2RPIA

The nmr structure of the submillisecond folding intermediate of the thermus thermophilus ribonuclease h
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
MNPSPRKRVALFTDGAALGNPGPGTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title The high-resolution NMR structure of the early folding intermediate of the Thermus thermophilus ribonuclease H
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Hydrolase
total genus 19
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rpiA00
2IOCA 1IH7A 3VQ8A 4GMJB 1UOCA 4CIFA 2XY5A 2VG6A 3DLEA 1TKXA 1JLAA 2EX3A 4HVJA 3OYEA 4DTRA 1IKXA 1KTQA 4DSEA 4CGHA 1TL1A 1WAJA 4CFCA 2Y1JA 2G8UA 4HCBA 4CF9A 1N5YA 2Q3SA 2QKKA 3SV4A 3QNNA 1KVAA 4Q5VA 3AO1A 3MECA 4CEAA 2HVIA 1KRPA 3O3HA 1WSGA 3C6TA 3ZT2A 4FCYA 3CYMA 4EZ9A 1RT6A 2KFZA 5DMRA 1ASVA 1S9GA 3TI0A 1KVBA 2P5OA 4DWIA 4E0DA 3H08A 2P51A 4DFMA 4CFBA 3AO4A 2G8VA 4ELUA 1A5XA 1C6VA 1BI4B 1LAVA 1K6YA 4AHRA 3KK2A 4CK1A 3AO2A 1C1AA 4H8KA 4BDYA 3E01A 3MXMA 3ZSYA 2DTUA 4M42A 4OPKA 5HRSA 3PX6A 4FJXA 3I0SA 4BACA 4PWDA 4KREA 4E19A 2HNYA 1SKRA 5J2NA 2ZE2A 3LP2A 2G8WA 4KI4A 3V9SA 1U4BA 3LP1A 3F9KA 4MQ3A 3HT3A 3SI6A 2GV9A 3HVTA 2IGIA 4KB1A 4AH9A 3DI6A 4FLZA 4H4MA 3K5LA 3CM6A 4N76A 4I9LA 4IKFA 2F8SA 3C6UA 1TVRA 4CEOA 1BCOA 2GBZA 3CQ8A 3HPOA 1C0MA 1SKWA 4B9NA 3DLGA 4CE9A 3TWHA 3SUQA 4KHNA 1RBTA 4QAGA 3ISNC 4CF2A 2HHVA 3V9UA 2E6LA 4F8RA 1WSFA 5JS2A 4LSLA 4DF4A 3TANA 1RBUA 3K59A 1RCHA 1X9WA 3RRGA 3AVNA 1VSMA 3A2FA 4IBNA 1VSDA 1W0HA 3ZSXA 3AVKA 1LW2A 1W9HA 4FLTA 3QEWA 1CZ9A 4DQPA 4JS4A 3OS0A 3OYLA 1GOBA 1KCFA 1L5UA 4B9LA 3OS1A 4AILC 3QERA 2IC3A 2X6SA 3RR7A 4CHNA 1D8YA 4B08A 1IO2A 3CM5A 3ZSWA 5KTQA 4W5TA 3QIPA 4BE2A 5J2MA 3ZSVA 3OYFA 4NYFA 4DTNA 1A5WA 4M3YA 2RKIA 1FKOA 1RT7A 2RN2A 1SV5A 2YNGA 3DOLA 3MEDA 2ETJA 4IDKA 3OYBA 1JLGA 3PUFA 1T8EA 4BE0A 1SL0A 3DRPA 5DK5A 3O3GA 4E7HA 3T3FA 4CFAA 3TAFA 4O55A 3SQ0A 4RW6A 3KD5E 4EP5A 5C42A 4OPJA 5CZ1A 4UQGA 4N5SA 2B6AA 1RTIA 4FM2A 4Z4EA 4KB0A 2KQ2A 5FROA 2XY6A 4CF1A 3QETA 5KI6A 3VQAA 2OZMA 3OYAA 4FM1A 3AVGA 3AVCA 1VSLA 3V1OA 1D9FA 3NGYA 3DLHA 3U6FA 4FW2A 5K14A 3RWUA 1QE1A 4IFYA 1RT3A 2X74A 3L3VA 1J53A 1BQMA 3M8QA 4GW6A 4BE1A 1D5AA 4KTWA 1QHTA 3OYMA 1T05A 4FJMA 3P1GA 2FBVA 2KW4A 2NUBA 4DSIA 3VQ6A 4ELTA 4HUGA 3S3OA 4CEBA 2HVHA 4I2QA 2HHTA 2HHUA 1LWFA 2YNFA 1JLQA 3VQBA 3VA0A 1U49A 2IDOA 2PYJA 3MXJA 2VG5A 3V81A 4M3ZA 3ZCMA 1BL3A 1C1BA 4ID5A 5CYMA 2PY5A 1UAXA 4DFJA 1CLQA 1UA0A 4CJTA 3KLIA 3SYZA 3HP9A 4CJEA 2HHQA 4FJ5A 1JXEA 1B9DA 1TV6A 3C95A 3OYHA 3B6PA 3ZT4A 3V1QA 3LWLA 1S6QA 3MAQA 4N47A 5SZTA 3L2RA 1WSIA 4AHTA 2XHBA 3MEEA 1LAWA 3VQCA 1BI4A 3LP3A 4CIEA 1QQCA 4W5RA 1IKYA 4OGCA 3CFRA 3AVAA 4DS4A 3SUPA 5I42A 1RTDA 1G15A 2I5JA 4ZTFA 3AVHA 1EKEA 3WNHA 1NK8A 4FJ8A 4M3UA 4K8XA 3KKRA 1ZBUA 3K58A 4DQSA 1NK9A 1Q9XA 1CZBA 3T1AA 4DTXA 4PA1A 5J2QA 1VRTA 2HNDA 3T19A 1TGOA 3L8BA 2DFEA 3SQ4A 4C8NA 1S6PA 3VQ9A 4CCHA 4AHSA 1L3UA 4ELVA 4YFUA 1JXBA 4FJJA 4DQIA 4DG1A 4L8RB 2ATQA 2X78A 2X6NA 2OPSA 1N6QA 3LAMA 4EP4A 1EXQA 4CHYA 5FRMA 4KI6A 4I7FA 3NH0A 1DLOA 1U04A 4OKJA 2XRIA 3OYCA 4LY7A 3OJSA 1BISA 2Z1JA 4FJ7A 3I0RA 4FVMA 2YV0X 5C24A 4NCGA 4B9TA 2R7YA 2F96A 4KRFA 3O4QA 3P83D 3LZJA 4RW4A 2D5RA 4K8ZA 4FJNA 4EZ6A 1IKVA 1Y97A 3LPTA 2YNIA 4CGFA 4DTMA 3V6DA 1NOYA 2YKNA 3ALYA 3L2WA 2HMIA 4IG0A 4RW9A 4KHSA 2QKBA 1B9FA 2HHSA 3AA3A 1VK0A 4FK4A 4O4GA 4CK2A 1RDAA 1LWEA 2RPIA 4AHUA 4H4OA 3SQ1A 2D0AA 2WONA 1BIZA 4DLGA 4CJPA 2WOMA 1RT4A 4JLHA 3L3UA 4CHZA 3DLRA 1ZBFA 2OPPA 3BGRA 2W42A 4LH5A 4HTUA 3S3MA 1X9SA 3KTQA 1RT2A 4QCLA 3IAYA 4DFKA 1Q8IA 3HP6A 4E89A 4KV8A 3TAMA 1U45A 1TK0A 3QLHA 4FW1A 3KLHA 2HHWA 4ID1A 2HHXA 3IRXA 4M3WA 5J2PA 1LV5A 1S1TA 2O4GA 4CJWA 4HUEA 4OLAA 1A5VA 1EX4A 2P1JA 3VQEA 3TAGA 1ZBHA 3HK2A 4CEZA 4KTQA 3QINA 3KK1A 4O0IA 4FJLA 3AA4A 1FK9A 4CESA 3OYNA 3RTVA 4CFDA 3OYKA 4DTSA 1WSJA 3VQ5A 2ITGA 2BDPA 2EHGA 1Q9YA 4M3XA 4CEQA 3NH1A 1JLEA 3CFOA 3NFAA 1SL2A 1KSPA 1HYSA 3SCXA 1HYVA 1RBVA 1I39A 1NK6A 2A1SA 2ZD1A 2ZQBA 4E7IA 4M3RA 5SWMA 2P5GA 4DLEA 3TR8A 4G1QA 3NBPA 3HXMA 1TAQA 3DYAA 4Y1DA 5HP1A 2PZSA 2Z1HA 3SJJA 4GVMA 3DRSA 1BHLA 1TL3A 4Z4CA 5HRPA 3LALA 4E7JA 1TKDA 4DSLA 3VQQA 4FJ9A 5FRNA 4NYNA 3V4IA 4HCCA 1Z25A 3HM9A 1UA1A 1BCMA 3B6OA 3ULDA 1NKEA 3FFIA 3NGIA 1J9AA 1JLCA 4CGGA 1BGXT 1Z26A 3OYGA 4CJ3A 1FXXA 4FLYA 4CJVA 2HW3A 4FXDA 3VA3A 3D45A 2KFNA 4Z4IA 4E3SA 1LWCA 3JSMA 4CEDA 3SUNA 1QTMA 4F4KA 1WSEA 5FDLA 1C1CA 1BIUA 3HPGA 2F8TA 1IKWA 3HJFA 4CECA 4N56A 2AJQA 4KO0A 3G10A 1RTJA 3HYFA 3AVFA 4BWJA 4F3OA 3K5OA 5HRNA 3TAQA 3OYDA 1LW0A 3RR8A 3KK3A 3DM2A 2G8IA 3NE6A 1O1WA 3NDKA 2FBXA 2E4LA 3SUOA 4FZXC 4CJLA 4M3TA 4OVLA 3V9ZA 3QESA 4KFBA 3ZT3A 1F21A 2FBYA 3LP0A 4DSFA 1NJWA 4DU1A 3M8SA 3AVMA 1QS4A 2D0CA 1YT3A 3AO5A 4CEEA 4DTUA 3ZSOA 1T7PA 3ZSQA 4DU3A 1NK7A 3NF8A 4CJRA 3KLFA 3L2QA 1WNSA 3THVA 1R0AA 1EETA 3EZ5A 4JRPA 5EU7A 3VQPA 3O4NA 3OS2A 3AA2A 2D0BA 3TARA 4B8AB 4C8KA 4Z4HA 4F3TA 2IS3A 1S1XA 1NK0A 3NF7A 1IG9A 3I8DA 1S5JA 3C94A 4DTOA 4DFPA 1RTHA 4F2RA 4QOZB 4CF0A 1WAFA 5D3GA 4CJ4A 1QSLA 1HJRA 2RF2A 2HB5A 4B9MA 2A1RA 4KKOA 4NCBA 4KHUA 2BGGA 2Z1IA 4M45A 3OYIA 3SPYA 4HHTA 3V9XA 4DQRA 4Z4GA 3K57A 1RDBA 3QO9A 3L2VA 3ZSRA 1HPZA 4E1NA 1SUQA 4B3OA 1WSHA 1U47A 4FJKA 1I3AA 1RT1A 1XHZA 1NK4A 4PQUA 2FBTA 3TAEA 1HQEA 1UWBA 1VSEA 2B5JA 3MEGA 3QNOA 5HLFA 4OGEA 1SKSA 3SZ2A 3NAEA 4O44A 1J5OA 4CEFA 1HYZA 1DTQA 4IG3A 4LH4A 5KRSA 4FLXA 1RDCA 3M8PA 2VWKA 3LPUA 5I3UA 4JS5A 4W5NA 4Q0BA 1L3VA 4CJKA 2OA8A 3TABA 4CERA 4OKEA 4FJGA 2DFFA 4W5QA 3LWMA 2Z1GA 3ZT1A 1WLJA 4Y1CA 4CK3A 2VWJA 4DU4A 2BANA 5C25A 4ZHRA 4J2DA 1BQNA 1ITGA 1JL1A 1JLFA 5E41A 1JLBA 4CF8A 1JKHA 4BWMA 1RT5A 2FC0A 3SV3A 1XI1A 4KHYA 4KAZA 1L3SA 1XC9A 1QSYA 1SL1A 1ASWA 2B4JA 3VN5A 3RMDA 4CJFA 3MXIA 4DTJA 1NJYA 1X9MA 4FLWA 4NCAA 1TAUA 3WNFA 3SNNA 3IG1A 3HL8A 3IS9A 4WE1A 1YVUA 1RNHA 3AO3A 3AVLA 3KLGA 3TAPA 3QEXA 4N41A 3NCIA 3CFPA 4DMNA 1NKCA 1MU2A 2E6MA 2YHAA 2IAJA 1EP4A 2YKMA 3PO4A 3NF9A 2LSNA 1QSSA 1S9EA 4FM0A 1WN7A 3VQDA 3PX0A 4RW8A 3WNEA 1VRUA 4ICLA 4DSKA 3G0ZA 1ZBLA 3EY1A 3DMJA 4FJHA 1NJXA 5KGWA 4C8LA 1RBSA 1HRHA 2QXFA 3KKSA 3NF6A 4AHCA 3RMCA 5CY4A 4B9UA 4FZYA 3V1RA 4W5OA 4RG8A 1KLMA 3OJUA 3SPZA 1RILA 2HNZA 3S3NA 1NKBA 4KHQA 1VSIA 1FKPA 3DOKA 3DRRA 4E7KA 3ZT0A 3BDPA 3HO1A 4I9QA 4KPYA 1KVCA 1NK5A 1VSHA 5KRTA 2KZMA 3KD1E 4DSJA 3HPHA 3OVNA 2JGUA 2GUIA 1C0TA 3QEIA 3NGZA 3KJVA 1YTAA 3WNGA 4IFVA 3LANA 4FZZA 1J54A 1ASUA 3ITHA 1YTUA 1X1PA 4B8CA 3K2PA 4O0JA 1TKTA 4PUOA 4MFBA 3U3YA 4Z4FA 4E1MA 4CJUA 2DY4A 2OPQA 3KIOA 4OJRA 4XIUA 3L2UA 1B92A 4YNQA 4DF8A 4KHWA 4FLVA 1VSKA 4OKKA 4J2EA 1HNVA 3ASMA 4CGJA 5J1EA 4ZTJA 1GOCA 1JL2A 5CYQA 1ZBIA 5KGXA 3U3GA 3AV9A 4C8OA 3F73A 3LDSA 1KFDA 1VSFA 3AVIA 4CJ5A 2KTQA 4LD0A 4CGIA 2XO7A 3RRHA 1HMVA 3PV8A 4R5PA 4HUFA 5HBMA 3HSTB 3OY9A 3HVRA 4DTPA 4PY5A 3SQ2A 5JS1A 4Z0UA 1HNIA 3ZSZA 3PO5A 4FK2A 2PYLA 2O4IA 4CIGA 1RDDA 2XY8A 3AVBA 4O5BA 3O3FA 3OYJA 3LZIA 4E7LA 2YHBA 4CJSA 4DQQA 3VQ4A 4LSNA 4OLBA 2OZSA 4FJIA 3S9HA 4J2BA 4DS5A 3AA5X 4BDZA 1S1VA 3QEPA 3DLBA 2YNHA 2QK9A 2BE2A 1CXUA 4RW7A 3K5NA 4TSXA 1NOZA 1RBRA 1XWLA 3PX4A 1U48A 3QIOA 3M8RA 2XY7A 3PY8A 1HQUA 1TK5A 1VSJA 2Y1IA 4F2SA 1D9DA 1ZYQA 2VG7A 4CHPA 3RMBA 1S1WA 5T7BA 3K5MA 3V9WA 5HROA 4CHOA 4FYDA 3AVJA 4B9VA 1DTTA 3KLEA 2OYQA 4CGDA 2KZZA 1L3TA 3D0PA 1KLNA 3EYZA 2JLEA 3UIQA 4M41A 2G8FA 3RMAA 3NH2A 3DLKA 4AHVA 4CHQA 1TKZA 4B9SA 1NJZA 4KTZA 3NHGA 2DFHA 1REVA 3P5JA 2G8HA 4J2AA 4I2PA 5CZ2A 1GOAA 4C8MA 4CJQA 3QEVA 3VQ7A 1S1UA 2G8KA 4BDPA 1XHXA 3LAKA 3JYTA 1KFSA 1C0UA 4FLUA 5HRRA 1CXQA 4FK0A 1T03A 3CG7A 2OPRA 1TK8A 4JRQA
chains in the Genus database with same CATH superfamily
1IH7A 1M90O 3GOIA 2F4VK 4PHTX 3DLEA 4DTRA 3J81O 2G8UA 4BGBA 3SV4A 1KVAA 4BRHA 2O8EA 1Z6RA 3PIOL 2H3GX 3CYMA 1S9GA 1KVBA 3H08A 2P51A 5KPZA 3G25A 4GY2B 1LAVA 1K6YA 4AHRA 1GLFO 3CD6N 3WEEA 4BDYA 5B8HA 4M42A 4FJXA 3I0SA 4BACA 4PWDA 4KREA 1SKRA 4KI4A 3UKUB 3F9KA 4MQ3A 3DI6A 3HTVA 3C6UA 1BCOA 2GBZA 1NGHA 1C0MA 3ULEB 4JKBA 4B9NA 4KHNA 3EEQA 1NGBA 1HKBA 4YOUA 3A5NC 1JJ2M 3A2FA 2P9PB 3QEWA 1CZ9A 2O8FA 3CC2N 2IC3A 3CM5A 4BE2A 3ZSVA 2YNGA 4IDKA 2E5LK 2ETJA 1T8EA 3PUFA 4WCEL 3DRPA 3T3FA 5BRHA 3MN6A 4CFAA 4O55A 3SQ0A 4XH4A 4CBXA 4EP5A 4N5SA 4MLEA 1RTIA 2YJEA 3FGUA 3ENHA 3VEVA 4FM2A 4KB0A 5FROA 4CF1A 4CZGA 1GLDG 4RWTA 3OYAA 3AVGA 3SBTA 1D9FA 4FW2A 1YJNN 3RWUA 1YJ9N 2D0OA 2X74A 4BC5A 2FF6A 4GW6A 4BE1A 4KTWA 1QHTA 4H0TB 4JN4A 3P1GA 2NUBA 4B1ZA 4ELTA 4DSIA 4CEBA 1TUYA 5AJ3K 3F5TA 2IDOA 3ZEUB 3AAQA 4GKJK 1SS6A 3V81A 4M3ZA 2BH1A 1C1BA 2PY5A 3QMLA 4DFJA 1OH7A 1UA0A 4CJTA 3HP9A 3SMSA 2F9WA 4FJ5A 4ILJA 2ZM6K 3B6PA 5BREA 4X64K 3ZT4A 2BTFA 4N47A 3L2RA 4AHTA 3D7EO 3MEEA 2XHBA 1LAWA 3VQCA 5BR9A 1IV0A 1BI4A 5JMVA 3LP3A 3CFRA 4OGCA 3S41A 3AVAA 5AQJA 1EKEA 3KKRA 1CZBA 3T1AA 5J2QA 4OPAA 3T19A 2HNDA 3E9PA 5AQVA 1JCEA 4C8NA 5M1KA 3CCVN 3MMVA 4DG1A 2ATQA 3R8EA 3OA9A 1N6QA 5BPNA 4KI6A 3NH0A 1U04A 1Q86O 4H0XB 2XRIA 3OYCA 5EX5A 2Z1JA 3T7ZA 4FVMA 4A2BA 4NCGA 3P83D 4FJNA 2D5RA 1IKVA 5LJWA 4WYBA 5LY3A 2YKNA 4BRGA 4IG0A 5AQSA 2FLOA 1B9FA 1VK0A 5C10A 2RPIA 3QFPA 1BIZA 4EIAA 4BRDA 3BGRA 2W42A 4LH5A 2P9KB 1Q8IA 3F9MA 1U45A 3C7NA 3KLHA 4ID1A 1NGCA 4A62A 4B3TK 1S1TA 4CJWA 4OLAA 4CEZA 4KTQA 3QINA 3CJCA 4FJLA 3AA4A 3RTVA 3OYNA 4DTSA 1IBLK 2ITGA 5DM7L 1EO1A 3NH1A 1HLUA 3NFAA 4C23A 3IUCA 1HYVA 3C65A 3D2EB 3ZX3A 3TR8A 3IMXA 2PZSA 3DRSA 1TL3A 4Z4CA 3OTOK 1GLAG 4E7JA 1NMDA 4DSLA 3GL1A 2UU9K 5IT9O 2IVNA 1BCMA 3ULDA 4JI3K 3NGIA 1P8ZA 4QS7A 2NNWA 1LWCA 2A42A 4GVEA 3SMPA 1C1CA 3HOSA 2F8TA 4Z94A 3P38A 4JKCA 5GIPA 4KO0A 3HYFA 3VEYA 4F3OA 4BWJA 3TSUA 1YF5L 2NRTA 2FBXA 1QHAA 4CJLA 3QESA 2FBYA 1NJWA 4JKEA 3AVMA 1YT3A 2A5XA 4DTUA 2W40A 4K41A 1T7PA 4DU3A 4CJRA 1EETA 1SZ2A 3QFUA 4FL9A 3O4NA 3AA2A 4BRIA 2V51B 2D0BA 4C8KA 4Z4HA 4F3TA 3JAMO 1S5JA 3CI5A 3UE5A 2QTDA 2RF2A 4KHUA 4HHTA 4DQRA 5FPMA 2KKZA 3L2VA 3CCJN 4E1NA 4FJKA 1I3AA 1NK4A 3TAEA 1WBDA 3J80O 1HQEA 2NLXA 4OGEA 3C0BA 4M7YA 4O5FA 1J5OA 1HYZA 4IG3A 2WFBA 3M8PA 1VQMN 3ZYYX 3LPUA 4W5NA 4JS5A 1LOTB 3ENOA 4CJKA 4BR2A 3TABA 4OKEA 1ESVA 1YITN 4EFHA 2VWJA 2BANA 2W6LA 3H3OB 4CZHA 5C25A 2NRZA 1JL1A 2ASOA 1JLBA 3IDHA 4CF8A 1RT5A 4IO9L 1BOTO 1ASWA 1NJYA 3WNFA 3IG1A 3MX5A 3DLLL 1RNHA 1JCGA 4N41A 3NCIA 4DMNA 3O9QA 1C0FA 4I6MA 4QS8A 1WN7A 1XNQK 3PX0A 3CIPA 1ZBLA 4WF9L 4NXNK 4YOTA 4FOIA 3NF6A 5M1NA 4W5OA 3QBXA 1KAXA 2VQEK 3SPZA 4X65K 1RILA 3BDPA 1S22A 1OH8A 4NLCA 2KZMA 2YHWA 3KD1E 5AQKA 3HPHA 3QEIA 3ZX2A 3NGZA 4BVOA 3WNGA 4IFVA 5JVHL 5BRFA 4WFAL 4BC4A 3ITHA 1YTUA 4O0JA 4PL7A 4FO0A 1TKTA 1FJGK 3U3YA 3BZKA 2DY4A 1EQYA 2OPQA 3KIOA 1GLCG 4XIUA 3L2UA 3I33A 1VSKA 4JKAA 4GKKK 1HNVA 3ASMA 4CGJA 5J1EA 2HOEA 5MLCQ 1JL2A 3A0IX 4K0KK 3LDSA 4FWRA 3K9JA 2KTQA 2XO7A 2IVPA 5HBMA 3HSTB 4CZEA 3THYB 2O4IA 1QQMA 2XY8A 3OYJA 4OLBA 4WFBL 3AA5X 5ADXA 1S1VA 4BDZA 4LFAK 3CQXA 4ILGB 1CXUA 4Y0WA 3TTFA 4BG8A 1IJJA 4TSXA 3EKUA 1XWLA 3M8RA 1TK5A 5AZJB 3H1QA 3WXIA 4NXMK 3PIPL 4NLBA 3TPQA 3DXKB 4OO1J 3QBWA 3V9WA 1DTTA 3KLEA 2UYTA 4DR3K 1L3TA 1VQKN 2IVOA 3EYZA 4M41A 3NH2A 3DLKA 4AHVA 4CHQA 4DV2K 1K73O 1REVA 3P5JA 3VF4A 1VQ4N 3AY9A 5CZ2A 1GOAA 3QEVA 3H45C 3VQ7A 1BWFO 2RHKA 2QWLA 1Q7YO 5HRRA 2IOCA 4GMJB 2PFUA 3OYEA 1KTQA 1BO5O 1NLVA 1N5YA 4FWMA 3QNNA 3AO1A 2HVIA 1WSGA 4FCYA 4BVPA 1RT6A 5DMRA 3TI0A 2P5OA 3ID6A 4H5VA 5HOOA 4YHHK 4A61A 3I55N 3E01A 4OPKA 3DXMA 2DPNA 3PSIA 2HHVA 3LP2A 4CJ7A 4JKGA 3LP1A 4IEEA 2GV9A 3HVTA 2IGIA 3CM6A 4I9LA 3UB5A 3WQUA 3J7ZO 4JI5K 3I56N 3DLGA 4CE9A 3TWHA 3C6AA 3ISNC 4C1NK 4F8RA 4BRNA 5JS2A 4LSLA 4DF4A 3TANA 1RCHA 3CCLN 1X9WA 5KPTA 5TKWA 4YOYA 3RRGA 3AVNA 3NMUA 3T1HK 4IBNA 1VSDA 3AVKA 1LW2A 5LMNK 2OCEA 1GOBA 1KCFA 1L5UA 3VF2A 3RR7A 5E84A 4PKHA 4B08A 5KTQA 4W5TA 5AZIA 5C12A 1A5WA 5M1PA 1FKOA 1SL0A 4B3OA 2NRHA 2P9UA 3TAFA 1OVYA 4H0OA 4IEIA 3KD5E 4OPJA 5C42A 4H5RA 5KQ8A 4DCHA 4NB4A 2W41A 2KQ2A 2XY6A 3QETA 3VPZA 5KI6A 5CHIA 3B8AX 3KWGA 4FM1A 1VSLA 3NGYA 3DLHA 1K8KA 4IZ9A 5K14A 3U6FA 3THWB 3DAWA 1QE1A 3R1XA 1TYQA 1BQMA 1OVQA 2I7PA 3M8QA 3O8MA 1D5AA 4DR6K 3ENBA 1QQOA 2KW4A 4IJNA 3M6GA 4HUGA 1NGIA 2YHXA 2HHTA 2HHUA 1LWFA 3VQBA 1YHQN 3MXJA 4JAXA 4LC9B 1BL3A 2KHOA 5CYMA 1UAXA 3RSEB 3G4SN 3CJ9A 3FZMA 1BA0A 3SYZA 1NGDA 4JI6K 3C95A 3LWLA 1S6QA 1WSIA 2YX6A 2P9IB 1OH6A 4IWVA 2ZJRL 1QQCA 4W5RA 5I42A 1RTDA 5E26A 3AVHA 1NK8A 2QW9A 2IIRA 1GLEG 4XEIA 1ZBUA 4BRLA 4PA1A 5AFUA 1NU0A 1VRTA 1E4FT 1TGOA 3WXJA 3UKUA 3SQ4A 3VQ9A 1TYQB 4YFUA 1JXBA 2X78A 2X6NA 3GG4A 5FRMA 3HRGA 5LL6Z 3P4IA 3ULEA 2QWQA 4LY7A 4FJ7A 2YV0X 5C24A 2R7YA 2F96A 2UXDK 1ZC6A 4K8ZA 3LPTA 3R6MA 2VQFK 4BREA 4DTMA 3H6EA 2HMIA 2HHSA 3A5LC 4KHSA 2P9PA 4FK4A 3GDQA 4DR1K 3OBWA 4CK2A 2QA4N 1RDAA 4AHUA 3SQ1A 2D0AA 2WONA 4CJPA 1RT4A 4CHZA 1ZBFA 2OPPA 3S3MA 1X9SA 1IBKK 4DV7K 4DFKA 3HP6A 4B1XB 4ISGA 1XC3A 4FW1A 2HHWA 2HHXA 4M3WA 1K8AO 4HUEA 1EX4A 5AQMA 3TAGA 3KK1A 2YCHA 4IDHA 4M3XA 2EHGA 3CFOA 1SL2A 1NM1A 2YJFA 1HYSA 2JWKA 2V7YA 2ZD1A 2ZQBA 4E7IA 1Q81O 3NBPA 1TAQA 3ZEUA 3DYAA 4Y1DA 5HP1A 2P9SB 1BHLA 2P9LB 3LALA 1TKDA 5FPDA 3VQQA 4JI8K 4NYNA 1Z25A 3H46O 2PBDA 4CZFA 3FFIA 1J9AA 1JLCA 1BGXT 1MA9B 4JD2A 2HW3A 3OYGA 4FXDA 3D45A 2KFNA 4K43A 3JSMA 4CEDA 4BC2A 1QTMA 4F4KA 5FDLA 3OHRA 1BIUA 3U9DA 1RTJA 1ATSA 5HRNA 3TAQA 3KK3A 2O8DB 1O1WA 4CBWA 2A3ZA 2E4LA 4JYAK 2E2QA 4YOXA 3M8SA 5AQYA 1QS4A 2D0CA 3ZSOA 1NK7A 3NF8A 3L2QA 2QWOA 5GAHP 4X62K 1BDGA 3D2FB 3EZ5A 3VQPA 3MX2A 3MCPA 3TARA 2GUPA 1S1XA 4PKIA 1NK0A 1IG9A 3C94A 4J8FA 4DFPA 4JD2B 4QOZB 4CF0A 2NRXA 1HJRA 2P9NB 2HB5A 2P9KA 2BGGA 2Z1IA 4CZJA 1YAGA 3SPYA 4FSVA 1RDBA 3VGLA 3ZSRA 4DR7K 1SUQA 1U2VA 1WSHA 4PQUA 1UWBA 2VYPA 2B5JA 3QNOA 2OTLN 5C15A 4BR9A 5BR8K 3Q7CA 3SZ2A 3NAEA 4GV9A 5AQUA 4LH4A 4FLXA 5JLHA 1U6ZA 3D2EA 4Q0BA 1L3VA 2W6KA 3IKMA 4FJGA 4CERA 4W5QA 2Z1GA 1TUUA 1DT9A 4RCHA 4DU4A 1K9MO 1BQNA 1X3MA 1JLFA 1O13A 2FC0A 2NRRA 4BR5A 1QSYA 4OPHA 3RMDA 3CF5L 1U2VB 4U7BA 3TSPA 3IS9A 4FWOA 3AVLA 3KLGA 3CCSN 3CFPA 3MN5A 2IAJA 3OW2M 1EP4A 2ASPA 1S9EA 2O8CB 3VQDA 3WNEA 1VRUA 4ICLA 4DSKA 3G0ZA 3EY1A 5M1QA 4C8LA 4B9UA 5M1FA 3A5MC 5CY4A 2CGJA 2FSJA 1KLMA 3OJUA 1Q18A 2A6AA 2HNZA 3WT0A 1NKBA 3CJAA 3MDQA 4KHQA 3HO1A 4E7KA 3ZT0A 1NGFA 3NVMA 4KPYA 1HNXK 1N34K 4DSJA 4IOXA 4XH5A 3OVNA 1HX1A 2JGUA 2GUIA 2YHYA 1YTAA 3VEOA 3LANA 1Z05A 1X1PA 3K2PA 5GAEP 2HBJA 4MFBA 4Z4FA 1V4TA 4FPAA 4DF8A 4KHWA 2Q0RA 3BEXA 1RDWX 3O08A 4BC3A 4B1UB 3TTCA 3U3GA 3AV9A 1D4XA 2D0PA 1VSFA 1KAYA 3AVIA 3MN9A 4CJ5A 3P39A 4CGIA 1HMVA 1J6ZA 3MK6A 3OY9A 5CE3A 4PY5A 4DR4K 3PO5A 2PYLA 3ZX0A 4O5BA 2YHBA 2QM1A 4LSNA 2OZSA 4FJIA 5AQGA 3U4LA 4CVNE 3DLBA 3SJHA 1HJOA 4RW7A 3U9ZA 1RBRA 3QIOA 4F2SA 1VSJA 1W2BM 5AQXA 5HROA 4FYDA 4CHOA 3AVJA 4B9VA 2OYQA 2KZZA 1VQ9N 1KLNA 2CGKA 1VHXA 1YUWA 3PSFA 2DFHA 4C8MA 4H03B 4MDAA 4MO5A 1S1UA 2G8KA 4BDPA 1XHXA 4H5TA 5FPEA 2WTUA 1KFSA 1C0UA 4FLUA 4FK0A 1WUAA 3CG7A 5KRTA 3VGMA 3UKRB 1TKXA 2KLAA 1JLAA 2FF3B 2Y1JA 1WAJA 4CFCA 4HCBA 4Q5VA 2E88A 4JK7A 5ADXH 1KRPA 4JV5K 3C6TA 3ZT2A 2KFZA 1ASVA 2WUSA 4DWIA 4G9ZA 4DFMA 4CFBA 2G8VA 1BUPA 1C1AA 4KHPK 3MXMA 2DTUA 3PX6A 3VESA 5HRSA 1VQ8N 4H5WA 1YJWN 3V9SA 4BRMA 4UY8O 3HT3A 3SI6A 1NGEA 5JICA 2F8SA 1SQKA 3O4WA 4IKFA 1FW6A 1TVRA 4B9QA 4CEOA 3WQTA 5AQHA 3THYA 3LDLA 1RBTA 4QAGA 4CF2A 3O5BA 3FE1A 3V9UA 5BPLA 5AQNA 3QDKA 3FFKB 1W0HA 3ZSXA 4CI6A 5CR4A 4FLTA 4DQPA 4JS4A 3OS0A 3OYLA 3QERA 5AZJA 2X6SA 4DV0K 1IO2A 5J2MA 3ZSWA 3QIPA 3DXKA 3VF6A 4M3YA 4HUFA 3DOLA 1RT7A 2RN2A 1JLGA 4BE0A 5DK5A 4RW6A 4JHDB 3LM9A 1ZBSA 5CZ1A 2B6AA 4CZMA 4GNIA 4DV6K 3V1OA 3E9OA 2CH5A 5AQOA 4IFYA 1RT3A 3D6RA 3GE1A 1XUPO 3EE9A 3VQ6A 2HVHA 3L4IA 2YNFA 1JLQA 1U49A 2PYJA 3VENA 3AGRA 3O1WA 3MN7A 2VG5A 1QQNA 3MCAB 3ZCMA 4WFNL 3BZCA 4YOVA 2Q36A 1CLQA 3DWLA 3QB0A 4CJEA 3OYHA 1TV6A 1HNZK 3LDNA 2VCPA 5C2DA 3V1QA 3OBYA 4JI7K 3THXB 3SUPA 4ZTFA 4M3UA 4FJ8A 4JEPA 4CZIA 4E1JA 1NK9A 1Q9XA 2FSNA 4DTXA 3LM2A 1VAZA 3L8BA 4CZLA 4AHSA 2Q31A 4FJJA 5EVZA 4L8RB 2WC9A 3C6HA 4I7FA 4A5AA 1DLOA 4OKJA 1N8RO 1BISA 3I0RA 4B9TA 4YORA 5ELZA 3O4QA 2FSKA 2OTJN 4CBUA 1Y97A 4B1YB 4EZ6A 5GIOA 4A57A 5GINA 3V6DA 3ALYA 3L2WA 3AA3A 2Q0UA 3VTIA 2UUBK 1I94K 3M5RA 2JWLA 3G71N 4DLGA 2WOMA 1WOQA 4CD1A 3L3UA 3KTQA 1RT2A 4AQYK 3IAYA 4KV8A 1ATRA 1NBWA 1TK0A 3QLHA 2QWRA 1LV5A 3O9TA 4JK8A 2P1JA 4F9OA 1ZBHA 1HUXA 3CHWA 4C1NI 5AFUH 1FK9A 4CESA 3QICA 1QZ5A 2GELA 3VQ5A 3THWA 2BDPA 1Q9YA 4CEQA 1NGGA 1JLEA 2ZWHA 3E66A 4DV1K 1HNWK 2D4WA 3SCXA 1RBVA 4B3MK 1I39A 5FLXO 3K9KA 2A1SA 4M3RA 5SWMA 4DLEA 3SAFA 1ILYA 4ILHA 4GVMA 5FPNA 3RSEA 1VQON 5HRPA 5F2RA 1KQSM 3V4IA 3GBTA 4HCCA 2BUPA 3HM9A 3B6OA 2P9IA 4CGGA 1Z26A 4CJ3A 1FXXA 4CJVA 3O9UA 3SUNA 3FLCO 1WSEA 3H1VX 1IKWA 3HJFA 4N56A 2AJQA 4JI1K 3AVFA 2QI2A 4MLHA 4IXCA 5A2QO 3RR8A 3DM2A 2G8IA 4BRPA 4KH5A 3V9ZA 1F21A 2Q1NA 3LDPA 4DU1A 3CCEN 4WQ5A 3AO5A 1EWRA 3LL3A 3KLFA 1WNSA 2ZGYA 3THVA 1E4GT 1R0AA 4BRFA 5EU7A 4WQ4A 4KBOA 3KVGA 4B8AB 3F2KA 1KXPA 4F2RA 1RTHA 1S3XA 2E2PA 1QSLA 2CGLA 4B9MA 4M45A 1M1KO 3OYIA 1W7AA 3V9XA 5TKYA 3K57A 2EWSA 3QO9A 3ZETB 3ZLJA 5LMUK 2UUAK 3A8YA 3T69A 1XHZA 5I9EB 2E2OA 4A5BA 3CXCM 1VSEA 2WBNA 1SKSA 1NJIO 5IWAK 4FWLA 4KH4A 1DTQA 3EL2A 2F9TA 5KRSA 3PLAA 2E2NA 2OA8A 2D1KA 2DFFA 3LWMA 3ZT1A 4CK3A 1W97L 4EHTA 3A5OC 4V19S 3T1YK 5AQZA 2P9SA 2RE2A 1CZAN 2QWNA 2P9LA 1GLJO 1T6CA 3L6QA 1L3SA 1ATNA 4CJFA 4B1VA 4DTJA 4NCAA 1TAUA 3SNNA 4IJAA 3LDQA 3M1FA 2ZJPL 3HL8A 4WE1A 2HBKA 1YVUA 3AO3A 3TAPA 2O8BB 3QEXA 1NKCA 1MU2A 2YHAA 5GADP 2YKMA 1XQSC 3PO4A 2NRVA 1QSSA 5BRDA 3WXKA 2O8DA 1GLLO 4FJHA 1NJXA 3VERA 1RBSA 1BA1A 1HRHA 2QXFA 3KKSA 5AQIA 4FZYA 4JI4K 1YIJN 1VQ6N 5AQRA 3VTHA 5EXWA 3ATUA 1LCUA 1FKPA 1VSIA 3DRRA 3D2FA 3CCMN 1NK5A 1VSHA 1Q82O 1NNEA 4GV6A 2O8EB 4CZKA 3L0QA 4DV4K 4FZZA 4DUYK 1J54A 5AQPA 5F1XA 2A41A 1ASUA 2P9NA 4LFBK 4B8CA 1WBBA 3WEEB 3JS6A 4KH6A 1HR0K 2CH6A 3MWTA 4OJRA 3CMEN 1B92A 3R3LA 1NG9A 4FLVA 4OKKA 4ZTJA 2VGMA 5KGXA 2GX9A 4C8OA 2OANA 4JKFA 4LD0A 3RRHA 3PV8A 4R5PA 3HVRA 2ASMA 1KAZA 3SQ2A 4Z0UA 1HNIA 4FK2A 3O3FA 4BQLA 3S9HA 4J2BA 4DS5A 3J7YP 3QEPA 2QK9A 1E3MA 3O1BA 2O8FB 3PX4A 4FOEA 2XY7A 3PY8A 1QVFM 2FXUA 2VG7A 2AP1A 3U8XA 3W3DA 3RMBA 1P90A 3ATVA 3KK7A 1N33K 2VWBA 4JNEA 3O80A 4FWKA 1BG3A 4LF6K 4EAHD 4FPBA 5LJVA 3CQYA 2JLEA 2G8FA 1ZXOA 4JKDA 3KWIA 4B9SA 3NHGA 5BPMA 3H3NO 2G8HA 3TU5A 2O8CA 3CPWM 4CJQA 3LAKA 4DKWA 3SK3A 1NMNA 4HTLA 1CXQA 1T03A 4GV3A 1TK8A 4BR4A 3AARA 3VQ8A 1UOCA 4CIFA 4A2AA 2XY5A 2VG6A 1X3NA 2EX3A 4HVJA 1IKXA 4DSEA 4CGHA 1TL1A 4CF9A 2Q3SA 2QKKA 3MECA 4CEAA 3O3HA 2E1YA 4EZ9A 4E0DA 1WB9A 5C2FA 1IG8A 3IFRA 3AO4A 5KQDA 4LF8K 4ELUA 1A5XA 1C6VA 1BI4B 3VGKA 3KK2A 4OX9K 1QVGM 4CK1A 3AO2A 3FZHA 4BRCA 4H8KA 3ZSYA 2A40A 3FR0A 4E19A 2HNYA 5J2NA 2ZE2A 2G8WA 1U4BA 1NGJA 1VQPN 2HBLA 2NZTA 3CMAN 3BF1A 4AH9A 4X66K 4KB1A 4N76A 4FLZA 4H4MA 3K5LA 2HF3A 1RDUA 3CQ8A 3HPOA 1NGAA 1SKWA 3SUQA 3HM8A 2HBMA 2E6LA 1WSFA 3DJCA 4FWNA 3SAHA 1RBUA 3K59A 4B3SK 2ZJQL 3HI0A 1VSMA 1VQLN 1N36K 2Q97A 2PAVA 4RTFD 1W9HA 3NVKA 4B9LA 3OS1A 4AILC 4H0VB 1NWKA 4CHNA 3I8BA 1D8YA 4L3QA 2QXLA 3OYFA 4NYFA 3SAGA 3CPEA 4DTNA 2RKIA 2HHQA 1SV5A 3MEDA 3OYBA 4PL8A 3C7NB 4E7HA 2AA4A 3O3GA 4M63C 3EO3A 5AQFA 3LDOA 4U67L 4UQGA 4Z4EA 4PKGA 3VQAA 2OZMA 3E1YA 3AVCA 3HZ6A 4DV3K 3CETA 4LF7K 3L3VA 1J53A 3HBTA 1MWMA 3OYMA 2NRWA 2YI1A 1T05A 4FJMA 2FBVA 4YDUC 3S3OA 3EN9A 4I2QA 5AQWA 3VEWA 3UKRA 3VA0A 3M3ZA 2GWKA 4ID5A 1H1VA 3KLIA 3KZBA 4BROA 4YY3K 1JXEA 1B9DA 5H1SQ 3BF3A 3MAQA 5SZTA 4FWQA 4CIEA 4DS4A 1IKYA 1G15A 2I5JA 1G99A 1N32K 3BP8A 3HSCA 3WNHA 1GLBG 4K8XA 3K58A 4DQSA 4AM6A 1XMOK 3P31A 2DFEA 1S6PA 3RVCA 2I7NA 4CCHA 2HSTA 1L3UA 4ELVA 5C0YA 4DQIA 2OPSA 3LAMA 4EP4A 2UUCK 1EXQA 4CHYA 4DUZK 5HL7L 4LF5K 3FZKA 3J7AP 2GTDA 3OJSA 4IO8A 5DM6L 4KRFA 3WXLA 3LZJA 4RW4A 2YNIA 1JCFA 4HWIA 4CGFA 1NOYA 2QKBA 2UXCK 4RW9A 4O4GA 1LWEA 4H4OA 3CJ7A 4DR2K 4H0YB 4JLHA 3DLRA 4BRAA 4HTUA 4QCLA 1SAZA 1OKJA 4E89A 3TAMA 4B1WB 2E8AA 4JI2K 3IRXA 5J2PA 4JHDA 2O4GA 1A5VA 3VQEA 3HK2A 1DEJA 1T44A 4O0IA 3BY5A 4CFDA 3OYKA 3WUHA 1WSJA 5M1OA 2ZGZA 1KSPA 4EHUA 3VOVA 2HF4A 1NK6A 3VMFB 3VETA 5BN9A 4BQZA 1DKGD 4DB3A 2P5GA 4G1QA 4LFCK 3BUZB 3HXMA 4CD3A 3VEZA 4BR7A 5KPRA 2Z1HA 3SJJA 1KC8O 1VQ7N 3J8AA 4WQ5C 4H0PA 4B3RK 4FJ9A 4BRKA 5FRNA 1HKGA 3CJBA 3CJ1A 1DGKN 1UA1A 1NKEA 4AM7A 3TTDA 4JK9A 4WQ4C 4YOWA 4IFEA 4FLYA 3THXA 1YI2N 3VA3A 4BR0A 4Z4IA 4E3SA 3O9RA 4FVUA 3E9LA 1MDUB 3HPGA 1VQNN 3W0LA 4CECA 2F7TA 4I6MB 3G10A 3K5OA 3OYDA 1LW0A 2E20A 3TSQA 5BN8A 2GWJA 3NDKA 3ID8A 3NE6A 3SUOA 4FZXC 4M3TA 4OVLA 4KFBA 3ZT3A 1IBMK 4DSFA 3LP0A 4BGAA 3O9SA 4CEEA 3ZSQA 4R79A 4DV5K 2VGNA 4JRPA 3OS2A 1V4SA 2IS3A 1XNRK 3NF7A 2V7ZA 3I8DA 4DTOA 1WAFA 5D3GA 4CJ4A 2A1RA 4KKOA 4NCBA 1EWQA 3Q7BA 4Z4GA 4BY9C 5EOYA 1HPZA 4YDUA 2UXBK 1U47A 1RT1A 2FBTA 3AGKA 3EE8A 4NO7A 3MEGA 4DHYA 4K42A 5HLFA 4QS9A 3CCQN 4DQ8A 1YXQA 4O44A 4H5NA 4CEFA 4CW7B 1RDCA 4IOCL 2VWKA 5I3UA 3FZFA 5JVGL 2HMPA 4O8KA 4XH1A 4O8UA 1WLJA 4Y1CA 2ITMA 3KHYA 4ZHRA 4J2DA 2J4RA 1ITGA 5E41A 1RFQA 1JKHA 4BWMA 3SV3A 1XI1A 4KHYA 4KAZA 3CCRN 1XC9A 1SL1A 2B4JA 3VN5A 4LF4K 3MXIA 3CC7N 1X9MA 4FLWA 1J5EK 2HHHK 1HKCA 3SBGA 5F0XA 1X9JA 4FWPA 4BG9A 2QWMA 2GEMA 2E6MA 2QWPA 3MWPA 4JKHA 3NF9A 2LSNA 4FM0A 2Q2RA 4RW8A 1T3VA 3N4PA 3DMJA 5KGWA 4BRQA 3SLCA 3VEXA 4AHCA 3RMCA 1KD1O 1Y64A 3V1RA 4RG8A 5EY4A 3CERA 3AAPA 3N4QA 4M7XA 4A59A 3S3NA 1S72N 3DOKA 4I9QA 1KVCA 4DR5K 5GAGP 1MWKA 1C0TA 3L4QA 3KJVA 4ISFA 1XMQK 2V52B 1C0GA 3G6EN 3FZLA 4PUOA 3K0SA 4MDBA 1QZ6A 4E1MA 3ZETA 4CJUA 3DXMB 1BU6O 5AQQA 3R9PA 5AR0A 4YNQA 4JKGB 4J2EA 1GOCA 5CYQA 4FWSA 1ZBIA 1OH5A 3F73A 1KFDA 1YVNA 3JXUA 1R59O 4DTPA 5JS1A 3ZSZA 3WXMB 4CIGA 1RDDA 3AVBA 3LZIA 3CCUN 4E7LA 4DQQA 2E1ZA 4CJSA 3VQ4A 3O6WA 1T6DA 2YNHA 2QEXN 2BE2A 3HOTA 3K5NA 1NOZA 1U48A 1HQUA 1VQ5N 2Y1IA 1D9DA 1ZYQA 3EKSA 4CHPA 5AZIB 1S1WA 5T7BA 4K25A 4AF1A 3K5MA 4CGDA 2P9UB 2O8BA 3D0PA 4ISEA 3UIQA 3RMAA 4LF9K 1RGIA 1TKZA 1NJZA 4KTZA 5AQTA 1HPMA 4J2AA 4I2PA 2ZF5O 1K8KB 4MO4A 5JLFA 4IOAL 4JI0K 3JYTA 3EZWA 5AQLA 3CC4N 2OPRA 4JRQA
chains in the Genus database with same CATH topology
2IOCA 1IH7A 3VQ8A 4GMJB 1UOCA 4CIFA 2XY5A 2VG6A 3DLEA 1TKXA 1JLAA 2EX3A 4HVJA 3OYEA 4DTRA 1IKXA 1KTQA 4DSEA 4CGHA 1TL1A 1WAJA 4CFCA 2Y1JA 2G8UA 4HCBA 4CF9A 1N5YA 2Q3SA 2QKKA 3SV4A 3QNNA 1KVAA 4Q5VA 3AO1A 3MECA 4CEAA 2HVIA 1KRPA 3O3HA 1WSGA 3C6TA 3ZT2A 4FCYA 3CYMA 4EZ9A 1RT6A 2KFZA 5DMRA 1ASVA 1S9GA 3TI0A 1KVBA 2P5OA 4DWIA 4E0DA 3H08A 2P51A 4DFMA 4CFBA 3AO4A 2G8VA 4ELUA 1A5XA 1C6VA 1BI4B 1LAVA 1K6YA 4AHRA 3KK2A 4CK1A 3AO2A 1C1AA 4H8KA 4BDYA 3E01A 3MXMA 3ZSYA 2DTUA 4M42A 4OPKA 5HRSA 3PX6A 4FJXA 3I0SA 4BACA 4PWDA 4KREA 4E19A 2HNYA 1SKRA 5J2NA 2ZE2A 3LP2A 2G8WA 4KI4A 3V9SA 1U4BA 3LP1A 3F9KA 4MQ3A 3HT3A 3SI6A 2GV9A 3HVTA 2IGIA 4KB1A 4AH9A 3DI6A 4FLZA 4H4MA 3K5LA 3CM6A 4N76A 4I9LA 4IKFA 2F8SA 3C6UA 1TVRA 4CEOA 1BCOA 2GBZA 3CQ8A 3HPOA 1C0MA 1SKWA 4B9NA 3DLGA 4CE9A 3TWHA 3SUQA 4KHNA 1RBTA 4QAGA 3ISNC 4CF2A 2HHVA 3V9UA 2E6LA 4F8RA 1WSFA 5JS2A 4LSLA 4DF4A 3TANA 1RBUA 3K59A 1RCHA 1X9WA 3RRGA 3AVNA 1VSMA 3A2FA 4IBNA 1VSDA 1W0HA 3ZSXA 3AVKA 1LW2A 1W9HA 4FLTA 3QEWA 1CZ9A 4DQPA 4JS4A 3OS0A 3OYLA 1GOBA 1KCFA 1L5UA 4B9LA 3OS1A 4AILC 3QERA 2IC3A 2X6SA 3RR7A 4CHNA 1D8YA 4B08A 1IO2A 3CM5A 3ZSWA 5KTQA 4W5TA 3QIPA 4BE2A 5J2MA 3ZSVA 3OYFA 4NYFA 4DTNA 1A5WA 4M3YA 2RKIA 1FKOA 1RT7A 2RN2A 1SV5A 2YNGA 3DOLA 3MEDA 2ETJA 4IDKA 3OYBA 1JLGA 3PUFA 1T8EA 4BE0A 1SL0A 3DRPA 5DK5A 3O3GA 4E7HA 3T3FA 4CFAA 3TAFA 4O55A 3SQ0A 4RW6A 3KD5E 4EP5A 5C42A 4OPJA 5CZ1A 4UQGA 4N5SA 2B6AA 1RTIA 4FM2A 4Z4EA 4KB0A 2KQ2A 5FROA 2XY6A 4CF1A 3QETA 5KI6A 3VQAA 2OZMA 3OYAA 4FM1A 3AVGA 3AVCA 1VSLA 3V1OA 1D9FA 3NGYA 3DLHA 3U6FA 4FW2A 5K14A 3RWUA 1QE1A 4IFYA 1RT3A 2X74A 3L3VA 1J53A 1BQMA 3M8QA 4GW6A 4BE1A 1D5AA 4KTWA 1QHTA 3OYMA 1T05A 4FJMA 3P1GA 2FBVA 2KW4A 2NUBA 4DSIA 3VQ6A 4ELTA 4HUGA 3S3OA 4CEBA 2HVHA 4I2QA 2HHTA 2HHUA 1LWFA 2YNFA 1JLQA 3VQBA 3VA0A 1U49A 2IDOA 2PYJA 3MXJA 2VG5A 3V81A 4M3ZA 3ZCMA 1BL3A 1C1BA 4ID5A 5CYMA 2PY5A 1UAXA 4DFJA 1CLQA 1UA0A 4CJTA 3KLIA 3SYZA 3HP9A 4CJEA 2HHQA 4FJ5A 1JXEA 1B9DA 1TV6A 3C95A 3OYHA 3B6PA 3ZT4A 3V1QA 3LWLA 1S6QA 3MAQA 4N47A 5SZTA 3L2RA 1WSIA 4AHTA 2XHBA 3MEEA 1LAWA 3VQCA 1BI4A 3LP3A 4CIEA 1QQCA 4W5RA 1IKYA 4OGCA 3CFRA 3AVAA 4DS4A 3SUPA 5I42A 1RTDA 1G15A 2I5JA 4ZTFA 3AVHA 1EKEA 3WNHA 1NK8A 4FJ8A 4M3UA 4K8XA 3KKRA 1ZBUA 3K58A 4DQSA 1NK9A 1Q9XA 1CZBA 3T1AA 4DTXA 4PA1A 5J2QA 1VRTA 2HNDA 3T19A 1TGOA 3L8BA 2DFEA 3SQ4A 4C8NA 1S6PA 3VQ9A 4CCHA 4AHSA 1L3UA 4ELVA 4YFUA 1JXBA 4FJJA 4DQIA 4DG1A 4L8RB 2ATQA 2X78A 2X6NA 2OPSA 1N6QA 3LAMA 4EP4A 1EXQA 4CHYA 5FRMA 4KI6A 4I7FA 3NH0A 1DLOA 1U04A 4OKJA 2XRIA 3OYCA 4LY7A 3OJSA 1BISA 2Z1JA 4FJ7A 3I0RA 4FVMA 2YV0X 5C24A 4NCGA 4B9TA 2R7YA 2F96A 4KRFA 3O4QA 3P83D 3LZJA 4RW4A 2D5RA 4K8ZA 4FJNA 4EZ6A 1IKVA 1Y97A 3LPTA 2YNIA 4CGFA 4DTMA 3V6DA 1NOYA 2YKNA 3ALYA 3L2WA 2HMIA 4IG0A 4RW9A 4KHSA 2QKBA 1B9FA 2HHSA 3AA3A 1VK0A 4FK4A 4O4GA 4CK2A 1RDAA 1LWEA 2RPIA 4AHUA 4H4OA 3SQ1A 2D0AA 2WONA 1BIZA 4DLGA 4CJPA 2WOMA 1RT4A 4JLHA 3L3UA 4CHZA 3DLRA 1ZBFA 2OPPA 3BGRA 2W42A 4LH5A 4HTUA 3S3MA 1X9SA 3KTQA 1RT2A 4QCLA 3IAYA 4DFKA 1Q8IA 3HP6A 4E89A 4KV8A 3TAMA 1U45A 1TK0A 3QLHA 4FW1A 3KLHA 2HHWA 4ID1A 2HHXA 3IRXA 4M3WA 5J2PA 1LV5A 1S1TA 2O4GA 4CJWA 4HUEA 4OLAA 1A5VA 1EX4A 2P1JA 3VQEA 3TAGA 1ZBHA 3HK2A 4CEZA 4KTQA 3QINA 3KK1A 4O0IA 4FJLA 3AA4A 1FK9A 4CESA 3OYNA 3RTVA 4CFDA 3OYKA 4DTSA 1WSJA 3VQ5A 2ITGA 2BDPA 2EHGA 1Q9YA 4M3XA 4CEQA 3NH1A 1JLEA 3CFOA 3NFAA 1SL2A 1KSPA 1HYSA 3SCXA 1HYVA 1RBVA 1I39A 1NK6A 2A1SA 2ZD1A 2ZQBA 4E7IA 4M3RA 5SWMA 2P5GA 4DLEA 3TR8A 4G1QA 3NBPA 3HXMA 1TAQA 3DYAA 4Y1DA 5HP1A 2PZSA 2Z1HA 3SJJA 4GVMA 3DRSA 1BHLA 1TL3A 4Z4CA 5HRPA 3LALA 4E7JA 1TKDA 4DSLA 3VQQA 4FJ9A 5FRNA 4NYNA 3V4IA 4HCCA 1Z25A 3HM9A 1UA1A 1BCMA 3B6OA 3ULDA 1NKEA 3FFIA 3NGIA 1J9AA 1JLCA 4CGGA 1BGXT 1Z26A 3OYGA 4CJ3A 1FXXA 4FLYA 4CJVA 2HW3A 4FXDA 3VA3A 3D45A 2KFNA 4Z4IA 4E3SA 1LWCA 3JSMA 4CEDA 3SUNA 1QTMA 4F4KA 1WSEA 5FDLA 1C1CA 1BIUA 3HPGA 2F8TA 1IKWA 3HJFA 4CECA 4N56A 2AJQA 4KO0A 3G10A 1RTJA 3HYFA 3AVFA 4BWJA 4F3OA 3K5OA 5HRNA 3TAQA 3OYDA 1LW0A 3RR8A 3KK3A 3DM2A 2G8IA 3NE6A 1O1WA 3NDKA 2FBXA 2E4LA 3SUOA 4FZXC 4CJLA 4M3TA 4OVLA 3V9ZA 3QESA 4KFBA 3ZT3A 1F21A 2FBYA 3LP0A 4DSFA 1NJWA 4DU1A 3M8SA 3AVMA 1QS4A 2D0CA 1YT3A 3AO5A 4CEEA 4DTUA 3ZSOA 1T7PA 3ZSQA 4DU3A 1NK7A 3NF8A 4CJRA 3KLFA 3L2QA 1WNSA 3THVA 1R0AA 1EETA 3EZ5A 4JRPA 5EU7A 3VQPA 3O4NA 3OS2A 3AA2A 2D0BA 3TARA 4B8AB 4C8KA 4Z4HA 4F3TA 2IS3A 1S1XA 1NK0A 3NF7A 1IG9A 3I8DA 1S5JA 3C94A 4DTOA 4DFPA 1RTHA 4F2RA 4QOZB 4CF0A 1WAFA 5D3GA 4CJ4A 1QSLA 1HJRA 2RF2A 2HB5A 4B9MA 2A1RA 4KKOA 4NCBA 4KHUA 2BGGA 2Z1IA 4M45A 3OYIA 3SPYA 4HHTA 3V9XA 4DQRA 4Z4GA 3K57A 1RDBA 3QO9A 3L2VA 3ZSRA 1HPZA 4E1NA 1SUQA 4B3OA 1WSHA 1U47A 4FJKA 1I3AA 1RT1A 1XHZA 1NK4A 4PQUA 2FBTA 3TAEA 1HQEA 1UWBA 1VSEA 2B5JA 3MEGA 3QNOA 5HLFA 4OGEA 1SKSA 3SZ2A 3NAEA 4O44A 1J5OA 4CEFA 1HYZA 1DTQA 4IG3A 4LH4A 5KRSA 4FLXA 1RDCA 3M8PA 2VWKA 3LPUA 5I3UA 4JS5A 4W5NA 4Q0BA 1L3VA 4CJKA 2OA8A 3TABA 4CERA 4OKEA 4FJGA 2DFFA 4W5QA 3LWMA 2Z1GA 3ZT1A 1WLJA 4Y1CA 4CK3A 2VWJA 4DU4A 2BANA 5C25A 4ZHRA 4J2DA 1BQNA 1ITGA 1JL1A 1JLFA 5E41A 1JLBA 4CF8A 1JKHA 4BWMA 1RT5A 2FC0A 3SV3A 1XI1A 4KHYA 4KAZA 1L3SA 1XC9A 1QSYA 1SL1A 1ASWA 2B4JA 3VN5A 3RMDA 4CJFA 3MXIA 4DTJA 1NJYA 1X9MA 4FLWA 4NCAA 1TAUA 3WNFA 3SNNA 3IG1A 3HL8A 3IS9A 4WE1A 1YVUA 1RNHA 3AO3A 3AVLA 3KLGA 3TAPA 3QEXA 4N41A 3NCIA 3CFPA 4DMNA 1NKCA 1MU2A 2E6MA 2YHAA 2IAJA 1EP4A 2YKMA 3PO4A 3NF9A 2LSNA 1QSSA 1S9EA 4FM0A 1WN7A 3VQDA 3PX0A 4RW8A 3WNEA 1VRUA 4ICLA 4DSKA 3G0ZA 1ZBLA 3EY1A 3DMJA 4FJHA 1NJXA 5KGWA 4C8LA 1RBSA 1HRHA 2QXFA 3KKSA 3NF6A 4AHCA 3RMCA 5CY4A 4B9UA 4FZYA 3V1RA 4W5OA 4RG8A 1KLMA 3OJUA 3SPZA 1RILA 2HNZA 3S3NA 1NKBA 4KHQA 1VSIA 1FKPA 3DOKA 3DRRA 4E7KA 3ZT0A 3BDPA 3HO1A 4I9QA 4KPYA 1KVCA 1NK5A 1VSHA 5KRTA 2KZMA 3KD1E 4DSJA 3HPHA 3OVNA 2JGUA 2GUIA 1C0TA 3QEIA 3NGZA 3KJVA 1YTAA 3WNGA 4IFVA 3LANA 4FZZA 1J54A 1ASUA 3ITHA 1YTUA 1X1PA 4B8CA 3K2PA 4O0JA 1TKTA 4PUOA 4MFBA 3U3YA 4Z4FA 4E1MA 4CJUA 2DY4A 2OPQA 3KIOA 4OJRA 4XIUA 3L2UA 1B92A 4YNQA 4DF8A 4KHWA 4FLVA 1VSKA 4OKKA 4J2EA 1HNVA 3ASMA 4CGJA 5J1EA 4ZTJA 1GOCA 1JL2A 5CYQA 1ZBIA 5KGXA 3U3GA 3AV9A 4C8OA 3F73A 3LDSA 1KFDA 1VSFA 3AVIA 4CJ5A 2KTQA 4LD0A 4CGIA 2XO7A 3RRHA 1HMVA 3PV8A 4R5PA 4HUFA 5HBMA 3HSTB 3OY9A 3HVRA 4DTPA 4PY5A 3SQ2A 5JS1A 4Z0UA 1HNIA 3ZSZA 3PO5A 4FK2A 2PYLA 2O4IA 4CIGA 1RDDA 2XY8A 3AVBA 4O5BA 3O3FA 3OYJA 3LZIA 4E7LA 2YHBA 4CJSA 4DQQA 3VQ4A 4LSNA 4OLBA 2OZSA 4FJIA 3S9HA 4J2BA 4DS5A 3AA5X 4BDZA 1S1VA 3QEPA 3DLBA 2YNHA 2QK9A 2BE2A 1CXUA 4RW7A 3K5NA 4TSXA 1NOZA 1RBRA 1XWLA 3PX4A 1U48A 3QIOA 3M8RA 2XY7A 3PY8A 1HQUA 1TK5A 1VSJA 2Y1IA 4F2SA 1D9DA 1ZYQA 2VG7A 4CHPA 3RMBA 1S1WA 5T7BA 3K5MA 3V9WA 5HROA 4CHOA 4FYDA 3AVJA 4B9VA 1DTTA 3KLEA 2OYQA 4CGDA 2KZZA 1L3TA 3D0PA 1KLNA 3EYZA 2JLEA 3UIQA 4M41A 2G8FA 3RMAA 3NH2A 3DLKA 4AHVA 4CHQA 1TKZA 4B9SA 1NJZA 4KTZA 3NHGA 2DFHA 1REVA 3P5JA 2G8HA 4J2AA 4I2PA 5CZ2A 1GOAA 4C8MA 4CJQA 3QEVA 3VQ7A 1S1UA 2G8KA 4BDPA 1XHXA 3LAKA 3JYTA 1KFSA 1C0UA 4FLUA 5HRRA 1CXQA 4FK0A 1T03A 3CG7A 2OPRA 1TK8A 4JRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOC A;  1IH7 A;  3VQ8 A;  4GMJ B;  1UOC A;  4CIF A;  2XY5 A;  2VG6 A;  3DLE A;  1TKX A;  1JLA A;  2EX3 A;  4HVJ A;  3OYE A;  4DTR A;  1IKX A;  1KTQ A;  4DSE A;  4CGH A;  1TL1 A;  1WAJ A;  4CFC A;  2Y1J A;  2G8U A;  4HCB A;  4CF9 A;  1N5Y A;  2Q3S A;  2QKK A;  3SV4 A;  3QNN A;  1KVA A;  4Q5V A;  3AO1 A;  3MEC A;  4CEA A;  2HVI A;  1KRP A;  3O3H A;  1WSG A;  3C6T A;  3ZT2 A;  4FCY A;  3CYM A;  4EZ9 A;  1RT6 A;  2KFZ A;  5DMR A;  1ASV A;  1S9G A;  3TI0 A;  1KVB A;  2P5O A;  4DWI A;  4E0D A;  3H08 A;  2P51 A;  4DFM A;  4CFB A;  3AO4 A;  2G8V A;  4ELU A;  1A5X A;  1C6V A;  1BI4 B;  1LAV A;  1K6Y A;  4AHR A;  3KK2 A;  4CK1 A;  3AO2 A;  1C1A A;  4H8K A;  4BDY A;  3E01 A;  3MXM A;  3ZSY A;  2DTU A;  4M42 A;  4OPK A;  5HRS A;  3PX6 A;  4FJX A;  3I0S A;  4BAC A;  4PWD A;  4KRE A;  4E19 A;  2HNY A;  1SKR A;  5J2N A;  2ZE2 A;  3LP2 A;  2G8W A;  4KI4 A;  3V9S A;  1U4B A;  3LP1 A;  3F9K A;  4MQ3 A;  3HT3 A;  3SI6 A;  2GV9 A;  3HVT A;  2IGI A;  4KB1 A;  4AH9 A;  3DI6 A;  4FLZ A;  4H4M A;  3K5L A;  3CM6 A;  4N76 A;  4I9L A;  4IKF A;  2F8S A;  3C6U A;  1TVR A;  4CEO A;  1BCO A;  2GBZ A;  3CQ8 A;  3HPO A;  1C0M A;  1SKW A;  4B9N A;  3DLG A;  4CE9 A;  3TWH A;  3SUQ A;  4KHN A;  1RBT A;  4QAG A;  3ISN C;  4CF2 A;  2HHV A;  3V9U A;  2E6L A;  4F8R A;  1WSF A;  5JS2 A;  4LSL A;  4DF4 A;  3TAN A;  1RBU A;  3K59 A;  1RCH A;  1X9W A;  3RRG A;  3AVN A;  1VSM A;  3A2F A;  4IBN A;  1VSD A;  1W0H A;  3ZSX A;  3AVK A;  1LW2 A;  1W9H A;  4FLT A;  3QEW A;  1CZ9 A;  4DQP A;  4JS4 A;  3OS0 A;  3OYL A;  1GOB A;  1KCF A;  1L5U A;  4B9L A;  3OS1 A;  4AIL C;  3QER A;  2IC3 A;  2X6S A;  3RR7 A;  4CHN A;  1D8Y A;  4B08 A;  1IO2 A;  3CM5 A;  3ZSW A;  5KTQ A;  4W5T A;  3QIP A;  4BE2 A;  5J2M A;  3ZSV A;  3OYF A;  4NYF A;  4DTN A;  1A5W A;  4M3Y A;  2RKI A;  1FKO A;  1RT7 A;  2RN2 A;  1SV5 A;  2YNG A;  3DOL A;  3MED A;  2ETJ A;  4IDK A;  3OYB A;  1JLG A;  3PUF A;  1T8E A;  4BE0 A;  1SL0 A;  3DRP A;  5DK5 A;  3O3G A;  4E7H A;  3T3F A;  4CFA A;  3TAF A;  4O55 A;  3SQ0 A;  4RW6 A;  3KD5 E;  4EP5 A;  5C42 A;  4OPJ A;  5CZ1 A;  4UQG A;  4N5S A;  2B6A A;  1RTI A;  4FM2 A;  4Z4E A;  4KB0 A;  2KQ2 A;  5FRO A;  2XY6 A;  4CF1 A;  3QET A;  5KI6 A;  3VQA A;  2OZM A;  3OYA A;  4FM1 A;  3AVG A;  3AVC A;  1VSL A;  3V1O A;  1D9F A;  3NGY A;  3DLH A;  3U6F A;  4FW2 A;  5K14 A;  3RWU A;  1QE1 A;  4IFY A;  1RT3 A;  2X74 A;  3L3V A;  1J53 A;  1BQM A;  3M8Q A;  4GW6 A;  4BE1 A;  1D5A A;  4KTW A;  1QHT A;  3OYM A;  1T05 A;  4FJM A;  3P1G A;  2FBV A;  2KW4 A;  2NUB A;  4DSI A;  3VQ6 A;  4ELT A;  4HUG A;  3S3O A;  4CEB A;  2HVH A;  4I2Q A;  2HHT A;  2HHU A;  1LWF A;  2YNF A;  1JLQ A;  3VQB A;  3VA0 A;  1U49 A;  2IDO A;  2PYJ A;  3MXJ A;  2VG5 A;  3V81 A;  4M3Z A;  3ZCM A;  1BL3 A;  1C1B A;  4ID5 A;  5CYM A;  2PY5 A;  1UAX A;  4DFJ A;  1CLQ A;  1UA0 A;  4CJT A;  3KLI A;  3SYZ A;  3HP9 A;  4CJE A;  2HHQ A;  4FJ5 A;  1JXE A;  1B9D A;  1TV6 A;  3C95 A;  3OYH A;  3B6P A;  3ZT4 A;  3V1Q A;  3LWL A;  1S6Q A;  3MAQ A;  4N47 A;  5SZT A;  3L2R A;  1WSI A;  4AHT A;  2XHB A;  3MEE A;  1LAW A;  3VQC A;  1BI4 A;  3LP3 A;  4CIE A;  1QQC A;  4W5R A;  1IKY A;  4OGC A;  3CFR A;  3AVA A;  4DS4 A;  3SUP A;  5I42 A;  1RTD A;  1G15 A;  2I5J A;  4ZTF A;  3AVH A;  1EKE A;  3WNH A;  1NK8 A;  4FJ8 A;  4M3U A;  4K8X A;  3KKR A;  1ZBU A;  3K58 A;  4DQS A;  1NK9 A;  1Q9X A;  1CZB A;  3T1A A;  4DTX A;  4PA1 A;  5J2Q A;  1VRT A;  2HND A;  3T19 A;  1TGO A;  3L8B A;  2DFE A;  3SQ4 A;  4C8N A;  1S6P A;  3VQ9 A;  4CCH A;  4AHS A;  1L3U A;  4ELV A;  4YFU A;  1JXB A;  4FJJ A;  4DQI A;  4DG1 A;  4L8R B;  2ATQ A;  2X78 A;  2X6N A;  2OPS A;  1N6Q A;  3LAM A;  4EP4 A;  1EXQ A;  4CHY A;  5FRM A;  4KI6 A;  4I7F A;  3NH0 A;  1DLO A;  1U04 A;  4OKJ A;  2XRI A;  3OYC A;  4LY7 A;  3OJS A;  1BIS A;  2Z1J A;  4FJ7 A;  3I0R A;  4FVM A;  2YV0 X;  5C24 A;  4NCG A;  4B9T A;  2R7Y A;  2F96 A;  4KRF A;  3O4Q A;  3P83 D;  3LZJ A;  4RW4 A;  2D5R A;  4K8Z A;  4FJN A;  4EZ6 A;  1IKV A;  1Y97 A;  3LPT A;  2YNI A;  4CGF A;  4DTM A;  3V6D A;  1NOY A;  2YKN A;  3ALY A;  3L2W A;  2HMI A;  4IG0 A;  4RW9 A;  4KHS A;  2QKB A;  1B9F A;  2HHS A;  3AA3 A;  1VK0 A;  4FK4 A;  4O4G A;  4CK2 A;  1RDA A;  1LWE A;  2RPI A;  4AHU A;  4H4O A;  3SQ1 A;  2D0A A;  2WON A;  1BIZ A;  4DLG A;  4CJP A;  2WOM A;  1RT4 A;  4JLH A;  3L3U A;  4CHZ A;  3DLR A;  1ZBF A;  2OPP A;  3BGR A;  2W42 A;  4LH5 A;  4HTU A;  3S3M A;  1X9S A;  3KTQ A;  1RT2 A;  4QCL A;  3IAY A;  4DFK A;  1Q8I A;  3HP6 A;  4E89 A;  4KV8 A;  3TAM A;  1U45 A;  1TK0 A;  3QLH A;  4FW1 A;  3KLH A;  2HHW A;  4ID1 A;  2HHX A;  3IRX A;  4M3W A;  5J2P A;  1LV5 A;  1S1T A;  2O4G A;  4CJW A;  4HUE A;  4OLA A;  1A5V A;  1EX4 A;  2P1J A;  3VQE A;  3TAG A;  1ZBH A;  3HK2 A;  4CEZ A;  4KTQ A;  3QIN A;  3KK1 A;  4O0I A;  4FJL A;  3AA4 A;  1FK9 A;  4CES A;  3OYN A;  3RTV A;  4CFD A;  3OYK A;  4DTS A;  1WSJ A;  3VQ5 A;  2ITG A;  2BDP A;  2EHG A;  1Q9Y A;  4M3X A;  4CEQ A;  3NH1 A;  1JLE A;  3CFO A;  3NFA A;  1SL2 A;  1KSP A;  1HYS A;  3SCX A;  1HYV A;  1RBV A;  1I39 A;  1NK6 A;  2A1S A;  2ZD1 A;  2ZQB A;  4E7I A;  4M3R A;  5SWM A;  2P5G A;  4DLE A;  3TR8 A;  4G1Q A;  3NBP A;  3HXM A;  1TAQ A;  3DYA A;  4Y1D A;  5HP1 A;  2PZS A;  2Z1H A;  3SJJ A;  4GVM A;  3DRS A;  1BHL A;  1TL3 A;  4Z4C A;  5HRP A;  3LAL A;  4E7J A;  1TKD A;  4DSL A;  3VQQ A;  4FJ9 A;  5FRN A;  4NYN A;  3V4I A;  4HCC A;  1Z25 A;  3HM9 A;  1UA1 A;  1BCM A;  3B6O A;  3ULD A;  1NKE A;  3FFI A;  3NGI A;  1J9A A;  1JLC A;  4CGG A;  1BGX T;  1Z26 A;  3OYG A;  4CJ3 A;  1FXX A;  4FLY A;  4CJV A;  2HW3 A;  4FXD A;  3VA3 A;  3D45 A;  2KFN A;  4Z4I A;  4E3S A;  1LWC A;  3JSM A;  4CED A;  3SUN A;  1QTM A;  4F4K A;  1WSE A;  5FDL A;  1C1C A;  1BIU A;  3HPG A;  2F8T A;  1IKW A;  3HJF A;  4CEC A;  4N56 A;  2AJQ A;  4KO0 A;  3G10 A;  1RTJ A;  3HYF A;  3AVF A;  4BWJ A;  4F3O A;  3K5O A;  5HRN A;  3TAQ A;  3OYD A;  1LW0 A;  3RR8 A;  3KK3 A;  3DM2 A;  2G8I A;  3NE6 A;  1O1W A;  3NDK A;  2FBX A;  2E4L A;  3SUO A;  4FZX C;  4CJL A;  4M3T A;  4OVL A;  3V9Z A;  3QES A;  4KFB A;  3ZT3 A;  1F21 A;  2FBY A;  3LP0 A;  4DSF A;  1NJW A;  4DU1 A;  3M8S A;  3AVM A;  1QS4 A;  2D0C A;  1YT3 A;  3AO5 A;  4CEE A;  4DTU A;  3ZSO A;  1T7P A;  3ZSQ A;  4DU3 A;  1NK7 A;  3NF8 A;  4CJR A;  3KLF A;  3L2Q A;  1WNS A;  3THV A;  1R0A A;  1EET A;  3EZ5 A;  4JRP A;  5EU7 A;  3VQP A;  3O4N A;  3OS2 A;  3AA2 A;  2D0B A;  3TAR A;  4B8A B;  4C8K A;  4Z4H A;  4F3T A;  2IS3 A;  1S1X A;  1NK0 A;  3NF7 A;  1IG9 A;  3I8D A;  1S5J A;  3C94 A;  4DTO A;  4DFP A;  1RTH A;  4F2R A;  4QOZ B;  4CF0 A;  1WAF A;  5D3G A;  4CJ4 A;  1QSL A;  1HJR A;  2RF2 A;  2HB5 A;  4B9M A;  2A1R A;  4KKO A;  4NCB A;  4KHU A;  2BGG A;  2Z1I A;  4M45 A;  3OYI A;  3SPY A;  4HHT A;  3V9X A;  4DQR A;  4Z4G A;  3K57 A;  1RDB A;  3QO9 A;  3L2V A;  3ZSR A;  1HPZ A;  4E1N A;  1SUQ A;  4B3O A;  1WSH A;  1U47 A;  4FJK A;  1I3A A;  1RT1 A;  1XHZ A;  1NK4 A;  4PQU A;  2FBT A;  3TAE A;  1HQE A;  1UWB A;  1VSE A;  2B5J A;  3MEG A;  3QNO A;  5HLF A;  4OGE A;  1SKS A;  3SZ2 A;  3NAE A;  4O44 A;  1J5O A;  4CEF A;  1HYZ A;  1DTQ A;  4IG3 A;  4LH4 A;  5KRS A;  4FLX A;  1RDC A;  3M8P A;  2VWK A;  3LPU A;  5I3U A;  4JS5 A;  4W5N A;  4Q0B A;  1L3V A;  4CJK A;  2OA8 A;  3TAB A;  4CER A;  4OKE A;  4FJG A;  2DFF A;  4W5Q A;  3LWM A;  2Z1G A;  3ZT1 A;  1WLJ A;  4Y1C A;  4CK3 A;  2VWJ A;  4DU4 A;  2BAN A;  5C25 A;  4ZHR A;  4J2D A;  1BQN A;  1ITG A;  1JL1 A;  1JLF A;  5E41 A;  1JLB A;  4CF8 A;  1JKH A;  4BWM A;  1RT5 A;  2FC0 A;  3SV3 A;  1XI1 A;  4KHY A;  4KAZ A;  1L3S A;  1XC9 A;  1QSY A;  1SL1 A;  1ASW A;  2B4J A;  3VN5 A;  3RMD A;  4CJF A;  3MXI A;  4DTJ A;  1NJY A;  1X9M A;  4FLW A;  4NCA A;  1TAU A;  3WNF A;  3SNN A;  3IG1 A;  3HL8 A;  3IS9 A;  4WE1 A;  1YVU A;  1RNH A;  3AO3 A;  3AVL A;  3KLG A;  3TAP A;  3QEX A;  4N41 A;  3NCI A;  3CFP A;  4DMN A;  1NKC A;  1MU2 A;  2E6M A;  2YHA A;  2IAJ A;  1EP4 A;  2YKM A;  3PO4 A;  3NF9 A;  2LSN A;  1QSS A;  1S9E A;  4FM0 A;  1WN7 A;  3VQD A;  3PX0 A;  4RW8 A;  3WNE A;  1VRU A;  4ICL A;  4DSK A;  3G0Z A;  1ZBL A;  3EY1 A;  3DMJ A;  4FJH A;  1NJX A;  5KGW A;  4C8L A;  1RBS A;  1HRH A;  2QXF A;  3KKS A;  3NF6 A;  4AHC A;  3RMC A;  5CY4 A;  4B9U A;  4FZY A;  3V1R A;  4W5O A;  4RG8 A;  1KLM A;  3OJU A;  3SPZ A;  1RIL A;  2HNZ A;  3S3N A;  1NKB A;  4KHQ A;  1VSI A;  1FKP A;  3DOK A;  3DRR A;  4E7K A;  3ZT0 A;  3BDP A;  3HO1 A;  4I9Q A;  4KPY A;  1KVC A;  1NK5 A;  1VSH A;  5KRT A;  2KZM A;  3KD1 E;  4DSJ A;  3HPH A;  3OVN A;  2JGU A;  2GUI A;  1C0T A;  3QEI A;  3NGZ A;  3KJV A;  1YTA A;  3WNG A;  4IFV A;  3LAN A;  4FZZ A;  1J54 A;  1ASU A;  3ITH A;  1YTU A;  1X1P A;  4B8C A;  3K2P A;  4O0J A;  1TKT A;  4PUO A;  4MFB A;  3U3Y A;  4Z4F A;  4E1M A;  4CJU A;  2DY4 A;  2OPQ A;  3KIO A;  4OJR A;  4XIU A;  3L2U A;  1B92 A;  4YNQ A;  4DF8 A;  4KHW A;  4FLV A;  1VSK A;  4OKK A;  4J2E A;  1HNV A;  3ASM A;  4CGJ A;  5J1E A;  4ZTJ A;  1GOC A;  1JL2 A;  5CYQ A;  1ZBI A;  5KGX A;  3U3G A;  3AV9 A;  4C8O A;  3F73 A;  3LDS A;  1KFD A;  1VSF A;  3AVI A;  4CJ5 A;  2KTQ A;  4LD0 A;  4CGI A;  2XO7 A;  3RRH A;  1HMV A;  3PV8 A;  4R5P A;  4HUF A;  5HBM A;  3HST B;  3OY9 A;  3HVR A;  4DTP A;  4PY5 A;  3SQ2 A;  5JS1 A;  4Z0U A;  1HNI A;  3ZSZ A;  3PO5 A;  4FK2 A;  2PYL A;  2O4I A;  4CIG A;  1RDD A;  2XY8 A;  3AVB A;  4O5B A;  3O3F A;  3OYJ A;  3LZI A;  4E7L A;  2YHB A;  4CJS A;  4DQQ A;  3VQ4 A;  4LSN A;  4OLB A;  2OZS A;  4FJI A;  3S9H A;  4J2B A;  4DS5 A;  3AA5 X;  4BDZ A;  1S1V A;  3QEP A;  3DLB A;  2YNH A;  2QK9 A;  2BE2 A;  1CXU A;  4RW7 A;  3K5N A;  4TSX A;  1NOZ A;  1RBR A;  1XWL A;  3PX4 A;  1U48 A;  3QIO A;  3M8R A;  2XY7 A;  3PY8 A;  1HQU A;  1TK5 A;  1VSJ A;  2Y1I A;  4F2S A;  1D9D A;  1ZYQ A;  2VG7 A;  4CHP A;  3RMB A;  1S1W A;  5T7B A;  3K5M A;  3V9W A;  5HRO A;  4CHO A;  4FYD A;  3AVJ A;  4B9V A;  1DTT A;  3KLE A;  2OYQ A;  4CGD A;  2KZZ A;  1L3T A;  3D0P A;  1KLN A;  3EYZ A;  2JLE A;  3UIQ A;  4M41 A;  2G8F A;  3RMA A;  3NH2 A;  3DLK A;  4AHV A;  4CHQ A;  1TKZ A;  4B9S A;  1NJZ A;  4KTZ A;  3NHG A;  2DFH A;  1REV A;  3P5J A;  2G8H A;  4J2A A;  4I2P A;  5CZ2 A;  1GOA A;  4C8M A;  4CJQ A;  3QEV A;  3VQ7 A;  1S1U A;  2G8K A;  4BDP A;  1XHX A;  3LAK A;  3JYT A;  1KFS A;  1C0U A;  4FLU A;  5HRR A;  1CXQ A;  4FK0 A;  1T03 A;  3CG7 A;  2OPR A;  1TK8 A;  4JRQ A; 
#chains in the Genus database with same CATH topology
 1IH7 A;  1M90 O;  3GOI A;  2F4V K;  4PHT X;  3DLE A;  4DTR A;  3J81 O;  2G8U A;  4BGB A;  3SV4 A;  1KVA A;  4BRH A;  2O8E A;  1Z6R A;  3PIO L;  2H3G X;  3CYM A;  1S9G A;  1KVB A;  3H08 A;  2P51 A;  5KPZ A;  3G25 A;  4GY2 B;  1LAV A;  1K6Y A;  4AHR A;  1GLF O;  3CD6 N;  3WEE A;  4BDY A;  5B8H A;  4M42 A;  4FJX A;  3I0S A;  4BAC A;  4PWD A;  4KRE A;  1SKR A;  4KI4 A;  3UKU B;  3F9K A;  4MQ3 A;  3DI6 A;  3HTV A;  3C6U A;  1BCO A;  2GBZ A;  1NGH A;  1C0M A;  3ULE B;  4JKB A;  4B9N A;  4KHN A;  3EEQ A;  1NGB A;  1HKB A;  4YOU A;  3A5N C;  1JJ2 M;  3A2F A;  2P9P B;  3QEW A;  1CZ9 A;  2O8F A;  3CC2 N;  2IC3 A;  3CM5 A;  4BE2 A;  3ZSV A;  2YNG A;  4IDK A;  2E5L K;  2ETJ A;  1T8E A;  3PUF A;  4WCE L;  3DRP A;  3T3F A;  5BRH A;  3MN6 A;  4CFA A;  4O55 A;  3SQ0 A;  4XH4 A;  4CBX A;  4EP5 A;  4N5S A;  4MLE A;  1RTI A;  2YJE A;  3FGU A;  3ENH A;  3VEV A;  4FM2 A;  4KB0 A;  5FRO A;  4CF1 A;  4CZG A;  1GLD G;  4RWT A;  3OYA A;  3AVG A;  3SBT A;  1D9F A;  4FW2 A;  1YJN N;  3RWU A;  1YJ9 N;  2D0O A;  2X74 A;  4BC5 A;  2FF6 A;  4GW6 A;  4BE1 A;  4KTW A;  1QHT A;  4H0T B;  4JN4 A;  3P1G A;  2NUB A;  4B1Z A;  4ELT A;  4DSI A;  4CEB A;  1TUY A;  5AJ3 K;  3F5T A;  2IDO A;  3ZEU B;  3AAQ A;  4GKJ K;  1SS6 A;  3V81 A;  4M3Z A;  2BH1 A;  1C1B A;  2PY5 A;  3QML A;  4DFJ A;  1OH7 A;  1UA0 A;  4CJT A;  3HP9 A;  3SMS A;  2F9W A;  4FJ5 A;  4ILJ A;  2ZM6 K;  3B6P A;  5BRE A;  4X64 K;  3ZT4 A;  2BTF A;  4N47 A;  3L2R A;  4AHT A;  3D7E O;  3MEE A;  2XHB A;  1LAW A;  3VQC A;  5BR9 A;  1IV0 A;  1BI4 A;  5JMV A;  3LP3 A;  3CFR A;  4OGC A;  3S41 A;  3AVA A;  5AQJ A;  1EKE A;  3KKR A;  1CZB A;  3T1A A;  5J2Q A;  4OPA A;  3T19 A;  2HND A;  3E9P A;  5AQV A;  1JCE A;  4C8N A;  5M1K A;  3CCV N;  3MMV A;  4DG1 A;  2ATQ A;  3R8E A;  3OA9 A;  1N6Q A;  5BPN A;  4KI6 A;  3NH0 A;  1U04 A;  1Q86 O;  4H0X B;  2XRI A;  3OYC A;  5EX5 A;  2Z1J A;  3T7Z A;  4FVM A;  4A2B A;  4NCG A;  3P83 D;  4FJN A;  2D5R A;  1IKV A;  5LJW A;  4WYB A;  5LY3 A;  2YKN A;  4BRG A;  4IG0 A;  5AQS A;  2FLO A;  1B9F A;  1VK0 A;  5C10 A;  2RPI A;  3QFP A;  1BIZ A;  4EIA A;  4BRD A;  3BGR A;  2W42 A;  4LH5 A;  2P9K B;  1Q8I A;  3F9M A;  1U45 A;  3C7N A;  3KLH A;  4ID1 A;  1NGC A;  4A62 A;  4B3T K;  1S1T A;  4CJW A;  4OLA A;  4CEZ A;  4KTQ A;  3QIN A;  3CJC A;  4FJL A;  3AA4 A;  3RTV A;  3OYN A;  4DTS A;  1IBL K;  2ITG A;  5DM7 L;  1EO1 A;  3NH1 A;  1HLU A;  3NFA A;  4C23 A;  3IUC A;  1HYV A;  3C65 A;  3D2E B;  3ZX3 A;  3TR8 A;  3IMX A;  2PZS A;  3DRS A;  1TL3 A;  4Z4C A;  3OTO K;  1GLA G;  4E7J A;  1NMD A;  4DSL A;  3GL1 A;  2UU9 K;  5IT9 O;  2IVN A;  1BCM A;  3ULD A;  4JI3 K;  3NGI A;  1P8Z A;  4QS7 A;  2NNW A;  1LWC A;  2A42 A;  4GVE A;  3SMP A;  1C1C A;  3HOS A;  2F8T A;  4Z94 A;  3P38 A;  4JKC A;  5GIP A;  4KO0 A;  3HYF A;  3VEY A;  4F3O A;  4BWJ A;  3TSU A;  1YF5 L;  2NRT A;  2FBX A;  1QHA A;  4CJL A;  3QES A;  2FBY A;  1NJW A;  4JKE A;  3AVM A;  1YT3 A;  2A5X A;  4DTU A;  2W40 A;  4K41 A;  1T7P A;  4DU3 A;  4CJR A;  1EET A;  1SZ2 A;  3QFU A;  4FL9 A;  3O4N A;  3AA2 A;  4BRI A;  2V51 B;  2D0B A;  4C8K A;  4Z4H A;  4F3T A;  3JAM O;  1S5J A;  3CI5 A;  3UE5 A;  2QTD A;  2RF2 A;  4KHU A;  4HHT A;  4DQR A;  5FPM A;  2KKZ A;  3L2V A;  3CCJ N;  4E1N A;  4FJK A;  1I3A A;  1NK4 A;  3TAE A;  1WBD A;  3J80 O;  1HQE A;  2NLX A;  4OGE A;  3C0B A;  4M7Y A;  4O5F A;  1J5O A;  1HYZ A;  4IG3 A;  2WFB A;  3M8P A;  1VQM N;  3ZYY X;  3LPU A;  4W5N A;  4JS5 A;  1LOT B;  3ENO A;  4CJK A;  4BR2 A;  3TAB A;  4OKE A;  1ESV A;  1YIT N;  4EFH A;  2VWJ A;  2BAN A;  2W6L A;  3H3O B;  4CZH A;  5C25 A;  2NRZ A;  1JL1 A;  2ASO A;  1JLB A;  3IDH A;  4CF8 A;  1RT5 A;  4IO9 L;  1BOT O;  1ASW A;  1NJY A;  3WNF A;  3IG1 A;  3MX5 A;  3DLL L;  1RNH A;  1JCG A;  4N41 A;  3NCI A;  4DMN A;  3O9Q A;  1C0F A;  4I6M A;  4QS8 A;  1WN7 A;  1XNQ K;  3PX0 A;  3CIP A;  1ZBL A;  4WF9 L;  4NXN K;  4YOT A;  4FOI A;  3NF6 A;  5M1N A;  4W5O A;  3QBX A;  1KAX A;  2VQE K;  3SPZ A;  4X65 K;  1RIL A;  3BDP A;  1S22 A;  1OH8 A;  4NLC A;  2KZM A;  2YHW A;  3KD1 E;  5AQK A;  3HPH A;  3QEI A;  3ZX2 A;  3NGZ A;  4BVO A;  3WNG A;  4IFV A;  5JVH L;  5BRF A;  4WFA L;  4BC4 A;  3ITH A;  1YTU A;  4O0J A;  4PL7 A;  4FO0 A;  1TKT A;  1FJG K;  3U3Y A;  3BZK A;  2DY4 A;  1EQY A;  2OPQ A;  3KIO A;  1GLC G;  4XIU A;  3L2U A;  3I33 A;  1VSK A;  4JKA A;  4GKK K;  1HNV A;  3ASM A;  4CGJ A;  5J1E A;  2HOE A;  5MLC Q;  1JL2 A;  3A0I X;  4K0K K;  3LDS A;  4FWR A;  3K9J A;  2KTQ A;  2XO7 A;  2IVP A;  5HBM A;  3HST B;  4CZE A;  3THY B;  2O4I A;  1QQM A;  2XY8 A;  3OYJ A;  4OLB A;  4WFB L;  3AA5 X;  5ADX A;  1S1V A;  4BDZ A;  4LFA K;  3CQX A;  4ILG B;  1CXU A;  4Y0W A;  3TTF A;  4BG8 A;  1IJJ A;  4TSX A;  3EKU A;  1XWL A;  3M8R A;  1TK5 A;  5AZJ B;  3H1Q A;  3WXI A;  4NXM K;  3PIP L;  4NLB A;  3TPQ A;  3DXK B;  4OO1 J;  3QBW A;  3V9W A;  1DTT A;  3KLE A;  2UYT A;  4DR3 K;  1L3T A;  1VQK N;  2IVO A;  3EYZ A;  4M41 A;  3NH2 A;  3DLK A;  4AHV A;  4CHQ A;  4DV2 K;  1K73 O;  1REV A;  3P5J A;  3VF4 A;  1VQ4 N;  3AY9 A;  5CZ2 A;  1GOA A;  3QEV A;  3H45 C;  3VQ7 A;  1BWF O;  2RHK A;  2QWL A;  1Q7Y O;  5HRR A;  2IOC A;  4GMJ B;  2PFU A;  3OYE A;  1KTQ A;  1BO5 O;  1NLV A;  1N5Y A;  4FWM A;  3QNN A;  3AO1 A;  2HVI A;  1WSG A;  4FCY A;  4BVP A;  1RT6 A;  5DMR A;  3TI0 A;  2P5O A;  3ID6 A;  4H5V A;  5HOO A;  4YHH K;  4A61 A;  3I55 N;  3E01 A;  4OPK A;  3DXM A;  2DPN A;  3PSI A;  2HHV A;  3LP2 A;  4CJ7 A;  4JKG A;  3LP1 A;  4IEE A;  2GV9 A;  3HVT A;  2IGI A;  3CM6 A;  4I9L A;  3UB5 A;  3WQU A;  3J7Z O;  4JI5 K;  3I56 N;  3DLG A;  4CE9 A;  3TWH A;  3C6A A;  3ISN C;  4C1N K;  4F8R A;  4BRN A;  5JS2 A;  4LSL A;  4DF4 A;  3TAN A;  1RCH A;  3CCL N;  1X9W A;  5KPT A;  5TKW A;  4YOY A;  3RRG A;  3AVN A;  3NMU A;  3T1H K;  4IBN A;  1VSD A;  3AVK A;  1LW2 A;  5LMN K;  2OCE A;  1GOB A;  1KCF A;  1L5U A;  3VF2 A;  3RR7 A;  5E84 A;  4PKH A;  4B08 A;  5KTQ A;  4W5T A;  5AZI A;  5C12 A;  1A5W A;  5M1P A;  1FKO A;  1SL0 A;  4B3O A;  2NRH A;  2P9U A;  3TAF A;  1OVY A;  4H0O A;  4IEI A;  3KD5 E;  4OPJ A;  5C42 A;  4H5R A;  5KQ8 A;  4DCH A;  4NB4 A;  2W41 A;  2KQ2 A;  2XY6 A;  3QET A;  3VPZ A;  5KI6 A;  5CHI A;  3B8A X;  3KWG A;  4FM1 A;  1VSL A;  3NGY A;  3DLH A;  1K8K A;  4IZ9 A;  5K14 A;  3U6F A;  3THW B;  3DAW A;  1QE1 A;  3R1X A;  1TYQ A;  1BQM A;  1OVQ A;  2I7P A;  3M8Q A;  3O8M A;  1D5A A;  4DR6 K;  3ENB A;  1QQO A;  2KW4 A;  4IJN A;  3M6G A;  4HUG A;  1NGI A;  2YHX A;  2HHT A;  2HHU A;  1LWF A;  3VQB A;  1YHQ N;  3MXJ A;  4JAX A;  4LC9 B;  1BL3 A;  2KHO A;  5CYM A;  1UAX A;  3RSE B;  3G4S N;  3CJ9 A;  3FZM A;  1BA0 A;  3SYZ A;  1NGD A;  4JI6 K;  3C95 A;  3LWL A;  1S6Q A;  1WSI A;  2YX6 A;  2P9I B;  1OH6 A;  4IWV A;  2ZJR L;  1QQC A;  4W5R A;  5I42 A;  1RTD A;  5E26 A;  3AVH A;  1NK8 A;  2QW9 A;  2IIR A;  1GLE G;  4XEI A;  1ZBU A;  4BRL A;  4PA1 A;  5AFU A;  1NU0 A;  1VRT A;  1E4F T;  1TGO A;  3WXJ A;  3UKU A;  3SQ4 A;  3VQ9 A;  1TYQ B;  4YFU A;  1JXB A;  2X78 A;  2X6N A;  3GG4 A;  5FRM A;  3HRG A;  5LL6 Z;  3P4I A;  3ULE A;  2QWQ A;  4LY7 A;  4FJ7 A;  2YV0 X;  5C24 A;  2R7Y A;  2F96 A;  2UXD K;  1ZC6 A;  4K8Z A;  3LPT A;  3R6M A;  2VQF K;  4BRE A;  4DTM A;  3H6E A;  2HMI A;  2HHS A;  3A5L C;  4KHS A;  2P9P A;  4FK4 A;  3GDQ A;  4DR1 K;  3OBW A;  4CK2 A;  2QA4 N;  1RDA A;  4AHU A;  3SQ1 A;  2D0A A;  2WON A;  4CJP A;  1RT4 A;  4CHZ A;  1ZBF A;  2OPP A;  3S3M A;  1X9S A;  1IBK K;  4DV7 K;  4DFK A;  3HP6 A;  4B1X B;  4ISG A;  1XC3 A;  4FW1 A;  2HHW A;  2HHX A;  4M3W A;  1K8A O;  4HUE A;  1EX4 A;  5AQM A;  3TAG A;  3KK1 A;  2YCH A;  4IDH A;  4M3X A;  2EHG A;  3CFO A;  1SL2 A;  1NM1 A;  2YJF A;  1HYS A;  2JWK A;  2V7Y A;  2ZD1 A;  2ZQB A;  4E7I A;  1Q81 O;  3NBP A;  1TAQ A;  3ZEU A;  3DYA A;  4Y1D A;  5HP1 A;  2P9S B;  1BHL A;  2P9L B;  3LAL A;  1TKD A;  5FPD A;  3VQQ A;  4JI8 K;  4NYN A;  1Z25 A;  3H46 O;  2PBD A;  4CZF A;  3FFI A;  1J9A A;  1JLC A;  1BGX T;  1MA9 B;  4JD2 A;  2HW3 A;  3OYG A;  4FXD A;  3D45 A;  2KFN A;  4K43 A;  3JSM A;  4CED A;  4BC2 A;  1QTM A;  4F4K A;  5FDL A;  3OHR A;  1BIU A;  3U9D A;  1RTJ A;  1ATS A;  5HRN A;  3TAQ A;  3KK3 A;  2O8D B;  1O1W A;  4CBW A;  2A3Z A;  2E4L A;  4JYA K;  2E2Q A;  4YOX A;  3M8S A;  5AQY A;  1QS4 A;  2D0C A;  3ZSO A;  1NK7 A;  3NF8 A;  3L2Q A;  2QWO A;  5GAH P;  4X62 K;  1BDG A;  3D2F B;  3EZ5 A;  3VQP A;  3MX2 A;  3MCP A;  3TAR A;  2GUP A;  1S1X A;  4PKI A;  1NK0 A;  1IG9 A;  3C94 A;  4J8F A;  4DFP A;  4JD2 B;  4QOZ B;  4CF0 A;  2NRX A;  1HJR A;  2P9N B;  2HB5 A;  2P9K A;  2BGG A;  2Z1I A;  4CZJ A;  1YAG A;  3SPY A;  4FSV A;  1RDB A;  3VGL A;  3ZSR A;  4DR7 K;  1SUQ A;  1U2V A;  1WSH A;  4PQU A;  1UWB A;  2VYP A;  2B5J A;  3QNO A;  2OTL N;  5C15 A;  4BR9 A;  5BR8 K;  3Q7C A;  3SZ2 A;  3NAE A;  4GV9 A;  5AQU A;  4LH4 A;  4FLX A;  5JLH A;  1U6Z A;  3D2E A;  4Q0B A;  1L3V A;  2W6K A;  3IKM A;  4FJG A;  4CER A;  4W5Q A;  2Z1G A;  1TUU A;  1DT9 A;  4RCH A;  4DU4 A;  1K9M O;  1BQN A;  1X3M A;  1JLF A;  1O13 A;  2FC0 A;  2NRR A;  4BR5 A;  1QSY A;  4OPH A;  3RMD A;  3CF5 L;  1U2V B;  4U7B A;  3TSP A;  3IS9 A;  4FWO A;  3AVL A;  3KLG A;  3CCS N;  3CFP A;  3MN5 A;  2IAJ A;  3OW2 M;  1EP4 A;  2ASP A;  1S9E A;  2O8C B;  3VQD A;  3WNE A;  1VRU A;  4ICL A;  4DSK A;  3G0Z A;  3EY1 A;  5M1Q A;  4C8L A;  4B9U A;  5M1F A;  3A5M C;  5CY4 A;  2CGJ A;  2FSJ A;  1KLM A;  3OJU A;  1Q18 A;  2A6A A;  2HNZ A;  3WT0 A;  1NKB A;  3CJA A;  3MDQ A;  4KHQ A;  3HO1 A;  4E7K A;  3ZT0 A;  1NGF A;  3NVM A;  4KPY A;  1HNX K;  1N34 K;  4DSJ A;  4IOX A;  4XH5 A;  3OVN A;  1HX1 A;  2JGU A;  2GUI A;  2YHY A;  1YTA A;  3VEO A;  3LAN A;  1Z05 A;  1X1P A;  3K2P A;  5GAE P;  2HBJ A;  4MFB A;  4Z4F A;  1V4T A;  4FPA A;  4DF8 A;  4KHW A;  2Q0R A;  3BEX A;  1RDW X;  3O08 A;  4BC3 A;  4B1U B;  3TTC A;  3U3G A;  3AV9 A;  1D4X A;  2D0P A;  1VSF A;  1KAY A;  3AVI A;  3MN9 A;  4CJ5 A;  3P39 A;  4CGI A;  1HMV A;  1J6Z A;  3MK6 A;  3OY9 A;  5CE3 A;  4PY5 A;  4DR4 K;  3PO5 A;  2PYL A;  3ZX0 A;  4O5B A;  2YHB A;  2QM1 A;  4LSN A;  2OZS A;  4FJI A;  5AQG A;  3U4L A;  4CVN E;  3DLB A;  3SJH A;  1HJO A;  4RW7 A;  3U9Z A;  1RBR A;  3QIO A;  4F2S A;  1VSJ A;  1W2B M;  5AQX A;  5HRO A;  4FYD A;  4CHO A;  3AVJ A;  4B9V A;  2OYQ A;  2KZZ A;  1VQ9 N;  1KLN A;  2CGK A;  1VHX A;  1YUW A;  3PSF A;  2DFH A;  4C8M A;  4H03 B;  4MDA A;  4MO5 A;  1S1U A;  2G8K A;  4BDP A;  1XHX A;  4H5T A;  5FPE A;  2WTU A;  1KFS A;  1C0U A;  4FLU A;  4FK0 A;  1WUA A;  3CG7 A;  5KRT A;  3VGM A;  3UKR B;  1TKX A;  2KLA A;  1JLA A;  2FF3 B;  2Y1J A;  1WAJ A;  4CFC A;  4HCB A;  4Q5V A;  2E88 A;  4JK7 A;  5ADX H;  1KRP A;  4JV5 K;  3C6T A;  3ZT2 A;  2KFZ A;  1ASV A;  2WUS A;  4DWI A;  4G9Z A;  4DFM A;  4CFB A;  2G8V A;  1BUP A;  1C1A A;  4KHP K;  3MXM A;  2DTU A;  3PX6 A;  3VES A;  5HRS A;  1VQ8 N;  4H5W A;  1YJW N;  3V9S A;  4BRM A;  4UY8 O;  3HT3 A;  3SI6 A;  1NGE A;  5JIC A;  2F8S A;  1SQK A;  3O4W A;  4IKF A;  1FW6 A;  1TVR A;  4B9Q A;  4CEO A;  3WQT A;  5AQH A;  3THY A;  3LDL A;  1RBT A;  4QAG A;  4CF2 A;  3O5B A;  3FE1 A;  3V9U A;  5BPL A;  5AQN A;  3QDK A;  3FFK B;  1W0H A;  3ZSX A;  4CI6 A;  5CR4 A;  4FLT A;  4DQP A;  4JS4 A;  3OS0 A;  3OYL A;  3QER A;  5AZJ A;  2X6S A;  4DV0 K;  1IO2 A;  5J2M A;  3ZSW A;  3QIP A;  3DXK A;  3VF6 A;  4M3Y A;  4HUF A;  3DOL A;  1RT7 A;  2RN2 A;  1JLG A;  4BE0 A;  5DK5 A;  4RW6 A;  4JHD B;  3LM9 A;  1ZBS A;  5CZ1 A;  2B6A A;  4CZM A;  4GNI A;  4DV6 K;  3V1O A;  3E9O A;  2CH5 A;  5AQO A;  4IFY A;  1RT3 A;  3D6R A;  3GE1 A;  1XUP O;  3EE9 A;  3VQ6 A;  2HVH A;  3L4I A;  2YNF A;  1JLQ A;  1U49 A;  2PYJ A;  3VEN A;  3AGR A;  3O1W A;  3MN7 A;  2VG5 A;  1QQN A;  3MCA B;  3ZCM A;  4WFN L;  3BZC A;  4YOV A;  2Q36 A;  1CLQ A;  3DWL A;  3QB0 A;  4CJE A;  3OYH A;  1TV6 A;  1HNZ K;  3LDN A;  2VCP A;  5C2D A;  3V1Q A;  3OBY A;  4JI7 K;  3THX B;  3SUP A;  4ZTF A;  4M3U A;  4FJ8 A;  4JEP A;  4CZI A;  4E1J A;  1NK9 A;  1Q9X A;  2FSN A;  4DTX A;  3LM2 A;  1VAZ A;  3L8B A;  4CZL A;  4AHS A;  2Q31 A;  4FJJ A;  5EVZ A;  4L8R B;  2WC9 A;  3C6H A;  4I7F A;  4A5A A;  1DLO A;  4OKJ A;  1N8R O;  1BIS A;  3I0R A;  4B9T A;  4YOR A;  5ELZ A;  3O4Q A;  2FSK A;  2OTJ N;  4CBU A;  1Y97 A;  4B1Y B;  4EZ6 A;  5GIO A;  4A57 A;  5GIN A;  3V6D A;  3ALY A;  3L2W A;  3AA3 A;  2Q0U A;  3VTI A;  2UUB K;  1I94 K;  3M5R A;  2JWL A;  3G71 N;  4DLG A;  2WOM A;  1WOQ A;  4CD1 A;  3L3U A;  3KTQ A;  1RT2 A;  4AQY K;  3IAY A;  4KV8 A;  1ATR A;  1NBW A;  1TK0 A;  3QLH A;  2QWR A;  1LV5 A;  3O9T A;  4JK8 A;  2P1J A;  4F9O A;  1ZBH A;  1HUX A;  3CHW A;  4C1N I;  5AFU H;  1FK9 A;  4CES A;  3QIC A;  1QZ5 A;  2GEL A;  3VQ5 A;  3THW A;  2BDP A;  1Q9Y A;  4CEQ A;  1NGG A;  1JLE A;  2ZWH A;  3E66 A;  4DV1 K;  1HNW K;  2D4W A;  3SCX A;  1RBV A;  4B3M K;  1I39 A;  5FLX O;  3K9K A;  2A1S A;  4M3R A;  5SWM A;  4DLE A;  3SAF A;  1ILY A;  4ILH A;  4GVM A;  5FPN A;  3RSE A;  1VQO N;  5HRP A;  5F2R A;  1KQS M;  3V4I A;  3GBT A;  4HCC A;  2BUP A;  3HM9 A;  3B6O A;  2P9I A;  4CGG A;  1Z26 A;  4CJ3 A;  1FXX A;  4CJV A;  3O9U A;  3SUN A;  3FLC O;  1WSE A;  3H1V X;  1IKW A;  3HJF A;  4N56 A;  2AJQ A;  4JI1 K;  3AVF A;  2QI2 A;  4MLH A;  4IXC A;  5A2Q O;  3RR8 A;  3DM2 A;  2G8I A;  4BRP A;  4KH5 A;  3V9Z A;  1F21 A;  2Q1N A;  3LDP A;  4DU1 A;  3CCE N;  4WQ5 A;  3AO5 A;  1EWR A;  3LL3 A;  3KLF A;  1WNS A;  2ZGY A;  3THV A;  1E4G T;  1R0A A;  4BRF A;  5EU7 A;  4WQ4 A;  4KBO A;  3KVG A;  4B8A B;  3F2K A;  1KXP A;  4F2R A;  1RTH A;  1S3X A;  2E2P A;  1QSL A;  2CGL A;  4B9M A;  4M45 A;  1M1K O;  3OYI A;  1W7A A;  3V9X A;  5TKY A;  3K57 A;  2EWS A;  3QO9 A;  3ZET B;  3ZLJ A;  5LMU K;  2UUA K;  3A8Y A;  3T69 A;  1XHZ A;  5I9E B;  2E2O A;  4A5B A;  3CXC M;  1VSE A;  2WBN A;  1SKS A;  1NJI O;  5IWA K;  4FWL A;  4KH4 A;  1DTQ A;  3EL2 A;  2F9T A;  5KRS A;  3PLA A;  2E2N A;  2OA8 A;  2D1K A;  2DFF A;  3LWM A;  3ZT1 A;  4CK3 A;  1W97 L;  4EHT A;  3A5O C;  4V19 S;  3T1Y K;  5AQZ A;  2P9S A;  2RE2 A;  1CZA N;  2QWN A;  2P9L A;  1GLJ O;  1T6C A;  3L6Q A;  1L3S A;  1ATN A;  4CJF A;  4B1V A;  4DTJ A;  4NCA A;  1TAU A;  3SNN A;  4IJA A;  3LDQ A;  3M1F A;  2ZJP L;  3HL8 A;  4WE1 A;  2HBK A;  1YVU A;  3AO3 A;  3TAP A;  2O8B B;  3QEX A;  1NKC A;  1MU2 A;  2YHA A;  5GAD P;  2YKM A;  1XQS C;  3PO4 A;  2NRV A;  1QSS A;  5BRD A;  3WXK A;  2O8D A;  1GLL O;  4FJH A;  1NJX A;  3VER A;  1RBS A;  1BA1 A;  1HRH A;  2QXF A;  3KKS A;  5AQI A;  4FZY A;  4JI4 K;  1YIJ N;  1VQ6 N;  5AQR A;  3VTH A;  5EXW A;  3ATU A;  1LCU A;  1FKP A;  1VSI A;  3DRR A;  3D2F A;  3CCM N;  1NK5 A;  1VSH A;  1Q82 O;  1NNE A;  4GV6 A;  2O8E B;  4CZK A;  3L0Q A;  4DV4 K;  4FZZ A;  4DUY K;  1J54 A;  5AQP A;  5F1X A;  2A41 A;  1ASU A;  2P9N A;  4LFB K;  4B8C A;  1WBB A;  3WEE B;  3JS6 A;  4KH6 A;  1HR0 K;  2CH6 A;  3MWT A;  4OJR A;  3CME N;  1B92 A;  3R3L A;  1NG9 A;  4FLV A;  4OKK A;  4ZTJ A;  2VGM A;  5KGX A;  2GX9 A;  4C8O A;  2OAN A;  4JKF A;  4LD0 A;  3RRH A;  3PV8 A;  4R5P A;  3HVR A;  2ASM A;  1KAZ A;  3SQ2 A;  4Z0U A;  1HNI A;  4FK2 A;  3O3F A;  4BQL A;  3S9H A;  4J2B A;  4DS5 A;  3J7Y P;  3QEP A;  2QK9 A;  1E3M A;  3O1B A;  2O8F B;  3PX4 A;  4FOE A;  2XY7 A;  3PY8 A;  1QVF M;  2FXU A;  2VG7 A;  2AP1 A;  3U8X A;  3W3D A;  3RMB A;  1P90 A;  3ATV A;  3KK7 A;  1N33 K;  2VWB A;  4JNE A;  3O80 A;  4FWK A;  1BG3 A;  4LF6 K;  4EAH D;  4FPB A;  5LJV A;  3CQY A;  2JLE A;  2G8F A;  1ZXO A;  4JKD A;  3KWI A;  4B9S A;  3NHG A;  5BPM A;  3H3N O;  2G8H A;  3TU5 A;  2O8C A;  3CPW M;  4CJQ A;  3LAK A;  4DKW A;  3SK3 A;  1NMN A;  4HTL A;  1CXQ A;  1T03 A;  4GV3 A;  1TK8 A;  4BR4 A;  3AAR A;  3VQ8 A;  1UOC A;  4CIF A;  4A2A A;  2XY5 A;  2VG6 A;  1X3N A;  2EX3 A;  4HVJ A;  1IKX A;  4DSE A;  4CGH A;  1TL1 A;  4CF9 A;  2Q3S A;  2QKK A;  3MEC A;  4CEA A;  3O3H A;  2E1Y A;  4EZ9 A;  4E0D A;  1WB9 A;  5C2F A;  1IG8 A;  3IFR A;  3AO4 A;  5KQD A;  4LF8 K;  4ELU A;  1A5X A;  1C6V A;  1BI4 B;  3VGK A;  3KK2 A;  4OX9 K;  1QVG M;  4CK1 A;  3AO2 A;  3FZH A;  4BRC A;  4H8K A;  3ZSY A;  2A40 A;  3FR0 A;  4E19 A;  2HNY A;  5J2N A;  2ZE2 A;  2G8W A;  1U4B A;  1NGJ A;  1VQP N;  2HBL A;  2NZT A;  3CMA N;  3BF1 A;  4AH9 A;  4X66 K;  4KB1 A;  4N76 A;  4FLZ A;  4H4M A;  3K5L A;  2HF3 A;  1RDU A;  3CQ8 A;  3HPO A;  1NGA A;  1SKW A;  3SUQ A;  3HM8 A;  2HBM A;  2E6L A;  1WSF A;  3DJC A;  4FWN A;  3SAH A;  1RBU A;  3K59 A;  4B3S K;  2ZJQ L;  3HI0 A;  1VSM A;  1VQL N;  1N36 K;  2Q97 A;  2PAV A;  4RTF D;  1W9H A;  3NVK A;  4B9L A;  3OS1 A;  4AIL C;  4H0V B;  1NWK A;  4CHN A;  3I8B A;  1D8Y A;  4L3Q A;  2QXL A;  3OYF A;  4NYF A;  3SAG A;  3CPE A;  4DTN A;  2RKI A;  2HHQ A;  1SV5 A;  3MED A;  3OYB A;  4PL8 A;  3C7N B;  4E7H A;  2AA4 A;  3O3G A;  4M63 C;  3EO3 A;  5AQF A;  3LDO A;  4U67 L;  4UQG A;  4Z4E A;  4PKG A;  3VQA A;  2OZM A;  3E1Y A;  3AVC A;  3HZ6 A;  4DV3 K;  3CET A;  4LF7 K;  3L3V A;  1J53 A;  3HBT A;  1MWM A;  3OYM A;  2NRW A;  2YI1 A;  1T05 A;  4FJM A;  2FBV A;  4YDU C;  3S3O A;  3EN9 A;  4I2Q A;  5AQW A;  3VEW A;  3UKR A;  3VA0 A;  3M3Z A;  2GWK A;  4ID5 A;  1H1V A;  3KLI A;  3KZB A;  4BRO A;  4YY3 K;  1JXE A;  1B9D A;  5H1S Q;  3BF3 A;  3MAQ A;  5SZT A;  4FWQ A;  4CIE A;  4DS4 A;  1IKY A;  1G15 A;  2I5J A;  1G99 A;  1N32 K;  3BP8 A;  3HSC A;  3WNH A;  1GLB G;  4K8X A;  3K58 A;  4DQS A;  4AM6 A;  1XMO K;  3P31 A;  2DFE A;  1S6P A;  3RVC A;  2I7N A;  4CCH A;  2HST A;  1L3U A;  4ELV A;  5C0Y A;  4DQI A;  2OPS A;  3LAM A;  4EP4 A;  2UUC K;  1EXQ A;  4CHY A;  4DUZ K;  5HL7 L;  4LF5 K;  3FZK A;  3J7A P;  2GTD A;  3OJS A;  4IO8 A;  5DM6 L;  4KRF A;  3WXL A;  3LZJ A;  4RW4 A;  2YNI A;  1JCF A;  4HWI A;  4CGF A;  1NOY A;  2QKB A;  2UXC K;  4RW9 A;  4O4G A;  1LWE A;  4H4O A;  3CJ7 A;  4DR2 K;  4H0Y B;  4JLH A;  3DLR A;  4BRA A;  4HTU A;  4QCL A;  1SAZ A;  1OKJ A;  4E89 A;  3TAM A;  4B1W B;  2E8A A;  4JI2 K;  3IRX A;  5J2P A;  4JHD A;  2O4G A;  1A5V A;  3VQE A;  3HK2 A;  1DEJ A;  1T44 A;  4O0I A;  3BY5 A;  4CFD A;  3OYK A;  3WUH A;  1WSJ A;  5M1O A;  2ZGZ A;  1KSP A;  4EHU A;  3VOV A;  2HF4 A;  1NK6 A;  3VMF B;  3VET A;  5BN9 A;  4BQZ A;  1DKG D;  4DB3 A;  2P5G A;  4G1Q A;  4LFC K;  3BUZ B;  3HXM A;  4CD3 A;  3VEZ A;  4BR7 A;  5KPR A;  2Z1H A;  3SJJ A;  1KC8 O;  1VQ7 N;  3J8A A;  4WQ5 C;  4H0P A;  4B3R K;  4FJ9 A;  4BRK A;  5FRN A;  1HKG A;  3CJB A;  3CJ1 A;  1DGK N;  1UA1 A;  1NKE A;  4AM7 A;  3TTD A;  4JK9 A;  4WQ4 C;  4YOW A;  4IFE A;  4FLY A;  3THX A;  1YI2 N;  3VA3 A;  4BR0 A;  4Z4I A;  4E3S A;  3O9R A;  4FVU A;  3E9L A;  1MDU B;  3HPG A;  1VQN N;  3W0L A;  4CEC A;  2F7T A;  4I6M B;  3G10 A;  3K5O A;  3OYD A;  1LW0 A;  2E20 A;  3TSQ A;  5BN8 A;  2GWJ A;  3NDK A;  3ID8 A;  3NE6 A;  3SUO A;  4FZX C;  4M3T A;  4OVL A;  4KFB A;  3ZT3 A;  1IBM K;  4DSF A;  3LP0 A;  4BGA A;  3O9S A;  4CEE A;  3ZSQ A;  4R79 A;  4DV5 K;  2VGN A;  4JRP A;  3OS2 A;  1V4S A;  2IS3 A;  1XNR K;  3NF7 A;  2V7Z A;  3I8D A;  4DTO A;  1WAF A;  5D3G A;  4CJ4 A;  2A1R A;  4KKO A;  4NCB A;  1EWQ A;  3Q7B A;  4Z4G A;  4BY9 C;  5EOY A;  1HPZ A;  4YDU A;  2UXB K;  1U47 A;  1RT1 A;  2FBT A;  3AGK A;  3EE8 A;  4NO7 A;  3MEG A;  4DHY A;  4K42 A;  5HLF A;  4QS9 A;  3CCQ N;  4DQ8 A;  1YXQ A;  4O44 A;  4H5N A;  4CEF A;  4CW7 B;  1RDC A;  4IOC L;  2VWK A;  5I3U A;  3FZF A;  5JVG L;  2HMP A;  4O8K A;  4XH1 A;  4O8U A;  1WLJ A;  4Y1C A;  2ITM A;  3KHY A;  4ZHR A;  4J2D A;  2J4R A;  1ITG A;  5E41 A;  1RFQ A;  1JKH A;  4BWM A;  3SV3 A;  1XI1 A;  4KHY A;  4KAZ A;  3CCR N;  1XC9 A;  1SL1 A;  2B4J A;  3VN5 A;  4LF4 K;  3MXI A;  3CC7 N;  1X9M A;  4FLW A;  1J5E K;  2HHH K;  1HKC A;  3SBG A;  5F0X A;  1X9J A;  4FWP A;  4BG9 A;  2QWM A;  2GEM A;  2E6M A;  2QWP A;  3MWP A;  4JKH A;  3NF9 A;  2LSN A;  4FM0 A;  2Q2R A;  4RW8 A;  1T3V A;  3N4P A;  3DMJ A;  5KGW A;  4BRQ A;  3SLC A;  3VEX A;  4AHC A;  3RMC A;  1KD1 O;  1Y64 A;  3V1R A;  4RG8 A;  5EY4 A;  3CER A;  3AAP A;  3N4Q A;  4M7X A;  4A59 A;  3S3N A;  1S72 N;  3DOK A;  4I9Q A;  1KVC A;  4DR5 K;  5GAG P;  1MWK A;  1C0T A;  3L4Q A;  3KJV A;  4ISF A;  1XMQ K;  2V52 B;  1C0G A;  3G6E N;  3FZL A;  4PUO A;  3K0S A;  4MDB A;  1QZ6 A;  4E1M A;  3ZET A;  4CJU A;  3DXM B;  1BU6 O;  5AQQ A;  3R9P A;  5AR0 A;  4YNQ A;  4JKG B;  4J2E A;  1GOC A;  5CYQ A;  4FWS A;  1ZBI A;  1OH5 A;  3F73 A;  1KFD A;  1YVN A;  3JXU A;  1R59 O;  4DTP A;  5JS1 A;  3ZSZ A;  3WXM B;  4CIG A;  1RDD A;  3AVB A;  3LZI A;  3CCU N;  4E7L A;  4DQQ A;  2E1Z A;  4CJS A;  3VQ4 A;  3O6W A;  1T6D A;  2YNH A;  2QEX N;  2BE2 A;  3HOT A;  3K5N A;  1NOZ A;  1U48 A;  1HQU A;  1VQ5 N;  2Y1I A;  1D9D A;  1ZYQ A;  3EKS A;  4CHP A;  5AZI B;  1S1W A;  5T7B A;  4K25 A;  4AF1 A;  3K5M A;  4CGD A;  2P9U B;  2O8B A;  3D0P A;  4ISE A;  3UIQ A;  3RMA A;  4LF9 K;  1RGI A;  1TKZ A;  1NJZ A;  4KTZ A;  5AQT A;  1HPM A;  4J2A A;  4I2P A;  2ZF5 O;  1K8K B;  4MO4 A;  5JLF A;  4IOA L;  4JI0 K;  3JYT A;  3EZW A;  5AQL A;  3CC4 N;  2OPR A;  4JRQ A; 
#chains in the Genus database with same CATH homology
 2IOC A;  1IH7 A;  3VQ8 A;  4GMJ B;  1UOC A;  4CIF A;  2XY5 A;  2VG6 A;  3DLE A;  1TKX A;  1JLA A;  2EX3 A;  4HVJ A;  3OYE A;  4DTR A;  1IKX A;  1KTQ A;  4DSE A;  4CGH A;  1TL1 A;  1WAJ A;  4CFC A;  2Y1J A;  2G8U A;  4HCB A;  4CF9 A;  1N5Y A;  2Q3S A;  2QKK A;  3SV4 A;  3QNN A;  1KVA A;  4Q5V A;  3AO1 A;  3MEC A;  4CEA A;  2HVI A;  1KRP A;  3O3H A;  1WSG A;  3C6T A;  3ZT2 A;  4FCY A;  3CYM A;  4EZ9 A;  1RT6 A;  2KFZ A;  5DMR A;  1ASV A;  1S9G A;  3TI0 A;  1KVB A;  2P5O A;  4DWI A;  4E0D A;  3H08 A;  2P51 A;  4DFM A;  4CFB A;  3AO4 A;  2G8V A;  4ELU A;  1A5X A;  1C6V A;  1BI4 B;  1LAV A;  1K6Y A;  4AHR A;  3KK2 A;  4CK1 A;  3AO2 A;  1C1A A;  4H8K A;  4BDY A;  3E01 A;  3MXM A;  3ZSY A;  2DTU A;  4M42 A;  4OPK A;  5HRS A;  3PX6 A;  4FJX A;  3I0S A;  4BAC A;  4PWD A;  4KRE A;  4E19 A;  2HNY A;  1SKR A;  5J2N A;  2ZE2 A;  3LP2 A;  2G8W A;  4KI4 A;  3V9S A;  1U4B A;  3LP1 A;  3F9K A;  4MQ3 A;  3HT3 A;  3SI6 A;  2GV9 A;  3HVT A;  2IGI A;  4KB1 A;  4AH9 A;  3DI6 A;  4FLZ A;  4H4M A;  3K5L A;  3CM6 A;  4N76 A;  4I9L A;  4IKF A;  2F8S A;  3C6U A;  1TVR A;  4CEO A;  1BCO A;  2GBZ A;  3CQ8 A;  3HPO A;  1C0M A;  1SKW A;  4B9N A;  3DLG A;  4CE9 A;  3TWH A;  3SUQ A;  4KHN A;  1RBT A;  4QAG A;  3ISN C;  4CF2 A;  2HHV A;  3V9U A;  2E6L A;  4F8R A;  1WSF A;  5JS2 A;  4LSL A;  4DF4 A;  3TAN A;  1RBU A;  3K59 A;  1RCH A;  1X9W A;  3RRG A;  3AVN A;  1VSM A;  3A2F A;  4IBN A;  1VSD A;  1W0H A;  3ZSX A;  3AVK A;  1LW2 A;  1W9H A;  4FLT A;  3QEW A;  1CZ9 A;  4DQP A;  4JS4 A;  3OS0 A;  3OYL A;  1GOB A;  1KCF A;  1L5U A;  4B9L A;  3OS1 A;  4AIL C;  3QER A;  2IC3 A;  2X6S A;  3RR7 A;  4CHN A;  1D8Y A;  4B08 A;  1IO2 A;  3CM5 A;  3ZSW A;  5KTQ A;  4W5T A;  3QIP A;  4BE2 A;  5J2M A;  3ZSV A;  3OYF A;  4NYF A;  4DTN A;  1A5W A;  4M3Y A;  2RKI A;  1FKO A;  1RT7 A;  2RN2 A;  1SV5 A;  2YNG A;  3DOL A;  3MED A;  2ETJ A;  4IDK A;  3OYB A;  1JLG A;  3PUF A;  1T8E A;  4BE0 A;  1SL0 A;  3DRP A;  5DK5 A;  3O3G A;  4E7H A;  3T3F A;  4CFA A;  3TAF A;  4O55 A;  3SQ0 A;  4RW6 A;  3KD5 E;  4EP5 A;  5C42 A;  4OPJ A;  5CZ1 A;  4UQG A;  4N5S A;  2B6A A;  1RTI A;  4FM2 A;  4Z4E A;  4KB0 A;  2KQ2 A;  5FRO A;  2XY6 A;  4CF1 A;  3QET A;  5KI6 A;  3VQA A;  2OZM A;  3OYA A;  4FM1 A;  3AVG A;  3AVC A;  1VSL A;  3V1O A;  1D9F A;  3NGY A;  3DLH A;  3U6F A;  4FW2 A;  5K14 A;  3RWU A;  1QE1 A;  4IFY A;  1RT3 A;  2X74 A;  3L3V A;  1J53 A;  1BQM A;  3M8Q A;  4GW6 A;  4BE1 A;  1D5A A;  4KTW A;  1QHT A;  3OYM A;  1T05 A;  4FJM A;  3P1G A;  2FBV A;  2KW4 A;  2NUB A;  4DSI A;  3VQ6 A;  4ELT A;  4HUG A;  3S3O A;  4CEB A;  2HVH A;  4I2Q A;  2HHT A;  2HHU A;  1LWF A;  2YNF A;  1JLQ A;  3VQB A;  3VA0 A;  1U49 A;  2IDO A;  2PYJ A;  3MXJ A;  2VG5 A;  3V81 A;  4M3Z A;  3ZCM A;  1BL3 A;  1C1B A;  4ID5 A;  5CYM A;  2PY5 A;  1UAX A;  4DFJ A;  1CLQ A;  1UA0 A;  4CJT A;  3KLI A;  3SYZ A;  3HP9 A;  4CJE A;  2HHQ A;  4FJ5 A;  1JXE A;  1B9D A;  1TV6 A;  3C95 A;  3OYH A;  3B6P A;  3ZT4 A;  3V1Q A;  3LWL A;  1S6Q A;  3MAQ A;  4N47 A;  5SZT A;  3L2R A;  1WSI A;  4AHT A;  2XHB A;  3MEE A;  1LAW A;  3VQC A;  1BI4 A;  3LP3 A;  4CIE A;  1QQC A;  4W5R A;  1IKY A;  4OGC A;  3CFR A;  3AVA A;  4DS4 A;  3SUP A;  5I42 A;  1RTD A;  1G15 A;  2I5J A;  4ZTF A;  3AVH A;  1EKE A;  3WNH A;  1NK8 A;  4FJ8 A;  4M3U A;  4K8X A;  3KKR A;  1ZBU A;  3K58 A;  4DQS A;  1NK9 A;  1Q9X A;  1CZB A;  3T1A A;  4DTX A;  4PA1 A;  5J2Q A;  1VRT A;  2HND A;  3T19 A;  1TGO A;  3L8B A;  2DFE A;  3SQ4 A;  4C8N A;  1S6P A;  3VQ9 A;  4CCH A;  4AHS A;  1L3U A;  4ELV A;  4YFU A;  1JXB A;  4FJJ A;  4DQI A;  4DG1 A;  4L8R B;  2ATQ A;  2X78 A;  2X6N A;  2OPS A;  1N6Q A;  3LAM A;  4EP4 A;  1EXQ A;  4CHY A;  5FRM A;  4KI6 A;  4I7F A;  3NH0 A;  1DLO A;  1U04 A;  4OKJ A;  2XRI A;  3OYC A;  4LY7 A;  3OJS A;  1BIS A;  2Z1J A;  4FJ7 A;  3I0R A;  4FVM A;  2YV0 X;  5C24 A;  4NCG A;  4B9T A;  2R7Y A;  2F96 A;  4KRF A;  3O4Q A;  3P83 D;  3LZJ A;  4RW4 A;  2D5R A;  4K8Z A;  4FJN A;  4EZ6 A;  1IKV A;  1Y97 A;  3LPT A;  2YNI A;  4CGF A;  4DTM A;  3V6D A;  1NOY A;  2YKN A;  3ALY A;  3L2W A;  2HMI A;  4IG0 A;  4RW9 A;  4KHS A;  2QKB A;  1B9F A;  2HHS A;  3AA3 A;  1VK0 A;  4FK4 A;  4O4G A;  4CK2 A;  1RDA A;  1LWE A;  2RPI A;  4AHU A;  4H4O A;  3SQ1 A;  2D0A A;  2WON A;  1BIZ A;  4DLG A;  4CJP A;  2WOM A;  1RT4 A;  4JLH A;  3L3U A;  4CHZ A;  3DLR A;  1ZBF A;  2OPP A;  3BGR A;  2W42 A;  4LH5 A;  4HTU A;  3S3M A;  1X9S A;  3KTQ A;  1RT2 A;  4QCL A;  3IAY A;  4DFK A;  1Q8I A;  3HP6 A;  4E89 A;  4KV8 A;  3TAM A;  1U45 A;  1TK0 A;  3QLH A;  4FW1 A;  3KLH A;  2HHW A;  4ID1 A;  2HHX A;  3IRX A;  4M3W A;  5J2P A;  1LV5 A;  1S1T A;  2O4G A;  4CJW A;  4HUE A;  4OLA A;  1A5V A;  1EX4 A;  2P1J A;  3VQE A;  3TAG A;  1ZBH A;  3HK2 A;  4CEZ A;  4KTQ A;  3QIN A;  3KK1 A;  4O0I A;  4FJL A;  3AA4 A;  1FK9 A;  4CES A;  3OYN A;  3RTV A;  4CFD A;  3OYK A;  4DTS A;  1WSJ A;  3VQ5 A;  2ITG A;  2BDP A;  2EHG A;  1Q9Y A;  4M3X A;  4CEQ A;  3NH1 A;  1JLE A;  3CFO A;  3NFA A;  1SL2 A;  1KSP A;  1HYS A;  3SCX A;  1HYV A;  1RBV A;  1I39 A;  1NK6 A;  2A1S A;  2ZD1 A;  2ZQB A;  4E7I A;  4M3R A;  5SWM A;  2P5G A;  4DLE A;  3TR8 A;  4G1Q A;  3NBP A;  3HXM A;  1TAQ A;  3DYA A;  4Y1D A;  5HP1 A;  2PZS A;  2Z1H A;  3SJJ A;  4GVM A;  3DRS A;  1BHL A;  1TL3 A;  4Z4C A;  5HRP A;  3LAL A;  4E7J A;  1TKD A;  4DSL A;  3VQQ A;  4FJ9 A;  5FRN A;  4NYN A;  3V4I A;  4HCC A;  1Z25 A;  3HM9 A;  1UA1 A;  1BCM A;  3B6O A;  3ULD A;  1NKE A;  3FFI A;  3NGI A;  1J9A A;  1JLC A;  4CGG A;  1BGX T;  1Z26 A;  3OYG A;  4CJ3 A;  1FXX A;  4FLY A;  4CJV A;  2HW3 A;  4FXD A;  3VA3 A;  3D45 A;  2KFN A;  4Z4I A;  4E3S A;  1LWC A;  3JSM A;  4CED A;  3SUN A;  1QTM A;  4F4K A;  1WSE A;  5FDL A;  1C1C A;  1BIU A;  3HPG A;  2F8T A;  1IKW A;  3HJF A;  4CEC A;  4N56 A;  2AJQ A;  4KO0 A;  3G10 A;  1RTJ A;  3HYF A;  3AVF A;  4BWJ A;  4F3O A;  3K5O A;  5HRN A;  3TAQ A;  3OYD A;  1LW0 A;  3RR8 A;  3KK3 A;  3DM2 A;  2G8I A;  3NE6 A;  1O1W A;  3NDK A;  2FBX A;  2E4L A;  3SUO A;  4FZX C;  4CJL A;  4M3T A;  4OVL A;  3V9Z A;  3QES A;  4KFB A;  3ZT3 A;  1F21 A;  2FBY A;  3LP0 A;  4DSF A;  1NJW A;  4DU1 A;  3M8S A;  3AVM A;  1QS4 A;  2D0C A;  1YT3 A;  3AO5 A;  4CEE A;  4DTU A;  3ZSO A;  1T7P A;  3ZSQ A;  4DU3 A;  1NK7 A;  3NF8 A;  4CJR A;  3KLF A;  3L2Q A;  1WNS A;  3THV A;  1R0A A;  1EET A;  3EZ5 A;  4JRP A;  5EU7 A;  3VQP A;  3O4N A;  3OS2 A;  3AA2 A;  2D0B A;  3TAR A;  4B8A B;  4C8K A;  4Z4H A;  4F3T A;  2IS3 A;  1S1X A;  1NK0 A;  3NF7 A;  1IG9 A;  3I8D A;  1S5J A;  3C94 A;  4DTO A;  4DFP A;  1RTH A;  4F2R A;  4QOZ B;  4CF0 A;  1WAF A;  5D3G A;  4CJ4 A;  1QSL A;  1HJR A;  2RF2 A;  2HB5 A;  4B9M A;  2A1R A;  4KKO A;  4NCB A;  4KHU A;  2BGG A;  2Z1I A;  4M45 A;  3OYI A;  3SPY A;  4HHT A;  3V9X A;  4DQR A;  4Z4G A;  3K57 A;  1RDB A;  3QO9 A;  3L2V A;  3ZSR A;  1HPZ A;  4E1N A;  1SUQ A;  4B3O A;  1WSH A;  1U47 A;  4FJK A;  1I3A A;  1RT1 A;  1XHZ A;  1NK4 A;  4PQU A;  2FBT A;  3TAE A;  1HQE A;  1UWB A;  1VSE A;  2B5J A;  3MEG A;  3QNO A;  5HLF A;  4OGE A;  1SKS A;  3SZ2 A;  3NAE A;  4O44 A;  1J5O A;  4CEF A;  1HYZ A;  1DTQ A;  4IG3 A;  4LH4 A;  5KRS A;  4FLX A;  1RDC A;  3M8P A;  2VWK A;  3LPU A;  5I3U A;  4JS5 A;  4W5N A;  4Q0B A;  1L3V A;  4CJK A;  2OA8 A;  3TAB A;  4CER A;  4OKE A;  4FJG A;  2DFF A;  4W5Q A;  3LWM A;  2Z1G A;  3ZT1 A;  1WLJ A;  4Y1C A;  4CK3 A;  2VWJ A;  4DU4 A;  2BAN A;  5C25 A;  4ZHR A;  4J2D A;  1BQN A;  1ITG A;  1JL1 A;  1JLF A;  5E41 A;  1JLB A;  4CF8 A;  1JKH A;  4BWM A;  1RT5 A;  2FC0 A;  3SV3 A;  1XI1 A;  4KHY A;  4KAZ A;  1L3S A;  1XC9 A;  1QSY A;  1SL1 A;  1ASW A;  2B4J A;  3VN5 A;  3RMD A;  4CJF A;  3MXI A;  4DTJ A;  1NJY A;  1X9M A;  4FLW A;  4NCA A;  1TAU A;  3WNF A;  3SNN A;  3IG1 A;  3HL8 A;  3IS9 A;  4WE1 A;  1YVU A;  1RNH A;  3AO3 A;  3AVL A;  3KLG A;  3TAP A;  3QEX A;  4N41 A;  3NCI A;  3CFP A;  4DMN A;  1NKC A;  1MU2 A;  2E6M A;  2YHA A;  2IAJ A;  1EP4 A;  2YKM A;  3PO4 A;  3NF9 A;  2LSN A;  1QSS A;  1S9E A;  4FM0 A;  1WN7 A;  3VQD A;  3PX0 A;  4RW8 A;  3WNE A;  1VRU A;  4ICL A;  4DSK A;  3G0Z A;  1ZBL A;  3EY1 A;  3DMJ A;  4FJH A;  1NJX A;  5KGW A;  4C8L A;  1RBS A;  1HRH A;  2QXF A;  3KKS A;  3NF6 A;  4AHC A;  3RMC A;  5CY4 A;  4B9U A;  4FZY A;  3V1R A;  4W5O A;  4RG8 A;  1KLM A;  3OJU A;  3SPZ A;  1RIL A;  2HNZ A;  3S3N A;  1NKB A;  4KHQ A;  1VSI A;  1FKP A;  3DOK A;  3DRR A;  4E7K A;  3ZT0 A;  3BDP A;  3HO1 A;  4I9Q A;  4KPY A;  1KVC A;  1NK5 A;  1VSH A;  5KRT A;  2KZM A;  3KD1 E;  4DSJ A;  3HPH A;  3OVN A;  2JGU A;  2GUI A;  1C0T A;  3QEI A;  3NGZ A;  3KJV A;  1YTA A;  3WNG A;  4IFV A;  3LAN A;  4FZZ A;  1J54 A;  1ASU A;  3ITH A;  1YTU A;  1X1P A;  4B8C A;  3K2P A;  4O0J A;  1TKT A;  4PUO A;  4MFB A;  3U3Y A;  4Z4F A;  4E1M A;  4CJU A;  2DY4 A;  2OPQ A;  3KIO A;  4OJR A;  4XIU A;  3L2U A;  1B92 A;  4YNQ A;  4DF8 A;  4KHW A;  4FLV A;  1VSK A;  4OKK A;  4J2E A;  1HNV A;  3ASM A;  4CGJ A;  5J1E A;  4ZTJ A;  1GOC A;  1JL2 A;  5CYQ A;  1ZBI A;  5KGX A;  3U3G A;  3AV9 A;  4C8O A;  3F73 A;  3LDS A;  1KFD A;  1VSF A;  3AVI A;  4CJ5 A;  2KTQ A;  4LD0 A;  4CGI A;  2XO7 A;  3RRH A;  1HMV A;  3PV8 A;  4R5P A;  4HUF A;  5HBM A;  3HST B;  3OY9 A;  3HVR A;  4DTP A;  4PY5 A;  3SQ2 A;  5JS1 A;  4Z0U A;  1HNI A;  3ZSZ A;  3PO5 A;  4FK2 A;  2PYL A;  2O4I A;  4CIG A;  1RDD A;  2XY8 A;  3AVB A;  4O5B A;  3O3F A;  3OYJ A;  3LZI A;  4E7L A;  2YHB A;  4CJS A;  4DQQ A;  3VQ4 A;  4LSN A;  4OLB A;  2OZS A;  4FJI A;  3S9H A;  4J2B A;  4DS5 A;  3AA5 X;  4BDZ A;  1S1V A;  3QEP A;  3DLB A;  2YNH A;  2QK9 A;  2BE2 A;  1CXU A;  4RW7 A;  3K5N A;  4TSX A;  1NOZ A;  1RBR A;  1XWL A;  3PX4 A;  1U48 A;  3QIO A;  3M8R A;  2XY7 A;  3PY8 A;  1HQU A;  1TK5 A;  1VSJ A;  2Y1I A;  4F2S A;  1D9D A;  1ZYQ A;  2VG7 A;  4CHP A;  3RMB A;  1S1W A;  5T7B A;  3K5M A;  3V9W A;  5HRO A;  4CHO A;  4FYD A;  3AVJ A;  4B9V A;  1DTT A;  3KLE A;  2OYQ A;  4CGD A;  2KZZ A;  1L3T A;  3D0P A;  1KLN A;  3EYZ A;  2JLE A;  3UIQ A;  4M41 A;  2G8F A;  3RMA A;  3NH2 A;  3DLK A;  4AHV A;  4CHQ A;  1TKZ A;  4B9S A;  1NJZ A;  4KTZ A;  3NHG A;  2DFH A;  1REV A;  3P5J A;  2G8H A;  4J2A A;  4I2P A;  5CZ2 A;  1GOA A;  4C8M A;  4CJQ A;  3QEV A;  3VQ7 A;  1S1U A;  2G8K A;  4BDP A;  1XHX A;  3LAK A;  3JYT A;  1KFS A;  1C0U A;  4FLU A;  5HRR A;  1CXQ A;  4FK0 A;  1T03 A;  3CG7 A;  2OPR A;  1TK8 A;  4JRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...