1IKXA

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikxA05
3DOKB 1TP7A 3CWJA 3OYHA 1RA7A 3NGIA 1WNSA 2CKWA 2ZD1B 2UVRA 3AVJA 4KREA 4DTPA 3KLFB 4XPEA 4B08A 1SL0A 1XWLA 4K4WA 4LSLA 2FC0A 1NKBA 3V9UA 3QERA 4KBIA 4NLYA 4AHVA 5F8LA 4CCHA 3OL6A 1RAJA 4J9PA 1SKSA 5KFOA 1YT3A 3MXMA 3ZSVA 5T7BA 3RB3A 4LSLB 5L1KA 2ASJA 4CJTA 4DFKA 4W5QA 2RF2A 4AILC 3OYFA 1S1TA 3V81A 1S9GA 3PJXA 4CGHA 4QWCA 1DTQA 1TKTA 2UUTA 1RT3A 3DRPA 5KT4A 4HUGA 4IDKA 3L8BA 4OVLA 3OHAA 4O4GB 3OSNA 2WONA 2RF2B 3QO9A 3ASMA 4CK3A 3V81B 4DTXA 1S9GB 1VSIA 3ISNC 3QLHA 2W8LA 2FVPA 4J9MA 1UAXA 1J54A 1DTQB 1TKTB 5F8HA 4CECA 3SV4A 1RT3B 3N6MA 4KHYA 1JLBA 4IRDA 3OY9A 3DRPB 5KT6A 3RMBA 2ILYA 4KAZA 4IDKB 1VRTB 1KFSA 4CJKA 2WONB 3G6VA 3K58A 1MMLA 3QO9B 4IFYA 4IG3A 3K5NA 5F8IA 3QLHB 4Z4FA 3BSAA 3VQPA 1U04A 3GIIA 4O3SA 1JLBB 4CFAA 3DLBA 4C8LA 1T94A 4FJLA 4TY8A 1Q8IA 5FDLB 4IFYB 4IG3B 4ZVHA 3RRGA 2R8JA 4RNHA 1SV5B 3NGYA 5L9XA 1YVUA 1IKXA 4CGIA 4RUAA 4TY8B 4BDYA 3TAEA 4M95A 3AA4A 3LDSA 4FM0A 5KTQA 4EYIB 1ZBLA 1RILA 4FLTA 5F9NA 3AA5X 3VQ9A 1QE1A 3ZSWA 1T8EA 4QW8A 2D5RA 4NLWA 1Y97A 2DFFA 3KLVA 1TL3A 3P5JA 2XY7A 4DLEA 4OGEA 1IKXB 4QWEA 2D0CA 2B43A 5CZ1A 4DL7A 1RT1A 4JUZA 3V1QA 1QE1B 3CQ8A 3JYTA 1TL3B 2QKBA 4K4TA 4CJPA 1C0TA 4Y2AA 4ELVA 1QSSA 3SUQA 1RT1B 1BIZA 4ZTJA 4DL4A 1KHVA 1QAIA 1VSMA 5DG7A 5F8NA 3P1GA 4ECQA 1EXQA 4URSA 1C0TB 4NYFA 1EKEA 4CESA 3OJSA 3NAHA 4DQRA 2A1SA 2QV6A 1BGXT 3RMCA 2R8KA 3VQEA 2W8KA 1C0MA 4ZPDA 2F96A 3AVMA 1S5JA 1GOAA 2B5JA 4CJ4A 4KSEB 1JXLA 1RDDA 4TN2A 4J9RA 4RNNA 3PW5A 1TAUA 3MECA 1VRUA 3HPOA 1REVA 3L2QA 3OYGA 4ICLA 3LWLA 3G6XA 1LWFA 4KFBA 4O5BA 4CHOA 4IKAA 4R8UB 4FS1A 4KHUA 2RPIA 2IM2A 4ECUA 1XR6A 1BI4A 3C6TA 1MU2A 3T5HA 3RMAA 4YR2A 1NJXA 2Z1IA 3C94A 3GIJA 3MECB 2O5DA 1VRUB 4IG0A 1REVB 4DTSA 5KFMA 2V9WA 1S0OA 3HM9A 4ICLB 4FW1A 1T05B 4RW4B 1LWFB 4KFBB 4HYKA 1RA6A 4QPXA 5KFEA 4Q45A 2O4GA 1BI4B 3C6TB 4J2DA 2OYQA 1MU2B 4AHRA 3IN5A 4YNQA 4AHSA 3DYAA 3OL8A 3VA0A 4IG0B 3OL9A 2OZMA 2IJFA 1HARA 3ZT0A 1RDAA 2ILZA 4FLXA 4Z0UA 3OYDA 3A2FA 1C0UA 4FJ9A 4DTNA 1HMVA 3HVRA 3OYKA 4HVJA 5CY4A 4BDPA 3HK2A 3DYAB 4FK4A 1VSKA 4ED0A 4DSLA 5DG8A 3WNHA 1LW2A 4KKOA 3H5XA 1QQCA 1C0UB 1HMVB 1X9SA 3SFUA 1G15A 3HYFA 3G10A 3VQQA 1NJYA 2OPRA 4M3XA 1HNIA 3ZCMA 1YTUA 5KT3A 2DFHA 2E9RX 4KKOB 5DK5A 1ZBIA 3LZJA 4RNOA 2BRLA 3M8RA 1K1QA 1NHVA 4MIAA 5HRPA 1VSEA 1L5UA 4DF8A 2OPRB 4TYAA 1TVRA 2FLPA 2NUBA 1HNIB 1UA0A 4KV8A 4ELUA 3K5LA 3TANA 3QZ8A 3VQSA 5KFPA 2DY4A 3MR6A 2OPQA 4TSXA 1JXBA 1KLMA 4DQIA 2RDJA 3NHGA 1VSHA 1TVRB 4U6PA 4TQSA 2HNZB 4KB7A 4KV8B 4IRCA 4FZYA 2YNFB 3ITHA 3AVIA 3TVKA 4CGGA 2BRKA 4WXWA 4M3UA 4B9MA 1KLMB 3QEXA 1TKZA 3RB6A 5KFHA 4Z4IA 2UVVA 3OS1A 3NKYA 3OYEA 2JLEA 3AVNA 3S3NA 4MK8A 4B9VA 1WAJA 4CJFA 2D41A 1C1BA 4NLDA 4NLOA 3KOAA 2HNDA 4DU3A 1RT7A 4YQWA 4J9NA 3KLEA 3NL0A 2XGQA 4C8KA 4E3SA 5KFCA 4PUOA 1TKZB 4DTJA 5SWMA 4DSIA 4KRFA 4OJRA 5L1JA 3B6OA 1XR5A 3U3GA 1OS5A 1A5VA 1RTHA 4EZ6A 2RKIA 5K14A 1C1BB 4EP5A 4N56A 4CEOA 2IM1A 1HYZA 4K4UA 4ZP6A 2HNDB 2GIRA 2KFZA 1SH0A 1RT7B 3KLEB 5DLFA 4CJSA 2PZSA 2XCPA 4FM1A 2KW4A 3OS0A 3V9WA 3P83D 1RTHB 4H8KA 1I3AA 4BWJA 1KTQA 2ETJA 3Q8RB 2RKIB 3CM5A 5K14B 4ED1A 1N56A 4CHYA 4E7HA 2OPSA 3H98A 4KTWA 1TQLA 4CEEA 1JL2A 3ISND 1Z4UA 4Y1DA 3LWMA 1C6VA 3BSCA 2A1RA 5T14A 2XRIA 4RUCA 2AGPA 5KG0A 4K4ZA 3L2RA 3SUNA 1NJWA 1BL3A 2BQRA 2OPSB 2YHAA 4RNMA 4CIFA 2F8SA 4IH7A 1B9FA 2HAIA 4Q44A 1RT5A 1ZYQA 4WZMA 1WSIA 4C8NA 5KFBA 3DM2A 5J2MA 4B9NA 1HQUA 4OL8A 4FJHA 4ECZA 2X74A 4IBNA 2E9TA 3I5CA 3VQCA 1ITGA 4ECRA 2ATQA 3UR0A 3G0ZA 2G8FA 3T5KA 3VQ6A 1RT5B 4AH9A 4TXSA 3DM2B 5J2MB 1DTTA 4H4OA 1NK9A 4FJXA 3LAKA 4FZZA 2VWJA 4FYDA 1TGOA 1TAQA 5JS1A 4CK1A 5KG4A 2JEFA 2IOCA 1XHXA 3V6KA 2WB4A 3ZSRA 3Q8QB 4DSEA 3SQ2A 1NHUA 3NF9A 4HCCA 3PX0A 4AHTA 1LW0A 3SZ2A 1DTTB 4H4OB 2IA6A 4WE1A 3PY8A 5KFXA 3MXJA 3OYLA 4GW6A 4M3ZA 4ZVEA 3QIPA 1LV5A 3LANA 4WZQA 4WXOA 5F8JA 3OYCA 5J2PA 1LW0B 4WE1B 3TAFA 4NCGA 1DLOA 4M45A 1N5YA 4CGDA 2LSNA 3V4IA 3QIPB 2VWKA 3RMDA 4RG8A 5KFQA 1L3TA 3D28A 3KHGA 4B9TA 4FLWA 4Y2CA 5J2PB 1LAVA 2KTQA 4ECTA 2XY8A 2ZE2A 3MEGA 2RDIA 1F21A 4N5SA 4FVMA 1DLOB 1N5YB 4WYLA 3MFIA 3NGDA 3V4IB 3NAIA 1WNEA 3WNEA 4HHTA 3QGGA 2V4QA 3K5OA 2AJQA 3QINA 3M9NB 4LY7A 3ALYA 1NK4A 3OSPA 4RU9A 3HPGA 4E19A 2HHUA 4NCBA 3AVLA 2QK9A 2ZE2B 3MEGB 2DPIA 4FLZA 4CF1A 3PW4A 2IM0A 3PV8A 4DEZA 5HRNA 1NJZA 3QEPA 2JEJA 3AO3A 4J9SA 4CHZA 3BQ0A 5KFVA 1WSEA 1WSGA 4KHMA 2W7PA 4HTUA 2O4IA 4CEDA 1TKXA 4OLAA 3EPGA 1TK5A 5DG9A 4FW2A 1D5AA 4KHQA 3OLAA 4K4VA 4NRTA 4J2BA 1ZBHA 2ITGA 4NLSA 3SQ4A 4FZXC 3KLGA 4K4SA 2XI3A 4ZP8A 1SH3A 1B92A 4ID5A 1TKXB 2WOMA 3BSOA 5KRTA 1S1TB 3CFOA 3MTKA 4UQGA 4OLBA 3HKWA 2UVUA 3LPTA 1WN7A 3PJWA 3NH0A 3H4BA 3KK3A 3KLGB 1ASWA 3M9MB 4M94A 4B8AB 2BANA 1RDCA 5KFUA 2IMWP 2G8WA 4ID5B 1GOCA 2WOMB 5C24A 3TQ1A 5I42A 2WRMA 2C28A 1QAJA 4HUFA 4O3OA 3BGRA 2UUWA 1J9AA 3O3FA 4CIGA 2OH2A 4NRUA 4O3PA 3KK3B 4DQPA 3IG1A 4F4XA 1C1CA 3AVCA 2BANB 5DLGA 3DI6A 4GC7A 4E1MA 5C24B 2XC9A 5I42B 1RT2A 4DSKA 3HT3A 4NLUA 2E9ZA 5L1LA 4F4KA 4CHPA 1KCFA 2X78A 4WYWA 1W0HA 3IG1B 5KG7A 4KO0A 5KG1A 1C1CB 2W9AA 4ZP9A 3DI6B 4ED7A 4FK0A 2D3ZA 2PYLA 4O4RA 2G8HA 2XY5A 3T5LA 3H5SA 2XGPA 4DU1A 1CSJA 3UIQA 3GYNA 3CDEA 4FCYA 3KK1A 4C8OA 5CYQA 5J2NA 4N41A 3B6PA 3EZUA 3H2LA 4KHSA 5DMRA 4KO0B 3O3GA 4IOBA 3MEDA 3TWHA 1EETA 1LWEA 3K57A 4LQ3A 3V6HA 3KK1B 4NZ0A 3LP1A 4Q0BA 4CGFA 4DG1A 5CYQB 5J2NB 4CEBA 5DQHA 3RB4A 3RBDA 3CIZA 4ED2A 3V1RA 4ZTFA 3QESA 3MEDB 3CG7A 5KRSA 2XCAA 3TARA 1NKCA 3MXIA 1EETB 4ECSA 1LWEB 1SKRA 4W5RA 1RYRA 4FJIA 1S1VA 3LP1B 4Q0BB 2GUIA 3G86A 3SI8A 2C2EA 4DG1B 3VQDA 1RTIA 3H5YA 1EX4A 4ECXA 3EZ5A 3JYTB 5C42A 3THVA 2J6SA 4OPJA 4ED6A 1K6YA 4GMJB 4QAGA 1RBUA 3QEWA 1QS4A 3FFIA 2PY5A 3QGIA 5KFGA 1S1VB 1KVAA 4F2SA 1RTIB 2GV9A 1C1AA 5C42B 3KMSA 2R2RA 1X1PA 2BQ3A 3IRXA 4FJNA 4LH4A 3FFIB 1RNHA 5KG5A 2FVQA 4X2BA 5J2QA 4Q43A 3ZSXA 2YHBA 4I9LA 5KFDA 4KB1A 4NYZA 2B5JB 4IR1A 3HHKA 3IRXB 3KLHA 2FJVA 4G3IA 4CJ3A 3PW0A 4NYNA 2G8UA 2IDOA 1NK5A 5SZTA 2EX3A 3H5UA 5J2QB 4TLRA 4JV1A 3DDKA 2BE2A 2G8KA 5F8GA 4OKKA 3N6NA 2JEIA 4ZPCA 3S3OA 3SFGA 5D3GA 4N47A 1N48A 1RTJA 2W9CA 3SCXA 4C8MA 4JLHA 3TAPA 1HPZA 2BE2B 4U7CA 3ULDA 2HHSA 3NGZA 2CJQA 2IAJA 3DRRA 3QIDA 3JSMA 3TI0A 5KFWA 5EWEA 5D3GB 1S6PA 4DTRA 2W9CB 1NOYA 5CZ2A 3HL8A 4K8ZA 3I0RA 1HPZB 4IH5A 2AWZA 3GV7B 2IAJB 3DRRB 3HXMA 3JSMB 2I5JA 3SNNA 1U47A 3SUPA 4ZVFA 2DPJA 1D9FA 2FBVA 4AHUA 2FJXA 1S6PB 3NFAA 2GC8A 2XI2A 3OS2A 3CJ3A 2E6MA 2ALZA 3H08A 2B4JA 1LW2B 3LP3A 3OYAA 4YR3A 3V9SA 4B8CA 5HBMA 1HQEA 4CEQA 3QYYA 3CDWA 5KFKA 2I5JB 2XWYA 5HRSA 4IFVA 3M8SA 4CJUA 1WAFA 3GQCA 4DMNA 1B9DA 2BDPA 3VN5A 3AO4A 3WNGA 4DQSA 5HBMB 1HQEB 3UDLA 3GV8B 4RW9A 4CHNA 5DQGA 4KI4A 4IFVB 2OPQB 3OYJA 1JX4A 4F2RA 1N6QA 1SL2A 4PQUA 3NF8A 2QE5A 3NBPA 3OJUA 4O44A 4RW9B 1YVFA 2FBYA 3VQ5A 3PR5B 4DWIA 2VG6A 3PUFA 4CJQA 3ITHB 2FVRA 3L3UA 2R8HA 4QOZB 4G1QA 3FQKA 1JXEA 4RW8A 5I3UA 5KGWA 3KHRA 4J9LA 4JS4A 3T19A 3VQBA 2ZQBA 3HP9A 4DTOA 2P5GA 3H40A 1QTMA 1J5OA 4PQUB 3NBPB 3HPHA 2VG6B 4DFPA 2HVHA 4JRQA 4JRPA 1SUQA 1JLEA 4G1QB 2EHGA 3OYNA 4RW8B 3M9OB 3DOLA 4QW9A 1JLQA 1UOCA 3IS9A 2HHTA 1J5OB 2VG5A 4E0DA 1T3NA 4Z4CA 4PUOB 2V4RA 1IG9A 5FRNA 4DSFA 2WCXA 3NH1A 4FLYA 1SUQB 1JLEB 1HJRA 3QEVA 3DOLB 1BQNA 2ZKUA 3V1OA 4XPCA 1JLQB 2UVWA 3IS9B 1QSLA 3PR4A 1SKWA 2VG5B 2HHVA 3E01A 3H4DA 4CF9A 4N76A 3RB0A 5DQIA 4WFYA 4NLGA 3AA2A 1XI1A 2XO7A 3KD1E 3VQ8A 2HHWA 2Z1HA 4DL5A 3AO2A 4I2PA 4CIEA 1BQNB 2YNHA 4EO8A 3IGNA 3AVFA 3NH2A 3HVWA 3U6FA 1RDBA 3E01B 5J1EA 3OLBA 1ZBUA 5KI6A 1NNDA 4FM2A 1A5WA 4MKAA 3Q8PB 2WTFA 4F3TA 4CF8A 1WSJA 3RAXA 3AO5A 2VG7A 3EYZA 4I2PB 2YNHB 3BQ2A 1U09A 3RTVA 1QUVA 3AVBA 4OGCA 3ZT2A 4ZPBA 4EBDA 5J1EB 4EZ9A 3VA3A 2D3UA 2P51A 4DS5A 4DTUA 4MKBA 1KFDA 4CFDA 2VG7B 3OL7A 2IS3A 1HQUB 3O4NA 2R8GA 1IM4A 5FRMA 2FBTA 2XY6A 4F4ZA 4FBUA 1NK8A 3NE6A 5KGXA 1S0NA 4K50A 3BSNA 1HNVA 4DL2A 2AQ4A 4KE5A 3CO9A 3PW7A 3ZT4A 2G8VA 1GX5A 3GIKA 4CF0A 4EEYA 3OYBA 1FKOA 2X6NA 3KKSA 3SJJA 4B9UA 3TAGA 2QXFA 4CJVA 1CLQA 1HNVB 4RNFA 1VSLA 4CEAA 1BISA 2R2TA 5E41A 1FK9A 4BE2A 3E51A 3T5JA 4DS4A 1FKOB 4M3YA 1L3VA 3NAEA 4KHWA 5DGAA 2VA3A 4EO6A 3G6YA 4M41A 3SPZA 3AO1A 1FK9B 4NCGB 4QWAA 1C2PA 1JL1A 3HSTB 5JS2A 4CEFA 1XC9A 3S3MA 2GBZA 1U4BA 1Q9YA 3FQLA 4DF4A 3KTQA 1RTDA 3MF5A 2HW3A 1W25A 3GILA 3SV3A 2PYJA 4K8XA 1ASVA 4CEZA 1IKYA 4NLRA 2D0AA 4KHRA 2D0BA 1RBSA 3VQ4A 2P1JA 2W42A 4J2AA 2HWHA 1RTDB 5F8MA 1SL1A 4RW7A 2Y1JA 3BDPA 4HUEA 4YP3A 1L3UA 1U48A 3WNFA 2Z1GA 1IKYB 2WHOA 2C2RA 1BIUA 4Z4EA 2AX1A 2IGIA 4FXDA 4KTQA 3AVHA 5HRRA 1ZTTA 3QETA 1BHLA 2HB5A 4BWMA 4RW7B 3NF7A 4NLXA 5KT2A 4FJJA 4FJ5A 4BE1A 1RCHA 3DRSA 4OKEA 4M3TA 3QGHA 1KVCA 4QWBA 1U45A 1EP4A 3PO4A 2OPPA 4CHQA 4F4YA 2YKNA 1IKVA 2HVIA 2YKMA 3U3YA 3K5MA 3KHLA 4O4GA 4I9QA 3BREA 4O55A 4CJRA 2BR0A 4LD0A 3FRZA 2E6LA 5KFSA 4W5TA 2RN2A 3L3VA 4FJKA 3SI6A 3DRSB 4O3QA 1NKEA 1S1UA 1EP4B 4PA1A 2OPPB 3ICLA 4JV0A 1VRTA 2YKNB 1IKVB 2YKMB 5C5JA 3PZPA 5EWGA 4CE9A 3I5BA 5KFLA 3DLRA 2JEGA 2YNGA 4HCBA 3OHBA 1TK0A 4H4MA 2V0NA 1S1UB 1LWCA 4CK2A 1I6JA 4HKQA 4DU4A 1D8YA 3KLIA 1NOZA 3AV9A 3D45A 2R8IA 5FDLA 3EPIA 1VSFA 3GIMA 3V6JA 3T1AA 2YNGB 3BGRB 1SV5A 2R2SA 4H4MB 1JIHA 4WFXA 1TV6A 3NCIA 4CFCA 1LWCB 1Q9XA 1D0EA 4Q8EA 3ZSQA 3PW2A 5KFJA 3KD5E 4DFJA 3KLIB 1LAWA 1CXUA 4H54A 1RT2B 3C95A 4B3OA 3S9HA 2FLLA 4O3RA 3LP0A 3BJYA 1Z26A 2Y1IA 4IR9A 3HVTA 3CJ0A 1TV6B 4E7IA 3CJ4A 4QWDA 4J2EA 3F73A 5EUHA 1WSHA 3QZ7A 4Q8FA 4CJWA 4B3OB 1TKDA 4NLTA 3RR7A 2VA2A 3I8DA 3LP0B 1RT4A 3HVTB 3KKRA 3CFRA 1WSFA 3OYIA 4TQRA 4ECYA 3HJFA 1HYSA 4BE0A 3K59A 4EYHB 3KNAA 4FJGA 3DLHA 2YNIA 3LPUA 4DTMA 4M3WA 4LSNA 3L2VA 2QKKA 3Q8SB 1RT4B 4JS5A 3V9XA 3M8QA 2OZSA 4Y34A 1HYSB 4PY5A 5KFAA 3TABA 4B9SA 4W5NA 4F50A 4QCLA 3L2WA 3VQAA 2YNIB 4BDZA 4Q5VA 4LSNB 2JC0A 3KJVA 4ID1A 4BACA 2I1RA 4DSJA 4GVMA 4KHNA 3SYZA 2DTUA 2ATLA 4FK2A 4KPYA 5HP1A 1HYVA 3M8QB 1ZETA 1ASUA 4NLPA 4E7KA 4MH8A 4R0EA 1JLFA 4DQQA 2HWIA 4ECWA 2IM3A 3AA3A 5KG6A 5HLFA 3KJVB 3EY1A 5KFNA 4CJLA 2DFEA 4E7LA 1KHWA 3L2UA 4ZHRA 5HP1B 4R8UA 3CFPA 4W5OA 4RZRA 4ED8A 4PWDA 3PX6A 1JLFB 1S4FA 2IC3A 5KT5A 3NF6A 5HLFB 4FBTA 4KAIA 3OVNA 1X9MA 4EBEA 1T05A 4RW4A 2BGGA 4E89A 4ZHRB 1K1SA 4M42A 3D0PA 3KLHB 3LAMA 4Z4GA 3MEEA 4PWDB 1JLAA 3DLGA 5KFFA 4FLVA 3RBEA 3SPYA 2IC3B 2HNYA 1O1WA 4J9KA 4ZMMA 3UPFA 1N4LA 2IJNA 3KHHA 5KFZA 2G8IA 1JLCA 3MR5A 3QNNA 3MEEB 2AGOA 2Q3SA 1JLAB 1GX6A 3DLGB 1KRPA 3SQ0A 1IO2A 1RTJB 4F3OA 3UQSA 1NK6A 2HNYB 3RR8A 2W9BA 1L3SA 2D7SA 5EDWA 1JLCB 3CJ2A 5EU7A 5EWFA 4K4XA 3MAQA 1NK7A 4WFZA 3IGVA 4NLVA 4NLQA 1S9EA 4E7JA 2KQ2A 4LH5A 3CYMA 3I0RB 2HHXA 2W9BB 4KI6A 4E1NA 4I7FA 3MR3A 2AU0A 1GOBA 1KLNA 3V6DA 2E4LA 2C22A 2JGUA 1TK8A 1S9EB 5DGBA 3ZT3A 3BQ1A 4IH6A 4DFMA 2XHBA 4I7FB 3AVGA 4Z4HA 4Y3CA 4R5PA 3V6DB 1HRHA 3SUOA 1RDRA 4Y1CA 3NDKA 3C6UA 3DLEA 2JC1A 3CVKA 3VQ7A 2P5OA 2HNZA 2FVSA 2YNFA 2FVCA 4ECVA 4YR0A 2R7YA 2KZMA 2YV0X 4MIBA 1RYSA 1KVBA 4LQ9A 2KFNA 2Z1JA 4R5PB 3MFHA 3DLEB 3C6UB 3GV5B 1QHTA 3M8PA 5JXSA 1S10A 4ZPAA 4I2QA 3KMQA 4J9OA 4JV2A 2C2DA 1RT6A 1VK0A 1N6QB 3CM6A 4CFBA 1FKPA 3TAQA 1KSPA 4O44B 1R0AA 4XIUA 3M8PB 1S0MA 2GIQA 4I2QB 1RBRA 5FROA 3QIOA 3RRHA 1S1WA 4FJMA 3BR9A 1VSJA 5I3UB 3T3FA 1RT6B 2AX0A 1UWBA 5JUMA 1ZTWA 3PHEA 3RAQA 4URQU 2F8EX 3V9ZA 1FKPB 1VSDA 3HVAA 1R0AB 5KFRA 2ASDA 4ZVGA 3CDUA 2ASLA 5CYMA 4CERA 1T03A 5KFYA 1S1WB 4FLUA 4FJ8A 4IQXA 3DLKA 4IRKA 3OYMA 4MFBA 1UWBB 2FLNA 4O0IA 1D9DA 3PVXA 1S49A 1BQMA 3DMJA 3CJ5A 4TYBA 3ZSYA 3RWUA 1Z25A 1J53A 1A5XA 4CGJA 4GC6A 3MR2A 2BQUA 5CYMB 1S1XA 3KK2A 1T03B 5F9LA 1NK0A 4URGA 3DLKB 1CZBA 4MFBB 3SQ1A 4DL3A 1UA1A 3O3HA 1BQMB 3DMJB 3LP2A 2FJWA 4J9QA 2IBKA 3H59A 4OKJA 2AGQA 1S1XB 3KK2B 1JLGA 1FXXA 4RW6A 1SH2A 1I39A 4MQ3A 2FBXA 4CF2A 1RBVA 1YTAA 3PX4A 2X6SA 3QEIA 3HO1A 1X9WA 3LP2B 4F8RA 4ZP7A 3TAMA 4EBCA 4KB0A 1CZ9A 4ED3A 1JLGB 3LALA 3I0SA 4RW6B 2B6AA 1JKHA 4CJEA 1RBTA 4K4YA 5KFIA 2J6UA 1CXQA 5KT7A 1BCOA 1IKWA 4B9LA 3TAMB 4YFUA 1S97A 1U49A 5C25A 3ZSZA 3I0SB 3FDSA 3F9KA 2B6AB 5KG2A 1JKHB 1BCMA 1D1UA 5HROA 1S6QA 3IAYA 1IKWB 4MK7A 1S48A 2WK4A 2HMIA 4L8RB 5KFTA 4IKFA 1TL1A 2OA8A 5C25B 4FS2A 1S9FA 2F8TA 1T7PA 4O3NA 2EC0A 3HP6A 4CJ5A 2KZZA 4TY9A 1ZBFA 3KIOA 4FJ7A 3I5AA 5HROB 1S6QB 4M3RA 3N6LA 2HHQA 4YMEA 4MK9A 2W7OA 4DLGA 2HMIB 3FSIA 5L1IA 1TL1B 3ZSOA 4XO0A 3AVAA 3D5MA 4AHCA 3K2PA 2R2UA 1QSYA 3ZT1A 3LZIA 5KG3A 4OPKA 3AVKA 1WLJA 3DOKA 4KTZA 2ZD1A 4O0JA 4EP4A 1W9HA 3KLFA 4F4WA 1XR7A 3NMAA 2J6TA 3QNOA 1IH7A 3PO5A 4DL6A 3TR8A 4NCAA 1XHZA 4ELTA 3O4QA
chains in the Genus database with same CATH superfamily
3NGIA 1WNSA 2CKWA 3R6MA 3BBCA 4KREA 4DTPA 4XDDA 3D6FB 2UXDJ 4JI8K 1SL0A 4DV1J 1FCAA 1X0PA 3N4PA 3IFRA 2FC0A 5B0DA 3V9UA 2RS2A 4NLYA 3VF0B 3OL6A 2AYGA 1JWWA 1RAJA 1SKSA 5KFOA 3EO3A 5BJRA 3AHPA 3CXCR 1N33F 3RB3A 5L1KA 4CJTA 4R25A 4ZVSB 5IWAK 2RF2A 4WF9Q 2HFOA 4LFBF 2WVDA 1ZPWX 5C7PA 2UUTA 4BVOA 3TOQA 4HUGA 4DV4J 2WVEA 2RF2B 1M5VC 1V5IB 1WOPA 4XTTA 1VC6A 5ADXA 3QLHA 3OTOJ 2K3IA 4J9MA 2QJ3A 1N5TA 3I32A 3SV4A 1J54A 2RU3A 2ZH5A 4IRDA 2N3LA 2ILYA 3D2EA 2EWHA 1ZC6A 1T44A 4CRJA 1IBMK 1IN0A 3KWGA 4IFYA 1RISA 4DUZF 3K5NA 2V67A 3QLHB 4Z4FA 1AROP 1R6YA 2FHJD 2DGXA 1GLAG 4IUFA 4CFAA 4A8OA 1T94A 3CB4A 3M2VA 4FJLA 1Q8IA 2HKEA 1JK9B 4IFYB 3EVWA 2VASA 1WDDA 2GZOA 5CAAA 4DV2F 4CGIA 2LECA 5LY3A 3M2VB 4XK8C 5ITHA 4JI0F 5HQMA 3LDSA 5KTQA 1F60B 1RILA 4FLTA 2D5RA 1Y97A 3D2FA 1U25A 1RK8A 3HSDA 3KLVA 1TL3A 4DLEA 1ZAXA 3LGHA 1Q1KA 3CMEN 2OMOA 3IA0A 4ZN3A 2B43A 4X66K 1Q8BA 3A4TA 4LR8A 3FCWA 2VHGA 1IJJA 2VQEK 3CQ8A 3D2FB 4USHA 3LO3A 1TL3B 2G13A 3W8PA 4CJPA 2ZZMA 1WUUA 3VQTA 3TJAA 3J7A1 1U1OA 1BIZA 4H4KC 2JRSA 4IZ9A 4ZPVR 1BMQB 4LR9A 2A1SA 1BGXT 2R8KA 1N54B 4ZPDA 2F96A 4DR3F 4AL6A 5BREA 1S4EA 1N33K 5KPRA 1GOAA 2OSRA 2XS2A 1G2EA 1M5OC 4H0YB 4J9RA 4RNNA 3PW5A 3W1YC 1M0SA 4DZDA 1JCEA 1VRUA 4ZOSA 3FBCA 2YX6A 4CQ1A 2OEKA 1LWFA 3G6XA 4LFBK 4CHOA 2JFKA 2DRBA 4KHUA 4ECUA 1YHQS 3I33A 2J7WA 2O5DA 1VRUB 1TTHB 1HNXK 4DTSA 1X7VA 2V9WA 3HM9A 1LWFB 2QRRA 3AQPA 4AM6A 5IZHA 4WK3A 1RA6A 2O4GA 3VGMA 2OYQA 1T9VA 4DR7K 1FJGJ 2F9JA 3U7JA 4DR6K 3OL9A 3CCVS 4DUZK 2ILZA 5A8KA 2XMAA 3S6EA 4AQYK 3OYDA 3TX0A 4DTNA 1HMVA 4LFAJ 3HVRA 1CULA 2MKIA 3HK2A 2HS0A 2ASMA 1VSKA 4ED0A 2HHPA 3MMBA 5A8KB 1LW2A 4KKOA 3D3CJ 1SPBP 3MM5A 1SQEA 1HMVB 1CULB 4ZA1A 3G10A 2JWNA 3W2VA 3HYFA 3EZOA 1NJYA 3VQQA 1VHFA 2IY5B 1M5SA 2BH1A 4BRAA 2HSTA 4OV6A 2C1EB 3MMBB 4KKOB 5AXKA 2C3PA 2VBXA 3OTCA 3MM5B 4PRFA 2VGMA 2BRLA 2NXNA 5HVHA 3W2VB 1VSEA 1L5UA 1Q79A 4L73A 1TVRA 2VBWA 2HAFA 1VQ8N 2GFFA 4B1YB 2YI1A 1Q0NA 3TANA 3NGSA 4N77A 2OPQA 4TSXA 3FVYA 4DQIA 1UMJA 4I0WA 2RDJA 2ZHAA 1GXLA 4J5OA 3NHGA 1FFWB 1U1PA 1TVRB 2OSQA 4TQSA 3SSSA 2JVRA 4CLSA 3BZKA 3N4QA 4CGGA 3DLLL 3PEJA 2BRKA 1SAZA 3EDQB 5ETVA 1UAWA 3UFCX 3W7BA 3R5BA 4LREA 5KFHA 4FOEA 4BCAA 4DX8H 4X4SA 3DDIA 3S01A 3UW1A 1C1BA 4PL7A 4NLDA 4ZITA 3KOAA 3MHYA 2DO0A 2GW8A 4DU3A 2LFVA 3G2XA 3KLEA 1ZBTA 2MKCA 2ZKTA 3SBMA 2QLJB 4UTGA 2GEMA 4U95A 4DSIA 4F7VA 3B6OA 1GMWA 5B0AA 4EZ6A 1A5VA 4LF2A 5HI7A 3KUGA 3AB4B 1C1BB 3B8AX 2D3OR 3WXLA 3DXSX 1B7YB 4QIEA 4ZP6A 1SKUB 3O44A 3KLEB 5FD1A 4FM1A 4WFNQ 3OS0A 3GIRA 1URRA 3P83D 4OX7A 4RX6A 3CM5A 4BY9C 1N56A 1U2VA 4AM7A 4CHYA 2O01C 2OPSA 3F44A 3VGVA 4PCQA 2RUGA 4OPHA 4CEEA 1JL2A 1C6VA 5GADI 2W2NP 3BSCA 3NVKA 4G65A 4H0OA 4K4ZA 1O8BA 1Y10A 2BV3A 3CCLS 1NJWA 1WC1A 1Q18A 1U2VB 3EKUA 2OPSB 1W2IA 1W97L 1IBLJ 4RNMA 4FYXB 4CIFA 2F8SA 4OLPA 2FLOA 1U02A 2HAIA 4WZMA 2XBPA 4EK2A 4CW7B 5IT9O 4C8NA 2E1YA 4DN0A 3GOIA 3OD2A 4ECZA 2P9EA 3CJ1A 1ITGA 3G0ZA 3VEVA 1NB7A 3ZX3A 3ENWA 1HWUA 4ANEA 2I7PA 1RHRB 2RQCA 4IOAQ 4H4OA 2GO8A 1QAYA 2MQMA 3EX7B 2YJEA 4OZJA 4FYDA 1TAQA 1IG8A 5JS1A 5KG4A 1KNZA 2JEFA 2IOCA 1XHXA 2WB4A 2BOAA 2HBRB 3LDQA 1NHUA 4JI7F 2LKZA 2NYIA 2PA3A 3SZ2A 4H4OB 4KHPF 1KC8T 3MN9A 1P8GA 5KFXA 3OYLA 2U1AA 5I4MA 4GW6A 2M4MA 4ILJA 4YOVA 4I68A 3PRBA 4M1KA 1SJ4P 5ETSA 2BJ3A 5HL7L 2LCWA 3TAFA 1MW7A 1H2TZ 3GFYA 4BRCA 4NCGA 1IBKK 1RKIA 2VWKA 4IWVA 5KQDA 1HA1A 3CJRA 4Y2CA 2J0WA 1NGFA 1Q95G 1WC3A 4ECTA 5AJ3F 2LA4A 4ANCA 4DV6J 2HHHK 2MLXA 3QFHA 3ALYA 3VEZA 4F26A 1NK4A 4PG4A 2HHUA 1MWYA 4OI0A 4ZVQB 2O8DA 5HRNA 3NRBA 1VQ6S 4CHZA 2QLXA 5KFVA 2CG8A 2HRYA 4IJAA 4HTUA 1UFLA 2O8DB 3EPGA 5DG9A 3HMJG 9ATCB 2ZM6J 2HURA 2ITGA 4NLSA 3J80O 3SQ4A 4YB7A 2KH9A 3CULA 1ACMB 2WOMA 3BSOA 4DV5K 3UD4P 2E7WA 2A41A 1S1TB 1NAQA 2A3JA 2VJVA 2VCPA 4UQGA 3HKWA 2UVUA 1WN7A 4BC5A 3NH0A 1AB8A 3A5NC 3GTYX 3M9MB 2JL9A 4HH1A 4M94A 2BANA 1VFJA 2FPHX 2PFUA 3KWIA 3L4QA 1RAGB 2WOMB 1FO1A 5C24A 4USJC 2HQDA 3GBTA 4HUFA 5L46A 2GGPA 3BGRA 2UUWA 4H0XB 2IDEA 2OH2A 4NRUA 4DQPA 4F4XA 2BANB 3UN5A 3DI6A 5IOLA 5C24B 3BGFA 2XC9A 3RZAA 4DCJB 1WOSA 4NLUA 4F4KA 4CHPA 2GGPB 1VLOA 5AZIA 4KHPK 4B02A 1W0HA 4H0VB 2D69A 4ED7A 3DI6B 4FK0A 3HOTA 2G8HA 5ETRA 3M8WA 2W40A 3H5SA 3WXMB 5D6GA 3KK1A 3ID8A 4FNIA 4LF4J 4R79A 3I96A 2DGSA 1E6YB 3EZUA 4LIWA 3QWUA 1HNWF 3MEDA 4BRLA 2J9DE 4LQ3A 4BHQA 3KK1B 3V6HA 2HFZA 4DG1A 4USTA 3QMLA 3CIZA 2EC2A 4ZTFA 3MEDB 1I51B 3F41A 2XCAA 3TARA 3ZZYA 4ECSA 5GVQA 1KVJA 3N01A 4NA1A 4W5RA 4WU2A 1RYRA 1D8ZA 2GUIA 3D1QA 3G86A 3MPYA 2OJ3A 4DG1B 2C2EA 1RTIA 2QI2A 3VQDA 5LJVA 1K0VA 4OZLA 2GO9A 5C42A 4GMJB 2APOA 4GO5X 3TRGA 2QEXS 4M5JA 2YKQA 2XNQA 2WW4A 2P6TA 2PMZD 3MWTA 1ESVA 4F2SA 1RTIB 1NEEA 4MTPA 5C42B 3RG6A 2MSSA 1DURA 4RBTA 4IO8A 1M1KO 4BLGA 4G1IA 2FVQA 3VWSA 2YWGA 4O0NA 3ZEUA 4Q43A 3ZSXA 1UPMB 3UKRA 1U2RA 5AQLA 2V68A 2Z8QA 1WBBA 3KLHA 2FJVA 5SUHA 4CJ3A 3E9OA 3PW0A 3GE9A 3J7YP 5MAOA 3U1MA 4TLRA 1FD8A 3ZEUB 4N8NA 4JKGA 2LU2A 3UKRB 2L41A 2FY1A 3DXKA 2BE2A 4BR5A 2G8KA 3NGKA 2NPFA 4CZKA 4ZLPA 2QA4G 3N6NA 4CNYA 3I4HX 4GVBA 2JEIA 1O5JA 1RJJA 2MKHA 1VYAA 2RT3A 2RS8A 4JKGB 3TAPA 1U2FA 1HPZA 1KEKA 2BE2B 1KP6A 2HHSA 2CJQA 3JTNA 4GVBB 4OZ3A 4Q2MA 5KFWA 4LF8J 2MZQA 3J80U 5CZ2A 3HL8A 2DGWA 1HPZB 4PWUA 1WELA 4C1NI 2V2KA 3WQUA 3O08A 2I5JA 1YHQN 1U47A 2FGCA 1KQGB 4ZVFA 4AHUA 3VEWA 4Z2XA 3NFAA 2E1ZA 3IWXA 3ENHA 3SAGA 3AJ2A 4A8MP 3LP3A 2F40A 4OZ0A 4YR3A 2XYPB 1M1KT 1HQEA 5HMWA 3HZGA 3MI7X 3QYYA 3CDWA 5KFKA 2I5JB 1HNWK 3DGPA 5AQYA 2DNOA 3C8YA 4IFVA 2HGMA 1VDHA 3M8SA 3CCJS 4CJUA 1WAFA 3TVYA 3SQOP 2LVWA 2KVIA 1B9DA 4BBYA 4LRAA 3KUHA 4DQSA 1S57A 1HQEB 2ZH6A 4WPAA 4OYBA 3DGPB 3M6VA 4CHNA 3PXGa 4IFVB 3SAHA 1FVQA 3ZTRA 1AFIA 3TA2A 1VMBA 3CC7S 1JX4A 3TQEA 5FIIA 1Y4ZB 4DJBA 3NF8A 5E0OA 1MA9B 4ES2A 2FBYA 3EVMA 2CGJA 4DWIA 2A10A 3PUFA 4ED5A 3GFXA 2NNWA 3VQBA 5GAEP 3H40A 5I3QA 4PKIA 2I0XA 2CYYA 2V51B 2OTLS 2Q66A 2KVQE 2EHGA 2KRBA 3VAGA 3OYNA 2P9SA 2HHTA 3FZBA 2UUBK 2VG5A 4E0DA 1T3NA 4Z4CA 4PUOB 1VQ9N 1XIQA 1IG9A 4OI4A 5CR4A 2P2CB 4DSFA 2WCXA 5HQLA 5M2RA 4JI2F 4XPCA 2UVWA 2P9SB 4NL5A 3PR4A 2VG5B 2GTDA 1JNZB 2HHVA 4CZGA 2L3MA 2VC1A 1VQKS 1FE4A 1T9XA 4N76A 4CF9A 1CG2A 4WFYA 1XI1A 3OBYA 2XO7A 4M5MA 4DL5A 3AO2A 4RTFD 3IGNA 3NH2A 1WBDA 5CH7B 4B3MK 3A5OC 2YQ3A 4XH5A 3OW2M 1RDBA 2DHGA 1M1GA 1ZBUA 3TSPA 5CYJA 4LF7F 2CDRB 1KVKA 5HMZA 3Q8PB 4Y6IA 2WTFA 3NNCA 3RAXA 4CZIA 3BQ2A 4PZVA 2VC0A 4EBDA 1E3MA 3CQXA 2Z0GA 1WHVA 2KRRA 1TFWA 5EXWA 4MKBA 1KFDA 4LF6F 2BUPA 2IS3A 1HQUB 4RU2A 3MX5A 2ZOFA 4DV0F 1HNZF 2QA1A 1WEYA 1S0NA 4HI2A 4KE5A 2CJYB 2P9LA 5M1OA 1P8ZA 3KJQB 1EZZB 3CCLN 4EHTA 4X4QA 2O8FA 3U1LA 2QXFA 1CLQA 1U6FA 3D3BJ 5EX0A 1BISA 4CZCA 2P9LB 4X4VA 3DU5A 4GRSA 4F4AA 5B0EA 4BE2A 2GMHA 1E4FT 4DS4A 2EFOA 3BKUA 2O8FB 4DV3F 5KQ8A 1Z05A 3AA8A 1EKRA 3AO1A 4BRGA 1B7FA 1XC9A 4YOWA 4DV7J 3S3MA 1NGJA 4WFAL 3NXZA 3KUEA 4DF4A 1HR0F 3TSQA 1S99A 1P9YA 3ENVA 5ETQA 4GKKJ 4I64A 1ASVA 2D0AA 1XQIA 1PYSB 4P2XA 1DT9A 2D0BA 5L38A 1RBSA 3VQ4A 2W42A 2ZNZA 1O6XA 2A2DA 1SC4B 2UUAF 1GMUA 4HUEA 3K7RA 2UUCJ 2L9NA 3WNFA 1NGIA 2F1FA 3HF5A 3AA9A 2WHOA 2C2RA 4GKJK 3BF1A 2MJUA 4DPYA 3RYLA 1BHLA 3FBEA 4BG9A 4B3TJ 5KT2A 2BX6A 1RCHA 3WXJA 5LMUJ 3WDOA 1KVCA 4H03B 1EP4A 1APSA 2Z56B 3CC2N 3IUCA 4CHQA 2HVIA 2M9KA 4O4GA 2MKYA 3M2UA 4LF5F 2ZITA 3BREA 3A1YG 4LF7K 4C3KA 3SBTA 1NSKL 4W5TA 4UY8T 3HSCA 1X3NA 4FJKA 4YDDB 2I6WA 2E1PA 5BN9A 1S1UA 3JSBA 1EP4B 3KDNA 1FNXH 1VQ5S 2VFRA 1VRTA 3PZPA 5EWGA 4CE9A 3M2UB 3N5BA 1SI9A 4OJ1A 2D1CA 4B3RJ 3I5BA 1DZ5A 2F9DA 2ALYB 1TK0A 4K2JA 4CNZA 1N0UA 1VQ6N 1S1UB 3F5TA 5G4DA 4FPBA 4DMZA 1VQNS 3J7AN 1KAYA 1Q4RA 4HKQA 1IV0A 5BRFA 2Y1RI 3D45A 1HNZK 3GWCA 3V6JA 3T1AA 4KGKA 4E98A 2PN6A 3DRXA 2NXCA 3ZNJ1 1N32J 1SV5A 1VBXA 4CFCA 2ZVIA 1W7AA 1D0EA 1U1KA 2BZ2A 3PW2A 5KFJA 1B99A 1X4CA 3CCSS 2LQJA 1CXUA 3PSIA 3CXCM 1RWOB 1RT2B 3CD6S 2HVDA 4ZDNA 3CCZA 4B3OA 3LP0A 4IR9A 2DB1A 4ZVTB 1XQSC 1OO0B 3EMTA 4NE9C 3A8KA 2B8PA 4Q8FA 4DV3K 4B3OB 2CAJA 5HAOA 2QWQA 3LP0B 1DARA 1B0PA 2WUSA 3HM8A 4F3MA 1MROA 1M5HA 3B6BA 1BO5O 2NRVA 1PJ7A 4BGBA 3OT9A 2E1AA 4EYHB 4K0KJ 1N36F 1HR0K 2YNIA 2BA9A 4DTMA 5HK4A 1NPPA 4LSNA 4CVNE 4LBPA 2QKKA 4F0KA 1U8SA 4JS5A 3TTDA 1GT8A 1GMWD 1U0HA 1MROB 1VQPS 2OZSA 2KN4A 4M7YA 4JV5J 5KFAA 4W5NA 4F50A 2CQPA 3VQAA 1SIWB 2YNIB 4P74A 4YDUA 2MZSA 4LSNB 2JC0A 4BACA 4DSJA 1KD1O 2DTUA 2ATLA 2POKA 4W92B 3O9RA 4KH5A 1U0HB 1ASUA 4NLPA 2W2QP 2O66A 4NPOA 2HWIA 2MYFA 4ECWA 2MY8A 4JKDA 4CTAA 2H4YB 4HT5A 2FZCB 3L2UA 4R8UA 1QDUB 4NXMK 4W5OA 3MM6A 4RUHA 4ED8A 2DR9A 3ZLJA 1TELA 3CD0A 4YHHF 1S4FA 4LF5K 3NF6A 1FWLA 2KJWA 4KAIA 4M7XA 2NSCA 2I7NA 2HZCA 3SCKE 4CTAB 4EBEA 4RW4A 2BJ9A 2BGGA 2VYPA 4M42A 2QM1A 3LAMA 2W41A 3MM6B 1VHIA 3A8JA 1NNEA 2FD2A 2DCLA 1XMOJ 5BR8F 3N9UC 2QEXN 2HNYA 3L7PA 3CMQA 4EUVA 4ZMMA 3FKBA 3BYRA 3MM8A 2V7YA 3T7ZA 1QTNB 2AGOA 2ZBQA 3BGLA 3W65A 2E2QA 5LJWA 2EWSA 2HNYB 2W9BA 4G6VB 1L3SA 4O5FA 4V19X 3BZCA 5A6PA 3MM8B 5EDWA 3KNGA 3CJ2A 5EU7A 4K4XA 5JLFA 2AEMA 2LA6A 4NLVA 4P2FA 1N34F 4ATNA 2CZ9A 2W9BB 4ZCLA 5KOWA 3NP5A 1KD1T 1QVFR 4KI6A 2D74B 4E1NA 1JXVA 1GOBA 1T0TV 4MT1A 5CZXA 3PYFA 2JGUA 3AB2B 2GHPA 1WTBA 1TK8A 1XNRJ 3EUNA 1HWLA 1Q16B 7FDRA 3BQ1A 2Y0SD 4NMLA 3CCUS 4EIAA 4DX5A 5DETA 1BWVA 1NJIT 1HRHA 3US5A 4NMXA 4JI0J 4Y1CA 3DLEA 2E5LJ 3CVKA 5BYQA 2A2CA 2YHWA 1N36K 1NPKA 4YR0A 1OVYA 1Q81O 3DLEB 5K8MA 1QHTA 2PT0A 3JQMA 2O67A 4ZIVA 2FJAB 4ZPAA 1BOTO 4I2QA 4OLOA 4ZKAA 4X64K 4JV2A 3VESA 3U1NA 3G6ES 2BW2A 2RRBA 2ZDPA 4F0HA 4USWA 1VK0A 4DR1F 4C23A 4X62K 3JXUA 2FF3B 3CM6A 2Y3YA 4CFBA 4TLQA 3FSYA 1X5SA 2E2OA 4XIUA 3JAMO 1H6KX 4I2QB 1RBRA 2XHCA 1RFQA 5I3UB 3T3FA 3CDBA 2AX0A 1ZTWA 2XLIA 2YWHA 3RW7A 1GLFO 2F8EX 2QGFB 2WAQD 3MM9A 5KFRA 2ASDA 1V5VA 5GAHP 2LEAA 5CCMA 5CYMA 4FJ8A 1FFGB 3ONQA 4OHXA 2QL9B 1U6BA 2FLNA 2JZ5A 1CZAN 3CC7N 4A47A 4USVA 3CJ5A 4TYBA 1RUSA 4X4RA 3TA0A 3R8EA 3MM9B 2VQFJ 3ZX2A 1J53A 2XNRA 4XH1A 3R2DJ 1CJKA 2IA0A 3MR2A 2OAUA 5CYMB 3KK2A 4P75A 3AD7C 3AARA 2BUNA 1CZBA 2IYIA 3EXCX 4KR0B 3CC4S 4JI3J 2IBKA 1IXKA 4DV4F 1CJKB 3DCAA 3ETMA 3KK2B 2OTLN 1JLGA 4RW6A 4JYAK 1NGEA 4Y0FA 3T1HK 3J8AA 4MQ3A 1EHWA 1YTAA 3OTOF 3AGRA 2GJIA 1VS3A 3TAMA 1NHKL 4BR4A 1ZPVA 3GPAA 4OHVA 3O9TA 3OXLA 5JVGL 4ED3A 5AXLA 5KPTA 1JLGB 4RW6B 2FHOB 2AEJA 4LF9K 3N0VA 2J6UA 1WACA 1CXQA 1YWXA 4NWBA 1BCOA 1SQGA 4K8RA 2XLJA 3TAMB 2E5HA 1S97A 5F3ZA 4ILMA 2OHDA 3GG4A 5KG2A 5HJXA 2HRUA 5LMNJ 2XSFA 4MK7A 3QSIA 2HMIA 4L8RB 4IKFA 2QLBB 2GX8A 1S9FA 3C2PA 2OTJS 5I9EB 3KIOA 1HBMA 2CQ3A 1BWFO 3I5AA 3JTPA 3GCXP 4M3RA 1FDAA 4IXCA 3NNHA 2DD8S 2HMIB 4NX9A 4IOCL 2QWNA 4XO0A 1B3TA 2ROEA 3VAJA 3CJ7A 1LFWA 1XEZA 3D5MA 2PI4A 3F2KA 4AHCA 2EKNA 2R2UA 1HBMB 1YVNA 3ZT1A 5KG3A 4DR1K 4MLEA 3SAFA 3KLFA 1XC3A 3JQJA 2ZJRL 1WKLA 3CQYA 3TW0A 4MKYA 2DEIA 4ES3A 3N28A 2UXDK 3O4QA 4DV1K 1RA7A 3O6QA 1VBYA 2UVRA 1ATNA 2BJ1A 1W7WA 3KLFB 1VQ4S 4B08A 3NS7B 5AQTA 4LSLA 4UOHA 3PIPL 2E7XA 3C46A 3QERA 3H2VE 4AHVA 3N79A 1HX1A 2RSQA 1X5PA 3ZSVA 2CPJA 2F4VJ 4LSLB 3IWLA 3EGWB 3JAMU 4IOXA 2HFVA 3CERA 5BR9A 4NXNJ 4AILC 4FVUA 2UXBF 1S9GA 3DU6A 4OX6A 2CIMA 3PJXA 1NO8A 4QWCA 1RT3A 3E2EA 1WG4A 2DK2A 3R5DA 1BUPA 3HI9A 2B4UA 2QT7A 3WXKA 1EX8A 4MO4A 2JH3A 4MO5A 1FJGF 3I56S 1S9GB 3ISNC 4KJIA 2Y1LB 2W8LA 1F3FA 1UAXA 2AJ4A 2XB2D 4CECA 1RT3B 1DQ9A 1HW8A 2G0IA 2J76E 1KFSA 3CEDA 2Y8YA 1MMLA 4FWPA 3UVJA 4CLLA 3UN2A 3Q7BA 1RWMB 5F8IA 4FSVA 2ATCB 2N7YA 3THXA 3BSAA 3C3LA 1U04A 5FPDA 4YOYA 3DLBA 1NGCA 1OVQA 5AQNA 3UVJB 5GAGU 4ZVHA 3RRGA 4RNHA 4CIOA 1NDLA 4RCHA 5AQRA 1MWZA 1YVUA 2PO4A 2ZUAA 3ZTQA 3PKMA 4BDYA 4M95A 3TZXA 5KOXA 4EYIB 1RAAB 3FCVA 3ZSWA 1QE1A 2ZH3A 2YWEA 4QW8A 3D54A 3W0LA 4FWLA 2NRRA 3FBBA 4DR2F 3AQOA 3KKFA 1TFYA 3TSUA 1U8WA 1VQNN 2D0CA 3HDSA 5CZ1A 2BJ8A 1QE1B 4DR4K 4MLHA 1HI0P 2J8SA 2VZ9A 2NCKL 2PEBA 1XK8A 1NGDA 1C0TA 3HHLA 3M32B 2MZJA 4ELVA 1QSSA 2Q0UA 3CCSN 4A8YA 4LUBA 1A9NB 4ZTJA 2XZDB 3P38A 1QAIA 1VSMA 4C6AA 3T9NA 3CW2C 3E1YA 1EXQA 1C0TB 1EKEA 1YJWS 3NAHA 2D1KA 5IV4A 5CHIA 2CUYA 5D0EA 2F4FA 2KT5A 5AQHA 3VQEA 4M63C 3WIUA 2W8KA 1C0MA 2B7CB 2H48B 1VQOS 2SXLA 2KT2A 4CJ4A 1VCTA 4M5IA 1JXLA 1RDDA 4FYVB 4OYMA 4CZMA 4ZPWR 2RD5C 4BG8A 3IR6B 2CG4A 4O5BA 1HL6A 4FS1A 1OY9A 1WI6A 2RPIA 1XR6A 2VH7A 3C6TA 1VQPN 4WQ5C 2UZAA 3RMAA 2Z1IA 4NYOA 5KFMA 1S0OA 4FW1A 1T05B 3JS6A 2AKWB 1SC1B 3C6TB 3NMRA 2NZCA 1IBLF 4LFAK 1GLCG 1ELOA 5DDOC 2OZMA 2IJFA 3ZT0A 1WG1A 1AUSL 4Z0UA 3A2FA 3HKZD 1C0UA 2A6OA 2F8MA 4FJ9A 4L76A 4WJBA 3DJCA 3OYKA 2JLGA 1D4XA 2MKKA 2CQ0A 4WYBA 1HWIA 4FK4A 1WI8A 2WSEC 4OI1A 4DSLA 5DG8A 3CJCA 3WNHA 2ZBCA 5F0WA 1C0UB 3SBGA 4W90B 1X9SA 2K7JA 1G15A 2GQ2A 3RU0A 2GAGC 3E66A 4A8KA 2CQHA 3EJMA 2PEHA 1WHXA 1IM6A 4CO5A 1FXRA 1YTUA 3SIPB 4YORA 2D9PA 4WTOB 4O23A 5F1XA 1YZ7A 4JNEA 3CCRS 1K1QA 1NHVA 5HRPA 2C2NA 4NEZA 4TYAA 5AQZA 4NEYA 4KV8A 4ELUA 4BRNA 1UVLA 2RQMA 4EFHA 3VQSA 1RZMA 3HLUA 3MR6A 1KLMA 2J7KA 3AOBA 2MXYA 3MDQA 1VSHA 2PD1A 1P27B 3W66A 4KV8B 1RGVA 4ZCKA 2YNFB 3ITHA 3TVKA 2YWKA 4M3UA 3GL1A 4B9MA 4W4MA 1KLMB 4IEEA 4L6V3 3HT0A 5HMXA 3N4WA 3A3NB 3QEXA 4YS2A 2QX0A 2QWMA 2Z2ZA 4DV6F 4MK8A 4C0OC 4CI0B 4FKYA 1RAOA 3DWLA 4WTYA 3CCUN 1PIEA 4YQWA 2IRYA 4J9NA 2CGKA 3BBFA 4C8KA 4P2SA 4DTJA 1OMSA 5L1JA 1GLDG 2B9YA 1OS5A 3MMVA 3M5RA 4EP5A 4N56A 4PR6A 1LFPA 1HYZA 2GIRA 2KFZA 4CJSA 3MUMP 4B1UB 3CJ8A 5A6WA 2WC9A 4H8KA 3Q8RB 4PYDA 1NGBA 4ED1A 2ZM6F 3M6GA 3KJNB 3UNYA 2F65A 5D8HB 4C7QA 2LLZA 2DPNA 2IYGA 3P5TL 2EG1A 1RWKB 4Y1DA 1BC6A 4DCPB 1IBLK 3UDVA 3MM7A 3CJAA 2XRIA 4RUCA 1XNQJ 5KG0A 1QVGR 1JJ2M 3MCSA 3HSJA 5AE1A 4WFBL 2KU7A 3Q89A 2Q1NA 5BRDA 4AXIA 1OY6A 1B9FA 2DHXA 4RUBA 4Q44A 1C0FA 1ZYQA 2V2QA 3MPUB 3MM7B 4WCEL 4M5DA 4BRDA 2QWPA 4FJHA 3CSKA 2X74A 4ECRA 2AEFA 2ATQA 1KS2A 3UR0A 3PACA 2G8FA 4Q7AA 4M5DB 1DTTA 1NK9A 3G87A 4FJXA 1D3WA 3T9ZA 1BLUA 3M2RA 4CK1A 1QZ6A 3CC4N 4LRCA 4WFAQ 4JKFA 3Q8QB 1RACB 3M7VA 3QT7A 4QU6A 4AHTA 1Q78A 1HKBA 1DTTB 3PY8A 5LL6d 2GCFA 4PG6A 2ROGA 3M2RB 1X3MA 2JVOA 3UD3P 1UL3A 4Z7CA 3T41A 5F8JA 3OYCA 4H5VA 1OH8A 5A0YA 3ZYYX 4XDCA 2DIUA 4ED4A 3DOMA 3R7SB 2K7KA 1RWXB 1F0XA 4ZVOB 3H2UB 4M45A 4HTJA 4ETZA 3D28A 3KHGA 2D0OA 1TMMA 1LAVA 4DV6K 3QBWA 4QIGA 2O1PA 5A0YB 4LRFA 3OFFA 1RU1A 3DOMB 2PDAA 4IFEA 3OV7A 2PIIA 2QFIA 5E3CA 4M5HA 1EO1A 1WNEA 2MQNA 1F9HA 3NAIA 2V4QA 2LQ9A 3K5OA 4LY7A 1UETA 1B70B 1SB6A 4C48A 5FLXY 2VL1A 5D4NA 2OTJN 4NCBA 3AVLA 1PCAA 2QK9A 2CWXA 4M8LA 1SXLA 4ISFA 4CF1A 3PW4A 4JI8J 4X4NA 4Z7YA 4UW2A 1NJZA 3QEPA 3L0QA 5BRHA 4WP8A 2N4DA 3D4JA 3BQ0A 2ZM6K 3GE1A 1WSEA 1OIAA 1WC5A 3VVTA 1YZ6A 4KHMA 1FRHA 1URNA 2O4IA 2ZNYA 3B4MA 4OLAA 4CBWA 4KHQA 3QGPA 1DKGD 4BGAA 2LU1A 2IPOB 3ENBA 2DRAA 2GUPA 3E3XA 3MR7A 5HVFA 4K4SA 2XI3A 5IWAJ 4BR0A 4OO1J 5DM7L 4TNOA 2NZTA 2K8GA 5M1FA 1SH3A 1WJ9A 3IO1A 5KRTA 3UNGC 4ZIWA 1SZ2A 4F04B 4OLBA 3NCRA 1AA1B 1VQ4N 3PJWA 3KK3A 4TU7A 2OANA 3H3OB 3NMUA 5KFUA 1HUXA 4U67Q 2C28A 1QAJA 4IO1A 1YI2S 1J9AA 3O3FA 2BJ7A 2HQCA 3KK3B 5ETLA 1C1CA 1IBMJ 5DLGA 3FEZA 3SSQA 2DGUA 3W8GA 2MB0B 4DSKA 5M1NA 3HT3A 1RCOB 1HBUA 2X78A 4CZHA 5L39A 4WYWA 1DFDA 3RAMA 4AXJA 3J7ZT 1C1CB 3HTVA 4LF4K 5C10A 4IJNA 2D3ZA 2PYLA 2P9PA 1H74A 2XGPA 4FDFA 2MQQA 3UIQA 4USMA 1BDGA 1HBUB 4C8OA 1M90O 4KIAA 3I56N 5J2NA 4KYZA 3B6PA 1HQ2A 3H2LA 4KHSA 3G82A 1XUPO 2Q0RA 1VLYA 2GNKA 3QJPA 3TWHA 2P9PB 1IJEB 3FR0A 3H1QA 1U0SA 1AT1B 3JTOA 4CGFA 4Q0BA 5J2NB 3P45B 3OFGA 3DC2A 2ZEJA 3G82B 5DQHA 4ED2A 4Y00A 3WIVA 1QD1A 3CG7A 2P9GA 4ZVRB 5HN0A 2C2MB 1TMJA 1TUGB 1UWAA 1VBKA 1FJCA 4FJIA 1WF1A 4Q0BB 4JKBA 3SI8A 2KFYA 1EX4A 5F2RA 3JYTB 4U8YA 2A6AA 5AZJA 3CTRA 3D0IE 3PLAA 3A3OB 1K6YA 4QAGA 3I55S 4OV1A 1OJ4A 3SMPA 5AQVA 1RHKB 5C15A 1S12A 1T6CA 1P1LA 3QGIA 2CQGA 1FWPA 1KVAA 1LXNA 5F3TA 3R8YA 2H51B 2GV9A 1C1AA 5AZJB 4AYBD 3HSGA 1AZSA 2UUAJ 4LR7A 1QHAA 1NDCA 1NBEB 3T1YF 1G1XA 5J2QA 4C9DA 3CCMS 2QWRA 4CH0S 1V3ZA 2B5JB 2QO3A 2ADCA 1NH7A 3QAEA 4JP8A 4X4PA 4G3IA 4QR0A 2C3OA 2IDOA 5HJYA 3H5UA 5J2QB 3DDKA 3GR0A 2RB7A 5ETPA 5F8GA 1PYOB 3ENOA 3MD3A 2B9XA 1BHNA 2I8EA 3S3OA 1HNXJ 1FNMA 2YXLA 1NSAA 3R2CJ 4N47A 2XLKA 2RQ4A 5GADP 1RTJA 2W9CA 1EQ0A 3SCXA 2H54B 4HDHA 2AJ2A 4C8MA 4LF8K 1F3VA 4U7CA 4DR7J 5M1PA 3IDHA 3DRRA 3M6XA 3BZQA 5EWEA 3L95X 5A8WA 4DTRA 2W9CB 4AQYJ 4BQZA 1NOYA 4MYUA 3I0RA 1KOHA 4IH5A 3GV7B 2B56A 4CO0A 3EGVA 3DRRB 3HXMA 2F9WA 4BRQA 3GONA 3SUPA 1NU0A 2FBVA 3W9HA 5A8WB 1ZA1B 2YPZA 2XI2A 4P6QA 3OS2A 3CJ3A 1BWEA 4AFFA 3IKMA 3OYAA 2R7WA 1H3DA 1XTZA 3V9SA 4B8CA 2MHEA 2VPZB 3WX8A 1HWKA 5HRSA 3THPA 3NS5A 4J8FA 2EFPA 1I94K 1OYDA 1TUYA 4DMNA 3R3TA 4UZCA 4HTLA 3LDLA 3AO4A 3NY0A 3NCPA 3OHRA 4YB5A 2QMXA 4X4TA 5DQGA 2WSFC 1PJ6A 1YJUA 2BM0A 3UCUP 2H9ZA 3OYJA 1N6QA 2LQ8A 1VAZA 1NSPA 2WZ1A 3JSRA 5K8NA 2QE5A 4DV7F 3OJUA 1HHQA 4HT7A 1QUPA 3WXIA 3ILJA 2QMWA 2FVRA 3L3UA 2R8HA 4G1QA 3FQKA 1GLEG 4GKKF 4RW8A 3KHRA 1K9MT 1WD6A 2QG9B 3PG9A 3T19A 1KR4A 3HP9A 1Q86T 2P5GA 5AQPA 2KT3A 3CCRN 1OYEA 2RE2A 2QLWA 2JDJA 1QVFM 1FRKA 2GMJA 1V3SA 4JRPA 1Y11A 1F2HA 4G1QB 1PC5A 4RW8B 2E5GA 3DOLA 4F9OA 2AZ3A 2H5JB 1X4DA 3G25A 1JLQA 1UOCA 2KXNB 4C0HA 2IRXA 2V4RA 2DR5A 2D0PA 5JVGQ 3TR5A 1NPRA 1VJWA 1K73O 3OR1A 4B3TF 3DAWA 3DOLB 3V1OA 1JLQB 4BC9A 5LMUF 2P9CA 5GMEA 4BRMA 4NO7A 5DQIA 2EXUA 1UFWA 3W60A 1FDDA 4NLGA 3VEOA 3OR1B 3KD1E 2OD6A 4FPAA 4EO8A 1DQAA 4GNIA 2VPWB 5J1EA 4FM2A 2DISA 2RDDA 4B3RF 4D3GA 2CH6A 4OGCA 4S0MA 4ZPBA 5J1EB 1H73A 3HD1A 3S41A 3VA3A 1LK7A 1VQSA 5A2QY 4IOCQ 4DS5A 4DTUA 5H9FK 5AQIA 2QW9A 1QQMA 5C12A 3O4NA 2R8GA 3O9QA 1KOOA 1N32F 2XY6A 3B4DA 3HRGA 2LXUA 2DHHA 3VCDA 3BEXA 1KQFB 5KGXA 1N34J 4K50A 4A48A 3BP8A 3L3CA 3T69A 2ZJRQ 3CIMA 3CI5A 3CO9A 2CPIA 1GX5A 3GIKA 2AV5A 2HK3A 4CF0A 1C4AA 1NLKL 1UW4A 2X6NA 3KKSA 3SJJA 3CE8A 3GG0A 3ZZUA 4Y2IA 2G0JA 2V8HA 4CEAA 3UDCA 5E41A 2O3DA 3VAIA 1YJNN 5FPMA 4CLPA 3PIPQ 3T5JA 5D4LA 2B8QA 5AQFA 1GEHA 4AUKA 3IBCB 3Q2SC 4FOIA 4AF1A 2BBEA 1IBKJ 1XMQK 3HHNB 4M41A 4K0KF 2AZ1A 1RAEB 3LDNA 4QWAA 5JS2A 1C2PA 1QQOA 3LH2S 2DGOA 3OTEA 3K89A 1RAHB 2HQFA 1U4BA 4I6YA 3KTQA 1RTDA 2FC9A 4JV5F 2EBEA 1WKKA 4JI4J 3VR1A 1W25A 3M30B 4QIWD 3SV3A 1HPMA 2PYJA 4K8XA 4CEZA 1IKYA 1S72S 2HHHJ 4DUYK 1JNRB 2UUCK 3KZBA 4X84A 4KT0C 1GLLO 4QBUA 4FWKA 5CE3A 1RTDB 5F8MA 2R7TA 1SL1A 4RW7A 3BDPA 4PABA 2Z1GA 1IKYB 4FL9A 1TL5A 3MCAB 4A62A 2JNJA 5IS2A 2EKYA 1RCXB 2AX1A 2LDYA 1JJ4A 5M1QA 1FEEA 3QETA 4RW7B 3NF7A 2J9EA 4NLXA 4FJJA 1UEKA 1O13A 2HLTA 3CJKA 1MN7A 2DNRA 3A0IX 5GAEU 5U47A 1MG7A 1U45A 2OPPA 4F4YA 2YKNA 2B4VA 1KQSR 3K5MA 3KHLA 4U8VA 2W4PA 4O55A 3MAAA 1XMOF 4CYUA 2RVJA 3CCES 4U96A 2RN2A 3L3VA 3HFKA 4P2MA 3CJKB 2ADBA 3VERA 4DV5J 4PA1A 2OPPB 2YKNB 1DQ8A 2E2PA 3C19A 2VPXB 3WT0A 1ZM9A 3MAAB 4CYUB 2JEGA 4UF4A 2V52B 3CGIA 2V0NA 3TX8A 1RBAA 3KG1A 4I4BA 4DU4A 1N32K 1NOZA 2OUGA 2QWOA 2CRLA 2L48A 3KDOA 2P8IA 1QZ5A 3EPIA 3O4WA 3GIMA 3BGUA 1S5ZA 2EBGA 4B3SJ 4BC4A 1Q9XA 3PFOA 4OX9K 5CQGA 3Q7CA 1CLFA 2YKPA 1FESA 2V34A 4ES1A 1NLVA 3S9HA 4UY85 4O3RA 1XNRF 1Z26A 2Y1IA 3EM1A 3CJ0A 3CJ4A 3Q83A 3MN7A 5EUHA 2ZHBA 4CJWA 2E5LF 2K06A 3TYTA 4KH6A 3RR7A 4CO3A 3I8DA 2Z2MA 4V19J 1YI2N 4USUA 4K0KK 3GCWP 2IMOA 1WSFA 4BR7A 2DH8A 3K0JA 1Z2ZA 3W64A 3KNAA 3BBBA 4CD1A 3QMQA 1VJQA 3D6HB 3L2VA 1J5EK 3P96A 3G71S 4YN3B 5C0YA 1KKHA 1R6VA 2WVCA 5IM0A 2J8AA 4B9SA 4QCLA 2CPHA 3L2WA 3HSZA 4BDZA 1GXUA 1GMVA 5D0GA 3IAM9 2CGLA 4EWTA 3GP9A 3R3LA 2J0XA 5D0HA 1HYVA 1ZETA 1IBCB 4OX8A 1U2CA 1F5AA 5IM0B 1CJUA 4MH8A 2FB0A 4DQQA 3CJTA 1H7WA 2R42A 1YKWA 3GU0A 2VDHA 1FRLA 4YOXA 3O80A 2GQCA 4AL7A 4E7LA 1KHWA 3QB0A 2B4PA 3CF5L 3K2YA 1AXQA 4FXWA 2V8VA 5B08A 1CJUB 4PWDA 3PX6A 5DM6Q 1NMNA 4F67A 2Q2RA 5AQOA 3OXGA 2EK1A 2VQFF 2MMYA 1YRTA 1X9MA 2YHXA 2NQPA 3M1FA 4Z4GA 3I55N 4PWDB 2UXBJ 3DLGA 2R7OA 4JI3F 3CD7A 1HLWA 3SPYA 1NU4A 4QYZK 4DBQA 2RHSB 5LL6Z 4QIVA 3KHHA 2G8IA 3BEGB 4E1JA 2EEYA 1N88A 1V4SA 1JLCA 1O51A 3MR5A 3QNNA 2XQCA 5HATA 2Q3SA 3DLGB 2ZFHA 1NDPA 3A5LC 2BW7A 1YQHA 2KKHA 5CA5A 3L7UA 3BO2A 2JLFA 2GVZA 3NOGA 1JLCB 3WC2A 4O8UA 4WFZA 3IGVA 1U1NA 3LUYA 1FXLA 1AFJA 5BXIA 4BREA 4ENOA 2WBNA 2D9OA 3MR3A 2GVZB 2AU0A 3HX9A 1KLNA 3V6DA 2LXFA 1SJQA 3VALA 4DV2K 2M0GB 5LMNF 2GWKA 1NUEA 2BMBA 4JI0K 2IJRA 1AUDA 3FUYA 1K8KA 3PYEA 1YJTA 2X1FA 3I82A 1X9JA 4IH6A 4BQLA 4Z4HA 3HBTA 4R5PA 3V6DB 2EPIA 4AT1B 2GVDA 2E88A 3NDKA 4DDFA 3VQ7A 3CCWA 2P5OA 1K8KB 2EK6A 2FVCA 4DR2J 4ECVA 1KVBA 1WG5A 4LQ9A 2KFNA 4R5PB 3D2WA 2GVDB 2MTLA 3GV5B 2NS1B 2AYEA 2DGQA 3IM9A 3MZIA 1Y7PA 4ZJOA 1RT6A 1F9EB 2VGNA 3FBFA 3L09A 3FZFA 1FKPA 1A6LA 3C6HA 4O44B 3QAUA 4CM2A 5HMYA 2YX4A 3RRHA 3QIOA 4DR3K 1RT6B 1FF2A 4WFBQ 4KH4A 4C8YA 3PJ9A 1GLJO 3RAQA 3PCOB 1YBUA 4A2BA 4A8WA 4HLBA 1FKPB 4L3NA 2GHVC 3R9LA 1VSDA 3K17A 1Q7YO 1ZA2B 3PSFA 1YITN 4WCEQ 3CDUA 6FDRA 4UUXA 1G7CB 3D1OA 3O3LA 2UUBJ 2DO4A 3MD1A 4IRKA 2AMCB 3PVXA 2F4VF 1S49A 3QFPA 2IVMA 3DN9A 1XN9A 3ZSYA 1Z25A 1EWQA 4AE5A 4NXNF 1PJ5A 1RWNB 1X8DA 1NK0A 3UR3C 1UEUA 2BXJA 3SQ1A 4DL3A 2DTJA 4GO7X 3O3HA 4K5SA 3QT8A 2FJWA 4B1VA 1UP1A 4OYOA 1DBDA 1I39A 1T11A 4I69A 2M88A 1P90A 3HO1A 4J9UE 4K7QA 1KONA 2DRDA 3R7NB 2DKOB 2UXCJ 3AFGA 4C4WA 3LALA 2AF6A 3MN6A 3EKSA 1S0VA 3P8BB 1SVDA 1RBTA 5KT7A 2L9WA 5LMNK 1VIXA 2GX9A 1Q8KA 3PEHA 4JBCA 5ETMA 2QSWA 1X5OA 2DNYA 5HROA 2M70A 5JVHL 1YBAA 4NZ6A 1UVJA 1MWKA 1Q7YT 2XZWA 3D6TB 2OA8A 3FMBA 2JSXA 3MWBA 4HEA9 3BYPA 1GH8A 2EC0A 4FJ7A 5HROB 1LEOA 2YWWA 3PTWA 1NGHA 2W7OA 4FWSA 2V69A 1QVGM 4BC7A 1X4AA 4FF1A 1RDUA 2KYXA 1N5QA 2X7IA 2AYMA 3K5PA 1WORA 3JB9k 1T6DA 1VRQC 3VGSA 1VQLS 1NH8A 2ZD1A 2KG0A 1XR7A 4L3QA 1OH7A 2NXEA 3MN5A 2XO6A 4DL6A 5HOOA 2X51A 4NCAA 3TR8A 1XHZA 5DM7Q 3CWJA 3G8SA 2ZD1B 4EMDA 3ZC4A 4ID8A 2ZBIA 3H8YA 3R27A 1HW9A 3AVJA 2BABA 1X4HA 3MEKA 4I1TA 5GINA 3CPWR 4K4WA 4PXBA 2IVYA 3FC9A 4BC3A 4HR2A 1NKBA 2BYCA 1IVZA 4ISEA 2CPZA 1PKUA 3GFZA 2F4VK 5F8LA 2C3UA 1BU6O 4I67A 4CCHA 2KO1A 3HZ6A 3VZIA 4J9PA 1ZZFA 5D4PA 3MXMA 5CCLA 3ZETA 4GKJJ 1S76D 5T7BA 2LMIA 4X65F 4DFKA 1ZM2A 2CNKB 1S1TA 2HQIA 4ZK7M 1SCJB 4Q2LA 1Q8LA 4KGVB 5J1PA 4C11A 2XTJP 4CGHA 3ZETB 1DTQA 2A3ZA 4XAKA 3DRPA 2B7BB 4JHDA 3L8BA 1C0GA 3UB5A 4OYZA 5GAHU 3DHXA 3QO9A 3UKUA 3GJQB 4CK3A 4I6AA 4DTXA 1VSIA 4C11B 1K8AO 2FVPA 1DTQB 5F8HA 3DKDA 2UP1A 1NGAA 4KHYA 1JLBA 2V6AA 3CMES 3DRPB 5KT6A 3RMBA 3V2UC 4JHDB 4L3KA 4CJKA 2M2BA 3QO9B 4P73A 2FHMA 3UKUB 3QPIA 4IG3A 2QSFA 2MEWA 2BKPA 2W6LA 3GIIA 5RUBA 4FWOA 3W3SA 1JLBB 2F63A 4JI1J 4PPZA 1H2VZ 3FEYB 3H45C 4KY3A 1GXTA 1DAXA 5B8HA 5FDLB 4JI7K 4IG3B 2R8JA 5EN1A 3P39A 1E6YA 2W4DA 2YY3A 5HANA 1IKXA 1MSWD 4JI5J 4OI6A 3TAEA 1VOMA 4CD3A 3AA4A 2VF3A 1H38A 1ZBLA 2AHOB 3AA5X 1T8EA 3VQ9A 4JKHA 2ASPA 2DH9A 3FJ2A 2DFFA 4J7CA 3P5JA 2GAHC 2XY7A 2QLFB 5AFUH 1IKXB 4LMZA 4QWEA 2MQPA 3MMAA 4PL8A 1TL4A 2CH5A 3CJQA 1RT1A 3F56A 4LRBA 4JUZA 2CZVC 3V1QA 1NM1A 4B1XB 1PBAA 2OCEA 4HACA 3BB5A 4RLEA 2YKOA 1TUVA 2BVZA 3EE9A 5AJ3K 4K4TA 3VF4A 3UCGA 3MMAB 2KKZA 3DGVA 2PAVA 4K5RA 3AAWB 1RT1B 3BN7A 1ZOTA 6FD1A 2YQ1A 4HACB 5DG7A 5F8NA 1NSQA 4URSA 3QBXA 1VHXA 4CESA 4DQRA 2QV6A 2BKNA 1YUWA 1H0HB 3OFHA 2AT1B 2CQDA 3TTCA 2PMHA 4PG5A 4K41A 4QJVA 1FDBA 3KXDA 1AW0A 1QY7A 3MTJA 1JB0C 3FGUA 1TAUA 3MECA 5T7LA 3FZ2A 4NXMJ 3OYGA 4P71A 4KFBA 3U27A 1YDLA 2ZWHA 2X1GA 3LPEA 1SJRA 3SCIE 3G71N 1SC3B 2IM2A 3R5JB 3T5HA 5B7WA 3AOAA 1NJXA 3KHYA 3MECB 1WB9A 4IG0A 5T7LB 2R7QA 2J7UA 1XNQF 4KFBB 3O5BA 3LGMA 5LXRA 3KG4A 1HFEL 1PAUB 2Q97A 3PKYA 4Q45A 1PILA 2VUGA 3I9V9 4AHRA 2G1HA 3W5XA 2CQ4A 3IN5A 1VQ8S 4NA3A 1N8RO 4IG0B 3FFKB 1HARA 4EFAC 1SJFA 3GSIA 1SIZA 2IVPA 4ZVPB 4BRKA 3NWRA 8ATCB 1CPZA 4ANDA 5CY4A 4BDPA 3OQ2A 1OH5A 5LM7E 3OA9A 1R31A 2A5XA 3QNWB 3Q8UA 1WHWA 4FO0A 2OFHX 2NXJA 1UFKA 2E44A 4DN9A 2FSNA 3SFUA 1Z1ZA 3LQVA 3Q0AA 4BS2A 1QAXA 1YJ7A 2CZ4A 2VODA 3FSXA 3E9PA 3ZCMA 2HG4A 2PE8A 2E9RX 5DK5A 3LZJA 3W62A 2PSZA 3M6WA 4DF8A 2EFGA 2FLPA 2NUBA 3BH7B 3HOSA 3FZKA 3MPVA 3K5LA 3G8QA 4UZBA 3CCVN 2DY4A 4FXVA 3BUZB 4J9VA 1FX2A 4FF2A 4HVZA 2HYIB 3VV2B 2HNZB 4KB7A 4ITSA 2HBJA 1YIJS 3AVIA 1RU2A 4HTIA 4KGZB 1ATRA 1NDKA 4WXWA 2JOQA 2CJBA 5F0XA 1IR1A 3UI3A 2IVNA 1MMNA 3RB6A 4X64J 4Z4IA 3OS1A 3RUBL 2JLEA 1N8RT 4B9VA 1WAJA 4X62J 4CJFA 4DL0C 4NLOA 2AA4A 2HNDA 2ZDOA 1RT7A 2XGQA 5KFCA 3AT1B 4PUOA 4EAHD 4OJRA 2MSTA 1XR5A 3U3GA 3EE3A 4AL5A 1UJ6A 4JI8F 4KGXB 5K14A 4CEOA 2HNDB 1SH0A 1RT7B 3G4SS 3T1YJ 3QWPA 3WUHA 2PZSA 2KW4A 3V9WA 4FWMA 4OJ3A 2M52A 1I3AA 4BWJA 5K14B 1S22A 3BGOP 5IV3A 4OYXA 2VU5A 3BF3A 1RKJA 4KTWA 1TQLA 1CJVA 3ISND 5IWAF 3NEKA 4H0PA 1NGGA 5T14A 3FEXB 1EKSA 2AGPA 3SCLE 1H72C 3HD2A 2GJFA 1CJVB 1F1BB 5H1SQ 4E2FB 4JYAJ 3T1HJ 1WSIA 3DM2A 1FE0A 3M3ZA 4B9NA 1CBKA 1WEXA 4ISGA 1HQUA 1FT8A 2E9TA 3I5CA 3VQCA 3IP0A 3C15B 1IBMF 2FJEB 1R89A 3VQ6A 4AH9A 4FWQA 4LF9J 5C2DA 3DM2B 2R7UA 3LAKA 3CJSA 1Y5NB 3V6KA 3ZSRA 3SQ2A 3NF9A 5BYSA 2E1MC 4HCCA 3AODA 1LW0A 4W98A 2IA6A 5E2QA 2BJDA 1OPZA 3TUPA 4NI2A 3MXJA 4M3ZA 3QIPA 5FLXO 2DGTA 4PPDA 2VB6A 2G4BA 4H5NA 2FYXA 5J2PA 1LW0B 2E20A 1H98A 3CJ9A 3A8YA 3WEEA 2CPFA 4NI2B 1DLOA 1N5YA 4CGDA 3V4IA 1HBOB 3QIPB 3OXFA 5F0UA 3J7AP 1L3TA 1O0PA 1TL7A 2B4OA 1CQNA 4FLWA 5J2PB 3Q2TC 2XEXA 4CT9A 2XY8A 2ZE2A 3WEEB 2RDIA 1F21A 4N5SA 1DLOB 1N5YB 4WYLA 3V4IB 2AJQA 3QINA 3M9NB 3CJBA 1TL7B 4ILLA 5H9EJ 2CWKA 2J0QD 4RU9A 3HPGA 4E19A 3HZEA 4YOEA 3W63A 4JOUA 1OH6A 2ZE2B 2DPIA 1LQ9A 4NYPA 3LGNA 1FW6A 3BO3A 4OYPA 1VQYA 2KI2A 5HO4A 4YUDA 3PV8A 2WTUA 2OI2A 3WHIA 2JEJA 4X4OA 5I3PA 3AO3A 4J9SA 1D9AA 2NRZA 4JI2K 1VQLN 2XHWA 2XSJA 4CEDA 5FPNA 2XG8A 4FW2A 3OLAA 1MDUB 2DR8A 1SJ1A 4Z94A 4EGLA 3KLGA 1WUAA 2KDOA 5KPZA 4UOCA 1KAZA 4ZP8A 3IAS9 2XSJB 1B64A 1B92A 4ID5A 3P49B 1HNXF 4ETXA 3CFOA 5IXUA 3C7NA 3NOCA 2AIRB 3LPTA 4L74A 2HFSA 3KLGB 1ZXOA 3PM9A 4B8AB 2Y9HA 5BN8A 4DR7F 2PC6A 1M5KC 2E8AA 1LXJA 2IMWP 3UE5A 2G8WA 4ID5B 1GOCA 3TQ1A 2W1BA 5I42A 4DR6F 1SC6A 4O3OA 3C7NB 3AJDA 3F0NA 1IWGA 4AQYF 4LF6K 1PBUA 2HVEA 2FSJA 1OQ3A 3IG1A 3H0PA 4A46A 2VD3A 3D2EB 2ZJQL 4DV0K 4KH1B 4GC7A 5I42B 1MWQA 1RT2A 2C3MA 2DHSA 5H1SV 2E9ZA 2NPIA 5L1LA 5ADXH 3H25A 3ZTOA 2CPEA 3IG1B 4KO0A 2B51A 3FK4A 2FZKB 1WSVA 3ZZOA 2YWFA 4DU1A 1CSJA 2UU9J 3GYNA 3CDEA 3JXOA 3H90A 3QBCA 5CYQA 1KQSM 2V5HG 2DNKA 4N41A 2DHAA 4DX7A 3UCZP 5DMRA 1VI7A 3W5YA 4KO0B 3G9CA 2HIYA 1VBZA 1YX2A 3GYGA 4C3LA 4NZ0A 3LP1A 4YOUA 5CYQB 4OYWA 2CVEA 2ZH8A 2FY8A 5AXNA 4CEBA 3RBDA 2Q36A 3V1RA 3CF5Q 3QESA 2HS4A 4CZFA 5KRSA 1KWMA 1NKCA 4DR4J 1SKRA 2DNQA 4YDUC 5IFMA 2R7SA 1S1VA 2WBMA 3LP1B 3OBIA 1EQYA 3EZ5A 3B78A 2J6SA 4OPJA 3LA0A 1QLNA 1XJWB 3DHWC 5FLXU 3J7Z5 4ED6A 1G4CA 4M5KA 1RBUA 5A8RA 3QEWA 1QS4A 2IRUA 2PY5A 3P6YC 5BPLA 4I6MA 2H65B 1G3OA 2UUAK 2HLUA 2N4CA 1S1VB 1WF2A 4KBOA 4H4KA 2BQ3A 5A8RB 2MLYA 4FJNA 1Y5IB 4LH4A 3ZZRA 5HQ8A 4X2BA 2EI5A 1C4CA 4RKUC 4I6MB 2CQIA 3A5MC 2YHBA 5KFDA 4KB1A 4NYZA 1SJ3P 1WHYA 1N0VC 1NK5A 5SZTA 2EX3A 4QPTA 3I4PA 2KL8A 2KYZA 3EICA 1X31C 2CPYA 2W6KA 1RAFB 4BVPA 4JKEA 1RXOB 3SFGA 1IR2A 3FGVA 3LDOA 4QS8A 3L7OA 2LP4A 5M2PA 2G2YA 4WP3A 2IAJA 4IEIA 3JSMA 1VIOA 3RW6A 1GFWB 3ZX0A 4CLFA 2FXUA 2BOPA 2LXIA 3SMZA 3RBXA 3BV8A 4K8ZA 1VC0A 5E5NA 4OFZA 5LOQA 2IAJB 4WQ4C 3JSMB 3SNNA 1RGIA 1D9FA 2ZC4A 2KM8C 3H7HB 2GC8A 3PYGA 4MAKA 2AP1A 1LW2B 1Q7LB 3DLLQ 5C2GA 3D6RA 2R7XA 4C98A 5HBMA 4CEQA 1DHMA 2COLA 4V19S 4Y0WA 1UEVA 3W3DA 4K43A 1VC5A 3QSYB 2NLXA 1S6UA 4MJKA 4G1PA 2BDPA 3VN5A 3VF6A 5AQWA 2JJ4D 5HBMB 5E7OB 1VISA 2GQQA 3UO0A 1VQ9S 1W2BR 2AYBA 3UDLA 3NGRA 3GV8B 4DU7A 3H6EA 1YRXA 4RW9A 1CC8A 2ZH7A 2OPQB 1IBKF 1DRZA 1WC6A 4F2RA 1RHQB 1SL2A 3NGUA 2UYTA 1ICEB 2NR0A 4RW9B 3O1LA 1YVFA 3NLCA 3VQ5A 3PR5B 2VG6A 4CJQA 4HHHA 3M8YA 5I3UA 2LQBA 4JI4F 3MCPA 2GMLA 2ZQBA 4DTOA 1QTMA 2HHHF 1J5OA 1S59A 5JMNA 2ZWOA 3HPHA 2DBBA 2VG6B 4DFPA 2HVHA 3SDEA 1CVJA 3CCJN 1N5VA 4C2MA 1KC8O 1JLEA 3M9OB 3EGZA 4A8FA 3TJ8A 1UVKA 4Y28C 3X1LB 1JCFA 1J5OB 2XS7A 4C0BA 1AYEA 5FRNA 4YHHK 3LW5C 3SDEB 3NH1A 3GG1A 5E3RA 1JLEB 1HJRA 1YIJN 3QEVA 1BQNA 2ZKUA 5A2QO 5AQKA 3C16A 3E01A 1KXPA 4A61A 1RB0A 4BRHA 3U4LA 5BR8K 1F5CA 2XMMA 2HHWA 5JMVA 3ET6A 3TNVA 1BQNB 2YNHA 4KH0B 3AVFA 4FP9A 1ROFA 3U6FA 5EOYA 5JVHQ 3C16B 5AQQA 3E01B 4DV5F 2KXHA 3OLBA 3I8BA 5KI6A 1NNDA 3ISZA 4ZS6A 1UJ5A 4F3TA 4CF8A 4CT8A 4GV3A 1WSJA 1NMDA 2VG7A 2HBMA 3EYZA 3ET6B 2YNHB 2YQ0A 1U09A 2FQQB 1YLXA 3R6LB 4GMKA 2KG1A 1Q81T