1IKXA

K103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikxA05
1FK9A 1K1SA 3HVAA 2FVQA 4CJ4A 1JLFB 3K57A 2Q3SA 2G8HA 4IR9A 4NYNA 3TVKA 2NUBA 2KZMA 4W5NA 4E7LA 3SUPA 2HMIB 3I5AA 3QETA 3ZSOA 3G6YA 3SQ0A 4J9RA 3D0PA 1TKTA 3H08A 4IBNA 4OLAA 3V9XA 4CGGA 3HPGA 2YHBA 4K50A 5KFIA 1NK4A 1S9FA 2FVSA 3GIIA 4HUFA 1BISA 5F8JA 3BSNA 2E9ZA 4J2DA 4YR2A 3OYLA 4WE1A 1BHLA 4CJEA 3SQ4A 2F8EX 3KLIA 4RUCA 4DFKA 3DDKA 5KFOA 2ASDA 2BE2B 3QZ7A 2VWJA 4H4OA 4ELUA 3HM9A 5KRTA 3D5MA 1LWCB 1U45A 3MR6A 1S0MA 4OLBA 1ZETA 4FZZA 1IKYB 4M45A 2VG6B 3PW4A 1VSHA 4KHYA 1WSIA 5DK5A 4X2BA 2HMIA 1TAUA 1KCFA 4TQRA 1RDRA 4B3OB 4CGJA 3SZ2A 1FKOA 1QAIA 2DFHA 5DQIA 2CKWA 3VQ6A 5L1JA 1VSEA 2RDIA 3GILA 2OH2A 3UR0A 4GC6A 2BGGA 2HB5A 4NLVA 4YNQA 1U09A 1NKCA 4XIUA 4KO0B 4B8CA 2BDPA 4KREA 1KTQA 3C6UA 4EO6A 1JKHA 4DTPA 4E7HA 2E6LA 4PWDA 1VSIA 4ZVHA 1RTHA 4BWMA 1NJZA 1S6QA 2VG5B 3M8RA 1IKYA 2PZSA 3QLHB 1NJWA 3QNNA 3VQDA 1Z25A 4ECYA 2DPJA 4IFYB 1WSFA 3H5YA 1C1CB 3RRGA 5KG5A 1L3VA 4FLUA 3TABA 3RAXA 3HPHA 2P1JA 3K5MA 4OKEA 4KBIA 4RNMA 3LDSA 3MR2A 1C1AA 1VSKA 4CJLA 2D0AA 3BDPA 3RAQA 1IKXB 4FJNA 4J9PA 5KT3A 3OYBA 2ILZA 4JUZA 2OPRB 5JXSA 4KO0A 3RWUA 1VRTB 3NBPB 3CFRA 2RKIB 5KG0A 4JV0A 4ECWA 4RW8B 2IJNA 3LP0A 2AJQA 5J2QB 4NLGA 4J9KA 3SFUA 2R2UA 1NNDA 5I3UB 4CHPA 5CYQB 1VSMA 1ASUA 2R2TA 4Z4HA 4IOBA 1QAJA 1RILA 3NGDA 4E1NA 4ZTFA 1C1CA 4Z4EA 4F8RA 2DY4A 3TQ1A 5KG3A 4KKOB 5HRRA 4FJ7A 4KAZA 2O4IA 1Z4UA 1RCHA 3RB3A 2ZKUA 4ID1A 2XI3A 4G3IA 3RMAA 4M95A 3KHHA 3NBPA 2W9BB 2RKIA 4I7FA 3VQCA 1HYZA 1BIZA 3K58A 5I3UA 1YVUA 1VRUB 3O4NA 2W8KA 2ASLA 2FLLA 4DMNA 3CDUA 1QS4A 4DS4A 1RTDB 4F3TA 2OYQA 4TQSA 4IFVB 5EWGA 4NLSA 3M8SA 4FJ8A 4J9NA 4J2AA 2HHTA 4ICLB 1S49A 4ZHRB 2BQ3A 1JLGA 2YKNB 2C2DA 1X9WA 3QEXA 1DLOB 1SH0A 2ZE2B 1UWBB 4O44B 3QGGA 1ASVA 3AO3A 4FZXC 3IAYA 4HCBA 1XR6A 4ELTA 2OZMA 1F21A 4FBTA 3WNEA 3DLKB 3SYZA 4W5RA 3DI6B 3RMCA 4ZPDA 4ZPCA 5F8MA 1IKWB 4EP4A 4FVMA 1KVCA 2OZSA 4ZP8A 3NHGA 1X9MA 2V4RA 1IH7A 1S97A 2JEIA 4NCBA 2WB4A 4F2SA 1RT3B 4DSEA 2X6SA 4IFVA 5C24A 2P5GA 1QUVA 4W5QA 3OYCA 4DF8A 4IRKA 4J9QA 4ZHRA 3HPOA 2YKNA 3ULDA 4Y2AA 1DLOA 1UWBA 4O44A 3KLEB 3KK1A 4YMEA 2G8WA 4I2QA 1CXQA 4B9SA 3CM5A 1REVA 4CFCA 1X9SA 4FCYA 2D3ZA 3HO1A 3DLKA 1UA0A 3DI6A 5EU7A 5KFZA 3SNNA 4FK0A 3T5KA 4C8NA 4DL4A 2IBKA 2IA6A 3FQKA 1GOAA 4JS4A 1JLAA 3IGVA 2QKBA 3MEDA 2WRMA 2UVVA 4O5BA 3QGHA 4O4RA 2G8KA 3T5HA 4KE5A 5CYMB 3V9UA 1NJXA 4E3SA 3MECB 5JUMA 3AO1A 4IKFA 3L2VA 4YP3A 4G1QB 2GIQA 3SV3A 1J54A 1I39A 3PJXA 4K4YA 5KT7A 2EX3A 3OLBA 4KTQA 1RT2A 3ALYA 4CIGA 3I8DA 4CECA 1XWLA 3Q8RB 4B9LA 4DU3A 1RBUA 4IDKB 3RR8A 3PY8A 4OPJA 4TYBA 1G15A 3VQ8A 1CLQA 1TV6A 1EX4A 2HNZB 1RT1B 4M3YA 5KG6A 4FYDA 4WYWA 3V81B 3OHBA 3SPZA 4HVJA 4DSIA 3QNOA 1RTIA 4FJGA 4M3XA 3THVA 4RU9A 3MECA 4KHUA 4XO0A 3RR7A 3D45A 5DQGA 3OVNA 4QAGA 4M3WA 1LAVA 4G1QA 3MFHA 4FJMA 3KOAA 1XHXA 2XC9A 2XGPA 4CEZA 4UQGA 3IRXA 1XHZA 1NK5A 3LP3A 3BR9A 4CJFA 4F50A 2HAIA 4Q43A 4WFZA 4OPKA 2ZD1A 3ZT2A 3B6PA 1RT7A 4Z4CA 1LV5A 4IKAA 5FROA 3DRSA 4CJRA 5KFMA 3SQ2A 4C8OA 3ZSVA 4IDKA 5KRSA 4FJHA 2HNZA 3F73A 1RT1A 4MK8A 4PA1A 2FVCA 2YNHA 1Z26A 4CJSA 3NGYA 3OYHA 1GOBA 3BGRB 4ID5B 4GC7A 1FXXA 5HRNA 2BQUA 2WOMB 3MF5A 4Y1DA 4MKBA 3CM6A 1B9DA 1JLQA 4MFBB 4NLDA 4OVLA 4NCGA 1KLMB 4KTWA 2I1RA 4NLQA 2OPPB 3IG1A 4BDYA 3TI0A 4CFDA 2F8SA 4ZVFA 4CHOA 5HRSA 5HROB 2FLPA 3PX4A 4FS1A 3NH1A 3CIZA 4KHQA 2F96A 2HVHA 2VWKA 1HNVA 4DU4A 3MEEA 2XCPA 3KLHB 3OYKA 3VQEA 3VQBA 1TKDA 4CGFA 3O3HA 1BQMB 2QXFA 5FDLA 3BGRA 3EZUA 1LW2A 4AHVA 1GX5A 4K4UA 1LWEB 4XPCA 1J53A 3AVFA 1HQEA 3KK2B 3SI6A 1NKEA 2OPQA 2D3UA 4J9MA 1EKEA 2VA3A 4EEYA 2RF2B 2OPPA 3NMAA 4TLRA 1K6YA 4I2PB 5HROA 2A1RA 3OYMA 4RW7B 1HYSA 3ZT3A 2YKMA 3LAMA 1KRPA 3LP2B 2AWZA 4NLUA 2GIRA 2V4QA 4DU1A 4RW4A 4O3NA 3OS2A 1S1UA 4R5PA 3NDKA 2XO7A 5J1EA 1BQMA 2XI2A 1VSFA 4CIFA 4K4WA 3CFOA 3BQ1A 4CF8A 1ZBLA 4RW6A 4DSFA 3H5SA 2FVRA 3QESA 4OGCA 1LWEA 4W5OA 3RTVA 4DL3A 3MFIA 2Y1JA 3S3NA 4QWCA 1ZTTA 4DFJA 1A5XA 3TANA 5KG1A 2RF2A 1YTAA 2J6SA 1NJYA 3DMJB 1SUQA 3LALA 4K8ZA 3ZSZA 2XGQA 3CJ2A 3MXMA 3I5CA 3KHRA 1NK8A 4N41A 3LP2A 5L9XA 4F4WA 4PQUB 5KT5A 4GVMA 4DTNA 1C0TB 1WSHA 3KLIB 3MXIA 3CDWA 4H4OB 4IG3B 3NE6A 1JIHA 4J2BA 4DTRA 3NH0A 5KFGA 3A2FA 2WONA 2JLEA 3H5UA 4JV1A 1NHUA 3G6VA 3OYAA 5KGWA 5KFJA 3HT3A 4CGHA 1VSJA 1QSSA 4Z0UA 4O3QA 3H4DA 3SJJA 4NLRA 4NLYA 4RUAA 3K5OA 1FKOB 3DRPB 4TXSA 1D0EA 4IRDA 1GX6A 3QEVA 3DMJA 3DYAA 4MKAA 3L2UA 4E0DA 3BSOA 4TN2A 1OS5A 4DTSA 4CEBA 2HHSA 2UVWA 3C6TA 3BQ0A 1WNEA 1KVBA 4GW6A 4PQUA 4C8LA 2Z1HA 3RMDA 1C0TA 3SCXA 1T7PA 3C6UB 1JKHB 1J5OB 2HHXA 4WYLA 5DLFA 2B5JB 4IG3A 4PWDB 3NGIA 1RDDA 1RTHB 4Y3CA 1IG9A 1TKZB 1S6QB 5FRNA 1Q9XA 2I5JB 3OS0A 5KFHA 3V9ZA 5EWEA 2FBXA 4FLXA 1DTTB 4ECZA 2D0BA 3OS1A 3UDLA 1WLJA 2B6AA 3GV8B 5DG8A 1NK0A 2X74A 3PV8A 3MEGA 4DQSA 4MIBA 3CO9A 2HNDA 3DRPA 4M3TA 3DLHA 1MU2B 1SH3A 5HRPA 4NLPA 1YT3A 4MK7A 4ECTA 5HP1B 4R8UA 2JGUA 2V9WA 4Z4GA 1DTQB 4N5SA 1O1WA 5F8GA 4HUGA 3DOKA 3LP0B 1J5OA 3OL7A 4ECUA 4KHWA 4MIAA 1LW0A 2B5JA 1K1QA 2AQ4A 2PY5A 1TKZA 2I5JA 3NAIA 5KT2A 3EY1A 2HWHA 4DSLA 1DTTA 1KFSA 1FKPA 4ZP7A 4EO8A 3T5JA 2IC3A 4DQIA 2YNFB 2WCXA 2IDOA 4B9MA 4F4KA 2O5DA 1MU2A 3ZT0A 3N6LA 4CJPA 1XI1A 1ZBFA 3EYZA 2F8TA 5HP1A 4QW8A 4O3SA 5HLFA 5DGBA 4E89A 5DQHA 1DTQA 4IR1A 4K4XA 3HVTB 5KFDA 4RZRA 4I7FB 3PHEA 3I0RB 3T19A 5KFVA 3L2QA 2D0CA 4CJVA 4CERA 1BCOA 4CK3A 4CEOA 5F8IA 2P51A 2IM1A 1ITGA 2XY7A 2ZQBA 3PW7A 4DFMA 4PUOB 3KLFB 4Y34A 3VQPA 4O0IA 2KTQA 1RA7A 5KG4A 2YNFA 1LAWA 2HW3A 3K5LA 1JLGB 3AVJA 3RBEA 3O4QA 4IQXA 4DL2A 1RBTA 5KFWA 1QSYA 5FRMA 2R2SA 1NK7A 4DQPA 4WXWA 3CJ5A 2BRKA 3HVTA 3I0RA 1T3NA 2DFEA 3QGIA 3DOLB 4EZ9A 3TR8A 5L1LA 1SL0A 4Q5VA 5KG7A 2IM3A 1HQUB 1TGOA 1RA6A 5KFBA 4FLWA 1QE1A 2EC0A 1VSLA 3H40A 1ZYQA 4PUOA 3KLFA 3CDEA 2HNYA 5C24B 4Q44A 4FK2A 3OYFA 3QEWA 1NK6A 2RDJA 4ED6A 3KJVA 4KHRA 1L3TA 4O0JA 2ILYA 2YNIA 3KK1B 3P83D 4I2QB 3BREA 1KLNA 1TL3B 1REVB 3DRRA 3PZPA 5E41A 4E7JA 1LWFA 4ECRA 1U47A 1WNSA 3DOLA 4YR3A 1N6QA 4CEEA 3VN5A 3O3GA 4CCHA 1S9GA 1NHVA 3PR4A 1HQUA 3FQLA 3M9OB 1JXEA 1JLAB 4WZQA 3OL8A 3MEDB 2BANA 5C42A 3NFAA 4AHSA 3QIPA 4KPYA 3HL8A 4DWIA 2A1SA 2JEFA 3EZ5A 3HP9A 4CJQA 2W9CA 2IM2A 3OYJA 2GV9A 4KTZA 1R0AA 4DL6A 3AVIA 5JS1A 3NGZA 3WNHA 2C2RA 3FFIA 4BE1A 5KFXA 3GV5B 3G10A 4KHSA 3HYFA 3HKWA 3KKSA 2W42A 3DM2B 3HSTB 1RT2B 5KTQA 4ELVA 2IMWP 1TL3A 5F9LA 4NYZA 3G0ZA 2RPIA 3AO2A 4HHTA 4DTUA 3QYYA 1TV6B 3M8PB 1D1UA 3NF9A 4QOZB 3GV7B 4N56A 1YTUA 3OL9A 4DTOA 1RTIB 1WSEA 3PJWA 5KG2A 1TQLA 1RBSA 2IJFA 3S3OA 4LSNA 3IRXB 1WAFA 4M94A 3U3YA 5KFNA 2HHVA 5K14A 2IAJA 1RDAA 3DM2A 2ZD1B 3AA4A 3I5BA 4QWEA 3JYTB 1RT7B 1RAJA 2VA2A 1RT6B 4J9LA 4EBCA 3KIOA 1D9FA 3DRSB 2YNGA 4NCAA 3HP6A 2IGIA 1BIUA 4RW9A 3M8PA 4DQQA 4MH8A 4DF4A 2YNHB 3OSPA 3TAQA 4KSEB 2IOCA 4Z4IA 3AVCA 1ZBHA 3MR5A 1UA1A 3D28A 4O3RA 4HCCA 2KW4A 1WSJA 4QWDA 3WNFA 1S4FA 4CF2A 4LQ3A 4K4TA 2X78A 2QKKA 3AO5A 3PVXA 1JLQB 2KQ2A 4NCGB 3ZSQA 2JEJA 2LSNA 2G8VA 4KRFA 3IG1B 4IG0A 3JYTA 1RT6A 4U6PA 4O55A 4DTJA 1HNVB 4ECQA 2O4GA 2VG7A 3PX6A 3MEEB 4EP5A 2WTFA 4C8KA 4NRTA 4F4YA 1GOCA 3S9HA 3VQ7A 1B92A 5FDLB 3E01A 4J9OA 5I42B 2GC8A 5F8LA 5KFKA 5L1IA 1C2PA 3Q8PB 1LW2B 4B9NA 3PR5B 1RNHA 3LANA 3SUOA 3V9SA 5CY4A 1HQEB 3V6DB 2OPQB 2AGQA 3KD5E 4PY5A 2UVRA 4ED3A 1EETA 3NKYA 3KTQA 1A5VA 3QINA 4KB1A 4WZMA 2JC1A 4M3ZA 1HARA 1U49A 3ZSXA 1IO2A 1VSDA 3UIQA 2FLNA 3IS9A 1HYSB 2YKMB 2QE5A 3ASMA 4QPXA 1C6VA 4RW4B 1QQCA 4LD0A 4WXOA 1S1UB 4R5PB 3H59A 3QEPA 5J1EB 4BWJA 4MK9A 2XHBA 2Z1GA 4KFBB 5I42A 3VQ5A 4F2RA 4RW6B 4WFXA 2PYJA 4CEFA 3KHGA 4DFPA 2HVIA 3K2PA 2W8LA 2R8IA 4E7IA 3PX0A 4ED0A 4Q8EA 3AVAA 2P5OA 3ISND 4RNHA 5DGAA 3V6DA 3MR3A 1C0MA 1RDBA 1S9EA 4CEDA 3ZT4A 4AHUA 5DLGA 3L2WA 1SUQB 4DQRA 3OLAA 1WAJA 4B08A 5C25B 4WFYA 4CEQA 4I9QA 3SQ1A 4B9VA 4KV8B 3VQSA 4FXDA 1HPZA 2HHUA 1ZBIA 1T94A 1S0OA 1BCMA 3MAQA 2XY5A 4EZ6A 4E1MA 2HHWA 2WONB 4KFBA 2HWIA 5HBMB 4IH7A 4Q45A 4J9SA 3V4IA 2XY8A 2ATLA 3CQ8A 4GMJB 4JRPA 4K4VA 1BGXT 4Y2CA 1RYRA 4XPEA 5KFQA 4L8RB 4TY8B 3BSCA 3AVLA 3TWHA 3U6FA 4M41A 3B6OA 4U7CA 3OYGA 3DYAB 2E6MA 4URGA 4I9LA 4DL5A 5C25A 1S6PA 4O4GA 3AVNA 3C6TB 3PO4A 3QIDA 1S1WA 5KFAA 3ZSRA 4FJ9A 5J2NB 4KV8A 2R8KA 2G8FA 2AU0A 1XC9A 4M3UA 3V1QA 4FM0A 2B43A 3LP1A 5HBMA 1U48A 3GIMA 2R2RA 4BE2A 3HXMA 3L3UA 2B6AB 3GIKA 5DG7A 1TKXB 2UUWA 4FLTA 2FBYA 4IH6A 2PYLA 2ASJA 5CZ2A 1JLCA 3OYIA 3MEGB 3ZSYA 3NH2A 1BL3A 4YFUA 3OL6A 4TY8A 2HNDB 3SFGA 1HRHA 1ZTWA 3F9KA 4EYIB 1S1VB 3CJ0A 4KHMA 3AA2A 3MTKA 1TK5A 5KFRA 2ETJA 2E9RX 4LQ9A 2J6TA 2FJXA 2DFFA 3V1RA 4R8UB 1TL1B 3VQ4A 4ZTJA 4H4MB 3CJ4A 1XR5A 1C1BB 2RN2A 5J2NA 3VA0A 3OYEA 3QERA 3DOKB 4RNNA 1D8YA 5EUHA 1C0UA 1LW0B 4ECSA 3AVHA 3JSMB 2UVUA 3T3FA 1TK8A 1L3UA 3QO9B 1RTJB 1N48A 1T03A 3SI8A 1QHTA 3L2RA 4FJKA 1W0HA 1B9FA 2W7OA 3KNAA 3PW2A 3QEIA 1FKPB 1S5JA 1TKXA 4CE9A 2AGOA 3Q8SB 3LWLA 3LZIA 2IC3B 4OKKA 2DTUA 4ECXA 1S1VA 1JLFA 3AA3A 4HUEA 1BI4B 1TL1A 5HLFB 4H4MA 4CESA 3HVRA 1C1BA 4OJRA 4ED1A 1HJRA 4DLGA 3JSMA 3RMBA 3QO9A 3H5XA 1RTJA 1JLEB 4N76A 4N47A 4FZYA 3SUNA 5KT6A 3OY9A 1RBVA 4FLZA 1SL2A 2G8IA 4DEZA 3UQSA 3NCIA 1S1XB 5F8HA 1N5YB 2BE2A 3FSIA 3BJYA 2IS3A 1S10A 1LWCA 1CSJA 2KFZA 4QWBA 1J9AA 2XY6A 2VG6A 3GYNA 5SWMA 1BI4A 3LWMA 2HHQA 5KFCA 2WK4A 4B3OA 1U4BA 3FRZA 3TAFA 2KFNA 4OKJA 4DSJA 1I6JA 4TY9A 5KT4A 1T05B 4E19A 1CZBA 4R0EA 3IN5A 4CF0A 2Y1IA 2QK9A 3GIJA 4CK1A 4FJ5A 3AV9A 1JLEA 1QE1B 4LH4A 3T5LA 3IGNA 5KI6A 2IM0A 4AHRA 4LY7A 2HNYB 1JXLA 4K4SA 3QZ8A 1S1XA 4HKQA 4QW9A 1N5YA 2XRIA 5DG9A 4CHNA 1I3AA 3CG7A 4ZPAA 2C22A 1HNIB 1D9DA 3EPIA 2VG5A 3KJVB 3QLHA 4LSLB 4QCLA 4NZ0A 2YNIB 3OSNA 2ITGA 1JLBB 4IFYA 5L1KA 3UPFA 5JS2A 3DRRB 4C8MA 4CJKA 3VQQA 3AVKA 4AHTA 1LWFB 4FJJA 2UUTA 2GUIA 1Q9YA 1N6QB 1T05A 3N6NA 2EHGA 4DL7A 1S9GB 2FJWA 3TAGA 4M3RA 1EXQA 1IKXA 5SZTA 3RRHA 4BACA 3TAMB 3PW0A 2OPRA 2BANB 5C42B 4IRCA 1VRTA 3QIPB 2FBTA 4CF1A 4CF9A 4YQWA 3CFPA 3K59A 4CGIA 4URQU 3HJFA 4RW8A 2W9CB 5J2QA 1Y97A 1R0AB 5CYQA 3FFIB 5KFFA 4NRUA 1HNIA 1W25A 2YHAA 2B4JA 3GQCA 1HMVB 4LSLA 4ZMMA 4CJ5A 2FJVA 1JLBA 4JRQA 4ZVEA 2ALZA 3O3FA 4MQ3A 4BE0A 4KKOA 5DMRA 4O3PA 5KFYA 4ZP6A 4H8KA 3LZJA 3RBDA 3K5NA 1T8EA 1W9HA 4F4XA 4H54A 1TK0A 3TAMA 3H98A 3H4BA 1UOCA 2W9BA 4DLEA 3KLVA 3PO5A 3OJSA 3E51A 5KFEA 4HYKA 1VRUA 4DTMA 4LSNB 4AH9A 4CFBA 1VK0A 1HMVA 3BQ2A 4NLOA 1S48A 5K14B 2IAJB 4F4ZA 1RTDA 4EBDA 2OA8A 4CJ3A 2BRLA 1KSPA 4FLVA 1RDCA 4DS5A 5KFTA 4ICLA 1S1TB 3VQAA 3HK2A 4RG8A 3QIOA 2YNGB 3U3GA 4RW9B 2ZE2A 2Z1JA 4RNFA 1UAXA 3V6KA 4CJWA 2X6NA 4EYHB 1KFDA 3TARA 3ICLA 3ZCMA 3KK3B 1SKSA 1SKWA 1JL1A 1TP7A 4ED8A 3N6MA 4FJXA 1IKWA 4BDZA 4B9TA 3DLBA 4FLYA 1WSGA 1S0NA 1SV5B 4NLTA 3L3VA 3P5JA 3C95A 1IM4A 2DPIA 3DLGB 3CVKA 1JXBA 4CHZA 1RT3A 4IG0B 5F9NA 1NKBA 4FW2A 3NL0A 4CGDA 3OJUA 2FC0A 1S1TA 4K4ZA 4FM2A 4ZP9A 2VG7B 5KFPA 4NYFA 4CFAA 3RB6A 3AVGA 3SV4A 3M8QB 1YVFA 1NOYA 4DG1B 5T14A 3KLEA 2E4LA 1QSLA 3DLEB 5J2PB 2YV0X 5J2MB 3E01B 3KK3A 1TVRB 4Q0BB 2AGPA 3CYMA 1N4LA 2GBZA 1QTMA 3ITHB 1RT4B 4M42A 4IH5A 2D41A 1SL1A 2QV6A 1IKVB 4CJUA 1SV5A 1WN7A 4BDPA 1EETB 4Z4FA 3DLGA 5F8NA 5CYMA 4FS2A 2AX0A 3NAEA 1XR7A 2KZZA 4ECVA 3I0SB 3IS9B 3G86A 2FVPA 3OYNA 3NF7A 2W9AA 3KKRA 3M8QA 4DG1A 3S3MA 3H2LA 3MXJA 4CIEA 3NAHA 4FW1A 3P1GA 5C5JA 1SKRA 3DLEA 4K8XA 5J2PA 3LPTA 5J2MA 3L8BA 1TVRA 4Q0BA 2ATQA 5D3GB 4Y1CA 4HTUA 2D5RA 3ITHA 1L3SA 3NF8A 1RT4A 2XCAA 4ED2A 1EP4B 3DLRA 1TAQA 1KHVA 4CHQA 1BQNB 1HYVA 4Q8FA 1IKVA 3PW5A 4DTXA 4FM1A 3V81A 1S9EB 4KHNA 3VQ9A 4KI4A 4NLWA 5EWFA 3TAPA 4EBEA 2R8JA 3I0SA 2JEGA 3V6JA 3FDSA 2R8HA 1HPZB 4OL8A 3BSAA 1CXUA 4ZPBA 1D5AA 1N56A 4CK2A 2C28A 4B9UA 2WHOA 4YR0A 4CJTA 2C2EA 5D3GA 4AHCA 4FJIA 4KB7A 4RNOA 3V4IB 4JS5A 1EP4A 2CJQA 4J2EA 1L5UA 3RB0A 3KMSA 2Z1IA 3SUQA 1BQNA 4W5TA 3M9MB 5EDWA 5KGXA 4FK4A 4KI6A 3TAEA 4CHYA 1X1PA 3KLGB 1NOZA 4FBUA 3SPYA 5KFUA 4KB0A 2BR0A 4E7KA 4ID5A 4DSKA 5KFSA 1S6PB 4JLHA 4O4GB 2WOMA 3HHKA 1S1WB 3V9WA 3PUFA 4URSA 4KAIA 3HVWA 2D7SA 2R7YA 1RYSA 1U04A 4MFBA 3LAKA 1KLMA 3EPGA 2E9TA 4JV2A 1CZ9A 1SH2A 1Q8IA 4NLXA 2JC0A 1RT5B 1ZBUA 3LP1B 4QWAA 4ED7A 4CEAA 3RB4A 2OPSB 3OYDA 4ZVGA 1RBRA 4LH5A 3AA5X 3KLHA 1NK9A 3ZSWA 1JLCB 3ISNC 4OGEA 3WNGA 4TSXA 2FBVA 2AX1A 4F3OA 1FK9B 1ASWA 3KHLA 3KLGA 5CZ1A 3ZT1A 3C94A 3CWJA 3G6XA 3NF6A 3V6HA 3OHAA 3LPUA 3KK2A 1TKTB 4O3OA 1JL2A 3M9NB 1C0UB 3AVMA 4TYAA 2XWYA 2W7PA 2V0NA 4B8AB 4I2PA 1A5WA 3AO4A 4FJLA 3Q8QB 1RT5A 4RW7A 1T03B 2J6UA 4AILC 2R8GA 1JX4A 5KFLA 2OPSA 3KD1E 3CJ3A 3VA3A 2BQRA 1KHWA 4WE1B 3KMQA 3V1OA 1KVAA 3T1AA 5T7BA 2G8UA 1MMLA 3AVBA
chains in the Genus database with same CATH superfamily
3DXSX 5HATA 3HVAA 3OHRA 3PG9A 1RBOB 3BO4A 2HHHK 1UEVA 1HNWJ 3IR5B 3U27A 4CH7A 3LA0A 2UUAJ 4BC9A 2E7WA 4HDHA 4E7LA 3UWTA 3J7Z5 4GV3A 4C6AA 3SSQA 1TKTA 4CGGA 3NS7B 1NK4A 2KU7A 1D3WA 2GCFA 4H5VA 5B7WA 1BHLA 2KT5A 5GINA 4RUCA 2KKZA 2BE2B 1VGYA 3QZ7A 2VWJA 4ELUA 5KRTA 1LWCB 3LDNA 4WP8A 4EMDA 5HL7Q 1ZETA 4FZZA 3PW4A 2QTDA 1WSIA 1DT9A 4I68A 4X2BA 2HMIA 5B0AA 1T0TV 1VIOA 4YB1P 4DPXA 1VQ8S 3SZ2A 2E5LJ 1QQMA 4X66J 1TELA 4CZHA 4JI1J 2ZC4A 1LNQA 2H4WB 3AHPA 2Z4PA 1WC1A 1Z2ZA 4I6YA 1HL6A 3EX7B 4YN3B 4OZ3A 2C42A 2HB5A 2VJVA 1U09A 2H65B 1SC4B 1F2HA 2DEIA 1X4EA 3EE8A 3BGFA 1PJ7A 1JKHA 3PEJA 1X9JA 4ZVHA 2VQEF 3S7RA 4XDCA 2LU1A 3D6RA 1NJWA 1C1CB 2DNKA 3RRGA 5KG5A 1UPPA 3TABA 3HPHA 4GV9A 3MCSA 4BRKA 4KBIA 3OVBA 3FZKA 3MR2A 1DARA 1XK8A 2ZZTA 1VSKA 1UVJA 2YWGA 2W7AA 3RAQA 1IKXB 1YI2S 3SLCA 2ILZA 2OPRB 4KO0A 3HSJA 3NBPB 4HH1A 2RKIB 3JTOA 1H2VZ 2JVRA 4ECWA 1UFWA 3QBWA 4RW8B 5EX5A 4J9KA 3SFUA 2KHDA 3SCLE 4CHPA 4LR8A 1VSMA 1U1MA 3Q22A 4B17A 1QAJA 1RILA 3ZTSA 2YQ1A 4ZTFA 1F9EB 3KK7A 4ILLA 3I32A 5HQLA 3FGUA 4OPAA 5AFUA 4KAZA 4Q2LA 1U0HA 1Z4UA 1W2IA 3PRDA 1Y3KA 1VQLS 1KS2A 1QZ6A 4ID1A 5BRHA 1N36F 4G3IA 3RMAA 4KGVB 2W9BB 3X3UA 1UFKA 4I7FA 5D15A 2ZHBA 3A5MC 3VQCA 3F41A 4H4KC 3OVAA 4OIXA 2A10A 2MZJA 3MMCA 2LXUA 2W8KA 2ASLA 1ZA1B 4GO7X 2DXDA 3CDUA 1QS4A 1NGEA 4DS4A 2IVNA 2A40A 4F3TA 2AJ4A 4RO0A 3I55N 3M8SA 4L74A 5CHCB 4J2AA 4ICLB 3D54A 5B0FA 1SB6A 3DKDA 3GOIA 1R8PA 1NAQA 4FPAA 4NXMF 1UWBB 1BDGA 4JKBA 3AO3A 1S7IA 5M1NA 1XR6A 3M30A 2KKHA 4LFCK 4ELTA 2H5JB 3MMJA 4WP9A 2P9CA 2RSQA 2FC9A 3RMCA 3D3CJ 4ZPDA 3MMVA 4ZPCA 3KJQB 3F5TA 4EP4A 4FVMA 3TZZA 3A8YA 5LMUF 2JVOA 3NHGA 1N8RO 1IH7A 1NDCA 5DDRC 1ILYA 1CS4A 4X62J 4X65F 2FY8A 3DGVA 2X6SA 4LBIA 4OMFG 1K73O 4M5DA 4PXCA 1GLDG 4PXBA 4E8UA 3DOMA 4AM7A 3MI7X 3W65A 1XMQF 5LXYA 3JS9A 1YBUA 4Y2AA 3D66A 2LDIA 2Q97A 1T9XA 3P39A 5EHHA 3GG0A 5BR8K 2ZITA 4B9SA 1CXQA 4NLBA 3NS6A 1REVA 4DKWA 1X9SA 5GAEI 2QRRA 3GFYA 4PRFA 3OBWA 2D3ZA 5JLHA 2JFKA 1SJ3P 3N5FA 3N0VA 3AGRA 4DR1F 4JI8J 2K7KA 5H9EJ 4JS4A 1M5SA 4LR7A 4DR2J 2A18A 3SCIE 4KE5A 1PJ5A 1VQ8N 2F9WA 1FFSB 5LJWA 1O0PA 3MECB 2XMWA 4M8LA 2YQ3A 4JI6J 3CPWM 2CJBA 3NLCA 3PYGA 3SV3A 1J54A 4HL9A 1I94J 3EGNA 4JI2K 3TX0A 4M5MA 4K4YA 4CLPA 1U6FA 1WI8A 4CIGA 3FNNA 4C0OC 3H6EA 3Q8RB 4V19X 4A4JA 2HBLA 2HVEA 1RBUA 1TUYA 1Q7YO 3VEYA 2GNKA 1CLQA 1TV6A 1EX4A 1YUWA 2HNZB 2LQJA 2L3MA 4M3YA 4AL6A 5IV3A 1HBMB 1R27B 3DGPA 1WKKA 2QWMA 4FDFA 4FYVB 3QNOA 1Q53A 2MZRA 4RU9A 3B4DA 3RR7A 1FEHA 3D45A 1X5OA 3MFHA 4B3SF 2CG8A 3LP3A 1UTAA 1IBMF 1YI2N 2YTCA 5IS2A 2G13A 4CJFA 2HAIA 4CZCA 4WFZA 4OPKA 3DFEA 3RW6A 3O3LA 3AA8A 4CBUA 2WSFC 2KRRA 1ZPVA 5IWAF 3UN3A 3EE3A 1Y7PA 2P9UA 3LQVA 3ZSVA 2DR9A 4ZVQB 2EBGA 2FF3B 3NGYA 3R6LB 5LSOA 3HDSA 4JHDA 1GOBA 4ID5B 3ADAC 3UD4P 4UZCA 4MKBA 1VQLN 5A8RB 4KH6A 3L3CA 3CJKA 2X1GA 4C9DA 4MFBB 4NLDA 3NS5A 3R5AA 2UU9F 3EDRB 2J9EA 3GTYX 2I1RA 4OJHA 4NZ7A 2ZHOA 4BDYA 1TMMA 5HRSA 4AM6A 3CIZA 3M32B 1MWMA 1HWUA 1HNVA 3MEEA 2XCPA 2XNRA 5AQIA 4USUA 2Z2MA 1HI1A 2DGXA 4ILRA 2GGPA 2CPFA 3IM8A 4DCOB 2QXFA 2QW9A 2O8BA 3BGRA 1MROB 3CCJS 4HHJA 3I82A 1LW2A 4AHVA 4K4UA 1LWEB 4L6V3 1VK3A 1KNZA 5BR9A 4Y6IA 2PEBA 3UN2A 2IIRA 3SI6A 3H1VX 2DBBA 4S0MA 2VA3A 2CQBA 2RF2B 3VAHA 2OPPA 2V34A 4I2PB 3CCQS 5HROA 1FD8A 3EO3A 3OYMA 3ZT3A 2Q1NA 4XH4A 1ZH5A 2VWBA 2AWZA 2GIRA 1WUAA 4G1IA 4MO4A 2KT3A 4PQAA 2CJXB 4FWRA 1BQMA 4B3TF 5DZ6A 1VSFA 1OSDA 4CIFA 3CFOA 4CF8A 3S6EA 4LIRA 2F4FA 2AYEA 4GKKF 3ATVA 4FF4A 1NMNA 2BUPA 5G0RA 1LQ9A 2LXIA 4AT1B 2ROGA 5CHIA 2B7CB 1YTAA 5HVGA 1D8ZA 2ROPA 4YY3K 3CJ2A 3MXMA 3I5CA 4FSVA 5E2QA 2YWHA 1H3DA 1XMBA 1RZMA 1NK8A 4F4WA 4PQUB 1G7CB 4GVBA 2BABA 3A8KA 4QYZJ 2P9LA 2WONA 2ZJRQ 1XMQK 3VTHA 4ISGA 3OTOF 3G6VA 4DV6F 3VOVA 5H9FJ 1WD6A 2HK3A 4O3QA 4RUAA 1FKOB 4R79A 3ZX3A 1VQKS 3QJJA 3QEVA 3DMJA 2K1RB 4BRMA 3BSOA 4OYAA 2A3JA 3WZ0A 4TN2A 3R7BB 2X3GA 3NMRA 2EFQA 3DHWC 2B51A 2VQEJ 1YSJA 4LT6A 3C6TA 3NNCA 1KVBA 2Z1HA 3RMDA 1C0TA 3C6UB 4NASA 5AZJA 4OX8A 5DLFA 8RUCA 2GQCA 3GSDA 3NGIA 1RDDA 4ILHA 1VLOA 2V8VA 1N8RT 1RISA 1Q9XA 5IXUA 3V9ZA 4IOAQ 1DTTB 7AT1B 2HFSA 2B6AA 1WLJA 4IO1A 4PG5A 2X74A 3CD7A 1K73T 1HA1A 3MEGA 3LGHA 4NWBA 2BXJA 1RACB 3DRPA 3D68A 4PWUA 2XS2A 3W9HA 1YT3A 1HI0P 1YHQN 1KC8T 5HP1B 2XYPB 1ZS6A 5ADXH 1R3NA 2YWEA 5BYRA 1VQ4S 1IN0A 1TZ0A 4HUGA 4KYZA 4ECUA 2GZOA 5DDQC 4K5RA 1HWLA 2DH8A 2I5JA 5KT2A 5DDOC 4BC7A 2XWXA 2CH5A 1GLFO 4J8FA 4X84A 4ZA1A 3M4XA 1LEOA 1S12A 3C14B 4ZP7A 4EO8A 4IDHA 3T5JA 1N36J 2WCXA 1OVQA 5HMZA 2HGNA 3QFPA 2A1BA 3K8VA 2O5DA 1MU2A 4CJPA 1XI1A 2ZBIA 5IWAK 2J7UA 3EYZA 5BRDA 1BXNA 1WBBA 3EMTA 4USJC 4DX7A 1JJ4A 4QW8A 4O3SA 4DU8A 5DQHA 3MM9A 4RZRA 4JYAJ 2YQ0A 1Z1ZA 5EVZA 4I56A 2ZH9A 2ZGYA 3CCJN 1ITGA 4I67A 3KFWX 3J80Y 2XY7A 1WHXA 2ZQBA 3TTCA 4DFMA 4PUOB 3TUIC 3ET6A 4NXMJ 4O0IA 2YNFA 2JH3A 2P8IA 3IR7B 3TQEA 3K5LA 1NBWA 1JLGB 3CCQN 3KVGA 4L75A 1Y10A 2HYIB 1H73A 4WFAL 5FRMA 2R2SA 5LMUJ 4WXWA 3DRYA 4PKGA 1SS6A 2AW0A 3I0RA 1IJFB 2HBYB 3QGIA 1FDBA 4X65J 2QLXA 2Y1LB 3O08A 2CFXA 2E20A 1HQUB 1TGOA 5AQGA 3TSQA 3THYA 4BRAA 2EC0A 3H40A 4CQ1A 3IFEA 5D4OA 3C66A 2DNHA 2HQIA 2OEMA 3WBZA 2HNYA 4Q44A 2BJ1A 1NB2A 1BOTO 3QEWA 1D9AA 2ZGZA 2ZWHA 1RP5A 3CJTA 3J8AA 4BR4A 5L38A 2I2YA 2BVZA 2RDJA 1PILA 3R5BA 2ILYA 4O0JA 3UD3P 2B4UA 4JI3F 3KK1B 4DR1J 4JKDA 1ESVA 2HBQB 4PL7A 3V2UC 2A42A 5E41A 3AJ2A 2CQ2A 5U47A 1LWFA 1GH8A 3L4BC 2X7IA 2UUCF 4LRAA 2ZVSA 4CCHA 1NNEA 4GKKK 5A2QY 1JXEA 1JLAB 2Z2YB 3MEDB 4RUHA 1HFEL 2QWNA 4Z37A 2WVBA 4B3MF 3EZ5A 3HP9A 4DV7K 4X4PA 4KTZA 1R0AA 5JS1A 3NGZA 2C2RA 3FFIA 2CQGA 3KHYA 4BE1A 1XMOK 5KTQA 2AZ3A 3SBMA 2GO8A 5BRFA 5RUBA 5GADP 2RPIA 1ROFA 1Y64A 2CPEA 3PYEA 1VQ5S 1Q81O 2P9NB 4WIQA 3OTOK 4DV6K 4Z7YA 5F2RA 3GV7B 2ITMA 4DX8H 4B3SJ 4DV5F 1IBMJ 1RTIB 2W01A 3QRRA 3G8TA 2QTWA 1BUPA 1TQLA 2IJFA 3S3OA 1J5EF 3PYDA 3U3YA 2GMJA 3WXKA 2HHVA 1VQ4N 3AA4A 4X4QA 4QWEA 1NHKL 1RT6B 4N77A 1YRUA 2O67A 2ZEJA 2B4OA 1VAZA 2C3YA 1JQGA 1M1GA 1RB0A 2YNGA 4QOTA 4NCAA 5T7LB 3EVWA 3HP6A 1BIUA 2W2PP 2IGIA 1WKLA 3M8PA 4USWA 2ZBQA 1HKAA 1SC3B 4DF4A 3W1YC 4KSEB 2Q0RA 4Z4IA 2JWKA 2DH9A 1S6UA 3MR5A 2UU9J 2GWKA 2FF6A 3L7OA 3J80O 4P6QA 1S4FA 2DK2A 4OZLA 4C11B 5CQGA 1HWIA 4NCGB 5IT0A 2JEJA 3BEGB 2G8VA 1UVKA 3CJ7A 2IRYA 5D0RA 2GW8A 1K47A 2BEFA 2VHGA 2V4JA 3OR2B 4B1VA 4FYYB 4EP5A 3D2WA 1EKRA 4F4YA 4WQ4C 1GOCA 3S9HA 1SJRA 4PYDA 5J1NA 3WDOA 1Y4ZB 4J9OA 5I42B 5AQHA 2CPDA 4OZNA 4OO1J 1QVFM 2YXLA 3VERA 3LANA 1R0BG 1CJKA 1F3VA 3L09A 3V9SA 2MQQA 1Q86O 2WBNA 3DXKA 2OPQB 2FLOA 3QFHA 3T9NA 1A5VA 4BRQA 4IO9Q 4ZPVR 4PG8A 3O8MA 2JC1A 2ZJQQ 4FWNA 1IO2A 4FWMA 4B3TJ 2YKMB 3CQXA 5CABA 4WCEQ 2HPUA 4QPXA 1ZM3A 1C6VA 2CIMA 1GT8A 4CVNE 4R5PB 5E33A 2A2CA 1VRQC 2Z1GA 4RW6B 4GVEA 5A2QO 3KHGA 5AQRA 3CULA 1HKBA 4ED0A 3W9IA 2XZWA 3AVAA 5DGAA 3V6DA 1RDBA 2QSWA 3ZT4A 2NRZA 3HHEA 4OLPA 1SUQB 4FXVA 3UKUA 1HBNB 1RFQA 4NA3A 4B08A 4CEQA 4I9QA 4DDFA 2E2PA 2VQFF 4NMLA 2V2KA 5M2RA 2LA4A 2PDAA 4KV8B 3D6HB 4FXDA 1HPZA 2HHUA 5T41A 5GAHI 3VAFA 4X4SA 4M63C 2HHWA 4KFBA 3C3LA 2HWIA 3BH6B 2W24A 3TVYA 3IWXA 4OYBA 1OY8A 4K4VA 4JI3K 3A3OB 2DXFA 2OMOA 5FJ4A 4ANDA 4I1TA 3HF5A 1J6ZA 4QS8A 3U6FA 2A6OA 3VAMA 3B6OA 5AXLA 2DNLA 1KVJA 4DV4K 5C25A 2VDIA 4ZCKA 3DHXA 1GLBG 3ZTQA 3ZSRA 4FJ9A 1RKJA 5AXKA 2AU0A 1Z05A 2JSXA 4OV6A 1XC9A 4P2FA 5DM6L 2I6WA 2B43A 3CPWR 4M5HA 2P2CB 3EL2A 3HKZD 3GIKA 4ERDA 5DG7A 4FLTA 3VEVA 2FBYA 2ASJA 1JLCA 3ZSYA 2B3TB 4AYBD 3SFGA 1XUPO 3F9KA 2F4VK 1V6HA 4KHMA 4LF9K 2ZWOA 5IC4B 1TK5A 3OA9A 2IVYA 2ETJA 3V1RA 4R8UB 1U02A 5A8KB 3CSKA 2FHJD 1XR5A 1KDNA 2RN2A 3BBFA 2KLAA 2HBKA 4ER8A 3AVHA 3T3FA 1T9TA 4IOCQ 3QO9B 1RTJB 3GE1A 2HFNA 1B9FA 2DNNA 3KNAA 3PW2A 5F0WA 4LSZB 1S5JA 2E5JA 3D6MB 1TKXA 1JJCB 5E3PA 3Q8SB 4FO0A 2Q66A 2IC3B 3FE1A 3LZIA 3CCWA 1S1VA 1GNKA 4IZ9A 5AQJA 2UXCK 2WW4A 3IBFB 3B78A 3HVRA 1AA1B 3J81U 4A2BA 3GPAA 3U1LA 5GMDA 4ES2A 2CZ4A 1HJRA 2DY1A 1IBLK 4RBTA 3I9V9 1Q81T 4ES1A 3HZ6A 1EQMA 3VEXA 1VBZA 5KT6A 2R7QA 5A6PA 5DZ7A 1TU0B 2IYGA 4DEZA 3MD1A 1HBOB 1HHSA 2JNJA 2MKYA 2VB6A 2VPYB 2CUYA 5F8HA 2BE2A 3GYXB 5LMNK 1LWCA 3V5RA 3M6WA 3H42A 1GMVA 1CSJA 3B4MA 4QWBA 1J9AA 4IYQA 1CC7A 3GYNA 3T1HJ 1F5BA 4OI1A 1BI4A 2Q6CA 4NO7A 4QR1A 4NXNF 1RGVA 4DV0J 3FRZA 1RSCA 4HI1A 2D9PA 2QGFB 5KT4A 1RE1B 2F63A 2Y1IA 3GIJA 4FJ5A 1N5TA 4X4TA 1JLEA 4X4RA 1PO6A 1PYOB 1NEEA 1HHTP 2F3JA 5KI6A 1WG1A 3RUBL 1O13A 3D0GE 2D0PA 3N4PA 4DZDA 4HKQA 2ZM6F 3K0JA 3DWLA 1I3AA 1LK7A 1YDLA 1HNIB 1D9DA 2NYIA 5IT9U 4RKUC 1Q79A 3KJVB 4QCLA 3TR5A 5LT5A 2YNIB 1EWQA 2UUCJ 2GX9A 2YKAA 4C7QA 3D1HA 5L1KA 3DRRB 2CQ3A 4CZLA 2WSEC 1P8ZA 4FJJA 4WU2A 3SJHA 2GUIA 4B3MJ 2MQMA 4OFZA 1U6BA 2NPFA 1S9GB 2MLXA 3LGNA 1IKXA 5SZTA 4DPYA 2OD4A 4BACA 4IRCA 2OPRA 2BANB 3FMBA 4OZ2A 1M90O 3CFPA 3K59A 4WJBA 2HOEA 2WC9A 3MN7A 2H3EB 4RW8A 1NU0A 1W25A 1WKJA 1ZBTA 2B4JA 4LF4F 3GQCA 1Y3JA 4LSLA 2B9XA 4JRQA 1JLBA 5HI7A 1WC5A 2OI2A 2ALZA 5F3TA 3O3FA 4BE0A 1FJEB 2IFXA 2ZBCA 4ZP6A 4DV5J 5IQ6A 4QIGA 2N7CA 1ATRA 3RBDA 1T8EA 4F4XA 3AOBA 4WYBA 3TAMA 3JXUA 1J5EJ 4WFBL 1EX8A 2W9BA 4DLEA 2PGCA 1YJ7A 2MLYA 4A8QA 1HKCA 3I6PA 2BMBA 2ZHAA 4HYKA 3BUZB 4DTMA 3HM8A 1V3RA 2YX7A 4NLOA 1S48A 2DNQA 2D3OR 3MCOA 5B09A 3HULA 1BA0A 3QT6A 1R8HA 4DHVA 2CH6A 4CBWA 4CJ3A 1UETA 4X4OA 3R7NB 4F67A 1CLFA 4DS5A 1T9YA 5KFTA 4ICLA 2QFIA 2OUGA 2FSKA 1JNRB 5CZVA 2CADA 2FHJA 5AXMA 4RW9B 5BYQA 1GK8A 4CJWA 3UR3C 2X6NA 1KFDA 3TARA 3ICLA 2VBWA 3ZCMA 1SKSA 3TSPA 1VQ7S 4DX6A 4H0YB 1JL1A 5ADZA 4C23A 4BDZA 3DLBA 2RQMA 3ZZTA 1FRIA 2VD3A 1SV5B 4C0HA 2IY5B 2DXEA 2PD1A 2J9DE 3CCRS 3NOGA 5F9NA 4FW2A 2VYPA 1S1TA 4FM2A 5KFPA 2M8DB 3AVGA 3M8QB 1YVFA 1CPZA 2RDDA 3CERA 2RHSB 4UY85 1EO1A 5J2PB 2HBMA 2YV0X 4CNZA 2QG9B 3KK3A 1KQSM 2AGPA 1FRKA 2GBZA 4RBUA 3ITHB 4OYZA 2HVDA 2ZF5O 1Q1KA 4CO5A 3NP5A 4HT5A 2X51A 3W5ZA 1F6TA 1VHIA 3LM9A 4DZ6A 2J5AA 5BXIA 4Z4FA 2RRNA 2ADBA 2IPOB 1P27B 2AX0A 3GB0A 1XR7A 2FVPA 2VFTA 1HIYA 4JI5K 1NSAA 3NF7A 4LF5F 2AYMA 1HNZF 1ZAWA 4DG1A 2HAFA 4JB8B 1U6ZA 3UI3A 2FHOB 3EVOA 3P1GA 2V51B 2E8AA 2NPIA 3LPTA 2NRHA 2OO4A 1TVRA 2ATQA 5D3GB 3D1OA 4QBUA 1R59O 4P75A 2C3PA 3DLRA 1TAQA 2VQFJ 1IKVA 4MKVA 5AQSA 1HBMA 1HWJA 4LFAJ 4CD3A 1EZZB 1OMSA 2CQPA 3VR1A 4EBEA 4PCQA 1A6LA 1X5TA 5ETLA 1IG8A 1WC3A 2NRRA 3UCUP 3A0IX 2LCWA 4CH1A 2R8HA 4G65A 3BSAA 4ZPBA 3UDVA 1UJ6A 2C28A 2YBVA 1DJ0A 1XN9A 4KB7A 3O1BA 2MY8A 1EP4A 3SUQA 5KGXA 2Z57B 5D78A 4KI6A 1P1TA 4H0PA 3THXB 4OX9F 3SPYA 2PEHA 5KFUA 4KB0A 3M6XA 4E7KA 1X4BA 1XNQF 4ID5A 1E6YB 4GKJF 4KH0B 2KFYA 3OFGA 1BC6A 3HHKA 4F02A 1S1WB 4DQ8A 2V8GA 2POKA 2V2ZA 2AIRB 3BZKA 2R7VA 1XNRK 1U04A 4MFBA 2JWNA 3VAIA 3T7ZA 3EPGA 3N4QA 3X1LB 2IRUA 1CZ9A 3QICA 2JC0A 1XTZA 1NH7A 4JAXA 1FNMA 4X64K 4DU7A 4LH5A 3AA5X 2L08A 2BW7A 4OGEA 3WNGA 3CJ1A 3E3XA 2P9IA 4C0BA 3KHLA 5CZ1A 3KUGA 1X4AA 1MROA 2RUSA 5K8MA 4LF7K 2IYIA 5HL7L 1SXLA 1TKTB 2RS2A 2QLJB 2V94A 1JL2A 3M9NB 3OFFA 2W7PA 3FZFA 4I2PA 1A5WA 3AO4A 4FJLA 3FK4A 3CTRA 1VQ7N 1KAZA 4K0KF 5KFLA 4FF3A 2OPSA 2BJEA 1M90T 2D3O1 1I3OB 5T7BA 1MMLA 3ETOA 3RGIA 1PSDA 4ES3A 2FVQA 2G1HA 1V3ZA 2F5GA 3L9ZA 4CJ4A 3K57A 2Q3SA 1Q5YA 3EICA 3BO3A 4NYNA 3TVKA 5KQDA 4D3GA 4B1ZA 4W5NA 2HMIB 3I5AA 2B9YA 2M4MA 3CCMS 3SQ0A 3G6YA 3PXGa 1A9NB 4OLAA 3V9XA 1ZOTA 1SJ4P 3TW0A 1N34F 2YHBA 4K50A 2JZ5A 5GIOA 2OSRA 3IM9A 4U7BA 4TU9A 2KHOA 3NWRA 2X1BA 2LP4A 1BISA 5F8JA 3BSNA 2E9ZA 1F5CA 5MLCV 4J2DA 2ZC3A 3KG4A 4DR7F 3AY9A 3NG8A 4UOFA 2KM8C 5AQYA 1X60A 2M8HA 3DDKA 1ITPA 4FF2A 3HM9A 4QR2A 4NXNJ 2LXFA 2C3UA 1SIZA 2J0WA 3ILJA 1UZHA 2PE8A 3PCOB 4PPZA 2BJDA 1KCFA 1U25A 1RDRA 1QVGM 3ZNUA 3AOAA 1HR0F 1FKOA 3CW2C 1NJIO 3W61A 4YB7A 2HZCA 3P4UB 4ZJOA 1RAIB 4GC6A 1QVFR 4DV1F 3EEQA 2FGOA 4FYXB 1KAXA 2UXDK 5AE2A 2ZM6J 1HQ2A 1XQSC 1FJGF 4KO0B 3ZZUA 3K5PA 1KTQA 3C6UA 4EO6A 3Q8YA 4WWSA 3MAHA 2AZ1A 2GHVC 4E7HA 3VENA 4K42A 1V4SA 1Q82O 3PLAA 4BWMA 2CNLB 3FFKB 2VG5B 3M8RA 1IKYA 5D0EA 1L3KA 1CULA 3SSRA 3NVKA 3GFZA 2CQ4A 3QDKA 5HQMA 1X31C 2GEMA 4FLUA 1U1NA 3RAXA 3F56A 2NUUG 2GHPA 3F9MA 2H54B 4HTLA 3IUCA 3HHLB 3MOZA 3S41A 1J2VA 4LF4J 5AQUA 4LF8K 5J2QB 2G0CA 2R2UA 1NNDA 1UVLA 4RX6A 2XYGB 5GAHU 4F8RA 1WDTA 2DY4A 4KKOB 4BCAA 2ERRA 2GUPA 3IFRA 5HRRA 2FC8A 1TUUA 3J7AP 1IR1A 3POTA 1RKIA 1EKSA 1DQ9A 2QYCA 1X5SA 1CJVB 2W2MP 3M30B 3GR0A 3HTVA 5IQQA 4W92B 1SQFA 3K58A 1BIZA 3CQYA 4J7CA 2MQPA 3P38A 5GAEP 1CS4B 4DV2J 3P4IA 4TQSA 4KHPK 4M5DB 4FJ8A 3DDNA 4J9NA 3CF5L 1LCUA 4FPIA 1FCAA 1JLGA 4FVUA 1N32F 3QMLA 3QEXA 2D1CA 4L3KA 1SH0A 4P71A 3BF1A 4BHQA 1H38A 3BN7A 1F21A 4FBTA 2MKJA 4W5RA 3UKRB 2LEBA 5F8MA 4F9OA 1IKWB 3ENWA 2A3ZA 1KVCA 2KHCA 3O9UA 2GA7A 3ULHA 2V4RA 4XK8C 5HMWA 1PYSB 3CCMN 1IVZA 4F2SA 2GAHC 1RT3B 3U9DA 4A46A 3FEYB 1QUVA 3DLLQ 4W5QA 4WFAQ 4OV1A 4AD6A 4J9QA 1B70B 1KWMA 3GYGA 1DLOA 4LC9B 4O44A 2MSTA 3KK1A 4YMEA 4TLQA 2G8WA 3VEZA 3M2RA 3RG6A 2M5YA 3GDQA 4CFCA 3JSBA 3A12A 4FCYA 3DLKA 4YHHK 3DI6A 5EU7A 3SNNA 4QYRA 2VPXB 3T5KA 4DL4A 1U1KA 2IA6A 2FYXA 1JLAA 3LDLA 3MEDA 2MKSA 3DGPB 4O5BA 4YB5A 3SAGA 1K0TA 1VBYA 4O4RA 4C3MA 4LF5J 3T5HA 2G8KA 1HNZJ 5AQZA 5CYMB 4F36A 1NJXA 1QAXA 3L2VA 4YP3A 2GIQA 1CG2A 2FZCB 2LQ9A 4JNEA 4BGAA 4DR6K 3MM8B 5KT7A 3SK3A 2V2QA 4HHUA 1GQEA 2JDJA 4J9UE 4HWIA 3BR8A 1WSRA 4BC3A 4CECA 1XWLA 1FNXH 4B9LA 4B1XB 1LWXA 4NL5A 4DU3A 2P9UB 2CWKA 1YLXA 2G2OA 5GIPA 4OPJA 2OAUA 3VQ8A 3TX8A 2DB1A 4KY3A 2V6AA 1U0SA 2CVIA 2QI2A 4FPBA 2O8DB 4FYDA 4WYWA 3OHBA 3A5LC 3ENBA 4JHDB 4JBCA 1WEXA 3BF4A 1RTIA 3R5GA 5ETOA 2HFUA 4JI4K 4FJMA 1BWEA 4ZPWR 2XC9A 1XHZA 3J7ZT 2PFUA 4FF1A 4Q43A 2YKQA 4NOHA 4RTFD 3B82A 2BW2A 1LV5A 1H2UX 4OX9J 4IDKA 5T7LA 5KRSA 1XNQJ 2YWKA 4GKJJ 1MWKA 1RT1A 4PA1A 4AUKA 4ZVRB 4DR3J 2R4FA 2JRSA 1Z26A 1PAUB 2GGPB 4CJSA 1S6OA 3SMZA 1VCTA 2O8BB 3BGRB 3KJNB 4GC7A 3G6ES 2BQUA 4MLHA 2WOMB 3I4PA 1R43A 4WK1A 1T6DA 5HJXA 3CM6A 2MQ8A 4C11A 2J7KA 4NCGA 5CCMA 1NJIT 1GMWD 2OPPB 1ZC6A 4PR6A 4EAHD 2F8SA 3VAJA 4ZVFA 4CHOA 5HROB 3VZIA 3ZZRA 2F96A 2HVHA 4DU4A 3W66A 2DHAA 4RWXA 3OR2A 1EQYA 2LFVA 1Y5NB 3VQBA 1TKDA 4ZJQA 3O3HA 1BQMB 2MKHA 1WBDA 4XPCA 3AVFA 4F26A 5G0RB 3CXCM 2Q0UA 4K0KJ 2OPQA 2D3UA 1EKEA 2IA0A 3VEWA 1X4CA 2A1RA 2ZZNA 2YKMA 3LAMA 1KRPA 1DGKN 4P10A 3R2CJ 4DU1A 4MT1A 2BJ3A 4WTOB 4O3NA 3OS2A 1APSA 4R5PA 2O1PA 2DNRA 3EZWA 5LJ3Y 1GLAG 4KH4A 1N34J 4RW6A 3H5SA 2H4YB 4OGCA 4BG9A 1N32K 3QJPA 3RTVA 3MFIA 3MCMA 3S3NA 4BQLA 5L9NA 4QWCA 2EG2A 3Q83A 1QD1A 2ZJPL 4DR7J 2JHEA 4QJVA 3DMJB 1SUQA 3BP8A 1HUXA 2XGQA 2FUG9 3VWSA 3G4SS 3QT7A 5M2UA 1C0TB 3MN5A 3BB5A 1FX4A 4FNHA 4FKYA 2D4WA 5AZJB 3KLIB 4H4OB 3NE6A 4UUWA 1AYEA 4J2BA 4LRDA 2HQGA 3A13A 1YBAA 4PWWA 1LFPA 1HR0J 3A2FA 3ZZZA 4I6MA 2H1YA 3MUMP 4DV1J 3OYAA 4OZ5A 3HT3A 3DN9A 2OTJS 4CGHA 1VSJA 4Z0UA 1FJGJ 1KQKA 3DRPB 4TXSA 4DPOA 5JJBA 1S57A 4E0DA 3BGOP 1KQSR 4OZ0A 1FJCA 4DTSA 4CEBA 2HHSA 3BQ0A 1T7PA 4CRJA 2DNGA 2GAGC 2HHXA 4DUZF 2C3OA 4PWDB 4XAKA 4O0NA 2RS8A 4LF6F 2I5JB 3SBTA 1N5SA 3H2VE 5LSLA 4A61A 2VPZB 3HCXA 5DETA 3UDLA 2RILA 3HT0A 1RLCL 5B0DA 3CO9A 2KO1A 1MU2B 1SH3A 5HRPA 4MK7A 2XEXA 2IVPA 2V2VA 4R8UA 5DM6Q 5EOYA 1O1WA 3MM9B 3SAFA 2HLTA 3LP0B 1J5OA 1FVSA 2HQCA 2UUAF 2IVOA 2B5JA 3J7YI 2ZH4A 2AQ4A 1TKZA 3UDCA 4JV5F 3G6EN 3EY1A 3L7PA 3U9ZA 1HWKA 3ET6B 1QHAA 1YIJS 2QA2A 2IC3A 1KQFB 2YNFB 2HURA 3H3NO 4F04B 2QWLA 4AXIA 2F8TA 2WBMA 4L3QA 1FDNA 4E89A 3F2KA 1DTQA 2GJIA 4IR1A 3I0RB 1BLUA 4Y2IA 3M6UA 1F0XA 2DR5A 1KP6A 4OJ1A 4CERA 4Y00A 1BCOA 4CK3A 2V7ZA 5F8IA 1I51B 3EVMA 2QLWA 3K17A 2E5LF 1T9WA 3PW7A 4Y34A 4JI1F 1QY7A 3VQPA 3GP9A 4ZIVA 3J80U 1GLJO 3GJTB 3M8YA 2BACA 3O4QA 1IWAA 4IQXA 4FOEA 4DOZA 5KFWA 1QSYA 1NDLA 4E1JA 3OTBA 4DQPA 4B3RK 5C0YA 3HVTA 2MKKA 1T3NA 3MZIA 2DFEA 1S76D 4EZ9A 3RJMB 4A8SA 2O3DA 1OJ4A 4RL1A 4FLWA 3PYFA 4DR5K 5JVGL 3VVTA 5AE1A 2CQHA 2M88A 3CDEA 4BR5A 3BEXA 1ATNA 3AJ1A 2OGUA 4CO1A 2CRLA 1G99A 4ED6A 3LOUA 3KJVA 4KHRA 2YNIA 3P83D 4I2QB 3BREA 4OHWA 1CBKA 2L9WA 3DRRA 3PZPA 4E7JA 3DRXA 1Z6RA 1F1BB 3TRGA 3D7SB 4ECRA 2UXBJ 1WNSA 1YRXA 3DOLA 4YR3A 3T1YF 2DIUA 1K8KA 4JP8A 3Q8UA 2BA9A 3O3GA 1S9GA 1NHVA 3D0IE 3LM2A 1OVYA 4WKYA 2MJNA 1TUWA 3OL8A 7FDRA 2BANA 3NFAA 4AHSA 4JI0K 4KPYA 2GQQA 2P6TA 3OQ2A 3HL8A 3RZAA 2FPHX 2OTJN 2PT0A 1GLLO 1QDUB 4RBVA 2ZOFA 2IM2A 3OYJA 4G9ZA 3HHDA 2DHSA 5A2QU 2M2BA 4BROA 1SC6A 4RLEA 3G10A 3DU6A 5EX3A 1M1KT 1Y11A 4ELVA 2R7RA 2IMWP 1TL3A 4UW2A 2HG4A 3M8WA 3ILOA 3R6MA 3QYYA 3M8PB 1G3OA 1D1UA 4U7UK 4QOZB 2NZTA 1QJHA 3NGTA 4EU0A 1YTUA 1QVGR 1NSQA 1FO1A 3OL9A 1VQSA 4NX9A 1RWUA 1RXOB 4DXLA 1MW7A 5KG2A 4K41A 3OTCA 1NM1A 2MPUA 4CP5A 3D2EA 4ZVOB 4JI7F 3IRXB 1Q8LA 1WAFA 3PM9A 3H90A 3DM2A 1Q5VA 3I5BA 5E26A 2VA2A 1RT7B 1RAJA 4OI6A 5ETQA 2OJ3A 4J9LA 1B0VA 3KIOA 3QPIA 3OT9A 3O1WA 4PKHA 9ATCB 3DRSB 2H3GX 3VTIA 4IO9L 4H0VB 4RW9A 2KYXA 3Q8VA 1Q0NA 3MEKA 2ZJQL 2YNHB 3WUHA 2Z2LA 1HNXK 2IOCA 3QRPA 4NYPA 1YIJN 2J8AA 4WCEL 1NRKA 1UVIA 3VHQA 2R9LA 2KW4A 1WSJA 4BR9A 4QWDA 1CJKB 3CPEA 3VGKA 2QYGA 3CMES 3JQMA 3DXKB 4H5RA 2QKKA 5AJ3F 3MN9A 4KRFA 2XLKA 3IG1B 1HNWK 3GONA 5L8RC 3IWLA 2UUAK 2M70A 2E1CA 4ECQA 5F41A 5B0BA 1H74A 2N3OA 1SQGA 5BPNA 4C8KA 4NRTA 3MR7A 4JI6F 2NRXA 4LRCA 1B92A 1ZM2A 1LKZA 5KFKA 2E1YA 1QTNB 3Q8PB 4MYTA 2D9OA 4ITSA 3SUOA 4WQ5A 1XC3A 1YZ7A 2DNZA 3V6DB 3EJMA 2AGQA 3KD5E 5GAHP 4ED3A 3NKYA 2B0GA 3KTQA 2V63A 3UKUB 4KB1A 2OMLA 3JB9k 2CZVC 4WZMA 2E5IA 4M3ZA 1HARA 3PDNA 1U49A 1FXLA 1NMDA 1HYSB 1VQON 2QC3A 4N8OA 3ASMA 4BVPA 2E5HA 3VGMA 2YX6A 3SQOP 3MM6A 4RW4B 1QQCA 2E5LK 4A8OA 4F0KA 4X66K 4WXOA 1S1UB 4JI1K 4OYIA 5J1EB 3BPDA 4MK9A 2XHBA 4KFBB 4F2RA 4WFXA 4OZ1A 4CEFA 2W8LA 3PX0A 2YHYA 3BF3A 1IBKF 1G6BA 4C1NK 1K0VA 2CPZA 4BRFA 3L2WA 4DCPB 3R2DJ 2HQFA 1H0HB 1WAJA 5C25B 1KOHA 2I7PA 3MWPA 3HHLD 1T94A 3MAQA 2RRBA 2LYVA 1DRZA 4EZ6A 3CMQA 3CJAA 4IH7A 2ZOGA 4J9SA 1ZAVA 3CQ8A 4GMJB 4A8MP 4JRPA 2SXLA 4FPRA 1RYRA 5KFQA 2IBOA 3A5NC 3BSCA 3AVLA 4ENOA 4M41A 3ZFVA 4J90A 4URGA 4DUZJ 1E6YA 2QA4S 1KD1O 1S1WA 4LF6J 4KPCA 1S3XA 3ATUA 2MQNA 2G9OA 3N4WA 3OXLA 5IT4A 1V9OA 2XB2D 4A8YA 2YHXA 3ZC4A 4P72A 4JKEA 3EM1A 4M3UA 4FM0A 2XS7A 4K43A 1X3NA 1GFWB 5HBMA 1U48A 4E2FB 1V4TA 2R2RA 2CNKB 4R0JA 1TKXB 3O5TB 2PYLA 5CZ2A 4Z2XA 4A5BA 3NH2A 5FD1A 2HHPA 4TY8A 2HNDB 1C4AA 1HRHA 2AMCB 4EYIB 1S1VB 1U26A 3CJ0A 3CJBA 1S0VA 5CH7B 2XG8A 3CI5A 2J6TA 3UCZP 2DFFA 2P9SB 3VQ4A 4ED4A 4BVOA 4JV5J 5J2NA 5DRKA 5F0XA 2GFFA 3I4HX 2VZ9A 3C65A 4MYUA 3M3ZA 1LW0B 4ECSA 5GADU 4YEAA 2UVUA 4ISEA 2AJ1A 4HT7A 2E2OA 2QO3A 3U1MA 1N48A 1W0HA 4CTAA 3QEIA 1FKPB 3CMEN 3TTFA 2C1EB 3AY0A 2D74B 1YK9A 4JD2A 3HMJG 2F8HA 5E84A 1M5PC 1OH5A 5EN1A 3CT9A 3O9RA 3O5BA 1EIYB 2OIHA 4P7VA 2YX4A 1BI4B 1TL1A 5AQQA 5HLFB 4X62K 1YJ9N 1C1BA 4WK3A 1JCGA 3IDHA 5D6GA 4OJRA 4EI2A 1HBUB 1ZA2B 4YDXA 3VQTA 3JSMA 3MURP 1U2CA 2DT9A 1PAEX 1JLEB 4N76A 4N47A 1RJJA 3CO0P 2NXEA 4PG7A 1SL2A 2MZQA 1RBVA 3SBGA 3RU0A 4FWQA 2O8CA 3UQSA 1AFIA 2GO9A 1WF2A 2A6MA 4DV3F 1CEZA 2KRBA 3BJYA 1S10A 3LL3A 4JI8K 5H9EK 1U2VB 3MPWA 5SWMA 3IC1A 2FSJA 4DR2K 3B8HA 5F1XA 3W8GA 4JI6K 4DUYF 2KFNA 3TAFA 4OKJA 1I6JA 4ZCMA 1YJNN 1I94K 4CF0A 2AJFE 1CQNA 3A4TA 4EK2A 2HBRB 4LH4A 3T5LA 3IGNA 5CE3A 2KT2A 4A59A 4LY7A 1JXLA 4K4SA 1ACMB 5LOQA 4G1PA 3L4IA 1MLAA 4QW9A 1N5YA 1R8CA 2XRIA 4CHNA 2HRYA 5FLXY 3NCPA 1VYAA 3FEZA 2UP1A 2RMLA 2VG5A 4BS2A 4LSLB 3T1YJ 2ITGA 4BBYA 1JLBB 4J5OA 2HIQA 4NA1A 3UPFA 4AQYF 5JS2A 2K3KA 4CJKA 3VQQA 4NMXA 1GXTA 3W62A 1OYEA 3DXBA 1C4CA 1YJVA 1T3VA 2RHQB 1N6QB 3CJCA 2GVZB 1HX1A 2DNYA 4XTTA 3TAGA 3D6FB 3HHLA 3TYTA 1FESA 4CYUB 3TAMB 5C42B 4J9VA 3QIPB 3VGSA 4CF1A 2CQ1A 4CF9A 3VCDA 4YQWA 2FZGB 3FBEA 2PMZD 4URQU 3HJFA 2W9CB 3IMQJ 1FKAF 5J2QA 1UVNA 1S72S 4JEPA 3HRGA 2N4CA 2QA4N 3I33A 4JYAF 5C10A 5C12A 1QUPA 4DMZA 3ZEUB 4C8YA 4OI2A 2R7XA 4MQ3A 4W98A 1I5OB 2G0IA 1RAOA 4KKOA 2W25A 2ZH8A 2EFOA 1YQHA 3MDFA 3LZJA 4CWBA 3O8WA 3K5NA 2V50A 2BH1A 2DNMA 1S7HA 4JKHA 3OTDA 3G71S 1GLEG 2QZ8A 3FCWA 1TFWA 1CJVA 2D0OA 4JI7J 4BR2A 2W41A 3VGVA 2JWLA 2BTFA 2ASYA 4QS7A 5MAOA 3OJSA 2R3VA 1IXKA 5KFEA 3BS9A 4LSNB 3MCAB 3HZEA 3DC2A 3M2UB 4NE9C 4CFBA 3IKMA 2IIHA 2E1AA 2KI2A 2WUSA 3SMPA 4Q2MA 1S1TB 2G0JA 2MEWA 3VQAA 3HK2A 3U3GA 1NLKL 4O5FA 1UAXA 1KQGB 4TVAB 2VFUA 1KC8O 2QWQA 1RTZA 5H1SV 3IA0A 4ZIWA 1O6XA 3KK3B 5AJ3J 3ZXWA 3UKRA 2GJ2A 4FJXA 1IKWA 4CLUA 1C0FA 4B9TA 1S0NA 3CF5Q 3IXQA 3L3VA 2NXUA 1IM4A 4C97A 3OUYB 3D2FB 3CVKA 4CHZA 1RT3A 4IG0B 3J7YU 1NKBA 2B8QA 1SZ2A 2HWTA 4Y0FA 4CGDA 1KD1T 4JK8A 4HEA9 3GZ7A 2VG7B 3SV4A 4R25A 1NOYA 4DG1B 2V69A 3PNIA 2E4LA 1NXIA 4FXWA 4UY8O 3E01B 4YOEA 1PBUA 2FQQB 1TVRB 1FWKA 3CYMA 1X4GA 3ZZYA 2PO4A 1U8SA 2AJ2A 3K0SA 2D41A 1SL1A 1IKVB 3OPKA 2RJZA 4JK9A 1EETB 3UVJA 4EGLA 4QYZK 5FLXO 5CYMA 1D09B 4JKGA 3G82A 3IS9B 3G86A 3P5TL 3MM5A 1WSVA 1TUGB 3UW1A 5H9FK 1OH7A 3KKRA 3MM8A 3H2LA 3MXJA 5DM7Q 4WP3A 2O8FA 3NAHA 3UFCX 3DLEA 1IBKJ 3L8BA 3TUZC 1YHQS 4Y1CA 2VQEK 2BKOA 4HTUA 1L3SA 3NF8A 1EP4B 1HYVA 2A5XA 2O8DA 3PW5A 1S77D 5BN8A 2NXNA 3QSYB 4DCHA 3UE5A 4KI4A 4LBHA 3TAPA 2RQCA 3I0SA 2JEGA 3V6JA 2IDLA 2PBDA 2PSZA 4LFBF 4N7TA 3WXMB 1ZXOA 3NNHA 1P9YA 5BPLA 4OL8A 3GCXP 2ZNZA 1D5AA 1YBTA 4M5IA 2FIUA 4CK2A 3GE9A 4CJTA 4P2SA 1T95A 2C2EA 1NGIA 4FJIA 3V4IB 1S72N 2RH3A 2MMYA 3KMSA 2Z1IA 1UL3A 2PMHA 1BQNA 4FK4A 4NEYA 5HSPA 1SBRA 2WW8A 2P9IB 1HD0A 2F65A 3R1XA 1S6PB 1NH8A 5IM0A 2WOMA 2Z8QA 3V9WA 1VBKA 4KAIA 3QMQA 4AE5A 2D7SA 4OJ3A 2HBZB 3G71N 1N36K 3LAKA 4ZLLA 4CZEA 4JV2A 2R7TA 1VBXA 1CQMA 4NI2B 1SH2A 1Q8IA 2W2QP 4NLXA 4EFHA 2DVIA 1ZBUA 3LP1B 3IR6B 2OPSB 4FN5A 2WTUA 5BREA 1FNOA 4ZVGA 4GNIA 1TL5A 4JYAK 1NK9A 3ISNC 4LVOP 4CW7B 1ASWA 4CO2A 2ZH7A 4TNOA 1T9UA 5HOOA 3GLJA 1S99A 2VODA 3V6HA 1E4FT 3D67A 3SXLA 2FGCA 3OHAA 2ZH2A 4NXMK 3KXDA 1UPMB 2CNOB 1H2TZ 4O3OA 3GR1A 1CJTB 3NGKA 5LJ5Y 4B8AB 4B02A 4PEOA 3Q8QB 1N33J 3QWPA 1TL7A 1RT5A 1T03B 3UDEA 4AILC 2R8GA 2YH0A 5LMUK 2BQRA 1KHWA 1KAYA 1RQ0A 4MIWA 3V1OA 1REGX 1PIEA 2ZUAA 4X65K 1FK9A 3H45C 2Y8WA 1YVNA 4IR9A 2NUBA 2MHEA 4HTJA 3SUPA 1FHTA 3QETA 3ZSOA 3WC2A 3D0PA 5D4PA 3FJ2A 3IWNC 4IBNA 3MMBA 1ZBSA 4LJMA 4WU3A 4HH0A 4DV3J 2E1RA 4DR1K 3OYLA 4JN4A 3ENAA 3MN6A 3WQPA 1NSPA 2Q2RA 3SQ4A 2F8EX 4UUXA 3KLIA 4DFKA 3H25A 5CXTA 4H4OA 4H5TA 3J81Y 1U45A 1IM6A 1DQAA 3MR6A 4OLBA 1IKYB 4DUYJ 3FSXA 3VVUA 2ZJPQ 1C0GA 5KPTA 1CULB 4ZLPA 4KHYA 1VK8A 3MD3A 2BZ2A 4F3MA 4TQRA 1XEZA 4K25A 4CGJA 1QAIA 2DFHA 1XQIA 3VQ6A 4YDUA 4HR2A 3GILA 3UR0A 2BGGA 5M1QA 3CJQA 3ZLJA 4NLVA 2UYTA 4ZK7M 3U1NA 2XSJA 1NKCA 4XIUA 4B8CA 4KREA 2NRTA 4DTPA 2J8SA 4P7TA 1Q95G 3E2EA 3VGUA 4FZVA 4PWDA 4AQYJ 3R3LA 3KDNA 3QLHB 3TEHB 5JVHQ 4PPDA 4B9QA 1Z25A 4ECYA 3PEHA 4B3SK 1IBMK 2DPJA 2P9EA 1L3VA 2V9KA 1WEZA 5EGYA 3H0PA 3DCAA 5B0GA 4RNMA 2HGMA 5HQ8A 3POTB 3ENOA 4CJLA 2D0AA 4EHUA 1SIWB 4FJNA 4GMKA 3OYBA 2I0XA 4JUZA 5JXSA 4UY8T 4PYAA 4QIFA 5KG0A 2AV5A 4JV0A 2CQDA 1NGHA 4DX5A 3OBYA 3LP0A 2AJQA 4NLGA 2VOOA 1MSWD 2MJUA 2R2TA 1X5PA 4Z4HA 3CETA 4GVLA 3NGDA 4L3NA 4BC4A 2UU9K 5KG3A 3CJSA 5GVQA 1K8AT 2MHNA 1VFJA 2VGNA 4FJ7A 2O4IA 1WELA 3OD2A 2KDOA 2EG1A 1O5JA 2F40A 1Q18A 1MMDA 3DLLL 1IQTA 3R5CA 4M95A 2NRVA 3KHHA 1EWRA 3WEEA 4WF9L 2AA4A 2VV5A 3RYLA 3T1HF 5I3UA 3NWGA 1WJ9A 3O4NA 8AT1B 1K9MO 4DV0F 4DMNA 4CZIA 1RTDB 2QX0A 1MDUB 2OYQA 4NLSA 2NXJA 2HHTA 1S49A 3TEGA 3MWTA 2RRAA 1S59A 2BQ3A 2C2DA 5JICA 1DLOB 2ZE2B 1UEKA 4O44B 4LBPA 3QGGA 1IQZA 3QFUA 2P5VA 3M2RB 2VICA 3AQOA 1HI8A 3O9QA 2GV1A 4LMZA 2OZMA 2CYYA 2JJ4D 3DLKB 3SYZA 2UUBF 4B3TK 3DI6B 3AXMA 5AQMA 4JKAA 5A76A 2VC1A 3FR0A 3P31A 2OZSA 1F9HA 3E9LA 1X9MA 1S97A 2PIIA 2WSCC 4NCBA 2WB4A 5TKWA 4DSEA 5HJYA 4UQTA 4IFVA 4QU6A 2P5GA 2ZVIA 2HHHF 2IHR1 3OXFA 4WIIA 1VMBA 3Q86A 1WG5A 3FZMA 2QL7B 4ZHRA 5CD4H 3HPOA 1YJTA 2YKNA 3ULDA 2CQIA 2EFVA 2NS1B 4OI0A 1YWXA 5CR4A 2YCHA 4I2QA 3CM5A 1VQMS 1MG7A 3CCUS 1UA0A 2BYCA 5JVGQ 4IFEA 5KFZA 4IJAA 2FTRA 5E5NA 4FK0A 2VFSA 4C8NA 2IBKA 4ZVSB 1W7WA 2B4VA 4K2XA 1GOAA 2QKBA 2V5HG 1Q8BA 3QGHA 3ID8A 4RR5A 2FJAB 5ELZA 3V9UA 4HI2A 2HBJA 4IKFA 1T6CA 5FPMA 3LO3A 1PCAA 3ELHA 3PJXA 3R3TA 3SCJE 2P9KA 3ALYA 1JCEA 3OR1B 5E3RA 3GBTA 3AOCA 4IDKB 1M1HA 3JTNA 3RR8A 2ZZMA 1MWQA 1RT1B 5KG6A 2DO0A 1NM2A 2EK1A 3V81B 2X3DA 4LFBJ 4HVJA 3QT5A 2AYBA 3THVA 3N28A 2QWOA 4KHUA 3OVNA 3ONQA 5DQGA 4M3WA 4G1QA 3KOAA 1XHXA 1DKGD 3DXMA 3A3PB 2XGPA 1DZ5A 3IRXA 1NK5A 4DHYA 4FL9A 1OSCA 4F50A 3EUNA 4UOCA 3ZT2A 3ZETB 1RT7A 3R5DA 2O8EA 4IKAA 1BO5O 3DRSA 5KFMA 3SQ2A 2M3DA 5SUHA 3B54A 4FJHA 4PG6A 2DJWA 4MK8A 1AB8A 2YNHA 4CZJA 1BA1A 2G2ZA 1A7GE 3OYHA 3HLUA 3EE9A 2NSCA 1FXXA 3P96A 2NQPA 4Y1DA 4OHXA 1QAYA 1B9DA 4BG8A 1RDWX 4KH5A 3FLCO 1XBWA 1KLMB 1WC0A 3PKYA 2DR8A 4KTWA 4NLQA 3M1VB 3IG1A 3TI0A 1ZM4A 3OBIA 2FLPA 3NH1A 3AB2B 2MKIA 2VFVA 2KXFA 3K89A 3W3SA 2MY7A 2OP5A 3G8SA 2WVEA 3OYKA 3GU0A 5D0HA 5CZXA 2LEAA 3CCVN 2MQOA 1F9FA 1NPKA 3VF0B 4BRDA 3R8YA 2YJFA 3KK2B 1VQ9N 4F25A 4EEYA 1Q78A 3A3NB 1U1RA 3NMAA 1K6YA 3KYLA 2I8EA 1FTCA 3T1HK 4RW7B 4CT8A 1HYSA 1KR4A 5K20B 5HVHA 3LTOA 4NLUA 1VJQA 4LFAF 1EARA 4DV0K 2QLFB 4RW4A 3AFGA 1PJ6A 4V19J 4LFCF 1S1UA 2MQLA 2XO7A 5J1EA 4BR7A 2XI2A 1QQNA 1YXQA 5M1PA 4I6MB 2E29A 1ZBLA 3ZX2A 2RU9A 3PSFA 2FVRA 2J9CA 4W5OA 3P8BB 1TR0A 4DL3A 5GAEU 1A5XA 3TANA 4QZVB 3A8EA 3PFOA 1VQMN 1EAYC 2J6SA 1RHRB 2KG0A 1FWPA 2HK2A 3LALA 1FT8A 3AJDA 4OPHA 1V3SA 4K8ZA 3CCUN 1FDAA 2UZAA 2UUCK 2AF6A 4N41A 2DRDA 3LP2A 3GL1A 5KT5A 4GVMA 3Q89A 2HLUA 4BQZA 2WAQD 5BR8F 1DBDA 5E3AA 1WSHA 4RWTA 3PJ9A 1RAGB 5E0OA 2M7SA 3MXIA 3CDWA 4B3MK 4ILJA 1JIHA 3CC2S 1K9MT 3L0QA 3NH0A 4KGXB 3RW7A 2JLEA 1B4SA 2NRWA 4HACA 1NHUA 3L6QA 3AB4B 3B8AX 5KGWA 1UFLA 2L9NA 3G87A 2AKWB 1QSSA 4NLYA 3J7YP 1D0EA 4RJVA 1RUSA 1NBEB 2XMJA 2BJ7A 2UVWA 4JI2F 1WNEA 4GRSA 2MGZB 2K8GA 4GW6A 1FJ7A 5BYSA 3KWIA 1J5OB 4DV5K 4H0OA 2B5JB 4IG3A 2DITA 1RTHB 1TKZB 1S6QB 1RK8A 2YI1A 3W63A 5EWEA 2FBXA 4ECZA 1J5EK 2I9SA 3CC4S 3GV8B 5DG8A 2XLIA 1NK0A 3PV8A 1HHQA 2Z2ZA 3WX4A 4MIBA 1XJWB 2HNDA 4L72B 4M3TA 3DLHA 1FXDA 3T6BA 2P9PB 2RAQA 1KVIA 3CD6S 3G2XA 2ACYA 4BREA 4PXEA 2P9SA 2V9WA 5CD4A 1DTQB 4N5SA 1KXPA 4P73A 3BGLA 3OL7A 3MWBA 1LW0A 1K1QA 2CVEA 3ZNJ1 3Q2TC 1B64A 4YS2A 2HWHA 3M1FA 4DSLA 5MLCQ 1WF1A 4OJGA 1FKPA 5BN9A 2OFHX 4W4MA 4DQIA 2JFDA 2IDOA 4B9MA 4DR4J 4F4KA 4BLGA 5I9EB 1UW9A 4ZPTR 1ZBFA 5K8PA 5M1FA 3ID6A 4IEIA 2K06A 2F9TA 5HLFA 2A41A 4C98A 4WFNL 3HVTB 5KFDA 4V19S 3P49B 1AZSB 4QPTA 1HBUA 5K8NA 3L2QA 2D0CA 3ULEA 4CJVA 4OYOA 5IZHA 1FRHA 2KVIA 1S22A 2IM1A 2NXCA 2XMVA 3AAWB 2VFRA 3QRQA 1IBCB 5I4MA 3CCLS 4I4BA 3SCKE 1RA7A 5AQPA 4G6VB 4CD1A 1LAWA 2AP1A 2HW3A 2CGKA 5KPRA 4MMOA 3RBEA 5KQ8A 2UUBJ 1U2VA 2MDAA 3DLJA 2ZH6A 2BE7D 4DL2A 1RBTA 3FKBA 1H1VA 4U95A 4LF1A 1X7VA 3CJ5A 5CYJA 4FWKA 4EHTA 2CJYB 4LVNP 5AQXA 3DOLB 4IWVA 5L1LA 4L73A 1K8KB 2CDQA 3SQGA 1SL0A 4Q5VA 4Y2MA 2HHHJ 3CIPA 5AQLA 2IM3A 3OTEA 2RUGA 5KFBA 3MAAB 1VSLA 4WQ5C 4IXCA 1ZYQA 1RAHB 2E2QA 3KLFA 2C3MA 1RWMB 4NLCA 5C24B 4U9RA 1FRJA 2QA1A 3KG0A 4M7XA 5A8WB 1X4DA 1G2EA 4ILMA 2DRAA 3NGUA 4USMA 1NG9A 2VQFK 4YUDA 2FZKB 4LFAK 2KVQE 1KLNA 1TL3B 1E3MA 2HKEA 2CJ9A 2OSQA 1OPZA 2GWJA 1X0FA 3MK6A 4YY3F 2OEJA 3CC2N 1N6QA 2E88A 2GVZA 4GO5X 1V5VA 2CPJA 3PR4A 3M9OB 2FXUA 4WZQA 4CYUA 2DHHA 2Q79A 5C42A 5M2PA 2N7YA 3QIPA 4KGKA 3W9JA 4DWIA 1KOOA 2A1SA 1RADB 4ZVPB 2YWFA 3LPEA 2W9CA 1TUVA 2DR7A 3FZLA 3AVIA 2E66A 3D2EB 4KHSA 3HYFA 2W42A 3M8ZA 3KKSA 3DM2B 2C2MB 1RT2B 4RUBA 3ZEUA 4NYZA 2ZH5A 2XS5A 4KBOA 1RLDA 2FY1A 2HF3A 2LQ8A 3AO2A 2DD8S 4CBXA 4DTUA 1FW6A 5LM7E 4DV2F 1DAXA 1YF5L 4EIAA 4LREA 1JB0C 3HSDA 5KAKA 3W2VA 3MX2A 3NF9A 3NXZA 3ZTRA 1J27A 4XH5A 4NA2A 4USHA 3CC4N 2LA6A 4Y65A 4DTOA 1WSEA 3C0BA 2UV8A 3PJWA 1AT1B 2W6LA 2E7VA 3CD6N 1URNA 4LSNA 1B0PA 3M2UA 1AUSL 1BHNA 2G1DA 5KFNA 2ZD1B 3NCRA 3W3DA 1RDUA 3O44A 1D9FA 3I31A 1H7WA 2VGMA 5THWA 2ATCB 2XO6A 3W2WB 3MCPA 2APOA 4MH8A 2YPYA 3R27A 3OSPA 4QIWD 3TAQA 2DPNA 1NGFA 2Q3PA 3W8PA 3AVCA 1MA9B 2PMWA 3TP2A 2HMPA 4HCCA 3KG1A 1SQEA 5L39A 4CF2A 2VPWB 4K4TA 1N5QA 3AO5A 3PVXA 1JLQB 4AL5A 3OUYA 3D2FA 3MTJA 4IG0A 3JYTA 3CD5A 4FVCA 3C7NB 3RAMA 2MYFA 2ASOA 3L7UA 2BOPA 1BWFO 1W2BM 2O4GA 2VG7A 5ETMA 2WTFA 1WC4A 3MM6B 1QQOA 3CCLN 3RBZA 2GIFA 2U1AA 5FDLB 3E01A 1FRXA 2GC8A 3O9TA 5L1IA 3G9CA 3U7JA 2HRUA 4B9NA 2AEFA 2G2YA 4CNYA 4DPUA 5CY4A 1HQEB 3PRBA 4PY5A 1QLNA 1EETA 3H8YA 4NXNK 1U2FA 3QINA 3US5A 3TZYA 4LFCJ 2DGWA 4A57