1IKXA

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikxA05
1JIHA 3TABA 5DGBA 3HPGA 4B8AB 4DS4A 1U09A 1R0AA 5DG7A 4FK0A 1QE1A 2BDPA 3BSOA 5KFEA 3CM5A 4DTUA 2RKIA 4NLGA 1BI4B 4IBNA 1A5WA 1WSJA 4FZXC 1S97A 3BQ2A 1S48A 4DL5A 3Q8RB 4YP3A 5L1JA 4ED7A 3KLHB 1RNHA 3QEVA 4C8LA 1W9HA 5I42A 3IGVA 3FQKA 4MIBA 3OLAA 5KG0A 4U6PA 4HUGA 3F73A 3QNNA 1RTHB 2QKKA 1DTQB 3KIOA 3V1QA 2WTFA 3OY9A 3LP1B 4PUOB 4C8MA 5KFBA 4RW6A 1KVBA 3DYAB 5KFQA 1JKHB 2AX0A 4ZHRA 1RDCA 4MFBA 3OJUA 3AVKA 3OYBA 3VQ6A 4J9SA 3I5AA 1SV5A 1ZTWA 2OPQB 3SUQA 2VG7A 2VA2A 3ICLA 3LANA 3VQQA 2VWKA 4IDKA 1GOAA 3C95A 4J9LA 1KVAA 2YNHB 1U48A 5KFVA 3DYAA 3H40A 1NJZA 3LP2A 3A2FA 2B5JA 2FJWA 3EZ5A 4ED6A 1HYSA 1RTHA 2W7OA 2IA6A 3AA5X 4NLPA 3I0RA 4R8UB 3NGYA 3VQ9A 4CHOA 4ZMMA 3IRXA 3GQCA 1F21A 3RB3A 5EWGA 3G6YA 4F4ZA 1WSGA 3CIZA 1JLCA 4IH7A 3RR8A 3QEWA 4YMEA 2ZD1A 2GIQA 2WB4A 1KSPA 2YKMA 4HUEA 3NGIA 3H5SA 3CVKA 3LPTA 5CYMA 3MXMA 3BJYA 2IC3A 3QIPA 4WXWA 1ZETA 3TARA 1JX4A 3ZCMA 3JYTA 1TKXA 1Z25A 2R2RA 1C0TA 2FVCA 3KTQA 1BQNA 4KHRA 3JSMA 1RBVA 5KGWA 2HNZA 3OL7A 1WN7A 3DDKA 1RCHA 1TGOA 3V6JA 2XI3A 1VSDA 4C8NA 2RDIA 5HRNA 1HPZB 1DTTB 3K5OA 4Y3CA 3MFHA 4G1QB 2D0CA 2FLNA 4LH4A 1S1XB 4URSA 1BCOA 1RTDA 1VSEA 3WNEA 3FQLA 4FXDA 4RW4B 2D41A 1GOCA 3N6LA 4DTMA 3PVXA 5KGXA 5K14A 2DPIA 4NLDA 5J1EB 5DQGA 1JXEA 2XY7A 4R0EA 2W8KA 1JXLA 1RTIB 3LAMA 3HT3A 5KFIA 4NCAA 3K5MA 5KFRA 3UR0A 3ULDA 2VG5B 3OYAA 5D3GB 4E7IA 2XGPA 4KRFA 3OS2A 2J6SA 4M41A 4DWIA 3DLKA 3L3UA 4O4GA 2R8JA 1C1CB 3QGGA 2ASJA 1ASUA 1REVB 4OLAA 2BR0A 3NAEA 4KB1A 1EETA 4ZP8A 4NLSA 4M3TA 3T5LA 4FLVA 4K4VA 3ZT0A 2FLLA 4B3OA 1IKYB 4LSNA 3VQ4A 4DSKA 1IKXB 4Y34A 4WE1B 2AJQA 1S1VB 1IH7A 2P5OA 3L3VA 4CJTA 2VG6A 2UVVA 4PQUA 1D0EA 3PV8A 4HYKA 2BRKA 1SKWA 4ZVGA 3OYFA 4ED0A 4NLOA 4URGA 3AO1A 2HHSA 3BGRB 3OSNA 2X74A 3K59A 3SUOA 4NCGB 3QEXA 4B3OB 4HCCA 4E7LA 5F8IA 2WOMB 3KK3B 2ASLA 3KLGA 4Q0BA 4OKEA 2XCPA 1A5XA 3KOAA 4Y1DA 4TY8B 2D5RA 1W25A 4JRQA 4E19A 3NE6A 3PJWA 1RT2B 1QSSA 3ZSOA 4DLGA 1LWFB 4MK9A 3EY1A 2UVUA 5C42A 1HNVA 1RA7A 1LWFA 1Q9XA 3QERA 3LZJA 4PWDB 2ETJA 3T5KA 1TKZA 4PWDA 1C6VA 3V81B 4DU1A 5F8GA 2C2RA 1SKRA 3KLGB 3OLBA 1RILA 4TSXA 3PZPA 3I5BA 1X9SA 4RW4A 5EWEA 1RT2A 1RDBA 1S6QB 2QV6A 3BGRA 3HP6A 2E9RX 1RAJA 2FLPA 3HL8A 2RF2B 2O4IA 5EWFA 4ELVA 1TK0A 1N5YA 4KTQA 3THVA 5HBMB 3SFGA 5DQIA 3AA2A 2JGUA 4LQ9A 5SZTA 3AVNA 4O0IA 1HNIB 4Y2CA 4K8XA 1XC9A 3CJ3A 3V4IB 1RT3B 2R2TA 2C22A 4CGIA 3DLBA 1I39A 2XWYA 2YNIA 4FM0A 1IKVB 3PX6A 3MFIA 1TV6A 4FJNA 2XY8A 1NNDA 3AVGA 3C6UA 5CYMB 3RWUA 3AVBA 4EZ9A 4FJGA 2JLEA 3DOKB 4QWDA 4O4GB 5C25A 4W5RA 5I3UB 2IJNA 4DQRA 2DFEA 4Z4HA 3OYMA 4QW8A 3AVCA 4YR2A 1HMVA 3DLEB 4CFCA 1SL0A 2G8WA 4KFBB 5F8LA 4I2QA 4QWEA 4BACA 4K4SA 4CGHA 3VQ8A 2R8HA 4IDKB 1NOZA 2VG7B 1BQMA 2VG5A 4KI6A 4CFAA 1NK9A 1L3UA 1S1XA 5HP1B 5KFNA 1B9DA 1CXUA 4MQ3A 4JS5A 3TVKA 2AU0A 2ITGA 4DSLA 1JKHA 5KT4A 1DLOA 2W42A 4ECTA 4FJMA 1RT6A 2F8SA 1RT1B 5CZ1A 1UOCA 2G8UA 1X9MA 3PHEA 4RW9A 3S3NA 3NAHA 4AHUA 1TV6B 4BDPA 3QIOA 3DLGA 3TR8A 4E0DA 1ZBIA 1LWCA 1MU2A 4M3WA 4EO6A 4DU3A 4J2EA 4OL8A 3L2UA 3PX0A 2R8GA 3QIDA 1W0HA 3O4QA 5HRRA 4CF8A 1QSLA 1JLBB 1S0MA 4BDYA 4CK1A 1NK4A 4KHUA 1JLFA 1NK8A 4QWBA 5KFMA 3KK1A 3ZSYA 1C0TB 3L2WA 4B9SA 4JLHA 4IH6A 3V6DB 2WRMA 4CCHA 4FVMA 2FVRA 4ZPDA 4IFVB 4FK2A 1L3SA 3MEEA 2IM2A 4BE2A 3M8QA 3IN5A 5KFCA 1TL1A 1Y97A 3LP3A 4HHTA 3LALA 1N48A 4AHRA 3U6FA 1ZBFA 1S1TB 4K8ZA 5C24B 4WFZA 1T05B 1HYSB 2KQ2A 2DTUA 3MECA 5F9NA 5KFJA 3G6XA 3KMQA 3P5JA 4B9LA 3HVTA 1MMLA 4EYIB 2WCXA 4YFUA 4JV0A 2LSNA 4I7FB 2YKNA 3DRPA 4NLXA 4CK3A 3GIKA 1SV5B 2YV0X 4OGEA 2IAJA 3GV5B 2HW3A 2HNDA 4CK2A 4CIFA 1QHTA 3TI0A 4DTRA 3UQSA 4CHZA 5KFUA 4FJJA 1IKXA 2FVQA 4OGCA 3KD5E 1UAXA 4O3RA 2I1RA 3MEEB 4KV8B 5DK5A 2W7PA 4RNHA 1JL2A 3MEDB 3ALYA 4BWMA 4DFPA 2GC8A 2KFZA 3AVHA 1T8EA 4XPCA 3H5XA 4KPYA 2HVIA 2OZSA 3DM2B 1S9GA 4MKBA 3ZSWA 2ILYA 3KLHA 4AHCA 4QWCA 4CJRA 3SCXA 4M45A 3O3HA 3AO4A 1Q8IA 4W5QA 1UWBB 4RW7B 2NUBA 1T03A 2OA8A 5KTQA 1VSJA 1RT7B 5JXSA 3SI8A 3GIMA 4DG1A 4OKKA 4ECRA 3OYIA 2GUIA 5J1EA 4F4XA 3K5LA 2G8KA 3EPGA 3DLKB 1NJYA 4W5NA 2EHGA 1TQLA 4O3SA 1VSLA 2BE2A 1S1UA 3HKWA 2ZKUA 2BRLA 4DTJA 4GVMA 1ZTTA 1RTIA 3CFPA 1HPZA 1RT6B 3UIQA 3SUNA 3KLEB 4YR0A 1KLMA 1HQUB 3MTKA 3KJVB 4AH9A 3OL9A 4IKFA 3G0ZA 3SV4A 2G8IA 4CE9A 3KLIA 1FKOB 2BE2B 3G10A 3UDLA 3AA3A 1FKPB 4KHWA 2B6AB 3TAGA 4NLYA 4W5OA 2IGIA 4BE1A 4M3YA 3RMDA 4NLRA 4FJ8A 1FK9B 4NLWA 3DM2A 4J9KA 5F8JA 4WYLA 1S1WB 4TYAA 3KHRA 3QIPB 1GX6A 4FLUA 4JV2A 1TL3B 2KTQA 5DGAA 4RNFA 2HNZB 4F2SA 4ZP7A 1I6JA 2Z1HA 2HB5A 4FLXA 2ZD1B 1T7PA 5C25B 3DI6A 2HHXA 4LQ3A 3F9KA 4CGDA 2WHOA 3AVFA 3FFIA 3KMSA 3DRRA 4O3NA 2JEJA 3IRXB 1KHVA 3I0SA 4WZQA 1QUVA 4KV8A 4ZPAA 4ZVFA 4O4RA 3M9MB 4TQSA 4KBIA 2YKNB 3DRPB 1S49A 3KK2A 3QO9A 2AX1A 1XR5A 1VSIA 1TKTB 2FJVA 3BQ0A 4K4TA 3L8BA 4H4MB 3OYJA 5J2QA 4OVLA 3DLRA 2F8EX 2QXFA 2YHBA 1KLMB 1WAJA 1Z26A 4ZTJA 1TL1B 5FRNA 2J6TA 1VSHA 1S6QA 4ID5B 3KLIB 2D0AA 3MECB 2ATQA 3P83D 1WSIA 2Z1GA 3V6HA 5KG4A 3RBDA 4FW1A 3D0PA 2DFHA 1BCMA 3WNGA 2ASDA 2RDJA 1HYVA 4CEFA 3AO2A 5HRPA 1VRUA 3Q8QB 4YQWA 2W9BB 4ICLB 4ECZA 1S1UB 3NL0A 2QKBA 4EP5A 4FW2A 5T7BA 4CHQA 4CJFA 2RKIB 5FDLA 1BI4A 1QSYA 2YNFA 3KK1B 1BIZA 4CEAA 4DG1B 2GV9A 1JLFB 4Q44A 1JLEA 1T03B 4CJ5A 1J9AA 2WONB 4CF2A 4URQU 4DL7A 2HNYB 3TAEA 1L3TA 3M9NB 4WFXA 4DU4A 4M3XA 4F3TA 3D5MA 4IG0A 4O44B 2FBVA 2AGPA 4MKAA 4DSIA 2C2DA 4OJRA 1S9EA 3NHGA 1SH3A 4Q5VA 2YNIB 2OH2A 2BANB 4AHVA 3IG1A 4HVJA 2XHBA 4J9OA 4CJKA 1LWEB 4FLYA 4WE1A 3RAQA 2AGOA 4XO0A 4DS5A 1HMVB 3NAIA 4Z0UA 3KLVA 4HKQA 1WAFA 3PW7A 2W8LA 4I7FA 3RBEA 3CG7A 1TK8A 1EETB 3M8QB 5DG9A 3HYFA 4RW8A 3DLEA 3GV8B 1C1CA 1YT3A 4WFYA 1JLAB 4FCYA 4CF0A 3FRZA 3PW0A 3I0SB 3BQ1A 4F4KA 4ED2A 1S0NA 4QPXA 3NFAA 3NF7A 3MXIA 2E6MA 3VQBA 4CHYA 4ZP6A 1SH0A 3P1GA 3SQ0A 5DG8A 4E7HA 2D3UA 5KFKA 3M9OB 1KCFA 1S9FA 4ED1A 4KTZA 4CGJA 4O3QA 1NK0A 1YTAA 5E41A 1SUQA 3OJSA 4DTNA 2AQ4A 3KHLA 1FKPA 2Y1JA 4N47A 3KHGA 3SI6A 4TN2A 3T5JA 4RW9B 1IM4A 4IQXA 3RB6A 1RTJB 3AVMA 1N5YB 4HCBA 2E9ZA 2ZE2B 3OS1A 2RF2A 4PY5A 3FSIA 4FS2A 1MU2B 4K4ZA 5KFLA 3L2QA 2GBZA 1B92A 1SUQB 4H54A 4KAIA 3TAMA 5J2PA 4ID1A 2G8FA 3ASMA 5KFZA 2I5JB 5HLFB 3V9XA 4J2DA 5KT5A 5KFDA 4CEEA 3WNHA 4NYZA 4CEBA 2RN2A 1DLOB 3ZT3A 4M3RA 1RYRA 5KFWA 1WSEA 3IAYA 3N6MA 4Z4FA 3OYCA 4Q0BB 3MXJA 1XHXA 1K1QA 4KREA 4NYNA 4CJQA 4CF9A 3BSCA 5KFOA 2R2SA 2AGQA 1QAIA 4NZ0A 3SV3A 1QTMA 4KFBA 4NRUA 1D9DA 4ELTA 3LDSA 4DSFA 4FJKA 3H5UA 3C94A 4Y2AA 3QLHB 4I2PA 4TYBA 3MEDA 4Y1CA 3KD1E 1EKEA 3OS0A 2UVRA 4B9UA 4FJLA 4Q45A 2HMIB 4N41A 4M42A 4ECXA 5CYQB 1WNSA 3SFUA 2Z1IA 2XI2A 3ZT4A 1SKSA 4CJPA 4L8RB 4ZPCA 4ECSA 1QS4A 3V6KA 3PY8A 4KKOA 4ZHRB 3VQDA 4CECA 2XGQA 1IKWB 3V9SA 1CLQA 1ITGA 2AWZA 4GW6A 4XIUA 3EYZA 5F8HA 3C6UB 1LW0A 2WONA 2C2EA 3PX4A 2XRIA 5F8MA 5F9LA 4CJ4A 1FXXA 1Z4UA 3HVWA 4RZRA 2PY5A 5I42B 3OYGA 1T05A 3NGDA 1BHLA 2HWHA 3M8PB 4BWJA 5KT3A 3RMAA 1TKZB 1TVRA 2KZMA 2YNFB 3LPUA 1C0UB 4RNNA 1C1BA 3KLFB 4CEQA 3KKSA 1B9FA 3BSNA 1S6PA 1QE1B 4E3SA 1HNVB 4TXSA 3ISND 4LH5A 1RTDB 4H8KA 4EO8A 3KHHA 4HUFA 3MR6A 3V6DA 4RG8A 4ID5A 1RBSA 1LV5A 3CDEA 3HP9A 3VQPA 3U3YA 3BREA 1WSFA 1JLBA 3TAPA 3E51A 4ZVEA 2ALZA 4HTUA 2I5JA 5HLFA 4FS1A 1HJRA 4FZYA 3MR2A 3SPYA 1KTQA 4NCGA 1N4LA 3GIIA 2Z1JA 4IH5A 4NLUA 4KB0A 3MR5A 3TWHA 2JEFA 3VQSA 3DLGB 4H4OA 3WNFA 3KK2B 5KRSA 1S4FA 2WOMA 4ZP9A 5FRMA 3FDSA 1BL3A 2YKMB 3LZIA 2ATLA 4F2RA 4NRTA 3PR4A 4TQRA 4W5TA 3JYTB 4E89A 3QO9B 3HXMA 1IKYA 1WNEA 2VG6B 5KT7A 2B5JB 3ZSVA 4CHPA 3LP2B 3RTVA 1TL3A 1JL1A 3SYZA 3DRRB 3TANA 4DQSA 1JLCB 2VA3A 4IRCA 5KFSA 1FKOA 3MR3A 4E1NA 1KHWA 1XR7A 1JLAA 3HHKA 3VQAA 2PZSA 2X6NA 4FJ9A 2HHWA 4CFBA 3QGIA 3KJVA 3SPZA 4LD0A 4DL3A 4I9LA 4ECWA 2A1RA 1NHVA 3QGHA 1JLQB 3K5NA 2B6AA 2WK4A 3H08A 3QEIA 1U47A 3VQ7A 1DTQA 5DLGA 3O3FA 2V4RA 4CIGA 1VSMA 3TAMB 5J2PB 3HPHA 2FVSA 1RYSA 3AVIA 2VWJA 3V4IA 2FVPA 2E6LA 1UA0A 4KHNA 2HAIA 2XO7A 3LWMA 2E4LA 4EBCA 5JS2A 4PA1A 4F4WA 2FBYA 5KG3A 5J2NA 4DF8A 5HBMA 1JLEB 4RW7A 1BQNB 4G1QA 4NLVA 1DTTA 2IDOA 4DQPA 1TKXB 3UPFA 4EP4A 3MAQA 3KKRA 3TAFA 2HNYA 1N6QA 3K57A 4B8CA 5KG6A 4IRKA 3D45A 1NKEA 4J9QA 2W9BA 2ZQBA 2OPSB 3DOLA 1LW2B 2XCAA 2W9CA 5HROA 3HM9A 1GOBA 1D9FA 2PYJA 4K4UA 3HVRA 4F50A 5KG1A 3I0RB 4R8UA 5C42B 4CGGA 4C8OA 4Z4IA 2O5DA 1VRUB 4KO0B 4MIAA 3NH1A 3OYKA 1C0MA 4DQQA 1O1WA 3E01A 1I3AA 4LSLB 1XR6A 4EBEA 4Z4EA 3NF8A 4KHQA 5CY4A 1ZYQA 2YNGB 2DY4A 3EPIA 5FROA 2OPQA 4OLBA 1NJXA 3EZUA 4F8RA 1JLGB 1JLQA 3QZ8A 4RNMA 2CKWA 2P51A 1LAWA 1YVUA 4ZTFA 2UUWA 2KFNA 4KO0A 3ZSQA 2Y1IA 4H4MA 1S9EB 3BR9A 1C1AA 3OYHA 4ECUA 1L3VA 4CJSA 1S1TA 1HARA 3H5YA 2BQRA 1TKTA 4R5PB 5KI6A 4CERA 3BDPA 2G8VA 4IG0B 3T3FA 3NF9A 5HROB 1QAJA 1HQEB 4RW6B 5KFYA 5EU7A 4PUOA 4UQGA 3DOLB 4FLTA 3QESA 3QINA 4M3UA 1RDDA 3SZ2A 4Q8EA 2IM3A 1ZBUA 4N5SA 3RMBA 1SL2A 3K2PA 3CWJA 1YVFA 1RBUA 1LAVA 1ASWA 4DTSA 4IG3A 1EP4A 2OPSA 1UA1A 4K4WA 5J2NB 4RNOA 2UUTA 1VRTB 2IBKA 1JXBA 3HVAA 3KLEA 3H59A 4KI4A 1G15A 2QE5A 4IFYA 1RBTA 1D5AA 4DLEA 4DFKA 1LWCB 3PUFA 3VQEA 3LAKA 4U7CA 4J2BA 4FJHA 1RA6A 1NK6A 1RT5B 1RDRA 4KE5A 3AVAA 4NYFA 2KW4A 3CQ8A 2HHVA 1RT1A 4IFYB 1XI1A 3V1RA 3DLHA 2JC0A 1VRTA 4N56A 1NOYA 4WXOA 4J9RA 5KFFA 1RT5A 4B9VA 3DRSB 4B9NA 4FBUA 4OPKA 3C6TA 1BQMB 4BE0A 4Q8FA 3B6OA 4O55A 3I5CA 4ECQA 4QCLA 2XY6A 4O0JA 5L9XA 1C2PA 3NF6A 3I8DA 1TVRB 2X6SA 4EYHB 3L2VA 4F3OA 4C8KA 3AO5A 1KRPA 2FBTA 3ZSRA 5C5JA 2X78A 4Z4CA 4FJ7A 1KLNA 2D3ZA 3CFOA 3LP0A 3K58A 1S10A 1KFSA 2E9TA 1J54A 2R7YA 4EEYA 3V9WA 2F8TA 1TAQA 5KT6A 1IKWA 4WZMA 3SQ1A 4ECYA 4J9NA 1HQEA 1S1WA 2B4JA 1IKVA 1T3NA 2OZMA 3OHBA 3T1AA 1SL1A 2IAJB 3Q8SB 3OYDA 4FJIA 5KG7A 1KFDA 2HMIA 2GIRA 1X9WA 3V81A 3NKYA 1GX5A 5DQHA 3QETA 4JV1A 2FC0A 3AVJA 5KG5A 1TAUA 1XWLA 2ILZA 2V9WA 5J2MB 2OPRB 1S6PB 4EBDA 4FBTA 2JEGA 3QZ7A 4O3OA 3E01B 1RT4A 1SH2A 1C0UA 1LW2A 4XPEA 4TY8A 4CJ3A 3DMJA 1RT7A 4IFVA 3CJ5A 4GC6A 3M8PA 4LY7A 4DL4A 5J2MA 3KK3A 3RAXA 3ZT1A 2BQ3A 5EUHA 1YTUA 4J2AA 1S9GB 2DFFA 1C1BB 3KLFA 2OPPB 2PYLA 4CJEA 1EX4A 1XHZA 4B08A 4MK7A 3OYNA 1K1SA 1NK7A 5CZ2A 4PQUB 3PO5A 1N6QB 4FYDA 3RR7A 2B43A 2D7SA 3BSAA 1U04A 3M8SA 3HJFA 5F8NA 1IO2A 3SJJA 3NBPA 4F4YA 5L1IA 3NH2A 3V9UA 3GYNA 4QWAA 3OL6A 5KRTA 1J5OA 3ZSXA 2IM0A 4JUZA 1VSKA 4FLWA 1S1VA 4I2QB 3HVTB 4KKOB 4CJWA 5KFGA 2HHTA 3IS9A 3LP0B 1RDAA 1D1UA 3PW4A 4RUAA 1ASVA 1U4BA 1NKCA 5CYQA 4GC7A 3SQ4A 2HHUA 5C24A 4DEZA 4E1MA 5D3GA 4QW9A 4RU9A 4DTXA 4KSEB 1IG9A 4M94A 5DMRA 2QK9A 2W9AA 3HSTB 4CGFA 1CSJA 1D8YA 3OL8A 3OHAA 3GIJA 1T94A 3H98A 4IRDA 4K4XA 3AA4A 1TP7A 1RT3A 3CFRA 4N76A 1HNIA 5KFXA 4G3IA 3VQCA 3O3GA 4B9MA 4QAGA 1J5OB 3S3MA 4IKAA 2HHQA 4Q43A 3ITHB 3T5HA 4YNQA 4KHSA 1CXQA 3JSMB 4DFJA 4K4YA 4CHNA 4DQIA 4KHYA 5KFAA 4NLQA 4O44A 1NJWA 3RRHA 1OS5A 1S5JA 3AO3A 2OYQA 4B9TA 3N6NA 2J6UA 1VSFA 5L1KA 4M3ZA 3PJXA 3SQ2A 3CO9A 4O5BA 4FLZA 1TK5A 3NMAA 4CF1A 2Q3SA 1EP4B 4IG3B 4DSJA 5EDWA 5DLFA 4J9PA 5HP1A 3PW2A 3ITHA 3SUPA 2OPRA 4CJVA 3H4BA 4CFDA 4IR1A 3ZSZA 2JC1A 3QYYA 3CM6A 3H2LA 1K6YA 2P5GA 3PW5A 3H4DA 4RW8B 3S9HA 1NKBA 2FBXA 2V0NA 2V4QA 2R8KA 4O3PA 4R5PA 4YR3A 4FJXA 1U45A 5I3UA 3QEPA 2XC9A 3DOKA 3RB0A 3NGZA 4ZVHA 3IS9B 3RB4A 3D28A 4FZZA 4ECVA 4AILC 2R2UA 1A5VA 3PO4A 3V9ZA 3TQ1A 1LW0B 3RRGA 1JLGA 4IR9A 4GMJB 2IOCA 3MF5A 4KHMA 4CEOA 4IOBA 3NBPB 4ED3A 3VA3A 4FJ5A 1LWEA 4FM2A 4DL2A 4AHTA 4QOZB 3OYLA 3RMCA 2UVWA 4CIEA 3V1OA 4DTOA 3LP1A 2IJFA 2EC0A 5T14A 5HRSA 1WLJA 2XY5A 1BISA 1ZBHA 3HPOA 2A1SA 4ED8A 3VN5A 4CEZA 3FFIB 4TLRA 3VA0A 4LSNB 1S0OA 2IS3A 3CYMA 3LWLA 3HO1A 1L5UA 1R0AB 3C6TB 4DL6A 4ICLA 4AHSA 4DF4A 3QLHA 4I2PB 3T19A 3MEGA 5FDLB 2OPPA 1RT4B 5L1LA 4WYWA 3ISNC 3KNAA 3AV9A 3CDUA 3AVLA 4DTPA 1QQCA 3O4NA 1WSHA 2FJXA 4X2BA 1NK5A 3DMJB 1VK0A 2EX3A 3S3OA 3CDWA 4E7KA 2JEIA 3IGNA 4M95A 4I9QA 4OKJA 2ZE2A 3NCIA 1RTJA 1KVCA 5J2QB 2P1JA 1X1PA 4MK8A 4NLTA 4CJUA 4JS4A 2IC3B 5KT2A 1RBRA 2C28A 4Z4GA 2IM1A 1UWBA 5KFTA 4KB7A 2CJQA 5KFHA 2IMWP 3NDKA 1N56A 2RPIA 5SWMA 1NHUA 5KG2A 3VQ5A 4FM1A 4FK4A 4KAZA 3Q8PB 3U3GA 4DMNA 5JUMA 3ZT2A 2YHAA 3OSPA 1EXQA 3M8RA 2BGGA 3HK2A 2D0BA 1REVA 4J9MA 4DFMA 2YNHA 4DSEA 1FK9A 1ZBLA 3DI6B 1CZBA 2HNDB 4TY9A 3L2RA 2F96A 1HYZA 1BGXT 2DPJA 3DRSA 4JRPA 3GILA 1U49A 2YNGA 4E7JA 4RUCA 3SNNA 4NCBA 2O4GA 3G86A 3G6VA 1CZ9A 4H4OB 3CJ2A 3NH0A 4EZ6A 4OPJA 2KZZA 2BANA 4CEDA 5K14B 1J53A 2HWIA 4K50A 3CJ4A 3PR5B 1HRHA 3OYEA 4MH8A 4ZPBA 4BDZA 2HVHA 3GV7B 4MFBB 1BIUA 1HQUA 2R8IA 4LSLA 1TKDA 3OVNA 4ELUA 3IG1B 1Q9YA 2W9CB 3TAQA 2G8HA 4CJLA 3QNOA 5KFPA 4CESA 3CJ0A 3B6PA 5JS1A 4KTWA 3MEGB 2BQUA
chains in the Genus database with same CATH superfamily
1KQKA 3TABA 2OGUA 3THXA 1QQNA 2C3MA 1ULRA 3N4QA 2N3LA 3DGVA 1R0AA 3AARA 4FK0A 3NMRA 3J7ZO 3BSOA 1RKJA 2Z30B 4C98A 2RKIA 1RLDA 1W2BR 4FZXC 3ENAA 2DRDA 3AY9A 4IO9L 4MLHA 1L3KA 2WSEC 3DDIA 5L1JA 5A0YA 4ED7A 1H6KX 4C8LA 1W9HA 1R27B 1HLUA 4YOEA 4KH4A 4YEAA 3G96A 1V5IB 2QKKA 3SEOA 1DTQB 4FKXA 5HOOA 2LLZA 3PG9A 4C8MA 3BM7A 3DYAB 5KFQA 3R6LB 1TUYA 2R7RA 2AX0A 2K7KA 4ZHRA 1RDCA 1J2VA 4EI2A 3L95X 1HKBA 4J9SA 1SV5A 1ZTWA 1N36J 2QIFA 1YJUA 3GCXP 3SUQA 2H65B 1AT1B 1KVAA 2O8DA 3M2VB 3DYAA 1NJZA 3BBCA 1NU0A 3LP2A 2LU2A 2B5JA 1FEHA 4ED6A 1KKHA 2W7OA 4M63A 3AA5X 3M30A 1CJVA 4CHOA 4ZMMA 3PHTA 4K2JA 1JLCA 4IH7A 5E33A 1X4BA 4FF2A 4AQYK 1RK8A 4PWUA 2WB4A 2YKMA 1VBYA 3TTCA 3NGIA 2HGMA 3H5SA 3CVKA 2A6OA 4OHYA 2KHOA 3BPDA 3BJYA 3ET6A 5D4OA 2IC3A 5F2RA 3VAHA 4IOAQ 4FXVA 5DZ7A 2HVEA 1ROFA 1BQNA 1RBVA 5KGWA 3HSZA 2ZBIA 5IC6B 4ISGA 3UFCX 4CLKA 1WN7A 3FCHA 3TSUA 3E9OA 4Y3CA 3R5AA 4LH4A 1KS2A 1BA0A 4OZ5A 5BXIA 5AQXA 1JNZB 1GOCA 4DTMA 3LDLA 2FD2A 4C7QA 2AF6A 4LFBK 3OUYA 2DPIA 1N5TA 5J1EB 1OIAA 5DQGA 4B3RJ 5D4LA 1JXLA 1RTIB 3R3TA 3HT3A 3K5MA 1BO5O 5KFRA 3UR0A 4YDUA 1KQFB 3OYAA 3TZZA 1N5SA 4TU7A 4KRFA 4NI2A 3C46A 2J6SA 4C3KA 3L3UA 1U2VB 4CQ1A 1FJGF 2ASJA 4UW2A 3D4JA 2JLGA 3NAEA 1EETA 1H98A 3I32A 4DX5A 1PKUA 3C14A 2JFKA 4XH4A 4JK8A 1SC6A 3O6QA 3R2DJ 4B3OA 1YUWA 1IKYB 1Q82T 2B7CB 2P9LB 2AJQA 1YI2N 1JJ2M 1RCXB 4MO4A 3R2CJ 1S1VB 4RJVA 3L3VA 2XQCA 4OJGA 2UVVA 1HJOA 4WBFA 1HNZK 3OVSA 4HYKA 3R8EA 1SKWA 4YOVA 2D9PA 4ED0A 4NLOA 3QB0A 3AO1A 1Y11A 3C66A 2UXDK 4L3QA 3QEXA 2V34A 2W01A 3UDVA 4Y28C 1FRLA 2CDQA 4EHTA 4NXMF 2YCHA 3QJPA 3MM6B 4OKEA 3SK3A 4ZCLA 2XCPA 2C1EB 2D5RA 3HULA 4JRQA 4E19A 2HSTA 1RT2B 4OFZA 1QSSA 3FFKB 4OZ3A 2DJWA 4IEIA 4R25A 3W61A 3THYA 4I1TA 4GRSA 4OI2A 3B82A 3T5KA 2IVFB 3A8KA 2QLJB 5F8GA 1O0PA 4TSXA 3SSQA 4LBIA 2A10A 4RW4A 3FK4A 3G87A 3ZZUA 4WFAQ 1RT2A 4DCOB 5B0DA 1LK5A 4F0KA 2CNOB 3HP6A 1RAJA 2FLPA 5K9FA 1QVFM 3HL8A 3Q22A 5EWFA 1E3MA 1WOSA 4ELVA 3THVA 4IJNA 5LMUK 3R97A 1NBEB 1Q81O 4F67A 5SZTA 3GYGA 5IOLA 3ID6A 3DXSX 5EY4A 2W4DA 2R2TA 1NNEA 2OEKA 3RJMB 2UV8A 1P9YA 4WQ5C 1RCOB 3QT5A 4FJNA 2XY8A 4BG8A 4I6YA 3QBWA 2FJDB 2DH7A 1F60B 1VQNN 3OPKA 4FJGA 4P2FA 4FWOA 3MX2A 4YY3F 4F9OA 4O4GB 1SS6A 3K8VA 4AF1A 1YJNN 2IJNA 2DGXA 5IV3A 3D3BJ 2KXNB 1HHQA 3BGLA 4CFCA 3MOZA 1SL0A 4CH1A 4UTGA 2R8HA 1VQ4S 2VG7B 1VQSA 4S0MA 4LF4F 4X4OA 1H0HB 3UCGA 2J9EA 4DR1J 3E9PA 5HP1B 2GVZB 1B9DA 4MQ3A 3OR2A 4I6MB 2ITGA 3CCRN 2MKSA 1VC0A 5KT4A 5BPLA 3CE8A 2MKYA 5IQQA 1RT6A 2F8SA 3WQTA 4CZCA 3QFPA 2RRAA 5AE2A 2G8UA 3CQYA 1UFLA 4RW9A 2VQEK 1TV6B 3T9NA 5JVHL 2YH0A 1U1RA 3LGHA 4DU3A 3B8AX 1WKJA 2YKAA 3L2UA 4AL6A 2QN6B 4ZCMA 2UXBF 3HSGA 4A2BA 3SDEB 2FC8A 1W0HA 4BRPA 4XAKA 4KHUA 1IBLJ 1JLFA 3PSIA 1UW4A 4JD2A 2DNNA 2CQ3A 5LY3A 3L2WA 3AAPA 3BDEA 1VGYA 5TKYA 4CI6A 5AXMA 3NNHA 4DV5K 5AXLA 2W2NP 3U02A 2RB7A 1L3SA 2CYYA 4IWVA 4K7QA 5KFCA 2W25A 3ZZYA 2O66A 4C3LA 5C24B 3IAM9 1T05B 2CQ4A 3W7BA 4FL9A 3CB4A 1K44A 1K8AT 7FD1A 4LF4J 4HTIA 5F9NA 5AQPA 3WUHA 1HWJA 1X5OA 1D8ZA 4PHTX 4BHQA 3IMXA 2O01C 4CK3A 4C9DA 3GV5B 1OH8A 2YQ0A 2EG2A 1U6FA 2LMIA 3SMZA 3UQSA 3WEEB 1T9WA 2B8PA 3IBFB 4V19X 5AQWA 3I9ZA 4RNHA 2HS0A 3L7PA 4CD3A 3VVUA 4MT1A 3N4WA 2OMLA 2OZSA 3DM2B 1CG2A 4MKBA 4QWCA 4CJRA 3AO4A 3O5TB 1Q1KA 5M1KA 3CJQA 2NUBA 2VBXA 1RT7B 2Y9HA 2P9PB 2DNGA 1ACMB 4OKKA 5DM6Q 2V67A 1H72C 5J1EA 4F3QA 2G8KA 4IJAA 2MTLA 2DHAA 4P2XA 1S59A 2KYZA 1TQLA 4O3SA 3HKWA 2BRLA 4IUFA 1ZTTA 2B4PA 5EOYA 2F3JA 4CLSA 1QQOA 3UIQA 1AYEA 1MSWD 1KQSM 2G1HA 2DR9A 3NS7B 1OH6A 4LFAK 1RWVB 4YUDA 3KJVB 2HVDA 5GAEP 4PKHA 5HJXA 5E0OA 3MPYA 1FKOB 4LRAA 3RVCA 3AA3A 1FKPB 3TAGA 4W5OA 1NBWA 3RMDA 3H0PA 1WHWA 4WYLA 2U2FA 3QIPB 3PSFA 2KTQA 1N32F 4U8VA 3BBBA 1MNEA 1I6JA 2Z1HA 5D0EA 4FLXA 1V6HA 2PA3A 2ZH6A 3FEXB 5C25B 3WZ0A 2VONA 2EC2A 3FFIA 2E5LF 3A0IX 1TFWA 1KHVA 4PYDA 4F0MA 4ZVFA 4O4RA 3M9MB 4TQSA 4RWXA 3MR7A 1NGJA 5IQ6A 3KG4A 3EVMA 1XR5A 3WIVA 4K4TA 4U7UK 4H4MB 2R7UA 2UV8G 3L6QA 2F65A 4OVLA 1JB0C 4BREA 2MGZB 2V2ZA 4OIXA 2YHBA 1KLMB 2J6TA 1CZAN 1S6QA 2D0AA 3RBXA 3ZFVA 4PKIA 5THWA 1WSIA 2Z1GA 1PAUB 3V6HA 4FW1A 1U24A 1BCMA 1N5VA 5ETLA 3Q8YA 1SJRA 2DPNA 3Q8QB 4YQWA 4ECZA 4ANDA 2V9KA 3NL0A 3CJ1A 1VMBA 3JS9A 1AXQA 1RWKB 3BV8A 5T7BA 2ZUGA 2RKIB 5FDLA 4DZ6A 1SC4B 4BRKA 4HH1A 3MWPA 5AT1B 3D2EB 2BA9A 3ZTPA 2XNQA 1JLEA 2DGWA 4B3MJ 1T03B 3U9ZA 4JI7F 4CM2A 4DR6J 3CQXA 3MK6A 1J9AA 4CF2A 2H51B 4UF4A 4ZDNA 3QFHA 1YIJS 1KEKA 4M3XA 4F3TA 4IG0A 3CO0P 3B4MA 1NLKL 3O44A 4M5GA 1S9EA 4EMDA 3NHGA 1SH3A 1TR0A 4PAAA 2CQ0A 3DOMA 1H1VA 2MY8A 3RGIA 2D1KA 3IG1A 3OQ2A 1M1KO 2JWNA 1LWEB 3RAQA 2ZUAA 1HMVB 3NAIA 4I6AA 4Z0UA 2VKZG 2DY9A 4I7FA 1GK8A 2IIRA 3CG7A 1TK8A 4P73A 2V52B 3ADAC 4AXJA 4RW8A 1NRKA 2CWXA 4OX9F 3VQTA 3DLEA 2DR5A 1X4DA 2HHHK 3MMCA 2QXLA 2XMTA 3FNNA 3I0SB 1T3VA 4U7UD 4F4KA 4ED2A 1EIYB 3ZZTA 4QPXA 3RUBL 3NF7A 3IRWP 4CHYA 1Z2LA 1S3XA 1SH0A 4GVLA 2HMPA 2W41A 3TA2A 5DG8A 4E7HA 4CYUB 5HL7L 2OCEA 5H9EJ 4L76A 2EFNA 3X3UA 2CG8A 1YJNS 1HBOB 4F26A 3PYGA 4CO1A 1Y5LB 1N33F 4AYBD 1U6ZA 1CJUA 4DPUA 4UY8T 4FYXB 1GNKA 4WYBA 4N47A 4L74A 2J5AA 2VICA 3SI6A 4KIAA 2IYIA 3MAAA 2IRXA 4BGAA 3EKUA 1JCEA 2RSQA 3C3LA 4OX9J 1CVJA 1W26A 2AKWB 2GGPB 4FS2A 3L2QA 5KFLA 4H54A 2G8FA 5J2PA 3V9XA 1ZM3A 5KFDA 1WELA 4DXLA 1X4AA 4MMOA 1DLOB 3ZT3A 1SKUB 1PBAA 2ZOFA 2EXUA 1WSEA 3A5MC 3IAYA 2BW7A 4Z4FA 4Q0BB 2OTJN 3TA0A 4NYNA 2YX1A 1LXNA 1QAIA 2AGQA 1QTMA 1VBZA 4LF1A 2DH9A 4WQ5A 4TYBA 3MEDA 2I0XA 4NX9A 2KLAA 1FX2A 2UVRA 3M6VA 4Q45A 4OLOA 2F8HA 3DKDA 1WNSA 3K9JA 2L9WA 1OY6A 2VOPA 3VQDA 4B3SJ 1IKWB 3V9SA 3EGNA 3QSIA 5F8HA 3M2RB 1WTBA 3PX4A 2XRIA 1RLCL 2M5YA 1GLLO 4NYPA 4LT6A 4FF4A 3CD6S 1CULA 5I42B 1NGBA 3OYGA 1IBKF 3A5LC 4OHWA 1BHLA 1O5JA 3TJ9A 3O8MA 3PRDA 1NGCA 2YKOA 1TVRA 3M32B 1C4AA 4A48A 4RNNA 3A8IA 3VEWA 1R6YA 1C1BA 4Z7CA 3KKSA 5EX0A 3CC7S 4M63C 4TXSA 9RUBA 1VIXA 2XM3A 3V6DA 4PG7A 1WHVA 1RBSA 4HT7A 1LV5A 3RZAA 4QU6A 3VQPA 4HHHA 3I87A 4K2XA 1DJ0A 5ETNA 3E51A 5HK4A 1B64A 3VWSA 5AQUA 4CNYA 2H3EB 2I5JA 4FS1A 1HJRA 2PBDA 2UU9J 5C15A 4OZ1A 2Z1JA 4ED4A 4KB0A 1IXKA 2I7NA 4X84A 5BR8K 1JMTA 1ZM2A 2OIHA 4TU9A 2A0FB 3M1VA 1RWNB 3G6EN 3VERA 1R8PA 4P72A 3LZIA 1VQYA 5F1XA 4P75A 3PR4A 3W9HA 4E89A 3PNIA 3VETA 3W8PA 5BYSA 5B0FA 1WNEA 2VG6B 3KWIA 4CJ7A 2FB0A 1U7LA 5KT7A 2IVNA 1VK8A 4CHPA 1U8WA 1JL1A 3GYXB 3TRGA 2IPOB 3SYZA 1JLCB 2ZWOA 1YLXA 4QIFA 3A13A 1XNQF 4E1NA 3TU5A 2HBKA 1JLAA 2E5HA 2PZSA 1VJWA 2MZSA 2LXIA 2IDLA 2OTLS 3SPZA 4DL3A 3EUNA 4I9LA 2YHWA 4ECWA 1WOOA 1I51B 3MM5B 3K5NA 2KM8C 2ZKTA 2OFGX 3K5PA 5EN1A 1WKLA 2RU3A 2GJ2A 3EXCX 4JKHA 4WP8A 2M3DA 3O3FA 2V4RA 2R42A 1FT8A 4P7TA 4I69A 5GAHP 1RWUA 2E2QA 1T9VA 1NSQA 1RYSA 3PIPL 2VWJA 1U25A 3H2VE 2OSQA 1FRKA 2OHDA 2VGNA 2FBYA 3W63A 1GMWD 4AM6A 1JLEB 3FBEA 5F41A 4ER8A 1BQNB 1T3OA 4DI6A 1DTTA 2MLYA 3O9RA 2JWLA 3TAFA 2VFUA 1MN7A 3K57A 1G7CB 2CPHA 1BOTO 2V63A 4J9QA 1T6DA 2COLA 1P1TA 3EGWB 3SSRA 3D7EO 3GOIA 1HBMA 2XCAA 1IBLK 1KD1T 3G82B 2Q79A 1GOBA 3UB5A 2PYJA 2A41A 5AJ3J 2DR8A 3M30B 3ZZPA 4CGGA 3I56N 4DCPB 4C8OA 2F4VK 4DR7K 1VRUB 2KI2A 2LQJA 4MDAA 1A6LA 3OW2R 1DZ5A 4LIWA 4DQQA 1O1WA 3DDNA 3AXMA 3MD1A 4DV4K 2MJUA 4KHQA 3PTWA 2YNGB 2DY4A 2LEPA 3EPIA 2FSJA 1MN9A 4F8RA 1JLGB 2CKWA 1VOMA 3ID8A 4DMZA 1LAWA 2ZH5A 4B1VA 5B0AA 1FHTA 3S6EA 3MAHA 4ZTFA 1OWXA 5A2QY 2R7TA 3ZSQA 4BC3A 5B0GA 2DGSA 4LF8F 4MAKA 1K47A 4MYUA 4CJSA 1S1TA 2OSRA 3VMFB 1U2FA 5KI6A 2G8VA 1PYTA 5HROB 2AZ1A 4OZ2A 1UJ4A 3TP2A 4OYIA 4PUOA 2HBYB 5EU7A 3SJHA 4ZPVR 4USJC 2XULA 4Q8EA 1NPKA 3MPUB 3KJNB 2FGOA 2HIYA 3RMBA 2BKOA 3UI3A 1LAVA 2W2OP 2B9YA 1ASWA 4IYQA 1EP4A 3PACA 2BE7D 1H2UX 2ADCA 2OFHX 2H54B 4PXBA 2IBOA 1VRTB 1H73A 1VQ5S 5LMUJ 3SCLE 3CC2S 1D5AA 3OTOF 2CQBA 1N34J 1DBDA 1LWCB 2EFQA 1V5VA 1RHKB 1RDRA 1Q7YO 2YQ1A 3PYDA 2KW4A 3CQ8A 1VQ7N 7AT1B 4AD6A 4E2FB 2R7QA 2NRTA 3W2VB 4GY2B 5BRDA 3IR5B 3DLHA 2JC0A 4N56A 2PGCA 5KFFA 1K8KA 1LQ9A 1NGEA 4B9NA 3P31A 2OEJA 1UVNA 3DN9A 3NGKA 1ATNA 4Q8FA 4FXWA 2P8IA 3MM9B 4ECQA 2O8BB 4QCLA 4QIGA 2JVRA 2CPYA 2PEHA 5CHIA 1TVRB 2R7OA 2X6SA 4EYHB 2W6LA 4WCEQ 2B4OA 4H0XB 3KVGA 3DLLL 2VCPA 3BN4A 1UETA 4J9VA 1H3DA 4NYOA 5C5JA 2YX4A 3AH6A 4Z4CA 4FJ7A 2D3ZA 3CFOA 3K58A 1VC5A 4EEYA 3R1XA 2CQ1A 1JJ4A 3IR7B 2VQFJ 3QT7A 3V9WA 3M2RA 1GMVA 2APOA 3MUTP 3CF5Q 4ECYA 1S1WA 2W4CA 3CD7A 2B4JA 3T7ZA 1IKVA 1T3NA 4CI0B 2J7WA 5KOXA 3LTOA 3T1AA 1LFPA 3C15A 3OYDA 3CETA 3CJKB 3HSDA 3K17A 3WXIA 2XHCA 2IRYA 1BWFO 5BN9A 3V81A 5DQHA 4DV0F 1Q86T 4JK9A 2GFFA 5GAGP 4NXMJ 3B54A 2V9WA 1HD1A 5J2MB 2IVPA 5EXWA 1SH2A 4AFFA 2DGOA 2RS8A 1N36F 5DJBA 4JI1F 4IFVA 2FXUA 4GC6A 5M2UA 1WEXA 2LP4A 1RBLA 3ZT1A 3CCSS 1S9GB 2DFFA 3KLFA 1E6VB 1KVIA 2BE9B 4CJEA 2GCFA 4ILRA 4B08A 3OYNA 2BM0A 2VV5A 1K1SA 2X3GA 1SB6A 5CZ2A 4PQUB 1XK8A 4LRBA 1D9AA 4X66F 2B43A 1U04A 1YZ6A 3EJMA 3CMAN 3JTPA 5D8HB 1NGGA 1I94F 3AOBA 4F4YA 3NH2A 3PXGa 5KRTA 2CPEA 1Z05A 3CDAA 1VSKA 3BEXA 1S1VA 3HVTB 4HI1A 2JLFA 3ZXWA 1FFSB 2HHTA 1VQ8S 5KFGA 3IS9A 1Q53A 1WF0A 3MPDA 1RDAA 3AJ1A 2BXJA 1RISA 1WUUA 4I4BA 4GC7A 2YX7A 1FRIA 4CT9A 4WF9L 4QW9A 5JICA 1IWAA 2NS1B 2ZH3A 4ERDA 2DB1A 3N5FA 3D68A 3JXUA 1VISA 3PFEA 3MM9A 5FLXY 2W9AA 2HEKA 2IMOA 5EX5A 3OL8A 3CJ9A 3FBBA 3Q7CA 3OHAA 1SPBP 3H98A 4B3MF 5AR0A 4K4XA 3UD4P 1BA1A 2N3OA 1TL5A 2NXJA 5KFXA 3O3GA 4B9MA 2NRHA 2HLUA 1P1LA 4Q43A 5D0HA 3ITHB 4YNQA 1CXQA 4YOTA 3VGUA 3VEZA 2U1AA 4NLQA 1NJIO 4FNIA 3P49B 4LBHA 4B9TA 1E4GT 3DRYA 1VSFA 1VQPS 2QFIA 3HHLA 3AD8C 3O1WA 5ETKA 3BO4A 3PJXA 3CO9A 1X31C 2P9IB 1PBUA 4ZS6A 1TK5A 3NMAA 2Q66A 1GLAG 4JV5K 4IG3B 4DSJA 3GWCA 2DHGA 5DLFA 3S1TA 1JWWA 1MWQA 1LFWA 3GFZA 3SUPA 2I6WA 5LXYA 3QYYA 3M8WA 1Y64A 3CM6A 3MEKA 4RW8B 4B9QA 2QA4N 3MM6A 5B8HA 2V4QA 1BHNA 4YDUC 4NZ7A 1U45A 3QPIA 4WFBL 2XC9A 3DOKA 3LOUA 1GXLA 2HFNA 2E5GA 3RB4A 4DR1F 1FD8A 4CZFA 5D4NA 2L48A 5CE3A 4AILC 4QS8A 3OD2A 2A40A 3V9ZA 3B4DA 3RRGA 1JLGA 3I56S 4EFAC 4DU8A 1ZM9A 5EX3A 3WXJA 2IOCA 3MF5A 1D09B 2PDAA 3GDQA 2Y3YA 5LMNK 1RWXB 4QOZB 3RMCA 5IFMA 3V1OA 3UKUB 2DKOB 4PR6A 1Q79A 2XMKA 4OI6A 1TL7A 1U8SA 1IJJA 1UFWA 1S5ZA 1IQTA 4ED8A 2YWGA 4FO0A 3QWPA 2HQIA 3FFIB 2MMYA 3VA0A 3TYTA 4LSNB 3GIRA 1S0OA 3CYMA 4GVEA 2DITA 3PIOL 3C6TB 3SQGB 3NWGA 4DF4A 4I2PB 2FZKB 3T19A 3C2PA 3MEGA 3I8BA 2DEIA 3KUHA 3EWGA 1FXDA 1RT4B 2XSJB 4EHUA 3CDUA 3OUYB 4PG6A 3JXOA 5E2QA 3D54A 4RPFA 3AD7C 4X64F 1X5SA 2FJXA 1RHJB 4QQBA 3DMJB 1VK0A 4JI4K 1Y00A 2EX3A 3S3OA 1VDHA 4G65A 1YAGA 2R7WA 2ZE2A 4O5FA 3NCIA 1RTJA 1BUPA 5GAGI 1SCJB 2QG9B 3GFXA 2RT3A 2DD8S 4MK8A 1QHAA 2QMXA 4L3KA 1AZSB 4NLTA 4BR9A 3ULEA 1FKAF 4MKYA 2K1RA 4H0VB 2VD3A 3R5BA 3RYLA 4L75A 4EGLA 5CABA 3DU5A 4IO1A 4KB7A 5A76A 4LFBF 2CJ9A 3BUZB 1N56A 3JAMY 3VQ5A 5AQYA 2NNWA 1T95A 3U3GA 5JUMA 3AB2B 4YORA 2R3VA 1R8AA 3OSPA 3GL1A 2UU9F 5HMXA 1EXQA 1GTHA 3M8RA 2D0BA 3I31A 3TSPA 1REVA 4J9MA 2Q31A 2ZVIA 3AODA 3DI6B 3CCMS 4TY9A 4USUA 4HHJA 4WIQA 2DPJA 2CPIA 3GILA 1U49A 4E7JA 4RUCA 3SNNA 3J8AA 5GADU 2O4GA 3G86A 3NOGA 3A4TA 4H4OB 4OPJA 4CEDA 2ASOA 5K14B 3QJJA 3CCVN 3R1LA 2MQNA 4BLGA 4ZPBA 2KKHA 6AT1B 1X4CA 3V4MA 2V68A 3GU0A 3TAQA 2HFUA 1WDTA 4BRDA 4CESA 2CJYB 2ZBQA 2BQUA 1SVDA 5DGBA 2H48B 3HPGA 4PZVA 4DS4A 3AOAA 2V7ZA 1WC1A 5CD4A 1HI0P 4DTUA 5AZIB 3W65A 1BI4B 1GLBG 4LF7K 4QPTA 4JV5F 2Y1LB 1A5WA 3LUYA 1S97A 1ZPVA 3OXLA 3BQ2A 1UCNA 1PGZA 5KPRA 2CDRB 2QTDA 4DL5A 3Q8RB 4FWPA 2RIJA 4YP3A 2CXEA 2GHWA 3ONQA 3FQKA 2C3UA 1OQ6A 4BS2A 4HUGA 4U6PA 2KL8A 3QNNA 1RTHB 2CQCA 2XS2A 2BJEA 4K25A 2WTFA 1R8CA 2RUSA 5KFBA 4IOCQ 2XYHB 3UCUP 3U1NA 3OJUA 2MKIA 3ZX3A 5E3QA 3AVKA 3I5AA 2JFDA 3C19A 2VG7A 3ICLA 2IHR1 1DAXA 1YJWN 2YBVA 1IVZA 2MQLA 2HF3A 3CXCM 2CAJA 4C8YA 2Q0RA 2FLOA 4BR7A 2W2PP 2YY3A 2AYGA 3EZ5A 1BWEA 1XJWB 4NXMK 1TUUA 1HNXJ 2IA6A 4R8UB 3MZIA 1CBKA 3RB3A 5EWGA 4X66J 4A8XA 4GKJK 4PPZA 4GNIA 2GIQA 1FJ7A 1M5SA 4CTAB 3LDPA 5CYMA 1EHWA 2JX2A 3F0NA 1JX4A 2BMBA 1Z25A 1TKXA 1C0TA 2HFVA 2DNOA 3OBIA 1OH7A 3LA0A 1NMNA 2WSFC 3JSMA 1NDLA 1OY8A 1Q0NA 3DDKA 4WJBA 1UTAA 2HZAA 2VZ9A 3DHWC 1DTTB 2HURA 4G1QB 1U1LA 2RHKA 2GJIA 3HI0A 1S1XB 3SMSA 4DV7J 1VSEA 4DR3F 2DNMA 2F7VA 4CZKA 2D41A 1VJQA 5EGYA 2J8SA 3N6LA 1M5KC 5K14A 4OYPA 4NLDA 3HFVA 1JXEA 2ZOMA 2XY7A 5ETMA 4YY3K 5KFIA 4CH7A 4E7IA 1LKZA 1P8GA 2XGPA 2ZJRL 1N33J 3OS2A 4AXIA 4DN9A 2NR0A 3QGGA 2V2VA 4OLAA 3MMAB 3OTCA 3T1HJ 4U67Q 3DXKA 4FLVA 3WT0A 3ZT0A 3LDQA 5ETVA 4DR2J 3VQ4A 4LSNA 4PXCA 1HWUA 2BJ1A 3IA0A 3MXHP 3D6HB 2E1PA 4EAHD 1U1MA 1D0EA 2IRUA 4ZVGA 3OFFA 4URGA 4U96A 3HZEA 3ZNJ1 4W90B 3SUOA 2AYEA 4NCGB 3H90A 2XTJP 1U0HB 1TTHB 4B3OB 4FPRA 2G2OA 4E7LA 2LFVA 4JKCA 5M1OA 4X62J 4FWRA 1A5XA 3D2EA 3HOSA 3I55N 1AUDA 1UZHA 1KQSR 3R7SB 4KHPJ 5H1SQ 3MI7X 1QTNB 3ETOA 1PILA 3QERA 2CH6A 2PIIA 4PWDB 3EGZA 1KVKA 3W5XA 5K8MA 2CJKA 4J9UE 2EWSA 2DBBA 2GMJA 4PWDA 4DU1A 2C2RA 5FPNA 4DPYA 5JVGQ 4ED5A 5HI7A 3W62A 4C1NI 2P6TA 1ZA2B 1UZDA 5EWEA 3IP0A 1S7HA 2EI5A 2HKEA 1RDBA 3BN7A 4NA3A 2K3KA 4PG4A 2E9RX 4RUBA 1GT8A 4X64J 1TK0A 1N5YA 4CBWA 3SFGA 3SDEA 1RXOB 3HHLB 4JKGB 4NWBA 2NSCA 2HYIB 3CJ3A 2AEMA 2M88A 2VC0A 1V9OA 1YJ7A 1KOHA 3MFIA 1TV6A 2DISA 3T6BA 5BR8J 4QIWD 2XZWA 1O6XA 1Y3KA 1WG1A 3RWUA 3HZ6A 4ILJA 4FYYB 4ZPWR 2C2OB 2JLEA 5A2QU 3DOKB 1KNZA 4A5BA 2O8BA 5C2DA 5C25A 4W5RA 2Y8WA 2WUSA 3OYMA 2ZDPA 3TO8A 1HMVA 1BD6A 1NGIA 5IS2A 2G8WA 2GA7A 1NSKL 3CPWR 3BGFA 4K4SA 4IDHA 4XEIA 1XNRF 1BC6A 1WC0A 2RILA 3CJRA 1L3UA 1CXUA 5KFNA 4FNHA 3TVKA 1RB0A 3CD5A 4DSLA 3ZETA 2HRUA 2M4MA 1T6CA 1RT1B 1A9NB 1F5AA 2KFYA 1N32J 2RU9A 2VQFK 4KYZA 2H5JB 3RBZA 4OX9K 2CPXA 1VQ9N 4AHUA 2DGTA 4QYRA 4ES2A 4BDPA 3QIOA 2ZH4A 1EX8A 4E0DA 1ZBIA 1MU2A 2AEFA 4M3WA 3IWLA 1CEZA 4J2EA 3GB0A 3VOVA 4ISFA 2C2ZB 4OL8A 3CCVS 2HHPA 4P2MA 3ISZA 1SJ3P 1XMBA 1YJ9S 3QMQA 4Y2MA 1UVJA 1QSLA 1S0MA 1NK4A 1NK8A 4OX7A 4QWBA 5KFMA 2W24A 3KK1A 3W2WB 5AQLA 4USVA 1FF2A 4IH6A 2WRMA 1GMWA 5E3RA 4CCHA 4JI5F 4DR3K 2FVRA 2NCKL 1SJ4P 4IFVB 2H9ZA 1B7YB 4IQMA 1VS3A 4HVZA 5IWAK 5LJVA 3J81Y 3T1HK 3LP3A 2H1YA 4HHTA 2DK2A 2KU7A 2NZ4A 1H2TZ 4DPWA 1N48A 2XMWA 4BROA 2KQ2A 3MECA 3NG8A 3KUGA 2E1YA 5KFJA 4LF9F 3HVTA 3CD6N 4EYIB 4YFUA 3DRPA 2MQ8A 5J1PA 1VQKN 3M3ZA 2EPIA 4MKVA 2YV0X 4W98A 2HNDA 3ILJA 4IOAL 1QHTA 1B4SA 2PSZA 2ZEJA 5KFUA 1IKXA 4O3RA 2I1RA 4NMXA 3MEEB 4KV8B 5CYJA 2O8FA 3MEDB 3UCZP 2GC8A 3AVHA 1OVQA 4XPCA 2HIQA 1S9GA 1UEKA 3ZSWA 2VFTA 2ILYA 3O3HA 4C2MA 2LA6A 1FRXA 2VFSA 1T03A 2UZAA 3MCMA 2N82B 2OA8A 5F3ZA 3GIMA 4A57A 5AQQA 4ECRA 3EPGA 1NJYA 4W5NA 2VBYA 2BE2A 3AQPA 1S1UA 3PFOA 4OI0A 2ZKUA 2JOQA 2B0GA 5BR9A 1FRJA 3W2VA 2QWLA 1HPZA 3AA8A 3W5ZA 4H4KA 4YR0A 1HQUB 1XBWA 1O13A 1V3SA 2CNKB 5HVGA 5LJWA 2G8IA 3SQOP 3KLIA 1VQMS 3FC9A 1CJTA 4NLYA 4M3YA 4BE1A 1FK9B 5F8JA 2HPUA 1S1WB 1MLAA 4JV2A 2PFFB 2GHPA 2KH9A 3QWUA 2LQ5A 4RNFA 4ZP7A 4DUYF 2HB5A 5T41A 2CRLA 3QRRA 3DI6A 1R7IA 3WEEA 4LQ3A 4AUKA 3IRXB 4CD1A 3I0SA 2JVOA 1UFKA 2VPXB 2YVSA 4RU2A 4ZPAA 4KBIA 2FUG9 1S49A 3I33A 1X5TA 4MDBA 3QO9A 2AX1A 1U0SA 1N33K 1RKIA 2GNKA 4JB8B 4F7VA 1CJTB 3BQ0A 3L8BA 2ZWHA 3O8WA 1K8KB 2PA8D 1NAQA 3EGVA 5LJ5Y 3K8WA 2QXFA 4ZVUB 3J7YU 4JN4A 4GV3A 4ETXA 1VLYA 4X4PA 3A5NC 1MDUB 2ATQA 4X65F 3H1VX 3P83D 3LM9A 3IBCB 3RBDA 3O9QA 3H3OB 2DFHA 5BJRA 5AFUA 1WEYA 2OELA 1HYVA 3F5TA 3M4XA 5HRPA 1VRUA 3D2WA 3AXKA 1O51A 1ATSA 3PJ9A 4GV9A 3NLCA 1KWMA 4PWWA 4FW2A 3QRPA 4CHQA 1BI4A 1QSYA 1ITPA 2H3GX 2YNFA 4RKUC 3KK1B 2OO4A 3VEOA 4CEAA 3GJQB 1RGVA 2YKQA 1WTFA 1FW6A 5FIIA 2I9SA 3WDOA 4URQU 1HFEL 3TAEA 2MLZA 3UNYA 2VU5A 3DLLQ 1GLCG 3MMBA 2L3MA 4M8LA 1P27B 4ATNA 5ETPA 4O44B 3I4HX 2FBVA 4UOCA 3T1HF 2KVIA 3MMVA 2C2DA 5T7LB 1FJGJ 1J5EF 4Q5VA 2YNIB 1V3RA 2QL9B 5BN8A 5CR4A 4JKBA 4AHVA 1N36K 4FF1A 2UXCF 2FHJD 4WE1A 2Q6CA 1HR0K 1VK3A 2E5LJ 1NB7A 1IBKK 3GJSB 2IA0A 1YGYA 5FPMA 1EETB 4DV7F 3US5A 1IBLF 3HYFA 4RX6A 3GV8B 1Q82O 3CCJS 1JLAB 4XH5A 4CF0A 5AQNA 3FRZA 1X4FA 3PW0A 3BQ1A 2GAHC 3JSRA 2V8DA 4LF5J 1VQNS 3KYLA 3NFAA 3G82A 2DNHA 1YXQA 4RBUA 4YOUA 3P39A 3SQ0A 1HQ2A 4LF5K 4ZVTB 3EE8A 3GBTA 1KCFA 4GVBB 5M1NA 4ED1A 3EE3A 2Z57B 4KTZA 1U2RA 4O3QA 1NK0A 4DTNA 1GLDG 1WACA 3KHLA 3THPA 3VF6A 1T44A 1FKPA 2E44A 1X5PA 3KHGA 4TN2A 2NRWA 3ZNUA 1IM4A 3M05A 3AVMA 4HCBA 2ZE2B 1GEHA 2VQEJ 1NH7A 2GBZA 3A3NB 1SUQB 5F0UA 5ADXH 4KAIA 3TAMA 2OJ3A 4DV7K 2KRBA 5HLFB 4RO0A 1TZ0A 1FERA 5E3CA 4ANEA 5DO2A 1H38A 1FTCA 1WI6A 5KFWA 2AA4A 3N6MA 3QDKA 2QL5B 4LR9A 4GKKF 3TVYA 4TKTA 5D78A 3OT9A 1HKAA 1YJ9N 2RD5C 2WSCC 2XG8A 1NZAA 1OMSA 2ZJQQ 3BSCA 4NEYA 4C0HA 4NZ0A 3SV3A 1D9DA 4ZA1A 4WF9Q 2NLWA 4Y1CA 1CQMA 1G6BA 2J4RA 2A3JA 1NDCA 4B9UA 3E3XA 5AQZA 4DUYK 4H5RA 3L7UA 4N41A 4M42A 4AQYF 4XH1A 1RU1A 2Z1IA 3J81j 1SKSA 3ZT4A 4ZPCA 1PYOB 1QS4A 3JTNA 4YB5A 3SCIE 3VAMA 3PY8A 2HOEA 2P9LA 1N5QA 4OMFG 1WSVA 3LL3A 4H03B 1CLQA 3F56A 2AP6A 2DEJA 3C6UB 3TX0A 4DV0K 2C2EA 4JI8K 2KXFA 5ETSA 5F8MA 3VEVA 4JNEA 5IT9U 3QBXA 3HVWA 3LPEA 4JI8F 1NDKA 2PY5A 3MOJB 5HN0A 1T05A 3NGDA 3M8PB 1NB2A 4LF7J 3T41A 3MMAA 2KZMA 4DV3F 4DR5F 1C0UB 2HQ3A 2NXCA 3KLFB 3CCUN 1S6PA 4E3SA 1KBRA 2CVEA 1RTDB 4EO8A 4H8KA 1IBCB 1XERA 3GONA 3CDEA 4X66K 3TNVA 1JLBA 3W60A 3HM8A 1T11A 4HTUA 2H4WB 3MR2A 2CZ9A 1KTQA 3GIIA 3FVYA 2PMWA 1J27A 1OVYA 4IH5A 3MR5A 4YHHF 5DDQC 2YH1A 2JEFA 3VQSA 3GFYA 5KRSA 1S4FA 4KGMA 2QLBB 1DGKN 5FRMA 4HDHA 1YF5L 3FDSA 2YKMB 3AJDA 4KGVB 2ATLA 4F2RA 4NRTA 1QY7A 3G2XA 3QO9B 2P2CB 3HXMA 3G8TA 4QR0A 2DXEA 8AT1B 2V4JB 3KUEA 1Q8KA 2X1GA 3LP2B 1VCTA 1TL3A 2PI4A 2VODA 3DRRB 4RBTA 3UN3A 5K20B 1ILYA 2VA3A 2YWWA 4IRCA 5KFSA 1FKOA 1CQNA 4ZVQB 3R8YA 1HNWK 3HHKA 3DXMA 2HHWA 4FJ9A 3BH7B 1QDUB 3CGIA 1RQ0A 1YWXA 3KJVA 5EHHA 4LD0A 5E3AA 3N79A 5AJ3F 1HBUA 4DCJB 1NMDA 2J0WA 2PC6A 1JLQB 2VC1A 4M5LA 5HMZA 1VQPN 1LWXA 1X60A 3FE1A 3QEIA 3VQ7A 5LSLA 2Q43A 1FVQA 4CIGA 1EQ0A 5J2PB 4LFBJ 2XS5A 1U1QA 3HPHA 5AQVA 2BJ9A 4LF7F 2FVSA 4JHDA 4BGBA 4R79A 1VR6A 3V4IA 2FVPA 2IVMA 1UA0A 4KHNA 1HBNA 2HAIA 2XO7A 2IIHA 4BRAA 2HBRB 4PQAA 2XLIA 5JS2A 4LF8K 2UXBJ 5M1QA 4NASA 4PA1A 4DF8A 3UE5A 4FWSA 4RW7A 3IFEA 4JKEA 3VAFA 1N34K 4DQPA 2IDOA 2J7KA 4A8OA 4YN3B 5CHCB 2AT1B 2A5XA 3ATUA 2DO4A 3WXMB 1HL6A 4DHYA 1ZA1B 3F2KA 4RR5A 3MN5A 5KG6A 4IRKA 4CTAA 2W9BA 3MN9A 3TA1A 2OPSB 4WP9A 3DOLA 2DO0A 3RG6A 3ELHA 2XMAA 2W9CA 3JTOA 4B3MK 2DNZA 3HM9A 3HVRA 4R8UA 4M5KA 4Z4IA 3MMCB 3L9ZA 3NH1A 1UL3A 1C0MA 3PDNA 2ZC3A 3FRYA 1XR6A 4EBEA 3DU6A 3LW5C 1NGDA 3NF8A 5CY4A 5FROA 2OPQA 5JLFA 1DARA 3EZUA 1JLQA 3QZ8A 1YIJN 3N0VA 5AQGA 1OJ4A 2MGZA 2Y1IA 1X3NA 1S9EB 2VPWB 2GMLA 2MHEA 1AB8A 3H5YA 1HHTP 2W7AA 4CERA 2KHDA 3BDPA 1MMNA 4IG0B 3NF9A 1HQEB 3D0IE 4RW6B 2OMOA 4NA2A 3HHDA 3NRBA 2XO6A 3OBYA 1J6ZA 3DOLB 3FGVA 4FLTA 4B3RF 3QINA 2E2OA 1AFIA 3K2PA 3CWJA 4FWQA 1RBUA 1JJCB 2GVDB 1YZ7A 4CBXA 2DGVA 2UUTA 4TVAB 2F9WA 3OTOJ 4AL5A 2IBKA 3CSKA 2WW4A 3S8SA 3H59A 4K5RA 5CD4H 4Z7YA 4DLEA 1UEUA 4DFKA 3X1LB 3PUFA 3VQEA 2LXUA 1RA6A 1RT5B 4KE5A 3ETMA 3CCES 4NYFA 3H6EA 5C2GA 2HHVA 4OYWA 4OI4A 4UUWA 4CBUA 3ENOA 1A7GE 1VRTA 1SQGA 1GLJO 2EVZA 4Z94A 4B9VA 2DCUB 2CQHA 3EX7B 4A8KA 2QFJA 4OPHA 4P10A 4LMZA 5HQLA 2XY6A 2ALYB 4O0JA 1C2PA 3I8DA 2M8DB 2DHHA 3CNQP 3L2VA 4F3OA 3CCMN 1DQ8A 2D9OA 2RQMA 4DDFA 2NSBA 2EFVA 4C8KA 4OZLA 1PSDA 1B0PA 4CWBA 2FBTA 3ZSRA 3SCKE 2HWTA 2CWKA 1YJTA 2CNNB 2JJ4D 2E9TA 4CLUA 4DUTA 2RE2A 1DEJA 4FYWB 4OYXA 4CM0A 3HTVA 4WZMA 4M5MA 3QICA 1VHFA 5IT9O 3T1YF 3KDOA 1TMJA 3UD5A 3C16A 1SL1A 1VHIA 3EZWA 1TELA 3M1VB 3Q8SB 3TEHB 3W3DA 4FJIA 1KFDA 3A3OB 3MGJA 4WFAL 2GIRA 1Q16B 4WFNL 5DM7L 4WTOB 2CGLA 2GV1A 5A2QO 2VPZB 3TTDA 3QETA 2AZ3A 3ZZRA 2YPZA 1I94J 2I8EA 2QMUB 5F0WA 2OPRB 4EBDA 1T0TV 3BPSP 4HACA 2XSJA 1RT4A 4XPEA 4F04B 3CMES 4TY8A 4CJ3A 5K8PA 2C3YA 1RT7A 2P9PA 3VPZA 5I3QA 3FCVA 1FE0A 2OD6A 1IM6A 3GR1A 5EUHA 3CPEA 1ZZNA 2DGUA 2VL1A 4A61A 1DY3A 2OPPB 2N4DA 2PYLA 4UY85 4CLWA 4CLTA 3M32A 3CCUS 1FE4A 4QOTA 1AROP 2QA2A 1FI4A 1N6QB 2PO4A 4H0OA 3HJFA 1NSPA 4X4VA 4V19J 3R9LA 2VB6A 1YG0A 2RQCA 3E1YA 5GINA 4QWAA 3E66A 3WX4A 4DV0J 3ZSXA 2IM0A 4N8OA 1RACB 3TEGA 2MKHA 4FLWA 2KHCA 4U9RA 4KKOB 4A46A 2J0QD 3NGRA 4OJHA 1ASVA 5CYQA 3U1LA 5C24A 4E1MA 2YJFA 3BH6B 4DTXA 1ZOTA 1VQLS 3O9UA 1Q7LB 3TSQA 3TWZA 5D0GA 3ZTRA 2VQFF 4E8UA 1VFJA 5IC4B 1FX4A 3HSTB 2B7BB 2K06A 2DY1A 2Z4PA 3UVJB 3LM2A 4JD2B 2AJ2A 1HNIA 4UUXA 5HANA 4G3IA 2DNYA 5JJBA 4C1NK 5LOQA 2HHQA 4ISEA 1HI8A 1YSJA 4KHSA 4A8MP 4K4YA 4HWIA 4CHNA 3CD0A 4DPOA 4O44A 4ILGB 2Q6BA 1NJIT 3JB9k 1OS5A 3O1LA 2AMCB 3N6NA 3O2IA 3WXLA 2J6UA 5A8RA 4NMLA 3IFRA 3SQ2A 4FLZA 2J8AA 2CVIA 1HHSA 2EFOA 2M7SA 2DGQA 1X4GA 3THWA 5EDWA 4ITSA 3PIOQ 3D2FB 4J9PA 5HP1A 2GVZA 2ZJRQ 2DTJA 2OPRA 3H4BA 2AYBA 4CFDA 2HQDA 3ZSZA 5L39A 3CT9A 1RGIA 3KG1A 1UJ6A 1K6YA 1FRMA 2A1BA 2FBXA 2O8DB 2V0NA 1LK7A 3MX5A 4O3PA 4FP9A 2F4FA 3HLUA 2EW9A 2OEMA 2EKYA 1WC5A 3NGZA 2NRRA 1BLUA 5ETTA 4C4WA 1H74A 3PO4A 2VIHA 2EWHA 1LW0B 5A8WA 3T6JA 1GXUA 1GQEA 1LXJA 3IMQJ 4KHMA 1ELOA 4CEOA 4B3TF 2DHSA 5JVHQ 3QFUA 3HDSA 4ED3A 4FJ5A 5FD1A 2P9UB 4FF3A 4LF8J 3O80A 4DUZF 2GJFA 2BUPA 3LP1A 1FXRA 5T14A 2EC0A 5HRSA 5A8WB 4RL1A 4QYZJ 1F3VA 4DV5F 4MTPA 3HX9A 3NCRA 3VN5A 1HIYA 3IC1A 4D3HA 3BYPA 3QGPA 4QIVA 2HG4A 1R0AB 5L38A 2MZ1A 3JQJA 5HVHA 3QLHA 2VFVA 5GAEI 2XMJA 1YX2A 4F3MA 5JVGL 1R0BG 5FDLB 3KZBA 2OPPA 1NG9A 4C97A 3ISNC 3AV9A 4YOYA 1S57A 2ZNYA 1N32K 1NH8A 2R9LA 4X2BA 3EDRB 4GO7X 4OLPA 4BC4A 2JEIA 3EDQB 4H5NA 1KAXA 4OKJA 2ROPA 3Q89A 2MZRA 1QVFR 1PYSB 5FJ4A 4PL7A 4M5HA 2HK3A 4HLBA 2W1BA 1CJUB 5G0RA 3OFHA 3CCWA 1JK9B 1AA1B 3HCXA 5C7PA 1RBRA 4OO1J 4L72B 2C28A 2IM1A 4DV6J 1F2HA 5KFTA 3J80Y 2CJQA 1GMUA 1X4HA 3NDKA 2V94A 3UDCA 2V8PA 1FJGK 3OXGA 5CQGA 2YHAA 1F6TA 5KOWA 2ZM6K 3U4LA 1ZBTA 3BKFA 3HK2A 3CCRS 4DFMA 2A3ZA 2ZM6F 1ZBLA 5E26A 2ZGZA 2HNDB 1CJVB 5IV4A 1VBXA 1R59O 5L8RC 4HTJA 1BGXT 2CH5A 5GIPA 2FF6A 4CH0S 3KHYA 4KRWA 3DHXA 3M2VA 2DIVA 4JI3J 2BANA 1MA9B 2Q97A 2VASA 1J53A 2E5JA 5DRKA 4XK8C 1M5VC 3OYEA 2C2KB 1GLEG 4BDZA 3GV7B 3U27A 4LSLA 1TKDA 1C4CA 4O8UA 1Q9YA 2W9CB 4CJLA 4B3TK 2VF3A 3ZZ0A 3CJ0A 2YNIA 1JIHA 4ZK7M 4WWSA 1C0FA 3VEXA 4B8AB 2PFDA 1G1XA 1U09A 4DUZK 2RMLA 5DG7A 1QE1A 2BDPA 3CM5A 2FHJA 4IZ9A 4NLGA 4IBNA 3VAIA 3TUPA 3K9KA 1Q4RA 3CDBA 4NZ6A 4B3TJ 4J90A 2GVDA 3QEVA 3AA9A 3OLAA 3H25A 3SAHA 2G4BA 3F73A 3DFEA 3EXYA 1JJ2R 1Q8BA 1XNQK 4RW6A 2B8QA 4MYTA 1KVBA 4YOXA 4JKFA 1JKHB 1N52B 5HL7Q 5DDRC 1VQ6N 1UMJA 2VA2A 3IXQA 3LANA 3P5TL 4CIOA 2WVBA 1Q95G 4J37A 1VIOA 5KFVA 4M1KA 2F1FA 4TNOA 5KPZA 3UKRB 3A2FA 2HQGA 4ZVSB 2EBEA 1EWRA 1OPIA 4ZN3A 4ZLPA 4AL7A 2O1PA 4NLPA 4DPXA 3NGYA 1F21A 4ZVRB 1NLVA 1G4CA 3RR8A 1VQ8N 3QEWA 3EEQA 4I56A 2ZD1A 3R5GA 3BZCA 1KSPA 4HUEA 1V4TA 1JQGA 2ZITA 3LQVA 3LPTA 1K9MT 3W9JA 3TJ8A 2R7VA 5AQKA 3QIPA 4WXWA 1ZETA 3ZCMA 3KTQA 4KHRA 3MWBA 4F36A 3OL7A 2UUCF 1IV0A 4BR2A 2YHYA 2GEMA 1XNRK 2XI3A 1VSDA 4C8NA 1YVNA 2RDIA 5HRNA 4BC2A 4DKWA 3OTOK 3K5OA 2QGFB 3MFHA 3Q83A 2FLNA 2D0CA 4I68A 2V50A 1RTDA 1P9QC 3FQLA 4FSVA 5FPEA 1FTRA 5KGXA 1HI1A 1EAYC 1X3MA 4OPAA 1UEVA 2AP1A 4JHDB 3LAMA 3RRKA 4X4TA 1K73O 3E9LA 4J8FA 2ZWPA 1FFWB 4DWIA 3DLKA 5D0RA 2R8JA 1C1CB 4KBOA 5HO4A 2BR0A 1WDDA 2J76E 4FN5A 2O67A 5G4DA 4ZP8A 4NA1A 4NLSA 3MURP 4M3TA 4JI6F 3T5LA 4HH0A 4C23A 1N8RO 2FLLA 1UVIA 2DNKA 1KOOA 2ASYA 3GZ7A 5IM0B 4DSKA 1NM1A 2QC3A 4Y34A 2JWKA 4WFBQ 4WE1B 2RVJA 2MEWA 2ZDOA 2MZTA 1IH7A 3JSBA 5B0EA 2LECA 4B3SK 2P5OA 1APSA 1TMMA 4JKGA 1CC7A 1ZZFA 1AFJA 1SJ1A 3NXZA 3PV8A 3IO1A 2BRKA 5T7LA 2HBJA 3NEKA 4QR2A 3OSNA 2X74A 3HFKA 2JRSA 3TUIC 3FBCA 4GKJJ 5LMNJ 4HCCA 2WOMB 4CLYA 2CIMA 1MWZA 4B17A 1WG5A 3KLGA 4PPDA 2C2NA 3L4BC 1XTZA 3KOAA 3WC2A 1HNZJ 4TY8B 3V5RA 3NE6A 3PJWA 1QZ6A 3ZSOA 4DLGA 2HRYA 4PXEA 1LWFB 4MK9A 2UVUA 5C42A 1HNVA 5LL6Z 2F7TA 3AHPA 5DETA 2P9SB 3T1YJ 2JZ5A 4X4UA 3OLBA 1RILA 3D0GE 4ZPTR 3PZPA 1X9SA 3NY0A 5KPTA 3WIUA 3R5JB 4B3SF 1U0HA 2QV6A 5DZ6A 3BGRA 2KB2A 1CPZA 4BR5A 4OZNA 2O4IA 2KJWA 5HBMB 1R0CB 5B08A 2JGUA 4LQ9A 2M9KA 1EARA 2E29A 2MKKA 1XC9A 5IWAJ 3V4IB 1RT3B 2C22A 4CGIA 3DLBA 4CLLA 1I39A 4FM0A 1RHRB 1IKVB 3PX6A 4BRNA 1G2EA 1NNDA 4OHXA 3C6UA 5CYMB 3AQOA 1HBOA 2KT5A 3AVBA 3HSJA 3A8EA 4FZVA 4EZ9A 3ZO7A 3CJTA 1YTYA 3BF3A 3DXMB 2B51A 1IBMJ 3GFHA 4DQRA 2DFEA 4Z4HA 3AVCA 3C14B 4YR2A 4A8YA 2BX6A 1PJ5A 1OYEA 3PKMA 3DLEB 4WQ4A 4KFBB 5F8LA 4I2QA 3BKUA 5FLXO 4BACA 2DNQA 2XWXA 4CGHA 1EWQA 3VQ8A 4QS7A 4IDKB 1T9UA 1S7IA 4E1JA 5HSPA 1Y0HA 1S1XA 4JS5A 3CC4S 2NXNA 1RAAB 1RWMB 3TUJC 4FJMA 4XDDA 1XMQJ 1FDBA 4WK1A 3AOCA 1NPRA 5CZ1A 4BR0A 1UOCA 1SC3B 5D15A 4FKYA 1X9MA 3PHEA 3S3NA 5JMNA 3DLGA 4JKAA 4YY3J 3TR8A 2NYIA 1LWCA 4GKKK 4MO5A 4IOXA 4BCAA 5GADP 1NUEA 1XN9A 4UOFA 3PX0A 2R8GA 3Q8VA 5HRRA 4CF8A 3L0QA 1JLBB 4G1IA 4CK1A 1IR0A 1BQXA 3VGLA 1IUJA 2HHHF 3ZSYA 4CZHA 4B9SA 4JLHA 5AZIA 2D4WA 1S6OA 1RJJA 3BB5A 4BRCA 4GMKA 5AZJB 5FPDA 3LH2S 4FVMA 1ZAXA 2PAVA 4OZ0A 2X3DA 3MEEA 2YX6A 4BE2A 4QJVA 3M8QA 1N0VC 2GQQA 3IN5A 1TL1A 5KQ8A 2QLXA 3LALA 2BYCA 2GIFA 1S1TB 1UWAA 3NP5A 4WFZA 3OFEA 4RLEA 2NXEA 2YPYA 3KK7A 3KMQA 4LRFA 4RCHA 1MROB 2WCXA 2E1MC 4JV0A 5H9FK 2YKNA 3S41A 4ZIVA 2NLXA 4BRGA 1TFYA 4DR6F 1SV5B 4OGEA 2IAJA 2HW3A 1IBMF 2G9OA 4CK2A 4CIFA 3TI0A 3IUCA 4C48A 4DTRA 4EUVA 3O3LA 4CHZA 2XMUA 1SXLA 2QWMA 1DFDA 3W5YA 4OGCA 1KC8O 3KD5E 1UAXA 1M1KT 4A8FA 1XMOJ 1RFQA 1U1NA 1JL2A 4BWMA 3ALYA 3BBFA 2KFZA 1T8EA 3VGMA 4KPYA 3H5XA 5IXUA 4JI0J 2QO3A 4PG8A 1XMOK 3OXFA 4AHCA 3SCXA 4M45A 1Q8IA 3K7RA 2YKPA 2F4VF 4W5QA 1O8BA 4RW7B 3WX8A 2JSXA 1D3WA 2CZVC 5JXSA 4DG1A 1R89A 4RWWA 2GUIA 2K3IA 3HF5A 4F4XA 1HBNB 1ESVA 4ZITA 2Z2YB 3CJBA 3FSXA 1VSLA 4HTLA 3FCWA 1Z2ZA 4GVMA 5F3TA 2CG4A 3LGMA 2XMMA 1MMDA 3SUNA 3KLEB 4DV1K 1KLMA 4ZIWA 4F0HA 3AGRA 1WJ9A 2VBZA 1IBKJ 4AH9A 3FSYA 3HMJG 4IKFA 2VPYB 3GG0A 3UDLA 4KHWA 2IVOA 4NLRA 4CO0A 3W3SA 4FJ8A 4NLWA 1BY9A 3THTA 4GV6A 1GX6A 4FLUA 2LQBA 1TL3B 2XNRA 2CPJA 3IKMA 2HNZB 2NZCA 4F2SA 2ZD1B 1M5PC 2OTLN 3MD3A 2A6AA 3BEGB 3VF0B 2WHOA 3KMSA 2MQQA 3QQCD 2JEJA 3HD1A 1WC3A 3MN6A 1YKWA 3CEDA 1QUVA 5C2CA 2POKA 1QAYA 3MPVA 1XIQA 3AAQA 3UKRA 4FPAA 3A8JA 3DRPB 1GH8A 3KK2A 4CLFA 5I9EB 4WFNQ 1NXIA 1IJEB 2MKJA 2F8MA 3VGTA 2B9XA 2F8EX 4QYZK 5U47A 3JQKA 2WBMA 4LFCJ 5C12A 2E1ZA 2CPZA 1Z26A 4ZTJA 5G0RB 1YI2S 2G1DA 2J9DA 1HD0A 3L4IA 2QWRA 4V19S 1WBDA 2DRBA 3KLIB 2Y8YA 4L6V3 2VHGA 4LREA 3MCPA 4FWKA 1FD2A 3ZZZA 3GJTB 4OX8A 3F9MA 2ASDA 2NZTA 2ZHBA 3HT0A 3MMJA 2XS7A 3AO2A 1NO8A 2KG1A 2FYXA 4B1YB 1S1UB 4EP5A 2HS4A 1SBRA 2G0JA 4DJBA 3Q8UA 2GV9A 1JLFB 4Q44A 4CJ5A 2WONB 2M8HA 3THXB 5DDOC 4DL7A 5HQMA 2X1FA 4NPOA 4WFXA 2L9DA 4NL5A 1X4EA 1KP6A 2GW8A 3VCDA 4DPTA 2AGPA 1HUXA 5LM7E 3CUNA 1M5OC 4DSIA 2QYGA 3LF0A 1B70B 3MCNA 3EZOA 2KT2A 1W2IA 2BANB 2XHBA 2N7YA 4CJKA 2AGOA 2OAUA 1YJRA 2WVDA 4DS5A 3OV7A 1Y10A 4X4RA 3KLVA 3POTA 5BPMA 4F4AA 1WAFA 3MCOA 3RBEA 1PJ7A 1Y7PA 3KNGA 3WQPA 1S72S 3Q2SC 3M8QB 4AT1B 5BYRA 5GMDA 3GLJA 4FCYA 4UZBA 1JCFA 2SXLA 3CJAA 1X9JA 2F9TA 3D9BA 4I64A 1FEEA 2E6MA 2E5IA 4ZP6A 3NMUA 2ZJPL 2VKRA 1FESA 2WVEA 3E8OA 3M9OB 2XSFA 4QBUA 1S9FA 3C65A 4IEEA 5AQIA 4ES3A 3R7BB 4A59A 3OJSA 3VTHA 3OTBA 3J7YP 3PYEA 1XQIA 3T5JA 3NS6A 4RW9B 3GE9A 2M0GB 1OO0B 1VLOA 3EMTA 2BJDA 3R5DA 4IQXA 3RB6A 1JJHA 3U1MA 1T9TA 2E9ZA 3OS1A 4WKYA 3FSIA 4DV1J 1MU2B 1JXVA 2P6SA 4K4ZA 1E6VA 1B92A 5BREA 4F02A 4JBCA 1GLFO 4J2DA 5KT5A 4CEEA 3WNHA 2NXUA 2GQ2A 3DNCA 3VAJA 5AE1A 2PMHA 1RP5A 4C6AA 1AW0A 1NGAA 4K59A 1K1QA 2VDHA 2QA1A 3BP8A 3FUYA 1RWPB 4E98A 3WHIA 1IQZA 5KFOA 1UVMA 4EK2A 5MAOA 4ELTA 5H1SV 5DDPC 2A2CA 4FJKA 2AV5A 3H5UA 4I2PA 2V4JA 2D0PA 1EKEA 4BRMA 3OS0A 5A8KB 4DU7A 4ECXA 5CYQB 3SFUA 2XI2A 1EKRA 4M5DB 4IO9Q 3M8ZA 4ECSA 2RE1A 3V6KA 4CO2A 3J7AP 4KKOA 3BR8A 4CECA 2XGQA 2MQPA 4GW6A 4N77A 3EYZA 1LW0A 1FDAA 4EFHA 3H42A 4UT4A 4CJ4A 3HFZB 3J7ZT 4RZRA 1TYQB 3KDNA 3TR5A 2CQ2A 3C6AA 2HWHA 1RBOB 3KWGA 4BWJA 5KT3A 2BW2A 4LF6K 3RMAA 2P9SA 1OPZA 3LPUA 2ERRA 4CEQA 4DL0C 1FDDA 3D6MB 4A4JA 2AJ0A 3BSNA 4A8QA 1HNWF 1HNVB 4DR4F 3ISND 3MDFA 4HUFA 3MR6A 4RG8A 4ID5A 2G0IA 2UXDF 3U3YA 2O8CA 1FNXH 1XNQJ 3TAPA 2ZHAA 4ZVEA 5K5MA 2ALZA 3CJKA 2ZZMA 5HLFA 2FPHX 1NM2A 4NLUA 4BY9C 2NYHA 2O8EB 3TWHA 5GMEA 4H4OA 2RQ4A 3WNFA 3Q24A 1F0XA 1QVGR 4CO5A 1M5HA 3QNWB 3CCLN 5GADI 7FDRA 2BOPA 1YK9A 1VQLN 1QLNA 5CZXA 4M7XA 1AUSL 2CQGA 3BZQA 4LF6F 4H0PA 1IKYA 5ADXA 4DV2F 2VH7A 1HW8A 2ZNZA 1VQMN 2QL7B 3ZZOA 3ZSVA