZEA 3SUOA 2G8KA 2FSNA 1XHZA 4M63C 5A2QO 2OYQA 4C23A 4FWSA 3TR8A 4CK1A 3OYMA 3KHYA 3F9KA 3H6EA 5KQDA 3V9WA 3JYTA 3QIOA 2DPNA 4Z4FA 4XEIA 4CZIA 3VTHA 2RPIA 4KTZA 5ELZA 2E2QA 4FLYA 3JS6A 2E4LA 4DHYA 3SPYA 2HHVA 3QERA 4H0OA 1YAGA 4DF4A 1MWMA 3CPWM 1NK7A 4OPKA 4YY3K 2YNIA 4BRCA 2IGIA 4FW1A 1Z25A 4JI3K 3AVBA 4JRQA 1KVBA 1LWFA 1BIUA 5AQVA 4WE1A 3A2FA 4GW6A 3LZJA 3T3FA 1QTMA 4AHSA 3AVGA 4B9LA 3ZT0A 2HMIA 5HP1A 1L5UA 4GV9A 2LSNA 5AQOA 1JCEA 3I0SA 5M1KA 2ZJRL 1NMDA 3HRGA 4FLUA 2YV0X 3OTOK 4DKWA 1NOZA 3QIPA 5AQXA 4PQUA 4CEBA 4HWIA 1E4FT 2GEMA 4LH5A 3TAPA 4FYDA 4DU4A 3T1HK 4IG3A 1ZBIA 3OVNA 4CJWA 1YJNN 4CJ3A 1BGXT 2YHXA 2XY8A 3DRSA 4B9QA 3VQ9A 4M41A 1VRTA 4FJJA 4A5BA 4JLHA 2A40A 1BL3A 3TANA 2QWQA 1WLJA 3H1VX 4IZ9A 4DV6K 2FF6A 1J6ZA 1RTDA 2V51B 5MLCQ 2YNGA 4QS7A 2F8TA 1NGHA 3LAMA 3DRPA 3VQ5A 1RT7A 2XHBA 1DKGD 3QBXA 3GL1A 2ZE2A 3A5NC 4CJVA 3RMAA 3SK3A 1HPMA 3ULEB 2D1KA 2QTDA 1QVFM 3M3ZA 1C0FA 3ZCMA 4ZTFA 2HF3A 2FBYA 3K9JA 3D7EO 1XNQK 4O8UA 3LPTA 2UXCK 3J7AP 3QEWA 1SKWA 4MDAA 1FJGK 4N47A 3HPOA 3HJFA 2UXBK 3PIPL 3O9RA 2D0CA 1CZBA 4DR4K 1KTQA 1KAZA 3DLRA 2WC9A 2NRTA 3QEPA 3RWUA 3ZT2A 4EAHD 1HUXA 3SJHA 3THYB 4KREA 4DS4A 3L2RA 5C24A 1YVUA 3H3OB 4BRHA 2YNFA 3P38A 3ZSWA 4M3RA 4CERA 2PFUA 4KH6A 4CJPA 3SQ1A 4JI8K 2OPPA 5JVGL 3ALYA 3D6RA 4FWPA 4DV3K 3TSPA 3WQTA 4DQIA 3KTQA 3CJAA 4BACA 2G8VA 1CZAN 5I9EB 1C0UA 2GX9A 3VOVA 1ATSA 2YHBA 4F9OA 5GIOA 2Z1HA 3BZKA 1IG8A 1SL0A 4PKHA 1NBWA 4YORA 3ZT1A 2WUSA 3W3DA 1S1WA 3VGKA 3CJ7A 3G25A 5HRNA 1TL1A 4M3WA 2V52B 5GIPA 3E66A 4DV4K 5KGXA 1T8EA 1NMNA 4YDUA 3VESA 4BR2A 1GOAA 2F96A 4CHPA 4HUFA 5GAEP 5C2FA 1VK0A 2HHXA 1IBLK 1JXEA 3ISNC 4BC4A 2QXLA 2D0PA 1E3MA 2UUBK 4DU3A 2E5LK 1WSEA 1KVAA 2VCPA 3CFOA 2CGJA 4YOUA 5C15A 4CHZA 1LWEA 4CGGA 2X78A 3LDLA 4H4OA 3MXJA 1OKJA 1TKXA 1F21A 1S1XA 1LAWA 3C94A 5AJ3K 4I6MB 1NJIO 3V1OA 4PA1A 3KJVA 3IS9A 3NE6A 2P9SB 4JI2K 3PX0A 3U6FA 2JLEA 3D2FB 4TSXA 2IIRA 1P90A 1XC9A 1WAJA 1GOBA 1QZ6A 1S9EA 1YTAA 2HBKA 3F9MA 3EYZA 2ZD1A 4PKGA 4FVMA 4O4GA 4DR3K 4H0PA 4CF8A 5C2DA 3AO3A 1BOTO 1NK0A 3ZLJA 3OYBA 5CHIA 5J2PA 2OA8A 3U4LA 4OKKA 4HCBA 3OYCA 2OTLN 3CCUN 2YHAA 3NH2A 2F4VK 4I2PA 1S1TA 2BE2A 1TV6A 1YF5L 1I94K 1VQ4N 4PL7A 4M3XA 2WONA 4B3MK 5AZJA 2WOMA 4FLVA 1S72N 5FRNA 4DSLA 1U4BA 1J5OA 3ZETA 3DLHA 1HLUA 2HBMA 5AQKA 5HRPA 4O44A 3HVRA 5J2NA 4IFYA 3BF3A 4XH5A 1RT4A 3UKRB 3VA3A 3RVCA 3CFPA 2IVNA 4YOYA 1RT2A 1S6PA 1RBUA 1J54A 1SL1A 1X9MA 2PYJA 1SS6A 4B8AB 3KKRA 4WQ5A 3GE1A 3KKSA 4M7XA 3SI6A 3B6OA 4DTJA 3U3YA 3O4QA 3OYIA 2Q0RA 4JKGB 4FJ5A 3I8BA 5AQUA 2VG7A 1U6ZA 2O8BA 3TSUA 3THWA 4MLEA 3AVMA 4AHTA 1ZBSA 4KKOA 2E6LA 2QEXN 4KBOA 3MCAB 4DV0K 2P51A 3RRHA 1KC8O 3K0SA 3LAKA 4BY9C 4Y1CA 2HBLA 4OGEA 1K6YA 4DSFA 1IKXA 2D0AA 4N41A 4KHYA 4NXMK 3MN6A 1SV5A 2UYTA 4FWQA 4WYBA 3J7ZO 4X66K 2UUAK 2R7YA 4J2EA 1CXUA 2YHYA 3LM9A 4FK0A 1NNEA 3O1BA 1K8KA 2YCHA 4NYFA 2XY5A 1N36K 5JS1A 4XH4A 4A57A 2NRRA 1CLQA 3CQYA 2Q97A 3LM2A 3SQ2A 1BI4A 2O8DA 4FLZA 4F4KA 3C95A 4EZ9A 2ZF5O 4O0IA 4GKJK 1DTQA 4B08A 1Q8IA 1ZBHA 2YX6A 4B3RK 3EZ5A 4DQQA 3OYEA 1QS4A 1N5YA 3QB0A 1S9GA 3NFAA 4BDYA 1NK5A 4RW9A 3P39A 3EZWA 3QEVA 4NB4A 2DFEA 3HM8A 3DXMB 2NRXA 1NGGA 3QICA 3VQQA 4KTQA 3K5NA 1Y97A 1B9FA 1S1VA 3LDPA 1S6QA 5EY4A 3NVMA 4CJ4A 3SMSA 1T7PA 4U7BA 3CJ9A 4HUGA 2BUPA 1RCHA 4W5TA 3CMEN 2HHSA 4KI4A 2VWKA 1B92A 5ADXH 1EETA 2HHQA 3OJSA 3H1QA 4BDZA 3SAGA 5GADP 1VSEA 2NZTA 3IKMA 3M1FA 4A2AA 3NVKA 3NBPA 4A61A 4FSVA 3NMUA 3T7ZA 1ASUA 1RDWX 2PAVA 3DI6A 4PL8A 1EWRA 2OTJN 4IKFA 2G8IA 4DV1K 2XO7A 2P9NA 4IBNA 4RW8A 3E9OA 2QWPA 5BREA 1BQNA 3LP2A 5JLHA 2D0OA 1NG9A 4BC3A 2H3GX 4ILHA 2IOCA 2UXDK 2A6AA 3WXMB 4KHPK 4BVOA 2RN2A 1RILA 4KTWA 3CJ1A 3OHRA 5AQHA 3SMPA 1BUPA 3T19A 1VSIA 1SAZA 1BIZA 2AP1A 3CYMA 3SYZA 4J2BA 2YI1A 3AO4A 4B3TK
chains in the Genus database with same CATH topology
1BIUA 4M45A 4CHQA 1Z26A 4K8ZA 4WE1A 3LANA 2A1RA 4KB0A 3A2FA 4GW6A 3NCIA 3LZJA 3KIOA 4AHSA 3AVGA 3T3FA 1QTMA 4B9LA 4DTXA 4NCAA 1O1WA 1TKTA 2E6MA 4AILC 3ZT0A 2HMIA 5HP1A 1L5UA 2LSNA 2Q3SA 4PY5A 3ZT4A 3I0SA 3QEIA 1VSKA 2ITGA 2F8SA 4CJSA 4HVJA 3SPZA 3HK2A 4CHOA 1BCOA 4FLUA 2YV0X 1NOZA 3QIPA 4PQUA 4YNQA 1KLMA 4CEBA 5SZTA 4O55A 1HQUA 1LWCA 3O3HA 2IDOA 3PO4A 3TAQA 4LH5A 3SQ4A 3S3NA 3TAPA 1JLAA 2Z1GA 4FYDA 4DU4A 4CK2A 4IG3A 1ZBIA 1JKHA 3OVNA 1R0AA 3MEEA 3LP0A 1EX4A 4CJWA 1TAQA 4CJ3A 1BGXT 3CFRA 4CF2A 2OZMA 2XY8A 3DRSA 4LY7A 3VQ9A 3BDPA 1FKOA 1VRTA 4M41A 4AHUA 3K5MA 3LZIA 1RTJA 4FJJA 4N76A 2PY5A 4UQGA 4CE9A 2YKNA 2EHGA 4JLHA 1XWLA 2FC0A 1WN7A 1BL3A 4CF1A 3TANA 4CFCA 4CEAA 4E7IA 3QETA 3TAMA 5HROA 1WLJA 3VQEA 1D5AA 3VA0A 2I5JA 1RTDA 3SUPA 4KB1A 1HPZA 2YNGA 2F8TA 3H08A 4OVLA 1QE1A 3LAMA 5CZ2A 3NH1A 3RR7A 2JGUA 3DRPA 1JLEA 3VQ5A 3WNFA 1RT7A 3OYFA 4DTSA 2XHBA 2Y1JA 1NK6A 4L8RB 2D5RA 2ZE2A 3AA4A 3AVLA 1C0MA 3HT3A 3L2VA 2O4IA 4CJVA 4DTMA 3RMAA 4FLXA 3LP1A 4Z4HA 3RMBA 1J53A 4CJEA 1Q9XA 3ZCMA 4ZTFA 2FBYA 4W5RA 3PO5A 4KO0A 2X74A 3F73A 3LPTA 4HHTA 3SV4A 3QEWA 5KGWA 4AHRA 4CHNA 1SKWA 1WSHA 3QO9A 1KLNA 4M3ZA 2BDPA 1C1AA 1QSSA 3B6PA 5JS2A 3DLBA 4CF0A 3SZ2A 4CESA 4Z0UA 4N47A 3HPOA 3HJFA 3S3MA 2RF2A 4FW2A 2D0CA 1CZBA 4E1MA 1KTQA 3NGYA 5T7BA 1W0HA 3DLRA 4FLWA 3QEPA 4ZTJA 4B9TA 3LALA 3RWUA 4I7FA 4FJ7A 3ZSXA 3ZT2A 2OPSA 2HNZA 3MEGA 3KLFA 1NJWA 3PY8A 2X6NA 1RNHA 2Z1IA 3L8BA 1VSLA 3SCXA 4KPYA 4KREA 1LW2A 4DS4A 3KLEA 3L2RA 5C24A 3KLGA 4OPJA 1YVUA 1A5VA 4I9QA 1EP4A 4J2AA 1RBTA 5KRSA 4LD0A 2YNFA 1WSFA 1I39A 1NJXA 3ZSWA 4DG1A 3V9XA 3QNNA 3SUQA 4QCLA 1RTIA 3AVKA 4M3RA 4ICLA 4CERA 4CEFA 4CJPA 5SWMA 3SQ1A 1EXQA 1U49A 4B9VA 4FCYA 1TL3A 1HNVA 2OPPA 3K5OA 4FJXA 1FK9A 3ALYA 1IH7A 4F3TA 4CGHA 1GOCA 4XIUA 4DQIA 3KD1E 2KZMA 3KTQA 4BACA 2G8VA 4CJFA 1IKYA 1RBRA 1QQCA 4FM2A 2DFHA 1ASWA 1EKEA 1C0UA 4KHSA 4C8NA 5CYQA 2YHBA 4ELVA 3V1QA 1VSMA 3DLGA 3JSMA 2Z1HA 3NDKA 3AVNA 3D45A 1XI1A 1TK5A 1N6QA 2G8HA 4E0DA 5FRMA 3TAGA 3G10A 1NJZA 1SL0A 2HNYA 3E01A 3K5LA 3IAYA 3ZT1A 2PYLA 4DWIA 1QSYA 1NKBA 3ZSVA 1S1WA 1WSGA 3M8SA 3QNOA 3S9HA 1YT3A 2G8UA 3LDSA 4BE0A 3SUNA 4RW6A 4M42A 3TABA 1ITGA 4K8XA 1C0TA 4CJKA 3D0PA 5HRNA 3OS1A 1TL1A 4DTNA 1RDDA 2P1JA 3TARA 1VSFA 4M3WA 3VQ4A 1HYVA 4YFUA 1L3VA 4EZ6A 2P5GA 3LWLA 5KGXA 2KFZA 1T8EA 3K59A 1NKEA 1BI4B 1U45A 2KZZA 4IDKA 3MECA 2HVHA 1GOAA 2BGGA 4NYNA 2F96A 4CHPA 4HUFA 4LSNA 3L2WA 1VK0A 4DTUA 4DFKA 2HHXA 5DMRA 1D8YA 4QAGA 1JXEA 3PUFA 1BHLA 3ISNC 3L3VA 3ZSQA 4DU3A 1WSEA 3V1RA 3C6TA 1KVAA 3NHGA 3VN5A 3ZSZA 3CFOA 3QINA 2OPRA 3HP6A 4DLEA 4E7JA 1HYSA 4OKJA 3M8RA 4CHZA 1LWEA 4CGGA 1YTUA 4M3YA 2X78A 4BDPA 4I9LA 1L3UA 1NK9A 3G0ZA 4H4OA 3SV3A 4J2DA 3L3UA 2YNHA 3TAFA 1S1UA 1B9DA 2KTQA 4KRFA 3EY1A 4N56A 3MXJA 2HHUA 1TKXA 1F21A 4CFBA 3OS0A 2OPQA 2AJQA 5CYMA 1S1XA 1LAWA 3C94A 1UA0A 1KFDA 4HTUA 3V6DA 4DFMA 4PWDA 4C8KA 3NAEA 4ELTA 3NF6A 3DM2A 3V1OA 3HPHA 1FXXA 4FK2A 4PA1A 4FJNA 1X1PA 3KJVA 3IS9A 4FXDA 3NE6A 1VRUA 3NH0A 4W5OA 4AHVA 3PX0A 3U6FA 1A5XA 2GBZA 2JLEA 4FJ8A 4TSXA 1C6VA 3MXIA 5HBMA 2DFFA 3OY9A 1XC9A 4I2QA 1WAJA 3T1AA 2XRIA 1GOBA 3WNHA 4F3OA 1S9EA 3AVFA 3MXMA 1QHTA 3OYAA 1YTAA 2BANA 4F2RA 1JL1A 1RT6A 1WSIA 2ZD1A 3WNEA 3EYZA 3TI0A 5KTQA 4FVMA 4O4GA 3VQAA 3LWMA 4E3SA 3O4NA 2QKKA 4FZXC 1WNSA 4BWJA 3ITHA 3V81A 4CF8A 1A5WA 3AO3A 1C1BA 1RTHA 4CEDA 3TAEA 1NK0A 3UIQA 1TKZA 2B4JA 2D0BA 4GMJB 3OYGA 4M3UA 3OS2A 4IG0A 1BQMA 3LP3A 1RDAA 3OYBA 2W42A 1NKCA 2KW4A 3HVTA 5J2PA 2DTUA 4EP5A 2OA8A 4RW7A 1MU2A 3M8QA 4DLGA 5HRSA 3VQPA 3VQBA 4E7HA 3AVJA 4DTRA 3OYHA 1T03A 4B3OA 4B9NA 4OKKA 4CEEA 3HM9A 3OYCA 4HCBA 1UA1A 4DSJA 3AA2A 4CJQA 1NOYA 2QXFA 4W5NA 1HYZA 1Q9YA 1HNIA 2YHAA 3NH2A 4I2PA 3VQDA 4Z4GA 1S1TA 2BE2A 1TV6A 3SJJA 4CJLA 4M3XA 2WONA 1WSJA 3KLIA 4G1QA 1JLBA 2QKBA 2WOMA 4FLVA 3L2UA 1RBVA 3OJUA 3CM5A 4DSLA 2IAJA 5FRNA 1TAUA 3DYAA 1U4BA 1J5OA 3AVAA 1REVA 1QSLA 3AVIA 4RG8A 1TGOA 3OYKA 2YKMA 4DTPA 3DLHA 2DY4A 1ZBLA 5HRPA 4NCGA 4O44A 3VQ8A 5J2QA 3HVRA 5J2NA 3P83D 4IFYA 2XY7A 4E7KA 1RT4A 4ELUA 2HNDA 4R5PA 3V9ZA 3VA3A 4OLBA 3PX6A 4FJGA 4DU1A 3CFPA 4OJRA 3O3FA 2ATQA 1RT2A 1WAFA 2HHWA 1S6PA 1UWBA 3VQ6A 1RBUA 1J54A 3DMJA 4B8CA 1SL1A 1D9DA 1X9MA 1XHXA 2OZSA 3C6UA 4DQSA 2PYJA 1HQEA 4B8AB 3KKRA 4CFAA 3OYLA 4LH4A 3RMDA 3K58A 2HVIA 4DSIA 3KKSA 1JLCA 1C1CA 3NF9A 3B6OA 3SI6A 2HW3A 1SUQA 3DOLA 3PX4A 4DTJA 3U3YA 3O4QA 4Z4CA 4O0JA 3OYIA 4KHNA 1FKPA 1X9WA 1JLFA 1NK4A 2ETJA 4CJUA 1TK0A 2HHTA 2KFNA 2B6AA 4FJHA 4FJ5A 2RKIA 3KD5E 1LAVA 1NK8A 4NCBA 4Z4EA 4JS5A 1I3AA 2VG7A 3P1GA 1L3TA 4H8KA 3AVMA 4IFVA 1JXBA 4AHTA 4DMNA 4PUOA 1UOCA 1IKWA 3NF7A 4KKOA 2E6LA 4OKEA 1RDCA 1VSJA 2NUBA 3ZSYA 3RTVA 3RR8A 2P51A 3RRHA 2PZSA 4DFPA 1TKDA 3LAKA 4CEQA 1HRHA 1CZ9A 4Y1CA 4OGEA 1K6YA 4DSFA 1IKXA 2D0AA 1KVCA 1U04A 3HYFA 4KV8A 4JS4A 1D9FA 4N41A 4FJKA 4KHYA 3HP9A 4CF9A 1SV5A 4KFBA 1U48A 2VG5A 3S3OA 2GUIA 3IG1A 4F8RA 3FFIA 2R7YA 4CHYA 4J2EA 3AVHA 1CXUA 5FDLA 2GV9A 3VQCA 4FK0A 3I8DA 4KHUA 4W5QA 2Y1IA 4FK4A 2IS3A 3AO5A 2VG6A 3K2PA 4OGCA 4Q5VA 3QEXA 4FLTA 1VSHA 3NGIA 1LW0A 4ZHRA 4NYFA 2XY5A 3BGRA 1BISA 5JS1A 1G15A 1JLQA 4DSEA 3AA3A 4C8LA 4M3TA 1CLQA 3KK1A 5I42A 3HL8A 3LPUA 3HSTB 5J2MA 4OLAA 3CG7A 3IRXA 3KK2A 3OYNA 3SQ2A 1BI4A 4KHWA 4FLZA 2Z1JA 1HJRA 3C95A 4F4KA 4BWMA 5D3GA 4ID1A 4MFBA 4EZ9A 5FROA 3HPGA 4O0IA 1JL2A 1LV5A 1DTQA 4B08A 3KK3A 3OYJA 1Q8IA 1S5JA 3SQ0A 1CXQA 5EU7A 4CEZA 3DRRA 3PV8A 1T05A 1J9AA 1ZBHA 1HMVA 3V9UA 5K14A 3O3GA 1SKRA 4C8OA 3EZ5A 3SNNA 4DQQA 3OYEA 5I3UA 4KAZA 1IKVA 1QS4A 4FM0A 1VSDA 2XY6A 1N5YA 4LSLA 3QESA 1S9GA 4EP4A 1ZYQA 4AH9A 5DK5A 1KCFA 3V9SA 1SL2A 3NFAA 4CGJA 4CJTA 5C25A 4BDYA 1NK5A 4RW9A 4E1NA 4DFJA 1L3SA 3NF8A 3VQ7A 3QEVA 2G8WA 5HLFA 3QLHA 4CK3A 1W9HA 2DFEA 2HB5A 5CZ1A 3HXMA 3DLEA 1DTTA 4DQRA 1JLGA 3DOKA 4FJMA 3AVCA 4N5SA 3P5JA 3VQQA 5KI6A 4KTQA 3WNGA 3K5NA 1Y97A 4AHCA 1B9FA 1S1VA 3K57A 4HUEA 4RW4A 3ZSRA 1NJYA 4B9MA 4KI6A 1S6QA 4Z4IA 4CIFA 3CQ8A 4B9UA 4CJ4A 2IC3A 4E7LA 1T7PA 4CGDA 4Q0BA 3TWHA 4HUGA 1ASVA 3V4IA 4DF8A 5HRRA 4DSKA 4E89A 3M8PA 1RCHA 2FBVA 3ZSOA 4W5TA 4DS5A 4Y1DA 1RT1A 4CJ5A 1TVRA 1X9SA 2B5JA 3AO1A 1SKSA 4BE2A 2FBTA 4CFDA 1IG9A 3NGZA 2HHSA 4KI4A 5CY4A 2VWKA 3THVA 1B92A 5KRTA 4FZYA 4E19A 3RRGA 1EETA 3ZT3A 2HHQA 5E41A 3OJSA 1RT5A 4DTOA 2ZQBA 4BDZA 1ZBFA 4ID5A 1RDBA 3ULDA 1TK8A 1VSEA 3OYDA 3MAQA 4BE1A 1KRPA 4JRPA 4CECA 4DQPA 3SUOA 3NBPA 2O4GA 2G8KA 5C42A 4KHQA 1XHZA 2OYQA 3CM6A 1KSPA 4H4MA 1ASUA 4CGFA 4FM1A 3DI6A 3AA5X 4CIEA 4FJ9A 4CCHA 3TR8A 4CK1A 3OYMA 4IKFA 2G8IA 4C8MA 2XO7A 2G8FA 4IBNA 4RW8A 3F9KA 3AO2A 4GVMA 3V9WA 1BCMA 3JYTA 4CEOA 1DLOA 1BQNA 3AV9A 3RMCA 3LP2A 1IO2A 4MQ3A 3QIOA 4CGIA 4Z4FA 3HO1A 2EX3A 3L2QA 2RPIA 4KTZA 1RBSA 4O5BA 2IOCA 4FLYA 4B9SA 4QOZB 2E4LA 2KQ2A 3I0RA 1RT3A 3SPYA 2HHVA 3QERA 4CIGA 1U47A 2RN2A 2FBXA 4CJRA 1RILA 1KFSA 4KTWA 4FZZA 4DF4A 3KLHA 3U3GA 1NK7A 2VWJA 4OPKA 2P5OA 1ZBUA 4F2SA 4FJIA 3ASMA 2YNIA 4HCCA 2X6SA 3T19A 1VSIA 2IGIA 1UAXA 1BIZA 5J1EA 2A1SA 2QK9A 4FW1A 1Z25A 4FJLA 3CYMA 3AVBA 4JRQA 3SYZA 4J2BA 3DLKA 1KVBA 1LWFA 3AO4A 3MEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIU A;  4M45 A;  4CHQ A;  1Z26 A;  4K8Z A;  4WE1 A;  3LAN A;  2A1R A;  4KB0 A;  3A2F A;  4GW6 A;  3NCI A;  3LZJ A;  3KIO A;  4AHS A;  3AVG A;  3T3F A;  1QTM A;  4B9L A;  4DTX A;  4NCA A;  1O1W A;  1TKT A;  2E6M A;  4AIL C;  3ZT0 A;  2HMI A;  5HP1 A;  1L5U A;  2LSN A;  2Q3S A;  4PY5 A;  3ZT4 A;  3I0S A;  3QEI A;  1VSK A;  2ITG A;  2F8S A;  4CJS A;  4HVJ A;  3SPZ A;  3HK2 A;  4CHO A;  1BCO A;  4FLU A;  2YV0 X;  1NOZ A;  3QIP A;  4PQU A;  4YNQ A;  1KLM A;  4CEB A;  5SZT A;  4O55 A;  1HQU A;  1LWC A;  3O3H A;  2IDO A;  3PO4 A;  3TAQ A;  4LH5 A;  3SQ4 A;  3S3N A;  3TAP A;  1JLA A;  2Z1G A;  4FYD A;  4DU4 A;  4CK2 A;  4IG3 A;  1ZBI A;  1JKH A;  3OVN A;  1R0A A;  3MEE A;  3LP0 A;  1EX4 A;  4CJW A;  1TAQ A;  4CJ3 A;  1BGX T;  3CFR A;  4CF2 A;  2OZM A;  2XY8 A;  3DRS A;  4LY7 A;  3VQ9 A;  3BDP A;  1FKO A;  1VRT A;  4M41 A;  4AHU A;  3K5M A;  3LZI A;  1RTJ A;  4FJJ A;  4N76 A;  2PY5 A;  4UQG A;  4CE9 A;  2YKN A;  2EHG A;  4JLH A;  1XWL A;  2FC0 A;  1WN7 A;  1BL3 A;  4CF1 A;  3TAN A;  4CFC A;  4CEA A;  4E7I A;  3QET A;  3TAM A;  5HRO A;  1WLJ A;  3VQE A;  1D5A A;  3VA0 A;  2I5J A;  1RTD A;  3SUP A;  4KB1 A;  1HPZ A;  2YNG A;  2F8T A;  3H08 A;  4OVL A;  1QE1 A;  3LAM A;  5CZ2 A;  3NH1 A;  3RR7 A;  2JGU A;  3DRP A;  1JLE A;  3VQ5 A;  3WNF A;  1RT7 A;  3OYF A;  4DTS A;  2XHB A;  2Y1J A;  1NK6 A;  4L8R B;  2D5R A;  2ZE2 A;  3AA4 A;  3AVL A;  1C0M A;  3HT3 A;  3L2V A;  2O4I A;  4CJV A;  4DTM A;  3RMA A;  4FLX A;  3LP1 A;  4Z4H A;  3RMB A;  1J53 A;  4CJE A;  1Q9X A;  3ZCM A;  4ZTF A;  2FBY A;  4W5R A;  3PO5 A;  4KO0 A;  2X74 A;  3F73 A;  3LPT A;  4HHT A;  3SV4 A;  3QEW A;  5KGW A;  4AHR A;  4CHN A;  1SKW A;  1WSH A;  3QO9 A;  1KLN A;  4M3Z A;  2BDP A;  1C1A A;  1QSS A;  3B6P A;  5JS2 A;  3DLB A;  4CF0 A;  3SZ2 A;  4CES A;  4Z0U A;  4N47 A;  3HPO A;  3HJF A;  3S3M A;  2RF2 A;  4FW2 A;  2D0C A;  1CZB A;  4E1M A;  1KTQ A;  3NGY A;  5T7B A;  1W0H A;  3DLR A;  4FLW A;  3QEP A;  4ZTJ A;  4B9T A;  3LAL A;  3RWU A;  4I7F A;  4FJ7 A;  3ZSX A;  3ZT2 A;  2OPS A;  2HNZ A;  3MEG A;  3KLF A;  1NJW A;  3PY8 A;  2X6N A;  1RNH A;  2Z1I A;  3L8B A;  1VSL A;  3SCX A;  4KPY A;  4KRE A;  1LW2 A;  4DS4 A;  3KLE A;  3L2R A;  5C24 A;  3KLG A;  4OPJ A;  1YVU A;  1A5V A;  4I9Q A;  1EP4 A;  4J2A A;  1RBT A;  5KRS A;  4LD0 A;  2YNF A;  1WSF A;  1I39 A;  1NJX A;  3ZSW A;  4DG1 A;  3V9X A;  3QNN A;  3SUQ A;  4QCL A;  1RTI A;  3AVK A;  4M3R A;  4ICL A;  4CER A;  4CEF A;  4CJP A;  5SWM A;  3SQ1 A;  1EXQ A;  1U49 A;  4B9V A;  4FCY A;  1TL3 A;  1HNV A;  2OPP A;  3K5O A;  4FJX A;  1FK9 A;  3ALY A;  1IH7 A;  4F3T A;  4CGH A;  1GOC A;  4XIU A;  4DQI A;  3KD1 E;  2KZM A;  3KTQ A;  4BAC A;  2G8V A;  4CJF A;  1IKY A;  1RBR A;  1QQC A;  4FM2 A;  2DFH A;  1ASW A;  1EKE A;  1C0U A;  4KHS A;  4C8N A;  5CYQ A;  2YHB A;  4ELV A;  3V1Q A;  1VSM A;  3DLG A;  3JSM A;  2Z1H A;  3NDK A;  3AVN A;  3D45 A;  1XI1 A;  1TK5 A;  1N6Q A;  2G8H A;  4E0D A;  5FRM A;  3TAG A;  3G10 A;  1NJZ A;  1SL0 A;  2HNY A;  3E01 A;  3K5L A;  3IAY A;  3ZT1 A;  2PYL A;  4DWI A;  1QSY A;  1NKB A;  3ZSV A;  1S1W A;  1WSG A;  3M8S A;  3QNO A;  3S9H A;  1YT3 A;  2G8U A;  3LDS A;  4BE0 A;  3SUN A;  4RW6 A;  4M42 A;  3TAB A;  1ITG A;  4K8X A;  1C0T A;  4CJK A;  3D0P A;  5HRN A;  3OS1 A;  1TL1 A;  4DTN A;  1RDD A;  2P1J A;  3TAR A;  1VSF A;  4M3W A;  3VQ4 A;  1HYV A;  4YFU A;  1L3V A;  4EZ6 A;  2P5G A;  3LWL A;  5KGX A;  2KFZ A;  1T8E A;  3K59 A;  1NKE A;  1BI4 B;  1U45 A;  2KZZ A;  4IDK A;  3MEC A;  2HVH A;  1GOA A;  2BGG A;  4NYN A;  2F96 A;  4CHP A;  4HUF A;  4LSN A;  3L2W A;  1VK0 A;  4DTU A;  4DFK A;  2HHX A;  5DMR A;  1D8Y A;  4QAG A;  1JXE A;  3PUF A;  1BHL A;  3ISN C;  3L3V A;  3ZSQ A;  4DU3 A;  1WSE A;  3V1R A;  3C6T A;  1KVA A;  3NHG A;  3VN5 A;  3ZSZ A;  3CFO A;  3QIN A;  2OPR A;  3HP6 A;  4DLE A;  4E7J A;  1HYS A;  4OKJ A;  3M8R A;  4CHZ A;  1LWE A;  4CGG A;  1YTU A;  4M3Y A;  2X78 A;  4BDP A;  4I9L A;  1L3U A;  1NK9 A;  3G0Z A;  4H4O A;  3SV3 A;  4J2D A;  3L3U A;  2YNH A;  3TAF A;  1S1U A;  1B9D A;  2KTQ A;  4KRF A;  3EY1 A;  4N56 A;  3MXJ A;  2HHU A;  1TKX A;  1F21 A;  4CFB A;  3OS0 A;  2OPQ A;  2AJQ A;  5CYM A;  1S1X A;  1LAW A;  3C94 A;  1UA0 A;  1KFD A;  4HTU A;  3V6D A;  4DFM A;  4PWD A;  4C8K A;  3NAE A;  4ELT A;  3NF6 A;  3DM2 A;  3V1O A;  3HPH A;  1FXX A;  4FK2 A;  4PA1 A;  4FJN A;  1X1P A;  3KJV A;  3IS9 A;  4FXD A;  3NE6 A;  1VRU A;  3NH0 A;  4W5O A;  4AHV A;  3PX0 A;  3U6F A;  1A5X A;  2GBZ A;  2JLE A;  4FJ8 A;  4TSX A;  1C6V A;  3MXI A;  5HBM A;  2DFF A;  3OY9 A;  1XC9 A;  4I2Q A;  1WAJ A;  3T1A A;  2XRI A;  1GOB A;  3WNH A;  4F3O A;  1S9E A;  3AVF A;  3MXM A;  1QHT A;  3OYA A;  1YTA A;  2BAN A;  4F2R A;  1JL1 A;  1RT6 A;  1WSI A;  2ZD1 A;  3WNE A;  3EYZ A;  3TI0 A;  5KTQ A;  4FVM A;  4O4G A;  3VQA A;  3LWM A;  4E3S A;  3O4N A;  2QKK A;  4FZX C;  1WNS A;  4BWJ A;  3ITH A;  3V81 A;  4CF8 A;  1A5W A;  3AO3 A;  1C1B A;  1RTH A;  4CED A;  3TAE A;  1NK0 A;  3UIQ A;  1TKZ A;  2B4J A;  2D0B A;  4GMJ B;  3OYG A;  4M3U A;  3OS2 A;  4IG0 A;  1BQM A;  3LP3 A;  1RDA A;  3OYB A;  2W42 A;  1NKC A;  2KW4 A;  3HVT A;  5J2P A;  2DTU A;  4EP5 A;  2OA8 A;  4RW7 A;  1MU2 A;  3M8Q A;  4DLG A;  5HRS A;  3VQP A;  3VQB A;  4E7H A;  3AVJ A;  4DTR A;  3OYH A;  1T03 A;  4B3O A;  4B9N A;  4OKK A;  4CEE A;  3HM9 A;  3OYC A;  4HCB A;  1UA1 A;  4DSJ A;  3AA2 A;  4CJQ A;  1NOY A;  2QXF A;  4W5N A;  1HYZ A;  1Q9Y A;  1HNI A;  2YHA A;  3NH2 A;  4I2P A;  3VQD A;  4Z4G A;  1S1T A;  2BE2 A;  1TV6 A;  3SJJ A;  4CJL A;  4M3X A;  2WON A;  1WSJ A;  3KLI A;  4G1Q A;  1JLB A;  2QKB A;  2WOM A;  4FLV A;  3L2U A;  1RBV A;  3OJU A;  3CM5 A;  4DSL A;  2IAJ A;  5FRN A;  1TAU A;  3DYA A;  1U4B A;  1J5O A;  3AVA A;  1REV A;  1QSL A;  3AVI A;  4RG8 A;  1TGO A;  3OYK A;  2YKM A;  4DTP A;  3DLH A;  2DY4 A;  1ZBL A;  5HRP A;  4NCG A;  4O44 A;  3VQ8 A;  5J2Q A;  3HVR A;  5J2N A;  3P83 D;  4IFY A;  2XY7 A;  4E7K A;  1RT4 A;  4ELU A;  2HND A;  4R5P A;  3V9Z A;  3VA3 A;  4OLB A;  3PX6 A;  4FJG A;  4DU1 A;  3CFP A;  4OJR A;  3O3F A;  2ATQ A;  1RT2 A;  1WAF A;  2HHW A;  1S6P A;  1UWB A;  3VQ6 A;  1RBU A;  1J54 A;  3DMJ A;  4B8C A;  1SL1 A;  1D9D A;  1X9M A;  1XHX A;  2OZS A;  3C6U A;  4DQS A;  2PYJ A;  1HQE A;  4B8A B;  3KKR A;  4CFA A;  3OYL A;  4LH4 A;  3RMD A;  3K58 A;  2HVI A;  4DSI A;  3KKS A;  1JLC A;  1C1C A;  3NF9 A;  3B6O A;  3SI6 A;  2HW3 A;  1SUQ A;  3DOL A;  3PX4 A;  4DTJ A;  3U3Y A;  3O4Q A;  4Z4C A;  4O0J A;  3OYI A;  4KHN A;  1FKP A;  1X9W A;  1JLF A;  1NK4 A;  2ETJ A;  4CJU A;  1TK0 A;  2HHT A;  2KFN A;  2B6A A;  4FJH A;  4FJ5 A;  2RKI A;  3KD5 E;  1LAV A;  1NK8 A;  4NCB A;  4Z4E A;  4JS5 A;  1I3A A;  2VG7 A;  3P1G A;  1L3T A;  4H8K A;  3AVM A;  4IFV A;  1JXB A;  4AHT A;  4DMN A;  4PUO A;  1UOC A;  1IKW A;  3NF7 A;  4KKO A;  2E6L A;  4OKE A;  1RDC A;  1VSJ A;  2NUB A;  3ZSY A;  3RTV A;  3RR8 A;  2P51 A;  3RRH A;  2PZS A;  4DFP A;  1TKD A;  3LAK A;  4CEQ A;  1HRH A;  1CZ9 A;  4Y1C A;  4OGE A;  1K6Y A;  4DSF A;  1IKX A;  2D0A A;  1KVC A;  1U04 A;  3HYF A;  4KV8 A;  4JS4 A;  1D9F A;  4N41 A;  4FJK A;  4KHY A;  3HP9 A;  4CF9 A;  1SV5 A;  4KFB A;  1U48 A;  2VG5 A;  3S3O A;  2GUI A;  3IG1 A;  4F8R A;  3FFI A;  2R7Y A;  4CHY A;  4J2E A;  3AVH A;  1CXU A;  5FDL A;  2GV9 A;  3VQC A;  4FK0 A;  3I8D A;  4KHU A;  4W5Q A;  2Y1I A;  4FK4 A;  2IS3 A;  3AO5 A;  2VG6 A;  3K2P A;  4OGC A;  4Q5V A;  3QEX A;  4FLT A;  1VSH A;  3NGI A;  1LW0 A;  4ZHR A;  4NYF A;  2XY5 A;  3BGR A;  1BIS A;  5JS1 A;  1G15 A;  1JLQ A;  4DSE A;  3AA3 A;  4C8L A;  4M3T A;  1CLQ A;  3KK1 A;  5I42 A;  3HL8 A;  3LPU A;  3HST B;  5J2M A;  4OLA A;  3CG7 A;  3IRX A;  3KK2 A;  3OYN A;  3SQ2 A;  1BI4 A;  4KHW A;  4FLZ A;  2Z1J A;  1HJR A;  3C95 A;  4F4K A;  4BWM A;  5D3G A;  4ID1 A;  4MFB A;  4EZ9 A;  5FRO A;  3HPG A;  4O0I A;  1JL2 A;  1LV5 A;  1DTQ A;  4B08 A;  3KK3 A;  3OYJ A;  1Q8I A;  1S5J A;  3SQ0 A;  1CXQ A;  5EU7 A;  4CEZ A;  3DRR A;  3PV8 A;  1T05 A;  1J9A A;  1ZBH A;  1HMV A;  3V9U A;  5K14 A;  3O3G A;  1SKR A;  4C8O A;  3EZ5 A;  3SNN A;  4DQQ A;  3OYE A;  5I3U A;  4KAZ A;  1IKV A;  1QS4 A;  4FM0 A;  1VSD A;  2XY6 A;  1N5Y A;  4LSL A;  3QES A;  1S9G A;  4EP4 A;  1ZYQ A;  4AH9 A;  5DK5 A;  1KCF A;  3V9S A;  1SL2 A;  3NFA A;  4CGJ A;  4CJT A;  5C25 A;  4BDY A;  1NK5 A;  4RW9 A;  4E1N A;  4DFJ A;  1L3S A;  3NF8 A;  3VQ7 A;  3QEV A;  2G8W A;  5HLF A;  3QLH A;  4CK3 A;  1W9H A;  2DFE A;  2HB5 A;  5CZ1 A;  3HXM A;  3DLE A;  1DTT A;  4DQR A;  1JLG A;  3DOK A;  4FJM A;  3AVC A;  4N5S A;  3P5J A;  3VQQ A;  5KI6 A;  4KTQ A;  3WNG A;  3K5N A;  1Y97 A;  4AHC A;  1B9F A;  1S1V A;  3K57 A;  4HUE A;  4RW4 A;  3ZSR A;  1NJY A;  4B9M A;  4KI6 A;  1S6Q A;  4Z4I A;  4CIF A;  3CQ8 A;  4B9U A;  4CJ4 A;  2IC3 A;  4E7L A;  1T7P A;  4CGD A;  4Q0B A;  3TWH A;  4HUG A;  1ASV A;  3V4I A;  4DF8 A;  5HRR A;  4DSK A;  4E89 A;  3M8P A;  1RCH A;  2FBV A;  3ZSO A;  4W5T A;  4DS5 A;  4Y1D A;  1RT1 A;  4CJ5 A;  1TVR A;  1X9S A;  2B5J A;  3AO1 A;  1SKS A;  4BE2 A;  2FBT A;  4CFD A;  1IG9 A;  3NGZ A;  2HHS A;  4KI4 A;  5CY4 A;  2VWK A;  3THV A;  1B92 A;  5KRT A;  4FZY A;  4E19 A;  3RRG A;  1EET A;  3ZT3 A;  2HHQ A;  5E41 A;  3OJS A;  1RT5 A;  4DTO A;  2ZQB A;  4BDZ A;  1ZBF A;  4ID5 A;  1RDB A;  3ULD A;  1TK8 A;  1VSE A;  3OYD A;  3MAQ A;  4BE1 A;  1KRP A;  4JRP A;  4CEC A;  4DQP A;  3SUO A;  3NBP A;  2O4G A;  2G8K A;  5C42 A;  4KHQ A;  1XHZ A;  2OYQ A;  3CM6 A;  1KSP A;  4H4M A;  1ASU A;  4CGF A;  4FM1 A;  3DI6 A;  3AA5 X;  4CIE A;  4FJ9 A;  4CCH A;  3TR8 A;  4CK1 A;  3OYM A;  4IKF A;  2G8I A;  4C8M A;  2XO7 A;  2G8F A;  4IBN A;  4RW8 A;  3F9K A;  3AO2 A;  4GVM A;  3V9W A;  1BCM A;  3JYT A;  4CEO A;  1DLO A;  1BQN A;  3AV9 A;  3RMC A;  3LP2 A;  1IO2 A;  4MQ3 A;  3QIO A;  4CGI A;  4Z4F A;  3HO1 A;  2EX3 A;  3L2Q A;  2RPI A;  4KTZ A;  1RBS A;  4O5B A;  2IOC A;  4FLY A;  4B9S A;  4QOZ B;  2E4L A;  2KQ2 A;  3I0R A;  1RT3 A;  3SPY A;  2HHV A;  3QER A;  4CIG A;  1U47 A;  2RN2 A;  2FBX A;  4CJR A;  1RIL A;  1KFS A;  4KTW A;  4FZZ A;  4DF4 A;  3KLH A;  3U3G A;  1NK7 A;  2VWJ A;  4OPK A;  2P5O A;  1ZBU A;  4F2S A;  4FJI A;  3ASM A;  2YNI A;  4HCC A;  2X6S A;  3T19 A;  1VSI A;  2IGI A;  1UAX A;  1BIZ A;  5J1E A;  2A1S A;  2QK9 A;  4FW1 A;  1Z25 A;  4FJL A;  3CYM A;  3AVB A;  4JRQ A;  3SYZ A;  4J2B A;  3DLK A;  1KVB A;  1LWF A;  3AO4 A;  3MED A; 
#chains in the Genus database with same CATH topology
 4M45 A;  5AZI B;  4K8Z A;  3AAP A;  1TKT A;  1ZXO A;  3CCM N;  2OCE A;  3QEI A;  1VSK A;  3SPZ A;  3HK2 A;  3CET A;  3QDK A;  4BRF A;  3BP8 A;  1VQP N;  2P9L B;  1HQU A;  5TKY A;  4LF4 K;  4BRK A;  3SQ4 A;  1JLA A;  1S22 A;  3ID6 A;  1EX4 A;  2WBN A;  1T6D A;  2OZM A;  5GAH P;  1X3N A;  2FSK A;  1FKO A;  4AHU A;  1MWK A;  2EHG A;  1XWL A;  2Q2R A;  1HJO A;  2FC0 A;  4LFC K;  4CF1 A;  5BR8 K;  4FWL A;  4E7I A;  5KQ8 A;  3MDQ A;  2QW9 A;  1D5A A;  4H5R A;  3VEY A;  3VA0 A;  2I5J A;  4JKE A;  1NLV A;  1QE1 A;  1WBD A;  3OYF A;  1T3V A;  1N8R O;  1NK6 A;  2D5R A;  3AA4 A;  3AVL A;  1C0M A;  3HT3 A;  3CCL N;  4FLX A;  4FWN A;  4LF9 K;  3OW2 M;  4WFN L;  3PO5 A;  1KXP A;  2X74 A;  4BRG A;  5BN9 A;  3SV4 A;  3I33 A;  5KGW A;  5AQI A;  3QO9 A;  5AQY A;  1KLN A;  4IOC L;  2BDP A;  5AQJ A;  3QFP A;  5JS2 A;  1E4G T;  4FWO A;  4CF0 A;  3SZ2 A;  4CES A;  3SLC A;  2NRZ A;  2RF2 A;  4FW2 A;  4E1M A;  4H5N A;  5T7B A;  4ZTJ A;  4B9T A;  4I7F A;  1VQ5 N;  5CE3 A;  2OPS A;  3KLF A;  4H0V B;  3VEV A;  1VSL A;  2QWM A;  3ULE A;  3KLG A;  4OPJ A;  4I9Q A;  1EP4 A;  1VQL N;  1RBT A;  5KRS A;  1WSF A;  3O9T A;  4DG1 A;  3QNN A;  3AVK A;  4ICL A;  1EXQ A;  2E20 A;  1TL3 A;  2F9W A;  3EN9 A;  4FJX A;  1IH7 A;  1GOC A;  4XIU A;  1IKY A;  4OO1 J;  5JMV A;  1EKE A;  4JK7 A;  5FPM A;  4EHT A;  5CYQ A;  4ELV A;  3BF1 A;  3V1Q A;  1VSM A;  4DV7 K;  3JSM A;  3NDK A;  4E0D A;  5FRM A;  1SQK A;  2HNY A;  3MN5 A;  4H03 B;  2PYL A;  4B1Y B;  4DWI A;  3ENO A;  1HNX K;  3QNO A;  3S9H A;  5LMU K;  2G8U A;  4M42 A;  1OVY A;  4CJK A;  2P9U B;  3VF2 A;  4DTN A;  1HYV A;  2P5G A;  3LWL A;  1OVQ A;  4BG8 A;  4DR7 K;  2KZZ A;  1U45 A;  4LSN A;  3L2W A;  3EKU A;  5DMR A;  3PUF A;  5M1F A;  5IT9 O;  5AFU A;  3ZSQ A;  3V1R A;  3C6T A;  3QIN A;  4DLE A;  2OPR A;  3HP6 A;  1HYS A;  2HST A;  4OKJ A;  3M8R A;  2A3Z A;  1BWF O;  3FZM A;  2W6L A;  4ILG B;  1NK9 A;  4J2D A;  4H0Y B;  4KRF A;  3EY1 A;  2GTD A;  3OS0 A;  2A41 A;  2OPQ A;  4JI1 K;  5CYM A;  3LDN A;  1IV0 A;  1KFD A;  3L6Q A;  5HOO A;  1TYQ B;  4C8K A;  4FWM A;  3FZL A;  3D2E B;  1FXX A;  4LF6 K;  1X1P A;  4FXD A;  1VRU A;  4R79 A;  4JHD B;  2GBZ A;  3LDO A;  5BRD A;  4FJ8 A;  5HBM A;  2DFF A;  4BRE A;  4IO9 L;  3T1A A;  3WNH A;  4F3O A;  1ILY A;  1QHT A;  3OYA A;  3FZK A;  2BAN A;  2FSJ A;  4F2R A;  1WSI A;  3TU5 A;  5KTQ A;  2QKK A;  4CI6 A;  4IOX A;  3O4N A;  4FZX C;  4OPA A;  3ITH A;  5EVZ A;  1RTH A;  2KKZ A;  3TAE A;  1N34 K;  4M3U A;  1TKZ A;  4IG0 A;  2I7P A;  3LP3 A;  3ATU A;  2P9I A;  3EEQ A;  4RW7 A;  5HRS A;  3E9L A;  3OYH A;  4B3O A;  1NGD A;  1OH8 A;  3W0L A;  3VEO A;  4DSJ A;  4CJQ A;  2QXF A;  5AQL A;  1OH7 A;  4FO0 A;  3KWI A;  3SJJ A;  4CJL A;  4H5V A;  4K25 A;  3O6W A;  3L2U A;  1RBV A;  3CM5 A;  1TAU A;  5KPR A;  1QQN A;  3AVA A;  4RG8 A;  2NRV A;  2YKM A;  2DY4 A;  1ZBL A;  4NCG A;  5J2Q A;  1T44 A;  3BZC A;  4E7K A;  3KWG A;  3R6M A;  3FFK B;  2HND A;  4R5P A;  3PX6 A;  4DU1 A;  3ZYY X;  2ATQ A;  1WAF A;  1TUU A;  2HHW A;  5JVH L;  1BG3 A;  3MWT A;  3DMJ A;  2D4W A;  2OZS A;  4DQS A;  5AQM A;  4LH4 A;  3RMD A;  5JLF A;  3IFR A;  2HVI A;  3NF9 A;  4A62 A;  4QOZ B;  1X9W A;  2P9P B;  5LJW A;  1NK4 A;  2HHT A;  4A59 A;  4C1N K;  2RKI A;  2Q1N A;  1HNW K;  3U9Z A;  5BPL A;  4NCB A;  4Z4E A;  1BO5 O;  2FF3 B;  1WUA A;  4H8K A;  3N4P A;  3UKR A;  3NF7 A;  4OKE A;  3RTV A;  1RDC A;  4OPH A;  2CGL A;  1U2V B;  1TKD A;  1HRH A;  1CZ9 A;  1VQ9 N;  2IVO A;  3QFU A;  4FPB A;  1KVC A;  4JS4 A;  4DR2 K;  2FXU A;  3HP9 A;  4JD2 A;  4CF9 A;  4KFB A;  1U48 A;  2GUI A;  5FDL A;  2F9T A;  2ASM A;  4BRQ A;  2Y1I A;  3AO5 A;  3QEX A;  3CC2 N;  1VSH A;  1N33 K;  5M1N A;  1MDU B;  3BGR A;  1BIS A;  1JLQ A;  4U67 L;  3E1Y A;  3GOI A;  3HL8 A;  1KAY A;  3HST B;  3MN7 A;  4OLA A;  3CG7 A;  3IRX A;  3KK2 A;  3OYN A;  4KHW A;  5AR0 A;  2Z1J A;  1HJR A;  3PSI A;  4YOV A;  4BWM A;  1HKC A;  4JI4 K;  5FRO A;  1LV5 A;  3KK3 A;  1CXQ A;  5EU7 A;  1JJ2 M;  1J9A A;  4NLC A;  5K14 A;  3HBT A;  4JEP A;  3O3G A;  1SKR A;  4PHT X;  4C8O A;  5AQR A;  1IKV A;  2XY6 A;  1BDG A;  4LSL A;  3QES A;  2AA4 A;  3U8X A;  3EL2 A;  5C25 A;  3WQU A;  3CQX A;  3ZEU B;  3NF8 A;  3VQ7 A;  2G8W A;  3DJC A;  2HB5 A;  1DTT A;  1YJW N;  3AVC A;  4B1W B;  3UE5 A;  3WNG A;  4AHC A;  3THX A;  3J7Y P;  1NJY A;  2CGK A;  4E7L A;  5C12 A;  4CGD A;  4Q0B A;  4IEE A;  1X9J A;  2W40 A;  1ASV A;  4CZH A;  4E89 A;  4LF7 K;  4DS5 A;  4Y1D A;  1RT1 A;  4H5W A;  2B5J A;  1IG9 A;  4DR6 K;  3F5T A;  3HOT A;  2V7Z A;  3THV A;  2KHO A;  4FZY A;  4E19 A;  3RRG A;  4CD1 A;  1VQN N;  1RT5 A;  3O5B A;  3OBW A;  1ZBF A;  3ULD A;  1KRP A;  4BE1 A;  1RGI A;  5M1Q A;  4BR5 A;  5E84 A;  3DXM A;  4YOT A;  1Q7Y O;  1P8Z A;  2O4G A;  5C42 A;  4KHQ A;  1KSP A;  3VEX A;  4DUY K;  4FM1 A;  1BU6 O;  4FJ9 A;  3MX5 A;  4CCH A;  1YXQ A;  1KQS M;  4C8M A;  2G8F A;  4H0X B;  4JK9 A;  4JK8 A;  1BCM A;  4CEO A;  4MQ3 A;  3A5L C;  1WBB A;  3C0B A;  4CGI A;  4IJA A;  3O9Q A;  3HO1 A;  2EX3 A;  3L2Q A;  1DEJ A;  1RBS A;  4O5B A;  4B9S A;  3I0R A;  4CIG A;  1U47 A;  4CJR A;  2FBX A;  1KFS A;  1X3M A;  3KLH A;  3U3G A;  2VWJ A;  1YIT N;  1ZBU A;  4F2S A;  4FJI A;  2CH6 A;  3ASM A;  2X6S A;  5J1E A;  2A1S A;  2QWO A;  3E9P A;  2ZGZ A;  5CR4 A;  4JV5 K;  4MDB A;  4IFE A;  3LAN A;  1NGJ A;  3AAR A;  3MK6 A;  4BRA A;  5AQS A;  1O1W A;  2E6M A;  4NLB A;  4AIL C;  2Q3S A;  4PY5 A;  3ATV A;  5EOY A;  2F8S A;  4YDU C;  4WQ4 A;  5M1P A;  1VHX A;  3HZ6 A;  3AY9 A;  5C0Y A;  1KLM A;  2ZJQ L;  1BA1 A;  3O3H A;  2IDO A;  3PO4 A;  1QZ5 A;  3TAQ A;  5F2R A;  2NRW A;  3PLA A;  1JKH A;  1R0A A;  3LP0 A;  5F1X A;  1K73 O;  2GUP A;  4CF2 A;  4RTF D;  5AZI A;  2E88 A;  4LY7 A;  4CD3 A;  4N76 A;  3DXK B;  3K5M A;  3LZI A;  1RTJ A;  2PY5 A;  4UQG A;  4CE9 A;  3KK7 A;  4PKI A;  3A0I X;  2BTF A;  1SZ2 A;  4JKF A;  4CEA A;  3QET A;  3TAM A;  3G4S N;  4WFB L;  3VQE A;  4OX9 K;  3SUP A;  3H08 A;  5CZ2 A;  3WNF A;  4BQZ A;  2P9L A;  3ZX3 A;  3GBT A;  4DTM A;  4JI0 K;  3RMB A;  5AZJ B;  4CJE A;  3HTV A;  4W5R A;  1QHA A;  3HSC A;  4KO0 A;  3F73 A;  3FZH A;  4HHT A;  4AHR A;  3WXL A;  4CHN A;  3U9D A;  1WSH A;  3QBW A;  4M3Z A;  1C1A A;  4JN4 A;  3P31 A;  4IO8 A;  4DV5 K;  1GLB G;  4Z0U A;  3NGY A;  3CMA N;  2ITM A;  4FLW A;  4FJ7 A;  2HNZ A;  3MEG A;  5FPE A;  3PY8 A;  1RNH A;  2Z1I A;  3CER A;  4CJ7 A;  3R1X A;  4JKH A;  4LD0 A;  1VQO N;  1I39 A;  1NJX A;  3FZF A;  1C0G A;  3IUC A;  3V9X A;  3BUZ B;  4WFA L;  5SWM A;  1U49 A;  3TSQ A;  4B9V A;  1HNV A;  1OH5 A;  4F3T A;  4CGH A;  3L0Q A;  3VTI A;  1QQC A;  4FM2 A;  1ATR A;  4JI6 K;  4KHS A;  5E26 A;  3MN9 A;  2ASP A;  4BR0 A;  1V4T A;  3DLG A;  1JCG A;  1TK5 A;  3D45 A;  3PSF A;  4WQ5 C;  3E01 A;  3IAY A;  1QSY A;  3FLC O;  3SBT A;  3RSE B;  1YT3 A;  2QWR A;  3VEZ A;  1K8K B;  3LDS A;  2E2O A;  4RW6 A;  4BE0 A;  3TAB A;  3SUN A;  4LFA K;  1C0T A;  3D0P A;  4JI5 K;  3OS1 A;  3JXU A;  2P1J A;  3TAR A;  4YFU A;  1L3V A;  4FWK A;  4YHH K;  1HR0 K;  3CHW A;  3CJC A;  1BI4 B;  3VF4 A;  2O8D B;  3I56 N;  3MMV A;  4DFK A;  4DTU A;  4QAG A;  1Q18 A;  5LJV A;  4B3S K;  5LL6 Z;  3NHG A;  4E7J A;  3ZSZ A;  5M1O A;  3VPZ A;  3C65 A;  1T6C A;  4M3Y A;  4GV3 A;  4BDP A;  3B8A X;  1L3U A;  5AQW A;  4BGA A;  3SV3 A;  2P9U A;  3L3U A;  4CVN E;  1B9D A;  1S3X A;  4N56 A;  3H46 O;  4MLH A;  4CFB A;  1VAZ A;  3V6D A;  4PWD A;  5IWA K;  3HPH A;  4FK2 A;  4FJN A;  2VYP A;  4YOX A;  3F2K A;  3NH0 A;  4W5O A;  4AHV A;  1YHQ N;  3CIP A;  3ENH A;  2E1Y A;  4B1U B;  3OY9 A;  4I2Q A;  2XRI A;  1XQS C;  3MXM A;  3H45 C;  3C7N B;  4BC2 A;  3WNE A;  3ID8 A;  3UB5 A;  4E3S A;  1MA9 B;  1WNS A;  4BWJ A;  3T1Y K;  3V81 A;  1A5W A;  1C1B A;  4BRN A;  1M1K O;  3OYG A;  4GMJ B;  1ESV A;  1BQM A;  1RDA A;  2Q36 A;  1NKC A;  2KW4 A;  3HVT A;  1TYQ A;  3M8Q A;  4DLG A;  3AAQ A;  4XH1 A;  3D2E A;  3VQP A;  2O8C B;  3AVJ A;  1T03 A;  4B9N A;  3HM9 A;  1NOY A;  1HYZ A;  4QS8 A;  2BH1 A;  1Q9Y A;  4IOA L;  5H1S Q;  3VQD A;  5B8H A;  2P9K B;  1YVN A;  3GDQ A;  2P9N B;  1WSJ A;  2A42 A;  4EIA A;  4V19 S;  3OJU A;  2IAJ A;  4A2B A;  3G6E N;  1QSL A;  3AVI A;  2HHH K;  1TGO A;  2E2P A;  4DTP A;  3HOS A;  1GLC G;  1EO1 A;  4JAX A;  3EE9 A;  4ELU A;  3N4Q A;  4OLB A;  4UY8 O;  1IJJ A;  4FJG A;  1QQM A;  2F7T A;  2O8F B;  4OJR A;  1R59 O;  2GWJ A;  1UWB A;  4B8C A;  5AQF A;  1XHX A;  1HQE A;  5FLX O;  4BRP A;  4AQY K;  2HW3 A;  2WTU A;  3SBG A;  1D4X A;  3THY A;  1SUQ A;  3PX4 A;  4Z4C A;  1BA0 A;  2A5X A;  3EE8 A;  1FKP A;  2B6A A;  3AGR A;  4ISE A;  1QQO A;  3KD5 E;  1NGI A;  3CCV N;  4JNE A;  4JS5 A;  1I3A A;  4GVE A;  3P1G A;  1DT9 A;  4JI7 K;  2O8E B;  4EHU A;  1L3T A;  4PUO A;  4IFV A;  2ASO A;  1JXB A;  4FWR A;  1UOC A;  1VSJ A;  1GLA G;  3ZSY A;  3CCQ N;  3Q7C A;  2PZS A;  4DFP A;  4CEQ A;  1U04 A;  3HYF A;  4FJK A;  3O9U A;  3CJB A;  3S3O A;  4F8R A;  3IG1 A;  1YI2 N;  3CI5 A;  3OA9 A;  1EQY A;  3AVH A;  3C6H A;  4CHY A;  3VEN A;  4AM6 A;  3VQC A;  1NGE A;  2P9P A;  4FK4 A;  2YJF A;  4OGC A;  3K2P A;  4Q5V A;  2UU9 K;  4FOE A;  1LW0 A;  4ZHR A;  4B1Z A;  4CZJ A;  3TTC A;  4C8L A;  3AA3 A;  3CXC M;  3KK1 A;  5J2M A;  3LPU A;  1KD1 O;  1GLF O;  4MO5 A;  1U2V A;  3WXJ A;  3M5R A;  2RHK A;  4RWT A;  3H3N O;  4IDH A;  3HPG A;  3UKU B;  1JL2 A;  3IDH A;  4Z94 A;  3DAW A;  3WXI A;  1S5J A;  2QWN A;  1HMV A;  3V9U A;  3KVG A;  5JIC A;  2JWK A;  3SNN A;  2CH5 A;  4X62 K;  5I3U A;  4H5T A;  4KAZ A;  1VSD A;  4ISG A;  4EP4 A;  4AH9 A;  5DK5 A;  1KCF A;  5BRF A;  4CGJ A;  4CJT A;  5FPN A;  1VQ8 N;  1H1V A;  4CBX A;  4AF1 A;  4E1N A;  1L3S A;  3EKS A;  1Q81 O;  3JAM O;  5CZ1 A;  3VER A;  1XNR K;  1NGC A;  3DLE A;  4DQR A;  2FLO A;  3DOK A;  4I6M A;  2VQF K;  5DM6 L;  3WEE B;  3C6A A;  5KI6 A;  3LDQ A;  3I55 N;  4HUE A;  4B9M A;  4Z4I A;  4KI6 A;  4B9U A;  2P9S A;  2VQE K;  3V4I A;  3D2F A;  1FW6 A;  3ZSO A;  4LF5 K;  1X9S A;  3L4I A;  1HKG A;  3TTF A;  3AO1 A;  1WOQ A;  4GV6 A;  3CCS N;  3O8M A;  2W41 A;  1RFQ A;  5FPD A;  1K8A O;  3ZT3 A;  4BR4 A;  3G71 N;  3ZEU A;  2ZQB A;  1RDB A;  3OYD A;  3T69 A;  3CCJ N;  1YIJ N;  4JRP A;  4DQP A;  3ZX0 A;  4FL9 A;  3CM6 A;  4Y0W A;  4GNI A;  4H4M A;  4CGF A;  3AA5 X;  4CIE A;  3A5M C;  2ZGY A;  1KAX A;  3AO2 A;  4GVM A;  2V7Y A;  1DLO A;  3AV9 A;  3RMC A;  1IO2 A;  4BRO A;  4QS9 A;  2KQ2 A;  2VGN A;  1RT3 A;  4GKK K;  5LY3 A;  4FZZ A;  5ADX A;  2P5O A;  3AGK A;  4MO4 A;  2NLX A;  4HCC A;  4FVU A;  4LFB K;  3O4W A;  4C1N I;  4IJN A;  1UAX A;  2QK9 A;  5EX5 A;  4FJL A;  3J80 O;  3DLK A;  1TUY A;  1XUP O;  4K41 A;  2HF4 A;  4K0K K;  3MED A;  4CHQ A;  2ZJP L;  1Z26 A;  2A1R A;  4KB0 A;  3NCI A;  3HI0 A;  3KIO A;  4JKG A;  2YJE A;  4DTX A;  4NCA A;  2QI2 A;  2VGM A;  4O8K A;  3ZT4 A;  2ITG A;  2J4R A;  4CJS A;  4HVJ A;  4CHO A;  1BCO A;  2NNW A;  4L3Q A;  4RCH A;  1K9M O;  2E8A A;  4BRM A;  1NWK A;  4YNQ A;  5SZT A;  4O55 A;  1LWC A;  3DLL L;  2WFB A;  4BRI A;  5KPT A;  3S3N A;  2Z1G A;  4CK2 A;  5BPM A;  1O13 A;  3MEE A;  2ZM6 K;  1TAQ A;  4B1X B;  3CFR A;  2HMP A;  2EWS A;  3BDP A;  3VET A;  2YKN A;  5BN8 A;  2QA4 N;  1Q82 O;  3MCP A;  1WN7 A;  3FR0 A;  4CFC A;  5LMN K;  2P9I B;  5HRO A;  4KB1 A;  1HPZ A;  4OVL A;  4EFH A;  3RR7 A;  3NH1 A;  2JGU A;  1JLE A;  4DTS A;  4WCE L;  2Y1J A;  4L8R B;  4ISF A;  3L2V A;  1XC3 A;  2O4I A;  4AM7 A;  3LP1 A;  4Z4H A;  1J53 A;  5BRH A;  1Q9X A;  3VMF B;  4LC9 B;  3DXK A;  4CZL A;  3MWP A;  4K42 A;  4CBU A;  3M6G A;  3DWL A;  4DB3 A;  1QSS A;  1VQK N;  3B6P A;  3WXK A;  4CW7 B;  1YUW A;  4JKD A;  4JYA K;  3DLB A;  1G99 A;  3A8Y A;  4H0T B;  4BQL A;  3ENB A;  5KPZ A;  3S3M A;  4NXN K;  4BR9 A;  1W0H A;  3LAL A;  3ZSX A;  1NJW A;  1GLJ O;  2X6N A;  3L8B A;  3SCX A;  4KPY A;  1LW2 A;  2UUC K;  4BRL A;  3KLE A;  3Q7B A;  3CCR N;  1A5V A;  4J2A A;  3SAH A;  3SUQ A;  1RTI A;  5DM7 L;  4CEF A;  1OH6 A;  3SAF A;  4FCY A;  3K5O A;  1FK9 A;  3KD1 E;  1NGA A;  2KZM A;  5AFU H;  1RBR A;  4CJF A;  2DFH A;  4BGB A;  1ASW A;  4C8N A;  4JD2 B;  5GAG P;  2G8H A;  1XI1 A;  3AVN A;  5F0X A;  1N6Q A;  4DUZ K;  3TAG A;  3G10 A;  1NJZ A;  2E2N A;  3K5L A;  3A5O C;  1NKB A;  3ZSV A;  1WSG A;  3M8S A;  1W97 L;  5C10 A;  4BRD A;  1RDU A;  4JKC A;  1ITG A;  4K8X A;  1HX1 A;  2QM1 A;  4NO7 A;  1RDD A;  1VSF A;  3VQ4 A;  3S41 A;  4EZ6 A;  2KFZ A;  3K59 A;  1NKE A;  3O08 A;  4IDK A;  3MEC A;  4E1J A;  2HVH A;  2BGG A;  4NYN A;  1Q86 O;  1D8Y A;  1BHL A;  4GY2 B;  3QML A;  3L3V A;  3CD6 N;  3OBY A;  1NM1 A;  4BR7 A;  4FPA A;  2GEL A;  3VN5 A;  3RSE A;  4IWV A;  1YTU A;  3KZB A;  2Q0U A;  4I9L A;  3G0Z A;  1ATN A;  2YNH A;  3O9S A;  1S1U A;  3TAF A;  1VQ6 N;  2KTQ A;  1YJ9 N;  3VGL A;  2HHU A;  3EO3 A;  2AJQ A;  3WUH A;  1UA0 A;  4HTU A;  4DFM A;  2QWL A;  5EXW A;  3NAE A;  4ELT A;  3NF6 A;  3DM2 A;  5TKW A;  3THX B;  3O1W A;  3CPE A;  1N32 K;  1A5X A;  4KH4 A;  1C6V A;  3MXI A;  4CBW A;  4ILJ A;  1GLE G;  3AVF A;  5BPN A;  4X65 K;  4LF8 K;  4CZF A;  1JL1 A;  1RT6 A;  3TI0 A;  5AQP A;  3VQA A;  3ZET B;  4CZG A;  3LWM A;  4CED A;  3UIQ A;  2D0B A;  2B4J A;  3CF5 L;  3WT0 A;  3OS2 A;  2VWB A;  2W42 A;  4DV2 K;  2DTU A;  1VQM N;  4EP5 A;  1MU2 A;  3VQB A;  4E7H A;  4DTR A;  4CEE A;  2Q31 A;  1UA1 A;  3AA2 A;  5AQZ A;  4W5N A;  3R3L A;  1HNI A;  5AQT A;  4Z4G A;  3K9K A;  1Y64 A;  3KLI A;  1JLB A;  3BEX A;  4G1Q A;  2QKB A;  1WB9 A;  3DYA A;  3CC4 N;  3C7N A;  1REV A;  3OYK A;  3FGU A;  1LCU A;  3VQ8 A;  3CC7 N;  4X64 K;  3P83 D;  1DGK N;  2O8B B;  2XY7 A;  3THW B;  1QVG M;  4BVP A;  3V9Z A;  4JKB A;  2ZWH A;  4BG9 A;  3O3F A;  1XMO K;  2HOE A;  1M90 O;  3VQ6 A;  2O8C A;  4O5F A;  1D9D A;  3C6U A;  3TTD A;  4CFA A;  3OYL A;  3K58 A;  2OAN A;  4DSI A;  2P9K A;  1JCF A;  2RE2 A;  1JLC A;  1C1C A;  1IBK K;  3DOL A;  4O0J A;  4CZM A;  4KHN A;  1JLF A;  2ETJ A;  4CJU A;  1TK0 A;  3FE1 A;  4HTL A;  2KFN A;  2NRH A;  1IBM K;  4FJH A;  1GLL O;  1LAV A;  4DR1 K;  1NK8 A;  3VEW A;  1J5E K;  1NGF A;  3P4I A;  4DMN A;  3CQ8 A;  1IKW A;  3CCE N;  3RR8 A;  2NUB A;  4WF9 L;  2O8F A;  4FOI A;  1V4S A;  3R9P A;  4KV8 A;  1D9F A;  1W2B M;  2VG5 A;  2YHW A;  3FFI A;  1HNZ K;  2GV9 A;  3BY5 A;  3I8D A;  4KHU A;  1NGB A;  4W5Q A;  2IS3 A;  2VG6 A;  1Z6R A;  1GLD G;  4FLT A;  1EWQ A;  3NGI A;  1NU0 A;  5HL7 L;  2IVP A;  1G15 A;  4KH5 A;  4CZK A;  4A5A A;  4DSE A;  4M3T A;  2O8E A;  5I42 A;  3TPQ A;  4DQ8 A;  4WQ4 C;  4G9Z A;  1Z05 A;  5D3G A;  4ID1 A;  4MFB A;  4YOW A;  3IMX A;  3OYJ A;  3SQ0 A;  4CEZ A;  3ZX2 A;  3DRR A;  3PV8 A;  1T05 A;  4DCH A;  1LOT B;  2GWK A;  4FM0 A;  1XMQ K;  4M7Y A;  4B1V A;  3R8E A;  5AQG A;  1ZYQ A;  3V9S A;  4BC5 A;  1SL2 A;  3MX2 A;  4DR5 K;  5BR9 A;  1HKB A;  2I7N A;  2E1Z A;  4DFJ A;  4K43 A;  5GIN A;  5HLF A;  3QLH A;  4CK3 A;  1W9H A;  3GG4 A;  4J8F A;  3HXM A;  4FJM A;  1JLG A;  4N5S A;  2KLA A;  3P5J A;  3K57 A;  3UKU A;  3J8A A;  4RW4 A;  3ZSR A;  4QCL A;  4CIF A;  3PIO L;  2IC3 A;  2HBJ A;  4JHD A;  2PBD A;  3TWH A;  4DF8 A;  5HRR A;  4DSK A;  4IEI A;  3M8P A;  3LL3 A;  2FBV A;  4CJ5 A;  1SKS A;  1TVR A;  4BE2 A;  2FBT A;  4CFD A;  3VGM A;  1W7A A;  3NGZ A;  4IXC A;  5CY4 A;  5AQN A;  3J81 O;  5KRT A;  3L4Q A;  2JWL A;  2W6K A;  5E41 A;  1ZC6 A;  4DTO A;  1VQ7 N;  4ID5 A;  5AQQ A;  1TK8 A;  4JKA A;  3MAQ A;  3O80 A;  4CEC A;  3VF6 A;  3WEE A;  4CZE A;  3SUO A;  2G8K A;  2FSN A;  1XHZ A;  4M63 C;  5A2Q O;  2OYQ A;  4C23 A;  4FWS A;  3TR8 A;  4CK1 A;  3OYM A;  3KHY A;  3F9K A;  3H6E A;  5KQD A;  3V9W A;  3JYT A;  3QIO A;  2DPN A;  4Z4F A;  4XEI A;  4CZI A;  3VTH A;  2RPI A;  4KTZ A;  5ELZ A;  2E2Q A;  4FLY A;  3JS6 A;  2E4L A;  4DHY A;  3SPY A;  2HHV A;  3QER A;  4H0O A;  1YAG A;  4DF4 A;  1MWM A;  3CPW M;  1NK7 A;  4OPK A;  4YY3 K;  2YNI A;  4BRC A;  2IGI A;  4FW1 A;  1Z25 A;  4JI3 K;  3AVB A;  4JRQ A;  1KVB A;  1LWF A;  1BIU A;  5AQV A;  4WE1 A;  3A2F A;  4GW6 A;  3LZJ A;  3T3F A;  1QTM A;  4AHS A;  3AVG A;  4B9L A;  3ZT0 A;  2HMI A;  5HP1 A;  1L5U A;  4GV9 A;  2LSN A;  5AQO A;  1JCE A;  3I0S A;  5M1K A;  2ZJR L;  1NMD A;  3HRG A;  4FLU A;  2YV0 X;  3OTO K;  4DKW A;  1NOZ A;  3QIP A;  5AQX A;  4PQU A;  4CEB A;  4HWI A;  1E4F T;  2GEM A;  4LH5 A;  3TAP A;  4FYD A;  4DU4 A;  3T1H K;  4IG3 A;  1ZBI A;  3OVN A;  4CJW A;  1YJN N;  4CJ3 A;  1BGX T;  2YHX A;  2XY8 A;  3DRS A;  4B9Q A;  3VQ9 A;  4M41 A;  1VRT A;  4FJJ A;  4A5B A;  4JLH A;  2A40 A;  1BL3 A;  3TAN A;  2QWQ A;  1WLJ A;  3H1V X;  4IZ9 A;  4DV6 K;  2FF6 A;  1J6Z A;  1RTD A;  2V51 B;  5MLC Q;  2YNG A;  4QS7 A;  2F8T A;  1NGH A;  3LAM A;  3DRP A;  3VQ5 A;  1RT7 A;  2XHB A;  1DKG D;  3QBX A;  3GL1 A;  2ZE2 A;  3A5N C;  4CJV A;  3RMA A;  3SK3 A;  1HPM A;  3ULE B;  2D1K A;  2QTD A;  1QVF M;  3M3Z A;  1C0F A;  3ZCM A;  4ZTF A;  2HF3 A;  2FBY A;  3K9J A;  3D7E O;  1XNQ K;  4O8U A;  3LPT A;  2UXC K;  3J7A P;  3QEW A;  1SKW A;  4MDA A;  1FJG K;  4N47 A;  3HPO A;  3HJF A;  2UXB K;  3PIP L;  3O9R A;  2D0C A;  1CZB A;  4DR4 K;  1KTQ A;  1KAZ A;  3DLR A;  2WC9 A;  2NRT A;  3QEP A;  3RWU A;  3ZT2 A;  4EAH D;  1HUX A;  3SJH A;  3THY B;  4KRE A;  4DS4 A;  3L2R A;  5C24 A;  1YVU A;  3H3O B;  4BRH A;  2YNF A;  3P38 A;  3ZSW A;  4M3R A;  4CER A;  2PFU A;  4KH6 A;  4CJP A;  3SQ1 A;  4JI8 K;  2OPP A;  5JVG L;  3ALY A;  3D6R A;  4FWP A;  4DV3 K;  3TSP A;  3WQT A;  4DQI A;  3KTQ A;  3CJA A;  4BAC A;  2G8V A;  1CZA N;  5I9E B;  1C0U A;  2GX9 A;  3VOV A;  1ATS A;  2YHB A;  4F9O A;  5GIO A;  2Z1H A;  3BZK A;  1IG8 A;  1SL0 A;  4PKH A;  1NBW A;  4YOR A;  3ZT1 A;  2WUS A;  3W3D A;  1S1W A;  3VGK A;  3CJ7 A;  3G25 A;  5HRN A;  1TL1 A;  4M3W A;  2V52 B;  5GIP A;  3E66 A;  4DV4 K;  5KGX A;  1T8E A;  1NMN A;  4YDU A;  3VES A;  4BR2 A;  1GOA A;  2F96 A;  4CHP A;  4HUF A;  5GAE P;  5C2F A;  1VK0 A;  2HHX A;  1IBL K;  1JXE A;  3ISN C;  4BC4 A;  2QXL A;  2D0P A;  1E3M A;  2UUB K;  4DU3 A;  2E5L K;  1WSE A;  1KVA A;  2VCP A;  3CFO A;  2CGJ A;  4YOU A;  5C15 A;  4CHZ A;  1LWE A;  4CGG A;  2X78 A;  3LDL A;  4H4O A;  3MXJ A;  1OKJ A;  1TKX A;  1F21 A;  1S1X A;  1LAW A;  3C94 A;  5AJ3 K;  4I6M B;  1NJI O;  3V1O A;  4PA1 A;  3KJV A;  3IS9 A;  3NE6 A;  2P9S B;  4JI2 K;  3PX0 A;  3U6F A;  2JLE A;  3D2F B;  4TSX A;  2IIR A;  1P90 A;  1XC9 A;  1WAJ A;  1GOB A;  1QZ6 A;  1S9E A;  1YTA A;  2HBK A;  3F9M A;  3EYZ A;  2ZD1 A;  4PKG A;  4FVM A;  4O4G A;  4DR3 K;  4H0P A;  4CF8 A;  5C2D A;  3AO3 A;  1BOT O;  1NK0 A;  3ZLJ A;  3OYB A;  5CHI A;  5J2P A;  2OA8 A;  3U4L A;  4OKK A;  4HCB A;  3OYC A;  2OTL N;  3CCU N;  2YHA A;  3NH2 A;  2F4V K;  4I2P A;  1S1T A;  2BE2 A;  1TV6 A;  1YF5 L;  1I94 K;  1VQ4 N;  4PL7 A;  4M3X A;  2WON A;  4B3M K;  5AZJ A;  2WOM A;  4FLV A;  1S72 N;  5FRN A;  4DSL A;  1U4B A;  1J5O A;  3ZET A;  3DLH A;  1HLU A;  2HBM A;  5AQK A;  5HRP A;  4O44 A;  3HVR A;  5J2N A;  4IFY A;  3BF3 A;  4XH5 A;  1RT4 A;  3UKR B;  3VA3 A;  3RVC A;  3CFP A;  2IVN A;  4YOY A;  1RT2 A;  1S6P A;  1RBU A;  1J54 A;  1SL1 A;  1X9M A;  2PYJ A;  1SS6 A;  4B8A B;  3KKR A;  4WQ5 A;  3GE1 A;  3KKS A;  4M7X A;  3SI6 A;  3B6O A;  4DTJ A;  3U3Y A;  3O4Q A;  3OYI A;  2Q0R A;  4JKG B;  4FJ5 A;  3I8B A;  5AQU A;  2VG7 A;  1U6Z A;  2O8B A;  3TSU A;  3THW A;  4MLE A;  3AVM A;  4AHT A;  1ZBS A;  4KKO A;  2E6L A;  2QEX N;  4KBO A;  3MCA B;  4DV0 K;  2P51 A;  3RRH A;  1KC8 O;  3K0S A;  3LAK A;  4BY9 C;  4Y1C A;  2HBL A;  4OGE A;  1K6Y A;  4DSF A;  1IKX A;  2D0A A;  4N41 A;  4KHY A;  4NXM K;  3MN6 A;  1SV5 A;  2UYT A;  4FWQ A;  4WYB A;  3J7Z O;  4X66 K;  2UUA K;  2R7Y A;  4J2E A;  1CXU A;  2YHY A;  3LM9 A;  4FK0 A;  1NNE A;  3O1B A;  1K8K A;  2YCH A;  4NYF A;  2XY5 A;  1N36 K;  5JS1 A;  4XH4 A;  4A57 A;  2NRR A;  1CLQ A;  3CQY A;  2Q97 A;  3LM2 A;  3SQ2 A;  1BI4 A;  2O8D A;  4FLZ A;  4F4K A;  3C95 A;  4EZ9 A;  2ZF5 O;  4O0I A;  4GKJ K;  1DTQ A;  4B08 A;  1Q8I A;  1ZBH A;  2YX6 A;  4B3R K;  3EZ5 A;  4DQQ A;  3OYE A;  1QS4 A;  1N5Y A;  3QB0 A;  1S9G A;  3NFA A;  4BDY A;  1NK5 A;  4RW9 A;  3P39 A;  3EZW A;  3QEV A;  4NB4 A;  2DFE A;  3HM8 A;  3DXM B;  2NRX A;  1NGG A;  3QIC A;  3VQQ A;  4KTQ A;  3K5N A;  1Y97 A;  1B9F A;  1S1V A;  3LDP A;  1S6Q A;  5EY4 A;  3NVM A;  4CJ4 A;  3SMS A;  1T7P A;  4U7B A;  3CJ9 A;  4HUG A;  2BUP A;  1RCH A;  4W5T A;  3CME N;  2HHS A;  4KI4 A;  2VWK A;  1B92 A;  5ADX H;  1EET A;  2HHQ A;  3OJS A;  3H1Q A;  4BDZ A;  3SAG A;  5GAD P;  1VSE A;  2NZT A;  3IKM A;  3M1F A;  4A2A A;  3NVK A;  3NBP A;  4A61 A;  4FSV A;  3NMU A;  3T7Z A;  1ASU A;  1RDW X;  2PAV A;  3DI6 A;  4PL8 A;  1EWR A;  2OTJ N;  4IKF A;  2G8I A;  4DV1 K;  2XO7 A;  2P9N A;  4IBN A;  4RW8 A;  3E9O A;  2QWP A;  5BRE A;  1BQN A;  3LP2 A;  5JLH A;  2D0O A;  1NG9 A;  4BC3 A;  2H3G X;  4ILH A;  2IOC A;  2UXD K;  2A6A A;  3WXM B;  4KHP K;  4BVO A;  2RN2 A;  1RIL A;  4KTW A;  3CJ1 A;  3OHR A;  5AQH A;  3SMP A;  1BUP A;  3T19 A;  1VSI A;  1SAZ A;  1BIZ A;  2AP1 A;  3CYM A;  3SYZ A;  4J2B A;  2YI1 A;  3AO4 A;  4B3T K; 
#chains in the Genus database with same CATH homology
 1BIU A;  4M45 A;  4CHQ A;  1Z26 A;  4K8Z A;  4WE1 A;  3LAN A;  2A1R A;  4KB0 A;  3A2F A;  4GW6 A;  3NCI A;  3LZJ A;  3KIO A;  4AHS A;  3AVG A;  3T3F A;  1QTM A;  4B9L A;  4DTX A;  4NCA A;  1O1W A;  1TKT A;  2E6M A;  4AIL C;  3ZT0 A;  2HMI A;  5HP1 A;  1L5U A;  2LSN A;  2Q3S A;  4PY5 A;  3ZT4 A;  3I0S A;  3QEI A;  1VSK A;  2ITG A;  2F8S A;  4CJS A;  4HVJ A;  3SPZ A;  3HK2 A;  4CHO A;  1BCO A;  4FLU A;  2YV0 X;  1NOZ A;  3QIP A;  4PQU A;  4YNQ A;  1KLM A;  4CEB A;  5SZT A;  4O55 A;  1HQU A;  1LWC A;  3O3H A;  2IDO A;  3PO4 A;  3TAQ A;  4LH5 A;  3SQ4 A;  3S3N A;  3TAP A;  1JLA A;  2Z1G A;  4FYD A;  4DU4 A;  4CK2 A;  4IG3 A;  1ZBI A;  1JKH A;  3OVN A;  1R0A A;  3MEE A;  3LP0 A;  1EX4 A;  4CJW A;  1TAQ A;  4CJ3 A;  1BGX T;  3CFR A;  4CF2 A;  2OZM A;  2XY8 A;  3DRS A;  4LY7 A;  3VQ9 A;  3BDP A;  1FKO A;  1VRT A;  4M41 A;  4AHU A;  3K5M A;  3LZI A;  1RTJ A;  4FJJ A;  4N76 A;  2PY5 A;  4UQG A;  4CE9 A;  2YKN A;  2EHG A;  4JLH A;  1XWL A;  2FC0 A;  1WN7 A;  1BL3 A;  4CF1 A;  3TAN A;  4CFC A;  4CEA A;  4E7I A;  3QET A;  3TAM A;  5HRO A;  1WLJ A;  3VQE A;  1D5A A;  3VA0 A;  2I5J A;  1RTD A;  3SUP A;  4KB1 A;  1HPZ A;  2YNG A;  2F8T A;  3H08 A;  4OVL A;  1QE1 A;  3LAM A;  5CZ2 A;  3NH1 A;  3RR7 A;  2JGU A;  3DRP A;  1JLE A;  3VQ5 A;  3WNF A;  1RT7 A;  3OYF A;  4DTS A;  2XHB A;  2Y1J A;  1NK6 A;  4L8R B;  2D5R A;  2ZE2 A;  3AA4 A;  3AVL A;  1C0M A;  3HT3 A;  3L2V A;  2O4I A;  4CJV A;  4DTM A;  3RMA A;  4FLX A;  3LP1 A;  4Z4H A;  3RMB A;  1J53 A;  4CJE A;  1Q9X A;  3ZCM A;  4ZTF A;  2FBY A;  4W5R A;  3PO5 A;  4KO0 A;  2X74 A;  3F73 A;  3LPT A;  4HHT A;  3SV4 A;  3QEW A;  5KGW A;  4AHR A;  4CHN A;  1SKW A;  1WSH A;  3QO9 A;  1KLN A;  4M3Z A;  2BDP A;  1C1A A;  1QSS A;  3B6P A;  5JS2 A;  3DLB A;  4CF0 A;  3SZ2 A;  4CES A;  4Z0U A;  4N47 A;  3HPO A;  3HJF A;  3S3M A;  2RF2 A;  4FW2 A;  2D0C A;  1CZB A;  4E1M A;  1KTQ A;  3NGY A;  5T7B A;  1W0H A;  3DLR A;  4FLW A;  3QEP A;  4ZTJ A;  4B9T A;  3LAL A;  3RWU A;  4I7F A;  4FJ7 A;  3ZSX A;  3ZT2 A;  2OPS A;  2HNZ A;  3MEG A;  3KLF A;  1NJW A;  3PY8 A;  2X6N A;  1RNH A;  2Z1I A;  3L8B A;  1VSL A;  3SCX A;  4KPY A;  4KRE A;  1LW2 A;  4DS4 A;  3KLE A;  3L2R A;  5C24 A;  3KLG A;  4OPJ A;  1YVU A;  1A5V A;  4I9Q A;  1EP4 A;  4J2A A;  1RBT A;  5KRS A;  4LD0 A;  2YNF A;  1WSF A;  1I39 A;  1NJX A;  3ZSW A;  4DG1 A;  3V9X A;  3QNN A;  3SUQ A;  4QCL A;  1RTI A;  3AVK A;  4M3R A;  4ICL A;  4CER A;  4CEF A;  4CJP A;  5SWM A;  3SQ1 A;  1EXQ A;  1U49 A;  4B9V A;  4FCY A;  1TL3 A;  1HNV A;  2OPP A;  3K5O A;  4FJX A;  1FK9 A;  3ALY A;  1IH7 A;  4F3T A;  4CGH A;  1GOC A;  4XIU A;  4DQI A;  3KD1 E;  2KZM A;  3KTQ A;  4BAC A;  2G8V A;  4CJF A;  1IKY A;  1RBR A;  1QQC A;  4FM2 A;  2DFH A;  1ASW A;  1EKE A;  1C0U A;  4KHS A;  4C8N A;  5CYQ A;  2YHB A;  4ELV A;  3V1Q A;  1VSM A;  3DLG A;  3JSM A;  2Z1H A;  3NDK A;  3AVN A;  3D45 A;  1XI1 A;  1TK5 A;  1N6Q A;  2G8H A;  4E0D A;  5FRM A;  3TAG A;  3G10 A;  1NJZ A;  1SL0 A;  2HNY A;  3E01 A;  3K5L A;  3IAY A;  3ZT1 A;  2PYL A;  4DWI A;  1QSY A;  1NKB A;  3ZSV A;  1S1W A;  1WSG A;  3M8S A;  3QNO A;  3S9H A;  1YT3 A;  2G8U A;  3LDS A;  4BE0 A;  3SUN A;  4RW6 A;  4M42 A;  3TAB A;  1ITG A;  4K8X A;  1C0T A;  4CJK A;  3D0P A;  5HRN A;  3OS1 A;  1TL1 A;  4DTN A;  1RDD A;  2P1J A;  3TAR A;  1VSF A;  4M3W A;  3VQ4 A;  1HYV A;  4YFU A;  1L3V A;  4EZ6 A;  2P5G A;  3LWL A;  5KGX A;  2KFZ A;  1T8E A;  3K59 A;  1NKE A;  1BI4 B;  1U45 A;  2KZZ A;  4IDK A;  3MEC A;  2HVH A;  1GOA A;  2BGG A;  4NYN A;  2F96 A;  4CHP A;  4HUF A;  4LSN A;  3L2W A;  1VK0 A;  4DTU A;  4DFK A;  2HHX A;  5DMR A;  1D8Y A;  4QAG A;  1JXE A;  3PUF A;  1BHL A;  3ISN C;  3L3V A;  3ZSQ A;  4DU3 A;  1WSE A;  3V1R A;  3C6T A;  1KVA A;  3NHG A;  3VN5 A;  3ZSZ A;  3CFO A;  3QIN A;  2OPR A;  3HP6 A;  4DLE A;  4E7J A;  1HYS A;  4OKJ A;  3M8R A;  4CHZ A;  1LWE A;  4CGG A;  1YTU A;  4M3Y A;  2X78 A;  4BDP A;  4I9L A;  1L3U A;  1NK9 A;  3G0Z A;  4H4O A;  3SV3 A;  4J2D A;  3L3U A;  2YNH A;  3TAF A;  1S1U A;  1B9D A;  2KTQ A;  4KRF A;  3EY1 A;  4N56 A;  3MXJ A;  2HHU A;  1TKX A;  1F21 A;  4CFB A;  3OS0 A;  2OPQ A;  2AJQ A;  5CYM A;  1S1X A;  1LAW A;  3C94 A;  1UA0 A;  1KFD A;  4HTU A;  3V6D A;  4DFM A;  4PWD A;  4C8K A;  3NAE A;  4ELT A;  3NF6 A;  3DM2 A;  3V1O A;  3HPH A;  1FXX A;  4FK2 A;  4PA1 A;  4FJN A;  1X1P A;  3KJV A;  3IS9 A;  4FXD A;  3NE6 A;  1VRU A;  3NH0 A;  4W5O A;  4AHV A;  3PX0 A;  3U6F A;  1A5X A;  2GBZ A;  2JLE A;  4FJ8 A;  4TSX A;  1C6V A;  3MXI A;  5HBM A;  2DFF A;  3OY9 A;  1XC9 A;  4I2Q A;  1WAJ A;  3T1A A;  2XRI A;  1GOB A;  3WNH A;  4F3O A;  1S9E A;  3AVF A;  3MXM A;  1QHT A;  3OYA A;  1YTA A;  2BAN A;  4F2R A;  1JL1 A;  1RT6 A;  1WSI A;  2ZD1 A;  3WNE A;  3EYZ A;  3TI0 A;  5KTQ A;  4FVM A;  4O4G A;  3VQA A;  3LWM A;  4E3S A;  3O4N A;  2QKK A;  4FZX C;  1WNS A;  4BWJ A;  3ITH A;  3V81 A;  4CF8 A;  1A5W A;  3AO3 A;  1C1B A;  1RTH A;  4CED A;  3TAE A;  1NK0 A;  3UIQ A;  1TKZ A;  2B4J A;  2D0B A;  4GMJ B;  3OYG A;  4M3U A;  3OS2 A;  4IG0 A;  1BQM A;  3LP3 A;  1RDA A;  3OYB A;  2W42 A;  1NKC A;  2KW4 A;  3HVT A;  5J2P A;  2DTU A;  4EP5 A;  2OA8 A;  4RW7 A;  1MU2 A;  3M8Q A;  4DLG A;  5HRS A;  3VQP A;  3VQB A;  4E7H A;  3AVJ A;  4DTR A;  3OYH A;  1T03 A;  4B3O A;  4B9N A;  4OKK A;  4CEE A;  3HM9 A;  3OYC A;  4HCB A;  1UA1 A;  4DSJ A;  3AA2 A;  4CJQ A;  1NOY A;  2QXF A;  4W5N A;  1HYZ A;  1Q9Y A;  1HNI A;  2YHA A;  3NH2 A;  4I2P A;  3VQD A;  4Z4G A;  1S1T A;  2BE2 A;  1TV6 A;  3SJJ A;  4CJL A;  4M3X A;  2WON A;  1WSJ A;  3KLI A;  4G1Q A;  1JLB A;  2QKB A;  2WOM A;  4FLV A;  3L2U A;  1RBV A;  3OJU A;  3CM5 A;  4DSL A;  2IAJ A;  5FRN A;  1TAU A;  3DYA A;  1U4B A;  1J5O A;  3AVA A;  1REV A;  1QSL A;  3AVI A;  4RG8 A;  1TGO A;  3OYK A;  2YKM A;  4DTP A;  3DLH A;  2DY4 A;  1ZBL A;  5HRP A;  4NCG A;  4O44 A;  3VQ8 A;  5J2Q A;  3HVR A;  5J2N A;  3P83 D;  4IFY A;  2XY7 A;  4E7K A;  1RT4 A;  4ELU A;  2HND A;  4R5P A;  3V9Z A;  3VA3 A;  4OLB A;  3PX6 A;  4FJG A;  4DU1 A;  3CFP A;  4OJR A;  3O3F A;  2ATQ A;  1RT2 A;  1WAF A;  2HHW A;  1S6P A;  1UWB A;  3VQ6 A;  1RBU A;  1J54 A;  3DMJ A;  4B8C A;  1SL1 A;  1D9D A;  1X9M A;  1XHX A;  2OZS A;  3C6U A;  4DQS A;  2PYJ A;  1HQE A;  4B8A B;  3KKR A;  4CFA A;  3OYL A;  4LH4 A;  3RMD A;  3K58 A;  2HVI A;  4DSI A;  3KKS A;  1JLC A;  1C1C A;  3NF9 A;  3B6O A;  3SI6 A;  2HW3 A;  1SUQ A;  3DOL A;  3PX4 A;  4DTJ A;  3U3Y A;  3O4Q A;  4Z4C A;  4O0J A;  3OYI A;  4KHN A;  1FKP A;  1X9W A;  1JLF A;  1NK4 A;  2ETJ A;  4CJU A;  1TK0 A;  2HHT A;  2KFN A;  2B6A A;  4FJH A;  4FJ5 A;  2RKI A;  3KD5 E;  1LAV A;  1NK8 A;  4NCB A;  4Z4E A;  4JS5 A;  1I3A A;  2VG7 A;  3P1G A;  1L3T A;  4H8K A;  3AVM A;  4IFV A;  1JXB A;  4AHT A;  4DMN A;  4PUO A;  1UOC A;  1IKW A;  3NF7 A;  4KKO A;  2E6L A;  4OKE A;  1RDC A;  1VSJ A;  2NUB A;  3ZSY A;  3RTV A;  3RR8 A;  2P51 A;  3RRH A;  2PZS A;  4DFP A;  1TKD A;  3LAK A;  4CEQ A;  1HRH A;  1CZ9 A;  4Y1C A;  4OGE A;  1K6Y A;  4DSF A;  1IKX A;  2D0A A;  1KVC A;  1U04 A;  3HYF A;  4KV8 A;  4JS4 A;  1D9F A;  4N41 A;  4FJK A;  4KHY A;  3HP9 A;  4CF9 A;  1SV5 A;  4KFB A;  1U48 A;  2VG5 A;  3S3O A;  2GUI A;  3IG1 A;  4F8R A;  3FFI A;  2R7Y A;  4CHY A;  4J2E A;  3AVH A;  1CXU A;  5FDL A;  2GV9 A;  3VQC A;  4FK0 A;  3I8D A;  4KHU A;  4W5Q A;  2Y1I A;  4FK4 A;  2IS3 A;  3AO5 A;  2VG6 A;  3K2P A;  4OGC A;  4Q5V A;  3QEX A;  4FLT A;  1VSH A;  3NGI A;  1LW0 A;  4ZHR A;  4NYF A;  2XY5 A;  3BGR A;  1BIS A;  5JS1 A;  1G15 A;  1JLQ A;  4DSE A;  3AA3 A;  4C8L A;  4M3T A;  1CLQ A;  3KK1 A;  5I42 A;  3HL8 A;  3LPU A;  3HST B;  5J2M A;  4OLA A;  3CG7 A;  3IRX A;  3KK2 A;  3OYN A;  3SQ2 A;  1BI4 A;  4KHW A;  4FLZ A;  2Z1J A;  1HJR A;  3C95 A;  4F4K A;  4BWM A;  5D3G A;  4ID1 A;  4MFB A;  4EZ9 A;  5FRO A;  3HPG A;  4O0I A;  1JL2 A;  1LV5 A;  1DTQ A;  4B08 A;  3KK3 A;  3OYJ A;  1Q8I A;  1S5J A;  3SQ0 A;  1CXQ A;  5EU7 A;  4CEZ A;  3DRR A;  3PV8 A;  1T05 A;  1J9A A;  1ZBH A;  1HMV A;  3V9U A;  5K14 A;  3O3G A;  1SKR A;  4C8O A;  3EZ5 A;  3SNN A;  4DQQ A;  3OYE A;  5I3U A;  4KAZ A;  1IKV A;  1QS4 A;  4FM0 A;  1VSD A;  2XY6 A;  1N5Y A;  4LSL A;  3QES A;  1S9G A;  4EP4 A;  1ZYQ A;  4AH9 A;  5DK5 A;  1KCF A;  3V9S A;  1SL2 A;  3NFA A;  4CGJ A;  4CJT A;  5C25 A;  4BDY A;  1NK5 A;  4RW9 A;  4E1N A;  4DFJ A;  1L3S A;  3NF8 A;  3VQ7 A;  3QEV A;  2G8W A;  5HLF A;  3QLH A;  4CK3 A;  1W9H A;  2DFE A;  2HB5 A;  5CZ1 A;  3HXM A;  3DLE A;  1DTT A;  4DQR A;  1JLG A;  3DOK A;  4FJM A;  3AVC A;  4N5S A;  3P5J A;  3VQQ A;  5KI6 A;  4KTQ A;  3WNG A;  3K5N A;  1Y97 A;  4AHC A;  1B9F A;  1S1V A;  3K57 A;  4HUE A;  4RW4 A;  3ZSR A;  1NJY A;  4B9M A;  4KI6 A;  1S6Q A;  4Z4I A;  4CIF A;  3CQ8 A;  4B9U A;  4CJ4 A;  2IC3 A;  4E7L A;  1T7P A;  4CGD A;  4Q0B A;  3TWH A;  4HUG A;  1ASV A;  3V4I A;  4DF8 A;  5HRR A;  4DSK A;  4E89 A;  3M8P A;  1RCH A;  2FBV A;  3ZSO A;  4W5T A;  4DS5 A;  4Y1D A;  1RT1 A;  4CJ5 A;  1TVR A;  1X9S A;  2B5J A;  3AO1 A;  1SKS A;  4BE2 A;  2FBT A;  4CFD A;  1IG9 A;  3NGZ A;  2HHS A;  4KI4 A;  5CY4 A;  2VWK A;  3THV A;  1B92 A;  5KRT A;  4FZY A;  4E19 A;  3RRG A;  1EET A;  3ZT3 A;  2HHQ A;  5E41 A;  3OJS A;  1RT5 A;  4DTO A;  2ZQB A;  4BDZ A;  1ZBF A;  4ID5 A;  1RDB A;  3ULD A;  1TK8 A;  1VSE A;  3OYD A;  3MAQ A;  4BE1 A;  1KRP A;  4JRP A;  4CEC A;  4DQP A;  3SUO A;  3NBP A;  2O4G A;  2G8K A;  5C42 A;  4KHQ A;  1XHZ A;  2OYQ A;  3CM6 A;  1KSP A;  4H4M A;  1ASU A;  4CGF A;  4FM1 A;  3DI6 A;  3AA5 X;  4CIE A;  4FJ9 A;  4CCH A;  3TR8 A;  4CK1 A;  3OYM A;  4IKF A;  2G8I A;  4C8M A;  2XO7 A;  2G8F A;  4IBN A;  4RW8 A;  3F9K A;  3AO2 A;  4GVM A;  3V9W A;  1BCM A;  3JYT A;  4CEO A;  1DLO A;  1BQN A;  3AV9 A;  3RMC A;  3LP2 A;  1IO2 A;  4MQ3 A;  3QIO A;  4CGI A;  4Z4F A;  3HO1 A;  2EX3 A;  3L2Q A;  2RPI A;  4KTZ A;  1RBS A;  4O5B A;  2IOC A;  4FLY A;  4B9S A;  4QOZ B;  2E4L A;  2KQ2 A;  3I0R A;  1RT3 A;  3SPY A;  2HHV A;  3QER A;  4CIG A;  1U47 A;  2RN2 A;  2FBX A;  4CJR A;  1RIL A;  1KFS A;  4KTW A;  4FZZ A;  4DF4 A;  3KLH A;  3U3G A;  1NK7 A;  2VWJ A;  4OPK A;  2P5O A;  1ZBU A;  4F2S A;  4FJI A;  3ASM A;  2YNI A;  4HCC A;  2X6S A;  3T19 A;  1VSI A;  2IGI A;  1UAX A;  1BIZ A;  5J1E A;  2A1S A;  2QK9 A;  4FW1 A;  1Z25 A;  4FJL A;  3CYM A;  3AVB A;  4JRQ A;  3SYZ A;  4J2B A;  3DLK A;  1KVB A;  1LWF A;  3AO4 A;  3MED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...