1IKXA

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikxA05
3DOLA 4Y1DA 3K2PA 1S9GA 3OS1A 4MFBB 2ITGA 3CJ5A 5I3UA 3G6YA 3CDEA 5F9NA 5T14A 3IS9B 2J6UA 4Q8FA 1VSIA 1FKPB 1LWCA 3SNNA 2I5JB 4I2QB 4Z4HA 3VA0A 1RILA 3GV8B 3NBPB 3DRPB 3HK2A 3QESA 3VQSA 3SFGA 4TSXA 1REVA 5J2MB 5DMRA 4QWDA 3SUPA 4ECZA 4KHMA 3MR6A 2XY7A 3M8PA 4K4ZA 5C24A 1LW0A 2GV9A 4KB1A 1S4FA 4CJLA 4M3ZA 1SUQA 4DWIA 3AVNA 4CF2A 4KTZA 1TVRA 2E9RX 3HHKA 4ID5B 1TK0A 4ECVA 1XHXA 2OPQB 3AVJA 3MEEA 2FC0A 1CXQA 4FLZA 1VRTA 1SH0A 4J2EA 4K4VA 1NK0A 4FJHA 4H54A 4URGA 3L2UA 2B43A 4OPJA 2R2UA 3SZ2A 3RB6A 3CJ0A 2BDPA 3NDKA 2XCPA 2BE2B 1HNVB 1MU2B 2D41A 2QKKA 5CYMB 4ZPDA 5EUHA 4E7LA 4TLRA 4DSLA 3MFIA 5KT5A 1L3UA 2XRIA 3ZT3A 4NYZA 3OYDA 1RYSA 4E7JA 2YNGA 1LAVA 3AVBA 2OPSA 5KG6A 3H5UA 3OL8A 2BRLA 4E7KA 4PY5A 4ED1A 3DRRB 5DGBA 4ZVHA 4G1QA 4JV2A 1KVBA 5HLFB 2W7OA 1Z25A 3ZT0A 3PZPA 1K1SA 1XR6A 4DSFA 1X9MA 3TAEA 2KFZA 2LSNA 3AVHA 5KG5A 3L3VA 4CJEA 1L3SA 4F4YA 3PW4A 3PX0A 5KFUA 5E41A 3NE6A 4ZP6A 2D5RA 1S1WA 1IKWB 3ISND 4IBNA 2YNHB 2W7PA 1CLQA 1T05A 1WSJA 2R8JA 3M8RA 3TANA 5JS1A 5KFPA 3E51A 5F8JA 3QLHB 4DG1A 1BI4B 4FLTA 4O4GB 3O3FA 3HSTB 4K4SA 4C8OA 1WSIA 2OA8A 2XO7A 2FLNA 1BCOA 2JGUA 3K5MA 3S3MA 2WTFA 4WXOA 3IGNA 4MIBA 4F4XA 3M9OB 4M41A 3QEIA 3ALYA 5KT7A 2D0AA 3V1QA 3QEWA 3AO3A 4MFBA 4EYHB 2W9CB 4NLGA 3UIQA 1TL3B 3IS9A 3TAMB 3MXMA 4KHWA 4DFPA 4CIGA 4OPKA 1NKCA 4ELUA 2G8FA 1FKPA 1JXBA 3OYJA 4ZP7A 2I5JA 1LWFB 4I2QA 4M3UA 3NBPA 1T8EA 3AO5A 3VN5A 4CJRA 3DRPA 4GW6A 4DTJA 4HCBA 1VSDA 1EXQA 4K4TA 3QETA 5EWGA 1NNDA 3G6XA 3TABA 2CJQA 2IC3B 2ASDA 4AHRA 4OLAA 1XHZA 4BWMA 2XY6A 4F3OA 5D3GB 1B9FA 4TY9A 5KFHA 4Z0UA 1JLBA 4ID5A 3I5AA 3NGIA 1QAJA 2F96A 4WE1B 3V6DB 2RDIA 3C94A 3L2RA 3PV8A 2EHGA 4I7FB 4DTPA 3DLRA 3I0RB 3SQ0A 4M3RA 4ZPAA 4NLRA 1TGOA 1RTIB 5DQIA 3KHHA 5T7BA 3G6VA 2FBXA 2D0BA 4HUFA 5C5JA 3NFAA 1S1UA 1YVUA 1HNVA 1DTTB 4URQU 1MU2A 1HYZA 5CYMA 1FK9A 2R8IA 3KHLA 3HXMA 3V9ZA 3NAHA 2HHUA 4ED2A 3OVNA 3KMSA 3LP2B 3QNNA 3GQCA 2G8IA 3LALA 5KFIA 3V9UA 4N5SA 1RTHA 4DL3A 4CEBA 5EWFA 3DRRA 3Q8PB 4ZMMA 4ED7A 1RCHA 3Q8SB 2R7YA 5HLFA 5KG0A 4IG0B 1NK7A 1I3AA 1TKTA 3LAKA 3HPGA 5KFJA 3RWUA 3AVLA 3QGHA 3OSNA 3UQSA 4PWDB 4TXSA 2AGOA 3I0SB 4O5BA 3B6OA 4CJ4A 4DS5A 1IKWA 3AO1A 1Z4UA 2YNHA 2HWIA 2DPIA 1HYSB 1CSJA 4IFYB 1HPZA 4NYFA 1JLFB 3U6FA 4EP5A 3GV7B 4KHUA 5L1KA 4E1MA 4Q8EA 1S6QB 1KSPA 3V6HA 4ZVFA 4OKKA 4DQQA 5HROB 4KPYA 1BI4A 4O4GA 3VA3A 4Y34A 5J2NA 1TKXA 1XC9A 4E7IA 4O0JA 3EZ5A 2HNZB 2GBZA 2YHAA 3NAEA 4CHZA 4LY7A 2W9AA 5HRRA 3OYEA 3MR3A 3TR8A 4F4WA 4ZVGA 4Q43A 1GOAA 3SYZA 5KT6A 4OJRA 4OVLA 4CGFA 3QO9B 2W9CA 4C8MA 2KZMA 1TL3A 4Q44A 2Z1HA 2PYJA 3PW0A 5KFNA 4DTUA 3TAMA 3PUFA 4O3OA 1QAIA 3CIZA 1LWFA 1TK8A 1DTQB 3CM5A 5KFWA 3LAMA 2UVVA 4E19A 3HP9A 3F9KA 2D3ZA 2R8GA 3NF7A 3VQAA 1RA7A 3OYGA 2FVPA 1GOBA 2IC3A 1KTQA 4CJUA 4J9SA 2RKIB 4KI6A 4ELTA 5D3GA 1VSMA 4M3WA 1HARA 1JLCB 2ZD1B 2X74A 4FJLA 3TAFA 2ZQBA 1S5JA 2FVSA 3AV9A 3FSIA 3V6JA 2G8UA 1NOZA 1JLQB 3V6DA 4CEAA 1SH2A 4CGJA 1C0MA 1JKHA 3KK2A 3Q8QB 2ETJA 3I0RA 4CJSA 3E01B 3HVAA 2UUTA 3KTQA 1RTIA 4FLUA 4C8LA 1TV6B 3ZT2A 3QIOA 1KHWA 2IM1A 1RBRA 2IBKA 1FKOB 4W5NA 2W42A 4IH7A 2AGQA 1ZTTA 1DTTA 3V6KA 2B4JA 1WAFA 2JC1A 4FS2A 2BQRA 4CJ3A 4EBCA 1DLOB 4C8NA 4JS5A 4H4OA 2F8EX 4EBDA 2VA3A 3AVMA 3LP2A 4NLYA 1LV5A 4U7CA 5F9LA 1RTJB 4FJGA 4FJKA 1Q9XA 3M9MB 4CGDA 2XC9A 2ILYA 3S9HA 3NAIA 4CGHA 4JLHA 4CEEA 2G8KA 2XI2A 4PWDA 4NYNA 4DFKA 4B9MA 4FW1A 2WK4A 2W9BB 3I0SA 3N6MA 4H4MB 4CJPA 3ZSVA 3BQ0A 3NF8A 1ZBLA 4IDKA 4QWEA 1HYSA 4CJKA 4CHQA 3FFIA 3S3NA 1JLFA 2BANB 3KD1E 1S6QA 3KHGA 2FBTA 3ZSQA 3OL9A 4FJNA 3CJ4A 1A5VA 5HROA 4FLYA 4HCCA 1N6QA 5C25A 5HRPA 3LPTA 3OYMA 3DYAB 1YTAA 3V9SA 4NLXA 5J1EB 3NL0A 3K57A 2HNZA 2HWHA 5KG3A 4CEZA 4B8CA 3RMBA 4CEOA 5KFGA 4DS4A 2YKNB 4CHNA 4LSLB 4MIAA 4MKAA 3TAQA 4TQRA 3QO9A 4URSA 1S97A 2QV6A 1NK9A 3OYIA 3LZIA 4HUGA 2X6SA 1WN7A 2AWZA 1S49A 2R2RA 5CYQB 3KLEB 1TKDA 4RU9A 4M3TA 4YNQA 4CEDA 3SPZA 3BREA 1WSEA 1BQNA 2JLEA 3DLBA 4DTSA 4YR2A 3HM9A 4ZTJA 1W9HA 4PUOB 3FRZA 4J2AA 4MK9A 2RKIA 2JEJA 1S6PB 4CHYA 3BGRA 2BRKA 3I5BA 1BQMB 4M45A 4F4ZA 3MR2A 2E6LA 1JLCA 2ZD1A 1N4LA 4QPXA 4O3NA 3QEVA 1J54A 2HHXA 2BQUA 1QSSA 3RR8A 4DL7A 1NKEA 3KLHB 3IRXB 3SV4A 4CF0A 1QE1B 3RMCA 3HVTB 1JX4A 3PO4A 1MMLA 4FK4A 3GYNA 1FKOA 1RBUA 2D0CA 4ECUA 1TAUA 2YNIA 5JXSA 4WYWA 2Y1JA 3MECA 2RPIA 3MXJA 4Q5VA 4J9OA 1RT6B 1BIUA 1SL2A 1NHUA 2NUBA 3V4IB 3GILA 4OGEA 3M8QB 3OYKA 4QWAA 1DLOA 4J9MA 3QINA 2DFEA 4L8RB 2E6MA 4DFJA 1JIHA 3OLAA 4WFXA 4GC6A 4NLQA 4ECRA 1EP4B 1JLAB 4ECTA 3SQ1A 2BGGA 4FJIA 1RTJA 1IH7A 4DSIA 4ZHRB 4HTUA 4QAGA 4KBIA 2IDOA 3KJVB 3NHGA 4RNOA 4DLGA 3AO4A 3V81B 3BQ1A 2VG7B 4XPCA 2W9BA 1C2PA 4H4MA 1K1QA 2WB4A 5F8HA 1GX5A 2HMIB 3DMJB 1SL1A 2BANA 3MEDB 3PW2A 1RT5B 5F8GA 2VA2A 4CF9A 4BE0A 2HNDB 1KLNA 3CDUA 3G10A 2AX0A 2C22A 1NJXA 2DFFA 4NLVA 2DFHA 3NKYA 1J5OB 3DLEA 3CDWA 4AHVA 2WOMB 3DYAA 4H8KA 3D28A 5DG9A 1RA6A 3CO9A 4NLTA 1U4BA 1D0EA 5KFDA 4OKJA 3MEGB 4ID1A 3O4NA 5EDWA 4IKAA 3MXIA 4MK7A 4F8RA 4LSLA 4DL5A 1EKEA 2QK9A 3G86A 1BISA 1KLMA 4BDPA 4YQWA 1WSHA 3KKSA 3FQKA 1WSFA 3RMDA 5CYQA 2X6NA 2E9TA 3KLEA 1JLEB 3ZSOA 3OSPA 2P5GA 1J9AA 5FROA 2A1SA 4O3QA 4IRCA 3THVA 1SH3A 1S1VA 3OHAA 3OS2A 5KG1A 3CM6A 4CGIA 4RW6B 4PUOA 4NLOA 4J9NA 3MAQA 3IN5A 5L1IA 1S6PA 3AVFA 4B3OB 4K8ZA 3RB3A 3B6PA 3WNGA 1BQMA 1ZBUA 3AVKA 3LWLA 1KRPA 3HPOA 2XGQA 1R0AB 3PJXA 1X1PA 3DM2B 4PA1A 2KZZA 2B6AB 2C28A 3RTVA 3SQ2A 3KLHA 1XI1A 4DL6A 4ZP9A 3VQ4A 4O4RA 3HVTA 5FRNA 5KT3A 4TYBA 3H4BA 4XO0A 4J2BA 4F3TA 5J2PB 2V0NA 4MK8A 1SKSA 4O3RA 1UWBB 4CJTA 5KFCA 1RT6A 1IKYB 4ZP8A 3AA2A 3O3GA 1WNEA 4KHNA 3V4IA 3RAQA 4ZTFA 3M8QA 4Y2CA 5J2MA 1RT3B 1XR5A 5DG8A 1K6YA 4CF1A 2HB5A 4CJQA 5SZTA 4GMJB 4DL4A 3T5KA 2YNFB 3AVIA 4DQSA 2HAIA 4HKQA 4C8KA 3VQDA 1EP4A 3HVRA 1ZBFA 3OYNA 4CJFA 3ASMA 1HNIB 3FQLA 3V9XA 3L8BA 3TWHA 4ZHRA 3QZ8A 4EP4A 1IKXB 3KJVA 3V81A 2OPQA 2XI3A 1VSLA 3AVCA 1VSHA 4OGCA 3H5SA 4NCGB 4RNFA 2VG7A 1T94A 2A1RA 1KFSA 1HRHA 2C2DA 4RG8A 4ICLB 1W25A 2G8VA 3DLHA 2HMIA 1U45A 3MEDA 4OLBA 2HNDA 2IM3A 4KSEB 4ED0A 4RUAA 1C0UB 2Z1JA 1RAJA 4DSEA 2HHWA 2AJQA 4MH8A 3EY1A 2BE2A 2WOMA 2XGPA 4ECSA 3ZSYA 1QHTA 4KHYA 1RT2B 3HT3A 3K5LA 3ULDA 4BACA 4F50A 3DLKB 1S48A 4CFBA 4ECYA 4KHSA 4BWJA 2HNYB 3UDLA 1T3NA 3OL7A 3OYHA 4IKFA 2XY8A 5KFLA 4CHOA 2PZSA 3DRSB 4DTOA 2OPRB 3HO1A 4EBEA 4FK2A 1HMVB 1JXEA 4I2PB 3WNFA 1I39A 4EZ6A 2EC0A 3KLGB 4O3PA 2OYQA 1LWEB 1JLEA 4GC7A 1KFDA 2VWJA 1EETB 4B9SA 1WSGA 1U49A 5DQGA 3KLVA 1TL1B 1TK5A 3V9WA 4RW6A 2O4IA 2G8WA 4M3XA 3QLHA 4B3OA 3KLIB 1RBVA 3VQ8A 3I5CA 2OPPB 1NK8A 3RBDA 2YV0X 4M42A 2HHVA 4KV8B 1R0AA 3OYBA 4OKEA 4KAIA 4Z4CA 3G0ZA 1C1AA 1ZYQA 2IM2A 4W5TA 5KFYA 3DM2A 4CGGA 3H59A 2B6AA 1UOCA 3OY9A 4KRFA 5F8LA 3CFPA 2FBVA 4CFDA 3BSCA 2XCAA 3VQEA 5F8NA 3TAGA 4KI4A 2HHQA 3PX4A 1J53A 1W0HA 4HVJA 1BCMA 3GV5B 4RUCA 1JLGB 1UWBA 4ZPBA 3RBEA 4RW9B 1IKYA 5F8MA 4F2SA 5KFOA 3NGDA 3SFUA 5KFTA 3QIPB 3HL8A 4TQSA 4XPEA 4B9VA 3M8SA 1RT3A 1D9FA 2KTQA 4FS1A 1S10A 1D8YA 1RDRA 4W5RA 2Z1IA 3VQBA 1RTDB 3GIJA 3T5HA 2YKMB 4DFMA 1NK6A 3VQCA 4CEFA 1C6VA 4Q0BB 5KG4A 3HVWA 5KFQA 1HNIA 1LW2B 4KHRA 3AA5X 4CFCA 1IKXA 4ECQA 2JEIA 3JSMB 3PR5B 5KFSA 4K8XA 5L9XA 4WE1A 2GIQA 4NCGA 2ZKUA 4K50A 5FDLB 2R2TA 3TAPA 4ELVA 4I7FA 4AHSA 4ICLA 4ECXA 1NJWA 3IG1B 3LP1B 4KREA 1S9EB 2B5JB 1C0TB 3KOAA 4J9KA 1BIZA 2QKBA 1GX6A 2WCXA 2IMWP 3K58A 3DOLB 4IQXA 4YR3A 1F21A 1RT2A 1IG9A 4I9LA 1TQLA 3OJUA 1NHVA 3SPYA 3DLKA 3H98A 1X9SA 1VK0A 3SV3A 2HNYA 2ASJA 2IJNA 3LPUA 4J9QA 3ZCMA 1C1CB 4DTXA 3DRSA 5KFEA 3H2LA 1IKVB 1NK4A 1HMVA 3LP0B 4IG0A 4I2PA 4NLPA 4R8UB 3QIDA 4O0IA 3K5OA 3AA3A 1LWEA 3LP3A 4NLSA 2HHTA 4DEZA 1QQCA 3M8PB 3KNAA 4FXDA 1EETA 2Y1IA 4NCAA 3ZT4A 3AVGA 3UR0A 3DLGB 1XR7A 3KK3B 3VQ9A 2FLPA 4IR9A 1TL1A 3DI6B 4IFYA 3BSAA 3ZSZA 2IGIA 1TVRB 3N6NA 3PVXA 3ZT1A 4B8AB 3BR9A 3QNOA 4AHTA 2OPPA 3OYAA 4FJ9A 4FLXA 1VRTB 4GVMA 4KV8A 1VSEA 1NOYA 1LAWA 1RDDA 4Z4GA 1JL2A 3QEXA 4K4UA 3EPIA 1L3TA 2X78A 3CVKA 5JUMA 5KGWA 4WFZA 4IG3B 4B08A 1T03B 3OS0A 1HJRA 4RW4B 5KFMA 3H08A 4QW8A 5KFXA 3LDSA 2RF2B 1JLGA 4E7HA 3AVAA 2C2RA 1DTQA 4RW9A 2OPSB 5KGXA 3PHEA 3QIPA 1ZBHA 3PW5A 3O3HA 4YMEA 3BSNA 2BR0A 2ILZA 1QS4A 3PJWA 3HP6A 1RTDA 2F8TA 3JYTB 4AHCA 2YKMA 4AHUA 1VSJA 2W8LA 5KFBA 3SUOA 1LW2A 5HRSA 4X2BA 1NJYA 1L3VA 3NF9A 4DQRA 1T05B 3L2VA 4E3SA 2I1RA 5DK5A 1JLQA 4CFAA 3I8DA 2HVHA 4PQUB 5FDLA 3CJ2A 2WRMA 4JRPA 3E01A 3L3UA 3C6UB 4DG1B 3IG1A 4UQGA 1BL3A 1TV6A 5KFFA 3EZUA 3HPHA 1S9EA 1JL1A 2B5JA 3A2FA 4N56A 1C0TA 3PX6A 4CK3A 2FJXA 3L2WA 3OYLA 1SL0A 2IM0A 3KLFB 4YR0A 5KT4A 3ZSWA 4CEQA 3NMAA 4FM0A 3L2QA 5FRMA 4NRTA 4FM2A 5I42B 4WYLA 3P5JA 1RYRA 1RT1B 4B9NA 3DOKB 1C1CA 1UA1A 1IKVA 2GIRA 1KCFA 4CF8A 3LP0A 3TARA 3EPGA 3NGYA 4AH9A 4R8UA 4O44B 2UVRA 4Z4FA 4QWCA 1IO2A 1X9WA 3N6LA 3PW7A 1FXXA 3DLGA 3KK3A 4RNHA 1S1XB 1HQEB 3DI6A 2P5OA 1JLBB 3V1RA 1VRUB 1ZTWA 2IA6A 3D0PA 4E1NA 3LWMA 1L5UA 2JEFA 2O5DA 3MF5A 4CE9A 4DU1A 4R0EA 2J6TA 5J1EA 2OH2A 1KVAA 4J9PA 1S1TB 3CFRA 1YT3A 4RW8B 5KTQA 2YKNA 3QEPA 3U3GA 2VWKA 4IG3A 1S1UB 4KB0A 1T03A 3F73A 2G8HA 2UVWA 4RW4A 1FK9B 5CZ2A 1WNSA 2V9WA 2RF2A 1RDAA 2RDJA 2UVUA 3KMQA 3KK1B 4G3IA 3P83D 3TQ1A 2Z1GA 1RTHB 5JS2A 4M3YA 3AA4A 3HJFA 4O3SA 3PR4A 4HYKA 1TKTB 1N5YB 3JYTA 4ED3A 3VQPA 3CG7A 1S0MA 1Q9YA 4DU4A 2ATQA 4Y3CA 1QUVA 3MR5A 2IAJB 4OL8A 1BHLA 5C42B 1HPZB 4QCLA 4R5PB 4PQUA 3BSOA 3PY8A 2AGPA 3C6UA 3IRXA 1ASWA 4RNNA 4B9LA 1B92A 4DSKA 1QE1A 4N47A 4FK0A 5J2NB 1TKXB 4FJMA 4AILC 2QXFA 4M95A 4LH4A 5EU7A 2JC0A 4FCYA 1D5AA 4TN2A 3TVKA 1OS5A 4CHPA 4Z4EA 4IFVB 3SUQA 1YTUA 5EWEA 1QTMA 4ZVEA 3KLFA 3T5LA 3EYZA 4DSJA 2ZE2B 4B9UA 4TY8B 2HW3A 4K4YA 3WNHA 4DTNA 1U48A 4QWBA 2VG6B 3RB4A 1EX4A 3K5NA 5I42A 1RBSA 1RT1A 3OYCA 1A5WA 3DOKA 3V1OA 1JLAA 3SUNA 2W8KA 1GOCA 1ITGA 4DTRA 5J2QB 2FVRA 4FW2A 1SV5B 4CJWA 2KQ2A 4CK1A 3NCIA 4O44A 4NLDA 1VSKA 3NGZA 1WLJA 5L1LA 3HKWA 5DLFA 4DF4A 1ZETA 4FJJA 3MTKA 3T3FA 1S1XA 1RDBA 1HQEA 1Z26A 5K14B 2P1JA 3DMJA 2VG5B 1CZBA 3CFOA 1RT5A 4NZ0A 4KO0B 3CWJA 1VRUA 4F4KA 1D9DA 2WONB 3ITHB 1J5OA 2YHBA 4FVMA 4EZ9A 4NRUA 1ASUA 2HHSA 4O55A 1JKHB 3KK2B 2DY4A 1C1BB 3H5YA 3CJ3A 3K59A 1S1TA 3KIOA 3MEGA 1D1UA 4RW8A 4WFYA 1TAQA 4DQPA 1NK5A 4KAZA 5KRTA 4FBUA 4CCHA 3RR7A 4YP3A 2XWYA 4J9LA 2KFNA 1RT7B 5HBMB 3GIIA 4KB7A 2FVCA 4H4OB 3KK1A 2XHBA 4W5QA 4NLUA 4KFBB 5KFVA 4JUZA 2O4GA 3SCXA 5KFKA 3BJYA 1WAJA 1QSYA 2AQ4A 4K4WA 1RDCA 1Y97A 3KHRA 1S0NA 1N5YA 1RNHA 4CECA 2E4LA 2FVQA 4F2RA 2CKWA 3OLBA 1RT4B 3ISNC 3HYFA 4Z4IA 3C6TB 3H5XA 4BE1A 4N76A 1B9DA 4MKBA 3GIMA 4MQ3A 1HQUB 3D45A 2IAJA 5KRSA 4NCBA 4IDKB 5C42A 3VQ6A 2UUWA 3RAXA 3FFIB 3ZSXA 4R5PA 1U09A 3D5MA 5F8IA 3U3YA 5HRNA 1SKRA 4KHQA 5KG2A 4LSNB 4FLWA 1N6QB 5DG7A 5C25B 4FYDA 2EX3A 2IS3A 2AX1A 4KKOB 2ALZA 3DDKA 5J2PA 4IFVA 1TP7A 3SJJA 3S3OA 4J9RA 2FJVA 2ZE2A 2E9ZA 4TY8A 4JV1A 3C95A 1SKWA 4EO6A 4DTMA 1CZ9A 2VG6A 3PO5A 2JEGA 2YNFA 1KHVA 2F8SA 3T5JA 3SQ4A 3QGGA 1A5XA 3SI6A 2PY5A 2XY5A 1Q8IA 4LD0A 4FJ7A 5HP1B 3Q8RB 5J2QA 4KE5A 2BQ3A 1SV5A 3M9NB 4WXWA 4DQIA 2FBYA 1BQNB 4CIEA 2FJWA 4HHTA 3NH1A 1ASVA 2WHOA 3IAYA 3ICLA 1KVCA 4ZPCA 4FM1A 4IR1A 2AU0A 2OZMA 5KFAA 4U6PA 1O1WA 4E89A 1ZBIA 3BGRB 3IGVA 5K14A 4BDYA 2VG5A 1JXLA 4RW7B 4KO0A 3GIKA 4QW9A 1C0UA 2WONA 3NH0A 3UPFA 4I9QA 3ITHA 4IRKA 2ATLA 3BQ2A 5SWMA 1TKZB 4Y1CA 4HUEA 3NF6A 3WNEA 4FZYA 1C1BA 1S9GB 1N56A 3CYMA 3O4QA 5KG7A 4DF8A 5I3UB 2PYLA 2ASLA 2KW4A 4JS4A 1IM4A 3RB0A 3CQ8A 1U04A 4ED8A 2YNIB 3T19A 2C2EA 1NKBA 3MECB 1LWCB 3SI8A 4DU3A 2OPRA 4CJVA 2IJFA 4BE2A 4CJ5A 3OL6A 4EO8A 4XIUA 4BDZA 3KKRA 3H4DA 1RT7A 5HBMA 4CK2A 1REVB 1BGXT 1YVFA 2RN2A 3AO2A 4WZMA 3KLGA 4JV0A 5KI6A 3T1AA 2QE5A 5C24B 4KFBA 1LW0B 1HYVA 4K4XA 3RRHA 4FJ8A 4KTQA 1SUQB 4ECWA 4IH5A 1QSLA 4CIFA 2R2SA 4M94A 3QZ7A 3MFHA 4E0DA 3RRGA 2Q3SA 3KLIA 1RT4A 3QYYA 3MEEB 3TI0A 3C6TA 4CERA 2OZSA 2HVIA 1HQUA 1CXUA 4QOZB 1T7PA 1UAXA 3QERA 5KFRA 3VQ5A 4NLWA 4FBTA 4IRDA 2GUIA 4KTWA 3KD5E 1U47A 5KFZA 1N48A 4LSNA 4Y2AA 2J6SA 2R8KA 3DLEB 3BDPA 5L1JA 2GC8A 4KKOA 4W5OA 1UA0A 4IOBA 1NJZA 1S0OA 1G15A 4J2DA 5DLGA 2R8HA 2YNGB 3QGIA 3RMAA 3LZJA 4IH6A 3P1GA 4LQ3A 2P51A 4LH5A 4CESA 4DLEA 4LQ9A 1KLMB 4G1QB 4RNMA 4FZZA 4DL2A 5CZ1A 3H40A 1VSFA 4EYIB 3OHBA 3VQ7A 5HP1A 5CY4A 4DMNA 4Q0BA 4N41A 4ED6A 4FZXC 4JRQA 4FLVA 4RZRA 1S1WB 4FJXA 5DQHA 1S1VB 1I6JA 3VQQA 4B9TA 3FDSA 2DPJA 2V4RA 3JSMA 2IOCA 3ZSRA 3OYFA 3OJSA 4TYAA 5DGAA 1RBTA 4RW7A 2D3UA 3LP1A 4Q45A 2DTUA 1XWLA 4WZQA 4YFUA 3NH2A 3LANA 4FJ5A 5KT2A 4EEYA 2D7SA 1TKZA 2FLLA 1S9FA 2V4QA
chains in the Genus database with same CATH superfamily
2PA3A 3ZLJA 3LDLA 3K2PA 3NOGA 5M1OA 2OCEA 2AD9A 3NVMA 2C2MB 5T14A 3IS9B 2J6UA 2B9EA 4Q8FA 2UUCK 4NE9C 1LWCA 3SNNA 2I5JB 3EGVA 4RLEA 3NBPB 2IVYA 2DXDA 3DRPB 2G0JA 3QESA 3VQSA 3SUPA 2M4MA 2FJEB 3MR6A 4K4ZA 2IVOA 1J27A 4LF1A 4DR1J 1VQNS 4X64J 1X5PA 4M3ZA 1SUQA 4DWIA 3AVNA 2X7IA 2AIRB 1VK8A 3EVMA 2ZUGA 2RS2A 4F7VA 3M6UA 3MEEA 4CIOA 4I6YA 3HHEA 1E6VB 1CXQA 4FLZA 1N34J 1CVJA 4AQYJ 4FJHA 2MQNA 5HJYA 1KQGB 4MJKA 2OFGX 1OH8A 1M5KC 2WW4A 2B9WA 1LFPA 3MMVA 2VJVA 1HNVB 2D41A 4LR7A 1LOTB 2FJAB 4BRMA 5KT5A 1S6OA 2ZH2A 3ZT3A 3OYDA 1U1PA 3FZFA 2DCUB 3AVBA 3EGWB 1VQYA 4DR6J 2BRLA 1WF1A 4E7KA 2HIYA 2HIQA 1Z05A 1KVBA 4G1QA 3OR1B 4OYMA 1XR6A 1Y00A 3R7NB 5MLCV 2KFZA 2LSNA 3AVHA 5KG5A 4CJEA 2EC2A 4B1XB 1L3SA 5AQWA 4OV1A 4F4YA 1OY8A 3PX0A 5KFUA 1T9VA 1M1KT 4R0JA 1IKWB 4IBNA 3NLCA 5G4DA 1VQ7N 1WSJA 3EKSA 3M8RA 2R8JA 3TANA 3TVYA 5KFPA 5JS1A 2HGNA 1X0FA 1NGGA 1TZ0A 4LUBA 2VQFK 3O3FA 4O23A 3T6JA 2XQCA 3O6WA 1OSDA 3K5MA 1PYTA 4WXOA 2ZGYA 4QIGA 2HQIA 4DV5F 4M41A 3QEIA 3ALYA 2D0AA 1S76D 2OLWA 4ES3A 2CNNB 3KG4A 2O8CA 1RK8A 3QEWA 1LK5A 1F5CA 4MFBA 2DIUA 4USWA 4WTOB 4OX9F 1NGAA 1JJ2M 2CPEA 1R8CA 1VQ8S 3KXDA 3SK3A 4OPKA 1BOTO 2HMPA 5F2RA 3OVSA 1JXBA 1BA1A 3EL2A 4I2QA 3UCGA 2K3KA 2B4VA 4K43A 3QJJA 4HCBA 1VSDA 4B3TK 5EWGA 2FPHX 1SPBP 4Y2MA 4CZCA 2RDDA 5EN1A 4HT5A 4OPHA 2IC3B 4F3OA 5ETNA 1B9FA 4TY9A 3W63A 1NG9A 4PQAA 4ID5A 2DRAA 2RILA 1RHKB 4GKJK 1H2TZ 4WE1B 3V6DB 3KFWX 1QTNB 3PV8A 2V34A 2EHGA 2NCKL 4I7FB 3Q24A 3PRVA 1U26A 2PO4A 5DQIA 4DR4K 3KJQB 1IUJA 4UOCA 4WIIA 5HVHA 5T7BA 2FBXA 3HOSA 4HUFA 3D2EB 1S1UA 3NCPA 1K9MO 1UVIA 1DTTB 1MU2A 3M5RA 1FK9A 5DDPC 4BQLA 2CJAA 2CJYB 2HHUA 5E84A 3LP2B 2C2NA 1VLOA 1CQNA 6FD1A 4I56A 1SC6A 3S01A 2UUBJ 3QWUA 3Q8SB 2R7YA 3K7RA 4IG0B 1I3AA 1TKTA 1UVNA 3LAKA 1WG1A 4KHPJ 2UXDJ 3HX9A 3C2PA 5C10A 1Q7YT 3AVLA 5M1QA 2AEMA 3UQSA 3OSNA 4UY8T 2Q79A 1U2VA 3CCTA 4YOEA 3T9NA 5JMVA 2Q97A 3I0SB 3B6OA 4DS5A 3AO1A 1Z4UA 2YNHA 4IFYB 3MM7B 1HPZA 1VQMS 2B9XA 4NYFA 2RUGA 4ILMA 2LCWA 4OKKA 2YXLA 1H73A 2ZZTA 3BKUA 4O4GA 1RZMA 1KD1O 4NLBA 2A0FB 3VA3A 4Y34A 3BP8A 5D4NA 2DYAA 3LUYA 4DX5A 4OO1J 4MKVA 1P9QC 2QC3A 4BR5A 3ONQA 2HNZB 3NAEA 2FY8A 2CZVC 3TR8A 1X5SA 2CJKA 4LREA 2H4YB 3SYZA 5C2GA 4OVLA 2YX6A 1X3MA 2FF6A 4NA3A 1BUXA 3FNNA 3R7SB 3TAMA 3LL3A 4WFNQ 1T9YA 1F2HA 3MCSA 3CIZA 3F9KA 2RRBA 3NF7A 4AYBD 3KDNA 4QR0A 2W4PA 2G0CA 1KTQA 1YJTA 4C97A 3C46A 3B54A 5BJRA 3VGTA 1WI8A 1BDGA 4IO8A 1HNZJ 3VENA 1PILA 3TTCA 2VIHA 3E1YA 4BR0A 4OX7A 3DAWA 1AW0A 1VRQC 5JVGQ 1JLCB 3MGJA 3D6HB 4FJLA 3CETA 3TAFA 2ZQBA 1YI2S 1E6YA 2E1CA 3Q23A 3WZ0A 5GAHU 1C0MA 1JKHA 5HVFA 2FHJD 3JB9k 3I96A 1KAYA 2JL9A 2UUTA 4FLUA 1U1MA 3IAS9 2EI5A 4C8LA 5AQRA 4YDUC 1MWYA 4YOVA 3UKRB 2NUUG 2LECA 3BGFA 2HFVA 3ZZOA 3UD4P 3NGSA 2IBOA 2VYPA 1UPPA 2YKAA 2VOPA 2ZWHA 3AT1B 4CJ3A 4UZCA 1FF2A 2F8EX 1Q78A 1RJJA 2C2OB 3QBCA 2Q2RA 2CZ9A 3MUTP 3MDFA 4DUYK 2QWLA 1TTHB 4FJGA 1M1HA 3EUNA 2MKSA 4FJKA 4LF6J 2UV8G 4WF9Q 1GLCG 3A12A 3NAIA 5CCMA 4NYNA 5IZHA 2IA0A 2WK4A 2XS5A 5E33A 2HQGA 3BQ0A 4JI5J 4K0KF 2W4CA 3NF8A 4IDKA 1HYSA 4CHQA 1WEYA 3S3NA 3MPVA 1JLFA 4PAAA 2E5LF 3KD1E 3GJRB 3GBTA 4GMKA 3CJ4A 3MAAB 4FLYA 4HCCA 3N9UC 5C25A 3O1WA 1YTAA 1KN6A 1LNQA 4QS9A 2CQGA 3K57A 4CEZA 2VBYA 3RMBA 5KFGA 4MT1A 2J4RA 3U1MA 4MIAA 1UL3A 2CNKB 3G8TA 1HBUA 1S97A 1QZ5A 2GVDA 4F26A 4OJGA 4WBFA 3OYIA 2X6SA 3I4PA 1YKWA 2AWZA 2HQFA 3M8ZA 2R2RA 3H2UB 1YJ7A 1YJNN 1TKDA 2YQ1A 4YNQA 4WP9A 3BREA 1CS4A 9RUBA 2JLEA 2KG0A 3DLBA 1KVIA 3H25A 3SSRA 3AB2B 4PUOB 4M8LA 1OQ3A 4M1KA 2RKIA 4H5VA 3BGRA 2DEIA 2BRKA 2QYCA 1Q0NA 4DDFA 4EHUA 1N4LA 4LR9A 5IM0B 2XWXA 2A2CA 1QSSA 2Q31A 3RR8A 2ZC3A 4OI6A 5GAEP 3JTPA 4HR2A 1X7VA 4DL7A 1M90T 2QA4S 3FBEA 2UZAA 1HBNA 3IRXB 1WELA 2FZCB 1QE1B 1NGHA 4LRCA 2A3ZA 4XTTA 2CJ9A 1KC8T 2YH1A 2MY7A 5CD4H 3RBZA 1H7XA 2Y1JA 1Y9OA 4F67A 4Q5VA 1BIUA 1SL2A 1NHUA 3GILA 5IV4A 5CA5A 1NH7A 5ETRA 3OYKA 4QWAA 3W2WB 4BREA 2Y3YA 2J0WA 2EFNA 3D66A 5BPLA 1H2VZ 1JIHA 4GC6A 2AP1A 3MPWA 4C9DA 3MN5A 5GADU 3GL1A 4FYWB 4JI8F 2Q1NA 3T1YK 3AO4A 1VQLS 3OA9A 3ULHA 4XPCA 4LF7K 3EGNA 1IBKK 1KAZA 2BANA 3PW2A 4USUA 1BLUA 2DFFA 5B0CA 5BR8K 2DFHA 3AJDA 3BR8A 1YITN 3NKYA 3IR7B 3DYAA 4OJHA 1KDNA 1QVGR 2BKNA 5IC4B 4AM7A 4YOXA 3R27A 1L3KA 5M1NA 3CO9A 4NLTA 4NL5A 1D0EA 3MEGB 3O4NA 1DEJA 4MK7A 4LSLA 4P10A 1ZM9A 1V3ZA 1KVKA 2D0PA 1EKEA 3G86A 2Z58B 3BBBA 5D0EA 4BDPA 1FRKA 3D68A 4N77A 1WSHA 2HBZB 5DM7L 1B7FA 4KT0C 2X6NA 4EU0A 1JLEB 2G2OA 4C3MA 1J9AA 4M5HA 2ZM6K 1IJEB 2BOPA 1BHNA 2DNYA 3I56S 3I55N 4X62K 3OS2A 4CGIA 5MLCQ 2ROEA 4NLOA 4J9NA 1F9FA 3OR2B 1VCTA 5L1IA 3B6PA 2DR9A 3LWLA 3JSYA 1FJGF 3HPOA 5A2QO 4Q7AA 3PJXA 2XMKA 4CM0A 4WIQA 1VQOS 4FWLA 1SJ1A 2B6AB 5FLXO 4B1VA 3C15B 3RTVA 3OXGA 3MUMP 2BACA 3AOAA 1WC5A 1PGZA 3J7ZT 1HNWK 3BF4A 3JQJA 4O4RA 5FRNA 3H4BA 4XO0A 4OI1A 5J2PB 1C0GA 1UWBB 2RE1A 3DDIA 2FZKB 4BRQA 4CJTA 2I2YA 2VFUA 5KFCA 1RT6A 4ZP8A 1OIAA 4KHNA 3N4QA 2LA6A 1XMOF 5DG8A 1K6YA 5SZTA 4DL4A 1FHTA 3AVIA 3EKUA 1HLUA 3A8YA 3Q89A 1RKIA 3VQDA 1VHIA 4JV5K 3HVRA 2UU9J 1IV0A 2WSFC 4CJFA 4KY3A 3ASMA 1HNIB 3V9XA 3TWHA 4YN3B 5JMNA 3QZ8A 2N7CA 3V81A 2OPQA 2KVIA 3ENVA 2VG7A 4JI4J 2E7XA 1VQ9S 4ICLB 1GMVA 3THPA 1U0SA 1IQZA 2G8VA 2B51A 2XHCA 4DZDA 4DV3J 2E5IA 1YHQS 4KSEB 4FOIA 3KWIA 1X4FA 4CO2A 4HI2A 1ULRA 3FBBA 2Z1JA 2QEXS 2AJQA 4IEIA 2BE2A 2KDOA 1KXPA 4B3SK 4KH6A 4A47A 1ZM4A 5F41A 4BVPA 1RT2B 1SIWB 3CD0A 3MDQA 1S48A 4ECYA 1SQEA 2XSJA 3VOVA 2FJDB 3C0BA 2DY1A 5KFLA 1FD8A 4C11A 2VGNA 4X4TA 3HO1A 2C1EB 1JXEA 1I39A 4NX9A 2DNLA 3J8AA 2Q36A 2L9NA 3G25A 4O3PA 2OYQA 3PIOQ 1YTYA 2VWJA 4YY3F 4LRDA 3W2VB 3H1QA 2VPYB 3TX8A 1WSRA 2G8WA 2P9UB 3OFHA 4B3OA 3BO2A 3D2FB 2ZGZA 3RBDA 3SCLE 2UV8A 4N7TA 4BC2A 4M42A 2HHVA 1R0AA 1FTRA 4OKEA 4KAIA 4JI1K 4CZHA 2OTJN 2FD2A 5AQLA 4LF4J 2FBVA 2XCAA 1PYOB 3DOMA 2P8IA 5EGYA 2NXUA 1J53A 4HVJA 1KKHA 4RUCA 5LSRA 4CRJA 2MLZA 2RUSA 2CNOB 4H0PA 4JKEA 1EKRA 2BJEA 4RW9B 2RD5C 3NGDA 1FW6A 3QIPB 2OMOA 4TQSA 2P9LB 3FGVA 1UKUA 4NXMK 4FS1A 2KM8B 3RYLA 3VQBA 5T7LB 4QS7A 3GIJA 2VWBA 4TVAB 3T5HA 3B6BA 1C6VA 1R8BA 4KHRA 2F9WA 2OD6A 5IS2A 1IKXA 2MEWA 4OZ3A 2IVFB 1B64A 1P90A 4K8XA 2ZKUA 4NCGA 4K50A 5FDLB 5B7WA 1QVGM 4PWWA 1W26A 1RTZA 1H0HB 3MEKA 1R43A 3IAM9 2UXBK 3CNQP 5GINA 1GK8A 4KREA 4DUYJ 1S9EB 3LDNA 3KOAA 2PMZD 3GG0A 1GX6A 1NEEA 2WCXA 1VOMA 3VAKA 3ZTPA 3OXLA 2A41A 1TQLA 3C3LA 2YKQA 3POTA 3SPYA 2K1RA 2KFYA 2ZJQQ 2HNYA 2IJNA 5F1XA 4J9QA 5KFEA 1YLXA 3CCUN 1W7AA 1HI1A 4LBPA 4I6MB 2MZRA 3QSYB 2Z57B 3N0VA 3QIDA 2CQPA 4DR1F 5FJ4A 2AW0A 3M8PB 4MO5A 2KYXA 5KQDA 3ZZRA 3GE9A 2HBRB 3I6PA 2FLPA 2E5GA 4JI6F 4QU7A 4ZN1A 3N6NA 1FE4A 3PVXA 2IVNA 1N34F 1OH5A 3BR9A 1U1OA 4JI3F 2DB1A 1IR2A 3CCMN 2HHHK 1VRTB 4AQYF 3UCUP 2MLYA 4GVMA 3P4UB 1H72C 3GG1A 3BN4A 3IXQA 4NMXA 4CD3A 1E4GT 3QEXA 2QL5B 1HR0K 2I38A 2CQHA 3EPIA 2C42A 2HYIB 2ZHOA 5AXMA 4WFZA 2Y0BB 2CDRB 4RBTA 1XK8A 3H08A 2FSNA 5IT4A 5LMUF 3LDSA 4DR6F 3J80O 1JLGA 4E7HA 1O5JA 1NRKA 4DPUA 2AYGA 1I51B 2C2RA 1U1QA 2QJ3A 3JTNA 3CGIA 3LA0A 1ZBHA 1URRA 3WEEB 4YMEA 3VEWA 3U02A 2AYEA 2BR0A 2WAQD 1RTDA 2F8TA 4AHCA 5K8PA 7AT1B 2MSSA 2W8LA 1Q16B 2CQ3A 1Q86O 1LW2A 2J76E 1V3RA 1U1NA 4JKGB 1L3VA 2HKEA 4CLSA 3NF9A 1T05B 1JLQA 3CJ8A 4PQUB 1ZAVA 1DFDA 2FDNA 2WW8A 3BEXA 3L3UA 3C6UB 3O9TA 2QA4G 2I0XA 1REGX 4UQGA 3HPHA 2ZFHA 1NDCA 3W0LA 1JL1A 2B5JA 4N56A 3A2FA 4H0OA 2AZ3A 3HFVA 2FJXA 3L2WA 4G65A 3D0HE 1SL0A 3IC1A 3PKMA 3N28A 3BV8A 4NPOA 3QAEA 4ZOSA 2GJFA 1YK9A 3BGOP 5LM7E 1YIJS 5KPRA 4B1ZA 5FRMA 1FXLA 1Q8BA 2W6KA 2P9CA 1NB2A 2J8AA 4U96A 3P5JA 3CJ1A 1XC3A 3DOKB 3MX2A 1EB0A 1FX2A 3RZAA 5BR8J 3P5TL 2GIRA 1KCFA 4CF8A 1VC6A 3QRRA 1YSJA 3LP0A 4PXCA 2RJZA 2CZ4A 4OZJA 4K7QA 4ZVQB 1FXXA 5DRKA 5THWA 2EEYA 2UP1A 3TUPA 4R25A 3R6GB 2P9GA 3D1HA 1F9HA 1APSA 3U1LA 1GLLO 4E1NA 3GONA 3LWMA 4CE9A 2MKIA 1TMMA 5U47A 2KHCA 2MJNA 2Q1LA 1S1TB 1WKLA 4JHDB 3E2EA 2YKNA 4HTIA 3U3GA 4CZKA 1RWOB 1QUPA 4IG3A 2NYHA 3TZWA 2B8PA 4RW4A 5A2QU 2NXCA 2OP5A 4A48A 1WNSA 3L7UA 4DL0C 3M2UB 3RJMB 1MMNA 1RDAA 5FLXU 2R4FA 3P83D 1RTHB 2UXDF 1ZS6A 4M3YA 1MWKA 4HL9A 1NAQA 1VBYA 1EQ0A 3CG7A 1S0MA 2QMXA 4H4KC 2GVZA 1NMEB 1A6LA 2NSBA 2HEKA 1BHLA 4NI2B 4WK3A 3HHLB 4QCLA 4HHJA 4B3RF 2HSEB 1WDTA 2F65A 3ULEA 3BSOA 3PY8A 1G99A 2A10A 2LQ5A 3HF5A 3W9HA 1ASWA 2FSJA 2BM1A 1UVKA 4O8UA 2YPZA 5J2NB 1TKXB 2F9JA 1T11A 1YAGA 1PJ7A 5EU7A 1RHUB 2GGPB 3UW1A 4TN2A 4BRNA 1OS5A 4CI0B 5EWEA 3T5LA 2NYIA 6FDRA 2P5VA 1C4CA 2HW3A 4K4YA 4ETXA 4F04B 3ELHA 2IJRA 3H42A 4DUZF 5DETA 2VG6B 3RB4A 4DV1K 3MM5A 2N3LA 3AY9A 5BPNA 4DPXA 4NO7A 4NMLA 3SUNA 4ZKAA 1OJ4A 4WKYA 1WI6A 3G8QA 5HMZA 2GUPA 1VSKA 1WLJA 3HKWA 2B4UA 2RRAA 3H2VE 5CQGA 2ZBPA 3MTKA 3T3FA 1F60B 4AL5A 5AQFA 4DV2K 4V19J 4JD2A 2J9DA 4U67Q 3CFOA 4RCHA 4E1JA 4KQZA 4KO0B 3CWJA 1PO6A 4X65F 1YRXA 3CC4N 4LF8J 1GEHA 1UVLA 3UNYA 2YHBA 1VIXA 4EZ9A 3NGRA 2KT5A 4WQ5C 1WSVA 4O55A 2O8BA 3T7ZA 3MM8B 4DR7J 1JCGA 3O9QA 4QJVA 2CPZA 4PG4A 1PC5A 3MPUB 3KIOA 5D0HA 1D1UA 1F9EB 4DZ6A 5D77A 1OY6A 4WFYA 2D1CA 2RB7A 4DQPA 4FBUA 2WBNA 1F3FA 5E3QA 3M2VA 4ZS6A 1WORA 4OI4A 4KR0B 2JWLA 3CD7A 2IVPA 4GVLA 2JNJA 2CQDA 4KB7A 3TUJC 1WOQA 4NWBA 3KK1A 1OY9A 3TW0A 2ZZNA 4W5QA 4NLUA 2IIRA 5KFVA 3ZO7A 4MKYA 3BJYA 4LF6F 1HD0A 1YJWN 2B7CB 2CAJA 4C48A 2GTDA 1RDCA 1S0NA 3FLCO 1HKAA 5GIPA 4XDDA 3EE9A 5B8HA 4F2RA 2DNNA 3NWGA 4Z4IA 4BE1A 1AZSB 4MKBA 2ZDOA 2RQKA 1RFQA 5IQQA 5C42A 3I87A 3VQ6A 2FF3B 3FFIB 4UZBA 3ZSXA 2YCHA 3D5MA 5F8IA 2DXEA 3CQXA 2GEMA 4FLWA 3IBWA 4K25A 2MXYA 3DC2A 4CYUB 3NMUA 1Z2ZA 2V94A 1SJ4P 1WD6A 1YRUA 4IFVA 3EE8A 3S3OA 4J9RA 4OQJA 4TY8A 1XQIA 3Q8YA 4JV1A 1XNRF 3C95A 2VU5A 1AYEA 3MCNA 4ZCKA 2E88A 2YNFA 2FIUA 2VC0A 3QGGA 1N8RO 3SQGB 2LDYA 5HP1B 3GCWP 4KE5A 4RX6A 1BQNB 4BRFA 4HHTA 3NH1A 1VQ5N 3IAYA 2WB1D 4IR1A 1QAYA 3ZTOA 2UUCF 3QFWA 4U6PA 4E89A 2DR6A 2ROGA 4DV5K 1RBLA 1SAZA 1U2FA 2GMLA 5A8WA 1ZBIA 3IGVA 2F7TA 1DKGD 3ETOA 3CMAN 4USJC 2KG1A 1VQ4N 3BH6B 3FSXA 1C0UA 4R79A 3JSRA 4BBYA 3BQ2A 3H0PA 3BBFA 1N32K 4JI7K 2PN6A 2V8PA 1T95A 1C1BA 5T41A 5C0YA 5KG7A 1FA0A 4DF8A 1S0VA 4OHZA 2PYLA 1WOPA 4P73A 1GH8A 3CQ8A 2MTLA 2YNIB 4PR6A 1NKBA 1LWCB 4DU3A 5AQKA 2OPRA 2AZ1A 2EG1A 3BZQA 5HBMA 2G2ZA 5A2QY 3KLGA 2CFXA 4DV6J 3NGUA 1VQ6N 2GX8A 4CDIA 5FLXY 1HYVA 3NGTA 3FZHA 4L76A 3MTJA 1SUQB 2F5GA 2CG4A 4ZJOA 3HSDA 2HBJA 1G7CB 4CIFA 2R2SA 3J80U 1J5EK 1X4GA 2Q3SA 1RT4A 3MEEB 4LT6A 2OZSA 2HVIA 2YX1A 5C7PA 4TU7A 3CCRS 2N4DA 4GV3A 3FZLA 3E9OA 3W66A 4L3KA 4OHWA 4LRFA 2V8HA 1RUSA 1S0OA 4NEZA 1G15A 5DLGA 4JAXA 4C3LA 2JLGA 2VQFF 4LRBA 3NS5A 3QGIA 1R7IA 1T6CA 3P1GA 2FHMA 2KRRA 4USIA 4G1QB 2QFJA 4FZZA 1YXQA 3H40A 1Y11A 3VALA 5IWAK 1IWGA 5BRHA 3BYPA 5CY4A 4DMNA 4CP5A 4ED6A 5DQHA 1S1VB 1J2VA 3VQQA 3FDSA 5AZIA 3ZSRA 5CHCB 4GKKJ 1Q82O 3OJSA 4JKCA 1RBTA 4B3TF 3ZZZA 5AT1B 3O4WA 4WFNL 4G1PA 3LP1A 1N88A 3O1LA 4M5DA 2D1KA 1Q18A 3RUBL 3UDVA 1Q5YA 2BEFA 2ZJPQ 1B7YB 3W7BA 1TYQA 3DOLA 1S9GA 3OS1A 4B9QA 4MFBB 4A8SA 3HDSA 5M1FA 3CJ5A 1HKBA 3TSPA 4I69A 4UY85 1CULB 2V2KA 4GKJF 2DJWA 3GG4A 1MWQA 4ILGB 3T9ZA 4I2QB 4Z4HA 3VA0A 1RILA 3GV8B 4Y65A 5JVGL 2VC1A 4BS2A 2GO8A 2BKPA 1GMWA 2QWPA 4TSXA 3G87A 2HK3A 2IDEA 1GXLA 2CPXA 2GIFA 5DDRC 3OD2A 1LW0A 4KB1A 1KQFB 2CH6A 5HMXA 2DO0A 4FWQA 3Q8UA 2PSZA 1ZBSA 1VBXA 4KTZA 1LXNA 2VUGA 5IT0A 1TVRA 3P31A 3HHKA 4ID5B 1TK0A 3ILJA 1XHXA 2BW2A 2V7YA 2DRBA 4DV3F 3NNCA 1SH0A 3RVCA 4H54A 1M5OC 4URGA 2UUAJ 2NRHA 3RGIA 2R2UA 3SZ2A 5C2CA 1MU2B 4WF9L 4ZPDA 2GHPA 2QT7A 4E7LA 4DCOB 5LJWA 2W40A 1FCAA 3EEQA 1NSPA 3H5UA 3OL8A 3DRYA 4CQ1A 2BUNA 5FPNA 1NH8A 1SCJB 3L9ZA 4K0KK 4JV2A 4MLHA 4LF2A 1OPZA 4PZVA 4DSFA 1X9MA 1NJIT 3B82A 3L3VA 3QB0A 1FEHA 2HZVA 2MQOA 1U2VB 4ZP6A 3OHRA 3ISND 2YNHB 1CLQA 4CLKA 3IFEA 3AAPA 2O3DA 1UAWA 1XUPO 2W2OP 4DG1A 4O4GB 4LF5J 2QLBB 4C8OA 1WSIA 4LF4F 2XO7A 3O6QA 2FLNA 2NUHA 4JI2K 2E1MC 3PM9A 2WTFA 4CWBA 3IGNA 4MIBA 4S0MA 1S59A 3H6EA 5KT7A 3ENAA 3V1QA 2D0OA 2O8EB 4EYHB 4WWSA 1SC1B 1WTFA 3TAMB 2F7VA 3MXMA 4ELUA 1NKCA 3SAGA 1TUYA 2AJFE 4ILRA 3ILOA 4DR3K 3JXUA 2VZ9A 4M3UA 4M5KA 4QS8A 2VFSA 4GW6A 1I3OB 3PKYA 3PYEA 2OKQA 4UOHA 1NM2A 3G6XA 2DHAA 3GJQB 3BF1A 4CLFA 4OLAA 4BWMA 3AQPA 3GYGA 2QL7B 3IKMA 1BG3A 4CZEA 1JLBA 2GNKA 4FWRA 3NGIA 1PAUB 3W62A 5DM6L 1QAJA 2ASPA 2G1DA 1X4BA 2JVRA 3L2RA 3J80Y 3DLRA 1Y10A 4ZPAA 4DUYF 3FMWA 2HG4A 5GMKa 4K8RA 2YX4A 4PYAA 5IC6B 3KHHA 3JXOA 4GNIA 3MMBA 5C5JA 1HBOA 3A8JA 1VLYA 4WFBQ 1YVUA 2QRRA 1Y4ZB 4M7YA 4CO4A 2R8IA 3V4MA 1N0VC 4IOXA 3V9ZA 2H51B 3HHNB 3CB4A 3QNNA 3GQCA 2D3OR 5HOOA 5KFIA 3F56A 5EWFA 3C65A 2W2NP 5DJBA 4JP8A 3GDQA 1AB8A 3G6EN 2BUPA 1MN7A 3QFUA 1NPKA 3I4HX 4LFAK 4TXSA 4O5BA 3Q22A 1Q81T 2HWIA 4QQBA 1HYSB 5HVGA 1JLFB 1LQ9A 2ACYA 4HVZA 4EP5A 3GV7B 1F5AA 3G4SN 4Q8EA 3V6HA 2XNRA 2POKA 3CJKA 2HF3A 4KPYA 5KOXA 1SC3B 3PIPQ 3PDNA 1BA0A 2MKHA 2G0IA 2LEPA 4E7IA 1ZA2B 4LY7A 5AQQA 2W9AA 5HRRA 2V7ZA 3OYEA 3NNHA 5GMDA 4Q43A 5KT6A 1WEXA 4C8MA 3RBXA 4DTUA 3D1QA 2RH3A 2B3TB 1DTQB 3T1HJ 4E19A 1RA7A 4DHYA 2DCLA 3DN9A 1CS4B 2HVEA 3HD2A 1WG5A 3JQMA 2QN6B 4CJUA 3W65A 2MGZA 4J9SA 3QPIA 1HBMB 2RKIB 4KI6A 3CC2N 2QIFA 1VSMA 2P9KA 1IBMK 4QIWD 1HARA 2X74A 3TUZC 3R3TA 4DR5J 3V6JA 3QSIA 4P6QA 1NOZA 1HW8A 4CGJA 3Q8QB 3E01B 3HVAA 1HBNB 1U2CA 3KYLA 1RTIA 3QIOA 2I9SA 2MJUA 3BPDA 2IBKA 2GCFA 1KEKA 1J5EJ 4LF7F 1Y3KA 2B4JA 1IBKF 3S1TA 5A8KA 2B7BB 1RAAB 1WAFA 2HS0A 2JC1A 3EXYA 3PJ9A 4EBCA 4LFCJ 4EBDA 1R27B 5BR8F 3EX7B 1JK9B 2KJVA 2KT2A 1LV5A 4ILLA 2NRRA 3AY0A 3HOTA 3L09A 1CJUB 3CIPA 4ER8A 1K47A 4CT9A 1NO8A 3HHLD 3C16B 1Q9XA 3S9HA 2VPZB 4JLHA 4CEEA 3J7Z5 4Z94A 4PWDA 3ENBA 4BRPA 4B9MA 2EFGA 2PC6A 4CJPA 1FDBA 5HO4A 3OFGA 2BANB 3DLJA 1VQNN 2FBTA 3ZSQA 4FJNA 1M5VC 5HROA 4OHVA 2ZM6F 2OTLS 2AEFA 4OI2A 3DYAB 3MUVP 1V4SA 1FRHA 3V9SA 4X62F 4NLXA 1Q8LA 2M7SA 3PIOL 2DGXA 4B8CA 4CEOA 4DS4A 4L6V3 4BC5A 4LSLB 1C0FA 4TQRA 1S3XA 3QO9A 4QIFA 4URSA 2QV6A 2CJXB 4AT1B 1RLDA 1DJ0A 2XYHB 4JN4A 5B0EA 5ETOA 3LW5C 1PC4A 1HNWF 3SPZA 4OYXA 4ZTJA 1W9HA 4BC4A 4DCJB 2EG2A 4J2AA 3IMQJ 3ID8A 4MK9A 1WHVA 4M45A 4F4ZA 3MR2A 4OX6A 2E6LA 2ZD1A 2OHDA 3IM9A 2DGVA 1J54A 2R7SA 2BQUA 3MD3A 3ZNUA 1OQ6A 5HATA 4A8OA 2OJ3A 2MKJA 2QTDA 1LKZA 2E1PA 4A8WA 2DISA 4BRAA 2GFFA 3RMCA 2OEJA 1JX4A 4ZCIA 2MSTA 1YGYA 3EJMA 2MQMA 1DZ5A 1RBUA 3GZ7A 3MECA 2RPIA 1CJKA 4CT8A 3KDOA 4J9OA 3D6RA 1RT6B 1CZAN 3CEDA 5JLFA 2NUBA 2DBBA 2ZUAA 2EKNA 3QINA 1VJQA 2DFEA 3DKDA 4DFJA 1R6VA 3OLAA 2Z8QA 3O08A 4NLQA 1JLAB 4ECTA 4FJIA 1LXJA 4KBIA 3LGNA 3CJ9A 1B70B 5CXTA 4DLGA 1YJVA 4RPFA 3V81B 2AMCB 3THTA 4WK1A 2VG7B 2W9BA 2HFOA 2OGUA 4GVEA 4H4MA 4XH4A 1QM9A 4ZLJA 3DMJB 1SL1A 3LOUA 1RT5B 5F8GA 2ZJQL 1NGFA 2HHPA 2HVZA 3G10A 2C22A 4AFFA 1VC5A 3O1BA 3CO0P 1RAEB 1J5OB 3DLEA 4BRLA 1T9UA 2JLFA 1YJNS 2CH5A 3D28A 1RA6A 1EKSA 3IR6B 4DHVA 5GAHP 1U4BA 3G71S 4ID1A 2XMWA 4DR1K 5LJ5Y 4FVCA 4CI6A 4X64K 2OFHX 4MMOA 2XSJB 4DN9A 5CYJA 4DL5A 1BISA 4IWVA 2MQ8A 4JI1F 3W9JA 2I7PA 3KKSA 1W97L 2O8FA 3THXB 5CYQA 1N34K 2O8DA 3ZZYA 2FTRA 3ADAC 3NNAA 2M8HA 3I9V9 3THVA 1Q5VA 1SH3A 2K06A 1UW9A 4EFHA 1RLCL 4AXJA 3IN5A 2Q0RA 1S6PA 4B3OB 3OVAA 3WNGA 1BQMA 4OV6A 2IIHA 3QT8A 4A5AA 4DR3J 3FCHA 2DR8A 3NCQA 2XGQA 4H0TB 1R0AB 3DU5A 5GAEI 4NXMF 1FTCA 3IWXA 2QA1A 2X1BA 2K7KA 4DR6K 1S6UA 3TZZA 3KLHA 3JAMO 1K0VA 1EWQA 3R97A 1OMSA 4DL6A 4LVOP 3DOMB 4F25A 1OYDA 2CJBA 4RBUA 2R3VA 2BV3A 5KT3A 2I7NA 3WXMB 4Y00A 1K73T 5LSOA 1SKSA 4NYOA 4Z2XA 4M63A 2E7VA 1KAXA 3O3GA 1JNZB 3RAQA 2UXBF 3M8QA 4GY2B 4GMJB 4KJIA 3D1OA 4DQSA 4HKQA 3G96A 3RSEB 3A8IA 4Y0FA 3CSKA 3EWGA 5HMWA 1AFJA 1IKXB 2IRUA 4X66J 3KJVA 1WC3A 1VSLA 4CH1A 1VSHA 3H5SA 4NCGB 3O2IA 1T94A 4I1TA 4QR2A 2VHGA 4BY9C 4L75A 2C2DA 4HEA9 2HQCA 2HMIA 3MEDA 3S6EA 3Q0AA 5L39A 4PKHA 4ED5A 1N0UA 4MH8A 2ZBRA 2E1YA 3EY1A 4ZVPB 2WOMA 5AQVA 2XGPA 1RCXB 2FUG9 1WBBA 5GVQA 4KHYA 1WEZA 4RU2A 3K5LA 3ULDA 3POTB 4F50A 1XNQK 3I55S 2K1RB 4LSZB 3AODA 4LR8A 2QWOA 4BWJA 2HNYB 3UDLA 4CD1A 3OL7A 1AFIA 1V6HA 3OYHA 4IKFA 3VWSA 3BO3A 2HHHF 1LFWA 5BN9A 4DTOA 4QOTA 1XTZA 2XYPB 4C0HA 2EC0A 1HR0F 3HULA 2R7XA 5BYSA 2CGJA 4H03B 1YJ9N 2HRYA 4B9SA 1U49A 1IVZA 1NSKL 1PSDA 3KLVA 2DITA 4JI0J 3V9WA 1UTAA 4PG6A 3P3DA 2O4IA 2EK6A 3VEOA 5HL7L 4NZ6A 1XERA 5GADP 2XLIA 2ROPA 3OYBA 4Z4CA 4LBHA 2ZOGA 1VK3A 3R6MA 4X4QA 4BR9A 4KRFA 5F8LA 3FEZA 5F8NA 1R0CB 2UUBK 4I64A 3QQCD 2HHQA 1T3VA 4UW2A 4KHPK 2GJIA 2X1FA 3NY0A 1JLGB 3RBEA 3P5BP 4O5FA 4F2SA 5KFOA 1FNXH 3TO8A 1SJQA 2NSCA 3HL8A 1MLAA 2DH7A 4B9VA 3ZZ0A 1D9FA 3T6BA 5EHHA 2F4VJ 1S10A 2GW8A 8RUCA 1D8YA 1RDRA 4W5RA 1RTDB 1RQ0A 4BLGA 4DFMA 3VQCA 4Q0BB 1HA1A 5KG4A 1DQ8A 1LW2B 3H7HB 3GFHA 2DHSA 2QX0A 3GIRA 2MDAA 2JEIA 5AR0A 1GLAG 5L9XA 4WE1A 2GIQA 4NA2A 5E0OA 4JKAA 5I9EB 4I7FA 4AHSA 2HZCA 4CO0A 2HS3A 4ENOA 3MWBA 1NJWA 4C98A 1B4SA 2M52A 3BDEA 2L9DA 4QYRA 2B5JB 3D7SB 4J9KA 2JFKA 1BIZA 3D2EA 2QKBA 1ZPWX 4IZ9A 3K58A 1WUAA 3CULA 4AXIA 2DNGA 4P72A 3C7NA 4I9LA 3OJUA 1JWWA 4Y6IA 1OO0B 1HNZK 5AQTA 4J91A 3LPUA 5SUHA 1T3OA 4U67L 3DRSA 4DJBA 3H2LA 2ZC4A 1NK4A 3R3LA 1HMVA 3LP0B 4IG0A 4I2PA 3QRPA 5A8RA 4HHHA 3ZTRA 2VODA 2QWMA 1QQOA 2VCPA 3AA3A 1VS3A 1FVQA 1HLWA 1N33K 4FXDA 1EETA 1U8SA 5K5MA 2Y1IA 3UR0A 1KBRA 4HWIA 1XR7A 2BJDA 1VIOA 2VV5A 4LBIA 1T9WA 4IFYA 3BSAA 1DBDA 1NMNA 2NRWA 3ZT1A 4B8AB 3SXLA 3UVJB 2NXNA 3AAWB 5CCLA 4FJ9A 2AYBA 5H1SV 4KV8A 4KGXB 2VGMA 2QW9A 1LAWA 2QA2A 1VQLN 3LQVA 3FZ2A 1JL2A 4K4UA 3TVZA 3FZKA 1HW9A 5BXIA 1L3TA 2X78A 5JUMA 1URNA 5KGWA 2HWTA 2RVJA 4KH0B 2DGTA 3ZC4A 4IG3B 1HJRA 4RW4B 2GMJA 4LF6K 2X51A 2A1BA 2KU7A 1N5TA 5KFXA 2CGKA 2RE2A 3TX0A 4U8VA 3NS6A 3AVAA 4RL1A 5D0RA 4JI5K 2GAHC 2OPSB 3O9SA 3ZX0A 3PW5A 5RUBA 5BRFA 3O3HA 3BSNA 2ILZA 4A8QA 3AARA 1T44A 4HH1A 5B0GA 3JQKA 4RWWA 4L3NA 5KFBA 3B8HA 2GVZB 4LIRA 4ZDNA 4XDCA 1M1KO 4DQRA 4E3SA 1X4HA 2I1RA 3PFOA 3CPWR 2Z30B 4DPOA 4LF5F 1EQYA 2WRMA 2QWNA 3ULEB 4B1WB 3I56N 1JJHA 3TZXA 3IG1A 2KI2A 2P9NA 3EZUA 1NBWA 5IXUA 1C0TA 3CCUS 3PX6A 4Q2LA 1NCLA 4YR0A 4DV2F 4CEQA 3D3BJ 4FM0A 1X4EA 2WSCC 2JH3A 3MM5B 4CLWA 3CDAA 1VHXA 5AQOA 3W5XA 4M5LA 3CD6S 1C1CA 3UR3C 5HSPA 1MDUB 2U1AA 1UJ5A 2Y9HA 2VBXA 2J9EA 3CCMS 1DQAA 3TARA 3EPGA 4R8UA 3WXLA 3MMCA 5EOYA 1IO2A 4KGMA 3VMFB 1X9WA 3FZBA 3PW7A 5H9FJ 3DLGA 1R8AA 1GAOA 3CCQN 2IA6A 3D0PA 3MAAA 3VGVA 3UKUB 2W2MP 2DHXA 1XQSC 5E2QA 2EFVA 7FD1A 2O5DA 3MF5A 1HNXJ 2JEFA 2O8BB 3RRKA 4OHYA 4BRIA 3KNGA 1YF5L 1Q95G 1KVAA 2L08A 3CFRA 2QL9B 1VAZA 5KTQA 1VQ9N 3QEPA 2HFUA 2YHXA 1T03A 2YH0A 3V5RA 2UVWA 4HTJA 2B56A 2Z4PA 3M2VB 5CZ2A 2RF2A 1X4CA 4DPTA 2RDJA 3SSSA 4WU3A 3KK1B 3JAMU 2BH1A 4G3IA 4YDUA 3KZBA 4AF1A 2Z1GA 3VAIA 3S41A 5JS2A 3HJFA 3IR5B 3AA4A 4O3SA 5GAGU 3HD1A 3BPSP 1UP1A 3JYTA 2DNZA 2ZNZA 1Q7YO 2IDLA 2NQPA 4Y3CA 1UVMA 3VF0B 4UY8O 3RAMA 3KUHA 4MYUA 2V51B 5IM0A 1QY7A 5C42B 4ILHA 1IR0A 1ATSA 1QJHA 1KR4A 2O67A 3HM8A 2NLWA 3DRXA 2PGCA 3IRXA 4B9LA 4RNNA 4NXNJ 1B92A 4DSKA 3K9JA 1QE1A 1WC0A 3Q7CA 5CR4A 3R1XA 1QQMA 4N8OA 4QBUA 2J7UA 3BEGB 2JC0A 1D5AA 3TVKA 3DDNA 3J81U 2DVIA 4IFVB 2JWNA 1YTUA 1QTMA 4ZVEA 3KLFA 3EYZA 4DSJA 4DOZA 4TY8B 3PYFA 1UMJA 3WNHA 4HI1A 4QWBA 3C66A 1EZZB 2DEJA 1OKJA 2C3PA 1RBSA 5ELZA 1H3DA 1SI9A 1RT1A 5H9EJ 1A5WA 1N32F 4JI7F 3JS6A 1GXUA 3AA9A 3D6MB 2COLA 1ITGA 2FVRA 2R7RA 4FW2A 4USHA 4ISFA 4CJWA 1NU4A 3NGZA 2DNPA 2ZJPL 3PTWA 1XNQJ 4FOEA 1S1XA 3TJ9A 4IUFA 3SJHA 4L74A 2KT3A 4DR5F 4RKUC 4C23A 2LMIA 4KGZB 3R5BA 3R2DJ 4U7UD 1BC6A 5A0YB 3PFEA 1U02A 4FVMA 4NRUA 1TFYA 2HHSA 3KK2B 1C1BB 2DTJA 3H5YA 3CJ3A 4CLTA 5EX5A 1HD1A 3MEGA 1J5EF 5AQJA 4CZIA 2UU9K 1TAQA 1NK5A 5KRTA 1IJJA 1NM1A 4YP3A 3UCZP 4LFCF 2XWYA 1RWPB 1HI0P 2KFNA 2LQJA 5HBMB 2QG9B 1NZAA 4JI4K 5E3RA 4H4OB 1RWMB 1VGYA 1YJUA 4JUZA 3G9CA 1WAJA 4DV3K 5C15A 3KUGA 3PXGa 3VETA 1XMQJ 3KHRA 1N5YA 3CPWM 3GJTB 1Q4RA 2NZCA 1RT4B 4WQ4C 4A59A 1YWXA 3D45A 1ELOA 4NCBA 1FRMA 3CCWA 4YHHJ 1RACB 3BF3A 3NCRA 4R5PA 3VF2A 1U7LA 5IWAF 1NHKL 3MMJA 1ILYA 5KG2A 1PJ5A 1N6QB 5DG7A 4FYDA 2EX3A 2AX1A 2ALZA 3DDKA 1NB7A 5J2PA 3HCXA 2EW9A 2XMUA 3BO4A 1AA1B 2H48B 3R6LB 5K8OA 2FJVA 2BVZA 3R1LA 2ZE2A 2LP4A 2UYTA 5FPMA 2J9DE 4BR4A 3EVWA 3HHDA 4JB8B 3PO5A 2ZZMA 2F8SA 3SI6A 3SAHA 1Y64A 2XY5A 1Q8IA 1RB0A 3CC4S 4M5GA 5AXLA 3Q8RB 2BYCA 3HLUA 2BQ3A 1SV5A 2LYVA 2QWQA 5LSLA 5B0DA 4LF4K 2FJWA 2YX7A 2BE9B 1ASVA 4ZPCA 4FM1A 1U8WA 5AZIB 2OZMA 5KFAA 2ZH6A 2FSKA 4UUWA 1O1WA 3P6YC 3VR1A 5CD4A 1XJWB 4YS2A 2LQBA 1KWMA 1RISA 3UDCA 4FL9A 1P9YA 3AQOA 1IBLK 3A5OC 2WONA 3NH0A 2RMLA 3GSDA 1HFEL 2ATLA 4IRKA 5SWMA 3O9RA 2EBGA 1UZHA 4EWTA 1JCEA 1N33J 1M90O 4FZYA 1S9GB 3R2CJ 4H5NA 3CYMA 2LVWA 5M1PA 5C2FA 2OAUA 1A0OB 3VAMA 2HGLA 3DHWC 5D0GA 2KW4A 1KC8O 3AJ1A 3WXKA 4ED8A 1WWHA 4FNIA 1IR1A 4CJVA 3MCPA 3MK6A 3H4DA 1RT7A 2ALYB 4K59A 3AO2A 5KQ8A 4CLZA 4JV0A 3ZZTA 4UOFA 3L3CA 1CQMA 3ENOA 1Y5NB 1DURA 4KFBA 1LW0B 3JAMY 4ECWA 4IH5A 4M94A 3QZ7A 4GVBA 3MFHA 4WFBL 4F02A 4YOYA 3QYYA 3C6TA 1K8AT 2NRVA 4QOZB 1UAXA 2D9PA 4CO5A 3QERA 2HS4A 4NLWA 2EXUA 1N48A 2BJ8A 1ZAXA 1N5VA 2DGWA 1QLNA 2R8KA 5H1SQ 1RABB 3DXMA 4W5OA 2GWKA 1UA0A 2DHGA 1F3VA 4IOBA 3ILIA 2J0QD 1AXQA 1FJ7A 3LM2A 1FFWB 3CF5Q 2R8HA 1P8ZA 5F0UA 5AE2A 3J81Y 1FERA 3IBFB 1D4XA 2YWHA 5L38A 4LQ3A 2P51A 4JI2F 4LH5A 4WYBA 1KLMB 3EGZA 3CMAS 3A5MC 1ICEB 1NGBA 5CZ1A 4B3MJ 2CPDA 3ZZUA 4EYIB 4ISGA 3PIPL 4YOUA 1K0TA 3ID6A 2FXUA 3LF0A 1PBUA 4FZXC 1JQGA 4JRQA 3ET6A 4OYPA 3MURP 4UF4A 1I6JA 2V4RA 2DPJA 2IOCA 2OMLA 4F0MA 2WVDA 4DR3F 1ZM2A 5GMEA 2MB0B 1KTVA 2OUGA 4TYAA 3CW2C 4RW7A 2D3UA 5E7OB 1FRJA 1F2GA 2DTUA 1XWLA 4YFUA 3LANA 4FJ5A 1TKZA 4BGBA 2FLLA 1S9FA 3BM7A 4F3TA 3K8VA 4Y1DA 1VQ6S 3AXKA 2EFOA 3TYTA 5AQIA 4CLYA 2BMBA 3IWNC 3G6YA 3K17A 1U1LA 4FPBA 3HRGA 5DM6Q 1BXNA 4C4WA 1FXRA 3O8WA 3PACA 1JNRB 3HK2A 3GU0A 2CQ4A 1REVA 1N5QA 5J2MB 4TU9A 5DMRA 3VTIA 4OZLA 3TTDA 4CLPA 4ES1A 3M8PA 2CRLA 2GV9A 5IFMA 4CJLA 1FNOA 4F4AA 3AGKA 4XEIA 4DCHA 3SBTA 3GSIA 2ZHBA 4JK8A 5E26A 2E5LJ 2FC0A 4B1UB 2J0XA 4O0NA 2CUYA 2CYYA 1EO1A 1VRTA 2R7WA 3DLLQ 4ID8A 3Q8VA 3GYXB 4K4VA 1YBUA 2E5HA 4C2MA 4LFAF 3L2UA 2B43A 2F1FA 4CZGA 3MMBB 2XCPA 4PXEA 2KJWA 1HBOB 5KPZA 3E3XA 1ACMB 5EUHA 4DSLA 4ZPTR 3FC9A 1L3UA 3R8EA 2E2NA 4NYZA 2RQMA 1RYSA 5AQMA 2HBQB 2YNGA 1KS2A 2W24A 5AZJB 3QATA 3DCAA 4PY5A 4ED1A 2M0GB 3WQUA 5DGBA 4ZVHA 2X1GA 3K0SA 3MPDA 3TAEA 1FE0A 4RUHA 3QJLA 1H1VA 1X31C 3K0JA 2EK1A 3PW4A 3NE6A 1S1WA 1HWIA 3PRDA 3SCJE 2W7PA 1T05A 1YJRA 2BW7A 4AUKA 2MZ1A 3Q2TC 3R9LA 4ZVSB 5F8JA 3WIUA 3QLHB 3CJKB 3UNGC 4I67A 2KXHA 1QHAA 2V8GA 3HI0A 2C2KB 3HSTB 4K4SA 1M0SA 2AJ0A 1A7GE 3O80A 1BCOA 3CD5A 2A5XA 2JGUA 2LQ9A 1K8KA 2CA9A 1B0PA 3CCVN 1S12A 5HK4A 3CCSN 4F4XA 1S79A 4OFZA 1Q1KA 1IBMF 3AO3A 4BG8A 4KYZA 4BR2A 2WBRA 4NLGA 5AE3A 1PJ6A 1PBAA 4HTLA 3P45B 1R0BG 4F36A 1RDUA 4KHWA 4DFPA 2X3GA 4CIGA 2CQ0A 2G8FA 1FKPA 5F3ZA 4ZP7A 4XH1A 3MXHP 1T8EA 3VN5A 4CJRA 4TU8A 1RAGB 1EXQA 4K4TA 3QETA 4IO1A 3TABA 3Q7BA 2A6MA 3ZTQA 2ASDA 2RS8A 1XHZA 4ITSA 2XY6A 4ES2A 4DMZA 1A9NB 2OEMA 1UEUA 1WJ9A 3IM8A 8ATCB 2P9KB 1HUXA 4LVNP 3SLCA 2HBLA 2RDIA 3C94A 1BD6A 4X4VA 3SQ0A 4M3RA 2ABYA 3ENWA 3NS7B 5B0BA 3HZ6A 1RTIB 2W25A 2Z2MA 2O01C 4JHDA 2IYGA 4L72B 3G6VA 1LCUA 3NFAA 2KXFA 4E2FB 2KM8C 4URQU 1GLFO 2GWJA 1HYZA 5A8KB 5CYMA 4A8YA 5L9NA 3FE1A 3WHIA 3NAHA 3O5BA 2CWXA 3RG6A 4DV4J 1HKCA 4N5SA 1RTHA 4DL3A 4CEBA 3DRRA 4ED7A 4ZMMA 1RCHA 1X4AA 1X5OA 3N5FA 5LMNK 2W2QP 2MZJA 5HLFA 1GXTA 3N4PA 4LF8K 4JK9A 5KFJA 3RWUA 4OYAA 3QGHA 3LPEA 4PWDB 2F9DA 4DR7K 2AHOB 4D3HA 4P9SA 2YQ3A 2PMHA 2VL1A 4CJ4A 2AJ4A 1CSJA 3D9BA 3LDQA 5DDOC 3MMAA 3J7A1 4E1MA 2E1AA 2Q6BA 3M05A 4DQQA 1YBAA 3CC7S 5AQSA 4K2JA 5HROB 1BI4A 2YPYA 3BY5A 5F0WA 1SBRA 5J2NA 1TKXA 1XC9A 1MW7A 4WP3A 2I8EA 1HL6A 1S5ZA 1P6TA 5HI7A 1NDLA 3JTOA 4CHZA 4LMZA 4HLBA 4LJMA 1GOAA 3CIMA 4A61A 1FRIA 4OJRA 4C1NI 3QO9B 4NASA 2W9CA 2M2BA 1TL3A 4Q44A 2Z1HA 5ETQA 2OELA 4CTAA 1JCFA 2PYJA 1YVNA 2QXLA 2YI1A 4EGLA 3M2RA 4WCEQ 1XMOJ 3GR1A 1QAIA 1IBLJ 1DQ9A 1LWFA 1TK8A 3CM5A 4CM2A 3A1YG 3CXCR 1Z2LA 3LAMA 2KKHA 4ZLPA 2R8GA 3VQAA 4IOCQ 5HMYA 2GS8A 3R5AA 2L3MA 1HX1A 1EAYC 2FLOA 2JRSA 2JHEA 4ELTA 5D3GA 5AFUH 3PHTA 1M5HA 3R8YA 2ZD1B 3DFEA 4N8NA 2B9YA 3U27A 2FVSA 3AV9A 2G8UA 4P2MA 1AROP 2QO3A 3I0RA 4CJSA 1I94K 3Q2SC 1TV6B 3ZT2A 4H4KA 2DNOA 1KHWA 2IM1A 3VV2B 2CADA 2W42A 4IH7A 4OPAA 4K41A 2VQEJ 1ZTTA 4NYPA 3O8MA 3EMTA 1CJKB 4RUBA 3V6KA 4ANDA 1SQFA 5A76A 3GMGA 4C8NA 4JS5A 3AVMA 4M7XA 4IOAQ 3JSBA 1O8BA 2VDIA 3PEJA 2GELA 2IHR1 5IQ6A 4YY3J 3TSUA 3M9MB 4PHTX 2YHYA 3CCZA 2XC9A 2ILYA 4PL7A 3IMXA 4X64F 1NBEB 2F3JA 2XI2A 2A18A 4FW1A 2W9BB 3TNVA 3N6MA 5EX0A 4H4MB 4ERDA 3ZSVA 4M5IA 4QWEA 2OD4A 3FFIA 3DGVA 3NXZA 1S6QA 5HQLA 3OL9A 2VBWA 1ESVA 3WBZA 3UI3A 3CMES 2V50A 2Z2YB 2QFIA 2HRTA 4FSVA 2BX6A 4DV6K 5J1EB 3TQEA 5LOQA 2HWHA 4FF1A 2XZTB 1EIYB 2V4JA 3UFCX 3WC2A 4CHNA 4MKAA 3TAQA 1KQKA 1V5VA 1HHQA 2MKCA 3CC2S 4BRHA 2CQ1A 3LZIA 1WN7A 4WQ5A 4DB3A 2O8FB 3EO3A 4C8ZA 5CYQB 2O8DB 2XMVA 2MLXA 4DN0A 4FWSA 2X3DA 2HLUA 4CEDA 1BQNA 4YR2A 5IOLA 1Z1ZA 3HM9A 3LGMA 1M5PC 2JEJA 1IXKA 2ASYA 1S6PB 4CHYA 3QFHA 2XMJA 4C8YA 3I5BA 1ZXOA 4LRAA 1BQMB 4EMDA 2YWKA 2A3JA 4G1IA 5BPMA 3QEVA 2AT1B 1DAXA 2RHKA 1NKEA 3CE8A 3KLHB 3K89A 4CF0A 1MMLA 3M8WA 3CCLS 3GYNA 1FKOA 3SQOP 4DV7J 2YNIA 4GO7X 1LOUA 4OLOA 2WUSA 3MXJA 3BGLA 2ZKTA 3IDHA 2AP6A 4OGEA 3M8QB 3VGKA 3J7AN 3VQTA 1DLOA 4J9MA 4U7UK 4GKKK 5HAOA 4X4UA 4L8RB 2VBZA 3HHLC 3A5NC 4IEEA 4WFXA 1SIZA 4ECRA 1RTJA 3AGRA 4BR7A 4DSIA 1RP5A 2LXFA 4QAGA 1XNQF 1D3WA 2IDOA 3KJVB 1OH6A 4JI6J 3BS9A 4RNOA 3RW6A 3NHGA 3ETMA 2YWGA 1C2PA 4JI3J 1K1QA 2WB4A 3G2XA 2HMIB 2V68A 4BG9A 3MEDB 2VA2A 4CF9A 4BE0A 1RU2A 2HURA 4BHQA 5AXKA 2XS7A 5TKYA 1KLNA 2V69A 3CDUA 3CMQA 1CJVA 4AHVA 2WOMB 3C14A 4H8KA 1RU1A 5LL6Z 5ETPA 5DG9A 2B8QA 3VEYA 4OKJA 3MD1A 4LFBJ 3D3CJ 4J5OA 5EDWA 5LMUJ 4QPTA 3MXIA 4F8RA 3CXCM 4GO5X 3OUYA 2DNHA 4OZ1A 5HL7Q 4KH5A 3MCOA 3N4WA 2KVQE 2CDQA 3VAHA 1FJEB 4YUDA 4YQWA 1BUPA 3HJVA 1UETA 2E1RA 2OANA 2D74B 3RMDA 3MOJB 4JKDA 3A5LC 3KLEA 2KH9A 1S57A 2G13A 2P5GA 2PMWA 2UUBF 2KRBA 1N36K 2RQ4A 2M88A 4I4BA 1XMQF 2A1SA 4KHPF 4IRCA 1S1VA 1D9AA 1FFGB 2UUAK 4X4SA 5LXYA 2KYZA 2BOAA 3AVFA 1FXDA 2PI5A 4K8ZA 3ILLA 4YHHF 1NPRA 3AVKA 1KRPA 3M4XA 4MLEA 3WXIA 1SQKA 1U6ZA 1X1PA 3E9PA 1VQKN 2KZZA 2GA7A 3WC0A 2CVIA 4P2SA 4Y28C 4ZVTB 4X84A 2JSXA 2VICA 3OFEA 3HVTA 1GMWD 1YBTA 4TYBA 4CVNE 3FBFA 1CULA 1VDHA 4J2BA 2V0NA 4MK8A 4ZCMA 4O3RA 4BQZA 3IRWP 3J7YI 1KP6A 4E98A 2DGUA 4TLQA 3V4IA 4ZTFA 2ZH3A 3TRGA 4Y2CA 4CF1A 4CZMA 4CJQA 4MAKA 3SIPB 1W2IA 2HAIA 5TKWA 5CAAA 4LF5K 1F0XA 1LWXA 2XYGB 1EP4A 3QMLA 2F63A 3OYNA 3FQLA 3L8BA 4ZHRA 4EP4A 5BRDA 1HNZF 3VEXA 2V63A 5CABA 3AVCA 3THWB 4RNFA 1KFSA 3IA0A 1W25A 2FGCA 5AE1A 3DLHA 2WTUA 2R7VA 2EFPA 2XMAA 2HNDA 2IM3A 4ED0A 5LMNJ 1RAJA 1N33F 1G4CA 3GFXA 3DWLA 5GAHI 2IPOB 4HDHA 4GV6A 1PYSB 3SBMA 2CIMA 3L4BC 4AE5A 4BACA 3C7NB 1MN9A 4CFBA 3CT9A 4USTA 3FEXB 3MM9A 4CZJA 2Z2ZA 1GTEA 1T3NA 3BKFA 4YB7A 2V9KA 3T69A 2PZSA 5ETMA 3DRSB 4ZPVR 1HMVB 1SJ3P 4I2PB 3WNFA 3OBWA 4EZ6A 5A8RB 1N54B 4PEOA 2QMWA 1KFDA 2NRZA 1EETB 2XS2A 2R7TA 5DQGA 1TUUA 1ZH5A 2CQ2A 1TK5A 3ZX3A 2Y1RI 4OYIA 4IJAA 4RW6A 4PWUA 3K5PA 3US5A 4M5JA 3ZTSA 3FCVA 1RBVA 3KLIB 2B4PA 3VQ8A 4JI5F 3I5CA 4B3RJ 2CG8A 4KV8B 3M6XA 1HHSA 3G0ZA 3SCKE 5KFYA 3DM2A 3J7YU 4CGGA 3W5YA 1IG8A 2NRXA 5JLHA 2J7WA 5D6GA 4JBCA 3CFPA 1KONA 4CFDA 3VZHA 3GFYA 4JKHA 3VQEA 1OVYA 3TAGA 2O8EA 2QWRA 1CC8A 4K2XA 1W0HA 2NXEA 4FYVB 4ZVOB 3CCJN 1HI8A 1VYAA 1KOOA 2OTLN 4DUZJ 2BABA 4ZPBA 1XBWA 1IKYA 5F8MA 4XPEA 3TOQA 4B3MF 3M8SA 1RT3A 3W64A 1I94J 2WSEC 2YTCA 1NK6A 3OTEA 4CEFA 2YKPA 4RTFD 1XN9A 3HVWA 3CJQA 3AA5X 4CFCA 1HKGA 4ECQA 4OYBA 4O8KA 3JSMB 5KFSA 2V6AA 2XG8A 2DIVA 3U8XA 5MAOA 3TAPA 2NR0A 4ELVA 4X65J 2AV5A 4JK7A 2J5AA 1D09B 3CCEN 4BC7A 3IG1B 2XB2D 3CJBA 1H7WA 4HDGA 5LT5A 2P9NB 1C0TB 1MWZA 3T1HK 2EWHA 4P2FA 1K9MT 1LK7A 4B1YB 1TMJA 4I0WA 1ZAWA 2ZBCA 3TTFA 4OZ5A 2P9PA 1H98A 1YJ9S 1IG9A 5KPTA 2BJ3A 1MNEA 3DLKA 3I9ZA 3EDQB 2VKZG 2H1YA 1VK0A 3SV3A 4UQTA 1GLEG 3C6AA 1R8HA 3ZCMA 3MM6A 1NSAA 1C1CB 4RBVA 2DO4A 2PEHA 3K8WA 3ENQA 2LQ8A 4DR5K 4NLPA 4R8UB 3MMCB 3HBTA 5CE3A 1U6FA 1LWEA 4MTPA 4NLSA 2HHTA 4DEZA 1QQCA 3UD5A 3KNAA 4FYYB 3HSJA 4NCAA 3AVGA 3Q86A 3DLGB 5AQNA 3GE1A 3DXBA 1TL1A 2CVEA 5GADI 1QZ6A 3UB5A 4MDAA 4XK8C 3QNOA 1KD1T 4AHTA 4CO1A