2RPIA

The nmr structure of the submillisecond folding intermediate of the thermus thermophilus ribonuclease h
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
MNPSPRKRVALFTDGAALGNPGPGTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease H
publication title The high-resolution NMR structure of the early folding intermediate of the Thermus thermophilus ribonuclease H
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 19
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rpiA00
3OYCA 3LANA 3LALA 1X9SA 3RR7A 4FLYA 2Y1IA 1C0TA 4CJVA 4FJMA 4J2AA 5J1EA 5KRSA 1G15A 1HYVA 3AVIA 1NK7A 5JS1A 3LP1A 1XC9A 1X9WA 4CEEA 1WAJA 2XY7A 1NKBA 1DTQA 1BI4B 1W0HA 3KKRA 4BACA 3MXIA 4FJ7A 2KFZA 4IKFA 1DTTA 4LH4A 5J2NA 1JKHA 3ISNC 3VQPA 4CJ4A 3PV8A 3VA3A 3ZSQA 1VSHA 4K8XA 4AHSA 4ZHRA 1X1PA 5DMRA 1EX4A 3T19A 2ZQBA 1WSFA 4FZYA 3HVRA 4M42A 3M8PA 4L8RB 4DFKA 2HNDA 4ELUA 1DLOA 3V6DA 4E7HA 2HVIA 1BCOA 4DQQA 4E7LA 3TAQA 3QERA 1HYZA 1XHZA 3LPTA 2X74A 4KHSA 3HPOA 1JLFA 3O3HA 1HPZA 3DLGA 5J2QA 4F8RA 5CZ2A 4O0JA 2HB5A 4B8AB 4IDKA 4EP5A 4KTZA 1TKXA 3NH2A 4BE2A 3I8DA 5FRMA 1TAQA 4UQGA 3NGYA 3MECA 4DTXA 1TL1A 4Q5VA 2P5GA 1T7PA 2FBVA 3B6PA 3P5JA 1C0MA 1WSEA 4HVJA 4HTUA 1JLBA 1TVRA 3KJVA 1SV5A 3V4IA 4F3OA 2BGGA 4AHRA 3L2VA 2QKKA 3TANA 3BDPA 4CFAA 4QAGA 2RF2A 3KK1A 4CERA 3NE6A 3RMDA 1ZYQA 4DSKA 4CEFA 2JLEA 3QEVA 2IOCA 4Y1CA 3ITHA 3S3MA 4J2BA 1KCFA 5HROA 4CF9A 4DTRA 1IKYA 4CEDA 2F96A 4AHUA 4CEOA 1LW2A 1UAXA 2KTQA 1WSHA 3AVJA 3QINA 4E7JA 1LAVA 4CEBA 3SQ0A 2X6SA 1VSDA 5HRSA 3RRHA 3VN5A 4JLHA 1LAWA 3DRPA 3CM5A 1NOYA 1RDAA 3L2UA 3RRGA 2F8SA 4E0DA 2YHBA 1GOAA 1KFDA 3AVCA 4N5SA 4XIUA 3SV4A 5I42A 4N41A 2FC0A 1ZBUA 1A5VA 5FDLA 4CGIA 3DM2A 2VWJA 3AVLA 1SL2A 2EHGA 4FZZA 3I0SA 2FBYA 1LWEA 4N47A 1GOBA 4DQRA 3OYNA 1TKTA 1VSKA 5HRRA 4AHTA 4PWDA 4KKOA 3U3YA 1XI1A 3AVKA 3ZSXA 4BE0A 3HL8A 3EZ5A 2BDPA 4CK2A 2AJQA 1WSGA 1RT7A 2X78A 4N76A 5J2PA 4FVMA 3RMCA 4DU1A 3VQEA 2HMIA 4GVMA 4OPJA 4C8KA 1N6QA 3LAKA 2IGIA 3IAYA 2G8KA 1KRPA 4ELVA 4CE9A 3FFIA 4O4GA 3LZIA 1NJYA 1SUQA 3OS1A 4KB0A 2P51A 1JXEA 3ZSYA 3K5MA 4E19A 4FK4A 4Z4FA 2EX3A 4DTSA 3F73A 1WN7A 3V1QA 4ELTA 2P1JA 4OKEA 4Z4CA 4FLVA 4KI6A 3G10A 4RW6A 1UA0A 2D0AA 1S1VA 4PQUA 3HPGA 3B6OA 4DSEA 1JLCA 2KW4A 3OYMA 3K5NA 2LSNA 3V9UA 2PYLA 4FK2A 3KD1E 3ZSWA 1SKRA 2P5OA 1TV6A 3KKSA 3ZT2A 4JS4A 3TI0A 1VSMA 4BDZA 4CK1A 4NYFA 3SQ4A 4OKJA 3VQBA 4MFBA 4BWMA 3OS2A 3LP0A 5SWMA 4DU4A 3O3GA 1ZBIA 1RT5A 3P83D 1C1CA 3AO4A 3ZT0A 3KLFA 2RN2A 4DG1A 5CYMA 3M8RA 1KVAA 1BQMA 1VSJA 1GOCA 1JLAA 1LWCA 2G8VA 3T3FA 2OPRA 4Q0BA 1RT4A 1HQUA 2XHBA 1VRUA 3OYIA 4DLGA 1D9FA 2OPQA 4CGFA 1L3VA 4B9TA 3OJSA 4C8LA 4B8CA 2ZD1A 5J2MA 1BISA 3HO1A 4KAZA 1CZBA 3AO5A 4CJWA 4CJQA 3SNNA 1NKCA 3DLEA 1QSLA 3WNFA 2X6NA 3QNOA 2IAJA 1SL0A 2DY4A 4HCCA 1VSIA 4FLWA 4CJSA 3QNNA 3OYFA 4M41A 3KLIA 4YNQA 1L3SA 3TAFA 4HUFA 3K5OA 2XRIA 2KZMA 2ZE2A 3WNGA 2HHQA 3O4NA 2QKBA 3AA2A 4CHQA 4CIEA 2Q3SA 4GMJB 3DMJA 4FJHA 3AA4A 2W42A 4DTJA 3AO3A 3HYFA 4IFYA 3VQ5A 5T7BA 4DFJA 3U3GA 1VRTA 3OJUA 1IG9A 3O3FA 1D8YA 1KLNA 1HRHA 4O5BA 3KK2A 3SI6A 1J9AA 1RBRA 3ZSRA 4I7FA 5I3UA 4FJLA 4KI4A 3KK3A 4W5TA 1JLGA 1NK0A 1KVBA 4CF8A 1XHXA 4FXDA 3S3OA 2YHAA 2OPPA 4CIGA 1Q9XA 2F8TA 3L2RA 3LP3A 1TK8A 2RKIA 1HMVA 3DLRA 4PA1A 3NF6A 3KLEA 5DK5A 1KVCA 2RPIA 5CY4A 3AVHA 1RT2A 4B9MA 4DSLA 4NCBA 4C8MA 4ZTJA 1NJXA 2YNFA 4CFCA 3SPYA 4K8ZA 3H08A 4DFPA 3PX4A 4F3TA 4CCHA 4CK3A 2YKMA 3VQCA 3SV3A 3DOLA 3K58A 4HHTA 2OYQA 1YTUA 1RBUA 4OKKA 2ITGA 3KTQA 3PY8A 2QK9A 2E4LA 3AVNA 4O0IA 1B92A 1Z26A 4CF1A 3SYZA 4DS4A 4BE1A 1RT3A 3SUPA 3SJJA 4CJ3A 4FJ9A 2R7YA 1REVA 3K59A 3QEWA 3PO4A 1IH7A 1VSLA 3F9KA 3QESA 2KFNA 1Q8IA 1ASVA 2GUIA 3ZT4A 4FK0A 2YNHA 3OYKA 4CESA 4CJPA 4Z0UA 1NK8A 5EU7A 2OZSA 4H4MA 5KGXA 1NK6A 4C8NA 2FBTA 3K5LA 2ATQA 1T05A 1J5OA 1C0UA 3CQ8A 2OPSA 3OYLA 4DF8A 1BI4A 2YNIA 4O55A 1CXUA 1I39A 4KTWA 4Y1DA 2VWKA 4CJEA 4FLZA 1A5XA 2DFEA 4CF0A 4DSJA 3TWHA 1C1BA 3VQ4A 5C25A 1XWLA 1S1XA 3NCIA 3V9SA 1RDCA 1TL3A 4NYNA 4CJRA 1TKZA 4CGHA 3AVGA 1IKVA 3JYTA 5SZTA 3THVA 3EYZA 4CHOA 4F2SA 3NH0A 3IG1A 3TR8A 1EP4A 4CEAA 3V9XA 3QEXA 4IG0A 4OLBA 1TK5A 1NK5A 1K6YA 3KLHA 5HP1A 1LWFA 4FW1A 3IRXA 3L3VA 3DI6A 4CIFA 3QO9A 4RG8A 1RT6A 4B9NA 2WOMA 5KI6A 2B4JA 1QQCA 1TGOA 4QCLA 1HNVA 3KLGA 4R5PA 1RDDA 1T03A 3TARA 4W5QA 3RWUA 4H8KA 3WNHA 1L3TA 3DRRA 2E6MA 2PYJA 1HYSA 4I2PA 3ULDA 2Z1GA 3TAEA 2PZSA 1WSJA 3LDSA 1HNIA 3VQ9A 4JRPA 4LSLA 1QS4A 3NH1A 1SL1A 4FJKA 3HK2A 1D9DA 3NDKA 3RR8A 4CJLA 3ZT3A 4FLXA 3RMBA 1SKSA 3SQ2A 3D45A 3LZJA 4N56A 3SZ2A 4KFBA 4OVLA 4QOZB 4DTUA 2G8UA 3SUQA 1J54A 3TAPA 2HHVA 3OY9A 2B5JA 2O4GA 1S1UA 4KHNA 3VQQA 4CHZA 3L8BA 4KREA 2GV9A 4AILC 2D0BA 3IS9A 4E3SA 4CECA 3ASMA 3QIPA 4LH5A 4CHPA 4CF2A 4NCAA 3K2PA 2Z1JA 1BCMA 4IG3A 1BHLA 3MEDA 1NOZA 4DMNA 5FROA 5C24A 2XY5A 1WAFA 3C94A 3ZSZA 4DSFA 3MXMA 1RTDA 1D5AA 4I2QA 3LP2A 2IC3A 1QSSA 4J2DA 2OZMA 1JL2A 3ALYA 4NCGA 3ZT1A 3OS0A 1ASWA 3RTVA 4ZTFA 4DS5A 2DTUA 1BGXT 3HJFA 2O4IA 3PUFA 4DTOA 1JLQA 4DF4A 4OGEA 4JRQA 2Y1JA 4IFVA 3HM9A 3LWMA 1Y97A 3LPUA 4CGJA 4FJJA 4KHYA 1T8EA 3A2FA 1N5YA 4F4KA 4PUOA 4LY7A 2A1RA 1RTHA 4E7KA 3V81A 3C6TA 4ID1A 4O44A 5HRPA 3QETA 1S6QA 2BANA 4I9QA 3AA5X 3CYMA 4RW8A 3OYDA 2KQ2A 4DTNA 1BQNA 3HPHA 4M3YA 1LW0A 1IO2A 4OGCA 4M3RA 3NF8A 3T1AA 5E41A 3JSMA 3I0RA 1YTAA 1C1AA 4DU3A 3TABA 4DWIA 3E01A 4KB1A 4C8OA 4DFMA 1RBVA 4FM2A 4E1MA 1SKWA 2D5RA 4DQSA 1QHTA 1FKPA 4ID5A 3SCXA 5FRNA 1NJZA 3HP6A 4FZXC 2DFHA 3O4QA 4AHVA 4FYDA 4OPKA 2ETJA 3HVTA 4H4OA 3CFOA 3QIOA 3U6FA 2G8WA 3AV9A 4FM1A 3VQ7A 3AO1A 1F21A 3PO5A 1JXBA 1EETA 4ICLA 4CHYA 1W9HA 4DSIA 4J2EA 1WNSA 1HQEA 4CJKA 3VQ6A 3D0PA 3S9HA 3S3NA 4EZ6A 1CXQA 4CEZA 1I3AA 4Z4GA 3V1RA 1CZ9A 1L5UA 1FXXA 3AVFA 3OYHA 3L3UA 3SPZA 2OA8A 2G8FA 3QLHA 4E1NA 4CJFA 4LD0A 1U04A 1S9EA 3WNEA 5KTQA 3TAGA 3G0ZA 4W5OA 3V9WA 3PX6A 1KFSA 3KD5E 4PY5A 2G8HA 3VQAA 1S9GA 4EP4A 4YFUA 3UIQA 1WSIA 3NF9A 3L2QA 4CJTA 2KZZA 1B9DA 4KRFA 4CHNA 3NBPA 1TK0A 3DYAA 4RW9A 3SQ1A 1RILA 4MQ3A 4OJRA 1A5WA 3V1OA 3AO2A 1FK9A 1BIZA 2BE2A 2HNZA 3NF7A 2Z1IA 2HNYA 3CG7A 1VK0A 2E6LA 2GBZA 3EY1A 4FCYA 4Z4HA 3QEPA 4FJXA 1C6VA 3LAMA 4RW4A 4CGGA 3OYEA 2HVHA 1TAUA 1X9MA 4BDPA 2YV0X 3MEGA 4OLAA 3VQDA 1NK9A 2HHWA 4Z4IA 1MU2A 1RBTA 3DRSA 4HUGA 1O1WA 1QE1A 3KIOA 1HJRA 4M3WA 3NFAA 5CYQA 3ZSOA 1VSEA 4CJUA 4W5NA 4M3TA 3TAMA 1UA1A 1NJWA 1KSPA 4B9SA 5C42A 1YT3A 2IDOA 3NGZA 4FJ5A 1RCHA 5HRNA 4KHWA 4HUEA 4E89A 2HW3A 2HHSA 1IKXA 2IS3A 3DLKA 3MAQA 4HCBA 3OYBA 4RW7A 3HP9A 1S1TA 1IKWA 2HHUA 4TSXA 1NKEA 1VSFA 5K14A 3NHGA 2XY6A 1S6PA 5HBMA 4M3ZA 4AH9A 2HHXA 4KHUA 4AHCA 3P1GA 4LSNA 4I9LA 4BWJA 4CJ5A 1U49A 3C6UA 1JLEA 3CFRA 1UWBA 4FM0A 2VG6A 5KGWA 2WONA 1ITGA 3NGIA 4B9UA 1QTMA 1EXQA 3PX0A 1YVUA 1ZBFA 2NUBA 3SUNA 1UOCA 1RBSA 4CFBA 3AVMA 4BDYA 2D0CA 3SUOA 4CGDA 1LV5A 3OVNA 3CM6A 5HLFA 4KTQA 3AVBA 3VQ8A 2DFFA 5JS2A 4DQPA 4FJIA 4DQIA 1FKOA 3OYJA 4CEQA 1EKEA 1Z25A 3V9ZA 1CLQA 4FJNA 3DLHA 4B9VA 4DTPA 1ASUA 1S5JA 2YNGA 3K57A 4DTMA 1BL3A 4E7IA 3DLBA 1KLMA 1RTIA 4G1QA 1U4BA 1WLJA 4Z4EA 1Q9YA 1S1WA 1U47A 1RNHA 4M45A 1NK4A 4FJ8A 1KTQA 4GW6A 2B6AA 3AVAA 3HSTB 4KV8A 3MEEA 4WE1A 3ZCMA 4F2RA 3HT3A 4M3XA 2XO7A 1TKDA 1J53A 4FW2A 4FLUA 1JL1A 2JGUA 3M8SA 2VG5A 4M3UA 3C95A 2YKNA 3AA3A 5CZ1A 4DLEA 1QSYA 4FJGA 1RDBA 4JS5A 2G8IA 2XY8A 4FLTA 4KHQA 1RT1A 3OYGA 4IBNA 4B08A 5KRTA 1ZBLA 2FBXA 3ZSVA 2A1SA 2PY5A 1U48A 4B3OA 3LWLA 4B9LA 4CFDA 3QEIA 1BIUA 1RTJA 2VG7A 3DOKA 1ZBHA 1U45A 3MXJA 4W5RA 3RMAA 3L2WA 2Z1HA 3CFPA 5D3GA 3BGRA 4KPYA 2QXFA 4KO0A 1L3UA 2HHTA 3VA0A 1B9FA 3OYAA 3NAEA 3HXMA 2I5JA 4EZ9A 1R0AA 3M8QA
chains in the Genus database with same CATH superfamily
3LANA 1X9SA 4FLYA 4CJVA 5BRHA 4J2AA 1K8AO 5KRSA 1C0GA 1X9WA 4JI7K 4YOWA 2WBNA 1G99A 2HF3A 2QEXN 1IBKK 1JKHA 4EHTA 4AHSA 4B1YB 4GY2B 3M8PA 4JHDB 2Q0UA 2QWNA 4DQQA 1X9JA 3QERA 1EWRA 5AZIB 3NVKA 2O8BA 2X74A 4KHSA 3O3HA 1HPZA 4B8AB 2HB5A 3NH2A 4EP5A 2GEMA 3CMAN 3O9SA 4DV7K 4DTXA 2P5GA 3DWLA 3P5JA 3V4IA 1WSEA 4B1VA 5LL6Z 4CFAA 4A61A 2FF6A 3VOVA 2JLEA 2HBMA 3S3MA 1BG3A 1YVNA 2HOEA 3MN9A 1IKYA 3E66A 4CEOA 3EE9A 1UAXA 1HKBA 4E7JA 4CEBA 2ASPA 1V4TA 2X6SA 3RRHA 3SBTA 3VN5A 4JLHA 1LAWA 3CM5A 1RDAA 1MWMA 3WXJA 4E0DA 2YHBA 4JK8A 1KFDA 4B1UB 3O9TA 3DM2A 4FZZA 1GOBA 5FPMA 1VSKA 4BGBA 4KKOA 1LOTB 3ZSXA 4A62A 4BE0A 3HL8A 3EZ5A 4JYAK 3UE5A 3RMCA 2HMIA 5LJWA 4GVMA 4WQ5C 1N6QA 4C8KA 3LAKA 3IAYA 2G8KA 1KRPA 2P51A 4Z4FA 3K5MA 2EX3A 3RVCA 1WN7A 3V1QA 4KI6A 4WQ4A 1KD1O 4K41A 4CJ7A 1HLUA 4DSEA 3ZSWA 1TV6A 3ZT2A 5AQYA 1C0FA 4NYFA 3VQBA 1I94K 5SWMA 1RT5A 1C1CA 3ZT0A 3KLFA 4DG1A 5CYMA 1VQON 1GOCA 1LWCA 4Q0BA 1GLFO 3VEVA 4DLGA 1JJ2M 1D9FA 3NVMA 4C8LA 3OJSA 3O80A 2V7ZA 2ZD1A 2HBKA 4KAZA 1CZBA 1QSLA 4JKEA 5C2DA 1SL0A 2DY4A 1NLVA 4YNQA 2O8EB 2XRIA 2ZE2A 5C15A 4CIEA 2NRXA 4FJHA 5T7BA 3TSQA 2ZGYA 3FZFA 4WYBA 4DR6K 1JLGA 1KVBA 4CF8A 2JWLA 1TYQB 2YHAA 2OPPA 4CIGA 4EIAA 2CGJA 1Q9XA 1RDWX 1TK8A 2RKIA 3DLRA 4LF7K 3NF6A 3KLEA 2P9KA 5CY4A 3I33A 4JAXA 4C8MA 4ZTJA 3VETA 4XH4A 3D2EB 2YKMA 2A41A 1M90O 2OYQA 1NBWA 4YHHK 1NMDA 2ITGA 4KH4A 2E4LA 1NM1A 3SUPA 4YDUA 2ASMA 2VCPA 1O13A 2KFNA 1Q8IA 4MDBA 3H3OB 2GUIA 2YNHA 3OYKA 5AQGA 4CJPA 5EU7A 5KGXA 1OH8A 4BRGA 4B1XB 2FBTA 3CJ1A 2CGLA 3CQ8A 3OYLA 1BI4A 4CJEA 2CGKA 2W40A 3I8BA 1A5XA 1P8ZA 3LM2A 4A5BA 3V9SA 1UA0A 1TL3A 4LFAK 3IMXA 4CGHA 3JYTA 1IKVA 4JN4A 2FF3B 3THVA 3EYZA 3O5BA 1EP4A 3VENA 1NK5A 1KAXA 3E1YA 4JI8K 1VQPN 4CIFA 3MN7A 3QO9A 3U4LA 1RT6A 4B9NA 2B4JA 3WQTA 1TGOA 4FPAA 4QCLA 3O9QA 1OH6A 3RWUA 5GINA 1JCGA 3K0SA 3VQ9A 4JRPA 4LSLA 4BC4A 3O1WA 1ATSA 1SKSA 3CHWA 4N56A 3RSEA 4KFBA 3SZ2A 4OVLA 4BC2A 4DTUA 4BRMA 3PLAA 1GLCG 4NLCA 3BZKA 2B5JA 2O4GA 1S3XA 2E2QA 3IS9A 4CHPA 3QIPA 3K2PA 2Z1JA 2UUAK 5FROA 4DSFA 2ZF5O 1NU0A 3W0LA 1ASWA 3RTVA 5BRFA 3PUFA 5ELZA 4DF4A 3HM8A 2P9SB 1OH5A 4HWIA 1N5YA 4LY7A 4IEIA 3O8MA 2O8BB 4ID1A 3QETA 4FWPA 4QS7A 3OYDA 1HNZK 3HPHA 4OGCA 1IO2A 4M3RA 1N36K 3NF8A 3JSMA 3LDNA 3SJHA 4DU3A 4Y0WA 3J7AP 3E01A 3Q7CA 4C8OA 3THWA 2D5RA 1QHTA 1FKPA 1T6DA 3UKUA 4B9QA 5EY4A 3HP6A 3O9RA 4FZXC 4GV6A 4AHVA 2ETJA 2ZJQL 4IOXA 1F21A 4DSIA 1WNSA 4EZ6A 1I3AA 3HI0A 4H0OA 3SPZA 4KHPK 2RHKA 5AJ3K 3WXKA 3ID8A 3JS6A 3KD5E 2G8HA 1ATNA 3SMSA 4YFUA 3UIQA 4EHUA 3MN5A 3SQ1A 4G9ZA 4MQ3A 4OJRA 1XMQK 1A5WA 3V1OA 3MK6A 3FZHA 2BE2A 4FWSA 2Z1IA 4DUZK 4IJNA 2HNYA 4BRPA 1T44A 3GDQA 4DV2K 4FL9A 3LAMA 3OYEA 1X9MA 1QQNA 3JXUA 3MEGA 1Q7YO 1NK9A 5JICA 1RBTA 2OCEA 1HJRA 3TAMA 1NJWA 4CBXA 1VQ4N 4KHWA 4HUEA 2HHSA 3VEYA 3OYBA 4RW7A 2V51B 1S1TA 3U8XA 5AQRA 2HHUA 4BQZA 1S6PA 5HBMA 4E1JA 4WCEL 1N8RO 4KHUA 4AHCA 4CJ5A 3G4SN 2YHYA 3OW2M 4DV5K 5GAGP 1VQ7N 4AF1A 1JLEA 4FM0A 2NUBA 4BDYA 1RBSA 4CFBA 3Q7BA 3CM6A 3OHRA 5AQMA 4FWRA 1P90A 4DQIA 1FKOA 4NXMK 1Z25A 2V7YA 5KQ8A 5M1PA 4DTPA 3K57A 2YNGA 1KLMA 1Q9YA 2A5XA 4H0XB 4X66K 2UUCK 3C6HA 4FJ8A 4GW6A 4WE1A 4CZEA 3HT3A 2RE2A 4BGAA 4O8KA 3M8SA 4DR4K 2P9KB 2YKNA 1QSYA 4DLEA 4BRIA 2G8IA 4LF5K 3A5NC 4LC9B 3MN6A 4ILJA 3VMFB 5AFUH 1RTJA 3SBGA 2VG7A 1N34K 1U45A 5M1NA 4FVUA 1YF5L 1XMOK 4BRHA 1L3UA 3VA0A 3QFPA 4JKCA 2VYPA 3G71N 2I5JA 1LW2A 3OYCA 3PSFA 2QWPA 2Y1IA 2BH1A 1C0TA 4FJMA 3H46O 5J1EA 1HYVA 2PFUA 4BREA 3BP8A 3VTHA 3HSCA 1WAJA 3QBWA 1BI4B 1W0HA 3KKRA 2E2PA 3KHYA 1DTTA 3R1XA 3ISNC 3LDLA 4CJ4A 4BR9A 3PV8A 1VSHA 4K8XA 1EX4A 1X3NA 4XEIA 3T19A 4FZYA 1HR0K 5EXWA 4L8RB 2DPNA 2HNDA 3O1BA 2QA4N 1DLOA 3V6DA 4WQ5A 4E7HA 1BCOA 3TAQA 1NGJA 4ILGB 3CCQN 2O8EA 1JLFA 5LMNK 4KTZA 4BR0A 5BPLA 1T7PA 3CCLN 3C6AA 3N4QA 4B1WB 5JMVA 3DXKA 1QVFM 1JLBA 3KJVA 4MLHA 3OBWA 2Q0RA 4KH5A 4AHRA 5ADXH 3TANA 3KK1A 4QAGA 3NE6A 3THXA 4DQ8A 3RSEB 4CZIA 1KCFA 5HROA 1N32K 2VQEK 4DTRA 2EWSA 5LMUK 3SQ0A 3SK3A 5JVHL 5AQLA 4ISGA 4IJAA 3C7NA 5GAEP 4N5SA 4XIUA 1NWKA 3CF5L 5FDLA 1ZBUA 1A5VA 1NGEA 3I0SA 4DQRA 4N47A 1VQNN 2HBJA 5M1OA 5HRRA 1XI1A 1RT7A 5B8HA 3GOIA 4FVMA 3WT0A 3E9LA 3VQEA 4DU1A 1MA9B 4B1ZA 1Q86O 3ZX3A 1JXEA 2E20A 1OH7A 3F73A 5C2FA 4FLVA 2W6LA 3L6QA 1RFQA 3G10A 2QM1A 4RW6A 3BF3A 3B6OA 1J6ZA 4BR5A 3V9UA 2PYLA 3WUHA 3UKUB 3TI0A 2QWMA 1E3MA 1YIJN 1NNEA 4BDZA 3SQ4A 3OS2A 1YUWA 3O3GA 3ULEB 3CJCA 2RN2A 3I55N 5A2QO 2G8VA 3T3FA 2OPRA 1RT4A 2XHBA 3OYIA 1D4XA 1WBBA 1L3VA 4B9TA 3HO1A 5J2MA 1BISA 5AQQA 1FJGK 2UU9K 4CZFA 3C65A 2AP1A 4HCCA 1VSIA 3OYFA 3AAQA 3TAFA 4HUFA 2KZMA 1BA0A 3KWGA 4C1NK 4CHQA 3SAFA 2Q3SA 5E84A 2ITMA 5EX5A 4IFYA 4DFJA 5BR8K 3U3GA 1IG9A 1EWQA 2F9TA 3VERA 3VPZA 4BVOA 4IEEA 4IZ9A 4FXDA 2P9SA 2F8TA 3LP3A 4PA1A 3HOSA 5AQVA 2YHXA 2RPIA 4DSLA 4DUYK 4NCBA 1YHQN 1NJXA 4K8ZA 3BF1A 3SPYA 4F3TA 4CCHA 4CK3A 5LJVA 4KH6A 3K58A 5GADP 3U9ZA 4YOVA 3PY8A 3KTQA 4H03B 4O0IA 3A5MC 3EO3A 5IWAK 4BE1A 3SJJA 4FJ9A 4CBUA 4H0YB 3K59A 4V19S 4O8UA 4JKFA 2FSJA 4Z0UA 5BR9A 2OTJN 4BQLA 4H4MA 1NK6A 3W3DA 2YHWA 4IFEA 1RGIA 5HL7L 2P9LA 1I39A 2VWKA 3HRGA 3GG4A 1BUPA 4DSJA 1C1BA 4IWVA 1XWLA 1RDCA 3MWPA 4NYNA 4CJRA 2IVNA 4F2SA 4H5TA 3EE8A 4OO1J 4CEAA 4IG0A 3KLHA 1LWFA 3L3VA 3U9DA 4K42A 1N33K 5AQXA 2WOMA 3R3LA 5KI6A 3KLGA 2FXUA 1T03A 4FWKA 3TARA 3VESA 3WNHA 2UUBK 4NO7A 2PYJA 1HYSA 3CJAA 2Z1GA 2PZSA 2Q31A 4A2BA 2QTDA 4FJKA 4UY8O 5C10A 5IT9O 1D9DA 4B3TK 4FLXA 1TUYA 3D45A 2D0PA 3G25A 3J8AA 2G8UA 1ZBSA 3SUQA 3TAPA 3J80O 4KHNA 4CHZA 2GV9A 4CZJA 4E3SA 4CF2A 4LFBK 4NCAA 1BCMA 4L3QA 1BHLA 5C24A 2XY5A 4OPAA 1WAFA 3ZSZA 1W2BM 1RTDA 4I6MB 4BRLA 4I2QA 4J2DA 1JL2A 3ZT1A 2DTUA 3P31A 1NJIO 4DTOA 1JLQA 3JAMO 4C1NI 4JRQA 3CC2N 4IFVA 4YOUA 3LWMA 1MDUB 3CCRN 1YJNN 4E7KA 3O6WA 1HKCA 2P9UA 3C6TA 4O44A 4I9QA 3CYMA 2KQ2A 4DTNA 3HZ6A 1LW0A 3CCEN 5E41A 3I0RA 2VWBA 4GKJK 1C1AA 4DWIA 3K9KA 3EKUA 2ZJPL 4DFMA 1RBVA 1V4SA 4E1MA 3DXKB 4DQSA 4ID5A 4JKAA 1BU6O 3SCXA 3O4QA 1EO1A 4FYDA 3THXB 3HVTA 3U6FA 1OKJA 3M3ZA 4PHTX 4FM1A 1T6CA 2YJEA 1EETA 3D7EO 4ICLA 2GWKA 4CW7B 1HQEA 3S3NA 4BRFA 3M5RA 4CEZA 4Z4GA 1FXXA 4IOAL 3ZX2A 3OYHA 3M6GA 3MX5A 2OA8A 4O5FA 3C7NB 1K8KA 3WNEA 3G0ZA 4W5OA 2KHOA 3OTOK 1QQMA 1WSIA 3L2QA 4CJTA 3WEEA 2KZZA 1B9DA 2FLOA 5AQIA 4RW9A 1RILA 1XUPO 3AO2A 4CZLA 5C0YA 1BIZA 2HNZA 4IXCA 1VK0A 4JKHA 4FCYA 4RW4A 3KZBA 1SZ2A 2HVHA 2YV0X 3DXMB 3TSUA 2HHWA 4JD2A 1MU2A 4JK9A 3KIOA 1KQSM 3F2KA 4H0PA 3NFAA 1VSEA 4W5NA 5C12A 4M3TA 4BROA 1UA1A 2GWJA 1GLDG 1ESVA 5KQDA 1OVQA 4PL8A 5C42A 1YT3A 4B9SA 2AA4A 1Y64A 1RCHA 4JI5K 2HW3A 2Q2RA 2HF4A 3HP9A 4TSXA 4BVPA 5K14A 4BRCA 2HHXA 1U49A 4A5AA 1DKGD 3R6MA 2E88A 2PAVA 3TSPA 3NGIA 4ISEA 3SUNA 3IUCA 1RDUA 2D0CA 3SUOA 1YI2N 3CETA 1LV5A 1GLLO 4KTQA 2DFFA 2HHHK 3A8YA 3CCUN 1HKGA 1EKEA 2P9IA 5FPNA 3DAWA 3DLHA 4JKDA 1ASUA 4CD1A 2KKZA 3HTVA 4OX9K 4Z4EA 3EEQA 1VAZA 1U47A 1IBMK 2A3ZA 4KV8A 2B6AA 3HSTB 3ZCMA 3TTCA 2XO7A 4FW2A 1JL1A 2JGUA 2VG5A 4M3UA 3LM9A 1RDBA 4JS5A 1VQLN 1RT1A 3ZSVA 4B3OA 3LWLA 1K73O 5EVZA 3DOKA 3MXJA 4X62K 1U6ZA 5AQZA 2Z1HA 3CFPA 4U7BA 2HHTA 3SMPA 4HTLA 3NAEA 4NXNK 3HXMA 1Z6RA 4Z94A 3FLCO 3LALA 5AQHA 3RR7A 3MMVA 3IDHA 3E9OA 1NK7A 5AQOA 3FZKA 3LP1A 5JS1A 1W7AA 3ULEA 2P9LB 5F2RA 4CEEA 2XY7A 1BDGA 1DTQA 5M1KA 3R9PA 3MXIA 2KFZA 4IKFA 3VQPA 3R8EA 3VA3A 3ZSQA 5H1SQ 5BN9A 4ZHRA 1X1PA 2ZQBA 1WSFA 3LDQA 2VQFK 4DFKA 4ELUA 1GLEG 2HVIA 4BY9C 4WF9L 4XH5A 1HYZA 1XHZA 3QBXA 5BN8A 3HPOA 5J2QA 4QS9A 4F8RA 4O0JA 2GELA 5M1FA 1TKXA 3I8DA 3QMLA 3CPEA 2QI2A 3MECA 1TL1A 4Q5VA 4CI6A 2FBVA 3B6PA 3L0QA 4CZHA 1HNXK 1ZBHA 4HVJA 1TVRA 4F3OA 3A0IX 3BDPA 2RF2A 4DSKA 3WXMB 3CERA 4CEFA 4B3SK 2IOCA 3A5OC 4Y1CA 3ITHA 4J2BA 4CF9A 4CEDA 2QWRA 1HJOA 1WSHA 3AVJA 3QINA 4CD3A 1LAVA 4DV0K 1BOTO 3DRPA 5GIPA 1NOYA 1R59O 3RRGA 4A57A 1GOAA 3AVCA 3CD6N 5I42A 3CPWM 4N41A 2FC0A 3AVLA 3CCMN 1LWEA 3KVGA 3OYNA 3THYB 4AHTA 1IV0A 2BDPA 2AJQA 3T7ZA 4CK2A 4JI1K 1WSGA 3L4IA 4ELVA 1KAZA 2P9UB 4CE9A 3FFIA 4O4GA 2E1ZA 1SUQA 3C0BA 4KB0A 4B3RK 3ZSYA 4E19A 5AQUA 4DTSA 4BRKA 4LFCK 2P1JA 4OKEA 4Z4CA 3QFUA 2IVPA 2NRWA 4PQUA 3HPGA 4DHYA 3BY5A 2E2OA 2LSNA 4FK2A 2NRTA 4CBWA 1SKRA 2P5OA 4FWMA 2QWOA 4JS4A 2NZTA 3AAPA 3B8AX 4OKJA 4MFBA 1VQ5N 1ZBIA 3UB5A 3P83D 3CC7N 3AO4A 3M8RA 1KVAA 1BQMA 3KK7A 1JLAA 2OPQA 2ZGZA 1FW6A 3CQXA 3VF4A 3AO5A 1QVGM 4CJWA 4CJQA 3SNNA 1NKCA 3WNFA 4X65K 3QNOA 2IAJA 1K8KB 3E9PA 3F9MA 3QNNA 2VGNA 4M41A 3KLIA 4PKGA 3WNGA 2HHQA 3FE1A 3MCPA 3AA2A 3WEEB 3DMJA 3AA4A 2WFBA 3T69A 3AO3A 3HYFA 3VQ5A 2W42A 4DTJA 4I6MA 1VRTA 3OJUA 3O3FA 4JEPA 4O5BA 1YXQA 3KK2A 3SI6A 5I3UA 4FJLA 3T1YK 4W5TA 1NK0A 1XHXA 5AQPA 3OBYA 1KAYA 1ZXOA 3L2RA 1DGKN 4K0KK 4B9MA 3ENBA 3EN9A 3AVHA 4JD2B 3H08A 4DFPA 3PX4A 3MDQA 2NNWA 4DR1K 4JI6K 3VQCA 5CE3A 3DOLA 2FSNA 5AZJA 2BTFA 4WFNL 2ASOA 1RBUA 3FGUA 4FSVA 3SAHA 3SYZA 4DS4A 4GNIA 1RT3A 2R7YA 3PO4A 5AR0A 1BO5O 3F9KA 3DLLL 3O08A 1VQMN 3AY9A 2OTLN 1NG9A 4CESA 4WFAL 1NGHA 3AGRA 1NK8A 4JV5K 4C8NA 4JNEA 1J5OA 4C23A 1C0UA 2OPSA 3EL2A 4DF8A 2YNIA 1IJJA 4BR4A 1CXUA 4KTWA 4QS8A 3D6RA 2DFEA 4CF0A 3TWHA 3NCIA 4Z4IA 2P9IB 5KPTA 1TKZA 2O8FA 2E2NA 5SZTA 2HBLA 2KLAA 3TR8A 3QEXA 1TK5A 1K6YA 5HP1A 3H6EA 4IOCL 3BEXA 3LDOA 1VHXA 3VEZA 4R5PA 4W5QA 2UXCK 1L3TA 3DRRA 2F4VK 2E6MA 1QQOA 4I2PA 3TAEA 1WSJA 3AGKA 3WXIA 1VQ6N 2D4WA 2F9WA 3NDKA 3RR8A 4BRDA 3ZT3A 3DXMA 3SQ2A 4JI2K 4JKBA 3LZJA 4IO9L 4JKGA 5M1QA 4QOZB 2GTDA 1J54A 2YCHA 3OY9A 3VQQA 4FOEA 2D0OA 5AQWA 4BG9A 2D0BA 4CECA 4YOYA 1ILYA 3EZWA 4IG3A 1U2VA 3MEDA 4DMNA 4PKIA 1VQKN 3LP2A 2IC3A 3OA9A 2OZMA 1HPMA 4ZTFA 2UXDK 1BGXT 3HJFA 3J81O 3PSIA 3HM9A 3LPUA 4CGJA 5DM7L 4FJJA 4F4KA 2A1RA 1RTHA 1WB9A 3V81A 5HRPA 3FR0A 1S6QA 2BANA 3AA5X 4RW8A 3LL3A 1BQNA 2P9PA 1VQ9N 1X3MA 1YTAA 3SAGA 3TABA 3J7ZO 4KB1A 3ZETA 4FO0A 4H5RA 1NJZA 4AM7A 3PIOL 5TKWA 4H4OA 4CZKA 3CFOA 1GLBG 2HSTA 2VGMA 5BREA 4FWLA 3VQ7A 3ZEUB 5FLXO 1JXBA 4CHYA 1W9HA 4CJKA 3D0PA 3S9HA 2A6AA 4H5NA 5EOYA 1CZAN 3V1RA 3MWTA 1L5UA 5JVGL 1KC8O 3QLHA 4E1NA 4CJFA 4LD0A 1S9EA 3TAGA 4KREA 5BRDA 1YAGA 3PX6A 4PY5A 1S9GA 2W41A 3H3NO 4EP4A 5FPEA 4J8FA 1TK0A 3DYAA 5CR4A 4MLEA 3ZYYX 4X64K 1FK9A 1YITN 3NF7A 4M7YA 4B3MK 2E6LA 2GBZA 3EY1A 3QEPA 4FJXA 2UXBK 4CGGA 2H3GX 2W6KA 2WC9A 3ID6A 4OLAA 1O1WA 4M3WA 5AFUA 4H5WA 3ZSOA 3CC4N 4CJUA 4DR5K 3ATVA 2NRZA 2IDOA 3NGZA 4FJ5A 4MO5A 3H1QA 5HRNA 5BPMA 4IO8A 4HCBA 4BC5A 1NKEA 1VSFA 5F1XA 4AH9A 4WFBL 3KWIA 1IG8A 1K9MO 4I9LA 3N4PA 4GV3A 3C6UA 1UWBA 2VG6A 4B9UA 1ITGA 1QTMA 1BWFO 1YVUA 1ZBFA 3VGLA 3PX0A 3AVMA 4U67L 4CGDA 4EFHA 3D2FA 3AVBA 3F5TA 4RCHA 5JS2A 4FJIA 4DV4K 3V9ZA 4CZGA 1JCEA 2O8CB 1S5JA 1BL3A 3DLBA 4G1QA 1HNWK 1S1WA 2P9NA 4M45A 3VTIA 1NK4A 4BR2A 3THYA 4M3XA 1YJ9N 4FLUA 4AQYK 1WOQA 3C95A 4FJGA 2XY8A 2CH6A 4FLTA 5ADXA 3OYGA 5KRTA 4B08A 1ZBLA 2FBXA 4BC3A 2IVOA 5AZJB 4B9LA 3FZMA 4CFDA 5AQKA 1BIUA 4W5RA 1ATRA 3L2WA 5D3GA 3BGRA 4KPYA 4KO0A 3I56N 1B9FA 4H5VA 4RTFD 4IDHA 1R0AA 4DV3K 3M8QA 4EZ9A 4RWTA 3TU5A 4A59A 1SS6A 3QDKA 1G15A 3VGKA 2YX6A 3AVIA 1XC9A 2CH5A 5AQTA 3SLCA 3S41A 4BRNA 4BR7A 1NKBA 1S22A 4F9OA 4FJ7A 4BACA 1T3VA 4LH4A 5J2NA 1Q81O 2E1YA 5DMRA 2O8FB 3HVRA 4M42A 4M7XA 3J7YP 4A2AA 4E7LA 5AQSA 1DT9A 3LPTA 4R79A 3DLGA 5CZ2A 1KFSA 4IDKA 3MX2A 4BE2A 1TAQA 4UQGA 3NGYA 3T1HK 1XQSC 3CCVN 5HOOA 1C0MA 4HTUA 2BGGA 1SV5A 3L2VA 1IBLK 2QKKA 4CERA 3RMDA 1ZYQA 1GLJO 3QEVA 3CJ7A 4JKGB 4DV6K 1E4FT 5FPDA 1XNQK 2F96A 4AHUA 2F7TA 5F0XA 1DEJA 2KTQA 2O8DA 4FWNA 4XH1A 1VSDA 5HRSA 1U2VB 2Q97A 3L2UA 2F8SA 3G6EN 1Q82O 3SV4A 1SQKA 2VWJA 4CGIA 1SL2A 2EHGA 2FBYA 1TKTA 4LF9K 4PWDA 3U3YA 3AVKA 2GX9A 1NGBA 2X78A 4N76A 5J2PA 2NRVA 4OPJA 1Q18A 2IGIA 5LY3A 1NGCA 4FWQA 2BUPA 3LZIA 1NJYA 3OS1A 4FK4A 2P9PB 3LDPA 4ELTA 3K9JA 2WTUA 4DR2K 3O4WA 4PL7A 3CXCM 2D0AA 1S1VA 3ZETB 3CCJN 2I7PA 4YORA 1JLCA 1TUUA 3P39A 2KW4A 4BG8A 3OYMA 3K5NA 3KD1E 3KKSA 1WBDA 1VSMA 1W97L 4CK1A 1EQYA 4BWMA 3TTDA 3LP0A 5KPRA 4DU4A 3ZLJA 1VSJA 1HQUA 1VRUA 4CGFA 4B8CA 2YI1A 3DLEA 2NRRA 2X6NA 5AQNA 4FLWA 4CJSA 1VQ8N 3TTFA 1L3SA 3K5OA 1XC3A 3H45C 3O4NA 2QKBA 3UKRA 4GMJB 3P4IA 3VEWA 4LF4K 1KLNA 1D8YA 2NRHA 1HRHA 4OPHA 1J9AA 1RBRA 3VF2A 4I7FA 3ZSRA 4KI4A 2D1KA 3FFKB 3KK3A 3A5LC 3S3OA 3EKSA 1HMVA 5DK5A 1KVCA 2NLXA 1RT2A 3CIPA 1M1KO 2YNFA 4CFCA 4MDAA 4WQ4C 3SV3A 4HHTA 3AARA 3IFRA 1YTUA 4OKKA 1LCUA 2QK9A 3AVNA 1B92A 1Z26A 4CF1A 3HBTA 4CJ3A 3ENOA 3O9UA 1REVA 3QEWA 1IH7A 1MWKA 1VSLA 5BPNA 3QESA 1WUAA 1Z05A 1ASVA 3ZT4A 4FK0A 4YY3K 4YOXA 2OZSA 2JWKA 4ILHA 3VEOA 3K5LA 2ATQA 1T05A 3ZEUA 4O55A 3D2FB 4Y1DA 4FLZA 5AQJA 3VQ4A 5C25A 1S1XA 2V52B 5FRMA 3AVGA 3GE1A 2E8AA 4ISFA 4BRAA 1HX1A 1QZ6A 1GLAG 4CHOA 1KXPA 4JHDA 2QW9A 3NH0A 3IG1A 3BUZB 3ZX0A 4DR3K 3V9XA 4JI3K 4OLBA 3BZCA 4FWOA 2J4RA 3QB0A 4FW1A 3IRXA 5AZIA 2P9NB 3DI6A 4DV1K 4RG8A 2ZJRL 5I9EB 1QQCA 4FPBA 1HNVA 3QICA 3CCSN 1RDDA 2QWQA 3CMEN 5TKYA 4YOTA 4H8KA 1HUXA 3WXLA 5GAHP 4K43A 4CVNE 3ULDA 5E26A 3LDSA 1H1VA 1HNIA 1SL1A 3HK2A 1QS4A 3NH1A 5DM6L 4CJLA 3RMBA 5MLCQ 3DJCA 2A40A 4AM6A 2HHVA 4YDUC 1OVYA 1S1UA 3CI5A 2E5LK 4NB4A 3L8BA 3CJBA 4K25A 4AILC 3ASMA 4FOIA 3ATUA 4LH5A 4BRQA 4DCHA 4NLBA 1NOZA 4CZMA 3C94A 3MXMA 1QSSA 1D5AA 3ALYA 2I7NA 1NGIA 4NCGA 3OS0A 4DS5A 2O4IA 4OGEA 2Y1JA 4LF8K 1Y97A 2IIRA 2UYTA 3CQYA 1T8EA 3A2FA 4PUOA 4KHYA 3VF6A 2Q1NA 3PIPL 1NGDA 2QXLA 1NMNA 2O8CA 4M3YA 2ZM6K 3T1AA 1QHAA 4FM2A 1SKWA 4GVEA 2WUSA 5FRNA 3WQUA 2DFHA 2Q36A 3L4QA 4OPKA 3QIOA 1QZ5A 2FSKA 2G8WA 3AV9A 3AO1A 3PO5A 1S72N 4J2EA 4H0VB 5AQFA 5GIOA 3VQ6A 2OANA 1CXQA 2O8DB 3IKMA 1CZ9A 3AVFA 3L3UA 2G8FA 5KTQA 1U04A 3V9WA 2A42A 3VQAA 3NF9A 4KRFA 4CHNA 3NBPA 1NGFA 1ZC6A 4DB3A 3H1VX 4PKHA 1NGGA 2ZWHA 1XNRK 2GUPA 3VEXA 5KPZA 1TYQA 3CG7A 4GV9A 4Z4HA 3HOTA 1C6VA 4DKWA 1TAUA 4BDPA 4JI4K 3VQDA 3DRSA 4HUGA 3TPQA 1QE1A 3D2EA 5CYQA 1JCFA 2PBDA 1J5EK 1KSPA 1SAZA 2YJFA 3GBTA 4E89A 1IKXA 2IS3A 3DLKA 3MAQA 4LF6K 4JK7A 1IKWA 4M3ZA 3NHGA 2XY6A 3P1GA 4LSNA 4BWJA 3CFRA 5KGWA 2WONA 1EXQA 1UOCA 5JLFA 3M1FA 3OVNA 5HLFA 3VQ8A 2QWLA 2HMPA 4DQPA 4GKKK 3ENHA 3OYJA 4KBOA 4CEQA 1CLQA 3VGMA 3UKRB 4FJNA 4B9VA 4DTMA 4E7IA 1RTIA 1U4BA 3P38A 1WLJA 1BA1A 5JLHA 1YJWN 1RNHA 4EAHD 3THWB 1KTQA 5CHIA 3AVAA 4F2RA 3MEEA 1TKDA 4MO4A 1J53A 4H0TB 1E4GT 4M63C 5CZ1A 3AA3A 1NGAA 4KHQA 4IBNA 2A1SA 2PY5A 1U48A 4DR7K 3CJ9A 3QEIA 4JI0K 3RMAA 3FZLA 3NMUA 2QXFA 3OYAA 3MCAB 3GL1A
chains in the Genus database with same CATH topology
3OYCA 3LANA 3LALA 1X9SA 3RR7A 4FLYA 2Y1IA 1C0TA 4CJVA 4FJMA 4J2AA 5J1EA 5KRSA 1G15A 1HYVA 3AVIA 1NK7A 5JS1A 3LP1A 1XC9A 1X9WA 4CEEA 1WAJA 2XY7A 1NKBA 1DTQA 1BI4B 1W0HA 3KKRA 4BACA 3MXIA 4FJ7A 2KFZA 4IKFA 1DTTA 4LH4A 5J2NA 1JKHA 3ISNC 3VQPA 4CJ4A 3PV8A 3VA3A 3ZSQA 1VSHA 4K8XA 4AHSA 4ZHRA 1X1PA 5DMRA 1EX4A 3T19A 2ZQBA 1WSFA 4FZYA 3HVRA 4M42A 3M8PA 4L8RB 4DFKA 2HNDA 4ELUA 1DLOA 3V6DA 4E7HA 2HVIA 1BCOA 4DQQA 4E7LA 3TAQA 3QERA 1HYZA 1XHZA 3LPTA 2X74A 4KHSA 3HPOA 1JLFA 3O3HA 1HPZA 3DLGA 5J2QA 4F8RA 5CZ2A 4O0JA 2HB5A 4B8AB 4IDKA 4EP5A 4KTZA 1TKXA 3NH2A 4BE2A 3I8DA 5FRMA 1TAQA 4UQGA 3NGYA 3MECA 4DTXA 1TL1A 4Q5VA 2P5GA 1T7PA 2FBVA 3B6PA 3P5JA 1C0MA 1WSEA 4HVJA 4HTUA 1JLBA 1TVRA 3KJVA 1SV5A 3V4IA 4F3OA 2BGGA 4AHRA 3L2VA 2QKKA 3TANA 3BDPA 4CFAA 4QAGA 2RF2A 3KK1A 4CERA 3NE6A 3RMDA 1ZYQA 4DSKA 4CEFA 2JLEA 3QEVA 2IOCA 4Y1CA 3ITHA 3S3MA 4J2BA 1KCFA 5HROA 4CF9A 4DTRA 1IKYA 4CEDA 2F96A 4AHUA 4CEOA 1LW2A 1UAXA 2KTQA 1WSHA 3AVJA 3QINA 4E7JA 1LAVA 4CEBA 3SQ0A 2X6SA 1VSDA 5HRSA 3RRHA 3VN5A 4JLHA 1LAWA 3DRPA 3CM5A 1NOYA 1RDAA 3L2UA 3RRGA 2F8SA 4E0DA 2YHBA 1GOAA 1KFDA 3AVCA 4N5SA 4XIUA 3SV4A 5I42A 4N41A 2FC0A 1ZBUA 1A5VA 5FDLA 4CGIA 3DM2A 2VWJA 3AVLA 1SL2A 2EHGA 4FZZA 3I0SA 2FBYA 1LWEA 4N47A 1GOBA 4DQRA 3OYNA 1TKTA 1VSKA 5HRRA 4AHTA 4PWDA 4KKOA 3U3YA 1XI1A 3AVKA 3ZSXA 4BE0A 3HL8A 3EZ5A 2BDPA 4CK2A 2AJQA 1WSGA 1RT7A 2X78A 4N76A 5J2PA 4FVMA 3RMCA 4DU1A 3VQEA 2HMIA 4GVMA 4OPJA 4C8KA 1N6QA 3LAKA 2IGIA 3IAYA 2G8KA 1KRPA 4ELVA 4CE9A 3FFIA 4O4GA 3LZIA 1NJYA 1SUQA 3OS1A 4KB0A 2P51A 1JXEA 3ZSYA 3K5MA 4E19A 4FK4A 4Z4FA 2EX3A 4DTSA 3F73A 1WN7A 3V1QA 4ELTA 2P1JA 4OKEA 4Z4CA 4FLVA 4KI6A 3G10A 4RW6A 1UA0A 2D0AA 1S1VA 4PQUA 3HPGA 3B6OA 4DSEA 1JLCA 2KW4A 3OYMA 3K5NA 2LSNA 3V9UA 2PYLA 4FK2A 3KD1E 3ZSWA 1SKRA 2P5OA 1TV6A 3KKSA 3ZT2A 4JS4A 3TI0A 1VSMA 4BDZA 4CK1A 4NYFA 3SQ4A 4OKJA 3VQBA 4MFBA 4BWMA 3OS2A 3LP0A 5SWMA 4DU4A 3O3GA 1ZBIA 1RT5A 3P83D 1C1CA 3AO4A 3ZT0A 3KLFA 2RN2A 4DG1A 5CYMA 3M8RA 1KVAA 1BQMA 1VSJA 1GOCA 1JLAA 1LWCA 2G8VA 3T3FA 2OPRA 4Q0BA 1RT4A 1HQUA 2XHBA 1VRUA 3OYIA 4DLGA 1D9FA 2OPQA 4CGFA 1L3VA 4B9TA 3OJSA 4C8LA 4B8CA 2ZD1A 5J2MA 1BISA 3HO1A 4KAZA 1CZBA 3AO5A 4CJWA 4CJQA 3SNNA 1NKCA 3DLEA 1QSLA 3WNFA 2X6NA 3QNOA 2IAJA 1SL0A 2DY4A 4HCCA 1VSIA 4FLWA 4CJSA 3QNNA 3OYFA 4M41A 3KLIA 4YNQA 1L3SA 3TAFA 4HUFA 3K5OA 2XRIA 2KZMA 2ZE2A 3WNGA 2HHQA 3O4NA 2QKBA 3AA2A 4CHQA 4CIEA 2Q3SA 4GMJB 3DMJA 4FJHA 3AA4A 2W42A 4DTJA 3AO3A 3HYFA 4IFYA 3VQ5A 5T7BA 4DFJA 3U3GA 1VRTA 3OJUA 1IG9A 3O3FA 1D8YA 1KLNA 1HRHA 4O5BA 3KK2A 3SI6A 1J9AA 1RBRA 3ZSRA 4I7FA 5I3UA 4FJLA 4KI4A 3KK3A 4W5TA 1JLGA 1NK0A 1KVBA 4CF8A 1XHXA 4FXDA 3S3OA 2YHAA 2OPPA 4CIGA 1Q9XA 2F8TA 3L2RA 3LP3A 1TK8A 2RKIA 1HMVA 3DLRA 4PA1A 3NF6A 3KLEA 5DK5A 1KVCA 2RPIA 5CY4A 3AVHA 1RT2A 4B9MA 4DSLA 4NCBA 4C8MA 4ZTJA 1NJXA 2YNFA 4CFCA 3SPYA 4K8ZA 3H08A 4DFPA 3PX4A 4F3TA 4CCHA 4CK3A 2YKMA 3VQCA 3SV3A 3DOLA 3K58A 4HHTA 2OYQA 1YTUA 1RBUA 4OKKA 2ITGA 3KTQA 3PY8A 2QK9A 2E4LA 3AVNA 4O0IA 1B92A 1Z26A 4CF1A 3SYZA 4DS4A 4BE1A 1RT3A 3SUPA 3SJJA 4CJ3A 4FJ9A 2R7YA 1REVA 3K59A 3QEWA 3PO4A 1IH7A 1VSLA 3F9KA 3QESA 2KFNA 1Q8IA 1ASVA 2GUIA 3ZT4A 4FK0A 2YNHA 3OYKA 4CESA 4CJPA 4Z0UA 1NK8A 5EU7A 2OZSA 4H4MA 5KGXA 1NK6A 4C8NA 2FBTA 3K5LA 2ATQA 1T05A 1J5OA 1C0UA 3CQ8A 2OPSA 3OYLA 4DF8A 1BI4A 2YNIA 4O55A 1CXUA 1I39A 4KTWA 4Y1DA 2VWKA 4CJEA 4FLZA 1A5XA 2DFEA 4CF0A 4DSJA 3TWHA 1C1BA 3VQ4A 5C25A 1XWLA 1S1XA 3NCIA 3V9SA 1RDCA 1TL3A 4NYNA 4CJRA 1TKZA 4CGHA 3AVGA 1IKVA 3JYTA 5SZTA 3THVA 3EYZA 4CHOA 4F2SA 3NH0A 3IG1A 3TR8A 1EP4A 4CEAA 3V9XA 3QEXA 4IG0A 4OLBA 1TK5A 1NK5A 1K6YA 3KLHA 5HP1A 1LWFA 4FW1A 3IRXA 3L3VA 3DI6A 4CIFA 3QO9A 4RG8A 1RT6A 4B9NA 2WOMA 5KI6A 2B4JA 1QQCA 1TGOA 4QCLA 1HNVA 3KLGA 4R5PA 1RDDA 1T03A 3TARA 4W5QA 3RWUA 4H8KA 3WNHA 1L3TA 3DRRA 2E6MA 2PYJA 1HYSA 4I2PA 3ULDA 2Z1GA 3TAEA 2PZSA 1WSJA 3LDSA 1HNIA 3VQ9A 4JRPA 4LSLA 1QS4A 3NH1A 1SL1A 4FJKA 3HK2A 1D9DA 3NDKA 3RR8A 4CJLA 3ZT3A 4FLXA 3RMBA 1SKSA 3SQ2A 3D45A 3LZJA 4N56A 3SZ2A 4KFBA 4OVLA 4QOZB 4DTUA 2G8UA 3SUQA 1J54A 3TAPA 2HHVA 3OY9A 2B5JA 2O4GA 1S1UA 4KHNA 3VQQA 4CHZA 3L8BA 4KREA 2GV9A 4AILC 2D0BA 3IS9A 4E3SA 4CECA 3ASMA 3QIPA 4LH5A 4CHPA 4CF2A 4NCAA 3K2PA 2Z1JA 1BCMA 4IG3A 1BHLA 3MEDA 1NOZA 4DMNA 5FROA 5C24A 2XY5A 1WAFA 3C94A 3ZSZA 4DSFA 3MXMA 1RTDA 1D5AA 4I2QA 3LP2A 2IC3A 1QSSA 4J2DA 2OZMA 1JL2A 3ALYA 4NCGA 3ZT1A 3OS0A 1ASWA 3RTVA 4ZTFA 4DS5A 2DTUA 1BGXT 3HJFA 2O4IA 3PUFA 4DTOA 1JLQA 4DF4A 4OGEA 4JRQA 2Y1JA 4IFVA 3HM9A 3LWMA 1Y97A 3LPUA 4CGJA 4FJJA 4KHYA 1T8EA 3A2FA 1N5YA 4F4KA 4PUOA 4LY7A 2A1RA 1RTHA 4E7KA 3V81A 3C6TA 4ID1A 4O44A 5HRPA 3QETA 1S6QA 2BANA 4I9QA 3AA5X 3CYMA 4RW8A 3OYDA 2KQ2A 4DTNA 1BQNA 3HPHA 4M3YA 1LW0A 1IO2A 4OGCA 4M3RA 3NF8A 3T1AA 5E41A 3JSMA 3I0RA 1YTAA 1C1AA 4DU3A 3TABA 4DWIA 3E01A 4KB1A 4C8OA 4DFMA 1RBVA 4FM2A 4E1MA 1SKWA 2D5RA 4DQSA 1QHTA 1FKPA 4ID5A 3SCXA 5FRNA 1NJZA 3HP6A 4FZXC 2DFHA 3O4QA 4AHVA 4FYDA 4OPKA 2ETJA 3HVTA 4H4OA 3CFOA 3QIOA 3U6FA 2G8WA 3AV9A 4FM1A 3VQ7A 3AO1A 1F21A 3PO5A 1JXBA 1EETA 4ICLA 4CHYA 1W9HA 4DSIA 4J2EA 1WNSA 1HQEA 4CJKA 3VQ6A 3D0PA 3S9HA 3S3NA 4EZ6A 1CXQA 4CEZA 1I3AA 4Z4GA 3V1RA 1CZ9A 1L5UA 1FXXA 3AVFA 3OYHA 3L3UA 3SPZA 2OA8A 2G8FA 3QLHA 4E1NA 4CJFA 4LD0A 1U04A 1S9EA 3WNEA 5KTQA 3TAGA 3G0ZA 4W5OA 3V9WA 3PX6A 1KFSA 3KD5E 4PY5A 2G8HA 3VQAA 1S9GA 4EP4A 4YFUA 3UIQA 1WSIA 3NF9A 3L2QA 4CJTA 2KZZA 1B9DA 4KRFA 4CHNA 3NBPA 1TK0A 3DYAA 4RW9A 3SQ1A 1RILA 4MQ3A 4OJRA 1A5WA 3V1OA 3AO2A 1FK9A 1BIZA 2BE2A 2HNZA 3NF7A 2Z1IA 2HNYA 3CG7A 1VK0A 2E6LA 2GBZA 3EY1A 4FCYA 4Z4HA 3QEPA 4FJXA 1C6VA 3LAMA 4RW4A 4CGGA 3OYEA 2HVHA 1TAUA 1X9MA 4BDPA 2YV0X 3MEGA 4OLAA 3VQDA 1NK9A 2HHWA 4Z4IA 1MU2A 1RBTA 3DRSA 4HUGA 1O1WA 1QE1A 3KIOA 1HJRA 4M3WA 3NFAA 5CYQA 3ZSOA 1VSEA 4CJUA 4W5NA 4M3TA 3TAMA 1UA1A 1NJWA 1KSPA 4B9SA 5C42A 1YT3A 2IDOA 3NGZA 4FJ5A 1RCHA 5HRNA 4KHWA 4HUEA 4E89A 2HW3A 2HHSA 1IKXA 2IS3A 3DLKA 3MAQA 4HCBA 3OYBA 4RW7A 3HP9A 1S1TA 1IKWA 2HHUA 4TSXA 1NKEA 1VSFA 5K14A 3NHGA 2XY6A 1S6PA 5HBMA 4M3ZA 4AH9A 2HHXA 4KHUA 4AHCA 3P1GA 4LSNA 4I9LA 4BWJA 4CJ5A 1U49A 3C6UA 1JLEA 3CFRA 1UWBA 4FM0A 2VG6A 5KGWA 2WONA 1ITGA 3NGIA 4B9UA 1QTMA 1EXQA 3PX0A 1YVUA 1ZBFA 2NUBA 3SUNA 1UOCA 1RBSA 4CFBA 3AVMA 4BDYA 2D0CA 3SUOA 4CGDA 1LV5A 3OVNA 3CM6A 5HLFA 4KTQA 3AVBA 3VQ8A 2DFFA 5JS2A 4DQPA 4FJIA 4DQIA 1FKOA 3OYJA 4CEQA 1EKEA 1Z25A 3V9ZA 1CLQA 4FJNA 3DLHA 4B9VA 4DTPA 1ASUA 1S5JA 2YNGA 3K57A 4DTMA 1BL3A 4E7IA 3DLBA 1KLMA 1RTIA 4G1QA 1U4BA 1WLJA 4Z4EA 1Q9YA 1S1WA 1U47A 1RNHA 4M45A 1NK4A 4FJ8A 1KTQA 4GW6A 2B6AA 3AVAA 3HSTB 4KV8A 3MEEA 4WE1A 3ZCMA 4F2RA 3HT3A 4M3XA 2XO7A 1TKDA 1J53A 4FW2A 4FLUA 1JL1A 2JGUA 3M8SA 2VG5A 4M3UA 3C95A 2YKNA 3AA3A 5CZ1A 4DLEA 1QSYA 4FJGA 1RDBA 4JS5A 2G8IA 2XY8A 4FLTA 4KHQA 1RT1A 3OYGA 4IBNA 4B08A 5KRTA 1ZBLA 2FBXA 3ZSVA 2A1SA 2PY5A 1U48A 4B3OA 3LWLA 4B9LA 4CFDA 3QEIA 1BIUA 1RTJA 2VG7A 3DOKA 1ZBHA 1U45A 3MXJA 4W5RA 3RMAA 3L2WA 2Z1HA 3CFPA 5D3GA 3BGRA 4KPYA 2QXFA 4KO0A 1L3UA 2HHTA 3VA0A 1B9FA 3OYAA 3NAEA 3HXMA 2I5JA 4EZ9A 1R0AA 3M8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYC A;  3LAN A;  3LAL A;  1X9S A;  3RR7 A;  4FLY A;  2Y1I A;  1C0T A;  4CJV A;  4FJM A;  4J2A A;  5J1E A;  5KRS A;  1G15 A;  1HYV A;  3AVI A;  1NK7 A;  5JS1 A;  3LP1 A;  1XC9 A;  1X9W A;  4CEE A;  1WAJ A;  2XY7 A;  1NKB A;  1DTQ A;  1BI4 B;  1W0H A;  3KKR A;  4BAC A;  3MXI A;  4FJ7 A;  2KFZ A;  4IKF A;  1DTT A;  4LH4 A;  5J2N A;  1JKH A;  3ISN C;  3VQP A;  4CJ4 A;  3PV8 A;  3VA3 A;  3ZSQ A;  1VSH A;  4K8X A;  4AHS A;  4ZHR A;  1X1P A;  5DMR A;  1EX4 A;  3T19 A;  2ZQB A;  1WSF A;  4FZY A;  3HVR A;  4M42 A;  3M8P A;  4L8R B;  4DFK A;  2HND A;  4ELU A;  1DLO A;  3V6D A;  4E7H A;  2HVI A;  1BCO A;  4DQQ A;  4E7L A;  3TAQ A;  3QER A;  1HYZ A;  1XHZ A;  3LPT A;  2X74 A;  4KHS A;  3HPO A;  1JLF A;  3O3H A;  1HPZ A;  3DLG A;  5J2Q A;  4F8R A;  5CZ2 A;  4O0J A;  2HB5 A;  4B8A B;  4IDK A;  4EP5 A;  4KTZ A;  1TKX A;  3NH2 A;  4BE2 A;  3I8D A;  5FRM A;  1TAQ A;  4UQG A;  3NGY A;  3MEC A;  4DTX A;  1TL1 A;  4Q5V A;  2P5G A;  1T7P A;  2FBV A;  3B6P A;  3P5J A;  1C0M A;  1WSE A;  4HVJ A;  4HTU A;  1JLB A;  1TVR A;  3KJV A;  1SV5 A;  3V4I A;  4F3O A;  2BGG A;  4AHR A;  3L2V A;  2QKK A;  3TAN A;  3BDP A;  4CFA A;  4QAG A;  2RF2 A;  3KK1 A;  4CER A;  3NE6 A;  3RMD A;  1ZYQ A;  4DSK A;  4CEF A;  2JLE A;  3QEV A;  2IOC A;  4Y1C A;  3ITH A;  3S3M A;  4J2B A;  1KCF A;  5HRO A;  4CF9 A;  4DTR A;  1IKY A;  4CED A;  2F96 A;  4AHU A;  4CEO A;  1LW2 A;  1UAX A;  2KTQ A;  1WSH A;  3AVJ A;  3QIN A;  4E7J A;  1LAV A;  4CEB A;  3SQ0 A;  2X6S A;  1VSD A;  5HRS A;  3RRH A;  3VN5 A;  4JLH A;  1LAW A;  3DRP A;  3CM5 A;  1NOY A;  1RDA A;  3L2U A;  3RRG A;  2F8S A;  4E0D A;  2YHB A;  1GOA A;  1KFD A;  3AVC A;  4N5S A;  4XIU A;  3SV4 A;  5I42 A;  4N41 A;  2FC0 A;  1ZBU A;  1A5V A;  5FDL A;  4CGI A;  3DM2 A;  2VWJ A;  3AVL A;  1SL2 A;  2EHG A;  4FZZ A;  3I0S A;  2FBY A;  1LWE A;  4N47 A;  1GOB A;  4DQR A;  3OYN A;  1TKT A;  1VSK A;  5HRR A;  4AHT A;  4PWD A;  4KKO A;  3U3Y A;  1XI1 A;  3AVK A;  3ZSX A;  4BE0 A;  3HL8 A;  3EZ5 A;  2BDP A;  4CK2 A;  2AJQ A;  1WSG A;  1RT7 A;  2X78 A;  4N76 A;  5J2P A;  4FVM A;  3RMC A;  4DU1 A;  3VQE A;  2HMI A;  4GVM A;  4OPJ A;  4C8K A;  1N6Q A;  3LAK A;  2IGI A;  3IAY A;  2G8K A;  1KRP A;  4ELV A;  4CE9 A;  3FFI A;  4O4G A;  3LZI A;  1NJY A;  1SUQ A;  3OS1 A;  4KB0 A;  2P51 A;  1JXE A;  3ZSY A;  3K5M A;  4E19 A;  4FK4 A;  4Z4F A;  2EX3 A;  4DTS A;  3F73 A;  1WN7 A;  3V1Q A;  4ELT A;  2P1J A;  4OKE A;  4Z4C A;  4FLV A;  4KI6 A;  3G10 A;  4RW6 A;  1UA0 A;  2D0A A;  1S1V A;  4PQU A;  3HPG A;  3B6O A;  4DSE A;  1JLC A;  2KW4 A;  3OYM A;  3K5N A;  2LSN A;  3V9U A;  2PYL A;  4FK2 A;  3KD1 E;  3ZSW A;  1SKR A;  2P5O A;  1TV6 A;  3KKS A;  3ZT2 A;  4JS4 A;  3TI0 A;  1VSM A;  4BDZ A;  4CK1 A;  4NYF A;  3SQ4 A;  4OKJ A;  3VQB A;  4MFB A;  4BWM A;  3OS2 A;  3LP0 A;  5SWM A;  4DU4 A;  3O3G A;  1ZBI A;  1RT5 A;  3P83 D;  1C1C A;  3AO4 A;  3ZT0 A;  3KLF A;  2RN2 A;  4DG1 A;  5CYM A;  3M8R A;  1KVA A;  1BQM A;  1VSJ A;  1GOC A;  1JLA A;  1LWC A;  2G8V A;  3T3F A;  2OPR A;  4Q0B A;  1RT4 A;  1HQU A;  2XHB A;  1VRU A;  3OYI A;  4DLG A;  1D9F A;  2OPQ A;  4CGF A;  1L3V A;  4B9T A;  3OJS A;  4C8L A;  4B8C A;  2ZD1 A;  5J2M A;  1BIS A;  3HO1 A;  4KAZ A;  1CZB A;  3AO5 A;  4CJW A;  4CJQ A;  3SNN A;  1NKC A;  3DLE A;  1QSL A;  3WNF A;  2X6N A;  3QNO A;  2IAJ A;  1SL0 A;  2DY4 A;  4HCC A;  1VSI A;  4FLW A;  4CJS A;  3QNN A;  3OYF A;  4M41 A;  3KLI A;  4YNQ A;  1L3S A;  3TAF A;  4HUF A;  3K5O A;  2XRI A;  2KZM A;  2ZE2 A;  3WNG A;  2HHQ A;  3O4N A;  2QKB A;  3AA2 A;  4CHQ A;  4CIE A;  2Q3S A;  4GMJ B;  3DMJ A;  4FJH A;  3AA4 A;  2W42 A;  4DTJ A;  3AO3 A;  3HYF A;  4IFY A;  3VQ5 A;  5T7B A;  4DFJ A;  3U3G A;  1VRT A;  3OJU A;  1IG9 A;  3O3F A;  1D8Y A;  1KLN A;  1HRH A;  4O5B A;  3KK2 A;  3SI6 A;  1J9A A;  1RBR A;  3ZSR A;  4I7F A;  5I3U A;  4FJL A;  4KI4 A;  3KK3 A;  4W5T A;  1JLG A;  1NK0 A;  1KVB A;  4CF8 A;  1XHX A;  4FXD A;  3S3O A;  2YHA A;  2OPP A;  4CIG A;  1Q9X A;  2F8T A;  3L2R A;  3LP3 A;  1TK8 A;  2RKI A;  1HMV A;  3DLR A;  4PA1 A;  3NF6 A;  3KLE A;  5DK5 A;  1KVC A;  2RPI A;  5CY4 A;  3AVH A;  1RT2 A;  4B9M A;  4DSL A;  4NCB A;  4C8M A;  4ZTJ A;  1NJX A;  2YNF A;  4CFC A;  3SPY A;  4K8Z A;  3H08 A;  4DFP A;  3PX4 A;  4F3T A;  4CCH A;  4CK3 A;  2YKM A;  3VQC A;  3SV3 A;  3DOL A;  3K58 A;  4HHT A;  2OYQ A;  1YTU A;  1RBU A;  4OKK A;  2ITG A;  3KTQ A;  3PY8 A;  2QK9 A;  2E4L A;  3AVN A;  4O0I A;  1B92 A;  1Z26 A;  4CF1 A;  3SYZ A;  4DS4 A;  4BE1 A;  1RT3 A;  3SUP A;  3SJJ A;  4CJ3 A;  4FJ9 A;  2R7Y A;  1REV A;  3K59 A;  3QEW A;  3PO4 A;  1IH7 A;  1VSL A;  3F9K A;  3QES A;  2KFN A;  1Q8I A;  1ASV A;  2GUI A;  3ZT4 A;  4FK0 A;  2YNH A;  3OYK A;  4CES A;  4CJP A;  4Z0U A;  1NK8 A;  5EU7 A;  2OZS A;  4H4M A;  5KGX A;  1NK6 A;  4C8N A;  2FBT A;  3K5L A;  2ATQ A;  1T05 A;  1J5O A;  1C0U A;  3CQ8 A;  2OPS A;  3OYL A;  4DF8 A;  1BI4 A;  2YNI A;  4O55 A;  1CXU A;  1I39 A;  4KTW A;  4Y1D A;  2VWK A;  4CJE A;  4FLZ A;  1A5X A;  2DFE A;  4CF0 A;  4DSJ A;  3TWH A;  1C1B A;  3VQ4 A;  5C25 A;  1XWL A;  1S1X A;  3NCI A;  3V9S A;  1RDC A;  1TL3 A;  4NYN A;  4CJR A;  1TKZ A;  4CGH A;  3AVG A;  1IKV A;  3JYT A;  5SZT A;  3THV A;  3EYZ A;  4CHO A;  4F2S A;  3NH0 A;  3IG1 A;  3TR8 A;  1EP4 A;  4CEA A;  3V9X A;  3QEX A;  4IG0 A;  4OLB A;  1TK5 A;  1NK5 A;  1K6Y A;  3KLH A;  5HP1 A;  1LWF A;  4FW1 A;  3IRX A;  3L3V A;  3DI6 A;  4CIF A;  3QO9 A;  4RG8 A;  1RT6 A;  4B9N A;  2WOM A;  5KI6 A;  2B4J A;  1QQC A;  1TGO A;  4QCL A;  1HNV A;  3KLG A;  4R5P A;  1RDD A;  1T03 A;  3TAR A;  4W5Q A;  3RWU A;  4H8K A;  3WNH A;  1L3T A;  3DRR A;  2E6M A;  2PYJ A;  1HYS A;  4I2P A;  3ULD A;  2Z1G A;  3TAE A;  2PZS A;  1WSJ A;  3LDS A;  1HNI A;  3VQ9 A;  4JRP A;  4LSL A;  1QS4 A;  3NH1 A;  1SL1 A;  4FJK A;  3HK2 A;  1D9D A;  3NDK A;  3RR8 A;  4CJL A;  3ZT3 A;  4FLX A;  3RMB A;  1SKS A;  3SQ2 A;  3D45 A;  3LZJ A;  4N56 A;  3SZ2 A;  4KFB A;  4OVL A;  4QOZ B;  4DTU A;  2G8U A;  3SUQ A;  1J54 A;  3TAP A;  2HHV A;  3OY9 A;  2B5J A;  2O4G A;  1S1U A;  4KHN A;  3VQQ A;  4CHZ A;  3L8B A;  4KRE A;  2GV9 A;  4AIL C;  2D0B A;  3IS9 A;  4E3S A;  4CEC A;  3ASM A;  3QIP A;  4LH5 A;  4CHP A;  4CF2 A;  4NCA A;  3K2P A;  2Z1J A;  1BCM A;  4IG3 A;  1BHL A;  3MED A;  1NOZ A;  4DMN A;  5FRO A;  5C24 A;  2XY5 A;  1WAF A;  3C94 A;  3ZSZ A;  4DSF A;  3MXM A;  1RTD A;  1D5A A;  4I2Q A;  3LP2 A;  2IC3 A;  1QSS A;  4J2D A;  2OZM A;  1JL2 A;  3ALY A;  4NCG A;  3ZT1 A;  3OS0 A;  1ASW A;  3RTV A;  4ZTF A;  4DS5 A;  2DTU A;  1BGX T;  3HJF A;  2O4I A;  3PUF A;  4DTO A;  1JLQ A;  4DF4 A;  4OGE A;  4JRQ A;  2Y1J A;  4IFV A;  3HM9 A;  3LWM A;  1Y97 A;  3LPU A;  4CGJ A;  4FJJ A;  4KHY A;  1T8E A;  3A2F A;  1N5Y A;  4F4K A;  4PUO A;  4LY7 A;  2A1R A;  1RTH A;  4E7K A;  3V81 A;  3C6T A;  4ID1 A;  4O44 A;  5HRP A;  3QET A;  1S6Q A;  2BAN A;  4I9Q A;  3AA5 X;  3CYM A;  4RW8 A;  3OYD A;  2KQ2 A;  4DTN A;  1BQN A;  3HPH A;  4M3Y A;  1LW0 A;  1IO2 A;  4OGC A;  4M3R A;  3NF8 A;  3T1A A;  5E41 A;  3JSM A;  3I0R A;  1YTA A;  1C1A A;  4DU3 A;  3TAB A;  4DWI A;  3E01 A;  4KB1 A;  4C8O A;  4DFM A;  1RBV A;  4FM2 A;  4E1M A;  1SKW A;  2D5R A;  4DQS A;  1QHT A;  1FKP A;  4ID5 A;  3SCX A;  5FRN A;  1NJZ A;  3HP6 A;  4FZX C;  2DFH A;  3O4Q A;  4AHV A;  4FYD A;  4OPK A;  2ETJ A;  3HVT A;  4H4O A;  3CFO A;  3QIO A;  3U6F A;  2G8W A;  3AV9 A;  4FM1 A;  3VQ7 A;  3AO1 A;  1F21 A;  3PO5 A;  1JXB A;  1EET A;  4ICL A;  4CHY A;  1W9H A;  4DSI A;  4J2E A;  1WNS A;  1HQE A;  4CJK A;  3VQ6 A;  3D0P A;  3S9H A;  3S3N A;  4EZ6 A;  1CXQ A;  4CEZ A;  1I3A A;  4Z4G A;  3V1R A;  1CZ9 A;  1L5U A;  1FXX A;  3AVF A;  3OYH A;  3L3U A;  3SPZ A;  2OA8 A;  2G8F A;  3QLH A;  4E1N A;  4CJF A;  4LD0 A;  1U04 A;  1S9E A;  3WNE A;  5KTQ A;  3TAG A;  3G0Z A;  4W5O A;  3V9W A;  3PX6 A;  1KFS A;  3KD5 E;  4PY5 A;  2G8H A;  3VQA A;  1S9G A;  4EP4 A;  4YFU A;  3UIQ A;  1WSI A;  3NF9 A;  3L2Q A;  4CJT A;  2KZZ A;  1B9D A;  4KRF A;  4CHN A;  3NBP A;  1TK0 A;  3DYA A;  4RW9 A;  3SQ1 A;  1RIL A;  4MQ3 A;  4OJR A;  1A5W A;  3V1O A;  3AO2 A;  1FK9 A;  1BIZ A;  2BE2 A;  2HNZ A;  3NF7 A;  2Z1I A;  2HNY A;  3CG7 A;  1VK0 A;  2E6L A;  2GBZ A;  3EY1 A;  4FCY A;  4Z4H A;  3QEP A;  4FJX A;  1C6V A;  3LAM A;  4RW4 A;  4CGG A;  3OYE A;  2HVH A;  1TAU A;  1X9M A;  4BDP A;  2YV0 X;  3MEG A;  4OLA A;  3VQD A;  1NK9 A;  2HHW A;  4Z4I A;  1MU2 A;  1RBT A;  3DRS A;  4HUG A;  1O1W A;  1QE1 A;  3KIO A;  1HJR A;  4M3W A;  3NFA A;  5CYQ A;  3ZSO A;  1VSE A;  4CJU A;  4W5N A;  4M3T A;  3TAM A;  1UA1 A;  1NJW A;  1KSP A;  4B9S A;  5C42 A;  1YT3 A;  2IDO A;  3NGZ A;  4FJ5 A;  1RCH A;  5HRN A;  4KHW A;  4HUE A;  4E89 A;  2HW3 A;  2HHS A;  1IKX A;  2IS3 A;  3DLK A;  3MAQ A;  4HCB A;  3OYB A;  4RW7 A;  3HP9 A;  1S1T A;  1IKW A;  2HHU A;  4TSX A;  1NKE A;  1VSF A;  5K14 A;  3NHG A;  2XY6 A;  1S6P A;  5HBM A;  4M3Z A;  4AH9 A;  2HHX A;  4KHU A;  4AHC A;  3P1G A;  4LSN A;  4I9L A;  4BWJ A;  4CJ5 A;  1U49 A;  3C6U A;  1JLE A;  3CFR A;  1UWB A;  4FM0 A;  2VG6 A;  5KGW A;  2WON A;  1ITG A;  3NGI A;  4B9U A;  1QTM A;  1EXQ A;  3PX0 A;  1YVU A;  1ZBF A;  2NUB A;  3SUN A;  1UOC A;  1RBS A;  4CFB A;  3AVM A;  4BDY A;  2D0C A;  3SUO A;  4CGD A;  1LV5 A;  3OVN A;  3CM6 A;  5HLF A;  4KTQ A;  3AVB A;  3VQ8 A;  2DFF A;  5JS2 A;  4DQP A;  4FJI A;  4DQI A;  1FKO A;  3OYJ A;  4CEQ A;  1EKE A;  1Z25 A;  3V9Z A;  1CLQ A;  4FJN A;  3DLH A;  4B9V A;  4DTP A;  1ASU A;  1S5J A;  2YNG A;  3K57 A;  4DTM A;  1BL3 A;  4E7I A;  3DLB A;  1KLM A;  1RTI A;  4G1Q A;  1U4B A;  1WLJ A;  4Z4E A;  1Q9Y A;  1S1W A;  1U47 A;  1RNH A;  4M45 A;  1NK4 A;  4FJ8 A;  1KTQ A;  4GW6 A;  2B6A A;  3AVA A;  3HST B;  4KV8 A;  3MEE A;  4WE1 A;  3ZCM A;  4F2R A;  3HT3 A;  4M3X A;  2XO7 A;  1TKD A;  1J53 A;  4FW2 A;  4FLU A;  1JL1 A;  2JGU A;  3M8S A;  2VG5 A;  4M3U A;  3C95 A;  2YKN A;  3AA3 A;  5CZ1 A;  4DLE A;  1QSY A;  4FJG A;  1RDB A;  4JS5 A;  2G8I A;  2XY8 A;  4FLT A;  4KHQ A;  1RT1 A;  3OYG A;  4IBN A;  4B08 A;  5KRT A;  1ZBL A;  2FBX A;  3ZSV A;  2A1S A;  2PY5 A;  1U48 A;  4B3O A;  3LWL A;  4B9L A;  4CFD A;  3QEI A;  1BIU A;  1RTJ A;  2VG7 A;  3DOK A;  1ZBH A;  1U45 A;  3MXJ A;  4W5R A;  3RMA A;  3L2W A;  2Z1H A;  3CFP A;  5D3G A;  3BGR A;  4KPY A;  2QXF A;  4KO0 A;  1L3U A;  2HHT A;  3VA0 A;  1B9F A;  3OYA A;  3NAE A;  3HXM A;  2I5J A;  4EZ9 A;  1R0A A;  3M8Q A; 
#chains in the Genus database with same CATH topology
 3LAN A;  1X9S A;  4FLY A;  4CJV A;  5BRH A;  4J2A A;  1K8A O;  5KRS A;  1C0G A;  1X9W A;  4JI7 K;  4YOW A;  2WBN A;  1G99 A;  2HF3 A;  2QEX N;  1IBK K;  1JKH A;  4EHT A;  4AHS A;  4B1Y B;  4GY2 B;  3M8P A;  4JHD B;  2Q0U A;  2QWN A;  4DQQ A;  1X9J A;  3QER A;  1EWR A;  5AZI B;  3NVK A;  2O8B A;  2X74 A;  4KHS A;  3O3H A;  1HPZ A;  4B8A B;  2HB5 A;  3NH2 A;  4EP5 A;  2GEM A;  3CMA N;  3O9S A;  4DV7 K;  4DTX A;  2P5G A;  3DWL A;  3P5J A;  3V4I A;  1WSE A;  4B1V A;  5LL6 Z;  4CFA A;  4A61 A;  2FF6 A;  3VOV A;  2JLE A;  2HBM A;  3S3M A;  1BG3 A;  1YVN A;  2HOE A;  3MN9 A;  1IKY A;  3E66 A;  4CEO A;  3EE9 A;  1UAX A;  1HKB A;  4E7J A;  4CEB A;  2ASP A;  1V4T A;  2X6S A;  3RRH A;  3SBT A;  3VN5 A;  4JLH A;  1LAW A;  3CM5 A;  1RDA A;  1MWM A;  3WXJ A;  4E0D A;  2YHB A;  4JK8 A;  1KFD A;  4B1U B;  3O9T A;  3DM2 A;  4FZZ A;  1GOB A;  5FPM A;  1VSK A;  4BGB A;  4KKO A;  1LOT B;  3ZSX A;  4A62 A;  4BE0 A;  3HL8 A;  3EZ5 A;  4JYA K;  3UE5 A;  3RMC A;  2HMI A;  5LJW A;  4GVM A;  4WQ5 C;  1N6Q A;  4C8K A;  3LAK A;  3IAY A;  2G8K A;  1KRP A;  2P51 A;  4Z4F A;  3K5M A;  2EX3 A;  3RVC A;  1WN7 A;  3V1Q A;  4KI6 A;  4WQ4 A;  1KD1 O;  4K41 A;  4CJ7 A;  1HLU A;  4DSE A;  3ZSW A;  1TV6 A;  3ZT2 A;  5AQY A;  1C0F A;  4NYF A;  3VQB A;  1I94 K;  5SWM A;  1RT5 A;  1C1C A;  3ZT0 A;  3KLF A;  4DG1 A;  5CYM A;  1VQO N;  1GOC A;  1LWC A;  4Q0B A;  1GLF O;  3VEV A;  4DLG A;  1JJ2 M;  1D9F A;  3NVM A;  4C8L A;  3OJS A;  3O80 A;  2V7Z A;  2ZD1 A;  2HBK A;  4KAZ A;  1CZB A;  1QSL A;  4JKE A;  5C2D A;  1SL0 A;  2DY4 A;  1NLV A;  4YNQ A;  2O8E B;  2XRI A;  2ZE2 A;  5C15 A;  4CIE A;  2NRX A;  4FJH A;  5T7B A;  3TSQ A;  2ZGY A;  3FZF A;  4WYB A;  4DR6 K;  1JLG A;  1KVB A;  4CF8 A;  2JWL A;  1TYQ B;  2YHA A;  2OPP A;  4CIG A;  4EIA A;  2CGJ A;  1Q9X A;  1RDW X;  1TK8 A;  2RKI A;  3DLR A;  4LF7 K;  3NF6 A;  3KLE A;  2P9K A;  5CY4 A;  3I33 A;  4JAX A;  4C8M A;  4ZTJ A;  3VET A;  4XH4 A;  3D2E B;  2YKM A;  2A41 A;  1M90 O;  2OYQ A;  1NBW A;  4YHH K;  1NMD A;  2ITG A;  4KH4 A;  2E4L A;  1NM1 A;  3SUP A;  4YDU A;  2ASM A;  2VCP A;  1O13 A;  2KFN A;  1Q8I A;  4MDB A;  3H3O B;  2GUI A;  2YNH A;  3OYK A;  5AQG A;  4CJP A;  5EU7 A;  5KGX A;  1OH8 A;  4BRG A;  4B1X B;  2FBT A;  3CJ1 A;  2CGL A;  3CQ8 A;  3OYL A;  1BI4 A;  4CJE A;  2CGK A;  2W40 A;  3I8B A;  1A5X A;  1P8Z A;  3LM2 A;  4A5B A;  3V9S A;  1UA0 A;  1TL3 A;  4LFA K;  3IMX A;  4CGH A;  3JYT A;  1IKV A;  4JN4 A;  2FF3 B;  3THV A;  3EYZ A;  3O5B A;  1EP4 A;  3VEN A;  1NK5 A;  1KAX A;  3E1Y A;  4JI8 K;  1VQP N;  4CIF A;  3MN7 A;  3QO9 A;  3U4L A;  1RT6 A;  4B9N A;  2B4J A;  3WQT A;  1TGO A;  4FPA A;  4QCL A;  3O9Q A;  1OH6 A;  3RWU A;  5GIN A;  1JCG A;  3K0S A;  3VQ9 A;  4JRP A;  4LSL A;  4BC4 A;  3O1W A;  1ATS A;  1SKS A;  3CHW A;  4N56 A;  3RSE A;  4KFB A;  3SZ2 A;  4OVL A;  4BC2 A;  4DTU A;  4BRM A;  3PLA A;  1GLC G;  4NLC A;  3BZK A;  2B5J A;  2O4G A;  1S3X A;  2E2Q A;  3IS9 A;  4CHP A;  3QIP A;  3K2P A;  2Z1J A;  2UUA K;  5FRO A;  4DSF A;  2ZF5 O;  1NU0 A;  3W0L A;  1ASW A;  3RTV A;  5BRF A;  3PUF A;  5ELZ A;  4DF4 A;  3HM8 A;  2P9S B;  1OH5 A;  4HWI A;  1N5Y A;  4LY7 A;  4IEI A;  3O8M A;  2O8B B;  4ID1 A;  3QET A;  4FWP A;  4QS7 A;  3OYD A;  1HNZ K;  3HPH A;  4OGC A;  1IO2 A;  4M3R A;  1N36 K;  3NF8 A;  3JSM A;  3LDN A;  3SJH A;  4DU3 A;  4Y0W A;  3J7A P;  3E01 A;  3Q7C A;  4C8O A;  3THW A;  2D5R A;  1QHT A;  1FKP A;  1T6D A;  3UKU A;  4B9Q A;  5EY4 A;  3HP6 A;  3O9R A;  4FZX C;  4GV6 A;  4AHV A;  2ETJ A;  2ZJQ L;  4IOX A;  1F21 A;  4DSI A;  1WNS A;  4EZ6 A;  1I3A A;  3HI0 A;  4H0O A;  3SPZ A;  4KHP K;  2RHK A;  5AJ3 K;  3WXK A;  3ID8 A;  3JS6 A;  3KD5 E;  2G8H A;  1ATN A;  3SMS A;  4YFU A;  3UIQ A;  4EHU A;  3MN5 A;  3SQ1 A;  4G9Z A;  4MQ3 A;  4OJR A;  1XMQ K;  1A5W A;  3V1O A;  3MK6 A;  3FZH A;  2BE2 A;  4FWS A;  2Z1I A;  4DUZ K;  4IJN A;  2HNY A;  4BRP A;  1T44 A;  3GDQ A;  4DV2 K;  4FL9 A;  3LAM A;  3OYE A;  1X9M A;  1QQN A;  3JXU A;  3MEG A;  1Q7Y O;  1NK9 A;  5JIC A;  1RBT A;  2OCE A;  1HJR A;  3TAM A;  1NJW A;  4CBX A;  1VQ4 N;  4KHW A;  4HUE A;  2HHS A;  3VEY A;  3OYB A;  4RW7 A;  2V51 B;  1S1T A;  3U8X A;  5AQR A;  2HHU A;  4BQZ A;  1S6P A;  5HBM A;  4E1J A;  4WCE L;  1N8R O;  4KHU A;  4AHC A;  4CJ5 A;  3G4S N;  2YHY A;  3OW2 M;  4DV5 K;  5GAG P;  1VQ7 N;  4AF1 A;  1JLE A;  4FM0 A;  2NUB A;  4BDY A;  1RBS A;  4CFB A;  3Q7B A;  3CM6 A;  3OHR A;  5AQM A;  4FWR A;  1P90 A;  4DQI A;  1FKO A;  4NXM K;  1Z25 A;  2V7Y A;  5KQ8 A;  5M1P A;  4DTP A;  3K57 A;  2YNG A;  1KLM A;  1Q9Y A;  2A5X A;  4H0X B;  4X66 K;  2UUC K;  3C6H A;  4FJ8 A;  4GW6 A;  4WE1 A;  4CZE A;  3HT3 A;  2RE2 A;  4BGA A;  4O8K A;  3M8S A;  4DR4 K;  2P9K B;  2YKN A;  1QSY A;  4DLE A;  4BRI A;  2G8I A;  4LF5 K;  3A5N C;  4LC9 B;  3MN6 A;  4ILJ A;  3VMF B;  5AFU H;  1RTJ A;  3SBG A;  2VG7 A;  1N34 K;  1U45 A;  5M1N A;  4FVU A;  1YF5 L;  1XMO K;  4BRH A;  1L3U A;  3VA0 A;  3QFP A;  4JKC A;  2VYP A;  3G71 N;  2I5J A;  1LW2 A;  3OYC A;  3PSF A;  2QWP A;  2Y1I A;  2BH1 A;  1C0T A;  4FJM A;  3H46 O;  5J1E A;  1HYV A;  2PFU A;  4BRE A;  3BP8 A;  3VTH A;  3HSC A;  1WAJ A;  3QBW A;  1BI4 B;  1W0H A;  3KKR A;  2E2P A;  3KHY A;  1DTT A;  3R1X A;  3ISN C;  3LDL A;  4CJ4 A;  4BR9 A;  3PV8 A;  1VSH A;  4K8X A;  1EX4 A;  1X3N A;  4XEI A;  3T19 A;  4FZY A;  1HR0 K;  5EXW A;  4L8R B;  2DPN A;  2HND A;  3O1B A;  2QA4 N;  1DLO A;  3V6D A;  4WQ5 A;  4E7H A;  1BCO A;  3TAQ A;  1NGJ A;  4ILG B;  3CCQ N;  2O8E A;  1JLF A;  5LMN K;  4KTZ A;  4BR0 A;  5BPL A;  1T7P A;  3CCL N;  3C6A A;  3N4Q A;  4B1W B;  5JMV A;  3DXK A;  1QVF M;  1JLB A;  3KJV A;  4MLH A;  3OBW A;  2Q0R A;  4KH5 A;  4AHR A;  5ADX H;  3TAN A;  3KK1 A;  4QAG A;  3NE6 A;  3THX A;  4DQ8 A;  3RSE B;  4CZI A;  1KCF A;  5HRO A;  1N32 K;  2VQE K;  4DTR A;  2EWS A;  5LMU K;  3SQ0 A;  3SK3 A;  5JVH L;  5AQL A;  4ISG A;  4IJA A;  3C7N A;  5GAE P;  4N5S A;  4XIU A;  1NWK A;  3CF5 L;  5FDL A;  1ZBU A;  1A5V A;  1NGE A;  3I0S A;  4DQR A;  4N47 A;  1VQN N;  2HBJ A;  5M1O A;  5HRR A;  1XI1 A;  1RT7 A;  5B8H A;  3GOI A;  4FVM A;  3WT0 A;  3E9L A;  3VQE A;  4DU1 A;  1MA9 B;  4B1Z A;  1Q86 O;  3ZX3 A;  1JXE A;  2E20 A;  1OH7 A;  3F73 A;  5C2F A;  4FLV A;  2W6L A;  3L6Q A;  1RFQ A;  3G10 A;  2QM1 A;  4RW6 A;  3BF3 A;  3B6O A;  1J6Z A;  4BR5 A;  3V9U A;  2PYL A;  3WUH A;  3UKU B;  3TI0 A;  2QWM A;  1E3M A;  1YIJ N;  1NNE A;  4BDZ A;  3SQ4 A;  3OS2 A;  1YUW A;  3O3G A;  3ULE B;  3CJC A;  2RN2 A;  3I55 N;  5A2Q O;  2G8V A;  3T3F A;  2OPR A;  1RT4 A;  2XHB A;  3OYI A;  1D4X A;  1WBB A;  1L3V A;  4B9T A;  3HO1 A;  5J2M A;  1BIS A;  5AQQ A;  1FJG K;  2UU9 K;  4CZF A;  3C65 A;  2AP1 A;  4HCC A;  1VSI A;  3OYF A;  3AAQ A;  3TAF A;  4HUF A;  2KZM A;  1BA0 A;  3KWG A;  4C1N K;  4CHQ A;  3SAF A;  2Q3S A;  5E84 A;  2ITM A;  5EX5 A;  4IFY A;  4DFJ A;  5BR8 K;  3U3G A;  1IG9 A;  1EWQ A;  2F9T A;  3VER A;  3VPZ A;  4BVO A;  4IEE A;  4IZ9 A;  4FXD A;  2P9S A;  2F8T A;  3LP3 A;  4PA1 A;  3HOS A;  5AQV A;  2YHX A;  2RPI A;  4DSL A;  4DUY K;  4NCB A;  1YHQ N;  1NJX A;  4K8Z A;  3BF1 A;  3SPY A;  4F3T A;  4CCH A;  4CK3 A;  5LJV A;  4KH6 A;  3K58 A;  5GAD P;  3U9Z A;  4YOV A;  3PY8 A;  3KTQ A;  4H03 B;  4O0I A;  3A5M C;  3EO3 A;  5IWA K;  4BE1 A;  3SJJ A;  4FJ9 A;  4CBU A;  4H0Y B;  3K59 A;  4V19 S;  4O8U A;  4JKF A;  2FSJ A;  4Z0U A;  5BR9 A;  2OTJ N;  4BQL A;  4H4M A;  1NK6 A;  3W3D A;  2YHW A;  4IFE A;  1RGI A;  5HL7 L;  2P9L A;  1I39 A;  2VWK A;  3HRG A;  3GG4 A;  1BUP A;  4DSJ A;  1C1B A;  4IWV A;  1XWL A;  1RDC A;  3MWP A;  4NYN A;  4CJR A;  2IVN A;  4F2S A;  4H5T A;  3EE8 A;  4OO1 J;  4CEA A;  4IG0 A;  3KLH A;  1LWF A;  3L3V A;  3U9D A;  4K42 A;  1N33 K;  5AQX A;  2WOM A;  3R3L A;  5KI6 A;  3KLG A;  2FXU A;  1T03 A;  4FWK A;  3TAR A;  3VES A;  3WNH A;  2UUB K;  4NO7 A;  2PYJ A;  1HYS A;  3CJA A;  2Z1G A;  2PZS A;  2Q31 A;  4A2B A;  2QTD A;  4FJK A;  4UY8 O;  5C10 A;  5IT9 O;  1D9D A;  4B3T K;  4FLX A;  1TUY A;  3D45 A;  2D0P A;  3G25 A;  3J8A A;  2G8U A;  1ZBS A;  3SUQ A;  3TAP A;  3J80 O;  4KHN A;  4CHZ A;  2GV9 A;  4CZJ A;  4E3S A;  4CF2 A;  4LFB K;  4NCA A;  1BCM A;  4L3Q A;  1BHL A;  5C24 A;  2XY5 A;  4OPA A;  1WAF A;  3ZSZ A;  1W2B M;  1RTD A;  4I6M B;  4BRL A;  4I2Q A;  4J2D A;  1JL2 A;  3ZT1 A;  2DTU A;  3P31 A;  1NJI O;  4DTO A;  1JLQ A;  3JAM O;  4C1N I;  4JRQ A;  3CC2 N;  4IFV A;  4YOU A;  3LWM A;  1MDU B;  3CCR N;  1YJN N;  4E7K A;  3O6W A;  1HKC A;  2P9U A;  3C6T A;  4O44 A;  4I9Q A;  3CYM A;  2KQ2 A;  4DTN A;  3HZ6 A;  1LW0 A;  3CCE N;  5E41 A;  3I0R A;  2VWB A;  4GKJ K;  1C1A A;  4DWI A;  3K9K A;  3EKU A;  2ZJP L;  4DFM A;  1RBV A;  1V4S A;  4E1M A;  3DXK B;  4DQS A;  4ID5 A;  4JKA A;  1BU6 O;  3SCX A;  3O4Q A;  1EO1 A;  4FYD A;  3THX B;  3HVT A;  3U6F A;  1OKJ A;  3M3Z A;  4PHT X;  4FM1 A;  1T6C A;  2YJE A;  1EET A;  3D7E O;  4ICL A;  2GWK A;  4CW7 B;  1HQE A;  3S3N A;  4BRF A;  3M5R A;  4CEZ A;  4Z4G A;  1FXX A;  4IOA L;  3ZX2 A;  3OYH A;  3M6G A;  3MX5 A;  2OA8 A;  4O5F A;  3C7N B;  1K8K A;  3WNE A;  3G0Z A;  4W5O A;  2KHO A;  3OTO K;  1QQM A;  1WSI A;  3L2Q A;  4CJT A;  3WEE A;  2KZZ A;  1B9D A;  2FLO A;  5AQI A;  4RW9 A;  1RIL A;  1XUP O;  3AO2 A;  4CZL A;  5C0Y A;  1BIZ A;  2HNZ A;  4IXC A;  1VK0 A;  4JKH A;  4FCY A;  4RW4 A;  3KZB A;  1SZ2 A;  2HVH A;  2YV0 X;  3DXM B;  3TSU A;  2HHW A;  4JD2 A;  1MU2 A;  4JK9 A;  3KIO A;  1KQS M;  3F2K A;  4H0P A;  3NFA A;  1VSE A;  4W5N A;  5C12 A;  4M3T A;  4BRO A;  1UA1 A;  2GWJ A;  1GLD G;  1ESV A;  5KQD A;  1OVQ A;  4PL8 A;  5C42 A;  1YT3 A;  4B9S A;  2AA4 A;  1Y64 A;  1RCH A;  4JI5 K;  2HW3 A;  2Q2R A;  2HF4 A;  3HP9 A;  4TSX A;  4BVP A;  5K14 A;  4BRC A;  2HHX A;  1U49 A;  4A5A A;  1DKG D;  3R6M A;  2E88 A;  2PAV A;  3TSP A;  3NGI A;  4ISE A;  3SUN A;  3IUC A;  1RDU A;  2D0C A;  3SUO A;  1YI2 N;  3CET A;  1LV5 A;  1GLL O;  4KTQ A;  2DFF A;  2HHH K;  3A8Y A;  3CCU N;  1HKG A;  1EKE A;  2P9I A;  5FPN A;  3DAW A;  3DLH A;  4JKD A;  1ASU A;  4CD1 A;  2KKZ A;  3HTV A;  4OX9 K;  4Z4E A;  3EEQ A;  1VAZ A;  1U47 A;  1IBM K;  2A3Z A;  4KV8 A;  2B6A A;  3HST B;  3ZCM A;  3TTC A;  2XO7 A;  4FW2 A;  1JL1 A;  2JGU A;  2VG5 A;  4M3U A;  3LM9 A;  1RDB A;  4JS5 A;  1VQL N;  1RT1 A;  3ZSV A;  4B3O A;  3LWL A;  1K73 O;  5EVZ A;  3DOK A;  3MXJ A;  4X62 K;  1U6Z A;  5AQZ A;  2Z1H A;  3CFP A;  4U7B A;  2HHT A;  3SMP A;  4HTL A;  3NAE A;  4NXN K;  3HXM A;  1Z6R A;  4Z94 A;  3FLC O;  3LAL A;  5AQH A;  3RR7 A;  3MMV A;  3IDH A;  3E9O A;  1NK7 A;  5AQO A;  3FZK A;  3LP1 A;  5JS1 A;  1W7A A;  3ULE A;  2P9L B;  5F2R A;  4CEE A;  2XY7 A;  1BDG A;  1DTQ A;  5M1K A;  3R9P A;  3MXI A;  2KFZ A;  4IKF A;  3VQP A;  3R8E A;  3VA3 A;  3ZSQ A;  5H1S Q;  5BN9 A;  4ZHR A;  1X1P A;  2ZQB A;  1WSF A;  3LDQ A;  2VQF K;  4DFK A;  4ELU A;  1GLE G;  2HVI A;  4BY9 C;  4WF9 L;  4XH5 A;  1HYZ A;  1XHZ A;  3QBX A;  5BN8 A;  3HPO A;  5J2Q A;  4QS9 A;  4F8R A;  4O0J A;  2GEL A;  5M1F A;  1TKX A;  3I8D A;  3QML A;  3CPE A;  2QI2 A;  3MEC A;  1TL1 A;  4Q5V A;  4CI6 A;  2FBV A;  3B6P A;  3L0Q A;  4CZH A;  1HNX K;  1ZBH A;  4HVJ A;  1TVR A;  4F3O A;  3A0I X;  3BDP A;  2RF2 A;  4DSK A;  3WXM B;  3CER A;  4CEF A;  4B3S K;  2IOC A;  3A5O C;  4Y1C A;  3ITH A;  4J2B A;  4CF9 A;  4CED A;  2QWR A;  1HJO A;  1WSH A;  3AVJ A;  3QIN A;  4CD3 A;  1LAV A;  4DV0 K;  1BOT O;  3DRP A;  5GIP A;  1NOY A;  1R59 O;  3RRG A;  4A57 A;  1GOA A;  3AVC A;  3CD6 N;  5I42 A;  3CPW M;  4N41 A;  2FC0 A;  3AVL A;  3CCM N;  1LWE A;  3KVG A;  3OYN A;  3THY B;  4AHT A;  1IV0 A;  2BDP A;  2AJQ A;  3T7Z A;  4CK2 A;  4JI1 K;  1WSG A;  3L4I A;  4ELV A;  1KAZ A;  2P9U B;  4CE9 A;  3FFI A;  4O4G A;  2E1Z A;  1SUQ A;  3C0B A;  4KB0 A;  4B3R K;  3ZSY A;  4E19 A;  5AQU A;  4DTS A;  4BRK A;  4LFC K;  2P1J A;  4OKE A;  4Z4C A;  3QFU A;  2IVP A;  2NRW A;  4PQU A;  3HPG A;  4DHY A;  3BY5 A;  2E2O A;  2LSN A;  4FK2 A;  2NRT A;  4CBW A;  1SKR A;  2P5O A;  4FWM A;  2QWO A;  4JS4 A;  2NZT A;  3AAP A;  3B8A X;  4OKJ A;  4MFB A;  1VQ5 N;  1ZBI A;  3UB5 A;  3P83 D;  3CC7 N;  3AO4 A;  3M8R A;  1KVA A;  1BQM A;  3KK7 A;  1JLA A;  2OPQ A;  2ZGZ A;  1FW6 A;  3CQX A;  3VF4 A;  3AO5 A;  1QVG M;  4CJW A;  4CJQ A;  3SNN A;  1NKC A;  3WNF A;  4X65 K;  3QNO A;  2IAJ A;  1K8K B;  3E9P A;  3F9M A;  3QNN A;  2VGN A;  4M41 A;  3KLI A;  4PKG A;  3WNG A;  2HHQ A;  3FE1 A;  3MCP A;  3AA2 A;  3WEE B;  3DMJ A;  3AA4 A;  2WFB A;  3T69 A;  3AO3 A;  3HYF A;  3VQ5 A;  2W42 A;  4DTJ A;  4I6M A;  1VRT A;  3OJU A;  3O3F A;  4JEP A;  4O5B A;  1YXQ A;  3KK2 A;  3SI6 A;  5I3U A;  4FJL A;  3T1Y K;  4W5T A;  1NK0 A;  1XHX A;  5AQP A;  3OBY A;  1KAY A;  1ZXO A;  3L2R A;  1DGK N;  4K0K K;  4B9M A;  3ENB A;  3EN9 A;  3AVH A;  4JD2 B;  3H08 A;  4DFP A;  3PX4 A;  3MDQ A;  2NNW A;  4DR1 K;  4JI6 K;  3VQC A;  5CE3 A;  3DOL A;  2FSN A;  5AZJ A;  2BTF A;  4WFN L;  2ASO A;  1RBU A;  3FGU A;  4FSV A;  3SAH A;  3SYZ A;  4DS4 A;  4GNI A;  1RT3 A;  2R7Y A;  3PO4 A;  5AR0 A;  1BO5 O;  3F9K A;  3DLL L;  3O08 A;  1VQM N;  3AY9 A;  2OTL N;  1NG9 A;  4CES A;  4WFA L;  1NGH A;  3AGR A;  1NK8 A;  4JV5 K;  4C8N A;  4JNE A;  1J5O A;  4C23 A;  1C0U A;  2OPS A;  3EL2 A;  4DF8 A;  2YNI A;  1IJJ A;  4BR4 A;  1CXU A;  4KTW A;  4QS8 A;  3D6R A;  2DFE A;  4CF0 A;  3TWH A;  3NCI A;  4Z4I A;  2P9I B;  5KPT A;  1TKZ A;  2O8F A;  2E2N A;  5SZT A;  2HBL A;  2KLA A;  3TR8 A;  3QEX A;  1TK5 A;  1K6Y A;  5HP1 A;  3H6E A;  4IOC L;  3BEX A;  3LDO A;  1VHX A;  3VEZ A;  4R5P A;  4W5Q A;  2UXC K;  1L3T A;  3DRR A;  2F4V K;  2E6M A;  1QQO A;  4I2P A;  3TAE A;  1WSJ A;  3AGK A;  3WXI A;  1VQ6 N;  2D4W A;  2F9W A;  3NDK A;  3RR8 A;  4BRD A;  3ZT3 A;  3DXM A;  3SQ2 A;  4JI2 K;  4JKB A;  3LZJ A;  4IO9 L;  4JKG A;  5M1Q A;  4QOZ B;  2GTD A;  1J54 A;  2YCH A;  3OY9 A;  3VQQ A;  4FOE A;  2D0O A;  5AQW A;  4BG9 A;  2D0B A;  4CEC A;  4YOY A;  1ILY A;  3EZW A;  4IG3 A;  1U2V A;  3MED A;  4DMN A;  4PKI A;  1VQK N;  3LP2 A;  2IC3 A;  3OA9 A;  2OZM A;  1HPM A;  4ZTF A;  2UXD K;  1BGX T;  3HJF A;  3J81 O;  3PSI A;  3HM9 A;  3LPU A;  4CGJ A;  5DM7 L;  4FJJ A;  4F4K A;  2A1R A;  1RTH A;  1WB9 A;  3V81 A;  5HRP A;  3FR0 A;  1S6Q A;  2BAN A;  3AA5 X;  4RW8 A;  3LL3 A;  1BQN A;  2P9P A;  1VQ9 N;  1X3M A;  1YTA A;  3SAG A;  3TAB A;  3J7Z O;  4KB1 A;  3ZET A;  4FO0 A;  4H5R A;  1NJZ A;  4AM7 A;  3PIO L;  5TKW A;  4H4O A;  4CZK A;  3CFO A;  1GLB G;  2HST A;  2VGM A;  5BRE A;  4FWL A;  3VQ7 A;  3ZEU B;  5FLX O;  1JXB A;  4CHY A;  1W9H A;  4CJK A;  3D0P A;  3S9H A;  2A6A A;  4H5N A;  5EOY A;  1CZA N;  3V1R A;  3MWT A;  1L5U A;  5JVG L;  1KC8 O;  3QLH A;  4E1N A;  4CJF A;  4LD0 A;  1S9E A;  3TAG A;  4KRE A;  5BRD A;  1YAG A;  3PX6 A;  4PY5 A;  1S9G A;  2W41 A;  3H3N O;  4EP4 A;  5FPE A;  4J8F A;  1TK0 A;  3DYA A;  5CR4 A;  4MLE A;  3ZYY X;  4X64 K;  1FK9 A;  1YIT N;  3NF7 A;  4M7Y A;  4B3M K;  2E6L A;  2GBZ A;  3EY1 A;  3QEP A;  4FJX A;  2UXB K;  4CGG A;  2H3G X;  2W6K A;  2WC9 A;  3ID6 A;  4OLA A;  1O1W A;  4M3W A;  5AFU A;  4H5W A;  3ZSO A;  3CC4 N;  4CJU A;  4DR5 K;  3ATV A;  2NRZ A;  2IDO A;  3NGZ A;  4FJ5 A;  4MO5 A;  3H1Q A;  5HRN A;  5BPM A;  4IO8 A;  4HCB A;  4BC5 A;  1NKE A;  1VSF A;  5F1X A;  4AH9 A;  4WFB L;  3KWI A;  1IG8 A;  1K9M O;  4I9L A;  3N4P A;  4GV3 A;  3C6U A;  1UWB A;  2VG6 A;  4B9U A;  1ITG A;  1QTM A;  1BWF O;  1YVU A;  1ZBF A;  3VGL A;  3PX0 A;  3AVM A;  4U67 L;  4CGD A;  4EFH A;  3D2F A;  3AVB A;  3F5T A;  4RCH A;  5JS2 A;  4FJI A;  4DV4 K;  3V9Z A;  4CZG A;  1JCE A;  2O8C B;  1S5J A;  1BL3 A;  3DLB A;  4G1Q A;  1HNW K;  1S1W A;  2P9N A;  4M45 A;  3VTI A;  1NK4 A;  4BR2 A;  3THY A;  4M3X A;  1YJ9 N;  4FLU A;  4AQY K;  1WOQ A;  3C95 A;  4FJG A;  2XY8 A;  2CH6 A;  4FLT A;  5ADX A;  3OYG A;  5KRT A;  4B08 A;  1ZBL A;  2FBX A;  4BC3 A;  2IVO A;  5AZJ B;  4B9L A;  3FZM A;  4CFD A;  5AQK A;  1BIU A;  4W5R A;  1ATR A;  3L2W A;  5D3G A;  3BGR A;  4KPY A;  4KO0 A;  3I56 N;  1B9F A;  4H5V A;  4RTF D;  4IDH A;  1R0A A;  4DV3 K;  3M8Q A;  4EZ9 A;  4RWT A;  3TU5 A;  4A59 A;  1SS6 A;  3QDK A;  1G15 A;  3VGK A;  2YX6 A;  3AVI A;  1XC9 A;  2CH5 A;  5AQT A;  3SLC A;  3S41 A;  4BRN A;  4BR7 A;  1NKB A;  1S22 A;  4F9O A;  4FJ7 A;  4BAC A;  1T3V A;  4LH4 A;  5J2N A;  1Q81 O;  2E1Y A;  5DMR A;  2O8F B;  3HVR A;  4M42 A;  4M7X A;  3J7Y P;  4A2A A;  4E7L A;  5AQS A;  1DT9 A;  3LPT A;  4R79 A;  3DLG A;  5CZ2 A;  1KFS A;  4IDK A;  3MX2 A;  4BE2 A;  1TAQ A;  4UQG A;  3NGY A;  3T1H K;  1XQS C;  3CCV N;  5HOO A;  1C0M A;  4HTU A;  2BGG A;  1SV5 A;  3L2V A;  1IBL K;  2QKK A;  4CER A;  3RMD A;  1ZYQ A;  1GLJ O;  3QEV A;  3CJ7 A;  4JKG B;  4DV6 K;  1E4F T;  5FPD A;  1XNQ K;  2F96 A;  4AHU A;  2F7T A;  5F0X A;  1DEJ A;  2KTQ A;  2O8D A;  4FWN A;  4XH1 A;  1VSD A;  5HRS A;  1U2V B;  2Q97 A;  3L2U A;  2F8S A;  3G6E N;  1Q82 O;  3SV4 A;  1SQK A;  2VWJ A;  4CGI A;  1SL2 A;  2EHG A;  2FBY A;  1TKT A;  4LF9 K;  4PWD A;  3U3Y A;  3AVK A;  2GX9 A;  1NGB A;  2X78 A;  4N76 A;  5J2P A;  2NRV A;  4OPJ A;  1Q18 A;  2IGI A;  5LY3 A;  1NGC A;  4FWQ A;  2BUP A;  3LZI A;  1NJY A;  3OS1 A;  4FK4 A;  2P9P B;  3LDP A;  4ELT A;  3K9J A;  2WTU A;  4DR2 K;  3O4W A;  4PL7 A;  3CXC M;  2D0A A;  1S1V A;  3ZET B;  3CCJ N;  2I7P A;  4YOR A;  1JLC A;  1TUU A;  3P39 A;  2KW4 A;  4BG8 A;  3OYM A;  3K5N A;  3KD1 E;  3KKS A;  1WBD A;  1VSM A;  1W97 L;  4CK1 A;  1EQY A;  4BWM A;  3TTD A;  3LP0 A;  5KPR A;  4DU4 A;  3ZLJ A;  1VSJ A;  1HQU A;  1VRU A;  4CGF A;  4B8C A;  2YI1 A;  3DLE A;  2NRR A;  2X6N A;  5AQN A;  4FLW A;  4CJS A;  1VQ8 N;  3TTF A;  1L3S A;  3K5O A;  1XC3 A;  3H45 C;  3O4N A;  2QKB A;  3UKR A;  4GMJ B;  3P4I A;  3VEW A;  4LF4 K;  1KLN A;  1D8Y A;  2NRH A;  1HRH A;  4OPH A;  1J9A A;  1RBR A;  3VF2 A;  4I7F A;  3ZSR A;  4KI4 A;  2D1K A;  3FFK B;  3KK3 A;  3A5L C;  3S3O A;  3EKS A;  1HMV A;  5DK5 A;  1KVC A;  2NLX A;  1RT2 A;  3CIP A;  1M1K O;  2YNF A;  4CFC A;  4MDA A;  4WQ4 C;  3SV3 A;  4HHT A;  3AAR A;  3IFR A;  1YTU A;  4OKK A;  1LCU A;  2QK9 A;  3AVN A;  1B92 A;  1Z26 A;  4CF1 A;  3HBT A;  4CJ3 A;  3ENO A;  3O9U A;  1REV A;  3QEW A;  1IH7 A;  1MWK A;  1VSL A;  5BPN A;  3QES A;  1WUA A;  1Z05 A;  1ASV A;  3ZT4 A;  4FK0 A;  4YY3 K;  4YOX A;  2OZS A;  2JWK A;  4ILH A;  3VEO A;  3K5L A;  2ATQ A;  1T05 A;  3ZEU A;  4O55 A;  3D2F B;  4Y1D A;  4FLZ A;  5AQJ A;  3VQ4 A;  5C25 A;  1S1X A;  2V52 B;  5FRM A;  3AVG A;  3GE1 A;  2E8A A;  4ISF A;  4BRA A;  1HX1 A;  1QZ6 A;  1GLA G;  4CHO A;  1KXP A;  4JHD A;  2QW9 A;  3NH0 A;  3IG1 A;  3BUZ B;  3ZX0 A;  4DR3 K;  3V9X A;  4JI3 K;  4OLB A;  3BZC A;  4FWO A;  2J4R A;  3QB0 A;  4FW1 A;  3IRX A;  5AZI A;  2P9N B;  3DI6 A;  4DV1 K;  4RG8 A;  2ZJR L;  5I9E B;  1QQC A;  4FPB A;  1HNV A;  3QIC A;  3CCS N;  1RDD A;  2QWQ A;  3CME N;  5TKY A;  4YOT A;  4H8K A;  1HUX A;  3WXL A;  5GAH P;  4K43 A;  4CVN E;  3ULD A;  5E26 A;  3LDS A;  1H1V A;  1HNI A;  1SL1 A;  3HK2 A;  1QS4 A;  3NH1 A;  5DM6 L;  4CJL A;  3RMB A;  5MLC Q;  3DJC A;  2A40 A;  4AM6 A;  2HHV A;  4YDU C;  1OVY A;  1S1U A;  3CI5 A;  2E5L K;  4NB4 A;  3L8B A;  3CJB A;  4K25 A;  4AIL C;  3ASM A;  4FOI A;  3ATU A;  4LH5 A;  4BRQ A;  4DCH A;  4NLB A;  1NOZ A;  4CZM A;  3C94 A;  3MXM A;  1QSS A;  1D5A A;  3ALY A;  2I7N A;  1NGI A;  4NCG A;  3OS0 A;  4DS5 A;  2O4I A;  4OGE A;  2Y1J A;  4LF8 K;  1Y97 A;  2IIR A;  2UYT A;  3CQY A;  1T8E A;  3A2F A;  4PUO A;  4KHY A;  3VF6 A;  2Q1N A;  3PIP L;  1NGD A;  2QXL A;  1NMN A;  2O8C A;  4M3Y A;  2ZM6 K;  3T1A A;  1QHA A;  4FM2 A;  1SKW A;  4GVE A;  2WUS A;  5FRN A;  3WQU A;  2DFH A;  2Q36 A;  3L4Q A;  4OPK A;  3QIO A;  1QZ5 A;  2FSK A;  2G8W A;  3AV9 A;  3AO1 A;  3PO5 A;  1S72 N;  4J2E A;  4H0V B;  5AQF A;  5GIO A;  3VQ6 A;  2OAN A;  1CXQ A;  2O8D B;  3IKM A;  1CZ9 A;  3AVF A;  3L3U A;  2G8F A;  5KTQ A;  1U04 A;  3V9W A;  2A42 A;  3VQA A;  3NF9 A;  4KRF A;  4CHN A;  3NBP A;  1NGF A;  1ZC6 A;  4DB3 A;  3H1V X;  4PKH A;  1NGG A;  2ZWH A;  1XNR K;  2GUP A;  3VEX A;  5KPZ A;  1TYQ A;  3CG7 A;  4GV9 A;  4Z4H A;  3HOT A;  1C6V A;  4DKW A;  1TAU A;  4BDP A;  4JI4 K;  3VQD A;  3DRS A;  4HUG A;  3TPQ A;  1QE1 A;  3D2E A;  5CYQ A;  1JCF A;  2PBD A;  1J5E K;  1KSP A;  1SAZ A;  2YJF A;  3GBT A;  4E89 A;  1IKX A;  2IS3 A;  3DLK A;  3MAQ A;  4LF6 K;  4JK7 A;  1IKW A;  4M3Z A;  3NHG A;  2XY6 A;  3P1G A;  4LSN A;  4BWJ A;  3CFR A;  5KGW A;  2WON A;  1EXQ A;  1UOC A;  5JLF A;  3M1F A;  3OVN A;  5HLF A;  3VQ8 A;  2QWL A;  2HMP A;  4DQP A;  4GKK K;  3ENH A;  3OYJ A;  4KBO A;  4CEQ A;  1CLQ A;  3VGM A;  3UKR B;  4FJN A;  4B9V A;  4DTM A;  4E7I A;  1RTI A;  1U4B A;  3P38 A;  1WLJ A;  1BA1 A;  5JLH A;  1YJW N;  1RNH A;  4EAH D;  3THW B;  1KTQ A;  5CHI A;  3AVA A;  4F2R A;  3MEE A;  1TKD A;  4MO4 A;  1J53 A;  4H0T B;  1E4G T;  4M63 C;  5CZ1 A;  3AA3 A;  1NGA A;  4KHQ A;  4IBN A;  2A1S A;  2PY5 A;  1U48 A;  4DR7 K;  3CJ9 A;  3QEI A;  4JI0 K;  3RMA A;  3FZL A;  3NMU A;  2QXF A;  3OYA A;  3MCA B;  3GL1 A; 
#chains in the Genus database with same CATH homology
 3OYC A;  3LAN A;  3LAL A;  1X9S A;  3RR7 A;  4FLY A;  2Y1I A;  1C0T A;  4CJV A;  4FJM A;  4J2A A;  5J1E A;  5KRS A;  1G15 A;  1HYV A;  3AVI A;  1NK7 A;  5JS1 A;  3LP1 A;  1XC9 A;  1X9W A;  4CEE A;  1WAJ A;  2XY7 A;  1NKB A;  1DTQ A;  1BI4 B;  1W0H A;  3KKR A;  4BAC A;  3MXI A;  4FJ7 A;  2KFZ A;  4IKF A;  1DTT A;  4LH4 A;  5J2N A;  1JKH A;  3ISN C;  3VQP A;  4CJ4 A;  3PV8 A;  3VA3 A;  3ZSQ A;  1VSH A;  4K8X A;  4AHS A;  4ZHR A;  1X1P A;  5DMR A;  1EX4 A;  3T19 A;  2ZQB A;  1WSF A;  4FZY A;  3HVR A;  4M42 A;  3M8P A;  4L8R B;  4DFK A;  2HND A;  4ELU A;  1DLO A;  3V6D A;  4E7H A;  2HVI A;  1BCO A;  4DQQ A;  4E7L A;  3TAQ A;  3QER A;  1HYZ A;  1XHZ A;  3LPT A;  2X74 A;  4KHS A;  3HPO A;  1JLF A;  3O3H A;  1HPZ A;  3DLG A;  5J2Q A;  4F8R A;  5CZ2 A;  4O0J A;  2HB5 A;  4B8A B;  4IDK A;  4EP5 A;  4KTZ A;  1TKX A;  3NH2 A;  4BE2 A;  3I8D A;  5FRM A;  1TAQ A;  4UQG A;  3NGY A;  3MEC A;  4DTX A;  1TL1 A;  4Q5V A;  2P5G A;  1T7P A;  2FBV A;  3B6P A;  3P5J A;  1C0M A;  1WSE A;  4HVJ A;  4HTU A;  1JLB A;  1TVR A;  3KJV A;  1SV5 A;  3V4I A;  4F3O A;  2BGG A;  4AHR A;  3L2V A;  2QKK A;  3TAN A;  3BDP A;  4CFA A;  4QAG A;  2RF2 A;  3KK1 A;  4CER A;  3NE6 A;  3RMD A;  1ZYQ A;  4DSK A;  4CEF A;  2JLE A;  3QEV A;  2IOC A;  4Y1C A;  3ITH A;  3S3M A;  4J2B A;  1KCF A;  5HRO A;  4CF9 A;  4DTR A;  1IKY A;  4CED A;  2F96 A;  4AHU A;  4CEO A;  1LW2 A;  1UAX A;  2KTQ A;  1WSH A;  3AVJ A;  3QIN A;  4E7J A;  1LAV A;  4CEB A;  3SQ0 A;  2X6S A;  1VSD A;  5HRS A;  3RRH A;  3VN5 A;  4JLH A;  1LAW A;  3DRP A;  3CM5 A;  1NOY A;  1RDA A;  3L2U A;  3RRG A;  2F8S A;  4E0D A;  2YHB A;  1GOA A;  1KFD A;  3AVC A;  4N5S A;  4XIU A;  3SV4 A;  5I42 A;  4N41 A;  2FC0 A;  1ZBU A;  1A5V A;  5FDL A;  4CGI A;  3DM2 A;  2VWJ A;  3AVL A;  1SL2 A;  2EHG A;  4FZZ A;  3I0S A;  2FBY A;  1LWE A;  4N47 A;  1GOB A;  4DQR A;  3OYN A;  1TKT A;  1VSK A;  5HRR A;  4AHT A;  4PWD A;  4KKO A;  3U3Y A;  1XI1 A;  3AVK A;  3ZSX A;  4BE0 A;  3HL8 A;  3EZ5 A;  2BDP A;  4CK2 A;  2AJQ A;  1WSG A;  1RT7 A;  2X78 A;  4N76 A;  5J2P A;  4FVM A;  3RMC A;  4DU1 A;  3VQE A;  2HMI A;  4GVM A;  4OPJ A;  4C8K A;  1N6Q A;  3LAK A;  2IGI A;  3IAY A;  2G8K A;  1KRP A;  4ELV A;  4CE9 A;  3FFI A;  4O4G A;  3LZI A;  1NJY A;  1SUQ A;  3OS1 A;  4KB0 A;  2P51 A;  1JXE A;  3ZSY A;  3K5M A;  4E19 A;  4FK4 A;  4Z4F A;  2EX3 A;  4DTS A;  3F73 A;  1WN7 A;  3V1Q A;  4ELT A;  2P1J A;  4OKE A;  4Z4C A;  4FLV A;  4KI6 A;  3G10 A;  4RW6 A;  1UA0 A;  2D0A A;  1S1V A;  4PQU A;  3HPG A;  3B6O A;  4DSE A;  1JLC A;  2KW4 A;  3OYM A;  3K5N A;  2LSN A;  3V9U A;  2PYL A;  4FK2 A;  3KD1 E;  3ZSW A;  1SKR A;  2P5O A;  1TV6 A;  3KKS A;  3ZT2 A;  4JS4 A;  3TI0 A;  1VSM A;  4BDZ A;  4CK1 A;  4NYF A;  3SQ4 A;  4OKJ A;  3VQB A;  4MFB A;  4BWM A;  3OS2 A;  3LP0 A;  5SWM A;  4DU4 A;  3O3G A;  1ZBI A;  1RT5 A;  3P83 D;  1C1C A;  3AO4 A;  3ZT0 A;  3KLF A;  2RN2 A;  4DG1 A;  5CYM A;  3M8R A;  1KVA A;  1BQM A;  1VSJ A;  1GOC A;  1JLA A;  1LWC A;  2G8V A;  3T3F A;  2OPR A;  4Q0B A;  1RT4 A;  1HQU A;  2XHB A;  1VRU A;  3OYI A;  4DLG A;  1D9F A;  2OPQ A;  4CGF A;  1L3V A;  4B9T A;  3OJS A;  4C8L A;  4B8C A;  2ZD1 A;  5J2M A;  1BIS A;  3HO1 A;  4KAZ A;  1CZB A;  3AO5 A;  4CJW A;  4CJQ A;  3SNN A;  1NKC A;  3DLE A;  1QSL A;  3WNF A;  2X6N A;  3QNO A;  2IAJ A;  1SL0 A;  2DY4 A;  4HCC A;  1VSI A;  4FLW A;  4CJS A;  3QNN A;  3OYF A;  4M41 A;  3KLI A;  4YNQ A;  1L3S A;  3TAF A;  4HUF A;  3K5O A;  2XRI A;  2KZM A;  2ZE2 A;  3WNG A;  2HHQ A;  3O4N A;  2QKB A;  3AA2 A;  4CHQ A;  4CIE A;  2Q3S A;  4GMJ B;  3DMJ A;  4FJH A;  3AA4 A;  2W42 A;  4DTJ A;  3AO3 A;  3HYF A;  4IFY A;  3VQ5 A;  5T7B A;  4DFJ A;  3U3G A;  1VRT A;  3OJU A;  1IG9 A;  3O3F A;  1D8Y A;  1KLN A;  1HRH A;  4O5B A;  3KK2 A;  3SI6 A;  1J9A A;  1RBR A;  3ZSR A;  4I7F A;  5I3U A;  4FJL A;  4KI4 A;  3KK3 A;  4W5T A;  1JLG A;  1NK0 A;  1KVB A;  4CF8 A;  1XHX A;  4FXD A;  3S3O A;  2YHA A;  2OPP A;  4CIG A;  1Q9X A;  2F8T A;  3L2R A;  3LP3 A;  1TK8 A;  2RKI A;  1HMV A;  3DLR A;  4PA1 A;  3NF6 A;  3KLE A;  5DK5 A;  1KVC A;  2RPI A;  5CY4 A;  3AVH A;  1RT2 A;  4B9M A;  4DSL A;  4NCB A;  4C8M A;  4ZTJ A;  1NJX A;  2YNF A;  4CFC A;  3SPY A;  4K8Z A;  3H08 A;  4DFP A;  3PX4 A;  4F3T A;  4CCH A;  4CK3 A;  2YKM A;  3VQC A;  3SV3 A;  3DOL A;  3K58 A;  4HHT A;  2OYQ A;  1YTU A;  1RBU A;  4OKK A;  2ITG A;  3KTQ A;  3PY8 A;  2QK9 A;  2E4L A;  3AVN A;  4O0I A;  1B92 A;  1Z26 A;  4CF1 A;  3SYZ A;  4DS4 A;  4BE1 A;  1RT3 A;  3SUP A;  3SJJ A;  4CJ3 A;  4FJ9 A;  2R7Y A;  1REV A;  3K59 A;  3QEW A;  3PO4 A;  1IH7 A;  1VSL A;  3F9K A;  3QES A;  2KFN A;  1Q8I A;  1ASV A;  2GUI A;  3ZT4 A;  4FK0 A;  2YNH A;  3OYK A;  4CES A;  4CJP A;  4Z0U A;  1NK8 A;  5EU7 A;  2OZS A;  4H4M A;  5KGX A;  1NK6 A;  4C8N A;  2FBT A;  3K5L A;  2ATQ A;  1T05 A;  1J5O A;  1C0U A;  3CQ8 A;  2OPS A;  3OYL A;  4DF8 A;  1BI4 A;  2YNI A;  4O55 A;  1CXU A;  1I39 A;  4KTW A;  4Y1D A;  2VWK A;  4CJE A;  4FLZ A;  1A5X A;  2DFE A;  4CF0 A;  4DSJ A;  3TWH A;  1C1B A;  3VQ4 A;  5C25 A;  1XWL A;  1S1X A;  3NCI A;  3V9S A;  1RDC A;  1TL3 A;  4NYN A;  4CJR A;  1TKZ A;  4CGH A;  3AVG A;  1IKV A;  3JYT A;  5SZT A;  3THV A;  3EYZ A;  4CHO A;  4F2S A;  3NH0 A;  3IG1 A;  3TR8 A;  1EP4 A;  4CEA A;  3V9X A;  3QEX A;  4IG0 A;  4OLB A;  1TK5 A;  1NK5 A;  1K6Y A;  3KLH A;  5HP1 A;  1LWF A;  4FW1 A;  3IRX A;  3L3V A;  3DI6 A;  4CIF A;  3QO9 A;  4RG8 A;  1RT6 A;  4B9N A;  2WOM A;  5KI6 A;  2B4J A;  1QQC A;  1TGO A;  4QCL A;  1HNV A;  3KLG A;  4R5P A;  1RDD A;  1T03 A;  3TAR A;  4W5Q A;  3RWU A;  4H8K A;  3WNH A;  1L3T A;  3DRR A;  2E6M A;  2PYJ A;  1HYS A;  4I2P A;  3ULD A;  2Z1G A;  3TAE A;  2PZS A;  1WSJ A;  3LDS A;  1HNI A;  3VQ9 A;  4JRP A;  4LSL A;  1QS4 A;  3NH1 A;  1SL1 A;  4FJK A;  3HK2 A;  1D9D A;  3NDK A;  3RR8 A;  4CJL A;  3ZT3 A;  4FLX A;  3RMB A;  1SKS A;  3SQ2 A;  3D45 A;  3LZJ A;  4N56 A;  3SZ2 A;  4KFB A;  4OVL A;  4QOZ B;  4DTU A;  2G8U A;  3SUQ A;  1J54 A;  3TAP A;  2HHV A;  3OY9 A;  2B5J A;  2O4G A;  1S1U A;  4KHN A;  3VQQ A;  4CHZ A;  3L8B A;  4KRE A;  2GV9 A;  4AIL C;  2D0B A;  3IS9 A;  4E3S A;  4CEC A;  3ASM A;  3QIP A;  4LH5 A;  4CHP A;  4CF2 A;  4NCA A;  3K2P A;  2Z1J A;  1BCM A;  4IG3 A;  1BHL A;  3MED A;  1NOZ A;  4DMN A;  5FRO A;  5C24 A;  2XY5 A;  1WAF A;  3C94 A;  3ZSZ A;  4DSF A;  3MXM A;  1RTD A;  1D5A A;  4I2Q A;  3LP2 A;  2IC3 A;  1QSS A;  4J2D A;  2OZM A;  1JL2 A;  3ALY A;  4NCG A;  3ZT1 A;  3OS0 A;  1ASW A;  3RTV A;  4ZTF A;  4DS5 A;  2DTU A;  1BGX T;  3HJF A;  2O4I A;  3PUF A;  4DTO A;  1JLQ A;  4DF4 A;  4OGE A;  4JRQ A;  2Y1J A;  4IFV A;  3HM9 A;  3LWM A;  1Y97 A;  3LPU A;  4CGJ A;  4FJJ A;  4KHY A;  1T8E A;  3A2F A;  1N5Y A;  4F4K A;  4PUO A;  4LY7 A;  2A1R A;  1RTH A;  4E7K A;  3V81 A;  3C6T A;  4ID1 A;  4O44 A;  5HRP A;  3QET A;  1S6Q A;  2BAN A;  4I9Q A;  3AA5 X;  3CYM A;  4RW8 A;  3OYD A;  2KQ2 A;  4DTN A;  1BQN A;  3HPH A;  4M3Y A;  1LW0 A;  1IO2 A;  4OGC A;  4M3R A;  3NF8 A;  3T1A A;  5E41 A;  3JSM A;  3I0R A;  1YTA A;  1C1A A;  4DU3 A;  3TAB A;  4DWI A;  3E01 A;  4KB1 A;  4C8O A;  4DFM A;  1RBV A;  4FM2 A;  4E1M A;  1SKW A;  2D5R A;  4DQS A;  1QHT A;  1FKP A;  4ID5 A;  3SCX A;  5FRN A;  1NJZ A;  3HP6 A;  4FZX C;  2DFH A;  3O4Q A;  4AHV A;  4FYD A;  4OPK A;  2ETJ A;  3HVT A;  4H4O A;  3CFO A;  3QIO A;  3U6F A;  2G8W A;  3AV9 A;  4FM1 A;  3VQ7 A;  3AO1 A;  1F21 A;  3PO5 A;  1JXB A;  1EET A;  4ICL A;  4CHY A;  1W9H A;  4DSI A;  4J2E A;  1WNS A;  1HQE A;  4CJK A;  3VQ6 A;  3D0P A;  3S9H A;  3S3N A;  4EZ6 A;  1CXQ A;  4CEZ A;  1I3A A;  4Z4G A;  3V1R A;  1CZ9 A;  1L5U A;  1FXX A;  3AVF A;  3OYH A;  3L3U A;  3SPZ A;  2OA8 A;  2G8F A;  3QLH A;  4E1N A;  4CJF A;  4LD0 A;  1U04 A;  1S9E A;  3WNE A;  5KTQ A;  3TAG A;  3G0Z A;  4W5O A;  3V9W A;  3PX6 A;  1KFS A;  3KD5 E;  4PY5 A;  2G8H A;  3VQA A;  1S9G A;  4EP4 A;  4YFU A;  3UIQ A;  1WSI A;  3NF9 A;  3L2Q A;  4CJT A;  2KZZ A;  1B9D A;  4KRF A;  4CHN A;  3NBP A;  1TK0 A;  3DYA A;  4RW9 A;  3SQ1 A;  1RIL A;  4MQ3 A;  4OJR A;  1A5W A;  3V1O A;  3AO2 A;  1FK9 A;  1BIZ A;  2BE2 A;  2HNZ A;  3NF7 A;  2Z1I A;  2HNY A;  3CG7 A;  1VK0 A;  2E6L A;  2GBZ A;  3EY1 A;  4FCY A;  4Z4H A;  3QEP A;  4FJX A;  1C6V A;  3LAM A;  4RW4 A;  4CGG A;  3OYE A;  2HVH A;  1TAU A;  1X9M A;  4BDP A;  2YV0 X;  3MEG A;  4OLA A;  3VQD A;  1NK9 A;  2HHW A;  4Z4I A;  1MU2 A;  1RBT A;  3DRS A;  4HUG A;  1O1W A;  1QE1 A;  3KIO A;  1HJR A;  4M3W A;  3NFA A;  5CYQ A;  3ZSO A;  1VSE A;  4CJU A;  4W5N A;  4M3T A;  3TAM A;  1UA1 A;  1NJW A;  1KSP A;  4B9S A;  5C42 A;  1YT3 A;  2IDO A;  3NGZ A;  4FJ5 A;  1RCH A;  5HRN A;  4KHW A;  4HUE A;  4E89 A;  2HW3 A;  2HHS A;  1IKX A;  2IS3 A;  3DLK A;  3MAQ A;  4HCB A;  3OYB A;  4RW7 A;  3HP9 A;  1S1T A;  1IKW A;  2HHU A;  4TSX A;  1NKE A;  1VSF A;  5K14 A;  3NHG A;  2XY6 A;  1S6P A;  5HBM A;  4M3Z A;  4AH9 A;  2HHX A;  4KHU A;  4AHC A;  3P1G A;  4LSN A;  4I9L A;  4BWJ A;  4CJ5 A;  1U49 A;  3C6U A;  1JLE A;  3CFR A;  1UWB A;  4FM0 A;  2VG6 A;  5KGW A;  2WON A;  1ITG A;  3NGI A;  4B9U A;  1QTM A;  1EXQ A;  3PX0 A;  1YVU A;  1ZBF A;  2NUB A;  3SUN A;  1UOC A;  1RBS A;  4CFB A;  3AVM A;  4BDY A;  2D0C A;  3SUO A;  4CGD A;  1LV5 A;  3OVN A;  3CM6 A;  5HLF A;  4KTQ A;  3AVB A;  3VQ8 A;  2DFF A;  5JS2 A;  4DQP A;  4FJI A;  4DQI A;  1FKO A;  3OYJ A;  4CEQ A;  1EKE A;  1Z25 A;  3V9Z A;  1CLQ A;  4FJN A;  3DLH A;  4B9V A;  4DTP A;  1ASU A;  1S5J A;  2YNG A;  3K57 A;  4DTM A;  1BL3 A;  4E7I A;  3DLB A;  1KLM A;  1RTI A;  4G1Q A;  1U4B A;  1WLJ A;  4Z4E A;  1Q9Y A;  1S1W A;  1U47 A;  1RNH A;  4M45 A;  1NK4 A;  4FJ8 A;  1KTQ A;  4GW6 A;  2B6A A;  3AVA A;  3HST B;  4KV8 A;  3MEE A;  4WE1 A;  3ZCM A;  4F2R A;  3HT3 A;  4M3X A;  2XO7 A;  1TKD A;  1J53 A;  4FW2 A;  4FLU A;  1JL1 A;  2JGU A;  3M8S A;  2VG5 A;  4M3U A;  3C95 A;  2YKN A;  3AA3 A;  5CZ1 A;  4DLE A;  1QSY A;  4FJG A;  1RDB A;  4JS5 A;  2G8I A;  2XY8 A;  4FLT A;  4KHQ A;  1RT1 A;  3OYG A;  4IBN A;  4B08 A;  5KRT A;  1ZBL A;  2FBX A;  3ZSV A;  2A1S A;  2PY5 A;  1U48 A;  4B3O A;  3LWL A;  4B9L A;  4CFD A;  3QEI A;  1BIU A;  1RTJ A;  2VG7 A;  3DOK A;  1ZBH A;  1U45 A;  3MXJ A;  4W5R A;  3RMA A;  3L2W A;  2Z1H A;  3CFP A;  5D3G A;  3BGR A;  4KPY A;  2QXF A;  4KO0 A;  1L3U A;  2HHT A;  3VA0 A;  1B9F A;  3OYA A;  3NAE A;  3HXM A;  2I5J A;  4EZ9 A;  1R0A A;  3M8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...