2RPIA

The nmr structure of the submillisecond folding intermediate of the thermus thermophilus ribonuclease h
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
MNPSPRKRVALFTDGAALGNPGPGTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of the early folding intermediate of the Thermus thermophilus ribonuclease H
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Hydrolase
molecule keywords Ribonuclease H
total genus 19
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rpiA00
4DFKA 2PY5A 1JLFA 4KO0A 3TAGA 4C8MA 1TL3A 4ICLA 4I2QA 4FK0A 1RBSA 2VG5A 4DTUA 1BISA 4DFMA 1TVRA 3L3UA 4ZHRA 1J54A 4RW4A 3HXMA 4CHOA 2HHUA 3MECA 2DY4A 3AV9A 3DRRA 3NFAA 1RTDA 4RG8A 4M41A 3OVNA 4B9LA 1NK9A 4FJ5A 4O44A 4DU3A 1HYSA 4FM0A 4CEOA 3C94A 3QIOA 3CYMA 1S6PA 1TKTA 4KHWA 2OPSA 4I7FA 4KTWA 4HVJA 4PWDA 4CK1A 3OYBA 4PQUA 4CERA 2FBYA 3OYAA 3NDKA 3KK3A 1RNHA 2XY6A 3NBPA 3OS0A 3VQ5A 1C1BA 1XC9A 1NJZA 3S9HA 1RT4A 3S3NA 2OA8A 3SCXA 3LAMA 4CEZA 4BE1A 3PV8A 2BE2A 1CXQA 3TARA 1BL3A 3HL8A 4FLYA 2P5OA 3OYLA 4LSLA 3VQAA 4FYDA 2YNIA 4CJTA 4OLBA 3DRPA 4DLGA 5C24A 4B08A 1QSLA 4E0DA 1S1TA 4CEQA 4YNQA 2KFZA 3K5NA 1Q9YA 2DTUA 1ZYQA 4DTJA 3CFOA 3RRHA 2X78A 3VQQA 1RBVA 3AVFA 4FJGA 4BWJA 2HHXA 1NJWA 1C0MA 1MU2A 1RDCA 3QIPA 2ATQA 5CZ1A 3KLHA 1KRPA 4FZYA 3HVTA 4KFBA 3NH0A 3O3FA 5HRRA 1DTTA 4M3TA 4TSXA 3O3HA 3JYTA 2E4LA 4DTRA 4DF4A 4Y1CA 5I3UA 1UAXA 1ITGA 4IG0A 3PUFA 4JS4A 1WSGA 3LPUA 4H8KA 4RW8A 5CYQA 2YNGA 5CYMA 4W5RA 1NK5A 4DWIA 1C1AA 4OGEA 5EU7A 3HVRA 2BANA 2HHWA 3CFRA 3MXJA 1SKSA 3OYGA 3DRSA 4EP4A 4FLXA 1EETA 1BCMA 3T3FA 3V9ZA 3KK2A 4N5SA 1T05A 4Z4GA 4E1MA 3M8QA 4CJ5A 4M42A 1JXBA 3AA2A 4WE1A 4CEEA 1VSJA 3B6OA 4BE0A 1HNIA 4KREA 5HBMA 4DTOA 4CJLA 3KKRA 4R5PA 2O4GA 4DS4A 4Q0BA 4CJSA 3VN5A 3ISNC 1VSFA 4DLEA 3S3MA 4PY5A 2HHTA 1RTJA 3P83D 3SI6A 2WOMA 4H4MA 2AJQA 3LP3A 4FJMA 3ZCMA 4DTSA 3IG1A 1WLJA 4CJRA 4JRPA 1BIUA 3UIQA 1GOCA 3DI6A 1ZBUA 4QOZB 3V1OA 1QHTA 3V9XA 1EP4A 4H4OA 3O3GA 3C6TA 4OGCA 4HUGA 4DTNA 3TAPA 1D5AA 2Q3SA 2D0BA 1RCHA 1L5UA 1JLAA 1G15A 1TGOA 1RDDA 5JS2A 3OYFA 3NGIA 4KI4A 2XY5A 3SYZA 4M45A 4IDKA 4W5TA 3NGZA 4IFYA 1SV5A 2YKNA 1QSYA 4FK2A 1VSEA 4J2BA 3M8SA 3RMBA 1TV6A 3DYAA 4B9UA 4HTUA 4FJHA 4FVMA 3DLEA 3K2PA 3HK2A 1YTUA 2ZQBA 1LWFA 1XI1A 3V1QA 1HPZA 2A1RA 3L2QA 4CHYA 1CLQA 2IS3A 2HHVA 3QETA 3EY1A 1VSIA 4YFUA 2WONA 4KHUA 3RR8A 1Z26A 1N6QA 1X9MA 2HHSA 1L3SA 2GBZA 1LW0A 4CGGA 4FJXA 4LD0A 2OZSA 3AVJA 2YNFA 3V4IA 1DLOA 4KI6A 3OYNA 4CJUA 2YHAA 2Z1JA 4HCCA 2HB5A 4OKJA 4FK4A 4DU1A 1WNSA 1RBRA 4OJRA 3ZT1A 3VA3A 4F2RA 4RW6A 4W5QA 4ZTFA 3G10A 3G0ZA 2KW4A 2JLEA 2BGGA 1TKXA 3AVHA 4O5BA 4AH9A 4BACA 2NUBA 1XHXA 4C8OA 4HCBA 2X6NA 3P1GA 3PY8A 1F21A 2VG7A 3VQ6A 2G8IA 1RDAA 3JSMA 4BE2A 4CGDA 3WNHA 1NOYA 4LH5A 3KTQA 1RT1A 5HRSA 4DTPA 4ELVA 2PZSA 4CESA 4ZTJA 4ELUA 4B9NA 4FLZA 3TAMA 1TKDA 2VWJA 4CK3A 1EXQA 1JKHA 2OYQA 4CEAA 1LAVA 5J2PA 2EHGA 1BGXT 2IC3A 1KVAA 3KIOA 5FDLA 4C8NA 1EX4A 3RMCA 2RPIA 5J2NA 4KV8A 3F73A 1NK6A 1BIZA 1WAFA 2IGIA 1JLCA 5KRSA 2FBTA 4HUEA 4Z4IA 3KLEA 5K14A 3P5JA 3QINA 2IDOA 4Y1DA 5CZ2A 1U45A 2BDPA 4L8RB 3CG7A 3A2FA 4CEDA 4CFBA 3NE6A 3NF6A 3RWUA 2QXFA 3K5OA 2ZD1A 4ID5A 1K6YA 3V1RA 5HRPA 1WAJA 1L3TA 4CCHA 1JLEA 1JLBA 1NJYA 4Z4EA 2GUIA 3TWHA 3ZSQA 1VSLA 3AVLA 4Z0UA 3D45A 4I9QA 2KZMA 3VQ7A 4JLHA 3L8BA 3QEXA 4KTZA 3LP1A 3K58A 1L3UA 3KKSA 3VQBA 1WSEA 2X74A 3OYHA 2FBVA 3DLGA 2YKMA 1ASVA 1JLGA 3I0SA 3KLIA 5FRMA 4FJIA 1IKWA 1BI4B 2JGUA 3MEDA 1KCFA 4JS5A 1SL1A 3VQEA 2IOCA 3FFIA 1SKWA 1WN7A 3WNEA 5DMRA 1CZ9A 2I5JA 3NHGA 2IAJA 2OPRA 4CF8A 5HP1A 3DOKA 3I0RA 3NH1A 3AO2A 1X9WA 1EKEA 4NYNA 4AHVA 4F4KA 4DSJA 3RTVA 1U47A 3VQ4A 4B8AB 2Z1HA 3ALYA 3CM6A 2GV9A 4BDYA 2Y1JA 1TAQA 1ZBFA 2VWKA 1XWLA 2E6LA 3OYMA 1RDBA 2F8TA 4E7KA 5KI6A 3ZSZA 3OJSA 1QQCA 1JXEA 3NAEA 3ZSYA 3PO5A 2Z1IA 2G8FA 2OPPA 4AHCA 4FZZA 4FM2A 1VRTA 4E7HA 3QEIA 2B6AA 1RBTA 4CGJA 1S6QA 2HNYA 3KLGA 1Q8IA 1HYVA 4DMNA 1FXXA 2DFEA 4CHQA 2KFNA 3LZJA 4EZ6A 1L3VA 3NF7A 1D8YA 1REVA 2D5RA 4RW9A 4CJQA 4KHYA 1BCOA 4FLTA 1RILA 4HHTA 3PX6A 1O1WA 3HO1A 3ULDA 1ASUA 3ZSRA 2D0AA 1SL0A 5FRNA 2X6SA 4MQ3A 4DFPA 1VK0A 1LWCA 1LV5A 4B9MA 3LDSA 4DQIA 2A1SA 3HPGA 3ITHA 4E1NA 3SNNA 3OY9A 4FJJA 4OLAA 2PYLA 3WNFA 4E7IA 3U6FA 4MFBA 3CFPA 4KB0A 3AA3A 5C25A 3SV4A 4O55A 3NH2A 1FK9A 3V9UA 3AVNA 1NK4A 2YHBA 3BDPA 5J2MA 3ZSOA 1IKYA 3L3VA 1KSPA 3D0PA 4O4GA 1TAUA 1SL2A 4DF8A 3ZT3A 1RT3A 1JL2A 4KB1A 4FJKA 2B5JA 5E41A 4CEBA 3THVA 3ZSWA 3DLBA 2FBXA 4F3OA 1C6VA 4FLUA 3VQDA 3CQ8A 4GMJB 1A5XA 3SUQA 3OYEA 4CJFA 3MAQA 3RMAA 3K5LA 1SKRA 2RF2A 2FC0A 1S1XA 3PO4A 2VG6A 1U04A 1WSIA 4CJ3A 1KVCA 1U48A 3DLHA 1C1CA 1KLMA 3MEEA 3QEWA 3RRGA 4XIUA 3LZIA 2W42A 4Z4HA 4M3UA 4CF2A 4M3WA 1R0AA 3HP9A 4FJ9A 3NF9A 2G8HA 4KHNA 4W5OA 2XO7A 1S1WA 4Z4FA 3I8DA 1IH7A 3HJFA 1A5VA 4IG3A 3TR8A 2DFHA 3H08A 4CIFA 4CJKA 2DFFA 3TAFA 4F8RA 3KLFA 1Z25A 3HM9A 3IRXA 5D3GA 4AHRA 4E89A 1ZBIA 1RT5A 1KVBA 1IG9A 3SQ1A 4OKEA 4I9LA 3AO4A 5C42A 4CJPA 1S1UA 3SUNA 4J2AA 1TL1A 4CJ4A 5KGXA 1KFDA 4AHSA 3AA4A 4CGHA 4CHZA 5HRNA 2R7YA 1X9SA 3V9SA 5J1EA 5I42A 1X1PA 5FROA 1UOCA 4RW7A 1NK7A 3M8RA 3V81A 2P51A 5SWMA 4BDZA 3AVKA 4FJ8A 1YT3A 3C6UA 1U49A 1NKEA 1UA0A 4CECA 1JL1A 2KTQA 3ZSXA 3HYFA 3QNOA 3SV3A 3QEVA 2OPQA 4FJNA 1FKPA 1JLQA 4N41A 3SJJA 1LWEA 3OS1A 3TAQA 5JS1A 1RTIA 4FXDA 4KHSA 2G8WA 1IKVA 4IFVA 2Z1GA 4NCGA 4CF0A 5SZTA 4JRQA 3SQ4A 3ZT4A 3U3GA 3OYIA 2LSNA 3DLRA 3V9WA 3KD5E 4NCAA 4EP5A 4OVLA 4KAZA 4IBNA 1HRHA 3M8PA 1VSKA 4AHTA 2PYJA 3HT3A 4B3OA 4E7LA 2P5GA 2RN2A 2O4IA 1TK0A 1ZBLA 4M3XA 5T7BA 2HMIA 1I3AA 1FKOA 3AO5A 3LALA 4DQRA 3VQ9A 3LANA 5CY4A 3QLHA 1HQUA 3SPZA 4NYFA 1HYZA 1IKXA 4DSEA 4HUFA 1XHZA 4DSKA 4E7JA 1KFSA 4KTQA 1VRUA 3DLKA 4CIEA 4OPKA 1S9GA 1BI4A 2HNDA 4KKOA 2HVHA 2ITGA 3VA0A 3O4NA 4E3SA 1T7PA 3LWMA 3AA5X 3RMDA 4B9SA 1NOZA 4K8XA 1ZBHA 3AVAA 2QKBA 1C0UA 3NGYA 3LP2A 1NKCA 1QE1A 3AO3A 2D0CA 4NCBA 3L2WA 5J2QA 4J2DA 1RT7A 3S3OA 3SPYA 3KJVA 4IKFA 3F9KA 4B8CA 4DU4A 3SQ0A 1CXUA 3TI0A 3SUPA 4W5NA 3HPOA 4ID1A 3LPTA 4DQSA 4CIGA 2E6MA 4CJWA 4K8ZA 1VSDA 3BGRA 2KZZA 3PX4A 4FJ7A 3OS2A 3TAEA 3LWLA 1J5OA 3MXIA 1QTMA 4EZ9A 4CGIA 3VQCA 1D9FA 1J53A 3NCIA 3ASMA 3WNGA 1RTHA 4C8KA 2XY8A 4FJLA 1UA1A 3SQ2A 1BHLA 3MEGA 1IO2A 3HP6A 3EZ5A 1KTQA 1LAWA 2P1JA 4I2PA 3L2VA 3HPHA 5DK5A 3V6DA 4CJVA 2OZMA 3RR7A 2XY7A 2B4JA 3O4QA 4BDPA 4LY7A 4Z4CA 1LW2A 2YV0X 3AVCA 4CF9A 3OYCA 1NJXA 1Q9XA 4N47A 3DMJA 4Q5VA 1BQNA 4DG1A 4FM1A 2HHQA 3ZSVA 4CE9A 3AVBA 4CHNA 1HQEA 1U4BA 4PA1A 1WSJA 1S1VA 4LH4A 4DQPA 4DQQA 4N76A 4DSIA 4CJEA 1NKBA 3HSTB 2ZE2A 1TK8A 2EX3A 4M3RA 1WSHA 1N5YA 3TABA 3DOLA 5KTQA 3IS9A 3SZ2A 5HLFA 1SUQA 4N56A 4J2EA 1VSMA 3QO9A 1RT6A 4CFAA 2Y1IA 2F8SA 3OJUA 3QERA 1TKZA 2XHBA 1GOBA 3ZT2A 4DS5A 3MXMA 1QSSA 4FLVA 3DM2A 3KD1E 4CHPA 1D9DA 3ZT0A 1W9HA 4FLWA 1B9FA 4CFCA 1HMVA 3OYDA 1YTAA 3U3YA 3TANA 1J9AA 4KPYA 3LP0A 3L2RA 3QNNA 1GOAA 1B9DA 3L2UA 4PUOA 4OPJA 3T1AA 2XRIA 4OKKA 4M3ZA 4LSNA 2HVIA 1HJRA 2ETJA 4QAGA 1CZBA 4GW6A 1W0HA 3OYKA 1T8EA 4AILC 2HNZA 3IAYA 4B9VA 1DTQA 4DFJA 1NK0A 3VQPA 1VSHA 2G8KA 2G8VA 4UQGA 1QS4A 1RT2A 2QKKA 3PX0A 3AVMA 1WSFA 3LAKA 4AHUA 3C95A 4O0JA 3AVGA 4CGFA 4DTMA 3QESA 2HW3A 1S9EA 4FW1A 3T19A 4DSLA 4KHQA 3EYZA 4KRFA 4DTXA 2RKIA 4FCYA 2KQ2A 3K59A 4CEFA 3NF8A 5HROA 1B92A 3QEPA 1S5JA 3KK1A 3K57A 2YNHA 4F3TA 4QCLA 4GVMA 1NK8A 4CK2A 1TK5A 1KLNA 4DSFA 3CM5A 4FZXC 1A5WA 1HNVA 2G8UA 4M3YA 3VQ8A 1YVUA 3K5MA 1Y97A 1RBUA 3AVIA 1ASWA 3AO1A 4BWMA 4G1QA 4CF1A 5KRTA 3E01A 1BQMA 4E19A 4O0IA 4C8LA 4FW2A 4B9TA 4ELTA 1T03A 3SUOA 1C0TA 2F96A 3OYJA 2QK9A 3B6PA 1UWBA 4F2SA 5KGWA 4CFDA 1I39A
chains in the Genus database with same CATH superfamily
4DFKA 3E9PA 2PY5A 3ATVA 4X62K 5JLFA 1TL3A 3ZYYX 4U7BA 5AQJA 2O8DA 3L3UA 1J54A 3HXMA 4CHOA 2D4WA 3DRRA 3OVNA 2P9NB 4O44A 4DU3A 4FJ5A 1N33K 3C94A 4ILHA 3G4SN 1BA0A 1HPMA 4I7FA 4PWDA 4CK1A 5LJWA 3OYBA 4BC5A 4PQUA 2FBYA 2Q2RA 4FSVA 2XY6A 1RNHA 1NJZA 3NBPA 2P9PB 3S3NA 2P9IB 3QBXA 1T44A 4CEZA 2BE2A 4UY8O 1IBMK 5B8HA 3OYLA 4FYDA 1P90A 4BRDA 5BPLA 5TKWA 3DRPA 5C24A 3SLCA 5AQKA 4LFBK 1BUPA 1S1TA 1Q9YA 4DTJA 5AQXA 2QA4N 4FJGA 3AVFA 4BRKA 1E4FT 3VERA 2HHXA 1NJWA 1C0MA 2ZJRL 3QIPA 5ADXH 2ATQA 1KRPA 1DTTA 4M3TA 4H0PA 1UAXA 1ITGA 3KHYA 4IG0A 2QEXN 3ATUA 3A5MC 4PL7A 2HHWA 3HVRA 4JYAK 4RTFD 4BROA 1BCMA 1Q18A 4N5SA 4M42A 3M8QA 4CJ5A 2O8CA 4WE1A 4CZFA 4MDAA 2W6LA 3KKRA 4R5PA 4H5RA 2PAVA 2O8FB 3ZX3A 4BRQA 4DLEA 3S3MA 4PY5A 4H4MA 3CMAN 1TUUA 4FJMA 4JK9A 3D7EO 4DTSA 3JS6A 1WLJA 4CZHA 1QHAA 1BIUA 4EAHD 2FXUA 4PHTX 3O3GA 4PKHA 4OGCA 1YAGA 5AFUH 1S22A 2D0BA 1TGOA 2WC9A 3NGZA 4IFYA 1QSYA 4J2BA 2V7YA 3M8SA 4HTUA 3EL2A 4NLCA 3LM2A 4CI6A 1LWFA 2W40A 3I8BA 3HBTA 2A1RA 1CLQA 1GLDG 3EY1A 2P9KA 3J7AP 4JI2K 1XQSC 1L3SA 2GBZA 2W6KA 3VTIA 4FJXA 4LD0A 4JKAA 4IOAL 4CJUA 5BR9A 2Z1JA 4JD2B 3VENA 4HCCA 3GL1A 3T7ZA 2V7ZA 2E2PA 3VA3A 3W0LA 4DUZK 4W5QA 3HTVA 3G10A 3G0ZA 3H3OB 3AVHA 4AH9A 4BACA 2NRXA 4JKBA 2UXDK 2X6NA 5AQZA 4B9QA 3EKUA 4GKKK 1YVNA 3W3DA 3JSMA 2PZSA 1HR0K 4RCHA 3TSQA 2QWOA 1LAVA 3KIOA 4WFNL 1BIZA 1WAFA 3CJ7A 3C6AA 4Z4IA 2PFUA 1JCFA 3EKSA 2FSJA 3THXB 2GTDA 3NF6A 4ID5A 3K0SA 1K6YA 1WBBA 1HKBA 2FF3B 4H5WA 4I9QA 3EN9A 4DKWA 3CETA 3L8BA 4KTZA 2O8CB 3K58A 3OYHA 1K8KB 4JI6K 1JLGA 2QWRA 3I0SA 3KLIA 4H5NA 2CH6A 3I56N 5IT9O 5FRMA 4JHDA 2E1ZA 3VEWA 3JXUA 1MA9B 4R79A 5AQSA 1SKWA 2I5JA 3NHGA 3D2FA 3I0RA 3NH1A 4NYNA 2P9LB 3HOTA 4K25A 4DSJA 1WOQA 1NGHA 3GDQA 1U47A 3HZ6A 4B8AB 3ALYA 2Y1JA 2VWKA 4Z94A 4E7KA 3ZSZA 3NAEA 4BRLA 1JXEA 2Z1IA 2G8FA 2OPPA 3N4PA 4A57A 1RBTA 4CGJA 1HYVA 4JKDA 4JI0K 2KFNA 1REVA 1RILA 4HHTA 4B3RK 2D0AA 5FRNA 2X6SA 2GWJA 1LV5A 4DV0K 4DQIA 3HPGA 4E1NA 2NRZA 3P4IA 3H1QA 2PYLA 4GNIA 4A5AA 1Q86O 3AA3A 4E1JA 5C25A 4CBUA 5AZIB 4H0OA 1FK9A 3AVNA 3ZSOA 5AQOA 3D0PA 2ZWHA 4OPHA 4YOUA 4DF8A 3J81O 3GOIA 4FJKA 5E41A 4CEBA 3ZSWA 1NGFA 1J5EK 4FLUA 4GMJB 3MAQA 2OTLN 2RF2A 4BC4A 3WXKA 1U04A 4AQYK 1U48A 1C1CA 5AQIA 3QEWA 4IXCA 3GG4A 4XIUA 2A5XA 4M3WA 1R0AA 2D0PA 3NF9A 4KHNA 4W5OA 2Q1NA 4ISEA 1A5VA 4IG3A 4OO1J 4BRPA 2DFFA 3HM9A 5D3GA 4E89A 4WQ4C 1WB9A 3AO4A 1S1UA 5KGXA 3AA4A 5BR8K 1QVGM 1X9SA 5I42A 5M1QA 4GVEA 4IFEA 3DJCA 4BDZA 4JV5K 3SBTA 4XH5A 2QWQA 1K8AO 1JL1A 4YHHK 3AAPA 4CZIA 1KAXA 4N41A 1GLLO 1RTIA 3O9RA 4BR9A 4LF9K 1ATSA 3SQ4A 4CZGA 3U3GA 2LSNA 3DLRA 5I9EB 5JLHA 3KD5E 4OVLA 1DT9A 2A41A 4KAZA 1VSKA 1SZ2A 2YHWA 3CHWA 2O4IA 4BG8A 4M3XA 3FR0A 5T7BA 3AAQA 3WUHA 1I3AA 1ATNA 3SPZA 3FZMA 3CJAA 3HRGA 1NGEA 4DSKA 1KFSA 4KTQA 3DLKA 1VQLN 2A42A 4E3SA 4K8XA 1ZBHA 4M63C 3NGYA 4WF9L 2FLOA 1RT7A 5AQGA 3PSIA 3OBYA 3SQ0A 3SUPA 3OBWA 1G99A 2E6MA 4FJ7A 3MMVA 3WNGA 5LMNK 4C8KA 5BRDA 3MEGA 4IJNA 3EZ5A 3ZEUA 1LAWA 2P1JA 3WQUA 3HPHA 3DXMB 4CJVA 3CCJN 4OX9K 3RR7A 3F9MA 4Z4CA 1LW2A 1NJXA 4CHNA 1U4BA 1WSJA 4LH4A 5JICA 3LL3A 1K9MO 4DSIA 3KWGA 3BZCA 3O1BA 2ZE2A 3SMSA 1IV0A 3DOLA 3C65A 1RT6A 3LDQA 4CFAA 5GAGP 2Y1IA 3FE1A 3QERA 3O9QA 1GOBA 3DXKB 4I6MB 3MXMA 4IJAA 4FLVA 1W9HA 3U3YA 4U67L 2VGMA 4PUOA 1BG3A 3FZKA 4C23A 2QWMA 4LSNA 1HJRA 4QAGA 1CZBA 4GW6A 1HKCA 2YHXA 1T8EA 4AILC 1DTQA 5LJVA 1VSHA 1RT2A 3IMXA 3PX0A 4AHUA 4O0JA 4DSLA 4BR5A 1H1VA 2ASOA 4DTXA 4FCYA 2KQ2A 3K59A 2VYPA 2P9SB 1B92A 4FWMA 3KK1A 4C1NK 1KLNA 4WQ4A 1IJJA 2ITMA 1YVUA 4WQ5A 1NWKA 1RBUA 3QB0A 3D2EA 2BH1A 4G1QA 1QZ5A 4CF1A 4O0IA 1BQMA 3THWB 4B9TA 4MLEA 3P38A 5E84A 4QS9A 4F2SA 4FWLA 4KH6A 1EWQA 4RWTA 4LC9B 4I2QA 2O8EA 2VG5A 4DTUA 4ZHRA 4L3QA 4RW4A 2HHUA 2VWBA 4LFCK 3AV9A 3CD6N 1S72N 4RG8A 4B9LA 4C1NI 1HYSA 1C0FA 2OPSA 4HVJA 5KPTA 3NVKA 3A8YA 4LF6K 3NDKA 3KK3A 1GLCG 3WEEB 1XC9A 1C1BA 3SCXA 3EE9A 1BL3A 1T3VA 3J7ZO 2P5OA 2YNIA 4CZKA 1RDWX 2Q31A 4WYBA 3RVCA 4CJTA 4DLGA 3VEVA 4OLBA 1VAZA 3Q7BA 5EY4A 4YNQA 5C2FA 3RRHA 3VQQA 4BWJA 4H5TA 3THYA 1ZBSA 1WBDA 5CZ1A 4FZYA 2YHYA 3F5TA 3O3FA 4BRHA 4G9ZA 4DF4A 3R8EA 2FSKA 1WSGA 3LPUA 4H8KA 4RW8A 2YNGA 1NK5A 4DWIA 1C1AA 4OGEA 1X3NA 3OTOK 4KH5A 3CFRA 3MXJA 2VCPA 4EP4A 4CEEA 4H0TB 5EOYA 4KREA 2O4GA 3VN5A 3ISNC 3CC2N 1VSFA 3MX2A 1RTJA 4FWPA 5AQVA 3LP3A 5BREA 2WBNA 1N32K 2RHKA 3IG1A 4CJRA 5AQHA 1GOCA 3DI6A 1ZBUA 2IVOA 4QOZB 4V19S 1QHTA 1EP4A 3J7YP 1WUAA 2QM1A 3TAPA 1NMNA 1L5UA 3NGIA 1RDDA 3E1YA 4JKFA 3GE1A 3SYZA 4IDKA 1SV5A 3RMBA 4FVMA 3DLEA 2ZQBA 3L2QA 2W41A 4FVUA 4KHUA 2WONA 4BREA 3TU5A 4X65K 1N6QA 3AVJA 2YNFA 3V4IA 1DLOA 3OYNA 3G25A 2P9UB 1R59O 2E20A 3DXKA 1W97L 4LFAK 1WNSA 3ZT1A 4F2RA 1BOTO 4RW6A 1SAZA 5H1SQ 5TKYA 2QWLA 3G71N 2JLEA 3R9PA 2NUBA 3U9ZA 3P1GA 3CMEN 3QICA 5M1NA 1F21A 1RDUA 3UKUA 4BY9C 2G8IA 1RDAA 3BF3A 2A40A 2IIRA 3F2KA 4QS8A 4ZTJA 3QFPA 3TAMA 1VQ5N 2VWJA 5CHIA 1VQKN 3U8XA 1GLBG 5BRHA 4C8NA 4A61A 2IGIA 5KRSA 2A3ZA 3E66A 5M1FA 2V52B 5K14A 5CZ2A 2IDOA 2BDPA 3NE6A 4EIAA 3CCUN 2ZD1A 5HRPA 4BR7A 4Z4EA 3AVLA 3D45A 4JLHA 3LP1A 3KKSA 1NGGA 2X74A 1V4SA 1YI2N 5BRFA 4FJIA 1IKWA 3DAWA 5FPMA 1KCFA 3FZLA 3VQEA 3K9KA 4LF5K 4K42A 2IAJA 2OPRA 4CF8A 3DOKA 3CCEN 1Y64A 3ZX2A 3CM6A 2GV9A 1ILYA 1TAQA 1ZBFA 2E6LA 1RDBA 3WQTA 2QI2A 1QQCA 4B3TK 2OANA 2B6AA 4FWNA 5AQUA 3MN6A 3U4LA 4JEPA 1FXXA 3LZJA 4EZ6A 2NRHA 1L3VA 3NF7A 4RW9A 1HNZK 4DQ8A 4FLTA 3ULDA 3ZSRA 4MQ3A 4DFPA 1VK0A 2A1SA 3SNNA 1GLEG 3WNFA 3U6FA 4KB0A 2WFBA 5ELZA 4BG9A 3CCRN 3CPEA 5IWAK 2YHBA 3P39A 4ISFA 5J2MA 3BDPA 1IKYA 3L3VA 1KSPA 4CVNE 4O4GA 4CBXA 3ZT3A 4HWIA 4KB1A 1YIJN 3A5OC 3TTCA 5LL6Z 3CQ8A 3SUQA 4Y0WA 4CJFA 1VQ8N 2FC0A 4CJ3A 5DM6L 5JVHL 3RRGA 2W42A 4Z4HA 3EEQA 3HP9A 1S1WA 3CC7N 1OH8A 3TR8A 3BEXA 4CIFA 4CJKA 2YJFA 4F8RA 1Z25A 4AHRA 3O5BA 1KVBA 3HSCA 3ENHA 4CJPA 4CJ4A 3CJ1A 4CGHA 5HRNA 2R7YA 5EVZA 2YJEA 3ENBA 4BR2A 4FWOA 5KPRA 4RW7A 3AVKA 4FJ8A 3JAMO 2ASPA 1N34K 4YOTA 3ZSXA 1W7AA 5DM7L 3QEVA 1C0GA 5AFUA 5C0YA 3SJJA 1HKGA 3OS1A 1FJGK 4DB3A 2VGNA 3P31A 4CF0A 1EO1A 4NCGA 3ZT4A 1DGKN 4B1YB 2IVPA 3UKUB 4FWRA 3M8PA 4IO8A 1IBKK 3C6HA 2DPNA 4E7LA 2RN2A 2HBJA 1OH6A 1N36K 2HMIA 2Q0RA 4DR7K 1FKOA 3AO5A 4HTLA 4JI4K 3VQ9A 3LANA 5AQQA 3D2FB 4CZJA 3FZHA 4HUFA 1S9GA 1NNEA 1BI4A 2HNDA 4KKOA 2HVHA 3NVMA 3O4NA 3CCLN 4B9SA 3AA5X 3CJBA 1VQNN 3LP2A 1QE1A 3AO3A 2D0CA 4BQZA 4NCBA 4DR6K 5J2QA 1T6CA 2O8FA 4DR3K 3TI0A 3BUZB 3VETA 4KBOA 3LPTA 4ISGA 1NU0A 4CJWA 1W2BM 4DUYK 1J5OA 1QTMA 2ZF5O 4CJ7A 2XY8A 1M90O 1BHLA 3CJCA 4I2PA 1TYQA 3L2VA 3CQXA 2XY7A 2B4JA 4BDPA 3TSPA 2Q0UA 3M3ZA 4CF9A 1QQOA 3OYCA 4N47A 4DG1A 2KHOA 3ZSVA 4JKCA 1HQEA 3ZX0A 4N76A 3HSTB 2EX3A 4FO0A 4M3RA 1N5YA 1SQKA 3TABA 4PL8A 4B1WB 3SZ2A 5HLFA 1SUQA 4J2EA 2D0OA 3CERA 5AQFA 1TKZA 2F7TA 2XHBA 4B1VA 3DM2A 3H3NO 3TANA 1J9AA 4KPYA 5E26A 3LP0A 3O9SA 4JI5K 4K0KK 5GINA 1NGDA 1Q7YO 3H45C 2E88A 5M1PA 1W0HA 3VEXA 2HNZA 4B9VA 2ZGZA 4DFJA 3AVMA 1WSFA 1NGIA 3R3LA 1VQ4N 1VQ7N 3J80O 1S9EA 4A62A 4H0VB 2OTJN 4CEFA 3QEPA 3VMFB 4QCLA 4F3TA 4CK2A 4B1XB 3CM5A 1A5WA 1HNVA 2P9PA 2QXLA 2ZJPL 2G8UA 3VQ8A 1XNQK 3THWA 1Y97A 1VHXA 4E19A 2O8BA 4F9OA 4ELTA 3EO3A 1T03A 5AQTA 4BRGA 4JKGA 4CFDA 1I39A 4GV3A 1JLFA 4KO0A 1XUPO 3TAGA 4C8MA 3ID6A 4ICLA 2O8EB 2EWSA 1RBSA 1IG8A 3O4WA 3ZETA 1BISA 5BN9A 2ASMA 1DEJA 4AM6A 3MECA 3THXA 3QIOA 1S6PA 1TKTA 4FPBA 4KHWA 4KTWA 4CERA 4B1ZA 3OYAA 3OS0A 3VQ5A 1M1KO 4M7XA 3S9HA 1OH5A 2HBKA 3QFUA 3LAMA 4BE1A 3PV8A 1CXQA 3HL8A 3C0BA 3H46O 3CIPA 2E2QA 3IFRA 4B08A 1XMOK 1N8RO 4E0DA 3SAHA 2DTUA 3G6EN 3CFOA 4IZ9A 1MU2A 4IOCL 3KLHA 3HVTA 4KFBA 4CW7B 1GLJO 5HRRA 3IKMA 4DV5K 4DTRA 4Y1CA 4WQ5C 4JKHA 3O9TA 5MLCQ 3U9DA 5EU7A 5ADXA 4DR2K 1SKSA 3OYGA 4Z4GA 4NB4A 3KK2A 4E1MA 3SBGA 3AA2A 1VSJA 1QQNA 3B6OA 4BE0A 5HBMA 4DTOA 4A59A 4CJSA 2NZTA 3P83D 1NLVA 4GV6A 5C10A 3ZCMA 1X9JA 3UIQA 5LY3A 4PKIA 2HBMA 3C6TA 4DTNA 1D5AA 2Q3SA 1RCHA 5BPNA 1JLAA 3VOVA 2XY5A 4M45A 4W5TA 5AQPA 3SMPA 4FWSA 2JWKA 1VSEA 4BR4A 4B3SK 4B9UA 1XI1A 3V1QA 1HPZA 4IEIA 2HHVA 2CGLA 3QETA 2NRWA 4ILJA 1VSIA 4YFUA 3QMLA 3RR8A 1Z26A 1X9MA 2F9TA 4MDBA 1LW0A 4CGGA 2OZSA 4XH1A 4H0YB 4KI6A 3PSFA 4FK4A 2P9NA 1RBRA 4FWQA 4AM7A 4ZTFA 2NRTA 1IBLK 2KW4A 2BGGA 4C8OA 1XHXA 3OW2M 3VQ6A 5HL7L 3VEZA 4CGDA 3WNHA 1LOTB 1NOYA 3KTQA 5HRSA 4B9NA 1JKHA 2OYQA 4MO4A 1BA1A 5J2PA 1BGXT 4JI1K 3RMCA 5J2NA 4KV8A 2YCHA 1O13A 1JLCA 3VEYA 2Q36A 5KQDA 4KHPK 3KLEA 3QINA 4Y1DA 1U45A 1ATRA 3VTHA 3CXCM 3CCVN 4CFBA 3K5OA 3KVGA 3V1RA 1L3TA 4CCHA 1JLEA 1JLBA 1NJYA 3TWHA 4NXMK 3KK7A 4CD3A 4Z0UA 1U6ZA 2KZMA 3VQ7A 1L3UA 1MWKA 3DLGA 2YKMA 3QBWA 5M1KA 3MEDA 1BI4B 2JGUA 3SK3A 1SL1A 4DHYA 1SS6A 2IOCA 3FFIA 1WN7A 3WNEA 1VQ9N 5DMRA 1CZ9A 3WXJA 1DKGD 1OVYA 5HP1A 3PLAA 1U2VA 4I6MA 2UUBK 1X9WA 4AHVA 4F4KA 2P9SA 4ILGB 3RTVA 3TPQA 4IEEA 3VQ4A 2Z1HA 1KD1O 4BDYA 1XWLA 2F8TA 5KI6A 3M5RA 4BVOA 4CZLA 3ZSYA 4FZZA 4FM2A 1VRTA 3VF6A 4E7HA 3QEIA 5AZIA 1S6QA 3VEOA 4CHQA 3AY9A 1D8YA 2D5RA 4JKEA 1BCOA 3PX6A 5A2QO 5CR4A 4BRFA 4B9MA 4FJJA 3ITHA 4OLAA 3OY9A 1NJIO 1JCEA 3MN9A 4E7IA 3A5NC 5EXWA 3V9UA 1NK4A 4MO5A 4WFBL 4YOYA 5AJ3K 4OPAA 3PIPL 1SL2A 1FW6A 4O5FA 1RT3A 1JL2A 3DLBA 3LM9A 2O8BB 5AR0A 3VPZA 4A5BA 3K5LA 3EE8A 1S1XA 1T6DA 2VG6A 1KVCA 1NG9A 3DLHA 3MEEA 4EHUA 4K41A 3S41A 1K73O 4LF4K 4FJ9A 4DV4K 3CCMN 2G8HA 2CH5A 1IH7A 3HJFA 1K8KA 2DFHA 3TAFA 5JS1A 3KLFA 3IRXA 2AA4A 1RT5A 4OKEA 3WXMB 5C42A 2GUPA 1TL1A 1HNWK 4JNEA 1YXQA 4AF1A 4BRNA 3CQYA 3V9SA 4NLBA 5J1EA 3BP8A 4DV7K 1X1PA 5FROA 1UOCA 1NK7A 3M8RA 4YDUC 1YT3A 3C6UA 3N4QA 1U49A 3PIOL 1NKEA 1J6ZA 3T69A 1UA0A 2OCEA 2KTQA 3FLCO 4DV1K 3SV3A 4NXNK 3MN7A 1FKPA 3FGUA 3M6GA 4EFHA 5BPMA 4FXDA 1IKVA 4IFVA 2Z1GA 5SZTA 4JRQA 3OYIA 2NRVA 4NCAA 5GIPA 1HRHA 3I33A 1TUYA 2P5GA 1TK0A 3Q7CA 4FL9A 4DQRA 3LALA 3J8AA 4YOXA 3QLHA 1HQUA 1YUWA 1HYZA 4B1UB 3AGKA 2Q97A 2PBDA 5CE3A 4E7JA 1VRUA 1GLFO 4DR4K 2ITGA 3CI5A 4JHDB 2QTDA 3VA0A 4QS7A 1T7PA 3LWMA 1NOZA 2QKBA 3AVAA 1YJWN 1NKCA 3L2WA 3CF5L 4IKFA 4A2BA 3L4IA 4B8CA 5BN8A 4DU4A 1CXUA 4W5NA 3HPOA 2V51B 1KAZA 1YHQN 4CIGA 4K8ZA 5C12A 2KZZA 4JKGB 3PX4A 3LWLA 1S3XA 4CGIA 3VQCA 1D9FA 2A6AA 2QWNA 3RSEB 3NCIA 1RTHA 4FJLA 3SQ2A 3HP6A 3DLLL 2YI1A 5DK5A 4BGBA 2OZMA 5AQMA 3AVCA 2E5LK 1X3MA 5GAHP 4CE9A 3AVBA 4PA1A 4CJEA 1NKBA 1TK8A 4FPAA 1QZ6A 5FLXO 2H3GX 4N56A 1VSMA 3QO9A 2F8SA 3ZT2A 1QSSA 3KD1E 4CHPA 3ZT0A 1B9FA 4CFCA 2P9UA 1HMVA 3ENOA 1YTAA 3OYDA 3QNNA 3L2UA 4OPJA 4M3ZA 4OKKA 2ETJA 1EWRA 3WXLA 4X64K 2CGJA 4IDHA 1NK0A 2G8KA 3O80A 2QKKA 4DTMA 2E8AA 3C95A 2HW3A 3AVGA 3QESA 4KHQA 3T19A 2GEMA 4KRFA 2RKIA 1P8ZA 2HMPA 3NF8A 1KXPA 2P9LA 3MDQA 2YNHA 4GVMA 3VGKA 1NK8A 2UU9K 4DSFA 1VQPN 4FZXC 4M3YA 1KC8O 3KWIA 1VQON 3ULEB 3FFKB 3AVIA 3AO1A 1TYQB 1OVQA 4WCEL 3E01A 3RSEA 5GIOA 1KAYA 4JK7A 1C0TA 3IDHA 2F96A 2QK9A 1UWBA 4FOIA 5HROA 5KQ8A 1E3MA 2UUAK 4FK0A 4DFMA 1TVRA 2WTUA 4GV9A 5C2DA 3OA9A 4XEIA 1MDUB 3NFAA 1E4GT 4BC2A 1RTDA 4EHTA 4M41A 1NK9A 4FM0A 4CEOA 3CYMA 1Q82O 3ULEA 3LDPA 2HBLA 3UKRB 1RT4A 2OA8A 3TARA 1OKJA 1EQYA 4FLYA 4LSLA 3VQAA 2UXBK 3OHRA 1OH7A 4K43A 5AQRA 1QSLA 4BQLA 4CEQA 2KFZA 3K5NA 1VQ6N 1ZYQA 1Z05A 2BTFA 2X78A 1RBVA 3AARA 1RDCA 1NMDA 3UKRA 3NH0A 3WEEA 4TSXA 3O3HA 1HX1A 3JYTA 2E4LA 3TTDA 5HOOA 3T1HK 3MK6A 5I3UA 3PUFA 4JS4A 5CYQA 5CYMA 4W5RA 2GX9A 2BANA 4YOWA 3VF4A 2AJQA 4DCHA 3DRSA 1T05A 4FLXA 1EETA 3T3FA 3V9ZA 3UE5A 5FPNA 1JXBA 4BC3A 5FPEA 5JMVA 1HNIA 2O8DB 4CJLA 4DS4A 1VQMN 4Q0BA 2HHTA 3SI6A 2WOMA 4X66K 1BWFO 4YOVA 4FOEA 4CZEA 3T1YK 3TSUA 3VESA 2I7PA 3B8AX 4JRPA 1KQSM 4BRCA 3L0QA 3V1OA 3V9XA 3MCPA 4CZMA 4H4OA 2AP1A 4HUGA 4DV2K 1G15A 3OYFA 4KI4A 5JS2A 2E2NA 3KZBA 1RFQA 2F9WA 2YKNA 4FK2A 1TV6A 3DYAA 4FJHA 3H1VX 3TTFA 3K2PA 3HK2A 2VQEK 1YTUA 1XMQK 1HLUA 4JN4A 4CHYA 2IS3A 2JWLA 1NGBA 3MX5A 2HHSA 1ESVA 4PKGA 2FF6A 3QDKA 3R1XA 4MLHA 2D1KA 2YHAA 5KPZA 2HB5A 4OKJA 3UB5A 4DU1A 2BUPA 4OJRA 1YJNN 2P9KB 3M1FA 5F2RA 1TKXA 3O1WA 4O5BA 4HCBA 3PY8A 2ZJQL 2VG7A 2GWKA 3O9UA 1XC3A 1NBWA 4BE2A 4ELVA 3CPWM 4LH5A 1RT1A 4ELUA 4DTPA 3AGRA 4CESA 2NRRA 2CGKA 4FLZA 2ZGYA 1TKDA 4JI7K 4CK3A 1EXQA 3WT0A 1ZXOA 4CEAA 2EHGA 2KKZA 2IC3A 1KVAA 5FDLA 1EX4A 2RPIA 3F73A 1NGCA 1NK6A 2FBTA 4WFAL 4HUEA 3ZEUB 4JAXA 4YY3K 3P5JA 4L8RB 3O6WA 3SJHA 3CG7A 3A2FA 4CEDA 3RWUA 2QXFA 3CJ9A 2RE2A 1BO5O 1WAJA 3MWPA 2GUIA 4IOXA 3ZSQA 1VSLA 1Q81O 3CCQN 3QEXA 3VQBA 1WSEA 2FBVA 4J8FA 5AZJA 1ASVA 5F1XA 4JK8A 2HF3A 4XH4A 3I55N 4JS5A 2J4RA 1CZAN 4YDUA 3A5LC 4A2AA 3AO2A 3D6RA 1EKEA 1JJ2M 4IO9L 3SAGA 4KH4A 1D4XA 3IUCA 3OYMA 3OJSA 3PO5A 2E2OA 4O8KA 3WXIA 4AHCA 3CCSN 1GLAG 5EX5A 2P9IA 2HNYA 3KLGA 1Q8IA 4LF7K 4DMNA 5FPDA 1YF5L 2DFEA 5F0XA 3VGLA 3L4QA 4KHYA 4CJQA 3HO1A 2GELA 1O1WA 1ASUA 4BRAA 1SL0A 4DV3K 1LWCA 3LDSA 2NLXA 4MFBA 3CFPA 1Z6RA 3SV4A 4O55A 4BGAA 3NH2A 3VF2A 3A0IX 4BR0A 3O8MA 1TAUA 5C15A 4H0XB 2B5JA 3FZFA 1JCGA 3THVA 4F3OA 3VGMA 2FBXA 1C6VA 3VQDA 3ZLJA 1A5XA 3ID8A 3OYEA 1SKRA 3RMAA 2UUCK 4JI3K 3PO4A 1WSIA 1MWMA 1KLMA 1HNXK 3LZIA 3MWTA 4M3UA 4CF2A 1V4TA 3LDNA 2XO7A 4Z4FA 3I8DA 5AQWA 2NNWA 3H08A 3SAFA 3MN5A 1ZBIA 1IG9A 3SQ1A 4GY2B 3MCAB 4I9LA 3SUNA 4J2AA 1KFDA 4AHSA 1YITN 4CHZA 4BRMA 3CC4N 3HOSA 4M7YA 5GADP 4IWVA 3V81A 2P51A 5SWMA 2F4VK 4CECA 4DR5K 3HYFA 3QNOA 4FJNA 2OPQA 5LMUK 1JLQA 4DV6K 1LWEA 3TAQA 3THYB 4O8UA 4KHSA 2G8WA 3V9WA 4EP5A 4IBNA 4AHTA 2PYJA 5AQLA 3HT3A 4GKJK 1RGIA 4B3OA 1ZBLA 1NGJA 2HF4A 2FSNA 5CY4A 4NYFA 1IKXA 3EZWA 1QVFM 3C7NA 4DSEA 4DR1K 1XHZA 4CIEA 4OPKA 3HM8A 2QWPA 4H03B 1XNRK 3RMDA 1C0UA 3L6QA 3GBTA 4J2DA 3HI0A 3S3OA 3SPYA 3O08A 3DWLA 3KJVA 3F9KA 2UYTA 4ID1A 1BU6O 4DQSA 4H5VA 2VQFK 3R6MA 1YJ9N 1VSDA 3BGRA 5AQNA 3C7NB 2HSTA 3OS2A 3TAEA 4EZ9A 3MXIA 1J53A 3ASMA 1UA1A 1IO2A 3LDLA 1KTQA 1QQMA 3D2EB 1BDGA 3V6DA 3NMUA 5AQYA 3O4QA 3E9LA 4LY7A 2YV0X 5M1OA 1Q9XA 3DMJA 4Q5VA 1BQNA 1LCUA 2I7NA 4FM1A 5GAEP 2HHQA 1S1VA 4DQPA 4DQQA 4BVPA 5JVGL 2WUSA 1WSHA 2UXCK 5KTQA 3IS9A 3BY5A 4B3MK 4JI8K 3OJUA 4DS5A 1D9DA 1U2VB 4FLWA 4JD2A 3L2RA 1GOAA 1HUXA 3BF1A 1B9DA 1NGAA 3T1AA 2XRIA 1HJOA 2HVIA 4NO7A 3OYKA 3IAYA 2G8VA 3VQPA 4LF8K 1ZC6A 3BZKA 1QS4A 4UQGA 3E9OA 2DY4A 3LAKA 4CD1A 4CGFA 3K9JA 3ZETB 4FW1A 3EYZA 1I94K 2HHHK 1S5JA 2KLAA 2YX6A 3K57A 2E1YA 4BRIA 1TK5A 2HOEA 3K5MA 3LDOA 4FWKA 3DXMA 1ASWA 2IVNA 4BWMA 2QW9A 5KRTA 4YORA 4C8LA 4FW2A 3H6EA 4CBWA 5AZJB 2ZM6K 3SUOA 3OYJA 3B6PA 5KGWA 1NM1A
chains in the Genus database with same CATH topology
4DFKA 2PY5A 1JLFA 4KO0A 3TAGA 4C8MA 1TL3A 4ICLA 4I2QA 4FK0A 1RBSA 2VG5A 4DTUA 1BISA 4DFMA 1TVRA 3L3UA 4ZHRA 1J54A 4RW4A 3HXMA 4CHOA 2HHUA 3MECA 2DY4A 3AV9A 3DRRA 3NFAA 1RTDA 4RG8A 4M41A 3OVNA 4B9LA 1NK9A 4FJ5A 4O44A 4DU3A 1HYSA 4FM0A 4CEOA 3C94A 3QIOA 3CYMA 1S6PA 1TKTA 4KHWA 2OPSA 4I7FA 4KTWA 4HVJA 4PWDA 4CK1A 3OYBA 4PQUA 4CERA 2FBYA 3OYAA 3NDKA 3KK3A 1RNHA 2XY6A 3NBPA 3OS0A 3VQ5A 1C1BA 1XC9A 1NJZA 3S9HA 1RT4A 3S3NA 2OA8A 3SCXA 3LAMA 4CEZA 4BE1A 3PV8A 2BE2A 1CXQA 3TARA 1BL3A 3HL8A 4FLYA 2P5OA 3OYLA 4LSLA 3VQAA 4FYDA 2YNIA 4CJTA 4OLBA 3DRPA 4DLGA 5C24A 4B08A 1QSLA 4E0DA 1S1TA 4CEQA 4YNQA 2KFZA 3K5NA 1Q9YA 2DTUA 1ZYQA 4DTJA 3CFOA 3RRHA 2X78A 3VQQA 1RBVA 3AVFA 4FJGA 4BWJA 2HHXA 1NJWA 1C0MA 1MU2A 1RDCA 3QIPA 2ATQA 5CZ1A 3KLHA 1KRPA 4FZYA 3HVTA 4KFBA 3NH0A 3O3FA 5HRRA 1DTTA 4M3TA 4TSXA 3O3HA 3JYTA 2E4LA 4DTRA 4DF4A 4Y1CA 5I3UA 1UAXA 1ITGA 4IG0A 3PUFA 4JS4A 1WSGA 3LPUA 4H8KA 4RW8A 5CYQA 2YNGA 5CYMA 4W5RA 1NK5A 4DWIA 1C1AA 4OGEA 5EU7A 3HVRA 2BANA 2HHWA 3CFRA 3MXJA 1SKSA 3OYGA 3DRSA 4EP4A 4FLXA 1EETA 1BCMA 3T3FA 3V9ZA 3KK2A 4N5SA 1T05A 4Z4GA 4E1MA 3M8QA 4CJ5A 4M42A 1JXBA 3AA2A 4WE1A 4CEEA 1VSJA 3B6OA 4BE0A 1HNIA 4KREA 5HBMA 4DTOA 4CJLA 3KKRA 4R5PA 2O4GA 4DS4A 4Q0BA 4CJSA 3VN5A 3ISNC 1VSFA 4DLEA 3S3MA 4PY5A 2HHTA 1RTJA 3P83D 3SI6A 2WOMA 4H4MA 2AJQA 3LP3A 4FJMA 3ZCMA 4DTSA 3IG1A 1WLJA 4CJRA 4JRPA 1BIUA 3UIQA 1GOCA 3DI6A 1ZBUA 4QOZB 3V1OA 1QHTA 3V9XA 1EP4A 4H4OA 3O3GA 3C6TA 4OGCA 4HUGA 4DTNA 3TAPA 1D5AA 2Q3SA 2D0BA 1RCHA 1L5UA 1JLAA 1G15A 1TGOA 1RDDA 5JS2A 3OYFA 3NGIA 4KI4A 2XY5A 3SYZA 4M45A 4IDKA 4W5TA 3NGZA 4IFYA 1SV5A 2YKNA 1QSYA 4FK2A 1VSEA 4J2BA 3M8SA 3RMBA 1TV6A 3DYAA 4B9UA 4HTUA 4FJHA 4FVMA 3DLEA 3K2PA 3HK2A 1YTUA 2ZQBA 1LWFA 1XI1A 3V1QA 1HPZA 2A1RA 3L2QA 4CHYA 1CLQA 2IS3A 2HHVA 3QETA 3EY1A 1VSIA 4YFUA 2WONA 4KHUA 3RR8A 1Z26A 1N6QA 1X9MA 2HHSA 1L3SA 2GBZA 1LW0A 4CGGA 4FJXA 4LD0A 2OZSA 3AVJA 2YNFA 3V4IA 1DLOA 4KI6A 3OYNA 4CJUA 2YHAA 2Z1JA 4HCCA 2HB5A 4OKJA 4FK4A 4DU1A 1WNSA 1RBRA 4OJRA 3ZT1A 3VA3A 4F2RA 4RW6A 4W5QA 4ZTFA 3G10A 3G0ZA 2KW4A 2JLEA 2BGGA 1TKXA 3AVHA 4O5BA 4AH9A 4BACA 2NUBA 1XHXA 4C8OA 4HCBA 2X6NA 3P1GA 3PY8A 1F21A 2VG7A 3VQ6A 2G8IA 1RDAA 3JSMA 4BE2A 4CGDA 3WNHA 1NOYA 4LH5A 3KTQA 1RT1A 5HRSA 4DTPA 4ELVA 2PZSA 4CESA 4ZTJA 4ELUA 4B9NA 4FLZA 3TAMA 1TKDA 2VWJA 4CK3A 1EXQA 1JKHA 2OYQA 4CEAA 1LAVA 5J2PA 2EHGA 1BGXT 2IC3A 1KVAA 3KIOA 5FDLA 4C8NA 1EX4A 3RMCA 2RPIA 5J2NA 4KV8A 3F73A 1NK6A 1BIZA 1WAFA 2IGIA 1JLCA 5KRSA 2FBTA 4HUEA 4Z4IA 3KLEA 5K14A 3P5JA 3QINA 2IDOA 4Y1DA 5CZ2A 1U45A 2BDPA 4L8RB 3CG7A 3A2FA 4CEDA 4CFBA 3NE6A 3NF6A 3RWUA 2QXFA 3K5OA 2ZD1A 4ID5A 1K6YA 3V1RA 5HRPA 1WAJA 1L3TA 4CCHA 1JLEA 1JLBA 1NJYA 4Z4EA 2GUIA 3TWHA 3ZSQA 1VSLA 3AVLA 4Z0UA 3D45A 4I9QA 2KZMA 3VQ7A 4JLHA 3L8BA 3QEXA 4KTZA 3LP1A 3K58A 1L3UA 3KKSA 3VQBA 1WSEA 2X74A 3OYHA 2FBVA 3DLGA 2YKMA 1ASVA 1JLGA 3I0SA 3KLIA 5FRMA 4FJIA 1IKWA 1BI4B 2JGUA 3MEDA 1KCFA 4JS5A 1SL1A 3VQEA 2IOCA 3FFIA 1SKWA 1WN7A 3WNEA 5DMRA 1CZ9A 2I5JA 3NHGA 2IAJA 2OPRA 4CF8A 5HP1A 3DOKA 3I0RA 3NH1A 3AO2A 1X9WA 1EKEA 4NYNA 4AHVA 4F4KA 4DSJA 3RTVA 1U47A 3VQ4A 4B8AB 2Z1HA 3ALYA 3CM6A 2GV9A 4BDYA 2Y1JA 1TAQA 1ZBFA 2VWKA 1XWLA 2E6LA 3OYMA 1RDBA 2F8TA 4E7KA 5KI6A 3ZSZA 3OJSA 1QQCA 1JXEA 3NAEA 3ZSYA 3PO5A 2Z1IA 2G8FA 2OPPA 4AHCA 4FZZA 4FM2A 1VRTA 4E7HA 3QEIA 2B6AA 1RBTA 4CGJA 1S6QA 2HNYA 3KLGA 1Q8IA 1HYVA 4DMNA 1FXXA 2DFEA 4CHQA 2KFNA 3LZJA 4EZ6A 1L3VA 3NF7A 1D8YA 1REVA 2D5RA 4RW9A 4CJQA 4KHYA 1BCOA 4FLTA 1RILA 4HHTA 3PX6A 1O1WA 3HO1A 3ULDA 1ASUA 3ZSRA 2D0AA 1SL0A 5FRNA 2X6SA 4MQ3A 4DFPA 1VK0A 1LWCA 1LV5A 4B9MA 3LDSA 4DQIA 2A1SA 3HPGA 3ITHA 4E1NA 3SNNA 3OY9A 4FJJA 4OLAA 2PYLA 3WNFA 4E7IA 3U6FA 4MFBA 3CFPA 4KB0A 3AA3A 5C25A 3SV4A 4O55A 3NH2A 1FK9A 3V9UA 3AVNA 1NK4A 2YHBA 3BDPA 5J2MA 3ZSOA 1IKYA 3L3VA 1KSPA 3D0PA 4O4GA 1TAUA 1SL2A 4DF8A 3ZT3A 1RT3A 1JL2A 4KB1A 4FJKA 2B5JA 5E41A 4CEBA 3THVA 3ZSWA 3DLBA 2FBXA 4F3OA 1C6VA 4FLUA 3VQDA 3CQ8A 4GMJB 1A5XA 3SUQA 3OYEA 4CJFA 3MAQA 3RMAA 3K5LA 1SKRA 2RF2A 2FC0A 1S1XA 3PO4A 2VG6A 1U04A 1WSIA 4CJ3A 1KVCA 1U48A 3DLHA 1C1CA 1KLMA 3MEEA 3QEWA 3RRGA 4XIUA 3LZIA 2W42A 4Z4HA 4M3UA 4CF2A 4M3WA 1R0AA 3HP9A 4FJ9A 3NF9A 2G8HA 4KHNA 4W5OA 2XO7A 1S1WA 4Z4FA 3I8DA 1IH7A 3HJFA 1A5VA 4IG3A 3TR8A 2DFHA 3H08A 4CIFA 4CJKA 2DFFA 3TAFA 4F8RA 3KLFA 1Z25A 3HM9A 3IRXA 5D3GA 4AHRA 4E89A 1ZBIA 1RT5A 1KVBA 1IG9A 3SQ1A 4OKEA 4I9LA 3AO4A 5C42A 4CJPA 1S1UA 3SUNA 4J2AA 1TL1A 4CJ4A 5KGXA 1KFDA 4AHSA 3AA4A 4CGHA 4CHZA 5HRNA 2R7YA 1X9SA 3V9SA 5J1EA 5I42A 1X1PA 5FROA 1UOCA 4RW7A 1NK7A 3M8RA 3V81A 2P51A 5SWMA 4BDZA 3AVKA 4FJ8A 1YT3A 3C6UA 1U49A 1NKEA 1UA0A 4CECA 1JL1A 2KTQA 3ZSXA 3HYFA 3QNOA 3SV3A 3QEVA 2OPQA 4FJNA 1FKPA 1JLQA 4N41A 3SJJA 1LWEA 3OS1A 3TAQA 5JS1A 1RTIA 4FXDA 4KHSA 2G8WA 1IKVA 4IFVA 2Z1GA 4NCGA 4CF0A 5SZTA 4JRQA 3SQ4A 3ZT4A 3U3GA 3OYIA 2LSNA 3DLRA 3V9WA 3KD5E 4NCAA 4EP5A 4OVLA 4KAZA 4IBNA 1HRHA 3M8PA 1VSKA 4AHTA 2PYJA 3HT3A 4B3OA 4E7LA 2P5GA 2RN2A 2O4IA 1TK0A 1ZBLA 4M3XA 5T7BA 2HMIA 1I3AA 1FKOA 3AO5A 3LALA 4DQRA 3VQ9A 3LANA 5CY4A 3QLHA 1HQUA 3SPZA 4NYFA 1HYZA 1IKXA 4DSEA 4HUFA 1XHZA 4DSKA 4E7JA 1KFSA 4KTQA 1VRUA 3DLKA 4CIEA 4OPKA 1S9GA 1BI4A 2HNDA 4KKOA 2HVHA 2ITGA 3VA0A 3O4NA 4E3SA 1T7PA 3LWMA 3AA5X 3RMDA 4B9SA 1NOZA 4K8XA 1ZBHA 3AVAA 2QKBA 1C0UA 3NGYA 3LP2A 1NKCA 1QE1A 3AO3A 2D0CA 4NCBA 3L2WA 5J2QA 4J2DA 1RT7A 3S3OA 3SPYA 3KJVA 4IKFA 3F9KA 4B8CA 4DU4A 3SQ0A 1CXUA 3TI0A 3SUPA 4W5NA 3HPOA 4ID1A 3LPTA 4DQSA 4CIGA 2E6MA 4CJWA 4K8ZA 1VSDA 3BGRA 2KZZA 3PX4A 4FJ7A 3OS2A 3TAEA 3LWLA 1J5OA 3MXIA 1QTMA 4EZ9A 4CGIA 3VQCA 1D9FA 1J53A 3NCIA 3ASMA 3WNGA 1RTHA 4C8KA 2XY8A 4FJLA 1UA1A 3SQ2A 1BHLA 3MEGA 1IO2A 3HP6A 3EZ5A 1KTQA 1LAWA 2P1JA 4I2PA 3L2VA 3HPHA 5DK5A 3V6DA 4CJVA 2OZMA 3RR7A 2XY7A 2B4JA 3O4QA 4BDPA 4LY7A 4Z4CA 1LW2A 2YV0X 3AVCA 4CF9A 3OYCA 1NJXA 1Q9XA 4N47A 3DMJA 4Q5VA 1BQNA 4DG1A 4FM1A 2HHQA 3ZSVA 4CE9A 3AVBA 4CHNA 1HQEA 1U4BA 4PA1A 1WSJA 1S1VA 4LH4A 4DQPA 4DQQA 4N76A 4DSIA 4CJEA 1NKBA 3HSTB 2ZE2A 1TK8A 2EX3A 4M3RA 1WSHA 1N5YA 3TABA 3DOLA 5KTQA 3IS9A 3SZ2A 5HLFA 1SUQA 4N56A 4J2EA 1VSMA 3QO9A 1RT6A 4CFAA 2Y1IA 2F8SA 3OJUA 3QERA 1TKZA 2XHBA 1GOBA 3ZT2A 4DS5A 3MXMA 1QSSA 4FLVA 3DM2A 3KD1E 4CHPA 1D9DA 3ZT0A 1W9HA 4FLWA 1B9FA 4CFCA 1HMVA 3OYDA 1YTAA 3U3YA 3TANA 1J9AA 4KPYA 3LP0A 3L2RA 3QNNA 1GOAA 1B9DA 3L2UA 4PUOA 4OPJA 3T1AA 2XRIA 4OKKA 4M3ZA 4LSNA 2HVIA 1HJRA 2ETJA 4QAGA 1CZBA 4GW6A 1W0HA 3OYKA 1T8EA 4AILC 2HNZA 3IAYA 4B9VA 1DTQA 4DFJA 1NK0A 3VQPA 1VSHA 2G8KA 2G8VA 4UQGA 1QS4A 1RT2A 2QKKA 3PX0A 3AVMA 1WSFA 3LAKA 4AHUA 3C95A 4O0JA 3AVGA 4CGFA 4DTMA 3QESA 2HW3A 1S9EA 4FW1A 3T19A 4DSLA 4KHQA 3EYZA 4KRFA 4DTXA 2RKIA 4FCYA 2KQ2A 3K59A 4CEFA 3NF8A 5HROA 1B92A 3QEPA 1S5JA 3KK1A 3K57A 2YNHA 4F3TA 4QCLA 4GVMA 1NK8A 4CK2A 1TK5A 1KLNA 4DSFA 3CM5A 4FZXC 1A5WA 1HNVA 2G8UA 4M3YA 3VQ8A 1YVUA 3K5MA 1Y97A 1RBUA 3AVIA 1ASWA 3AO1A 4BWMA 4G1QA 4CF1A 5KRTA 3E01A 1BQMA 4E19A 4O0IA 4C8LA 4FW2A 4B9TA 4ELTA 1T03A 3SUOA 1C0TA 2F96A 3OYJA 2QK9A 3B6PA 1UWBA 4F2SA 5KGWA 4CFDA 1I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DFK A;  2PY5 A;  1JLF A;  4KO0 A;  3TAG A;  4C8M A;  1TL3 A;  4ICL A;  4I2Q A;  4FK0 A;  1RBS A;  2VG5 A;  4DTU A;  1BIS A;  4DFM A;  1TVR A;  3L3U A;  4ZHR A;  1J54 A;  4RW4 A;  3HXM A;  4CHO A;  2HHU A;  3MEC A;  2DY4 A;  3AV9 A;  3DRR A;  3NFA A;  1RTD A;  4RG8 A;  4M41 A;  3OVN A;  4B9L A;  1NK9 A;  4FJ5 A;  4O44 A;  4DU3 A;  1HYS A;  4FM0 A;  4CEO A;  3C94 A;  3QIO A;  3CYM A;  1S6P A;  1TKT A;  4KHW A;  2OPS A;  4I7F A;  4KTW A;  4HVJ A;  4PWD A;  4CK1 A;  3OYB A;  4PQU A;  4CER A;  2FBY A;  3OYA A;  3NDK A;  3KK3 A;  1RNH A;  2XY6 A;  3NBP A;  3OS0 A;  3VQ5 A;  1C1B A;  1XC9 A;  1NJZ A;  3S9H A;  1RT4 A;  3S3N A;  2OA8 A;  3SCX A;  3LAM A;  4CEZ A;  4BE1 A;  3PV8 A;  2BE2 A;  1CXQ A;  3TAR A;  1BL3 A;  3HL8 A;  4FLY A;  2P5O A;  3OYL A;  4LSL A;  3VQA A;  4FYD A;  2YNI A;  4CJT A;  4OLB A;  3DRP A;  4DLG A;  5C24 A;  4B08 A;  1QSL A;  4E0D A;  1S1T A;  4CEQ A;  4YNQ A;  2KFZ A;  3K5N A;  1Q9Y A;  2DTU A;  1ZYQ A;  4DTJ A;  3CFO A;  3RRH A;  2X78 A;  3VQQ A;  1RBV A;  3AVF A;  4FJG A;  4BWJ A;  2HHX A;  1NJW A;  1C0M A;  1MU2 A;  1RDC A;  3QIP A;  2ATQ A;  5CZ1 A;  3KLH A;  1KRP A;  4FZY A;  3HVT A;  4KFB A;  3NH0 A;  3O3F A;  5HRR A;  1DTT A;  4M3T A;  4TSX A;  3O3H A;  3JYT A;  2E4L A;  4DTR A;  4DF4 A;  4Y1C A;  5I3U A;  1UAX A;  1ITG A;  4IG0 A;  3PUF A;  4JS4 A;  1WSG A;  3LPU A;  4H8K A;  4RW8 A;  5CYQ A;  2YNG A;  5CYM A;  4W5R A;  1NK5 A;  4DWI A;  1C1A A;  4OGE A;  5EU7 A;  3HVR A;  2BAN A;  2HHW A;  3CFR A;  3MXJ A;  1SKS A;  3OYG A;  3DRS A;  4EP4 A;  4FLX A;  1EET A;  1BCM A;  3T3F A;  3V9Z A;  3KK2 A;  4N5S A;  1T05 A;  4Z4G A;  4E1M A;  3M8Q A;  4CJ5 A;  4M42 A;  1JXB A;  3AA2 A;  4WE1 A;  4CEE A;  1VSJ A;  3B6O A;  4BE0 A;  1HNI A;  4KRE A;  5HBM A;  4DTO A;  4CJL A;  3KKR A;  4R5P A;  2O4G A;  4DS4 A;  4Q0B A;  4CJS A;  3VN5 A;  3ISN C;  1VSF A;  4DLE A;  3S3M A;  4PY5 A;  2HHT A;  1RTJ A;  3P83 D;  3SI6 A;  2WOM A;  4H4M A;  2AJQ A;  3LP3 A;  4FJM A;  3ZCM A;  4DTS A;  3IG1 A;  1WLJ A;  4CJR A;  4JRP A;  1BIU A;  3UIQ A;  1GOC A;  3DI6 A;  1ZBU A;  4QOZ B;  3V1O A;  1QHT A;  3V9X A;  1EP4 A;  4H4O A;  3O3G A;  3C6T A;  4OGC A;  4HUG A;  4DTN A;  3TAP A;  1D5A A;  2Q3S A;  2D0B A;  1RCH A;  1L5U A;  1JLA A;  1G15 A;  1TGO A;  1RDD A;  5JS2 A;  3OYF A;  3NGI A;  4KI4 A;  2XY5 A;  3SYZ A;  4M45 A;  4IDK A;  4W5T A;  3NGZ A;  4IFY A;  1SV5 A;  2YKN A;  1QSY A;  4FK2 A;  1VSE A;  4J2B A;  3M8S A;  3RMB A;  1TV6 A;  3DYA A;  4B9U A;  4HTU A;  4FJH A;  4FVM A;  3DLE A;  3K2P A;  3HK2 A;  1YTU A;  2ZQB A;  1LWF A;  1XI1 A;  3V1Q A;  1HPZ A;  2A1R A;  3L2Q A;  4CHY A;  1CLQ A;  2IS3 A;  2HHV A;  3QET A;  3EY1 A;  1VSI A;  4YFU A;  2WON A;  4KHU A;  3RR8 A;  1Z26 A;  1N6Q A;  1X9M A;  2HHS A;  1L3S A;  2GBZ A;  1LW0 A;  4CGG A;  4FJX A;  4LD0 A;  2OZS A;  3AVJ A;  2YNF A;  3V4I A;  1DLO A;  4KI6 A;  3OYN A;  4CJU A;  2YHA A;  2Z1J A;  4HCC A;  2HB5 A;  4OKJ A;  4FK4 A;  4DU1 A;  1WNS A;  1RBR A;  4OJR A;  3ZT1 A;  3VA3 A;  4F2R A;  4RW6 A;  4W5Q A;  4ZTF A;  3G10 A;  3G0Z A;  2KW4 A;  2JLE A;  2BGG A;  1TKX A;  3AVH A;  4O5B A;  4AH9 A;  4BAC A;  2NUB A;  1XHX A;  4C8O A;  4HCB A;  2X6N A;  3P1G A;  3PY8 A;  1F21 A;  2VG7 A;  3VQ6 A;  2G8I A;  1RDA A;  3JSM A;  4BE2 A;  4CGD A;  3WNH A;  1NOY A;  4LH5 A;  3KTQ A;  1RT1 A;  5HRS A;  4DTP A;  4ELV A;  2PZS A;  4CES A;  4ZTJ A;  4ELU A;  4B9N A;  4FLZ A;  3TAM A;  1TKD A;  2VWJ A;  4CK3 A;  1EXQ A;  1JKH A;  2OYQ A;  4CEA A;  1LAV A;  5J2P A;  2EHG A;  1BGX T;  2IC3 A;  1KVA A;  3KIO A;  5FDL A;  4C8N A;  1EX4 A;  3RMC A;  2RPI A;  5J2N A;  4KV8 A;  3F73 A;  1NK6 A;  1BIZ A;  1WAF A;  2IGI A;  1JLC A;  5KRS A;  2FBT A;  4HUE A;  4Z4I A;  3KLE A;  5K14 A;  3P5J A;  3QIN A;  2IDO A;  4Y1D A;  5CZ2 A;  1U45 A;  2BDP A;  4L8R B;  3CG7 A;  3A2F A;  4CED A;  4CFB A;  3NE6 A;  3NF6 A;  3RWU A;  2QXF A;  3K5O A;  2ZD1 A;  4ID5 A;  1K6Y A;  3V1R A;  5HRP A;  1WAJ A;  1L3T A;  4CCH A;  1JLE A;  1JLB A;  1NJY A;  4Z4E A;  2GUI A;  3TWH A;  3ZSQ A;  1VSL A;  3AVL A;  4Z0U A;  3D45 A;  4I9Q A;  2KZM A;  3VQ7 A;  4JLH A;  3L8B A;  3QEX A;  4KTZ A;  3LP1 A;  3K58 A;  1L3U A;  3KKS A;  3VQB A;  1WSE A;  2X74 A;  3OYH A;  2FBV A;  3DLG A;  2YKM A;  1ASV A;  1JLG A;  3I0S A;  3KLI A;  5FRM A;  4FJI A;  1IKW A;  1BI4 B;  2JGU A;  3MED A;  1KCF A;  4JS5 A;  1SL1 A;  3VQE A;  2IOC A;  3FFI A;  1SKW A;  1WN7 A;  3WNE A;  5DMR A;  1CZ9 A;  2I5J A;  3NHG A;  2IAJ A;  2OPR A;  4CF8 A;  5HP1 A;  3DOK A;  3I0R A;  3NH1 A;  3AO2 A;  1X9W A;  1EKE A;  4NYN A;  4AHV A;  4F4K A;  4DSJ A;  3RTV A;  1U47 A;  3VQ4 A;  4B8A B;  2Z1H A;  3ALY A;  3CM6 A;  2GV9 A;  4BDY A;  2Y1J A;  1TAQ A;  1ZBF A;  2VWK A;  1XWL A;  2E6L A;  3OYM A;  1RDB A;  2F8T A;  4E7K A;  5KI6 A;  3ZSZ A;  3OJS A;  1QQC A;  1JXE A;  3NAE A;  3ZSY A;  3PO5 A;  2Z1I A;  2G8F A;  2OPP A;  4AHC A;  4FZZ A;  4FM2 A;  1VRT A;  4E7H A;  3QEI A;  2B6A A;  1RBT A;  4CGJ A;  1S6Q A;  2HNY A;  3KLG A;  1Q8I A;  1HYV A;  4DMN A;  1FXX A;  2DFE A;  4CHQ A;  2KFN A;  3LZJ A;  4EZ6 A;  1L3V A;  3NF7 A;  1D8Y A;  1REV A;  2D5R A;  4RW9 A;  4CJQ A;  4KHY A;  1BCO A;  4FLT A;  1RIL A;  4HHT A;  3PX6 A;  1O1W A;  3HO1 A;  3ULD A;  1ASU A;  3ZSR A;  2D0A A;  1SL0 A;  5FRN A;  2X6S A;  4MQ3 A;  4DFP A;  1VK0 A;  1LWC A;  1LV5 A;  4B9M A;  3LDS A;  4DQI A;  2A1S A;  3HPG A;  3ITH A;  4E1N A;  3SNN A;  3OY9 A;  4FJJ A;  4OLA A;  2PYL A;  3WNF A;  4E7I A;  3U6F A;  4MFB A;  3CFP A;  4KB0 A;  3AA3 A;  5C25 A;  3SV4 A;  4O55 A;  3NH2 A;  1FK9 A;  3V9U A;  3AVN A;  1NK4 A;  2YHB A;  3BDP A;  5J2M A;  3ZSO A;  1IKY A;  3L3V A;  1KSP A;  3D0P A;  4O4G A;  1TAU A;  1SL2 A;  4DF8 A;  3ZT3 A;  1RT3 A;  1JL2 A;  4KB1 A;  4FJK A;  2B5J A;  5E41 A;  4CEB A;  3THV A;  3ZSW A;  3DLB A;  2FBX A;  4F3O A;  1C6V A;  4FLU A;  3VQD A;  3CQ8 A;  4GMJ B;  1A5X A;  3SUQ A;  3OYE A;  4CJF A;  3MAQ A;  3RMA A;  3K5L A;  1SKR A;  2RF2 A;  2FC0 A;  1S1X A;  3PO4 A;  2VG6 A;  1U04 A;  1WSI A;  4CJ3 A;  1KVC A;  1U48 A;  3DLH A;  1C1C A;  1KLM A;  3MEE A;  3QEW A;  3RRG A;  4XIU A;  3LZI A;  2W42 A;  4Z4H A;  4M3U A;  4CF2 A;  4M3W A;  1R0A A;  3HP9 A;  4FJ9 A;  3NF9 A;  2G8H A;  4KHN A;  4W5O A;  2XO7 A;  1S1W A;  4Z4F A;  3I8D A;  1IH7 A;  3HJF A;  1A5V A;  4IG3 A;  3TR8 A;  2DFH A;  3H08 A;  4CIF A;  4CJK A;  2DFF A;  3TAF A;  4F8R A;  3KLF A;  1Z25 A;  3HM9 A;  3IRX A;  5D3G A;  4AHR A;  4E89 A;  1ZBI A;  1RT5 A;  1KVB A;  1IG9 A;  3SQ1 A;  4OKE A;  4I9L A;  3AO4 A;  5C42 A;  4CJP A;  1S1U A;  3SUN A;  4J2A A;  1TL1 A;  4CJ4 A;  5KGX A;  1KFD A;  4AHS A;  3AA4 A;  4CGH A;  4CHZ A;  5HRN A;  2R7Y A;  1X9S A;  3V9S A;  5J1E A;  5I42 A;  1X1P A;  5FRO A;  1UOC A;  4RW7 A;  1NK7 A;  3M8R A;  3V81 A;  2P51 A;  5SWM A;  4BDZ A;  3AVK A;  4FJ8 A;  1YT3 A;  3C6U A;  1U49 A;  1NKE A;  1UA0 A;  4CEC A;  1JL1 A;  2KTQ A;  3ZSX A;  3HYF A;  3QNO A;  3SV3 A;  3QEV A;  2OPQ A;  4FJN A;  1FKP A;  1JLQ A;  4N41 A;  3SJJ A;  1LWE A;  3OS1 A;  3TAQ A;  5JS1 A;  1RTI A;  4FXD A;  4KHS A;  2G8W A;  1IKV A;  4IFV A;  2Z1G A;  4NCG A;  4CF0 A;  5SZT A;  4JRQ A;  3SQ4 A;  3ZT4 A;  3U3G A;  3OYI A;  2LSN A;  3DLR A;  3V9W A;  3KD5 E;  4NCA A;  4EP5 A;  4OVL A;  4KAZ A;  4IBN A;  1HRH A;  3M8P A;  1VSK A;  4AHT A;  2PYJ A;  3HT3 A;  4B3O A;  4E7L A;  2P5G A;  2RN2 A;  2O4I A;  1TK0 A;  1ZBL A;  4M3X A;  5T7B A;  2HMI A;  1I3A A;  1FKO A;  3AO5 A;  3LAL A;  4DQR A;  3VQ9 A;  3LAN A;  5CY4 A;  3QLH A;  1HQU A;  3SPZ A;  4NYF A;  1HYZ A;  1IKX A;  4DSE A;  4HUF A;  1XHZ A;  4DSK A;  4E7J A;  1KFS A;  4KTQ A;  1VRU A;  3DLK A;  4CIE A;  4OPK A;  1S9G A;  1BI4 A;  2HND A;  4KKO A;  2HVH A;  2ITG A;  3VA0 A;  3O4N A;  4E3S A;  1T7P A;  3LWM A;  3AA5 X;  3RMD A;  4B9S A;  1NOZ A;  4K8X A;  1ZBH A;  3AVA A;  2QKB A;  1C0U A;  3NGY A;  3LP2 A;  1NKC A;  1QE1 A;  3AO3 A;  2D0C A;  4NCB A;  3L2W A;  5J2Q A;  4J2D A;  1RT7 A;  3S3O A;  3SPY A;  3KJV A;  4IKF A;  3F9K A;  4B8C A;  4DU4 A;  3SQ0 A;  1CXU A;  3TI0 A;  3SUP A;  4W5N A;  3HPO A;  4ID1 A;  3LPT A;  4DQS A;  4CIG A;  2E6M A;  4CJW A;  4K8Z A;  1VSD A;  3BGR A;  2KZZ A;  3PX4 A;  4FJ7 A;  3OS2 A;  3TAE A;  3LWL A;  1J5O A;  3MXI A;  1QTM A;  4EZ9 A;  4CGI A;  3VQC A;  1D9F A;  1J53 A;  3NCI A;  3ASM A;  3WNG A;  1RTH A;  4C8K A;  2XY8 A;  4FJL A;  1UA1 A;  3SQ2 A;  1BHL A;  3MEG A;  1IO2 A;  3HP6 A;  3EZ5 A;  1KTQ A;  1LAW A;  2P1J A;  4I2P A;  3L2V A;  3HPH A;  5DK5 A;  3V6D A;  4CJV A;  2OZM A;  3RR7 A;  2XY7 A;  2B4J A;  3O4Q A;  4BDP A;  4LY7 A;  4Z4C A;  1LW2 A;  2YV0 X;  3AVC A;  4CF9 A;  3OYC A;  1NJX A;  1Q9X A;  4N47 A;  3DMJ A;  4Q5V A;  1BQN A;  4DG1 A;  4FM1 A;  2HHQ A;  3ZSV A;  4CE9 A;  3AVB A;  4CHN A;  1HQE A;  1U4B A;  4PA1 A;  1WSJ A;  1S1V A;  4LH4 A;  4DQP A;  4DQQ A;  4N76 A;  4DSI A;  4CJE A;  1NKB A;  3HST B;  2ZE2 A;  1TK8 A;  2EX3 A;  4M3R A;  1WSH A;  1N5Y A;  3TAB A;  3DOL A;  5KTQ A;  3IS9 A;  3SZ2 A;  5HLF A;  1SUQ A;  4N56 A;  4J2E A;  1VSM A;  3QO9 A;  1RT6 A;  4CFA A;  2Y1I A;  2F8S A;  3OJU A;  3QER A;  1TKZ A;  2XHB A;  1GOB A;  3ZT2 A;  4DS5 A;  3MXM A;  1QSS A;  4FLV A;  3DM2 A;  3KD1 E;  4CHP A;  1D9D A;  3ZT0 A;  1W9H A;  4FLW A;  1B9F A;  4CFC A;  1HMV A;  3OYD A;  1YTA A;  3U3Y A;  3TAN A;  1J9A A;  4KPY A;  3LP0 A;  3L2R A;  3QNN A;  1GOA A;  1B9D A;  3L2U A;  4PUO A;  4OPJ A;  3T1A A;  2XRI A;  4OKK A;  4M3Z A;  4LSN A;  2HVI A;  1HJR A;  2ETJ A;  4QAG A;  1CZB A;  4GW6 A;  1W0H A;  3OYK A;  1T8E A;  4AIL C;  2HNZ A;  3IAY A;  4B9V A;  1DTQ A;  4DFJ A;  1NK0 A;  3VQP A;  1VSH A;  2G8K A;  2G8V A;  4UQG A;  1QS4 A;  1RT2 A;  2QKK A;  3PX0 A;  3AVM A;  1WSF A;  3LAK A;  4AHU A;  3C95 A;  4O0J A;  3AVG A;  4CGF A;  4DTM A;  3QES A;  2HW3 A;  1S9E A;  4FW1 A;  3T19 A;  4DSL A;  4KHQ A;  3EYZ A;  4KRF A;  4DTX A;  2RKI A;  4FCY A;  2KQ2 A;  3K59 A;  4CEF A;  3NF8 A;  5HRO A;  1B92 A;  3QEP A;  1S5J A;  3KK1 A;  3K57 A;  2YNH A;  4F3T A;  4QCL A;  4GVM A;  1NK8 A;  4CK2 A;  1TK5 A;  1KLN A;  4DSF A;  3CM5 A;  4FZX C;  1A5W A;  1HNV A;  2G8U A;  4M3Y A;  3VQ8 A;  1YVU A;  3K5M A;  1Y97 A;  1RBU A;  3AVI A;  1ASW A;  3AO1 A;  4BWM A;  4G1Q A;  4CF1 A;  5KRT A;  3E01 A;  1BQM A;  4E19 A;  4O0I A;  4C8L A;  4FW2 A;  4B9T A;  4ELT A;  1T03 A;  3SUO A;  1C0T A;  2F96 A;  3OYJ A;  2QK9 A;  3B6P A;  1UWB A;  4F2S A;  5KGW A;  4CFD A;  1I39 A; 
#chains in the Genus database with same CATH topology
 4DFK A;  3E9P A;  2PY5 A;  3ATV A;  4X62 K;  5JLF A;  1TL3 A;  3ZYY X;  4U7B A;  5AQJ A;  2O8D A;  3L3U A;  1J54 A;  3HXM A;  4CHO A;  2D4W A;  3DRR A;  3OVN A;  2P9N B;  4O44 A;  4DU3 A;  4FJ5 A;  1N33 K;  3C94 A;  4ILH A;  3G4S N;  1BA0 A;  1HPM A;  4I7F A;  4PWD A;  4CK1 A;  5LJW A;  3OYB A;  4BC5 A;  4PQU A;  2FBY A;  2Q2R A;  4FSV A;  2XY6 A;  1RNH A;  1NJZ A;  3NBP A;  2P9P B;  3S3N A;  2P9I B;  3QBX A;  1T44 A;  4CEZ A;  2BE2 A;  4UY8 O;  1IBM K;  5B8H A;  3OYL A;  4FYD A;  1P90 A;  4BRD A;  5BPL A;  5TKW A;  3DRP A;  5C24 A;  3SLC A;  5AQK A;  4LFB K;  1BUP A;  1S1T A;  1Q9Y A;  4DTJ A;  5AQX A;  2QA4 N;  4FJG A;  3AVF A;  4BRK A;  1E4F T;  3VER A;  2HHX A;  1NJW A;  1C0M A;  2ZJR L;  3QIP A;  5ADX H;  2ATQ A;  1KRP A;  1DTT A;  4M3T A;  4H0P A;  1UAX A;  1ITG A;  3KHY A;  4IG0 A;  2QEX N;  3ATU A;  3A5M C;  4PL7 A;  2HHW A;  3HVR A;  4JYA K;  4RTF D;  4BRO A;  1BCM A;  1Q18 A;  4N5S A;  4M42 A;  3M8Q A;  4CJ5 A;  2O8C A;  4WE1 A;  4CZF A;  4MDA A;  2W6L A;  3KKR A;  4R5P A;  4H5R A;  2PAV A;  2O8F B;  3ZX3 A;  4BRQ A;  4DLE A;  3S3M A;  4PY5 A;  4H4M A;  3CMA N;  1TUU A;  4FJM A;  4JK9 A;  3D7E O;  4DTS A;  3JS6 A;  1WLJ A;  4CZH A;  1QHA A;  1BIU A;  4EAH D;  2FXU A;  4PHT X;  3O3G A;  4PKH A;  4OGC A;  1YAG A;  5AFU H;  1S22 A;  2D0B A;  1TGO A;  2WC9 A;  3NGZ A;  4IFY A;  1QSY A;  4J2B A;  2V7Y A;  3M8S A;  4HTU A;  3EL2 A;  4NLC A;  3LM2 A;  4CI6 A;  1LWF A;  2W40 A;  3I8B A;  3HBT A;  2A1R A;  1CLQ A;  1GLD G;  3EY1 A;  2P9K A;  3J7A P;  4JI2 K;  1XQS C;  1L3S A;  2GBZ A;  2W6K A;  3VTI A;  4FJX A;  4LD0 A;  4JKA A;  4IOA L;  4CJU A;  5BR9 A;  2Z1J A;  4JD2 B;  3VEN A;  4HCC A;  3GL1 A;  3T7Z A;  2V7Z A;  2E2P A;  3VA3 A;  3W0L A;  4DUZ K;  4W5Q A;  3HTV A;  3G10 A;  3G0Z A;  3H3O B;  3AVH A;  4AH9 A;  4BAC A;  2NRX A;  4JKB A;  2UXD K;  2X6N A;  5AQZ A;  4B9Q A;  3EKU A;  4GKK K;  1YVN A;  3W3D A;  3JSM A;  2PZS A;  1HR0 K;  4RCH A;  3TSQ A;  2QWO A;  1LAV A;  3KIO A;  4WFN L;  1BIZ A;  1WAF A;  3CJ7 A;  3C6A A;  4Z4I A;  2PFU A;  1JCF A;  3EKS A;  2FSJ A;  3THX B;  2GTD A;  3NF6 A;  4ID5 A;  3K0S A;  1K6Y A;  1WBB A;  1HKB A;  2FF3 B;  4H5W A;  4I9Q A;  3EN9 A;  4DKW A;  3CET A;  3L8B A;  4KTZ A;  2O8C B;  3K58 A;  3OYH A;  1K8K B;  4JI6 K;  1JLG A;  2QWR A;  3I0S A;  3KLI A;  4H5N A;  2CH6 A;  3I56 N;  5IT9 O;  5FRM A;  4JHD A;  2E1Z A;  3VEW A;  3JXU A;  1MA9 B;  4R79 A;  5AQS A;  1SKW A;  2I5J A;  3NHG A;  3D2F A;  3I0R A;  3NH1 A;  4NYN A;  2P9L B;  3HOT A;  4K25 A;  4DSJ A;  1WOQ A;  1NGH A;  3GDQ A;  1U47 A;  3HZ6 A;  4B8A B;  3ALY A;  2Y1J A;  2VWK A;  4Z94 A;  4E7K A;  3ZSZ A;  3NAE A;  4BRL A;  1JXE A;  2Z1I A;  2G8F A;  2OPP A;  3N4P A;  4A57 A;  1RBT A;  4CGJ A;  1HYV A;  4JKD A;  4JI0 K;  2KFN A;  1REV A;  1RIL A;  4HHT A;  4B3R K;  2D0A A;  5FRN A;  2X6S A;  2GWJ A;  1LV5 A;  4DV0 K;  4DQI A;  3HPG A;  4E1N A;  2NRZ A;  3P4I A;  3H1Q A;  2PYL A;  4GNI A;  4A5A A;  1Q86 O;  3AA3 A;  4E1J A;  5C25 A;  4CBU A;  5AZI B;  4H0O A;  1FK9 A;  3AVN A;  3ZSO A;  5AQO A;  3D0P A;  2ZWH A;  4OPH A;  4YOU A;  4DF8 A;  3J81 O;  3GOI A;  4FJK A;  5E41 A;  4CEB A;  3ZSW A;  1NGF A;  1J5E K;  4FLU A;  4GMJ B;  3MAQ A;  2OTL N;  2RF2 A;  4BC4 A;  3WXK A;  1U04 A;  4AQY K;  1U48 A;  1C1C A;  5AQI A;  3QEW A;  4IXC A;  3GG4 A;  4XIU A;  2A5X A;  4M3W A;  1R0A A;  2D0P A;  3NF9 A;  4KHN A;  4W5O A;  2Q1N A;  4ISE A;  1A5V A;  4IG3 A;  4OO1 J;  4BRP A;  2DFF A;  3HM9 A;  5D3G A;  4E89 A;  4WQ4 C;  1WB9 A;  3AO4 A;  1S1U A;  5KGX A;  3AA4 A;  5BR8 K;  1QVG M;  1X9S A;  5I42 A;  5M1Q A;  4GVE A;  4IFE A;  3DJC A;  4BDZ A;  4JV5 K;  3SBT A;  4XH5 A;  2QWQ A;  1K8A O;  1JL1 A;  4YHH K;  3AAP A;  4CZI A;  1KAX A;  4N41 A;  1GLL O;  1RTI A;  3O9R A;  4BR9 A;  4LF9 K;  1ATS A;  3SQ4 A;  4CZG A;  3U3G A;  2LSN A;  3DLR A;  5I9E B;  5JLH A;  3KD5 E;  4OVL A;  1DT9 A;  2A41 A;  4KAZ A;  1VSK A;  1SZ2 A;  2YHW A;  3CHW A;  2O4I A;  4BG8 A;  4M3X A;  3FR0 A;  5T7B A;  3AAQ A;  3WUH A;  1I3A A;  1ATN A;  3SPZ A;  3FZM A;  3CJA A;  3HRG A;  1NGE A;  4DSK A;  1KFS A;  4KTQ A;  3DLK A;  1VQL N;  2A42 A;  4E3S A;  4K8X A;  1ZBH A;  4M63 C;  3NGY A;  4WF9 L;  2FLO A;  1RT7 A;  5AQG A;  3PSI A;  3OBY A;  3SQ0 A;  3SUP A;  3OBW A;  1G99 A;  2E6M A;  4FJ7 A;  3MMV A;  3WNG A;  5LMN K;  4C8K A;  5BRD A;  3MEG A;  4IJN A;  3EZ5 A;  3ZEU A;  1LAW A;  2P1J A;  3WQU A;  3HPH A;  3DXM B;  4CJV A;  3CCJ N;  4OX9 K;  3RR7 A;  3F9M A;  4Z4C A;  1LW2 A;  1NJX A;  4CHN A;  1U4B A;  1WSJ A;  4LH4 A;  5JIC A;  3LL3 A;  1K9M O;  4DSI A;  3KWG A;  3BZC A;  3O1B A;  2ZE2 A;  3SMS A;  1IV0 A;  3DOL A;  3C65 A;  1RT6 A;  3LDQ A;  4CFA A;  5GAG P;  2Y1I A;  3FE1 A;  3QER A;  3O9Q A;  1GOB A;  3DXK B;  4I6M B;  3MXM A;  4IJA A;  4FLV A;  1W9H A;  3U3Y A;  4U67 L;  2VGM A;  4PUO A;  1BG3 A;  3FZK A;  4C23 A;  2QWM A;  4LSN A;  1HJR A;  4QAG A;  1CZB A;  4GW6 A;  1HKC A;  2YHX A;  1T8E A;  4AIL C;  1DTQ A;  5LJV A;  1VSH A;  1RT2 A;  3IMX A;  3PX0 A;  4AHU A;  4O0J A;  4DSL A;  4BR5 A;  1H1V A;  2ASO A;  4DTX A;  4FCY A;  2KQ2 A;  3K59 A;  2VYP A;  2P9S B;  1B92 A;  4FWM A;  3KK1 A;  4C1N K;  1KLN A;  4WQ4 A;  1IJJ A;  2ITM A;  1YVU A;  4WQ5 A;  1NWK A;  1RBU A;  3QB0 A;  3D2E A;  2BH1 A;  4G1Q A;  1QZ5 A;  4CF1 A;  4O0I A;  1BQM A;  3THW B;  4B9T A;  4MLE A;  3P38 A;  5E84 A;  4QS9 A;  4F2S A;  4FWL A;  4KH6 A;  1EWQ A;  4RWT A;  4LC9 B;  4I2Q A;  2O8E A;  2VG5 A;  4DTU A;  4ZHR A;  4L3Q A;  4RW4 A;  2HHU A;  2VWB A;  4LFC K;  3AV9 A;  3CD6 N;  1S72 N;  4RG8 A;  4B9L A;  4C1N I;  1HYS A;  1C0F A;  2OPS A;  4HVJ A;  5KPT A;  3NVK A;  3A8Y A;  4LF6 K;  3NDK A;  3KK3 A;  1GLC G;  3WEE B;  1XC9 A;  1C1B A;  3SCX A;  3EE9 A;  1BL3 A;  1T3V A;  3J7Z O;  2P5O A;  2YNI A;  4CZK A;  1RDW X;  2Q31 A;  4WYB A;  3RVC A;  4CJT A;  4DLG A;  3VEV A;  4OLB A;  1VAZ A;  3Q7B A;  5EY4 A;  4YNQ A;  5C2F A;  3RRH A;  3VQQ A;  4BWJ A;  4H5T A;  3THY A;  1ZBS A;  1WBD A;  5CZ1 A;  4FZY A;  2YHY A;  3F5T A;  3O3F A;  4BRH A;  4G9Z A;  4DF4 A;  3R8E A;  2FSK A;  1WSG A;  3LPU A;  4H8K A;  4RW8 A;  2YNG A;  1NK5 A;  4DWI A;  1C1A A;  4OGE A;  1X3N A;  3OTO K;  4KH5 A;  3CFR A;  3MXJ A;  2VCP A;  4EP4 A;  4CEE A;  4H0T B;  5EOY A;  4KRE A;  2O4G A;  3VN5 A;  3ISN C;  3CC2 N;  1VSF A;  3MX2 A;  1RTJ A;  4FWP A;  5AQV A;  3LP3 A;  5BRE A;  2WBN A;  1N32 K;  2RHK A;  3IG1 A;  4CJR A;  5AQH A;  1GOC A;  3DI6 A;  1ZBU A;  2IVO A;  4QOZ B;  4V19 S;  1QHT A;  1EP4 A;  3J7Y P;  1WUA A;  2QM1 A;  3TAP A;  1NMN A;  1L5U A;  3NGI A;  1RDD A;  3E1Y A;  4JKF A;  3GE1 A;  3SYZ A;  4IDK A;  1SV5 A;  3RMB A;  4FVM A;  3DLE A;  2ZQB A;  3L2Q A;  2W41 A;  4FVU A;  4KHU A;  2WON A;  4BRE A;  3TU5 A;  4X65 K;  1N6Q A;  3AVJ A;  2YNF A;  3V4I A;  1DLO A;  3OYN A;  3G25 A;  2P9U B;  1R59 O;  2E20 A;  3DXK A;  1W97 L;  4LFA K;  1WNS A;  3ZT1 A;  4F2R A;  1BOT O;  4RW6 A;  1SAZ A;  5H1S Q;  5TKY A;  2QWL A;  3G71 N;  2JLE A;  3R9P A;  2NUB A;  3U9Z A;  3P1G A;  3CME N;  3QIC A;  5M1N A;  1F21 A;  1RDU A;  3UKU A;  4BY9 C;  2G8I A;  1RDA A;  3BF3 A;  2A40 A;  2IIR A;  3F2K A;  4QS8 A;  4ZTJ A;  3QFP A;  3TAM A;  1VQ5 N;  2VWJ A;  5CHI A;  1VQK N;  3U8X A;  1GLB G;  5BRH A;  4C8N A;  4A61 A;  2IGI A;  5KRS A;  2A3Z A;  3E66 A;  5M1F A;  2V52 B;  5K14 A;  5CZ2 A;  2IDO A;  2BDP A;  3NE6 A;  4EIA A;  3CCU N;  2ZD1 A;  5HRP A;  4BR7 A;  4Z4E A;  3AVL A;  3D45 A;  4JLH A;  3LP1 A;  3KKS A;  1NGG A;  2X74 A;  1V4S A;  1YI2 N;  5BRF A;  4FJI A;  1IKW A;  3DAW A;  5FPM A;  1KCF A;  3FZL A;  3VQE A;  3K9K A;  4LF5 K;  4K42 A;  2IAJ A;  2OPR A;  4CF8 A;  3DOK A;  3CCE N;  1Y64 A;  3ZX2 A;  3CM6 A;  2GV9 A;  1ILY A;  1TAQ A;  1ZBF A;  2E6L A;  1RDB A;  3WQT A;  2QI2 A;  1QQC A;  4B3T K;  2OAN A;  2B6A A;  4FWN A;  5AQU A;  3MN6 A;  3U4L A;  4JEP A;  1FXX A;  3LZJ A;  4EZ6 A;  2NRH A;  1L3V A;  3NF7 A;  4RW9 A;  1HNZ K;  4DQ8 A;  4FLT A;  3ULD A;  3ZSR A;  4MQ3 A;  4DFP A;  1VK0 A;  2A1S A;  3SNN A;  1GLE G;  3WNF A;  3U6F A;  4KB0 A;  2WFB A;  5ELZ A;  4BG9 A;  3CCR N;  3CPE A;  5IWA K;  2YHB A;  3P39 A;  4ISF A;  5J2M A;  3BDP A;  1IKY A;  3L3V A;  1KSP A;  4CVN E;  4O4G A;  4CBX A;  3ZT3 A;  4HWI A;  4KB1 A;  1YIJ N;  3A5O C;  3TTC A;  5LL6 Z;  3CQ8 A;  3SUQ A;  4Y0W A;  4CJF A;  1VQ8 N;  2FC0 A;  4CJ3 A;  5DM6 L;  5JVH L;  3RRG A;  2W42 A;  4Z4H A;  3EEQ A;  3HP9 A;  1S1W A;  3CC7 N;  1OH8 A;  3TR8 A;  3BEX A;  4CIF A;  4CJK A;  2YJF A;  4F8R A;  1Z25 A;  4AHR A;  3O5B A;  1KVB A;  3HSC A;  3ENH A;  4CJP A;  4CJ4 A;  3CJ1 A;  4CGH A;  5HRN A;  2R7Y A;  5EVZ A;  2YJE A;  3ENB A;  4BR2 A;  4FWO A;  5KPR A;  4RW7 A;  3AVK A;  4FJ8 A;  3JAM O;  2ASP A;  1N34 K;  4YOT A;  3ZSX A;  1W7A A;  5DM7 L;  3QEV A;  1C0G A;  5AFU A;  5C0Y A;  3SJJ A;  1HKG A;  3OS1 A;  1FJG K;  4DB3 A;  2VGN A;  3P31 A;  4CF0 A;  1EO1 A;  4NCG A;  3ZT4 A;  1DGK N;  4B1Y B;  2IVP A;  3UKU B;  4FWR A;  3M8P A;  4IO8 A;  1IBK K;  3C6H A;  2DPN A;  4E7L A;  2RN2 A;  2HBJ A;  1OH6 A;  1N36 K;  2HMI A;  2Q0R A;  4DR7 K;  1FKO A;  3AO5 A;  4HTL A;  4JI4 K;  3VQ9 A;  3LAN A;  5AQQ A;  3D2F B;  4CZJ A;  3FZH A;  4HUF A;  1S9G A;  1NNE A;  1BI4 A;  2HND A;  4KKO A;  2HVH A;  3NVM A;  3O4N A;  3CCL N;  4B9S A;  3AA5 X;  3CJB A;  1VQN N;  3LP2 A;  1QE1 A;  3AO3 A;  2D0C A;  4BQZ A;  4NCB A;  4DR6 K;  5J2Q A;  1T6C A;  2O8F A;  4DR3 K;  3TI0 A;  3BUZ B;  3VET A;  4KBO A;  3LPT A;  4ISG A;  1NU0 A;  4CJW A;  1W2B M;  4DUY K;  1J5O A;  1QTM A;  2ZF5 O;  4CJ7 A;  2XY8 A;  1M90 O;  1BHL A;  3CJC A;  4I2P A;  1TYQ A;  3L2V A;  3CQX A;  2XY7 A;  2B4J A;  4BDP A;  3TSP A;  2Q0U A;  3M3Z A;  4CF9 A;  1QQO A;  3OYC A;  4N47 A;  4DG1 A;  2KHO A;  3ZSV A;  4JKC A;  1HQE A;  3ZX0 A;  4N76 A;  3HST B;  2EX3 A;  4FO0 A;  4M3R A;  1N5Y A;  1SQK A;  3TAB A;  4PL8 A;  4B1W B;  3SZ2 A;  5HLF A;  1SUQ A;  4J2E A;  2D0O A;  3CER A;  5AQF A;  1TKZ A;  2F7T A;  2XHB A;  4B1V A;  3DM2 A;  3H3N O;  3TAN A;  1J9A A;  4KPY A;  5E26 A;  3LP0 A;  3O9S A;  4JI5 K;  4K0K K;  5GIN A;  1NGD A;  1Q7Y O;  3H45 C;  2E88 A;  5M1P A;  1W0H A;  3VEX A;  2HNZ A;  4B9V A;  2ZGZ A;  4DFJ A;  3AVM A;  1WSF A;  1NGI A;  3R3L A;  1VQ4 N;  1VQ7 N;  3J80 O;  1S9E A;  4A62 A;  4H0V B;  2OTJ N;  4CEF A;  3QEP A;  3VMF B;  4QCL A;  4F3T A;  4CK2 A;  4B1X B;  3CM5 A;  1A5W A;  1HNV A;  2P9P A;  2QXL A;  2ZJP L;  2G8U A;  3VQ8 A;  1XNQ K;  3THW A;  1Y97 A;  1VHX A;  4E19 A;  2O8B A;  4F9O A;  4ELT A;  3EO3 A;  1T03 A;  5AQT A;  4BRG A;  4JKG A;  4CFD A;  1I39 A;  4GV3 A;  1JLF A;  4KO0 A;  1XUP O;  3TAG A;  4C8M A;  3ID6 A;  4ICL A;  2O8E B;  2EWS A;  1RBS A;  1IG8 A;  3O4W A;  3ZET A;  1BIS A;  5BN9 A;  2ASM A;  1DEJ A;  4AM6 A;  3MEC A;  3THX A;  3QIO A;  1S6P A;  1TKT A;  4FPB A;  4KHW A;  4KTW A;  4CER A;  4B1Z A;  3OYA A;  3OS0 A;  3VQ5 A;  1M1K O;  4M7X A;  3S9H A;  1OH5 A;  2HBK A;  3QFU A;  3LAM A;  4BE1 A;  3PV8 A;  1CXQ A;  3HL8 A;  3C0B A;  3H46 O;  3CIP A;  2E2Q A;  3IFR A;  4B08 A;  1XMO K;  1N8R O;  4E0D A;  3SAH A;  2DTU A;  3G6E N;  3CFO A;  4IZ9 A;  1MU2 A;  4IOC L;  3KLH A;  3HVT A;  4KFB A;  4CW7 B;  1GLJ O;  5HRR A;  3IKM A;  4DV5 K;  4DTR A;  4Y1C A;  4WQ5 C;  4JKH A;  3O9T A;  5MLC Q;  3U9D A;  5EU7 A;  5ADX A;  4DR2 K;  1SKS A;  3OYG A;  4Z4G A;  4NB4 A;  3KK2 A;  4E1M A;  3SBG A;  3AA2 A;  1VSJ A;  1QQN A;  3B6O A;  4BE0 A;  5HBM A;  4DTO A;  4A59 A;  4CJS A;  2NZT A;  3P83 D;  1NLV A;  4GV6 A;  5C10 A;  3ZCM A;  1X9J A;  3UIQ A;  5LY3 A;  4PKI A;  2HBM A;  3C6T A;  4DTN A;  1D5A A;  2Q3S A;  1RCH A;  5BPN A;  1JLA A;  3VOV A;  2XY5 A;  4M45 A;  4W5T A;  5AQP A;  3SMP A;  4FWS A;  2JWK A;  1VSE A;  4BR4 A;  4B3S K;  4B9U A;  1XI1 A;  3V1Q A;  1HPZ A;  4IEI A;  2HHV A;  2CGL A;  3QET A;  2NRW A;  4ILJ A;  1VSI A;  4YFU A;  3QML A;  3RR8 A;  1Z26 A;  1X9M A;  2F9T A;  4MDB A;  1LW0 A;  4CGG A;  2OZS A;  4XH1 A;  4H0Y B;  4KI6 A;  3PSF A;  4FK4 A;  2P9N A;  1RBR A;  4FWQ A;  4AM7 A;  4ZTF A;  2NRT A;  1IBL K;  2KW4 A;  2BGG A;  4C8O A;  1XHX A;  3OW2 M;  3VQ6 A;  5HL7 L;  3VEZ A;  4CGD A;  3WNH A;  1LOT B;  1NOY A;  3KTQ A;  5HRS A;  4B9N A;  1JKH A;  2OYQ A;  4MO4 A;  1BA1 A;  5J2P A;  1BGX T;  4JI1 K;  3RMC A;  5J2N A;  4KV8 A;  2YCH A;  1O13 A;  1JLC A;  3VEY A;  2Q36 A;  5KQD A;  4KHP K;  3KLE A;  3QIN A;  4Y1D A;  1U45 A;  1ATR A;  3VTH A;  3CXC M;  3CCV N;  4CFB A;  3K5O A;  3KVG A;  3V1R A;  1L3T A;  4CCH A;  1JLE A;  1JLB A;  1NJY A;  3TWH A;  4NXM K;  3KK7 A;  4CD3 A;  4Z0U A;  1U6Z A;  2KZM A;  3VQ7 A;  1L3U A;  1MWK A;  3DLG A;  2YKM A;  3QBW A;  5M1K A;  3MED A;  1BI4 B;  2JGU A;  3SK3 A;  1SL1 A;  4DHY A;  1SS6 A;  2IOC A;  3FFI A;  1WN7 A;  3WNE A;  1VQ9 N;  5DMR A;  1CZ9 A;  3WXJ A;  1DKG D;  1OVY A;  5HP1 A;  3PLA A;  1U2V A;  4I6M A;  2UUB K;  1X9W A;  4AHV A;  4F4K A;  2P9S A;  4ILG B;  3RTV A;  3TPQ A;  4IEE A;  3VQ4 A;  2Z1H A;  1KD1 O;  4BDY A;  1XWL A;  2F8T A;  5KI6 A;  3M5R A;  4BVO A;  4CZL A;  3ZSY A;  4FZZ A;  4FM2 A;  1VRT A;  3VF6 A;  4E7H A;  3QEI A;  5AZI A;  1S6Q A;  3VEO A;  4CHQ A;  3AY9 A;  1D8Y A;  2D5R A;  4JKE A;  1BCO A;  3PX6 A;  5A2Q O;  5CR4 A;  4BRF A;  4B9M A;  4FJJ A;  3ITH A;  4OLA A;  3OY9 A;  1NJI O;  1JCE A;  3MN9 A;  4E7I A;  3A5N C;  5EXW A;  3V9U A;  1NK4 A;  4MO5 A;  4WFB L;  4YOY A;  5AJ3 K;  4OPA A;  3PIP L;  1SL2 A;  1FW6 A;  4O5F A;  1RT3 A;  1JL2 A;  3DLB A;  3LM9 A;  2O8B B;  5AR0 A;  3VPZ A;  4A5B A;  3K5L A;  3EE8 A;  1S1X A;  1T6D A;  2VG6 A;  1KVC A;  1NG9 A;  3DLH A;  3MEE A;  4EHU A;  4K41 A;  3S41 A;  1K73 O;  4LF4 K;  4FJ9 A;  4DV4 K;  3CCM N;  2G8H A;  2CH5 A;  1IH7 A;  3HJF A;  1K8K A;  2DFH A;  3TAF A;  5JS1 A;  3KLF A;  3IRX A;  2AA4 A;  1RT5 A;  4OKE A;  3WXM B;  5C42 A;  2GUP A;  1TL1 A;  1HNW K;  4JNE A;  1YXQ A;  4AF1 A;  4BRN A;  3CQY A;  3V9S A;  4NLB A;  5J1E A;  3BP8 A;  4DV7 K;  1X1P A;  5FRO A;  1UOC A;  1NK7 A;  3M8R A;  4YDU C;  1YT3 A;  3C6U A;  3N4Q A;  1U49 A;  3PIO L;  1NKE A;  1J6Z A;  3T69 A;  1UA0 A;  2OCE A;  2KTQ A;  3FLC O;  4DV1 K;  3SV3 A;  4NXN K;  3MN7 A;  1FKP A;  3FGU A;  3M6G A;  4EFH A;  5BPM A;  4FXD A;  1IKV A;  4IFV A;  2Z1G A;  5SZT A;  4JRQ A;  3OYI A;  2NRV A;  4NCA A;  5GIP A;  1HRH A;  3I33 A;  1TUY A;  2P5G A;  1TK0 A;  3Q7C A;  4FL9 A;  4DQR A;  3LAL A;  3J8A A;  4YOX A;  3QLH A;  1HQU A;  1YUW A;  1HYZ A;  4B1U B;  3AGK A;  2Q97 A;  2PBD A;  5CE3 A;  4E7J A;  1VRU A;  1GLF O;  4DR4 K;  2ITG A;  3CI5 A;  4JHD B;  2QTD A;  3VA0 A;  4QS7 A;  1T7P A;  3LWM A;  1NOZ A;  2QKB A;  3AVA A;  1YJW N;  1NKC A;  3L2W A;  3CF5 L;  4IKF A;  4A2B A;  3L4I A;  4B8C A;  5BN8 A;  4DU4 A;  1CXU A;  4W5N A;  3HPO A;  2V51 B;  1KAZ A;  1YHQ N;  4CIG A;  4K8Z A;  5C12 A;  2KZZ A;  4JKG B;  3PX4 A;  3LWL A;  1S3X A;  4CGI A;  3VQC A;  1D9F A;  2A6A A;  2QWN A;  3RSE B;  3NCI A;  1RTH A;  4FJL A;  3SQ2 A;  3HP6 A;  3DLL L;  2YI1 A;  5DK5 A;  4BGB A;  2OZM A;  5AQM A;  3AVC A;  2E5L K;  1X3M A;  5GAH P;  4CE9 A;  3AVB A;  4PA1 A;  4CJE A;  1NKB A;  1TK8 A;  4FPA A;  1QZ6 A;  5FLX O;  2H3G X;  4N56 A;  1VSM A;  3QO9 A;  2F8S A;  3ZT2 A;  1QSS A;  3KD1 E;  4CHP A;  3ZT0 A;  1B9F A;  4CFC A;  2P9U A;  1HMV A;  3ENO A;  1YTA A;  3OYD A;  3QNN A;  3L2U A;  4OPJ A;  4M3Z A;  4OKK A;  2ETJ A;  1EWR A;  3WXL A;  4X64 K;  2CGJ A;  4IDH A;  1NK0 A;  2G8K A;  3O80 A;  2QKK A;  4DTM A;  2E8A A;  3C95 A;  2HW3 A;  3AVG A;  3QES A;  4KHQ A;  3T19 A;  2GEM A;  4KRF A;  2RKI A;  1P8Z A;  2HMP A;  3NF8 A;  1KXP A;  2P9L A;  3MDQ A;  2YNH A;  4GVM A;  3VGK A;  1NK8 A;  2UU9 K;  4DSF A;  1VQP N;  4FZX C;  4M3Y A;  1KC8 O;  3KWI A;  1VQO N;  3ULE B;  3FFK B;  3AVI A;  3AO1 A;  1TYQ B;  1OVQ A;  4WCE L;  3E01 A;  3RSE A;  5GIO A;  1KAY A;  4JK7 A;  1C0T A;  3IDH A;  2F96 A;  2QK9 A;  1UWB A;  4FOI A;  5HRO A;  5KQ8 A;  1E3M A;  2UUA K;  4FK0 A;  4DFM A;  1TVR A;  2WTU A;  4GV9 A;  5C2D A;  3OA9 A;  4XEI A;  1MDU B;  3NFA A;  1E4G T;  4BC2 A;  1RTD A;  4EHT A;  4M41 A;  1NK9 A;  4FM0 A;  4CEO A;  3CYM A;  1Q82 O;  3ULE A;  3LDP A;  2HBL A;  3UKR B;  1RT4 A;  2OA8 A;  3TAR A;  1OKJ A;  1EQY A;  4FLY A;  4LSL A;  3VQA A;  2UXB K;  3OHR A;  1OH7 A;  4K43 A;  5AQR A;  1QSL A;  4BQL A;  4CEQ A;  2KFZ A;  3K5N A;  1VQ6 N;  1ZYQ A;  1Z05 A;  2BTF A;  2X78 A;  1RBV A;  3AAR A;  1RDC A;  1NMD A;  3UKR A;  3NH0 A;  3WEE A;  4TSX A;  3O3H A;  1HX1 A;  3JYT A;  2E4L A;  3TTD A;  5HOO A;  3T1H K;  3MK6 A;  5I3U A;  3PUF A;  4JS4 A;  5CYQ A;  5CYM A;  4W5R A;  2GX9 A;  2BAN A;  4YOW A;  3VF4 A;  2AJQ A;  4DCH A;  3DRS A;  1T05 A;  4FLX A;  1EET A;  3T3F A;  3V9Z A;  3UE5 A;  5FPN A;  1JXB A;  4BC3 A;  5FPE A;  5JMV A;  1HNI A;  2O8D B;  4CJL A;  4DS4 A;  1VQM N;  4Q0B A;  2HHT A;  3SI6 A;  2WOM A;  4X66 K;  1BWF O;  4YOV A;  4FOE A;  4CZE A;  3T1Y K;  3TSU A;  3VES A;  2I7P A;  3B8A X;  4JRP A;  1KQS M;  4BRC A;  3L0Q A;  3V1O A;  3V9X A;  3MCP A;  4CZM A;  4H4O A;  2AP1 A;  4HUG A;  4DV2 K;  1G15 A;  3OYF A;  4KI4 A;  5JS2 A;  2E2N A;  3KZB A;  1RFQ A;  2F9W A;  2YKN A;  4FK2 A;  1TV6 A;  3DYA A;  4FJH A;  3H1V X;  3TTF A;  3K2P A;  3HK2 A;  2VQE K;  1YTU A;  1XMQ K;  1HLU A;  4JN4 A;  4CHY A;  2IS3 A;  2JWL A;  1NGB A;  3MX5 A;  2HHS A;  1ESV A;  4PKG A;  2FF6 A;  3QDK A;  3R1X A;  4MLH A;  2D1K A;  2YHA A;  5KPZ A;  2HB5 A;  4OKJ A;  3UB5 A;  4DU1 A;  2BUP A;  4OJR A;  1YJN N;  2P9K B;  3M1F A;  5F2R A;  1TKX A;  3O1W A;  4O5B A;  4HCB A;  3PY8 A;  2ZJQ L;  2VG7 A;  2GWK A;  3O9U A;  1XC3 A;  1NBW A;  4BE2 A;  4ELV A;  3CPW M;  4LH5 A;  1RT1 A;  4ELU A;  4DTP A;  3AGR A;  4CES A;  2NRR A;  2CGK A;  4FLZ A;  2ZGY A;  1TKD A;  4JI7 K;  4CK3 A;  1EXQ A;  3WT0 A;  1ZXO A;  4CEA A;  2EHG A;  2KKZ A;  2IC3 A;  1KVA A;  5FDL A;  1EX4 A;  2RPI A;  3F73 A;  1NGC A;  1NK6 A;  2FBT A;  4WFA L;  4HUE A;  3ZEU B;  4JAX A;  4YY3 K;  3P5J A;  4L8R B;  3O6W A;  3SJH A;  3CG7 A;  3A2F A;  4CED A;  3RWU A;  2QXF A;  3CJ9 A;  2RE2 A;  1BO5 O;  1WAJ A;  3MWP A;  2GUI A;  4IOX A;  3ZSQ A;  1VSL A;  1Q81 O;  3CCQ N;  3QEX A;  3VQB A;  1WSE A;  2FBV A;  4J8F A;  5AZJ A;  1ASV A;  5F1X A;  4JK8 A;  2HF3 A;  4XH4 A;  3I55 N;  4JS5 A;  2J4R A;  1CZA N;  4YDU A;  3A5L C;  4A2A A;  3AO2 A;  3D6R A;  1EKE A;  1JJ2 M;  4IO9 L;  3SAG A;  4KH4 A;  1D4X A;  3IUC A;  3OYM A;  3OJS A;  3PO5 A;  2E2O A;  4O8K A;  3WXI A;  4AHC A;  3CCS N;  1GLA G;  5EX5 A;  2P9I A;  2HNY A;  3KLG A;  1Q8I A;  4LF7 K;  4DMN A;  5FPD A;  1YF5 L;  2DFE A;  5F0X A;  3VGL A;  3L4Q A;  4KHY A;  4CJQ A;  3HO1 A;  2GEL A;  1O1W A;  1ASU A;  4BRA A;  1SL0 A;  4DV3 K;  1LWC A;  3LDS A;  2NLX A;  4MFB A;  3CFP A;  1Z6R A;  3SV4 A;  4O55 A;  4BGA A;  3NH2 A;  3VF2 A;  3A0I X;  4BR0 A;  3O8M A;  1TAU A;  5C15 A;  4H0X B;  2B5J A;  3FZF A;  1JCG A;  3THV A;  4F3O A;  3VGM A;  2FBX A;  1C6V A;  3VQD A;  3ZLJ A;  1A5X A;  3ID8 A;  3OYE A;  1SKR A;  3RMA A;  2UUC K;  4JI3 K;  3PO4 A;  1WSI A;  1MWM A;  1KLM A;  1HNX K;  3LZI A;  3MWT A;  4M3U A;  4CF2 A;  1V4T A;  3LDN A;  2XO7 A;  4Z4F A;  3I8D A;  5AQW A;  2NNW A;  3H08 A;  3SAF A;  3MN5 A;  1ZBI A;  1IG9 A;  3SQ1 A;  4GY2 B;  3MCA B;  4I9L A;  3SUN A;  4J2A A;  1KFD A;  4AHS A;  1YIT N;  4CHZ A;  4BRM A;  3CC4 N;  3HOS A;  4M7Y A;  5GAD P;  4IWV A;  3V81 A;  2P51 A;  5SWM A;  2F4V K;  4CEC A;  4DR5 K;  3HYF A;  3QNO A;  4FJN A;  2OPQ A;  5LMU K;  1JLQ A;  4DV6 K;  1LWE A;  3TAQ A;  3THY B;  4O8U A;  4KHS A;  2G8W A;  3V9W A;  4EP5 A;  4IBN A;  4AHT A;  2PYJ A;  5AQL A;  3HT3 A;  4GKJ K;  1RGI A;  4B3O A;  1ZBL A;  1NGJ A;  2HF4 A;  2FSN A;  5CY4 A;  4NYF A;  1IKX A;  3EZW A;  1QVF M;  3C7N A;  4DSE A;  4DR1 K;  1XHZ A;  4CIE A;  4OPK A;  3HM8 A;  2QWP A;  4H03 B;  1XNR K;  3RMD A;  1C0U A;  3L6Q A;  3GBT A;  4J2D A;  3HI0 A;  3S3O A;  3SPY A;  3O08 A;  3DWL A;  3KJV A;  3F9K A;  2UYT A;  4ID1 A;  1BU6 O;  4DQS A;  4H5V A;  2VQF K;  3R6M A;  1YJ9 N;  1VSD A;  3BGR A;  5AQN A;  3C7N B;  2HST A;  3OS2 A;  3TAE A;  4EZ9 A;  3MXI A;  1J53 A;  3ASM A;  1UA1 A;  1IO2 A;  3LDL A;  1KTQ A;  1QQM A;  3D2E B;  1BDG A;  3V6D A;  3NMU A;  5AQY A;  3O4Q A;  3E9L A;  4LY7 A;  2YV0 X;  5M1O A;  1Q9X A;  3DMJ A;  4Q5V A;  1BQN A;  1LCU A;  2I7N A;  4FM1 A;  5GAE P;  2HHQ A;  1S1V A;  4DQP A;  4DQQ A;  4BVP A;  5JVG L;  2WUS A;  1WSH A;  2UXC K;  5KTQ A;  3IS9 A;  3BY5 A;  4B3M K;  4JI8 K;  3OJU A;  4DS5 A;  1D9D A;  1U2V B;  4FLW A;  4JD2 A;  3L2R A;  1GOA A;  1HUX A;  3BF1 A;  1B9D A;  1NGA A;  3T1A A;  2XRI A;  1HJO A;  2HVI A;  4NO7 A;  3OYK A;  3IAY A;  2G8V A;  3VQP A;  4LF8 K;  1ZC6 A;  3BZK A;  1QS4 A;  4UQG A;  3E9O A;  2DY4 A;  3LAK A;  4CD1 A;  4CGF A;  3K9J A;  3ZET B;  4FW1 A;  3EYZ A;  1I94 K;  2HHH K;  1S5J A;  2KLA A;  2YX6 A;  3K57 A;  2E1Y A;  4BRI A;  1TK5 A;  2HOE A;  3K5M A;  3LDO A;  4FWK A;  3DXM A;  1ASW A;  2IVN A;  4BWM A;  2QW9 A;  5KRT A;  4YOR A;  4C8L A;  4FW2 A;  3H6E A;  4CBW A;  5AZJ B;  2ZM6 K;  3SUO A;  3OYJ A;  3B6P A;  5KGW A;  1NM1 A; 
#chains in the Genus database with same CATH homology
 4DFK A;  2PY5 A;  1JLF A;  4KO0 A;  3TAG A;  4C8M A;  1TL3 A;  4ICL A;  4I2Q A;  4FK0 A;  1RBS A;  2VG5 A;  4DTU A;  1BIS A;  4DFM A;  1TVR A;  3L3U A;  4ZHR A;  1J54 A;  4RW4 A;  3HXM A;  4CHO A;  2HHU A;  3MEC A;  2DY4 A;  3AV9 A;  3DRR A;  3NFA A;  1RTD A;  4RG8 A;  4M41 A;  3OVN A;  4B9L A;  1NK9 A;  4FJ5 A;  4O44 A;  4DU3 A;  1HYS A;  4FM0 A;  4CEO A;  3C94 A;  3QIO A;  3CYM A;  1S6P A;  1TKT A;  4KHW A;  2OPS A;  4I7F A;  4KTW A;  4HVJ A;  4PWD A;  4CK1 A;  3OYB A;  4PQU A;  4CER A;  2FBY A;  3OYA A;  3NDK A;  3KK3 A;  1RNH A;  2XY6 A;  3NBP A;  3OS0 A;  3VQ5 A;  1C1B A;  1XC9 A;  1NJZ A;  3S9H A;  1RT4 A;  3S3N A;  2OA8 A;  3SCX A;  3LAM A;  4CEZ A;  4BE1 A;  3PV8 A;  2BE2 A;  1CXQ A;  3TAR A;  1BL3 A;  3HL8 A;  4FLY A;  2P5O A;  3OYL A;  4LSL A;  3VQA A;  4FYD A;  2YNI A;  4CJT A;  4OLB A;  3DRP A;  4DLG A;  5C24 A;  4B08 A;  1QSL A;  4E0D A;  1S1T A;  4CEQ A;  4YNQ A;  2KFZ A;  3K5N A;  1Q9Y A;  2DTU A;  1ZYQ A;  4DTJ A;  3CFO A;  3RRH A;  2X78 A;  3VQQ A;  1RBV A;  3AVF A;  4FJG A;  4BWJ A;  2HHX A;  1NJW A;  1C0M A;  1MU2 A;  1RDC A;  3QIP A;  2ATQ A;  5CZ1 A;  3KLH A;  1KRP A;  4FZY A;  3HVT A;  4KFB A;  3NH0 A;  3O3F A;  5HRR A;  1DTT A;  4M3T A;  4TSX A;  3O3H A;  3JYT A;  2E4L A;  4DTR A;  4DF4 A;  4Y1C A;  5I3U A;  1UAX A;  1ITG A;  4IG0 A;  3PUF A;  4JS4 A;  1WSG A;  3LPU A;  4H8K A;  4RW8 A;  5CYQ A;  2YNG A;  5CYM A;  4W5R A;  1NK5 A;  4DWI A;  1C1A A;  4OGE A;  5EU7 A;  3HVR A;  2BAN A;  2HHW A;  3CFR A;  3MXJ A;  1SKS A;  3OYG A;  3DRS A;  4EP4 A;  4FLX A;  1EET A;  1BCM A;  3T3F A;  3V9Z A;  3KK2 A;  4N5S A;  1T05 A;  4Z4G A;  4E1M A;  3M8Q A;  4CJ5 A;  4M42 A;  1JXB A;  3AA2 A;  4WE1 A;  4CEE A;  1VSJ A;  3B6O A;  4BE0 A;  1HNI A;  4KRE A;  5HBM A;  4DTO A;  4CJL A;  3KKR A;  4R5P A;  2O4G A;  4DS4 A;  4Q0B A;  4CJS A;  3VN5 A;  3ISN C;  1VSF A;  4DLE A;  3S3M A;  4PY5 A;  2HHT A;  1RTJ A;  3P83 D;  3SI6 A;  2WOM A;  4H4M A;  2AJQ A;  3LP3 A;  4FJM A;  3ZCM A;  4DTS A;  3IG1 A;  1WLJ A;  4CJR A;  4JRP A;  1BIU A;  3UIQ A;  1GOC A;  3DI6 A;  1ZBU A;  4QOZ B;  3V1O A;  1QHT A;  3V9X A;  1EP4 A;  4H4O A;  3O3G A;  3C6T A;  4OGC A;  4HUG A;  4DTN A;  3TAP A;  1D5A A;  2Q3S A;  2D0B A;  1RCH A;  1L5U A;  1JLA A;  1G15 A;  1TGO A;  1RDD A;  5JS2 A;  3OYF A;  3NGI A;  4KI4 A;  2XY5 A;  3SYZ A;  4M45 A;  4IDK A;  4W5T A;  3NGZ A;  4IFY A;  1SV5 A;  2YKN A;  1QSY A;  4FK2 A;  1VSE A;  4J2B A;  3M8S A;  3RMB A;  1TV6 A;  3DYA A;  4B9U A;  4HTU A;  4FJH A;  4FVM A;  3DLE A;  3K2P A;  3HK2 A;  1YTU A;  2ZQB A;  1LWF A;  1XI1 A;  3V1Q A;  1HPZ A;  2A1R A;  3L2Q A;  4CHY A;  1CLQ A;  2IS3 A;  2HHV A;  3QET A;  3EY1 A;  1VSI A;  4YFU A;  2WON A;  4KHU A;  3RR8 A;  1Z26 A;  1N6Q A;  1X9M A;  2HHS A;  1L3S A;  2GBZ A;  1LW0 A;  4CGG A;  4FJX A;  4LD0 A;  2OZS A;  3AVJ A;  2YNF A;  3V4I A;  1DLO A;  4KI6 A;  3OYN A;  4CJU A;  2YHA A;  2Z1J A;  4HCC A;  2HB5 A;  4OKJ A;  4FK4 A;  4DU1 A;  1WNS A;  1RBR A;  4OJR A;  3ZT1 A;  3VA3 A;  4F2R A;  4RW6 A;  4W5Q A;  4ZTF A;  3G10 A;  3G0Z A;  2KW4 A;  2JLE A;  2BGG A;  1TKX A;  3AVH A;  4O5B A;  4AH9 A;  4BAC A;  2NUB A;  1XHX A;  4C8O A;  4HCB A;  2X6N A;  3P1G A;  3PY8 A;  1F21 A;  2VG7 A;  3VQ6 A;  2G8I A;  1RDA A;  3JSM A;  4BE2 A;  4CGD A;  3WNH A;  1NOY A;  4LH5 A;  3KTQ A;  1RT1 A;  5HRS A;  4DTP A;  4ELV A;  2PZS A;  4CES A;  4ZTJ A;  4ELU A;  4B9N A;  4FLZ A;  3TAM A;  1TKD A;  2VWJ A;  4CK3 A;  1EXQ A;  1JKH A;  2OYQ A;  4CEA A;  1LAV A;  5J2P A;  2EHG A;  1BGX T;  2IC3 A;  1KVA A;  3KIO A;  5FDL A;  4C8N A;  1EX4 A;  3RMC A;  2RPI A;  5J2N A;  4KV8 A;  3F73 A;  1NK6 A;  1BIZ A;  1WAF A;  2IGI A;  1JLC A;  5KRS A;  2FBT A;  4HUE A;  4Z4I A;  3KLE A;  5K14 A;  3P5J A;  3QIN A;  2IDO A;  4Y1D A;  5CZ2 A;  1U45 A;  2BDP A;  4L8R B;  3CG7 A;  3A2F A;  4CED A;  4CFB A;  3NE6 A;  3NF6 A;  3RWU A;  2QXF A;  3K5O A;  2ZD1 A;  4ID5 A;  1K6Y A;  3V1R A;  5HRP A;  1WAJ A;  1L3T A;  4CCH A;  1JLE A;  1JLB A;  1NJY A;  4Z4E A;  2GUI A;  3TWH A;  3ZSQ A;  1VSL A;  3AVL A;  4Z0U A;  3D45 A;  4I9Q A;  2KZM A;  3VQ7 A;  4JLH A;  3L8B A;  3QEX A;  4KTZ A;  3LP1 A;  3K58 A;  1L3U A;  3KKS A;  3VQB A;  1WSE A;  2X74 A;  3OYH A;  2FBV A;  3DLG A;  2YKM A;  1ASV A;  1JLG A;  3I0S A;  3KLI A;  5FRM A;  4FJI A;  1IKW A;  1BI4 B;  2JGU A;  3MED A;  1KCF A;  4JS5 A;  1SL1 A;  3VQE A;  2IOC A;  3FFI A;  1SKW A;  1WN7 A;  3WNE A;  5DMR A;  1CZ9 A;  2I5J A;  3NHG A;  2IAJ A;  2OPR A;  4CF8 A;  5HP1 A;  3DOK A;  3I0R A;  3NH1 A;  3AO2 A;  1X9W A;  1EKE A;  4NYN A;  4AHV A;  4F4K A;  4DSJ A;  3RTV A;  1U47 A;  3VQ4 A;  4B8A B;  2Z1H A;  3ALY A;  3CM6 A;  2GV9 A;  4BDY A;  2Y1J A;  1TAQ A;  1ZBF A;  2VWK A;  1XWL A;  2E6L A;  3OYM A;  1RDB A;  2F8T A;  4E7K A;  5KI6 A;  3ZSZ A;  3OJS A;  1QQC A;  1JXE A;  3NAE A;  3ZSY A;  3PO5 A;  2Z1I A;  2G8F A;  2OPP A;  4AHC A;  4FZZ A;  4FM2 A;  1VRT A;  4E7H A;  3QEI A;  2B6A A;  1RBT A;  4CGJ A;  1S6Q A;  2HNY A;  3KLG A;  1Q8I A;  1HYV A;  4DMN A;  1FXX A;  2DFE A;  4CHQ A;  2KFN A;  3LZJ A;  4EZ6 A;  1L3V A;  3NF7 A;  1D8Y A;  1REV A;  2D5R A;  4RW9 A;  4CJQ A;  4KHY A;  1BCO A;  4FLT A;  1RIL A;  4HHT A;  3PX6 A;  1O1W A;  3HO1 A;  3ULD A;  1ASU A;  3ZSR A;  2D0A A;  1SL0 A;  5FRN A;  2X6S A;  4MQ3 A;  4DFP A;  1VK0 A;  1LWC A;  1LV5 A;  4B9M A;  3LDS A;  4DQI A;  2A1S A;  3HPG A;  3ITH A;  4E1N A;  3SNN A;  3OY9 A;  4FJJ A;  4OLA A;  2PYL A;  3WNF A;  4E7I A;  3U6F A;  4MFB A;  3CFP A;  4KB0 A;  3AA3 A;  5C25 A;  3SV4 A;  4O55 A;  3NH2 A;  1FK9 A;  3V9U A;  3AVN A;  1NK4 A;  2YHB A;  3BDP A;  5J2M A;  3ZSO A;  1IKY A;  3L3V A;  1KSP A;  3D0P A;  4O4G A;  1TAU A;  1SL2 A;  4DF8 A;  3ZT3 A;  1RT3 A;  1JL2 A;  4KB1 A;  4FJK A;  2B5J A;  5E41 A;  4CEB A;  3THV A;  3ZSW A;  3DLB A;  2FBX A;  4F3O A;  1C6V A;  4FLU A;  3VQD A;  3CQ8 A;  4GMJ B;  1A5X A;  3SUQ A;  3OYE A;  4CJF A;  3MAQ A;  3RMA A;  3K5L A;  1SKR A;  2RF2 A;  2FC0 A;  1S1X A;  3PO4 A;  2VG6 A;  1U04 A;  1WSI A;  4CJ3 A;  1KVC A;  1U48 A;  3DLH A;  1C1C A;  1KLM A;  3MEE A;  3QEW A;  3RRG A;  4XIU A;  3LZI A;  2W42 A;  4Z4H A;  4M3U A;  4CF2 A;  4M3W A;  1R0A A;  3HP9 A;  4FJ9 A;  3NF9 A;  2G8H A;  4KHN A;  4W5O A;  2XO7 A;  1S1W A;  4Z4F A;  3I8D A;  1IH7 A;  3HJF A;  1A5V A;  4IG3 A;  3TR8 A;  2DFH A;  3H08 A;  4CIF A;  4CJK A;  2DFF A;  3TAF A;  4F8R A;  3KLF A;  1Z25 A;  3HM9 A;  3IRX A;  5D3G A;  4AHR A;  4E89 A;  1ZBI A;  1RT5 A;  1KVB A;  1IG9 A;  3SQ1 A;  4OKE A;  4I9L A;  3AO4 A;  5C42 A;  4CJP A;  1S1U A;  3SUN A;  4J2A A;  1TL1 A;  4CJ4 A;  5KGX A;  1KFD A;  4AHS A;  3AA4 A;  4CGH A;  4CHZ A;  5HRN A;  2R7Y A;  1X9S A;  3V9S A;  5J1E A;  5I42 A;  1X1P A;  5FRO A;  1UOC A;  4RW7 A;  1NK7 A;  3M8R A;  3V81 A;  2P51 A;  5SWM A;  4BDZ A;  3AVK A;  4FJ8 A;  1YT3 A;  3C6U A;  1U49 A;  1NKE A;  1UA0 A;  4CEC A;  1JL1 A;  2KTQ A;  3ZSX A;  3HYF A;  3QNO A;  3SV3 A;  3QEV A;  2OPQ A;  4FJN A;  1FKP A;  1JLQ A;  4N41 A;  3SJJ A;  1LWE A;  3OS1 A;  3TAQ A;  5JS1 A;  1RTI A;  4FXD A;  4KHS A;  2G8W A;  1IKV A;  4IFV A;  2Z1G A;  4NCG A;  4CF0 A;  5SZT A;  4JRQ A;  3SQ4 A;  3ZT4 A;  3U3G A;  3OYI A;  2LSN A;  3DLR A;  3V9W A;  3KD5 E;  4NCA A;  4EP5 A;  4OVL A;  4KAZ A;  4IBN A;  1HRH A;  3M8P A;  1VSK A;  4AHT A;  2PYJ A;  3HT3 A;  4B3O A;  4E7L A;  2P5G A;  2RN2 A;  2O4I A;  1TK0 A;  1ZBL A;  4M3X A;  5T7B A;  2HMI A;  1I3A A;  1FKO A;  3AO5 A;  3LAL A;  4DQR A;  3VQ9 A;  3LAN A;  5CY4 A;  3QLH A;  1HQU A;  3SPZ A;  4NYF A;  1HYZ A;  1IKX A;  4DSE A;  4HUF A;  1XHZ A;  4DSK A;  4E7J A;  1KFS A;  4KTQ A;  1VRU A;  3DLK A;  4CIE A;  4OPK A;  1S9G A;  1BI4 A;  2HND A;  4KKO A;  2HVH A;  2ITG A;  3VA0 A;  3O4N A;  4E3S A;  1T7P A;  3LWM A;  3AA5 X;  3RMD A;  4B9S A;  1NOZ A;  4K8X A;  1ZBH A;  3AVA A;  2QKB A;  1C0U A;  3NGY A;  3LP2 A;  1NKC A;  1QE1 A;  3AO3 A;  2D0C A;  4NCB A;  3L2W A;  5J2Q A;  4J2D A;  1RT7 A;  3S3O A;  3SPY A;  3KJV A;  4IKF A;  3F9K A;  4B8C A;  4DU4 A;  3SQ0 A;  1CXU A;  3TI0 A;  3SUP A;  4W5N A;  3HPO A;  4ID1 A;  3LPT A;  4DQS A;  4CIG A;  2E6M A;  4CJW A;  4K8Z A;  1VSD A;  3BGR A;  2KZZ A;  3PX4 A;  4FJ7 A;  3OS2 A;  3TAE A;  3LWL A;  1J5O A;  3MXI A;  1QTM A;  4EZ9 A;  4CGI A;  3VQC A;  1D9F A;  1J53 A;  3NCI A;  3ASM A;  3WNG A;  1RTH A;  4C8K A;  2XY8 A;  4FJL A;  1UA1 A;  3SQ2 A;  1BHL A;  3MEG A;  1IO2 A;  3HP6 A;  3EZ5 A;  1KTQ A;  1LAW A;  2P1J A;  4I2P A;  3L2V A;  3HPH A;  5DK5 A;  3V6D A;  4CJV A;  2OZM A;  3RR7 A;  2XY7 A;  2B4J A;  3O4Q A;  4BDP A;  4LY7 A;  4Z4C A;  1LW2 A;  2YV0 X;  3AVC A;  4CF9 A;  3OYC A;  1NJX A;  1Q9X A;  4N47 A;  3DMJ A;  4Q5V A;  1BQN A;  4DG1 A;  4FM1 A;  2HHQ A;  3ZSV A;  4CE9 A;  3AVB A;  4CHN A;  1HQE A;  1U4B A;  4PA1 A;  1WSJ A;  1S1V A;  4LH4 A;  4DQP A;  4DQQ A;  4N76 A;  4DSI A;  4CJE A;  1NKB A;  3HST B;  2ZE2 A;  1TK8 A;  2EX3 A;  4M3R A;  1WSH A;  1N5Y A;  3TAB A;  3DOL A;  5KTQ A;  3IS9 A;  3SZ2 A;  5HLF A;  1SUQ A;  4N56 A;  4J2E A;  1VSM A;  3QO9 A;  1RT6 A;  4CFA A;  2Y1I A;  2F8S A;  3OJU A;  3QER A;  1TKZ A;  2XHB A;  1GOB A;  3ZT2 A;  4DS5 A;  3MXM A;  1QSS A;  4FLV A;  3DM2 A;  3KD1 E;  4CHP A;  1D9D A;  3ZT0 A;  1W9H A;  4FLW A;  1B9F A;  4CFC A;  1HMV A;  3OYD A;  1YTA A;  3U3Y A;  3TAN A;  1J9A A;  4KPY A;  3LP0 A;  3L2R A;  3QNN A;  1GOA A;  1B9D A;  3L2U A;  4PUO A;  4OPJ A;  3T1A A;  2XRI A;  4OKK A;  4M3Z A;  4LSN A;  2HVI A;  1HJR A;  2ETJ A;  4QAG A;  1CZB A;  4GW6 A;  1W0H A;  3OYK A;  1T8E A;  4AIL C;  2HNZ A;  3IAY A;  4B9V A;  1DTQ A;  4DFJ A;  1NK0 A;  3VQP A;  1VSH A;  2G8K A;  2G8V A;  4UQG A;  1QS4 A;  1RT2 A;  2QKK A;  3PX0 A;  3AVM A;  1WSF A;  3LAK A;  4AHU A;  3C95 A;  4O0J A;  3AVG A;  4CGF A;  4DTM A;  3QES A;  2HW3 A;  1S9E A;  4FW1 A;  3T19 A;  4DSL A;  4KHQ A;  3EYZ A;  4KRF A;  4DTX A;  2RKI A;  4FCY A;  2KQ2 A;  3K59 A;  4CEF A;  3NF8 A;  5HRO A;  1B92 A;  3QEP A;  1S5J A;  3KK1 A;  3K57 A;  2YNH A;  4F3T A;  4QCL A;  4GVM A;  1NK8 A;  4CK2 A;  1TK5 A;  1KLN A;  4DSF A;  3CM5 A;  4FZX C;  1A5W A;  1HNV A;  2G8U A;  4M3Y A;  3VQ8 A;  1YVU A;  3K5M A;  1Y97 A;  1RBU A;  3AVI A;  1ASW A;  3AO1 A;  4BWM A;  4G1Q A;  4CF1 A;  5KRT A;  3E01 A;  1BQM A;  4E19 A;  4O0I A;  4C8L A;  4FW2 A;  4B9T A;  4ELT A;  1T03 A;  3SUO A;  1C0T A;  2F96 A;  3OYJ A;  2QK9 A;  3B6P A;  1UWB A;  4F2S A;  5KGW A;  4CFD A;  1I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...