1IKXA

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikxA05
1RTDA 4JV0A 3UPFA 4DG1A 4FBUA 1MU2B 2GC8A 2E6LA 3V6DA 2FLLA 2JC0A 2XRIA 3K5MA 2DY4A 3IS9A 3DRPA 1HYZA 5J2PB 5J2QA 4NRTA 4O5BA 3RB3A 5HRRA 3LDSA 3KLEA 3NBPB 4FXDA 1HYSA 5KT2A 3NE6A 3OLBA 4C8KA 5J1EB 3QYYA 4CK3A 4Z0UA 4M41A 1RT4B 4OL8A 3ZSRA 4CJRA 2AGQA 4FJNA 3LPUA 2C2DA 1EKEA 4M45A 2OPQB 3TAPA 4ECTA 5KFDA 2QK9A 3SQ0A 1EETB 3CDWA 2ZD1A 1IKVB 4JS4A 3HSTB 4F8RA 5JS2A 3CFRA 1BISA 5J2NB 4DWIA 1GX6A 3OS0A 4M3UA 4I2QA 4MKBA 1QUVA 4ECRA 4QAGA 2HVHA 4DMNA 4DSEA 4Q8EA 4KE5A 1D8YA 4FLVA 4DS4A 4M3TA 3FRZA 4NLRA 2V9WA 3RMDA 3PX4A 3SUPA 4F4ZA 2W7OA 1SH2A 2R8JA 2RPIA 4PY5A 1XC9A 4AHCA 3U6FA 1HQUA 4M42A 4DF8A 5KT6A 1K6YA 1L3SA 4DU3A 1RDRA 3S3OA 1U45A 3C95A 4ECUA 3G6XA 1S6PA 4TXSA 3UQSA 3SFGA 1FKOB 2F8SA 3KLFB 4F2SA 4EBCA 1VRTA 3AVIA 1HQEB 3KIOA 4DQQA 2IM1A 3HHKA 2KFNA 1GOBA 4F3OA 3CJ0A 5CY4A 4LSNA 1C0TB 4WFXA 1T05B 3NGDA 3OYNA 2ILYA 5KT5A 2V0NA 1N48A 5C24A 3FQLA 2A1RA 4ZTFA 4DL2A 5DLGA 4LSLB 4KO0A 4HVJA 1JLGB 2X6SA 1RT5A 2FJVA 5KFYA 4OKKA 1N5YB 3H5YA 4IQXA 2J6UA 4ZMMA 4RUAA 1ZBUA 1KRPA 2IM3A 4QW8A 4K4TA 2OYQA 1DTTB 4ZVHA 4NYNA 4FK4A 5SWMA 4AHTA 4GVMA 3QEVA 1QSYA 4J2AA 2ASLA 3QGHA 1W0HA 4FM0A 1WSEA 2IJNA 1CZ9A 3ZCMA 4FJJA 1HYVA 1GX5A 1I6JA 5KFKA 3KKSA 3BR9A 2OPPA 4URQU 3UIQA 4QWAA 2PZSA 4RNMA 1N4LA 1KVCA 4OGEA 2G8FA 3L2WA 4JRQA 4ED6A 4R0EA 4KBIA 3MEGA 3VQBA 1N5YA 2IC3A 3CJ5A 2FBVA 3QLHA 2D0CA 3H98A 4WYLA 2W9BB 3BQ1A 4XIUA 3OYIA 4LQ9A 3VQPA 4DQRA 4Y1DA 3DRPB 3SJJA 4RW4B 5F9NA 4EBDA 1X9SA 1LWCB 4I9LA 4ZTJA 3HO1A 4DTRA 2DFHA 3T5JA 1JLQA 3HPOA 3CG7A 4CIGA 4FS2A 5F8JA 4DTUA 3OJSA 4FZZA 2NUBA 4RW8B 3TVKA 4FK0A 4RW6A 4B8CA 4AH9A 4O4GA 4ZP8A 4TY8B 3QINA 3V1RA 5KRSA 1IKVA 4Z4CA 5KFOA 3BSNA 2G8HA 4DLEA 4AHRA 3TAGA 1TKTB 3MFHA 5J2NA 2FLNA 1G15A 1HPZA 3SZ2A 1NJWA 3OYGA 5JS1A 3VQQA 3O4NA 4E7KA 5KRTA 3I0SB 1R0AA 4ECVA 1N6QA 5KG5A 2P5OA 1UAXA 1UWBB 4KKOA 3QIPA 2W42A 2RDJA 4KI4A 3T19A 2F8EX 2EX3A 1FK9A 4QPXA 3LZJA 4ZHRB 4CJFA 4CHZA 3RRHA 1RA6A 3L2UA 4WE1B 1EP4A 3HVTA 3I5BA 4FJGA 4DU1A 1JIHA 3QEPA 2D3UA 4JS5A 1VRUA 2KZZA 4DS5A 3NF9A 3QNNA 1XR5A 4NCGA 5F8IA 3VA0A 2YNFA 4OKEA 4JV2A 2XWYA 3O3HA 5F8HA 4TN2A 4TYBA 1WLJA 5KFBA 3CJ3A 3PHEA 1R0AB 4MQ3A 3NAHA 5KFQA 4N47A 4YNQA 1CXQA 2GIRA 3G6YA 2Z1GA 1IH7A 1DTQA 4J9LA 1HNVA 4Q0BA 3H40A 1FK9B 3AVGA 4CFCA 4URGA 1RTHA 2XY8A 1LWFA 1XR7A 3DLKA 3OYDA 3KMSA 2XCAA 3U3GA 1IKXA 5KG0A 5F8MA 3CJ2A 4J2DA 1TKZA 5KFAA 4K4VA 4KHQA 3K5NA 1HNIB 4XPCA 3EPIA 3AA2A 4Q44A 1VRUB 3Q8PB 4ECQA 3HXMA 4ED2A 4RNFA 5DQHA 3WNFA 3V1OA 3TAFA 1UOCA 4GW6A 3KK3B 3Q8SB 4CGDA 1ZBHA 4FLZA 2C2RA 4BDZA 4URSA 4LQ3A 2OPPB 1I3AA 3C6UB 4ZP6A 4ZVFA 3GV8B 1U04A 4CEAA 4K4XA 1XWLA 3ITHA 3H4DA 2BQ3A 1LAVA 3NHGA 3SNNA 4NLWA 1RT6A 1S1UB 1BIZA 2YNIA 3SFUA 5HRSA 2VG5B 1X9MA 4IBNA 4F4YA 3I5CA 4TLRA 1ZBFA 4KRFA 4FLWA 3NAEA 1LW0B 3DLEA 2R2TA 3HM9A 1JLBA 3ULDA 1S97A 3B6OA 3TAEA 4K8ZA 3IGVA 1RNHA 2FBXA 3PW2A 4C8OA 3DRSA 5KG6A 1SV5A 1JL1A 3QZ7A 2IDOA 3N6NA 2EC0A 4HUEA 2D3ZA 4CGHA 4DTPA 1N56A 3MEEA 1SKRA 4CF1A 3A2FA 4BDYA 1S9GB 4IRKA 1J9AA 5K14B 1VRTB 4FBTA 1T03A 2XY6A 1KLMB 1TKXA 3DOKB 3G0ZA 3V9WA 1A5WA 3SQ1A 1JLAB 3IRXA 3T1AA 3RAQA 3PO5A 3MFIA 3HKWA 3RWUA 4DTMA 1IKYA 3AVFA 3VN5A 3JSMB 2V4QA 3PX6A 5KFHA 1LW0A 4MIAA 2AU0A 3ZSZA 3OS2A 4EO8A 3BQ2A 2G8UA 5CYQB 4CEBA 2P51A 4W5NA 2UVRA 1YVUA 3QIPB 3AVLA 3QIOA 2OZSA 4E1MA 1JLCB 3KK1A 1K1SA 4U6PA 2DFEA 4JLHA 3OHBA 4GC6A 1C1AA 1C1CA 5KT7A 4FS1A 3OYLA 2R8GA 3KLGA 3CM5A 4EBEA 4K50A 4FCYA 4U7CA 4MK7A 3TABA 2JC1A 3CVKA 1RILA 3C6TA 1TK0A 1BCOA 4LH5A 4KB1A 3OYMA 5KFZA 3F73A 3V9XA 1KFSA 2ITGA 3HPHA 1RT4A 3ICLA 2G8IA 1KVAA 1J53A 5HBMA 3K59A 5F9LA 4RW7B 1NK0A 3GV7B 3VQDA 4CJ4A 2JEGA 4CERA 1T94A 4CHQA 4MIBA 1TAQA 5DG7A 3TQ1A 2IC3B 4Q0BB 2BDPA 4CFBA 1L3UA 4E3SA 3GIJA 3RB4A 4J9NA 4CECA 4FJKA 3MEDB 3PV8A 4FVMA 3M8PB 1C1BB 3MAQA 5HROA 5KG1A 3E51A 2VA2A 3LAKA 1NNDA 3KLGB 4FJLA 1HNIA 3V1QA 4I7FA 3PX0A 2D7SA 3RR7A 2R8HA 3V81A 1FXXA 5J2MA 2O5DA 4NCBA 4QCLA 2UVWA 4BACA 3AA4A 4OGCA 4IKFA 4ED8A 2RN2A 2XGPA 4CJ3A 1BI4A 4PQUA 3TWHA 1TK8A 4HTUA 2YNGB 3GV5B 1JLEB 4I2PB 2G8WA 2HHWA 3KJVB 2EHGA 4OLBA 3OYAA 1FKOA 2JGUA 3KLIB 4FW2A 1S9EB 5C42A 4DL4A 4KI6A 4YR2A 2W9AA 5KFEA 1BIUA 4KV8A 3Q8RB 4O4GB 3MXMA 2R2UA 1KTQA 1T05A 4I7FB 3ZT0A 1ASUA 3AO2A 1LWEB 2AGPA 1CSJA 4RNOA 3L2VA 2X74A 4JRPA 2IBKA 4H8KA 3ZSQA 2ZQBA 3I0SA 2YNGA 4NLDA 3L8BA 1RTJA 3WNHA 2GIQA 4CJKA 1N6QB 4J9QA 3QEXA 1GOAA 1TL3A 5EUHA 1YVFA 4ICLB 1RDBA 1VK0A 4W5OA 3BQ0A 2G8KA 4HCBA 4OVLA 2DPJA 4Z4HA 4OPKA 1WSIA 3DI6B 3AO5A 3IS9B 3O3FA 2UVVA 3QZ8A 3LP2A 4FJ5A 1TL1A 2Y1IA 4NLSA 1WSGA 5DQIA 4PUOA 3BREA 3AO1A 3BDPA 3V9SA 4CHYA 1SUQB 5FROA 3QLHB 3BGRA 1S1XA 2OPQA 1DTQB 2FVCA 2B6AA 1EETA 4IFVA 2FBYA 4FJHA 4IH5A 4H4OB 5L1JA 4IFYB 2PYJA 3ZT1A 4RW4A 4HHTA 4ED7A 5KFTA 1T3NA 1DLOB 3IGNA 4CESA 3NBPA 4DSKA 3GYNA 4I2QB 1NJZA 3JYTA 3DLKB 4DSLA 1VSDA 2HWIA 2JLEA 2ZKUA 1RBVA 1JLQB 3M8QB 4O3RA 4K4YA 5KFIA 1D9FA 3LPTA 1X9WA 2HAIA 3OSNA 5CYMA 5KT3A 2QE5A 4PUOB 4TY8A 2YKNA 3KOAA 2FVPA 2VWKA 1SUQA 1S1VA 4WXWA 3LWLA 4DQSA 1BQMB 3CFOA 1B92A 4DFKA 4W5QA 2FVSA 3T3FA 3LP1A 1S6PB 3DLHA 3MR5A 5SZTA 4O55A 5KFCA 3EYZA 3TAMB 3HJFA 1BHLA 2HHQA 4DL5A 1SL1A 3NDKA 2YNIB 4TY9A 3ZT4A 4ID1A 3JYTB 2VG5A 1C0TA 1K1QA 2BE2A 2IA6A 3EY1A 2IAJA 3OYFA 4F4WA 3VQ4A 4B9UA 1KHWA 1KHVA 3EZUA 3NL0A 3RTVA 3CM6A 5KFJA 3SI6A 4TSXA 1ZBIA 1REVB 3HP9A 3SCXA 1D1UA 4PWDA 3KHHA 1JXLA 1S1VB 3PJWA 1HJRA 4EYHB 1JLAA 2RKIB 2BRKA 3MEEB 5I42B 3JSMA 3GIIA 3TR8A 3LALA 3TAMA 4KHMA 4ED3A 4ID5B 1RT3B 1JLFA 1TKXB 1KLMA 5HLFA 4FJIA 1IKWB 3V6HA 4N76A 1TKDA 4DTSA 4E89A 4K4ZA 1NOYA 2KFZA 4Y3CA 1SL2A 3RMBA 4IR1A 3ZT3A 1WSHA 2LSNA 2OH2A 3K5LA 4K8XA 3G10A 1OS5A 3H5SA 1TV6A 2D5RA 3DM2B 2HMIA 3DI6A 1YTUA 1RDAA 1RT3A 3KK2A 4CJSA 3C6UA 4WFYA 5KFPA 1RYSA 4DEZA 1BL3A 4KB0A 3MEGB 4IDKB 2F8TA 1WSFA 2RF2A 3ITHB 5KFRA 4I9QA 3SUOA 4CE9A 5DLFA 3LP0B 4HKQA 4HCCA 3C94A 2XHBA 5HBMB 5HP1B 3NGIA 4KTZA 2PY5A 3RB0A 1QE1B 4CGIA 1RBUA 1RBSA 1WSJA 5E41A 4H4OA 3OJUA 4QW9A 3VQEA 1S49A 1NKEA 3KNAA 1MU2A 1DLOA 4M95A 3MEDA 3VQAA 3OL7A 1HRHA 1C1BA 4KTQA 5DGAA 3PO4A 3EPGA 2OA8A 1BI4B 3I8DA 4PQUB 3M8QA 4M3YA 3CWJA 1SKSA 5KFMA 3VA3A 4RW6B 4B8AB 4CJQA 1HYSB 1S48A 3QEIA 1QS4A 2RF2B 4YP3A 1D5AA 1T03B 4NLVA 2C2EA 3DRRA 4J9SA 1S9EA 5C42B 5DK5A 2AQ4A 4JUZA 3HVWA 2HB5A 3SV3A 1TKTA 4B9SA 3RBDA 2QXFA 1QTMA 2BR0A 1ASWA 4IG0B 1HPZB 3OHAA 4MK8A 2WONB 5CZ1A 5L1KA 4CF2A 3SPZA 4CF0A 2AJQA 5KFGA 4QOZB 4KKOB 3KD5E 1WAFA 3QIDA 2BE2B 2KTQA 2CJQA 4EZ6A 4RW9B 1JLCA 4DQPA 2B43A 3KLHB 4ECZA 4TYAA 1S1TA 4WE1A 3H5UA 2XCPA 3L3UA 3M8SA 2OPSA 4Y34A 4IRCA 1QAJA 4ICLA 4CHNA 2BRLA 3V6JA 4B9TA 2A1SA 5J2QB 5J2PA 3DYAB 3H4BA 3OL9A 4RZRA 1S6QA 4R5PA 3OY9A 3T5KA 1LAWA 4DFMA 3V9UA 4DTXA 4CEEA 3SI8A 2W8LA 4FK2A 3IG1B 3V4IB 3M9OB 3V9ZA 4IG3A 4K4SA 2E9RX 4ELUA 2VWJA 4ECYA 2UUTA 1XR6A 1HNVB 3M9NB 1ZTTA 1TAUA 3VQ9A 4C8MA 2YKMB 4F3TA 1FKPA 2KZMA 4CJPA 4B9MA 4KO0B 4CJEA 2ETJA 1S5JA 5C25A 3DOLA 1RT5B 4IFYA 4M3XA 1C0MA 3F9KA 5KG3A 1YT3A 1NK6A 1BQNB 4OLAA 1S1UA 2KQ2A 5EWFA 4Y2CA 4UQGA 2I5JA 3DDKA 2E4LA 4FZYA 3DM2A 2HMIB 1RAJA 5JUMA 3KD1E 3WNGA 1S9FA 4KHRA 3QESA 1JLBB 2Z1HA 2QKBA 3MTKA 2DTUA 4IDKA 2YKNB 4DTOA 2YKMA 1VSHA 2AX1A 3MXIA 2WB4A 1KVBA 2C28A 4TQRA 3B6PA 3M8RA 1U4BA 3DMJB 4MK9A 5EWEA 1J5OA 5DQGA 2QKKA 4ED0A 1VSLA 1C0UB 5CYMB 4NLYA 3P83D 4ZVGA 1BCMA 3H59A 3RMAA 5KG7A 5KFUA 5D3GA 2OPRB 1CLQA 2ILZA 2D0BA 4F4KA 2Y1JA 3SUNA 1TQLA 3T5LA 3OYJA 2R2RA 2RDIA 1B9DA 4M3ZA 3QO9A 3KHLA 1I39A 1T8EA 3NF7A 4ZPCA 2AGOA 4OJRA 4NLOA 1D9DA 2ATLA 3KTQA 2HHUA 2B5JA 1GOCA 2P1JA 4GMJB 1NOZA 4NLTA 2G8VA 1LWCA 1HMVA 5CYQA 4KAIA 4PWDB 2UVUA 4B9LA 3HPGA 4CK2A 1RCHA 3DRRB 3CO9A 3I5AA 3DOKA 3UR0A 3KK1B 4OKJA 2E6MA 2XO7A 1C1CB 3E01A 4DL7A 1B9FA 1KCFA 3TANA 3HVRA 3PVXA 3BSCA 2ZE2A 3TI0A 3SYZA 4NLXA 4XO0A 3AV9A 3AVKA 3C6TB 4DLGA 4MKAA 2BQUA 4KFBA 4CJWA 4J9RA 1RT7A 4AILC 3AVBA 4ZPAA 2B5JB 4RW9A 2FJWA 2YHAA 5FDLA 2W9BA 3NH0A 4DSFA 4ECWA 4J9OA 4E1NA 5KFFA 1IO2A 2KW4A 3HVAA 4KAZA 4XPEA 1S0NA 1RT2A 4G1QA 4IFVB 1Z25A 4KHSA 5KTQA 1RA7A 3DLGA 1A5XA 4CJTA 3M8PA 3MR6A 3KMQA 4KREA 3KK2B 1SH0A 2HVIA 1D0EA 5I3UB 2VG7A 2XY5A 3V4IA 4O44B 3KLEB 2HNZA 2D41A 4NCGB 1RBTA 4CK1A 1UA1A 3MECB 3H2LA 4BE2A 5DGBA 4Y1CA 4DF4A 4EP5A 4AHUA 2WHOA 4DTNA 4CGGA 4I2PA 4YFUA 3VQ6A 4PA1A 4E7HA 1Q8IA 1RT2B 4G1QB 3NF8A 4WZMA 2O4IA 3NMAA 3AVJA 4O0JA 2YNHA 4KHNA 1JKHB 5C5JA 4J9KA 4AHVA 2HHSA 4IR9A 3PR4A 2B4JA 1XHXA 3N6LA 5KGWA 4CIFA 4J2BA 4BE0A 3KHRA 4NYFA 4O3OA 3CQ8A 5DG9A 4EP4A 4Z4FA 4KHUA 1YTAA 2VG7B 4KB7A 1RTIA 1LWEA 4J2EA 4L8RB 4CHPA 3GIKA 4KTWA 1REVA 1CZBA 3VQCA 3MECA 5KGXA 3PR5B 4Y2AA 4AHSA 1TVRA 4Q45A 3PW4A 3ZSVA 2HWHA 2XC9A 3OLAA 2RKIA 3QNOA 1QAIA 1VSJA 1W25A 3HT3A 1NK9A 3GILA 4JV1A 2W7PA 4O0IA 3OYCA 3QETA 2YNHB 2VG6A 2OPRA 4NLGA 1SL0A 3ZT2A 1Y97A 4O3PA 4ZPDA 1Z4UA 3NFAA 3HP6A 4HYKA 1JXBA 3D5MA 2JEJA 2WRMA 4W5RA 4KHYA 3DLEB 3LP2B 1RTJB 1LWFB 4DSIA 3IN5A 3GQCA 2R8IA 3QGIA 4BE1A 4CEQA 1TVRB 1U47A 2J6TA 4FLXA 2BQRA 2HW3A 3BSOA 3G6VA 3KLHA 4CHOA 1ASVA 2X6NA 4QWBA 4MFBA 2YV0X 4E0DA 3D45A 1J54A 3U3YA 2OPSB 3I0RA 3OYEA 4YR3A 5EDWA 2HNYA 5KT4A 2JEIA 4C8NA 3QERA 2Z1IA 1C2PA 3ZSWA 2XI3A 4FJMA 5KFXA 2PYLA 5KFNA 4R5PB 2WTFA 4Q8FA 4F4XA 1IKYB 4RUCA 1WN7A 1QQCA 2Z1JA 4DU4A 3DLBA 3O3GA 3LP0A 1FKPB 5HRNA 1BGXT 4RU9A 4NLQA 3IAYA 1XI1A 2R8KA 4HUFA 4R8UB 3TAQA 3P5JA 2W9CA 4NLPA 4CJVA 3ZSOA 1L5UA 3L2RA 1S4FA 4DL6A 1IG9A 1UA0A 2P5GA 5KFWA 4WXOA 2GBZA 3AVNA 2IAJB 1RYRA 1ZTWA 4CJUA 4Z4EA 4CJLA 2HHTA 3IRXB 4YR0A 4ECXA 1NHUA 4RW8A 1QSSA 4CF8A 1S0MA 1Z26A 1ITGA 3L2QA 1Q9YA 2WONA 2E9ZA 4KHWA 4O3SA 5T7BA 5T14A 4ELVA 2WOMB 3PW5A 3OVNA 3P1GA 5DG8A 1JKHA 3QO9B 4LH4A 4CIEA 3OYKA 3ZSXA 4BDPA 1S1WA 2I1RA 3KKRA 3O4QA 4B08A 4DL3A 4ID5A 1C6VA 5DMRA 5HLFB 4NCAA 1UWBA 5JXSA 1JL2A 1JX4A 3SPYA 4Z4IA 3H08A 4DQIA 2E9TA 3DYAA 3NAIA 1RDCA 1X1PA 3OL6A 4QWDA 3AVHA 1RDDA 3OS1A 4ED1A 3RR8A 1NK8A 2ZE2B 2FLPA 3IG1A 1IM4A 2QV6A 2D0AA 2ALZA 4O3QA 3HL8A 3OYHA 3BSAA 2WCXA 2V4RA 1RT7B 1W9HA 4B3OB 2ATQA 4ZHRA 5KFSA 1LW2A 3V6DB 1KSPA 3EZ5A 2AWZA 4N56A 4KPYA 5HROB 1S0OA 1EP4B 2BANA 3HVTB 3RBEA 1JXEA 2ASDA 1TP7A 5C25B 4O3NA 3M9MB 4GC7A 4E7JA 4CCHA 3DLGB 1O1WA 3UDLA 1NKBA 1BQNA 3RB6A 3AO3A 4IOBA 4CFAA 4IRDA 1CXUA 4E7IA 1IKXB 3LAMA 3KHGA 4M3WA 3CDUA 4QWCA 3S3NA 2XI2A 2HNYB 2C22A 2X78A 1DTTA 1RT1B 2GV9A 3OL8A 4ZP7A 3VQ7A 3WNEA 4J9PA 4RG8A 3KLIA 2IM0A 3NCIA 5J1EA 2WK4A 3QGGA 2HNDA 1NKCA 2IM2A 4NZ0A 3VQ8A 4CEZA 4ZVEA 3D28A 5FRNA 4QWEA 2F96A 4BWJA 4KSEB 5D3GB 1VSKA 3PW0A 4FW1A 1TK5A 4R8UA 1QSLA 1RT6B 3AA3A 3BGRB 3PW7A 4FLTA 4RNHA 4IG0A 3KK3A 3NF6A 3LZIA 4NYZA 1NHVA 3OSPA 2B6AB 3K5OA 1RBRA 5L9XA 4CJ5A 4FLUA 3SQ4A 1L3VA 1VSFA 4E19A 4FJ7A 3QEWA 3ISNC 3PJXA 1Q9XA 3AVCA 4Q5VA 2R2SA 4NLUA 3LANA 4FYDA 4CGFA 1SKWA 3DRSB 1QHTA 3FFIA 2HNDB 2HHXA 3NKYA 4ZP9A 1ZBLA 2XY7A 4DFPA 1A5VA 3OYBA 4LSNB 1RTIB 1S1TB 1NK5A 4E7LA 5K14A 4CEOA 4DFJA 3DLRA 3KLFA 1S10A 3L3VA 4FJXA 5HRPA 2IS3A 5CZ2A 3ISND 1TL1B 4K4UA 4FZXC 4CEFA 3LP3A 4LSLA 4B9VA 1BQMA 3N6MA 1JLGA 2W8KA 4NRUA 4EYIB 2FVRA 3VQSA 4KFBB 1TGOA 4H54A 1WNEA 4CEDA 1S1WB 3CDEA 3S9HA 3K58A 2IOCA 4J9MA 1S1XB 2IMWP 4M3RA 3RAXA 3SUQA 1MMLA 4YMEA 4LY7A 3HK2A 3HYFA 1S9GA 1RTDB 1KFDA 4OPJA 4WFZA 4DG1B 3FFIB 4K4WA 1KLNA 4YQWA 1S6QB 4X2BA 4WYWA 5KG2A 3FDSA 4ZPBA 3MF5A 3PZPA 5L1IA 4FM1A 4H4MB 3H5XA 3NGZA 3SQ2A 2YHBA 5I3UA 4FM2A 4F50A 4IG3B 4EO6A 1NJYA 1NJXA 3AVMA 4MFBB 2I5JB 3BJYA 3RRGA 4C8LA 2XGQA 1XHZA 3NGYA 1VSEA 4EZ9A 1JLFB 2Q3SA 1HARA 4RW7A 3LP1B 1IKWA 4CGJA 5FRMA 2BANB 3DOLB 3NH2A 2ZD1B 1VSIA 5L1LA 2BGGA 4DTJA 4N5SA 5EU7A 3TARA 3FQKA 4EEYA 4HUGA 1RTHB 4G3IA 3DMJA 3RMCA 2R7YA 3PY8A 3PUFA 3D0PA 2O4GA 2W9CB 1C0UA 3CFPA 2FBTA 3S3MA 3NH1A 4H4MA 4WZQA 1L3TA 3K57A 5EWGA 3MR3A 1RT1A 1EX4A 1NK4A 4FLYA 3FSIA 1T7PA 1SH3A 2CKWA 1ZETA 2DFFA 1HQUB 2UUWA 5KFVA 3CJ4A 4FJ9A 1U48A 3LWMA 2FJXA 2IGIA 2DPIA 4MH8A 3G86A 4M94A 2IJFA 4FJ8A 1J5OB 1JLEA 4TQSA 5KI6A 5I42A 3KJVA 1HQEA 4LD0A 2VA3A 4DSJA 2VG6B 3Q8QB 3ALYA 4B9NA 4ELTA 3V81B 5J2MB 4Q43A 1F21A 1U49A 3AVAA 5HP1A 4KV8B 3ASMA 3E01B 3GIMA 1VSMA 3ZSYA 3THVA 2JEFA 4Z4GA 4BWMA 5C24B 3K2PA 1EXQA 2WOMA 4IH6A 4F2RA 4O4RA 4N41A 3AA5X 3MR2A 1HMVB 4IH7A 3AO4A 2J6SA 3T5HA 1SV5B 3CIZA 5KFLA 1TV6B 5FDLB 1WAJA 1TL3B 1WNSA 3I0RB 2ASJA 4IKAA 4CFDA 3V6KA 4CF9A 2FVQA 5KG4A 3SV4A 3VQ5A 4W5TA 2YNFB 2GUIA 2FC0A 5F8LA 4B3OA 2AX0A 3MXJA 1LV5A 3CYMA 5F8GA 3KLVA 1LW2B 4RNNA 4ECSA 1U09A 2OZMA 5F8NA 4O44A 1NK7A 1QE1A 1ZYQA 2HNZB 2HHVA 1TKZB
chains in the Genus database with same CATH superfamily
2GUPA 2QMUB 4FBUA 1SCJB 2R7QA 4LFBJ 1JJCB 2A40A 3MAHA 2YPZA 5HAOA 1UZDA 2EKYA 3DRPA 4M5NA 4FN5A 1HYZA 1OY6A 4UT4A 3IWLA 2ZH1A 1FJEB 1Y00A 1VQ8N 1HLWA 4DV6J 5KT2A 3C7NA 3NE6A 2OTJN 4CK3A 3FMWA 4M41A 4OL8A 3ZSRA 4IOAQ 1MG7A 4CJRA 4FJNA 4V1Ak 2OPQB 4ECTA 1H1VA 3CMAN 1DQ9A 2QK9A 3HD2A 2C2OB 5IZHA 3CFRA 2MQNA 2RDDA 2VQFJ 3OS0A 4MKBA 1J2VA 1FRLA 4QAGA 2RU3A 3J81U 2HVHA 4DMNA 1P6TA 1D8YA 2HS0A 4RX6A 3FRZA 3NVKA 4QBUA 2JH3A 5L9NA 1SH2A 2W7OA 2R8JA 1YITS 4FL9A 5IT4A 4H5RA 4AHCA 4M42A 4DF8A 2W2MP 3ADAC 1IBCB 1K6YA 3HHLD 4A47A 4IDHA 4OYAA 3TOQA 1M90O 4CZFA 4ECUA 3G6XA 4MLHA 1S6PA 3VZHA 5H1SQ 1KD1T 3MMAB 4F2SA 4EBCA 3KIOA 2IM1A 2E1RA 2DJWA 1GOBA 4F3OA 3AB2B 1IR1A 3ZEUA 2JVRA 1VQMN 1HBNA 1WEXA 2J0XA 1T05B 2KXNB 3CCJS 3A8IA 4FZVA 2NREA 4YOEA 5C24A 3FQLA 2A1RA 5LMNJ 4DL2A 1UCNA 2IVYA 1VQLS 4LSLB 3C3LA 4HVJA 2GW8A 2V52B 1CPZA 2FJVA 1FTRA 4BR9A 4WU3A 3UO0A 2CQPA 2PE8A 1RK8A 4L73A 5AQLA 4I6YA 2R7WA 3TRGA 1HQ2A 1J5EF 4NYNA 4GVMA 3QJLA 1QSYA 4WF9L 4J2AA 1W0HA 3QGHA 1WSEA 4NMLA 3V2UC 4NXMF 3D0IE 2VASA 2E1CA 1HYVA 5F1XA 1BUXA 3F44A 1R89A 4HACA 1UJ5A 3NNCA 3UIQA 1S7IA 4QWAA 1RI7A 4RNMA 4P71A 5LL6d 1KVCA 4OGEA 2VF3A 4UY8O 3VQBA 2FBVA 4WYLA 2W9BB 1HKCA 1TYQA 3PRVA 2JWLA 1LXNA 1R27B 5B08A 1SB6A 3F5TA 1WHWA 2MKSA 4I69A 4RW4B 1RTZA 5F9NA 4EBDA 1IVZA 2F4FA 4ZTJA 2PD1A 3HO1A 2LECA 3MM7A 1XBWA 1SQFA 4DTUA 4ZLNA 3M8ZA 1FRMA 3OJSA 1ZC6A 4FZZA 2NUBA 3TVKA 2MKCA 4FK0A 1FFSB 3ENWA 3H6EA 4O4GA 3P96A 3L09A 2QLFB 5KRSA 4DLEA 4OO1J 1TKTB 4ANCA 1RAAB 2QJ3A 1U1NA 1YSJA 3EO3A 4DR6F 3OYGA 3VQQA 4IJNA 1R0AA 3D2EB 4P2SA 4CZLA 2XSJA 1N6QA 5KG5A 3KHYA 3CB4A 3CJTA 2OHDA 2RDJA 2F8EX 2C2KB 3GR0A 4IO9L 4NXNF 4CJFA 1XMOK 3L2UA 4WE1B 2ZBRA 4LF6K 3I5BA 4FJGA 4DU1A 1NGGA 3VQTA 1JIHA 3IRWP 1K8KA 1JCFA 1VRUA 3F56A 2KM8C 4U7BA 3GCXP 1HWLA 5A2QU 1HBNB 1B3TA 4TN2A 2I7PA 3PHEA 4A5BA 3AOCA 1CXQA 2GIRA 4LRFA 2ZM6J 3G6YA 3TA0A 2Z1GA 2H5EA 5LSOA 3BM7A 1HNVA 3N5FA 1VQNS 1X5PA 1FK9B 3JTPA 4DR6J 1YZ7A 2L9WA 5C7PA 3X3UA 2KYXA 1XR7A 3MTJA 4I1TA 3KMSA 3U3GA 5KG0A 3V5RA 3CJ2A 4EMDA 4R0JA 5KFAA 4K4VA 1S5ZA 2Q31A 1VJWA 1GLJO 1CULB 1HNIB 4XPCA 3EPIA 2PI5A 5K8OA 1GMWA 1YBAA 3ENHA 2QWLA 4WFAL 3V1OA 2BUPA 3TAFA 3QSYB 2I6WA 4DV5J 4BRFA 3R97A 1U2FA 3Q8SB 2MQQA 1WC3A 2C2RA 2EKNA 3BKTA 4LQ3A 2FJAB 4A48A 2BMBA 1I3AA 1VQ6N 1C4CA 4ID8A 5AQOA 2FHOB 3H4DA 2BQ3A 2ROPA 2ZBCA 4DV3J 4KHPJ 2IY5B 1RT6A 3LTOA 6AT1B 2YNIA 3SFUA 5HRSA 2VG5B 3PFOA 3TSUA 4KRFA 5IM0A 3SCKE 1AB8A 1KD1O 5IQ6A 2UUBK 2GAHC 2HZCA 1TZ0A 4WCEQ 3MM7B 2EC0A 2D3ZA 4CGHA 4DZ6A 4CF1A 3A2FA 2HSTA 1AFIA 4GVEA 2O8EB 3CPWR 4IJAA 1T03A 2N7YA 3ZX0A 2CYYA 4LF4K 1TKXA 1PJ7A 3V9WA 3O8MA 1JLAB 3T1AA 3HKWA 1IKYA 2BYCA 2CADA 3PCOB 1JQGA 1LW0A 1X4FA 2DNQA 5JLFA 3BQ2A 5CYQB 3RJMB 1XMOF 5AFUH 2E1PA 5B0BA 1OVQA 3LM2A 2OCEA 3UCGA 3HCXA 4E1MA 4A8QA 4U6PA 1LKZA 2DFEA 4JLHA 4QOTA 3OHBA 3RW7A 4FCYA 3RYLA 4USHA 1GEHA 5HMXA 1TFYA 2PFFB 3NVMA 3CC4N 3M8WA 4B3MJ 3BH6B 1TK0A 2YHXA 3HHNB 3L4IA 1YJTA 5KFZA 3V9XA 2CNNB 3CC2S 1RT4A 1Y7PA 3ICLA 3C2PA 4FO0A 4JKCA 3VQDA 2MKKA 4CHQA 4L3QA 1OVYA 4DV7J 2BDPA 1WSVA 4LR7A 5BR8J 5HQ8A 4E3SA 3GIJA 4J9NA 3I55N 1RFQA 1WHXA 3MEDB 3PV8A 2EFVA 2E2PA 1FD8A 2NXJA 3MAQA 5HROA 4B3RK 3KLGB 5CD4A 2OTLS 4FJLA 1KAXA 1HNIA 3T1YF 4MJKA 2XYHB 5BPMA 3CJ1A 5EVZA 4FXWA 4PQUA 1MW7A 4RL1A 4HTUA 3EX7B 4LRCA 3US5A 2AJ0A 4DUYF 2EHGA 4OLBA 2UXCK 3DDIA 3W8GA 2NRTA 1OH7A 5EN1A 3JB9k 1S9EB 2GS8A 4RBUA 2SXLA 4PEOA 3H2UB 2LEPA 4KV8A 2ZH2A 3W9IA 2Q2RA 2Q97A 5FJ4A 4WQ4A 1W7WA 4O4GB 3R9LA 2LA4A 1KTQA 3Q8VA 2GV1A 4I7FB 3SAGA 3DLJA 2IRXA 2HVZA 2G2YA 2CJBA 3L2VA 2X74A 5M1FA 3BGUA 5AXMA 1FVSA 1VQ6S 2PC6A 2M0GB 2KHCA 3HZEA 2KFYA 4M5DB 5HSPA 1RTJA 2MJUA 1N6QB 4J9QA 4WQ4C 3W65A 1TL3A 5I3QA 2VUGA 3JS9A 4HLBA 4ISEA 9ATCB 2LLZA 3MMBB 7AT1B 3BQ0A 1VLYA 4OVLA 1VQ4N 3MN9A 2IDLA 5FLXY 3Q24A 4JKEA 2NSCA 1H38A 3EE9A 3RSEA 4EHUA 2QWRA 4CLFA 2Y1IA 4LFCK 3MPVA 3EZWA 3AO1A 2FGCA 3GTYX 4L3KA 5ADXH 1S1XA 2APOA 2BUNA 3AQOA 2XEXA 1YJ9S 1N8RO 4G65A 4OI4A 1EETA 1KAZA 2CZ4A 5L1JA 3ZT1A 1VLOA 4IOXA 4ED7A 2R7XA 5GAHP 4LBHA 3C66A 2UXDK 2KM8B 5HMWA 1DRZA 2HWIA 5AJ3F 1RBVA 1JLQB 3QT7A 3PG9A 4K4YA 5KFIA 4UY8T 4IOAL 4WIQA 1RADB 4I6MA 4ILJA 3WQUA 3FKBA 4Y2KA 3K9JA 2XMUA 4V19X 2QE5A 4PUOB 4TY8A 4MDBA 2X1AA 3EDQB 4C98A 4WXWA 1GK8A 4J8FA 5D0RA 4DR7J 3LUYA 3LP1A 2DGOA 3MR5A 5KFCA 2MJNA 3GDQA 2O8BA 2QLJB 2K7JA 2AJ2A 3M1VB 3OD2A 2CGKA 1O13A 2ZOFA 1BWEA 4DUZK 4AL6A 2G2ZA 4I6WA 4ID1A 2VG5A 3QAEA 1C0TA 1K1QA 3RG6A 3QMQA 5A0YA 3IBFB 4QU6A 1TUVA 2QFJA 1BOTO 4FYXB 3IKMA 1WHVA 5LMUF 3FBBA 4X4RA 3CJAA 4X64K 3CCMN 3AGRA 4BC5A 1D1UA 4AQYF 1FRHA 1S1VB 2XZWA 3K0SA 2BOAA 2RKIB 2BRKA 5IT9O 4KHPF 2XMKA 3BPDA 1X31C 2IA0A 1TKXB 2GGPB 1N36K 2QIFA 3CI5A 4A8SA 4DTSA 4K4ZA 1NOYA 5SUHA 2HFNA 2ZH6A 3RMBA 4IR1A 2Q6CA 2CPJA 4ZVSB 3WXIA 2P5VA 2HFSA 2ZFHA 1QUPA 3A8YA 3DGPB 2WTUA 3THWA 2D5RA 5CYJA 3DM2B 1VHXA 1RDAA 4YB1P 1SPBP 3G8QA 1RT3A 4CJSA 3C6UA 4OI0A 3RVCA 1RYSA 3C14A 5AZIB 4IDKB 2F8TA 3ZTOA 2CIMA 3J81O 4I9QA 5BR9A 1B70B 4HCCA 1M5PC 1C0GA 2XHBA 5HBMB 1GFWB 3NGIA 1YI2N 3ZX2A 2LQJA 1SQEA 4C0HA 3H42A 1WSJA 2OD4A 1N33F 3PRBA 3VQEA 1N5TA 1NJIT 4KJIA 1MU2A 1DLOA 3MEDA 3OL7A 2CG4A 4H4KA 5DGAA 4MO5A 5DM6Q 4X4SA 2OA8A 4PQUB 3M8QA 3L95X 2XLJA 3VGLA 4B8AB 4TLQA 2GO9A 2M70A 4Y00A 4YP3A 2KDOA 2LCWA 2C2EA 1S9EA 1XNRK 5DK5A 4JUZA 2KJWA 4B9SA 1JJ2R 2QXFA 2BR0A 3DXBA 4CRJA 4IG0B 5BR8F 4RBVA 1DFDA 2BACA 2WONB 4A5AA 5L1KA 5J1PA 4OYBA 5DDRC 1XJWB 1EX8A 2MKYA 1XMBA 3KD5E 3QIDA 4NA2A 3BGFA 1Y5IB 4FWRA 4EZ6A 3CJKB 2MZ1A 3DRYA 3JSYA 4DQPA 2B43A 3FBFA 4BRPA 4TYAA 3H5UA 2XCPA 4Y34A 1QLNA 3VGKA 1OPIA 4B9TA 3M2UB 1MROB 2FYXA 4S0MA 3IM9A 5J2QB 5J2PA 1Q95G 3H4BA 2Y1RI 2RE2A 2IHR1 1XMQJ 2UV8G 3PRDA 3OY9A 1LAWA 2BKNA 4NASA 1KONA 3GYXB 3SI8A 3R5AA 3M9OB 3V9ZA 3GU0A 4K4SA 2E9RX 4FWMA 4ECYA 4LF1A 3R1HA 3TWZA 3O6QA 1Q0NA 2HLTA 1ZTTA 2YKMB 1PKUA 1NPKA 1U7LA 2KZMA 3N28A 2CUYA 2QN6B 1QVGM 2KT2A 2ETJA 1S5JA 3DOLA 1RT5B 4CO3A 2IVNA 1YITN 4BGBA 2AEMA 3AFGA 5KG3A 1NK6A 1NGEA 3P39A 2KQ2A 5EWFA 2ASOA 4RO0A 4Y2CA 5BN8A 3BZKA 2KU7A 3DDKA 5E3AA 5EGYA 3QBXA 4MO4A 3QWPA 1JLBB 2Z1HA 4OYXA 2QKBA 3H1QA 1PBUA 4IDKA 4PXCA 1I94J 1V4TA 2VQFK 3C15B 3IR7B 2AX1A 1KVBA 2C28A 3B6PA 2RUSA 5EWEA 4MK9A 1J5OA 1PC5A 2IYGA 1M5OC 2CH6A 1VDHA 4NLYA 2AP1A 5FPDA 1BCMA 1TELA 3HM8A 5D3GA 2ZZTA 3O4WA 2D74B 4F4KA 3CMEN 2LEBA 3BBBA 3Q23A 3ZZOA 2MEWA 3NF7A 2AGOA 5L39A 2ATLA 2ROEA 2HHUA 4DCOB 2G9OA 2QA2A 1NOZA 4NLTA 3PKYA 1S22A 4DR5K 4C7QA 1SI9A 4I0WA 3FCHA 3R5BA 2A5XA 2UVUA 2ZWPA 2BOPA 3CO9A 3KK1B 4JKHA 3WHIA 4P7VA 1YX2A 3MCSA 1IBMJ 3OHRA 1YRTA 2MZSA 3G71S 2CRLA 2NXCA 4CZGA 1GLDG 3BSCA 3SSRA 2M4MA 1WDDA 1PGZA 3W5YA 3H2VE 4ED5A 2VKZG 3VZIA 4DLGA 2F4VF 2BQUA 3QATA 4KFBA 3DRXA 2UUCJ 1Q53A 4OZ3A 2GHVC 4BRLA 2OSQA 4ZPAA 4ZCLA 1AW0A 3D6MB 3W2WA 2YHAA 3FBCA 3QBWA 4DPUA 4E1NA 5K8NA 2KW4A 3HVAA 4KAZA 4XPEA 1RT2A 4G1QA 2Y0SD 1Z25A 2EC2A 3IP0A 3DLGA 4JB8B 1SZ2A 3G8SA 2HHPA 2J4RA 3MR6A 3AJ2A 3GIRA 3A5LC 2I7NA 1KN6A 4KREA 1SH0A 3SMPA 4RKUC 5I3UB 1XC3A 1V3RA 1R43A 1KVJA 3KLEB 2HNZA 2D41A 1RBTA 2B9XA 2BJ9A 5HI7A 3H2LA 1EQMA 3KUEA 5AQPA 2E5IA 2WHOA 2O66A 3WQPA 4I2PA 3VQ6A 3RBZA 3HZ6A 1RU2A 1APSA 3AVJA 2YNHA 1Y11A 2OKQA 2ZM6K 2VH7A 1RWXB 2HHSA 4IR9A 3PR4A 3JSRA 3HLUA 2QC3A 1RGVA 3KHRA 3GG1A 3HJVA 2XS5A 4KHUA 1YTAA 2NYHA 4KB7A 1QDUB 1IWGA 1K8AO 2XMVA 5K20B 2MZTA 3WEEA 2BE7D 4G1PA 3PR5B 1TVRA 4Q45A 2FXUA 1HLUA 5B0CA 3I55S 3OLAA 2E1YA 1W25A 2DEJA 5F41A 2LDIA 2W7PA 4PABA 1YJWS 1RGIA 3ZO7A 3MR7A 1RWUA 3QETA 2B8QA 4EHTA 5M1NA 2FQQB 2AIRB 1P27B 3MMCA 1YBTA 2QFIA 1Z4UA 3OR2B 1VYAA 1VI7A 4DV5F 2JEJA 2QGFB 3AA9A 2PA8D 1U8SA 1I3OB 3CETA 3O9QA 3TUIC 4LVNP 3GJSB 3ULEA 3B4MA 2CQ2A 3OR1B 5D4LA 2BQRA 2V94A 3BSOA 2X6NA 1EB0A 2XWXA 2YV0X 2QI2A 1HW8A 5EDWA 2QYGA 3M4XA 2JEIA 4C8NA 4TU9A 1IBMK 5DO2A 4FJMA 5KFXA 3WX4A 2PYLA 1V3ZA 4EI2A 2VBXA 2WTFA 2LFVA 3L7UA 4F4XA 1IKYB 2A3ZA 4CI6A 4DX5A 2Z1JA 4ZK7M 1FXDA 3VESA 3ISZA 5HRNA 4Z7CA 2QWQA 4CJ7A 1A9NB 5LJ3Y 3IAYA 3C16B 2BEFA 4B3MF 3W3SA 3IAM9 5AJ3K 1KBRA 5J1NA 3M1FA 3E1YA 3E3XA 4IFEA 4KH5A 4CLPA 3LF0A 1VC0A 4B1UB 3PIOL 4NLPA 4CJVA 3M2VB 1CJTA 1W7AA 2AHOB 4LF6F 2VBZA 2P5GA 1IQZA 4O23A 2GBZA 1HBUB 3AVNA 1HIYA 2IAJB 4FYWB 5H9EK 4Z4EA 1U2RA 1SKUB 4H5WA 3IRXB 2VOPA 3J7AN 4DR2F 1NHUA 4CF8A 1Z26A 1PJ6A 4U9RA 3W9JA 3I4PA 1ITGA 2IVPA 3BN4A 1WHYA 4ER8A 4KHWA 1NDCA 2WOMB 2LXUA 3N0VA 3P1GA 4UW2A 5LMNK 5DG8A 2QEXS 5BR8K 4OX6A 1SC3B 3HSZA 5IT0A 3OYKA 1VC5A 1RABB 1GNKA 4B1VA 2QL7B 4BDPA 2P8IA 4DL3A 4ID5A 1C6VA 4C48A 1W2BR 1WG1A 1TU0B 1QY7A 4NCAA 1WG5A 5JXSA 3Q2SC 3U02A 5AT1B 1BE4A 2CQ0A 2XMMA 1VFJA 3VEOA 2QW9A 4DV0K 3THYA 3H08A 2E9TA 1U2VA 4DHYA 6FD1A 4ZLJA 3AVHA 1X1PA 5A76A 3OL6A 4EK2A 3RR8A 2JVOA 1NK8A 2V8GA 3JAMY 2FLPA 3VHQA 3THXA 1SBRA 4O3QA 4RTFD 2DO4A 4NLBA 2ATQA 4ZHRA 5KFSA 1ATRA 3ENOA 2ZGYA 4OHYA 3V6DB 2AWZA 3T41A 4PG8A 4KPYA 3FGUA 1Y5NB 1EP4B 3HVTB 3MXHP 4HH0A 3DLGB 3UDLA 3CDAA 4QS9A 1LEOA 3OVAA 1FWLA 4Z7YA 2UUBF 4DV7F 2VQEJ 2X3GA 1IKXB 2DR6A 1VJQA 3CDUA 1SQGA 1DTTA 4JI6J 4LF5J 1E6VA 2GV9A 3DKDA 4YOXA 4DBQA 3O08A 2BJEA 3DXSX 5CZVA 5CCMA 4RG8A 3KLIA 3C7NB 5IWAF 2GX8A 2L08A 1VQ7N 3G8TA 3QGGA 1NKCA 2IM2A 2QWNA 5B09A 4CEZA 2MDAA 2F96A 3HSJA 2B56A 3Q22A 2AT1B 1K8AT 1TK5A 1QSLA 3CXCM 4C8ZA 1IBLF 1HW9A 3CJBA 2DHGA 4HH1A 4NYZA 1T0TV 3MCMA 3QT6A 5L9XA 4QYRA 5DM6L 4OZ5A 3ISNC 2O8FB 1FE0A 3MPDA 2HQ3A 4CGFA 1SKWA 1XNQF 2AA4A 3DRSB 2LU2A 1CJKB 4DV5K 4JI1J 5CCLA 5IT9Y 1ZBLA 1K0TA 3OYBA 3EDRB 1S1TB 1TFWA 2NRVA 1FXRA 3H1VX 2KB2A 2V2VA 2NZ4A 2ZZMA 4E7LA 3UE5A 4DFJA 1GLEG 3KLFA 2VL1A 3UN2A 1T9YA 4CEFA 4B9VA 1JLGA 4A8XA 3RAMA 4LF4F 2O8BB 1S1WB 5BRHA 3W64A 3K58A 3LOUA 3TTCA 2MSTA 4DUZJ 4M3RA 3RAXA 4OV6A 3CCZA 1S9GA 3PDNA 4BLGA 5DJBA 3CCQS 1EKSA 3THYB 2FHMA 4YQWA 2ZH3A 3FDSA 4ZPBA 1WI8A 4BRQA 2RB7A 1HA1A 1E4GT 4FM1A 4JI8K 3NGZA 4OHVA 4OYZA 4IG3B 1HI0P 5CZXA 4FNIA 4P7TA 1ICEB 4MFBB 4M5GA 2FJEB 5GADU 3ZX3A 2W24A 3AB4B 1UW9A 1VSEA 3P49B 4NI2B 4RW7A 1O8BA 3KG0A 2UV8A 3ZNUA 2ZD1B 2XMTA 3EVMA 5L1LA 3L9ZA 3TARA 3FQKA 3NMUA 1CS4A 2DRDA 3PY8A 3D0PA 4YOUA 3FC9A 4ILMA 2OANA 3CFPA 4A57A 3NH1A 2IBOA 1L3TA 5AE2A 5EWGA 4LFCJ 1NSPA 1RDWX 2X1BA 2EG1A 3PFEA 3Q89A 1HNZF 2GO8A 2UUWA 1IBMF 5GAEP 4FJ9A 4P2MA 1FNMA 2FJXA 5GAGP 3BGLA 2V69A 2IJFA 4CLWA 4FJ8A 3R2DJ 1JLEA 4TQSA 5I42A 1IN0A 3OTDA 2ZHOA 3FZBA 4HT5A 5LMUJ 3KJVA 4JOUA 1YJWN 2K2PA 2KH9A 3POTB 4C23A 1PJ5A 4LD0A 4DSJA 1FEHA 4USUA 4W98A 4AYBD 3ASMA 1ZZFA 3E01B 3JQKA 2FUG9 4K2JA 5ETOA 4BWMA 2MLXA 2UP1A 3BEGB 2WOMA 1W2IA 1JJHA 3NGSA 4N41A 2MXYA 2HPUA 4IH7A 3AO4A 4GKJJ 4LIRA 5FDLB 1RHMB 2YWEA 3ENAA 3JXOA 5DDQC 1WAJA 1T9VA 4NEZA 1WNSA 3BKFA 4CFDA 2E20A 3M6XA 3V6KA 1BWFO 3SSQA 4GY2B 4NWBA 2HQFA 1YTYA 4W5TA 4U8YA 1HHSA 1NZAA 1LV5A 4JHDB 4RNNA 4WP3A 1OYEA 2OZMA 1ZYQA 3QWUA 3CJQA 1YWXA 2NXUA 1HKBA 2FZCB 3SEOA 5BYQA 4A46A 4B3RJ 3JAMU 2E6LA 1X4CA 2WSFC 4M5KA 3K5MA 3FZ2A 5HANA 2KRBA 3S1TA 2D0PA 3IS9A 3BF1A 1FEEA 3VAGA 5M1OA 3S8SA 4PPDA 3TUJC 3TU5A 2UU9F 3LDSA 2FJBB 1ZM9A 1HYSA 1U6BA 3MM5A 1FDAA 4Z0UA 1V3SA 5H1SV 2DO0A 1ZAVA 1QHAA 3LPUA 2C2DA 4OYOA 2OMLA 5LJWA 3D1QA 3R1LA 3SQ0A 2HBQB 4ED4A 2GJIA 2WBRA 2ZD1A 1IKVB 4DJBA 4F8RA 3HSTB 1VISA 5JS2A 1TL5A 1N33K 3CQYA 3C19A 5J2NB 1U26A 4ILLA 1NZ8A 1GX6A 3BBFA 4M3UA 4I2QA 1QUVA 4P73A 5AQMA 2VFUA 1CJUB 4DSEA 4KE5A 2V9WA 3F2KA 2Q0UA 2MQPA 4IO8A 3K5PA 4PWWA 5D4PA 4UTGA 1NGFA 4DN9A 1XC9A 1HKAA 1PG5B 5M2PA 1ZA2B 1L3SA 2KLAA 1TL4A 5K9FA 1MWQA 1QVFR 2HLUA 3SQOP 2YCHA 1FKOB 2MHEA 3KLFB 3G2XA 4NZ7A 4DQQA 1RDUA 1DT9A 1Q7LB 1ESVA 1X5TA 5CY4A 3PACA 4CZHA 2BJDA 4WFXA 1SAZA 3FNNA 1D3WA 1FDDA 1S3XA 1T6CA 1RHKB 5ETMA 3OYNA 1IXKA 1WDTA 4JI0F 5JMNA 3DFEA 1NPPA 4OKKA 1N5YB 3H5YA 2QWMA 5HMYA 4J37A 2J6UA 4ZIVA 2MZRA 4PXBA 4RUAA 2ZH9A 4DB3A 2IM3A 1O6XA 1SC4B 1YBUA 3CJ8A 1P8GA 4QW8A 4DV1F 5SWMA 4AHTA 3QEVA 2ASLA 5E3CA 4FM0A 4F3QA 3ULHA 1Q7YO 1CZ9A 4FJJA 3R7NB 5GINA 3IFRA 1GX5A 2X7IA 3CF5Q 2CQ4A 3KKSA 1N52B 4URQU 4J9VA 1RAIB 2K1RA 3QT8A 3HI0A 4CW7B 4DV4K 3I33A 4UZCA 4ED6A 3MEGA 3UKRB 4NL5A 3EWGA 1SS6A 2D0CA 1UEKA 4G1IA 2F8HA 1Y10A 1IR0A 3OYIA 4XIUA 1RKIA 2QG9B 2FIUA 3DRPB 3SJJA 4K2XA 4KY3A 2OI2A 2R7SA 3KUHA 3BR8A 4I9LA 1VK3A 3PIPQ 3SBTA 4ZVOB 5AQNA 1UWAA 1J6ZA 2F9WA 1WC1A 1YQHA 4RPFA 2NRWA 2KVIA 4OI1A 4AH9A 5B0FA 4A8MP 3G25A 3V1RA 1IKVA 3TYTA 5KFOA 3UD4P 4LFAF 4U7UD 1VQ5S 2M3DA 5J2NA 1GXLA 2FLNA 1G15A 2P2CB 3IO1A 3O4NA 1QJHA 4OPAA 1YIJS 3WDOA 2F5GA 2OEMA 1UAXA 4KKOA 2H5JB 3QIPA 4EU0A 2QSWA 1EIYB 2A6AA 5B8HA 1FK9A 3T9NA 2FY8A 3CQXA 2YWGA 2F9JA 3RRHA 3FZHA 3NWRA 4CBWA 2J8SA 4OX9F 3QEPA 1T9WA 2D3UA 2FB0A 1RAHB 3TUZC 1VC6A 4DS5A 2FZKB 1UMJA 4ZITA 5F8IA 2YNFA 4G6VB 4CTAA 3O3HA 5KFBA 4MQ3A 4LF9K 6FDRA 2LKZA 4ILRA 3ATUA 3DXKA 2B7CB 1DTQA 2WW8A 3NLCA 3MMCB 1Q16B 2Q0RA 3UI3A 3JTNA 4Q0BA 4BVOA 1GMWD 2Z30B 1QZ5A 3W60A 4URGA 3BY5A 3VGSA 2XY8A 3CDBA 4J2DA 2HF4A 3BO2A 3Q8PB 3HXMA 4RNFA 3M30A 4XTTA 4AD6A 4DR5F 1UOCA 5ETNA 5HATA 4BDZA 3K17A 3P31A 2ZC4A 4URSA 3NS6A 4M63C 4BRGA 1F2HA 4JI2K 1RQ0A 4EAHD 2QRRA 4PQAA 1H72C 3SMZA 2IIRA 4DV0J 1NMEB 1KC8T 4Y2MA 2OTJS 2PFUA 2OAUA 1FRJA 2O8EA 3W66A 3NHGA 3SNNA 3KUGA 1S1UB 4WK3A 1BIZA 3DDNA 4PL7A 2DR9A 2DNHA 1LOTB 3NAEA 1LW0B 3DLEA 2R2TA 2FGOA 2DGXA 1S97A 2FJDB 4K8ZA 2FBXA 1YLXA 1HBOA 2YH1A 2YKQA 5KG6A 4PKDB 1SV5A 2IDOA 3AHPA 2D3OR 5H9FK 3BV8A 5F0XA 3MEEA 4JYAJ 1N33J 1SKRA 4M5IA 4A2AA 1UPPA 4IRKA 1J9AA 5K14B 1IJFB 1AROP 1G7CB 1KLMB 2ZH8A 1EQ0A 3G0ZA 1RISA 4DTMA 3MK6A 3VN5A 5AZJA 3BYRA 4MIAA 5D78A 3OS2A 2C3OA 5GAHI 2MPUA 4E8UA 4CLUA 1DBDA 4W5NA 4DR4K 1YVUA 3QIPB 3MX2A 3AVLA 1Z05A 7FD1A 3C6AA 1VBKA 1JLCB 2VJVA 4RJVA 1HFEL 4ZCMA 2RE1A 4Z94A 2V67A 4XK8C 4USKA 4N7TA 1C1CA 2IIHA 4FS1A 1NAQA 2HS3A 4CLSA 2WC9A 1IBKF 4K50A 1V9OA 4U7CA 1B0TA 4ISFA 4KGXB 2JC1A 5C0YA 3GJQB 3C6TA 3MM8B 4KB1A 1X9JA 3W7BA 2WZ1A 3HPHA 4OV1A 2G8IA 1J53A 1NK0A 3GV7B 1XERA 3R7BB 1TAQA 5DG7A 1OYDA 4Q0BB 4TU7A 3DWLA 2BW7A 3LAKA 3IBWA 1TUUA 4WTOB 1DURA 1HNXK 1YJVA 2D7SA 3RR7A 4GKJF 2W2PP 2R8HA 3V81A 4NCBA 4QCLA 4CYUA 2ERRA 4BACA 3MCAB 3ET6A 1F3FA 3MCPA 4OGCA 2M9KA 3V4MA 2RN2A 2BX6A 1U1LA 2D3O1 2XGPA 4GV9A 4CJ3A 2XZDB 1YRXA 2E29A 2YNGB 3GV5B 1XNRF 3OYAA 4FW2A 2QMXA 5C42A 4DL4A 5ETLA 3D7EO 2V2QA 4CLTA 1HUXA 3MM6B 5KFEA 1BIUA 2DHXA 3VEZA 4DMZA 2N4CA 2VQEF 3ZT0A 3P38A 2H3GX 4EFAC 5D6GA 1FX4A 4RNOA 1QTNB 3VAHA 2IBKA 2ZOGA 3DU5A 4NLDA 2DK2A 3L8BA 2ADCA 2GIQA 4FF1A 3QEXA 3T6BA 4P10A 1RWPB 4W5OA 4F9OA 3QPIA 1F9HA 5LXYA 2G8KA 4HCBA 5ETSA 4Z4HA 4OPKA 4UF4A 4Y0FA 3DI6B 4YDDB 3IFEA 4FYVB 1FDNA 3O3FA 4H0OA 2X51A 2RMLA 3LP2A 4XH5A 3DXKB 3SQGB 3X1LB 3S41A 2GCFA 5DQIA 3T1YK 3A13A 1T9UA 4PUOA 2B4PA 4UOGA 4OZNA 1U0HB 1TUGB 3QLHB 3BGRA 3G96A 1D9AA 2OPQA 1DTQB 4O8KA 4ALZA 3W61A 1HHTP 2XNQA 4IFVA 2FBYA 4MKYA 4IH5A 2B51A 4IFYB 4BC4A 3M1VA 3D68A 5FLXU 4HHTA 2ZBQA 3AAPA 3IGNA 4USMA 3NBPA 2ZDPA 3JYTA 2BJ1A 4DSLA 1VSDA 4JI5K 2MLYA 4DHVA 4O3RA 2ZJQL 3VTHA 2HFOA 2YQ0A 4C0BA 5DZ7A 3R3LA 2GVDA 1BG3A 2O8DA 2DNNA 5KT3A 5GAGI 1NPRA 2YKNA 1WF0A 5GAEI 3EXCX 5HOOA 1BQMB 4J5OA 3MOJB 3CFOA 2DH8A 2FVSA 4O55A 3GFHA 3O9SA 1BHLA 3G6EN 2HHQA 4DL5A 1OH6A 2EFQA 4WFNL 1R8PA 4NEYA 3UWTA 3ZEUB 2YNIB 3G82A 4TY9A 3ZT4A 2BE2A 2IA6A 2GJ2A 1N54B 5LM7E 1DQ8A 3WUHA 2OJ3A 2F4VJ 1ZZNA 4KR0B 2KI2A 3KYLA 5IFMA 5G4DA 4XEIA 3VGUA 4C9DA 3IR6B 1R0CB 2D0OA 3IM8A 3Q2TC 1JXLA 1HJRA 2MTLA 2F4VK 4JKGA 3ZZ0A 3MEEB 1WI6A 4BHQA 4DV3F 3GIIA 1SJ4P 3TR8A 4LC9B 3TAMA 1CC7A 3KK7A 4KHMA 2CNKB 4ED3A 1T6DA 2Z8QA 1JLFA 1Q8KA 4QIGA 1KLMA 1FKAF 5MLCV 1IUJA 4FJIA 1BUPA 1IKWB 1VIXA 1NXIA 1NBWA 1B0VA 2EK1A 1P90A 1EJ7L 1HI1A 3QRRA 4OZLA 3CNQP 3M32B 2KFZA 5IC6B 4Y3CA 5AQIA 4A8WA 4K0KF 1O0PA 1FRXA 2HBYB 3DCAA 3VAFA 1NM2A 5HVGA 2M8HA 3O8WA 2P9PA 2Y9HA 2HMIA 2VWBA 3GL1A 3DI6A 4M5JA 4FPAA 3O9UA 2F63A 1YTUA 2DNRA 4DR4J 2PEHA 1RBAA 3THTA 3GCWP 3MM9A 5KFPA 1BL3A 2Q1NA 4KB0A 1T9TA 3OXGA 4HWIA 1YJ7A 1WSFA 3ITHB 1NB2A 5D0HA 4CD3A 3BS9A 2BA9A 3GZ7A 3LP0B 1NU4A 2YHWA 4KTZA 1JXVA 2PY5A 3RB0A 1QE1B 2NQPA 1WKLA 1RBUA 3KWGA 1RBSA 3VWSA 2CPDA 3QMLA 1FXLA 4ZVTB 3OJUA 2BJ3A 1S49A 3KNAA 4DUYK 4B1WB 3OVSA 2R3VA 4KBOA 3C0BA 4C3KA 2VOOA 3CWJA 2UXDJ 4M3YA 1MWZA 4JI5J 1N34K 4RW6B 1SJQA 1N88A 4CYUB 5A2QY 1HYSB 4BS2A 3W62A 2GVZB 2RF2B 5CE3A 1D5AA 2BW2A 1T03B 4J9SA 5C42B 1KDNA 2JX2A 2Q43A 3SV3A 1RWVB 4K0KK 1QTMA 3U27A 5A8RA 1HPZB 2N3LA 1YI2S 1SC6A 1E6YA 3QAUA 4CF2A 1M1KO 3UN3A 4GV3A 3MEKA 3MPUB 2AJQA 2H65B 3NGTA 3I31A 4QOZB 1P1TA 2BKPA 1WAFA 2W1BA 1DEJA 2XB2D 3M6VA 4Y65A 3KLHB 4ECZA 2V50A 1CVJA 1BQXA 4Q2LA 2OPSA 3HHEA 2BRLA 4NZ6A 3BEXA 2H4YB 2YPYA 2I2YA 3ENQA 4QPTA 2VICA 5AQUA 1VQNN 3V9UA 3ZNJ1 3TTFA 2OUGA 1FRIA 4AXIA 3IG1B 4ELUA 1TUYA 4J91A 1NSKL 4LF9J 1ZS6A 3M9NB 1RAFB 4P52A 3NXZA 4U96A 4ZVPB 1TAUA 4C8MA 4C8YA 1XNQK 1NMNA 3TQEA 1QM9A 2Z2YB 5EX5A 2PBDA 2UU9K 4CJPA 5CHIA 4CJEA 5C25A 4IFYA 1C0MA 4CZEA 2ZJRQ 3F9KA 4QIVA 1BQNB 2FHKA 2KKHA 2F7TA 4OPHA 2I5JA 3DM2A 3WNGA 3GFYA 3CCUS 1V6HA 1WACA 5HK4A 3ZTSA 3L4BC 2CPIA 2YKNB 2UUAF 2OSRA 2LQ5A 3MMVA 3MXIA 2WB4A 3PYFA 3QFWA 2PEBA 2UXBF 3DMJB 3T1HK 4Y2IA 5DQGA 1C0UB 2RSQA 2PI4A 3P83D 4ZVGA 2C3MA 4PAAA 2MZQA 3RMAA 2WSEC 1NGCA 4LF9F 2D0BA 1UFWA 3CIPA 4Q7AA 4A8OA 2RDIA 2X1GA 4DV1J 3O1LA 4ZVQB 3PYGA 1T8EA 2H1YA 4ZPCA 2PIIA 1RHUB 1NG9A 1ZM3A 4B9QA 2KL8A 1Y5LB 1F3VA 1HMVA 5CYQA 1VS3A 4KAIA 4BC9A 5CXTA 2DNMA 1X3MA 2ZNYA 3LO3A 3DOKA 5EX3A 3UR0A 1LWXA 1YJNS 4PZVA 3TPQA 3P3DA 4DL7A 3TANA 2ZE2A 3U1MA 3J7ZT 1E6YB 2ACYA 4FP9A 1OMSA 4X4QA 2VIHA 4MAKA 4B1ZA 4BC2A 3P45B 3VAKA 4MKAA 5JJBA 4BVPA 3QFHA 4AILC 3AVBA 2I8EA 3ZZUA 1HI8A 3NH0A 1LFWA 4J9OA 2Q66A 2BABA 2HBKA 3CPWM 1ILYA 4KHSA 3OPKA 4B3MK 1RA7A 2DKOB 1A5XA 3DJCA 2ZBPA 4CJTA 3M8PA 4JI3F 1KKHA 2DRAA 2GA7A 3FZKA 3MUVP 2UUCK 2U2FA 1U6FA 4X65F 4DUZF 1JB0C 2HVIA 1D0EA 5D4NA 3ILLA 3IUCA 3QRQA 3FMBA 3C8YA 1UA1A 4GVLA 1VQ9N 5A6WA 2DH9A 4DTNA 4CGGA 4YFUA 1HPMA 3NY0A 3VEXA 4E7HA 1Q8IA 3K8VA 4XAKA 2R7UA 3FSYA 4WZMA 2VDHA 2F3JA 3G4SN 2O4IA 2RU9A 2W2OP 1U1PA 5MAOA 3W0LA 3K2YA 2B4JA 3PEJA 1XHXA 2G13A 4OLOA 1KS2A 4CIFA 2Z57B 4BE0A 1HWKA 3O9TA 4K5RA 1SVDA 3CHWA 4GKKJ 5DG9A 4EP4A 4Z4FA 3HHLA 2DCUB 3DU6A 2GIFA 5FIIA 1T44A 1RTIA 1LWEA 1NHKL 3DLLQ 3ENBA 4J2EA 4DCJB 4IOCQ 3CCMS 5KGXA 3I6PA 1MN9A 3A3NB 4M5DA 1QAIA 3HT3A 1NK9A 5FPEA 4O0IA 4LFCF 1X0PA 3OYCA 4M7XA 1K44A 3LW5C 2DXEA 3HOSA 4KHPK 4NLGA 4DV3K 1SL0A 3CCSS 4N77A 3OFHA 4F36A 1FNOA 4OJHA 3PM9A 3H46O 2XS7A 3FK4A 1S72S 3K9KA 3PYEA 2KT3A 1P1LA 2HOEA 2BJ7A 2HSEB 4KHYA 4USJC 4BRMA 2R7RA 1CG2A 1NM1A 3CD7A 1RTJB 1LWFB 4DSIA 3CCVN 1S57A 2X3DA 2DGQA 3ID8A 3VEVA 4FLXA 4CHOA 2OTLN 4QR0A 2KRRA 4E0DA 1J54A 3J80O 1S4EA 3TNVA 4YR3A 2HNYA 2XI3A 5E0OA 5KFNA 4Q8FA 4B3SJ 3HZGA 2U1AA 1WN7A 2YX4A 3HHDA 4ZVRB 3K8WA 5IWAK 3JS6A 3TEGA 3IDHA 2JFKA 2R8KA 4HUFA 2V8PA 4JI5F 3GYGA 3DAWA 4R8UB 1AFJA 2BKOA 3N4PA 3P5JA 4BR4A 4BC3A 3AA8A 2R7VA 2J9CA 1E3MA 2V7ZA 1RXOB 4A8KA 1L5UA 3DHWC 3C6HA 1S4FA 4RUBA 3TO8A 3JSBA 3GOIA 4DKWA 4WXOA 3A5MC 1ZTWA 2HHTA 4JBCA 3TZZA 2QT7A 2HFUA 3AD8C 2RH3A 4X4TA 3TA1A 4YR0A 2WBNA 4ECXA 3SSSA 4IYQA 3HHLC 3L2QA 1Q9YA 4P2XA 5E84A 4RWWA 5D0GA 5T7BA 2ASMA 3PW5A 1BA1A 4O5FA 2DXFA 3AY0A 2Y8WA 4ZOSA 1Q1KA 1HR0J 5A0YB 3ZSXA 2M88A 2B8PA 2I1RA 2JL9A 3KKRA 3O4QA 4B08A 4FNHA 1FO1A 2AJ1A 1ULRA 1S99A 1SJ1A 3Q83A 3AQPA 1Y4ZB 4DV2F 1UWBA 3W2VB 3HSGA 1BY9A 4WFBQ 5ITHA 1JX4A 4YORA 2WSCC 2G0CA 3WIVA 4DQIA 4IO9Q 5BREA 1ELOA 3NAIA 2J0SD 1EAYC 3I56S 2UUAJ 1RWNB 2YBVA 3VOVA 1CC8A 3SDEA 3ZC4A 4X84A 8AT1B 1JWWA 1JNRB 3MMAA 2ZE2B 4BG8A 2DTJA 2ALZA 4F26A 3OYHA 4IXCA 2MKJA 4YHHK 3R5JB 1RT7B 1NO8A 2D1CA 3EZ5A 2K3IA 3M8YA 4H03B 1S0OA 2BANA 3L7OA 3HT0A 3O9RA 1EKRA 4OLPA 3E66A 3EKUA 2D9PA 3VGTA 3DNCA 1NGHA 4CCHA 1F5CA 1NKBA 2DNLA 3RB6A 5AQZA 2AKWB 4QZVB 2W01A 2KG0A 2L48A 4CFAA 5HJYA 1R8AA 3UD3P 1ZAXA 4DV2J 2HNYB 4ZPWR 3VV2B 1HD0A 4DV1K 3OL8A 4ZP7A 1T9XA 3WNEA 4J9PA 2DITA 1RB0A 3IR5B 4LF6J 3ZXWA 1CJKA 1VQ4S 2HNDA 4NZ0A 5E3PA 3U4LA 2E1AA 4ZVEA 4JI7F 4QWEA 2DVIA 4ZIWA 4BWJA 3PHTA 4JI2F 2HRUA 1KXPA 4KSEB 4ES1A 3M2RB 1R6VA 2J9DA 1RT6B 4BR5A 3PW7A 4F02A 4IG0A 1OQ6A 3IAS9 3R6GB 4PWUA 3NF6A 3LZIA 3GWCA 2YX7A 3MDFA 2Y8YA 1L3VA 4BRHA 4OX8A 1RWMB 4E19A 5C2FA 4GVBB 3PJXA 2BVZA 3CCQN 2B9EA 4Q5VA 2XSFA 3O3LA 3TX0A 5IXUA 5E26A 1X8DA 4Q2MA 2HHXA 1WWHA 2O8CB 4ZP9A 2CJKA 2XY7A 4DFPA 4H5NA 4LSNB 1RTIB 1HWIA 2JZ5A 4F0KA 4CEOA 3MMJA 4M7YA 3MCOA 2XNRA 7FDRA 4FJXA 2IS3A 1VQ5N 1TL1B 1YXQA 3NGRA 1KQSR 1BQMA 2W8KA 4NRUA 1B7FA 1BHNA 4LRBA 4WPAA 1DY3A 3VQSA 4KFBB 1M5SA 1J27A 5M1PA 3OTOK 5AQYA 3CJRA 1NDLA 3MD1A 3SUQA 4LY7A 4PKHA 2RNEA 4IOCL 4DPTA 3HYFA 4OPJA 1PO6A 1D09B 1NBEB 4AUKA 5L38A 5E5NA 1C0FA 4QR1A 4X2BA 5KG2A 4DL0C 1OH5A 1WORA 4NOHA 3AJ1A 2RQKA 4KH1B 1VQSA 3W5ZA 1K8KB 3H5XA 3B4DA 5I3UA 4QJVA 4DXLA 4FM2A 1VQLN 1RACB 1XNQJ 4B3TJ 1NJYA 2HZVA 4JK7A 4ANDA 3FCWA 3CJ7A 1K73O 2UXBJ 3RRGA 3UKUA 1OSCA 4UZBA 1NGJA 3NEKA 1XHZA 4K0KJ 3NGYA 3SIPB 3D2FB 4EZ9A 1JLFB 3I9ZA 1HJOA 2GGPA 3AOBA 3I9V9 3UDEA 4OYIA 4CGJA 2BANB 3DOLB 3NH2A 2HBRB 2BGGA 1GMVA 4N5SA 2KKZA 2XYPB 4EEYA 4HUGA 1RTHB 3RMCA 4ZJLA 3PUFA 1OY8A 4LF2A 3FBEA 4H4MA 3K57A 5AR0A 3UDVA 2G4BA 4NLCA 1BU6O 1EX4A 1AYEA 3FSIA 1N36F 3UVJB 1YAGA 5IQQA 2DFFA 1HQUB 5KFVA 3NP5A 2Z2ZA 1U48A 3LWMA 1OO0B 2IGIA 4B3SF 2DPIA 2JLGA 1VQPS 3UFCX 3G86A 1J5OB 4DCPB 3GJTB 3PLAA 3R2CJ 1PCAA 2DRBA 1X4EA 2P9IB 2QTDA 1Q4RA 2QLBB 3Q8QB 3WBZA 1SQKA 4M1KA 5J2MB 5BYRA 1U49A 3AVAA 3ZSYA 4IQMA 4V19S 3EXYA 4ZJQA 1AZSA 1EXQA 5ETQA 3MR2A 4C2MA 5AQGA 1Y3KA 2Y1LB 2J6SA 1F6TA 2MSSA 1U1RA 3BZCA 3CIZA 4JI3J 3A8KA 1F2GA 2LDYA 5KFLA 3VEWA 1TV6B 2IMOA 1RUSA 5CA5A 2QSFA 2Q6BA 3MWPA 1TL3B 4JI0K 3I0RB 3F0NA 4CF9A 3NCPA 1YF5L 4KC5A 4CVNE 2YNFB 4LFAK 2GUIA 5F8LA 4B3OA 2AX0A 3MXJA 1P8ZA 4WQ5A 1VQKS 1U09A 2JJ4D 4O44A 2EPIA 1NK7A 2HNZB 3A12A 4K59A 3ELHA 4JV0A 3GR1A 1FCAA 3UPFA 1P9QC 3R6LB 1VQMS 1GXUA 2GC8A 3V6DA 2R7OA 3AAQA 1PC4A 1GTHA 1X4DA 3ATVA 2MHNA 3D0GE 4BRDA 5J2PB 5J2QA 3SCIE 4JI1K 4LIWA 4O5BA 2P9UB 1DJ0A 4D3HA 2ZUAA 3TTDA 3KLEA 5IOLA 1WC0A 4NA3A 4O0NA 4LF8F 3OLBA 4C8KA 1BLUA 3UKUB 3GLJA 2P9KB 3BPSP 2AGQA 4F4AA 3TVYA 1W2BM 1EKEA 4ILHA 4M45A 1OKJA 4TU8A 3TAPA 1FRKA 1P9YA 4HTJA 2AYMA 3I82A 2EFNA 2BBEA 4IEIA 1RWWB 1UL3A 2OGUA 4I68A 3L7PA 1BISA 4X64J 3CCEN 4DWIA 3ZETB 3OXLA 3MD3A 4BROA 4DS4A 4M3TA 2DGUA 3TSQA 3PX4A 3SUPA 4F4ZA 1JMTA 1PIEA 1IJJA 2XBPA 4ANEA 4I6MB 2CWKA 3SMSA 4A61A 2RPIA 3LGNA 2WW4A 3GE1A 4PY5A 4NYPA 4C4WA 2L41A 3U6FA 3SK3A 2J7UA 2PMHA 4YB5A 2HHHF 4DU3A 2W4PA 1FW6A 5ADZA 3S3OA 4JI6K 3CIMA 1U45A 3C95A 5BJRA 4TXSA 3UQSA 8ATCB 1T95A 4IO1A 4OFZA 3OUYA 3CC7S 3AVIA 2IVMA 3BYPA 3HHKA 3CJ0A 4ZLPA 2RHKA 1HHQA 4JKFA 4RWTA 2DNKA 2Q3PA 4NA1A 2ILYA 2V0NA 3D2WA 2DY1A 2H48B 2Z0GA 4M5HA 1JLGB 2X6SA 1FE4A 2K7KA 5KFYA 1U1QA 3AARA 3KWMA 2B4UA 4ZMMA 5JICA 2HIQA 2EI5A 1K73T 1TMJA 1ZBUA 1KRPA 4ITSA 5H9EJ 2CA9A 4QQBA 3FRYA 1FHTA 1KOHA 4LVOP 1UJ4A 4JI2J 2HQIA 2XQCA 3ZCMA 2EFPA 1ATNA 1I6JA 4NX9A 3BR9A 2OPPA 2PZSA 5L46A 1B4SA 2A10A 3E2EA 4I67A 5AQJA 3L2WA 4JRQA 2EG2A 3VF6A 4HDGA 4KBIA 2W6LA 2CZ9A 3D6HB 2W41A 5LSLA 2IC3A 1XNRJ 3VAMA 3O6WA 1AUDA 2RRBA 1Q78A 4JK8A 1GXTA 2QWOA 2CGJA 3VQPA 2N3OA 4DQRA 2O1PA 3DOMB 1X9SA 1RP5A 1LWCB 5IV4A 4FOEA 1S72N 3J7YU 3C14B 3SBGA 3BDEA 2QLXA 4YOWA 4DTRA 3ET6B 2K3KA 1BWVA 2DFHA 3MM5B 1B99A 4ZPTR 3T5JA 4R25A 2YWHA 4UUWA 3HPOA 3W5XA 4FS2A 1KC8O 4RW8B 4DPYA 4B8CA 4JD2A 4ZP8A 1HR0K 1IWAA 3K7RA 4TY8B 3QINA 1X3NA 2L9NA 2G8HA 4AHRA 4ILGB 3MFHA 1AXQA 3PEHA 3VMFB 1NJWA 3T7ZA 4YOTA 4ZVUB 2V9KA 5JLHA 3POTA 5KRTA 3RUBL 3I0SB 5LY3A 4ECVA 2P5OA 2DH7A 5CH7B 3UNYA 4A8FA 2CVIA 4KI4A 3T19A 2NNWA 3DC2A 2EX3A 4QPXA 3N5BA 3VERA 1RA6A 3R5DA 4RWXA 1HX1A 1FT8A 4HEA9 1EWRA 1EP4A 3HVTA 5I3PA 5B0DA 3OUYB 4BQZA 4QIFA 1VQPN 5LSRA 2RUGA 2KVQE 3M30B 2NUHA 3NF9A 3QNNA 1XR5A 5EX0A 4NCGA 3H3OB 4OKEA 1VIOA 3QICA 2XWYA 5DETA 5F8HA 4TYBA 1WLJA 4JV5K 4USVA 3AODA 1R0AB 3D2EA 1X60A 5KFQA 2HZAA 4N47A 2WVEA 4WIIA 2VODA 1REGX 4KYZA 2J7WA 1MSWD 2HQGA 1PYSB 4J9LA 5C2DA 2DNOA 4CT9A 5HJXA 3H40A 1Q81T 2DT9A 1URRA 3CCSN 4CFCA 3S6EA 2PGCA 2LYVA 3AOAA 4DX7A 2ZWHA 4OMFG 5AQTA 1LWFA 3DLKA 5F8MA 2DNYA 4KHQA 3BP8A 4DR7F 5BRDA 3AA2A 1VRUB 4FF4A 4ED2A 1R31A 5DQHA 3WNFA 3ZTRA 1QVGR 1GTEA 5B0GA 3KK3B 1ZBHA 3Q0AA 2VC1A 1CZAN 4WK1A 4K25A 2C2MB 4RLEA 4JI4F 3FUYA 4ZVFA 1CJVA 1U04A 4CEAA 1RLCL 5AZIA 3MURP 4K4XA 3LH2S 1XWLA 1LK7A 2QL5B 2HEKA 1JK9B 1Q8BA 2V4JB 4B3RF 1X9MA 2E88A 4F4YA 3DHXA 1HNWK 4TLRA 2RQCA 5H9FJ 4LMZA 3B6OA 5AQHA 3TAEA 1RNHA 2QL9B 1NUEA 3DRSA 4LJMA 1HNWJ 1JL1A 3QZ7A 2RHSB 3N6NA 2DGWA 2E66A 4WJBA 4DTPA 3R7SB 1S9GB 2CPZA 4FBTA 4DR5J 3QFPA 1HR0F 2XY6A 3N4WA 1A5WA 2ZHAA 2ASPA 3K89A 3IRXA 3RAQA 3PO5A 3RWUA 2DNGA 1I5OB 3HSDA 3AVFA 4X64F 3JSMB 2QA1A 3BF4A 2V4QA 2MYFA 3A5OC 5KFHA 2RD5C 3GE9A 5KAKA 2G8UA 4DR4F 3HRGA 5AXLA 4KIAA 2UVRA 2H54B 4A59A 2FTRA 3CD0A 3QIOA 4JAXA 2OZSA 3KK1A 2BTFA 2BV3A 4GC6A 4MTPA 5KT7A 2Q36A 2K8GA 4OIXA 4FWKA 3KLGA 4EBEA 5KPTA 4CNZA 4N8NA 4MK7A 2EVZA 2WVBA 1KOOA 3TABA 3CVKA 4OYMA 3FZFA 1BCOA 3SDEB 5FPMA 2W40A 3OYMA 3F73A 2QM1A 2ITGA 2E2OA 3SAHA 4WKRA 3ETMA 1UFLA 5F9LA 4Y6IA 1RLDA 2XO6A 3AAWB 2JEGA 4CERA 1T94A 4YB7A 4GRSA 1K0VA 2IC3B 3AJDA 1ZM2A 1L3UA 5D77A 2HQDA 4X62J 3RB4A 1I1GA 4FJKA 2P9CA 3TZWA 1UFKA 1RZMA 1FJGK 1G1XA 1C1BB 1R8CA 1AA1B 1ZBSA 3E51A 2VA2A 1NNDA 1TMMA 2BM1A 1OJ4A 3V1QA 4RU2A 4I7FA 4CZIA 3PX0A 4WQ5C 2W6KA 3SJHA 2O5DA 4USTA 4DDFA 1YJUA 4IKFA 1DARA 4HVZA 4ED8A 2FSJA 2ZF5O 1I51B 3KJQB 3TWHA 1JLEB 4I2PB 3ILJA 2HHWA 2YKPA 3KJVB 3N01A 2MKIA 1CQMA 2JGUA 3KLIB 4A4JA 1A0OB 1X4HA 4NMXA 2V2KA 2O01C 3HOTA 1NB7A 2V4JA 2MZJA 3TP2A 1RE1B 3Q8RB 2XLKA 2WFBA 1T05A 3D0HE 2PSZA 3AO2A 1S7HA 1CSJA 4QIEA 3MOZA 3A3PB 4FPBA 1EARA 4H8KA 3ZSQA 3OW2M 1U0HA 3CXCR 3I0SA 1AUSL 3Q8UA 4GVBA 4CJKA 3CJ9A 1GOAA 1KR4A 1VK0A 3Q7CA 5BXIA 5CHCB 4QS7A 1FX2A 1WSIA 5KPZA 1HD1A 1HBMA 3AO5A 3IS9B 4ZN3A 5AQRA 1R8HA 2GHWA 2UVVA 1VQON 3QZ8A 2EWSA 4FJ5A 1TL1A 2N4DA 3TVZA 4OJGA 4NLSA 3J7Z5 2OEKA 3QB0A 2GWKA 4DPOA 1BXNA 3BDPA 3V9SA 3LDOA 4CHYA 3EKSA 1X7VA 3OVBA 3C16A 2CVEA 2WVCA 2FVCA 4DR1K 4FJHA 4H4OB 4BRCA 4RW4A 2PO4A 4MIWA 5KFTA 4NB4A 3GYNA 4I2QB 5DM7Q 4XDDA 1MDUB 3D6RA 2DGSA 2E1ZA 2ZM6F 2M5YA 1H73A 1TR0A 1D9FA 3LPTA 2HAIA 4LREA 1HBUA 3RBXA 2YWKA 3KOAA 1RCOB 1SUQA 1S1VA 3VALA 4DFKA 4W5QA 5JVGQ 3T3FA 1S6PB 1C4AA 5SZTA 3DXMA 4OI6A 5MLCQ 5GIPA 2IJRA 1TTHB 4PG6A 2UXCJ 3GSDA 2RRNA 2ZOMA 4ZLLA 4BREA 3NCRA 4UUXA 3J80U 1MA9B 4KH6A 1GLCG 5GADP 1SXLA 1EO1A 3EY1A 2J8AA 5ETKA 3LDLA 3NOCA 3HULA 3GB0A 1FFGB 1KHWA 1S0VA 1KHVA 3EZUA 3NL0A 3RTVA 4JEPA 5A8WA 3SI6A 2LXIA 1ZBIA 1REVB 3HP9A 1M5VC 1F9FA 4OX7A 4CO5A 2NUUG 4H0XB 2OELA 4EYHB 1G99A 3WC0A 2C3PA 4X62K 4FPIA 5I42B 2D69A 3JSMA 3HD1A 4CTAB 3LALA 3CJCA 5A6PA 3EVOA 4P6QA 4DV6K 1RT3B 2VU5A 2XZTB 2VGMA 3CPEA 5HQMA 4HI1A 3DLLL 5HLFA 3KDOA 2X1FA 1RBLA 3V6HA 5GAGU 4N76A 3O1WA 2PDAA 4CO4A 1HNWF 3ZFVA 4M5LA 5A8KB 1SL2A 3IWXA 2P9NB 4CO0A 4B1YB 1Z2LA 1WSHA 5TKWA 2OH2A 4K8XA 2P9SA 3H5SA 4PKGA 1TV6A 2EFOA 5E7OB 3B8HA 3BUZB 2LQ9A 4NYOA 2OIHA 3PIOQ 1MMNA 4X4PA 1N32F 2CPYA 4WFYA 3KJFB 1NDPA 2OD6A 3MEGB 2CQGA 3UKRA 3A3OB 2VBWA 1NEEA 4DR3J 4CE9A 5DLFA 3ZZPA 2G2OA 4MKVA 2E7XA 2FC8A 3TEHB 3CT9A 5HP1B 3CCLN 1RAEB 4CGIA 3B8AX 5E41A 2VONA 3FFKB 3HFKA 4QW9A 2YKAA 2DBBA 4USIA 3EUNA 2HYIB 3ZTPA 4M95A 3VQAA 4CH1A 1UEVA 3BH7B 4H0TB 4UOHA 2DIUA 2CDRB 2R9LA 3PO4A 1GLFO 4PXDA 4UOCA 3EPGA 3I8DA 1XK8A 5B7WA 2P6SA 2AV5A 3VA3A 4KT0C 4CJQA 4R79A 4OZ2A 1LOUA 3OV7A 3QEIA 4FPRA 1QS4A 4EGLA 3G87A 3DRRA 2HFVA 2W7AA 5E2QA 2AQ4A 1TKTA 3W9HA 3RBDA 4A8YA 1R6YA 2LMIA 2M7SA 4NXNK 2ALYB 5CZ1A 3M7VA 3SPZA 5AQKA 1UVMA 3BO3A 3GONA 4OYWA 2BE2B 2KTQA 2CJQA 2EFGA 1FA0A 2E5LF 1N5SA 5ETRA 4RW9B 1JLCA 3IA0A 4LSZB 3LDQA 1LCUA 4WE1A 3M8SA 4IRCA 4ICLA 4CHNA 2PN6A 3O44A 3LDNA 3TSPA 3V6JA 1H2VZ 3EL2A 3GFXA 2V7YA 3DYAB 2QZ8A 3OL9A 1QQOA 1S6QA 4R5PA 3T5KA 4L72B 4DFMA 2KT5A 2BH1A 4DTXA 4C11A 4CEEA 4FK2A 3V4IB 4IG3A 3OTCA 4B1XB 2HVEA 4FKXA 2VWJA 3F9MA 2UUTA 1XR6A 1HNVB 2VKRA 3P4IA 2J9EA 4FWLA 5BPLA 3VQ9A 1WG4A 1WOQA 2WUSA 2NRHA 3CERA 1GQEA 1FKPA 4YY3F 3QGPA 5FD1A 2QYCA 1S12A 3HFZB 2DR7A