1IKXA

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikxA05
2AGQA 3TAMA 1VRUA 2HWIA 5EDWA 4ZVGA 3KK1B 4AHUA 4CEZA 3LP2B 1NKCA 1RTJA 4CK1A 3MR2A 4NLYA 3QIPA 4PWDB 1KLNA 4IH7A 4H4OB 2VG5A 4CJLA 4K8ZA 1RA7A 3GIMA 5KG7A 4CFAA 4YR3A 3QO9A 5F9NA 4WE1A 4EP5A 4ECWA 4DF8A 3O4NA 4FJ9A 1UWBB 4ED0A 5KFUA 1ZTTA 2D7SA 1NJXA 1UA0A 2BRKA 3FDSA 4CEEA 3CFRA 2GV9A 1L3UA 3QEVA 3OSNA 2XGQA 4I9LA 5KFMA 3OYIA 1TKTA 1RDBA 5F8IA 5C25B 1QHTA 1HYVA 4RW8A 1FKPA 4R5PA 3DLHA 3AVGA 3GIJA 3CG7A 5HRSA 2I1RA 4Y1DA 1N6QA 5KFBA 4CHQA 3C6UA 4CERA 1J9AA 1T8EA 5KFQA 5KGXA 4AHSA 2X6SA 4MIBA 3V6JA 4DQQA 4H4MB 3OYJA 3H4DA 4Q8EA 1O1WA 4J9OA 2VWKA 4B9MA 4WYLA 4DMNA 3GV7B 3OYCA 1BISA 5KFCA 3AVMA 5J2MB 3VQ7A 2JEJA 3EZ5A 4MQ3A 2QKBA 4ICLA 3GV5B 2HMIB 3MFHA 3DLRA 1RT7B 4CJWA 4AHTA 1C1CA 4JLHA 3NAHA 2BANA 3QGGA 3M8SA 3H08A 4DS5A 3I8DA 2OPSB 4IR9A 2RF2A 4NLWA 5C24A 4RW7B 4NLPA 5KFEA 2R8KA 3ZT3A 4HUGA 4QCLA 4DL4A 4ZPAA 3WNHA 3M8PA 1J5OB 2HHWA 2BRLA 3SFUA 4AH9A 3SCXA 4CJ3A 3SQ2A 3AVNA 3U3GA 3HVTA 4KPYA 4LH5A 3Q8QB 1CXQA 3RB4A 1JXEA 1X9SA 4WFYA 4FJGA 1TAQA 3OYMA 2ETJA 1Q8IA 2RPIA 5HBMB 4GMJB 2AGOA 4NLOA 3GQCA 3VQQA 3KLFB 4Q5VA 4UQGA 4X2BA 4CHYA 3TAMB 3BSNA 5I3UB 4OL8A 4GVMA 4O3OA 1JXBA 5SWMA 4URQU 4NLUA 1RT3B 1BQMA 4RUCA 1HRHA 4J9LA 2GBZA 3T5JA 2PY5A 4FW1A 1Q9YA 1JKHA 4FK0A 2ASDA 4FBUA 1JL2A 2D3ZA 1EX4A 3RRHA 2HHUA 2D41A 4NLTA 1S9EB 3CVKA 4IG3B 3RMDA 4I2PA 4KHUA 2RKIB 1DTQA 1ASUA 1X9MA 1S97A 5DK5A 1HYSB 4F8RA 1DTQB 1LAVA 4FCYA 3AVJA 3G0ZA 3T1AA 2X6NA 5EWFA 1Z25A 3H5YA 2UVRA 3V4IA 3OLAA 3ULDA 3DYAB 3DOLA 3RB3A 2X78A 3QETA 3SV3A 1U48A 1C0TB 2R8GA 5F8NA 3RMBA 3V6DB 1VSDA 4PUOB 3JYTB 5KG5A 2EC0A 3KMQA 4NCGB 2V4QA 3PVXA 4LSNA 1TKTB 1S5JA 3DLGA 2HHTA 4Z4HA 3KK3A 4K8XA 5HP1A 3HP9A 1QE1B 4BE0A 3I5CA 1MU2A 2YHAA 5FRMA 4Y3CA 4J2DA 2OPSA 1WLJA 4J9PA 1ZYQA 4CEBA 4GW6A 4B9TA 3KJVB 4AHVA 4CFBA 3M8QB 4CGHA 3S9HA 2GIQA 1D0EA 4CGGA 1G15A 1NK8A 2P5OA 4NCBA 4FM2A 4ELVA 2DTUA 1RTIA 1TKZB 1S1UA 3V4IB 2FVSA 4B8CA 2RDJA 4EZ9A 1N56A 3RAQA 3TAQA 3C6UB 4CE9A 4NLXA 4CJFA 1QTMA 1RT4A 1TK8A 1A5WA 2VG7B 5KG6A 4I2PB 3I5AA 2OH2A 4J9QA 4O3NA 5DG9A 2W7OA 1T05A 4CEDA 4AHCA 1KHWA 4MK9A 4ELTA 1JLFA 2B4JA 4HKQA 3NE6A 3KLEB 1EXQA 3MEDA 2WHOA 1XR7A 3KK3B 2R2TA 2XI3A 2W42A 2IC3A 4O3RA 3U6FA 3ASMA 3CWJA 3MEEA 4KHMA 3JYTA 4FJLA 4CGDA 4BDZA 4YFUA 1JL1A 3AO3A 1N48A 4ID1A 3U3YA 1U49A 3ZSZA 4OLAA 4BWMA 2XHBA 3KLIB 4TN2A 1SKRA 1GOBA 1KSPA 3NBPA 4RZRA 2VWJA 3MXMA 2IM3A 3VQEA 4Y34A 4J2EA 3TQ1A 3NBPB 4CJRA 3NDKA 2W9AA 1CSJA 3WNGA 3PJXA 3L2QA 3SJJA 3KHHA 4F50A 3RR8A 2JEIA 2HAIA 2VG6B 4KO0A 4DLGA 3CQ8A 4JV0A 1U47A 1J5OA 4NYFA 3M9MB 2YNIB 4B9NA 5KT7A 1N4LA 4QWCA 2G8VA 5T14A 3AVLA 1ZETA 3OYFA 4IDKA 2YKNB 2IM0A 3NH2A 4M3XA 4M45A 4M3YA 3QLHB 3KJVA 3CM6A 3HL8A 4U7CA 4FZYA 4FJNA 4OKEA 3TWHA 4DLEA 3V81B 3H5UA 2OYQA 3BQ0A 1VK0A 4ECUA 1B9FA 4W5RA 3VQ5A 4Y2CA 3PO4A 4KB0A 1IO2A 4KFBA 5J2MA 4E7HA 4E0DA 4NYNA 4KRFA 3HP6A 1HARA 1GOAA 1C1AA 5FRNA 1IKWA 2F8TA 4FLYA 1DTTA 4DL3A 4KO0B 1HNVB 4L8RB 4ZP6A 4XPCA 4ECXA 4F4WA 3DRSB 1HYSA 3KD1E 3ICLA 4J2BA 3TANA 4W5OA 1S1TB 3BQ2A 2G8IA 3KK2B 2ZE2B 3EZUA 3QESA 4ECYA 2E9RX 4EZ6A 3LAKA 3MEGB 4RNHA 3RBDA 4ZPBA 2RF2B 3PY8A 4KE5A 2J6SA 1S6PB 3HPGA 1WSIA 5J2NB 2FVQA 4E7JA 4EBDA 5KG1A 3N6NA 3KLGA 3OL6A 4LQ3A 1TL1B 3K59A 2E6MA 1BIUA 3MEDB 3RMAA 4F4KA 4PQUA 1MU2B 1NOZA 5KFLA 3DRPB 4FLWA 3VQSA 2R8HA 3DI6A 3CFOA 3MEEB 2V0NA 3PW4A 3L3UA 4JRPA 1C0UA 1HQEA 3E01A 3K5LA 3VA0A 2F8SA 4RW6B 2ZD1B 2QV6A 2HNDA 1U45A 3HJFA 4OLBA 4RU9A 4DTSA 2W8LA 3NFAA 3T19A 1JLBB 4KB1A 4Z0UA 2F96A 4IKAA 3IG1A 2Z1JA 1ITGA 4MK7A 2GIRA 3VQBA 4IG3A 5C25A 5KFPA 4G3IA 4CF2A 4OGEA 3P83D 4ELUA 4DG1A 2XC9A 4DTOA 5FDLB 2A1RA 1FXXA 4DU1A 4K4YA 1U04A 4CJ4A 3D0PA 3VQCA 3QNOA 4DTPA 2HVIA 2ASLA 4C8KA 4R8UB 2E9ZA 1NJZA 3E51A 3DLKA 4DL6A 3KTQA 4IFVA 4R0EA 4B9SA 4EYIB 1WAJA 2KZZA 3FFIB 2O5DA 3OS2A 2NUBA 3V9XA 2WOMB 2P1JA 4OJRA 2OZMA 2IC3B 5KFFA 4TQRA 1RYRA 3ALYA 5HP1B 1RT1A 4IKFA 3K5OA 1BQMB 3TVKA 4HYKA 1TV6A 5KG0A 3KLVA 2IJNA 1WSEA 4F4XA 2R8IA 4YR2A 4O44A 2HWHA 4RUAA 2FLLA 2WONA 4LQ9A 1SV5A 5J2QB 3QZ7A 4N76A 5I42B 4MKBA 3OSPA 4O44B 5HBMA 5KFHA 4QW9A 2C28A 3SV4A 3CJ5A 4NZ0A 1RAJA 4KFBB 2OA8A 5F8JA 3TABA 3Q8SB 2G8UA 3OHAA 1HNIA 5CZ2A 5F8MA 1K1QA 4H54A 4YNQA 1HNVA 4FVMA 3C6TB 4IBNA 1W25A 4NLGA 1S6PA 4N5SA 4XIUA 3DRSA 4DFKA 1HQUA 4NLSA 3B6OA 4DTJA 1KCFA 1IKVA 4F4ZA 1SH0A 4DSIA 1CXUA 2BGGA 4KREA 3DMJA 2UVVA 2DPJA 2UUWA 4M3RA 3NF6A 1WNEA 5HLFA 3IN5A 4NCGA 3NKYA 4F3TA 3Q8RB 3OYLA 4O4GB 1JLGA 2CKWA 1RILA 3C95A 3K5MA 3KKSA 4CK2A 4DQRA 4OVLA 3VQ4A 3NAIA 3ZSRA 2WOMA 3AA2A 4YP3A 2FVRA 3BSOA 4OKKA 3MECA 4AHRA 3HXMA 3VQDA 5CY4A 4BE2A 3CYMA 3H59A 4EO6A 3GV8B 3VQ6A 3SYZA 4FJHA 3PV8A 3KLHA 4K50A 4Z4EA 2F8EX 3SI6A 4FS1A 3MXIA 1B9DA 2PZSA 4CFCA 3AVHA 4IR1A 3TAEA 4CK3A 1IM4A 5DQHA 1S9GB 4I7FB 1KFDA 2C2EA 4AILC 4QWBA 2XWYA 1FK9B 3ZT2A 5E41A 4EYHB 2KTQA 2OPQA 4FLZA 5HRRA 3G86A 1NJWA 5JXSA 3NL0A 1NK6A 4HTUA 4JUZA 2O4IA 1RBRA 1TKXB 4ICLB 3WNEA 3V9WA 3V9UA 3NGYA 2P5GA 3MEGA 1ASWA 1WSJA 4K4TA 2OPPA 2ILYA 2DFFA 3D45A 3QZ8A 2QKKA 1LWEA 3H5XA 4DTRA 1SL2A 1VSJA 1RT5A 2OPPB 2EX3A 3BSCA 3CJ0A 4K4VA 3KLFA 4MFBB 3AO5A 4I2QA 1A5XA 2J6TA 3D5MA 1RT5B 1GX6A 2FLPA 2D0AA 3OYHA 3H40A 2YKMA 3KLGB 2P51A 2Z1GA 2PYJA 3HT3A 1NK0A 4CCHA 1N6QB 4Z4IA 1TQLA 2BQRA 2AQ4A 4FLVA 4ID5A 4W5QA 2IOCA 2KFNA 4FYDA 5T7BA 1HQUB 3AVBA 3QINA 1S9FA 4FLTA 3VN5A 3V1RA 1DTTB 4CGJA 3CO9A 1QAJA 3LP0B 4KSEB 5CYQB 2E6LA 2YV0X 4FJ5A 3LANA 3ZT0A 3SUNA 1QQCA 4Y2AA 4DL5A 2FC0A 1NNDA 4LD0A 2R2SA 3BSAA 3KHGA 4N56A 1S1UB 4FXDA 4ECZA 2ZE2A 2FVCA 3CDUA 1RBTA 4EEYA 1NHUA 1C0MA 4TXSA 3PX6A 3ISND 4ED6A 4OPKA 4G1QA 4MIAA 5K14A 2W9CA 1NJYA 2KW4A 3HK2A 3K57A 2PYLA 4RNFA 5FROA 1RT6B 3ZSOA 4JRQA 2Y1IA 1KFSA 2W9BB 1BQNA 1QSLA 4F3OA 4TSXA 3F73A 1RTHA 3CJ4A 4ED2A 4IFVB 4N47A 2I5JA 3BJYA 2C2DA 4XO0A 3QLHA 3C6TA 4WYWA 3P1GA 4CGFA 1KRPA 2YNHB 2IBKA 1SKWA 1EP4A 2WCXA 2JGUA 1YTAA 3HHKA 4B9VA 3DM2A 1NHVA 4J2AA 5EWGA 2EHGA 1IKVB 2ITGA 1RBUA 4DSFA 1TP7A 1S1WB 2ALZA 3NF9A 3M9OB 2E4LA 1FKOB 4IFYA 1TKZA 3D28A 4I7FA 1RT3A 3RB6A 1Q9XA 3ISNC 4Z4GA 3NF8A 1BIZA 3Q8PB 5HRNA 3BGRA 1RCHA 3H98A 3AO4A 4J9RA 1S49A 5FDLA 4M41A 4E3SA 3H2LA 4WFXA 5DMRA 4FJ7A 4KHWA 2JC0A 3LDSA 2W9CB 3QO9B 3KD5E 2HHSA 1S0OA 1S10A 3V81A 3TR8A 4QOZB 2YKMB 3PR5B 3LPTA 4E1MA 3HVAA 3QYYA 3OYBA 1XHZA 3OJSA 4Q44A 4CEQA 1QSSA 3CJ3A 5DG7A 2JEGA 4O4GA 3JSMA 3TAPA 3V6KA 3RMCA 1CZ9A 5I3UA 1RTDB 4DFJA 3EYZA 3MAQA 1VSHA 4LY7A 2CJQA 4CIFA 2ZKUA 4KHYA 3OLBA 5KRSA 2BE2B 1C1BB 3LALA 1SH2A 2QE5A 3VA3A 2WB4A 3PX0A 2G8FA 1X9WA 3DLEA 4FM1A 3ZSXA 4K4SA 5HROA 2BE2A 4KTZA 1NK7A 4QAGA 4J9MA 1JLAB 4ZHRA 3OYAA 2YHBA 4OGCA 4HHTA 3AV9A 3KHLA 3KKRA 3SQ0A 3BQ1A 2BDPA 1HJRA 5KI6A 4ZMMA 2FVPA 1HMVA 1KHVA 3I0SB 2FBYA 4NLDA 5KFKA 4HUEA 4O3SA 3M8PB 1S1TA 1RT6A 1YT3A 1IKYA 2AGPA 4CJQA 4CEFA 1JLQA 3AVKA 5JUMA 1J54A 3ZCMA 4ZTJA 1RTHB 5KT6A 1D9FA 2IA6A 2R7YA 3SNNA 1QS4A 4QW8A 3OYGA 1D9DA 3V9SA 2XY5A 4C8LA 4O4RA 3O3GA 1VSEA 5DG8A 3IGVA 3I0RB 4OPJA 4DTXA 4CF8A 3NHGA 2WTFA 4KHRA 1D1UA 2AJQA 3O3FA 3L3VA 3AVAA 3G6YA 1RT2A 3LP1A 3NF7A 4NLQA 1X1PA 4B9UA 5HRPA 4J9SA 3PW2A 2D0BA 1WNSA 5L1KA 4KHQA 3IS9A 4Z4CA 1JX4A 2XY8A 2HVHA 1XWLA 1KLMB 2IM1A 5JS2A 3HVWA 4KKOB 3GILA 5KFYA 2ZD1A 1UWBA 1UOCA 3OY9A 3KLIA 4DS4A 1JXLA 3AO1A 2GC8A 4JS5A 3LWLA 4CJ5A 3SQ4A 1D8YA 2YNIA 2O4GA 3OYEA 4C8NA 2FBXA 2E9TA 2ZQBA 1BHLA 4O3PA 2HNZA 5J1EB 1LWFA 4HUFA 1RTDA 3VQPA 3CDWA 4M3TA 4M3WA 4CECA 3HSTB 5KG4A 4BACA 2ILZA 3ZT1A 2G8WA 2BQ3A 2IM2A 1IKYB 4FZZA 1CZBA 1LW2B 3QIDA 2KQ2A 2W8KA 3CM5A 3NMAA 4DF4A 3V9ZA 1BQNB 4I9QA 4IRDA 3N6LA 5KFJA 3NGDA 2Q3SA 4MFBA 3LPUA 3M9NB 1T3NA 1I6JA 5L9XA 1KVBA 1LWEB 2YNFB 2VA3A 1U09A 4XPEA 5KFXA 5J2PA 4IG0B 1TGOA 4WFZA 1SL1A 3IRXA 1RT7A 5J2QA 4K4UA 4DQSA 2RN2A 3DLEB 4RW9A 1RDDA 1S0MA 4CJEA 4CIEA 4DQPA 4KHNA 4IH5A 1ZTWA 2GUIA 1ZBFA 3T5LA 2XY7A 1YVFA 1VSFA 1RTJB 3HM9A 1L5UA 4PQUB 1SKSA 3KLHB 5J1EA 4WXOA 1FK9A 4NRTA 3QEPA 1VRTA 4CF9A 1L3SA 3HKWA 3ITHA 3KNAA 1ZBIA 1BL3A 4DTUA 1LWFB 4R8UA 1RDCA 3C94A 4FJMA 1S1XB 3PUFA 1NOYA 3AO2A 1IH7A 3AA3A 1HPZA 1EETB 3N6MA 1JLFB 1NK9A 1JLGB 2XGPA 1JLQB 4ZVFA 4G1QB 4ZPDA 2B6AB 2HNYA 3L2UA 2V4RA 2R2UA 4DSJA 1A5VA 4W5NA 2FJXA 1KLMA 5L1JA 4CESA 3FFIA 4F2SA 4KKOA 3DYAA 3DDKA 3PW5A 3O3HA 1LWCA 4WZQA 3HPHA 3OL9A 2HW3A 2IS3A 5D3GB 5KFZA 4ECQA 4M95A 1W0HA 1LWCB 4C8MA 3AVFA 3L2WA 3DM2B 4FS2A 2OPRB 3PJWA 5F9LA 3PHEA 1JLEA 4CEAA 4RW9B 3RWUA 1SV5B 4ED1A 4ECSA 2IAJB 3M8RA 3DRPA 2AX1A 3G6XA 4ID5B 5KFSA 2VA2A 4QPXA 3MFIA 3SZ2A 3ZSYA 4NRUA 1OS5A 2VG6A 3SPZA 4B8AB 3DLBA 2XCAA 4FJJA 1JLCA 5KT3A 4MH8A 4TY8A 3SQ1A 4O5BA 3I0SA 4IRKA 4Q43A 4QWDA 1RNHA 5KFTA 1XC9A 1LW2A 3DLGB 4WE1B 1KTQA 1S0NA 5DGBA 1S6QA 3UR0A 2W9BA 4DL7A 4KI4A 1CLQA 1S1VB 1I39A 3ITHB 2D0CA 1I3AA 1WAFA 1JIHA 3S3NA 4RG8A 1ZBHA 5CYMB 2HHVA 4CGIA 3PO5A 2XCPA 3SUPA 4Q45A 3DOLB 4IH6A 3OS0A 3MR6A 4J9KA 4DSLA 5F8HA 3B6PA 3MR5A 1SL0A 2J6UA 3V1OA 4CF0A 4JV2A 3T3FA 2Y1JA 3LZIA 2WONB 2KZMA 4ZTFA 3TI0A 2RDIA 4CJTA 2I5JB 1JLBA 1RDRA 4ED8A 1ASVA 3OS1A 4NLRA 3OJUA 3JSMB 3OYNA 1IKXB 4FJXA 3T5HA 3BR9A 4KV8B 1FKOA 2HNDB 4IFYB 4KI6A 3UDLA 2IGIA 2R2RA 4FK4A 3QEXA 5KG2A 5KT2A 1VRTB 4O55A 1WSGA 5F8LA 1NK4A 3IG1B 2B5JB 1EP4B 2DFHA 5L1LA 4LH4A 2Z1IA 4BDYA 4FJKA 1LW0B 3L8BA 4ZP9A 4H8KA 1XI1A 4TLRA 3H4BA 1SUQA 1EETA 3SFGA 1VSLA 3VQ9A 4KB7A 3S3OA 4M42A 3CIZA 3ZSWA 1SUQB 4FJIA 3EPIA 1T94A 2AU0A 1TVRB 3GIIA 4KHSA 3OYDA 4CJKA 5CZ1A 4C8OA 1VSMA 2HHQA 5J2NA 2JLEA 3OL7A 4DU4A 3KHRA 3UQSA 4URGA 4BWJA 1TAUA 1NKBA 1TL3A 3HO1A 1TK0A 3AA4A 1TL1A 4YMEA 3CJ2A 1L3TA 4FZXC 4KBIA 1KVAA 4LSLB 4IQXA 4PA1A 3OVNA 1C0TA 3K2PA 1BI4B 4DFPA 4RNMA 3NCIA 4IRCA 3SPYA 3NGIA 3OHBA 3LZJA 2OZSA 4H4MA 2HHXA 5KFOA 1RYSA 1JLEB 1K6YA 3RB0A 4Y1CA 2KFZA 5KFRA 1B92A 3H5SA 1RT2B 3LP1B 1IG9A 1C0UB 1HQEB 3HVTB 1UAXA 1HNIB 4IG0A 4ZPCA 3PW0A 2ATLA 4F2RA 4J9NA 4PY5A 3QIPB 4PWDA 3ZT4A 3QIOA 3I0RA 1JLCB 4NLVA 1C1CB 4ED3A 1LV5A 5HROB 1S1XA 4EO8A 1VSKA 1C1BA 4BE1A 1HPZB 2G8KA 4CJSA 5C24B 1VSIA 4CFDA 1RA6A 2HMIA 1HYZA 2IAJA 1TKXA 2BQUA 5KFNA 2XRIA 2UVWA 4KTQA 1S9EA 2ATQA 4N41A 2R8JA 3THVA 4ECTA 4ECRA 5C5JA 4KTWA 1GOCA 2VG7A 1R0AB 2OPQB 2DPIA 5CYQA 1QUVA 4E7IA 3RR7A 2XY6A 2IMWP 2BR0A 1Z4UA 1REVA 1EKEA 1XHXA 4YQWA 3RTVA 4CHPA 3GIKA 3DOKB 3KLEA 4E7KA 1ZBLA 3KOAA 5KTQA 3OL8A 2Z1HA 3NH0A 5C42B 4NYZA 3MR3A 4CJPA 3PX4A 2XI2A 3E01B 1S9GA 3V6HA 2LSNA 3QNNA 2QK9A 4E7LA 1JLAA 4ZHRB 3A2FA 3FQKA 3ZSQA 3KK1A 4K4XA 4JV1A 3FSIA 4HCCA 5KFAA 3MTKA 5JS1A 2YNFA 4CHOA 2FJVA 3PR4A 3DI6B 3BDPA 1TK5A 3G10A 5F8GA 4Q8FA 4ZVEA 4GC7A 1LAWA 1SH3A 3NGZA 1MMLA 2FLNA 1NK5A 4MKAA 4YR0A 1TL3B 4O0JA 3AA5X 4FK2A 3NH1A 3LP0A 4ED7A 3RBEA 3I5BA 4TQSA 2HNZB 3EY1A 1FKPB 2IDOA 4Q0BA 1T05B 4CJVA 4IOBA 1UA1A 5J2PB 3K58A 3G6VA 1WSHA 4DG1B 2WRMA 4DTNA 3QERA 1DLOA 5HLFB 4B3OA 4KV8A 4R5PB 1S6QB 5EUHA 5KT5A 1DLOB 4RW6A 4KAZA 3CDEA 4JS4A 5KGWA 5DQGA 1XR5A 3HYFA 2ASJA 3MF5A 2XO7A 4HVJA 4DQIA 4DL2A 1GX5A 3QGHA 1T7PA 3CFPA 4DSKA 4BDPA 3SUQA 4LSLA 2YNHA 3IAYA 4CHZA 4Z4FA 4RNOA 3MECB 2V9WA 2FJWA 2UVUA 5KFVA 5EWEA 2FBVA 4FJ8A 3RRGA 4K4WA 1Y97A 2BANB 2D3UA 5C42A 1T03A 1U4BA 1J53A 4K4ZA 1TVRA 1QE1A 3HVRA 3UPFA 5KRTA 3V1QA 3KIOA 1IKWB 1YTUA 1C2PA 4HCBA 2JC1A 4FLXA 2YNGB 1N5YA 4CJUA 3TAFA 4M3ZA 3VQ8A 1WSFA 3K5NA 4NCAA 2VG5B 4KAIA 3ZSVA 5K14B 3NAEA 1XR6A 3DRRB 3LP3A 2X74A 4CF1A 3V6DA 1R0AA 1BI4A 1ZBUA 1RDAA 3LP2A 5KFIA 5SZTA 5DLGA 3MXJA 3FQLA 3AVIA 3DMJB 3FRZA 4IDKB 1D5AA 4O0IA 3L2VA 3PZPA 3QEWA 4TY9A 1TKDA 4PUOA 4RW8B 4E19A 1RBVA 1HMVB 4RW4B 3IRXB 1YVUA 4E1NA 4WZMA 4RW7A 4URSA 4QWAA 4OKJA 2OPRA 1RT1B 1BCOA 2DY4A 5I42A 4ZP8A 4F4YA 4TYAA 4WXWA 4O3QA 4QWEA 5KT4A 1S1WA 3F9KA 1BGXT 4EP4A 2B6AA 1S1VA 1JKHB 4ECVA 3TAGA 2JEFA 5CYMA 3GYNA 1KVCA 2HB5A 1S4FA 1C6VA 3EPGA 4B9LA 4U6PA 4H4OA 3OYKA 1IKXA 3RAXA 4TY8B 5D3GA 3T5KA 5DGAA 4FW2A 4FM0A 1Z26A 1TV6B 2RKIA 3QGIA 2AWZA 2B5JA 3PW7A 3TARA 3DRRA 4Q0BB 4DEZA 3DLKB 4DSEA 4DFMA 5KG3A 3WNFA 1VRUB 1LW0A 2B43A 2YNGA 4E89A 3BREA 4EBCA 3L2RA 1T03B 5KFDA 4GC6A 1L3VA 2HNYB 2YKNA 1F21A 1QSYA 4DU3A 5KFGA 2WK4A 1RT4B 3SI8A 4RNNA 4EBEA 5L1IA 3BGRB 1BCMA 1W9HA 1NKEA 3HPOA 2QXFA 4TYBA 4RW4A 5DLFA 4ZVHA 3O4QA 2FBTA 3P5JA 1S48A 4LSNB 1QAIA 2A1SA 4FLUA 3AVCA 3LAMA 3S3MA 4DTMA 4B3OB 4M94A 3DOKA 5KFWA 2C2RA 1RBSA 2D5RA 2G8HA 1WN7A 3KK2A 3IGNA 4CHNA 5DQIA 1REVB 4ZP7A 4CEOA 2UUTA 3IS9B 4B08A 2IJFA 3UIQA 3SUOA 1K1SA 3VQAA 2C22A 4FBTA 4CIGA 3LWMA 4I2QB 4DWIA 2W7PA 3KMSA 4MK8A 5EU7A 1N5YB 4M3UA 3M8QA 3QEIA 4W5TA 2DFEA 1RTIB 2AX0A
chains in the Genus database with same CATH superfamily
2AGQA 3L6QA 1VRUA 4JK8A 3AD8C 3R1HA 3VEZA 4H5RA 4AHUA 4CEZA 1UAWA 3BGLA 3LP2B 2HLUA 1B7FA 3QIPA 4PWDB 1WOPA 5GAEU 5KPZA 5T7LB 5B09A 2D3OR 3PYFA 4CFAA 3QO9A 4WE1A 2A18A 3OD2A 4IDHA 2D7SA 5CCLA 4RX6A 2BRKA 3FDSA 4CEEA 3CFRA 3OSNA 5H9FK 4GV9A 1NG9A 4CLWA 5DM7Q 2PEBA 3TUZC 1DEJA 2CWXA 4UUXA 3CG7A 5HRSA 2I1RA 4NASA 3E9PA 4Y1DA 1NSKL 3MAAA 3M2VA 3M2UA 1Q81T 5KFQA 1YJ9N 1VISA 4IO9L 4OFZA 2V51B 2BW7A 4H4MB 4M63C 2ACYA 3OW2R 1FVSA 3VQ7A 2HFZA 3AQOA 2XMAA 1UCNA 1DJ0A 4L76A 1DT9A 3GV5B 2O66A 1QQOA 4FVUA 4NXMF 4CJWA 2JH3A 1C1CA 4JLHA 2HVZA 3GR1A 1FRLA 3QGGA 3H08A 4OV1A 5C12A 3NNAA 5BYRA 4I6MB 4RW7B 4HUGA 2DJWA 3S8SA 1GXTA 3F5TA 2VFVA 2M5YA 3HX9A 1U2RA 2HHWA 4FNIA 3SFUA 3UI3A 3ENBA 3A8JA 2DH8A 1I51B 4RJVA 4CJ3A 3I32A 4NMXA 3SQ2A 2BW2A 3RBZA 3AVNA 3GONA 2MQNA 4KPYA 1WORA 3AQPA 3C14B 3RB4A 2OTJS 2MDAA 4OYOA 1FA0A 4DV1K 4JI2F 1S4EA 4A5AA 2I38A 2AGOA 5HQ8A 5ELZA 4FYWB 4PKHA 3KLFB 4Y6IA 3GIRA 2AJFE 3TAMB 4JYAK 1PSDA 4F7VA 5I3UB 4OL8A 2H5JB 4O3OA 1GNKA 4NLUA 1BQMA 2VWBA 2VDHA 4FK0A 1QQMA 2ASDA 1DFDA 3EGNA 1P6TA 1XBWA 2ZM6F 4HTIA 2VASA 2HHUA 2J0WA 4OI0A 2D41A 4DV1J 3J80Y 3CVKA 2B4VA 3RMDA 5AZIA 2E5LJ 3W5XA 2W01A 1ASUA 3KFWX 5AQFA 2EVZA 3WDOA 4NLCA 3LQVA 3RU0A 2DR8A 1DTQB 4FCYA 3QT5A 3G0ZA 3AFGA 1U1OA 2UVRA 3T6BA 4LF7J 3QETA 3SV3A 3GJTB 2XMMA 1C0TB 1H7WA 2XO6A 1SJ3P 2D1KA 2IFXA 4HL9A 4PUOB 3JYTB 4ZIWA 5G0RA 4NCGB 4B02A 5IQQA 4F26A 2E5LK 3PVXA 1K8KB 1TKTB 1S5JA 3GPAA 5EY4A 2B51A 2HHTA 4B9QA 4K8XA 3TA1A 4B3MF 1R0CB 3HP9A 3FEXB 1QE1B 2EFGA 4C2MA 4BE0A 2MHNA 5A6PA 2FIUA 4J2DA 1U6FA 2JOQA 2QWLA 4J9PA 4LFCJ 4JD2B 5DZ6A 4GW6A 4HT5A 4LF9J 2C42A 3KJVB 3O1WA 2FD2A 2KJVA 2UV8A 3M32B 1Y11A 1FW6A 2P5OA 2RHSB 4IJNA 3ID6A 4FM2A 4EFHA 1RTIA 4ANDA 4K41A 3VV2B 4PL7A 4U7UK 1BXNA 1PIEA 2MZTA 2W2OP 4NI2B 2CQDA 4PG6A 3IM8A 3RRKA 2WSFC 2N4CA 4DUTA 1N56A 3RAQA 2A10A 4CE9A 3FBBA 1QTMA 1H3DA 1KOHA 2WC9A 4WP8A 3SBTA 4MMOA 1A5WA 2VG7B 4F02A 4ZJLA 1WF0A 4J9QA 4AUKA 5AZJB 1T05A 3MOJB 3MX2A 3BPDA 2J5AA 3SDEA 1N32F 2O8CA 5HMXA 3NE6A 1FO1A 3MGJA 3KLEB 1EXQA 3AAWB 4OPHA 3GR0A 4EUVA 1T9TA 3M1VB 1DAXA 2OELA 4OZ0A 1F9EB 4QR1A 4CGDA 2V69A 1N48A 4QZVB 1U49A 4OLAA 2YQ3A 4KC5A 2QWNA 1IJFB 3KLIB 4OYZA 1SKRA 1GOBA 1V3RA 2YH0A 1RHRB 2DIVA 3MXMA 3VESA 4Y34A 5F2RA 4DV5K 3KUHA 1XC3A 2HAIA 2VG6B 3G82B 3CQ8A 3KYLA 4JV0A 1U47A 4NYFA 3M9MB 3NWRA 4DR2F 5FPEA 4MKVA 1RE1B 2F9JA 2VGMA 1N4LA 4QWCA 2WSEC 2G8VA 2DHHA 1WSVA 3NH2A 4XH5A 4M3XA 3P45B 3MUTP 2MKHA 3R3LA 5LMUK 1R8PA 3AARA 2CJ9A 2QL7B 2F7VA 1KQSM 2NRTA 2NXUA 4BCAA 5FPMA 3W3SA 4C4WA 2CJYB 3H5UA 5TKWA 4FVCA 4OYAA 2DNKA 5DS7A 1VK0A 2YX6A 2XB2D 4WFNL 3DDIA 2CPZA 3O5BA 1VBZA 1PYSB 3TSQA 3PO4A 2YWEA 1K8AT 4KB0A 2V34A 1U25A 1IO2A 2VCPA 2QLJB 1D8ZA 4NYNA 1U26A 3I8BA 4IXCA 1IR1A 2F8TA 2XYGB 4FLYA 2ZHOA 3G82A 1RWOB 4LVNP 2HK3A 2CQ2A 2OFHX 4F4WA 2FY8A 4JEPA 4GY2B 3DRSB 4RUBA 2ZDPA 3ICLA 2HBLA 4J2BA 4LF6J 3NCQA 1S1TB 5LY3A 1FWLA 1G3OA 3KK2B 3CEDA 3QESA 1HKCA 5THWA 4M5MA 2E9RX 3PY8A 4R25A 4KE5A 2N7CA 3LA0A 2J6SA 3HPGA 3QFUA 1JCGA 5KG1A 1TUUA 4YY3F 1YJUA 2H9ZA 2LDYA 4AQYF 3K59A 3VAFA 1X4CA 1LK5A 5HJXA 3MX5A 1MSWD 4B3TK 3T69A 3DHXA 5KFLA 1YX2A 1VQPS 5CD4A 4B1ZA 3H7HB 3K5LA 3HSCA 1NRKA 3CD6N 2ZD1B 2QV6A 4NB4A 3TWZA 1RUSA 1UW4A 5ADZA 4LFAJ 4ISFA 1I94K 3NFAA 2XLJA 3IWXA 3MM9B 5HMYA 3LM2A 4BRMA 5EHHA 2DR6A 2Z1JA 1Y3KA 2P9UA 3CCZA 3W63A 4DG1A 1HJOA 3MM6B 2OIHA 2ZWPA 1VQKN 3AODA 1H2TZ 4K4YA 4XDCA 1J5EF 3BF1A 3VQCA 3QNOA 4L6V3 3MMVA 2N3LA 2ASLA 4OHYA 4R8UB 5AE1A 3QDKA 3E51A 4IFVA 2M0GB 3NOGA 2QMXA 1R8BA 4ANCA 5ETSA 2COLA 5LMNF 2LU2A 2OZMA 1HBMB 2M52A 2LKZA 4A46A 1R43A 4USHA 2IA0A 3GE9A 3ALYA 5HP1B 4IKFA 1BQMB 4P7VA 5CHCB 1UVIA 3ULEB 1TV6A 2G1HA 1EIYB 3KLVA 3MEKA 1N33K 2R8IA 1QVFM 3OTBA 2WONA 3ETMA 4LQ9A 1SV5A 1SJRA 3CIMA 5HBMA 5KFHA 4QW9A 3CJ5A 2V8GA 3GCWP 3TABA 3Q8SB 5AQIA 3DN9A 4H54A 4YNQA 5C2CA 2HKEA 5B7WA 4ZK7M 1S6PA 2XLIA 2V68A 3DRSA 4DFKA 4NLSA 1M5KC 4BRAA 2NS1B 2AP1A 4DTJA 3ZNJ1 4P74A 4F4ZA 5D15A 4GVBB 3DMJA 2CQPA 2UVVA 4AXJA 3NF6A 3DWLA 2YQ0A 2DY9A 4BQLA 2FHJD 4NCGA 2AEFA 3G71S 3D2FA 4H0TB 3Q8RB 5E2QA 3OYLA 1JLGA 3A8KA 1X31C 2BE9B 3AXMA 4WFNQ 3K5MA 3KKSA 2D9OA 2LECA 4OVLA 3NAIA 2YXLA 2CDRB 2A2CA 4OKKA 5EX0A 3VQDA 5CY4A 4GO7X 4BE2A 3CYMA 3ENOA 2CGKA 1HW8A 3GV8B 3VQ6A 3CPEA 3VEWA 3CNQP 4LF9K 3SYZA 4FJHA 4Z4EA 2F8EX 3TUPA 1BA0A 2M70A 4CFCA 2MXYA 1S9GB 5ETQA 4QS9A 4CZHA 1RHKB 3ZETA 2QO3A 2XWYA 1FK9B 5GADI 5DDQC 2DHAA 2ZBCA 1F3VA 3JTNA 2KT2A 3TX0A 3Q2SC 2P9UB 3G86A 3FLCO 3GLJA 2P9GA 5JXSA 4G1IA 1Q5YA 4DB3A 3DKDA 1IR0A 2FY1A 2LEAA 2BM1A 4H0OA 3V9WA 3V9UA 2P5GA 4A47A 5BPMA 3L4IA 2HQDA 2K3IA 1WSJA 1RLCL 4CJ7A 4F0MA 3D45A 1B0VA 3H5XA 1RWUA 2E2NA 4DTRA 1RT5A 2OPPB 3L4BC 4C11A 4K4VA 4I2QA 2FF3B 3D5MA 1Q7LB 3LPYA 2CXEA 3J7YU 3U8XA 5FPDA 1ZA1B 2GMHA 2RT3A 2OJ3A 1SZ2A 2YY3A 4QU6A 2HZCA 2KVIA 2W4PA 4OHXA 2KFNA 2IOCA 4FYDA 4OI4A 1HQUB 4LF8F 3AVBA 4CIOA 1M5OC 4A61A 3B54A 4KSEB 1WF1A 2YV0X 4YB7A 4DR7K 3ZT0A 1ITPA 5AQHA 1TR0A 4DPOA 3SUNA 2R2SA 3MI7X 1S1UB 3UNGC 4FXDA 1RBTA 4EEYA 2C2ZB 3QT8A 2ZH3A 2WBNA 5K14A 1X0FA 2PYLA 2QM1A 4NXMJ 1U7LA 5FROA 3A8YA 2Y1IA 3HHNB 3HD2A 1BQNA 3THWA 1R3NA 3MUMP 1PC4A 3WBZA 4F3OA 4DR2K 3T41A 3W62A 3CJ4A 1J27A 4F4AA 4HACA 2XS5A 1IJJA 4CTAB 3PIPL 2GUPA 1K8AO 3C6TA 4WYWA 4OX8A 1EP4A 2WCXA 2JGUA 1YTAA 4B9VA 3PNIA 3R5BA 3DM2A 1NHVA 5LMUF 3VEYA 4BVOA 3MM7B 3BP8A 3ATVA 2UXCF 4ZJOA 1U1KA 1TP7A 1XTZA 4PXBA 2ALZA 2ZOGA 2K06A 1FKOB 4A48A 4DR2J 4FWRA 3BZCA 1BLUA 2IBOA 3ZXWA 3FE1A 3AGKA 1F60B 3NF8A 3PTWA 1BIZA 3BGRA 2WVFA 5DRKA 1UEKA 4WFXA 3G96A 5DMRA 3V2UC 4C3KA 1YBAA 5EX5A 3WIUA 2DGSA 2VICA 2PIIA 4CBXA 1V3SA 2HHSA 3GJRB 4CLZA 4E1MA 2VD3A 3OJSA 4CEQA 1QSSA 3H0PA 3JSMA 2RQKA 3MM8A 3UCZP 3LDLA 4NL5A 5I3UA 1RTDB 1URNA 3P8BB 2ABYA 4DUZK 5K8PA 1T9WA 2KL8A 5A8WA 1PBUA 3EGVA 1QM9A 3EO3A 4LFBF 3IMXA 3OLBA 5KRSA 4FPIA 5DZ7A 2RHQB 2BE2B 1NH7A 1SH2A 2WB4A 1BU6O 2IIHA 4FM1A 1JK9B 3W65A 2VBWA 3W61A 4P7TA 4IOAQ 1JLAB 4UZBA 2OMOA 2CH5A 2ROGA 2BE7D 1KHVA 2DGVA 1HWLA 1PJ7A 3LOUA 1S1TA 3CCLS 2X1AA 2VL1A 2LCWA 3KWIA 3MMCB 4DV0K 1VQ4N 1JLQA 1H6KX 3AVKA 2WFBA 4H0VB 1J54A 3I55S 3EE3A 1RTHB 2GJFA 3TZYA 3K89A 3WQTA 5GADU 3TUJC 4DR3F 1BUPA 1FNXH 3ENAA 3L9ZA 1U0HA 2DNQA 5D4LA 4O4RA 3CD7A 4U7BA 5DG8A 3I0RB 4OPJA 2VBXA 1SIWB 1H72C 4KHRA 3CCEN 4MDBA 5GAGU 3NF7A 2RE2A 2D0BA 1WNSA 3TUIC 4KHQA 2XZWA 3R5CA 4AT1B 2XBPA 1V4TA 3VALA 1Z2ZA 3F9MA 2IM1A 3PCOB 2B3TB 4JI2J 1SS6A 2YPYA 1VQ8N 4KKOB 3GILA 1UOCA 3OY9A 3TA2A 3SEOA 1JXLA 2GC8A 4KGVB 4JS5A 4HTLA 1J5EJ 1AUDA 1RDWX 4Q2MA 2AYMA 2VBYA 3OYEA 5H9EK 4ZDNA 1NGEA 2FBXA 2E9TA 3MMAB 2APOA 5J1EB 3QJPA 4DV1F 3A3NB 3FGVA 1Y64A 4JI2K 1Q1KA 4FZVA 1U2VB 2OUGA 2AYGA 1SJFA 2HIYA 4DX8H 4GKKJ 5EVZA 4CD3A 2A6OA 1H38A 4Y2IA 3ZT1A 2VQEK 1Q79A 2HQGA 2KQ2A 2UXDF 1BQNB 3THWB 1TU0B 5L9XA 2YNFB 1EHWA 1FJGF 3S01A 2VA3A 1U09A 5KFXA 5J2PA 2Z2LA 4K2XA 2GVDA 2I2YA 4Y00A 3CD5A 3W2VA 4DI6A 1XNQJ 4DPTA 2V8VA 3Q7CA 4LRCA 3MPWA 2QWRA 1RDDA 1RWWB 2E5JA 3M30B 3G8SA 2GW8A 1VHXA 5JMVA 4P9SA 2GUIA 3O9SA 1SQKA 3TTDA 1B70B 1L5UA 5J1EA 2Z2MA 2NLXA 1GQEA 2XULA 4NRTA 1C4AA 4RWWA 4CF9A 2MLYA 3HKWA 1ZBIA 1FRMA 2RS2A 3DC2A 2B8QA 3SSQA 1S1XB 3AO2A 3F56A 2VC0A 1WHWA 4OYMA 1I94J 3BY5A 2P9NA 1DQ9A 4EMDA 2GMJA 1NK9A 1JLGB 5G4DA 4Q7AA 4G1QB 4ZPDA 2R4FA 1RAHB 1AXQA 2Y1RI 2CQ0A 4PPZA 4X4RA 3Q86A 1KLMA 5L1JA 4CESA 1S0VA 1PJ6A 3DDKA 3UFCX 3MM6A 4WZQA 4BQZA 2HW3A 2IS3A 2R7SA 2E2OA 4C98A 1LWCB 4C8MA 4YB6A 4BR9A 1NAQA 5DDOC 3TYTA 3OXFA 2ZF5O 3CCSS 4FS2A 3M30A 2LU1A 5F9LA 2M3DA 2V8PA 3ETOA 1PG5B 4RW9B 1VQSA 3M8RA 1SQFA 2HFSA 3DRPA 4JKGB 4ID5B 3N79A 4ER8A 5BR8J 4QPXA 1NGDA 1IBKK 1KQKA 2P9IA 1YKWA 4FWLA 2VG6A 4DPWA 3PSIA 1NWKA 4WF9L 1WC1A 5BRFA 4IRKA 3FCWA 1RNHA 3EVMA 1NM1A 1ZM3A 1S0NA 5DGBA 1S6QA 4KI4A 1N34J 3IBCB 1I39A 3ITHB 2D0CA 1I3AA 1WAFA 1ZBHA 4CGIA 5ETTA 4IO1A 3DOLB 4JK9A 4IH6A 3HZ6A 4J9KA 4DSLA 3GZ7A 5F8HA 1K44A 2BKOA 2MYFA 2UUAJ 4DV2K 2V94A 2F4FA 2WONB 2MJNA 1XNQF 1P1TA 4QPTA 4GMKA 1AZSA 3OS1A 3BF3A 3EZOA 2X1FA 1FKOA 2HNDB 3UDLA 1SBRA 4DJBA 4LF4K 1WEZA 3LDQA 4PKDB 1IBCB 3FNNA 4WK3A 5HQMA 2GJIA 4O55A 1FDNA 4UY8O 1CJTB 1NK4A 3OTCA 2B5JB 2DFHA 3A8IA 2CQ1A 1YIJS 2HAFA 4LH4A 2Z1IA 4CZLA 4KY3A 3U1LA 1LW0B 2VFUA 2DCLA 3CQXA 1RISA 4FDFA 1EETA 5E7OB 4ZCKA 3BGOP 1F1BB 4YY3K 2QLBB 3ZSWA 5E5NA 4LREA 3EPIA 3SBMA 1HKAA 1VSMA 2HHQA 4DBQA 2JLEA 3KHRA 1TAUA 4URGA 4UW2A 4DU7A 5IWAJ 2ZZMA 3CJ2A 3CJ9A 2Z0GA 4BR2A 4LF5F 3OVNA 1C0TA 1GMVA 4DFPA 1BI4B 3K2PA 3NCIA 3MR7A 2WB1D 3PYEA 2XLKA 2HHXA 4MLHA 3RB0A 3E3XA 4M5GA 4Y1CA 2KFZA 1X4GA 1B92A 3JAMY 1GLDG 3H5SA 1RT2B 3FMBA 1YRTA 2FTRA 4IG0A 1Y9OA 3PW0A 4PY5A 3QIPB 4PWDA 2VGNA 4NLVA 4ES1A 3B78A 2BJDA 2VIHA 4MYUA 2MEWA 5HROB 1LV5A 1YBTA 2H5IB 1VR6A 1APSA 1C1BA 2E5HA 2W1BA 4CFDA 5B0BA 3CCWA 5B0CA 3U9DA 2VU5A 4OYBA 4JI7K 4FSVA 1Y5LB 4N41A 4MT1A 2LDIA 4ECRA 5C5JA 3MAAB 4ES3A 5M1PA 3W9JA 1U8SA 4IOCQ 3UKUA 3UO0A 3HSJA 4M5LA 2G2ZA 3RR7A 2XY6A 1I5OB 3M7VA 1REVA 5B8HA 1EKEA 4YQWA 1GXUA 3RTVA 4CHPA 4CO2A 3DOKB 1YJNS 4PG7A 3V4MA 3OL8A 2Z1HA 4NYZA 2F1FA 5DDRC 3ULEA 3DOMA 2CZ9A 5JLFA 2QX0A 1VHFA 3HHLD 1S9GA 4NXNF 1T3VA 3J80O 4PKGA 2QK9A 4E7LA 4DV6J 2RHKA 1JLAA 5BPNA 3GBTA 1WBBA 4KQZA 3A2FA 5CZVA 5L46A 1KC8T 1RTZA 3VVUA 3KK1A 2JLFA 5LJ5Y 3A13A 3FRYA 2GX8A 4CHOA 3DGPA 1FJ7A 5B0DA 2AEMA 3ZZYA 2E1CA 1WACA 2GEMA 3DI6B 2O1PA 3L95X 3BDPA 5AQZA 4ZVEA 2VFSA 3NGSA 5M2RA 5K8MA 2QA2A 4FF1A 4DV6K 3OUYB 4X4TA 3PRDA 4LT6A 3BO3A 2HEKA 4TQSA 1N54B 4PPDA 2KXHA 1HWUA 2EW9A 3NCPA 1GLEG 2H5EA 3G2XA 3K58A 3KG4A 2CG8A 4CO5A 2L48A 5HLFB 3QRRA 3WXKA 4RBTA 5EUHA 1JNZB 1KP6A 1OYEA 5KGWA 3KG0A 3BS9A 1HNZF 1XR5A 3KK7A 4OYWA 3MF5A 2XO7A 2ASJA 1DZ5A 4DQIA 2QT7A 4CBWA 3X3UA 4A4JA 4DSKA 2FZCB 2GGPB 3HFZB 5DM6Q 4FWSA 4LRAA 3N0VA 4FXVA 3MECB 1ZM9A 2V9WA 1NDLA 5LXYA 5KFVA 5EWEA 2FBVA 3RRGA 4CM2A 2I7NA 1U4BA 1T03A 2ZGYA 1F5CA 1QE1A 3UPFA 2N7YA 5KRTA 4BR0A 2VQFK 1YBUA 2E2QA 3P4IA 2E44A 1R8AA 1N5YA 4M3ZA 1K47A 5E3AA 3VQ8A 2VG5B 5K14B 1KQSR 3IFEA 3Q23A 3LP3A 4X62F 2X74A 4CLFA 1R0AA 2J0XA 2QSFA 2F9WA 3ZZPA 3LP2A 2PT0A 2O8BA 4KBOA 3MXJA 2MMYA 4FYVB 1Q82O 1HNWJ 4E19A 2W2PP 1SQEA 4CTAA 4KH0B 4RW4B 4AL5A 1YVUA 3TP2A 4P73A 4FWPA 2DY4A 1YRXA 4ZP8A 4AQYJ 4PQAA 4PAAA 3CCUN 4QWEA 3QFHA 5KT4A 2FSNA 5AQXA 3F9KA 1BGXT 2B6AA 1ZM4A 3S1TA 1S1VA 1N36K 1AYEA 4BC7A 4JI5F 4YOYA 3P49B 1B4SA 2GCFA 3GYNA 2KH9A 2NYHA 2J9DE 2F9TA 4NO7A 1JJ2M 3RAXA 2R7TA 3IR6B 2NRXA 5A8KB 2RKIA 4DL0C 2BOAA 2RRNA 3DLKB 5KG3A 3HMJG 2YNGA 4E89A 5FJ4A 3BREA 3L2RA 1RB0A 2IHR1 1L3VA 1QSYA 5KFGA 3SI8A 5FD1A 2HS4A 4F3MA 4RNNA 4OLOA 3U27A 2V8DA 3AA8A 3M1VA 4RW4A 3VGUA 4CRJA 3QBWA 4AF1A 2R7XA 3HM8A 2E1YA 3CJ7A 1RU2A 3TO8A 3AVCA 2IPOB 4DTMA 4LF8K 4M94A 3DOKA 2D5RA 2G8HA 4HACB 3KK2A 1O0PA 3ZC4A 5DQIA 4DV2J 2RRAA 3C14A 2VYPA 3DHWC 1U6ZA 3NGKA 4LBHA 1Q7YO 1R8HA 3UIQA 4ZN1A 3SUOA 3SQOP 4RKUC 2F8MA 1K1SA 2C22A 2E29A 4ZCIA 4P52A 5JLHA 4OIXA 2YX1A 3TAMA 1AFIA 1RAEB 2F3JA 1XK8A 3P31A 2H1YA 4NYOA 2OD4A 1RTJA 1HHQA 2GVZA 4CK1A 5AQRA 4NLYA 2J8AA 4IH7A 4B3RK 2VG5A 4YDXA 2B9EA 4EP5A 4ECWA 4DF8A 4YN3B 1UWBB 4ED0A 4KIAA 1ZTTA 4DR5J 2XGQA 3OYIA 2HGNA 5F8IA 4NYPA 1QHTA 4LRFA 4H0PA 4CZCA 5EN1A 1EO1A 3DLHA 3AVGA 1Y4ZB 2QMUB 2FYXA 5KFBA 4CHQA 1J9AA 1Y0HA 2XHCA 3AJDA 2RJZA 5KPRA 3QAEA 3O1BA 2E20A 2X6SA 1K73O 3OYJA 4LR8A 4B9MA 3GV7B 2FSJA 2J0QD 2JWKA 4OJ1A 2EFOA 2ADBA 5J2MB 1TTHB 5RUBA 1KNZA 3IR5B 2M88A 1OVQA 1XMOJ 1CJTA 3O9RA 2QKBA 4ICLA 3EE9A 3HFKA 3DLRA 3MFHA 5JVGL 5E3RA 1VQOS 4AHTA 2JLGA 5H1SV 3NAHA 1M1KT 2LQ5A 1SPBP 5M2PA 2DCUB 3ZT3A 1D9AA 3VR1A 1J5OB 4OJ3A 2LXIA 3AB4B 4QIEA 1LXNA 4MYTA 4DUZJ 2CFXA 2FSKA 4BRIA 4KGZB 4DR7J 1NBEB 4LH5A 1M5HA 1YGYA 3MMJA 2YJEA 4H0XB 4GKJK 3W7BA 4DR7F 3AGRA 3EGZA 2Z57B 2D9PA 1Q8IA 4X4UA 2HHHF 2RPIA 3ISZA 5BR8K 4GMJB 4NLOA 2GAHC 3GQCA 3VQQA 4Q5VA 1T6DA 2HHPA 4X2BA 1A9NB 1MW7A 1UW9A 3FEYB 1JXBA 2QN6B 5HI7A 3A0IX 4URQU 3BZKA 1RT3B 3HBTA 4RUCA 2HFUA 1HRHA 2Q66A 2PY5A 4FW1A 1Q9YA 4FBUA 4DV0J 1JL2A 3CMAN 1EX4A 1DRZA 2CNLB 2VKZG 3WXJA 4M5KA 3D0IE 1KTVA 4HHHA 1RAOA 2CQ4A 5K8NA 3HFVA 3G71N 1WJ9A 1S97A 1HYSB 4F8RA 2FLOA 3OFEA 3ENWA 1LAVA 2QA1A 3T1AA 2X6NA 1CC8A 5EWFA 2HF4A 3V4IA 1BWVA 1UEUA 2UXCK 1Y5IB 3DOLA 3NGRA 2X78A 2R8GA 1MWZA 3Q83A 3V6DB 1VSDA 3OTEA 4UOHA 1YHQS 2RIJA 4P10A 4LSNA 2YQ1A 1OQ3A 3ZZRA 3TVYA 3I5CA 3RJMB 4U8VA 2YHAA 1VLOA 4P2MA 4CNZA 2OPSA 1WLJA 3D2EB 3M2UB 4IZ9A 4B9TA 4TU9A 5IV3A 2X51A 2E5LF 4ZVUB 4AHVA 3S9HA 3ZZUA 1DKGD 1ZZNA 3C2PA 3ZZOA 1D0EA 4GNIA 3NGUA 2DHXA 5AQJA 1G15A 2CPDA 4GVBA 4ILLA 1KVKA 4DZ6A 1RZMA 4YHHJ 1QY7A 2HQIA 4CM0A 4NE9C 3EDQB 5C0YA 1CS4B 4JI1F 2XMJA 3V4IB 2RDJA 2PSZA 3C6UB 4X62J 4CJFA 3D1OA 1RT4A 3CHWA 1GLBG 1R6VA 5AT1B 4I2PB 4XEIA 3I5AA 1ATNA 4WU2A 2OH2A 3NXZA 4O3NA 2MY7A 2QGFB 1UVJA 3Q22A 4CYUB 4AHCA 3M3ZA 4IOAL 1HWIA 2B4JA 3PG9A 4K7QA 2UUBF 4QIFA 4HKQA 4WQ5A 1E6VA 1RGVA 2M8HA 1LEOA 2WUSA 2ITMA 2R2TA 4WQ5C 1VJQA 5B0GA 2IC3A 1HKBA 1KWMA 4O3RA 2HVEA 2WSCC 3CWJA 3ZTOA 3MEEA 1P8GA 2YHYA 3NS6A 2PGCA 3D6FB 4FJLA 4B3TJ 3NWGA 2Q1LA 1RFQA 1N32K 4BDZA 2RILA 3QAUA 1JL1A 4ILRA 1VLYA 1GK8A 4ID1A 3U3YA 3BO2A 2DD8S 3BBCA 4BWMA 4Y28C 1HHTP 4CBUA 3NBPA 2IM3A 3VQEA 3CCVS 1HA1A 2XNRA 1FXLA 3KNGA 2KVQE 3L2QA 1CSJA 3SJJA 4F50A 2JEIA 4A62A 4KO0A 2H65B 1J5OA 3QNWB 4ED4A 2ZH8A 3HSZA 2YNIB 3FR0A 2DXFA 4V1Ak 5KT7A 2GVDB 4OX9K 3NNHA 4H5WA 2Q3PA 3AVLA 4OQJA 1ZETA 4IDKA 3W2VB 2YKNB 2IM0A 5L9NA 2ASYA 4M45A 1IJEB 3QLHB 1HQ2A 3FUYA 1H2UX 3CJKB 1QVFR 2O8DB 4DV0F 2WVCA 4WQ4A 4FZYA 4OKEA 4M8LA 5FLXU 1NMNA 3J7YP 2QMWA 4E8UA 2OYQA 4HDHA 3BQ0A 1DHMA 2KKZA 4ZJQA 4U95A 3G6ES 2P5VA 1FJGJ 3CJ1A 4JI1K 5D78A 3T1YJ 1YJWS 3DRYA 3P5TL 5JJBA 3I4PA 2ZJPL 4WWSA 1K0TA 1SC1B 2C1EB 2MLXA 5DETA 4KRFA 1GOAA 1EQMA 2YKQA 3MURP 1IKWA 4C7QA 4RCHA 4DL3A 4KO0B 3FVYA 4V19S 4PG5A 2AHOB 4ECXA 3UWTA 1DQ8A 1E3MA 4TU8A 1UL3A 1HYSA 4J90A 1RBLA 5LM7E 4M5NA 3PDNA 4W5OA 2G8IA 3VF6A 1NDKA 3EZUA 2HK2A 1ZA2B 4ECYA 5BYSA 4FF4A 3MEGB 3THTA 3X1LB 1W2BM 4MIWA 3RBDA 2RF2B 4AFFA 3QQCD 3LDNA 2I9SA 1CG2A 4YDDB 1TMMA 2YHWA 4LQ3A 4OLPA 1YZ7A 1BIUA 1OJ4A 3IBFB 2O8BB 3RMAA 2KXFA 4F4KA 2X7IA 2P2CB 4DPXA 2F65A 3VQSA 2R8HA 3DI6A 3CFOA 3MEEB 3PW4A 3L3UA 2J7UA 4JRPA 2KN4A 2ZH5A 4ISGA 1XUPO 4QYZJ 1XMOK 1DARA 3D7EO 1U45A 3T1HK 4EHUA 3HJFA 4RU9A 3VMFB 4DTSA 2W8LA 3GP9A 4OYIA 3T19A 4KB1A 4DPUA 3SK3A 3CF5L 2EFNA 5C25A 5KFPA 4OGEA 2LA6A 4ELUA 2AT1B 1RHMB 3LM9A 2XC9A 1R6YA 4I6MA 4CWBA 4BGAA 4D3HA 1LNQA 1FXXA 4LBPA 4LF2A 3K7RA 4ZVRB 3ZX3A 4CJ4A 3R3TA 3D0PA 4Y0FA 2BV3A 2RQCA 3EWGA 1NM2A 3DLKA 4I56A 4UQTA 4R0EA 4EYIB 1WAJA 4ZITA 1IWGA 3C7NA 2O5DA 2P1JA 4ILGB 2IC3B 3D0GE 2HIQA 2DB1A 4DX6A 1RT1A 1FXDA 3THYA 3TVKA 1NUEA 1TUWA 2HS0A 3KJQB 3LUYA 5IT9O 1WSEA 4ZOSA 3SCKE 2H51B 3CC4S 4YR2A 1U6BA 5I42B 2VV5A 3SV4A 4NZ0A 1KN6A 2IMOA 2G8UA 1OVYA 2PA3A 4CNYA 4HI2A 5F8MA 2AJ1A 5HSPA 1RWNB 1YK9A 4FVMA 2FGOA 4NLGA 2F40A 1VQ8S 2ACMA 1X4EA 4XIUA 5CH7B 4OPAA 1SH0A 3WQUA 2QTWA 2BGGA 2DPJA 2UUWA 2P9SA 5J1NA 2XYPB 1LQ9A 5HLFA 2QL9B 1H7XA 3GG4A 1GLAG 2F7TA 3WQPA 2EEYA 1RILA 2NREA 1WKKA 1X4AA 3HOSA 1N0UA 4C48A 4F36A 3UKRB 4IO8A 2HFVA 3AA2A 2HVDA 2FVRA 2C3OA 3D2EA 3H20A 3MECA 4AHRA 1CZAN 5FPNA 3G6EN 4EO6A 3CC4N 4LUBA 1OO0B 3KLHA 4K50A 3SI6A 4FS1A 3MXIA 3Q7BA 3S7RA 3A5MC 4XAKA 4IR1A 3AVHA 3HHLB 3OFGA 3IAS9 1UKUA 1U1LA 1IM4A 5DQHA 4GO5X 2YBVA 1KFDA 1NEEA 4X66J 3FZ2A 2FQQB 1KVIA 4IJAA 3NVKA 3P5BP 3O6WA 2POKA 1S7IA 5AQKA 1NK6A 3PACA 4HTUA 3G4SN 3CDBA 2O4IA 1EKSA 4UOFA 5F0XA 4ICLB 3NGYA 1M1HA 4GKJJ 4X4NA 1RK8A 3MMBA 2Y0SD 1NB7A 3MEGA 1ASWA 1BHNA 2WBMA 3CPWR 3D2FB 5LXRA 3QZ8A 4B1UB 4N8NA 2QKKA 1LWEA 2P9KA 5HATA 1O5JA 3CJ0A 4MFBB 3AO5A 2GFFA 2RSQA 3B4MA 4USWA 1RT5B 2FLPA 3OYHA 3K0SA 1PJ5A 3B6BA 2YKMA 3KXDA 2ZUAA 3KLGB 2P51A 1X5TA 4EK2A 2LEBA 2PYJA 5E0OA 3HT3A 1NK0A 2IVNA 1N6QB 2AQ4A 3SCJE 4DV5F 1HI1A 2LQ9A 5T7BA 2Q2RA 4FLTA 3QINA 1S9FA 1HBNB 4FN5A 2E6LA 3FMWA 4BLGA 1AZSB 4U67Q 3ULHA 4Y2AA 4WP9A 4DL5A 3CETA 3THXA 2PFUA 2UUBJ 3BSAA 3TTCA 4N56A 3OW2M 2R7WA 2RH3A 1OH6A 3DCAA 1NHUA 1C0MA 4TXSA 2HF3A 1WUAA 3ISND 1CULB 5ITHA 4ED6A 1FWKA 2JVOA 2A3JA 1NJIT 5FLXO 3OFHA 2EK6A 1NJYA 2Z8QA 3OR2A 3K57A 3D54A 3WIVA 5LSLA 3LF0A 1RT6B 4BRQA 2EFVA 1KFSA 2W9BB 4C8YA 1K9MT 3NVMA 1QSLA 3BKUA 1VIOA 2YJFA 4ED2A 2I5JA 3BZQA 1NO8A 5CABA 4NWBA 4TNOA 3EE8A 1HIYA 4CGFA 1R31A 4JI1J 1SKWA 1Q8KA 1HBOB 2E7WA 3HHKA 4J2AA 1IVZA 1IKVB 2DR9A 2ITGA 1RBUA 2CJKA 5SUHA 1U24A 2E4LA 1M5SA 4IFYA 2NPIA 1P27B 1VK3A 3JQMA 3ZTRA 2QRRA 2DKOB 3RB6A 3KVGA 1LFWA 4OYPA 4OJGA 4Z4GA 3QT6A 2WAQD 4X4QA 5D8HB 4ZCMA 3TSPA 2OKQA 2NZ4A 3A1YG 1GEHA 1F0XA 1OYDA 2HLTA 4PKIA 3C6AA 3LDSA 3KD5E 2PFDA 2VH7A 3GL1A 3V81A 4PHTX 2ZM6K 4OI2A 4B3TF 1JXVA 1Q5VA 1XHZA 4Q44A 3BUZB 3CJ3A 2JEGA 3H90A 3VF0B 3TAPA 4C8ZA 3L3CA 4USVA 4DPYA 1YIJN 4LY7A 2CJQA 4CIFA 1WOQA 2ZKUA 4BG8A 3L0QA 4OX6A 4I68A 2CZVC 1M1KO 1N8RT 1X9WA 1WI8A 2L08A 3ZSXA 4CYUA 2Y8WA 2BE2A 2F8HA 4KTZA 1NK7A 4N7TA 2FF6A 4J9MA 1X4HA 4C3MA 4OGCA 3MM7A 2NZTA 2VOOA 3OT9A 3SQ0A 3Q8UA 1BC6A 1HJRA 5AXMA 5ETLA 1F2GA 1G99A 3VENA 1H73A 3MM5B 2FVPA 1HMVA 2YKPA 5C2DA 2RU3A 2QL5B 1X5PA 4PG4A 2ERRA 3CMEN 1Z2LA 1YT3A 2KM8C 1XMOF 3P4UB 4CEFA 2Q31A 3QBXA 4LR7A 4HEA9 4KYZA 3C8YA 3ZCMA 4ZTJA 4YOUA 5GAEI 5KT6A 4FPRA 2HHHK 3MMBB 2UV8G 3SNNA 4QW8A 3M1FA 4AM7A 3V9SA 1HD0A 1LXJA 3NRBA 4C8LA 4RTFD 1WBDA 2M4MA 1FF2A 2XNQA 4CF8A 2WTFA 4PWUA 4ALZA 1D1UA 1ILYA 1HBUB 3IP0A 3O3FA 4M5DB 4OZ1A 2U1AA 4WCEQ 5HRPA 5A2QU 4J9SA 4RO0A 2GIFA 3IS9A 2XY8A 1XWLA 1KLMB 3JXUA 4FWNA 4O8UA 2GTDA 2VQFJ 4PEOA 4BR4A 3C0BA 1S59A 5JS2A 2W2QP 3ENVA 3ELHA 2ZD1A 1UWBA 3DOMB 3MM5A 3KLIA 3VGMA 3BDEA 4DS4A 5HVGA 3HKZD 3CMQA 5BJRA 3TW0A 3J7YI 3UKUB 2FJAB 4OZ3A 1Q81O 2WZ1A 2YNIA 4GKJF 4C8NA 2IDEA 1KD1T 3HHLC 4O3PA 1FRHA 1YUWA 4CI0B 1YTYA 2O8EB 3M6WA 4M3WA 5GAHI 3VETA 2YKAA 2W6LA 5KG4A 4WQ4C 4CW7B 4NLBA 1TYQB 5GMDA 4CDIA 1IKYB 2FHJA 1PBAA 1CZBA 2FC9A 3CJQA 3V9ZA 2Q3SA 5KFJA 3THPA 3TSUA 4CZJA 3M9NB 5CYJA 1R8CA 1KVBA 4CLTA 3J7A1 2B4PA 3MWBA 2PFFB 3QATA 1SL1A 4CZGA 3SXLA 4MJKA 3WHIA 4K4UA 1FRXA 2V4JB 4CJEA 1RGIA 3VAJA 4O23A 4KHNA 3HHEA 4IH5A 5GAEP 1ZTWA 2AMCB 1RU1A 1NU0A 3RSEA 2RVJA 3MDFA 2DTJA 3T5LA 3BYPA 2HGMA 1FK9A 2HMPA 3D66A 1OH8A 2PMHA 1HI0P 4BC3A 4ES2A 4KH1B 4DTUA 3NMRA 3FEZA 2H4WB 1RDCA 3C94A 1OIAA 4LF8J 1NOYA 5HO4A 5KPTA 3KJNB 1DQAA 3AA3A 1HPZA 1EETB 2UUAF 3MTJA 1JLQB 3IDHA 2W40A 3AD9C 5LOQA 2HFOA 1FFSB 3W60A 1TL7A 4DSJA 3NOCA 1A5VA 4YHHK 4W5NA 3LGMA 3F0NA 3FFIA 4F2SA 5BRHA 3DYAA 1ZM2A 3RW6A 3JSYA 2CWKA 3O3HA 4OHWA 3LH2S 3JS6A 3OL9A 2LFVA 1YJRA 3DM2B 1IR2A 5DM7L 3PHEA 2JRSA 5ETNA 3A12A 2DNLA 3H2UB 1A7GE 1FNOA 3AD7C 2IAJB 1FRKA 3G6XA 1NGIA 1R59O 2VPXB 2VA2A 3SZ2A 3ZSYA 4DQ8A 4NI2A 4NRUA 1OS5A 4HVZA 4EU0A 3M2RA 5BR8F 4MAKA 5AQWA 1SJ1A 4ZS6A 2BJ7A 4X65K 4MH8A 3I0SA 2Y1LB 1NLKL 1LW2A 4EAHD 2MSTA 1IBKF 1QZ5A 5HANA 3A3OB 2FDNA 1MROB 2V52B 3UR0A 3I31A 2W9BA 3G8TA 2DIUA 1U1PA 1S1VB 5CZXA 2E66A 4DOZA 1QTNB 3RW7A 4J9VA 4V19X 5GVQA 2HHVA 3PO5A 2XCPA 5HQLA 1TFWA 3O80A 3SUPA 2IY5B 3M4XA 2QWOA 3B6PA 2J6UA 3V1OA 4CF0A 1VI7A 2P8IA 3T3FA 3LZIA 4G1PA 4E1JA 2KZMA 2D69A 4ZTFA 2CRLA 3TI0A 1V4SA 4ED8A 4NLRA 2UZAA 2JHEA 5C7PA 1YJ7A 4FJXA 2JFKA 3T5HA 1H0HB 4IFYB 1QZ6A 2KHCA 4M7YA 5KG2A 1Y7PA 1QD1A 4WFAQ 1WC6A 2I7PA 3BYRA 4BBYA 5L1LA 1K9MO 4OZ2A 1HNXF 3CC2N 1T6CA 2E1PA 4TLRA 1U1RA 1E6VB 2EG1A 3SFGA 1VSLA 4KB7A 4M42A 4K5RA 2DRAA 3SCIE 2QZ8A 2CQBA 4CJKA 3FK4A 5CZ1A 3MUVP 3OL7A 4DU4A 5LL6d 2YCHA 5B0FA 1NKBA 1TL3A 2BM0A 1TK0A 3HO1A 4FZXC 1KVAA 4LSLB 3PEHA 4IQXA 4PA1A 5AJ3K 3O5TB 2VQFF 3NGIA 3OHBA 3LZJA 3K2YA 4N77A 1KBRA 1RYSA 4K25A 3R6LB 1GLCG 2KB2A 3LP1B 1A0OB 1RJJA 1RKIA 1UAXA 3EICA 3ZT4A 3QIOA 5ETOA 3DXKA 1KAXA 1JLCB 4DUYJ 1ELOA 4DHYA 1UJ4A 4CI6A 4ED3A 1UVKA 5IXUA 3UVJB 2AJ4A 5C24B 2HMIA 3GWCA 1ICEB 1HYZA 2BQUA 3ZZZA 5KFNA 2DITA 2PO4A 1G2EA 3D6RA 1G6BA 2QW9A 2R7QA 1S9EA 5ETMA 1YSJA 2QI2A 2BYCA 2YTCA 4B1WB 2BBEA 3MMCA 2VG7A 1HBNA 1R0AB 2OPQB 1CQMA 2E88A 2B7BB 2G2OA 4UY85 2LLZA 3T1YF 1S7HA 1Z4UA 3EVOA 2YX4A 4E7KA 3KLEA 3KOAA 4A8MP 2JJ4D 2HFNA 3NH0A 3HCXA 4AD6A 1CPZA 4CLPA 5K20B 3QPIA 1T0TV 4IFEA 1NSQA 4KGMA 3BGUA 3QSIA 1IQZA 1U2CA 4X64K 2EG2A 4U67L 2GQ2A 4L72B 4A8QA 3UD4P 5D6GA 4B3RJ 4A8KA 3G10A 5F8GA 2HBZB 3PRVA 4Q8FA 4GC7A 1LAWA 1WG1A 1MMNA 1SH3A 1BQXA 4DN0A 4YR0A 1UZHA 4O0JA 4FK2A 3D1QA 2C3PA 2XQCA 3LP0A 3I56N 4C0HA 3SLCA 3EKUA 1TMJA 3H3OB 3R5AA 2IDOA 1WDDA 4CJVA 1G1XA 3G6VA 2PA8D 4EI2A 2VZ9A 3QERA 4KV8A 4R5PB 2L9WA 3GG1A 5JVGQ 1E4GT 1PCAA 2OO4A 2MZRA 2M7SA 1KDNA 2GQCA 3HYFA 2MQLA 1C0GA 1NGAA 1HNXK 2R7UA 4CZIA 4DR5F 3SUQA 3KHYA 3GFXA 4RNOA 2FJWA 2UVUA 2X1GA 2AZ1A 4FJ8A 3SSRA 2D3UA 5C42A 3NY0A 1TVRA 3V1QA 1KQFB 3IXQA 5AXKA 2ZNYA 2JC1A 4FLXA 2LQ8A 4CJUA 3TAFA 3K5NA 4NCAA 1BE4A 4KAIA 5H9FJ 3NAEA 3DRRB 2G0JA 5AZJA 4AQYK 3V6DA 4HDGA 3MCAB 4OV6A 2HBJA 4HHJA 5KFIA 4JNEA 1WKLA 3QMQA 3AVIA 1FX4A 1VQYA 2FJEB 3J80U 3VZHA 3H3NO 4C23A 1RAFB 4O0IA 1TL7B 1D5AA 3PZPA 3QEWA 1TKDA 4PUOA 1Q95G 2DH9A 2XM3A 1HMVB 1XMQK 2BJ3A 2P9NB 2B9WA 2ZVIA 4RW7A 1P9YA 4URSA 2Y8YA 2OPRA 1R7IA 1P1LA 3K9KA 5I42A 1HHSA 4F4YA 5HMWA 1VFJA 3HULA 2J9DA 3VERA 5DO2A 4WTYA 1YITS 4ECVA 2ZDOA 3TAGA 4DXLA 4B1YB 2KHDA 4Z2XA 3CJKA 1EKRA 3C6HA 3W1YC 1HI8A 1IKXA 1M5VC 4RLEA 5D3GA 3T5KA 5BR9A 1Z26A 3QGIA 3MCOA 2B5JA 1S57A 3TARA 2KXNB 3SSSA 1B64A 3DRRA 4Q0BB 1F3FA 3Q8VA 4DSEA 4DFMA 1LW0A 1DY3A 4EBCA 4GC6A 4MO4A 2HNYB 3PYDA 3LGNA 3R97A 3M6UA 5LMNK 3R1XA 3ILLA 1VQMS 2R3VA 2P9PA 1W9HA 3HPOA 4ILJA 4TYBA 1IQTA 4QR0A 3O4QA 4BC4A 2D1CA 2AF6A 1K8KA 3UD3P 4JKDA 1X0PA 4I64A 3N01A 5LL6Z 1FD2A 3DLLL 1SVDA 1WN7A 3IGNA 1GTHA 3UB5A 4ZP7A 3CSKA 4DX5A 5HMZA 3HD1A 4B08A 2IJFA 3HZGA 5AQGA 1HBOA 3FFKB 1ZZFA 3J81Y 5E84A 3I55N 1BDGA 3OFFA 2GO8A 1B7YB 3VQAA 2XTJP 4DWIA 1OMSA 5DDPC 4MK8A 3WX4A 5EU7A 3QEIA 4IG3A 1RTIB 4LF5K 2AX0A 4PXDA 2HWIA 4DR1K 1Q8LA 1XERA 2EC2A 1UFKA 5GADP 3MR2A 2E1MC 5AQSA 1LKZA 3CCMN 4H4OB 1X3NA 4CJLA 4QBUA 4YR3A 1X7VA 5F9NA 1TYQA 4L3QA 3KDOA 4FJ9A 5KFUA 1ATSA 2HS3A 2GAGC 2JWNA 4RWTA 3R6MA 1L3UA 3QEVA 3VAHA 1S5ZA 1B0PA 5J1PA 2C2KB 1RDBA 5C25B 1JCEA 4S0MA 3I56S 5EOYA 1FKPA 4R5PA 3WZ0A 2QA4S 3D9BA 3GIJA 2KT3A 2A3ZA 1UWAA 1SCJB 4K59A 3R7SB 6AT1B 4CERA 3PFOA 2EWSA 1MWQA 4P2FA 3OQ2A 3KG1A 3DXBA 3VEOA 3QRQA 4MIBA 5DM6L 3V6JA 4LFAF 1X9JA 1FE4A 3SMPA 4Q8EA 4J9OA 3RSEB 4WYLA 4DMNA 2HRUA 3OYCA 1BISA 2PE8A 5KFCA 3AVMA 1OY8A 3SDEB 2O8CB 5F3ZA 3EZ5A 3OTOK 4MQ3A 3CE8A 5EX3A 5GMKa 3W9IA 2HMIB 2NRRA 3W2WA 1RT7B 1FJGK 3F41A 2BANA 3OR1B 3PKYA 4IYQA 3M8SA 4DS5A 2UUBK 1VBXA 1FRJA 3I8DA 3Q8YA 2RF2A 4IR9A 4NLWA 3C66A 2NXEA 2Z30B 4QCLA 2KYXA 1GLFO 3P96A 2GV1A 3QFWA 4CO1A 3LTOA 3BO4A 1VQNS 1AW0A 5F1XA 3DU6A 2LVWA 2BRLA 4AH9A 3HZEA 3IFRA 5D0RA 4J8FA 2NUHA 4C0OC 2OHDA 3U3GA 4NXNK 5BYQA 4LC9B 5GAHP 1C4CA 5U47A 4WKYA 3VCDA 3Q8QB 1CXQA 4IUFA 1X9SA 4WFYA 3ZX2A 5A8WB 4DHVA 3VGKA 1Q78A 4ZLLA 3J8AA 1TAQA 4WFAL 1PYOB 3CCSN 2IIRA 1GFWB 2ETJA 2OEKA 4YORA 2V2ZA 3R1LA 5HBMB 4H5VA 1F5BA 4ZKAA 1GXLA 4UQGA 1MROA 4FKYA 5CAAA 4U8YA 2DNOA 3W2WB 4MKYA 4J9LA 2GBZA 3A5LC 1JKHA 4KR0B 2J7WA 3RRHA 4DR6J 3JQJA 2XMUA 1OH5A 2DR7A 1S9EB 2OI2A 2VKRA 4HH0A 5DK5A 5LMUJ 1PKUA 4TVAB 1Z25A 2OTJN 1TZ0A 3OLAA 3Q24A 3DYAB 3RB3A 4GV3A 2ZJRQ 1U48A 5HAOA 1YLXA 2MQMA 5KG5A 1Z6RA 2EC0A 3PJ9A 1V9OA 4DV3J 4I67A 2V4QA 2MZJA 1SJ4P 4F0KA 2VJVA 3POTA 2DNGA 4Z4HA 3KK3A 3O8MA 5HP1A 1UJ6A 4QIWD 1YJTA 4QIGA 2HURA 5AE2A 2KG0A 2ZKTA 2OAUA 3LO3A 4ENOA 4CEBA 2PN6A 4KGXB 3M2RB 1HNZJ 1AT1B 5CE3A 3NS5A 3NG8A 4CFBA 3BV8A 2NQPA 4CGHA 4RBVA 4WCEL 4LRBA 4JKGA 4L75A 1NLVA 4X4VA 3T6JA 1NK8A 2P9IB 4NCBA 2ZC4A 2FHMA 1M0SA 3PIOQ 2FVSA 4B8CA 4CLUA 2H54B 4NLXA 3AOAA 4LFAK 7FDRA 5KG6A 3CCJN 5AZIB 5DG9A 2W7OA 3P38A 4CEDA 4JI5K 4MK9A 4F9OA 2VBZA 1EAYC 4ELTA 2K7KA 3UN2A 3M6VA 4EGLA 1UZDA 4C0BA 3TZZA 1KQGB 2XI3A 1T9XA 1WDTA 4A8XA 2WVDA 3D7SB 3PKMA 3U6FA 3D68A 3OR2B 4PCQA 1XMQF 3JYTA 1KXPA 4GV6A 4Y65A 3AO3A 3ZETB 2L9NA 1NB2A 2LXUA 5IZHA 2HBRB 2ZOMA 1IBLF 2CVEA 4TN2A 5IT0A 1S72N 2E7VA 2VWJA 4YB5A 5E3CA 1X4DA 3NBPB 4CJRA 2W9AA 4L73A 3WNGA 2JVRA 1BD6A 3PJXA 3KHHA 3CJCA 2CGJA 4DLGA 3EEQA 1NH8A 4F04B 1FCAA 2KHOA 2QIFA 2KT5A 3ENQA 4UZCA 5AQTA 1UFLA 4ANEA 4F3QA 5A76A 5T14A 1ZH5A 4BRPA 4OZ5A 5AQMA 3KJVA 3HL8A 2CQCA 2XMWA 2ZZTA 3FZKA 2ZWHA 3VGVA 4FJNA 2OD6A 2DHSA 3PXGa 5MAOA 4DLEA 1O13A 2D0OA 3CJRA 3V81B 1ZPVA 5AQOA 3EDRB 5JVHQ 4UF4A 4ECUA 1HBUA 4CO4A 2N3OA 1OSCA 3PEJA 4W5RA 1F9HA 3VQ5A 4Y2CA 4KPCA 3A5OC 4H5NA 2G0CA 3ILOA 5D77A 2FUG9 4XTTA 4KFBA 2RE1A 3NMUA 4JYAJ 4E7HA 1NGFA 1M90O 4F0HA 3HP6A 2WW8A 4YDUA 1C1AA 4A2BA 5FRNA 1S6OA 3CIPA 2EK1A 2B7CB 3J7AP 4BC2A 1DTTA 1HNVB 1NSAA 3O6QA 4JKEA 4L8RB 2BOPA 3LW5C 4LR9A 4USTA 1Q8BA 1F5AA 4LFCF 2ZE2B 4QOTA 1YI2N 2LEPA 4ED5A 4EZ6A 3LAKA 3AY9A 3E66A 2R9LA 4ZPBA 3R9LA 2ROPA 3RYLA 1S6PB 3AB2B 2FVQA 1W2BR 1VQKS 4E7JA 4EBDA 4C3LA 3QWPA 1TL1B 3LGHA 3MK6A 1OPIA 4WJBA 1UVMA 5AQLA 1YRUA 3RG6A 3CQYA 4LF7F 4PQUA 1VQNN 3J81U 1NOZA 2ZITA 3NEKA 3DRPB 2C2MB 3CF5Q 4TKTA 2V0NA 1NPKA 2HBMA 3E01A 3JXOA 3ET6A 3VA0A 2F8SA 3IM9A 3GCXP 5LSOA 4OO1J 4OLBA 1VQ4S 4M5HA 4FPAA 2Q1NA 1GTEA 1LOTB 4Z0UA 1RLDA 4IKAA 5LMNJ 3IG1A 1CJUA 1ITGA 3VQBA 2AEJA 4DR3J 2RUSA 2IYGA 4WK1A 1BUXA 1RWKB 3PRBA 4FKXA 1RHJB 4J9UE 5FDLB 6FD1A 2MZSA 1H1VA 2A1RA 5D0GA 4JI8J 4FXWA 4DU1A 3CCES 2BABA 4X4PA 1YJWN 1CQNA 3HLUA 2HVIA 4C8KA 5IT9Y 1FDAA 3CCUS 1CJVA 3I96A 4ZLNA 3KTQA 2JX2A 3O44A 3JAMU 2DXDA 1QVGM 4JV5J 3OS2A 2WOMB 4OJRA 3IWLA 1U02A 2XMKA 4A8WA 2CIMA 4DV7J 4X65J 2GHVC 1B3TA 5KG0A 4BRDA 2R7OA 4ZPVR 2IJNA 4O44A 2DH7A 4AL7A 2Q6BA 2KDOA 4B1XB 2C28A 1ZOTA 3MDQA 1RAJA 4KFBB 2OA8A 1J5EK 1OQ6A 1X8DA 4JV5K 4CT9A 3OHAA 4RWXA 5CZ2A 1K1QA 1EWQA 3E9OA 1HNVA 3C6TB 4IQMA 4IBNA 1W25A 2EBGA 3M05A 4N5SA 2BUPA 1ZS6A 1HQUA 2OFGX 2FB0A 2JDJA 3B6OA 4HHUA 4DSIA 2K3KA 4KREA 1NBWA 1VOMA 4M3RA 4W98A 1S6UA 1TUVA 2B8PA 4MLEA 1TL5A 1GMWA 1ZBTA 4O4GB 4X65F 3IRWP 2O8EA 4CK2A 4DQRA 3A4TA 4YOEA 5AXLA 1S12A 1WEXA 3FZHA 4ZVTB 2W4DA 4AE5A 3HXMA 5B0AA 4BY9C 3MD3A 3THYB 2HBYB 3H59A 2MZQA 1Z05A 1XNRK 1ZBSA 3Q2TC 3CI5A 4LFCK 2V8HA 3PV8A 1FXRA 1H98A 3TOQA 4M1KA 3TX8A 1Q4RA 6FDRA 1O51A 1BWEA 1ACMB 1MLAA 4PYDA 1VCTA 4AILC 2O8FA 4CZKA 3MN5A 1YG0A 2W4CA 5E41A 2KTQA 2OPQA 5HRRA 4IEEA 1UMJA 4JOUA 3BB5A 5AFUH 4E2FB 1V5VA 1NJWA 1P8ZA 3LDPA 2BACA 3FSYA 3CJ8A 3I9V9 1U0HB 1RBRA 5BPLA 1X4FA 3WNEA 2PEHA 3WUHA 1OH7A 4PABA 3ZTQA 1EZZB 2E5GA 5BN8A 1FEHA 4HWIA 4DUYK 2BKPA 3MCSA 4I4BA 2IVOA 2NUUG 1SL2A 5M1QA 1VSJA 2EX3A 4GKKK 3TPQA 1A5XA 3D1HA 1GX6A 1KAYA 2D0AA 9ATCB 3H40A 1VQ5N 1T9VA 1YXQA 4AL6A 2JNJA 3C46A 3M2VB 1RSCA 1TQLA 2BQRA 4K42A 2PBDA 4FLVA 4DR6K 4W5QA 1HNWK 3F44A 3BH7B 2E7XA 3UCUP 1AB8A 5AJ3F 3CCQN 3PM9A 2QEXN 2ZC3A 2DEIA 3PLAA 4LF6K 4CGJA 3H42A 3OUYA 1VQ7N 3EM1A 5CYQB 2FHOB 3FKBA 4RPFA 4FJ5A 3LANA 5LJ3Y 1NGCA 1QQCA 2FC0A 1NNDA 4G6VB 4ECZA 3AXKA 1HBMA 3WXLA 3PX6A 3QRPA 3CXCR 4JKHA 2B4OA 5KQDA 3MPYA 4G1QA 4Y2MA 4MIAA 4ITSA 2KW4A 4C1NI 3N4QA 3ZSOA 3RZAA 4JRQA 3K8VA 2P9SB 4KGKA 4TSXA 1YJNN 4IOCL 2CPFA 1KD1O 3M6GA 1RTHA 4N47A 4IFVB 2MJUA 1QHAA 2NRWA 2LMIA 2C2DA 4OX7A 4FL9A 3KKFA 2ROEA 2ZJPQ 4YUDA 3FZBA 2EXUA 3VAMA 2YNHB 2IBKA 3T1YK 4AYBD 3S41A 5EWGA 1RADB 4DSFA 4A8SA 4X4OA 3NF9A 3M9OB 2M9KA 3IR7B 4RL1A 2MQQA 1TKZA 1WHYA 1ZAWA 3D28A 1UVNA 3SBGA 2XEXA 4DR4J 2IVFB 3ISNC 4DUYF 3AO4A 1S49A 2HBQB 2PMZD 1QVGR 5CHIA 1HNZK 1QLNA 1YAGA 3CPWM 4FOEA 3VGSA 4H03B 2JC0A 4KHWA 3CD0A 1S10A 2W41A 3E8OA 3ZEUA 4E98A 3OHRA 3TR8A 3VEXA 3HSGA 3PR5B 1XNRF 4PXCA 4QOZB 2FHKA 3DXMA 1I1GA 2VPWB 3HVAA 1OWXA 4O4GA 3P39A 4JI0F 2QEXS 4QS8A 2A0FB 3B8AX 1FTRA 1CZ9A 1XQSC 4DFJA 4FP9A 2QG9B 1VSHA 4USKA 1NDPA 1JJHA 4KHYA 3OV7A 3CC7N 4JBCA 1C1BB 1LWXA 2QE5A 2G8FA 3DLEA 4LIRA 4K4SA 4QAGA 4JKBA 4ZHRA 3O8WA 3OYAA 2YHBA 4HHTA 2G1DA 3PSFA 1O8BA 3KHLA 3KKRA 3FC9A 4WPAA 5IC4B 4P72A 1RWPB 1W97L 2V4JA 4DV4J 4JI4K 2FBYA 2K7JA 1PILA 4HUEA 4GKKF 4JI5J 4O3SA 9RUBA 1RQ0A 3W5ZA 2AGPA 2YKOA 2MLZA 3I82A 2IDLA 5JUMA 2AYBA 2HBKA 2CPYA 3NS7B 3D4JA 1BOTO 5C15A 4USMA 3QT7A 3HSDA 2CPJA 1CC7A 1VBYA 3N5BA 1HNWF 3O3GA 3RBXA 3DRXA 1WC0A 4DTXA 1U1QA 1FE0A 4NOHA 5CR4A 2AJQA 3G6YA 3NNCA 1RT2A 3FCVA